2QYOA

Crystal structure of isoflavone o-methyltransferase homolog in complex with biochanin a and sah
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
INNRKPSEIFKAQALLYKNMYAFVDSMSLKWSIEMNIPNIIHNHGKPITLSNLVSILQIPSTKVDNVQRLMRYLAHNGFFEIITNQELENEEEAYALTVASELLVKGTELCLAPMVECVLDPTLSTSFHNLKKWVYEEDLTLFAVNLGCDLWEFLNKNPEYNTLYNDALASDSKMINLAMKDCNLVFEGLESIVDVGGGNGTTGKIICETFPKLTCVVFDRPKVVENLCGSNNLTYVGGDMFISVPKADAVLLKAVLHDWTDKDCIKILKKCKEAVTSDGKRGKVIVIDMVINEKKDENQLTQIKLLMNVTISCVNGKERNEEEWKKLFIEAGFQDYKISPFTGLMSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase
publication title Crystal structures of Medicago truncatula isoflavone O-methyltransferase reveal conserved surface binding motifs critical for enzymatic activity
rcsb
source organism Medicago truncatula
molecule tags Transferase
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 2.1.1.46: Isoflavone 4'-O-methyltransferase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qyoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qyoA02
3UJ9A 4OMYA 2E1NA 2KIMA 3GLXA 3MGGA 4R79A 2ZNZA 1R18A 3WGIA 1J75A 1YZ3A 1KQ8A 3HVKA 2PFBA 3HSRA 3P2KA 3G89A 4X60A 3L7WA 2C7QA 2IA2A 2A14A 3I64A 2YUIA 2ACJA 3KEOA 1XMAA 1MD0A 1WY7A 2XVAA 5ERIA 5JUWA 2FYTA 3ML6A 2HS5A 4DCMA 4L7VA 3NJRA 5GWXA 3K1MA 3I54A 4YV1A 1U6GA 5E8IA 5K0GA 1BIBA 2GLUA 4EM2A 5ERGB 5C1IA 3FUTA 3RKYA 4RTOA 3PT9A 4MHTA 2PI0A 3GRZA 1LEAA 2JHAA 1S3JA 3KR2A 3ERCA 1R00A 4B17A 1RUNA 2GQQA 3ZN1A 1B42A 3DXZA 4QVGA 4HGZA 2BR4A 3P97A 1ZG5A 2BGCA 2ZO4A 5DUIA 2PT6A 4M9XA 3A7EA 5E9WA 4ER6A 2G1PA 7MHTA 3RPQA 4L18B 3LPMA 3EETA 2O06A 5FWDA 3OZTA 3CUQA 4BQAA 3FUXA 4IHTA 2YQZA 2Z6AA 2V9VA 3HUGA 3OU7A 4QTUB 4LWPA 2YXEA 2ZKZA 4EKGA 2MC3A 1O9GA 4MGRA 2H00A 3CJQA 5DTQA 3KETA 5DXAA 5FA8A 1YB2A 2PWPA 1ORHA 3SQNA 4UVAA 1RI2A 3PFHA 2YR2A 3GNLA 5EGSA 3U81A 2P7HA 4LK1F 4RAZA 3V7SA 2FEZA 3RPUA 3KQTA 2HGCA 3ECOA 3KQWA 3JTHA 2ISZA 3SSOA 3ELKA 3TR6A 1F1ZA 2FNAA 5D1NA 5FCDA 2ZBKA 3QOPA 1R74A 4L5IA 2AVDA 1K7AA 1PJZA 3PQKA 2JH9A 3DULA 5DCFA 3BWCA 4LLGF 3VEPA 2V1DA 2XGXA 2Z33A 2KJCA 1RI7A 1FYKA 3BGVA 3DF8A 1FSHA 2PN6A 5EPEA 2ZMEA 4I2OA 2R6ZA 5E9JA 4HX4A 4HLYA 1X1BA 4Y2HA 1V39A 1SVUA 2HNKA 2B9EA 2XAJA 3LCVB 5ILVA 2OBPA 1C0WA 4M6XA 2A07F 1DPUA 3LFKA 1HSJA 1QZZA 3FMQA 2HWVA 3KKZA 3NVKI 3W6KB 1KP9A 2GH1A 1KU7A 5EC8A 3BGDA 1RNLA 1J5YA 4ESBA 5CVJA 2O57A 4Y13A 2A68F 2IFTA 3E6MA 3NDIA 2GB4A 4KNYA 2OAZA 3IHTA 4QDKA 2VXZA 3NRVA 4FX0A 5K01A 2IDJA 1HW1A 3NDJA 3J81Z 4PYOA 2R3SA 4GCVA 4ETSA 1TQMA 5P8WA 4DNCA 5KS2A 2O61A 5K8VA 3PFGA 3SGLA 4Z2YA 1KYZA 1XVAA 1U8RA 2EA4A 2NXCA 3EVZA 3U9GA 5BMZA 4G7OF 4OQEA 2UYHA 3DP7A 5BPDA 5EQJB 3HVJA 5MHTA 2ORED 3WU1B 3BJOA 2JRTA 2ZJ2A 3DFGA 2B78A 1D8KA 2HKOA 3J7AO 4CYDA 1ODDA 2WA2A 2PY6A 4HOBA 2XYRA 3UA3A 3SFZA 4NQWA 4BXUA 4ZH4F 5LQJA 4HTFB 3BDDA 1HBXG 4YIFA 4RB0A 5CVVA 4OX9Y 3CC8A 1WG8A 2LDUA 1VL5A 2B3TA 3P2IA 1K6OA 3SMQA 4PYIA 4RB1A 1X1AA 2ZCWA 2AN4A 2NAZA 3M4XA 3PS9A 2NS0A 2W84A 3LKDA 3KLOA 5HS8A 2P3QA 3BKXA 3RKWA 2IDKA 3HP7A 2XAQA 2OA4A 3K1NA 3AXTA 2FE3A 3M8FA 1QGPA 2VT2A 2ZCJA 3LGAA 1B9NA 3EMBA 3HNRA 4DQ0A 4E2YA 3FZVA 4GOOD 5CM2Z 5HDKA 2DPUA 1DCTA 2HQNA 2UXNA 1YQAA 3CGGA 2Z9OA 5A2QZ 5LEJA 1H9GA 1S7OA 1G55A 1L3LA 5HLHA 3KPYA 3ISPA 2FXAA 4OU0A 4M36A 2GZWA 4FGZA 4YMGA 2G72A 3KQMA 2Y1WA 4HSGA 1Z6TA 1XD7A 3VC2A 2OZUA 4M74A 3FZGA 4IRIA 3E97A 3DR5A 1HQCA 2TDXA 2ZNYA 4I01A 5HIIA 3KZYA 1WZNA 1NW8A 2VC1A 1X19A 4M9ZA 1UFMA 4KUMA 2XAHA 5FQOA 2Y1XA 4KDRA 3M1EA 5KVRA 3R4KA 5T67A 1W5TA 1FBSA 2YR0A 1PRYA 1BC8C 1IXKA 3QU6A 4WK8F 2P3OA 5L3CA 4F7ZA 2GAFA 2QBYA 3CJRA 2VDVE 2OQRA 1W7PD 3M33A 3HYIA 4MTDA 3RYPA 3I5UA 4A0ZA 5F2OA 2ZZMA 2JHCA 2STWA 3LDFA 3SR4A 3AAFA 2FA5A 1Y8CA 5CCBA 4ER7A 4ZYDA 2O03A 1MDMB 3UJDA 3DPLC 5H6RA 5EHGA 2ZWVA 4IF4A 3TO9A 5FUBA 1BJAA 2AXLA 5E1XA 1R22A 3EEOA 1UHMA 3P9CA 2EB7A 2AOWA 1NW5A 5CIYA 3U2RA 1B6AA 3C0KA 2IP2A 4KN4X 5HIMA 1XSVA 2IVMA 3JWGA 1G60A 3DTNA 2MLGA 4RTLA 4BHBA 3ORHA 2CGPA 3OCJA 2JPBA 3BZ6A 4RX1A 2P7IA 5HIJA 3ZMDA 5H20A 4S04A 5J8CA 3DH0A 3OZRA 3WGHA 1YIOA 2IRFG 2QZ8A 4ENNA 4V0QA 3DQVC 1FYMA 3JAMK 5DEQA 4FHTA 3F8MA 5E20A 5FFZA 5IT9Z 3FTFA 4YMHA 3HM2A 1SQFA 3TPZA 2L3DA 4EJWA 2M8EA 2RKHA 4GYIA 2ZFUA 1BI1A 2AZTA 4F86A 5EZQA 2HTEA 5K03A 3KPUA 3PTAA 2FOKA 1NW3A 3M6VA 2H09A 2AOTB 1AQJA 3ABTA 2BE5F 2G8NA 4I0BA 4DZRA 2XHKA 5F6FA 3GFJA 1NV9A 5KQSA 5HOQA 3P9NA 4A0XA 1XB4A 2OY0A 2Q8KA 3LQRA 2XV4S 2EFPA 1LVAA 5DD8A 3RW9A 3Q9SA 3M7GA 4FT8A 4POOA 4EQQA 3A25A 3LCCA 3O31A 3FTEA 1HSTA 4YFXF 2VT3A 1QNTA 3JW4A 3H92A 2AN5A 1KQ0A 3UJBA 2NNNA 1JHFA 3TM4A 2K02A 3HOTA 2QRVB 3MCTA 4UUVA 5LQUA 1OKRA 1AWCA 2PXXA 2NXNA 1YYVA 5HEKA 2FRXA 2PVCA 5DX8A 5DM4A 1OYWA 1WI9A 3ZMZA 2FK8A 2H94A 4PYMA 5BOXA 3KQQA 1XCJA 1XDSA 3KQSA 3QPHA 2ONYA 4ESFA 4P7FA 2RQPA 2ESHA 2CG4A 3A7DA 2F5DA 4H0NA 5EEGA 4RVHA 1F9NA 1R6AA 2P6TA 4P96A 3WTUC 3HCEA 1UB9A 5GINE 3V8JA 1EG2A 1IN7A 2BR5A 5CYVA 4QVKA 1IY9A 1XGOA 3G5LA 3SSMA 3HVIA 1MZBA 2VS1A 3DOUA 1XN7A 3K0LA 3UJ8A 2ZTHA 2M30A 3ID6C 1R36A 4HA8A 3UZUA 1VQ1A 4HDVA 4TV7A 2P8TA 3VC1A 3PVCA 2KIFA 5E9QA 3GFIA 2A3SA 5DD4A 3FUUA 4E2XA 4ER0A 2DI3A 2FBIA 5GM2A 2G9WA 2Z5UA 3AWIA 4HQMA 1DUSA 4G56A 2LF7A 4AZTA 4RGXA 3SM3A 2PLYA 3GCZA 4IVNA 3G2QA 4NB5A 1CGPA 3DEUA 1I1GA 1G3SA 3V8LA 1FPQA 3I71A 2CWEA 5K0FA 1ZHFA 4OBWA 1LB2A 2IPQX 2A61A 3EVFA 3H3UA 3GDHA 2PLWA 1HKTA 1O9HA 4G6DA 4YG2F 2ZIGA 2DQRA 1ON2A 3OPNA 2DW4A 4LJZF 5DV5A 2X4HA 3ZP5A 2XIGA 1TLHB 3R61A 2W24A 2J5OA 4P7JA 1R23A 2M87A 3BXOA 3D5LA 1QQIA 4GYGA 1N7JA 3WGGA 3HSEA 1R8XA 4YUYA 4YFKF 4P9FA 3EVBA 3FPEA 3OE5A 1HW5A 1MJ9A 3FWEA 1JG3A 1Z91A 4RTSA 1R58A 2GS9A 3CLOA 1P1BA 4LFUA 2EX4A 4CKBA 1K78B 1G4DA 4G8XA 5FLXK 4U0YA 3Q87B 1SD6A 4C04A 2AR0A 1PP8F 1I6XA 5DPMA 4B8XA 3LX6A 3K9TA 4HX8A 2G7UA 3B3JA 3A27A 1S29A 1UHWA 3RJPA 2OBFA 1FX7A 5D4RA 5DRTA 2ZFWA 3GYHX 8MHTA 3O6BB 4HTFA 2RVCA 2NP7A 3F8CA 1JG4A 1JHHA 3JSOA 4Q48A 1XTPA 1MHTA 4U0VA 3NWEA 4WXDA 1CF7B 3UBTA 5LEKA 2OB2A 4P58A 2R7FA 4X61A 3G2PA 1YF3A 2F2EA 2JHPA 4YUXA 2ZVJA 5LQNA 5BS6A 3VYWA 4UNOA 3P7NA 3CCFA 1V4RA 3FRIA 3OOPA 1JGSA 4M6YA 4D0PA 3VODA 3LDUA 4YV2A 3P71T 4FT4A 3SHFA 2MH2A 3T5XA 3C3YA 2H6BA 4BYYA 3R24A 1LDJA 4QQKA 2VONA 2RDPA 1R7JA 1T6SA 3WU0A 4RSRA 3TRKA 4BLUA 4XBFA 1RI4A 1QO0D 1USTA 4LWOA 2K4JA 2N47A 3CUOA 2FF4A 5HILA 1Z9CA 3E5XA 3L9FA 5DRYA 2LNBA 2UZKA 2HOEA 3HTUA 2PJPA 3MCZA 4IJAA 3GFMA 4R8RA 4A6EA 3IRQA 1R5GA 4JQFA 4LLLA 4RB2C 2O07A 3G2MA 4MQVA 4U7DA 3U1DA 3C6MA 1TTYA 2HKXA 1P91A 4OIQF 3FXQA 3TLJA 5D8LB 1IM8A 4ENMA 2F8LA 1MJFA 2MH9A 2HZTA 3IYLW 3UJAA 1L3BA 5LQCA 5DTRA 1ZAOA 1SFXA 4IWNA 1O3TA 1KU9A 5EIFA 3NQOA 4I98B 3OU6A 3SX0A 4EJUA 4PINA 4C03A 5GIPE 3J80Z 1KIAA 3ZPLA 4A5MA 4G94A 4ON0A 4DCGA 1ZKDA 4WF2A 3E6BA 4PGHA 5DSXA 5HFJA 3TO6A 3HRUA 3NTVA 1MDMA 3VSEA 4EVIA 1YFHA 4GUAA 1SAXA 3ZN0A 2UYQA 1FBUA 4JK1X 3HCCA 1JR4A 2NNWB 3GEZA 1GXPA 2YXDA 3F21A 3KE2A 1ZN2A 3E6DA 2VBXA 2WWYA 5FWAA 1AOYA 1IXCA 1RJGA 2E7XA 1TW2A 4KWCA 3HCFA 3GWZA 2O0LA 2P5LC 2NP6A 2VOOA 3LQQA 3I9FA 3N97A 1H0MA 1TPYA 1N7IA 3E7PA 5K0LA 5LRSA 3SVZA 1F5TA 3C1DA 4PYJA 3X0DA 1IZ1A 2ZIFA 2IBSA 3MAGA 3DMHA 5EZSA 3FM5A 2FBHA 4XSXF 1QAQA 2JSCA 4DQ2A 1N2XA 1FJXA 2GA9A 2K86A 2PQ8A 4AIHA 3F6OA 5F1RA 2P1DA 4M72A 2PSSA 3EEYA 5HS9A 1R8YA 4N9IA 5FADA 1ZRFA 3GGDA 2EA2A 3IKTA 2AOTA 1E2XA 4AWXB 1SUSA 4DM3A 1XMKA 2QUFA 1LQ1A 1I4WA 4RTJA 1RI3A 3GRYA 4FT2A 2OPBA 2O6GE 1UWVA 3P2EA 3TDZC 2ESRA 1B9MA 3I0TA 1Y0UA 2M5WA 5ICEA 5K0NA 4GO1A 2EFJA 2OXTA 3GRVA 2DAOA 4KW7A 2HR1A 2DK8A 4EJVA 3F8FA 5CJ9A 2DULA 5KVAA 3HCBA 3F72A 1KXZA 3D0SA 2NYUA 2B25A 3FMRA 1FOKA 2HTSA 2KRFA 3P8ZA 2FBKA 5F2KA 2PXCA 4ZZDA 5K5RA 4PIPA 1IUYA 3M9AA 3FPFA 2OO3A 4DA4A 2L4AA 1AV6A 3CUQC 4YUWA 2IBTA 4RTQA 3GF2A 3LAJA 2QRVA 3ZQ7A 3HRMA 1FY7A 5HZMA 5IH3A 2WC2A 1ZQ9A 5EMJA 2UYCA 4KA4A 1P4XA 4PGGA 3T0YA 1SFEA 1VIDA 2MLKA 3GUDA 4MHGA 2K27A 2BBYA 4XCXA 1YO5C 3RIEA 4A2UA 4CXMA 5ICCA 3Q9VA 1XDUA 1DP7P 3PX3A 4IPAA 10MHA 2Q0OA 5E1OA 3BY6A 1QYRA 3EYYA 3QOXA 1XSDA 3IL2A 3DPTA 5HS7A 4FR0A 3PFIA 1DDNA 1IN6A 4RGRA 2YVLA 4AX8A 5T6BA 2DO7A 1TBXA 4EKIA 3WTSC 2D1VA 5IKMA 5KQRA 3O4FA 3MTEA 2XROA 4AZSA 6PAXA 1PDNC 5AIQA 4E2WA 3EGIA 3LKZA 3M6WA 3KPWA 2O3FA 4FP9A 2XASA 3B89A 2V79A 3F8NA 3E5UA 3VOEA 1L0OC 4M71A 1PP7U 1BI3A 4HF2A 2DPDA 1Q0TA 3O3KA 4HLXA 4CDGA 4RV9A 2MBFA 2YX4A 5DM2A 1NBHA 4XUCA 1SQGA 4CKCA 2X0LA 2BZGA 5DTMA 1R1TA 2KW5A 3JTGA 3HEMA 3BOQA 1BI0A 2C7PA 3KP2A 1AF7A 5EMKA 5E8GA 2UXXA 3GFLA 4G9YA 1Z1DA 3K69A 1J9IA 2JPCA 5HDNA 1EH8A 3HRSA 3ELDA 5D1HA 3FYDA 2PWYA 4EGYA 3MHTA 3WTWC 2JG3A 1DUXC 2VP3A 4AIJA 1NW7A 1KPHA 1DL5A 2QQAA 3KP6A 2VBWA 4QTTB 3V8VA 2RGVA 3B5IA 2G71A 4C05A 2PXAA 4Y15A 2VBZA 3I58A 3MQ0A 3MZYA 4HW0A 3IRRA 2Y0MA 4U7BA 5JI6A 1K78A 2ESNA 1FZPB 1TQPA 4XUDA 1WSUA 2O8XA 4R8HA 3WTXC 4QDJA 4FZVA 3UJCA 2LSOA 4G7HF 4PYQA 3MWMA 2QLZA 3DXXA 4OA5A 3F6VA 1YFJA 4ENKA 5DYMA 5CVIA 3HA3A 4LB5A 1F38A 2IT0A 2CMHA 1W4MA 1YS7A 2AS0A 1D8JA 4LG0B 5DM1A 1CF7A 3GO5A 5FO5A 3ME5A 3CKKA 3ZMUA 3IWFA 2P5KA 3K2ZA 4RS8A 3NEUA 2FU4A 4KN7X 4C06A 5LGUA 1RZ4A 4GOLD 5G02A 1P4AA 2VE9A 5E1WA 4LECA 2DBBA 1P4WA 3RYRA 2FMLA 4E31A 2P7VB 4BP3A 5L3DA 2FNPA 4O5VA 5BW5A 2BEOA 1XCVA 2W25A 4L5JA 4A12A 1X1CA 5FHRA 3V7CA 3C6KA 5DCMB 4CTJA 1ONVA 1SKMA 3RODA 1G6NA 4QLCU 2EFOA 1XGNA 2V6CA 2FCAA 2EJRA 3I4PA 3GZ5A 1OR7A 3F22A 2UWMA 1G3YA 1VLMA 3QAHA 3BGIA 1XGSA 2M1BA 4E30A 4NECA 3L2CA 3MB5A 1O3SA 1JE8A 9MHTA 3DUWA 5EKXA 2DLLA 3FXUA 1JQEA 2WTEA 1QBJA 3QPTA 3QU3A 4PYKA 5J6XA 5ED4A 2EFQA 4MNUA 2ZBQA 5FTWA 1ORIA 3E3VA 3BJ6A 4L9TA 1VTNC 2OYRA 4HC4A 3KP5A 1IXSB 2GPYA 5LGTA 4M9SA 5D5UB 1X1DA 3DMFA 4KRGA 4O3MA 4PZJA 4KT5C 1NW6A 3QRFF 2ZBRA 1QAOA 3FPJA 4P5OA 2BYVE 4WVLA 2CWWA 3BT7A 1RJFA 5DUKA 5C9ZA 1J7KA 2HFHA 4RYLA 1UIRA 2CSOA 4YUZA 2VDWA 3E05A 3LHDA 4WWCA 3FYCA 5DLYA 1D3YA 4EK9A 2AOXA 2I6GA 3UA4A 1OYIA 1YLFA 3PQJA 5HLIA 3MTIA 4R8SA 4BY9E 1BHJA 2F5FA 3I59B 1WKMA 2ZXJA 1VPTA 4MWZA 2XAFA 2F5EA 2AVNA 2FPOA 3JWJA 4AIKA 3EVDA 5EIWA 3R9XB 2W57A 2V74B 3ZMSA 3C3PA 1W5SA 1LJ9A 2D2WA 1U78A 3JWIA 2XBMA 1SD5A 2GXBA 1BC5A 3ER9A 3RIRA 1I1SA 1WWXA 1FC3A 3FUWA 5U4XA 4MIKA 1BM9A 4O29A 3FMSA 5EMLA 5E1MA 3TQNA 3A26A 1JSZA 5CVEA 1QPMA 2PX4A 3MAJA 2EJTA 4AVPA 1REPC 2EFNA 1STZA 4G6QA 3TKAA 4XSZF 4OIOF 1NV8A 5ICGA 4H0EA 3FHZA 1IW7F 1VP3A 3ULQB 3IEIA 5EVJA 5T64A 5D6FA 5CVDA 2EV6A 5AIPA 4ZYEA 2IW5A 1M6EX 2XYQA 4KDCA 1E17A 4IRGA 4OIPF 1SD7A 4BHPA 2CYYA 3BPXA 2O05A 1USSA 1O54A 2IA1A 2ADUA 3T7SA 1P6RA 4CO8A 4CGZA 1MGTA 3EDPA 4UV9A 3KU1A 1FBQA 3EVEA 2ZBPA 3SXJA 2XYVA 5JHUA 2OZVA 1XGMA 4GXOA 4WXHA 1ZGJA 3EVCA 3IC7A 2EWNA 1B59A 2OKCA 5JR3A 2RNJA 1PUEE 1IRFA 1YFLA 1I1NA 3E23A 4HBLA 5D6EA 3WE2A 2A6EF 2AOVA 3OFKA 1L1EA 4M38A 1T98A 3ELWA 1YZHA 3THRA 3GW2A 3QP6A 2HEOA 5FD6A 4OBXA 3LBYA 5CLSA 3TDUC 2VBYA 4OIRF 2E7WA 1NKVA 3MFKA 4R6XA 3LCUA 3FX3A 5FFXA 3THSA 2V1XA 3CJNA 3LA7A 1DPRA 2YX1A 4ZYGA 2A6HF 2Q2EA 1GHCA 4RVDA 4KIBA 1GVJA 1LDDA 1ZYRF 2CKDA 2IJLA 5D8KB 5F64A 1B1BA 4RTRA 3TFWA 2COMA 4L0ZB 2G70A 2XRNA 4LMYA 2ONZA 3WSTA 3CBGA 3M8EA 2FMYA 2QQ9A 4K2EA 2C7OA 2B2CA 1ZLJA 2QQBA 2D1HA 4UHTA 3FTCA 1O7FA 3S2WA 3M6XA 2ZZNA 4YV0A 3DXJF 1XXLA 3OFJA 3WTZA 4HQEA 2OB1A 2QY6A 1HKSA 4PWYA 2OD5A 3KQOA 2JZYA 2Z3YA 4R1HA 1RI5A 2RN7A 1V3FA 3LECA 5BP7A 3L8DA 2XUBA 1LDKB 2OZ6A 3KPJA 3FPGA 3FUVA 1O7LA 1SG9A 3HIFA 1MJAA 4R6WA 2EFWA 4GEKA 2PX8A 4GOND 2CMGA 5E8RA 4JBAA 2K4MA 5K09A 1MKMA 1KPIA 2KKOA 2VN2A 4HGYA 1IAWA 1RUOA 1JTEA 2QENA 5EEHA 1EQAA 4I09A 4FSXA 5LRRA 5CVUA 2AOUB 3GU3A 4QQNA 2P40A 4KMFA 4LK0F 2CQKA 1SD4A 1W7PB 1RIOH 4GF5A 1RJEA 5DX1A 2GA1A 1Q0SA 2D45A 4KFCA 2IGTA 4ZZLA 5EOVA 3HCDA 4PNEA 5DWQA 3WODF 2L54A 4HX7A 1EJ6A 2EK5A 1HKQA 5L3FA 4X1OA 1X3UA 3WE3A 2G7HA 2GA2A 4I02A 4E70A 3KCCA 3M70A 3EGVA 5L3GA 4LG0A 2AN3A 5GP1A 1L3CA 5FLXZ 2XVMA 2DU9A 4LD5A 3OU2A 2A69F 5L3BA 3NW9A 1D5VA 3HCAA 2JT1A 4RGUA 3LA2A 2VC0A 3KHKA 1WXWA 4A0YA 3LDGA 2E1CA 3LSTA 3LA3A 4R05A 4F85A 4CICA 2I62A 3J81K 1XCLA 3V7RA 3BROA 4BNCA 4HG2A 1EAMA 1JSXA 5DCMA 1XDZA 3TKYA 3T1BA 5LHIA 2PMUA 1J2XA 5L3EA 3T8RA 5DXJA 1EIZA 3B7PA 2IPXA 3NWBA 4I7HA 1WXXA 2FQ3A 5K0CA 5KK1A 1EV7A 3SZTA 3REOA 4RVFA 3P9IA 2CL5A 1R1UA 1JQ3A 5K0BA 3G73A 3ELYA 2ADMA 1IN5A 5GM1A 3M6UA 3GIWA 2QE6A 3GRRA 5DM0A 2P3LA 5H6QA 4HV5A 2VE8A 4GOMD 3E5QA 4L0YB 1S8NA 1U5TB 4RTMA 3B3FA 3GZ6A 3CJTA 4P55A 2ERCA 1KHHA 3FTDA 3R6TA 4RTPA 2CFXA 2EV5A 2NXJA 2QM3A 1O57A 1J59A 1JG1A 1Q1HA 1IRGA 3K6RA 3TM5A 5H02A 4C4AA 2DQLA 3JWHA 5BW4A 2WV0A 1TQIA 2BR3A 5CD1A 4FS8A 1G3WA 3W6JB 3IWZA 1IN4A 1JQDA 3H3ZA 3KQPA 2HWKA 1ZG1A 3Q5FA 3BPVA 1L3IA 1L9KA 4YFNF 4AZWA 3R0JA 5AONA 4MTLA 5FB2A 5LQAA 3CO7C 4HZFA 4MTEA 3RDIA 2W85A 2YPRA 2R7DA 3I59A 3T7TA 5A2QK 3SZPA 4NHJA 4GC9A 2O0YA 1YW7A 2V1UA 1T43A 3SSNA 5E2AA 4PDKA 4WCGA 3TMAA 1TNSA 3SXYA 1KQ9A 3Q7EA 3BKWA 3R3HA 1ZLKA 3L09A 1UFKA 4C08A 1I9GA 2DPMA 1HMYA 4IHSA 5E8JA 3RI4A 5TJJA 3LAPA 2BV6A 3WTYC 3KPVA 3KP7A 4UXNA 4LGWA 3TQSA 3CDHA 1ZREA 4PIMA 2KJBA 2NXEA 2JH8A 3GRUA 1T38A 3DV8A 3COAC 4KMUX 4PYNA 2PG4A 2F5CA 2PT9A 4EMSA 4HF1A 3BWYA 1MJBA 4HV6A 1M0EA 1S6LA 2VZ9A 3HA7A 3I53A 2MA3A 5K05A 3WTTC 3BP8A 1NT2A 4FSDA 3RKXA 4X63A 3UJ6A 1NHAA 5E1DA 1P39A 2ETHA 4CXFA 1EH7A 2ZULA 2BM8A 1D2CA 1RJDA 3E6CC 5HLGA 3ABUA 1KGSA 1LEBA 1U2ZA 4RTNA 3EPPA 4G7ZF 3LWFA 1NE2A 3C7JA 2C7RA 5DSTA 3EMDA 2UZ4A 1U3EM 3O7WA 2CW0F 2OU2A 4A6DA 1NBIA 1O3QA 4E2ZA 2FRHA 3WTVC 4M73A 2Z6UA 3N4MA 2DFIA 1HW2A 5CCXA 3HTXA 1BOOA 1KPGA 4KYWA 1YUBA 4V0RA 2I9KA 1Z6RA 4BLWA 3KR1A 5FA5A 3F4KA 1JTFA 5IT9K 4MQ9F 2HDCA 2A5YB 3QP5A 4A5NA 4L9JA 5FHQA 1FLIA 4IRHA 3KFWX 5KYGA 3R0AA 4Q47A 2DTRA 1QAMA 4U88A 4RTKA 4KDPA 5LHHA 2VOPA 2P5VA 1INLA 1P1CA 5FGMA 1Z05A 4QPPA 2PGXA 4RWZA 2STTA 2DT5A 2XKPA 4EV0A 1FNNA 2K4BA 3R60A 1FBNA 3GO4A 3G3ZA 3C3WA 5IT3A 2RC4A 5E1BA 5LQKA 3V8KA 4OMZA 3ROUA 2KIUA 3AY0A 4WXCA 4Y17A 1A04A 1QZYA 2V7EA 3LL7A 5B1SA 4E32A 5EKUA 3BJAA 3R6SA 2L4MA 1G8AA 4Q5SF 4PCQA 4PYLA 1R1VA 1I5ZA 3KEQA 4U0WA 3T0IA 4AZVA 2LF8A 1XCBA 1D2HA 4XRFA 1H9TA 4CWAA 3IHUA 3GX4X 4GBED 1FP2A 1FT9A 3B73A 1FSEA 4U7PB 4KVZA 1HXDA 5DT2A 1T0FA 3ZMVA 3A4TA 3QOWA 2H6CA 3FM3A 3K1PA 1EJ0A 5K0JA 1UCRA 2XVCA 4UV8A 5FD5A 2P6SA 5E2BA 2Z6QA 2OQGA 1JXSA 1ZRCA 2FSWA 3B02A 1SUIA 2L01A 1J0RA 3EVGA 1SFUA 3V4GA 5BQTA 4CHUA 3ER8A 3FRHA 5HVQC 2NRAC 3UWPA 4BLVA 4RVGA 4HAMA 1YTYA 5TRDA 4L9NA 1VBFA 2EG5A 4RB3C 5LBQA 3GVAA 1KA8A 5ICFA 2AS5F 3T7RA 4P7GA 2IH4A 5C0OE 2P41A 5HOOA 5FQNA 3CVOA 3OV8A 2WA1A 2Q41A 5BXYA 3IV6A 5FULA 2ISYA 5CUQA 3CUQB 3VFZA 1HNNA 3DMGA 2AOUA 4WX9A 1F4KA 3HA5A 5HIKA 1ZH5A 1FWZA 2EV0A 2K7LA 2BH2A 1W7PA 4IKPA 4PCLA 1SMYF 3TOBA 4QWQA 4FX4A 3B3GA 3L00A 5LHGA 1AQIA 4CKEA 3MZHA 4HH4A 2HTJA 4K6MA 5E1ZB 4MQ4A 1OMIA 5LGNA 3BWMA 1KU2A 3MQ2A 3TO7A 4ISCA 1P92A 5GOZA 1IXRC 5ILUA 2PBFA 2NNYA 4RGSA 4EJOA 5K5QA 3OE4A 3FPHA 4EGZA 1ON1A 1BKYA 1ZG3A 1YW9A 2FHPA 2HMYB 2ZZKA 4HRAA 3BWBA 1KU3A 2IH2A 4Q4ZF 2HQRA 2JJQA 3AJDA 3F23A 5LLQA 1RI1A 2P4WA 1ZRDA 3C18A 5EMMA 4DKJA 4ENJA 1K79A 2ZMEB 3G8AA 3EYIA 4N9HA 3PLAE 1XSXA 3HHHA 2ZW9A 1M6YA 1S7AA 3BWGA 1XJ5A 2NYXA 5D4SA 4BAYA 1ULYA 4ZYHA 4AD9A 2HYGD 2GWRA 5HDGA 3MEXA 5J8FA 3HTSB 2QVOA 2J5PA 5K0EA 5E18F 2H11A 4ESJA 4OQDA 4U7TB 3OZSA 1TW3A 1VP9A 4E33A 1YS6A 2JTVA 3G2OA 4EM1A 1G6Q1 4KICA 4BHCA 4IXAA 4MEXF 5DX0A 3QV2A 1ZGAA 4UVCA 3ERED 4JXJA 4XLNF 5K5OA 3KR0A 1LNWA 1G38A 2PEXA 5LSAA 3G5TA 2BM9A 2QYOA 3HSFA 5JFRA 1U5TA 1U2WA 2ELHA 2Z99A 1WS6A 2GXGA 2PBIA 3NMUF 4CTKA 2VDUE 3BZBA 1BIAA 2CO5A 3KLNA 2DK5A 3KQVA 3WG9A 3H2BA 2PX2A 4EQZA 2Y75A 4O6JA 5GIOE 1OPCA 3EUHA 2MD5A 4HDUA 2Y48A 4X41A 2UYOA 3JAMZ 5F2NA 3S68A 5BPIA 3GXOA 2YXLA 1JG2A 1F3LA 3FF5A 2HV9A 2IIPA 3CTAA 3ANXA 1FYLA 1FP1D 4QPNA 3KR9A 3O2PE 3HVHA 4LG1A 1KYWA 5ILSA 5D5XB 4HYEA 3G88A 2YTZA 3BUSA 4LB6B 1EH6A 3GJYA 4XLPF 3KQYA 2EJUA 4HF0A 3MERA 3DKWA 1YG2A 3G7UA 3T8TA 1IN8A 1WQ2A 2QWWA 3HRTA 3F8BA 3DXYA 2M45A 3JSPA 4C07A 3LBFA 3AXSA 1O3RA 3NVMB 3VB2A 3TOAA 1YW8A 2ZIEA 2HYFA 5D5VB 2IA0A 1OYYA 4P9UA 4B09A 4L9VA 3TOSA 4GC5A 4PCAA 5LR6A 4KIFA 2ZSUA 4ER5A 4ZTBA 2LD4A 1U5TC 2YSRA 3E8SA 1H1DA 2B0LA 3D2LA 2PKWA 3ELUA 2I7CA 2FK7A 2P8JA 1D2GA 1I27A 4BH9A 2P7CB 2IH5A 4EJTA 1SMTA 5JVTA 1T39A 3P9KA 4OINF 4KIGA 4ATNA 4YIIA 4AUKA 2PX5A 3HOSA 1BBYA 5DDGA 1BC7C 4N0BA 3J80K 1R5HA 3ECHA 1BOAA 4CZZA 4PONA 3TGNA 4GQBA 1B4AA 1Z7UA 3K0BA 2PV0A 3CO6C 4DMGA 5E17F 3IKVA 4UOEA 5M5BA 4IV0A 2H1RA 1BI2A 4YUVA 4DF3A 4LLNA 2P35A 4F84A 2C6YA 3G8BA 2VODA 2PMHA 1G3TA 3F3XA 4UVBA 2YU3A 3R0QA 3KP3A 5EG5A 5K1YA 1P2FA 2H27A 4ER3A 2QBYB 4OOIA 4S05A 3KZZA 1KR5A 3HHGA 4P7KA 1VE3A 3UFBA 4GGGA 4XUEA 4OA8A 4M37A 1IF1A 1Z3CA 2GIVA 3ZMTA 5CVRA 2ZWAA 1T2KA 1G8SA 3RTRA 1TNTA 2RV8A 1GXQA 4I0AA 5D5WB 1ZARA 3FXRA 3DLCA 3PX2A 2YX7A 3EGEA 2XKOA 1QANA 4EM0B 3V97A 1OR8A 2L02A 2ZLBA 3KP4A 3EVAA 3PB3A 4BP1A 4M7RA 3UJ7A 1WRJA 2E5WA 2PJDA 4IV8A 1BN5A 4Y30A 2LKPA 2HR3A 4RAYA 4ASNA 2GAUA 4MEYF 5EHIA 3DLIA 5LQRA 3EQLF 2WK1A 2XAGA
chains in the Genus database with same CATH superfamily
2VRCD 4M9CA 1T5TA 1OT3A 3VR0A 5K7SA 4PFQA 2QAIA 1QV9A 4PPQA 4UUOA 1X6VA 4JT9A 1G5HA 3ZK8A 2GZHA 5F52A 1UXKA 2PRZA 2LWIA 4FEAA 2C4VA 4E6EA 1TYEB 4JVLA 3QMVA 4ENPA 1Q0RA 2H8GA 3S8PA 3S55A 3I54A 3E0QA 4MYDA 2RD2A 1SNYA 1ABBA 3HVRA 2WHYA 5KVVA 2CLOB 4DLUA 3IPAA 2BR4A 2NXNB 3T41A 1EB8A 1QR6A 2VF4X 2C4HA 1MH9A 1IXZA 2IA5A 3OZTA 3CUQA 5F7ZA 1E2GA 4ZVLA 3FSGD 5CGZA 1XF1A 4MGRA 1SCDA 3E5HA 2H5EA 5EGSA 3VAYA 3VFDA 1ZWKA 2X8AA 1I36A 1OISA 5GVSA 3O8GA 4CA0A 2DDAA 5DULA 1QQTA 4TQAA 3R7BA 1VSQA 3BWCA 4LLGF 1EX6A 3X2EA 3N0VA 2XXJA 2QTHA 4E08A 3GUCA 4YRGA 3U26A 5KOIA 3BH6A 2PRJA 2DCUA 3V2HA 2RI1A 4TTAA 1E20A 5ILVA 4G1MB 4J6FA 1DT5A 1FB5A 3PENA 2HWVA 5F0HA 1C1DA 1H8HD 4J00A 3NVKI 1ILEA 2ODBA 5FNZA 4IICA 5CVJA 2J5XA 3S7TA 3UICA 1G5RA 3K0KA 3A9WA 2FSSA 3C74A 2EW8A 3HG9A 3BQ9A 1GQ2A 1TQMA 4PSVA 1WW8A 3J7YJ 4YTEA 4JXXA 4JIMA 2B78A 2HDWA 4MRRA 1KOLA 2VLBA 3EAGA 3ROZA 1Z4JA 3TD2A 1GTMA 3MCVA 4CGYA 1FU7A 2XUJA 3KLOA 2X5KO 5CLJA 3RKWA 1ESCA 4K86A 1LLFA 2OA4A 1V41E 5COAA 3V4FA 2XQFA 2C20A 2PL3A 1S9DA 3I4MJ 3MJVA 2EG9A 3LGAA 1B9NA 3OS2A 5TY0A 1WUIS 2UXNA 5A2QZ 3GLFB 4OU0A 1O89A 3L0OA 2H2WA 3DKRA 1EWQA 2DQKA 4INAA 2AEEA 1K6IA 4I5FA 4UTRA 2F3TA 2PU7A 3NB0A 3AKDA 3L8YA 4Y98A 1DFGA 1IXKA 2C07A 3H2IA 2Q07A 1E2KA 1JHAA 5BW6B 4CQMB 1RBYA 3HL4A 3UKDA 4M89A 3AAFA 5CCBA 2F3QA 3OL4A 3CB4A 4QT4A 1GVNB 1KVSA 4BMZA 3F1KA 4U3JB 1JGGA 5A5VA 4A2PA 4BNUA 2V4UA 1UHMA 4HDKA 1NW5A 3BBPA 4YFVA 4NENB 4IOJA 1WPQA 1WXDA 7REQB 4H7HA 4ZREA 3ORHA 4LSWA 3N2KA 4OI4A 5JD5A 4F6LA 3DH0A 1XNRB 5DTEA 1ZJZA 2Z58A 3A1WA 2AMVA 2P79A 2VQCA 5IDXA 1U9CA 4XCQA 5G0SA 4YGYA 2FAXA 5TT1A 2L3DA 4EJWA 5IAAA 2VNKA 1EBUA 2HTEA 1P8AA 3MHPA 4QJ5A 4S12A 4W7HA 1REQA 1NW3A 4F45A 1GGVA 2H1OA 2JBAB 4BTVA 3M9WA 2IU4A 1HDIA 1T2CA 1B0AA 1BJRE 4OGGA 3BRWA 3IELA 1G7CA 2XYPA 4HXFB 2VT3A 5KUTA 5A0TA 3BDIA 2V5AA 5GP9A 1Q50A 1V8ZA 4BLPA 4J8PA 4S2EA 2XE6A 5IN5A 4ZVVA 1FFEA 1XCJA 1N3YA 1PJQA 1U65A 1QE5A 4C1NA 2VJMA 5IP7J 2AKYA 3I6YA 1DC8A 3OURA 5GINE 1QKKA 2B94A 4DJJA 2GYYA 1UEXC 3HMQA 4ZA2A 3GVIA 2G25A 4NULA 3NT4A 4GU5A 4CQNA 2FBIA 1DNPA 1AHPA 3MINB 4OXRA 5CFRA 4IS2A 3PRKE 3GAAA 1LEHA 1TIKA 4DSTA 4AZTA 3UB3A 1T1JA 1BZYA 4F4FA 3BL6A 3D3KA 4CMJA 1KFJB 4BMSA 3EVFA 1IUOA 2EW1A 3ZKAA 1HKTA 1O9HA 2V5VA 4G6DA 4LZNA 3NOQA 4FR5A 2X4HA 2HCFA 2Q4TA 3ROPA 2QXYA 1XTAA 4LY3A 1XZHA 4YUYA 4R84A 3RHTA 2DOKA 2QLLA 3CLOA 1TCAA 1JL3A 3NBKA 1ZC3A 1M54A 1TLTA 5FORA 3W4KA 1ZN9A 1YNOA 2KM1A 1S29A 2LC2A 1T1EA 4JOMA 1X4OA 4MGYR 4OKNA 3NANA 4FTHA 3M6AA 1ZNQO 5FWYB 4GKKB 4P58A 5AM1A 1WA5A 5AM5A 1EUCA 2F2EA 2ISQA 2JGNA 5BS6A 4YRZA 1UJ5A 3B38A 3R09A 3LNQA 3QE2A 5E7IA 3T5XA 3Q5EA 3WU0A 1WUJS 1VC2A 3A1YA 2UZKA 2QQFA 1A36A 5KU1A 1HDYA 3GLRA 1UQRA 2WVHA 2PNJA 4MW4A 1WY5A 1E4VA 4EPRA 3FXQA 3TLJA 1HF3A 3PIOF 4DYQA 1XCMA 3X1XA 2Y2ZA 1E89A 1O3TA 4CCSA 3DMNA 3MFQA 3KAPA 1NXTA 4JY7A 4CCAA 1R8SA 3ZNOA 2OXIA 2D3WA 3UJHA 3VZPA 4PLWA 1XVTA 6LDHA 1DKPA 4TMYA 1FX0A 2AJLI 2EIKH 4GUAA 4MVJE 3FIJA 2EKDA 3I6IA 3KOOA 5B5SA 3TRFA 3WNDA 3H05A 1GXPA 1CJBA 1ZN2A 4C14A 3HSSA 4EIWA 1SVMA 5CTAA 1QZTA 3F3MA 1T26A 5K0LA 4YXFA 5EKDA 1VLLA 3IT0A 3DLAA 1U0NA 4M1EA 3MAGA 5EZSA 2JSCA 2ZWPA 1MW7A 4G01B 2ZIVB 4CW7A 2PQ8A 3K9FC 3EIOA 5F1RA 1U9OA 3JQBA 1UEIA 2IXGA 3AEKA 4OQYA 5FADA 2QX7A 4JCOA 5MGNA 1CUAA 1QVWA 4GZMA 4W9NA 2R7NA 1HL7A 1VLJA 4YROA 3TQOA 3LFUA 4JI8B 2YY6A 4IP0A 1FMVA 1UWVA 3MUNA 3TDZC 1OLXA 4RFSA 1B9MA 5K0NA 3TLAA 3E9RA 1IQUA 1D5YA 1VDMA 2PXCA 1IUYA 1S89A 5ECWA 2OO3A 5CFNA 1CR1A 4P38A 3RZOJ 4TTJA 1YDMA 3OYLA 1P4XA 1W4AA 4DMFA 2C4UA 2SHKA 4DNQA 4UBKA 3RANA 1Z0ZA 1EFAA 4E5DA 4FFDA 3F6RA 4BMXA 4UVGA 4DLVA 2WICA 4M1MA 4JNKA 3AVYA 3SIPA 2VQLA 3B6MA 3GLVA 5HCIA 1OBCA 3COJA 4K0KB 1N0UA 2W11A 1KZ4A 3O4FA 1CZLA 1UBSB 2R1UA 3UV3A 5BNIA 3CT4A 4I9UA 2DM6A 3KPWA 1P33A 5KQGA 1OD6A 1X7YB 5ITSA 4YRKA 4P3PA 3LOCA 1NX6A 3JRFA 1E3TA 1Z3YA 4D3YA 3TOXA 3ICPA 3CEPB 1NBHA 1VRWA 3D6JA 4XUCA 2ZGVA 4OAZA 3HEMA 5THKA 1QJ4A 3GFLA 3H65A 1LJLA 3H6HA 1BS9A 2A86A 3FYDA 1LVKA 2CXSA 3AOEC 3UOWA 1EZ4A 4KU4A 3U5TA 4E5SA 4JLWA 3DAYA 3QVKA 4Q9IA 3CRW1 1E5VA 5B2ZA 2O3UA 3P45A 4GYKA 5JARA 4UHFA 1FIPA 1ISHA 4HNVA 4GGMX 4Y15A 5KWEA 5JDIC 1QDEA 4FE3A 1KEKA 3U7GA 3STXA 1M0SA 3CKLA 3MRVA 4G8JA 3DF9A 4GLLA 3EF0A 2AB0A 2GWHA 3MOIA 2H1KA 3K9GA 2SKDA 1I6KA 4LG0B 4ZCTA 1VQ7I 1MJGM 1UPUA 4D45A 5LP6F 4GOLD 1OX4B 3C7AA 3RRNA 4I9FA 4RADA 1RC9A 3L4JA 1ZDMA 2W25A 1X1CA 5FHRA 1XZMA 4K40A 4MV3A 3HKEB 1MV5A 2DTZA 1DGRM 4KI7A 5ILGA 4N3AA 1QLHA 4HATA 4LDJA 2X7XA 3L2CA 1RFLA 4XLTA 4CQJA 3DUWA 4PYKA 3EW9A 2ZBQA 5B7NA 1ORIA 3SX2A 1T13A 5SZJA 5LGTA 1X1DA 3UUFA 4P2BA 2JEOA 4PBRA 1NW6A 3QRFF 3TPCA 1QAOA 3FPJA 2RGAA 4K9NA 3RC3A 2JD2A 1E2DA 5AKLA 4NMXB 1KEWA 3KOUA 4MZDA 1GSAA 2ZAOA 6PFKA 4YUZA 2VDWA 3JRBA 5EWLB 2EZIA 2QL7A 4HVAA 4KV7A 4Y7NJ 2F5FA 2I9PA 4LZLA 5CNKA 3LLVA 2I8AA 5HUJA 1OR7C 3W34A 1PIWA 5EIWA 3QQ5A 3VTZA 2R66A 4MR7B 1TU0A 2FVYA 1QNLA 3DPIA 3FKIJ 4KB5A 3F96A 4UUMA 1RQ2A 3OQHA 4RLFA 4J29A 2PWZA 4UCQA 3NRBA 1ZIPA 4Z0TA 4HR7A 4MVYA 1SEUA 3DDUA 4A3IJ 1WNTA 1RRVA 2PS1A 3JALA 4MVJA 3ESZA 2I76A 1RKWA 1QKIA 1HL3A 3I4NJ 2Q3CA 4DAEA 3MJFA 1FYEA 4IRGA 2DJIA 2O05A 3SLGA 4E4HA 1Y8ZA 1N5KA 4O59O 4G6ZA 4JXKA 4HK4A 4D4GA 4BLTA 4S1WA 4WXHA 1G0NA 2RNGA 4BY7J 2A7QA 2XTJA 4EFLA 3RIMA 1IRFA 2Q50A 2ZRCA 4NFSA 1Q0PA 3CKYA 4KR7A 1HRDA 2D1YA 3A1DA 4M38A 4ASUA 1I01A 1HY3A 1T5HX 3MT7A 3TVDA 4GPD1 1QGZA 4DDKA 4R6XA 3LCUA 4MKIA 3CJNA 4CUZA 4ZYGA 3I01M 1YZVA 3JZFA 4MCAA 3RYFB 4BNIA 2JJ2D 2D5BA 4ESEA 1W29A 1XKXA 2ZRPA 3FTCA 3Q6MA 3JATB 2VHTA 4YRQA 1H85A 4HQEA 2OB1A 4FUTA 1GZHB 3VPDA 4R1HA 1RI5A 3BIJA 1NTCA 1ETYA 3O8CA 1GNRA 1R0RE 4ZRNA 1O7LA 1SG9A 4GXRA 2AW5A 1HLFA 5EUBA 4ZCPA 4FE7A 3DOCA 4XTRA 2BI4A 2IP1A 1XZKA 1WMSA 3QUTA 1OPXA 1LK7A 4OYLA 2DU8A 4I50A 4FYJA 1H0RA 4M3FA 4FSXA 1DKUA 5EXPA 3ZHSA 4IJUA 3H18A 4LK0F 1N5JA 1Q6YA 2JVHA 5CDSA 2K87A 3WI7A 3D6AA 3A4VA 4XIFA 3GTLJ 2CHEA 3VPHA 3D7SA 3GVCA 2VQFB 2QRNA 4X54A 1CYDA 1XZQA 1HLPA 5B3JC 2IYRA 3R2JA 3ZCVA 2CVZA 2CCJA 3NW9A 4PLGA 3UNXA 4JQYA 3W9YA 1OCTC 4GSKA 4UAVA 2VRCA 4BNWA 2DODA 5GQSA 1R4NA 1L4YA 3QX8A 2XB9A 4I2VA 3OX2A 3B7PA 3KHSA 1K63A 2BFAA 3K9QO 1A3CA 1QH1A 1XJWA 3IAHA 2P3LA 2XUIA 5AW1A 1EGAA 4QFMA 2XE7A 1GG8A 4RULA 2BHYA 2NXJA 3KXKA 4MLZA 2JGDA 2ATXA 3LS2A 1HV8A 1K0FA 3GQVA 5JS2A 2WV0A 4LRSB 2R8EA 2VJDA 3W6JB 4PSCA 3ITNA 1GRQA 3UGJA 5L8VA 4QU0A 4GM1A 2PRKA 2YPRA 2V26A 1MUUA 5F73A 4OLBA 2PZAA 1S96A 1T43A 2GD0A 3QVMA 3FSGA 3IB3A 2QT0A 4N65A 4EX7A 3IQDB 4R5MA 5KNCH 5T3UA 1UFKA 2YMMA 4XD7D 3QYJA 4PSAA 3NDBB 3NIWA 3TVTA 2Z8XA 1EAYA 2C7BA 3PUXA 2F9LA 3EWNA 4HTAA 2GN4A 4ALLA 4TTQA 3COAC 4RKEA 4HVCA 1G8XA 2JBWA 2ZUTA 1MJBA 2NADA 4HV6A 4RKFA 1EK1A 1NT2A 2P5TB 1WU8A 5BWOA 3EOAI 5E1DA 1VSUA 2DMUA 2FPMA 4MA4A 3KT0A 1RJDA 1Z77A 3PXBA 2HVSA 5AKIA 2VP5A 1KVUA 4G7ZF 1FUEA 4R3NA 4QO8A 1JT2A 4RDXA 2C7RA 4N76A 1JU3A 3MJDA 1E4YA 4A6DA 3A37A 1BW9B 2R751 4YRDA 3N4MA 4EUEA 5TSDA 3D5TA 4HGQA 1P7PA 1HW2A 3HTXA 1KDPA 2CV2A 1W36B 1L4BA 3V6MA 3RVNA 1JTFA 2QTLA 2A9KA 1ADFA 5FHQA 1IBCA 1SU6A 3S8MA 4NCBA 5I7VA 2K5UA 4A3MJ 2IJGX 3L6BA 3DBRA 5LHHA 5TB5A 5E6SB 1INLA 1T0HB 1XGKA 1PR5A 1JPVA 3C3WA 4OBBA 3AY0A 4Y17A 2BY1A 1QZYA 3BJAA 1VZ0A 3A0UA 1A96A 4LOIA 3OTIA 4EHKA 4F38A 4PTZA 3EUAA 3AZQA 4C9BA 4WN9A 3S1AA 3S1LA 1T9GS 4RK4A 3L1JA 2GEFA 3IPYA 4TM8A 3FPKA 1R1DA 3K1PA 4KQWA 1OVMA 1JAXA 4BQRA 3NYIA 1PP4A 3ED1A 4IYRA 4NZPA 4BDTA 1HYGA 1K6YA 3KKLA 2XRYA 4RB3C 4Q3CA 2VJYA 1Q2XA 4Z99A 2GAIA 3ORYA 2GSWA 2IPNA 5FULA 1R6VA 2FJ0A 2J9RA 4W9RA 4Q6BA 1CU1A 5SYMA 3B3GA 5IYZA 1AQIA 4JEHA 1EUYA 2AE2A 4JKYA 3MQ2A 1FTNA 5KO2A 3CP8A 2QD1A 5LMNB 4HT3B 2H17A 2HU2A 4MUXA 3LT5A 4MYCA 1ID8A 1ZRDA 3C18A 1EJ9A 4IIUA 4L6AA 1CUWA 1Q7BA 5CFOA 3ZDEA 2OORA 5DM60 4BECA 2RKOA 4GXTA 2RI0A 1UJ8A 3UYKA 4AUNA 1M1ZA 2QVOA 1C3XA 4PSUA 1U2PA 2ZJ4A 1KI1A 3G2OA 4BHCA 5LP6B 3OIPA 3QUCA 3QV2A 4D3SA 1G38A 3QSGA 1SC3A 2JCGA 1J23A 2BM9A 2HBQA 2WWGA 2NVQJ 3V5NA 4U2FA 4AWBA 3LTEA 4POAA 2VDUE 3OBBA 5MN4A 2PX2A 3CS3A 4B87A 1YRAA 3JARA 1F3LA 3MRSA 1WJDA 3O2PE 2X1VA 3HVHA 4LYYA 4FXPA 4LG1A 3BJMA 3FMGA 4Y2TA 4YCNA 2RHDA 2OSVA 2Z2SB 2EJUA 1NVBA 1NYLA 3LRTA 2D8AA 3R7DA 3U4QA 3MERA 4XARA 4OD0A 5K3SA 3INNA 2QMOA 5L95A 2M9HA 3E3AA 4ZOLB 3I4FA 3NHKA 1YIAA 4N40A 4Y9RA 2IW1A 4P36A 1BWRA 3QJGA 1I27A 4QOEA 1LUAA 2ZIZA 1MC8A 1O95D 4J4BA 2BMDA 3TGNA 3GC6A 3WTBA 4ZYLA 3CLUD 1ZP6A 4UNPA 1HGXA 5DLEA 1BI2A 1ORTA 4DREA 5FTKA 5ALVA 2R8BA 1U0JA 2IEGA 4DDMA 2GK6A 5JC1A 1TZCA 4EY8A 3IBCA 3H2ZA 5AQEA 4I1VA 3KAKA 4PRZA 2ECPA 4QDUA 2HRZA 1JLLB 1DINA 4ZI7F 4OK6A 2WJVA 3VUFA 4AYBA 2HA5A 1AUQA 3A05A 1T2NA 3CZ5A 4NBUA 1H6BA 3H5NA 3UJ7A 4IO0A 3LHKA 3KSBC 4F21A 1GTG1 5ADUS 4QTXA 4QD3A 1D1AA 5LKRA 3I1FA 1B73A 3PEYA 4IJVA 3HB0A 3GLXA 1KARA 3LCJA 3DBLB 5JSHA 4X60A 2XRLA 4X62B 2KE5A 2D0PB 5F4BA 4Y0NA 4DJTA 1J9ZA 1WY7A 1KBOA 1XK6A 4HXEB 3TDMA 2H5JA 2XVAA 1Q11A 1Q77A 1M6VB 2J3JA 4URWR 1Y8RB 2PEZA 1NQWA 3DAOA 2W70A 3NZEA 2CF5A 3FLAA 3UR3C 4EUSA 5K0GA 3F5MA 2YHIA 1W36C 1WAMA 1W5EA 3DDSA 4TLEA 2YFYA 5BQPA 1QUEA 1S3JA 5IFKA 3KWJA 1PQ4A 3MGBA 4DV0B 5DO9A 2NN3C 1N25A 4YIRX 4RLHA 5C5IA 4GNKA 5C7OO 5JHHB 2W0SA 2E4WA 5JJ5A 2ZU0C 1I50J 4A03A 3BL5A 3QPBA 2ZB4A 2XQKA 4RMIA 4WKGA 3MNFA 1E3OC 1CJTC 2H63A 3BTUA 1NSYA 2NZWA 3BXEA 2QTNA 2C1ZA 3B6EA 1R3UA 2W0MA 1E9BA 3U81A 5IM5A 4Z4QA 3KQTA 1FSPA 2Q4EA 1EGQA 1F1ZA 4KR3A 1CQIA 4X6UA 3R74A 3RSSA 2JCSA 2Q4BA 1HOMA 1G64A 5LZ7A 4Z51A 5EHXA 2JH9A 1GFSA 3DZBA 2AQKA 3GLLA 3BGVA 2ZXEA 2WHQA 3CVWA 2HU5A 2R6ZA 4AUMA 5IAOA 1GAEO 3JWEA 2XAJA 1I2CA 1ODCA 4RK0A 2X0EA 3D8RA 2I3DA 3N3AC 4QECA 3QEJA 3PE4A 5LDHA 1QS0B 2V8OA 3AUTA 5AJZA 3BGDA 4BKOA 3PQCA 2V03A 2WJYA 2YWHA 1KO7A 2DQSA 3EW7A 3W1EA 2DTDA 3HBLA 3FI9A 4ETSA 3MTGA 4LJ8A 1I7DA 2NU8B 4EF6A 3BMQB 2C57A 4Z5XA 1R0ZA 5BVHA 4OQEA 3BA6A 4AUXA 3RREA 8OHMA 2YWBA 4X1IA 2VNAA 4K03A 4YC7A 2JRTA 5DBFA 1D8KA 3H2GA 1KEPA 3VU3A 3DGFC 1G20E 1Q7RA 4EW3A 4FK8A 4NQWA 3SJBA 4XI9A 1Z4PX 3QVXA 2ID4A 1ZOIA 3PIDA 1U9YA 8ATCA 1E98A 4QUDA 1K6OA 2IHVA 3BFJA 4NYMR 1V6CA 3DBHA 2IW3A 3OZXA 3PS9A 4JK3A 4WNIA 5MN5A 2X48A 4OYRA 2P3QA 3HP7A 3S7ZA 2VJLA 5HYVA 5LP6C 3AXTA 3KP1A 3E27A 2NO7A 1U1FA 4LIPD 1RAHA 1A50B 4NBWA 4YUAA 1XBTA 1L3LA 3FLBA 2P6OA 4JGBA 4IRIA 2ZJ3A 1YMVA 4HP8A 3G2HA 4O8ZA 1WZNA 4QBFA 3H9BA 2NM0A 3EQ8A 5TGDA 4LZWA 1WNFA 2R7KA 4CZCA 5D5QA 3RJZA 1WGXA 1HT1E 3VNUA 5B3LA 4YRMA 1ZSNA 3I9V1 3LF1A 4FN4A 1A9SA 4KQKA 4KDFA 5H6RA 3ZWOA 4HYTA 1ZK2A 1GUYA 1UT5A 2ZB2A 1CY6A 4YJ3F 1Z9BA 2XUDA 4EENA 3P0IA 3BZ6A 2XUAA 4RX1A 3MKWB 1F6BA 5J8CA 3OZRA 5I8PA 4UASA 1XDWA 4LDPA 3T1HB 3GNSA 2ZQZA 1VJTA 3N0XA 4AO8A 1RBMA 4BRZA 2AZTA 1JEQA 3JAKB 3HXMA 3CIFA 3DO8A 2QF7A 4HVTA 4B6JA 3IJRA 1SJ9A 2XV4S 3DAGA 4LE1A 5G53C 1X70A 5HJ7A 3MCAA 4HDOB 4M3EA 1HMPA 4NFLA 1MB2A 2RHLA 4ZEWA 5K8UA 4CH7A 2YIDA 3M8JA 4LGCA 3R3XA 3TG8A 4ITRC 4UUVA 4IDFA 4QUJA 1R6UA 3SDGA 1EVYA 4Q3NA 1EWVA 3EDRA 3X1WA 4BL5A 1CBUA 3DDOA 4Z9FA 3UVEA 1AZSC 4EJSB 4X0EA 2FDRA 3FJYA 2UUAB 3C2GA 4PC7A 3QUQA 5FBWB 1VQ1A 1VYVA 2LZ0A 5DHRA 5DD4A 1KZ6A 4JQZA 2XMDA 1U4SA 5GAEJ 4IVNA 3OOWA 5TF4A 2JA6J 2GBGA 2VDNB 1GTL1 1UH5A 5K0FA 1D0SA 2IHUA 1HLDA 2A61A 3LT4A 3GDHA 2PLWA 1YDWA 3EXHC 3SHQA 2ORVA 4KH1A 5AKHA 5LB2A 1TLHB 4NC8A 4CIWA 3QEKA 4CPDA 3THYB 2LTPA 5JJIA 3WGGA 4OQXA 5G0WA 1DO8A 3EVBA 3EPHA 4JKIA 1MJ9A 1WHUA 2EZ9A 3CLRC 1XVVA 4Q1CA 3HH8A 3WGZA 3H1BA 2VNIA 3HP1A 2P65A 2YN2A 5JU6A 3FJ1A 2Q7DA 1RYHA 1SU7A 2OBFA 8MHTA 2XJ4A 5K99A 3JRHA 3K4KA 1BKDR 3BPSA 5LEKA 2OB2A 3OUUA 1GGFA 3CW8X 2UZ1B 1JLKA 3H2KA 2ZVJA 4IOKA 2GBCA 3G1WA 5CA0A 4DZPA 5DBHX 2K9LA 3ENVA 4EMTA 4XR6A 3NWOA 4OJMX 3GIDA 4P4LA 2WB1A 4JASB 3PITA 4QQKA 1G20A 2EV9A 3LPNA 3F97A 3PDWA 2WV7A 2I7DA 3OIWA 1KRWA 3NDRA 2P78A 2JJ2A 4WBXC 2JLYA 2CDBA 3FB4A 1MBJA 3PJFA 2FMXA 1G16A 3ELBA 2ZJOA 2I8CA 4YQZA 4B9AA 2NVWA 4OH7A 1GUZA 1X92A 4C4PA 1OBOA 1LKXA 1TK9A 2OCLA 3NTOA 4K28A 3ZDBA 2OHVA 4OIQF 2VQHA 3KSMA 3K16A 4RABA 1L3BA 3TGWA 1KU9A 2Y2UA 2YW9A 2HUNA 3ZXYA 9ATCA 2QVLA 4GM0A 1NURA 3LJKA 2QG6A 5KVQA 4LF8B 3SXUA 2GRJA 2L42A 5K2MA 2JJ7A 3HRUA 3VSEA 3H2YA 2H57A 2ZI6A 5F04A 4E46A 1LS6A 1DWPA 3AUYA 1QOPB 1N2SA 4GPBA 3S1NJ 5IAJA 2AWOA 4CCYA 1MAWA 3ZY5A 4ZI7B 4PR0A 4ZHSA 3O4GA 3PC8A 4DQ2A 2QG4A 1QF7A 2PZJA 3F6OA 3EEYA 4LS3A 5BRJA 1NN1A 4RLQA 1DFIA 2I65A 5HFNA 4ZO9A 2AOTA 4AWXB 1GEEA 1I3AA 3GY0A 1PCXA 1GM5A 4ZC3A 4RTJA 4GX5A 2O6GE 1QHYA 1QP8A 4KPUA 3LLCA 2PMBA 1FJ2A 5FDFA 4CQLB 4JI4B 5DDIP 1UZMA 2VBFA 4FZ5A 3AGPA 4YRNA 3KQKA 1PYGA 4BC0A 3ENZA 4DA4A 1NE7A 1MT0A 1VGQA 4AG3A 2OV3A 1IEVA 1RPJA 3RTAA 3NGMA 4NU0A 5CGQB 3T0YA 1CJKC 1TQDA 1ISSA 3E9MA 2VLIA 4IPAA 1A2OA 3KYCA 2Z16A 1KMHA 1U2GC 1OE0A 1QRUA 3LAWA 5AOVA 2C78A 3BHIA 2B5WA 2Q2EB 4PK4A 5KX5F 2FZKA 3HN6A 3CZ4A 3RSZA 5D3MA 4D98A 9ANTA 3RC8A 3ICOA 3X2FA 4EGSA 3A6DA 4KT6A 3BTLA 4EB8A 2OILA 4EMBA 3NCHA 4XD7A 5KWVA 1EE1A 2EDCA 1QHSA 2Z2IA 1Z0AA 5DTMA 5KKAA 1WPGA 2FZCA 2PR2A 1UDRA 1V11A 1GLNA 1TD9A 4KRYA 1D4ZA 3KYDA 1T95A 5K6AC 4AC0A 4AICA 3C5CA 4DUPA 1KPHA 3PA8A 4UXHA 4EGFA 4EJSC 4HYYA 1KAEA 4CLHA 4H4KC 4LV6A 5LZ8A 1UK7A 2HX1A 4U7BA 3F5SA 3HM5A 1E3LA 2ESNA 4PG5A 1E59A 3SU8A 5FEMA 4MJXA 4DJFC 4YH1A 1SBQA 2JFYA 5LDDC 1Z2OX 1T33A 2V6MA 3TRHA 3MWEA 3NBAA 1LNSA 3WQRA 1P7VA 3NBXX 2VTBA 4PE5B 1SR8A 3IXQA 1A88A 2GEDA 5HXAA 3BCHA 3ZJUA 1AGRA 1SZPA 3MEQA 1XE3A 5ED0A 1LBHA 2BKAA 4BP3A 1FU4A 2NYRA 1IIRA 4CTJA 2ZT6A 1SKMA 3KCNA 1WW2A 2GDZA 3WLPA 3W1WA 2F6RA 3M6MD 3NHPA 2OZLB 1MAAA 4E30A 2WD7A 5IEBA 2ZTVA 2O50A 4WH0A 3CKMA 4MDHA 3K0AB 3QPTA 4WOPA 2WG0A 2WIDA 5K8LA 3GAZA 2X6OA 2GMWA 2H08A 3UUEA 1RU3A 1NK3P 2J3DA 3K9BA 1ZCBA 2CWWA 2OXRA 4R1PA 3E9QA 3VVBA 4NTZA 1H69A 4ZDIA 4AJ1A 1LSUA 4L8WB 1I80A 5DLYA 1CPYA 2XHEA 2F43A 3AJ8A 3X1ZA 3CZRA 2FG7C 1VPTA 2WLTA 2AVNA 3L77A 1T29A 3EVDA 2HDDA 3T95A 1D5CA 1I2AA 3MJSA 2WYOA 3IB6A 4CETA 1U78A 4WY2A 1NAHA 4QLOA 2GXBA 4A8JA 1DIBA 2YDYA 3QPLA 2PL9A 4DRXA 2BY3A 1I3QJ 4C89A 4YJ3B 2E9SA 1LLUA 3TKAA 4R2IA 1ZM9A 2WF7A 1NR5A 4MK4A 5ERYA 3TK1A 1M6EX 5I7RA 2B1QA 4BDYA 2XYQA 4PLFA 4JLBA 2W2NA 5JCPA 4O0MA 3OPXA 3BK7A 2CFRA 2OZVA 4F5WA 1XGMA 4GXOA 2J1LA 3BD7A 3GAFA 3GFVA 5F33A 3DL4A 4DPMA 1TCBA 2HI3A 4RJJA 2OV4A 2AXTC 2J0EA 3OFSA 1ZCFA 4LTDA 2OBMA 3LBYA 4Q00A 3PM1A 3LXRA 3OM8A 4BOYA 4LHWA 1VMAA 3SJMA 1H1TA 3I2GA 2F48A 2NS7A 4BV3A 3AW8A 3OLYA 4R51A 3PFFA 5HWSA 4IFEA 2EFEB 1Q1VA 1OA0A 2QTWB 2D0OB 1Z35A 4V0NA 2FMYA 2BGMA 5D85A 3T52A 2QUKA 3LVFO 1XXLA 5JDCC 4C3HJ 3PQ3A 1WHTB 4AK9A 1MNDA 4Z8XA 2IZ0A 5JAZA 1CFJA 2NU9A 4WCFB 1GEGA 2J4CA 2ZVPX 3ZBQA 1WWKA 1G7SA 2K5CA 1T1SA 4MW7A 3SBOA 1FS5A 1O95A 1MW9X 5E8RA 5BNTA 3HDHA 4U8HA 1GVHA 1I0LA 1MKMA 1QPZA 3KOMA 1MB3A 1IAWA 2NTEA 1YE3A 3PJEA 2VJ5A 3DVAA 3IT1A 5KCZA 4RVOA 3UY4A 3ODPA 3FVRA 2WR8A 3OR1C 5JLJA 4QQNA 1G3IA 1KOJA 5I8ZA 4ZVUA 1HE4A 1E2QA 1WV1A 3TCNA 1CQPA 2Q5EA 3VZBA 1AOXA 2IGTA 2D2FA 1II8B 3VH3A 3RHSA 3S2DJ 3PRHA 3DAHA 4RC9A 3KTOA 2EJWA 1JUMA 3STHA 3E1SA 1NJ2A 1LY1A 3PRJA 4IZHA 3B9PA 4YPFA 1R4MA 2O8EA 4LGMA 3NBYC 2YNMC 3TTXA 1XF9A 4NRDA 3HCAA 4KMSA 4XGIA 3WGLA 3LSTA 2OV2A 3SF8B 3T3EA 1JTYA 4N4NB 2B1IA 3HO1A 3QHPA 1TGYA 3IVXA 3BG7A 4A0RA 1TTTA 3WL6A 2ZVQX 2DUJA 4LDNA 8AT1A 3HCPA 3GJXC 4XIIA 4I7HA 5EYPA 1YR2A 1J90A 3A04A 3QM1A 4GI1A 5C3MA 4CIYA 1DZIA 1IN5A 1OWOA 1GQOA 1JR2A 4PG4A 2VE8A 2RG1A 2EW2A 4H7FA 2VEDA 2VLAA 1DGQA 4O25A 4LF7B 1IRGA 2NO1A 5KVCA 3JWHA 5CD1A 3IWZA 1ZISA 1Y1KE 1QP4A 4YFNF 1Q1ZA 4HNHA 4DFDA 4FOOA 4CE6A 3DD5A 3CO7C 3EUFA 3U5ZB 2O0YA 2WP8J 1SOVA 3LLSA 2QZSA 3HP4A 4R1QA 2V1UA 2H29A 2QR3A 2X2EA 4WCGA 1KQ9A 1EKEA 2GD1O 1S4QA 1IE3A 3DTVB 1HDGO 1H2XA 3A4MA 4YRVA 1ZREA 4HOYA 5ANRB 1TQ2A 4FU0A 4JEIA 3TZQA 2J3KA 3I5MA 3BZCA 2WAXA 3LSMA 3WIUA 3N05A 2X19A 4MB6A 3PPWA 4FSDA 2ZJ8A 1U9ZA 3BXXA 3BJIC 4WK4B 1AXRA 1D2CA 1XPOA 3UAVA 5HLGA 2A94A 3OIVA 4RTNA 1IC8A 5M5XJ 2X0DA 5H68A 2YZ2A 1J0EA 2C3UA 3HB1A 3HPGA 2FEWB 2VRWA 3LC0A 1GQQA 4G25A 3M5CA 4ZPJA 2ZB7A 3WNZA 1F2TA 3RSGA 1U28C 2MGQA 4GM4A 5A4KA 2B1GA 4WLNA 5ICMA 1T6ZA 4PLVA 4MQ9F 1HDPA 4D5CA 2CLIB 1I5RA 4IRHA 3R0AA 3D0OA 3NX4A 2PX3A 4H27A 3RUAA 4F3RA 3GJSA 2VOPA 1EB9A 1TB4A 4QE3A 2PGXA 3SQLA 3ZG6A 1TIBA 4LGVA 2RC4A 1ZIYA 3N0WA 1BCRB 1ZU5A 3O4VA 4DZJA 2I2XB 4UXIA 5CK4A 2LW7A 2Q6OA 4IEJA 1R1VA 1E1NA 3GFGA 3GR6A 4U0WA 1FVXA 1PJRA 2LF8A 4NARA 1HG1A 4V1CA 4U7PB 1HXDA 3ZMVA 4E7KA 4B3AA 5L3QB 5CAEB 2JATA 1ZRCA 2FSWA 1SUIA 3KZXA 5HVQC 1QTRA 3PXXA 3WC4A 1DLIA 4KISA 1JZQA 3K09A 3ZIAD 1P9WA 4DJ5X 4C2MJ 2B1JA 2W2QA 5C0OE 4US1R 3V46A 4H1HA 1CQWA 4WGGA 3UF0A 4BEBA 3TW4A 1LJUA 1KDYA 2E49A 2HFJA 2K7LA 3EIEA 4J9VA 3OIDA 3L00A 6CHYA 2IYTA 3QLVC 3MZHA 4B44A 4OHWA 2I7TA 1D6NA 4HH4A 4DB2A 2YYSA 4RMJA 3BWMA 4LFBB 2BFMA 3TO7A 3EXEB 3LUCA 4UHKA 4EI2A 2IS6A 2BGLA 1XALA 4EJOA 2C5EA 3NWJA 2GHIA 4WCFC 3D6VA 1TA4A 3L1PA 4UM8B 1YQ9A 3GA5A 5IKEA 5THXA 5EMMA 5FEUA 3AJRA 2ANBA 3CX3A 4JX8A 3M2TA 5CDUA 5IJ0A 2KRCA 1B23P 3G9XA 1QIKA 4GWGA 2HDNB 1HDOA 3UMBA 4A69C 5HDGA 5K2OA 1ZD4A 4CG2A 3D8BA 4IW3B 5TISC 4MI9A 4E33A 4WDRA 4TYWA 1YI1A 1AM4D 2HJVA 2YV3A 4UVCA 3DLBA 4MPDA 4JXJA 5K5OA 2HHJA 2X76A 3PGXA 3WSWA 3B7GA 5JMTA 4B3GA 3VBCA 1WV0A 1DQRA 2IS1A 2HQAA 3ANMA 3T4XA 1VL0A 2JFPA 4BCBA 3LOUA 1NASA 4PN3A 2YXLA 3WE7A 5L40A 2IIPA 2XOKD 1RXVA 4XW2A 4YS6A 3ZK9A 4LB6B 3EGCA 4JA2A 4MW0A 1CZKA 3QU7A 3DP9A 3HJFA 2WSLA 4BZWA 4CR6A 2EOAA 5F1JA 4LJLA 2AEFA 2ZJYA 4R31A 5FO0A 3RPEA 1E2EA 3QH4A 2O2IA 1R12A 1RCFA 4R81A 4DYVA 3FBTA 3K31A 5D5VB 3P5SA 2BLNA 1PF7E 3TOSA 1AKWA 4PCAA 4Z4EA 3WWOA 4JCCA 1CE8A 3P9XA 2VC2B 2P7CB 2MT9A 1YWGO 3QMWA 1Q1BA 2ZETA 2I6SA 2QD4A 3GFQA 3CM0A 2XX3A 1JDJA 4KH0A 2EZ8A 2YWRA 4EM6A 1P75A 4IV0A 4D82A 4F84A 3MLBA 5DXFA 2L7MP 4L9AA 3AZPA 2HYIC 1JU4A 4QDZA 1LVGA 1VE3A 3QI7A 1ULHA 4JU9A 4F5EA 2IXEA 4IG4A 2GIVA 1TUBA 4EAQA 5D5WB 4DA9A 4IDAA 2WJPA 4P4TA 2FA9A 3BMXA 2I7VA 2ZXUA 5AK6A 1SC6A 3HEAA 2OFOA 2J45A 4NBVA 1L4GA 5BOSB 2QRMA 3VC3A 4GXNA 4ZKDA 3CEJA 1DXOA 3PDHA 2H8WA 2G40A 1X13A 4B4VA 1YZYA 1O87A 4MUBA 1ZHOA 2JI7A 1H9BA 4JUIA 1A2KC 3OD5A 3ONQA 3WRYC 4ZDLA 1N2BA 1Z17A 1JALA 3JQ8B 5TF0A 1W94A 2PLNA 3RB8A 3O8QB 1U6GA 5KU7A 1PUFB 5C1IA 5BSKA 4BVLA 1L7BA 1KMCA 4MRAA 1DRVA 1ZW1A 4KZKA 2XNKA 2ILTA 1AHIA 3QTBA 3OZCA 1W46A 3B60A 2WILA 2MSWA 1E64A 2ID7A 1JQJC 1BDMA 4YMSA 2YS6A 2FSVA 3DWGA 3K32A 2ZUVA 4L18B 5FWDA 1TF7A 1RJ9B 5KYNA 2VASA 1FYDA 1GCOA 1UKCA 1CLUA 5A3SA 3K1AA 3L4SO 1O9GA 1Z4NA 1YB2A 2Q27A 1GRVA 5DBGA 3V7SA 4B83A 4N3BA 2HGCA 4TUYF 4HMPA 1DG9A 2C5FA 3A3NA 1DPFA 7YASA 3G7NA 2ZBKA 3FYHA 3VKHA 2XODA 1Q5PA 2XCTB 4YCLA 3DULA 1ZH0A 4URYR 2R1VA 4NV0A 1YOVA 4CDMA 2II6A 1FSHA 1C3OA 3WRXC 1XEAA 2J33A 5ALZA 1QIGA 1AURA 3GGGA 2GERA 2B9EA 4PX5A 4PU0A 4H7EA 2FPPA 4EX6A 2BGKA 3K6SB 3M5PA 1TJPB 1QZZA 3JRCA 1KEVA 1VFCA 1H4SA 4MIYA 4HX5A 4BGVA 2EQRA 2O61A 3PFGA 1XVAA 3A1FA 1EDEA 3DMYA 3ZNPA 1VJ0A 4FFLA 4FDAA 1EIWA 4CSWA 3U31A 1TUGA 5IHXA 1P2SA 3ZY3A 5T5QA 2A2ZA 3WBKA 1X77A 4WD3A 1XN1A 2V7TA 5ARBA 4QUBA 2Q0QA 1AV7A 1L4KA 1ZM4A 1OZAA 2EU8A 3ZKWB 2XTMA 1XLVA 2WUGA 1L1RA 3J7TA 1BXGB 1JJVA 3KYIB 2NTJA 1FFXA 5IN4A 4EKDA 2ZSDA 5CXXA 4E2YA 2QOEA 2J30A 4CTOA 4PXYA 1YQAA 3V00A 3L18A 4J0KA 4OEHA 4IY1A 4HB2A 2FXAA 2OHFA 5IDVA 2Y9YA 2AKAB 1V43A 1Z6TA 5A4JA 4KQ9A 3SC4A 4GMFA 4M9ZA 1UFMA 1RP1A 2B98A 3C87A 2W4MA 2WWTA 1T9ZA 1C0PA 5KVRA 1R16A 3AIIA 1AKQA 2FJ1A 2HMAA 2WOOA 1JXMA 3OQVA 3PUBA 1ILWA 3DF7A 3DQQA 3I5UA 1WO8A 3E15A 3GD7A 1GGJA 2D8MA 2H54A 2W6CX 4WGFA 3CEAA 4JI0B 1MDMB 1M73E 3FFWA 2HNHA 4LVOA 4V24A 2BY4A 1ORVA 4DG8A 1M2NA 1YC2A 4CFSA 4B34A 1YB5A 1VHQA 1UPTA 5J2UF 1XZJA 1KVRA 2Q5CA 1UMQA 1QZXA 4RTLA 1KP3A 1C4OA 2LH9A 4MQMA 3Q0IA 3LSYA 4LC9A 3JRXA 1DADA 1PU2A 1QX3A 3BD6A 1WCYA 1FPMA 4NK5A 3ZE1B 4L6IA 1L5VA 3F8MA 5E20A 5IT9Z 2O0HA 2BH9A 2OHOA 2CUKA 1YVUA 2I54A 1CJVC 4XRGA 1UC5B 3AYXB 3CUEF 2A35A 5F6FA 5KQSA 3T61A 2HSGA 5CLQA 3IO5A 4BNKA 4DA6A 4NHOA 5HE8A 4AF8A 4GE3A 1DG3A 2O0MA 4IO1A 4RKQA 1VE1A 3PHIA 4YO8A 1GT91 4GKJB 3PGVA 1XD9A 4DIBA 4R0VA 3WLEA 3SP1A 2VKTA 5BQ3A 2WD9A 1MU0A 1N5LA 5BSFA 1F20A 4FM9A 4PYMA 4CMKA 1S3FA 4W82A 5JAOA 2PJRA 1XDSA 3R7FA 3QPHA 2J32A 1ZONA 1PGPA 5M3MJ 3KC2A 2YICA 1XGOA 4EA8A 4HLUA 4QUKA 1ISFA 5JQGF 3JQDA 3ID6C 4HA8A 3GT3A 2A59A 4F4HA 2O3QA 1TP4A 1ULAA 4E2XA 1D2MA 1KFBB 1AIPA 1L8AA 1VXRA 2G9WA 1JHRA 3QE0A 4N1AA 4PJNA 1JH9A 2SKCA 5KPJA 1K7YA 5BUSA 4B81A 1ECBA 3TE6A 2CWEA 3FPAA 1LB2A 4BN4A 2IPQX 3VHLB 1H1LA 4CMIA 3U0VA 3SQWA 1Z13A 1L5QA 2I71A 4K6GA 2N0SA 4OQQA 4G5YA 5BQOA 2JSPA 1UT8A 5DTIA 4IG9A 2BFEB 2PRSA 4I99C 1O08A 2P77A 4C04A 1NDHA 4MV9A 4KO4S 3UGTA 4I14A 4AY3A 1YNSA 4IVQA 3RJPA 4ED9A 3B1FA 1M33A 1OLUA 2FEMA 2I34A 4D9BA 2MINA 2P6UA 2M6RA 3TB6A 4XJSA 1Z29A 3ZXSA 4DYCA 4TL6A 4X61A 3G2PA 3ICCA 1PDVA 3O0TA 5JHFA 5EE1A 2D1FA 2GNPA 3DDWA 3FMIA 3H9EO 3BVPA 1E63A 5ES3A 4Y0VA 4F12A 2W37A 5LQMA 2GVNA 1I4OA 3JYLA 1R7JA 2BONA 3FWZA 5IZCA 3HE3A 4NFHA 2QX9A 4B3CA 2LNBA 5B57C 2BHLA 4A6EA 1N34B 3UFXA 1COZA 1MNQA 5CB4F 2D2XA 1MGPA 3OCVA 3X43A 3DVLA 1KJNA 4XPZA 1YA4A 4UDOA 3MT8A 2IPOA 1BDHA 2JLQA 3ND8A 3WK5A 1IM8A 4XAQA 3UJAA 3DYVA 4GPIB 4PPYA 3TB4A 1W35A 2EIMH 1A9OA 3OU6A 3U09A 2LBPA 3WGTA 1GPJA 4ND8B 4D9MA 5ENVA 3L4KA 1FRNA 2BGNA 2LR0A 1SAXA 4NMHA 2V6GA 3KZNA 2EP8A 4MV8A 2NV0A 5C4MA 1EK5A 2OCPA 1PYVA 3EXFB 4EY3A 1IXCA 3KZCA 4D79A 3PPYA 4UMEA 1O94D 2P5LC 2OE2A 3D6MA 3TEJA 3NTLA 4LY9A 3HPRA 2ZYRA 3C1DA 4X1KB 3H4IA 1ODSA 2ZIFA 3FM5A 4XSXF 4M1SA 5JW6A 2QX8A 5EGNA 2WHPB 5AVUA 3U44A 2IX9A 4OFWA 4YDQA 2ICAA 2Z08A 1E1YA 2G4CA 1OA1A 5FBQB 3P0JA 5D6NA 3TBKA 2QX4A 3V1MA 3ZCRA 2VZEA 3DGEC 2CJYA 4ZOEA 3HCBA 1Z74A 1KXZA 4ACAA 1Q1QA 1T1RA 1J49A 3H0CA 1KY3A 5AK4A 1XX6A 4XVHA 2IZ5A 1X58A 3CUQC 2CHVA 4KA4A 1LXCA 2L9NA 1S7EA 2PYDA 1CNEA 3WNQA 3FZEA 1OXSC 3EYYA 3AM5A 2X0IA 1WJAA 1RXYA 1ECFA 1YONA 4ZANA 5LWHA 1Y9DA 3I23A 1W5CC 4W1UA 1XTIA 2HOSA 3MTEA 4RIHA 1YQWA 4BXXJ 2FQQA 4E7HA 3RNLA 2R6AA 3ZU2A 4ESVA 5L7YA 3EZ7A 3EDCA 1SG6A 1JUPA 2V7FA 1Q0TA 2B61A 1OBHA 1IMOA 2EDAA 5JNUA 1PR3A 3A6ZA 1OXBB 1GU1A 4OXKA 4EB6B 2BZGA 4TUYB 5A7FA 1W4BA 5EMKA 3AHCA 1S6YA 1SK8A 2ZSEA 4YCAA 1MB9A 3ICQB 2VP3A 5DHSA 1JKOC 1NUUA 2VBWA 2VAXA 2KQRA 3V9AA 1X8KA 2GO1A 2R8YA 3LQYA 4LYGA 2RGBA 5DMHA 1XZEA 4NCJA 2HHCA 2QSYA 1WSUA 2C8VA 1EVQA 3BEDA 4H1VA 2M7BA 3NUQA 1PJBA 1YFJA 3N2GB 4MKRA 2HXOA 1UELB 3W5UA 2IYPA 3BF8A 3FN4A 3TSZA 3CMYA 1WHSB 5JOQA 2BI8A 2VRNA 4N12A 4DBLE 1IOWA 4UKDA 5CFLA 4ZDWA 1ADYA 5JLWA 2QP9X 2GPNA 2ZS7A 3IDQA 4KN5A 4L5JA 4FHFA 3NI2A 4K8RB 3OEED 3ZDXB 4J91A 2PUTA 3PSFA 4CLDA 2QA4I 4CZ2A 2XMSA 4ND1A 2VJBA 3L92A 4ALKA 1ZD5A 4TKLA 4Q3OA 1U1IA 1CJUC 2PA3A 5M04A 1AKRA 3QODA 5D5UB 4I81A 5KIAA 4L4YA 2WIKA 1IY1A 4M7WA 4P5OA 4QTRA 1WETA 2B3DA 3M83A 2A1TS 1Z5NA 4V39A 3ZIAA 4A73A 4EFKA 3IUJA 3HPQA 3S5JA 3V1LA 1TMGE 1NIPA 2I33A 4R8SA 4FWTA 4EPVA 2PDAA 1T0PA 5BVGB 4MWZA 4BEHA 4QARA 3DL7A 2ATIA 3WLRA 2CQXA 2GBLC 2QSZA 2KSQA 4RWEA 3GP5A 1VQPI 4CG0A 2I0FA 3I32A 3RIRA 1RM3A 2YCBA 3KVYA 4G5OA 4KWTA 1UBCA 2XMPA 2H1WA 3TO5A 3DEEA 4GP7A 5DOVA 3PHHA 1JDTA 1JA1A 1THMA 1VP3A 2ZJFA 4OIFA 3ULQB 5J2UB 4GZ6A 2IW5A 3WAJA 1JG6A 2YWXA 3OM0A 3HDYA 5KOHA 2AFRA 3HCNA 3T99A 3UWSA 3R7NA 5JAHA 1SCQA 4D7NA 2B2NA 5AM3A 3EDPA 2IKQA 4LI3X 5LN1A 5C1DA 1KBQA 5ALLA 1KAGA 2BE7A 4RJKA 1ORWA 1Z8DA 4TLDA 3ZI7A 4GFDA 2EWNA 4CMCA 2RNJA 2GZ1A 3MZ8A 3T3NA 2CQ7A 3UOAB 3JY6A 2VCEA 5JIBA 3RWOA 1K2VN 3RS7A 2KRHA 2X6TA 2DA3A 3IAS1 4CFZA 2NAPA 3HC7A 2IUYA 3QRWA 4RPLA 2GCIA 1QE0A 3TCXB 1NXXA 2E7WA 1WXFA 4PXSA 5FFXA 2XOKA 1YJCA 4KIBA 1LDDA 1WPKA 4GRDA 1QRDA 1QRTA 4GVLA 2BDUA 4OWRB 1J2YA 4RAFA 1N75A 3IQEA 3VXKA 4P84A 4HAWA 1KZ9A 4QPOA 2VJQA 3AHDA 3K4CA 1NP7A 1RYDA 5AKJA 4JYKA 2VKEA 1I32A 5JQGB 1KTVA 4ZYZA 4G5XA 4CI9A 1GUDA 5MF6A 5B1HA 1Z26A 1OI4A 1RWQA 2TYSB 2G7MC 1CUDA 4ENQA 2JZCA 4B79A 1J8MF 4JBAA 1ZHHA 1KYQA 3VHXA 1E0SA 5KYUA 5GV7A 1TADA 1RUOA 1XROA 5EEHA 1QOQB 1QIEA 1G41A 2CE7A 1J8FA 4EDHA 3KUUA 5T4BA 2PLRA 4ZAWA 3LUJA 4L9RA 4NLLA 5FKKA 3CR7A 3UG7A 2J3MA 1RJEA 4PHGA 4RM2A 5EOVA 5ITWA 4K87A 2QI9F 3DZKA 1H2YA 1X3UA 2AFHE 3IV5A 2GSDA 2RCNA 4P5PA 4DCUA 3KCCA 4AVYA 5B7PA 2YIVX 1YCFA 3AO0B 1DAHA 3OZGA 1MEJA 2ZI9A 4O63O 2C98A 2BGRA 5TMEA 1JFLA 2M4GA 1IOZA 4K6KA 5H81A 1NJ5A 4MI6A 2CV1A 2DWOA 3J81K 5L6LB 3D1LA 3VDQA 3ABOB 3AI7A 3VGJA 1JSXA 4WZBB 2XCQA 1TVCA 1FX1A 1IB0A 1LB1B 2C00A 1J2XA 4KYTA 4BX8A 4PC3A 1IUNA 1V1RB 4DTIA 4QKQA 5CFPA 1JQ3A 2V59A 1RAGA 4IJMA 4L0YB 3EXHB 1K3UB 4MJLA 3CRVA 1JSRA 1DIOB 1A9PA 1V7PC 3A70A 2JGIA 1BX3A 3FA2A 3RG2A 3HFSA 5CB4B 1SHZA 2V97A 2RREA 2HWKA 1WCWA 4KXXA 1KH1A 3S17J 2HCRA 1Y42X 1Z0KA 3KSRA 3ZE2B 2WIBA 3H9UA 3MCWA 3MJ4A 2F17A 2J7KA 3KCQA 3I59A 2C54A 1QRYA 1I4DD 1TCCA 3PIIA 3SSNA 4NESA 2H7CA 2BVNA 3I52A 3E03A 4CNQA 4Q1DA 3JD0A 4HRVA 4MV5A 2DOAA 1G6OA 1KF0A 2GPJA 3KP7A 4L95C 3KZIC 3CDHA 1NVTA 2WP0A