2QYOA

Crystal structure of isoflavone o-methyltransferase homolog in complex with biochanin a and sah
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
b'INNRKPSEIFKAQALLYKNMYAFVDSMSLKWSIEMNIPNIIHNHGKPITLSNLVSILQIPSTKVDNVQRLMRYLAHNGFFEIITNQELENEEEAYALTVASELLVKGTELCLAPMVECVLDPTLSTSFHNLKKWVYEEDLTLFAVNLGCDLWEFLNKNPEYNTLYNDALASDSKMINLAMKDCNLVFEGLESIVDVGGGNGTTGKIICETFPKLTCVVFDRPKVVENLCGSNNLTYVGGDMFISVPKADAVLLKAVLHDWTDKDCIKILKKCKEAVTSDGKRGKVIVIDMVINEKKDENQLTQIKLLMNVTISCVNGKERNEEEWKKLFIEAGFQDYKISPFTGLMSLIEIYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase
publication title Crystal structures of Medicago truncatula isoflavone O-methyltransferase reveal conserved surface binding motifs critical for enzymatic activity
rcsb
source organism Medicago truncatula
molecule tags Transferase
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 2.1.1.46: Isoflavone 4'-O-methyltransferase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qyoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qyoA02
2H6BA 4XUEA 4OBWA 3KQYA 4KVZA 1QANA 7MHTA 4FZVA 3ZMTA 4X61A 2EFNA 3BWGA 3KPJA 5U4XA 4PDKA 1SFUA 1JXSA 3EGVA 1XD7A 3LFKA 2DPMA 2Z3YA 2VOPA 4M9SA 3ORHA 4KWCA 3VC1A 3EVDA 2CWEA 4LWPA 4GO1A 1M0EA 5LQKA 4MEXF 2IT0A 2H27A 2VC1A 4BLVA 3FPHA 2MA3A 4IVNA 2QWWA 3K1PA 1U2WA 3A25A 2Z99A 3L7WA 2OQGA 2JSCA 3DV8A 2VOOA 3AY0A 4WXCA 1XGOA 5IH3A 4PYMA 3SSMA 3GIWA 1IXCA 1FNNA 2BYVE 2AN3A 1R1TA 3DPLC 1FBSA 4IF4A 3DULA 2IBTA 1AWCA 4OQDA 5K03A 5L3EA 5LGTA 1O3RA 3JWIA 5H6QA 1ZRCA 4YG2F 4U0WA 1K78B 2NXNA 5HDKA 5CM2Z 5FADA 1OYWA 1R58A 4A12A 4CDGA 4HX7A 4RAZA 1V3FA 3I4PA 3UFBA 2B9EA 2O07A 3TDZC 2MLGA 2V1UA 2EA4A 3KP6A 1G8AA 4L5IA 3ELYA 4RTRA 1PUEE 4X41A 1J2XA 3CO7C 3Q5FA 2PJDA 5P8WA 2KIFA 2Y0MA 1G6NA 2ZW9A 4UVBA 3FMQA 3O6BB 1W4MA 1BJAA 1YO5C 4WXDA 2G1PA 4QDKA 1NE2A 1DCTA 1ORHA 4ENKA 2Z6UA 4IHTA 1G3YA 3IYLW 3DF8A 2PBIA 4ESFA 2OO3A 4ZZLA 5BP7A 2QVOA 1TNSA 4RS8A 3OU2A 5F2OA 4YV0A 1XSVA 4KIGA 3GGDA 3ZP5A 4C04A 3TOSA 5AONA 3T0IA 3B5IA 1YW8A 1FYKA 3FZGA 5HS9A 3ELDA 1SAXA 2LDUA 2WTEA 2XYVA 4P7GA 4G7ZF 2H11A 3V8VA 4LD5A 5DYMA 2KRFA 2D2WA 2QENA 4WX9A 3KQVA 2NS0A 2QE6A 5EHIA 4MHTA 4EJUA 1F5TA 1EH6A 3SMQA 3R3HA 4HBLA 1EH7A 4UVAA 4WWCA 1R23A 2MH2A 4GOND 1ZH5A 3PX3A 2I9KA 3P7NA 4R05A 4E2XA 4U0YA 3VYWA 1MJAA 5K5QA 3SHFA 3WGGA 4BYYA 5HEKA 4EJVA 2P7HA 2QUFA 2BR4A 2HQRA 2L01A 2RNJA 3HRMA 4ZYGA 2ZIGA 1JQ3A 2QBYB 3GXOA 3EGIA 1D2CA 3GUDA 5DV5A 5EZQA 1ZRFA 4M7RA 1XGMA 2KJBA 1IRGA 5HOQA 5L3GA 2Y1WA 5IT3A 3FPEA 3KLOA 2VDVE 2YX4A 4DQ0A 1Z91A 1RJEA 4DCMA 1BI3A 1WWXA 3JAMZ 1U5TA 2OQRA 4IWNA 4OU0A 3PQJA 1S29A 2RV8A 2M45A 5FLXZ 4KMFA 2FOKA 1HQCA 2DQLA 3OV8A 1JTEA 1G3SA 1YZ3A 3SX0A 5EEGA 2FBHA 5AIQA 2O61A 3TMAA 4F85A 4U7PB 5D6EA 3FYDA 2A68F 3WTZA 1P91A 3DMFA 5CVIA 3ERED 4PYJA 4UHTA 1BI1A 5FUBA 1X3UA 2ZJ2A 1FZPB 1AOYA 2BE5F 3M9AA 2GWRA 1J59A 2A07F 3LBFA 5DSTA 4YUWA 2OAZA 3AWIA 1R22A 1QBJA 2Y75A 2P3QA 3HNRA 2O05A 5EPEA 2VBYA 3CLOA 5LQUA 4KNYA 3NJRA 3LAJA 4F7ZA 3I71A 1ZKDA 5TRDA 3IEIA 4M9ZA 2NNWB 1O7LA 3DXZA 5FA8A 4HV6A 2A5YB 2ZBRA 3UA3A 4U7TB 4U88A 4FSXA 3SVZA 1YS6A 3WE3A 3TR6A 3T7RA 1H0MA 2C7OA 1KP9A 4EM1A 4EQQA 3DFGA 2R7DA 1NKVA 4IRGA 3DH0A 4EV0A 4FP9A 5FQNA 1YG2A 3F8NA 2RKHA 3J81K 2FF4A 1YW9A 4L0ZB 1RI7A 2OD5A 2GQQA 3UJ8A 2P3LA 2YVLA 4R8RA 1K78A 3FPFA 4BHPA 2NYUA 5DPMA 5EKUA 2UYHA 5CVDA 2MC3A 4KDRA 1JTFA 1TQMA 2H00A 5BW4A 5E8GA 5D8LB 2Q0OA 5M5BA 4RTPA 3FHZA 5ED4A 2V1DA 3QU3A 5F64A 1KA8A 4AIHA 3VFZA 3SQNA 1O3QA 2OB1A 1ON2A 2DTRA 2IVMA 4KFCA 3IHTA 5HILA 2NXEA 3DLCA 1FSEA 4GYGA 3I9FA 1HBXG 3T1BA 5LRSA 1ZYRF 1MDMB 5EEHA 2UWMA 1YZHA 1JSZA 2X4HA 1L3BA 3HCCA 3IV6A 1S3JA 4R8SA 2P5VA 3R0AA 3THSA 2DU9A 2AS0A 4ZZDA 2ZLBA 2IDKA 1HNNA 3NMUF 1Z05A 4HH4A 4RVGA 3E6MA 4PINA 2DBBA 5HIMA 4RTSA 2VP3A 3M6WA 1WY7A 2GXBA 5E9WA 2HTEA 2FNPA 3SM3A 3PVCA 4PWYA 3E5UA 3DEUA 5DM2A 4ATNA 2XVMA 1L3IA 2OBPA 1XCVA 1A04A 4E2YA 1JHHA 4MNUA 2F5EA 4FSDA 5FTWA 3MQ0A 3KP5A 3KPVA 3A4TA 3T7TA 4I98B 4RVFA 4PNEA 5TJJA 4C08A 5K0EA 3RODA 3HVKA 3ZMDA 1JSXA 1L3LA 2IA2A 3ABUA 4FT8A 3BDDA 1R74A 3G89A 2G70A 3GU3A 1GHCA 2FRXA 2DAOA 5H20A 3IRQA 2IBSA 1F38A 4GGGA 5F1RA 3C6KA 3KE2A 3KZZA 2CWWA 3AXSA 4G8XA 2IIPA 1N7JA 2CYYA 5DEQA 5FFXA 1RI2A 3FUWA 2QBYA 3JWJA 2FRHA 4MEYF 3LSTA 3M6UA 1HXDA 1SVUA 3TRKA 5HLHA 4WF2A 1L1EA 1DUXC 2W85A 2YXLA 5CVVA 5ERIA 1FPQA 1MJFA 2VN2A 2M30A 3TO6A 3GLXA 4Z2YA 4IKPA 1VLMA 4ENMA 2JJQA 4C4AA 3W6JB 2O57A 1P4AA 1FP1D 5E1WA 4A6DA 4HGZA 2EWNA 4GYIA 3C7JA 1TQPA 4I02A 2RVCA 2EFJA 1FX7A 1R1VA 2DULA 4RVDA 4HF2A 4RGXA 1QGPA 1N7IA 2FPOA 2IPXA 4DMGA 3F8FA 4LB5A 5T6BA 5BPDA 2CSOA 3UZUA 3OZTA 4IHSA 3G2QA 5DM0A 2B0LA 4E2WA 4FX4A 2DK8A 3PT9A 4ON0A 3TO9A 2D45A 4MQ4A 3PB3A 3CTAA 3LKDA 4OX9Y 2JT1A 4A0XA 2QRVA 5EC8A 1B4AA 4RTKA 3GFJA 2AOWA 1JG4A 3E3VA 4HLXA 4N9IA 2AR0A 5HS8A 3C6MA 3IC7A 1JHFA 3GWZA 2ETHA 4QTUB 2NXCA 2V74B 4O29A 4DQ2A 1I6XA 3E97A 4U0VA 4R6XA 2ZWVA 1IN4A 4Q5SF 3QRFF 3DR5A 3BOQA 3LX6A 1I1GA 2BH2A 3DLIA 5EG5A 1FT9A 2J5PA 4XUDA 3OE4A 2DPUA 2YXEA 3P8ZA 2W25A 1WSUA 3K69A 1NBIA 3O7WA 1SUIA 5LQCA 3EUHA 3BGVA 5CJ9A 1ZHFA 1BC7C 3FPJA 4C07A 3O31A 1M6YA 2NP6A 1ZAOA 1UB9A 3ZMZA 4XCXA 3HCFA 3OFKA 1O57A 2OKCA 2PMUA 1TTYA 3DQVC 3LECA 1LDJA 3O4FA 2VONA 4G94A 2WK1A 3HM2A 3D5LA 4BHCA 5T64A 5CCBA 4G7OF 3LCUA 3MGGA 4HTFB 2ZZMA 1I1NA 4L7VA 3AJDA 4PCLA 2W84A 2XRNA 3GEZA 2BGCA 4KIFA 1PJZA 4UV8A 1SFXA 4LLLA 3J80K 3GFIA 1HW5A 3WU0A 1MDMA 1USTA 3A26A 1J5YA 1HSTA 2JG3A 1G4DA 5BQTA 2K4MA 4QVKA 4QPPA 3HA7A 4ISCA 4JBAA 3WGHA 1FYMA 2OB2A 1MZBA 2G7HA 4GQBA 3KQWA 5HS7A 4M38A 5DTQA 1UWVA 3GCZA 3DP7A 1R5GA 1TW3A 4GC9A 3KQOA 2VXZA 2ZWAA 2DI3A 1Z6RA 5C9ZA 1SQGA 4L9NA 4P55A 2O6GE 4WVLA 2L02A 4YUZA 3EVAA 4HOBA 1P2FA 3KEOA 3FRIA 2VBZA 4A6EA 3BJ6A 4A2UA 4B17A 3BUSA 3E5QA 4GOMD 3P2EA 5KVAA 4HYEA 4EKIA 3FMRA 5EMKA 4HW0A 1Z3CA 4CGZA 3V7RA 2CQKA 2FSWA 1O54A 3G5LA 5L3DA 5EIWA 2O0LA 4PYIA 1Q0SA 2PX4A 2P6SA 5D1HA 4JQFA 4EM2A 3FRHA 2XAQA 1LQ1A 1F4KA 1XSDA 3B02A 2WC2A 5DXJA 1O9GA 5EHGA 5LBQA 1ZG3A 3OCJA 4UVCA 4HSGA 2GA2A 1P6RA 4YV1A 2JTVA 5EMMA 4RGRA 1G60A 2NXJA 3V7SA 3S2WA 4ER3A 1J9IA 3BPVA 1XXLA 3RKYA 1K7AA 2COMA 4Y13A 1QAMA 3IWFA 5D8KB 1NBHA 3BZBA 3HCDA 2YSRA 4OOIA 2KW5A 3A27A 4GEKA 2YUIA 3MCTA 3U9GA 3F4KA 2ESHA 2EFOA 3QOPA 1VP9A 3R0JA 2VE8A 2GA1A 1U8RA 4PYOA 3DOUA 3RDIA 2UZ4A 3ZQ7A 3AAFA 2GPYA 5EMJA 2D1VA 2HKXA 3WODF 5CVEA 2P7IA 5HIKA 3ECHA 3NTVA 3HTXA 3GFMA 3NVKI 2HTSA 2OU2A 2XYQA 2GS9A 1T0FA 4BLUA 2PWPA 4PCAA 4C03A 4ASNA 2O3FA 2Y48A 5LRRA 3RYRA 4KICA 3G73A 3H92A 1NW6A 4NECA 5E1XA 4N9HA 2GAFA 3NDJA 3D0SA 2HNKA 3SGLA 3KP2A 3ER9A 1YF3A 3QP6A 2AS5F 5BMZA 1TLHB 2MLKA 1C0WA 2K27A 5D5XB 3PFGA 2W24A 2XVAA 3HA3A 2PN6A 3JTGA 4R6WA 4R8HA 5FHRA 2ZVJA 1K79A 4P9FA 2NNYA 4IRIA 3WTSC 3SXJA 2AOXA 3O3KA 3LKZA 3BZ6A 3THRA 3H2BA 2WA2A 3CC8A 4LECA 1B1BA 3ML6A 3ID6C 3BPXA 5L3CA 1FC3A 3I53A 1ZARA 3HOSA 4K2EA 2DT5A 2E1CA 3MB5A 5K0GA 3VODA 4CYDA 3ER8A 4DF3A 3MHTA 4PIPA 4BHBA 1OYYA 5D4RA 1W7PD 3R6TA 1JG3A 4G56A 2UYOA 3SZTA 4LWOA 3FUVA 4G7HF 4ZTBA 2EV0A 4U7BA 2BV6A 2GAUA 5FGMA 2YQZA 3BJOA 4YIFA 2Z9OA 1GXQA 3PFIA 2PV0A 1UFMA 1K6OA 2Q8KA 3WE2A 1KPGA 4HTFA 3MTEA 1SFEA 1M6EX 4RX1A 1P4XA 4AUKA 3KETA 3LDFA 2PXCA 2VT2A 4HA8A 4M71A 2FBIA 5HOOA 3CUQC 3OU6A 3GW2A 3EMBA 4LB6B 3B89A 4LGWA 3GRZA 4GXOA 2GIVA 3DXYA 1IXRC 3ZPLA 3TDUC 2IH2A 1P1BA 4PGHA 3REOA 1XSXA 4BY9E 4XLPF 1DPUA 3DTNA 1XDUA 2YXDA 2ZMEB 4K6MA 1DL5A 4M6XA 4RB0A 5D5WB 4OIRF 1FOKA 2RGVA 1HKTA 4ER7A 2XGXA 2IGTA 3NWBA 1J0RA 4PYQA 2A3SA 5DRYA 2G72A 2XKPA 5DCFA 2ZZKA 1JR4A 5CVRA 5EOVA 1R7JA 2EK5A 2G71A 3GJYA 1YFLA 2F5CA 3TOBA 5FHQA 2P8TA 3WTWC 1KHHA 1YFHA 3HHGA 3H3UA 1T2KA 1RI4A 2PXAA 3LQQA 1BBYA 2N47A 3KZYA 3WU1B 4KRGA 1B59A 2ZCWA 2H94A 2FMYA 1JQEA 2DPDA 1X1CA 2FE3A 5EGSA 1SMTA 5E9QA 3RYPA 3MERA 4O6JA 1QAOA 2O8XA 1R8YA 2EA2A 5K01A 1NW8A 4CO8A 3N97A 1T6SA 1TW2A 1RJDA 1Y0UA 5LHHA 5F2KA 2I7CA 3BKWA 5FB2A 4I2OA 5J8CA 1KPIA 3KU1A 2ZNZA 1SD7A 5LSAA 4MWZA 2ESRA 3SSOA 4GOOD 4KN7X 1G38A 3IWZA 3V8JA 4MTDA 2K7LA 2CO5A 3E6BA 5CIYA 1I4WA 4CKCA 3ZMSA 2H6CA 2UYCA 2BBYA 4YV2A 2JH9A 3EVGA 3QPTA 4Q4ZF 3EQLF 2LSOA 1BN5A 4B8XA 2ERCA 2ZTHA 4DKJA 1RI3A 2W57A 5CLSA 4F84A 3E23A 4HDUA 1WZNA 1QQIA 3FX3A 1XCBA 2GB4A 1T43A 2QRVB 1YLFA 1ODDA 1WI9A 1HW1A 2O0YA 1D8JA 1R6AA 3BWMA 3G88A 3TFWA 3RKWA 3GZ6A 3TM5A 2QQAA 4LG0A 4C05A 2X0LA 2HYFA 2ZSUA 3T8TA 2F5FA 2UXNA 3NDIA 5BS6A 3HCBA 3QPHA 3DXJF 3ELUA 5LHIA 1R1UA 1PDNC 2IW5A 3SZPA 2XAHA 3QU6A 3UJDA 5LR6A 3B3FA 2PX5A 4HQMA 4YFXF 3JAMK 5K5OA 1IY9A 4ENJA 2PGXA 5FLXK 1MJBA 1W7PA 2KIMA 3L2CA 5BOXA 2CMHA 2DK5A 2L54A 4M73A 3AXTA 3BROA 1IM8A 1D3YA 2YPRA 2GA9A 2BR3A 4OQEA 2P7VB 3FF5A 5KS2A 3TKYA 4Y2HA 5DTMA 2IH5A 1H1DA 2H1RA 1QAQA 2YX1A 2B3TA 4DCGA 2HYGD 4N0BA 5HVQC 4L18B 2P6TA 4X63A 2B2CA 1L3CA 3F8CA 1XB4A 3JTHA 3JW4A 5E17F 2HWVA 3ELWA 4QPNA 2AN5A 1Z6TA 2F5DA 1NW3A 3GRRA 5J6XA 3FM5A 1IRFA 3KHKA 1EG2A 2QQBA 1MHTA 3R0QA 2JRTA 1FYLA 3E7PA 2FU4A 1VP3A 3L9FA 3BWBA 1G6Q1 4I7HA 4CWAA 1JG2A 2FYTA 2HDCA 2OBFA 4RTJA 3P9KA 2PMHA 4BXUA 3F23A 1GVJA 2ZBQA 2FA5A 1BM9A 3FXRA 4MQVA 4ER6A 3EETA 1YS7A 3S68A 2CGPA 4GC5A 2BR5A 5E1BA 3RW9A 1STZA 3UJAA 1XCLA 3BWCA 3U1DA 1OMIA 4HZFA 4YUYA 1RIOH 1G55A 1BIBA 4U7DA 2B78A 4OBXA 3KQSA 5GIPE 1P92A 3MAJA 3OZSA 1V39A 4I09A 2M5WA 2ZMEA 3VOEA 2MD5A 3F6VA 5D5UB 4YFNF 2GLUA 1EIZA 1KIAA 1FBNA 2C7PA 5JHUA 3HVHA 1HSJA 1FBUA 5LQAA 3GRVA 3D2LA 4CXMA 1KU7A 1BI0A 1FJXA 5C0OE 1F1ZA 5E2AA 3M8FA 3NEUA 1P4WA 5HIJA 3V7CA 2UXXA 4RGSA 5KQSA 3LL7A 1BC5A 2HQNA 3I54A 3B7PA 2IJLA 3KP4A 4I0AA 2BM8A 1U6GA 1BKYA 3HEMA 3Q7EA 3MZHA 4H0NA 4E32A 3RIRA 4RTQA 3C3YA 4RTLA 3WTVC 2UYQA 3KPUA 1T98A 5CUQA 4PGGA 4H0EA 2M1BA 2XYRA 1PP8F 3K9TA 3B3JA 1RZ4A 4LLGF 1KU2A 4Y30A 3LA7A 2P7CB 4MGRA 4POOA 1NV8A 2ZCJA 4P5OA 3W6KB 2FNAA 2QLZA 1E17A 1BHJA 3HP7A 2I62A 3TM4A 3B3GA 5KYGA 3CKKA 2NRAC 3CVOA 3CBGA 1NT2A 5IT9Z 2HGCA 3I59B 3DMHA 1WS6A 1YIOA 3HVIA 1G3WA 3Q9VA 3FUUA 1IN5A 2ZXJA 4EGZA 2XASA 3QOXA 4BAYA 1T39A 3GVAA 5F6FA 3EVFA 2HFHA 1DUSA 3UJ9A 1KGSA 1F9NA 3EVBA 5GP1A 3I64A 1R18A 5K5RA 2QM3A 5LQRA 5EZSA 1S7AA 2FXAA 4X60A 3P9CA 4AIJA 2HZTA 2M8EA 4PYKA 2V9VA 3BGIA 1S6LA 4WXHA 3FM3A 4P7FA 3HSFA 4HAMA 2VZ9A 4L9JA 2PT6A 5K0NA 1G3TA 4EQZA 2VE9A 1QZZA 4LFUA 5DD8A 3G3ZA 3R24A 4I01A 4E70A 5DCMB 2ESNA 4A5MA 4P58A 4HX8A 1YB2A 3GYHX 2Y1XA 3EVCA 4HDVA 4KT5C 5IT9K 2BEOA 2P4WA 1IF1A 5GOZA 5G02A 3F21A 3VSEA 5DM4A 5ILSA 1SD4A 4FHTA 5H6RA 4EKGA 2C7QA 3CJRA 2ORED 3M7GA 3QAHA 2PX2A 3SR4A 5BXYA 3R6SA 2YU3A 3CDHA 2JPCA 1KU9A 2MBFA 5ILUA 2Z33A 1I9GA 5GWXA 5JUWA 5DXAA 5FWAA 2G8NA 4QTTB 4MQ9F 3WGIA 2ONZA 3UJ6A 2VBWA 4P7KA 3CJTA 1YUBA 1LEAA 3HVJA 1W5TA 2XAGA 4S05A 4OIOF 2JPBA 4EJTA 1ULYA 4KN4X 1ZRDA 1WKMA 1QZYA 1R36A 2NP7A 4P9UA 2P1DA 4QQNA 4Q48A 2HS5A 3NQOA 5A2QZ 5GM1A 3OE5A 3BJAA 3HRSA 4NHJA 3LQRA 5D4SA 3J7AO 1X19A 1U5TC 4IV8A 2ZULA 3U81A 3QV2A 3KQMA 1KU3A 4PCQA 5IKMA 4PIMA 4PONA 5E1MA 3C3WA 1MD0A 3TKAA 1DP7P 4BP1A 3NWEA 2GZWA 3HRUA 1VIDA 3O2PE 5K0BA 3G2OA 3JSPA 5EVJA 1PRYA 3X0DA 4R1HA 1WRJA 3RKXA 2AOUB 3FXQA 3K2ZA 3RPQA 5DUIA 1VE3A 1X1DA 1OYIA 2QY6A 4A0ZA 2EV5A 2PFBA 3RJPA 3KR2A 1JG1A 3HTSB 4LK1F 1EH8A 3V8LA 1INLA 4GBED 1G8SA 2PVCA 1RUOA 2VT3A 3U2RA 5CYVA 4R79A 1U78A 4XRFA 3BP8A 5E20A 5K0FA 3FZVA 4IPAA 5E8JA 1R8XA 2V7EA 4WK8F 8MHTA 1BC8C 4RTNA 1FWZA 2STTA 5EIFA 3Q9SA 1EJ6A 3K0BA 5C1IA 3FXUA 2PLWA 1JQDA 2P40A 3EMDA 4MTEA 1SD6A 2JHPA 4HGYA 3GDHA 3OPNA 3WTTC 2NYXA 3F8BA 4CZZA 3SSNA 4X1OA 3BGDA 3VEPA 2EJTA 1UFKA 2XBMA 2C7RA 2Q2EA 3I59A 4BH9A 3TOAA 2CMGA 4NQWA 3P71T 3TQSA 2CL5A 2O06A 1D8KA 4AZTA 2CFXA 4CKEA 4DNCA 2WWYA 1ZLKA 2A6EF 4CICA 1VQ1A 3HHHA 5ICCA 3M33A 1CF7A 3LA2A 1ZN2A 2Z6QA 3RPUA 5GIOE 5FFZA 3HRTA 2KJCA 4AZWA 1IW7F 4RWZA 3OZRA 4QVGA 3M4XA 5LQNA 3G2MA 2LF8A 1JGSA 2K86A 3JWGA 3KKZA 3R4KA 4HF0A 2FQ3A 3G8AA 1ZG5A 1SUSA 1J75A 4HF1A 2CKDA 1Z7UA 2YR0A 1XJ5A 2QZ8A 1ZREA 4LG0B 1IN8A 3VC2A 5K0JA 2HKOA 1PP7U 2OZVA 5CVJA 4YUVA 3I0TA 4Y15A 4YMGA 1IN6A 1TQIA 4KIBA 2EG5A 2WA1A 3UA4A 1IZ1A 2VC0A 2IPQX 2D1HA 3TQNA 2IH4A 1OR7A 3K0LA 5HDGA 4HG2A 3F72A 5DCMA 4AWXB 1KXZA 4RV9A 1W7PB 3MEXA 3BY6A 5CD1A 4FGZA 4ESBA 3GNLA 1MJ9A 1D2HA 1Y8CA 4D0PA 4LJZF 2ZO4A 4NB5A 3H3ZA 3M6VA 4EM0B 1X1BA 2P5KA 2ADUA 4HC4A 2PQ8A 2K02A 5L3FA 4L5JA 5LEKA 1XVAA 4IJAA 4IV0A 3R9XB 4MIKA 4ESJA 1ON1A 4DA4A 4E31A 3IKTA 2FK8A 2OZ6A 1RI1A 2PY6A 5ICGA 2M87A 4PZJA 3ZMVA 2AZTA 2A69F 1IN7A 3K6RA 3EVEA 3P2IA 1XMAA 4RYLA 2ZFUA 4AIKA 3KLNA 2RC4A 3LCCA 1YFJA 3ZN1A 4P96A 5DDGA 4XUCA 2FEZA 2E1NA 1DPRA 4QDJA 3KFWX 3BKXA 5D6FA 3ECOA 5LEJA 1YYVA 3LDUA 4G6DA 1XGSA 4YMHA 4Q47A 4OA5A 2VS1A 1ZGAA 1ZQ9A 3G7UA 2EB7A 4RGUA 4HX4A 4KA4A 3BT7A 2E7XA 4RAYA 1EQAA 1FLIA 1SD5A 5FD6A 1O3TA 5JVTA 2EX4A 1T38A 4YIIA 4HRAA 3DUWA 4OIPF 1AF7A 3ERCA 2AOUA 1NV9A 1EAMA 5KK1A 2A6HF 2RN7A 2JH8A 4GUAA 1AQIA 3LPMA 3E6DA 4IRHA 3GF2A 2YTZA 3IKVA 3FTCA 5DTRA 3IRRA 1AQJA 1NHAA 3G5TA 1LDKB 1XMKA 2PBFA 2STWA 3UWPA 4ZYDA 1IUYA 4KW7A 4OINF 5DWQA 5ICFA 3GFLA 2OY0A 5CVUA 1R00A 3GRUA 1MKMA 2TDXA 5DSXA 2HWKA 2AOTB 3P9NA 3MTIA 3NRVA 3DPTA 2IFTA 3DMGA 1BI2A 1VTNC 3KP3A 1KQ9A 1B6AA 1ZLJA 2PLYA 3P97A 1UHWA 1OR8A 4ZYEA 3P9IA 3HA5A 4FR0A 2FBKA 1LB2A 5LQJA 1R5HA 3EPPA 3UJ7A 2IA1A 5HZMA 3SXYA 2YR2A 2DFIA 3Q87B 3T7SA 2EFQA 5K05A 5FCDA 3E8SA 3F3XA 5EKXA 2V79A 3R61A 2ZBPA 4M37A 2NNNA 3GZ5A 3MCZA 3FUTA 3P2KA 3E6CC 2HMYB 4EGYA 4DZRA 3RTRA 5FA5A 3CUQB 1D5VA 2XIGA 2O03A 4V0RA 4FS8A 3C3PA 3FWEA 2Z5UA 5DX0A 1QPMA 3MZYA 1O7FA 4L0YB 3L8DA 4EJWA 1B42A 2P8JA 2MH9A 2J5OA 4XLNF 4S04A 3EVZA 3J81Z 3OOPA 1WQ2A 5KQRA 2XVCA 3MWMA 1D2GA 2EFPA 1O3SA 1RJGA 3WTUC 2F2EA 2P5LC 5E8IA 4LK0F 2H09A 2PJPA 1Q1HA 1KQ0A 2ZBKA 3KQPA 2IP2A 3LGAA 2ELHA 3COAC 2OYRA 4EVIA 5EMLA 4F86A 2ISYA 3HIFA 4KUMA 2VODA 5BPIA 2DO7A 2ZIEA 3KR0A 4FX0A 5E1ZB 3TGNA 3EYYA 4UOEA 5DRTA 1ORIA 2CW0F 5DM1A 4RTMA 2QQ9A 2LNBA 3NVMB 2AVDA 4LMYA 1REPC 2GXGA 10MHA 2ZFWA 1VPTA 2B25A 3I58A 2G7UA 2XUBA 3F8MA 2R3SA 4BQAA 3ISPA 1E2XA 4ZH4F 1UCRA 4TV7A 3FYCA 5DD4A 4RB3C 1HKQA 1I1SA 5E1DA 4CKBA 5F2NA 3FTEA 3KR9A 3T0YA 1XTPA 4BP3A 1B9MA 2I6GA 4GCVA 5E2BA 1U3EM 3RI4A 5JFRA 2HR3A 4C06A 2NAZA 5DLYA 2Q41A 3MAGA 2HOEA 4I0BA 5BW5A 4M6YA 2L3DA 3TO7A 1WXWA 2DLLA 4QWQA 2AOVA 4G9YA 2LD4A 4OA8A 1NW5A 2DW4A 4JXJA 1LVAA 3C18A 1H9GA 4CTKA 4M36A 2HEOA 3OU7A 3LHDA 3C0KA 1CGPA 1VBFA 4RSRA 4OMYA 1OPCA 2FMLA 1XN7A 3FUXA 4HLYA 2JHCA 3T5XA 4E30A 3KPYA 2VBXA 4O3MA 3MFKA 4KDPA 2ZNYA 4L9VA 5LGUA 2FCAA 2UZKA 3PLAE 1S8NA 2K4JA 2PG4A 2EJRA 2A14A 3DKWA 3F22A 2DQRA 4CTJA 2P41A 2E7WA 4MHGA 2HR1A 1DDNA 3GO4A 1TBXA 2ZKZA 3C1DA 4QQKA 2PX8A 3JSOA 3VB2A 5FQOA 1Z1DA 1H9TA 1WG8A 3BXOA 5CCXA 3ULQB 3GO5A 2WV0A 4IXAA 3HTUA 3HOTA 1U2ZA 4CXFA 2A61A 4L9TA 1EJ0A 4E33A 3CJQA 4CHUA 3KQQA 3ME5A 1BIAA 3GX4X 3UBTA 1P39A 3QOWA 2FHPA 1MGTA 3JWHA 1V4RA 5HLGA 1GXPA 2P35A 4AX8A 4HV5A 1IXKA 3LCVB 5E1OA 3HCAA 1NW7A 5LLQA 2RQPA 2AOTA 2HTJA 2LF7A 1KR5A 4FT4A 3MQ2A 1OKRA 4AZSA 3WSTA 2OZUA 1XDZA 2PXXA 5HLIA 1HW2A 1RUNA 3L09A 2FK7A 1Q0TA 2PEXA 4FT2A 2BM9A 4AD9A 3A7DA 5KVRA 2XKOA 4OIQF 5K8VA 4RTOA 3FMSA 3IL2A 2KIUA 5MHTA 3SFZA 1YW7A 3KEQA 3K1MA 5DX1A 5GM2A 3HUGA 3V4GA 3ELKA 3IHUA 3FTFA 2RDPA 4UV9A 1CF7B 2AN4A 2E5WA 3OFJA 4YFKF 4BNCA 4LG1A 2JZYA 3WTXC 1Z9CA 3CUQA 5ERGB 1TPYA 4XSXF 2R7FA 2JHAA 3ANXA 3DXXA 4XSZF 5D1NA 5HFJA 4EJOA 3CO6C 2YX7A 2VDWA 3UJCA 3M6XA 5ILVA 1YTYA 3LAPA 3KPWA 5K0CA 5GINE 4M74A 2G9WA 5E9JA 3WG9A 2V6CA 5K0LA 4G6QA 3B73A 1JE8A 3ZN0A 2OA4A 2IRFG 1USSA 4UNOA 9MHTA 5K09A 1SG9A 2EFWA 1W5SA 4JK1X 1S7OA 4ZYHA 4EK9A 4AVPA 2OXTA 1FSHA 1L9KA 1WXXA 1X1AA 3BWYA 2PI0A 4GF5A 3J80Z 1VL5A 1FP2A 4KMUX 4UXNA 3N4MA 2V1XA 3HSEA 4KYWA 4QLCU 3FTDA 3M8EA 5EQJB 1HKSA 1FY7A 3E05A 2BZGA 4WCGA 4MTLA 2ONYA 2ZZNA 3EGEA 1ONVA 2K4BA 2C6YA 5ICEA 1QYRA 3F6OA 2PWYA 2PT9A 3LWFA 3E5XA 3HCEA 5FO5A 5HIIA 1I5ZA 4M72A 4PYLA 4BLWA 2XAFA 4LLNA 3KR1A 5J8FA 2AXLA 3KP7A 2PSSA 2IA0A 4HQEA 3LA3A 2P3OA 1O9HA 1UIRA 3ROUA 1QNTA 3EEYA 4RB1A 4B09A 2CG4A 1XDSA 3I5UA 5FULA 3K1NA 3ABTA 3HSRA 3L00A 3V97A 5L3BA 1B9NA 1KYZA 3G8BA 5HDNA 5H02A 1TNTA 3FPGA 1AV6A 1HMYA 2OPBA 3CUOA 4OMZA 3M1EA 4A0YA 3CGGA 1SMYF 5LHGA 1XCJA 3TPZA 2IDJA 5D5VB 3LBYA 4ENNA 5JI6A 2XV4S 4KDCA 2KKOA 3PFHA 2EJUA 5DT2A 3EYIA 1FBQA 3WTYC 3KCCA 4ER5A 2L4AA 1IAWA 3UJBA 2ADMA 4AZVA 1UHMA 5A2QK 3V8KA 3EEOA 2R6ZA 1J7KA 5K1YA 4XBFA 2GH1A 3TLJA 5LGNA 1BOAA 3GRYA 5DX8A 4UUVA 5B1SA 1L0OC 4DM3A 2XAJA 1P1CA 3RIEA 5E18F 1LJ9A 5AIPA 1KPHA 3ZMUA 4EMSA 3KQTA 1KQ8A 1EV7A 3G2PA 3PX2A 5JR3A 4E2ZA 4P7JA 4YUXA 2QYOA 3M70A 2HV9A 2ZIFA 4A5NA 1I27A 1LDDA 1SQFA 2AVNA 2F8LA 4Y17A 4PYNA 4ETSA 1F3LA 4RB2C 5E8RA 4V0QA 2ISZA 4O5VA 3R60A 5FD5A 1RI5A 3NW9A 3QP5A 5DUKA 2EV6A 4GOLD 1LNWA 4RVHA 1RJFA 1IXSB 3PQKA 1RNLA 1ZGJA 3LDGA 4ER0A 3T8RA 2ACJA 3CJNA 1N2XA 4M9XA 2Z6AA 1LEBA 5T67A 1KYWA 1U5TB 3HYIA 2PKWA 1SKMA 2L4MA 1QO0D 3PTAA 1XGNA 2XHKA 6PAXA 2VDUE 1YQAA 1BOOA 1ZG1A 3PS9A 3EDPA 5FWDA 3A7EA 2LKPA 2XROA 3CCFA
chains in the Genus database with same CATH superfamily
3PE3A 1V1RB 4J7CA 4GZ6A 4J9VA 5CGQB 2JVHA 2C4MA 1P29A 5B1DA 1SFUA 1XD7A 2I29A 3E3MA 2GYWA 2PHZA 1BRTA 4E5YA 4HXGA 3ZZMA 4ZAWA 3RTEA 3QQ5A 4LHEA 2DCEA 4H16A 3L7WA 4WZAB 2OQGA 2YJNA 3AY0A 5FWYA 3H9EO 4F52A 2PE5A 3NOQA 4NZZA 2GDJA 1M2KA 3AINA 1POXA 3RCOA 3T99A 3D43A 1GO2A 3TYXA 1U8XX 2O5RA 4AT1A 2BKAA 5CITA 3DMNA 3M4OJ 2B9SA 2VDKB 4MWOA 2EA4A 1NF3A 3A03A 3SX4A 1F2TA 1JLHA 3H65A 3BD9A 4EG0A 2LK2A 4P4GA 1X80B 4UHDA 3PT5A 1NE2A 1Y37A 3OA2A 5EE3A 3FHCB 1SG0A 1N2IA 3KKKA 3PE6A 4F5YA 1Q6ZA 4UFOA 4JIGA 5B3KA 5E6SA 1D9XA 1CUFA 4ON9A 3UK0A 1PTKA 3UC9A 4E5UA 2ZRPA 3V7UA 4NPHA 1MZPA 2A2ZA 3VU9B 5I9BA 4CMEC 2BEKA 2CE7A 2II6A 3SYKA 3P7NA 1W6UA 1ATIA 1XDBA 2V9PA 1A5BB 5ED0A 4U0YA 1LB1B 1G41A 1KY2A 5HCIA 2I2CA 3ETDA 1ECCA 4EYOA 1ERDA 1GTJ1 4OLAA 1GPDG 3CT4A 1XGMA 4BKXA 3UMJA 3FPEA 1GPWB 3MWDB 5HFAA 5LDHA 2F3UA 1QGOA 4RHFA 1OPRA 3SX0A 3JYQA 4BBJA 2G88A 3CZ4A 4UEOA 3B6MA 3B6EA 4JHLA 3R44A 4WUVA 3M9AA 3TOXA 2QJTA 3FNQA 3WTCA 3AWIA 2H65A 3BD6A 2P3QA 3HNRA 3R6GA 4I99C 4QU9A 1QCZA 3FSGA 1DBPA 2AFIE 2FSIA 4CCMA 2PLNA 1Q1ZA 2FPPB 2ZROA 4PFQA 1NUSA 3UT5A 1XVTA 5FQNA 3HQ4O 3J81K 2OD5A 1JIQA 2V54A 2R1VB 4G5SA 2CYCA 5DPMA 1J23A 3FHZA 2KFDA 1NI4B 1UADA 1QRAA 3DLCA 1FQJA 3AIMA 1CQZA 4ND8B 4Q7MB 1FP6A 4MVYA 5AHXA 4V39A 4KXXA 1Z05A 3BG6A 5A1JA 3U7EB 2OGWA 2EBHX 1TYDE 3NRCA 1S5LC 3PVCA 5LP6B 4Y6QA 1PZGA 2XQFA 1OA1A 3DBLA 4EHFA 2HLHA 4LUCA 1PGJA 2V4JC 4YT5A 3ILSA 1YDHA 3T7TA 4KFUA 4UTXA 4A26A 2DFEA 4HZUA 3IUOA 4ZMRA 4HXFB 4L8FA 4YAWA 1XZQA 3HADA 3N2LA 2DAOA 3NC0C 3S3TA 4GGGA 2JA7J 3KZZA 3ECSA 4RHXA 3JWJA 3C7DB 2WWFA 2PVSA 1YGPA 3SZOA 1D0ZA 4RXTA 5A4MS 4XVRA 2JJQA 2DPGA 3KEMA 2GPBA 5ALWA 2Z9CA 2F1RA 3S1NJ 3F74A 5TPZA 5A06A 4RVDA 3R3VA 4H08A 3NRJA 2OECA 5F0HA 4P4LA 4YFVA 3A4IA 3PUJA 1SCBA 4TS4A 1TA0A 2OK8A 2R6DA 4QYSA 2IYFA 3GFJA 2AOWA 3RAJA 3LWBA 3EG5A 5IC6A 5FAKA 3FETA 2VPYA 4JLSA 3W5JA 1OLUB 4IIXA 3SZRA 1A9XB 2ZWVA 4YRTA 3KSZO 1JHPA 1YMQA 1JSLA 1T3ZA 3DLIA 1VJDA 1LQTA 4OQ4A 1IUPA 3QXSA 4LEIA 5IYZA 2C2KA 1B8NA 4XRRA 2HK6A 4OLHA 2NP6A 3OJEA 4O2AB 4A82A 4RS3A 4I1IA 1XN4A 1Z18A 3EGCA 2W70A 2B1JA 2DFTA 4PLCA 1M0WA 1QS0B 2J1LA 2WTAA 1ZYUA 4AUMA 1HW5A 3LOCA 1TFUA 4MEBA 2QSUA 2HSDA 1V7CA 3V1LA 1HSTA 4RD4A 3SVTA 1GEEA 1G4DA 3R3ZA 3OYEA 1HDIA 2P9QA 2CN1A 1E5XA 4GQBA 1YL7A 1O95D 4UVDA 3W8FA 5JTUA 3GFVA 2PJUA 1MBJA 3IODA 3QHPA 3DYBA 4GC9A 3V8PA 3R8FA 2RI0A 5E9AA 4RMHA 2WUFA 1SXPA 2IE8A 4WNAA 3FRIA 4OWRB 3U4IA 4JB8A 4A2UA 4JLWA 4GWLA 2CH0A 3P2EA 4E7SA 3Q8MA 1UP4A 2ODWA 1TK2A 2R8RA 2DKOA 2NO9A 3SBDA 1Q3HA 5B3JC 1WDWB 3FRHA 1ZMRA 4BACA 3V8BA 3AONB 4GIBA 1L4GA 4CHGA 3EYAA 4JOCA 3WYEA 4M6WA 4YV1A 4WKOA 2Q21A 2C5BA 1PLLA 1G60A 3V7SA 3S2WA 2PFSA 3RLFA 1LK7A 3DE6X 4MLDA 4UHKA 1TCVA 4FC7A 3QOPA 2C78A 1NYRA 2VPPA 5JD3A 2GPYA 4XKJA 3PD0A 4FX2A 1NI3A 1RQXA 5CTAA 2HKXA 4L27A 1KDRA 3HJAA 4OHVA 2VK1A 4DSZA 5BSMA 3LVRE 3IP1A 2YV4A 3ECHA 2HTSA 2HO5A 1P1IA 1UBGA 1NW6A 4NJEA 5LUBA 3PKJA 4IMJB 3QP6A 3CO5A 3CCMI 2AS5F 4WACA 4PNZA 1NJ6A 2LIPA 1PD1A 5SZHB 2YWGA 1CUXA 1J09A 1IRZA 1Z56C 4E88A 4N8EA 4N40A 4BJTA 4ZDIA 4LJKA 4A0SA 2C3UA 4CYDA 4DF3A 1MCZA 1KVQA 1Z5OA 1O9BA 1F4LA 2DA3A 2UYOA 1N9GA 5K7ZA 1U7WA 3KVOA 4AG3A 1DPGA 3U5ZB 1KPGA 3FPKA 4Q1DA 1QG2A 1U3UA 4E5SA 1EZ4A 3SJZA 1EKXA 3D7MA 2A9KA 3S3OA 4AUKA 4TRMA 4LCEA 3CUQC 3DVQX 3DF9A 4L02A 4RF5A 4WGFA 3K2IA 4LIVA 2K9SA 4G63A 5FOVA 4UVHA 2IH2A 1WD5A 3IJ5A 3NBXX 1BJZA 2IV2X 3NVDA 4MVJG 2FEPA 4XLPF 2AEJA 4URFA 3NYQA 5D5WB 4DLRA 5CYPA 1HYQA 2IELA 2IGTA 3IR7A 1W2WB 5BWMA 4MS1B 1XA0A 5H83A 2OBXA 4MX8A 1LW7A 2DSTA 2BKXA 1PR6A 2E48A 3E2PA 1BBYA 3MWGA 2WFMA 3G85A 5T6MA 3KVYA 2WD7A 2Q7DA 4O6JA 1YU9A 3SIXA 5BRNA 4CO8A 1QO7A 1RJDA 2PQ2A 1K4SA 5BQFA 1YCGA 1B72A 4I2OA 2EKQA 3OTQA 1G38A 4YFYA 4MTDA 4G09A 4GXRA 3LYAA 4MUIA 1HCRA 1GKUB 3TTWA 1JEOA 3BIOA 4B8XA 3X44A 4DKJA 1C3OA 5CYOA 4B34A 1ZFNA 4KV7A 4QC2A 3DLHA 4B3JA 3O2SB 1HTWA 2WJGA 1N0IA 4NC6A 5EJEA 3UJDA 3IAFA 4HQMA 3AR5A 1PEYA 4EY3A 5JQGF 2QW0X 4Q0MA 4MQFA 4KRYA 4GAEA 4BFZA 3VSDA 4Y4RA 2ZU6A 4QGSA 3ND8A 5DWVA 4BNFA 4EEZA 1XB4A 4MLOA 5F3DA 5AKIA 3WLAA 2F5DA 3W2AA 4ND3A 5K4GA 1MHTA 3R0QA 1JT9A 5JXIA 3GEIA 2QTVB 3AJ8A 1PZMA 2HCTA 3IFSA 2A3NA 2X8BA 2BI4A 1UDBA 4KE7A 3BILA 4MQVA 1NVGA 4ER6A 1KJZA 4F0JA 3EMKA 1VQ8I 1C7QA 1R4MB 1O7JA 1XCLA 4HZFA 1RIOH 1W0JA 3KQSA 5DZSA 2YN4A 4RKEA 4Z1OA 5D5UB 2KI5A 1AO3A 3VDRA 5JMWA 5C4MA 4GBGA 4KI0A 3C6YA 3ZKWB 1BI0A 1E3MA 4RPHA 3ZCRA 2XE8A 1XT6A 1WOYA 2HQNA 1MDBA 3EUKL 2BM8A 5F3RA 5KHAA 1PJ8A 4B35A 2ZXEA 3JZIA 3G2BA 3ITNA 4PC6A 4TLLB 1KU2A 1OD6A 3H1GA 2QLZA 4UVGA 1YIAA 3RVJA 1OROA 3SF8A 4GWGA 4B7XA 4CDNA 2ET6A 3SQDA 4PHCA 3KZ1E 1K7CA 3I64A 5FV7A 2CS3A 4AIJA 4HFJA 4HVTA 2XUQA 1T5IA 4WXHA 2G08A 4C7VA 2JANA 2OPTA 1L7XA 1UFQA 3ASUA 3MQFA 3D4PA 3AB7A 4RZQA 1P60A 3GUHA 1CIJA 2R6GA 4H60A 4CMEA 5TQ2A 3AR8A 5M2QA 1O96B 4O5AA 5CVTA 2I65A 3QVKA 1QVAA 1WVGA 2YBDA 1E2BA 2JHGA 2HQ1A 5BXYA 3SR4A 1GR0A 3BRWD 3OVMA 3P5JA 1I9GA 2VYCA 5B12A 3RVPA 5CLJA 1MJGM 2BEVA 3C3XA 1FJLA 3NFRA 1I6KA 3RIGA 4YVFA 4B3BA 2XPCA 4PRKA 3IXLA 5TVGA 3EC2A 1A9PA 2HS5A 4F8YA 5D3MA 1K5PA 3TAXA 1X19A 2B8NA 1T56A 2ZI6A 1U2RA 1NW4A 3R74A 1IOVA 5IYBJ 1MD0A 1DP7P 2H2HA 3HH8A 1PRYA 1CJMA 3RKQA 3T7CA 3RKXA 4Q93A 4EI2A 1XBTA 1Y9JA 1U6IA 1UC5B 1VE3A 1YTLA 1OYIA 3BTSA 3EAFA 4F6CA 4I99A 3VHXA 2D7DA 3PKZA 1INLA 1OWMA 1K0FA 2Q62A 2KRHA 2NW6A 4KTTE 4IXNA 3M5PA 3TLBA 4DBLE 1MQSA 3KTAA 1JUMA 4W5WA 2HYIC 1PFKA 1VNDA 2V26A 1ODFA 4LK2A 4NG4A 4CH7A 3DZHA 5EJ4A 5KQLA 1DV2A 3D3EA 4DJEC 2ZRKA 1AK1A 3K96A 1P7IA 3ZVRA 3ZU6A 2Q2EA 2CMGA 3TOAA 3CMAI 4NQWA 1SMKA 2CL5A 2CFXA 2N0SA 3LUHA 4WASA 5ICCA 4S24A 2IYUA 1AQ6A 4ZDLA 2ETVA 1BJKA 5FFZA 3OZRA 1KEEA 2K86A 1KWKA 1K7FB 1HSZA 1Q84A 2C2YA 6NULA 5JPCA 3MOGA 4RJ2A 3O9ZA 4P5EA 2FZKA 5B58C 4O4HF 4CUJA 1M2GA 4ITVA 3VC2A 2R65A 3NHBA 1NN5A 3I0TA 2VPRA 3NB0A 4DT1A 2D1HA 5IJ0A 1ULSA 1OGYA 2V59A 3U1BA 4IXWA 1XZDA 3CZQA 2PQ8A 5BOSB 3D6NB 3C43A 2E19A 4NBSA 2VHXA 2ZIZA 1DDIA 5A6SB 1FFBA 1MX9A 1UZUA 1JIKA 3TNLA 1HEUA 4ESEA 4BOYA 3ORYA 1EI9A 3MJEA 4O0LA 4FEAA 3UNGC 3RYCB 4RYLA 3H0DA 1W35A 3FPBA 2HPZA 2M7BA 3H5LA 1ZKGA 4JUDX 4DTIA 1AGXA 1R71A 4I55F 1C4WA 5IPAA 2XDWA 2CW5A 1GCIA 1Z6QA 1CJBA 1T38A 1X94A 5ECDA 1PJBA 4F3CA 2RN7A 4RIIA 3NASA 5IEJA 4F97A 3T5PA 3B53X 2Y1KA 4WY2A 3MINA 4BO9A 3WWYA 1SO8A 4PNHA 1ECJA 3QEAZ 2M1XA 5CVUA 3MTIA 3NRVA 2SCUB 4LJ8A 1VHWA 3M6AA 3GHHA 3PNVA 5T4EA 5DBIA 4RY2A 2V58A 3EUHC 2F4MB 5LQJA 2DR0A 4AYBN 3D4LA 4MQLA 5LZ9A 3WK9A 4OXNA 4IIJF 2AZ4A 3E8SA 3GZ5A 1HM5A 3THYA 3NG1A 3A1DA 2O03A 2BFEA 4FS8A 4IVRA 3H6HA 1Y80A 2PL1A 3PDHA 4EABA 3GLFE 5FTMA 1A77A 5CKTA 3DTKA 4CQLA 4XLNF 4LBYA 3RKRA 3KE9A 5I47A 2OFOA 3M9WA 1W5BA 4HMPA 1H05A 2DUUA 5BSKA 4OAYA 4UUOA 1ETOA 1SGWA 3HGGA 2VODA 3LVFO 1DIRA 1E9VA 4QXQA 2CW0F 3AUUA 2A5JA 5E3IA 5B3JA 4ND5A 1FS6A 2L7ZA 2AD5A 1HC8A 3FTNA 3KYCB 4ZH4F 2OVFA 3H8WA 2ZXHA 4LXXA 4X6LA 5EE0A 1GGEA 1A8PA 5DLYA 4IQ4A 3WNCA 1WM1A 2P2YA 4MROA 4P7BA 2CCJA 3GLGA 3C18A 4CW7A 2VTBB 1A9ZA 3M07A 3OU7A 2ZUWA 3VR5D 1I3NA 4BJ1A 2X5XA 1OBCA 3KE8A 4JVSB 4FYIA 5KINB 3Q1KA 3PU6A 3DVLA 2VNSA 3IAUA 4I8IA 1Z6XA 2A1IA 2I8CA 1O8CA 4R1PA 5EQDA 3K31A 1JAIA 1GYPA 3TIFA 1Y1WJ 3GO5A 1P1RA 3KOZA 1RLUA 2A61A 3BZWA 2O23A 4BXOB 1DKUA 4Y2YA 2O5VA 1K5GA 2P35A 3BC1A 2QUAA 2CXSA 3F5FA 1OMOA 5CFPA 3PQDA 2Q5QA 1KH3A 1Q0TA 2CW7A 1G8PA 5D6NA 3CIFA 3HU5A 4BNJA 1V5FA 1AY0A 3QI7A 3WLSA 5IXYA 3OLCX 2BW3B 4OXYA 1Z33A 4R98A 4XL9A 2XHEA 3VJLA 5CDHA 2R4TA 1NA5A 3CUQA 1GL3A 1I94B 4GPIB 2R7FA 4EY8A 1LZKA 3FXLA 1EA7A 5K3EA 4A3JJ 4MP3A 1D0XA 2WJIA 3CB4A 2VN8A 4YAGA 3TTUA 1ISJA 2YHBA 5KYYA 1Z83A 3Q0UA 3I0ZA 5KWJA 1YOVB 2R7MA 2BEJA 9MHTA 4I4CA 1W5SA 2REBA 1ZP6A 3WY9A 2VHJA 2BIFA 3A10A 2EFYA 1KI1A 1N2CE 4KMUX 1M2EA 2P9ZA 4EGAA 3I55I 5AQ1A 3DHWC 2ONKA 3U3RA 2K4BA 1JP7A 1X9IA 3IBCA 4BWFB 4ZI7F 2HKIA 5JVDB 3KR1A 2Z1NA 3CP8A 5CFLA 4NMXB 5ITVA 1YL6A 4RENA 4ZV9A 3G1OA 4FCVA 5BN5B 2Y9MB 1ZD3A 2B1RA 4ARVA 2H1HA 1RS0A 1ACIA 1YKSA 4RD2A 4GPTA 4JLDA 1WLYA 4HDSA 2ZB7A 3TMYA 3ZV4A 2GPNA 2BMEA 5EKDA 4YN3A 1KQFA 1ZLYA 3DKPA 5BVGB 5HM6A 2Q27A 4M88A 4Y2QA 5FRNA 2YJ3A 1BFUA 4Q39A 2XJ4A 2O0MA 4Y2TA 1CEQA 1LX7A 2JC3A 1J7KA 4WIAA 2ZE7A 3PX2A 1J00A 4P7JA 1QH1B 2LBPA 2OQIA 3KEYA 2EU8A 3W79A 2C9CA 1ANKA 1MB4A 4V0QA 4URXR 4D3YA 5BSTA 3CMEI 4IDAA 3ZHUA 4RXMA 4GP7A 5T4BA 1RJFA 1ZNWA 3JVDA 1Q3TA 4PSUA 3W2EA 1I6HJ 1I5RA 4FUTA 3PTAA 2F7SA 3COVA 4YRSA 1D0VA 3CCFA 1KVUA 1TCCA 4M3FA 2UZ1B 3JQ9C 3ANSA 9ATCA 4DYVA 3ZDFA 3AERB 2DPMA 3JV7A 3CUYA 1YZNA 4M9SA 1IC8A 2FX0A 3OEWA 3IBYA 1U3CA 1DP4A 3PRYA 3TVYA 1CJTC 2BFBA 1NUUA 5IARA 1YC2A 2IT0A 2IXTA 5DW3A 5EQTA 3AKCA 1MJ5A 1U2WA 1RKUA 3SSMA 1JR3A 1F43A 3W5SA 5J3JA 5L45A 3VPXA 3L07A 4K87A 1HE8B 2QZ4A 1H0SA 1K68A 2NXNA 1K78B 1NI5A 2QSYA 4ZEOA 3H2JA 2BE7A 3N75A 3UWDA 4D3DA 1FXSA 1IQ0A 4RAZA 1V3FA 1VIAA 2QUKA 2BFOA 3DL4A 1WV0A 3AG3H 4RTRA 3KLPX 4UEWA 4RSMA 2HLDA 1F8UA 2XRLA 3FMQA 4BX2A 4WXDA 3PM1A 1K8RA 3IUQA 4XB2A 1EG7A 4U6NA 3ZX5A 5AVZA 4YAUA 3IYLW 3DF8A 1J22A 2OTCA 4EQ6B 3DHYA 4ND4A 2DFLA 1IG3A 5KMGA 1TA4A 3II6X 1M5TA 3OU2A 4PJ0C 2FPSA 4A3BJ 2QTZA 2UUBB 2P6OA 3B1XA 5LD2C 3U61B 1W85B 5A62A 3TI7A 3SHWA 3IA7A 1PFWA 2G07A 4YEJA 2XTJA 4MMYB 4LS3A 1LRJA 4RZUA 2D5IA 5HEKA 3C7AA 2QJRA 2NZYA 3PFBA 2P7HA 2BR4A 3HV0A 3OWOA 3ZQKA 2QBYB 1K89A 2X8LA 5HOQA 2NUTB 3U56A 2Q4EA 3HCRA 2Q5IA 1KOGA 1SKUA 1XROA 1UAGA 3WL3A 3TGLA 3AM3A 1PR3A 1S29A 1A98A 2V6IA 4D3ZA 3H2KA 5EEGA 2W43A 2GRAA 3PR2B 3N6VA 2GD1O 4RPJA 4I1VA 2D1FA 4W5NA 4PYJA 1UZNA 1Z5WA 1XTUA 3MRSA 5WRFA 3ZWYA 3HU3A 3LBNA 1ZD1A 4TSFD 1MKYA 2Q4DA 1XCMA 3PQ6A 1RXIA 2PLFA 2M2EA 2JJYA 1POGA 1F8GA 4D42A 2VBYA 1DC7A 1ZWKA 3KC2A 3PV0A 3R40A 1DQPA 2FQXA 4U88A 1KAGA 5CNKA 3EJWA 1JAHA 3H3JA 5FUQA 1KP9A 5BNFA 1YCHA 2BZSA 2YYSA 2XGMA 4H7HA 4PLZA 1F20A 2VQDA 4QGBA 2O3SA 5BN1A 5JDCA 4QLAA 2RCYA 1QH9A 3ZH2A 2VJDA 3QPLA 2QA4I 5JDIC 4C4YA 1D0YA 5HBGA 5FPPA 2CC2A 3B52X 5F64A 4M55A 3GZ4A 1M1YB 5MGNA 3IV6A 2VXYA 4D3SA 2H7VA 4AMGA 1W0UA 2H8WA 3WB9A 1DXHA 4HH4A 1LK5A 5CLHA 3I34X 1JDPA 2VP3A 1UBMS 4U7JA 4F12A 3TQTA 5KU1A 1XZIA 4FHCA 1R9JA 1I7PA 4IOCF 3E5UA 1FTZA 2Y1CA 2XVMA 4PG5A 4ZAGA 4EP1A 2Q1YA 3VWBA 3FXMA 3R23A 1UPTA 4G0YA 2E49A 3ET5A 5C5IA 4CEIB 1Z4MA 2M0MA 2VZLA 4MVJE 1KBQA 2HIHA 2NU8B 2M1ZA 4GPEA 5B55A 3QG1A 3ZRGA 1R0KA 4FSHA 4WEQA 4DLSA 4B43A 4KWTA 4P4TA 1W48A 4HSRA 1RACA 3IGFA 3RS7A 3NORA 3N2KB 1T24A 1RM0A 3ZXYA 3TRKA 1A7KA 5ADVA 4WF2A 2FV8A 3BXPA 1VE1A 1QOQB 3GLXA 3E15A 3K6JA 1OX6A 4MYRA 4WN9A 2VP0A 4I02A 2RVCA 5HZKA 2YWXA 3HKZN 1D7AA 4YWJA 2IPXA 1ZAYA 4Y6OA 5JOQA 5EJFA 1Z22A 5T6BA 1ETVA 2J4DA 3ZE2B 1S89A 5FNZA 4ON0A 3KTDA 2WF7A 1B8PA 3BFPA 4UOZA 3HSSA 3SEFA 5HS8A 1ADFA 2LRDA 3EJ6A 3FCUB 1IN4A 3LX6A 4JX5A 3WBKA 1GQ2A 5KJ1A 1Z0ZA 2GFIA 2IW1A 3PIOF 3H18A 2ZU0C 3N0XA 1GPNA 5TGZA 3EUHA 4NCIA 5GONF 3ZMZA 4MW4A 4KR3A 5K3FA 1VRWA 3EZ6A 2HDOA 2AXTC 3EEFA 3FBWA 5AXDA 3Q6NA 3AG5A 5KU7A 4OKSA 4GGMX 2ZI5A 3GTOJ 1UXHA 3PXGA 5T4FA 4IJ6A 1B8VA 1U28C 2QUIA 5DHAA 4L5BA 3QX9A 1IEXA 2PUDA 2P3SA 4B9EA 4HNUA 3U2QA 4TSKA 2XC7A 2DFHA 3IIEA 1LTQA 2IEAA 5ALIA 3QY0A 1JPJA 1OCRH 4CQMA 4XE5A 3QJ5A 4CN8A 4ZVUA 5KC9A 4JROA 4K9OA 4JX9A 3G5LA 3RJMA 2DPHA 2WKWA 4KVFA 4AI6A 5JT1A 1M1NA 1U5BA 1KBZA 5IC5A 2O4UX 4L4SA 3OQOA 1NWCA 1E9FA 4D3XA 4BKPA 4HDAA 2NXJA 2R8YA 4OJQA 2B4TO 3RKYA 1QG0A 2GCGA 2ZE6A 4CL3A 1VQ6I 3T0GA 2YZ7A 5LC1A 1Z7EA 1WXGA 1W44A 1NBME 3T9FA 1Z77A 1AS3A 3SEAA 4E15A 2A7QA 3TW8B 4PNPA 1DC6A 2PZLA 4YQEA 1A4XA 2OE2A 3P2MA 3EG9A 3NTVA 3HTXA 4DYCA 4MS3A 5F9MA 3LVQE 2WJAA 4LNUB 5KIAA 2Y48A 3G73A 2FWBA 1JKOC 1N1EA 3GPLA 2HNKA 2LD5A 4AYWA 4BNTA 2GCOB 5CA1B 2OOKA 4JP8A 1E1YA 1W0KD 3DW3X 2PNJA 3I53A 3OZBA 4V1CB 2R7TA 3ER8A 1GPLA 3HJBA 1ETXA 2VQ3A 1YR7A 3MGKA 5IULC 1UMQA 2NSDA 1E3DA 1JG3A 1VGQA 2C29D 4OYHA 1IC6A 5CNIA 1LDNA 5AKKA 1ENHA 3GMIA 4A8PA 1TJ4A 4A23A 3BMOA 3S1LA 1BKSB 2PUHA 4BV9A 5BRJA 2PV0A 4UZEA 3K1AA 2QX9A 3JAWB 5GAJA 3B1WA 1OLOA 4HH1A 2B7CA 1X0XA 4RD6A 1K8QA 4HA8A 4F21A 2OCAA 2XB6A 3OKAA 4P8RA 2ZUDA 3REOA 3ZVNA 3FWYA 4G5XA 2K2QB 3H83A 4BY9E 5EIBC 1W36D 2XCTB 3B2NA 2WAQN 1G8XA 2YXDA 4L07A 5J1SB 3KQKA 1HKTA 3ZQJA 1V5GA 4M1WA 2IXBA 4MV3A 1RD4A 2WFZA 3AO0B 4BC0A 4PQRA 4G5YA 2Y69H 1WVIA 2PTHA 1YA6A 4KRGA 4CEJA 2ZCWA 4E21A 2FE3A 3PJEA 3K92A 1H6DA 3TW0A 2EA2A 2X0EA 1C0LA 3PUYA 1NW8A 2QTMA 2RAUA 1GP2A 3AEQB 3VPBA 1FNCA 4EHAA 4TVBA 4XORA 2H2AA 4UHHA 4EPYA 3RBXA 2J9RA 3N7UA 4CM7A 2G80A 3MM4A 2NU7B 4IGIA 3DV0B 3CSSA 4L74A 1RI3A 5IKXA 5IY5H 1QWOA 2C3PA 5I01A 3K4PA 1ULTA 3ZIDA 4D4IA 1HTTA 1T5SA 4O8CA 3B7GA 3QNMA 3CCYA 2CSUA 3INGA 4RA9A 1Q83A 4QWWA 5LHIA 3OT1B 3OPVA 1LDGA 3JQQA 4XPZA 2P6PA 1VJ1A 2H31A 2A57A 1MJBA 4PAQA 1E3LA 3CRNA 3BX1A 4RC9A 3NNSA 1SUFA 4ZTJA 4H6PA 1CY1A 3DDZX 3X1KA 3QBJA 4DR5B 3AUSA 2F1KA 3GGPA 1E2NA 1UPFA 2QIOA 3PJGA 2IS4A 1HKHA 2Z5VA 1ONBA 4FX5A 1SXJA 3VTFA 1VKHA 1R8SA 4LITA 4DGQA 5LOVA 4KNVA 3F7TA 4XK4A 4LI0A 2ECCA 2P4SA 2O8BA 4NZOA 4ZHSA 2HDCA 1OI7A 2ODNA 4BNIA 3W5HA 5JCJD 4PSKA 3R3WA 4C76A 3WGJA 1ISSA 1RESA 2XVYA 4WDQA 3B6ZA 2ZKIA 5GAGJ 1IJBA 5FB3A 1BU8A 3VYVA 3RSLA 5HGJA 2MD5A 1FXUA 4K3VA 5KTYA 2BGWA 4PSAA 1WVMA 2WYOA 4QG7A 5IXJA 1C0EA 1F8YA 5C0OE 1I1OA 3V7CA 3WDMA 1F12A 2UXXA 1OXTA 5CB4B 5A9SA 4HDMB 4U3JA 1HKUA 3NP9A 2UYQA 1T4BA 3R5JA 1YNSA 1OX4B 4MQMA 2QVYX 4XJTA 5FTLA 5LQSA 5K8LA 4N5LA 4POOA 1PV1A 3W6KB 1BHJA 8LDHA 3OF3A 5EP2A 4BECA 2DQZA 1PR4A 3FBIB 3O8GA 3HVIA 4UXJA 3Q9VA 4DLKA 1T39A 1YBVA 5F6FA 2PIDA 3E70C 1F9NA 5FDFA 2WTUA 5K5RA 2GXAA 1P0IA 4C7MA 1ZJJA 3SR3A 1T9KA 4FMCB 3ZVKA 2ZIWB 3ZCPA 1L5RA 2QD4A 3NBFA 2VBFA 5EMNA 1SAYA 1T29A 4X91A 2ACEA 2B82A 2GPSA 1QK4A 2PYDA 5CLFA 2GZAA 4W1SA 1QG4A 4E70A 1FFGA 5DCMB 4L4UA 3QELA 2JEYA 3VVMA 5IT9K 3EPZA 2P4WA 1V11A 1U63A 1C9JA 4MQUA 2ZTSA 2Y1OA 5DM4A 4REOA 6YASA 1ZD4A 3QFFA 4NBKA 1WI3A 3Q3CA 3GQBA 2CYBA 4QTTB 4PO1A 2LYCA 4ZAFA 2PEZA 1JHXA 4QRIA 3AUFA 1YUBA 1Q44A 2JPBA 3A3YA 1ZRDA 1QZYA 1BDJA 1CR4A 3LTNC 1JG7A 3HRSA 3Q3GE 5H3CA 2WAOA 3RYFB 2QHXA 4DXAA 4DA9A 4XLAA 2JI6A 4ALLA 4XIDA 5EVJA 3D3NA 4XIFA 4A3DJ 3D64A 4I08A 1RXCA 5DM7F 1QLHA 2INGX 2HHAA 1RZRD 5KSPA 3BR5A 5AIAA 4XX0B 3K0CC 2E2IJ 1IBRA 1E1LA 3LAWA 3B36A 2QTGA 3HYRA 2FKAA 2JATA 4OQMA 2XF6A 2ZSAA 3OM8A 4FGWA 3U62A 5CMLA 5KTOA 2M9HA 3GELA 1SD6A 3DAPA 1UM9A 3ZXIA 4E7JA 3OPNA 2VJOA 4BX3A 3AU9A 1F0PA 4UCWA 5IMBA 3SSNA 4LXTA 1P0PA 3DC2A 4R0MA 3HCWA 2XBMA 1SOMA 3CNBA 1E5DA 1E6WA 1NY6A 2EZ4A 1V9SA 4CF3A 4HUQA 3L0OA 2H5IA 4I50F 5JI3E 2BGMA 3E58A 4U1RA 3URMA 4I0WB 2LF8A 1UXIA 2HBQA 4Z49A 2B63J 2IXAA 4IIEA 4H31A 3U48A 2IEIA 2FP4B 2YR0A 3PC6A 5EWJA 5FKNA 4IHJF 4QZVA 3G0HA 4ZRMA 3FKJA 1GKIA 1V3VA 2XECA 2WA1A 1XNRB 5BSVA 3TQNA 4D9NA 3JARB 3DOEA 4ARUA 3ZWQA 4RAOA 2F9FA 4FOPA 3T61A 2RGBA 1RZ3A 2KZGA 1QHHA 1CB0A 1WJAA 5AVYA 2O3JA 3NTRA 2C95A 1P44A 4O8ZA 3U17A 1AE1A 5JHGB 2QG6A 3PPXA 3JRIA 1MC5A 4A69C 1GNTA 2PZMA 4WXMA 2AZTA 3ECAA 2Q5CA 2DYSH 1D8AA 2VIIA 2ARKA 2PA3A 4YRGA 2YKGA 4AY5A 1NATA 2ERYA 2P5YA 2QMYA 2G77B 2JLRA 3F6CA 3OQ1A 3TAUA 4Q47A 1W36B 1GAXA 2C2GA 5F4BA 3Q41A 1ZH2A 4DSAA 3QLJA 4L73A 2R6R1 1V96A 3B78A 3Q7IA 4MEJA 5FD6A 1IM5A 4X24A 1GLGA 2LBFB 4EENA 4PVDA 1WXIA 1TK3A 1PZXA 2GZ1A 1IIRA 1UZLA 3E7WA 3MUFA 2OGSA 2F3PA 2HJWA 1PX0A 2GZMA 1NY5A 5TRTA 1UFVA 3K9QO 3BTJA 1EDDA 2XMSA 2GHTA 1SCQA 4MYSA 4QODA 2XZLA 1IATA 5I8PA 2DGDA 1TM7E 4NBLA 5CVCA 2O2CA 3OLZA 3DU6A 5C34B 1U0GA 2EV9A 2GXUA 3RRYA 5JJIA 3SFVA 2YWHA 2R7WA 5IABA 4NBRA 5AVJA 4ZKDA 1LB2A 3NEYA 2VRCD 2IA1A 4LV6A 2JA1A 1JJIA 2JIPA 2EFQA 3UV3A 1W4BA 2CJYA 4EJ0A 1WV1A 2W8ZA 3QE3A 1Q21A 4DXHA 1JEEA 1U28A 4AVYA 1N4DA 4AMZA 2PKYX 1OY1A 4AECA 1JAYA 1KYVA 4RGBA 3KUDA 1U3DA 4XQFA 1XKTA 3IKJA 4RPGA 3F73A 3CNOA 4DEYA 4PGFA 1COZA 3V6MA 1RJGA 4RNDB 1W30A 2P5LC 3TAHA 3KQPA 1QF9A 5E1ZB 4IKFA 2R4UA 3QWIA 4OCZA 5KX5F 4OP3A 1IDOA 4HAWA 1W8DA 2X8AA 2PUGA 1LJ8A 3BAFA 1JTYA 5E1DA 3FTEA 3W06A 3KX2A 1N32B 5BUCA 5E2BA 3CD6I 2HI3A 7REQA 3AEUA 3VR2D 2ZRBA 4G9YA 4DQLA 1HF0A 2A88A 3P4XA 1ORRA 4KR9A 2J5RA 3BICA 2J3MA 2PSHA 3U19A 2HRCA 4QGAA 3D5EA 3WRWA 2I7VA 2PGIA 1QV6A 2CZQA 5DMXA 1R27A 4UDNA 1QOPB 3RBAA 4FYYA 1PJ3A 1SUWA 4QUBA 2A14A 1R8QA 3DKWA 1AOXA 4YUAA 5H59A 1M75A 3PGKA 1TBXA 3DE5X 1T0FC 1KK0A 5IANA 2J6BA 2UUZA 2JLBA 3HDGA 2GLXA 1N0WA 5FNVA 2TECE 3NPMA 4P33A 2P2GA 2O7OA 2FHPA 3WLNA 3MTJA 4I2VA 1ZK4A 2EXXA 1V4RA 4OXIA 5G4KA 2KE5A 4CM9A 3IDFA 3L5OA 3HCAA 4HRIA 2AOTA 2HTJA 3MQ2A 4YJKA 1Y5NA 2J0SA 2P0YA 4E7LA 1TECE 3K16A 4ALKA 5MDHA 2X0IA 4P93A 1IZ9A 2B7BA 2GOYA 721PA 1CE8A 1SIUA 3EIUA 4TLEA 3DXXA 1VIMA 5D1NA 5HFJA 4M9UA 5ITSA 1B4DA 1LY1A 1M6VA 1K4KA 5K0CA 4GYKA 3FBGA 2BKLA 5F5XA 1RW4A 3OM9A 4D6PA 2PYIA 5CG1A 2OA4A 4WESA 2IRFG 4UNOA 1E2EA 2FDRA 4N76A 1SG9A 3WI7A 1B8OA 1WWKA 4KXUA 4UUMA 2RBEA 3AG4H 2P4EA 1Z67A 3X1MA 3VC7A 4DLLA 1EFUA 4GBMA 1LVHA 3EGEA 4BTEA 4WFIA 4CR6A 4PZDA 1F4PA 5ICEA 1DQUA 4EI7A 1DI0A 3MFYA 2ZAOA 1TQDA 3RUCA 4IZOA 3QE4A 4XVHA 2Z5FA 4G5HA 1AZWA 2Z1DA 4NP6A 4HQEA 1B26A 1AUQA 2WABA 1DEHA 3VU1A 3LPNA 1J8VA 1RAGA 1DCFA 2L7MP 4JT2A 3B6KA 1KYZA 3WDLA 5CW1A 2BDEA 5H02A 4Y9UA 4KSBA 2O3RA 5JLXA 3K0FA 4XWAA 5IJ9B 4LDRA 3LW7A 4QPJC 2I22A 2ZJ8A 5IKOA 1Y3FE 1QTNA 4WKBA 5TT0A 2ELKA 3HGQA 4PN7A 5C8YF 3WRXA 3KCCA 2WVHA 1IAWA 2WMDA 1LX6A 5LGNA 3HJFA 3IEKA 3SYRA 2ZDQA 2NTVA 4DM3A 5AW4A 5IUNC 2BCJQ 1E9EA 4F71A 1FRVA 5B1HA 3U9TA 2PGAA 1KQ8A 3EW9A 3RS5A 3F6EX 3FVRA 3WIEA 1TUBB 3CRVA 2X58A 3B5JA 3PEFA 1F3LA 1E3JA 4BO0A 2G36A 2NQ8A 2XSDC 3RTDA 1N2OA 3RHZA 4PG7A 1QHGA 1LNWA 1BWQA 3P96A 5REQA 4Q21A 5B3AA 1GEGA 1SUEA 2K9LA 2PKWA 4D4GA 3ZWDA 4C6TB 4ESOA 5KNDD 3PS9A 5ECWA 3O8RA 3LC2O 3EPLA 3GLRA 4DL9A 2A9QA 1RR8C 5C7LO 4LDPA 1TUIA 3LPDA 1IN1A 2W48A 3RC9A 4P2BA 3AUTA 1S2LA 2FH5B 5JZBA 3L0PA 5AI9A 2W71A 1VJ0A 3DEFA 4HH3C 1EWQA 4BLVA 1GJRA 3EW7A 3ETLA 4MLCA 1UG0A 2PJRB 5B6JA 5F9FA 3EBPA 2BZ0A 3FRJA 2UZIR 2IVZA 5FROA 3MBIA 2BYVE 4DLAA 2V4UA 3CP2A 3PUWA 2GNOA 4NJOA 2ZRAA 1L7NA 1Q1NA 1AK9A 3G9TA 5HE9A 5KWVA 1E1QD 4W5RA 3GLSA 3UUGA 1PV2A 4YRVA 5I7WA 1YQQA 1DAHA 2D1TA 1U0OC 2UV8A 3H9UA 3PJRA 3GG2A 2ZW9A 5KTSA 1F0KA 4NICA 4C30A 1RHMA 4HAXA 1ORHA 4ENKA 2Z6UA 1Y9EA 4WOPA 3V4RA 1CUYA 1HQDA 3HN2A 3TTXA 4G81A 1YW8A 3BWXA 1YCFA 1ADGA 3CF4G 4WN3A 4EJUA 4EBBA 1JB9A 3DE2X 4UVAA 1JX6A 3BHIA 2E85A 4GOND 3F8TA 1MG0A 4U6QA 1T3LA 2QT1A 2QPOA 5CT8A 3OJFA 5IFLA 1UBTS 4EM6A 3TZEA 4A5OA 2QAIA 1QE5A 4B3SB 2ZSKA 5AJHA 2QV7A 2VXOA 3IEVA 1AKTA 3DAOA 2FOKA 3OV8A 3X1JA 3FHJA 5AIQA 2VP5A 2Q6TA 5D6EA 2VVTA 1XN1A 5CVIA 1ZH4A 2AFHB 4MO2A 2OHHA 1PG2A 2JA8J 2UKDA 4HQOA 1X3UA 3VH2A 4E22A 2VSOA 5ES3A 3E5MA 3S2DJ 1QJ4A 3GIDA 4Q02A 2MYNA 1EWKA 2ZWIA 2RKBA 5KUTA 3LAJA 4J7XA 5FLYA 2ENUA 4FIDA 4CKXA 4ZDKA 3I73A 2H5EA 4K26A 3GCGA 1VHLA 5E0KB 5A03A 1N6IA 2C7OA 5BV8A 5CHYA 2EF1A 5INTA 2XOXA 2Q8PA 3KZKA 4R8RA 1WHSB 5JQWA 2NYUA 5EYPA 4BO4A 2HPIA 2PS1A 2H2IA 1TF7A 2C59A 2K9QA 1Q0PA 2I7XA 2B6NA 4OUKX 4C5CA 5FTJA 3CVUA 2JFFA 1UC8A 2G17A 4MJXA 3T1BA 5TEVA 1QVUA 1YZHA 2CQXA 3X2QH 2R93J 3IMKA 2RBGA 3ND9A 2BW0A 3A2LA 2ZLBA 1HNNA 1V54H 4O4LB 5C1DA 2HRDA 4NZ9A 4ZO7A 5H5JA 4XI9A 3TXYA 4RY8A 5DM2A 1AGNA 1SA0B 1DQRA 3OQIB 2YJ5A 1QSGA 4NESA 4GM4A 1YU6A 4QU0A 3WP0A 4KBFA 2YYAA 2Y0SN 4K6CA 1XOIA 3HVKA 3HN6A 3ZMDA 3BHMA 5KI6A 2PAAA 4PTYA 1VE7A 4NXMB 4WEOA 5D86A 2DKNA 3ZOBA 3C6KA 2CWWA 1EB9A 1H9BA 1X7ZA 1CDEA 1MTZA 5HLHA 2XMDA 5NLLA 1BFKA 4IL5A 1QTIA 3KSAC 2DH5A 3ONFA 3L7CA 2QNRA 4WSOA 2QR2A 4KWIA 5JH7A 2EBUA 4HGZA 1MJNA 1UKCA 4NBWA 3C7JA 4JP0A 3DR3A 3ACBA 3DE3X 4ALIA 3QVWA 4ZAVA 4WK4B 4AS2A 4IHSA 1RC0A 1M3SA 2NVOA 5ALVA 1BA5A 3H99A 3UMCA 3E3VA 4GPD1 2GK3A 4TLCA 2QAGB 3GWZA 3UVEA 3CF5F 3MZ8A 5LZ4A 1BD4A 1AS0A 1MO2A 5G4LA 2AEEA 3U3MA 4REQA 3FNHA 3WGLA 2COKA 4J1QA 4Q05A 4AQDA 2XXJA 3CW9A 4C07A 1KU0A 4ROTA 1M6YA 2R751 1O57A 4E5NA 1EK6A 2VPZA 1TTYA 1LDJA 4PFPA 5K1ZA 2MMGA 2Y2ZA 2BJVA 3IMCA 3IUSA 4A8JB 1KSFX 4LRUA 4O1MA 4QO7A 2O8DB 4RW0A 2CNWD 1N5LA 1MHPA 1P7YA 3A2NA 3I4LA 5JG7A 3H9GA 5FLMJ 3B3QA 4CODB 4ISCA 4JKIA 3WGHA 1C50A 4EPRA 1UBNA 4ENQA 2ZXFA 2E21A 5DTQA 5E3JA 1BX3A 3GCZA 2ZSDA 1QP7A 3KQOA 1T0PA 3W1EA 3D1JA 5G1PA 5AHOA 2XMBA 4JLJA 3LZDA 1K6IA 4F2WA 1RYZA 5A9RA 3EGXA 3V1NA 1BCRB 3Q8WA 3PNYA 3DNFA 4F1KA 3EPRA 4ZVNA 2VRNA 3KKOA 4FOSA 3THXB 3WBFA 1GFZA 2DBRA 5JWHA 3E61A 2B2NA 3ENWA 3WGZA 2YUTA 3VNSA 2HDDA 2X22A 3UG7A 4XCQA 2YUIA 3VKHA 2IUSA 1ZC4A 2EFOA 1NWHA 4HD8A 2RHMA 3NHPA 3DDNA 4JLOA 5HYVA 2AK2A 3VR5H 4IGKA 1P1KA 4RCVA 1NF9A 1T0FA 4PCAA 3NARA 1O1YA 3OOHA 2O8VA 2GAFA 3A01A 1X7YB 3ROZA 5DYYA 3TMKA 4C2TA 2MLKA 3OYHA 2XVAA 3NFYA 1VCHA 3AF6A 3QFSA 4IEEA 5C1OA 1H0KA 3THRA 2LFBA 1GG5A 1GQOA 1P33A 1ONOA 1Z4NA 4PHTA 1ILWA 5K0GA 4YMSA 1H1TA 4MS4A 4IDEA 1WVRA 1F0NA 1JNYA 621PA 4LOKA 4WERA 4YB8A 3DVAA 3HKDA 5EIHA 1Q15A 3QMMA 4RV4A 3DWFA 1YQUA 5IN5A 1E6MA 4GGPA 3LT0A 4N8DA 4RX1A 4AF6A 4GWKA 1QHYA 2P0WA 1MOZA 3EXIB 4XDGA 4NS1A 1R2QA 1Y3IA 3KOWA 1XSXA 2L69A 3PENA 3HOUJ 3WIUA 2DTZA 2LKDA 4OHWA 4Q1AA 5AKGA 3NWBA 2X41A 3DAHA 3OZEA 5CFNA 2ME6A 3K05A 2MIIA 2ZZKA 4LYHA 4CR7A 4RQBA 1J33A 1LLQA 2R6CA 1JHUA 1SM4A 1WUKS 3LQQA 4C7OB 1C7FA 1A7JA 1B59A 2DPDA 4YLGA 1CSEE 1YDWA 1A69A 2WV9A 3HJCA 4JDUA 4MW6A 3X2EA 4LJ5A 2PMCA 1XLTC 5KTTA 3OQJA 2ZNZA 4H1UA 5IT0A 4YV7A 2VAXA 2JFHA 4R1TA 4UB6C 4C3VA 3IWZA 3EZ7A 3EQLF 2RK3A 1I50J 3JD4A 4GR5A 4PXSA 1BW9A 2X9DA 4E1AA 4G8DA 2QQAA 2HYFA 5JAZA 3T8TA 2F5FA 2UXNA 3QXGA 3EHEA 4M1OA 3UGJA 2IUTA 3AETA 1R66A 1VE5A 4AWXA 2WDPA 3PP8A 3E9RA 4M73A 2DUMA 2XXAB 2BR3A 1F3OA 1GVHA 4GI1A 2LUOA 2H1RA 1EFVA 3F8CA 3P0FA 5H1YA 5CDGA 1PJCA 1BD3A 3GRRA 3HY6A 4DSTA 3NAQA 4ZGGA 3VNQA 1UPXA 4AMYA 3IMEA 1G6Q1 3JASB 2GN8A 1LVKA 5HQ3A 1IU9A 1C1YA 4NAVA 2VJYA 2G4LA 4M54A 3LO5A 2ZBQA 4P98A 4FYPA 2X1LA 2NT4A 1M2OA 2AMFA 2VJPA 4I09A 3D6TB 2B92A 1G6OA 5JHUA 2O1WA 5EGOA 1G98A 1ZU5A 1H5UA 3OT5A 5BNIA 1A8HA 4OTZA 1G4AE 2OAQ1 3B7PA 2UVDA 1LE8A 3DKKA 3CLTD 3K2QA 4ND7A 1KMMA 1XWWA 3H11A 1MOSA 3G8DA 5J40A 3Q4GA 3K9TA 4ARSA 3PUIA 2W5UA 2I62A 2HA2A 4JXZA 3FUCA 2CVPA 3VAYA 2JW5A 2J7PD 3CUWA 3A0HC 4BNYA 5A2GA 5M34A 3FUUA 2ISCA 3ASYA 2XASA 1SVWA 2ZIVB 4X64B 1F2UA 3AHGA 2GTPA 5JVGF 1G20B 4XMYA 5A3JA 1ES9A 3M3DA 3FNBA 3LVBA 4WOKA 1VDZA 4F3TA 1JECA 2HA4A 4ZDWA 4H77A 2W4IA 2PT6A 1L5GB 4DBZA 1QNLA 1QHSA 2FCRA 3OD1A 4BCDA 3LF2A 3VAZA 4U02A 5I7EA 4YAOA 3WHIA 3PZBA 2JZOA 1UOEA 3MIIA 3CPJB 2DETA 4E13A 3JPYA 2P0EA 2XT9A 4JLKA 1ZQ3P 3IUMA 5ILUA 1RXVA 1JZQA 1PT7A 1PT8A 2BF7A 3T06B 4D5EA 4EI8A 1QXSA 2GBIA 3IP4B 5GP9A 2A0YA 4FYVA 1GKKA 4S05A 4RMIA 1H8HD 1ECFA 3H05A 1I0LA 1RQ2A 4D96A 1XZLA 3K6GA 1R49A 4W8GA 4H6WA 5I7UA 4ZO8A 5G2OA 3T7DA 4CIWA 4QOGA 3ED1A 3PO3J 3NTUA 2F43B 2CLCX 1BKDR 1OXUA 4HOYA 3TEFA 3PF8A 3T95A 3AHHA 3BAZA 4QUEA 5DUIA 3GLIB 3M2PA 3LSRA 2WOJA 3K8YA 1NDUA 4KV9A 3I9MA 4L8WB 2ZBDA 2YJTD 2J3EA 4U0JA 5ALMA 2IYWA 2V7EA 2ZSBA 1FMFA 4B1FA 4ITRC 2M98A 3QVXA 3PVSA 4XOIA 4Z8XA 1T26A 2ZJ1A 4DJDC 2EQBA 1JV2B 5L8VA 3BGDA 3LK6A 5JISA 1HFKA 2PZ8A 4WZBA 2OHVA 5DULA 3SMVA 4DMFA 1ZJZA 3BCRA 4CKEA 3CZAA 1ZLKA 2X5OA 5A5FA 1BG6A 5IXSA 4YASA 3FVQA 1YK1A 2JLZA 1YDMA 1IW7F 3P9ZA 5BYAA 3DLTA 1J75A 5ARDA 4C3OB 4ZXFA 1N2BA 1JBQA 3EX7C 1XZCA 4LOJA 5CVJA 1YJQA 4Y15A 1ENPA 5I5GA 3WFJA 1TB4A 3CLVA 4JJ6A 3A1WA 3K0LA 2JLWA 2OHXA 1Y6IA 5IVDA 4K6KA 3BY6A 1PR5A 2GCPA 4KHZA 1R0CA 3P0RA 4U4AA 4LZZA 5KWSA 1ND5A 5EPOA 4L5JA 1FVHA 5JXJA 1PNQA 1EEXB 1XTTA 4PLYA 1OIVA 4ESJA 4C4TA 3EXG2 1W0CA 1N6KA 4DA8A 4KSYA 4JUIA 3A36A 2W8BA 3MWEB 2VAVA 4NAHA 3ZHQA 3LDUA 1C0IA 2C4HA 2VS1A 4OP1A 5SYMA 2E5LB 4FILA 1HEIA 2PM8A 2EZUA 4DWOA 3CBQA 1CUJA 2XNKA 1T1EA 4RAYA 1EQAA 3DKXA 2NXWA 1ZGWA 3PDJA 4MWGA 2EBWA 1WUHS 3LRXA 3B12A 1NLUA 1BHO1 1XK6A 2QM8A 1NTOA 3BJIC 3RRXA 4DV6B 2P78A 1AQJA 2VO1A 1DWPA 3QKUA 2PBFA 4PZ9A 4JX4A 2AKAB 3G0GA 3GDGA 4F11A 4X62B 4FJ0A 3UAGA 4DQXA 3RNOA 4L8VA 1KZGB 1K27A 4YMLA 3Q87B 3F3YA 3MILA 2PN1A 2W6NA 5D3ZA 2GR9A 3P2KA 4D8YA 1BO6A 2H0RA 2JVJA 5DXFA 2JD0A 5FI1B 1WHTB 4JSRA 4V0RA 3LA8A 1CG6A 1Y6RA 2VDWB 1HORA 2AF4C 3QA9A 4B9AA 4YRIA 4KGXA 5FOQA 5CR9A 3OPYA 5FORA 2MH9A 2W6MA 1GV1A 3NRBA 2GTHA 4U6SA 3BG5A 3MWMA 3IKMB 3WTUC 3WLMA 4LDJA 2EHDA 4BNDA 1Q1HA 3LGAA 4I4TB 5DHTA 1P7VA 1B41A 1NVFA 2V7WA 5THXA 4GZLA 5EUBA 1R6TA 3Q9UA 2GXGA 1LBEA 2HEIA 3F8MA 4KCGA 1W19A 2EKDA 2CB9A 1XEFA 3G6WA 1I1SA 1B0UA 4O1HA 1XPRA 4BP3A 2D1QA 2HR3A 2JBAB 1YDEA 3HJNA 5U9CA 1IOLA 3WXMA 3OZWA 4CTKA 4JI7B 4V0KA 1CGPA 2ZAGA 2JHCA 3F96A 1YX5A 2CUEA 2ZPAA 4RANA 3NNNA 1OT3A 3WQQA 3WMGA 5FTKA 1EVIA 1KMNA 1E7RA 2A6TA 5DYWA 2P41A 1LWNA 3CVVA 1DDNA 2IS6A 4LBZA 1VOTA 5FQOA 1Q0RA 1QJCA 3NYWA 3DAGA 2BSXA 3TX6A 1Y6QA 3KUCA 4CXFA 1O77A 3FXKA 4M1TA 1JJ7A 2VDMB 1T5OA 2JH3A 4NEHB 2SHKA 4GZ5A 4JI1B 3TUZC 1M1EB 2NSYA 4I3FA 1MBGA 5EFZA 1NJGA 2LF7A 2ZM5A 1USIA 4CKWB 3L09A 1KK2A 3SICE 2WYHA 4OIQF 1CDDA 2M9MA