2QYOA

Crystal structure of isoflavone o-methyltransferase homolog in complex with biochanin a and sah
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
INNRKPSEIFKAQALLYKNMYAFVDSMSLKWSIEMNIPNIIHNHGKPITLSNLVSILQIPSTKVDNVQRLMRYLAHNGFFEIITNQELENEEEAYALTVASELLVKGTELCLAPMVECVLDPTLSTSFHNLKKWVYEEDLTLFAVNLGCDLWEFLNKNPEYNTLYNDALASDSKMINLAMKDCNLVFEGLESIVDVGGGNGTTGKIICETFPKLTCVVFDRPKVVENLCGSNNLTYVGGDMFISVPKADAVLLKAVLHDWTDKDCIKILKKCKEAVTSDGKRGKVIVIDMVINEKKDENQLTQIKLLMNVTISCVNGKERNEEEWKKLFIEAGFQDYKISPFTGLMSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O-methyltransferase
publication title Crystal structures of Medicago truncatula isoflavone O-methyltransferase reveal conserved surface binding motifs critical for enzymatic activity
rcsb
source organism Medicago truncatula
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 2.1.1.46: Isoflavone 4'-O-methyltransferase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qyoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qyoA02
3GDHA 5CJ9A 2ZWAA 2DPUA 2A5YB 5HILA 5CD1A 4RAZA 3SVZA 5CVVA 5K05A 2FNAA 4DA4A 3KZZA 3PVCA 3I4PA 3C0KA 1R22A 3T0YA 4EJOA 2ONZA 4ENKA 4E2YA 5KQRA 5LR6A 4L9JA 4F7ZA 3QOPA 3F72A 4CXFA 1E2XA 3FUXA 5FQOA 3IWFA 1YW7A 2O6GE 5CVJA 1IY9A 3B7PA 3FUVA 1SD4A 4KDPA 5ILUA 2MLKA 2LKPA 3P8ZA 1JGSA 3KP6A 3FMRA 2JH8A 1X1CA 5G02A 1ODDA 2FBKA 4RGSA 3KU1A 4O29A 1D2CA 1SQFA 3RJPA 3GVAA 2BV6A 3L8DA 2QBYB 4GOLD 4ER6A 3C3YA 3FUWA 2PKWA 1U8RA 3SX0A 2WC2A 2ZNYA 3G5LA 1JG1A 3DOUA 3C18A 2GA1A 5IH3A 4KN4X 4RVGA 2O8XA 3EVDA 3Q87B 1F1ZA 5K0NA 5EOVA 2ELHA 1ZN2A 3P97A 1VBFA 3VFZA 3M1EA 2B25A 3UJ8A 1EH8A 3UA3A 3MQ0A 3CO7C 1P92A 1X1BA 2NYXA 4IWNA 3BPVA 5CVRA 4M6XA 1BI1A 3LDGA 2K02A 1AWCA 1D8KA 2RKHA 1WY7A 4WF2A 3UJDA 2JPCA 4M37A 5EMMA 4YV0A 4BP1A 3HSEA 1D2GA 4U7PB 4I0AA 2QBYA 3BGVA 5E1MA 1V4RA 2E5WA 2YR0A 3BWYA 2IT0A 3A26A 4M9XA 3SSMA 5HIIA 3KQQA 4P7GA 3WTWC 2RNJA 4CHUA 4QQKA 3I54A 5KVAA 4G6DA 4LWOA 1U5TB 4XLPF 3CJQA 3Q7EA 4FT8A 2Z6AA 3JWGA 4AIJA 3V8JA 1YW9A 5LQCA 2Z3YA 3RPUA 5FWDA 4X41A 1HSJA 2XYVA 2NRAC 4A2UA 1J9IA 5B1SA 2F5EA 4RWZA 4OIPF 2PQ8A 2DT5A 3M7GA 2VC1A 1VP9A 3WTSC 5EKXA 2KIFA 2H94A 3KEQA 5CVDA 2GAUA 2ZBPA 4M72A 1DDNA 2A6HF 1I1NA 1P1CA 1TQIA 2FOKA 2PBFA 2AN5A 5H6RA 3DXXA 4CYDA 4E2ZA 1JTEA 2G9WA 4O3MA 2ESNA 2I6GA 1RI1A 2DPMA 2CO5A 1ZYRF 3T8RA 2A07F 3K1MA 5DX1A 4G8XA 1R1UA 4BAYA 5FA5A 4ZYEA 2VP3A 5LQUA 2OAZA 4AWXB 5LLQA 4HSGA 2DTRA 1DUSA 1T39A 3KPJA 2AOTB 1R1TA 5D6EA 5M5BA 4HQEA 3CTAA 3WODF 4GBED 5TJJA 3RYPA 4R1HA 3WTUC 1H0MA 2QY6A 3BJ6A 1B4AA 1BJAA 4F84A 5EMJA 2B2CA 1FBNA 3FMQA 3V97A 3QOWA 4RSRA 3G7UA 4S04A 2AN3A 4FX4A 4Y2HA 1SD5A 2OU2A 4PINA 2ESRA 4UXNA 5CCXA 1I1SA 2UYHA 4YUXA 1YIOA 3G2MA 1USSA 2RGVA 1BI0A 1SG9A 3UJAA 2FK8A 1VE3A 3F6VA 5BXYA 2M8EA 1HW1A 3SZPA 3G5TA 3MAJA 3B5IA 3BGDA 1BC5A 2G8NA 4EMSA 3CC8A 2JJQA 2M87A 5GM1A 5FFZA 3JWIA 3LFKA 4KIFA 1RIOH 4PYQA 1IAWA 5HDNA 4L9VA 4M9SA 3IEIA 2L3DA 3E23A 4MQ4A 3U81A 2ZTHA 3MWMA 2VE9A 3FXRA 3K6RA 3CJRA 3HVIA 2G70A 5ERIA 4PCLA 2VS1A 2HS5A 2OO3A 3BPXA 4S05A 1WZNA 3FRIA 1YYVA 3VEPA 3GU3A 1XSXA 2L01A 1R58A 2VODA 4AZWA 3EMDA 4RTPA 2P3QA 4N0BA 4Q47A 4P7FA 4HGZA 2XAJA 6PAXA 3V8LA 1Z1DA 2NP6A 5T67A 2XUBA 4EGZA 2HDCA 1YFHA 3SSNA 2CKDA 4BXUA 3R0AA 3EGVA 3R6TA 1NW6A 3EVZA 1FBQA 1RJDA 1DPRA 2EV0A 3HTUA 1W7PD 5DM4A 2NNYA 3FPHA 4KMFA 3AAFA 3EEYA 3M33A 2IVMA 5CIYA 5K09A 4FR0A 3E6DA 4LWPA 2D1VA 2FBHA 3UJ6A 2BM8A 2P7IA 4AUKA 1HXDA 4GC9A 1QAQA 3A25A 3FXQA 1FBSA 3HM2A 3BGIA 2W24A 4KYWA 3LHDA 5JUWA 1J5YA 3HUGA 1M6YA 5FLXZ 2JH9A 5D5WB 2CSOA 2PWPA 2MA3A 2M1BA 5E1XA 2DQLA 3GLXA 5E9WA 4I98B 1HSTA 1J0RA 2P3LA 3DV8A 4XUDA 3T0IA 4RAYA 2KIMA 3FM5A 3R61A 1PP8F 1JQEA 1XCJA 3TLJA 5HS8A 4CGZA 10MHA 2UXXA 3OU7A 4RVFA 2CMHA 4DQ0A 2CWEA 5DCMB 3KLOA 5GP1A 3ULQB 1KQ9A 3X0DA 4U88A 3E5QA 3VODA 5DV5A 4I0BA 3HCCA 3LCCA 5L3GA 1W7PB 1QPMA 1FSHA 3LECA 3R4KA 5DM0A 3JSPA 5DSTA 4BP3A 2CGPA 1L3IA 2A61A 1XSDA 5L3CA 3F8CA 3HTSB 2G7UA 4YUZA 2E1CA 1RJEA 1LDJA 2RVCA 2HZTA 4HX8A 3HVJA 3RODA 5DX8A 3PFGA 2H6BA 3ELKA 5FD6A 1IXRC 2ISYA 4G7HF 2DBBA 2BZGA 4HC4A 1YZHA 4MIKA 2VXZA 4DQ2A 3IRRA 3N97A 4GQBA 2XVCA 4PIMA 5E17F 2DW4A 2K4JA 3HCBA 2V1XA 3HSFA 3H2BA 2WWYA 1TQMA 3KR2A 2PEXA 3HA7A 1W7PA 4P5OA 4ATNA 3CJNA 2AOXA 4CWAA 3KETA 4PGGA 2OZVA 1ZH5A 4PDKA 4OIQF 3GNLA 4MTLA 2XRNA 4BHPA 4UVCA 4HYEA 1IN6A 4IF4A 1ZGAA 5E8GA 3C1DA 1RI5A 1IXKA 4XLNF 4RV9A 3IHTA 4LG0A 4RTOA 3CDHA 1G8AA 4KUMA 2IBSA 3EVEA 1MJ9A 3G73A 2YTZA 2AR0A 2FPOA 3HCDA 3BUSA 3GFJA 1OR8A 3K1NA 4M74A 2IA2A 2Q8KA 3NDJA 4RGUA 1KA8A 1RI2A 2QENA 3ZMZA 5E18F 2QQBA 4GO1A 2YVLA 3EYYA 4OQEA 1IF1A 4YUYA 1L3BA 1QQIA 2HTJA 5EPEA 1O3SA 3HA3A 5FD5A 2XASA 2GXGA 5E1ZB 5ILVA 4DMGA 3KHKA 3DKWA 5CVIA 4HDUA 4G94A 3V8VA 1HKQA 3IKTA 2Z5UA 4OMYA 3GRZA 2PT6A 3I9FA 2GLUA 3U9GA 2HGCA 5FWAA 4PZJA 4E30A 2HWVA 4Z2YA 1PUEE 4QPPA 5D6FA 3GRUA 3G8AA 4E2XA 1I9GA 1DCTA 4ZZDA 2RN7A 5CUQA 2YU3A 8MHTA 4IXAA 4RB2C 3FX3A 4YUWA 2XBMA 2XAHA 3FYCA 4LG1A 2ZIGA 3GO4A 4LJZF 4MQVA 1FLIA 1NBHA 1S29A 2QE6A 5GIPE 3PS9A 5LHHA 4CKCA 2IH5A 1MHTA 3B02A 1F38A 2KRFA 3RI4A 2YUIA 5H20A 2M5WA 2UYCA 4EKIA 4AIHA 2K4MA 1EH7A 1PDNC 4CO8A 1WXWA 1BOAA 5L3BA 3ELWA 1JXSA 5FA8A 2P1DA 2ZW9A 3DH0A 2DPDA 5DWQA 3THSA 4BY9E 4HLXA 1Y8CA 2GXBA 1Z6RA 2FHPA 3BWBA 4P58A 4NHJA 4GOOD 2BR4A 1IN8A 2VT3A 2K27A 4IPAA 5EHIA 5P8WA 1R18A 3QU6A 1MDMA 4P55A 3DXYA 5E8RA 1ZLJA 4QLCU 3V7SA 1RUOA 2ADMA 4CXMA 5CCBA 1XD7A 1HW2A 1XJ5A 1WI9A 4OA8A 2JHPA 1NV8A 3GRYA 3MTIA 2P5KA 5HFJA 2IRFG 2Y1XA 2PJPA 4OU0A 3CO6C 3R0JA 3KP5A 4BQAA 2GPYA 3WTZA 5JFRA 3BKWA 2CFXA 2MBFA 3F22A 3GEZA 4L0YB 1R5GA 2G7HA 3F6OA 3M6WA 3PFHA 5E2BA 3PLAE 2FA5A 4EM2A 5DTRA 3PQJA 2MLGA 2ZBRA 3RDIA 3K69A 1F5TA 4E2WA 5HDKA 3GYHX 4L5JA 4YFXF 1RUNA 3GCZA 1JSZA 2ZFWA 3M6VA 1IRFA 5CVEA 3I71A 5KYGA 4UV8A 4MEXF 3NVKI 1FZPB 2XIGA 1KXZA 2FYTA 3FTFA 1RZ4A 1BI2A 4I7HA 3KP7A 3F21A 4QTTB 4HZFA 2G72A 2EV6A 3BP8A 3FM3A 1RI3A 4M38A 4OOIA 5D5UB 1YF3A 2HYGD 1ORIA 2Z9OA 5JI6A 3IC7A 2GQQA 3HP7A 1NV9A 3OU6A 3LQQA 3WU0A 5HS9A 5L3FA 4HGYA 3ABTA 4U7TB 3J81Z 2IP2A 5HVQC 7MHTA 3I59B 4EKGA 2X0LA 3OZSA 3ABUA 5A2QZ 4DM3A 4EK9A 4Y13A 1A04A 3MZHA 3DXJF 2OKCA 2P6TA 2PLWA 3DFGA 2OQRA 3GO5A 3ANXA 1CF7B 3KE2A 2ZZMA 3G8BA 3K0BA 1I6XA 2GWRA 1ZRDA 2P7VB 2XKOA 5ED4A 4YG2F 3ZMDA 2GH1A 2NXJA 2EFQA 2FNPA 2TDXA 3M9AA 3E5UA 2G71A 1OYWA 1KU2A 4LB5A 2PT9A 4UHTA 4PCAA 1Y0UA 4IJAA 4KRGA 5HEKA 3MTEA 4RTLA 4QVGA 3FZGA 3LA7A 1R5HA 2QQAA 5BP7A 4E70A 3LQRA 1T2KA 2Y75A 3V7RA 2EJUA 3TKYA 1QYRA 2PV0A 4R8HA 9MHTA 2OD5A 1FP2A 2FRXA 1FYLA 3BDDA 1G38A 3PX3A 2HFHA 3FHZA 1NKVA 2QLZA 1TW3A 4RB1A 4PYMA 2FRHA 4KIBA 3B73A 3BJAA 1XVAA 1EV7A 3HOSA 2UYQA 2C7OA 5DX0A 5FULA 5DTQA 2P8JA 3R9XB 5EQJB 3GRRA 5IT3A 2QYOA 4PYNA 1Z3CA 3DXZA 3BZBA 4AD9A 1B6AA 2MD5A 2E7XA 1K78B 4M71A 3EVFA 1YUBA 2PX2A 3MZYA 2IH2A 2HV9A 4M6YA 5HLGA 3KQOA 4UV9A 4A5MA 4FS8A 3TMAA 4LFUA 4RX1A 3M8EA 1V3FA 3CUQC 3P9KA 3GGDA 2JZYA 1KU9A 2DI3A 5HIJA 4DCGA 3J80K 1STZA 4N9IA 1SUIA 3L00A 4RS8A 4RB3C 1YO5C 2ZZKA 2AXLA 2YSRA 3LSTA 3UBTA 2A68F 4I2OA 4BYYA 3RW9A 1O3QA 5K0EA 1Z6TA 3HRMA 1R00A 3AWIA 1MD0A 4WK8F 5BW4A 5D5VB 1LNWA 2CQKA 2A6EF 1G6Q1 3EGIA 1ZARA 1Z91A 3FYDA 1B42A 4P96A 4GF5A 3KQYA 1N2XA 2YX1A 4CKBA 3WTTC 3EPPA 2XHKA 1L3CA 5A2QK 2N47A 5DCFA 3WTXC 3PB3A 3MAGA 2E7WA 4ER0A 3M4XA 2OA4A 1O3RA 5K0GA 4RTKA 4O6JA 4MTEA 1UFMA 3KQTA 4HOBA 2H11A 2P40A 1ZHFA 4HTFB 4C03A 2IH4A 4HA8A 4RTJA 3WG9A 2HTSA 4EGYA 2GA9A 2DFIA 3FUTA 1U5TA 1Q1HA 4H0NA 5LRSA 3C3WA 2M45A 1XGOA 4XSXF 1Q0SA 3FUUA 3OFKA 4UOEA 5E9JA 4WVLA 1RI7A 3BOQA 3FWEA 1L3LA 4XBFA 3O3KA 4U7DA 2HMYB 3OE4A 4C08A 3TKAA 1TTYA 3ID6C 4LLLA 3CJTA 1IXSB 3VC1A 4C05A 3JWJA 5IKMA 4FT2A 3BWCA 3WE3A 3R6SA 5ICEA 3IYLW 2PLYA 2L4AA 1KU3A 2R7FA 2ZBQA 1O57A 4ESBA 2PI0A 1G3TA 1INLA 3E6BA 1BKYA 1H1DA 1MJFA 1SFEA 3ME5A 2WV0A 4EJTA 3EETA 1Z05A 2H27A 3ELYA 4HH4A 3SZTA 3LCUA 4YV1A 2CYYA 1I1GA 5EIFA 3ECHA 1LJ9A 3BJOA 1G3WA 3JAMZ 3HOTA 1KPIA 4R6XA 3O4FA 3N4MA 4C06A 1YLFA 3F4KA 1VTNC 2AOTA 4HBLA 1IM8A 1ZRCA 1EG2A 1HBXG 3M6XA 1R6AA 3MCZA 1BIAA 3G88A 5LGNA 5K5OA 3TO6A 4U7BA 3EVAA 4WX9A 1K7AA 2WTEA 4C04A 3OE5A 3IKVA 3P2EA 3HEMA 1HW5A 3CKKA 4FHTA 4HV5A 3S2WA 5HOQA 1MGTA 1IN7A 1M6EX 1L1EA 1BM9A 2W85A 3LA2A 1J75A 4BNCA 2QUFA 3P9IA 5AIQA 2AVDA 3K1PA 1BC8C 3V7CA 4ER3A 4G6QA 1DUXC 1TQPA 4D0PA 3FPJA 5EZQA 4A0XA 3A7DA 5FHQA 1JE8A 4OIOF 1SQGA 1CGPA 1ZG3A 4QVKA 2PJDA 3NDIA 4GOMD 2EFNA 2ZWVA 2P35A 5ILSA 1MJAA 3ZN1A 3I5UA 3UJCA 3V8KA 1KGSA 4K2EA 3BKXA 2IJLA 3O31A 4PIPA 2EJRA 1KU7A 4FSDA 3UA4A 4POOA 1U6GA 1XGSA 3GX4X 3DP7A 5K0JA 5AIPA 3QU3A 1REPC 3ZMVA 2FBIA 3LX6A 2VDVE 1L0OC 3Q5FA 3G3ZA 1UCRA 3OV8A 5KK1A 3QP5A 4XUEA 4KW7A 3DPLC 1WKMA 1IUYA 3NW9A 3LWFA 2DK5A 4CTJA 2VT2A 1VIDA 1JG2A 3ERCA 3E97A 2Q41A 2QZ8A 3FPFA 4U0VA 2B0LA 3G2PA 1H9GA 3KR0A 2FMYA 2LDUA 3I64A 1D5VA 2ONYA 4Y30A 4I02A 2UZKA 1G3YA 2YXDA 1OPCA 2IA1A 3RTRA 2A3SA 5EG5A 1B9NA 1WRJA 3BZ6A 5FFXA 2HNKA 3MB5A 4ZYHA 3FRHA 4HF2A 4FP9A 2OQGA 3EYIA 1WXXA 1KHHA 1BN5A 1YTYA 3GWZA 2PXAA 2VDUE 1NW8A 3TOAA 1D2HA 2XVAA 4HF0A 3P2KA 3KFWX 1FYKA 1SKMA 5KS2A 2FXAA 2NXNA 4NB5A 2I9KA 5LQJA 2ZMEB 3HYIA 5J6XA 1FSEA 2XAGA 4KICA 5DCMA 4KT5C 4Y17A 4FZVA 3G89A 3WU1B 2IDKA 4MEYF 1R8YA 3I0TA 4EVIA 1FNNA 1YS6A 5GIOE 2ESHA 3HSRA 2IPXA 3TOSA 4C07A 4RGRA 3HNRA 3GRVA 1Z9CA 2R3SA 3EEOA 2OB2A 1O9GA 3ZN0A 5DPMA 5DDGA 5DRTA 3T5XA 1EJ0A 2JHAA 4G56A 4PYLA 2CL5A 1DP7P 1PJZA 4HV6A 2IGTA 3HVHA 3CGGA 1JQ3A 2NXCA 1RJGA 5D4RA 2OXTA 3PX2A 1R36A 2IBTA 2ACJA 4CKEA 5K8VA 5LGTA 5HIMA 2D1HA 3LL7A 4GOND 1P6RA 2JSCA 4IKPA 4IV8A 1YQAA 5CLSA 3KQMA 5FO5A 2CWWA 3RYRA 2BM9A 3LAPA 4EM0B 1VLMA 3TGNA 3B3FA 5FLXK 1W4MA 5K0FA 4GUAA 2EWNA 4JQFA 5K5RA 3A27A 3A4TA 2FU4A 3OCJA 2EB7A 1S3JA 3DLIA 4KVZA 2QM3A 1AF7A 1JHHA 1T6SA 3LBFA 4Y15A 3IHUA 1XDSA 2VBZA 4ISCA 3LDUA 4DF3A 1IN5A 2Q0OA 3CLOA 3E6MA 1JQDA 1I4WA 1Z7UA 2V6CA 3KPUA 1P4AA 5LQKA 1G6NA 1K79A 1NT2A 1XDUA 3U1DA 2V1DA 4QWQA 4GXOA 5DM1A 5GM2A 4F86A 4ZYGA 3W6KB 1YB2A 3PT9A 2XYRA 3ZMSA 1D8JA 5J8CA 1DPUA 1N7IA 4AX8A 3WSTA 4PYOA 5LQRA 3AJDA 3H92A 3NVMB 1QZYA 2ETHA 3TR6A 2P8TA 3K9TA 1UIRA 1XSVA 3NWBA 1KP9A 4KN7X 5AONA 3TM4A 3ELUA 2P5VA 1O9HA 2F2EA 1GXQA 5ERGB 4EM1A 2CMGA 3SR4A 3BT7A 5HDGA 1ZG5A 2O07A 2HR1A 3F8NA 2PVCA 1XTPA 3U2RA 2JT1A 3SGLA 3ZQ7A 1B9MA 1SVUA 4R6WA 5D5XB 5HLIA 5F2NA 3EGEA 2XKPA 1AOYA 2B9EA 4HX4A 1G8SA 2QVOA 4LECA 1QAOA 4MQ9F 4XSZF 1S6LA 1KQ0A 2MH9A 1LQ1A 1QANA 3FPEA 1G3SA 4KDCA 4AZSA 3P9CA 2DULA 3DQVC 2F5CA 2LSOA 1JG4A 2PXXA 2HKXA 4QQNA 3F8BA 3R3HA 1BI3A 1W5SA 2OZ6A 3CBGA 1ONVA 1SUSA 1WWXA 2C6YA 1FWZA 3RIEA 1U2WA 1UHWA 5JHUA 2ORED 3KR9A 3Q9VA 4DNCA 1YW8A 2EA2A 2GB4A 3QRFF 2DK8A 5DXJA 4M73A 5K03A 2EFPA 2W84A 2NS0A 4QTUB 3KPWA 1LB2A 4GC5A 4RB0A 3MFKA 4UUVA 2UZ4A 5KVRA 3SQNA 1P2FA 1FYMA 4WXCA 5K0CA 2AVNA 2NYUA 5DTMA 2OYRA 2K4BA 2EJTA 3SXYA 1ZRFA 2Y1WA 3MGGA 3NTVA 3OOPA 3K2ZA 3IL2A 3VOEA 3NEUA 2ZULA 4U0WA 4DKJA 4IHSA 4PNEA 2P41A 5IT9Z 2ISZA 2D45A 4UVAA 4RTQA 1NW3A 4BLVA 5J8FA 4ENJA 2QWWA 1FP1D 1RJFA 5FTWA 4X63A 4ENMA 3QV2A 5GOZA 1O3TA 1E17A 4EJVA 4NECA 3HIFA 4Q48A 4ESJA 1UHMA 1GXPA 1FJXA 3ROUA 1LEAA 1QBJA 1USTA 4YIIA 2IFTA 5JVTA 1KIAA 2PSSA 2QRVB 3WE2A 4P9FA 5F6FA 2IDJA 3P71T 3OU2A 1T38A 4GEKA 4ETSA 2Z6UA 4RGXA 2R7DA 1ZKDA 1R8XA 4HQMA 4ESFA 2VBXA 3KR1A 4YFKF 5EMLA 3L7WA 4ENNA 2V1UA 4MWZA 4BLUA 4JK1X 3T7RA 3TQSA 1QAMA 4KIGA 1D3YA 4MTDA 1AQIA 1FPQA 2UWMA 3DEUA 3RIRA 3EVBA 4GYIA 3VB2A 1QNTA 2B78A 3DR5A 1KYZA 3RPQA 5D8KB 1XCVA 3BWGA 3GZ5A 1C0WA 5H02A 2P5LC 1SD7A 5E8JA 2KJBA 1FBUA 5LBQA 3MEXA 4LK1F 4E33A 3KLNA 1SMYF 2VBWA 1KYWA 3I59A 2QRVA 1PRYA 2EX4A 3P7NA 5K1YA 1J2XA 2DQRA 1BIBA 3E05A 2PMHA 1F3LA 2G1PA 2VOOA 1CF7A 1HMYA 3PQKA 1JTFA 2A69F 4HDVA 3UZUA 3QPHA 4FX0A 3S68A 3GF2A 3TM5A 3L9FA 5HIKA 3KP3A 2W25A 2M30A 1LVAA 2DAOA 4RTRA 3B3JA 3UWPA 3L2CA 3JTGA 4KMUX 5K0BA 2HKOA 5BPIA 5HS7A 1ULYA 1YG2A 2P7CB 2YX4A 3UJBA 1J7KA 1TW2A 4QPNA 1OMIA 2UYOA 2Z33A 1F4KA 5K0LA 3EDPA 3GZ6A 4EQZA 2H6CA 2PGXA 3JWHA 3BWMA 5EMKA 3UJ9A 3TQNA 5DT2A 4IVNA 1IRGA 3HRUA 5E1WA 2WK1A 3C6KA 5IT9K 2DLLA 3AXSA 3JSOA 4Q4ZF 4E32A 3ELDA 2DU9A 4HF1A 4XUCA 3SHFA 3GFLA 1ON2A 3NQOA 5FB2A 4XCXA 3P9NA 4KA4A 3HCEA 3FMSA 3WGIA 2PY6A 5GWXA 2J5PA 2JPBA 1ZG1A 3DLCA 2KW5A 1BBYA 1NBIA 4G7OF 3J81K 4IV0A 2B3TA 1KR5A 1K78A 5CVUA 3ZPLA 4JXJA 2RC4A 4LLNA 2JRTA 2Y0MA 3COAC 3D2LA 5C9ZA 3LAJA 1AV6A 4GCVA 4R8SA 4BH9A 4Q5SF 2AN4A 2HR3A 1T43A 3ISPA 1S7OA 1I27A 4ZH4F 2OBFA 3DMHA 3TFWA 1X3UA 3F8FA 1L9KA 1GVJA 3EQLF 2ZO4A 5E1BA 4RTSA 4OBWA 1MKMA 1FY7A 1XGNA 5D8LB 1G60A 5BOXA 2QQ9A 2AOUB 1P39A 1AQJA 1V39A 1JSXA 2P3OA 1NW7A 2X4HA 3GJYA 2P4WA 4I09A 3MCTA 4A6EA 3EVGA 1W5TA 4XRFA 2IPQX 4AIKA 4F85A 4RTMA 1S8NA 2COMA 2ZZNA 3CUOA 3C3PA 2AZTA 3FZVA 3GFMA 2AS5F 4HAMA 1N7JA 1TPYA 5BMZA 4EJUA 3WGGA 3VSEA 2JTVA 1XCBA 2HTEA 1BC7C 2BYVE 2PWYA 2L54A 2FQ3A 2XROA 3E8SA 3ZP5A 4HLYA 2FF4A 4KDRA 2GAFA 1YS7A 3AXTA 5DYMA 2H00A 1SFXA 3IWZA 2VE8A 3QPTA 4MHGA 2AOUA 4GGGA 1SMTA 5ICCA 2V74B 3TDZC 3KPYA 2BEOA 3SXJA 2F8LA 4HG2A 2YQZA 4HTFA 5DRYA 2FEZA 2Q2EA 4RTNA 1O7LA 3KEOA 3KQVA 4DZRA 3V4GA 2Z6QA 4PYKA 4FT4A 4PYIA 1T98A 3AY0A 5F2OA 2DO7A 2RV8A 5L3EA 1OYIA 3GXOA 1FC3A 4RYLA 2NXEA 3D5LA 1S7AA 2HQNA 4A12A 4RVHA 1G55A 4M9ZA 1R23A 2KJCA 2UXNA 3DMGA 1XGMA 3LKDA 2V79A 1XMKA 3HHGA 3SFZA 1NHAA 4M36A 1SD6A 2AOWA 3LA3A 4BHCA 4G7ZF 3DULA 2H09A 1BOOA 1I5ZA 4QDJA 1R1VA 5EEHA 2ZFUA 3LGAA 2OB1A 2PX8A 2GIVA 2XAFA 2STWA 1HQCA 3ZMUA 2A14A 5FADA 1SAXA 3F3XA 4BLWA 3G2QA 5DEQA 2PXCA 4AVPA 1XB4A 4BHBA 3EVCA 4PWYA 5DXAA 3GUDA 3H3UA 3B3GA 2C7RA 3FTDA 1Q0TA 2BH2A 1IXCA 3TO7A 1WS6A 2VONA 3NRVA 3EMBA 5DD8A 1O54A 5D1NA 5F64A 1OKRA 3TDUC 3WGHA 3DPTA 4EJWA 1NW5A 1LDDA 2WA2A 4M7RA 3SMQA 5DUKA 2NNNA 1KPGA 1QO0D 2XV4S 3ER8A 1HKTA 3T7SA 4ON0A 4L5IA 1SFUA 1B59A 5HLHA 2HYFA 3I53A 5E2AA 2GA2A 4A5NA 3TOBA 1UB9A 2LNBA 4ZZLA 2FCAA 2O05A 3Q9SA 2V9VA 3LCVB 3D0SA 2C7QA 3UJ7A 2IIPA 3PTAA 4PCQA 4KFCA 2AOVA 2PMUA 1KQ8A 4JBAA 4E31A 5F1RA 2XVMA 2J5OA 4X1OA 1IN4A 4CDGA 1EH6A 1R74A 5E20A 2EV5A 5HOOA 4V0QA 1LDKB 2FSWA 4IRIA 4AZTA 4CTKA 4MGRA 3IV6A 3M70A 3F8MA 1ZREA 5U4XA 2O61A 3KP2A 5BPDA 4YFNF 4L0ZB 2XGXA 1KPHA 2BR5A 3O7WA 2XYQA 2PX5A 4EV0A 2FE3A 1WQ2A 2YPRA 1YFLA 4CZZA 3A7EA 3KZYA 4IRHA 4UVBA 1XXLA 5F2KA 3ERED 2HWKA 4HX7A 4X61A 4FGZA 1JR4A 1WSUA 5H6QA 5FUBA 2P6SA 3I58A 1X1DA 5FHRA 3RKXA 4A0ZA 3R60A 2ADUA 3MQ2A 2LD4A 2EK5A 1ON1A 3JAMK 1QZZA 5BQTA 5L3DA 2OPBA 2XAQA 5EIWA 5TRDA 2JG3A 3HRSA 3THRA 2VZ9A 1EQAA 2MH2A 5E1DA 4FSXA 2VOPA 3PFIA 4UNOA 2GS9A 3O6BB 4EQQA 4LG0B 3W6JB 4B09A 2F5FA 4ZTBA 4P7KA 1P1BA 2LF8A 1GHCA 1FT9A 3UFBA 2VN2A 2GZWA 1EIZA 4LD5A 2RQPA 3QAHA 1UWVA 1G4DA 1B1BA 4L9NA 4OA5A 2IA0A 3L09A 3R0QA 5C1IA 3OPNA 2FK7A 1P4XA 3C7JA 2VDWA 3KQSA 3CVOA 3FPGA 4KWCA 2PFBA 5ICGA 2I62A 2ZBKA 3SSOA 4PONA 2ZMEA 5D4SA 1K6OA 4PGHA 2HQRA 3FXUA 4CICA 3DTNA 1FX7A 4R8RA 1YZ3A 3REOA 5LEJA 2ZVJA 5DSXA 1P4WA 3GW2A 3KCCA 4TV7A 4LGWA 5LQNA 3LPMA 5LSAA 5E8IA 5HZMA 2ERCA 1TLHB 5FQNA 5EHGA 2FMLA 4IRGA 3CUQB 1JG3A 4OBXA 4X60A 2O57A 3DF8A 1U5TC 3WTYC 3LKZA 3M6UA 5MHTA 1X1AA 4OINF 4MNUA 1U78A 3QP6A 1HNNA 1PP7U 3OZRA 2O03A 2W57A 3C6MA 3HVKA 5EC8A 2WA1A 1BHJA 2P7HA 4U0YA 4ASNA 5LHIA 3HCAA 3TPZA 4OX9Y 3VC2A 1OR7A 2CW0F 2ZCWA 4L9TA 2L4MA 2OBPA 3H3ZA 1H9TA 5BW5A 2NAZA 3HA5A 2O0YA 3E5XA 1EJ6A 1U3EM 3ER9A 2LF7A 1UFKA 4LLGF 5LEKA 2BR3A 4YMGA 2C7PA 4GYGA 2O3FA 3B89A 4YUVA 3KP4A 1FOKA 3WTVC 1WG8A 2ZNZA 5EGSA 5EZSA 2ZKZA 3KPVA 3DMFA 1XDZA 2PBIA 3CUQA 5CYVA 1QGPA 3J7AO 3LDFA 2HEOA 2NNWB 5DLYA 2V7EA 3LBYA 4R79A 4H0EA 2PN6A 4OMZA 3HTXA 5C0OE 3TO9A 1DL5A 2ZSUA 5FCDA 4LK0F 4QDKA 2IW5A 4YIFA 1VPTA 1XMAA 4LMYA 5K5QA 1EAMA 3KQWA 1IZ1A 3TRKA 1MZBA 5BS6A 2O06A 2STTA 4C4AA 4P9UA 1MDMB 4B8XA 3EUHA 3MHTA 3M8FA 3GIWA 4L18B 4RVDA 5JR3A 2KIUA 2BE5F 4ER7A 3GFIA 5DD4A 2YR2A 2BBYA 3T7TA 3RKYA 2L02A 4NQWA 2OY0A 3E3VA 5GINE 5EVJA 4HRAA 2K86A 3RKWA 2F5DA 1VQ1A 2EA4A 2YXEA 2ZJ2A 4YV2A 3KQPA 5LGUA 1ZAOA 2MC3A 4AZVA 4I01A 2JHCA 4WXDA 4PYJA 2Y48A 3DUWA 1NE2A 2EG5A 3MERA 3HHHA 1IW7F 4HW0A 5E9QA 1ZLKA 2ZXJA 4OIRF 5D1HA 5LHGA 4L7VA 2I7CA 3ZMTA 4YMHA 1M0EA 4LB6B 2ZCJA 4B17A 2Z99A 2O0LA 5LQAA 3T1BA 4WWCA 1XN7A 1J59A 2EFOA 3T8TA 2E1NA 5FGMA 3O2PE 1TNSA 4A0YA 4WCGA 3IRQA 2KKOA 4G9YA 1XCLA 5CM2Z 4N9HA 4OQDA 2OZUA 2RDPA 5DUIA 3OZTA 2YX7A 1ZQ9A 3BXOA 2HOEA 3HCFA 3NJRA 3SM3A 3FF5A 1ORHA 3ECOA 4KNYA 5EKUA 2ZIFA 3OFJA 1RI4A 2EFJA 1MJBA 3BY6A 4ER5A 3ORHA 1T0FA 3F23A 3KKZA 2VBYA 4IHTA 1U2ZA 3JW4A 3NWEA 4ZYDA 2ZLBA 1F9NA 1R7JA 3QOXA 2H1RA 1OYYA 1O7FA 4MHTA 1P91A 4K6MA 3K0LA 2BGCA 3VYWA 3J80Z 3ML6A 1LEBA 4P7JA 1TNTA 2VC0A 5LRRA 1VL5A 1JHFA 3CCFA 2PG4A 2PX4A 5EEGA 5DM2A 3E7PA 1YFJA 3JTHA 3R24A 1X19A 3HRTA 4V0RA 2D2WA 1ZGJA 3FTCA 5T64A 3G2OA 3FTEA 5ICFA 1HKSA 2ZIEA 3NMUF 2EFWA 4A6DA 4WXHA 5E1OA 3P2IA 1VP3A 2YXLA 3BROA 3E6CC 2R6ZA 5T6BA 2K7LA 4DCMA 1TBXA 2AS0A 5K01A 2NP7A 1RNLA 5KQSA 2CG4A 4R05A 4O5VA
chains in the Genus database with same CATH superfamily
3E8MA 5KYWB 2UZAA 1MAVA 1J39A 4GR9A 1P4HA 1IJEA 4IG4A 4JR1A 1GPBA 3AR4A 2Y76A 2CJJA 1Q0RA 2OC6A 2GD2A 2ZRKA 3UXYA 5ADHA 5J9FA 4RH1A 1MTOA 3F72A 3OT5A 1Q7BA 3ND9A 2I6SA 1TC3C 2PRZA 2QP3A 2O52A 5K6AA 5IYZF 2BP7A 1CVLA 2QUZA 3KU1A 1SQFA 3GVAA 2BV6A 4RA6B 3M7IA 2JAWA 4A3FJ 1JAHA 3LX5A 3J7TA 4Q12A 5I3ZA 1J22A 2WSMA 1H3NA 5A4IS 3RKSA 4IIBA 2G1KA 2E19A 1W29A 3M1EA 1YJQA 3OIVA 2XUHA 1KMMA 4PY2A 1X1BA 2C5BA 3BJEA 3S1NJ 2FUCA 4MXDA 4K9PA 5DEIA 5IABA 3NH6A 7REQB 5CLHA 3KAKA 3OZGA 4LF9B 3D7KA 2C8JA 2GYUA 1A98A 3PUYA 1FFCA 2AX3A 5CXQA 3PL1A 3I54A 1T9GS 3A0HC 5IJ9A 4IDNA 2PIAA 1L4BA 5BURA 1YGPA 1HSJA 1DKLA 1G7TA 3EF3A 1QWOA 4LMAA 3UCFA 3BXPA 1NP6A 2VC1A 5IU6A 1NQTA 1DARA 2L7KA 4M72A 1I1NA 1UMDB 5LC1A 1MEJA 2QW1A 3QPDA 3HPRA 3AUXA 3NIFB 1ZYRF 3TQQA 3ZGOA 3RZOJ 3WL7A 3KYJB 5BOSB 4FMDF 4ZYEA 2NV2B 1OLTA 2RGNC 2VP6A 4JEUA 1T39A 3AETB 5DGCA 4PQRA 1X58A 1YFKA 2QD5A 4MRAA 2AN3A 1A3CA 4GR5A 3CH6A 3DKYA 3WKDA 3G2MA 2Q46A 3UJAA 3HPHA 5BXYA 2XVYA 3UN1A 3B5IA 2DQ4A 2HUNA 5F9FA 4CCYA 2PKEA 4I14A 4JMLA 1LF5A 1LFPA 5JAUA 2L3DA 4MQ4A 1S89A 4R0NA 2VE9A 1A8SA 1J20A 2DGDA 4J1QA 4I4LA 4ZQFA 2HS5A 1U8BA 3VEPA 2CMDA 5E6SB 3E0QA 4P7FA 4XWAA 3B6MA 2EVWX 5AKXA 4B74A 5CDFA 4AN0A 4ZZ2A 3HLTA 4FUQA 2CKDA 1SURA 2IXAA 4QGBA 13PKA 3U37A 4KKVA 4Z0HO 1Q1GA 4QYIA 3ENVA 2XUAA 5EIAA 1XAHA 5C18A 2WYUA 3GPDG 3AEQA 3W77A 1LDYA 2P4EA 1C7QA 5AHRA 2BD0A 4YQEA 3ZH9B 4F97A 1XR3A 1PWHA 4PBTA 2RGUA 4Q4CA 3OPXA 1E99A 3GLHA 4QPDA 4J75A 3T0IA 1O03A 4XR6A 4PZ9A 4BEWA 3WLAA 3CRNA 2FZLA 1KJJA 4KLNA 1Q7RA 3HYSA 1P7IA 2VYND 5F08A 1CQXA 4ECEA 3QKIA 1NLMA 2O6HA 4OK3A 4DRZA 1XHEA 4FR5A 1I7SB 1SPBS 4GBJA 3D7NA 1T0UA 1E98A 4F3QA 3QKRA 2R8PA 4UEQA 1SD2A 4AU1A 4K5QA 4IICA 3H11A 5I5EA 3ELKA 3EXIA 3DE7X 3ZUPA 4JQYA 2RE8A 4YBRA 1VI0A 4UMVA 5LQSA 4AMYA 2FWPA 3DZBA 4FX2A 4DM4A 3CIFA 2WMYA 1U99A 2AYXA 3HA7A 3TKLA 1RIIA 1H2AS 3CRVA 3IILA 2OZVA 3L8ZA 1SUCA 2JC3A 1RI5A 2VKDA 1PQWA 1YVEI 4KVAA 4P1WA 3RYHB 4P3NA 3K1NA 4MZDA 3V1TC 1GAEO 3BZKA 4GO1A 5J3JA 1H6DA 1NLZA 4UBNA 2W8BA 3HV2A 2QLBA 5HIAA 1UJCA 4JP2A 4PV7A 1A5TA 3I2YX 1AKRA 4IOJA 5JD6A 3NDPA 2Z5UA 4KQIA 3I9FA 3U3MA 2ZJ3A 2B30A 4R0MA 2EW2A 1JKIA 2WU8A 1KO7A 4ZOLA 1PL0A 3GP8A 2JA1A 4IOKA 3RH0A 1Z33A 2VTBB 1FDIA 4YUWA 2FKNA 1D1TA 6NULA 2XCRB 3D7MA 1XX5A 4GI3A 3VPGA 2JEYA 5P21A 5REQB 4HDSA 3PGA1 1MBKA 1J2UA 4X9XA 1M2FA 4QG7A 2CHUA 2GVNA 4ZJYA 5JNTA 3DH0A 5KNBH 1FX0A 1Z6RA 4C7OB 1PR6A 2YJ6A 1CERA 5A9SB 4QTYA 2PR2A 2OM2A 1XD7A 1XJ5A 2CV0A 2RDMA 1IOWA 4D98A 1QIJA 3STXA 1FYDA 2IRFG 2Y1XA 2X48A 3EN0A 4BQAA 5B66C 4LE0A 4CYCB 5TQVA 3EDCA 4KDEA 3HB5X 3HC7A 1NVTA 2FA5A 2ECQA 4IXDA 1RESA 1Y8QA 1DAOA 2GM5A 3GMIA 3Q0VA 2XEDA 3UW3A 3P52A 4DCNA 4IIDA 1YJ5A 2RGEA 3JZFA 5F1OA 5CFOA 1QKJA 3VO2A 4KFSA 3BVPA 4DYHA 3ZR8X 4LRTB 4BC0A 1U02A 3HJAA 4AJ9A 2ILVA 5EWLB 2NU9B 7MHTA 4G4SP 2B8TA 3U44B 1AM4D 1FXWF 3PFYA 4IGKA 4KXVA 1PYGA 3N8HA 4NDLA 3GT7A 4EJFA 5CM9C 4BZQA 2XKOA 3KUUA 3HV0A 4F5ZA 2GH1A 1NYTA 3I4LA 4EUKA 2BKAA 1V37A 3ABZA 2W71A 3LV8A 1R6UA 3P0EA 4J0GA 1H3EA 1EFAA 1FNBA 1ZC3A 2F64A 4JP0A 1CRQA 4E70A 3LQRA 1L5KA 3QLTA 2NVQJ 2XUPA 3WLRA 2R9VA 1YS9A 3CLUC 4MWGA 5EG0A 2ORIA 4QPZA 4S1PA 3KSUA 1RZ3A 4XPZA 3EXEB 5EFOA 2P8JA 1IBMB 3REQB 3H0CA 4R9VA 2R2GA 1P8JA 4HRIA 2QL5A 5TC4A 2FEXA 5LZ2A 3V80A 1EBFA 1GU1A 1ZLYA 4KPUA 2CMPA 1RADA 3KLPX 4WNIA 3WK5A 4UDOA 4EUHA 4N7JA 1EFVA 3QKWA 1H0KA 2OWEA 1SUIA 1XCOA 1CB0A 3NASA 16PKA 4F3RA 2MYTA 3HRMA 2XRFA 4YXWD 3KEMA 2VHWA 2BY3A 3ILYA 2Q5CA 4JVSB 4AUEA 3KSDO 2YOFA 3H5WA 4OV6B 4K6CA 4LJ4A 1BQ3A 5DNWA 3WKEA 2O0JA 4M87A 1ORRA 1OAOA 3CF0A 4K86A 3BF8A 4UHHA 3TG2A 3RRFA 4N0EA 2MT9A 2X1MA 2WD9A 1RE1A 1FU7A 3MAAC 4DCUA 2HTSA 1UZAA 3DZFA 3AFHA 1JHAA 3A9WA 3EGOA 2M45A 1XGOA 4AJ4A 1BHO1 1JT9A 4BRZA 1SUFA 4C08A 1CY6A 2GYYA 1TTYA 2QSUA 1A2KC 3CJTA 4D0NA 1IG0A 3K4HA 4DN6A 1G3TA 1XLTA 4BVEA 1OXMA 1OI7A 2EKQA 2AG0A 4BKMA 1PR1A 4CCAA 2XNDA 1TWAJ 2H8KA 5AHXA 2HBZA 4C06A 5FH9A 4LQCA 4TS4A 1UMCB 3AKEA 1U0JA 2ID3A 4WNYA 5JS2A 1QH1B 4BFSA 3DCIA 2C9CA 4KTVE 4FHTA 1UANA 5HOQA 1EK0A 4X5OA 1M1YB 4YJGB 1L1EA 1FP7A 3N7TA 1CY7A 2EIXA 4MUHA 2RGRA 1X0XA 2J9YB 3RK4A 3F6EX 4FN4A 4JLVA 4WNAB 1GILA 4Y7NJ 4GMDA 5LL6P 3ZD7A 1YULA 1H88C 3M5CA 4ZA2A 1CUXA 1RZUA 2IJLA 3WYCA 2BMEA 1A0OA 3LS2A 1GD1O 3KTAB 5AIPA 1CQWA 1T26A 1REPC 4LKOA 5D5QA 2ZWPA 3CISA 3G17A 1JFRA 1E1DA 1UZUA 4B6SA 3NIGB 1FVOA 1GZ7A 3S1AB 3X1YA 1XYYA 2OGWA 4UDXX 4U2GA 3SMVA 3PIPF 2XCLA 2ONYA 4UCFA 4BO4A 3FW1A 4YJ3F 1WETA 2B36A 2A3SA 4C6RA 1B9NA 1WRJA 2HNKA 4MW7A 1KSHA 2G0NA 1SXJB 4WK0B 3GWZA 2DJNA 1T8UA 3O0DA 1QZTA 1UCFA 3F7OA 5EA2A 1WO8A 1UAYA 3SYRA 1IM2A 5F5XA 2CDNA 2RARA 4LXIA 3G89A 3JWEA 4MVJP 3BK7A 3IOMA 2LIVA 5CB8A 3LP8A 2V55B 2A3RA 3RAPR 1QTIA 2LZ0A 1OCCH 4D96A 1O9GA 4D5EA 1XL0A 2H7YA 1VJCA 4TGLA 4NESA 3S3NA 3PC6A 3LNTA 1DBPA 4Q4LA 4ENSA 5HF8A 3KK0A 1XD8A 2JSCA 5F5LA 2BM9A 3SFVA 2VYNA 3CIOA 3MMZA 3IAUA 4WESB 3A27A 1L7OA 1K4KA 2DXIA 2L2OA 3PPYA 1R5JA 2I55A 2DSTA 2VJLA 3TW0A 3T1OA 4X45A 1ZYUA 2Y27A 3NWPA 1AUPA 3R7AA 2Q99A 3AUYA 1HEYA 5DM1A 2RHLA 2QR5A 5DN6D 2I4OA 5J8CA 2H08A 3WSTA 4Z7NB 4PYOA 2CFOA 1CUZA 2KT0A 2Z3VA 2E2IJ 3GJXC 2P8TA 4ZEXA 1HLVA 3C5EA 1XSVA 2FMFA 4BE7B 1NSYA 5LYYA 1GXQA 4P4NA 2DA3A 2PVCA 4V1CA 3RABA 4JWTA 4I5GA 1GM5A 1G8SA 3A05A 4XSHA 3DE2X 2YZNA 2MH9A 3GT0A 4B6RA 3IUEA 5M3BA 1NN1A 4TWBA 4DBLC 5C3UA 1E1RD 1U90A 1U8FO 3WADA 1IOZA 1W5SA 1GEEA 4MUIA 2ZSIB 3KR9A 4XJTA 2DHEA 4MULA 2EA2A 3PGVA 4HAWA 3HDJA 2WWVD 3TINA 3F7TA 2YICA 5CHYA 4Z1MD 3D6AA 3JQ8A 5G3YA 5HJ7A 3WU2C 1Q2XA 3NEUA 1CBUA 1NATA 2WIJA 4NH0A 4KQGA 2OD7A 5IYZB 1GY8A 4DIOA 3OMWA 3HKCA 1SG6A 5LDGA 1ES9A 3R5FA 4Q48A 4ESJA 2JVIA 3T3MB 2R87A 5K6TA 3CB4A 1SXIA 2XJ9A 2B5OA 4OKSA 4X1YB 4RGXA 4B31A 3UOAB 1SCBA 4D9EA 2R4GA 4YFKF 3RNOA 1JJAA 4Y6RA 1EFPB 1D0XA 3L77A 2WJIA 3DE5X 4H31A 3DR5A 5D8KB 3ODPA 1R6TA 3NWSA 5E8JA 1B8PA 4M1OA 3KLNA 3TP3A 1P6QA 3S99A 3JAKB 1USGA 3CTMA 1BKSB 4QUHA 2GN6A 4DA6A 1VQOI 5AJWA 3F8TA 5LP6B 2IYFA 4R1PA 2FGKA 4TN5A 4D44A 5FUWA 4C3ZA 5B7PA 1LVAA 2CLKB 2UVQA 1QO7A 4AKHA 5BPIA 1ZVVA 4R71A 4F4JA 4WY2A 5TVKA 1ORKA 1WHUA 2JAOA 3RTCA 3GL9A 3DVRX 3ESRA 8AT1A 2QLJA 4FMDB 1JEOA 5E1WA 1FDWA 1HXHA 2OCXA 3D5QA 3PXBA 1MBEA 4C4YA 3ZHSA 4LY0A 1ONBA 5FB2A 2PJRA 4KA4A 3WGIA 2DQZA 2PLNA 3ETDA 3DAPA 4LLNA 5LBTA 3I28A 4A26A 3IP6A 1GGHA 2C7BA 1Y1TA 2FTKE 5E1BA 4G5YA 4IDDA 1T3ZA 3REFA 1NJ5A 1G60A 1AQJA 1SQ0A 2CLLB 1GPJA 2A86A 4HDAA 2BTQB 3ROMA 1YCHA 3DEHA 4D43A 4FINA 2HPZA 4EJUA 2WZBA 5BW6B 4LZOA 2WSYB 3M4NA 2P2GA 2GO1A 4KDRA 3GTJJ 1MNMC 4RZXA 3GFTA 3B9QA 2ZSAA 4RHXA 5IFLA 4MHGA 2D06A 3M9LA 3KPYA 5BQXA 1MBHA 2O7SA 2CF6A 1AKVA 4RTNA 3WGMA 3V4GA 3TZCA 1J0XO 2QD4A 4BVBA 2LUOA 4L6CA 4BNLA 3CJRB 3D3JA 1OT5A 4AJPA 4MCIA 3K5IA 4KN5A 1Y89A 5J2UF 2KJCA 4X20B 5DP1A 4YXWA 3ZJ5A 2EBUA 1NHAA 2QZ4A 1ZXXA 5GQSA 1BOOA 3R7NA 2XXAB 1XZFA 3IAAA 1BA2A 1KP3A 2XNJA 3CLQA 4DCTA 1E0KA 2F9FA 1G3MA 4HD8A 1RYFA 3V32A 2XOKA 3AWDA 4O4HF 2WQZA 5DXAA 3AVTA 1KQFA 1Q0TA 3TO7A 4TN1A 4PHHA 3QBEA 2GKSA 4M7RA 2XF8A 1PSZA 1G2IA 1M34E 1HKTA 2HYFA 3K31A 2FMTA 2E3JA 2FCAA 4B34A 3D0SA 1JE0A 1N6PA 3WWCA 4HZUB 3NYRA 5HF6A 3RI3A 3GLQA 3IV6A 4H3KB 1BJRE 4GMFA 3VR4D 4WCFA 2YPRA 1YASA 3CP2A 1JBQA 2X2OA 3GOHA 1QYVA 4FNAA 4TLBA 2L9RA 5EIOA 3I58A 1U2EA 1GRCA 3UH1A 3I62A 3D3WB 1ON1A 1NXPA 5TRDA 1HWYA 4CMIA 1A7JA 1KFCB 4FZJA 3FI0A 3S7ZA 2GS9A 4K46A 1XTSA 1WMEA 3G9ZA 3VZRA 1P1BA 2LF8A 2XE7A 3UFBA 3B53X 3QVKA 4LD5A 2X5XA 4EI7A 3EWSA 2C5EA 2HBQA 3EYAA 4TLEA 2FK7A 5J2TF 3D4NA 5LXTB 2FPXA 4L0CA 3QFSA 1HX7A 1TWCJ 5EJIA 4BFCA 4NMWA 2Y30A 2VP5A 3FE2A 1QWSA 1BW6A 2B20A 1QOQB 3G2HA 3F71A 2AI1A 3K7AJ 3TH5A 1D09A 1BRTA 5CJPA 1X1AA 2B3DA 3QNUA 5L7TA 1GA1A 4D26A 4EJ0A 3IPXA 1U8YA 4K9LA 2WA1A 4UE6A 2JFZA 2PANA 3G2JA 3TQIA 3P27A 1VFNA 2CW0F 2AMYA 5A71A 1G20B 4CL8A 2IEBA 4BUCA 2MMGA 3QFCA 1U3EM 1E79D 1UFKA 1UJ5A 1WLSA 3SVLA 1X7GA 1NVVR 4DXAA 5EQDA 2O5VA 4GZ5A 3HVUA 3U3DA 1TTHA 4BEBA 4CIAA 5FTMA 4KAFA 5H9VA 5JWOA 3BSSA 2MSEB 4YIFA 2WF7A 1RMQA 2GZ3A 4Y2QA 1IZ1A 5EZYF 2ZU0C 4ND8A 1ZD8A 5BS6A 5CH3A 1MH1A 5K0SA 3GBSA 3GFIA 2YR2A 2FN3A 2NUAB 4OTZA 2FPMA 3OPYB 4Q05A 4XDYA 1E4EB 3SPXA 4UQPA 4XONA 1QC5A 2RK3A 2OO7A 2PMKA 3EDOA 3A6GA 2GCOA 3CMEI 1HDGO 1M0EA 2PGIA 2ZJ7A 1CUGA 3BULA 3LUHA 1GCGA 4BXOB 1SB8A 2EFOA 5FGMA 2NZWA 2HYIC 2BL4A 3OR2C 4RFSA 2VZ8A 5DN6A 1XBTA 5FBHA 5A5VA 1L5NA 2X85A 1WD7A 2EFJA 2AEMA 1T0FA 3KKZA 1UK9A 3FWNA 2A1UB 5B1AH 3CRQA 2G82A 3MTJA 3G1MA 3VYWA 5A2GA 1OCTC 3QVGB 3CCFA 2BHSA 3SSAA 1YFJA 1ZGJA 5T64A 2VKHA 1WXFA 4X1KA 2W4QA 3NMUF 4BMVA 2EJCA 3VOSA 4N18A 4DCOA 4CE6A 4C5CA 2A3NA 4YX9A 1CYEA 2Z8YA 2O1WA 4LBVA 3Q9LA 1A76A 3PRHA 1E1RA 4XLCA 3RTEA 5JSQA 4FGUA 1ATIA 3VTAA 1Q91A 4AJOA 2YHUA 4OMUA 5HKKD 3ER6A 1UBOS 4L3OA 4RGVA 3KZZA 4NBWA 4Z1MA 2SCUB 3QE3A 2ELJA 2FFJA 5FFFA 3VSLA 2PNFA 2X5KO 2JK0A 3HCPA 1ISIA 5B36A 2AC4A 4DQKA 2LKPA 2L7FP 1XEAA 1E3JA 1C8KA 3CVJA 5B6JA 3EBPA 1VQKI 4LUCA 1SCUB 3CCMI 1E1CA 2OLKA 3SX0A 2WC2A 3J7YJ 3ORQA 4C3VA 4NCXA 3I0NA 5IH3A 3UHJA 3N28A 4PXAA 4ABZA 3Q87B 3AM5A 2LP0A 2YJ4A 3RIYA 1YVPA 5B1EA 2QTRA 2L19A 3ZG6A 1VKRA 2EPFA 2YYAA 2IS4A 1YJBA 3NANA 1E6EA 5SYAA 5B5EC 3K4PA 2Q0HA 3RT9A 3ZBUA 3NHJA 2CVFA 3CRRA 1N57A 3L8FA 1CS0B 4OUKX 1UEXC 4URUR 4MPTA 3CX3A 2Q3HA 2VIIA 1GNTA 4QXMA 5MGBA 2HQBA 4ESHA 3WTSC 3KEQA 1FLDA 4JCOA 5F52A 3HDYA 4EI9A 4HQNA 1YRQA 5BVHA 2PEZA 5H6RA 3W34A 3FETA 3I04M 5E4JA 1Z0SA 4G8DA 3H3VK 2IY8A 1W1IA 5KTKA 4JLWA 2CJYA 1JI8A 1FOXA 1FFGA 2OAZA 1T4CB 2AOTB 4HNSA 3ITKA 3OQJA 1K0FA 3OQIA 3NKFA 3IBSA 3IOEA 2QUHA 3HGMA 4H7KA 2FHSA 4F91B 1YRYE 1SG9A 4DMUB 2PWAA 3MAJA 1FX1A 1EWQA 2F8SA 2H2IA 3U4CA 1QF9A 4DIEA 3PGXA 3K6RA 1CQIB 1CR2A 3PYXA 4B9AA 2OO3A 4DJ5X 3KEGA 2VODA 4M9UA 1E2GA 1BXRA 5T67A 4UXHA 2NZUG 3LO8A 3ENKA 1FFXA 2H2FA 2E55A 1W7PD 3BN3A 4ZVTA 2JA2A 3O0TA 2X8AA 1TU3A 2VUUA 1SU6A 2WOJA 3OIGA 3WB9A 3FIJA 3R0VA 3MWFA 3FCEA 2GK7A 3U7RA 5IC5A 2VQCA 2X0KA 4EI2A 5C4GB 4JJ4A 1MABA 4TZTA 2DOAA 2O1EA 2PWPA 4ZCSA 5E1XA 5E9WA 3V3TA 3CLSC 4MFEA 5FUXA 3TLJA 1NE7A 2IEZA 2XNHA 2PUBA 1HT2E 3R2JA 2H0AA 4M1YA 1ILWA 4HYYA 3FSJX 2OPHA 3SDBA 2A7QA 4BDTA 3JREA 4V03A 2B92A 1EAYA 3A1WA 5CITA 4LJAA 4S2EA 1GZVA 4TTIA 2HZTA 5GONA 1NGSA 3GJ0A 4KKXB 4CMJA 2XWBF 4A69C 2BZGA 1OXTA 4R01A 4MRSA 1TK3A 4DQ2A 3L18A 3T99A 4AKGA 2GTIA 4G0QA 4DQDA 4P5OA 4X24A 2ZWIA 4J49A 2KBEA 3BJIC 3ZK8A 4PDKA 1OAOC 1FUEA 2EJBA 4F04A 3PQFA 4BO6A 3F73A 4RV9A 2B6NA 2FOXA 4F6RA 5FRMA 2OV8A 1Z7LA 2VBCA 4OBBA 1KL7A 1V11A 2QU7A 1S7CA 4FDAA 5L4NA 1V5FA 3SLGA 4TV9A 1JJFA 5EPEA 3IP7A 1S2OA 1KYYA 2WE7A 5AVYA 5FAKA 3KHKA 2C5FA 4HNGA 1Z25A 1EP3B 4BQRA 5FWAA 2HGCA 2QRKA 1T0PA 1M0SA 5ALUA 5JQGF 2HWXA 1TADA 3FWKA 1XZNA 1P4RA 3MGAA 1J0AA 4CLXA 2YU3A 1TI7A 4AF6A 3FG9A 3RSZA 4GR4A 2P2SA 1KVTA 5JYCA 1NPDA 3FYUA 2C03A 2QE6A 3AKYA 2J45A 2XQJA 1QHFA 1QZUA 1MHTA 3W5UA 2YUIA 4DIDA 2PHZA 2RAFA 4D9KA 4KQ2A 2ZU6A 1MW9X 3BG3A 2P0YA 4YDHB 4AVYA 4RULA 3BCUA 3E3MA 4YMVA 2ZW9A 1DTWA 4JB2A 3WNDA 3NRBA 4P58A 1G3RA 4KO3S 4GOOD 1NVBA 3D1VA 4F06A 1GUUA 2XDQB 1LPQA 5AQEA 4NMLA 3MTDA 5IPFA 3VVBA 3IODA 2O3SA 1XCPA 3M5PA 4N8DA 4UHBA 3BKWA 1N5OX 3GEZA 4L0YB 2G7HA 1E79A 3TJZA 4EKEA 2MLGA 3CZCA 4QBIA 2Q0XA 1HFJA 1CUVA 3K69A 3UAWA 1UPAA 4I66A 1IBSA 3OOSA 1KAHA 1QFJA 5DBHX 4XWYA 5AKGA 2I2WA 3B51X 4RLSA 3D4IA 2FYTA 1RZ4A 2R7LA 2ZUEA 3OYEA 4E6EA 2EV6A 4YR7A 3KELA 2BISA 4OQLA 4DV4B 1K8RA 3HB1A 2R7MA 2REQB 1UM9A 1P8AA 3KZCA 3PJFA 3K9BA 1DHRA 3NB0A 2YFQA 2V6EA 2QKLB 2HRCA 4QREA 2YXNA 3ZXIA 4DL9A 1UJ8A 5CNKA 1GKLA 2VJKA 1VIYA 5ED4A 3AUUA 1ZA2A 2EHJA 4X54A 4CEIB 1SKUA 4IFIA 1Y0UA 2ZBVA 1VB3A 3SQLA 3WLJA 2VDPB 4K05A 5KHLB 1QQ7A 4WXEA 2JZOA 1Z82A 3OCWA 1H0RA 1ULBA 5DIFA 5ADUS 3ET5A 4A3MJ 3AONB 4A9AA 4PYMA 4WA8A 4EELA 2C31A 3AEUA 3LL4A 3E27A 4BNVA 1NUQA 1Z3CA 421PA 3DXZA 3DGEC 3EGCA 4L5CA 4EDFA 4ARIA 2MINB 3V4RA 3QLVA 2HV9A 3PBKA 1FOEB 1FTTA 3E3NA 4Y7CA 4A5MA 2QG9A 4LNAA 3COZA 5DHUA 3TMAA 2NVUB 3ROQA 1ELOA 4BY7J 3WOVA 2X51A 2EF1A 4MDYA 1YR6A 4TYNA 4TXNA 1GG9A 5EYPA 4QBFA 3LOQA 4CMHA 1VMEA 2ACEA 4EHDA 4QDUA 5ALMA 3UKJA 5J2UB 1JIQA 1XPRA 1QQAA 4WJKB 3GLIB 4EGQA 3NX4A 1T9BA 4HQLA 4X6AJ 1N2XA 5HKKA 3KKPA 1MV8A 4BE0A 1ZFNA 3G0GA 2G25A 3NBUA 4PFJA 1QFYA 1GKYA 1YB5A 3AOGA 3MAGA 4O4HB 5DYNA 4UPVA 1U1CA 2HK8A 1L5MA 4R54A 4WZBE 4MS1A 1NXSA 1W88A 3KDPA 4P34A 2Q2EB 3NC1C 2FFHA 2QKYA 2DFIA 1MC1A 1R4NB 3VMMA 3VJKA 1MVOA 3C3WA 3CCEI 5M2QA 3OFKA 4WVLA 1SNYA 2DOKA 2OJED 3RRBA 4FT2A 4M1MA 4J3NA 2VP4A 2CL6X 4X6XA 2P6MA 2PI0A 1I10A 1BKYA 5KDDA 4HXFB 4DOZA 3LUAA 2QZZA 3W3AH 1U1DA 5FBLB 1CZUA 3LT1A 3BCSA 3SJUA 2H4YA 1R9MA 4FWBA 5CDTA 5H82A 3CEHA 2CN1A 3SOPA 2GZMA 1HCRA 4HV5A 4FMCF 2YRWA 1ZJJA 3LA2A 4KXNA 1Q0UA 2WHPA 2G1UA 1E8NA 3L0BA 4PX9A 5BN5A 4ER3A 2OPTA 1GQYA 1TQPA 4D0PA 4BE9A 3LTNC 1NU8A 5LCXA 5EZQA 4CUJA 3A1UA 2AMFA 1C2YA 4XEUA 1SQGA 4EYOA 5CT6A 5FO0A 5J2TB 5TDHA 3V8KA 3RSFA 4CF6A 5IT0A 4HEQA 4FSDA 2OV3A 2O8EA 2WAAA 3GX4X 3SC2A 3P19A 4EOGA 1L0OC 1RYEA 1T6YA 1D3AA 5G0UA 4FBLA 3LCRA 5HRAA 1L7RA 3ESAA 1XMPA 1UZLA 4S3MA 3ZKWB 3BA6A 5I7WA 1K5PA 2H06A 4A0QA 1QKIA 4D2IA 4QXPA 3GMSA 1U0BB 3GP5A 4UBLA 3HO8A 4HF2A 2FW7A 1W73A 2YWFA 3JQGB 2VDWB 3QU4A 1H8ED 4ENWA 3BZUA 3SAJA 2P81A 5L40A 4AJNA 4G24A 2I9KA 4DA8A 3H5LA 3B6IA 4MR7A 3AR2A 4KICA 4KT5C 3IRVA 2QSJA 3GBVA 3T9AA 1QTQA 2IPXA 4LE1A 3QJ5A 3RYCA 5K7HA 4PRLA 5EZYB 3C1AA 4REMA 2I10A 1DO0A 1GN9A 1L8QA 5L8VA 4FOSA 5AM2A 4JLMA 1QE0A 2O3UA 3DAOA 2GF0A 4HSTA 1MBZA 4UAVA 4E4TA 3ADPA 1XZAA 3P4XA 1EBBA 3RIMA 1FS6A 3ESZA 3J81A 3ESDA 2D1HA 1RRKA 3N8GA 1HDPA 1ISSA 1ONPA 2RC6A 3T4EA 4JX8A 5LU9A 2FUG2 4FYYA 1SHKA 2ECPA 1PYOA 3TVTA 2POQX 1K79A 5AI8A 1I13A 4F86A 4BUPA 4S0HB 3EQ6A 1E2IA 3AT1A 1RZRD 5BSWA 2E71A 2GZAA 4M99A 2HU5A 1VG0B 3HKDA 2Z98A 1FCJA 4LIUA 3ZI7A 4R84A 2VF8A 3TRFA 1MBGA 1OI4A 4KHZA 4H60A 2HXOA 3RFTA 2CYCA 4U9HS 2FX2A 3PQDA 4L4XA 1PLKA 3SK0A 3H4VA 1RQXA 5GGYA 5ICMA 3OSFA 1M9NA 2IYEA 3RVRA 1AOYA 3Q7IA 3MILA 2AZXA 4FHEA 3NNNA 3MTBA 2N3ZA 1Z13A 3T61A 1NX6A 1M83A 1KQNA 1BOBA 2L9SA 3CO0S 1SUSA 4Z6YA 3RIEA 2AQHA 3OLQA 4D9HA 1OH8A 1BGWA 4MI6A 3F9IA 1R5BA 4UUVA 4OQPA 4Q1EA 3CF2A 1OXUA 1ISRA 3K2ZA 3TW4A 4QFDA 4CLRB 1CY1A 4F1JA 4DKJA 3B8EA 2WJZB 3H16A 4FTHA 1F0KA 4KO1S 2JUCA 1OAAA 1RBZA 1E17A 4XKBA 3RU9A 3LQ1A 4B40A 5JCPA 1SCAA 5F6FA 4L9RA 2HXIA 1T2EA 1T38A 3DBIA 4GP9A 4MIOA 3N74A 4DZPA 1B72B 2QL6A 2W2VA 3S4YA 1Q3HA 3GVXA 3VAAA 4HWGA 2PH1A 3WLOA 4D3FA 1RJWA 5GVSA 4IQ0A 1G5IA 4X95A 1SMYF 2R00A 3S2EA 4YT5A 4P38A 2QL7A 5BOVA 1USKA 4OF4A 3RPUD 1U8EA 4GLLA 5EN4A 3CN9A 3CMYA 1YU9A 3C6XA 3GF2A 3V6LA 3GXBA 2HZBA 1J8FA 2DAOA 2VVTA 4HI0E 3JD0A 3ZRGA 2WWRA 5FOQA 1RWMA 5LDHA 1HYEA 4ZYYA 2GXSA 1P7ZA 2Z33A 2X8LA 3VR5H 2B4KA 3QVJA 3RBAA 2M9HA 2WB2A 4PLFA 4Z99A 2JCXA 2X9NA 4Y8VA 1E1QD 2H4HA 1L5QA 4QU0A 2DLLA 3JSOA 4QAJA 2OCDA 1PEAA 1QRTA 4W1SA 4H6XA 2J9FA 5JRZA 3HCEA 3WWOA 3I52A 1U98A 1ZUNA 4MRVA 4CGYA 1P7WA 4GCVA 3WZLA 1R0SA 4ZH4F 1QGZA 3F8FA 4GLOA 3EQLF 1TZBA 4FNOA 4K9RA 1TYEB 1NRXA 2C5GA 1K6XA 3E15A 3Q5DA 3MTQA 1K75A 3LNQA 3B5EA 2E5NA 4D4MA 5LP6F 2RAPA 4O1HA 2COMA 4FFDA 3FZVA 1KC1A 1JVSA 3TNFA 3IMKA 3WGGA 1P9RA 3K53A 2PWYA 2VT6A 3BTUA 3VX4A 3HZJA 3M83A 5L53A 4OI0A 2O8CB 1U0EA 4LXTA 1MIOB 2VYQA 4S1TA 1T5OA 2P6NA 1SVMA 1KK2A 3S8YA 3KP1A 2XUFA 3QJGA 1CP3A 1TQDA 4NV1A 3D5LA 2P0WA 5CW1A 2H1CA 2DUWA 5FX2A 4F7WA 3S0JA 1MAHA 5JO0A 3T9CA 4KXWA 1IB6A 1RXYA 1NI4B 3AM1A 4PJMA 4QUIA 3JVEA 2Z9DA 5F27A 3OYJA 3CZPA 2ZIWB 3G2QA 4PS0A 4EVRA 3O3OB 5EJFA 1C1YA 1JNXX 4OXKA 1OXVA 2WWGA 3CPJB 1JQLB 4COKA 4PLWA 5DGIA 4HVTA 2KS6A 1FFEA 4DNFA 1ZSYA 3TLXA 3F5QA 2RNGA 1IVNA 4BEVA 1O94D 4BE1A 3MS7A 4F9EA 4JJ6A 3M8JA 1VPDA 1CRPA 4E3WA 5BV0A 4PCQA 4MV9A 5ALIA 1KQ8A 1DTEA 3PJRA 5BV1A 2HIGA 5HOOA 3UAVA 3TNLA 4DCCA 5TPZD 4MGRA 2D5VA 2M0CA 1MIHA 1ZREA 4Y1EA 2A0FA 5BPDA 3PEYA 3B1ZA 5DI3B 1I6LA 3SE0A 4W7HA 1BX3A 1XEWY 2BMJA 3VH4A 4B82A 2CVOA 3F2IA 4HP8A 1N36B 1Q14A 3AC0A 4A0ZA 5COQA 3MCUA 5FTNA 5A4JA 1J5PA 1PDWA 3CPEA 5BVGB 5JQGB 1Z0JA 3ZW7A 2Y93A 1TQ6A 4E15A 4ZVPA 1QR2A 3HL0A 1FT9A 3QPWA 4B4CA 1G4DA 2X5OA 1JGGA 9LDTA 4OXIA 3O8RA 3WL3A 4KIUA 1OWNA 1LGYA 4KWCA 4OYRA 1JEJA 1SANA 3GFSA 1M1YE 4EPVA 1NVVQ 1K6OA 1MP0A 5EMHA 2CNNA 4DV3B 5B64A 3GW2A 3RVPA 5IPAA 1QXSA 1N0HA 5E8IA 4PC7A 4CM1A 1E2KA 2ZB4A 3TEDA 3CUQB 1DZIA 4AY3A 1U78A 1HNNA 2DT6A 3QUBA 5AO9A 2W57A 1HOXA 4A7PA 3LOPA 2X15A 3CF6R 4GU5A 3KXKA 4JY7A 2J3HA 2ZEJA 1UZNA 4N5IX 1TM4E 2P5UA 2BF7A 3HYNA 1UKYA 2CJXA 3PR1A 3TIFA 2GKOA 2AH5A 2DLCX 3J7AO 5CH5A 3EMVA 5HQ3B 1LLCA 2YFKA 1CJTC 3SS9X 1GTJ1 2PN6A 3FTPA 4Z4HA 3FCYA 2OOSA 3LWZA 4PLGA 1K5DA 4KMRA 4ZEWA 1O96B 2PS1A 1SXJE 4RV5A 4B8XA 4CG1A 1E9VA 4D25A 5LXTF 4BRSA 3ENNA 2V98A 5LJLA 3AR3A 2NSJA 5C51B 2NTVA 1EDDA 2PZJA 1YDFA 4NARA 4C7VA 2QLMA 3WISA 4OHRA 2B9SA 2Z1DA 1IO2A 5LHGA 4RJKA 3ONQA 4YMHA 1E7RA 1ETHA 2PDAA 4WWCA 3DTVB 3L8EA 2Y2UA 1IG7A 5J23A 1XWWA 5J4YA 2COUA 5KMGA 3OZWA 5AVWA 1EFLA 1U0TA 1RZRA 1QHHB 3NBMA 1FMJA 3S32A 2JHGA 2ZROA 4O08A 3DC2A 1KYQA 2GD0A 4YAKA 2NO7A 3ZXUB 4BWYA 3AOEA 1O7FA 1P91A 4K6MA 3PR3A 2WMDA 5KX5F 4AY2A 1DAMA 4I1RA 2VC0A 2E85A 5LRRA 3TPCA 3WZMA 3N0TA 2JI6A 5KWSA 4FFBA 2BFFA 2PG4A 3Q85A 4MINA 1VNDA 4JT9A 3FTCA 3T38A 3PUVA 4HPJB 2ZIEA 4MB2A 2EJVA 2OF7A 1EMDA 3P2IA 4EPXA 2JDID 4KR0A 2ZE5A 4OUDA 4FE4A 5KQSA 3V00A 1DQYA 1PSDA 5EGOB 2A5YB 3EX7C 3L04A 1T36A 3H5AA 1QPBA 2D5CA 1O6FA 5B58C 3H5TA 3BXEA 1I7QB 1ZK1A 1W0KA 2OEPA 3FUXA 4JASB 5T41A 4FOLA 2QT0A 3C48A 3FMRA 3VHQA 1ODDA 1D2CA 4KR6A 1ADBA 2BGGA 4O2AB 4X8HA 2D1QA 4MOWA 4QYSA 3KWLA 3EVDA 3MMSA 2D1RA 2WKRA 2WUFA 3T0GA 4BWVA 3R75A 3VFZA 2HTFA 1Z5GA 1UQTA 2K02A 4JBLA 3V55A 2Q3CA 4Q3LA 4YV0A 3HSEA 2CD7A 5JMTA 4XWTA 3G4SI 5J1RA 2FY8A 2IT0A 5IKXA 3RWOA 2C9MA 2SBTA 4RNDB 3V8JA 4X3OA 3UHOA 5K9ZA 3RPUA 3FYSA 4X41A 4A2UA 3STHA 3WA7A 1J9IA 2FEMA 4FMCB 4BCBA 4D8TA 1GV0A 2QG6A 3T8YA 4MQFA 5IASA 4DCVA 1M6NA 4E2ZA 1XEWX 3CSDA 1X8KA 2XR1A 3RS9A 4TVOA 5DX1A 1A9OA 4YXFA 4GX1A 2JAHA 2R6GA 2BW3A 3KPJA 4XTRA 4LIVA 4X1IA 3RYPA 1E1QA 1NJFA 5CB4A 1YR2A 2M1ZA 4YCCA 5TF4A 4B8WA 3PNYA 3KYCB 2OU2A 1PDVA 2L69A 2VJCA 1YIOA 4O4IF 2RJOA 1J5EB 3F6VA 2P5YA 4YIRX 2NADA 1IQUA 4RVUA 4KG7A 1TZLA 4KIFA 4N76A 1TWHJ 3RHTA 4C4XA 3L93A 2MSCB 2VP2A 3FXRA 3DT9A 5AW8A 3HB7A 3V8PA 4PCLA 1XMOB 2L01A 2NU7A 2Y0DA 3DAHA 3MT0A 1YFHA 5EXTA 3PYLA 1IBKB 3WL8A 3DZJA 1JAYA 3CCLI 5ALKA 3IAEA 4KMFA 3EOBI 1AHHA 2GX6A 2Q8PA 2DBQA 2UUBB 4XX0B 1GKIA 3ISTA 4F56A 1RXWA 4JL6A 2A9VA 3WQSB 3LHDA 2F6CA 2ADOA 5GAJA 5D5WB 2BFAA 4ZO8A 3ZHZA 1Y5RA 3ZR4B 3X2FA 3ZDEA 4G5XA 4HB4A 3R61A 1JQEA 1P31A 5HS8A 4YCSA 4M22A 2I65A 1JKXA 3CF5F 2OP0A 3MGKA 3TTSA 5G1NA 3TSYA 2CGEA 4KQWA 3LC7O 5JRJA 2CGPA 3OFSA 4J2TA 4AICA 3UOWA 2PZKA 3HTSB 1A4IA 3IVCA 2PRIA 4F2GA 3KOYA 3IC5A 2F2TA 3R20A 4IYJA 2WD7B 2VRNA 5F2EA 4P0PB 4G7HF 1KVRA 1OFHA 1PGPA 3AG4H 2Y05A 4ZOEA 1UADA 2XVCA 4MO7A 4HGPA 2Y3IA 4DABA 3VA7A 1C3EA 1O94A 3BHJA 4J9VA 1K0UA 3SDGA 4C0SA 4L4YA 4BNGA 3AUTA 2NMVA 1ZGAA 1EHYA 1TD1A 5DS9A 1AQUA 3IHTA 1YNSA 1Y3CE 3D8UA 1N1EA 1WPKA 4WRRA 1TX4B 3GCWA 5TPZA 3VPBA 4K2HA 2Q8KA 1DJPA 4WIAA 4ND1A 3EYYA 1HMPA 3IBTA 4UZEA 3HGYA 3HZRA 4RA9B 2C83A 5ARCA 1KJYA 4IQJA 4DFDA 4DMGA 3AKDA 3DKWA 1MT0A 4MUMA 5L3RA 4OMYA 3T3PB 1QS0B 2CB0A 4JXZA 2WT9A 2PKYX 3DVLA 1KWKA 4Q21A 4BN5A 2D0OB 3GRUA 5H4HA 4EF4A 3EFOB 3K73O 1E20A 4G5GA 1I5RA 1TB4A 4NNJA 2NU8A 2DJ5A 3F6CA 4MQVA 4P81A 2E4XA 2M32A 4DILA 1AO0A 1HDDC 4RAQA 2LRDA 2KSQA 2IIBA 3P5JA 2IX9A 4BNWA 5B4VA 4LYYA 2G5TA 2XI4A 1SIOA 4L9SA 4EPWA 1AE1A 2VT3A 4TQAA 3ZY6A 1MDMA 3DXYA 3G2IA 4YT8A 4Q4HA 1RPTA 3PGLA 4X90A 2JSPA 4BEHA 2RREA 1A6IA 3PLAE 4D7MA 1JR2A 3EE6A 1JHQA 2CJWB 1MEEA 1E2DA 2SKDA 3DL7A 2QVLA 4P22A 3C98A 5K3DA 2Z2IA 5CVEA 5KYGA 3ILVA 5DCWA 2CUTA 4J00A 3FTFA 1KTIA 1G20E 4HZFA 1QFSA 4LAFA 2WTBA 3Q0UA 5AMXA 2AFRA 5EJCA 4Y1FA 1NNLA 3ZHOA 1NUAA 4XTCS 2PUTA 4QOFA 4MUJA 1QTNA 3AJEA 4O1IA 4ALIA 2HRBA 3H1AA 3KE2A 2ZZMA 4PTZA 3SZMA 3FA2A 3WXMA 4QELA 4YG2F 2OCAA 3RYIB 3W6VA 4W9MC 4DKXA 3T7KA 2HBRA 3TDMA 2B4TO 3FNFA 2ZMEC 3ZHTA 4D9FA 5BP7A 1YCGA 4PLVA 4Q7EA 4DG8A 4G8CA 1ZM2A 3OIQA 3FYTA 3UHFA 4BU2A 4RF4A 3BJRA 1D6SA 1XVAA 3BDVA 5DX0A 1M8KA 1UBNA 5A1JA 4Q9AA 3MS4A 4RC9A 1OXXK 4CVNA 5IDWA 2CW5A 1FFDA 3DE1X 4HAYA 2HI0A 3PM1A 2IJGX 2DCEA 1YHYA 9ANTA 1SQ6A 3WWEA 1OOEA 1KU9A 3KXDA 4DHWA 1E9BA 2XOEA 2JDIA 4O0MA 2HPMA 3C6YA 3CGWA 2BHZA 2GCGA 4ZI3A 1E32A 5D6OA 1B2LA 1G6Q1 3UV6A 2HA7A 3EGIA 3FYDA 1B42A 3DL4A 3D64A 4MYSA 4K6GA 3IAM6 4WBSA 2WE8A 3QWHA 2IHVA 1JQKA 1MHPA 3I3OA 3QNWA 1GSHA 1FVXA 3MJTA 4TMXA 1NMYA 4QUBA 2W6NA 3BSFA 1GL9B 5IVIA 2IW3A 4X94A 2MGQA 3RF6A 1Y1VJ 3Q8XB 1SCJA 4HA8A 3SHTA 1X7WB 3HBJA 2WB4A 1O89A 3S93A 1EVZA 2EYQA 4JQCA 5JMWA 1WUKS 5EUBA 3W2IA 4EG5A 4LF7B 3DHEA 1VBKA 4WN9A 3V2IA 3H3FA 3V4VB 4LWQA 4AQYB 3BTSA 2G63A 2L4AA 1KU3A 1H2XA 4K40A 1INLA 5AJTA 3FWHA 3JCZA 4JLOA 4KHPB 5TISC 3E2MA 3ECHA 4MV6A 4NBKA 1SXPA 1R27A 3ZD9A 4KSCA 4YPVA 3MWYW 3BORA 4HBLA 1ZRCA 3M6XA 1R6AA 2VQLA 3JALB 3U31A 2FRDC 1RFGE 1WEHA 1YZYA 4M6WB 5L3QA 1XGKA 2RD2A 1FSFA 4L8FA 2AIRA 3S2WA 1MGTA 3IDSA 1JFFA 1WXGA 2GFIA 3QYJA 5JQWA 1IN7A 4F21A 3ZD6A 1YACA 2Q6TA 3TDKA 3O8DA 3Q72A 5CBPB 4LDJA 4ZO6A 1LSJA 4TMKA 2A5WA 3B6JA 2X40A 4YCAA 4FYPA 2NVWA 3OYAA 3WHIA 1ZW1A 2XW6A 2HVRA 1GSAA 3LFHA 4MA0A 4LMRA 4OP3A 1C7IA 2D00A 3FNQA 4MKRA 2NVYJ 1NX9A 4KV9A 1BE6A 3OIPA 3GJ4A 3ZMVA 4TZ6A 1PQ4A 2VDVE 2Q3BA 4ENPA 1Z88A 2H0RA 1PR4A 1NURA 1D8TA 5JSYA 1ZGWA 5K6AC 4NC6A 4DQLA 4X84A 1BCSA 3GDGA 3B6EA 2OXFA 2FSGA 3KB8A 4TL9A 4HMQA 3ZNNA 4JNCA 4Y52J 2H65A 2JFYA 2ERXA 4NABA 4EY8A 5JLJA 5CH8A 3EYIA 1F0NA 1KHHA 4LEIA 3HXOA 4N49A 4TKUA 4E11A 2P62A 2ZUWA 2H52A 7YASA 1I94B 8GPBA 5J6XA 1FSEA 1KAEA 1JDBB 4JI5B 3L7YA 5GIOE 2DWCA 4B35A 3T35A 3S1MJ 1YI8A 4X8LA 2OB2A 2VNAA 2CUFA 4PYLA 3S16J 2WTAA 3HVHA 3UCXA 2NXCA 3HO6A 1VJRA 4BCCA 5JJIA 3BFJA 2G9VA 4OHXA 2FR1A 1JUSA 5LGTA 2NSHA 1TCVA 2I67A 3OJOA 1F6DA 5FO5A 1MOQA 4ZT3A 1JLLA 1XRQA 3OUTA 1M6HA 4QNRA 2QMZA 1YE8A 1QP0A 1DWQA 3M5WA 3IP5A 3IHUA 5E0KB 2FFQA 1KRWA 4WD3A 2QF7A 2Q0OA 1AUQA 2YZ2A 1I4WA 1Z7UA 1E3MA 4LGCA 2LCFA 3DZIA 2OK7A 2G76A 4ZYGA 5D3KA 3N0WA 1ICIA 5IJAA 5IUJC 3AJDA 3AEKB 2JCYA 3QWBA 1C5KA 3K9TA 3LBAA 3NWBA 4ZJZA 1DXOA 1BX0A 4UB8C 5AONA 2FU5C 4O4JA 4YRTA 1I3CA 3T5AA 5KX5B 1VL8A 4LBYA 1PT8A 2BJWA 5ERGB 3TZEA 2X8JA 1JVBA 1CUEA 3ZZTA 3VQTA 3SGLA 3ZQ7A 5AM0A 3EGEA 4MCAA 1A77A 4MS3B 2HF8A 5DB4A 1KQ0A 1J8VA 2WWWA 4CCSA 3P9CA 2WFAA 3B20A 1FUYB 1XWIA 3CBGA 1PL6A 4UHEA 1UHWA 4LOCA 2J33A 1PUXA 3QRFF 2DK8A 3FX2A 4BIIA 4DCSA 1B14A 3WK4A 3S2YA 4RB0A 2ZJAA 2E34A 2ALJA 2AVNA 4IJWA 3SXYA 2Z2ZA 5TVGA 3JQRA 2GK6A 4XORA 5MN5A 4WXPA 2VYVD 3C14C 2CKMA 5K45A 2HEIA 1GDTA 2JJ8A 4F2DA 3DBLA 2QRMA 5C5DA 2VG8A 1FJXA 5IBPA 2IFTA 2GAJA 2PSSA 3WE2A 4P9FA 2XTJA 2HGZA 1FF9A 1R8XA 4IJ6A 3OL3A 4MWZA 3TSOA 4UTNA 2Q9CA 1AQIA 4QUKA 3MSXA 2W4MA 3S2GA 3P5SA 4R16A 2ZT5A 1XCVA 3K2IA 4MKIA 5AI9A 4JP5A 2ISQA 3EVNA 3EXAA 2A5DA 1N77A 5LMUB 3MHPA 4KO4S 1LU9A 2P6OA 1T8SA 3E05A 4L6AA 3VH2A 1BR4A 1QZEA 3Q41A 1LJLA 2H0QA 3BXHA 4LMPA 2XMQA 5FL3A 2VJJA 3V4LA 1O97D 4H15A 5AT1A 2PYIA 1JL3A 3FPBA 4CRWB 2VCHA 1RAAA 2I8DA 1TW2A 4GAEA 4QPNA 3A9SA 4J90A 2W6CX 4FLMA 3IAXA 5BWOA 5ITVA 1O5OA 2TMKA 1F4LA 1BDMA 4RGBA 3NWJA 1V1RB 5EP4A 1HBJA 1C30B 3T6KA 4YRSA 1YRAA 5KVSA 3GK3A 1U0GA 1RLJA 2FJ1A 2Y0CA 3A06A 4XQFA 4O4IB 3FMSA 5FF9A 3UK1A 1SC6A 4QE3A 1D2MA 1UODA 3BTJA 2DJIA 1WB9A 1RAEA 1FXUA 1GVJA 2HLHA 3B9RA 3U62A 4LOAA 2FQ4A 5K51A 1VL1A 1T91A 1NW7A 1LUAA 1E63A 5BN3B 2CCGA 2DA2A 3KHUA 1ODCA 1Z07A 1S8NA 2SECE 4M7PA 1M34A 3NVAA 5EZHA 3HJHA 1Z37A 3GRPA 4ZVLA 2FQ3A 1C3OA 4OAQA 2GNPA 1F2UB 4ZYVA 4IG9A 2P1RA 3P9QA 3P32A 1VDMA 4WY8A 2O0HA 1O4XA 1C1XA 2CDRA 1O95D 2Q45A 5C8YA 3KQVA 4UAJA 4ME6A 1SIUA 4LCJA 2CXUA 1L5HA 4FT4A 5BPHA 2FZEA 1NULA 3WLSA 2H2HA 1G8MA 1LRLA 5JOQA 1CUCA 1XYVA 2QV7A 1XGMA 1GGEA 4GRAA 2IGMA 5GJCA 1RRJA 3QVOA 4AO8A 1FYWA 1M1NA 1U7TA 4Y9DA 2XAFA 3KS9A 2HM7A 4XOIA 4YJHA 1EM8B 1E5LA 1NRIA 4Y9SA 2CLIB 1XA4A 1NC1A 4IFBA 3EVCA 4IHQA 4MZXA 1NQVA 2O7VA 1E64A 5F64A 5JXJA 3GLIE 2WIDA 1RKBA 5DM7F 4QAQA 1B59A 3TOBA 5D5PA 3IV9A 1N32B 3T5MA 3VZCA 1JXMA 3CNBA 1YZTA 3ICQB 3LQYA 3EBOA 5D85A 1Z62A 3ZQUA 2VNJA 2J5OA 2KL4A 4D0GA 2PKRA 4L2IA 4PZPA 2WYHA 1W9MA 2QZSA 1DX6A 4C29A 4H7DA 4KRYA 4JT4A 4AWAA 2NZ2A 1EXWA 2HPVA 4RS4A 4UUPA 3K1ZA 3FLEA 4V3BA 1X74A 4B3JA 2JLRA 1P62B 2JS7A 4NZNA 3TL3A 2Z2KA 2XAQA 1AXEA 3D0OA 3DEZA 1FDSA 3HRSA 3ETJA 1ETVA 4YIHA 4Q66C 1E9RA 2MJLA 2FDCA 1N0UA 1LJUA 2KPOA 1SY7A 1FSSA 2FLWA 3WWDA 2R1TA 4NI5A 2C99A 2Z2JA 3KIOA 2FG7C 1A31A 1ZWLA 5ELMA 1H94A 4WEOA 1X1QA 2QS9A 1POGA 4LX8A 1H5QA 3ORYA 1EX9A 3HKBA 3DLAA 4IH4A 1RXUA 1XSEA 3N1UA 3EH1A 4OK6A 4PGHA 3IQHX 1Q1QA 4BOYA 3K4BA 4CICA 3C8HA 4JCCA 5KJEA 5J4VA