2QYOA

Crystal structure of isoflavone o-methyltransferase homolog in complex with biochanin a and sah
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
INNRKPSEIFKAQALLYKNMYAFVDSMSLKWSIEMNIPNIIHNHGKPITLSNLVSILQIPSTKVDNVQRLMRYLAHNGFFEIITNQELENEEEAYALTVASELLVKGTELCLAPMVECVLDPTLSTSFHNLKKWVYEEDLTLFAVNLGCDLWEFLNKNPEYNTLYNDALASDSKMINLAMKDCNLVFEGLESIVDVGGGNGTTGKIICETFPKLTCVVFDRPKVVENLCGSNNLTYVGGDMFISVPKADAVLLKAVLHDWTDKDCIKILKKCKEAVTSDGKRGKVIVIDMVINEKKDENQLTQIKLLMNVTISCVNGKERNEEEWKKLFIEAGFQDYKISPFTGLMSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Medicago truncatula isoflavone O-methyltransferase reveal conserved surface binding motifs critical for enzymatic activity
rcsb
source organism Medicago truncatula
molecule tags Transferase
molecule keywords O-methyltransferase
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 2.1.1.46: Isoflavone 4'-O-methyltransferase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qyoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qyoA02
4LD5A 3JAMZ 3F8FA 5EOVA 4PGHA 5EZSA 3BDDA 4Y15A 1SAXA 2G70A 3GRZA 2EJTA 3HTSB 4UOEA 4EQQA 1CF7A 1ZG3A 4PIPA 5CVUA 2DW4A 3T0IA 2YR0A 3MZHA 3QAHA 5E8RA 3T8TA 3QPHA 3GXOA 1L3LA 1FOKA 5CVEA 1MGTA 3COAC 5LEJA 4XLPF 1HKQA 5ICGA 1D8KA 1DPUA 2P5LC 4M72A 3IRQA 2AOUA 3FYCA 1K7AA 1YF3A 1ULYA 2VT3A 5K5QA 4YUZA 2P7HA 3HP7A 2GA2A 1XTPA 1YUBA 4RV9A 3G2OA 4AIKA 1S29A 5D5UB 4PINA 4OIQF 3CLOA 2DK5A 5IT3A 1ODDA 4RTJA 5LGNA 1SFUA 3FMSA 3E23A 3FRIA 2KW5A 2NYUA 1B6AA 1USTA 2RGVA 2VN2A 2EFNA 2CGPA 1SG9A 1O3TA 3J81Z 4FT4A 3JWGA 2COMA 4DM3A 2K4BA 1Q0SA 3DTNA 4G8XA 3G89A 4CO8A 1FBNA 1HW5A 2P7CB 3L8DA 4R1HA 2GAUA 1LDDA 3E5UA 3O7WA 4AX8A 1XDUA 1OMIA 4HTFA 5EVJA 2H6BA 3R3HA 1GHCA 4CTJA 1H1DA 2Z6AA 4A0YA 4HSGA 3UZUA 1H9TA 2GPYA 4E2WA 2NYXA 2H1RA 3R61A 2R6ZA 3HA3A 1WI9A 4EJVA 2EA4A 3BPVA 3B3FA 1QAQA 2UYHA 3OZRA 1BJAA 3E6DA 1HSTA 5E17F 5HIKA 1SD4A 4KICA 5DXJA 2B0LA 3WU1B 5DCMB 5EHGA 1T39A 5EPEA 5F2OA 3T5XA 4MTEA 2HQNA 2HTEA 5ERIA 5DV5A 1SQFA 4IV0A 3G3ZA 4R8SA 1NE2A 1YFJA 1B42A 2IVMA 2HYGD 2ZJ2A 2XRNA 4GOND 2A07F 5E1BA 1O3SA 3FTEA 2CWWA 1O3RA 3ROUA 4KA4A 2R7DA 4KIGA 3JSOA 1UFMA 2F5FA 3R6SA 3FUTA 2FRHA 3GJYA 4KNYA 4Q5SF 2ZBPA 2XYVA 1LQ1A 2DQRA 2AVNA 4FZVA 3TDZC 1T6SA 5CM2Z 1ZGJA 2CO5A 2EFJA 1LJ9A 2STWA 3FYDA 2CQKA 1UIRA 3HYIA 4KDRA 3S68A 4GBED 1MJ9A 3ANXA 5K0JA 4HDUA 1U78A 3ML6A 1OYYA 4DZRA 4LB6B 2XAGA 3DXZA 5KS2A 3EVEA 2Z99A 4UVAA 3AXTA 3R0JA 3LA3A 4LG0B 3DF8A 1SD5A 3SZTA 2FEZA 4M6YA 2XIGA 4E2ZA 3GDHA 2G1PA 3EMBA 4RAZA 2J5OA 1TPYA 2A14A 2JHAA 4WXHA 1IZ1A 3R6TA 5HLIA 5F6FA 3P2KA 2I6GA 1J0RA 3WTWC 5GINE 1HW2A 1G3SA 3NTVA 2M45A 2O0LA 3UA3A 3M6XA 2X0LA 1K79A 3GU3A 4IF4A 4IPAA 4R05A 4N9IA 3HVJA 3FXUA 5HIMA 4CTKA 2ETHA 5CVVA 1L3BA 1D2CA 3CC8A 2XVMA 1G55A 4ZZLA 1U5TA 3HRSA 1BI1A 3O4FA 5H20A 3FUVA 2ORED 1G4DA 1USSA 2RV8A 4BP1A 3B02A 1W5TA 4UUVA 1U2ZA 3UA4A 4MGRA 1FBUA 3DQVC 4GXOA 4RGXA 2P1DA 2JRTA 3CJTA 2MH2A 2P6SA 4Y17A 3KZYA 3FPJA 1OYWA 4OMZA 1R6AA 2B2CA 3SFZA 4S05A 2O0YA 2W84A 4LWOA 2QRVB 3GZ6A 4M36A 2HR1A 1BIAA 1FBQA 3D0SA 2JSCA 4OMYA 4PYNA 8MHTA 2ONYA 4U7TB 3FTFA 4ENNA 5FGMA 4V0QA 3EVDA 5DTQA 3HM2A 2PMHA 3OU6A 5DCMA 4I0AA 4RTLA 2JPCA 3L00A 4FSDA 3ABTA 2NXEA 3NQOA 3GFLA 4CKEA 4MNUA 2VP3A 3B89A 1XDZA 1O54A 3JW4A 3MZYA 3NDJA 5DXAA 2IT0A 4I7HA 4L9VA 1G3WA 2VC0A 5U4XA 5H02A 1ZG1A 4YUXA 1R8XA 3KEQA 3CUOA 4R8RA 3CJRA 1V39A 2EX4A 3GIWA 3HVKA 3NJRA 1O7FA 2P7IA 3KQPA 1ON2A 5FB2A 3T7TA 3IYLW 4JK1X 1ZN2A 2V1UA 3R4KA 3WTTC 2HTJA 1KU3A 5FFZA 2CMGA 3KPYA 4GOMD 5K01A 3F3XA 2FBIA 1G8SA 4R79A 3VOEA 3TRKA 4BLWA 4O3MA 3EEYA 4RGRA 3LAPA 1W7PD 5LQCA 3DEUA 5K09A 3BJAA 4G6DA 1JSXA 1A04A 2FU4A 1FSHA 2QQBA 4DA4A 4P96A 4LLGF 5LQJA 4YIFA 3KQWA 2GA1A 4F7ZA 2IH2A 1G8AA 5AIQA 2E1NA 3BJOA 3K69A 4EJTA 1BOOA 4PYQA 4ENMA 2PGXA 2DO7A 4A0XA 1EH8A 1BI2A 3E8SA 3CO6C 2ZULA 2RN7A 5FUBA 3SSOA 2QYOA 1DPRA 3K6RA 2GIVA 4A5MA 4FS8A 2YX7A 1L3CA 4I01A 4AZTA 2AN3A 3IHUA 3A25A 3CCFA 3LGAA 4KUMA 1TTYA 3G2MA 3F23A 2ZMEA 3RYRA 4AIHA 1I27A 4EM2A 1X1DA 3P2IA 2HOEA 5AIPA 5KYGA 2YUIA 1TLHB 2XBMA 1IAWA 5KK1A 1HKSA 3EEOA 2GAFA 4WCGA 3DV8A 5DYMA 3BXOA 1DL5A 2EJUA 1LDJA 3FX3A 1Z91A 5D6EA 3WGHA 1HXDA 1V4RA 3P9NA 4RTOA 1QGPA 1R7JA 4G9YA 5DM1A 1P2FA 3TO9A 3O6BB 3LKDA 2PX5A 2YX4A 4MWZA 1AOYA 1B59A 2JHPA 1YW9A 3ZP5A 3MQ2A 2IH4A 1ZRCA 2V9VA 3DFGA 1ZGAA 3KQTA 4UVBA 4CKCA 2VC1A 2NXNA 2WA2A 4RAYA 3QRFF 1J7KA 4GUAA 5HDNA 5FHRA 5CJ9A 4IHSA 4RSRA 2P8JA 2ZVJA 3LCCA 3BUSA 3LBFA 2B9EA 2O05A 2DULA 2OB2A 3ECHA 3FF5A 2ZIGA 2QQ9A 3NRVA 4GYGA 4L9JA 2GXBA 4HF2A 1BBYA 3TKAA 4POOA 3CJNA 2VS1A 5GOZA 3EVCA 3P97A 3H3ZA 4KWCA 4HGYA 1JSZA 2LNBA 2VE9A 3C0KA 4MTLA 3KP3A 5JI6A 4LK1F 5T64A 2EFOA 3S2WA 5TJJA 5KQRA 1P4XA 4ENJA 1FYKA 1IRFA 1NT2A 1V3FA 1P1BA 1ZH5A 2ADMA 4PCAA 3UJ9A 5EKXA 2AR0A 3VYWA 1I6XA 4BHPA 4MEXF 2OQRA 3HSFA 5GWXA 3U2RA 3DOUA 2XASA 4YMGA 3RODA 1LEAA 2FMYA 4Q4ZF 1FLIA 4ER0A 5ED4A 5DM0A 4IWNA 3SM3A 3KR9A 1BIBA 4E32A 2QVOA 4GCVA 4E70A 4WXCA 3F22A 3OFKA 3V97A 1Y0UA 3M9AA 1MDMB 3EVGA 4R6WA 3HCFA 3P7NA 3EUHA 4GYIA 1I1NA 4ER5A 2OZUA 1L1EA 1W4MA 4G7ZF 5HIJA 4BLVA 1XXLA 5G02A 2IDJA 4OQEA 5CCXA 4FX0A 4M37A 1YS6A 2RNJA 2A3SA 1VLMA 1J5YA 4DQ2A 1L0OC 2IDKA 4M9XA 2ZBRA 3MFKA 4I09A 5JVTA 2ZWVA 3U9GA 3UBTA 5GIPE 3JSPA 2GZWA 1XSDA 4MQ4A 1O3QA 2DTRA 3TKYA 5LQRA 5BOXA 1U8RA 1ONVA 4HA8A 3WTSC 1J59A 2VOOA 1EJ0A 1W7PB 1IN4A 2IJLA 5F64A 3HTXA 1R5GA 2DFIA 2HWVA 1JQDA 1WXWA 2XAJA 5CIYA 5FLXK 1M6YA 2H6CA 2K4JA 1NBHA 2BYVE 2G71A 2YR2A 1MKMA 1FY7A 4WK8F 4RTMA 4RB1A 1IRGA 3TFWA 4M38A 3PQJA 4QVGA 5MHTA 4FT2A 3KCCA 1FBSA 3R0AA 1KXZA 5JUWA 2ZCJA 3F8NA 1UWVA 4LLNA 3RKXA 2DU9A 4AZWA 5J8CA 5HLGA 3FXRA 3LAJA 5L3DA 2KIMA 5E1DA 3WE2A 1B9NA 4IRGA 1VPTA 4JBAA 4Z2YA 1SFEA 5ERGB 2CG4A 5FD6A 3G73A 4QQNA 2V1DA 3NWEA 4XBFA 3EDPA 4Y2HA 1O9HA 2HWKA 2DI3A 3T8RA 4AWXB 3C3WA 5D8LB 4IJAA 2QUFA 2NAZA 3WTZA 1I1GA 4KN7X 2NS0A 4HC4A 2OD5A 2A69F 2ZBKA 4ENKA 3TMAA 3KQOA 4P7KA 3GYHX 5EG5A 3WTXC 1G3TA 4O6JA 2JH8A 3I59B 2NXJA 3GF2A 3I4PA 3IL2A 5HS7A 3A27A 2LF8A 2EA2A 5L3GA 2R3SA 3OOPA 2G72A 2PX4A 1TW3A 3PS9A 4EM0B 1SD7A 4U0WA 3I54A 5L3BA 2FA5A 4PYMA 4G6QA 2K86A 4P7JA 2Y0MA 3KETA 2MD5A 5DEQA 1YG2A 2YVLA 1H9GA 1BC7C 3C1DA 5KVAA 3EETA 3HHGA 3NVMB 4QTTB 3EGIA 2HS5A 1T43A 4HX4A 2ZCWA 1J75A 1EQAA 4G56A 2ESNA 3PVCA 3CKKA 2UYCA 4HV6A 4IRIA 1B1BA 1YYVA 4LMYA 4RVFA 2P4WA 4KMUX 2P8TA 5FCDA 3A4TA 1YFHA 2I7CA 3LL7A 3ZN1A 3Q7EA 1HBXG 2YXDA 3I64A 3DLCA 2RC4A 2Z3YA 4U0YA 3DPLC 2FXAA 3VEPA 1D8JA 1P4WA 2QZ8A 2WK1A 2AVDA 4XUEA 4HF1A 4C04A 4HH4A 3VODA 1TNSA 5FHQA 2ZO4A 3IKVA 4ZYEA 1IY9A 2GWRA 2PXAA 1VBFA 2FK7A 4ISCA 4BHBA 3G2PA 4G7OF 1VIDA 2B25A 2K02A 3KE2A 2XAFA 4X1OA 1JXSA 1J2XA 3LKZA 5D5XB 1ZHFA 1QO0D 3BWBA 2YTZA 2Y75A 5EMLA 5LQUA 3ZMUA 2WTEA 4KDPA 5EEHA 3VC1A 1EH6A 3REOA 2P35A 3K1MA 2DPDA 1YB2A 3FPHA 5E1MA 1GXPA 2FMLA 4GQBA 3SSMA 5D4RA 4I98B 2ZMEB 3NWBA 2OQGA 5K1YA 2YQZA 5ICFA 3V7CA 4YG2F 4LK0F 1FYMA 4EKGA 4U7PB 4RTQA 3FM3A 1D2HA 3BGVA 1MDMA 3FUUA 2Y1XA 2IRFG 2IBSA 2ONZA 4QVKA 2IBTA 2BH2A 2VBZA 5CD1A 4C07A 4XCXA 3WTUC 3O31A 2UYOA 1XD7A 1XGNA 5DM2A 2C7PA 2PBIA 4L0ZB 3PFGA 1SMYF 5EC8A 3BWCA 4MQVA 1DUSA 4G94A 3UJ7A 3AWIA 2AOWA 4ASNA 4GC5A 2LSOA 3SQNA 4NECA 4E2YA 2DK8A 4LECA 3G88A 3SXYA 2IPQX 1QZZA 4O5VA 3FPFA 4IHTA 3EGEA 4EM1A 3I53A 2H11A 2V74B 3DPTA 5DSXA 3V7SA 2CW0F 3KQMA 4U7DA 3M6WA 5FWAA 1SUSA 1XN7A 5K5RA 5C0OE 5CVRA 4YUVA 2M87A 1KR5A 3EQLF 2PBFA 1QBJA 3PLAE 2DLLA 3KR2A 3LQQA 2XGXA 2E1CA 4U0VA 3TOAA 1IN5A 1Z6TA 3EMDA 2OBFA 2IFTA 5LRRA 2O3FA 4JXJA 4I2OA 4ER3A 3BGIA 3NMUF 2GB4A 3GW2A 2CWEA 1RJDA 3B3JA 1R36A 2UWMA 3LDUA 2BR3A 3R9XB 2QBYA 3AAFA 1I9GA 4HQEA 1PUEE 1IUYA 1F4KA 3IEIA 1STZA 3KHKA 3Q9VA 5LSAA 1FWZA 4A0ZA 2XV4S 2FRXA 5L3CA 3RPQA 5BP7A 2HTSA 3DXXA 2YU3A 2ZLBA 1VP3A 2MLGA 3DP7A 3EVBA 1ZREA 2HDCA 1R8YA 2PT6A 1S3JA 5B1SA 2PN6A 3J81K 4MEYF 3E5QA 5BPDA 3FZVA 2HV9A 2EWNA 3J80K 4C06A 2CMHA 3FMQA 1Z3CA 1VL5A 3T7RA 1LDKB 3BWGA 4BQAA 3KPVA 3C7JA 4NQWA 3BZBA 4TV7A 4ZYHA 3A7DA 1IN7A 1MJBA 4P5OA 3PFHA 5D1HA 2O8XA 5BW4A 4ESFA 3IWFA 3EGVA 3CO7C 2K4MA 1Q1HA 2O07A 1XCVA 3ZMVA 2JTVA 1EV7A 5EHIA 1WRJA 3MTIA 3UJBA 1JE8A 2NP6A 2O6GE 5L3FA 3U81A 2F5CA 2VT2A 4QLCU 2OA4A 1IN6A 4CZZA 1XVAA 1QNTA 5E9JA 3GRUA 4HAMA 5M5BA 3TO7A 1RI4A 2N47A 2OKCA 4HLXA 1K78B 5DX1A 4EQZA 3G5TA 3X0DA 3K1NA 4AVPA 5ICCA 3W6JB 3MTEA 3BOQA 3D2LA 5JR3A 3LQRA 1MZBA 4R6XA 2ZTHA 3KEOA 4N9HA 1DCTA 2L54A 2QWWA 1E17A 4ESJA 1BHJA 3WTVC 3HVIA 3I9FA 1GVJA 1HNNA 1ORIA 1X1AA 2I62A 2NP7A 3CUQA 1EG2A 2ZWAA 5K0FA 4RB0A 1BKYA 4EKIA 1UFKA 3E97A 2PWPA 5D8KB 4HW0A 3DXYA 3QOWA 4PYJA 4B09A 1U6GA 3FUWA 3KLNA 3L2CA 1LB2A 3TR6A 4YIIA 2ZZKA 2OY0A 5HDGA 3RDIA 4DCGA 4DKJA 3KQQA 1RI3A 3HSEA 2CL5A 2PSSA 1SVUA 3LECA 5LR6A 2PXCA 2NNYA 1MHTA 2OB1A 3FXQA 5P8WA 3QPTA 3KPWA 4PCQA 4L9NA 3BGDA 1G60A 2F5DA 3MB5A 2HKXA 1G38A 2P3LA 2JPBA 4XLNF 1TW2A 3EVZA 4H0NA 4FT8A 1P1CA 3SSNA 3FHZA 1N7JA 2Y1WA 5LHIA 3GVAA 3LFKA 4DMGA 1OPCA 4D0PA 3E3VA 3ABUA 5DX8A 1ZRDA 2ELHA 3I58A 2RDPA 1Z1DA 3BP8A 1TBXA 1AWCA 3C6KA 2EJRA 5GIOE 4L7VA 1PJZA 1S7OA 2K27A 1R1VA 4YFKF 4E33A 3ERCA 3I59A 4RTNA 3VC2A 2AS0A 3OV8A 2Z9OA 4OIOF 4WWCA 1I1SA 1OR8A 3UJDA 3M70A 3RW9A 3UJ8A 3LA2A 3T1BA 3KPJA 3I5UA 2XVAA 1BM9A 2OZ6A 1KPIA 5E2BA 1JG1A 3QU3A 5FLXZ 5DRTA 2DT5A 5F2NA 4PCLA 3C18A 2EFWA 3BY6A 2PFBA 1REPC 1P92A 5EGSA 4DF3A 2IH5A 2MBFA 1RNLA 3PQKA 1W5SA 1WS6A 5E2AA 4RWZA 2H00A 4P9UA 5E9QA 3B7PA 5K0CA 2OAZA 3BPXA 1M0EA 3LBYA 4HX8A 2D1VA 5EQJB 1XB4A 3ZMZA 4DCMA 4PWYA 9MHTA 2PX8A 2Q41A 1WWXA 4E31A 4YV2A 3L09A 2XAQA 3O2PE 3KKZA 1KP9A 5GP1A 2BR5A 4OU0A 5FWDA 3HRTA 2ZZNA 3FPEA 3CTAA 1RIOH 3G7UA 1SUIA 3HHHA 2G7UA 3ELYA 2UZ4A 1XDSA 4HBLA 5DDGA 3OZSA 4BLUA 4KMFA 5FULA 1UHWA 5DPMA 3M6UA 2VZ9A 2E5WA 5HOOA 2MLKA 4EK9A 4P7GA 2ISYA 3ID6C 3LPMA 4KDCA 2Q0OA 1FT9A 5FFXA 2L01A 1T38A 2M5WA 4C05A 2AN5A 4V0RA 3KP6A 5D5VB 3P2EA 3TOSA 3ELWA 2VONA 1YO5C 2BEOA 2Q8KA 3HCAA 1YTYA 1NW7A 3E05A 1ON1A 5LHHA 5DWQA 3JWIA 4ZZDA 2CSOA 4CGZA 3GO5A 2C7OA 3ZPLA 1SD6A 5EEGA 2A6HF 2NRAC 3LDGA 4DQ0A 5E1OA 1O7LA 5E1ZB 2IIPA 3SVZA 5DLYA 4KW7A 4RTKA 2FSWA 2ZFWA 1U5TB 3FM5A 5HS8A 3CVOA 1QZYA 4IV8A 2P7VB 2WA1A 4QTUB 5T67A 3OE4A 3PFIA 4AD9A 1N2XA 2P6TA 3OCJA 2W85A 4CICA 2X4HA 1T0FA 2O03A 1EIZA 5D6FA 3FRHA 5E8JA 3P9KA 3VB2A 2IA1A 3NW9A 5EIFA 1WZNA 2PMUA 1YZHA 2PJPA 3GCZA 3R0QA 1EH7A 2L4AA 3KZZA 2Z5UA 3DMGA 2EFQA 3N97A 3EVFA 1I5ZA 3G8AA 4EV0A 5DTMA 5LLQA 1YLFA 4M73A 1R74A 4L5IA 5CVIA 4OBWA 3OPNA 2JHCA 1BI0A 5HIIA 1OYIA 3PB3A 2UXXA 2QQAA 1NBIA 4OOIA 3OU2A 2W57A 3MQ0A 3BKWA 3KP7A 5FTWA 3HUGA 4RB2C 5LRSA 2DPMA 4RVHA 4UV8A 2HGCA 1R1TA 4YFNF 4XUDA 4KN4X 3UJAA 2A68F 2QENA 2FNPA 4FX4A 4BY9E 4U88A 1BI3A 3THRA 3RTRA 4NB5A 3M7GA 3JWHA 3WE3A 3HCDA 2BGCA 2L02A 5DCFA 5IH3A 3KLOA 3GZ5A 2EG5A 4B17A 5ILVA 2UZKA 1VQ1A 1X1BA 2KRFA 1FNNA 4LGWA 2ZNYA 4XUCA 2AOTB 3BJ6A 4CHUA 4OINF 2DPUA 4A6EA 1BN5A 2TDXA 2L4MA 1SKMA 2VE8A 2KJCA 3KR0A 1P4AA 3W6KB 5AONA 1R18A 5EMJA 4UXNA 1KQ0A 4HG2A 4EGZA 1XGSA 3T7SA 5EIWA 5BXYA 2ZBQA 2OXTA 1IF1A 1RI2A 3M33A 2F8LA 1UCRA 4PIMA 4ESBA 1P91A 3F4KA 5IKMA 3RJPA 4I0BA 1B4AA 5E1XA 3BT7A 5FA8A 4KFCA 4HRAA 1HSJA 4L9TA 1QYRA 5LBQA 2P41A 2VXZA 5DD8A 3EPPA 1QQIA 4YFXF 5HLHA 3MERA 3A26A 3K0LA 3HCEA 4ZTBA 2Q2EA 2M1BA 4WX9A 4AUKA 3ZMTA 1CGPA 2ZIEA 1IXCA 2VDUE 4HTFB 3GFMA 2HMYB 3RIEA 3IWZA 5LGUA 4OA5A 1XCLA 1AQJA 3QV2A 5J6XA 3QOXA 4A6DA 3FTDA 3JWJA 1DDNA 4P58A 2FBHA 3T0YA 2RQPA 1C0WA 3ISPA 3LX6A 2JH9A 4WVLA 2FNAA 4PYOA 1KA8A 3BWYA 3LCVB 5EMMA 4L18B 2A6EF 2YSRA 5HEKA 4HLYA 1FJXA 5K0LA 3KU1A 2EV5A 5H6RA 2YX1A 4XRFA 1KU9A 1KYZA 4H0EA 2IP2A 4KVZA 4YUWA 5DX0A 4JQFA 1R58A 2H09A 3DR5A 3I0TA 4G7HF 3SZPA 2C6YA 3F8BA 3CDHA 3NDIA 1AF7A 3MCZA 5LEKA 5HFJA 3HRUA 3KP5A 1NW3A 1MJFA 3CJQA 4M6XA 4UNOA 1FZPB 3PT9A 1XSXA 2PQ8A 2AOTA 5A2QK 3M4XA 1FP1D 2QLZA 3HOSA 2VBWA 3OU7A 4X60A 4RTSA 5K0EA 4RVGA 3ECOA 1Z9CA 3VFZA 2J5PA 5DUKA 3TGNA 4KT5C 2H94A 2OBPA 2ZW9A 2P40A 2LD4A 2LDUA 3RKWA 3KPUA 3PX2A 3UJ6A 4HGZA 1F1ZA 5FA5A 1JHFA 3M8FA 3DMHA 4YV1A 1L3IA 4Q47A 4AZVA 3THSA 3ER8A 2FCAA 5DT2A 3J80Z 5E1WA 2PJDA 3TOBA 1BC8C 3UJCA 3V4GA 2HKOA 2G9WA 1GXQA 2QBYB 4MQ9F 1D5VA 5BMZA 1R22A 2KJBA 2PLYA 1YW8A 3SXJA 1LVAA 1BC5A 1JG2A 1S8NA 3FTCA 4UV9A 1Z7UA 4L0YB 3QU6A 3P71T 2HEOA 1JQEA 3O3KA 2UXNA 4FR0A 4PYKA 3LDFA 2PG4A 4QWQA 3RIRA 4OA8A 1I4WA 2YXLA 3RKYA 1ZLKA 2D45A 2EB7A 1EAMA 2STTA 3SHFA 4LG1A 5A2QZ 1UHMA 2QRVA 2KKOA 2L3DA 5LHGA 3GFJA 3MEXA 2V79A 2OYRA 2E7WA 1JHHA 4YV0A 1KIAA 1IXSB 3N4MA 4OX9Y 2P3QA 3TQSA 1QANA 4ER6A 3CGGA 2DBBA 1TQIA 3H92A 2DAOA 4PZJA 2PLWA 4QDKA 2CKDA 4CXMA 1R00A 1ZQ9A 3F6VA 5K0NA 2P5VA 2WV0A 3UFBA 1SMTA 1G6NA 3R60A 3PX3A 3ELUA 2BBYA 3UWPA 1TQMA 3TM4A 3Q9SA 4YMHA 2IW5A 1P39A 1T2KA 1M6EX 5D4SA 3FPGA 3G8BA 3GGDA 4AIJA 3SMQA 5K0GA 3C3PA 3PTAA 3A7EA 3DMFA 1D3YA 1RZ4A 4X41A 3F72A 4HDVA 3FMRA 2HR3A 4QPNA 2H27A 2ISZA 1JTEA 1FC3A 2W25A 3ERED 5FQOA 4CDGA 4WXDA 4BYYA 4QQKA 3B5IA 1AV6A 4P55A 1NW6A 2F2EA 4LG0A 1KPGA 5DD4A 5CLSA 5E9WA 2M8EA 3WODF 2BM8A 3HNRA 3MGGA 4O29A 2O61A 5EKUA 5CCBA 4LFUA 4MIKA 4CWAA 4F84A 3DKWA 1CF7B 1YIOA 2HQRA 3V8VA 1PRYA 2AZTA 1HQCA 3SR4A 3OFJA 3QP6A 4GOLD 1Z05A 3TLJA 1SFXA 4LLLA 1QAOA 3MAGA 3E6BA 1KQ8A 3E6CC 4GGGA 1F9NA 3SGLA 4S04A 1XGOA 1EJ6A 5F2KA 4M74A 2YXEA 1IW7F 3IV6A 3GUDA 2JG3A 2Z6QA 4BP3A 1KQ9A 3WTYC 1JG4A 1F3LA 1LEBA 2JZYA 4BXUA 3QP5A 5DSTA 2PKWA 3DLIA 1NW8A 2AXLA 3EYYA 1N7IA 4RGSA 2AOXA 2UYQA 2A5YB 4M71A 3BKXA 2PV0A 5E18F 2LF7A 1G3YA 4HX7A 2VBXA 3FUXA 3MWMA 1X1CA 4IRHA 2GXGA 5LQKA 3KR1A 2PY6A 2VDVE 1FSEA 1ZKDA 2OU2A 1OR7A 1B9MA 1R5HA 3GRRA 3JTHA 5IT9Z 4KIFA 4L5JA 5CUQA 1NW5A 3M6VA 4ON0A 3MHTA 2XUBA 1S7AA 4OIPF 5DRYA 1RJEA 1INLA 2IA0A 2ZKZA 2GQQA 4B8XA 1RI5A 2FPOA 2MA3A 4RS8A 2XKPA 2IA2A 3IC7A 3WGIA 5DTRA 3GLXA 5CYVA 1DUXC 1VTNC 2ZZMA 4Y30A 4FHTA 3KP4A 1YS7A 2YPRA 5E8GA 3ZN0A 1H0MA 3Q5FA 1FP2A 1Y8CA 2C7QA 2O06A 2ZSUA 4I02A 4RTRA 1WQ2A 4EVIA 2PWYA 1WSUA 3HSRA 5L3EA 1QPMA 4UHTA 3FZGA 1Z6RA 1PP7U 4P9FA 5K8VA 2CYYA 1KGSA 1FX7A 4GO1A 4GOOD 1U2WA 4ETSA 3ZMDA 5TRDA 3WG9A 1JQ3A 5J8FA 3LSTA 3CUQB 5KQSA 1TQPA 3P9IA 2FF4A 3U1DA 2AOUB 3ME5A 2XROA 2ZIFA 3V8JA 1NHAA 2VBYA 2PXXA 2IGTA 1IM8A 1KPHA 4ZH4F 1KHHA 3F8MA 2ZNZA 1NV8A 3KQSA 5CVDA 4Q48A 2I9KA 3IKTA 3GO4A 3FWEA 4PDKA 3CUQC 4OQDA 2OZVA 2NXCA 2HYFA 1VE3A 1F5TA 3OE5A 2G7HA 2VODA 2XYQA 2HFHA 2O57A 3CBGA 3BROA 3KQVA 1RUOA 3HA7A 2AS5F 2KIFA 2LKPA 3HIFA 4ER7A 5LGTA 4DNCA 1JTFA 2P3OA 2W24A 5C1IA 3GNLA 2E7XA 3MCTA 2V1XA 1ORHA 1F38A 4A5NA 4MHGA 5E20A 5FO5A 4Y13A 4C08A 1X3UA 3E7PA 3G2QA 5LQAA 1R1UA 3E5XA 4PGGA 4N0BA 2PI0A 5BS6A 3TO6A 3F21A 3HRMA 3GRVA 1P6RA 2JT1A 1YW7A 3G5LA 2ERCA 3HEMA 3LCUA 3R24A 5EMKA 2OO3A 3P8ZA 2RVCA 3TDUC 1ZAOA 3GFIA 1XJ5A 3GEZA 3J7AO 5EZQA 1RJGA 2KIUA 2F5EA 4EJUA 3GX4X 4LB5A 5K03A 2QY6A 5HVQC 1WG8A 5HZMA 3GRYA 2PT9A 1LNWA 5FD5A 4EGYA 3ZQ7A 4U7BA 1RUNA 1K6OA 2CFXA 1YZ3A 3C3YA 2VDWA 1Q0TA 1ZARA 4MHTA 4BAYA 2FYTA 4PONA 3ER9A 5LQNA 1JG3A 1AQIA 4PYIA 3K2ZA 5F1RA 3F8CA 5GM1A 4E30A 5FQNA 1HW1A 1RJFA 2OPBA 3E6MA 2FK8A 3WSTA 4YUYA 4PYLA 1WXXA 3KFWX 4ZYGA 5E8IA 1JR4A 3Q87B 3LWFA 1G6Q1 1JGSA 4KRGA 1IXKA 4P7FA 4GF5A 1WY7A 4HZFA 3DH0A 4IKPA 4X61A 2EFPA 2QM3A 3HTUA 5K0BA 2GS9A 1HMYA 2FE3A 5KVRA 3M8EA 1X19A 4FP9A 4MTDA 3P9CA 1MJAA 3WGGA 2VOPA 1E2XA 1XMAA 5D5WB 5DM4A 1ZRFA 4OBXA 3WU0A 4R8HA 2EK5A 4BH9A 1W7PA 5H6QA 2Z6UA 2MH9A 5DUIA 3TPZA 4EJWA 5BW5A 4M9ZA 1PP8F 2WC2A 4CXFA 3HCBA 1O57A 3C6MA 2BM9A 4C4AA 3D5LA 1IXRC 1RI1A 2HZTA 3QOPA 3V8KA 4RX1A 4EJOA 2B3TA 4NHJA 1XCBA 3TQNA 3KP2A 4RB3C 3KQYA 4KIBA 4F85A 1YQAA 2ACJA 4BHCA 2FQ3A 4HQMA 4HYEA 5ILSA 2ESHA 5GM2A 2ZXJA 4K6MA 1KU2A 3IRRA 2GA9A 3BWMA 2BE5F 1D2GA 2PVCA 3NVKI 2C7RA 4EMSA 1O9GA 3SX0A 1KYWA 3GWZA 1U5TC 2WWYA 2JJQA 3B3GA 1MD0A 1BOAA 4GC9A 3AY0A 3LHDA 3AJDA 4F86A 2XKOA 2M30A 4HF0A 2P5KA 5JHUA 2HNKA 1PDNC 4E2XA 4WF2A 5C9ZA 2GH1A 2BV6A 2FHPA 5K5OA 1YFLA 5BQTA 5BPIA 1XMKA 4KYWA 4FGZA 1IN8A 1TNTA 3TM5A 2GLUA 2PEXA 2NNNA 2PX2A 3JTGA 1OKRA 4GEKA 2ZFUA 3ZMSA 3I71A 3B73A 1U3EM 3EVAA 4RGUA 2XYRA 4HV5A 4PNEA 3ELDA 3ORHA 4M9SA 1XCJA 2D1HA 1QAMA 3HA5A 3V8LA 4UVCA 4LWPA 2QE6A 3HOTA 4IVNA 1FYLA 1DP7P 1VP9A 3ULQB 2V6CA 4M7RA 2AN4A 1L9KA 5ICEA 4RTPA 2V7EA 5K05A 3K9TA 4OIRF 3V7RA 3NEUA 4ZYDA 1RI7A 4FSXA 3IHTA 1HKTA 4BNCA 5CVJA 2BZGA 3JAMK 2ADUA 2A61A 2IPXA 3K1PA 4CKBA 3LA7A 2EV0A 1S6LA 2EV6A 4A2UA 5IT9K 4RVDA 3HVHA 2D2WA 3RYPA 4ATNA 2AOVA 3AXSA 3RI4A 3VSEA 1ZYRF 4QDJA 4QPPA 2NNWB 2ESRA 2XHKA 3ELKA 2XAHA 1KU7A 5HDKA 1WKMA 2MC3A 2RKHA 4XSZF 2DQLA 4X63A 3F6OA 6PAXA 1XGMA 3L7WA 1R23A 3H2BA 3DXJF 4LJZF 4C03A 2FBKA 1UB9A 1FPQA 5ILUA 2Z33A 3H3UA 2G8NA 1J9IA 1SQGA 3M1EA 2B78A 3OZTA 2XVCA 1NV9A 5JFRA 1ZLJA 2R7FA 5HS9A 4AZSA 5HOQA 3EYIA 1XSVA 1ZG5A 4K2EA 2FOKA 3L9FA 4A12A 4RYLA 3K0BA 2BR4A 5FADA 1NKVA 4IXAA 3BZ6A 3MAJA 5HILA 5T6BA 4CYDA 3DULA 10MHA 1T98A 5D1NA 7MHTA 2K7LA 4HOBA 3RPUA 4XSXF 3DUWA 1K78A 2Y48A 3HCCA
chains in the Genus database with same CATH superfamily
4LD5A 1KK0A 2PWZA 2Y0EA 1Z4MA 4JOCA 4I5FA 1Z22A 5SY9A 3R3WA 1Q84A 1YMQA 4NU6A 4PGHA 3ND6A 5DYGA 2PMZN 3HTSB 4I1IA 3KIOA 4EQQA 3ZQHA 1BN6A 2Y27A 2AJ8A 3P2YA 1CF7A 3QWIA 1ZG3A 1F4VA 1LQ2A 1SCJA 2VLIA 5A7HA 4DHWA 2BHYA 1YGYA 3PJFA 5U1PA 1PR1A 3U3RA 1UBSB 4R1MA 2YR0A 5F0HA 4K88A 3QAHA 4N1AA 3T8TA 1Y8QA 1ZUD1 3QPHA 3GXOA 1L3LA 2NU7A 3FI0A 2QZ9A 3NBMA 4K9PA 4REQB 4D44A 3IAXA 3QLUA 1L8AA 3V8BA 3ZIUA 2PZGA 4XLPF 3PR1A 4DE5A 5AI9A 2VJAA 2LCIA 2PXHA 1YNOA 4GZ6A 4B2YA 4YAGA 2L69A 2MIIA 1ETKA 2R60A 2AOUA 3HBJA 4BN0A 2J5QA 4ITUA 1ULYA 2BEWA 2HQBA 1QIIA 3IAS6 2OHFA 4NBWA 5CH3A 5CFQA 1KI2A 1OX6A 1KEEB 2CXOA 2OECA 3HADA 3OHSX 4KJXA 1Q83A 4O59O 4EI2A 2NVXJ 2C4HA 4A4DA 5A4JA 1TAGA 1R16A 4XQCA 3FIUA 1E1LA 2WWHA 2PVPA 4EMBA 1NLZA 1YUBA 3K8QA 1E2MA 3G2OA 3U62A 4E15A 1S29A 1WCIA 5D3MB 1FC0A 3PNLA 1QIJA 1U11A 2PGIA 2OWDA 4K7JA 1E20A 2IW1A 2XRMA 2FFHA 3ABRB 3NUZA 4KH0A 2WHRA 5FRDA 5T7BA 3HZJA 2OBBA 4N5HX 3EX7C 2FPPA 4A0QA 5FI1B 4DBVO 5TR9A 3I62A 4XVHA 1XZMA 5HM6A 1XEWX 4XDYA 1AQ6A 1VNDA 3AG4H 3FMSA 1KMNA 3M34A 2QMOA 2WB4A 3K15A 1ZM3A 1JJVA 2O1XA 1IUFA 1P9QC 2UUPA 1E3TA 5IY5H 1Y4UA 2EFNA 4JUBA 2Z2YA 4A03A 3ZIAA 1SG9A 3UMBA 3J81Z 1Y7PA 3ASZA 3H8VA 1UXIA 1MW9X 3JWGA 2COMA 4OHBA 3GPDG 1VC2A 4CG3A 4DM3A 1XEFA 3GT4A 1WI3A 3DW3X 3PIIA 4BQIA 1UDRA 1FBNA 1JJFA 3CKYA 3WNDA 4EL0A 4II2A 5E7JA 2VKVA 4TMXA 4PIVA 1U8YA 2P7CB 4R1HA 1MG0A 2Y1DA 3IQZA 4QE3A 4BV8A 9GPBA 2E89A 5KHOC 2XSZD 2BZTA 1XDUA 1QJ4A 3PKZA 4P2GA 1ZMXA 2WHYA 5HDQA 3C45A 3H9GA 3JSXA 4DIEA 2KMLA 4CTJA 1QQ7A 2H1HA 2X0NA 1A31A 3DFIA 1U1EA 5CXQA 2OZEA 3RSLA 1C7RA 1KJNA 3H1PA 4RZUA 5LA6B 1U3TA 1X1PA 2ECFA 2YV5A 4IJQA 5G4KB 4A2WA 2XTZA 3H2KA 1WI9A 2IXTA 3FBIB 1D2AA 3BPVA 2QZJA 3B3FA 4WBNB 4BMOB 1J9ZA 2JLSA 1FLNA 1H4VB 1Y1KE 2TYSB 5IJ0A 5CLGA 4B6JA 3D3QA 2HMTA 1DC7A 1BVRA 1Y5MA 1M8PA 1BQ3A 1HSTA 2HT6A 4MRRA 1SD4A 5GONB 3W9UA 5L7WA 1G20A 2BTEA 3WU1B 4MEBA 1DHTA 1RSZA 1GTVA 4OHWA 5F2OA 5JMPA 3JRWA 4PE5B 3T5XA 2FP3A 3U21A 1F0KA 1IUOA 3QPSA 2HTEA 3B7GA 3OY7A 4QGBA 2DCMA 4Q1FA 3OYNA 1ZJ5A 4KPFC 1T35A 3M4OJ 1CJVC 1ODTC 4P1WA 2FDXA 1D7OA 2H8GA 3KC2A 4LI3X 1EWTA 2VF5X 3J7AY 5EP3A 1YFJA 4UEQA 1B42A 1MEOA 4MA5A 3AJEA 1NJGA 2FLKA 5I3CA 1WHUA 1PJ3A 2L82A 3A03A 3LY7A 2W6QA 1D0YA 4NV3A 5F9MA 4GOND 2E2WA 5F0FA 4M6VA 3BFKA 1H9CA 1JJIA 4AIIA 2N1BA 1X92A 3AUUA 2YY6A 3ECAA 3C48A 1ARZA 3B1XA 4G1VA 4GZLA 2Q7XA 1M1UA 1MAUA 5CM8B 1VRCA 2BMAA 2ERYA 2JDIA 1O3RA 3ROUA 4KA4A 1SXIA 3DAFA 4I55B 4YJFA 4KIGA 3OE7A 3MGBA 5CYOA 3T3DA 4EG0A 4MS4A 1GPJA 2VF7A 1UFMA 1W9MA 1P61B 1AGXA 3B9QA 1KQFA 4KNYA 1V9CA 2CXHA 2FSVA 2XYVA 5EJIA 2DQRA 1WDLA 4M3GA 4OI1A 1LDYA 1NATA 3HFGA 3CYFA 1ZUNB 1US8A 2WJ6A 2XMBA 2PJRB 1XEXB 4MGKR 1YQXA 4X91A 2CFOA 2GPTA 1YB4A 3VR6H 2P2SA 3CZMA 3WDMA 5BPFA 5CA1B 3ZDBA 1BWQA 2IIBA 2PKQP 2VQ3A 4HFJA 1ADGA 4Q66C 4TKVB 2QX6A 3F8SA 4N54A 3RTCA 1U78A 4DUZB 1J09A 1PT5A 1UT8A 2YWFA 3KSMA 1OYYA 1CQIB 4PLFA 2HT1A 4QTXA 1VYTA 2VHYA 2XAGA 2X2FA 3VX4A 4OQYA 1D5CA 1EP9A 3ZD7A 1H89C 1Z62A 1JE0A 3QVXA 3PCXA 1TYDE 1ADFA 1FMCA 3AXTA 4LG0B 3DF8A 4DGSA 5CCDA 1AHPA 3SZTA 3P5JA 1LNQA 1P7JA 2QQ0A 3ILSA 4OGWA 4M6YA 4EATA 4AK9A 2FZCA 1NH3A 4E2ZA 1U0FA 5JVDB 2KYRA 3GDHA 4BDZA 4G4SO 1NJ5A 4WCDA 2H4ZA 1TPYA 3GFQA 4YPVA 1NRIA 2JHAA 5KUTA 4XYGA 3KL4A 3H83A 5HLIA 1ODJA 2EINH 2WILA 2WSIA 3GLFB 4L8WB 5DOZA 3U61B 1HW2A 3RRMA 1XZNA 3GOQA 1CFJA 4MUGA 1KJWA 1PF7E 3U7JA 1RLTA 2O0LA 2ZE5A 3M6XA 1K79A 1N3BA 4MB2A 4WA8A 2FFBA 5JEEA 4DR5B 3THWB 2BD0A 2VXBA 1ZD4A 2M32A 2WWTA 2C84A 3AIOA 3I0ZA 4QVIA 4RO0A 1ZJ4A 3FHCB 3FXUA 1G2HA 5T8KA 1ZIXA 4CTKA 4IICA 4TN5A 1JDBC 2GCEA 1R5NA 2COBA 3CDLA 1VTKA 1A88A 2AKYA 2EFGA 4HSRA 1G3QA 1APLC 1NHWA 2PZLA 1R0RE 2PYDA 4XKCA 4HAOA 1QIEA 2LKXA 4ZZLA 1EB8A 4EBBA 3LBHA 3HRSA 1DXYA 3ETCA 1GL3A 1ULBA 3CH4B 4UE2A 1KWKA 4F5DA 2IY8A 3O4FA 3SC4A 5C5EA 2NQ2C 4Z4HA 1SU7A 4ZAVA 3F7TA 2ORED 2O2SA 1Z38A 4QICA 1NRXA 4YFYA 3ZNNA 4KAXA 5FOQA 1CDOA 1W5TA 3CNNA 5B55A 2B8WA 1G21B 2RB5A 4FYJA 4TWAA 1H6DA 4I5GA 1JL3A 1D6NA 2VQLA 3N6XA 2W6JD 4FX2A 3VBCA 4IRMA 2BWJA 1V1JA 1GWNA 4N3AA 2MH2A 2HCTA 3LXXA 2QRMA 4TGLA 1E4OA 1L1FA 3RTEA 3VZCA 1CJBA 2UUZA 3ZC3A 2BFCA 3N74A 4JBXA 3TB4A 7REQB 4U7JA 5FL7A 3NCTA 3OMLA 1NF2A 4UD2A 3TX2A 3PU6A 4DRYA 3N3AC 3SJMA 2PH5A 3PNMA 1XMPA 3H17A 5C53B 3HMQA 3PR2B 2CVHA 3K6SA 2O0YA 3H4MA 3JQ8B 2JFFA 2OXCA 4LHZA 1QE5A 4LWOA 3RYHA 5FKJA 1K4YA 4CM5A 5LN1A 3DLLF 1P4HA 821PA 2BBOA 3MRTA 3UATA 3FNIA 4PYNA 3B6ZA 1W0UA 3BRCA 3D4NA 1RQGA 4BRWA 4ECAA 2BKUA 1U0GA 1F4PA 2QD3A 2CLIB 5FGMA 2QX8A 2OM2A 4KV9A 1LE8B 4MUJA 4J8PA 4ZRDA 1KE2A 2C92A 5E3NA 1F60A 1YQQA 3G49A 3P5BA 2D7DA 2PMHA 2DXIA 1VGVA 3MKZA 5KDOA 4V2IA 5EERA 3AWDA 1VGQA 3T1TA 1USWA 1JZQA 1GSOA 2RK6A 5D8DA 2XUIA 1K06A 1RCUA 1VL1A 1F9AA 1ZI8A 1DOHA 2RGXA 1J90A 3ZH9B 3BZUA 1OASA 4ZYWA 1TU3A 4NCJA 5BVHA 4X6YA 1FE8A 4EM6A 3NQOA 1C0EA 3WLOA 1F8FA 1ZXLA 2Q5LA 3BE8A 3WHKA 2IX9A 1L4GA 3BEDA 4MNUA 3BH0A 2M9HA 3B89A 3FPAA 3H7AA 2BEUA 4NG5A 1U1CA 3IPAA 3W3AA 5G4KA 1L7NA 3L4BA 4XWTA 1NNSA 1XSEA 2I0FA 4Y3UA 3WK8A 4EEKA 1PLJA 2F43B 5KTOA 4I7HA 5ENDA 2HQOA 2XOKA 2VC0A 2H07A 4R7ZA 3RUHA 1Z2OX 5B3LA 3GJSA 2CY0A 3J7YJ 2HJHA 4L4UA 3CUOA 1QGUA 3MJHA 1RP1A 3HN2A 4ARZA 1V39A 1OCCH 3HVKA 3R74A 2P7IA 4B3HA 2V7UA 4B45A 1LUAA 3OCYA 3T7TA 3WIEA 2C77A 2DDAA 1E2FA 1IEVA 1NKSA 4RENA 3QYFA 4TTRA 5DLQC 3E8MA 1HC8A 3CLSC 3SKVA 5IKEA 3KXDA 2V1UA 5TMDA 4BMCA 3HGTA 2OUMA 5GTIC 4GOMD 2CMGA 2QZZA 1QRRA 4X20B 4BMYA 1JEYA 3F3XA 3LXMA 3ZYCA 3UH1A 4RXTA 1G8SA 1VMIA 1S2OA 2LYCA 4UTPA 4YJ2F 3B6MA 4O02B 3WA6A 3VPDA 1T0FC 4AYBA 3H0CA 5COQA 2CXUA 5C81A 3CWCA 4E4YA 4RGRA 3LAPA 3DBOB 1W7PD 4IDGA 3P9QA 1GOTA 1V0JA 1YL6A 2AT1A 4IJUA 3ISJA 5GP9A 4AY4A 1JSXA 4BFWA 2YHBA 4CT4B 1LI7A 2HF8A 1T9CA 2QQBA 1XFDA 4PPYA 4JJEA 5TARA 3UMCA 2GA1A 5LNK6 1WBJB 4G5XA 4QGHA 1Z67A 5M5YJ 2DQSA 1JMVA 2G9UA 2HHCA 2VWGA 5HF6A 5AIQA 2OYSA 3WC4A 5IJ9B 4ND8A 1A9TA 3D0OA 2DEUA 2VCYA 1GGMA 5ABPA 2TMDA 3M4JA 3VDQA 4ENMA 4LY9A 5KPJA 4E7LA 1RM0A 3BRWA 3KVNA 1D0VA 3OZBA 2XZOA 5LD2B 2OMKA 3A06A 1Q1QA 1NTCA 1SGWA 5B3JC 4LKRA 2WLSA 5IP7J 5IG2A 1BI2A 3P0JA 1WB9A 2CT8A 5DBEX 3CO6C 1RHMA 1ST3A 2RN7A 3PXBA 1KOFA 3SSOA 1P45A 2QYOA 2EIHA 2QP3A 1HQKA 3LRXA 3GEHA 1ZSNA 1IJEA 2NO4A 3K6RA 4HAYA 1AUOA 4FS8A 1U9ZA 3DDSA 3OMYA 3JQPA 3CQ9A 1NFQA 1WFXA 1BAPA 2Q9AA 1KBZA 1QBKC 1JSLA 4Y52J 2YFYA 3KXLA 3CCFA 3O9VA 4AG3A 2BEUB 3PQ8A 4KUMA 5KNCD 1HG0A 3KXIA 2KJQA 4LSGA 1TTYA 1GRCA 1W76A 1RC9A 3AEKA 3RYRA 1MV8A 1RLMA 2V7GA 4B75A 3PJEA 5KTPA 4XR4A 4MMZB 3E6AA 3AW8A 4IDAA 2XWPA 3S3MA 3PFKA 1L4EA 5HX7A 5TJHA 4PICA 4EUFA 1TLHB 1MOZA 3WXBA 1NK3P 4PBSA 4TZKA 2EZKA 1D1QA 4CV3A 4OUDA 4YAJA 5J5AA 3RC1A 3WZMA 4ENRA 4DUYB 1MZVA 2H5EA 1V8BA 4UC0A 4AY5A 5H2FC 5HJ2A 5L3VA 3TZCA 1G7RA 2R4GA 1KI6B 1H2YA 1Z0DA 2HNBA 5ECGC 1MD9A 3WGHA 3MS2A 4ZTZB 3P9NA 1X7ZA 1W1WA 1GZ4A 3JRXA 2WOJA 2A4KA 1R7JA 4QBIA 5A3JA 5DM1A 4JBIA 3HNOA 4K9RA 1ACIA 1XQ9A 3HKEB 4JYBA 4LZJA 3Q5GA 3O2QB 1IM2A 2Q2WA 3LKDA 1CF9A 2I80A 2HKIA 4K2AA 4MWZA 2VRWA 2VDMB 4JZKA 2JHPA 2B99A 4DNPA 1ETXA 2Q2OA 2IH4A 1ZRCA 1GCUA 3L18A 4GI7A 1SG6A 2X22A 5H81A 3ZCRA 2BXZA 1L7DA 2RDMA 4LOJA 3OFVA 5JS6A 2VC1A 1GGVA 1YQTA 1I6MA 2R1UA 4FN5A 2ADFA 4GR4A 4NV0A 5JS7A 1WCXA 3V42A 4I66A 1S3IA 4DRXB 3UK2A 1J7KA 3L4EA 1R1DA 3DWFA 4Y6GB 1DKRA 3BR3A 5CJ9A 3QUSA 4M55A 1RMYA 2KB0A 4QHYA 2QTNA 3T5GA 1T0HB 5ALVA 3VYSB 3T5AA 3S8YA 1XHEA 3BUSA 4IKEA 4XX1A 1ZRHA 5DHAA 3EUKL 1LPSA 2VHZA 5ELLA 5KSPA 5B1EA 3DHEA 1T8YA 1AHNA 4AJLA 1QO9A 2QSZA 4YDHB 4U3JA 3KZCA 2QQ9A 4UU8A 2HRZA 1SCQA 1B93A 1BBYA 4IJKA 4Z9YA 4YO8A 1W36B 1WMSA 4R1TA 2JAHA 5GOZA 1OX4B 3H9QA 3B20A 3FCSB 1JDSA 2ACKA 2OFFA 1BE6A 4ZAZA 5ADUS 1AIPA 4GVPA 3BSYA 4X90A 4JN6B 1M1NA 1UKCA 2P68A 2R1TA 1JSZA 4HGYA 4JUCA 3BMOB 4R2JA 1NOIA 4DLXA 4JXZA 4MRPA 3BJIC 4BY7J 3BFXA 1OSNA 3C0KA 4DN6A 4YCCA 1E79D 1OC2A 3TLMA 4LIUA 3VO8A 4AU7A 3RU2A 2ZT6A 2EFOA 3S2WA 1PS0A 3LA8A 1W88A 3CP2A 3OS0A 4ENJA 2OCBA 4YMUA 1NT2A 2ZXUA 3SC2A 1RQ7A 4DEVA 3VDXA 3SEQA 1P1BA 1TNDA 2F1JA 3KTAB 4IH4A 4DV2B 5TS3A 1O6ZA 2KBEA 6PFKA 2ADMA 4XFDA 1PL8A 4V3CA 5J4VA 3SOZA 3F0CA 1I4TD 2POQX 4OHKA 1DT3A 4UBKA 4WK4B 4EG7A 4EI7A 3OOSA 2BUCA 4H59A 1DU6A 1UJ4A 1SU8A 2J48A 1P17A 5JNTA 2OBMA 4PAWA 1XNRB 3F67A 4C2AA 5EKXA 4M53A 3WTBA 5TY0A 2XQFA 4MVJG 2EXXA 5A05A 3TLXA 2VH2A 4BQEA 3FPSA 1ZW1A 3U2RA 3DP9A 4RKRA 4Q9KA 2P9BA 2QTWB 2XASA 1HOXA 1VGRA 3DOUA 4M7WA 1AO0A 2BFEB 2PSEA 1H6AA 1J2RA 3PFNA 1FLIA 5FFFA 5DM0A 4PN7A 1YULA 3ABSB 1ONNA 2J41A 2X0RA 2ZU6A 3F6SA 2D2EA 3PFCA 3KR9A 3JQAD 1NVUQ 4RVSA 2J9FA 1V8OA 2QM7A 4CCWA 3FDFA 5I7SA 1E1QA 4Z4EA 3HQ4O 1BIBA 1WZEA 1IZZA 3OLWA 1JAIA 1NP3A 4H7EA 2JBAB 1OBVA 2P30A 1SKYB 1E69A 2WMYA 4YEDA 1DXQA 4YRKA 1FTTA 1YS1X 2D62A 1V16B 1KYIA 4FJ0A 1WMBA 5B2FA 5IK2D 1JZSA 3OFKA 3GG2A 1F1BA 1UFRA 4FBMA 4UUOA 3QQ5A 4XD7D 1Z8DA 3V97A 4HAWA 5H83A 4ZC3A 3ONQA 2FWIA 2WR8A 2NS7A 4Q9NA 4M3NA 3RASA 5K8JB 1OI3A 4E7SA 1EMDA 2JCXA 1D2MA 1JR3A 2W2MA 1YZGA 4GYIA 3JXEA 2V9CA 4A0SA 3DQPA 2Y4OA 1IH8A 1K8RA 2H48A 3GTMJ 5HUHA 5AVRA 1L1EA 1W4MA 1DIGA 4G7ZF 1ZXXA 1V45E 2Q3CA 4IQ8A 4RD3A 4C76A 4JLAA 1HNZB 3CR7A 3OLQA 1RRKA 2IDJA 1O1YA 1IHDA 1Z17A 1J8YF 5G02A 3A6EA 4U7WA 4FX0A 1TLLA 1Y4AE 2IY9A 4JNKA 1UCFA 2RNJA 3O3MB 4FDVA 4ZVPA 5BQPA 1TI7A 2FQXA 1DEXA 4CF4A 5A2GA 4M9XA 3BHJA 4PSKA 4OXXA 4IHAA 4I09A 5JZ9A 4CIAA 1N2GA 3CF6R 4EO9A 3H16A 2FU5C 3Q0TA 4XASA 3NUGA 5EIXA 1JT6A 4A3JJ 2W93A 1QTQA 2PRZA 3JSPA 4OATA 1VE7A 1SUCA 1W47A 1GXSB 5TLSA 4WLEA 4MQ4A 2Q3JA 3ZGYA 1EWVA 2WBLC 4D3SA 3EPJA 4YMIA 2EYQA 4Z1MD 4LY0A 4C22A 1O3QA 3CRW1 3ACDA 1DRVA 2GPAA 5DOVA 4EHAA 4HA8A 1ZMOA 3WTSC 1U3VA 3UHFA 1NVVQ 5LA6A 3H1AA 1EJ0A 4JI3B 2OCIA 3HTXA 1R3UA 3KB2A 1S2LA 4L8FA 1GV2A 3LUJA 4CV0A 3I92A 3CCUI 1JHDA 2GLOA 1EJ9A 1WXWA 2WU4A 4KK4A 4XX0B 2ETXA 2D59A 1N6HA 4MGEA 5FLXK 4O4LB 4C4SA 2JLYA 1Z26A 2XA2A 2K4JA 3FX2A 2I2AA 2VBFA 2BYVE 5ER9A 3RE1A 2G71A 2RHRA 3ZQIA 1L8XA 4LDRA 2ZVQX 3KAPA 4RB1A 1IRGA 1Q22A 3N0TA 5H3LA 4M3DA 5KC8A 4EOGA 4DQDA 1X3SA 3T7AA 2R5YA 5B37A 5JJLA 4DYVA 1GXSA 1QZ3A 3SNKA 2OC9A 2B21A 3IEKA 4BLSA 3I32A 2X4IA 1DGWY 1FBSA 4D9JA 2EP5A 1Y1SA 3D6UA 3JD1A 1GQ2A 1KXZA 1U9YA 2R8RA 4TWIA 4V0ME 5D51S 4L8LA 3R9IA 2ORIA 3U4CA 2F67A 2Q4EA 3K70B 2FFQA 2QEQA 2WE8A 1H4QA 4NUBA 1GYQA 1YXMA 3NDRA 4JQOA 5G2OA 4AIRA 3EXIA 3LG2A 1RTTA 4I1VA 2DU9A 1O0CA 3Q0WA 2AG5A 4TL8A 3PUVA 2GZ1A 5C2JB 2DUJA 4E7ZA 3LVRE 3L7BA 4G09A 1PZHA 4AZWA 4QYSA 5J8CA 5HLGA 3LAJA 1WXFA 4BO3A 4JODA 2KIMA 1NR5A 1XBTA 1YE3A 2C1XA 3I6IA 4KODA 3AERB 2JA1A 1KOLA 1VPTA 3ZHQA 1PFQA 2EBFX 1AS0A 4JBAA 2GBPA 1SXQA 4EEXA 4DLKA 5ERGB 1FFWA 2N0SA 5KNBH 1U7WA 2F64A 3SE7A 1T9HA 3TG8A 4NK4A 1K3UB 2HIHA 4LV5B 1QRTA 4QQNA 1V6AA 3EY9A 4EF6A 1KARA 1SWWA 3BTIA 2HDWA 5AQEA 5LMNB 1J9EA 1JDPA 4NMXB 4Y2HA 2VK8A 1T2UA 1A35A 3THWA 3MJVA 1ISHA 4FCVA 3QFRA 4LOKA 3WQHA 3T8RA 4B6FA 4AWXB 3C3WA 2OTJI 3KB6A 1FFDA 3N2EA 1HDDC 1K5HA 2NAZA 2Z8ZA 2A4MA 3E1KA 3IUYA 4PAMA 3U5TA 3HXMA 4KN7X 5F76A 3UANA 4FB4A 1PWZA 4GP7A 4KBGA 4NFSA 2Y9MB 3W5DA 2YIJA 4ENKA 1JVNA 4C1BA 4C0XA 4R01A 1QHHD 4BKPA 1SQSA 2PMDA 3ESXA 4P7KA 5IM4F 1EVKA 5SYMA 3AHDA 2ZUVA 5EG5A 1O6CA 3K1YA 4HBZA 3J7AC 4XPIA 4NDNE 3I59B 2NXJA 3G0IA 2PEZA 2WAOA 3ED5A 3V48A 3GTJJ 1RYDA 4D0GA 2M7AA 2WPDD 4GKBA 4QD3A 1N8SA 2W71A 1T6NA 2LF8A 1GGJA 3HKCA 4NMLA 1JS1X 1TM1E 4RD4A 4UCWA 2R3SA 5EYPA 3VKVA 3ZWCA 5KOJB 2EHDA 4H4DA 1TW3A 4FUQA 1Z5OA 2I03A 4LEIA 3BXHA 2HMVA 4ZD6A 5I7OA 4RAQA 2FA5A 4M9UA 1KKMA 3B9RA 5JDCC 2H1IA 4D82A 1MH4A 1O97D 2Q46A 2R7AA 1NMYA 1OFGA 1YHNA 4MMXB 4P7JA 4EHFA 2ZYHA 5CAEA 2Y0MA 3KETA 1I7NA 1OH8A 1RWMA 3CZ6A 3GHYA 1E1YA 2YVLA 2XZTA 1NXOA 3URMA 1BC7C 1B6GA 2A0WA 1Y6FA 3RJTA 2NLOA 2IYAA 3HHGA 2BBSA 2C2WA 2OXEA 2V7QA 3CPEA 3MMNA 3PRJA 4JLUA 1EJ2A 3TLGA 3QE0A 3TXXA 3ZQ4A 1Z8FA 5B1YA 2ZCWA 3NPAA 3PQ5A 5KYKA 3QEMA 3H5RA 4HRIA 5HE8A 2ESNA 1CUZA 2Z2XA 5HLTA 4U87A 3LZDA 4WHMA 3W6UA 4FNMA 1C2YA 1FMJA 3PVCA 4CM8B 3AHCA 3HACA 4F6CA 3MKWB 1B1BA 2ACVA 1KFKB 1LDMA 2AJTA 2XVYA 2JZNA 4KIJA 3WS7A 1XDDA 1FVFA 5JY1A 2FSSA 3GVHA 3TLAA 1A7UA 2B8TA 3H9CA 4BVLA 5FCDA 3W6OA 4B3RB 3TIIA 1X7XA 5E4TA 4YBRA 1A95A 2NGRA 5LBTA 2KSQA 1IHOA 1FP7A 2FMUA 1ZMRA 2YXDA 5B1HA 1FUKA 4LX8A 4YK7A 2C5BA 2L0XA 2O9JA 2O2XA 4NDZA 5FPHA 2FXAA 2W6ZA 2EC5A 2LKDA 3N6VA 4UPDA 1RZRA 1H94A 3I1IA 4AP9A 1B23P 4D41A 2LNDA 1P77A 5AKZA 1Q1VA 3BJRA 3MMZA 4QC2A 5HF8A 2I91A 2YWCA 3IEPA 4IW3B 3U3JA 4OHYA 4F93B 1H2RS 4D3YA 4QTYA 5JJIA 4HF1A 1KFBB 5K0GA 2YNMA 3ICOA 7REQA 3RTGA 2QUAA 2B4RO 4PLVA 4BJ6A 1MR3F 1W9HA 2NO6A 1KZ4A 3QK7A 2ZDQA 5E3MA 1V71A 3EZLA 3RIXA 1DTWB 1UQTA 1LH0A 1VBFA 4CRWB 4D3DA 5B6PA 1KRWA 1T10A 2FK7A 4JI1B 4S0ZA 4BHBA 4G7OF 1G9TA 4E13A 3KEGA 3ZHZA 2Q5HA 5ALPA 5KMGB 5JQGB 2XAFA 3AHFA 3NWSA 4BJ5C 3LS2A 3O2JA 3HU3A 4EKYA 4D9HA 1IVNA 3MXTA 3BR2A 3TIGA 2YTZA 1PZEA 3AHHA 3RH0A 3CC2I 1GPYA 1P4RA 3ZMUA 2VHJA 5F2EA 3V1KA 5EEHA 3A4LA 1ZAYA 1E0JA 4EH1A 3REOA 1Z4KA 5MN5A 4F9GA 4J01A 1UWCA 1YB2A 4JLKA 5E1MA 2JIDA 4Y9SA 2X0FA 3PGMA 2BFBB 1R5BA 3W2IA 2Q2NA 2FF5A 5AI8A 3BE5A 3SSMA 4NCAA 1PT7A 5D4RA 1S2MA 5DGCA 3EQ7A 2BUAA 3BK1A 4Y6QA 2R7LA 4KR2A 4RZHA 2R0QC 1AUVA 4WZBA 4OCZA 3NWBA 2OQGA 3WFJA 4XTCS 3MELA 3OZAA 3U5ZB 5K1YA 1RYNA 3DL7A 2YQZA 4XORA 3UAXA 4LJAA 5ICFA 3OJFA 4YG2F 1RZUA 2ZBEA 4D99A 5DHQA 4OWRB 1FYMA 4B79A 5JYEA 4UEJA 1EFDN 1V1MA 3AGPA 4NDAA 3X1JA 2AQEA 3VA7A 2C7RA 5EQDA 3FM3A 1D2HA 1E96A 2Y1XA 4PG5A 3TKLA 4WXYB 1T9DA 4R9VA 5F5NA 2J3MA 4ZHQB 2IBSA 2IIVA 1UM9A 3ZZMA 4R5HA 4Q18A 3WL7A 4C4TA 4EENA 2VQFB 1U2QA 2IBTA 5CD1A 1OJLA 4U39A 4HVTA 1CZNA 1S4QA 3O31A 3NIFB 2VI5A 5DM2A 1DADA 5ECDA 4MO7A 3C3CA 3UKGA 5EJFA 5K3BA 4LGCA 5B57C 3NHRA 3NRBA 2I1LA 3FFXA 4NS4A 1MF7A 2YMLA 2I3ZA 1SRQA 1RHKA 3PFGA 4Q1DA 5IJ9A 2QL7A 3ABLH 3W5HA 3AERA 5JPIA 1QIDA 4Z53A 2CW7A 4EUHA 2M2EA 1SURA 1T1RA 3KYCA 2Q3LA 3UJ7A 2VHWA 2AOWA 2WYWA 3I04M 4ASNA 3HWSA 3RIGA 3SF0A 3KNZA 4DIMA 4EO7A 2DWOA 4EW2A 4LCBA 1YS4A 4RMJA 1Q14A 4LYGA 4BJTA 1K6YA 4LECA 2R7OA 1XZ8A 2D1FA 4ENUA 5MFZA 4Q4DA 1L6RA 3DVLA 5DASA 1XU7A 4QO7A 3UHAA 2YUTA 5DYNA 3MZ0A 4Z0HO 3HJEA 3ENVA 1T5HX 3EGEA 4DAOA 1LFPA 1LUJB 1JV2B 3D4LA 4F9TA 4GLBA 1GQFA 1XEWY 4CLHA 2H11A 3C5VA 1IY1A 3HUFA 2DKFA 2I87A 4G4GA 3CZQA 3B1JA 2FJ1A 4QYTA 4AECA 4MVYA 4F97A 1RPZA 5DSXA 5AR1A 3KJHA 4F52A 1PL6A 2JRCA 5JWOA 2CDCA 2I3AA 4CL2A 4U7DA 3LSPA 2BAGA 3M6WA 4EZEA 4NYIQ 4PG8A 1GL7A 2J3IA 1R5OA 4K9MA 3UHOA 4A8TA 1KZHA 2HIMA 5C0OE 4JI6B 2OPHA 2WV9A 3AZPA 2HHLA 4BO1A 4CYMA 4XRGA 1VKHA 2M87A 5JSZB 4LS3A 1SKMA 4JA2A 1OD6A 2I4RA 4HNTA 4M76B 2GTIA 1E7QA 1F06A 3E9QA 3TBFA 3VC7A 4MCIA 4FYYA 1VBMA 5F3RA 1YCGA 1QX4A 4MS1A 3KB1A 2O1SA 2XGXA 3H5VA 3OJWA 5GONA 1OISA 3GAZA 3CC4I 1AC5A 1SA0B 3EMDA 2BP7A 3IIKA 1BMTA 1CUSA 4FW9A 4CMGA 3BQMB 2JJ1A 1J33A 1MJHA 3NAZA 5HG0A 2H18A 1D09A 2NUTB 1EVEA 5F5XA 3SF8A 3SIRA 4YJ2A 4QPDA 2QGZA 4D8XA 3AL0C 3F9IA 4JY7A 4MRVA 5ECWA 3KJNA 4BVKA 1PR6A 2JI6A 1GR0A 1XNHA 5ILGA 4B3GA 1YZLA 3QU9A 3RS2A 3ED1A 3NC0C 1VXOA 1CS0B 3LSHA 3WLMA 3C74A 2GB4A 4NYMQ 2ECCA 3FYUA 2ZUFA 2CNWD 1VE9A 1WU8A 2A2ZA 1GKLA 3DTTA 4GOJA 1L7VC 4OV6B 5IM4A 1VQ6I 3A6DA 4GI1A 4EY3A 1Z08A 1RJDA 4EMUA 3B2QA 3JQ8A 1KU0A 1ZJZA 4GX5A 2BR3A 1ZH8A 2M9MA 4Q9IA 4B81A 3AAFA 2XZPA 3BXZA 3I4MJ 3D1NI 4HQEA 4RGBA 4Y33A 4XLLA 3NVDA 4DPMA 1IUYA 1YRNA 1E2QA 4JKYA 4E11A 3RVSA 1QRUA 3RUCA 4OD0A 3HLKA 4C6SA 3H3FA 3C87A 5B7GA 4CIWA 2XV4S 2WJGA 5L3CA 5BT8A 2WHQA 4RF5A 2ENUA 3S81A 1JB9A 4CMEA 4G67A 2Q0XA 1S1CA 1VJCA 4D9FA 4AMBA 3G0DA 2MLGA 1CZLA 1JKQC 3EXHC 4QKQA 5I9NA 3QKSB 1G8FA 4BO9A 4CUJA 1NF9A 3NB0A 5KNBA 3I2IA 5B1SA 4AF8A 2XWSA 3L6BA 1E9CA 3OFNA 3J81K 1W30A 1W25A 3W3AH 4V39A 2OZLB 3HY6A 2X4GA 1V7QA 5BPDA 3FZVA 2HV9A 3WK7A 1P0MA 1V7CA 4JYKA 2J3JA 3QTLA 4OB8A 3EBLA 4C06A 2LXNA 5L3SB 2CMHA 3J81A 1EB9A 1A1VA 1KO5A 1G59A 1VL5A 4OQPA 5CH8A 3T7RA 1LDKB 3BWGA 4PGMA 1NX9A 4I3FA 1VYHA 3E61A 4H15A 3EJ6A 4FNOA 3WJ7A 3AI1A 4ZYHA 1NUTA 1QE3A 4TT3A 1TXGA 2X9VA 3EW9A 4Y1RA 4BNTA 4C2TA 4PTLA 3GH3A 1IN7A 3QNMA 4P5OA 2RBKA 5D1HA 2IYRA 3LYLA 4MVJM 5EFZA 1PX0A 2ZBGA 4WKBA 2BKEA 5IAJA 1K75A 2EWVA 4WNIA 4ESFA 4X7BA 2NACA 5DHRA 1JLHA 4O2BF 2O07A 2O54A 3GRCA 4BC1A 2WUGA 3F6EX 3WZLA 3ZWOA 3WIVA 2FPIB 3LUAA 2PU7A 4JT2A 4COOA 3D4PA 1O7JA 1YJ9I 3G23A 3GJQA 2VT2A 5CFZA 2WTXA 3DWEX 1D4AA 2C1ZA 4LF4B 1IAQA 1M2FA 3EUEA 4G2TA 2WTMA 1IZ9A 4CZZA 3GVPA 4H3KB 2FB9A 3F97A 2QORA 4M0LA 4O6VA 1IEQA 2C95A 4A27A 3HZHA 3HR4A 1NJ2A 4PZAA 4BVAA 2F1OA 4HLXA 4KR9A 1K78B 3MBIA 5IXYA 4EQZA 1WD5A 4GMXA 2A1TS 3GLIB 5HMLA 4BPRA 4BGUA 2QU8A 3LKVA 5AXBA 1QKKA 5GGYA 4AVPA 1Z4JA 1Y7IA 3MTEA 3BOQA 3PUBA 4MVXA 3UV3A 2XKKA 3G1UA 1MZBA 4MP6A 4TSFD 4AUNA 1U6JA 4N9HA 2N46A 5CW2A 3NBYC 3BSWA 1U9IA 1QHYA 1DKQA 2LY9A 4ESJA 3U60B 3W2VA 2AQKA 1W5AA 1BHJA 1TE2A 2Q6OA 4U2BA 4II3A 1JKOC 5EG0A 1ZC4A 2AI3A 1BMFD 3CCJI 1F2VA 4E5YA 4AD8A 3DL2A 1BQ4A 1HNNA 1X42A 2N75A 2E7ZA 1X1AA 4Y18A 4RADA 4I3GA 3HWRA 4YBZA 1FFXB 3GJ7A 3WQQA 4W9MC 2IELA 5E6SA 5C1OA 5HGXA 3PWSA 4TKUA 1Z0JA 3EZFA 3H5TA 3IRVA 5JZBA 2HYDA 3E97A 3DBRA 4I99A 2XF6A 4HW0A 1EUDA 1PSZA 3D59A 1PDVA 4TRNA 1UH5A 1PFWA 1TK3A 5SZIA 4D9CA 9ATCA 5L3ZA 4PYJA 4B09A 2HMUA 3FUWA 4M8LA 4Q12A 3KLNA 5IVPA 2CUTA 1QYWA 2JA5J 1Q95A 2IUFA 1N4DA 3EIWA 5JRZA 2O8DB 1H8HA 1M2VB 1YRAA 2NOGA 1LB2A 3KOWA 5AKHA 1YHQI 4YIIA 1PQYA 2GBFA 5IP5A 2OY0A 4DKJA 3HKEA 3O84A 4GX0A 3KQQA 1ETYA 3UENA 1KOGA 4R4JA 1H93A 2CL5A 4XQFA 2BH9A 2PSSA 3OPVA 4E5VA 2BF4A 5LR6A 1J49A 1KE1A 4UZSA 1NOKA 5C7YA 1S7EA 2CCJA 3B85A 1Z2EA 4FIZA 2ZTLA 4KMOA 1Q6YA 2NUPA 3VZRA 2JC3A 1IK6A 1VE6A 5P8WA 1NAIA 5TNXA 1C0PA 5D85A 2ZIAA 5LMUB 4FR5A 3TXYA 2M4GA 1QHHB 3B9PA 3ESAA 3MB5A 4ZDOA 1JIVA 1WNTA 4IL5A 3QYPA 4V02A 1Q92A 1CJCA 3PGLA 5JHGB 4YALA 2QTCA 1A4UA 3SYRA 4RJLA 3CVUA 1TW2A 5I51A 4BYGA 4Z7OB 2DM6A 3DLBA 2X2EA 3SSNA 1TZ2A 3IAFA 3QX8A 4UAJA 4ACBA 4FD2A 3T5BA 3QA3E 3FHZA 5HDBB 1SH7A 3B12A 2FDCA 1PT6A 4LE0A 1TWAJ 4EBFA 1CY6A 1RZVA 4UNSA 1ZK4A 5TB5A 6AT1A 4KXNA 1S72I 3ZI0A 1S2IA 3JCZA 2GOMA 1BS1A 4HAIA 4KQ1A 4MGIR 3E3VA 2CF6A 2OHOA 4FK8A 2O59A 1YRBA 1HO3A 3ABUA 1W34A 5DX8A 3RFVA 2ZREA 3KTOA 5L4NA 1ZRDA 3CRZA 1IJBA 2FMIA 3GUZA 1X7GA 2HVQA 4US2R 3A6LA 3I58A 2RDPA 4QU0A 4RFLA 3E2PA 1LX6A 3QLJA 4LUCA 4HGPA 5FUXA 2WD7A 3PWTA 3T7CA 1XPUA 1GVDA 2W6ID 2YUSA 3BR1A 1C8BA 1K7YA 1W581 2OK8A 1WAMA 3DBVO 4MWEA 1POXA 1CQZA 2HOQA 2K27A 1D0SA 1GD1O 3HEAA 3AILA 3JTMA 4E33A 1J56A 4MUKA 3K4QA 4LYFA 1DIAA 1L6IA 2IW3A 2EBHX 4QGGA 3ZI4A 3DO8A 1GL6A 1YH3A 5LLSA 4CNBA 5EJEA 3SWWA 3RKUA 5JAOA 4RTNA 4B43A 3S32A 3KKNA 3RBXA 2BKLA 1BX3A 3VC2A 4ALMA 1WULS 2AS0A 1FTSA 1EX7A 3GTLJ 2Z9OA 4OIOF 2KISA 1I1SA 1MNQA 1OR8A 3COYA 3UJDA 3M70A 4DMRA 3UJ8A 5IFLA 5CX1B 1SZDA 3DWIA 5FWXB 3T1BA 2WTAA 4PSCA 1DAOA 3I5UA 1W35A 2WYOA 2X0JA 4D46A 4C0KA 2OZ6A 1EZ1A 3ABMH 4H0FA 1YI2I 1Y8ZA 2OAGA 1Z7BA 5ALUA 4ESVA 3OJEA 1Y8RA 3KWMA 1UBKS 1QG4A 4JQZA 5BR4A 8OHMA 1URPA 1IY0A 4P53A 4UDOA 2QLTA 4UATA 1E7WA 3PGVA 221PA 3K7EA 4TTQA 4TWBA 2P2NA 3C18A 5FKOA 4EI8A 1C1HA 4HSTA 1P92A 1HKUA 2IYUA 2BFAA 2ZSIB 3PQKA 3EH1A 4XKWA 3V1LA 4BVHA 4LZAA 3UBMA 1AV7A 1LPAB 4QLAA 4URHA 4BP9A 3IQIX 3A0HC 3NBUA 5JH7F 2OAZA 3E22A 5K0CA 1X77A 1Z5UA 3GWGA 3OEEA 2JIQA 3ZMZA 1O94C 4DCMA 3KEFA 1E3WB 4TL6A 2B7CA 9MHTA 2PX8A 4PS0A 2VQEB 1P9RA 4BNVA 2Q41A 2YDYA 3S1RJ 3I6ZA 4YV2A 3K94A 1CYEA 1ONSA 2P9HA 3CZCA 1X39A 4KUGA 1WQ1R 2XAQA 3O2PE 1I4OA 2NU7B 4K2HA 3YASA 6ADHA 4FMBB 3KQKA 3CLVA 3NBXX 5GP1A 3T54A 5F9HA 1HL3A 2BR5A 2A7XA 4XSVA 4HRVA 5FWDA 2R8PA 3SQMA 5E3OA 1VJDA 4Z2AA 5JALA 3CTAA 3PHLA 3VPXA 3PDIA 3I1JA 4IH1A 1UDXA 3U9TA 3UT0A 4DZZA 4ZOQI 1ZQ3P 4TTJA 3CNQS 5B12A 1V1RB 5AP9A 5JT1A 4ZHSA 3TBIA 2E21A 4D5GA 2Q2QA 1H4SA 2HZ7A 1WPGA 1FTGA 2PGOA 3BQ9A 3C14C 4ZYAA 1QVTA 1UHWA 2DTXA 2FX2A 1N0HA 2R2GA 5EJ2A 2R6HA 1OXMA 1P7CA 1C3XA 3L0SA 4WNCA 5FUVA 1O95D 1XA0A 3LZ6A 4WZAE 2ZSDA 5LBIA 4Q7JB 1DEHA 3QEKA 3BICA 4F04A 3VPBA 2XTNA 4EK9A 4A3MJ 2P0AA 2XBUA 4EPYA 1U65A 3SQLA 2GJ4A 2NPOA 3ID6C 3L3BA 3QSGA 5ULLA 4YHBA 2ILVA 1T38A 3JVEA 4C05A 5LOVB 2AN5A 2V3CC 2O0KA 3KP6A 4MW9A 2HXSA 3VU9B 1KXJA 2W2LA 1P6QA 3TOSA 2WAQN 3ELWA 1AH2A 1RYZA 1V3QE 1Y63A 2B7LA 2C3YA 4UEKA 4CEJB 5ARCA 1HR0B 4EVSA 3DDNA 1UJ6A 4MUBA 4DLWA 5IWAB 4Z4CA 4CEHB 1HL7A 3EHEA 3UMGA 5IT4A 2GN1A 4K46A 1F2TB 1ST2A 4WN9A 3ZVRA 2VO1A 1OXSC 1KSFX 3OYBA 2ZRGA 1YL7A 2BGUA 2JFZA 2CSOA 1U80A 3GO5A 2ZWMA 3IAEA 3ML1A 1F0NA 4BB5A 2F1HA 1MQ9A 3W2EA 2NVTJ 121PA 1J8VA 3EXG1 4TLAA 1KO1A 4EGFA 1JW9B 1XKXA 4LRXA 1T95A 3RC3A 1TM4E 3V1UA 1RWXA 3EQZA 2Z58A 4E7JA 4K9OA 2P9EA 2ZJ0A 2X0DA 3HPQA 2JKZA 4XRSG 4PX3A 3FM5A 5HS8A 1NXWA 1SEVA 2CL0X 4XLEA 5T67A 4B7XA 2ZYDA 2C7VA 2YZ7A 3JSAA 1KYVA 3SDBA 1N2XA 2HK9A 3CUYA 4YDRA 3UUGA 3I5YA 1P6UA 2P6TA 2DX7A 1JEQA 1W59A 2NTEA 1XVTA 2VZ0A 4EX6A 1BVYF 3OTQA 3ZHOA 2O03A 2ZT7A 3H2JA 4JLJA 1NNEA 5JAIA 4IHJB 1KI8A 3B8EA 3DF9A 3ZKWA 5JI2E 3E0XA 1HFJA 2FAXA 4LYEA 2AW3A 1LF0A 3HCOA 3VB2A 1ENPA 1EP3B 3RCOA 4HCJA 5AVKA 5EXEA 2WWWA 2FKAA 3K5WA 1GITA 3HSYA 3R7LA 3RVQA 5FR2A 2L9SA 3R0QA 2Z5UA 1W5EA 2C0PA 1VPEA 1D0XA 2G7MC 3ADBA 2O7VA 3GCMA 3N97A 1WJEA 1ELOA 1E1MA 3EVFA 4W5HA 1TD1A 1S01A 2DT7B 1CX9B 3CG0A 5DTMA 2XRLA 1W87A 4Z4FA 3L06A 4YELA 2B83A 4EYKA 5CVIA 2DERA 2WINI 3K0FA 1BI0A 3BVPA 4YRVA 2VKDA 3E3LA 1ENOA 2I8LA 2IHJA 4JROA 3TR5A 3IV7A 3OU2A 3TNFA 1J99A 4YMLA 4RJKA 3BKWA 3NOOA 2W2KB 4UDNA 4UMVA 2BLNA 1I39A 3HUGA 3PGKA 2ZSJA 1SXJC 1YC2A 1EXWA 2D2FA 2VBIA 3ITKA 3PXEA 3RJ5A 2PMZA 1HYQA 3SSAA 1C0IA 3IAHA 3KQNA 1HNXB 1QWSA 2XF8A 1G0OA 2HHHB 3FCXA 1V2HE 5FJIA 4EYEA 3H99A 3TZHA 4TVOA 4KN4X 3AETA 2A68F 3TW6A 3MWYW 5EGOB 1F1JA 3ABZA 3QNUA 3BCAA 3QE2A 4NX2A 1JE1A 1GNPA 2Q8QA 3SDSA 1CJSA 4BCBA 1GZHB 1OX5A 4B3TB 3M7GA 1WWKA 3WE3A 2XCOA 1XXHE 2R1ZA 3A32A 3BMOA 3OZ7A 3T5MA 3VPCA 4C6RA 1EUQA 1SK8A 2J08A 1KVUA 3FM9A 3ZW8A 4Y0AA 2H5IA 1YDWA 1C4XA 4DREA 5C1DA 4F3YA 3GZ5A 1EX9A 2EG5A 2BT4A 1X1BA 3I05A 4UE6A 2GZ2A 4Q4CA 3MG9A 1FNNA 1AKWA 5I8ZA 4BL0B 1Q20A 4JFRA 2ZNYA 3ZY3A 1TVEA 3TZ6A 5KNLA 1NUQA 1E66A 3AUTA 3VWBA 2XUHA 3BJ6A 3N05A 4Q7LA 4CHUA 3EQ9A 1R6DA 4QOSA 3WV4A 2DFFA 1GPNA 4D4IA 3M3HA 4QFCA 1YX3A 4N7RA 3SJUA 2I76A 3ZH2A 2CEAA 2VE8A 4RDUA 1DBVO 1XV5A 4PVDA 1P4AA 2G5CA 1GLNA 4IOCF 1R18A 3PC6A 4IIHA 1MC5A 1TEVA 5DK4A 3V2GA 4HH1A 4ASUA 4DBLE 3WB1A 3TLYA 1JTXA 4MVWA 2VCHA 3W2GA 1CUGA 3ZWDA 5AHXA 1ZHOA 4MP3A 1UCRA 1FL9A 5IKMA 4BCDA 2J8ZA 2NUAB 5A5DA 5AVZA 3RJPA 1OTYA 2EZ9A 5EE9A 5AUPB 3RVNA 5IP6A 1W48A 1G21E 1I13A 3PC8A 5C32A 1PS8A 2C4MA 5E1XA 2SKDA 2F17A 4DCTA 4FFPA 3BT7A 2YNMC 3ORQA 5JAPA 5FA8A 4RELA 3X1KA 3P5SA 4HK4A 2D3TA 4BOYA 3JRNA 4HRAA 1HSJA 4L9TA 1QYRA 5HFNA 4E22A 1YIJI 5M04A 3SHVA 3QI2A 3K0LA 4N76A 1E3MA 2DTZA 5HFAA 2QROA 3HCEA 4LHVA 4ITVA 2F4MB 2CFTA 4AUKA 2BONA 2QRHA 2C88A 2RI0A 3SR3A 2HNAA 5C8XA 3IHWA 2Q1SA 3L49A 1XMIA 3JYHA 3LFHA 1IXCA 2RJNA 4M7PA 1Y6RA 2WT4A 4O2AA 1R88A 2A35A 4FQ8A 4A26A 5F7XA 3CF2A 1S9HA 3TLZA 3NWJA 4DCCA 3U37A 1YIDA 4J1NA 1DBIA 3PSAA 3BMNB 3B2EA 3GLRA 2HA5A 4UOQA 4AM8A 4HYQA 1MSFC 4LZOA 4FC6A 4NCXA 2QMQA 4OSEA 2XF2A 1ZISA 1QC5A 3FCUB 2ETVA 3JQ9C 4L57A 4B4OA 1M8JA 3PFYA 1E5QA 1MQ8B 3MF4A 3FPKA 2PRJA 2MW8A 3AY6A 5F08A 5CT8A 1KZ1A 4ND5A 3BA1A 3BFPA 3K6JA 1SFOJ 2JH9A 1OLXA 2JI7A 2GX6A 3CSSA 4EEFG 4FOSA 2FNAA 4PYOA 3ZZ1A 2NG1A 4GNRA 4MWCA 13PKA 4HPQA 1JIQA 2ZB3A 4I2VA 2YSRA 4F55A 2LKCA 4DSTA 3LFTA 1EFVA 3PE6A 3AUSA 1FJXA 3E3AA 3T1YB 3P2OA 2Q9BA 5ILOA 2JUGA 1QQ6A 4XRFA 4FIDA 3VFDA 1KYZA 3ZWYA 3O5AA 4YACA 4BDTA 3TCNA 1PNRA 3EW7A 4RDXA 1PJTA 5KREA 2OD7A 4DKXA 5MHTA 2O5EA 1U5AA 4N39A 4XA8A 2V6FA 2QF7A 1M2NA 1NYRA 1U02A 1D6JA 2N1MA 3EASA 3U31A 1SU6A 1WB5A 2C6YA 1DG3A 1WKCA 3CDHA 3FNQA 3IJRA 3UGTA 4B40A 2PZFA 2QVXX 1AF7A 3NOQA 4FGWA 3RUPA 2PMKA 5EIOA 2LLKA 1P72A 1JT2A 5I9TA 4TROA 4BVFA 2TSYB 2QW0X 4TWRA 1UEXC 5ER6A 3ODGA 1J5EB 2RGNA 2WP8J 1K88A 1MJFA 2INGX 3CJQA 1FZPB 1JVBA 3PT9A 4X1KB 5NULA 2CJYA 2AOTA 4FEYA 3FFBA 1WM1A 3DB1A 4GQIA 4I4LA 5A2QK 3Q3CA 3G2IA 2Y31A 3M4XA 2XEDA 4I5DA 2QLZA 3HKBB 1CEYA 2BM0A 3EDQA 4GWKA 5K0EA 3ZVLA 3PR3A 3VO1A 1Z9CA 2DSNA 2UZ0A 4FQ7A 4D9IA 3VFZA 5DUKA 3VNUA 1CE8A 1MRSA 3PGA1 3AVWA 4KT5C 4G4JA 2NS8A 1YASA 3GUCA 3ZY5A 3BB4A 2DC1A 3K9HA 4TYNA 2LD4A 4F96A 1ZPDA 5FUWA 5M3MJ 6REQB 2R6FA 1OBOA 3QI7A 2WQ7A 2C29D 4ME6A 1T9ZA 2IXFA 2QAIA 1M34B 3PX2A 4ZDLA 4LJ9A 5EXDA 2YRWA 4CIDA 4D6PA 3CLKA 1AJEA 4UAGA 1F1ZA 2OILA 3JQ6A 2Q1UA 1QGUB 3K2QA 1JHFA 1A8HA 1M6VA 3DOOA 2PR2A 1PU2A 1XD2A 3VU3A 4YV1A 5BWMA 1X87A 2X7XA 2VASA 4Z3OA 4YQFA 3EFHA 1N1MA 4H6WA 3IOCA 4AZVA 3MYYA 1HF0A 3UMJA 4TT3D 2MG4A 4GI3A 3U39A 3NBKA 1Y82A 5J1SB 2JI8A 3KFLA 1ZN7A 4TV8F 3UCXA 2OLJA 1BC8C 2RKOA 1B00A 5IMSA 3V4GA 3L7YA 2IPMA 2LBPA 4M98A 4MQ9F 1GQQA 4R1SA 3G2JA 3LQYA 1E89A 1D5VA 5DW0A 1CRPA 2WKRA 4RCVA 4F91B 1IMOA 1R22A 2KJBA