2QYOA

Crystal structure of isoflavone o-methyltransferase homolog in complex with biochanin a and sah
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
INNRKPSEIFKAQALLYKNMYAFVDSMSLKWSIEMNIPNIIHNHGKPITLSNLVSILQIPSTKVDNVQRLMRYLAHNGFFEIITNQELENEEEAYALTVASELLVKGTELCLAPMVECVLDPTLSTSFHNLKKWVYEEDLTLFAVNLGCDLWEFLNKNPEYNTLYNDALASDSKMINLAMKDCNLVFEGLESIVDVGGGNGTTGKIICETFPKLTCVVFDRPKVVENLCGSNNLTYVGGDMFISVPKADAVLLKAVLHDWTDKDCIKILKKCKEAVTSDGKRGKVIVIDMVINEKKDENQLTQIKLLMNVTISCVNGKERNEEEWKKLFIEAGFQDYKISPFTGLMSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Medicago truncatula isoflavone O-methyltransferase reveal conserved surface binding motifs critical for enzymatic activity
rcsb
source organism Medicago truncatula
molecule tags Transferase
molecule keywords O-methyltransferase
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 2.1.1.46: Isoflavone 4'-O-methyltransferase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qyoA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qyoA02
2JPBA 3UFBA 2QQ9A 4TV7A 3BWMA 3MTEA 4MWZA 3UWPA 2FBIA 1B6AA 4U7DA 2FMLA 3SGLA 3DQVC 4CGZA 3ZMZA 2BM8A 3E97A 1ZRDA 2BV6A 1NW5A 3LBYA 5GINE 4C05A 3KHKA 2MH9A 4UV8A 2BR4A 3CLOA 2JTVA 1OYYA 1D2GA 2XKOA 1Y0UA 1R5GA 3V8LA 1SFUA 4UHTA 2CO5A 4UOEA 3E5UA 5CVUA 4PCAA 3GLXA 1KQ8A 5EKUA 4DQ0A 3TR6A 5LR6A 1CF7B 1ZRFA 2V1XA 1NE2A 1RJDA 2VDUE 1NBIA 2X0LA 1WSUA 1SG9A 3FTDA 1O3RA 1SVUA 3KPUA 5CVDA 1H9GA 4POOA 1ON1A 3FTFA 3WU0A 3FRIA 4X60A 4YV2A 3SVZA 1R18A 2CG4A 1L3IA 3KP3A 3G2PA 3VC2A 3WGIA 2ZCWA 3BROA 3TM4A 1H0MA 5GWXA 3RKWA 1M6EX 4HG2A 3EVCA 2FYTA 4DZRA 3LWFA 1K7AA 5DM0A 5KK1A 5T6BA 1FYKA 3JWIA 1P4XA 5LQCA 2IDKA 2IBSA 4CKBA 3TOAA 4HZFA 1SQFA 2G71A 4FT4A 1FYLA 1IN8A 3ML6A 3G5LA 3GRVA 2EFQA 3LA7A 3QOXA 1RIOH 3FRHA 1EH8A 3QV2A 4LWPA 2EFNA 3VODA 1RI7A 1RI2A 2XROA 3C6MA 5DWQA 2YPRA 3TO7A 1P1BA 1NV8A 3FPEA 4WX9A 2E1CA 3ANXA 1JQDA 3DLCA 1BOOA 2VS1A 5DCMB 3M6UA 3WTVC 1MD0A 3G88A 2E7WA 3FUUA 4IKPA 4PZJA 2PEXA 3ZMDA 2PY6A 1P91A 3AY0A 5FHRA 4ZZLA 2GS9A 1NW7A 1G55A 3A4TA 1HW1A 1IF1A 1EG2A 4MQVA 2PFBA 1ON2A 4OMZA 3L00A 4UVBA 5U4XA 1NW6A 4U0VA 2GIVA 4P7KA 3IKVA 1MZBA 2NAZA 4BXUA 1WWXA 4HX7A 4NB5A 2QBYB 4Q5SF 3L2CA 4GYGA 3OZRA 4HC4A 3G5TA 4RAYA 2UZKA 4UUVA 5HDGA 3GZ5A 2P6SA 2IH2A 5D8KB 2FA5A 3C3PA 4ESBA 3Q9SA 1Z9CA 3CVOA 4EM0B 4PWYA 1YFLA 2PXXA 4PYKA 3DTNA 4YUWA 3HIFA 2DQLA 3VSEA 2YQZA 1UB9A 5EEHA 5MHTA 2AN3A 3JSPA 4DNCA 3ELYA 2RKHA 4MTDA 1YW7A 1ZHFA 3NVMB 3CGGA 5DX8A 2RN7A 3QRFF 3G89A 1UHWA 5CLSA 5KQRA 3GDHA 2PLWA 4DCMA 4E33A 2HKXA 1I5ZA 2PI0A 1XD7A 3LA3A 1XMKA 5H6QA 4GC5A 4X63A 4EV0A 4WK8F 3BJ6A 4RX1A 2K4JA 2HWKA 1YTYA 4F86A 2XAGA 3CUOA 2HR1A 1HSTA 3I58A 1U8RA 5HDNA 5M5BA 1USTA 2PV0A 2XUBA 1KPGA 1QO0D 2FK8A 3WSTA 3MGGA 4L18B 1R74A 1YFHA 3PS9A 4RTLA 3DMHA 2IA1A 3K0LA 5E9WA 3K0BA 2RDPA 1E17A 2ZFUA 4HLXA 4PYQA 1UIRA 3Q87B 5GOZA 2LF7A 3HRMA 1ZN2A 1I4WA 3TQSA 3MAJA 3IRRA 5E9QA 1ORIA 5DD8A 1GXQA 4QVKA 5FFXA 4PYOA 2P6TA 1L9KA 1XGSA 1MJFA 2IRFG 3LPMA 2ESHA 2AR0A 3TKAA 4AZWA 2FRXA 2P40A 1VE3A 4EQQA 1SD5A 2H94A 2PMUA 3G73A 1TW3A 2A69F 3CTAA 2O0YA 1WZNA 3DXZA 2NP6A 1XCVA 3PTAA 1PP8F 2O0LA 4RGRA 4M9XA 2KRFA 1L3LA 1KU7A 1IM8A 4XCXA 5E8GA 2BYVE 3BY6A 4WXDA 5EC8A 2HOEA 1FJXA 3SSMA 3UJAA 4RGXA 2QRVB 2JRTA 2MBFA 1JHFA 2G7UA 5L3FA 1BC5A 4HGZA 5FCDA 3JAMK 3BWYA 3HSFA 3FPGA 1KYWA 2HTEA 1I9GA 4ZYGA 3KQQA 3SXJA 2VBZA 5K5OA 3K1MA 2QYOA 1RNLA 4D0PA 2AOXA 1ZGJA 5DSTA 2MC3A 4HDVA 4B09A 1R22A 5DDGA 2FNAA 5L3BA 2B0LA 3J81Z 4YUZA 1MKMA 1R1TA 2XAFA 2GAFA 3LCVB 3QPTA 1KHHA 4HTFB 3OE4A 1XGNA 1FLIA 2FXAA 3ME5A 3IWFA 3EGEA 3G2OA 4YUYA 5LQKA 2LD4A 2MH2A 2X4HA 3WODF 1N2XA 2EJRA 2EB7A 1IW7F 3FYCA 4RVGA 1QQIA 4YUVA 1FP2A 1TPYA 2XVCA 3IHTA 5K01A 2OB2A 4I2OA 3TO9A 5L3CA 2IT0A 3E8SA 4R8HA 1RI3A 1IN4A 3I4PA 4IRHA 3V7CA 5LQNA 4G6QA 5D5WB 2F5DA 4FX0A 3HOTA 3HHHA 1ZYRF 1TQPA 1G4DA 5CYVA 3OU6A 4KYWA 4YIIA 3BGDA 3DMFA 5D1HA 3P2IA 1MJBA 4L0YB 3UJ6A 3TFWA 3D5LA 5ICEA 2FK7A 4BLVA 2BR3A 5LSAA 1YF3A 2OQRA 3JW4A 5A2QK 2D1VA 5FUBA 2HDCA 2ETHA 4L9TA 4RYLA 4GQBA 3KLNA 2DO7A 3LKDA 2HYFA 4H0NA 4HLYA 2ONZA 4F7ZA 3U9GA 4IXAA 4CTKA 3C6KA 5F2KA 1XCBA 3BJOA 3CJTA 2OA4A 3R6SA 2L4MA 1HBXG 3LKZA 5HS7A 4OIPF 3I59B 2V74B 4OU0A 1G3YA 2O61A 4QPPA 1YQAA 4LLNA 2CL5A 2HNKA 1R8YA 4RTSA 2WA1A 4HH4A 4RB0A 2CMHA 1BIBA 3HCCA 2RQPA 4M37A 3NQOA 1YO5C 4BHBA 2DQRA 1S6LA 5EMMA 4LD5A 1ZLKA 5G02A 2IH5A 3KZZA 1HKTA 2VDWA 2H6CA 3GFMA 5LHIA 5HZMA 3EVBA 3KR1A 3CC8A 2OQGA 1FPQA 4EKIA 4OBWA 1ZG5A 2G72A 2J5OA 4Y13A 4N9IA 1G3SA 5ERGB 3HA7A 1Z3CA 2W85A 3THSA 4H0EA 4MHGA 3I54A 5FA5A 1YZHA 1FBNA 1JHHA 1Z6TA 4WXHA 1WKMA 4A5NA 1J0RA 1SMYF 2A6HF 2M30A 5CCBA 5FTWA 4ER3A 2VBXA 3GYHX 5AONA 2XAJA 5D5XB 3PX2A 5DRYA 7MHTA 3EVDA 3OPNA 1X19A 3N4MA 5LHGA 4KDPA 3KP2A 3QU3A 4DF3A 2WC2A 5E2AA 1EV7A 2NNNA 4HV5A 3O3KA 3DLIA 1AOYA 1FWZA 1QPMA 3ELKA 3LAPA 4ER6A 2G70A 5CVJA 4HW0A 3NWEA 2P5LC 3VEPA 2Z6QA 3RODA 3E6CC 1SD4A 1MDMB 3TLJA 4UXNA 4U7TB 2ZTHA 2PBIA 2ZMEB 3EQLF 5K0EA 4NQWA 3U81A 3A27A 2AN4A 3V4GA 1QNTA 1KPHA 3GRYA 1ZG3A 3HCBA 2UWMA 3R9XB 4RTOA 3R0JA 2K02A 2JZYA 5DYMA 1WQ2A 3WG9A 2ZO4A 2PG4A 2AOTB 4R6WA 2DK8A 2KW5A 1WXXA 5JVTA 5FHQA 2HTJA 4E2YA 1VL5A 1D5VA 5F64A 4AWXB 2OAZA 1O3TA 2G1PA 1FSHA 5E1XA 1F5TA 3UJ9A 3ORHA 3HTUA 3JWHA 4M71A 1XXLA 4X61A 3KQTA 4BAYA 5EIFA 5K05A 1ZGAA 3ULQB 4M73A 3RYRA 3TDUC 1JSXA 1IXKA 1Z1DA 2R7DA 5EGSA 3GZ6A 3EUHA 2AOUA 2NNYA 4YFNF 4P58A 4K2EA 5EOVA 2OD5A 5CCXA 3LX6A 4NHJA 5EVJA 2Z99A 5HVQC 2GXBA 2ACJA 3RKYA 3FXRA 5FFZA 2ZVJA 1AV6A 3B5IA 4G7HF 4PONA 4YUXA 5EPEA 1LNWA 3RYPA 2A61A 5L3DA 2N47A 3CJRA 1VP3A 5E8JA 5HLGA 3KPJA 4DCGA 3PFGA 3H3ZA 5LEJA 3BWCA 1BM9A 3E6BA 1IN7A 3RJPA 2YVLA 1STZA 2FE3A 5LLQA 5B1SA 3MAGA 3DF8A 2IFTA 4WWCA 2NYXA 3ECOA 2DAOA 5ED4A 3P9NA 4RTJA 2PN6A 3FZVA 1IRFA 1K78A 2VOOA 2GPYA 3KP4A 2VBWA 4V0RA 1QZYA 3HM2A 5LRRA 1LEAA 4C08A 3KP7A 4M9ZA 1ULYA 5CVVA 4I02A 2NYUA 2Q8KA 4XSZF 1F3LA 1TQMA 2RGVA 1Q1HA 4IJAA 3WE2A 3MQ0A 3R0AA 2PSSA 4L5JA 4LJZF 2Z3YA 4QWQA 4S04A 3F8CA 3I71A 1OYIA 4XSXF 4CKCA 2XGXA 3UBTA 4ENNA 1HSJA 2HFHA 4AIHA 3ECHA 4PDKA 5FLXK 1CF7A 3FUXA 3WTSC 3MB5A 1IN6A 3HVKA 2JHPA 1I27A 4OA8A 3CO7C 3AJDA 3NMUF 1JGSA 2ZW9A 3OCJA 4MQ9F 4OIRF 4YV1A 4RGUA 2A68F 1FYMA 2ZULA 1B42A 3TO6A 4A0YA 3NJRA 1FC3A 2XKPA 2KJBA 5DSXA 4PCQA 3OU7A 3ZMUA 3A26A 2CMGA 1Q0SA 5C0OE 3EMBA 4U7PB 5D1NA 4RB3C 3FPFA 4LFUA 3GXOA 1G8AA 3BWBA 3BJAA 1JTEA 1FBSA 1O3QA 4AIKA 3RPUA 4R6XA 1PRYA 3V8KA 4YIFA 3M1EA 5EG5A 2ZBKA 2C7QA 2CKDA 4HF0A 4RTKA 1SAXA 4KNYA 3WU1B 2VDVE 2O8XA 4P9FA 1BN5A 4IPAA 1YUBA 2VZ9A 2P3QA 3BPXA 2GAUA 4RS8A 5HLIA 2VONA 5EQJB 4C07A 3WGGA 1YW9A 4OQDA 2FBHA 3GW2A 5EZQA 1HKSA 3LSTA 3A7EA 3UA3A 2COMA 3OV8A 4AUKA 3FXUA 3R60A 1NHAA 5E9JA 2C7PA 5F2OA 4FT8A 3I0TA 5CIYA 3VB2A 3M6XA 3FM3A 4KN4X 3K9TA 1DUSA 4RWZA 2L01A 1ZARA 3OE5A 3T0IA 1P39A 2ERCA 5J8FA 3TPZA 3E3VA 5F1RA 1FBUA 1HW2A 1M0EA 1QZZA 5CVIA 3V97A 5E8IA 1IY9A 1JG3A 2GWRA 3M8EA 2EG5A 4JK1X 2FRHA 3PVCA 2FCAA 2OBPA 2NXJA 2ADMA 2PWYA 1T38A 4M36A 2QZ8A 4YV0A 2TDXA 4ESFA 4DA4A 2KIFA 1U3EM 3BT7A 3GIWA 3EEOA 4LG1A 2W57A 4P5OA 4MEXF 3FMQA 4L5IA 3GJYA 3K69A 3SZTA 5FGMA 2I62A 3D2LA 5E1OA 4Y30A 1ORHA 3CUQA 4CO8A 1Z7UA 3T8TA 1EJ6A 2VODA 1HKQA 3JWJA 5K1YA 1JG2A 2AN5A 2F8LA 1SUSA 1O7FA 3FHZA 2OO3A 2YXLA 4IVNA 1XGMA 3MZHA 4LB6B 3HUGA 5EMJA 2JH9A 2GQQA 3C0KA 4G7OF 3F8FA 4M9SA 5TRDA 4BLUA 2M5WA 5HFJA 4KT5C 3P9IA 3F8BA 2E1NA 3HNRA 4P96A 2O05A 2IA2A 3UJBA 1W4MA 2D2WA 3DOUA 1K78B 2P3OA 4GXOA 5JHUA 1ZQ9A 2JSCA 3KQVA 4C04A 3DP7A 2FEZA 2FQ3A 4U88A 5E1DA 1KYZA 2OYRA 2DPUA 3ERED 5T64A 4QQNA 3RIEA 4CDGA 1WXWA 3I64A 3A25A 5KQSA 2W84A 5D6FA 1AF7A 2P7CB 2PT6A 5E8RA 3OU2A 4C06A 5BQTA 1JQ3A 2CFXA 4O29A 2G7HA 1P4AA 1UHMA 4O5VA 4ENKA 3ZPLA 2VE9A 3BKWA 5K0LA 4ZYEA 1BC7C 3K2ZA 1B4AA 1EH6A 4MGRA 1WY7A 4IRGA 3EVFA 3KEOA 5ICCA 5LBQA 4OMYA 3C3YA 5BXYA 1PP7U 5IKMA 1B59A 2ZXJA 5DV5A 3N97A 3RTRA 2A5YB 3F3XA 1KR5A 3BXOA 1XGOA 5KYGA 2ESRA 2RNJA 4GOOD 1KQ9A 2YX4A 2P7IA 3X0DA 1NV9A 2NS0A 1VP9A 5DD4A 1QANA 1QYRA 4BP1A 4PNEA 2HMYB 3P2KA 3KPVA 1FT9A 2VC0A 5K0BA 3R24A 3GRRA 5AIPA 1PJZA 3HVIA 1ZH5A 4KDRA 5ILSA 3IHUA 5K0JA 3D0SA 2M8EA 4JQFA 2OU2A 1T98A 2K4MA 3NEUA 4RVDA 4XUEA 1J75A 4OA5A 3SSOA 5HOQA 3EEYA 3ZMSA 2ZMEA 1U5TB 4M6XA 5K0CA 5ICFA 2PXCA 5DTMA 4R8RA 3GVAA 3P9CA 4M38A 1KU2A 5FD5A 3BPVA 1B1BA 3TKYA 2P3LA 3BZBA 2EJUA 1R6AA 4P7GA 3P2EA 2QQBA 5E1ZB 3QOPA 2J5PA 2HTSA 2UXXA 2G9WA 1CGPA 2NXEA 2YX1A 3UJDA 3TOBA 1Y8CA 1YZ3A 3HOSA 1JG1A 2UYQA 5GM1A 2JG3A 2NNWB 4QLCU 2AXLA 5CVRA 3B02A 2GZWA 1OYWA 5BPDA 4XUCA 5EIWA 5JUWA 2K4BA 5CUQA 1GVJA 3CJQA 2NP7A 2V79A 4PIMA 2AOUB 5EMLA 4LG0A 4KWCA 3T5XA 1I6XA 2CGPA 4WCGA 2IVMA 3GX4X 4CXMA 4ER7A 2H6BA 4I98B 2H00A 3O31A 3UA4A 4E2XA 2MLKA 4KRGA 4QVGA 2AOVA 2ZBRA 2YX7A 2EA4A 3OFKA 2PKWA 3VYWA 1XDSA 1EQAA 2Y75A 3GFJA 3CDHA 4BY9E 1QAMA 2I9KA 2IP2A 2M87A 1SD7A 2LSOA 4GYIA 3PFHA 2ZCJA 1W7PD 1UFKA 5J8CA 5D6EA 5CM2Z 3M33A 4BHCA 3F6VA 3HCEA 3COAC 2JPCA 2R6ZA 2OBFA 4CKEA 5HLHA 3KEQA 3LL7A 1G8SA 3M4XA 5LGTA 3GFLA 5DTQA 2ESNA 2HR3A 1XCJA 2YXEA 3R6TA 1OMIA 2L02A 3NDIA 3KETA 3WTXC 3ZQ7A 2PVCA 1X3UA 1VBFA 2OPBA 3ZP5A 1HQCA 2VC1A 5FWDA 1P1CA 5E20A 3ELDA 5FLXZ 3LQRA 3ABTA 2ZWAA 3P7NA 5FA8A 3J80Z 2WV0A 2I7CA 2XVAA 1R23A 1V39A 2A6EF 3HRUA 2KIUA 1KGSA 3KR2A 2QENA 4GCVA 3PB3A 3MEXA 1Z91A 1IXCA 2H1RA 3VC1A 1J59A 1IZ1A 2MA3A 2XHKA 2YXDA 4EQZA 4YFXF 4R1HA 4RTQA 1EAMA 4RTNA 3ISPA 2QRVA 3AXSA 2PWPA 3O4FA 4HAMA 2DFIA 3MHTA 2P8JA 4IF4A 4BHPA 5D8LB 3ER8A 3BUSA 1BBYA 3QU6A 4ISCA 3LBFA 1S8NA 2P1DA 5GIPE 3TOSA 2CYYA 3BWGA 3EGIA 5HIIA 4E70A 3A7DA 4EJWA 1FNNA 2RVCA 1JXSA 3G2QA 2G8NA 2ZIGA 5K5QA 3F72A 2BE5F 3V7RA 3DFGA 5F2NA 4A6EA 4G94A 1YB2A 4Q48A 4IHSA 3DULA 3PT9A 3PLAE 2VE8A 2Q0OA 1VQ1A 4P7JA 4LK0F 2YTZA 2QVOA 1NW8A 5HOOA 3HCFA 4IWNA 1RI4A 2F5CA 2STWA 1JR4A 5EHIA 3C3WA 6PAXA 3FX3A 3LDGA 3BP8A 1FP1D 1VPTA 1U6GA 4MTEA 1BI1A 3G7UA 3UJ7A 1VTNC 1YS7A 4KIGA 3GF2A 3K6RA 4MIKA 1G6NA 1BIAA 3FYDA 2GA2A 1XN7A 2CQKA 4GUAA 5DRTA 1MJAA 3KP5A 1KQ0A 2WTEA 1FX7A 1XSXA 1HNNA 3MTIA 5TJJA 2Y1WA 1W5SA 2P5KA 3KPWA 3P8ZA 1XDZA 3LQQA 4ETSA 2L54A 3EVEA 1G38A 2C6YA 1G6Q1 1RUOA 3EETA 4ZTBA 5IT9Z 1ZRCA 3I9FA 3SFZA 4RB1A 3SHFA 4XUDA 3HA5A 3M8FA 2F2EA 2BM9A 4Q47A 1XDUA 1TTYA 3EDPA 4KN7X 3RDIA 3BGIA 2HYGD 3FTCA 4A12A 4OOIA 2DK5A 3MFKA 4KMUX 4E31A 1SMTA 5ERIA 1BI3A 4OX9Y 3EVGA 1QGPA 4HOBA 5H20A 2Q41A 2ZIEA 2WWYA 2EFPA 2IW5A 3GU3A 2V1DA 3QOWA 3CKKA 1G3WA 2ISYA 4QTUB 1XSVA 2PLYA 3CUQB 4ZH4F 1W7PA 4FX4A 3I59A 1S29A 4U0YA 3PQKA 3LCCA 2O03A 4GF5A 4XBFA 2RV8A 5K8VA 3CCFA 4AIJA 1DL5A 1KU3A 5E1WA 1P92A 1M6YA 1X1BA 2MLGA 3B3FA 1IAWA 1YIOA 5LQUA 2P7HA 5GM2A 3WE3A 1WI9A 5P8WA 4KICA 2HS5A 2CW0F 4L0ZB 1R5HA 1D2HA 3KPYA 4OBXA 3IC7A 1RI1A 1XMAA 2DTRA 5DLYA 2V1UA 1R36A 3ELUA 4B17A 1F4KA 1KIAA 4I0AA 2ZBQA 3T0YA 5JR3A 1I1SA 2DU9A 3BZ6A 3LCUA 4AVPA 2ZFWA 3IEIA 3M7GA 2Z33A 3FMRA 2W25A 4GO1A 2VT2A 3U1DA 3GRUA 2EV0A 4HQMA 4R05A 3OFJA 4G8XA 3G8AA 3UZUA 1LVAA 4K6MA 4FGZA 4C03A 4IHTA 5D5VB 2JJQA 4KIFA 5FULA 5D5UB 1E2XA 2P8TA 5H6RA 1J9IA 2C7OA 5FO5A 3K1PA 1SFEA 2NRAC 2AZTA 1G60A 1OKRA 1JSZA 1R58A 2OB1A 2PJDA 5JFRA 4EK9A 1QAOA 3B7PA 1RJFA 1UFMA 2IA0A 1MDMA 3MCZA 3GWZA 5HIJA 2XYQA 4P55A 4RTMA 4XLNF 3WTWC 2C7RA 1DPUA 1F9NA 4GEKA 1RUNA 1G3TA 2LDUA 3IL2A 3F6OA 3DH0A 2FU4A 5E17F 4ENJA 3B89A 4KDCA 3R61A 4A2UA 1D3YA 4HX4A 3GUDA 4P9UA 2OZ6A 1U2WA 4HDUA 1O9HA 4LK1F 4ESJA 4CZZA 5C9ZA 2P35A 4UNOA 4FR0A 1U5TA 2P7VB 3SXYA 3AAFA 3CJNA 3Q9VA 2VN2A 1XTPA 4L9JA 2PX2A 3F22A 4ZYDA 3HA3A 4BNCA 3Q7EA 4HSGA 4RB2C 2H11A 1XCLA 3PQJA 5K0FA 3MQ2A 1OR7A 3FF5A 3LFKA 2AVNA 3KFWX 5DTRA 2B9EA 3G3ZA 3M9AA 1S3JA 2FMYA 5A2QZ 2ISZA 2MD5A 3HVJA 2Y1XA 2O06A 3FUTA 1YW8A 4V0QA 2KIMA 5BMZA 1KU9A 4PYNA 2WA2A 3B3GA 2VBYA 2FHPA 2OZUA 5EEGA 1H1DA 2JH8A 2CWWA 4A0XA 4A0ZA 3EYYA 2LKPA 4N9HA 3EMDA 2BH2A 3OOPA 2B3TA 3KQMA 3J80K 1F38A 2A07F 4I0BA 3UJCA 4LLLA 4PINA 2P4WA 2DT5A 5HS9A 1P6RA 3V8JA 1ONVA 1P4WA 2ZIFA 1TNTA 3E05A 3HSEA 4P7FA 4RVHA 2E5WA 2ADUA 2HV9A 3HP7A 4EGZA 1W7PB 1YS6A 1ZREA 4EM2A 3UJ8A 3K1NA 4LWOA 1LDJA 2H27A 3HCAA 3W6KB 1UWVA 3KLOA 4NECA 1F1ZA 2UYCA 2BGCA 4YG2F 1BJAA 5K5RA 5GIOE 3HVHA 5HS8A 5FWAA 4ER0A 1DPRA 4F85A 1SUIA 9MHTA 5ICGA 1N7JA 3DUWA 3FWEA 4ZYHA 1IRGA 4YMHA 4HF1A 4Y17A 4UVCA 4FT2A 2IGTA 2QM3A 2ORED 3DMGA 1NW3A 4AZSA 8MHTA 3C18A 4ASNA 4KMFA 2GLUA 4L9VA 5E1MA 1T39A 3B73A 2XAHA 1UCRA 3F8NA 3H3UA 2D1HA 5T67A 4OIQF 2GXGA 4PGGA 3HEMA 3FXQA 3KU1A 2ZLBA 4UVAA 3EVZA 1BI0A 4BH9A 1S7OA 1LJ9A 1YYVA 3MCTA 4EGYA 4CXFA 3HYIA 4Z2YA 4N0BA 4MHTA 1P2FA 4QTTB 4FP9A 1R00A 1MHTA 1U78A 2YU3A 1O9GA 5FQNA 5DM2A 4L9NA 5K09A 3IKTA 2AS5F 3O7WA 2QUFA 1MJ9A 5HILA 3KR0A 2XIGA 2PX8A 1J7KA 3TM5A 4QDJA 4FSDA 3ABUA 5HEKA 5D4RA 3EYIA 4RTPA 2Z5UA 4Y15A 4MEYF 3KKZA 4G56A 2XV4S 3E23A 3TGNA 3DKWA 1W5TA 2FOKA 5J6XA 3ID6C 3E5QA 3G2MA 5HDKA 1XVAA 4E32A 1FY7A 5DM4A 3E6DA 1ZLJA 3RW9A 2XRNA 2A14A 1O57A 3EPPA 1FSEA 2ZJ2A 3I5UA 3J81K 2XVMA 5DXJA 1I1GA 1N7IA 2B25A 1JG4A 5DCMA 2ZBPA 4GOMD 4EJTA 2PX5A 4CWAA 4E30A 1DDNA 2V6CA 4WVLA 2OXTA 3JWGA 3KP6A 2XBMA 3HHGA 1NBHA 4JBAA 1IN5A 3E5XA 1LEBA 4G6DA 4M6YA 3F4KA 1USSA 3JTHA 5K0NA 2QWWA 2O07A 4FSXA 4X1OA 3VFZA 2IPQX 2HEOA 5HIMA 2VT3A 2EA2A 2XYRA 3REOA 2ZNZA 2RC4A 3MZYA 2I6GA 2QBYA 3NWBA 2L4AA 1L1EA 3PFIA 4BQAA 3S2WA 3TMAA 1TNSA 2HWVA 2JHCA 3KQWA 4UV9A 1FZPB 3C1DA 1ZKDA 3DR5A 3QP6A 2O6GE 2Z6UA 4CHUA 1L3CA 1U5TC 2PBFA 3OZSA 5EZSA 4GGGA 4PCLA 4OQEA 2AOWA 4M7RA 3SZPA 3GO4A 2XAQA 3T7SA 1XB4A 3FTEA 4HYEA 1R1UA 5K0GA 4KUMA 1TBXA 3QAHA 1X1DA 1RI5A 3P71T 4XLPF 1R8XA 2VP3A 3S68A 3DV8A 4KA4A 3NDJA 5DM1A 4EJOA 3L9FA 3DXJF 4ON0A 2HKOA 3EVAA 4KFCA 3L09A 4QPNA 2EFWA 4I09A 3DPLC 2XASA 2AVDA 5BS6A 2DW4A 3FUVA 2Y48A 1O3SA 3E6MA 3LAJA 2IDJA 3IYLW 3T7TA 4M74A 2ONYA 4RAZA 3SX0A 2Z6AA 1KA8A 4E2WA 1S7AA 1JTFA 1AWCA 4LMYA 4DMGA 3IWZA 2QE6A 3T7RA 3E7PA 1YFJA 3GO5A 3ERCA 4YFKF 5EKXA 3KR9A 5F6FA 1JQEA 2OKCA 3AXTA 2VOPA 4C4AA 1A04A 3M6VA 1T6SA 1ZAOA 2QY6A 3GNLA 2DBBA 3WTTC 4FHTA 3RKXA 5BW4A 5IH3A 1D8KA 1SKMA 2R3SA 5DX0A 2FNPA 3JAMZ 5E2BA 3KCCA 1T0FA 2ZNYA 2HZTA 3NTVA 3TDZC 1U2ZA 4EKGA 4U0WA 3ZMVA 3F8MA 1NKVA 1ZG1A 1IXSB 10MHA 1V3FA 2IPXA 2EWNA 3KQYA 1LB2A 3SMQA 3BGVA 3HTXA 1YLFA 1WG8A 3RPQA 3WTZA 3ZN0A 2ZKZA 1GHCA 3CBGA 2FBKA 2F5FA 3SQNA 3JTGA 1V4RA 3G8BA 3FPHA 1R1VA 3F21A 1NT2A 2UYHA 1QAQA 1VIDA 3HRTA 4L7VA 3EGVA 5LQRA 4HV6A 5LQJA 5K03A 1O7LA 5BP7A 3KQPA 3WTYC 1PDNC 1OPCA 3TQNA 5D4SA 4DQ2A 2UYOA 4GBED 4QQKA 5BOXA 2ELHA 4IV8A 2HQRA 3GEZA 1FOKA 3L8DA 3SSNA 3LDUA 4BLWA 4PGHA 1EH7A 1HXDA 1BHJA 5BPIA 2H09A 1I1NA 4GOLD 5KVAA 2YUIA 4PYJA 2BBYA 2W24A 4LGWA 1L0OC 5DPMA 5LGUA 5LHHA 5L3EA 4HF2A 2PX4A 3GGDA 1O54A 2V9VA 1D8JA 3DPTA 3KQOA 4YMGA 2QLZA 3M6WA 2GB4A 2L3DA 2YSRA 3QP5A 3O2PE 3Q5FA 4HQEA 1DCTA 4O6JA 3PX3A 1KP9A 5DXAA 5HIKA 1TQIA 2DLLA 2AOTA 3C7JA 4LG0B 2R7FA 2EJTA 1REPC 4EM1A 3H92A 2K27A 5CJ9A 4GOND 1T43A 2DULA 2DPDA 4HBLA 1QBJA 3HRSA 4KIBA 4HX8A 1RZ4A 1KXZA 2GA9A 2IH4A 4EMSA 2O57A 3B3JA 2ZZNA 5CVEA 3CUQC 1L3BA 2BR5A 4O3MA 3GFIA 2EFJA 3KZYA 2ZSUA 2FPOA 2ZWVA 2EK5A 3THRA 3AWIA 2Y0MA 4WXCA 2PMHA 2OZVA 3SR4A 4ATNA 3IV6A 4EJUA 4HRAA 5AIQA 1AQJA 4AZTA 1RJGA 2IJLA 3NRVA 3P9KA 1DP7P 3U2RA 3ROUA 1HMYA 4BYYA 1K79A 4R79A 3DXXA 3DXYA 4HGYA 4CICA 2GA1A 2DPMA 2PJPA 1TLHB 3HSRA 1IUYA 4CTJA 3FM5A 4XRFA 4Y2HA 3VOEA 3LECA 1SD6A 2HGCA 2V7EA 4RSRA 2XYVA 4EJVA 3IRQA 5L3GA 4U7BA 3DEUA 2E7XA 5FD6A 1Z05A 4EVIA 3J7AO 1SQGA 3OZTA 2GH1A 1AQIA 1RJEA 4PYIA 3I53A 5BW5A 3BKXA 3RI4A 4A5MA 2KJCA 1XSDA 1GXPA 3LA2A 3WTUC 5FADA 3R4KA 2PT9A 5IT9K 5DX1A 2OY0A 1KPIA 3F23A 2A3SA 2KKOA 1WRJA 4Q4ZF 1T2KA 5E1BA 4X41A 3BOQA 2M45A 3R3HA 1BI2A 1FBQA 4ZZDA 1TW2A 4I01A 4DM3A 1H9TA 1LQ1A 1D2CA 2PXAA 2LNBA 2PQ8A 1K6OA 3ZN1A 4R8SA 2CSOA 3L7WA 3P97A 1WS6A 2ZZMA 3WGHA 2D45A 1X1CA 1LDDA 2YR0A 4HA8A 3T1BA 3RIRA 3ELWA 4AZVA 2BZGA 3NW9A 1BOAA 4OIOF 1EIZA 5DCFA 1IXRC 2K7LA 2Z9OA 4CYDA 4QDKA 3SM3A 2UXNA 5EHGA 2EX4A 4AD9A 4GC9A 1J5YA 5DUIA 3TRKA 2F5EA 3GRZA 5ILUA 5FB2A 4FS8A 2BEOA 4DKJA 2IBTA 2AS0A 4KVZA 2WK1A 1BC8C 4KW7A 4MNUA 3V7SA 4OINF 1X1AA 2M1BA 2NXNA 4G9YA 4WF2A 4G7ZF 5LGNA 5H02A 4HTFA 5C1IA 4IRIA 2Q2EA 2B2CA 2LF8A 1JE8A 4B8XA 2B78A 1VLMA 3KQSA 5LQAA 3H2BA 3HCDA 4BP3A 3ZMTA 1LDKB 4E2ZA 3LDFA 1BKYA 1XJ5A 1B9NA 4LB5A 1EJ0A 3W6JB 3FMSA 5JI6A 2HQNA 2STTA 3JSOA 1J2XA 2EV6A 3QPHA 4F84A 3MERA 1DUXC 5LEKA 2FSWA 5GP1A 4AX8A 3MWMA 2QQAA 5FQOA 5E18F 5ILVA 2CWEA 2FF4A 3KE2A 1Z6RA 4PYLA 1HW5A 2PGXA 2YR2A 4S05A 3FZGA 3CO6C 1ODDA 2EV5A 5DUKA 3R0QA 5LRSA 5IT3A 3M70A 2DI3A 4ER5A 4RV9A 2O3FA 4RVFA 3T8RA 4PIPA 3BDDA 1OR8A 5EMKA 4JXJA 1INLA 5KVRA 4A6DA 4IV0A 1Q0TA 2K86A 5DT2A 3LGAA 3HTSB 1PUEE 4RGSA 1R7JA 1YG2A 2EFOA 4FZVA 3NVKI 3LHDA 1C0WA 4LECA 4ENMA 3FUWA 5DEQA 4MTLA 2ZZKA 2JT1A 3ER9A 3FPJA 2JHAA 2P5VA 4MQ4A 1MGTA 3O6BB 3GCZA 2NXCA 5CD1A 2IIPA 2VXZA 2P41A 2UZ4A 3V8VA 5KS2A 1SFXA 4M72A 4I7HA 1B9MA 4RTRA 4LLGF 4PYMA
chains in the Genus database with same CATH superfamily
2FUKA 2ZAMA 1OIWA 4DLVA 5JQGF 1Q77A 3CSDA 4TV7A 3BWMA 4PICA 5AM4A 1Z7GA 3IP9A 3Q9LA 4MWZA 2K2WA 3TQIA 2Y67A 5FAKA 3HVRA 3JQRA 4Z6YA 5A4JA 4I4TB 3PEEA 4I9GA 4AC9A 4R9UC 4AN1A 2D13A 4BX0A 5JZSA 4A8JB 1XMSA 5B3JA 3LBYA 4P36A 4WZAB 3NETA 4B3SB 4QM6A 4C9BA 3GBSA 1U6JA 2BR4A 3FZEA 4PHCA 2QX9A 3T4PA 3TIGA 1MN6A 3DAYA 1Y0UA 2A5DA 1S3GA 3GWGA 3JYQA 4LGYA 1VYTA 4MAMA 2O2YA 4PC3A 1QRRA 2WMNB 4UOEA 2YMLA 2YVUA 5EGNA 2AFIE 2OBYA 5CVUA 3K2EA 3KYCB 1F5NA 3CONA 3RVQA 4YX9A 3H2KA 1YDGA 1HDZA 4LOLA 4A0GA 3TGLA 5EKUA 4OGFA 4F4HA 4TWJA 4J0KA 4ZYXA 2XOEA 2L69A 5LWHA 1FIUA 4PO1A 2AFIA 1ZRFA 3S2EA 3F2VA 4ZYAA 1NIJA 4AVZA 1YR9A 2HB6A 3MKLA 2I5UA 4L5YA 4ERNA 1W73A 3H19A 5C8DA 5A5EA 2X0LA 1WSUA 2BFCB 1PR2A 3PNSA 2ZXIA 1A77A 4HEJA 1V5IA 1J6UA 1XD9A 2BFDB 1J39A 2WSMA 2NVOA 3AY3A 4DLYA 1L7XA 2Q5EA 2QN8A 3PUBA 1ZD9A 3HV2A 4L4RA 3AJEA 4UBIA 4CF6A 3FTFA 1KIFA 1P77A 1V96A 2VPIA 4I55A 4X60A 5HGJA 1GQRA 4BB5A 5BNTA 1CLEA 1R18A 4OMUA 2CG4A 1M2VA 3RSGA 5L7TA 2GD0A 3MJHA 5SYAA 2XDAA 3O03A 2KPOA 3KP3A 2ST1A 3R3WA 2KQUA 3R3UA 4IWYA 2GEDA 3RHTA 3MN2A 1C14A 2GTPA 2R1ZA 3WGIA 4XIYA 3VC2A 3D8SA 4C7JA 5BOSA 2AXTC 5LXTF 4URFA 1CW2B 1X3LA 1Z7EA 2I66A 3N58A 1RBZA 1Z5WA 3PSFA 4GHWA 3SIPA 3RS9A 3UTDA 4PN3A 4HG2A 3RKWA 1AOXA 1DV1A 1GTMA 1LSJA 1M6EX 1SBHA 1QE0A 2BV3A 3CF4G 3PLNA 1DOAA 2FYTA 3R76A 3SOPA 5I8WA 2Y6UA 3M1CA 5GPCA 3A01B 1K7AA 1M0SA 3CMYA 2C8KA 4IZHA 2FFJA 4G9BA 3ABLH 5KK1A 4MKIA 3GPCA 1FYKA 2EEPA 4FMPA 1D1CA 1P1RA 3V46A 5KNCD 5LQCA 1JHYA 2IBSA 3BTIA 3E6AA 1TF7A 3L6EA 3DJYA 1SQFA 1CJUC 4G41A 3EIFA 1RXEA 4FT4A 1FYLA 1XRQA 1MQ9A 3GRVA 1SHTX 1IG0A 2M3AA 3VSKA 1IQRA 3LA7A 1UKBA 4HTAA 1NU8A 3QOXA 1RIOH 1JQLB 2HL6A 1RS0A 2NAPA 2XW6A 3SYKA 3A4MA 3QV2A 3BDIA 3MPUA 3KV1A 4HZGA 1UBHS 2O2GA 2WAXA 1ELOA 3AU8A 3LUHA 2B34A 4ITRC 4X9XA 4CM8A 1RI7A 3AFOA 1MBGA 2HF2A 2BY0A 4N9WA 3C6MA 1WCMJ 3RZOJ 1EVIA 3DC2A 1KFCB 2CJWA 1P1BA 3TO7A 1T08B 3NARA 2QG4A 5LNK1 4LKOA 3K4LA 1UJNA 2EQBA 1D7AA 4NEQA 2WPNA 2G04A 3FMFA 3HFGA 1HT0A 3WOHA 421PA 2WZCA 2C61A 2CC2A 3M6UA 1OZGA 3GPBA 2GD1O 1F8GA 4DMUB 3RFFA 2XUDA 1ZM3A 3QU4A 4MEAA 2H4FA 4KJZA 2AL7A 2JANA 2OHHA 1JA9A 4JL6A 4OG2A 3UC5A 4DIEA 4ZZLA 5ENZA 3M07A 4G4SP 4MYDA 4QJIA 5TF0A 1MB9A 2QKMB 5G3ZA 2LG4A 3TL2A 1G55A 1NY6A 1UMDA 2FG5A 3A4TA 1IF1A 3CLUC 3HZHA 2L9RA 3KDAA 3CNNA 4GZ3A 3RWOA 1O96B 3A11A 3NR2A 1GUBA 3O1JC 4DMMA 4W5QA 1XNQB 4OMZA 1ON2A 4C2TA 2H1VA 2GCOB 3T5DA 4ZIRB 4YEDA 1NVFA 2WIJA 2X6TA 2CV0A 4UHEA 2OLJA 2Q6LA 3R4CA 5AJZA 4PZ0A 4JY7A 4BXUA 1IJFA 1UMCB 4H1TA 1WWXA 4RHYA 3WLEA 2QGFA 4D4JA 1XZEA 5CGQB 1OI7A 1J8QA 2Q9UA 2QBYB 1AS0A 2QAGA 2A05A 3L40A 4DQDA 1HFKA 3VZSA 3W7VA 4DWWA 1Z4IA 1CE8A 3OZRA 3PICA 1JKJA 1B0ZA 3E5NA 4N4NB 2IYTA 2EKQA 5LDGA 1O3YA 1Y42X 4N48A 3BK2A 4NFSA 1V1JA 2OTCA 4NBNA 3PPYA 1Q7RA 3FKSA 3L7DA 4RSMA 3KAKA 2P6SA 3U56A 1O8CA 5LD2C 5FROA 1XTRA 4TRRA 5D8KB 4WKPA 2FA5A 4US1R 4X8LA 1KO5A 3DDHA 2F7SA 4QYMA 3C3PA 4U9UA 4B3HA 1U8XX 3PNMA 3QI7A 1Z9CA 2O3UA 4PWYA 4B4KA 4Q4DA 4KSCA 4RV4A 2DQLA 4PANA 1NR5A 4C14A 2DTDA 4EB6B 1W0KD 4EVSA 2RHLA 2QMQA 1W9HA 1E4EA 2W6ID 2O5VA 1F2VA 4UVIA 1SVLA 1C4OA 1PR3A 1SEPA 3DZJA 4KMMA 5AM5A 5LJIA 4MDEA 3JD1A 2HPAA 1PVVA 1UPBA 2FUG6 4U8GA 1Z4OA 4AWBA 1LNSA 3NM4A 5DX8A 4OEHA 3CUWA 1UHWA 1MBJA 2V5UA 5CLSA 1R4ZA 4MYUA 3UMJA 3X1JA 3UJHA 4BFXA 4DRZA 3DTTA 5KQRA 1JNXX 3GUUA 4DCMA 2GZAA 1BWQA 3HKZN 1U7UA 4GMHA 4JJ8A 3TLAA 3LSHA 1H2WA 2GUWA 2YXBA 1XMKA 2CVOA 2RAPA 3HR8A 1GT0C 2N42A 3VTKA 4EV0A 2PG3A 4WK8F 3K0EA 3BJ6A 3NTOA 4AAYA 5LZ2A 3OQOA 2VOJA 1JFFB 1S8AA 3D02A 5JAHA 3H1EA 4OUDA 5C5EA 4UQOA 2OHIA 2G9VA 4EBFA 1Z0FA 4GG1A 2PK3A 3EIEA 3P0RA 3ZI4A 2XYGA 1KAMA 1DQZA 3A6DA 4A5OA 3K9CA 4S2EA 3HOYJ 2DBRA 2FW1A 4B3CA 1G19A 4DM7A 1E8DA 4DMHA 2I99A 3KD2A 3JQEA 3TVTA 3C48A 3HVUA 4Z3DA 3SE0A 5CB4B 1KFBB 1YQ9A 2FKAA 1KFKB 4JI7B 5THKA 4XCQA 1N9GB 1RM4A 1GQOA 4RTLA 5CFQA 2X41A 4TTVA 2X9NA 3EEQA 5FKLA 2ZUFA 4K6HA 3DKXA 5E9WA 4PZLA 3K0BA 3BICA 1JILA 3THSA 2B9VA 2YWJA 1NQOA 1CP2A 1PTKA 3T3MB 2LF7A 3IIMA 2A57A 3HRMA 1U9YA 1ZN2A 3VYTB 3J7ZI 4Z0NA 1T4CA 4C7BA 4DJEC 1I4WA 2MABA 2GJ9A 3AL0C 3MAJA 3D5EA 4DJDC 1ZESA 1ZUNA 4LGMA 1ORIA 5CDSA 5DD8A 4XONA 1AXGA 1D2NA 4OCZA 3WMXA 3GIDA 3V42A 2DFKB 1FBTA 5LPNA 2P6TA 1DHTA 2X8BA 1U9CA 1MJFA 4C1NA 3LPMA 1VA5A 3IURA 2ESHA 4NC7A 3TKAA 4AZWA 1BMDA 2HOSA 3AF1A 1IRZA 1II9A 2AG1A 2V0CA 2EINH 1CUAA 2P40A 4C3JJ 3BH6A 3QLJA 1XPRA 1R6TA 3NRJA 3GZNA 4J1SA 4HI0E 3V7FA 2RHBA 4UEQA 3KXPA 1EEHA 2A69F 4WPGA 3S2ZA 2I4NA 2B1IA 2O0YA 1XA3A 2DYRH 3GLHB 3ONDA 2PCJA 1XCVA 4BKQA 5JD4A 1PK8A 1XJ0A 1PP8F 2O0LA 2QTVB 2GXAA 4M9XA 2KRFA 3A2KA 4H15A 3GUCA 4O4HF 3RC9A 3T9EA 2H4WA 3D7KA 4HWOA 4UKDA 4XCXA 3Q3CA 1UBOS 1X0VA 3IERA 4A7PA 3LYLA 4WXDA 1E1YA 2LFBA 5EC8A 2L17A 1VSQA 2AMLA 3WQRA 3V4ZA 3LTEA 3RQ4A 4QYSA 1ADBA 1TP4A 1C41A 2JRTA 2MBFA 1BC5A 1Q0PA 1JECA 1RRGA 2LTAA 3A6LA 3K16A 4HGZA 4W8OA 4YV0A 4M86A 3BWYA 1ECPA 2EGHA 1XNJA 4R31A 1KYWA 1JDBB 5C8VA 3WLMA 3SIXA 3M4JA 3KQQA 3SXJA 1DIHA 1JUSA 5K5OA 1N6LA 1XA0A 1MBEA 4NZOA 4X44A 4ZQEA 1MJGM 4FDUA 2XUPA 5B6IA 4MV4A 2A3RA 3AUKA 4D0PA 1G98A 1TIBA 2R8XA 3HDDA 5LZ9A 2MC3A 1BYUA 4BDTA 1LX6A 4RANA 3LRPA 1APLC 3AF4A 3TW8A 1MZPA 1QGAA 1NYTA 1P4GA 3OIFA 4X1YB 1WB4A 2P9QA 2ZGVA 4LI0A 5IX8A 2XAFA 3RPUD 4HTFB 1X92A 3CS3A 4MJLA 4R40A 3T3IA 4ED9A 1LFUP 3JD0A 4ARIA 5CB0A 2FXAA 3WIBA 3D5SC 1S96A 3BXHA 3L6OO 3ME5A 1JU9A 5H59A 2M98A 1EVEA 3Q8KA 3JXEA 4YUYA 4REQA 2LD4A 4O4IB 2BHZA 2MH2A 3LSIA 4YRFA 3O8GA 3QPAA 4KLAA 4XZ3A 1WEKA 4NDLA 2M6SA 2NZJA 4FYJA 2WM9B 2D5BA 4I0WB 4RPGA 4BCBA 4BVAA 7YASA 1P62B 1IW7F 2VB6A 3B6AA 1NQ5A 2IXFA 2WJVA 1XRLA 3MN1A 3R44A 1ZNQO 3OP4A 1QQIA 4YRTA 1K6JA 3TZEA 4R2XA 5KNLA 5DNUA 3IHTA 1CLUA 4B8YA 5IAAA 3LY5A 2VDQB 3ZHYA 4KO8A 1G21E 1X39A 3B1WA 3G85A 1OLUB 3ZRGA 4R2KA 5C46F 2E4ZA 3D4OA 3B78A 1KZ7B 3V1NA 3SHQA 3PUIA 4R8HA 3W05A 3ZIAD 2ZROA 1R10A 3NGMA 1Q84A 4KQKA 5JBIA 4V1CA 5CPBA 1KFEB 3ASNH 2PWBA 1DXYA 2G7ZA 2Y2VA 3WXMA 2X40A 1TQPA 3K1ZA 3A02A 1HA3A 1L0BA 1MU0A 1DAIA 1Z74A 2EW2A 2QXTA 2W6NA 3QTBA 4RPKA 5ECYA 5FP0A 5EWJB 3WE7A 4YREA 4AJPA 3C1UA 2WVHA 1XVVA 4ZRMA 5DI3A 1W34A 5I47A 5GV7A 4KRXA 5D1HA 4E4RA 3VHQA 2Y0DA 3PC8C 3QVLA 4ID9A 1BXKA 1QGED 2YY6A 3V4PB 2CW5A 4NUBA 4KWEA 3ZV5A 2CHVA 3VPBA 3PO2J 4BLRA 2HXGA 3HU1A 2RHHA 4M1QA 3IBYA 3L07A 2XQKA 4MUEA 1VQMI 2VPLA 2F1OA 3DVAA 1EWQA 2GF2A 1JKJB 2AQHA 2X22A 3A28A 3R7WB 3NI2A 4O33A 4RA9B 4BBPA 2WM8A 3U3XA 3DD5A 3M2TA 1FW6A 3OTGA 3KLNA 2BHRA 4HK4A 4YRRA 1CUIA 2FPIB 1XQWA 4J49A 3REGA 1L8OA 1SAUA 4UBOA 3JY6A 1QK3A 4PZDA 5JYCA 3O4VA 4R2JA 3TBKA 1TCVA 2JRCA 3A4YA 3B1YA 3T1OA 3PGJA 4HLYA 3Q1KA 1KI6A 4F7ZA 3U9GA 1B8NA 1MAHA 3ED5A 5ALSA 4HJXA 3T7DA 4AL4A 4BO6A 2F67A 1U80A 1VCIA 3O8DA 2OAEA 1AXRA 3HGTA 1XCBA 1VSBA 2J9YB 1GPYA 4FOOA 4H1HA 5JYDA 4ABYA 1QQBA 4RHXA 3TUZC 4ZKDA 1UPTA 2Y2ZA 2YRXA 3GMIA 1U81A 5IP5A 1WMBA 2BFOA 2OA4A 3R6SA 2L4MA 4MV1A 2R7QA 2GBYA 4Y1GA 4OIPF 3I59B 2C2XA 4FFWA 3BRQA 2O61A 1DTWA 4XYBA 2AQKA 5T3YA 3RBZA 1XCPA 1C2YA 4H7EA 5AVUA 2QZ9A 1YQAA 5HBRA 3A1NA 4DR6B 1SU8A 4CVNA 1X8JA 3BHIA 2N3ZA 4PSUA 2QUAA 4LLNA 2CL5A 3EIUA 1WKVA 3O2NA 3OT4A 2C00A 4AK9A 2CWDA 4B6JA 1ECLA 2GNAA 5HE8A 4FYHA 3VKWA 2WA1A 4WK4B 5K4AA 2J32A 2LYCA 2CMHA 1BIBA 3ESDA 4BVHA 5EJ8A 3ZK8A 2RQPA 1N1GA 1YBVA 1NGSA 1DIGA 4BHBA 2AC2A 2HKIA 2JZOA 3GH1A 5A71A 4ILEA 3U4QA 1GDHA 2ZWOA 4JUAA 3NAZA 1E1RD 2DTZA 1E7MA 2BDEA 2OHVA 1ZLKA 2GX6A 2FSVC 3CW8X 3EEBA 3OEWA 2XRLA 1XTKA 4YJDA 2O1SA 1A9YA 3AEUB 2FEMA 3MAAC 1MO5A 3X2SA 1EI9A 1CHDA 4OF4A 3V1MA 4C6RA 4E7JA 1EFRD 2DETA 5DHQA 1JE1A 4TXLA 4BBSJ 2HK9A 5J1UA 2GR9A 3JZMA 4XLEA 1JZSA 3KR1A 1A7AA 4Q3LA 3AHFA 3T1TA 1AKYA 4I8DA 3GTJJ 2GYUA 2YHIB 2O8EA 4UUAA 3RR2A 1Y8RA 2G72A 3LC0A 5D87A 2BFFB 1C4WA 3HA7A 1R0YA 4YDQA 4B3GA 2W85A 3F67A 5DIFA 1W0UA 1Q1ZA 1HEIA 1Q11A 1CDEA 2O2HA 2HRBA 2V6FA 3PNKA 4YO7A 4M1ZA 3U40A 2VA9A 4Y2YA 4LNHA 4P4LA 5D3MB 4F3CA 4CEJB 1AKTA 1NIPA 1JHUA 4QECA 2EP8A 1SOAA 2P4SA 4NONA 2CLKB 3UFXA 2REOA 1MO4A 2IE8A 4ER3A 5KOYA 1E89A 1YE3A 4ZO4A 4ALMA 2GOYA 4IW3B 3EVDA 3OPNA 1B93A 3IDZA 4QKQA 3I9OA 7MHTA 1PTJC 5LHGA 4G8DA 1ZKGA 1RSZA 2GESA 2FFHA 1ZQ3P 1PJRA 2PKYX 3LG2A 3LIIA 3MG9A 4AJKA 4MRSA 4ARVA 4CH7A 2PX0A 3MXOA 4NU6A 2IYZA 3RC3A 2XCLA 4OFZA 3K6SB 4RF3A 3FISA 2X0KA 1B72A 3ANSA 3H4IA 1DPFA 5E2AA 3JD4A 3LHKA 3WNDA 3A9TA 5YASA 4B4CA 1POXA 1T26A 3WHPA 2C20A 5A4AA 1AOYA 4M9UA 4LZNA 4JV5B 5DGCA 1AA6A 3ELKA 1XLVA 1ZINA 3KZMA 5FOSA 1IBMB 2C96A 2YNMA 4I4TF 2F2TA 4EBBA 2LREA 5E7JA 1PYDA 3VEPA 1SPXA 4FI3F 3RODA 3E6CC 1O77A 1Y7LA 1SD4A 2H48A 5EMNA 4A82A 6ABPA 2Q6IA 4ALLA 1PL7A 3QWFA 4K8OA 4BWFB 1OI3A 2ZTHA 5IN4A 1BGWA 2NU9B 3D3NA 5K0EA 4NQWA 3IQDB 1UBRS 2HRZA 4CV1A 4IX9A 4B3RB 4X90A 1S02A 3WGKA 3V4GA 2VPTA 3HCRA 4A91A 3SK0A 2R00C 2PL5A 5IXYA 3KKNA 5MGNA 4EJ2A 1N7GA 3TRIA 4PZUA 1M74A 3MS7A 4RTOA 3WYGA 1VPEA 4ROSA 3FCCA 2W8BB 1I2AA 1KI3A 4IM7A 3WG9A 4PBTA 1F8YA 4ZVUA 1ACJA 1VI0A 4F93B 2VJOA 2XB5A 2BVMA 3CKMA 2PH3A 5KSOA 1YKSA 1FJLA 1G8HA 1L7VC 3PFWO 2PUFA 3WYCA 2DK8A 4RJ2A 3P4UA 2HK6A 1WXXA 2AV6A 5JVTA 3RVDA 5FHQA 1NDHA 2F62A 4XLLA 4J00A 1WUIS 3DEJA 2JLZA 3BQZA 3LY8A 4BBZA 1YOVA 4QTZA 4XX1A 3RKUA 1KSJA 3P20A 5I4BA 2EKLA 5CLLA 1IGNA 5DH9A 3ZW8A 5T4HA 1QVRA 2G1PA 2KZGA 5IC4A 4KE9A 3QOEA 4PLYA 1FSHA 4U02A 5FBQB 3S3MA 1F5TA 1RPNA 2BSXA 3HTUA 5HF8A 3IUYA 3U2QA 4BZPA 5LMUB 1G2HA 1TTQB 1UPFA 1W94A 2WBLC 3KQTA 1XXHB 3RD5A 1O4WA 3JCUC 3IDSA 2D3WA 5AKZA 2CL0X 3TDUC 1NMEA 1L5ZA 4RGVA 2OO7A 3AU9A 5KCZA 4HQRA 4GP6A 5BR7A 1R0BA 5GQSA 1ESZA 4JXZA 5TPWA 3ZPXA 2NNYA 2FPUA 4P58A 3EY9A 3S32A 4C0AC 1M2HA 2DFPA 3AI3A 4LRTB 2OD5A 4F8YA 2P0EA 3LX6A 3V8PA 3ICQB 1PZXA 2BYTA 4HAIA 4AXXA 5KTMA 1LPAB 5HVQC 1CJSA 3M83A 2ACJA 2IBMA 2VPYA 4MQFA 3FXRA 1O0CA 3ABQB 3C87A 2WJJA 3K72B 2ZJ6A 1OXBB 1E5LA 2OQVA 3B5IA 4G7HF 3CSUA 4CM4B 4AVYA 2NYAA 2WVJA 3A3YA 3CJRA 2E4WA 3Q85A 4RVCA 4MO7A 1PFQA 1AUVA 1TT0A 4H17A 1H5NA 3Q5DA 5EHZA 3HCPA 4AKGA 3ZDBA 4TSFA 3KUXA 2C3MA 1J0AA 1XP8A 1BM9A 2D00A 5DNCA 1IN7A 3RJPA 4FCYA 2PA3A 4OWRB 3JQDA 2FE3A 1D7OA 2VDPB 3LGSA 2P6MA 1AVTA 4RDCA 2CVQA 1Z4PX 1MNEA 3L01A 3MAGA 3WHLA 1WF3A 4EJ6A 1D6SA 1MVOA 1T4BA 3Q7QA 2DZDA 2PZEA 4HLDA 3DR3A 4YUZA 2VOOA 4ZVTA 2F8MA 4B7XA 3U44B 2RK4A 1Y1KE 4P4TA 2BFBA 2B82A 3B9BA 3PWSA 1LF0A 3NTUA 4UCQA 3HM2A 4BQSA 4C29A 3Q15C 1YRQA 5EERA 5F27A 3KP7A 1ULYA 2M4GA 2ZQZA 5ALWA 3MVEA 1WFXA 1FFWA 1QOPB 1L4GA 3I4LA 4JX9A 4L51A 4KXYA 4P2GA 4E5DA 4ILKA 4ZT2A 2FE4A 2HVRA 3F96A 2H1IA 3F0TA 5AHOA 1S2MA 3ETNA 1CUVA 3RSFA 2VKDA 3OMXA 4DHEA 2HYIC 1YIAA 4MVYA 3E9RA 3MSXA 4L5JA 2A9FA 2Z2YA 4G8CA 4GGOA 5DTIA 1R9NA 4D5FA 1CZLA 4OQLA 4ZAXA 3H1AA 2H4XA 4WZAE 2YWGA 4BFZA 4MVJM 3PO3J 1IJEA 2OGWA 3ASVA 1E9AA 1P0PA 5EN4A 2I7XA 5DNWA 2SKDA 5KEIA 1G3QA 5CYPA 3QVWA 4UXHA 4PJJA 1PZMA 1WVMA 1Y81A 2H7XA 3B1JA 1HSJA 2G77B 3IV7A 4CODB 3KIOA 3ECHA 1IEVA 2Y6VA 2ILVA 4H7KA 4M0LA 3ACCA 2CCGA 4NC6A 3FUXA 5I9MA 3WTSC 3PXEA 2BEWB 4PQYA 4AKSA 1IN6A 3L8MA 1Y34E 3DZ8A 1MOSA 1IFXA 1X80B 2EF1A 2JHPA 2FQXA 2WYWA 3DOOA 3MCVA 4HN2A 1BW9A 5EXPA 2BFCA 4DWJA 5FUQA 4OOFA 5JANA 3TD6A 1MMAA 3AILA 3UJ3X 4CCJA 2QZZA 3IBFA 1WJAA 3H36A 3DBHA 4H3HB 3AJDA 3U6BA 1Z7YA 2B0JA 1JGSA 4J0HA 3OCJA 4OIRF 1HT1E 1KIMA 4Q05A 3IJ5A 4KVGA 1C7RA 1U8BA 2WTNA 5DHPA 6ADHA 3EPJA 3QPBA 2ZULA 3A0RB 2CJJA 1IY8A 1K5GA 3K92A 2ZRAA 4R0VA 1M5UA 4OJNA 1B42A 3TO6A 1JA1A 3ECSA 3W9SA 1GY8A 5FTKA 2ECKA 3GB9A 2FLVA 5F5NA 1FFAA 1U7PA 3OCCA 3WYAA 2P0WA 3A0HC 2KJBA 4EEXA 3OU7A 4IOKA 2V7UA 2JLBA 3EMBA 4P2BA 4F12A 3A2NA 1TQDA 3IQGX 4CNBA 5LIPA 2E1MC 3GXOA 4IHQA 3HZZA 3ICVA 2F1KA 2JAUA 4DYVA 2Q2NA 2HDWA 4QDOA 1NI4B 4IDDA 2PT5A 4CZ2A 2QA5A 5D2CA 3C3CA 5I9TA 3SSAA 4YIFA 3ILYA 4DLPA 1MRNA 4GFDA 4ZJUA 2I91A 4IHAA 1GDTA 4LMPA 3BCAA 1AQLA 4N82A 1L5LA 2BWJA 1A98A 2EBUA 5AICA 1Q7BA 4M0FA 4ML3A 1C7EA 3JRNA 4O2BA 5K3FA 1FFBA 3ANTA 3FGOA 1SCUA 4GR9A 1ZWLA 4V0LA 4E7OA 2O8XA 4P9FA 2YS6A 2Y9YA 4NSNA 4WLFA 5E4FA 1SCDA 1V8PA 4LW8A 2VQDA 1B14A 1YUBA 2WSSA 1D2RA 2JI4A 4GKVA 3I32A 4ZDIA 3OJXA 1KO4A 1SQ6A 2CXQA 1W2HA 2HYJA 2P3QA 1K08A 2VYVD 4RS8A 3I30X 5JNWA 1J8FA 3S93A 2KLOA 4BC0A 1A7KA 3HPRA 2V7FA 1Z35A 3CCVI 1YW9A 3L3BA 3SIWA 5J40A 4C07A 1EEXB 2FBHA 1KK0A 2XSZD 3I83A 3OIWA 3OUZA 4HDNA 4W1QA 1VRWA 2E4AA 3KTOA 4Q82A 5AI0A 1GNRA 3ZQGA 1GGVA 2YIDA 2QLBA 1Z4KA 1NHAA 3F5DA 5IG2A 3SXUB 4UREA 2FX5A 5E9JA 2IW3A 2LZ0A 3EXHA 2XVYA 4MI9A 4CL8A 2EBWA 3W2EA 5CIYA 2HXSA 2GN9A 3JQ9C 3QELB 4QTRA 1TOAA 4XI9A 4ENVA 1UJCA 1HYEA 2C07A 5CX4A 3DFKA 4KN4X 3K9TA 3CJQB 4PS1A 2HA2A 3I2GA 4DCCA 2Y68A 3OPYA 2GZ2A 4RWZA 3VMMA 2L01A 1ZARA 1GPAA 3AEXA 1T33A 4F3NA 3H0KA 3SZRA 2WIBA 3I55I 3T0IA 3WQSB 1GTL1 1P39A 1WB9A 2ERCA 1QC5A 4H6VA 4N8DA 3KVNA 2WM2A 3L2QA 3FYUC 4H35A 4JJEA 4QRIA 1JIUA 3ZWAA 3CKYA 4RLHA 4I3HA 2QLFA 1UDAA 2IHUA 2ZUTA 1M0EA 1ZCJA 2XLCA 1LPPA 2XD9A 3RS4A 3VPRA 1NFFA 1JG3A 2DOKA 2P0YA 3DDZX 3WGVA 4FZRA 5IHPA 1HNWB 2ZATA 3BXEA 4HDOB 4H4KC 4YRPA 4E12A 2NXJA 4EZBA 3WRWA 2Q8NA 2XZPA 5K8CA 4H2DA 4WFIA 5FJJA 2QZ8A 3U4GA 2CNDA 2W6JD 1IULA 1NYQA 1QIMA 3QBJA 4RGYA 4TL6A 3ZQJA 4D0LB 1M8GA 4ZYVA 4EEZA 5IYBJ 1CK4A 3ET4A 3VO1A 1LXCA 4IG9A 3NBFA 3L79A 4EAQA 5CG1A 3F73A 1KAGA 3OO0A 2BHLA 1WKCA 2MOKA 3PYLA 3FVRA 3QKRB 4KV9A 4AJJA 4EKDA 3K69A 3SZTA 3LD9A 3A3OA 3UAVA 1I50J 5HP4A 5D3QA 4TVOA 5BSEA 3E22A 1B8IA 5E1OA 4TTTS 1W30A 4Y30A 1LH0A 3F5SA 4CEHA 3E18A 5IKOA 1BMFD 1VIMA 4LOIA 4U7JA 1KSHA 4WNYA 3ZX5A 4DR7B 3FWKA 1CUWA 1M76A 1X9IA 1ZSYA 2FQ4A 2UYYA 2GBLC 2ZSIB 5K1YA 1JG2A 2AN5A 3T9CA 5BW8A 1SUSA 4PLHA 2ZU0C 3I4CA 1E9BA 1EUDA 3ZWWA 2ONCA 1B8OA 4M21A 3MZHA 1B73A 1GRQA 2OAQ1 5EMJA 1QCCA 3QITA 2GQQA 1FQJA 3JVUA 1VJRA 3ZBPA 4UFPA 4BQIA 2HO4A 1K8RA 2ZRGA 2K9LA 4INOA 3GT3A 5E6RB 1NYLA 5EIBC 3HUUA 2IIQA 1UC4B 5HFJA 3L7BA 4GQIA 2H6EA 2NU7B 2JFUA 4LYAA 2X4LA 3F8BA 1ZXLA 2IYYA 1FMTA 4I1UA 4JASB 4UMVA 2HCFA 3AR8A 2IA2A 1BH2A 2VT7A 4P22A 3WICA 4EB3A 3VH1A 4MWOA 5I9IA 1P9WA 5CNKA 4RIGA 5KHDA 2W2TA 5BNFA 4LYEA 1VQLI 5DNEA 3RRYA 1NR1A 1YBFA 1HDPA 3KYCA 3DZIA 3MWLA 4JIGA 1ZQ9A 5CB4F 3K0CA 3QZUA 2NPFA 1IEWA 2Z43A 3F5FA 4C04A 2PR2A 2H8GA 4D3YA 4XX0B 2GFQA 3GLIE 5A6SA 3KQNA 1IJKA 4E94A 1OCZH 1VMDA 2HMUA 3L0YA 4L08A 3RREA 1V25A 2VJQA 3ZQIA 4WK6A 4WBNF 4D5EA 3QYAA 2W70A 3RTGA 4CDGA 3FSGA 1SVIA 3V8NA 3I64A 5FKOA 3VYUB 2BFDA 3ASUA 4G4GA 2G9UA 4J07A 4L9WA 2FSFA 5D6FA 3VC3A 3ZK7A 5KQSA 2P7CB 5E8RA 4ZVMA 4HVLA 1U8ZA 1GPMA 3I9V1 4KQWA 2LH9A 4DGQA 4OK5A 4B83A 2VUTA 5BYJA 3MRTA 1B1CA 2G7HA 2X1CA 2Z8YA 3MNFA 2ECOA 1UHMA 4A93J 4R7GA 1EFLA 2MINA 3QJ5A 2FI1A 1K5DA 4ZT3A 3TIIA 3OYIA 5SZIA 3VOTA 4C7MA 5CAEA 4GR4A 5DLPA 4FBLA 2IEDA 5K45A 4IRGA 3WDSA 3KEOA 5FOQA 5ICCA 1KI1A 4ZDWA 2XMGA 1MTOA 4LHVA 4UMEA 3SJ7A 1BQEA 5H80A 4DB2A 3KYDA 1SOMA 2QW0X 1CF9A 5DV5A 2NU6A 4NCXA 4K03A 5FLMJ 3ZX4A 1XGOA 2QLMA 1TYEB 1A9XB 4XGRA 2HRRA 1LV8A 2QMYA 2EPFA 3JATA 5IEJA 3VA7A 1X3SA 4BMZA 121PA 4Q9DA 2FMHA 4P7BA 3IQXA 1BVHA 3KJHA 1VP9A 3GYGA 3HRKA 3IAUA 5M3BA 1O8BA 2NZ8A 4GE0A 4BX2A 4CUZA 2Q0HA 1WPQA 1J8VA 2CLCX 3OJEA 4BP1A 2R5ZB 4CLRB 2XE7A 1OY1A 2A86A 2GEBA 3P2KA 4TXHA 5DGTA 2ZB3A 3ZQUA 5JY6A 1RCUA 3CZ9A 2D06A 4YLGA 4ABTA 3LUGA 3JW8A 3WRYC 1BIFA 3R24A 3ZKWA 1IRIA 4F5WA 3UUEA 1FLDA 1B6SA 3O84A 2ZE6A 3COPA 3HVIA 5JADA 2OHGA 2VHVA 4PZZA 4IHXA 1XU4A 2L5QA 3UANA 1JBEA 4MRRA 1G4AE 1A88A 5TRTA 4G26A 1ESEA 3NPMA 5BPHA 2XPCA 2GO7A 2N1BA 2R1TB 3L0DA 5LZ4A 2O8CB 4QBKA 1ILEA 1JSCA 4R8LA 4X62B 5DM60 4IEJA 4XMYA 1HTWA 3PUVA 3RFUA 3SZUA 4RVDA 3UVEA 2ZRKA 1PYGA 1XALA 2B4KA 1CZOA 3A1TA 3HCOA 1I3MA 3NV7A 2YOGA 2A84A 1VQNI 3O1LA 3VPGA 2JGJA 5HOQA 4MV7A 4Y6LA 5FCDA 2CNWD 4BV9A 4WT7A 3L02A 4PSAA 3S29A 2DAPA 4XLAA 1U5TB 1CQWA 2FSIA 2KBFA 3GFVA 1JJBA 4IZZA 4WSOA 3SEZA 1XEFA 1XAIA 4TM7A 4WESA 2PSJA 4QASA 4RABA 4ZOLA 4AXBA 4LOCA 1TNDA 2W4MA 3KZOA 4HN9A 5BV7A 1SY7A 1KWKA 1LGYA 5EJEA 4N1AA 5LQSA 3N39C 2QR5A 1LBHA 2OFXA 3IALA 3VSAA 3HLKA 3TKYA 2ZSFA 3L4SO 2BVNA 4ND1A 1NVAA 3LC1O 4NG4A 3W3CA 4PGFA 4XM0A 3MTGA 1YQQA 2Z1MA 3OS1A 4JP2A 3C6ZA 3IE2A 2A0WA 5GOTA 4C5AA 4LTDA 1ZP6A 2UXXA 2GARA 2BMVA 1I6LA 5ULLA 2C2BA 2NV0A 2XT9A 5LNK6 3AVYA 1C3XA 1RKVA 3K6JA 2NXEA 2R5YB 2XQGA 3L6CA 3PFNA 1SXGA 1C3LA 4IUYA 4CF4A 1Y8CA 3IBSA 1T6NA 2UYQA 3D7LA 2JG3A 2YWXA 4RVSA 5KTNA 4KDFA 1XZHA 4D9BA 2BGUA 2AXLA 3MK31 3VPDA 1S3SA 2PMDA 5CVRA 1F6WA 4RK7A 1C80A 4WOCA 4YTEA 3B02A 5BPDA 3E4DA 5H0IA 3S6JA 3TD9A 2GBFA 4FNOA 4D43A 5HW0A 1IG7A 3DOFA 3JD2A 3W5AA 1XTQA 3CJQA 1H88C 3E35A 1F51E 3UKGA 1J33A 1X74A 3I9KA 4LPSA 4RW0A 4XKJA 4ZQIA 3SFVA 1PIWA 1D4ZA 5DI3B 3V7YA 4ZCIA 5JW6A 1NULA 5K8LA 1RIIA 3OC6A 3RC8A 2AOUB 3TVYA 5EMLA 4LG0A 3AR4A 5KAIC 1VKJA 4LIPD 5SY4A 3HG9A 3E3OA 2IYUA 4HB4A 1EZZA 3QHAA 1B6TA 3FWYA 3KWMA 4NBSA 4WCGA 4CXMA 3ON5A 4FE7A 4GI5A 2PD3A 3EC1A 3ZLUA 3KVYA 4YXFA 3UA4A 1OZHA 3E0XA 3GI1A 2O2EA 2ZJPF 1HBJA 3PCXA 5JWRA 5IWAB 1DAHA 1JHMA 3CPSA 2MSKA 1U5AA 1YRAA 5K1ZA 1G4HA 1DNPA 1Z6AA 4MRNA 4RHUA 4WLUA 2Q6KA 3CB2A 3VYWA 1AQUA 4W82A 3MQFA 3TSZA 3NNNA 3GFJA 1PUJA 1Q0RA 3H2IA 4BU1A 2C03A 1JU3A 4BAGA 1OCCH 2IP2A 1B16A 2BF4A 4AICA 4GYIA 1QNLA 5TGTA 1K6EA 2ODBA 4TKUB 3D59A 1KY5A 1T9GR 2X2FA 3BZKA 2BMDA 3BJZA 4YRCA 1UFKA 3GDFA 3HJUA 4M8NE 5TQVA 4ZI2A 4MSUA 2QRUA 2X6WA 2WV7A 4H4CA 4C9YA 4OATA 1VDMA 4BX9A 4RCVA 4JJAA 3F6VA 4LXQA 4OMDA 4DCNA 2W2KA 4COOA 5JXWA 2X58A 4Q9IA 2F43B 5CLIA 1BS1A 4JZKA 3UMGA 3V3KA 5HLHA 2X19A 4TWRA 2J9GA 4OM8A 3CZ4A 3ZG6A 4DC0A 3LL7A 1CULC 2HSWA 4W5WA 5FUVA 3IQZA 4CM9D 5CTAA 1CU1A 4M46A 5LQDA 1DJLA 4RY0A 3NGXA 5ALFA 2J45A 4IQJA 5ADHA 3CE9A 1II8B 1WL8A 4F84A 1V47A 1ODFA 3OHPA 2IUFA 4E3ZA 1UBSB 1XTTA 4FEGA 1JU4A 3O8OA 1G4UR 3BG6A 3PDUA 4QOJA 1E1CB 3KVOA 3NDIA 4OKIA 4X5OA 2F3RA 5L3ZA 3K4CA 4LZOA 4MYRA 4GVXA 3AEUA 3WTXC 1CUYA 4KFSA 3SPXA 1X3UA 2QVBA 4FDTA 1U8AA 1HQCA 2C8JA 3U4CA 3FZNA 4PLFA 2HVQA 1F4VA 2VC1A 3DE6X 4G8BA 1N9KA 4TROA 3K10A 3RSQA 3UAYA 1L4YA 2CXNA 2I2AA 3P7NA 2O2JA 3L6UA 1S1CA 3WO0A 4FKBA 2WLTA 3EMVA 4X95A 2WV0A 2I7CA 1YCHA 5G41A 4OGGA 2ZSHA 3FSRA 5CA0B 1NJ1A 2Q5QA 5AQ1A 1V39A 3NO4A 3GZNB 4H7FA 1T2NA 2KIUA 2ZQYA 4RBNA 5DJ5A 4Y8VA 1KGSA 2BMWA 3COVA 3TRHA 4YBRA 1R3UA 4BNXA 1I0ZA 2W6CX 3PB3A 1DDGA 3MEXA 2ZRIA 4TRNA 3QHQA 4UZSA 3W2GA 5BSHA 5ADWA 2XX3A 3DHYA 3TTVA 2AZ4A 1JLHA 3IA7A 3JASB 4JN6B 4R1TA 5F1PA 1GZ5A 3SX2A 4H1WA 1YVPA 2ZJFA 3BAFA 2C98A 4Q3OA 1TU4A 1XN4A 3QG1A 4JKIA 4GZLA 1KH1A 2ZT7A 1DKUA 2YXDA 5J4VA 1QR6A 4KQJA 4QHYA 4YFXF 4EP1A 5C51B 1PNRA 3HMQA 3ABOB 4C2BA 2QRVA 1XZGA 2PWPA 3PGKA 3TZHA 1LS1A 2C3PA 2Q6TA 3CMAI 3DTYA 3LA6A 2O7NA 2GPBA 3AUXA 4MQEB 5L51A 4CSWA 2BFMA 3L6DA 3ACBA 4Z9FA 1B00A 4IO0A 3MHTA 4D96A 2NVTJ 4H6XA 3UBMA 4Y2JA 3N8HA 4ZYTA 3G0GA 2ODAA 3HBNA 4AZ3B 4IF6A 4IJKA 1W25A 2WW8A 1BBYA 1BYIA 5I51A 1QFSA 1T0BA 4ISCA 3FSJX 5ALKA 2VDRB 1S8NA 3CD6I 1M1YE 1WRBA 4NOLA 3FAZA 2CYYA 1BXRA 4CLOB 3GAAA 3MHPA 4P6VF 3OYEA 3TQFA 1EFPA 3SJZA 2RVCA 4FQGA 1L5WA 3K1AB 3G2QA 2W9XA 2WI8A 2ZIGA 2D2XA 4TMYA 4Y2PA 4JROA 2BE5F 3V7RA 1QB7A 2Z8XA 5TXGA 5F2NA 3DONA 3D4PA 3VC7A 1E2JA 3G0OA 4P7JA 1G42A 4MUYA 1RQLA 3WL7A 1QH0A 4BRZA 2ZM6B 1NW8A 4X71A 4L2IB 4CFZA 1JEYA 3KOXA 3RAGA 2AG5A 4IWNA 3CRMA 3FKQA 2RKOA 8ABPA 2DPXA 2IZ0A 5CFLA 3ZV6A 3BEOA 4H31A 1AMOA 3P19A 1VLHA 1GTVA 2Q1YA 3OCYA 6PAXA 1BDIA 3FX3A 4IQ8A 3BP8A 4GPD1 1H2AS 1VPTA 2IY7A 3R5XA 4X20B 1XG1A 1SVNA 2EQ5A 3G7UA 1JXMA 1NJ2A 3GMSA 4YP6A 1E3HA 2HQOA 5A7HA 3UJ7A 5LA6B 4AYWA 3C45A 1VYVA 4AO6A 4AG6A 2DPGA 3W2FA 1YS7A 3FXOA 3SXUA 3G6WA 1RD4A 3CH4B 3UPUA 1FMJA 4CKZA 3Q88A 2WAAA 1G6NA 1DSSG 4MIKA 3TXAA 3B6ZA 4AKEA 5ES4B 2CQKA 4KP7A 5C3EJ 2CFTA 2GK4A 4MGKR 4WESB 4ZVKA 1ID1A 2WV1A 1B2RA 1SRQA 3WDKA 5L45A 5ALLA 3KFLA 4PSKA 1IVSA 3QXJA 1AN9A 4WZBA 4IOAF 4Z9XA 4RF4A 2P5KA 1JHAA 3AGQA 1MOQA 1E9DA 1XDZA 3HGQA 3PC3A 1U5CA 1TZMA 4ND2A 2E55A 3HOWJ 4NYIQ 1G38A 3A9SA 1EUQA 1G6Q1 1S2GA 1HYHA 3A4IA 1RUOA 3CLUD 4IHJF 4KR9A 4IGKA 3EETA 3EF0A 5E3JA 3VMFA 3UQYS 3U49A 2BGJA 4BBRJ 2YHAA 3ZXUB 4CYCA 1T4MA 3IA2A 4O4LB 1JJAA 3SHFA 4EGAA 3GLFA 1QF6A 3M8FA 4NY1A 3MLAA 2F2EA 4BO7A 4Q47A 2JFBA 1N2OA 4RPCA 4ZU3A 1ZR4A 1M5RA 3K5PA 3K35A 4GICA 4JB8A 3DDWA 3MJSA 2ACVA 3KEYA 2CLIB 2WJHA 3K30A 5GZ3A 4TTSA 3PDIB 2JFWA 1TMKA 3BGIA 1TYDE 5JVDA 2HYGD 2M4KA 4HPQA 3TXXA 3WB9A 4A12A 3TD2A 2JGLA 1U0HC 2G4CA 2GBPA 3Q8WA 1FB5A 4KMUX 2OL4A 4LOAA 2SBTA 4NYIR 5KYVA 3FTNA 3ROTA 5ERIA 4FS3A 5EE5B 4E31A 1US8B 3RSLA 1SH7A 3EAFA 1BR4A 1FJGB 4HOBA 2CFRA 2CLLB 2O6LA 3AT1A 2WWYA 2EFPA 5F0HA 2IW5A 1XMPA 1YE5A 1I2ZA 3D7RA 1Q17A 2C9ZA 2WE8A 3THWB 4N47A 3Q3GE 3AVTA 5JRZA 3ETLA 2OVBA 2RGYA 1PT8A 2RHTA 4IOLA 1XSVA 3AVOA 2XQIA 4DOZA 5C2JB 2PLYA 1FFEA 1SC9A 4LRWA 5BMVA 3BIOA 1JXQA 2XWPA 3V6MA 1DRJA 3F6SA 2R8ZA 1S29A 3BRWD 3PQKA 3CNEA 3WDMA 5B1YA 2IPOA 1YDEA 4EX7A 4HRXA 2V1NA 1ZITA 2D59A 1OTYA 4RA2A 2RV8A 5K8VA 2VLAA 4IOMA 4NFLA 3BMCA 1C30A 3JQPA 2L7KA 4HGQA 3JYOA 5ENVA 5KJ1A 1QZEA 2F8TA 3OWOA 1P92A 4L8WB 4XCVA 2PYDA 3AX6A 5LDDC 2MLGA 3OECA 1BROA 2VJIA 2AW3A 2BY4A 1GXSA 1XLUA 4TXNA 4AF8A 4JUBA 4Y2UA 4D56A 4L6IA 5FPSA 2ERXA 4CZCA 3VVCA 4GBMA 2WUWE 2C84A 4MDYA 3U3RA 3JRCA 3WJ2A 3WE3A 3F6EX 4FFDA 4K1LA 4KICA 1XRSB 2OCBA 4JJIA 4LKRA 5TPZA 2J0SA 3CCYA 1E2LA 4B3FX 1ZU5A 2RBKA 2HHHB 4KH0A 1R5HA 3IPLA 3ND9A 4D4KA 4OBXA 1POGA 3JU3A 2W2KB 2ZJ4A 3STUA 4LGVA 2J8ZA 1FY2A 2FPLA 1HQDA 1RE1A 2YV1A 4DS3A 4DIMA 1H0HA 1QFZA 2WKPA 3N2ZB 3DQPA 3N7UA 4HAWA 2TMKA 4NMWA 4I0AA 5M7EA 3ZE7A 2FN8A 2Z56A 1F8FA 1I3QJ 1V1MB 3LCUA 1RBQA 2GXQA 2CJXA 2ZFWA 1NUPA 3GNQA 3IAS1 1NLFA 4KRFA 1SVSA 4WCFA 4CEJA 1S2IA 3FMRA 2W25A 1HDYA 3WAKA 1DBIA 4PC7A 1XIVA 4GO1A 1Z68A 4LMRA 4JD5A 3GRUA 5MN4A 4JI1B 1PL6A 4HQMA 4R05A 4FI3C 4G1FA 1T5BA 4CIYA 1H1TA 1XRNA 2FLWA 1JB9A 4K6MA 4FGZA 1U90A 1NXWA 2V7PA 4IICA 4ZYUA 1XHEA 4A3SA 4EOGA 2J59A 1JJ6C 1JW9B 1XQVA 3R5FA 2YY5A 2NYRA 2IOQA 4MROA 2EQAA 4J3JA 3WYBA 4FYMA 3EX7C 5H6RA 1J9IA 3BSWA 3W2WA 3K32A 2QL6A 4MKGA 3BR6A 4ZDLA 1HO3A 1H1LA 5DWDA 1FIAA 1OKRA 1XJWA 2HX1A 1ODJA 2VTKA 1IZZA 1QAOA 3B7PA 2WY7Q 3L8HA 4JITA 5BVGB 5CEFA 4RE5A 1Y3IA 4C4SA 5JAOA 1X1RA 2IA0A 1MDMA 3LWBA 3E2IA 4KK3A 1XX6A 4MJ3A 3HR4A 1NDQA 3ZU5A 2YJ6A 4WRRA 1VBKA 3Q40A 4J7UA 4BMOB 5I7UA 4ITUA 5ALMA 2GERA 1YHZA 3CO0S 1QP8A 1RYFA 1TZKA 3SZLA 5JXHA 3EPZA 3I4FA 4G1BA 3U7EB 2C7RA 1DPUA 1F9NA 1T2VA 1RUNA 2MYUA 1G3TA 2QVZX 3O47A 1CUUA 4RDIA 4B71A 4XDYA 3F6OA 3U7QB 3B89A 4G86A 1DE0A 2MGQA 3R61A 4JYMA 4I3FA 3PGVA 4FE4A 3LM8A 1FFYA 5JJIA 1HYGA 5KJ6A 4HX4A 3G9XA 1GAWA 4P9UA 1SXHA 4QXPA 4HDUA 3RZDJ 2WHQA 2MSWA 4F7DA 5JASA 2Y1FA 4IDAA 1VECA 2IELA 3TDNA 4MV0A 4XFJA 1Y1TA 1QYIA 2W2MA 3HOVJ 2ATCA 4CZZA 4R2IA 3TW4A 1WSWA 5DFAA 2P35A 4OL0A 3S15J 2EDAA 2P5UA 4FR0A 2PKQP 2WHEA 4IY1A 2VJAA 3DVSX 5IDYA 4CF7A 1KF0A 3SXYA 1IDYA 3AAFA 1XHFA 4O4HA 1XLWA 2VN2A 4MB6A 4MWCA 3F22A 2K5UA 4A3LJ 1REQB 4MPJA 2DA4A 1MDFA 3BC8A 2IE0A 1H8HA 3OOSA 4ND4A 1VF9A 4D4IA 3HA3A 1QHIA 2AXQA 2CUJA 3Q7EA 5IM4F 3QEBZ 2QSHX 1ISSA 3AIOA 4TS1A 4QWMA 3ESQA 4HWTA 2VK4A 2NXWA 4JLPA 3RYTC 4PRZA 1W1UA 3TO5A 4D9MA 1YA6A 3NDRA 5K0FA 3ZDDA 3LFKA 1I33A 2AVNA 2JFGA 4GMFA 4TLMB 4UUMA 1Z8DA 4BJ6A 2O14A 4ZEWA 3GNSA 2VOEA 1S3JA 1T4DA 2GPAA 1W6UA 2MD5A 2XDWA 3BREA 4TUYA 3S5UA 3U9LA 4F6CA 2ZMEC 3N2KA 1RCTE 2AWOA 3MWGA 1XP5A 3DZDA 1RHMA 1S8FA 1DKQA 2H52A 2YZ2A 4FONA 1EVYA 5AFSA 5BUQA 1W5BA 2XRZA 4LHZA 4MS3A 2F5VA 3I6QA 3PVSA 1Z15A 4LC1A 4FCWA 1FRNA 1PHPA 5C31A 1A9SA 3DLTA 1A95A 3NHPA 4MUXA 2HIAA 2X8JA 4BKRA 1E3MA 2MYNA 1H3EA 1O87A 2X1DA 2C94A 2J9ZB 3EY4A 3CQ9A 1H1DA 5EEGA 1WPGA 2ROQA 3HU3A 1I13A 2CWWA 3PI7A 1NPYA 1H0RA 2VEDA 1H2BA 3OFSA 4J0CA 3TINA 2B98A 1Y3BE 2B8TA 2BGIA 2AI3A 1JQAA 2WOOA 3O90A 5FRNA 3KJNA 1MGOA 2J41A 2PSHA 4OV6B 3GY0A 1J4AA 1KAHA 1CY0A 5TIIA 2GF0A 3VR5H 4BGVA 2ZP1A 4D8YA 3OSFA 1RKXA 4CDNA 3TFOA 2B8WA 4I9NA 5ESDA 1RJWA 3WLPA 3DJFA 3U1VA 2BI7A 2XF8A 4MPRA 1E4YA 1ORKA 5HA5A 3VPCA 2DT5A 4Y0NA 4CMHA 4JLDA 4EMBA 4JC5A 1ONVA 2V5VA 5F2EA 1KDVA 4F2GA 3ZJTA 2ZIFA 1TNTA 2PJRB 1H5QA 3E05A 3H65A 2IEBA 4FUQA 4UHDA 2XE6A 5L4LA 1U2RA 2C59A 1BWSA 4OJTA 4ZD6A 3N0RA 4FQ5A 1MVNA 3WWYA 3PIPF 1IMOA 2HV9A 2VAXA 3IQWA 2HLHA 4GW3A 4IRXA 2H4YA 4HUQA 3H5WA 1H6AA 4PLTA 1ZW1A 2Z9CA 1VQ5I 4EYKA 5K4GA 4J7AA 3AONB 3BD8A 1RR8C 3K1NA 3MOSA 1LDJA 2H27A 4ENTA 1GG2A 4B6OA 3W5DA 3CM0A 4H4DA 1CUGA 1CY8A 3KLOA 3AKYA 4MMYB 5HTKA 1WMSA 3ZJ4A 1G2OA 4BP8A 3HVHA 3U3ZA 1JHDA 3SJMA 1DC8A 2RSLA 3MMXA 4GDMA 1C9DB 4R7ZA 3SU8A 2GCEA 1IEQA 4LSZA 2W8ZA 3RUHA 2UUBB 1DV2A 1XT6A 2B61A 4F85A 4UEOA 3CB4A 4LYYA 3KKPA 3OTQA 1WX1A 3W9UA 2OGUA 2P9GA 3I73A 2C7BA 4I99A 5BO5A 4YMLA 4KR6A 3FWEA 4ZYHA 4NK5A 4PBRA 2XY4A 4HF1A 2BM1A 3KK0A 5AXDA 3UICA 4YMHA 5IS2A 3C3EA 2GEKA 3CISA 1NAIA 3AQ4A 5FJ8J 3JQBC 2JGMA 5K3DA 1YR8A 1LSOA 2PPVA 5DU2A 3W0LB 2O50A 3P32A 3PRHA 4BNUA 2PIDA 5DE3A 2QD4A 1YZYA 2PMZA 2AE2A 2FUEA 4D99A 1IHXA 2F59A