1LEBA

Solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the LexA repressor DNA binding domain determined by 1H NMR spectroscopy.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords LEXA REPRESSOR DNA BINDING DOMAIN
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 1994-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lebA00
2ZFWA 1L3LA 4R79A 1W5SA 4UHTA 3K9TA 1BBYA 2VN2A 1FNNA 1HKQA 3DQVC 3O2PE 1MJBA 3LQQA 1YIOA 1ZGAA 2OU2A 5LGUA 3K0LA 3IKVA 2GAUA 3IC7A 3MZYA 3J80Z 3F8MA 5ED4A 4LG0B 2M45A 3RIRA 3O6BB 2X4HA 2GWRA 4FX4A 1B9MA 5DYMA 2LDUA 2WWYA 4UXNA 1T38A 4WXHA 5KK1A 3WTWC 1MJAA 2VC0A 3IL2A 3ELKA 1EH7A 2HQNA 2XV4S 3FM5A 2PN6A 3FZVA 2XUBA 3KP5A 4BHBA 2EV0A 2QQ9A 3RTRA 3MEXA 1C0WA 4CO8A 4EM1A 1FC3A 2P5KA 3I59A 2G9WA 5L3EA 4FT8A 4KN4X 4XRFA 1YO5C 2QENA 2MC3A 3ISPA 4IRIA 2IA1A 1DUXC 3WU0A 3GO5A 4RGRA 3R61A 2VBZA 2J5OA 2PBIA 4RGXA 1ZAOA 4EJTA 2KJBA 5J8FA 5FO5A 1R1TA 3BJAA 1A04A 4I02A 1J59A 2EK5A 1J2XA 2CQKA 3L2CA 5LBQA 2DT5A 4AIJA 2K4BA 1RI7A 1W7PA 4AIKA 3GLXA 1WWXA 2BEOA 1FX7A 2COMA 1O7FA 4HX7A 2OQGA 5DCFA 3J81K 3GFMA 3BDDA 4MTDA 4HX8A 3GZ6A 2O6GE 2K02A 4KIBA 4EVIA 3HSFA 4I2OA 1F1ZA 3COAC 4S04A 2KIFA 3U1DA 3CUOA 1QZZA 1S8NA 2O03A 3PQJA 3TGNA 4P5OA 1HW1A 5HDKA 3HOTA 2RV8A 4R1HA 3LA2A 1TNTA 5JR3A 4E70A 5ILUA 4RGUA 1T2KA 2XKPA 1OR7A 3C7JA 4A5NA 4RB1A 2KRFA 4M73A 2HDCA 2MH2A 3ECHA 3WGIA 4UVBA 2A5YB 3WGGA 2P6TA 2MD5A 5A2QK 3T8RA 1KU9A 1YTYA 2Q2EA 3WGHA 4A0ZA 5DCMA 4WK8F 2XASA 3EUHA 5K5RA 3KE2A 4HDVA 2BBYA 2RKHA 2XKOA 1SFUA 3FXRA 3S2WA 2V9VA 1YFHA 1G6NA 3BPXA 3V7CA 1LVAA 3I4PA 4M9SA 1SFEA 3PFIA 4M71A 3EYIA 4QWQA 3GYHX 2XAJA 2W57A 3ZMDA 4RAYA 1B59A 4O3MA 2DQLA 2CYYA 1RUOA 1G3WA 3ABTA 3BJ6A 1D8KA 4G6QA 1G3SA 1LJ9A 5F1RA 3RI4A 3FMSA 1IN7A 1RIOH 1Z91A 2RQPA 2IVMA 3CO6C 2ESNA 2EFNA 2VOPA 2IP2A 4U88A 2ZO4A 1GXPA 4P9UA 1TW2A 2J5PA 2FEZA 1FBUA 4KMUX 3WTVC 3MQ0A 5HS9A 3HOSA 4WCGA 4KIFA 4YIFA 2M8EA 4M6XA 1P6RA 1LDDA 1ONVA 5FLXZ 5E1WA 1UFMA 2XAFA 4ETSA 1K6OA 2FF4A 2HYGD 3VFZA 4M6YA 5D8KB 4EMSA 3GFLA 3SHFA 4ESJA 3F8NA 4PGHA 1IN6A 4G8XA 2CWEA 3LA3A 4EM0B 1T98A 1ZARA 5CYVA 5D8LB 2O3FA 4UVAA 4HA8A 3EETA 5HLGA 4ESBA 2NRAC 4F7ZA 2NNNA 1XMKA 5TRDA 4A12A 4LJZF 5AIPA 3KP7A 3JTGA 3CDHA 5DV5A 1SD6A 2FRHA 2XAHA 2H27A 4GYIA 2LNBA 2XVCA 3ZPLA 4LB5A 1V4RA 4M74A 1G4DA 1J0RA 2EA2A 3RYRA 1PDNC 4L9TA 2STTA 1ZHFA 4OIQF 2V1DA 2LKPA 3TQNA 2DAOA 1IN8A 1X3UA 5BPIA 2UWMA 4UV9A 5DUIA 1OYWA 2DQRA 1H9TA 4NHJA 4EM2A 1IRGA 2NYXA 1UHWA 1ZN2A 3W6KB 1WRJA 1HW5A 3QOPA 3SFZA 2JRTA 3CUQC 3T1BA 4OU0A 4BHCA 3ULQB 5LRRA 1SMTA 2VONA 2V1XA 2VT3A 4RB3C 1DDNA 1KU2A 4M9ZA 4HQEA 3ZP5A 4EJOA 1R23A 3WODF 5FFZA 2V6CA 4LGWA 2A68F 1KGSA 5L3BA 4HZFA 4OIRF 3I64A 1QNTA 1E17A 1ZG1A 1ZRDA 1PP8F 2HKOA 1XB4A 1KYZA 3CUQB 3P7NA 4UVCA 1W7PD 3E5XA 3QP5A 3SZTA 1P2FA 1HW2A 1FP1D 1O3RA 1XSVA 1OYIA 4ZYEA 2QUFA 2G7HA 1H0MA 5E1XA 2E1CA 2HS5A 4RB0A 1S3JA 2YR2A 5DDGA 1IRFA 3L00A 1Z1DA 3KCCA 2M30A 5H20A 1EH6A 5D5WB 3GX4X 3M8FA 2HFHA 3BY6A 1R58A 2RN7A 3HRTA 3JTHA 4CHUA 2HR3A 4MEYF 1F9NA 4P55A 2L01A 3TOAA 3GWZA 4AD9A 1CGPA 1XGNA 4ENNA 3FXQA 4L9NA 1I1SA 3KEOA 3J7AO 1PUEE 2X0LA 2W84A 4EGZA 3EDPA 1XN7A 1ZG5A 4Q5SF 3IWFA 1O7LA 4MEXF 1FPQA 2JT1A 3KEQA 3RPUA 1YLFA 4KUMA 4YIIA 1Z6TA 1F4KA 3GFJA 2L54A 2HYFA 2W24A 4Z2YA 3LAPA 3C1DA 5K5OA 5HVQC 1YW9A 3E97A 2ACJA 2JPBA 3FWEA 4HLXA 2DK8A 2WV0A 1SD4A 2UXXA 4MQVA 5BQTA 4G7ZF 3J80K 5FD6A 4HQMA 4LD5A 1FLIA 3MCZA 3M7GA 3F72A 1YS7A 1T39A 4IHTA 5F64A 3DKWA 1S7OA 1D5VA 1U3EM 4ZYGA 1JE8A 2QZ8A 2DFIA 4KICA 3E6DA 4WWCA 1R00A 4Q47A 2K86A 5CVJA 1IAWA 4BAYA 2UXNA 4L18B 4CXFA 2FE3A 5DD4A 1HSJA 3EQLF 4B09A 3H92A 3HHHA 1ZG3A 4IRGA 3JAMZ 5LHGA 1TLHB 3ML6A 2JPCA 1DPUA 2D45A 1D8JA 5IT9K 2IA0A 2A07F 1J7KA 1J9IA 3P9CA 4GXOA 2FBIA 1J75A 1JHFA 3CTAA 4IRHA 5IT9Z 2EFOA 2VOOA 2P7VB 2FSWA 2YPRA 2Y48A 5L3DA 3GXOA 3K69A 3JSPA 1GVJA 2M87A 4OMZA 4JBAA 1GHCA 3RKYA 3QAHA 5E18F 2L4AA 3WTTC 1K79A 4XLNF 4UV8A 1BOAA 1D3YA 3RJPA 2FXAA 5L3GA 3ERED 1OPCA 3K1MA 4QLCU 1Z9CA 3TO7A 3T0YA 3HSRA 3V8KA 3N97A 4A6DA 3FXUA 3ZN0A 4XLPF 3I59B 4LK1F 2V1UA 1H9GA 1HKSA 1R5GA 3WTYC 2H94A 3E6MA 1SD5A 5DUKA 1SMYF 2OBPA 2DPDA 1XGOA 2MLKA 3NRVA 4HF0A 3QU6A 1UHMA 4O5VA 2A3SA 3ZN1A 4U0YA 1Y0UA 2MH9A 4GCVA 4A2UA 1FY7A 2FU4A 1O3QA 2EA4A 3R6SA 3F8BA 3MWMA 4N0BA 1QPMA 1R1VA 4IXAA 2QVOA 5JI6A 4KMFA 4XSXF 4OIOF 1G3YA 1FBQA 2ZXJA 2QWWA 1JHHA 2JZYA 3P9KA 1R36A 3BPVA 3WTXC 2Q8KA 3IRQA 4N9HA 5CVIA 1MDMA 1RZ4A 1YW8A 4G7OF 3E3VA 1MJ9A 4BYYA 2Z5UA 5TJJA 4KFCA 2YU3A 4RGSA 1TQPA 4Y17A 3OOPA 2DLLA 3REOA 2MLGA 2IRFG 2CFXA 1BC7C 1W5TA 4IF4A 5K1YA 3W6JB 2IJLA 1YYVA 3CUQA 3D5LA 3SZPA 4KN7X 5HS8A 3RPQA 1TQMA 3TDUC 2ZNYA 4OIPF 4JQFA 1ODDA 1KU7A 4MNUA 1K7AA 3CLOA 3BROA 5D5VB 1LQ1A 1Z6RA 4P96A 2VT2A 4P9FA 4YFXF 4FX0A 1FSEA 3KLOA 2JSCA 4L5JA 3M8EA 3D0SA 3G3ZA 2DBBA 5HOOA 3IKTA 1YS6A 2GQQA 5JFRA 3C3WA 2V79A 2IA2A 3V7SA 4RS8A 1IZ1A 3DF8A 4ZYDA 2ZBKA 4LLLA 1U2WA 5CJ9A 4AVPA 3CO7C 1B9NA 4I0BA 1SD7A 2XAGA 2XHKA 1RNLA 4Q48A 4H0EA 3HTUA 4KYWA 1IUYA 2FBHA 4WX9A 1QGPA 1IXSB 5IT3A 3DP7A 2QLZA 3EYYA 4JK1X 2TDXA 4XSZF 3BWGA 5LRSA 2L02A 3VOEA 1Z05A 3BJOA 5ICEA 3I5UA 1XGMA 2IW5A 1FYKA 1XDUA 1P4WA 1Z7UA 2Y75A 1P4AA 5ERIA 1FWZA 2DO7A 2QQBA 1WQ2A 3I71A 1BI1A 3ZMTA 2HGCA 1JXSA 1J5YA 1B1BA 2Z33A 2IT0A 1IW7F 4UNOA 2FNPA 2Z9OA 1ZRCA 4GYGA 2DTRA 2LF7A 1TTYA 2O0YA 3DEUA 4U0VA 2ZJ2A 4IJAA 3QRFF 1ON1A 4WXCA 1LDJA 2L3DA 2NNYA 4IHSA 5FD5A 1P4XA 3LFKA 1ZYRF 2KJCA 2CSOA 4MGRA 4A0XA 2RNJA 4CICA 3IHUA 2WC2A 2Z99A 4WF2A 2F5DA 4A6EA 4CYDA 4KNYA 1ZH5A 3JW4A 2NAZA 3TKYA 5E17F 2CGPA 2ZCWA 3SXYA 3E5QA 4O6JA 5ICGA 4HDUA 1LDKB 2G7UA 1HSTA 4R8HA 2GZWA 5LEJA 2OQRA 1XGSA 3ZMUA 4PDKA 5FB2A 2EFQA 4MTEA 5FFXA 2VE9A 3I58A 3FX3A 3LA7A 4UUVA 2VBYA 4YFNF 1UB9A 1SFXA 1BC8C 2FBKA 3KP4A 4Y13A 2ESHA 2RDPA 2QM3A 1T6SA 1I6XA 3ECOA 1RUNA 3LWFA 2GIVA 4IPAA 5EEGA 2FQ3A 4CZZA 4BH9A 4EJWA 2QBYA 3DV8A 3HTSB 2ZNZA 3LAJA 3WE2A 1GXQA 3ZMSA 3Q9SA 4D0PA 3G73A 1KQ0A 4I0AA 5DCMB 3NQOA 4A0YA 1JGSA 2HKXA 2PMUA 1E2XA 5EEHA 1ULYA 1PP7U 5DEQA 3U9GA 2IPQX 2P5LC 5LHHA 2BGCA 5LLQA 2WTEA 4L0YB 5HLHA 3DFGA 3T8TA 4ZZLA 3IRRA 2HZTA 3KP6A 4I01A 3RDIA 3M9AA 2CO5A 4HV5A 3JAMK 3F23A 4L9JA 1REPC 3R60A 3L7WA 4KT5C 3WTSC 3F8FA 2LSOA 1O57A 5HS7A 5AIQA 1TNSA 2EV5A 1U78A 2AXLA 1ZGJA 3HSEA 1XCVA 2ZKZA 4BNCA 4G6DA 2PMHA 4L0ZB 2FMLA 1I5ZA 2F5FA 1W7PB 3BP8A 4HBLA 5LGNA 1P92A 2FNAA 2YX4A 3HYIA 3HUGA 2XAQA 5BOXA 1USSA 1LB2A 3C18A 3HRUA 1QO0D 1FOKA 3B73A 1L0OC 2R7FA 4FHTA 1HBXG 3MFKA 4MHGA 1U5TA 5E8IA 2W85A 1AWCA 3E6BA 3QPTA 2YSRA 1TW3A 4A5MA 1HKTA 4HV6A 1KU3A 5ILVA 2P6SA 2EJRA 5HDNA 5D6EA 1XD7A 1DP7P 2BV6A 2HEOA 4YG2F 4CDGA 1EV7A 4Q4ZF 2P7CB 1ZLJA 2EV6A 3FF5A 1LEAA 2Z3YA 1IF1A 4EGYA 4LLNA 1STZA 3AAFA 1T0FA 6PAXA 4AIHA 5K5QA 3E6CC 2HQRA 3U2RA 2KIMA 3WG9A 3N4MA 5H6RA 2PG4A 3KETA 4DNCA 2KIUA 2VBXA 3VB2A 4HYEA 2E7WA 5BMZA 4PCQA 4HW0A 4MQ9F 1OKRA 5E1ZB 3JSOA 1KQ9A 4WXDA 1VTNC 5CVRA 2BE5F 4LLGF 1MGTA 1HXDA 1BI3A 2H6BA 4KIGA 1QZYA 2UZKA 1ZREA 4Y15A 4DQ2A 4G9YA 2VC1A 3GEZA 2PFBA 3GUDA 3IWZA 1BIAA 4NB5A 2D1VA 5JHUA 5D5XB 1XSDA 2FMYA 2GA2A 4I98B 5J8CA 2P5VA 2L4MA 2RGVA 2OZ6A 4HF2A 3OV8A 3V4GA 2K4JA 3O3KA 2CW0F 1R7JA 2K27A 3J81Z 3RYPA 1FP2A 4HOBA 3VEPA 3T5XA 1R5HA 1G3TA 2F5EA 5BS6A 2EB7A 1DPRA 1QBJA 4K2EA 2BYVE 4XBFA 1S6LA 2PEXA 1BI0A 3HRMA 1AOYA 2O8XA 2EFPA 1XCBA 1IXCA 5LHIA 4U7DA 3VODA 2GXGA 1WSUA 1BM9A 2VE8A 5CVUA 3V8LA 3V8JA 3NEUA 5D4SA 5AONA 4ZZDA 3ABUA 5ILSA 4LMYA 1TBXA 5LEKA 1W4MA 2PI0A 4RB2C 4ENMA 3R0AA 1XSXA 2OZUA 3KZYA 2HOEA 3Q5FA 2HTSA 3FMQA 5H6QA 3RKXA 1R1UA 2MA3A 1I27A 1KYWA 1BJAA 1ZRFA 3FMRA 2D2WA 2AS5F 1CF7B 1WI9A 3K2ZA 1TQIA 3F6OA 2OAZA 2Y0MA 3F21A 1FYLA 4YFKF 2KKOA 1ZLKA 5DD8A 4ENJA 4PZJA 3F8CA 4BQAA 2M1BA 4EQQA 4GGGA 2VODA 2E1NA 3WTZA 2JTVA 1NHAA 3H3UA 3F3XA 1IXRC 4HX4A 3CJNA 4U7BA 1F5TA 4OMYA 2QBYB 1MDMB 3LQRA 3TOBA 4L5IA 5E8GA 5HLIA 4PGGA 3HHGA 3DPTA 1B4AA 3BZ6A 4TV7A 1U5TC 3GZ5A 4I7HA 5KVRA 2STWA 1K78A 2DK5A 5FGMA 1MKMA 4BHPA 1XDSA 2ISYA 2R7DA 2PQ8A 1SAXA 4U0WA 2ISZA 4G94A 1YG2A 1KA8A 2ELHA 2EFWA 4EJUA 5ICCA 1ON2A 2ADUA 1FSHA 1FT9A 3P9IA 2DI3A 1U6GA 2OA4A 2W25A 4LG0A 4ZH4F 1YQAA 3I0TA 4LB6B 3GFIA 3KZZA 2ZMEA 1BN5A 1MD0A 3I54A 3V7RA 2QYOA 3K1NA 1O3TA 2ZMEB 3FM3A 5D4RA 4ON0A 2A69F 3M1EA 4RAZA 1K78B 1B6AA 3F22A 2XROA 2ETHA 3LSTA 1OMIA 3H3ZA 5BPDA 2EWNA 5ICFA 3QP6A 4HF1A 2R3SA 5JVTA 2PJPA 1V3FA 2A61A 3GF2A 2RC4A 4EJVA 5L3CA 1LEBA 1LNWA 5D6FA 4ENKA 3QU3A 1OYYA 3ZQ7A 3PQKA 3TDZC 3GW2A 1I1GA 1HQCA 3E5UA 3ZMZA 3ROUA 2VXZA 2DPUA 3L09A 3KP3A 1S29A 5A2QZ 2HTJA 4ESFA 4BXUA 2C6YA 1Q1HA 1EH8A 1FZPB 2DU9A 4AWXB 2H09A 3I53A 2XGXA 4N9IA 2A6EF 4NQWA 4KA4A 1U5TB 3SQNA 3K1PA 2A6HF 5CVVA 3HRSA 2XRNA 5L3FA 1O3SA 3Q9VA 3R0JA 2DW4A 1BI2A 2NS0A 1IN5A 1FYMA 2P4WA 1USTA 2VBWA 4B8XA 2M5WA 3DXJF 1CF7A 4EV0A 4ASNA 2FOKA 4L9VA 3QPHA 1YW7A 2D1HA 2OD5A 2RVCA 1S7AA 3TO9A 1UCRA 4CGZA 2XIGA 3GVAA 4S05A 2K7LA 2H6CA 5LGTA 4LK0F 4G7HF 1IN4A 2Q0OA 1WKMA 3WU1B 1BIBA 3KFWX 5CLSA 4M72A 3DPLC 5HDGA 2PLYA 4HAMA 3RKWA 4ZYHA 2FA5A 4OINF 5FLXK 3KP2A 2HWVA 3R4KA 2F2EA 3ZMVA 1FBSA 2E7XA 4HLYA 4I09A 5F6FA 3MAJA 4IVNA 2B0LA 3MZHA 5E20A 2O61A 2QQAA 3F6VA 1KQ8A 3HIFA 4OOIA 2GXBA 2YX7A 2CG4A 4M9XA 1MZBA 4GO1A 5J6XA 3TO6A 5D5UB 3FHZA 2MBFA 3L9FA 1QQIA 3B02A 1XMAA 4LFUA 4KDPA 3WE3A 2P8TA 1R22A 2F5CA 3KLNA 3BOQA 2LF8A 2GA1A 1U8RA 3WTUC
chains in the Genus database with same CATH superfamily
2ZFWA 4A3FJ 1L3LA 3OYJA 4R79A 1W5SA 4UHTA 1D1BA 1BA5A 2DT6A 3K9TA 1BBYA 1PUFA 2VN2A 1FNNA 1HKQA 3DQVC 3O2PE 1VQ4I 1JT6A 2R7ZJ 1X1CA 4UB6C 1MJBA 3LQQA 1YIOA 2HOSA 1ZGAA 2OU2A 5LGUA 3K0LA 3L2RA 3IKVA 5KAFC 4A3LJ 1DGWY 1X58A 2GAUA 3IC7A 1Z67A 3BR3A 2K5CA 4F91B 1UELB 2LH9A 3MZYA 2IS6A 2L0KA 3J80Z 5E79C 3F8MA 5ED4A 4LG0B 2M45A 3RIRA 3H9QA 3O6BB 4IEJA 4PJJA 5EGOA 2X4HA 2GWRA 4FX4A 2K9QA 3S1QJ 3ZQGA 1B9MA 1TT5B 5DYMA 4EEFG 2LDUA 4JX4A 2WWYA 4UXNA 1T38A 4WXHA 5KK1A 5J1YA 3WTWC 1MJAA 3H35A 2VC0A 3IL2A 2GIZA 3ELKA 4M3FA 1EH7A 2E2IJ 2M4GA 5GAHJ 2IS1A 3TL4X 2HQNA 2XV4S 3FM5A 2PN6A 3FZVA 2XUBA 4CCNA 3KP5A 1ZR4A 1G59A 2KLOA 4HSTA 4BHBA 1MNMC 2EV0A 2QQ9A 3OIOA 2LFBA 3RTRA 3MEXA 1C0WA 4CO8A 4EM1A 1FC3A 4IX7A 2P5KA 3I59A 2EZKA 2G9WA 5L3EA 2OCEA 4FT8A 4KN4X 2LC2A 4XRFA 2XPVA 1YO5C 2QENA 2MC3A 3ISPA 9ANTA 4IRIA 1ETOA 4V2GA 2IA1A 3OYIA 2E34A 1DUXC 3WU0A 4A3DJ 3J7AY 3RZDJ 2KQRA 3I3LA 1HDDC 3GO5A 4RGRA 3R61A 2VBZA 2J5OA 2PBIA 4RGXA 3FIWA 2DA3A 4CZCA 1ZAOA 2Y69H 4ZC3A 4EJTA 2KJBA 5J8FA 4HEA2 2L7MP 4QPQA 3DEEA 5FO5A 3OIPA 3IAM2 1R1TA 3DWLE 4BBSJ 2JQ7A 3QYBA 2FUG2 2Y31A 3DCFA 3BJAA 1A04A 2K40A 4I02A 1Y0NA 1J59A 2EK5A 1J2XA 2CQKA 2H8RA 2DDBA 4UUSA 3WHCA 3L2CA 3EPZA 3PSFA 2E36A 4A3JJ 3A2KA 3PUBA 2KP6A 5LBQA 1JTXA 2OF7A 2V1NA 2DT5A 4HSRA 4AIJA 2DFFA 2K4BA 1RI7A 1W7PA 3F0CA 1K61A 3G2BA 4AIKA 3BQZA 3CDLA 2CRGA 1YX3A 2RQQA 3GLXA 1WCMJ 1WWXA 2IGNA 2BEOA 2CUZA 4NDLA 5FKMA 4HPQA 1FX7A 1UG2A 2COMA 2JA6J 1O7FA 4HX7A 1SAUA 2OQGA 1RKTA 5DCFA 1CQTA 2DMNA 3J81K 1V5FA 3GFMA 2QSHX 3BDDA 5LD2C 4MTDA 1FEXA 4HX8A 3GZ6A 2R5YB 2O6GE 4ZTJA 1N75A 2K02A 2L7KA 3H0GJ 1H89C 4KIBA 4XKWA 4EVIA 2BHZA 3HSFA 1OCOH 1Z77A 1F1ZA 4I2OA 2KHMA 3COAC 3FK7A 4S04A 2KIFA 3U1DA 3CUOA 3GTGJ 1QZZA 1S8NA 3HKZA 2O03A 2Z2SB 3PQJA 3TGNA 4P5OA 1HW1A 5HDKA 3HOTA 2RV8A 5B1AH 4R1HA 2ZSHB 5M5XJ 3LA2A 1TNTA 5J3LA 4E70A 5JR3A 5ILUA 2X48A 4RGUA 1T2KA 3CP2A 4FTHA 3BG5A 3CDIA 3BR0A 2XKPA 5B5EC 1OR7A 3C7JA 3SDBA 4A5NA 3CCJI 4RB1A 2KRFA 4M73A 3CF5F 2EPFA 4CCKA 2HDCA 4XRMA 4ZDLA 2MH2A 1RKWA 3ECHA 2ECBA 3WGIA 4UVBA 2A5YB 3WGGA 3CCMI 2P6TA 2MD5A 3MMYB 5A2QK 1WVRA 4E6KG 3T8RA 1AA7A 4F93B 1KU9A 1YTYA 4ZDOA 2Q2EA 3WGHA 4A0ZA 1GV2A 1UMQA 3K4JA 5DCMA 4WK8F 2XASA 3CMAI 3A0BC 4NQWB 2DODA 3H9GA 3EUHA 5K5RA 3BR6A 3KE2A 4HDVA 2BBYA 1IDYA 4C2MJ 2XKOA 2RKHA 1SFUA 3FXRA 4W1UA 3S2WA 2V9VA 1YFHA 4HNUA 1G6NA 1ETWA 3BPXA 1LVAA 3I4PA 4PJMA 3V7CA 1Y6IA 4C3HJ 3BR2A 2ECCA 1D0YA 4M9SA 3S1RJ 1SFEA 3GTQJ 4DZPA 2R5ZB 3PFIA 4M71A 1F43A 3EYIA 1RRJA 2HVSA 4QWQA 3GYHX 3ZQLA 2QCOA 2DMQA 2XAJA 2ZSIB 4NC6A 3TP3A 4GRIA 2W57A 4IKFA 3ZMDA 4RAYA 5F04A 1B59A 4XLHA 2DYSH 1VI0A 1PJRA 3KX2A 2DQLA 4O3MA 2CYYA 3ZCOA 1RUOA 1G3WA 3ABTA 2LLKA 3BJ6A 2CUFA 3PNVA 3W2VA 1D8KA 2V9PA 4ZYAA 3CMMA 1WGXA 1IRXA 3HDDA 1Y8QB 2NOJB 2Z16A 1G3SA 4G6QA 3DBHB 1LJ9A 5F1RA 1FOXA 3ABLH 2CUEA 3RZOJ 3RI4A 3FMSA 1IN7A 5E3MA 2N8GA 1D5YA 2EBIA 4RA2A 2L9VA 2YS9A 1Z91A 2RQPA 2IVMA 1RIOH 1LFPA 3CO6C 2ESNA 2EFNA 1NH3A 3O8GA 2VOPA 2IP2A 3LOCA 2DFEA 4U88A 3SZGA 2ZO4A 1YJNI 1GXPA 1LE8A 2ICWG 2W4SA 1TW2A 2J5PA 4P9UA 4RBOA 1JKQC 5HODA 2FEZA 3QPSA 1A35A 1FBUA 4KMUX 3ZQIA 3WTVC 3MQ0A 2DXIA 5HS9A 3HOSA 4MFDA 1KZHA 3IH3A 4WCGA 1MSFC 4KIFA 3LSJA 3PNTA 2M8EA 4YIFA 4M6XA 5B66C 1P6RA 1LDDA 1OCCH 2KDZA 1ONVA 4Y33A 1ETKA 5FLXZ 4Y3OA 4DBRA 2OPTA 5E1WA 1UFMA 3VPRA 3C2GA 2VL8A 4XNFA 5GTIC 5IY5H 4IO9F 2ZXWH 2XAFA 4ETSA 1K6OA 2FF4A 4FISA 1EA3A 2HYGD 3A0HC 2E2JJ 1FTTA 3VFZA 2IGOA 4M6YA 5D8KB 3TBIA 4EMSA 3GFLA 3K4MA 4XLCA 1N77A 3SHFA 3G1MA 3FXMA 4ESJA 3F8NA 4PGHA 3J7YJ 1IN6A 4G8XA 4YIRX 2CWEA 1IC8A 3LA3A 1X4OA 4EM0B 1T98A 1ZARA 1ZR2A 5EZHA 1E0EA 4C3JJ 5CYVA 2OTJI 2VQGA 5D8LB 2O3FA 4UVAA 4HA8A 3EETA 4IZZA 5HLGA 2E2HJ 4ESBA 2NRAC 4F7ZA 2B7EA 4A3KJ 5TGTA 3CCLI 4CH7A 2NNNA 3RQ4A 1XMKA 5TRDA 1DP3A 4A12A 2DFHA 4LJZF 5AIPA 3KP7A 3JTGA 1OCPA 3CDHA 5DV5A 1SD6A 2KT0A 4KT6A 3OS2A 4IHYA 2FRHA 3EUKL 5CPRB 2XAHA 5BNGA 4M6VA 2H27A 4GYIA 2LNBA 2O8KA 2XVCA 4BXXJ 2PLYA 3ZPLA 4LB5A 1FIPA 1T08B 1V4RA 2QSGX 1RR8C 3HKZN 4BDYA 2WAEA 4M74A 1G4DA 1EF4A 1J0RA 2EA2A 2ELKA 1XMXA 3PO2J 2KL4A 3RYRA 4E7JA 1GUUA 2B63J 1PDNC 4HRIA 2DMPA 2DA5A 1OR7C 4L9TA 3QQAA 5HNHA 1TP4A 2M8GX 2DA1A 2STTA 1ETYA 4AYBN 1ZHFA 3H5AA 4OIQF 3QYEA 2V1DA 2EIJH 2LKPA 3TQNA 4DYRA 1JKOC 2RNGA 5EG0B 1BOBA 1IN8A 2DAOA 4XM3A 2XDVA 1X3UA 4V19K 1BR4A 3JRAA 5BPIA 5HNFA 2UWMA 4UV9A 3JR9A 4CUGA 1OYWA 2DQRA 2ZMEC 1BR2A 5DUIA 1H9TA 4NHJA 4EM2A 4II2A 2DDAA 4PK4A 2OJED 1IRGA 2NYXA 2BOLA 1UHWA 3DKYA 1A6IA 1ZN2A 5EJCA 3W6KB 2KRCA 1WRJA 1HW5A 3QOPA 1XPXA 3PUFA 3SFZA 1W0TA 2JRTA 2Z1DA 3CUQC 5JLXA 3T1BA 1WJ5A 4OU0A 4BHCA 3NWSA 3ULQB 2O9LA 5LRRA 1SMTA 1PYVA 1RPWA 2VONA 2V1XA 2VT3A 3O8HA 4RB3C 3H5RA 2K3FA 4BXFA 3L2QA 3CCSI 1Y1WJ 1DDNA 1KU2A 4XLAA 3ERMA 4JX6A 4M9ZA 4HQEA 1A5JA 1MMNA 3ZP5A 3ZQCA 4EJOA 4BUPA 3G1LA 3G71I 2CQNA 2BY1A 1FJLA 5EF6A 5JHFA 1R23A 3WODF 5FFZA 2V6CA 1FOYA 4LGWA 2A68F 2WV1A 1NK2P 2M7AA 3VYUB 1KGSA 5L3BA 4HZFA 4OIRF 3CJQB 3I64A 1QNTA 3GTJJ 3G1OA 1D0ZA 4F52A 2F5VA 1E17A 1MBGA 1ZG1A 2IGKA 1SVMA 1ZRDA 5TISC 2GLOA 5IP6A 5IYCJ 2Y30A 1PP8F 4JX5A 2HKOA 3KYLA 2JA8J 1XB4A 1KYZA 3CUQB 3P7NA 4UVCA 1W7PD 3E5XA 3QP5A 4YELA 3SZTA 1P2FA 1HW2A 1FP1D 1O3RA 3I4MJ 2F4IA 1XSVA 3OYNA 1OYIA 4ZYEA 2WB1N 2QUFA 2G7HA 5J40A 3CCQI 4A3CJ 1H0MA 2PMZN 5E1XA 1WPKA 3QYFA 2E1CA 2HS5A 3A1YA 1F36A 3OIQA 4RB0A 3CCVI 1RR7A 3C2HA 1S5LC 2WBMA 1HCRA 1S3JA 3OYDA 3H1CA 2YR2A 1U9OA 4V2FA 2F4OB 5DDGA 1IRFA 3BR1A 3L00A 4BJ6C 1Z1DA 1ZKGA 3KCCA 2M30A 2JSPA 5H20A 2E1OA 2VJ4A 1TC3C 2VPRA 4Y4RA 1EH6A 5D5WB 3GX4X 3M8FA 2HFHA 3BY6A 1R58A 2RN7A 4XICA 3HRTA 3JTHA 1R9TJ 4CHUA 2HR3A 3GZNB 4MEYF 1F9NA 2NVQJ 3FK6A 4P55A 2L01A 3TOAA 3GWZA 4BU2A 4AD9A 1IRZA 1XC5A 5J47A 2IGMA 5CQEA 4A3BJ 3KEYA 1CGPA 1MW7A 1XGNA 4ENNA 2M7BA 3FISA 1FMWA 3FXQA 3FXJA 2HDWA 3KZIC 4L9NA 4XK4A 1I1SA 1HOMA 2ELJA 3KEOA 3PFYA 1R71A 4H4KC 4D5FA 2HPMA 1VQ5I 3J7AO 1PUEE 2BY0A 4W97A 2X0LA 2W84A 4BL0B 2E5NA 4EGZA 4A3GJ 1I6HJ 3EDPA 1XN7A 2M2EA 1B72A 3FDYA 1ZG5A 4Q5SF 5LFAA 3IWFA 1O7LA 2ZXHA 3D5RC 3LMMA 3SYTA 3S16J 4FETA 4MO7A 3HOYJ 2VKEA 1HDPA 2FD5A 3AG4H 5KCMA 4MEXF 1FPQA 2JT1A 3KEQA 3RPUA 1YLFA 4KUMA 4YIIA 3ZOBA 1K6YA 1Z6TA 1F4KA 2IS4A 4AUXA 3GFJA 1T95A 4BQQA 1VFCA 2L54A 2HYFA 2W24A 2M3AA 4XOTA 1VQNI 1UHSA 4Z2YA 2IXSA 3LAPA 3BTIA 5F08A 3C1DA 5K5OA 3OR2C 5HVQC 1YW9A 3TEDA 3E97A 4M3BA 4AC0A 1TWFJ 4CYCA 2ACJA 2JPBA 3FWEA 2CS3A 4F92B 4HLXA 2NS7A 2DK8A 3UKGA 3TP0A 2WV0A 5DM7F 2QSFX 1SD4A 2UXXA 3PSIA 3OSFA 4MQVA 1A31A 2HPIA 3OS0A 5IYDJ 5BQTA 5FKNA 2GXAA 4G7ZF 3J80K 4PJNA 5FD6A 4HQMA 2CH0A 2HQAA 4LD5A 4IQ4A 1FLIA 3MCZA 3M7GA 1X4PA 3HJEA 3F72A 2XF5A 1FMVA 1YS7A 3C2BA 1T39A 4IHTA 5F64A 3KYCB 3DKWA 4OAZA 2XRLA 1S7OA 1D5VA 1U3EM 4ZYGA 4B3AA 1LUJB 3BG3A 2HOTA 1JE8A 2I5UA 2QZ8A 2DFIA 4KICA 1GDTA 3E6DA 4WWCA 1R00A 4Q47A 2K86A 4PJ0C 5CVJA 1IAWA 4BAYA 3MKZA 1VQ8I 2UXNA 4CA0A 1TL8A 2L2OA 4J00A 4L18B 4CXFA 2FE3A 2WY8Q 3WG7H 5DD4A 1IV8A 1HSJA 1SANA 2R5YA 3EQLF 4B09A 1MNDA 3H92A 3HHHA 5EG0A 2K9MA 1ZG3A 1P9QC 4IRGA 1TWGJ 3FHNA 3JAMZ 5LHGA 1TLHB 2Y9YA 2FQ4A 3DKXA 2JPCA 3ML6A 5K7FA 1G8XA 1DPUA 2D45A 1D8JA 3U1KA 1YJ9I 5IT9K 2EZHA 2IA0A 2A07F 1J7KA 1J9IA 3P9CA 4JOMA 4GXOA 4BACA 3KPHA 2FBIA 1J75A 5J1RA 1JUMA 3HPGA 1JHFA 3CTAA 3BCBA 2BHYA 4IRHA 3S17J 5IT9Z 2EFOA 2L7ZA 4NC7A 2VOOA 2P7VB 1I50J 2FSWA 2Y48A 2YPRA 5L3DA 3GXOA 3K69A 3JSPA 4UUSB 1GVJA 1HA8A 2CJJA 2M87A 2UV1A 4AYBA 3LSHA 4OMZA 1T0FC 4P1WA 4JBAA 1GHCA 4KITB 3RKYA 3TMOA 1X19A 3QAHA 5E18F 2L4AA 2ZXIA 4LIUA 1ERDA 3WTTC 1K79A 4XLNF 2WAQN 3BG7A 1J09A 4UV8A 1I3AA 1BOAA 4BEHA 1D3YA 3RJPA 4HNTA 2FXAA 5L3GA 3ABMH 1BR1A 3ERED 1WFXA 3HOZJ 1OPCA 3ESWB 3K1MA 4QLCU 3MVPA 4CCLA 1Z9CA 3TO7A 1IG7A 4RLFA 1MMDA 5DM6F 4RMNA 3T0YA 4S0HB 3HSRA 4U87A 4B3XA 3V8KA 1FOWA 1BJZA 3N97A 1T8IA 3CQZJ 4A6DA 3FXUA 3ZN0A 3G4SI 1SFOJ 1AHDP 1QRYA 1XTAA 2DA7A 4XLPF 2LMDA 3I59B 3AL0B 4LK1F 2V1UA 1H9GA 2CV0A 2AO9A 1HKSA 1R5GA 2R7OA 4BBRJ 3WTYC 2VKDA 2QQ8A 2H94A 3E6MA 1SD5A 3E7LA 1SMYF 2OBPA 2ZB9A 5DUKA 2DPDA 4BE1A 2CUJA 2OV7A 1XGOA 2NVYJ 5JLWA 4X0GA 2MLKA 3NRVA 4HF0A 3QU6A 5C4XJ 1UHMA 4O5VA 2A3SA 3ZN1A 2VI6A 3AFHA 2A05A 3CESA 3BG9A 3I56I 1YIJI 1VQMI 4U0YA 4AIDA 2FOWA 2HXIA 1X1BA 1Y0UA 2FJ1A 2MH9A 3Q3SA 4GCVA 1WJAA 2LOOA 1ACIA 2TRTA 3S93A 4A2UA 1FY7A 2FU4A 1O3QA 2XF6A 2K9NA 2EA4A 2KISA 1E3PA 2RREA 3OYEA 3R6SA 3F8BA 4J01A 3MWMA 4N0BA 1QPMA 5E3OA 1R1VA 2IS2A 3EUAA 4IXAA 2QVOA 3KIOA 5JI6A 3BLYA 4KMFA 3BG6A 4XSXF 2KIQA 2JK3A 4OIOF 5IP7J 1G3YA 2B9SA 1VQPI 1FBQA 5GADJ 2ZXJA 3CCEI 5FJ8J 2WAFA 4XONA 3S2HJ 3ZQFA 3W3CA 2QWWA 1JHHA 2E35A 1H8AC 2JZYA 3P9KA 1UG0A 2BXYA 1R36A 3GLLA 5J1UA 3BPVA 5HLTA 3MKYB 1B72B 4E7ZA 2R5ZA 3OMYA 3WTXC 2Q8KA 3HBLA 1RESA 3OYKA 3IRQA 3TW7A 5DS9A 4N9HA 5CVIA 1MDMA 1RZ4A 2XGDA 2LY1A 1YW8A 4G7OF 3E3VA 2VB6A 3Q0UA 3ZRGA 4DW6A 2EQRA 1MJ9A 4BYYA 1IGNA 2Z5UA 3VYRB 5TJJA 3J7ZI 2XSJC 1KONA 2HOAA 1QVTA 3JRHA 2ZJQF 4KFCA 2YU3A 4RGSA 1TQPA 1UJ8A 4Y17A 3OOPA 1VQ9I 2DLLA 3REOA 2MLGA 4BGDA 2IRFG 2V9KA 2CFXA 5F27A 3GTLJ 1BC7C 1W5TA 1JJ8C 4IF4A 5K1YA 1NK3P 2DA4A 1I39A 3OYLA 3TW6A 3W6JB 1HF0A 3ZGKA 2IJLA 1YYVA 4CCMA 3CUQA 3D5LA 1K4SA 2A5WA 4BKXA 4PSXA 3SZPA 4KN7X 5HS8A 3RPQA 1TQMA 3TDUC 2ZNYA 2QEXI 4ZJZA 4CSWA 4OIPF 1WH7A 4JQFA 2ZJRF 4M3EA 5FRNA 1ODDA 1IDZA 1KU7A 4MNUA 1Y39A 1K7AA 2I10A 3CLOA 2M34A 3BROA 5D5VB 4XN0A 3CF2A 4HG2A 1H88C 4Y52J 1LQ1A 1Z6RA 4P96A 4A3EJ 2VT2A 4KJZA 4I99C 4FX0A 4P9FA 1FSEA 4PFOA 4XRSG 4YFXF 3L1PA 3L2WA 1XG1A 3KLOA 2JSCA 4L5JA 5GAEJ 3M8EA 3D0SA 3G3ZA 2DBBA 1B8IA 5HOOA 1UAAA 3IKTA 1YS6A 2ID3A 4I6ZA 2GQQA 5JFRA 2ZJPF 3C3WA 1YOVB 2PJRB 2V79A 4JP0A 4BEHB 2IA2A 3K4KA 3V7SA 1E3HA 4RS8A 1IZ1A 3FXLA 2ME6A 3DF8A 1LFBA 4ZYDA 2ZBKA 3Q0VA 4LLLA 1U2WA 3SFIA 3N05A 4NNJA 5CJ9A 4PFPA 4AVPA 3CO7C 1B9NA 4I0BA 3HPHA 1SD7A 3VYTB 5FRMA 2VJ5A 2XPUA 2XAGA 2XHKA 1RNLA 2VJIA 1X1PA 1BL0A 2W48A 2GBYA 1IV6A 3OYCA 4Q48A 4H0EA 2L9NA 3HTUA 1R5ID 4IL6C 3H36A 3Q0WA 4E7SA 4KYWA 1IUYA 2FBHA 2LRDA 2JN6A 4WX9A 2MG4A 1QGPA 2XB5A 4XRSA 5EEAA 3GTPJ 2X6WA 3OYFA 4XMYA 1IXSB 5IT3A 3DP7A 5IPAA 3AL0C 2QLZA 3EYYA 2JVHA 2W00A 3CCUI 4JK1X 2TDXA 4XSZF 1OFCX 2XC7A 3BWGA 4PUSA 5LRSA 2L02A 3CJRB 3LL7A 3VOEA 1Z05A 2KMUA 4B47A 4MFEA 3BJOA 1WJBA 5ICEA 1AU7A 3I5UA 3VDXA 4LIVA 1QZEA 2JA5J 1XGMA 2IW5A 1FYKA 5F0FA 1X3ZB 1XDUA 3IAS2 1P4WA 1Z7UA 2Y75A 1P4AA 2LVSA 5ERIA 1FWZA 1OLTA 2LREA 2DO7A 2QQBA 1WQ2A 3I71A 1YX5A 1BI1A 3CC2I 4BY1J 3ZMTA 2HGCA 3ZQHA 1JXSA 1U0JA 1J5YA 1B1BA 2Z33A 4II3A 3DPUA 1IO2A 2IT0A 1IW7F 5FKLA 3CMYA 4UNOA 2FNPA 4DJAA 2Z9OA 2PJRA 5J4YA 1X1AA 2OC6A 1S72I 1WZ2A 3BTJA 1ZRCA 1MH3A 2UUZA 2DTRA 4GYGA 4ZDPA 2LF7A 1TTYA 2O0YA 2KDOA 3DEUA 4U0VA 2ZJ2A 4IJAA 3RCOA 3QRFF 1ON1A 4WXCA 1LDJA 2L3DA 2NNYA 3AG2H 4X6AJ 5GPCA 3VYSB 4IHSA 2E19A 5FD5A 3HOUJ 3JRDA 1X1DA 3BTLA 4A69C 1P4XA 3LFKA 1P7IA 1ZYRF 2KJCA 2CSOA 4X1EA 3AG1H 4MGRA 4A0XA 2RNJA 2VQLA 4CICA 4C9YA 3CJTB 4G12A 2P81A 3IHUA 2P0WA 1BW6A 2WC2A 4QSHA 3U21A 5IYBJ 2Z99A 3WU2C 3QPLA 4WF2A 5GAGJ 2MABA 2F5DA 4A6EA 3DEWA 4D9JA 4CYDA 4KNYA 3NARA 1ZH5A 3JW4A 2LYCA 4BS9A 4RDUA 2NAZA 4M3DA 3TKYA 4F55A 1N78A 2KFDA 5E17F 2CGPA 2ZCWA 1GLNA 3HEFA 3SXYA 3E5QA 2V4JC 4O6JA 1LKXA 2VLAA 1R49A 3OSGA 5ICGA 4XKVA 4HDUA 1LDKB 2G7UA 1HSTA 1W5CC 2IEKA 2DOFA 3HC7A 2LD5A 4R8HA 1X2MA 4IHVA 2GZWA 3P5JA 5LEJA 4Y7NJ 2OQRA 3W2AA 1XGSA 4FQGA 3ZMUA 1V5GA 1P7JA 2AQFA 3PL8A 3OYMA 4PDKA 1MH4A 5FB2A 3L2VA 3M3YJ 2EFQA 3BR5A 3HGGA 4NBQA 4MTEA 5FFXA 2VE9A 3I58A 1NG7A 3FX3A 3LA7A 4UUVA 1D0XA 2R0QC 2VBYA 2O7OA 4YFNF 4C2UA 1UB9A 1SFXA 1BC8C 2CFOA 2FBKA 4XR6A 3KP4A 4Y13A 1LE8B 2ESHA 2DJIA 2RDPA 3FBNB 2QM3A 3JRBA 1T6SA 1I6XA 3ECOA 5EDNA 5M5WJ 1RUNA 3K4NA 3LWFA 2GOXB 2GIVA 2HNHA 4IPAA 5EEGA 5E3NA 2FQ3A 4CZZA 1T33A 4OWRB 4BH9A 1WJEA 4EJWA 3VWBA 2DA6A 3PNYA 4DZJA 2QBYA 3DV8A 2K3PA 3DTEA 4B43A 3HTSB 2NXNB 2ZNZA 3LAJA 4DYQA 3WE2A 1GXQA 4FE7A 3I4NJ 3ZMSA 3Q9SA 4D0PA 3G73A 1KQ0A 2LTPA 2CQQA 4I0AA 5DCMB 1YE9A 3NQOA 4BDZA 4A0YA 2CW8A 5IOZA 1JGSA 2HKXA 2Q2EB 2PMUA 1SEUA 1E2XA 2DT7B 5EEHA 2CQ7A 1ULYA 1PP7U 5DEQA 3U9GA 5C44J 2DYRH 4ITVA 2W82A 2X1DA 1WHUA 2IPQX 2P5LC 5LHHA 2BGCA 4DIQA 3S14J 5LLQA 1Y8RB 3HUGB 4XN3A 3B6CA 4B1RA 2H1KA 2WTEA 3MKLA 4L0YB 5HLHA 1MMAA 2JA2A 3DFGA 5B1BH 3T8TA 3CCRI 4ZZLA 2HZTA 3IRRA 2LY9A 3KP6A 4I01A 2VUMJ 2R7XA 2MW8A 2CQXA 4D7NA 4E7IA 3RDIA 3HZJA 4CCJA 2GOMA 3M9AA 2CO5A 4HV5A 4C30A 1JJ6C 3JAMK 3F23A 1DGRM 4L9JA 1REPC 3R60A 3L7WA 3JCUC 2JJ7A 4KT5C 2VQHA 3WTSC 3F8FA 2DTZA 2LSOA 4I76A 3UR3C 3CP8A 4NC8A 1DU0A 1O57A 4XLEA 2HVRA 3S8PA 5F0CA 5HS7A 2V26A 5AIQA 1TNSA 2EV5A 1POGA 1U78A 2AXLA 1ZGJA 3HSEA 1OCZH 1XCVA 4ANJA 1SVLA 2NVXJ 3HOXJ 3OY9A 1QHGA 2EZLA 2Y0SN 5H2FC 2ZKZA 4BNCA 3HGYA 4G6DA 2PMHA 4L0ZB 2M0CA 2FMLA 1I5ZA 3CC7I 2F5FA 2JUCA 1W7PB 1YHQI 3BP8A 3A03A 4HBLA 5LGNA 2QF7A 2HU9A 3IH4A 4UY8I 3BC8A 1P92A 2FNAA 2YX4A 2H8WA 2V6EA 2HVQA 1RC9A 3HYIA 1V55H 1ZQ3P 5CQGA 5GP9A 2GM4A 3HUGA 2DJNA 4NUBA 2XAQA 3UNGC 1V5EA 2IBDA 4RM2A 5BOXA 2HDDA 1PVEA 1TZLA 1USSA 1VNDA 2K9LA 4BY7J 1LB2A 3C18A 3HRUA 1QO0D 1TT0A 3SDGA 1FOKA 1JKPC 3B73A 5IOYA 1L0OC 2R7FA 4FHTA 1HBXG 1TWCJ 1JGGA 3LSGA 1N25A 3OWTA 2JUGA 3MFKA 4JYKA 3GBGA 2HI3A 4MHGA 1U5TA 3HL2A 5E8IA 2W85A 3BZCA 3H0DA 3HG9A 1MBEA 1T56A 3H5NA 1AWCA 3E6BA 1Q1VA 2QKLB 3HXLA 3QPTA 1GV5A 2YSRA 1TW3A 4A5MA 1QU3A 1HKTA 2R7WA 4HV6A 4XOPA 3AKZA 2DMTA 1KU3A 1AKHA 5K7ZA 5ILVA 2P6SA 2EJRA 5KHDA 5HDNA 5D6EA 4RAGA 3OYHA 1XD7A 1XS9A 1MBHA 3RKQA 1DP7P 4E7KA 2BV6A 2HEOA 4D5CA 4YG2F 4CDGA 2AQEA 2XGCA 3SEZA 3DU5A 1OQYA 1EV7A 4UUTA 4DOZA 4Q4ZF 2EIMH 2L9RA 2P7CB 1ZLJA 2EV6A 3FF5A 1LEAA 2Z3YA 1IF1A 2X1EA 2EH3A 1I3QJ 2XAUA 4EATA 1STZA 4EGYA 3AAFA 4LLNA 4B44A 4XIDA 3JRCA 1T0FA 2MGQA 5FLMJ 6PAXA 2DA2A 4AIHA 2VKVA 5K5QA 2JWTA 4BQNA 3E6CC 2HQRA 2PX9A 1ZGWA 3U2RA 1FIAA 2KIMA 3K70D 3WG9A 4DGWB 3S2DJ 3N4MA 5H6RA 1X2NA 2PG4A 3KETA 3BT9A 4DNCA 2MSYA 2KIUA 2VASA 2VBXA 3MZ8A 3VB2A 3OYGA 4HYEA 2E7WA 5BMZA 4PCQA 4HW0A 3HOVJ 3CZ6A 2JMWA 2X6YA 1OKRA 4MQ9F 2ME0A 5E1ZB 3JSOA 2EILH 1KQ9A 3VSLA 3H3VK 4WXDA 1VTNC 5CVRA 1WJCA 4GFBA 1MMGA 3D5SC 2EIKH 2BY3A 3F9KA 5CKTA 2BE5F 4LLGF 1MGTA 4FASD 1HXDA 1BI3A 4XLFA 2H6BA 2F48A 3PO3J 5FKKA 2L9SA 1X3WB 5EGOB 4KIGA 1QZYA 2BY2A 2UZKA 1ZREA 4Y15A 3RQIA 4DQ2A 2QA4I 4G9YA 3PIOF 2QKMB 3QWLA 2AHQA 1ITYA 2VC1A 3GEZA 3ONQA 3WHBA 4LITA 3IH2A 2PFBA 3GUDA 1R4NB 3LFUA 2X51A 3I9V2 1SC7A 3IWZA 1BIAA 3SEQA 2XPWA 1JI8A 1ENHA 4NB5A 2D1VA 5JHUA 5D5XB 3ZXSA 1XSDA 1PUFB 1IJWC 1QVUA 5M3FJ 3ABKH 2MC4A 3RPUD 2FMYA 2GA2A 2FX0A 3DLAA 4I98B 4M3GA 5J8CA 2P5VA 5KAIC 2L4MA 4GDFA 2RGVA 2OZ6A 1OISA 2WAQA 4HF2A 4XORA 4BE0A 4KISA 3OV8A 3V4GA 2K4JA 3O3KA 4AVZA 4XQFA 2BZTA 3H9JA 2CW0F 1R7JA 2DCEA 4ABZA 2K27A 4PSWA 3J81Z 4G6TB 2JA7J 3RYPA 1EKEA 1Y56A 1FP2A 3E0JB 3IP4B 2BW3B 4HOBA 5FKOA 3VEPA 3G6EI 3T5XA 1R5HA 1WH5A 1G3TA 2NVTJ 3M07A 2F5EA 5BS6A 3K4BA 2EB7A 1Z21A 3RSNA 1DPRA 2X9DA 3JRFA 2E71A 1QBJA 4K2EA 2BYVE 3KYDB 2LG4A 4UB8C 1WI3A 4XBFA 1S6LA 4RLQA 2PEXA 1BI0A 4IHXA 3HRMA 3A4CA 2KZGA 2D5VA 3L2UA 1AOYA 4J19A 2O8XA 2EFPA 2E1MB 1XCBA 1IXCA 4RM3A 5LHIA 4U7DA 3VODA 2GXGA 1ETXA 2M0MA 2H1LA 1A36A 1U9NA 1WSUA 1YRNB 4XL9A 3SJMA 1VQLI 1BM9A 2VE8A 1QHHD 5CVUA 2EINH 2LKSA 3V8JA 3V8LA 3NEUA 5D4SA 5AONA 3K10A 4ZZDA 3S1NJ 1W36C 3NWTA 3A01A 3EUHC 4AU7A 3CD6I 1JKRC 3ABUA 2F4MB 2CV1A 2A6TA 5ILSA 1ZELA 3DLLF 3ASNH 4LMYA 1TBXA 5LEKA 1GT0C 2G0EA 1W4MA 2PI0A 3LSRA 4C3IJ 3ZQQA 2VPLA 4RB2C 3OOUA 1W1WE 2HZDA 2ZFUA 2HXOA 4ENMA 4BQOA 2XB0X 1XSXA 2OZUA 3R0AA 3KZYA 2HOEA 3FXOA 1TWHJ 2Y9ZA 3Q5FA 2HTSA 5F1JA 4Z6YA 2AXTC 2R7RA 5C3EJ 3LSPA 3FMQA 5H6QA 3RKXA 3ASOH 3S3OA 1R1UA 1GVDA 2MA3A 1I27A 1KYWA 3B6AA 1Z3XA 2LR8A 1K83J 4YEJA 1BJAA 3IUOA 3CCYA 3JRIA 1ZRFA 1YRNA 2XGEA 1VQKI 3FMRA 2D2WA 4C2TA 2AS5F 1CF7B 4YRVA 1WI9A 3MKWB 2JVGA 3K2ZA 1TQIA 3F6OA 2OAZA 2MYSA 2Y0MA 5IP9J 2M4KA 3F21A 5M5YJ 1FYLA 4YFKF 1ETVA 2KKOA 1ZLKA 3LSIA 5DD8A 1VZ0A 5KNLA 4ENJA 2PMZA 4PZJA 2LBFB 3MN2A 2JRMA 1G2HA 3F8CA 3DTKA 4BQAA 1LFUP 2M1BA 3DTIA 4IQJA 2NS8A 1QPIA 4EQQA 4GGGA 5EYRA 1MBKA 5B3SH 2Y0SA 2VODA 2E1NA 3WTZA 2JTVA 2BW3A 1NHAA 2W1OA 1S7EA 3H3UA 3F3XA 1ETQA 1JT0A 1IXRC 3MD2A 4HX4A 3CJNA 4U7BA 1F5TA 4OMYA 3BZKA 4HNVA 2DN0A 1U8BA 2VJJA 2Q1ZB 2QBYB 3FBIB 1MDMB 3LQRA 3TOBA 1JUSA 4L5IA 3OYAA 5E8GA 2KZVA 2LY2A 5HLIA 4PGGA 1RETA 3HHGA 3DU6A 3DPTA 1B4AA 1R6RA 3BZ6A 3JREA 2OUMA 4LOCA 4TV7A 1U5TC 3GZ5A 3HM5A 1SFKA 4XKCA 4AM3A 2CU7A 4I7HA 2K9SA 5KVRA 3GTKJ 1NTCA 1QA6A 4OAYA 2STWA 1K78A 4N4OB 3FKJA 2DK5A 5FGMA 1O4XA 1MKMA 4BHPA 1XDSA 2ISYA 5FROA 2R7DA 2PQ8A 1SAXA 3DBRB 4U0WA 1OCRH 2ISZA 4XKBA 4G94A 1YG2A 3LNQA 4D7MA 1KA8A 2F6CA 5JVGF 1D1AA 2ELHA 3A02A 3CMEI 3M4OJ 4IOCF 2EFWA 4EJUA 2YUSA 1A6QA 4E7LA 5ICCA 1ON2A 2ADUA 3BQYA 1FSHA 1BW5A 2NOGA 2NVUB 3K4LA 3V42A 1FT9A 1VQ7I 3P9IA 4BJ5C 2DI3A 1U6GA 2OA4A 2R7VA 2W25A 4LG0A 4ZH4F 1YQAA 3I0TA 4LB6B 2M9HA 3GFIA 1EJ9A 3KZZA 2ZMEA 1BN5A 1MD0A 2QGUA 1OJLA 3I54A 3NAUA 1WJDA 2CMPA 3V7RA 2QYOA 4MLOA 2ZC2A 3K1NA 1O3TA 2ZMEB 2KRHA 3FM3A 1IUFA 1MMSA 5D4RA 2TCTA 4ON0A 2A69F 3M1EA 2W7NA 2OTLI 4RAZA 1K78B 1B6AA 3F22A 1D1CA 5F0HA 1LVKA 5K7HA 2XROA 2ETHA 3LSTA 1OMIA 3H3ZA 1TWAJ 5BPDA 3S1MJ 4N4NB 3K2AA 1XX5A 2EWNA 2EZIA 3M1CA 5ICFA 1K4TA 3QP6A 1MNEA 2LP0A 5GPAA 3W6VA 4HF1A 2R7UA 2R3SA 3LSKA 5EZGA 4IOAF 2Y2ZA 5JVTA 2PJPA 1V3FA 3PM1A 2A61A 2V7FA 3GF2A 4ZTFA 1OCTC 2RC4A 4EJVA 5M3MJ 4E7HA 2L5QA 5L3CA 1MBFA 4QTRA 1LEBA 1LNWA 5D6FA 2E1MC 4ENKA 1E3OC 3QU3A 1OYYA 2LKXA 3ZQ7A 3PQKA 3K7AJ 2OCCH 3TDZC 3S3MA 4RAFA 3HB9A 3GW2A 3VSKA 3PIPF 3QOEA 2VXDA 4A3MJ 2X85A 1I1GA 3E5UA 1HQCA 1WJFA 3PJRA 3ZMZA 3ROUA 2VXZA 2DOAA 3GTMJ 1S9HA 2L7FP 1YJWI 1MBJA 2DPUA 3L09A 3KP3A 5J4VA 2HQ5A 2MFZA 1S29A 2LBFA 1AKHB 5A2QZ 2DOEA 2HTJA 4ESFA 1ORKA 2YU9J 4BXUA 2C6YA 1Q1HA 1EH8A 1FZPB 1UZCA 3W2WA 4BE2A 5FLVA 2DU9A 3CC4I 2BVLA 2H09A 3I53A 4AWXB 2XGXA 4N9IA 1LPQA 2VKHA 2A6EF 4NQWA 2R7SA 1DQUA 1Y1VJ 4KA4A 1U5TB 3SQNA 3OR1C 3DBLB 3K1PA 1VF9A 1VQ6I 2A6HF 5CVVA 2COBA 2DMUA 3HRSA 1NG6A 2XRNA 5L3FA 1O3SA 2WADA 4QPOA 2WB1A 4D1QA 3ZR8X 2ID6A 3Q9VA 1DU6A 3R0JA 3FKIJ 2DW4A 3LSMA 5C4JJ 1BI2A 2I8DA 2NS0A 4MIMA 3E1SA 3FXKA 2WY7Q 1IN5A 3OL4A 1FYMA 2X1CA 2IAIA 1USTA 2MD0A 2P4WA 2K85A 2VBWA 4B8XA 2M5WA 3DXJF 4B48A 1CF7A 2R93J 2CV2A 2LK2A 3GMEA 4EV0A 4ASNA 4DYCA 4DBQA 2FOKA 4E4HA 4L9VA 3X2QH 2E5ZA 3QPHA 1YW7A 3IV5A 3GCMA 1YI2I 2HYJA 2D1HA 2OD5A 2RVCA 1S7AA 3TO9A 1UCRA 2WA0A 4CGZA 2XIGA 1HLVA 3GVAA 3S15J 4S05A 1M1EB 2K7LA 2BVMA 2H6CA 3AG3H 1MSEC 1Z0XA 1R4MB 3CLQA 4PJLA 2XF7A 5LGTA 1B8IB 4LK0F 4G7HF 1IN4A 3K6GA 2Q0OA 1YITI 1WKMA 1Z7LA 3OYBA 1Z3YA 3WU1B 1BIBA 3KFWX 4A93J 5CLSA 4M72A 2BXZA 2R7QA 3DPLC 2KPMA 5HDGA 3QODA 4QIWN 3I55I 1APLC 1ZK8A 4HAMA 4FE4A 3RKWA 4ZYHA 3A01B 1W36D 5E3LA 2FA5A 4IHWA 4OINF 5FLXK 2CW7A 3KP2A 2HWVA 2X6XA 3R4KA 4CYCB 2VQCA 3D1NI 2F2EA 3OS1A 2XSDC 3ZMVA 1FBSA 4F3QA 2R4GA 2E7XA 4HLYA 1FTZA 4I09A 5F6FA 3MAJA 3S32A 1HC8A 4B4CA 4IVNA 2B0LA 4A3IJ 2R7TA 3GTOJ 3M8JA 1V54H 3OL3A 3MZHA 2R92J 5E20A 2O61A 3S3NA 4BJTA 2QQAA 3F6VA 1KQ8A 3HIFA 4OOIA 2E60A 3BTCA 2GXBA 2YX7A 3JRGA 2CG4A 1JTYA 1JUPA 2X6OA 3BCAA 4M9XA 1MZBA 4GO1A 5GTHC 3TO6A 5J6XA 5D5UB 3FHZA 1W0UA 4FCYA 4L5EA 2MBFA 3L9FA 5DTDA 1QQIA 1VQOI 3B02A 1ZTRA 2RAEA 1XMAA 4LFUA 4KDPA 3WE3A 2P8TA 4LG3A 1R22A 2F5CA 3KLNA 2VIXA 3BOQA 1MIJA 2LF8A 2GA1A 3K4CA 3HOWJ 4CCOA 2O5RA 3K70C 1U8RA 1SVOA 3WTUC
chains in the Genus database with same CATH topology
2ZFWA 1L3LA 4R79A 1W5SA 4UHTA 3K9TA 1BBYA 2VN2A 1FNNA 1HKQA 3DQVC 3O2PE 1MJBA 3LQQA 1YIOA 1ZGAA 2OU2A 5LGUA 3K0LA 3IKVA 2GAUA 3IC7A 3MZYA 3J80Z 3F8MA 5ED4A 4LG0B 2M45A 3RIRA 3O6BB 2X4HA 2GWRA 4FX4A 1B9MA 5DYMA 2LDUA 2WWYA 4UXNA 1T38A 4WXHA 5KK1A 3WTWC 1MJAA 2VC0A 3IL2A 3ELKA 1EH7A 2HQNA 2XV4S 3FM5A 2PN6A 3FZVA 2XUBA 3KP5A 4BHBA 2EV0A 2QQ9A 3RTRA 3MEXA 1C0WA 4CO8A 4EM1A 1FC3A 2P5KA 3I59A 2G9WA 5L3EA 4FT8A 4KN4X 4XRFA 1YO5C 2QENA 2MC3A 3ISPA 4IRIA 2IA1A 1DUXC 3WU0A 3GO5A 4RGRA 3R61A 2VBZA 2J5OA 2PBIA 4RGXA 1ZAOA 4EJTA 2KJBA 5J8FA 5FO5A 1R1TA 3BJAA 1A04A 4I02A 1J59A 2EK5A 1J2XA 2CQKA 3L2CA 5LBQA 2DT5A 4AIJA 2K4BA 1RI7A 1W7PA 4AIKA 3GLXA 1WWXA 2BEOA 1FX7A 2COMA 1O7FA 4HX7A 2OQGA 5DCFA 3J81K 3GFMA 3BDDA 4MTDA 4HX8A 3GZ6A 2O6GE 2K02A 4KIBA 4EVIA 3HSFA 4I2OA 1F1ZA 3COAC 4S04A 2KIFA 3U1DA 3CUOA 1QZZA 1S8NA 2O03A 3PQJA 3TGNA 4P5OA 1HW1A 5HDKA 3HOTA 2RV8A 4R1HA 3LA2A 1TNTA 5JR3A 4E70A 5ILUA 4RGUA 1T2KA 2XKPA 1OR7A 3C7JA 4A5NA 4RB1A 2KRFA 4M73A 2HDCA 2MH2A 3ECHA 3WGIA 4UVBA 2A5YB 3WGGA 2P6TA 2MD5A 5A2QK 3T8RA 1KU9A 1YTYA 2Q2EA 3WGHA 4A0ZA 5DCMA 4WK8F 2XASA 3EUHA 5K5RA 3KE2A 4HDVA 2BBYA 2RKHA 2XKOA 1SFUA 3FXRA 3S2WA 2V9VA 1YFHA 1G6NA 3BPXA 3V7CA 1LVAA 3I4PA 4M9SA 1SFEA 3PFIA 4M71A 3EYIA 4QWQA 3GYHX 2XAJA 2W57A 3ZMDA 4RAYA 1B59A 4O3MA 2DQLA 2CYYA 1RUOA 1G3WA 3ABTA 3BJ6A 1D8KA 4G6QA 1G3SA 1LJ9A 5F1RA 3RI4A 3FMSA 1IN7A 1RIOH 1Z91A 2RQPA 2IVMA 3CO6C 2ESNA 2EFNA 2VOPA 2IP2A 4U88A 2ZO4A 1GXPA 4P9UA 1TW2A 2J5PA 2FEZA 1FBUA 4KMUX 3WTVC 3MQ0A 5HS9A 3HOSA 4WCGA 4KIFA 4YIFA 2M8EA 4M6XA 1P6RA 1LDDA 1ONVA 5FLXZ 5E1WA 1UFMA 2XAFA 4ETSA 1K6OA 2FF4A 2HYGD 3VFZA 4M6YA 5D8KB 4EMSA 3GFLA 3SHFA 4ESJA 3F8NA 4PGHA 1IN6A 4G8XA 2CWEA 3LA3A 4EM0B 1T98A 1ZARA 5CYVA 5D8LB 2O3FA 4UVAA 4HA8A 3EETA 5HLGA 4ESBA 2NRAC 4F7ZA 2NNNA 1XMKA 5TRDA 4A12A 4LJZF 5AIPA 3KP7A 3JTGA 3CDHA 5DV5A 1SD6A 2FRHA 2XAHA 2H27A 4GYIA 2LNBA 2XVCA 3ZPLA 4LB5A 1V4RA 4M74A 1G4DA 1J0RA 2EA2A 3RYRA 1PDNC 4L9TA 2STTA 1ZHFA 4OIQF 2V1DA 2LKPA 3TQNA 2DAOA 1IN8A 1X3UA 5BPIA 2UWMA 4UV9A 5DUIA 1OYWA 2DQRA 1H9TA 4NHJA 4EM2A 1IRGA 2NYXA 1UHWA 1ZN2A 3W6KB 1WRJA 1HW5A 3QOPA 3SFZA 2JRTA 3CUQC 3T1BA 4OU0A 4BHCA 3ULQB 5LRRA 1SMTA 2VONA 2V1XA 2VT3A 4RB3C 1DDNA 1KU2A 4M9ZA 4HQEA 3ZP5A 4EJOA 1R23A 3WODF 5FFZA 2V6CA 4LGWA 2A68F 1KGSA 5L3BA 4HZFA 4OIRF 3I64A 1QNTA 1E17A 1ZG1A 1ZRDA 1PP8F 2HKOA 1XB4A 1KYZA 3CUQB 3P7NA 4UVCA 1W7PD 3E5XA 3QP5A 3SZTA 1P2FA 1HW2A 1FP1D 1O3RA 1XSVA 1OYIA 4ZYEA 2QUFA 2G7HA 1H0MA 5E1XA 2E1CA 2HS5A 4RB0A 1S3JA 2YR2A 5DDGA 1IRFA 3L00A 1Z1DA 3KCCA 2M30A 5H20A 1EH6A 5D5WB 3GX4X 3M8FA 2HFHA 3BY6A 1R58A 2RN7A 3HRTA 3JTHA 4CHUA 2HR3A 4MEYF 1F9NA 4P55A 2L01A 3TOAA 3GWZA 4AD9A 1CGPA 1XGNA 4ENNA 3FXQA 4L9NA 1I1SA 3KEOA 3J7AO 1PUEE 2X0LA 2W84A 4EGZA 3EDPA 1XN7A 1ZG5A 4Q5SF 3IWFA 1O7LA 4MEXF 1FPQA 2JT1A 3KEQA 3RPUA 1YLFA 4KUMA 4YIIA 1Z6TA 1F4KA 3GFJA 2L54A 2HYFA 2W24A 4Z2YA 3LAPA 3C1DA 5K5OA 5HVQC 1YW9A 3E97A 2ACJA 2JPBA 3FWEA 4HLXA 2DK8A 2WV0A 1SD4A 2UXXA 4MQVA 5BQTA 4G7ZF 3J80K 5FD6A 4HQMA 4LD5A 1FLIA 3MCZA 3M7GA 3F72A 1YS7A 1T39A 4IHTA 5F64A 3DKWA 1S7OA 1D5VA 1U3EM 4ZYGA 1JE8A 2QZ8A 2DFIA 4KICA 3E6DA 4WWCA 1R00A 4Q47A 2K86A 5CVJA 1IAWA 4BAYA 2UXNA 4L18B 4CXFA 2FE3A 5DD4A 1HSJA 3EQLF 4B09A 3H92A 3HHHA 1ZG3A 4IRGA 3JAMZ 5LHGA 1TLHB 3ML6A 2JPCA 1DPUA 2D45A 1D8JA 5IT9K 2IA0A 2A07F 1J7KA 1J9IA 3P9CA 4GXOA 2FBIA 1J75A 1JHFA 3CTAA 4IRHA 5IT9Z 2EFOA 2VOOA 2P7VB 2FSWA 2YPRA 2Y48A 5L3DA 3GXOA 3K69A 3JSPA 1GVJA 2M87A 4OMZA 4JBAA 1GHCA 3RKYA 3QAHA 5E18F 2L4AA 3WTTC 1K79A 4XLNF 4UV8A 1BOAA 1D3YA 3RJPA 2FXAA 5L3GA 3ERED 1OPCA 3K1MA 4QLCU 1Z9CA 3TO7A 3T0YA 3HSRA 3V8KA 3N97A 4A6DA 3FXUA 3ZN0A 4XLPF 3I59B 4LK1F 2V1UA 1H9GA 1HKSA 1R5GA 3WTYC 2H94A 3E6MA 1SD5A 5DUKA 1SMYF 2OBPA 2DPDA 1XGOA 2MLKA 3NRVA 4HF0A 3QU6A 1UHMA 4O5VA 2A3SA 3ZN1A 4U0YA 1Y0UA 2MH9A 4GCVA 4A2UA 1FY7A 2FU4A 1O3QA 2EA4A 3R6SA 3F8BA 3MWMA 4N0BA 1QPMA 1R1VA 4IXAA 2QVOA 5JI6A 4KMFA 4XSXF 4OIOF 1G3YA 1FBQA 2ZXJA 2QWWA 1JHHA 2JZYA 3P9KA 1R36A 3BPVA 3WTXC 2Q8KA 3IRQA 4N9HA 5CVIA 1MDMA 1RZ4A 1YW8A 4G7OF 3E3VA 1MJ9A 4BYYA 2Z5UA 5TJJA 4KFCA 2YU3A 4RGSA 1TQPA 4Y17A 3OOPA 2DLLA 3REOA 2MLGA 2IRFG 2CFXA 1BC7C 1W5TA 4IF4A 5K1YA 3W6JB 2IJLA 1YYVA 3CUQA 3D5LA 3SZPA 4KN7X 5HS8A 3RPQA 1TQMA 3TDUC 2ZNYA 4OIPF 4JQFA 1ODDA 1KU7A 4MNUA 1K7AA 3CLOA 3BROA 5D5VB 1LQ1A 1Z6RA 4P96A 2VT2A 4P9FA 4YFXF 4FX0A 1FSEA 3KLOA 2JSCA 4L5JA 3M8EA 3D0SA 3G3ZA 2DBBA 5HOOA 3IKTA 1YS6A 2GQQA 5JFRA 3C3WA 2V79A 2IA2A 3V7SA 4RS8A 1IZ1A 3DF8A 4ZYDA 2ZBKA 4LLLA 1U2WA 5CJ9A 4AVPA 3CO7C 1B9NA 4I0BA 1SD7A 2XAGA 2XHKA 1RNLA 4Q48A 4H0EA 3HTUA 4KYWA 1IUYA 2FBHA 4WX9A 1QGPA 1IXSB 5IT3A 3DP7A 2QLZA 3EYYA 4JK1X 2TDXA 4XSZF 3BWGA 5LRSA 2L02A 3VOEA 1Z05A 3BJOA 5ICEA 3I5UA 1XGMA 2IW5A 1FYKA 1XDUA 1P4WA 1Z7UA 2Y75A 1P4AA 5ERIA 1FWZA 2DO7A 2QQBA 1WQ2A 3I71A 1BI1A 3ZMTA 2HGCA 1JXSA 1J5YA 1B1BA 2Z33A 2IT0A 1IW7F 4UNOA 2FNPA 2Z9OA 1ZRCA 4GYGA 2DTRA 2LF7A 1TTYA 2O0YA 3DEUA 4U0VA 2ZJ2A 4IJAA 3QRFF 1ON1A 4WXCA 1LDJA 2L3DA 2NNYA 4IHSA 5FD5A 1P4XA 3LFKA 1ZYRF 2KJCA 2CSOA 4MGRA 4A0XA 2RNJA 4CICA 3IHUA 2WC2A 2Z99A 4WF2A 2F5DA 4A6EA 4CYDA 4KNYA 1ZH5A 3JW4A 2NAZA 3TKYA 5E17F 2CGPA 2ZCWA 3SXYA 3E5QA 4O6JA 5ICGA 4HDUA 1LDKB 2G7UA 1HSTA 4R8HA 2GZWA 5LEJA 2OQRA 1XGSA 3ZMUA 4PDKA 5FB2A 2EFQA 4MTEA 5FFXA 2VE9A 3I58A 3FX3A 3LA7A 4UUVA 2VBYA 4YFNF 1UB9A 1SFXA 1BC8C 2FBKA 3KP4A 4Y13A 2ESHA 2RDPA 2QM3A 1T6SA 1I6XA 3ECOA 1RUNA 3LWFA 2GIVA 4IPAA 5EEGA 2FQ3A 4CZZA 4BH9A 4EJWA 2QBYA 3DV8A 3HTSB 2ZNZA 3LAJA 3WE2A 1GXQA 3ZMSA 3Q9SA 4D0PA 3G73A 1KQ0A 4I0AA 5DCMB 3NQOA 4A0YA 1JGSA 2HKXA 2PMUA 1E2XA 5EEHA 1ULYA 1PP7U 5DEQA 3U9GA 2IPQX 2P5LC 5LHHA 2BGCA 5LLQA 2WTEA 4L0YB 5HLHA 3DFGA 3T8TA 4ZZLA 3IRRA 2HZTA 3KP6A 4I01A 3RDIA 3M9AA 2CO5A 4HV5A 3JAMK 3F23A 4L9JA 1REPC 3R60A 3L7WA 4KT5C 3WTSC 3F8FA 2LSOA 1O57A 5HS7A 5AIQA 1TNSA 2EV5A 1U78A 2AXLA 1ZGJA 3HSEA 1XCVA 2ZKZA 4BNCA 4G6DA 2PMHA 4L0ZB 2FMLA 1I5ZA 2F5FA 1W7PB 3BP8A 4HBLA 5LGNA 1P92A 2FNAA 2YX4A 3HYIA 3HUGA 2XAQA 5BOXA 1USSA 1LB2A 3C18A 3HRUA 1QO0D 1FOKA 3B73A 1L0OC 2R7FA 4FHTA 1HBXG 3MFKA 4MHGA 1U5TA 5E8IA 2W85A 1AWCA 3E6BA 3QPTA 2YSRA 1TW3A 4A5MA 1HKTA 4HV6A 1KU3A 5ILVA 2P6SA 2EJRA 5HDNA 5D6EA 1XD7A 1DP7P 2BV6A 2HEOA 4YG2F 4CDGA 1EV7A 4Q4ZF 2P7CB 1ZLJA 2EV6A 3FF5A 1LEAA 2Z3YA 1IF1A 4EGYA 4LLNA 1STZA 3AAFA 1T0FA 6PAXA 4AIHA 5K5QA 3E6CC 2HQRA 3U2RA 2KIMA 3WG9A 3N4MA 5H6RA 2PG4A 3KETA 4DNCA 2KIUA 2VBXA 3VB2A 4HYEA 2E7WA 5BMZA 4PCQA 4HW0A 4MQ9F 1OKRA 5E1ZB 3JSOA 1KQ9A 4WXDA 1VTNC 5CVRA 2BE5F 4LLGF 1MGTA 1HXDA 1BI3A 2H6BA 4KIGA 1QZYA 2UZKA 1ZREA 4Y15A 4DQ2A 4G9YA 2VC1A 3GEZA 2PFBA 3GUDA 3IWZA 1BIAA 4NB5A 2D1VA 5JHUA 5D5XB 1XSDA 2FMYA 2GA2A 4I98B 5J8CA 2P5VA 2L4MA 2RGVA 2OZ6A 4HF2A 3OV8A 3V4GA 2K4JA 3O3KA 2CW0F 1R7JA 2K27A 3J81Z 3RYPA 1FP2A 4HOBA 3VEPA 3T5XA 1R5HA 1G3TA 2F5EA 5BS6A 2EB7A 1DPRA 1QBJA 4K2EA 2BYVE 4XBFA 1S6LA 2PEXA 1BI0A 3HRMA 1AOYA 2O8XA 2EFPA 1XCBA 1IXCA 5LHIA 4U7DA 3VODA 2GXGA 1WSUA 1BM9A 2VE8A 5CVUA 3V8LA 3V8JA 3NEUA 5D4SA 5AONA 4ZZDA 3ABUA 5ILSA 4LMYA 1TBXA 5LEKA 1W4MA 2PI0A 4RB2C 4ENMA 3R0AA 1XSXA 2OZUA 3KZYA 2HOEA 3Q5FA 2HTSA 3FMQA 5H6QA 3RKXA 1R1UA 2MA3A 1I27A 1KYWA 1BJAA 1ZRFA 3FMRA 2D2WA 2AS5F 1CF7B 1WI9A 3K2ZA 1TQIA 3F6OA 2OAZA 2Y0MA 3F21A 1FYLA 4YFKF 2KKOA 1ZLKA 5DD8A 4ENJA 4PZJA 3F8CA 4BQAA 2M1BA 4EQQA 4GGGA 2VODA 2E1NA 3WTZA 2JTVA 1NHAA 3H3UA 3F3XA 1IXRC 4HX4A 3CJNA 4U7BA 1F5TA 4OMYA 2QBYB 1MDMB 3LQRA 3TOBA 4L5IA 5E8GA 5HLIA 4PGGA 3HHGA 3DPTA 1B4AA 3BZ6A 4TV7A 1U5TC 3GZ5A 4I7HA 5KVRA 2STWA 1K78A 2DK5A 5FGMA 1MKMA 4BHPA 1XDSA 2ISYA 2R7DA 2PQ8A 1SAXA 4U0WA 2ISZA 4G94A 1YG2A 1KA8A 2ELHA 2EFWA 4EJUA 5ICCA 1ON2A 2ADUA 1FSHA 1FT9A 3P9IA 2DI3A 1U6GA 2OA4A 2W25A 4LG0A 4ZH4F 1YQAA 3I0TA 4LB6B 3GFIA 3KZZA 2ZMEA 1BN5A 1MD0A 3I54A 3V7RA 2QYOA 3K1NA 1O3TA 2ZMEB 3FM3A 5D4RA 4ON0A 2A69F 3M1EA 4RAZA 1K78B 1B6AA 3F22A 2XROA 2ETHA 3LSTA 1OMIA 3H3ZA 5BPDA 2EWNA 5ICFA 3QP6A 4HF1A 2R3SA 5JVTA 2PJPA 1V3FA 2A61A 3GF2A 2RC4A 4EJVA 5L3CA 1LEBA 1LNWA 5D6FA 4ENKA 3QU3A 1OYYA 3ZQ7A 3PQKA 3TDZC 3GW2A 1I1GA 1HQCA 3E5UA 3ZMZA 3ROUA 2VXZA 2DPUA 3L09A 3KP3A 1S29A 5A2QZ 2HTJA 4ESFA 4BXUA 2C6YA 1Q1HA 1EH8A 1FZPB 2DU9A 4AWXB 2H09A 3I53A 2XGXA 4N9IA 2A6EF 4NQWA 4KA4A 1U5TB 3SQNA 3K1PA 2A6HF 5CVVA 3HRSA 2XRNA 5L3FA 1O3SA 3Q9VA 3R0JA 2DW4A 1BI2A 2NS0A 1IN5A 1FYMA 2P4WA 1USTA 2VBWA 4B8XA 2M5WA 3DXJF 1CF7A 4EV0A 4ASNA 2FOKA 4L9VA 3QPHA 1YW7A 2D1HA 2OD5A 2RVCA 1S7AA 3TO9A 1UCRA 4CGZA 2XIGA 3GVAA 4S05A 2K7LA 2H6CA 5LGTA 4LK0F 4G7HF 1IN4A 2Q0OA 1WKMA 3WU1B 1BIBA 3KFWX 5CLSA 4M72A 3DPLC 5HDGA 2PLYA 4HAMA 3RKWA 4ZYHA 2FA5A 4OINF 5FLXK 3KP2A 2HWVA 3R4KA 2F2EA 3ZMVA 1FBSA 2E7XA 4HLYA 4I09A 5F6FA 3MAJA 4IVNA 2B0LA 3MZHA 5E20A 2O61A 2QQAA 3F6VA 1KQ8A 3HIFA 4OOIA 2GXBA 2YX7A 2CG4A 4M9XA 1MZBA 4GO1A 5J6XA 3TO6A 5D5UB 3FHZA 2MBFA 3L9FA 1QQIA 3B02A 1XMAA 4LFUA 4KDPA 3WE3A 2P8TA 1R22A 2F5CA 3KLNA 3BOQA 2LF8A 2GA1A 1U8RA 3WTUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFW A;  1L3L A;  4R79 A;  1W5S A;  4UHT A;  3K9T A;  1BBY A;  2VN2 A;  1FNN A;  1HKQ A;  3DQV C;  3O2P E;  1MJB A;  3LQQ A;  1YIO A;  1ZGA A;  2OU2 A;  5LGU A;  3K0L A;  3IKV A;  2GAU A;  3IC7 A;  3MZY A;  3J80 Z;  3F8M A;  5ED4 A;  4LG0 B;  2M45 A;  3RIR A;  3O6B B;  2X4H A;  2GWR A;  4FX4 A;  1B9M A;  5DYM A;  2LDU A;  2WWY A;  4UXN A;  1T38 A;  4WXH A;  5KK1 A;  3WTW C;  1MJA A;  2VC0 A;  3IL2 A;  3ELK A;  1EH7 A;  2HQN A;  2XV4 S;  3FM5 A;  2PN6 A;  3FZV A;  2XUB A;  3KP5 A;  4BHB A;  2EV0 A;  2QQ9 A;  3RTR A;  3MEX A;  1C0W A;  4CO8 A;  4EM1 A;  1FC3 A;  2P5K A;  3I59 A;  2G9W A;  5L3E A;  4FT8 A;  4KN4 X;  4XRF A;  1YO5 C;  2QEN A;  2MC3 A;  3ISP A;  4IRI A;  2IA1 A;  1DUX C;  3WU0 A;  3GO5 A;  4RGR A;  3R61 A;  2VBZ A;  2J5O A;  2PBI A;  4RGX A;  1ZAO A;  4EJT A;  2KJB A;  5J8F A;  5FO5 A;  1R1T A;  3BJA A;  1A04 A;  4I02 A;  1J59 A;  2EK5 A;  1J2X A;  2CQK A;  3L2C A;  5LBQ A;  2DT5 A;  4AIJ A;  2K4B A;  1RI7 A;  1W7P A;  4AIK A;  3GLX A;  1WWX A;  2BEO A;  1FX7 A;  2COM A;  1O7F A;  4HX7 A;  2OQG A;  5DCF A;  3J81 K;  3GFM A;  3BDD A;  4MTD A;  4HX8 A;  3GZ6 A;  2O6G E;  2K02 A;  4KIB A;  4EVI A;  3HSF A;  4I2O A;  1F1Z A;  3COA C;  4S04 A;  2KIF A;  3U1D A;  3CUO A;  1QZZ A;  1S8N A;  2O03 A;  3PQJ A;  3TGN A;  4P5O A;  1HW1 A;  5HDK A;  3HOT A;  2RV8 A;  4R1H A;  3LA2 A;  1TNT A;  5JR3 A;  4E70 A;  5ILU A;  4RGU A;  1T2K A;  2XKP A;  1OR7 A;  3C7J A;  4A5N A;  4RB1 A;  2KRF A;  4M73 A;  2HDC A;  2MH2 A;  3ECH A;  3WGI A;  4UVB A;  2A5Y B;  3WGG A;  2P6T A;  2MD5 A;  5A2Q K;  3T8R A;  1KU9 A;  1YTY A;  2Q2E A;  3WGH A;  4A0Z A;  5DCM A;  4WK8 F;  2XAS A;  3EUH A;  5K5R A;  3KE2 A;  4HDV A;  2BBY A;  2RKH A;  2XKO A;  1SFU A;  3FXR A;  3S2W A;  2V9V A;  1YFH A;  1G6N A;  3BPX A;  3V7C A;  1LVA A;  3I4P A;  4M9S A;  1SFE A;  3PFI A;  4M71 A;  3EYI A;  4QWQ A;  3GYH X;  2XAJ A;  2W57 A;  3ZMD A;  4RAY A;  1B59 A;  4O3M A;  2DQL A;  2CYY A;  1RUO A;  1G3W A;  3ABT A;  3BJ6 A;  1D8K A;  4G6Q A;  1G3S A;  1LJ9 A;  5F1R A;  3RI4 A;  3FMS A;  1IN7 A;  1RIO H;  1Z91 A;  2RQP A;  2IVM A;  3CO6 C;  2ESN A;  2EFN A;  2VOP A;  2IP2 A;  4U88 A;  2ZO4 A;  1GXP A;  4P9U A;  1TW2 A;  2J5P A;  2FEZ A;  1FBU A;  4KMU X;  3WTV C;  3MQ0 A;  5HS9 A;  3HOS A;  4WCG A;  4KIF A;  4YIF A;  2M8E A;  4M6X A;  1P6R A;  1LDD A;  1ONV A;  5FLX Z;  5E1W A;  1UFM A;  2XAF A;  4ETS A;  1K6O A;  2FF4 A;  2HYG D;  3VFZ A;  4M6Y A;  5D8K B;  4EMS A;  3GFL A;  3SHF A;  4ESJ A;  3F8N A;  4PGH A;  1IN6 A;  4G8X A;  2CWE A;  3LA3 A;  4EM0 B;  1T98 A;  1ZAR A;  5CYV A;  5D8L B;  2O3F A;  4UVA A;  4HA8 A;  3EET A;  5HLG A;  4ESB A;  2NRA C;  4F7Z A;  2NNN A;  1XMK A;  5TRD A;  4A12 A;  4LJZ F;  5AIP A;  3KP7 A;  3JTG A;  3CDH A;  5DV5 A;  1SD6 A;  2FRH A;  2XAH A;  2H27 A;  4GYI A;  2LNB A;  2XVC A;  3ZPL A;  4LB5 A;  1V4R A;  4M74 A;  1G4D A;  1J0R A;  2EA2 A;  3RYR A;  1PDN C;  4L9T A;  2STT A;  1ZHF A;  4OIQ F;  2V1D A;  2LKP A;  3TQN A;  2DAO A;  1IN8 A;  1X3U A;  5BPI A;  2UWM A;  4UV9 A;  5DUI A;  1OYW A;  2DQR A;  1H9T A;  4NHJ A;  4EM2 A;  1IRG A;  2NYX A;  1UHW A;  1ZN2 A;  3W6K B;  1WRJ A;  1HW5 A;  3QOP A;  3SFZ A;  2JRT A;  3CUQ C;  3T1B A;  4OU0 A;  4BHC A;  3ULQ B;  5LRR A;  1SMT A;  2VON A;  2V1X A;  2VT3 A;  4RB3 C;  1DDN A;  1KU2 A;  4M9Z A;  4HQE A;  3ZP5 A;  4EJO A;  1R23 A;  3WOD F;  5FFZ A;  2V6C A;  4LGW A;  2A68 F;  1KGS A;  5L3B A;  4HZF A;  4OIR F;  3I64 A;  1QNT A;  1E17 A;  1ZG1 A;  1ZRD A;  1PP8 F;  2HKO A;  1XB4 A;  1KYZ A;  3CUQ B;  3P7N A;  4UVC A;  1W7P D;  3E5X A;  3QP5 A;  3SZT A;  1P2F A;  1HW2 A;  1FP1 D;  1O3R A;  1XSV A;  1OYI A;  4ZYE A;  2QUF A;  2G7H A;  1H0M A;  5E1X A;  2E1C A;  2HS5 A;  4RB0 A;  1S3J A;  2YR2 A;  5DDG A;  1IRF A;  3L00 A;  1Z1D A;  3KCC A;  2M30 A;  5H20 A;  1EH6 A;  5D5W B;  3GX4 X;  3M8F A;  2HFH A;  3BY6 A;  1R58 A;  2RN7 A;  3HRT A;  3JTH A;  4CHU A;  2HR3 A;  4MEY F;  1F9N A;  4P55 A;  2L01 A;  3TOA A;  3GWZ A;  4AD9 A;  1CGP A;  1XGN A;  4ENN A;  3FXQ A;  4L9N A;  1I1S A;  3KEO A;  3J7A O;  1PUE E;  2X0L A;  2W84 A;  4EGZ A;  3EDP A;  1XN7 A;  1ZG5 A;  4Q5S F;  3IWF A;  1O7L A;  4MEX F;  1FPQ A;  2JT1 A;  3KEQ A;  3RPU A;  1YLF A;  4KUM A;  4YII A;  1Z6T A;  1F4K A;  3GFJ A;  2L54 A;  2HYF A;  2W24 A;  4Z2Y A;  3LAP A;  3C1D A;  5K5O A;  5HVQ C;  1YW9 A;  3E97 A;  2ACJ A;  2JPB A;  3FWE A;  4HLX A;  2DK8 A;  2WV0 A;  1SD4 A;  2UXX A;  4MQV A;  5BQT A;  4G7Z F;  3J80 K;  5FD6 A;  4HQM A;  4LD5 A;  1FLI A;  3MCZ A;  3M7G A;  3F72 A;  1YS7 A;  1T39 A;  4IHT A;  5F64 A;  3DKW A;  1S7O A;  1D5V A;  1U3E M;  4ZYG A;  1JE8 A;  2QZ8 A;  2DFI A;  4KIC A;  3E6D A;  4WWC A;  1R00 A;  4Q47 A;  2K86 A;  5CVJ A;  1IAW A;  4BAY A;  2UXN A;  4L18 B;  4CXF A;  2FE3 A;  5DD4 A;  1HSJ A;  3EQL F;  4B09 A;  3H92 A;  3HHH A;  1ZG3 A;  4IRG A;  3JAM Z;  5LHG A;  1TLH B;  3ML6 A;  2JPC A;  1DPU A;  2D45 A;  1D8J A;  5IT9 K;  2IA0 A;  2A07 F;  1J7K A;  1J9I A;  3P9C A;  4GXO A;  2FBI A;  1J75 A;  1JHF A;  3CTA A;  4IRH A;  5IT9 Z;  2EFO A;  2VOO A;  2P7V B;  2FSW A;  2YPR A;  2Y48 A;  5L3D A;  3GXO A;  3K69 A;  3JSP A;  1GVJ A;  2M87 A;  4OMZ A;  4JBA A;  1GHC A;  3RKY A;  3QAH A;  5E18 F;  2L4A A;  3WTT C;  1K79 A;  4XLN F;  4UV8 A;  1BOA A;  1D3Y A;  3RJP A;  2FXA A;  5L3G A;  3ERE D;  1OPC A;  3K1M A;  4QLC U;  1Z9C A;  3TO7 A;  3T0Y A;  3HSR A;  3V8K A;  3N97 A;  4A6D A;  3FXU A;  3ZN0 A;  4XLP F;  3I59 B;  4LK1 F;  2V1U A;  1H9G A;  1HKS A;  1R5G A;  3WTY C;  2H94 A;  3E6M A;  1SD5 A;  5DUK A;  1SMY F;  2OBP A;  2DPD A;  1XGO A;  2MLK A;  3NRV A;  4HF0 A;  3QU6 A;  1UHM A;  4O5V A;  2A3S A;  3ZN1 A;  4U0Y A;  1Y0U A;  2MH9 A;  4GCV A;  4A2U A;  1FY7 A;  2FU4 A;  1O3Q A;  2EA4 A;  3R6S A;  3F8B A;  3MWM A;  4N0B A;  1QPM A;  1R1V A;  4IXA A;  2QVO A;  5JI6 A;  4KMF A;  4XSX F;  4OIO F;  1G3Y A;  1FBQ A;  2ZXJ A;  2QWW A;  1JHH A;  2JZY A;  3P9K A;  1R36 A;  3BPV A;  3WTX C;  2Q8K A;  3IRQ A;  4N9H A;  5CVI A;  1MDM A;  1RZ4 A;  1YW8 A;  4G7O F;  3E3V A;  1MJ9 A;  4BYY A;  2Z5U A;  5TJJ A;  4KFC A;  2YU3 A;  4RGS A;  1TQP A;  4Y17 A;  3OOP A;  2DLL A;  3REO A;  2MLG A;  2IRF G;  2CFX A;  1BC7 C;  1W5T A;  4IF4 A;  5K1Y A;  3W6J B;  2IJL A;  1YYV A;  3CUQ A;  3D5L A;  3SZP A;  4KN7 X;  5HS8 A;  3RPQ A;  1TQM A;  3TDU C;  2ZNY A;  4OIP F;  4JQF A;  1ODD A;  1KU7 A;  4MNU A;  1K7A A;  3CLO A;  3BRO A;  5D5V B;  1LQ1 A;  1Z6R A;  4P96 A;  2VT2 A;  4P9F A;  4YFX F;  4FX0 A;  1FSE A;  3KLO A;  2JSC A;  4L5J A;  3M8E A;  3D0S A;  3G3Z A;  2DBB A;  5HOO A;  3IKT A;  1YS6 A;  2GQQ A;  5JFR A;  3C3W A;  2V79 A;  2IA2 A;  3V7S A;  4RS8 A;  1IZ1 A;  3DF8 A;  4ZYD A;  2ZBK A;  4LLL A;  1U2W A;  5CJ9 A;  4AVP A;  3CO7 C;  1B9N A;  4I0B A;  1SD7 A;  2XAG A;  2XHK A;  1RNL A;  4Q48 A;  4H0E A;  3HTU A;  4KYW A;  1IUY A;  2FBH A;  4WX9 A;  1QGP A;  1IXS B;  5IT3 A;  3DP7 A;  2QLZ A;  3EYY A;  4JK1 X;  2TDX A;  4XSZ F;  3BWG A;  5LRS A;  2L02 A;  3VOE A;  1Z05 A;  3BJO A;  5ICE A;  3I5U A;  1XGM A;  2IW5 A;  1FYK A;  1XDU A;  1P4W A;  1Z7U A;  2Y75 A;  1P4A A;  5ERI A;  1FWZ A;  2DO7 A;  2QQB A;  1WQ2 A;  3I71 A;  1BI1 A;  3ZMT A;  2HGC A;  1JXS A;  1J5Y A;  1B1B A;  2Z33 A;  2IT0 A;  1IW7 F;  4UNO A;  2FNP A;  2Z9O A;  1ZRC A;  4GYG A;  2DTR A;  2LF7 A;  1TTY A;  2O0Y A;  3DEU A;  4U0V A;  2ZJ2 A;  4IJA A;  3QRF F;  1ON1 A;  4WXC A;  1LDJ A;  2L3D A;  2NNY A;  4IHS A;  5FD5 A;  1P4X A;  3LFK A;  1ZYR F;  2KJC A;  2CSO A;  4MGR A;  4A0X A;  2RNJ A;  4CIC A;  3IHU A;  2WC2 A;  2Z99 A;  4WF2 A;  2F5D A;  4A6E A;  4CYD A;  4KNY A;  1ZH5 A;  3JW4 A;  2NAZ A;  3TKY A;  5E17 F;  2CGP A;  2ZCW A;  3SXY A;  3E5Q A;  4O6J A;  5ICG A;  4HDU A;  1LDK B;  2G7U A;  1HST A;  4R8H A;  2GZW A;  5LEJ A;  2OQR A;  1XGS A;  3ZMU A;  4PDK A;  5FB2 A;  2EFQ A;  4MTE A;  5FFX A;  2VE9 A;  3I58 A;  3FX3 A;  3LA7 A;  4UUV A;  2VBY A;  4YFN F;  1UB9 A;  1SFX A;  1BC8 C;  2FBK A;  3KP4 A;  4Y13 A;  2ESH A;  2RDP A;  2QM3 A;  1T6S A;  1I6X A;  3ECO A;  1RUN A;  3LWF A;  2GIV A;  4IPA A;  5EEG A;  2FQ3 A;  4CZZ A;  4BH9 A;  4EJW A;  2QBY A;  3DV8 A;  3HTS B;  2ZNZ A;  3LAJ A;  3WE2 A;  1GXQ A;  3ZMS A;  3Q9S A;  4D0P A;  3G73 A;  1KQ0 A;  4I0A A;  5DCM B;  3NQO A;  4A0Y A;  1JGS A;  2HKX A;  2PMU A;  1E2X A;  5EEH A;  1ULY A;  1PP7 U;  5DEQ A;  3U9G A;  2IPQ X;  2P5L C;  5LHH A;  2BGC A;  5LLQ A;  2WTE A;  4L0Y B;  5HLH A;  3DFG A;  3T8T A;  4ZZL A;  3IRR A;  2HZT A;  3KP6 A;  4I01 A;  3RDI A;  3M9A A;  2CO5 A;  4HV5 A;  3JAM K;  3F23 A;  4L9J A;  1REP C;  3R60 A;  3L7W A;  4KT5 C;  3WTS C;  3F8F A;  2LSO A;  1O57 A;  5HS7 A;  5AIQ A;  1TNS A;  2EV5 A;  1U78 A;  2AXL A;  1ZGJ A;  3HSE A;  1XCV A;  2ZKZ A;  4BNC A;  4G6D A;  2PMH A;  4L0Z B;  2FML A;  1I5Z A;  2F5F A;  1W7P B;  3BP8 A;  4HBL A;  5LGN A;  1P92 A;  2FNA A;  2YX4 A;  3HYI A;  3HUG A;  2XAQ A;  5BOX A;  1USS A;  1LB2 A;  3C18 A;  3HRU A;  1QO0 D;  1FOK A;  3B73 A;  1L0O C;  2R7F A;  4FHT A;  1HBX G;  3MFK A;  4MHG A;  1U5T A;  5E8I A;  2W85 A;  1AWC A;  3E6B A;  3QPT A;  2YSR A;  1TW3 A;  4A5M A;  1HKT A;  4HV6 A;  1KU3 A;  5ILV A;  2P6S A;  2EJR A;  5HDN A;  5D6E A;  1XD7 A;  1DP7 P;  2BV6 A;  2HEO A;  4YG2 F;  4CDG A;  1EV7 A;  4Q4Z F;  2P7C B;  1ZLJ A;  2EV6 A;  3FF5 A;  1LEA A;  2Z3Y A;  1IF1 A;  4EGY A;  4LLN A;  1STZ A;  3AAF A;  1T0F A;  6PAX A;  4AIH A;  5K5Q A;  3E6C C;  2HQR A;  3U2R A;  2KIM A;  3WG9 A;  3N4M A;  5H6R A;  2PG4 A;  3KET A;  4DNC A;  2KIU A;  2VBX A;  3VB2 A;  4HYE A;  2E7W A;  5BMZ A;  4PCQ A;  4HW0 A;  4MQ9 F;  1OKR A;  5E1Z B;  3JSO A;  1KQ9 A;  4WXD A;  1VTN C;  5CVR A;  2BE5 F;  4LLG F;  1MGT A;  1HXD A;  1BI3 A;  2H6B A;  4KIG A;  1QZY A;  2UZK A;  1ZRE A;  4Y15 A;  4DQ2 A;  4G9Y A;  2VC1 A;  3GEZ A;  2PFB A;  3GUD A;  3IWZ A;  1BIA A;  4NB5 A;  2D1V A;  5JHU A;  5D5X B;  1XSD A;  2FMY A;  2GA2 A;  4I98 B;  5J8C A;  2P5V A;  2L4M A;  2RGV A;  2OZ6 A;  4HF2 A;  3OV8 A;  3V4G A;  2K4J A;  3O3K A;  2CW0 F;  1R7J A;  2K27 A;  3J81 Z;  3RYP A;  1FP2 A;  4HOB A;  3VEP A;  3T5X A;  1R5H A;  1G3T A;  2F5E A;  5BS6 A;  2EB7 A;  1DPR A;  1QBJ A;  4K2E A;  2BYV E;  4XBF A;  1S6L A;  2PEX A;  1BI0 A;  3HRM A;  1AOY A;  2O8X A;  2EFP A;  1XCB A;  1IXC A;  5LHI A;  4U7D A;  3VOD A;  2GXG A;  1WSU A;  1BM9 A;  2VE8 A;  5CVU A;  3V8L A;  3V8J A;  3NEU A;  5D4S A;  5AON A;  4ZZD A;  3ABU A;  5ILS A;  4LMY A;  1TBX A;  5LEK A;  1W4M A;  2PI0 A;  4RB2 C;  4ENM A;  3R0A A;  1XSX A;  2OZU A;  3KZY A;  2HOE A;  3Q5F A;  2HTS A;  3FMQ A;  5H6Q A;  3RKX A;  1R1U A;  2MA3 A;  1I27 A;  1KYW A;  1BJA A;  1ZRF A;  3FMR A;  2D2W A;  2AS5 F;  1CF7 B;  1WI9 A;  3K2Z A;  1TQI A;  3F6O A;  2OAZ A;  2Y0M A;  3F21 A;  1FYL A;  4YFK F;  2KKO A;  1ZLK A;  5DD8 A;  4ENJ A;  4PZJ A;  3F8C A;  4BQA A;  2M1B A;  4EQQ A;  4GGG A;  2VOD A;  2E1N A;  3WTZ A;  2JTV A;  1NHA A;  3H3U A;  3F3X A;  1IXR C;  4HX4 A;  3CJN A;  4U7B A;  1F5T A;  4OMY A;  2QBY B;  1MDM B;  3LQR A;  3TOB A;  4L5I A;  5E8G A;  5HLI A;  4PGG A;  3HHG A;  3DPT A;  1B4A A;  3BZ6 A;  4TV7 A;  1U5T C;  3GZ5 A;  4I7H A;  5KVR A;  2STW A;  1K78 A;  2DK5 A;  5FGM A;  1MKM A;  4BHP A;  1XDS A;  2ISY A;  2R7D A;  2PQ8 A;  1SAX A;  4U0W A;  2ISZ A;  4G94 A;  1YG2 A;  1KA8 A;  2ELH A;  2EFW A;  4EJU A;  5ICC A;  1ON2 A;  2ADU A;  1FSH A;  1FT9 A;  3P9I A;  2DI3 A;  1U6G A;  2OA4 A;  2W25 A;  4LG0 A;  4ZH4 F;  1YQA A;  3I0T A;  4LB6 B;  3GFI A;  3KZZ A;  2ZME A;  1BN5 A;  1MD0 A;  3I54 A;  3V7R A;  2QYO A;  3K1N A;  1O3T A;  2ZME B;  3FM3 A;  5D4R A;  4ON0 A;  2A69 F;  3M1E A;  4RAZ A;  1K78 B;  1B6A A;  3F22 A;  2XRO A;  2ETH A;  3LST A;  1OMI A;  3H3Z A;  5BPD A;  2EWN A;  5ICF A;  3QP6 A;  4HF1 A;  2R3S A;  5JVT A;  2PJP A;  1V3F A;  2A61 A;  3GF2 A;  2RC4 A;  4EJV A;  5L3C A;  1LEB A;  1LNW A;  5D6F A;  4ENK A;  3QU3 A;  1OYY A;  3ZQ7 A;  3PQK A;  3TDZ C;  3GW2 A;  1I1G A;  1HQC A;  3E5U A;  3ZMZ A;  3ROU A;  2VXZ A;  2DPU A;  3L09 A;  3KP3 A;  1S29 A;  5A2Q Z;  2HTJ A;  4ESF A;  4BXU A;  2C6Y A;  1Q1H A;  1EH8 A;  1FZP B;  2DU9 A;  4AWX B;  2H09 A;  3I53 A;  2XGX A;  4N9I A;  2A6E F;  4NQW A;  4KA4 A;  1U5T B;  3SQN A;  3K1P A;  2A6H F;  5CVV A;  3HRS A;  2XRN A;  5L3F A;  1O3S A;  3Q9V A;  3R0J A;  2DW4 A;  1BI2 A;  2NS0 A;  1IN5 A;  1FYM A;  2P4W A;  1UST A;  2VBW A;  4B8X A;  2M5W A;  3DXJ F;  1CF7 A;  4EV0 A;  4ASN A;  2FOK A;  4L9V A;  3QPH A;  1YW7 A;  2D1H A;  2OD5 A;  2RVC A;  1S7A A;  3TO9 A;  1UCR A;  4CGZ A;  2XIG A;  3GVA A;  4S05 A;  2K7L A;  2H6C A;  5LGT A;  4LK0 F;  4G7H F;  1IN4 A;  2Q0O A;  1WKM A;  3WU1 B;  1BIB A;  3KFW X;  5CLS A;  4M72 A;  3DPL C;  5HDG A;  2PLY A;  4HAM A;  3RKW A;  4ZYH A;  2FA5 A;  4OIN F;  5FLX K;  3KP2 A;  2HWV A;  3R4K A;  2F2E A;  3ZMV A;  1FBS A;  2E7X A;  4HLY A;  4I09 A;  5F6F A;  3MAJ A;  4IVN A;  2B0L A;  3MZH A;  5E20 A;  2O61 A;  2QQA A;  3F6V A;  1KQ8 A;  3HIF A;  4OOI A;  2GXB A;  2YX7 A;  2CG4 A;  4M9X A;  1MZB A;  4GO1 A;  5J6X A;  3TO6 A;  5D5U B;  3FHZ A;  2MBF A;  3L9F A;  1QQI A;  3B02 A;  1XMA A;  4LFU A;  4KDP A;  3WE3 A;  2P8T A;  1R22 A;  2F5C A;  3KLN A;  3BOQ A;  2LF8 A;  2GA1 A;  1U8R A;  3WTU C; 
#chains in the Genus database with same CATH topology
 2ZFW A;  4A3F J;  1L3L A;  3OYJ A;  4R79 A;  1W5S A;  4UHT A;  1D1B A;  1BA5 A;  2DT6 A;  3K9T A;  1BBY A;  1PUF A;  2VN2 A;  1FNN A;  1HKQ A;  3DQV C;  3O2P E;  1VQ4 I;  1JT6 A;  2R7Z J;  1X1C A;  4UB6 C;  1MJB A;  3LQQ A;  1YIO A;  2HOS A;  1ZGA A;  2OU2 A;  5LGU A;  3K0L A;  3L2R A;  3IKV A;  5KAF C;  4A3L J;  1DGW Y;  1X58 A;  2GAU A;  3IC7 A;  1Z67 A;  3BR3 A;  2K5C A;  4F91 B;  1UEL B;  2LH9 A;  3MZY A;  2IS6 A;  2L0K A;  3J80 Z;  5E79 C;  3F8M A;  5ED4 A;  4LG0 B;  2M45 A;  3RIR A;  3H9Q A;  3O6B B;  4IEJ A;  4PJJ A;  5EGO A;  2X4H A;  2GWR A;  4FX4 A;  2K9Q A;  3S1Q J;  3ZQG A;  1B9M A;  1TT5 B;  5DYM A;  4EEF G;  2LDU A;  4JX4 A;  2WWY A;  4UXN A;  1T38 A;  4WXH A;  5KK1 A;  5J1Y A;  3WTW C;  1MJA A;  3H35 A;  2VC0 A;  3IL2 A;  2GIZ A;  3ELK A;  4M3F A;  1EH7 A;  2E2I J;  2M4G A;  5GAH J;  2IS1 A;  3TL4 X;  2HQN A;  2XV4 S;  3FM5 A;  2PN6 A;  3FZV A;  2XUB A;  4CCN A;  3KP5 A;  1ZR4 A;  1G59 A;  2KLO A;  4HST A;  4BHB A;  1MNM C;  2EV0 A;  2QQ9 A;  3OIO A;  2LFB A;  3RTR A;  3MEX A;  1C0W A;  4CO8 A;  4EM1 A;  1FC3 A;  4IX7 A;  2P5K A;  3I59 A;  2EZK A;  2G9W A;  5L3E A;  2OCE A;  4FT8 A;  4KN4 X;  2LC2 A;  4XRF A;  2XPV A;  1YO5 C;  2QEN A;  2MC3 A;  3ISP A;  9ANT A;  4IRI A;  1ETO A;  4V2G A;  2IA1 A;  3OYI A;  2E34 A;  1DUX C;  3WU0 A;  4A3D J;  3J7A Y;  3RZD J;  2KQR A;  3I3L A;  1HDD C;  3GO5 A;  4RGR A;  3R61 A;  2VBZ A;  2J5O A;  2PBI A;  4RGX A;  3FIW A;  2DA3 A;  4CZC A;  1ZAO A;  2Y69 H;  4ZC3 A;  4EJT A;  2KJB A;  5J8F A;  4HEA 2;  2L7M P;  4QPQ A;  3DEE A;  5FO5 A;  3OIP A;  3IAM 2;  1R1T A;  3DWL E;  4BBS J;  2JQ7 A;  3QYB A;  2FUG 2;  2Y31 A;  3DCF A;  3BJA A;  1A04 A;  2K40 A;  4I02 A;  1Y0N A;  1J59 A;  2EK5 A;  1J2X A;  2CQK A;  2H8R A;  2DDB A;  4UUS A;  3WHC A;  3L2C A;  3EPZ A;  3PSF A;  2E36 A;  4A3J J;  3A2K A;  3PUB A;  2KP6 A;  5LBQ A;  1JTX A;  2OF7 A;  2V1N A;  2DT5 A;  4HSR A;  4AIJ A;  2DFF A;  2K4B A;  1RI7 A;  1W7P A;  3F0C A;  1K61 A;  3G2B A;  4AIK A;  3BQZ A;  3CDL A;  2CRG A;  1YX3 A;  2RQQ A;  3GLX A;  1WCM J;  1WWX A;  2IGN A;  2BEO A;  2CUZ A;  4NDL A;  5FKM A;  4HPQ A;  1FX7 A;  1UG2 A;  2COM A;  2JA6 J;  1O7F A;  4HX7 A;  1SAU A;  2OQG A;  1RKT A;  5DCF A;  1CQT A;  2DMN A;  3J81 K;  1V5F A;  3GFM A;  2QSH X;  3BDD A;  5LD2 C;  4MTD A;  1FEX A;  4HX8 A;  3GZ6 A;  2R5Y B;  2O6G E;  4ZTJ A;  1N75 A;  2K02 A;  2L7K A;  3H0G J;  1H89 C;  4KIB A;  4XKW A;  4EVI A;  2BHZ A;  3HSF A;  1OCO H;  1Z77 A;  1F1Z A;  4I2O A;  2KHM A;  3COA C;  3FK7 A;  4S04 A;  2KIF A;  3U1D A;  3CUO A;  3GTG J;  1QZZ A;  1S8N A;  3HKZ A;  2O03 A;  2Z2S B;  3PQJ A;  3TGN A;  4P5O A;  1HW1 A;  5HDK A;  3HOT A;  2RV8 A;  5B1A H;  4R1H A;  2ZSH B;  5M5X J;  3LA2 A;  1TNT A;  5J3L A;  4E70 A;  5JR3 A;  5ILU A;  2X48 A;  4RGU A;  1T2K A;  3CP2 A;  4FTH A;  3BG5 A;  3CDI A;  3BR0 A;  2XKP A;  5B5E C;  1OR7 A;  3C7J A;  3SDB A;  4A5N A;  3CCJ I;  4RB1 A;  2KRF A;  4M73 A;  3CF5 F;  2EPF A;  4CCK A;  2HDC A;  4XRM A;  4ZDL A;  2MH2 A;  1RKW A;  3ECH A;  2ECB A;  3WGI A;  4UVB A;  2A5Y B;  3WGG A;  3CCM I;  2P6T A;  2MD5 A;  3MMY B;  5A2Q K;  1WVR A;  4E6K G;  3T8R A;  1AA7 A;  4F93 B;  1KU9 A;  1YTY A;  4ZDO A;  2Q2E A;  3WGH A;  4A0Z A;  1GV2 A;  1UMQ A;  3K4J A;  5DCM A;  4WK8 F;  2XAS A;  3CMA I;  3A0B C;  4NQW B;  2DOD A;  3H9G A;  3EUH A;  5K5R A;  3BR6 A;  3KE2 A;  4HDV A;  2BBY A;  1IDY A;  4C2M J;  2XKO A;  2RKH A;  1SFU A;  3FXR A;  4W1U A;  3S2W A;  2V9V A;  1YFH A;  4HNU A;  1G6N A;  1ETW A;  3BPX A;  1LVA A;  3I4P A;  4PJM A;  3V7C A;  1Y6I A;  4C3H J;  3BR2 A;  2ECC A;  1D0Y A;  4M9S A;  3S1R J;  1SFE A;  3GTQ J;  4DZP A;  2R5Z B;  3PFI A;  4M71 A;  1F43 A;  3EYI A;  1RRJ A;  2HVS A;  4QWQ A;  3GYH X;  3ZQL A;  2QCO A;  2DMQ A;  2XAJ A;  2ZSI B;  4NC6 A;  3TP3 A;  4GRI A;  2W57 A;  4IKF A;  3ZMD A;  4RAY A;  5F04 A;  1B59 A;  4XLH A;  2DYS H;  1VI0 A;  1PJR A;  3KX2 A;  2DQL A;  4O3M A;  2CYY A;  3ZCO A;  1RUO A;  1G3W A;  3ABT A;  2LLK A;  3BJ6 A;  2CUF A;  3PNV A;  3W2V A;  1D8K A;  2V9P A;  4ZYA A;  3CMM A;  1WGX A;  1IRX A;  3HDD A;  1Y8Q B;  2NOJ B;  2Z16 A;  1G3S A;  4G6Q A;  3DBH B;  1LJ9 A;  5F1R A;  1FOX A;  3ABL H;  2CUE A;  3RZO J;  3RI4 A;  3FMS A;  1IN7 A;  5E3M A;  2N8G A;  1D5Y A;  2EBI A;  4RA2 A;  2L9V A;  2YS9 A;  1Z91 A;  2RQP A;  2IVM A;  1RIO H;  1LFP A;  3CO6 C;  2ESN A;  2EFN A;  1NH3 A;  3O8G A;  2VOP A;  2IP2 A;  3LOC A;  2DFE A;  4U88 A;  3SZG A;  2ZO4 A;  1YJN I;  1GXP A;  1LE8 A;  2ICW G;  2W4S A;  1TW2 A;  2J5P A;  4P9U A;  4RBO A;  1JKQ C;  5HOD A;  2FEZ A;  3QPS A;  1A35 A;  1FBU A;  4KMU X;  3ZQI A;  3WTV C;  3MQ0 A;  2DXI A;  5HS9 A;  3HOS A;  4MFD A;  1KZH A;  3IH3 A;  4WCG A;  1MSF C;  4KIF A;  3LSJ A;  3PNT A;  2M8E A;  4YIF A;  4M6X A;  5B66 C;  1P6R A;  1LDD A;  1OCC H;  2KDZ A;  1ONV A;  4Y33 A;  1ETK A;  5FLX Z;  4Y3O A;  4DBR A;  2OPT A;  5E1W A;  1UFM A;  3VPR A;  3C2G A;  2VL8 A;  4XNF A;  5GTI C;  5IY5 H;  4IO9 F;  2ZXW H;  2XAF A;  4ETS A;  1K6O A;  2FF4 A;  4FIS A;  1EA3 A;  2HYG D;  3A0H C;  2E2J J;  1FTT A;  3VFZ A;  2IGO A;  4M6Y A;  5D8K B;  3TBI A;  4EMS A;  3GFL A;  3K4M A;  4XLC A;  1N77 A;  3SHF A;  3G1M A;  3FXM A;  4ESJ A;  3F8N A;  4PGH A;  3J7Y J;  1IN6 A;  4G8X A;  4YIR X;  2CWE A;  1IC8 A;  3LA3 A;  1X4O A;  4EM0 B;  1T98 A;  1ZAR A;  1ZR2 A;  5EZH A;  1E0E A;  4C3J J;  5CYV A;  2OTJ I;  2VQG A;  5D8L B;  2O3F A;  4UVA A;  4HA8 A;  3EET A;  4IZZ A;  5HLG A;  2E2H J;  4ESB A;  2NRA C;  4F7Z A;  2B7E A;  4A3K J;  5TGT A;  3CCL I;  4CH7 A;  2NNN A;  3RQ4 A;  1XMK A;  5TRD A;  1DP3 A;  4A12 A;  2DFH A;  4LJZ F;  5AIP A;  3KP7 A;  3JTG A;  1OCP A;  3CDH A;  5DV5 A;  1SD6 A;  2KT0 A;  4KT6 A;  3OS2 A;  4IHY A;  2FRH A;  3EUK L;  5CPR B;  2XAH A;  5BNG A;  4M6V A;  2H27 A;  4GYI A;  2LNB A;  2O8K A;  2XVC A;  4BXX J;  2PLY A;  3ZPL A;  4LB5 A;  1FIP A;  1T08 B;  1V4R A;  2QSG X;  1RR8 C;  3HKZ N;  4BDY A;  2WAE A;  4M74 A;  1G4D A;  1EF4 A;  1J0R A;  2EA2 A;  2ELK A;  1XMX A;  3PO2 J;  2KL4 A;  3RYR A;  4E7J A;  1GUU A;  2B63 J;  1PDN C;  4HRI A;  2DMP A;  2DA5 A;  1OR7 C;  4L9T A;  3QQA A;  5HNH A;  1TP4 A;  2M8G X;  2DA1 A;  2STT A;  1ETY A;  4AYB N;  1ZHF A;  3H5A A;  4OIQ F;  3QYE A;  2V1D A;  2EIJ H;  2LKP A;  3TQN A;  4DYR A;  1JKO C;  2RNG A;  5EG0 B;  1BOB A;  1IN8 A;  2DAO A;  4XM3 A;  2XDV A;  1X3U A;  4V19 K;  1BR4 A;  3JRA A;  5BPI A;  5HNF A;  2UWM A;  4UV9 A;  3JR9 A;  4CUG A;  1OYW A;  2DQR A;  2ZME C;  1BR2 A;  5DUI A;  1H9T A;  4NHJ A;  4EM2 A;  4II2 A;  2DDA A;  4PK4 A;  2OJE D;  1IRG A;  2NYX A;  2BOL A;  1UHW A;  3DKY A;  1A6I A;  1ZN2 A;  5EJC A;  3W6K B;  2KRC A;  1WRJ A;  1HW5 A;  3QOP A;  1XPX A;  3PUF A;  3SFZ A;  1W0T A;  2JRT A;  2Z1D A;  3CUQ C;  5JLX A;  3T1B A;  1WJ5 A;  4OU0 A;  4BHC A;  3NWS A;  3ULQ B;  2O9L A;  5LRR A;  1SMT A;  1PYV A;  1RPW A;  2VON A;  2V1X A;  2VT3 A;  3O8H A;  4RB3 C;  3H5R A;  2K3F A;  4BXF A;  3L2Q A;  3CCS I;  1Y1W J;  1DDN A;  1KU2 A;  4XLA A;  3ERM A;  4JX6 A;  4M9Z A;  4HQE A;  1A5J A;  1MMN A;  3ZP5 A;  3ZQC A;  4EJO A;  4BUP A;  3G1L A;  3G71 I;  2CQN A;  2BY1 A;  1FJL A;  5EF6 A;  5JHF A;  1R23 A;  3WOD F;  5FFZ A;  2V6C A;  1FOY A;  4LGW A;  2A68 F;  2WV1 A;  1NK2 P;  2M7A A;  3VYU B;  1KGS A;  5L3B A;  4HZF A;  4OIR F;  3CJQ B;  3I64 A;  1QNT A;  3GTJ J;  3G1O A;  1D0Z A;  4F52 A;  2F5V A;  1E17 A;  1MBG A;  1ZG1 A;  2IGK A;  1SVM A;  1ZRD A;  5TIS C;  2GLO A;  5IP6 A;  5IYC J;  2Y30 A;  1PP8 F;  4JX5 A;  2HKO A;  3KYL A;  2JA8 J;  1XB4 A;  1KYZ A;  3CUQ B;  3P7N A;  4UVC A;  1W7P D;  3E5X A;  3QP5 A;  4YEL A;  3SZT A;  1P2F A;  1HW2 A;  1FP1 D;  1O3R A;  3I4M J;  2F4I A;  1XSV A;  3OYN A;  1OYI A;  4ZYE A;  2WB1 N;  2QUF A;  2G7H A;  5J40 A;  3CCQ I;  4A3C J;  1H0M A;  2PMZ N;  5E1X A;  1WPK A;  3QYF A;  2E1C A;  2HS5 A;  3A1Y A;  1F36 A;  3OIQ A;  4RB0 A;  3CCV I;  1RR7 A;  3C2H A;  1S5L C;  2WBM A;  1HCR A;  1S3J A;  3OYD A;  3H1C A;  2YR2 A;  1U9O A;  4V2F A;  2F4O B;  5DDG A;  1IRF A;  3BR1 A;  3L00 A;  4BJ6 C;  1Z1D A;  1ZKG A;  3KCC A;  2M30 A;  2JSP A;  5H20 A;  2E1O A;  2VJ4 A;  1TC3 C;  2VPR A;  4Y4R A;  1EH6 A;  5D5W B;  3GX4 X;  3M8F A;  2HFH A;  3BY6 A;  1R58 A;  2RN7 A;  4XIC A;  3HRT A;  3JTH A;  1R9T J;  4CHU A;  2HR3 A;  3GZN B;  4MEY F;  1F9N A;  2NVQ J;  3FK6 A;  4P55 A;  2L01 A;  3TOA A;  3GWZ A;  4BU2 A;  4AD9 A;  1IRZ A;  1XC5 A;  5J47 A;  2IGM A;  5CQE A;  4A3B J;  3KEY A;  1CGP A;  1MW7 A;  1XGN A;  4ENN A;  2M7B A;  3FIS A;  1FMW A;  3FXQ A;  3FXJ A;  2HDW A;  3KZI C;  4L9N A;  4XK4 A;  1I1S A;  1HOM A;  2ELJ A;  3KEO A;  3PFY A;  1R71 A;  4H4K C;  4D5F A;  2HPM A;  1VQ5 I;  3J7A O;  1PUE E;  2BY0 A;  4W97 A;  2X0L A;  2W84 A;  4BL0 B;  2E5N A;  4EGZ A;  4A3G J;  1I6H J;  3EDP A;  1XN7 A;  2M2E A;  1B72 A;  3FDY A;  1ZG5 A;  4Q5S F;  5LFA A;  3IWF A;  1O7L A;  2ZXH A;  3D5R C;  3LMM A;  3SYT A;  3S16 J;  4FET A;  4MO7 A;  3HOY J;  2VKE A;  1HDP A;  2FD5 A;  3AG4 H;  5KCM A;  4MEX F;  1FPQ A;  2JT1 A;  3KEQ A;  3RPU A;  1YLF A;  4KUM A;  4YII A;  3ZOB A;  1K6Y A;  1Z6T A;  1F4K A;  2IS4 A;  4AUX A;  3GFJ A;  1T95 A;  4BQQ A;  1VFC A;  2L54 A;  2HYF A;  2W24 A;  2M3A A;  4XOT A;  1VQN I;  1UHS A;  4Z2Y A;  2IXS A;  3LAP A;  3BTI A;  5F08 A;  3C1D A;  5K5O A;  3OR2 C;  5HVQ C;  1YW9 A;  3TED A;  3E97 A;  4M3B A;  4AC0 A;  1TWF J;  4CYC A;  2ACJ A;  2JPB A;  3FWE A;  2CS3 A;  4F92 B;  4HLX A;  2NS7 A;  2DK8 A;  3UKG A;  3TP0 A;  2WV0 A;  5DM7 F;  2QSF X;  1SD4 A;  2UXX A;  3PSI A;  3OSF A;  4MQV A;  1A31 A;  2HPI A;  3OS0 A;  5IYD J;  5BQT A;  5FKN A;  2GXA A;  4G7Z F;  3J80 K;  4PJN A;  5FD6 A;  4HQM A;  2CH0 A;  2HQA A;  4LD5 A;  4IQ4 A;  1FLI A;  3MCZ A;  3M7G A;  1X4P A;  3HJE A;  3F72 A;  2XF5 A;  1FMV A;  1YS7 A;  3C2B A;  1T39 A;  4IHT A;  5F64 A;  3KYC B;  3DKW A;  4OAZ A;  2XRL A;  1S7O A;  1D5V A;  1U3E M;  4ZYG A;  4B3A A;  1LUJ B;  3BG3 A;  2HOT A;  1JE8 A;  2I5U A;  2QZ8 A;  2DFI A;  4KIC A;  1GDT A;  3E6D A;  4WWC A;  1R00 A;  4Q47 A;  2K86 A;  4PJ0 C;  5CVJ A;  1IAW A;  4BAY A;  3MKZ A;  1VQ8 I;  2UXN A;  4CA0 A;  1TL8 A;  2L2O A;  4J00 A;  4L18 B;  4CXF A;  2FE3 A;  2WY8 Q;  3WG7 H;  5DD4 A;  1IV8 A;  1HSJ A;  1SAN A;  2R5Y A;  3EQL F;  4B09 A;  1MND A;  3H92 A;  3HHH A;  5EG0 A;  2K9M A;  1ZG3 A;  1P9Q C;  4IRG A;  1TWG J;  3FHN A;  3JAM Z;  5LHG A;  1TLH B;  2Y9Y A;  2FQ4 A;  3DKX A;  2JPC A;  3ML6 A;  5K7F A;  1G8X A;  1DPU A;  2D45 A;  1D8J A;  3U1K A;  1YJ9 I;  5IT9 K;  2EZH A;  2IA0 A;  2A07 F;  1J7K A;  1J9I A;  3P9C A;  4JOM A;  4GXO A;  4BAC A;  3KPH A;  2FBI A;  1J75 A;  5J1R A;  1JUM A;  3HPG A;  1JHF A;  3CTA A;  3BCB A;  2BHY A;  4IRH A;  3S17 J;  5IT9 Z;  2EFO A;  2L7Z A;  4NC7 A;  2VOO A;  2P7V B;  1I50 J;  2FSW A;  2Y48 A;  2YPR A;  5L3D A;  3GXO A;  3K69 A;  3JSP A;  4UUS B;  1GVJ A;  1HA8 A;  2CJJ A;  2M87 A;  2UV1 A;  4AYB A;  3LSH A;  4OMZ A;  1T0F C;  4P1W A;  4JBA A;  1GHC A;  4KIT B;  3RKY A;  3TMO A;  1X19 A;  3QAH A;  5E18 F;  2L4A A;  2ZXI A;  4LIU A;  1ERD A;  3WTT C;  1K79 A;  4XLN F;  2WAQ N;  3BG7 A;  1J09 A;  4UV8 A;  1I3A A;  1BOA A;  4BEH A;  1D3Y A;  3RJP A;  4HNT A;  2FXA A;  5L3G A;  3ABM H;  1BR1 A;  3ERE D;  1WFX A;  3HOZ J;  1OPC A;  3ESW B;  3K1M A;  4QLC U;  3MVP A;  4CCL A;  1Z9C A;  3TO7 A;  1IG7 A;  4RLF A;  1MMD A;  5DM6 F;  4RMN A;  3T0Y A;  4S0H B;  3HSR A;  4U87 A;  4B3X A;  3V8K A;  1FOW A;  1BJZ A;  3N97 A;  1T8I A;  3CQZ J;  4A6D A;  3FXU A;  3ZN0 A;  3G4S I;  1SFO J;  1AHD P;  1QRY A;  1XTA A;  2DA7 A;  4XLP F;  2LMD A;  3I59 B;  3AL0 B;  4LK1 F;  2V1U A;  1H9G A;  2CV0 A;  2AO9 A;  1HKS A;  1R5G A;  2R7O A;  4BBR J;  3WTY C;  2VKD A;  2QQ8 A;  2H94 A;  3E6M A;  1SD5 A;  3E7L A;  1SMY F;  2OBP A;  2ZB9 A;  5DUK A;  2DPD A;  4BE1 A;  2CUJ A;  2OV7 A;  1XGO A;  2NVY J;  5JLW A;  4X0G A;  2MLK A;  3NRV A;  4HF0 A;  3QU6 A;  5C4X J;  1UHM A;  4O5V A;  2A3S A;  3ZN1 A;  2VI6 A;  3AFH A;  2A05 A;  3CES A;  3BG9 A;  3I56 I;  1YIJ I;  1VQM I;  4U0Y A;  4AID A;  2FOW A;  2HXI A;  1X1B A;  1Y0U A;  2FJ1 A;  2MH9 A;  3Q3S A;  4GCV A;  1WJA A;  2LOO A;  1ACI A;  2TRT A;  3S93 A;  4A2U A;  1FY7 A;  2FU4 A;  1O3Q A;  2XF6 A;  2K9N A;  2EA4 A;  2KIS A;  1E3P A;  2RRE A;  3OYE A;  3R6S A;  3F8B A;  4J01 A;  3MWM A;  4N0B A;  1QPM A;  5E3O A;  1R1V A;  2IS2 A;  3EUA A;  4IXA A;  2QVO A;  3KIO A;  5JI6 A;  3BLY A;  4KMF A;  3BG6 A;  4XSX F;  2KIQ A;  2JK3 A;  4OIO F;  5IP7 J;  1G3Y A;  2B9S A;  1VQP I;  1FBQ A;  5GAD J;  2ZXJ A;  3CCE I;  5FJ8 J;  2WAF A;  4XON A;  3S2H J;  3ZQF A;  3W3C A;  2QWW A;  1JHH A;  2E35 A;  1H8A C;  2JZY A;  3P9K A;  1UG0 A;  2BXY A;  1R36 A;  3GLL A;  5J1U A;  3BPV A;  5HLT A;  3MKY B;  1B72 B;  4E7Z A;  2R5Z A;  3OMY A;  3WTX C;  2Q8K A;  3HBL A;  1RES A;  3OYK A;  3IRQ A;  3TW7 A;  5DS9 A;  4N9H A;  5CVI A;  1MDM A;  1RZ4 A;  2XGD A;  2LY1 A;  1YW8 A;  4G7O F;  3E3V A;  2VB6 A;  3Q0U A;  3ZRG A;  4DW6 A;  2EQR A;  1MJ9 A;  4BYY A;  1IGN A;  2Z5U A;  3VYR B;  5TJJ A;  3J7Z I;  2XSJ C;  1KON A;  2HOA A;  1QVT A;  3JRH A;  2ZJQ F;  4KFC A;  2YU3 A;  4RGS A;  1TQP A;  1UJ8 A;  4Y17 A;  3OOP A;  1VQ9 I;  2DLL A;  3REO A;  2MLG A;  4BGD A;  2IRF G;  2V9K A;  2CFX A;  5F27 A;  3GTL J;  1BC7 C;  1W5T A;  1JJ8 C;  4IF4 A;  5K1Y A;  1NK3 P;  2DA4 A;  1I39 A;  3OYL A;  3TW6 A;  3W6J B;  1HF0 A;  3ZGK A;  2IJL A;  1YYV A;  4CCM A;  3CUQ A;  3D5L A;  1K4S A;  2A5W A;  4BKX A;  4PSX A;  3SZP A;  4KN7 X;  5HS8 A;  3RPQ A;  1TQM A;  3TDU C;  2ZNY A;  2QEX I;  4ZJZ A;  4CSW A;  4OIP F;  1WH7 A;  4JQF A;  2ZJR F;  4M3E A;  5FRN A;  1ODD A;  1IDZ A;  1KU7 A;  4MNU A;  1Y39 A;  1K7A A;  2I10 A;  3CLO A;  2M34 A;  3BRO A;  5D5V B;  4XN0 A;  3CF2 A;  4HG2 A;  1H88 C;  4Y52 J;  1LQ1 A;  1Z6R A;  4P96 A;  4A3E J;  2VT2 A;  4KJZ A;  4I99 C;  4FX0 A;  4P9F A;  1FSE A;  4PFO A;  4XRS G;  4YFX F;  3L1P A;  3L2W A;  1XG1 A;  3KLO A;  2JSC A;  4L5J A;  5GAE J;  3M8E A;  3D0S A;  3G3Z A;  2DBB A;  1B8I A;  5HOO A;  1UAA A;  3IKT A;  1YS6 A;  2ID3 A;  4I6Z A;  2GQQ A;  5JFR A;  2ZJP F;  3C3W A;  1YOV B;  2PJR B;  2V79 A;  4JP0 A;  4BEH B;  2IA2 A;  3K4K A;  3V7S A;  1E3H A;  4RS8 A;  1IZ1 A;  3FXL A;  2ME6 A;  3DF8 A;  1LFB A;  4ZYD A;  2ZBK A;  3Q0V A;  4LLL A;  1U2W A;  3SFI A;  3N05 A;  4NNJ A;  5CJ9 A;  4PFP A;  4AVP A;  3CO7 C;  1B9N A;  4I0B A;  3HPH A;  1SD7 A;  3VYT B;  5FRM A;  2VJ5 A;  2XPU A;  2XAG A;  2XHK A;  1RNL A;  2VJI A;  1X1P A;  1BL0 A;  2W48 A;  2GBY A;  1IV6 A;  3OYC A;  4Q48 A;  4H0E A;  2L9N A;  3HTU A;  1R5I D;  4IL6 C;  3H36 A;  3Q0W A;  4E7S A;  4KYW A;  1IUY A;  2FBH A;  2LRD A;  2JN6 A;  4WX9 A;  2MG4 A;  1QGP A;  2XB5 A;  4XRS A;  5EEA A;  3GTP J;  2X6W A;  3OYF A;  4XMY A;  1IXS B;  5IT3 A;  3DP7 A;  5IPA A;  3AL0 C;  2QLZ A;  3EYY A;  2JVH A;  2W00 A;  3CCU I;  4JK1 X;  2TDX A;  4XSZ F;  1OFC X;  2XC7 A;  3BWG A;  4PUS A;  5LRS A;  2L02 A;  3CJR B;  3LL7 A;  3VOE A;  1Z05 A;  2KMU A;  4B47 A;  4MFE A;  3BJO A;  1WJB A;  5ICE A;  1AU7 A;  3I5U A;  3VDX A;  4LIV A;  1QZE A;  2JA5 J;  1XGM A;  2IW5 A;  1FYK A;  5F0F A;  1X3Z B;  1XDU A;  3IAS 2;  1P4W A;  1Z7U A;  2Y75 A;  1P4A A;  2LVS A;  5ERI A;  1FWZ A;  1OLT A;  2LRE A;  2DO7 A;  2QQB A;  1WQ2 A;  3I71 A;  1YX5 A;  1BI1 A;  3CC2 I;  4BY1 J;  3ZMT A;  2HGC A;  3ZQH A;  1JXS A;  1U0J A;  1J5Y A;  1B1B A;  2Z33 A;  4II3 A;  3DPU A;  1IO2 A;  2IT0 A;  1IW7 F;  5FKL A;  3CMY A;  4UNO A;  2FNP A;  4DJA A;  2Z9O A;  2PJR A;  5J4Y A;  1X1A A;  2OC6 A;  1S72 I;  1WZ2 A;  3BTJ A;  1ZRC A;  1MH3 A;  2UUZ A;  2DTR A;  4GYG A;  4ZDP A;  2LF7 A;  1TTY A;  2O0Y A;  2KDO A;  3DEU A;  4U0V A;  2ZJ2 A;  4IJA A;  3RCO A;  3QRF F;  1ON1 A;  4WXC A;  1LDJ A;  2L3D A;  2NNY A;  3AG2 H;  4X6A J;  5GPC A;  3VYS B;  4IHS A;  2E19 A;  5FD5 A;  3HOU J;  3JRD A;  1X1D A;  3BTL A;  4A69 C;  1P4X A;  3LFK A;  1P7I A;  1ZYR F;  2KJC A;  2CSO A;  4X1E A;  3AG1 H;  4MGR A;  4A0X A;  2RNJ A;  2VQL A;  4CIC A;  4C9Y A;  3CJT B;  4G12 A;  2P81 A;  3IHU A;  2P0W A;  1BW6 A;  2WC2 A;  4QSH A;  3U21 A;  5IYB J;  2Z99 A;  3WU2 C;  3QPL A;  4WF2 A;  5GAG J;  2MAB A;  2F5D A;  4A6E A;  3DEW A;  4D9J A;  4CYD A;  4KNY A;  3NAR A;  1ZH5 A;  3JW4 A;  2LYC A;  4BS9 A;  4RDU A;  2NAZ A;  4M3D A;  3TKY A;  4F55 A;  1N78 A;  2KFD A;  5E17 F;  2CGP A;  2ZCW A;  1GLN A;  3HEF A;  3SXY A;  3E5Q A;  2V4J C;  4O6J A;  1LKX A;  2VLA A;  1R49 A;  3OSG A;  5ICG A;  4XKV A;  4HDU A;  1LDK B;  2G7U A;  1HST A;  1W5C C;  2IEK A;  2DOF A;  3HC7 A;  2LD5 A;  4R8H A;  1X2M A;  4IHV A;  2GZW A;  3P5J A;  5LEJ A;  4Y7N J;  2OQR A;  3W2A A;  1XGS A;  4FQG A;  3ZMU A;  1V5G A;  1P7J A;  2AQF A;  3PL8 A;  3OYM A;  4PDK A;  1MH4 A;  5FB2 A;  3L2V A;  3M3Y J;  2EFQ A;  3BR5 A;  3HGG A;  4NBQ A;  4MTE A;  5FFX A;  2VE9 A;  3I58 A;  1NG7 A;  3FX3 A;  3LA7 A;  4UUV A;  1D0X A;  2R0Q C;  2VBY A;  2O7O A;  4YFN F;  4C2U A;  1UB9 A;  1SFX A;  1BC8 C;  2CFO A;  2FBK A;  4XR6 A;  3KP4 A;  4Y13 A;  1LE8 B;  2ESH A;  2DJI A;  2RDP A;  3FBN B;  2QM3 A;  3JRB A;  1T6S A;  1I6X A;  3ECO A;  5EDN A;  5M5W J;  1RUN A;  3K4N A;  3LWF A;  2GOX B;  2GIV A;  2HNH A;  4IPA A;  5EEG A;  5E3N A;  2FQ3 A;  4CZZ A;  1T33 A;  4OWR B;  4BH9 A;  1WJE A;  4EJW A;  3VWB A;  2DA6 A;  3PNY A;  4DZJ A;  2QBY A;  3DV8 A;  2K3P A;  3DTE A;  4B43 A;  3HTS B;  2NXN B;  2ZNZ A;  3LAJ A;  4DYQ A;  3WE2 A;  1GXQ A;  4FE7 A;  3I4N J;  3ZMS A;  3Q9S A;  4D0P A;  3G73 A;  1KQ0 A;  2LTP A;  2CQQ A;  4I0A A;  5DCM B;  1YE9 A;  3NQO A;  4BDZ A;  4A0Y A;  2CW8 A;  5IOZ A;  1JGS A;  2HKX A;  2Q2E B;  2PMU A;  1SEU A;  1E2X A;  2DT7 B;  5EEH A;  2CQ7 A;  1ULY A;  1PP7 U;  5DEQ A;  3U9G A;  5C44 J;  2DYR H;  4ITV A;  2W82 A;  2X1D A;  1WHU A;  2IPQ X;  2P5L C;  5LHH A;  2BGC A;  4DIQ A;  3S14 J;  5LLQ A;  1Y8R B;  3HUG B;  4XN3 A;  3B6C A;  4B1R A;  2H1K A;  2WTE A;  3MKL A;  4L0Y B;  5HLH A;  1MMA A;  2JA2 A;  3DFG A;  5B1B H;  3T8T A;  3CCR I;  4ZZL A;  2HZT A;  3IRR A;  2LY9 A;  3KP6 A;  4I01 A;  2VUM J;  2R7X A;  2MW8 A;  2CQX A;  4D7N A;  4E7I A;  3RDI A;  3HZJ A;  4CCJ A;  2GOM A;  3M9A A;  2CO5 A;  4HV5 A;  4C30 A;  1JJ6 C;  3JAM K;  3F23 A;  1DGR M;  4L9J A;  1REP C;  3R60 A;  3L7W A;  3JCU C;  2JJ7 A;  4KT5 C;  2VQH A;  3WTS C;  3F8F A;  2DTZ A;  2LSO A;  4I76 A;  3UR3 C;  3CP8 A;  4NC8 A;  1DU0 A;  1O57 A;  4XLE A;  2HVR A;  3S8P A;  5F0C A;  5HS7 A;  2V26 A;  5AIQ A;  1TNS A;  2EV5 A;  1POG A;  1U78 A;  2AXL A;  1ZGJ A;  3HSE A;  1OCZ H;  1XCV A;  4ANJ A;  1SVL A;  2NVX J;  3HOX J;  3OY9 A;  1QHG A;  2EZL A;  2Y0S N;  5H2F C;  2ZKZ A;  4BNC A;  3HGY A;  4G6D A;  2PMH A;  4L0Z B;  2M0C A;  2FML A;  1I5Z A;  3CC7 I;  2F5F A;  2JUC A;  1W7P B;  1YHQ I;  3BP8 A;  3A03 A;  4HBL A;  5LGN A;  2QF7 A;  2HU9 A;  3IH4 A;  4UY8 I;  3BC8 A;  1P92 A;  2FNA A;  2YX4 A;  2H8W A;  2V6E A;  2HVQ A;  1RC9 A;  3HYI A;  1V55 H;  1ZQ3 P;  5CQG A;  5GP9 A;  2GM4 A;  3HUG A;  2DJN A;  4NUB A;  2XAQ A;  3UNG C;  1V5E A;  2IBD A;  4RM2 A;  5BOX A;  2HDD A;  1PVE A;  1TZL A;  1USS A;  1VND A;  2K9L A;  4BY7 J;  1LB2 A;  3C18 A;  3HRU A;  1QO0 D;  1TT0 A;  3SDG A;  1FOK A;  1JKP C;  3B73 A;  5IOY A;  1L0O C;  2R7F A;  4FHT A;  1HBX G;  1TWC J;  1JGG A;  3LSG A;  1N25 A;  3OWT A;  2JUG A;  3MFK A;  4JYK A;  3GBG A;  2HI3 A;  4MHG A;  1U5T A;  3HL2 A;  5E8I A;  2W85 A;  3BZC A;  3H0D A;  3HG9 A;  1MBE A;  1T56 A;  3H5N A;  1AWC A;  3E6B A;  1Q1V A;  2QKL B;  3HXL A;  3QPT A;  1GV5 A;  2YSR A;  1TW3 A;  4A5M A;  1QU3 A;  1HKT A;  2R7W A;  4HV6 A;  4XOP A;  3AKZ A;  2DMT A;  1KU3 A;  1AKH A;  5K7Z A;  5ILV A;  2P6S A;  2EJR A;  5KHD A;  5HDN A;  5D6E A;  4RAG A;  3OYH A;  1XD7 A;  1XS9 A;  1MBH A;  3RKQ A;  1DP7 P;  4E7K A;  2BV6 A;  2HEO A;  4D5C A;  4YG2 F;  4CDG A;  2AQE A;  2XGC A;  3SEZ A;  3DU5 A;  1OQY A;  1EV7 A;  4UUT A;  4DOZ A;  4Q4Z F;  2EIM H;  2L9R A;  2P7C B;  1ZLJ A;  2EV6 A;  3FF5 A;  1LEA A;  2Z3Y A;  1IF1 A;  2X1E A;  2EH3 A;  1I3Q J;  2XAU A;  4EAT A;  1STZ A;  4EGY A;  3AAF A;  4LLN A;  4B44 A;  4XID A;  3JRC A;  1T0F A;  2MGQ A;  5FLM J;  6PAX A;  2DA2 A;  4AIH A;  2VKV A;  5K5Q A;  2JWT A;  4BQN A;  3E6C C;  2HQR A;  2PX9 A;  1ZGW A;  3U2R A;  1FIA A;  2KIM A;  3K70 D;  3WG9 A;  4DGW B;  3S2D J;  3N4M A;  5H6R A;  1X2N A;  2PG4 A;  3KET A;  3BT9 A;  4DNC A;  2MSY A;  2KIU A;  2VAS A;  2VBX A;  3MZ8 A;  3VB2 A;  3OYG A;  4HYE A;  2E7W A;  5BMZ A;  4PCQ A;  4HW0 A;  3HOV J;  3CZ6 A;  2JMW A;  2X6Y A;  1OKR A;  4MQ9 F;  2ME0 A;  5E1Z B;  3JSO A;  2EIL H;  1KQ9 A;  3VSL A;  3H3V K;  4WXD A;  1VTN C;  5CVR A;  1WJC A;  4GFB A;  1MMG A;  3D5S C;  2EIK H;  2BY3 A;  3F9K A;  5CKT A;  2BE5 F;  4LLG F;  1MGT A;  4FAS D;  1HXD A;  1BI3 A;  4XLF A;  2H6B A;  2F48 A;  3PO3 J;  5FKK A;  2L9S A;  1X3W B;  5EGO B;  4KIG A;  1QZY A;  2BY2 A;  2UZK A;  1ZRE A;  4Y15 A;  3RQI A;  4DQ2 A;  2QA4 I;  4G9Y A;  3PIO F;  2QKM B;  3QWL A;  2AHQ A;  1ITY A;  2VC1 A;  3GEZ A;  3ONQ A;  3WHB A;  4LIT A;  3IH2 A;  2PFB A;  3GUD A;  1R4N B;  3LFU A;  2X51 A;  3I9V 2;  1SC7 A;  3IWZ A;  1BIA A;  3SEQ A;  2XPW A;  1JI8 A;  1ENH A;  4NB5 A;  2D1V A;  5JHU A;  5D5X B;  3ZXS A;  1XSD A;  1PUF B;  1IJW C;  1QVU A;  5M3F J;  3ABK H;  2MC4 A;  3RPU D;  2FMY A;  2GA2 A;  2FX0 A;  3DLA A;  4I98 B;  4M3G A;  5J8C A;  2P5V A;  5KAI C;  2L4M A;  4GDF A;  2RGV A;  2OZ6 A;  1OIS A;  2WAQ A;  4HF2 A;  4XOR A;  4BE0 A;  4KIS A;  3OV8 A;  3V4G A;  2K4J A;  3O3K A;  4AVZ A;  4XQF A;  2BZT A;  3H9J A;  2CW0 F;  1R7J A;  2DCE A;  4ABZ A;  2K27 A;  4PSW A;  3J81 Z;  4G6T B;  2JA7 J;  3RYP A;  1EKE A;  1Y56 A;  1FP2 A;  3E0J B;  3IP4 B;  2BW3 B;  4HOB A;  5FKO A;  3VEP A;  3G6E I;  3T5X A;  1R5H A;  1WH5 A;  1G3T A;  2NVT J;  3M07 A;  2F5E A;  5BS6 A;  3K4B A;  2EB7 A;  1Z21 A;  3RSN A;  1DPR A;  2X9D A;  3JRF A;  2E71 A;  1QBJ A;  4K2E A;  2BYV E;  3KYD B;  2LG4 A;  4UB8 C;  1WI3 A;  4XBF A;  1S6L A;  4RLQ A;  2PEX A;  1BI0 A;  4IHX A;  3HRM A;  3A4C A;  2KZG A;  2D5V A;  3L2U A;  1AOY A;  4J19 A;  2O8X A;  2EFP A;  2E1M B;  1XCB A;  1IXC A;  4RM3 A;  5LHI A;  4U7D A;  3VOD A;  2GXG A;  1ETX A;  2M0M A;  2H1L A;  1A36 A;  1U9N A;  1WSU A;  1YRN B;  4XL9 A;  3SJM A;  1VQL I;  1BM9 A;  2VE8 A;  1QHH D;  5CVU A;  2EIN H;  2LKS A;  3V8J A;  3V8L A;  3NEU A;  5D4S A;  5AON A;  3K10 A;  4ZZD A;  3S1N J;  1W36 C;  3NWT A;  3A01 A;  3EUH C;  4AU7 A;  3CD6 I;  1JKR C;  3ABU A;  2F4M B;  2CV1 A;  2A6T A;  5ILS A;  1ZEL A;  3DLL F;  3ASN H;  4LMY A;  1TBX A;  5LEK A;  1GT0 C;  2G0E A;  1W4M A;  2PI0 A;  3LSR A;  4C3I J;  3ZQQ A;  2VPL A;  4RB2 C;  3OOU A;  1W1W E;  2HZD A;  2ZFU A;  2HXO A;  4ENM A;  4BQO A;  2XB0 X;  1XSX A;  2OZU A;  3R0A A;  3KZY A;  2HOE A;  3FXO A;  1TWH J;  2Y9Z A;  3Q5F A;  2HTS A;  5F1J A;  4Z6Y A;  2AXT C;  2R7R A;  5C3E J;  3LSP A;  3FMQ A;  5H6Q A;  3RKX A;  3ASO H;  3S3O A;  1R1U A;  1GVD A;  2MA3 A;  1I27 A;  1KYW A;  3B6A A;  1Z3X A;  2LR8 A;  1K83 J;  4YEJ A;  1BJA A;  3IUO A;  3CCY A;  3JRI A;  1ZRF A;  1YRN A;  2XGE A;  1VQK I;  3FMR A;  2D2W A;  4C2T A;  2AS5 F;  1CF7 B;  4YRV A;  1WI9 A;  3MKW B;  2JVG A;  3K2Z A;  1TQI A;  3F6O A;  2OAZ A;  2MYS A;  2Y0M A;  5IP9 J;  2M4K A;  3F21 A;  5M5Y J;  1FYL A;  4YFK F;  1ETV A;  2KKO A;  1ZLK A;  3LSI A;  5DD8 A;  1VZ0 A;  5KNL A;  4ENJ A;  2PMZ A;  4PZJ A;  2LBF B;  3MN2 A;  2JRM A;  1G2H A;  3F8C A;  3DTK A;  4BQA A;  1LFU P;  2M1B A;  3DTI A;  4IQJ A;  2NS8 A;  1QPI A;  4EQQ A;  4GGG A;  5EYR A;  1MBK A;  5B3S H;  2Y0S A;  2VOD A;  2E1N A;  3WTZ A;  2JTV A;  2BW3 A;  1NHA A;  2W1O A;  1S7E A;  3H3U A;  3F3X A;  1ETQ A;  1JT0 A;  1IXR C;  3MD2 A;  4HX4 A;  3CJN A;  4U7B A;  1F5T A;  4OMY A;  3BZK A;  4HNV A;  2DN0 A;  1U8B A;  2VJJ A;  2Q1Z B;  2QBY B;  3FBI B;  1MDM B;  3LQR A;  3TOB A;  1JUS A;  4L5I A;  3OYA A;  5E8G A;  2KZV A;  2LY2 A;  5HLI A;  4PGG A;  1RET A;  3HHG A;  3DU6 A;  3DPT A;  1B4A A;  1R6R A;  3BZ6 A;  3JRE A;  2OUM A;  4LOC A;  4TV7 A;  1U5T C;  3GZ5 A;  3HM5 A;  1SFK A;  4XKC A;  4AM3 A;  2CU7 A;  4I7H A;  2K9S A;  5KVR A;  3GTK J;  1NTC A;  1QA6 A;  4OAY A;  2STW A;  1K78 A;  4N4O B;  3FKJ A;  2DK5 A;  5FGM A;  1O4X A;  1MKM A;  4BHP A;  1XDS A;  2ISY A;  5FRO A;  2R7D A;  2PQ8 A;  1SAX A;  3DBR B;  4U0W A;  1OCR H;  2ISZ A;  4XKB A;  4G94 A;  1YG2 A;  3LNQ A;  4D7M A;  1KA8 A;  2F6C A;  5JVG F;  1D1A A;  2ELH A;  3A02 A;  3CME I;  3M4O J;  4IOC F;  2EFW A;  4EJU A;  2YUS A;  1A6Q A;  4E7L A;  5ICC A;  1ON2 A;  2ADU A;  3BQY A;  1FSH A;  1BW5 A;  2NOG A;  2NVU B;  3K4L A;  3V42 A;  1FT9 A;  1VQ7 I;  3P9I A;  4BJ5 C;  2DI3 A;  1U6G A;  2OA4 A;  2R7V A;  2W25 A;  4LG0 A;  4ZH4 F;  1YQA A;  3I0T A;  4LB6 B;  2M9H A;  3GFI A;  1EJ9 A;  3KZZ A;  2ZME A;  1BN5 A;  1MD0 A;  2QGU A;  1OJL A;  3I54 A;  3NAU A;  1WJD A;  2CMP A;  3V7R A;  2QYO A;  4MLO A;  2ZC2 A;  3K1N A;  1O3T A;  2ZME B;  2KRH A;  3FM3 A;  1IUF A;  1MMS A;  5D4R A;  2TCT A;  4ON0 A;  2A69 F;  3M1E A;  2W7N A;  2OTL I;  4RAZ A;  1K78 B;  1B6A A;  3F22 A;  1D1C A;  5F0H A;  1LVK A;  5K7H A;  2XRO A;  2ETH A;  3LST A;  1OMI A;  3H3Z A;  1TWA J;  5BPD A;  3S1M J;  4N4N B;  3K2A A;  1XX5 A;  2EWN A;  2EZI A;  3M1C A;  5ICF A;  1K4T A;  3QP6 A;  1MNE A;  2LP0 A;  5GPA A;  3W6V A;  4HF1 A;  2R7U A;  2R3S A;  3LSK A;  5EZG A;  4IOA F;  2Y2Z A;  5JVT A;  2PJP A;  1V3F A;  3PM1 A;  2A61 A;  2V7F A;  3GF2 A;  4ZTF A;  1OCT C;  2RC4 A;  4EJV A;  5M3M J;  4E7H A;  2L5Q A;  5L3C A;  1MBF A;  4QTR A;  1LEB A;  1LNW A;  5D6F A;  2E1M C;  4ENK A;  1E3O C;  3QU3 A;  1OYY A;  2LKX A;  3ZQ7 A;  3PQK A;  3K7A J;  2OCC H;  3TDZ C;  3S3M A;  4RAF A;  3HB9 A;  3GW2 A;  3VSK A;  3PIP F;  3QOE A;  2VXD A;  4A3M J;  2X85 A;  1I1G A;  3E5U A;  1HQC A;  1WJF A;  3PJR A;  3ZMZ A;  3ROU A;  2VXZ A;  2DOA A;  3GTM J;  1S9H A;  2L7F P;  1YJW I;  1MBJ A;  2DPU A;  3L09 A;  3KP3 A;  5J4V A;  2HQ5 A;  2MFZ A;  1S29 A;  2LBF A;  1AKH B;  5A2Q Z;  2DOE A;  2HTJ A;  4ESF A;  1ORK A;  2YU9 J;  4BXU A;  2C6Y A;  1Q1H A;  1EH8 A;  1FZP B;  1UZC A;  3W2W A;  4BE2 A;  5FLV A;  2DU9 A;  3CC4 I;  2BVL A;  2H09 A;  3I53 A;  4AWX B;  2XGX A;  4N9I A;  1LPQ A;  2VKH A;  2A6E F;  4NQW A;  2R7S A;  1DQU A;  1Y1V J;  4KA4 A;  1U5T B;  3SQN A;  3OR1 C;  3DBL B;  3K1P A;  1VF9 A;  1VQ6 I;  2A6H F;  5CVV A;  2COB A;  2DMU A;  3HRS A;  1NG6 A;  2XRN A;  5L3F A;  1O3S A;  2WAD A;  4QPO A;  2WB1 A;  4D1Q A;  3ZR8 X;  2ID6 A;  3Q9V A;  1DU6 A;  3R0J A;  3FKI J;  2DW4 A;  3LSM A;  5C4J J;  1BI2 A;  2I8D A;  2NS0 A;  4MIM A;  3E1S A;  3FXK A;  2WY7 Q;  1IN5 A;  3OL4 A;  1FYM A;  2X1C A;  2IAI A;  1UST A;  2MD0 A;  2P4W A;  2K85 A;  2VBW A;  4B8X A;  2M5W A;  3DXJ F;  4B48 A;  1CF7 A;  2R93 J;  2CV2 A;  2LK2 A;  3GME A;  4EV0 A;  4ASN A;  4DYC A;  4DBQ A;  2FOK A;  4E4H A;  4L9V A;  3X2Q H;  2E5Z A;  3QPH A;  1YW7 A;  3IV5 A;  3GCM A;  1YI2 I;  2HYJ A;  2D1H A;  2OD5 A;  2RVC A;  1S7A A;  3TO9 A;  1UCR A;  2WA0 A;  4CGZ A;  2XIG A;  1HLV A;  3GVA A;  3S15 J;  4S05 A;  1M1E B;  2K7L A;  2BVM A;  2H6C A;  3AG3 H;  1MSE C;  1Z0X A;  1R4M B;  3CLQ A;  4PJL A;  2XF7 A;  5LGT A;  1B8I B;  4LK0 F;  4G7H F;  1IN4 A;  3K6G A;  2Q0O A;  1YIT I;  1WKM A;  1Z7L A;  3OYB A;  1Z3Y A;  3WU1 B;  1BIB A;  3KFW X;  4A93 J;  5CLS A;  4M72 A;  2BXZ A;  2R7Q A;  3DPL C;  2KPM A;  5HDG A;  3QOD A;  4QIW N;  3I55 I;  1APL C;  1ZK8 A;  4HAM A;  4FE4 A;  3RKW A;  4ZYH A;  3A01 B;  1W36 D;  5E3L A;  2FA5 A;  4IHW A;  4OIN F;  5FLX K;  2CW7 A;  3KP2 A;  2HWV A;  2X6X A;  3R4K A;  4CYC B;  2VQC A;  3D1N I;  2F2E A;  3OS1 A;  2XSD C;  3ZMV A;  1FBS A;  4F3Q A;  2R4G A;  2E7X A;  4HLY A;  1FTZ A;  4I09 A;  5F6F A;  3MAJ A;  3S32 A;  1HC8 A;  4B4C A;  4IVN A;  2B0L A;  4A3I J;  2R7T A;  3GTO J;  3M8J A;  1V54 H;  3OL3 A;  3MZH A;  2R92 J;  5E20 A;  2O61 A;  3S3N A;  4BJT A;  2QQA A;  3F6V A;  1KQ8 A;  3HIF A;  4OOI A;  2E60 A;  3BTC A;  2GXB A;  2YX7 A;  3JRG A;  2CG4 A;  1JTY A;  1JUP A;  2X6O A;  3BCA A;  4M9X A;  1MZB A;  4GO1 A;  5GTH C;  3TO6 A;  5J6X A;  5D5U B;  3FHZ A;  1W0U A;  4FCY A;  4L5E A;  2MBF A;  3L9F A;  5DTD A;  1QQI A;  1VQO I;  3B02 A;  1ZTR A;  2RAE A;  1XMA A;  4LFU A;  4KDP A;  3WE3 A;  2P8T A;  4LG3 A;  1R22 A;  2F5C A;  3KLN A;  2VIX A;  3BOQ A;  1MIJ A;  2LF8 A;  2GA1 A;  3K4C A;  3HOW J;  4CCO A;  2O5R A;  3K70 C;  1U8R A;  1SVO A;  3WTU C; 
#chains in the Genus database with same CATH homology
 2ZFW A;  1L3L A;  4R79 A;  1W5S A;  4UHT A;  3K9T A;  1BBY A;  2VN2 A;  1FNN A;  1HKQ A;  3DQV C;  3O2P E;  1MJB A;  3LQQ A;  1YIO A;  1ZGA A;  2OU2 A;  5LGU A;  3K0L A;  3IKV A;  2GAU A;  3IC7 A;  3MZY A;  3J80 Z;  3F8M A;  5ED4 A;  4LG0 B;  2M45 A;  3RIR A;  3O6B B;  2X4H A;  2GWR A;  4FX4 A;  1B9M A;  5DYM A;  2LDU A;  2WWY A;  4UXN A;  1T38 A;  4WXH A;  5KK1 A;  3WTW C;  1MJA A;  2VC0 A;  3IL2 A;  3ELK A;  1EH7 A;  2HQN A;  2XV4 S;  3FM5 A;  2PN6 A;  3FZV A;  2XUB A;  3KP5 A;  4BHB A;  2EV0 A;  2QQ9 A;  3RTR A;  3MEX A;  1C0W A;  4CO8 A;  4EM1 A;  1FC3 A;  2P5K A;  3I59 A;  2G9W A;  5L3E A;  4FT8 A;  4KN4 X;  4XRF A;  1YO5 C;  2QEN A;  2MC3 A;  3ISP A;  4IRI A;  2IA1 A;  1DUX C;  3WU0 A;  3GO5 A;  4RGR A;  3R61 A;  2VBZ A;  2J5O A;  2PBI A;  4RGX A;  1ZAO A;  4EJT A;  2KJB A;  5J8F A;  5FO5 A;  1R1T A;  3BJA A;  1A04 A;  4I02 A;  1J59 A;  2EK5 A;  1J2X A;  2CQK A;  3L2C A;  5LBQ A;  2DT5 A;  4AIJ A;  2K4B A;  1RI7 A;  1W7P A;  4AIK A;  3GLX A;  1WWX A;  2BEO A;  1FX7 A;  2COM A;  1O7F A;  4HX7 A;  2OQG A;  5DCF A;  3J81 K;  3GFM A;  3BDD A;  4MTD A;  4HX8 A;  3GZ6 A;  2O6G E;  2K02 A;  4KIB A;  4EVI A;  3HSF A;  4I2O A;  1F1Z A;  3COA C;  4S04 A;  2KIF A;  3U1D A;  3CUO A;  1QZZ A;  1S8N A;  2O03 A;  3PQJ A;  3TGN A;  4P5O A;  1HW1 A;  5HDK A;  3HOT A;  2RV8 A;  4R1H A;  3LA2 A;  1TNT A;  5JR3 A;  4E70 A;  5ILU A;  4RGU A;  1T2K A;  2XKP A;  1OR7 A;  3C7J A;  4A5N A;  4RB1 A;  2KRF A;  4M73 A;  2HDC A;  2MH2 A;  3ECH A;  3WGI A;  4UVB A;  2A5Y B;  3WGG A;  2P6T A;  2MD5 A;  5A2Q K;  3T8R A;  1KU9 A;  1YTY A;  2Q2E A;  3WGH A;  4A0Z A;  5DCM A;  4WK8 F;  2XAS A;  3EUH A;  5K5R A;  3KE2 A;  4HDV A;  2BBY A;  2RKH A;  2XKO A;  1SFU A;  3FXR A;  3S2W A;  2V9V A;  1YFH A;  1G6N A;  3BPX A;  3V7C A;  1LVA A;  3I4P A;  4M9S A;  1SFE A;  3PFI A;  4M71 A;  3EYI A;  4QWQ A;  3GYH X;  2XAJ A;  2W57 A;  3ZMD A;  4RAY A;  1B59 A;  4O3M A;  2DQL A;  2CYY A;  1RUO A;  1G3W A;  3ABT A;  3BJ6 A;  1D8K A;  4G6Q A;  1G3S A;  1LJ9 A;  5F1R A;  3RI4 A;  3FMS A;  1IN7 A;  1RIO H;  1Z91 A;  2RQP A;  2IVM A;  3CO6 C;  2ESN A;  2EFN A;  2VOP A;  2IP2 A;  4U88 A;  2ZO4 A;  1GXP A;  4P9U A;  1TW2 A;  2J5P A;  2FEZ A;  1FBU A;  4KMU X;  3WTV C;  3MQ0 A;  5HS9 A;  3HOS A;  4WCG A;  4KIF A;  4YIF A;  2M8E A;  4M6X A;  1P6R A;  1LDD A;  1ONV A;  5FLX Z;  5E1W A;  1UFM A;  2XAF A;  4ETS A;  1K6O A;  2FF4 A;  2HYG D;  3VFZ A;  4M6Y A;  5D8K B;  4EMS A;  3GFL A;  3SHF A;  4ESJ A;  3F8N A;  4PGH A;  1IN6 A;  4G8X A;  2CWE A;  3LA3 A;  4EM0 B;  1T98 A;  1ZAR A;  5CYV A;  5D8L B;  2O3F A;  4UVA A;  4HA8 A;  3EET A;  5HLG A;  4ESB A;  2NRA C;  4F7Z A;  2NNN A;  1XMK A;  5TRD A;  4A12 A;  4LJZ F;  5AIP A;  3KP7 A;  3JTG A;  3CDH A;  5DV5 A;  1SD6 A;  2FRH A;  2XAH A;  2H27 A;  4GYI A;  2LNB A;  2XVC A;  3ZPL A;  4LB5 A;  1V4R A;  4M74 A;  1G4D A;  1J0R A;  2EA2 A;  3RYR A;  1PDN C;  4L9T A;  2STT A;  1ZHF A;  4OIQ F;  2V1D A;  2LKP A;  3TQN A;  2DAO A;  1IN8 A;  1X3U A;  5BPI A;  2UWM A;  4UV9 A;  5DUI A;  1OYW A;  2DQR A;  1H9T A;  4NHJ A;  4EM2 A;  1IRG A;  2NYX A;  1UHW A;  1ZN2 A;  3W6K B;  1WRJ A;  1HW5 A;  3QOP A;  3SFZ A;  2JRT A;  3CUQ C;  3T1B A;  4OU0 A;  4BHC A;  3ULQ B;  5LRR A;  1SMT A;  2VON A;  2V1X A;  2VT3 A;  4RB3 C;  1DDN A;  1KU2 A;  4M9Z A;  4HQE A;  3ZP5 A;  4EJO A;  1R23 A;  3WOD F;  5FFZ A;  2V6C A;  4LGW A;  2A68 F;  1KGS A;  5L3B A;  4HZF A;  4OIR F;  3I64 A;  1QNT A;  1E17 A;  1ZG1 A;  1ZRD A;  1PP8 F;  2HKO A;  1XB4 A;  1KYZ A;  3CUQ B;  3P7N A;  4UVC A;  1W7P D;  3E5X A;  3QP5 A;  3SZT A;  1P2F A;  1HW2 A;  1FP1 D;  1O3R A;  1XSV A;  1OYI A;  4ZYE A;  2QUF A;  2G7H A;  1H0M A;  5E1X A;  2E1C A;  2HS5 A;  4RB0 A;  1S3J A;  2YR2 A;  5DDG A;  1IRF A;  3L00 A;  1Z1D A;  3KCC A;  2M30 A;  5H20 A;  1EH6 A;  5D5W B;  3GX4 X;  3M8F A;  2HFH A;  3BY6 A;  1R58 A;  2RN7 A;  3HRT A;  3JTH A;  4CHU A;  2HR3 A;  4MEY F;  1F9N A;  4P55 A;  2L01 A;  3TOA A;  3GWZ A;  4AD9 A;  1CGP A;  1XGN A;  4ENN A;  3FXQ A;  4L9N A;  1I1S A;  3KEO A;  3J7A O;  1PUE E;  2X0L A;  2W84 A;  4EGZ A;  3EDP A;  1XN7 A;  1ZG5 A;  4Q5S F;  3IWF A;  1O7L A;  4MEX F;  1FPQ A;  2JT1 A;  3KEQ A;  3RPU A;  1YLF A;  4KUM A;  4YII A;  1Z6T A;  1F4K A;  3GFJ A;  2L54 A;  2HYF A;  2W24 A;  4Z2Y A;  3LAP A;  3C1D A;  5K5O A;  5HVQ C;  1YW9 A;  3E97 A;  2ACJ A;  2JPB A;  3FWE A;  4HLX A;  2DK8 A;  2WV0 A;  1SD4 A;  2UXX A;  4MQV A;  5BQT A;  4G7Z F;  3J80 K;  5FD6 A;  4HQM A;  4LD5 A;  1FLI A;  3MCZ A;  3M7G A;  3F72 A;  1YS7 A;  1T39 A;  4IHT A;  5F64 A;  3DKW A;  1S7O A;  1D5V A;  1U3E M;  4ZYG A;  1JE8 A;  2QZ8 A;  2DFI A;  4KIC A;  3E6D A;  4WWC A;  1R00 A;  4Q47 A;  2K86 A;  5CVJ A;  1IAW A;  4BAY A;  2UXN A;  4L18 B;  4CXF A;  2FE3 A;  5DD4 A;  1HSJ A;  3EQL F;  4B09 A;  3H92 A;  3HHH A;  1ZG3 A;  4IRG A;  3JAM Z;  5LHG A;  1TLH B;  3ML6 A;  2JPC A;  1DPU A;  2D45 A;  1D8J A;  5IT9 K;  2IA0 A;  2A07 F;  1J7K A;  1J9I A;  3P9C A;  4GXO A;  2FBI A;  1J75 A;  1JHF A;  3CTA A;  4IRH A;  5IT9 Z;  2EFO A;  2VOO A;  2P7V B;  2FSW A;  2YPR A;  2Y48 A;  5L3D A;  3GXO A;  3K69 A;  3JSP A;  1GVJ A;  2M87 A;  4OMZ A;  4JBA A;  1GHC A;  3RKY A;  3QAH A;  5E18 F;  2L4A A;  3WTT C;  1K79 A;  4XLN F;  4UV8 A;  1BOA A;  1D3Y A;  3RJP A;  2FXA A;  5L3G A;  3ERE D;  1OPC A;  3K1M A;  4QLC U;  1Z9C A;  3TO7 A;  3T0Y A;  3HSR A;  3V8K A;  3N97 A;  4A6D A;  3FXU A;  3ZN0 A;  4XLP F;  3I59 B;  4LK1 F;  2V1U A;  1H9G A;  1HKS A;  1R5G A;  3WTY C;  2H94 A;  3E6M A;  1SD5 A;  5DUK A;  1SMY F;  2OBP A;  2DPD A;  1XGO A;  2MLK A;  3NRV A;  4HF0 A;  3QU6 A;  1UHM A;  4O5V A;  2A3S A;  3ZN1 A;  4U0Y A;  1Y0U A;  2MH9 A;  4GCV A;  4A2U A;  1FY7 A;  2FU4 A;  1O3Q A;  2EA4 A;  3R6S A;  3F8B A;  3MWM A;  4N0B A;  1QPM A;  1R1V A;  4IXA A;  2QVO A;  5JI6 A;  4KMF A;  4XSX F;  4OIO F;  1G3Y A;  1FBQ A;  2ZXJ A;  2QWW A;  1JHH A;  2JZY A;  3P9K A;  1R36 A;  3BPV A;  3WTX C;  2Q8K A;  3IRQ A;  4N9H A;  5CVI A;  1MDM A;  1RZ4 A;  1YW8 A;  4G7O F;  3E3V A;  1MJ9 A;  4BYY A;  2Z5U A;  5TJJ A;  4KFC A;  2YU3 A;  4RGS A;  1TQP A;  4Y17 A;  3OOP A;  2DLL A;  3REO A;  2MLG A;  2IRF G;  2CFX A;  1BC7 C;  1W5T A;  4IF4 A;  5K1Y A;  3W6J B;  2IJL A;  1YYV A;  3CUQ A;  3D5L A;  3SZP A;  4KN7 X;  5HS8 A;  3RPQ A;  1TQM A;  3TDU C;  2ZNY A;  4OIP F;  4JQF A;  1ODD A;  1KU7 A;  4MNU A;  1K7A A;  3CLO A;  3BRO A;  5D5V B;  1LQ1 A;  1Z6R A;  4P96 A;  2VT2 A;  4P9F A;  4YFX F;  4FX0 A;  1FSE A;  3KLO A;  2JSC A;  4L5J A;  3M8E A;  3D0S A;  3G3Z A;  2DBB A;  5HOO A;  3IKT A;  1YS6 A;  2GQQ A;  5JFR A;  3C3W A;  2V79 A;  2IA2 A;  3V7S A;  4RS8 A;  1IZ1 A;  3DF8 A;  4ZYD A;  2ZBK A;  4LLL A;  1U2W A;  5CJ9 A;  4AVP A;  3CO7 C;  1B9N A;  4I0B A;  1SD7 A;  2XAG A;  2XHK A;  1RNL A;  4Q48 A;  4H0E A;  3HTU A;  4KYW A;  1IUY A;  2FBH A;  4WX9 A;  1QGP A;  1IXS B;  5IT3 A;  3DP7 A;  2QLZ A;  3EYY A;  4JK1 X;  2TDX A;  4XSZ F;  3BWG A;  5LRS A;  2L02 A;  3VOE A;  1Z05 A;  3BJO A;  5ICE A;  3I5U A;  1XGM A;  2IW5 A;  1FYK A;  1XDU A;  1P4W A;  1Z7U A;  2Y75 A;  1P4A A;  5ERI A;  1FWZ A;  2DO7 A;  2QQB A;  1WQ2 A;  3I71 A;  1BI1 A;  3ZMT A;  2HGC A;  1JXS A;  1J5Y A;  1B1B A;  2Z33 A;  2IT0 A;  1IW7 F;  4UNO A;  2FNP A;  2Z9O A;  1ZRC A;  4GYG A;  2DTR A;  2LF7 A;  1TTY A;  2O0Y A;  3DEU A;  4U0V A;  2ZJ2 A;  4IJA A;  3QRF F;  1ON1 A;  4WXC A;  1LDJ A;  2L3D A;  2NNY A;  4IHS A;  5FD5 A;  1P4X A;  3LFK A;  1ZYR F;  2KJC A;  2CSO A;  4MGR A;  4A0X A;  2RNJ A;  4CIC A;  3IHU A;  2WC2 A;  2Z99 A;  4WF2 A;  2F5D A;  4A6E A;  4CYD A;  4KNY A;  1ZH5 A;  3JW4 A;  2NAZ A;  3TKY A;  5E17 F;  2CGP A;  2ZCW A;  3SXY A;  3E5Q A;  4O6J A;  5ICG A;  4HDU A;  1LDK B;  2G7U A;  1HST A;  4R8H A;  2GZW A;  5LEJ A;  2OQR A;  1XGS A;  3ZMU A;  4PDK A;  5FB2 A;  2EFQ A;  4MTE A;  5FFX A;  2VE9 A;  3I58 A;  3FX3 A;  3LA7 A;  4UUV A;  2VBY A;  4YFN F;  1UB9 A;  1SFX A;  1BC8 C;  2FBK A;  3KP4 A;  4Y13 A;  2ESH A;  2RDP A;  2QM3 A;  1T6S A;  1I6X A;  3ECO A;  1RUN A;  3LWF A;  2GIV A;  4IPA A;  5EEG A;  2FQ3 A;  4CZZ A;  4BH9 A;  4EJW A;  2QBY A;  3DV8 A;  3HTS B;  2ZNZ A;  3LAJ A;  3WE2 A;  1GXQ A;  3ZMS A;  3Q9S A;  4D0P A;  3G73 A;  1KQ0 A;  4I0A A;  5DCM B;  3NQO A;  4A0Y A;  1JGS A;  2HKX A;  2PMU A;  1E2X A;  5EEH A;  1ULY A;  1PP7 U;  5DEQ A;  3U9G A;  2IPQ X;  2P5L C;  5LHH A;  2BGC A;  5LLQ A;  2WTE A;  4L0Y B;  5HLH A;  3DFG A;  3T8T A;  4ZZL A;  3IRR A;  2HZT A;  3KP6 A;  4I01 A;  3RDI A;  3M9A A;  2CO5 A;  4HV5 A;  3JAM K;  3F23 A;  4L9J A;  1REP C;  3R60 A;  3L7W A;  4KT5 C;  3WTS C;  3F8F A;  2LSO A;  1O57 A;  5HS7 A;  5AIQ A;  1TNS A;  2EV5 A;  1U78 A;  2AXL A;  1ZGJ A;  3HSE A;  1XCV A;  2ZKZ A;  4BNC A;  4G6D A;  2PMH A;  4L0Z B;  2FML A;  1I5Z A;  2F5F A;  1W7P B;  3BP8 A;  4HBL A;  5LGN A;  1P92 A;  2FNA A;  2YX4 A;  3HYI A;  3HUG A;  2XAQ A;  5BOX A;  1USS A;  1LB2 A;  3C18 A;  3HRU A;  1QO0 D;  1FOK A;  3B73 A;  1L0O C;  2R7F A;  4FHT A;  1HBX G;  3MFK A;  4MHG A;  1U5T A;  5E8I A;  2W85 A;  1AWC A;  3E6B A;  3QPT A;  2YSR A;  1TW3 A;  4A5M A;  1HKT A;  4HV6 A;  1KU3 A;  5ILV A;  2P6S A;  2EJR A;  5HDN A;  5D6E A;  1XD7 A;  1DP7 P;  2BV6 A;  2HEO A;  4YG2 F;  4CDG A;  1EV7 A;  4Q4Z F;  2P7C B;  1ZLJ A;  2EV6 A;  3FF5 A;  1LEA A;  2Z3Y A;  1IF1 A;  4EGY A;  4LLN A;  1STZ A;  3AAF A;  1T0F A;  6PAX A;  4AIH A;  5K5Q A;  3E6C C;  2HQR A;  3U2R A;  2KIM A;  3WG9 A;  3N4M A;  5H6R A;  2PG4 A;  3KET A;  4DNC A;  2KIU A;  2VBX A;  3VB2 A;  4HYE A;  2E7W A;  5BMZ A;  4PCQ A;  4HW0 A;  4MQ9 F;  1OKR A;  5E1Z B;  3JSO A;  1KQ9 A;  4WXD A;  1VTN C;  5CVR A;  2BE5 F;  4LLG F;  1MGT A;  1HXD A;  1BI3 A;  2H6B A;  4KIG A;  1QZY A;  2UZK A;  1ZRE A;  4Y15 A;  4DQ2 A;  4G9Y A;  2VC1 A;  3GEZ A;  2PFB A;  3GUD A;  3IWZ A;  1BIA A;  4NB5 A;  2D1V A;  5JHU A;  5D5X B;  1XSD A;  2FMY A;  2GA2 A;  4I98 B;  5J8C A;  2P5V A;  2L4M A;  2RGV A;  2OZ6 A;  4HF2 A;  3OV8 A;  3V4G A;  2K4J A;  3O3K A;  2CW0 F;  1R7J A;  2K27 A;  3J81 Z;  3RYP A;  1FP2 A;  4HOB A;  3VEP A;  3T5X A;  1R5H A;  1G3T A;  2F5E A;  5BS6 A;  2EB7 A;  1DPR A;  1QBJ A;  4K2E A;  2BYV E;  4XBF A;  1S6L A;  2PEX A;  1BI0 A;  3HRM A;  1AOY A;  2O8X A;  2EFP A;  1XCB A;  1IXC A;  5LHI A;  4U7D A;  3VOD A;  2GXG A;  1WSU A;  1BM9 A;  2VE8 A;  5CVU A;  3V8L A;  3V8J A;  3NEU A;  5D4S A;  5AON A;  4ZZD A;  3ABU A;  5ILS A;  4LMY A;  1TBX A;  5LEK A;  1W4M A;  2PI0 A;  4RB2 C;  4ENM A;  3R0A A;  1XSX A;  2OZU A;  3KZY A;  2HOE A;  3Q5F A;  2HTS A;  3FMQ A;  5H6Q A;  3RKX A;  1R1U A;  2MA3 A;  1I27 A;  1KYW A;  1BJA A;  1ZRF A;  3FMR A;  2D2W A;  2AS5 F;  1CF7 B;  1WI9 A;  3K2Z A;  1TQI A;  3F6O A;  2OAZ A;  2Y0M A;  3F21 A;  1FYL A;  4YFK F;  2KKO A;  1ZLK A;  5DD8 A;  4ENJ A;  4PZJ A;  3F8C A;  4BQA A;  2M1B A;  4EQQ A;  4GGG A;  2VOD A;  2E1N A;  3WTZ A;  2JTV A;  1NHA A;  3H3U A;  3F3X A;  1IXR C;  4HX4 A;  3CJN A;  4U7B A;  1F5T A;  4OMY A;  2QBY B;  1MDM B;  3LQR A;  3TOB A;  4L5I A;  5E8G A;  5HLI A;  4PGG A;  3HHG A;  3DPT A;  1B4A A;  3BZ6 A;  4TV7 A;  1U5T C;  3GZ5 A;  4I7H A;  5KVR A;  2STW A;  1K78 A;  2DK5 A;  5FGM A;  1MKM A;  4BHP A;  1XDS A;  2ISY A;  2R7D A;  2PQ8 A;  1SAX A;  4U0W A;  2ISZ A;  4G94 A;  1YG2 A;  1KA8 A;  2ELH A;  2EFW A;  4EJU A;  5ICC A;  1ON2 A;  2ADU A;  1FSH A;  1FT9 A;  3P9I A;  2DI3 A;  1U6G A;  2OA4 A;  2W25 A;  4LG0 A;  4ZH4 F;  1YQA A;  3I0T A;  4LB6 B;  3GFI A;  3KZZ A;  2ZME A;  1BN5 A;  1MD0 A;  3I54 A;  3V7R A;  2QYO A;  3K1N A;  1O3T A;  2ZME B;  3FM3 A;  5D4R A;  4ON0 A;  2A69 F;  3M1E A;  4RAZ A;  1K78 B;  1B6A A;  3F22 A;  2XRO A;  2ETH A;  3LST A;  1OMI A;  3H3Z A;  5BPD A;  2EWN A;  5ICF A;  3QP6 A;  4HF1 A;  2R3S A;  5JVT A;  2PJP A;  1V3F A;  2A61 A;  3GF2 A;  2RC4 A;  4EJV A;  5L3C A;  1LEB A;  1LNW A;  5D6F A;  4ENK A;  3QU3 A;  1OYY A;  3ZQ7 A;  3PQK A;  3TDZ C;  3GW2 A;  1I1G A;  1HQC A;  3E5U A;  3ZMZ A;  3ROU A;  2VXZ A;  2DPU A;  3L09 A;  3KP3 A;  1S29 A;  5A2Q Z;  2HTJ A;  4ESF A;  4BXU A;  2C6Y A;  1Q1H A;  1EH8 A;  1FZP B;  2DU9 A;  4AWX B;  2H09 A;  3I53 A;  2XGX A;  4N9I A;  2A6E F;  4NQW A;  4KA4 A;  1U5T B;  3SQN A;  3K1P A;  2A6H F;  5CVV A;  3HRS A;  2XRN A;  5L3F A;  1O3S A;  3Q9V A;  3R0J A;  2DW4 A;  1BI2 A;  2NS0 A;  1IN5 A;  1FYM A;  2P4W A;  1UST A;  2VBW A;  4B8X A;  2M5W A;  3DXJ F;  1CF7 A;  4EV0 A;  4ASN A;  2FOK A;  4L9V A;  3QPH A;  1YW7 A;  2D1H A;  2OD5 A;  2RVC A;  1S7A A;  3TO9 A;  1UCR A;  4CGZ A;  2XIG A;  3GVA A;  4S05 A;  2K7L A;  2H6C A;  5LGT A;  4LK0 F;  4G7H F;  1IN4 A;  2Q0O A;  1WKM A;  3WU1 B;  1BIB A;  3KFW X;  5CLS A;  4M72 A;  3DPL C;  5HDG A;  2PLY A;  4HAM A;  3RKW A;  4ZYH A;  2FA5 A;  4OIN F;  5FLX K;  3KP2 A;  2HWV A;  3R4K A;  2F2E A;  3ZMV A;  1FBS A;  2E7X A;  4HLY A;  4I09 A;  5F6F A;  3MAJ A;  4IVN A;  2B0L A;  3MZH A;  5E20 A;  2O61 A;  2QQA A;  3F6V A;  1KQ8 A;  3HIF A;  4OOI A;  2GXB A;  2YX7 A;  2CG4 A;  4M9X A;  1MZB A;  4GO1 A;  5J6X A;  3TO6 A;  5D5U B;  3FHZ A;  2MBF A;  3L9F A;  1QQI A;  3B02 A;  1XMA A;  4LFU A;  4KDP A;  3WE3 A;  2P8T A;  1R22 A;  2F5C A;  3KLN A;  3BOQ A;  2LF8 A;  2GA1 A;  1U8R A;  3WTU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...