1LEBA

Solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords LEXA REPRESSOR DNA BINDING DOMAIN
publication title Solution structure of the LexA repressor DNA binding domain determined by 1H NMR spectroscopy.
pubmed rcsb
source organism Escherichia coli
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 1994-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lebA00
1FWZA 3GUDA 1O7FA 4ENKA 5L3BA 4ZYHA 5EEGA 3GLXA 1LDDA 1YQAA 1CF7A 2ELHA 4LG0B 2P4WA 1BI2A 3D5LA 1FBQA 5ILSA 5KK1A 1YO5C 3J81K 1Z91A 5FFZA 3K0LA 1BIAA 1IXCA 5AIPA 3VOEA 2KRFA 1I5ZA 3HUGA 1SFXA 1ULYA 2ZFWA 2QLZA 4G6QA 1MZBA 1H9TA 1FX7A 2K27A 1RIOH 1QNTA 2EA4A 4RGXA 4O3MA 4OIOF 3KETA 4KMFA 4EGZA 2CO5A 1CF7B 1JE8A 1PDNC 2V6CA 3L2CA 1WWXA 3QP5A 2HQRA 5ILVA 5CLSA 3GYHX 4CDGA 4GYIA 5BPDA 4IPAA 3KZYA 2FNPA 3EUHA 1DP7P 2H94A 1B59A 2PLYA 3I5UA 4XSZF 4BHPA 3E6MA 2UXNA 1ZHFA 3H92A 1BIBA 4L5IA 5LHIA 4YG2F 1SD4A 3WE2A 4I01A 3BP8A 3FMQA 3G3ZA 2VT2A 3E6BA 1JHHA 2LDUA 3CJNA 4FX0A 2DTRA 3ZN0A 2STWA 1FYMA 4IF4A 5BPIA 4WF2A 3MFKA 1WRJA 2RKHA 4Y13A 3IC7A 2A3SA 3JAMK 1G3WA 4M9ZA 1S8NA 3K69A 1L3LA 1YLFA 2CGPA 4XLPF 1WKMA 3T8TA 2VC1A 2CSOA 4UUVA 2UZKA 1DDNA 4EMSA 2QWWA 4OINF 2UWMA 5AIQA 1JXSA 5FO5A 2LKPA 2X4HA 3TOAA 3KP5A 1FLIA 2XVCA 1QO0D 4YFKF 2MD5A 3RJPA 3J80Z 4CO8A 2NRAC 2NNNA 1EH7A 1TLHB 5K5QA 3H3UA 3IKTA 3CO6C 1R1UA 1OKRA 1STZA 2DK5A 1NHAA 2DFIA 2KIMA 1YG2A 1F4KA 1TW3A 3BZ6A 4ZZDA 1OMIA 2IW5A 4LJZF 4L9TA 4RGRA 2MH9A 1HKSA 5D6EA 4WXHA 1WSUA 4WX9A 4LMYA 2V1DA 3GXOA 1R36A 2QYOA 2EFNA 4JQFA 2M87A 4L18B 4R79A 1R1TA 2E7WA 3HRUA 1FSEA 2P5LC 4IHTA 4ETSA 4CICA 1KQ9A 3HRSA 5DCMA 2E1NA 4LK0F 2ZNZA 1FYKA 1XGOA 4N9IA 2FMLA 2L4AA 2ZMEA 3ZQ7A 4UNOA 3T5XA 1KU2A 2KIUA 4GXOA 4IJAA 4G7HF 3QU3A 4B09A 2ESNA 3GW2A 3F72A 2FOKA 1J5YA 4RGUA 2RC4A 4ESJA 2GA2A 1I6XA 4BQAA 4CYDA 3WTXC 4TV7A 3GF2A 2XAHA 5DCMB 3HOSA 1W7PA 1HW2A 2E7XA 3HYIA 3WU1B 2ZMEB 4DQ2A 2DPUA 2HWVA 1D3YA 5F64A 3L9FA 2MH2A 2R7DA 2GXGA 4G7OF 4EM1A 1BC7C 3JSPA 2IP2A 3WU0A 2STTA 2D1VA 2GAUA 4QWQA 1BI1A 2M8EA 1W7PB 2DLLA 1DPUA 1FBUA 1ON2A 2ISZA 5HLHA 1FY7A 3EQLF 2L02A 4KA4A 5L3EA 1W5TA 3BY6A 2O03A 4I0BA 2F2EA 3O2PE 3HIFA 4KUMA 4ZH4F 3ULQB 2EFQA 1DPRA 2IPQX 5FGMA 2V9VA 3WTVC 3RKXA 3HHGA 3ROUA 2ZXJA 5DD4A 3LQRA 3NQOA 5CJ9A 3BPXA 1LJ9A 1PUEE 4MTEA 3RYPA 2LF8A 5DV5A 4BAYA 3HOTA 1LDKB 2PI0A 1X3UA 2Q2EA 3V8KA 1QQIA 4HYEA 4UVAA 2BGCA 3IL2A 1FPQA 1XDUA 4KDPA 4HF2A 4A6DA 3WODF 1V3FA 3T0YA 2A69F 5HOOA 3M9AA 5LHHA 4M73A 3LSTA 2F5FA 1UHWA 5H6QA 4O6JA 2DAOA 2O3FA 4P9FA 1W7PD 2A6HF 2XAQA 2GQQA 4L0ZB 2F5DA 2GXBA 4I0AA 3RPUA 2VBZA 4XSXF 2E1CA 2QVOA 1T6SA 1TQPA 4GCVA 1BOAA 2FA5A 1ZGAA 4A0YA 2K4BA 1O3SA 1OYIA 1ZN2A 1GHCA 3KP3A 4MEYF 4EV0A 3ERED 2OBPA 4UVBA 1G4DA 1IRGA 2ZCWA 1IW7F 2M30A 1D8JA 1T38A 3M1EA 3R4KA 4WXDA 3MEXA 2XASA 3I0TA 1UB9A 3MZHA 4WCGA 4HQMA 2FU4A 3E97A 2P7VB 1Z6TA 2P6SA 2ZJ2A 3HRMA 2FNAA 3O6BB 1S3JA 1MD0A 2H09A 2IJLA 4UV8A 4XBFA 2R3SA 3KEOA 1R1VA 1T2KA 4MQVA 3WTZA 1K79A 2P6TA 3OV8A 4HQEA 2EFOA 1XDSA 3GO5A 3DF8A 2RDPA 3U2RA 5LLQA 1KU9A 3BOQA 4RGSA 4KICA 4AIKA 2PN6A 1R58A 3F3XA 1XMKA 3CTAA 2A07F 1YIOA 1AOYA 2ZBKA 1IF1A 2H27A 3Q9SA 2FBKA 4L9VA 4HDVA 2ADUA 5L3GA 1G3YA 1BC8C 2F5CA 3JTHA 5HS7A 1KU7A 1I1GA 3L7WA 3GWZA 1V4RA 4A6EA 1ZGJA 4BHCA 2HZTA 1SAXA 3IWZA 2DO7A 3DQVC 3FWEA 3GFJA 4L0YB 3FM5A 3RIRA 4HAMA 4G94A 3WGIA 1B6AA 1PP7U 3P9IA 1JGSA 2JPCA 1W4MA 2PBIA 1ZLJA 4Q4ZF 1K78A 5L3CA 3I59A 3I58A 3ZMVA 1XSVA 1FC3A 3V8LA 4IHSA 2OZ6A 1ZRCA 4HX4A 4KT5C 1EH8A 3C7JA 1BBYA 2VBYA 4LLNA 2YX4A 1RI7A 2V1XA 4HX8A 4RAZA 3VODA 3EETA 4AVPA 1FT9A 2VOOA 1ZH5A 4CHUA 1YS6A 3RI4A 4JBAA 3KCCA 4O5VA 4N9HA 5KVRA 1IRFA 1HKTA 4HOBA 3IWFA 1K78B 4GO1A 3I59B 4WXCA 1FNNA 3P9CA 2EFPA 4HV6A 1Z6RA 2Z33A 2G7HA 4Y17A 3WGHA 2QQBA 3BJ6A 4PGHA 5EEHA 1RNLA 5ILUA 5IT3A 2L4MA 4RB2C 3QOPA 4G8XA 2GWRA 3MAJA 3MQ0A 4F7ZA 3MCZA 5LGNA 3S2WA 4M9XA 3ZMUA 2BBYA 4PGGA 4A0ZA 1KQ0A 4P9UA 2RN7A 3CUOA 3RYRA 3WTTC 1USSA 2J5PA 2MLKA 3WTUC 3K1MA 2FXAA 2YSRA 4UXNA 3HTUA 4OMZA 3CO7C 4I2OA 3TOBA 2OQGA 5FD5A 3M8FA 4QLCU 3F21A 3ABTA 5LRSA 3ZMSA 3F8FA 3J7AO 5H20A 2HS5A 2OAZA 2FQ3A 4P55A 1OYWA 1FZPB 2CQKA 3I53A 4KIFA 2HEOA 2RNJA 1TNSA 2XAGA 4FT8A 2EJRA 2DU9A 2NS0A 2H6CA 2MBFA 4Y15A 2XGXA 5LBQA 4P96A 3K1PA 3FMSA 2QM3A 2P5VA 2K7LA 1ZG5A 2XHKA 2W85A 5BQTA 2IA2A 1IUYA 4BHBA 2QENA 5ICEA 4ESFA 3LQQA 5CVUA 3ZMZA 4KIGA 1IXRC 1ZYRF 3FXRA 4ENJA 1IN8A 3NRVA 3LAJA 4B8XA 4ON0A 4AD9A 2A61A 2HKXA 2VODA 1XCVA 1Q1HA 1Z9CA 3ECHA 1HSJA 2GZWA 2DPDA 3QPTA 4ESBA 4LLLA 5D5VB 1G3TA 4A0XA 3GZ6A 1S29A 2Q0OA 1LEAA 1MJ9A 1B1BA 2FEZA 3ZPLA 2L54A 1SFEA 3E5XA 1Y0UA 4KIBA 2CYYA 1RUNA 2DQLA 5LEKA 3B02A 1IN4A 1SD6A 3QPHA 4EVIA 2C6YA 1R7JA 3HHHA 3OOPA 5LRRA 2NYXA 3KP7A 2FF4A 2PMHA 2WC2A 5E1ZB 4ZYGA 4K2EA 4N0BA 1K7AA 2PFBA 1ON1A 5E8GA 4LFUA 3TO6A 4OMYA 4HV5A 1U2WA 2DK8A 5A2QZ 4L9JA 3WTYC 3DXJF 2VBXA 4BH9A 2EV0A 3MZYA 1J2XA 4ASNA 1HQCA 2EB7A 4UVCA 2K02A 2D1HA 4MTDA 3WE3A 1J0RA 2D45A 3IHUA 4OIPF 1BJAA 1MGTA 4D0PA 3P7NA 3R6SA 4RB0A 1O3RA 1BM9A 1BI0A 1OPCA 1YW7A 4G9YA 3KP2A 2MA3A 4HLYA 3DP7A 1R5HA 2PQ8A 1QZYA 5J8FA 2M45A 2EFWA 3HTSB 3WG9A 2W84A 1B9MA 1WI9A 4EM2A 1SMTA 2WV0A 2ZKZA 2HR3A 2FMYA 3SHFA 2HYFA 1O57A 5DUKA 2YPRA 5L3DA 3IKVA 4A5MA 1TTYA 1K6OA 2YR2A 4NQWA 2OU2A 2DQRA 2R7FA 1YFHA 4Z2YA 3BJOA 3E6DA 3R60A 1IXSB 3KLNA 1HW1A 3I64A 3QRFF 2IRFG 1LEBA 3GZ5A 3F23A 2QQ9A 4RB3C 2G9WA 3F8CA 3KP4A 4AIHA 2JT1A 2HKOA 4G7ZF 1LB2A 4BNCA 3VFZA 2KIFA 4Q5SF 4U7DA 2OD5A 4JK1X 2HTSA 1AWCA 1UCRA 2BEOA 2BYVE 1SFUA 4M74A 5HDNA 1J9IA 2H6BA 2PG4A 5LHGA 4LLGF 4HF1A 1P92A 1KA8A 1G3SA 3GEZA 4MNUA 1HSTA 3FXUA 4CGZA 3T1BA 3W6KB 2ETHA 1GXQA 1Z1DA 2VC0A 4IXAA 5JR3A 3TDUC 1R5GA 2XROA 4LB6B 2RGVA 1P6RA 2JTVA 1YW9A 3N97A 5JI6A 2GA1A 1D5VA 3K1NA 3F8NA 3R0AA 2JSCA 1TBXA 1S7OA 2VT3A 3T8RA 2CFXA 1QBJA 4PCQA 2RQPA 3FHZA 1IN5A 3TO9A 1IAWA 1BI3A 5CVJA 2OZUA 5D8LB 5HDKA 3WGGA 1P4AA 1USTA 3MWMA 4LGWA 2HQNA 5D8KB 3K9TA 1H9GA 3F6OA 1YYVA 1MKMA 2Y75A 4A5NA 1ZG1A 3HRTA 1KYZA 1R23A 5CVVA 5HS8A 3H3ZA 4HX7A 1UFMA 2P5KA 5DEQA 2CG4A 3ELKA 3ZN1A 4EGYA 1TNTA 2K86A 1U5TA 3DFGA 4OIQF 3B73A 1FBSA 2ESHA 1S7AA 4S05A 1R00A 5F1RA 2Q8KA 1HBXG 1YTYA 3EYIA 5E20A 2FSWA 2VBWA 5CVRA 4NHJA 4IRIA 3EDPA 5ICFA 2JPBA 2XAJA 1XCBA 5ICGA 5A2QK 4M9SA 4KYWA 1MJAA 3F8MA 4U88A 5LEJA 2VE8A 3F6VA 3WTSC 4U0WA 5HLGA 2EV6A 3M8EA 1YW8A 1G6NA 2YU3A 3RPQA 1F9NA 4MGRA 1XD7A 4WK8F 1FSHA 1U5TB 1QGPA 1XMAA 5FLXK 1F5TA 3AAFA 5D5XB 4I98B 5JVTA 1A04A 2DT5A 3COAC 4EQQA 2AXLA 4EJTA 4M6XA 3W6JB 4ENMA 3Q5FA 1O7LA 4FX4A 5L3FA 5HVQC 1J7KA 2QQAA 4MEXF 1SD7A 3EYYA 3ZMTA 3NEUA 1GXPA 4PZJA 3QP6A 5DYMA 5LGTA 3I71A 5BMZA 5K1YA 4M72A 5CVIA 4OIRF 3V7CA 1XN7A 4U0YA 3CDHA 1KYWA 4I02A 3KZZA 2V1UA 2ZNYA 2XIGA 1ZLKA 2CWEA 5ERIA 4U7BA 2PMUA 3GX4X 1D8KA 4KNYA 1LVAA 2DBBA 4M6YA 1C0WA 3GFIA 1ZREA 3ISPA 3BWGA 3U1DA 1SD5A 4CXFA 3R0JA 1I27A 2EA2A 2XAFA 5E1XA 2HYGD 2Y0MA 2MLGA 2IVMA 1HXDA 1ZG3A 3ML6A 2VOPA 3GFMA 3L00A 2L3DA 4MHGA 3VB2A 1Z05A 1XB4A 1RZ4A 2XKOA 2W24A 2IA0A 2W57A 4KFCA 2IT0A 5DDGA 4KMUX 3TDZC 2LF7A 1MJBA 2TDXA 3F22A 2M1BA 4GGGA 2HFHA 4IRHA 5D5WB 2PJPA 2FE3A 2KKOA 4HBLA 4Q48A 1O3QA 2O61A 5J6XA 4FHTA 1B4AA 1DUXC 2LSOA 4HW0A 2A68F 2RV8A 1ZAOA 3KLOA 2HTJA 5TJJA 1EH6A 4EJVA 3ZMDA 3CUQA 2IA1A 2VN2A 1XSDA 5HS9A 1T98A 1F1ZA 1T39A 4EJOA 3G73A 1EV7A 2CW0F 1YS7A 2XV4S 2Z9OA 3E5QA 3TKYA 5D4SA 3SZPA 4A12A 2ACJA 4A2UA 4XLNF 2X0LA 3DKWA 3M7GA 1XGSA 4I7HA 1REPC 4Q47A 1IN7A 1TQIA 1SMYF 3ZP5A 3SFZA 2O6GE 4GYGA 3CUQB 1U6GA 3RKYA 3LAPA 3CLOA 2Y48A 5E1WA 4WWCA 1CGPA 1FOKA 1XGMA 3LA7A 4IRGA 3SQNA 3C3WA 3P9KA 4BYYA 4UV9A 2LNBA 1LQ1A 3PQJA 4MQ9F 3REOA 4H0EA 1QZZA 2KJBA 3BDDA 4NB5A 5IT9K 5H6RA 4YIFA 3HSFA 4YIIA 3V4GA 4RS8A 1BN5A 1U5TC 5J8CA 4OU0A 4EM0B 1XGNA 1U78A 3E6CC 2M5WA 3D0SA 1UHMA 1PP8F 2ISYA 4ZYEA 4IVNA 3TO7A 4HF0A 4ENNA 4I09A 2WWYA 4KN4X 3BJAA 3FM3A 2FBIA 1KQ8A 4M71A 3R61A 1IZ1A 3RKWA 3IRQA 5JHUA 1J75A 2O8XA 4PDKA 2RVCA 5K5OA 3SXYA 3PFIA 4HDUA 3J81Z 5FLXZ 5CYVA 5K5RA 4RAYA 1P4XA 2W25A 2HOEA 2EK5A 2Z99A 1ODDA 1KGSA 5BS6A 3KP6A 3F8BA 3V7RA 1OYYA 1B9NA 3JW4A 1S6LA 4RB1A 3E3VA 4YFNF 3JSOA 2QUFA 1XSXA 2GIVA 4L9NA 3C1DA 5DCFA 3Q9VA 1ZARA 1RUOA 2EWNA 2G7UA 2EV5A 1FP1D 3L09A 2OA4A 3C18A 5D5UB 2VONA 2VE9A 1OR7A 3ABUA 2MC3A 3DV8A 4LK1F 2JRTA 1R22A 3KFWX 2QBYA 3GFLA 2HGCA 2FBHA 3LA3A 4DNCA 5ICCA 5HDGA 3RTRA 4L5JA 2QZ8A 4YFXF 1TW2A 2PEXA 2BV6A 3QU6A 2ZO4A 4CZZA 2B0LA 6PAXA 1GVJA 5E18F 1O3TA 4S04A 1IN6A 2P8TA 4U0VA 3V7SA 5D4RA 2J5OA 3SZTA 4EJWA 3JAMZ 2DI3A 4LD5A 3HSEA 2DW4A 3TGNA 5HLIA 2Z5UA 2XRNA 3BROA 2COMA 2FRHA 2QBYB 2F5EA 1U8RA 2NAZA 3BPVA 3I54A 3KE2A 2XUBA 3KEQA 4R8HA 4XRFA 1KU3A 3DPTA 2KJCA 2BE5F 2XKPA 3FMRA 5FB2A 1W5SA 2L01A 2A6EF 1VTNC 3TQNA 3DEUA 2HDCA 1MDMA 3J80K 2JZYA 4ZYDA 3U9GA 4G6DA 4HLXA 1QPMA 3GVAA 5FFXA 4LB5A 5ED4A 1ZRFA 1ONVA 4AWXB 1E17A 3CUQC 2YX7A 3FZVA 1L0OC 4BXUA 3I4PA 4OOIA 5D6FA 4EJUA 4HZFA 3N4MA 2NNYA 4KN7X 4UHTA 2O0YA 4P5OA 1TQMA 3E5UA 5FD6A 1FYLA 3V8JA 3LFKA 2P7CB 3FX3A 3PQKA 1J59A 1LNWA 1MDMB 1E2XA 3FF5A 3RDIA 3VEPA 3WTWC 5E8IA 5F6FA 4R1HA 2VXZA 3O3KA 5DUIA 1P2FA 1T0FA 2UXXA 2OQRA 3DPLC 1FP2A 3JTGA 5TRDA 1P4WA 3FXQA 1ZRDA 2A5YB 3QAHA 5DD8A 1H0MA 4ZZLA 1U3EM 5AONA 2WTEA 2V79A 3LWFA 4E70A 1Z7UA 4LG0A 1JHFA 2Z3YA 2D2WA 5E17F 3K2ZA 5BOXA 2K4JA 3LA2A 1LDJA 1WQ2A 5IT9Z 5LGUA 1I1SA 3ECOA 1HKQA 5JFRA 4HA8A 4AIJA 1HW5A 2AS5F 3IRRA 3HSRA
chains in the Genus database with same CATH superfamily
1FWZA 3GUDA 3LSIA 1MMAA 1O7FA 4Y3OA 4ENKA 5L3BA 4ZYHA 4AYBN 2R7SA 3GTLJ 5EEGA 3GLXA 3WU2C 1K61A 2NOGA 1LDDA 3CF5F 1ETKA 3P5JA 1DU0A 1YQAA 2RAEA 1WJDA 2GOXB 1N25A 4BACA 1CF7A 2ELHA 2VKHA 3HXLA 1BW5A 2CRGA 2R7QA 4LG0B 2BHZA 2M7AA 2P4WA 3HKZN 2L7ZA 2Z16A 1BI2A 3D5LA 1HC8A 1FBQA 1MBJA 5ILSA 3UKGA 2KRCA 3UNGC 3DU6A 2CQXA 4GRIA 1Y6IA 2DOEA 2HDWA 5KK1A 1YO5C 1FTZA 1LUJB 2DA3A 1IRXA 3J81K 2DXIA 1Z91A 2CV0A 5FFZA 4EEFG 2IS6A 3K0LA 1FIAA 1BIAA 1IXCA 5AIPA 3RQ4A 1DGWY 2EIJH 4IEJA 3VOEA 2KRFA 1I5ZA 3PNTA 3HUGA 1SFXA 1ULYA 2ZFWA 3HB9A 3SFIA 4M3EA 4DOZA 2QLZA 1H89C 4G6QA 1MZBA 3BZCA 2VUMJ 3A0HC 2AHQA 4DIQA 1D0XA 1OCTC 1H9TA 2DA1A 3MVPA 3LFUA 3PNYA 1FX7A 1XMXA 2K27A 1RIOH 1POGA 1QNTA 4A3CJ 2EA4A 4CUGA 5GAHJ 2JA5J 4RGXA 4O3MA 4OIOF 1OCCH 3KETA 4KMFA 2AO9A 4EGZA 2CO5A 1CF7B 1JE8A 1FMWA 1PDNC 2V6CA 3L2CA 3S1RJ 4PUSA 1WWXA 3QP5A 2HQRA 3CCEI 3CCQI 3B6CA 4D1QA 5ILVA 5CLSA 1T95A 3GYHX 4CDGA 4GYIA 5BPDA 1T08B 4IPAA 3JRAA 1IV6A 3KZYA 2FNPA 3EUHA 1LVKA 1XS9A 1DP7P 2WA0A 2H94A 1B59A 1JUPA 2DODA 3QWLA 2PLYA 3I5UA 4XSZF 3AG4H 4XN3A 1FIPA 1JJ8C 4DGWB 4BHPA 3E6MA 4BY7J 5LD2C 2UXNA 3BG5A 5FLMJ 1ZHFA 3H92A 3NARA 3HUGB 1BIBA 2XF7A 4L5IA 3TBIA 2R7RA 4L5EA 1A35A 5LHIA 4YG2F 1U9OA 1FOYA 2X1EA 3E0JB 3JRIA 1SD4A 3WE2A 3OYIA 1JKOC 4I01A 2KFDA 3BP8A 1VQKI 3FMQA 3G3ZA 2OTJI 2VT2A 3OMYA 1SAUA 3E6BA 1JHHA 2LDUA 3CJNA 4FX0A 1F43A 2LLKA 2DTRA 4E7ZA 3ZN0A 2DMPA 2STWA 3WG7H 3JCUC 1FYMA 2ZSHB 4D5CA 4IF4A 5BPIA 1S5LC 4WF2A 3MFKA 1WRJA 3CP2A 2RKHA 4Y13A 3IC7A 2A3SA 1W36C 3JAMK 2JSPA 1G3WA 4M9ZA 1S8NA 4U87A 3K69A 4BL0B 1L3LA 3I3LA 4MLOA 4NNJA 4LOCA 1YLFA 4CSWA 1TC3C 2CGPA 2VJIA 4XLPF 1WKMA 2NOJB 3T8TA 2HXOA 1A31A 2VC1A 2CSOA 2IGNA 4XOTA 3HOYJ 4UUVA 2UZKA 1MMGA 3W3CA 1DDNA 1TT5B 3S93A 4EMSA 2QWWA 4OINF 1WHUA 3X2QH 3K4CA 4A3BJ 2UWMA 5AIQA 4A69C 2PJRB 1JXSA 2EZKA 2LYCA 5FO5A 2LKPA 4XK4A 2X4HA 1AKHA 1MBKA 1OISA 4ANJA 4A3MJ 3KP5A 3TOAA 1FLIA 3HEFA 2XVCA 1X3WB 4KJZA 4AC0A 1QO0D 3LSKA 3CC2I 4YFKF 2MD5A 2YS9A 4RAFA 3W6VA 3DTKA 3RJPA 3J80Z 4CO8A 3S1NJ 2NRAC 2BW3A 2NNNA 5JLWA 1EH7A 1TLHB 5K5QA 3H3UA 3IKTA 4A3JJ 2CU7A 3IAM2 4PJNA 3CO6C 1WH7A 1R1UA 1OKRA 3BTCA 1STZA 2R7TA 4JX5A 2DK5A 3HGYA 3HOZJ 1NHAA 5J4YA 1XG1A 1F36A 5J47A 2DFIA 2KIMA 1YG2A 3S3OA 3A02A 1F4KA 1HA8A 3J7ZI 1TW3A 3BZ6A 3TMOA 1AHDP 4ZZDA 1OMIA 2IW5A 5JLXA 4LJZF 1GVDA 4L9TA 4RGRA 2MH9A 2K9NA 2EZLA 2HOSA 1HKSA 2H8RA 2QF7A 3GLLA 5D6EA 4WXHA 1TWAJ 2QKMB 3KZIC 1NG6A 2DDBA 1WSUA 3IH3A 2DFEA 4WX9A 4LMYA 4M3DA 2DFHA 2V1DA 3GXOA 3BR5A 3K2AA 2VL8A 5B5EC 5FROA 2DMNA 1GDTA 2DA7A 4ZDOA 2BW3B 3DLLF 4G12A 1R36A 2QYOA 5F1JA 2EFNA 4FTHA 2BXYA 4JQFA 3JR9A 1EKEA 1WH5A 2M87A 4L18B 1Z67A 4BU2A 3CMEI 4R79A 1R1TA 4BUPA 2E7WA 5HNFA 3HRUA 1FSEA 1UJ8A 3IH2A 2P5LC 4IHTA 4ETSA 2LVSA 5M5YJ 4CICA 1KQ9A 3HRSA 4BQNA 3VYUB 2M0CA 5DCMA 2E1NA 1P7JA 3OSGA 4LK0F 2N8GA 2ZNZA 1FYKA 1XGOA 2XGDA 4Y33A 1ZGWA 4N9IA 2FMLA 2K85A 2ID3A 4Y7NJ 1U0JA 2E2IJ 3J7YJ 2L4AA 2ZMEA 3ZQ7A 3OYLA 4UNOA 2ZXWH 1KU2A 2KIUA 4GXOA 4IJAA 3CDLA 4XLAA 3T5XA 3QQAA 5K7ZA 4BDZA 4G7HF 2NVQJ 2V26A 3ZQGA 3QU3A 4XONA 4B09A 3H3VK 1WCMJ 4ZDLA 1ETWA 3BG3A 2ESNA 4QIWN 3PL8A 3GW2A 3F72A 2JUCA 3HGGA 3HDDA 4F91B 2Y9YA 2FOKA 1MMNA 2FQ4A 2XRLA 3RQIA 3AG3H 1J5YA 1O4XA 3CCJI 4RGUA 3G4SI 2RREA 2RC4A 5H2FC 4ESJA 2GA2A 1I6XA 4DJAA 1X4OA 4BQAA 4JP0A 1HOMA 2M9HA 4CYDA 2EINH 3WTXC 3KYCB 4TV7A 3GF2A 2ELJA 2XAHA 5DCMB 3HOSA 3SDBA 1W7PA 1VFCA 1D5YA 4XKCA 1HW2A 2E7XA 3HYIA 3WU1B 2ZMEB 4DQ2A 1SEUA 2DPUA 4XLCA 2LY2A 1UELB 2HWVA 5F08A 2MGQA 2WAEA 2X6YA 1D3YA 1HDPA 5F64A 3I55I 3FBIB 1EF4A 3K4KA 3L9FA 2MH2A 2R7DA 2GXGA 4JX6A 4G7OF 3PIPF 2HXIA 2HOAA 4EM1A 1BC7C 3JSPA 2IP2A 3FBNB 1OQYA 3WU0A 2STTA 4BY1J 2M4KA 3QYBA 4XLHA 3MMYB 1NK2P 1XPXA 3LSHA 2D1VA 2GAUA 5M5XJ 4AUXA 1SFKA 2XGCA 3OL4A 2LP0A 2DMTA 4QWQA 3HG9A 1BI1A 2K3PA 2M8EA 3SDGA 2KLOA 1W7PB 2DLLA 2ZJQF 1DPUA 1FBUA 1ON2A 1BA5A 2ISZA 5HLHA 2LK2A 1FY7A 3EQLF 2L02A 5KAIC 4CZCA 2E60A 4KA4A 5L3EA 5K7FA 3DBRB 1W5TA 3OIPA 1TL8A 2BY1A 4YEJA 3ASOH 3BY6A 1PJRA 2O03A 2Q1ZB 4I0BA 4QPQA 2M7BA 3EUHC 2F2EA 3O2PE 3HIFA 1VQ4I 4KUMA 4ZH4F 3ULQB 2EFQA 1DPRA 3ABMH 2IPQX 3BTIA 3ZR8X 1VQMI 5FGMA 2V9VA 4HNTA 3WTVC 2QCOA 4CA0A 3RKXA 2WAQA 3HHGA 2ZXJA 3ROUA 1OCZH 1MBEA 5DD4A 3CC7I 3LQRA 1TT0A 3NQOA 5CJ9A 1GUUA 3BPXA 1LJ9A 5FKNA 2V6EA 1VQ7I 1PUEE 2OJED 2FUG2 4MTEA 3RYPA 2CV1A 2LF8A 5DV5A 4BAYA 2E35A 2KT0A 3DLAA 3HOTA 1LDKB 2GLOA 4FQGA 1K4SA 5IP9J 3LSGA 2Y0SA 2PI0A 1X3UA 2Q2EA 2LTPA 4IHYA 2KRHA 2X51A 3V8KA 1QQIA 4HYEA 1U9NA 2BHYA 4UVAA 3JRDA 1SVLA 1AA7A 2BGCA 3IL2A 1YIJI 1FPQA 1OCRH 1XDUA 4BJTA 5CKTA 1RR8C 3L1PA 2HNHA 4KDPA 2R7OA 4ZTFA 4HF2A 4CH7A 4A6DA 3WODF 1V3FA 4BQQA 3T0YA 2A69F 5HOOA 3M9AA 1V5FA 1B72A 5LHHA 2P0WA 4M73A 3LSTA 1VQ5I 2F5FA 1UHWA 5H6QA 2GM4A 2QSFX 2RNGA 4O6JA 5E3NA 2DAOA 1QVTA 5EEAA 2O3FA 4ZJZA 4P9FA 1W7PD 3TP3A 2A6HF 1T56A 3OS1A 3KYDB 4LIUA 2Y2ZA 2XAQA 2A6TA 2GQQA 4L0ZB 2HVRA 5EYRA 2F5DA 2GXBA 4I0AA 2Q2EB 2O7OA 2VBZA 3RPUA 4XSXF 2E1CA 2CUEA 2QVOA 1T6SA 1TQPA 4V2GA 1TWCJ 3DTEA 5GTIC 1R4NB 4GCVA 1BOAA 2FA5A 3TP0A 1ZGAA 4A0YA 2K4BA 1O3SA 4CCLA 1OYIA 4XNFA 1ZN2A 5J3LA 2NVXJ 1GHCA 3KP3A 4MEYF 4EV0A 2LY9A 2R7XA 1BR4A 3ERED 5KCMA 2OBPA 1V55H 4UVBA 3H9GA 1G4DA 1IRGA 2ZCWA 4RLQA 3A2KA 1IW7F 5FJ8J 2M30A 4IHXA 5DM7F 2Z1DA 2V7FA 1JGGA 1T38A 1D8JA 3M1EA 2LMDA 3R4KA 4WXDA 1B72B 3MEXA 2XASA 3I0TA 4MFDA 3B6AA 2CUFA 1UB9A 3MZHA 2YU9J 4WCGA 4HQMA 4ZDPA 2FU4A 3HJEA 3E97A 4OWRB 2P7VB 1ZR2A 1Z6TA 1X1PA 2P6SA 2F48A 2ZJ2A 3DTIA 1FMVA 3D1NI 3HRMA 3LSRA 1Z0XA 2FNAA 3O6BB 4W1UA 4E7HA 1FOXA 2WB1N 1IO2A 1S3JA 1MD0A 2H09A 2IJLA 4UV8A 4XBFA 2R3SA 3KEOA 1R1VA 3HBLA 1ZK8A 1R5ID 1Q1VA 4BDYA 2KMUA 1I39A 1T2KA 4B1RA 2LD5A 4MQVA 3WTZA 2D5VA 1K79A 5J40A 4PFPA 3CDIA 2P6TA 3CLQA 3OV8A 4A3KJ 2JA2A 4HQEA 3JRHA 2EFOA 4BJ5C 3CJQB 1EA3A 1XDSA 3EUKL 3S3MA 2ZJRF 3GO5A 3DF8A 5DS9A 2RDPA 3U2RA 5LLQA 1KU9A 1GV2A 3K6GA 3BOQA 2KZGA 4RGSA 3HOXJ 4KICA 4AIKA 2PN6A 3ZQFA 2ZXIA 1W36D 1R58A 2PMZA 3F3XA 1XMKA 3CTAA 5F04A 2A07F 1YIOA 2ICWG 3OIOA 1AOYA 1TWGJ 2EIMH 3K70D 4ZC3A 2ZBKA 3CMMA 2V4JC 2ZMEC 1IF1A 2H27A 3Q9SA 1QHGA 2FBKA 5DM6F 3CZ6A 4M3GA 4L9VA 5B1BH 3TW7A 4HDVA 3GCMA 2ADUA 1NTCA 3FXKA 5L3GA 3QYFA 1OLTA 1G3YA 1JKQC 1BC8C 3I4MJ 4PFOA 3I9V2 1P7IA 2VJ4A 2JVGA 2F5CA 3IH4A 3JTHA 4PJMA 5HS7A 2VIXA 4FETA 4DYCA 1KU7A 3CCLI 1I1GA 3L7WA 3GWZA 3OY9A 1V4RA 3FXLA 4A6EA 1ZGJA 2R7VA 4BHCA 5HODA 3ZQCA 3OYGA 2HZTA 1SAXA 3IWZA 2LBFA 2DO7A 2W4SA 3DQVC 3FWEA 3GFJA 4L0YB 3FM5A 5IP7J 3RIRA 4HAMA 3KYLA 2KZVA 4G94A 3WGIA 1B6AA 1PP7U 1IJWC 3P9IA 4XLEA 4BBRJ 1JGSA 2ECBA 1JT6A 4FISA 2JPCA 2QKLB 1W4MA 1ZELA 2PBIA 3S8PA 4J01A 4AYBA 2KPMA 1ZLJA 5F0HA 1WJBA 2CUJA 4Q4ZF 1K78A 4S0HB 3H9JA 5L3CA 3F0CA 3I59A 3I58A 3ZMVA 3H0DA 1IG7A 3RPUD 1XSVA 1FC3A 3V8LA 4IHSA 2L7MP 2OZ6A 1R49A 5GAGJ 1IV8A 4XM3A 1ZRCA 4HX4A 2HPIA 4JOMA 4KT5C 4XKBA 3AKZA 1EH8A 3C7JA 4GFBA 2NVYJ 3HKZA 4V19K 1BBYA 5LFAA 2L2OA 2VBYA 3CQZJ 3FIWA 4H4KC 1RESA 3L2QA 1ITYA 3S17J 4LLNA 2YX4A 1RI7A 1VQ9I 1D1AA 2V1XA 4NDLA 4W97A 3HOWJ 4HX8A 4RAZA 5B3SH 3VODA 4AU7A 3EETA 4AVPA 1FT9A 1N75A 3G71I 2VQGA 2VOOA 2LBFB 1ZH5A 2DT7B 2R93J 4CHUA 1V5EA 4HEA2 1YS6A 3RI4A 4JBAA 3KCCA 5EJCA 3OYBA 2LKSA 4O5VA 2ZB9A 2BXZA 2IS4A 4N9HA 1S7EA 5KVRA 2IXSA 1IRFA 2XF6A 1HKTA 4DZJA 3SZGA 4HOBA 2HU9A 1TP4A 3IWFA 2GOMA 1K78B 4GO1A 3Q3SA 2EPFA 3I59B 1UG2A 4WXCA 1FNNA 2LH9A 3BR1A 3P9CA 2B7EA 2EFPA 2XF5A 4HV6A 3LNQA 1Z6RA 2VKDA 2Z33A 5FRMA 2G7HA 3FXMA 4Y17A 5IY5H 3OOUA 3WGHA 3FDYA 2QQBA 4A3GJ 4NBQA 3BJ6A 4PGHA 3HPHA 1QVUA 5EEHA 2IEKA 1LPQA 2K9QA 4XLFA 1HF0A 1OCPA 3TEDA 1RNLA 2LG4A 3C2GA 5ILUA 2R5YA 2JA6J 5IT3A 4X1EA 1TWHJ 2L4MA 1Z21A 3CJTB 1MSFC 4XMYA 4RB2C 3QOPA 4X6AJ 3HM5A 4CCMA 4BXFA 1WZ2A 4XKWA 3ONQA 4XQFA 4G8XA 2GWRA 3LL7A 4GDFA 5IYCJ 3MAJA 2L9VA 3MQ0A 4F7ZA 1N77A 3MKZA 2DDAA 1H88C 1RPWA 3BR6A 3MCZA 3PO2J 2I10A 1Z3YA 3S2WA 5LGNA 2R0QC 3BCAA 4QSHA 4M9XA 3ZMUA 5IOYA 1JT0A 3S32A 2BBYA 4PGGA 4A0ZA 5GADJ 1KQ0A 3KX2A 1ETVA 4P9UA 2RN7A 3AFHA 3CUOA 3VYRB 4IOCF 2WBMA 3RYRA 3K70C 2E1MB 4XR6A 3WTTC 3EUAA 1USSA 2J5PA 2MLKA 3GTMJ 3WTUC 3K1MA 2FXAA 3PFYA 2F4OB 3GTKJ 3DEEA 3BT9A 2XPVA 2YSRA 1WI3A 5GAEJ 5C3EJ 3ABLH 4UXNA 3HTUA 1GLNA 1X1BA 1RRJA 4OMZA 4ZTJA 3CO7C 2R5YB 3TOBA 4I2OA 2P81A 2OQGA 2UV1A 5FD5A 3M8FA 1I50J 4QLCU 3F21A 3CCMI 3ABTA 5LRSA 3VPRA 3ZMSA 1XC5A 3F8FA 3J7AO 1PUFA 5H20A 2HS5A 2OAZA 2FQ3A 4P55A 1OYWA 3IV5A 1FZPB 2CQKA 2JRMA 4EATA 2MFZA 3I53A 4KIFA 3DEWA 4ITVA 2HEOA 2RNJA 5F0CA 1TNSA 2XAGA 2FOWA 4FT8A 2L7FP 2W7NA 2EJRA 5JHFA 3D5RC 2DU9A 2NS0A 1E3OC 2H6CA 2MBFA 2OPTA 2OF7A 4Y15A 2VJJA 4D7NA 3HOUJ 2XGXA 5LBQA 4P96A 3K1PA 3FMSA 2QM3A 1B8IA 3ZQLA 3GTJJ 2P5VA 2K7LA 3K7AJ 2M8GX 2JWTA 1ZG5A 3CJRB 3QPSA 2XHKA 2W85A 3RZDJ 1D0ZA 5BQTA 2IA2A 1R9TJ 1IUYA 3V42A 4AIDA 1D1CA 4A3LJ 1AKHB 2F4MB 4BHBA 2AQFA 2QENA 5ICEA 2HQ5A 1YHQI 3CCSI 4UB6C 2JA7J 4ESFA 3LQQA 3PUFA 1PUFB 5CVUA 3ZMZA 3OYHA 4CYCA 3S2DJ 4KIGA 2B9SA 1IXRC 1ZYRF 3FXRA 1MMDA 3LSMA 3NWSA 4RMNA 5FKOA 3E1SA 3UR3C 4ENJA 3M4OJ 1G8XA 1IN8A 3NRVA 3LAJA 4B3AA 2F5VA 4B8XA 1W0TA 3MZ8A 4ON0A 2VPRA 5HLTA 4AD9A 5M3FJ 3OYDA 2A61A 1WJFA 4Y52J 2XPWA 2HKXA 2L9NA 2VODA 2X48A 1XCVA 1LFBA 1Q1HA 1Z9CA 3G1MA 1B8IB 3ECHA 1HSJA 2KHMA 1A6IA 4P1WA 4HRIA 2GZWA 2OUMA 2DPDA 1WJEA 3QPTA 1SANA 3D5SC 3HOVJ 4ESBA 4LLLA 5D5VB 1G3TA 4A0XA 3GZ6A 1S29A 2Q0OA 1LEAA 2L5QA 1ETYA 4IL6C 1MJ9A 1E3HA 4XL9A 4CYCB 2TCTA 1B1BA 4LIVA 2FEZA 2Y30A 3ZPLA 2L54A 1SFEA 3CCRI 1YRNA 3E5XA 1Y0UA 1BR2A 4KIBA 2CYYA 1RUNA 2GXAA 1WGXA 5E3MA 4XICA 2DQLA 4PJLA 5LEKA 5J1UA 2M34A 2WAFA 5C44J 3B02A 3VYSB 1IN4A 3A1YA 1SD6A 1YX5A 3CF2A 3QPHA 2VJ5A 4EVIA 2C6YA 1WJCA 1R7JA 3HHHA 3OOPA 5LRRA 2K3FA 4NC8A 2NYXA 3KP7A 1KONA 5EZGA 1FJLA 2FF4A 4V2FA 2PMHA 2WC2A 5E1ZB 4ZYGA 2IBDA 2E34A 4K2EA 5F27A 4N0BA 1K7AA 2PFBA 2WV1A 4C3HJ 1OFCX 2GBYA 1ON1A 2WADA 5E8GA 4LFUA 4XRSG 3TO6A 4OMYA 4HV5A 3JRBA 1Y8RB 1HCRA 1U2WA 1UHSA 2DK8A 2VQCA 4L9JA 5A2QZ 2KQRA 3WTYC 2TRTA 3DXJF 2VBXA 4E7JA 4BH9A 4C3IJ 3PIOF 2EV0A 3MZYA 1J2XA 2ME0A 2ID6A 1X2MA 4ASNA 3IAS2 1WPKA 1HQCA 2EB7A 4UVCA 2K02A 1Y8QB 3CCVI 2QEXI 2D1HA 4MTDA 3WE3A 5EDNA 4BGDA 3ABKH 2O8KA 4YIRX 4HG2A 2LR8A 1J0RA 2D45A 3IHUA 4IKFA 1MIJA 2JK3A 4OIPF 1BJAA 1MGTA 4D0PA 3P7NA 1BR1A 2HI3A 4RAGA 4MIMA 2MYSA 2EH3A 3R6SA 5B66C 1VQLI 1G59A 2MG4A 4RB0A 1O3RA 1BM9A 1RKWA 4JX4A 4D7MA 2X85A 1BI0A 3RCOA 1OPCA 4IOAF 1YW7A 4G9YA 3KP2A 1JI8A 1QHHD 3QOEA 5C4XJ 1MW7A 5TISC 2EQRA 2MA3A 3PM1A 4HLYA 3DP7A 1R5HA 2PQ8A 1QZYA 5J8FA 4RM3A 2IS1A 2M45A 1BJZA 2EFWA 2OC6A 2IGMA 1YI2I 3HTSB 3WG9A 2W84A 1B9MA 4A3DJ 2WAQN 3K4BA 2VQHA 4KITB 3MKYB 3OIQA 1WI9A 4QPOA 4EM2A 2X9DA 2Y31A 1SMTA 3K4NA 2E1MC 1MBHA 3I4NJ 2WV0A 1FEXA 2ZKZA 3RKQA 2HR3A 2FMYA 3SHFA 3OYKA 2HYFA 1O57A 4DW6A 1X4PA 5DUKA 1V5GA 4HNUA 4JYKA 1VQ8I 1T8IA 2KP6A 2YPRA 4PSWA 2Y0SN 4OAZA 5L3DA 3IKVA 4A5MA 1TTYA 1K6OA 2YR2A 5F0FA 4F92B 4NQWA 2OU2A 1VNDA 2DQRA 2R7FA 2O9LA 4UB8C 1YFHA 4Z2YA 1IGNA 5KHDA 3BJOA 3OL3A 1R6RA 3E6DA 4DZPA 3R60A 1LKXA 2DT6A 4I76A 2UUZA 1IXSB 3KLNA 1HW1A 2COBA 3I64A 3QRFF 2IRFG 1RETA 3FISA 3GZ5A 2JA8J 3F23A 1LEBA 1FTTA 3MKLA 2QQ9A 2CW8A 4PJJA 1VZ0A 4RB3C 4XIDA 1X1AA 2G9WA 2L9RA 3F8CA 4HNVA 3KP4A 4AIHA 2JT1A 4B47A 4CCNA 5M3MJ 2HKOA 4IQ4A 1YJWI 3FHNA 3S3NA 2OV7A 2VKVA 1SVMA 2XPUA 4G7ZF 1MMSA 1ZKGA 1LB2A 3VFZA 4BNCA 2KIFA 4YELA 4Q5SF 4I6ZA 5FRNA 4U7DA 2OD5A 4JK1X 3LMMA 2HTSA 4D5FA 5B1AH 3BR0A 4AM3A 4PK4A 1AWCA 1UCRA 2BEOA 2EIKH 2BYVE 4NQWB 1SFUA 4M74A 5C4JJ 5HDNA 2HZDA 5J4VA 1J9IA 5TGTA 2H6BA 2PG4A 5LHGA 4LLGF 4HF1A 2NXNB 3LSPA 2X1CA 1P92A 4RA2A 1KA8A 3GBGA 1G3SA 3VYTB 1G2HA 2IAIA 3GEZA 4MNUA 1MBFA 1HSTA 4CCKA 3ASNH 3FXUA 3K4JA 3TL4X 3OSFA 4CGZA 3HZJA 1BOBA 3T1BA 3W6KB 5IYDJ 1DU6A 2CUZA 2ETHA 3TW6A 5CQGA 1GXQA 2NS8A 4E4HA 1Z1DA 2VC0A 4IXAA 5JR3A 2BY3A 3CESA 1R5GA 3TDUC 2XROA 4LB6B 3OYJA 1X1CA 2M3AA 2RGVA 2K9SA 1HDDC 1JTXA 4M3BA 4BXXJ 1OCOH 1P6RA 2JTVA 1YW9A 4CCOA 3N97A 4BKXA 2ZFUA 5JI6A 2GA1A 1NK3P 1D5VA 3K1NA 3F8NA 2CQQA 3SEZA 3R0AA 2JSCA 1TBXA 1S7OA 4AVZA 2VT3A 3T8RA 2CFXA 1QBJA 4PCQA 4RBOA 5FKLA 2ME6A 2RQPA 3FHZA 1IN5A 3TO9A 3DWLE 1J09A 1IAWA 1BI3A 3KIOA 5CVJA 2JUGA 2OZUA 3S14J 5D8LB 2MC4A 5HDKA 2BVLA 3QPLA 3WGGA 2DTZA 1P4AA 4IX7A 1USTA 3MWMA 3AG2H 2XSDC 1D1BA 3DPUA 4LGWA 2PMZN 3BR3A 2HQNA 3BG7A 5D8KB 1IRZA 2BY0A 3K9TA 2KDZA 1H9GA 3F6OA 1VQOI 5GPAA 1YYVA 1MKMA 2Y75A 4A5NA 1ZG1A 4PSXA 3FXOA 1V54H 2MD0A 3Q0VA 4BE1A 3HRTA 1KYZA 1R23A 5CVVA 2EBIA 4KT6A 5HS8A 4UY8I 4MO7A 3H3ZA 4HX7A 3BQYA 2W00A 1UFMA 1MSEC 2P5KA 5DEQA 2CG4A 3JRGA 3ELKA 3ZN1A 4EGYA 1TNTA 2K86A 4IHWA 1U5TA 1W5CC 2ZSIB 3DFGA 4OIQF 3B73A 3H35A 2EILH 1FBSA 2FX0A 1XX5A 2ESHA 1S7AA 4S05A 1MNEA 2O5RA 1R00A 5F1RA 5KNLA 2B63J 1DGRM 2Q8KA 2H1KA 1HBXG 1GV5A 1YTYA 2R7ZJ 3O8GA 4DBQA 2JJ7A 3J7AY 1Z77A 2W1OA 3EYIA 5E20A 2FSWA 2VBWA 2RQQA 5CVRA 4NHJA 3A0BC 1VQPI 3EDPA 4IRIA 3G1OA 1IDYA 5ICFA 3VSKA 5J1YA 2JPBA 2XAJA 1XCBA 4I99C 2LREA 2OCEA 4M9SA 2ZC2A 5ICGA 5A2QK 3OS0A 2VLAA 4KYWA 1QRYA 2DOFA 1MJAA 1X1DA 3QYEA 3F8MA 2KL4A 4U88A 1A6QA 2VE8A 3F6VA 5LEJA 3WTSC 4U0WA 5HLGA 2EV6A 3M8EA 1YW8A 1G6NA 1VQ6I 2YU3A 3RPQA 1F9NA 2K9LA 4MGRA 1BL0A 2CV2A 4IHVA 1XD7A 4WK8F 1FSHA 4E7SA 3G1LA 4D9JA 3KEYA 1U5TB 1UAAA 1QGPA 3A03A 2WY8Q 1XMAA 5FLXK 2IGOA 1F5TA 4BE0A 3BTJA 3AAFA 5D5XB 4I98B 2AXTC 5JVTA 2HDDA 1A04A 2DT5A 3O8HA 3COAC 2E1OA 4EQQA 2AXLA 4EJTA 5IYBJ 3L2UA 4M6XA 1WFXA 3W6JB 3DBHB 4ENMA 3Q5FA 3DKXA 1O7LA 4FX4A 1E0EA 5L3FA 5HVQC 2GIZA 3K10A 3ZCOA 4NC7A 2XB5A 1J7KA 4J00A 2QQAA 4MEXF 1SD7A 3EYYA 3ZMTA 3NEUA 1GXPA 1DP3A 4PZJA 3QP6A 5DYMA 5LGTA 2FD5A 3DBLB 3I71A 5BMZA 5K1YA 2DA4A 3AG1H 4M72A 5CVIA 3GTQJ 4OIRF 3V7CA 2H1LA 1XN7A 2LC2A 4U0YA 2CH0A 2DYRH 3CDHA 1KYWA 4I02A 3KZZA 2X6OA 2CQ7A 2V1UA 2ZNYA 2XIGA 1ZLKA 4B3XA 2CWEA 5ERIA 1LFUP 4U7BA 2CJJA 2PMUA 3OYNA 4N4NB 3MD2A 5BNGA 1D8KA 3GX4X 4KNYA 2E2HJ 3W2VA 4FE4A 3ZQHA 1LVAA 3GZNB 3M8JA 2DBBA 4M6YA 1NH3A 1C0WA 3GFIA 1H8AC 1ZREA 3ISPA 1TZLA 4RLFA 1OR7C 5K7HA 3SJMA 3BWGA 5DTDA 2X6XA 2DA2A 3S15J 3ZGKA 3BG9A 2PJRA 3U1DA 2W48A 4F52A 1SD5A 1VI0A 4Z6YA 3IUOA 4CXFA 3ZRGA 3R0JA 4DBRA 1I27A 3ZQQA 1U8BA 2EA2A 2E5ZA 3H5NA 3HL2A 2NVUB 1QA6A 2XAFA 2H8WA 2HYGD 5E1XA 3CC4I 4C3JJ 2Y0MA 2V9PA 4BS9A 2MLGA 2IVMA 1NG7A 3SEQA 1HXDA 1UG0A 1ZG3A 2K40A 3ML6A 2VOPA 3GFMA 2QA4I 3L00A 1Y0NA 1BW6A 2L3DA 4MHGA 3VB2A 2BY2A 1Z05A 1XB4A 1RZ4A 2XKOA 3AL0B 2W24A 2IA0A 2W57A 4KFCA 2FJ1A 2IT0A 4ZYAA 2BVMA 5DDGA 3LSJA 4IQJA 1A36A 1Y1WJ 4KMUX 3TDZC 2IGKA 2JN6A 2LF7A 3S16J 5FKKA 2DMQA 3OR1C 1MJBA 2TDXA 3F22A 2XGEA 2M1BA 4GGGA 2HFHA 4IRHA 5D5WB 2PJPA 2K5CA 2Z2SB 2FE3A 2DFFA 2KKOA 2HYJA 2OCCH 2EZHA 4HBLA 4Q48A 1O3QA 3G2BA 2YUSA 1ZTRA 4E7IA 2O61A 1D0YA 1X19A 4XORA 5J6XA 4FHTA 4NC6A 1AU7A 3FKJA 4BQOA 1B4AA 2M2EA 1DUXC 2LSOA 4KISA 4HW0A 2A68F 2RV8A 1ZAOA 3KLOA 1MNMC 1IDZA 1W0UA 2HTJA 3DCFA 5TJJA 1EH6A 3PNVA 4EJVA 3ZMDA 3OYEA 3CUQA 2L0KA 1E3PA 2IA1A 2VN2A 5GP9A 1XSDA 5HS9A 2E71A 4C30A 1T98A 1F1ZA 4DYQA 2VB6A 3EPZA 1T39A 4EJOA 3G73A 3N05A 2ZJPF 1SVOA 1RR7A 2LFBA 1EV7A 3WHBA 2CW0F 1YS7A 3W2WA 1RC9A 2MABA 2XV4S 2MW8A 2Z9OA 3E5QA 3H1CA 4HPQA 3TKYA 5D4SA 2CFOA 1EJ9A 3SZPA 4A12A 3VDXA 1ETOA 2ACJA 4A2UA 1S72I 2CS3A 3E7LA 3OYCA 4XLNF 2X0LA 3DKWA 3M7GA 1XGSA 4I7HA 1Y1VJ 3S1QJ 3U1KA 1WVRA 1REPC 1A5JA 4Q47A 1IN7A 4OAYA 3BTLA 1TQIA 1SMYF 2X1DA 4II3A 2DJIA 3ZP5A 3SFZA 3OR2C 2JVHA 2O6GE 4GYGA 4B43A 2DCEA 2OTLI 4LG3A 4F93B 3CUQB 2HPMA 3S2HJ 1U6GA 3RKYA 4B44A 3LAPA 1ZR4A 2LKXA 3CLOA 2Y9ZA 3CMAI 1MH4A 4IO9F 2Y48A 5E1WA 3QODA 2QSGX 3C2BA 4WWCA 2R4GA 1CGPA 1FOKA 1WJAA 2VKEA 1XGMA 3LA7A 2CMPA 1GT0C 2L7KA 2KISA 4IRGA 5FKMA 2XB0X 3LOCA 4M6VA 2F6CA 3SQNA 1T0FC 1LE8A 3C3WA 3PSIA 3P9KA 4BYYA 3VSLA 4UV9A 4F55A 4A3FJ 2LNBA 4A3EJ 1YJNI 1LQ1A 3CP8A 3PQJA 2M4GA 4MQ9F 3REOA 1YX3A 4XN0A 4H0EA 1QZZA 5CPRB 1ETQA 3WHCA 2KJBA 3G6EI 2R5ZA 3RZOJ 3BDDA 4NB5A 3JRFA 1LFPA 5IT9K 3DU5A 5CQEA 1K6YA 2VI6A 1YE9A 5H6RA 4E7LA 4BJ6C 3Q0UA 4LITA 2V1NA 3HSFA 4YIFA 1I6HJ 4YIIA 2KIQA 1JJ6C 2CW7A 5IP6A 1QPIA 2JMWA 3V4GA 3HPGA 4RS8A 1BN5A 1U5TC 2E19A 5J8CA 3K4LA 4OU0A 4EM0B 3F9KA 3JRCA 1XGNA 1U78A 1MNDA 2M5WA 3D0SA 1UHMA 5HNHA 3E6CC 1X3ZB 1PP8F 2ISYA 3ZOBA 4NUBA 4ZYEA 3ESWB 4IVNA 3TO7A 4HF0A 4F3QA 4ENNA 3OS2A 2DMUA 4I09A 2WWYA 2I5UA 4KN4X 2LY1A 3BJAA 1LE8B 3FM3A 2FBIA 2KDOA 1YRNB 4M71A 1KQ8A 3DKYA 1IZ1A 1Z3XA 2LRDA 3R61A 3RKWA 3IRQA 3GTGJ 1VQNI 5JHUA 1M1EB 9ANTA 2BZTA 4E7KA 2R5ZB 1J75A 1S9HA 2O8XA 4PDKA 2VASA 2K9MA 5E79C 2MSYA 5J1RA 1SC7A 3FK7A 3OWTA 4XOPA 2RVCA 3H36A 5K5OA 3SXYA 3PFIA 4HDUA 3I56I 3J81Z 5FLXZ 5CYVA 4C2TA 1SFOJ 3CCUI 1R4MB 2V9KA 3FK6A 5K5RA 4J19A 2XC7A 4RAYA 1P4XA 2W25A 2HOEA 4B4CA 2EK5A 3BQZA 2Z99A 3GTPJ 2DN0A 1ODDA 1KGSA 5BS6A 3KP6A 3F8BA 3V7RA 1OYYA 1IC8A 1B9NA 3JW4A 1S6LA 4RB1A 3E3VA 4YFNF 3JSOA 2HQAA 4XKVA 2QUFA 1XSXA 5EZHA 2A5WA 2DJNA 2DA6A 2GIVA 5IOZA 3M07A 3PSFA 2XDVA 3H9QA 3FKIJ 4L9NA 4CCJA 3S1MJ 2DA5A 3C1DA 1MBGA 3M1CA 5DCFA 3Q9VA 1ZARA 1RUOA 2EWNA 5EG0A 2VXDA 3IP4B 3SYTA 1CQTA 2G7UA 3JREA 2EV5A 1FP1D 1JUSA 3L09A 2OA4A 3C18A 5D5UB 2VONA 2VE9A 2JQ7A 1OR7A 3ABUA 2IS2A 1K83J 2MC3A 3DV8A 4LK1F 2JRTA 3PJRA 1R22A 3U21A 3KFWX 2QBYA 3GFLA 1N78A 1ACIA 2HGCA 5GTHC 3AL0C 2FBHA 3LA3A 4DNCA 1Y56A 5ICCA 2E5NA 5HDGA 3GMEA 3RTRA 3BZKA 4L5JA 2QZ8A 2XSJC 4N4OB 3HC7A 4YFXF 1TW2A 2PEXA 2BV6A 4RM2A 4UUSA 1K4TA 3QU6A 2ZO4A 5JVGF 1JUMA 2XAUA 4CZZA 2QQ8A 2B0LA 2R92J 6PAXA 1GVJA 2ECCA 1WJ5A 5E18F 2M0MA 1O3TA 1YOVB 4S04A 1IN6A 2P8TA 4U0VA 3M3YJ 3V7SA 2HVSA 5EG0B 3PUBA 5D4RA 2J5OA 3SZTA 5M5WJ 1ORKA 3BLYA 4EJWA 3JAMZ 4G6TB 5IPAA 2DI3A 4II2A 4RDUA 4LD5A 1FOWA 3HSEA 2DW4A 1QU3A 3TGNA 2HVQA 3L2VA 5HLIA 2Z5UA 2PX9A 2XRNA 3BROA 3RSNA 2COMA 2FRHA 2QBYB 1Y39A 3W2AA 2F5EA 1U8RA 2NAZA 3ZXSA 3BPVA 3I54A 2LOOA 3KE2A 4X0GA 1ZQ3P 2XUBA 3KEQA 4R8HA 3OYAA 1JKPC 1IUFA 4A93J 4XRFA 1KU3A 3DPTA 1ERDA 2KJCA 1XTAA 2BE5F 2XKPA 4BBSJ 4UUSB 2DOAA 1RKTA 4PJ0C 3FMRA 5FB2A 1W5SA 2L01A 2A6EF 1KZHA 1VTNC 3TQNA 3DEUA 2HDCA 1MDMA 3J80K 2JZYA 3FXJA 4IZZA 3CD6I 4ZYDA 1R71A 3U9GA 2NVTJ 2VQLA 3H0GJ 1T33A 4G6DA 4HLXA 4YRVA 1QPMA 3GVAA 4E6KG 5FFXA 4LB5A 1UMQA 3BG6A 5ED4A 3H5AA 1ZRFA 2ZXHA 1ONVA 2EZIA 1TWFJ 4AWXB 4QTRA 4C2UA 3L2WA 2ELKA 4BEHA 1E17A 3OYMA 1YJ9I 3CUQC 2YX7A 5E3LA 1X58A 3FZVA 1L0OC 4BXUA 4FASD 5E3OA 3I4PA 3BC8A 1W1WE 4OOIA 5D6FA 4EJUA 1ETXA 2AQEA 4HZFA 3N4MA 2NS7A 1DQUA 2NNYA 4KN7X 4C9YA 4UHTA 2F4IA 2O0YA 2WY7Q 4P5OA 3A01A 2R7UA 1UZCA 1JTYA 2VPLA 1TQMA 1P9QC 3E5UA 4FCYA 2HOTA 5EGOA 5FD6A 1PVEA 1FYLA 3V8JA 3ERMA 1OJLA 4FE7A 3C2HA 3LFKA 2P7CB 3FX3A 3PQKA 1J59A 1LNWA 2QGUA 4B48A 3K4MA 1MDMB 1E2XA 3FF5A 4HSTA 3RDIA 1I3AA 1I3QJ 3VEPA 3H5RA 3WTWC 5E8IA 5F6FA 3BR2A 4UUTA 2E2JJ 2WB1A 4R1HA 1HLVA 2VXZA 3O3KA 5DUIA 1X2NA 2CQNA 4BE2A 1APLC 2R7WA 1P2FA 1T0FA 2Y69H 5EF6A 2UXXA 2OQRA 1QZEA 3GTOJ 3OYFA 3DPLC 1FP2A 4BEHB 3JTGA 5TRDA 5GPCA 4A3IJ 3L2RA 2QSHX 1P4WA 1Z7LA 3FXQA 1ZRDA 2A5YB 4DYRA 2E36A 3CMYA 3QAHA 4M3FA 5DD8A 4ZZLA 1H0MA 3A01B 1U3EM 3MKWB 3A4CA 3BCBA 2WTEA 2V79A 3LWFA 5AONA 4E70A 1Z7UA 4XRMA 5FLVA 4LG0A 3ZQIA 1JHFA 5EGOB 2L9SA 2DYSH 1JKRC 2BOLA 3Q0WA 4C2MJ 2Z3YA 2A05A 1VF9A 2D2WA 3K2ZA 5E17F 5BOXA 3MN2A 3PO3J 2K4JA 4MFEA 5KAFC 3CCYA 2X6WA 3LA2A 1LDJA 4HSRA 1WQ2A 5IT9Z 3KPHA 4XRSA 4ABZA 5LGUA 1ENHA 1I1SA 3ECOA 1HKQA 5JFRA 1YITI 4HA8A 4AIJA 4Y4RA 1HW5A 1MH3A 3VWBA 2W82A 3NAUA 3NWTA 2I8DA 2AS5F 3IRRA 2G0EA 3HSRA 1PYVA
chains in the Genus database with same CATH topology
1FWZA 3GUDA 1O7FA 4ENKA 5L3BA 4ZYHA 5EEGA 3GLXA 1LDDA 1YQAA 1CF7A 2ELHA 4LG0B 2P4WA 1BI2A 3D5LA 1FBQA 5ILSA 5KK1A 1YO5C 3J81K 1Z91A 5FFZA 3K0LA 1BIAA 1IXCA 5AIPA 3VOEA 2KRFA 1I5ZA 3HUGA 1SFXA 1ULYA 2ZFWA 2QLZA 4G6QA 1MZBA 1H9TA 1FX7A 2K27A 1RIOH 1QNTA 2EA4A 4RGXA 4O3MA 4OIOF 3KETA 4KMFA 4EGZA 2CO5A 1CF7B 1JE8A 1PDNC 2V6CA 3L2CA 1WWXA 3QP5A 2HQRA 5ILVA 5CLSA 3GYHX 4CDGA 4GYIA 5BPDA 4IPAA 3KZYA 2FNPA 3EUHA 1DP7P 2H94A 1B59A 2PLYA 3I5UA 4XSZF 4BHPA 3E6MA 2UXNA 1ZHFA 3H92A 1BIBA 4L5IA 5LHIA 4YG2F 1SD4A 3WE2A 4I01A 3BP8A 3FMQA 3G3ZA 2VT2A 3E6BA 1JHHA 2LDUA 3CJNA 4FX0A 2DTRA 3ZN0A 2STWA 1FYMA 4IF4A 5BPIA 4WF2A 3MFKA 1WRJA 2RKHA 4Y13A 3IC7A 2A3SA 3JAMK 1G3WA 4M9ZA 1S8NA 3K69A 1L3LA 1YLFA 2CGPA 4XLPF 1WKMA 3T8TA 2VC1A 2CSOA 4UUVA 2UZKA 1DDNA 4EMSA 2QWWA 4OINF 2UWMA 5AIQA 1JXSA 5FO5A 2LKPA 2X4HA 3TOAA 3KP5A 1FLIA 2XVCA 1QO0D 4YFKF 2MD5A 3RJPA 3J80Z 4CO8A 2NRAC 2NNNA 1EH7A 1TLHB 5K5QA 3H3UA 3IKTA 3CO6C 1R1UA 1OKRA 1STZA 2DK5A 1NHAA 2DFIA 2KIMA 1YG2A 1F4KA 1TW3A 3BZ6A 4ZZDA 1OMIA 2IW5A 4LJZF 4L9TA 4RGRA 2MH9A 1HKSA 5D6EA 4WXHA 1WSUA 4WX9A 4LMYA 2V1DA 3GXOA 1R36A 2QYOA 2EFNA 4JQFA 2M87A 4L18B 4R79A 1R1TA 2E7WA 3HRUA 1FSEA 2P5LC 4IHTA 4ETSA 4CICA 1KQ9A 3HRSA 5DCMA 2E1NA 4LK0F 2ZNZA 1FYKA 1XGOA 4N9IA 2FMLA 2L4AA 2ZMEA 3ZQ7A 4UNOA 3T5XA 1KU2A 2KIUA 4GXOA 4IJAA 4G7HF 3QU3A 4B09A 2ESNA 3GW2A 3F72A 2FOKA 1J5YA 4RGUA 2RC4A 4ESJA 2GA2A 1I6XA 4BQAA 4CYDA 3WTXC 4TV7A 3GF2A 2XAHA 5DCMB 3HOSA 1W7PA 1HW2A 2E7XA 3HYIA 3WU1B 2ZMEB 4DQ2A 2DPUA 2HWVA 1D3YA 5F64A 3L9FA 2MH2A 2R7DA 2GXGA 4G7OF 4EM1A 1BC7C 3JSPA 2IP2A 3WU0A 2STTA 2D1VA 2GAUA 4QWQA 1BI1A 2M8EA 1W7PB 2DLLA 1DPUA 1FBUA 1ON2A 2ISZA 5HLHA 1FY7A 3EQLF 2L02A 4KA4A 5L3EA 1W5TA 3BY6A 2O03A 4I0BA 2F2EA 3O2PE 3HIFA 4KUMA 4ZH4F 3ULQB 2EFQA 1DPRA 2IPQX 5FGMA 2V9VA 3WTVC 3RKXA 3HHGA 3ROUA 2ZXJA 5DD4A 3LQRA 3NQOA 5CJ9A 3BPXA 1LJ9A 1PUEE 4MTEA 3RYPA 2LF8A 5DV5A 4BAYA 3HOTA 1LDKB 2PI0A 1X3UA 2Q2EA 3V8KA 1QQIA 4HYEA 4UVAA 2BGCA 3IL2A 1FPQA 1XDUA 4KDPA 4HF2A 4A6DA 3WODF 1V3FA 3T0YA 2A69F 5HOOA 3M9AA 5LHHA 4M73A 3LSTA 2F5FA 1UHWA 5H6QA 4O6JA 2DAOA 2O3FA 4P9FA 1W7PD 2A6HF 2XAQA 2GQQA 4L0ZB 2F5DA 2GXBA 4I0AA 3RPUA 2VBZA 4XSXF 2E1CA 2QVOA 1T6SA 1TQPA 4GCVA 1BOAA 2FA5A 1ZGAA 4A0YA 2K4BA 1O3SA 1OYIA 1ZN2A 1GHCA 3KP3A 4MEYF 4EV0A 3ERED 2OBPA 4UVBA 1G4DA 1IRGA 2ZCWA 1IW7F 2M30A 1D8JA 1T38A 3M1EA 3R4KA 4WXDA 3MEXA 2XASA 3I0TA 1UB9A 3MZHA 4WCGA 4HQMA 2FU4A 3E97A 2P7VB 1Z6TA 2P6SA 2ZJ2A 3HRMA 2FNAA 3O6BB 1S3JA 1MD0A 2H09A 2IJLA 4UV8A 4XBFA 2R3SA 3KEOA 1R1VA 1T2KA 4MQVA 3WTZA 1K79A 2P6TA 3OV8A 4HQEA 2EFOA 1XDSA 3GO5A 3DF8A 2RDPA 3U2RA 5LLQA 1KU9A 3BOQA 4RGSA 4KICA 4AIKA 2PN6A 1R58A 3F3XA 1XMKA 3CTAA 2A07F 1YIOA 1AOYA 2ZBKA 1IF1A 2H27A 3Q9SA 2FBKA 4L9VA 4HDVA 2ADUA 5L3GA 1G3YA 1BC8C 2F5CA 3JTHA 5HS7A 1KU7A 1I1GA 3L7WA 3GWZA 1V4RA 4A6EA 1ZGJA 4BHCA 2HZTA 1SAXA 3IWZA 2DO7A 3DQVC 3FWEA 3GFJA 4L0YB 3FM5A 3RIRA 4HAMA 4G94A 3WGIA 1B6AA 1PP7U 3P9IA 1JGSA 2JPCA 1W4MA 2PBIA 1ZLJA 4Q4ZF 1K78A 5L3CA 3I59A 3I58A 3ZMVA 1XSVA 1FC3A 3V8LA 4IHSA 2OZ6A 1ZRCA 4HX4A 4KT5C 1EH8A 3C7JA 1BBYA 2VBYA 4LLNA 2YX4A 1RI7A 2V1XA 4HX8A 4RAZA 3VODA 3EETA 4AVPA 1FT9A 2VOOA 1ZH5A 4CHUA 1YS6A 3RI4A 4JBAA 3KCCA 4O5VA 4N9HA 5KVRA 1IRFA 1HKTA 4HOBA 3IWFA 1K78B 4GO1A 3I59B 4WXCA 1FNNA 3P9CA 2EFPA 4HV6A 1Z6RA 2Z33A 2G7HA 4Y17A 3WGHA 2QQBA 3BJ6A 4PGHA 5EEHA 1RNLA 5ILUA 5IT3A 2L4MA 4RB2C 3QOPA 4G8XA 2GWRA 3MAJA 3MQ0A 4F7ZA 3MCZA 5LGNA 3S2WA 4M9XA 3ZMUA 2BBYA 4PGGA 4A0ZA 1KQ0A 4P9UA 2RN7A 3CUOA 3RYRA 3WTTC 1USSA 2J5PA 2MLKA 3WTUC 3K1MA 2FXAA 2YSRA 4UXNA 3HTUA 4OMZA 3CO7C 4I2OA 3TOBA 2OQGA 5FD5A 3M8FA 4QLCU 3F21A 3ABTA 5LRSA 3ZMSA 3F8FA 3J7AO 5H20A 2HS5A 2OAZA 2FQ3A 4P55A 1OYWA 1FZPB 2CQKA 3I53A 4KIFA 2HEOA 2RNJA 1TNSA 2XAGA 4FT8A 2EJRA 2DU9A 2NS0A 2H6CA 2MBFA 4Y15A 2XGXA 5LBQA 4P96A 3K1PA 3FMSA 2QM3A 2P5VA 2K7LA 1ZG5A 2XHKA 2W85A 5BQTA 2IA2A 1IUYA 4BHBA 2QENA 5ICEA 4ESFA 3LQQA 5CVUA 3ZMZA 4KIGA 1IXRC 1ZYRF 3FXRA 4ENJA 1IN8A 3NRVA 3LAJA 4B8XA 4ON0A 4AD9A 2A61A 2HKXA 2VODA 1XCVA 1Q1HA 1Z9CA 3ECHA 1HSJA 2GZWA 2DPDA 3QPTA 4ESBA 4LLLA 5D5VB 1G3TA 4A0XA 3GZ6A 1S29A 2Q0OA 1LEAA 1MJ9A 1B1BA 2FEZA 3ZPLA 2L54A 1SFEA 3E5XA 1Y0UA 4KIBA 2CYYA 1RUNA 2DQLA 5LEKA 3B02A 1IN4A 1SD6A 3QPHA 4EVIA 2C6YA 1R7JA 3HHHA 3OOPA 5LRRA 2NYXA 3KP7A 2FF4A 2PMHA 2WC2A 5E1ZB 4ZYGA 4K2EA 4N0BA 1K7AA 2PFBA 1ON1A 5E8GA 4LFUA 3TO6A 4OMYA 4HV5A 1U2WA 2DK8A 5A2QZ 4L9JA 3WTYC 3DXJF 2VBXA 4BH9A 2EV0A 3MZYA 1J2XA 4ASNA 1HQCA 2EB7A 4UVCA 2K02A 2D1HA 4MTDA 3WE3A 1J0RA 2D45A 3IHUA 4OIPF 1BJAA 1MGTA 4D0PA 3P7NA 3R6SA 4RB0A 1O3RA 1BM9A 1BI0A 1OPCA 1YW7A 4G9YA 3KP2A 2MA3A 4HLYA 3DP7A 1R5HA 2PQ8A 1QZYA 5J8FA 2M45A 2EFWA 3HTSB 3WG9A 2W84A 1B9MA 1WI9A 4EM2A 1SMTA 2WV0A 2ZKZA 2HR3A 2FMYA 3SHFA 2HYFA 1O57A 5DUKA 2YPRA 5L3DA 3IKVA 4A5MA 1TTYA 1K6OA 2YR2A 4NQWA 2OU2A 2DQRA 2R7FA 1YFHA 4Z2YA 3BJOA 3E6DA 3R60A 1IXSB 3KLNA 1HW1A 3I64A 3QRFF 2IRFG 1LEBA 3GZ5A 3F23A 2QQ9A 4RB3C 2G9WA 3F8CA 3KP4A 4AIHA 2JT1A 2HKOA 4G7ZF 1LB2A 4BNCA 3VFZA 2KIFA 4Q5SF 4U7DA 2OD5A 4JK1X 2HTSA 1AWCA 1UCRA 2BEOA 2BYVE 1SFUA 4M74A 5HDNA 1J9IA 2H6BA 2PG4A 5LHGA 4LLGF 4HF1A 1P92A 1KA8A 1G3SA 3GEZA 4MNUA 1HSTA 3FXUA 4CGZA 3T1BA 3W6KB 2ETHA 1GXQA 1Z1DA 2VC0A 4IXAA 5JR3A 3TDUC 1R5GA 2XROA 4LB6B 2RGVA 1P6RA 2JTVA 1YW9A 3N97A 5JI6A 2GA1A 1D5VA 3K1NA 3F8NA 3R0AA 2JSCA 1TBXA 1S7OA 2VT3A 3T8RA 2CFXA 1QBJA 4PCQA 2RQPA 3FHZA 1IN5A 3TO9A 1IAWA 1BI3A 5CVJA 2OZUA 5D8LB 5HDKA 3WGGA 1P4AA 1USTA 3MWMA 4LGWA 2HQNA 5D8KB 3K9TA 1H9GA 3F6OA 1YYVA 1MKMA 2Y75A 4A5NA 1ZG1A 3HRTA 1KYZA 1R23A 5CVVA 5HS8A 3H3ZA 4HX7A 1UFMA 2P5KA 5DEQA 2CG4A 3ELKA 3ZN1A 4EGYA 1TNTA 2K86A 1U5TA 3DFGA 4OIQF 3B73A 1FBSA 2ESHA 1S7AA 4S05A 1R00A 5F1RA 2Q8KA 1HBXG 1YTYA 3EYIA 5E20A 2FSWA 2VBWA 5CVRA 4NHJA 4IRIA 3EDPA 5ICFA 2JPBA 2XAJA 1XCBA 5ICGA 5A2QK 4M9SA 4KYWA 1MJAA 3F8MA 4U88A 5LEJA 2VE8A 3F6VA 3WTSC 4U0WA 5HLGA 2EV6A 3M8EA 1YW8A 1G6NA 2YU3A 3RPQA 1F9NA 4MGRA 1XD7A 4WK8F 1FSHA 1U5TB 1QGPA 1XMAA 5FLXK 1F5TA 3AAFA 5D5XB 4I98B 5JVTA 1A04A 2DT5A 3COAC 4EQQA 2AXLA 4EJTA 4M6XA 3W6JB 4ENMA 3Q5FA 1O7LA 4FX4A 5L3FA 5HVQC 1J7KA 2QQAA 4MEXF 1SD7A 3EYYA 3ZMTA 3NEUA 1GXPA 4PZJA 3QP6A 5DYMA 5LGTA 3I71A 5BMZA 5K1YA 4M72A 5CVIA 4OIRF 3V7CA 1XN7A 4U0YA 3CDHA 1KYWA 4I02A 3KZZA 2V1UA 2ZNYA 2XIGA 1ZLKA 2CWEA 5ERIA 4U7BA 2PMUA 3GX4X 1D8KA 4KNYA 1LVAA 2DBBA 4M6YA 1C0WA 3GFIA 1ZREA 3ISPA 3BWGA 3U1DA 1SD5A 4CXFA 3R0JA 1I27A 2EA2A 2XAFA 5E1XA 2HYGD 2Y0MA 2MLGA 2IVMA 1HXDA 1ZG3A 3ML6A 2VOPA 3GFMA 3L00A 2L3DA 4MHGA 3VB2A 1Z05A 1XB4A 1RZ4A 2XKOA 2W24A 2IA0A 2W57A 4KFCA 2IT0A 5DDGA 4KMUX 3TDZC 2LF7A 1MJBA 2TDXA 3F22A 2M1BA 4GGGA 2HFHA 4IRHA 5D5WB 2PJPA 2FE3A 2KKOA 4HBLA 4Q48A 1O3QA 2O61A 5J6XA 4FHTA 1B4AA 1DUXC 2LSOA 4HW0A 2A68F 2RV8A 1ZAOA 3KLOA 2HTJA 5TJJA 1EH6A 4EJVA 3ZMDA 3CUQA 2IA1A 2VN2A 1XSDA 5HS9A 1T98A 1F1ZA 1T39A 4EJOA 3G73A 1EV7A 2CW0F 1YS7A 2XV4S 2Z9OA 3E5QA 3TKYA 5D4SA 3SZPA 4A12A 2ACJA 4A2UA 4XLNF 2X0LA 3DKWA 3M7GA 1XGSA 4I7HA 1REPC 4Q47A 1IN7A 1TQIA 1SMYF 3ZP5A 3SFZA 2O6GE 4GYGA 3CUQB 1U6GA 3RKYA 3LAPA 3CLOA 2Y48A 5E1WA 4WWCA 1CGPA 1FOKA 1XGMA 3LA7A 4IRGA 3SQNA 3C3WA 3P9KA 4BYYA 4UV9A 2LNBA 1LQ1A 3PQJA 4MQ9F 3REOA 4H0EA 1QZZA 2KJBA 3BDDA 4NB5A 5IT9K 5H6RA 4YIFA 3HSFA 4YIIA 3V4GA 4RS8A 1BN5A 1U5TC 5J8CA 4OU0A 4EM0B 1XGNA 1U78A 3E6CC 2M5WA 3D0SA 1UHMA 1PP8F 2ISYA 4ZYEA 4IVNA 3TO7A 4HF0A 4ENNA 4I09A 2WWYA 4KN4X 3BJAA 3FM3A 2FBIA 1KQ8A 4M71A 3R61A 1IZ1A 3RKWA 3IRQA 5JHUA 1J75A 2O8XA 4PDKA 2RVCA 5K5OA 3SXYA 3PFIA 4HDUA 3J81Z 5FLXZ 5CYVA 5K5RA 4RAYA 1P4XA 2W25A 2HOEA 2EK5A 2Z99A 1ODDA 1KGSA 5BS6A 3KP6A 3F8BA 3V7RA 1OYYA 1B9NA 3JW4A 1S6LA 4RB1A 3E3VA 4YFNF 3JSOA 2QUFA 1XSXA 2GIVA 4L9NA 3C1DA 5DCFA 3Q9VA 1ZARA 1RUOA 2EWNA 2G7UA 2EV5A 1FP1D 3L09A 2OA4A 3C18A 5D5UB 2VONA 2VE9A 1OR7A 3ABUA 2MC3A 3DV8A 4LK1F 2JRTA 1R22A 3KFWX 2QBYA 3GFLA 2HGCA 2FBHA 3LA3A 4DNCA 5ICCA 5HDGA 3RTRA 4L5JA 2QZ8A 4YFXF 1TW2A 2PEXA 2BV6A 3QU6A 2ZO4A 4CZZA 2B0LA 6PAXA 1GVJA 5E18F 1O3TA 4S04A 1IN6A 2P8TA 4U0VA 3V7SA 5D4RA 2J5OA 3SZTA 4EJWA 3JAMZ 2DI3A 4LD5A 3HSEA 2DW4A 3TGNA 5HLIA 2Z5UA 2XRNA 3BROA 2COMA 2FRHA 2QBYB 2F5EA 1U8RA 2NAZA 3BPVA 3I54A 3KE2A 2XUBA 3KEQA 4R8HA 4XRFA 1KU3A 3DPTA 2KJCA 2BE5F 2XKPA 3FMRA 5FB2A 1W5SA 2L01A 2A6EF 1VTNC 3TQNA 3DEUA 2HDCA 1MDMA 3J80K 2JZYA 4ZYDA 3U9GA 4G6DA 4HLXA 1QPMA 3GVAA 5FFXA 4LB5A 5ED4A 1ZRFA 1ONVA 4AWXB 1E17A 3CUQC 2YX7A 3FZVA 1L0OC 4BXUA 3I4PA 4OOIA 5D6FA 4EJUA 4HZFA 3N4MA 2NNYA 4KN7X 4UHTA 2O0YA 4P5OA 1TQMA 3E5UA 5FD6A 1FYLA 3V8JA 3LFKA 2P7CB 3FX3A 3PQKA 1J59A 1LNWA 1MDMB 1E2XA 3FF5A 3RDIA 3VEPA 3WTWC 5E8IA 5F6FA 4R1HA 2VXZA 3O3KA 5DUIA 1P2FA 1T0FA 2UXXA 2OQRA 3DPLC 1FP2A 3JTGA 5TRDA 1P4WA 3FXQA 1ZRDA 2A5YB 3QAHA 5DD8A 1H0MA 4ZZLA 1U3EM 5AONA 2WTEA 2V79A 3LWFA 4E70A 1Z7UA 4LG0A 1JHFA 2Z3YA 2D2WA 5E17F 3K2ZA 5BOXA 2K4JA 3LA2A 1LDJA 1WQ2A 5IT9Z 5LGUA 1I1SA 3ECOA 1HKQA 5JFRA 4HA8A 4AIJA 1HW5A 2AS5F 3IRRA 3HSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWZ A;  3GUD A;  1O7F A;  4ENK A;  5L3B A;  4ZYH A;  5EEG A;  3GLX A;  1LDD A;  1YQA A;  1CF7 A;  2ELH A;  4LG0 B;  2P4W A;  1BI2 A;  3D5L A;  1FBQ A;  5ILS A;  5KK1 A;  1YO5 C;  3J81 K;  1Z91 A;  5FFZ A;  3K0L A;  1BIA A;  1IXC A;  5AIP A;  3VOE A;  2KRF A;  1I5Z A;  3HUG A;  1SFX A;  1ULY A;  2ZFW A;  2QLZ A;  4G6Q A;  1MZB A;  1H9T A;  1FX7 A;  2K27 A;  1RIO H;  1QNT A;  2EA4 A;  4RGX A;  4O3M A;  4OIO F;  3KET A;  4KMF A;  4EGZ A;  2CO5 A;  1CF7 B;  1JE8 A;  1PDN C;  2V6C A;  3L2C A;  1WWX A;  3QP5 A;  2HQR A;  5ILV A;  5CLS A;  3GYH X;  4CDG A;  4GYI A;  5BPD A;  4IPA A;  3KZY A;  2FNP A;  3EUH A;  1DP7 P;  2H94 A;  1B59 A;  2PLY A;  3I5U A;  4XSZ F;  4BHP A;  3E6M A;  2UXN A;  1ZHF A;  3H92 A;  1BIB A;  4L5I A;  5LHI A;  4YG2 F;  1SD4 A;  3WE2 A;  4I01 A;  3BP8 A;  3FMQ A;  3G3Z A;  2VT2 A;  3E6B A;  1JHH A;  2LDU A;  3CJN A;  4FX0 A;  2DTR A;  3ZN0 A;  2STW A;  1FYM A;  4IF4 A;  5BPI A;  4WF2 A;  3MFK A;  1WRJ A;  2RKH A;  4Y13 A;  3IC7 A;  2A3S A;  3JAM K;  1G3W A;  4M9Z A;  1S8N A;  3K69 A;  1L3L A;  1YLF A;  2CGP A;  4XLP F;  1WKM A;  3T8T A;  2VC1 A;  2CSO A;  4UUV A;  2UZK A;  1DDN A;  4EMS A;  2QWW A;  4OIN F;  2UWM A;  5AIQ A;  1JXS A;  5FO5 A;  2LKP A;  2X4H A;  3TOA A;  3KP5 A;  1FLI A;  2XVC A;  1QO0 D;  4YFK F;  2MD5 A;  3RJP A;  3J80 Z;  4CO8 A;  2NRA C;  2NNN A;  1EH7 A;  1TLH B;  5K5Q A;  3H3U A;  3IKT A;  3CO6 C;  1R1U A;  1OKR A;  1STZ A;  2DK5 A;  1NHA A;  2DFI A;  2KIM A;  1YG2 A;  1F4K A;  1TW3 A;  3BZ6 A;  4ZZD A;  1OMI A;  2IW5 A;  4LJZ F;  4L9T A;  4RGR A;  2MH9 A;  1HKS A;  5D6E A;  4WXH A;  1WSU A;  4WX9 A;  4LMY A;  2V1D A;  3GXO A;  1R36 A;  2QYO A;  2EFN A;  4JQF A;  2M87 A;  4L18 B;  4R79 A;  1R1T A;  2E7W A;  3HRU A;  1FSE A;  2P5L C;  4IHT A;  4ETS A;  4CIC A;  1KQ9 A;  3HRS A;  5DCM A;  2E1N A;  4LK0 F;  2ZNZ A;  1FYK A;  1XGO A;  4N9I A;  2FML A;  2L4A A;  2ZME A;  3ZQ7 A;  4UNO A;  3T5X A;  1KU2 A;  2KIU A;  4GXO A;  4IJA A;  4G7H F;  3QU3 A;  4B09 A;  2ESN A;  3GW2 A;  3F72 A;  2FOK A;  1J5Y A;  4RGU A;  2RC4 A;  4ESJ A;  2GA2 A;  1I6X A;  4BQA A;  4CYD A;  3WTX C;  4TV7 A;  3GF2 A;  2XAH A;  5DCM B;  3HOS A;  1W7P A;  1HW2 A;  2E7X A;  3HYI A;  3WU1 B;  2ZME B;  4DQ2 A;  2DPU A;  2HWV A;  1D3Y A;  5F64 A;  3L9F A;  2MH2 A;  2R7D A;  2GXG A;  4G7O F;  4EM1 A;  1BC7 C;  3JSP A;  2IP2 A;  3WU0 A;  2STT A;  2D1V A;  2GAU A;  4QWQ A;  1BI1 A;  2M8E A;  1W7P B;  2DLL A;  1DPU A;  1FBU A;  1ON2 A;  2ISZ A;  5HLH A;  1FY7 A;  3EQL F;  2L02 A;  4KA4 A;  5L3E A;  1W5T A;  3BY6 A;  2O03 A;  4I0B A;  2F2E A;  3O2P E;  3HIF A;  4KUM A;  4ZH4 F;  3ULQ B;  2EFQ A;  1DPR A;  2IPQ X;  5FGM A;  2V9V A;  3WTV C;  3RKX A;  3HHG A;  3ROU A;  2ZXJ A;  5DD4 A;  3LQR A;  3NQO A;  5CJ9 A;  3BPX A;  1LJ9 A;  1PUE E;  4MTE A;  3RYP A;  2LF8 A;  5DV5 A;  4BAY A;  3HOT A;  1LDK B;  2PI0 A;  1X3U A;  2Q2E A;  3V8K A;  1QQI A;  4HYE A;  4UVA A;  2BGC A;  3IL2 A;  1FPQ A;  1XDU A;  4KDP A;  4HF2 A;  4A6D A;  3WOD F;  1V3F A;  3T0Y A;  2A69 F;  5HOO A;  3M9A A;  5LHH A;  4M73 A;  3LST A;  2F5F A;  1UHW A;  5H6Q A;  4O6J A;  2DAO A;  2O3F A;  4P9F A;  1W7P D;  2A6H F;  2XAQ A;  2GQQ A;  4L0Z B;  2F5D A;  2GXB A;  4I0A A;  3RPU A;  2VBZ A;  4XSX F;  2E1C A;  2QVO A;  1T6S A;  1TQP A;  4GCV A;  1BOA A;  2FA5 A;  1ZGA A;  4A0Y A;  2K4B A;  1O3S A;  1OYI A;  1ZN2 A;  1GHC A;  3KP3 A;  4MEY F;  4EV0 A;  3ERE D;  2OBP A;  4UVB A;  1G4D A;  1IRG A;  2ZCW A;  1IW7 F;  2M30 A;  1D8J A;  1T38 A;  3M1E A;  3R4K A;  4WXD A;  3MEX A;  2XAS A;  3I0T A;  1UB9 A;  3MZH A;  4WCG A;  4HQM A;  2FU4 A;  3E97 A;  2P7V B;  1Z6T A;  2P6S A;  2ZJ2 A;  3HRM A;  2FNA A;  3O6B B;  1S3J A;  1MD0 A;  2H09 A;  2IJL A;  4UV8 A;  4XBF A;  2R3S A;  3KEO A;  1R1V A;  1T2K A;  4MQV A;  3WTZ A;  1K79 A;  2P6T A;  3OV8 A;  4HQE A;  2EFO A;  1XDS A;  3GO5 A;  3DF8 A;  2RDP A;  3U2R A;  5LLQ A;  1KU9 A;  3BOQ A;  4RGS A;  4KIC A;  4AIK A;  2PN6 A;  1R58 A;  3F3X A;  1XMK A;  3CTA A;  2A07 F;  1YIO A;  1AOY A;  2ZBK A;  1IF1 A;  2H27 A;  3Q9S A;  2FBK A;  4L9V A;  4HDV A;  2ADU A;  5L3G A;  1G3Y A;  1BC8 C;  2F5C A;  3JTH A;  5HS7 A;  1KU7 A;  1I1G A;  3L7W A;  3GWZ A;  1V4R A;  4A6E A;  1ZGJ A;  4BHC A;  2HZT A;  1SAX A;  3IWZ A;  2DO7 A;  3DQV C;  3FWE A;  3GFJ A;  4L0Y B;  3FM5 A;  3RIR A;  4HAM A;  4G94 A;  3WGI A;  1B6A A;  1PP7 U;  3P9I A;  1JGS A;  2JPC A;  1W4M A;  2PBI A;  1ZLJ A;  4Q4Z F;  1K78 A;  5L3C A;  3I59 A;  3I58 A;  3ZMV A;  1XSV A;  1FC3 A;  3V8L A;  4IHS A;  2OZ6 A;  1ZRC A;  4HX4 A;  4KT5 C;  1EH8 A;  3C7J A;  1BBY A;  2VBY A;  4LLN A;  2YX4 A;  1RI7 A;  2V1X A;  4HX8 A;  4RAZ A;  3VOD A;  3EET A;  4AVP A;  1FT9 A;  2VOO A;  1ZH5 A;  4CHU A;  1YS6 A;  3RI4 A;  4JBA A;  3KCC A;  4O5V A;  4N9H A;  5KVR A;  1IRF A;  1HKT A;  4HOB A;  3IWF A;  1K78 B;  4GO1 A;  3I59 B;  4WXC A;  1FNN A;  3P9C A;  2EFP A;  4HV6 A;  1Z6R A;  2Z33 A;  2G7H A;  4Y17 A;  3WGH A;  2QQB A;  3BJ6 A;  4PGH A;  5EEH A;  1RNL A;  5ILU A;  5IT3 A;  2L4M A;  4RB2 C;  3QOP A;  4G8X A;  2GWR A;  3MAJ A;  3MQ0 A;  4F7Z A;  3MCZ A;  5LGN A;  3S2W A;  4M9X A;  3ZMU A;  2BBY A;  4PGG A;  4A0Z A;  1KQ0 A;  4P9U A;  2RN7 A;  3CUO A;  3RYR A;  3WTT C;  1USS A;  2J5P A;  2MLK A;  3WTU C;  3K1M A;  2FXA A;  2YSR A;  4UXN A;  3HTU A;  4OMZ A;  3CO7 C;  4I2O A;  3TOB A;  2OQG A;  5FD5 A;  3M8F A;  4QLC U;  3F21 A;  3ABT A;  5LRS A;  3ZMS A;  3F8F A;  3J7A O;  5H20 A;  2HS5 A;  2OAZ A;  2FQ3 A;  4P55 A;  1OYW A;  1FZP B;  2CQK A;  3I53 A;  4KIF A;  2HEO A;  2RNJ A;  1TNS A;  2XAG A;  4FT8 A;  2EJR A;  2DU9 A;  2NS0 A;  2H6C A;  2MBF A;  4Y15 A;  2XGX A;  5LBQ A;  4P96 A;  3K1P A;  3FMS A;  2QM3 A;  2P5V A;  2K7L A;  1ZG5 A;  2XHK A;  2W85 A;  5BQT A;  2IA2 A;  1IUY A;  4BHB A;  2QEN A;  5ICE A;  4ESF A;  3LQQ A;  5CVU A;  3ZMZ A;  4KIG A;  1IXR C;  1ZYR F;  3FXR A;  4ENJ A;  1IN8 A;  3NRV A;  3LAJ A;  4B8X A;  4ON0 A;  4AD9 A;  2A61 A;  2HKX A;  2VOD A;  1XCV A;  1Q1H A;  1Z9C A;  3ECH A;  1HSJ A;  2GZW A;  2DPD A;  3QPT A;  4ESB A;  4LLL A;  5D5V B;  1G3T A;  4A0X A;  3GZ6 A;  1S29 A;  2Q0O A;  1LEA A;  1MJ9 A;  1B1B A;  2FEZ A;  3ZPL A;  2L54 A;  1SFE A;  3E5X A;  1Y0U A;  4KIB A;  2CYY A;  1RUN A;  2DQL A;  5LEK A;  3B02 A;  1IN4 A;  1SD6 A;  3QPH A;  4EVI A;  2C6Y A;  1R7J A;  3HHH A;  3OOP A;  5LRR A;  2NYX A;  3KP7 A;  2FF4 A;  2PMH A;  2WC2 A;  5E1Z B;  4ZYG A;  4K2E A;  4N0B A;  1K7A A;  2PFB A;  1ON1 A;  5E8G A;  4LFU A;  3TO6 A;  4OMY A;  4HV5 A;  1U2W A;  2DK8 A;  5A2Q Z;  4L9J A;  3WTY C;  3DXJ F;  2VBX A;  4BH9 A;  2EV0 A;  3MZY A;  1J2X A;  4ASN A;  1HQC A;  2EB7 A;  4UVC A;  2K02 A;  2D1H A;  4MTD A;  3WE3 A;  1J0R A;  2D45 A;  3IHU A;  4OIP F;  1BJA A;  1MGT A;  4D0P A;  3P7N A;  3R6S A;  4RB0 A;  1O3R A;  1BM9 A;  1BI0 A;  1OPC A;  1YW7 A;  4G9Y A;  3KP2 A;  2MA3 A;  4HLY A;  3DP7 A;  1R5H A;  2PQ8 A;  1QZY A;  5J8F A;  2M45 A;  2EFW A;  3HTS B;  3WG9 A;  2W84 A;  1B9M A;  1WI9 A;  4EM2 A;  1SMT A;  2WV0 A;  2ZKZ A;  2HR3 A;  2FMY A;  3SHF A;  2HYF A;  1O57 A;  5DUK A;  2YPR A;  5L3D A;  3IKV A;  4A5M A;  1TTY A;  1K6O A;  2YR2 A;  4NQW A;  2OU2 A;  2DQR A;  2R7F A;  1YFH A;  4Z2Y A;  3BJO A;  3E6D A;  3R60 A;  1IXS B;  3KLN A;  1HW1 A;  3I64 A;  3QRF F;  2IRF G;  1LEB A;  3GZ5 A;  3F23 A;  2QQ9 A;  4RB3 C;  2G9W A;  3F8C A;  3KP4 A;  4AIH A;  2JT1 A;  2HKO A;  4G7Z F;  1LB2 A;  4BNC A;  3VFZ A;  2KIF A;  4Q5S F;  4U7D A;  2OD5 A;  4JK1 X;  2HTS A;  1AWC A;  1UCR A;  2BEO A;  2BYV E;  1SFU A;  4M74 A;  5HDN A;  1J9I A;  2H6B A;  2PG4 A;  5LHG A;  4LLG F;  4HF1 A;  1P92 A;  1KA8 A;  1G3S A;  3GEZ A;  4MNU A;  1HST A;  3FXU A;  4CGZ A;  3T1B A;  3W6K B;  2ETH A;  1GXQ A;  1Z1D A;  2VC0 A;  4IXA A;  5JR3 A;  3TDU C;  1R5G A;  2XRO A;  4LB6 B;  2RGV A;  1P6R A;  2JTV A;  1YW9 A;  3N97 A;  5JI6 A;  2GA1 A;  1D5V A;  3K1N A;  3F8N A;  3R0A A;  2JSC A;  1TBX A;  1S7O A;  2VT3 A;  3T8R A;  2CFX A;  1QBJ A;  4PCQ A;  2RQP A;  3FHZ A;  1IN5 A;  3TO9 A;  1IAW A;  1BI3 A;  5CVJ A;  2OZU A;  5D8L B;  5HDK A;  3WGG A;  1P4A A;  1UST A;  3MWM A;  4LGW A;  2HQN A;  5D8K B;  3K9T A;  1H9G A;  3F6O A;  1YYV A;  1MKM A;  2Y75 A;  4A5N A;  1ZG1 A;  3HRT A;  1KYZ A;  1R23 A;  5CVV A;  5HS8 A;  3H3Z A;  4HX7 A;  1UFM A;  2P5K A;  5DEQ A;  2CG4 A;  3ELK A;  3ZN1 A;  4EGY A;  1TNT A;  2K86 A;  1U5T A;  3DFG A;  4OIQ F;  3B73 A;  1FBS A;  2ESH A;  1S7A A;  4S05 A;  1R00 A;  5F1R A;  2Q8K A;  1HBX G;  1YTY A;  3EYI A;  5E20 A;  2FSW A;  2VBW A;  5CVR A;  4NHJ A;  4IRI A;  3EDP A;  5ICF A;  2JPB A;  2XAJ A;  1XCB A;  5ICG A;  5A2Q K;  4M9S A;  4KYW A;  1MJA A;  3F8M A;  4U88 A;  5LEJ A;  2VE8 A;  3F6V A;  3WTS C;  4U0W A;  5HLG A;  2EV6 A;  3M8E A;  1YW8 A;  1G6N A;  2YU3 A;  3RPQ A;  1F9N A;  4MGR A;  1XD7 A;  4WK8 F;  1FSH A;  1U5T B;  1QGP A;  1XMA A;  5FLX K;  1F5T A;  3AAF A;  5D5X B;  4I98 B;  5JVT A;  1A04 A;  2DT5 A;  3COA C;  4EQQ A;  2AXL A;  4EJT A;  4M6X A;  3W6J B;  4ENM A;  3Q5F A;  1O7L A;  4FX4 A;  5L3F A;  5HVQ C;  1J7K A;  2QQA A;  4MEX F;  1SD7 A;  3EYY A;  3ZMT A;  3NEU A;  1GXP A;  4PZJ A;  3QP6 A;  5DYM A;  5LGT A;  3I71 A;  5BMZ A;  5K1Y A;  4M72 A;  5CVI A;  4OIR F;  3V7C A;  1XN7 A;  4U0Y A;  3CDH A;  1KYW A;  4I02 A;  3KZZ A;  2V1U A;  2ZNY A;  2XIG A;  1ZLK A;  2CWE A;  5ERI A;  4U7B A;  2PMU A;  3GX4 X;  1D8K A;  4KNY A;  1LVA A;  2DBB A;  4M6Y A;  1C0W A;  3GFI A;  1ZRE A;  3ISP A;  3BWG A;  3U1D A;  1SD5 A;  4CXF A;  3R0J A;  1I27 A;  2EA2 A;  2XAF A;  5E1X A;  2HYG D;  2Y0M A;  2MLG A;  2IVM A;  1HXD A;  1ZG3 A;  3ML6 A;  2VOP A;  3GFM A;  3L00 A;  2L3D A;  4MHG A;  3VB2 A;  1Z05 A;  1XB4 A;  1RZ4 A;  2XKO A;  2W24 A;  2IA0 A;  2W57 A;  4KFC A;  2IT0 A;  5DDG A;  4KMU X;  3TDZ C;  2LF7 A;  1MJB A;  2TDX A;  3F22 A;  2M1B A;  4GGG A;  2HFH A;  4IRH A;  5D5W B;  2PJP A;  2FE3 A;  2KKO A;  4HBL A;  4Q48 A;  1O3Q A;  2O61 A;  5J6X A;  4FHT A;  1B4A A;  1DUX C;  2LSO A;  4HW0 A;  2A68 F;  2RV8 A;  1ZAO A;  3KLO A;  2HTJ A;  5TJJ A;  1EH6 A;  4EJV A;  3ZMD A;  3CUQ A;  2IA1 A;  2VN2 A;  1XSD A;  5HS9 A;  1T98 A;  1F1Z A;  1T39 A;  4EJO A;  3G73 A;  1EV7 A;  2CW0 F;  1YS7 A;  2XV4 S;  2Z9O A;  3E5Q A;  3TKY A;  5D4S A;  3SZP A;  4A12 A;  2ACJ A;  4A2U A;  4XLN F;  2X0L A;  3DKW A;  3M7G A;  1XGS A;  4I7H A;  1REP C;  4Q47 A;  1IN7 A;  1TQI A;  1SMY F;  3ZP5 A;  3SFZ A;  2O6G E;  4GYG A;  3CUQ B;  1U6G A;  3RKY A;  3LAP A;  3CLO A;  2Y48 A;  5E1W A;  4WWC A;  1CGP A;  1FOK A;  1XGM A;  3LA7 A;  4IRG A;  3SQN A;  3C3W A;  3P9K A;  4BYY A;  4UV9 A;  2LNB A;  1LQ1 A;  3PQJ A;  4MQ9 F;  3REO A;  4H0E A;  1QZZ A;  2KJB A;  3BDD A;  4NB5 A;  5IT9 K;  5H6R A;  4YIF A;  3HSF A;  4YII A;  3V4G A;  4RS8 A;  1BN5 A;  1U5T C;  5J8C A;  4OU0 A;  4EM0 B;  1XGN A;  1U78 A;  3E6C C;  2M5W A;  3D0S A;  1UHM A;  1PP8 F;  2ISY A;  4ZYE A;  4IVN A;  3TO7 A;  4HF0 A;  4ENN A;  4I09 A;  2WWY A;  4KN4 X;  3BJA A;  3FM3 A;  2FBI A;  1KQ8 A;  4M71 A;  3R61 A;  1IZ1 A;  3RKW A;  3IRQ A;  5JHU A;  1J75 A;  2O8X A;  4PDK A;  2RVC A;  5K5O A;  3SXY A;  3PFI A;  4HDU A;  3J81 Z;  5FLX Z;  5CYV A;  5K5R A;  4RAY A;  1P4X A;  2W25 A;  2HOE A;  2EK5 A;  2Z99 A;  1ODD A;  1KGS A;  5BS6 A;  3KP6 A;  3F8B A;  3V7R A;  1OYY A;  1B9N A;  3JW4 A;  1S6L A;  4RB1 A;  3E3V A;  4YFN F;  3JSO A;  2QUF A;  1XSX A;  2GIV A;  4L9N A;  3C1D A;  5DCF A;  3Q9V A;  1ZAR A;  1RUO A;  2EWN A;  2G7U A;  2EV5 A;  1FP1 D;  3L09 A;  2OA4 A;  3C18 A;  5D5U B;  2VON A;  2VE9 A;  1OR7 A;  3ABU A;  2MC3 A;  3DV8 A;  4LK1 F;  2JRT A;  1R22 A;  3KFW X;  2QBY A;  3GFL A;  2HGC A;  2FBH A;  3LA3 A;  4DNC A;  5ICC A;  5HDG A;  3RTR A;  4L5J A;  2QZ8 A;  4YFX F;  1TW2 A;  2PEX A;  2BV6 A;  3QU6 A;  2ZO4 A;  4CZZ A;  2B0L A;  6PAX A;  1GVJ A;  5E18 F;  1O3T A;  4S04 A;  1IN6 A;  2P8T A;  4U0V A;  3V7S A;  5D4R A;  2J5O A;  3SZT A;  4EJW A;  3JAM Z;  2DI3 A;  4LD5 A;  3HSE A;  2DW4 A;  3TGN A;  5HLI A;  2Z5U A;  2XRN A;  3BRO A;  2COM A;  2FRH A;  2QBY B;  2F5E A;  1U8R A;  2NAZ A;  3BPV A;  3I54 A;  3KE2 A;  2XUB A;  3KEQ A;  4R8H A;  4XRF A;  1KU3 A;  3DPT A;  2KJC A;  2BE5 F;  2XKP A;  3FMR A;  5FB2 A;  1W5S A;  2L01 A;  2A6E F;  1VTN C;  3TQN A;  3DEU A;  2HDC A;  1MDM A;  3J80 K;  2JZY A;  4ZYD A;  3U9G A;  4G6D A;  4HLX A;  1QPM A;  3GVA A;  5FFX A;  4LB5 A;  5ED4 A;  1ZRF A;  1ONV A;  4AWX B;  1E17 A;  3CUQ C;  2YX7 A;  3FZV A;  1L0O C;  4BXU A;  3I4P A;  4OOI A;  5D6F A;  4EJU A;  4HZF A;  3N4M A;  2NNY A;  4KN7 X;  4UHT A;  2O0Y A;  4P5O A;  1TQM A;  3E5U A;  5FD6 A;  1FYL A;  3V8J A;  3LFK A;  2P7C B;  3FX3 A;  3PQK A;  1J59 A;  1LNW A;  1MDM B;  1E2X A;  3FF5 A;  3RDI A;  3VEP A;  3WTW C;  5E8I A;  5F6F A;  4R1H A;  2VXZ A;  3O3K A;  5DUI A;  1P2F A;  1T0F A;  2UXX A;  2OQR A;  3DPL C;  1FP2 A;  3JTG A;  5TRD A;  1P4W A;  3FXQ A;  1ZRD A;  2A5Y B;  3QAH A;  5DD8 A;  1H0M A;  4ZZL A;  1U3E M;  5AON A;  2WTE A;  2V79 A;  3LWF A;  4E70 A;  1Z7U A;  4LG0 A;  1JHF A;  2Z3Y A;  2D2W A;  5E17 F;  3K2Z A;  5BOX A;  2K4J A;  3LA2 A;  1LDJ A;  1WQ2 A;  5IT9 Z;  5LGU A;  1I1S A;  3ECO A;  1HKQ A;  5JFR A;  4HA8 A;  4AIJ A;  1HW5 A;  2AS5 F;  3IRR A;  3HSR A; 
#chains in the Genus database with same CATH topology
 1FWZ A;  3GUD A;  3LSI A;  1MMA A;  1O7F A;  4Y3O A;  4ENK A;  5L3B A;  4ZYH A;  4AYB N;  2R7S A;  3GTL J;  5EEG A;  3GLX A;  3WU2 C;  1K61 A;  2NOG A;  1LDD A;  3CF5 F;  1ETK A;  3P5J A;  1DU0 A;  1YQA A;  2RAE A;  1WJD A;  2GOX B;  1N25 A;  4BAC A;  1CF7 A;  2ELH A;  2VKH A;  3HXL A;  1BW5 A;  2CRG A;  2R7Q A;  4LG0 B;  2BHZ A;  2M7A A;  2P4W A;  3HKZ N;  2L7Z A;  2Z16 A;  1BI2 A;  3D5L A;  1HC8 A;  1FBQ A;  1MBJ A;  5ILS A;  3UKG A;  2KRC A;  3UNG C;  3DU6 A;  2CQX A;  4GRI A;  1Y6I A;  2DOE A;  2HDW A;  5KK1 A;  1YO5 C;  1FTZ A;  1LUJ B;  2DA3 A;  1IRX A;  3J81 K;  2DXI A;  1Z91 A;  2CV0 A;  5FFZ A;  4EEF G;  2IS6 A;  3K0L A;  1FIA A;  1BIA A;  1IXC A;  5AIP A;  3RQ4 A;  1DGW Y;  2EIJ H;  4IEJ A;  3VOE A;  2KRF A;  1I5Z A;  3PNT A;  3HUG A;  1SFX A;  1ULY A;  2ZFW A;  3HB9 A;  3SFI A;  4M3E A;  4DOZ A;  2QLZ A;  1H89 C;  4G6Q A;  1MZB A;  3BZC A;  2VUM J;  3A0H C;  2AHQ A;  4DIQ A;  1D0X A;  1OCT C;  1H9T A;  2DA1 A;  3MVP A;  3LFU A;  3PNY A;  1FX7 A;  1XMX A;  2K27 A;  1RIO H;  1POG A;  1QNT A;  4A3C J;  2EA4 A;  4CUG A;  5GAH J;  2JA5 J;  4RGX A;  4O3M A;  4OIO F;  1OCC H;  3KET A;  4KMF A;  2AO9 A;  4EGZ A;  2CO5 A;  1CF7 B;  1JE8 A;  1FMW A;  1PDN C;  2V6C A;  3L2C A;  3S1R J;  4PUS A;  1WWX A;  3QP5 A;  2HQR A;  3CCE I;  3CCQ I;  3B6C A;  4D1Q A;  5ILV A;  5CLS A;  1T95 A;  3GYH X;  4CDG A;  4GYI A;  5BPD A;  1T08 B;  4IPA A;  3JRA A;  1IV6 A;  3KZY A;  2FNP A;  3EUH A;  1LVK A;  1XS9 A;  1DP7 P;  2WA0 A;  2H94 A;  1B59 A;  1JUP A;  2DOD A;  3QWL A;  2PLY A;  3I5U A;  4XSZ F;  3AG4 H;  4XN3 A;  1FIP A;  1JJ8 C;  4DGW B;  4BHP A;  3E6M A;  4BY7 J;  5LD2 C;  2UXN A;  3BG5 A;  5FLM J;  1ZHF A;  3H92 A;  3NAR A;  3HUG B;  1BIB A;  2XF7 A;  4L5I A;  3TBI A;  2R7R A;  4L5E A;  1A35 A;  5LHI A;  4YG2 F;  1U9O A;  1FOY A;  2X1E A;  3E0J B;  3JRI A;  1SD4 A;  3WE2 A;  3OYI A;  1JKO C;  4I01 A;  2KFD A;  3BP8 A;  1VQK I;  3FMQ A;  3G3Z A;  2OTJ I;  2VT2 A;  3OMY A;  1SAU A;  3E6B A;  1JHH A;  2LDU A;  3CJN A;  4FX0 A;  1F43 A;  2LLK A;  2DTR A;  4E7Z A;  3ZN0 A;  2DMP A;  2STW A;  3WG7 H;  3JCU C;  1FYM A;  2ZSH B;  4D5C A;  4IF4 A;  5BPI A;  1S5L C;  4WF2 A;  3MFK A;  1WRJ A;  3CP2 A;  2RKH A;  4Y13 A;  3IC7 A;  2A3S A;  1W36 C;  3JAM K;  2JSP A;  1G3W A;  4M9Z A;  1S8N A;  4U87 A;  3K69 A;  4BL0 B;  1L3L A;  3I3L A;  4MLO A;  4NNJ A;  4LOC A;  1YLF A;  4CSW A;  1TC3 C;  2CGP A;  2VJI A;  4XLP F;  1WKM A;  2NOJ B;  3T8T A;  2HXO A;  1A31 A;  2VC1 A;  2CSO A;  2IGN A;  4XOT A;  3HOY J;  4UUV A;  2UZK A;  1MMG A;  3W3C A;  1DDN A;  1TT5 B;  3S93 A;  4EMS A;  2QWW A;  4OIN F;  1WHU A;  3X2Q H;  3K4C A;  4A3B J;  2UWM A;  5AIQ A;  4A69 C;  2PJR B;  1JXS A;  2EZK A;  2LYC A;  5FO5 A;  2LKP A;  4XK4 A;  2X4H A;  1AKH A;  1MBK A;  1OIS A;  4ANJ A;  4A3M J;  3KP5 A;  3TOA A;  1FLI A;  3HEF A;  2XVC A;  1X3W B;  4KJZ A;  4AC0 A;  1QO0 D;  3LSK A;  3CC2 I;  4YFK F;  2MD5 A;  2YS9 A;  4RAF A;  3W6V A;  3DTK A;  3RJP A;  3J80 Z;  4CO8 A;  3S1N J;  2NRA C;  2BW3 A;  2NNN A;  5JLW A;  1EH7 A;  1TLH B;  5K5Q A;  3H3U A;  3IKT A;  4A3J J;  2CU7 A;  3IAM 2;  4PJN A;  3CO6 C;  1WH7 A;  1R1U A;  1OKR A;  3BTC A;  1STZ A;  2R7T A;  4JX5 A;  2DK5 A;  3HGY A;  3HOZ J;  1NHA A;  5J4Y A;  1XG1 A;  1F36 A;  5J47 A;  2DFI A;  2KIM A;  1YG2 A;  3S3O A;  3A02 A;  1F4K A;  1HA8 A;  3J7Z I;  1TW3 A;  3BZ6 A;  3TMO A;  1AHD P;  4ZZD A;  1OMI A;  2IW5 A;  5JLX A;  4LJZ F;  1GVD A;  4L9T A;  4RGR A;  2MH9 A;  2K9N A;  2EZL A;  2HOS A;  1HKS A;  2H8R A;  2QF7 A;  3GLL A;  5D6E A;  4WXH A;  1TWA J;  2QKM B;  3KZI C;  1NG6 A;  2DDB A;  1WSU A;  3IH3 A;  2DFE A;  4WX9 A;  4LMY A;  4M3D A;  2DFH A;  2V1D A;  3GXO A;  3BR5 A;  3K2A A;  2VL8 A;  5B5E C;  5FRO A;  2DMN A;  1GDT A;  2DA7 A;  4ZDO A;  2BW3 B;  3DLL F;  4G12 A;  1R36 A;  2QYO A;  5F1J A;  2EFN A;  4FTH A;  2BXY A;  4JQF A;  3JR9 A;  1EKE A;  1WH5 A;  2M87 A;  4L18 B;  1Z67 A;  4BU2 A;  3CME I;  4R79 A;  1R1T A;  4BUP A;  2E7W A;  5HNF A;  3HRU A;  1FSE A;  1UJ8 A;  3IH2 A;  2P5L C;  4IHT A;  4ETS A;  2LVS A;  5M5Y J;  4CIC A;  1KQ9 A;  3HRS A;  4BQN A;  3VYU B;  2M0C A;  5DCM A;  2E1N A;  1P7J A;  3OSG A;  4LK0 F;  2N8G A;  2ZNZ A;  1FYK A;  1XGO A;  2XGD A;  4Y33 A;  1ZGW A;  4N9I A;  2FML A;  2K85 A;  2ID3 A;  4Y7N J;  1U0J A;  2E2I J;  3J7Y J;  2L4A A;  2ZME A;  3ZQ7 A;  3OYL A;  4UNO A;  2ZXW H;  1KU2 A;  2KIU A;  4GXO A;  4IJA A;  3CDL A;  4XLA A;  3T5X A;  3QQA A;  5K7Z A;  4BDZ A;  4G7H F;  2NVQ J;  2V26 A;  3ZQG A;  3QU3 A;  4XON A;  4B09 A;  3H3V K;  1WCM J;  4ZDL A;  1ETW A;  3BG3 A;  2ESN A;  4QIW N;  3PL8 A;  3GW2 A;  3F72 A;  2JUC A;  3HGG A;  3HDD A;  4F91 B;  2Y9Y A;  2FOK A;  1MMN A;  2FQ4 A;  2XRL A;  3RQI A;  3AG3 H;  1J5Y A;  1O4X A;  3CCJ I;  4RGU A;  3G4S I;  2RRE A;  2RC4 A;  5H2F C;  4ESJ A;  2GA2 A;  1I6X A;  4DJA A;  1X4O A;  4BQA A;  4JP0 A;  1HOM A;  2M9H A;  4CYD A;  2EIN H;  3WTX C;  3KYC B;  4TV7 A;  3GF2 A;  2ELJ A;  2XAH A;  5DCM B;  3HOS A;  3SDB A;  1W7P A;  1VFC A;  1D5Y A;  4XKC A;  1HW2 A;  2E7X A;  3HYI A;  3WU1 B;  2ZME B;  4DQ2 A;  1SEU A;  2DPU A;  4XLC A;  2LY2 A;  1UEL B;  2HWV A;  5F08 A;  2MGQ A;  2WAE A;  2X6Y A;  1D3Y A;  1HDP A;  5F64 A;  3I55 I;  3FBI B;  1EF4 A;  3K4K A;  3L9F A;  2MH2 A;  2R7D A;  2GXG A;  4JX6 A;  4G7O F;  3PIP F;  2HXI A;  2HOA A;  4EM1 A;  1BC7 C;  3JSP A;  2IP2 A;  3FBN B;  1OQY A;  3WU0 A;  2STT A;  4BY1 J;  2M4K A;  3QYB A;  4XLH A;  3MMY B;  1NK2 P;  1XPX A;  3LSH A;  2D1V A;  2GAU A;  5M5X J;  4AUX A;  1SFK A;  2XGC A;  3OL4 A;  2LP0 A;  2DMT A;  4QWQ A;  3HG9 A;  1BI1 A;  2K3P A;  2M8E A;  3SDG A;  2KLO A;  1W7P B;  2DLL A;  2ZJQ F;  1DPU A;  1FBU A;  1ON2 A;  1BA5 A;  2ISZ A;  5HLH A;  2LK2 A;  1FY7 A;  3EQL F;  2L02 A;  5KAI C;  4CZC A;  2E60 A;  4KA4 A;  5L3E A;  5K7F A;  3DBR B;  1W5T A;  3OIP A;  1TL8 A;  2BY1 A;  4YEJ A;  3ASO H;  3BY6 A;  1PJR A;  2O03 A;  2Q1Z B;  4I0B A;  4QPQ A;  2M7B A;  3EUH C;  2F2E A;  3O2P E;  3HIF A;  1VQ4 I;  4KUM A;  4ZH4 F;  3ULQ B;  2EFQ A;  1DPR A;  3ABM H;  2IPQ X;  3BTI A;  3ZR8 X;  1VQM I;  5FGM A;  2V9V A;  4HNT A;  3WTV C;  2QCO A;  4CA0 A;  3RKX A;  2WAQ A;  3HHG A;  2ZXJ A;  3ROU A;  1OCZ H;  1MBE A;  5DD4 A;  3CC7 I;  3LQR A;  1TT0 A;  3NQO A;  5CJ9 A;  1GUU A;  3BPX A;  1LJ9 A;  5FKN A;  2V6E A;  1VQ7 I;  1PUE E;  2OJE D;  2FUG 2;  4MTE A;  3RYP A;  2CV1 A;  2LF8 A;  5DV5 A;  4BAY A;  2E35 A;  2KT0 A;  3DLA A;  3HOT A;  1LDK B;  2GLO A;  4FQG A;  1K4S A;  5IP9 J;  3LSG A;  2Y0S A;  2PI0 A;  1X3U A;  2Q2E A;  2LTP A;  4IHY A;  2KRH A;  2X51 A;  3V8K A;  1QQI A;  4HYE A;  1U9N A;  2BHY A;  4UVA A;  3JRD A;  1SVL A;  1AA7 A;  2BGC A;  3IL2 A;  1YIJ I;  1FPQ A;  1OCR H;  1XDU A;  4BJT A;  5CKT A;  1RR8 C;  3L1P A;  2HNH A;  4KDP A;  2R7O A;  4ZTF A;  4HF2 A;  4CH7 A;  4A6D A;  3WOD F;  1V3F A;  4BQQ A;  3T0Y A;  2A69 F;  5HOO A;  3M9A A;  1V5F A;  1B72 A;  5LHH A;  2P0W A;  4M73 A;  3LST A;  1VQ5 I;  2F5F A;  1UHW A;  5H6Q A;  2GM4 A;  2QSF X;  2RNG A;  4O6J A;  5E3N A;  2DAO A;  1QVT A;  5EEA A;  2O3F A;  4ZJZ A;  4P9F A;  1W7P D;  3TP3 A;  2A6H F;  1T56 A;  3OS1 A;  3KYD B;  4LIU A;  2Y2Z A;  2XAQ A;  2A6T A;  2GQQ A;  4L0Z B;  2HVR A;  5EYR A;  2F5D A;  2GXB A;  4I0A A;  2Q2E B;  2O7O A;  2VBZ A;  3RPU A;  4XSX F;  2E1C A;  2CUE A;  2QVO A;  1T6S A;  1TQP A;  4V2G A;  1TWC J;  3DTE A;  5GTI C;  1R4N B;  4GCV A;  1BOA A;  2FA5 A;  3TP0 A;  1ZGA A;  4A0Y A;  2K4B A;  1O3S A;  4CCL A;  1OYI A;  4XNF A;  1ZN2 A;  5J3L A;  2NVX J;  1GHC A;  3KP3 A;  4MEY F;  4EV0 A;  2LY9 A;  2R7X A;  1BR4 A;  3ERE D;  5KCM A;  2OBP A;  1V55 H;  4UVB A;  3H9G A;  1G4D A;  1IRG A;  2ZCW A;  4RLQ A;  3A2K A;  1IW7 F;  5FJ8 J;  2M30 A;  4IHX A;  5DM7 F;  2Z1D A;  2V7F A;  1JGG A;  1T38 A;  1D8J A;  3M1E A;  2LMD A;  3R4K A;  4WXD A;  1B72 B;  3MEX A;  2XAS A;  3I0T A;  4MFD A;  3B6A A;  2CUF A;  1UB9 A;  3MZH A;  2YU9 J;  4WCG A;  4HQM A;  4ZDP A;  2FU4 A;  3HJE A;  3E97 A;  4OWR B;  2P7V B;  1ZR2 A;  1Z6T A;  1X1P A;  2P6S A;  2F48 A;  2ZJ2 A;  3DTI A;  1FMV A;  3D1N I;  3HRM A;  3LSR A;  1Z0X A;  2FNA A;  3O6B B;  4W1U A;  4E7H A;  1FOX A;  2WB1 N;  1IO2 A;  1S3J A;  1MD0 A;  2H09 A;  2IJL A;  4UV8 A;  4XBF A;  2R3S A;  3KEO A;  1R1V A;  3HBL A;  1ZK8 A;  1R5I D;  1Q1V A;  4BDY A;  2KMU A;  1I39 A;  1T2K A;  4B1R A;  2LD5 A;  4MQV A;  3WTZ A;  2D5V A;  1K79 A;  5J40 A;  4PFP A;  3CDI A;  2P6T A;  3CLQ A;  3OV8 A;  4A3K J;  2JA2 A;  4HQE A;  3JRH A;  2EFO A;  4BJ5 C;  3CJQ B;  1EA3 A;  1XDS A;  3EUK L;  3S3M A;  2ZJR F;  3GO5 A;  3DF8 A;  5DS9 A;  2RDP A;  3U2R A;  5LLQ A;  1KU9 A;  1GV2 A;  3K6G A;  3BOQ A;  2KZG A;  4RGS A;  3HOX J;  4KIC A;  4AIK A;  2PN6 A;  3ZQF A;  2ZXI A;  1W36 D;  1R58 A;  2PMZ A;  3F3X A;  1XMK A;  3CTA A;  5F04 A;  2A07 F;  1YIO A;  2ICW G;  3OIO A;  1AOY A;  1TWG J;  2EIM H;  3K70 D;  4ZC3 A;  2ZBK A;  3CMM A;  2V4J C;  2ZME C;  1IF1 A;  2H27 A;  3Q9S A;  1QHG A;  2FBK A;  5DM6 F;  3CZ6 A;  4M3G A;  4L9V A;  5B1B H;  3TW7 A;  4HDV A;  3GCM A;  2ADU A;  1NTC A;  3FXK A;  5L3G A;  3QYF A;  1OLT A;  1G3Y A;  1JKQ C;  1BC8 C;  3I4M J;  4PFO A;  3I9V 2;  1P7I A;  2VJ4 A;  2JVG A;  2F5C A;  3IH4 A;  3JTH A;  4PJM A;  5HS7 A;  2VIX A;  4FET A;  4DYC A;  1KU7 A;  3CCL I;  1I1G A;  3L7W A;  3GWZ A;  3OY9 A;  1V4R A;  3FXL A;  4A6E A;  1ZGJ A;  2R7V A;  4BHC A;  5HOD A;  3ZQC A;  3OYG A;  2HZT A;  1SAX A;  3IWZ A;  2LBF A;  2DO7 A;  2W4S A;  3DQV C;  3FWE A;  3GFJ A;  4L0Y B;  3FM5 A;  5IP7 J;  3RIR A;  4HAM A;  3KYL A;  2KZV A;  4G94 A;  3WGI A;  1B6A A;  1PP7 U;  1IJW C;  3P9I A;  4XLE A;  4BBR J;  1JGS A;  2ECB A;  1JT6 A;  4FIS A;  2JPC A;  2QKL B;  1W4M A;  1ZEL A;  2PBI A;  3S8P A;  4J01 A;  4AYB A;  2KPM A;  1ZLJ A;  5F0H A;  1WJB A;  2CUJ A;  4Q4Z F;  1K78 A;  4S0H B;  3H9J A;  5L3C A;  3F0C A;  3I59 A;  3I58 A;  3ZMV A;  3H0D A;  1IG7 A;  3RPU D;  1XSV A;  1FC3 A;  3V8L A;  4IHS A;  2L7M P;  2OZ6 A;  1R49 A;  5GAG J;  1IV8 A;  4XM3 A;  1ZRC A;  4HX4 A;  2HPI A;  4JOM A;  4KT5 C;  4XKB A;  3AKZ A;  1EH8 A;  3C7J A;  4GFB A;  2NVY J;  3HKZ A;  4V19 K;  1BBY A;  5LFA A;  2L2O A;  2VBY A;  3CQZ J;  3FIW A;  4H4K C;  1RES A;  3L2Q A;  1ITY A;  3S17 J;  4LLN A;  2YX4 A;  1RI7 A;  1VQ9 I;  1D1A A;  2V1X A;  4NDL A;  4W97 A;  3HOW J;  4HX8 A;  4RAZ A;  5B3S H;  3VOD A;  4AU7 A;  3EET A;  4AVP A;  1FT9 A;  1N75 A;  3G71 I;  2VQG A;  2VOO A;  2LBF B;  1ZH5 A;  2DT7 B;  2R93 J;  4CHU A;  1V5E A;  4HEA 2;  1YS6 A;  3RI4 A;  4JBA A;  3KCC A;  5EJC A;  3OYB A;  2LKS A;  4O5V A;  2ZB9 A;  2BXZ A;  2IS4 A;  4N9H A;  1S7E A;  5KVR A;  2IXS A;  1IRF A;  2XF6 A;  1HKT A;  4DZJ A;  3SZG A;  4HOB A;  2HU9 A;  1TP4 A;  3IWF A;  2GOM A;  1K78 B;  4GO1 A;  3Q3S A;  2EPF A;  3I59 B;  1UG2 A;  4WXC A;  1FNN A;  2LH9 A;  3BR1 A;  3P9C A;  2B7E A;  2EFP A;  2XF5 A;  4HV6 A;  3LNQ A;  1Z6R A;  2VKD A;  2Z33 A;  5FRM A;  2G7H A;  3FXM A;  4Y17 A;  5IY5 H;  3OOU A;  3WGH A;  3FDY A;  2QQB A;  4A3G J;  4NBQ A;  3BJ6 A;  4PGH A;  3HPH A;  1QVU A;  5EEH A;  2IEK A;  1LPQ A;  2K9Q A;  4XLF A;  1HF0 A;  1OCP A;  3TED A;  1RNL A;  2LG4 A;  3C2G A;  5ILU A;  2R5Y A;  2JA6 J;  5IT3 A;  4X1E A;  1TWH J;  2L4M A;  1Z21 A;  3CJT B;  1MSF C;  4XMY A;  4RB2 C;  3QOP A;  4X6A J;  3HM5 A;  4CCM A;  4BXF A;  1WZ2 A;  4XKW A;  3ONQ A;  4XQF A;  4G8X A;  2GWR A;  3LL7 A;  4GDF A;  5IYC J;  3MAJ A;  2L9V A;  3MQ0 A;  4F7Z A;  1N77 A;  3MKZ A;  2DDA A;  1H88 C;  1RPW A;  3BR6 A;  3MCZ A;  3PO2 J;  2I10 A;  1Z3Y A;  3S2W A;  5LGN A;  2R0Q C;  3BCA A;  4QSH A;  4M9X A;  3ZMU A;  5IOY A;  1JT0 A;  3S32 A;  2BBY A;  4PGG A;  4A0Z A;  5GAD J;  1KQ0 A;  3KX2 A;  1ETV A;  4P9U A;  2RN7 A;  3AFH A;  3CUO A;  3VYR B;  4IOC F;  2WBM A;  3RYR A;  3K70 C;  2E1M B;  4XR6 A;  3WTT C;  3EUA A;  1USS A;  2J5P A;  2MLK A;  3GTM J;  3WTU C;  3K1M A;  2FXA A;  3PFY A;  2F4O B;  3GTK J;  3DEE A;  3BT9 A;  2XPV A;  2YSR A;  1WI3 A;  5GAE J;  5C3E J;  3ABL H;  4UXN A;  3HTU A;  1GLN A;  1X1B A;  1RRJ A;  4OMZ A;  4ZTJ A;  3CO7 C;  2R5Y B;  3TOB A;  4I2O A;  2P81 A;  2OQG A;  2UV1 A;  5FD5 A;  3M8F A;  1I50 J;  4QLC U;  3F21 A;  3CCM I;  3ABT A;  5LRS A;  3VPR A;  3ZMS A;  1XC5 A;  3F8F A;  3J7A O;  1PUF A;  5H20 A;  2HS5 A;  2OAZ A;  2FQ3 A;  4P55 A;  1OYW A;  3IV5 A;  1FZP B;  2CQK A;  2JRM A;  4EAT A;  2MFZ A;  3I53 A;  4KIF A;  3DEW A;  4ITV A;  2HEO A;  2RNJ A;  5F0C A;  1TNS A;  2XAG A;  2FOW A;  4FT8 A;  2L7F P;  2W7N A;  2EJR A;  5JHF A;  3D5R C;  2DU9 A;  2NS0 A;  1E3O C;  2H6C A;  2MBF A;  2OPT A;  2OF7 A;  4Y15 A;  2VJJ A;  4D7N A;  3HOU J;  2XGX A;  5LBQ A;  4P96 A;  3K1P A;  3FMS A;  2QM3 A;  1B8I A;  3ZQL A;  3GTJ J;  2P5V A;  2K7L A;  3K7A J;  2M8G X;  2JWT A;  1ZG5 A;  3CJR B;  3QPS A;  2XHK A;  2W85 A;  3RZD J;  1D0Z A;  5BQT A;  2IA2 A;  1R9T J;  1IUY A;  3V42 A;  4AID A;  1D1C A;  4A3L J;  1AKH B;  2F4M B;  4BHB A;  2AQF A;  2QEN A;  5ICE A;  2HQ5 A;  1YHQ I;  3CCS I;  4UB6 C;  2JA7 J;  4ESF A;  3LQQ A;  3PUF A;  1PUF B;  5CVU A;  3ZMZ A;  3OYH A;  4CYC A;  3S2D J;  4KIG A;  2B9S A;  1IXR C;  1ZYR F;  3FXR A;  1MMD A;  3LSM A;  3NWS A;  4RMN A;  5FKO A;  3E1S A;  3UR3 C;  4ENJ A;  3M4O J;  1G8X A;  1IN8 A;  3NRV A;  3LAJ A;  4B3A A;  2F5V A;  4B8X A;  1W0T A;  3MZ8 A;  4ON0 A;  2VPR A;  5HLT A;  4AD9 A;  5M3F J;  3OYD A;  2A61 A;  1WJF A;  4Y52 J;  2XPW A;  2HKX A;  2L9N A;  2VOD A;  2X48 A;  1XCV A;  1LFB A;  1Q1H A;  1Z9C A;  3G1M A;  1B8I B;  3ECH A;  1HSJ A;  2KHM A;  1A6I A;  4P1W A;  4HRI A;  2GZW A;  2OUM A;  2DPD A;  1WJE A;  3QPT A;  1SAN A;  3D5S C;  3HOV J;  4ESB A;  4LLL A;  5D5V B;  1G3T A;  4A0X A;  3GZ6 A;  1S29 A;  2Q0O A;  1LEA A;  2L5Q A;  1ETY A;  4IL6 C;  1MJ9 A;  1E3H A;  4XL9 A;  4CYC B;  2TCT A;  1B1B A;  4LIV A;  2FEZ A;  2Y30 A;  3ZPL A;  2L54 A;  1SFE A;  3CCR I;  1YRN A;  3E5X A;  1Y0U A;  1BR2 A;  4KIB A;  2CYY A;  1RUN A;  2GXA A;  1WGX A;  5E3M A;  4XIC A;  2DQL A;  4PJL A;  5LEK A;  5J1U A;  2M34 A;  2WAF A;  5C44 J;  3B02 A;  3VYS B;  1IN4 A;  3A1Y A;  1SD6 A;  1YX5 A;  3CF2 A;  3QPH A;  2VJ5 A;  4EVI A;  2C6Y A;  1WJC A;  1R7J A;  3HHH A;  3OOP A;  5LRR A;  2K3F A;  4NC8 A;  2NYX A;  3KP7 A;  1KON A;  5EZG A;  1FJL A;  2FF4 A;  4V2F A;  2PMH A;  2WC2 A;  5E1Z B;  4ZYG A;  2IBD A;  2E34 A;  4K2E A;  5F27 A;  4N0B A;  1K7A A;  2PFB A;  2WV1 A;  4C3H J;  1OFC X;  2GBY A;  1ON1 A;  2WAD A;  5E8G A;  4LFU A;  4XRS G;  3TO6 A;  4OMY A;  4HV5 A;  3JRB A;  1Y8R B;  1HCR A;  1U2W A;  1UHS A;  2DK8 A;  2VQC A;  4L9J A;  5A2Q Z;  2KQR A;  3WTY C;  2TRT A;  3DXJ F;  2VBX A;  4E7J A;  4BH9 A;  4C3I J;  3PIO F;  2EV0 A;  3MZY A;  1J2X A;  2ME0 A;  2ID6 A;  1X2M A;  4ASN A;  3IAS 2;  1WPK A;  1HQC A;  2EB7 A;  4UVC A;  2K02 A;  1Y8Q B;  3CCV I;  2QEX I;  2D1H A;  4MTD A;  3WE3 A;  5EDN A;  4BGD A;  3ABK H;  2O8K A;  4YIR X;  4HG2 A;  2LR8 A;  1J0R A;  2D45 A;  3IHU A;  4IKF A;  1MIJ A;  2JK3 A;  4OIP F;  1BJA A;  1MGT A;  4D0P A;  3P7N A;  1BR1 A;  2HI3 A;  4RAG A;  4MIM A;  2MYS A;  2EH3 A;  3R6S A;  5B66 C;  1VQL I;  1G59 A;  2MG4 A;  4RB0 A;  1O3R A;  1BM9 A;  1RKW A;  4JX4 A;  4D7M A;  2X85 A;  1BI0 A;  3RCO A;  1OPC A;  4IOA F;  1YW7 A;  4G9Y A;  3KP2 A;  1JI8 A;  1QHH D;  3QOE A;  5C4X J;  1MW7 A;  5TIS C;  2EQR A;  2MA3 A;  3PM1 A;  4HLY A;  3DP7 A;  1R5H A;  2PQ8 A;  1QZY A;  5J8F A;  4RM3 A;  2IS1 A;  2M45 A;  1BJZ A;  2EFW A;  2OC6 A;  2IGM A;  1YI2 I;  3HTS B;  3WG9 A;  2W84 A;  1B9M A;  4A3D J;  2WAQ N;  3K4B A;  2VQH A;  4KIT B;  3MKY B;  3OIQ A;  1WI9 A;  4QPO A;  4EM2 A;  2X9D A;  2Y31 A;  1SMT A;  3K4N A;  2E1M C;  1MBH A;  3I4N J;  2WV0 A;  1FEX A;  2ZKZ A;  3RKQ A;  2HR3 A;  2FMY A;  3SHF A;  3OYK A;  2HYF A;  1O57 A;  4DW6 A;  1X4P A;  5DUK A;  1V5G A;  4HNU A;  4JYK A;  1VQ8 I;  1T8I A;  2KP6 A;  2YPR A;  4PSW A;  2Y0S N;  4OAZ A;  5L3D A;  3IKV A;  4A5M A;  1TTY A;  1K6O A;  2YR2 A;  5F0F A;  4F92 B;  4NQW A;  2OU2 A;  1VND A;  2DQR A;  2R7F A;  2O9L A;  4UB8 C;  1YFH A;  4Z2Y A;  1IGN A;  5KHD A;  3BJO A;  3OL3 A;  1R6R A;  3E6D A;  4DZP A;  3R60 A;  1LKX A;  2DT6 A;  4I76 A;  2UUZ A;  1IXS B;  3KLN A;  1HW1 A;  2COB A;  3I64 A;  3QRF F;  2IRF G;  1RET A;  3FIS A;  3GZ5 A;  2JA8 J;  3F23 A;  1LEB A;  1FTT A;  3MKL A;  2QQ9 A;  2CW8 A;  4PJJ A;  1VZ0 A;  4RB3 C;  4XID A;  1X1A A;  2G9W A;  2L9R A;  3F8C A;  4HNV A;  3KP4 A;  4AIH A;  2JT1 A;  4B47 A;  4CCN A;  5M3M J;  2HKO A;  4IQ4 A;  1YJW I;  3FHN A;  3S3N A;  2OV7 A;  2VKV A;  1SVM A;  2XPU A;  4G7Z F;  1MMS A;  1ZKG A;  1LB2 A;  3VFZ A;  4BNC A;  2KIF A;  4YEL A;  4Q5S F;  4I6Z A;  5FRN A;  4U7D A;  2OD5 A;  4JK1 X;  3LMM A;  2HTS A;  4D5F A;  5B1A H;  3BR0 A;  4AM3 A;  4PK4 A;  1AWC A;  1UCR A;  2BEO A;  2EIK H;  2BYV E;  4NQW B;  1SFU A;  4M74 A;  5C4J J;  5HDN A;  2HZD A;  5J4V A;  1J9I A;  5TGT A;  2H6B A;  2PG4 A;  5LHG A;  4LLG F;  4HF1 A;  2NXN B;  3LSP A;  2X1C A;  1P92 A;  4RA2 A;  1KA8 A;  3GBG A;  1G3S A;  3VYT B;  1G2H A;  2IAI A;  3GEZ A;  4MNU A;  1MBF A;  1HST A;  4CCK A;  3ASN H;  3FXU A;  3K4J A;  3TL4 X;  3OSF A;  4CGZ A;  3HZJ A;  1BOB A;  3T1B A;  3W6K B;  5IYD J;  1DU6 A;  2CUZ A;  2ETH A;  3TW6 A;  5CQG A;  1GXQ A;  2NS8 A;  4E4H A;  1Z1D A;  2VC0 A;  4IXA A;  5JR3 A;  2BY3 A;  3CES A;  1R5G A;  3TDU C;  2XRO A;  4LB6 B;  3OYJ A;  1X1C A;  2M3A A;  2RGV A;  2K9S A;  1HDD C;  1JTX A;  4M3B A;  4BXX J;  1OCO H;  1P6R A;  2JTV A;  1YW9 A;  4CCO A;  3N97 A;  4BKX A;  2ZFU A;  5JI6 A;  2GA1 A;  1NK3 P;  1D5V A;  3K1N A;  3F8N A;  2CQQ A;  3SEZ A;  3R0A A;  2JSC A;  1TBX A;  1S7O A;  4AVZ A;  2VT3 A;  3T8R A;  2CFX A;  1QBJ A;  4PCQ A;  4RBO A;  5FKL A;  2ME6 A;  2RQP A;  3FHZ A;  1IN5 A;  3TO9 A;  3DWL E;  1J09 A;  1IAW A;  1BI3 A;  3KIO A;  5CVJ A;  2JUG A;  2OZU A;  3S14 J;  5D8L B;  2MC4 A;  5HDK A;  2BVL A;  3QPL A;  3WGG A;  2DTZ A;  1P4A A;  4IX7 A;  1UST A;  3MWM A;  3AG2 H;  2XSD C;  1D1B A;  3DPU A;  4LGW A;  2PMZ N;  3BR3 A;  2HQN A;  3BG7 A;  5D8K B;  1IRZ A;  2BY0 A;  3K9T A;  2KDZ A;  1H9G A;  3F6O A;  1VQO I;  5GPA A;  1YYV A;  1MKM A;  2Y75 A;  4A5N A;  1ZG1 A;  4PSX A;  3FXO A;  1V54 H;  2MD0 A;  3Q0V A;  4BE1 A;  3HRT A;  1KYZ A;  1R23 A;  5CVV A;  2EBI A;  4KT6 A;  5HS8 A;  4UY8 I;  4MO7 A;  3H3Z A;  4HX7 A;  3BQY A;  2W00 A;  1UFM A;  1MSE C;  2P5K A;  5DEQ A;  2CG4 A;  3JRG A;  3ELK A;  3ZN1 A;  4EGY A;  1TNT A;  2K86 A;  4IHW A;  1U5T A;  1W5C C;  2ZSI B;  3DFG A;  4OIQ F;  3B73 A;  3H35 A;  2EIL H;  1FBS A;  2FX0 A;  1XX5 A;  2ESH A;  1S7A A;  4S05 A;  1MNE A;  2O5R A;  1R00 A;  5F1R A;  5KNL A;  2B63 J;  1DGR M;  2Q8K A;  2H1K A;  1HBX G;  1GV5 A;  1YTY A;  2R7Z J;  3O8G A;  4DBQ A;  2JJ7 A;  3J7A Y;  1Z77 A;  2W1O A;  3EYI A;  5E20 A;  2FSW A;  2VBW A;  2RQQ A;  5CVR A;  4NHJ A;  3A0B C;  1VQP I;  3EDP A;  4IRI A;  3G1O A;  1IDY A;  5ICF A;  3VSK A;  5J1Y A;  2JPB A;  2XAJ A;  1XCB A;  4I99 C;  2LRE A;  2OCE A;  4M9S A;  2ZC2 A;  5ICG A;  5A2Q K;  3OS0 A;  2VLA A;  4KYW A;  1QRY A;  2DOF A;  1MJA A;  1X1D A;  3QYE A;  3F8M A;  2KL4 A;  4U88 A;  1A6Q A;  2VE8 A;  3F6V A;  5LEJ A;  3WTS C;  4U0W A;  5HLG A;  2EV6 A;  3M8E A;  1YW8 A;  1G6N A;  1VQ6 I;  2YU3 A;  3RPQ A;  1F9N A;  2K9L A;  4MGR A;  1BL0 A;  2CV2 A;  4IHV A;  1XD7 A;  4WK8 F;  1FSH A;  4E7S A;  3G1L A;  4D9J A;  3KEY A;  1U5T B;  1UAA A;  1QGP A;  3A03 A;  2WY8 Q;  1XMA A;  5FLX K;  2IGO A;  1F5T A;  4BE0 A;  3BTJ A;  3AAF A;  5D5X B;  4I98 B;  2AXT C;  5JVT A;  2HDD A;  1A04 A;  2DT5 A;  3O8H A;  3COA C;  2E1O A;  4EQQ A;  2AXL A;  4EJT A;  5IYB J;  3L2U A;  4M6X A;  1WFX A;  3W6J B;  3DBH B;  4ENM A;  3Q5F A;  3DKX A;  1O7L A;  4FX4 A;  1E0E A;  5L3F A;  5HVQ C;  2GIZ A;  3K10 A;  3ZCO A;  4NC7 A;  2XB5 A;  1J7K A;  4J00 A;  2QQA A;  4MEX F;  1SD7 A;  3EYY A;  3ZMT A;  3NEU A;  1GXP A;  1DP3 A;  4PZJ A;  3QP6 A;  5DYM A;  5LGT A;  2FD5 A;  3DBL B;  3I71 A;  5BMZ A;  5K1Y A;  2DA4 A;  3AG1 H;  4M72 A;  5CVI A;  3GTQ J;  4OIR F;  3V7C A;  2H1L A;  1XN7 A;  2LC2 A;  4U0Y A;  2CH0 A;  2DYR H;  3CDH A;  1KYW A;  4I02 A;  3KZZ A;  2X6O A;  2CQ7 A;  2V1U A;  2ZNY A;  2XIG A;  1ZLK A;  4B3X A;  2CWE A;  5ERI A;  1LFU P;  4U7B A;  2CJJ A;  2PMU A;  3OYN A;  4N4N B;  3MD2 A;  5BNG A;  1D8K A;  3GX4 X;  4KNY A;  2E2H J;  3W2V A;  4FE4 A;  3ZQH A;  1LVA A;  3GZN B;  3M8J A;  2DBB A;  4M6Y A;  1NH3 A;  1C0W A;  3GFI A;  1H8A C;  1ZRE A;  3ISP A;  1TZL A;  4RLF A;  1OR7 C;  5K7H A;  3SJM A;  3BWG A;  5DTD A;  2X6X A;  2DA2 A;  3S15 J;  3ZGK A;  3BG9 A;  2PJR A;  3U1D A;  2W48 A;  4F52 A;  1SD5 A;  1VI0 A;  4Z6Y A;  3IUO A;  4CXF A;  3ZRG A;  3R0J A;  4DBR A;  1I27 A;  3ZQQ A;  1U8B A;  2EA2 A;  2E5Z A;  3H5N A;  3HL2 A;  2NVU B;  1QA6 A;  2XAF A;  2H8W A;  2HYG D;  5E1X A;  3CC4 I;  4C3J J;  2Y0M A;  2V9P A;  4BS9 A;  2MLG A;  2IVM A;  1NG7 A;  3SEQ A;  1HXD A;  1UG0 A;  1ZG3 A;  2K40 A;  3ML6 A;  2VOP A;  3GFM A;  2QA4 I;  3L00 A;  1Y0N A;  1BW6 A;  2L3D A;  4MHG A;  3VB2 A;  2BY2 A;  1Z05 A;  1XB4 A;  1RZ4 A;  2XKO A;  3AL0 B;  2W24 A;  2IA0 A;  2W57 A;  4KFC A;  2FJ1 A;  2IT0 A;  4ZYA A;  2BVM A;  5DDG A;  3LSJ A;  4IQJ A;  1A36 A;  1Y1W J;  4KMU X;  3TDZ C;  2IGK A;  2JN6 A;  2LF7 A;  3S16 J;  5FKK A;  2DMQ A;  3OR1 C;  1MJB A;  2TDX A;  3F22 A;  2XGE A;  2M1B A;  4GGG A;  2HFH A;  4IRH A;  5D5W B;  2PJP A;  2K5C A;  2Z2S B;  2FE3 A;  2DFF A;  2KKO A;  2HYJ A;  2OCC H;  2EZH A;  4HBL A;  4Q48 A;  1O3Q A;  3G2B A;  2YUS A;  1ZTR A;  4E7I A;  2O61 A;  1D0Y A;  1X19 A;  4XOR A;  5J6X A;  4FHT A;  4NC6 A;  1AU7 A;  3FKJ A;  4BQO A;  1B4A A;  2M2E A;  1DUX C;  2LSO A;  4KIS A;  4HW0 A;  2A68 F;  2RV8 A;  1ZAO A;  3KLO A;  1MNM C;  1IDZ A;  1W0U A;  2HTJ A;  3DCF A;  5TJJ A;  1EH6 A;  3PNV A;  4EJV A;  3ZMD A;  3OYE A;  3CUQ A;  2L0K A;  1E3P A;  2IA1 A;  2VN2 A;  5GP9 A;  1XSD A;  5HS9 A;  2E71 A;  4C30 A;  1T98 A;  1F1Z A;  4DYQ A;  2VB6 A;  3EPZ A;  1T39 A;  4EJO A;  3G73 A;  3N05 A;  2ZJP F;  1SVO A;  1RR7 A;  2LFB A;  1EV7 A;  3WHB A;  2CW0 F;  1YS7 A;  3W2W A;  1RC9 A;  2MAB A;  2XV4 S;  2MW8 A;  2Z9O A;  3E5Q A;  3H1C A;  4HPQ A;  3TKY A;  5D4S A;  2CFO A;  1EJ9 A;  3SZP A;  4A12 A;  3VDX A;  1ETO A;  2ACJ A;  4A2U A;  1S72 I;  2CS3 A;  3E7L A;  3OYC A;  4XLN F;  2X0L A;  3DKW A;  3M7G A;  1XGS A;  4I7H A;  1Y1V J;  3S1Q J;  3U1K A;  1WVR A;  1REP C;  1A5J A;  4Q47 A;  1IN7 A;  4OAY A;  3BTL A;  1TQI A;  1SMY F;  2X1D A;  4II3 A;  2DJI A;  3ZP5 A;  3SFZ A;  3OR2 C;  2JVH A;  2O6G E;  4GYG A;  4B43 A;  2DCE A;  2OTL I;  4LG3 A;  4F93 B;  3CUQ B;  2HPM A;  3S2H J;  1U6G A;  3RKY A;  4B44 A;  3LAP A;  1ZR4 A;  2LKX A;  3CLO A;  2Y9Z A;  3CMA I;  1MH4 A;  4IO9 F;  2Y48 A;  5E1W A;  3QOD A;  2QSG X;  3C2B A;  4WWC A;  2R4G A;  1CGP A;  1FOK A;  1WJA A;  2VKE A;  1XGM A;  3LA7 A;  2CMP A;  1GT0 C;  2L7K A;  2KIS A;  4IRG A;  5FKM A;  2XB0 X;  3LOC A;  4M6V A;  2F6C A;  3SQN A;  1T0F C;  1LE8 A;  3C3W A;  3PSI A;  3P9K A;  4BYY A;  3VSL A;  4UV9 A;  4F55 A;  4A3F J;  2LNB A;  4A3E J;  1YJN I;  1LQ1 A;  3CP8 A;  3PQJ A;  2M4G A;  4MQ9 F;  3REO A;  1YX3 A;  4XN0 A;  4H0E A;  1QZZ A;  5CPR B;  1ETQ A;  3WHC A;  2KJB A;  3G6E I;  2R5Z A;  3RZO J;  3BDD A;  4NB5 A;  3JRF A;  1LFP A;  5IT9 K;  3DU5 A;  5CQE A;  1K6Y A;  2VI6 A;  1YE9 A;  5H6R A;  4E7L A;  4BJ6 C;  3Q0U A;  4LIT A;  2V1N A;  3HSF A;  4YIF A;  1I6H J;  4YII A;  2KIQ A;  1JJ6 C;  2CW7 A;  5IP6 A;  1QPI A;  2JMW A;  3V4G A;  3HPG A;  4RS8 A;  1BN5 A;  1U5T C;  2E19 A;  5J8C A;  3K4L A;  4OU0 A;  4EM0 B;  3F9K A;  3JRC A;  1XGN A;  1U78 A;  1MND A;  2M5W A;  3D0S A;  1UHM A;  5HNH A;  3E6C C;  1X3Z B;  1PP8 F;  2ISY A;  3ZOB A;  4NUB A;  4ZYE A;  3ESW B;  4IVN A;  3TO7 A;  4HF0 A;  4F3Q A;  4ENN A;  3OS2 A;  2DMU A;  4I09 A;  2WWY A;  2I5U A;  4KN4 X;  2LY1 A;  3BJA A;  1LE8 B;  3FM3 A;  2FBI A;  2KDO A;  1YRN B;  4M71 A;  1KQ8 A;  3DKY A;  1IZ1 A;  1Z3X A;  2LRD A;  3R61 A;  3RKW A;  3IRQ A;  3GTG J;  1VQN I;  5JHU A;  1M1E B;  9ANT A;  2BZT A;  4E7K A;  2R5Z B;  1J75 A;  1S9H A;  2O8X A;  4PDK A;  2VAS A;  2K9M A;  5E79 C;  2MSY A;  5J1R A;  1SC7 A;  3FK7 A;  3OWT A;  4XOP A;  2RVC A;  3H36 A;  5K5O A;  3SXY A;  3PFI A;  4HDU A;  3I56 I;  3J81 Z;  5FLX Z;  5CYV A;  4C2T A;  1SFO J;  3CCU I;  1R4M B;  2V9K A;  3FK6 A;  5K5R A;  4J19 A;  2XC7 A;  4RAY A;  1P4X A;  2W25 A;  2HOE A;  4B4C A;  2EK5 A;  3BQZ A;  2Z99 A;  3GTP J;  2DN0 A;  1ODD A;  1KGS A;  5BS6 A;  3KP6 A;  3F8B A;  3V7R A;  1OYY A;  1IC8 A;  1B9N A;  3JW4 A;  1S6L A;  4RB1 A;  3E3V A;  4YFN F;  3JSO A;  2HQA A;  4XKV A;  2QUF A;  1XSX A;  5EZH A;  2A5W A;  2DJN A;  2DA6 A;  2GIV A;  5IOZ A;  3M07 A;  3PSF A;  2XDV A;  3H9Q A;  3FKI J;  4L9N A;  4CCJ A;  3S1M J;  2DA5 A;  3C1D A;  1MBG A;  3M1C A;  5DCF A;  3Q9V A;  1ZAR A;  1RUO A;  2EWN A;  5EG0 A;  2VXD A;  3IP4 B;  3SYT A;  1CQT A;  2G7U A;  3JRE A;  2EV5 A;  1FP1 D;  1JUS A;  3L09 A;  2OA4 A;  3C18 A;  5D5U B;  2VON A;  2VE9 A;  2JQ7 A;  1OR7 A;  3ABU A;  2IS2 A;  1K83 J;  2MC3 A;  3DV8 A;  4LK1 F;  2JRT A;  3PJR A;  1R22 A;  3U21 A;  3KFW X;  2QBY A;  3GFL A;  1N78 A;  1ACI A;  2HGC A;  5GTH C;  3AL0 C;  2FBH A;  3LA3 A;  4DNC A;  1Y56 A;  5ICC A;  2E5N A;  5HDG A;  3GME A;  3RTR A;  3BZK A;  4L5J A;  2QZ8 A;  2XSJ C;  4N4O B;  3HC7 A;  4YFX F;  1TW2 A;  2PEX A;  2BV6 A;  4RM2 A;  4UUS A;  1K4T A;  3QU6 A;  2ZO4 A;  5JVG F;  1JUM A;  2XAU A;  4CZZ A;  2QQ8 A;  2B0L A;  2R92 J;  6PAX A;  1GVJ A;  2ECC A;  1WJ5 A;  5E18 F;  2M0M A;  1O3T A;  1YOV B;  4S04 A;  1IN6 A;  2P8T A;  4U0V A;  3M3Y J;  3V7S A;  2HVS A;  5EG0 B;  3PUB A;  5D4R A;  2J5O A;  3SZT A;  5M5W J;  1ORK A;  3BLY A;  4EJW A;  3JAM Z;  4G6T B;  5IPA A;  2DI3 A;  4II2 A;  4RDU A;  4LD5 A;  1FOW A;  3HSE A;  2DW4 A;  1QU3 A;  3TGN A;  2HVQ A;  3L2V A;  5HLI A;  2Z5U A;  2PX9 A;  2XRN A;  3BRO A;  3RSN A;  2COM A;  2FRH A;  2QBY B;  1Y39 A;  3W2A A;  2F5E A;  1U8R A;  2NAZ A;  3ZXS A;  3BPV A;  3I54 A;  2LOO A;  3KE2 A;  4X0G A;  1ZQ3 P;  2XUB A;  3KEQ A;  4R8H A;  3OYA A;  1JKP C;  1IUF A;  4A93 J;  4XRF A;  1KU3 A;  3DPT A;  1ERD A;  2KJC A;  1XTA A;  2BE5 F;  2XKP A;  4BBS J;  4UUS B;  2DOA A;  1RKT A;  4PJ0 C;  3FMR A;  5FB2 A;  1W5S A;  2L01 A;  2A6E F;  1KZH A;  1VTN C;  3TQN A;  3DEU A;  2HDC A;  1MDM A;  3J80 K;  2JZY A;  3FXJ A;  4IZZ A;  3CD6 I;  4ZYD A;  1R71 A;  3U9G A;  2NVT J;  2VQL A;  3H0G J;  1T33 A;  4G6D A;  4HLX A;  4YRV A;  1QPM A;  3GVA A;  4E6K G;  5FFX A;  4LB5 A;  1UMQ A;  3BG6 A;  5ED4 A;  3H5A A;  1ZRF A;  2ZXH A;  1ONV A;  2EZI A;  1TWF J;  4AWX B;  4QTR A;  4C2U A;  3L2W A;  2ELK A;  4BEH A;  1E17 A;  3OYM A;  1YJ9 I;  3CUQ C;  2YX7 A;  5E3L A;  1X58 A;  3FZV A;  1L0O C;  4BXU A;  4FAS D;  5E3O A;  3I4P A;  3BC8 A;  1W1W E;  4OOI A;  5D6F A;  4EJU A;  1ETX A;  2AQE A;  4HZF A;  3N4M A;  2NS7 A;  1DQU A;  2NNY A;  4KN7 X;  4C9Y A;  4UHT A;  2F4I A;  2O0Y A;  2WY7 Q;  4P5O A;  3A01 A;  2R7U A;  1UZC A;  1JTY A;  2VPL A;  1TQM A;  1P9Q C;  3E5U A;  4FCY A;  2HOT A;  5EGO A;  5FD6 A;  1PVE A;  1FYL A;  3V8J A;  3ERM A;  1OJL A;  4FE7 A;  3C2H A;  3LFK A;  2P7C B;  3FX3 A;  3PQK A;  1J59 A;  1LNW A;  2QGU A;  4B48 A;  3K4M A;  1MDM B;  1E2X A;  3FF5 A;  4HST A;  3RDI A;  1I3A A;  1I3Q J;  3VEP A;  3H5R A;  3WTW C;  5E8I A;  5F6F A;  3BR2 A;  4UUT A;  2E2J J;  2WB1 A;  4R1H A;  1HLV A;  2VXZ A;  3O3K A;  5DUI A;  1X2N A;  2CQN A;  4BE2 A;  1APL C;  2R7W A;  1P2F A;  1T0F A;  2Y69 H;  5EF6 A;  2UXX A;  2OQR A;  1QZE A;  3GTO J;  3OYF A;  3DPL C;  1FP2 A;  4BEH B;  3JTG A;  5TRD A;  5GPC A;  4A3I J;  3L2R A;  2QSH X;  1P4W A;  1Z7L A;  3FXQ A;  1ZRD A;  2A5Y B;  4DYR A;  2E36 A;  3CMY A;  3QAH A;  4M3F A;  5DD8 A;  4ZZL A;  1H0M A;  3A01 B;  1U3E M;  3MKW B;  3A4C A;  3BCB A;  2WTE A;  2V79 A;  3LWF A;  5AON A;  4E70 A;  1Z7U A;  4XRM A;  5FLV A;  4LG0 A;  3ZQI A;  1JHF A;  5EGO B;  2L9S A;  2DYS H;  1JKR C;  2BOL A;  3Q0W A;  4C2M J;  2Z3Y A;  2A05 A;  1VF9 A;  2D2W A;  3K2Z A;  5E17 F;  5BOX A;  3MN2 A;  3PO3 J;  2K4J A;  4MFE A;  5KAF C;  3CCY A;  2X6W A;  3LA2 A;  1LDJ A;  4HSR A;  1WQ2 A;  5IT9 Z;  3KPH A;  4XRS A;  4ABZ A;  5LGU A;  1ENH A;  1I1S A;  3ECO A;  1HKQ A;  5JFR A;  1YIT I;  4HA8 A;  4AIJ A;  4Y4R A;  1HW5 A;  1MH3 A;  3VWB A;  2W82 A;  3NAU A;  3NWT A;  2I8D A;  2AS5 F;  3IRR A;  2G0E A;  3HSR A;  1PYV A; 
#chains in the Genus database with same CATH homology
 1FWZ A;  3GUD A;  1O7F A;  4ENK A;  5L3B A;  4ZYH A;  5EEG A;  3GLX A;  1LDD A;  1YQA A;  1CF7 A;  2ELH A;  4LG0 B;  2P4W A;  1BI2 A;  3D5L A;  1FBQ A;  5ILS A;  5KK1 A;  1YO5 C;  3J81 K;  1Z91 A;  5FFZ A;  3K0L A;  1BIA A;  1IXC A;  5AIP A;  3VOE A;  2KRF A;  1I5Z A;  3HUG A;  1SFX A;  1ULY A;  2ZFW A;  2QLZ A;  4G6Q A;  1MZB A;  1H9T A;  1FX7 A;  2K27 A;  1RIO H;  1QNT A;  2EA4 A;  4RGX A;  4O3M A;  4OIO F;  3KET A;  4KMF A;  4EGZ A;  2CO5 A;  1CF7 B;  1JE8 A;  1PDN C;  2V6C A;  3L2C A;  1WWX A;  3QP5 A;  2HQR A;  5ILV A;  5CLS A;  3GYH X;  4CDG A;  4GYI A;  5BPD A;  4IPA A;  3KZY A;  2FNP A;  3EUH A;  1DP7 P;  2H94 A;  1B59 A;  2PLY A;  3I5U A;  4XSZ F;  4BHP A;  3E6M A;  2UXN A;  1ZHF A;  3H92 A;  1BIB A;  4L5I A;  5LHI A;  4YG2 F;  1SD4 A;  3WE2 A;  4I01 A;  3BP8 A;  3FMQ A;  3G3Z A;  2VT2 A;  3E6B A;  1JHH A;  2LDU A;  3CJN A;  4FX0 A;  2DTR A;  3ZN0 A;  2STW A;  1FYM A;  4IF4 A;  5BPI A;  4WF2 A;  3MFK A;  1WRJ A;  2RKH A;  4Y13 A;  3IC7 A;  2A3S A;  3JAM K;  1G3W A;  4M9Z A;  1S8N A;  3K69 A;  1L3L A;  1YLF A;  2CGP A;  4XLP F;  1WKM A;  3T8T A;  2VC1 A;  2CSO A;  4UUV A;  2UZK A;  1DDN A;  4EMS A;  2QWW A;  4OIN F;  2UWM A;  5AIQ A;  1JXS A;  5FO5 A;  2LKP A;  2X4H A;  3TOA A;  3KP5 A;  1FLI A;  2XVC A;  1QO0 D;  4YFK F;  2MD5 A;  3RJP A;  3J80 Z;  4CO8 A;  2NRA C;  2NNN A;  1EH7 A;  1TLH B;  5K5Q A;  3H3U A;  3IKT A;  3CO6 C;  1R1U A;  1OKR A;  1STZ A;  2DK5 A;  1NHA A;  2DFI A;  2KIM A;  1YG2 A;  1F4K A;  1TW3 A;  3BZ6 A;  4ZZD A;  1OMI A;  2IW5 A;  4LJZ F;  4L9T A;  4RGR A;  2MH9 A;  1HKS A;  5D6E A;  4WXH A;  1WSU A;  4WX9 A;  4LMY A;  2V1D A;  3GXO A;  1R36 A;  2QYO A;  2EFN A;  4JQF A;  2M87 A;  4L18 B;  4R79 A;  1R1T A;  2E7W A;  3HRU A;  1FSE A;  2P5L C;  4IHT A;  4ETS A;  4CIC A;  1KQ9 A;  3HRS A;  5DCM A;  2E1N A;  4LK0 F;  2ZNZ A;  1FYK A;  1XGO A;  4N9I A;  2FML A;  2L4A A;  2ZME A;  3ZQ7 A;  4UNO A;  3T5X A;  1KU2 A;  2KIU A;  4GXO A;  4IJA A;  4G7H F;  3QU3 A;  4B09 A;  2ESN A;  3GW2 A;  3F72 A;  2FOK A;  1J5Y A;  4RGU A;  2RC4 A;  4ESJ A;  2GA2 A;  1I6X A;  4BQA A;  4CYD A;  3WTX C;  4TV7 A;  3GF2 A;  2XAH A;  5DCM B;  3HOS A;  1W7P A;  1HW2 A;  2E7X A;  3HYI A;  3WU1 B;  2ZME B;  4DQ2 A;  2DPU A;  2HWV A;  1D3Y A;  5F64 A;  3L9F A;  2MH2 A;  2R7D A;  2GXG A;  4G7O F;  4EM1 A;  1BC7 C;  3JSP A;  2IP2 A;  3WU0 A;  2STT A;  2D1V A;  2GAU A;  4QWQ A;  1BI1 A;  2M8E A;  1W7P B;  2DLL A;  1DPU A;  1FBU A;  1ON2 A;  2ISZ A;  5HLH A;  1FY7 A;  3EQL F;  2L02 A;  4KA4 A;  5L3E A;  1W5T A;  3BY6 A;  2O03 A;  4I0B A;  2F2E A;  3O2P E;  3HIF A;  4KUM A;  4ZH4 F;  3ULQ B;  2EFQ A;  1DPR A;  2IPQ X;  5FGM A;  2V9V A;  3WTV C;  3RKX A;  3HHG A;  3ROU A;  2ZXJ A;  5DD4 A;  3LQR A;  3NQO A;  5CJ9 A;  3BPX A;  1LJ9 A;  1PUE E;  4MTE A;  3RYP A;  2LF8 A;  5DV5 A;  4BAY A;  3HOT A;  1LDK B;  2PI0 A;  1X3U A;  2Q2E A;  3V8K A;  1QQI A;  4HYE A;  4UVA A;  2BGC A;  3IL2 A;  1FPQ A;  1XDU A;  4KDP A;  4HF2 A;  4A6D A;  3WOD F;  1V3F A;  3T0Y A;  2A69 F;  5HOO A;  3M9A A;  5LHH A;  4M73 A;  3LST A;  2F5F A;  1UHW A;  5H6Q A;  4O6J A;  2DAO A;  2O3F A;  4P9F A;  1W7P D;  2A6H F;  2XAQ A;  2GQQ A;  4L0Z B;  2F5D A;  2GXB A;  4I0A A;  3RPU A;  2VBZ A;  4XSX F;  2E1C A;  2QVO A;  1T6S A;  1TQP A;  4GCV A;  1BOA A;  2FA5 A;  1ZGA A;  4A0Y A;  2K4B A;  1O3S A;  1OYI A;  1ZN2 A;  1GHC A;  3KP3 A;  4MEY F;  4EV0 A;  3ERE D;  2OBP A;  4UVB A;  1G4D A;  1IRG A;  2ZCW A;  1IW7 F;  2M30 A;  1D8J A;  1T38 A;  3M1E A;  3R4K A;  4WXD A;  3MEX A;  2XAS A;  3I0T A;  1UB9 A;  3MZH A;  4WCG A;  4HQM A;  2FU4 A;  3E97 A;  2P7V B;  1Z6T A;  2P6S A;  2ZJ2 A;  3HRM A;  2FNA A;  3O6B B;  1S3J A;  1MD0 A;  2H09 A;  2IJL A;  4UV8 A;  4XBF A;  2R3S A;  3KEO A;  1R1V A;  1T2K A;  4MQV A;  3WTZ A;  1K79 A;  2P6T A;  3OV8 A;  4HQE A;  2EFO A;  1XDS A;  3GO5 A;  3DF8 A;  2RDP A;  3U2R A;  5LLQ A;  1KU9 A;  3BOQ A;  4RGS A;  4KIC A;  4AIK A;  2PN6 A;  1R58 A;  3F3X A;  1XMK A;  3CTA A;  2A07 F;  1YIO A;  1AOY A;  2ZBK A;  1IF1 A;  2H27 A;  3Q9S A;  2FBK A;  4L9V A;  4HDV A;  2ADU A;  5L3G A;  1G3Y A;  1BC8 C;  2F5C A;  3JTH A;  5HS7 A;  1KU7 A;  1I1G A;  3L7W A;  3GWZ A;  1V4R A;  4A6E A;  1ZGJ A;  4BHC A;  2HZT A;  1SAX A;  3IWZ A;  2DO7 A;  3DQV C;  3FWE A;  3GFJ A;  4L0Y B;  3FM5 A;  3RIR A;  4HAM A;  4G94 A;  3WGI A;  1B6A A;  1PP7 U;  3P9I A;  1JGS A;  2JPC A;  1W4M A;  2PBI A;  1ZLJ A;  4Q4Z F;  1K78 A;  5L3C A;  3I59 A;  3I58 A;  3ZMV A;  1XSV A;  1FC3 A;  3V8L A;  4IHS A;  2OZ6 A;  1ZRC A;  4HX4 A;  4KT5 C;  1EH8 A;  3C7J A;  1BBY A;  2VBY A;  4LLN A;  2YX4 A;  1RI7 A;  2V1X A;  4HX8 A;  4RAZ A;  3VOD A;  3EET A;  4AVP A;  1FT9 A;  2VOO A;  1ZH5 A;  4CHU A;  1YS6 A;  3RI4 A;  4JBA A;  3KCC A;  4O5V A;  4N9H A;  5KVR A;  1IRF A;  1HKT A;  4HOB A;  3IWF A;  1K78 B;  4GO1 A;  3I59 B;  4WXC A;  1FNN A;  3P9C A;  2EFP A;  4HV6 A;  1Z6R A;  2Z33 A;  2G7H A;  4Y17 A;  3WGH A;  2QQB A;  3BJ6 A;  4PGH A;  5EEH A;  1RNL A;  5ILU A;  5IT3 A;  2L4M A;  4RB2 C;  3QOP A;  4G8X A;  2GWR A;  3MAJ A;  3MQ0 A;  4F7Z A;  3MCZ A;  5LGN A;  3S2W A;  4M9X A;  3ZMU A;  2BBY A;  4PGG A;  4A0Z A;  1KQ0 A;  4P9U A;  2RN7 A;  3CUO A;  3RYR A;  3WTT C;  1USS A;  2J5P A;  2MLK A;  3WTU C;  3K1M A;  2FXA A;  2YSR A;  4UXN A;  3HTU A;  4OMZ A;  3CO7 C;  4I2O A;  3TOB A;  2OQG A;  5FD5 A;  3M8F A;  4QLC U;  3F21 A;  3ABT A;  5LRS A;  3ZMS A;  3F8F A;  3J7A O;  5H20 A;  2HS5 A;  2OAZ A;  2FQ3 A;  4P55 A;  1OYW A;  1FZP B;  2CQK A;  3I53 A;  4KIF A;  2HEO A;  2RNJ A;  1TNS A;  2XAG A;  4FT8 A;  2EJR A;  2DU9 A;  2NS0 A;  2H6C A;  2MBF A;  4Y15 A;  2XGX A;  5LBQ A;  4P96 A;  3K1P A;  3FMS A;  2QM3 A;  2P5V A;  2K7L A;  1ZG5 A;  2XHK A;  2W85 A;  5BQT A;  2IA2 A;  1IUY A;  4BHB A;  2QEN A;  5ICE A;  4ESF A;  3LQQ A;  5CVU A;  3ZMZ A;  4KIG A;  1IXR C;  1ZYR F;  3FXR A;  4ENJ A;  1IN8 A;  3NRV A;  3LAJ A;  4B8X A;  4ON0 A;  4AD9 A;  2A61 A;  2HKX A;  2VOD A;  1XCV A;  1Q1H A;  1Z9C A;  3ECH A;  1HSJ A;  2GZW A;  2DPD A;  3QPT A;  4ESB A;  4LLL A;  5D5V B;  1G3T A;  4A0X A;  3GZ6 A;  1S29 A;  2Q0O A;  1LEA A;  1MJ9 A;  1B1B A;  2FEZ A;  3ZPL A;  2L54 A;  1SFE A;  3E5X A;  1Y0U A;  4KIB A;  2CYY A;  1RUN A;  2DQL A;  5LEK A;  3B02 A;  1IN4 A;  1SD6 A;  3QPH A;  4EVI A;  2C6Y A;  1R7J A;  3HHH A;  3OOP A;  5LRR A;  2NYX A;  3KP7 A;  2FF4 A;  2PMH A;  2WC2 A;  5E1Z B;  4ZYG A;  4K2E A;  4N0B A;  1K7A A;  2PFB A;  1ON1 A;  5E8G A;  4LFU A;  3TO6 A;  4OMY A;  4HV5 A;  1U2W A;  2DK8 A;  5A2Q Z;  4L9J A;  3WTY C;  3DXJ F;  2VBX A;  4BH9 A;  2EV0 A;  3MZY A;  1J2X A;  4ASN A;  1HQC A;  2EB7 A;  4UVC A;  2K02 A;  2D1H A;  4MTD A;  3WE3 A;  1J0R A;  2D45 A;  3IHU A;  4OIP F;  1BJA A;  1MGT A;  4D0P A;  3P7N A;  3R6S A;  4RB0 A;  1O3R A;  1BM9 A;  1BI0 A;  1OPC A;  1YW7 A;  4G9Y A;  3KP2 A;  2MA3 A;  4HLY A;  3DP7 A;  1R5H A;  2PQ8 A;  1QZY A;  5J8F A;  2M45 A;  2EFW A;  3HTS B;  3WG9 A;  2W84 A;  1B9M A;  1WI9 A;  4EM2 A;  1SMT A;  2WV0 A;  2ZKZ A;  2HR3 A;  2FMY A;  3SHF A;  2HYF A;  1O57 A;  5DUK A;  2YPR A;  5L3D A;  3IKV A;  4A5M A;  1TTY A;  1K6O A;  2YR2 A;  4NQW A;  2OU2 A;  2DQR A;  2R7F A;  1YFH A;  4Z2Y A;  3BJO A;  3E6D A;  3R60 A;  1IXS B;  3KLN A;  1HW1 A;  3I64 A;  3QRF F;  2IRF G;  1LEB A;  3GZ5 A;  3F23 A;  2QQ9 A;  4RB3 C;  2G9W A;  3F8C A;  3KP4 A;  4AIH A;  2JT1 A;  2HKO A;  4G7Z F;  1LB2 A;  4BNC A;  3VFZ A;  2KIF A;  4Q5S F;  4U7D A;  2OD5 A;  4JK1 X;  2HTS A;  1AWC A;  1UCR A;  2BEO A;  2BYV E;  1SFU A;  4M74 A;  5HDN A;  1J9I A;  2H6B A;  2PG4 A;  5LHG A;  4LLG F;  4HF1 A;  1P92 A;  1KA8 A;  1G3S A;  3GEZ A;  4MNU A;  1HST A;  3FXU A;  4CGZ A;  3T1B A;  3W6K B;  2ETH A;  1GXQ A;  1Z1D A;  2VC0 A;  4IXA A;  5JR3 A;  3TDU C;  1R5G A;  2XRO A;  4LB6 B;  2RGV A;  1P6R A;  2JTV A;  1YW9 A;  3N97 A;  5JI6 A;  2GA1 A;  1D5V A;  3K1N A;  3F8N A;  3R0A A;  2JSC A;  1TBX A;  1S7O A;  2VT3 A;  3T8R A;  2CFX A;  1QBJ A;  4PCQ A;  2RQP A;  3FHZ A;  1IN5 A;  3TO9 A;  1IAW A;  1BI3 A;  5CVJ A;  2OZU A;  5D8L B;  5HDK A;  3WGG A;  1P4A A;  1UST A;  3MWM A;  4LGW A;  2HQN A;  5D8K B;  3K9T A;  1H9G A;  3F6O A;  1YYV A;  1MKM A;  2Y75 A;  4A5N A;  1ZG1 A;  3HRT A;  1KYZ A;  1R23 A;  5CVV A;  5HS8 A;  3H3Z A;  4HX7 A;  1UFM A;  2P5K A;  5DEQ A;  2CG4 A;  3ELK A;  3ZN1 A;  4EGY A;  1TNT A;  2K86 A;  1U5T A;  3DFG A;  4OIQ F;  3B73 A;  1FBS A;  2ESH A;  1S7A A;  4S05 A;  1R00 A;  5F1R A;  2Q8K A;  1HBX G;  1YTY A;  3EYI A;  5E20 A;  2FSW A;  2VBW A;  5CVR A;  4NHJ A;  4IRI A;  3EDP A;  5ICF A;  2JPB A;  2XAJ A;  1XCB A;  5ICG A;  5A2Q K;  4M9S A;  4KYW A;  1MJA A;  3F8M A;  4U88 A;  5LEJ A;  2VE8 A;  3F6V A;  3WTS C;  4U0W A;  5HLG A;  2EV6 A;  3M8E A;  1YW8 A;  1G6N A;  2YU3 A;  3RPQ A;  1F9N A;  4MGR A;  1XD7 A;  4WK8 F;  1FSH A;  1U5T B;  1QGP A;  1XMA A;  5FLX K;  1F5T A;  3AAF A;  5D5X B;  4I98 B;  5JVT A;  1A04 A;  2DT5 A;  3COA C;  4EQQ A;  2AXL A;  4EJT A;  4M6X A;  3W6J B;  4ENM A;  3Q5F A;  1O7L A;  4FX4 A;  5L3F A;  5HVQ C;  1J7K A;  2QQA A;  4MEX F;  1SD7 A;  3EYY A;  3ZMT A;  3NEU A;  1GXP A;  4PZJ A;  3QP6 A;  5DYM A;  5LGT A;  3I71 A;  5BMZ A;  5K1Y A;  4M72 A;  5CVI A;  4OIR F;  3V7C A;  1XN7 A;  4U0Y A;  3CDH A;  1KYW A;  4I02 A;  3KZZ A;  2V1U A;  2ZNY A;  2XIG A;  1ZLK A;  2CWE A;  5ERI A;  4U7B A;  2PMU A;  3GX4 X;  1D8K A;  4KNY A;  1LVA A;  2DBB A;  4M6Y A;  1C0W A;  3GFI A;  1ZRE A;  3ISP A;  3BWG A;  3U1D A;  1SD5 A;  4CXF A;  3R0J A;  1I27 A;  2EA2 A;  2XAF A;  5E1X A;  2HYG D;  2Y0M A;  2MLG A;  2IVM A;  1HXD A;  1ZG3 A;  3ML6 A;  2VOP A;  3GFM A;  3L00 A;  2L3D A;  4MHG A;  3VB2 A;  1Z05 A;  1XB4 A;  1RZ4 A;  2XKO A;  2W24 A;  2IA0 A;  2W57 A;  4KFC A;  2IT0 A;  5DDG A;  4KMU X;  3TDZ C;  2LF7 A;  1MJB A;  2TDX A;  3F22 A;  2M1B A;  4GGG A;  2HFH A;  4IRH A;  5D5W B;  2PJP A;  2FE3 A;  2KKO A;  4HBL A;  4Q48 A;  1O3Q A;  2O61 A;  5J6X A;  4FHT A;  1B4A A;  1DUX C;  2LSO A;  4HW0 A;  2A68 F;  2RV8 A;  1ZAO A;  3KLO A;  2HTJ A;  5TJJ A;  1EH6 A;  4EJV A;  3ZMD A;  3CUQ A;  2IA1 A;  2VN2 A;  1XSD A;  5HS9 A;  1T98 A;  1F1Z A;  1T39 A;  4EJO A;  3G73 A;  1EV7 A;  2CW0 F;  1YS7 A;  2XV4 S;  2Z9O A;  3E5Q A;  3TKY A;  5D4S A;  3SZP A;  4A12 A;  2ACJ A;  4A2U A;  4XLN F;  2X0L A;  3DKW A;  3M7G A;  1XGS A;  4I7H A;  1REP C;  4Q47 A;  1IN7 A;  1TQI A;  1SMY F;  3ZP5 A;  3SFZ A;  2O6G E;  4GYG A;  3CUQ B;  1U6G A;  3RKY A;  3LAP A;  3CLO A;  2Y48 A;  5E1W A;  4WWC A;  1CGP A;  1FOK A;  1XGM A;  3LA7 A;  4IRG A;  3SQN A;  3C3W A;  3P9K A;  4BYY A;  4UV9 A;  2LNB A;  1LQ1 A;  3PQJ A;  4MQ9 F;  3REO A;  4H0E A;  1QZZ A;  2KJB A;  3BDD A;  4NB5 A;  5IT9 K;  5H6R A;  4YIF A;  3HSF A;  4YII A;  3V4G A;  4RS8 A;  1BN5 A;  1U5T C;  5J8C A;  4OU0 A;  4EM0 B;  1XGN A;  1U78 A;  3E6C C;  2M5W A;  3D0S A;  1UHM A;  1PP8 F;  2ISY A;  4ZYE A;  4IVN A;  3TO7 A;  4HF0 A;  4ENN A;  4I09 A;  2WWY A;  4KN4 X;  3BJA A;  3FM3 A;  2FBI A;  1KQ8 A;  4M71 A;  3R61 A;  1IZ1 A;  3RKW A;  3IRQ A;  5JHU A;  1J75 A;  2O8X A;  4PDK A;  2RVC A;  5K5O A;  3SXY A;  3PFI A;  4HDU A;  3J81 Z;  5FLX Z;  5CYV A;  5K5R A;  4RAY A;  1P4X A;  2W25 A;  2HOE A;  2EK5 A;  2Z99 A;  1ODD A;  1KGS A;  5BS6 A;  3KP6 A;  3F8B A;  3V7R A;  1OYY A;  1B9N A;  3JW4 A;  1S6L A;  4RB1 A;  3E3V A;  4YFN F;  3JSO A;  2QUF A;  1XSX A;  2GIV A;  4L9N A;  3C1D A;  5DCF A;  3Q9V A;  1ZAR A;  1RUO A;  2EWN A;  2G7U A;  2EV5 A;  1FP1 D;  3L09 A;  2OA4 A;  3C18 A;  5D5U B;  2VON A;  2VE9 A;  1OR7 A;  3ABU A;  2MC3 A;  3DV8 A;  4LK1 F;  2JRT A;  1R22 A;  3KFW X;  2QBY A;  3GFL A;  2HGC A;  2FBH A;  3LA3 A;  4DNC A;  5ICC A;  5HDG A;  3RTR A;  4L5J A;  2QZ8 A;  4YFX F;  1TW2 A;  2PEX A;  2BV6 A;  3QU6 A;  2ZO4 A;  4CZZ A;  2B0L A;  6PAX A;  1GVJ A;  5E18 F;  1O3T A;  4S04 A;  1IN6 A;  2P8T A;  4U0V A;  3V7S A;  5D4R A;  2J5O A;  3SZT A;  4EJW A;  3JAM Z;  2DI3 A;  4LD5 A;  3HSE A;  2DW4 A;  3TGN A;  5HLI A;  2Z5U A;  2XRN A;  3BRO A;  2COM A;  2FRH A;  2QBY B;  2F5E A;  1U8R A;  2NAZ A;  3BPV A;  3I54 A;  3KE2 A;  2XUB A;  3KEQ A;  4R8H A;  4XRF A;  1KU3 A;  3DPT A;  2KJC A;  2BE5 F;  2XKP A;  3FMR A;  5FB2 A;  1W5S A;  2L01 A;  2A6E F;  1VTN C;  3TQN A;  3DEU A;  2HDC A;  1MDM A;  3J80 K;  2JZY A;  4ZYD A;  3U9G A;  4G6D A;  4HLX A;  1QPM A;  3GVA A;  5FFX A;  4LB5 A;  5ED4 A;  1ZRF A;  1ONV A;  4AWX B;  1E17 A;  3CUQ C;  2YX7 A;  3FZV A;  1L0O C;  4BXU A;  3I4P A;  4OOI A;  5D6F A;  4EJU A;  4HZF A;  3N4M A;  2NNY A;  4KN7 X;  4UHT A;  2O0Y A;  4P5O A;  1TQM A;  3E5U A;  5FD6 A;  1FYL A;  3V8J A;  3LFK A;  2P7C B;  3FX3 A;  3PQK A;  1J59 A;  1LNW A;  1MDM B;  1E2X A;  3FF5 A;  3RDI A;  3VEP A;  3WTW C;  5E8I A;  5F6F A;  4R1H A;  2VXZ A;  3O3K A;  5DUI A;  1P2F A;  1T0F A;  2UXX A;  2OQR A;  3DPL C;  1FP2 A;  3JTG A;  5TRD A;  1P4W A;  3FXQ A;  1ZRD A;  2A5Y B;  3QAH A;  5DD8 A;  1H0M A;  4ZZL A;  1U3E M;  5AON A;  2WTE A;  2V79 A;  3LWF A;  4E70 A;  1Z7U A;  4LG0 A;  1JHF A;  2Z3Y A;  2D2W A;  5E17 F;  3K2Z A;  5BOX A;  2K4J A;  3LA2 A;  1LDJ A;  1WQ2 A;  5IT9 Z;  5LGU A;  1I1S A;  3ECO A;  1HKQ A;  5JFR A;  4HA8 A;  4AIJ A;  1HW5 A;  2AS5 F;  3IRR A;  3HSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...