1LEBA

Solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
b'MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEXA REPRESSOR DNA BINDING DOMAIN
publication title Solution structure of the LexA repressor DNA binding domain determined by 1H NMR spectroscopy.
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 1994-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lebA00
1RIOH 1LQ1A 2Q0OA 2O61A 2QBYB 1QQIA 1U5TA 1IF1A 1O7FA 1IN4A 2P7VB 3F8NA 3ZQ7A 3O3KA 2QQBA 5EEHA 4HF1A 3F23A 1X3UA 1B59A 1YW9A 1ZN2A 4DNCA 3KP5A 4A2UA 3CUOA 3ECHA 1Z6TA 1BIBA 2XV4S 2IJLA 3JTHA 5LRSA 3IC7A 1WRJA 3WE3A 4A5NA 3VODA 2H94A 1IW7F 5LEKA 4LGWA 4HV6A 4NB5A 4EM1A 4BNCA 1ZG1A 4UVAA 1TQIA 2Q8KA 2XRNA 1YTYA 3IKTA 5ICCA 5L3EA 5JFRA 2XAHA 3LQQA 3MAJA 4KMUX 3FMRA 2GZWA 1XB4A 2NNYA 3T5XA 4L0YB 1J5YA 4AIKA 2VBZA 5JVTA 1QZZA 2QQ9A 2W85A 4OMZA 4KN7X 4B8XA 1MKMA 4RAYA 4GCVA 3NRVA 3GFMA 2IP2A 2NRAC 1B9NA 5D6EA 2WTEA 4BAYA 5K1YA 1MJ9A 4EQQA 3M8FA 3BJAA 1W4MA 3MEXA 2ISYA 2ZKZA 4R1HA 4P96A 4IHTA 4N0BA 3M9AA 1E2XA 2PBIA 3RKYA 1DDNA 3GVAA 4RGUA 3DP7A 5L3GA 2V9VA 2B0LA 4U0WA 5E1ZB 2P6TA 2X4HA 1HQCA 3I5UA 3N97A 2K4JA 1USTA 5CVUA 4KIGA 3WG9A 2K86A 2HKXA 2YX7A 3TOAA 4HQEA 1O3TA 3FMSA 1J9IA 1XSXA 2QQAA 4G9YA 4RGSA 1P4XA 2P7CB 1MZBA 4IPAA 2Z33A 3LQRA 5D4SA 3ELKA 1CGPA 1YW7A 2D1VA 2MBFA 1BBYA 2ZO4A 3F22A 2PLYA 2L4AA 2DFIA 2DI3A 5LGUA 1RNLA 4KFCA 1MJAA 2JZYA 2KIUA 3K9TA 3WTVC 4UVBA 2ZJ2A 2GQQA 3ERED 5FB2A 1DPUA 3LA7A 4HOBA 2HWVA 4WX9A 1S7AA 4AIHA 1W5SA 2DO7A 3SHFA 2FSWA 3E6MA 3ULQB 3GF2A 2E7WA 2PFBA 4A6EA 4EJTA 1IUYA 3M8EA 3ZP5A 1YFHA 2DPDA 1U5TC 2JRTA 1TBXA 2W84A 5LHGA 3CUQC 5KVRA 3L9FA 3CDHA 4BXUA 1YW8A 1K78B 4BQAA 3H92A 4L9JA 4UNOA 3RKWA 1FC3A 2QZ8A 2V1XA 3GWZA 2BBYA 3CO6C 4QLCU 5AIPA 5ICFA 4JQFA 3QPHA 5FD6A 2XGXA 1FBSA 3QP6A 3QOPA 1XGSA 4HYEA 2HYFA 1JGSA 5DCFA 5LGNA 1D3YA 2E1NA 1U78A 1T38A 3RDIA 1KYWA 5JR3A 1O3SA 3G3ZA 3HSEA 4G94A 4CICA 2V1UA 3ABTA 1K6OA 1OKRA 3KP2A 1RZ4A 3OOPA 2MLGA 4JBAA 4U0VA 5E1WA 3F72A 4Y15A 3WTYC 5BMZA 4G7OF 5ERIA 1P6RA 2EFQA 4YIFA 4GYGA 3K69A 2MLKA 1P4WA 2AS5F 2OU2A 2E1CA 2UZKA 1ZREA 3HOTA 2P5KA 4ZYDA 2OQRA 1S8NA 3HRSA 2CG4A 2CQKA 3HUGA 4HAMA 4WXCA 3FWEA 2PN6A 1G6NA 2JT1A 5D4RA 4LG0B 3I59A 2IA2A 1SAXA 3ZMVA 1KQ9A 3HRMA 2DBBA 1RUOA 3ISPA 2W25A 3O2PE 4KIBA 4WWCA 1BM9A 3LFKA 3V8LA 3R6SA 3CO7C 3SZTA 3JSOA 4O3MA 4MGRA 2ZNYA 3RYRA 2G7UA 1CF7A 1YS6A 1R58A 1ZHFA 4I0BA 5E18F 1T0FA 2A6HF 2F5DA 5LEJA 2V79A 1BN5A 2XAJA 1PDNC 1ON2A 5ICEA 3BDDA 3S2WA 2R3SA 3TO9A 1IXCA 3RTRA 3TGNA 3JW4A 5K5RA 3KZZA 3GW2A 4OMYA 5D8LB 3L2CA 4CO8A 1DP7P 1R36A 4OIOF 1UHMA 3BY6A 5ILUA 2YPRA 2HQRA 3FZVA 4Q47A 5LHIA 3JTGA 1YG2A 5D5UB 3BJOA 1REPC 4ETSA 5BQTA 1IRGA 4ENKA 4O6JA 5DUKA 1I1GA 3I54A 4WXDA 1V3FA 3C18A 5E8GA 1EH6A 4EM0B 4XLNF 5F6FA 5L3DA 1BOAA 4ZZLA 3E3VA 4LK1F 4IRIA 1ZAOA 3GFLA 5D5VB 5LRRA 1B1BA 1HKTA 2XAFA 5ILSA 1UCRA 2QM3A 4M9XA 1ZYRF 3F6VA 1JE8A 2QLZA 1FY7A 3DV8A 1IN7A 1IAWA 4LLNA 4YIIA 4ESJA 2VT3A 4RAZA 3KFWX 2IPQX 2IT0A 1TW2A 4GGGA 1W7PA 4JK1X 4MEXF 1T98A 2RVCA 2LKPA 1R5HA 1LDDA 4OU0A 3RPUA 3U2RA 3WTUC 4HLYA 5DD8A 2DQLA 4IHSA 4Q5SF 1YO5C 1XDUA 5CVRA 4IRHA 2HTJA 4EGZA 2EFNA 4M6XA 1OMIA 2BE5F 3WTTC 1OYYA 1KQ0A 2XIGA 5D6FA 4IVNA 3E6BA 4ASNA 3VOEA 2ISZA 5JHUA 2ACJA 4EJUA 3QRFF 3EUHA 2PJPA 1KU9A 4RGRA 3MZYA 3F8BA 3WTXC 1SD6A 3I53A 5DV5A 3GZ5A 3QU3A 2GIVA 1ZRFA 2DK8A 1ZG5A 3U9GA 3P9KA 1IN6A 1HW1A 5DEQA 4B09A 1GHCA 3CUQA 4N9HA 2QYOA 3FXRA 1IRFA 4RB2C 5HS9A 4KN4X 2DT5A 2HZTA 3ZMTA 3BROA 2L02A 3KLNA 2VOOA 2JTVA 5CVJA 2UWMA 4MTDA 4DQ2A 2XKOA 3FMQA 1K7AA 3V8KA 3T8TA 2UXXA 2JPBA 1B9MA 2YX4A 1S7OA 4KT5C 2OAZA 2EV5A 2ELHA 4GXOA 3J81K 4PGHA 4OOIA 2R7FA 4EJVA 3QPTA 4F7ZA 2FQ3A 5ILVA 5A2QZ 4ON0A 1T2KA 3HRTA 1SFEA 4A0XA 1F9NA 1ZGJA 4G8XA 2JSCA 3RIRA 2MC3A 2F5EA 3KLOA 4QWQA 3BWGA 2IA1A 4U0YA 2O3FA 1STZA 2J5OA 1O7LA 2M30A 3ECOA 3GFJA 2BEOA 1GXQA 3WGHA 4RB0A 4L18B 2NNNA 5AONA 6PAXA 4KA4A 1J7KA 4HBLA 4CGZA 1OR7A 2ZXJA 2H09A 3O6BB 4RB3C 4CZZA 3HYIA 1XMAA 4WCGA 4U88A 2ZCWA 3L00A 3E5XA 3E5UA 4WK8F 3F8FA 5FFXA 2EV0A 5AIQA 4LD5A 2HTSA 1IXSB 4IXAA 1BI2A 1KU2A 4LK0F 2PMHA 2XKPA 3FX3A 2H6CA 3K1NA 2FOKA 3BJ6A 2ESHA 3IRQA 2DPUA 1WSUA 3KP7A 3JAMZ 2A07F 2OZUA 3ZPLA 3LAJA 2CYYA 4Q48A 2L54A 4BH9A 4G6QA 2FBHA 5FLXZ 2LSOA 1FBQA 1HSJA 3K0LA 3OV8A 4KDPA 1RUNA 3WTZA 5LBQA 4HLXA 1KU7A 1WKMA 2Y75A 1Z9CA 1EH7A 3DPTA 2GXBA 4L9TA 2PI0A 1BJAA 2M5WA 3BP8A 1G3WA 5HS8A 4YFKF 4U7BA 3I0TA 4XLPF 2P5LC 1F5TA 1ZH5A 1LJ9A 3KP3A 4UUVA 4PCQA 3I71A 2DU9A 1Z6RA 3RI4A 3C3WA 1C0WA 1S6LA 2D2WA 4LFUA 3D0SA 4KICA 2HR3A 3MZHA 4EV0A 1O3QA 1USSA 2FA5A 1MJBA 3KCCA 3IRRA 2CWEA 2EFWA 1H9TA 4LB6B 1IN5A 1J75A 2JPCA 5HDGA 2MA3A 4EM2A 3REOA 1ZRCA 4GYIA 4HF0A 1SD7A 1R22A 4P55A 1ODDA 3J81Z 1XSDA 2D45A 2OD5A 3SZPA 2PG4A 4G6DA 1K78A 4LLGF 3F6OA 1D8JA 2V6CA 4RGXA 1BI0A 3LSTA 4LJZF 3KETA 2MH2A 1Y0UA 3FHZA 3V7RA 1YQAA 3B73A 1QBJA 1P2FA 2FEZA 2RN7A 1MD0A 4RS8A 2M8EA 4UVCA 4XBFA 2EK5A 5TJJA 2K27A 4IRGA 3LA3A 4UHTA 3KEOA 1ZG3A 4HF2A 1QGPA 3ZN0A 5LHHA 2GAUA 2ZMEB 3I4PA 2LNBA 3WTWC 3GUDA 1LDKB 5FO5A 1LDJA 4OIQF 1FNNA 2IA0A 2A3SA 2XVCA 3GZ6A 2FMLA 1G4DA 2DQRA 4HX4A 2IW5A 2HS5A 4XSZF 2M1BA 3GXOA 3RKXA 3NEUA 4I2OA 5BOXA 4PGGA 3TDUC 1H9GA 1Z05A 1D8KA 2J5PA 1TQPA 3W6JB 4A12A 1UFMA 4M6YA 3DQVC 3BZ6A 1IXRC 1LEAA 1BI1A 3WGGA 1T6SA 3T8RA 3WE2A 1GVJA 3ZMDA 5L3CA 2VBXA 3ZMZA 3IWFA 2O03A 1YS7A 2NAZA 1EH8A 2FNAA 5BS6A 1XGNA 4M71A 2HEOA 4LG0A 4ZYGA 2QUFA 1T39A 1A04A 3VEPA 3KP6A 1BC7C 4UV8A 4LLLA 5HLIA 3AAFA 1XDSA 3KP4A 2K4BA 2EA2A 2OBPA 3MQ0A 1G3SA 2LF8A 5K5OA 2EV6A 4PZJA 1TTYA 4HQMA 3W6KB 5A2QK 4ZZDA 2Z5UA 2Z3YA 3T1BA 3JSPA 1G3YA 4M9SA 5HLHA 2HOEA 2FBIA 5BPIA 2BV6A 2Y48A 3WGIA 2GWRA 5DCMA 4L5JA 2K7LA 1R5GA 4EJWA 3KEQA 5DYMA 2CW0F 2VC1A 1OPCA 2WC2A 2W24A 4FX0A 1KA8A 1SFUA 2C6YA 3L09A 2RNJA 1MGTA 2VXZA 5FD5A 2FMYA 3TO7A 1MDMA 2G7HA 1ZLJA 4HV5A 2YU3A 2PQ8A 3V4GA 3TO6A 4Y17A 4A5MA 2VOPA 3E97A 5E17F 4FT8A 2QENA 1P92A 2A5YB 3P9IA 2HKOA 1PP7U 4I7HA 1LNWA 1YLFA 2PEXA 3JAMK 3F21A 3E5QA 4MNUA 4EVIA 2KKOA 2P6SA 4MTEA 5DUIA 2KIMA 3HRUA 3GO5A 1QNTA 5BPDA 1J0RA 1WQ2A 2VBYA 2K02A 5FLXK 5H6RA 3FM3A 5LGTA 4KNYA 2A69F 1JXSA 5CVIA 5DD4A 2M45A 3ML6A 1U5TB 3CTAA 1G3TA 3MCZA 5L3BA 3FXUA 2O6GE 3CLOA 3CUQB 4MQ9F 1KGSA 2ADUA 3TOBA 1HBXG 4I0AA 1F1ZA 4OIPF 3BOQA 3CJNA 3MFKA 2X0LA 5ICGA 2E7XA 4KMFA 4A0YA 1HSTA 1PUEE 1LEBA 4Z2YA 2DW4A 2RDPA 4IJAA 3R0JA 5HDNA 2STWA 4L0ZB 3J80Z 3VFZA 3ABUA 3DXJF 1K79A 3IHUA 4HDUA 4BYYA 2Q2EA 3QP5A 1XCBA 3T0YA 1SMTA 2QBYA 1I5ZA 3TQNA 4NQWA 3RJPA 3IKVA 4CYDA 4ZYHA 4I02A 3QAHA 4FHTA 2XASA 3C1DA 4H0EA 2WWYA 3H3ZA 4O5VA 1B4AA 3EYYA 1O3RA 1HW5A 1OYWA 3DF8A 1SD5A 1XGMA 3F8CA 4PDKA 5HLGA 4U7DA 1SD4A 2KIFA 4P5OA 5IT9Z 1EV7A 2GA1A 2OA4A 4YG2F 3WTSC 1FZPB 2RKHA 3LAPA 2V1DA 3GFIA 2FBKA 4KYWA 3M1EA 3HHHA 2H27A 2EB7A 4AVPA 3GLXA 1LB2A 4L9VA 5L3FA 3R60A 3HHGA 1W7PD 2GXGA 1HXDA 4Q4ZF 4L5IA 1BI3A 2EJRA 3Q9VA 1FYLA 4M74A 5KK1A 2L01A 2HYGD 3HSFA 3WODF 2VE9A 5CYVA 3FM5A 4KUMA 4P9UA 2Z9OA 1KQ8A 3ZMUA 3LWFA 2F2EA 1FPQA 2L3DA 1ONVA 3WU0A 1HKQA 3I58A 5IT3A 2STTA 4CHUA 2Z99A 1R1VA 3L7WA 1TW3A 5EEGA 2VT2A 1V4RA 5J6XA 3GX4X 3I64A 1B6AA 3HIFA 1D5VA 1FT9A 4HA8A 2A6EF 1WI9A 1W5TA 5FGMA 1O57A 2M87A 2A61A 2Y0MA 2DLLA 2H6BA 3WU1B 2O8XA 1ON1A 4I01A 1FSEA 5FFZA 3DFGA 4OINF 1FX7A 4ENMA 3K1MA 2P5VA 4G7HF 5F1RA 1S29A 3GEZA 3EETA 3KZYA 3TKYA 2PMUA 3E6DA 3SXYA 2BYVE 3HSRA 1Z1DA 4M73A 3R0AA 5TRDA 2P4WA 2HGCA 5H6QA 2NYXA 1U2WA 2W57A 4CDGA 1R23A 4K2EA 5LLQA 3F8MA 1AOYA 2QWWA 4R8HA 4NHJA 5H20A 4LB5A 1FP1D 2KJBA 1I6XA 3DPLC 2HDCA 2VE8A 3C7JA 3EYIA 2A68F 3K1PA 5CLSA 3FXQA 1KU3A 1ULYA 3HTUA 1FBUA 3ROUA 1PP8F 1XGOA 4GO1A 1P4AA 1QZYA 2QVOA 1YYVA 2ZBKA 2VONA 1J2XA 4A6DA 1TQMA 4N9IA 2BGCA 4HX7A 1FOKA 3U1DA 2NS0A 2FXAA 2XAGA 3N4MA 1FYKA 5E8IA 3TDZC 1E17A 3PQKA 4CXFA 2EA4A 2YR2A 3R4KA 2FRHA 4L9NA 1Z91A 4BHBA 3BPXA 4AIJA 4MEYF 2G9WA 3NQOA 5D5WB 1FSHA 4S05A 2LDUA 3COAC 2AXLA 2EFPA 3KE2A 5J8FA 3RYPA 2HQNA 1XMKA 1BIAA 1IN8A 1ZARA 1S3JA 1R7JA 1XD7A 1SFXA 4IF4A 2EWNA 4RB1A 5CJ9A 5J8CA 1H0MA 4FX4A 2RV8A 4YFNF 2IRFG 3PFIA 2TDXA 2ESNA 2FU4A 1DPRA 4BHCA 2YSRA 4P9FA 1JHFA 2ETHA 3IL2A 2F5CA 4UXNA 1Z7UA 3I59B 4ESFA 5F64A 4AWXB 3D5LA 2R7DA 1ZLKA 2WV0A 3M7GA 4EJOA 3SQNA 3Q9SA 4Y13A 1SMYF 2KJCA 2ZMEA 2FE3A 2XUBA 2XHKA 2OQGA 2FF4A 1CF7B 4AD9A 4BHPA 4I98B 2MD5A 5K5QA 1OYIA 4A0ZA 3H3UA 5E20A 1Q1HA 3QU6A 3P9CA 3Q5FA 3MWMA 3EQLF 4YFXF 4WF2A 3J80K 3ZMSA 4I09A 4HZFA 1XN7A 4XSXF 4EMSA 4HW0A 3GYHX 4UV9A 1L3LA 4XRFA 4R79A 1U8RA 4E70A 2MH9A 4MQVA 2VN2A 4ZH4F 2ZFWA 5HS7A 3E6CC 5HDKA 2CSOA 4KIFA 1FYMA 5DCMB 1QO0D 3RPQA 1TNSA 1TLHB 3V8JA 5IT9K 3ZN1A 2ZNZA 5D5XB 1XSVA 4WXHA 2GA2A 3VB2A 3LA2A 5DDGA 4MHGA 3EDPA 1IZ1A 2RC4A 1MDMB 1NHAA 3R61A 1R00A 4ENNA 2CO5A 2O0YA 4EGYA 3B02A 1YIOA 1FWZA 2DTRA 2CFXA 1HW2A 4M9ZA 1R1TA 3V7CA 1HKSA 3BPVA 5D8KB 2DAOA 1UHWA 2FNPA 4S04A 2VBWA 1JHHA 2IVMA 3F3XA 1AWCA 2L4MA 1W7PB 4ESBA 2EFOA 1L0OC 1KYZA 3G73A 3P7NA 1U6GA 2RGVA 1F4KA 1U3EM 1TNTA 2CGPA 4G7ZF 5HOOA 5CVVA 2VODA 3HTSB 2UXNA 2LF7A 3DKWA 3HOSA 1FLIA 2COMA 2D1HA 1RI7A 1ZGAA 4TV7A 1XCVA 1VTNC 2DK5A 2RQPA 1GXPA 2KRFA 2VC0A 1ZRDA 1I1SA 3DEUA 2F5FA 5ED4A 4D0PA 3IWZA 2HFHA 2OZ6A 3SFZA 4ZYEA 3V7SA 2XROA 1UB9A 1WWXA 1QPMA 5JI6A 1BC8C 4HDVA 1J59A 3J7AO 1DUXC 2P8TA 1FP2A 2XAQA 4LMYA 1I27A 3FF5A 1LVAA 5HVQC 4OIRF 4HX8A 5E1XA 4ENJA 4M72A 3PQJA 1R1UA 3K2ZA
chains in the Genus database with same CATH superfamily
2XPVA 1OCPA 1RIOH 1LQ1A 2Q0OA 2VPLA 5CQEA 3LFUA 2O61A 3BTCA 2G0EA 2ZXHA 2QBYB 1QQIA 4NQWB 1U5TA 1IF1A 4MIMA 2L7ZA 1O7FA 1IN4A 2H8WA 2P7VB 3F8NA 3ZQ7A 2BW3A 2FUG2 2QQBA 3O3KA 2B7EA 5EEHA 4XM3A 4HF1A 1WPKA 4PSXA 5JVGF 3F23A 1X3UA 4BE0A 1B59A 1YW9A 1ZN2A 3M8JA 4DNCA 1F36A 3KP5A 3VYTB 4A3IJ 1MBFA 4A2UA 1QVTA 3CUOA 2JWTA 3ECHA 1Z6TA 1BIBA 2XV4S 2IJLA 3JTHA 5LRSA 3EUKL 1N78A 4IHWA 3IC7A 1WRJA 3WE3A 4A5NA 4DBQA 3VODA 1HDDC 2H94A 1IW7F 5LEKA 4LGWA 4IQJA 2ID3A 3JCUC 4HV6A 4NB5A 4EM1A 2K9NA 1X1DA 4BNCA 1ZG1A 2FOWA 2VB6A 4UVAA 1TQIA 2Q8KA 3RZDJ 5F0CA 2GLOA 1TT5B 2XRNA 1LFPA 1YTYA 3IKTA 1NTCA 5ICCA 5JFRA 5L3EA 1FMVA 4NC7A 2XAHA 3LQQA 3FXMA 3MAJA 4KMUX 4BUPA 3FMRA 2GZWA 1XB4A 4D9JA 4M3FA 2H1LA 5J47A 2NNYA 1B72A 3OYJA 2XRLA 3OYLA 2VXDA 4IKFA 1JJ8C 2E1OA 5GAGJ 3T5XA 4E7LA 4DZJA 4L0YB 4QPOA 1VQOI 3TP0A 1J5YA 4HNUA 2VKHA 4AIKA 5JLXA 2VBZA 3BCAA 3BR1A 5JVTA 4D1QA 1X4OA 3FXKA 1QZZA 2QQ9A 2W85A 4OMZA 4UY8I 4MO7A 4KN7X 2ID6A 4B8XA 1VQNI 1MKMA 4NDLA 4RAYA 1BOBA 4GCVA 5J1YA 3AG4H 4XICA 3NRVA 3GFMA 3K4LA 1X1BA 2IP2A 2NRAC 3KYCB 3NWSA 4UUSA 1B9NA 5D6EA 2WTEA 4BAYA 5K1YA 1MJ9A 4EQQA 3M8FA 3ZXSA 3BJAA 1W4MA 3MEXA 2ISYA 3OY9A 1Y56A 2ZKZA 4R1HA 2VI6A 4P96A 1WGXA 5EDNA 5FLVA 1TP4A 4YIRX 4IHTA 2DODA 4N0BA 3M9AA 1E2XA 2PBIA 3RKYA 2XGCA 2IGKA 3KYLA 1DDNA 2LTPA 3GVAA 2VLAA 4RGUA 3EUAA 1A5JA 3DP7A 1K83J 3HPHA 3B6CA 5L3GA 1BW6A 2V9VA 5FKOA 4RDUA 1OCRH 2B0LA 4U0WA 5LD2C 2B63J 4FCYA 1RC9A 4NNJA 5E1ZB 5J3LA 4RA2A 4QIWN 2P6TA 2X4HA 3CZ6A 1HQCA 3DTEA 3I5UA 3HB9A 3N97A 2K4JA 1FTZA 1USTA 2KRCA 5CVUA 4KIGA 3WG9A 3CCJI 2EBIA 1VQ8I 2XC7A 2K86A 2HKXA 3CLQA 2YX7A 3TOAA 4HQEA 1O3TA 3FMSA 1J9IA 1XSXA 3FBNB 1VNDA 2QQAA 2NS8A 4G9YA 2HVRA 1I3QJ 2L9NA 4QPQA 4XLHA 2JA2A 3AG2H 4RGSA 1P4XA 2P7CB 4C2UA 1MZBA 4IPAA 2Z33A 3LQRA 5D4SA 3ELKA 2X1EA 3S1NJ 1CGPA 2BY2A 2KL4A 3L1PA 2M34A 3S3MA 1YW7A 2D1VA 1WJAA 2MBFA 5IP7J 1BBYA 2R7SA 2ZO4A 4S0HB 3F22A 2PLYA 1HOMA 5HLTA 1ZELA 4LG3A 2L4AA 3Q0UA 2DFIA 2DJNA 2DI3A 3HEFA 5LGUA 1RR8C 2GOXB 1RNLA 4KFCA 4A3MJ 1MJAA 2JZYA 1P9QC 2HDWA 1K6YA 5EG0B 1HCRA 1ENHA 3HDDA 2VKDA 2XB5A 2KIUA 3LNQA 3K9TA 3WTVC 4UVBA 5GPAA 2ZJ2A 2GQQA 4Y3OA 4XIDA 2R7OA 3ERED 1WJBA 3WG7H 5FB2A 2DA5A 3TEDA 1UELB 3WHBA 1A6IA 5GP9A 1DPUA 3LA7A 4HOBA 1LE8B 1R5ID 2HWVA 4WX9A 1DP3A 4XN0A 1S7AA 3HKZA 2DA6A 4AIHA 1W5SA 4D7NA 2DO7A 3SHFA 2FSWA 3E6MA 1N25A 3ULQB 3EUHC 4E7HA 3J7ZI 3GF2A 2E7WA 2PFBA 2K85A 4A6EA 3GBGA 4EJTA 1IUYA 1ETOA 1OCOH 5J4VA 2DDAA 3M8EA 5JLWA 3ZP5A 2XGDA 4BS9A 3D5SC 1YFHA 3FK7A 2DPDA 1WJDA 1U5TC 2JJ7A 3CCMI 4A3KJ 2JRTA 3BR2A 2W48A 3DBHB 1TBXA 4BQNA 2W84A 5LHGA 3CUQC 5KVRA 1MH3A 3L9FA 3G1OA 1P7JA 4BBRJ 3CDHA 4BXUA 1YW8A 1K78B 1EF4A 2LRDA 3FK6A 3FISA 3H92A 4L9JA 4BQAA 4UNOA 1Z3YA 5IYDJ 3RKWA 3DTIA 1FC3A 2QZ8A 2PJRB 2EINH 2L7MP 2R5YA 2E35A 2V1XA 1MBEA 3S3NA 3GWZA 1X3ZB 2BBYA 3ZQIA 4XRSG 2HXIA 3H9JA 3IP4B 4QLCU 3CO6C 1DGWY 5AIPA 5ICFA 4JQFA 3QPHA 5FD6A 2F6CA 2L9SA 1UMQA 1ZR2A 2XGXA 1FBSA 3VDXA 5IPAA 3M4OJ 3QP6A 4F3QA 1AA7A 3G2BA 3QOPA 3LL7A 2VJJA 1XGSA 1JKRC 4HYEA 1MBJA 2HYFA 3GMEA 1JGSA 2QGUA 2X85A 5DCFA 1AKHB 3GTKJ 5LGNA 2QCOA 2JVHA 1D3YA 2E1NA 2DFHA 3HXLA 1U78A 1T38A 2LK2A 2QQ8A 3RDIA 5J1UA 1TT0A 1KYWA 2Y31A 5JR3A 3CDLA 4BJ5C 5FKNA 2FX0A 2WB1N 1O3SA 3G3ZA 2HPMA 3HSEA 4G94A 4CICA 2V1UA 3ABTA 1K6OA 1OKRA 4HEA2 1UG2A 3KP2A 3KYDB 3ZGKA 1SFKA 2LC2A 1RZ4A 3OOPA 2MLGA 4JBAA 2L7FP 4U0VA 5E1WA 1MSFC 4Z6YA 3H3VK 3F72A 4Y15A 1WJEA 3W3CA 5FRNA 3WTYC 2CQ7A 5M5XJ 3JRDA 5BMZA 1QHGA 2K3FA 1UHSA 2DOAA 3OYHA 3H5AA 1BR1A 4G7OF 3K4KA 5ERIA 1P6RA 2EFQA 3OIOA 1QPIA 3PSFA 3OYMA 3A01B 4YIFA 4GYGA 3K69A 5J4YA 2MLKA 1Z67A 1R49A 4CZCA 1P4WA 2AS5F 1JUSA 2OU2A 2E1CA 2UZKA 1ZGWA 1ZREA 2VJ5A 3MKYB 3HOTA 2P5KA 4I6ZA 4ZYDA 2OQRA 1S8NA 3HRSA 2CG4A 1DGRM 1W0TA 1PVEA 2CQKA 3HUGA 5IOZA 4HAMA 2OTLI 3MN2A 4WXCA 1GV2A 3FWEA 2PN6A 4HNVA 4PJMA 1G6NA 2BHYA 2JT1A 3M07A 5D4RA 2X51A 3TBIA 4AYBA 4LG0B 2GOMA 3I59A 2IA2A 4IOCF 1WI3A 1SAXA 3ZMVA 2LOOA 1KQ9A 3HRMA 2DBBA 5FROA 2W4SA 1RUOA 3ISPA 3OWTA 2W25A 1H88C 3O2PE 4KIBA 3TW6A 4WWCA 1BM9A 3HGGA 3LFKA 3V8LA 3R6SA 3CO7C 3BR5A 2Y30A 3LOCA 3SZTA 3JSOA 2OF7A 2K9QA 4O3MA 4MGRA 5KAFC 2ZNYA 3RYRA 3ZOBA 4GRIA 3BQYA 2G7UA 4BEHB 1CF7A 2ME0A 1YS6A 1R58A 1R6RA 1ZHFA 2LG4A 3UNGC 2E71A 4I0BA 5E18F 1T0FA 5CPRB 2A6HF 4UUTA 3OS2A 2F5DA 3HKZN 5LEJA 2EILH 1PUFB 2V79A 3IV5A 1ZR4A 2MYSA 1BN5A 3S8PA 1ETWA 2HNHA 3W2WA 2XAJA 1PDNC 2UUZA 3CJQB 1ON2A 5ICEA 1DU6A 4F91B 4IHVA 3BDDA 3D5RC 3S2WA 2BOLA 4NC8A 4EEFG 2R3SA 3K4MA 3TO9A 1IXCA 3VSKA 2A5WA 2OC6A 2TRTA 2LY1A 3RTRA 3TGNA 3JW4A 5K5RA 3N05A 1IRZA 3KZZA 3GW2A 2LBFA 4C9YA 4MFEA 4OMYA 5D8LB 4M3DA 3L2CA 4CO8A 1DP7P 2DXIA 1LUJB 1R36A 1VQ7I 4OIOF 1UHMA 3BY6A 5ILUA 2JK3A 2HQRA 2YPRA 3FZVA 1D1BA 1Y1VJ 4Q47A 5LHIA 2KPMA 4UB6C 3JTGA 3OYKA 2DYRH 3BLYA 5M3FJ 1YG2A 5D5UB 1SVOA 2L9RA 2NOJB 3BJOA 4ETSA 5F0FA 5BQTA 1B8IA 1REPC 1IRGA 2EQRA 4ENKA 4O6JA 3MZ8A 5DUKA 3L2RA 4M6VA 1I1GA 3I54A 4WXDA 3CMMA 1JGGA 1V3FA 4BU2A 3C18A 3F0CA 5E8GA 2RAEA 1EH6A 3RZOJ 4EM0B 1ETYA 4JX6A 4XLNF 5F6FA 5L3DA 1BOAA 1SVMA 4ZZLA 2R5ZB 4PFPA 2R7TA 3E3VA 4LK1F 4IRIA 2K3PA 1ZQ3P 2RREA 1ZAOA 1JUMA 3DLAA 3GFLA 4CCNA 3QYEA 4XKWA 3CC4I 3OYDA 2QKMB 5D5VB 2OTJI 3AG1H 2BVMA 5LRRA 1B1BA 2ZB9A 1HKTA 2E5ZA 2XAFA 3CJRB 2Z2SB 5ILSA 2EZHA 1FTTA 1Y8RB 1UCRA 2W82A 4X1EA 3OL3A 3CMYA 2QM3A 4M9XA 3CDIA 1V54H 2ECCA 1ZYRF 3F6VA 1D0ZA 2K40A 3ABMH 2QLZA 1JE8A 3OYCA 3QOEA 3K70D 4BDYA 1FY7A 3DV8A 1IN7A 1NK3P 1IAWA 4LLNA 2HOSA 1FIPA 1WH7A 4YIIA 4ESJA 4B48A 2VT3A 4RAZA 3KFWX 1P7IA 2IPQX 3M1CA 1JJ6C 1X3WB 2IT0A 4FE4A 3CMAI 1TW2A 2E36A 4GGGA 1W7PA 4JK1X 2DYSH 1ETQA 4MEXF 2LP0A 4CSWA 1T98A 2RVCA 1BW5A 2BY1A 2OCCH 2LKPA 1R5HA 5M3MJ 1E0EA 4A69C 1LDDA 1JT0A 2X6OA 4HSTA 4OU0A 3RPUA 3U2RA 2WAQN 3WTUC 3HL2A 4HLYA 2IXSA 5DD8A 2IS6A 2DQLA 4IHSA 4Q5SF 4AU7A 2KMUA 2EIMH 1TL8A 2L5QA 1EKEA 1YO5C 1XDUA 5CVRA 4IRHA 1U8BA 1T33A 1APLC 2HTJA 4EGZA 2EFNA 4M6XA 1OMIA 1RETA 2BE5F 1IO2A 4XKVA 2V4JC 2KT0A 5EGOB 3WTTC 1OYYA 1YITI 1KQ0A 4J00A 2XIGA 5D6FA 2M0MA 4IVNA 4DBRA 3E6BA 4ASNA 4XN3A 2V9PA 3VOEA 4MLOA 2ISZA 5JHUA 1YI2I 2ACJA 4EJUA 3S1QJ 3QRFF 3EUHA 2PJPA 2Q2EB 1KU9A 4XLFA 1E3PA 4AYBN 2HXOA 4RGRA 1VQKI 3MZYA 3ZQCA 2MABA 3B6AA 3F8BA 1GT0C 3WTXC 2CU7A 1SD6A 3I53A 5DV5A 4CCJA 3GZ5A 1T8IA 3QU3A 3GTQJ 3PUBA 4L5EA 3HC7A 1I6HJ 1VZ0A 2GIVA 1ZRFA 2DK8A 1ZG5A 3U9GA 4AM3A 3P9KA 1U0JA 3MVPA 3DPUA 1IN6A 1HW1A 5DEQA 4B09A 1GHCA 3E1SA 3CUQA 1SEUA 1MMNA 2QYOA 4N9HA 2H1KA 2R93J 3FXRA 5FJ8J 1IRFA 2ECBA 5HS9A 4KN4X 4RB2C 2LD5A 2DT5A 2HZTA 3ZMTA 4E7JA 3BROA 2MSYA 2L02A 3KLNA 5CQGA 2VOOA 2HYJA 2JTVA 5CVJA 3I9V2 3K7AJ 2UWMA 3LSPA 4MTDA 1JT6A 1T0FC 4II2A 4DQ2A 2XKOA 4CUGA 3FMQA 1ZKGA 1K7AA 3V8KA 1JTYA 3T8TA 2UXXA 2JPBA 1B9MA 2YX4A 1S7OA 2BXZA 2HQAA 3U1KA 3BR6A 3OYEA 4KT5C 4JOMA 4YEJA 2OAZA 2EV5A 1VQ4I 2ELHA 4GXOA 3J81K 4PGHA 1OFCX 4OOIA 2R7FA 4EJVA 3HG9A 3QPTA 1VQ5I 1V5FA 4E7KA 4F7ZA 4B3XA 2FQ3A 3BR0A 5ILVA 5A2QZ 1SFOJ 4ON0A 1T2KA 3HRTA 1SFEA 4M3EA 4A0XA 4A3EJ 2VJ4A 3PFYA 1GDTA 1F9NA 3ZQGA 1ZGJA 5B1AH 4G8XA 2JSCA 3RIRA 2MC3A 2F5EA 2MW8A 3KLOA 4QWQA 3HZJA 3BWGA 2IA1A 4U0YA 2O3FA 3DBLB 4XLEA 1H8AC 1STZA 2J5OA 1O7LA 3K6GA 4BXFA 2M30A 3ECOA 1RKWA 3AL0B 1ITYA 2MC4A 1OCTC 3GFJA 2BEOA 4BE2A 1GXQA 3WGHA 5F08A 3X2QH 5FRMA 3J7AY 4RB0A 2KISA 1JTXA 4L18B 2NNNA 2OJED 3H9QA 5AONA 4KA4A 2KQRA 1EJ9A 6PAXA 2WAEA 1J7KA 1JUPA 4HBLA 4CGZA 1E3OC 1OR7A 4HPQA 4XKCA 2P0WA 2KFDA 2ZXJA 2H09A 3O6BB 4RB3C 4CZZA 3CCYA 3HYIA 1XMAA 4WCGA 4U88A 2ZCWA 3VYUB 3S15J 4X6AJ 3L00A 3E5XA 3E5UA 3H36A 3ONQA 4WK8F 3BCBA 4PFOA 2CRGA 3F8FA 4W1UA 1I3AA 5FFXA 4G6TB 2Q1ZB 2DCEA 3DEWA 2EV0A 3ABLH 3MD2A 5AIQA 4LD5A 1W36C 2HTSA 1IXSB 1X2MA 3E7LA 4RAFA 5IYCJ 4ZJZA 4IXAA 1BI2A 4D5CA 1KU2A 4LK0F 2L0KA 2Y0SN 2PMHA 2XKPA 3OIQA 3FX3A 2H6CA 3K1NA 2FOKA 3AKZA 3IH2A 1IC8A 3BJ6A 2ESHA 4E7ZA 1SC7A 2FJ1A 3IRQA 2DPUA 3FKIJ 1WSUA 3KP7A 4I76A 2ME6A 1T95A 3JAMZ 2A07F 2DA2A 2F4MB 2DDBA 3ZCOA 2OZUA 3LSHA 3ZPLA 1K61A 3LSJA 3LAJA 2CYYA 3K4JA 4Q48A 1OISA 5K7FA 2L54A 3SJMA 3BZKA 1AHDP 1NH3A 5F0HA 2KP6A 4G6QA 4BH9A 4IHXA 2IS4A 3AG3H 2FBHA 4HNTA 3Q0VA 1LPQA 3DLLF 5FLXZ 2LSOA 1FBQA 1OJLA 1HSJA 3K0LA 3OV8A 4KDPA 3BT9A 1RUNA 3C2BA 2E1MC 3WTZA 5LBQA 4HLXA 4XRMA 4A3CJ 3RSNA 4D5FA 1KU7A 1WKMA 2Y75A 1Z9CA 1A35A 2GXAA 1U9OA 4NUBA 3UR3C 2R7QA 4PJNA 1X19A 1EH7A 2K9LA 3DPTA 3OR2C 2GXBA 2O5RA 4L9TA 4W97A 2PI0A 3QPLA 3AFHA 1BJAA 2M5WA 3BP8A 5GPCA 1VQ9I 1G3WA 5HS8A 4BXXJ 1IUFA 4YFKF 3BG9A 2COBA 1QRYA 2XF7A 4U7BA 5IP9J 4BE1A 5EG0A 1T08B 3MKLA 3I0TA 4BKXA 4XLPF 2P5LC 1F5TA 4DW6A 1FOXA 1IJWC 2QA4I 4IHYA 3HOXJ 1ZH5A 1LJ9A 3KP3A 2W7NA 4UUVA 4PCQA 3I71A 2CUFA 2DU9A 2F5VA 1Z6RA 3DKXA 3RI4A 1IG7A 2OPTA 4N4OB 3C3WA 1C0WA 2Y69H 2KLOA 1S6LA 2D2WA 1Z0XA 4LFUA 3D0SA 4KICA 2E19A 2HR3A 1IV6A 3GTOJ 3MZHA 4EV0A 2EIKH 4X0GA 1LE8A 5TISC 1O3QA 2DFFA 1USSA 3CCQI 2FA5A 5E3OA 3NAUA 2E5NA 5H2FC 1MBKA 1MJBA 2Y2ZA 3PNVA 3KCCA 3IRRA 2CWEA 1MW7A 2EFWA 1H9TA 4LB6B 1IN5A 1J75A 2JPCA 5HDGA 2MA3A 5GAHJ 3SYTA 3FHNA 4EM2A 3REOA 1ZRCA 1VQ6I 4GYIA 1QU3A 4HF0A 4A3GJ 1SD7A 5DM6F 1R22A 1RPWA 3TMOA 5IY5H 4P55A 3TL4X 1Q1VA 4B3AA 1ODDA 4J19A 4DGWB 3J81Z 2DMPA 2LREA 1XSDA 2MGQA 2D45A 2IEKA 2E34A 2OD5A 3BG6A 3H0GJ 1Z21A 2DOFA 5E79C 2R0QC 3SZPA 2QSHX 5FLMJ 4IOAF 2ZFUA 2PG4A 1SANA 3SEQA 2IGOA 4G6DA 3WU2C 2CH0A 1K78A 2NVTJ 3LSKA 1YRNB 2E2JJ 5C4JJ 5B3SH 4LLGF 4BQOA 3F6OA 1D8JA 3OYFA 2V6CA 2QKLB 3Q0WA 2JRMA 4RGXA 1BI0A 1T56A 3LSTA 4FTHA 4LJZF 3KETA 3Q3SA 4PJLA 2MFZA 1YIJI 2VUMJ 2MH2A 2L2OA 2X9DA 1Y0UA 1OCZH 3FHZA 1UJ8A 3NARA 3V7RA 4CYCB 2E2HJ 2X6YA 3OSGA 3ASNH 5FKLA 2CV2A 2AQEA 1YQAA 1TWHJ 3B73A 4IEJA 1P2FA 3MKZA 1QBJA 2JQ7A 2FEZA 2RN7A 1MD0A 4RS8A 2M8EA 3S1MJ 4UVCA 1LKXA 1RKTA 1XC5A 2EK5A 4XBFA 1LFUP 2NVQJ 5TJJA 1HA8A 2K27A 4IRGA 3LA3A 1A6QA 1BR2A 4UHTA 3KEOA 1FIAA 1ZG3A 4HF2A 1QGPA 4BDZA 1VF9A 1AKHA 3ZN0A 3HOWJ 1QZEA 2LH9A 4ANJA 4YRVA 2CV0A 5LHHA 2GAUA 2ZMEB 3BQZA 3I4PA 1WJCA 1OR7C 1WZ2A 2LNBA 3WTWC 3GUDA 1LDKB 5FO5A 1LDJA 2UV1A 4OIQF 1FNNA 2IA0A 2A3SA 2XVCA 5E3MA 3OYIA 2F48A 3JR9A 3GZ6A 3GTMJ 2IGNA 1UG0A 2FMLA 2DJIA 1G4DA 2X48A 2DQRA 5B66C 3O8HA 2FQ4A 2PMZA 2XDVA 2DA3A 4HX4A 2IW5A 1RESA 2HS5A 3IH4A 2HQ5A 1HF0A 4XSZF 2R7WA 2M1BA 3GXOA 3RKXA 2Z16A 3NEUA 1TC3C 4I2OA 4HSRA 2JA8J 5BOXA 2R7UA 2M4GA 4PGGA 3TDUC 4ABZA 1H9GA 2O7OA 1Z05A 2ELKA 2DA1A 1D8KA 4ZTJA 3H1CA 3HOUJ 2J5PA 4XMYA 2LKXA 1D0XA 2B9SA 1TQPA 3SZGA 4NC6A 3W6JB 1UAAA 4A12A 1UFMA 4M6YA 2O8KA 3DQVC 3HGYA 3BZ6A 2HOAA 2ZSHB 2JSPA 1IXRC 5DS9A 1LEAA 2LY9A 1BI1A 1R71A 3WGGA 2HZDA 1T6SA 3T8RA 3WE2A 2K9MA 2WADA 1GVJA 2ICWG 3A02A 3ZMDA 3JRBA 1A31A 2IS2A 5L3CA 2VBXA 3ZMZA 2XF6A 3IWFA 2O03A 1IDZA 1YS7A 2NAZA 5B1BH 1EH8A 3I4NJ 2FNAA 5BS6A 4IX7A 1SVLA 1XGNA 4M71A 2YS9A 4A3FJ 1GV5A 2HEOA 4LG0A 2Z1DA 4ZYGA 2VPRA 2QUFA 4AC0A 1T39A 1A04A 3VEPA 3KP6A 3FDYA 3OR1C 2XSJC 3KX2A 4UV8A 4LLLA 1BC7C 5HLIA 3AAFA 1XDSA 3KP4A 2EH3A 2K4BA 2EA2A 4KJZA 2OBPA 1MH4A 3MQ0A 1FOWA 1G3SA 2LF8A 1Y6IA 5K5OA 2XPWA 2EV6A 2LR8A 4PZJA 5IOYA 1WJFA 4IQ4A 3CQZJ 1TTYA 4DYQA 4HQMA 3W6KB 5A2QK 4ZZDA 3CC7I 2Z5UA 3L2WA 2Z3YA 4BEHA 3T1BA 3JSPA 1G3YA 3DBRB 3I3LA 1G59A 4M9SA 5HLHA 4XONA 2HOEA 4C3HJ 5M5YJ 2OV7A 2FBIA 2V1NA 3PJRA 5BPIA 2BV6A 4A3JJ 1V5GA 1PUFA 3RCOA 1MSEC 2ZSIB 4DZPA 3BR3A 4RAGA 3DU6A 2Y48A 3CJTB 1IDYA 3IH3A 3WGIA 3CCLI 2GWRA 5DCMA 4L5JA 2K7LA 1F43A 1R5GA 2WAFA 4EJWA 3KEQA 5DYMA 4FE7A 1OLTA 4PSWA 2CW0F 2VC1A 2XGEA 1OPCA 2WC2A 3FKJA 2IGMA 1DU0A 2W24A 4FX0A 3QWLA 3L2UA 5TGTA 1KA8A 1XPXA 1SFUA 2C6YA 3HJEA 4F55A 3CCRI 3L09A 3QODA 2RNJA 1MGTA 1XS9A 1XG1A 2VXZA 5FD5A 1POGA 4BY7J 2VJIA 2FMYA 3TO7A 1MDMA 1XMXA 2G7HA 4PJJA 1WJ5A 2ZJRF 1TZLA 1ZLJA 3PO2J 1YX5A 3LMMA 4HV5A 2YU3A 2PQ8A 3MMYB 3V4GA 3TO6A 2BZTA 3CC2I 3PIPF 2WY7Q 3HOYJ 4Y17A 4A5MA 1WH5A 2VOPA 3E97A 5E17F 1YOVB 5C3EJ 5EJCA 4FT8A 3S17J 3FXOA 2QENA 3VYRB 4XRSA 1P92A 2A5YB 3P9IA 2HKOA 1JKQC 3BC8A 1PP7U 3I55I 2R5ZA 4RMNA 4I7HA 1LNWA 1YLFA 2HPIA 3O8GA 2PEXA 3JAMK 3F21A 3E5QA 4MNUA 4EVIA 2KKOA 2P6SA 4Y33A 2JVGA 3LSGA 4MTEA 5DUIA 2KIMA 3OIPA 3HRUA 2M4KA 3CCSI 1S7EA 3GO5A 3CD6I 2YU9J 2EZLA 1QNTA 2BXYA 5BPDA 1J0RA 2M0CA 1WQ2A 1WHUA 2W00A 2VBYA 2K02A 5FLXK 1MMDA 3OOUA 5H6RA 2I8DA 1VI0A 2VIXA 3FM3A 1EA3A 5LGTA 2KHMA 2BVLA 4I99C 4KNYA 2A69F 1JXSA 5CVIA 5DD4A 4PK4A 2M45A 3ML6A 1U5TB 3CTAA 5EEAA 1G3TA 3MCZA 1Y8QB 5L3BA 3FXUA 5KCMA 4F93B 2O6GE 2BW3B 4XLCA 3CLOA 2KDOA 3CUQB 1ZTRA 4MQ9F 3GZNB 1KGSA 2ADUA 3TOBA 1HBXG 3FBIB 4I0AA 3H35A 2R7RA 1F1ZA 4OIPF 3OSFA 2ZMEC 3JRIA 2P81A 5J1RA 3BOQA 2K9SA 3CJNA 3K70C 3MFKA 2BY3A 3SDBA 4DYRA 4RBOA 3M3YJ 3CF2A 3V42A 2X0LA 4D7MA 5ICGA 2CW8A 2QSFX 3FIWA 2E7XA 1MMGA 2EZIA 1I39A 4KMFA 3DU5A 2AQFA 4A0YA 1X4PA 1HSTA 1ETKA 5EGOA 2R7XA 4CA0A 1PUEE 3OMYA 1YX3A 2OCEA 1LEBA 3CESA 2ZJPF 2VKEA 4Z2YA 3PL8A 3F9KA 9ANTA 2DW4A 2RDPA 4IJAA 3HBLA 4KT6A 4RLQA 3R0JA 3FXLA 5HDNA 2VL8A 2STWA 2NVYJ 2HU9A 2GIZA 4L0ZB 3J80Z 1V5EA 3VFZA 3ABUA 2LY2A 3DXJF 2JUGA 2CJJA 1K79A 3IHUA 4HDUA 4BYYA 2Q2EA 2V26A 1RR7A 4C2MJ 3GTJJ 1MMAA 3QP5A 2KZGA 4AUXA 1B72B 2CUEA 1XCBA 4ZDPA 3H9GA 3T0YA 3U21A 3ABKH 1SMTA 2D5VA 1I5ZA 2QBYA 3TQNA 4NQWA 3RJPA 1YHQI 4YELA 2I10A 3WHCA 3IKVA 1D1CA 1S5LC 4CYDA 4ZYHA 2IBDA 1Y1WJ 2DT6A 3PNYA 4I02A 5GTHC 2X1DA 3BTLA 3QAHA 3JRGA 4FHTA 4XQFA 2XASA 3C1DA 4H0EA 2WWYA 5CKTA 1W5CC 3H3ZA 1DQUA 4O5VA 1B4AA 3EYYA 2HDDA 1O3RA 4UUSB 1VQPI 1HW5A 1OYWA 3C2HA 3DF8A 3A0BC 3OYBA 4AVZA 1SD5A 1XGMA 3F8CA 4PDKA 5HLGA 2JA6J 1AU7A 4U7DA 3S14J 4CCLA 3UKGA 1SD4A 4OAZA 2KIFA 4P5OA 3GLLA 3JRFA 5IT9Z 1NG7A 1EV7A 2EZKA 2GA1A 2OA4A 2NVUB 1W36D 4YG2F 3WTSC 1FZPB 1M1EB 1H89C 1MBHA 4B44A 2RKHA 3LSMA 3LAPA 2EPFA 2V1DA 3GFIA 3D1NI 2FBKA 1TWAJ 3M1EA 2AXTC 3HHHA 2H27A 4KYWA 2EB7A 4AVPA 3GLXA 1LB2A 4HRIA 2GBYA 4L9VA 5L3FA 3W2AA 4N4NB 1O4XA 2EIJH 2WB1A 3R60A 3HHGA 4BL0B 1W7PD 1BL0A 2GXGA 4DJAA 1Y39A 1K4SA 4DYCA 4LOCA 3HOZJ 4XR6A 4E6KG 1HXDA 3CMEI 4ZDOA 4Q4ZF 4L5IA 1BI3A 2M9HA 3RPUD 2EJRA 1ZK8A 2AHQA 3Q9VA 4P1WA 3G1MA 1FYLA 4M74A 5KK1A 2L01A 2HYGD 3HSFA 3WODF 3LSIA 4RM2A 4G12A 2VE9A 5CYVA 3FM5A 4KUMA 2JUCA 2NXNB 2DMTA 2N8GA 3HM5A 2ZXIA 2L7KA 3SFIA 2CQNA 4P9UA 5C4XJ 2Z9OA 1KQ8A 5C44J 3ZMUA 3LWFA 5K7HA 2F2EA 1FPQA 2L3DA 1ONVA 3WU0A 3BG3A 1HKQA 3H5NA 3I58A 5IT3A 1LFBA 4EATA 2CUJA 2STTA 5BNGA 4CHUA 5IYBJ 4CCOA 4XORA 3VSLA 2Z99A 1R1VA 4IZZA 3L7WA 1TW3A 2ELJA 3A1YA 5EEGA 2VT2A 1V4RA 4QSHA 2RQQA 5J6XA 3ERMA 2KIQA 4DOZA 5E3LA 1MMSA 3GX4X 3I64A 3L2QA 1PYVA 2K5CA 1PJRA 4ITVA 2CFOA 2BHZA 1MNEA 1D0YA 3K4CA 1B6AA 3HIFA 1D5VA 1FT9A 4HA8A 2A6EF 3RQ4A 3ZRGA 1WI9A 1W5TA 5FGMA 1O57A 2M87A 2A61A 2Y0MA 1D5YA 3VYSB 1IV8A 1MBGA 3H0DA 2DLLA 2A6TA 2DMNA 5EF6A 4KISA 4RM3A 1YE9A 2H6BA 3WU1B 2O8XA 4LITA 2CW7A 1ON1A 1R4MB 4I01A 1FSEA 3K10A 4XOTA 5FFZA 5KAIC 2L9VA 4B4CA 4CCMA 4B43A 3DFGA 4OINF 1FX7A 5B5EC 4JP0A 3K1MA 4ENMA 2HI3A 1TWCJ 4B1RA 4A3BJ 3HPGA 5F04A 2P5VA 2XSDC 4G7HF 2O9LA 5F1RA 1JI8A 2CMPA 1KONA 1S29A 5FKMA 3GEZA 3EETA 3KZYA 1HC8A 3TKYA 1MIJA 2PMUA 3E6DA 3SXYA 2BYVE 3HSRA 1Z1DA 4M73A 1X2NA 3A0HC 3W6VA 3R0AA 5TRDA 2DT7B 3A03A 2P4WA 2CV1A 2HGCA 3ASOH 5H6QA 2NYXA 1U2WA 3RQIA 2W57A 2WY8Q 3QQAA 4CDGA 5IP6A 3G6EI 1R23A 4K2EA 2JA5J 2R5YB 2LLKA 3BZCA 3S93A 5LLQA 3F8MA 4C3JJ 3BG7A 1AOYA 2QWWA 1CQTA 3ESWB 4R8HA 4NHJA 5H20A 4LB5A 1FP1D 2KJBA 3DEEA 1I6XA 3DPLC 4FQGA 3CP2A 2HDCA 2VE8A 3C7JA 3EYIA 2A68F 4M3GA 3CCUI 1YJNI 3K1PA 3S2HJ 1HDPA 2RNGA 5CLSA 3FXQA 4JX5A 1KU3A 1ULYA 3HTUA 1FBUA 3ROUA 3ZQFA 1PP8F 1XGOA 4GO1A 5F1JA 4V2FA 1ETXA 1P4AA 1QZYA 2QVOA 5J40A 1YYVA 2ZBKA 2VONA 1J2XA 4A6DA 1G2HA 1TQMA 4N9IA 3PNTA 2BGCA 4HX7A 1FOKA 3GCMA 3U1DA 4XKBA 2NS0A 4FASD 2FXAA 2DFEA 2CQQA 3OL4A 2XAGA 3QPSA 3N4MA 1FYKA 5E8IA 4J01A 3TDZC 2R7ZJ 4XK4A 1E17A 1X58A 3PQKA 2VKVA 1V55H 1N75A 4CXFA 2EA4A 2YR2A 3A4CA 3R4KA 2FRHA 4L9NA 5EZHA 3HOVJ 1Z91A 4BHBA 2Y9ZA 3BPXA 3PO3J 4AIJA 4MEYF 2G9WA 3NQOA 2AO9A 2V9KA 1J09A 2PJRA 5D5WB 1FSHA 3KPHA 4BBSJ 2OUMA 3G1LA 3GTGJ 2DMQA 2PX9A 1GUUA 2LKSA 4S05A 3ZQLA 2DA4A 2LDUA 1X1AA 3COAC 4GDFA 2AXLA 2EFPA 3KE2A 5J8FA 3RYPA 4U87A 2HQNA 1XMKA 2IAIA 1BIAA 1IN8A 1ZARA 1S3JA 1R7JA 1XD7A 4F92B 1SFXA 4IF4A 1U9NA 1VQMI 1E3HA 2EWNA 4RB1A 2X1CA 5CJ9A 5J8CA 1H0MA 4A3LJ 2TCTA 4FX4A 3G71I 2RV8A 5KHDA 4YFNF 1BJZA 1MNDA 2IRFG 3PFIA 5HNHA 1ACIA 3K4NA 2TDXA 1N77A 2ESNA 3OS0A 1YRNA 4ZYAA 1S9HA 4AIDA 2H8RA 2FU4A 1DPRA 3HUGB 2LVSA 1YJ9I 2NS7A 2Y9YA 1ERDA 4BHCA 2YSRA 1QA6A 3MKWB 2IS1A 5DTDA 3EPZA 4P9FA 1JHFA 2ETHA 5EYRA 3S2DJ 3IL2A 2F5CA 1BA5A 4UXNA 4XLAA 3VWBA 1Z7UA 2MG4A 3I59B 4FISA 2GM4A 4ESFA 5F64A 4CYCA 1WVRA 4AWXB 5E3NA 3D5LA 1NG6A 2KRHA 2WAQA 2R7DA 2XF5A 3AL0C 1ZLKA 2BY0A 2WV0A 3M7GA 3H5RA 4IO9F 4LIVA 4EJOA 3IAM2 4Y7NJ 1OQYA 3PSIA 5KNLA 3SQNA 4Y52J 2CQXA 2JN6A 2QEXI 3Q9SA 2VQGA 1W1WE 4QTRA 3S3OA 1D1AA 4Y13A 3G4SI 1VFCA 1SMYF 2KJCA 4OWRB 2ZMEA 3FXJA 1FEXA 2FE3A 3A01A 2VQLA 3IAS2 1S72I 2WBMA 2XUBA 1IGNA 2XHKA 2OQGA 1R9TJ 2FF4A 1CF7B 4AD9A 2HVSA 4BHPA 4I98B 4PJ0C 3QYFA 2MD5A 2VASA 5K5QA 4BACA 4E7SA 4M3BA 1OYIA 3PUFA 4A0ZA 3H3UA 4E4HA 4Y4RA 4BJTA 5E20A 1G8XA 3E0JB 3SEZA 1Q1HA 3QU6A 3P9CA 3Q5FA 2JMWA 4FETA 1QHHD 4CH7A 3MWMA 3EQLF 4A3DJ 4YFXF 4WF2A 3J80K 2HOTA 3ZMSA 1XX5A 4I09A 4HZFA 1XN7A 4JYKA 4XNFA 2X6XA 3OYNA 3KZIC 5GTIC 4XSXF 2V7FA 4EMSA 2LBFB 1MNMC 2ZXWH 1OCCH 5LFAA 4HW0A 3GYHX 3BG5A 4UV9A 3A2KA 1L3LA 4RLFA 4BJ6C 4XRFA 1UZCA 4MFDA 4R79A 1NK2P 1U8RA 1SAUA 1QVUA 1X1PA 4E70A 3L2VA 1VQLI 3CCVI 2MH9A 3NWTA 4MQVA 5HNFA 2F4IA 2VN2A 1B8IB 4ZH4F 1A36A 5GADJ 2QF7A 2ZFWA 3TW7A 2FD5A 5HS7A 3E6CC 5HDKA 5HODA 2CSOA 4KIFA 3I56I 4XL9A 1TWFJ 1FYMA 1ORKA 4IL6C 4GFBA 5DCMB 3RKQA 1BR4A 1QO0D 3BTIA 1X1CA 3RPQA 1TNSA 1TLHB 3V8JA 5F27A 5IT9K 3JRCA 4E7IA 1LVKA 1FMWA 3ZN1A 2E60A 3TP3A 3GTLJ 2ZC2A 1I50J 2M8GX 2ZNZA 3DCFA 3OS1A 2NVXJ 2M2EA 3DWLE 3J7YJ 5EZGA 4HG2A 3S32A 5D5XB 3QYBA 4ZC3A 1XSVA 4WXHA 2GA2A 3VB2A 3CP8A 3LA2A 5DDGA 4MHGA 3EDPA 3JREA 3CCEI 1GLNA 1KZHA 1IZ1A 2RC4A 1MDMB 4A93J 1NHAA 3R61A 1R00A 4ENNA 1XTAA 4H4KC 4XOPA 4V19K 3S16J 2ZJQF 2CO5A 2O0YA 4EGYA 2LYCA 3PIOF 2LFBA 1WFXA 3B02A 1YIOA 3KIOA 1FWZA 2DTRA 3ZR8X 2CFXA 2WV1A 1W0UA 1ETVA 1HW2A 4M9ZA 1R1TA 2XPUA 2DOEA 3P5JA 3V7CA 2DA7A 2M7AA 2R92J 1HKSA 3BPVA 2DN0A 5D8KB 2DAOA 1Z77A 3DTKA 1UHWA 2W1OA 1JKOC 4CCKA 2FNPA 4S04A 1Z3XA 2LMDA 4V2GA 5DM7F 1RRJA 2VBWA 1JHHA 2IVMA 3DKYA 3F3XA 1AWCA 2NOGA 2F4OB 2L4MA 3OYAA 4C2TA 1W7PB 3K2AA 4ESBA 2DMUA 2EFOA 2CUZA 4BQQA 1L0OC 1KYZA 3G73A 3P7NA 1U6GA 1HLVA 2RGVA 1WCMJ 2KZVA 1F4KA 2YUSA 3K4BA 3PM1A 1U3EM 1TNTA 5K7ZA 2CGPA 4G7ZF 1GVDA 2QSGX 5HOOA 5CVVA 2VQCA 4C30A 2VODA 3HTSB 2UXNA 2LF7A 3DKWA 3HOSA 3S1RJ 2KDZA 1FLIA 2WA0A 2COMA 1FJLA 1FOYA 2D1HA 1RI7A 2M3AA 2CS3A 2E1MB 4C3IJ 2X6WA 1JKPC 1ZGAA 4TV7A 1XCVA 1Y0NA 2Y0SA 3ZQQA 1VTNC 3GTPJ 2DK5A 5FKKA 4B47A 2RQPA 1GXPA 2MD0A 4NBQA 2KRFA 2DTZA 4BGDA 2VC0A 1ZRDA 3I4MJ 2PMZN 2V6EA 4BY1J 1I1SA 3LSRA 3DEUA 2F5FA 5ED4A 3KEYA 4D0PA 3IWZA 2HFHA 4KITB 1Z7LA 3SDGA 2OZ6A 3SFZA 4ZYEA 3IUOA 4JX4A 3ZQHA 3V7SA 2XROA 1UB9A 4PUSA 3OYGA 1K4TA 1WWXA 1QPMA 5JI6A 1BC8C 4HDVA 4OAYA 3JRHA 1J59A 3J7AO 2E2IJ 4F52A 4UB8C 5M5WJ 2A05A 1DUXC 5JHFA 4ZTFA 3C2GA 2P8TA 1FP2A 2XAQA 3CF5F 2M7BA 4LMYA 1I27A 1IRXA 1YJWI 2JA7J 3FF5A 1LVAA 3VPRA 1TWGJ 4ZDLA 3BTJA 2HVQA 3JRAA 4DIQA 5HVQC 4OIRF 1R4NB 4HX8A 5E1XA 2I5UA 4LIUA 2XAUA 2R7VA 4ENJA 4M72A 3W2VA 2VQHA 2R4GA 3PQJA 2XB0X 5GAEJ 1R1UA 3K2ZA 4II3A
chains in the Genus database with same CATH topology
1RIOH 1LQ1A 2Q0OA 2O61A 2QBYB 1QQIA 1U5TA 1IF1A 1O7FA 1IN4A 2P7VB 3F8NA 3ZQ7A 3O3KA 2QQBA 5EEHA 4HF1A 3F23A 1X3UA 1B59A 1YW9A 1ZN2A 4DNCA 3KP5A 4A2UA 3CUOA 3ECHA 1Z6TA 1BIBA 2XV4S 2IJLA 3JTHA 5LRSA 3IC7A 1WRJA 3WE3A 4A5NA 3VODA 2H94A 1IW7F 5LEKA 4LGWA 4HV6A 4NB5A 4EM1A 4BNCA 1ZG1A 4UVAA 1TQIA 2Q8KA 2XRNA 1YTYA 3IKTA 5ICCA 5L3EA 5JFRA 2XAHA 3LQQA 3MAJA 4KMUX 3FMRA 2GZWA 1XB4A 2NNYA 3T5XA 4L0YB 1J5YA 4AIKA 2VBZA 5JVTA 1QZZA 2QQ9A 2W85A 4OMZA 4KN7X 4B8XA 1MKMA 4RAYA 4GCVA 3NRVA 3GFMA 2IP2A 2NRAC 1B9NA 5D6EA 2WTEA 4BAYA 5K1YA 1MJ9A 4EQQA 3M8FA 3BJAA 1W4MA 3MEXA 2ISYA 2ZKZA 4R1HA 4P96A 4IHTA 4N0BA 3M9AA 1E2XA 2PBIA 3RKYA 1DDNA 3GVAA 4RGUA 3DP7A 5L3GA 2V9VA 2B0LA 4U0WA 5E1ZB 2P6TA 2X4HA 1HQCA 3I5UA 3N97A 2K4JA 1USTA 5CVUA 4KIGA 3WG9A 2K86A 2HKXA 2YX7A 3TOAA 4HQEA 1O3TA 3FMSA 1J9IA 1XSXA 2QQAA 4G9YA 4RGSA 1P4XA 2P7CB 1MZBA 4IPAA 2Z33A 3LQRA 5D4SA 3ELKA 1CGPA 1YW7A 2D1VA 2MBFA 1BBYA 2ZO4A 3F22A 2PLYA 2L4AA 2DFIA 2DI3A 5LGUA 1RNLA 4KFCA 1MJAA 2JZYA 2KIUA 3K9TA 3WTVC 4UVBA 2ZJ2A 2GQQA 3ERED 5FB2A 1DPUA 3LA7A 4HOBA 2HWVA 4WX9A 1S7AA 4AIHA 1W5SA 2DO7A 3SHFA 2FSWA 3E6MA 3ULQB 3GF2A 2E7WA 2PFBA 4A6EA 4EJTA 1IUYA 3M8EA 3ZP5A 1YFHA 2DPDA 1U5TC 2JRTA 1TBXA 2W84A 5LHGA 3CUQC 5KVRA 3L9FA 3CDHA 4BXUA 1YW8A 1K78B 4BQAA 3H92A 4L9JA 4UNOA 3RKWA 1FC3A 2QZ8A 2V1XA 3GWZA 2BBYA 3CO6C 4QLCU 5AIPA 5ICFA 4JQFA 3QPHA 5FD6A 2XGXA 1FBSA 3QP6A 3QOPA 1XGSA 4HYEA 2HYFA 1JGSA 5DCFA 5LGNA 1D3YA 2E1NA 1U78A 1T38A 3RDIA 1KYWA 5JR3A 1O3SA 3G3ZA 3HSEA 4G94A 4CICA 2V1UA 3ABTA 1K6OA 1OKRA 3KP2A 1RZ4A 3OOPA 2MLGA 4JBAA 4U0VA 5E1WA 3F72A 4Y15A 3WTYC 5BMZA 4G7OF 5ERIA 1P6RA 2EFQA 4YIFA 4GYGA 3K69A 2MLKA 1P4WA 2AS5F 2OU2A 2E1CA 2UZKA 1ZREA 3HOTA 2P5KA 4ZYDA 2OQRA 1S8NA 3HRSA 2CG4A 2CQKA 3HUGA 4HAMA 4WXCA 3FWEA 2PN6A 1G6NA 2JT1A 5D4RA 4LG0B 3I59A 2IA2A 1SAXA 3ZMVA 1KQ9A 3HRMA 2DBBA 1RUOA 3ISPA 2W25A 3O2PE 4KIBA 4WWCA 1BM9A 3LFKA 3V8LA 3R6SA 3CO7C 3SZTA 3JSOA 4O3MA 4MGRA 2ZNYA 3RYRA 2G7UA 1CF7A 1YS6A 1R58A 1ZHFA 4I0BA 5E18F 1T0FA 2A6HF 2F5DA 5LEJA 2V79A 1BN5A 2XAJA 1PDNC 1ON2A 5ICEA 3BDDA 3S2WA 2R3SA 3TO9A 1IXCA 3RTRA 3TGNA 3JW4A 5K5RA 3KZZA 3GW2A 4OMYA 5D8LB 3L2CA 4CO8A 1DP7P 1R36A 4OIOF 1UHMA 3BY6A 5ILUA 2YPRA 2HQRA 3FZVA 4Q47A 5LHIA 3JTGA 1YG2A 5D5UB 3BJOA 1REPC 4ETSA 5BQTA 1IRGA 4ENKA 4O6JA 5DUKA 1I1GA 3I54A 4WXDA 1V3FA 3C18A 5E8GA 1EH6A 4EM0B 4XLNF 5F6FA 5L3DA 1BOAA 4ZZLA 3E3VA 4LK1F 4IRIA 1ZAOA 3GFLA 5D5VB 5LRRA 1B1BA 1HKTA 2XAFA 5ILSA 1UCRA 2QM3A 4M9XA 1ZYRF 3F6VA 1JE8A 2QLZA 1FY7A 3DV8A 1IN7A 1IAWA 4LLNA 4YIIA 4ESJA 2VT3A 4RAZA 3KFWX 2IPQX 2IT0A 1TW2A 4GGGA 1W7PA 4JK1X 4MEXF 1T98A 2RVCA 2LKPA 1R5HA 1LDDA 4OU0A 3RPUA 3U2RA 3WTUC 4HLYA 5DD8A 2DQLA 4IHSA 4Q5SF 1YO5C 1XDUA 5CVRA 4IRHA 2HTJA 4EGZA 2EFNA 4M6XA 1OMIA 2BE5F 3WTTC 1OYYA 1KQ0A 2XIGA 5D6FA 4IVNA 3E6BA 4ASNA 3VOEA 2ISZA 5JHUA 2ACJA 4EJUA 3QRFF 3EUHA 2PJPA 1KU9A 4RGRA 3MZYA 3F8BA 3WTXC 1SD6A 3I53A 5DV5A 3GZ5A 3QU3A 2GIVA 1ZRFA 2DK8A 1ZG5A 3U9GA 3P9KA 1IN6A 1HW1A 5DEQA 4B09A 1GHCA 3CUQA 4N9HA 2QYOA 3FXRA 1IRFA 4RB2C 5HS9A 4KN4X 2DT5A 2HZTA 3ZMTA 3BROA 2L02A 3KLNA 2VOOA 2JTVA 5CVJA 2UWMA 4MTDA 4DQ2A 2XKOA 3FMQA 1K7AA 3V8KA 3T8TA 2UXXA 2JPBA 1B9MA 2YX4A 1S7OA 4KT5C 2OAZA 2EV5A 2ELHA 4GXOA 3J81K 4PGHA 4OOIA 2R7FA 4EJVA 3QPTA 4F7ZA 2FQ3A 5ILVA 5A2QZ 4ON0A 1T2KA 3HRTA 1SFEA 4A0XA 1F9NA 1ZGJA 4G8XA 2JSCA 3RIRA 2MC3A 2F5EA 3KLOA 4QWQA 3BWGA 2IA1A 4U0YA 2O3FA 1STZA 2J5OA 1O7LA 2M30A 3ECOA 3GFJA 2BEOA 1GXQA 3WGHA 4RB0A 4L18B 2NNNA 5AONA 6PAXA 4KA4A 1J7KA 4HBLA 4CGZA 1OR7A 2ZXJA 2H09A 3O6BB 4RB3C 4CZZA 3HYIA 1XMAA 4WCGA 4U88A 2ZCWA 3L00A 3E5XA 3E5UA 4WK8F 3F8FA 5FFXA 2EV0A 5AIQA 4LD5A 2HTSA 1IXSB 4IXAA 1BI2A 1KU2A 4LK0F 2PMHA 2XKPA 3FX3A 2H6CA 3K1NA 2FOKA 3BJ6A 2ESHA 3IRQA 2DPUA 1WSUA 3KP7A 3JAMZ 2A07F 2OZUA 3ZPLA 3LAJA 2CYYA 4Q48A 2L54A 4BH9A 4G6QA 2FBHA 5FLXZ 2LSOA 1FBQA 1HSJA 3K0LA 3OV8A 4KDPA 1RUNA 3WTZA 5LBQA 4HLXA 1KU7A 1WKMA 2Y75A 1Z9CA 1EH7A 3DPTA 2GXBA 4L9TA 2PI0A 1BJAA 2M5WA 3BP8A 1G3WA 5HS8A 4YFKF 4U7BA 3I0TA 4XLPF 2P5LC 1F5TA 1ZH5A 1LJ9A 3KP3A 4UUVA 4PCQA 3I71A 2DU9A 1Z6RA 3RI4A 3C3WA 1C0WA 1S6LA 2D2WA 4LFUA 3D0SA 4KICA 2HR3A 3MZHA 4EV0A 1O3QA 1USSA 2FA5A 1MJBA 3KCCA 3IRRA 2CWEA 2EFWA 1H9TA 4LB6B 1IN5A 1J75A 2JPCA 5HDGA 2MA3A 4EM2A 3REOA 1ZRCA 4GYIA 4HF0A 1SD7A 1R22A 4P55A 1ODDA 3J81Z 1XSDA 2D45A 2OD5A 3SZPA 2PG4A 4G6DA 1K78A 4LLGF 3F6OA 1D8JA 2V6CA 4RGXA 1BI0A 3LSTA 4LJZF 3KETA 2MH2A 1Y0UA 3FHZA 3V7RA 1YQAA 3B73A 1QBJA 1P2FA 2FEZA 2RN7A 1MD0A 4RS8A 2M8EA 4UVCA 4XBFA 2EK5A 5TJJA 2K27A 4IRGA 3LA3A 4UHTA 3KEOA 1ZG3A 4HF2A 1QGPA 3ZN0A 5LHHA 2GAUA 2ZMEB 3I4PA 2LNBA 3WTWC 3GUDA 1LDKB 5FO5A 1LDJA 4OIQF 1FNNA 2IA0A 2A3SA 2XVCA 3GZ6A 2FMLA 1G4DA 2DQRA 4HX4A 2IW5A 2HS5A 4XSZF 2M1BA 3GXOA 3RKXA 3NEUA 4I2OA 5BOXA 4PGGA 3TDUC 1H9GA 1Z05A 1D8KA 2J5PA 1TQPA 3W6JB 4A12A 1UFMA 4M6YA 3DQVC 3BZ6A 1IXRC 1LEAA 1BI1A 3WGGA 1T6SA 3T8RA 3WE2A 1GVJA 3ZMDA 5L3CA 2VBXA 3ZMZA 3IWFA 2O03A 1YS7A 2NAZA 1EH8A 2FNAA 5BS6A 1XGNA 4M71A 2HEOA 4LG0A 4ZYGA 2QUFA 1T39A 1A04A 3VEPA 3KP6A 1BC7C 4UV8A 4LLLA 5HLIA 3AAFA 1XDSA 3KP4A 2K4BA 2EA2A 2OBPA 3MQ0A 1G3SA 2LF8A 5K5OA 2EV6A 4PZJA 1TTYA 4HQMA 3W6KB 5A2QK 4ZZDA 2Z5UA 2Z3YA 3T1BA 3JSPA 1G3YA 4M9SA 5HLHA 2HOEA 2FBIA 5BPIA 2BV6A 2Y48A 3WGIA 2GWRA 5DCMA 4L5JA 2K7LA 1R5GA 4EJWA 3KEQA 5DYMA 2CW0F 2VC1A 1OPCA 2WC2A 2W24A 4FX0A 1KA8A 1SFUA 2C6YA 3L09A 2RNJA 1MGTA 2VXZA 5FD5A 2FMYA 3TO7A 1MDMA 2G7HA 1ZLJA 4HV5A 2YU3A 2PQ8A 3V4GA 3TO6A 4Y17A 4A5MA 2VOPA 3E97A 5E17F 4FT8A 2QENA 1P92A 2A5YB 3P9IA 2HKOA 1PP7U 4I7HA 1LNWA 1YLFA 2PEXA 3JAMK 3F21A 3E5QA 4MNUA 4EVIA 2KKOA 2P6SA 4MTEA 5DUIA 2KIMA 3HRUA 3GO5A 1QNTA 5BPDA 1J0RA 1WQ2A 2VBYA 2K02A 5FLXK 5H6RA 3FM3A 5LGTA 4KNYA 2A69F 1JXSA 5CVIA 5DD4A 2M45A 3ML6A 1U5TB 3CTAA 1G3TA 3MCZA 5L3BA 3FXUA 2O6GE 3CLOA 3CUQB 4MQ9F 1KGSA 2ADUA 3TOBA 1HBXG 4I0AA 1F1ZA 4OIPF 3BOQA 3CJNA 3MFKA 2X0LA 5ICGA 2E7XA 4KMFA 4A0YA 1HSTA 1PUEE 1LEBA 4Z2YA 2DW4A 2RDPA 4IJAA 3R0JA 5HDNA 2STWA 4L0ZB 3J80Z 3VFZA 3ABUA 3DXJF 1K79A 3IHUA 4HDUA 4BYYA 2Q2EA 3QP5A 1XCBA 3T0YA 1SMTA 2QBYA 1I5ZA 3TQNA 4NQWA 3RJPA 3IKVA 4CYDA 4ZYHA 4I02A 3QAHA 4FHTA 2XASA 3C1DA 4H0EA 2WWYA 3H3ZA 4O5VA 1B4AA 3EYYA 1O3RA 1HW5A 1OYWA 3DF8A 1SD5A 1XGMA 3F8CA 4PDKA 5HLGA 4U7DA 1SD4A 2KIFA 4P5OA 5IT9Z 1EV7A 2GA1A 2OA4A 4YG2F 3WTSC 1FZPB 2RKHA 3LAPA 2V1DA 3GFIA 2FBKA 4KYWA 3M1EA 3HHHA 2H27A 2EB7A 4AVPA 3GLXA 1LB2A 4L9VA 5L3FA 3R60A 3HHGA 1W7PD 2GXGA 1HXDA 4Q4ZF 4L5IA 1BI3A 2EJRA 3Q9VA 1FYLA 4M74A 5KK1A 2L01A 2HYGD 3HSFA 3WODF 2VE9A 5CYVA 3FM5A 4KUMA 4P9UA 2Z9OA 1KQ8A 3ZMUA 3LWFA 2F2EA 1FPQA 2L3DA 1ONVA 3WU0A 1HKQA 3I58A 5IT3A 2STTA 4CHUA 2Z99A 1R1VA 3L7WA 1TW3A 5EEGA 2VT2A 1V4RA 5J6XA 3GX4X 3I64A 1B6AA 3HIFA 1D5VA 1FT9A 4HA8A 2A6EF 1WI9A 1W5TA 5FGMA 1O57A 2M87A 2A61A 2Y0MA 2DLLA 2H6BA 3WU1B 2O8XA 1ON1A 4I01A 1FSEA 5FFZA 3DFGA 4OINF 1FX7A 4ENMA 3K1MA 2P5VA 4G7HF 5F1RA 1S29A 3GEZA 3EETA 3KZYA 3TKYA 2PMUA 3E6DA 3SXYA 2BYVE 3HSRA 1Z1DA 4M73A 3R0AA 5TRDA 2P4WA 2HGCA 5H6QA 2NYXA 1U2WA 2W57A 4CDGA 1R23A 4K2EA 5LLQA 3F8MA 1AOYA 2QWWA 4R8HA 4NHJA 5H20A 4LB5A 1FP1D 2KJBA 1I6XA 3DPLC 2HDCA 2VE8A 3C7JA 3EYIA 2A68F 3K1PA 5CLSA 3FXQA 1KU3A 1ULYA 3HTUA 1FBUA 3ROUA 1PP8F 1XGOA 4GO1A 1P4AA 1QZYA 2QVOA 1YYVA 2ZBKA 2VONA 1J2XA 4A6DA 1TQMA 4N9IA 2BGCA 4HX7A 1FOKA 3U1DA 2NS0A 2FXAA 2XAGA 3N4MA 1FYKA 5E8IA 3TDZC 1E17A 3PQKA 4CXFA 2EA4A 2YR2A 3R4KA 2FRHA 4L9NA 1Z91A 4BHBA 3BPXA 4AIJA 4MEYF 2G9WA 3NQOA 5D5WB 1FSHA 4S05A 2LDUA 3COAC 2AXLA 2EFPA 3KE2A 5J8FA 3RYPA 2HQNA 1XMKA 1BIAA 1IN8A 1ZARA 1S3JA 1R7JA 1XD7A 1SFXA 4IF4A 2EWNA 4RB1A 5CJ9A 5J8CA 1H0MA 4FX4A 2RV8A 4YFNF 2IRFG 3PFIA 2TDXA 2ESNA 2FU4A 1DPRA 4BHCA 2YSRA 4P9FA 1JHFA 2ETHA 3IL2A 2F5CA 4UXNA 1Z7UA 3I59B 4ESFA 5F64A 4AWXB 3D5LA 2R7DA 1ZLKA 2WV0A 3M7GA 4EJOA 3SQNA 3Q9SA 4Y13A 1SMYF 2KJCA 2ZMEA 2FE3A 2XUBA 2XHKA 2OQGA 2FF4A 1CF7B 4AD9A 4BHPA 4I98B 2MD5A 5K5QA 1OYIA 4A0ZA 3H3UA 5E20A 1Q1HA 3QU6A 3P9CA 3Q5FA 3MWMA 3EQLF 4YFXF 4WF2A 3J80K 3ZMSA 4I09A 4HZFA 1XN7A 4XSXF 4EMSA 4HW0A 3GYHX 4UV9A 1L3LA 4XRFA 4R79A 1U8RA 4E70A 2MH9A 4MQVA 2VN2A 4ZH4F 2ZFWA 5HS7A 3E6CC 5HDKA 2CSOA 4KIFA 1FYMA 5DCMB 1QO0D 3RPQA 1TNSA 1TLHB 3V8JA 5IT9K 3ZN1A 2ZNZA 5D5XB 1XSVA 4WXHA 2GA2A 3VB2A 3LA2A 5DDGA 4MHGA 3EDPA 1IZ1A 2RC4A 1MDMB 1NHAA 3R61A 1R00A 4ENNA 2CO5A 2O0YA 4EGYA 3B02A 1YIOA 1FWZA 2DTRA 2CFXA 1HW2A 4M9ZA 1R1TA 3V7CA 1HKSA 3BPVA 5D8KB 2DAOA 1UHWA 2FNPA 4S04A 2VBWA 1JHHA 2IVMA 3F3XA 1AWCA 2L4MA 1W7PB 4ESBA 2EFOA 1L0OC 1KYZA 3G73A 3P7NA 1U6GA 2RGVA 1F4KA 1U3EM 1TNTA 2CGPA 4G7ZF 5HOOA 5CVVA 2VODA 3HTSB 2UXNA 2LF7A 3DKWA 3HOSA 1FLIA 2COMA 2D1HA 1RI7A 1ZGAA 4TV7A 1XCVA 1VTNC 2DK5A 2RQPA 1GXPA 2KRFA 2VC0A 1ZRDA 1I1SA 3DEUA 2F5FA 5ED4A 4D0PA 3IWZA 2HFHA 2OZ6A 3SFZA 4ZYEA 3V7SA 2XROA 1UB9A 1WWXA 1QPMA 5JI6A 1BC8C 4HDVA 1J59A 3J7AO 1DUXC 2P8TA 1FP2A 2XAQA 4LMYA 1I27A 3FF5A 1LVAA 5HVQC 4OIRF 4HX8A 5E1XA 4ENJA 4M72A 3PQJA 1R1UA 3K2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIO H;  1LQ1 A;  2Q0O A;  2O61 A;  2QBY B;  1QQI A;  1U5T A;  1IF1 A;  1O7F A;  1IN4 A;  2P7V B;  3F8N A;  3ZQ7 A;  3O3K A;  2QQB A;  5EEH A;  4HF1 A;  3F23 A;  1X3U A;  1B59 A;  1YW9 A;  1ZN2 A;  4DNC A;  3KP5 A;  4A2U A;  3CUO A;  3ECH A;  1Z6T A;  1BIB A;  2XV4 S;  2IJL A;  3JTH A;  5LRS A;  3IC7 A;  1WRJ A;  3WE3 A;  4A5N A;  3VOD A;  2H94 A;  1IW7 F;  5LEK A;  4LGW A;  4HV6 A;  4NB5 A;  4EM1 A;  4BNC A;  1ZG1 A;  4UVA A;  1TQI A;  2Q8K A;  2XRN A;  1YTY A;  3IKT A;  5ICC A;  5L3E A;  5JFR A;  2XAH A;  3LQQ A;  3MAJ A;  4KMU X;  3FMR A;  2GZW A;  1XB4 A;  2NNY A;  3T5X A;  4L0Y B;  1J5Y A;  4AIK A;  2VBZ A;  5JVT A;  1QZZ A;  2QQ9 A;  2W85 A;  4OMZ A;  4KN7 X;  4B8X A;  1MKM A;  4RAY A;  4GCV A;  3NRV A;  3GFM A;  2IP2 A;  2NRA C;  1B9N A;  5D6E A;  2WTE A;  4BAY A;  5K1Y A;  1MJ9 A;  4EQQ A;  3M8F A;  3BJA A;  1W4M A;  3MEX A;  2ISY A;  2ZKZ A;  4R1H A;  4P96 A;  4IHT A;  4N0B A;  3M9A A;  1E2X A;  2PBI A;  3RKY A;  1DDN A;  3GVA A;  4RGU A;  3DP7 A;  5L3G A;  2V9V A;  2B0L A;  4U0W A;  5E1Z B;  2P6T A;  2X4H A;  1HQC A;  3I5U A;  3N97 A;  2K4J A;  1UST A;  5CVU A;  4KIG A;  3WG9 A;  2K86 A;  2HKX A;  2YX7 A;  3TOA A;  4HQE A;  1O3T A;  3FMS A;  1J9I A;  1XSX A;  2QQA A;  4G9Y A;  4RGS A;  1P4X A;  2P7C B;  1MZB A;  4IPA A;  2Z33 A;  3LQR A;  5D4S A;  3ELK A;  1CGP A;  1YW7 A;  2D1V A;  2MBF A;  1BBY A;  2ZO4 A;  3F22 A;  2PLY A;  2L4A A;  2DFI A;  2DI3 A;  5LGU A;  1RNL A;  4KFC A;  1MJA A;  2JZY A;  2KIU A;  3K9T A;  3WTV C;  4UVB A;  2ZJ2 A;  2GQQ A;  3ERE D;  5FB2 A;  1DPU A;  3LA7 A;  4HOB A;  2HWV A;  4WX9 A;  1S7A A;  4AIH A;  1W5S A;  2DO7 A;  3SHF A;  2FSW A;  3E6M A;  3ULQ B;  3GF2 A;  2E7W A;  2PFB A;  4A6E A;  4EJT A;  1IUY A;  3M8E A;  3ZP5 A;  1YFH A;  2DPD A;  1U5T C;  2JRT A;  1TBX A;  2W84 A;  5LHG A;  3CUQ C;  5KVR A;  3L9F A;  3CDH A;  4BXU A;  1YW8 A;  1K78 B;  4BQA A;  3H92 A;  4L9J A;  4UNO A;  3RKW A;  1FC3 A;  2QZ8 A;  2V1X A;  3GWZ A;  2BBY A;  3CO6 C;  4QLC U;  5AIP A;  5ICF A;  4JQF A;  3QPH A;  5FD6 A;  2XGX A;  1FBS A;  3QP6 A;  3QOP A;  1XGS A;  4HYE A;  2HYF A;  1JGS A;  5DCF A;  5LGN A;  1D3Y A;  2E1N A;  1U78 A;  1T38 A;  3RDI A;  1KYW A;  5JR3 A;  1O3S A;  3G3Z A;  3HSE A;  4G94 A;  4CIC A;  2V1U A;  3ABT A;  1K6O A;  1OKR A;  3KP2 A;  1RZ4 A;  3OOP A;  2MLG A;  4JBA A;  4U0V A;  5E1W A;  3F72 A;  4Y15 A;  3WTY C;  5BMZ A;  4G7O F;  5ERI A;  1P6R A;  2EFQ A;  4YIF A;  4GYG A;  3K69 A;  2MLK A;  1P4W A;  2AS5 F;  2OU2 A;  2E1C A;  2UZK A;  1ZRE A;  3HOT A;  2P5K A;  4ZYD A;  2OQR A;  1S8N A;  3HRS A;  2CG4 A;  2CQK A;  3HUG A;  4HAM A;  4WXC A;  3FWE A;  2PN6 A;  1G6N A;  2JT1 A;  5D4R A;  4LG0 B;  3I59 A;  2IA2 A;  1SAX A;  3ZMV A;  1KQ9 A;  3HRM A;  2DBB A;  1RUO A;  3ISP A;  2W25 A;  3O2P E;  4KIB A;  4WWC A;  1BM9 A;  3LFK A;  3V8L A;  3R6S A;  3CO7 C;  3SZT A;  3JSO A;  4O3M A;  4MGR A;  2ZNY A;  3RYR A;  2G7U A;  1CF7 A;  1YS6 A;  1R58 A;  1ZHF A;  4I0B A;  5E18 F;  1T0F A;  2A6H F;  2F5D A;  5LEJ A;  2V79 A;  1BN5 A;  2XAJ A;  1PDN C;  1ON2 A;  5ICE A;  3BDD A;  3S2W A;  2R3S A;  3TO9 A;  1IXC A;  3RTR A;  3TGN A;  3JW4 A;  5K5R A;  3KZZ A;  3GW2 A;  4OMY A;  5D8L B;  3L2C A;  4CO8 A;  1DP7 P;  1R36 A;  4OIO F;  1UHM A;  3BY6 A;  5ILU A;  2YPR A;  2HQR A;  3FZV A;  4Q47 A;  5LHI A;  3JTG A;  1YG2 A;  5D5U B;  3BJO A;  1REP C;  4ETS A;  5BQT A;  1IRG A;  4ENK A;  4O6J A;  5DUK A;  1I1G A;  3I54 A;  4WXD A;  1V3F A;  3C18 A;  5E8G A;  1EH6 A;  4EM0 B;  4XLN F;  5F6F A;  5L3D A;  1BOA A;  4ZZL A;  3E3V A;  4LK1 F;  4IRI A;  1ZAO A;  3GFL A;  5D5V B;  5LRR A;  1B1B A;  1HKT A;  2XAF A;  5ILS A;  1UCR A;  2QM3 A;  4M9X A;  1ZYR F;  3F6V A;  1JE8 A;  2QLZ A;  1FY7 A;  3DV8 A;  1IN7 A;  1IAW A;  4LLN A;  4YII A;  4ESJ A;  2VT3 A;  4RAZ A;  3KFW X;  2IPQ X;  2IT0 A;  1TW2 A;  4GGG A;  1W7P A;  4JK1 X;  4MEX F;  1T98 A;  2RVC A;  2LKP A;  1R5H A;  1LDD A;  4OU0 A;  3RPU A;  3U2R A;  3WTU C;  4HLY A;  5DD8 A;  2DQL A;  4IHS A;  4Q5S F;  1YO5 C;  1XDU A;  5CVR A;  4IRH A;  2HTJ A;  4EGZ A;  2EFN A;  4M6X A;  1OMI A;  2BE5 F;  3WTT C;  1OYY A;  1KQ0 A;  2XIG A;  5D6F A;  4IVN A;  3E6B A;  4ASN A;  3VOE A;  2ISZ A;  5JHU A;  2ACJ A;  4EJU A;  3QRF F;  3EUH A;  2PJP A;  1KU9 A;  4RGR A;  3MZY A;  3F8B A;  3WTX C;  1SD6 A;  3I53 A;  5DV5 A;  3GZ5 A;  3QU3 A;  2GIV A;  1ZRF A;  2DK8 A;  1ZG5 A;  3U9G A;  3P9K A;  1IN6 A;  1HW1 A;  5DEQ A;  4B09 A;  1GHC A;  3CUQ A;  4N9H A;  2QYO A;  3FXR A;  1IRF A;  4RB2 C;  5HS9 A;  4KN4 X;  2DT5 A;  2HZT A;  3ZMT A;  3BRO A;  2L02 A;  3KLN A;  2VOO A;  2JTV A;  5CVJ A;  2UWM A;  4MTD A;  4DQ2 A;  2XKO A;  3FMQ A;  1K7A A;  3V8K A;  3T8T A;  2UXX A;  2JPB A;  1B9M A;  2YX4 A;  1S7O A;  4KT5 C;  2OAZ A;  2EV5 A;  2ELH A;  4GXO A;  3J81 K;  4PGH A;  4OOI A;  2R7F A;  4EJV A;  3QPT A;  4F7Z A;  2FQ3 A;  5ILV A;  5A2Q Z;  4ON0 A;  1T2K A;  3HRT A;  1SFE A;  4A0X A;  1F9N A;  1ZGJ A;  4G8X A;  2JSC A;  3RIR A;  2MC3 A;  2F5E A;  3KLO A;  4QWQ A;  3BWG A;  2IA1 A;  4U0Y A;  2O3F A;  1STZ A;  2J5O A;  1O7L A;  2M30 A;  3ECO A;  3GFJ A;  2BEO A;  1GXQ A;  3WGH A;  4RB0 A;  4L18 B;  2NNN A;  5AON A;  6PAX A;  4KA4 A;  1J7K A;  4HBL A;  4CGZ A;  1OR7 A;  2ZXJ A;  2H09 A;  3O6B B;  4RB3 C;  4CZZ A;  3HYI A;  1XMA A;  4WCG A;  4U88 A;  2ZCW A;  3L00 A;  3E5X A;  3E5U A;  4WK8 F;  3F8F A;  5FFX A;  2EV0 A;  5AIQ A;  4LD5 A;  2HTS A;  1IXS B;  4IXA A;  1BI2 A;  1KU2 A;  4LK0 F;  2PMH A;  2XKP A;  3FX3 A;  2H6C A;  3K1N A;  2FOK A;  3BJ6 A;  2ESH A;  3IRQ A;  2DPU A;  1WSU A;  3KP7 A;  3JAM Z;  2A07 F;  2OZU A;  3ZPL A;  3LAJ A;  2CYY A;  4Q48 A;  2L54 A;  4BH9 A;  4G6Q A;  2FBH A;  5FLX Z;  2LSO A;  1FBQ A;  1HSJ A;  3K0L A;  3OV8 A;  4KDP A;  1RUN A;  3WTZ A;  5LBQ A;  4HLX A;  1KU7 A;  1WKM A;  2Y75 A;  1Z9C A;  1EH7 A;  3DPT A;  2GXB A;  4L9T A;  2PI0 A;  1BJA A;  2M5W A;  3BP8 A;  1G3W A;  5HS8 A;  4YFK F;  4U7B A;  3I0T A;  4XLP F;  2P5L C;  1F5T A;  1ZH5 A;  1LJ9 A;  3KP3 A;  4UUV A;  4PCQ A;  3I71 A;  2DU9 A;  1Z6R A;  3RI4 A;  3C3W A;  1C0W A;  1S6L A;  2D2W A;  4LFU A;  3D0S A;  4KIC A;  2HR3 A;  3MZH A;  4EV0 A;  1O3Q A;  1USS A;  2FA5 A;  1MJB A;  3KCC A;  3IRR A;  2CWE A;  2EFW A;  1H9T A;  4LB6 B;  1IN5 A;  1J75 A;  2JPC A;  5HDG A;  2MA3 A;  4EM2 A;  3REO A;  1ZRC A;  4GYI A;  4HF0 A;  1SD7 A;  1R22 A;  4P55 A;  1ODD A;  3J81 Z;  1XSD A;  2D45 A;  2OD5 A;  3SZP A;  2PG4 A;  4G6D A;  1K78 A;  4LLG F;  3F6O A;  1D8J A;  2V6C A;  4RGX A;  1BI0 A;  3LST A;  4LJZ F;  3KET A;  2MH2 A;  1Y0U A;  3FHZ A;  3V7R A;  1YQA A;  3B73 A;  1QBJ A;  1P2F A;  2FEZ A;  2RN7 A;  1MD0 A;  4RS8 A;  2M8E A;  4UVC A;  4XBF A;  2EK5 A;  5TJJ A;  2K27 A;  4IRG A;  3LA3 A;  4UHT A;  3KEO A;  1ZG3 A;  4HF2 A;  1QGP A;  3ZN0 A;  5LHH A;  2GAU A;  2ZME B;  3I4P A;  2LNB A;  3WTW C;  3GUD A;  1LDK B;  5FO5 A;  1LDJ A;  4OIQ F;  1FNN A;  2IA0 A;  2A3S A;  2XVC A;  3GZ6 A;  2FML A;  1G4D A;  2DQR A;  4HX4 A;  2IW5 A;  2HS5 A;  4XSZ F;  2M1B A;  3GXO A;  3RKX A;  3NEU A;  4I2O A;  5BOX A;  4PGG A;  3TDU C;  1H9G A;  1Z05 A;  1D8K A;  2J5P A;  1TQP A;  3W6J B;  4A12 A;  1UFM A;  4M6Y A;  3DQV C;  3BZ6 A;  1IXR C;  1LEA A;  1BI1 A;  3WGG A;  1T6S A;  3T8R A;  3WE2 A;  1GVJ A;  3ZMD A;  5L3C A;  2VBX A;  3ZMZ A;  3IWF A;  2O03 A;  1YS7 A;  2NAZ A;  1EH8 A;  2FNA A;  5BS6 A;  1XGN A;  4M71 A;  2HEO A;  4LG0 A;  4ZYG A;  2QUF A;  1T39 A;  1A04 A;  3VEP A;  3KP6 A;  1BC7 C;  4UV8 A;  4LLL A;  5HLI A;  3AAF A;  1XDS A;  3KP4 A;  2K4B A;  2EA2 A;  2OBP A;  3MQ0 A;  1G3S A;  2LF8 A;  5K5O A;  2EV6 A;  4PZJ A;  1TTY A;  4HQM A;  3W6K B;  5A2Q K;  4ZZD A;  2Z5U A;  2Z3Y A;  3T1B A;  3JSP A;  1G3Y A;  4M9S A;  5HLH A;  2HOE A;  2FBI A;  5BPI A;  2BV6 A;  2Y48 A;  3WGI A;  2GWR A;  5DCM A;  4L5J A;  2K7L A;  1R5G A;  4EJW A;  3KEQ A;  5DYM A;  2CW0 F;  2VC1 A;  1OPC A;  2WC2 A;  2W24 A;  4FX0 A;  1KA8 A;  1SFU A;  2C6Y A;  3L09 A;  2RNJ A;  1MGT A;  2VXZ A;  5FD5 A;  2FMY A;  3TO7 A;  1MDM A;  2G7H A;  1ZLJ A;  4HV5 A;  2YU3 A;  2PQ8 A;  3V4G A;  3TO6 A;  4Y17 A;  4A5M A;  2VOP A;  3E97 A;  5E17 F;  4FT8 A;  2QEN A;  1P92 A;  2A5Y B;  3P9I A;  2HKO A;  1PP7 U;  4I7H A;  1LNW A;  1YLF A;  2PEX A;  3JAM K;  3F21 A;  3E5Q A;  4MNU A;  4EVI A;  2KKO A;  2P6S A;  4MTE A;  5DUI A;  2KIM A;  3HRU A;  3GO5 A;  1QNT A;  5BPD A;  1J0R A;  1WQ2 A;  2VBY A;  2K02 A;  5FLX K;  5H6R A;  3FM3 A;  5LGT A;  4KNY A;  2A69 F;  1JXS A;  5CVI A;  5DD4 A;  2M45 A;  3ML6 A;  1U5T B;  3CTA A;  1G3T A;  3MCZ A;  5L3B A;  3FXU A;  2O6G E;  3CLO A;  3CUQ B;  4MQ9 F;  1KGS A;  2ADU A;  3TOB A;  1HBX G;  4I0A A;  1F1Z A;  4OIP F;  3BOQ A;  3CJN A;  3MFK A;  2X0L A;  5ICG A;  2E7X A;  4KMF A;  4A0Y A;  1HST A;  1PUE E;  1LEB A;  4Z2Y A;  2DW4 A;  2RDP A;  4IJA A;  3R0J A;  5HDN A;  2STW A;  4L0Z B;  3J80 Z;  3VFZ A;  3ABU A;  3DXJ F;  1K79 A;  3IHU A;  4HDU A;  4BYY A;  2Q2E A;  3QP5 A;  1XCB A;  3T0Y A;  1SMT A;  2QBY A;  1I5Z A;  3TQN A;  4NQW A;  3RJP A;  3IKV A;  4CYD A;  4ZYH A;  4I02 A;  3QAH A;  4FHT A;  2XAS A;  3C1D A;  4H0E A;  2WWY A;  3H3Z A;  4O5V A;  1B4A A;  3EYY A;  1O3R A;  1HW5 A;  1OYW A;  3DF8 A;  1SD5 A;  1XGM A;  3F8C A;  4PDK A;  5HLG A;  4U7D A;  1SD4 A;  2KIF A;  4P5O A;  5IT9 Z;  1EV7 A;  2GA1 A;  2OA4 A;  4YG2 F;  3WTS C;  1FZP B;  2RKH A;  3LAP A;  2V1D A;  3GFI A;  2FBK A;  4KYW A;  3M1E A;  3HHH A;  2H27 A;  2EB7 A;  4AVP A;  3GLX A;  1LB2 A;  4L9V A;  5L3F A;  3R60 A;  3HHG A;  1W7P D;  2GXG A;  1HXD A;  4Q4Z F;  4L5I A;  1BI3 A;  2EJR A;  3Q9V A;  1FYL A;  4M74 A;  5KK1 A;  2L01 A;  2HYG D;  3HSF A;  3WOD F;  2VE9 A;  5CYV A;  3FM5 A;  4KUM A;  4P9U A;  2Z9O A;  1KQ8 A;  3ZMU A;  3LWF A;  2F2E A;  1FPQ A;  2L3D A;  1ONV A;  3WU0 A;  1HKQ A;  3I58 A;  5IT3 A;  2STT A;  4CHU A;  2Z99 A;  1R1V A;  3L7W A;  1TW3 A;  5EEG A;  2VT2 A;  1V4R A;  5J6X A;  3GX4 X;  3I64 A;  1B6A A;  3HIF A;  1D5V A;  1FT9 A;  4HA8 A;  2A6E F;  1WI9 A;  1W5T A;  5FGM A;  1O57 A;  2M87 A;  2A61 A;  2Y0M A;  2DLL A;  2H6B A;  3WU1 B;  2O8X A;  1ON1 A;  4I01 A;  1FSE A;  5FFZ A;  3DFG A;  4OIN F;  1FX7 A;  4ENM A;  3K1M A;  2P5V A;  4G7H F;  5F1R A;  1S29 A;  3GEZ A;  3EET A;  3KZY A;  3TKY A;  2PMU A;  3E6D A;  3SXY A;  2BYV E;  3HSR A;  1Z1D A;  4M73 A;  3R0A A;  5TRD A;  2P4W A;  2HGC A;  5H6Q A;  2NYX A;  1U2W A;  2W57 A;  4CDG A;  1R23 A;  4K2E A;  5LLQ A;  3F8M A;  1AOY A;  2QWW A;  4R8H A;  4NHJ A;  5H20 A;  4LB5 A;  1FP1 D;  2KJB A;  1I6X A;  3DPL C;  2HDC A;  2VE8 A;  3C7J A;  3EYI A;  2A68 F;  3K1P A;  5CLS A;  3FXQ A;  1KU3 A;  1ULY A;  3HTU A;  1FBU A;  3ROU A;  1PP8 F;  1XGO A;  4GO1 A;  1P4A A;  1QZY A;  2QVO A;  1YYV A;  2ZBK A;  2VON A;  1J2X A;  4A6D A;  1TQM A;  4N9I A;  2BGC A;  4HX7 A;  1FOK A;  3U1D A;  2NS0 A;  2FXA A;  2XAG A;  3N4M A;  1FYK A;  5E8I A;  3TDZ C;  1E17 A;  3PQK A;  4CXF A;  2EA4 A;  2YR2 A;  3R4K A;  2FRH A;  4L9N A;  1Z91 A;  4BHB A;  3BPX A;  4AIJ A;  4MEY F;  2G9W A;  3NQO A;  5D5W B;  1FSH A;  4S05 A;  2LDU A;  3COA C;  2AXL A;  2EFP A;  3KE2 A;  5J8F A;  3RYP A;  2HQN A;  1XMK A;  1BIA A;  1IN8 A;  1ZAR A;  1S3J A;  1R7J A;  1XD7 A;  1SFX A;  4IF4 A;  2EWN A;  4RB1 A;  5CJ9 A;  5J8C A;  1H0M A;  4FX4 A;  2RV8 A;  4YFN F;  2IRF G;  3PFI A;  2TDX A;  2ESN A;  2FU4 A;  1DPR A;  4BHC A;  2YSR A;  4P9F A;  1JHF A;  2ETH A;  3IL2 A;  2F5C A;  4UXN A;  1Z7U A;  3I59 B;  4ESF A;  5F64 A;  4AWX B;  3D5L A;  2R7D A;  1ZLK A;  2WV0 A;  3M7G A;  4EJO A;  3SQN A;  3Q9S A;  4Y13 A;  1SMY F;  2KJC A;  2ZME A;  2FE3 A;  2XUB A;  2XHK A;  2OQG A;  2FF4 A;  1CF7 B;  4AD9 A;  4BHP A;  4I98 B;  2MD5 A;  5K5Q A;  1OYI A;  4A0Z A;  3H3U A;  5E20 A;  1Q1H A;  3QU6 A;  3P9C A;  3Q5F A;  3MWM A;  3EQL F;  4YFX F;  4WF2 A;  3J80 K;  3ZMS A;  4I09 A;  4HZF A;  1XN7 A;  4XSX F;  4EMS A;  4HW0 A;  3GYH X;  4UV9 A;  1L3L A;  4XRF A;  4R79 A;  1U8R A;  4E70 A;  2MH9 A;  4MQV A;  2VN2 A;  4ZH4 F;  2ZFW A;  5HS7 A;  3E6C C;  5HDK A;  2CSO A;  4KIF A;  1FYM A;  5DCM B;  1QO0 D;  3RPQ A;  1TNS A;  1TLH B;  3V8J A;  5IT9 K;  3ZN1 A;  2ZNZ A;  5D5X B;  1XSV A;  4WXH A;  2GA2 A;  3VB2 A;  3LA2 A;  5DDG A;  4MHG A;  3EDP A;  1IZ1 A;  2RC4 A;  1MDM B;  1NHA A;  3R61 A;  1R00 A;  4ENN A;  2CO5 A;  2O0Y A;  4EGY A;  3B02 A;  1YIO A;  1FWZ A;  2DTR A;  2CFX A;  1HW2 A;  4M9Z A;  1R1T A;  3V7C A;  1HKS A;  3BPV A;  5D8K B;  2DAO A;  1UHW A;  2FNP A;  4S04 A;  2VBW A;  1JHH A;  2IVM A;  3F3X A;  1AWC A;  2L4M A;  1W7P B;  4ESB A;  2EFO A;  1L0O C;  1KYZ A;  3G73 A;  3P7N A;  1U6G A;  2RGV A;  1F4K A;  1U3E M;  1TNT A;  2CGP A;  4G7Z F;  5HOO A;  5CVV A;  2VOD A;  3HTS B;  2UXN A;  2LF7 A;  3DKW A;  3HOS A;  1FLI A;  2COM A;  2D1H A;  1RI7 A;  1ZGA A;  4TV7 A;  1XCV A;  1VTN C;  2DK5 A;  2RQP A;  1GXP A;  2KRF A;  2VC0 A;  1ZRD A;  1I1S A;  3DEU A;  2F5F A;  5ED4 A;  4D0P A;  3IWZ A;  2HFH A;  2OZ6 A;  3SFZ A;  4ZYE A;  3V7S A;  2XRO A;  1UB9 A;  1WWX A;  1QPM A;  5JI6 A;  1BC8 C;  4HDV A;  1J59 A;  3J7A O;  1DUX C;  2P8T A;  1FP2 A;  2XAQ A;  4LMY A;  1I27 A;  3FF5 A;  1LVA A;  5HVQ C;  4OIR F;  4HX8 A;  5E1X A;  4ENJ A;  4M72 A;  3PQJ A;  1R1U A;  3K2Z A; 
#chains in the Genus database with same CATH topology
 2XPV A;  1OCP A;  1RIO H;  1LQ1 A;  2Q0O A;  2VPL A;  5CQE A;  3LFU A;  2O61 A;  3BTC A;  2G0E A;  2ZXH A;  2QBY B;  1QQI A;  4NQW B;  1U5T A;  1IF1 A;  4MIM A;  2L7Z A;  1O7F A;  1IN4 A;  2H8W A;  2P7V B;  3F8N A;  3ZQ7 A;  2BW3 A;  2FUG 2;  2QQB A;  3O3K A;  2B7E A;  5EEH A;  4XM3 A;  4HF1 A;  1WPK A;  4PSX A;  5JVG F;  3F23 A;  1X3U A;  4BE0 A;  1B59 A;  1YW9 A;  1ZN2 A;  3M8J A;  4DNC A;  1F36 A;  3KP5 A;  3VYT B;  4A3I J;  1MBF A;  4A2U A;  1QVT A;  3CUO A;  2JWT A;  3ECH A;  1Z6T A;  1BIB A;  2XV4 S;  2IJL A;  3JTH A;  5LRS A;  3EUK L;  1N78 A;  4IHW A;  3IC7 A;  1WRJ A;  3WE3 A;  4A5N A;  4DBQ A;  3VOD A;  1HDD C;  2H94 A;  1IW7 F;  5LEK A;  4LGW A;  4IQJ A;  2ID3 A;  3JCU C;  4HV6 A;  4NB5 A;  4EM1 A;  2K9N A;  1X1D A;  4BNC A;  1ZG1 A;  2FOW A;  2VB6 A;  4UVA A;  1TQI A;  2Q8K A;  3RZD J;  5F0C A;  2GLO A;  1TT5 B;  2XRN A;  1LFP A;  1YTY A;  3IKT A;  1NTC A;  5ICC A;  5JFR A;  5L3E A;  1FMV A;  4NC7 A;  2XAH A;  3LQQ A;  3FXM A;  3MAJ A;  4KMU X;  4BUP A;  3FMR A;  2GZW A;  1XB4 A;  4D9J A;  4M3F A;  2H1L A;  5J47 A;  2NNY A;  1B72 A;  3OYJ A;  2XRL A;  3OYL A;  2VXD A;  4IKF A;  1JJ8 C;  2E1O A;  5GAG J;  3T5X A;  4E7L A;  4DZJ A;  4L0Y B;  4QPO A;  1VQO I;  3TP0 A;  1J5Y A;  4HNU A;  2VKH A;  4AIK A;  5JLX A;  2VBZ A;  3BCA A;  3BR1 A;  5JVT A;  4D1Q A;  1X4O A;  3FXK A;  1QZZ A;  2QQ9 A;  2W85 A;  4OMZ A;  4UY8 I;  4MO7 A;  4KN7 X;  2ID6 A;  4B8X A;  1VQN I;  1MKM A;  4NDL A;  4RAY A;  1BOB A;  4GCV A;  5J1Y A;  3AG4 H;  4XIC A;  3NRV A;  3GFM A;  3K4L A;  1X1B A;  2IP2 A;  2NRA C;  3KYC B;  3NWS A;  4UUS A;  1B9N A;  5D6E A;  2WTE A;  4BAY A;  5K1Y A;  1MJ9 A;  4EQQ A;  3M8F A;  3ZXS A;  3BJA A;  1W4M A;  3MEX A;  2ISY A;  3OY9 A;  1Y56 A;  2ZKZ A;  4R1H A;  2VI6 A;  4P96 A;  1WGX A;  5EDN A;  5FLV A;  1TP4 A;  4YIR X;  4IHT A;  2DOD A;  4N0B A;  3M9A A;  1E2X A;  2PBI A;  3RKY A;  2XGC A;  2IGK A;  3KYL A;  1DDN A;  2LTP A;  3GVA A;  2VLA A;  4RGU A;  3EUA A;  1A5J A;  3DP7 A;  1K83 J;  3HPH A;  3B6C A;  5L3G A;  1BW6 A;  2V9V A;  5FKO A;  4RDU A;  1OCR H;  2B0L A;  4U0W A;  5LD2 C;  2B63 J;  4FCY A;  1RC9 A;  4NNJ A;  5E1Z B;  5J3L A;  4RA2 A;  4QIW N;  2P6T A;  2X4H A;  3CZ6 A;  1HQC A;  3DTE A;  3I5U A;  3HB9 A;  3N97 A;  2K4J A;  1FTZ A;  1UST A;  2KRC A;  5CVU A;  4KIG A;  3WG9 A;  3CCJ I;  2EBI A;  1VQ8 I;  2XC7 A;  2K86 A;  2HKX A;  3CLQ A;  2YX7 A;  3TOA A;  4HQE A;  1O3T A;  3FMS A;  1J9I A;  1XSX A;  3FBN B;  1VND A;  2QQA A;  2NS8 A;  4G9Y A;  2HVR A;  1I3Q J;  2L9N A;  4QPQ A;  4XLH A;  2JA2 A;  3AG2 H;  4RGS A;  1P4X A;  2P7C B;  4C2U A;  1MZB A;  4IPA A;  2Z33 A;  3LQR A;  5D4S A;  3ELK A;  2X1E A;  3S1N J;  1CGP A;  2BY2 A;  2KL4 A;  3L1P A;  2M34 A;  3S3M A;  1YW7 A;  2D1V A;  1WJA A;  2MBF A;  5IP7 J;  1BBY A;  2R7S A;  2ZO4 A;  4S0H B;  3F22 A;  2PLY A;  1HOM A;  5HLT A;  1ZEL A;  4LG3 A;  2L4A A;  3Q0U A;  2DFI A;  2DJN A;  2DI3 A;  3HEF A;  5LGU A;  1RR8 C;  2GOX B;  1RNL A;  4KFC A;  4A3M J;  1MJA A;  2JZY A;  1P9Q C;  2HDW A;  1K6Y A;  5EG0 B;  1HCR A;  1ENH A;  3HDD A;  2VKD A;  2XB5 A;  2KIU A;  3LNQ A;  3K9T A;  3WTV C;  4UVB A;  5GPA A;  2ZJ2 A;  2GQQ A;  4Y3O A;  4XID A;  2R7O A;  3ERE D;  1WJB A;  3WG7 H;  5FB2 A;  2DA5 A;  3TED A;  1UEL B;  3WHB A;  1A6I A;  5GP9 A;  1DPU A;  3LA7 A;  4HOB A;  1LE8 B;  1R5I D;  2HWV A;  4WX9 A;  1DP3 A;  4XN0 A;  1S7A A;  3HKZ A;  2DA6 A;  4AIH A;  1W5S A;  4D7N A;  2DO7 A;  3SHF A;  2FSW A;  3E6M A;  1N25 A;  3ULQ B;  3EUH C;  4E7H A;  3J7Z I;  3GF2 A;  2E7W A;  2PFB A;  2K85 A;  4A6E A;  3GBG A;  4EJT A;  1IUY A;  1ETO A;  1OCO H;  5J4V A;  2DDA A;  3M8E A;  5JLW A;  3ZP5 A;  2XGD A;  4BS9 A;  3D5S C;  1YFH A;  3FK7 A;  2DPD A;  1WJD A;  1U5T C;  2JJ7 A;  3CCM I;  4A3K J;  2JRT A;  3BR2 A;  2W48 A;  3DBH B;  1TBX A;  4BQN A;  2W84 A;  5LHG A;  3CUQ C;  5KVR A;  1MH3 A;  3L9F A;  3G1O A;  1P7J A;  4BBR J;  3CDH A;  4BXU A;  1YW8 A;  1K78 B;  1EF4 A;  2LRD A;  3FK6 A;  3FIS A;  3H92 A;  4L9J A;  4BQA A;  4UNO A;  1Z3Y A;  5IYD J;  3RKW A;  3DTI A;  1FC3 A;  2QZ8 A;  2PJR B;  2EIN H;  2L7M P;  2R5Y A;  2E35 A;  2V1X A;  1MBE A;  3S3N A;  3GWZ A;  1X3Z B;  2BBY A;  3ZQI A;  4XRS G;  2HXI A;  3H9J A;  3IP4 B;  4QLC U;  3CO6 C;  1DGW Y;  5AIP A;  5ICF A;  4JQF A;  3QPH A;  5FD6 A;  2F6C A;  2L9S A;  1UMQ A;  1ZR2 A;  2XGX A;  1FBS A;  3VDX A;  5IPA A;  3M4O J;  3QP6 A;  4F3Q A;  1AA7 A;  3G2B A;  3QOP A;  3LL7 A;  2VJJ A;  1XGS A;  1JKR C;  4HYE A;  1MBJ A;  2HYF A;  3GME A;  1JGS A;  2QGU A;  2X85 A;  5DCF A;  1AKH B;  3GTK J;  5LGN A;  2QCO A;  2JVH A;  1D3Y A;  2E1N A;  2DFH A;  3HXL A;  1U78 A;  1T38 A;  2LK2 A;  2QQ8 A;  3RDI A;  5J1U A;  1TT0 A;  1KYW A;  2Y31 A;  5JR3 A;  3CDL A;  4BJ5 C;  5FKN A;  2FX0 A;  2WB1 N;  1O3S A;  3G3Z A;  2HPM A;  3HSE A;  4G94 A;  4CIC A;  2V1U A;  3ABT A;  1K6O A;  1OKR A;  4HEA 2;  1UG2 A;  3KP2 A;  3KYD B;  3ZGK A;  1SFK A;  2LC2 A;  1RZ4 A;  3OOP A;  2MLG A;  4JBA A;  2L7F P;  4U0V A;  5E1W A;  1MSF C;  4Z6Y A;  3H3V K;  3F72 A;  4Y15 A;  1WJE A;  3W3C A;  5FRN A;  3WTY C;  2CQ7 A;  5M5X J;  3JRD A;  5BMZ A;  1QHG A;  2K3F A;  1UHS A;  2DOA A;  3OYH A;  3H5A A;  1BR1 A;  4G7O F;  3K4K A;  5ERI A;  1P6R A;  2EFQ A;  3OIO A;  1QPI A;  3PSF A;  3OYM A;  3A01 B;  4YIF A;  4GYG A;  3K69 A;  5J4Y A;  2MLK A;  1Z67 A;  1R49 A;  4CZC A;  1P4W A;  2AS5 F;  1JUS A;  2OU2 A;  2E1C A;  2UZK A;  1ZGW A;  1ZRE A;  2VJ5 A;  3MKY B;  3HOT A;  2P5K A;  4I6Z A;  4ZYD A;  2OQR A;  1S8N A;  3HRS A;  2CG4 A;  1DGR M;  1W0T A;  1PVE A;  2CQK A;  3HUG A;  5IOZ A;  4HAM A;  2OTL I;  3MN2 A;  4WXC A;  1GV2 A;  3FWE A;  2PN6 A;  4HNV A;  4PJM A;  1G6N A;  2BHY A;  2JT1 A;  3M07 A;  5D4R A;  2X51 A;  3TBI A;  4AYB A;  4LG0 B;  2GOM A;  3I59 A;  2IA2 A;  4IOC F;  1WI3 A;  1SAX A;  3ZMV A;  2LOO A;  1KQ9 A;  3HRM A;  2DBB A;  5FRO A;  2W4S A;  1RUO A;  3ISP A;  3OWT A;  2W25 A;  1H88 C;  3O2P E;  4KIB A;  3TW6 A;  4WWC A;  1BM9 A;  3HGG A;  3LFK A;  3V8L A;  3R6S A;  3CO7 C;  3BR5 A;  2Y30 A;  3LOC A;  3SZT A;  3JSO A;  2OF7 A;  2K9Q A;  4O3M A;  4MGR A;  5KAF C;  2ZNY A;  3RYR A;  3ZOB A;  4GRI A;  3BQY A;  2G7U A;  4BEH B;  1CF7 A;  2ME0 A;  1YS6 A;  1R58 A;  1R6R A;  1ZHF A;  2LG4 A;  3UNG C;  2E71 A;  4I0B A;  5E18 F;  1T0F A;  5CPR B;  2A6H F;  4UUT A;  3OS2 A;  2F5D A;  3HKZ N;  5LEJ A;  2EIL H;  1PUF B;  2V79 A;  3IV5 A;  1ZR4 A;  2MYS A;  1BN5 A;  3S8P A;  1ETW A;  2HNH A;  3W2W A;  2XAJ A;  1PDN C;  2UUZ A;  3CJQ B;  1ON2 A;  5ICE A;  1DU6 A;  4F91 B;  4IHV A;  3BDD A;  3D5R C;  3S2W A;  2BOL A;  4NC8 A;  4EEF G;  2R3S A;  3K4M A;  3TO9 A;  1IXC A;  3VSK A;  2A5W A;  2OC6 A;  2TRT A;  2LY1 A;  3RTR A;  3TGN A;  3JW4 A;  5K5R A;  3N05 A;  1IRZ A;  3KZZ A;  3GW2 A;  2LBF A;  4C9Y A;  4MFE A;  4OMY A;  5D8L B;  4M3D A;  3L2C A;  4CO8 A;  1DP7 P;  2DXI A;  1LUJ B;  1R36 A;  1VQ7 I;  4OIO F;  1UHM A;  3BY6 A;  5ILU A;  2JK3 A;  2HQR A;  2YPR A;  3FZV A;  1D1B A;  1Y1V J;  4Q47 A;  5LHI A;  2KPM A;  4UB6 C;  3JTG A;  3OYK A;  2DYR H;  3BLY A;  5M3F J;  1YG2 A;  5D5U B;  1SVO A;  2L9R A;  2NOJ B;  3BJO A;  4ETS A;  5F0F A;  5BQT A;  1B8I A;  1REP C;  1IRG A;  2EQR A;  4ENK A;  4O6J A;  3MZ8 A;  5DUK A;  3L2R A;  4M6V A;  1I1G A;  3I54 A;  4WXD A;  3CMM A;  1JGG A;  1V3F A;  4BU2 A;  3C18 A;  3F0C A;  5E8G A;  2RAE A;  1EH6 A;  3RZO J;  4EM0 B;  1ETY A;  4JX6 A;  4XLN F;  5F6F A;  5L3D A;  1BOA A;  1SVM A;  4ZZL A;  2R5Z B;  4PFP A;  2R7T A;  3E3V A;  4LK1 F;  4IRI A;  2K3P A;  1ZQ3 P;  2RRE A;  1ZAO A;  1JUM A;  3DLA A;  3GFL A;  4CCN A;  3QYE A;  4XKW A;  3CC4 I;  3OYD A;  2QKM B;  5D5V B;  2OTJ I;  3AG1 H;  2BVM A;  5LRR A;  1B1B A;  2ZB9 A;  1HKT A;  2E5Z A;  2XAF A;  3CJR B;  2Z2S B;  5ILS A;  2EZH A;  1FTT A;  1Y8R B;  1UCR A;  2W82 A;  4X1E A;  3OL3 A;  3CMY A;  2QM3 A;  4M9X A;  3CDI A;  1V54 H;  2ECC A;  1ZYR F;  3F6V A;  1D0Z A;  2K40 A;  3ABM H;  2QLZ A;  1JE8 A;  3OYC A;  3QOE A;  3K70 D;  4BDY A;  1FY7 A;  3DV8 A;  1IN7 A;  1NK3 P;  1IAW A;  4LLN A;  2HOS A;  1FIP A;  1WH7 A;  4YII A;  4ESJ A;  4B48 A;  2VT3 A;  4RAZ A;  3KFW X;  1P7I A;  2IPQ X;  3M1C A;  1JJ6 C;  1X3W B;  2IT0 A;  4FE4 A;  3CMA I;  1TW2 A;  2E36 A;  4GGG A;  1W7P A;  4JK1 X;  2DYS H;  1ETQ A;  4MEX F;  2LP0 A;  4CSW A;  1T98 A;  2RVC A;  1BW5 A;  2BY1 A;  2OCC H;  2LKP A;  1R5H A;  5M3M J;  1E0E A;  4A69 C;  1LDD A;  1JT0 A;  2X6O A;  4HST A;  4OU0 A;  3RPU A;  3U2R A;  2WAQ N;  3WTU C;  3HL2 A;  4HLY A;  2IXS A;  5DD8 A;  2IS6 A;  2DQL A;  4IHS A;  4Q5S F;  4AU7 A;  2KMU A;  2EIM H;  1TL8 A;  2L5Q A;  1EKE A;  1YO5 C;  1XDU A;  5CVR A;  4IRH A;  1U8B A;  1T33 A;  1APL C;  2HTJ A;  4EGZ A;  2EFN A;  4M6X A;  1OMI A;  1RET A;  2BE5 F;  1IO2 A;  4XKV A;  2V4J C;  2KT0 A;  5EGO B;  3WTT C;  1OYY A;  1YIT I;  1KQ0 A;  4J00 A;  2XIG A;  5D6F A;  2M0M A;  4IVN A;  4DBR A;  3E6B A;  4ASN A;  4XN3 A;  2V9P A;  3VOE A;  4MLO A;  2ISZ A;  5JHU A;  1YI2 I;  2ACJ A;  4EJU A;  3S1Q J;  3QRF F;  3EUH A;  2PJP A;  2Q2E B;  1KU9 A;  4XLF A;  1E3P A;  4AYB N;  2HXO A;  4RGR A;  1VQK I;  3MZY A;  3ZQC A;  2MAB A;  3B6A A;  3F8B A;  1GT0 C;  3WTX C;  2CU7 A;  1SD6 A;  3I53 A;  5DV5 A;  4CCJ A;  3GZ5 A;  1T8I A;  3QU3 A;  3GTQ J;  3PUB A;  4L5E A;  3HC7 A;  1I6H J;  1VZ0 A;  2GIV A;  1ZRF A;  2DK8 A;  1ZG5 A;  3U9G A;  4AM3 A;  3P9K A;  1U0J A;  3MVP A;  3DPU A;  1IN6 A;  1HW1 A;  5DEQ A;  4B09 A;  1GHC A;  3E1S A;  3CUQ A;  1SEU A;  1MMN A;  2QYO A;  4N9H A;  2H1K A;  2R93 J;  3FXR A;  5FJ8 J;  1IRF A;  2ECB A;  5HS9 A;  4KN4 X;  4RB2 C;  2LD5 A;  2DT5 A;  2HZT A;  3ZMT A;  4E7J A;  3BRO A;  2MSY A;  2L02 A;  3KLN A;  5CQG A;  2VOO A;  2HYJ A;  2JTV A;  5CVJ A;  3I9V 2;  3K7A J;  2UWM A;  3LSP A;  4MTD A;  1JT6 A;  1T0F C;  4II2 A;  4DQ2 A;  2XKO A;  4CUG A;  3FMQ A;  1ZKG A;  1K7A A;  3V8K A;  1JTY A;  3T8T A;  2UXX A;  2JPB A;  1B9M A;  2YX4 A;  1S7O A;  2BXZ A;  2HQA A;  3U1K A;  3BR6 A;  3OYE A;  4KT5 C;  4JOM A;  4YEJ A;  2OAZ A;  2EV5 A;  1VQ4 I;  2ELH A;  4GXO A;  3J81 K;  4PGH A;  1OFC X;  4OOI A;  2R7F A;  4EJV A;  3HG9 A;  3QPT A;  1VQ5 I;  1V5F A;  4E7K A;  4F7Z A;  4B3X A;  2FQ3 A;  3BR0 A;  5ILV A;  5A2Q Z;  1SFO J;  4ON0 A;  1T2K A;  3HRT A;  1SFE A;  4M3E A;  4A0X A;  4A3E J;  2VJ4 A;  3PFY A;  1GDT A;  1F9N A;  3ZQG A;  1ZGJ A;  5B1A H;  4G8X A;  2JSC A;  3RIR A;  2MC3 A;  2F5E A;  2MW8 A;  3KLO A;  4QWQ A;  3HZJ A;  3BWG A;  2IA1 A;  4U0Y A;  2O3F A;  3DBL B;  4XLE A;  1H8A C;  1STZ A;  2J5O A;  1O7L A;  3K6G A;  4BXF A;  2M30 A;  3ECO A;  1RKW A;  3AL0 B;  1ITY A;  2MC4 A;  1OCT C;  3GFJ A;  2BEO A;  4BE2 A;  1GXQ A;  3WGH A;  5F08 A;  3X2Q H;  5FRM A;  3J7A Y;  4RB0 A;  2KIS A;  1JTX A;  4L18 B;  2NNN A;  2OJE D;  3H9Q A;  5AON A;  4KA4 A;  2KQR A;  1EJ9 A;  6PAX A;  2WAE A;  1J7K A;  1JUP A;  4HBL A;  4CGZ A;  1E3O C;  1OR7 A;  4HPQ A;  4XKC A;  2P0W A;  2KFD A;  2ZXJ A;  2H09 A;  3O6B B;  4RB3 C;  4CZZ A;  3CCY A;  3HYI A;  1XMA A;  4WCG A;  4U88 A;  2ZCW A;  3VYU B;  3S15 J;  4X6A J;  3L00 A;  3E5X A;  3E5U A;  3H36 A;  3ONQ A;  4WK8 F;  3BCB A;  4PFO A;  2CRG A;  3F8F A;  4W1U A;  1I3A A;  5FFX A;  4G6T B;  2Q1Z B;  2DCE A;  3DEW A;  2EV0 A;  3ABL H;  3MD2 A;  5AIQ A;  4LD5 A;  1W36 C;  2HTS A;  1IXS B;  1X2M A;  3E7L A;  4RAF A;  5IYC J;  4ZJZ A;  4IXA A;  1BI2 A;  4D5C A;  1KU2 A;  4LK0 F;  2L0K A;  2Y0S N;  2PMH A;  2XKP A;  3OIQ A;  3FX3 A;  2H6C A;  3K1N A;  2FOK A;  3AKZ A;  3IH2 A;  1IC8 A;  3BJ6 A;  2ESH A;  4E7Z A;  1SC7 A;  2FJ1 A;  3IRQ A;  2DPU A;  3FKI J;  1WSU A;  3KP7 A;  4I76 A;  2ME6 A;  1T95 A;  3JAM Z;  2A07 F;  2DA2 A;  2F4M B;  2DDB A;  3ZCO A;  2OZU A;  3LSH A;  3ZPL A;  1K61 A;  3LSJ A;  3LAJ A;  2CYY A;  3K4J A;  4Q48 A;  1OIS A;  5K7F A;  2L54 A;  3SJM A;  3BZK A;  1AHD P;  1NH3 A;  5F0H A;  2KP6 A;  4G6Q A;  4BH9 A;  4IHX A;  2IS4 A;  3AG3 H;  2FBH A;  4HNT A;  3Q0V A;  1LPQ A;  3DLL F;  5FLX Z;  2LSO A;  1FBQ A;  1OJL A;  1HSJ A;  3K0L A;  3OV8 A;  4KDP A;  3BT9 A;  1RUN A;  3C2B A;  2E1M C;  3WTZ A;  5LBQ A;  4HLX A;  4XRM A;  4A3C J;  3RSN A;  4D5F A;  1KU7 A;  1WKM A;  2Y75 A;  1Z9C A;  1A35 A;  2GXA A;  1U9O A;  4NUB A;  3UR3 C;  2R7Q A;  4PJN A;  1X19 A;  1EH7 A;  2K9L A;  3DPT A;  3OR2 C;  2GXB A;  2O5R A;  4L9T A;  4W97 A;  2PI0 A;  3QPL A;  3AFH A;  1BJA A;  2M5W A;  3BP8 A;  5GPC A;  1VQ9 I;  1G3W A;  5HS8 A;  4BXX J;  1IUF A;  4YFK F;  3BG9 A;  2COB A;  1QRY A;  2XF7 A;  4U7B A;  5IP9 J;  4BE1 A;  5EG0 A;  1T08 B;  3MKL A;  3I0T A;  4BKX A;  4XLP F;  2P5L C;  1F5T A;  4DW6 A;  1FOX A;  1IJW C;  2QA4 I;  4IHY A;  3HOX J;  1ZH5 A;  1LJ9 A;  3KP3 A;  2W7N A;  4UUV A;  4PCQ A;  3I71 A;  2CUF A;  2DU9 A;  2F5V A;  1Z6R A;  3DKX A;  3RI4 A;  1IG7 A;  2OPT A;  4N4O B;  3C3W A;  1C0W A;  2Y69 H;  2KLO A;  1S6L A;  2D2W A;  1Z0X A;  4LFU A;  3D0S A;  4KIC A;  2E19 A;  2HR3 A;  1IV6 A;  3GTO J;  3MZH A;  4EV0 A;  2EIK H;  4X0G A;  1LE8 A;  5TIS C;  1O3Q A;  2DFF A;  1USS A;  3CCQ I;  2FA5 A;  5E3O A;  3NAU A;  2E5N A;  5H2F C;  1MBK A;  1MJB A;  2Y2Z A;  3PNV A;  3KCC A;  3IRR A;  2CWE A;  1MW7 A;  2EFW A;  1H9T A;  4LB6 B;  1IN5 A;  1J75 A;  2JPC A;  5HDG A;  2MA3 A;  5GAH J;  3SYT A;  3FHN A;  4EM2 A;  3REO A;  1ZRC A;  1VQ6 I;  4GYI A;  1QU3 A;  4HF0 A;  4A3G J;  1SD7 A;  5DM6 F;  1R22 A;  1RPW A;  3TMO A;  5IY5 H;  4P55 A;  3TL4 X;  1Q1V A;  4B3A A;  1ODD A;  4J19 A;  4DGW B;  3J81 Z;  2DMP A;  2LRE A;  1XSD A;  2MGQ A;  2D45 A;  2IEK A;  2E34 A;  2OD5 A;  3BG6 A;  3H0G J;  1Z21 A;  2DOF A;  5E79 C;  2R0Q C;  3SZP A;  2QSH X;  5FLM J;  4IOA F;  2ZFU A;  2PG4 A;  1SAN A;  3SEQ A;  2IGO A;  4G6D A;  3WU2 C;  2CH0 A;  1K78 A;  2NVT J;  3LSK A;  1YRN B;  2E2J J;  5C4J J;  5B3S H;  4LLG F;  4BQO A;  3F6O A;  1D8J A;  3OYF A;  2V6C A;  2QKL B;  3Q0W A;  2JRM A;  4RGX A;  1BI0 A;  1T56 A;  3LST A;  4FTH A;  4LJZ F;  3KET A;  3Q3S A;  4PJL A;  2MFZ A;  1YIJ I;  2VUM J;  2MH2 A;  2L2O A;  2X9D A;  1Y0U A;  1OCZ H;  3FHZ A;  1UJ8 A;  3NAR A;  3V7R A;  4CYC B;  2E2H J;  2X6Y A;  3OSG A;  3ASN H;  5FKL A;  2CV2 A;  2AQE A;  1YQA A;  1TWH J;  3B73 A;  4IEJ A;  1P2F A;  3MKZ A;  1QBJ A;  2JQ7 A;  2FEZ A;  2RN7 A;  1MD0 A;  4RS8 A;  2M8E A;  3S1M J;  4UVC A;  1LKX A;  1RKT A;  1XC5 A;  2EK5 A;  4XBF A;  1LFU P;  2NVQ J;  5TJJ A;  1HA8 A;  2K27 A;  4IRG A;  3LA3 A;  1A6Q A;  1BR2 A;  4UHT A;  3KEO A;  1FIA A;  1ZG3 A;  4HF2 A;  1QGP A;  4BDZ A;  1VF9 A;  1AKH A;  3ZN0 A;  3HOW J;  1QZE A;  2LH9 A;  4ANJ A;  4YRV A;  2CV0 A;  5LHH A;  2GAU A;  2ZME B;  3BQZ A;  3I4P A;  1WJC A;  1OR7 C;  1WZ2 A;  2LNB A;  3WTW C;  3GUD A;  1LDK B;  5FO5 A;  1LDJ A;  2UV1 A;  4OIQ F;  1FNN A;  2IA0 A;  2A3S A;  2XVC A;  5E3M A;  3OYI A;  2F48 A;  3JR9 A;  3GZ6 A;  3GTM J;  2IGN A;  1UG0 A;  2FML A;  2DJI A;  1G4D A;  2X48 A;  2DQR A;  5B66 C;  3O8H A;  2FQ4 A;  2PMZ A;  2XDV A;  2DA3 A;  4HX4 A;  2IW5 A;  1RES A;  2HS5 A;  3IH4 A;  2HQ5 A;  1HF0 A;  4XSZ F;  2R7W A;  2M1B A;  3GXO A;  3RKX A;  2Z16 A;  3NEU A;  1TC3 C;  4I2O A;  4HSR A;  2JA8 J;  5BOX A;  2R7U A;  2M4G A;  4PGG A;  3TDU C;  4ABZ A;  1H9G A;  2O7O A;  1Z05 A;  2ELK A;  2DA1 A;  1D8K A;  4ZTJ A;  3H1C A;  3HOU J;  2J5P A;  4XMY A;  2LKX A;  1D0X A;  2B9S A;  1TQP A;  3SZG A;  4NC6 A;  3W6J B;  1UAA A;  4A12 A;  1UFM A;  4M6Y A;  2O8K A;  3DQV C;  3HGY A;  3BZ6 A;  2HOA A;  2ZSH B;  2JSP A;  1IXR C;  5DS9 A;  1LEA A;  2LY9 A;  1BI1 A;  1R71 A;  3WGG A;  2HZD A;  1T6S A;  3T8R A;  3WE2 A;  2K9M A;  2WAD A;  1GVJ A;  2ICW G;  3A02 A;  3ZMD A;  3JRB A;  1A31 A;  2IS2 A;  5L3C A;  2VBX A;  3ZMZ A;  2XF6 A;  3IWF A;  2O03 A;  1IDZ A;  1YS7 A;  2NAZ A;  5B1B H;  1EH8 A;  3I4N J;  2FNA A;  5BS6 A;  4IX7 A;  1SVL A;  1XGN A;  4M71 A;  2YS9 A;  4A3F J;  1GV5 A;  2HEO A;  4LG0 A;  2Z1D A;  4ZYG A;  2VPR A;  2QUF A;  4AC0 A;  1T39 A;  1A04 A;  3VEP A;  3KP6 A;  3FDY A;  3OR1 C;  2XSJ C;  3KX2 A;  4UV8 A;  4LLL A;  1BC7 C;  5HLI A;  3AAF A;  1XDS A;  3KP4 A;  2EH3 A;  2K4B A;  2EA2 A;  4KJZ A;  2OBP A;  1MH4 A;  3MQ0 A;  1FOW A;  1G3S A;  2LF8 A;  1Y6I A;  5K5O A;  2XPW A;  2EV6 A;  2LR8 A;  4PZJ A;  5IOY A;  1WJF A;  4IQ4 A;  3CQZ J;  1TTY A;  4DYQ A;  4HQM A;  3W6K B;  5A2Q K;  4ZZD A;  3CC7 I;  2Z5U A;  3L2W A;  2Z3Y A;  4BEH A;  3T1B A;  3JSP A;  1G3Y A;  3DBR B;  3I3L A;  1G59 A;  4M9S A;  5HLH A;  4XON A;  2HOE A;  4C3H J;  5M5Y J;  2OV7 A;  2FBI A;  2V1N A;  3PJR A;  5BPI A;  2BV6 A;  4A3J J;  1V5G A;  1PUF A;  3RCO A;  1MSE C;  2ZSI B;  4DZP A;  3BR3 A;  4RAG A;  3DU6 A;  2Y48 A;  3CJT B;  1IDY A;  3IH3 A;  3WGI A;  3CCL I;  2GWR A;  5DCM A;  4L5J A;  2K7L A;  1F43 A;  1R5G A;  2WAF A;  4EJW A;  3KEQ A;  5DYM A;  4FE7 A;  1OLT A;  4PSW A;  2CW0 F;  2VC1 A;  2XGE A;  1OPC A;  2WC2 A;  3FKJ A;  2IGM A;  1DU0 A;  2W24 A;  4FX0 A;  3QWL A;  3L2U A;  5TGT A;  1KA8 A;  1XPX A;  1SFU A;  2C6Y A;  3HJE A;  4F55 A;  3CCR I;  3L09 A;  3QOD A;  2RNJ A;  1MGT A;  1XS9 A;  1XG1 A;  2VXZ A;  5FD5 A;  1POG A;  4BY7 J;  2VJI A;  2FMY A;  3TO7 A;  1MDM A;  1XMX A;  2G7H A;  4PJJ A;  1WJ5 A;  2ZJR F;  1TZL A;  1ZLJ A;  3PO2 J;  1YX5 A;  3LMM A;  4HV5 A;  2YU3 A;  2PQ8 A;  3MMY B;  3V4G A;  3TO6 A;  2BZT A;  3CC2 I;  3PIP F;  2WY7 Q;  3HOY J;  4Y17 A;  4A5M A;  1WH5 A;  2VOP A;  3E97 A;  5E17 F;  1YOV B;  5C3E J;  5EJC A;  4FT8 A;  3S17 J;  3FXO A;  2QEN A;  3VYR B;  4XRS A;  1P92 A;  2A5Y B;  3P9I A;  2HKO A;  1JKQ C;  3BC8 A;  1PP7 U;  3I55 I;  2R5Z A;  4RMN A;  4I7H A;  1LNW A;  1YLF A;  2HPI A;  3O8G A;  2PEX A;  3JAM K;  3F21 A;  3E5Q A;  4MNU A;  4EVI A;  2KKO A;  2P6S A;  4Y33 A;  2JVG A;  3LSG A;  4MTE A;  5DUI A;  2KIM A;  3OIP A;  3HRU A;  2M4K A;  3CCS I;  1S7E A;  3GO5 A;  3CD6 I;  2YU9 J;  2EZL A;  1QNT A;  2BXY A;  5BPD A;  1J0R A;  2M0C A;  1WQ2 A;  1WHU A;  2W00 A;  2VBY A;  2K02 A;  5FLX K;  1MMD A;  3OOU A;  5H6R A;  2I8D A;  1VI0 A;  2VIX A;  3FM3 A;  1EA3 A;  5LGT A;  2KHM A;  2BVL A;  4I99 C;  4KNY A;  2A69 F;  1JXS A;  5CVI A;  5DD4 A;  4PK4 A;  2M45 A;  3ML6 A;  1U5T B;  3CTA A;  5EEA A;  1G3T A;  3MCZ A;  1Y8Q B;  5L3B A;  3FXU A;  5KCM A;  4F93 B;  2O6G E;  2BW3 B;  4XLC A;  3CLO A;  2KDO A;  3CUQ B;  1ZTR A;  4MQ9 F;  3GZN B;  1KGS A;  2ADU A;  3TOB A;  1HBX G;  3FBI B;  4I0A A;  3H35 A;  2R7R A;  1F1Z A;  4OIP F;  3OSF A;  2ZME C;  3JRI A;  2P81 A;  5J1R A;  3BOQ A;  2K9S A;  3CJN A;  3K70 C;  3MFK A;  2BY3 A;  3SDB A;  4DYR A;  4RBO A;  3M3Y J;  3CF2 A;  3V42 A;  2X0L A;  4D7M A;  5ICG A;  2CW8 A;  2QSF X;  3FIW A;  2E7X A;  1MMG A;  2EZI A;  1I39 A;  4KMF A;  3DU5 A;  2AQF A;  4A0Y A;  1X4P A;  1HST A;  1ETK A;  5EGO A;  2R7X A;  4CA0 A;  1PUE E;  3OMY A;  1YX3 A;  2OCE A;  1LEB A;  3CES A;  2ZJP F;  2VKE A;  4Z2Y A;  3PL8 A;  3F9K A;  9ANT A;  2DW4 A;  2RDP A;  4IJA A;  3HBL A;  4KT6 A;  4RLQ A;  3R0J A;  3FXL A;  5HDN A;  2VL8 A;  2STW A;  2NVY J;  2HU9 A;  2GIZ A;  4L0Z B;  3J80 Z;  1V5E A;  3VFZ A;  3ABU A;  2LY2 A;  3DXJ F;  2JUG A;  2CJJ A;  1K79 A;  3IHU A;  4HDU A;  4BYY A;  2Q2E A;  2V26 A;  1RR7 A;  4C2M J;  3GTJ J;  1MMA A;  3QP5 A;  2KZG A;  4AUX A;  1B72 B;  2CUE A;  1XCB A;  4ZDP A;  3H9G A;  3T0Y A;  3U21 A;  3ABK H;  1SMT A;  2D5V A;  1I5Z A;  2QBY A;  3TQN A;  4NQW A;  3RJP A;  1YHQ I;  4YEL A;  2I10 A;  3WHC A;  3IKV A;  1D1C A;  1S5L C;  4CYD A;  4ZYH A;  2IBD A;  1Y1W J;  2DT6 A;  3PNY A;  4I02 A;  5GTH C;  2X1D A;  3BTL A;  3QAH A;  3JRG A;  4FHT A;  4XQF A;  2XAS A;  3C1D A;  4H0E A;  2WWY A;  5CKT A;  1W5C C;  3H3Z A;  1DQU A;  4O5V A;  1B4A A;  3EYY A;  2HDD A;  1O3R A;  4UUS B;  1VQP I;  1HW5 A;  1OYW A;  3C2H A;  3DF8 A;  3A0B C;  3OYB A;  4AVZ A;  1SD5 A;  1XGM A;  3F8C A;  4PDK A;  5HLG A;  2JA6 J;  1AU7 A;  4U7D A;  3S14 J;  4CCL A;  3UKG A;  1SD4 A;  4OAZ A;  2KIF A;  4P5O A;  3GLL A;  3JRF A;  5IT9 Z;  1NG7 A;  1EV7 A;  2EZK A;  2GA1 A;  2OA4 A;  2NVU B;  1W36 D;  4YG2 F;  3WTS C;  1FZP B;  1M1E B;  1H89 C;  1MBH A;  4B44 A;  2RKH A;  3LSM A;  3LAP A;  2EPF A;  2V1D A;  3GFI A;  3D1N I;  2FBK A;  1TWA J;  3M1E A;  2AXT C;  3HHH A;  2H27 A;  4KYW A;  2EB7 A;  4AVP A;  3GLX A;  1LB2 A;  4HRI A;  2GBY A;  4L9V A;  5L3F A;  3W2A A;  4N4N B;  1O4X A;  2EIJ H;  2WB1 A;  3R60 A;  3HHG A;  4BL0 B;  1W7P D;  1BL0 A;  2GXG A;  4DJA A;  1Y39 A;  1K4S A;  4DYC A;  4LOC A;  3HOZ J;  4XR6 A;  4E6K G;  1HXD A;  3CME I;  4ZDO A;  4Q4Z F;  4L5I A;  1BI3 A;  2M9H A;  3RPU D;  2EJR A;  1ZK8 A;  2AHQ A;  3Q9V A;  4P1W A;  3G1M A;  1FYL A;  4M74 A;  5KK1 A;  2L01 A;  2HYG D;  3HSF A;  3WOD F;  3LSI A;  4RM2 A;  4G12 A;  2VE9 A;  5CYV A;  3FM5 A;  4KUM A;  2JUC A;  2NXN B;  2DMT A;  2N8G A;  3HM5 A;  2ZXI A;  2L7K A;  3SFI A;  2CQN A;  4P9U A;  5C4X J;  2Z9O A;  1KQ8 A;  5C44 J;  3ZMU A;  3LWF A;  5K7H A;  2F2E A;  1FPQ A;  2L3D A;  1ONV A;  3WU0 A;  3BG3 A;  1HKQ A;  3H5N A;  3I58 A;  5IT3 A;  1LFB A;  4EAT A;  2CUJ A;  2STT A;  5BNG A;  4CHU A;  5IYB J;  4CCO A;  4XOR A;  3VSL A;  2Z99 A;  1R1V A;  4IZZ A;  3L7W A;  1TW3 A;  2ELJ A;  3A1Y A;  5EEG A;  2VT2 A;  1V4R A;  4QSH A;  2RQQ A;  5J6X A;  3ERM A;  2KIQ A;  4DOZ A;  5E3L A;  1MMS A;  3GX4 X;  3I64 A;  3L2Q A;  1PYV A;  2K5C A;  1PJR A;  4ITV A;  2CFO A;  2BHZ A;  1MNE A;  1D0Y A;  3K4C A;  1B6A A;  3HIF A;  1D5V A;  1FT9 A;  4HA8 A;  2A6E F;  3RQ4 A;  3ZRG A;  1WI9 A;  1W5T A;  5FGM A;  1O57 A;  2M87 A;  2A61 A;  2Y0M A;  1D5Y A;  3VYS B;  1IV8 A;  1MBG A;  3H0D A;  2DLL A;  2A6T A;  2DMN A;  5EF6 A;  4KIS A;  4RM3 A;  1YE9 A;  2H6B A;  3WU1 B;  2O8X A;  4LIT A;  2CW7 A;  1ON1 A;  1R4M B;  4I01 A;  1FSE A;  3K10 A;  4XOT A;  5FFZ A;  5KAI C;  2L9V A;  4B4C A;  4CCM A;  4B43 A;  3DFG A;  4OIN F;  1FX7 A;  5B5E C;  4JP0 A;  3K1M A;  4ENM A;  2HI3 A;  1TWC J;  4B1R A;  4A3B J;  3HPG A;  5F04 A;  2P5V A;  2XSD C;  4G7H F;  2O9L A;  5F1R A;  1JI8 A;  2CMP A;  1KON A;  1S29 A;  5FKM A;  3GEZ A;  3EET A;  3KZY A;  1HC8 A;  3TKY A;  1MIJ A;  2PMU A;  3E6D A;  3SXY A;  2BYV E;  3HSR A;  1Z1D A;  4M73 A;  1X2N A;  3A0H C;  3W6V A;  3R0A A;  5TRD A;  2DT7 B;  3A03 A;  2P4W A;  2CV1 A;  2HGC A;  3ASO H;  5H6Q A;  2NYX A;  1U2W A;  3RQI A;  2W57 A;  2WY8 Q;  3QQA A;  4CDG A;  5IP6 A;  3G6E I;  1R23 A;  4K2E A;  2JA5 J;  2R5Y B;  2LLK A;  3BZC A;  3S93 A;  5LLQ A;  3F8M A;  4C3J J;  3BG7 A;  1AOY A;  2QWW A;  1CQT A;  3ESW B;  4R8H A;  4NHJ A;  5H20 A;  4LB5 A;  1FP1 D;  2KJB A;  3DEE A;  1I6X A;  3DPL C;  4FQG A;  3CP2 A;  2HDC A;  2VE8 A;  3C7J A;  3EYI A;  2A68 F;  4M3G A;  3CCU I;  1YJN I;  3K1P A;  3S2H J;  1HDP A;  2RNG A;  5CLS A;  3FXQ A;  4JX5 A;  1KU3 A;  1ULY A;  3HTU A;  1FBU A;  3ROU A;  3ZQF A;  1PP8 F;  1XGO A;  4GO1 A;  5F1J A;  4V2F A;  1ETX A;  1P4A A;  1QZY A;  2QVO A;  5J40 A;  1YYV A;  2ZBK A;  2VON A;  1J2X A;  4A6D A;  1G2H A;  1TQM A;  4N9I A;  3PNT A;  2BGC A;  4HX7 A;  1FOK A;  3GCM A;  3U1D A;  4XKB A;  2NS0 A;  4FAS D;  2FXA A;  2DFE A;  2CQQ A;  3OL4 A;  2XAG A;  3QPS A;  3N4M A;  1FYK A;  5E8I A;  4J01 A;  3TDZ C;  2R7Z J;  4XK4 A;  1E17 A;  1X58 A;  3PQK A;  2VKV A;  1V55 H;  1N75 A;  4CXF A;  2EA4 A;  2YR2 A;  3A4C A;  3R4K A;  2FRH A;  4L9N A;  5EZH A;  3HOV J;  1Z91 A;  4BHB A;  2Y9Z A;  3BPX A;  3PO3 J;  4AIJ A;  4MEY F;  2G9W A;  3NQO A;  2AO9 A;  2V9K A;  1J09 A;  2PJR A;  5D5W B;  1FSH A;  3KPH A;  4BBS J;  2OUM A;  3G1L A;  3GTG J;  2DMQ A;  2PX9 A;  1GUU A;  2LKS A;  4S05 A;  3ZQL A;  2DA4 A;  2LDU A;  1X1A A;  3COA C;  4GDF A;  2AXL A;  2EFP A;  3KE2 A;  5J8F A;  3RYP A;  4U87 A;  2HQN A;  1XMK A;  2IAI A;  1BIA A;  1IN8 A;  1ZAR A;  1S3J A;  1R7J A;  1XD7 A;  4F92 B;  1SFX A;  4IF4 A;  1U9N A;  1VQM I;  1E3H A;  2EWN A;  4RB1 A;  2X1C A;  5CJ9 A;  5J8C A;  1H0M A;  4A3L J;  2TCT A;  4FX4 A;  3G71 I;  2RV8 A;  5KHD A;  4YFN F;  1BJZ A;  1MND A;  2IRF G;  3PFI A;  5HNH A;  1ACI A;  3K4N A;  2TDX A;  1N77 A;  2ESN A;  3OS0 A;  1YRN A;  4ZYA A;  1S9H A;  4AID A;  2H8R A;  2FU4 A;  1DPR A;  3HUG B;  2LVS A;  1YJ9 I;  2NS7 A;  2Y9Y A;  1ERD A;  4BHC A;  2YSR A;  1QA6 A;  3MKW B;  2IS1 A;  5DTD A;  3EPZ A;  4P9F A;  1JHF A;  2ETH A;  5EYR A;  3S2D J;  3IL2 A;  2F5C A;  1BA5 A;  4UXN A;  4XLA A;  3VWB A;  1Z7U A;  2MG4 A;  3I59 B;  4FIS A;  2GM4 A;  4ESF A;  5F64 A;  4CYC A;  1WVR A;  4AWX B;  5E3N A;  3D5L A;  1NG6 A;  2KRH A;  2WAQ A;  2R7D A;  2XF5 A;  3AL0 C;  1ZLK A;  2BY0 A;  2WV0 A;  3M7G A;  3H5R A;  4IO9 F;  4LIV A;  4EJO A;  3IAM 2;  4Y7N J;  1OQY A;  3PSI A;  5KNL A;  3SQN A;  4Y52 J;  2CQX A;  2JN6 A;  2QEX I;  3Q9S A;  2VQG A;  1W1W E;  4QTR A;  3S3O A;  1D1A A;  4Y13 A;  3G4S I;  1VFC A;  1SMY F;  2KJC A;  4OWR B;  2ZME A;  3FXJ A;  1FEX A;  2FE3 A;  3A01 A;  2VQL A;  3IAS 2;  1S72 I;  2WBM A;  2XUB A;  1IGN A;  2XHK A;  2OQG A;  1R9T J;  2FF4 A;  1CF7 B;  4AD9 A;  2HVS A;  4BHP A;  4I98 B;  4PJ0 C;  3QYF A;  2MD5 A;  2VAS A;  5K5Q A;  4BAC A;  4E7S A;  4M3B A;  1OYI A;  3PUF A;  4A0Z A;  3H3U A;  4E4H A;  4Y4R A;  4BJT A;  5E20 A;  1G8X A;  3E0J B;  3SEZ A;  1Q1H A;  3QU6 A;  3P9C A;  3Q5F A;  2JMW A;  4FET A;  1QHH D;  4CH7 A;  3MWM A;  3EQL F;  4A3D J;  4YFX F;  4WF2 A;  3J80 K;  2HOT A;  3ZMS A;  1XX5 A;  4I09 A;  4HZF A;  1XN7 A;  4JYK A;  4XNF A;  2X6X A;  3OYN A;  3KZI C;  5GTI C;  4XSX F;  2V7F A;  4EMS A;  2LBF B;  1MNM C;  2ZXW H;  1OCC H;  5LFA A;  4HW0 A;  3GYH X;  3BG5 A;  4UV9 A;  3A2K A;  1L3L A;  4RLF A;  4BJ6 C;  4XRF A;  1UZC A;  4MFD A;  4R79 A;  1NK2 P;  1U8R A;  1SAU A;  1QVU A;  1X1P A;  4E70 A;  3L2V A;  1VQL I;  3CCV I;  2MH9 A;  3NWT A;  4MQV A;  5HNF A;  2F4I A;  2VN2 A;  1B8I B;  4ZH4 F;  1A36 A;  5GAD J;  2QF7 A;  2ZFW A;  3TW7 A;  2FD5 A;  5HS7 A;  3E6C C;  5HDK A;  5HOD A;  2CSO A;  4KIF A;  3I56 I;  4XL9 A;  1TWF J;  1FYM A;  1ORK A;  4IL6 C;  4GFB A;  5DCM B;  3RKQ A;  1BR4 A;  1QO0 D;  3BTI A;  1X1C A;  3RPQ A;  1TNS A;  1TLH B;  3V8J A;  5F27 A;  5IT9 K;  3JRC A;  4E7I A;  1LVK A;  1FMW A;  3ZN1 A;  2E60 A;  3TP3 A;  3GTL J;  2ZC2 A;  1I50 J;  2M8G X;  2ZNZ A;  3DCF A;  3OS1 A;  2NVX J;  2M2E A;  3DWL E;  3J7Y J;  5EZG A;  4HG2 A;  3S32 A;  5D5X B;  3QYB A;  4ZC3 A;  1XSV A;  4WXH A;  2GA2 A;  3VB2 A;  3CP8 A;  3LA2 A;  5DDG A;  4MHG A;  3EDP A;  3JRE A;  3CCE I;  1GLN A;  1KZH A;  1IZ1 A;  2RC4 A;  1MDM B;  4A93 J;  1NHA A;  3R61 A;  1R00 A;  4ENN A;  1XTA A;  4H4K C;  4XOP A;  4V19 K;  3S16 J;  2ZJQ F;  2CO5 A;  2O0Y A;  4EGY A;  2LYC A;  3PIO F;  2LFB A;  1WFX A;  3B02 A;  1YIO A;  3KIO A;  1FWZ A;  2DTR A;  3ZR8 X;  2CFX A;  2WV1 A;  1W0U A;  1ETV A;  1HW2 A;  4M9Z A;  1R1T A;  2XPU A;  2DOE A;  3P5J A;  3V7C A;  2DA7 A;  2M7A A;  2R92 J;  1HKS A;  3BPV A;  2DN0 A;  5D8K B;  2DAO A;  1Z77 A;  3DTK A;  1UHW A;  2W1O A;  1JKO C;  4CCK A;  2FNP A;  4S04 A;  1Z3X A;  2LMD A;  4V2G A;  5DM7 F;  1RRJ A;  2VBW A;  1JHH A;  2IVM A;  3DKY A;  3F3X A;  1AWC A;  2NOG A;  2F4O B;  2L4M A;  3OYA A;  4C2T A;  1W7P B;  3K2A A;  4ESB A;  2DMU A;  2EFO A;  2CUZ A;  4BQQ A;  1L0O C;  1KYZ A;  3G73 A;  3P7N A;  1U6G A;  1HLV A;  2RGV A;  1WCM J;  2KZV A;  1F4K A;  2YUS A;  3K4B A;  3PM1 A;  1U3E M;  1TNT A;  5K7Z A;  2CGP A;  4G7Z F;  1GVD A;  2QSG X;  5HOO A;  5CVV A;  2VQC A;  4C30 A;  2VOD A;  3HTS B;  2UXN A;  2LF7 A;  3DKW A;  3HOS A;  3S1R J;  2KDZ A;  1FLI A;  2WA0 A;  2COM A;  1FJL A;  1FOY A;  2D1H A;  1RI7 A;  2M3A A;  2CS3 A;  2E1M B;  4C3I J;  2X6W A;  1JKP C;  1ZGA A;  4TV7 A;  1XCV A;  1Y0N A;  2Y0S A;  3ZQQ A;  1VTN C;  3GTP J;  2DK5 A;  5FKK A;  4B47 A;  2RQP A;  1GXP A;  2MD0 A;  4NBQ A;  2KRF A;  2DTZ A;  4BGD A;  2VC0 A;  1ZRD A;  3I4M J;  2PMZ N;  2V6E A;  4BY1 J;  1I1S A;  3LSR A;  3DEU A;  2F5F A;  5ED4 A;  3KEY A;  4D0P A;  3IWZ A;  2HFH A;  4KIT B;  1Z7L A;  3SDG A;  2OZ6 A;  3SFZ A;  4ZYE A;  3IUO A;  4JX4 A;  3ZQH A;  3V7S A;  2XRO A;  1UB9 A;  4PUS A;  3OYG A;  1K4T A;  1WWX A;  1QPM A;  5JI6 A;  1BC8 C;  4HDV A;  4OAY A;  3JRH A;  1J59 A;  3J7A O;  2E2I J;  4F52 A;  4UB8 C;  5M5W J;  2A05 A;  1DUX C;  5JHF A;  4ZTF A;  3C2G A;  2P8T A;  1FP2 A;  2XAQ A;  3CF5 F;  2M7B A;  4LMY A;  1I27 A;  1IRX A;  1YJW I;  2JA7 J;  3FF5 A;  1LVA A;  3VPR A;  1TWG J;  4ZDL A;  3BTJ A;  2HVQ A;  3JRA A;  4DIQ A;  5HVQ C;  4OIR F;  1R4N B;  4HX8 A;  5E1X A;  2I5U A;  4LIU A;  2XAU A;  2R7V A;  4ENJ A;  4M72 A;  3W2V A;  2VQH A;  2R4G A;  3PQJ A;  2XB0 X;  5GAE J;  1R1U A;  3K2Z A;  4II3 A; 
#chains in the Genus database with same CATH homology
 1RIO H;  1LQ1 A;  2Q0O A;  2O61 A;  2QBY B;  1QQI A;  1U5T A;  1IF1 A;  1O7F A;  1IN4 A;  2P7V B;  3F8N A;  3ZQ7 A;  3O3K A;  2QQB A;  5EEH A;  4HF1 A;  3F23 A;  1X3U A;  1B59 A;  1YW9 A;  1ZN2 A;  4DNC A;  3KP5 A;  4A2U A;  3CUO A;  3ECH A;  1Z6T A;  1BIB A;  2XV4 S;  2IJL A;  3JTH A;  5LRS A;  3IC7 A;  1WRJ A;  3WE3 A;  4A5N A;  3VOD A;  2H94 A;  1IW7 F;  5LEK A;  4LGW A;  4HV6 A;  4NB5 A;  4EM1 A;  4BNC A;  1ZG1 A;  4UVA A;  1TQI A;  2Q8K A;  2XRN A;  1YTY A;  3IKT A;  5ICC A;  5L3E A;  5JFR A;  2XAH A;  3LQQ A;  3MAJ A;  4KMU X;  3FMR A;  2GZW A;  1XB4 A;  2NNY A;  3T5X A;  4L0Y B;  1J5Y A;  4AIK A;  2VBZ A;  5JVT A;  1QZZ A;  2QQ9 A;  2W85 A;  4OMZ A;  4KN7 X;  4B8X A;  1MKM A;  4RAY A;  4GCV A;  3NRV A;  3GFM A;  2IP2 A;  2NRA C;  1B9N A;  5D6E A;  2WTE A;  4BAY A;  5K1Y A;  1MJ9 A;  4EQQ A;  3M8F A;  3BJA A;  1W4M A;  3MEX A;  2ISY A;  2ZKZ A;  4R1H A;  4P96 A;  4IHT A;  4N0B A;  3M9A A;  1E2X A;  2PBI A;  3RKY A;  1DDN A;  3GVA A;  4RGU A;  3DP7 A;  5L3G A;  2V9V A;  2B0L A;  4U0W A;  5E1Z B;  2P6T A;  2X4H A;  1HQC A;  3I5U A;  3N97 A;  2K4J A;  1UST A;  5CVU A;  4KIG A;  3WG9 A;  2K86 A;  2HKX A;  2YX7 A;  3TOA A;  4HQE A;  1O3T A;  3FMS A;  1J9I A;  1XSX A;  2QQA A;  4G9Y A;  4RGS A;  1P4X A;  2P7C B;  1MZB A;  4IPA A;  2Z33 A;  3LQR A;  5D4S A;  3ELK A;  1CGP A;  1YW7 A;  2D1V A;  2MBF A;  1BBY A;  2ZO4 A;  3F22 A;  2PLY A;  2L4A A;  2DFI A;  2DI3 A;  5LGU A;  1RNL A;  4KFC A;  1MJA A;  2JZY A;  2KIU A;  3K9T A;  3WTV C;  4UVB A;  2ZJ2 A;  2GQQ A;  3ERE D;  5FB2 A;  1DPU A;  3LA7 A;  4HOB A;  2HWV A;  4WX9 A;  1S7A A;  4AIH A;  1W5S A;  2DO7 A;  3SHF A;  2FSW A;  3E6M A;  3ULQ B;  3GF2 A;  2E7W A;  2PFB A;  4A6E A;  4EJT A;  1IUY A;  3M8E A;  3ZP5 A;  1YFH A;  2DPD A;  1U5T C;  2JRT A;  1TBX A;  2W84 A;  5LHG A;  3CUQ C;  5KVR A;  3L9F A;  3CDH A;  4BXU A;  1YW8 A;  1K78 B;  4BQA A;  3H92 A;  4L9J A;  4UNO A;  3RKW A;  1FC3 A;  2QZ8 A;  2V1X A;  3GWZ A;  2BBY A;  3CO6 C;  4QLC U;  5AIP A;  5ICF A;  4JQF A;  3QPH A;  5FD6 A;  2XGX A;  1FBS A;  3QP6 A;  3QOP A;  1XGS A;  4HYE A;  2HYF A;  1JGS A;  5DCF A;  5LGN A;  1D3Y A;  2E1N A;  1U78 A;  1T38 A;  3RDI A;  1KYW A;  5JR3 A;  1O3S A;  3G3Z A;  3HSE A;  4G94 A;  4CIC A;  2V1U A;  3ABT A;  1K6O A;  1OKR A;  3KP2 A;  1RZ4 A;  3OOP A;  2MLG A;  4JBA A;  4U0V A;  5E1W A;  3F72 A;  4Y15 A;  3WTY C;  5BMZ A;  4G7O F;  5ERI A;  1P6R A;  2EFQ A;  4YIF A;  4GYG A;  3K69 A;  2MLK A;  1P4W A;  2AS5 F;  2OU2 A;  2E1C A;  2UZK A;  1ZRE A;  3HOT A;  2P5K A;  4ZYD A;  2OQR A;  1S8N A;  3HRS A;  2CG4 A;  2CQK A;  3HUG A;  4HAM A;  4WXC A;  3FWE A;  2PN6 A;  1G6N A;  2JT1 A;  5D4R A;  4LG0 B;  3I59 A;  2IA2 A;  1SAX A;  3ZMV A;  1KQ9 A;  3HRM A;  2DBB A;  1RUO A;  3ISP A;  2W25 A;  3O2P E;  4KIB A;  4WWC A;  1BM9 A;  3LFK A;  3V8L A;  3R6S A;  3CO7 C;  3SZT A;  3JSO A;  4O3M A;  4MGR A;  2ZNY A;  3RYR A;  2G7U A;  1CF7 A;  1YS6 A;  1R58 A;  1ZHF A;  4I0B A;  5E18 F;  1T0F A;  2A6H F;  2F5D A;  5LEJ A;  2V79 A;  1BN5 A;  2XAJ A;  1PDN C;  1ON2 A;  5ICE A;  3BDD A;  3S2W A;  2R3S A;  3TO9 A;  1IXC A;  3RTR A;  3TGN A;  3JW4 A;  5K5R A;  3KZZ A;  3GW2 A;  4OMY A;  5D8L B;  3L2C A;  4CO8 A;  1DP7 P;  1R36 A;  4OIO F;  1UHM A;  3BY6 A;  5ILU A;  2YPR A;  2HQR A;  3FZV A;  4Q47 A;  5LHI A;  3JTG A;  1YG2 A;  5D5U B;  3BJO A;  1REP C;  4ETS A;  5BQT A;  1IRG A;  4ENK A;  4O6J A;  5DUK A;  1I1G A;  3I54 A;  4WXD A;  1V3F A;  3C18 A;  5E8G A;  1EH6 A;  4EM0 B;  4XLN F;  5F6F A;  5L3D A;  1BOA A;  4ZZL A;  3E3V A;  4LK1 F;  4IRI A;  1ZAO A;  3GFL A;  5D5V B;  5LRR A;  1B1B A;  1HKT A;  2XAF A;  5ILS A;  1UCR A;  2QM3 A;  4M9X A;  1ZYR F;  3F6V A;  1JE8 A;  2QLZ A;  1FY7 A;  3DV8 A;  1IN7 A;  1IAW A;  4LLN A;  4YII A;  4ESJ A;  2VT3 A;  4RAZ A;  3KFW X;  2IPQ X;  2IT0 A;  1TW2 A;  4GGG A;  1W7P A;  4JK1 X;  4MEX F;  1T98 A;  2RVC A;  2LKP A;  1R5H A;  1LDD A;  4OU0 A;  3RPU A;  3U2R A;  3WTU C;  4HLY A;  5DD8 A;  2DQL A;  4IHS A;  4Q5S F;  1YO5 C;  1XDU A;  5CVR A;  4IRH A;  2HTJ A;  4EGZ A;  2EFN A;  4M6X A;  1OMI A;  2BE5 F;  3WTT C;  1OYY A;  1KQ0 A;  2XIG A;  5D6F A;  4IVN A;  3E6B A;  4ASN A;  3VOE A;  2ISZ A;  5JHU A;  2ACJ A;  4EJU A;  3QRF F;  3EUH A;  2PJP A;  1KU9 A;  4RGR A;  3MZY A;  3F8B A;  3WTX C;  1SD6 A;  3I53 A;  5DV5 A;  3GZ5 A;  3QU3 A;  2GIV A;  1ZRF A;  2DK8 A;  1ZG5 A;  3U9G A;  3P9K A;  1IN6 A;  1HW1 A;  5DEQ A;  4B09 A;  1GHC A;  3CUQ A;  4N9H A;  2QYO A;  3FXR A;  1IRF A;  4RB2 C;  5HS9 A;  4KN4 X;  2DT5 A;  2HZT A;  3ZMT A;  3BRO A;  2L02 A;  3KLN A;  2VOO A;  2JTV A;  5CVJ A;  2UWM A;  4MTD A;  4DQ2 A;  2XKO A;  3FMQ A;  1K7A A;  3V8K A;  3T8T A;  2UXX A;  2JPB A;  1B9M A;  2YX4 A;  1S7O A;  4KT5 C;  2OAZ A;  2EV5 A;  2ELH A;  4GXO A;  3J81 K;  4PGH A;  4OOI A;  2R7F A;  4EJV A;  3QPT A;  4F7Z A;  2FQ3 A;  5ILV A;  5A2Q Z;  4ON0 A;  1T2K A;  3HRT A;  1SFE A;  4A0X A;  1F9N A;  1ZGJ A;  4G8X A;  2JSC A;  3RIR A;  2MC3 A;  2F5E A;  3KLO A;  4QWQ A;  3BWG A;  2IA1 A;  4U0Y A;  2O3F A;  1STZ A;  2J5O A;  1O7L A;  2M30 A;  3ECO A;  3GFJ A;  2BEO A;  1GXQ A;  3WGH A;  4RB0 A;  4L18 B;  2NNN A;  5AON A;  6PAX A;  4KA4 A;  1J7K A;  4HBL A;  4CGZ A;  1OR7 A;  2ZXJ A;  2H09 A;  3O6B B;  4RB3 C;  4CZZ A;  3HYI A;  1XMA A;  4WCG A;  4U88 A;  2ZCW A;  3L00 A;  3E5X A;  3E5U A;  4WK8 F;  3F8F A;  5FFX A;  2EV0 A;  5AIQ A;  4LD5 A;  2HTS A;  1IXS B;  4IXA A;  1BI2 A;  1KU2 A;  4LK0 F;  2PMH A;  2XKP A;  3FX3 A;  2H6C A;  3K1N A;  2FOK A;  3BJ6 A;  2ESH A;  3IRQ A;  2DPU A;  1WSU A;  3KP7 A;  3JAM Z;  2A07 F;  2OZU A;  3ZPL A;  3LAJ A;  2CYY A;  4Q48 A;  2L54 A;  4BH9 A;  4G6Q A;  2FBH A;  5FLX Z;  2LSO A;  1FBQ A;  1HSJ A;  3K0L A;  3OV8 A;  4KDP A;  1RUN A;  3WTZ A;  5LBQ A;  4HLX A;  1KU7 A;  1WKM A;  2Y75 A;  1Z9C A;  1EH7 A;  3DPT A;  2GXB A;  4L9T A;  2PI0 A;  1BJA A;  2M5W A;  3BP8 A;  1G3W A;  5HS8 A;  4YFK F;  4U7B A;  3I0T A;  4XLP F;  2P5L C;  1F5T A;  1ZH5 A;  1LJ9 A;  3KP3 A;  4UUV A;  4PCQ A;  3I71 A;  2DU9 A;  1Z6R A;  3RI4 A;  3C3W A;  1C0W A;  1S6L A;  2D2W A;  4LFU A;  3D0S A;  4KIC A;  2HR3 A;  3MZH A;  4EV0 A;  1O3Q A;  1USS A;  2FA5 A;  1MJB A;  3KCC A;  3IRR A;  2CWE A;  2EFW A;  1H9T A;  4LB6 B;  1IN5 A;  1J75 A;  2JPC A;  5HDG A;  2MA3 A;  4EM2 A;  3REO A;  1ZRC A;  4GYI A;  4HF0 A;  1SD7 A;  1R22 A;  4P55 A;  1ODD A;  3J81 Z;  1XSD A;  2D45 A;  2OD5 A;  3SZP A;  2PG4 A;  4G6D A;  1K78 A;  4LLG F;  3F6O A;  1D8J A;  2V6C A;  4RGX A;  1BI0 A;  3LST A;  4LJZ F;  3KET A;  2MH2 A;  1Y0U A;  3FHZ A;  3V7R A;  1YQA A;  3B73 A;  1QBJ A;  1P2F A;  2FEZ A;  2RN7 A;  1MD0 A;  4RS8 A;  2M8E A;  4UVC A;  4XBF A;  2EK5 A;  5TJJ A;  2K27 A;  4IRG A;  3LA3 A;  4UHT A;  3KEO A;  1ZG3 A;  4HF2 A;  1QGP A;  3ZN0 A;  5LHH A;  2GAU A;  2ZME B;  3I4P A;  2LNB A;  3WTW C;  3GUD A;  1LDK B;  5FO5 A;  1LDJ A;  4OIQ F;  1FNN A;  2IA0 A;  2A3S A;  2XVC A;  3GZ6 A;  2FML A;  1G4D A;  2DQR A;  4HX4 A;  2IW5 A;  2HS5 A;  4XSZ F;  2M1B A;  3GXO A;  3RKX A;  3NEU A;  4I2O A;  5BOX A;  4PGG A;  3TDU C;  1H9G A;  1Z05 A;  1D8K A;  2J5P A;  1TQP A;  3W6J B;  4A12 A;  1UFM A;  4M6Y A;  3DQV C;  3BZ6 A;  1IXR C;  1LEA A;  1BI1 A;  3WGG A;  1T6S A;  3T8R A;  3WE2 A;  1GVJ A;  3ZMD A;  5L3C A;  2VBX A;  3ZMZ A;  3IWF A;  2O03 A;  1YS7 A;  2NAZ A;  1EH8 A;  2FNA A;  5BS6 A;  1XGN A;  4M71 A;  2HEO A;  4LG0 A;  4ZYG A;  2QUF A;  1T39 A;  1A04 A;  3VEP A;  3KP6 A;  1BC7 C;  4UV8 A;  4LLL A;  5HLI A;  3AAF A;  1XDS A;  3KP4 A;  2K4B A;  2EA2 A;  2OBP A;  3MQ0 A;  1G3S A;  2LF8 A;  5K5O A;  2EV6 A;  4PZJ A;  1TTY A;  4HQM A;  3W6K B;  5A2Q K;  4ZZD A;  2Z5U A;  2Z3Y A;  3T1B A;  3JSP A;  1G3Y A;  4M9S A;  5HLH A;  2HOE A;  2FBI A;  5BPI A;  2BV6 A;  2Y48 A;  3WGI A;  2GWR A;  5DCM A;  4L5J A;  2K7L A;  1R5G A;  4EJW A;  3KEQ A;  5DYM A;  2CW0 F;  2VC1 A;  1OPC A;  2WC2 A;  2W24 A;  4FX0 A;  1KA8 A;  1SFU A;  2C6Y A;  3L09 A;  2RNJ A;  1MGT A;  2VXZ A;  5FD5 A;  2FMY A;  3TO7 A;  1MDM A;  2G7H A;  1ZLJ A;  4HV5 A;  2YU3 A;  2PQ8 A;  3V4G A;  3TO6 A;  4Y17 A;  4A5M A;  2VOP A;  3E97 A;  5E17 F;  4FT8 A;  2QEN A;  1P92 A;  2A5Y B;  3P9I A;  2HKO A;  1PP7 U;  4I7H A;  1LNW A;  1YLF A;  2PEX A;  3JAM K;  3F21 A;  3E5Q A;  4MNU A;  4EVI A;  2KKO A;  2P6S A;  4MTE A;  5DUI A;  2KIM A;  3HRU A;  3GO5 A;  1QNT A;  5BPD A;  1J0R A;  1WQ2 A;  2VBY A;  2K02 A;  5FLX K;  5H6R A;  3FM3 A;  5LGT A;  4KNY A;  2A69 F;  1JXS A;  5CVI A;  5DD4 A;  2M45 A;  3ML6 A;  1U5T B;  3CTA A;  1G3T A;  3MCZ A;  5L3B A;  3FXU A;  2O6G E;  3CLO A;  3CUQ B;  4MQ9 F;  1KGS A;  2ADU A;  3TOB A;  1HBX G;  4I0A A;  1F1Z A;  4OIP F;  3BOQ A;  3CJN A;  3MFK A;  2X0L A;  5ICG A;  2E7X A;  4KMF A;  4A0Y A;  1HST A;  1PUE E;  1LEB A;  4Z2Y A;  2DW4 A;  2RDP A;  4IJA A;  3R0J A;  5HDN A;  2STW A;  4L0Z B;  3J80 Z;  3VFZ A;  3ABU A;  3DXJ F;  1K79 A;  3IHU A;  4HDU A;  4BYY A;  2Q2E A;  3QP5 A;  1XCB A;  3T0Y A;  1SMT A;  2QBY A;  1I5Z A;  3TQN A;  4NQW A;  3RJP A;  3IKV A;  4CYD A;  4ZYH A;  4I02 A;  3QAH A;  4FHT A;  2XAS A;  3C1D A;  4H0E A;  2WWY A;  3H3Z A;  4O5V A;  1B4A A;  3EYY A;  1O3R A;  1HW5 A;  1OYW A;  3DF8 A;  1SD5 A;  1XGM A;  3F8C A;  4PDK A;  5HLG A;  4U7D A;  1SD4 A;  2KIF A;  4P5O A;  5IT9 Z;  1EV7 A;  2GA1 A;  2OA4 A;  4YG2 F;  3WTS C;  1FZP B;  2RKH A;  3LAP A;  2V1D A;  3GFI A;  2FBK A;  4KYW A;  3M1E A;  3HHH A;  2H27 A;  2EB7 A;  4AVP A;  3GLX A;  1LB2 A;  4L9V A;  5L3F A;  3R60 A;  3HHG A;  1W7P D;  2GXG A;  1HXD A;  4Q4Z F;  4L5I A;  1BI3 A;  2EJR A;  3Q9V A;  1FYL A;  4M74 A;  5KK1 A;  2L01 A;  2HYG D;  3HSF A;  3WOD F;  2VE9 A;  5CYV A;  3FM5 A;  4KUM A;  4P9U A;  2Z9O A;  1KQ8 A;  3ZMU A;  3LWF A;  2F2E A;  1FPQ A;  2L3D A;  1ONV A;  3WU0 A;  1HKQ A;  3I58 A;  5IT3 A;  2STT A;  4CHU A;  2Z99 A;  1R1V A;  3L7W A;  1TW3 A;  5EEG A;  2VT2 A;  1V4R A;  5J6X A;  3GX4 X;  3I64 A;  1B6A A;  3HIF A;  1D5V A;  1FT9 A;  4HA8 A;  2A6E F;  1WI9 A;  1W5T A;  5FGM A;  1O57 A;  2M87 A;  2A61 A;  2Y0M A;  2DLL A;  2H6B A;  3WU1 B;  2O8X A;  1ON1 A;  4I01 A;  1FSE A;  5FFZ A;  3DFG A;  4OIN F;  1FX7 A;  4ENM A;  3K1M A;  2P5V A;  4G7H F;  5F1R A;  1S29 A;  3GEZ A;  3EET A;  3KZY A;  3TKY A;  2PMU A;  3E6D A;  3SXY A;  2BYV E;  3HSR A;  1Z1D A;  4M73 A;  3R0A A;  5TRD A;  2P4W A;  2HGC A;  5H6Q A;  2NYX A;  1U2W A;  2W57 A;  4CDG A;  1R23 A;  4K2E A;  5LLQ A;  3F8M A;  1AOY A;  2QWW A;  4R8H A;  4NHJ A;  5H20 A;  4LB5 A;  1FP1 D;  2KJB A;  1I6X A;  3DPL C;  2HDC A;  2VE8 A;  3C7J A;  3EYI A;  2A68 F;  3K1P A;  5CLS A;  3FXQ A;  1KU3 A;  1ULY A;  3HTU A;  1FBU A;  3ROU A;  1PP8 F;  1XGO A;  4GO1 A;  1P4A A;  1QZY A;  2QVO A;  1YYV A;  2ZBK A;  2VON A;  1J2X A;  4A6D A;  1TQM A;  4N9I A;  2BGC A;  4HX7 A;  1FOK A;  3U1D A;  2NS0 A;  2FXA A;  2XAG A;  3N4M A;  1FYK A;  5E8I A;  3TDZ C;  1E17 A;  3PQK A;  4CXF A;  2EA4 A;  2YR2 A;  3R4K A;  2FRH A;  4L9N A;  1Z91 A;  4BHB A;  3BPX A;  4AIJ A;  4MEY F;  2G9W A;  3NQO A;  5D5W B;  1FSH A;  4S05 A;  2LDU A;  3COA C;  2AXL A;  2EFP A;  3KE2 A;  5J8F A;  3RYP A;  2HQN A;  1XMK A;  1BIA A;  1IN8 A;  1ZAR A;  1S3J A;  1R7J A;  1XD7 A;  1SFX A;  4IF4 A;  2EWN A;  4RB1 A;  5CJ9 A;  5J8C A;  1H0M A;  4FX4 A;  2RV8 A;  4YFN F;  2IRF G;  3PFI A;  2TDX A;  2ESN A;  2FU4 A;  1DPR A;  4BHC A;  2YSR A;  4P9F A;  1JHF A;  2ETH A;  3IL2 A;  2F5C A;  4UXN A;  1Z7U A;  3I59 B;  4ESF A;  5F64 A;  4AWX B;  3D5L A;  2R7D A;  1ZLK A;  2WV0 A;  3M7G A;  4EJO A;  3SQN A;  3Q9S A;  4Y13 A;  1SMY F;  2KJC A;  2ZME A;  2FE3 A;  2XUB A;  2XHK A;  2OQG A;  2FF4 A;  1CF7 B;  4AD9 A;  4BHP A;  4I98 B;  2MD5 A;  5K5Q A;  1OYI A;  4A0Z A;  3H3U A;  5E20 A;  1Q1H A;  3QU6 A;  3P9C A;  3Q5F A;  3MWM A;  3EQL F;  4YFX F;  4WF2 A;  3J80 K;  3ZMS A;  4I09 A;  4HZF A;  1XN7 A;  4XSX F;  4EMS A;  4HW0 A;  3GYH X;  4UV9 A;  1L3L A;  4XRF A;  4R79 A;  1U8R A;  4E70 A;  2MH9 A;  4MQV A;  2VN2 A;  4ZH4 F;  2ZFW A;  5HS7 A;  3E6C C;  5HDK A;  2CSO A;  4KIF A;  1FYM A;  5DCM B;  1QO0 D;  3RPQ A;  1TNS A;  1TLH B;  3V8J A;  5IT9 K;  3ZN1 A;  2ZNZ A;  5D5X B;  1XSV A;  4WXH A;  2GA2 A;  3VB2 A;  3LA2 A;  5DDG A;  4MHG A;  3EDP A;  1IZ1 A;  2RC4 A;  1MDM B;  1NHA A;  3R61 A;  1R00 A;  4ENN A;  2CO5 A;  2O0Y A;  4EGY A;  3B02 A;  1YIO A;  1FWZ A;  2DTR A;  2CFX A;  1HW2 A;  4M9Z A;  1R1T A;  3V7C A;  1HKS A;  3BPV A;  5D8K B;  2DAO A;  1UHW A;  2FNP A;  4S04 A;  2VBW A;  1JHH A;  2IVM A;  3F3X A;  1AWC A;  2L4M A;  1W7P B;  4ESB A;  2EFO A;  1L0O C;  1KYZ A;  3G73 A;  3P7N A;  1U6G A;  2RGV A;  1F4K A;  1U3E M;  1TNT A;  2CGP A;  4G7Z F;  5HOO A;  5CVV A;  2VOD A;  3HTS B;  2UXN A;  2LF7 A;  3DKW A;  3HOS A;  1FLI A;  2COM A;  2D1H A;  1RI7 A;  1ZGA A;  4TV7 A;  1XCV A;  1VTN C;  2DK5 A;  2RQP A;  1GXP A;  2KRF A;  2VC0 A;  1ZRD A;  1I1S A;  3DEU A;  2F5F A;  5ED4 A;  4D0P A;  3IWZ A;  2HFH A;  2OZ6 A;  3SFZ A;  4ZYE A;  3V7S A;  2XRO A;  1UB9 A;  1WWX A;  1QPM A;  5JI6 A;  1BC8 C;  4HDV A;  1J59 A;  3J7A O;  1DUX C;  2P8T A;  1FP2 A;  2XAQ A;  4LMY A;  1I27 A;  3FF5 A;  1LVA A;  5HVQ C;  4OIR F;  4HX8 A;  5E1X A;  4ENJ A;  4M72 A;  3PQJ A;  1R1U A;  3K2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...