1GXPA

Phob effector domain in complex with pho box dna.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
AVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcriptional activator
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN
publication title Tandem DNA Recognition by Two-Component Signal Transduction Transcriptional Activator Phob
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 103
sequence length 103
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1gxpA00
2IPQX 3E6MA 4ENNA 3L9FA 2Z3YA 5JI6A 1HW1A 3H3ZA 2CQKA 4LFUA 3Q9VA 4A6EA 5H6RA 1K78A 1FBQA 3ZMZA 4HDUA 1QGPA 2IP2A 2Y48A 4B09A 1XSVA 1HBXG 2MC3A 2IA1A 4XSZF 1RUOA 2RN7A 3EETA 1FYMA 1R36A 3CTAA 1Y0UA 3KCCA 1F1ZA 3VFZA 1D8KA 1FC3A 3MQ0A 2A07F 2O03A 4HQMA 1LDDA 4UVBA 3HTSB 3WG9A 4U88A 5K5RA 1BM9A 5DYMA 2ZXJA 3WTUC 3EQLF 4AIHA 4N0BA 2PN6A 3GW2A 1USTA 2X4HA 2P4WA 3WGHA 5CVJA 3JSOA 1K7AA 3IRQA 4UHTA 4EJOA 3F21A 4L9NA 3HSEA 5CYVA 1XGOA 3J80Z 3RKYA 1TBXA 3ZN1A 1YS7A 3IWZA 3MAJA 3BWGA 4TV7A 1FX7A 2QZ8A 3KZYA 1D8JA 4D0PA 4L5JA 4ZYDA 4RGRA 5BMZA 2GXGA 2KRFA 4RGXA 4KIGA 5FD6A 4OIOF 1B9MA 1SD4A 4K2EA 3DQVC 2DQLA 1J5YA 3KP3A 4G94A 4HX7A 1J9IA 4NQWA 4CDGA 3IC7A 3ABUA 1WI9A 2G7UA 2GXBA 4ZYGA 4HF2A 2NYXA 2Y0MA 2OU2A 1Z1DA 3Q9SA 1H0MA 1OMIA 3OOPA 5D8KB 1KGSA 4PGGA 3QPTA 5D6EA 1XGMA 3ZMSA 5HDNA 3PFIA 1IN8A 1TQPA 3F8MA 3E5UA 3RKXA 2ZNYA 1ZGAA 2L4MA 2F5CA 4BXUA 2OD5A 3ZN0A 5ERIA 3HOSA 3VB2A 2HWVA 1J0RA 1O7LA 1G4DA 3E3VA 4MTEA 3V7RA 3BZ6A 3RYPA 4LLGF 5TJJA 5JHUA 2DI3A 1MD0A 1XCVA 3HUGA 4OIPF 5K1YA 2W25A 3F72A 3HOTA 3CUQC 3TGNA 3SFZA 1CF7B 2EFNA 2O6GE 2M45A 3BJAA 5ILSA 2Z5UA 1RIOH 3J81K 4BNCA 3MEXA 3K0LA 4I01A 5FFZA 1TNSA 4GO1A 2ACJA 4Q5SF 3LA7A 2EK5A 2JSCA 4WXHA 4MTDA 1SMTA 2VE8A 4LG0B 3JTGA 4WXDA 1ON1A 3R60A 2EA2A 2MH9A 2BGCA 3BJ6A 3TKYA 4KA4A 1DPUA 4RAYA 3FM5A 5CJ9A 2HS5A 3DV8A 3CUOA 3FZVA 4RB2C 5A2QK 1V4RA 1DDNA 3N4MA 1Z05A 1ODDA 1GHCA 5K5QA 5HS9A 5KK1A 3H92A 4HLXA 1FOKA 2CG4A 4RB1A 1REPC 2QQAA 4BHCA 2FXAA 3V8KA 5LGTA 3RYRA 2GA1A 2O61A 4YIIA 2FA5A 4UV9A 3G3ZA 2ELHA 4GYIA 1TW3A 5AIQA 2L3DA 2PJPA 1FSEA 2VONA 1YIOA 3DPLC 2H6CA 4N9HA 2Z99A 3WODF 5FO5A 1SD5A 3I59A 4HYEA 1KYZA 3K1MA 3GFJA 4U0VA 5ICCA 1JGSA 2MD5A 1YW7A 5EEHA 2L01A 3GLXA 1KA8A 1YG2A 1W7PA 1YQAA 2QBYB 1TQMA 5J6XA 1YO5C 2XRNA 4M6YA 5D4SA 1ZN2A 3E5QA 1TLHB 1O3QA 4EM0B 1R5GA 4P96A 4KNYA 3WTYC 2NNYA 1ZG3A 5BS6A 4LJZF 2E1CA 1J7KA 2PMHA 4U0WA 1QZYA 4BHBA 1OR7A 2P7CB 1P2FA 3FM3A 2CYYA 2DTRA 1J2XA 1JHFA 4EV0A 3T1BA 2QLZA 2R3SA 3CO7C 2OQGA 4N9IA 1R23A 1Z9CA 5DDGA 1KU2A 4IRHA 2DPDA 4YG2F 1KQ9A 1DUXC 5D5UB 2O0YA 3ZMDA 4HAMA 5E8GA 4CO8A 2E7WA 2LF8A 2FNPA 2D1HA 2XAHA 2X0LA 2E1NA 1AOYA 1IRFA 2VBXA 4XRFA 1L3LA 1UCRA 2E7XA 2O8XA 2UZKA 5ILVA 3I5UA 2HTJA 1E17A 3RDIA 3QU3A 1ZARA 3ELKA 1J59A 2R7DA 1KYWA 3ABTA 4EGYA 4P55A 4KN4X 2GZWA 1IRGA 1U2WA 3M8FA 5AONA 4O5VA 5L3BA 4A6DA 5D4RA 3P9KA 2K02A 3DEUA 2RQPA 1E2XA 4MEYF 1ZRCA 2MH2A 3BOQA 1W5TA 1HW5A 3R6SA 1SMYF 4YFNF 2UWMA 3GVAA 4OIRF 3QPHA 4I0BA 2V1XA 4ZZDA 3I58A 4Y17A 5LLQA 2XKOA 1BOAA 2HEOA 3T5XA 4YFKF 1SFEA 4ENKA 1R1TA 2XASA 2MLGA 2HQNA 4ZZLA 1PP7U 3GEZA 5L3GA 5AIPA 2FMLA 2M5WA 2LSOA 2F5EA 1FPQA 4WK8F 5CVVA 3R61A 4ENJA 1QNTA 2VOOA 1ZRDA 3K1NA 4EJVA 2PFBA 3KZZA 1IZ1A 3KLNA 2RKHA 5FLXZ 2RV8A 1IF1A 1I6XA 1OYYA 5IT9K 4AVPA 1O3RA 2ZMEB 2FMYA 2IW5A 1LJ9A 2ESHA 2ZJ2A 1T38A 1U8RA 3GZ6A 2XAGA 3F8BA 2PG4A 3KP2A 5EEGA 4O3MA 4DNCA 3I64A 3ISPA 3U1DA 5H20A 5BPDA 3VOEA 3NEUA 4M74A 4XLNF 4G6QA 3M9AA 3KEQA 1SD6A 2JPCA 3V7SA 5ED4A 1L0OC 4HQEA 2IRFG 2ZO4A 1S6LA 1FWZA 4FX4A 2YR2A 1BI3A 2FBHA 1XMAA 2IJLA 1LEAA 4BAYA 2EFWA 2K27A 4HDVA 4Q47A 4LB5A 1D3YA 2VBZA 1YLFA 2HQRA 3N97A 4M72A 3KEOA 3HRSA 4ZYHA 5D5VB 2V6CA 4WXCA 2CGPA 4G7OF 5CVRA 4MHGA 2CW0F 4UVCA 3O6BB 1O3TA 4Z2YA 3BPXA 2W57A 4MGRA 2DO7A 2XAQA 1U78A 1HXDA 1EH8A 5JR3A 4LLNA 5F64A 4GCVA 2YSRA 2MBFA 3T8TA 1MKMA 5D5WB 5FFXA 3AAFA 5E17F 3LA2A 1U5TB 2HFHA 4FT8A 1CF7A 4FHTA 4AIKA 1EH6A 1HKSA 3KP6A 3EYIA 1FYLA 5DEQA 4P9FA 4S05A 2FSWA 4QWQA 3WTWC 3FX3A 4LG0A 3KP4A 4AIJA 2QWWA 3VODA 4XBFA 3JAMZ 3HIFA 4DQ2A 1Z91A 4LMYA 2YX4A 1Z7UA 5E8IA 1U6GA 5E18F 1FLIA 2ESNA 2LKPA 4MEXF 1F4KA 1XSDA 1P4WA 2K86A 1A04A 1G3TA 3KLOA 1B6AA 1F9NA 5HLGA 1K6OA 1C0WA 1X3UA 4A2UA 2DQRA 4CZZA 4EMSA 2OZ6A 4RAZA 3KP5A 3B73A 4M6XA 1R1VA 1IUYA 3LFKA 4L9TA 3SXYA 1IXRC 1LDKB 2QUFA 2PI0A 1OYWA 3FMRA 5FLXK 2GWRA 3WTZA 1BI0A 1P92A 4HV5A 3EYYA 2HKXA 4IRGA 1YW8A 4M9ZA 3QU6A 1K79A 5LHGA 2OQRA 3F8NA 1HKTA 4WWCA 2HKOA 4A0YA 1O57A 1NHAA 1BC8C 3D0SA 1G3WA 3CJNA 4CGZA 4R8HA 3FWEA 1EV7A 1R5HA 5H6QA 4IVNA 3HRUA 5LHHA 3CO6C 3KP7A 2WV0A 2MA3A 3LQQA 4L0ZB 2OA4A 2QBYA 2EFQA 2QQ9A 5HVQC 2BE5F 1TW2A 1O7FA 4YFXF 3ZP5A 2P8TA 3F22A 2D45A 3Q5FA 1XDSA 3S2WA 3RTRA 3FXRA 2NRAC 3J7AO 2V1DA 1YFHA 2P6TA 2FEZA 3ZQ7A 2M8EA 1B4AA 3RI4A 3G73A 3K69A 3L2CA 2VC1A 1WWXA 4HF0A 3BPVA 5LRSA 2Q2EA 3KFWX 3O3KA 4A12A 2K4JA 3E5XA 4IF4A 2CSOA 4WF2A 3HSRA 2VN2A 5LHIA 1QBJA 3GFLA 3P7NA 4GXOA 2XKPA 3MFKA 4IRIA 1Q1HA 3J80K 1GXQA 1QPMA 4G8XA 4KIFA 2ZBKA 3GYHX 3PQKA 3FF5A 2PMUA 3WE2A 2COMA 2ZKZA 3DF8A 2LDUA 3ZMUA 3RIRA 4OIQF 2Q8KA 4ESBA 2P5KA 3M7GA 3JAMK 3I71A 5DCMB 1ZHFA 3MZHA 3ML6A 3P9IA 2G7HA 3WE3A 4F7ZA 2P7VB 4MNUA 4LLLA 2VC0A 3TO7A 1ONVA 3BJOA 2KIMA 4AWXB 2B0LA 1BC7C 1ZLKA 1R22A 2GQQA 4WX9A 2HR3A 3P9CA 1USSA 4MQ9F 2A69F 4A0ZA 2VOPA 3BROA 4JQFA 3ECHA 1ZYRF 1PP8F 2GAUA 2WWYA 4R1HA 1I27A 3TDZC 1U3EM 2ISYA 4LB6B 3WU1B 1ON2A 1G3YA 2PLYA 4QLCU 1FBUA 1FSHA 4RB3C 4ZYEA 1XCBA 1SFUA 3HYIA 2ETHA 5E1ZB 2FF4A 3TO9A 2QENA 1MGTA 3C7JA 2BBYA 1KQ8A 3SQNA 2JRTA 1IN7A 2XVCA 3QP5A 2ZMEA 4HF1A 2HDCA 3F6VA 3JTHA 1BIAA 2A3SA 3C3WA 3T0YA 4CHUA 1JE8A 4G9YA 3IKTA 3MWMA 1BBYA 5TRDA 4G7HF 5DUKA 1XGNA 5L3CA 3E6CC 4CXFA 2BV6A 5LBQA 3F8FA 4H0EA 3CDHA 3W6KB 4A0XA 4WCGA 4G6DA 2OAZA 5DD4A 3HRMA 1R7JA 2DK8A 5BOXA 3BDDA 2M30A 3E6DA 4EGZA 2V79A 2L54A 3R0AA 3GFMA 2GIVA 1BN5A 1GXPA 5J8FA 2IT0A 3RKWA 4KMUX 2VXZA 4OU0A 3I0TA 2CO5A 4HW0A 2V9VA 4UXNA 1ZH5A 2H6BA 3NRVA 1FP2A 3O2PE 2VE9A 1MJ9A 4LK1F 1J75A 1IAWA 2KJCA 4HV6A 1UB9A 2G9WA 3MZYA 2EFOA 2EV5A 3LSTA 2W85A 3QAHA 4IXAA 4RGUA 2C6YA 1FYKA 5IT3A 4EJUA 1Z6RA 3IWFA 3TQNA 4KDPA 2F5FA 4ETSA 2J5PA 1H9TA 4B8XA 4I02A 1UHWA 2K7LA 4EQQA 1U5TA 3WTSC 1SFXA 3U2RA 2QYOA 1R00A 3EUHA 3JW4A 4HLYA 4PZJA 3OV8A 2KIFA 1IN4A 1I5ZA 2JZYA 5D5XB 5LEKA 1P4AA 2EV0A 3E97A 4EM1A 2LNBA 4L0YB 1TNTA 4I7HA 4RS8A 2W84A 2UXNA 1ZREA 3ZPLA 5F1RA 4HA8A 2HYGD 2IVMA 1WKMA 1MDMB 3WGIA 3TOBA 2RGVA 3M1EA 2GA2A 4JK1X 4Y15A 2ZFWA 3VEPA 3DXJF 1DPRA 3GO5A 3FHZA 3C1DA 4AD9A 2XHKA 2YX7A 3U9GA 2VBYA 2IA2A 1WSUA 1W5SA 4Q4ZF 2AXLA 2EWNA 2HTSA 2EJRA 3GXOA 4M73A 1BJAA 2JT1A 2BEOA 4UV8A 2HZTA 4CICA 3I4PA 3F6OA 2VODA 2ZNZA 3C18A 5ILUA 1TQIA 4HX8A 2YPRA 2QM3A 3V8JA 5A2QZ 2JPBA 1DP7P 5D8LB 3WTVC 3QP6A 5LRRA 5KVRA 1ZG1A 5F6FA 2V1UA 3CUQB 1B59A 3LA3A 2P5VA 2FE3A 4E70A 3W6JB 1PUEE 1JHHA 4A5NA 1T98A 4KYWA 1KU7A 3F8CA 1XB4A 1PDNC 2PQ8A 3HHGA 4GYGA 4RB0A 3ECOA 1T6SA 1VTNC 3I54A 1S3JA 5E20A 4L9JA 4IPAA 2A6HF 2BYVE 2RVCA 2ZCWA 4LK0F 3WGGA 3DFGA 4KN7X 4M9XA 4P5OA 2EB7A 2L4AA 1LQ1A 1HSTA 1ZLJA 1LVAA 3D5LA 1LNWA 3TDUC 1G3SA 3L7WA 2CWEA 3K2ZA 4EVIA 1EH7A 4Q48A 2Q0OA 5K5OA 1UFMA 5CVIA 4NB5A 1D5VA 2RDPA 4BHPA 4U7BA 1ZGJA 5JFRA 5L3DA 1HW2A 4LGWA 2O3FA 1P6RA 1W4MA 2L02A 2DW4A 1K78B 1LDJA 2DFIA 2FU4A 4UUVA 1FP1D 3FXUA 1FZPB 2H94A 2ADUA 2W24A 2JTVA 2KJBA 4BH9A 5BPIA 1OPCA 3V8LA 1QQIA 3H3UA 2QVOA 2IA0A 1WRJA 1KQ0A 4EM2A 2NNNA 2PEXA 3CLOA 3ULQB 2A6EF 4U7DA 5HLIA 1IN6A 2F5DA 4S04A 5HDKA 4KICA 3GUDA 5FGMA 1YTYA 1QZZA 5DCMA 1HQCA 2FNAA 3REOA 5HS8A 3M8EA 2VT3A 3GX4X 4I2OA 3HHHA 3IL2A 3KE2A 1KU9A 3DP7A 5E1XA 1U5TC 4OMYA 2P5LC 3WU0A 2ISZA 2EA4A 3GZ5A 3HSFA 2XROA 5JVTA 2D1VA 4MQVA 1QO0D 5HLHA 3R4KA 2A61A 1Z6TA 1IW7F 2M1BA 2CFXA 1TTYA 2M87A 2WTEA 3HTUA 4RGSA 2FOKA 1I1GA 1UHMA 2FRHA 4NHJA 5LEJA 2DAOA 1S7AA 2EFPA 1HKQA 3L00A 3QOPA 1B1BA 1FY7A 3FXQA 4FX0A 1SD7A 5DCFA 2H09A 4ON0A 3SZPA 4ESJA 3FMQA 2XIGA 2DLLA 2XAJA 1ZAOA 4O6JA 1XGSA 2FQ3A 1RI7A 5CLSA 5LGUA 5HDGA 4XSXF 1I1SA 1XN7A 3MCZA 1ZRFA 3I53A 2HOEA 3SZTA 4EJWA 4R79A 2J5OA 3GFIA 1R58A 3RJPA 2A5YB 1MJAA 2NAZA 3K1PA 4JBAA 2XGXA 1JXSA 3KETA 2Y75A 5IT9Z 3TO6A 3F3XA 4KUMA 2D2WA 4PCQA 5BQTA 4L18B 2DT5A 2HGCA 3V7CA 2Z9OA 4M9SA 2AS5F 4I98B 5FD5A 1KU3A 3DKWA 3K9TA 1OKRA 3DPTA 2FBKA 2A68F 1OYIA 1H9GA 2XV4S 5J8CA 2DPUA 3GF2A 3LAJA 4EJTA 2R7FA 1BIBA 2KKOA 2RNJA 1RUNA 3COAC 4Y13A 1BI1A 4KT5C 4LD5A 2XUBA 3RPUA 4OMZA 3T8RA 1FNNA 1RZ4A 4BYYA 3PQJA 1T0FA 5DUIA 2QQBA 3TOAA 2DK5A 3RPQA 1XMKA 4U0YA 2XAFA 4L5IA 3JSPA 4I0AA 3LAPA 4UNOA 1LB2A 2VT2A 3E6BA 3ZMTA 2KIUA 1T2KA 3ZMVA 2STWA 1MJBA 5HS7A 4M71A 1IN5A 3L09A 4I09A 5L3EA 1B9NA 1R1UA 3NQOA 4XLPF 2EV6A 4HBLA 4ESFA 2VBWA 5L3FA 3HRTA 1RNLA 2K4BA 3QRFF 5FB2A 1YS6A 3B02A 2DU9A 1MDMA 2F2EA 4OOIA 5CVUA 4HOBA 5DD8A 1XD7A 3BP8A 3WTXC 5E1WA 3LWFA 3SHFA 6PAXA 1P4XA 2OZUA 4HZFA 1CGPA 3I59B 1BI2A 3IHUA 1MZBA 5HOOA 4IJAA 2WC2A 1YYVA 4CYDA 3FMSA 5LGNA 3F23A 2NS0A 2UXXA 1ZG5A 3IRRA 2P6SA 3ERED 1G6NA 2RC4A 4IHSA 1HSJA 1FBSA 3GWZA 4BQAA 5ICEA 4ASNA 1LEBA 3EDPA 1W7PB 4KFCA 4GGGA 2OBPA 3ROUA 2MLKA 4PGHA 2DBBA 1XSXA 2HYFA 2STTA 1STZA 4ZH4F 4L9VA 4OINF 5ICFA 3CUQA 3BY6A 1W7PD 4ENMA 1S8NA 1FT9A 1F5TA 4HX4A 1YW9A 2LF7A 1AWCA 1IXSB 1ULYA 1SAXA 2FBIA 1T39A 1V3FA 2Z33A 4YIFA 4KMFA 3R0JA 4UVAA 1XDUA 1GVJA 3WTTC 4A5MA 5D6FA 5DV5A 2PBIA 1O3SA 2H27A 4KIBA 1WQ2A 3IKVA 2TDXA 4P9UA 4PDKA 3LQRA 2YU3A 4G7ZF 4IHTA 5ICGA 3V4GA 1S29A 3J81Z 1S7OA 1IXCA
chains in the Genus database with same CATH superfamily
2IPQX 3E6MA 1V54H 4ENNA 2AQEA 2L2OA 2W1OA 1X1BA 3L9FA 1BOBA 1X1PA 4XKBA 2Z3YA 1RKWA 3OR1C 3LSRA 2JA2A 4B47A 5JI6A 1HW1A 3H3ZA 2L5QA 2CQKA 4LFUA 1JKOC 2QF7A 1HDDC 1I6HJ 3Q9VA 4XLHA 1E3PA 2AXTC 4A6EA 5H6RA 1E0EA 2FJ1A 3A4CA 1K78A 1FBQA 3ZMZA 1ZR2A 1PVEA 3S15J 1IG7A 1Y1WJ 1R4NB 4BXFA 4HDUA 1QGPA 2FX0A 2IP2A 1JTYA 1GLNA 2Y48A 4B09A 4RM2A 1XSVA 3QODA 1HBXG 5TISC 2MC3A 2IA1A 4XSZF 4KISA 1RUOA 1VQPI 2RN7A 4XN3A 2XGDA 2XRLA 3M1CA 3EETA 2XB5A 1MH4A 1FYMA 1R36A 3CTAA 1Y0UA 5JHFA 3KCCA 1F1ZA 1ETKA 2IBDA 1WPKA 3GZNB 2Q1ZB 2Y31A 1ETWA 3VFZA 1D8KA 1FC3A 2FD5A 3MQ0A 4W1UA 4B3XA 2KP6A 3ZOBA 2A07F 1LE8A 1XMXA 4BDZA 3I9V2 2O03A 4HQMA 3TEDA 2R92J 1LDDA 4UVBA 3HTSB 1SAUA 4BL0B 3WG9A 4U88A 2VKHA 5K5RA 1IV6A 1BM9A 3E0JB 5DYMA 5J4VA 1A36A 2LTPA 2ZXJA 4HG2A 3WTUC 3EQLF 5IY5H 1RPWA 4AIHA 1FOWA 4N0BA 2QEXI 2PN6A 2IGOA 3GW2A 4AIDA 1D1BA 1USTA 2X4HA 2K9MA 2P4WA 1PUFB 3WGHA 1B72A 2F6CA 5CVJA 3JSOA 2EIKH 1Z3XA 2R7SA 2K9QA 2EZLA 1K7AA 3IRQA 1POGA 4UHTA 4EJOA 1IDYA 2V9PA 4L9NA 3OS2A 3HSEA 5CYVA 3F21A 1XGOA 3J80Z 3RKYA 1TBXA 4PSWA 3JRFA 3ZN1A 1YS7A 3IWZA 2ZJQF 4NUBA 3ONQA 3MAJA 3BWGA 4TV7A 1FX7A 2BW3A 2QZ8A 4CCNA 2ZMEC 3KZYA 1D8JA 4D0PA 4L5JA 5DS9A 4ZYDA 2MSYA 2WY7Q 4RGRA 1SEUA 5BMZA 2GXGA 2KRFA 4RGXA 4G6TB 4IQJA 4KIGA 5FD6A 4OIOF 1B9MA 4IL6C 4KITB 1SD4A 4HEA2 4K2EA 4IZZA 1U8BA 3DQVC 2DQLA 1J5YA 3O8GA 3OYBA 3KP3A 1MIJA 4XLCA 2WB1N 4G94A 2E19A 3MKWB 3OYHA 4A3JJ 4HX7A 1J9IA 4NQWA 4CDGA 3CJTB 3IC7A 4JX4A 3MD2A 1ZGWA 4X1EA 3ABUA 1WI9A 3J7YJ 2G7UA 2GXBA 4IHXA 4L5EA 4ZYGA 3H9JA 2NYXA 3CJRB 2HVSA 5M3FJ 4HF2A 5F0CA 2Y0MA 2OU2A 1Z1DA 3Q9SA 4CCKA 4XLEA 3CESA 1H0MA 4CYCA 1OMIA 3OOPA 1AU7A 4QSHA 5D8KB 2D5VA 4RBOA 1KGSA 4PGGA 3QPTA 3I3LA 5D6EA 2XSDC 3W6VA 3PUBA 1XGMA 3ZMSA 3CMMA 3GTGJ 5HDNA 3PFIA 2BVLA 1V5FA 1IN8A 1TQPA 2L7ZA 3KYDB 3F8MA 3E5UA 3RKXA 2E71A 2ZNYA 3A02A 4E7LA 1ZGAA 4OAZA 2L4MA 2F5CA 2M8GX 2OC6A 1P7JA 4BXUA 2IGKA 2OD5A 3ZN0A 4V2FA 1D0XA 3MZ8A 3MKYB 1QHGA 5ERIA 2F4MB 1A5JA 2IS4A 2PX9A 2VKDA 2X6WA 2CQ7A 4CA0A 3HOSA 3VB2A 3HOXJ 4A69C 5F08A 3G2BA 4BACA 2YUSA 1ETYA 2HWVA 1J0RA 1O7LA 2AO9A 4YRVA 4BEHA 1G4DA 3E3VA 4MTEA 3V7RA 3BZ6A 3NWSA 3RYPA 4LLGF 5TJJA 5JHUA 1LFUP 2CQNA 1OCPA 2DI3A 2VPRA 1FJLA 1MD0A 4IEJA 1XCVA 3HUGA 1YRNA 4OIPF 5K1YA 2W25A 1R49A 3F72A 3HOTA 3CUQC 3CQZJ 3TGNA 3SFZA 3CCMI 2EFNA 1CF7B 2O6GE 3SDGA 2M45A 1Z67A 4DZPA 3BJAA 1OCTC 5ILSA 2Z5UA 1RIOH 1XC5A 5GAGJ 1P9QC 3J81K 1MSEC 4BNCA 4I76A 3MEXA 3K0LA 4I01A 2PMZN 5FFZA 4Z6YA 1TNSA 4GO1A 4BE2A 2M9HA 2XC7A 2ACJA 5EZHA 1QVTA 5J4YA 4Q5SF 3LA7A 2EK5A 2JSCA 3GLLA 4WXHA 3AL0C 4MTDA 1SMTA 2VE8A 4LG0B 2VL8A 3M07A 1EJ9A 5GAHJ 3SJMA 1XG1A 3JTGA 2KDZA 1X1DA 4WXDA 1ON1A 3R60A 4BJ5C 3ZGKA 2EA2A 4RLQA 2MH9A 3EPZA 2BGCA 3BJ6A 3TKYA 4KA4A 3SDBA 4BQOA 1DPUA 4RAYA 3FM5A 4I99C 4EATA 5CJ9A 1A6IA 2HS5A 2L9SA 3DV8A 2LVSA 3JRGA 4N4OB 3BTJA 3CUOA 3FZVA 4IHWA 4RB2C 2R7XA 4NC7A 5A2QK 1V4RA 1DDNA 2A6TA 5FKLA 2H8RA 5JLWA 3N4MA 5FRMA 1Z05A 2ME0A 3K4MA 1ODDA 1GHCA 5K5QA 4XONA 5HS9A 1G59A 5KK1A 3H92A 4HLXA 1ETQA 4DOZA 3S16J 2MFZA 3FXOA 5F27A 1FOKA 2CG4A 4RB1A 2BHYA 3L2WA 3PSIA 1REPC 2QQAA 1OQYA 4BHCA 3LOCA 1TP4A 1I50J 3S32A 4V2GA 1FTTA 3GTMJ 2FXAA 3V8KA 5LGTA 4S0HB 1QHHD 3RYRA 3H35A 2GA1A 2O61A 1MNDA 2KMUA 4YIIA 1BR2A 3Q0UA 3MMYB 2FA5A 1TWAJ 2Y0SN 4AUXA 3HB9A 1GT0C 5EGOA 3S1RJ 4UV9A 3G3ZA 3K7AJ 2ELHA 4GYIA 1TW3A 1LKXA 2L3DA 5AIQA 2PJPA 2DA4A 3HOUJ 3E7LA 1FSEA 2VONA 3C2HA 1YIOA 1GUUA 2LH9A 3U1KA 3DPLC 4PJJA 2XPWA 2QKMB 2DA1A 3RKQA 2H6CA 4KJZA 4N9HA 3IAM2 2Z99A 5DTDA 1SANA 4ITVA 3WG7H 3WODF 5FO5A 1SD5A 1UJ8A 2VIXA 3I59A 2R7TA 4IO9F 2OV7A 2NOGA 4HYEA 3LSKA 2M7BA 1WJDA 4AM3A 1BR1A 1KYZA 3K1MA 3QPLA 3GFJA 3HKZN 4U0VA 4BE0A 3K70D 5ICCA 3KYCB 1JGSA 2MD5A 5GAEJ 5KNLA 3V42A 1LVKA 1YW7A 5EEHA 2L01A 3GLXA 1VI0A 1KA8A 5K7FA 1YG2A 1W7PA 1LFPA 3TW6A 2XB0X 2EILH 1YQAA 2QBYB 5J47A 2WAFA 3AG2H 1TQMA 5J6XA 1YO5C 2XRNA 4M6YA 5D4SA 1ZN2A 3E5QA 2V4JC 1TLHB 1O3QA 4EM0B 1BW5A 1R5GA 5J1YA 3HPHA 3H9GA 4P96A 3ZQQA 2PMZA 1D5YA 1IV8A 1HC8A 4KNYA 2HXOA 3RZDJ 3WTYC 2NNYA 1ZG3A 5BS6A 3Q0WA 4HNTA 2ZB9A 2WAEA 2W7NA 4JYKA 4LJZF 1JUSA 2E1CA 3CD6I 1J7KA 2PMHA 4U0WA 1QZYA 4BHBA 1OR7A 3HDDA 2P7CB 1P2FA 3DKXA 1E3OC 3FM3A 2AQFA 2CYYA 1VF9A 2JN6A 5F0FA 3OYDA 2DTRA 1J2XA 2DA6A 1JHFA 2MW8A 3H5AA 4EV0A 5EDNA 1MNMC 3T1BA 5CQEA 2KT0A 3BTCA 2QLZA 1HCRA 2R3SA 3CO7C 1YI2I 2OQGA 3W2AA 4N9IA 2ZXWH 1R23A 1Z9CA 5DDGA 1KU2A 4IRHA 2Q2EB 2DPDA 3CP8A 1Q1VA 2LG4A 3GMEA 4YG2F 1KQ9A 1DUXC 5D5UB 1LUJB 2O0YA 3ZMDA 4HAMA 2LYCA 5E8GA 2WV1A 3SFIA 4CO8A 2VPLA 2E7WA 1T95A 2LF8A 2VQHA 2FNPA 2D1HA 2XAHA 1IDZA 2X0LA 1H8AC 2Y69H 2E1NA 4ANJA 1IRFA 1YJ9I 1AOYA 2VBXA 5JVGF 4XRFA 4PK4A 4YIRX 2Y30A 3SEQA 3FBNB 4ZJZA 1UCRA 2E7XA 1L3LA 3S17J 1HF0A 2JJ7A 2O8XA 3G1OA 2LBFB 2UZKA 5ILVA 3I5UA 4IX7A 2HTJA 1E17A 3BZKA 3HOVJ 1OLTA 3RDIA 3QU3A 1ZARA 1JUPA 3ELKA 3IUOA 4HNUA 1J59A 4ZDOA 3PNYA 2R7DA 1KYWA 2DT6A 3ABTA 4XN0A 4EGYA 4P55A 1YITI 2E5NA 2K5CA 2ZXIA 2DOFA 4KN4X 2GZWA 4BJ6C 5J1UA 1IRGA 2DFFA 5KAIC 3JRHA 1U2WA 3M8FA 3OYKA 5AONA 4O5VA 1VQ5I 5L3BA 4A6DA 2H8WA 5C3EJ 5D4RA 3P9KA 3ZXSA 3RQIA 2K02A 1AA7A 1HDPA 3DEUA 2RQPA 1E2XA 1NG7A 4MEYF 4NBQA 3OYIA 1WH5A 1ZRCA 2MH2A 3BOQA 4BUPA 1HW5A 1W5TA 3R6SA 1SMYF 2KPMA 2M4GA 4YFNF 2X9DA 2UWMA 4RA2A 3GVAA 4OIRF 3I55I 1UG0A 3QPHA 3FBIB 4I0BA 1YOVB 3FISA 4M3FA 1Z0XA 1R6RA 1ETVA 2V1XA 4ZZDA 3I58A 4Y17A 2V6EA 5LLQA 4RM3A 3OOUA 2XKOA 1BOAA 2HEOA 3T5XA 4YFKF 1SFEA 4ENKA 5GTHC 3HKZA 1R1TA 2XASA 2MLGA 5GADJ 2HQNA 3DBLB 3BT9A 4A3DJ 1SVLA 3PIPF 2DOEA 4ZZLA 1PP7U 3GEZA 5L3GA 4UUSB 3OYMA 1V5GA 1OCCH 4HSRA 5FLVA 2JK3A 5AIPA 2FMLA 2M5WA 2HNHA 2LSOA 2F5EA 1U0JA 1VZ0A 1FPQA 4WK8F 1MBKA 5CVVA 3R61A 4ENJA 1QNTA 5FKMA 2EIMH 3OYLA 2HXIA 3F0CA 2VOOA 5KAFC 2R0QC 4CCLA 1N77A 2M3AA 5C4XJ 5E79C 1ZRDA 3K1NA 4EJVA 2VKVA 5HNHA 2PFBA 3KZZA 1XS9A 1IZ1A 1VQ4I 3KLNA 2RKHA 3H1CA 5FLXZ 1AKHB 2RV8A 3JR9A 1IF1A 4AVZA 1JKPC 1PUFA 1MSFC 1NH3A 1I6XA 1UHSA 1OYYA 2K40A 1SC7A 5IT9K 4H4KC 4AVPA 1O3RA 4N4NB 1YIJI 2VJIA 2ZMEB 1FMWA 2FMYA 3SZGA 1T33A 2IW5A 1S72I 2CU7A 1LJ9A 2ESHA 2ZJ2A 3D5RC 1T38A 3ZRGA 2QSFX 1U8RA 3GZ6A 2XAGA 3F8BA 2PG4A 3KP2A 2E1OA 3FIWA 5EEGA 2F5VA 2HOAA 2OCEA 4HPQA 4O3MA 4DNCA 1UZCA 3I64A 3ISPA 3S14J 2QGUA 3MN2A 4PUSA 2CFOA 3U1DA 3OIOA 5H20A 5BPDA 3VOEA 1WJBA 3BQZA 3NEUA 4M74A 4MFEA 4XLNF 2L7MP 3PSFA 3VWBA 3QYEA 2CQQA 4G6QA 3JRCA 3M9AA 5IP6A 3KEQA 1SD6A 3HM5A 2DA5A 2JPCA 2OTJI 3V7SA 4NDLA 4LITA 1X3WB 5ED4A 5FKNA 1L0OC 4HQEA 3LSMA 2IRFG 2ZO4A 1S6LA 2X6XA 1FWZA 4FE4A 4F91B 4FX4A 3OWTA 2YR2A 2LD5A 4B4CA 4RAGA 4F93B 1IO2A 1BI3A 2FBHA 1BR4A 1XMAA 2IJLA 2DMUA 4Y7NJ 1LEAA 4BAYA 2EFWA 2IAIA 3BG6A 2FUG2 2K27A 3LSJA 4HDVA 4Q47A 1GV2A 4LB5A 1OISA 2VBZA 1D3YA 4C9YA 2F4OB 3DKYA 2OPTA 1YLFA 4NC6A 4FASD 4E7HA 2HQRA 3N97A 3RCOA 3S1NJ 2VI6A 2DJNA 4M72A 3H0GJ 4ZC3A 2R7RA 3G4SI 4IHVA 3KEOA 4HSTA 1W5CC 2HPIA 3HRSA 4ZYHA 5D5VB 2V6CA 4WXCA 2CGPA 4G7OF 5CVRA 1JT6A 4MHGA 3UR3C 2CW0F 3DLAA 1ZTRA 1T56A 4UVCA 5HODA 3O6BB 2DOAA 3D1NI 1O3TA 2HVRA 1S5LC 2X85A 4Z2YA 3A01B 3BPXA 4CUGA 2W57A 4MGRA 2IS6A 2BOLA 2DO7A 2XAQA 4BDYA 1U78A 2VKEA 1HXDA 4V19K 1EH8A 4FETA 2NXNB 3S8PA 5JR3A 3K4BA 4LLNA 2UV1A 5F64A 4GCVA 2YSRA 3H9QA 3DCFA 1QPIA 2MBFA 3CDLA 3L2RA 4XKWA 3OIPA 3T8TA 1MKMA 5D5WB 2DTZA 5FFXA 1RETA 3AAFA 1T0FC 5B66C 5E17F 3LA2A 1U5TB 2HFHA 4KT6A 4FT8A 1CF7A 5IYDJ 2VASA 4FHTA 1VQ8I 4AIKA 1KONA 5GPAA 1SVOA 1EH6A 1HKSA 1OR7C 3KP6A 4PSXA 3G1MA 3EYIA 1I3AA 2F48A 3FDYA 1MNEA 1FYLA 2M0CA 2K9NA 3BLYA 1ZKGA 2IGMA 5DEQA 4P9FA 3VYRB 5B1AH 3PUFA 3PJRA 4S05A 2FSWA 3L2QA 2CUFA 4QWQA 3CF5F 1WJFA 1W36C 3WTWC 2Z1DA 3FX3A 1VQLI 1WGXA 1DU6A 4BE1A 4LG0A 5E3OA 3KP4A 4AIJA 2CW7A 1IUFA 2QWWA 3VODA 4XBFA 3KPHA 3JAMZ 2DN0A 4ZTFA 4HRIA 3K4LA 3CCSI 3GTPJ 1X4PA 3HIFA 4DQ2A 2GOXB 3QOEA 2LKSA 1Z91A 4LMYA 2B7EA 2YX4A 3K4KA 1Z7UA 2XSJC 5E8IA 3LNQA 1U6GA 4AC0A 5E18F 1FLIA 1JKRC 1D0ZA 2ESNA 2LKPA 4MEXF 4J19A 4E4HA 2TCTA 3CCRI 4DYRA 3L2VA 2RAEA 1U9OA 1F4KA 1XSDA 5BNGA 1P4WA 2A05A 3CMAI 4M3GA 2K86A 1A04A 1G3TA 2M2EA 4XRMA 3KLOA 1B6AA 3BR6A 1F9NA 5KHDA 5HLGA 5DM6F 4GRIA 1K6OA 1IRXA 1C0WA 1X3UA 1WJCA 4A2UA 3CZ6A 2DQRA 1VQNI 4XLFA 2O7OA 3K10A 2WADA 4CZZA 3A0HC 4EMSA 2OZ6A 4RAZA 3KP5A 3B73A 4M6XA 1JGGA 1R1VA 4DBRA 2E1MC 1X2MA 1WJAA 1IUYA 3DBHB 3LFKA 4L9TA 3TL4X 1YX5A 3SXYA 2OCCH 3I4NJ 3L1PA 4ZDPA 1IXRC 3ZQCA 2Y9YA 3ABLH 1LDKB 2QUFA 5EF6A 2PI0A 1FOYA 1OYWA 4XRSG 3FMRA 1RC9A 5FLXK 2GWRA 3WTZA 2LKXA 4A3KJ 2Y9ZA 1BI0A 3WHCA 1P92A 4HV5A 4XKCA 3EYYA 2HKXA 4W97A 4IRGA 4GDFA 1YW8A 2KHMA 5IYCJ 3A03A 4M9ZA 4DYQA 1K4TA 3QU6A 1K79A 5LHGA 3DLLF 2OQRA 3F8NA 1HKTA 4WWCA 2HKOA 3C2GA 4PFPA 4A0YA 1O57A 1NHAA 1Y8QB 1BC8C 2MGQA 3D0SA 2R5YB 1G3WA 3BR3A 3CJNA 1S7EA 4CGZA 4R8HA 3FWEA 1EV7A 1R5HA 5H6QA 2E2JJ 4XQFA 1EKEA 3DEEA 4IVNA 2X48A 3HRUA 2VJ5A 3S2HJ 3VYUB 4U87A 2CUZA 2KQRA 1R9TJ 5LHHA 3CO6C 2R7WA 3KP7A 5GP9A 1MBHA 4C30A 2WV0A 3GBGA 4M3EA 2MA3A 3LQQA 1J09A 3BC8A 3VDXA 3ESWB 3S2DJ 3IV5A 3OSGA 4L0ZB 2OA4A 2MC4A 2QBYA 2EFQA 1XPXA 1JT0A 2QQ9A 5HVQC 5LFAA 1JKQC 4DIQA 3OYEA 2CV0A 2ID6A 3C2BA 3CMYA 2BE5F 1X4OA 1HLVA 1TW2A 3QYBA 2OUMA 4UUTA 1O7FA 4YFXF 4E7IA 3ZP5A 2P8TA 3F22A 4LIUA 3DEWA 1MH3A 2D45A 3PL8A 3Q5FA 1XDSA 3S2WA 2X1CA 1Y1VJ 3ZQLA 3VSLA 4JP0A 2LREA 3KYLA 1WFXA 3RTRA 3FXRA 2NRAC 3J7AO 3TW7A 2V1DA 1YFHA 2P6TA 1ZK8A 2FEZA 5FROA 2E5ZA 3ZQ7A 4BBRJ 3JRDA 2M8EA 3AG4H 1GVDA 1B4AA 3RI4A 4C3IJ 1QZEA 3G73A 3K69A 3L2CA 2VC1A 9ANTA 1WWXA 3HZJA 5E3LA 4HF0A 3BPVA 1VQOI 5LRSA 2Q2EA 3CC4I 2KISA 1WCMJ 3KFWX 2QA4I 3FK7A 1ACIA 3O3KA 4OAYA 2YU9J 4A12A 1T8IA 4CYCB 1MMDA 2K4JA 3E5XA 4IF4A 1AHDP 4LOCA 1N78A 2CSOA 2P81A 2X6YA 2NS7A 4WF2A 3HSRA 2I8DA 1MBGA 1MMNA 2VN2A 2OF7A 5LHIA 3JREA 2XAUA 1QBJA 3JRAA 3GFLA 3P7NA 5FJ8J 3BTLA 4GXOA 5J3LA 1YJNI 2XKPA 3MFKA 3EUKL 4IRIA 2TRTA 2LBFA 1Q1HA 3J80K 1GXQA 3OYCA 2A5WA 1QPMA 2R5ZB 2AHQA 3BG9A 4G8XA 2ZBKA 4KIFA 3KEYA 4IKFA 3FKJA 3OYAA 3GYHX 3PQKA 3X2QH 3FF5A 2PMUA 2BVMA 5IP7J 4B43A 3WE2A 2COMA 2RNGA 3S1QJ 2ZKZA 3DF8A 3DWLE 1K83J 2LDUA 1DP3A 3HBLA 3ZMUA 3VYTB 3RIRA 4A3EJ 4OIQF 2Q8KA 4ESBA 5H2FC 3NAUA 2P5KA 3CP2A 3M7GA 3JAMK 3I71A 5LD2C 3AG3H 2Z16A 5DCMB 1ZHFA 2VUMJ 3LL7A 3MZHA 3ML6A 3P9IA 2G7HA 2DT7B 3WE3A 4BJTA 1YHQI 1GV5A 1NK3P 2HOSA 2JA5J 4F7ZA 2DDAA 2P7VB 4MNUA 4E6KG 3ASOH 4LLLA 1ETOA 2VC0A 4D9JA 3TO7A 1ONVA 1VFCA 3EUAA 1IRZA 3BJOA 2KIMA 4AWXB 3OY9A 2IS2A 3CMEI 3NWTA 4II3A 2FQ4A 2MYSA 1MBFA 2B0LA 3FK6A 1BC7C 1E3HA 1ZLKA 1R22A 4NC8A 3FXLA 4ZDLA 2GQQA 4WX9A 1TC3C 2HR3A 5IPAA 3P9CA 1USSA 3ABMH 2A69F 4MQ9F 3WU2C 3G6EI 1APLC 2XF7A 3IH3A 4A0ZA 1B8IB 3BR0A 2VOPA 3BROA 4JQFA 2QQ8A 3ECHA 3K4NA 1ZYRF 1I3QJ 5M3MJ 4UUSA 3I4MJ 1PP8F 2GAUA 1O4XA 3BR1A 2HYJA 2WWYA 2EZHA 4R1HA 1I27A 3TDZC 5CKTA 5IP9J 1U3EM 1MBEA 2ISYA 4GFBA 3OL3A 4LB6B 4M3BA 1VQ6I 3WU1B 2NVUB 1ON2A 1G3YA 2B9SA 2JA6J 3H5RA 3QWLA 4QLCU 1FBUA 3JRBA 2PLYA 1FSHA 4RB3C 4ZYEA 3BG5A 2KRHA 3VSKA 1XCBA 4XK4A 3A1YA 3HYIA 1SFUA 2ETHA 5E1ZB 2FF4A 3TO9A 2QENA 1MGTA 1AKHA 3C7JA 5EG0B 2BBYA 3BG7A 4XOTA 1KQ8A 3SQNA 2JRTA 2QKLB 1IN7A 2XVCA 4DZJA 4IQ4A 3M3YJ 3QP5A 1Y39A 2ZMEA 2WAQN 4HF1A 2HDCA 4MFDA 3F6VA 2L7FP 3JTHA 3MVPA 1BIAA 1RR7A 3OS0A 2A3SA 3C3WA 1ETXA 3T0YA 1BJZA 5IOYA 4CHUA 4CSWA 2I5UA 5C44J 4X0GA 3M8JA 4MLOA 1JE8A 4G9YA 3K2AA 3DTIA 3IKTA 1OJLA 2JWTA 5GTIC 2COBA 3MWMA 4JOMA 1BBYA 4G7HF 5TRDA 5DUKA 4M3DA 1XGNA 5L3CA 3E6CC 4CXFA 1TT0A 2BV6A 5B3SH 5LBQA 2LY2A 1R71A 3F8FA 4LIVA 4H0EA 3CDHA 3OL4A 3W6KB 4A0XA 4WCGA 3OYJA 4G6DA 4CZCA 1MW7A 2DFEA 3OYNA 2R7UA 1MMAA 1QVUA 2OAZA 4QPOA 5DD4A 3HRMA 1R7JA 2DK8A 4I6ZA 2JSPA 4J00A 2VXDA 5BOXA 3S3MA 2NVTJ 3BDDA 4XKVA 2M30A 5JLXA 1IJWC 3CCYA 2IEKA 4J01A 3S3NA 3E6DA 2OTLI 4EGZA 3K70C 2V79A 4Y3OA 2L54A 3CDIA 4EEFG 2VJ4A 3R0AA 3GFMA 2GIVA 1BN5A 3B6CA 1GXPA 5J8FA 1X1AA 3LSPA 4QPQA 2IT0A 1BW6A 1OFCX 4Y4RA 3DPUA 3F9KA 1FIAA 2VXZA 4KMUX 4OU0A 3RKWA 2EINH 3I0TA 3ASNH 2CO5A 2PJRB 5IOZA 3HPGA 4XR6A 3QPSA 2DCEA 4HW0A 2V9VA 2DA3A 5EYRA 4UXNA 1ZH5A 2H6BA 3NRVA 1Z21A 2MD0A 1Z3YA 1P7IA 1FP2A 3O2PE 2VE9A 1Y56A 2X1EA 4FISA 2K9LA 5KCMA 1MJ9A 3IH4A 3BR2A 4LK1F 4C2MJ 1J75A 2NVXJ 1IAWA 5FRNA 3UNGC 2KJCA 4HV6A 5M5XJ 3A01A 3S93A 1UB9A 4PJMA 2ICWG 2G9WA 3MZYA 4FQGA 4XMYA 2EFOA 2EV5A 3LSTA 2W85A 3QAHA 1UAAA 4IXAA 4RGUA 3SEZA 2C6YA 1FYKA 5IT3A 4EJUA 1Z6RA 4X6AJ 1BA5A 4BQQA 2WY8Q 3E1SA 1S9HA 3IWFA 3J7AY 3TQNA 4D5FA 4KDPA 3IAS2 1PYVA 4IOAF 1YJWI 2F5FA 4ETSA 2J5PA 1H9TA 4B8XA 5HNFA 1K6YA 3CC2I 4I02A 4DGWB 1UHWA 2K7LA 1NTCA 1X19A 4EQQA 1DU0A 1U5TA 3WTSC 2DMNA 1SFXA 3U2RA 1JI8A 2QYOA 1R00A 3EUHA 3JW4A 3RPUD 4HLYA 4PZJA 2K9SA 3OV8A 2KIFA 3CC7I 1IN4A 1I5ZA 2JZYA 5D5XB 2KFDA 5LEKA 1P4AA 2G0EA 3TP0A 2EV0A 3E97A 4EM1A 2DYSH 2LNBA 4L0YB 1TNTA 4I7HA 2BY1A 4RS8A 2DXIA 2W84A 5E3NA 5EEAA 1X58A 2EH3A 2P0WA 2UXNA 2VJJA 4AYBN 1ZREA 2JQ7A 3ZPLA 1WJEA 5F1RA 4HA8A 2HYGD 1Y0NA 2F4IA 2IVMA 1WKMA 2KRCA 1MDMB 3WGIA 3H0DA 2WAQA 3TOBA 2XGEA 2W48A 1X1CA 1JUMA 4E7JA 2CUEA 2RGVA 3M1EA 3ZQIA 4RDUA 3BG3A 3G71I 2GA2A 4A3FJ 4JK1X 4DYCA 4A3BJ 2EBIA 4Y15A 2ZFWA 2BXYA 4PJLA 3VEPA 1A31A 2R93J 1N75A 1ERDA 3DXJF 1FOXA 1DPRA 3GO5A 3LSHA 2CQXA 4IOCF 2L7KA 3K4JA 3C1DA 3FHZA 3QQAA 2ZJRF 3DBRB 4AD9A 1YE9A 2WA0A 2XHKA 2YX7A 4A3CJ 3U9GA 2VBYA 5B5EC 2IA2A 1WSUA 1W5SA 4Q4ZF 2AXLA 2EWNA 2HTSA 2EJRA 2E1MB 3GXOA 1F36A 4M73A 2CJJA 4AU7A 3KIOA 4BXXJ 3FXMA 1BJAA 3HOZJ 2ZXHA 2IGNA 4FTHA 2JT1A 4LG3A 2BEOA 1Z7LA 2VQCA 4UV8A 1I39A 3D5SC 4BY1J 2B63J 2JA7J 3GTQJ 1UELB 5C4JJ 2HZTA 4CICA 2ECBA 3I4PA 2V26A 3IH2A 3F6OA 2VODA 2ZNZA 3C18A 5ILUA 1BL0A 4CCJA 1TQIA 4HX8A 4F92B 2RREA 2YPRA 4XICA 2QM3A 4XNFA 3V8JA 3VYSB 3K6GA 5EJCA 5A2QZ 2JPBA 1DP7P 5D8LB 4D5CA 3WTVC 3QP6A 3ABKH 4A93J 1TWGJ 5LRRA 5KVRA 2LR8A 5F6FA 1ZG1A 2V1UA 3CUQB 1B59A 3LA3A 2E34A 2JRMA 2P5VA 2FE3A 1IC8A 1WHUA 3DTEA 2R5YA 3PIOF 4E70A 4D1QA 3W6JB 2QCOA 4B1RA 4C2UA 1PUEE 1JHHA 4A5NA 4BGDA 4F55A 3OIQA 1T98A 3Q3SA 4KYWA 2ZSHB 1KU7A 2EZKA 3F8CA 2OJED 3SYTA 1XB4A 1PDNC 2PQ8A 3HHGA 1T08B 4GYGA 3ECOA 1T6SA 4RB0A 1VTNC 4JX5A 3I54A 1HOMA 4FCYA 3AL0B 2LRDA 4F52A 1S3JA 3RQ4A 5E20A 3J7ZI 4L9JA 3OSFA 2HVQA 4IPAA 1FEXA 2BXZA 2A6HF 5TGTA 2R7VA 2BYVE 2RVCA 1OCOH 3QYFA 2ZCWA 4LK0F 4MIMA 2XDVA 2JVHA 3M4OJ 3FXJA 5F04A 3GTLJ 3WGGA 3DFGA 1VQKI 1WH7A 2JUGA 4RAFA 4KN7X 4M9XA 1K4SA 1WI3A 4P5OA 2EB7A 2L4AA 1LQ1A 1HSTA 3BTIA 1ZLJA 1LVAA 1ZELA 3TMOA 3D5LA 1LNWA 3TDUC 3I56I 1G3SA 3L7WA 5J1RA 3W2VA 2LMDA 2CWEA 3K2ZA 2ME6A 3BCAA 4EVIA 2EQRA 4B3AA 1EH7A 4Q48A 3CCVI 2Q0OA 1H88C 2HDWA 1MMSA 5K5OA 4AYBA 2ZC2A 1UFMA 5CVIA 4NB5A 1D5VA 2RDPA 2ZSIB 4BHPA 4U7BA 1ZGJA 3PNTA 1HA8A 3OYGA 5JFRA 2HU9A 4A3LJ 5L3DA 1HW2A 4E7KA 4LGWA 2O3FA 1FTZA 1P6RA 1W4MA 2L02A 2DW4A 1K78B 1LDJA 2DFIA 3PFYA 2FU4A 2CV1A 2BY3A 2KL4A 1U9NA 4UUVA 1CQTA 3AFHA 2V1NA 2UUZA 1FP1D 3A0BC 3FXUA 1FZPB 2H94A 3LSGA 2ADUA 2W24A 2JTVA 4E7SA 2KJBA 4BH9A 5BPIA 2JVGA 1OPCA 2CS3A 3V8LA 3WHBA 1R5ID 2LLKA 5F1JA 1QQIA 2BZTA 1MBJA 3H3UA 5M5YJ 2QVOA 2IA0A 2DA7A 2HOTA 1WRJA 3MKLA 1KQ0A 4EM2A 2NNNA 4QTRA 2PEXA 3DU6A 1H89C 2R5ZA 2DMPA 2DJIA 3CLOA 2KIQA 1KZHA 3ULQB 3U21A 2A6EF 4XIDA 2CH0A 2I10A 4U7DA 2E35A 3HC7A 5HLIA 1IN6A 2F5DA 4S04A 1LE8B 5HDKA 3CLQA 4KICA 4Y52J 2DFHA 3GUDA 3ZR8X 3RZOJ 5FGMA 1VQ7I 1K61A 1YTYA 1QZZA 5DCMA 1HQCA 2FNAA 1D1AA 4PJ0C 3REOA 5E3MA 5HS8A 3M8EA 2VT3A 5DM7F 5K7ZA 3GX4X 4I2OA 1V5EA 3HHHA 3IL2A 5F0HA 4RLFA 3KE2A 1KU9A 1B72B 3DP7A 3H5NA 5E1XA 3FKIJ 5IYBJ 2M0MA 1W0TA 3K4CA 2HQ5A 2M34A 3TP3A 3BZCA 2VB6A 1U5TC 1TT5B 3HXLA 4DW6A 4OMYA 2P5LC 2ID3A 2VQGA 3WU0A 3EUHC 2M7AA 2EA4A 3GZ5A 2ISZA 2R7OA 2MG4A 3HSFA 3KZIC 2XROA 1DGRM 2BW3B 5JVTA 4F3QA 2CV2A 1M1EB 1X2NA 2O5RA 2D1VA 4MQVA 2GLOA 1QO0D 2JA8J 2ZJPF 1SFKA 2GBYA 3MKZA 5HLHA 2EZIA 1B8IA 3R4KA 2A61A 3AKZA 2HZDA 1Z6TA 1IW7F 2GXAA 2M1BA 3S1MJ 1UG2A 1VQMI 1OCZH 2X51A 3ZQGA 2CFXA 1TTYA 2M87A 2WTEA 1TWCJ 1A6QA 3HTUA 2KDOA 4RGSA 2FOKA 1SFOJ 4YELA 1I1GA 1UHMA 2FRHA 1OCRH 1G2HA 2R7QA 4NQWB 4NHJA 5LEJA 2DAOA 1S7AA 2EFPA 1HKQA 3L00A 3QOPA 1B1BA 4II2A 4UB8C 3B6AA 5FKKA 1FY7A 3FXQA 2E36A 5EG0A 4FX0A 1SD7A 5DCFA 2H09A 4ON0A 4BY7J 3SZPA 2DMTA 4ESJA 3FMQA 4IHYA 2BHZA 2XIGA 2XPUA 4DBQA 2DLLA 2KZGA 3CCLI 2H1KA 2XAJA 2WB1A 1ZAOA 2NS8A 1D0YA 4O6JA 1XGSA 2R4GA 2RQQA 2GIZA 3HL2A 4A3MJ 2FQ3A 1RI7A 2XF5A 3LMMA 2M4KA 5CLSA 1TZLA 4ZYAA 5HDGA 5LGUA 4XSXF 1I1SA 4NNJA 1XN7A 1W0UA 3OR2C 3MCZA 1ZRFA 3I53A 2KLOA 2HOEA 1JJ6C 1YX3A 3SZTA 4EJWA 1QA6A 4R79A 5J40A 4C2TA 2J5OA 1W1WE 4BQNA 1R58A 3GFIA 2LC2A 5B1BH 1LFBA 3RJPA 4P1WA 5K7HA 3ERMA 4BEHB 2A5YB 4UB6C 4XM3A 1MJAA 4BBSJ 3PNVA 2L9VA 2NAZA 3K1PA 4QIWN 3L2UA 4JBAA 2XGXA 2JUCA 3LFUA 2Y75A 3KETA 5IT9Z 1JXSA 3TO6A 3HUGB 1YRNB 2HI3A 2HDDA 3F3XA 4KUMA 3PO3J 3DU5A 4A3GJ 3AG1H 2D2WA 4PCQA 5BQTA 2QSGX 4L18B 2DT5A 2HGCA 1RESA 1V55H 3V7CA 2Z9OA 4M9SA 2AS5F 4I98B 2BY0A 5FD5A 2ZFUA 1KU3A 3DKWA 3K9TA 3HOWJ 1OKRA 3DPTA 3W2WA 3BQYA 1PJRA 1F43A 2Z2SB 1JJ8C 2FBKA 2LY9A 3N05A 2A68F 1OYIA 1H9GA 2XV4S 3DTKA 2PJRA 2O8KA 2XGCA 5J8CA 3HG9A 1VNDA 2O9LA 2DPUA 3GF2A 3KX2A 3LAJA 4OWRB 5FKOA 3RSNA 4EJTA 2E60A 2WBMA 2R7FA 1BIBA 2KKOA 4MO7A 2RNJA 2YS9A 1RUNA 2IXSA 4D7MA 3COAC 1BI1A 4Y13A 4KT5C 4Y33A 1FIPA 3PM1A 4M6VA 4LD5A 2LOOA 2DODA 1EF4A 2XUBA 3RPUA 2R7ZJ 4OMZA 4DJAA 1EA3A 4G12A 1FNNA 3T8RA 1RZ4A 2V9KA 4BYYA 3VPRA 3PQJA 1T0FA 5DUIA 2QQBA 3HEFA 3TOAA 2XF6A 1TWHJ 2DK5A 3RPQA 1XMKA 3HGYA 1RR8C 4U0YA 2E2IJ 2CUJA 2XAFA 3HJEA 4L5IA 3JSPA 5CQGA 1Z77A 4I0AA 1MMGA 3LAPA 2XPVA 4B44A 4UNOA 1LB2A 1ORKA 3PO2J 2VT2A 3E6BA 2DMQA 3ZMTA 2KIUA 1RKTA 2VQLA 1T2KA 1DQUA 3ZMVA 2STWA 1SVMA 4PJNA 1MJBA 1XTAA 5HS7A 4M71A 1IN5A 5GPCA 4FE7A 3L09A 1DGWY 3TBIA 2L0KA 2DDBA 4I09A 1WJ5A 5L3EA 1B9NA 1R1UA 3NQOA 2X6OA 4XLPF 2EV6A 1GDTA 3S3OA 4HBLA 4ESFA 2VBWA 4XLAA 2L9RA 1Y6IA 1ZQ3P 5L3FA 5CPRB 3HRTA 1RNLA 2K4BA 1WVRA 5EGOB 3CCUI 3QRFF 5FB2A 4ZTJA 1YS6A 3B02A 1NG6A 3G1LA 1VQ9I 2DU9A 1MDMA 2F2EA 2W4SA 3UKGA 4OOIA 3BCBA 5CVUA 4HOBA 4YEJA 3GTKJ 5DD8A 1XD7A 3OYFA 3BP8A 3WTXC 5M5WJ 3GTJJ 3H3VK 3FHNA 1R4MB 3IP4B 4BKXA 5E1WA 3LWFA 3SHFA 6PAXA 4E7ZA 2LP0A 1ITYA 1P4XA 2OZUA 4RMNA 4HZFA 1X3ZB 4CCMA 2Y0SA 1TL8A 1XX5A 2FOWA 1CGPA 2K3PA 3JRIA 4PFOA 3I59B 3ZQHA 1BI2A 3IHUA 1ENHA 1MZBA 3P5JA 4CH7A 5HOOA 4IJAA 5HLTA 2WC2A 3CCJI 2X1DA 2MABA 2IS1A 1YYVA 4CYDA 3FMSA 1QRYA 2E2HJ 2CMPA 5LGNA 4ABZA 3OS1A 1N25A 2NS0A 2UXXA 2KZVA 2DA2A 3IRRA 3F23A 1ZG5A 4XORA 3FXKA 4XL9A 2P6SA 3ERED 2CRGA 1G6NA 1IGNA 2LY1A 2RC4A 4IHSA 3GTOJ 1HSJA 1FBSA 3GWZA 4BQAA 2QSHX 3H36A 3W3CA 1A35A 2ELJA 5ICEA 4ASNA 1LEBA 3EDPA 1W7PB 4C3JJ 4KFCA 4GGGA 2OBPA 3ROUA 2MLKA 4PGHA 4D7NA 2DBBA 2N8GA 2HPMA 1XSXA 2HYFA 2LK2A 1RRJA 2H1LA 2NOJB 1ZR4A 3A2KA 3JCUC 2STTA 1STZA 4XRSA 4ZH4F 1WZ2A 4L9VA 4OINF 1UMQA 5ICFA 3CF2A 3LSIA 3CUQA 3BY6A 1W7PD 3NARA 2W00A 3HOYJ 4ENMA 1S8NA 1FT9A 2K85A 1JTXA 1F5TA 4HX4A 1YW9A 2LF7A 3CJQB 2LFBA 3ZCOA 1AWCA 1LPQA 1G8XA 4B48A 1IXSB 1ULYA 1SAXA 2NVQJ 1NK2P 2FBIA 2CW8A 1T39A 2VLAA 2GM4A 1V3FA 5EZGA 2Z33A 3CCEI 4YIFA 3CCQI 2EPFA 5FLMJ 4KMFA 3R0JA 4UVAA 1XDUA 1GVJA 4CCOA 3BR5A 4JX6A 4HNVA 3WTTC 4A5MA 2JMWA 5D6FA 5DV5A 2PBIA 4A3IJ 1O3SA 2HQAA 2H27A 4C3HJ 1Y8RB 3GCMA 2ECCA 2BY2A 4BS9A 2NVYJ 4KIBA 2EIJH 2W82A 2Y2ZA 2L9NA 1TWFJ 1WQ2A 3IKVA 1W36D 4BU2A 3O8HA 2TDXA 2DYRH 4P9UA 3Q0VA 4PDKA 3LQRA 2YU3A 4XOPA 4G7ZF 4IHTA 1FMVA 5ICGA 4UY8I 1QU3A 3OMYA 2K3FA 3V4GA 1D1CA 2GOMA 3HGGA 3ZQFA 1S29A 3J81Z 2ELKA 1S7OA 1IXCA 2V7FA
chains in the Genus database with same CATH topology
2IPQX 3E6MA 4ENNA 3L9FA 2Z3YA 5JI6A 1HW1A 3H3ZA 2CQKA 4LFUA 3Q9VA 4A6EA 5H6RA 1K78A 1FBQA 3ZMZA 4HDUA 1QGPA 2IP2A 2Y48A 4B09A 1XSVA 1HBXG 2MC3A 2IA1A 4XSZF 1RUOA 2RN7A 3EETA 1FYMA 1R36A 3CTAA 1Y0UA 3KCCA 1F1ZA 3VFZA 1D8KA 1FC3A 3MQ0A 2A07F 2O03A 4HQMA 1LDDA 4UVBA 3HTSB 3WG9A 4U88A 5K5RA 1BM9A 5DYMA 2ZXJA 3WTUC 3EQLF 4AIHA 4N0BA 2PN6A 3GW2A 1USTA 2X4HA 2P4WA 3WGHA 5CVJA 3JSOA 1K7AA 3IRQA 4UHTA 4EJOA 3F21A 4L9NA 3HSEA 5CYVA 1XGOA 3J80Z 3RKYA 1TBXA 3ZN1A 1YS7A 3IWZA 3MAJA 3BWGA 4TV7A 1FX7A 2QZ8A 3KZYA 1D8JA 4D0PA 4L5JA 4ZYDA 4RGRA 5BMZA 2GXGA 2KRFA 4RGXA 4KIGA 5FD6A 4OIOF 1B9MA 1SD4A 4K2EA 3DQVC 2DQLA 1J5YA 3KP3A 4G94A 4HX7A 1J9IA 4NQWA 4CDGA 3IC7A 3ABUA 1WI9A 2G7UA 2GXBA 4ZYGA 4HF2A 2NYXA 2Y0MA 2OU2A 1Z1DA 3Q9SA 1H0MA 1OMIA 3OOPA 5D8KB 1KGSA 4PGGA 3QPTA 5D6EA 1XGMA 3ZMSA 5HDNA 3PFIA 1IN8A 1TQPA 3F8MA 3E5UA 3RKXA 2ZNYA 1ZGAA 2L4MA 2F5CA 4BXUA 2OD5A 3ZN0A 5ERIA 3HOSA 3VB2A 2HWVA 1J0RA 1O7LA 1G4DA 3E3VA 4MTEA 3V7RA 3BZ6A 3RYPA 4LLGF 5TJJA 5JHUA 2DI3A 1MD0A 1XCVA 3HUGA 4OIPF 5K1YA 2W25A 3F72A 3HOTA 3CUQC 3TGNA 3SFZA 1CF7B 2EFNA 2O6GE 2M45A 3BJAA 5ILSA 2Z5UA 1RIOH 3J81K 4BNCA 3MEXA 3K0LA 4I01A 5FFZA 1TNSA 4GO1A 2ACJA 4Q5SF 3LA7A 2EK5A 2JSCA 4WXHA 4MTDA 1SMTA 2VE8A 4LG0B 3JTGA 4WXDA 1ON1A 3R60A 2EA2A 2MH9A 2BGCA 3BJ6A 3TKYA 4KA4A 1DPUA 4RAYA 3FM5A 5CJ9A 2HS5A 3DV8A 3CUOA 3FZVA 4RB2C 5A2QK 1V4RA 1DDNA 3N4MA 1Z05A 1ODDA 1GHCA 5K5QA 5HS9A 5KK1A 3H92A 4HLXA 1FOKA 2CG4A 4RB1A 1REPC 2QQAA 4BHCA 2FXAA 3V8KA 5LGTA 3RYRA 2GA1A 2O61A 4YIIA 2FA5A 4UV9A 3G3ZA 2ELHA 4GYIA 1TW3A 5AIQA 2L3DA 2PJPA 1FSEA 2VONA 1YIOA 3DPLC 2H6CA 4N9HA 2Z99A 3WODF 5FO5A 1SD5A 3I59A 4HYEA 1KYZA 3K1MA 3GFJA 4U0VA 5ICCA 1JGSA 2MD5A 1YW7A 5EEHA 2L01A 3GLXA 1KA8A 1YG2A 1W7PA 1YQAA 2QBYB 1TQMA 5J6XA 1YO5C 2XRNA 4M6YA 5D4SA 1ZN2A 3E5QA 1TLHB 1O3QA 4EM0B 1R5GA 4P96A 4KNYA 3WTYC 2NNYA 1ZG3A 5BS6A 4LJZF 2E1CA 1J7KA 2PMHA 4U0WA 1QZYA 4BHBA 1OR7A 2P7CB 1P2FA 3FM3A 2CYYA 2DTRA 1J2XA 1JHFA 4EV0A 3T1BA 2QLZA 2R3SA 3CO7C 2OQGA 4N9IA 1R23A 1Z9CA 5DDGA 1KU2A 4IRHA 2DPDA 4YG2F 1KQ9A 1DUXC 5D5UB 2O0YA 3ZMDA 4HAMA 5E8GA 4CO8A 2E7WA 2LF8A 2FNPA 2D1HA 2XAHA 2X0LA 2E1NA 1AOYA 1IRFA 2VBXA 4XRFA 1L3LA 1UCRA 2E7XA 2O8XA 2UZKA 5ILVA 3I5UA 2HTJA 1E17A 3RDIA 3QU3A 1ZARA 3ELKA 1J59A 2R7DA 1KYWA 3ABTA 4EGYA 4P55A 4KN4X 2GZWA 1IRGA 1U2WA 3M8FA 5AONA 4O5VA 5L3BA 4A6DA 5D4RA 3P9KA 2K02A 3DEUA 2RQPA 1E2XA 4MEYF 1ZRCA 2MH2A 3BOQA 1W5TA 1HW5A 3R6SA 1SMYF 4YFNF 2UWMA 3GVAA 4OIRF 3QPHA 4I0BA 2V1XA 4ZZDA 3I58A 4Y17A 5LLQA 2XKOA 1BOAA 2HEOA 3T5XA 4YFKF 1SFEA 4ENKA 1R1TA 2XASA 2MLGA 2HQNA 4ZZLA 1PP7U 3GEZA 5L3GA 5AIPA 2FMLA 2M5WA 2LSOA 2F5EA 1FPQA 4WK8F 5CVVA 3R61A 4ENJA 1QNTA 2VOOA 1ZRDA 3K1NA 4EJVA 2PFBA 3KZZA 1IZ1A 3KLNA 2RKHA 5FLXZ 2RV8A 1IF1A 1I6XA 1OYYA 5IT9K 4AVPA 1O3RA 2ZMEB 2FMYA 2IW5A 1LJ9A 2ESHA 2ZJ2A 1T38A 1U8RA 3GZ6A 2XAGA 3F8BA 2PG4A 3KP2A 5EEGA 4O3MA 4DNCA 3I64A 3ISPA 3U1DA 5H20A 5BPDA 3VOEA 3NEUA 4M74A 4XLNF 4G6QA 3M9AA 3KEQA 1SD6A 2JPCA 3V7SA 5ED4A 1L0OC 4HQEA 2IRFG 2ZO4A 1S6LA 1FWZA 4FX4A 2YR2A 1BI3A 2FBHA 1XMAA 2IJLA 1LEAA 4BAYA 2EFWA 2K27A 4HDVA 4Q47A 4LB5A 1D3YA 2VBZA 1YLFA 2HQRA 3N97A 4M72A 3KEOA 3HRSA 4ZYHA 5D5VB 2V6CA 4WXCA 2CGPA 4G7OF 5CVRA 4MHGA 2CW0F 4UVCA 3O6BB 1O3TA 4Z2YA 3BPXA 2W57A 4MGRA 2DO7A 2XAQA 1U78A 1HXDA 1EH8A 5JR3A 4LLNA 5F64A 4GCVA 2YSRA 2MBFA 3T8TA 1MKMA 5D5WB 5FFXA 3AAFA 5E17F 3LA2A 1U5TB 2HFHA 4FT8A 1CF7A 4FHTA 4AIKA 1EH6A 1HKSA 3KP6A 3EYIA 1FYLA 5DEQA 4P9FA 4S05A 2FSWA 4QWQA 3WTWC 3FX3A 4LG0A 3KP4A 4AIJA 2QWWA 3VODA 4XBFA 3JAMZ 3HIFA 4DQ2A 1Z91A 4LMYA 2YX4A 1Z7UA 5E8IA 1U6GA 5E18F 1FLIA 2ESNA 2LKPA 4MEXF 1F4KA 1XSDA 1P4WA 2K86A 1A04A 1G3TA 3KLOA 1B6AA 1F9NA 5HLGA 1K6OA 1C0WA 1X3UA 4A2UA 2DQRA 4CZZA 4EMSA 2OZ6A 4RAZA 3KP5A 3B73A 4M6XA 1R1VA 1IUYA 3LFKA 4L9TA 3SXYA 1IXRC 1LDKB 2QUFA 2PI0A 1OYWA 3FMRA 5FLXK 2GWRA 3WTZA 1BI0A 1P92A 4HV5A 3EYYA 2HKXA 4IRGA 1YW8A 4M9ZA 3QU6A 1K79A 5LHGA 2OQRA 3F8NA 1HKTA 4WWCA 2HKOA 4A0YA 1O57A 1NHAA 1BC8C 3D0SA 1G3WA 3CJNA 4CGZA 4R8HA 3FWEA 1EV7A 1R5HA 5H6QA 4IVNA 3HRUA 5LHHA 3CO6C 3KP7A 2WV0A 2MA3A 3LQQA 4L0ZB 2OA4A 2QBYA 2EFQA 2QQ9A 5HVQC 2BE5F 1TW2A 1O7FA 4YFXF 3ZP5A 2P8TA 3F22A 2D45A 3Q5FA 1XDSA 3S2WA 3RTRA 3FXRA 2NRAC 3J7AO 2V1DA 1YFHA 2P6TA 2FEZA 3ZQ7A 2M8EA 1B4AA 3RI4A 3G73A 3K69A 3L2CA 2VC1A 1WWXA 4HF0A 3BPVA 5LRSA 2Q2EA 3KFWX 3O3KA 4A12A 2K4JA 3E5XA 4IF4A 2CSOA 4WF2A 3HSRA 2VN2A 5LHIA 1QBJA 3GFLA 3P7NA 4GXOA 2XKPA 3MFKA 4IRIA 1Q1HA 3J80K 1GXQA 1QPMA 4G8XA 4KIFA 2ZBKA 3GYHX 3PQKA 3FF5A 2PMUA 3WE2A 2COMA 2ZKZA 3DF8A 2LDUA 3ZMUA 3RIRA 4OIQF 2Q8KA 4ESBA 2P5KA 3M7GA 3JAMK 3I71A 5DCMB 1ZHFA 3MZHA 3ML6A 3P9IA 2G7HA 3WE3A 4F7ZA 2P7VB 4MNUA 4LLLA 2VC0A 3TO7A 1ONVA 3BJOA 2KIMA 4AWXB 2B0LA 1BC7C 1ZLKA 1R22A 2GQQA 4WX9A 2HR3A 3P9CA 1USSA 4MQ9F 2A69F 4A0ZA 2VOPA 3BROA 4JQFA 3ECHA 1ZYRF 1PP8F 2GAUA 2WWYA 4R1HA 1I27A 3TDZC 1U3EM 2ISYA 4LB6B 3WU1B 1ON2A 1G3YA 2PLYA 4QLCU 1FBUA 1FSHA 4RB3C 4ZYEA 1XCBA 1SFUA 3HYIA 2ETHA 5E1ZB 2FF4A 3TO9A 2QENA 1MGTA 3C7JA 2BBYA 1KQ8A 3SQNA 2JRTA 1IN7A 2XVCA 3QP5A 2ZMEA 4HF1A 2HDCA 3F6VA 3JTHA 1BIAA 2A3SA 3C3WA 3T0YA 4CHUA 1JE8A 4G9YA 3IKTA 3MWMA 1BBYA 5TRDA 4G7HF 5DUKA 1XGNA 5L3CA 3E6CC 4CXFA 2BV6A 5LBQA 3F8FA 4H0EA 3CDHA 3W6KB 4A0XA 4WCGA 4G6DA 2OAZA 5DD4A 3HRMA 1R7JA 2DK8A 5BOXA 3BDDA 2M30A 3E6DA 4EGZA 2V79A 2L54A 3R0AA 3GFMA 2GIVA 1BN5A 1GXPA 5J8FA 2IT0A 3RKWA 4KMUX 2VXZA 4OU0A 3I0TA 2CO5A 4HW0A 2V9VA 4UXNA 1ZH5A 2H6BA 3NRVA 1FP2A 3O2PE 2VE9A 1MJ9A 4LK1F 1J75A 1IAWA 2KJCA 4HV6A 1UB9A 2G9WA 3MZYA 2EFOA 2EV5A 3LSTA 2W85A 3QAHA 4IXAA 4RGUA 2C6YA 1FYKA 5IT3A 4EJUA 1Z6RA 3IWFA 3TQNA 4KDPA 2F5FA 4ETSA 2J5PA 1H9TA 4B8XA 4I02A 1UHWA 2K7LA 4EQQA 1U5TA 3WTSC 1SFXA 3U2RA 2QYOA 1R00A 3EUHA 3JW4A 4HLYA 4PZJA 3OV8A 2KIFA 1IN4A 1I5ZA 2JZYA 5D5XB 5LEKA 1P4AA 2EV0A 3E97A 4EM1A 2LNBA 4L0YB 1TNTA 4I7HA 4RS8A 2W84A 2UXNA 1ZREA 3ZPLA 5F1RA 4HA8A 2HYGD 2IVMA 1WKMA 1MDMB 3WGIA 3TOBA 2RGVA 3M1EA 2GA2A 4JK1X 4Y15A 2ZFWA 3VEPA 3DXJF 1DPRA 3GO5A 3FHZA 3C1DA 4AD9A 2XHKA 2YX7A 3U9GA 2VBYA 2IA2A 1WSUA 1W5SA 4Q4ZF 2AXLA 2EWNA 2HTSA 2EJRA 3GXOA 4M73A 1BJAA 2JT1A 2BEOA 4UV8A 2HZTA 4CICA 3I4PA 3F6OA 2VODA 2ZNZA 3C18A 5ILUA 1TQIA 4HX8A 2YPRA 2QM3A 3V8JA 5A2QZ 2JPBA 1DP7P 5D8LB 3WTVC 3QP6A 5LRRA 5KVRA 1ZG1A 5F6FA 2V1UA 3CUQB 1B59A 3LA3A 2P5VA 2FE3A 4E70A 3W6JB 1PUEE 1JHHA 4A5NA 1T98A 4KYWA 1KU7A 3F8CA 1XB4A 1PDNC 2PQ8A 3HHGA 4GYGA 4RB0A 3ECOA 1T6SA 1VTNC 3I54A 1S3JA 5E20A 4L9JA 4IPAA 2A6HF 2BYVE 2RVCA 2ZCWA 4LK0F 3WGGA 3DFGA 4KN7X 4M9XA 4P5OA 2EB7A 2L4AA 1LQ1A 1HSTA 1ZLJA 1LVAA 3D5LA 1LNWA 3TDUC 1G3SA 3L7WA 2CWEA 3K2ZA 4EVIA 1EH7A 4Q48A 2Q0OA 5K5OA 1UFMA 5CVIA 4NB5A 1D5VA 2RDPA 4BHPA 4U7BA 1ZGJA 5JFRA 5L3DA 1HW2A 4LGWA 2O3FA 1P6RA 1W4MA 2L02A 2DW4A 1K78B 1LDJA 2DFIA 2FU4A 4UUVA 1FP1D 3FXUA 1FZPB 2H94A 2ADUA 2W24A 2JTVA 2KJBA 4BH9A 5BPIA 1OPCA 3V8LA 1QQIA 3H3UA 2QVOA 2IA0A 1WRJA 1KQ0A 4EM2A 2NNNA 2PEXA 3CLOA 3ULQB 2A6EF 4U7DA 5HLIA 1IN6A 2F5DA 4S04A 5HDKA 4KICA 3GUDA 5FGMA 1YTYA 1QZZA 5DCMA 1HQCA 2FNAA 3REOA 5HS8A 3M8EA 2VT3A 3GX4X 4I2OA 3HHHA 3IL2A 3KE2A 1KU9A 3DP7A 5E1XA 1U5TC 4OMYA 2P5LC 3WU0A 2ISZA 2EA4A 3GZ5A 3HSFA 2XROA 5JVTA 2D1VA 4MQVA 1QO0D 5HLHA 3R4KA 2A61A 1Z6TA 1IW7F 2M1BA 2CFXA 1TTYA 2M87A 2WTEA 3HTUA 4RGSA 2FOKA 1I1GA 1UHMA 2FRHA 4NHJA 5LEJA 2DAOA 1S7AA 2EFPA 1HKQA 3L00A 3QOPA 1B1BA 1FY7A 3FXQA 4FX0A 1SD7A 5DCFA 2H09A 4ON0A 3SZPA 4ESJA 3FMQA 2XIGA 2DLLA 2XAJA 1ZAOA 4O6JA 1XGSA 2FQ3A 1RI7A 5CLSA 5LGUA 5HDGA 4XSXF 1I1SA 1XN7A 3MCZA 1ZRFA 3I53A 2HOEA 3SZTA 4EJWA 4R79A 2J5OA 3GFIA 1R58A 3RJPA 2A5YB 1MJAA 2NAZA 3K1PA 4JBAA 2XGXA 1JXSA 3KETA 2Y75A 5IT9Z 3TO6A 3F3XA 4KUMA 2D2WA 4PCQA 5BQTA 4L18B 2DT5A 2HGCA 3V7CA 2Z9OA 4M9SA 2AS5F 4I98B 5FD5A 1KU3A 3DKWA 3K9TA 1OKRA 3DPTA 2FBKA 2A68F 1OYIA 1H9GA 2XV4S 5J8CA 2DPUA 3GF2A 3LAJA 4EJTA 2R7FA 1BIBA 2KKOA 2RNJA 1RUNA 3COAC 4Y13A 1BI1A 4KT5C 4LD5A 2XUBA 3RPUA 4OMZA 3T8RA 1FNNA 1RZ4A 4BYYA 3PQJA 1T0FA 5DUIA 2QQBA 3TOAA 2DK5A 3RPQA 1XMKA 4U0YA 2XAFA 4L5IA 3JSPA 4I0AA 3LAPA 4UNOA 1LB2A 2VT2A 3E6BA 3ZMTA 2KIUA 1T2KA 3ZMVA 2STWA 1MJBA 5HS7A 4M71A 1IN5A 3L09A 4I09A 5L3EA 1B9NA 1R1UA 3NQOA 4XLPF 2EV6A 4HBLA 4ESFA 2VBWA 5L3FA 3HRTA 1RNLA 2K4BA 3QRFF 5FB2A 1YS6A 3B02A 2DU9A 1MDMA 2F2EA 4OOIA 5CVUA 4HOBA 5DD8A 1XD7A 3BP8A 3WTXC 5E1WA 3LWFA 3SHFA 6PAXA 1P4XA 2OZUA 4HZFA 1CGPA 3I59B 1BI2A 3IHUA 1MZBA 5HOOA 4IJAA 2WC2A 1YYVA 4CYDA 3FMSA 5LGNA 3F23A 2NS0A 2UXXA 1ZG5A 3IRRA 2P6SA 3ERED 1G6NA 2RC4A 4IHSA 1HSJA 1FBSA 3GWZA 4BQAA 5ICEA 4ASNA 1LEBA 3EDPA 1W7PB 4KFCA 4GGGA 2OBPA 3ROUA 2MLKA 4PGHA 2DBBA 1XSXA 2HYFA 2STTA 1STZA 4ZH4F 4L9VA 4OINF 5ICFA 3CUQA 3BY6A 1W7PD 4ENMA 1S8NA 1FT9A 1F5TA 4HX4A 1YW9A 2LF7A 1AWCA 1IXSB 1ULYA 1SAXA 2FBIA 1T39A 1V3FA 2Z33A 4YIFA 4KMFA 3R0JA 4UVAA 1XDUA 1GVJA 3WTTC 4A5MA 5D6FA 5DV5A 2PBIA 1O3SA 2H27A 4KIBA 1WQ2A 3IKVA 2TDXA 4P9UA 4PDKA 3LQRA 2YU3A 4G7ZF 4IHTA 5ICGA 3V4GA 1S29A 3J81Z 1S7OA 1IXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPQ X;  3E6M A;  4ENN A;  3L9F A;  2Z3Y A;  5JI6 A;  1HW1 A;  3H3Z A;  2CQK A;  4LFU A;  3Q9V A;  4A6E A;  5H6R A;  1K78 A;  1FBQ A;  3ZMZ A;  4HDU A;  1QGP A;  2IP2 A;  2Y48 A;  4B09 A;  1XSV A;  1HBX G;  2MC3 A;  2IA1 A;  4XSZ F;  1RUO A;  2RN7 A;  3EET A;  1FYM A;  1R36 A;  3CTA A;  1Y0U A;  3KCC A;  1F1Z A;  3VFZ A;  1D8K A;  1FC3 A;  3MQ0 A;  2A07 F;  2O03 A;  4HQM A;  1LDD A;  4UVB A;  3HTS B;  3WG9 A;  4U88 A;  5K5R A;  1BM9 A;  5DYM A;  2ZXJ A;  3WTU C;  3EQL F;  4AIH A;  4N0B A;  2PN6 A;  3GW2 A;  1UST A;  2X4H A;  2P4W A;  3WGH A;  5CVJ A;  3JSO A;  1K7A A;  3IRQ A;  4UHT A;  4EJO A;  3F21 A;  4L9N A;  3HSE A;  5CYV A;  1XGO A;  3J80 Z;  3RKY A;  1TBX A;  3ZN1 A;  1YS7 A;  3IWZ A;  3MAJ A;  3BWG A;  4TV7 A;  1FX7 A;  2QZ8 A;  3KZY A;  1D8J A;  4D0P A;  4L5J A;  4ZYD A;  4RGR A;  5BMZ A;  2GXG A;  2KRF A;  4RGX A;  4KIG A;  5FD6 A;  4OIO F;  1B9M A;  1SD4 A;  4K2E A;  3DQV C;  2DQL A;  1J5Y A;  3KP3 A;  4G94 A;  4HX7 A;  1J9I A;  4NQW A;  4CDG A;  3IC7 A;  3ABU A;  1WI9 A;  2G7U A;  2GXB A;  4ZYG A;  4HF2 A;  2NYX A;  2Y0M A;  2OU2 A;  1Z1D A;  3Q9S A;  1H0M A;  1OMI A;  3OOP A;  5D8K B;  1KGS A;  4PGG A;  3QPT A;  5D6E A;  1XGM A;  3ZMS A;  5HDN A;  3PFI A;  1IN8 A;  1TQP A;  3F8M A;  3E5U A;  3RKX A;  2ZNY A;  1ZGA A;  2L4M A;  2F5C A;  4BXU A;  2OD5 A;  3ZN0 A;  5ERI A;  3HOS A;  3VB2 A;  2HWV A;  1J0R A;  1O7L A;  1G4D A;  3E3V A;  4MTE A;  3V7R A;  3BZ6 A;  3RYP A;  4LLG F;  5TJJ A;  5JHU A;  2DI3 A;  1MD0 A;  1XCV A;  3HUG A;  4OIP F;  5K1Y A;  2W25 A;  3F72 A;  3HOT A;  3CUQ C;  3TGN A;  3SFZ A;  1CF7 B;  2EFN A;  2O6G E;  2M45 A;  3BJA A;  5ILS A;  2Z5U A;  1RIO H;  3J81 K;  4BNC A;  3MEX A;  3K0L A;  4I01 A;  5FFZ A;  1TNS A;  4GO1 A;  2ACJ A;  4Q5S F;  3LA7 A;  2EK5 A;  2JSC A;  4WXH A;  4MTD A;  1SMT A;  2VE8 A;  4LG0 B;  3JTG A;  4WXD A;  1ON1 A;  3R60 A;  2EA2 A;  2MH9 A;  2BGC A;  3BJ6 A;  3TKY A;  4KA4 A;  1DPU A;  4RAY A;  3FM5 A;  5CJ9 A;  2HS5 A;  3DV8 A;  3CUO A;  3FZV A;  4RB2 C;  5A2Q K;  1V4R A;  1DDN A;  3N4M A;  1Z05 A;  1ODD A;  1GHC A;  5K5Q A;  5HS9 A;  5KK1 A;  3H92 A;  4HLX A;  1FOK A;  2CG4 A;  4RB1 A;  1REP C;  2QQA A;  4BHC A;  2FXA A;  3V8K A;  5LGT A;  3RYR A;  2GA1 A;  2O61 A;  4YII A;  2FA5 A;  4UV9 A;  3G3Z A;  2ELH A;  4GYI A;  1TW3 A;  5AIQ A;  2L3D A;  2PJP A;  1FSE A;  2VON A;  1YIO A;  3DPL C;  2H6C A;  4N9H A;  2Z99 A;  3WOD F;  5FO5 A;  1SD5 A;  3I59 A;  4HYE A;  1KYZ A;  3K1M A;  3GFJ A;  4U0V A;  5ICC A;  1JGS A;  2MD5 A;  1YW7 A;  5EEH A;  2L01 A;  3GLX A;  1KA8 A;  1YG2 A;  1W7P A;  1YQA A;  2QBY B;  1TQM A;  5J6X A;  1YO5 C;  2XRN A;  4M6Y A;  5D4S A;  1ZN2 A;  3E5Q A;  1TLH B;  1O3Q A;  4EM0 B;  1R5G A;  4P96 A;  4KNY A;  3WTY C;  2NNY A;  1ZG3 A;  5BS6 A;  4LJZ F;  2E1C A;  1J7K A;  2PMH A;  4U0W A;  1QZY A;  4BHB A;  1OR7 A;  2P7C B;  1P2F A;  3FM3 A;  2CYY A;  2DTR A;  1J2X A;  1JHF A;  4EV0 A;  3T1B A;  2QLZ A;  2R3S A;  3CO7 C;  2OQG A;  4N9I A;  1R23 A;  1Z9C A;  5DDG A;  1KU2 A;  4IRH A;  2DPD A;  4YG2 F;  1KQ9 A;  1DUX C;  5D5U B;  2O0Y A;  3ZMD A;  4HAM A;  5E8G A;  4CO8 A;  2E7W A;  2LF8 A;  2FNP A;  2D1H A;  2XAH A;  2X0L A;  2E1N A;  1AOY A;  1IRF A;  2VBX A;  4XRF A;  1L3L A;  1UCR A;  2E7X A;  2O8X A;  2UZK A;  5ILV A;  3I5U A;  2HTJ A;  1E17 A;  3RDI A;  3QU3 A;  1ZAR A;  3ELK A;  1J59 A;  2R7D A;  1KYW A;  3ABT A;  4EGY A;  4P55 A;  4KN4 X;  2GZW A;  1IRG A;  1U2W A;  3M8F A;  5AON A;  4O5V A;  5L3B A;  4A6D A;  5D4R A;  3P9K A;  2K02 A;  3DEU A;  2RQP A;  1E2X A;  4MEY F;  1ZRC A;  2MH2 A;  3BOQ A;  1W5T A;  1HW5 A;  3R6S A;  1SMY F;  4YFN F;  2UWM A;  3GVA A;  4OIR F;  3QPH A;  4I0B A;  2V1X A;  4ZZD A;  3I58 A;  4Y17 A;  5LLQ A;  2XKO A;  1BOA A;  2HEO A;  3T5X A;  4YFK F;  1SFE A;  4ENK A;  1R1T A;  2XAS A;  2MLG A;  2HQN A;  4ZZL A;  1PP7 U;  3GEZ A;  5L3G A;  5AIP A;  2FML A;  2M5W A;  2LSO A;  2F5E A;  1FPQ A;  4WK8 F;  5CVV A;  3R61 A;  4ENJ A;  1QNT A;  2VOO A;  1ZRD A;  3K1N A;  4EJV A;  2PFB A;  3KZZ A;  1IZ1 A;  3KLN A;  2RKH A;  5FLX Z;  2RV8 A;  1IF1 A;  1I6X A;  1OYY A;  5IT9 K;  4AVP A;  1O3R A;  2ZME B;  2FMY A;  2IW5 A;  1LJ9 A;  2ESH A;  2ZJ2 A;  1T38 A;  1U8R A;  3GZ6 A;  2XAG A;  3F8B A;  2PG4 A;  3KP2 A;  5EEG A;  4O3M A;  4DNC A;  3I64 A;  3ISP A;  3U1D A;  5H20 A;  5BPD A;  3VOE A;  3NEU A;  4M74 A;  4XLN F;  4G6Q A;  3M9A A;  3KEQ A;  1SD6 A;  2JPC A;  3V7S A;  5ED4 A;  1L0O C;  4HQE A;  2IRF G;  2ZO4 A;  1S6L A;  1FWZ A;  4FX4 A;  2YR2 A;  1BI3 A;  2FBH A;  1XMA A;  2IJL A;  1LEA A;  4BAY A;  2EFW A;  2K27 A;  4HDV A;  4Q47 A;  4LB5 A;  1D3Y A;  2VBZ A;  1YLF A;  2HQR A;  3N97 A;  4M72 A;  3KEO A;  3HRS A;  4ZYH A;  5D5V B;  2V6C A;  4WXC A;  2CGP A;  4G7O F;  5CVR A;  4MHG A;  2CW0 F;  4UVC A;  3O6B B;  1O3T A;  4Z2Y A;  3BPX A;  2W57 A;  4MGR A;  2DO7 A;  2XAQ A;  1U78 A;  1HXD A;  1EH8 A;  5JR3 A;  4LLN A;  5F64 A;  4GCV A;  2YSR A;  2MBF A;  3T8T A;  1MKM A;  5D5W B;  5FFX A;  3AAF A;  5E17 F;  3LA2 A;  1U5T B;  2HFH A;  4FT8 A;  1CF7 A;  4FHT A;  4AIK A;  1EH6 A;  1HKS A;  3KP6 A;  3EYI A;  1FYL A;  5DEQ A;  4P9F A;  4S05 A;  2FSW A;  4QWQ A;  3WTW C;  3FX3 A;  4LG0 A;  3KP4 A;  4AIJ A;  2QWW A;  3VOD A;  4XBF A;  3JAM Z;  3HIF A;  4DQ2 A;  1Z91 A;  4LMY A;  2YX4 A;  1Z7U A;  5E8I A;  1U6G A;  5E18 F;  1FLI A;  2ESN A;  2LKP A;  4MEX F;  1F4K A;  1XSD A;  1P4W A;  2K86 A;  1A04 A;  1G3T A;  3KLO A;  1B6A A;  1F9N A;  5HLG A;  1K6O A;  1C0W A;  1X3U A;  4A2U A;  2DQR A;  4CZZ A;  4EMS A;  2OZ6 A;  4RAZ A;  3KP5 A;  3B73 A;  4M6X A;  1R1V A;  1IUY A;  3LFK A;  4L9T A;  3SXY A;  1IXR C;  1LDK B;  2QUF A;  2PI0 A;  1OYW A;  3FMR A;  5FLX K;  2GWR A;  3WTZ A;  1BI0 A;  1P92 A;  4HV5 A;  3EYY A;  2HKX A;  4IRG A;  1YW8 A;  4M9Z A;  3QU6 A;  1K79 A;  5LHG A;  2OQR A;  3F8N A;  1HKT A;  4WWC A;  2HKO A;  4A0Y A;  1O57 A;  1NHA A;  1BC8 C;  3D0S A;  1G3W A;  3CJN A;  4CGZ A;  4R8H A;  3FWE A;  1EV7 A;  1R5H A;  5H6Q A;  4IVN A;  3HRU A;  5LHH A;  3CO6 C;  3KP7 A;  2WV0 A;  2MA3 A;  3LQQ A;  4L0Z B;  2OA4 A;  2QBY A;  2EFQ A;  2QQ9 A;  5HVQ C;  2BE5 F;  1TW2 A;  1O7F A;  4YFX F;  3ZP5 A;  2P8T A;  3F22 A;  2D45 A;  3Q5F A;  1XDS A;  3S2W A;  3RTR A;  3FXR A;  2NRA C;  3J7A O;  2V1D A;  1YFH A;  2P6T A;  2FEZ A;  3ZQ7 A;  2M8E A;  1B4A A;  3RI4 A;  3G73 A;  3K69 A;  3L2C A;  2VC1 A;  1WWX A;  4HF0 A;  3BPV A;  5LRS A;  2Q2E A;  3KFW X;  3O3K A;  4A12 A;  2K4J A;  3E5X A;  4IF4 A;  2CSO A;  4WF2 A;  3HSR A;  2VN2 A;  5LHI A;  1QBJ A;  3GFL A;  3P7N A;  4GXO A;  2XKP A;  3MFK A;  4IRI A;  1Q1H A;  3J80 K;  1GXQ A;  1QPM A;  4G8X A;  4KIF A;  2ZBK A;  3GYH X;  3PQK A;  3FF5 A;  2PMU A;  3WE2 A;  2COM A;  2ZKZ A;  3DF8 A;  2LDU A;  3ZMU A;  3RIR A;  4OIQ F;  2Q8K A;  4ESB A;  2P5K A;  3M7G A;  3JAM K;  3I71 A;  5DCM B;  1ZHF A;  3MZH A;  3ML6 A;  3P9I A;  2G7H A;  3WE3 A;  4F7Z A;  2P7V B;  4MNU A;  4LLL A;  2VC0 A;  3TO7 A;  1ONV A;  3BJO A;  2KIM A;  4AWX B;  2B0L A;  1BC7 C;  1ZLK A;  1R22 A;  2GQQ A;  4WX9 A;  2HR3 A;  3P9C A;  1USS A;  4MQ9 F;  2A69 F;  4A0Z A;  2VOP A;  3BRO A;  4JQF A;  3ECH A;  1ZYR F;  1PP8 F;  2GAU A;  2WWY A;  4R1H A;  1I27 A;  3TDZ C;  1U3E M;  2ISY A;  4LB6 B;  3WU1 B;  1ON2 A;  1G3Y A;  2PLY A;  4QLC U;  1FBU A;  1FSH A;  4RB3 C;  4ZYE A;  1XCB A;  1SFU A;  3HYI A;  2ETH A;  5E1Z B;  2FF4 A;  3TO9 A;  2QEN A;  1MGT A;  3C7J A;  2BBY A;  1KQ8 A;  3SQN A;  2JRT A;  1IN7 A;  2XVC A;  3QP5 A;  2ZME A;  4HF1 A;  2HDC A;  3F6V A;  3JTH A;  1BIA A;  2A3S A;  3C3W A;  3T0Y A;  4CHU A;  1JE8 A;  4G9Y A;  3IKT A;  3MWM A;  1BBY A;  5TRD A;  4G7H F;  5DUK A;  1XGN A;  5L3C A;  3E6C C;  4CXF A;  2BV6 A;  5LBQ A;  3F8F A;  4H0E A;  3CDH A;  3W6K B;  4A0X A;  4WCG A;  4G6D A;  2OAZ A;  5DD4 A;  3HRM A;  1R7J A;  2DK8 A;  5BOX A;  3BDD A;  2M30 A;  3E6D A;  4EGZ A;  2V79 A;  2L54 A;  3R0A A;  3GFM A;  2GIV A;  1BN5 A;  1GXP A;  5J8F A;  2IT0 A;  3RKW A;  4KMU X;  2VXZ A;  4OU0 A;  3I0T A;  2CO5 A;  4HW0 A;  2V9V A;  4UXN A;  1ZH5 A;  2H6B A;  3NRV A;  1FP2 A;  3O2P E;  2VE9 A;  1MJ9 A;  4LK1 F;  1J75 A;  1IAW A;  2KJC A;  4HV6 A;  1UB9 A;  2G9W A;  3MZY A;  2EFO A;  2EV5 A;  3LST A;  2W85 A;  3QAH A;  4IXA A;  4RGU A;  2C6Y A;  1FYK A;  5IT3 A;  4EJU A;  1Z6R A;  3IWF A;  3TQN A;  4KDP A;  2F5F A;  4ETS A;  2J5P A;  1H9T A;  4B8X A;  4I02 A;  1UHW A;  2K7L A;  4EQQ A;  1U5T A;  3WTS C;  1SFX A;  3U2R A;  2QYO A;  1R00 A;  3EUH A;  3JW4 A;  4HLY A;  4PZJ A;  3OV8 A;  2KIF A;  1IN4 A;  1I5Z A;  2JZY A;  5D5X B;  5LEK A;  1P4A A;  2EV0 A;  3E97 A;  4EM1 A;  2LNB A;  4L0Y B;  1TNT A;  4I7H A;  4RS8 A;  2W84 A;  2UXN A;  1ZRE A;  3ZPL A;  5F1R A;  4HA8 A;  2HYG D;  2IVM A;  1WKM A;  1MDM B;  3WGI A;  3TOB A;  2RGV A;  3M1E A;  2GA2 A;  4JK1 X;  4Y15 A;  2ZFW A;  3VEP A;  3DXJ F;  1DPR A;  3GO5 A;  3FHZ A;  3C1D A;  4AD9 A;  2XHK A;  2YX7 A;  3U9G A;  2VBY A;  2IA2 A;  1WSU A;  1W5S A;  4Q4Z F;  2AXL A;  2EWN A;  2HTS A;  2EJR A;  3GXO A;  4M73 A;  1BJA A;  2JT1 A;  2BEO A;  4UV8 A;  2HZT A;  4CIC A;  3I4P A;  3F6O A;  2VOD A;  2ZNZ A;  3C18 A;  5ILU A;  1TQI A;  4HX8 A;  2YPR A;  2QM3 A;  3V8J A;  5A2Q Z;  2JPB A;  1DP7 P;  5D8L B;  3WTV C;  3QP6 A;  5LRR A;  5KVR A;  1ZG1 A;  5F6F A;  2V1U A;  3CUQ B;  1B59 A;  3LA3 A;  2P5V A;  2FE3 A;  4E70 A;  3W6J B;  1PUE E;  1JHH A;  4A5N A;  1T98 A;  4KYW A;  1KU7 A;  3F8C A;  1XB4 A;  1PDN C;  2PQ8 A;  3HHG A;  4GYG A;  4RB0 A;  3ECO A;  1T6S A;  1VTN C;  3I54 A;  1S3J A;  5E20 A;  4L9J A;  4IPA A;  2A6H F;  2BYV E;  2RVC A;  2ZCW A;  4LK0 F;  3WGG A;  3DFG A;  4KN7 X;  4M9X A;  4P5O A;  2EB7 A;  2L4A A;  1LQ1 A;  1HST A;  1ZLJ A;  1LVA A;  3D5L A;  1LNW A;  3TDU C;  1G3S A;  3L7W A;  2CWE A;  3K2Z A;  4EVI A;  1EH7 A;  4Q48 A;  2Q0O A;  5K5O A;  1UFM A;  5CVI A;  4NB5 A;  1D5V A;  2RDP A;  4BHP A;  4U7B A;  1ZGJ A;  5JFR A;  5L3D A;  1HW2 A;  4LGW A;  2O3F A;  1P6R A;  1W4M A;  2L02 A;  2DW4 A;  1K78 B;  1LDJ A;  2DFI A;  2FU4 A;  4UUV A;  1FP1 D;  3FXU A;  1FZP B;  2H94 A;  2ADU A;  2W24 A;  2JTV A;  2KJB A;  4BH9 A;  5BPI A;  1OPC A;  3V8L A;  1QQI A;  3H3U A;  2QVO A;  2IA0 A;  1WRJ A;  1KQ0 A;  4EM2 A;  2NNN A;  2PEX A;  3CLO A;  3ULQ B;  2A6E F;  4U7D A;  5HLI A;  1IN6 A;  2F5D A;  4S04 A;  5HDK A;  4KIC A;  3GUD A;  5FGM A;  1YTY A;  1QZZ A;  5DCM A;  1HQC A;  2FNA A;  3REO A;  5HS8 A;  3M8E A;  2VT3 A;  3GX4 X;  4I2O A;  3HHH A;  3IL2 A;  3KE2 A;  1KU9 A;  3DP7 A;  5E1X A;  1U5T C;  4OMY A;  2P5L C;  3WU0 A;  2ISZ A;  2EA4 A;  3GZ5 A;  3HSF A;  2XRO A;  5JVT A;  2D1V A;  4MQV A;  1QO0 D;  5HLH A;  3R4K A;  2A61 A;  1Z6T A;  1IW7 F;  2M1B A;  2CFX A;  1TTY A;  2M87 A;  2WTE A;  3HTU A;  4RGS A;  2FOK A;  1I1G A;  1UHM A;  2FRH A;  4NHJ A;  5LEJ A;  2DAO A;  1S7A A;  2EFP A;  1HKQ A;  3L00 A;  3QOP A;  1B1B A;  1FY7 A;  3FXQ A;  4FX0 A;  1SD7 A;  5DCF A;  2H09 A;  4ON0 A;  3SZP A;  4ESJ A;  3FMQ A;  2XIG A;  2DLL A;  2XAJ A;  1ZAO A;  4O6J A;  1XGS A;  2FQ3 A;  1RI7 A;  5CLS A;  5LGU A;  5HDG A;  4XSX F;  1I1S A;  1XN7 A;  3MCZ A;  1ZRF A;  3I53 A;  2HOE A;  3SZT A;  4EJW A;  4R79 A;  2J5O A;  3GFI A;  1R58 A;  3RJP A;  2A5Y B;  1MJA A;  2NAZ A;  3K1P A;  4JBA A;  2XGX A;  1JXS A;  3KET A;  2Y75 A;  5IT9 Z;  3TO6 A;  3F3X A;  4KUM A;  2D2W A;  4PCQ A;  5BQT A;  4L18 B;  2DT5 A;  2HGC A;  3V7C A;  2Z9O A;  4M9S A;  2AS5 F;  4I98 B;  5FD5 A;  1KU3 A;  3DKW A;  3K9T A;  1OKR A;  3DPT A;  2FBK A;  2A68 F;  1OYI A;  1H9G A;  2XV4 S;  5J8C A;  2DPU A;  3GF2 A;  3LAJ A;  4EJT A;  2R7F A;  1BIB A;  2KKO A;  2RNJ A;  1RUN A;  3COA C;  4Y13 A;  1BI1 A;  4KT5 C;  4LD5 A;  2XUB A;  3RPU A;  4OMZ A;  3T8R A;  1FNN A;  1RZ4 A;  4BYY A;  3PQJ A;  1T0F A;  5DUI A;  2QQB A;  3TOA A;  2DK5 A;  3RPQ A;  1XMK A;  4U0Y A;  2XAF A;  4L5I A;  3JSP A;  4I0A A;  3LAP A;  4UNO A;  1LB2 A;  2VT2 A;  3E6B A;  3ZMT A;  2KIU A;  1T2K A;  3ZMV A;  2STW A;  1MJB A;  5HS7 A;  4M71 A;  1IN5 A;  3L09 A;  4I09 A;  5L3E A;  1B9N A;  1R1U A;  3NQO A;  4XLP F;  2EV6 A;  4HBL A;  4ESF A;  2VBW A;  5L3F A;  3HRT A;  1RNL A;  2K4B A;  3QRF F;  5FB2 A;  1YS6 A;  3B02 A;  2DU9 A;  1MDM A;  2F2E A;  4OOI A;  5CVU A;  4HOB A;  5DD8 A;  1XD7 A;  3BP8 A;  3WTX C;  5E1W A;  3LWF A;  3SHF A;  6PAX A;  1P4X A;  2OZU A;  4HZF A;  1CGP A;  3I59 B;  1BI2 A;  3IHU A;  1MZB A;  5HOO A;  4IJA A;  2WC2 A;  1YYV A;  4CYD A;  3FMS A;  5LGN A;  3F23 A;  2NS0 A;  2UXX A;  1ZG5 A;  3IRR A;  2P6S A;  3ERE D;  1G6N A;  2RC4 A;  4IHS A;  1HSJ A;  1FBS A;  3GWZ A;  4BQA A;  5ICE A;  4ASN A;  1LEB A;  3EDP A;  1W7P B;  4KFC A;  4GGG A;  2OBP A;  3ROU A;  2MLK A;  4PGH A;  2DBB A;  1XSX A;  2HYF A;  2STT A;  1STZ A;  4ZH4 F;  4L9V A;  4OIN F;  5ICF A;  3CUQ A;  3BY6 A;  1W7P D;  4ENM A;  1S8N A;  1FT9 A;  1F5T A;  4HX4 A;  1YW9 A;  2LF7 A;  1AWC A;  1IXS B;  1ULY A;  1SAX A;  2FBI A;  1T39 A;  1V3F A;  2Z33 A;  4YIF A;  4KMF A;  3R0J A;  4UVA A;  1XDU A;  1GVJ A;  3WTT C;  4A5M A;  5D6F A;  5DV5 A;  2PBI A;  1O3S A;  2H27 A;  4KIB A;  1WQ2 A;  3IKV A;  2TDX A;  4P9U A;  4PDK A;  3LQR A;  2YU3 A;  4G7Z F;  4IHT A;  5ICG A;  3V4G A;  1S29 A;  3J81 Z;  1S7O A;  1IXC A; 
#chains in the Genus database with same CATH topology
 2IPQ X;  3E6M A;  1V54 H;  4ENN A;  2AQE A;  2L2O A;  2W1O A;  1X1B A;  3L9F A;  1BOB A;  1X1P A;  4XKB A;  2Z3Y A;  1RKW A;  3OR1 C;  3LSR A;  2JA2 A;  4B47 A;  5JI6 A;  1HW1 A;  3H3Z A;  2L5Q A;  2CQK A;  4LFU A;  1JKO C;  2QF7 A;  1HDD C;  1I6H J;  3Q9V A;  4XLH A;  1E3P A;  2AXT C;  4A6E A;  5H6R A;  1E0E A;  2FJ1 A;  3A4C A;  1K78 A;  1FBQ A;  3ZMZ A;  1ZR2 A;  1PVE A;  3S15 J;  1IG7 A;  1Y1W J;  1R4N B;  4BXF A;  4HDU A;  1QGP A;  2FX0 A;  2IP2 A;  1JTY A;  1GLN A;  2Y48 A;  4B09 A;  4RM2 A;  1XSV A;  3QOD A;  1HBX G;  5TIS C;  2MC3 A;  2IA1 A;  4XSZ F;  4KIS A;  1RUO A;  1VQP I;  2RN7 A;  4XN3 A;  2XGD A;  2XRL A;  3M1C A;  3EET A;  2XB5 A;  1MH4 A;  1FYM A;  1R36 A;  3CTA A;  1Y0U A;  5JHF A;  3KCC A;  1F1Z A;  1ETK A;  2IBD A;  1WPK A;  3GZN B;  2Q1Z B;  2Y31 A;  1ETW A;  3VFZ A;  1D8K A;  1FC3 A;  2FD5 A;  3MQ0 A;  4W1U A;  4B3X A;  2KP6 A;  3ZOB A;  2A07 F;  1LE8 A;  1XMX A;  4BDZ A;  3I9V 2;  2O03 A;  4HQM A;  3TED A;  2R92 J;  1LDD A;  4UVB A;  3HTS B;  1SAU A;  4BL0 B;  3WG9 A;  4U88 A;  2VKH A;  5K5R A;  1IV6 A;  1BM9 A;  3E0J B;  5DYM A;  5J4V A;  1A36 A;  2LTP A;  2ZXJ A;  4HG2 A;  3WTU C;  3EQL F;  5IY5 H;  1RPW A;  4AIH A;  1FOW A;  4N0B A;  2QEX I;  2PN6 A;  2IGO A;  3GW2 A;  4AID A;  1D1B A;  1UST A;  2X4H A;  2K9M A;  2P4W A;  1PUF B;  3WGH A;  1B72 A;  2F6C A;  5CVJ A;  3JSO A;  2EIK H;  1Z3X A;  2R7S A;  2K9Q A;  2EZL A;  1K7A A;  3IRQ A;  1POG A;  4UHT A;  4EJO A;  1IDY A;  2V9P A;  4L9N A;  3OS2 A;  3HSE A;  5CYV A;  3F21 A;  1XGO A;  3J80 Z;  3RKY A;  1TBX A;  4PSW A;  3JRF A;  3ZN1 A;  1YS7 A;  3IWZ A;  2ZJQ F;  4NUB A;  3ONQ A;  3MAJ A;  3BWG A;  4TV7 A;  1FX7 A;  2BW3 A;  2QZ8 A;  4CCN A;  2ZME C;  3KZY A;  1D8J A;  4D0P A;  4L5J A;  5DS9 A;  4ZYD A;  2MSY A;  2WY7 Q;  4RGR A;  1SEU A;  5BMZ A;  2GXG A;  2KRF A;  4RGX A;  4G6T B;  4IQJ A;  4KIG A;  5FD6 A;  4OIO F;  1B9M A;  4IL6 C;  4KIT B;  1SD4 A;  4HEA 2;  4K2E A;  4IZZ A;  1U8B A;  3DQV C;  2DQL A;  1J5Y A;  3O8G A;  3OYB A;  3KP3 A;  1MIJ A;  4XLC A;  2WB1 N;  4G94 A;  2E19 A;  3MKW B;  3OYH A;  4A3J J;  4HX7 A;  1J9I A;  4NQW A;  4CDG A;  3CJT B;  3IC7 A;  4JX4 A;  3MD2 A;  1ZGW A;  4X1E A;  3ABU A;  1WI9 A;  3J7Y J;  2G7U A;  2GXB A;  4IHX A;  4L5E A;  4ZYG A;  3H9J A;  2NYX A;  3CJR B;  2HVS A;  5M3F J;  4HF2 A;  5F0C A;  2Y0M A;  2OU2 A;  1Z1D A;  3Q9S A;  4CCK A;  4XLE A;  3CES A;  1H0M A;  4CYC A;  1OMI A;  3OOP A;  1AU7 A;  4QSH A;  5D8K B;  2D5V A;  4RBO A;  1KGS A;  4PGG A;  3QPT A;  3I3L A;  5D6E A;  2XSD C;  3W6V A;  3PUB A;  1XGM A;  3ZMS A;  3CMM A;  3GTG J;  5HDN A;  3PFI A;  2BVL A;  1V5F A;  1IN8 A;  1TQP A;  2L7Z A;  3KYD B;  3F8M A;  3E5U A;  3RKX A;  2E71 A;  2ZNY A;  3A02 A;  4E7L A;  1ZGA A;  4OAZ A;  2L4M A;  2F5C A;  2M8G X;  2OC6 A;  1P7J A;  4BXU A;  2IGK A;  2OD5 A;  3ZN0 A;  4V2F A;  1D0X A;  3MZ8 A;  3MKY B;  1QHG A;  5ERI A;  2F4M B;  1A5J A;  2IS4 A;  2PX9 A;  2VKD A;  2X6W A;  2CQ7 A;  4CA0 A;  3HOS A;  3VB2 A;  3HOX J;  4A69 C;  5F08 A;  3G2B A;  4BAC A;  2YUS A;  1ETY A;  2HWV A;  1J0R A;  1O7L A;  2AO9 A;  4YRV A;  4BEH A;  1G4D A;  3E3V A;  4MTE A;  3V7R A;  3BZ6 A;  3NWS A;  3RYP A;  4LLG F;  5TJJ A;  5JHU A;  1LFU P;  2CQN A;  1OCP A;  2DI3 A;  2VPR A;  1FJL A;  1MD0 A;  4IEJ A;  1XCV A;  3HUG A;  1YRN A;  4OIP F;  5K1Y A;  2W25 A;  1R49 A;  3F72 A;  3HOT A;  3CUQ C;  3CQZ J;  3TGN A;  3SFZ A;  3CCM I;  2EFN A;  1CF7 B;  2O6G E;  3SDG A;  2M45 A;  1Z67 A;  4DZP A;  3BJA A;  1OCT C;  5ILS A;  2Z5U A;  1RIO H;  1XC5 A;  5GAG J;  1P9Q C;  3J81 K;  1MSE C;  4BNC A;  4I76 A;  3MEX A;  3K0L A;  4I01 A;  2PMZ N;  5FFZ A;  4Z6Y A;  1TNS A;  4GO1 A;  4BE2 A;  2M9H A;  2XC7 A;  2ACJ A;  5EZH A;  1QVT A;  5J4Y A;  4Q5S F;  3LA7 A;  2EK5 A;  2JSC A;  3GLL A;  4WXH A;  3AL0 C;  4MTD A;  1SMT A;  2VE8 A;  4LG0 B;  2VL8 A;  3M07 A;  1EJ9 A;  5GAH J;  3SJM A;  1XG1 A;  3JTG A;  2KDZ A;  1X1D A;  4WXD A;  1ON1 A;  3R60 A;  4BJ5 C;  3ZGK A;  2EA2 A;  4RLQ A;  2MH9 A;  3EPZ A;  2BGC A;  3BJ6 A;  3TKY A;  4KA4 A;  3SDB A;  4BQO A;  1DPU A;  4RAY A;  3FM5 A;  4I99 C;  4EAT A;  5CJ9 A;  1A6I A;  2HS5 A;  2L9S A;  3DV8 A;  2LVS A;  3JRG A;  4N4O B;  3BTJ A;  3CUO A;  3FZV A;  4IHW A;  4RB2 C;  2R7X A;  4NC7 A;  5A2Q K;  1V4R A;  1DDN A;  2A6T A;  5FKL A;  2H8R A;  5JLW A;  3N4M A;  5FRM A;  1Z05 A;  2ME0 A;  3K4M A;  1ODD A;  1GHC A;  5K5Q A;  4XON A;  5HS9 A;  1G59 A;  5KK1 A;  3H92 A;  4HLX A;  1ETQ A;  4DOZ A;  3S16 J;  2MFZ A;  3FXO A;  5F27 A;  1FOK A;  2CG4 A;  4RB1 A;  2BHY A;  3L2W A;  3PSI A;  1REP C;  2QQA A;  1OQY A;  4BHC A;  3LOC A;  1TP4 A;  1I50 J;  3S32 A;  4V2G A;  1FTT A;  3GTM J;  2FXA A;  3V8K A;  5LGT A;  4S0H B;  1QHH D;  3RYR A;  3H35 A;  2GA1 A;  2O61 A;  1MND A;  2KMU A;  4YII A;  1BR2 A;  3Q0U A;  3MMY B;  2FA5 A;  1TWA J;  2Y0S N;  4AUX A;  3HB9 A;  1GT0 C;  5EGO A;  3S1R J;  4UV9 A;  3G3Z A;  3K7A J;  2ELH A;  4GYI A;  1TW3 A;  1LKX A;  2L3D A;  5AIQ A;  2PJP A;  2DA4 A;  3HOU J;  3E7L A;  1FSE A;  2VON A;  3C2H A;  1YIO A;  1GUU A;  2LH9 A;  3U1K A;  3DPL C;  4PJJ A;  2XPW A;  2QKM B;  2DA1 A;  3RKQ A;  2H6C A;  4KJZ A;  4N9H A;  3IAM 2;  2Z99 A;  5DTD A;  1SAN A;  4ITV A;  3WG7 H;  3WOD F;  5FO5 A;  1SD5 A;  1UJ8 A;  2VIX A;  3I59 A;  2R7T A;  4IO9 F;  2OV7 A;  2NOG A;  4HYE A;  3LSK A;  2M7B A;  1WJD A;  4AM3 A;  1BR1 A;  1KYZ A;  3K1M A;  3QPL A;  3GFJ A;  3HKZ N;  4U0V A;  4BE0 A;  3K70 D;  5ICC A;  3KYC B;  1JGS A;  2MD5 A;  5GAE J;  5KNL A;  3V42 A;  1LVK A;  1YW7 A;  5EEH A;  2L01 A;  3GLX A;  1VI0 A;  1KA8 A;  5K7F A;  1YG2 A;  1W7P A;  1LFP A;  3TW6 A;  2XB0 X;  2EIL H;  1YQA A;  2QBY B;  5J47 A;  2WAF A;  3AG2 H;  1TQM A;  5J6X A;  1YO5 C;  2XRN A;  4M6Y A;  5D4S A;  1ZN2 A;  3E5Q A;  2V4J C;  1TLH B;  1O3Q A;  4EM0 B;  1BW5 A;  1R5G A;  5J1Y A;  3HPH A;  3H9G A;  4P96 A;  3ZQQ A;  2PMZ A;  1D5Y A;  1IV8 A;  1HC8 A;  4KNY A;  2HXO A;  3RZD J;  3WTY C;  2NNY A;  1ZG3 A;  5BS6 A;  3Q0W A;  4HNT A;  2ZB9 A;  2WAE A;  2W7N A;  4JYK A;  4LJZ F;  1JUS A;  2E1C A;  3CD6 I;  1J7K A;  2PMH A;  4U0W A;  1QZY A;  4BHB A;  1OR7 A;  3HDD A;  2P7C B;  1P2F A;  3DKX A;  1E3O C;  3FM3 A;  2AQF A;  2CYY A;  1VF9 A;  2JN6 A;  5F0F A;  3OYD A;  2DTR A;  1J2X A;  2DA6 A;  1JHF A;  2MW8 A;  3H5A A;  4EV0 A;  5EDN A;  1MNM C;  3T1B A;  5CQE A;  2KT0 A;  3BTC A;  2QLZ A;  1HCR A;  2R3S A;  3CO7 C;  1YI2 I;  2OQG A;  3W2A A;  4N9I A;  2ZXW H;  1R23 A;  1Z9C A;  5DDG A;  1KU2 A;  4IRH A;  2Q2E B;  2DPD A;  3CP8 A;  1Q1V A;  2LG4 A;  3GME A;  4YG2 F;  1KQ9 A;  1DUX C;  5D5U B;  1LUJ B;  2O0Y A;  3ZMD A;  4HAM A;  2LYC A;  5E8G A;  2WV1 A;  3SFI A;  4CO8 A;  2VPL A;  2E7W A;  1T95 A;  2LF8 A;  2VQH A;  2FNP A;  2D1H A;  2XAH A;  1IDZ A;  2X0L A;  1H8A C;  2Y69 H;  2E1N A;  4ANJ A;  1IRF A;  1YJ9 I;  1AOY A;  2VBX A;  5JVG F;  4XRF A;  4PK4 A;  4YIR X;  2Y30 A;  3SEQ A;  3FBN B;  4ZJZ A;  1UCR A;  2E7X A;  1L3L A;  3S17 J;  1HF0 A;  2JJ7 A;  2O8X A;  3G1O A;  2LBF B;  2UZK A;  5ILV A;  3I5U A;  4IX7 A;  2HTJ A;  1E17 A;  3BZK A;  3HOV J;  1OLT A;  3RDI A;  3QU3 A;  1ZAR A;  1JUP A;  3ELK A;  3IUO A;  4HNU A;  1J59 A;  4ZDO A;  3PNY A;  2R7D A;  1KYW A;  2DT6 A;  3ABT A;  4XN0 A;  4EGY A;  4P55 A;  1YIT I;  2E5N A;  2K5C A;  2ZXI A;  2DOF A;  4KN4 X;  2GZW A;  4BJ6 C;  5J1U A;  1IRG A;  2DFF A;  5KAI C;  3JRH A;  1U2W A;  3M8F A;  3OYK A;  5AON A;  4O5V A;  1VQ5 I;  5L3B A;  4A6D A;  2H8W A;  5C3E J;  5D4R A;  3P9K A;  3ZXS A;  3RQI A;  2K02 A;  1AA7 A;  1HDP A;  3DEU A;  2RQP A;  1E2X A;  1NG7 A;  4MEY F;  4NBQ A;  3OYI A;  1WH5 A;  1ZRC A;  2MH2 A;  3BOQ A;  4BUP A;  1HW5 A;  1W5T A;  3R6S A;  1SMY F;  2KPM A;  2M4G A;  4YFN F;  2X9D A;  2UWM A;  4RA2 A;  3GVA A;  4OIR F;  3I55 I;  1UG0 A;  3QPH A;  3FBI B;  4I0B A;  1YOV B;  3FIS A;  4M3F A;  1Z0X A;  1R6R A;  1ETV A;  2V1X A;  4ZZD A;  3I58 A;  4Y17 A;  2V6E A;  5LLQ A;  4RM3 A;  3OOU A;  2XKO A;  1BOA A;  2HEO A;  3T5X A;  4YFK F;  1SFE A;  4ENK A;  5GTH C;  3HKZ A;  1R1T A;  2XAS A;  2MLG A;  5GAD J;  2HQN A;  3DBL B;  3BT9 A;  4A3D J;  1SVL A;  3PIP F;  2DOE A;  4ZZL A;  1PP7 U;  3GEZ A;  5L3G A;  4UUS B;  3OYM A;  1V5G A;  1OCC H;  4HSR A;  5FLV A;  2JK3 A;  5AIP A;  2FML A;  2M5W A;  2HNH A;  2LSO A;  2F5E A;  1U0J A;  1VZ0 A;  1FPQ A;  4WK8 F;  1MBK A;  5CVV A;  3R61 A;  4ENJ A;  1QNT A;  5FKM A;  2EIM H;  3OYL A;  2HXI A;  3F0C A;  2VOO A;  5KAF C;  2R0Q C;  4CCL A;  1N77 A;  2M3A A;  5C4X J;  5E79 C;  1ZRD A;  3K1N A;  4EJV A;  2VKV A;  5HNH A;  2PFB A;  3KZZ A;  1XS9 A;  1IZ1 A;  1VQ4 I;  3KLN A;  2RKH A;  3H1C A;  5FLX Z;  1AKH B;  2RV8 A;  3JR9 A;  1IF1 A;  4AVZ A;  1JKP C;  1PUF A;  1MSF C;  1NH3 A;  1I6X A;  1UHS A;  1OYY A;  2K40 A;  1SC7 A;  5IT9 K;  4H4K C;  4AVP A;  1O3R A;  4N4N B;  1YIJ I;  2VJI A;  2ZME B;  1FMW A;  2FMY A;  3SZG A;  1T33 A;  2IW5 A;  1S72 I;  2CU7 A;  1LJ9 A;  2ESH A;  2ZJ2 A;  3D5R C;  1T38 A;  3ZRG A;  2QSF X;  1U8R A;  3GZ6 A;  2XAG A;  3F8B A;  2PG4 A;  3KP2 A;  2E1O A;  3FIW A;  5EEG A;  2F5V A;  2HOA A;  2OCE A;  4HPQ A;  4O3M A;  4DNC A;  1UZC A;  3I64 A;  3ISP A;  3S14 J;  2QGU A;  3MN2 A;  4PUS A;  2CFO A;  3U1D A;  3OIO A;  5H20 A;  5BPD A;  3VOE A;  1WJB A;  3BQZ A;  3NEU A;  4M74 A;  4MFE A;  4XLN F;  2L7M P;  3PSF A;  3VWB A;  3QYE A;  2CQQ A;  4G6Q A;  3JRC A;  3M9A A;  5IP6 A;  3KEQ A;  1SD6 A;  3HM5 A;  2DA5 A;  2JPC A;  2OTJ I;  3V7S A;  4NDL A;  4LIT A;  1X3W B;  5ED4 A;  5FKN A;  1L0O C;  4HQE A;  3LSM A;  2IRF G;  2ZO4 A;  1S6L A;  2X6X A;  1FWZ A;  4FE4 A;  4F91 B;  4FX4 A;  3OWT A;  2YR2 A;  2LD5 A;  4B4C A;  4RAG A;  4F93 B;  1IO2 A;  1BI3 A;  2FBH A;  1BR4 A;  1XMA A;  2IJL A;  2DMU A;  4Y7N J;  1LEA A;  4BAY A;  2EFW A;  2IAI A;  3BG6 A;  2FUG 2;  2K27 A;  3LSJ A;  4HDV A;  4Q47 A;  1GV2 A;  4LB5 A;  1OIS A;  2VBZ A;  1D3Y A;  4C9Y A;  2F4O B;  3DKY A;  2OPT A;  1YLF A;  4NC6 A;  4FAS D;  4E7H A;  2HQR A;  3N97 A;  3RCO A;  3S1N J;  2VI6 A;  2DJN A;  4M72 A;  3H0G J;  4ZC3 A;  2R7R A;  3G4S I;  4IHV A;  3KEO A;  4HST A;  1W5C C;  2HPI A;  3HRS A;  4ZYH A;  5D5V B;  2V6C A;  4WXC A;  2CGP A;  4G7O F;  5CVR A;  1JT6 A;  4MHG A;  3UR3 C;  2CW0 F;  3DLA A;  1ZTR A;  1T56 A;  4UVC A;  5HOD A;  3O6B B;  2DOA A;  3D1N I;  1O3T A;  2HVR A;  1S5L C;  2X85 A;  4Z2Y A;  3A01 B;  3BPX A;  4CUG A;  2W57 A;  4MGR A;  2IS6 A;  2BOL A;  2DO7 A;  2XAQ A;  4BDY A;  1U78 A;  2VKE A;  1HXD A;  4V19 K;  1EH8 A;  4FET A;  2NXN B;  3S8P A;  5JR3 A;  3K4B A;  4LLN A;  2UV1 A;  5F64 A;  4GCV A;  2YSR A;  3H9Q A;  3DCF A;  1QPI A;  2MBF A;  3CDL A;  3L2R A;  4XKW A;  3OIP A;  3T8T A;  1MKM A;  5D5W B;  2DTZ A;  5FFX A;  1RET A;  3AAF A;  1T0F C;  5B66 C;  5E17 F;  3LA2 A;  1U5T B;  2HFH A;  4KT6 A;  4FT8 A;  1CF7 A;  5IYD J;  2VAS A;  4FHT A;  1VQ8 I;  4AIK A;  1KON A;  5GPA A;  1SVO A;  1EH6 A;  1HKS A;  1OR7 C;  3KP6 A;  4PSX A;  3G1M A;  3EYI A;  1I3A A;  2F48 A;  3FDY A;  1MNE A;  1FYL A;  2M0C A;  2K9N A;  3BLY A;  1ZKG A;  2IGM A;  5DEQ A;  4P9F A;  3VYR B;  5B1A H;  3PUF A;  3PJR A;  4S05 A;  2FSW A;  3L2Q A;  2CUF A;  4QWQ A;  3CF5 F;  1WJF A;  1W36 C;  3WTW C;  2Z1D A;  3FX3 A;  1VQL I;  1WGX A;  1DU6 A;  4BE1 A;  4LG0 A;  5E3O A;  3KP4 A;  4AIJ A;  2CW7 A;  1IUF A;  2QWW A;  3VOD A;  4XBF A;  3KPH A;  3JAM Z;  2DN0 A;  4ZTF A;  4HRI A;  3K4L A;  3CCS I;  3GTP J;  1X4P A;  3HIF A;  4DQ2 A;  2GOX B;  3QOE A;  2LKS A;  1Z91 A;  4LMY A;  2B7E A;  2YX4 A;  3K4K A;  1Z7U A;  2XSJ C;  5E8I A;  3LNQ A;  1U6G A;  4AC0 A;  5E18 F;  1FLI A;  1JKR C;  1D0Z A;  2ESN A;  2LKP A;  4MEX F;  4J19 A;  4E4H A;  2TCT A;  3CCR I;  4DYR A;  3L2V A;  2RAE A;  1U9O A;  1F4K A;  1XSD A;  5BNG A;  1P4W A;  2A05 A;  3CMA I;  4M3G A;  2K86 A;  1A04 A;  1G3T A;  2M2E A;  4XRM A;  3KLO A;  1B6A A;  3BR6 A;  1F9N A;  5KHD A;  5HLG A;  5DM6 F;  4GRI A;  1K6O A;  1IRX A;  1C0W A;  1X3U A;  1WJC A;  4A2U A;  3CZ6 A;  2DQR A;  1VQN I;  4XLF A;  2O7O A;  3K10 A;  2WAD A;  4CZZ A;  3A0H C;  4EMS A;  2OZ6 A;  4RAZ A;  3KP5 A;  3B73 A;  4M6X A;  1JGG A;  1R1V A;  4DBR A;  2E1M C;  1X2M A;  1WJA A;  1IUY A;  3DBH B;  3LFK A;  4L9T A;  3TL4 X;  1YX5 A;  3SXY A;  2OCC H;  3I4N J;  3L1P A;  4ZDP A;  1IXR C;  3ZQC A;  2Y9Y A;  3ABL H;  1LDK B;  2QUF A;  5EF6 A;  2PI0 A;  1FOY A;  1OYW A;  4XRS G;  3FMR A;  1RC9 A;  5FLX K;  2GWR A;  3WTZ A;  2LKX A;  4A3K J;  2Y9Z A;  1BI0 A;  3WHC A;  1P92 A;  4HV5 A;  4XKC A;  3EYY A;  2HKX A;  4W97 A;  4IRG A;  4GDF A;  1YW8 A;  2KHM A;  5IYC J;  3A03 A;  4M9Z A;  4DYQ A;  1K4T A;  3QU6 A;  1K79 A;  5LHG A;  3DLL F;  2OQR A;  3F8N A;  1HKT A;  4WWC A;  2HKO A;  3C2G A;  4PFP A;  4A0Y A;  1O57 A;  1NHA A;  1Y8Q B;  1BC8 C;  2MGQ A;  3D0S A;  2R5Y B;  1G3W A;  3BR3 A;  3CJN A;  1S7E A;  4CGZ A;  4R8H A;  3FWE A;  1EV7 A;  1R5H A;  5H6Q A;  2E2J J;  4XQF A;  1EKE A;  3DEE A;  4IVN A;  2X48 A;  3HRU A;  2VJ5 A;  3S2H J;  3VYU B;  4U87 A;  2CUZ A;  2KQR A;  1R9T J;  5LHH A;  3CO6 C;  2R7W A;  3KP7 A;  5GP9 A;  1MBH A;  4C30 A;  2WV0 A;  3GBG A;  4M3E A;  2MA3 A;  3LQQ A;  1J09 A;  3BC8 A;  3VDX A;  3ESW B;  3S2D J;  3IV5 A;  3OSG A;  4L0Z B;  2OA4 A;  2MC4 A;  2QBY A;  2EFQ A;  1XPX A;  1JT0 A;  2QQ9 A;  5HVQ C;  5LFA A;  1JKQ C;  4DIQ A;  3OYE A;  2CV0 A;  2ID6 A;  3C2B A;  3CMY A;  2BE5 F;  1X4O A;  1HLV A;  1TW2 A;  3QYB A;  2OUM A;  4UUT A;  1O7F A;  4YFX F;  4E7I A;  3ZP5 A;  2P8T A;  3F22 A;  4LIU A;  3DEW A;  1MH3 A;  2D45 A;  3PL8 A;  3Q5F A;  1XDS A;  3S2W A;  2X1C A;  1Y1V J;  3ZQL A;  3VSL A;  4JP0 A;  2LRE A;  3KYL A;  1WFX A;  3RTR A;  3FXR A;  2NRA C;  3J7A O;  3TW7 A;  2V1D A;  1YFH A;  2P6T A;  1ZK8 A;  2FEZ A;  5FRO A;  2E5Z A;  3ZQ7 A;  4BBR J;  3JRD A;  2M8E A;  3AG4 H;  1GVD A;  1B4A A;  3RI4 A;  4C3I J;  1QZE A;  3G73 A;  3K69 A;  3L2C A;  2VC1 A;  9ANT A;  1WWX A;  3HZJ A;  5E3L A;  4HF0 A;  3BPV A;  1VQO I;  5LRS A;  2Q2E A;  3CC4 I;  2KIS A;  1WCM J;  3KFW X;  2QA4 I;  3FK7 A;  1ACI A;  3O3K A;  4OAY A;  2YU9 J;  4A12 A;  1T8I A;  4CYC B;  1MMD A;  2K4J A;  3E5X A;  4IF4 A;  1AHD P;  4LOC A;  1N78 A;  2CSO A;  2P81 A;  2X6Y A;  2NS7 A;  4WF2 A;  3HSR A;  2I8D A;  1MBG A;  1MMN A;  2VN2 A;  2OF7 A;  5LHI A;  3JRE A;  2XAU A;  1QBJ A;  3JRA A;  3GFL A;  3P7N A;  5FJ8 J;  3BTL A;  4GXO A;  5J3L A;  1YJN I;  2XKP A;  3MFK A;  3EUK L;  4IRI A;  2TRT A;  2LBF A;  1Q1H A;  3J80 K;  1GXQ A;  3OYC A;  2A5W A;  1QPM A;  2R5Z B;  2AHQ A;  3BG9 A;  4G8X A;  2ZBK A;  4KIF A;  3KEY A;  4IKF A;  3FKJ A;  3OYA A;  3GYH X;  3PQK A;  3X2Q H;  3FF5 A;  2PMU A;  2BVM A;  5IP7 J;  4B43 A;  3WE2 A;  2COM A;  2RNG A;  3S1Q J;  2ZKZ A;  3DF8 A;  3DWL E;  1K83 J;  2LDU A;  1DP3 A;  3HBL A;  3ZMU A;  3VYT B;  3RIR A;  4A3E J;  4OIQ F;  2Q8K A;  4ESB A;  5H2F C;  3NAU A;  2P5K A;  3CP2 A;  3M7G A;  3JAM K;  3I71 A;  5LD2 C;  3AG3 H;  2Z16 A;  5DCM B;  1ZHF A;  2VUM J;  3LL7 A;  3MZH A;  3ML6 A;  3P9I A;  2G7H A;  2DT7 B;  3WE3 A;  4BJT A;  1YHQ I;  1GV5 A;  1NK3 P;  2HOS A;  2JA5 J;  4F7Z A;  2DDA A;  2P7V B;  4MNU A;  4E6K G;  3ASO H;  4LLL A;  1ETO A;  2VC0 A;  4D9J A;  3TO7 A;  1ONV A;  1VFC A;  3EUA A;  1IRZ A;  3BJO A;  2KIM A;  4AWX B;  3OY9 A;  2IS2 A;  3CME I;  3NWT A;  4II3 A;  2FQ4 A;  2MYS A;  1MBF A;  2B0L A;  3FK6 A;  1BC7 C;  1E3H A;  1ZLK A;  1R22 A;  4NC8 A;  3FXL A;  4ZDL A;  2GQQ A;  4WX9 A;  1TC3 C;  2HR3 A;  5IPA A;  3P9C A;  1USS A;  3ABM H;  2A69 F;  4MQ9 F;  3WU2 C;  3G6E I;  1APL C;  2XF7 A;  3IH3 A;  4A0Z A;  1B8I B;  3BR0 A;  2VOP A;  3BRO A;  4JQF A;  2QQ8 A;  3ECH A;  3K4N A;  1ZYR F;  1I3Q J;  5M3M J;  4UUS A;  3I4M J;  1PP8 F;  2GAU A;  1O4X A;  3BR1 A;  2HYJ A;  2WWY A;  2EZH A;  4R1H A;  1I27 A;  3TDZ C;  5CKT A;  5IP9 J;  1U3E M;  1MBE A;  2ISY A;  4GFB A;  3OL3 A;  4LB6 B;  4M3B A;  1VQ6 I;  3WU1 B;  2NVU B;  1ON2 A;  1G3Y A;  2B9S A;  2JA6 J;  3H5R A;  3QWL A;  4QLC U;  1FBU A;  3JRB A;  2PLY A;  1FSH A;  4RB3 C;  4ZYE A;  3BG5 A;  2KRH A;  3VSK A;  1XCB A;  4XK4 A;  3A1Y A;  3HYI A;  1SFU A;  2ETH A;  5E1Z B;  2FF4 A;  3TO9 A;  2QEN A;  1MGT A;  1AKH A;  3C7J A;  5EG0 B;  2BBY A;  3BG7 A;  4XOT A;  1KQ8 A;  3SQN A;  2JRT A;  2QKL B;  1IN7 A;  2XVC A;  4DZJ A;  4IQ4 A;  3M3Y J;  3QP5 A;  1Y39 A;  2ZME A;  2WAQ N;  4HF1 A;  2HDC A;  4MFD A;  3F6V A;  2L7F P;  3JTH A;  3MVP A;  1BIA A;  1RR7 A;  3OS0 A;  2A3S A;  3C3W A;  1ETX A;  3T0Y A;  1BJZ A;  5IOY A;  4CHU A;  4CSW A;  2I5U A;  5C44 J;  4X0G A;  3M8J A;  4MLO A;  1JE8 A;  4G9Y A;  3K2A A;  3DTI A;  3IKT A;  1OJL A;  2JWT A;  5GTI C;  2COB A;  3MWM A;  4JOM A;  1BBY A;  4G7H F;  5TRD A;  5DUK A;  4M3D A;  1XGN A;  5L3C A;  3E6C C;  4CXF A;  1TT0 A;  2BV6 A;  5B3S H;  5LBQ A;  2LY2 A;  1R71 A;  3F8F A;  4LIV A;  4H0E A;  3CDH A;  3OL4 A;  3W6K B;  4A0X A;  4WCG A;  3OYJ A;  4G6D A;  4CZC A;  1MW7 A;  2DFE A;  3OYN A;  2R7U A;  1MMA A;  1QVU A;  2OAZ A;  4QPO A;  5DD4 A;  3HRM A;  1R7J A;  2DK8 A;  4I6Z A;  2JSP A;  4J00 A;  2VXD A;  5BOX A;  3S3M A;  2NVT J;  3BDD A;  4XKV A;  2M30 A;  5JLX A;  1IJW C;  3CCY A;  2IEK A;  4J01 A;  3S3N A;  3E6D A;  2OTL I;  4EGZ A;  3K70 C;  2V79 A;  4Y3O A;  2L54 A;  3CDI A;  4EEF G;  2VJ4 A;  3R0A A;  3GFM A;  2GIV A;  1BN5 A;  3B6C A;  1GXP A;  5J8F A;  1X1A A;  3LSP A;  4QPQ A;  2IT0 A;  1BW6 A;  1OFC X;  4Y4R A;  3DPU A;  3F9K A;  1FIA A;  2VXZ A;  4KMU X;  4OU0 A;  3RKW A;  2EIN H;  3I0T A;  3ASN H;  2CO5 A;  2PJR B;  5IOZ A;  3HPG A;  4XR6 A;  3QPS A;  2DCE A;  4HW0 A;  2V9V A;  2DA3 A;  5EYR A;  4UXN A;  1ZH5 A;  2H6B A;  3NRV A;  1Z21 A;  2MD0 A;  1Z3Y A;  1P7I A;  1FP2 A;  3O2P E;  2VE9 A;  1Y56 A;  2X1E A;  4FIS A;  2K9L A;  5KCM A;  1MJ9 A;  3IH4 A;  3BR2 A;  4LK1 F;  4C2M J;  1J75 A;  2NVX J;  1IAW A;  5FRN A;  3UNG C;  2KJC A;  4HV6 A;  5M5X J;  3A01 A;  3S93 A;  1UB9 A;  4PJM A;  2ICW G;  2G9W A;  3MZY A;  4FQG A;  4XMY A;  2EFO A;  2EV5 A;  3LST A;  2W85 A;  3QAH A;  1UAA A;  4IXA A;  4RGU A;  3SEZ A;  2C6Y A;  1FYK A;  5IT3 A;  4EJU A;  1Z6R A;  4X6A J;  1BA5 A;  4BQQ A;  2WY8 Q;  3E1S A;  1S9H A;  3IWF A;  3J7A Y;  3TQN A;  4D5F A;  4KDP A;  3IAS 2;  1PYV A;  4IOA F;  1YJW I;  2F5F A;  4ETS A;  2J5P A;  1H9T A;  4B8X A;  5HNF A;  1K6Y A;  3CC2 I;  4I02 A;  4DGW B;  1UHW A;  2K7L A;  1NTC A;  1X19 A;  4EQQ A;  1DU0 A;  1U5T A;  3WTS C;  2DMN A;  1SFX A;  3U2R A;  1JI8 A;  2QYO A;  1R00 A;  3EUH A;  3JW4 A;  3RPU D;  4HLY A;  4PZJ A;  2K9S A;  3OV8 A;  2KIF A;  3CC7 I;  1IN4 A;  1I5Z A;  2JZY A;  5D5X B;  2KFD A;  5LEK A;  1P4A A;  2G0E A;  3TP0 A;  2EV0 A;  3E97 A;  4EM1 A;  2DYS H;  2LNB A;  4L0Y B;  1TNT A;  4I7H A;  2BY1 A;  4RS8 A;  2DXI A;  2W84 A;  5E3N A;  5EEA A;  1X58 A;  2EH3 A;  2P0W A;  2UXN A;  2VJJ A;  4AYB N;  1ZRE A;  2JQ7 A;  3ZPL A;  1WJE A;  5F1R A;  4HA8 A;  2HYG D;  1Y0N A;  2F4I A;  2IVM A;  1WKM A;  2KRC A;  1MDM B;  3WGI A;  3H0D A;  2WAQ A;  3TOB A;  2XGE A;  2W48 A;  1X1C A;  1JUM A;  4E7J A;  2CUE A;  2RGV A;  3M1E A;  3ZQI A;  4RDU A;  3BG3 A;  3G71 I;  2GA2 A;  4A3F J;  4JK1 X;  4DYC A;  4A3B J;  2EBI A;  4Y15 A;  2ZFW A;  2BXY A;  4PJL A;  3VEP A;  1A31 A;  2R93 J;  1N75 A;  1ERD A;  3DXJ F;  1FOX A;  1DPR A;  3GO5 A;  3LSH A;  2CQX A;  4IOC F;  2L7K A;  3K4J A;  3C1D A;  3FHZ A;  3QQA A;  2ZJR F;  3DBR B;  4AD9 A;  1YE9 A;  2WA0 A;  2XHK A;  2YX7 A;  4A3C J;  3U9G A;  2VBY A;  5B5E C;  2IA2 A;  1WSU A;  1W5S A;  4Q4Z F;  2AXL A;  2EWN A;  2HTS A;  2EJR A;  2E1M B;  3GXO A;  1F36 A;  4M73 A;  2CJJ A;  4AU7 A;  3KIO A;  4BXX J;  3FXM A;  1BJA A;  3HOZ J;  2ZXH A;  2IGN A;  4FTH A;  2JT1 A;  4LG3 A;  2BEO A;  1Z7L A;  2VQC A;  4UV8 A;  1I39 A;  3D5S C;  4BY1 J;  2B63 J;  2JA7 J;  3GTQ J;  1UEL B;  5C4J J;  2HZT A;  4CIC A;  2ECB A;  3I4P A;  2V26 A;  3IH2 A;  3F6O A;  2VOD A;  2ZNZ A;  3C18 A;  5ILU A;  1BL0 A;  4CCJ A;  1TQI A;  4HX8 A;  4F92 B;  2RRE A;  2YPR A;  4XIC A;  2QM3 A;  4XNF A;  3V8J A;  3VYS B;  3K6G A;  5EJC A;  5A2Q Z;  2JPB A;  1DP7 P;  5D8L B;  4D5C A;  3WTV C;  3QP6 A;  3ABK H;  4A93 J;  1TWG J;  5LRR A;  5KVR A;  2LR8 A;  5F6F A;  1ZG1 A;  2V1U A;  3CUQ B;  1B59 A;  3LA3 A;  2E34 A;  2JRM A;  2P5V A;  2FE3 A;  1IC8 A;  1WHU A;  3DTE A;  2R5Y A;  3PIO F;  4E70 A;  4D1Q A;  3W6J B;  2QCO A;  4B1R A;  4C2U A;  1PUE E;  1JHH A;  4A5N A;  4BGD A;  4F55 A;  3OIQ A;  1T98 A;  3Q3S A;  4KYW A;  2ZSH B;  1KU7 A;  2EZK A;  3F8C A;  2OJE D;  3SYT A;  1XB4 A;  1PDN C;  2PQ8 A;  3HHG A;  1T08 B;  4GYG A;  3ECO A;  1T6S A;  4RB0 A;  1VTN C;  4JX5 A;  3I54 A;  1HOM A;  4FCY A;  3AL0 B;  2LRD A;  4F52 A;  1S3J A;  3RQ4 A;  5E20 A;  3J7Z I;  4L9J A;  3OSF A;  2HVQ A;  4IPA A;  1FEX A;  2BXZ A;  2A6H F;  5TGT A;  2R7V A;  2BYV E;  2RVC A;  1OCO H;  3QYF A;  2ZCW A;  4LK0 F;  4MIM A;  2XDV A;  2JVH A;  3M4O J;  3FXJ A;  5F04 A;  3GTL J;  3WGG A;  3DFG A;  1VQK I;  1WH7 A;  2JUG A;  4RAF A;  4KN7 X;  4M9X A;  1K4S A;  1WI3 A;  4P5O A;  2EB7 A;  2L4A A;  1LQ1 A;  1HST A;  3BTI A;  1ZLJ A;  1LVA A;  1ZEL A;  3TMO A;  3D5L A;  1LNW A;  3TDU C;  3I56 I;  1G3S A;  3L7W A;  5J1R A;  3W2V A;  2LMD A;  2CWE A;  3K2Z A;  2ME6 A;  3BCA A;  4EVI A;  2EQR A;  4B3A A;  1EH7 A;  4Q48 A;  3CCV I;  2Q0O A;  1H88 C;  2HDW A;  1MMS A;  5K5O A;  4AYB A;  2ZC2 A;  1UFM A;  5CVI A;  4NB5 A;  1D5V A;  2RDP A;  2ZSI B;  4BHP A;  4U7B A;  1ZGJ A;  3PNT A;  1HA8 A;  3OYG A;  5JFR A;  2HU9 A;  4A3L J;  5L3D A;  1HW2 A;  4E7K A;  4LGW A;  2O3F A;  1FTZ A;  1P6R A;  1W4M A;  2L02 A;  2DW4 A;  1K78 B;  1LDJ A;  2DFI A;  3PFY A;  2FU4 A;  2CV1 A;  2BY3 A;  2KL4 A;  1U9N A;  4UUV A;  1CQT A;  3AFH A;  2V1N A;  2UUZ A;  1FP1 D;  3A0B C;  3FXU A;  1FZP B;  2H94 A;  3LSG A;  2ADU A;  2W24 A;  2JTV A;  4E7S A;  2KJB A;  4BH9 A;  5BPI A;  2JVG A;  1OPC A;  2CS3 A;  3V8L A;  3WHB A;  1R5I D;  2LLK A;  5F1J A;  1QQI A;  2BZT A;  1MBJ A;  3H3U A;  5M5Y J;  2QVO A;  2IA0 A;  2DA7 A;  2HOT A;  1WRJ A;  3MKL A;  1KQ0 A;  4EM2 A;  2NNN A;  4QTR A;  2PEX A;  3DU6 A;  1H89 C;  2R5Z A;  2DMP A;  2DJI A;  3CLO A;  2KIQ A;  1KZH A;  3ULQ B;  3U21 A;  2A6E F;  4XID A;  2CH0 A;  2I10 A;  4U7D A;  2E35 A;  3HC7 A;  5HLI A;  1IN6 A;  2F5D A;  4S04 A;  1LE8 B;  5HDK A;  3CLQ A;  4KIC A;  4Y52 J;  2DFH A;  3GUD A;  3ZR8 X;  3RZO J;  5FGM A;  1VQ7 I;  1K61 A;  1YTY A;  1QZZ A;  5DCM A;  1HQC A;  2FNA A;  1D1A A;  4PJ0 C;  3REO A;  5E3M A;  5HS8 A;  3M8E A;  2VT3 A;  5DM7 F;  5K7Z A;  3GX4 X;  4I2O A;  1V5E A;  3HHH A;  3IL2 A;  5F0H A;  4RLF A;  3KE2 A;  1KU9 A;  1B72 B;  3DP7 A;  3H5N A;  5E1X A;  3FKI J;  5IYB J;  2M0M A;  1W0T A;  3K4C A;  2HQ5 A;  2M34 A;  3TP3 A;  3BZC A;  2VB6 A;  1U5T C;  1TT5 B;  3HXL A;  4DW6 A;  4OMY A;  2P5L C;  2ID3 A;  2VQG A;  3WU0 A;  3EUH C;  2M7A A;  2EA4 A;  3GZ5 A;  2ISZ A;  2R7O A;  2MG4 A;  3HSF A;  3KZI C;  2XRO A;  1DGR M;  2BW3 B;  5JVT A;  4F3Q A;  2CV2 A;  1M1E B;  1X2N A;  2O5R A;  2D1V A;  4MQV A;  2GLO A;  1QO0 D;  2JA8 J;  2ZJP F;  1SFK A;  2GBY A;  3MKZ A;  5HLH A;  2EZI A;  1B8I A;  3R4K A;  2A61 A;  3AKZ A;  2HZD A;  1Z6T A;  1IW7 F;  2GXA A;  2M1B A;  3S1M J;  1UG2 A;  1VQM I;  1OCZ H;  2X51 A;  3ZQG A;  2CFX A;  1TTY A;  2M87 A;  2WTE A;  1TWC J;  1A6Q A;  3HTU A;  2KDO A;  4RGS A;  2FOK A;  1SFO J;  4YEL A;  1I1G A;  1UHM A;  2FRH A;  1OCR H;  1G2H A;  2R7Q A;  4NQW B;  4NHJ A;  5LEJ A;  2DAO A;  1S7A A;  2EFP A;  1HKQ A;  3L00 A;  3QOP A;  1B1B A;  4II2 A;  4UB8 C;  3B6A A;  5FKK A;  1FY7 A;  3FXQ A;  2E36 A;  5EG0 A;  4FX0 A;  1SD7 A;  5DCF A;  2H09 A;  4ON0 A;  4BY7 J;  3SZP A;  2DMT A;  4ESJ A;  3FMQ A;  4IHY A;  2BHZ A;  2XIG A;  2XPU A;  4DBQ A;  2DLL A;  2KZG A;  3CCL I;  2H1K A;  2XAJ A;  2WB1 A;  1ZAO A;  2NS8 A;  1D0Y A;  4O6J A;  1XGS A;  2R4G A;  2RQQ A;  2GIZ A;  3HL2 A;  4A3M J;  2FQ3 A;  1RI7 A;  2XF5 A;  3LMM A;  2M4K A;  5CLS A;  1TZL A;  4ZYA A;  5HDG A;  5LGU A;  4XSX F;  1I1S A;  4NNJ A;  1XN7 A;  1W0U A;  3OR2 C;  3MCZ A;  1ZRF A;  3I53 A;  2KLO A;  2HOE A;  1JJ6 C;  1YX3 A;  3SZT A;  4EJW A;  1QA6 A;  4R79 A;  5J40 A;  4C2T A;  2J5O A;  1W1W E;  4BQN A;  1R58 A;  3GFI A;  2LC2 A;  5B1B H;  1LFB A;  3RJP A;  4P1W A;  5K7H A;  3ERM A;  4BEH B;  2A5Y B;  4UB6 C;  4XM3 A;  1MJA A;  4BBS J;  3PNV A;  2L9V A;  2NAZ A;  3K1P A;  4QIW N;  3L2U A;  4JBA A;  2XGX A;  2JUC A;  3LFU A;  2Y75 A;  3KET A;  5IT9 Z;  1JXS A;  3TO6 A;  3HUG B;  1YRN B;  2HI3 A;  2HDD A;  3F3X A;  4KUM A;  3PO3 J;  3DU5 A;  4A3G J;  3AG1 H;  2D2W A;  4PCQ A;  5BQT A;  2QSG X;  4L18 B;  2DT5 A;  2HGC A;  1RES A;  1V55 H;  3V7C A;  2Z9O A;  4M9S A;  2AS5 F;  4I98 B;  2BY0 A;  5FD5 A;  2ZFU A;  1KU3 A;  3DKW A;  3K9T A;  3HOW J;  1OKR A;  3DPT A;  3W2W A;  3BQY A;  1PJR A;  1F43 A;  2Z2S B;  1JJ8 C;  2FBK A;  2LY9 A;  3N05 A;  2A68 F;  1OYI A;  1H9G A;  2XV4 S;  3DTK A;  2PJR A;  2O8K A;  2XGC A;  5J8C A;  3HG9 A;  1VND A;  2O9L A;  2DPU A;  3GF2 A;  3KX2 A;  3LAJ A;  4OWR B;  5FKO A;  3RSN A;  4EJT A;  2E60 A;  2WBM A;  2R7F A;  1BIB A;  2KKO A;  4MO7 A;  2RNJ A;  2YS9 A;  1RUN A;  2IXS A;  4D7M A;  3COA C;  1BI1 A;  4Y13 A;  4KT5 C;  4Y33 A;  1FIP A;  3PM1 A;  4M6V A;  4LD5 A;  2LOO A;  2DOD A;  1EF4 A;  2XUB A;  3RPU A;  2R7Z J;  4OMZ A;  4DJA A;  1EA3 A;  4G12 A;  1FNN A;  3T8R A;  1RZ4 A;  2V9K A;  4BYY A;  3VPR A;  3PQJ A;  1T0F A;  5DUI A;  2QQB A;  3HEF A;  3TOA A;  2XF6 A;  1TWH J;  2DK5 A;  3RPQ A;  1XMK A;  3HGY A;  1RR8 C;  4U0Y A;  2E2I J;  2CUJ A;  2XAF A;  3HJE A;  4L5I A;  3JSP A;  5CQG A;  1Z77 A;  4I0A A;  1MMG A;  3LAP A;  2XPV A;  4B44 A;  4UNO A;  1LB2 A;  1ORK A;  3PO2 J;  2VT2 A;  3E6B A;  2DMQ A;  3ZMT A;  2KIU A;  1RKT A;  2VQL A;  1T2K A;  1DQU A;  3ZMV A;  2STW A;  1SVM A;  4PJN A;  1MJB A;  1XTA A;  5HS7 A;  4M71 A;  1IN5 A;  5GPC A;  4FE7 A;  3L09 A;  1DGW Y;  3TBI A;  2L0K A;  2DDB A;  4I09 A;  1WJ5 A;  5L3E A;  1B9N A;  1R1U A;  3NQO A;  2X6O A;  4XLP F;  2EV6 A;  1GDT A;  3S3O A;  4HBL A;  4ESF A;  2VBW A;  4XLA A;  2L9R A;  1Y6I A;  1ZQ3 P;  5L3F A;  5CPR B;  3HRT A;  1RNL A;  2K4B A;  1WVR A;  5EGO B;  3CCU I;  3QRF F;  5FB2 A;  4ZTJ A;  1YS6 A;  3B02 A;  1NG6 A;  3G1L A;  1VQ9 I;  2DU9 A;  1MDM A;  2F2E A;  2W4S A;  3UKG A;  4OOI A;  3BCB A;  5CVU A;  4HOB A;  4YEJ A;  3GTK J;  5DD8 A;  1XD7 A;  3OYF A;  3BP8 A;  3WTX C;  5M5W J;  3GTJ J;  3H3V K;  3FHN A;  1R4M B;  3IP4 B;  4BKX A;  5E1W A;  3LWF A;  3SHF A;  6PAX A;  4E7Z A;  2LP0 A;  1ITY A;  1P4X A;  2OZU A;  4RMN A;  4HZF A;  1X3Z B;  4CCM A;  2Y0S A;  1TL8 A;  1XX5 A;  2FOW A;  1CGP A;  2K3P A;  3JRI A;  4PFO A;  3I59 B;  3ZQH A;  1BI2 A;  3IHU A;  1ENH A;  1MZB A;  3P5J A;  4CH7 A;  5HOO A;  4IJA A;  5HLT A;  2WC2 A;  3CCJ I;  2X1D A;  2MAB A;  2IS1 A;  1YYV A;  4CYD A;  3FMS A;  1QRY A;  2E2H J;  2CMP A;  5LGN A;  4ABZ A;  3OS1 A;  1N25 A;  2NS0 A;  2UXX A;  2KZV A;  2DA2 A;  3IRR A;  3F23 A;  1ZG5 A;  4XOR A;  3FXK A;  4XL9 A;  2P6S A;  3ERE D;  2CRG A;  1G6N A;  1IGN A;  2LY1 A;  2RC4 A;  4IHS A;  3GTO J;  1HSJ A;  1FBS A;  3GWZ A;  4BQA A;  2QSH X;  3H36 A;  3W3C A;  1A35 A;  2ELJ A;  5ICE A;  4ASN A;  1LEB A;  3EDP A;  1W7P B;  4C3J J;  4KFC A;  4GGG A;  2OBP A;  3ROU A;  2MLK A;  4PGH A;  4D7N A;  2DBB A;  2N8G A;  2HPM A;  1XSX A;  2HYF A;  2LK2 A;  1RRJ A;  2H1L A;  2NOJ B;  1ZR4 A;  3A2K A;  3JCU C;  2STT A;  1STZ A;  4XRS A;  4ZH4 F;  1WZ2 A;  4L9V A;  4OIN F;  1UMQ A;  5ICF A;  3CF2 A;  3LSI A;  3CUQ A;  3BY6 A;  1W7P D;  3NAR A;  2W00 A;  3HOY J;  4ENM A;  1S8N A;  1FT9 A;  2K85 A;  1JTX A;  1F5T A;  4HX4 A;  1YW9 A;  2LF7 A;  3CJQ B;  2LFB A;  3ZCO A;  1AWC A;  1LPQ A;  1G8X A;  4B48 A;  1IXS B;  1ULY A;  1SAX A;  2NVQ J;  1NK2 P;  2FBI A;  2CW8 A;  1T39 A;  2VLA A;  2GM4 A;  1V3F A;  5EZG A;  2Z33 A;  3CCE I;  4YIF A;  3CCQ I;  2EPF A;  5FLM J;  4KMF A;  3R0J A;  4UVA A;  1XDU A;  1GVJ A;  4CCO A;  3BR5 A;  4JX6 A;  4HNV A;  3WTT C;  4A5M A;  2JMW A;  5D6F A;  5DV5 A;  2PBI A;  4A3I J;  1O3S A;  2HQA A;  2H27 A;  4C3H J;  1Y8R B;  3GCM A;  2ECC A;  2BY2 A;  4BS9 A;  2NVY J;  4KIB A;  2EIJ H;  2W82 A;  2Y2Z A;  2L9N A;  1TWF J;  1WQ2 A;  3IKV A;  1W36 D;  4BU2 A;  3O8H A;  2TDX A;  2DYR H;  4P9U A;  3Q0V A;  4PDK A;  3LQR A;  2YU3 A;  4XOP A;  4G7Z F;  4IHT A;  1FMV A;  5ICG A;  4UY8 I;  1QU3 A;  3OMY A;  2K3F A;  3V4G A;  1D1C A;  2GOM A;  3HGG A;  3ZQF A;  1S29 A;  3J81 Z;  2ELK A;  1S7O A;  1IXC A;  2V7F A; 
#chains in the Genus database with same CATH homology
 2IPQ X;  3E6M A;  4ENN A;  3L9F A;  2Z3Y A;  5JI6 A;  1HW1 A;  3H3Z A;  2CQK A;  4LFU A;  3Q9V A;  4A6E A;  5H6R A;  1K78 A;  1FBQ A;  3ZMZ A;  4HDU A;  1QGP A;  2IP2 A;  2Y48 A;  4B09 A;  1XSV A;  1HBX G;  2MC3 A;  2IA1 A;  4XSZ F;  1RUO A;  2RN7 A;  3EET A;  1FYM A;  1R36 A;  3CTA A;  1Y0U A;  3KCC A;  1F1Z A;  3VFZ A;  1D8K A;  1FC3 A;  3MQ0 A;  2A07 F;  2O03 A;  4HQM A;  1LDD A;  4UVB A;  3HTS B;  3WG9 A;  4U88 A;  5K5R A;  1BM9 A;  5DYM A;  2ZXJ A;  3WTU C;  3EQL F;  4AIH A;  4N0B A;  2PN6 A;  3GW2 A;  1UST A;  2X4H A;  2P4W A;  3WGH A;  5CVJ A;  3JSO A;  1K7A A;  3IRQ A;  4UHT A;  4EJO A;  3F21 A;  4L9N A;  3HSE A;  5CYV A;  1XGO A;  3J80 Z;  3RKY A;  1TBX A;  3ZN1 A;  1YS7 A;  3IWZ A;  3MAJ A;  3BWG A;  4TV7 A;  1FX7 A;  2QZ8 A;  3KZY A;  1D8J A;  4D0P A;  4L5J A;  4ZYD A;  4RGR A;  5BMZ A;  2GXG A;  2KRF A;  4RGX A;  4KIG A;  5FD6 A;  4OIO F;  1B9M A;  1SD4 A;  4K2E A;  3DQV C;  2DQL A;  1J5Y A;  3KP3 A;  4G94 A;  4HX7 A;  1J9I A;  4NQW A;  4CDG A;  3IC7 A;  3ABU A;  1WI9 A;  2G7U A;  2GXB A;  4ZYG A;  4HF2 A;  2NYX A;  2Y0M A;  2OU2 A;  1Z1D A;  3Q9S A;  1H0M A;  1OMI A;  3OOP A;  5D8K B;  1KGS A;  4PGG A;  3QPT A;  5D6E A;  1XGM A;  3ZMS A;  5HDN A;  3PFI A;  1IN8 A;  1TQP A;  3F8M A;  3E5U A;  3RKX A;  2ZNY A;  1ZGA A;  2L4M A;  2F5C A;  4BXU A;  2OD5 A;  3ZN0 A;  5ERI A;  3HOS A;  3VB2 A;  2HWV A;  1J0R A;  1O7L A;  1G4D A;  3E3V A;  4MTE A;  3V7R A;  3BZ6 A;  3RYP A;  4LLG F;  5TJJ A;  5JHU A;  2DI3 A;  1MD0 A;  1XCV A;  3HUG A;  4OIP F;  5K1Y A;  2W25 A;  3F72 A;  3HOT A;  3CUQ C;  3TGN A;  3SFZ A;  1CF7 B;  2EFN A;  2O6G E;  2M45 A;  3BJA A;  5ILS A;  2Z5U A;  1RIO H;  3J81 K;  4BNC A;  3MEX A;  3K0L A;  4I01 A;  5FFZ A;  1TNS A;  4GO1 A;  2ACJ A;  4Q5S F;  3LA7 A;  2EK5 A;  2JSC A;  4WXH A;  4MTD A;  1SMT A;  2VE8 A;  4LG0 B;  3JTG A;  4WXD A;  1ON1 A;  3R60 A;  2EA2 A;  2MH9 A;  2BGC A;  3BJ6 A;  3TKY A;  4KA4 A;  1DPU A;  4RAY A;  3FM5 A;  5CJ9 A;  2HS5 A;  3DV8 A;  3CUO A;  3FZV A;  4RB2 C;  5A2Q K;  1V4R A;  1DDN A;  3N4M A;  1Z05 A;  1ODD A;  1GHC A;  5K5Q A;  5HS9 A;  5KK1 A;  3H92 A;  4HLX A;  1FOK A;  2CG4 A;  4RB1 A;  1REP C;  2QQA A;  4BHC A;  2FXA A;  3V8K A;  5LGT A;  3RYR A;  2GA1 A;  2O61 A;  4YII A;  2FA5 A;  4UV9 A;  3G3Z A;  2ELH A;  4GYI A;  1TW3 A;  5AIQ A;  2L3D A;  2PJP A;  1FSE A;  2VON A;  1YIO A;  3DPL C;  2H6C A;  4N9H A;  2Z99 A;  3WOD F;  5FO5 A;  1SD5 A;  3I59 A;  4HYE A;  1KYZ A;  3K1M A;  3GFJ A;  4U0V A;  5ICC A;  1JGS A;  2MD5 A;  1YW7 A;  5EEH A;  2L01 A;  3GLX A;  1KA8 A;  1YG2 A;  1W7P A;  1YQA A;  2QBY B;  1TQM A;  5J6X A;  1YO5 C;  2XRN A;  4M6Y A;  5D4S A;  1ZN2 A;  3E5Q A;  1TLH B;  1O3Q A;  4EM0 B;  1R5G A;  4P96 A;  4KNY A;  3WTY C;  2NNY A;  1ZG3 A;  5BS6 A;  4LJZ F;  2E1C A;  1J7K A;  2PMH A;  4U0W A;  1QZY A;  4BHB A;  1OR7 A;  2P7C B;  1P2F A;  3FM3 A;  2CYY A;  2DTR A;  1J2X A;  1JHF A;  4EV0 A;  3T1B A;  2QLZ A;  2R3S A;  3CO7 C;  2OQG A;  4N9I A;  1R23 A;  1Z9C A;  5DDG A;  1KU2 A;  4IRH A;  2DPD A;  4YG2 F;  1KQ9 A;  1DUX C;  5D5U B;  2O0Y A;  3ZMD A;  4HAM A;  5E8G A;  4CO8 A;  2E7W A;  2LF8 A;  2FNP A;  2D1H A;  2XAH A;  2X0L A;  2E1N A;  1AOY A;  1IRF A;  2VBX A;  4XRF A;  1L3L A;  1UCR A;  2E7X A;  2O8X A;  2UZK A;  5ILV A;  3I5U A;  2HTJ A;  1E17 A;  3RDI A;  3QU3 A;  1ZAR A;  3ELK A;  1J59 A;  2R7D A;  1KYW A;  3ABT A;  4EGY A;  4P55 A;  4KN4 X;  2GZW A;  1IRG A;  1U2W A;  3M8F A;  5AON A;  4O5V A;  5L3B A;  4A6D A;  5D4R A;  3P9K A;  2K02 A;  3DEU A;  2RQP A;  1E2X A;  4MEY F;  1ZRC A;  2MH2 A;  3BOQ A;  1W5T A;  1HW5 A;  3R6S A;  1SMY F;  4YFN F;  2UWM A;  3GVA A;  4OIR F;  3QPH A;  4I0B A;  2V1X A;  4ZZD A;  3I58 A;  4Y17 A;  5LLQ A;  2XKO A;  1BOA A;  2HEO A;  3T5X A;  4YFK F;  1SFE A;  4ENK A;  1R1T A;  2XAS A;  2MLG A;  2HQN A;  4ZZL A;  1PP7 U;  3GEZ A;  5L3G A;  5AIP A;  2FML A;  2M5W A;  2LSO A;  2F5E A;  1FPQ A;  4WK8 F;  5CVV A;  3R61 A;  4ENJ A;  1QNT A;  2VOO A;  1ZRD A;  3K1N A;  4EJV A;  2PFB A;  3KZZ A;  1IZ1 A;  3KLN A;  2RKH A;  5FLX Z;  2RV8 A;  1IF1 A;  1I6X A;  1OYY A;  5IT9 K;  4AVP A;  1O3R A;  2ZME B;  2FMY A;  2IW5 A;  1LJ9 A;  2ESH A;  2ZJ2 A;  1T38 A;  1U8R A;  3GZ6 A;  2XAG A;  3F8B A;  2PG4 A;  3KP2 A;  5EEG A;  4O3M A;  4DNC A;  3I64 A;  3ISP A;  3U1D A;  5H20 A;  5BPD A;  3VOE A;  3NEU A;  4M74 A;  4XLN F;  4G6Q A;  3M9A A;  3KEQ A;  1SD6 A;  2JPC A;  3V7S A;  5ED4 A;  1L0O C;  4HQE A;  2IRF G;  2ZO4 A;  1S6L A;  1FWZ A;  4FX4 A;  2YR2 A;  1BI3 A;  2FBH A;  1XMA A;  2IJL A;  1LEA A;  4BAY A;  2EFW A;  2K27 A;  4HDV A;  4Q47 A;  4LB5 A;  1D3Y A;  2VBZ A;  1YLF A;  2HQR A;  3N97 A;  4M72 A;  3KEO A;  3HRS A;  4ZYH A;  5D5V B;  2V6C A;  4WXC A;  2CGP A;  4G7O F;  5CVR A;  4MHG A;  2CW0 F;  4UVC A;  3O6B B;  1O3T A;  4Z2Y A;  3BPX A;  2W57 A;  4MGR A;  2DO7 A;  2XAQ A;  1U78 A;  1HXD A;  1EH8 A;  5JR3 A;  4LLN A;  5F64 A;  4GCV A;  2YSR A;  2MBF A;  3T8T A;  1MKM A;  5D5W B;  5FFX A;  3AAF A;  5E17 F;  3LA2 A;  1U5T B;  2HFH A;  4FT8 A;  1CF7 A;  4FHT A;  4AIK A;  1EH6 A;  1HKS A;  3KP6 A;  3EYI A;  1FYL A;  5DEQ A;  4P9F A;  4S05 A;  2FSW A;  4QWQ A;  3WTW C;  3FX3 A;  4LG0 A;  3KP4 A;  4AIJ A;  2QWW A;  3VOD A;  4XBF A;  3JAM Z;  3HIF A;  4DQ2 A;  1Z91 A;  4LMY A;  2YX4 A;  1Z7U A;  5E8I A;  1U6G A;  5E18 F;  1FLI A;  2ESN A;  2LKP A;  4MEX F;  1F4K A;  1XSD A;  1P4W A;  2K86 A;  1A04 A;  1G3T A;  3KLO A;  1B6A A;  1F9N A;  5HLG A;  1K6O A;  1C0W A;  1X3U A;  4A2U A;  2DQR A;  4CZZ A;  4EMS A;  2OZ6 A;  4RAZ A;  3KP5 A;  3B73 A;  4M6X A;  1R1V A;  1IUY A;  3LFK A;  4L9T A;  3SXY A;  1IXR C;  1LDK B;  2QUF A;  2PI0 A;  1OYW A;  3FMR A;  5FLX K;  2GWR A;  3WTZ A;  1BI0 A;  1P92 A;  4HV5 A;  3EYY A;  2HKX A;  4IRG A;  1YW8 A;  4M9Z A;  3QU6 A;  1K79 A;  5LHG A;  2OQR A;  3F8N A;  1HKT A;  4WWC A;  2HKO A;  4A0Y A;  1O57 A;  1NHA A;  1BC8 C;  3D0S A;  1G3W A;  3CJN A;  4CGZ A;  4R8H A;  3FWE A;  1EV7 A;  1R5H A;  5H6Q A;  4IVN A;  3HRU A;  5LHH A;  3CO6 C;  3KP7 A;  2WV0 A;  2MA3 A;  3LQQ A;  4L0Z B;  2OA4 A;  2QBY A;  2EFQ A;  2QQ9 A;  5HVQ C;  2BE5 F;  1TW2 A;  1O7F A;  4YFX F;  3ZP5 A;  2P8T A;  3F22 A;  2D45 A;  3Q5F A;  1XDS A;  3S2W A;  3RTR A;  3FXR A;  2NRA C;  3J7A O;  2V1D A;  1YFH A;  2P6T A;  2FEZ A;  3ZQ7 A;  2M8E A;  1B4A A;  3RI4 A;  3G73 A;  3K69 A;  3L2C A;  2VC1 A;  1WWX A;  4HF0 A;  3BPV A;  5LRS A;  2Q2E A;  3KFW X;  3O3K A;  4A12 A;  2K4J A;  3E5X A;  4IF4 A;  2CSO A;  4WF2 A;  3HSR A;  2VN2 A;  5LHI A;  1QBJ A;  3GFL A;  3P7N A;  4GXO A;  2XKP A;  3MFK A;  4IRI A;  1Q1H A;  3J80 K;  1GXQ A;  1QPM A;  4G8X A;  4KIF A;  2ZBK A;  3GYH X;  3PQK A;  3FF5 A;  2PMU A;  3WE2 A;  2COM A;  2ZKZ A;  3DF8 A;  2LDU A;  3ZMU A;  3RIR A;  4OIQ F;  2Q8K A;  4ESB A;  2P5K A;  3M7G A;  3JAM K;  3I71 A;  5DCM B;  1ZHF A;  3MZH A;  3ML6 A;  3P9I A;  2G7H A;  3WE3 A;  4F7Z A;  2P7V B;  4MNU A;  4LLL A;  2VC0 A;  3TO7 A;  1ONV A;  3BJO A;  2KIM A;  4AWX B;  2B0L A;  1BC7 C;  1ZLK A;  1R22 A;  2GQQ A;  4WX9 A;  2HR3 A;  3P9C A;  1USS A;  4MQ9 F;  2A69 F;  4A0Z A;  2VOP A;  3BRO A;  4JQF A;  3ECH A;  1ZYR F;  1PP8 F;  2GAU A;  2WWY A;  4R1H A;  1I27 A;  3TDZ C;  1U3E M;  2ISY A;  4LB6 B;  3WU1 B;  1ON2 A;  1G3Y A;  2PLY A;  4QLC U;  1FBU A;  1FSH A;  4RB3 C;  4ZYE A;  1XCB A;  1SFU A;  3HYI A;  2ETH A;  5E1Z B;  2FF4 A;  3TO9 A;  2QEN A;  1MGT A;  3C7J A;  2BBY A;  1KQ8 A;  3SQN A;  2JRT A;  1IN7 A;  2XVC A;  3QP5 A;  2ZME A;  4HF1 A;  2HDC A;  3F6V A;  3JTH A;  1BIA A;  2A3S A;  3C3W A;  3T0Y A;  4CHU A;  1JE8 A;  4G9Y A;  3IKT A;  3MWM A;  1BBY A;  5TRD A;  4G7H F;  5DUK A;  1XGN A;  5L3C A;  3E6C C;  4CXF A;  2BV6 A;  5LBQ A;  3F8F A;  4H0E A;  3CDH A;  3W6K B;  4A0X A;  4WCG A;  4G6D A;  2OAZ A;  5DD4 A;  3HRM A;  1R7J A;  2DK8 A;  5BOX A;  3BDD A;  2M30 A;  3E6D A;  4EGZ A;  2V79 A;  2L54 A;  3R0A A;  3GFM A;  2GIV A;  1BN5 A;  1GXP A;  5J8F A;  2IT0 A;  3RKW A;  4KMU X;  2VXZ A;  4OU0 A;  3I0T A;  2CO5 A;  4HW0 A;  2V9V A;  4UXN A;  1ZH5 A;  2H6B A;  3NRV A;  1FP2 A;  3O2P E;  2VE9 A;  1MJ9 A;  4LK1 F;  1J75 A;  1IAW A;  2KJC A;  4HV6 A;  1UB9 A;  2G9W A;  3MZY A;  2EFO A;  2EV5 A;  3LST A;  2W85 A;  3QAH A;  4IXA A;  4RGU A;  2C6Y A;  1FYK A;  5IT3 A;  4EJU A;  1Z6R A;  3IWF A;  3TQN A;  4KDP A;  2F5F A;  4ETS A;  2J5P A;  1H9T A;  4B8X A;  4I02 A;  1UHW A;  2K7L A;  4EQQ A;  1U5T A;  3WTS C;  1SFX A;  3U2R A;  2QYO A;  1R00 A;  3EUH A;  3JW4 A;  4HLY A;  4PZJ A;  3OV8 A;  2KIF A;  1IN4 A;  1I5Z A;  2JZY A;  5D5X B;  5LEK A;  1P4A A;  2EV0 A;  3E97 A;  4EM1 A;  2LNB A;  4L0Y B;  1TNT A;  4I7H A;  4RS8 A;  2W84 A;  2UXN A;  1ZRE A;  3ZPL A;  5F1R A;  4HA8 A;  2HYG D;  2IVM A;  1WKM A;  1MDM B;  3WGI A;  3TOB A;  2RGV A;  3M1E A;  2GA2 A;  4JK1 X;  4Y15 A;  2ZFW A;  3VEP A;  3DXJ F;  1DPR A;  3GO5 A;  3FHZ A;  3C1D A;  4AD9 A;  2XHK A;  2YX7 A;  3U9G A;  2VBY A;  2IA2 A;  1WSU A;  1W5S A;  4Q4Z F;  2AXL A;  2EWN A;  2HTS A;  2EJR A;  3GXO A;  4M73 A;  1BJA A;  2JT1 A;  2BEO A;  4UV8 A;  2HZT A;  4CIC A;  3I4P A;  3F6O A;  2VOD A;  2ZNZ A;  3C18 A;  5ILU A;  1TQI A;  4HX8 A;  2YPR A;  2QM3 A;  3V8J A;  5A2Q Z;  2JPB A;  1DP7 P;  5D8L B;  3WTV C;  3QP6 A;  5LRR A;  5KVR A;  1ZG1 A;  5F6F A;  2V1U A;  3CUQ B;  1B59 A;  3LA3 A;  2P5V A;  2FE3 A;  4E70 A;  3W6J B;  1PUE E;  1JHH A;  4A5N A;  1T98 A;  4KYW A;  1KU7 A;  3F8C A;  1XB4 A;  1PDN C;  2PQ8 A;  3HHG A;  4GYG A;  4RB0 A;  3ECO A;  1T6S A;  1VTN C;  3I54 A;  1S3J A;  5E20 A;  4L9J A;  4IPA A;  2A6H F;  2BYV E;  2RVC A;  2ZCW A;  4LK0 F;  3WGG A;  3DFG A;  4KN7 X;  4M9X A;  4P5O A;  2EB7 A;  2L4A A;  1LQ1 A;  1HST A;  1ZLJ A;  1LVA A;  3D5L A;  1LNW A;  3TDU C;  1G3S A;  3L7W A;  2CWE A;  3K2Z A;  4EVI A;  1EH7 A;  4Q48 A;  2Q0O A;  5K5O A;  1UFM A;  5CVI A;  4NB5 A;  1D5V A;  2RDP A;  4BHP A;  4U7B A;  1ZGJ A;  5JFR A;  5L3D A;  1HW2 A;  4LGW A;  2O3F A;  1P6R A;  1W4M A;  2L02 A;  2DW4 A;  1K78 B;  1LDJ A;  2DFI A;  2FU4 A;  4UUV A;  1FP1 D;  3FXU A;  1FZP B;  2H94 A;  2ADU A;  2W24 A;  2JTV A;  2KJB A;  4BH9 A;  5BPI A;  1OPC A;  3V8L A;  1QQI A;  3H3U A;  2QVO A;  2IA0 A;  1WRJ A;  1KQ0 A;  4EM2 A;  2NNN A;  2PEX A;  3CLO A;  3ULQ B;  2A6E F;  4U7D A;  5HLI A;  1IN6 A;  2F5D A;  4S04 A;  5HDK A;  4KIC A;  3GUD A;  5FGM A;  1YTY A;  1QZZ A;  5DCM A;  1HQC A;  2FNA A;  3REO A;  5HS8 A;  3M8E A;  2VT3 A;  3GX4 X;  4I2O A;  3HHH A;  3IL2 A;  3KE2 A;  1KU9 A;  3DP7 A;  5E1X A;  1U5T C;  4OMY A;  2P5L C;  3WU0 A;  2ISZ A;  2EA4 A;  3GZ5 A;  3HSF A;  2XRO A;  5JVT A;  2D1V A;  4MQV A;  1QO0 D;  5HLH A;  3R4K A;  2A61 A;  1Z6T A;  1IW7 F;  2M1B A;  2CFX A;  1TTY A;  2M87 A;  2WTE A;  3HTU A;  4RGS A;  2FOK A;  1I1G A;  1UHM A;  2FRH A;  4NHJ A;  5LEJ A;  2DAO A;  1S7A A;  2EFP A;  1HKQ A;  3L00 A;  3QOP A;  1B1B A;  1FY7 A;  3FXQ A;  4FX0 A;  1SD7 A;  5DCF A;  2H09 A;  4ON0 A;  3SZP A;  4ESJ A;  3FMQ A;  2XIG A;  2DLL A;  2XAJ A;  1ZAO A;  4O6J A;  1XGS A;  2FQ3 A;  1RI7 A;  5CLS A;  5LGU A;  5HDG A;  4XSX F;  1I1S A;  1XN7 A;  3MCZ A;  1ZRF A;  3I53 A;  2HOE A;  3SZT A;  4EJW A;  4R79 A;  2J5O A;  3GFI A;  1R58 A;  3RJP A;  2A5Y B;  1MJA A;  2NAZ A;  3K1P A;  4JBA A;  2XGX A;  1JXS A;  3KET A;  2Y75 A;  5IT9 Z;  3TO6 A;  3F3X A;  4KUM A;  2D2W A;  4PCQ A;  5BQT A;  4L18 B;  2DT5 A;  2HGC A;  3V7C A;  2Z9O A;  4M9S A;  2AS5 F;  4I98 B;  5FD5 A;  1KU3 A;  3DKW A;  3K9T A;  1OKR A;  3DPT A;  2FBK A;  2A68 F;  1OYI A;  1H9G A;  2XV4 S;  5J8C A;  2DPU A;  3GF2 A;  3LAJ A;  4EJT A;  2R7F A;  1BIB A;  2KKO A;  2RNJ A;  1RUN A;  3COA C;  4Y13 A;  1BI1 A;  4KT5 C;  4LD5 A;  2XUB A;  3RPU A;  4OMZ A;  3T8R A;  1FNN A;  1RZ4 A;  4BYY A;  3PQJ A;  1T0F A;  5DUI A;  2QQB A;  3TOA A;  2DK5 A;  3RPQ A;  1XMK A;  4U0Y A;  2XAF A;  4L5I A;  3JSP A;  4I0A A;  3LAP A;  4UNO A;  1LB2 A;  2VT2 A;  3E6B A;  3ZMT A;  2KIU A;  1T2K A;  3ZMV A;  2STW A;  1MJB A;  5HS7 A;  4M71 A;  1IN5 A;  3L09 A;  4I09 A;  5L3E A;  1B9N A;  1R1U A;  3NQO A;  4XLP F;  2EV6 A;  4HBL A;  4ESF A;  2VBW A;  5L3F A;  3HRT A;  1RNL A;  2K4B A;  3QRF F;  5FB2 A;  1YS6 A;  3B02 A;  2DU9 A;  1MDM A;  2F2E A;  4OOI A;  5CVU A;  4HOB A;  5DD8 A;  1XD7 A;  3BP8 A;  3WTX C;  5E1W A;  3LWF A;  3SHF A;  6PAX A;  1P4X A;  2OZU A;  4HZF A;  1CGP A;  3I59 B;  1BI2 A;  3IHU A;  1MZB A;  5HOO A;  4IJA A;  2WC2 A;  1YYV A;  4CYD A;  3FMS A;  5LGN A;  3F23 A;  2NS0 A;  2UXX A;  1ZG5 A;  3IRR A;  2P6S A;  3ERE D;  1G6N A;  2RC4 A;  4IHS A;  1HSJ A;  1FBS A;  3GWZ A;  4BQA A;  5ICE A;  4ASN A;  1LEB A;  3EDP A;  1W7P B;  4KFC A;  4GGG A;  2OBP A;  3ROU A;  2MLK A;  4PGH A;  2DBB A;  1XSX A;  2HYF A;  2STT A;  1STZ A;  4ZH4 F;  4L9V A;  4OIN F;  5ICF A;  3CUQ A;  3BY6 A;  1W7P D;  4ENM A;  1S8N A;  1FT9 A;  1F5T A;  4HX4 A;  1YW9 A;  2LF7 A;  1AWC A;  1IXS B;  1ULY A;  1SAX A;  2FBI A;  1T39 A;  1V3F A;  2Z33 A;  4YIF A;  4KMF A;  3R0J A;  4UVA A;  1XDU A;  1GVJ A;  3WTT C;  4A5M A;  5D6F A;  5DV5 A;  2PBI A;  1O3S A;  2H27 A;  4KIB A;  1WQ2 A;  3IKV A;  2TDX A;  4P9U A;  4PDK A;  3LQR A;  2YU3 A;  4G7Z F;  4IHT A;  5ICG A;  3V4G A;  1S29 A;  3J81 Z;  1S7O A;  1IXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...