1GXPA

Phob effector domain in complex with pho box dna.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
AVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tandem DNA Recognition by Two-Component Signal Transduction Transcriptional Activator Phob
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcriptional activator
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN
total genus 22
structure length 103
sequence length 103
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1gxpA00
3MCZA 2P4WA 5DD8A 5BQTA 2PMHA 1OR7A 4L18B 2K27A 1T39A 5ED4A 2EK5A 2GA1A 2QBYA 3ABTA 2E1NA 4KN7X 3HUGA 4MTEA 3E5UA 3BY6A 3TOAA 3LAJA 2Z99A 4TV7A 4CXFA 2HFHA 4EGZA 3WTUC 3L00A 1OYWA 3WGGA 2ZJ2A 3W6JB 1GXPA 2PJPA 3IHUA 2P7CB 5FB2A 3P7NA 1ZG3A 3WTVC 4RS8A 1Z1DA 3KZZA 2YPRA 1G3YA 1RIOH 3WTTC 3QP5A 5ILSA 2VONA 3HRUA 1FC3A 2MA3A 2PG4A 1Z7UA 4ZYGA 2EV0A 5J8CA 1OPCA 1H9TA 2M5WA 3HTUA 4LLNA 2VXZA 1KU9A 4S04A 3B73A 3T8TA 2XUBA 4CHUA 4XLNF 5ILUA 1UHMA 5BOXA 2OZ6A 1TQIA 1XSVA 2W57A 4BQAA 1KU2A 2A07F 4CICA 1K78B 3MWMA 1S3JA 2KRFA 2XAQA 5IT3A 2RDPA 3EYIA 4I0AA 1BOAA 1YW9A 3ZMZA 1XDSA 2UXXA 2LKPA 1F9NA 3H92A 1HSTA 4ZYEA 2DQRA 4ENMA 5E20A 2RQPA 4YIIA 5LGUA 2WWYA 2DPUA 4ESJA 1ON2A 1SMYF 3LWFA 4KIBA 3GWZA 2BV6A 4MHGA 2XRNA 1S8NA 2M8EA 3M8EA 1IN7A 1TQPA 4S05A 4EJVA 1J7KA 2VBZA 2LNBA 2FOKA 3VODA 1S7OA 4WCGA 1ZRDA 1XCBA 1T6SA 3VEPA 4L0YB 3WTWC 2K4JA 1SMTA 5DYMA 4HX7A 2EA4A 2V9VA 1BC7C 1R5GA 4CZZA 3GUDA 4E70A 5ICGA 5E1XA 1G3WA 5AIQA 1J59A 4KYWA 1R7JA 4IRIA 5AIPA 3RPQA 1T2KA 4HOBA 2L4MA 3DP7A 1R36A 3CO6C 4Y13A 4G8XA 4B8XA 3G3ZA 3E6MA 4I09A 2K7LA 2Q2EA 3I53A 3MZHA 1O57A 1O3RA 4HQMA 2H27A 3ZMVA 4EJWA 1Q1HA 3N4MA 1MGTA 1REPC 2LSOA 3HSEA 3M9AA 4EJUA 5D4SA 3C18A 3COAC 2IJLA 4MGRA 2A5YB 2IT0A 1B59A 1R00A 5JHUA 4MQVA 3VFZA 1TBXA 1UFMA 2Z5UA 3F72A 3JAMK 1TTYA 4IRGA 2J5PA 2ZKZA 3B02A 5H20A 4UV8A 2QBYB 2HKXA 2EA2A 2QQ9A 4KICA 1HKQA 4M9XA 2JSCA 2MLKA 1XGNA 3WE3A 2HR3A 2ISYA 2FE3A 3I59B 2ZO4A 4EMSA 4GGGA 5FD5A 2XAJA 2FMLA 3CUQA 2AXLA 2CWEA 2VC1A 2HTSA 3Q9VA 1I6XA 3F6OA 1R22A 3FHZA 5L3FA 1Y0UA 1YG2A 1ZN2A 2K86A 4Y17A 4M74A 4IPAA 5FLXZ 4HF2A 3QP6A 2LDUA 1P92A 2OU2A 4HDUA 3KP3A 1JGSA 4R79A 2O03A 3F8NA 5ICFA 1LEAA 1W7PD 4MQ9F 3ERED 4WXDA 2FXAA 3N97A 5K1YA 3WE2A 3LQQA 4LJZF 1D8KA 3REOA 2FF4A 2V79A 1O3TA 1XB4A 1ZGAA 3RKWA 1QBJA 1KQ8A 1ODDA 2DT5A 4BYYA 3I58A 4BHPA 1LJ9A 4AD9A 3L9FA 2ZBKA 4FX4A 4HF1A 4BH9A 4RGUA 4U88A 3ZN0A 2VOPA 4YFNF 5ILVA 2Y48A 4MEYF 4JK1X 3U2RA 5BPDA 3SQNA 2FMYA 4L9TA 2HWVA 5LEJA 4A0ZA 5CLSA 4IHTA 3HSRA 5HLGA 1KU7A 3GFIA 2UWMA 1XD7A 4MEXF 5DUIA 3BOQA 4CDGA 4A6DA 1SFXA 3CJNA 4B09A 4ENNA 3WGHA 1WWXA 2PBIA 1RZ4A 2D1HA 5CYVA 2JZYA 5D8KB 3RKXA 4I98B 4UUVA 2V6CA 4UHTA 3WG9A 5L3DA 1FYKA 2CFXA 1IRFA 5IT9Z 2V1UA 5FD6A 3L7WA 3LA2A 4G6QA 3HOSA 1RUOA 2E1CA 2HKOA 2DK5A 2VBYA 1B4AA 1IXRC 2D2WA 3C1DA 4RAZA 4WX9A 2YSRA 1CF7A 2WV0A 3ZMTA 3E5QA 1I1SA 2HEOA 3R6SA 3FM3A 4G9YA 2A69F 4HV5A 3F23A 1JHFA 2FA5A 4KN4X 1MJBA 4N9IA 1LDJA 4YFXF 4I2OA 1FP1D 2XGXA 3IWFA 2QENA 2VODA 5LGTA 2KKOA 2EFQA 3O6BB 3I64A 5EEHA 2LF7A 4KIGA 2GQQA 1BIAA 3J7AO 1BC8C 4HX4A 1HKTA 2GIVA 1ZLKA 1S6LA 3KP6A 3RKYA 1IXCA 3P9KA 1G6NA 3E6CC 3TO9A 4LLGF 4XLPF 3SZTA 4EVIA 2UXNA 2IA1A 4XBFA 2ZNZA 2CW0F 3W6KB 1W4MA 1P4AA 2OQRA 1J2XA 5BMZA 1P6RA 2CGPA 3RJPA 1XGSA 3GX4X 2XROA 2DTRA 2ADUA 5FFZA 3KP5A 1F5TA 4ETSA 1HQCA 5FLXK 4G7HF 4UVCA 3KFWX 3R0JA 1EH7A 4HA8A 3K69A 4IVNA 1PP7U 4GXOA 5TJJA 2Z33A 1USSA 2HGCA 1XSDA 2K4BA 3M7GA 4R8HA 3ZP5A 1VTNC 1R58A 2KJCA 3MFKA 4G7ZF 1P2FA 4HW0A 4P9UA 2QLZA 4EM0B 3TO6A 2L01A 3R0AA 1U3EM 2XASA 3SHFA 5HDKA 2PQ8A 1MJ9A 4OIPF 1KYWA 3WU1B 1LEBA 1FYLA 4NB5A 2P5VA 3ECHA 3FMRA 2BE5F 1F1ZA 1IN5A 3WODF 4ESBA 1I5ZA 3QPHA 2DPDA 1S29A 3WGIA 4HQEA 1RNLA 1ZREA 1Z05A 4P5OA 3OV8A 3CDHA 2QWWA 2VOOA 1ZG1A 3RYPA 4OIOF 4ON0A 1QZZA 2L54A 4QLCU 3F8CA 2ZMEA 1FOKA 4EV0A 5ICEA 2FNPA 2DQLA 1HXDA 2RN7A 2P5KA 1S7AA 4LG0A 1XGMA 4OMZA 2CSOA 4HF0A 3ML6A 4Q5SF 3PQKA 2GXGA 2IVMA 4CGZA 2STTA 1FZPB 1LDKB 1JE8A 2AS5F 3KLOA 4IRHA 1YW7A 3HRMA 3RPUA 1FY7A 2DLLA 3BJAA 5D5VB 2IA0A 2QVOA 3U1DA 4KMUX 5K5QA 1WSUA 2ACJA 1XMKA 2XKPA 1YO5C 4OU0A 3GFMA 1IN4A 4L9NA 1BIBA 2IPQX 2Q8KA 3FXQA 2OQGA 3P9IA 3IKVA 2VBXA 3R61A 2KIFA 2L3DA 2A6HF 3TDZC 1JXSA 1FBQA 1ZH5A 1ZLJA 3ZMDA 2A3SA 3D0SA 5LHIA 4L5IA 2E7WA 2Y75A 4OMYA 1IN8A 4AIHA 3IRRA 4KDPA 1XGOA 2FBHA 1V3FA 4EM1A 3IWZA 2BEOA 4RB0A 1B1BA 3BZ6A 3V7RA 2O6GE 1ZRCA 5D5WB 1P4XA 4LK0F 1ZARA 3V7SA 2F5EA 5DUKA 3ZQ7A 1XSXA 2OBPA 2CYYA 3LA7A 2QUFA 3BPVA 4A5NA 2EV6A 3HTSB 3D5LA 4MNUA 5K5OA 2H6BA 4A0YA 3L2CA 1GXQA 1FX7A 2HZTA 4MTDA 3CUQC 1K78A 2P6SA 2HS5A 4PZJA 2HOEA 4NHJA 3IKTA 3VOEA 1YLFA 3V8KA 3ABUA 2W84A 3JSPA 3WTYC 2F5FA 1FLIA 1BI3A 2MD5A 3E6DA 4YG2F 2XHKA 3JW4A 1BM9A 1RUNA 1HW5A 3WU0A 2YU3A 3FXUA 2L4AA 3QU3A 2PMUA 4Q47A 2PFBA 1PP8F 4IJAA 1YS6A 3RTRA 1L0OC 4GO1A 3RYRA 2HDCA 1XCVA 2BYVE 2X4HA 5E8GA 2MH2A 1W5SA 4I02A 3JAMZ 1C0WA 3CUOA 5DD4A 4KNYA 3F8FA 4P96A 2FNAA 1B9NA 3ZN1A 4EM2A 4KT5C 4LLLA 5BPIA 2DO7A 2OA4A 1BJAA 3DF8A 3T0YA 4BXUA 1D8JA 1DDNA 1J0RA 4LK1F 3F6VA 4AWXB 3QU6A 4LD5A 5CVJA 3KCCA 3JSOA 2VE8A 3IL2A 5HDNA 1Z6RA 4LFUA 4ZYDA 2QQAA 3LQRA 1T0FA 1V4RA 3WTXC 1WI9A 2X0LA 4RAYA 1WKMA 1TQMA 1ZAOA 5HS7A 2NYXA 4ZZDA 2QM3A 1U2WA 2JPCA 2O0YA 5DDGA 5JI6A 1EH8A 4BHBA 1BI1A 2GXBA 1E17A 3ZPLA 4P55A 5TRDA 2DBBA 2IA2A 4ZZLA 2FEZA 1U5TB 5DCMA 3NEUA 1TNSA 3QRFF 3QAHA 4U0YA 3F8BA 2D1VA 3EQLF 2NAZA 1EV7A 3RDIA 4BNCA 4XSZF 3HRTA 5CJ9A 1GHCA 5L3GA 3FZVA 1QO0D 2COMA 4D0PA 2VT2A 2V1XA 3FMSA 4LB6B 4OIQF 3F22A 2HQNA 1QZYA 2R3SA 1E2XA 1MKMA 1Z9CA 1FP2A 1HW2A 2VE9A 1IZ1A 3TGNA 1R23A 1ZHFA 5LBQA 1SAXA 2LF8A 2D45A 3DEUA 3M1EA 3CO7C 3I71A 2DW4A 5E17F 2Z9OA 1U6GA 2M45A 5HS8A 3J80Z 4A12A 2WC2A 2EFOA 1WQ2A 1I27A 3T1BA 1R1UA 4KFCA 5D6EA 2FBKA 1IUYA 2YX4A 1FNNA 4L5JA 5E18F 2MC3A 3T8RA 2HQRA 2ZNYA 4ZYHA 3BJ6A 1Z6TA 3LFKA 3E3VA 2EFNA 5HS9A 3ZMUA 3JTHA 4Q4ZF 3FX3A 3KE2A 3CTAA 5L3BA 4EJTA 3DFGA 1G4DA 4M71A 1IN6A 3K1PA 4BHCA 1AWCA 3BPXA 3WTSC 3FF5A 1IAWA 1O3QA 1LDDA 2EFPA 3P9CA 1FPQA 2YX7A 1LNWA 3F8MA 1FBUA 1O3SA 1U5TC 4UXNA 2H09A 4L0ZB 3VB2A 1YS7A 1O7LA 1BN5A 3Q9SA 1TLHB 2JTVA 3TDUC 1NHAA 2EWNA 1QQIA 2XAGA 4HLXA 3J80K 4AIKA 2W24A 2ESNA 2A6EF 4U7DA 2PI0A 5A2QZ 5ICCA 4G6DA 3J81K 3T5XA 1OKRA 4FX0A 4AIJA 2O3FA 2F5CA 1G3TA 1F4KA 1BBYA 4L9VA 2RKHA 3K1MA 2CG4A 3F3XA 2MLGA 4L9JA 2ISZA 3G73A 1IF1A 3BDDA 2ELHA 4GYIA 5K5RA 1D5VA 5FFXA 3PFIA 4M6YA 1MJAA 1LQ1A 1MD0A 2F5DA 4K2EA 4UV9A 1T38A 4UNOA 3I5UA 5HLHA 2Q0OA 2ZFWA 3NQOA 2EJRA 5L3CA 1U78A 2H94A 3HYIA 2W25A 3WTZA 1T98A 1Z91A 2MH9A 1J5YA 3GF2A 1R5HA 5E8IA 1CGPA 3M8FA 1L3LA 1OYIA 1TNTA 1CF7B 1DUXC 1LVAA 1U8RA 4AVPA 4GYGA 4OINF 2O61A 5DCFA 3DXJF 4RGRA 3V4GA 1KU3A 3GEZA 3C7JA 2GZWA 4DNCA 4M72A 5F6FA 2A61A 4A2UA 4RGXA 2QYOA 2L02A 4CO8A 3LAPA 2OAZA 3GLXA 1MDMA 4KA4A 2HYFA 2Y0MA 1IW7F 2VBWA 3DPLC 2EFWA 3Q5FA 4PGHA 4P9FA 3KLNA 3HHGA 1QGPA 2GWRA 2IP2A 5J8FA 2DAOA 3KP2A 4WWCA 4HAMA 1YTYA 5F64A 2XAFA 2W85A 2GA2A 4I01A 2ESHA 1J9IA 2J5OA 2M30A 5H6RA 3HSFA 3F21A 3AAFA 3QOPA 2RGVA 3DQVC 1XDUA 3GW2A 2B0LA 3KEOA 4HYEA 3GFJA 2R7FA 5L3EA 1SD6A 2RC4A 1KGSA 3DKWA 1IRGA 2G7UA 5KVRA 3TOBA 3GO5A 2PN6A 4HZFA 4ENJA 2RNJA 1ULYA 1OMIA 1DP7P 4FT8A 4OOIA 2M87A 1LB2A 4M9SA 3ISPA 3ROUA 4PCQA 2P8TA 4RB1A 3IC7A 4KUMA 2VT3A 5FGMA 1YIOA 3OOPA 1X3UA 2O8XA 4UVBA 4ZH4F 3ZMSA 3HOTA 2QZ8A 4IXAA 2YR2A 2WTEA 1FSHA 3I59A 5BS6A 4KIFA 1K7AA 4OIRF 3HRSA 1HKSA 1XN7A 3TKYA 1J75A 2ZCWA 3EUHA 3HHHA 1RI7A 3BWGA 1HW1A 1UB9A 3KP7A 3MQ0A 2H6CA 1B6AA 2BBYA 2CQKA 2P7VB 1STZA 3TQNA 3K0LA 4O5VA 3SXYA 5D5UB 3QPTA 5LRRA 4WK8F 1FSEA 2ETHA 4LGWA 1UHWA 1KQ9A 5LLQA 1KYZA 1AOYA 3FWEA 3MEXA 5D8LB 1HSJA 5F1RA 4Z2YA 1BI0A 2K02A 2HYGD 3DV8A 4R1HA 2P5LC 3IRQA 3J81Z 5HVQC 1FT9A 2Z3YA 3RI4A 4PDKA 5LEKA 2OD5A 4BAYA 2XIGA 1SD5A 1GVJA 4YFKF 3V7CA 1ZYRF 3GVAA 3S2WA 3H3ZA 3KP4A 2G7HA 3U9GA 1BI2A 3SFZA 4F7ZA 4H0EA 1D3YA 2XV4S 4M9ZA 5DEQA 2KIMA 5LRSA 2NRAC 5HOOA 4Q48A 3BROA 1KQ0A 4IF4A 1P4WA 2G9WA 4U7BA 1WRJA 6PAXA 3MZYA 2JPBA 2JT1A 3E5XA 1TW2A 1IXSB 1R1TA 3BP8A 5DCMB 1USTA 3E97A 4WXHA 1SD4A 3ELKA 1W7PA 1W7PB 5DV5A 5H6QA 5LGNA 4WXCA 5LHHA 1K6OA 1FWZA 3LSTA 2A68F 3GFLA 4M73A 5EEGA 4DQ2A 5JVTA 2DFIA 1SFUA 4I0BA 3KEQA 3K2ZA 2KIUA 5D4RA 4NQWA 2FSWA 4LB5A 2P6TA 3EETA 1O7FA 3LA3A 1A04A 5KK1A 2DK8A 3GZ6A 3E6BA 1PUEE 2VC0A 4EJOA 4HX8A 5D5XB 4A6EA 1QPMA 2EV5A 3GYHX 4ESFA 3SZPA 2CO5A 1U5TA 4KMFA 1JHHA 3RIRA 2M1BA 4WF2A 2MBFA 2GAUA 1ONVA 2OZUA 3R60A 3FMQA 5FO5A 1ZGJA 1K79A 5HDGA 2JRTA 3K1NA 5JFRA 5CVIA 4PGGA 4HBLA 3K9TA 1EH6A 1ZG5A 3KETA 2NNYA 3CLOA 5JR3A 5A2QK 1YQAA 4RB3C 3PQJA 5IT9K 4G94A 2KJBA 2XKOA 3O3KA 1H0MA 4O3MA 1ON1A 3H3UA 3KZYA 2R7DA 2BGCA 4N9HA 2STWA 2NNNA 4HV6A 2VN2A 3FM5A 2DI3A 1HBXG 4ASNA 5D6FA 1YFHA 1OYYA 4A5MA 1SFEA 1UCRA 2RV8A 4HDVA 2F2EA 2PLYA 2IRFG 1KA8A 2ZXJA 2V1DA 2RVCA 2E7XA 4N0BA 4GCVA 4U0WA 3R4KA 1FYMA 3CUQB 1MZBA 4CYDA 3I4PA 1G3SA 4LMYA 1FBSA 2XAHA 5HLIA 3V8LA 2FRHA 4RGSA 3EDPA 1SD7A 1XMAA 3ECOA 4I7HA 4M6XA 4ENKA 1W5TA 3DPTA 3NRVA 3C3WA 2DU9A 1H9GA 3HIFA 5E1ZB 2ZMEB 4EGYA 2XVCA 4RB2C 4XSXF 4JBAA 3GXOA 3O2PE 4O6JA 3V8JA 1R1VA 5CVVA 4LG0B 3FXRA 4U0VA 2PEXA 2UZKA 1TW3A 5AONA 5LHGA 4G7OF 3TO7A 2TDXA 1DPUA 2FBIA 3ULQB 3GZ5A 2QQBA 3MAJA 4YIFA 4QWQA 5ERIA 2EB7A 5E1WA 2C6YA 2HTJA 3L09A 1YYVA 5CVRA 1YW8A 1QNTA 2FU4A 4XRFA 1DPRA 2NS0A 3JTGA 4HLYA 2IW5A 4Y15A 3EYYA 5CVUA 3I0TA 4UVAA 3BJOA 4JQFA 4IHSA 4FHTA 3I54A 4EQQA 4A0XA 1ZRFA 1PDNC 5J6XA 1B9MA 1I1GA 2FQ3A 1MDMB
chains in the Genus database with same CATH superfamily
1OR7C 2YUSA 3DU5A 2EIKH 3MCZA 2P4WA 3K4KA 3H5AA 5DD8A 1LFBA 2PMHA 5BQTA 2VQHA 2FUG2 5J4VA 1OR7A 4L18B 4XMYA 2K27A 1T39A 2W00A 5ED4A 2EK5A 2GA1A 3GTPJ 1AKHA 3ABTA 2QBYA 2E1NA 2JJ7A 2IS4A 4KN7X 1N75A 4YIRX 3HUGA 4CCJA 4MTEA 1Z3XA 3U1KA 3M8JA 3ZXSA 2X6OA 1X3ZB 3BG5A 3E5UA 3BY6A 2LBFB 4V2GA 3C2BA 2L7KA 4ZDLA 1BOBA 3GTMJ 3MN2A 2Y30A 3TOAA 3LAJA 1H8AC 2LLKA 2MSYA 4G6TB 2Z99A 4TV7A 1Y8QB 4CXFA 2FQ4A 3VSLA 5C3EJ 2HFHA 3M07A 4RM2A 4EGZA 2K9SA 3WTUC 3OL3A 2LP0A 2E2IJ 3L00A 5KCMA 1OYWA 3WGGA 2ZJ2A 1HDPA 1LFPA 3W6JB 1WPKA 1IJWC 4D7NA 4NNJA 1S7EA 3HXLA 2R5ZA 1GXPA 2PJPA 3IHUA 3RPUD 1BR4A 3KEYA 3TW7A 3HL2A 5FB2A 2P7CB 2R7SA 3P7NA 1V54H 3O8HA 1ZG3A 5LFAA 3WTVC 1WJAA 1Z1DA 3KZZA 4RS8A 4HNTA 3L2QA 5LD2C 2YPRA 2HOAA 2LG4A 1G3YA 2K3FA 1RIOH 3WTTC 3QP5A 5ILSA 2VONA 2OPTA 4J00A 3HRUA 1FC3A 2MA3A 2V26A 2PG4A 1Z7UA 4IL6C 3I55I 1EKEA 4ZYGA 2KLOA 2EV0A 2OTLI 4BEHA 1OPCA 5J8CA 1H9TA 1APLC 3OIPA 2M5WA 4E7JA 3ZQFA 3HTUA 4LLNA 2VXZA 4HSRA 2I10A 1KU9A 4S04A 2XPVA 3G1OA 3B73A 3T8TA 2XUBA 3L2WA 4CHUA 4XLNF 2ELJA 5KNLA 5ILUA 1UHMA 5BOXA 2OZ6A 3FKIJ 3OMYA 1TQIA 1XSVA 2W57A 4E7HA 4BQAA 3E0JB 2NVYJ 1KU2A 2NVXJ 2A07F 2WBMA 4CICA 1K78B 3MWMA 1S3JA 3MKLA 2KRFA 3SFIA 2XAQA 5IT3A 2RDPA 1SANA 1YRNA 1YX5A 4I0AA 4RM3A 3EYIA 5IPAA 1BOAA 2KT0A 1E3PA 1YW9A 3ZMZA 2L9RA 2YU9J 1XDSA 2UXXA 2BVLA 2DODA 2LKPA 1D1CA 1F9NA 3H92A 1HSTA 4ZYEA 3SZGA 4XONA 2DQRA 4ENMA 4BL0B 5E20A 2P0WA 2R5YB 2JVGA 2RQPA 4JX6A 4YIIA 5KAFC 3CCSI 5LGUA 2WWYA 2DPUA 5F1JA 4ESJA 1ON2A 2BOLA 3CDLA 1SMYF 3LWFA 4KIBA 3WHCA 3FXJA 3GWZA 2BV6A 2KISA 4MHGA 3K6GA 3OYJA 1YX3A 2XRNA 1S8NA 2M8EA 4DOZA 2GXAA 3M8EA 1IN7A 1TQPA 1Z0XA 4S05A 3ESWB 4EJVA 2PJRB 4XM3A 1J7KA 3TMOA 3D5RC 2VBZA 2LNBA 2FOKA 3P5JA 3VODA 5IOZA 1S7OA 1S9HA 4WCGA 3OYIA 1EF4A 1ZRDA 1XCBA 1K83J 1T6SA 3VEPA 4Y4RA 2M0MA 3W2VA 4L0YB 3WTWC 2K4JA 1SMTA 5DYMA 4HX7A 2EA4A 2MGQA 1OJLA 2V9VA 3EPZA 4NDLA 1BC7C 1R5GA 4CZZA 1VQLI 3GUDA 2V7FA 3ZQIA 4E70A 5GAHJ 1JUSA 2DJIA 5ICGA 5E1XA 1G3WA 3QYFA 1QVTA 2QKLB 4NC6A 4B3XA 3ZR8X 4BQQA 2E1OA 3DU6A 3HBLA 5AIQA 1R7JA 1J59A 4IRIA 4KYWA 5AIPA 3RPQA 3HJEA 1JTXA 2OJED 2M9HA 5GTHC 1T2KA 3JRGA 4XQFA 4HOBA 2L4MA 2DTZA 2JVHA 3DP7A 1R36A 4PSWA 3CO6C 4Y13A 2O5RA 5DTDA 5B5EC 4G8XA 2RNGA 2G0EA 2KRCA 4E7KA 4B8XA 3H1CA 3CESA 1T95A 3G3ZA 2O7OA 3E6MA 4I09A 1S72I 3K10A 2K7LA 2Q2EA 3CP8A 3I53A 4PJMA 3MZHA 2DA5A 2LKXA 1O57A 4A3FJ 1O3RA 4IKFA 3FKJA 1U9NA 2DFHA 4HQMA 4XLFA 2R7XA 2H27A 2WAQN 2ZJQF 3ZMVA 4EJWA 5F0CA 4E7IA 1H89C 1HCRA 2V4JC 1Q1HA 3GBGA 3N4MA 3ABKH 1MGTA 4IOAF 2ECBA 2LSOA 2X9DA 3HSEA 4IOCF 1REPC 3L2RA 3M9AA 3VYUB 1K4SA 5IOYA 4EJUA 5D4SA 3GTOJ 3C18A 1RETA 3COAC 1ETKA 2BY1A 2IJLA 4MGRA 4FE7A 2A5YB 2QA4I 2IT0A 2XSJC 3PO2J 3PIPF 1TWHJ 2NS7A 1B59A 1R00A 5JHUA 4MQVA 3VFZA 4CSWA 4CYCB 1TBXA 1UFMA 3QWLA 1R6RA 3HKZN 2Z5UA 3F72A 4LOCA 3JAMK 1TTYA 4IRGA 2J5PA 2V9PA 2ZKZA 3B02A 5H20A 3BTCA 1VQOI 2KMUA 4UV8A 1AKHB 2QBYB 2HKXA 2EA2A 2KRHA 2QQ9A 2VXDA 4KICA 1HKQA 4M9XA 1G59A 1JKOC 2JSCA 5EDNA 2OC6A 1FIAA 2MLKA 1X4PA 1XGNA 1XG1A 2E1MB 1VQ7I 3WE3A 2HR3A 2ISYA 2FE3A 3MD2A 1MNMC 3I59B 2ZO4A 4EMSA 4BKXA 4GGGA 2LD5A 5FD5A 2XAJA 2HXIA 2FMLA 4BQNA 2AQEA 2DT7B 4F3QA 3CUQA 2AXLA 2CWEA 2VC1A 4XKCA 1VQ6I 2HTSA 2XF7A 3Q9VA 1VF9A 1I6XA 1WH7A 1TT5B 3F6OA 3S1RJ 1R22A 3B6CA 2IGKA 1ACIA 3FHZA 4IHVA 5L3FA 2IGOA 1Y0UA 1YG2A 1VQ5I 1HLVA 5J47A 2OTJI 1ZN2A 4CZCA 2K86A 4Y17A 4M74A 1JJ8C 4IPAA 3LSMA 5FLXZ 4HF2A 2AO9A 3I56I 3QP6A 2KFDA 2LDUA 1P92A 2OU2A 4P1WA 4HDUA 3BCBA 2W82A 2X48A 3H5RA 3KP3A 1JKRC 1A36A 4X1EA 1W5CC 1JGSA 1V55H 4R79A 2O03A 4CCMA 4QSHA 1RR8C 3F8NA 5ICFA 1FJLA 1LEAA 2ID6A 3HKZA 1W7PD 2K9NA 1Y1VJ 4MQ9F 3S3NA 1VQPI 3ERED 4WXDA 3B6AA 4PSXA 3OYLA 4OAYA 1TT0A 2FXAA 3E7LA 3CP2A 3N97A 2B9SA 5K1YA 3WE2A 3LQQA 1GT0C 5EYRA 4LIVA 2W4SA 4LJZF 1D8KA 2QEXI 2M4GA 5BNGA 3REOA 5DM6F 2FF4A 2CW8A 2V79A 1O3TA 1XB4A 3DBRB 1ZGAA 3RKWA 2V1NA 2VUMJ 1OQYA 1QBJA 1KQ8A 1ODDA 4EATA 2E2JJ 3CC4I 2DT5A 4UB6C 3LSPA 1MIJA 5FLVA 4BYYA 3I58A 4A3LJ 4BHPA 3FBNB 1LJ9A 2KZGA 3L9FA 4AD9A 2ZBKA 4FX4A 2CUJA 2IGNA 5EF6A 1K6YA 4HF1A 4BH9A 4RGUA 2XRLA 3BG7A 1X1DA 4U88A 1QVUA 1IDYA 2R5YA 1X1AA 3ZN0A 2H1LA 2VOPA 4YFNF 5ILVA 3TW6A 2Y48A 2CUFA 4MEYF 4JK1X 1W0TA 4DW6A 3U2RA 3OYFA 1F36A 5BPDA 1XTAA 3SQNA 2FMYA 4L9TA 3CMYA 2HWVA 5LEJA 3ZQQA 3HGYA 3BR6A 3HOWJ 4A0ZA 3HOZJ 3OL4A 5FRNA 1Z77A 3ASOH 1OISA 5CLSA 4QIWN 3D1NI 4IHTA 2E19A 3HSRA 5HLGA 2JUGA 2Z16A 4LIUA 1WJEA 1KU7A 3GFIA 2E5NA 2UWMA 3HEFA 2X6YA 1BW5A 4B1RA 4IQJA 2H8RA 4KT6A 3U21A 1XD7A 4KITB 1DQUA 1OFCX 4MEXF 2LVSA 2TCTA 1IG7A 5DUIA 2X51A 3BOQA 4CDGA 2P81A 3ONQA 5EG0B 3QYEA 4CYCA 2PMZN 3GTJJ 4A6DA 4C9YA 1SFXA 3CJNA 4B09A 1N25A 2X1EA 3OIQA 2DMNA 4ENNA 3WGHA 2BVMA 1WWXA 3HB9A 4E7ZA 2PBIA 1QHGA 1RZ4A 3VWBA 2D1HA 2R0QC 3A1YA 5CYVA 2JZYA 2AQFA 5D8KB 3IV5A 2GBYA 2L7FP 3RKXA 1X2MA 4I98B 4UUVA 2V6CA 3DPUA 4UHTA 3WG9A 5L3DA 1IC8A 3GTLJ 5JHFA 1FYKA 5HODA 2CFXA 4BJ6C 1IRFA 3KPHA 5IT9Z 4GRIA 2HDDA 2V1UA 5FD6A 3OYMA 3PUFA 3CF5F 3L7WA 3LA2A 4G6QA 2DJNA 3HOSA 1RUOA 2R92J 2E1CA 2HKOA 1AU7A 2DK5A 2VBYA 4N4OB 4E7LA 1B4AA 2VB6A 2K5CA 1IXRC 3KYLA 2D2WA 3C1DA 4B4CA 3CCQI 4RAZA 4WX9A 2YSRA 1RESA 1CF7A 5GAEJ 2WV0A 3UR3C 1QHHD 5K7HA 3MKZA 3ZMTA 3E5QA 1I1SA 1ETVA 2L7MP 2HEOA 5GPAA 1HOMA 3FXKA 2X6XA 3R6SA 3FM3A 2R7VA 4G9YA 2A69F 3OWTA 4HV5A 3F23A 1JHFA 2FA5A 2CUEA 4KN4X 3BTLA 1MJBA 4N9IA 1LDJA 1Z21A 4YFXF 4I2OA 1FP1D 2LREA 4XLEA 2XGXA 3IWFA 2DA4A 2EPFA 1GLNA 2QENA 4W1UA 1UZCA 2VODA 5LGTA 5IP9J 2KKOA 2EFQA 3O6BB 1IRZA 3I64A 5EEHA 1WHUA 3LFUA 5M3MJ 2LF7A 4KIGA 2Y0SN 2GQQA 3BT9A 1BIAA 4YELA 3J7AO 3ZQCA 1BC8C 4HX4A 3GLLA 4D5FA 1HKTA 4CCKA 2GIVA 1D5YA 1ZLKA 1S6LA 5JVGF 1JUMA 3KP6A 4J19A 3RKYA 1IXCA 3P9KA 1G6NA 3NWSA 3JRBA 3C2HA 3E6CC 3TO9A 4LLGF 4XLPF 3SZTA 4EVIA 1FTZA 2UXNA 1I3QJ 2FOWA 3HM5A 2IA1A 4XBFA 2ZNZA 2CW0F 1D0YA 3W6KB 1W4MA 3TP3A 2CQXA 1P4AA 2OQRA 1J2XA 2E5ZA 2CQ7A 5BMZA 1P6RA 5JLXA 2CGPA 1DGWY 3RJPA 4F92B 1XGSA 3EUAA 2XROA 3GX4X 2DTRA 2RAEA 4G12A 2ADUA 2WAQA 5FFZA 3KP5A 2LH9A 3ASNH 1F5TA 2WB1N 4ETSA 1HQCA 2CRGA 5FLXK 9ANTA 4G7HF 4UVCA 1TP4A 3KFWX 3R0JA 2M7BA 1EH7A 4HA8A 3K69A 4IVNA 3JRCA 1PP7U 4GXOA 5TJJA 1YJWI 2Z33A 1N78A 1USSA 1DU6A 3HOXJ 2L0KA 3LSRA 2HGCA 1XSDA 2K4BA 5EZHA 3IH3A 2X1CA 3M7GA 4R8HA 3ZP5A 5K7ZA 3Q3SA 2QSGX 1FEXA 1R4MB 2BY0A 3IH2A 1B8IA 5IYDJ 2VL8A 2DYRH 5FKLA 4HNUA 2LY2A 3NARA 1R58A 2KJCA 1VTNC 3MFKA 3CC7I 2B63J 4BE1A 4G7ZF 1P2FA 4HW0A 4P9UA 2QLZA 3FXLA 2M34A 2KL4A 4EM0B 3TP0A 3TO6A 5J1RA 1WJ5A 5GPCA 2L01A 2E60A 1ENHA 3OYGA 3R0AA 1U3EM 2XASA 3A02A 3SHFA 2VQLA 2L9SA 2WV1A 5HDKA 2PQ8A 1YJ9I 1MJ9A 4RLFA 1KYWA 4OIPF 3WU1B 2K9MA 1LEBA 1FYLA 4NB5A 2P5VA 3ECHA 3FMRA 1YJNI 2HYJA 2BE5F 1F1ZA 1IN5A 3PSFA 2VIXA 5EZGA 3WODF 4ESBA 1I5ZA 3QPHA 1NK3P 2DPDA 1S29A 4A69C 3WGIA 4HQEA 5B66C 1RNLA 1ORKA 1ZREA 1Z05A 1S5LC 2NXNB 4P5OA 3MKYB 3OV8A 3OYCA 3N05A 2JA2A 2N8GA 3CDHA 2AXTC 2QWWA 2X1DA 2Z2SB 4PJJA 5FKNA 1HC8A 2VOOA 5M5WJ 2UV1A 2XSDC 1ZG1A 3RYPA 4OIOF 3LSKA 4ON0A 4IHYA 1HF0A 4V2FA 5EJCA 1QZZA 2L54A 4XKWA 3BG3A 4QLCU 3CCJI 2COBA 4XL9A 3F8CA 2ZMEA 5HNFA 3OYAA 1FOKA 4EV0A 1Y56A 5ICEA 2HQ5A 2QGUA 2H8WA 3CJTB 4FE4A 2XAUA 2ZB9A 2FNPA 1V5EA 1HXDA 2DQLA 2RN7A 3K4JA 4BXFA 2P5KA 1S7AA 5B3SH 2Y9YA 2MD0A 3S17J 4LG0A 1XGMA 5M5YJ 2ZC2A 4OMZA 4ANJA 2CSOA 1PVEA 3E1SA 4HF0A 3ML6A 2BY3A 4Q5SF 1SFKA 2ZXIA 3RQ4A 3PQKA 2GXGA 3A03A 4FTHA 2IVMA 1I6HJ 4CGZA 2STTA 1Z3YA 3HOVJ 1P9QC 4XRMA 4BJ5C 1FZPB 3OS2A 1LDKB 1JE8A 5HLTA 3KLOA 2AS5F 1T08B 3SEZA 4IRHA 1YW7A 3HRMA 2GLOA 2OCCH 3RPUA 1FY7A 2DLLA 1IV6A 2E34A 3BJAA 5D5VB 1FIPA 3M1CA 2IA0A 1W1WE 2QVOA 3AL0C 4QTRA 3U1DA 4KMUX 1WZ2A 5K5QA 1WSUA 2ACJA 3S2DJ 1XMKA 1MBFA 2XKPA 3SEQA 2M3AA 4OU0A 3OYHA 4A3KJ 1YO5C 2IAIA 3AL0B 2VPRA 4UUTA 3GFMA 4CCOA 1IN4A 4B44A 4L9NA 4HSTA 1BIBA 2IPQX 2Q8KA 3FXQA 1FOYA 2OQGA 2K85A 3CCYA 3P9IA 3IKVA 2VBXA 3R61A 3TEDA 2HZDA 4I6ZA 2DA2A 3K7AJ 2R5ZB 2KIFA 3LL7A 3RQIA 2L3DA 2A6HF 4BBRJ 3TDZC 3ZQLA 1JXSA 4D9JA 1FBQA 2CU7A 2JRMA 4II3A 3ZQGA 1ZH5A 4B47A 1ZLJA 3ZMDA 1VQMI 2A3SA 3D0SA 4NUBA 5LHIA 4L5IA 4A3EJ 2LOOA 1QZEA 2E7WA 4XORA 2DMUA 1X3WB 3FK7A 2Y75A 2RREA 4OMYA 3A01B 1IN8A 3OSGA 4YRVA 4AIHA 3IRRA 3PM1A 3OYBA 2MYSA 2LK2A 3H35A 4XN3A 4U87A 4KDPA 1XGOA 1FTTA 2FBHA 1V3FA 4EM1A 1UG0A 3IWZA 1JT0A 2BEOA 3JCUC 3HPGA 2R7WA 4RB0A 3JRFA 3S2HJ 5DM7F 1MMSA 1B1BA 3BZ6A 3MZ8A 3V7RA 1SVMA 1NK2P 2CQQA 1I3AA 2XB5A 2O6GE 1ZRCA 5D5WB 1P4XA 3BCAA 2XDVA 3HGGA 1ETOA 4LK0F 1ZARA 3V7SA 5F04A 2F5EA 5IP6A 1MNDA 2CS3A 1RKTA 4KISA 1VZ0A 5DUKA 3OSFA 3ZQ7A 1XSXA 2CW7A 4UUSB 2OBPA 2CYYA 3VPRA 4H4KC 3LA7A 4QPOA 3GZNB 2QUFA 2L9VA 3VSKA 4CA0A 5JLWA 4PJNA 1ETXA 3BPVA 4MFEA 4BEHB 3BG6A 2HPIA 3PFYA 4A5NA 3LNQA 2EV6A 1IO2A 4ZDPA 3HTSB 3D5LA 4MNUA 4A3DJ 5K5OA 2H6BA 3I3LA 3MVPA 1FOWA 4A0YA 3L2CA 1N77A 1GXQA 5EG0A 1FX7A 4I76A 2DA3A 2E35A 2HZTA 4MTDA 3CUQC 4XLHA 2RQQA 1K78A 2P6SA 1R4NB 2HS5A 3BTJA 3F9KA 4BUPA 2BHZA 4PZJA 2AHQA 2KQRA 2HOEA 1OCZH 4NHJA 3H9QA 5J4YA 3IKTA 2DFEA 2KIQA 2EINH 3VOEA 4XICA 1YLFA 3LMMA 3V8KA 2Y69H 3ABUA 2W84A 3JSPA 3WTYC 2R7TA 2BHYA 2CQNA 4AC0A 3W2AA 2B7EA 4F93B 1VNDA 2F5FA 1BI3A 1FLIA 2MD5A 3E6DA 4YG2F 4C2MJ 2XHKA 3JW4A 3IAM2 1J09A 1BM9A 1RUNA 3H5NA 3PIOF 5E3OA 1HW5A 3WU0A 4BJTA 1LE8B 3NWTA 4XLCA 4X0GA 1YE9A 2YU3A 4RBOA 1UG2A 3FXUA 2L4AA 3QU3A 2PMUA 4Q47A 3CJQB 2PFBA 3RZDJ 4W97A 1PP8F 4FISA 4IJAA 1YS6A 3W2WA 2HOTA 3RTRA 1L0OC 4PFPA 1A5JA 4GO1A 2IGMA 4NC7A 4XR6A 3RYRA 5M3FJ 2HDCA 1XCVA 2BYVE 1GVDA 2X4HA 5E8GA 1O4XA 4B48A 2NOGA 3CMMA 3EUKL 3ABMH 2MH2A 1W5SA 4I02A 3JAMZ 3H0GJ 1C0WA 3SJMA 5FKKA 3CUOA 5DD4A 4A93J 4KNYA 3F8FA 1TWGJ 3KZIC 4P96A 2FNAA 2DDBA 4LITA 1B9NA 2GOMA 1KZHA 3ZN1A 4EM2A 4KT5C 4LLLA 1DGRM 1Y0NA 5BPIA 1OLTA 2DO7A 1OCTC 2OA4A 1BJAA 3DF8A 3T0YA 2WADA 4PJ0C 3H0DA 2XF5A 1P7JA 4BXUA 1DDNA 1D8JA 1UMQA 1J0RA 4M3GA 4LK1F 3F6VA 4AWXB 2DA6A 2O9LA 1VQKI 3G2BA 3QU6A 4LD5A 5CVJA 1JKPC 3KCCA 5HNHA 1D1AA 3A01A 3GTKJ 3JSOA 3AG3H 2VE8A 3IL2A 5HDNA 1Z6RA 3EUHC 1I39A 4LFUA 3DCFA 2F4IA 4ZYDA 2QQAA 3LQRA 1T0FA 1V4RA 3WTXC 4JP0A 1JTYA 1WI9A 1I50J 1OCPA 2X0LA 4RAYA 2EZHA 1WKMA 1FMVA 1TQMA 1ZAOA 5HS7A 1R9TJ 2NYXA 4ZZDA 3M4OJ 2QM3A 1U2WA 2JPCA 4PFOA 2O0YA 1WJBA 2IEKA 3FHNA 5DDGA 5JI6A 4A3MJ 1EH8A 4L5EA 4BHBA 1T8IA 1BI1A 2WY7Q 3IH4A 5C4JJ 1MBGA 2HXOA 2GXBA 3A2KA 2NVQJ 1E17A 3ZPLA 4P55A 2JSPA 5GP9A 4XNFA 2XPWA 5TRDA 5F27A 2CV2A 3NAUA 3ZOBA 2DBBA 3J7YJ 2IA2A 3FK6A 2W1OA 4ZZLA 3CCMI 2FEZA 3O8GA 1U5TB 5DCMA 1D1BA 3NEUA 1TNSA 3QRFF 2ZSHB 3QAHA 4U0YA 3F8BA 4JX4A 4Y3OA 2D1VA 3TBIA 3BR2A 3EQLF 2MC4A 2NAZA 2KPMA 1EV7A 4YEJA 4BQOA 3RDIA 4BNCA 3WU2C 4XSZF 3HRTA 5CJ9A 1GHCA 5L3GA 1H88C 3FZVA 1QO0D 2WA0A 2COMA 1SEUA 1F43A 2BW3B 4D0PA 2HVQA 2VKDA 4IHWA 2D5VA 2VT2A 2V1XA 3FMSA 3G4SI 4DJAA 4LB6B 3TL4X 4OIQF 1JGGA 5J1UA 3F22A 2HQNA 1TWAJ 3SDBA 1QZYA 3CCEI 2R3SA 1X1PA 1E0EA 1E2XA 2W48A 4D7MA 1MKMA 2MFZA 4C2UA 1Z9CA 1FP2A 1HW2A 4OWRB 2VE9A 2LY1A 1MW7A 1FMWA 1IZ1A 1JKQC 2K3PA 3TGNA 1Z67A 2BXZA 1R23A 1ZHFA 5LBQA 1SAXA 3BR0A 2LF8A 2D45A 3DEUA 3M1EA 3CO7C 1OCCH 5IYCJ 3H9JA 3I71A 2DW4A 5E17F 3JRHA 2Z9OA 2VJ5A 2XF6A 1U6GA 2M45A 5HS8A 3J80Z 3S14J 3FDYA 3CCLI 4GFBA 3ZGKA 4A12A 4A3JJ 1W0UA 2WC2A 5TISC 2EFOA 1BA5A 1WQ2A 1I27A 3T1BA 2EBIA 1R1UA 4KFCA 5D6EA 3CCVI 1DP3A 1G8XA 2FBKA 2ME0A 1P7IA 2VQGA 2XGDA 3RZOJ 1IUYA 2YX4A 3DTEA 2JMWA 4D1QA 2TRTA 2HI3A 1NG7A 1BW6A 2PMZA 1FNNA 2X85A 4L5JA 5E18F 2K9QA 2WAEA 2MC3A 3T8RA 2HVSA 4A3GJ 2DA7A 5KHDA 2HQRA 2YS9A 2ZNYA 4AUXA 3BJ6A 4ZYHA 2R4GA 1Z6TA 2DMPA 3LFKA 3E3VA 2EFNA 5HS9A 2LFBA 3JTHA 3ZMUA 4Q4ZF 4IHXA 3G6EI 2CMPA 3CD6I 3PO3J 4DIQA 5IYBJ 3FX3A 1UHSA 2I8DA 3CTAA 3KE2A 5L3BA 4EJTA 5DS9A 4C30A 3DFGA 1U8BA 1G4DA 3Q0UA 4M71A 1IN6A 2E1MC 2VPLA 3K1PA 3JRAA 2VKHA 4MLOA 4BHCA 1AWCA 3BPXA 3WTSC 2HQAA 3FF5A 1IAWA 1O3QA 1LDDA 4C2TA 2EFPA 3P9CA 1K61A 1FPQA 2YX7A 1LNWA 2MG4A 4XLAA 3F8MA 5GTIC 1FBUA 1O3SA 3H3VK 1U5TC 2VJJA 4UXNA 1IRXA 2H09A 4C3JJ 2Y9ZA 4L0ZB 2VASA 1POGA 3S8PA 1RKWA 3VB2A 5FLMJ 1YS7A 2X6WA 1O7LA 3VYSB 1QU3A 3G1MA 1BN5A 1VI0A 3OOUA 3Q9SA 1MBKA 2UUZA 3A0HC 1TLHB 2JTVA 3TDUC 1NHAA 1QRYA 2EWNA 1QQIA 2XAGA 4HLXA 3J80K 4AIKA 2W24A 2ESNA 2XGEA 2A6EF 4UUSA 1LUJB 1B8IB 4DYCA 4U7DA 3OYEA 2PI0A 5A2QZ 3CCRI 5ICCA 4G6DA 3J81K 3T5XA 4DGWB 5B1BH 2DN0A 1OKRA 3CMAI 4ZYAA 1U9OA 4FX0A 4AIJA 1SVLA 2O3FA 3DTIA 2F5CA 1G3TA 4IQ4A 4DYRA 4ZJZA 1SFOJ 2EZKA 1F4KA 1BBYA 1ETQA 4L9VA 2VI6A 2RKHA 3A4CA 4PK4A 1XC5A 1YHQI 1V5GA 3OYNA 3FBIB 3K1MA 1WCMJ 4V19K 2CG4A 3F3XA 2DOEA 2MLGA 3FISA 4L9JA 2ISZA 3L2UA 4AYBN 3G73A 1IF1A 3BDDA 2JUCA 2ELHA 4GYIA 5K5RA 3DLLF 1D5VA 5FFXA 3DWLE 3PFIA 4M6VA 4M6YA 1MJAA 4ZTFA 1MD0A 2F5DA 4K2EA 3JRDA 4UV9A 4FQGA 1LQ1A 2JA6J 2NVUB 2Z1DA 1T38A 4UNOA 3VYRB 5FKOA 1IGNA 3I5UA 5HLHA 3DKYA 2Q0OA 2KHMA 2EIJH 2JK3A 3K4LA 3RCOA 3GCMA 1Q1VA 2ZFWA 4BXXJ 5E3NA 1QPIA 3KYCB 3NQOA 2CH0A 1ZQ3P 3J7AY 2EJRA 5L3CA 2CFOA 2EILH 3JREA 1U78A 2R7UA 2H94A 3HYIA 5F0HA 2W25A 3WTZA 1T98A 3GTGJ 2M7AA 1Z91A 2ZMEC 2R7ZJ 1XS9A 1MMNA 2MH9A 1J5YA 3GF2A 3RSNA 3SYTA 1R5HA 5E8IA 1CGPA 3M8FA 1L3LA 1OYIA 2K9LA 4M3EA 3C2GA 2PJRA 3S15J 1TNTA 3K4CA 1CF7B 3HPHA 1MMGA 1DUXC 1TC3C 1W36C 3DTKA 1LVAA 3HZJA 5C4XJ 1U8RA 4AVPA 4GYGA 4OINF 2MABA 2O61A 2V6EA 5DCFA 2QKMB 2GIZA 3DXJF 4RGRA 3V4GA 1KU3A 3GEZA 1MH3A 2HNHA 3C7JA 2GZWA 4BDYA 4DNCA 2Y0SA 1YOVB 4M72A 2LRDA 3W3CA 1RPWA 2A61A 3D5SC 5F6FA 4A2UA 4RGXA 4CUGA 2QYOA 3QQAA 3Q0VA 3OYDA 2L02A 3FXMA 3QOEA 4CO8A 3LAPA 2OAZA 1AA7A 3PUBA 3W6VA 3GLXA 2L2OA 1MDMA 4KA4A 2HYFA 2Y0MA 1IW7F 1WVRA 1U0JA 1TL8A 4JOMA 1AHDP 2VBWA 3DPLC 2EFWA 2ZFUA 4E4HA 3Q5FA 3DBHB 4PGHA 4NC8A 4AYBA 3UKGA 5GAGJ 4P9FA 3KLNA 3JR9A 2LR8A 3K4NA 2JA7J 3PL8A 3HHGA 2R93J 1QGPA 2GWRA 2IP2A 3VYTB 3QYBA 5J8FA 2DAOA 4M3FA 2IS1A 2IBDA 3KP2A 4WWCA 1ERDA 4HAMA 1TZLA 3HUGB 1YTYA 5F64A 3WG7H 5E79C 5FRMA 2XAFA 2W85A 2FD5A 1WJDA 2PX9A 1X58A 2GA2A 2ESHA 2QQ8A 4I01A 1LFUP 1J9IA 2LMDA 2LBFA 3AKZA 1W36D 2J5OA 2M30A 2OF7A 5H6RA 4UY8I 3HSFA 2MW8A 3F21A 3AAFA 1B72B 3LOCA 3QOPA 1MBHA 1B72A 2RGVA 4S0HB 3DQVC 1XDUA 3GW2A 4A3BJ 2B0LA 3KEOA 5B1AH 4HYEA 3S16J 1NH3A 3BLYA 1MNEA 3GFJA 2R7FA 3I9V2 4C3HJ 5L3EA 1E3OC 1SD6A 4PJLA 2RC4A 1KGSA 3DKWA 5J1YA 1IRGA 2G7UA 4AM3A 5KVRA 2ZJRF 5J3LA 2A05A 3TOBA 3GO5A 2PN6A 1IV8A 4HZFA 1MSEC 2Y31A 4ENJA 2RNJA 3K70D 2DCEA 4E6KG 3AG4H 1ULYA 3RKQA 1OMIA 1A6QA 2VKEA 3AG1H 2VJ4A 2HOSA 1DP7P 4FT8A 1UAAA 4OOIA 3ABLH 2M87A 1LB2A 4M9SA 3ISPA 4RAGA 2LKSA 3ROUA 4PCQA 1BR1A 2P8TA 4RB1A 3IC7A 4B43A 5IY5H 4BBSJ 4KUMA 3OR1C 3OY9A 2VT3A 5FGMA 1YIOA 2Q2EB 4B3AA 4Y52J 4A3CJ 1SAUA 3OOPA 1X3UA 2O8XA 4UVBA 1T56A 3BG9A 5F08A 2ELKA 2BXYA 4ZH4F 4HG2A 3ZMSA 1GV2A 1A6IA 3HOTA 4BU2A 2KP6A 2QZ8A 2L5QA 3ZRGA 2QSHX 4A3IJ 2YR2A 4IXAA 2WTEA 3X2QH 1BR2A 1MBJA 2V9KA 1FSHA 3GMEA 3I59A 3K70C 5BS6A 4NBQA 3FIWA 4KIFA 1K7AA 1G2HA 4XRSA 4OIRF 3HRSA 1HKSA 1XN7A 5CQEA 1YRNB 2HVRA 3TKYA 1LVKA 4LG3A 2WAFA 3VDXA 2JWTA 4IEJA 5GADJ 1J75A 2ZCWA 1Y8RB 3EUHA 3HHHA 3ZCOA 1RI7A 1T0FC 3BWGA 3QPSA 2ZXWH 1HW1A 1UB9A 3DEWA 3KP7A 1WH5A 3MQ0A 5EGOB 2H6CA 1B6AA 4GDFA 4HPQA 2DOAA 5EGOA 2Q1ZB 2BBYA 2CQKA 2P7VB 2M0CA 2KDZA 1STZA 3G1LA 4HEA2 3TQNA 1Z7LA 2Y2ZA 2A6TA 3CC2I 3K0LA 2DXIA 3BTIA 4D5CA 4O5VA 3SXYA 5D5UB 1UELB 3QPTA 1SC7A 5LRRA 2DMTA 4WK8F 1FSEA 4ZC3A 4RLQA 2ETHA 2ICWG 3J7ZI 1K4TA 2QSFX 4LGWA 1UHWA 3HC7A 5M5XJ 1KQ9A 5LLQA 1KYZA 1CQTA 1AOYA 3FWEA 3MEXA 2BY2A 5D8LB 2OCEA 2DA1A 2FJ1A 2ZSIB 4HRIA 3S1NJ 1HSJA 2M2EA 2KDOA 5F1RA 4Z2YA 1T33A 2HU9A 2ID3A 1BI0A 2K02A 4I99C 1UJ8A 1QA6A 2HYGD 3DV8A 1XX5A 4R1HA 5IP7J 2P5LC 1LE8A 3J81Z 3IRQA 5HVQC 2H1KA 1FT9A 2Z3YA 3RI4A 3DBLB 4PDKA 5LEKA 2OD5A 3CDIA 4BAYA 2EH3A 2XIGA 1SD5A 1GVJA 4YFKF 3V7CA 1ZYRF 3DLAA 3GVAA 1WJCA 4ITVA 4CH7A 3S2WA 2JQ7A 3PNTA 3H3ZA 3KP4A 2G7HA 4AIDA 5CPRB 4Y7NJ 2M4KA 3KX2A 3U9GA 1MBEA 1OCOH 1JI8A 4DZPA 1BI2A 3SFZA 4F7ZA 4H0EA 4ZDOA 1D3YA 5FJ8J 4BE0A 1ZGWA 1RC9A 2XV4S 4M9ZA 2JA5J 5DEQA 2F4OB 2W7NA 2KIMA 5LRSA 3BZKA 1PUFB 2IS6A 3IUOA 2DT6A 2NRAC 5HOOA 4Q48A 4C3IJ 3OS1A 4XK4A 3BROA 1KQ0A 4IF4A 1MH4A 1P4WA 1ZELA 2G9WA 3PNVA 4ABZA 3KIOA 4U7BA 1WRJA 3BQYA 6PAXA 1YI2I 3MZYA 2JPBA 3SDGA 2JT1A 4MFDA 3BQZA 3E5XA 1A31A 1TW2A 4XKVA 1IXSB 1R1TA 3BP8A 4XKBA 5DCMB 2XGCA 1USTA 3E97A 4WXHA 4X6AJ 1SD4A 3ELKA 3DKXA 4N4NB 2F48A 1W7PA 1X4OA 1W7PB 5DV5A 5H6QA 1GUUA 2R7OA 4MIMA 5LGNA 4WXCA 5LHHA 1K6OA 1FWZA 4AU7A 2BZTA 4BY1J 3LSGA 2OV7A 3H9GA 3S93A 5EEAA 1MSFC 1HDDC 3S1MJ 2R7QA 4CCNA 3LSTA 2ECCA 5E3LA 2A68F 3GFLA 4BDZA 4M73A 5EEGA 4DQ2A 5JVTA 3BR1A 1WGXA 2DFIA 3OYKA 1NTCA 1SFUA 1LKXA 3OIOA 4I0BA 4NQWB 3KEQA 1ITYA 3K2ZA 2KIUA 4BGDA 4NQWA 2FSWA 5D4RA 4LB5A 2P6TA 3EETA 1O7FA 3MMYB 3LA3A 3H36A 1A04A 5KK1A 2DK8A 3IP4B 3GZ6A 3AFHA 3E6BA 2CV1A 1PUEE 5K7FA 2VC0A 1MMAA 4EJOA 2LY9A 2GM4A 3WHBA 1RR7A 2VQCA 4M3DA 3ERMA 2L7ZA 4HX8A 5D5XB 2LTPA 4AVZA 2CV0A 4A6EA 3M3YJ 2JA8J 3KYDB 2E2HJ 1PJRA 4EEFG 1QPMA 2CUZA 2EV5A 1VFCA 3GYHX 2EQRA 4ESFA 3I4MJ 3SZPA 2CO5A 1U5TA 4KMFA 3CMEI 1JHHA 4HNVA 3RIRA 3PJRA 1ZK8A 2M1BA 3LSHA 4WF2A 1E3HA 2MBFA 3K4BA 2GAUA 3ZQHA 2ME6A 1ONVA 1VQNI 1BJZA 1X2NA 2M8GX 2OZUA 1ETWA 2JN6A 2A5WA 3R60A 3FMQA 2DYSH 2WB1A 2XPUA 2DFFA 4RAFA 3CQZJ 5FO5A 1ZGJA 4FCYA 1PYVA 1K79A 2VKVA 5HDGA 2JRTA 3K1NA 5CQGA 5E3MA 5JFRA 5CVIA 4PGGA 2NVTJ 1Y1WJ 4HBLA 4F52A 3K9TA 1EH6A 3A0BC 3F0CA 1XPXA 2LYCA 1ZG5A 4MO7A 3HG9A 3KETA 1R5ID 2NNYA 3CLOA 4DBQA 4IX7A 5JR3A 1JJ6C 5A2QK 2HPMA 1YQAA 2QCOA 3PQJA 1X1CA 4BS9A 4RB3C 5IT9K 4G94A 5C44J 1R49A 2KJBA 3IAS2 2XKOA 3CZ6A 3O3KA 1WJFA 4IO9F 1H0MA 4O3MA 5KAIC 1ON1A 3H3UA 3KZYA 1BL0A 2ZXHA 2R7DA 4DBRA 2BGCA 4BE2A 2DOFA 4N9HA 2STWA 5FROA 2NNNA 4OAZA 1HA8A 1Y6IA 2VLAA 4F55A 1JUPA 4HV6A 3S3OA 4KJZA 1JT6A 2DMQA 3FXOA 4XN0A 4F91B 2VN2A 3FM5A 2DI3A 1R71A 1HBXG 4ASNA 1DU0A 5D6FA 1YFHA 1OYYA 4XIDA 4A5MA 5F0FA 1SFEA 1UCRA 3LSJA 1LPQA 2RV8A 3L2VA 4HDVA 2WY8Q 2E71A 2F2EA 5H2FC 2PLYA 4XOPA 2IRFG 1KA8A 1GV5A 4JX5A 5J40A 2ZXJA 3LSIA 1IDZA 3PSIA 2V1DA 2GOXB 2RVCA 2E7XA 4N0BA 4GCVA 4U0WA 3R4KA 3G71I 1FYMA 3CUQB 1MZBA 4BY7J 3JRIA 5CKTA 4CYDA 4FASD 3CLQA 3S32A 4RMNA 3I4PA 1NG6A 3S1QJ 2F4MB 2I5UA 2F6CA 1YITI 1WFXA 1ZTRA 1G3SA 4LMYA 1FBSA 4IZZA 1X19A 4M3BA 1RRJA 1TWFJ 2XAHA 5HLIA 3V8LA 4II2A 2FRHA 3CF2A 4RGSA 1ZR4A 4UB8C 3EDPA 3BR5A 1SD7A 1XMAA 2XB0X 1XMXA 2NS8A 3ECOA 4I7HA 4M6XA 4ENKA 2O8KA 2EIMH 1W5TA 3DPTA 4E7SA 3I4NJ 3NRVA 3C3WA 2DU9A 1H9GA 1KONA 2VJIA 3HOUJ 2CJJA 4RA2A 2EZLA 2QF7A 3HIFA 5E1ZB 2ZMEB 4EGYA 3L1PA 2XVCA 1Y39A 4RB2C 1D0ZA 4XSXF 4JBAA 3GXOA 1GDTA 1EJ9A 3O2PE 3CJRB 4O6JA 3K4MA 3V8JA 1R1VA 3K2AA 4J01A 5CVVA 4LG0B 2L9NA 4XRSG 5TGTA 2XC7A 3BZCA 3FXRA 2K40A 4U0VA 2DDAA 4QPQA 4FETA 4DYQA 2BW3A 2ZJPF 3MKWB 2PEXA 2UZKA 1TW3A 5AONA 4CCLA 5LHGA 3OS0A 4DZJA 2LC2A 1YIJI 1WI3A 4G7OF 1A35A 3TO7A 2R7RA 2TDXA 1DPUA 1TWCJ 2FBIA 3ULQB 3GZ5A 2QQBA 3MAJA 4YIFA 4QWQA 5ERIA 3HDDA 2EB7A 5E1WA 4Z6YA 2HTJA 4XOTA 5FKMA 2C6YA 2IS2A 1FOXA 3L09A 1SVOA 3V42A 1VQ8I 3AG2H 1YYVA 3S3MA 1ZR2A 4Y33A 2E36A 5CVRA 1YW8A 1QNTA 4BACA 3QPLA 2FU4A 1ZKGA 3PNYA 1DPRA 1D0XA 4XRFA 1EA3A 1M1EB 2NS0A 3BR3A 3JTGA 4HLYA 1OCRH 2IW5A 3HOYJ 3OR2C 1X1BA 2FX0A 4Y15A 2HDWA 3EYYA 2NOJB 3BC8A 1IUFA 2KZVA 3I0TA 5CVUA 4UVAA 3BJOA 1VQ9I 1VQ4I 4JYKA 4JQFA 2IXSA 3QODA 3CCUI 2EZIA 2OUMA 3DEEA 3UNGC 4FHTA 1ETYA 4IHSA 3I54A 1V5FA 3Q0WA 4ZTJA 4EQQA 1PUFA 4RDUA 3GTQJ 4A0XA 1ZRFA 1PDNC 4PUSA 5J6XA 1B9MA 1I1GA 2FQ3A 1MDMB 2F5VA 1MMDA
chains in the Genus database with same CATH topology
3MCZA 2P4WA 5DD8A 5BQTA 2PMHA 1OR7A 4L18B 2K27A 1T39A 5ED4A 2EK5A 2GA1A 2QBYA 3ABTA 2E1NA 4KN7X 3HUGA 4MTEA 3E5UA 3BY6A 3TOAA 3LAJA 2Z99A 4TV7A 4CXFA 2HFHA 4EGZA 3WTUC 3L00A 1OYWA 3WGGA 2ZJ2A 3W6JB 1GXPA 2PJPA 3IHUA 2P7CB 5FB2A 3P7NA 1ZG3A 3WTVC 4RS8A 1Z1DA 3KZZA 2YPRA 1G3YA 1RIOH 3WTTC 3QP5A 5ILSA 2VONA 3HRUA 1FC3A 2MA3A 2PG4A 1Z7UA 4ZYGA 2EV0A 5J8CA 1OPCA 1H9TA 2M5WA 3HTUA 4LLNA 2VXZA 1KU9A 4S04A 3B73A 3T8TA 2XUBA 4CHUA 4XLNF 5ILUA 1UHMA 5BOXA 2OZ6A 1TQIA 1XSVA 2W57A 4BQAA 1KU2A 2A07F 4CICA 1K78B 3MWMA 1S3JA 2KRFA 2XAQA 5IT3A 2RDPA 3EYIA 4I0AA 1BOAA 1YW9A 3ZMZA 1XDSA 2UXXA 2LKPA 1F9NA 3H92A 1HSTA 4ZYEA 2DQRA 4ENMA 5E20A 2RQPA 4YIIA 5LGUA 2WWYA 2DPUA 4ESJA 1ON2A 1SMYF 3LWFA 4KIBA 3GWZA 2BV6A 4MHGA 2XRNA 1S8NA 2M8EA 3M8EA 1IN7A 1TQPA 4S05A 4EJVA 1J7KA 2VBZA 2LNBA 2FOKA 3VODA 1S7OA 4WCGA 1ZRDA 1XCBA 1T6SA 3VEPA 4L0YB 3WTWC 2K4JA 1SMTA 5DYMA 4HX7A 2EA4A 2V9VA 1BC7C 1R5GA 4CZZA 3GUDA 4E70A 5ICGA 5E1XA 1G3WA 5AIQA 1J59A 4KYWA 1R7JA 4IRIA 5AIPA 3RPQA 1T2KA 4HOBA 2L4MA 3DP7A 1R36A 3CO6C 4Y13A 4G8XA 4B8XA 3G3ZA 3E6MA 4I09A 2K7LA 2Q2EA 3I53A 3MZHA 1O57A 1O3RA 4HQMA 2H27A 3ZMVA 4EJWA 1Q1HA 3N4MA 1MGTA 1REPC 2LSOA 3HSEA 3M9AA 4EJUA 5D4SA 3C18A 3COAC 2IJLA 4MGRA 2A5YB 2IT0A 1B59A 1R00A 5JHUA 4MQVA 3VFZA 1TBXA 1UFMA 2Z5UA 3F72A 3JAMK 1TTYA 4IRGA 2J5PA 2ZKZA 3B02A 5H20A 4UV8A 2QBYB 2HKXA 2EA2A 2QQ9A 4KICA 1HKQA 4M9XA 2JSCA 2MLKA 1XGNA 3WE3A 2HR3A 2ISYA 2FE3A 3I59B 2ZO4A 4EMSA 4GGGA 5FD5A 2XAJA 2FMLA 3CUQA 2AXLA 2CWEA 2VC1A 2HTSA 3Q9VA 1I6XA 3F6OA 1R22A 3FHZA 5L3FA 1Y0UA 1YG2A 1ZN2A 2K86A 4Y17A 4M74A 4IPAA 5FLXZ 4HF2A 3QP6A 2LDUA 1P92A 2OU2A 4HDUA 3KP3A 1JGSA 4R79A 2O03A 3F8NA 5ICFA 1LEAA 1W7PD 4MQ9F 3ERED 4WXDA 2FXAA 3N97A 5K1YA 3WE2A 3LQQA 4LJZF 1D8KA 3REOA 2FF4A 2V79A 1O3TA 1XB4A 1ZGAA 3RKWA 1QBJA 1KQ8A 1ODDA 2DT5A 4BYYA 3I58A 4BHPA 1LJ9A 4AD9A 3L9FA 2ZBKA 4FX4A 4HF1A 4BH9A 4RGUA 4U88A 3ZN0A 2VOPA 4YFNF 5ILVA 2Y48A 4MEYF 4JK1X 3U2RA 5BPDA 3SQNA 2FMYA 4L9TA 2HWVA 5LEJA 4A0ZA 5CLSA 4IHTA 3HSRA 5HLGA 1KU7A 3GFIA 2UWMA 1XD7A 4MEXF 5DUIA 3BOQA 4CDGA 4A6DA 1SFXA 3CJNA 4B09A 4ENNA 3WGHA 1WWXA 2PBIA 1RZ4A 2D1HA 5CYVA 2JZYA 5D8KB 3RKXA 4I98B 4UUVA 2V6CA 4UHTA 3WG9A 5L3DA 1FYKA 2CFXA 1IRFA 5IT9Z 2V1UA 5FD6A 3L7WA 3LA2A 4G6QA 3HOSA 1RUOA 2E1CA 2HKOA 2DK5A 2VBYA 1B4AA 1IXRC 2D2WA 3C1DA 4RAZA 4WX9A 2YSRA 1CF7A 2WV0A 3ZMTA 3E5QA 1I1SA 2HEOA 3R6SA 3FM3A 4G9YA 2A69F 4HV5A 3F23A 1JHFA 2FA5A 4KN4X 1MJBA 4N9IA 1LDJA 4YFXF 4I2OA 1FP1D 2XGXA 3IWFA 2QENA 2VODA 5LGTA 2KKOA 2EFQA 3O6BB 3I64A 5EEHA 2LF7A 4KIGA 2GQQA 1BIAA 3J7AO 1BC8C 4HX4A 1HKTA 2GIVA 1ZLKA 1S6LA 3KP6A 3RKYA 1IXCA 3P9KA 1G6NA 3E6CC 3TO9A 4LLGF 4XLPF 3SZTA 4EVIA 2UXNA 2IA1A 4XBFA 2ZNZA 2CW0F 3W6KB 1W4MA 1P4AA 2OQRA 1J2XA 5BMZA 1P6RA 2CGPA 3RJPA 1XGSA 3GX4X 2XROA 2DTRA 2ADUA 5FFZA 3KP5A 1F5TA 4ETSA 1HQCA 5FLXK 4G7HF 4UVCA 3KFWX 3R0JA 1EH7A 4HA8A 3K69A 4IVNA 1PP7U 4GXOA 5TJJA 2Z33A 1USSA 2HGCA 1XSDA 2K4BA 3M7GA 4R8HA 3ZP5A 1VTNC 1R58A 2KJCA 3MFKA 4G7ZF 1P2FA 4HW0A 4P9UA 2QLZA 4EM0B 3TO6A 2L01A 3R0AA 1U3EM 2XASA 3SHFA 5HDKA 2PQ8A 1MJ9A 4OIPF 1KYWA 3WU1B 1LEBA 1FYLA 4NB5A 2P5VA 3ECHA 3FMRA 2BE5F 1F1ZA 1IN5A 3WODF 4ESBA 1I5ZA 3QPHA 2DPDA 1S29A 3WGIA 4HQEA 1RNLA 1ZREA 1Z05A 4P5OA 3OV8A 3CDHA 2QWWA 2VOOA 1ZG1A 3RYPA 4OIOF 4ON0A 1QZZA 2L54A 4QLCU 3F8CA 2ZMEA 1FOKA 4EV0A 5ICEA 2FNPA 2DQLA 1HXDA 2RN7A 2P5KA 1S7AA 4LG0A 1XGMA 4OMZA 2CSOA 4HF0A 3ML6A 4Q5SF 3PQKA 2GXGA 2IVMA 4CGZA 2STTA 1FZPB 1LDKB 1JE8A 2AS5F 3KLOA 4IRHA 1YW7A 3HRMA 3RPUA 1FY7A 2DLLA 3BJAA 5D5VB 2IA0A 2QVOA 3U1DA 4KMUX 5K5QA 1WSUA 2ACJA 1XMKA 2XKPA 1YO5C 4OU0A 3GFMA 1IN4A 4L9NA 1BIBA 2IPQX 2Q8KA 3FXQA 2OQGA 3P9IA 3IKVA 2VBXA 3R61A 2KIFA 2L3DA 2A6HF 3TDZC 1JXSA 1FBQA 1ZH5A 1ZLJA 3ZMDA 2A3SA 3D0SA 5LHIA 4L5IA 2E7WA 2Y75A 4OMYA 1IN8A 4AIHA 3IRRA 4KDPA 1XGOA 2FBHA 1V3FA 4EM1A 3IWZA 2BEOA 4RB0A 1B1BA 3BZ6A 3V7RA 2O6GE 1ZRCA 5D5WB 1P4XA 4LK0F 1ZARA 3V7SA 2F5EA 5DUKA 3ZQ7A 1XSXA 2OBPA 2CYYA 3LA7A 2QUFA 3BPVA 4A5NA 2EV6A 3HTSB 3D5LA 4MNUA 5K5OA 2H6BA 4A0YA 3L2CA 1GXQA 1FX7A 2HZTA 4MTDA 3CUQC 1K78A 2P6SA 2HS5A 4PZJA 2HOEA 4NHJA 3IKTA 3VOEA 1YLFA 3V8KA 3ABUA 2W84A 3JSPA 3WTYC 2F5FA 1FLIA 1BI3A 2MD5A 3E6DA 4YG2F 2XHKA 3JW4A 1BM9A 1RUNA 1HW5A 3WU0A 2YU3A 3FXUA 2L4AA 3QU3A 2PMUA 4Q47A 2PFBA 1PP8F 4IJAA 1YS6A 3RTRA 1L0OC 4GO1A 3RYRA 2HDCA 1XCVA 2BYVE 2X4HA 5E8GA 2MH2A 1W5SA 4I02A 3JAMZ 1C0WA 3CUOA 5DD4A 4KNYA 3F8FA 4P96A 2FNAA 1B9NA 3ZN1A 4EM2A 4KT5C 4LLLA 5BPIA 2DO7A 2OA4A 1BJAA 3DF8A 3T0YA 4BXUA 1D8JA 1DDNA 1J0RA 4LK1F 3F6VA 4AWXB 3QU6A 4LD5A 5CVJA 3KCCA 3JSOA 2VE8A 3IL2A 5HDNA 1Z6RA 4LFUA 4ZYDA 2QQAA 3LQRA 1T0FA 1V4RA 3WTXC 1WI9A 2X0LA 4RAYA 1WKMA 1TQMA 1ZAOA 5HS7A 2NYXA 4ZZDA 2QM3A 1U2WA 2JPCA 2O0YA 5DDGA 5JI6A 1EH8A 4BHBA 1BI1A 2GXBA 1E17A 3ZPLA 4P55A 5TRDA 2DBBA 2IA2A 4ZZLA 2FEZA 1U5TB 5DCMA 3NEUA 1TNSA 3QRFF 3QAHA 4U0YA 3F8BA 2D1VA 3EQLF 2NAZA 1EV7A 3RDIA 4BNCA 4XSZF 3HRTA 5CJ9A 1GHCA 5L3GA 3FZVA 1QO0D 2COMA 4D0PA 2VT2A 2V1XA 3FMSA 4LB6B 4OIQF 3F22A 2HQNA 1QZYA 2R3SA 1E2XA 1MKMA 1Z9CA 1FP2A 1HW2A 2VE9A 1IZ1A 3TGNA 1R23A 1ZHFA 5LBQA 1SAXA 2LF8A 2D45A 3DEUA 3M1EA 3CO7C 3I71A 2DW4A 5E17F 2Z9OA 1U6GA 2M45A 5HS8A 3J80Z 4A12A 2WC2A 2EFOA 1WQ2A 1I27A 3T1BA 1R1UA 4KFCA 5D6EA 2FBKA 1IUYA 2YX4A 1FNNA 4L5JA 5E18F 2MC3A 3T8RA 2HQRA 2ZNYA 4ZYHA 3BJ6A 1Z6TA 3LFKA 3E3VA 2EFNA 5HS9A 3ZMUA 3JTHA 4Q4ZF 3FX3A 3KE2A 3CTAA 5L3BA 4EJTA 3DFGA 1G4DA 4M71A 1IN6A 3K1PA 4BHCA 1AWCA 3BPXA 3WTSC 3FF5A 1IAWA 1O3QA 1LDDA 2EFPA 3P9CA 1FPQA 2YX7A 1LNWA 3F8MA 1FBUA 1O3SA 1U5TC 4UXNA 2H09A 4L0ZB 3VB2A 1YS7A 1O7LA 1BN5A 3Q9SA 1TLHB 2JTVA 3TDUC 1NHAA 2EWNA 1QQIA 2XAGA 4HLXA 3J80K 4AIKA 2W24A 2ESNA 2A6EF 4U7DA 2PI0A 5A2QZ 5ICCA 4G6DA 3J81K 3T5XA 1OKRA 4FX0A 4AIJA 2O3FA 2F5CA 1G3TA 1F4KA 1BBYA 4L9VA 2RKHA 3K1MA 2CG4A 3F3XA 2MLGA 4L9JA 2ISZA 3G73A 1IF1A 3BDDA 2ELHA 4GYIA 5K5RA 1D5VA 5FFXA 3PFIA 4M6YA 1MJAA 1LQ1A 1MD0A 2F5DA 4K2EA 4UV9A 1T38A 4UNOA 3I5UA 5HLHA 2Q0OA 2ZFWA 3NQOA 2EJRA 5L3CA 1U78A 2H94A 3HYIA 2W25A 3WTZA 1T98A 1Z91A 2MH9A 1J5YA 3GF2A 1R5HA 5E8IA 1CGPA 3M8FA 1L3LA 1OYIA 1TNTA 1CF7B 1DUXC 1LVAA 1U8RA 4AVPA 4GYGA 4OINF 2O61A 5DCFA 3DXJF 4RGRA 3V4GA 1KU3A 3GEZA 3C7JA 2GZWA 4DNCA 4M72A 5F6FA 2A61A 4A2UA 4RGXA 2QYOA 2L02A 4CO8A 3LAPA 2OAZA 3GLXA 1MDMA 4KA4A 2HYFA 2Y0MA 1IW7F 2VBWA 3DPLC 2EFWA 3Q5FA 4PGHA 4P9FA 3KLNA 3HHGA 1QGPA 2GWRA 2IP2A 5J8FA 2DAOA 3KP2A 4WWCA 4HAMA 1YTYA 5F64A 2XAFA 2W85A 2GA2A 4I01A 2ESHA 1J9IA 2J5OA 2M30A 5H6RA 3HSFA 3F21A 3AAFA 3QOPA 2RGVA 3DQVC 1XDUA 3GW2A 2B0LA 3KEOA 4HYEA 3GFJA 2R7FA 5L3EA 1SD6A 2RC4A 1KGSA 3DKWA 1IRGA 2G7UA 5KVRA 3TOBA 3GO5A 2PN6A 4HZFA 4ENJA 2RNJA 1ULYA 1OMIA 1DP7P 4FT8A 4OOIA 2M87A 1LB2A 4M9SA 3ISPA 3ROUA 4PCQA 2P8TA 4RB1A 3IC7A 4KUMA 2VT3A 5FGMA 1YIOA 3OOPA 1X3UA 2O8XA 4UVBA 4ZH4F 3ZMSA 3HOTA 2QZ8A 4IXAA 2YR2A 2WTEA 1FSHA 3I59A 5BS6A 4KIFA 1K7AA 4OIRF 3HRSA 1HKSA 1XN7A 3TKYA 1J75A 2ZCWA 3EUHA 3HHHA 1RI7A 3BWGA 1HW1A 1UB9A 3KP7A 3MQ0A 2H6CA 1B6AA 2BBYA 2CQKA 2P7VB 1STZA 3TQNA 3K0LA 4O5VA 3SXYA 5D5UB 3QPTA 5LRRA 4WK8F 1FSEA 2ETHA 4LGWA 1UHWA 1KQ9A 5LLQA 1KYZA 1AOYA 3FWEA 3MEXA 5D8LB 1HSJA 5F1RA 4Z2YA 1BI0A 2K02A 2HYGD 3DV8A 4R1HA 2P5LC 3IRQA 3J81Z 5HVQC 1FT9A 2Z3YA 3RI4A 4PDKA 5LEKA 2OD5A 4BAYA 2XIGA 1SD5A 1GVJA 4YFKF 3V7CA 1ZYRF 3GVAA 3S2WA 3H3ZA 3KP4A 2G7HA 3U9GA 1BI2A 3SFZA 4F7ZA 4H0EA 1D3YA 2XV4S 4M9ZA 5DEQA 2KIMA 5LRSA 2NRAC 5HOOA 4Q48A 3BROA 1KQ0A 4IF4A 1P4WA 2G9WA 4U7BA 1WRJA 6PAXA 3MZYA 2JPBA 2JT1A 3E5XA 1TW2A 1IXSB 1R1TA 3BP8A 5DCMB 1USTA 3E97A 4WXHA 1SD4A 3ELKA 1W7PA 1W7PB 5DV5A 5H6QA 5LGNA 4WXCA 5LHHA 1K6OA 1FWZA 3LSTA 2A68F 3GFLA 4M73A 5EEGA 4DQ2A 5JVTA 2DFIA 1SFUA 4I0BA 3KEQA 3K2ZA 2KIUA 5D4RA 4NQWA 2FSWA 4LB5A 2P6TA 3EETA 1O7FA 3LA3A 1A04A 5KK1A 2DK8A 3GZ6A 3E6BA 1PUEE 2VC0A 4EJOA 4HX8A 5D5XB 4A6EA 1QPMA 2EV5A 3GYHX 4ESFA 3SZPA 2CO5A 1U5TA 4KMFA 1JHHA 3RIRA 2M1BA 4WF2A 2MBFA 2GAUA 1ONVA 2OZUA 3R60A 3FMQA 5FO5A 1ZGJA 1K79A 5HDGA 2JRTA 3K1NA 5JFRA 5CVIA 4PGGA 4HBLA 3K9TA 1EH6A 1ZG5A 3KETA 2NNYA 3CLOA 5JR3A 5A2QK 1YQAA 4RB3C 3PQJA 5IT9K 4G94A 2KJBA 2XKOA 3O3KA 1H0MA 4O3MA 1ON1A 3H3UA 3KZYA 2R7DA 2BGCA 4N9HA 2STWA 2NNNA 4HV6A 2VN2A 3FM5A 2DI3A 1HBXG 4ASNA 5D6FA 1YFHA 1OYYA 4A5MA 1SFEA 1UCRA 2RV8A 4HDVA 2F2EA 2PLYA 2IRFG 1KA8A 2ZXJA 2V1DA 2RVCA 2E7XA 4N0BA 4GCVA 4U0WA 3R4KA 1FYMA 3CUQB 1MZBA 4CYDA 3I4PA 1G3SA 4LMYA 1FBSA 2XAHA 5HLIA 3V8LA 2FRHA 4RGSA 3EDPA 1SD7A 1XMAA 3ECOA 4I7HA 4M6XA 4ENKA 1W5TA 3DPTA 3NRVA 3C3WA 2DU9A 1H9GA 3HIFA 5E1ZB 2ZMEB 4EGYA 2XVCA 4RB2C 4XSXF 4JBAA 3GXOA 3O2PE 4O6JA 3V8JA 1R1VA 5CVVA 4LG0B 3FXRA 4U0VA 2PEXA 2UZKA 1TW3A 5AONA 5LHGA 4G7OF 3TO7A 2TDXA 1DPUA 2FBIA 3ULQB 3GZ5A 2QQBA 3MAJA 4YIFA 4QWQA 5ERIA 2EB7A 5E1WA 2C6YA 2HTJA 3L09A 1YYVA 5CVRA 1YW8A 1QNTA 2FU4A 4XRFA 1DPRA 2NS0A 3JTGA 4HLYA 2IW5A 4Y15A 3EYYA 5CVUA 3I0TA 4UVAA 3BJOA 4JQFA 4IHSA 4FHTA 3I54A 4EQQA 4A0XA 1ZRFA 1PDNC 5J6XA 1B9MA 1I1GA 2FQ3A 1MDMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCZ A;  2P4W A;  5DD8 A;  5BQT A;  2PMH A;  1OR7 A;  4L18 B;  2K27 A;  1T39 A;  5ED4 A;  2EK5 A;  2GA1 A;  2QBY A;  3ABT A;  2E1N A;  4KN7 X;  3HUG A;  4MTE A;  3E5U A;  3BY6 A;  3TOA A;  3LAJ A;  2Z99 A;  4TV7 A;  4CXF A;  2HFH A;  4EGZ A;  3WTU C;  3L00 A;  1OYW A;  3WGG A;  2ZJ2 A;  3W6J B;  1GXP A;  2PJP A;  3IHU A;  2P7C B;  5FB2 A;  3P7N A;  1ZG3 A;  3WTV C;  4RS8 A;  1Z1D A;  3KZZ A;  2YPR A;  1G3Y A;  1RIO H;  3WTT C;  3QP5 A;  5ILS A;  2VON A;  3HRU A;  1FC3 A;  2MA3 A;  2PG4 A;  1Z7U A;  4ZYG A;  2EV0 A;  5J8C A;  1OPC A;  1H9T A;  2M5W A;  3HTU A;  4LLN A;  2VXZ A;  1KU9 A;  4S04 A;  3B73 A;  3T8T A;  2XUB A;  4CHU A;  4XLN F;  5ILU A;  1UHM A;  5BOX A;  2OZ6 A;  1TQI A;  1XSV A;  2W57 A;  4BQA A;  1KU2 A;  2A07 F;  4CIC A;  1K78 B;  3MWM A;  1S3J A;  2KRF A;  2XAQ A;  5IT3 A;  2RDP A;  3EYI A;  4I0A A;  1BOA A;  1YW9 A;  3ZMZ A;  1XDS A;  2UXX A;  2LKP A;  1F9N A;  3H92 A;  1HST A;  4ZYE A;  2DQR A;  4ENM A;  5E20 A;  2RQP A;  4YII A;  5LGU A;  2WWY A;  2DPU A;  4ESJ A;  1ON2 A;  1SMY F;  3LWF A;  4KIB A;  3GWZ A;  2BV6 A;  4MHG A;  2XRN A;  1S8N A;  2M8E A;  3M8E A;  1IN7 A;  1TQP A;  4S05 A;  4EJV A;  1J7K A;  2VBZ A;  2LNB A;  2FOK A;  3VOD A;  1S7O A;  4WCG A;  1ZRD A;  1XCB A;  1T6S A;  3VEP A;  4L0Y B;  3WTW C;  2K4J A;  1SMT A;  5DYM A;  4HX7 A;  2EA4 A;  2V9V A;  1BC7 C;  1R5G A;  4CZZ A;  3GUD A;  4E70 A;  5ICG A;  5E1X A;  1G3W A;  5AIQ A;  1J59 A;  4KYW A;  1R7J A;  4IRI A;  5AIP A;  3RPQ A;  1T2K A;  4HOB A;  2L4M A;  3DP7 A;  1R36 A;  3CO6 C;  4Y13 A;  4G8X A;  4B8X A;  3G3Z A;  3E6M A;  4I09 A;  2K7L A;  2Q2E A;  3I53 A;  3MZH A;  1O57 A;  1O3R A;  4HQM A;  2H27 A;  3ZMV A;  4EJW A;  1Q1H A;  3N4M A;  1MGT A;  1REP C;  2LSO A;  3HSE A;  3M9A A;  4EJU A;  5D4S A;  3C18 A;  3COA C;  2IJL A;  4MGR A;  2A5Y B;  2IT0 A;  1B59 A;  1R00 A;  5JHU A;  4MQV A;  3VFZ A;  1TBX A;  1UFM A;  2Z5U A;  3F72 A;  3JAM K;  1TTY A;  4IRG A;  2J5P A;  2ZKZ A;  3B02 A;  5H20 A;  4UV8 A;  2QBY B;  2HKX A;  2EA2 A;  2QQ9 A;  4KIC A;  1HKQ A;  4M9X A;  2JSC A;  2MLK A;  1XGN A;  3WE3 A;  2HR3 A;  2ISY A;  2FE3 A;  3I59 B;  2ZO4 A;  4EMS A;  4GGG A;  5FD5 A;  2XAJ A;  2FML A;  3CUQ A;  2AXL A;  2CWE A;  2VC1 A;  2HTS A;  3Q9V A;  1I6X A;  3F6O A;  1R22 A;  3FHZ A;  5L3F A;  1Y0U A;  1YG2 A;  1ZN2 A;  2K86 A;  4Y17 A;  4M74 A;  4IPA A;  5FLX Z;  4HF2 A;  3QP6 A;  2LDU A;  1P92 A;  2OU2 A;  4HDU A;  3KP3 A;  1JGS A;  4R79 A;  2O03 A;  3F8N A;  5ICF A;  1LEA A;  1W7P D;  4MQ9 F;  3ERE D;  4WXD A;  2FXA A;  3N97 A;  5K1Y A;  3WE2 A;  3LQQ A;  4LJZ F;  1D8K A;  3REO A;  2FF4 A;  2V79 A;  1O3T A;  1XB4 A;  1ZGA A;  3RKW A;  1QBJ A;  1KQ8 A;  1ODD A;  2DT5 A;  4BYY A;  3I58 A;  4BHP A;  1LJ9 A;  4AD9 A;  3L9F A;  2ZBK A;  4FX4 A;  4HF1 A;  4BH9 A;  4RGU A;  4U88 A;  3ZN0 A;  2VOP A;  4YFN F;  5ILV A;  2Y48 A;  4MEY F;  4JK1 X;  3U2R A;  5BPD A;  3SQN A;  2FMY A;  4L9T A;  2HWV A;  5LEJ A;  4A0Z A;  5CLS A;  4IHT A;  3HSR A;  5HLG A;  1KU7 A;  3GFI A;  2UWM A;  1XD7 A;  4MEX F;  5DUI A;  3BOQ A;  4CDG A;  4A6D A;  1SFX A;  3CJN A;  4B09 A;  4ENN A;  3WGH A;  1WWX A;  2PBI A;  1RZ4 A;  2D1H A;  5CYV A;  2JZY A;  5D8K B;  3RKX A;  4I98 B;  4UUV A;  2V6C A;  4UHT A;  3WG9 A;  5L3D A;  1FYK A;  2CFX A;  1IRF A;  5IT9 Z;  2V1U A;  5FD6 A;  3L7W A;  3LA2 A;  4G6Q A;  3HOS A;  1RUO A;  2E1C A;  2HKO A;  2DK5 A;  2VBY A;  1B4A A;  1IXR C;  2D2W A;  3C1D A;  4RAZ A;  4WX9 A;  2YSR A;  1CF7 A;  2WV0 A;  3ZMT A;  3E5Q A;  1I1S A;  2HEO A;  3R6S A;  3FM3 A;  4G9Y A;  2A69 F;  4HV5 A;  3F23 A;  1JHF A;  2FA5 A;  4KN4 X;  1MJB A;  4N9I A;  1LDJ A;  4YFX F;  4I2O A;  1FP1 D;  2XGX A;  3IWF A;  2QEN A;  2VOD A;  5LGT A;  2KKO A;  2EFQ A;  3O6B B;  3I64 A;  5EEH A;  2LF7 A;  4KIG A;  2GQQ A;  1BIA A;  3J7A O;  1BC8 C;  4HX4 A;  1HKT A;  2GIV A;  1ZLK A;  1S6L A;  3KP6 A;  3RKY A;  1IXC A;  3P9K A;  1G6N A;  3E6C C;  3TO9 A;  4LLG F;  4XLP F;  3SZT A;  4EVI A;  2UXN A;  2IA1 A;  4XBF A;  2ZNZ A;  2CW0 F;  3W6K B;  1W4M A;  1P4A A;  2OQR A;  1J2X A;  5BMZ A;  1P6R A;  2CGP A;  3RJP A;  1XGS A;  3GX4 X;  2XRO A;  2DTR A;  2ADU A;  5FFZ A;  3KP5 A;  1F5T A;  4ETS A;  1HQC A;  5FLX K;  4G7H F;  4UVC A;  3KFW X;  3R0J A;  1EH7 A;  4HA8 A;  3K69 A;  4IVN A;  1PP7 U;  4GXO A;  5TJJ A;  2Z33 A;  1USS A;  2HGC A;  1XSD A;  2K4B A;  3M7G A;  4R8H A;  3ZP5 A;  1VTN C;  1R58 A;  2KJC A;  3MFK A;  4G7Z F;  1P2F A;  4HW0 A;  4P9U A;  2QLZ A;  4EM0 B;  3TO6 A;  2L01 A;  3R0A A;  1U3E M;  2XAS A;  3SHF A;  5HDK A;  2PQ8 A;  1MJ9 A;  4OIP F;  1KYW A;  3WU1 B;  1LEB A;  1FYL A;  4NB5 A;  2P5V A;  3ECH A;  3FMR A;  2BE5 F;  1F1Z A;  1IN5 A;  3WOD F;  4ESB A;  1I5Z A;  3QPH A;  2DPD A;  1S29 A;  3WGI A;  4HQE A;  1RNL A;  1ZRE A;  1Z05 A;  4P5O A;  3OV8 A;  3CDH A;  2QWW A;  2VOO A;  1ZG1 A;  3RYP A;  4OIO F;  4ON0 A;  1QZZ A;  2L54 A;  4QLC U;  3F8C A;  2ZME A;  1FOK A;  4EV0 A;  5ICE A;  2FNP A;  2DQL A;  1HXD A;  2RN7 A;  2P5K A;  1S7A A;  4LG0 A;  1XGM A;  4OMZ A;  2CSO A;  4HF0 A;  3ML6 A;  4Q5S F;  3PQK A;  2GXG A;  2IVM A;  4CGZ A;  2STT A;  1FZP B;  1LDK B;  1JE8 A;  2AS5 F;  3KLO A;  4IRH A;  1YW7 A;  3HRM A;  3RPU A;  1FY7 A;  2DLL A;  3BJA A;  5D5V B;  2IA0 A;  2QVO A;  3U1D A;  4KMU X;  5K5Q A;  1WSU A;  2ACJ A;  1XMK A;  2XKP A;  1YO5 C;  4OU0 A;  3GFM A;  1IN4 A;  4L9N A;  1BIB A;  2IPQ X;  2Q8K A;  3FXQ A;  2OQG A;  3P9I A;  3IKV A;  2VBX A;  3R61 A;  2KIF A;  2L3D A;  2A6H F;  3TDZ C;  1JXS A;  1FBQ A;  1ZH5 A;  1ZLJ A;  3ZMD A;  2A3S A;  3D0S A;  5LHI A;  4L5I A;  2E7W A;  2Y75 A;  4OMY A;  1IN8 A;  4AIH A;  3IRR A;  4KDP A;  1XGO A;  2FBH A;  1V3F A;  4EM1 A;  3IWZ A;  2BEO A;  4RB0 A;  1B1B A;  3BZ6 A;  3V7R A;  2O6G E;  1ZRC A;  5D5W B;  1P4X A;  4LK0 F;  1ZAR A;  3V7S A;  2F5E A;  5DUK A;  3ZQ7 A;  1XSX A;  2OBP A;  2CYY A;  3LA7 A;  2QUF A;  3BPV A;  4A5N A;  2EV6 A;  3HTS B;  3D5L A;  4MNU A;  5K5O A;  2H6B A;  4A0Y A;  3L2C A;  1GXQ A;  1FX7 A;  2HZT A;  4MTD A;  3CUQ C;  1K78 A;  2P6S A;  2HS5 A;  4PZJ A;  2HOE A;  4NHJ A;  3IKT A;  3VOE A;  1YLF A;  3V8K A;  3ABU A;  2W84 A;  3JSP A;  3WTY C;  2F5F A;  1FLI A;  1BI3 A;  2MD5 A;  3E6D A;  4YG2 F;  2XHK A;  3JW4 A;  1BM9 A;  1RUN A;  1HW5 A;  3WU0 A;  2YU3 A;  3FXU A;  2L4A A;  3QU3 A;  2PMU A;  4Q47 A;  2PFB A;  1PP8 F;  4IJA A;  1YS6 A;  3RTR A;  1L0O C;  4GO1 A;  3RYR A;  2HDC A;  1XCV A;  2BYV E;  2X4H A;  5E8G A;  2MH2 A;  1W5S A;  4I02 A;  3JAM Z;  1C0W A;  3CUO A;  5DD4 A;  4KNY A;  3F8F A;  4P96 A;  2FNA A;  1B9N A;  3ZN1 A;  4EM2 A;  4KT5 C;  4LLL A;  5BPI A;  2DO7 A;  2OA4 A;  1BJA A;  3DF8 A;  3T0Y A;  4BXU A;  1D8J A;  1DDN A;  1J0R A;  4LK1 F;  3F6V A;  4AWX B;  3QU6 A;  4LD5 A;  5CVJ A;  3KCC A;  3JSO A;  2VE8 A;  3IL2 A;  5HDN A;  1Z6R A;  4LFU A;  4ZYD A;  2QQA A;  3LQR A;  1T0F A;  1V4R A;  3WTX C;  1WI9 A;  2X0L A;  4RAY A;  1WKM A;  1TQM A;  1ZAO A;  5HS7 A;  2NYX A;  4ZZD A;  2QM3 A;  1U2W A;  2JPC A;  2O0Y A;  5DDG A;  5JI6 A;  1EH8 A;  4BHB A;  1BI1 A;  2GXB A;  1E17 A;  3ZPL A;  4P55 A;  5TRD A;  2DBB A;  2IA2 A;  4ZZL A;  2FEZ A;  1U5T B;  5DCM A;  3NEU A;  1TNS A;  3QRF F;  3QAH A;  4U0Y A;  3F8B A;  2D1V A;  3EQL F;  2NAZ A;  1EV7 A;  3RDI A;  4BNC A;  4XSZ F;  3HRT A;  5CJ9 A;  1GHC A;  5L3G A;  3FZV A;  1QO0 D;  2COM A;  4D0P A;  2VT2 A;  2V1X A;  3FMS A;  4LB6 B;  4OIQ F;  3F22 A;  2HQN A;  1QZY A;  2R3S A;  1E2X A;  1MKM A;  1Z9C A;  1FP2 A;  1HW2 A;  2VE9 A;  1IZ1 A;  3TGN A;  1R23 A;  1ZHF A;  5LBQ A;  1SAX A;  2LF8 A;  2D45 A;  3DEU A;  3M1E A;  3CO7 C;  3I71 A;  2DW4 A;  5E17 F;  2Z9O A;  1U6G A;  2M45 A;  5HS8 A;  3J80 Z;  4A12 A;  2WC2 A;  2EFO A;  1WQ2 A;  1I27 A;  3T1B A;  1R1U A;  4KFC A;  5D6E A;  2FBK A;  1IUY A;  2YX4 A;  1FNN A;  4L5J A;  5E18 F;  2MC3 A;  3T8R A;  2HQR A;  2ZNY A;  4ZYH A;  3BJ6 A;  1Z6T A;  3LFK A;  3E3V A;  2EFN A;  5HS9 A;  3ZMU A;  3JTH A;  4Q4Z F;  3FX3 A;  3KE2 A;  3CTA A;  5L3B A;  4EJT A;  3DFG A;  1G4D A;  4M71 A;  1IN6 A;  3K1P A;  4BHC A;  1AWC A;  3BPX A;  3WTS C;  3FF5 A;  1IAW A;  1O3Q A;  1LDD A;  2EFP A;  3P9C A;  1FPQ A;  2YX7 A;  1LNW A;  3F8M A;  1FBU A;  1O3S A;  1U5T C;  4UXN A;  2H09 A;  4L0Z B;  3VB2 A;  1YS7 A;  1O7L A;  1BN5 A;  3Q9S A;  1TLH B;  2JTV A;  3TDU C;  1NHA A;  2EWN A;  1QQI A;  2XAG A;  4HLX A;  3J80 K;  4AIK A;  2W24 A;  2ESN A;  2A6E F;  4U7D A;  2PI0 A;  5A2Q Z;  5ICC A;  4G6D A;  3J81 K;  3T5X A;  1OKR A;  4FX0 A;  4AIJ A;  2O3F A;  2F5C A;  1G3T A;  1F4K A;  1BBY A;  4L9V A;  2RKH A;  3K1M A;  2CG4 A;  3F3X A;  2MLG A;  4L9J A;  2ISZ A;  3G73 A;  1IF1 A;  3BDD A;  2ELH A;  4GYI A;  5K5R A;  1D5V A;  5FFX A;  3PFI A;  4M6Y A;  1MJA A;  1LQ1 A;  1MD0 A;  2F5D A;  4K2E A;  4UV9 A;  1T38 A;  4UNO A;  3I5U A;  5HLH A;  2Q0O A;  2ZFW A;  3NQO A;  2EJR A;  5L3C A;  1U78 A;  2H94 A;  3HYI A;  2W25 A;  3WTZ A;  1T98 A;  1Z91 A;  2MH9 A;  1J5Y A;  3GF2 A;  1R5H A;  5E8I A;  1CGP A;  3M8F A;  1L3L A;  1OYI A;  1TNT A;  1CF7 B;  1DUX C;  1LVA A;  1U8R A;  4AVP A;  4GYG A;  4OIN F;  2O61 A;  5DCF A;  3DXJ F;  4RGR A;  3V4G A;  1KU3 A;  3GEZ A;  3C7J A;  2GZW A;  4DNC A;  4M72 A;  5F6F A;  2A61 A;  4A2U A;  4RGX A;  2QYO A;  2L02 A;  4CO8 A;  3LAP A;  2OAZ A;  3GLX A;  1MDM A;  4KA4 A;  2HYF A;  2Y0M A;  1IW7 F;  2VBW A;  3DPL C;  2EFW A;  3Q5F A;  4PGH A;  4P9F A;  3KLN A;  3HHG A;  1QGP A;  2GWR A;  2IP2 A;  5J8F A;  2DAO A;  3KP2 A;  4WWC A;  4HAM A;  1YTY A;  5F64 A;  2XAF A;  2W85 A;  2GA2 A;  4I01 A;  2ESH A;  1J9I A;  2J5O A;  2M30 A;  5H6R A;  3HSF A;  3F21 A;  3AAF A;  3QOP A;  2RGV A;  3DQV C;  1XDU A;  3GW2 A;  2B0L A;  3KEO A;  4HYE A;  3GFJ A;  2R7F A;  5L3E A;  1SD6 A;  2RC4 A;  1KGS A;  3DKW A;  1IRG A;  2G7U A;  5KVR A;  3TOB A;  3GO5 A;  2PN6 A;  4HZF A;  4ENJ A;  2RNJ A;  1ULY A;  1OMI A;  1DP7 P;  4FT8 A;  4OOI A;  2M87 A;  1LB2 A;  4M9S A;  3ISP A;  3ROU A;  4PCQ A;  2P8T A;  4RB1 A;  3IC7 A;  4KUM A;  2VT3 A;  5FGM A;  1YIO A;  3OOP A;  1X3U A;  2O8X A;  4UVB A;  4ZH4 F;  3ZMS A;  3HOT A;  2QZ8 A;  4IXA A;  2YR2 A;  2WTE A;  1FSH A;  3I59 A;  5BS6 A;  4KIF A;  1K7A A;  4OIR F;  3HRS A;  1HKS A;  1XN7 A;  3TKY A;  1J75 A;  2ZCW A;  3EUH A;  3HHH A;  1RI7 A;  3BWG A;  1HW1 A;  1UB9 A;  3KP7 A;  3MQ0 A;  2H6C A;  1B6A A;  2BBY A;  2CQK A;  2P7V B;  1STZ A;  3TQN A;  3K0L A;  4O5V A;  3SXY A;  5D5U B;  3QPT A;  5LRR A;  4WK8 F;  1FSE A;  2ETH A;  4LGW A;  1UHW A;  1KQ9 A;  5LLQ A;  1KYZ A;  1AOY A;  3FWE A;  3MEX A;  5D8L B;  1HSJ A;  5F1R A;  4Z2Y A;  1BI0 A;  2K02 A;  2HYG D;  3DV8 A;  4R1H A;  2P5L C;  3IRQ A;  3J81 Z;  5HVQ C;  1FT9 A;  2Z3Y A;  3RI4 A;  4PDK A;  5LEK A;  2OD5 A;  4BAY A;  2XIG A;  1SD5 A;  1GVJ A;  4YFK F;  3V7C A;  1ZYR F;  3GVA A;  3S2W A;  3H3Z A;  3KP4 A;  2G7H A;  3U9G A;  1BI2 A;  3SFZ A;  4F7Z A;  4H0E A;  1D3Y A;  2XV4 S;  4M9Z A;  5DEQ A;  2KIM A;  5LRS A;  2NRA C;  5HOO A;  4Q48 A;  3BRO A;  1KQ0 A;  4IF4 A;  1P4W A;  2G9W A;  4U7B A;  1WRJ A;  6PAX A;  3MZY A;  2JPB A;  2JT1 A;  3E5X A;  1TW2 A;  1IXS B;  1R1T A;  3BP8 A;  5DCM B;  1UST A;  3E97 A;  4WXH A;  1SD4 A;  3ELK A;  1W7P A;  1W7P B;  5DV5 A;  5H6Q A;  5LGN A;  4WXC A;  5LHH A;  1K6O A;  1FWZ A;  3LST A;  2A68 F;  3GFL A;  4M73 A;  5EEG A;  4DQ2 A;  5JVT A;  2DFI A;  1SFU A;  4I0B A;  3KEQ A;  3K2Z A;  2KIU A;  5D4R A;  4NQW A;  2FSW A;  4LB5 A;  2P6T A;  3EET A;  1O7F A;  3LA3 A;  1A04 A;  5KK1 A;  2DK8 A;  3GZ6 A;  3E6B A;  1PUE E;  2VC0 A;  4EJO A;  4HX8 A;  5D5X B;  4A6E A;  1QPM A;  2EV5 A;  3GYH X;  4ESF A;  3SZP A;  2CO5 A;  1U5T A;  4KMF A;  1JHH A;  3RIR A;  2M1B A;  4WF2 A;  2MBF A;  2GAU A;  1ONV A;  2OZU A;  3R60 A;  3FMQ A;  5FO5 A;  1ZGJ A;  1K79 A;  5HDG A;  2JRT A;  3K1N A;  5JFR A;  5CVI A;  4PGG A;  4HBL A;  3K9T A;  1EH6 A;  1ZG5 A;  3KET A;  2NNY A;  3CLO A;  5JR3 A;  5A2Q K;  1YQA A;  4RB3 C;  3PQJ A;  5IT9 K;  4G94 A;  2KJB A;  2XKO A;  3O3K A;  1H0M A;  4O3M A;  1ON1 A;  3H3U A;  3KZY A;  2R7D A;  2BGC A;  4N9H A;  2STW A;  2NNN A;  4HV6 A;  2VN2 A;  3FM5 A;  2DI3 A;  1HBX G;  4ASN A;  5D6F A;  1YFH A;  1OYY A;  4A5M A;  1SFE A;  1UCR A;  2RV8 A;  4HDV A;  2F2E A;  2PLY A;  2IRF G;  1KA8 A;  2ZXJ A;  2V1D A;  2RVC A;  2E7X A;  4N0B A;  4GCV A;  4U0W A;  3R4K A;  1FYM A;  3CUQ B;  1MZB A;  4CYD A;  3I4P A;  1G3S A;  4LMY A;  1FBS A;  2XAH A;  5HLI A;  3V8L A;  2FRH A;  4RGS A;  3EDP A;  1SD7 A;  1XMA A;  3ECO A;  4I7H A;  4M6X A;  4ENK A;  1W5T A;  3DPT A;  3NRV A;  3C3W A;  2DU9 A;  1H9G A;  3HIF A;  5E1Z B;  2ZME B;  4EGY A;  2XVC A;  4RB2 C;  4XSX F;  4JBA A;  3GXO A;  3O2P E;  4O6J A;  3V8J A;  1R1V A;  5CVV A;  4LG0 B;  3FXR A;  4U0V A;  2PEX A;  2UZK A;  1TW3 A;  5AON A;  5LHG A;  4G7O F;  3TO7 A;  2TDX A;  1DPU A;  2FBI A;  3ULQ B;  3GZ5 A;  2QQB A;  3MAJ A;  4YIF A;  4QWQ A;  5ERI A;  2EB7 A;  5E1W A;  2C6Y A;  2HTJ A;  3L09 A;  1YYV A;  5CVR A;  1YW8 A;  1QNT A;  2FU4 A;  4XRF A;  1DPR A;  2NS0 A;  3JTG A;  4HLY A;  2IW5 A;  4Y15 A;  3EYY A;  5CVU A;  3I0T A;  4UVA A;  3BJO A;  4JQF A;  4IHS A;  4FHT A;  3I54 A;  4EQQ A;  4A0X A;  1ZRF A;  1PDN C;  5J6X A;  1B9M A;  1I1G A;  2FQ3 A;  1MDM B; 
#chains in the Genus database with same CATH topology
 1OR7 C;  2YUS A;  3DU5 A;  2EIK H;  3MCZ A;  2P4W A;  3K4K A;  3H5A A;  5DD8 A;  1LFB A;  2PMH A;  5BQT A;  2VQH A;  2FUG 2;  5J4V A;  1OR7 A;  4L18 B;  4XMY A;  2K27 A;  1T39 A;  2W00 A;  5ED4 A;  2EK5 A;  2GA1 A;  3GTP J;  1AKH A;  3ABT A;  2QBY A;  2E1N A;  2JJ7 A;  2IS4 A;  4KN7 X;  1N75 A;  4YIR X;  3HUG A;  4CCJ A;  4MTE A;  1Z3X A;  3U1K A;  3M8J A;  3ZXS A;  2X6O A;  1X3Z B;  3BG5 A;  3E5U A;  3BY6 A;  2LBF B;  4V2G A;  3C2B A;  2L7K A;  4ZDL A;  1BOB A;  3GTM J;  3MN2 A;  2Y30 A;  3TOA A;  3LAJ A;  1H8A C;  2LLK A;  2MSY A;  4G6T B;  2Z99 A;  4TV7 A;  1Y8Q B;  4CXF A;  2FQ4 A;  3VSL A;  5C3E J;  2HFH A;  3M07 A;  4RM2 A;  4EGZ A;  2K9S A;  3WTU C;  3OL3 A;  2LP0 A;  2E2I J;  3L00 A;  5KCM A;  1OYW A;  3WGG A;  2ZJ2 A;  1HDP A;  1LFP A;  3W6J B;  1WPK A;  1IJW C;  4D7N A;  4NNJ A;  1S7E A;  3HXL A;  2R5Z A;  1GXP A;  2PJP A;  3IHU A;  3RPU D;  1BR4 A;  3KEY A;  3TW7 A;  3HL2 A;  5FB2 A;  2P7C B;  2R7S A;  3P7N A;  1V54 H;  3O8H A;  1ZG3 A;  5LFA A;  3WTV C;  1WJA A;  1Z1D A;  3KZZ A;  4RS8 A;  4HNT A;  3L2Q A;  5LD2 C;  2YPR A;  2HOA A;  2LG4 A;  1G3Y A;  2K3F A;  1RIO H;  3WTT C;  3QP5 A;  5ILS A;  2VON A;  2OPT A;  4J00 A;  3HRU A;  1FC3 A;  2MA3 A;  2V26 A;  2PG4 A;  1Z7U A;  4IL6 C;  3I55 I;  1EKE A;  4ZYG A;  2KLO A;  2EV0 A;  2OTL I;  4BEH A;  1OPC A;  5J8C A;  1H9T A;  1APL C;  3OIP A;  2M5W A;  4E7J A;  3ZQF A;  3HTU A;  4LLN A;  2VXZ A;  4HSR A;  2I10 A;  1KU9 A;  4S04 A;  2XPV A;  3G1O A;  3B73 A;  3T8T A;  2XUB A;  3L2W A;  4CHU A;  4XLN F;  2ELJ A;  5KNL A;  5ILU A;  1UHM A;  5BOX A;  2OZ6 A;  3FKI J;  3OMY A;  1TQI A;  1XSV A;  2W57 A;  4E7H A;  4BQA A;  3E0J B;  2NVY J;  1KU2 A;  2NVX J;  2A07 F;  2WBM A;  4CIC A;  1K78 B;  3MWM A;  1S3J A;  3MKL A;  2KRF A;  3SFI A;  2XAQ A;  5IT3 A;  2RDP A;  1SAN A;  1YRN A;  1YX5 A;  4I0A A;  4RM3 A;  3EYI A;  5IPA A;  1BOA A;  2KT0 A;  1E3P A;  1YW9 A;  3ZMZ A;  2L9R A;  2YU9 J;  1XDS A;  2UXX A;  2BVL A;  2DOD A;  2LKP A;  1D1C A;  1F9N A;  3H92 A;  1HST A;  4ZYE A;  3SZG A;  4XON A;  2DQR A;  4ENM A;  4BL0 B;  5E20 A;  2P0W A;  2R5Y B;  2JVG A;  2RQP A;  4JX6 A;  4YII A;  5KAF C;  3CCS I;  5LGU A;  2WWY A;  2DPU A;  5F1J A;  4ESJ A;  1ON2 A;  2BOL A;  3CDL A;  1SMY F;  3LWF A;  4KIB A;  3WHC A;  3FXJ A;  3GWZ A;  2BV6 A;  2KIS A;  4MHG A;  3K6G A;  3OYJ A;  1YX3 A;  2XRN A;  1S8N A;  2M8E A;  4DOZ A;  2GXA A;  3M8E A;  1IN7 A;  1TQP A;  1Z0X A;  4S05 A;  3ESW B;  4EJV A;  2PJR B;  4XM3 A;  1J7K A;  3TMO A;  3D5R C;  2VBZ A;  2LNB A;  2FOK A;  3P5J A;  3VOD A;  5IOZ A;  1S7O A;  1S9H A;  4WCG A;  3OYI A;  1EF4 A;  1ZRD A;  1XCB A;  1K83 J;  1T6S A;  3VEP A;  4Y4R A;  2M0M A;  3W2V A;  4L0Y B;  3WTW C;  2K4J A;  1SMT A;  5DYM A;  4HX7 A;  2EA4 A;  2MGQ A;  1OJL A;  2V9V A;  3EPZ A;  4NDL A;  1BC7 C;  1R5G A;  4CZZ A;  1VQL I;  3GUD A;  2V7F A;  3ZQI A;  4E70 A;  5GAH J;  1JUS A;  2DJI A;  5ICG A;  5E1X A;  1G3W A;  3QYF A;  1QVT A;  2QKL B;  4NC6 A;  4B3X A;  3ZR8 X;  4BQQ A;  2E1O A;  3DU6 A;  3HBL A;  5AIQ A;  1R7J A;  1J59 A;  4IRI A;  4KYW A;  5AIP A;  3RPQ A;  3HJE A;  1JTX A;  2OJE D;  2M9H A;  5GTH C;  1T2K A;  3JRG A;  4XQF A;  4HOB A;  2L4M A;  2DTZ A;  2JVH A;  3DP7 A;  1R36 A;  4PSW A;  3CO6 C;  4Y13 A;  2O5R A;  5DTD A;  5B5E C;  4G8X A;  2RNG A;  2G0E A;  2KRC A;  4E7K A;  4B8X A;  3H1C A;  3CES A;  1T95 A;  3G3Z A;  2O7O A;  3E6M A;  4I09 A;  1S72 I;  3K10 A;  2K7L A;  2Q2E A;  3CP8 A;  3I53 A;  4PJM A;  3MZH A;  2DA5 A;  2LKX A;  1O57 A;  4A3F J;  1O3R A;  4IKF A;  3FKJ A;  1U9N A;  2DFH A;  4HQM A;  4XLF A;  2R7X A;  2H27 A;  2WAQ N;  2ZJQ F;  3ZMV A;  4EJW A;  5F0C A;  4E7I A;  1H89 C;  1HCR A;  2V4J C;  1Q1H A;  3GBG A;  3N4M A;  3ABK H;  1MGT A;  4IOA F;  2ECB A;  2LSO A;  2X9D A;  3HSE A;  4IOC F;  1REP C;  3L2R A;  3M9A A;  3VYU B;  1K4S A;  5IOY A;  4EJU A;  5D4S A;  3GTO J;  3C18 A;  1RET A;  3COA C;  1ETK A;  2BY1 A;  2IJL A;  4MGR A;  4FE7 A;  2A5Y B;  2QA4 I;  2IT0 A;  2XSJ C;  3PO2 J;  3PIP F;  1TWH J;  2NS7 A;  1B59 A;  1R00 A;  5JHU A;  4MQV A;  3VFZ A;  4CSW A;  4CYC B;  1TBX A;  1UFM A;  3QWL A;  1R6R A;  3HKZ N;  2Z5U A;  3F72 A;  4LOC A;  3JAM K;  1TTY A;  4IRG A;  2J5P A;  2V9P A;  2ZKZ A;  3B02 A;  5H20 A;  3BTC A;  1VQO I;  2KMU A;  4UV8 A;  1AKH B;  2QBY B;  2HKX A;  2EA2 A;  2KRH A;  2QQ9 A;  2VXD A;  4KIC A;  1HKQ A;  4M9X A;  1G59 A;  1JKO C;  2JSC A;  5EDN A;  2OC6 A;  1FIA A;  2MLK A;  1X4P A;  1XGN A;  1XG1 A;  2E1M B;  1VQ7 I;  3WE3 A;  2HR3 A;  2ISY A;  2FE3 A;  3MD2 A;  1MNM C;  3I59 B;  2ZO4 A;  4EMS A;  4BKX A;  4GGG A;  2LD5 A;  5FD5 A;  2XAJ A;  2HXI A;  2FML A;  4BQN A;  2AQE A;  2DT7 B;  4F3Q A;  3CUQ A;  2AXL A;  2CWE A;  2VC1 A;  4XKC A;  1VQ6 I;  2HTS A;  2XF7 A;  3Q9V A;  1VF9 A;  1I6X A;  1WH7 A;  1TT5 B;  3F6O A;  3S1R J;  1R22 A;  3B6C A;  2IGK A;  1ACI A;  3FHZ A;  4IHV A;  5L3F A;  2IGO A;  1Y0U A;  1YG2 A;  1VQ5 I;  1HLV A;  5J47 A;  2OTJ I;  1ZN2 A;  4CZC A;  2K86 A;  4Y17 A;  4M74 A;  1JJ8 C;  4IPA A;  3LSM A;  5FLX Z;  4HF2 A;  2AO9 A;  3I56 I;  3QP6 A;  2KFD A;  2LDU A;  1P92 A;  2OU2 A;  4P1W A;  4HDU A;  3BCB A;  2W82 A;  2X48 A;  3H5R A;  3KP3 A;  1JKR C;  1A36 A;  4X1E A;  1W5C C;  1JGS A;  1V55 H;  4R79 A;  2O03 A;  4CCM A;  4QSH A;  1RR8 C;  3F8N A;  5ICF A;  1FJL A;  1LEA A;  2ID6 A;  3HKZ A;  1W7P D;  2K9N A;  1Y1V J;  4MQ9 F;  3S3N A;  1VQP I;  3ERE D;  4WXD A;  3B6A A;  4PSX A;  3OYL A;  4OAY A;  1TT0 A;  2FXA A;  3E7L A;  3CP2 A;  3N97 A;  2B9S A;  5K1Y A;  3WE2 A;  3LQQ A;  1GT0 C;  5EYR A;  4LIV A;  2W4S A;  4LJZ F;  1D8K A;  2QEX I;  2M4G A;  5BNG A;  3REO A;  5DM6 F;  2FF4 A;  2CW8 A;  2V79 A;  1O3T A;  1XB4 A;  3DBR B;  1ZGA A;  3RKW A;  2V1N A;  2VUM J;  1OQY A;  1QBJ A;  1KQ8 A;  1ODD A;  4EAT A;  2E2J J;  3CC4 I;  2DT5 A;  4UB6 C;  3LSP A;  1MIJ A;  5FLV A;  4BYY A;  3I58 A;  4A3L J;  4BHP A;  3FBN B;  1LJ9 A;  2KZG A;  3L9F A;  4AD9 A;  2ZBK A;  4FX4 A;  2CUJ A;  2IGN A;  5EF6 A;  1K6Y A;  4HF1 A;  4BH9 A;  4RGU A;  2XRL A;  3BG7 A;  1X1D A;  4U88 A;  1QVU A;  1IDY A;  2R5Y A;  1X1A A;  3ZN0 A;  2H1L A;  2VOP A;  4YFN F;  5ILV A;  3TW6 A;  2Y48 A;  2CUF A;  4MEY F;  4JK1 X;  1W0T A;  4DW6 A;  3U2R A;  3OYF A;  1F36 A;  5BPD A;  1XTA A;  3SQN A;  2FMY A;  4L9T A;  3CMY A;  2HWV A;  5LEJ A;  3ZQQ A;  3HGY A;  3BR6 A;  3HOW J;  4A0Z A;  3HOZ J;  3OL4 A;  5FRN A;  1Z77 A;  3ASO H;  1OIS A;  5CLS A;  4QIW N;  3D1N I;  4IHT A;  2E19 A;  3HSR A;  5HLG A;  2JUG A;  2Z16 A;  4LIU A;  1WJE A;  1KU7 A;  3GFI A;  2E5N A;  2UWM A;  3HEF A;  2X6Y A;  1BW5 A;  4B1R A;  4IQJ A;  2H8R A;  4KT6 A;  3U21 A;  1XD7 A;  4KIT B;  1DQU A;  1OFC X;  4MEX F;  2LVS A;  2TCT A;  1IG7 A;  5DUI A;  2X51 A;  3BOQ A;  4CDG A;  2P81 A;  3ONQ A;  5EG0 B;  3QYE A;  4CYC A;  2PMZ N;  3GTJ J;  4A6D A;  4C9Y A;  1SFX A;  3CJN A;  4B09 A;  1N25 A;  2X1E A;  3OIQ A;  2DMN A;  4ENN A;  3WGH A;  2BVM A;  1WWX A;  3HB9 A;  4E7Z A;  2PBI A;  1QHG A;  1RZ4 A;  3VWB A;  2D1H A;  2R0Q C;  3A1Y A;  5CYV A;  2JZY A;  2AQF A;  5D8K B;  3IV5 A;  2GBY A;  2L7F P;  3RKX A;  1X2M A;  4I98 B;  4UUV A;  2V6C A;  3DPU A;  4UHT A;  3WG9 A;  5L3D A;  1IC8 A;  3GTL J;  5JHF A;  1FYK A;  5HOD A;  2CFX A;  4BJ6 C;  1IRF A;  3KPH A;  5IT9 Z;  4GRI A;  2HDD A;  2V1U A;  5FD6 A;  3OYM A;  3PUF A;  3CF5 F;  3L7W A;  3LA2 A;  4G6Q A;  2DJN A;  3HOS A;  1RUO A;  2R92 J;  2E1C A;  2HKO A;  1AU7 A;  2DK5 A;  2VBY A;  4N4O B;  4E7L A;  1B4A A;  2VB6 A;  2K5C A;  1IXR C;  3KYL A;  2D2W A;  3C1D A;  4B4C A;  3CCQ I;  4RAZ A;  4WX9 A;  2YSR A;  1RES A;  1CF7 A;  5GAE J;  2WV0 A;  3UR3 C;  1QHH D;  5K7H A;  3MKZ A;  3ZMT A;  3E5Q A;  1I1S A;  1ETV A;  2L7M P;  2HEO A;  5GPA A;  1HOM A;  3FXK A;  2X6X A;  3R6S A;  3FM3 A;  2R7V A;  4G9Y A;  2A69 F;  3OWT A;  4HV5 A;  3F23 A;  1JHF A;  2FA5 A;  2CUE A;  4KN4 X;  3BTL A;  1MJB A;  4N9I A;  1LDJ A;  1Z21 A;  4YFX F;  4I2O A;  1FP1 D;  2LRE A;  4XLE A;  2XGX A;  3IWF A;  2DA4 A;  2EPF A;  1GLN A;  2QEN A;  4W1U A;  1UZC A;  2VOD A;  5LGT A;  5IP9 J;  2KKO A;  2EFQ A;  3O6B B;  1IRZ A;  3I64 A;  5EEH A;  1WHU A;  3LFU A;  5M3M J;  2LF7 A;  4KIG A;  2Y0S N;  2GQQ A;  3BT9 A;  1BIA A;  4YEL A;  3J7A O;  3ZQC A;  1BC8 C;  4HX4 A;  3GLL A;  4D5F A;  1HKT A;  4CCK A;  2GIV A;  1D5Y A;  1ZLK A;  1S6L A;  5JVG F;  1JUM A;  3KP6 A;  4J19 A;  3RKY A;  1IXC A;  3P9K A;  1G6N A;  3NWS A;  3JRB A;  3C2H A;  3E6C C;  3TO9 A;  4LLG F;  4XLP F;  3SZT A;  4EVI A;  1FTZ A;  2UXN A;  1I3Q J;  2FOW A;  3HM5 A;  2IA1 A;  4XBF A;  2ZNZ A;  2CW0 F;  1D0Y A;  3W6K B;  1W4M A;  3TP3 A;  2CQX A;  1P4A A;  2OQR A;  1J2X A;  2E5Z A;  2CQ7 A;  5BMZ A;  1P6R A;  5JLX A;  2CGP A;  1DGW Y;  3RJP A;  4F92 B;  1XGS A;  3EUA A;  2XRO A;  3GX4 X;  2DTR A;  2RAE A;  4G12 A;  2ADU A;  2WAQ A;  5FFZ A;  3KP5 A;  2LH9 A;  3ASN H;  1F5T A;  2WB1 N;  4ETS A;  1HQC A;  2CRG A;  5FLX K;  9ANT A;  4G7H F;  4UVC A;  1TP4 A;  3KFW X;  3R0J A;  2M7B A;  1EH7 A;  4HA8 A;  3K69 A;  4IVN A;  3JRC A;  1PP7 U;  4GXO A;  5TJJ A;  1YJW I;  2Z33 A;  1N78 A;  1USS A;  1DU6 A;  3HOX J;  2L0K A;  3LSR A;  2HGC A;  1XSD A;  2K4B A;  5EZH A;  3IH3 A;  2X1C A;  3M7G A;  4R8H A;  3ZP5 A;  5K7Z A;  3Q3S A;  2QSG X;  1FEX A;  1R4M B;  2BY0 A;  3IH2 A;  1B8I A;  5IYD J;  2VL8 A;  2DYR H;  5FKL A;  4HNU A;  2LY2 A;  3NAR A;  1R58 A;  2KJC A;  1VTN C;  3MFK A;  3CC7 I;  2B63 J;  4BE1 A;  4G7Z F;  1P2F A;  4HW0 A;  4P9U A;  2QLZ A;  3FXL A;  2M34 A;  2KL4 A;  4EM0 B;  3TP0 A;  3TO6 A;  5J1R A;  1WJ5 A;  5GPC A;  2L01 A;  2E60 A;  1ENH A;  3OYG A;  3R0A A;  1U3E M;  2XAS A;  3A02 A;  3SHF A;  2VQL A;  2L9S A;  2WV1 A;  5HDK A;  2PQ8 A;  1YJ9 I;  1MJ9 A;  4RLF A;  1KYW A;  4OIP F;  3WU1 B;  2K9M A;  1LEB A;  1FYL A;  4NB5 A;  2P5V A;  3ECH A;  3FMR A;  1YJN I;  2HYJ A;  2BE5 F;  1F1Z A;  1IN5 A;  3PSF A;  2VIX A;  5EZG A;  3WOD F;  4ESB A;  1I5Z A;  3QPH A;  1NK3 P;  2DPD A;  1S29 A;  4A69 C;  3WGI A;  4HQE A;  5B66 C;  1RNL A;  1ORK A;  1ZRE A;  1Z05 A;  1S5L C;  2NXN B;  4P5O A;  3MKY B;  3OV8 A;  3OYC A;  3N05 A;  2JA2 A;  2N8G A;  3CDH A;  2AXT C;  2QWW A;  2X1D A;  2Z2S B;  4PJJ A;  5FKN A;  1HC8 A;  2VOO A;  5M5W J;  2UV1 A;  2XSD C;  1ZG1 A;  3RYP A;  4OIO F;  3LSK A;  4ON0 A;  4IHY A;  1HF0 A;  4V2F A;  5EJC A;  1QZZ A;  2L54 A;  4XKW A;  3BG3 A;  4QLC U;  3CCJ I;  2COB A;  4XL9 A;  3F8C A;  2ZME A;  5HNF A;  3OYA A;  1FOK A;  4EV0 A;  1Y56 A;  5ICE A;  2HQ5 A;  2QGU A;  2H8W A;  3CJT B;  4FE4 A;  2XAU A;  2ZB9 A;  2FNP A;  1V5E A;  1HXD A;  2DQL A;  2RN7 A;  3K4J A;  4BXF A;  2P5K A;  1S7A A;  5B3S H;  2Y9Y A;  2MD0 A;  3S17 J;  4LG0 A;  1XGM A;  5M5Y J;  2ZC2 A;  4OMZ A;  4ANJ A;  2CSO A;  1PVE A;  3E1S A;  4HF0 A;  3ML6 A;  2BY3 A;  4Q5S F;  1SFK A;  2ZXI A;  3RQ4 A;  3PQK A;  2GXG A;  3A03 A;  4FTH A;  2IVM A;  1I6H J;  4CGZ A;  2STT A;  1Z3Y A;  3HOV J;  1P9Q C;  4XRM A;  4BJ5 C;  1FZP B;  3OS2 A;  1LDK B;  1JE8 A;  5HLT A;  3KLO A;  2AS5 F;  1T08 B;  3SEZ A;  4IRH A;  1YW7 A;  3HRM A;  2GLO A;  2OCC H;  3RPU A;  1FY7 A;  2DLL A;  1IV6 A;  2E34 A;  3BJA A;  5D5V B;  1FIP A;  3M1C A;  2IA0 A;  1W1W E;  2QVO A;  3AL0 C;  4QTR A;  3U1D A;  4KMU X;  1WZ2 A;  5K5Q A;  1WSU A;  2ACJ A;  3S2D J;  1XMK A;  1MBF A;  2XKP A;  3SEQ A;  2M3A A;  4OU0 A;  3OYH A;  4A3K J;  1YO5 C;  2IAI A;  3AL0 B;  2VPR A;  4UUT A;  3GFM A;  4CCO A;  1IN4 A;  4B44 A;  4L9N A;  4HST A;  1BIB A;  2IPQ X;  2Q8K A;  3FXQ A;  1FOY A;  2OQG A;  2K85 A;  3CCY A;  3P9I A;  3IKV A;  2VBX A;  3R61 A;  3TED A;  2HZD A;  4I6Z A;  2DA2 A;  3K7A J;  2R5Z B;  2KIF A;  3LL7 A;  3RQI A;  2L3D A;  2A6H F;  4BBR J;  3TDZ C;  3ZQL A;  1JXS A;  4D9J A;  1FBQ A;  2CU7 A;  2JRM A;  4II3 A;  3ZQG A;  1ZH5 A;  4B47 A;  1ZLJ A;  3ZMD A;  1VQM I;  2A3S A;  3D0S A;  4NUB A;  5LHI A;  4L5I A;  4A3E J;  2LOO A;  1QZE A;  2E7W A;  4XOR A;  2DMU A;  1X3W B;  3FK7 A;  2Y75 A;  2RRE A;  4OMY A;  3A01 B;  1IN8 A;  3OSG A;  4YRV A;  4AIH A;  3IRR A;  3PM1 A;  3OYB A;  2MYS A;  2LK2 A;  3H35 A;  4XN3 A;  4U87 A;  4KDP A;  1XGO A;  1FTT A;  2FBH A;  1V3F A;  4EM1 A;  1UG0 A;  3IWZ A;  1JT0 A;  2BEO A;  3JCU C;  3HPG A;  2R7W A;  4RB0 A;  3JRF A;  3S2H J;  5DM7 F;  1MMS A;  1B1B A;  3BZ6 A;  3MZ8 A;  3V7R A;  1SVM A;  1NK2 P;  2CQQ A;  1I3A A;  2XB5 A;  2O6G E;  1ZRC A;  5D5W B;  1P4X A;  3BCA A;  2XDV A;  3HGG A;  1ETO A;  4LK0 F;  1ZAR A;  3V7S A;  5F04 A;  2F5E A;  5IP6 A;  1MND A;  2CS3 A;  1RKT A;  4KIS A;  1VZ0 A;  5DUK A;  3OSF A;  3ZQ7 A;  1XSX A;  2CW7 A;  4UUS B;  2OBP A;  2CYY A;  3VPR A;  4H4K C;  3LA7 A;  4QPO A;  3GZN B;  2QUF A;  2L9V A;  3VSK A;  4CA0 A;  5JLW A;  4PJN A;  1ETX A;  3BPV A;  4MFE A;  4BEH B;  3BG6 A;  2HPI A;  3PFY A;  4A5N A;  3LNQ A;  2EV6 A;  1IO2 A;  4ZDP A;  3HTS B;  3D5L A;  4MNU A;  4A3D J;  5K5O A;  2H6B A;  3I3L A;  3MVP A;  1FOW A;  4A0Y A;  3L2C A;  1N77 A;  1GXQ A;  5EG0 A;  1FX7 A;  4I76 A;  2DA3 A;  2E35 A;  2HZT A;  4MTD A;  3CUQ C;  4XLH A;  2RQQ A;  1K78 A;  2P6S A;  1R4N B;  2HS5 A;  3BTJ A;  3F9K A;  4BUP A;  2BHZ A;  4PZJ A;  2AHQ A;  2KQR A;  2HOE A;  1OCZ H;  4NHJ A;  3H9Q A;  5J4Y A;  3IKT A;  2DFE A;  2KIQ A;  2EIN H;  3VOE A;  4XIC A;  1YLF A;  3LMM A;  3V8K A;  2Y69 H;  3ABU A;  2W84 A;  3JSP A;  3WTY C;  2R7T A;  2BHY A;  2CQN A;  4AC0 A;  3W2A A;  2B7E A;  4F93 B;  1VND A;  2F5F A;  1BI3 A;  1FLI A;  2MD5 A;  3E6D A;  4YG2 F;  4C2M J;  2XHK A;  3JW4 A;  3IAM 2;  1J09 A;  1BM9 A;  1RUN A;  3H5N A;  3PIO F;  5E3O A;  1HW5 A;  3WU0 A;  4BJT A;  1LE8 B;  3NWT A;  4XLC A;  4X0G A;  1YE9 A;  2YU3 A;  4RBO A;  1UG2 A;  3FXU A;  2L4A A;  3QU3 A;  2PMU A;  4Q47 A;  3CJQ B;  2PFB A;  3RZD J;  4W97 A;  1PP8 F;  4FIS A;  4IJA A;  1YS6 A;  3W2W A;  2HOT A;  3RTR A;  1L0O C;  4PFP A;  1A5J A;  4GO1 A;  2IGM A;  4NC7 A;  4XR6 A;  3RYR A;  5M3F J;  2HDC A;  1XCV A;  2BYV E;  1GVD A;  2X4H A;  5E8G A;  1O4X A;  4B48 A;  2NOG A;  3CMM A;  3EUK L;  3ABM H;  2MH2 A;  1W5S A;  4I02 A;  3JAM Z;  3H0G J;  1C0W A;  3SJM A;  5FKK A;  3CUO A;  5DD4 A;  4A93 J;  4KNY A;  3F8F A;  1TWG J;  3KZI C;  4P96 A;  2FNA A;  2DDB A;  4LIT A;  1B9N A;  2GOM A;  1KZH A;  3ZN1 A;  4EM2 A;  4KT5 C;  4LLL A;  1DGR M;  1Y0N A;  5BPI A;  1OLT A;  2DO7 A;  1OCT C;  2OA4 A;  1BJA A;  3DF8 A;  3T0Y A;  2WAD A;  4PJ0 C;  3H0D A;  2XF5 A;  1P7J A;  4BXU A;  1DDN A;  1D8J A;  1UMQ A;  1J0R A;  4M3G A;  4LK1 F;  3F6V A;  4AWX B;  2DA6 A;  2O9L A;  1VQK I;  3G2B A;  3QU6 A;  4LD5 A;  5CVJ A;  1JKP C;  3KCC A;  5HNH A;  1D1A A;  3A01 A;  3GTK J;  3JSO A;  3AG3 H;  2VE8 A;  3IL2 A;  5HDN A;  1Z6R A;  3EUH C;  1I39 A;  4LFU A;  3DCF A;  2F4I A;  4ZYD A;  2QQA A;  3LQR A;  1T0F A;  1V4R A;  3WTX C;  4JP0 A;  1JTY A;  1WI9 A;  1I50 J;  1OCP A;  2X0L A;  4RAY A;  2EZH A;  1WKM A;  1FMV A;  1TQM A;  1ZAO A;  5HS7 A;  1R9T J;  2NYX A;  4ZZD A;  3M4O J;  2QM3 A;  1U2W A;  2JPC A;  4PFO A;  2O0Y A;  1WJB A;  2IEK A;  3FHN A;  5DDG A;  5JI6 A;  4A3M J;  1EH8 A;  4L5E A;  4BHB A;  1T8I A;  1BI1 A;  2WY7 Q;  3IH4 A;  5C4J J;  1MBG A;  2HXO A;  2GXB A;  3A2K A;  2NVQ J;  1E17 A;  3ZPL A;  4P55 A;  2JSP A;  5GP9 A;  4XNF A;  2XPW A;  5TRD A;  5F27 A;  2CV2 A;  3NAU A;  3ZOB A;  2DBB A;  3J7Y J;  2IA2 A;  3FK6 A;  2W1O A;  4ZZL A;  3CCM I;  2FEZ A;  3O8G A;  1U5T B;  5DCM A;  1D1B A;  3NEU A;  1TNS A;  3QRF F;  2ZSH B;  3QAH A;  4U0Y A;  3F8B A;  4JX4 A;  4Y3O A;  2D1V A;  3TBI A;  3BR2 A;  3EQL F;  2MC4 A;  2NAZ A;  2KPM A;  1EV7 A;  4YEJ A;  4BQO A;  3RDI A;  4BNC A;  3WU2 C;  4XSZ F;  3HRT A;  5CJ9 A;  1GHC A;  5L3G A;  1H88 C;  3FZV A;  1QO0 D;  2WA0 A;  2COM A;  1SEU A;  1F43 A;  2BW3 B;  4D0P A;  2HVQ A;  2VKD A;  4IHW A;  2D5V A;  2VT2 A;  2V1X A;  3FMS A;  3G4S I;  4DJA A;  4LB6 B;  3TL4 X;  4OIQ F;  1JGG A;  5J1U A;  3F22 A;  2HQN A;  1TWA J;  3SDB A;  1QZY A;  3CCE I;  2R3S A;  1X1P A;  1E0E A;  1E2X A;  2W48 A;  4D7M A;  1MKM A;  2MFZ A;  4C2U A;  1Z9C A;  1FP2 A;  1HW2 A;  4OWR B;  2VE9 A;  2LY1 A;  1MW7 A;  1FMW A;  1IZ1 A;  1JKQ C;  2K3P A;  3TGN A;  1Z67 A;  2BXZ A;  1R23 A;  1ZHF A;  5LBQ A;  1SAX A;  3BR0 A;  2LF8 A;  2D45 A;  3DEU A;  3M1E A;  3CO7 C;  1OCC H;  5IYC J;  3H9J A;  3I71 A;  2DW4 A;  5E17 F;  3JRH A;  2Z9O A;  2VJ5 A;  2XF6 A;  1U6G A;  2M45 A;  5HS8 A;  3J80 Z;  3S14 J;  3FDY A;  3CCL I;  4GFB A;  3ZGK A;  4A12 A;  4A3J J;  1W0U A;  2WC2 A;  5TIS C;  2EFO A;  1BA5 A;  1WQ2 A;  1I27 A;  3T1B A;  2EBI A;  1R1U A;  4KFC A;  5D6E A;  3CCV I;  1DP3 A;  1G8X A;  2FBK A;  2ME0 A;  1P7I A;  2VQG A;  2XGD A;  3RZO J;  1IUY A;  2YX4 A;  3DTE A;  2JMW A;  4D1Q A;  2TRT A;  2HI3 A;  1NG7 A;  1BW6 A;  2PMZ A;  1FNN A;  2X85 A;  4L5J A;  5E18 F;  2K9Q A;  2WAE A;  2MC3 A;  3T8R A;  2HVS A;  4A3G J;  2DA7 A;  5KHD A;  2HQR A;  2YS9 A;  2ZNY A;  4AUX A;  3BJ6 A;  4ZYH A;  2R4G A;  1Z6T A;  2DMP A;  3LFK A;  3E3V A;  2EFN A;  5HS9 A;  2LFB A;  3JTH A;  3ZMU A;  4Q4Z F;  4IHX A;  3G6E I;  2CMP A;  3CD6 I;  3PO3 J;  4DIQ A;  5IYB J;  3FX3 A;  1UHS A;  2I8D A;  3CTA A;  3KE2 A;  5L3B A;  4EJT A;  5DS9 A;  4C30 A;  3DFG A;  1U8B A;  1G4D A;  3Q0U A;  4M71 A;  1IN6 A;  2E1M C;  2VPL A;  3K1P A;  3JRA A;  2VKH A;  4MLO A;  4BHC A;  1AWC A;  3BPX A;  3WTS C;  2HQA A;  3FF5 A;  1IAW A;  1O3Q A;  1LDD A;  4C2T A;  2EFP A;  3P9C A;  1K61 A;  1FPQ A;  2YX7 A;  1LNW A;  2MG4 A;  4XLA A;  3F8M A;  5GTI C;  1FBU A;  1O3S A;  3H3V K;  1U5T C;  2VJJ A;  4UXN A;  1IRX A;  2H09 A;  4C3J J;  2Y9Z A;  4L0Z B;  2VAS A;  1POG A;  3S8P A;  1RKW A;  3VB2 A;  5FLM J;  1YS7 A;  2X6W A;  1O7L A;  3VYS B;  1QU3 A;  3G1M A;  1BN5 A;  1VI0 A;  3OOU A;  3Q9S A;  1MBK A;  2UUZ A;  3A0H C;  1TLH B;  2JTV A;  3TDU C;  1NHA A;  1QRY A;  2EWN A;  1QQI A;  2XAG A;  4HLX A;  3J80 K;  4AIK A;  2W24 A;  2ESN A;  2XGE A;  2A6E F;  4UUS A;  1LUJ B;  1B8I B;  4DYC A;  4U7D A;  3OYE A;  2PI0 A;  5A2Q Z;  3CCR I;  5ICC A;  4G6D A;  3J81 K;  3T5X A;  4DGW B;  5B1B H;  2DN0 A;  1OKR A;  3CMA I;  4ZYA A;  1U9O A;  4FX0 A;  4AIJ A;  1SVL A;  2O3F A;  3DTI A;  2F5C A;  1G3T A;  4IQ4 A;  4DYR A;  4ZJZ A;  1SFO J;  2EZK A;  1F4K A;  1BBY A;  1ETQ A;  4L9V A;  2VI6 A;  2RKH A;  3A4C A;  4PK4 A;  1XC5 A;  1YHQ I;  1V5G A;  3OYN A;  3FBI B;  3K1M A;  1WCM J;  4V19 K;  2CG4 A;  3F3X A;  2DOE A;  2MLG A;  3FIS A;  4L9J A;  2ISZ A;  3L2U A;  4AYB N;  3G73 A;  1IF1 A;  3BDD A;  2JUC A;  2ELH A;  4GYI A;  5K5R A;  3DLL F;  1D5V A;  5FFX A;  3DWL E;  3PFI A;  4M6V A;  4M6Y A;  1MJA A;  4ZTF A;  1MD0 A;  2F5D A;  4K2E A;  3JRD A;  4UV9 A;  4FQG A;  1LQ1 A;  2JA6 J;  2NVU B;  2Z1D A;  1T38 A;  4UNO A;  3VYR B;  5FKO A;  1IGN A;  3I5U A;  5HLH A;  3DKY A;  2Q0O A;  2KHM A;  2EIJ H;  2JK3 A;  3K4L A;  3RCO A;  3GCM A;  1Q1V A;  2ZFW A;  4BXX J;  5E3N A;  1QPI A;  3KYC B;  3NQO A;  2CH0 A;  1ZQ3 P;  3J7A Y;  2EJR A;  5L3C A;  2CFO A;  2EIL H;  3JRE A;  1U78 A;  2R7U A;  2H94 A;  3HYI A;  5F0H A;  2W25 A;  3WTZ A;  1T98 A;  3GTG J;  2M7A A;  1Z91 A;  2ZME C;  2R7Z J;  1XS9 A;  1MMN A;  2MH9 A;  1J5Y A;  3GF2 A;  3RSN A;  3SYT A;  1R5H A;  5E8I A;  1CGP A;  3M8F A;  1L3L A;  1OYI A;  2K9L A;  4M3E A;  3C2G A;  2PJR A;  3S15 J;  1TNT A;  3K4C A;  1CF7 B;  3HPH A;  1MMG A;  1DUX C;  1TC3 C;  1W36 C;  3DTK A;  1LVA A;  3HZJ A;  5C4X J;  1U8R A;  4AVP A;  4GYG A;  4OIN F;  2MAB A;  2O61 A;  2V6E A;  5DCF A;  2QKM B;  2GIZ A;  3DXJ F;  4RGR A;  3V4G A;  1KU3 A;  3GEZ A;  1MH3 A;  2HNH A;  3C7J A;  2GZW A;  4BDY A;  4DNC A;  2Y0S A;  1YOV B;  4M72 A;  2LRD A;  3W3C A;  1RPW A;  2A61 A;  3D5S C;  5F6F A;  4A2U A;  4RGX A;  4CUG A;  2QYO A;  3QQA A;  3Q0V A;  3OYD A;  2L02 A;  3FXM A;  3QOE A;  4CO8 A;  3LAP A;  2OAZ A;  1AA7 A;  3PUB A;  3W6V A;  3GLX A;  2L2O A;  1MDM A;  4KA4 A;  2HYF A;  2Y0M A;  1IW7 F;  1WVR A;  1U0J A;  1TL8 A;  4JOM A;  1AHD P;  2VBW A;  3DPL C;  2EFW A;  2ZFU A;  4E4H A;  3Q5F A;  3DBH B;  4PGH A;  4NC8 A;  4AYB A;  3UKG A;  5GAG J;  4P9F A;  3KLN A;  3JR9 A;  2LR8 A;  3K4N A;  2JA7 J;  3PL8 A;  3HHG A;  2R93 J;  1QGP A;  2GWR A;  2IP2 A;  3VYT B;  3QYB A;  5J8F A;  2DAO A;  4M3F A;  2IS1 A;  2IBD A;  3KP2 A;  4WWC A;  1ERD A;  4HAM A;  1TZL A;  3HUG B;  1YTY A;  5F64 A;  3WG7 H;  5E79 C;  5FRM A;  2XAF A;  2W85 A;  2FD5 A;  1WJD A;  2PX9 A;  1X58 A;  2GA2 A;  2ESH A;  2QQ8 A;  4I01 A;  1LFU P;  1J9I A;  2LMD A;  2LBF A;  3AKZ A;  1W36 D;  2J5O A;  2M30 A;  2OF7 A;  5H6R A;  4UY8 I;  3HSF A;  2MW8 A;  3F21 A;  3AAF A;  1B72 B;  3LOC A;  3QOP A;  1MBH A;  1B72 A;  2RGV A;  4S0H B;  3DQV C;  1XDU A;  3GW2 A;  4A3B J;  2B0L A;  3KEO A;  5B1A H;  4HYE A;  3S16 J;  1NH3 A;  3BLY A;  1MNE A;  3GFJ A;  2R7F A;  3I9V 2;  4C3H J;  5L3E A;  1E3O C;  1SD6 A;  4PJL A;  2RC4 A;  1KGS A;  3DKW A;  5J1Y A;  1IRG A;  2G7U A;  4AM3 A;  5KVR A;  2ZJR F;  5J3L A;  2A05 A;  3TOB A;  3GO5 A;  2PN6 A;  1IV8 A;  4HZF A;  1MSE C;  2Y31 A;  4ENJ A;  2RNJ A;  3K70 D;  2DCE A;  4E6K G;  3AG4 H;  1ULY A;  3RKQ A;  1OMI A;  1A6Q A;  2VKE A;  3AG1 H;  2VJ4 A;  2HOS A;  1DP7 P;  4FT8 A;  1UAA A;  4OOI A;  3ABL H;  2M87 A;  1LB2 A;  4M9S A;  3ISP A;  4RAG A;  2LKS A;  3ROU A;  4PCQ A;  1BR1 A;  2P8T A;  4RB1 A;  3IC7 A;  4B43 A;  5IY5 H;  4BBS J;  4KUM A;  3OR1 C;  3OY9 A;  2VT3 A;  5FGM A;  1YIO A;  2Q2E B;  4B3A A;  4Y52 J;  4A3C J;  1SAU A;  3OOP A;  1X3U A;  2O8X A;  4UVB A;  1T56 A;  3BG9 A;  5F08 A;  2ELK A;  2BXY A;  4ZH4 F;  4HG2 A;  3ZMS A;  1GV2 A;  1A6I A;  3HOT A;  4BU2 A;  2KP6 A;  2QZ8 A;  2L5Q A;  3ZRG A;  2QSH X;  4A3I J;  2YR2 A;  4IXA A;  2WTE A;  3X2Q H;  1BR2 A;  1MBJ A;  2V9K A;  1FSH A;  3GME A;  3I59 A;  3K70 C;  5BS6 A;  4NBQ A;  3FIW A;  4KIF A;  1K7A A;  1G2H A;  4XRS A;  4OIR F;  3HRS A;  1HKS A;  1XN7 A;  5CQE A;  1YRN B;  2HVR A;  3TKY A;  1LVK A;  4LG3 A;  2WAF A;  3VDX A;  2JWT A;  4IEJ A;  5GAD J;  1J75 A;  2ZCW A;  1Y8R B;  3EUH A;  3HHH A;  3ZCO A;  1RI7 A;  1T0F C;  3BWG A;  3QPS A;  2ZXW H;  1HW1 A;  1UB9 A;  3DEW A;  3KP7 A;  1WH5 A;  3MQ0 A;  5EGO B;  2H6C A;  1B6A A;  4GDF A;  4HPQ A;  2DOA A;  5EGO A;  2Q1Z B;  2BBY A;  2CQK A;  2P7V B;  2M0C A;  2KDZ A;  1STZ A;  3G1L A;  4HEA 2;  3TQN A;  1Z7L A;  2Y2Z A;  2A6T A;  3CC2 I;  3K0L A;  2DXI A;  3BTI A;  4D5C A;  4O5V A;  3SXY A;  5D5U B;  1UEL B;  3QPT A;  1SC7 A;  5LRR A;  2DMT A;  4WK8 F;  1FSE A;  4ZC3 A;  4RLQ A;  2ETH A;  2ICW G;  3J7Z I;  1K4T A;  2QSF X;  4LGW A;  1UHW A;  3HC7 A;  5M5X J;  1KQ9 A;  5LLQ A;  1KYZ A;  1CQT A;  1AOY A;  3FWE A;  3MEX A;  2BY2 A;  5D8L B;  2OCE A;  2DA1 A;  2FJ1 A;  2ZSI B;  4HRI A;  3S1N J;  1HSJ A;  2M2E A;  2KDO A;  5F1R A;  4Z2Y A;  1T33 A;  2HU9 A;  2ID3 A;  1BI0 A;  2K02 A;  4I99 C;  1UJ8 A;  1QA6 A;  2HYG D;  3DV8 A;  1XX5 A;  4R1H A;  5IP7 J;  2P5L C;  1LE8 A;  3J81 Z;  3IRQ A;  5HVQ C;  2H1K A;  1FT9 A;  2Z3Y A;  3RI4 A;  3DBL B;  4PDK A;  5LEK A;  2OD5 A;  3CDI A;  4BAY A;  2EH3 A;  2XIG A;  1SD5 A;  1GVJ A;  4YFK F;  3V7C A;  1ZYR F;  3DLA A;  3GVA A;  1WJC A;  4ITV A;  4CH7 A;  3S2W A;  2JQ7 A;  3PNT A;  3H3Z A;  3KP4 A;  2G7H A;  4AID A;  5CPR B;  4Y7N J;  2M4K A;  3KX2 A;  3U9G A;  1MBE A;  1OCO H;  1JI8 A;  4DZP A;  1BI2 A;  3SFZ A;  4F7Z A;  4H0E A;  4ZDO A;  1D3Y A;  5FJ8 J;  4BE0 A;  1ZGW A;  1RC9 A;  2XV4 S;  4M9Z A;  2JA5 J;  5DEQ A;  2F4O B;  2W7N A;  2KIM A;  5LRS A;  3BZK A;  1PUF B;  2IS6 A;  3IUO A;  2DT6 A;  2NRA C;  5HOO A;  4Q48 A;  4C3I J;  3OS1 A;  4XK4 A;  3BRO A;  1KQ0 A;  4IF4 A;  1MH4 A;  1P4W A;  1ZEL A;  2G9W A;  3PNV A;  4ABZ A;  3KIO A;  4U7B A;  1WRJ A;  3BQY A;  6PAX A;  1YI2 I;  3MZY A;  2JPB A;  3SDG A;  2JT1 A;  4MFD A;  3BQZ A;  3E5X A;  1A31 A;  1TW2 A;  4XKV A;  1IXS B;  1R1T A;  3BP8 A;  4XKB A;  5DCM B;  2XGC A;  1UST A;  3E97 A;  4WXH A;  4X6A J;  1SD4 A;  3ELK A;  3DKX A;  4N4N B;  2F48 A;  1W7P A;  1X4O A;  1W7P B;  5DV5 A;  5H6Q A;  1GUU A;  2R7O A;  4MIM A;  5LGN A;  4WXC A;  5LHH A;  1K6O A;  1FWZ A;  4AU7 A;  2BZT A;  4BY1 J;  3LSG A;  2OV7 A;  3H9G A;  3S93 A;  5EEA A;  1MSF C;  1HDD C;  3S1M J;  2R7Q A;  4CCN A;  3LST A;  2ECC A;  5E3L A;  2A68 F;  3GFL A;  4BDZ A;  4M73 A;  5EEG A;  4DQ2 A;  5JVT A;  3BR1 A;  1WGX A;  2DFI A;  3OYK A;  1NTC A;  1SFU A;  1LKX A;  3OIO A;  4I0B A;  4NQW B;  3KEQ A;  1ITY A;  3K2Z A;  2KIU A;  4BGD A;  4NQW A;  2FSW A;  5D4R A;  4LB5 A;  2P6T A;  3EET A;  1O7F A;  3MMY B;  3LA3 A;  3H36 A;  1A04 A;  5KK1 A;  2DK8 A;  3IP4 B;  3GZ6 A;  3AFH A;  3E6B A;  2CV1 A;  1PUE E;  5K7F A;  2VC0 A;  1MMA A;  4EJO A;  2LY9 A;  2GM4 A;  3WHB A;  1RR7 A;  2VQC A;  4M3D A;  3ERM A;  2L7Z A;  4HX8 A;  5D5X B;  2LTP A;  4AVZ A;  2CV0 A;  4A6E A;  3M3Y J;  2JA8 J;  3KYD B;  2E2H J;  1PJR A;  4EEF G;  1QPM A;  2CUZ A;  2EV5 A;  1VFC A;  3GYH X;  2EQR A;  4ESF A;  3I4M J;  3SZP A;  2CO5 A;  1U5T A;  4KMF A;  3CME I;  1JHH A;  4HNV A;  3RIR A;  3PJR A;  1ZK8 A;  2M1B A;  3LSH A;  4WF2 A;  1E3H A;  2MBF A;  3K4B A;  2GAU A;  3ZQH A;  2ME6 A;  1ONV A;  1VQN I;  1BJZ A;  1X2N A;  2M8G X;  2OZU A;  1ETW A;  2JN6 A;  2A5W A;  3R60 A;  3FMQ A;  2DYS H;  2WB1 A;  2XPU A;  2DFF A;  4RAF A;  3CQZ J;  5FO5 A;  1ZGJ A;  4FCY A;  1PYV A;  1K79 A;  2VKV A;  5HDG A;  2JRT A;  3K1N A;  5CQG A;  5E3M A;  5JFR A;  5CVI A;  4PGG A;  2NVT J;  1Y1W J;  4HBL A;  4F52 A;  3K9T A;  1EH6 A;  3A0B C;  3F0C A;  1XPX A;  2LYC A;  1ZG5 A;  4MO7 A;  3HG9 A;  3KET A;  1R5I D;  2NNY A;  3CLO A;  4DBQ A;  4IX7 A;  5JR3 A;  1JJ6 C;  5A2Q K;  2HPM A;  1YQA A;  2QCO A;  3PQJ A;  1X1C A;  4BS9 A;  4RB3 C;  5IT9 K;  4G94 A;  5C44 J;  1R49 A;  2KJB A;  3IAS 2;  2XKO A;  3CZ6 A;  3O3K A;  1WJF A;  4IO9 F;  1H0M A;  4O3M A;  5KAI C;  1ON1 A;  3H3U A;  3KZY A;  1BL0 A;  2ZXH A;  2R7D A;  4DBR A;  2BGC A;  4BE2 A;  2DOF A;  4N9H A;  2STW A;  5FRO A;  2NNN A;  4OAZ A;  1HA8 A;  1Y6I A;  2VLA A;  4F55 A;  1JUP A;  4HV6 A;  3S3O A;  4KJZ A;  1JT6 A;  2DMQ A;  3FXO A;  4XN0 A;  4F91 B;  2VN2 A;  3FM5 A;  2DI3 A;  1R71 A;  1HBX G;  4ASN A;  1DU0 A;  5D6F A;  1YFH A;  1OYY A;  4XID A;  4A5M A;  5F0F A;  1SFE A;  1UCR A;  3LSJ A;  1LPQ A;  2RV8 A;  3L2V A;  4HDV A;  2WY8 Q;  2E71 A;  2F2E A;  5H2F C;  2PLY A;  4XOP A;  2IRF G;  1KA8 A;  1GV5 A;  4JX5 A;  5J40 A;  2ZXJ A;  3LSI A;  1IDZ A;  3PSI A;  2V1D A;  2GOX B;  2RVC A;  2E7X A;  4N0B A;  4GCV A;  4U0W A;  3R4K A;  3G71 I;  1FYM A;  3CUQ B;  1MZB A;  4BY7 J;  3JRI A;  5CKT A;  4CYD A;  4FAS D;  3CLQ A;  3S32 A;  4RMN A;  3I4P A;  1NG6 A;  3S1Q J;  2F4M B;  2I5U A;  2F6C A;  1YIT I;  1WFX A;  1ZTR A;  1G3S A;  4LMY A;  1FBS A;  4IZZ A;  1X19 A;  4M3B A;  1RRJ A;  1TWF J;  2XAH A;  5HLI A;  3V8L A;  4II2 A;  2FRH A;  3CF2 A;  4RGS A;  1ZR4 A;  4UB8 C;  3EDP A;  3BR5 A;  1SD7 A;  1XMA A;  2XB0 X;  1XMX A;  2NS8 A;  3ECO A;  4I7H A;  4M6X A;  4ENK A;  2O8K A;  2EIM H;  1W5T A;  3DPT A;  4E7S A;  3I4N J;  3NRV A;  3C3W A;  2DU9 A;  1H9G A;  1KON A;  2VJI A;  3HOU J;  2CJJ A;  4RA2 A;  2EZL A;  2QF7 A;  3HIF A;  5E1Z B;  2ZME B;  4EGY A;  3L1P A;  2XVC A;  1Y39 A;  4RB2 C;  1D0Z A;  4XSX F;  4JBA A;  3GXO A;  1GDT A;  1EJ9 A;  3O2P E;  3CJR B;  4O6J A;  3K4M A;  3V8J A;  1R1V A;  3K2A A;  4J01 A;  5CVV A;  4LG0 B;  2L9N A;  4XRS G;  5TGT A;  2XC7 A;  3BZC A;  3FXR A;  2K40 A;  4U0V A;  2DDA A;  4QPQ A;  4FET A;  4DYQ A;  2BW3 A;  2ZJP F;  3MKW B;  2PEX A;  2UZK A;  1TW3 A;  5AON A;  4CCL A;  5LHG A;  3OS0 A;  4DZJ A;  2LC2 A;  1YIJ I;  1WI3 A;  4G7O F;  1A35 A;  3TO7 A;  2R7R A;  2TDX A;  1DPU A;  1TWC J;  2FBI A;  3ULQ B;  3GZ5 A;  2QQB A;  3MAJ A;  4YIF A;  4QWQ A;  5ERI A;  3HDD A;  2EB7 A;  5E1W A;  4Z6Y A;  2HTJ A;  4XOT A;  5FKM A;  2C6Y A;  2IS2 A;  1FOX A;  3L09 A;  1SVO A;  3V42 A;  1VQ8 I;  3AG2 H;  1YYV A;  3S3M A;  1ZR2 A;  4Y33 A;  2E36 A;  5CVR A;  1YW8 A;  1QNT A;  4BAC A;  3QPL A;  2FU4 A;  1ZKG A;  3PNY A;  1DPR A;  1D0X A;  4XRF A;  1EA3 A;  1M1E B;  2NS0 A;  3BR3 A;  3JTG A;  4HLY A;  1OCR H;  2IW5 A;  3HOY J;  3OR2 C;  1X1B A;  2FX0 A;  4Y15 A;  2HDW A;  3EYY A;  2NOJ B;  3BC8 A;  1IUF A;  2KZV A;  3I0T A;  5CVU A;  4UVA A;  3BJO A;  1VQ9 I;  1VQ4 I;  4JYK A;  4JQF A;  2IXS A;  3QOD A;  3CCU I;  2EZI A;  2OUM A;  3DEE A;  3UNG C;  4FHT A;  1ETY A;  4IHS A;  3I54 A;  1V5F A;  3Q0W A;  4ZTJ A;  4EQQ A;  1PUF A;  4RDU A;  3GTQ J;  4A0X A;  1ZRF A;  1PDN C;  4PUS A;  5J6X A;  1B9M A;  1I1G A;  2FQ3 A;  1MDM B;  2F5V A;  1MMD A; 
#chains in the Genus database with same CATH homology
 3MCZ A;  2P4W A;  5DD8 A;  5BQT A;  2PMH A;  1OR7 A;  4L18 B;  2K27 A;  1T39 A;  5ED4 A;  2EK5 A;  2GA1 A;  2QBY A;  3ABT A;  2E1N A;  4KN7 X;  3HUG A;  4MTE A;  3E5U A;  3BY6 A;  3TOA A;  3LAJ A;  2Z99 A;  4TV7 A;  4CXF A;  2HFH A;  4EGZ A;  3WTU C;  3L00 A;  1OYW A;  3WGG A;  2ZJ2 A;  3W6J B;  1GXP A;  2PJP A;  3IHU A;  2P7C B;  5FB2 A;  3P7N A;  1ZG3 A;  3WTV C;  4RS8 A;  1Z1D A;  3KZZ A;  2YPR A;  1G3Y A;  1RIO H;  3WTT C;  3QP5 A;  5ILS A;  2VON A;  3HRU A;  1FC3 A;  2MA3 A;  2PG4 A;  1Z7U A;  4ZYG A;  2EV0 A;  5J8C A;  1OPC A;  1H9T A;  2M5W A;  3HTU A;  4LLN A;  2VXZ A;  1KU9 A;  4S04 A;  3B73 A;  3T8T A;  2XUB A;  4CHU A;  4XLN F;  5ILU A;  1UHM A;  5BOX A;  2OZ6 A;  1TQI A;  1XSV A;  2W57 A;  4BQA A;  1KU2 A;  2A07 F;  4CIC A;  1K78 B;  3MWM A;  1S3J A;  2KRF A;  2XAQ A;  5IT3 A;  2RDP A;  3EYI A;  4I0A A;  1BOA A;  1YW9 A;  3ZMZ A;  1XDS A;  2UXX A;  2LKP A;  1F9N A;  3H92 A;  1HST A;  4ZYE A;  2DQR A;  4ENM A;  5E20 A;  2RQP A;  4YII A;  5LGU A;  2WWY A;  2DPU A;  4ESJ A;  1ON2 A;  1SMY F;  3LWF A;  4KIB A;  3GWZ A;  2BV6 A;  4MHG A;  2XRN A;  1S8N A;  2M8E A;  3M8E A;  1IN7 A;  1TQP A;  4S05 A;  4EJV A;  1J7K A;  2VBZ A;  2LNB A;  2FOK A;  3VOD A;  1S7O A;  4WCG A;  1ZRD A;  1XCB A;  1T6S A;  3VEP A;  4L0Y B;  3WTW C;  2K4J A;  1SMT A;  5DYM A;  4HX7 A;  2EA4 A;  2V9V A;  1BC7 C;  1R5G A;  4CZZ A;  3GUD A;  4E70 A;  5ICG A;  5E1X A;  1G3W A;  5AIQ A;  1J59 A;  4KYW A;  1R7J A;  4IRI A;  5AIP A;  3RPQ A;  1T2K A;  4HOB A;  2L4M A;  3DP7 A;  1R36 A;  3CO6 C;  4Y13 A;  4G8X A;  4B8X A;  3G3Z A;  3E6M A;  4I09 A;  2K7L A;  2Q2E A;  3I53 A;  3MZH A;  1O57 A;  1O3R A;  4HQM A;  2H27 A;  3ZMV A;  4EJW A;  1Q1H A;  3N4M A;  1MGT A;  1REP C;  2LSO A;  3HSE A;  3M9A A;  4EJU A;  5D4S A;  3C18 A;  3COA C;  2IJL A;  4MGR A;  2A5Y B;  2IT0 A;  1B59 A;  1R00 A;  5JHU A;  4MQV A;  3VFZ A;  1TBX A;  1UFM A;  2Z5U A;  3F72 A;  3JAM K;  1TTY A;  4IRG A;  2J5P A;  2ZKZ A;  3B02 A;  5H20 A;  4UV8 A;  2QBY B;  2HKX A;  2EA2 A;  2QQ9 A;  4KIC A;  1HKQ A;  4M9X A;  2JSC A;  2MLK A;  1XGN A;  3WE3 A;  2HR3 A;  2ISY A;  2FE3 A;  3I59 B;  2ZO4 A;  4EMS A;  4GGG A;  5FD5 A;  2XAJ A;  2FML A;  3CUQ A;  2AXL A;  2CWE A;  2VC1 A;  2HTS A;  3Q9V A;  1I6X A;  3F6O A;  1R22 A;  3FHZ A;  5L3F A;  1Y0U A;  1YG2 A;  1ZN2 A;  2K86 A;  4Y17 A;  4M74 A;  4IPA A;  5FLX Z;  4HF2 A;  3QP6 A;  2LDU A;  1P92 A;  2OU2 A;  4HDU A;  3KP3 A;  1JGS A;  4R79 A;  2O03 A;  3F8N A;  5ICF A;  1LEA A;  1W7P D;  4MQ9 F;  3ERE D;  4WXD A;  2FXA A;  3N97 A;  5K1Y A;  3WE2 A;  3LQQ A;  4LJZ F;  1D8K A;  3REO A;  2FF4 A;  2V79 A;  1O3T A;  1XB4 A;  1ZGA A;  3RKW A;  1QBJ A;  1KQ8 A;  1ODD A;  2DT5 A;  4BYY A;  3I58 A;  4BHP A;  1LJ9 A;  4AD9 A;  3L9F A;  2ZBK A;  4FX4 A;  4HF1 A;  4BH9 A;  4RGU A;  4U88 A;  3ZN0 A;  2VOP A;  4YFN F;  5ILV A;  2Y48 A;  4MEY F;  4JK1 X;  3U2R A;  5BPD A;  3SQN A;  2FMY A;  4L9T A;  2HWV A;  5LEJ A;  4A0Z A;  5CLS A;  4IHT A;  3HSR A;  5HLG A;  1KU7 A;  3GFI A;  2UWM A;  1XD7 A;  4MEX F;  5DUI A;  3BOQ A;  4CDG A;  4A6D A;  1SFX A;  3CJN A;  4B09 A;  4ENN A;  3WGH A;  1WWX A;  2PBI A;  1RZ4 A;  2D1H A;  5CYV A;  2JZY A;  5D8K B;  3RKX A;  4I98 B;  4UUV A;  2V6C A;  4UHT A;  3WG9 A;  5L3D A;  1FYK A;  2CFX A;  1IRF A;  5IT9 Z;  2V1U A;  5FD6 A;  3L7W A;  3LA2 A;  4G6Q A;  3HOS A;  1RUO A;  2E1C A;  2HKO A;  2DK5 A;  2VBY A;  1B4A A;  1IXR C;  2D2W A;  3C1D A;  4RAZ A;  4WX9 A;  2YSR A;  1CF7 A;  2WV0 A;  3ZMT A;  3E5Q A;  1I1S A;  2HEO A;  3R6S A;  3FM3 A;  4G9Y A;  2A69 F;  4HV5 A;  3F23 A;  1JHF A;  2FA5 A;  4KN4 X;  1MJB A;  4N9I A;  1LDJ A;  4YFX F;  4I2O A;  1FP1 D;  2XGX A;  3IWF A;  2QEN A;  2VOD A;  5LGT A;  2KKO A;  2EFQ A;  3O6B B;  3I64 A;  5EEH A;  2LF7 A;  4KIG A;  2GQQ A;  1BIA A;  3J7A O;  1BC8 C;  4HX4 A;  1HKT A;  2GIV A;  1ZLK A;  1S6L A;  3KP6 A;  3RKY A;  1IXC A;  3P9K A;  1G6N A;  3E6C C;  3TO9 A;  4LLG F;  4XLP F;  3SZT A;  4EVI A;  2UXN A;  2IA1 A;  4XBF A;  2ZNZ A;  2CW0 F;  3W6K B;  1W4M A;  1P4A A;  2OQR A;  1J2X A;  5BMZ A;  1P6R A;  2CGP A;  3RJP A;  1XGS A;  3GX4 X;  2XRO A;  2DTR A;  2ADU A;  5FFZ A;  3KP5 A;  1F5T A;  4ETS A;  1HQC A;  5FLX K;  4G7H F;  4UVC A;  3KFW X;  3R0J A;  1EH7 A;  4HA8 A;  3K69 A;  4IVN A;  1PP7 U;  4GXO A;  5TJJ A;  2Z33 A;  1USS A;  2HGC A;  1XSD A;  2K4B A;  3M7G A;  4R8H A;  3ZP5 A;  1VTN C;  1R58 A;  2KJC A;  3MFK A;  4G7Z F;  1P2F A;  4HW0 A;  4P9U A;  2QLZ A;  4EM0 B;  3TO6 A;  2L01 A;  3R0A A;  1U3E M;  2XAS A;  3SHF A;  5HDK A;  2PQ8 A;  1MJ9 A;  4OIP F;  1KYW A;  3WU1 B;  1LEB A;  1FYL A;  4NB5 A;  2P5V A;  3ECH A;  3FMR A;  2BE5 F;  1F1Z A;  1IN5 A;  3WOD F;  4ESB A;  1I5Z A;  3QPH A;  2DPD A;  1S29 A;  3WGI A;  4HQE A;  1RNL A;  1ZRE A;  1Z05 A;  4P5O A;  3OV8 A;  3CDH A;  2QWW A;  2VOO A;  1ZG1 A;  3RYP A;  4OIO F;  4ON0 A;  1QZZ A;  2L54 A;  4QLC U;  3F8C A;  2ZME A;  1FOK A;  4EV0 A;  5ICE A;  2FNP A;  2DQL A;  1HXD A;  2RN7 A;  2P5K A;  1S7A A;  4LG0 A;  1XGM A;  4OMZ A;  2CSO A;  4HF0 A;  3ML6 A;  4Q5S F;  3PQK A;  2GXG A;  2IVM A;  4CGZ A;  2STT A;  1FZP B;  1LDK B;  1JE8 A;  2AS5 F;  3KLO A;  4IRH A;  1YW7 A;  3HRM A;  3RPU A;  1FY7 A;  2DLL A;  3BJA A;  5D5V B;  2IA0 A;  2QVO A;  3U1D A;  4KMU X;  5K5Q A;  1WSU A;  2ACJ A;  1XMK A;  2XKP A;  1YO5 C;  4OU0 A;  3GFM A;  1IN4 A;  4L9N A;  1BIB A;  2IPQ X;  2Q8K A;  3FXQ A;  2OQG A;  3P9I A;  3IKV A;  2VBX A;  3R61 A;  2KIF A;  2L3D A;  2A6H F;  3TDZ C;  1JXS A;  1FBQ A;  1ZH5 A;  1ZLJ A;  3ZMD A;  2A3S A;  3D0S A;  5LHI A;  4L5I A;  2E7W A;  2Y75 A;  4OMY A;  1IN8 A;  4AIH A;  3IRR A;  4KDP A;  1XGO A;  2FBH A;  1V3F A;  4EM1 A;  3IWZ A;  2BEO A;  4RB0 A;  1B1B A;  3BZ6 A;  3V7R A;  2O6G E;  1ZRC A;  5D5W B;  1P4X A;  4LK0 F;  1ZAR A;  3V7S A;  2F5E A;  5DUK A;  3ZQ7 A;  1XSX A;  2OBP A;  2CYY A;  3LA7 A;  2QUF A;  3BPV A;  4A5N A;  2EV6 A;  3HTS B;  3D5L A;  4MNU A;  5K5O A;  2H6B A;  4A0Y A;  3L2C A;  1GXQ A;  1FX7 A;  2HZT A;  4MTD A;  3CUQ C;  1K78 A;  2P6S A;  2HS5 A;  4PZJ A;  2HOE A;  4NHJ A;  3IKT A;  3VOE A;  1YLF A;  3V8K A;  3ABU A;  2W84 A;  3JSP A;  3WTY C;  2F5F A;  1FLI A;  1BI3 A;  2MD5 A;  3E6D A;  4YG2 F;  2XHK A;  3JW4 A;  1BM9 A;  1RUN A;  1HW5 A;  3WU0 A;  2YU3 A;  3FXU A;  2L4A A;  3QU3 A;  2PMU A;  4Q47 A;  2PFB A;  1PP8 F;  4IJA A;  1YS6 A;  3RTR A;  1L0O C;  4GO1 A;  3RYR A;  2HDC A;  1XCV A;  2BYV E;  2X4H A;  5E8G A;  2MH2 A;  1W5S A;  4I02 A;  3JAM Z;  1C0W A;  3CUO A;  5DD4 A;  4KNY A;  3F8F A;  4P96 A;  2FNA A;  1B9N A;  3ZN1 A;  4EM2 A;  4KT5 C;  4LLL A;  5BPI A;  2DO7 A;  2OA4 A;  1BJA A;  3DF8 A;  3T0Y A;  4BXU A;  1D8J A;  1DDN A;  1J0R A;  4LK1 F;  3F6V A;  4AWX B;  3QU6 A;  4LD5 A;  5CVJ A;  3KCC A;  3JSO A;  2VE8 A;  3IL2 A;  5HDN A;  1Z6R A;  4LFU A;  4ZYD A;  2QQA A;  3LQR A;  1T0F A;  1V4R A;  3WTX C;  1WI9 A;  2X0L A;  4RAY A;  1WKM A;  1TQM A;  1ZAO A;  5HS7 A;  2NYX A;  4ZZD A;  2QM3 A;  1U2W A;  2JPC A;  2O0Y A;  5DDG A;  5JI6 A;  1EH8 A;  4BHB A;  1BI1 A;  2GXB A;  1E17 A;  3ZPL A;  4P55 A;  5TRD A;  2DBB A;  2IA2 A;  4ZZL A;  2FEZ A;  1U5T B;  5DCM A;  3NEU A;  1TNS A;  3QRF F;  3QAH A;  4U0Y A;  3F8B A;  2D1V A;  3EQL F;  2NAZ A;  1EV7 A;  3RDI A;  4BNC A;  4XSZ F;  3HRT A;  5CJ9 A;  1GHC A;  5L3G A;  3FZV A;  1QO0 D;  2COM A;  4D0P A;  2VT2 A;  2V1X A;  3FMS A;  4LB6 B;  4OIQ F;  3F22 A;  2HQN A;  1QZY A;  2R3S A;  1E2X A;  1MKM A;  1Z9C A;  1FP2 A;  1HW2 A;  2VE9 A;  1IZ1 A;  3TGN A;  1R23 A;  1ZHF A;  5LBQ A;  1SAX A;  2LF8 A;  2D45 A;  3DEU A;  3M1E A;  3CO7 C;  3I71 A;  2DW4 A;  5E17 F;  2Z9O A;  1U6G A;  2M45 A;  5HS8 A;  3J80 Z;  4A12 A;  2WC2 A;  2EFO A;  1WQ2 A;  1I27 A;  3T1B A;  1R1U A;  4KFC A;  5D6E A;  2FBK A;  1IUY A;  2YX4 A;  1FNN A;  4L5J A;  5E18 F;  2MC3 A;  3T8R A;  2HQR A;  2ZNY A;  4ZYH A;  3BJ6 A;  1Z6T A;  3LFK A;  3E3V A;  2EFN A;  5HS9 A;  3ZMU A;  3JTH A;  4Q4Z F;  3FX3 A;  3KE2 A;  3CTA A;  5L3B A;  4EJT A;  3DFG A;  1G4D A;  4M71 A;  1IN6 A;  3K1P A;  4BHC A;  1AWC A;  3BPX A;  3WTS C;  3FF5 A;  1IAW A;  1O3Q A;  1LDD A;  2EFP A;  3P9C A;  1FPQ A;  2YX7 A;  1LNW A;  3F8M A;  1FBU A;  1O3S A;  1U5T C;  4UXN A;  2H09 A;  4L0Z B;  3VB2 A;  1YS7 A;  1O7L A;  1BN5 A;  3Q9S A;  1TLH B;  2JTV A;  3TDU C;  1NHA A;  2EWN A;  1QQI A;  2XAG A;  4HLX A;  3J80 K;  4AIK A;  2W24 A;  2ESN A;  2A6E F;  4U7D A;  2PI0 A;  5A2Q Z;  5ICC A;  4G6D A;  3J81 K;  3T5X A;  1OKR A;  4FX0 A;  4AIJ A;  2O3F A;  2F5C A;  1G3T A;  1F4K A;  1BBY A;  4L9V A;  2RKH A;  3K1M A;  2CG4 A;  3F3X A;  2MLG A;  4L9J A;  2ISZ A;  3G73 A;  1IF1 A;  3BDD A;  2ELH A;  4GYI A;  5K5R A;  1D5V A;  5FFX A;  3PFI A;  4M6Y A;  1MJA A;  1LQ1 A;  1MD0 A;  2F5D A;  4K2E A;  4UV9 A;  1T38 A;  4UNO A;  3I5U A;  5HLH A;  2Q0O A;  2ZFW A;  3NQO A;  2EJR A;  5L3C A;  1U78 A;  2H94 A;  3HYI A;  2W25 A;  3WTZ A;  1T98 A;  1Z91 A;  2MH9 A;  1J5Y A;  3GF2 A;  1R5H A;  5E8I A;  1CGP A;  3M8F A;  1L3L A;  1OYI A;  1TNT A;  1CF7 B;  1DUX C;  1LVA A;  1U8R A;  4AVP A;  4GYG A;  4OIN F;  2O61 A;  5DCF A;  3DXJ F;  4RGR A;  3V4G A;  1KU3 A;  3GEZ A;  3C7J A;  2GZW A;  4DNC A;  4M72 A;  5F6F A;  2A61 A;  4A2U A;  4RGX A;  2QYO A;  2L02 A;  4CO8 A;  3LAP A;  2OAZ A;  3GLX A;  1MDM A;  4KA4 A;  2HYF A;  2Y0M A;  1IW7 F;  2VBW A;  3DPL C;  2EFW A;  3Q5F A;  4PGH A;  4P9F A;  3KLN A;  3HHG A;  1QGP A;  2GWR A;  2IP2 A;  5J8F A;  2DAO A;  3KP2 A;  4WWC A;  4HAM A;  1YTY A;  5F64 A;  2XAF A;  2W85 A;  2GA2 A;  4I01 A;  2ESH A;  1J9I A;  2J5O A;  2M30 A;  5H6R A;  3HSF A;  3F21 A;  3AAF A;  3QOP A;  2RGV A;  3DQV C;  1XDU A;  3GW2 A;  2B0L A;  3KEO A;  4HYE A;  3GFJ A;  2R7F A;  5L3E A;  1SD6 A;  2RC4 A;  1KGS A;  3DKW A;  1IRG A;  2G7U A;  5KVR A;  3TOB A;  3GO5 A;  2PN6 A;  4HZF A;  4ENJ A;  2RNJ A;  1ULY A;  1OMI A;  1DP7 P;  4FT8 A;  4OOI A;  2M87 A;  1LB2 A;  4M9S A;  3ISP A;  3ROU A;  4PCQ A;  2P8T A;  4RB1 A;  3IC7 A;  4KUM A;  2VT3 A;  5FGM A;  1YIO A;  3OOP A;  1X3U A;  2O8X A;  4UVB A;  4ZH4 F;  3ZMS A;  3HOT A;  2QZ8 A;  4IXA A;  2YR2 A;  2WTE A;  1FSH A;  3I59 A;  5BS6 A;  4KIF A;  1K7A A;  4OIR F;  3HRS A;  1HKS A;  1XN7 A;  3TKY A;  1J75 A;  2ZCW A;  3EUH A;  3HHH A;  1RI7 A;  3BWG A;  1HW1 A;  1UB9 A;  3KP7 A;  3MQ0 A;  2H6C A;  1B6A A;  2BBY A;  2CQK A;  2P7V B;  1STZ A;  3TQN A;  3K0L A;  4O5V A;  3SXY A;  5D5U B;  3QPT A;  5LRR A;  4WK8 F;  1FSE A;  2ETH A;  4LGW A;  1UHW A;  1KQ9 A;  5LLQ A;  1KYZ A;  1AOY A;  3FWE A;  3MEX A;  5D8L B;  1HSJ A;  5F1R A;  4Z2Y A;  1BI0 A;  2K02 A;  2HYG D;  3DV8 A;  4R1H A;  2P5L C;  3IRQ A;  3J81 Z;  5HVQ C;  1FT9 A;  2Z3Y A;  3RI4 A;  4PDK A;  5LEK A;  2OD5 A;  4BAY A;  2XIG A;  1SD5 A;  1GVJ A;  4YFK F;  3V7C A;  1ZYR F;  3GVA A;  3S2W A;  3H3Z A;  3KP4 A;  2G7H A;  3U9G A;  1BI2 A;  3SFZ A;  4F7Z A;  4H0E A;  1D3Y A;  2XV4 S;  4M9Z A;  5DEQ A;  2KIM A;  5LRS A;  2NRA C;  5HOO A;  4Q48 A;  3BRO A;  1KQ0 A;  4IF4 A;  1P4W A;  2G9W A;  4U7B A;  1WRJ A;  6PAX A;  3MZY A;  2JPB A;  2JT1 A;  3E5X A;  1TW2 A;  1IXS B;  1R1T A;  3BP8 A;  5DCM B;  1UST A;  3E97 A;  4WXH A;  1SD4 A;  3ELK A;  1W7P A;  1W7P B;  5DV5 A;  5H6Q A;  5LGN A;  4WXC A;  5LHH A;  1K6O A;  1FWZ A;  3LST A;  2A68 F;  3GFL A;  4M73 A;  5EEG A;  4DQ2 A;  5JVT A;  2DFI A;  1SFU A;  4I0B A;  3KEQ A;  3K2Z A;  2KIU A;  5D4R A;  4NQW A;  2FSW A;  4LB5 A;  2P6T A;  3EET A;  1O7F A;  3LA3 A;  1A04 A;  5KK1 A;  2DK8 A;  3GZ6 A;  3E6B A;  1PUE E;  2VC0 A;  4EJO A;  4HX8 A;  5D5X B;  4A6E A;  1QPM A;  2EV5 A;  3GYH X;  4ESF A;  3SZP A;  2CO5 A;  1U5T A;  4KMF A;  1JHH A;  3RIR A;  2M1B A;  4WF2 A;  2MBF A;  2GAU A;  1ONV A;  2OZU A;  3R60 A;  3FMQ A;  5FO5 A;  1ZGJ A;  1K79 A;  5HDG A;  2JRT A;  3K1N A;  5JFR A;  5CVI A;  4PGG A;  4HBL A;  3K9T A;  1EH6 A;  1ZG5 A;  3KET A;  2NNY A;  3CLO A;  5JR3 A;  5A2Q K;  1YQA A;  4RB3 C;  3PQJ A;  5IT9 K;  4G94 A;  2KJB A;  2XKO A;  3O3K A;  1H0M A;  4O3M A;  1ON1 A;  3H3U A;  3KZY A;  2R7D A;  2BGC A;  4N9H A;  2STW A;  2NNN A;  4HV6 A;  2VN2 A;  3FM5 A;  2DI3 A;  1HBX G;  4ASN A;  5D6F A;  1YFH A;  1OYY A;  4A5M A;  1SFE A;  1UCR A;  2RV8 A;  4HDV A;  2F2E A;  2PLY A;  2IRF G;  1KA8 A;  2ZXJ A;  2V1D A;  2RVC A;  2E7X A;  4N0B A;  4GCV A;  4U0W A;  3R4K A;  1FYM A;  3CUQ B;  1MZB A;  4CYD A;  3I4P A;  1G3S A;  4LMY A;  1FBS A;  2XAH A;  5HLI A;  3V8L A;  2FRH A;  4RGS A;  3EDP A;  1SD7 A;  1XMA A;  3ECO A;  4I7H A;  4M6X A;  4ENK A;  1W5T A;  3DPT A;  3NRV A;  3C3W A;  2DU9 A;  1H9G A;  3HIF A;  5E1Z B;  2ZME B;  4EGY A;  2XVC A;  4RB2 C;  4XSX F;  4JBA A;  3GXO A;  3O2P E;  4O6J A;  3V8J A;  1R1V A;  5CVV A;  4LG0 B;  3FXR A;  4U0V A;  2PEX A;  2UZK A;  1TW3 A;  5AON A;  5LHG A;  4G7O F;  3TO7 A;  2TDX A;  1DPU A;  2FBI A;  3ULQ B;  3GZ5 A;  2QQB A;  3MAJ A;  4YIF A;  4QWQ A;  5ERI A;  2EB7 A;  5E1W A;  2C6Y A;  2HTJ A;  3L09 A;  1YYV A;  5CVR A;  1YW8 A;  1QNT A;  2FU4 A;  4XRF A;  1DPR A;  2NS0 A;  3JTG A;  4HLY A;  2IW5 A;  4Y15 A;  3EYY A;  5CVU A;  3I0T A;  4UVA A;  3BJO A;  4JQF A;  4IHS A;  4FHT A;  3I54 A;  4EQQ A;  4A0X A;  1ZRF A;  1PDN C;  5J6X A;  1B9M A;  1I1G A;  2FQ3 A;  1MDM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...