1GXPA

Phob effector domain in complex with pho box dna.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
AVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN
publication title Tandem DNA Recognition by Two-Component Signal Transduction Transcriptional Activator Phob
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcriptional activator
total genus 22
structure length 103
sequence length 103
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1gxpA00
3WG9A 4BHCA 3PQKA 1K78A 1UHWA 2QQBA 1XGSA 1IXSB 4I01A 2EFPA 3ZN1A 3FMRA 4JQFA 3FMQA 1BIBA 1KYZA 4BHBA 4IRIA 1Q1HA 1R5HA 2P5VA 1ZG5A 2IVMA 1IRFA 3P9IA 3I71A 4RGSA 1HSJA 3ROUA 4ESJA 3E6DA 2O6GE 5FD6A 2H09A 4HX4A 1ZHFA 3F22A 5BS6A 2O8XA 4A5MA 4CHUA 5HLIA 1RUOA 1J5YA 1D8KA 2L54A 3GX4X 4P9UA 2NNNA 1T38A 1S8NA 3BOQA 3O2PE 1FX7A 4XLNF 4EM0B 3F72A 1XMAA 1ZARA 2ELHA 1MJ9A 2J5OA 2P5KA 5E17F 2EFQA 4O3MA 5D5WB 2RV8A 4UVAA 2P5LC 1P4XA 3WODF 5L3CA 3BP8A 4LLLA 1ZGJA 3SFZA 4OMZA 1WRJA 2WWYA 3JSPA 2JTVA 2QWWA 3ZMVA 4A6EA 1CF7B 2FA5A 4HF0A 4D0PA 1LEAA 5E1ZB 1LDKB 1KQ8A 2EFWA 1Z6RA 3BPVA 5ED4A 2ZMEB 1TQPA 2PMHA 4KN7X 5DV5A 3JAMK 4I98B 1WWXA 1GXPA 1FBUA 4G7ZF 5TRDA 3MWMA 2Y48A 4DQ2A 3GZ5A 2EV0A 4BH9A 2FNPA 1DUXC 1QPMA 5LEJA 1ONVA 5L3EA 1ODDA 4YG2F 4YFKF 3MZYA 1SFXA 3RKWA 3CUQC 5JVTA 3HYIA 4IXAA 2GXGA 3GEZA 2TDXA 4A0YA 5E8GA 1IW7F 4EVIA 1Z9CA 1MZBA 4HOBA 5FFXA 2Z9OA 3WTXC 2XKPA 3BY6A 1SMYF 4KIGA 1JXSA 2DT5A 4U0YA 3WTWC 3E6BA 2V1UA 4P9FA 1P92A 5K5QA 1T39A 1YS7A 2PQ8A 1T0FA 1YTYA 1HBXG 2GA2A 1FNNA 2VC1A 2CYYA 3JSOA 4EGYA 5D5UB 3C18A 2QM3A 2HEOA 3KP6A 5FLXK 1J2XA 2QQAA 3DFGA 3V8LA 5K5OA 2DK5A 3LQRA 5LGNA 1S3JA 3ZN0A 2A6HF 2XGXA 3G73A 1U6GA 1FZPB 2FMYA 2KIMA 1LNWA 4EJWA 1LDDA 3GZ6A 4G7OF 1XSXA 3PQJA 3CDHA 5CVVA 3DF8A 1DPRA 4IHSA 2CSOA 4LMYA 1RI7A 4EGZA 2XIGA 4A0ZA 1KU7A 3F6OA 1W4MA 1O3QA 1H0MA 2VC0A 1ZH5A 1B59A 3V8JA 1XD7A 2AXLA 2ZNYA 4RB1A 1JGSA 1HKTA 3RDIA 1FP1D 3FXQA 2O0YA 1G3TA 1D3YA 2ZO4A 5L3FA 4UVCA 4I02A 4E70A 3WTZA 2DW4A 3D5LA 4BYYA 4HZFA 2YX7A 2VBYA 2KKOA 2LKPA 3BPXA 2A68F 2K27A 1J75A 2X4HA 3R0AA 1R00A 3IRQA 5BPIA 3FXUA 5LEKA 2FU4A 5E20A 1IXCA 2VT2A 2D1HA 4U88A 2ZBKA 5DCMA 3IL2A 1U78A 1K78B 4LK1F 1FP2A 4I0BA 1IN6A 2F5FA 5HS7A 2EWNA 1YQAA 2M1BA 1YIOA 4M6YA 1E2XA 4ESFA 2A69F 4PZJA 4M9XA 4IRHA 2JPBA 5D6EA 1IN5A 2IA1A 3E5XA 1LQ1A 1HSTA 1HW1A 3HUGA 2OBPA 2QENA 2PN6A 3TO9A 4CXFA 4NB5A 1P6RA 5DCFA 2DPDA 3V7SA 4XRFA 2O3FA 1Y0UA 1Z1DA 4HA8A 2VOOA 1I1GA 2R7FA 2VODA 1R36A 1TQIA 3V7RA 3TKYA 1KU2A 2MC3A 4L9NA 2YU3A 1FY7A 3JTGA 1BJAA 2FEZA 2H27A 1FYLA 2HYFA 4LLGF 2BEOA 3E6CC 5EEGA 4JBAA 4RGUA 4GCVA 1XGOA 5D4SA 2RDPA 2COMA 3GFIA 4RGXA 3M7GA 5LHIA 2L4AA 3QP6A 1TNSA 1R1VA 2HDCA 2W24A 4HLYA 4EV0A 1BI0A 5HS9A 4Z2YA 5DUKA 4G94A 4KDPA 2HWVA 4I7HA 5AONA 2NAZA 2VOPA 4CICA 1PP8F 2YSRA 2YPRA 2HKOA 3K9TA 2O61A 5AIQA 1V4RA 4S04A 2FBIA 4KA4A 5L3DA 1AWCA 1UB9A 3CTAA 2J5PA 3KP2A 3N4MA 2F2EA 1YW9A 2VBZA 3BJAA 1U2WA 1GHCA 4XLPF 1XCVA 2A61A 3VB2A 2RC4A 4FX4A 1XGNA 5K1YA 3L00A 4MQVA 2P7VB 5E1WA 3L7WA 1ZGAA 2KIUA 2RVCA 4A6DA 1RIOH 4OU0A 3EETA 2RKHA 2BGCA 3R61A 4WWCA 3G3ZA 3I59A 1J7KA 1RNLA 1OYIA 4LB6B 1I6XA 2XKOA 1IF1A 5K5RA 1FLIA 3SZTA 5JHUA 4XSXF 3E5UA 3VODA 4M9ZA 1BOAA 2FSWA 3KLNA 4QWQA 4XSZF 2LNBA 3KP3A 2PLYA 1DP7P 3MFKA 3NEUA 1K79A 4EJTA 4IPAA 3QP5A 1R5GA 1TW2A 2PMUA 1WKMA 4WCGA 2IT0A 2OAZA 2XUBA 2XASA 4RB0A 4EQQA 4Y17A 2P7CB 3CUQA 4FX0A 4A2UA 2F5CA 5HS8A 1G6NA 3CLOA 3I4PA 1LJ9A 2DBBA 3HHGA 5A2QK 2PG4A 4DNCA 2UXXA 5E18F 2CO5A 2PBIA 3FM5A 1XSVA 2GZWA 4WF2A 4G6DA 5HDGA 1T2KA 3MCZA 1PDNC 1BI2A 3WU1B 3KE2A 3DKWA 4OMYA 1EH8A 2VONA 2M8EA 2DPUA 2JPCA 3LA7A 5HDNA 2EV5A 3FM3A 3VFZA 4GYIA 4KMFA 2HFHA 3F21A 1F5TA 5DCMB 4ENNA 1YW7A 1B9NA 4O5VA 4OIPF 2EB7A 1PP7U 2R7DA 1QZZA 5CLSA 3CJNA 1XMKA 3NQOA 2XRNA 3B73A 4M9SA 3DXJF 5LRSA 3V8KA 2NNYA 4R1HA 1G4DA 1ZLKA 5DEQA 4EJUA 1J9IA 4KIFA 1KQ9A 2MA3A 1MKMA 2VBWA 4L0ZB 4LLNA 1SMTA 1Z91A 4FT8A 1T6SA 2K7LA 5CYVA 5EEHA 2DO7A 4UV9A 2NS0A 3ZMTA 1Z7UA 2CG4A 5D5XB 2RNJA 5E1XA 3W6KB 3ZMSA 3FWEA 5H6QA 3CUOA 2GAUA 1JE8A 2V9VA 2BV6A 3E5QA 2FMLA 3RTRA 2NRAC 3WTYC 2M30A 2DTRA 3MAJA 4U0WA 3O3KA 1O57A 3RJPA 2WTEA 4IJAA 4WXDA 2XVCA 5LGTA 4HDUA 1CGPA 1T98A 1K6OA 4OIRF 1ZG3A 2LSOA 4ZH4F 4RB2C 2IRFG 1XDUA 4BNCA 2YR2A 1WSUA 2BBYA 1U5TC 3HSFA 1IN7A 3TDZC 2DQRA 4QLCU 5JI6A 2WV0A 3HSEA 5D5VB 3DV8A 3F8CA 3OOPA 2CQKA 4ENMA 4N9IA 3ECHA 1L0OC 5H20A 4ENKA 3QOPA 3R6SA 2FBKA 5LBQA 4MTDA 2DFIA 3LQQA 3HTSB 5LGUA 3SZPA 3ZP5A 4AIJA 4MHGA 4LB5A 3LA3A 3W6JB 2O03A 4EJVA 5J8FA 5D4RA 1MJBA 4I09A 2P6TA 4HX8A 3WGIA 4I2OA 2B0LA 1SD4A 1PUEE 2YX4A 4L9TA 4M71A 3WTVC 3MZHA 3GUDA 3I59B 3NRVA 3ERED 3I54A 2RGVA 1X3UA 3L09A 4BHPA 1KU9A 1MGTA 3DP7A 3K1NA 2G7UA 2E1CA 2Q8KA 1B1BA 1OYYA 4RAYA 1R7JA 2DQLA 2KIFA 3K1MA 4Y15A 2CW0F 1P4AA 4KYWA 3T5XA 4L9JA 3E97A 2XAHA 1FYMA 3QPHA 3IWZA 3BROA 2ZKZA 2M5WA 1FPQA 1VTNC 1IN4A 4UUVA 1UFMA 4KMUX 2D1VA 3M9AA 5HLGA 3F8BA 1BN5A 3TO7A 3GXOA 2D2WA 3Q9SA 4CO8A 1JHHA 3CUQB 1SD7A 3IKTA 3ML6A 5A2QZ 1ZYRF 1KGSA 3V4GA 3J81Z 3HOTA 3J80Z 3CO6C 3GFJA 1G3YA 2OZ6A 1H9GA 1U5TB 3H92A 4K2EA 3HOSA 1A04A 1F1ZA 3ELKA 3I53A 3RYRA 2A07F 5FO5A 2OA4A 3K1PA 2IW5A 4TV7A 2XHKA 1F4KA 2GIVA 1R1UA 3ISPA 1UHMA 2HZTA 3AAFA 1BI1A 3KCCA 3LAPA 1R22A 4HW0A 2QYOA 3L2CA 4HDVA 2IA2A 4HQMA 3WGGA 4OIOF 2HYGD 2MH2A 4OINF 1FSHA 1FT9A 3U2RA 2VT3A 1BC7C 3RYPA 3S2WA 1ON1A 3I0TA 4F7ZA 2FE3A 4GXOA 3KZZA 4EJOA 5ILUA 5TJJA 4CDGA 3WTSC 4MQ9F 3WGHA 5FB2A 5ILVA 1SFEA 1EV7A 2K4BA 3I64A 3K0LA 3QAHA 2VE8A 3TDUC 1F9NA 1KQ0A 4UHTA 1ZN2A 2GQQA 3TOBA 1YYVA 1LDJA 5D8LB 2VE9A 5H6RA 3GLXA 4YIIA 3KETA 5KVRA 4U7DA 2K86A 4HX7A 2IPQX 3SQNA 3GF2A 1STZA 4U7BA 3TGNA 2DI3A 3HIFA 4XBFA 3ABUA 2CWEA 3KLOA 2FBHA 1FBSA 3GVAA 4KNYA 1LB2A 4A12A 3FX3A 1TNTA 3Q9VA 3FZVA 2Z5UA 4MEXF 2ESHA 1O3TA 3IKVA 2AS5F 3JW4A 1ZRCA 2P6SA 4L0YB 1WQ2A 4HAMA 3TOAA 3F8NA 2ZNZA 1O7LA 2MLGA 4P96A 2LF7A 2XAJA 1KYWA 2Y0MA 2ZFWA 2UZKA 4P5OA 4ETSA 3E3VA 2QVOA 5IT9Z 4WXHA 3M8FA 1FYKA 3O6BB 2ADUA 1HW5A 4I0AA 1EH6A 2BE5F 2PEXA 1D8JA 4PDKA 2UXNA 1S7AA 5CVIA 2EA4A 4HF1A 1W7PD 4KIBA 2H94A 2H6BA 2ACJA 3V7CA 1ZLJA 3GFMA 4AIHA 1FOKA 1IUYA 2G9WA 4HBLA 3ECOA 3DEUA 5DUIA 4U0VA 1L3LA 2OQGA 1P2FA 3FF5A 1XSDA 1RZ4A 1Z05A 3COAC 2QBYA 2HOEA 2DK8A 1XB4A 3FHZA 2EV6A 3H3UA 4R79A 3T1BA 4ASNA 2A3SA 2GWRA 3GYHX 3KP5A 3KZYA 4EMSA 1S29A 2K4JA 2A6EF 4LG0A 3LFKA 2KJCA 5LLQA 5CVUA 1IZ1A 4HF2A 2K02A 1TW3A 3B02A 4LGWA 2OD5A 2PJPA 3P7NA 3BJOA 1QQIA 3J81K 3C1DA 3J80K 1U5TA 4PGHA 3HRTA 2CFXA 1OYWA 4GYGA 1QNTA 1HKQA 3ULQB 1IN8A 2JSCA 4GGGA 4H0EA 3CO7C 2P4WA 3WE2A 2HGCA 5L3GA 1FC3A 1ON2A 2RQPA 4MEYF 2D45A 4MGRA 1GVJA 3RPQA 4G6QA 1YS6A 4BAYA 4RB3C 2IJLA 3EYIA 3U9GA 3HRSA 1TTYA 1XGMA 4UNOA 2W84A 2Y75A 2E7XA 2W25A 3MQ0A 4KFCA 4MNUA 4Q48A 4UVBA 4G9YA 4RS8A 2KJBA 2XAQA 3RI4A 1OKRA 4RGRA 2V79A 2GA1A 3T0YA 1I5ZA 2DLLA 1SAXA 5LHHA 2R3SA 1YW8A 1SD6A 4HYEA 3REOA 3I58A 4GO1A 5DD8A 4Y13A 2L4MA 4MTEA 3VEPA 2F5EA 2MLKA 1KU3A 3N97A 2HKXA 3FXRA 1S7OA 1XN7A 4A0XA 1GXQA 4Q5SF 5F6FA 3C3WA 3KEQA 4UXNA 4AD9A 2DAOA 2IA0A 3ZMDA 3OV8A 3F6VA 4YIFA 1G3SA 4Q4ZF 2G7HA 4KN4X 2E1NA 2OQRA 1QO0D 3QU6A 4M73A 3LWFA 4OIQF 3GW2A 2M87A 3F8MA 2VXZA 4BXUA 3ZPLA 2C6YA 2ZXJA 1O7FA 4L9VA 1REPC 2EFNA 5HVQC 4HQEA 2HQRA 4S05A 1HW2A 2ESNA 1HXDA 5D8KB 1MDMA 1DPUA 2PFBA 2ISZA 5AIPA 3F3XA 3EQLF 3GO5A 1YLFA 4IHTA 2BYVE 3WTTC 5IT9K 4IRGA 5ICGA 3RIRA 3KEOA 3HTUA 1D5VA 1P4WA 3IC7A 4OOIA 1J0RA 5J6XA 4FHTA 1KA8A 4IF4A 2EFOA 2P8TA 4ESBA 2W57A 1B9MA 2JZYA 1I27A 2WC2A 2XV4S 5LRRA 5J8CA 3EUHA 5HOOA 1WI9A 3DPTA 1LVAA 3T8TA 5ICCA 5ICEA 5L3BA 3ABTA 1UCRA 3Q5FA 1TQMA 1ZREA 3T8RA 3R60A 3KFWX 4ZYEA 3KP4A 4LFUA 1B4AA 4Q47A 1W7PA 3BWGA 4G7HF 1ZRFA 2FQ3A 1LEBA 2VBXA 1C0WA 5D6FA 3P9KA 4EM1A 2VN2A 3HRUA 1U8RA 1NHAA 4L5JA 4B09A 2OU2A 1G3WA 1SD5A 3L9FA 5ILSA 4M72A 2HTSA 5HDKA 5CVRA 2V1DA 3BJ6A 1Z6TA 2OZUA 2FRHA 3JTHA 5BMZA 2ETHA 2QBYB 3R4KA 2FXAA 3GFLA 3LSTA 3DPLC 3KP7A 5JR3A 2V6CA 3U1DA 3QPTA 3I5UA 3J7AO 2MD5A 3VOEA 1OPCA 1AOYA 3IHUA 4NQWA 4LK0F 1XCBA 4ON0A 4LG0B 1BC8C 1JHFA 3D0SA 4WK8F 1R1TA 1I1SA 5F1RA 2QLZA 1QGPA 3E6MA 3QRFF 2ZCWA 2ZJ2A 4HV6A 4AVPA 1H9TA 4M6XA 4CYDA 3F23A 3RKYA 2L3DA 2HS5A 1XDSA 3BDDA 1FBQA 1B6AA 2FNAA 2EA2A 4RAZA 3SHFA 3RPUA 2JRTA 5CJ9A 2HTJA 3ZMUA 2FOKA 2Z33A 1DDNA 2Q2EA 2W85A 3LA2A 2M45A 3TO6A 3BZ6A 2MH9A 1BM9A 3ZQ7A 4JK1X 6PAXA 2FF4A 1HKSA 2HQNA 4N0BA 3MEXA 1CF7A 5HLHA 2MBFA 1QBJA 2JT1A 2L01A 3FMSA 3ZMZA 4CZZA 4AWXB 2Z3YA 4LD5A 1BBYA 2ZMEA 1IRGA 4UV8A 1ZG1A 2XAFA 3WTUC 3TQNA 2H6CA 1W5TA 2E7WA 4LJZF 1E17A 4KICA 3F8FA 1J59A 2QUFA 3RKXA 5DD4A 4G8XA 2QZ8A 4HV5A 1BIAA 1MD0A 2RN7A 3P9CA 5BPDA 1FSEA 5BQTA 4NHJA 2Q0OA 1R23A 5FFZA 4L5IA 4O6JA 2Z99A 4ZYDA 3R0JA 4EM2A 2XAGA 2F5DA 3WU0A 2EK5A 3EYYA 4WX9A 4KUMA 1R58A 1RUNA 4HLXA 2NYXA 1ULYA 1IXRC 4CGZA 1IAWA 2A5YB 1HQCA 4YFNF 4PGGA 2LF8A 1TBXA 5LHGA 3QU3A 1ZRDA 1QZYA 2IP2A 3SXYA 5ERIA 1EH7A 3JAMZ 5FD5A 2STWA 2UWMA 4WXCA 1TLHB 4YFXF 3IWFA 4IVNA 4BQAA 2L02A 4R8HA 1MDMB 1YG2A 3GWZA 3HRMA 4KT5C 1V3FA 3WE3A 2PI0A 2XROA 1USTA 4ZZLA 1YFHA 5JFRA 1BI3A 1MJAA 3LAJA 3DQVC 1O3SA 5F64A 4ZZDA 1S6LA 4M74A 5KK1A 4P55A 5CVJA 4N9HA 1W5SA 2GXBA 3K69A 4ENJA 5E8IA 4A5NA 5ICFA 2EJRA 3HSRA 2LDUA 1YO5C 3C7JA 5FLXZ 2ISYA 5IT3A 1OMIA 4AIKA 2DU9A 2V1XA 2HR3A 1U3EM 2CGPA 3K2ZA 1SFUA 3EDPA 3M8EA 2QQ9A 3H3ZA 1ZAOA 1FWZA 3PFIA 5BOXA 1USSA 2X0LA 5DDGA 5DYMA 4L18B 3IRRA 3M1EA 2STTA 4PCQA 1O3RA 1K7AA 2KRFA 3HHHA 5FGMA 4ZYGA 1OR7A 1W7PB 4B8XA 4ZYHA
chains in the Genus database with same CATH superfamily
3WG9A 4BHCA 3PQKA 3HOUJ 1K78A 1UHWA 4ZTFA 2QQBA 4IL6C 1PJRA 1XGSA 1IXSB 4I01A 2EFPA 3ZN1A 3FMRA 4JQFA 3L2RA 3FMQA 1BIBA 1KYZA 4BHBA 3M4OJ 2O8KA 4IRIA 1Q1HA 4A3IJ 1R5HA 2IGMA 2P5VA 1B72A 2JJ7A 2JSPA 2DXIA 2IS4A 1X1CA 1ZG5A 4JX5A 3U21A 2IVMA 1IRFA 3OMYA 3P9IA 4N4OB 3I71A 2JN6A 1VQLI 2L7MP 4V19K 4OAZA 1HSJA 4RGSA 3ROUA 5K7HA 2HXIA 1GDTA 4ESJA 4XN3A 4RM2A 3A02A 3E6DA 1MH4A 4IOCF 4S0HB 4OWRB 2O6GE 3TMOA 5FD6A 2H09A 3BTLA 4HX4A 1R4MB 4YELA 1ZHFA 3F22A 5BS6A 2KIQA 2O8XA 1Y1WJ 1MMSA 3NWSA 4A5MA 4DYRA 2DCEA 4CHUA 4GDFA 5HLIA 1RUOA 1J5YA 1BA5A 3D5SC 2XGEA 2XF7A 1D8KA 1EF4A 3DLLF 3HOVJ 4I99C 2RNGA 2L54A 1K6YA 3OR2C 5B3SH 3GX4X 4P9UA 2MFZA 2NNNA 3CJRB 1T38A 1S8NA 3BOQA 3DKXA 3O2PE 1FX7A 4XLNF 4EM0B 3I55I 3F72A 1XMAA 2Y31A 1ZARA 2YUSA 2ME0A 3I4NJ 1R4NB 1MJ9A 2ELHA 2J5OA 2XC7A 2P5KA 5E17F 4PJ0C 2EFQA 3K4BA 4O3MA 2WAFA 4KJZA 5EDNA 4B48A 5D5WB 2UV1A 3G4SI 3CESA 2RV8A 2XF5A 2P81A 4UVAA 2P5LC 1P4XA 2GBYA 5IPAA 3WODF 2Q2EB 4V2GA 4HSTA 4CCJA 2DODA 5L3CA 3K4MA 1MBEA 2R7RA 2ZJRF 3BP8A 1U0JA 4LLLA 3PIPF 1ZGJA 2KL4A 3SFZA 4OMZA 1WRJA 1Z3XA 2WWYA 1APLC 3QYBA 3JSPA 2JTVA 3GTGJ 3ZQFA 2H8WA 2QWWA 3PNTA 3ZMVA 4A6EA 1CF7B 2FA5A 2JA5J 3BLYA 3GLLA 4HF0A 4D5FA 1KZHA 4D0PA 1LEAA 4BEHB 4D1QA 4A3MJ 1YITI 5E1ZB 1LDKB 1VQ4I 4DBRA 1KQ8A 4XRSG 2YU9J 2EFWA 1Z6RA 3BPVA 5ED4A 3CF5F 2ZMEB 1TQPA 2A5WA 2PMHA 4KN7X 2COBA 5EJCA 5DV5A 1D1BA 3S14J 3BG6A 2K9MA 3JAMK 4I98B 3ZRGA 1WWXA 1GXPA 4C3JJ 4IHXA 1FBUA 4G7ZF 2E1MB 5TRDA 2DDAA 1OISA 3MWMA 1POGA 2Y48A 3JRFA 4DQ2A 1OR7C 4BJ6C 2NS8A 4L5EA 3GZ5A 4RMNA 2BZTA 2EV0A 4BH9A 2HOAA 2FNPA 1DUXC 1QPMA 5LEJA 1ONVA 3A4CA 5L3EA 1ODDA 3FBNB 4YG2F 4YFKF 3MZYA 3ZQQA 1SFXA 2HVQA 3RKWA 3CUQC 5JVTA 3HYIA 4IXAA 2GXGA 2DT7B 4HEA2 1XX5A 3GEZA 2TDXA 1SVOA 4A0YA 5E8GA 1MMGA 1IW7F 4EVIA 1YOVB 1Z9CA 1MZBA 3CQZJ 1OJLA 4JOMA 1N78A 5FKOA 1FTTA 4HOBA 5FFXA 2Z9OA 3WTXC 3CJQB 5HNFA 2XKPA 3BY6A 2NVTJ 1SMYF 2LY2A 4KIGA 3DBHB 1LFUP 1EA3A 2HOTA 1JXSA 2DT5A 3WHBA 4U0YA 3PO2J 2CJJA 5F08A 2F6CA 3WTWC 3BT9A 2QKMB 3E6BA 3K6GA 1A6QA 3RQ4A 2V1UA 2FJ1A 1P92A 4P9FA 2QSHX 5K5QA 3CD6I 1T39A 1DU6A 1YS7A 1RESA 2PQ8A 1T0FA 1YTYA 5EG0B 1HBXG 2GA2A 1FNNA 1RKTA 3HBLA 3E7LA 4XLEA 3BR5A 2VC1A 2CYYA 3JSOA 4EGYA 5D5UB 4HNUA 3C18A 2QM3A 2HEOA 3KP6A 5FLXK 1YI2I 1J2XA 4DZPA 2QQAA 3DFGA 3V8LA 5K5OA 2DK5A 3LQRA 5LGNA 1BR4A 4A3LJ 1S3JA 3ZN0A 2A6HF 2XGXA 5EEAA 3MKLA 2JUGA 2VKEA 3G73A 2V26A 1U6GA 3OIQA 3PSFA 1FZPB 2FMYA 4NBQA 2KIMA 2KLOA 4FE4A 1LNWA 1JKQC 4EJWA 4ZC3A 1LDDA 1RR8C 1RR7A 3BG7A 3GZ6A 4G7OF 5M3MJ 1T8IA 1XSXA 2HQAA 4XKBA 3PQJA 3FXOA 4XLAA 3CDHA 5CVVA 4PFOA 1XG1A 1P7JA 1DPRA 3DF8A 4FE7A 2VIXA 2CSOA 4IHSA 4LMYA 3TW6A 1RI7A 2MABA 2XIGA 4A0ZA 4B47A 4BKXA 4EGZA 1KU7A 3CCQI 3F6OA 1W4MA 1IRZA 1O3QA 2CFOA 2CW8A 2VASA 1RRJA 4BU2A 2Y69H 2CUZA 4F55A 1H0MA 5H2FC 4II3A 2VC0A 1ZH5A 1B59A 1VQ5I 1E3HA 3V8JA 1XD7A 2AXLA 4CYCA 2ZNYA 4RB1A 2LYCA 2X51A 4LIVA 1IV8A 1JGSA 4A3CJ 3IP4B 3HEFA 1HKTA 3RDIA 1TT5B 1FP1D 3FXQA 2BW3B 2O0YA 5B1BH 3S32A 1G3TA 1D3YA 2ZO4A 3GTQJ 5L3FA 4UVCA 4I02A 2XGDA 4MIMA 2DA2A 4E70A 3WTZA 9ANTA 2DW4A 3D5LA 5JLWA 4BYYA 4HZFA 1S9HA 2YX7A 2VBYA 3FIWA 3JR9A 1K4TA 5FLVA 2LLKA 3SDGA 1NK2P 2MC4A 3OYBA 2KKOA 3DEWA 5J40A 2LKPA 3BPXA 1ZTRA 5CKTA 4NC8A 2X6OA 3S15J 2A68F 1H8AC 2K27A 3CJTB 1J75A 2X4HA 3R0AA 1R00A 5GTHC 3IRQA 2MGQA 2E2IJ 2XAUA 5BPIA 3FXUA 2E34A 5J1UA 5LEKA 2FU4A 4W97A 3GCMA 5E20A 4C9YA 1IXCA 2VT2A 2D1HA 4U88A 3CCLI 1SAUA 2ZBKA 4CZCA 1GV2A 2K3FA 1WJEA 5DCMA 1N25A 2XPWA 1TT0A 4FETA 2Z16A 1OLTA 2JK3A 3VYSB 3IL2A 4DGWB 1U78A 1K78B 2IS2A 2O9LA 2CMPA 1TP4A 5J4VA 1JKRC 4LK1F 1FP2A 2LY9A 4I0BA 2DMQA 1IN6A 4CA0A 2F5FA 1RKWA 5HS7A 1U9OA 2EWNA 3Q3SA 1YQAA 1K61A 1AHDP 3HOWJ 2M1BA 4DBQA 1B72B 1YIOA 4M6YA 3S3OA 2EZIA 1E2XA 1SVMA 3AG2H 4ESFA 3WG7H 2A69F 3QPSA 4PZJA 4M9XA 3CZ6A 4IRHA 2JPBA 5D6EA 1IN5A 2IA1A 3E5XA 1LQ1A 1HSTA 1HW1A 1RPWA 3HUGA 2OBPA 2QENA 2PN6A 1Z77A 1MMDA 3TO9A 3BG3A 4CXFA 4NB5A 1P6RA 5DCFA 1T0FC 2DPDA 4F3QA 3V7SA 1I3AA 4XRFA 2CUFA 2O3FA 5GP9A 1Y0UA 1X19A 1Z1DA 4HA8A 1XPXA 2VOOA 1I1GA 2R7FA 2EPFA 2VODA 2QQ8A 1R36A 5IP6A 3JRBA 1TQIA 2QEXI 3V7RA 2P0WA 3TKYA 1KU2A 4IKFA 2MC3A 4L9NA 2YU3A 2WBMA 1FY7A 3CC2I 2A6TA 3JTGA 2DYRH 3QPLA 4DYCA 1BJAA 2FEZA 4IHWA 2B7EA 4A69C 2R7OA 2H27A 1QA6A 1Y39A 3A01A 2WA0A 4H4KC 2BY0A 1FYLA 2HYFA 3H5AA 4QPOA 4LLGF 2BEOA 3E6CC 5EEGA 4JBAA 4RGUA 1TWHJ 4GCVA 3H36A 2ZXWH 1XGOA 5KAFC 5D4SA 4AC0A 2ZXHA 2RDPA 2IGOA 2M0MA 2COMA 3H3VK 3GFIA 3LSKA 2ZSHB 4RGXA 3KEYA 3M7GA 5LHIA 2L4AA 4I6ZA 3QP6A 1ETYA 1TNSA 2X6XA 3H5RA 2M4GA 1R1VA 2HDCA 2W24A 4HLYA 3F0CA 2HYJA 2DMPA 4EV0A 4NC7A 2VJ4A 3OOUA 1BI0A 1X1BA 2KISA 5HS9A 4PSWA 3BG5A 4Z2YA 1QU3A 5DUKA 4G94A 3VSLA 4KDPA 2HWVA 3GBGA 1U8BA 4I7HA 5AONA 2NAZA 4E7IA 4CICA 2VOPA 4XLFA 2ELJA 1PP8F 1WFXA 1T95A 2YSRA 4BDYA 4HNTA 2YPRA 2HKOA 1G59A 4M3EA 3ZXSA 3HZJA 4RAGA 3K9TA 2O61A 5AIQA 2JUCA 3MKYB 2HZDA 5HLTA 1V4RA 4S04A 2FBIA 2HVRA 4KA4A 3OYCA 3C2BA 4G12A 2I5UA 2WADA 5L3DA 1AWCA 2L9NA 1UB9A 3DKYA 3KZIC 2DDBA 3FXMA 3CTAA 1HOMA 1FIPA 1GV5A 3BR1A 2J5PA 3CP2A 3KP2A 3N4MA 4BACA 2F2EA 1YW9A 1JUPA 2DOFA 2VBZA 3HGGA 3BJAA 2R0QC 2CUJA 4XR6A 1U2WA 2M2EA 1GHCA 4XLPF 1AA7A 1XCVA 1QHGA 2KMUA 2HDDA 2L2OA 2A61A 3OR1C 2KDOA 4B3XA 3VB2A 3K70C 3HDDA 4B44A 2RC4A 4FX4A 1ETWA 1TWCJ 1XGNA 1WJCA 5K1YA 3L00A 3C2HA 4KT6A 4MQVA 2P7VB 2CV2A 2VKHA 1ZQ3P 5E1WA 1UG0A 1DGRM 3L7WA 4P1WA 4BBRJ 4ZJZA 1ZGAA 3ZQIA 1WH7A 4NC6A 2KIUA 2RVCA 4A6DA 4A3JJ 3RZOJ 2RQQA 3X2QH 4OU0A 1RIOH 1XMXA 3EETA 3JRCA 2RKHA 2LREA 2BGCA 3R61A 4WWCA 5EGOA 3M1CA 3G3ZA 4XONA 3I59A 1J7KA 3MZ8A 2JA6J 5J1YA 2OPTA 2R7XA 1RNLA 2DA7A 3PFYA 2BY2A 1BOBA 2X1EA 3LSJA 2LG4A 3DTEA 2OV7A 1OYIA 4LB6B 1I6XA 1A6IA 2XKOA 1IF1A 5K5RA 3ZGKA 4E7ZA 1FLIA 1NK3P 2VPLA 4F92B 1QRYA 1AU7A 3SZTA 5M5WJ 5GAHJ 1MBKA 4XL9A 4B43A 2GOXB 5JHUA 3DBRB 1GVDA 1Y8QB 3OYKA 4XSXF 3K4KA 3E5UA 1T56A 2X1CA 3VODA 3BR2A 1ORKA 1BOAA 3LFUA 2DFEA 2FSWA 4M9ZA 3KLNA 3OWTA 4QWQA 4XSZF 2LNBA 2NXNB 3FK6A 2W7NA 2QF7A 3JRHA 2K9NA 3KP3A 2KZVA 1DP7P 2PLYA 3MFKA 2LBFA 3JRIA 3NEUA 5IYCJ 4C30A 3GTOJ 4IQ4A 4LIUA 1K79A 2BXYA 4EJTA 3ZR8X 4IPAA 3QP5A 1R5GA 4NUBA 2EZHA 3OYLA 1TW2A 3UKGA 2PMUA 1WKMA 4WCGA 3BZCA 2IT0A 2OAZA 2XUBA 2LKSA 1W0UA 2LRDA 1D1CA 1R49A 2XASA 4B1RA 4IZZA 4RB0A 2W1OA 4EQQA 3S1MJ 4Y17A 4XNFA 4MO7A 5CPRB 2P7CB 3DU5A 4CYCB 3CUQA 1WJFA 4FX0A 4FTHA 4A2UA 3K4LA 3OYGA 2F5CA 1BW5A 5HS8A 5JLXA 1G6NA 2EIJH 4QIWN 3CLOA 4J01A 3I4PA 1LJ9A 2DBBA 3D1NI 3HHGA 3E0JB 1S7EA 5A2QK 2PG4A 4DNCA 1X2NA 2UXXA 2QSGX 3RKQA 5E18F 2V6EA 2CO5A 2PBIA 1MMNA 2Y0SA 3C2GA 2VJIA 3FM5A 1XSVA 2GZWA 4WF2A 4G6DA 3L2WA 4E7HA 5HDGA 2X6WA 4II2A 1T2KA 3MCZA 3FXJA 1QZEA 3QQAA 2X1DA 1PDNC 1BI2A 3W2WA 3WU1B 3KE2A 3K7AJ 4CCMA 3DKWA 4OMYA 1EH8A 2VKVA 4IEJA 3BG9A 2VONA 5DM6F 1K4SA 2M8EA 2DPUA 2ZC2A 2JPCA 3LA7A 1MMAA 4EEFG 5E3LA 3L1PA 5HDNA 5IOZA 2EV5A 3FM3A 3VFZA 5GADJ 1DP3A 4GYIA 2JVHA 4KMFA 2HFHA 3F21A 1F5TA 5DCMB 4ENNA 3E1SA 1X3ZB 1YW7A 1B9NA 3BR6A 4O5VA 4OIPF 2EB7A 1PP7U 2R7DA 1D0ZA 1QZZA 1JT6A 5CLSA 3CJNA 1VI0A 2F4MB 1D0XA 1XMKA 3NQOA 3M3YJ 3A03A 2MSYA 2XRNA 3CMAI 3B73A 2M7AA 2OJED 1B8IA 3FXKA 4M9SA 3J7AY 3DXJF 3K4CA 3K10A 5LRSA 3HOXJ 4CCLA 3V8KA 2NNYA 3K2AA 3PUFA 4PJNA 4R1HA 1JTYA 2GLOA 2WAEA 4AIDA 1G4DA 1ZLKA 1ZGWA 5DEQA 3Q0WA 4FQGA 2CU7A 4EJUA 3HUGB 4ITVA 4KITB 3DCFA 1J9IA 4KIFA 4F93B 1A31A 3G1MA 2R7SA 2EINH 1KQ9A 2MA3A 3RSNA 2R5YA 1MKMA 3DU6A 2VBWA 4L0ZB 4LLNA 1SMTA 1Z91A 4FT8A 3AL0C 4AVZA 1T6SA 2DMNA 2K7LA 5CYVA 2DO7A 2OCEA 2ZB9A 5EEHA 4CCOA 3ASOH 5GAGJ 4UV9A 3H9QA 2R4GA 2VKDA 2Y0SN 2NS0A 3OIOA 3ZMTA 1Z7UA 2CG4A 1S72I 5D5XB 2KQRA 1QVUA 2RNJA 5E1XA 4UUTA 3W6KB 2CS3A 4BGDA 3QYFA 3ZMSA 3FWEA 4BJTA 1IUFA 5H6QA 3CUOA 3A01B 2ZJQF 2GAUA 1JE8A 2V9VA 2IS1A 2BV6A 3A0HC 3E5QA 4DOZA 1WCMJ 2FMLA 3RTRA 1UJ8A 2NVYJ 2WV1A 4HRIA 4AYBA 2NRAC 3WTYC 5C4XJ 2M30A 3J7YJ 2GM4A 2DTRA 4LITA 2W48A 3IV5A 2H1KA 3MAJA 1R71A 1WVRA 4U0WA 5FKNA 3O3KA 1I39A 1N75A 1O57A 3RJPA 3I56I 2R93J 2WTEA 4IJAA 4UB6C 3OYDA 2XSJC 1DGWY 2WAQA 2CQXA 4WXDA 4C2UA 2F5VA 2XVCA 5LGTA 3G1LA 4Y3OA 2NS7A 3LNQA 2R5ZA 3K4JA 5LFAA 1VQNI 3BQZA 3CP8A 2TRTA 3I9V2 1PYVA 3QYEA 4HDUA 1CGPA 4BBSJ 1T98A 1K6OA 4OIRF 1ZG3A 2LSOA 3TBIA 4ZH4F 3P5JA 4BQQA 5GPAA 4IHVA 4RB2C 3ZQGA 2IRFG 1WJAA 2AHQA 1XDUA 2PMZA 4BNCA 2YR2A 1HDPA 1MW7A 1WSUA 2BBYA 2VQHA 1U5TC 3HSFA 2GIZA 1IN7A 1FTZA 2JQ7A 2DFHA 3SEZA 3TDZC 2DQRA 2HNHA 4QLCU 5JI6A 2WV0A 3HSEA 2CV1A 5D5VB 1OCOH 3DV8A 1YJWI 3CDLA 4LG3A 3F8CA 3B6AA 4B4CA 2L9VA 2CQKA 3OOPA 4ENMA 4N9IA 3ECHA 1L0OC 5H20A 4ENKA 3QOPA 3R6SA 1SVLA 4BS9A 2FBKA 5LBQA 1J09A 4MTDA 2DFIA 3U1KA 1Y0NA 1ITYA 1PUFA 3LQQA 3MD2A 1OCZH 3HTSB 2VL8A 1UAAA 5LGUA 2DTZA 3SDBA 2KHMA 4MFEA 2BY1A 3SZPA 2DYSH 3ZP5A 4AIJA 4MHGA 5FJ8J 3UR3C 4IHYA 3LA3A 4XQFA 4LB5A 3W6JB 1I50J 3BCBA 2Z1DA 2GOMA 2O03A 2ZXIA 4PJMA 5CQEA 1WGXA 5CQGA 4AYBN 4EJVA 4Y52J 2CH0A 3GMEA 5J8FA 3JRDA 1R9TJ 2DOEA 5D4RA 1MJBA 3JCUC 2P6TA 4I09A 4M3FA 4HX8A 3L2QA 3WGIA 4I2OA 2B0LA 1SD4A 1HF0A 1PUEE 2YX4A 4L9TA 4M71A 3WTVC 2I10A 3MZHA 5EGOB 3GUDA 3I59B 3NRVA 3ERED 2IAIA 3I54A 1JI8A 2WAQN 2RGVA 4XRSA 1X3UA 3L09A 3PIOF 3HL2A 4BHPA 1KU9A 2OTLI 1IC8A 1D1AA 1MGTA 3DP7A 3K1NA 3BCAA 3RCOA 2G7UA 2E1CA 2Q8KA 3ZCOA 1B1BA 1OYYA 1KONA 4RAYA 3AL0B 3OL3A 1R7JA 1LPQA 2CRGA 3BC8A 1X4OA 2DMTA 3ZQCA 3IH2A 2HPIA 2DQLA 2KIFA 3AG4H 3ASNH 1X4PA 2F4IA 2PMZN 3K1MA 4MLOA 4Y15A 1VFCA 2PX9A 2V9PA 2CW0F 1P4AA 2WY7Q 4KYWA 5B1AH 3T5XA 3OIPA 2F4OB 5DM7F 2GXAA 4L9JA 2VQLA 3E97A 2XAHA 3LSIA 2CW7A 1FYMA 2UUZA 3QPHA 3IWZA 3BROA 2ZKZA 5E3NA 3KYLA 3OS1A 2M5WA 1FPQA 1VTNC 1IN4A 2LBFB 4UUVA 1VQ9I 4NNJA 4E7KA 3EPZA 4RBOA 1UFMA 4KMUX 2D1VA 3CCEI 2QGUA 4YIRX 2RREA 3M9AA 5HLGA 4CSWA 3F8BA 1BN5A 3HGYA 2M34A 3TEDA 3TO7A 3CLQA 3FISA 3GXOA 4D7MA 2D2WA 3Q9SA 3H5NA 1ZR4A 4CO8A 1UHSA 2R7WA 1JHHA 1JUSA 3CUQB 1E0EA 1SD7A 1X3WB 3EUKL 3IKTA 3ML6A 5A2QZ 3H0DA 3A1YA 2ECCA 1ZYRF 2E19A 3S16J 1KGSA 2DJIA 3V4GA 3J81Z 3GTJJ 1VNDA 5C44J 3HOTA 1NTCA 2Y2ZA 3J80Z 3CO6C 3GFJA 4Y33A 1G3YA 1X2MA 2OZ6A 4BXXJ 2JMWA 3PL8A 1H9GA 1U5TB 5IYBJ 2QCOA 5EYRA 2V7FA 3H92A 4K2EA 2XPVA 3HOSA 2JVGA 1A04A 1F1ZA 3ELKA 3H9JA 4C3IJ 3BTJA 4XORA 3I53A 1LE8B 3RYRA 1Y56A 2A07F 5FO5A 3H9GA 2OA4A 2X85A 2IW5A 3BTCA 3K1PA 3GZNB 4TV7A 5J47A 2XHKA 4RA2A 1F4KA 2DA6A 2BVMA 2GIVA 1R1UA 1A36A 5HODA 3ISPA 1UHMA 4D9JA 2HZTA 2ZSIB 3AAFA 1BI1A 3KCCA 4NDLA 3LAPA 1R22A 4HW0A 1UZCA 2QYOA 2VJ5A 3L2CA 4HDVA 1IRXA 3HOYJ 3NWTA 2IA2A 4HQMA 3EUHC 3WGGA 3LSRA 4OIOF 1IJWC 1GUUA 4BY1J 2CV0A 4QSHA 2HYGD 1BJZA 2MH2A 4OINF 1FSHA 2LTPA 1Z67A 1FT9A 3U2RA 2VT3A 2ME6A 4CCNA 1BC7C 3RYPA 3S2WA 4BJ5C 1ON1A 2AXTC 2PJRA 1B8IB 3I0TA 4F7ZA 2FE3A 1WH5A 2EBIA 4GXOA 1FOXA 3KZZA 4EJOA 4J00A 5K7ZA 1X1PA 4HSRA 4M3BA 3S1RJ 1X1AA 5ILUA 5TJJA 3PO3J 1IV6A 1UELB 4CDGA 3WTSC 1P9QC 3ZOBA 4MQ9F 1TWAJ 3WGHA 5FB2A 2A05A 5ILVA 1SFEA 1EV7A 2ZJPF 2K4BA 2R5YB 3I64A 3K0LA 3QAHA 2VE8A 3S3NA 3S1NJ 3TDUC 1F9NA 3RQIA 1VQMI 3V42A 1KQ0A 2VLAA 1MSFC 4C2TA 4RM3A 5IY5H 4UHTA 1ZN2A 2GQQA 2LOOA 4RLQA 3TOBA 1YYVA 2M0CA 1LDJA 1GLNA 1ZELA 5D8LB 2VE9A 3ZQLA 5H6RA 4XKCA 1VQPI 3GLXA 3W2AA 4YIIA 5FLMJ 3KETA 5KVRA 4U7DA 3QOEA 2K86A 4HX7A 2IPQX 5EZGA 2XRLA 3SQNA 1R6RA 3GF2A 2LFBA 1FIAA 3FBIB 1STZA 2ECBA 1MIJA 5FRNA 4U7BA 3TGNA 5HNHA 3TW7A 2DI3A 3HIFA 1NG7A 4XBFA 3ABUA 2CWEA 3KLOA 3SFIA 3HOZJ 2IEKA 2FBHA 1FBSA 2LH9A 3GVAA 3FDYA 1FMVA 4KNYA 1LB2A 4A12A 3FX3A 1OCRH 1MNMC 5FROA 1TNTA 3LSMA 1IO2A 3Q9VA 3FZVA 5GPCA 1MH3A 2Z5UA 4DW6A 4MEXF 2ESHA 2K9QA 3DTIA 1O3TA 3IKVA 2XB0X 2AS5F 3JW4A 4LOCA 2P6SA 4W1UA 4BQNA 1WQ2A 1ZRCA 4L0YB 4HAMA 2JWTA 2DOAA 3TOAA 3F8NA 4D5CA 4ZYAA 2ZNZA 3S2DJ 1O7LA 2MLGA 4P96A 2LF7A 3CMMA 2HU9A 2R5ZB 2K9SA 2XAJA 3K4NA 3GTMJ 2O5RA 3CMEI 1KYWA 1TZLA 2Y0MA 2ZFWA 1VZ0A 2UZKA 4P5OA 4ETSA 3E3VA 2QVOA 5IT9Z 4WXHA 5C3EJ 3M8FA 2DMUA 1FYKA 3B6CA 2ADUA 3O6BB 4BE1A 1HW5A 1QVTA 4I0AA 2NOJB 4BXFA 1EH6A 4Y4RA 2BE5F 3S17J 4U87A 2PEXA 4A3EJ 2LC2A 1D8JA 5J4YA 4PDKA 1VQ7I 2UXNA 1S7AA 3HB9A 3QODA 5CVIA 2EA4A 4BDZA 2E2HJ 4HF1A 1W7PD 4KIBA 3I3LA 3CMYA 2H94A 2H6BA 2M7BA 2W00A 3PM1A 2ACJA 3V7CA 1ZLJA 1FJLA 3GFMA 4AIHA 1FOKA 1IUYA 2G9WA 1TC3C 4HBLA 5JHFA 2Y9ZA 4CUGA 4GFBA 1Y6IA 3ECOA 3DEUA 3FHNA 5DUIA 2DT6A 4U0VA 1FOWA 1V55H 1PUFB 4RLFA 3BZKA 1L3LA 1BR1A 3OSGA 2OQGA 1E3OC 1P2FA 3ABMH 3IUOA 5FKLA 4Z6YA 4HNVA 1Z0XA 3FF5A 1XSDA 1RZ4A 1HLVA 4G6TB 1Z05A 4Y7NJ 3COAC 1SC7A 2HOEA 3S8PA 2QBYA 2DA1A 2DK8A 5M3FJ 2OTJI 1XB4A 2DA3A 2MD0A 4V2FA 3FHZA 4IOAF 2EV6A 3H3UA 2LP0A 4R79A 3T1BA 2ZMEC 1JT0A 3VDXA 3CF2A 5BNGA 1V5FA 1I6HJ 2Y9YA 1HA8A 4ASNA 2A3SA 2GWRA 3GYHX 2CQ7A 3KP5A 3KZYA 2OF7A 4EMSA 1S29A 2K4JA 2FQ4A 2KRHA 3K70D 2A6EF 4LG0A 2BHYA 1YJNI 3A2KA 1ERDA 3LFKA 2KJCA 1JKPC 2E1MC 1WI3A 5LLQA 1P7IA 5CVUA 1IZ1A 2XGCA 4HF2A 4C3HJ 2K02A 1TW3A 3B02A 4LGWA 1QHHD 1HCRA 1Q1VA 2OD5A 4M3GA 2NOGA 3P7NA 2PJPA 2ZFUA 3BJOA 4DZJA 4PFPA 1ENHA 3EUAA 3ONQA 3PSIA 3KPHA 1MBFA 1YRNB 3PJRA 1QQIA 3N05A 1WJDA 4PJLA 3J81K 3C1DA 1VF9A 3J80K 1U5TA 4PGHA 5J3LA 3J7ZI 1A35A 3HRTA 3UNGC 4XN0A 2CFXA 1OYWA 3OL4A 4GYGA 1QNTA 1BW6A 1LE8A 1M1EB 1HKQA 3ULQB 1IN8A 2JSCA 2IBDA 4GGGA 3VYUB 4H0EA 2RAEA 1ETKA 3CO7C 2P4WA 3WE2A 3RPUD 3TP3A 2X6YA 2HGCA 5L3GA 3FKIJ 3L2VA 1T08B 1FC3A 2E5ZA 3HKZA 4PSXA 4A3BJ 1ON2A 5DTDA 2RQPA 3Q0UA 4MEYF 4HG2A 1S5LC 2D45A 4MGRA 1GVJA 3RPQA 4G6QA 1VQ6I 2Z2SB 1YS6A 4XMYA 4BAYA 4RB3C 2E60A 2IJLA 3EYIA 3HM5A 3U9GA 2KRCA 3HRSA 4NQWB 1TTYA 5IP9J 1XGMA 1MBHA 4XM3A 4IO9F 4UNOA 4QPQA 2W84A 1ETOA 2ICWG 3S93A 3HPGA 3JRAA 2N8GA 3DWLE 2V1NA 2Y75A 2E7XA 2KP6A 2W25A 3MQ0A 4KFCA 4M6VA 4BL0B 4MNUA 4A3FJ 5IYDJ 4YRVA 3TL4X 4XOPA 4Q48A 4UVBA 2KZGA 2FOWA 2XF6A 4G9YA 4RS8A 2KJBA 2XAQA 4UUSA 3RI4A 1YHQI 3O8HA 3OYHA 1OKRA 3ESWB 2F48A 2KPMA 1LUJB 4RGRA 3HC7A 2L9SA 2V79A 2GA1A 5F0HA 3S2HJ 3T0YA 1XS9A 1I5ZA 2DLLA 1SAXA 2TCTA 1F36A 5LHHA 1H89C 2R3SA 5JVGF 1YW8A 1SD6A 2FX0A 3IH4A 4HYEA 3REOA 3I58A 4GO1A 4PJJA 2M4KA 3SZGA 3QWLA 5DD8A 2V4JC 4Y13A 2L4MA 1Z3YA 2K85A 4MTEA 2LVSA 3VEPA 1IGNA 2F5EA 4HPQA 2MLKA 3OS2A 1KU3A 3N97A 4E7SA 4A3GJ 2I8DA 2HKXA 3PNVA 3FXRA 1S7OA 1XN7A 3H0GJ 2HQ5A 4E7JA 4A0XA 3CC4I 2ID6A 2K40A 2XB5A 1GXQA 3FK7A 4Q5SF 5F6FA 3C3WA 3HKZN 3KEQA 4UXNA 4AD9A 2JA7J 3ZQHA 2H8RA 2E1OA 1UMQA 2DAOA 2IA0A 3ZMDA 3OV8A 4FCYA 3F6VA 2R7QA 2PJRB 4YIFA 1G3SA 4Q4ZF 1W5CC 2G7HA 2BOLA 3O8GA 4KN4X 2E1NA 2OQRA 1QO0D 3QU6A 3S3MA 4M73A 4A3DJ 3LWFA 4OIQF 1SANA 4XLHA 4X6AJ 3GW2A 5F27A 2B9SA 2M87A 2L7FP 3F8MA 2VXZA 4BXUA 2DJNA 3SYTA 3L2UA 1XTAA 3ZPLA 1MBGA 2R92J 3KX2A 4AM3A 2C6YA 2EZKA 2ZXJA 1O7FA 4L9VA 1REPC 2EFNA 5HVQC 4HQEA 1IG7A 2HQRA 4S05A 1HW2A 2ESNA 3IAM2 1HXDA 1D5YA 5D8KB 1MDMA 2R7ZJ 1DPUA 3OYNA 1ZK8A 2PFBA 2ISZA 5AIPA 4UY8I 3VYTB 3F3XA 4BUPA 4X1EA 2NVQJ 3EQLF 3VYRB 3GO5A 5IOYA 2FD5A 1YLFA 4XKWA 4BE2A 1LVKA 4IHTA 2BYVE 2VQCA 3WTTC 4JYKA 2DA4A 5IT9K 1AKHA 4IRGA 3GTKJ 5ICGA 3RIRA 4ABZA 4BY7J 2VQGA 3KEOA 2DFFA 2NVXJ 3HTUA 1D5VA 1FOYA 2L9RA 1P4WA 3DLAA 3IC7A 5F1JA 4OOIA 1J0RA 1HC8A 1K83J 2LY1A 5J6XA 4FHTA 1KA8A 4IF4A 2EFOA 2CQNA 2P8TA 4ESBA 1OCCH 2IXSA 2W57A 5F0CA 3LOCA 1U9NA 1WJ5A 3MMYB 1FMWA 1B9MA 3F9KA 1G8XA 2JZYA 1I27A 3GTPJ 1WHUA 4A93J 3FXLA 1HDDC 2WC2A 1BL0A 2XV4S 5LRRA 5J8CA 3EUHA 2K9LA 4DJAA 5HOOA 1WI9A 3DPTA 3I4MJ 3G1OA 3JREA 1LVAA 4M3DA 2NVUB 3T8TA 2XSDC 3LL7A 1OCPA 2K5CA 2O7OA 2LK2A 5ICCA 5ICEA 1LKXA 3OYAA 2HOSA 2Q1ZB 4QTRA 5EF6A 3G2BA 5L3BA 3ABTA 1IDYA 5E79C 4MFDA 1UCRA 2HXOA 3Q5FA 1TQMA 1ZREA 1X1DA 1W0TA 2EZLA 4E6KG 5IP7J 5B66C 2IGKA 3T8RA 2R7UA 3R60A 3CCMI 3W6VA 3KFWX 4F91B 4UB8C 4JX4A 1H88C 4ZYEA 3KP4A 4LFUA 1B4AA 4Q47A 1W7PA 1D0YA 1Y1VJ 3BWGA 2FQ3A 2BVLA 5F0FA 3OS0A 2VBXA 4G7HF 1C0WA 1ZRFA 1LEBA 5D6FA 1NH3A 3P9KA 4EM1A 2VN2A 2R7VA 3HRUA 1U8RA 1NHAA 2E36A 4L5JA 1YRNA 2AO9A 2DN0A 1TWGJ 4B09A 2OU2A 5F04A 1MNDA 1G3WA 3MKZA 1SD5A 3L9FA 2BXZA 4JP0A 5M5XJ 1UG2A 3W2VA 5ILSA 1Z7LA 1MNEA 4M72A 5LD2C 2LR8A 3G6EI 4PK4A 4ZTJA 2HTSA 5HDKA 5CVRA 2CQQA 2V1DA 4GRIA 3PUBA 2G0EA 3BJ6A 1Z6TA 3CDIA 3CCJI 2OZUA 2FRHA 3JTHA 5BMZA 2VXDA 4KISA 2ETHA 2QBYB 3M07A 3R4KA 3CCYA 4DIQA 2HVSA 2FXAA 3GFLA 3LSTA 3DPLC 3KP7A 4AU7A 3MN2A 5JR3A 2V6CA 1YX5A 2Y30A 3U1DA 3QPTA 3I5UA 3G71I 5DS9A 1W36C 2X48A 3J7AO 2MD5A 3VOEA 1QPIA 1V54H 1OPCA 3Q0VA 1AOYA 3TP0A 3OY9A 3IHUA 3AG1H 4F52A 3IAS2 1I3QJ 4NQWA 4LK0F 2H1LA 1XCBA 4ON0A 2MW8A 1EJ9A 4LG0B 3VWBA 2EIMH 1BC8C 1JHFA 1Z21A 3D0SA 1WJBA 3ERMA 3OYJA 4WK8F 1R1TA 1I1SA 1YE9A 2CUEA 5F1RA 2QLZA 2QKLB 1QGPA 3E6MA 3MVPA 4ZDLA 1TWFJ 1DQUA 3QRFF 2ZCWA 2ZJ2A 2KT0A 4XLCA 1YIJI 3W3CA 1VQ8I 4HV6A 5EZHA 4AVPA 1H9TA 4M6XA 4CYDA 4FASD 1SFKA 3F23A 1W1WE 3RKYA 1ACIA 3LSGA 3AFHA 2L3DA 2ID3A 1TL8A 3LSHA 1VQKI 2HS5A 1XDSA 3BDDA 5M5YJ 1FBQA 2B63J 4OAYA 1B6AA 2ELKA 2FNAA 2EA2A 2HPMA 4RAZA 3SHFA 4A3KJ 3RPUA 2FUG2 4XOTA 2JRTA 5CJ9A 3OYFA 2HTJA 1F43A 3ZMUA 2FOKA 3HG9A 1LFPA 3HJEA 2Z33A 1DDNA 2Q2EA 3BR0A 1OQYA 1RC9A 2W85A 3D5RC 2BY3A 4CCKA 3LA2A 2M45A 3TO6A 3BZ6A 2MH9A 1BM9A 3ZQ7A 4JK1X 6PAXA 2FF4A 1HKSA 1V5EA 3GTLJ 2E2JJ 3KYDB 3VPRA 5FKMA 3CCVI 2HQNA 1JUMA 4N0BA 3MEXA 1CF7A 5HLHA 1ETQA 2MBFA 1QBJA 3SEQA 3JRGA 1WZ2A 2LKXA 2JT1A 4BEHA 2L01A 2E71A 1MBJA 3BQYA 4YEJA 1DU0A 4XRMA 2JRMA 3FMSA 3ZMZA 4CZZA 4AWXB 2Z3YA 1ETVA 4LD5A 1BBYA 2ZMEA 1IRGA 2WY8Q 4UV8A 4AUXA 1ZG1A 2XAFA 2AQEA 3WTUC 4UUSB 3TQNA 2LMDA 1W36D 3CCSI 1JGGA 1GT0C 4IQJA 2H6CA 3DBLB 3HPHA 5GAEJ 1W5TA 2EILH 4PUSA 2E7WA 4LJZF 3RZDJ 5GTIC 1E17A 4KICA 3F8FA 1J59A 2QUFA 3RKXA 3IH3A 5DD4A 4G8XA 2QZ8A 2W82A 4HV5A 1BIAA 1MD0A 2RN7A 3P9CA 5BPDA 4BQOA 1FSEA 5BQTA 4NHJA 2Q0OA 4I76A 2JA2A 3H35A 1R23A 4RDUA 5FFZA 4L5IA 4O6JA 1PVEA 2Z99A 4ZYDA 3R0JA 4EM2A 2M3AA 2VI6A 2XAGA 2F5DA 3WU0A 2QSFX 2MYSA 2EIKH 2EK5A 2M8GX 3EYYA 4WX9A 2KDZA 4XICA 4KUMA 3LSPA 1R58A 4E4HA 3DEEA 1RUNA 3FKJA 4HLXA 2NYXA 4J19A 1O4XA 1ULYA 1IXRC 1ZR2A 4CGZA 4XKVA 3LMMA 1IAWA 2A5YB 1HQCA 2L7ZA 4YFNF 3CCUI 4PGGA 2LF8A 4ANJA 1JJ8C 5KNLA 1TBXA 5LHGA 3QU3A 1ZRDA 3WHCA 5E3MA 1JKOC 1QZYA 2IP2A 3SXYA 5ERIA 2AQFA 4FISA 1EH7A 3JAMZ 1YX3A 1V5GA 5FD5A 2STWA 2M9HA 2UWMA 3WU2C 5EG0A 3A0BC 4WXCA 3BTIA 1N77A 1TLHB 3OYIA 4YFXF 3IWFA 3CC7I 1Y8RB 4BE0A 1JJ6C 3NARA 2HI3A 3S1QJ 1JTXA 1CQTA 2L5QA 4IVNA 3ABKH 4BQAA 5TGTA 1IDZA 2L02A 3HXLA 3NAUA 4R8HA 4C2MJ 1R5ID 1MDMB 2WB1A 2XPUA 1YG2A 3GWZA 4B3AA 5K7FA 2KFDA 3HRMA 4EATA 3KIOA 4KT5C 1V3FA 5E3OA 3WE3A 2L7KA 2D5VA 2OC6A 2PI0A 2XROA 1USTA 4ZZLA 4DYQA 1YFHA 3M8JA 3CCRI 5JFRA 2VUMJ 1BI3A 1MJAA 3OSFA 3LAJA 1FEXA 1AKHB 3DQVC 4N4NB 1O3SA 2DA5A 5F64A 5FKKA 2EQRA 4ZZDA 2R7TA 1E3PA 2VB6A 2XDVA 1S6LA 4E7LA 5B5EC 4CH7A 4D7NA 4M74A 1BR2A 5KK1A 1MSEC 4P55A 2QA4I 1XC5A 5CVJA 4N9HA 1WPKA 1W5SA 1T33A 4XIDA 3PNYA 2GXBA 3K69A 4XK4A 4ENJA 5E8IA 4A5NA 5C4JJ 1SFOJ 5ICFA 2VPRA 2EJRA 1ZKGA 3DPUA 2BHZA 2LDUA 3HSRA 1YJ9I 1YO5C 4ZDOA 4IX7A 4ZDPA 3C7JA 2BW3A 5FLXZ 2MG4A 2IS6A 2ISYA 2V9KA 5TISC 5IT3A 1OMIA 4RAFA 2DU9A 2V1XA 5KAIC 2HR3A 4AIKA 1U3EM 2CGPA 1OFCX 3OYEA 3K2ZA 5J1RA 1SFUA 3AKZA 3BR3A 3EDPA 3M8EA 2QQ9A 3MKWB 1VQOI 3OYMA 1RETA 3H3ZA 1ZAOA 1FWZA 3ABLH 2IGNA 2VJJA 3PFIA 3KYCB 2L0KA 5BOXA 1USSA 1EKEA 2X0LA 2OUMA 1SEUA 1A5JA 5DDGA 5DYMA 2E35A 2HDWA 2E5NA 3VSKA 4L18B 5KHDA 3IRRA 2EH3A 3M1EA 4JX6A 2STTA 2JA8J 4PCQA 3SJMA 1X58A 1G2HA 4X0GA 1O3RA 1K7AA 2KRFA 3HHHA 2OCCH 5FGMA 3DTKA 2W4SA 3AG3H 3H1CA 4ZYGA 1OR7A 1W7PB 5FRMA 4B8XA 1ETXA 2WB1N 2K3PA 2LD5A 1OCTC 5KCMA 2YS9A 1NG6A 1LFBA 4ZYHA 2X9DA
chains in the Genus database with same CATH topology
3WG9A 4BHCA 3PQKA 1K78A 1UHWA 2QQBA 1XGSA 1IXSB 4I01A 2EFPA 3ZN1A 3FMRA 4JQFA 3FMQA 1BIBA 1KYZA 4BHBA 4IRIA 1Q1HA 1R5HA 2P5VA 1ZG5A 2IVMA 1IRFA 3P9IA 3I71A 4RGSA 1HSJA 3ROUA 4ESJA 3E6DA 2O6GE 5FD6A 2H09A 4HX4A 1ZHFA 3F22A 5BS6A 2O8XA 4A5MA 4CHUA 5HLIA 1RUOA 1J5YA 1D8KA 2L54A 3GX4X 4P9UA 2NNNA 1T38A 1S8NA 3BOQA 3O2PE 1FX7A 4XLNF 4EM0B 3F72A 1XMAA 1ZARA 2ELHA 1MJ9A 2J5OA 2P5KA 5E17F 2EFQA 4O3MA 5D5WB 2RV8A 4UVAA 2P5LC 1P4XA 3WODF 5L3CA 3BP8A 4LLLA 1ZGJA 3SFZA 4OMZA 1WRJA 2WWYA 3JSPA 2JTVA 2QWWA 3ZMVA 4A6EA 1CF7B 2FA5A 4HF0A 4D0PA 1LEAA 5E1ZB 1LDKB 1KQ8A 2EFWA 1Z6RA 3BPVA 5ED4A 2ZMEB 1TQPA 2PMHA 4KN7X 5DV5A 3JAMK 4I98B 1WWXA 1GXPA 1FBUA 4G7ZF 5TRDA 3MWMA 2Y48A 4DQ2A 3GZ5A 2EV0A 4BH9A 2FNPA 1DUXC 1QPMA 5LEJA 1ONVA 5L3EA 1ODDA 4YG2F 4YFKF 3MZYA 1SFXA 3RKWA 3CUQC 5JVTA 3HYIA 4IXAA 2GXGA 3GEZA 2TDXA 4A0YA 5E8GA 1IW7F 4EVIA 1Z9CA 1MZBA 4HOBA 5FFXA 2Z9OA 3WTXC 2XKPA 3BY6A 1SMYF 4KIGA 1JXSA 2DT5A 4U0YA 3WTWC 3E6BA 2V1UA 4P9FA 1P92A 5K5QA 1T39A 1YS7A 2PQ8A 1T0FA 1YTYA 1HBXG 2GA2A 1FNNA 2VC1A 2CYYA 3JSOA 4EGYA 5D5UB 3C18A 2QM3A 2HEOA 3KP6A 5FLXK 1J2XA 2QQAA 3DFGA 3V8LA 5K5OA 2DK5A 3LQRA 5LGNA 1S3JA 3ZN0A 2A6HF 2XGXA 3G73A 1U6GA 1FZPB 2FMYA 2KIMA 1LNWA 4EJWA 1LDDA 3GZ6A 4G7OF 1XSXA 3PQJA 3CDHA 5CVVA 3DF8A 1DPRA 4IHSA 2CSOA 4LMYA 1RI7A 4EGZA 2XIGA 4A0ZA 1KU7A 3F6OA 1W4MA 1O3QA 1H0MA 2VC0A 1ZH5A 1B59A 3V8JA 1XD7A 2AXLA 2ZNYA 4RB1A 1JGSA 1HKTA 3RDIA 1FP1D 3FXQA 2O0YA 1G3TA 1D3YA 2ZO4A 5L3FA 4UVCA 4I02A 4E70A 3WTZA 2DW4A 3D5LA 4BYYA 4HZFA 2YX7A 2VBYA 2KKOA 2LKPA 3BPXA 2A68F 2K27A 1J75A 2X4HA 3R0AA 1R00A 3IRQA 5BPIA 3FXUA 5LEKA 2FU4A 5E20A 1IXCA 2VT2A 2D1HA 4U88A 2ZBKA 5DCMA 3IL2A 1U78A 1K78B 4LK1F 1FP2A 4I0BA 1IN6A 2F5FA 5HS7A 2EWNA 1YQAA 2M1BA 1YIOA 4M6YA 1E2XA 4ESFA 2A69F 4PZJA 4M9XA 4IRHA 2JPBA 5D6EA 1IN5A 2IA1A 3E5XA 1LQ1A 1HSTA 1HW1A 3HUGA 2OBPA 2QENA 2PN6A 3TO9A 4CXFA 4NB5A 1P6RA 5DCFA 2DPDA 3V7SA 4XRFA 2O3FA 1Y0UA 1Z1DA 4HA8A 2VOOA 1I1GA 2R7FA 2VODA 1R36A 1TQIA 3V7RA 3TKYA 1KU2A 2MC3A 4L9NA 2YU3A 1FY7A 3JTGA 1BJAA 2FEZA 2H27A 1FYLA 2HYFA 4LLGF 2BEOA 3E6CC 5EEGA 4JBAA 4RGUA 4GCVA 1XGOA 5D4SA 2RDPA 2COMA 3GFIA 4RGXA 3M7GA 5LHIA 2L4AA 3QP6A 1TNSA 1R1VA 2HDCA 2W24A 4HLYA 4EV0A 1BI0A 5HS9A 4Z2YA 5DUKA 4G94A 4KDPA 2HWVA 4I7HA 5AONA 2NAZA 2VOPA 4CICA 1PP8F 2YSRA 2YPRA 2HKOA 3K9TA 2O61A 5AIQA 1V4RA 4S04A 2FBIA 4KA4A 5L3DA 1AWCA 1UB9A 3CTAA 2J5PA 3KP2A 3N4MA 2F2EA 1YW9A 2VBZA 3BJAA 1U2WA 1GHCA 4XLPF 1XCVA 2A61A 3VB2A 2RC4A 4FX4A 1XGNA 5K1YA 3L00A 4MQVA 2P7VB 5E1WA 3L7WA 1ZGAA 2KIUA 2RVCA 4A6DA 1RIOH 4OU0A 3EETA 2RKHA 2BGCA 3R61A 4WWCA 3G3ZA 3I59A 1J7KA 1RNLA 1OYIA 4LB6B 1I6XA 2XKOA 1IF1A 5K5RA 1FLIA 3SZTA 5JHUA 4XSXF 3E5UA 3VODA 4M9ZA 1BOAA 2FSWA 3KLNA 4QWQA 4XSZF 2LNBA 3KP3A 2PLYA 1DP7P 3MFKA 3NEUA 1K79A 4EJTA 4IPAA 3QP5A 1R5GA 1TW2A 2PMUA 1WKMA 4WCGA 2IT0A 2OAZA 2XUBA 2XASA 4RB0A 4EQQA 4Y17A 2P7CB 3CUQA 4FX0A 4A2UA 2F5CA 5HS8A 1G6NA 3CLOA 3I4PA 1LJ9A 2DBBA 3HHGA 5A2QK 2PG4A 4DNCA 2UXXA 5E18F 2CO5A 2PBIA 3FM5A 1XSVA 2GZWA 4WF2A 4G6DA 5HDGA 1T2KA 3MCZA 1PDNC 1BI2A 3WU1B 3KE2A 3DKWA 4OMYA 1EH8A 2VONA 2M8EA 2DPUA 2JPCA 3LA7A 5HDNA 2EV5A 3FM3A 3VFZA 4GYIA 4KMFA 2HFHA 3F21A 1F5TA 5DCMB 4ENNA 1YW7A 1B9NA 4O5VA 4OIPF 2EB7A 1PP7U 2R7DA 1QZZA 5CLSA 3CJNA 1XMKA 3NQOA 2XRNA 3B73A 4M9SA 3DXJF 5LRSA 3V8KA 2NNYA 4R1HA 1G4DA 1ZLKA 5DEQA 4EJUA 1J9IA 4KIFA 1KQ9A 2MA3A 1MKMA 2VBWA 4L0ZB 4LLNA 1SMTA 1Z91A 4FT8A 1T6SA 2K7LA 5CYVA 5EEHA 2DO7A 4UV9A 2NS0A 3ZMTA 1Z7UA 2CG4A 5D5XB 2RNJA 5E1XA 3W6KB 3ZMSA 3FWEA 5H6QA 3CUOA 2GAUA 1JE8A 2V9VA 2BV6A 3E5QA 2FMLA 3RTRA 2NRAC 3WTYC 2M30A 2DTRA 3MAJA 4U0WA 3O3KA 1O57A 3RJPA 2WTEA 4IJAA 4WXDA 2XVCA 5LGTA 4HDUA 1CGPA 1T98A 1K6OA 4OIRF 1ZG3A 2LSOA 4ZH4F 4RB2C 2IRFG 1XDUA 4BNCA 2YR2A 1WSUA 2BBYA 1U5TC 3HSFA 1IN7A 3TDZC 2DQRA 4QLCU 5JI6A 2WV0A 3HSEA 5D5VB 3DV8A 3F8CA 3OOPA 2CQKA 4ENMA 4N9IA 3ECHA 1L0OC 5H20A 4ENKA 3QOPA 3R6SA 2FBKA 5LBQA 4MTDA 2DFIA 3LQQA 3HTSB 5LGUA 3SZPA 3ZP5A 4AIJA 4MHGA 4LB5A 3LA3A 3W6JB 2O03A 4EJVA 5J8FA 5D4RA 1MJBA 4I09A 2P6TA 4HX8A 3WGIA 4I2OA 2B0LA 1SD4A 1PUEE 2YX4A 4L9TA 4M71A 3WTVC 3MZHA 3GUDA 3I59B 3NRVA 3ERED 3I54A 2RGVA 1X3UA 3L09A 4BHPA 1KU9A 1MGTA 3DP7A 3K1NA 2G7UA 2E1CA 2Q8KA 1B1BA 1OYYA 4RAYA 1R7JA 2DQLA 2KIFA 3K1MA 4Y15A 2CW0F 1P4AA 4KYWA 3T5XA 4L9JA 3E97A 2XAHA 1FYMA 3QPHA 3IWZA 3BROA 2ZKZA 2M5WA 1FPQA 1VTNC 1IN4A 4UUVA 1UFMA 4KMUX 2D1VA 3M9AA 5HLGA 3F8BA 1BN5A 3TO7A 3GXOA 2D2WA 3Q9SA 4CO8A 1JHHA 3CUQB 1SD7A 3IKTA 3ML6A 5A2QZ 1ZYRF 1KGSA 3V4GA 3J81Z 3HOTA 3J80Z 3CO6C 3GFJA 1G3YA 2OZ6A 1H9GA 1U5TB 3H92A 4K2EA 3HOSA 1A04A 1F1ZA 3ELKA 3I53A 3RYRA 2A07F 5FO5A 2OA4A 3K1PA 2IW5A 4TV7A 2XHKA 1F4KA 2GIVA 1R1UA 3ISPA 1UHMA 2HZTA 3AAFA 1BI1A 3KCCA 3LAPA 1R22A 4HW0A 2QYOA 3L2CA 4HDVA 2IA2A 4HQMA 3WGGA 4OIOF 2HYGD 2MH2A 4OINF 1FSHA 1FT9A 3U2RA 2VT3A 1BC7C 3RYPA 3S2WA 1ON1A 3I0TA 4F7ZA 2FE3A 4GXOA 3KZZA 4EJOA 5ILUA 5TJJA 4CDGA 3WTSC 4MQ9F 3WGHA 5FB2A 5ILVA 1SFEA 1EV7A 2K4BA 3I64A 3K0LA 3QAHA 2VE8A 3TDUC 1F9NA 1KQ0A 4UHTA 1ZN2A 2GQQA 3TOBA 1YYVA 1LDJA 5D8LB 2VE9A 5H6RA 3GLXA 4YIIA 3KETA 5KVRA 4U7DA 2K86A 4HX7A 2IPQX 3SQNA 3GF2A 1STZA 4U7BA 3TGNA 2DI3A 3HIFA 4XBFA 3ABUA 2CWEA 3KLOA 2FBHA 1FBSA 3GVAA 4KNYA 1LB2A 4A12A 3FX3A 1TNTA 3Q9VA 3FZVA 2Z5UA 4MEXF 2ESHA 1O3TA 3IKVA 2AS5F 3JW4A 1ZRCA 2P6SA 4L0YB 1WQ2A 4HAMA 3TOAA 3F8NA 2ZNZA 1O7LA 2MLGA 4P96A 2LF7A 2XAJA 1KYWA 2Y0MA 2ZFWA 2UZKA 4P5OA 4ETSA 3E3VA 2QVOA 5IT9Z 4WXHA 3M8FA 1FYKA 3O6BB 2ADUA 1HW5A 4I0AA 1EH6A 2BE5F 2PEXA 1D8JA 4PDKA 2UXNA 1S7AA 5CVIA 2EA4A 4HF1A 1W7PD 4KIBA 2H94A 2H6BA 2ACJA 3V7CA 1ZLJA 3GFMA 4AIHA 1FOKA 1IUYA 2G9WA 4HBLA 3ECOA 3DEUA 5DUIA 4U0VA 1L3LA 2OQGA 1P2FA 3FF5A 1XSDA 1RZ4A 1Z05A 3COAC 2QBYA 2HOEA 2DK8A 1XB4A 3FHZA 2EV6A 3H3UA 4R79A 3T1BA 4ASNA 2A3SA 2GWRA 3GYHX 3KP5A 3KZYA 4EMSA 1S29A 2K4JA 2A6EF 4LG0A 3LFKA 2KJCA 5LLQA 5CVUA 1IZ1A 4HF2A 2K02A 1TW3A 3B02A 4LGWA 2OD5A 2PJPA 3P7NA 3BJOA 1QQIA 3J81K 3C1DA 3J80K 1U5TA 4PGHA 3HRTA 2CFXA 1OYWA 4GYGA 1QNTA 1HKQA 3ULQB 1IN8A 2JSCA 4GGGA 4H0EA 3CO7C 2P4WA 3WE2A 2HGCA 5L3GA 1FC3A 1ON2A 2RQPA 4MEYF 2D45A 4MGRA 1GVJA 3RPQA 4G6QA 1YS6A 4BAYA 4RB3C 2IJLA 3EYIA 3U9GA 3HRSA 1TTYA 1XGMA 4UNOA 2W84A 2Y75A 2E7XA 2W25A 3MQ0A 4KFCA 4MNUA 4Q48A 4UVBA 4G9YA 4RS8A 2KJBA 2XAQA 3RI4A 1OKRA 4RGRA 2V79A 2GA1A 3T0YA 1I5ZA 2DLLA 1SAXA 5LHHA 2R3SA 1YW8A 1SD6A 4HYEA 3REOA 3I58A 4GO1A 5DD8A 4Y13A 2L4MA 4MTEA 3VEPA 2F5EA 2MLKA 1KU3A 3N97A 2HKXA 3FXRA 1S7OA 1XN7A 4A0XA 1GXQA 4Q5SF 5F6FA 3C3WA 3KEQA 4UXNA 4AD9A 2DAOA 2IA0A 3ZMDA 3OV8A 3F6VA 4YIFA 1G3SA 4Q4ZF 2G7HA 4KN4X 2E1NA 2OQRA 1QO0D 3QU6A 4M73A 3LWFA 4OIQF 3GW2A 2M87A 3F8MA 2VXZA 4BXUA 3ZPLA 2C6YA 2ZXJA 1O7FA 4L9VA 1REPC 2EFNA 5HVQC 4HQEA 2HQRA 4S05A 1HW2A 2ESNA 1HXDA 5D8KB 1MDMA 1DPUA 2PFBA 2ISZA 5AIPA 3F3XA 3EQLF 3GO5A 1YLFA 4IHTA 2BYVE 3WTTC 5IT9K 4IRGA 5ICGA 3RIRA 3KEOA 3HTUA 1D5VA 1P4WA 3IC7A 4OOIA 1J0RA 5J6XA 4FHTA 1KA8A 4IF4A 2EFOA 2P8TA 4ESBA 2W57A 1B9MA 2JZYA 1I27A 2WC2A 2XV4S 5LRRA 5J8CA 3EUHA 5HOOA 1WI9A 3DPTA 1LVAA 3T8TA 5ICCA 5ICEA 5L3BA 3ABTA 1UCRA 3Q5FA 1TQMA 1ZREA 3T8RA 3R60A 3KFWX 4ZYEA 3KP4A 4LFUA 1B4AA 4Q47A 1W7PA 3BWGA 4G7HF 1ZRFA 2FQ3A 1LEBA 2VBXA 1C0WA 5D6FA 3P9KA 4EM1A 2VN2A 3HRUA 1U8RA 1NHAA 4L5JA 4B09A 2OU2A 1G3WA 1SD5A 3L9FA 5ILSA 4M72A 2HTSA 5HDKA 5CVRA 2V1DA 3BJ6A 1Z6TA 2OZUA 2FRHA 3JTHA 5BMZA 2ETHA 2QBYB 3R4KA 2FXAA 3GFLA 3LSTA 3DPLC 3KP7A 5JR3A 2V6CA 3U1DA 3QPTA 3I5UA 3J7AO 2MD5A 3VOEA 1OPCA 1AOYA 3IHUA 4NQWA 4LK0F 1XCBA 4ON0A 4LG0B 1BC8C 1JHFA 3D0SA 4WK8F 1R1TA 1I1SA 5F1RA 2QLZA 1QGPA 3E6MA 3QRFF 2ZCWA 2ZJ2A 4HV6A 4AVPA 1H9TA 4M6XA 4CYDA 3F23A 3RKYA 2L3DA 2HS5A 1XDSA 3BDDA 1FBQA 1B6AA 2FNAA 2EA2A 4RAZA 3SHFA 3RPUA 2JRTA 5CJ9A 2HTJA 3ZMUA 2FOKA 2Z33A 1DDNA 2Q2EA 2W85A 3LA2A 2M45A 3TO6A 3BZ6A 2MH9A 1BM9A 3ZQ7A 4JK1X 6PAXA 2FF4A 1HKSA 2HQNA 4N0BA 3MEXA 1CF7A 5HLHA 2MBFA 1QBJA 2JT1A 2L01A 3FMSA 3ZMZA 4CZZA 4AWXB 2Z3YA 4LD5A 1BBYA 2ZMEA 1IRGA 4UV8A 1ZG1A 2XAFA 3WTUC 3TQNA 2H6CA 1W5TA 2E7WA 4LJZF 1E17A 4KICA 3F8FA 1J59A 2QUFA 3RKXA 5DD4A 4G8XA 2QZ8A 4HV5A 1BIAA 1MD0A 2RN7A 3P9CA 5BPDA 1FSEA 5BQTA 4NHJA 2Q0OA 1R23A 5FFZA 4L5IA 4O6JA 2Z99A 4ZYDA 3R0JA 4EM2A 2XAGA 2F5DA 3WU0A 2EK5A 3EYYA 4WX9A 4KUMA 1R58A 1RUNA 4HLXA 2NYXA 1ULYA 1IXRC 4CGZA 1IAWA 2A5YB 1HQCA 4YFNF 4PGGA 2LF8A 1TBXA 5LHGA 3QU3A 1ZRDA 1QZYA 2IP2A 3SXYA 5ERIA 1EH7A 3JAMZ 5FD5A 2STWA 2UWMA 4WXCA 1TLHB 4YFXF 3IWFA 4IVNA 4BQAA 2L02A 4R8HA 1MDMB 1YG2A 3GWZA 3HRMA 4KT5C 1V3FA 3WE3A 2PI0A 2XROA 1USTA 4ZZLA 1YFHA 5JFRA 1BI3A 1MJAA 3LAJA 3DQVC 1O3SA 5F64A 4ZZDA 1S6LA 4M74A 5KK1A 4P55A 5CVJA 4N9HA 1W5SA 2GXBA 3K69A 4ENJA 5E8IA 4A5NA 5ICFA 2EJRA 3HSRA 2LDUA 1YO5C 3C7JA 5FLXZ 2ISYA 5IT3A 1OMIA 4AIKA 2DU9A 2V1XA 2HR3A 1U3EM 2CGPA 3K2ZA 1SFUA 3EDPA 3M8EA 2QQ9A 3H3ZA 1ZAOA 1FWZA 3PFIA 5BOXA 1USSA 2X0LA 5DDGA 5DYMA 4L18B 3IRRA 3M1EA 2STTA 4PCQA 1O3RA 1K7AA 2KRFA 3HHHA 5FGMA 4ZYGA 1OR7A 1W7PB 4B8XA 4ZYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG9 A;  4BHC A;  3PQK A;  1K78 A;  1UHW A;  2QQB A;  1XGS A;  1IXS B;  4I01 A;  2EFP A;  3ZN1 A;  3FMR A;  4JQF A;  3FMQ A;  1BIB A;  1KYZ A;  4BHB A;  4IRI A;  1Q1H A;  1R5H A;  2P5V A;  1ZG5 A;  2IVM A;  1IRF A;  3P9I A;  3I71 A;  4RGS A;  1HSJ A;  3ROU A;  4ESJ A;  3E6D A;  2O6G E;  5FD6 A;  2H09 A;  4HX4 A;  1ZHF A;  3F22 A;  5BS6 A;  2O8X A;  4A5M A;  4CHU A;  5HLI A;  1RUO A;  1J5Y A;  1D8K A;  2L54 A;  3GX4 X;  4P9U A;  2NNN A;  1T38 A;  1S8N A;  3BOQ A;  3O2P E;  1FX7 A;  4XLN F;  4EM0 B;  3F72 A;  1XMA A;  1ZAR A;  2ELH A;  1MJ9 A;  2J5O A;  2P5K A;  5E17 F;  2EFQ A;  4O3M A;  5D5W B;  2RV8 A;  4UVA A;  2P5L C;  1P4X A;  3WOD F;  5L3C A;  3BP8 A;  4LLL A;  1ZGJ A;  3SFZ A;  4OMZ A;  1WRJ A;  2WWY A;  3JSP A;  2JTV A;  2QWW A;  3ZMV A;  4A6E A;  1CF7 B;  2FA5 A;  4HF0 A;  4D0P A;  1LEA A;  5E1Z B;  1LDK B;  1KQ8 A;  2EFW A;  1Z6R A;  3BPV A;  5ED4 A;  2ZME B;  1TQP A;  2PMH A;  4KN7 X;  5DV5 A;  3JAM K;  4I98 B;  1WWX A;  1GXP A;  1FBU A;  4G7Z F;  5TRD A;  3MWM A;  2Y48 A;  4DQ2 A;  3GZ5 A;  2EV0 A;  4BH9 A;  2FNP A;  1DUX C;  1QPM A;  5LEJ A;  1ONV A;  5L3E A;  1ODD A;  4YG2 F;  4YFK F;  3MZY A;  1SFX A;  3RKW A;  3CUQ C;  5JVT A;  3HYI A;  4IXA A;  2GXG A;  3GEZ A;  2TDX A;  4A0Y A;  5E8G A;  1IW7 F;  4EVI A;  1Z9C A;  1MZB A;  4HOB A;  5FFX A;  2Z9O A;  3WTX C;  2XKP A;  3BY6 A;  1SMY F;  4KIG A;  1JXS A;  2DT5 A;  4U0Y A;  3WTW C;  3E6B A;  2V1U A;  4P9F A;  1P92 A;  5K5Q A;  1T39 A;  1YS7 A;  2PQ8 A;  1T0F A;  1YTY A;  1HBX G;  2GA2 A;  1FNN A;  2VC1 A;  2CYY A;  3JSO A;  4EGY A;  5D5U B;  3C18 A;  2QM3 A;  2HEO A;  3KP6 A;  5FLX K;  1J2X A;  2QQA A;  3DFG A;  3V8L A;  5K5O A;  2DK5 A;  3LQR A;  5LGN A;  1S3J A;  3ZN0 A;  2A6H F;  2XGX A;  3G73 A;  1U6G A;  1FZP B;  2FMY A;  2KIM A;  1LNW A;  4EJW A;  1LDD A;  3GZ6 A;  4G7O F;  1XSX A;  3PQJ A;  3CDH A;  5CVV A;  3DF8 A;  1DPR A;  4IHS A;  2CSO A;  4LMY A;  1RI7 A;  4EGZ A;  2XIG A;  4A0Z A;  1KU7 A;  3F6O A;  1W4M A;  1O3Q A;  1H0M A;  2VC0 A;  1ZH5 A;  1B59 A;  3V8J A;  1XD7 A;  2AXL A;  2ZNY A;  4RB1 A;  1JGS A;  1HKT A;  3RDI A;  1FP1 D;  3FXQ A;  2O0Y A;  1G3T A;  1D3Y A;  2ZO4 A;  5L3F A;  4UVC A;  4I02 A;  4E70 A;  3WTZ A;  2DW4 A;  3D5L A;  4BYY A;  4HZF A;  2YX7 A;  2VBY A;  2KKO A;  2LKP A;  3BPX A;  2A68 F;  2K27 A;  1J75 A;  2X4H A;  3R0A A;  1R00 A;  3IRQ A;  5BPI A;  3FXU A;  5LEK A;  2FU4 A;  5E20 A;  1IXC A;  2VT2 A;  2D1H A;  4U88 A;  2ZBK A;  5DCM A;  3IL2 A;  1U78 A;  1K78 B;  4LK1 F;  1FP2 A;  4I0B A;  1IN6 A;  2F5F A;  5HS7 A;  2EWN A;  1YQA A;  2M1B A;  1YIO A;  4M6Y A;  1E2X A;  4ESF A;  2A69 F;  4PZJ A;  4M9X A;  4IRH A;  2JPB A;  5D6E A;  1IN5 A;  2IA1 A;  3E5X A;  1LQ1 A;  1HST A;  1HW1 A;  3HUG A;  2OBP A;  2QEN A;  2PN6 A;  3TO9 A;  4CXF A;  4NB5 A;  1P6R A;  5DCF A;  2DPD A;  3V7S A;  4XRF A;  2O3F A;  1Y0U A;  1Z1D A;  4HA8 A;  2VOO A;  1I1G A;  2R7F A;  2VOD A;  1R36 A;  1TQI A;  3V7R A;  3TKY A;  1KU2 A;  2MC3 A;  4L9N A;  2YU3 A;  1FY7 A;  3JTG A;  1BJA A;  2FEZ A;  2H27 A;  1FYL A;  2HYF A;  4LLG F;  2BEO A;  3E6C C;  5EEG A;  4JBA A;  4RGU A;  4GCV A;  1XGO A;  5D4S A;  2RDP A;  2COM A;  3GFI A;  4RGX A;  3M7G A;  5LHI A;  2L4A A;  3QP6 A;  1TNS A;  1R1V A;  2HDC A;  2W24 A;  4HLY A;  4EV0 A;  1BI0 A;  5HS9 A;  4Z2Y A;  5DUK A;  4G94 A;  4KDP A;  2HWV A;  4I7H A;  5AON A;  2NAZ A;  2VOP A;  4CIC A;  1PP8 F;  2YSR A;  2YPR A;  2HKO A;  3K9T A;  2O61 A;  5AIQ A;  1V4R A;  4S04 A;  2FBI A;  4KA4 A;  5L3D A;  1AWC A;  1UB9 A;  3CTA A;  2J5P A;  3KP2 A;  3N4M A;  2F2E A;  1YW9 A;  2VBZ A;  3BJA A;  1U2W A;  1GHC A;  4XLP F;  1XCV A;  2A61 A;  3VB2 A;  2RC4 A;  4FX4 A;  1XGN A;  5K1Y A;  3L00 A;  4MQV A;  2P7V B;  5E1W A;  3L7W A;  1ZGA A;  2KIU A;  2RVC A;  4A6D A;  1RIO H;  4OU0 A;  3EET A;  2RKH A;  2BGC A;  3R61 A;  4WWC A;  3G3Z A;  3I59 A;  1J7K A;  1RNL A;  1OYI A;  4LB6 B;  1I6X A;  2XKO A;  1IF1 A;  5K5R A;  1FLI A;  3SZT A;  5JHU A;  4XSX F;  3E5U A;  3VOD A;  4M9Z A;  1BOA A;  2FSW A;  3KLN A;  4QWQ A;  4XSZ F;  2LNB A;  3KP3 A;  2PLY A;  1DP7 P;  3MFK A;  3NEU A;  1K79 A;  4EJT A;  4IPA A;  3QP5 A;  1R5G A;  1TW2 A;  2PMU A;  1WKM A;  4WCG A;  2IT0 A;  2OAZ A;  2XUB A;  2XAS A;  4RB0 A;  4EQQ A;  4Y17 A;  2P7C B;  3CUQ A;  4FX0 A;  4A2U A;  2F5C A;  5HS8 A;  1G6N A;  3CLO A;  3I4P A;  1LJ9 A;  2DBB A;  3HHG A;  5A2Q K;  2PG4 A;  4DNC A;  2UXX A;  5E18 F;  2CO5 A;  2PBI A;  3FM5 A;  1XSV A;  2GZW A;  4WF2 A;  4G6D A;  5HDG A;  1T2K A;  3MCZ A;  1PDN C;  1BI2 A;  3WU1 B;  3KE2 A;  3DKW A;  4OMY A;  1EH8 A;  2VON A;  2M8E A;  2DPU A;  2JPC A;  3LA7 A;  5HDN A;  2EV5 A;  3FM3 A;  3VFZ A;  4GYI A;  4KMF A;  2HFH A;  3F21 A;  1F5T A;  5DCM B;  4ENN A;  1YW7 A;  1B9N A;  4O5V A;  4OIP F;  2EB7 A;  1PP7 U;  2R7D A;  1QZZ A;  5CLS A;  3CJN A;  1XMK A;  3NQO A;  2XRN A;  3B73 A;  4M9S A;  3DXJ F;  5LRS A;  3V8K A;  2NNY A;  4R1H A;  1G4D A;  1ZLK A;  5DEQ A;  4EJU A;  1J9I A;  4KIF A;  1KQ9 A;  2MA3 A;  1MKM A;  2VBW A;  4L0Z B;  4LLN A;  1SMT A;  1Z91 A;  4FT8 A;  1T6S A;  2K7L A;  5CYV A;  5EEH A;  2DO7 A;  4UV9 A;  2NS0 A;  3ZMT A;  1Z7U A;  2CG4 A;  5D5X B;  2RNJ A;  5E1X A;  3W6K B;  3ZMS A;  3FWE A;  5H6Q A;  3CUO A;  2GAU A;  1JE8 A;  2V9V A;  2BV6 A;  3E5Q A;  2FML A;  3RTR A;  2NRA C;  3WTY C;  2M30 A;  2DTR A;  3MAJ A;  4U0W A;  3O3K A;  1O57 A;  3RJP A;  2WTE A;  4IJA A;  4WXD A;  2XVC A;  5LGT A;  4HDU A;  1CGP A;  1T98 A;  1K6O A;  4OIR F;  1ZG3 A;  2LSO A;  4ZH4 F;  4RB2 C;  2IRF G;  1XDU A;  4BNC A;  2YR2 A;  1WSU A;  2BBY A;  1U5T C;  3HSF A;  1IN7 A;  3TDZ C;  2DQR A;  4QLC U;  5JI6 A;  2WV0 A;  3HSE A;  5D5V B;  3DV8 A;  3F8C A;  3OOP A;  2CQK A;  4ENM A;  4N9I A;  3ECH A;  1L0O C;  5H20 A;  4ENK A;  3QOP A;  3R6S A;  2FBK A;  5LBQ A;  4MTD A;  2DFI A;  3LQQ A;  3HTS B;  5LGU A;  3SZP A;  3ZP5 A;  4AIJ A;  4MHG A;  4LB5 A;  3LA3 A;  3W6J B;  2O03 A;  4EJV A;  5J8F A;  5D4R A;  1MJB A;  4I09 A;  2P6T A;  4HX8 A;  3WGI A;  4I2O A;  2B0L A;  1SD4 A;  1PUE E;  2YX4 A;  4L9T A;  4M71 A;  3WTV C;  3MZH A;  3GUD A;  3I59 B;  3NRV A;  3ERE D;  3I54 A;  2RGV A;  1X3U A;  3L09 A;  4BHP A;  1KU9 A;  1MGT A;  3DP7 A;  3K1N A;  2G7U A;  2E1C A;  2Q8K A;  1B1B A;  1OYY A;  4RAY A;  1R7J A;  2DQL A;  2KIF A;  3K1M A;  4Y15 A;  2CW0 F;  1P4A A;  4KYW A;  3T5X A;  4L9J A;  3E97 A;  2XAH A;  1FYM A;  3QPH A;  3IWZ A;  3BRO A;  2ZKZ A;  2M5W A;  1FPQ A;  1VTN C;  1IN4 A;  4UUV A;  1UFM A;  4KMU X;  2D1V A;  3M9A A;  5HLG A;  3F8B A;  1BN5 A;  3TO7 A;  3GXO A;  2D2W A;  3Q9S A;  4CO8 A;  1JHH A;  3CUQ B;  1SD7 A;  3IKT A;  3ML6 A;  5A2Q Z;  1ZYR F;  1KGS A;  3V4G A;  3J81 Z;  3HOT A;  3J80 Z;  3CO6 C;  3GFJ A;  1G3Y A;  2OZ6 A;  1H9G A;  1U5T B;  3H92 A;  4K2E A;  3HOS A;  1A04 A;  1F1Z A;  3ELK A;  3I53 A;  3RYR A;  2A07 F;  5FO5 A;  2OA4 A;  3K1P A;  2IW5 A;  4TV7 A;  2XHK A;  1F4K A;  2GIV A;  1R1U A;  3ISP A;  1UHM A;  2HZT A;  3AAF A;  1BI1 A;  3KCC A;  3LAP A;  1R22 A;  4HW0 A;  2QYO A;  3L2C A;  4HDV A;  2IA2 A;  4HQM A;  3WGG A;  4OIO F;  2HYG D;  2MH2 A;  4OIN F;  1FSH A;  1FT9 A;  3U2R A;  2VT3 A;  1BC7 C;  3RYP A;  3S2W A;  1ON1 A;  3I0T A;  4F7Z A;  2FE3 A;  4GXO A;  3KZZ A;  4EJO A;  5ILU A;  5TJJ A;  4CDG A;  3WTS C;  4MQ9 F;  3WGH A;  5FB2 A;  5ILV A;  1SFE A;  1EV7 A;  2K4B A;  3I64 A;  3K0L A;  3QAH A;  2VE8 A;  3TDU C;  1F9N A;  1KQ0 A;  4UHT A;  1ZN2 A;  2GQQ A;  3TOB A;  1YYV A;  1LDJ A;  5D8L B;  2VE9 A;  5H6R A;  3GLX A;  4YII A;  3KET A;  5KVR A;  4U7D A;  2K86 A;  4HX7 A;  2IPQ X;  3SQN A;  3GF2 A;  1STZ A;  4U7B A;  3TGN A;  2DI3 A;  3HIF A;  4XBF A;  3ABU A;  2CWE A;  3KLO A;  2FBH A;  1FBS A;  3GVA A;  4KNY A;  1LB2 A;  4A12 A;  3FX3 A;  1TNT A;  3Q9V A;  3FZV A;  2Z5U A;  4MEX F;  2ESH A;  1O3T A;  3IKV A;  2AS5 F;  3JW4 A;  1ZRC A;  2P6S A;  4L0Y B;  1WQ2 A;  4HAM A;  3TOA A;  3F8N A;  2ZNZ A;  1O7L A;  2MLG A;  4P96 A;  2LF7 A;  2XAJ A;  1KYW A;  2Y0M A;  2ZFW A;  2UZK A;  4P5O A;  4ETS A;  3E3V A;  2QVO A;  5IT9 Z;  4WXH A;  3M8F A;  1FYK A;  3O6B B;  2ADU A;  1HW5 A;  4I0A A;  1EH6 A;  2BE5 F;  2PEX A;  1D8J A;  4PDK A;  2UXN A;  1S7A A;  5CVI A;  2EA4 A;  4HF1 A;  1W7P D;  4KIB A;  2H94 A;  2H6B A;  2ACJ A;  3V7C A;  1ZLJ A;  3GFM A;  4AIH A;  1FOK A;  1IUY A;  2G9W A;  4HBL A;  3ECO A;  3DEU A;  5DUI A;  4U0V A;  1L3L A;  2OQG A;  1P2F A;  3FF5 A;  1XSD A;  1RZ4 A;  1Z05 A;  3COA C;  2QBY A;  2HOE A;  2DK8 A;  1XB4 A;  3FHZ A;  2EV6 A;  3H3U A;  4R79 A;  3T1B A;  4ASN A;  2A3S A;  2GWR A;  3GYH X;  3KP5 A;  3KZY A;  4EMS A;  1S29 A;  2K4J A;  2A6E F;  4LG0 A;  3LFK A;  2KJC A;  5LLQ A;  5CVU A;  1IZ1 A;  4HF2 A;  2K02 A;  1TW3 A;  3B02 A;  4LGW A;  2OD5 A;  2PJP A;  3P7N A;  3BJO A;  1QQI A;  3J81 K;  3C1D A;  3J80 K;  1U5T A;  4PGH A;  3HRT A;  2CFX A;  1OYW A;  4GYG A;  1QNT A;  1HKQ A;  3ULQ B;  1IN8 A;  2JSC A;  4GGG A;  4H0E A;  3CO7 C;  2P4W A;  3WE2 A;  2HGC A;  5L3G A;  1FC3 A;  1ON2 A;  2RQP A;  4MEY F;  2D45 A;  4MGR A;  1GVJ A;  3RPQ A;  4G6Q A;  1YS6 A;  4BAY A;  4RB3 C;  2IJL A;  3EYI A;  3U9G A;  3HRS A;  1TTY A;  1XGM A;  4UNO A;  2W84 A;  2Y75 A;  2E7X A;  2W25 A;  3MQ0 A;  4KFC A;  4MNU A;  4Q48 A;  4UVB A;  4G9Y A;  4RS8 A;  2KJB A;  2XAQ A;  3RI4 A;  1OKR A;  4RGR A;  2V79 A;  2GA1 A;  3T0Y A;  1I5Z A;  2DLL A;  1SAX A;  5LHH A;  2R3S A;  1YW8 A;  1SD6 A;  4HYE A;  3REO A;  3I58 A;  4GO1 A;  5DD8 A;  4Y13 A;  2L4M A;  4MTE A;  3VEP A;  2F5E A;  2MLK A;  1KU3 A;  3N97 A;  2HKX A;  3FXR A;  1S7O A;  1XN7 A;  4A0X A;  1GXQ A;  4Q5S F;  5F6F A;  3C3W A;  3KEQ A;  4UXN A;  4AD9 A;  2DAO A;  2IA0 A;  3ZMD A;  3OV8 A;  3F6V A;  4YIF A;  1G3S A;  4Q4Z F;  2G7H A;  4KN4 X;  2E1N A;  2OQR A;  1QO0 D;  3QU6 A;  4M73 A;  3LWF A;  4OIQ F;  3GW2 A;  2M87 A;  3F8M A;  2VXZ A;  4BXU A;  3ZPL A;  2C6Y A;  2ZXJ A;  1O7F A;  4L9V A;  1REP C;  2EFN A;  5HVQ C;  4HQE A;  2HQR A;  4S05 A;  1HW2 A;  2ESN A;  1HXD A;  5D8K B;  1MDM A;  1DPU A;  2PFB A;  2ISZ A;  5AIP A;  3F3X A;  3EQL F;  3GO5 A;  1YLF A;  4IHT A;  2BYV E;  3WTT C;  5IT9 K;  4IRG A;  5ICG A;  3RIR A;  3KEO A;  3HTU A;  1D5V A;  1P4W A;  3IC7 A;  4OOI A;  1J0R A;  5J6X A;  4FHT A;  1KA8 A;  4IF4 A;  2EFO A;  2P8T A;  4ESB A;  2W57 A;  1B9M A;  2JZY A;  1I27 A;  2WC2 A;  2XV4 S;  5LRR A;  5J8C A;  3EUH A;  5HOO A;  1WI9 A;  3DPT A;  1LVA A;  3T8T A;  5ICC A;  5ICE A;  5L3B A;  3ABT A;  1UCR A;  3Q5F A;  1TQM A;  1ZRE A;  3T8R A;  3R60 A;  3KFW X;  4ZYE A;  3KP4 A;  4LFU A;  1B4A A;  4Q47 A;  1W7P A;  3BWG A;  4G7H F;  1ZRF A;  2FQ3 A;  1LEB A;  2VBX A;  1C0W A;  5D6F A;  3P9K A;  4EM1 A;  2VN2 A;  3HRU A;  1U8R A;  1NHA A;  4L5J A;  4B09 A;  2OU2 A;  1G3W A;  1SD5 A;  3L9F A;  5ILS A;  4M72 A;  2HTS A;  5HDK A;  5CVR A;  2V1D A;  3BJ6 A;  1Z6T A;  2OZU A;  2FRH A;  3JTH A;  5BMZ A;  2ETH A;  2QBY B;  3R4K A;  2FXA A;  3GFL A;  3LST A;  3DPL C;  3KP7 A;  5JR3 A;  2V6C A;  3U1D A;  3QPT A;  3I5U A;  3J7A O;  2MD5 A;  3VOE A;  1OPC A;  1AOY A;  3IHU A;  4NQW A;  4LK0 F;  1XCB A;  4ON0 A;  4LG0 B;  1BC8 C;  1JHF A;  3D0S A;  4WK8 F;  1R1T A;  1I1S A;  5F1R A;  2QLZ A;  1QGP A;  3E6M A;  3QRF F;  2ZCW A;  2ZJ2 A;  4HV6 A;  4AVP A;  1H9T A;  4M6X A;  4CYD A;  3F23 A;  3RKY A;  2L3D A;  2HS5 A;  1XDS A;  3BDD A;  1FBQ A;  1B6A A;  2FNA A;  2EA2 A;  4RAZ A;  3SHF A;  3RPU A;  2JRT A;  5CJ9 A;  2HTJ A;  3ZMU A;  2FOK A;  2Z33 A;  1DDN A;  2Q2E A;  2W85 A;  3LA2 A;  2M45 A;  3TO6 A;  3BZ6 A;  2MH9 A;  1BM9 A;  3ZQ7 A;  4JK1 X;  6PAX A;  2FF4 A;  1HKS A;  2HQN A;  4N0B A;  3MEX A;  1CF7 A;  5HLH A;  2MBF A;  1QBJ A;  2JT1 A;  2L01 A;  3FMS A;  3ZMZ A;  4CZZ A;  4AWX B;  2Z3Y A;  4LD5 A;  1BBY A;  2ZME A;  1IRG A;  4UV8 A;  1ZG1 A;  2XAF A;  3WTU C;  3TQN A;  2H6C A;  1W5T A;  2E7W A;  4LJZ F;  1E17 A;  4KIC A;  3F8F A;  1J59 A;  2QUF A;  3RKX A;  5DD4 A;  4G8X A;  2QZ8 A;  4HV5 A;  1BIA A;  1MD0 A;  2RN7 A;  3P9C A;  5BPD A;  1FSE A;  5BQT A;  4NHJ A;  2Q0O A;  1R23 A;  5FFZ A;  4L5I A;  4O6J A;  2Z99 A;  4ZYD A;  3R0J A;  4EM2 A;  2XAG A;  2F5D A;  3WU0 A;  2EK5 A;  3EYY A;  4WX9 A;  4KUM A;  1R58 A;  1RUN A;  4HLX A;  2NYX A;  1ULY A;  1IXR C;  4CGZ A;  1IAW A;  2A5Y B;  1HQC A;  4YFN F;  4PGG A;  2LF8 A;  1TBX A;  5LHG A;  3QU3 A;  1ZRD A;  1QZY A;  2IP2 A;  3SXY A;  5ERI A;  1EH7 A;  3JAM Z;  5FD5 A;  2STW A;  2UWM A;  4WXC A;  1TLH B;  4YFX F;  3IWF A;  4IVN A;  4BQA A;  2L02 A;  4R8H A;  1MDM B;  1YG2 A;  3GWZ A;  3HRM A;  4KT5 C;  1V3F A;  3WE3 A;  2PI0 A;  2XRO A;  1UST A;  4ZZL A;  1YFH A;  5JFR A;  1BI3 A;  1MJA A;  3LAJ A;  3DQV C;  1O3S A;  5F64 A;  4ZZD A;  1S6L A;  4M74 A;  5KK1 A;  4P55 A;  5CVJ A;  4N9H A;  1W5S A;  2GXB A;  3K69 A;  4ENJ A;  5E8I A;  4A5N A;  5ICF A;  2EJR A;  3HSR A;  2LDU A;  1YO5 C;  3C7J A;  5FLX Z;  2ISY A;  5IT3 A;  1OMI A;  4AIK A;  2DU9 A;  2V1X A;  2HR3 A;  1U3E M;  2CGP A;  3K2Z A;  1SFU A;  3EDP A;  3M8E A;  2QQ9 A;  3H3Z A;  1ZAO A;  1FWZ A;  3PFI A;  5BOX A;  1USS A;  2X0L A;  5DDG A;  5DYM A;  4L18 B;  3IRR A;  3M1E A;  2STT A;  4PCQ A;  1O3R A;  1K7A A;  2KRF A;  3HHH A;  5FGM A;  4ZYG A;  1OR7 A;  1W7P B;  4B8X A;  4ZYH A; 
#chains in the Genus database with same CATH topology
 3WG9 A;  4BHC A;  3PQK A;  3HOU J;  1K78 A;  1UHW A;  4ZTF A;  2QQB A;  4IL6 C;  1PJR A;  1XGS A;  1IXS B;  4I01 A;  2EFP A;  3ZN1 A;  3FMR A;  4JQF A;  3L2R A;  3FMQ A;  1BIB A;  1KYZ A;  4BHB A;  3M4O J;  2O8K A;  4IRI A;  1Q1H A;  4A3I J;  1R5H A;  2IGM A;  2P5V A;  1B72 A;  2JJ7 A;  2JSP A;  2DXI A;  2IS4 A;  1X1C A;  1ZG5 A;  4JX5 A;  3U21 A;  2IVM A;  1IRF A;  3OMY A;  3P9I A;  4N4O B;  3I71 A;  2JN6 A;  1VQL I;  2L7M P;  4V19 K;  4OAZ A;  1HSJ A;  4RGS A;  3ROU A;  5K7H A;  2HXI A;  1GDT A;  4ESJ A;  4XN3 A;  4RM2 A;  3A02 A;  3E6D A;  1MH4 A;  4IOC F;  4S0H B;  4OWR B;  2O6G E;  3TMO A;  5FD6 A;  2H09 A;  3BTL A;  4HX4 A;  1R4M B;  4YEL A;  1ZHF A;  3F22 A;  5BS6 A;  2KIQ A;  2O8X A;  1Y1W J;  1MMS A;  3NWS A;  4A5M A;  4DYR A;  2DCE A;  4CHU A;  4GDF A;  5HLI A;  1RUO A;  1J5Y A;  1BA5 A;  3D5S C;  2XGE A;  2XF7 A;  1D8K A;  1EF4 A;  3DLL F;  3HOV J;  4I99 C;  2RNG A;  2L54 A;  1K6Y A;  3OR2 C;  5B3S H;  3GX4 X;  4P9U A;  2MFZ A;  2NNN A;  3CJR B;  1T38 A;  1S8N A;  3BOQ A;  3DKX A;  3O2P E;  1FX7 A;  4XLN F;  4EM0 B;  3I55 I;  3F72 A;  1XMA A;  2Y31 A;  1ZAR A;  2YUS A;  2ME0 A;  3I4N J;  1R4N B;  1MJ9 A;  2ELH A;  2J5O A;  2XC7 A;  2P5K A;  5E17 F;  4PJ0 C;  2EFQ A;  3K4B A;  4O3M A;  2WAF A;  4KJZ A;  5EDN A;  4B48 A;  5D5W B;  2UV1 A;  3G4S I;  3CES A;  2RV8 A;  2XF5 A;  2P81 A;  4UVA A;  2P5L C;  1P4X A;  2GBY A;  5IPA A;  3WOD F;  2Q2E B;  4V2G A;  4HST A;  4CCJ A;  2DOD A;  5L3C A;  3K4M A;  1MBE A;  2R7R A;  2ZJR F;  3BP8 A;  1U0J A;  4LLL A;  3PIP F;  1ZGJ A;  2KL4 A;  3SFZ A;  4OMZ A;  1WRJ A;  1Z3X A;  2WWY A;  1APL C;  3QYB A;  3JSP A;  2JTV A;  3GTG J;  3ZQF A;  2H8W A;  2QWW A;  3PNT A;  3ZMV A;  4A6E A;  1CF7 B;  2FA5 A;  2JA5 J;  3BLY A;  3GLL A;  4HF0 A;  4D5F A;  1KZH A;  4D0P A;  1LEA A;  4BEH B;  4D1Q A;  4A3M J;  1YIT I;  5E1Z B;  1LDK B;  1VQ4 I;  4DBR A;  1KQ8 A;  4XRS G;  2YU9 J;  2EFW A;  1Z6R A;  3BPV A;  5ED4 A;  3CF5 F;  2ZME B;  1TQP A;  2A5W A;  2PMH A;  4KN7 X;  2COB A;  5EJC A;  5DV5 A;  1D1B A;  3S14 J;  3BG6 A;  2K9M A;  3JAM K;  4I98 B;  3ZRG A;  1WWX A;  1GXP A;  4C3J J;  4IHX A;  1FBU A;  4G7Z F;  2E1M B;  5TRD A;  2DDA A;  1OIS A;  3MWM A;  1POG A;  2Y48 A;  3JRF A;  4DQ2 A;  1OR7 C;  4BJ6 C;  2NS8 A;  4L5E A;  3GZ5 A;  4RMN A;  2BZT A;  2EV0 A;  4BH9 A;  2HOA A;  2FNP A;  1DUX C;  1QPM A;  5LEJ A;  1ONV A;  3A4C A;  5L3E A;  1ODD A;  3FBN B;  4YG2 F;  4YFK F;  3MZY A;  3ZQQ A;  1SFX A;  2HVQ A;  3RKW A;  3CUQ C;  5JVT A;  3HYI A;  4IXA A;  2GXG A;  2DT7 B;  4HEA 2;  1XX5 A;  3GEZ A;  2TDX A;  1SVO A;  4A0Y A;  5E8G A;  1MMG A;  1IW7 F;  4EVI A;  1YOV B;  1Z9C A;  1MZB A;  3CQZ J;  1OJL A;  4JOM A;  1N78 A;  5FKO A;  1FTT A;  4HOB A;  5FFX A;  2Z9O A;  3WTX C;  3CJQ B;  5HNF A;  2XKP A;  3BY6 A;  2NVT J;  1SMY F;  2LY2 A;  4KIG A;  3DBH B;  1LFU P;  1EA3 A;  2HOT A;  1JXS A;  2DT5 A;  3WHB A;  4U0Y A;  3PO2 J;  2CJJ A;  5F08 A;  2F6C A;  3WTW C;  3BT9 A;  2QKM B;  3E6B A;  3K6G A;  1A6Q A;  3RQ4 A;  2V1U A;  2FJ1 A;  1P92 A;  4P9F A;  2QSH X;  5K5Q A;  3CD6 I;  1T39 A;  1DU6 A;  1YS7 A;  1RES A;  2PQ8 A;  1T0F A;  1YTY A;  5EG0 B;  1HBX G;  2GA2 A;  1FNN A;  1RKT A;  3HBL A;  3E7L A;  4XLE A;  3BR5 A;  2VC1 A;  2CYY A;  3JSO A;  4EGY A;  5D5U B;  4HNU A;  3C18 A;  2QM3 A;  2HEO A;  3KP6 A;  5FLX K;  1YI2 I;  1J2X A;  4DZP A;  2QQA A;  3DFG A;  3V8L A;  5K5O A;  2DK5 A;  3LQR A;  5LGN A;  1BR4 A;  4A3L J;  1S3J A;  3ZN0 A;  2A6H F;  2XGX A;  5EEA A;  3MKL A;  2JUG A;  2VKE A;  3G73 A;  2V26 A;  1U6G A;  3OIQ A;  3PSF A;  1FZP B;  2FMY A;  4NBQ A;  2KIM A;  2KLO A;  4FE4 A;  1LNW A;  1JKQ C;  4EJW A;  4ZC3 A;  1LDD A;  1RR8 C;  1RR7 A;  3BG7 A;  3GZ6 A;  4G7O F;  5M3M J;  1T8I A;  1XSX A;  2HQA A;  4XKB A;  3PQJ A;  3FXO A;  4XLA A;  3CDH A;  5CVV A;  4PFO A;  1XG1 A;  1P7J A;  1DPR A;  3DF8 A;  4FE7 A;  2VIX A;  2CSO A;  4IHS A;  4LMY A;  3TW6 A;  1RI7 A;  2MAB A;  2XIG A;  4A0Z A;  4B47 A;  4BKX A;  4EGZ A;  1KU7 A;  3CCQ I;  3F6O A;  1W4M A;  1IRZ A;  1O3Q A;  2CFO A;  2CW8 A;  2VAS A;  1RRJ A;  4BU2 A;  2Y69 H;  2CUZ A;  4F55 A;  1H0M A;  5H2F C;  4II3 A;  2VC0 A;  1ZH5 A;  1B59 A;  1VQ5 I;  1E3H A;  3V8J A;  1XD7 A;  2AXL A;  4CYC A;  2ZNY A;  4RB1 A;  2LYC A;  2X51 A;  4LIV A;  1IV8 A;  1JGS A;  4A3C J;  3IP4 B;  3HEF A;  1HKT A;  3RDI A;  1TT5 B;  1FP1 D;  3FXQ A;  2BW3 B;  2O0Y A;  5B1B H;  3S32 A;  1G3T A;  1D3Y A;  2ZO4 A;  3GTQ J;  5L3F A;  4UVC A;  4I02 A;  2XGD A;  4MIM A;  2DA2 A;  4E70 A;  3WTZ A;  9ANT A;  2DW4 A;  3D5L A;  5JLW A;  4BYY A;  4HZF A;  1S9H A;  2YX7 A;  2VBY A;  3FIW A;  3JR9 A;  1K4T A;  5FLV A;  2LLK A;  3SDG A;  1NK2 P;  2MC4 A;  3OYB A;  2KKO A;  3DEW A;  5J40 A;  2LKP A;  3BPX A;  1ZTR A;  5CKT A;  4NC8 A;  2X6O A;  3S15 J;  2A68 F;  1H8A C;  2K27 A;  3CJT B;  1J75 A;  2X4H A;  3R0A A;  1R00 A;  5GTH C;  3IRQ A;  2MGQ A;  2E2I J;  2XAU A;  5BPI A;  3FXU A;  2E34 A;  5J1U A;  5LEK A;  2FU4 A;  4W97 A;  3GCM A;  5E20 A;  4C9Y A;  1IXC A;  2VT2 A;  2D1H A;  4U88 A;  3CCL I;  1SAU A;  2ZBK A;  4CZC A;  1GV2 A;  2K3F A;  1WJE A;  5DCM A;  1N25 A;  2XPW A;  1TT0 A;  4FET A;  2Z16 A;  1OLT A;  2JK3 A;  3VYS B;  3IL2 A;  4DGW B;  1U78 A;  1K78 B;  2IS2 A;  2O9L A;  2CMP A;  1TP4 A;  5J4V A;  1JKR C;  4LK1 F;  1FP2 A;  2LY9 A;  4I0B A;  2DMQ A;  1IN6 A;  4CA0 A;  2F5F A;  1RKW A;  5HS7 A;  1U9O A;  2EWN A;  3Q3S A;  1YQA A;  1K61 A;  1AHD P;  3HOW J;  2M1B A;  4DBQ A;  1B72 B;  1YIO A;  4M6Y A;  3S3O A;  2EZI A;  1E2X A;  1SVM A;  3AG2 H;  4ESF A;  3WG7 H;  2A69 F;  3QPS A;  4PZJ A;  4M9X A;  3CZ6 A;  4IRH A;  2JPB A;  5D6E A;  1IN5 A;  2IA1 A;  3E5X A;  1LQ1 A;  1HST A;  1HW1 A;  1RPW A;  3HUG A;  2OBP A;  2QEN A;  2PN6 A;  1Z77 A;  1MMD A;  3TO9 A;  3BG3 A;  4CXF A;  4NB5 A;  1P6R A;  5DCF A;  1T0F C;  2DPD A;  4F3Q A;  3V7S A;  1I3A A;  4XRF A;  2CUF A;  2O3F A;  5GP9 A;  1Y0U A;  1X19 A;  1Z1D A;  4HA8 A;  1XPX A;  2VOO A;  1I1G A;  2R7F A;  2EPF A;  2VOD A;  2QQ8 A;  1R36 A;  5IP6 A;  3JRB A;  1TQI A;  2QEX I;  3V7R A;  2P0W A;  3TKY A;  1KU2 A;  4IKF A;  2MC3 A;  4L9N A;  2YU3 A;  2WBM A;  1FY7 A;  3CC2 I;  2A6T A;  3JTG A;  2DYR H;  3QPL A;  4DYC A;  1BJA A;  2FEZ A;  4IHW A;  2B7E A;  4A69 C;  2R7O A;  2H27 A;  1QA6 A;  1Y39 A;  3A01 A;  2WA0 A;  4H4K C;  2BY0 A;  1FYL A;  2HYF A;  3H5A A;  4QPO A;  4LLG F;  2BEO A;  3E6C C;  5EEG A;  4JBA A;  4RGU A;  1TWH J;  4GCV A;  3H36 A;  2ZXW H;  1XGO A;  5KAF C;  5D4S A;  4AC0 A;  2ZXH A;  2RDP A;  2IGO A;  2M0M A;  2COM A;  3H3V K;  3GFI A;  3LSK A;  2ZSH B;  4RGX A;  3KEY A;  3M7G A;  5LHI A;  2L4A A;  4I6Z A;  3QP6 A;  1ETY A;  1TNS A;  2X6X A;  3H5R A;  2M4G A;  1R1V A;  2HDC A;  2W24 A;  4HLY A;  3F0C A;  2HYJ A;  2DMP A;  4EV0 A;  4NC7 A;  2VJ4 A;  3OOU A;  1BI0 A;  1X1B A;  2KIS A;  5HS9 A;  4PSW A;  3BG5 A;  4Z2Y A;  1QU3 A;  5DUK A;  4G94 A;  3VSL A;  4KDP A;  2HWV A;  3GBG A;  1U8B A;  4I7H A;  5AON A;  2NAZ A;  4E7I A;  4CIC A;  2VOP A;  4XLF A;  2ELJ A;  1PP8 F;  1WFX A;  1T95 A;  2YSR A;  4BDY A;  4HNT A;  2YPR A;  2HKO A;  1G59 A;  4M3E A;  3ZXS A;  3HZJ A;  4RAG A;  3K9T A;  2O61 A;  5AIQ A;  2JUC A;  3MKY B;  2HZD A;  5HLT A;  1V4R A;  4S04 A;  2FBI A;  2HVR A;  4KA4 A;  3OYC A;  3C2B A;  4G12 A;  2I5U A;  2WAD A;  5L3D A;  1AWC A;  2L9N A;  1UB9 A;  3DKY A;  3KZI C;  2DDB A;  3FXM A;  3CTA A;  1HOM A;  1FIP A;  1GV5 A;  3BR1 A;  2J5P A;  3CP2 A;  3KP2 A;  3N4M A;  4BAC A;  2F2E A;  1YW9 A;  1JUP A;  2DOF A;  2VBZ A;  3HGG A;  3BJA A;  2R0Q C;  2CUJ A;  4XR6 A;  1U2W A;  2M2E A;  1GHC A;  4XLP F;  1AA7 A;  1XCV A;  1QHG A;  2KMU A;  2HDD A;  2L2O A;  2A61 A;  3OR1 C;  2KDO A;  4B3X A;  3VB2 A;  3K70 C;  3HDD A;  4B44 A;  2RC4 A;  4FX4 A;  1ETW A;  1TWC J;  1XGN A;  1WJC A;  5K1Y A;  3L00 A;  3C2H A;  4KT6 A;  4MQV A;  2P7V B;  2CV2 A;  2VKH A;  1ZQ3 P;  5E1W A;  1UG0 A;  1DGR M;  3L7W A;  4P1W A;  4BBR J;  4ZJZ A;  1ZGA A;  3ZQI A;  1WH7 A;  4NC6 A;  2KIU A;  2RVC A;  4A6D A;  4A3J J;  3RZO J;  2RQQ A;  3X2Q H;  4OU0 A;  1RIO H;  1XMX A;  3EET A;  3JRC A;  2RKH A;  2LRE A;  2BGC A;  3R61 A;  4WWC A;  5EGO A;  3M1C A;  3G3Z A;  4XON A;  3I59 A;  1J7K A;  3MZ8 A;  2JA6 J;  5J1Y A;  2OPT A;  2R7X A;  1RNL A;  2DA7 A;  3PFY A;  2BY2 A;  1BOB A;  2X1E A;  3LSJ A;  2LG4 A;  3DTE A;  2OV7 A;  1OYI A;  4LB6 B;  1I6X A;  1A6I A;  2XKO A;  1IF1 A;  5K5R A;  3ZGK A;  4E7Z A;  1FLI A;  1NK3 P;  2VPL A;  4F92 B;  1QRY A;  1AU7 A;  3SZT A;  5M5W J;  5GAH J;  1MBK A;  4XL9 A;  4B43 A;  2GOX B;  5JHU A;  3DBR B;  1GVD A;  1Y8Q B;  3OYK A;  4XSX F;  3K4K A;  3E5U A;  1T56 A;  2X1C A;  3VOD A;  3BR2 A;  1ORK A;  1BOA A;  3LFU A;  2DFE A;  2FSW A;  4M9Z A;  3KLN A;  3OWT A;  4QWQ A;  4XSZ F;  2LNB A;  2NXN B;  3FK6 A;  2W7N A;  2QF7 A;  3JRH A;  2K9N A;  3KP3 A;  2KZV A;  1DP7 P;  2PLY A;  3MFK A;  2LBF A;  3JRI A;  3NEU A;  5IYC J;  4C30 A;  3GTO J;  4IQ4 A;  4LIU A;  1K79 A;  2BXY A;  4EJT A;  3ZR8 X;  4IPA A;  3QP5 A;  1R5G A;  4NUB A;  2EZH A;  3OYL A;  1TW2 A;  3UKG A;  2PMU A;  1WKM A;  4WCG A;  3BZC A;  2IT0 A;  2OAZ A;  2XUB A;  2LKS A;  1W0U A;  2LRD A;  1D1C A;  1R49 A;  2XAS A;  4B1R A;  4IZZ A;  4RB0 A;  2W1O A;  4EQQ A;  3S1M J;  4Y17 A;  4XNF A;  4MO7 A;  5CPR B;  2P7C B;  3DU5 A;  4CYC B;  3CUQ A;  1WJF A;  4FX0 A;  4FTH A;  4A2U A;  3K4L A;  3OYG A;  2F5C A;  1BW5 A;  5HS8 A;  5JLX A;  1G6N A;  2EIJ H;  4QIW N;  3CLO A;  4J01 A;  3I4P A;  1LJ9 A;  2DBB A;  3D1N I;  3HHG A;  3E0J B;  1S7E A;  5A2Q K;  2PG4 A;  4DNC A;  1X2N A;  2UXX A;  2QSG X;  3RKQ A;  5E18 F;  2V6E A;  2CO5 A;  2PBI A;  1MMN A;  2Y0S A;  3C2G A;  2VJI A;  3FM5 A;  1XSV A;  2GZW A;  4WF2 A;  4G6D A;  3L2W A;  4E7H A;  5HDG A;  2X6W A;  4II2 A;  1T2K A;  3MCZ A;  3FXJ A;  1QZE A;  3QQA A;  2X1D A;  1PDN C;  1BI2 A;  3W2W A;  3WU1 B;  3KE2 A;  3K7A J;  4CCM A;  3DKW A;  4OMY A;  1EH8 A;  2VKV A;  4IEJ A;  3BG9 A;  2VON A;  5DM6 F;  1K4S A;  2M8E A;  2DPU A;  2ZC2 A;  2JPC A;  3LA7 A;  1MMA A;  4EEF G;  5E3L A;  3L1P A;  5HDN A;  5IOZ A;  2EV5 A;  3FM3 A;  3VFZ A;  5GAD J;  1DP3 A;  4GYI A;  2JVH A;  4KMF A;  2HFH A;  3F21 A;  1F5T A;  5DCM B;  4ENN A;  3E1S A;  1X3Z B;  1YW7 A;  1B9N A;  3BR6 A;  4O5V A;  4OIP F;  2EB7 A;  1PP7 U;  2R7D A;  1D0Z A;  1QZZ A;  1JT6 A;  5CLS A;  3CJN A;  1VI0 A;  2F4M B;  1D0X A;  1XMK A;  3NQO A;  3M3Y J;  3A03 A;  2MSY A;  2XRN A;  3CMA I;  3B73 A;  2M7A A;  2OJE D;  1B8I A;  3FXK A;  4M9S A;  3J7A Y;  3DXJ F;  3K4C A;  3K10 A;  5LRS A;  3HOX J;  4CCL A;  3V8K A;  2NNY A;  3K2A A;  3PUF A;  4PJN A;  4R1H A;  1JTY A;  2GLO A;  2WAE A;  4AID A;  1G4D A;  1ZLK A;  1ZGW A;  5DEQ A;  3Q0W A;  4FQG A;  2CU7 A;  4EJU A;  3HUG B;  4ITV A;  4KIT B;  3DCF A;  1J9I A;  4KIF A;  4F93 B;  1A31 A;  3G1M A;  2R7S A;  2EIN H;  1KQ9 A;  2MA3 A;  3RSN A;  2R5Y A;  1MKM A;  3DU6 A;  2VBW A;  4L0Z B;  4LLN A;  1SMT A;  1Z91 A;  4FT8 A;  3AL0 C;  4AVZ A;  1T6S A;  2DMN A;  2K7L A;  5CYV A;  2DO7 A;  2OCE A;  2ZB9 A;  5EEH A;  4CCO A;  3ASO H;  5GAG J;  4UV9 A;  3H9Q A;  2R4G A;  2VKD A;  2Y0S N;  2NS0 A;  3OIO A;  3ZMT A;  1Z7U A;  2CG4 A;  1S72 I;  5D5X B;  2KQR A;  1QVU A;  2RNJ A;  5E1X A;  4UUT A;  3W6K B;  2CS3 A;  4BGD A;  3QYF A;  3ZMS A;  3FWE A;  4BJT A;  1IUF A;  5H6Q A;  3CUO A;  3A01 B;  2ZJQ F;  2GAU A;  1JE8 A;  2V9V A;  2IS1 A;  2BV6 A;  3A0H C;  3E5Q A;  4DOZ A;  1WCM J;  2FML A;  3RTR A;  1UJ8 A;  2NVY J;  2WV1 A;  4HRI A;  4AYB A;  2NRA C;  3WTY C;  5C4X J;  2M30 A;  3J7Y J;  2GM4 A;  2DTR A;  4LIT A;  2W48 A;  3IV5 A;  2H1K A;  3MAJ A;  1R71 A;  1WVR A;  4U0W A;  5FKN A;  3O3K A;  1I39 A;  1N75 A;  1O57 A;  3RJP A;  3I56 I;  2R93 J;  2WTE A;  4IJA A;  4UB6 C;  3OYD A;  2XSJ C;  1DGW Y;  2WAQ A;  2CQX A;  4WXD A;  4C2U A;  2F5V A;  2XVC A;  5LGT A;  3G1L A;  4Y3O A;  2NS7 A;  3LNQ A;  2R5Z A;  3K4J A;  5LFA A;  1VQN I;  3BQZ A;  3CP8 A;  2TRT A;  3I9V 2;  1PYV A;  3QYE A;  4HDU A;  1CGP A;  4BBS J;  1T98 A;  1K6O A;  4OIR F;  1ZG3 A;  2LSO A;  3TBI A;  4ZH4 F;  3P5J A;  4BQQ A;  5GPA A;  4IHV A;  4RB2 C;  3ZQG A;  2IRF G;  1WJA A;  2AHQ A;  1XDU A;  2PMZ A;  4BNC A;  2YR2 A;  1HDP A;  1MW7 A;  1WSU A;  2BBY A;  2VQH A;  1U5T C;  3HSF A;  2GIZ A;  1IN7 A;  1FTZ A;  2JQ7 A;  2DFH A;  3SEZ A;  3TDZ C;  2DQR A;  2HNH A;  4QLC U;  5JI6 A;  2WV0 A;  3HSE A;  2CV1 A;  5D5V B;  1OCO H;  3DV8 A;  1YJW I;  3CDL A;  4LG3 A;  3F8C A;  3B6A A;  4B4C A;  2L9V A;  2CQK A;  3OOP A;  4ENM A;  4N9I A;  3ECH A;  1L0O C;  5H20 A;  4ENK A;  3QOP A;  3R6S A;  1SVL A;  4BS9 A;  2FBK A;  5LBQ A;  1J09 A;  4MTD A;  2DFI A;  3U1K A;  1Y0N A;  1ITY A;  1PUF A;  3LQQ A;  3MD2 A;  1OCZ H;  3HTS B;  2VL8 A;  1UAA A;  5LGU A;  2DTZ A;  3SDB A;  2KHM A;  4MFE A;  2BY1 A;  3SZP A;  2DYS H;  3ZP5 A;  4AIJ A;  4MHG A;  5FJ8 J;  3UR3 C;  4IHY A;  3LA3 A;  4XQF A;  4LB5 A;  3W6J B;  1I50 J;  3BCB A;  2Z1D A;  2GOM A;  2O03 A;  2ZXI A;  4PJM A;  5CQE A;  1WGX A;  5CQG A;  4AYB N;  4EJV A;  4Y52 J;  2CH0 A;  3GME A;  5J8F A;  3JRD A;  1R9T J;  2DOE A;  5D4R A;  1MJB A;  3JCU C;  2P6T A;  4I09 A;  4M3F A;  4HX8 A;  3L2Q A;  3WGI A;  4I2O A;  2B0L A;  1SD4 A;  1HF0 A;  1PUE E;  2YX4 A;  4L9T A;  4M71 A;  3WTV C;  2I10 A;  3MZH A;  5EGO B;  3GUD A;  3I59 B;  3NRV A;  3ERE D;  2IAI A;  3I54 A;  1JI8 A;  2WAQ N;  2RGV A;  4XRS A;  1X3U A;  3L09 A;  3PIO F;  3HL2 A;  4BHP A;  1KU9 A;  2OTL I;  1IC8 A;  1D1A A;  1MGT A;  3DP7 A;  3K1N A;  3BCA A;  3RCO A;  2G7U A;  2E1C A;  2Q8K A;  3ZCO A;  1B1B A;  1OYY A;  1KON A;  4RAY A;  3AL0 B;  3OL3 A;  1R7J A;  1LPQ A;  2CRG A;  3BC8 A;  1X4O A;  2DMT A;  3ZQC A;  3IH2 A;  2HPI A;  2DQL A;  2KIF A;  3AG4 H;  3ASN H;  1X4P A;  2F4I A;  2PMZ N;  3K1M A;  4MLO A;  4Y15 A;  1VFC A;  2PX9 A;  2V9P A;  2CW0 F;  1P4A A;  2WY7 Q;  4KYW A;  5B1A H;  3T5X A;  3OIP A;  2F4O B;  5DM7 F;  2GXA A;  4L9J A;  2VQL A;  3E97 A;  2XAH A;  3LSI A;  2CW7 A;  1FYM A;  2UUZ A;  3QPH A;  3IWZ A;  3BRO A;  2ZKZ A;  5E3N A;  3KYL A;  3OS1 A;  2M5W A;  1FPQ A;  1VTN C;  1IN4 A;  2LBF B;  4UUV A;  1VQ9 I;  4NNJ A;  4E7K A;  3EPZ A;  4RBO A;  1UFM A;  4KMU X;  2D1V A;  3CCE I;  2QGU A;  4YIR X;  2RRE A;  3M9A A;  5HLG A;  4CSW A;  3F8B A;  1BN5 A;  3HGY A;  2M34 A;  3TED A;  3TO7 A;  3CLQ A;  3FIS A;  3GXO A;  4D7M A;  2D2W A;  3Q9S A;  3H5N A;  1ZR4 A;  4CO8 A;  1UHS A;  2R7W A;  1JHH A;  1JUS A;  3CUQ B;  1E0E A;  1SD7 A;  1X3W B;  3EUK L;  3IKT A;  3ML6 A;  5A2Q Z;  3H0D A;  3A1Y A;  2ECC A;  1ZYR F;  2E19 A;  3S16 J;  1KGS A;  2DJI A;  3V4G A;  3J81 Z;  3GTJ J;  1VND A;  5C44 J;  3HOT A;  1NTC A;  2Y2Z A;  3J80 Z;  3CO6 C;  3GFJ A;  4Y33 A;  1G3Y A;  1X2M A;  2OZ6 A;  4BXX J;  2JMW A;  3PL8 A;  1H9G A;  1U5T B;  5IYB J;  2QCO A;  5EYR A;  2V7F A;  3H92 A;  4K2E A;  2XPV A;  3HOS A;  2JVG A;  1A04 A;  1F1Z A;  3ELK A;  3H9J A;  4C3I J;  3BTJ A;  4XOR A;  3I53 A;  1LE8 B;  3RYR A;  1Y56 A;  2A07 F;  5FO5 A;  3H9G A;  2OA4 A;  2X85 A;  2IW5 A;  3BTC A;  3K1P A;  3GZN B;  4TV7 A;  5J47 A;  2XHK A;  4RA2 A;  1F4K A;  2DA6 A;  2BVM A;  2GIV A;  1R1U A;  1A36 A;  5HOD A;  3ISP A;  1UHM A;  4D9J A;  2HZT A;  2ZSI B;  3AAF A;  1BI1 A;  3KCC A;  4NDL A;  3LAP A;  1R22 A;  4HW0 A;  1UZC A;  2QYO A;  2VJ5 A;  3L2C A;  4HDV A;  1IRX A;  3HOY J;  3NWT A;  2IA2 A;  4HQM A;  3EUH C;  3WGG A;  3LSR A;  4OIO F;  1IJW C;  1GUU A;  4BY1 J;  2CV0 A;  4QSH A;  2HYG D;  1BJZ A;  2MH2 A;  4OIN F;  1FSH A;  2LTP A;  1Z67 A;  1FT9 A;  3U2R A;  2VT3 A;  2ME6 A;  4CCN A;  1BC7 C;  3RYP A;  3S2W A;  4BJ5 C;  1ON1 A;  2AXT C;  2PJR A;  1B8I B;  3I0T A;  4F7Z A;  2FE3 A;  1WH5 A;  2EBI A;  4GXO A;  1FOX A;  3KZZ A;  4EJO A;  4J00 A;  5K7Z A;  1X1P A;  4HSR A;  4M3B A;  3S1R J;  1X1A A;  5ILU A;  5TJJ A;  3PO3 J;  1IV6 A;  1UEL B;  4CDG A;  3WTS C;  1P9Q C;  3ZOB A;  4MQ9 F;  1TWA J;  3WGH A;  5FB2 A;  2A05 A;  5ILV A;  1SFE A;  1EV7 A;  2ZJP F;  2K4B A;  2R5Y B;  3I64 A;  3K0L A;  3QAH A;  2VE8 A;  3S3N A;  3S1N J;  3TDU C;  1F9N A;  3RQI A;  1VQM I;  3V42 A;  1KQ0 A;  2VLA A;  1MSF C;  4C2T A;  4RM3 A;  5IY5 H;  4UHT A;  1ZN2 A;  2GQQ A;  2LOO A;  4RLQ A;  3TOB A;  1YYV A;  2M0C A;  1LDJ A;  1GLN A;  1ZEL A;  5D8L B;  2VE9 A;  3ZQL A;  5H6R A;  4XKC A;  1VQP I;  3GLX A;  3W2A A;  4YII A;  5FLM J;  3KET A;  5KVR A;  4U7D A;  3QOE A;  2K86 A;  4HX7 A;  2IPQ X;  5EZG A;  2XRL A;  3SQN A;  1R6R A;  3GF2 A;  2LFB A;  1FIA A;  3FBI B;  1STZ A;  2ECB A;  1MIJ A;  5FRN A;  4U7B A;  3TGN A;  5HNH A;  3TW7 A;  2DI3 A;  3HIF A;  1NG7 A;  4XBF A;  3ABU A;  2CWE A;  3KLO A;  3SFI A;  3HOZ J;  2IEK A;  2FBH A;  1FBS A;  2LH9 A;  3GVA A;  3FDY A;  1FMV A;  4KNY A;  1LB2 A;  4A12 A;  3FX3 A;  1OCR H;  1MNM C;  5FRO A;  1TNT A;  3LSM A;  1IO2 A;  3Q9V A;  3FZV A;  5GPC A;  1MH3 A;  2Z5U A;  4DW6 A;  4MEX F;  2ESH A;  2K9Q A;  3DTI A;  1O3T A;  3IKV A;  2XB0 X;  2AS5 F;  3JW4 A;  4LOC A;  2P6S A;  4W1U A;  4BQN A;  1WQ2 A;  1ZRC A;  4L0Y B;  4HAM A;  2JWT A;  2DOA A;  3TOA A;  3F8N A;  4D5C A;  4ZYA A;  2ZNZ A;  3S2D J;  1O7L A;  2MLG A;  4P96 A;  2LF7 A;  3CMM A;  2HU9 A;  2R5Z B;  2K9S A;  2XAJ A;  3K4N A;  3GTM J;  2O5R A;  3CME I;  1KYW A;  1TZL A;  2Y0M A;  2ZFW A;  1VZ0 A;  2UZK A;  4P5O A;  4ETS A;  3E3V A;  2QVO A;  5IT9 Z;  4WXH A;  5C3E J;  3M8F A;  2DMU A;  1FYK A;  3B6C A;  2ADU A;  3O6B B;  4BE1 A;  1HW5 A;  1QVT A;  4I0A A;  2NOJ B;  4BXF A;  1EH6 A;  4Y4R A;  2BE5 F;  3S17 J;  4U87 A;  2PEX A;  4A3E J;  2LC2 A;  1D8J A;  5J4Y A;  4PDK A;  1VQ7 I;  2UXN A;  1S7A A;  3HB9 A;  3QOD A;  5CVI A;  2EA4 A;  4BDZ A;  2E2H J;  4HF1 A;  1W7P D;  4KIB A;  3I3L A;  3CMY A;  2H94 A;  2H6B A;  2M7B A;  2W00 A;  3PM1 A;  2ACJ A;  3V7C A;  1ZLJ A;  1FJL A;  3GFM A;  4AIH A;  1FOK A;  1IUY A;  2G9W A;  1TC3 C;  4HBL A;  5JHF A;  2Y9Z A;  4CUG A;  4GFB A;  1Y6I A;  3ECO A;  3DEU A;  3FHN A;  5DUI A;  2DT6 A;  4U0V A;  1FOW A;  1V55 H;  1PUF B;  4RLF A;  3BZK A;  1L3L A;  1BR1 A;  3OSG A;  2OQG A;  1E3O C;  1P2F A;  3ABM H;  3IUO A;  5FKL A;  4Z6Y A;  4HNV A;  1Z0X A;  3FF5 A;  1XSD A;  1RZ4 A;  1HLV A;  4G6T B;  1Z05 A;  4Y7N J;  3COA C;  1SC7 A;  2HOE A;  3S8P A;  2QBY A;  2DA1 A;  2DK8 A;  5M3F J;  2OTJ I;  1XB4 A;  2DA3 A;  2MD0 A;  4V2F A;  3FHZ A;  4IOA F;  2EV6 A;  3H3U A;  2LP0 A;  4R79 A;  3T1B A;  2ZME C;  1JT0 A;  3VDX A;  3CF2 A;  5BNG A;  1V5F A;  1I6H J;  2Y9Y A;  1HA8 A;  4ASN A;  2A3S A;  2GWR A;  3GYH X;  2CQ7 A;  3KP5 A;  3KZY A;  2OF7 A;  4EMS A;  1S29 A;  2K4J A;  2FQ4 A;  2KRH A;  3K70 D;  2A6E F;  4LG0 A;  2BHY A;  1YJN I;  3A2K A;  1ERD A;  3LFK A;  2KJC A;  1JKP C;  2E1M C;  1WI3 A;  5LLQ A;  1P7I A;  5CVU A;  1IZ1 A;  2XGC A;  4HF2 A;  4C3H J;  2K02 A;  1TW3 A;  3B02 A;  4LGW A;  1QHH D;  1HCR A;  1Q1V A;  2OD5 A;  4M3G A;  2NOG A;  3P7N A;  2PJP A;  2ZFU A;  3BJO A;  4DZJ A;  4PFP A;  1ENH A;  3EUA A;  3ONQ A;  3PSI A;  3KPH A;  1MBF A;  1YRN B;  3PJR A;  1QQI A;  3N05 A;  1WJD A;  4PJL A;  3J81 K;  3C1D A;  1VF9 A;  3J80 K;  1U5T A;  4PGH A;  5J3L A;  3J7Z I;  1A35 A;  3HRT A;  3UNG C;  4XN0 A;  2CFX A;  1OYW A;  3OL4 A;  4GYG A;  1QNT A;  1BW6 A;  1LE8 A;  1M1E B;  1HKQ A;  3ULQ B;  1IN8 A;  2JSC A;  2IBD A;  4GGG A;  3VYU B;  4H0E A;  2RAE A;  1ETK A;  3CO7 C;  2P4W A;  3WE2 A;  3RPU D;  3TP3 A;  2X6Y A;  2HGC A;  5L3G A;  3FKI J;  3L2V A;  1T08 B;  1FC3 A;  2E5Z A;  3HKZ A;  4PSX A;  4A3B J;  1ON2 A;  5DTD A;  2RQP A;  3Q0U A;  4MEY F;  4HG2 A;  1S5L C;  2D45 A;  4MGR A;  1GVJ A;  3RPQ A;  4G6Q A;  1VQ6 I;  2Z2S B;  1YS6 A;  4XMY A;  4BAY A;  4RB3 C;  2E60 A;  2IJL A;  3EYI A;  3HM5 A;  3U9G A;  2KRC A;  3HRS A;  4NQW B;  1TTY A;  5IP9 J;  1XGM A;  1MBH A;  4XM3 A;  4IO9 F;  4UNO A;  4QPQ A;  2W84 A;  1ETO A;  2ICW G;  3S93 A;  3HPG A;  3JRA A;  2N8G A;  3DWL E;  2V1N A;  2Y75 A;  2E7X A;  2KP6 A;  2W25 A;  3MQ0 A;  4KFC A;  4M6V A;  4BL0 B;  4MNU A;  4A3F J;  5IYD J;  4YRV A;  3TL4 X;  4XOP A;  4Q48 A;  4UVB A;  2KZG A;  2FOW A;  2XF6 A;  4G9Y A;  4RS8 A;  2KJB A;  2XAQ A;  4UUS A;  3RI4 A;  1YHQ I;  3O8H A;  3OYH A;  1OKR A;  3ESW B;  2F48 A;  2KPM A;  1LUJ B;  4RGR A;  3HC7 A;  2L9S A;  2V79 A;  2GA1 A;  5F0H A;  3S2H J;  3T0Y A;  1XS9 A;  1I5Z A;  2DLL A;  1SAX A;  2TCT A;  1F36 A;  5LHH A;  1H89 C;  2R3S A;  5JVG F;  1YW8 A;  1SD6 A;  2FX0 A;  3IH4 A;  4HYE A;  3REO A;  3I58 A;  4GO1 A;  4PJJ A;  2M4K A;  3SZG A;  3QWL A;  5DD8 A;  2V4J C;  4Y13 A;  2L4M A;  1Z3Y A;  2K85 A;  4MTE A;  2LVS A;  3VEP A;  1IGN A;  2F5E A;  4HPQ A;  2MLK A;  3OS2 A;  1KU3 A;  3N97 A;  4E7S A;  4A3G J;  2I8D A;  2HKX A;  3PNV A;  3FXR A;  1S7O A;  1XN7 A;  3H0G J;  2HQ5 A;  4E7J A;  4A0X A;  3CC4 I;  2ID6 A;  2K40 A;  2XB5 A;  1GXQ A;  3FK7 A;  4Q5S F;  5F6F A;  3C3W A;  3HKZ N;  3KEQ A;  4UXN A;  4AD9 A;  2JA7 J;  3ZQH A;  2H8R A;  2E1O A;  1UMQ A;  2DAO A;  2IA0 A;  3ZMD A;  3OV8 A;  4FCY A;  3F6V A;  2R7Q A;  2PJR B;  4YIF A;  1G3S A;  4Q4Z F;  1W5C C;  2G7H A;  2BOL A;  3O8G A;  4KN4 X;  2E1N A;  2OQR A;  1QO0 D;  3QU6 A;  3S3M A;  4M73 A;  4A3D J;  3LWF A;  4OIQ F;  1SAN A;  4XLH A;  4X6A J;  3GW2 A;  5F27 A;  2B9S A;  2M87 A;  2L7F P;  3F8M A;  2VXZ A;  4BXU A;  2DJN A;  3SYT A;  3L2U A;  1XTA A;  3ZPL A;  1MBG A;  2R92 J;  3KX2 A;  4AM3 A;  2C6Y A;  2EZK A;  2ZXJ A;  1O7F A;  4L9V A;  1REP C;  2EFN A;  5HVQ C;  4HQE A;  1IG7 A;  2HQR A;  4S05 A;  1HW2 A;  2ESN A;  3IAM 2;  1HXD A;  1D5Y A;  5D8K B;  1MDM A;  2R7Z J;  1DPU A;  3OYN A;  1ZK8 A;  2PFB A;  2ISZ A;  5AIP A;  4UY8 I;  3VYT B;  3F3X A;  4BUP A;  4X1E A;  2NVQ J;  3EQL F;  3VYR B;  3GO5 A;  5IOY A;  2FD5 A;  1YLF A;  4XKW A;  4BE2 A;  1LVK A;  4IHT A;  2BYV E;  2VQC A;  3WTT C;  4JYK A;  2DA4 A;  5IT9 K;  1AKH A;  4IRG A;  3GTK J;  5ICG A;  3RIR A;  4ABZ A;  4BY7 J;  2VQG A;  3KEO A;  2DFF A;  2NVX J;  3HTU A;  1D5V A;  1FOY A;  2L9R A;  1P4W A;  3DLA A;  3IC7 A;  5F1J A;  4OOI A;  1J0R A;  1HC8 A;  1K83 J;  2LY1 A;  5J6X A;  4FHT A;  1KA8 A;  4IF4 A;  2EFO A;  2CQN A;  2P8T A;  4ESB A;  1OCC H;  2IXS A;  2W57 A;  5F0C A;  3LOC A;  1U9N A;  1WJ5 A;  3MMY B;  1FMW A;  1B9M A;  3F9K A;  1G8X A;  2JZY A;  1I27 A;  3GTP J;  1WHU A;  4A93 J;  3FXL A;  1HDD C;  2WC2 A;  1BL0 A;  2XV4 S;  5LRR A;  5J8C A;  3EUH A;  2K9L A;  4DJA A;  5HOO A;  1WI9 A;  3DPT A;  3I4M J;  3G1O A;  3JRE A;  1LVA A;  4M3D A;  2NVU B;  3T8T A;  2XSD C;  3LL7 A;  1OCP A;  2K5C A;  2O7O A;  2LK2 A;  5ICC A;  5ICE A;  1LKX A;  3OYA A;  2HOS A;  2Q1Z B;  4QTR A;  5EF6 A;  3G2B A;  5L3B A;  3ABT A;  1IDY A;  5E79 C;  4MFD A;  1UCR A;  2HXO A;  3Q5F A;  1TQM A;  1ZRE A;  1X1D A;  1W0T A;  2EZL A;  4E6K G;  5IP7 J;  5B66 C;  2IGK A;  3T8R A;  2R7U A;  3R60 A;  3CCM I;  3W6V A;  3KFW X;  4F91 B;  4UB8 C;  4JX4 A;  1H88 C;  4ZYE A;  3KP4 A;  4LFU A;  1B4A A;  4Q47 A;  1W7P A;  1D0Y A;  1Y1V J;  3BWG A;  2FQ3 A;  2BVL A;  5F0F A;  3OS0 A;  2VBX A;  4G7H F;  1C0W A;  1ZRF A;  1LEB A;  5D6F A;  1NH3 A;  3P9K A;  4EM1 A;  2VN2 A;  2R7V A;  3HRU A;  1U8R A;  1NHA A;  2E36 A;  4L5J A;  1YRN A;  2AO9 A;  2DN0 A;  1TWG J;  4B09 A;  2OU2 A;  5F04 A;  1MND A;  1G3W A;  3MKZ A;  1SD5 A;  3L9F A;  2BXZ A;  4JP0 A;  5M5X J;  1UG2 A;  3W2V A;  5ILS A;  1Z7L A;  1MNE A;  4M72 A;  5LD2 C;  2LR8 A;  3G6E I;  4PK4 A;  4ZTJ A;  2HTS A;  5HDK A;  5CVR A;  2CQQ A;  2V1D A;  4GRI A;  3PUB A;  2G0E A;  3BJ6 A;  1Z6T A;  3CDI A;  3CCJ I;  2OZU A;  2FRH A;  3JTH A;  5BMZ A;  2VXD A;  4KIS A;  2ETH A;  2QBY B;  3M07 A;  3R4K A;  3CCY A;  4DIQ A;  2HVS A;  2FXA A;  3GFL A;  3LST A;  3DPL C;  3KP7 A;  4AU7 A;  3MN2 A;  5JR3 A;  2V6C A;  1YX5 A;  2Y30 A;  3U1D A;  3QPT A;  3I5U A;  3G71 I;  5DS9 A;  1W36 C;  2X48 A;  3J7A O;  2MD5 A;  3VOE A;  1QPI A;  1V54 H;  1OPC A;  3Q0V A;  1AOY A;  3TP0 A;  3OY9 A;  3IHU A;  3AG1 H;  4F52 A;  3IAS 2;  1I3Q J;  4NQW A;  4LK0 F;  2H1L A;  1XCB A;  4ON0 A;  2MW8 A;  1EJ9 A;  4LG0 B;  3VWB A;  2EIM H;  1BC8 C;  1JHF A;  1Z21 A;  3D0S A;  1WJB A;  3ERM A;  3OYJ A;  4WK8 F;  1R1T A;  1I1S A;  1YE9 A;  2CUE A;  5F1R A;  2QLZ A;  2QKL B;  1QGP A;  3E6M A;  3MVP A;  4ZDL A;  1TWF J;  1DQU A;  3QRF F;  2ZCW A;  2ZJ2 A;  2KT0 A;  4XLC A;  1YIJ I;  3W3C A;  1VQ8 I;  4HV6 A;  5EZH A;  4AVP A;  1H9T A;  4M6X A;  4CYD A;  4FAS D;  1SFK A;  3F23 A;  1W1W E;  3RKY A;  1ACI A;  3LSG A;  3AFH A;  2L3D A;  2ID3 A;  1TL8 A;  3LSH A;  1VQK I;  2HS5 A;  1XDS A;  3BDD A;  5M5Y J;  1FBQ A;  2B63 J;  4OAY A;  1B6A A;  2ELK A;  2FNA A;  2EA2 A;  2HPM A;  4RAZ A;  3SHF A;  4A3K J;  3RPU A;  2FUG 2;  4XOT A;  2JRT A;  5CJ9 A;  3OYF A;  2HTJ A;  1F43 A;  3ZMU A;  2FOK A;  3HG9 A;  1LFP A;  3HJE A;  2Z33 A;  1DDN A;  2Q2E A;  3BR0 A;  1OQY A;  1RC9 A;  2W85 A;  3D5R C;  2BY3 A;  4CCK A;  3LA2 A;  2M45 A;  3TO6 A;  3BZ6 A;  2MH9 A;  1BM9 A;  3ZQ7 A;  4JK1 X;  6PAX A;  2FF4 A;  1HKS A;  1V5E A;  3GTL J;  2E2J J;  3KYD B;  3VPR A;  5FKM A;  3CCV I;  2HQN A;  1JUM A;  4N0B A;  3MEX A;  1CF7 A;  5HLH A;  1ETQ A;  2MBF A;  1QBJ A;  3SEQ A;  3JRG A;  1WZ2 A;  2LKX A;  2JT1 A;  4BEH A;  2L01 A;  2E71 A;  1MBJ A;  3BQY A;  4YEJ A;  1DU0 A;  4XRM A;  2JRM A;  3FMS A;  3ZMZ A;  4CZZ A;  4AWX B;  2Z3Y A;  1ETV A;  4LD5 A;  1BBY A;  2ZME A;  1IRG A;  2WY8 Q;  4UV8 A;  4AUX A;  1ZG1 A;  2XAF A;  2AQE A;  3WTU C;  4UUS B;  3TQN A;  2LMD A;  1W36 D;  3CCS I;  1JGG A;  1GT0 C;  4IQJ A;  2H6C A;  3DBL B;  3HPH A;  5GAE J;  1W5T A;  2EIL H;  4PUS A;  2E7W A;  4LJZ F;  3RZD J;  5GTI C;  1E17 A;  4KIC A;  3F8F A;  1J59 A;  2QUF A;  3RKX A;  3IH3 A;  5DD4 A;  4G8X A;  2QZ8 A;  2W82 A;  4HV5 A;  1BIA A;  1MD0 A;  2RN7 A;  3P9C A;  5BPD A;  4BQO A;  1FSE A;  5BQT A;  4NHJ A;  2Q0O A;  4I76 A;  2JA2 A;  3H35 A;  1R23 A;  4RDU A;  5FFZ A;  4L5I A;  4O6J A;  1PVE A;  2Z99 A;  4ZYD A;  3R0J A;  4EM2 A;  2M3A A;  2VI6 A;  2XAG A;  2F5D A;  3WU0 A;  2QSF X;  2MYS A;  2EIK H;  2EK5 A;  2M8G X;  3EYY A;  4WX9 A;  2KDZ A;  4XIC A;  4KUM A;  3LSP A;  1R58 A;  4E4H A;  3DEE A;  1RUN A;  3FKJ A;  4HLX A;  2NYX A;  4J19 A;  1O4X A;  1ULY A;  1IXR C;  1ZR2 A;  4CGZ A;  4XKV A;  3LMM A;  1IAW A;  2A5Y B;  1HQC A;  2L7Z A;  4YFN F;  3CCU I;  4PGG A;  2LF8 A;  4ANJ A;  1JJ8 C;  5KNL A;  1TBX A;  5LHG A;  3QU3 A;  1ZRD A;  3WHC A;  5E3M A;  1JKO C;  1QZY A;  2IP2 A;  3SXY A;  5ERI A;  2AQF A;  4FIS A;  1EH7 A;  3JAM Z;  1YX3 A;  1V5G A;  5FD5 A;  2STW A;  2M9H A;  2UWM A;  3WU2 C;  5EG0 A;  3A0B C;  4WXC A;  3BTI A;  1N77 A;  1TLH B;  3OYI A;  4YFX F;  3IWF A;  3CC7 I;  1Y8R B;  4BE0 A;  1JJ6 C;  3NAR A;  2HI3 A;  3S1Q J;  1JTX A;  1CQT A;  2L5Q A;  4IVN A;  3ABK H;  4BQA A;  5TGT A;  1IDZ A;  2L02 A;  3HXL A;  3NAU A;  4R8H A;  4C2M J;  1R5I D;  1MDM B;  2WB1 A;  2XPU A;  1YG2 A;  3GWZ A;  4B3A A;  5K7F A;  2KFD A;  3HRM A;  4EAT A;  3KIO A;  4KT5 C;  1V3F A;  5E3O A;  3WE3 A;  2L7K A;  2D5V A;  2OC6 A;  2PI0 A;  2XRO A;  1UST A;  4ZZL A;  4DYQ A;  1YFH A;  3M8J A;  3CCR I;  5JFR A;  2VUM J;  1BI3 A;  1MJA A;  3OSF A;  3LAJ A;  1FEX A;  1AKH B;  3DQV C;  4N4N B;  1O3S A;  2DA5 A;  5F64 A;  5FKK A;  2EQR A;  4ZZD A;  2R7T A;  1E3P A;  2VB6 A;  2XDV A;  1S6L A;  4E7L A;  5B5E C;  4CH7 A;  4D7N A;  4M74 A;  1BR2 A;  5KK1 A;  1MSE C;  4P55 A;  2QA4 I;  1XC5 A;  5CVJ A;  4N9H A;  1WPK A;  1W5S A;  1T33 A;  4XID A;  3PNY A;  2GXB A;  3K69 A;  4XK4 A;  4ENJ A;  5E8I A;  4A5N A;  5C4J J;  1SFO J;  5ICF A;  2VPR A;  2EJR A;  1ZKG A;  3DPU A;  2BHZ A;  2LDU A;  3HSR A;  1YJ9 I;  1YO5 C;  4ZDO A;  4IX7 A;  4ZDP A;  3C7J A;  2BW3 A;  5FLX Z;  2MG4 A;  2IS6 A;  2ISY A;  2V9K A;  5TIS C;  5IT3 A;  1OMI A;  4RAF A;  2DU9 A;  2V1X A;  5KAI C;  2HR3 A;  4AIK A;  1U3E M;  2CGP A;  1OFC X;  3OYE A;  3K2Z A;  5J1R A;  1SFU A;  3AKZ A;  3BR3 A;  3EDP A;  3M8E A;  2QQ9 A;  3MKW B;  1VQO I;  3OYM A;  1RET A;  3H3Z A;  1ZAO A;  1FWZ A;  3ABL H;  2IGN A;  2VJJ A;  3PFI A;  3KYC B;  2L0K A;  5BOX A;  1USS A;  1EKE A;  2X0L A;  2OUM A;  1SEU A;  1A5J A;  5DDG A;  5DYM A;  2E35 A;  2HDW A;  2E5N A;  3VSK A;  4L18 B;  5KHD A;  3IRR A;  2EH3 A;  3M1E A;  4JX6 A;  2STT A;  2JA8 J;  4PCQ A;  3SJM A;  1X58 A;  1G2H A;  4X0G A;  1O3R A;  1K7A A;  2KRF A;  3HHH A;  2OCC H;  5FGM A;  3DTK A;  2W4S A;  3AG3 H;  3H1C A;  4ZYG A;  1OR7 A;  1W7P B;  5FRM A;  4B8X A;  1ETX A;  2WB1 N;  2K3P A;  2LD5 A;  1OCT C;  5KCM A;  2YS9 A;  1NG6 A;  1LFB A;  4ZYH A;  2X9D A; 
#chains in the Genus database with same CATH homology
 3WG9 A;  4BHC A;  3PQK A;  1K78 A;  1UHW A;  2QQB A;  1XGS A;  1IXS B;  4I01 A;  2EFP A;  3ZN1 A;  3FMR A;  4JQF A;  3FMQ A;  1BIB A;  1KYZ A;  4BHB A;  4IRI A;  1Q1H A;  1R5H A;  2P5V A;  1ZG5 A;  2IVM A;  1IRF A;  3P9I A;  3I71 A;  4RGS A;  1HSJ A;  3ROU A;  4ESJ A;  3E6D A;  2O6G E;  5FD6 A;  2H09 A;  4HX4 A;  1ZHF A;  3F22 A;  5BS6 A;  2O8X A;  4A5M A;  4CHU A;  5HLI A;  1RUO A;  1J5Y A;  1D8K A;  2L54 A;  3GX4 X;  4P9U A;  2NNN A;  1T38 A;  1S8N A;  3BOQ A;  3O2P E;  1FX7 A;  4XLN F;  4EM0 B;  3F72 A;  1XMA A;  1ZAR A;  2ELH A;  1MJ9 A;  2J5O A;  2P5K A;  5E17 F;  2EFQ A;  4O3M A;  5D5W B;  2RV8 A;  4UVA A;  2P5L C;  1P4X A;  3WOD F;  5L3C A;  3BP8 A;  4LLL A;  1ZGJ A;  3SFZ A;  4OMZ A;  1WRJ A;  2WWY A;  3JSP A;  2JTV A;  2QWW A;  3ZMV A;  4A6E A;  1CF7 B;  2FA5 A;  4HF0 A;  4D0P A;  1LEA A;  5E1Z B;  1LDK B;  1KQ8 A;  2EFW A;  1Z6R A;  3BPV A;  5ED4 A;  2ZME B;  1TQP A;  2PMH A;  4KN7 X;  5DV5 A;  3JAM K;  4I98 B;  1WWX A;  1GXP A;  1FBU A;  4G7Z F;  5TRD A;  3MWM A;  2Y48 A;  4DQ2 A;  3GZ5 A;  2EV0 A;  4BH9 A;  2FNP A;  1DUX C;  1QPM A;  5LEJ A;  1ONV A;  5L3E A;  1ODD A;  4YG2 F;  4YFK F;  3MZY A;  1SFX A;  3RKW A;  3CUQ C;  5JVT A;  3HYI A;  4IXA A;  2GXG A;  3GEZ A;  2TDX A;  4A0Y A;  5E8G A;  1IW7 F;  4EVI A;  1Z9C A;  1MZB A;  4HOB A;  5FFX A;  2Z9O A;  3WTX C;  2XKP A;  3BY6 A;  1SMY F;  4KIG A;  1JXS A;  2DT5 A;  4U0Y A;  3WTW C;  3E6B A;  2V1U A;  4P9F A;  1P92 A;  5K5Q A;  1T39 A;  1YS7 A;  2PQ8 A;  1T0F A;  1YTY A;  1HBX G;  2GA2 A;  1FNN A;  2VC1 A;  2CYY A;  3JSO A;  4EGY A;  5D5U B;  3C18 A;  2QM3 A;  2HEO A;  3KP6 A;  5FLX K;  1J2X A;  2QQA A;  3DFG A;  3V8L A;  5K5O A;  2DK5 A;  3LQR A;  5LGN A;  1S3J A;  3ZN0 A;  2A6H F;  2XGX A;  3G73 A;  1U6G A;  1FZP B;  2FMY A;  2KIM A;  1LNW A;  4EJW A;  1LDD A;  3GZ6 A;  4G7O F;  1XSX A;  3PQJ A;  3CDH A;  5CVV A;  3DF8 A;  1DPR A;  4IHS A;  2CSO A;  4LMY A;  1RI7 A;  4EGZ A;  2XIG A;  4A0Z A;  1KU7 A;  3F6O A;  1W4M A;  1O3Q A;  1H0M A;  2VC0 A;  1ZH5 A;  1B59 A;  3V8J A;  1XD7 A;  2AXL A;  2ZNY A;  4RB1 A;  1JGS A;  1HKT A;  3RDI A;  1FP1 D;  3FXQ A;  2O0Y A;  1G3T A;  1D3Y A;  2ZO4 A;  5L3F A;  4UVC A;  4I02 A;  4E70 A;  3WTZ A;  2DW4 A;  3D5L A;  4BYY A;  4HZF A;  2YX7 A;  2VBY A;  2KKO A;  2LKP A;  3BPX A;  2A68 F;  2K27 A;  1J75 A;  2X4H A;  3R0A A;  1R00 A;  3IRQ A;  5BPI A;  3FXU A;  5LEK A;  2FU4 A;  5E20 A;  1IXC A;  2VT2 A;  2D1H A;  4U88 A;  2ZBK A;  5DCM A;  3IL2 A;  1U78 A;  1K78 B;  4LK1 F;  1FP2 A;  4I0B A;  1IN6 A;  2F5F A;  5HS7 A;  2EWN A;  1YQA A;  2M1B A;  1YIO A;  4M6Y A;  1E2X A;  4ESF A;  2A69 F;  4PZJ A;  4M9X A;  4IRH A;  2JPB A;  5D6E A;  1IN5 A;  2IA1 A;  3E5X A;  1LQ1 A;  1HST A;  1HW1 A;  3HUG A;  2OBP A;  2QEN A;  2PN6 A;  3TO9 A;  4CXF A;  4NB5 A;  1P6R A;  5DCF A;  2DPD A;  3V7S A;  4XRF A;  2O3F A;  1Y0U A;  1Z1D A;  4HA8 A;  2VOO A;  1I1G A;  2R7F A;  2VOD A;  1R36 A;  1TQI A;  3V7R A;  3TKY A;  1KU2 A;  2MC3 A;  4L9N A;  2YU3 A;  1FY7 A;  3JTG A;  1BJA A;  2FEZ A;  2H27 A;  1FYL A;  2HYF A;  4LLG F;  2BEO A;  3E6C C;  5EEG A;  4JBA A;  4RGU A;  4GCV A;  1XGO A;  5D4S A;  2RDP A;  2COM A;  3GFI A;  4RGX A;  3M7G A;  5LHI A;  2L4A A;  3QP6 A;  1TNS A;  1R1V A;  2HDC A;  2W24 A;  4HLY A;  4EV0 A;  1BI0 A;  5HS9 A;  4Z2Y A;  5DUK A;  4G94 A;  4KDP A;  2HWV A;  4I7H A;  5AON A;  2NAZ A;  2VOP A;  4CIC A;  1PP8 F;  2YSR A;  2YPR A;  2HKO A;  3K9T A;  2O61 A;  5AIQ A;  1V4R A;  4S04 A;  2FBI A;  4KA4 A;  5L3D A;  1AWC A;  1UB9 A;  3CTA A;  2J5P A;  3KP2 A;  3N4M A;  2F2E A;  1YW9 A;  2VBZ A;  3BJA A;  1U2W A;  1GHC A;  4XLP F;  1XCV A;  2A61 A;  3VB2 A;  2RC4 A;  4FX4 A;  1XGN A;  5K1Y A;  3L00 A;  4MQV A;  2P7V B;  5E1W A;  3L7W A;  1ZGA A;  2KIU A;  2RVC A;  4A6D A;  1RIO H;  4OU0 A;  3EET A;  2RKH A;  2BGC A;  3R61 A;  4WWC A;  3G3Z A;  3I59 A;  1J7K A;  1RNL A;  1OYI A;  4LB6 B;  1I6X A;  2XKO A;  1IF1 A;  5K5R A;  1FLI A;  3SZT A;  5JHU A;  4XSX F;  3E5U A;  3VOD A;  4M9Z A;  1BOA A;  2FSW A;  3KLN A;  4QWQ A;  4XSZ F;  2LNB A;  3KP3 A;  2PLY A;  1DP7 P;  3MFK A;  3NEU A;  1K79 A;  4EJT A;  4IPA A;  3QP5 A;  1R5G A;  1TW2 A;  2PMU A;  1WKM A;  4WCG A;  2IT0 A;  2OAZ A;  2XUB A;  2XAS A;  4RB0 A;  4EQQ A;  4Y17 A;  2P7C B;  3CUQ A;  4FX0 A;  4A2U A;  2F5C A;  5HS8 A;  1G6N A;  3CLO A;  3I4P A;  1LJ9 A;  2DBB A;  3HHG A;  5A2Q K;  2PG4 A;  4DNC A;  2UXX A;  5E18 F;  2CO5 A;  2PBI A;  3FM5 A;  1XSV A;  2GZW A;  4WF2 A;  4G6D A;  5HDG A;  1T2K A;  3MCZ A;  1PDN C;  1BI2 A;  3WU1 B;  3KE2 A;  3DKW A;  4OMY A;  1EH8 A;  2VON A;  2M8E A;  2DPU A;  2JPC A;  3LA7 A;  5HDN A;  2EV5 A;  3FM3 A;  3VFZ A;  4GYI A;  4KMF A;  2HFH A;  3F21 A;  1F5T A;  5DCM B;  4ENN A;  1YW7 A;  1B9N A;  4O5V A;  4OIP F;  2EB7 A;  1PP7 U;  2R7D A;  1QZZ A;  5CLS A;  3CJN A;  1XMK A;  3NQO A;  2XRN A;  3B73 A;  4M9S A;  3DXJ F;  5LRS A;  3V8K A;  2NNY A;  4R1H A;  1G4D A;  1ZLK A;  5DEQ A;  4EJU A;  1J9I A;  4KIF A;  1KQ9 A;  2MA3 A;  1MKM A;  2VBW A;  4L0Z B;  4LLN A;  1SMT A;  1Z91 A;  4FT8 A;  1T6S A;  2K7L A;  5CYV A;  5EEH A;  2DO7 A;  4UV9 A;  2NS0 A;  3ZMT A;  1Z7U A;  2CG4 A;  5D5X B;  2RNJ A;  5E1X A;  3W6K B;  3ZMS A;  3FWE A;  5H6Q A;  3CUO A;  2GAU A;  1JE8 A;  2V9V A;  2BV6 A;  3E5Q A;  2FML A;  3RTR A;  2NRA C;  3WTY C;  2M30 A;  2DTR A;  3MAJ A;  4U0W A;  3O3K A;  1O57 A;  3RJP A;  2WTE A;  4IJA A;  4WXD A;  2XVC A;  5LGT A;  4HDU A;  1CGP A;  1T98 A;  1K6O A;  4OIR F;  1ZG3 A;  2LSO A;  4ZH4 F;  4RB2 C;  2IRF G;  1XDU A;  4BNC A;  2YR2 A;  1WSU A;  2BBY A;  1U5T C;  3HSF A;  1IN7 A;  3TDZ C;  2DQR A;  4QLC U;  5JI6 A;  2WV0 A;  3HSE A;  5D5V B;  3DV8 A;  3F8C A;  3OOP A;  2CQK A;  4ENM A;  4N9I A;  3ECH A;  1L0O C;  5H20 A;  4ENK A;  3QOP A;  3R6S A;  2FBK A;  5LBQ A;  4MTD A;  2DFI A;  3LQQ A;  3HTS B;  5LGU A;  3SZP A;  3ZP5 A;  4AIJ A;  4MHG A;  4LB5 A;  3LA3 A;  3W6J B;  2O03 A;  4EJV A;  5J8F A;  5D4R A;  1MJB A;  4I09 A;  2P6T A;  4HX8 A;  3WGI A;  4I2O A;  2B0L A;  1SD4 A;  1PUE E;  2YX4 A;  4L9T A;  4M71 A;  3WTV C;  3MZH A;  3GUD A;  3I59 B;  3NRV A;  3ERE D;  3I54 A;  2RGV A;  1X3U A;  3L09 A;  4BHP A;  1KU9 A;  1MGT A;  3DP7 A;  3K1N A;  2G7U A;  2E1C A;  2Q8K A;  1B1B A;  1OYY A;  4RAY A;  1R7J A;  2DQL A;  2KIF A;  3K1M A;  4Y15 A;  2CW0 F;  1P4A A;  4KYW A;  3T5X A;  4L9J A;  3E97 A;  2XAH A;  1FYM A;  3QPH A;  3IWZ A;  3BRO A;  2ZKZ A;  2M5W A;  1FPQ A;  1VTN C;  1IN4 A;  4UUV A;  1UFM A;  4KMU X;  2D1V A;  3M9A A;  5HLG A;  3F8B A;  1BN5 A;  3TO7 A;  3GXO A;  2D2W A;  3Q9S A;  4CO8 A;  1JHH A;  3CUQ B;  1SD7 A;  3IKT A;  3ML6 A;  5A2Q Z;  1ZYR F;  1KGS A;  3V4G A;  3J81 Z;  3HOT A;  3J80 Z;  3CO6 C;  3GFJ A;  1G3Y A;  2OZ6 A;  1H9G A;  1U5T B;  3H92 A;  4K2E A;  3HOS A;  1A04 A;  1F1Z A;  3ELK A;  3I53 A;  3RYR A;  2A07 F;  5FO5 A;  2OA4 A;  3K1P A;  2IW5 A;  4TV7 A;  2XHK A;  1F4K A;  2GIV A;  1R1U A;  3ISP A;  1UHM A;  2HZT A;  3AAF A;  1BI1 A;  3KCC A;  3LAP A;  1R22 A;  4HW0 A;  2QYO A;  3L2C A;  4HDV A;  2IA2 A;  4HQM A;  3WGG A;  4OIO F;  2HYG D;  2MH2 A;  4OIN F;  1FSH A;  1FT9 A;  3U2R A;  2VT3 A;  1BC7 C;  3RYP A;  3S2W A;  1ON1 A;  3I0T A;  4F7Z A;  2FE3 A;  4GXO A;  3KZZ A;  4EJO A;  5ILU A;  5TJJ A;  4CDG A;  3WTS C;  4MQ9 F;  3WGH A;  5FB2 A;  5ILV A;  1SFE A;  1EV7 A;  2K4B A;  3I64 A;  3K0L A;  3QAH A;  2VE8 A;  3TDU C;  1F9N A;  1KQ0 A;  4UHT A;  1ZN2 A;  2GQQ A;  3TOB A;  1YYV A;  1LDJ A;  5D8L B;  2VE9 A;  5H6R A;  3GLX A;  4YII A;  3KET A;  5KVR A;  4U7D A;  2K86 A;  4HX7 A;  2IPQ X;  3SQN A;  3GF2 A;  1STZ A;  4U7B A;  3TGN A;  2DI3 A;  3HIF A;  4XBF A;  3ABU A;  2CWE A;  3KLO A;  2FBH A;  1FBS A;  3GVA A;  4KNY A;  1LB2 A;  4A12 A;  3FX3 A;  1TNT A;  3Q9V A;  3FZV A;  2Z5U A;  4MEX F;  2ESH A;  1O3T A;  3IKV A;  2AS5 F;  3JW4 A;  1ZRC A;  2P6S A;  4L0Y B;  1WQ2 A;  4HAM A;  3TOA A;  3F8N A;  2ZNZ A;  1O7L A;  2MLG A;  4P96 A;  2LF7 A;  2XAJ A;  1KYW A;  2Y0M A;  2ZFW A;  2UZK A;  4P5O A;  4ETS A;  3E3V A;  2QVO A;  5IT9 Z;  4WXH A;  3M8F A;  1FYK A;  3O6B B;  2ADU A;  1HW5 A;  4I0A A;  1EH6 A;  2BE5 F;  2PEX A;  1D8J A;  4PDK A;  2UXN A;  1S7A A;  5CVI A;  2EA4 A;  4HF1 A;  1W7P D;  4KIB A;  2H94 A;  2H6B A;  2ACJ A;  3V7C A;  1ZLJ A;  3GFM A;  4AIH A;  1FOK A;  1IUY A;  2G9W A;  4HBL A;  3ECO A;  3DEU A;  5DUI A;  4U0V A;  1L3L A;  2OQG A;  1P2F A;  3FF5 A;  1XSD A;  1RZ4 A;  1Z05 A;  3COA C;  2QBY A;  2HOE A;  2DK8 A;  1XB4 A;  3FHZ A;  2EV6 A;  3H3U A;  4R79 A;  3T1B A;  4ASN A;  2A3S A;  2GWR A;  3GYH X;  3KP5 A;  3KZY A;  4EMS A;  1S29 A;  2K4J A;  2A6E F;  4LG0 A;  3LFK A;  2KJC A;  5LLQ A;  5CVU A;  1IZ1 A;  4HF2 A;  2K02 A;  1TW3 A;  3B02 A;  4LGW A;  2OD5 A;  2PJP A;  3P7N A;  3BJO A;  1QQI A;  3J81 K;  3C1D A;  3J80 K;  1U5T A;  4PGH A;  3HRT A;  2CFX A;  1OYW A;  4GYG A;  1QNT A;  1HKQ A;  3ULQ B;  1IN8 A;  2JSC A;  4GGG A;  4H0E A;  3CO7 C;  2P4W A;  3WE2 A;  2HGC A;  5L3G A;  1FC3 A;  1ON2 A;  2RQP A;  4MEY F;  2D45 A;  4MGR A;  1GVJ A;  3RPQ A;  4G6Q A;  1YS6 A;  4BAY A;  4RB3 C;  2IJL A;  3EYI A;  3U9G A;  3HRS A;  1TTY A;  1XGM A;  4UNO A;  2W84 A;  2Y75 A;  2E7X A;  2W25 A;  3MQ0 A;  4KFC A;  4MNU A;  4Q48 A;  4UVB A;  4G9Y A;  4RS8 A;  2KJB A;  2XAQ A;  3RI4 A;  1OKR A;  4RGR A;  2V79 A;  2GA1 A;  3T0Y A;  1I5Z A;  2DLL A;  1SAX A;  5LHH A;  2R3S A;  1YW8 A;  1SD6 A;  4HYE A;  3REO A;  3I58 A;  4GO1 A;  5DD8 A;  4Y13 A;  2L4M A;  4MTE A;  3VEP A;  2F5E A;  2MLK A;  1KU3 A;  3N97 A;  2HKX A;  3FXR A;  1S7O A;  1XN7 A;  4A0X A;  1GXQ A;  4Q5S F;  5F6F A;  3C3W A;  3KEQ A;  4UXN A;  4AD9 A;  2DAO A;  2IA0 A;  3ZMD A;  3OV8 A;  3F6V A;  4YIF A;  1G3S A;  4Q4Z F;  2G7H A;  4KN4 X;  2E1N A;  2OQR A;  1QO0 D;  3QU6 A;  4M73 A;  3LWF A;  4OIQ F;  3GW2 A;  2M87 A;  3F8M A;  2VXZ A;  4BXU A;  3ZPL A;  2C6Y A;  2ZXJ A;  1O7F A;  4L9V A;  1REP C;  2EFN A;  5HVQ C;  4HQE A;  2HQR A;  4S05 A;  1HW2 A;  2ESN A;  1HXD A;  5D8K B;  1MDM A;  1DPU A;  2PFB A;  2ISZ A;  5AIP A;  3F3X A;  3EQL F;  3GO5 A;  1YLF A;  4IHT A;  2BYV E;  3WTT C;  5IT9 K;  4IRG A;  5ICG A;  3RIR A;  3KEO A;  3HTU A;  1D5V A;  1P4W A;  3IC7 A;  4OOI A;  1J0R A;  5J6X A;  4FHT A;  1KA8 A;  4IF4 A;  2EFO A;  2P8T A;  4ESB A;  2W57 A;  1B9M A;  2JZY A;  1I27 A;  2WC2 A;  2XV4 S;  5LRR A;  5J8C A;  3EUH A;  5HOO A;  1WI9 A;  3DPT A;  1LVA A;  3T8T A;  5ICC A;  5ICE A;  5L3B A;  3ABT A;  1UCR A;  3Q5F A;  1TQM A;  1ZRE A;  3T8R A;  3R60 A;  3KFW X;  4ZYE A;  3KP4 A;  4LFU A;  1B4A A;  4Q47 A;  1W7P A;  3BWG A;  4G7H F;  1ZRF A;  2FQ3 A;  1LEB A;  2VBX A;  1C0W A;  5D6F A;  3P9K A;  4EM1 A;  2VN2 A;  3HRU A;  1U8R A;  1NHA A;  4L5J A;  4B09 A;  2OU2 A;  1G3W A;  1SD5 A;  3L9F A;  5ILS A;  4M72 A;  2HTS A;  5HDK A;  5CVR A;  2V1D A;  3BJ6 A;  1Z6T A;  2OZU A;  2FRH A;  3JTH A;  5BMZ A;  2ETH A;  2QBY B;  3R4K A;  2FXA A;  3GFL A;  3LST A;  3DPL C;  3KP7 A;  5JR3 A;  2V6C A;  3U1D A;  3QPT A;  3I5U A;  3J7A O;  2MD5 A;  3VOE A;  1OPC A;  1AOY A;  3IHU A;  4NQW A;  4LK0 F;  1XCB A;  4ON0 A;  4LG0 B;  1BC8 C;  1JHF A;  3D0S A;  4WK8 F;  1R1T A;  1I1S A;  5F1R A;  2QLZ A;  1QGP A;  3E6M A;  3QRF F;  2ZCW A;  2ZJ2 A;  4HV6 A;  4AVP A;  1H9T A;  4M6X A;  4CYD A;  3F23 A;  3RKY A;  2L3D A;  2HS5 A;  1XDS A;  3BDD A;  1FBQ A;  1B6A A;  2FNA A;  2EA2 A;  4RAZ A;  3SHF A;  3RPU A;  2JRT A;  5CJ9 A;  2HTJ A;  3ZMU A;  2FOK A;  2Z33 A;  1DDN A;  2Q2E A;  2W85 A;  3LA2 A;  2M45 A;  3TO6 A;  3BZ6 A;  2MH9 A;  1BM9 A;  3ZQ7 A;  4JK1 X;  6PAX A;  2FF4 A;  1HKS A;  2HQN A;  4N0B A;  3MEX A;  1CF7 A;  5HLH A;  2MBF A;  1QBJ A;  2JT1 A;  2L01 A;  3FMS A;  3ZMZ A;  4CZZ A;  4AWX B;  2Z3Y A;  4LD5 A;  1BBY A;  2ZME A;  1IRG A;  4UV8 A;  1ZG1 A;  2XAF A;  3WTU C;  3TQN A;  2H6C A;  1W5T A;  2E7W A;  4LJZ F;  1E17 A;  4KIC A;  3F8F A;  1J59 A;  2QUF A;  3RKX A;  5DD4 A;  4G8X A;  2QZ8 A;  4HV5 A;  1BIA A;  1MD0 A;  2RN7 A;  3P9C A;  5BPD A;  1FSE A;  5BQT A;  4NHJ A;  2Q0O A;  1R23 A;  5FFZ A;  4L5I A;  4O6J A;  2Z99 A;  4ZYD A;  3R0J A;  4EM2 A;  2XAG A;  2F5D A;  3WU0 A;  2EK5 A;  3EYY A;  4WX9 A;  4KUM A;  1R58 A;  1RUN A;  4HLX A;  2NYX A;  1ULY A;  1IXR C;  4CGZ A;  1IAW A;  2A5Y B;  1HQC A;  4YFN F;  4PGG A;  2LF8 A;  1TBX A;  5LHG A;  3QU3 A;  1ZRD A;  1QZY A;  2IP2 A;  3SXY A;  5ERI A;  1EH7 A;  3JAM Z;  5FD5 A;  2STW A;  2UWM A;  4WXC A;  1TLH B;  4YFX F;  3IWF A;  4IVN A;  4BQA A;  2L02 A;  4R8H A;  1MDM B;  1YG2 A;  3GWZ A;  3HRM A;  4KT5 C;  1V3F A;  3WE3 A;  2PI0 A;  2XRO A;  1UST A;  4ZZL A;  1YFH A;  5JFR A;  1BI3 A;  1MJA A;  3LAJ A;  3DQV C;  1O3S A;  5F64 A;  4ZZD A;  1S6L A;  4M74 A;  5KK1 A;  4P55 A;  5CVJ A;  4N9H A;  1W5S A;  2GXB A;  3K69 A;  4ENJ A;  5E8I A;  4A5N A;  5ICF A;  2EJR A;  3HSR A;  2LDU A;  1YO5 C;  3C7J A;  5FLX Z;  2ISY A;  5IT3 A;  1OMI A;  4AIK A;  2DU9 A;  2V1X A;  2HR3 A;  1U3E M;  2CGP A;  3K2Z A;  1SFU A;  3EDP A;  3M8E A;  2QQ9 A;  3H3Z A;  1ZAO A;  1FWZ A;  3PFI A;  5BOX A;  1USS A;  2X0L A;  5DDG A;  5DYM A;  4L18 B;  3IRR A;  3M1E A;  2STT A;  4PCQ A;  1O3R A;  1K7A A;  2KRF A;  3HHH A;  5FGM A;  4ZYG A;  1OR7 A;  1W7P B;  4B8X A;  4ZYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...