1GXPA

Phob effector domain in complex with pho box dna.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
AVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tandem DNA Recognition by Two-Component Signal Transduction Transcriptional Activator Phob
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcriptional activator
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN
total genus 22
structure length 103
sequence length 103
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1gxpA00
1KU3A 1ODDA 2QM3A 3O2PE 1PP7U 1EH8A 3EQLF 1KA8A 3MEXA 3KFWX 1H9TA 3GUDA 2PMUA 5DUIA 3QP5A 5BPIA 2X0LA 4I09A 1YIOA 3T1BA 1XGOA 1SFUA 3ZMZA 2FOKA 5L3FA 1XSVA 4GYIA 2FQ3A 1S7AA 2VC1A 2R7DA 4Q5SF 2FXAA 3LAPA 5J8FA 2XAHA 2ZBKA 1XCBA 2M30A 2DU9A 3SFZA 5DCMB 1G3YA 1MD0A 1FOKA 1XGSA 1FPQA 2P5KA 5LLQA 2P8TA 3E3VA 1J2XA 4G7ZF 1U5TA 1D8KA 3P9KA 2XV4S 3WTYC 1B4AA 4BAYA 3KP6A 2XAJA 4HLYA 2RGVA 1LQ1A 4DQ2A 2UZKA 1R36A 3MQ0A 1O7FA 4ZH4F 3GXOA 3HTSB 4OIRF 3GF2A 3ABUA 1YTYA 3M8EA 2P6TA 4A0XA 3LA3A 1FLIA 1FX7A 4LK1F 2VOPA 4G94A 2PG4A 1I27A 3ZN1A 4AIHA 3B02A 4RB3C 3MAJA 3JAMK 3K69A 4PGHA 2E7XA 2C6YA 4IXAA 3E6BA 2V79A 4ENKA 3R0AA 5ICCA 4WF2A 1ZH5A 3QAHA 3VODA 5K5OA 5K5QA 3V8JA 1YW8A 2Z9OA 2VBXA 4KMUX 2WC2A 3EYYA 1UHWA 1U2WA 3IL2A 5LRRA 4A0ZA 4LJZF 1T0FA 2LKPA 5HDNA 2GWRA 3WTSC 1SMYF 2FE3A 1ONVA 5JFRA 5D5WB 4XLNF 3K9TA 3KE2A 3MCZA 4FHTA 1QGPA 4G8XA 3RPQA 4N9IA 1U78A 2QBYB 4HOBA 4F7ZA 2EB7A 1K79A 1JHFA 3FM5A 5FD5A 4O6JA 1DP7P 1AWCA 1OMIA 1ZG5A 1T38A 2K86A 3GO5A 1XSDA 1UCRA 3F6VA 1HW5A 4HF1A 2W57A 3GX4X 1W5TA 1R58A 1K78B 4KDPA 2COMA 4A6DA 1UFMA 3LSTA 2DPDA 2Q2EA 3OOPA 3TDZC 3O6BB 1T98A 3KLNA 2XROA 3S2WA 5A2QZ 2G7HA 4PCQA 1FC3A 5DEQA 2EK5A 3IRQA 3T8RA 1A04A 5D4SA 2YX7A 2L3DA 2W24A 3KP2A 4MTDA 1KU9A 3F8CA 3U1DA 3M8FA 2H6BA 2MC3A 1WKMA 4EMSA 1IN8A 2ISYA 3QRFF 2PLYA 3ROUA 1CF7B 1PUEE 2BV6A 4HQEA 1Q1HA 1J59A 3TO6A 2IJLA 2NRAC 1BI3A 2PQ8A 1IW7F 1Z6TA 4IJAA 2J5OA 5D8LB 3F72A 3VFZA 1MJ9A 3GYHX 4LK0F 3I58A 3KEQA 1S6LA 4HX7A 4ASNA 2DAOA 2NNYA 4Y13A 2HYFA 4HDVA 1YO5C 3U2RA 3DQVC 1T6SA 2P7CB 3K1PA 4KYWA 1WI9A 2O03A 2P5LC 1BI0A 2F5DA 4OIOF 3HIFA 1IXCA 2MA3A 5BOXA 1QPMA 2EV6A 2KRFA 2RQPA 3F22A 1B9NA 4KFCA 4R1HA 5DD8A 2JZYA 1P4AA 4ON0A 1U8RA 3I53A 1JHHA 4WWCA 4OINF 5JHUA 5F1RA 1WWXA 3KETA 1ZG1A 3JW4A 4PDKA 4HA8A 1P4WA 2RC4A 2LF7A 3MFKA 2PJPA 2P4WA 2WWYA 2XKPA 3WTXC 3H92A 1YQAA 3R60A 3ZMVA 1I6XA 1K6OA 2STWA 2OZ6A 2UXXA 2ZKZA 3FMRA 4PGGA 1BC7C 2DPUA 1XSXA 5ERIA 4HDUA 4CGZA 2JPBA 1IRGA 3FX3A 1BM9A 1V3FA 1U3EM 2FNPA 3LWFA 2VE9A 5L3GA 4N9HA 2HWVA 3T0YA 2VXZA 3RKXA 4YIFA 1KGSA 4HLXA 5CVUA 4JQFA 1JE8A 1W7PA 1EH6A 3ZQ7A 5ICFA 3ZMTA 3BOQA 2DK8A 1TW2A 2XAQA 2W84A 1YFHA 4OMYA 3HUGA 1XGMA 3W6JB 5D4RA 2EA4A 3HRTA 3N97A 4S05A 2DT5A 1D3YA 4CHUA 3LFKA 1V4RA 1Z91A 1FZPB 4A6EA 1E2XA 1XD7A 2ESHA 4M6XA 1OYWA 1PP8F 2V1UA 2EFWA 4OIPF 2KIFA 2RDPA 2L4AA 4P96A 4QWQA 2HR3A 5ILSA 2IA0A 3FXQA 3ULQB 3HHHA 4JBAA 1BJAA 5E1WA 4I0BA 3HRUA 4XBFA 4ZYGA 5CJ9A 1KU2A 5FLXK 2A3SA 4BHPA 2LSOA 1YW9A 2H27A 5BMZA 2H6CA 1IN6A 3DEUA 3M9AA 5FD6A 4L9JA 4WCGA 5LHIA 5D6EA 1I1SA 1SMTA 1YG2A 3CJNA 5HS9A 3ERED 2E7WA 2FRHA 1STZA 1HKTA 4Z2YA 5D6FA 2CW0F 5TRDA 2JRTA 5JVTA 5LGTA 4YFNF 4WXHA 2BYVE 4G6DA 3D5LA 3FHZA 3T5XA 1FBQA 1ZYRF 1REPC 2YPRA 3F8FA 5L3CA 3CDHA 3V8LA 2E1CA 4DNCA 4UVBA 2HQRA 1LDKB 1G3WA 2B0LA 1U5TC 2ETHA 3MZHA 4EJTA 4YFXF 1SFXA 2EFPA 4HX8A 3BPXA 4IF4A 3C3WA 1D8JA 4OIQF 2IA1A 3G3ZA 3R6SA 3SZTA 3REOA 2PBIA 2Z5UA 4CYDA 4BXUA 4L9NA 5DYMA 2EWNA 3BZ6A 1JGSA 4MNUA 3VOEA 4EV0A 2BE5F 4AIKA 2NAZA 3E6MA 4OOIA 1O3TA 5LGUA 4A5MA 4XSZF 2K4JA 2IVMA 2YR2A 3HSRA 1QZYA 2RV8A 5L3BA 1TQIA 3SQNA 3GFJA 3WU0A 4FX4A 4GGGA 1LB2A 3C18A 3L7WA 3RTRA 5FO5A 4HZFA 3HSEA 1KQ0A 4BQAA 4A2UA 1RIOH 2ZNZA 4KICA 3PQJA 1HQCA 2G9WA 3O3KA 4OU0A 1LJ9A 3I64A 3JSOA 3F8NA 2STTA 2ESNA 1ZAOA 3BJ6A 2IP2A 1MKMA 3WE2A 4MTEA 2GIVA 3IWFA 3WTVC 3KZZA 5D8KB 2UXNA 1WQ2A 2MLKA 2FNAA 2FBHA 2XAFA 1C0WA 4L5IA 2EFNA 2RVCA 3ECHA 1ZHFA 4OMZA 2EFOA 4EGZA 2GQQA 2GZWA 5BS6A 3HHGA 1FP1D 5E8GA 2DO7A 1FNNA 5EEGA 3CUOA 3IRRA 4CXFA 2ZMEB 5DUKA 1IZ1A 1BI2A 1IXRC 1R7JA 2QQBA 2KIMA 1FBSA 2VBYA 1G3SA 2F2EA 1FSEA 2DK5A 3FXRA 3P7NA 2L02A 5FFZA 4MEYF 2OD5A 3WGIA 1R22A 4UXNA 4AIJA 2FMLA 4L18B 5HLIA 4HV6A 4P5OA 2M45A 2FU4A 2FMYA 1FBUA 1IN5A 4KN7X 5L3EA 2CFXA 2TDXA 2P7VB 2MH9A 2ZNYA 2VONA 1W7PB 3SHFA 1HSJA 3QPHA 5J8CA 2HTJA 2WTEA 5E1XA 1AOYA 1XGNA 1P2FA 3LAJA 3D0SA 3IHUA 4GO1A 5ILUA 3WTUC 3QOPA 1ZREA 1HSTA 2XKOA 3ZP5A 1QZZA 1MZBA 3DFGA 4RAYA 3ZPLA 4ZZLA 4WX9A 1W5SA 5CVIA 4KA4A 4MHGA 4A12A 4R79A 3QPTA 2M87A 3CO7C 3DV8A 5LBQA 4EM0B 2ACJA 2UWMA 2CGPA 2ZXJA 2GA2A 2FF4A 3IWZA 2HDCA 1BBYA 4KIBA 3F23A 3FWEA 3LQRA 1DPRA 3RKWA 2XRNA 1XMAA 2Z33A 3DKWA 4WXDA 1WRJA 1RNLA 1J5YA 3C1DA 5F6FA 3RIRA 3V4GA 5BPDA 3ABTA 2AS5F 2KKOA 1FYKA 2A6EF 3GW2A 4KNYA 4UUVA 2VE8A 2MH2A 2HYGD 1HW2A 4GCVA 2E1NA 2VN2A 2A07F 2QVOA 2G7UA 1OYYA 1DDNA 2V1DA 2CG4A 1ZRCA 4LGWA 3CUQB 3KZYA 4FT8A 4IPAA 2MD5A 2D45A 4ENNA 4LB5A 2NNNA 3GZ5A 3VEPA 1R5GA 1S29A 2HEOA 4HF0A 1RZ4A 3KP3A 1ZLJA 1Y0UA 1TQPA 1ZN2A 2OQGA 4NHJA 5K1YA 4UV9A 5BQTA 3AAFA 1KU7A 1KYWA 1F5TA 5FB2A 4HV5A 1KQ9A 5CVVA 4RB2C 1T39A 1IN4A 3K0LA 2OA4A 3QU6A 4EM1A 2BEOA 4A0YA 2FA5A 3EYIA 3I59B 5AONA 5CYVA 4LFUA 1TNSA 4WXCA 3K2ZA 5JR3A 1JXSA 5DCMA 5KK1A 1IUYA 4KN4X 1EH7A 2XVCA 2XUBA 5HVQC 5ED4A 2CSOA 4L0ZB 1FYMA 4MQ9F 4BNCA 2DI3A 2Z3YA 1LEBA 2O3FA 3ZN0A 3TQNA 1GXPA 2CO5A 3R0JA 4P9UA 1B59A 3KP4A 3E6CC 1F1ZA 2VOOA 1SD4A 4Y17A 1BOAA 1G4DA 3TOAA 1BC8C 1FT9A 3P9IA 3J80Z 4EJUA 3E97A 2QLZA 2ISZA 1KYZA 1ZLKA 2ADUA 4Q48A 3E5QA 4ETSA 3BROA 1FY7A 3WTWC 5AIQA 1YLFA 1ZRDA 4MGRA 4M71A 4A5NA 2O0YA 5F64A 2P6SA 2QWWA 4L0YB 3DPTA 2QQAA 4M72A 4EQQA 5ICEA 1P6RA 2Y48A 2XASA 1LVAA 5E1ZB 1O3QA 2DLLA 4I2OA 4ESBA 4ENJA 1R1UA 1CF7A 5H6QA 4NQWA 3GFLA 3KP7A 4G6QA 1LDJA 3V7CA 3ZMUA 2HFHA 2KJCA 1YW7A 2LDUA 2DQLA 4ENMA 2EJRA 3WU1B 1Z1DA 4N0BA 2GXGA 2M8EA 3H3UA 1TQMA 4O5VA 3W6KB 3CUQC 1DUXC 1XB4A 4H0EA 2PI0A 5D5VB 3WGGA 1ON2A 2HGCA 2LF8A 3BY6A 4ZYDA 3RYRA 2QYOA 3WGHA 5IT9Z 3FZVA 4YFKF 4UV8A 1BN5A 1TBXA 1TW3A 1NHAA 1HKQA 2KIUA 3J81K 3Q5FA 5E18F 4ZZDA 3F6OA 3RJPA 2IRFG 5IT3A 1HBXG 4RB1A 1QNTA 1J75A 3RPUA 3J7AO 5LGNA 1R23A 3CO6C 1Z05A 5HLHA 5DV5A 3F21A 4L5JA 5CLSA 4IRGA 3FF5A 1MJBA 3I59A 4KT5C 5FLXZ 1XN7A 1YYVA 4U88A 3FM3A 4UNOA 5D5UB 4M73A 5E17F 3TO7A 5D5XB 1B6AA 1ON1A 2L01A 1HXDA 1ZG3A 1BI1A 4FX0A 2WV0A 3PQKA 2K4BA 3SXYA 1LDDA 3RDIA 3I4PA 2IT0A 2ZMEA 4LG0B 1ZRFA 4M9SA 2VT3A 4G7HF 4U0YA 4U0WA 1P4XA 3KLOA 2W85A 2ZFWA 3HOTA 4I98B 2D1VA 1OR7A 4BYYA 2JT1A 5TJJA 4KIGA 2PMHA 2EV5A 1XMKA 1IF1A 3V8KA 1ZGJA 3ELKA 4TV7A 3GWZA 3GEZA 2Q8KA 4AD9A 4EGYA 2L4MA 2OAZA 2GXBA 3JTHA 3R4KA 1LNWA 1B9MA 3BJOA 1S3JA 4L9VA 5ICGA 5HDKA 3ECOA 2XAGA 2A6HF 2O6GE 3BP8A 3MZYA 1H0MA 3RKYA 1QQIA 2BGCA 2VBWA 5DDGA 4M9ZA 2QQ9A 1K7AA 4HF2A 2F5FA 4LD5A 4HBLA 4EJOA 1U5TB 1GVJA 5JI6A 2AXLA 2QZ8A 3IKVA 1K78A 2GA1A 2DFIA 2K02A 2IPQX 5CVRA 3WE3A 5H20A 1YS6A 1O57A 4L9TA 1TTYA 4P55A 4P9FA 2PEXA 1J7KA 1MDMA 3LA7A 4M9XA 4BHCA 4G7OF 1W4MA 1G6NA 4ESJA 3U9GA 1Z9CA 1IRFA 4BH9A 5ILVA 3LQQA 3LA2A 5FFXA 3M7GA 4IHTA 3IC7A 3JTGA 3JSPA 5DD4A 2DQRA 1ZARA 4BHBA 2OU2A 2V1XA 3NQOA 1FWZA 2OZUA 1SD7A 3VB2A 2L54A 2M1BA 2QENA 4M6YA 1S8NA 3HOSA 3RYPA 4R8HA 5AIPA 3HSFA 4MEXF 5J6XA 2A61A 2QUFA 5HOOA 5LHHA 1OKRA 2DBBA 1TLHB 2KJBA 4MQVA 4B8XA 2FBKA 3I54A 2HKXA 2R7FA 5LRSA 3KEOA 1R00A 3HTUA 1R5HA 2VC0A 1G3TA 2CQKA 2EA2A 3BWGA 4E70A 3FMQA 3PFIA 3DPLC 3KCCA 1OYIA 2H09A 4U7BA 1T2KA 3TGNA 2XGXA 1XCVA 4LMYA 1UHMA 4RGSA 4Y15A 1SD5A 3WTZA 4U7DA 5HLGA 4YG2F 4I01A 5LEJA 2HQNA 3JAMZ 2IW5A 2YU3A 4O3MA 2F5EA 2BBYA 1SAXA 2FSWA 2Y75A 2A69F 1MDMB 4I0AA 2NS0A 5H6RA 2K7LA 4S04A 5IT9K 3GVAA 3GFIA 4D0PA 5E20A 1R1TA 5LEKA 3V7RA 1USSA 1E17A 3QP6A 4AVPA 3J81Z 1SD6A 2EV0A 2H94A 4UHTA 1USTA 2F5CA 1F4KA 4NB5A 5DCFA 4KIFA 3QU3A 2DTRA 1RI7A 3ML6A 3GFMA 2FEZA 3N4MA 4LLNA 2K27A 1XDSA 1TNTA 5K5RA 4GYGA 3L9FA 2RN7A 2HTSA 4RGUA 2O61A 4K2EA 3I71A 2OQRA 1R1VA 1O3RA 3E5UA 3TOBA 4RGRA 2VT2A 4EVIA 4CICA 1J9IA 3P9CA 2HKOA 1Z6RA 4G9YA 1X3UA 2HOEA 1MGTA 1QO0D 3EDPA 1FSHA 1O3SA 3SZPA 4HYEA 2ZO4A 1IXSB 3NEUA 4LLLA 2JTVA 4EM2A 5CVJA 2M5WA 3F3XA 3GLXA 4B09A 1OPCA 1MJAA 4JK1X 4XLPF 3CLOA 1BIAA 1KQ8A 4IVNA 1DPUA 3F8BA 3K1NA 4CZZA 2Y0MA 3MWMA 5HS8A 4HX4A 1BIBA 2VODA 2V6CA 2J5PA 4RB0A 2A5YB 3C7JA 3M1EA 2RNJA 1L3LA 2JPCA 5HDGA 5E8IA 3Q9VA 2ZCWA 4QLCU 4PZJA 2LNBA 2P5VA 4HW0A 1YS7A 4RGXA 1U6GA 1I1GA 3E5XA 2PN6A 2MLGA 3CUQA 3OV8A 4ZYEA 4YIIA 4UVCA 1SFEA 1UB9A 4CDGA 3IKTA 5HS7A 4I02A 4RS8A 3CTAA 1L0OC 5L3DA 1F9NA 2JSCA 3GZ6A 3TO9A 1PDNC 2XIGA 5FGMA 3FMSA 3BJAA 4EJWA 3COAC 5KVRA 3F8MA 1O7LA 4GXOA 3ISPA 2CWEA 3E6DA 4CO8A 3HYIA 2HZTA 2W25A 3BDDA 3I0TA 4AWXB 1LEAA 6PAXA 2R3SA 2DW4A 3R61A 4LLGF 4RAZA 1I5ZA 4IHSA 2CYYA 1EV7A 2X4HA 3L09A 4Q47A 3WODF 1FYLA 2VBZA 2XHKA 2O8XA 2YX4A 1B1BA 5LHGA 1VTNC 3L2CA 4HAMA 3EUHA 3WTTC 3BPVA 2HS5A 1IAWA 3FXUA 1RUNA 4XRFA 2V9VA 3WG9A 4IRHA 1D5VA 3DF8A 1J0RA 4EJVA 5A2QK 2EFQA 2A68F 4ESFA 1HKSA 1XDUA 3I5UA 4WK8F 3T8TA 3NRVA 2YSRA 2Z99A 4KMFA 1H9GA 2ELHA 2QBYA 2IA2A 1HW1A 3TKYA 2ZJ2A 1FP2A 3DP7A 3RI4A 4KUMA 2NYXA 4LG0A 4HQMA 4LB6B 2RKHA 1P92A 3K1MA 3HRMA 1RUOA 4Q4ZF 2FBIA 2GAUA 1ULYA 2D2WA 1ZGAA 1Z7UA 4IRIA 1W7PD 2OBPA 1IN7A 4M74A 1QBJA 1WSUA 4ZYHA 3G73A 1GHCA 3Q9SA 3ZMSA 3DXJF 3L00A 5EEHA 2PFBA 1GXQA 3H3ZA 4I7HA 3J80K 2D1HA 3ZMDA 3B73A 3V7SA 3HRSA 2MBFA 3EETA 2Q0OA 3KP5A 4UVAA 4U0VA 4XSXF 1CGPA 1S7OA 3TDUC
chains in the Genus database with same CATH superfamily
2XB0X 5GPCA 1ZGWA 1KU3A 1BR4A 3DBLB 2FUG2 4X0GA 1ODDA 2R5YA 2QM3A 2KDZA 1AHDP 3V42A 1Y6IA 2W1OA 3H3VK 2LRDA 2DOAA 4GFBA 3O2PE 3PNVA 1PP7U 4MFEA 1EH8A 4NC6A 3EQLF 4FQGA 1KA8A 3MEXA 3UR3C 3KFWX 2P81A 1H9TA 1JJ6C 3GUDA 2QGUA 2PMUA 5DUIA 3QP5A 5BPIA 3U21A 1X19A 2V9PA 4XMYA 2X0LA 3JRFA 1GT0C 4I09A 4HNTA 1VQNI 1Z21A 1YIOA 3EUKL 3T1BA 2LBFA 2W00A 1XGOA 1SFUA 2WAFA 4UUTA 4XM3A 3ZMZA 2FOKA 5L3FA 2V1NA 3VYTB 1WGXA 1XSVA 3AL0C 3JRDA 4GYIA 1ETWA 2IS6A 4HG2A 2DCEA 2VQHA 2FQ3A 1S7AA 2VC1A 2R7DA 3MKWB 4Q5SF 3SFIA 2FXAA 3N05A 3LAPA 5J8FA 2XAHA 2GLOA 3PNTA 2ZBKA 2EIKH 1JUSA 1WFXA 1XCBA 2M30A 2DU9A 2JN6A 1ZR4A 3SFZA 2AHQA 3CZ6A 5DCMB 3CMYA 1G3YA 1MD0A 1FOKA 1POGA 1XGSA 4BY1J 1FPQA 2P5KA 3Q0VA 3WHBA 5LLQA 2P8TA 3AG4H 1MBJA 1V5FA 3E3VA 1J2XA 2EZKA 4G7ZF 3LSHA 2VASA 2Y9ZA 1U5TA 1R4NB 2M0MA 3ONQA 5JLWA 1D8KA 3P9KA 4DIQA 2XV4S 3WTYC 1B4AA 4BAYA 3KP6A 3OYGA 1OCTC 1ACIA 2XAJA 4HLYA 3ZR8X 2RGVA 2KPMA 1LQ1A 4DQ2A 3Q0WA 2XB5A 1RKTA 2UZKA 1ZR2A 1R36A 3MQ0A 4ITVA 4Y4RA 2JVHA 4DOZA 1EA3A 4IQ4A 3DU6A 1DU0A 4BDZA 1O7FA 1RR8C 3DLAA 4ZTJA 4ZH4F 3GXOA 3HTSB 4OIRF 3GF2A 4M3DA 1G59A 3ABUA 4FISA 1YTYA 3M8EA 3EUHC 1Y39A 2R93J 2P6TA 4A0XA 3LA3A 1FLIA 1FX7A 3FHNA 2EILH 4XLAA 4LK1F 2VOPA 4B3XA 1ETKA 3C2HA 1X1CA 4G94A 2PG4A 2ZJRF 1I27A 1Z77A 1I6HJ 1HA8A 3CLQA 3ZN1A 4AIHA 1R71A 2BHYA 2XSDC 3CJQB 3ASOH 5EF6A 3GTGJ 2LK2A 5HODA 2QCOA 3B02A 4RB3C 3MAJA 3JAMK 2CMPA 4FTHA 3G1MA 1NH3A 3MVPA 3CMAI 2QEXI 3K69A 4ZDLA 2PMZN 4PGHA 2E7XA 2C6YA 3FBIB 4IXAA 3E6BA 2V79A 4ENKA 3R0AA 5ICCA 3DEWA 1YJNI 3HOWJ 3BG5A 4WF2A 1ZH5A 5KAFC 2M9HA 3S16J 1A6IA 3QAHA 3VODA 2Y2ZA 4X1EA 5K5QA 5K5OA 3V8JA 3SZGA 1YW8A 2Z9OA 2VBXA 3PSIA 2WC2A 3LMMA 4KMUX 3EYYA 2TRTA 3SDBA 5C4XJ 2CRGA 1UHWA 1U2WA 3IL2A 5LRRA 4A0ZA 4PSXA 1X4PA 4LJZF 2L9VA 4D5FA 1SAUA 2BVMA 1PYVA 3CCVI 3KPHA 3D5SC 2HQAA 1T0FA 2LKPA 5HDNA 2GWRA 3WTSC 2VPRA 3GTMJ 1SMYF 1SVOA 2FE3A 4E7JA 2WAQN 5J4VA 4IKFA 2NXNB 1ONVA 3W2VA 5JFRA 5D5WB 3BCBA 3FXKA 2HPMA 4XLNF 2HYJA 1MBFA 4YIRX 3K9TA 4P1WA 3KE2A 3MCZA 2DT6A 5M5WJ 4FHTA 1QGPA 2EPFA 4G8XA 3RPQA 1Z67A 4N9IA 4NC7A 1U78A 2QBYB 3CC2I 4HOBA 2JSPA 2ZC2A 3PIOF 4B48A 4F7ZA 1JKOC 4RMNA 2EB7A 2K9QA 5J3LA 1K79A 1VZ0A 1JHFA 2PJRA 4NQWB 1B72A 3FM5A 5FD5A 4O6JA 2UV1A 1DP7P 1WHUA 1AWCA 1OMIA 3S3MA 1ZG5A 1T38A 4E7LA 4XQFA 2K86A 1B8IB 3GO5A 3C2BA 2W48A 1XSDA 3M4OJ 4QTRA 1MW7A 1UCRA 2VLAA 2FQ4A 3A0BC 3CF5F 3FDYA 2BOLA 3F6VA 1HW5A 2IGMA 1JKPC 2DN0A 4HF1A 4BS9A 4CCKA 3RSNA 1JJ8C 2W57A 2R7RA 3GX4X 1W5TA 1R58A 1KONA 1K78B 4KDPA 3ABMH 2COMA 2L7FP 4A6DA 3L2QA 1UFMA 4BGDA 4GRIA 3LSTA 2DA7A 2EZLA 2Q2EA 2M7BA 2NOGA 3OOPA 1ORKA 2DPDA 3TDZC 3O6BB 1T98A 3KLNA 1WJFA 2XROA 3S2WA 5A2QZ 3FXOA 2G7HA 4OWRB 4PCQA 1FC3A 3BZCA 5DEQA 4DBQA 1NG6A 3L2RA 2EK5A 3IRQA 5FLVA 1IRXA 3T8RA 3RZDJ 1A04A 5D4SA 2YX7A 2L3DA 2W24A 3KP2A 4MTDA 4A3CJ 1KU9A 1YX3A 3BQYA 1G2HA 4A3EJ 2DT7B 3F8CA 3U1DA 1UHSA 5J1YA 4M3FA 5K7ZA 3L2WA 4A3DJ 3M8FA 3SEQA 2H6BA 2MC3A 2NVQJ 1WKMA 4EMSA 1IN8A 2ISYA 3QRFF 2O9LA 4JOMA 2PLYA 3ROUA 1CF7B 1PUEE 2BV6A 4HQEA 1Q1HA 3HC7A 1J59A 4AYBN 2HXOA 5CQEA 3TO6A 2DMNA 3A4CA 2Y0SN 2IJLA 2NRAC 2GOMA 1BI3A 3CCQI 1AKHA 1QZEA 3ZCOA 2L7MP 2PQ8A 1OLTA 1IW7F 1Z6TA 3A02A 4IJAA 4DYRA 2J5OA 5D8LB 2HXIA 1YE9A 4FCYA 3ZQGA 3F72A 4EATA 3VFZA 4KITB 5TGTA 1MJ9A 3GYHX 3CC4I 4LK0F 1A5JA 2RAEA 2XPVA 4XKBA 3I58A 2KMUA 3KEQA 2JVGA 1S6LA 4HX7A 3OYKA 2V7FA 4ASNA 2DAOA 2NNYA 3EUAA 5EDNA 4Y13A 2HYFA 2OTJI 4HDVA 5EYRA 1MMNA 1YO5C 1X1PA 3U2RA 2BXZA 3DQVC 1T6SA 1W36D 2P7CB 1T8IA 1N77A 3K1PA 1UAAA 4KYWA 1WI9A 2O03A 2P5LC 1BI0A 2F5DA 1OQYA 4BEHA 2V6EA 4OIOF 3HIFA 1IXCA 4M6VA 3W3CA 4BE1A 2MA3A 4OAZA 3RCOA 2OF7A 4ZDOA 1OCZH 5JLXA 5BOXA 1QPMA 2EV6A 1MNMC 2DYRH 2KRFA 2RQPA 2XGCA 2R7QA 3F22A 1U9NA 1B9NA 4KFCA 4AC0A 4PJJA 5DM6F 3RQ4A 1BA5A 4R1HA 5DD8A 4Y52J 2ECBA 2EQRA 2JZYA 3O8GA 1P4AA 4ON0A 1U8RA 3S2HJ 3I53A 5IYCJ 2I5UA 1JHHA 4MO7A 1RRJA 1H88C 2EIMH 4WWCA 4OINF 5F1RA 5JHUA 3K7AJ 1WWXA 1SFKA 3KETA 1ZG1A 3JW4A 4E7HA 2DYSH 4PDKA 4HA8A 1WJCA 2BW3B 1P4WA 2RC4A 2W82A 2LF7A 3MFKA 1MMDA 1IDZA 2PJPA 2H8WA 4HPQA 3FKJA 1IG7A 5EEAA 2LG4A 3BTCA 1JTXA 2P4WA 5F0HA 2XKPA 3LSKA 2WWYA 2O8KA 3WTXC 3H92A 3OYNA 1YQAA 2LYCA 3R60A 3ZMVA 4OAYA 5F04A 3S93A 3K4MA 1I6XA 1K6OA 1OISA 2STWA 3WU2C 2OZ6A 2UXXA 4G6TB 4XR6A 2ZKZA 1X2MA 3DKXA 3FMRA 4NC8A 4PGGA 3J7ZI 1BC7C 1WJAA 1U0JA 1V5EA 2DPUA 2CUFA 1XS9A 2IXSA 1XSXA 2LY1A 5ERIA 4HDUA 1S5LC 2JPBA 4CGZA 4B47A 3BR2A 1IRGA 1FTZA 1N78A 4D9JA 3FX3A 1BM9A 1V3FA 4BBRJ 1U3EM 2FNPA 2OC6A 3LWFA 2X51A 1SVLA 4PJNA 4LG3A 5F27A 5L3GA 2VE9A 4N9HA 2HWVA 3T0YA 2VXZA 3RKXA 3NWTA 4YIFA 1KGSA 4HLXA 3GLLA 5CVUA 2N8GA 2E35A 3IUOA 3X2QH 4JQFA 1JE8A 3I4MJ 1W7PA 1EH6A 3ZQ7A 2W7NA 3BR1A 1X4OA 2EZIA 5ICFA 3ZMTA 4A3IJ 3BOQA 1A31A 1EF4A 2DK8A 3A1YA 1TW2A 2XAQA 4KT6A 2W84A 2XPUA 3CCSI 3HUGA 1YFHA 4OMYA 1XGMA 4RM3A 4H4KC 3W6JB 5D4RA 4IOCF 2F4OB 2NVYJ 3ZQHA 2EA4A 1Z3YA 1N75A 4CCMA 3HRTA 2Y9YA 3N97A 1MSEC 3K6GA 3GTPJ 4S05A 2DT5A 4D7MA 1D3YA 3BCAA 3LFKA 4CHUA 4BJTA 3GTLJ 1V4RA 1Z91A 1FZPB 4A6EA 3QYFA 1E2XA 4MFDA 1LUJB 1E3OC 1XD7A 2ESHA 4M6XA 3OY9A 1OYWA 1PP8F 2V1UA 2EFWA 1VI0A 3S14J 4OIPF 2KIFA 2RDPA 2L4AA 4P96A 4QWQA 1VQOI 2HR3A 2CQQA 5ILSA 2IA0A 3FXQA 1Y56A 3ULQB 2R7TA 5IP6A 1YJ9I 3HHHA 4JBAA 3K2AA 1BJAA 5E1WA 1PUFB 4I0BA 3HRUA 4F52A 3IP4B 3FBNB 3H35A 3A01A 2IEKA 4XBFA 4ZYGA 2BZTA 1VQ8I 4ZJZA 2ICWG 5CJ9A 3FKIJ 1KU2A 4A3MJ 5FLXK 2VQGA 4CYCA 2A3SA 4BHPA 5LD2C 3AG2H 2EBIA 2LSOA 1YW9A 2H27A 5BMZA 3E1SA 2H6CA 3H9GA 1IN6A 3DEUA 3M9AA 5FD6A 5KAIC 4L9JA 1T95A 3ZRGA 4WCGA 4D1QA 5LHIA 5D6EA 1MMSA 1I1SA 5IOYA 1SMTA 2JJ7A 4QSHA 1YG2A 3B6AA 3S3OA 3CJNA 1JT6A 1LE8B 2R5ZA 2ELKA 4XKWA 5HS9A 3E0JB 3BR0A 3ERED 2NVXJ 2L5QA 2DFEA 2E7WA 2FRHA 3NAUA 1STZA 2XDVA 2VUMJ 1HKTA 2K3PA 4Z2YA 5D6FA 2CW0F 1RKWA 3BR6A 5TRDA 2JRTA 5JVTA 2JQ7A 3ERMA 2BHZA 2LOOA 5LGTA 5FKMA 1MBHA 4PFOA 3OIPA 4UB6C 1QPIA 3OYMA 1JT0A 3DTIA 4YFNF 5B5EC 4WXHA 2BYVE 2PMZA 4G6DA 3D5LA 3FHZA 3T5XA 2YUSA 1FBQA 1ZYRF 1REPC 4Y33A 2YPRA 2CFOA 3F8FA 4BQOA 3FISA 1TT0A 5L3CA 2HI3A 3CDHA 3V8LA 2RQQA 2E1CA 4DNCA 3Q3SA 4UVBA 2HQRA 1LDKB 2Z1DA 1G3WA 2B0LA 1U5TC 1ZK8A 3Q0UA 3CQZJ 2EINH 2ETHA 3MZHA 4EJTA 4YFXF 2MG4A 1O4XA 3MD2A 4BXXJ 5FKKA 3C2GA 1SFXA 4XOPA 3QYBA 2EFPA 1Y1VJ 3WHCA 3HUGB 2L7KA 3ZXSA 4HX8A 1G8XA 3BPXA 2KHMA 4IF4A 4IQJA 1TC3C 3S1NJ 3C3WA 4QIWN 1D8JA 4OIQF 2KQRA 2IA1A 2OCCH 2QKMB 3G3ZA 3R6SA 3SZTA 1F36A 3REOA 2PBIA 5EJCA 2Z5UA 1J09A 2ZXHA 4CYDA 4BXUA 4L9NA 5DYMA 2B9SA 2EWNA 3BZ6A 4RBOA 1JGSA 2MW8A 4MNUA 3QPSA 2Z2SB 3BC8A 3PNYA 1T0FC 4S0HB 3OR1C 4NDLA 3VOEA 2ME6A 4EV0A 2BE5F 5GP9A 4AIKA 2OTLI 2AQEA 2NAZA 2ZFUA 2BY2A 3E6MA 4OOIA 3VPRA 3OWTA 1O3TA 4XN3A 5LGUA 1FOXA 3K4KA 4KJZA 4A5MA 4XSZF 2K4JA 2IVMA 2IS4A 2YR2A 3HSRA 2IAIA 1TWCJ 1QZYA 3PSFA 2RV8A 3H9QA 2CV0A 5FRMA 2XF5A 2CJJA 5L3BA 3W6VA 1TQIA 3SQNA 3GFJA 3WU0A 4FX4A 4GGGA 4I6ZA 3C18A 3L7WA 3RTRA 1LB2A 2VKVA 5FO5A 4HZFA 1D0XA 1D1AA 4C2MJ 3HSEA 2R7WA 2HVRA 3AL0B 3OYDA 4D7NA 1KQ0A 3PUFA 4BL0B 2V4JC 4BQAA 4A2UA 2DMPA 4IZZA 1UZCA 1TWGJ 3JRGA 1RIOH 5K7HA 2ZNZA 4KICA 1RC9A 2X6WA 4XIDA 3PQJA 2VIXA 1HQCA 2G9WA 3O3KA 2VKEA 3M1CA 3OOUA 4OU0A 1LJ9A 4C3IJ 3I64A 3GZNB 3JSOA 3F8NA 3WG7H 2STTA 2ESNA 1ZAOA 1S9HA 3BJ6A 4XRSG 4DYQA 2IP2A 1MKMA 2HU9A 3WE2A 4MTEA 1ERDA 2GIVA 1GV5A 1PVEA 3IWFA 3WTVC 1BL0A 3KZZA 4ZC3A 5D8KB 2X6YA 3OYIA 2R4GA 2UXNA 5IPAA 1WQ2A 3A0HC 2MLKA 4Y3OA 2FNAA 2FBHA 2H1KA 3HL2A 2XAFA 1C0WA 4L5IA 2EFNA 2RVCA 3ECHA 3I3LA 1ZHFA 2KLOA 2MABA 4OMZA 2EFOA 3I55I 4EGZA 2GQQA 2GZWA 5BS6A 1ZTRA 3IH3A 3OL4A 3HHGA 4XLCA 1FP1D 2MC4A 2MSYA 5E8GA 2DO7A 1FNNA 5JHFA 5EEGA 3CUOA 3QWLA 3VSLA 1WH7A 5GAGJ 3IRRA 1YJWI 4CXFA 1NG7A 2YS9A 1YRNB 1I3QJ 2ZMEB 3HBLA 5DUKA 1IZ1A 2WB1N 1JGGA 3K4CA 1A6QA 1BI2A 2ZSIB 1IXRC 1R7JA 3MMYB 5EG0A 2QQBA 1D1BA 2KIMA 3HOXJ 1FBSA 2M4KA 2VBYA 3RKQA 2VL8A 2VJ5A 1G3SA 2F2EA 2LP0A 4C2UA 1FSEA 3MZ8A 2DK5A 3FXRA 3OYFA 4RDUA 2XF7A 2L7ZA 1MMGA 3P7NA 4C3JJ 2L02A 3ESWB 5FFZA 4MEYF 2OD5A 3WGIA 1X2NA 3OYHA 2BY0A 2WAQA 3VDXA 1R22A 4UXNA 1H89C 4AIJA 1LPQA 2X9DA 2FMLA 4BQQA 2V26A 4L18B 5HLIA 2KFDA 4HV6A 4P5OA 2M45A 2FU4A 2FMYA 3HOYJ 2EH3A 2E5ZA 1FBUA 5LFAA 1IN5A 2DFFA 2KISA 3CJTB 3HGYA 4KN7X 3KZIC 5L3EA 2ZJPF 2RREA 4DW6A 2CFXA 2HDDA 2TDXA 3ASNH 2P7VB 1QU3A 2MH9A 2ZNYA 3K10A 1W7PB 3SHFA 1V54H 2VONA 1HSJA 2H8RA 3QPHA 3ZQCA 5J8CA 3DU5A 2HTJA 2WTEA 5FKLA 5HNFA 2CUJA 3G1LA 1T08B 5E1XA 3ZQQA 1AOYA 2LC2A 1XGNA 4NNJA 1P2FA 3HZJA 1TL8A 4A3KJ 3LAJA 2BXYA 5J4YA 1SC7A 3D0SA 3IHUA 4E7IA 4GO1A 5ILUA 1V5GA 3WTUC 1GDTA 3QOPA 1XC5A 2K9LA 4F91B 1ZREA 1HSTA 2XKOA 3H0DA 2VPLA 3FXLA 1WCMJ 3ZP5A 2JWTA 1QZZA 1MZBA 3DFGA 4RAYA 4AIDA 4A3FJ 3ZPLA 4ZZLA 4WX9A 3CCEI 1LKXA 1VQPI 2HOSA 1W5SA 2O5RA 3HEFA 5CVIA 3PFYA 4MHGA 4KA4A 4A12A 4R79A 1LE8A 3QPTA 2M87A 1S7EA 2DA1A 3DV8A 3CO7C 5M3MJ 1S72I 5LBQA 1W5CC 2WBMA 2JUGA 4EM0B 4M3EA 2ACJA 2UWMA 4HEA2 3CMMA 2CGPA 2A05A 2GA2A 2ZXJA 2FF4A 3IWZA 4FETA 2HDCA 1P9QC 1BBYA 3HB9A 4KIBA 3LNQA 2CW7A 5EZGA 2LH9A 3F23A 3FWEA 3RZOJ 4XLHA 3LQRA 4CA0A 2R7UA 3BR5A 2M0CA 1RPWA 1ETXA 1DPRA 3HKZN 2X6XA 3TBIA 3RKWA 4DJAA 2JA5J 1BR2A 2XRNA 1TP4A 2XGEA 2QSGX 2CUZA 2VJIA 1XMAA 1ETVA 2Z33A 3DKWA 3IAS2 1TT5B 4WXDA 5GAHJ 2X1DA 1WRJA 1RNLA 1RESA 1J5YA 3C1DA 5F6FA 3RIRA 3V4GA 1MBKA 5BPDA 3ABTA 2AS5F 2KKOA 1FYKA 2A6EF 1JUPA 1D0YA 3LFUA 3HM5A 3LSRA 1UG0A 3GW2A 4BE2A 4KNYA 4IHYA 3FK6A 4UUVA 2VE8A 3CCJI 2MH2A 4F3QA 1VF9A 4E4HA 2ZXIA 3BG7A 2HYGD 2IGKA 3PL8A 2R7SA 1HW2A 4FE7A 4GCVA 2E1NA 4Z6YA 2VN2A 1SFOJ 3ABLH 2A07F 2QVOA 2VB6A 3KYCB 2G7UA 1OYYA 3B6CA 1DDNA 2V1DA 2CG4A 1ZRCA 1MH3A 4LGWA 3CUQB 3KZYA 4FT8A 4IPAA 2MD5A 3DLLF 2D45A 2ZMEC 4ENNA 2CQNA 2QSFX 4LB5A 2NNNA 1R5ID 3GZ5A 3VEPA 1R5GA 1S29A 2HEOA 3KIOA 4AVZA 4HF0A 2M8GX 1RZ4A 1I50J 3CCMI 1HCRA 4PJLA 1GUUA 1BOBA 3KP3A 1ZLJA 3CESA 1Y0UA 1CQTA 1TQPA 3PM1A 1ZN2A 2L0KA 2OQGA 4NHJA 3LSGA 5K1YA 1HDDC 4UV9A 5BQTA 3AAFA 1KYWA 1KU7A 1F5TA 3M07A 5FB2A 4HV5A 1KQ9A 5CVVA 4RB2C 1T39A 1IN4A 3TW7A 3K0LA 2OA4A 3QU6A 2DMUA 2RNGA 4EM1A 1HF0A 2BEOA 2CV2A 2GXAA 4A0YA 2FA5A 4PJMA 3EYIA 3BLYA 3I59B 4II3A 5AONA 5CYVA 4LFUA 1TNSA 4WXCA 3K2ZA 4B3AA 3S17J 5JR3A 4F92B 2HPIA 2X48A 1JXSA 5CQGA 4XORA 2WA0A 2XRLA 3FXJA 5DCMA 5KK1A 1IUYA 1VQKI 1YX5A 4KN4X 1EH7A 4BJ5C 2LKSA 3HOUJ 2XVCA 1K4TA 1JKQC 2XUBA 5HVQC 2FOWA 2WY8Q 5ED4A 2CSOA 1JKRC 4L0ZB 4CCOA 2LVSA 2NS8A 3OR2C 4XNFA 1FYMA 2V9KA 4MQ9F 3CCLI 4BNCA 2DI3A 2Z3YA 3S15J 1LEBA 2O3FA 2WB1A 3ZN0A 2R5ZB 3NWSA 3TQNA 1GXPA 3K4LA 5M5XJ 1X58A 4XN0A 2CUEA 1OFCX 4CCLA 3KYLA 1UELB 2CO5A 1TWHJ 3R0JA 1VQ5I 4YEJA 4DZPA 4P9UA 5GPAA 1B59A 3KP4A 1VQ9I 4NBQA 4B1RA 3E6CC 1F1ZA 2E60A 2VOOA 4N4OB 1SD4A 4Y17A 1BOAA 1G4DA 4UUSB 4C2TA 3TOAA 1SVMA 1BC8C 2COBA 1FT9A 3P9IA 3J80Z 2KZVA 3TL4X 3F0CA 2CQXA 3E97A 4EJUA 2QLZA 2ISZA 1KYZA 1ZLKA 2ADUA 4IHWA 3VWBA 4Q48A 4V2GA 3E5QA 4ETSA 2Q1ZB 1R49A 4GDFA 1X1DA 3G1OA 3BROA 3HPGA 3H36A 5H2FC 1FY7A 3WTWC 1VQMI 5AIQA 1YLFA 3L1PA 2D5VA 5GADJ 1ZRDA 4MGRA 3LL7A 4M71A 4A5NA 3GBGA 4XONA 1VQ4I 2O0YA 2M4GA 5F64A 2P6SA 2F5VA 3GTQJ 2QWWA 4L0YB 3DPTA 3S2DJ 5B3SH 2QQAA 4M72A 4EQQA 5ICEA 1P6RA 2BY1A 2FD5A 2Y48A 3H0GJ 4L5EA 1FJLA 5DM7F 2XASA 3ZQIA 1LVAA 4W1UA 4HNVA 4J19A 3G2BA 3DTKA 5E1ZB 1O3QA 2DDAA 2DLLA 4I2OA 4A3LJ 4ESBA 3S8PA 4ENJA 1R1UA 1CF7A 5H6QA 2Y69H 4NQWA 3GFLA 3KP7A 4DBRA 2DA6A 4G6QA 1LDJA 3V7CA 2E34A 5E3LA 2E2JJ 2LR8A 3ZMUA 2HFHA 3DCFA 2KJCA 1YW7A 2LDUA 4J01A 4W97A 2DQLA 2VJ4A 1U9OA 2EZHA 4ENMA 2EJRA 1HDPA 3WU1B 2BY3A 1Z1DA 2VI6A 1A36A 2NVUB 1W36C 4N0BA 5IYBJ 5GTHC 2GXGA 1MNEA 2M8EA 3H3UA 1Y1WJ 1TQMA 2DA2A 4O5VA 3W6KB 1XPXA 2R7VA 2LLKA 3JRBA 1F43A 3CUQC 4B43A 2ZJQF 1DUXC 3K4JA 4HRIA 5IP9J 1XB4A 4H0EA 2Q2EB 2PI0A 4PFPA 3WGGA 5D5VB 4IHXA 1ON2A 2HGCA 2LF8A 3BY6A 2ME0A 4XRMA 4ZYDA 1XTAA 1AKHB 3RYRA 2QYOA 3WGHA 4BJ6C 5IT9Z 1Z7LA 3FZVA 2LTPA 9ANTA 2XAUA 1K83J 4PJ0C 5C3EJ 2ECCA 4YFKF 1YITI 4UV8A 1BN5A 1TBXA 1TW3A 1NHAA 3OS0A 1HKQA 2KIUA 3J81K 3PO3J 3Q5FA 2IGOA 4ZDPA 3MKZA 4IL6C 3VYSB 5E18F 3PUBA 4I76A 2K9MA 4ZZDA 3F6OA 3RJPA 4KISA 2DXIA 1XG1A 5IT3A 2IRFG 1HBXG 4JX5A 4RB1A 1QNTA 1J75A 3GTKJ 1MIJA 3RPUA 2L9RA 1DQUA 5LGNA 3J7AO 1R23A 4IX7A 3CO6C 4CH7A 2EIJH 1Z05A 5HLHA 2GM4A 5DV5A 2DMQA 4EEFG 2F6CA 4CCJA 4Y7NJ 3F21A 4L5JA 5J40A 4BBSJ 5CLSA 1BR1A 3OYJA 3HPHA 4IRGA 3OYCA 3FF5A 1MJBA 3I59A 3P5JA 4KT5C 5FLXZ 4E7SA 2O7OA 1XN7A 4JP0A 1YYVA 4U88A 3FM3A 2YU9J 1OR7C 2QA4I 4UNOA 5D5UB 2WV1A 4M73A 4B44A 5E17F 3AKZA 2NS7A 2B7EA 3TO7A 3VSKA 5D5XB 1B6AA 1IDYA 1QRYA 1YRNA 1ON1A 2L01A 2B63J 2KRCA 1HXDA 5IYDJ 1NTCA 4JYKA 2JRMA 1ZG3A 2X1CA 2LY2A 3K4BA 1BI1A 4FX0A 1FIPA 2KL4A 4A3BJ 2JA2A 1EJ9A 2WV0A 5EGOA 3PQKA 2IS1A 1AA7A 1QVUA 2K4BA 1E0EA 2HVQA 1LDDA 3SXYA 3RDIA 2G0EA 3I4PA 4ZTFA 2AXTC 1B8IA 2IT0A 2ZMEA 4LG0B 1UJ8A 1X1BA 1P7IA 2Z16A 1ZRFA 4M9SA 2MYSA 2VT3A 3J7AY 2HZDA 4G7HF 4U0YA 3OS2A 1XMXA 1UMQA 3A03A 4U0WA 1TWFJ 1OCPA 5FROA 1P4XA 1LVKA 1WZ2A 2DODA 3KLOA 3ZOBA 2W85A 2ZFWA 2ZXWH 3UNGC 1YHQI 3CCRI 3BQZA 3S32A 1ETQA 2K3FA 2D1VA 4I98B 4LOCA 3HOTA 1FTTA 1JUMA 1OR7A 4BYYA 2JT1A 1FOWA 2JA8J 5TJJA 3JR9A 3GCMA 3LSJA 3I56I 4KIGA 4XKCA 2PMHA 1OCRH 1BW6A 2EV5A 3ABKH 1XMKA 4XICA 1R9TJ 1IF1A 4UY8I 3V8KA 2QSHX 1ZGJA 3JRCA 3ELKA 1Y8QB 2AO9A 4TV7A 4DZJA 2JA6J 3GWZA 3GEZA 2E71A 2Q8KA 2XPWA 4AD9A 3OL3A 4EGYA 2A5WA 2L4MA 2H1LA 2OAZA 3ZQFA 5C4JJ 3RPUD 2P0WA 2GXBA 3JTHA 3S3NA 1DP3A 2E19A 3R4KA 1LNWA 1B9MA 2CU7A 3BJOA 3BG3A 3HOVJ 1S3JA 4L9VA 1W1WE 5ICGA 5HDKA 3ECOA 2XAGA 2A6HF 2O6GE 3OIQA 5IY5H 3BP8A 3MZYA 1H0MA 4XLFA 3RKYA 1QQIA 2ELJA 2K40A 2BGCA 2VBWA 3M8JA 2KP6A 4ANJA 3CC7I 4PSWA 5DDGA 2K9NA 4M9ZA 2QQ9A 4G12A 3BG9A 1K7AA 1IO2A 2F5FA 4HF2A 4LD5A 4A3JJ 1IV8A 4HBLA 4RLFA 2XGDA 1MBEA 2LMDA 4EJOA 1U5TB 2R7OA 1GVJA 3VYRB 5JI6A 3JRHA 2AXLA 3DBHB 2QZ8A 3IKVA 5EGOB 3JRIA 3K70D 4C9YA 3LSPA 1K78A 2GA1A 1WH5A 2JA7J 2DFIA 2K02A 2IPQX 5CVRA 3WE3A 2DMTA 5B1AH 5H20A 1YS6A 2BW3A 4U87A 1O57A 2IBDA 3CDIA 1R6RA 4L9TA 2FJ1A 1TTYA 4P55A 1OCCH 4P9FA 1LFUP 1DGRM 3CD6I 2PEXA 1J7KA 1IJWC 2E2HJ 2HVSA 4V19K 5E3OA 1I3AA 2L9SA 2I8DA 3HKZA 1MDMA 3LA7A 2JK3A 4X6AJ 4M9XA 2JUCA 4BHCA 4G7OF 2QQ8A 1W4MA 1IGNA 1ETYA 5K7FA 3H5AA 1G6NA 4ESJA 4BE0A 3ZGKA 5CPRB 2L9NA 3U9GA 1Z9CA 4A69C 2DJIA 1IRFA 3SEZA 4BH9A 3OYEA 5ILVA 3LQQA 3LA2A 5FFXA 3M7GA 5HNHA 4IHTA 3IC7A 3JTGA 3JSPA 5F0FA 5DD4A 5E3NA 3S1MJ 2DQRA 2X1EA 4DYCA 4PUSA 5BNGA 3DEEA 3DWLE 4IO9F 5EG0B 1GVDA 1ZARA 3E7LA 4BHBA 2OU2A 2CW8A 2V1XA 5IP7J 3NQOA 1FWZA 3AG1H 2OZUA 1SD7A 3VB2A 2KT0A 2L54A 2M1BA 1Z0XA 1WI3A 4N4NB 4E7ZA 2QENA 4M6YA 3IH4A 5J1UA 4E7KA 5IOZA 1YOVB 3OSFA 1S8NA 3HOSA 1WPKA 3RYPA 3HGGA 4R8HA 2LBFB 1QA6A 5AIPA 1ZELA 3HSFA 4MEXF 5J6XA 2HQ5A 2OUMA 2A61A 2QUFA 1LFBA 5HOOA 4HSTA 5B1BH 5LHHA 1OKRA 2TCTA 3KYDB 2KDOA 3BT9A 3NARA 4DGWB 1MSFC 2XF6A 2DBBA 3PO2J 2DDBA 1TLHB 2KJBA 1EKEA 4MQVA 4B8XA 1NK2P 2FBKA 1K6YA 4YELA 2MFZA 2WY7Q 3I54A 2HKXA 2R7FA 1YI2I 5LRSA 1D5YA 3LOCA 3KEOA 4B4CA 3HG9A 3D5RC 2LFBA 1R00A 3KX2A 2K5CA 3HTUA 1FMWA 1R5HA 2VC0A 1IRZA 5TISC 1G3TA 2CQKA 1FMVA 2EA2A 1T33A 2QF7A 3BWGA 4E70A 2R0QC 4FE4A 1IC8A 3FMQA 3PFIA 3G6EI 3DPLC 1BW5A 5M3FJ 4XRSA 3KCCA 1OYIA 2H09A 5J47A 4LIUA 4RA2A 2K85A 4U7BA 1T2KA 5F0CA 3TGNA 2XGXA 3GTOJ 1XCVA 4LMYA 5E79C 2OJED 1UHMA 3JRAA 3W2WA 2CQ7A 4RGSA 4Y15A 4RAGA 1SD5A 3TP3A 3WTZA 5FLMJ 3OYLA 4U7DA 4II2A 5HLGA 3FXMA 2E5NA 4YG2F 2K9SA 4UB8C 4I01A 5LEJA 2HQNA 3OIOA 5F1JA 2LY9A 3JAMZ 2IW5A 1DU6A 2M34A 3G4SI 2YU3A 1W0UA 3ZQLA 4O3MA 3JREA 2F5EA 2NVTJ 1LFPA 1VNDA 2BBYA 1SAXA 2CV1A 2FSWA 3A01B 2Y75A 2A69F 1MDMB 1NK3P 4F55A 4I0AA 2NS0A 5H6RA 2K7LA 4S04A 2VQCA 5IT9K 4IHVA 3GVAA 3GFIA 3CCYA 3BTJA 4D0PA 5E20A 2VKHA 3IAM2 1R1TA 5LEKA 3V7RA 1X1AA 1USSA 1E17A 4HSRA 5E3MA 3QP6A 4AVPA 5HLTA 3J81Z 5M5YJ 1SD6A 2EV0A 2H94A 3D1NI 3HDDA 3CMEI 3CP8A 4UHTA 1USTA 5EZHA 2F5CA 1F4KA 4F93B 1A35A 4NB5A 5DCFA 4UUSA 3OMYA 1W0TA 4KIFA 3QU3A 2HOTA 3TP0A 2DTRA 4BDYA 2R7XA 4RLQA 3S1RJ 5FRNA 2WADA 1QHHD 1U8BA 4RM2A 1YIJI 5KNLA 4JX4A 2QKLB 2BVLA 1AU7A 1RI7A 5DS9A 3ML6A 4BKXA 1X3WB 3GFMA 2FEZA 2L2OA 3N4MA 2E2IJ 4LLNA 2K27A 1TWAJ 1WJBA 1XDSA 1HOMA 1TNTA 1MMAA 2AQFA 4LITA 1RETA 5K5RA 4GYGA 3AFHA 2RN7A 3L9FA 4ABZA 2HTSA 4YRVA 4RGUA 2O61A 1QHGA 4K2EA 4NUBA 3HOZJ 3UKGA 2XC7A 3I71A 4C3HJ 2OQRA 1R1VA 3HXLA 1BJZA 1O3RA 3E5UA 3TOBA 4AYBA 4RGRA 2VT2A 2DA4A 2LKXA 2MD0A 4EVIA 2Y0SA 4CICA 1J9IA 3P9CA 2M7AA 2HKOA 1Z6RA 1VFCA 3IH2A 4G9YA 1D0ZA 1GV2A 1X3UA 4XK4A 4CUGA 3PIPF 2HOEA 3QYEA 1MGTA 1QO0D 3EDPA 1JTYA 1FSHA 1O3SA 3SZPA 5KCMA 4HYEA 2ZO4A 3MKLA 1IXSB 3HJEA 3PJRA 3W2AA 1FEXA 3NEUA 1E3HA 3CF2A 4ZYAA 4LLLA 5FKOA 2JTVA 4CYCB 3M3YJ 4EM2A 5GAEJ 1P7JA 2JMWA 5CVJA 3J7YJ 2M3AA 3OYBA 2M5WA 2DOFA 3A2KA 1E3PA 3CDLA 3F3XA 3GLXA 4B09A 1OPCA 1MJAA 3LSIA 2CS3A 2X6OA 4JK1X 2KIQA 4M3BA 2WAEA 1ZKGA 3QQAA 1MBGA 4XLPF 2UUZA 3CLOA 1BIAA 1KQ8A 4IVNA 1DPUA 4A93J 3F8BA 2MGQA 3K1NA 4CZZA 2Y0MA 3MWMA 3IV5A 3MN2A 5HS8A 4HX4A 2XSJC 1BIBA 1K4SA 2DJNA 5J1RA 2VODA 2V6CA 3DTEA 2DTZA 3CP2A 4XL9A 2J5PA 4J00A 4RB0A 3QPLA 2IS2A 2A5YB 3C7JA 3M1EA 2RNJA 1MNDA 1L3LA 1HC8A 2JPCA 5HDGA 5E8IA 3G71I 2R92J 1OCOH 4BACA 3Q9VA 3BR3A 3DBRB 2ZCWA 4QLCU 2HOAA 4PZJA 4CSWA 5C44J 2LNBA 2P5VA 3DKYA 1YS7A 3KEYA 4HW0A 1K61A 3F9KA 4RGXA 1U6GA 3SYTA 1ITYA 1WJEA 4BUPA 3QOEA 2DFHA 3LSMA 4JX6A 3H5RA 1I1GA 3E5XA 2PN6A 1FOYA 2MLGA 1X3ZB 3CUQA 3OV8A 1DGWY 2Y30A 2VQLA 4LIVA 4ZYEA 1PJRA 4YIIA 4UVCA 2ZSHB 2F48A 2OPTA 2M2EA 4IOAF 3BTLA 1SFEA 1UB9A 3GMEA 4CDGA 3IKTA 5HS7A 2W4SA 3OS1A 4I02A 4RS8A 3CTAA 1L0OC 5L3DA 1VQLI 1TZLA 1I39A 1F9NA 3QODA 2R7ZJ 2JSCA 5KHDA 3GZ6A 3TO9A 1PDNC 2GOXB 2XIGA 5FGMA 2F4IA 2X85A 4FASD 2DOEA 2F4MB 3FMSA 3VYUB 3BJAA 4EJWA 3TEDA 3COAC 2OV7A 5KVRA 4E6KG 3F8MA 1O7LA 4GXOA 2CH0A 3ISPA 1QVTA 3K4NA 4I99C 2ID3A 2CWEA 2KRHA 3E6DA 3I4NJ 4CO8A 5FJ8J 4V2FA 3H1CA 3SDGA 3HYIA 2HZTA 1HLVA 2W25A 1Y0NA 5B66C 5JVGF 1R4MB 3BDDA 4M3GA 2R5YB 2LREA 3I0TA 1V55H 4AWXB 1LEAA 6PAXA 3MKYB 2R3SA 3I9V2 4BQNA 2DW4A 3R61A 4LLGF 4RAZA 4C30A 1SEUA 2LD5A 2ZB9A 1H8AC 1I5ZA 4IHSA 3FIWA 2CYYA 2E1MB 3L2VA 2NOJB 1EV7A 1WVRA 2X4HA 3BTIA 1GLNA 3L09A 4Q47A 2DA5A 3H5NA 3WODF 1VQ6I 3U1KA 2DA3A 1FYLA 4AU7A 2PX9A 2VBZA 1APLC 2I10A 2XHKA 1ZQ3P 4XLEA 2O8XA 4AUXA 2YX4A 5DTDA 1B1BA 5LHGA 4XOTA 1VTNC 4MLOA 3JCUC 4PK4A 3L2CA 4A3GJ 4HAMA 2OCEA 4RAFA 1WJ5A 2GBYA 3BZKA 1JI8A 3EUHA 5FKNA 4HNUA 3WTTC 2E1MC 3BPVA 3CCUI 2A6TA 3SJMA 2HS5A 4BU2A 1IAWA 3FXUA 1RUNA 4CZCA 1FIAA 1N25A 2GIZA 4BEHB 3CJRB 2V9VA 4XRFA 1Z3XA 4MIMA 3DPUA 3WG9A 4CCNA 3OSGA 4IRHA 3O8HA 1D5VA 1B72B 3DF8A 1J0RA 4EJVA 5A2QK 4XKVA 2EFQA 4IEJA 4QPOA 1XX5A 2A68F 4ESFA 4D5CA 1PUFA 1HKSA 1XDUA 3TMOA 3I5UA 2HDWA 2E36A 1WJDA 3T8TA 4WK8F 3GTJJ 4AM3A 1T56A 3NRVA 2YSRA 2Z99A 1Q1VA 4KMFA 1H9GA 2ELHA 2QBYA 4QPQA 3FK7A 2VXDA 2IA2A 1D1CA 1HW1A 1IV6A 3TKYA 3TW6A 1MH4A 3L2UA 2KZGA 2PJRB 2VKDA 2ID6A 2ZJ2A 1FP2A 3DP7A 3RI4A 4KUMA 2NYXA 1UG2A 4LG0A 3BG6A 4HQMA 4LB6B 2RKHA 1ETOA 1P92A 3K1MA 3HRMA 1RUOA 4Q4ZF 3AG3H 2FBIA 2GAUA 1ENHA 1ULYA 1IUFA 3RQIA 2D2WA 1ZGAA 3S1QJ 1Z7UA 2VJJA 3K70C 1W7PD 4IRIA 2OBPA 1IN7A 1RR7A 4M74A 5GTIC 1QBJA 3EPZA 1KZHA 1WSUA 4ZYHA 3G73A 1GHCA 1Y8RB 1SANA 2HNHA 4BY7J 2E1OA 3Q9SA 3ZMSA 3DXJF 5F08A 3L00A 5EEHA 2PFBA 1GXQA 3H3ZA 4BXFA 4I7HA 2FX0A 3J80K 2D1HA 1VQ7I 3ZMDA 3B73A 3V7SA 3H9JA 2Y31A 2MBFA 3HRSA 5CKTA 2IGNA 1OJLA 3EETA 2Q0OA 3KP5A 4UVAA 4U0VA 1M1EB 4XSXF 1CGPA 1S7OA 3OYAA 3TDUC
chains in the Genus database with same CATH topology
1KU3A 1ODDA 2QM3A 3O2PE 1PP7U 1EH8A 3EQLF 1KA8A 3MEXA 3KFWX 1H9TA 3GUDA 2PMUA 5DUIA 3QP5A 5BPIA 2X0LA 4I09A 1YIOA 3T1BA 1XGOA 1SFUA 3ZMZA 2FOKA 5L3FA 1XSVA 4GYIA 2FQ3A 1S7AA 2VC1A 2R7DA 4Q5SF 2FXAA 3LAPA 5J8FA 2XAHA 2ZBKA 1XCBA 2M30A 2DU9A 3SFZA 5DCMB 1G3YA 1MD0A 1FOKA 1XGSA 1FPQA 2P5KA 5LLQA 2P8TA 3E3VA 1J2XA 4G7ZF 1U5TA 1D8KA 3P9KA 2XV4S 3WTYC 1B4AA 4BAYA 3KP6A 2XAJA 4HLYA 2RGVA 1LQ1A 4DQ2A 2UZKA 1R36A 3MQ0A 1O7FA 4ZH4F 3GXOA 3HTSB 4OIRF 3GF2A 3ABUA 1YTYA 3M8EA 2P6TA 4A0XA 3LA3A 1FLIA 1FX7A 4LK1F 2VOPA 4G94A 2PG4A 1I27A 3ZN1A 4AIHA 3B02A 4RB3C 3MAJA 3JAMK 3K69A 4PGHA 2E7XA 2C6YA 4IXAA 3E6BA 2V79A 4ENKA 3R0AA 5ICCA 4WF2A 1ZH5A 3QAHA 3VODA 5K5OA 5K5QA 3V8JA 1YW8A 2Z9OA 2VBXA 4KMUX 2WC2A 3EYYA 1UHWA 1U2WA 3IL2A 5LRRA 4A0ZA 4LJZF 1T0FA 2LKPA 5HDNA 2GWRA 3WTSC 1SMYF 2FE3A 1ONVA 5JFRA 5D5WB 4XLNF 3K9TA 3KE2A 3MCZA 4FHTA 1QGPA 4G8XA 3RPQA 4N9IA 1U78A 2QBYB 4HOBA 4F7ZA 2EB7A 1K79A 1JHFA 3FM5A 5FD5A 4O6JA 1DP7P 1AWCA 1OMIA 1ZG5A 1T38A 2K86A 3GO5A 1XSDA 1UCRA 3F6VA 1HW5A 4HF1A 2W57A 3GX4X 1W5TA 1R58A 1K78B 4KDPA 2COMA 4A6DA 1UFMA 3LSTA 2DPDA 2Q2EA 3OOPA 3TDZC 3O6BB 1T98A 3KLNA 2XROA 3S2WA 5A2QZ 2G7HA 4PCQA 1FC3A 5DEQA 2EK5A 3IRQA 3T8RA 1A04A 5D4SA 2YX7A 2L3DA 2W24A 3KP2A 4MTDA 1KU9A 3F8CA 3U1DA 3M8FA 2H6BA 2MC3A 1WKMA 4EMSA 1IN8A 2ISYA 3QRFF 2PLYA 3ROUA 1CF7B 1PUEE 2BV6A 4HQEA 1Q1HA 1J59A 3TO6A 2IJLA 2NRAC 1BI3A 2PQ8A 1IW7F 1Z6TA 4IJAA 2J5OA 5D8LB 3F72A 3VFZA 1MJ9A 3GYHX 4LK0F 3I58A 3KEQA 1S6LA 4HX7A 4ASNA 2DAOA 2NNYA 4Y13A 2HYFA 4HDVA 1YO5C 3U2RA 3DQVC 1T6SA 2P7CB 3K1PA 4KYWA 1WI9A 2O03A 2P5LC 1BI0A 2F5DA 4OIOF 3HIFA 1IXCA 2MA3A 5BOXA 1QPMA 2EV6A 2KRFA 2RQPA 3F22A 1B9NA 4KFCA 4R1HA 5DD8A 2JZYA 1P4AA 4ON0A 1U8RA 3I53A 1JHHA 4WWCA 4OINF 5JHUA 5F1RA 1WWXA 3KETA 1ZG1A 3JW4A 4PDKA 4HA8A 1P4WA 2RC4A 2LF7A 3MFKA 2PJPA 2P4WA 2WWYA 2XKPA 3WTXC 3H92A 1YQAA 3R60A 3ZMVA 1I6XA 1K6OA 2STWA 2OZ6A 2UXXA 2ZKZA 3FMRA 4PGGA 1BC7C 2DPUA 1XSXA 5ERIA 4HDUA 4CGZA 2JPBA 1IRGA 3FX3A 1BM9A 1V3FA 1U3EM 2FNPA 3LWFA 2VE9A 5L3GA 4N9HA 2HWVA 3T0YA 2VXZA 3RKXA 4YIFA 1KGSA 4HLXA 5CVUA 4JQFA 1JE8A 1W7PA 1EH6A 3ZQ7A 5ICFA 3ZMTA 3BOQA 2DK8A 1TW2A 2XAQA 2W84A 1YFHA 4OMYA 3HUGA 1XGMA 3W6JB 5D4RA 2EA4A 3HRTA 3N97A 4S05A 2DT5A 1D3YA 4CHUA 3LFKA 1V4RA 1Z91A 1FZPB 4A6EA 1E2XA 1XD7A 2ESHA 4M6XA 1OYWA 1PP8F 2V1UA 2EFWA 4OIPF 2KIFA 2RDPA 2L4AA 4P96A 4QWQA 2HR3A 5ILSA 2IA0A 3FXQA 3ULQB 3HHHA 4JBAA 1BJAA 5E1WA 4I0BA 3HRUA 4XBFA 4ZYGA 5CJ9A 1KU2A 5FLXK 2A3SA 4BHPA 2LSOA 1YW9A 2H27A 5BMZA 2H6CA 1IN6A 3DEUA 3M9AA 5FD6A 4L9JA 4WCGA 5LHIA 5D6EA 1I1SA 1SMTA 1YG2A 3CJNA 5HS9A 3ERED 2E7WA 2FRHA 1STZA 1HKTA 4Z2YA 5D6FA 2CW0F 5TRDA 2JRTA 5JVTA 5LGTA 4YFNF 4WXHA 2BYVE 4G6DA 3D5LA 3FHZA 3T5XA 1FBQA 1ZYRF 1REPC 2YPRA 3F8FA 5L3CA 3CDHA 3V8LA 2E1CA 4DNCA 4UVBA 2HQRA 1LDKB 1G3WA 2B0LA 1U5TC 2ETHA 3MZHA 4EJTA 4YFXF 1SFXA 2EFPA 4HX8A 3BPXA 4IF4A 3C3WA 1D8JA 4OIQF 2IA1A 3G3ZA 3R6SA 3SZTA 3REOA 2PBIA 2Z5UA 4CYDA 4BXUA 4L9NA 5DYMA 2EWNA 3BZ6A 1JGSA 4MNUA 3VOEA 4EV0A 2BE5F 4AIKA 2NAZA 3E6MA 4OOIA 1O3TA 5LGUA 4A5MA 4XSZF 2K4JA 2IVMA 2YR2A 3HSRA 1QZYA 2RV8A 5L3BA 1TQIA 3SQNA 3GFJA 3WU0A 4FX4A 4GGGA 1LB2A 3C18A 3L7WA 3RTRA 5FO5A 4HZFA 3HSEA 1KQ0A 4BQAA 4A2UA 1RIOH 2ZNZA 4KICA 3PQJA 1HQCA 2G9WA 3O3KA 4OU0A 1LJ9A 3I64A 3JSOA 3F8NA 2STTA 2ESNA 1ZAOA 3BJ6A 2IP2A 1MKMA 3WE2A 4MTEA 2GIVA 3IWFA 3WTVC 3KZZA 5D8KB 2UXNA 1WQ2A 2MLKA 2FNAA 2FBHA 2XAFA 1C0WA 4L5IA 2EFNA 2RVCA 3ECHA 1ZHFA 4OMZA 2EFOA 4EGZA 2GQQA 2GZWA 5BS6A 3HHGA 1FP1D 5E8GA 2DO7A 1FNNA 5EEGA 3CUOA 3IRRA 4CXFA 2ZMEB 5DUKA 1IZ1A 1BI2A 1IXRC 1R7JA 2QQBA 2KIMA 1FBSA 2VBYA 1G3SA 2F2EA 1FSEA 2DK5A 3FXRA 3P7NA 2L02A 5FFZA 4MEYF 2OD5A 3WGIA 1R22A 4UXNA 4AIJA 2FMLA 4L18B 5HLIA 4HV6A 4P5OA 2M45A 2FU4A 2FMYA 1FBUA 1IN5A 4KN7X 5L3EA 2CFXA 2TDXA 2P7VB 2MH9A 2ZNYA 2VONA 1W7PB 3SHFA 1HSJA 3QPHA 5J8CA 2HTJA 2WTEA 5E1XA 1AOYA 1XGNA 1P2FA 3LAJA 3D0SA 3IHUA 4GO1A 5ILUA 3WTUC 3QOPA 1ZREA 1HSTA 2XKOA 3ZP5A 1QZZA 1MZBA 3DFGA 4RAYA 3ZPLA 4ZZLA 4WX9A 1W5SA 5CVIA 4KA4A 4MHGA 4A12A 4R79A 3QPTA 2M87A 3CO7C 3DV8A 5LBQA 4EM0B 2ACJA 2UWMA 2CGPA 2ZXJA 2GA2A 2FF4A 3IWZA 2HDCA 1BBYA 4KIBA 3F23A 3FWEA 3LQRA 1DPRA 3RKWA 2XRNA 1XMAA 2Z33A 3DKWA 4WXDA 1WRJA 1RNLA 1J5YA 3C1DA 5F6FA 3RIRA 3V4GA 5BPDA 3ABTA 2AS5F 2KKOA 1FYKA 2A6EF 3GW2A 4KNYA 4UUVA 2VE8A 2MH2A 2HYGD 1HW2A 4GCVA 2E1NA 2VN2A 2A07F 2QVOA 2G7UA 1OYYA 1DDNA 2V1DA 2CG4A 1ZRCA 4LGWA 3CUQB 3KZYA 4FT8A 4IPAA 2MD5A 2D45A 4ENNA 4LB5A 2NNNA 3GZ5A 3VEPA 1R5GA 1S29A 2HEOA 4HF0A 1RZ4A 3KP3A 1ZLJA 1Y0UA 1TQPA 1ZN2A 2OQGA 4NHJA 5K1YA 4UV9A 5BQTA 3AAFA 1KU7A 1KYWA 1F5TA 5FB2A 4HV5A 1KQ9A 5CVVA 4RB2C 1T39A 1IN4A 3K0LA 2OA4A 3QU6A 4EM1A 2BEOA 4A0YA 2FA5A 3EYIA 3I59B 5AONA 5CYVA 4LFUA 1TNSA 4WXCA 3K2ZA 5JR3A 1JXSA 5DCMA 5KK1A 1IUYA 4KN4X 1EH7A 2XVCA 2XUBA 5HVQC 5ED4A 2CSOA 4L0ZB 1FYMA 4MQ9F 4BNCA 2DI3A 2Z3YA 1LEBA 2O3FA 3ZN0A 3TQNA 1GXPA 2CO5A 3R0JA 4P9UA 1B59A 3KP4A 3E6CC 1F1ZA 2VOOA 1SD4A 4Y17A 1BOAA 1G4DA 3TOAA 1BC8C 1FT9A 3P9IA 3J80Z 4EJUA 3E97A 2QLZA 2ISZA 1KYZA 1ZLKA 2ADUA 4Q48A 3E5QA 4ETSA 3BROA 1FY7A 3WTWC 5AIQA 1YLFA 1ZRDA 4MGRA 4M71A 4A5NA 2O0YA 5F64A 2P6SA 2QWWA 4L0YB 3DPTA 2QQAA 4M72A 4EQQA 5ICEA 1P6RA 2Y48A 2XASA 1LVAA 5E1ZB 1O3QA 2DLLA 4I2OA 4ESBA 4ENJA 1R1UA 1CF7A 5H6QA 4NQWA 3GFLA 3KP7A 4G6QA 1LDJA 3V7CA 3ZMUA 2HFHA 2KJCA 1YW7A 2LDUA 2DQLA 4ENMA 2EJRA 3WU1B 1Z1DA 4N0BA 2GXGA 2M8EA 3H3UA 1TQMA 4O5VA 3W6KB 3CUQC 1DUXC 1XB4A 4H0EA 2PI0A 5D5VB 3WGGA 1ON2A 2HGCA 2LF8A 3BY6A 4ZYDA 3RYRA 2QYOA 3WGHA 5IT9Z 3FZVA 4YFKF 4UV8A 1BN5A 1TBXA 1TW3A 1NHAA 1HKQA 2KIUA 3J81K 3Q5FA 5E18F 4ZZDA 3F6OA 3RJPA 2IRFG 5IT3A 1HBXG 4RB1A 1QNTA 1J75A 3RPUA 3J7AO 5LGNA 1R23A 3CO6C 1Z05A 5HLHA 5DV5A 3F21A 4L5JA 5CLSA 4IRGA 3FF5A 1MJBA 3I59A 4KT5C 5FLXZ 1XN7A 1YYVA 4U88A 3FM3A 4UNOA 5D5UB 4M73A 5E17F 3TO7A 5D5XB 1B6AA 1ON1A 2L01A 1HXDA 1ZG3A 1BI1A 4FX0A 2WV0A 3PQKA 2K4BA 3SXYA 1LDDA 3RDIA 3I4PA 2IT0A 2ZMEA 4LG0B 1ZRFA 4M9SA 2VT3A 4G7HF 4U0YA 4U0WA 1P4XA 3KLOA 2W85A 2ZFWA 3HOTA 4I98B 2D1VA 1OR7A 4BYYA 2JT1A 5TJJA 4KIGA 2PMHA 2EV5A 1XMKA 1IF1A 3V8KA 1ZGJA 3ELKA 4TV7A 3GWZA 3GEZA 2Q8KA 4AD9A 4EGYA 2L4MA 2OAZA 2GXBA 3JTHA 3R4KA 1LNWA 1B9MA 3BJOA 1S3JA 4L9VA 5ICGA 5HDKA 3ECOA 2XAGA 2A6HF 2O6GE 3BP8A 3MZYA 1H0MA 3RKYA 1QQIA 2BGCA 2VBWA 5DDGA 4M9ZA 2QQ9A 1K7AA 4HF2A 2F5FA 4LD5A 4HBLA 4EJOA 1U5TB 1GVJA 5JI6A 2AXLA 2QZ8A 3IKVA 1K78A 2GA1A 2DFIA 2K02A 2IPQX 5CVRA 3WE3A 5H20A 1YS6A 1O57A 4L9TA 1TTYA 4P55A 4P9FA 2PEXA 1J7KA 1MDMA 3LA7A 4M9XA 4BHCA 4G7OF 1W4MA 1G6NA 4ESJA 3U9GA 1Z9CA 1IRFA 4BH9A 5ILVA 3LQQA 3LA2A 5FFXA 3M7GA 4IHTA 3IC7A 3JTGA 3JSPA 5DD4A 2DQRA 1ZARA 4BHBA 2OU2A 2V1XA 3NQOA 1FWZA 2OZUA 1SD7A 3VB2A 2L54A 2M1BA 2QENA 4M6YA 1S8NA 3HOSA 3RYPA 4R8HA 5AIPA 3HSFA 4MEXF 5J6XA 2A61A 2QUFA 5HOOA 5LHHA 1OKRA 2DBBA 1TLHB 2KJBA 4MQVA 4B8XA 2FBKA 3I54A 2HKXA 2R7FA 5LRSA 3KEOA 1R00A 3HTUA 1R5HA 2VC0A 1G3TA 2CQKA 2EA2A 3BWGA 4E70A 3FMQA 3PFIA 3DPLC 3KCCA 1OYIA 2H09A 4U7BA 1T2KA 3TGNA 2XGXA 1XCVA 4LMYA 1UHMA 4RGSA 4Y15A 1SD5A 3WTZA 4U7DA 5HLGA 4YG2F 4I01A 5LEJA 2HQNA 3JAMZ 2IW5A 2YU3A 4O3MA 2F5EA 2BBYA 1SAXA 2FSWA 2Y75A 2A69F 1MDMB 4I0AA 2NS0A 5H6RA 2K7LA 4S04A 5IT9K 3GVAA 3GFIA 4D0PA 5E20A 1R1TA 5LEKA 3V7RA 1USSA 1E17A 3QP6A 4AVPA 3J81Z 1SD6A 2EV0A 2H94A 4UHTA 1USTA 2F5CA 1F4KA 4NB5A 5DCFA 4KIFA 3QU3A 2DTRA 1RI7A 3ML6A 3GFMA 2FEZA 3N4MA 4LLNA 2K27A 1XDSA 1TNTA 5K5RA 4GYGA 3L9FA 2RN7A 2HTSA 4RGUA 2O61A 4K2EA 3I71A 2OQRA 1R1VA 1O3RA 3E5UA 3TOBA 4RGRA 2VT2A 4EVIA 4CICA 1J9IA 3P9CA 2HKOA 1Z6RA 4G9YA 1X3UA 2HOEA 1MGTA 1QO0D 3EDPA 1FSHA 1O3SA 3SZPA 4HYEA 2ZO4A 1IXSB 3NEUA 4LLLA 2JTVA 4EM2A 5CVJA 2M5WA 3F3XA 3GLXA 4B09A 1OPCA 1MJAA 4JK1X 4XLPF 3CLOA 1BIAA 1KQ8A 4IVNA 1DPUA 3F8BA 3K1NA 4CZZA 2Y0MA 3MWMA 5HS8A 4HX4A 1BIBA 2VODA 2V6CA 2J5PA 4RB0A 2A5YB 3C7JA 3M1EA 2RNJA 1L3LA 2JPCA 5HDGA 5E8IA 3Q9VA 2ZCWA 4QLCU 4PZJA 2LNBA 2P5VA 4HW0A 1YS7A 4RGXA 1U6GA 1I1GA 3E5XA 2PN6A 2MLGA 3CUQA 3OV8A 4ZYEA 4YIIA 4UVCA 1SFEA 1UB9A 4CDGA 3IKTA 5HS7A 4I02A 4RS8A 3CTAA 1L0OC 5L3DA 1F9NA 2JSCA 3GZ6A 3TO9A 1PDNC 2XIGA 5FGMA 3FMSA 3BJAA 4EJWA 3COAC 5KVRA 3F8MA 1O7LA 4GXOA 3ISPA 2CWEA 3E6DA 4CO8A 3HYIA 2HZTA 2W25A 3BDDA 3I0TA 4AWXB 1LEAA 6PAXA 2R3SA 2DW4A 3R61A 4LLGF 4RAZA 1I5ZA 4IHSA 2CYYA 1EV7A 2X4HA 3L09A 4Q47A 3WODF 1FYLA 2VBZA 2XHKA 2O8XA 2YX4A 1B1BA 5LHGA 1VTNC 3L2CA 4HAMA 3EUHA 3WTTC 3BPVA 2HS5A 1IAWA 3FXUA 1RUNA 4XRFA 2V9VA 3WG9A 4IRHA 1D5VA 3DF8A 1J0RA 4EJVA 5A2QK 2EFQA 2A68F 4ESFA 1HKSA 1XDUA 3I5UA 4WK8F 3T8TA 3NRVA 2YSRA 2Z99A 4KMFA 1H9GA 2ELHA 2QBYA 2IA2A 1HW1A 3TKYA 2ZJ2A 1FP2A 3DP7A 3RI4A 4KUMA 2NYXA 4LG0A 4HQMA 4LB6B 2RKHA 1P92A 3K1MA 3HRMA 1RUOA 4Q4ZF 2FBIA 2GAUA 1ULYA 2D2WA 1ZGAA 1Z7UA 4IRIA 1W7PD 2OBPA 1IN7A 4M74A 1QBJA 1WSUA 4ZYHA 3G73A 1GHCA 3Q9SA 3ZMSA 3DXJF 3L00A 5EEHA 2PFBA 1GXQA 3H3ZA 4I7HA 3J80K 2D1HA 3ZMDA 3B73A 3V7SA 3HRSA 2MBFA 3EETA 2Q0OA 3KP5A 4UVAA 4U0VA 4XSXF 1CGPA 1S7OA 3TDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU3 A;  1ODD A;  2QM3 A;  3O2P E;  1PP7 U;  1EH8 A;  3EQL F;  1KA8 A;  3MEX A;  3KFW X;  1H9T A;  3GUD A;  2PMU A;  5DUI A;  3QP5 A;  5BPI A;  2X0L A;  4I09 A;  1YIO A;  3T1B A;  1XGO A;  1SFU A;  3ZMZ A;  2FOK A;  5L3F A;  1XSV A;  4GYI A;  2FQ3 A;  1S7A A;  2VC1 A;  2R7D A;  4Q5S F;  2FXA A;  3LAP A;  5J8F A;  2XAH A;  2ZBK A;  1XCB A;  2M30 A;  2DU9 A;  3SFZ A;  5DCM B;  1G3Y A;  1MD0 A;  1FOK A;  1XGS A;  1FPQ A;  2P5K A;  5LLQ A;  2P8T A;  3E3V A;  1J2X A;  4G7Z F;  1U5T A;  1D8K A;  3P9K A;  2XV4 S;  3WTY C;  1B4A A;  4BAY A;  3KP6 A;  2XAJ A;  4HLY A;  2RGV A;  1LQ1 A;  4DQ2 A;  2UZK A;  1R36 A;  3MQ0 A;  1O7F A;  4ZH4 F;  3GXO A;  3HTS B;  4OIR F;  3GF2 A;  3ABU A;  1YTY A;  3M8E A;  2P6T A;  4A0X A;  3LA3 A;  1FLI A;  1FX7 A;  4LK1 F;  2VOP A;  4G94 A;  2PG4 A;  1I27 A;  3ZN1 A;  4AIH A;  3B02 A;  4RB3 C;  3MAJ A;  3JAM K;  3K69 A;  4PGH A;  2E7X A;  2C6Y A;  4IXA A;  3E6B A;  2V79 A;  4ENK A;  3R0A A;  5ICC A;  4WF2 A;  1ZH5 A;  3QAH A;  3VOD A;  5K5O A;  5K5Q A;  3V8J A;  1YW8 A;  2Z9O A;  2VBX A;  4KMU X;  2WC2 A;  3EYY A;  1UHW A;  1U2W A;  3IL2 A;  5LRR A;  4A0Z A;  4LJZ F;  1T0F A;  2LKP A;  5HDN A;  2GWR A;  3WTS C;  1SMY F;  2FE3 A;  1ONV A;  5JFR A;  5D5W B;  4XLN F;  3K9T A;  3KE2 A;  3MCZ A;  4FHT A;  1QGP A;  4G8X A;  3RPQ A;  4N9I A;  1U78 A;  2QBY B;  4HOB A;  4F7Z A;  2EB7 A;  1K79 A;  1JHF A;  3FM5 A;  5FD5 A;  4O6J A;  1DP7 P;  1AWC A;  1OMI A;  1ZG5 A;  1T38 A;  2K86 A;  3GO5 A;  1XSD A;  1UCR A;  3F6V A;  1HW5 A;  4HF1 A;  2W57 A;  3GX4 X;  1W5T A;  1R58 A;  1K78 B;  4KDP A;  2COM A;  4A6D A;  1UFM A;  3LST A;  2DPD A;  2Q2E A;  3OOP A;  3TDZ C;  3O6B B;  1T98 A;  3KLN A;  2XRO A;  3S2W A;  5A2Q Z;  2G7H A;  4PCQ A;  1FC3 A;  5DEQ A;  2EK5 A;  3IRQ A;  3T8R A;  1A04 A;  5D4S A;  2YX7 A;  2L3D A;  2W24 A;  3KP2 A;  4MTD A;  1KU9 A;  3F8C A;  3U1D A;  3M8F A;  2H6B A;  2MC3 A;  1WKM A;  4EMS A;  1IN8 A;  2ISY A;  3QRF F;  2PLY A;  3ROU A;  1CF7 B;  1PUE E;  2BV6 A;  4HQE A;  1Q1H A;  1J59 A;  3TO6 A;  2IJL A;  2NRA C;  1BI3 A;  2PQ8 A;  1IW7 F;  1Z6T A;  4IJA A;  2J5O A;  5D8L B;  3F72 A;  3VFZ A;  1MJ9 A;  3GYH X;  4LK0 F;  3I58 A;  3KEQ A;  1S6L A;  4HX7 A;  4ASN A;  2DAO A;  2NNY A;  4Y13 A;  2HYF A;  4HDV A;  1YO5 C;  3U2R A;  3DQV C;  1T6S A;  2P7C B;  3K1P A;  4KYW A;  1WI9 A;  2O03 A;  2P5L C;  1BI0 A;  2F5D A;  4OIO F;  3HIF A;  1IXC A;  2MA3 A;  5BOX A;  1QPM A;  2EV6 A;  2KRF A;  2RQP A;  3F22 A;  1B9N A;  4KFC A;  4R1H A;  5DD8 A;  2JZY A;  1P4A A;  4ON0 A;  1U8R A;  3I53 A;  1JHH A;  4WWC A;  4OIN F;  5JHU A;  5F1R A;  1WWX A;  3KET A;  1ZG1 A;  3JW4 A;  4PDK A;  4HA8 A;  1P4W A;  2RC4 A;  2LF7 A;  3MFK A;  2PJP A;  2P4W A;  2WWY A;  2XKP A;  3WTX C;  3H92 A;  1YQA A;  3R60 A;  3ZMV A;  1I6X A;  1K6O A;  2STW A;  2OZ6 A;  2UXX A;  2ZKZ A;  3FMR A;  4PGG A;  1BC7 C;  2DPU A;  1XSX A;  5ERI A;  4HDU A;  4CGZ A;  2JPB A;  1IRG A;  3FX3 A;  1BM9 A;  1V3F A;  1U3E M;  2FNP A;  3LWF A;  2VE9 A;  5L3G A;  4N9H A;  2HWV A;  3T0Y A;  2VXZ A;  3RKX A;  4YIF A;  1KGS A;  4HLX A;  5CVU A;  4JQF A;  1JE8 A;  1W7P A;  1EH6 A;  3ZQ7 A;  5ICF A;  3ZMT A;  3BOQ A;  2DK8 A;  1TW2 A;  2XAQ A;  2W84 A;  1YFH A;  4OMY A;  3HUG A;  1XGM A;  3W6J B;  5D4R A;  2EA4 A;  3HRT A;  3N97 A;  4S05 A;  2DT5 A;  1D3Y A;  4CHU A;  3LFK A;  1V4R A;  1Z91 A;  1FZP B;  4A6E A;  1E2X A;  1XD7 A;  2ESH A;  4M6X A;  1OYW A;  1PP8 F;  2V1U A;  2EFW A;  4OIP F;  2KIF A;  2RDP A;  2L4A A;  4P96 A;  4QWQ A;  2HR3 A;  5ILS A;  2IA0 A;  3FXQ A;  3ULQ B;  3HHH A;  4JBA A;  1BJA A;  5E1W A;  4I0B A;  3HRU A;  4XBF A;  4ZYG A;  5CJ9 A;  1KU2 A;  5FLX K;  2A3S A;  4BHP A;  2LSO A;  1YW9 A;  2H27 A;  5BMZ A;  2H6C A;  1IN6 A;  3DEU A;  3M9A A;  5FD6 A;  4L9J A;  4WCG A;  5LHI A;  5D6E A;  1I1S A;  1SMT A;  1YG2 A;  3CJN A;  5HS9 A;  3ERE D;  2E7W A;  2FRH A;  1STZ A;  1HKT A;  4Z2Y A;  5D6F A;  2CW0 F;  5TRD A;  2JRT A;  5JVT A;  5LGT A;  4YFN F;  4WXH A;  2BYV E;  4G6D A;  3D5L A;  3FHZ A;  3T5X A;  1FBQ A;  1ZYR F;  1REP C;  2YPR A;  3F8F A;  5L3C A;  3CDH A;  3V8L A;  2E1C A;  4DNC A;  4UVB A;  2HQR A;  1LDK B;  1G3W A;  2B0L A;  1U5T C;  2ETH A;  3MZH A;  4EJT A;  4YFX F;  1SFX A;  2EFP A;  4HX8 A;  3BPX A;  4IF4 A;  3C3W A;  1D8J A;  4OIQ F;  2IA1 A;  3G3Z A;  3R6S A;  3SZT A;  3REO A;  2PBI A;  2Z5U A;  4CYD A;  4BXU A;  4L9N A;  5DYM A;  2EWN A;  3BZ6 A;  1JGS A;  4MNU A;  3VOE A;  4EV0 A;  2BE5 F;  4AIK A;  2NAZ A;  3E6M A;  4OOI A;  1O3T A;  5LGU A;  4A5M A;  4XSZ F;  2K4J A;  2IVM A;  2YR2 A;  3HSR A;  1QZY A;  2RV8 A;  5L3B A;  1TQI A;  3SQN A;  3GFJ A;  3WU0 A;  4FX4 A;  4GGG A;  1LB2 A;  3C18 A;  3L7W A;  3RTR A;  5FO5 A;  4HZF A;  3HSE A;  1KQ0 A;  4BQA A;  4A2U A;  1RIO H;  2ZNZ A;  4KIC A;  3PQJ A;  1HQC A;  2G9W A;  3O3K A;  4OU0 A;  1LJ9 A;  3I64 A;  3JSO A;  3F8N A;  2STT A;  2ESN A;  1ZAO A;  3BJ6 A;  2IP2 A;  1MKM A;  3WE2 A;  4MTE A;  2GIV A;  3IWF A;  3WTV C;  3KZZ A;  5D8K B;  2UXN A;  1WQ2 A;  2MLK A;  2FNA A;  2FBH A;  2XAF A;  1C0W A;  4L5I A;  2EFN A;  2RVC A;  3ECH A;  1ZHF A;  4OMZ A;  2EFO A;  4EGZ A;  2GQQ A;  2GZW A;  5BS6 A;  3HHG A;  1FP1 D;  5E8G A;  2DO7 A;  1FNN A;  5EEG A;  3CUO A;  3IRR A;  4CXF A;  2ZME B;  5DUK A;  1IZ1 A;  1BI2 A;  1IXR C;  1R7J A;  2QQB A;  2KIM A;  1FBS A;  2VBY A;  1G3S A;  2F2E A;  1FSE A;  2DK5 A;  3FXR A;  3P7N A;  2L02 A;  5FFZ A;  4MEY F;  2OD5 A;  3WGI A;  1R22 A;  4UXN A;  4AIJ A;  2FML A;  4L18 B;  5HLI A;  4HV6 A;  4P5O A;  2M45 A;  2FU4 A;  2FMY A;  1FBU A;  1IN5 A;  4KN7 X;  5L3E A;  2CFX A;  2TDX A;  2P7V B;  2MH9 A;  2ZNY A;  2VON A;  1W7P B;  3SHF A;  1HSJ A;  3QPH A;  5J8C A;  2HTJ A;  2WTE A;  5E1X A;  1AOY A;  1XGN A;  1P2F A;  3LAJ A;  3D0S A;  3IHU A;  4GO1 A;  5ILU A;  3WTU C;  3QOP A;  1ZRE A;  1HST A;  2XKO A;  3ZP5 A;  1QZZ A;  1MZB A;  3DFG A;  4RAY A;  3ZPL A;  4ZZL A;  4WX9 A;  1W5S A;  5CVI A;  4KA4 A;  4MHG A;  4A12 A;  4R79 A;  3QPT A;  2M87 A;  3CO7 C;  3DV8 A;  5LBQ A;  4EM0 B;  2ACJ A;  2UWM A;  2CGP A;  2ZXJ A;  2GA2 A;  2FF4 A;  3IWZ A;  2HDC A;  1BBY A;  4KIB A;  3F23 A;  3FWE A;  3LQR A;  1DPR A;  3RKW A;  2XRN A;  1XMA A;  2Z33 A;  3DKW A;  4WXD A;  1WRJ A;  1RNL A;  1J5Y A;  3C1D A;  5F6F A;  3RIR A;  3V4G A;  5BPD A;  3ABT A;  2AS5 F;  2KKO A;  1FYK A;  2A6E F;  3GW2 A;  4KNY A;  4UUV A;  2VE8 A;  2MH2 A;  2HYG D;  1HW2 A;  4GCV A;  2E1N A;  2VN2 A;  2A07 F;  2QVO A;  2G7U A;  1OYY A;  1DDN A;  2V1D A;  2CG4 A;  1ZRC A;  4LGW A;  3CUQ B;  3KZY A;  4FT8 A;  4IPA A;  2MD5 A;  2D45 A;  4ENN A;  4LB5 A;  2NNN A;  3GZ5 A;  3VEP A;  1R5G A;  1S29 A;  2HEO A;  4HF0 A;  1RZ4 A;  3KP3 A;  1ZLJ A;  1Y0U A;  1TQP A;  1ZN2 A;  2OQG A;  4NHJ A;  5K1Y A;  4UV9 A;  5BQT A;  3AAF A;  1KU7 A;  1KYW A;  1F5T A;  5FB2 A;  4HV5 A;  1KQ9 A;  5CVV A;  4RB2 C;  1T39 A;  1IN4 A;  3K0L A;  2OA4 A;  3QU6 A;  4EM1 A;  2BEO A;  4A0Y A;  2FA5 A;  3EYI A;  3I59 B;  5AON A;  5CYV A;  4LFU A;  1TNS A;  4WXC A;  3K2Z A;  5JR3 A;  1JXS A;  5DCM A;  5KK1 A;  1IUY A;  4KN4 X;  1EH7 A;  2XVC A;  2XUB A;  5HVQ C;  5ED4 A;  2CSO A;  4L0Z B;  1FYM A;  4MQ9 F;  4BNC A;  2DI3 A;  2Z3Y A;  1LEB A;  2O3F A;  3ZN0 A;  3TQN A;  1GXP A;  2CO5 A;  3R0J A;  4P9U A;  1B59 A;  3KP4 A;  3E6C C;  1F1Z A;  2VOO A;  1SD4 A;  4Y17 A;  1BOA A;  1G4D A;  3TOA A;  1BC8 C;  1FT9 A;  3P9I A;  3J80 Z;  4EJU A;  3E97 A;  2QLZ A;  2ISZ A;  1KYZ A;  1ZLK A;  2ADU A;  4Q48 A;  3E5Q A;  4ETS A;  3BRO A;  1FY7 A;  3WTW C;  5AIQ A;  1YLF A;  1ZRD A;  4MGR A;  4M71 A;  4A5N A;  2O0Y A;  5F64 A;  2P6S A;  2QWW A;  4L0Y B;  3DPT A;  2QQA A;  4M72 A;  4EQQ A;  5ICE A;  1P6R A;  2Y48 A;  2XAS A;  1LVA A;  5E1Z B;  1O3Q A;  2DLL A;  4I2O A;  4ESB A;  4ENJ A;  1R1U A;  1CF7 A;  5H6Q A;  4NQW A;  3GFL A;  3KP7 A;  4G6Q A;  1LDJ A;  3V7C A;  3ZMU A;  2HFH A;  2KJC A;  1YW7 A;  2LDU A;  2DQL A;  4ENM A;  2EJR A;  3WU1 B;  1Z1D A;  4N0B A;  2GXG A;  2M8E A;  3H3U A;  1TQM A;  4O5V A;  3W6K B;  3CUQ C;  1DUX C;  1XB4 A;  4H0E A;  2PI0 A;  5D5V B;  3WGG A;  1ON2 A;  2HGC A;  2LF8 A;  3BY6 A;  4ZYD A;  3RYR A;  2QYO A;  3WGH A;  5IT9 Z;  3FZV A;  4YFK F;  4UV8 A;  1BN5 A;  1TBX A;  1TW3 A;  1NHA A;  1HKQ A;  2KIU A;  3J81 K;  3Q5F A;  5E18 F;  4ZZD A;  3F6O A;  3RJP A;  2IRF G;  5IT3 A;  1HBX G;  4RB1 A;  1QNT A;  1J75 A;  3RPU A;  3J7A O;  5LGN A;  1R23 A;  3CO6 C;  1Z05 A;  5HLH A;  5DV5 A;  3F21 A;  4L5J A;  5CLS A;  4IRG A;  3FF5 A;  1MJB A;  3I59 A;  4KT5 C;  5FLX Z;  1XN7 A;  1YYV A;  4U88 A;  3FM3 A;  4UNO A;  5D5U B;  4M73 A;  5E17 F;  3TO7 A;  5D5X B;  1B6A A;  1ON1 A;  2L01 A;  1HXD A;  1ZG3 A;  1BI1 A;  4FX0 A;  2WV0 A;  3PQK A;  2K4B A;  3SXY A;  1LDD A;  3RDI A;  3I4P A;  2IT0 A;  2ZME A;  4LG0 B;  1ZRF A;  4M9S A;  2VT3 A;  4G7H F;  4U0Y A;  4U0W A;  1P4X A;  3KLO A;  2W85 A;  2ZFW A;  3HOT A;  4I98 B;  2D1V A;  1OR7 A;  4BYY A;  2JT1 A;  5TJJ A;  4KIG A;  2PMH A;  2EV5 A;  1XMK A;  1IF1 A;  3V8K A;  1ZGJ A;  3ELK A;  4TV7 A;  3GWZ A;  3GEZ A;  2Q8K A;  4AD9 A;  4EGY A;  2L4M A;  2OAZ A;  2GXB A;  3JTH A;  3R4K A;  1LNW A;  1B9M A;  3BJO A;  1S3J A;  4L9V A;  5ICG A;  5HDK A;  3ECO A;  2XAG A;  2A6H F;  2O6G E;  3BP8 A;  3MZY A;  1H0M A;  3RKY A;  1QQI A;  2BGC A;  2VBW A;  5DDG A;  4M9Z A;  2QQ9 A;  1K7A A;  4HF2 A;  2F5F A;  4LD5 A;  4HBL A;  4EJO A;  1U5T B;  1GVJ A;  5JI6 A;  2AXL A;  2QZ8 A;  3IKV A;  1K78 A;  2GA1 A;  2DFI A;  2K02 A;  2IPQ X;  5CVR A;  3WE3 A;  5H20 A;  1YS6 A;  1O57 A;  4L9T A;  1TTY A;  4P55 A;  4P9F A;  2PEX A;  1J7K A;  1MDM A;  3LA7 A;  4M9X A;  4BHC A;  4G7O F;  1W4M A;  1G6N A;  4ESJ A;  3U9G A;  1Z9C A;  1IRF A;  4BH9 A;  5ILV A;  3LQQ A;  3LA2 A;  5FFX A;  3M7G A;  4IHT A;  3IC7 A;  3JTG A;  3JSP A;  5DD4 A;  2DQR A;  1ZAR A;  4BHB A;  2OU2 A;  2V1X A;  3NQO A;  1FWZ A;  2OZU A;  1SD7 A;  3VB2 A;  2L54 A;  2M1B A;  2QEN A;  4M6Y A;  1S8N A;  3HOS A;  3RYP A;  4R8H A;  5AIP A;  3HSF A;  4MEX F;  5J6X A;  2A61 A;  2QUF A;  5HOO A;  5LHH A;  1OKR A;  2DBB A;  1TLH B;  2KJB A;  4MQV A;  4B8X A;  2FBK A;  3I54 A;  2HKX A;  2R7F A;  5LRS A;  3KEO A;  1R00 A;  3HTU A;  1R5H A;  2VC0 A;  1G3T A;  2CQK A;  2EA2 A;  3BWG A;  4E70 A;  3FMQ A;  3PFI A;  3DPL C;  3KCC A;  1OYI A;  2H09 A;  4U7B A;  1T2K A;  3TGN A;  2XGX A;  1XCV A;  4LMY A;  1UHM A;  4RGS A;  4Y15 A;  1SD5 A;  3WTZ A;  4U7D A;  5HLG A;  4YG2 F;  4I01 A;  5LEJ A;  2HQN A;  3JAM Z;  2IW5 A;  2YU3 A;  4O3M A;  2F5E A;  2BBY A;  1SAX A;  2FSW A;  2Y75 A;  2A69 F;  1MDM B;  4I0A A;  2NS0 A;  5H6R A;  2K7L A;  4S04 A;  5IT9 K;  3GVA A;  3GFI A;  4D0P A;  5E20 A;  1R1T A;  5LEK A;  3V7R A;  1USS A;  1E17 A;  3QP6 A;  4AVP A;  3J81 Z;  1SD6 A;  2EV0 A;  2H94 A;  4UHT A;  1UST A;  2F5C A;  1F4K A;  4NB5 A;  5DCF A;  4KIF A;  3QU3 A;  2DTR A;  1RI7 A;  3ML6 A;  3GFM A;  2FEZ A;  3N4M A;  4LLN A;  2K27 A;  1XDS A;  1TNT A;  5K5R A;  4GYG A;  3L9F A;  2RN7 A;  2HTS A;  4RGU A;  2O61 A;  4K2E A;  3I71 A;  2OQR A;  1R1V A;  1O3R A;  3E5U A;  3TOB A;  4RGR A;  2VT2 A;  4EVI A;  4CIC A;  1J9I A;  3P9C A;  2HKO A;  1Z6R A;  4G9Y A;  1X3U A;  2HOE A;  1MGT A;  1QO0 D;  3EDP A;  1FSH A;  1O3S A;  3SZP A;  4HYE A;  2ZO4 A;  1IXS B;  3NEU A;  4LLL A;  2JTV A;  4EM2 A;  5CVJ A;  2M5W A;  3F3X A;  3GLX A;  4B09 A;  1OPC A;  1MJA A;  4JK1 X;  4XLP F;  3CLO A;  1BIA A;  1KQ8 A;  4IVN A;  1DPU A;  3F8B A;  3K1N A;  4CZZ A;  2Y0M A;  3MWM A;  5HS8 A;  4HX4 A;  1BIB A;  2VOD A;  2V6C A;  2J5P A;  4RB0 A;  2A5Y B;  3C7J A;  3M1E A;  2RNJ A;  1L3L A;  2JPC A;  5HDG A;  5E8I A;  3Q9V A;  2ZCW A;  4QLC U;  4PZJ A;  2LNB A;  2P5V A;  4HW0 A;  1YS7 A;  4RGX A;  1U6G A;  1I1G A;  3E5X A;  2PN6 A;  2MLG A;  3CUQ A;  3OV8 A;  4ZYE A;  4YII A;  4UVC A;  1SFE A;  1UB9 A;  4CDG A;  3IKT A;  5HS7 A;  4I02 A;  4RS8 A;  3CTA A;  1L0O C;  5L3D A;  1F9N A;  2JSC A;  3GZ6 A;  3TO9 A;  1PDN C;  2XIG A;  5FGM A;  3FMS A;  3BJA A;  4EJW A;  3COA C;  5KVR A;  3F8M A;  1O7L A;  4GXO A;  3ISP A;  2CWE A;  3E6D A;  4CO8 A;  3HYI A;  2HZT A;  2W25 A;  3BDD A;  3I0T A;  4AWX B;  1LEA A;  6PAX A;  2R3S A;  2DW4 A;  3R61 A;  4LLG F;  4RAZ A;  1I5Z A;  4IHS A;  2CYY A;  1EV7 A;  2X4H A;  3L09 A;  4Q47 A;  3WOD F;  1FYL A;  2VBZ A;  2XHK A;  2O8X A;  2YX4 A;  1B1B A;  5LHG A;  1VTN C;  3L2C A;  4HAM A;  3EUH A;  3WTT C;  3BPV A;  2HS5 A;  1IAW A;  3FXU A;  1RUN A;  4XRF A;  2V9V A;  3WG9 A;  4IRH A;  1D5V A;  3DF8 A;  1J0R A;  4EJV A;  5A2Q K;  2EFQ A;  2A68 F;  4ESF A;  1HKS A;  1XDU A;  3I5U A;  4WK8 F;  3T8T A;  3NRV A;  2YSR A;  2Z99 A;  4KMF A;  1H9G A;  2ELH A;  2QBY A;  2IA2 A;  1HW1 A;  3TKY A;  2ZJ2 A;  1FP2 A;  3DP7 A;  3RI4 A;  4KUM A;  2NYX A;  4LG0 A;  4HQM A;  4LB6 B;  2RKH A;  1P92 A;  3K1M A;  3HRM A;  1RUO A;  4Q4Z F;  2FBI A;  2GAU A;  1ULY A;  2D2W A;  1ZGA A;  1Z7U A;  4IRI A;  1W7P D;  2OBP A;  1IN7 A;  4M74 A;  1QBJ A;  1WSU A;  4ZYH A;  3G73 A;  1GHC A;  3Q9S A;  3ZMS A;  3DXJ F;  3L00 A;  5EEH A;  2PFB A;  1GXQ A;  3H3Z A;  4I7H A;  3J80 K;  2D1H A;  3ZMD A;  3B73 A;  3V7S A;  3HRS A;  2MBF A;  3EET A;  2Q0O A;  3KP5 A;  4UVA A;  4U0V A;  4XSX F;  1CGP A;  1S7O A;  3TDU C; 
#chains in the Genus database with same CATH topology
 2XB0 X;  5GPC A;  1ZGW A;  1KU3 A;  1BR4 A;  3DBL B;  2FUG 2;  4X0G A;  1ODD A;  2R5Y A;  2QM3 A;  2KDZ A;  1AHD P;  3V42 A;  1Y6I A;  2W1O A;  3H3V K;  2LRD A;  2DOA A;  4GFB A;  3O2P E;  3PNV A;  1PP7 U;  4MFE A;  1EH8 A;  4NC6 A;  3EQL F;  4FQG A;  1KA8 A;  3MEX A;  3UR3 C;  3KFW X;  2P81 A;  1H9T A;  1JJ6 C;  3GUD A;  2QGU A;  2PMU A;  5DUI A;  3QP5 A;  5BPI A;  3U21 A;  1X19 A;  2V9P A;  4XMY A;  2X0L A;  3JRF A;  1GT0 C;  4I09 A;  4HNT A;  1VQN I;  1Z21 A;  1YIO A;  3EUK L;  3T1B A;  2LBF A;  2W00 A;  1XGO A;  1SFU A;  2WAF A;  4UUT A;  4XM3 A;  3ZMZ A;  2FOK A;  5L3F A;  2V1N A;  3VYT B;  1WGX A;  1XSV A;  3AL0 C;  3JRD A;  4GYI A;  1ETW A;  2IS6 A;  4HG2 A;  2DCE A;  2VQH A;  2FQ3 A;  1S7A A;  2VC1 A;  2R7D A;  3MKW B;  4Q5S F;  3SFI A;  2FXA A;  3N05 A;  3LAP A;  5J8F A;  2XAH A;  2GLO A;  3PNT A;  2ZBK A;  2EIK H;  1JUS A;  1WFX A;  1XCB A;  2M30 A;  2DU9 A;  2JN6 A;  1ZR4 A;  3SFZ A;  2AHQ A;  3CZ6 A;  5DCM B;  3CMY A;  1G3Y A;  1MD0 A;  1FOK A;  1POG A;  1XGS A;  4BY1 J;  1FPQ A;  2P5K A;  3Q0V A;  3WHB A;  5LLQ A;  2P8T A;  3AG4 H;  1MBJ A;  1V5F A;  3E3V A;  1J2X A;  2EZK A;  4G7Z F;  3LSH A;  2VAS A;  2Y9Z A;  1U5T A;  1R4N B;  2M0M A;  3ONQ A;  5JLW A;  1D8K A;  3P9K A;  4DIQ A;  2XV4 S;  3WTY C;  1B4A A;  4BAY A;  3KP6 A;  3OYG A;  1OCT C;  1ACI A;  2XAJ A;  4HLY A;  3ZR8 X;  2RGV A;  2KPM A;  1LQ1 A;  4DQ2 A;  3Q0W A;  2XB5 A;  1RKT A;  2UZK A;  1ZR2 A;  1R36 A;  3MQ0 A;  4ITV A;  4Y4R A;  2JVH A;  4DOZ A;  1EA3 A;  4IQ4 A;  3DU6 A;  1DU0 A;  4BDZ A;  1O7F A;  1RR8 C;  3DLA A;  4ZTJ A;  4ZH4 F;  3GXO A;  3HTS B;  4OIR F;  3GF2 A;  4M3D A;  1G59 A;  3ABU A;  4FIS A;  1YTY A;  3M8E A;  3EUH C;  1Y39 A;  2R93 J;  2P6T A;  4A0X A;  3LA3 A;  1FLI A;  1FX7 A;  3FHN A;  2EIL H;  4XLA A;  4LK1 F;  2VOP A;  4B3X A;  1ETK A;  3C2H A;  1X1C A;  4G94 A;  2PG4 A;  2ZJR F;  1I27 A;  1Z77 A;  1I6H J;  1HA8 A;  3CLQ A;  3ZN1 A;  4AIH A;  1R71 A;  2BHY A;  2XSD C;  3CJQ B;  3ASO H;  5EF6 A;  3GTG J;  2LK2 A;  5HOD A;  2QCO A;  3B02 A;  4RB3 C;  3MAJ A;  3JAM K;  2CMP A;  4FTH A;  3G1M A;  1NH3 A;  3MVP A;  3CMA I;  2QEX I;  3K69 A;  4ZDL A;  2PMZ N;  4PGH A;  2E7X A;  2C6Y A;  3FBI B;  4IXA A;  3E6B A;  2V79 A;  4ENK A;  3R0A A;  5ICC A;  3DEW A;  1YJN I;  3HOW J;  3BG5 A;  4WF2 A;  1ZH5 A;  5KAF C;  2M9H A;  3S16 J;  1A6I A;  3QAH A;  3VOD A;  2Y2Z A;  4X1E A;  5K5Q A;  5K5O A;  3V8J A;  3SZG A;  1YW8 A;  2Z9O A;  2VBX A;  3PSI A;  2WC2 A;  3LMM A;  4KMU X;  3EYY A;  2TRT A;  3SDB A;  5C4X J;  2CRG A;  1UHW A;  1U2W A;  3IL2 A;  5LRR A;  4A0Z A;  4PSX A;  1X4P A;  4LJZ F;  2L9V A;  4D5F A;  1SAU A;  2BVM A;  1PYV A;  3CCV I;  3KPH A;  3D5S C;  2HQA A;  1T0F A;  2LKP A;  5HDN A;  2GWR A;  3WTS C;  2VPR A;  3GTM J;  1SMY F;  1SVO A;  2FE3 A;  4E7J A;  2WAQ N;  5J4V A;  4IKF A;  2NXN B;  1ONV A;  3W2V A;  5JFR A;  5D5W B;  3BCB A;  3FXK A;  2HPM A;  4XLN F;  2HYJ A;  1MBF A;  4YIR X;  3K9T A;  4P1W A;  3KE2 A;  3MCZ A;  2DT6 A;  5M5W J;  4FHT A;  1QGP A;  2EPF A;  4G8X A;  3RPQ A;  1Z67 A;  4N9I A;  4NC7 A;  1U78 A;  2QBY B;  3CC2 I;  4HOB A;  2JSP A;  2ZC2 A;  3PIO F;  4B48 A;  4F7Z A;  1JKO C;  4RMN A;  2EB7 A;  2K9Q A;  5J3L A;  1K79 A;  1VZ0 A;  1JHF A;  2PJR A;  4NQW B;  1B72 A;  3FM5 A;  5FD5 A;  4O6J A;  2UV1 A;  1DP7 P;  1WHU A;  1AWC A;  1OMI A;  3S3M A;  1ZG5 A;  1T38 A;  4E7L A;  4XQF A;  2K86 A;  1B8I B;  3GO5 A;  3C2B A;  2W48 A;  1XSD A;  3M4O J;  4QTR A;  1MW7 A;  1UCR A;  2VLA A;  2FQ4 A;  3A0B C;  3CF5 F;  3FDY A;  2BOL A;  3F6V A;  1HW5 A;  2IGM A;  1JKP C;  2DN0 A;  4HF1 A;  4BS9 A;  4CCK A;  3RSN A;  1JJ8 C;  2W57 A;  2R7R A;  3GX4 X;  1W5T A;  1R58 A;  1KON A;  1K78 B;  4KDP A;  3ABM H;  2COM A;  2L7F P;  4A6D A;  3L2Q A;  1UFM A;  4BGD A;  4GRI A;  3LST A;  2DA7 A;  2EZL A;  2Q2E A;  2M7B A;  2NOG A;  3OOP A;  1ORK A;  2DPD A;  3TDZ C;  3O6B B;  1T98 A;  3KLN A;  1WJF A;  2XRO A;  3S2W A;  5A2Q Z;  3FXO A;  2G7H A;  4OWR B;  4PCQ A;  1FC3 A;  3BZC A;  5DEQ A;  4DBQ A;  1NG6 A;  3L2R A;  2EK5 A;  3IRQ A;  5FLV A;  1IRX A;  3T8R A;  3RZD J;  1A04 A;  5D4S A;  2YX7 A;  2L3D A;  2W24 A;  3KP2 A;  4MTD A;  4A3C J;  1KU9 A;  1YX3 A;  3BQY A;  1G2H A;  4A3E J;  2DT7 B;  3F8C A;  3U1D A;  1UHS A;  5J1Y A;  4M3F A;  5K7Z A;  3L2W A;  4A3D J;  3M8F A;  3SEQ A;  2H6B A;  2MC3 A;  2NVQ J;  1WKM A;  4EMS A;  1IN8 A;  2ISY A;  3QRF F;  2O9L A;  4JOM A;  2PLY A;  3ROU A;  1CF7 B;  1PUE E;  2BV6 A;  4HQE A;  1Q1H A;  3HC7 A;  1J59 A;  4AYB N;  2HXO A;  5CQE A;  3TO6 A;  2DMN A;  3A4C A;  2Y0S N;  2IJL A;  2NRA C;  2GOM A;  1BI3 A;  3CCQ I;  1AKH A;  1QZE A;  3ZCO A;  2L7M P;  2PQ8 A;  1OLT A;  1IW7 F;  1Z6T A;  3A02 A;  4IJA A;  4DYR A;  2J5O A;  5D8L B;  2HXI A;  1YE9 A;  4FCY A;  3ZQG A;  3F72 A;  4EAT A;  3VFZ A;  4KIT B;  5TGT A;  1MJ9 A;  3GYH X;  3CC4 I;  4LK0 F;  1A5J A;  2RAE A;  2XPV A;  4XKB A;  3I58 A;  2KMU A;  3KEQ A;  2JVG A;  1S6L A;  4HX7 A;  3OYK A;  2V7F A;  4ASN A;  2DAO A;  2NNY A;  3EUA A;  5EDN A;  4Y13 A;  2HYF A;  2OTJ I;  4HDV A;  5EYR A;  1MMN A;  1YO5 C;  1X1P A;  3U2R A;  2BXZ A;  3DQV C;  1T6S A;  1W36 D;  2P7C B;  1T8I A;  1N77 A;  3K1P A;  1UAA A;  4KYW A;  1WI9 A;  2O03 A;  2P5L C;  1BI0 A;  2F5D A;  1OQY A;  4BEH A;  2V6E A;  4OIO F;  3HIF A;  1IXC A;  4M6V A;  3W3C A;  4BE1 A;  2MA3 A;  4OAZ A;  3RCO A;  2OF7 A;  4ZDO A;  1OCZ H;  5JLX A;  5BOX A;  1QPM A;  2EV6 A;  1MNM C;  2DYR H;  2KRF A;  2RQP A;  2XGC A;  2R7Q A;  3F22 A;  1U9N A;  1B9N A;  4KFC A;  4AC0 A;  4PJJ A;  5DM6 F;  3RQ4 A;  1BA5 A;  4R1H A;  5DD8 A;  4Y52 J;  2ECB A;  2EQR A;  2JZY A;  3O8G A;  1P4A A;  4ON0 A;  1U8R A;  3S2H J;  3I53 A;  5IYC J;  2I5U A;  1JHH A;  4MO7 A;  1RRJ A;  1H88 C;  2EIM H;  4WWC A;  4OIN F;  5F1R A;  5JHU A;  3K7A J;  1WWX A;  1SFK A;  3KET A;  1ZG1 A;  3JW4 A;  4E7H A;  2DYS H;  4PDK A;  4HA8 A;  1WJC A;  2BW3 B;  1P4W A;  2RC4 A;  2W82 A;  2LF7 A;  3MFK A;  1MMD A;  1IDZ A;  2PJP A;  2H8W A;  4HPQ A;  3FKJ A;  1IG7 A;  5EEA A;  2LG4 A;  3BTC A;  1JTX A;  2P4W A;  5F0H A;  2XKP A;  3LSK A;  2WWY A;  2O8K A;  3WTX C;  3H92 A;  3OYN A;  1YQA A;  2LYC A;  3R60 A;  3ZMV A;  4OAY A;  5F04 A;  3S93 A;  3K4M A;  1I6X A;  1K6O A;  1OIS A;  2STW A;  3WU2 C;  2OZ6 A;  2UXX A;  4G6T B;  4XR6 A;  2ZKZ A;  1X2M A;  3DKX A;  3FMR A;  4NC8 A;  4PGG A;  3J7Z I;  1BC7 C;  1WJA A;  1U0J A;  1V5E A;  2DPU A;  2CUF A;  1XS9 A;  2IXS A;  1XSX A;  2LY1 A;  5ERI A;  4HDU A;  1S5L C;  2JPB A;  4CGZ A;  4B47 A;  3BR2 A;  1IRG A;  1FTZ A;  1N78 A;  4D9J A;  3FX3 A;  1BM9 A;  1V3F A;  4BBR J;  1U3E M;  2FNP A;  2OC6 A;  3LWF A;  2X51 A;  1SVL A;  4PJN A;  4LG3 A;  5F27 A;  5L3G A;  2VE9 A;  4N9H A;  2HWV A;  3T0Y A;  2VXZ A;  3RKX A;  3NWT A;  4YIF A;  1KGS A;  4HLX A;  3GLL A;  5CVU A;  2N8G A;  2E35 A;  3IUO A;  3X2Q H;  4JQF A;  1JE8 A;  3I4M J;  1W7P A;  1EH6 A;  3ZQ7 A;  2W7N A;  3BR1 A;  1X4O A;  2EZI A;  5ICF A;  3ZMT A;  4A3I J;  3BOQ A;  1A31 A;  1EF4 A;  2DK8 A;  3A1Y A;  1TW2 A;  2XAQ A;  4KT6 A;  2W84 A;  2XPU A;  3CCS I;  3HUG A;  1YFH A;  4OMY A;  1XGM A;  4RM3 A;  4H4K C;  3W6J B;  5D4R A;  4IOC F;  2F4O B;  2NVY J;  3ZQH A;  2EA4 A;  1Z3Y A;  1N75 A;  4CCM A;  3HRT A;  2Y9Y A;  3N97 A;  1MSE C;  3K6G A;  3GTP J;  4S05 A;  2DT5 A;  4D7M A;  1D3Y A;  3BCA A;  3LFK A;  4CHU A;  4BJT A;  3GTL J;  1V4R A;  1Z91 A;  1FZP B;  4A6E A;  3QYF A;  1E2X A;  4MFD A;  1LUJ B;  1E3O C;  1XD7 A;  2ESH A;  4M6X A;  3OY9 A;  1OYW A;  1PP8 F;  2V1U A;  2EFW A;  1VI0 A;  3S14 J;  4OIP F;  2KIF A;  2RDP A;  2L4A A;  4P96 A;  4QWQ A;  1VQO I;  2HR3 A;  2CQQ A;  5ILS A;  2IA0 A;  3FXQ A;  1Y56 A;  3ULQ B;  2R7T A;  5IP6 A;  1YJ9 I;  3HHH A;  4JBA A;  3K2A A;  1BJA A;  5E1W A;  1PUF B;  4I0B A;  3HRU A;  4F52 A;  3IP4 B;  3FBN B;  3H35 A;  3A01 A;  2IEK A;  4XBF A;  4ZYG A;  2BZT A;  1VQ8 I;  4ZJZ A;  2ICW G;  5CJ9 A;  3FKI J;  1KU2 A;  4A3M J;  5FLX K;  2VQG A;  4CYC A;  2A3S A;  4BHP A;  5LD2 C;  3AG2 H;  2EBI A;  2LSO A;  1YW9 A;  2H27 A;  5BMZ A;  3E1S A;  2H6C A;  3H9G A;  1IN6 A;  3DEU A;  3M9A A;  5FD6 A;  5KAI C;  4L9J A;  1T95 A;  3ZRG A;  4WCG A;  4D1Q A;  5LHI A;  5D6E A;  1MMS A;  1I1S A;  5IOY A;  1SMT A;  2JJ7 A;  4QSH A;  1YG2 A;  3B6A A;  3S3O A;  3CJN A;  1JT6 A;  1LE8 B;  2R5Z A;  2ELK A;  4XKW A;  5HS9 A;  3E0J B;  3BR0 A;  3ERE D;  2NVX J;  2L5Q A;  2DFE A;  2E7W A;  2FRH A;  3NAU A;  1STZ A;  2XDV A;  2VUM J;  1HKT A;  2K3P A;  4Z2Y A;  5D6F A;  2CW0 F;  1RKW A;  3BR6 A;  5TRD A;  2JRT A;  5JVT A;  2JQ7 A;  3ERM A;  2BHZ A;  2LOO A;  5LGT A;  5FKM A;  1MBH A;  4PFO A;  3OIP A;  4UB6 C;  1QPI A;  3OYM A;  1JT0 A;  3DTI A;  4YFN F;  5B5E C;  4WXH A;  2BYV E;  2PMZ A;  4G6D A;  3D5L A;  3FHZ A;  3T5X A;  2YUS A;  1FBQ A;  1ZYR F;  1REP C;  4Y33 A;  2YPR A;  2CFO A;  3F8F A;  4BQO A;  3FIS A;  1TT0 A;  5L3C A;  2HI3 A;  3CDH A;  3V8L A;  2RQQ A;  2E1C A;  4DNC A;  3Q3S A;  4UVB A;  2HQR A;  1LDK B;  2Z1D A;  1G3W A;  2B0L A;  1U5T C;  1ZK8 A;  3Q0U A;  3CQZ J;  2EIN H;  2ETH A;  3MZH A;  4EJT A;  4YFX F;  2MG4 A;  1O4X A;  3MD2 A;  4BXX J;  5FKK A;  3C2G A;  1SFX A;  4XOP A;  3QYB A;  2EFP A;  1Y1V J;  3WHC A;  3HUG B;  2L7K A;  3ZXS A;  4HX8 A;  1G8X A;  3BPX A;  2KHM A;  4IF4 A;  4IQJ A;  1TC3 C;  3S1N J;  3C3W A;  4QIW N;  1D8J A;  4OIQ F;  2KQR A;  2IA1 A;  2OCC H;  2QKM B;  3G3Z A;  3R6S A;  3SZT A;  1F36 A;  3REO A;  2PBI A;  5EJC A;  2Z5U A;  1J09 A;  2ZXH A;  4CYD A;  4BXU A;  4L9N A;  5DYM A;  2B9S A;  2EWN A;  3BZ6 A;  4RBO A;  1JGS A;  2MW8 A;  4MNU A;  3QPS A;  2Z2S B;  3BC8 A;  3PNY A;  1T0F C;  4S0H B;  3OR1 C;  4NDL A;  3VOE A;  2ME6 A;  4EV0 A;  2BE5 F;  5GP9 A;  4AIK A;  2OTL I;  2AQE A;  2NAZ A;  2ZFU A;  2BY2 A;  3E6M A;  4OOI A;  3VPR A;  3OWT A;  1O3T A;  4XN3 A;  5LGU A;  1FOX A;  3K4K A;  4KJZ A;  4A5M A;  4XSZ F;  2K4J A;  2IVM A;  2IS4 A;  2YR2 A;  3HSR A;  2IAI A;  1TWC J;  1QZY A;  3PSF A;  2RV8 A;  3H9Q A;  2CV0 A;  5FRM A;  2XF5 A;  2CJJ A;  5L3B A;  3W6V A;  1TQI A;  3SQN A;  3GFJ A;  3WU0 A;  4FX4 A;  4GGG A;  4I6Z A;  3C18 A;  3L7W A;  3RTR A;  1LB2 A;  2VKV A;  5FO5 A;  4HZF A;  1D0X A;  1D1A A;  4C2M J;  3HSE A;  2R7W A;  2HVR A;  3AL0 B;  3OYD A;  4D7N A;  1KQ0 A;  3PUF A;  4BL0 B;  2V4J C;  4BQA A;  4A2U A;  2DMP A;  4IZZ A;  1UZC A;  1TWG J;  3JRG A;  1RIO H;  5K7H A;  2ZNZ A;  4KIC A;  1RC9 A;  2X6W A;  4XID A;  3PQJ A;  2VIX A;  1HQC A;  2G9W A;  3O3K A;  2VKE A;  3M1C A;  3OOU A;  4OU0 A;  1LJ9 A;  4C3I J;  3I64 A;  3GZN B;  3JSO A;  3F8N A;  3WG7 H;  2STT A;  2ESN A;  1ZAO A;  1S9H A;  3BJ6 A;  4XRS G;  4DYQ A;  2IP2 A;  1MKM A;  2HU9 A;  3WE2 A;  4MTE A;  1ERD A;  2GIV A;  1GV5 A;  1PVE A;  3IWF A;  3WTV C;  1BL0 A;  3KZZ A;  4ZC3 A;  5D8K B;  2X6Y A;  3OYI A;  2R4G A;  2UXN A;  5IPA A;  1WQ2 A;  3A0H C;  2MLK A;  4Y3O A;  2FNA A;  2FBH A;  2H1K A;  3HL2 A;  2XAF A;  1C0W A;  4L5I A;  2EFN A;  2RVC A;  3ECH A;  3I3L A;  1ZHF A;  2KLO A;  2MAB A;  4OMZ A;  2EFO A;  3I55 I;  4EGZ A;  2GQQ A;  2GZW A;  5BS6 A;  1ZTR A;  3IH3 A;  3OL4 A;  3HHG A;  4XLC A;  1FP1 D;  2MC4 A;  2MSY A;  5E8G A;  2DO7 A;  1FNN A;  5JHF A;  5EEG A;  3CUO A;  3QWL A;  3VSL A;  1WH7 A;  5GAG J;  3IRR A;  1YJW I;  4CXF A;  1NG7 A;  2YS9 A;  1YRN B;  1I3Q J;  2ZME B;  3HBL A;  5DUK A;  1IZ1 A;  2WB1 N;  1JGG A;  3K4C A;  1A6Q A;  1BI2 A;  2ZSI B;  1IXR C;  1R7J A;  3MMY B;  5EG0 A;  2QQB A;  1D1B A;  2KIM A;  3HOX J;  1FBS A;  2M4K A;  2VBY A;  3RKQ A;  2VL8 A;  2VJ5 A;  1G3S A;  2F2E A;  2LP0 A;  4C2U A;  1FSE A;  3MZ8 A;  2DK5 A;  3FXR A;  3OYF A;  4RDU A;  2XF7 A;  2L7Z A;  1MMG A;  3P7N A;  4C3J J;  2L02 A;  3ESW B;  5FFZ A;  4MEY F;  2OD5 A;  3WGI A;  1X2N A;  3OYH A;  2BY0 A;  2WAQ A;  3VDX A;  1R22 A;  4UXN A;  1H89 C;  4AIJ A;  1LPQ A;  2X9D A;  2FML A;  4BQQ A;  2V26 A;  4L18 B;  5HLI A;  2KFD A;  4HV6 A;  4P5O A;  2M45 A;  2FU4 A;  2FMY A;  3HOY J;  2EH3 A;  2E5Z A;  1FBU A;  5LFA A;  1IN5 A;  2DFF A;  2KIS A;  3CJT B;  3HGY A;  4KN7 X;  3KZI C;  5L3E A;  2ZJP F;  2RRE A;  4DW6 A;  2CFX A;  2HDD A;  2TDX A;  3ASN H;  2P7V B;  1QU3 A;  2MH9 A;  2ZNY A;  3K10 A;  1W7P B;  3SHF A;  1V54 H;  2VON A;  1HSJ A;  2H8R A;  3QPH A;  3ZQC A;  5J8C A;  3DU5 A;  2HTJ A;  2WTE A;  5FKL A;  5HNF A;  2CUJ A;  3G1L A;  1T08 B;  5E1X A;  3ZQQ A;  1AOY A;  2LC2 A;  1XGN A;  4NNJ A;  1P2F A;  3HZJ A;  1TL8 A;  4A3K J;  3LAJ A;  2BXY A;  5J4Y A;  1SC7 A;  3D0S A;  3IHU A;  4E7I A;  4GO1 A;  5ILU A;  1V5G A;  3WTU C;  1GDT A;  3QOP A;  1XC5 A;  2K9L A;  4F91 B;  1ZRE A;  1HST A;  2XKO A;  3H0D A;  2VPL A;  3FXL A;  1WCM J;  3ZP5 A;  2JWT A;  1QZZ A;  1MZB A;  3DFG A;  4RAY A;  4AID A;  4A3F J;  3ZPL A;  4ZZL A;  4WX9 A;  3CCE I;  1LKX A;  1VQP I;  2HOS A;  1W5S A;  2O5R A;  3HEF A;  5CVI A;  3PFY A;  4MHG A;  4KA4 A;  4A12 A;  4R79 A;  1LE8 A;  3QPT A;  2M87 A;  1S7E A;  2DA1 A;  3DV8 A;  3CO7 C;  5M3M J;  1S72 I;  5LBQ A;  1W5C C;  2WBM A;  2JUG A;  4EM0 B;  4M3E A;  2ACJ A;  2UWM A;  4HEA 2;  3CMM A;  2CGP A;  2A05 A;  2GA2 A;  2ZXJ A;  2FF4 A;  3IWZ A;  4FET A;  2HDC A;  1P9Q C;  1BBY A;  3HB9 A;  4KIB A;  3LNQ A;  2CW7 A;  5EZG A;  2LH9 A;  3F23 A;  3FWE A;  3RZO J;  4XLH A;  3LQR A;  4CA0 A;  2R7U A;  3BR5 A;  2M0C A;  1RPW A;  1ETX A;  1DPR A;  3HKZ N;  2X6X A;  3TBI A;  3RKW A;  4DJA A;  2JA5 J;  1BR2 A;  2XRN A;  1TP4 A;  2XGE A;  2QSG X;  2CUZ A;  2VJI A;  1XMA A;  1ETV A;  2Z33 A;  3DKW A;  3IAS 2;  1TT5 B;  4WXD A;  5GAH J;  2X1D A;  1WRJ A;  1RNL A;  1RES A;  1J5Y A;  3C1D A;  5F6F A;  3RIR A;  3V4G A;  1MBK A;  5BPD A;  3ABT A;  2AS5 F;  2KKO A;  1FYK A;  2A6E F;  1JUP A;  1D0Y A;  3LFU A;  3HM5 A;  3LSR A;  1UG0 A;  3GW2 A;  4BE2 A;  4KNY A;  4IHY A;  3FK6 A;  4UUV A;  2VE8 A;  3CCJ I;  2MH2 A;  4F3Q A;  1VF9 A;  4E4H A;  2ZXI A;  3BG7 A;  2HYG D;  2IGK A;  3PL8 A;  2R7S A;  1HW2 A;  4FE7 A;  4GCV A;  2E1N A;  4Z6Y A;  2VN2 A;  1SFO J;  3ABL H;  2A07 F;  2QVO A;  2VB6 A;  3KYC B;  2G7U A;  1OYY A;  3B6C A;  1DDN A;  2V1D A;  2CG4 A;  1ZRC A;  1MH3 A;  4LGW A;  3CUQ B;  3KZY A;  4FT8 A;  4IPA A;  2MD5 A;  3DLL F;  2D45 A;  2ZME C;  4ENN A;  2CQN A;  2QSF X;  4LB5 A;  2NNN A;  1R5I D;  3GZ5 A;  3VEP A;  1R5G A;  1S29 A;  2HEO A;  3KIO A;  4AVZ A;  4HF0 A;  2M8G X;  1RZ4 A;  1I50 J;  3CCM I;  1HCR A;  4PJL A;  1GUU A;  1BOB A;  3KP3 A;  1ZLJ A;  3CES A;  1Y0U A;  1CQT A;  1TQP A;  3PM1 A;  1ZN2 A;  2L0K A;  2OQG A;  4NHJ A;  3LSG A;  5K1Y A;  1HDD C;  4UV9 A;  5BQT A;  3AAF A;  1KYW A;  1KU7 A;  1F5T A;  3M07 A;  5FB2 A;  4HV5 A;  1KQ9 A;  5CVV A;  4RB2 C;  1T39 A;  1IN4 A;  3TW7 A;  3K0L A;  2OA4 A;  3QU6 A;  2DMU A;  2RNG A;  4EM1 A;  1HF0 A;  2BEO A;  2CV2 A;  2GXA A;  4A0Y A;  2FA5 A;  4PJM A;  3EYI A;  3BLY A;  3I59 B;  4II3 A;  5AON A;  5CYV A;  4LFU A;  1TNS A;  4WXC A;  3K2Z A;  4B3A A;  3S17 J;  5JR3 A;  4F92 B;  2HPI A;  2X48 A;  1JXS A;  5CQG A;  4XOR A;  2WA0 A;  2XRL A;  3FXJ A;  5DCM A;  5KK1 A;  1IUY A;  1VQK I;  1YX5 A;  4KN4 X;  1EH7 A;  4BJ5 C;  2LKS A;  3HOU J;  2XVC A;  1K4T A;  1JKQ C;  2XUB A;  5HVQ C;  2FOW A;  2WY8 Q;  5ED4 A;  2CSO A;  1JKR C;  4L0Z B;  4CCO A;  2LVS A;  2NS8 A;  3OR2 C;  4XNF A;  1FYM A;  2V9K A;  4MQ9 F;  3CCL I;  4BNC A;  2DI3 A;  2Z3Y A;  3S15 J;  1LEB A;  2O3F A;  2WB1 A;  3ZN0 A;  2R5Z B;  3NWS A;  3TQN A;  1GXP A;  3K4L A;  5M5X J;  1X58 A;  4XN0 A;  2CUE A;  1OFC X;  4CCL A;  3KYL A;  1UEL B;  2CO5 A;  1TWH J;  3R0J A;  1VQ5 I;  4YEJ A;  4DZP A;  4P9U A;  5GPA A;  1B59 A;  3KP4 A;  1VQ9 I;  4NBQ A;  4B1R A;  3E6C C;  1F1Z A;  2E60 A;  2VOO A;  4N4O B;  1SD4 A;  4Y17 A;  1BOA A;  1G4D A;  4UUS B;  4C2T A;  3TOA A;  1SVM A;  1BC8 C;  2COB A;  1FT9 A;  3P9I A;  3J80 Z;  2KZV A;  3TL4 X;  3F0C A;  2CQX A;  3E97 A;  4EJU A;  2QLZ A;  2ISZ A;  1KYZ A;  1ZLK A;  2ADU A;  4IHW A;  3VWB A;  4Q48 A;  4V2G A;  3E5Q A;  4ETS A;  2Q1Z B;  1R49 A;  4GDF A;  1X1D A;  3G1O A;  3BRO A;  3HPG A;  3H36 A;  5H2F C;  1FY7 A;  3WTW C;  1VQM I;  5AIQ A;  1YLF A;  3L1P A;  2D5V A;  5GAD J;  1ZRD A;  4MGR A;  3LL7 A;  4M71 A;  4A5N A;  3GBG A;  4XON A;  1VQ4 I;  2O0Y A;  2M4G A;  5F64 A;  2P6S A;  2F5V A;  3GTQ J;  2QWW A;  4L0Y B;  3DPT A;  3S2D J;  5B3S H;  2QQA A;  4M72 A;  4EQQ A;  5ICE A;  1P6R A;  2BY1 A;  2FD5 A;  2Y48 A;  3H0G J;  4L5E A;  1FJL A;  5DM7 F;  2XAS A;  3ZQI A;  1LVA A;  4W1U A;  4HNV A;  4J19 A;  3G2B A;  3DTK A;  5E1Z B;  1O3Q A;  2DDA A;  2DLL A;  4I2O A;  4A3L J;  4ESB A;  3S8P A;  4ENJ A;  1R1U A;  1CF7 A;  5H6Q A;  2Y69 H;  4NQW A;  3GFL A;  3KP7 A;  4DBR A;  2DA6 A;  4G6Q A;  1LDJ A;  3V7C A;  2E34 A;  5E3L A;  2E2J J;  2LR8 A;  3ZMU A;  2HFH A;  3DCF A;  2KJC A;  1YW7 A;  2LDU A;  4J01 A;  4W97 A;  2DQL A;  2VJ4 A;  1U9O A;  2EZH A;  4ENM A;  2EJR A;  1HDP A;  3WU1 B;  2BY3 A;  1Z1D A;  2VI6 A;  1A36 A;  2NVU B;  1W36 C;  4N0B A;  5IYB J;  5GTH C;  2GXG A;  1MNE A;  2M8E A;  3H3U A;  1Y1W J;  1TQM A;  2DA2 A;  4O5V A;  3W6K B;  1XPX A;  2R7V A;  2LLK A;  3JRB A;  1F43 A;  3CUQ C;  4B43 A;  2ZJQ F;  1DUX C;  3K4J A;  4HRI A;  5IP9 J;  1XB4 A;  4H0E A;  2Q2E B;  2PI0 A;  4PFP A;  3WGG A;  5D5V B;  4IHX A;  1ON2 A;  2HGC A;  2LF8 A;  3BY6 A;  2ME0 A;  4XRM A;  4ZYD A;  1XTA A;  1AKH B;  3RYR A;  2QYO A;  3WGH A;  4BJ6 C;  5IT9 Z;  1Z7L A;  3FZV A;  2LTP A;  9ANT A;  2XAU A;  1K83 J;  4PJ0 C;  5C3E J;  2ECC A;  4YFK F;  1YIT I;  4UV8 A;  1BN5 A;  1TBX A;  1TW3 A;  1NHA A;  3OS0 A;  1HKQ A;  2KIU A;  3J81 K;  3PO3 J;  3Q5F A;  2IGO A;  4ZDP A;  3MKZ A;  4IL6 C;  3VYS B;  5E18 F;  3PUB A;  4I76 A;  2K9M A;  4ZZD A;  3F6O A;  3RJP A;  4KIS A;  2DXI A;  1XG1 A;  5IT3 A;  2IRF G;  1HBX G;  4JX5 A;  4RB1 A;  1QNT A;  1J75 A;  3GTK J;  1MIJ A;  3RPU A;  2L9R A;  1DQU A;  5LGN A;  3J7A O;  1R23 A;  4IX7 A;  3CO6 C;  4CH7 A;  2EIJ H;  1Z05 A;  5HLH A;  2GM4 A;  5DV5 A;  2DMQ A;  4EEF G;  2F6C A;  4CCJ A;  4Y7N J;  3F21 A;  4L5J A;  5J40 A;  4BBS J;  5CLS A;  1BR1 A;  3OYJ A;  3HPH A;  4IRG A;  3OYC A;  3FF5 A;  1MJB A;  3I59 A;  3P5J A;  4KT5 C;  5FLX Z;  4E7S A;  2O7O A;  1XN7 A;  4JP0 A;  1YYV A;  4U88 A;  3FM3 A;  2YU9 J;  1OR7 C;  2QA4 I;  4UNO A;  5D5U B;  2WV1 A;  4M73 A;  4B44 A;  5E17 F;  3AKZ A;  2NS7 A;  2B7E A;  3TO7 A;  3VSK A;  5D5X B;  1B6A A;  1IDY A;  1QRY A;  1YRN A;  1ON1 A;  2L01 A;  2B63 J;  2KRC A;  1HXD A;  5IYD J;  1NTC A;  4JYK A;  2JRM A;  1ZG3 A;  2X1C A;  2LY2 A;  3K4B A;  1BI1 A;  4FX0 A;  1FIP A;  2KL4 A;  4A3B J;  2JA2 A;  1EJ9 A;  2WV0 A;  5EGO A;  3PQK A;  2IS1 A;  1AA7 A;  1QVU A;  2K4B A;  1E0E A;  2HVQ A;  1LDD A;  3SXY A;  3RDI A;  2G0E A;  3I4P A;  4ZTF A;  2AXT C;  1B8I A;  2IT0 A;  2ZME A;  4LG0 B;  1UJ8 A;  1X1B A;  1P7I A;  2Z16 A;  1ZRF A;  4M9S A;  2MYS A;  2VT3 A;  3J7A Y;  2HZD A;  4G7H F;  4U0Y A;  3OS2 A;  1XMX A;  1UMQ A;  3A03 A;  4U0W A;  1TWF J;  1OCP A;  5FRO A;  1P4X A;  1LVK A;  1WZ2 A;  2DOD A;  3KLO A;  3ZOB A;  2W85 A;  2ZFW A;  2ZXW H;  3UNG C;  1YHQ I;  3CCR I;  3BQZ A;  3S32 A;  1ETQ A;  2K3F A;  2D1V A;  4I98 B;  4LOC A;  3HOT A;  1FTT A;  1JUM A;  1OR7 A;  4BYY A;  2JT1 A;  1FOW A;  2JA8 J;  5TJJ A;  3JR9 A;  3GCM A;  3LSJ A;  3I56 I;  4KIG A;  4XKC A;  2PMH A;  1OCR H;  1BW6 A;  2EV5 A;  3ABK H;  1XMK A;  4XIC A;  1R9T J;  1IF1 A;  4UY8 I;  3V8K A;  2QSH X;  1ZGJ A;  3JRC A;  3ELK A;  1Y8Q B;  2AO9 A;  4TV7 A;  4DZJ A;  2JA6 J;  3GWZ A;  3GEZ A;  2E71 A;  2Q8K A;  2XPW A;  4AD9 A;  3OL3 A;  4EGY A;  2A5W A;  2L4M A;  2H1L A;  2OAZ A;  3ZQF A;  5C4J J;  3RPU D;  2P0W A;  2GXB A;  3JTH A;  3S3N A;  1DP3 A;  2E19 A;  3R4K A;  1LNW A;  1B9M A;  2CU7 A;  3BJO A;  3BG3 A;  3HOV J;  1S3J A;  4L9V A;  1W1W E;  5ICG A;  5HDK A;  3ECO A;  2XAG A;  2A6H F;  2O6G E;  3OIQ A;  5IY5 H;  3BP8 A;  3MZY A;  1H0M A;  4XLF A;  3RKY A;  1QQI A;  2ELJ A;  2K40 A;  2BGC A;  2VBW A;  3M8J A;  2KP6 A;  4ANJ A;  3CC7 I;  4PSW A;  5DDG A;  2K9N A;  4M9Z A;  2QQ9 A;  4G12 A;  3BG9 A;  1K7A A;  1IO2 A;  2F5F A;  4HF2 A;  4LD5 A;  4A3J J;  1IV8 A;  4HBL A;  4RLF A;  2XGD A;  1MBE A;  2LMD A;  4EJO A;  1U5T B;  2R7O A;  1GVJ A;  3VYR B;  5JI6 A;  3JRH A;  2AXL A;  3DBH B;  2QZ8 A;  3IKV A;  5EGO B;  3JRI A;  3K70 D;  4C9Y A;  3LSP A;  1K78 A;  2GA1 A;  1WH5 A;  2JA7 J;  2DFI A;  2K02 A;  2IPQ X;  5CVR A;  3WE3 A;  2DMT A;  5B1A H;  5H20 A;  1YS6 A;  2BW3 A;  4U87 A;  1O57 A;  2IBD A;  3CDI A;  1R6R A;  4L9T A;  2FJ1 A;  1TTY A;  4P55 A;  1OCC H;  4P9F A;  1LFU P;  1DGR M;  3CD6 I;  2PEX A;  1J7K A;  1IJW C;  2E2H J;  2HVS A;  4V19 K;  5E3O A;  1I3A A;  2L9S A;  2I8D A;  3HKZ A;  1MDM A;  3LA7 A;  2JK3 A;  4X6A J;  4M9X A;  2JUC A;  4BHC A;  4G7O F;  2QQ8 A;  1W4M A;  1IGN A;  1ETY A;  5K7F A;  3H5A A;  1G6N A;  4ESJ A;  4BE0 A;  3ZGK A;  5CPR B;  2L9N A;  3U9G A;  1Z9C A;  4A69 C;  2DJI A;  1IRF A;  3SEZ A;  4BH9 A;  3OYE A;  5ILV A;  3LQQ A;  3LA2 A;  5FFX A;  3M7G A;  5HNH A;  4IHT A;  3IC7 A;  3JTG A;  3JSP A;  5F0F A;  5DD4 A;  5E3N A;  3S1M J;  2DQR A;  2X1E A;  4DYC A;  4PUS A;  5BNG A;  3DEE A;  3DWL E;  4IO9 F;  5EG0 B;  1GVD A;  1ZAR A;  3E7L A;  4BHB A;  2OU2 A;  2CW8 A;  2V1X A;  5IP7 J;  3NQO A;  1FWZ A;  3AG1 H;  2OZU A;  1SD7 A;  3VB2 A;  2KT0 A;  2L54 A;  2M1B A;  1Z0X A;  1WI3 A;  4N4N B;  4E7Z A;  2QEN A;  4M6Y A;  3IH4 A;  5J1U A;  4E7K A;  5IOZ A;  1YOV B;  3OSF A;  1S8N A;  3HOS A;  1WPK A;  3RYP A;  3HGG A;  4R8H A;  2LBF B;  1QA6 A;  5AIP A;  1ZEL A;  3HSF A;  4MEX F;  5J6X A;  2HQ5 A;  2OUM A;  2A61 A;  2QUF A;  1LFB A;  5HOO A;  4HST A;  5B1B H;  5LHH A;  1OKR A;  2TCT A;  3KYD B;  2KDO A;  3BT9 A;  3NAR A;  4DGW B;  1MSF C;  2XF6 A;  2DBB A;  3PO2 J;  2DDB A;  1TLH B;  2KJB A;  1EKE A;  4MQV A;  4B8X A;  1NK2 P;  2FBK A;  1K6Y A;  4YEL A;  2MFZ A;  2WY7 Q;  3I54 A;  2HKX A;  2R7F A;  1YI2 I;  5LRS A;  1D5Y A;  3LOC A;  3KEO A;  4B4C A;  3HG9 A;  3D5R C;  2LFB A;  1R00 A;  3KX2 A;  2K5C A;  3HTU A;  1FMW A;  1R5H A;  2VC0 A;  1IRZ A;  5TIS C;  1G3T A;  2CQK A;  1FMV A;  2EA2 A;  1T33 A;  2QF7 A;  3BWG A;  4E70 A;  2R0Q C;  4FE4 A;  1IC8 A;  3FMQ A;  3PFI A;  3G6E I;  3DPL C;  1BW5 A;  5M3F J;  4XRS A;  3KCC A;  1OYI A;  2H09 A;  5J47 A;  4LIU A;  4RA2 A;  2K85 A;  4U7B A;  1T2K A;  5F0C A;  3TGN A;  2XGX A;  3GTO J;  1XCV A;  4LMY A;  5E79 C;  2OJE D;  1UHM A;  3JRA A;  3W2W A;  2CQ7 A;  4RGS A;  4Y15 A;  4RAG A;  1SD5 A;  3TP3 A;  3WTZ A;  5FLM J;  3OYL A;  4U7D A;  4II2 A;  5HLG A;  3FXM A;  2E5N A;  4YG2 F;  2K9S A;  4UB8 C;  4I01 A;  5LEJ A;  2HQN A;  3OIO A;  5F1J A;  2LY9 A;  3JAM Z;  2IW5 A;  1DU6 A;  2M34 A;  3G4S I;  2YU3 A;  1W0U A;  3ZQL A;  4O3M A;  3JRE A;  2F5E A;  2NVT J;  1LFP A;  1VND A;  2BBY A;  1SAX A;  2CV1 A;  2FSW A;  3A01 B;  2Y75 A;  2A69 F;  1MDM B;  1NK3 P;  4F55 A;  4I0A A;  2NS0 A;  5H6R A;  2K7L A;  4S04 A;  2VQC A;  5IT9 K;  4IHV A;  3GVA A;  3GFI A;  3CCY A;  3BTJ A;  4D0P A;  5E20 A;  2VKH A;  3IAM 2;  1R1T A;  5LEK A;  3V7R A;  1X1A A;  1USS A;  1E17 A;  4HSR A;  5E3M A;  3QP6 A;  4AVP A;  5HLT A;  3J81 Z;  5M5Y J;  1SD6 A;  2EV0 A;  2H94 A;  3D1N I;  3HDD A;  3CME I;  3CP8 A;  4UHT A;  1UST A;  5EZH A;  2F5C A;  1F4K A;  4F93 B;  1A35 A;  4NB5 A;  5DCF A;  4UUS A;  3OMY A;  1W0T A;  4KIF A;  3QU3 A;  2HOT A;  3TP0 A;  2DTR A;  4BDY A;  2R7X A;  4RLQ A;  3S1R J;  5FRN A;  2WAD A;  1QHH D;  1U8B A;  4RM2 A;  1YIJ I;  5KNL A;  4JX4 A;  2QKL B;  2BVL A;  1AU7 A;  1RI7 A;  5DS9 A;  3ML6 A;  4BKX A;  1X3W B;  3GFM A;  2FEZ A;  2L2O A;  3N4M A;  2E2I J;  4LLN A;  2K27 A;  1TWA J;  1WJB A;  1XDS A;  1HOM A;  1TNT A;  1MMA A;  2AQF A;  4LIT A;  1RET A;  5K5R A;  4GYG A;  3AFH A;  2RN7 A;  3L9F A;  4ABZ A;  2HTS A;  4YRV A;  4RGU A;  2O61 A;  1QHG A;  4K2E A;  4NUB A;  3HOZ J;  3UKG A;  2XC7 A;  3I71 A;  4C3H J;  2OQR A;  1R1V A;  3HXL A;  1BJZ A;  1O3R A;  3E5U A;  3TOB A;  4AYB A;  4RGR A;  2VT2 A;  2DA4 A;  2LKX A;  2MD0 A;  4EVI A;  2Y0S A;  4CIC A;  1J9I A;  3P9C A;  2M7A A;  2HKO A;  1Z6R A;  1VFC A;  3IH2 A;  4G9Y A;  1D0Z A;  1GV2 A;  1X3U A;  4XK4 A;  4CUG A;  3PIP F;  2HOE A;  3QYE A;  1MGT A;  1QO0 D;  3EDP A;  1JTY A;  1FSH A;  1O3S A;  3SZP A;  5KCM A;  4HYE A;  2ZO4 A;  3MKL A;  1IXS B;  3HJE A;  3PJR A;  3W2A A;  1FEX A;  3NEU A;  1E3H A;  3CF2 A;  4ZYA A;  4LLL A;  5FKO A;  2JTV A;  4CYC B;  3M3Y J;  4EM2 A;  5GAE J;  1P7J A;  2JMW A;  5CVJ A;  3J7Y J;  2M3A A;  3OYB A;  2M5W A;  2DOF A;  3A2K A;  1E3P A;  3CDL A;  3F3X A;  3GLX A;  4B09 A;  1OPC A;  1MJA A;  3LSI A;  2CS3 A;  2X6O A;  4JK1 X;  2KIQ A;  4M3B A;  2WAE A;  1ZKG A;  3QQA A;  1MBG A;  4XLP F;  2UUZ A;  3CLO A;  1BIA A;  1KQ8 A;  4IVN A;  1DPU A;  4A93 J;  3F8B A;  2MGQ A;  3K1N A;  4CZZ A;  2Y0M A;  3MWM A;  3IV5 A;  3MN2 A;  5HS8 A;  4HX4 A;  2XSJ C;  1BIB A;  1K4S A;  2DJN A;  5J1R A;  2VOD A;  2V6C A;  3DTE A;  2DTZ A;  3CP2 A;  4XL9 A;  2J5P A;  4J00 A;  4RB0 A;  3QPL A;  2IS2 A;  2A5Y B;  3C7J A;  3M1E A;  2RNJ A;  1MND A;  1L3L A;  1HC8 A;  2JPC A;  5HDG A;  5E8I A;  3G71 I;  2R92 J;  1OCO H;  4BAC A;  3Q9V A;  3BR3 A;  3DBR B;  2ZCW A;  4QLC U;  2HOA A;  4PZJ A;  4CSW A;  5C44 J;  2LNB A;  2P5V A;  3DKY A;  1YS7 A;  3KEY A;  4HW0 A;  1K61 A;  3F9K A;  4RGX A;  1U6G A;  3SYT A;  1ITY A;  1WJE A;  4BUP A;  3QOE A;  2DFH A;  3LSM A;  4JX6 A;  3H5R A;  1I1G A;  3E5X A;  2PN6 A;  1FOY A;  2MLG A;  1X3Z B;  3CUQ A;  3OV8 A;  1DGW Y;  2Y30 A;  2VQL A;  4LIV A;  4ZYE A;  1PJR A;  4YII A;  4UVC A;  2ZSH B;  2F48 A;  2OPT A;  2M2E A;  4IOA F;  3BTL A;  1SFE A;  1UB9 A;  3GME A;  4CDG A;  3IKT A;  5HS7 A;  2W4S A;  3OS1 A;  4I02 A;  4RS8 A;  3CTA A;  1L0O C;  5L3D A;  1VQL I;  1TZL A;  1I39 A;  1F9N A;  3QOD A;  2R7Z J;  2JSC A;  5KHD A;  3GZ6 A;  3TO9 A;  1PDN C;  2GOX B;  2XIG A;  5FGM A;  2F4I A;  2X85 A;  4FAS D;  2DOE A;  2F4M B;  3FMS A;  3VYU B;  3BJA A;  4EJW A;  3TED A;  3COA C;  2OV7 A;  5KVR A;  4E6K G;  3F8M A;  1O7L A;  4GXO A;  2CH0 A;  3ISP A;  1QVT A;  3K4N A;  4I99 C;  2ID3 A;  2CWE A;  2KRH A;  3E6D A;  3I4N J;  4CO8 A;  5FJ8 J;  4V2F A;  3H1C A;  3SDG A;  3HYI A;  2HZT A;  1HLV A;  2W25 A;  1Y0N A;  5B66 C;  5JVG F;  1R4M B;  3BDD A;  4M3G A;  2R5Y B;  2LRE A;  3I0T A;  1V55 H;  4AWX B;  1LEA A;  6PAX A;  3MKY B;  2R3S A;  3I9V 2;  4BQN A;  2DW4 A;  3R61 A;  4LLG F;  4RAZ A;  4C30 A;  1SEU A;  2LD5 A;  2ZB9 A;  1H8A C;  1I5Z A;  4IHS A;  3FIW A;  2CYY A;  2E1M B;  3L2V A;  2NOJ B;  1EV7 A;  1WVR A;  2X4H A;  3BTI A;  1GLN A;  3L09 A;  4Q47 A;  2DA5 A;  3H5N A;  3WOD F;  1VQ6 I;  3U1K A;  2DA3 A;  1FYL A;  4AU7 A;  2PX9 A;  2VBZ A;  1APL C;  2I10 A;  2XHK A;  1ZQ3 P;  4XLE A;  2O8X A;  4AUX A;  2YX4 A;  5DTD A;  1B1B A;  5LHG A;  4XOT A;  1VTN C;  4MLO A;  3JCU C;  4PK4 A;  3L2C A;  4A3G J;  4HAM A;  2OCE A;  4RAF A;  1WJ5 A;  2GBY A;  3BZK A;  1JI8 A;  3EUH A;  5FKN A;  4HNU A;  3WTT C;  2E1M C;  3BPV A;  3CCU I;  2A6T A;  3SJM A;  2HS5 A;  4BU2 A;  1IAW A;  3FXU A;  1RUN A;  4CZC A;  1FIA A;  1N25 A;  2GIZ A;  4BEH B;  3CJR B;  2V9V A;  4XRF A;  1Z3X A;  4MIM A;  3DPU A;  3WG9 A;  4CCN A;  3OSG A;  4IRH A;  3O8H A;  1D5V A;  1B72 B;  3DF8 A;  1J0R A;  4EJV A;  5A2Q K;  4XKV A;  2EFQ A;  4IEJ A;  4QPO A;  1XX5 A;  2A68 F;  4ESF A;  4D5C A;  1PUF A;  1HKS A;  1XDU A;  3TMO A;  3I5U A;  2HDW A;  2E36 A;  1WJD A;  3T8T A;  4WK8 F;  3GTJ J;  4AM3 A;  1T56 A;  3NRV A;  2YSR A;  2Z99 A;  1Q1V A;  4KMF A;  1H9G A;  2ELH A;  2QBY A;  4QPQ A;  3FK7 A;  2VXD A;  2IA2 A;  1D1C A;  1HW1 A;  1IV6 A;  3TKY A;  3TW6 A;  1MH4 A;  3L2U A;  2KZG A;  2PJR B;  2VKD A;  2ID6 A;  2ZJ2 A;  1FP2 A;  3DP7 A;  3RI4 A;  4KUM A;  2NYX A;  1UG2 A;  4LG0 A;  3BG6 A;  4HQM A;  4LB6 B;  2RKH A;  1ETO A;  1P92 A;  3K1M A;  3HRM A;  1RUO A;  4Q4Z F;  3AG3 H;  2FBI A;  2GAU A;  1ENH A;  1ULY A;  1IUF A;  3RQI A;  2D2W A;  1ZGA A;  3S1Q J;  1Z7U A;  2VJJ A;  3K70 C;  1W7P D;  4IRI A;  2OBP A;  1IN7 A;  1RR7 A;  4M74 A;  5GTI C;  1QBJ A;  3EPZ A;  1KZH A;  1WSU A;  4ZYH A;  3G73 A;  1GHC A;  1Y8R B;  1SAN A;  2HNH A;  4BY7 J;  2E1O A;  3Q9S A;  3ZMS A;  3DXJ F;  5F08 A;  3L00 A;  5EEH A;  2PFB A;  1GXQ A;  3H3Z A;  4BXF A;  4I7H A;  2FX0 A;  3J80 K;  2D1H A;  1VQ7 I;  3ZMD A;  3B73 A;  3V7S A;  3H9J A;  2Y31 A;  2MBF A;  3HRS A;  5CKT A;  2IGN A;  1OJL A;  3EET A;  2Q0O A;  3KP5 A;  4UVA A;  4U0V A;  1M1E B;  4XSX F;  1CGP A;  1S7O A;  3OYA A;  3TDU C; 
#chains in the Genus database with same CATH homology
 1KU3 A;  1ODD A;  2QM3 A;  3O2P E;  1PP7 U;  1EH8 A;  3EQL F;  1KA8 A;  3MEX A;  3KFW X;  1H9T A;  3GUD A;  2PMU A;  5DUI A;  3QP5 A;  5BPI A;  2X0L A;  4I09 A;  1YIO A;  3T1B A;  1XGO A;  1SFU A;  3ZMZ A;  2FOK A;  5L3F A;  1XSV A;  4GYI A;  2FQ3 A;  1S7A A;  2VC1 A;  2R7D A;  4Q5S F;  2FXA A;  3LAP A;  5J8F A;  2XAH A;  2ZBK A;  1XCB A;  2M30 A;  2DU9 A;  3SFZ A;  5DCM B;  1G3Y A;  1MD0 A;  1FOK A;  1XGS A;  1FPQ A;  2P5K A;  5LLQ A;  2P8T A;  3E3V A;  1J2X A;  4G7Z F;  1U5T A;  1D8K A;  3P9K A;  2XV4 S;  3WTY C;  1B4A A;  4BAY A;  3KP6 A;  2XAJ A;  4HLY A;  2RGV A;  1LQ1 A;  4DQ2 A;  2UZK A;  1R36 A;  3MQ0 A;  1O7F A;  4ZH4 F;  3GXO A;  3HTS B;  4OIR F;  3GF2 A;  3ABU A;  1YTY A;  3M8E A;  2P6T A;  4A0X A;  3LA3 A;  1FLI A;  1FX7 A;  4LK1 F;  2VOP A;  4G94 A;  2PG4 A;  1I27 A;  3ZN1 A;  4AIH A;  3B02 A;  4RB3 C;  3MAJ A;  3JAM K;  3K69 A;  4PGH A;  2E7X A;  2C6Y A;  4IXA A;  3E6B A;  2V79 A;  4ENK A;  3R0A A;  5ICC A;  4WF2 A;  1ZH5 A;  3QAH A;  3VOD A;  5K5O A;  5K5Q A;  3V8J A;  1YW8 A;  2Z9O A;  2VBX A;  4KMU X;  2WC2 A;  3EYY A;  1UHW A;  1U2W A;  3IL2 A;  5LRR A;  4A0Z A;  4LJZ F;  1T0F A;  2LKP A;  5HDN A;  2GWR A;  3WTS C;  1SMY F;  2FE3 A;  1ONV A;  5JFR A;  5D5W B;  4XLN F;  3K9T A;  3KE2 A;  3MCZ A;  4FHT A;  1QGP A;  4G8X A;  3RPQ A;  4N9I A;  1U78 A;  2QBY B;  4HOB A;  4F7Z A;  2EB7 A;  1K79 A;  1JHF A;  3FM5 A;  5FD5 A;  4O6J A;  1DP7 P;  1AWC A;  1OMI A;  1ZG5 A;  1T38 A;  2K86 A;  3GO5 A;  1XSD A;  1UCR A;  3F6V A;  1HW5 A;  4HF1 A;  2W57 A;  3GX4 X;  1W5T A;  1R58 A;  1K78 B;  4KDP A;  2COM A;  4A6D A;  1UFM A;  3LST A;  2DPD A;  2Q2E A;  3OOP A;  3TDZ C;  3O6B B;  1T98 A;  3KLN A;  2XRO A;  3S2W A;  5A2Q Z;  2G7H A;  4PCQ A;  1FC3 A;  5DEQ A;  2EK5 A;  3IRQ A;  3T8R A;  1A04 A;  5D4S A;  2YX7 A;  2L3D A;  2W24 A;  3KP2 A;  4MTD A;  1KU9 A;  3F8C A;  3U1D A;  3M8F A;  2H6B A;  2MC3 A;  1WKM A;  4EMS A;  1IN8 A;  2ISY A;  3QRF F;  2PLY A;  3ROU A;  1CF7 B;  1PUE E;  2BV6 A;  4HQE A;  1Q1H A;  1J59 A;  3TO6 A;  2IJL A;  2NRA C;  1BI3 A;  2PQ8 A;  1IW7 F;  1Z6T A;  4IJA A;  2J5O A;  5D8L B;  3F72 A;  3VFZ A;  1MJ9 A;  3GYH X;  4LK0 F;  3I58 A;  3KEQ A;  1S6L A;  4HX7 A;  4ASN A;  2DAO A;  2NNY A;  4Y13 A;  2HYF A;  4HDV A;  1YO5 C;  3U2R A;  3DQV C;  1T6S A;  2P7C B;  3K1P A;  4KYW A;  1WI9 A;  2O03 A;  2P5L C;  1BI0 A;  2F5D A;  4OIO F;  3HIF A;  1IXC A;  2MA3 A;  5BOX A;  1QPM A;  2EV6 A;  2KRF A;  2RQP A;  3F22 A;  1B9N A;  4KFC A;  4R1H A;  5DD8 A;  2JZY A;  1P4A A;  4ON0 A;  1U8R A;  3I53 A;  1JHH A;  4WWC A;  4OIN F;  5JHU A;  5F1R A;  1WWX A;  3KET A;  1ZG1 A;  3JW4 A;  4PDK A;  4HA8 A;  1P4W A;  2RC4 A;  2LF7 A;  3MFK A;  2PJP A;  2P4W A;  2WWY A;  2XKP A;  3WTX C;  3H92 A;  1YQA A;  3R60 A;  3ZMV A;  1I6X A;  1K6O A;  2STW A;  2OZ6 A;  2UXX A;  2ZKZ A;  3FMR A;  4PGG A;  1BC7 C;  2DPU A;  1XSX A;  5ERI A;  4HDU A;  4CGZ A;  2JPB A;  1IRG A;  3FX3 A;  1BM9 A;  1V3F A;  1U3E M;  2FNP A;  3LWF A;  2VE9 A;  5L3G A;  4N9H A;  2HWV A;  3T0Y A;  2VXZ A;  3RKX A;  4YIF A;  1KGS A;  4HLX A;  5CVU A;  4JQF A;  1JE8 A;  1W7P A;  1EH6 A;  3ZQ7 A;  5ICF A;  3ZMT A;  3BOQ A;  2DK8 A;  1TW2 A;  2XAQ A;  2W84 A;  1YFH A;  4OMY A;  3HUG A;  1XGM A;  3W6J B;  5D4R A;  2EA4 A;  3HRT A;  3N97 A;  4S05 A;  2DT5 A;  1D3Y A;  4CHU A;  3LFK A;  1V4R A;  1Z91 A;  1FZP B;  4A6E A;  1E2X A;  1XD7 A;  2ESH A;  4M6X A;  1OYW A;  1PP8 F;  2V1U A;  2EFW A;  4OIP F;  2KIF A;  2RDP A;  2L4A A;  4P96 A;  4QWQ A;  2HR3 A;  5ILS A;  2IA0 A;  3FXQ A;  3ULQ B;  3HHH A;  4JBA A;  1BJA A;  5E1W A;  4I0B A;  3HRU A;  4XBF A;  4ZYG A;  5CJ9 A;  1KU2 A;  5FLX K;  2A3S A;  4BHP A;  2LSO A;  1YW9 A;  2H27 A;  5BMZ A;  2H6C A;  1IN6 A;  3DEU A;  3M9A A;  5FD6 A;  4L9J A;  4WCG A;  5LHI A;  5D6E A;  1I1S A;  1SMT A;  1YG2 A;  3CJN A;  5HS9 A;  3ERE D;  2E7W A;  2FRH A;  1STZ A;  1HKT A;  4Z2Y A;  5D6F A;  2CW0 F;  5TRD A;  2JRT A;  5JVT A;  5LGT A;  4YFN F;  4WXH A;  2BYV E;  4G6D A;  3D5L A;  3FHZ A;  3T5X A;  1FBQ A;  1ZYR F;  1REP C;  2YPR A;  3F8F A;  5L3C A;  3CDH A;  3V8L A;  2E1C A;  4DNC A;  4UVB A;  2HQR A;  1LDK B;  1G3W A;  2B0L A;  1U5T C;  2ETH A;  3MZH A;  4EJT A;  4YFX F;  1SFX A;  2EFP A;  4HX8 A;  3BPX A;  4IF4 A;  3C3W A;  1D8J A;  4OIQ F;  2IA1 A;  3G3Z A;  3R6S A;  3SZT A;  3REO A;  2PBI A;  2Z5U A;  4CYD A;  4BXU A;  4L9N A;  5DYM A;  2EWN A;  3BZ6 A;  1JGS A;  4MNU A;  3VOE A;  4EV0 A;  2BE5 F;  4AIK A;  2NAZ A;  3E6M A;  4OOI A;  1O3T A;  5LGU A;  4A5M A;  4XSZ F;  2K4J A;  2IVM A;  2YR2 A;  3HSR A;  1QZY A;  2RV8 A;  5L3B A;  1TQI A;  3SQN A;  3GFJ A;  3WU0 A;  4FX4 A;  4GGG A;  1LB2 A;  3C18 A;  3L7W A;  3RTR A;  5FO5 A;  4HZF A;  3HSE A;  1KQ0 A;  4BQA A;  4A2U A;  1RIO H;  2ZNZ A;  4KIC A;  3PQJ A;  1HQC A;  2G9W A;  3O3K A;  4OU0 A;  1LJ9 A;  3I64 A;  3JSO A;  3F8N A;  2STT A;  2ESN A;  1ZAO A;  3BJ6 A;  2IP2 A;  1MKM A;  3WE2 A;  4MTE A;  2GIV A;  3IWF A;  3WTV C;  3KZZ A;  5D8K B;  2UXN A;  1WQ2 A;  2MLK A;  2FNA A;  2FBH A;  2XAF A;  1C0W A;  4L5I A;  2EFN A;  2RVC A;  3ECH A;  1ZHF A;  4OMZ A;  2EFO A;  4EGZ A;  2GQQ A;  2GZW A;  5BS6 A;  3HHG A;  1FP1 D;  5E8G A;  2DO7 A;  1FNN A;  5EEG A;  3CUO A;  3IRR A;  4CXF A;  2ZME B;  5DUK A;  1IZ1 A;  1BI2 A;  1IXR C;  1R7J A;  2QQB A;  2KIM A;  1FBS A;  2VBY A;  1G3S A;  2F2E A;  1FSE A;  2DK5 A;  3FXR A;  3P7N A;  2L02 A;  5FFZ A;  4MEY F;  2OD5 A;  3WGI A;  1R22 A;  4UXN A;  4AIJ A;  2FML A;  4L18 B;  5HLI A;  4HV6 A;  4P5O A;  2M45 A;  2FU4 A;  2FMY A;  1FBU A;  1IN5 A;  4KN7 X;  5L3E A;  2CFX A;  2TDX A;  2P7V B;  2MH9 A;  2ZNY A;  2VON A;  1W7P B;  3SHF A;  1HSJ A;  3QPH A;  5J8C A;  2HTJ A;  2WTE A;  5E1X A;  1AOY A;  1XGN A;  1P2F A;  3LAJ A;  3D0S A;  3IHU A;  4GO1 A;  5ILU A;  3WTU C;  3QOP A;  1ZRE A;  1HST A;  2XKO A;  3ZP5 A;  1QZZ A;  1MZB A;  3DFG A;  4RAY A;  3ZPL A;  4ZZL A;  4WX9 A;  1W5S A;  5CVI A;  4KA4 A;  4MHG A;  4A12 A;  4R79 A;  3QPT A;  2M87 A;  3CO7 C;  3DV8 A;  5LBQ A;  4EM0 B;  2ACJ A;  2UWM A;  2CGP A;  2ZXJ A;  2GA2 A;  2FF4 A;  3IWZ A;  2HDC A;  1BBY A;  4KIB A;  3F23 A;  3FWE A;  3LQR A;  1DPR A;  3RKW A;  2XRN A;  1XMA A;  2Z33 A;  3DKW A;  4WXD A;  1WRJ A;  1RNL A;  1J5Y A;  3C1D A;  5F6F A;  3RIR A;  3V4G A;  5BPD A;  3ABT A;  2AS5 F;  2KKO A;  1FYK A;  2A6E F;  3GW2 A;  4KNY A;  4UUV A;  2VE8 A;  2MH2 A;  2HYG D;  1HW2 A;  4GCV A;  2E1N A;  2VN2 A;  2A07 F;  2QVO A;  2G7U A;  1OYY A;  1DDN A;  2V1D A;  2CG4 A;  1ZRC A;  4LGW A;  3CUQ B;  3KZY A;  4FT8 A;  4IPA A;  2MD5 A;  2D45 A;  4ENN A;  4LB5 A;  2NNN A;  3GZ5 A;  3VEP A;  1R5G A;  1S29 A;  2HEO A;  4HF0 A;  1RZ4 A;  3KP3 A;  1ZLJ A;  1Y0U A;  1TQP A;  1ZN2 A;  2OQG A;  4NHJ A;  5K1Y A;  4UV9 A;  5BQT A;  3AAF A;  1KU7 A;  1KYW A;  1F5T A;  5FB2 A;  4HV5 A;  1KQ9 A;  5CVV A;  4RB2 C;  1T39 A;  1IN4 A;  3K0L A;  2OA4 A;  3QU6 A;  4EM1 A;  2BEO A;  4A0Y A;  2FA5 A;  3EYI A;  3I59 B;  5AON A;  5CYV A;  4LFU A;  1TNS A;  4WXC A;  3K2Z A;  5JR3 A;  1JXS A;  5DCM A;  5KK1 A;  1IUY A;  4KN4 X;  1EH7 A;  2XVC A;  2XUB A;  5HVQ C;  5ED4 A;  2CSO A;  4L0Z B;  1FYM A;  4MQ9 F;  4BNC A;  2DI3 A;  2Z3Y A;  1LEB A;  2O3F A;  3ZN0 A;  3TQN A;  1GXP A;  2CO5 A;  3R0J A;  4P9U A;  1B59 A;  3KP4 A;  3E6C C;  1F1Z A;  2VOO A;  1SD4 A;  4Y17 A;  1BOA A;  1G4D A;  3TOA A;  1BC8 C;  1FT9 A;  3P9I A;  3J80 Z;  4EJU A;  3E97 A;  2QLZ A;  2ISZ A;  1KYZ A;  1ZLK A;  2ADU A;  4Q48 A;  3E5Q A;  4ETS A;  3BRO A;  1FY7 A;  3WTW C;  5AIQ A;  1YLF A;  1ZRD A;  4MGR A;  4M71 A;  4A5N A;  2O0Y A;  5F64 A;  2P6S A;  2QWW A;  4L0Y B;  3DPT A;  2QQA A;  4M72 A;  4EQQ A;  5ICE A;  1P6R A;  2Y48 A;  2XAS A;  1LVA A;  5E1Z B;  1O3Q A;  2DLL A;  4I2O A;  4ESB A;  4ENJ A;  1R1U A;  1CF7 A;  5H6Q A;  4NQW A;  3GFL A;  3KP7 A;  4G6Q A;  1LDJ A;  3V7C A;  3ZMU A;  2HFH A;  2KJC A;  1YW7 A;  2LDU A;  2DQL A;  4ENM A;  2EJR A;  3WU1 B;  1Z1D A;  4N0B A;  2GXG A;  2M8E A;  3H3U A;  1TQM A;  4O5V A;  3W6K B;  3CUQ C;  1DUX C;  1XB4 A;  4H0E A;  2PI0 A;  5D5V B;  3WGG A;  1ON2 A;  2HGC A;  2LF8 A;  3BY6 A;  4ZYD A;  3RYR A;  2QYO A;  3WGH A;  5IT9 Z;  3FZV A;  4YFK F;  4UV8 A;  1BN5 A;  1TBX A;  1TW3 A;  1NHA A;  1HKQ A;  2KIU A;  3J81 K;  3Q5F A;  5E18 F;  4ZZD A;  3F6O A;  3RJP A;  2IRF G;  5IT3 A;  1HBX G;  4RB1 A;  1QNT A;  1J75 A;  3RPU A;  3J7A O;  5LGN A;  1R23 A;  3CO6 C;  1Z05 A;  5HLH A;  5DV5 A;  3F21 A;  4L5J A;  5CLS A;  4IRG A;  3FF5 A;  1MJB A;  3I59 A;  4KT5 C;  5FLX Z;  1XN7 A;  1YYV A;  4U88 A;  3FM3 A;  4UNO A;  5D5U B;  4M73 A;  5E17 F;  3TO7 A;  5D5X B;  1B6A A;  1ON1 A;  2L01 A;  1HXD A;  1ZG3 A;  1BI1 A;  4FX0 A;  2WV0 A;  3PQK A;  2K4B A;  3SXY A;  1LDD A;  3RDI A;  3I4P A;  2IT0 A;  2ZME A;  4LG0 B;  1ZRF A;  4M9S A;  2VT3 A;  4G7H F;  4U0Y A;  4U0W A;  1P4X A;  3KLO A;  2W85 A;  2ZFW A;  3HOT A;  4I98 B;  2D1V A;  1OR7 A;  4BYY A;  2JT1 A;  5TJJ A;  4KIG A;  2PMH A;  2EV5 A;  1XMK A;  1IF1 A;  3V8K A;  1ZGJ A;  3ELK A;  4TV7 A;  3GWZ A;  3GEZ A;  2Q8K A;  4AD9 A;  4EGY A;  2L4M A;  2OAZ A;  2GXB A;  3JTH A;  3R4K A;  1LNW A;  1B9M A;  3BJO A;  1S3J A;  4L9V A;  5ICG A;  5HDK A;  3ECO A;  2XAG A;  2A6H F;  2O6G E;  3BP8 A;  3MZY A;  1H0M A;  3RKY A;  1QQI A;  2BGC A;  2VBW A;  5DDG A;  4M9Z A;  2QQ9 A;  1K7A A;  4HF2 A;  2F5F A;  4LD5 A;  4HBL A;  4EJO A;  1U5T B;  1GVJ A;  5JI6 A;  2AXL A;  2QZ8 A;  3IKV A;  1K78 A;  2GA1 A;  2DFI A;  2K02 A;  2IPQ X;  5CVR A;  3WE3 A;  5H20 A;  1YS6 A;  1O57 A;  4L9T A;  1TTY A;  4P55 A;  4P9F A;  2PEX A;  1J7K A;  1MDM A;  3LA7 A;  4M9X A;  4BHC A;  4G7O F;  1W4M A;  1G6N A;  4ESJ A;  3U9G A;  1Z9C A;  1IRF A;  4BH9 A;  5ILV A;  3LQQ A;  3LA2 A;  5FFX A;  3M7G A;  4IHT A;  3IC7 A;  3JTG A;  3JSP A;  5DD4 A;  2DQR A;  1ZAR A;  4BHB A;  2OU2 A;  2V1X A;  3NQO A;  1FWZ A;  2OZU A;  1SD7 A;  3VB2 A;  2L54 A;  2M1B A;  2QEN A;  4M6Y A;  1S8N A;  3HOS A;  3RYP A;  4R8H A;  5AIP A;  3HSF A;  4MEX F;  5J6X A;  2A61 A;  2QUF A;  5HOO A;  5LHH A;  1OKR A;  2DBB A;  1TLH B;  2KJB A;  4MQV A;  4B8X A;  2FBK A;  3I54 A;  2HKX A;  2R7F A;  5LRS A;  3KEO A;  1R00 A;  3HTU A;  1R5H A;  2VC0 A;  1G3T A;  2CQK A;  2EA2 A;  3BWG A;  4E70 A;  3FMQ A;  3PFI A;  3DPL C;  3KCC A;  1OYI A;  2H09 A;  4U7B A;  1T2K A;  3TGN A;  2XGX A;  1XCV A;  4LMY A;  1UHM A;  4RGS A;  4Y15 A;  1SD5 A;  3WTZ A;  4U7D A;  5HLG A;  4YG2 F;  4I01 A;  5LEJ A;  2HQN A;  3JAM Z;  2IW5 A;  2YU3 A;  4O3M A;  2F5E A;  2BBY A;  1SAX A;  2FSW A;  2Y75 A;  2A69 F;  1MDM B;  4I0A A;  2NS0 A;  5H6R A;  2K7L A;  4S04 A;  5IT9 K;  3GVA A;  3GFI A;  4D0P A;  5E20 A;  1R1T A;  5LEK A;  3V7R A;  1USS A;  1E17 A;  3QP6 A;  4AVP A;  3J81 Z;  1SD6 A;  2EV0 A;  2H94 A;  4UHT A;  1UST A;  2F5C A;  1F4K A;  4NB5 A;  5DCF A;  4KIF A;  3QU3 A;  2DTR A;  1RI7 A;  3ML6 A;  3GFM A;  2FEZ A;  3N4M A;  4LLN A;  2K27 A;  1XDS A;  1TNT A;  5K5R A;  4GYG A;  3L9F A;  2RN7 A;  2HTS A;  4RGU A;  2O61 A;  4K2E A;  3I71 A;  2OQR A;  1R1V A;  1O3R A;  3E5U A;  3TOB A;  4RGR A;  2VT2 A;  4EVI A;  4CIC A;  1J9I A;  3P9C A;  2HKO A;  1Z6R A;  4G9Y A;  1X3U A;  2HOE A;  1MGT A;  1QO0 D;  3EDP A;  1FSH A;  1O3S A;  3SZP A;  4HYE A;  2ZO4 A;  1IXS B;  3NEU A;  4LLL A;  2JTV A;  4EM2 A;  5CVJ A;  2M5W A;  3F3X A;  3GLX A;  4B09 A;  1OPC A;  1MJA A;  4JK1 X;  4XLP F;  3CLO A;  1BIA A;  1KQ8 A;  4IVN A;  1DPU A;  3F8B A;  3K1N A;  4CZZ A;  2Y0M A;  3MWM A;  5HS8 A;  4HX4 A;  1BIB A;  2VOD A;  2V6C A;  2J5P A;  4RB0 A;  2A5Y B;  3C7J A;  3M1E A;  2RNJ A;  1L3L A;  2JPC A;  5HDG A;  5E8I A;  3Q9V A;  2ZCW A;  4QLC U;  4PZJ A;  2LNB A;  2P5V A;  4HW0 A;  1YS7 A;  4RGX A;  1U6G A;  1I1G A;  3E5X A;  2PN6 A;  2MLG A;  3CUQ A;  3OV8 A;  4ZYE A;  4YII A;  4UVC A;  1SFE A;  1UB9 A;  4CDG A;  3IKT A;  5HS7 A;  4I02 A;  4RS8 A;  3CTA A;  1L0O C;  5L3D A;  1F9N A;  2JSC A;  3GZ6 A;  3TO9 A;  1PDN C;  2XIG A;  5FGM A;  3FMS A;  3BJA A;  4EJW A;  3COA C;  5KVR A;  3F8M A;  1O7L A;  4GXO A;  3ISP A;  2CWE A;  3E6D A;  4CO8 A;  3HYI A;  2HZT A;  2W25 A;  3BDD A;  3I0T A;  4AWX B;  1LEA A;  6PAX A;  2R3S A;  2DW4 A;  3R61 A;  4LLG F;  4RAZ A;  1I5Z A;  4IHS A;  2CYY A;  1EV7 A;  2X4H A;  3L09 A;  4Q47 A;  3WOD F;  1FYL A;  2VBZ A;  2XHK A;  2O8X A;  2YX4 A;  1B1B A;  5LHG A;  1VTN C;  3L2C A;  4HAM A;  3EUH A;  3WTT C;  3BPV A;  2HS5 A;  1IAW A;  3FXU A;  1RUN A;  4XRF A;  2V9V A;  3WG9 A;  4IRH A;  1D5V A;  3DF8 A;  1J0R A;  4EJV A;  5A2Q K;  2EFQ A;  2A68 F;  4ESF A;  1HKS A;  1XDU A;  3I5U A;  4WK8 F;  3T8T A;  3NRV A;  2YSR A;  2Z99 A;  4KMF A;  1H9G A;  2ELH A;  2QBY A;  2IA2 A;  1HW1 A;  3TKY A;  2ZJ2 A;  1FP2 A;  3DP7 A;  3RI4 A;  4KUM A;  2NYX A;  4LG0 A;  4HQM A;  4LB6 B;  2RKH A;  1P92 A;  3K1M A;  3HRM A;  1RUO A;  4Q4Z F;  2FBI A;  2GAU A;  1ULY A;  2D2W A;  1ZGA A;  1Z7U A;  4IRI A;  1W7P D;  2OBP A;  1IN7 A;  4M74 A;  1QBJ A;  1WSU A;  4ZYH A;  3G73 A;  1GHC A;  3Q9S A;  3ZMS A;  3DXJ F;  3L00 A;  5EEH A;  2PFB A;  1GXQ A;  3H3Z A;  4I7H A;  3J80 K;  2D1H A;  3ZMD A;  3B73 A;  3V7S A;  3HRS A;  2MBF A;  3EET A;  2Q0O A;  3KP5 A;  4UVA A;  4U0V A;  4XSX F;  1CGP A;  1S7O A;  3TDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...