1GXPA

Phob effector domain in complex with pho box dna.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
AVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tandem DNA Recognition by Two-Component Signal Transduction Transcriptional Activator Phob
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcriptional activator
molecule keywords PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN
total genus 22
structure length 103
sequence length 103
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1gxpA00
4XSXF 2PI0A 4KDPA 5FLXK 4LFUA 4U0VA 3TKYA 3QU6A 1U5TA 5AIPA 1PUEE 3E5UA 1K78A 2HQNA 3HOTA 1F9NA 3C18A 3EUHA 2IJLA 2V6CA 2OQRA 5D5VB 1QGPA 2FBKA 3F8MA 2Q0OA 5D8KB 3JW4A 1J9IA 3KEQA 2HTSA 4KT5C 4KYWA 4R1HA 4BYYA 3ABTA 1TLHB 1R00A 4RGRA 1HBXG 3FM5A 4RB2C 2ZXJA 2A3SA 1XB4A 2BYVE 2VC0A 4Q47A 3I58A 3CDHA 2Z5UA 5LEJA 2STTA 4RGUA 4YIIA 1G3TA 3ZMUA 4KIBA 4LGWA 1MGTA 1EH6A 2LF7A 1YW7A 2VXZA 1KGSA 4KIFA 3MWMA 4DQ2A 4I2OA 4ENKA 1XMKA 2L4AA 2X0LA 4BH9A 1GHCA 1G4DA 3GFJA 4Q4ZF 2ISZA 5LEKA 4KMFA 1TBXA 1JGSA 1LEAA 4XSZF 3C3WA 4E70A 2QUFA 1U2WA 2YR2A 2OBPA 4U7BA 3ZMZA 1Y0UA 2QM3A 5JFRA 4IF4A 1EH8A 1IXSB 3BPXA 2TDXA 3H3ZA 1Z91A 3SXYA 1MDMB 3CUOA 3DPLC 2EFPA 1KU9A 4HX8A 2V9VA 2O8XA 2HKOA 2FRHA 1T6SA 3F8BA 1O7FA 3U2RA 2IPQX 4FT8A 2WV0A 2Z3YA 1I1SA 1GXPA 4ESJA 2OA4A 5FO5A 1XGNA 3FX3A 2JPCA 2IT0A 5DD4A 3V8KA 2RKHA 1Z1DA 2XAHA 1ZLJA 2OZUA 1HW2A 2A68F 1HKSA 2Z99A 2L01A 2IP2A 2LF8A 5CVUA 2F5DA 4YG2F 1WWXA 4I0BA 4P5OA 2HGCA 4HBLA 3WG9A 1YW9A 2HWVA 1ZH5A 1BBYA 4IRIA 3H3UA 2O6GE 1VTNC 2A69F 2Z9OA 2ZJ2A 5LLQA 1FPQA 4ENNA 1WSUA 5HOOA 3GEZA 2XAFA 3TOBA 3F3XA 5J6XA 4Y13A 1XCVA 3E5XA 2P5LC 3VFZA 2DK8A 4R79A 1LNWA 1ZG3A 3HTSB 3J80Z 5DCMB 1P92A 2JTVA 4BQAA 1ZLKA 2EFWA 3M8FA 5DCMA 4CHUA 1C0WA 5LGNA 1FLIA 5ILSA 3CLOA 1HQCA 4LJZF 1ZG5A 2E1CA 4OIPF 5K5OA 2EV6A 4IJAA 2IRFG 2VBZA 2KKOA 2RGVA 4WWCA 1L0OC 2UXXA 3KP4A 2PEXA 5ICFA 1O3QA 2VBYA 3H92A 5DD8A 2EFQA 1X3UA 2XGXA 1YO5C 2BV6A 1FC3A 1OPCA 1FWZA 4CZZA 5F6FA 1BIBA 2FE3A 3Q5FA 5JR3A 2CSOA 1MJAA 1IN7A 4HV6A 4QWQA 1TW2A 3FF5A 2MLGA 1OKRA 1FZPB 4GYIA 1ZGAA 3F22A 3KP5A 1JHFA 1XSXA 1U8RA 3E6CC 1YS7A 3L09A 3I4PA 1S6LA 1T0FA 4OINF 4ZYHA 4I02A 1P6RA 3DFGA 3M7GA 2ELHA 3ML6A 2RC4A 3RYRA 2FNAA 1XGMA 2H09A 5L3CA 4LK1F 2C6YA 4AD9A 4NB5A 4UHTA 4UVBA 1SMTA 3TOAA 4RGSA 1F4KA 5CVRA 1LDDA 4M73A 4KFCA 2IA0A 3GX4X 1K6OA 2JZYA 5ED4A 3R6SA 2EJRA 4P9FA 4RAZA 2RN7A 3GVAA 5D6FA 1D8JA 4IVNA 2Z33A 2HR3A 3IWFA 3KLNA 3O2PE 3TQNA 4A12A 4LMYA 1B9MA 3TO9A 1QNTA 2PQ8A 3HUGA 4O6JA 2Q8KA 5FFXA 4HZFA 5ICGA 2GQQA 1HKTA 5BPDA 3KZZA 2UZKA 4UUVA 2DT5A 1OYIA 1LB2A 4L0YB 4O3MA 3KP6A 1H9TA 3DPTA 4N9HA 2A07F 5LHGA 3W6JB 4CXFA 1XGSA 4O5VA 2NNNA 3K69A 5D4RA 2MA3A 2CG4A 3B73A 3ZMSA 4HQMA 2EK5A 1O3TA 2KRFA 4LD5A 3LFKA 2VE9A 3CUQB 3RPQA 5AONA 2NS0A 5FFZA 4HW0A 3F8NA 3F8FA 1R1UA 1LDKB 2ESHA 3B02A 5L3FA 5D5WB 1IN4A 2M1BA 5E8GA 4IHTA 2Y0MA 1W7PD 4UXNA 1FBUA 5E18F 1PP7U 4L9JA 2M30A 1RUOA 2VC1A 2XAGA 3C7JA 1J75A 4KN7X 4L5JA 1Z6TA 3TO7A 2GZWA 2OQGA 1USSA 4PZJA 5D5XB 2E7WA 2KIUA 3CTAA 1U78A 3I64A 1J7KA 4ENMA 2K4JA 1BI1A 2ZMEB 5L3GA 3FXRA 4KICA 3HHGA 4LLLA 3R4KA 5BMZA 3TDUC 4AIKA 4WF2A 4I0AA 2ZMEA 5DUIA 1OYYA 2ETHA 3DF8A 1QQIA 2DW4A 4TV7A 4LK0F 2PMUA 3ZMVA 1GXQA 5L3EA 2XVCA 2QBYA 1JE8A 4K2EA 1DPUA 1TW3A 1NHAA 4HOBA 4FX0A 1FOKA 1DPRA 2PJPA 2V1XA 5FB2A 2DQRA 2GXBA 4WX9A 1SAXA 1AOYA 3QP6A 1IAWA 3JAMZ 1MJ9A 3BY6A 4OMZA 1J0RA 3FMRA 4G9YA 4HYEA 5CVJA 4G7HF 2EA4A 3ABUA 1YS6A 2L02A 3BROA 1KA8A 1TQIA 1ZREA 2CQKA 2FXAA 3V8JA 3IC7A 1HXDA 1J5YA 4FX4A 4HX7A 3E6MA 1I5ZA 1HW1A 4NHJA 4CO8A 1IZ1A 4ZZLA 3I54A 4NQWA 4GYGA 3RI4A 1ZGJA 5LHIA 4ON0A 4ESBA 3P7NA 2X4HA 5LHHA 3N97A 4A2UA 4L5IA 1F5TA 1JXSA 2DLLA 3SFZA 4Q5SF 5BPIA 4XBFA 2H6CA 4A6DA 3BPVA 4L0ZB 3E97A 2GAUA 3KP7A 4WXHA 1R1TA 3K1NA 1HSJA 5E8IA 2E7XA 1GVJA 3SQNA 3ECHA 4MEYF 1WRJA 1FX7A 4I01A 3TO6A 4UVAA 1QPMA 3D5LA 4AVPA 3WGIA 4XRFA 4R8HA 2GA1A 3RYPA 4MHGA 4PGHA 1QZYA 2YSRA 4ASNA 3HOSA 2WWYA 1STZA 2M5WA 1RZ4A 1B6AA 3DEUA 3HTUA 5ICCA 3WTVC 1LDJA 2D1VA 1DDNA 4N9IA 2BBYA 3K1PA 3LSTA 1B9NA 1BOAA 1IRFA 2XROA 3HRUA 3EQLF 3CJNA 2V79A 4KNYA 1WKMA 3TGNA 1SD4A 5CYVA 1R23A 1J59A 2J5PA 1YYVA 2QQ9A 4ZYEA 1G3YA 4EJUA 5HDGA 5E1WA 3QPHA 3M9AA 4EJWA 2VN2A 3FXQA 2ZO4A 4BXUA 2H94A 2A6HF 1RI7A 4HDUA 3WTSC 4RB3C 4HX4A 4HQEA 1XSDA 3KFWX 3IHUA 4M71A 4IXAA 1XGOA 3S2WA 1K79A 3DQVC 3R60A 1TQMA 3SZPA 4HF0A 4IRGA 4U0WA 3LQRA 3RJPA 4YFNF 2LKPA 3GO5A 2FBHA 4RB1A 5HLIA 1P4AA 1BI3A 1YG2A 4HDVA 1PDNC 2NRAC 4Q48A 2MLKA 4HLXA 4BHBA 5K1YA 4EQQA 2F5FA 3GZ6A 4ENJA 2EFNA 2ZCWA 4UV9A 3QAHA 1RNLA 2VE8A 3WTZA 1XSVA 2EFOA 5BOXA 2EV5A 2PG4A 3OV8A 2IW5A 3E6DA 5IT3A 1BM9A 3CO7C 3U1DA 4U7DA 4B8XA 2WC2A 3T5XA 1XCBA 4G6DA 1ODDA 2D45A 2YPRA 3KZYA 2MC3A 3L00A 3W6KB 2EV0A 2K02A 3HRMA 1MKMA 3SHFA 4ETSA 2NNYA 1S29A 1ZYRF 2F5CA 4RB0A 1ZG1A 4UNOA 2DI3A 4PGGA 1W5SA 4GO1A 3WGHA 4KN4X 3PQJA 1AWCA 4N0BA 5E1XA 3T8TA 2FU4A 2VT3A 2ZKZA 2RQPA 5CVIA 1RIOH 2CGPA 3CUQC 1ZRDA 4MTDA 4AIJA 5HVQC 1ZHFA 2FMYA 1IN8A 1I1GA 2P7VB 3WU0A 4CDGA 2XRNA 2P6TA 4OMYA 2VBXA 3I59A 3ECOA 2G7HA 4G6QA 2P5VA 1H0MA 3R0JA 4OIQF 1KU7A 3MCZA 1RUNA 2JRTA 1YW8A 1FBSA 4ZYDA 2LSOA 3V7CA 2QENA 3J81K 4EJOA 3RPUA 1ZRFA 4EGYA 3LAPA 2DAOA 4GCVA 3ZMTA 3ZMDA 3HSFA 3ISPA 5TJJA 1KQ9A 4HF1A 2PFBA 4A5MA 2XKOA 5AIQA 2MD5A 5HLHA 3N4MA 2HFHA 5CJ9A 2RNJA 3ZN1A 2VOOA 1D3YA 1XDSA 4Y15A 1LJ9A 1IW7F 5L3BA 1W4MA 1FBQA 2QYOA 3V7SA 5DYMA 2RVCA 4WCGA 1T39A 2NAZA 1ON1A 3BZ6A 3F6VA 3WODF 5E17F 2PN6A 1LVAA 2W57A 4LG0B 5F1RA 5FD6A 3HSRA 1V3FA 2YX4A 2HYFA 3GF2A 4LG0A 5L3DA 3WTYC 4S04A 2RV8A 1EV7A 2UWMA 1MDMA 2XKPA 2R3SA 2K27A 3WE2A 1R1VA 3MEXA 2HEOA 2P4WA 4EGZA 5TRDA 4UVCA 4RS8A 3DV8A 2CO5A 3F8CA 4EM0B 3PQKA 2EA2A 3U9GA 1B59A 2FOKA 2HOEA 1FY7A 5E20A 5EEGA 1FNNA 3BOQA 3QOPA 4MGRA 3R0AA 4JQFA 2QBYB 1OYWA 1R5HA 2GIVA 2P6SA 5HS7A 3MZYA 4A0XA 5LGTA 3KE2A 2J5OA 1Z7UA 3HHHA 5D8LB 4ESFA 4RGXA 5JHUA 3EETA 3O3KA 4WK8F 1XMAA 3F21A 5BS6A 5ERIA 3QPTA 2FA5A 1ONVA 2LNBA 2QQBA 3WTWC 2DPDA 2CW0F 2ZBKA 3JSOA 4KUMA 2ESNA 1Q1HA 2M45A 4M9SA 2DO7A 3GZ5A 4LB6B 2GXGA 4OOIA 5DEQA 1L3LA 2XASA 2XAJA 3RKYA 2ACJA 1PP8F 2DFIA 5K5QA 1KYWA 2BGCA 2DU9A 3HRSA 2P5KA 4AWXB 1G3WA 2Y48A 1B4AA 3C1DA 2PBIA 4YFXF 3REOA 1ZN2A 3SZTA 1DUXC 3WU1B 2OU2A 1KU2A 3MFKA 4EMSA 1I27A 5FLXZ 4I7HA 3Q9SA 2EWNA 3V4GA 1BJAA 1KU3A 2QVOA 4M74A 1IXCA 3JTGA 4FHTA 1R7JA 5DUKA 4IHSA 5K5RA 1S7OA 1MJBA 3LWFA 3RIRA 3NEUA 4L9TA 4ZYGA 5JVTA 1SD5A 2AXLA 4HA8A 2GA2A 1OR7A 4ZZDA 3BJ6A 1O3RA 2HZTA 4H0EA 1REPC 5H6RA 4LB5A 2OD5A 2VODA 4M6YA 4PCQA 2L4MA 2MH9A 4Y17A 1R36A 1IRGA 2XV4S 5CVVA 2JT1A 3P9IA 3IL2A 3I53A 3GFIA 2EB7A 3GFLA 4QLCU 3ZP5A 3VODA 3ROUA 4EJTA 3MQ0A 2OZ6A 5ICEA 5EEHA 1XN7A 2KJBA 2BEOA 3DP7A 4P55A 2DPUA 1YIOA 3HYIA 4P96A 5HDKA 5A2QK 3P9KA 5DDGA 3ZQ7A 4BHPA 1SFEA 3HRTA 1FSHA 3FMSA 4BNCA 1QZZA 4JBAA 5IT9Z 4RAYA 2GWRA 2L3DA 2RDPA 3JSPA 4WXDA 4IRHA 1U3EM 2L54A 3KETA 1ZRCA 3WTUC 3LA7A 3BDDA 1FYLA 4WXCA 3G3ZA 3E6BA 4A5NA 3I5UA 2PMHA 3EYYA 3LAJA 2YU3A 4I09A 1UB9A 1R5GA 3EYIA 1ULYA 3K9TA 4EJVA 1HSTA 1V4RA 4L9VA 5LBQA 2O3FA 2QZ8A 3BWGA 3DXJF 2G9WA 2CYYA 3FZVA 5H6QA 2FNPA 1J2XA 3K1MA 4YIFA 4IPAA 1BC8C 2V1UA 4A0YA 5KVRA 4BHCA 2DBBA 1U5TB 1H9GA 2F5EA 2AS5F 4HV5A 1T98A 2A6EF 4MNUA 4EVIA 3J80K 3K0LA 4KIGA 3LA3A 1WI9A 1BC7C 3GUDA 2CFXA 2ZFWA 4ZH4F 3GW2A 2IA1A 4MQ9F 2E1NA 2BE5F 2FQ3A 3F6OA 2O61A 3HIFA 1CGPA 1QO0D 1QBJA 1IXRC 3T8RA 4P9UA 1U6GA 2KIFA 2IVMA 4U0YA 5HS9A 4CYDA 6PAXA 3RKWA 1TNSA 4HLYA 1KQ0A 2LDUA 4F7ZA 4D0PA 2KJCA 4M9XA 4KA4A 2WTEA 1HKQA 1FSEA 2IA2A 4YFKF 1S7AA 2K86A 3F72A 1YQAA 2W85A 5LRSA 5J8FA 3NRVA 2DTRA 3IKTA 4M72A 5CLSA 5IT9K 1O3SA 4OU0A 3I0TA 1P4XA 4PDKA 2V1DA 3WTXC 1KQ8A 2FSWA 3IKVA 2HDCA 1W7PB 3ULQB 4KMUX 5FGMA 3V7RA 2R7DA 4LLGF 1Z6RA 3OOPA 1K78B 2CWEA 2VT2A 2K4BA 4I98B 4U88A 5J8CA 3ZPLA 3AAFA 2OAZA 3VB2A 1T2KA 2F2EA 2JPBA 3Q9VA 2B0LA 2ISYA 2P8TA 1R22A 1F1ZA 2H6BA 4OIRF 2ADUA 4XLNF 2DQLA 1YLFA 3K2ZA 4G94A 3ERED 5KK1A 1UCRA 2Y75A 4A6EA 3KP2A 3NQOA 4L9NA 2JSCA 5A2QZ 1OMIA 4S05A 4AIHA 1TQPA 1ZAOA 1KYZA 1A04A 3RKXA 3TDZC 5ILVA 2YX7A 3V8LA 4UV8A 2XUBA 4XLPF 3E5QA 3QP5A 2A61A 3QRFF 1D8KA 3FMQA 2P7CB 1XDUA 3COAC 3WTTC 3IRRA 3KLOA 3R61A 4JK1X 3WGGA 5BQTA 1SD6A 1UFMA 1BI2A 2Q2EA 5D5UB 1W7PA 4GGGA 3RDIA 2W25A 3BJAA 3HSEA 5E1ZB 4LLNA 3MZHA 2W24A 4GXOA 2XIGA 4B09A 1SFUA 3E3VA 3JAMK 5HLGA 3P9CA 1EH7A 2ZNZA 4MQVA 1YTYA 2STWA 2HKXA 1P2FA 3M8EA 4A0ZA 3J81Z 1BN5A 2O03A 3ZN0A 1CF7B 1E2XA 1IN5A 2UXNA 1K7AA 2H27A 1LQ1A 2HQRA 1CF7A 2A5YB 2QQAA 1LEBA 1I6XA 2QLZA 3EDPA 2D2WA 1FP2A 4M6XA 4CICA 2HTJA 3KEOA 3O6BB 2M8EA 3KP3A 1S8NA 2QWWA 1G6NA 3DKWA 1TNTA 1Z05A 4CGZA 3FWEA 1S3JA 5HDNA 3LQQA 2COMA 1FYMA 1WQ2A 2O0YA 1UHWA 5H20A 3QU3A 3PFIA 1TTYA 4HAMA 1FYKA 1U5TC 5DV5A 3VOEA 4MEXF 2XAQA 2HS5A 3JTHA 1D5VA 1O7LA 1P4WA 2FF4A 1JHHA 2VOPA 2W84A 3IWZA 3T1BA 5LGUA 1BIAA 5HS8A 1IUYA 3J7AO 1G3SA 3FXUA 3KCCA 2VONA 1MD0A 1Z9CA 5DCFA 4OIOF 5D6EA 4EV0A 1SMYF 2KIMA 5F64A 2ZNYA 3MAJA 3G73A 3BP8A 2DK5A 1IN6A 3GWZA 5FD5A 2FMLA 2VBWA 3GYHX 3CUQA 5D4SA 1W5TA 4MTEA 2D1HA 2FEZA 3GXOA 3IRQA 2MH2A 2G7UA 2HYGD 4EM2A 3ELKA 4EM1A 3GLXA 1ZARA 4G8XA 5ILUA 2MBFA 5LRRA 5JI6A 3BJOA 2FBIA 2NYXA 3M1EA 1FP1D 1B1BA 1YFHA 3FHZA 1XD7A 3L9FA 4L18B 2K7LA 3CO6C 3D0SA 4M9ZA 3L2CA 1SD7A 3WE3A 4HF2A 4BAYA 2R7FA 1R58A 3VEPA 1O57A 3GFMA 3I59B 1ON2A 3RTRA 3FM3A 3LA2A 4DNCA 3T0YA 1UHMA 2XHKA 1HW5A 1SFXA 2PLYA 1DP7P 1T38A 4G7OF 3L7WA 1IF1A 3F23A 1USTA 1BI0A 3I71A 1E17A 2M87A 4Z2YA 1MZBA 1FT9A 4G7ZF
chains in the Genus database with same CATH superfamily
3HOYJ 3S1MJ 2MSYA 1X4PA 4XSXF 2JQ7A 2PI0A 3LSGA 3KIOA 4KDPA 5FLXK 4CCNA 1OCTC 2M7BA 4LFUA 4U0VA 3TKYA 2NOGA 3SJMA 3QU6A 3AKZA 1U5TA 2LFBA 2Z2SB 2Y9YA 3E5UA 5AIPA 5B1AH 1K78A 1PUEE 2HQNA 3HOTA 1F9NA 1K6YA 3BTIA 1W0UA 3C18A 4RAGA 3EUHA 2IJLA 2FUG2 2V6CA 2RQQA 2OQRA 5D5VB 1RETA 1QGPA 2JUGA 2FBKA 3F8MA 3HM5A 3JRIA 2Q0OA 5GP9A 5D8KB 2JSPA 3JW4A 1W36C 1J9IA 1IV8A 3TW6A 2PJRA 3KEQA 2HTSA 2XB5A 4KT5C 1D1BA 4KYWA 2M8GX 2I5UA 4R1HA 4BYYA 3ABTA 3W3CA 3E0JB 1TLHB 1R00A 2HXOA 4RGRA 3OY9A 4AVZA 1HBXG 3FM5A 4RB2C 1WJFA 2ZXJA 1LE8A 4XKWA 2Y0SA 3DEEA 2A3SA 2OCCH 4IOAF 1XB4A 2BYVE 2MD0A 2VC0A 4Q47A 3I58A 3CDHA 2Z5UA 5LEJA 2STTA 1Z0XA 4RGUA 2K40A 4YIIA 1G3TA 3DEWA 4KIBA 3ZMUA 4LGWA 1MGTA 4F52A 3H3VK 4PJMA 1EH6A 2LF7A 1YW7A 2VXZA 1KGSA 4KIFA 1XTAA 3MWMA 4IQJA 4DQ2A 4I2OA 4ENKA 1XMKA 1X19A 2L4AA 2X0LA 4BH9A 1GHCA 1G4DA 4C2MJ 3GFJA 2AO9A 5B1BH 4CCLA 4Q4ZF 2ISZA 2F6CA 2VIXA 4E7IA 2X51A 5LEKA 4KMFA 1Z21A 1TBXA 1JGSA 2HQ5A 1LEAA 3RKQA 4XSZF 3C3WA 4E70A 1P9QC 1SANA 2HZDA 3OOUA 3BR6A 2QUFA 1U2WA 3OYNA 4BGDA 4NDLA 3SZGA 2IBDA 2YR2A 2R7UA 1EKEA 2OBPA 4XLCA 4U7BA 3H9JA 3ZMZA 3BG5A 3Q0VA 1Y0UA 1B8IB 2QM3A 5JFRA 4BACA 4IF4A 5IP6A 1EH8A 2DXIA 1IXSB 3BPXA 2TDXA 3H3ZA 3NAUA 1Z91A 2Y9ZA 1K83J 3SXYA 1ZR4A 1MDMB 4AC0A 3UNGC 4U87A 2DA7A 3CUOA 3WU2C 3DPLC 2EFPA 1YX5A 1I3QJ 1KU9A 4HX8A 2R5ZA 2V9VA 4A3BJ 2O8XA 2KLOA 2HKOA 2XGCA 2FRHA 3JCUC 3LSRA 1T6SA 3F8BA 1O7FA 2JWTA 1X1AA 3U2RA 2IPQX 4FT8A 2WV0A 4II3A 2Z3YA 1I1SA 4NC8A 1GXPA 4ESJA 2O9LA 3GTPJ 5GAHJ 3S93A 3PIOF 2OA4A 1H88C 5FO5A 1XGNA 4HNUA 3FX3A 5C44J 2JPCA 5GAGJ 2GLOA 5EG0A 2IT0A 1YRNA 4BQQA 4LIVA 3K7AJ 5DD4A 1A6IA 3V8KA 2RKHA 1Z1DA 4P1WA 2YU9J 2XAHA 4XOPA 1ZLJA 4YELA 2OZUA 1HW2A 1GV2A 1YJWI 5EG0B 2CUEA 2A68F 2BW3A 1YE9A 1HKSA 2ID6A 2ZMEC 1GV5A 2Z99A 2L7MP 4ZC3A 2L01A 3TP0A 2IP2A 2LF8A 5CVUA 4ZYAA 2F5DA 4YG2F 1WWXA 4I0BA 5J1YA 4RLQA 4P5OA 2HGCA 2XF6A 3MVPA 4HBLA 1HOMA 3BZKA 3WG9A 1YW9A 2B9SA 2K85A 4ZTJA 2HWVA 1ZH5A 2FX0A 3SEZA 1BBYA 4IRIA 2WB1A 3H3UA 2O6GE 4A3KJ 1VTNC 2A69F 5F27A 3FKIJ 2Z9OA 2ZJ2A 5LLQA 1FPQA 3ONQA 4ENNA 1WSUA 5HOOA 3GEZA 2XAFA 3TOBA 3F3XA 5J6XA 1XS9A 4Y13A 1XCVA 4FASD 3E5XA 2JA5J 2P5LC 3VFZA 1R6RA 2DK8A 4R79A 2MC4A 1LNWA 1ZG3A 3LSHA 3HTSB 3J80Z 3OS2A 3DTKA 5DCMB 1V5EA 1ETOA 3LSKA 3CJRB 1P92A 2JTVA 2F4MB 3DWLE 4ANJA 4X6AJ 1WZ2A 1SFKA 2V1NA 5E3NA 1K4SA 4XLFA 4BQAA 1I39A 1ZLKA 2EFWA 3M8FA 2ICWG 2VQCA 4V2GA 2JK3A 4XORA 5DCMA 5KCMA 4CHUA 1C0WA 5LGNA 1FLIA 5ILSA 3SFIA 3CLOA 3OMYA 1ENHA 1HQCA 3I9V2 3S14J 4LJZF 2QKLB 2NS7A 1MIJA 1ZG5A 1TWHJ 2E1CA 2IGOA 5J1UA 1MBJA 4OIPF 3TMOA 5K5OA 2EV6A 4IJAA 4OAZA 2IRFG 4DJAA 2VBZA 2BVMA 2KKOA 4IZZA 2RGVA 3UKGA 4WWCA 4G6TB 1JGGA 3OYDA 1L0OC 3OL4A 1OISA 2UXXA 5KAFC 3KP4A 2KPMA 2BXZA 2PEXA 4QSHA 5ICFA 2VBYA 1O3QA 1R9TJ 3H92A 5DD8A 3A03A 2EFQA 1X3UA 3HOZJ 2XGXA 4W1UA 3ZQFA 4BS9A 2BV6A 5JLWA 3CCUI 1YO5C 1FC3A 1OPCA 3LMMA 1FWZA 1O4XA 4V19K 1GLNA 4CZZA 3J7YJ 5F6FA 1BIBA 2FE3A 3Q5FA 5JR3A 2CSOA 1MJAA 3S3MA 1IN7A 4HV6A 4QWQA 1TW2A 3FF5A 1SVMA 1APLC 2MLGA 2EZKA 3PIPF 1OKRA 4CCJA 3GTJJ 1PJRA 1FZPB 4GYIA 4Y52J 2HXIA 1ZGAA 3F22A 3AG1H 2HOAA 3KP5A 1JHFA 1XSXA 1U8RA 3CMAI 1KZHA 3PO2J 3E6CC 2DYRH 2XGDA 3PSFA 3VYSB 1W36D 1YS7A 1GDTA 3L09A 2HPIA 5C4XJ 1S9HA 4GRIA 2XF5A 3I4PA 1S6LA 2ZJRF 1T0FA 4V2FA 3AL0C 4OINF 4ZYHA 1S7EA 4I02A 2QF7A 3MN2A 1N75A 1P6RA 3DFGA 3KYDB 3M7GA 2ELHA 2V26A 3ML6A 4QTRA 3TW7A 1W0TA 1FMVA 4A69C 2RC4A 2HNHA 3RYRA 3M8JA 2FNAA 1XGMA 2H09A 5L3CA 4LK1F 2C6YA 4AD9A 3X2QH 4NB5A 4UHTA 4UVBA 4CCKA 2B7EA 1SMTA 3TOAA 4RGSA 1F4KA 3DLAA 2BY0A 2WAQN 3HB9A 5CVRA 1LDDA 3PSIA 3OYCA 4M73A 4KFCA 2IGKA 2IA0A 3GX4X 1K6OA 2FD5A 2JZYA 5ED4A 3R6SA 2ECCA 2RREA 2EJRA 1YX3A 4P9FA 5E3MA 1U8BA 2R93J 3CQZJ 4RAZA 2E71A 2RN7A 1X3ZB 3GVAA 5F08A 2JA2A 4PK4A 5D6FA 2D5VA 4JX5A 1D8JA 4IVNA 2Z33A 2HR3A 3IWFA 1TT5B 3KLNA 1ZR2A 2V7FA 3O2PE 1EA3A 3K10A 3KX2A 2ZXIA 3TQNA 4A12A 4LMYA 1B9MA 4JYKA 2WA0A 4AYBA 3QPLA 4I6ZA 2HOTA 3ZCOA 3F0CA 3TO9A 1QNTA 3ZQIA 2DA3A 2PQ8A 3HG9A 3HUGA 4O6JA 2Q8KA 5FFXA 3Q0WA 3I3LA 4HZFA 1B72B 5ICGA 1OCOH 2GQQA 2V9KA 4A3JJ 1HKTA 2L7ZA 5BPDA 2EILH 2OCEA 5M3FJ 2JA7J 3KZZA 2UZKA 4UUVA 2DT5A 1ETWA 1OYIA 2Y30A 4JX4A 1B72A 1LB2A 4L0YB 4O3MA 3KP6A 1AU7A 1H9TA 1ITYA 3DPTA 3CCLI 5TISC 3H36A 4B3AA 1HLVA 3ERMA 4N9HA 2A6TA 2EZHA 2A07F 1X1DA 5LHGA 2L2OA 3W6JB 2H8RA 3DTIA 4CXFA 5HNFA 1XGSA 4O5VA 5C4JJ 4KITB 2EIJH 2NNNA 4XN0A 3A1YA 3K69A 4XRMA 2P81A 4CYCA 3KZIC 2ZJQF 1MNMC 3KEYA 5D4RA 2MA3A 2CG4A 3HOVJ 1PUFB 4CCOA 3B73A 1OFCX 4HQMA 3ZMSA 2VKEA 2BY2A 2RAEA 4CUGA 3RZDJ 2EK5A 2E1MB 1O3TA 2KRFA 4LD5A 3LFKA 2VE9A 3CUQB 9ANTA 2F4OB 3RPQA 5AONA 2NS0A 5FFZA 2UUZA 2G0EA 3IH3A 3HJEA 4BJTA 2F4IA 4HW0A 2E1OA 3F8NA 2KZVA 3F8FA 1R1UA 2JA6J 1LDKB 4XICA 4BXXJ 1OLTA 2ESHA 3B02A 5L3FA 3I55I 5GADJ 1OCZH 5D5WB 1X1BA 1IN4A 2M1BA 5E8GA 4IHTA 2Y0MA 1W7PD 5IOYA 3DBLB 1AKHA 4UXNA 1FBUA 1AHDP 1VQKI 3D1NI 2QSHX 4KNYA 5E18F 3HC7A 2QSFX 1PP7U 2IXSA 4L9JA 2M30A 1WJBA 3SDBA 1RUOA 5EDNA 2NVTJ 3H5AA 2VC1A 2XAGA 1H8AC 2CJJA 1Z67A 1KONA 3UR3C 1OQYA 3C7JA 4XLEA 4FTHA 5FJ8J 1J75A 4KN7X 4L5JA 1Z6TA 5FRMA 4XMYA 3CCVI 3TO7A 3BG6A 3ABLH 3FDYA 2GZWA 2ZB9A 4HPQA 2OQGA 1JKOC 1USSA 3H35A 4PZJA 5IYCJ 2LREA 4XIDA 5EYRA 1VQLI 3OIPA 2E7WA 5D5XB 1JKRC 4XKVA 1N78A 2KIUA 3CTAA 3CCMI 1DP3A 1Q1VA 4XN3A 1U78A 4D1QA 3I64A 1ORKA 2X9DA 2QSGX 1J7KA 2OUMA 4ZDLA 4ENMA 2GBYA 1BI1A 2K4JA 2ZMEB 1UAAA 2NVQJ 2ECBA 1LKXA 5L3GA 1JKPC 3FXRA 4KICA 5F04A 2JJ7A 3HHGA 4LLLA 3R4KA 5BMZA 3TDUC 4AIKA 4WF2A 2TCTA 4I0AA 3CMYA 2ZMEA 2NVXJ 3IH2A 2YS9A 5DUIA 5FKMA 1OYYA 2ETHA 3DF8A 1QQIA 4BEHB 1ETQA 2DW4A 4TV7A 4LK0F 3CJQB 5CKTA 2PMUA 3ZMVA 1GXQA 5L3EA 5GTHC 2XVCA 1Z77A 1VQ8I 1JE8A 2QBYA 4K2EA 1DPUA 1JI8A 1VQ7I 3PFYA 1TW3A 4E7ZA 2OTLI 4N4OB 4E6KG 1NHAA 4HOBA 3A01B 5CQEA 4FX0A 2E5ZA 2MABA 3QWLA 1FOKA 3CCQI 1DPRA 2PJPA 2V1XA 5FB2A 2DQRA 2DOFA 2GXBA 3ZQQA 2VUMJ 4WX9A 1SAXA 4HNTA 1RPWA 2LP0A 1FMWA 1AOYA 1TT0A 3QP6A 5M5XJ 1IAWA 2GOXB 3JAMZ 1MJ9A 3BY6A 3A0HC 4OMZA 2ELKA 1J0RA 3FMRA 4G9YA 4HYEA 3BT9A 1X2MA 5CVJA 4G7HF 3QYBA 2EA4A 3ABUA 1YS6A 3MKZA 2L02A 3BROA 1ZTRA 1KA8A 1IDZA 1JTYA 1QPIA 1HC8A 1TQIA 5GPAA 1ZREA 2CQKA 5M5WJ 2EPFA 2FXAA 1VF9A 2JVHA 4M3EA 2K5CA 3NWTA 1Y0NA 3V8JA 2M34A 3IC7A 3VYUB 1HXDA 2EZLA 1J5YA 4FX4A 4HX7A 5FKKA 1CQTA 1FIAA 3FXJA 4A3CJ 3E6MA 1I5ZA 1HW1A 4NHJA 4CO8A 2DOEA 1UJ8A 4FETA 5CPRB 1LFUP 2LC2A 4Y3OA 2W1OA 1IZ1A 1ETVA 3LNQA 4ZZLA 1Z3XA 1LVKA 2KFDA 3I54A 3ZQGA 4A3LJ 4NQWA 2MGQA 2XC7A 4GYGA 4W97A 3RI4A 1ZGJA 1E3HA 2DMPA 3IAS2 5LHIA 4ON0A 4ESBA 3P7NA 2X4HA 2A05A 3S3NA 5FRNA 5LHHA 1IO2A 3N97A 2EH3A 4A2UA 4L5IA 3CF2A 1FOXA 1JUMA 3BCBA 1F5TA 2V9PA 1JXSA 1WJAA 5HNHA 1T95A 2DLLA 3SFZA 4Q5SF 5BPIA 4I76A 5C3EJ 4XBFA 2HVQA 1ZK8A 2H6CA 4A6DA 3BPVA 3FBNB 4L0ZB 3E97A 2GAUA 3KP7A 4WXHA 1R1TA 2LY9A 1SAUA 3J7AY 3K1NA 1HSJA 5E8IA 2E7XA 3OYIA 1TWGJ 1GVJA 3SQNA 4C3IJ 2M4KA 3ECHA 4MEYF 4A3IJ 3S2HJ 1WRJA 1FX7A 4I01A 3TO6A 2DFHA 2K9LA 2HI3A 2VPRA 4UVAA 3DU6A 4E7LA 1SEUA 2CV0A 1QPMA 4XNFA 2R0QC 4BDZA 3D5LA 4AVPA 4OAYA 4E7SA 3WGIA 4XOTA 3A01A 4XRFA 1XPXA 4R8HA 2GA1A 2XGEA 2Y31A 3RYPA 4MHGA 3L2WA 4B48A 2P0WA 3B6CA 4PGHA 2AXTC 1QZYA 3TEDA 3PUFA 2YSRA 3TP3A 4ASNA 3HOSA 2E2IJ 1IGNA 2WWYA 1VFCA 1STZA 2M5WA 1RZ4A 1B6AA 1DGRM 2CQXA 3DEUA 2R7XA 3HTUA 2W00A 1OJLA 1NG6A 2LK2A 2XAUA 5ICCA 3L2UA 1S72I 3WTVC 1LDJA 3LOCA 2D1VA 5E79C 2KIQA 1RC9A 1DDNA 3OSFA 1RKWA 1MMNA 4N9IA 2R7RA 2BBYA 3K1PA 3LSTA 1B9NA 5J40A 1BOAA 1IRFA 2XROA 3HRUA 5JVGF 3EQLF 2DYSH 3CJNA 2X85A 2AHQA 2V79A 4DYQA 3K70D 3SEQA 1WKMA 5CYVA 1SD4A 3TGNA 4BKXA 4HNVA 3HPGA 1R23A 4II2A 2J5PA 5DM7F 1J59A 2LYCA 1YYVA 1EF4A 2QQ9A 2H8WA 4OWRB 4ZYEA 4ZDPA 1G3YA 5IYBJ 1XX5A 4EJUA 2MFZA 3ZGKA 5HDGA 4MFEA 2IS6A 5E1WA 3JRBA 2IEKA 2W4SA 3QPHA 3M9AA 2L7FP 4EJWA 2KISA 1X2NA 2VN2A 4RAFA 3IAM2 3FXQA 2ZO4A 4BXUA 1V55H 5IP9J 2H94A 2A6HF 1RI7A 3E7LA 4E4HA 4HDUA 4A3DJ 3QYEA 1YOVB 3WTSC 4RB3C 4HX4A 2X1DA 2ZSIB 4UB6C 4HQEA 4UUSB 1XSDA 3H9QA 3IHUA 3KFWX 2BXYA 3MKYB 2L9VA 4M71A 4IXAA 2KP6A 1XGOA 1BJZA 3S2WA 1T08B 1K79A 2XRLA 4E7HA 3DQVC 1WPKA 3R60A 3KYLA 1TQMA 3CJTB 1U9NA 3PNTA 4D7MA 2K9QA 3SZPA 4HF0A 3ZRGA 2VQLA 4IRGA 4U0WA 1VQMI 3LQRA 1SC7A 3CESA 1U0JA 3OIQA 2KDZA 3RJPA 3ZXSA 4YFNF 1VNDA 2LKPA 3M4OJ 3FK7A 3GO5A 2FBHA 4DZPA 4RB1A 2MYSA 1P4AA 2L9SA 5HLIA 3HOXJ 4BDYA 1BI3A 1YG2A 3A2KA 2LBFA 3AG3H 4UUTA 2CUZA 4HDVA 4MIMA 4BUPA 1PDNC 3EUAA 2NRAC 4Q48A 2MLKA 4HLXA 4HSTA 2CV1A 4MFDA 4BHBA 5K1YA 2F5FA 4EQQA 2NXNB 3GZ6A 1D0XA 2L7KA 1RR7A 4ENJA 2CH0A 3HBLA 2EFNA 2ZCWA 4UV9A 3WHBA 1JT6A 5F1JA 3QAHA 1RNLA 2VE8A 3S2DJ 2VJIA 4FQGA 3WTZA 1XSVA 3CLQA 2EFOA 3H0GJ 5BOXA 2EV5A 1DQUA 2PG4A 3OV8A 2IW5A 3E6DA 1PUFA 3BR5A 1NK2P 5FKLA 5IT3A 3GBGA 4PFPA 1BM9A 3CO7C 2KHMA 3U1DA 4B8XA 3O8GA 4U7DA 2WC2A 1LUJB 2ZSHB 3T5XA 4D9JA 3U1KA 5J4YA 3QOEA 1X4OA 4LITA 1QVTA 2I8DA 4XONA 1XCBA 1MMGA 2R4GA 3DPUA 4PUSA 4G6DA 1ODDA 1ACIA 3BG7A 3JR9A 1WI3A 3OR2C 4DBRA 1T0FC 3OYEA 2D45A 2QGUA 2YPRA 2PMZA 1OCPA 1ZQ3P 3AG2H 2Q1ZB 3HGYA 3KZYA 2KRHA 3U21A 2MC3A 3S8PA 1AKHB 2WB1N 3L00A 3W6KB 3K2AA 2EV0A 1IRXA 1JJ8C 3HRMA 2K02A 1MKMA 3SHFA 1F43A 2BY3A 4ETSA 1I50J 2NNYA 2DDBA 2V6EA 1S29A 1ZYRF 2F5CA 4RM3A 1ETXA 4RB0A 3BR3A 1ZG1A 4UNOA 3OYGA 2DI3A 3RQIA 4PGGA 1VQ6I 5FLMJ 5EGOA 1W5SA 3BZCA 4GO1A 3WGHA 4KN4X 3PQJA 1AWCA 4N0BA 5E1XA 3T8TA 4C3JJ 3Q0UA 1XMXA 3RSNA 4E7KA 2FU4A 3MKWB 2OTJI 2VT3A 2ZKZA 2RQPA 1X1CA 5CVIA 1IUFA 4QPQA 1RIOH 1NK3P 2CGPA 2W48A 3CUQC 2CQNA 1ZRDA 4DIQA 1W1WE 1M1EB 1POGA 4HG2A 4MTDA 4AIJA 5HVQC 1ZHFA 2FMYA 1IN8A 1I1GA 3CCEI 2P7VB 3WU0A 2LRDA 1PYVA 4CDGA 4Y33A 2XRNA 1TL8A 2P6TA 4BQOA 4OMYA 2VBXA 1JKQC 3I59A 3ECOA 3FXKA 2G7HA 1VQNI 3MD2A 4G6QA 2P5VA 1H0MA 3R0JA 4E7JA 4OIQF 2CUJA 1KU7A 1B8IA 1E0EA 3MCZA 2O5RA 2GXAA 3S16J 1RUNA 2JRTA 1YW8A 1R5ID 2FQ4A 2LKXA 1FBSA 4ZYDA 2LSOA 2R7VA 3MMYB 3V7CA 3PO3J 3RZOJ 2ME0A 2QENA 5B3SH 3J81K 1BL0A 1UELB 2CQ7A 1VQPI 3IUOA 4CSWA 4EJOA 2WAQA 3RPUA 1ZRFA 4DGWB 1FOWA 4EGYA 2CW8A 3OS1A 4XRSA 3L2VA 4DW6A 3GTLJ 3LAPA 2DAOA 2DMNA 4IO9F 4MO7A 4GCVA 3ZMTA 4XM3A 2X1EA 3M1CA 3ZMDA 3HSFA 3ISPA 1WJ5A 5TJJA 1KQ9A 3V42A 3EPZA 4HF1A 2Y69H 2PFBA 4A5MA 2XKOA 5AIQA 4F92B 3PUBA 1A35A 2MD5A 2FJ1A 1FTZA 3LFUA 2M7AA 5HLHA 3N4MA 4B43A 3BCAA 2HFHA 5CJ9A 2RNJA 3ZN1A 3OIOA 2VOOA 1D3YA 2KDOA 1QVUA 1XDSA 3M07A 1ZELA 3FXLA 2R92J 4Y15A 2PJRB 1LJ9A 1IW7F 3LL7A 5IPAA 5L3BA 3I4MJ 1OCCH 1W4MA 3VWBA 2CFOA 2N8GA 3GTGJ 1FBQA 2NVYJ 2QYOA 1RESA 3V7SA 2VJJA 5DYMA 1MBHA 2RVCA 4WCGA 1T39A 2NAZA 5E3OA 1ON1A 3BZ6A 3F6VA 3WODF 1D1AA 2K3FA 5E17F 2PN6A 4DBQA 1LVAA 2W57A 3GCMA 4LG0B 5F1RA 5FD6A 4GFBA 3HSRA 1V3FA 2YX4A 1LFBA 2PX9A 3H5NA 2IAIA 3CP2A 2Y0SN 2HYFA 1TC3C 4NQWB 3HL2A 4KISA 3H0DA 3GF2A 4LG0A 1T8IA 3BQYA 3CMMA 5L3DA 3BLYA 3WTYC 2IS1A 4S04A 1HA8A 2RV8A 3LSJA 1WFXA 1EV7A 2UWMA 3NARA 4YRVA 5GAEJ 2VPLA 4S0HB 3QYFA 1ERDA 2OC6A 1V5GA 1MDMA 2XKPA 2R3SA 3I4NJ 2K27A 3WE2A 1R1VA 3MEXA 2HEOA 4BY1J 2P4WA 5J4VA 4EGZA 2XF7A 5TRDA 4UVCA 5KNLA 5K7HA 4RS8A 3DV8A 5CQGA 3DKXA 2Q2EB 2CO5A 4XLAA 3F8CA 3CMEI 4EM0B 3PQKA 1TWAJ 2EA2A 2WBMA 3FXMA 3U9GA 1IDYA 2GOMA 1B59A 3D5RC 2FOKA 2E35A 2VASA 2HOEA 1ETKA 3FK6A 1Y56A 1FY7A 2IGNA 5E20A 1YJ9I 4G12A 3ASNH 1BR4A 1FIPA 5EEGA 1FNNA 4F3QA 1G8XA 2EBIA 2KZGA 3BOQA 2MG4A 2K3PA 3QOPA 4MGRA 5KAIC 3R0AA 2EIKH 4JQFA 2QBYB 1OYWA 1R5HA 2GIVA 2ZXWH 2P6SA 5HS7A 3MZYA 4A0XA 2NOJB 5LGTA 2JRMA 1Y1VJ 2AQEA 1LPQA 3KE2A 2J5OA 1Z7UA 3HHHA 5D8LB 1HDDC 4ESFA 2VQGA 3K4NA 1Z7LA 4RGXA 3S32A 5JHUA 1HF0A 3EETA 3O3KA 1I6HJ 3HDDA 3CCRI 4A3GJ 4WK8F 1YRNB 1XMAA 3F21A 5BS6A 3CF5F 4XKCA 5ERIA 1Z3YA 3TL4X 3QPTA 4C30A 2FA5A 2WY8Q 3ZQHA 1ONVA 2DFEA 2HDWA 3DU5A 2LNBA 2QQBA 3WTWC 2DPDA 2CW0F 3WHCA 2QKMB 2ZBKA 3JSOA 4KUMA 2ESNA 5EEAA 2XPWA 1Q1HA 2M45A 3SDGA 4M9SA 2DO7A 3GZ5A 4LB6B 2GXGA 3HKZN 3CCYA 3BC8A 4OOIA 4RLFA 5DEQA 1OR7C 1L3LA 2XASA 2DMTA 2LG4A 3CD6I 2XB0X 1WJEA 2XAJA 2K9MA 3RKYA 2LMDA 1RKTA 4IHWA 2ACJA 1PP8F 2DFIA 5K5QA 2ZXHA 1KYWA 1X1PA 5LD2C 1MBKA 2BGCA 5J47A 1MNDA 2CW7A 2DU9A 3HRSA 4FE4A 2CQQA 2P5KA 3GTMJ 4AWXB 1BOBA 2LTPA 1G3WA 3OYHA 4ZTFA 2Y48A 1B4AA 3VDXA 1N25A 3C1DA 1YI2I 3CZ6A 1R71A 2PBIA 2E1MC 3OWTA 4YFXF 3REOA 2LD5A 4NBQA 1ZN2A 3SZTA 1DUXC 3WU1B 2OU2A 3ABKH 1KU2A 3MFKA 3JRCA 4EMSA 1QA6A 3B6AA 3BTCA 1WJDA 3OYAA 1I27A 5FLXZ 2H1LA 3HGGA 4RBOA 4I7HA 3BTLA 3Q9SA 2EWNA 4XK4A 3Q3SA 3V4GA 1BJAA 2B63J 1KU3A 1Y8QB 1MBGA 2QVOA 3OYJA 2JA8J 4M74A 1IXCA 3HUGB 2OF7A 1HDPA 3JTGA 4FHTA 4XQFA 1R7JA 3HPHA 5DUKA 4IHSA 4IHVA 2LR8A 1V5FA 5K5RA 1S7OA 2VLAA 1WH5A 3LSIA 1MJBA 3LWFA 3VYRB 3RIRA 3BTJA 4M3BA 5EZGA 3NEUA 4L9TA 1D0YA 4JX6A 3CP8A 4ZYGA 3W2AA 5JVTA 1VZ0A 1SD5A 2AXLA 2LLKA 4CCMA 1XC5A 4HA8A 4UY8I 2GA2A 1FEXA 3GTKJ 1I3AA 2COBA 2TRTA 4RDUA 1OR7A 5EF6A 4ZZDA 2CMPA 3BJ6A 1O3RA 2HZTA 1HCRA 1DU0A 4H0EA 2KMUA 4A3FJ 1REPC 1FJLA 5H6RA 4LB5A 3OR1C 2OD5A 4C9YA 2VODA 4M6YA 5GTIC 3VSKA 4BBSJ 1DU6A 4PCQA 1F36A 2L4MA 2MH9A 2VKHA 4Y17A 1R36A 1IRGA 1LFPA 2XV4S 3ZQLA 3K4BA 3K70C 3DLLF 2A5WA 2ID3A 5CVVA 1QRYA 3HXLA 2I10A 2JT1A 3P9IA 3IL2A 1TZLA 1Y1WJ 3I53A 5K7ZA 4Y4RA 2DJNA 3CCSI 4DYRA 3GFIA 2EB7A 3GFLA 4QLCU 3ZP5A 3VODA 3ROUA 4EJTA 4XKBA 3MQ0A 2OZ6A 2X6XA 5ICEA 3OYFA 2XSDC 1Y39A 5EEHA 1XN7A 2O7OA 2KL4A 1IV6A 4KT6A 1D5YA 2CV2A 2KJBA 1MMAA 2BEOA 3DP7A 4B44A 3AFHA 4P55A 2DPUA 1YIOA 3HYIA 4P96A 4FISA 2LH9A 5HDKA 3JRDA 5A2QK 5F0CA 2WV1A 2QQ8A 3G6EI 3BG9A 3P9KA 5DDGA 2KT0A 4B4CA 3ZQ7A 4BHPA 1SFEA 3JREA 2XSJC 3HRTA 2R5YA 4AIDA 1FSHA 3FMSA 4BNCA 1QZZA 4F55A 2XDVA 4JBAA 4D7NA 5IT9Z 5FROA 4RAYA 4I99C 2GWRA 2L3DA 2RDPA 3JSPA 4WXDA 5DS9A 2VB6A 1YJNI 1QU3A 4IRHA 3A0BC 1U3EM 2L54A 3KETA 2WAFA 1ZRCA 3H1CA 1IRZA 1UG0A 3WTUC 1R4NB 3LA7A 3BDDA 4PJNA 1FYLA 1W5CC 4IKFA 4WXCA 2QA4I 3G3ZA 3ZOBA 3E6BA 2ZJPF 4A5NA 3I5UA 2PMHA 3EYYA 4NC6A 3LAJA 3W6VA 1A36A 2YU3A 4CH7A 3BG3A 2K9NA 1GVDA 2BZTA 4I09A 4LIUA 1YITI 1MMSA 2R7OA 2HQAA 2LY1A 1UB9A 2LBFB 1R5GA 2WAEA 1ULYA 4XR6A 3EYIA 3K9TA 4EJVA 1HSTA 1V4RA 3CC7I 4L9VA 5LBQA 2O3FA 2QZ8A 3BWGA 3DXJF 3S17J 2G9WA 2CYYA 3FZVA 5H6QA 2FNPA 4MLOA 1J2XA 3K1MA 4YIFA 1S5LC 2DCEA 3JRAA 4IPAA 2HPMA 3FHNA 2K9SA 2X6WA 1BC8C 5FLVA 1UZCA 4FCYA 3P5JA 4CA0A 2V1UA 4A0YA 4J01A 5KVRA 1BR2A 4M3GA 4BEHA 4BHCA 2DBBA 1U5TB 4D5FA 4XRSG 4C2UA 1H9GA 2BHYA 2M3AA 5TGTA 2F5EA 3FXOA 2AS5F 1UMQA 1BW5A 4HV5A 2DMQA 2XPVA 1MW7A 1T98A 4ITVA 1IJWC 2A6EF 2E2HJ 5F0FA 2RNGA 2BY1A 5DTDA 4MNUA 4EVIA 2ELJA 3TBIA 3J80K 1YHQI 2L9RA 3K0LA 4KIGA 3IP4B 3VYTB 3FKJA 4RM2A 2UV1A 3LA3A 1WI9A 1K61A 1BC7C 3GUDA 2E19A 2HVRA 2X48A 3DBRB 2CFXA 1T33A 4BJ5C 3GMEA 4JOMA 1T56A 1LE8B 2ZFWA 3VPRA 4ZH4F 3GW2A 3BR1A 4HRIA 2IA1A 2LVSA 4MQ9F 3AL0B 2E1NA 1G2HA 3EUKL 1WH7A 4FE7A 1E3OC 2BE5F 4N4NB 2FQ3A 3F6OA 2O61A 3M3YJ 3HIFA 4BJ6C 1CGPA 1MMDA 2F5VA 1QO0D 1QBJA 1IXRC 4UB8C 3T8RA 2EZIA 4P9UA 5IOZA 1U6GA 2KIFA 2R7QA 2IVMA 5JLXA 1WVRA 2QEXI 1DGWY 3IH4A 1K4TA 4U0YA 5HS9A 4D5CA 4CYDA 3WG7H 1NG7A 1MSEC 3S1QJ 4JP0A 2HU9A 6PAXA 3RKWA 1TNSA 4HLYA 2W82A 1KQ0A 2LDUA 2BOLA 4D0PA 4F7ZA 5EGOB 1IG7A 2DN0A 2KJCA 4M9XA 5LFAA 4KA4A 3KPHA 1MH4A 2WTEA 1HKQA 5HLTA 1A31A 1FSEA 3DCFA 2VKDA 3C2BA 2IA2A 2R7TA 4YFKF 1S7AA 1XG1A 2K86A 2L9NA 1VQOI 5DM6F 3F72A 1YQAA 2W85A 5LRSA 5J8FA 3NRVA 3N05A 2DTRA 2M2EA 2JUCA 2R7WA 2DTZA 3IKTA 4M72A 5CLSA 5IT9K 1SVLA 1O3SA 1G59A 4OU0A 3PJRA 3I0TA 1P4XA 4PDKA 1TWFJ 3KYCB 2V1DA 4L5EA 5GPCA 4XL9A 3WTXC 2R5ZB 2DA2A 2CUFA 4DYCA 1FTTA 4IEJA 1KQ8A 4AU7A 2IS2A 2FSWA 1GUUA 3IKVA 2L5QA 2O8KA 1MNEA 2HDCA 1W7PB 3ULQB 4KMUX 4X0GA 2WADA 2BW3B 2M9HA 3IV5A 2JN6A 5FGMA 3V7RA 1WGXA 2R7DA 3RPUD 1TWCJ 4PSXA 3MKLA 4LOCA 1VI0A 3C2HA 3JRGA 4H4KC 4PFOA 4LLGF 1Z6RA 4IOCF 1D1CA 3OOPA 1SVOA 1K78B 2CWEA 2VT2A 2K4BA 4I98B 4U88A 5J8CA 1SFOJ 3ZPLA 3AAFA 1VQ5I 1ETYA 2OAZA 3VB2A 1T2KA 2F2EA 2JPBA 1WHUA 2DA1A 5B66C 3RQ4A 2X6YA 3CC2I 2BVLA 4F91B 3Q9VA 3AG4H 1A5JA 2B0LA 3OS0A 3CDLA 2ISYA 3FIWA 1N77A 3QODA 1R4MB 2OV7A 4A93J 2P8TA 1R22A 5F0HA 3K4MA 1F1ZA 3HOUJ 2MW8A 3K4KA 1MBEA 2H6BA 2JVGA 2LY2A 4OIRF 2ADUA 4XLNF 2ZFUA 2EIMH 1Y8RB 4XLHA 3L2RA 2YUSA 2DFFA 2DQLA 3W2WA 1YLFA 3K2ZA 4A3MJ 4G94A 4LG3A 3ERED 3JRFA 5KK1A 2DT7B 1UCRA 2Y75A 4A6EA 2L0KA 3KP2A 3NQOA 4L9NA 2JSCA 3DBHB 4M6VA 2DJIA 5A2QZ 1OMIA 4S05A 2DOAA 4BXFA 4AIHA 5IY5H 1QZEA 2GIZA 1TQPA 2E5NA 2Z16A 1ZAOA 4QPOA 1KYZA 1A04A 2X1CA 3LSMA 2M4GA 3RKXA 3TDZC 1YIJI 5ILVA 3BR0A 2YX7A 3V8LA 1ZGWA 4BY7J 4UV8A 2XUBA 3H5RA 4XLPF 2DDAA 2XPUA 1VQ9I 3OYKA 3E5QA 3FBIB 2IGMA 3QP5A 4AUXA 2VI6A 3ASOH 2A61A 3K4LA 3G2BA 2EQRA 4RMNA 3L1PA 3QRFF 4UUSA 3ESWB 3G1MA 1GT0C 2VJ4A 3G71I 1MSFC 1D8KA 3FMQA 2P7CB 1PVEA 2QCOA 3L2QA 5J3LA 1A6QA 1XDUA 3COAC 3CCJI 3K4JA 3WTTC 3D5SC 3IRRA 4IHXA 3KLOA 1RR8C 4IX7A 3PM1A 1P7JA 3R61A 1JUSA 4JK1X 3OYLA 2EINH 3WGGA 4B47A 2E34A 3GTQJ 5BQTA 4PSWA 4ABZA 3F9KA 1SD6A 1UFMA 1BI2A 2E60A 5IP7J 5FKOA 1X3WB 3CDIA 3VSLA 2VL8A 2HOSA 1D0ZA 2Q2EA 5BNGA 1W7PA 4GGGA 5M5YJ 5D5UB 3RDIA 3I56I 3CC4I 4IHYA 2W25A 3BJAA 3DKYA 3HSEA 5E1ZB 4LLNA 2W7NA 3MZHA 1QHGA 2W24A 4GXOA 2XIGA 4Z6YA 4B09A 1SFUA 1U9OA 3E3VA 3SYTA 4YEJA 4BL0B 3OSGA 4EATA 3JAMK 5HLGA 2CU7A 1JJ6C 3P9CA 5EZHA 1EH7A 2ZNZA 2NS8A 2OJED 2Z1DA 4MQVA 1YTYA 2STWA 2DODA 2HKXA 2DMUA 1P2FA 3M8EA 4EEFG 4A0ZA 2X6OA 3J81Z 3RCOA 1BN5A 2O03A 3G4SI 3ZN0A 4DOZA 5H2FC 1CF7B 1BA5A 1E2XA 1IN5A 2UXNA 2ZC2A 2WY7Q 2M0CA 1K7AA 4HSRA 4BE0A 2PMZN 3J7ZI 2H27A 3A02A 3A4CA 4J00A 2DA6A 1NTCA 4DZJA 1NH3A 2HDDA 1LQ1A 2HQRA 3K4CA 3HZJA 2OPTA 2DA5A 1CF7A 2A5YB 2QQAA 1LEBA 2GM4A 1I6XA 2QLZA 3EDPA 3G1LA 2D2WA 1FP2A 4QIWN 3ZQCA 4M6XA 4CICA 2HTJA 3KEOA 5EJCA 3O6BB 4HEA2 1BR1A 1TP4A 1JUPA 3GTOJ 2M8EA 2VKVA 4BE1A 3KP3A 4ZJZA 1RRJA 2E2JJ 1S8NA 2E36A 1G6NA 2QWWA 3DKWA 3GLLA 2KQRA 3H9GA 1TNTA 1EJ9A 1IC8A 1Z05A 3ABMH 2R7ZJ 1UG2A 4BU2A 4C2TA 3S15J 3GZNB 5M3MJ 4CGZA 3FWEA 4B3XA 1S3JA 2VJ5A 4PJJA 5HDNA 4NUBA 3LQQA 2COMA 1R49A 1FYMA 1WQ2A 3PNVA 2NVUB 2O0YA 1UHWA 5H20A 3QU3A 1H89C 3PFIA 1TTYA 3HKZA 4HAMA 1FYKA 1U5TC 5DV5A 4IL6C 3VOEA 4MEXF 2XAQA 1ZKGA 2HS5A 3JTHA 1D5VA 1O7LA 3PNYA 1P4WA 2FF4A 3HEFA 1JHHA 3ZR8X 4ZDOA 2VOPA 2W84A 3IWZA 5B5EC 3T1BA 5LGUA 2CS3A 1BIAA 5HS8A 2HYJA 1IUYA 3J7AO 3C2GA 1G3SA 1OCRH 3FXUA 3KCCA 2VONA 1MD0A 1Z9CA 4Y7NJ 4M3FA 3G1OA 5DCFA 2V4JC 4OIOF 3PL8A 5J1RA 5D6EA 1FOYA 5IYDJ 2CRGA 4EV0A 2F48A 4X1EA 4CZCA 1Y6IA 4CYCB 4AM3A 1SMYF 2KIMA 5F64A 3LSPA 2ZNYA 2HVSA 3MAJA 3MZ8A 3G73A 3S3OA 3S1NJ 3BP8A 2DK5A 1IN6A 4C3HJ 2FOWA 2KRCA 3GWZA 5FD5A 2FMLA 2IS4A 5KHDA 4A3EJ 2VBWA 3GYHX 4AYBN 3CUQA 3QPSA 1X58A 2AQFA 5D4SA 1W5TA 4MTEA 2D1HA 2FEZA 3GXOA 3W2VA 4NNJA 3IRQA 2MH2A 2G7UA 2HYGD 4EM2A 3ELKA 4EM1A 4M3DA 1MH3A 3OYMA 3NWSA 5HODA 3GLXA 1ZARA 2DA4A 4G8XA 5ILUA 1WJCA 3BR2A 2LOOA 3HOWJ 1MBFA 2MBFA 5LRRA 5JHFA 4YIRX 3OYBA 5JI6A 3BJOA 2FBIA 2NYXA 3M1EA 2ME6A 4BBRJ 5E3LA 5FKNA 3O8HA 4PJLA 1FP1D 4J19A 1B1BA 1YFHA 2M0MA 3FHZA 1XD7A 3L9FA 4KJZA 1AA7A 4L18B 1BW6A 4PJ0C 1E3PA 2K7LA 3CO6C 4B1RA 3E1SA 4GDFA 3D0SA 4M9ZA 3L2CA 1SD7A 3WE3A 1VQ4I 3S1RJ 3BQZA 3EUHC 4HF2A 1QHHD 2BHZA 4BAYA 2R7FA 1R58A 2Y2ZA 5K7FA 3VEPA 1O57A 2JMWA 3GFMA 3I59B 1ON2A 3RTRA 3FM3A 3LA2A 4DNCA 2DT6A 4RA2A 3T0YA 1UHMA 2XHKA 1HW5A 4IQ4A 2VXDA 1SFXA 1JTXA 2PLYA 3FISA 3OL3A 2VQHA 2R5YB 2H1KA 4NC7A 1DP7P 1T38A 3JRHA 4G7OF 2R7SA 1J09A 1UHSA 4F93B 3L7WA 1JT0A 1IF1A 3DTEA 1WCMJ 1USTA 3F23A 3K6GA 2LKSA 1V54H 1BI0A 3I71A 3QQAA 1E17A 2M87A 1P7IA 4Z2YA 4BE2A 1MZBA 4BQNA 1FT9A 4G7ZF
chains in the Genus database with same CATH topology
4XSXF 2PI0A 4KDPA 5FLXK 4LFUA 4U0VA 3TKYA 3QU6A 1U5TA 5AIPA 1PUEE 3E5UA 1K78A 2HQNA 3HOTA 1F9NA 3C18A 3EUHA 2IJLA 2V6CA 2OQRA 5D5VB 1QGPA 2FBKA 3F8MA 2Q0OA 5D8KB 3JW4A 1J9IA 3KEQA 2HTSA 4KT5C 4KYWA 4R1HA 4BYYA 3ABTA 1TLHB 1R00A 4RGRA 1HBXG 3FM5A 4RB2C 2ZXJA 2A3SA 1XB4A 2BYVE 2VC0A 4Q47A 3I58A 3CDHA 2Z5UA 5LEJA 2STTA 4RGUA 4YIIA 1G3TA 3ZMUA 4KIBA 4LGWA 1MGTA 1EH6A 2LF7A 1YW7A 2VXZA 1KGSA 4KIFA 3MWMA 4DQ2A 4I2OA 4ENKA 1XMKA 2L4AA 2X0LA 4BH9A 1GHCA 1G4DA 3GFJA 4Q4ZF 2ISZA 5LEKA 4KMFA 1TBXA 1JGSA 1LEAA 4XSZF 3C3WA 4E70A 2QUFA 1U2WA 2YR2A 2OBPA 4U7BA 3ZMZA 1Y0UA 2QM3A 5JFRA 4IF4A 1EH8A 1IXSB 3BPXA 2TDXA 3H3ZA 1Z91A 3SXYA 1MDMB 3CUOA 3DPLC 2EFPA 1KU9A 4HX8A 2V9VA 2O8XA 2HKOA 2FRHA 1T6SA 3F8BA 1O7FA 3U2RA 2IPQX 4FT8A 2WV0A 2Z3YA 1I1SA 1GXPA 4ESJA 2OA4A 5FO5A 1XGNA 3FX3A 2JPCA 2IT0A 5DD4A 3V8KA 2RKHA 1Z1DA 2XAHA 1ZLJA 2OZUA 1HW2A 2A68F 1HKSA 2Z99A 2L01A 2IP2A 2LF8A 5CVUA 2F5DA 4YG2F 1WWXA 4I0BA 4P5OA 2HGCA 4HBLA 3WG9A 1YW9A 2HWVA 1ZH5A 1BBYA 4IRIA 3H3UA 2O6GE 1VTNC 2A69F 2Z9OA 2ZJ2A 5LLQA 1FPQA 4ENNA 1WSUA 5HOOA 3GEZA 2XAFA 3TOBA 3F3XA 5J6XA 4Y13A 1XCVA 3E5XA 2P5LC 3VFZA 2DK8A 4R79A 1LNWA 1ZG3A 3HTSB 3J80Z 5DCMB 1P92A 2JTVA 4BQAA 1ZLKA 2EFWA 3M8FA 5DCMA 4CHUA 1C0WA 5LGNA 1FLIA 5ILSA 3CLOA 1HQCA 4LJZF 1ZG5A 2E1CA 4OIPF 5K5OA 2EV6A 4IJAA 2IRFG 2VBZA 2KKOA 2RGVA 4WWCA 1L0OC 2UXXA 3KP4A 2PEXA 5ICFA 1O3QA 2VBYA 3H92A 5DD8A 2EFQA 1X3UA 2XGXA 1YO5C 2BV6A 1FC3A 1OPCA 1FWZA 4CZZA 5F6FA 1BIBA 2FE3A 3Q5FA 5JR3A 2CSOA 1MJAA 1IN7A 4HV6A 4QWQA 1TW2A 3FF5A 2MLGA 1OKRA 1FZPB 4GYIA 1ZGAA 3F22A 3KP5A 1JHFA 1XSXA 1U8RA 3E6CC 1YS7A 3L09A 3I4PA 1S6LA 1T0FA 4OINF 4ZYHA 4I02A 1P6RA 3DFGA 3M7GA 2ELHA 3ML6A 2RC4A 3RYRA 2FNAA 1XGMA 2H09A 5L3CA 4LK1F 2C6YA 4AD9A 4NB5A 4UHTA 4UVBA 1SMTA 3TOAA 4RGSA 1F4KA 5CVRA 1LDDA 4M73A 4KFCA 2IA0A 3GX4X 1K6OA 2JZYA 5ED4A 3R6SA 2EJRA 4P9FA 4RAZA 2RN7A 3GVAA 5D6FA 1D8JA 4IVNA 2Z33A 2HR3A 3IWFA 3KLNA 3O2PE 3TQNA 4A12A 4LMYA 1B9MA 3TO9A 1QNTA 2PQ8A 3HUGA 4O6JA 2Q8KA 5FFXA 4HZFA 5ICGA 2GQQA 1HKTA 5BPDA 3KZZA 2UZKA 4UUVA 2DT5A 1OYIA 1LB2A 4L0YB 4O3MA 3KP6A 1H9TA 3DPTA 4N9HA 2A07F 5LHGA 3W6JB 4CXFA 1XGSA 4O5VA 2NNNA 3K69A 5D4RA 2MA3A 2CG4A 3B73A 3ZMSA 4HQMA 2EK5A 1O3TA 2KRFA 4LD5A 3LFKA 2VE9A 3CUQB 3RPQA 5AONA 2NS0A 5FFZA 4HW0A 3F8NA 3F8FA 1R1UA 1LDKB 2ESHA 3B02A 5L3FA 5D5WB 1IN4A 2M1BA 5E8GA 4IHTA 2Y0MA 1W7PD 4UXNA 1FBUA 5E18F 1PP7U 4L9JA 2M30A 1RUOA 2VC1A 2XAGA 3C7JA 1J75A 4KN7X 4L5JA 1Z6TA 3TO7A 2GZWA 2OQGA 1USSA 4PZJA 5D5XB 2E7WA 2KIUA 3CTAA 1U78A 3I64A 1J7KA 4ENMA 2K4JA 1BI1A 2ZMEB 5L3GA 3FXRA 4KICA 3HHGA 4LLLA 3R4KA 5BMZA 3TDUC 4AIKA 4WF2A 4I0AA 2ZMEA 5DUIA 1OYYA 2ETHA 3DF8A 1QQIA 2DW4A 4TV7A 4LK0F 2PMUA 3ZMVA 1GXQA 5L3EA 2XVCA 2QBYA 1JE8A 4K2EA 1DPUA 1TW3A 1NHAA 4HOBA 4FX0A 1FOKA 1DPRA 2PJPA 2V1XA 5FB2A 2DQRA 2GXBA 4WX9A 1SAXA 1AOYA 3QP6A 1IAWA 3JAMZ 1MJ9A 3BY6A 4OMZA 1J0RA 3FMRA 4G9YA 4HYEA 5CVJA 4G7HF 2EA4A 3ABUA 1YS6A 2L02A 3BROA 1KA8A 1TQIA 1ZREA 2CQKA 2FXAA 3V8JA 3IC7A 1HXDA 1J5YA 4FX4A 4HX7A 3E6MA 1I5ZA 1HW1A 4NHJA 4CO8A 1IZ1A 4ZZLA 3I54A 4NQWA 4GYGA 3RI4A 1ZGJA 5LHIA 4ON0A 4ESBA 3P7NA 2X4HA 5LHHA 3N97A 4A2UA 4L5IA 1F5TA 1JXSA 2DLLA 3SFZA 4Q5SF 5BPIA 4XBFA 2H6CA 4A6DA 3BPVA 4L0ZB 3E97A 2GAUA 3KP7A 4WXHA 1R1TA 3K1NA 1HSJA 5E8IA 2E7XA 1GVJA 3SQNA 3ECHA 4MEYF 1WRJA 1FX7A 4I01A 3TO6A 4UVAA 1QPMA 3D5LA 4AVPA 3WGIA 4XRFA 4R8HA 2GA1A 3RYPA 4MHGA 4PGHA 1QZYA 2YSRA 4ASNA 3HOSA 2WWYA 1STZA 2M5WA 1RZ4A 1B6AA 3DEUA 3HTUA 5ICCA 3WTVC 1LDJA 2D1VA 1DDNA 4N9IA 2BBYA 3K1PA 3LSTA 1B9NA 1BOAA 1IRFA 2XROA 3HRUA 3EQLF 3CJNA 2V79A 4KNYA 1WKMA 3TGNA 1SD4A 5CYVA 1R23A 1J59A 2J5PA 1YYVA 2QQ9A 4ZYEA 1G3YA 4EJUA 5HDGA 5E1WA 3QPHA 3M9AA 4EJWA 2VN2A 3FXQA 2ZO4A 4BXUA 2H94A 2A6HF 1RI7A 4HDUA 3WTSC 4RB3C 4HX4A 4HQEA 1XSDA 3KFWX 3IHUA 4M71A 4IXAA 1XGOA 3S2WA 1K79A 3DQVC 3R60A 1TQMA 3SZPA 4HF0A 4IRGA 4U0WA 3LQRA 3RJPA 4YFNF 2LKPA 3GO5A 2FBHA 4RB1A 5HLIA 1P4AA 1BI3A 1YG2A 4HDVA 1PDNC 2NRAC 4Q48A 2MLKA 4HLXA 4BHBA 5K1YA 4EQQA 2F5FA 3GZ6A 4ENJA 2EFNA 2ZCWA 4UV9A 3QAHA 1RNLA 2VE8A 3WTZA 1XSVA 2EFOA 5BOXA 2EV5A 2PG4A 3OV8A 2IW5A 3E6DA 5IT3A 1BM9A 3CO7C 3U1DA 4U7DA 4B8XA 2WC2A 3T5XA 1XCBA 4G6DA 1ODDA 2D45A 2YPRA 3KZYA 2MC3A 3L00A 3W6KB 2EV0A 2K02A 3HRMA 1MKMA 3SHFA 4ETSA 2NNYA 1S29A 1ZYRF 2F5CA 4RB0A 1ZG1A 4UNOA 2DI3A 4PGGA 1W5SA 4GO1A 3WGHA 4KN4X 3PQJA 1AWCA 4N0BA 5E1XA 3T8TA 2FU4A 2VT3A 2ZKZA 2RQPA 5CVIA 1RIOH 2CGPA 3CUQC 1ZRDA 4MTDA 4AIJA 5HVQC 1ZHFA 2FMYA 1IN8A 1I1GA 2P7VB 3WU0A 4CDGA 2XRNA 2P6TA 4OMYA 2VBXA 3I59A 3ECOA 2G7HA 4G6QA 2P5VA 1H0MA 3R0JA 4OIQF 1KU7A 3MCZA 1RUNA 2JRTA 1YW8A 1FBSA 4ZYDA 2LSOA 3V7CA 2QENA 3J81K 4EJOA 3RPUA 1ZRFA 4EGYA 3LAPA 2DAOA 4GCVA 3ZMTA 3ZMDA 3HSFA 3ISPA 5TJJA 1KQ9A 4HF1A 2PFBA 4A5MA 2XKOA 5AIQA 2MD5A 5HLHA 3N4MA 2HFHA 5CJ9A 2RNJA 3ZN1A 2VOOA 1D3YA 1XDSA 4Y15A 1LJ9A 1IW7F 5L3BA 1W4MA 1FBQA 2QYOA 3V7SA 5DYMA 2RVCA 4WCGA 1T39A 2NAZA 1ON1A 3BZ6A 3F6VA 3WODF 5E17F 2PN6A 1LVAA 2W57A 4LG0B 5F1RA 5FD6A 3HSRA 1V3FA 2YX4A 2HYFA 3GF2A 4LG0A 5L3DA 3WTYC 4S04A 2RV8A 1EV7A 2UWMA 1MDMA 2XKPA 2R3SA 2K27A 3WE2A 1R1VA 3MEXA 2HEOA 2P4WA 4EGZA 5TRDA 4UVCA 4RS8A 3DV8A 2CO5A 3F8CA 4EM0B 3PQKA 2EA2A 3U9GA 1B59A 2FOKA 2HOEA 1FY7A 5E20A 5EEGA 1FNNA 3BOQA 3QOPA 4MGRA 3R0AA 4JQFA 2QBYB 1OYWA 1R5HA 2GIVA 2P6SA 5HS7A 3MZYA 4A0XA 5LGTA 3KE2A 2J5OA 1Z7UA 3HHHA 5D8LB 4ESFA 4RGXA 5JHUA 3EETA 3O3KA 4WK8F 1XMAA 3F21A 5BS6A 5ERIA 3QPTA 2FA5A 1ONVA 2LNBA 2QQBA 3WTWC 2DPDA 2CW0F 2ZBKA 3JSOA 4KUMA 2ESNA 1Q1HA 2M45A 4M9SA 2DO7A 3GZ5A 4LB6B 2GXGA 4OOIA 5DEQA 1L3LA 2XASA 2XAJA 3RKYA 2ACJA 1PP8F 2DFIA 5K5QA 1KYWA 2BGCA 2DU9A 3HRSA 2P5KA 4AWXB 1G3WA 2Y48A 1B4AA 3C1DA 2PBIA 4YFXF 3REOA 1ZN2A 3SZTA 1DUXC 3WU1B 2OU2A 1KU2A 3MFKA 4EMSA 1I27A 5FLXZ 4I7HA 3Q9SA 2EWNA 3V4GA 1BJAA 1KU3A 2QVOA 4M74A 1IXCA 3JTGA 4FHTA 1R7JA 5DUKA 4IHSA 5K5RA 1S7OA 1MJBA 3LWFA 3RIRA 3NEUA 4L9TA 4ZYGA 5JVTA 1SD5A 2AXLA 4HA8A 2GA2A 1OR7A 4ZZDA 3BJ6A 1O3RA 2HZTA 4H0EA 1REPC 5H6RA 4LB5A 2OD5A 2VODA 4M6YA 4PCQA 2L4MA 2MH9A 4Y17A 1R36A 1IRGA 2XV4S 5CVVA 2JT1A 3P9IA 3IL2A 3I53A 3GFIA 2EB7A 3GFLA 4QLCU 3ZP5A 3VODA 3ROUA 4EJTA 3MQ0A 2OZ6A 5ICEA 5EEHA 1XN7A 2KJBA 2BEOA 3DP7A 4P55A 2DPUA 1YIOA 3HYIA 4P96A 5HDKA 5A2QK 3P9KA 5DDGA 3ZQ7A 4BHPA 1SFEA 3HRTA 1FSHA 3FMSA 4BNCA 1QZZA 4JBAA 5IT9Z 4RAYA 2GWRA 2L3DA 2RDPA 3JSPA 4WXDA 4IRHA 1U3EM 2L54A 3KETA 1ZRCA 3WTUC 3LA7A 3BDDA 1FYLA 4WXCA 3G3ZA 3E6BA 4A5NA 3I5UA 2PMHA 3EYYA 3LAJA 2YU3A 4I09A 1UB9A 1R5GA 3EYIA 1ULYA 3K9TA 4EJVA 1HSTA 1V4RA 4L9VA 5LBQA 2O3FA 2QZ8A 3BWGA 3DXJF 2G9WA 2CYYA 3FZVA 5H6QA 2FNPA 1J2XA 3K1MA 4YIFA 4IPAA 1BC8C 2V1UA 4A0YA 5KVRA 4BHCA 2DBBA 1U5TB 1H9GA 2F5EA 2AS5F 4HV5A 1T98A 2A6EF 4MNUA 4EVIA 3J80K 3K0LA 4KIGA 3LA3A 1WI9A 1BC7C 3GUDA 2CFXA 2ZFWA 4ZH4F 3GW2A 2IA1A 4MQ9F 2E1NA 2BE5F 2FQ3A 3F6OA 2O61A 3HIFA 1CGPA 1QO0D 1QBJA 1IXRC 3T8RA 4P9UA 1U6GA 2KIFA 2IVMA 4U0YA 5HS9A 4CYDA 6PAXA 3RKWA 1TNSA 4HLYA 1KQ0A 2LDUA 4F7ZA 4D0PA 2KJCA 4M9XA 4KA4A 2WTEA 1HKQA 1FSEA 2IA2A 4YFKF 1S7AA 2K86A 3F72A 1YQAA 2W85A 5LRSA 5J8FA 3NRVA 2DTRA 3IKTA 4M72A 5CLSA 5IT9K 1O3SA 4OU0A 3I0TA 1P4XA 4PDKA 2V1DA 3WTXC 1KQ8A 2FSWA 3IKVA 2HDCA 1W7PB 3ULQB 4KMUX 5FGMA 3V7RA 2R7DA 4LLGF 1Z6RA 3OOPA 1K78B 2CWEA 2VT2A 2K4BA 4I98B 4U88A 5J8CA 3ZPLA 3AAFA 2OAZA 3VB2A 1T2KA 2F2EA 2JPBA 3Q9VA 2B0LA 2ISYA 2P8TA 1R22A 1F1ZA 2H6BA 4OIRF 2ADUA 4XLNF 2DQLA 1YLFA 3K2ZA 4G94A 3ERED 5KK1A 1UCRA 2Y75A 4A6EA 3KP2A 3NQOA 4L9NA 2JSCA 5A2QZ 1OMIA 4S05A 4AIHA 1TQPA 1ZAOA 1KYZA 1A04A 3RKXA 3TDZC 5ILVA 2YX7A 3V8LA 4UV8A 2XUBA 4XLPF 3E5QA 3QP5A 2A61A 3QRFF 1D8KA 3FMQA 2P7CB 1XDUA 3COAC 3WTTC 3IRRA 3KLOA 3R61A 4JK1X 3WGGA 5BQTA 1SD6A 1UFMA 1BI2A 2Q2EA 5D5UB 1W7PA 4GGGA 3RDIA 2W25A 3BJAA 3HSEA 5E1ZB 4LLNA 3MZHA 2W24A 4GXOA 2XIGA 4B09A 1SFUA 3E3VA 3JAMK 5HLGA 3P9CA 1EH7A 2ZNZA 4MQVA 1YTYA 2STWA 2HKXA 1P2FA 3M8EA 4A0ZA 3J81Z 1BN5A 2O03A 3ZN0A 1CF7B 1E2XA 1IN5A 2UXNA 1K7AA 2H27A 1LQ1A 2HQRA 1CF7A 2A5YB 2QQAA 1LEBA 1I6XA 2QLZA 3EDPA 2D2WA 1FP2A 4M6XA 4CICA 2HTJA 3KEOA 3O6BB 2M8EA 3KP3A 1S8NA 2QWWA 1G6NA 3DKWA 1TNTA 1Z05A 4CGZA 3FWEA 1S3JA 5HDNA 3LQQA 2COMA 1FYMA 1WQ2A 2O0YA 1UHWA 5H20A 3QU3A 3PFIA 1TTYA 4HAMA 1FYKA 1U5TC 5DV5A 3VOEA 4MEXF 2XAQA 2HS5A 3JTHA 1D5VA 1O7LA 1P4WA 2FF4A 1JHHA 2VOPA 2W84A 3IWZA 3T1BA 5LGUA 1BIAA 5HS8A 1IUYA 3J7AO 1G3SA 3FXUA 3KCCA 2VONA 1MD0A 1Z9CA 5DCFA 4OIOF 5D6EA 4EV0A 1SMYF 2KIMA 5F64A 2ZNYA 3MAJA 3G73A 3BP8A 2DK5A 1IN6A 3GWZA 5FD5A 2FMLA 2VBWA 3GYHX 3CUQA 5D4SA 1W5TA 4MTEA 2D1HA 2FEZA 3GXOA 3IRQA 2MH2A 2G7UA 2HYGD 4EM2A 3ELKA 4EM1A 3GLXA 1ZARA 4G8XA 5ILUA 2MBFA 5LRRA 5JI6A 3BJOA 2FBIA 2NYXA 3M1EA 1FP1D 1B1BA 1YFHA 3FHZA 1XD7A 3L9FA 4L18B 2K7LA 3CO6C 3D0SA 4M9ZA 3L2CA 1SD7A 3WE3A 4HF2A 4BAYA 2R7FA 1R58A 3VEPA 1O57A 3GFMA 3I59B 1ON2A 3RTRA 3FM3A 3LA2A 4DNCA 3T0YA 1UHMA 2XHKA 1HW5A 1SFXA 2PLYA 1DP7P 1T38A 4G7OF 3L7WA 1IF1A 3F23A 1USTA 1BI0A 3I71A 1E17A 2M87A 4Z2YA 1MZBA 1FT9A 4G7ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSX F;  2PI0 A;  4KDP A;  5FLX K;  4LFU A;  4U0V A;  3TKY A;  3QU6 A;  1U5T A;  5AIP A;  1PUE E;  3E5U A;  1K78 A;  2HQN A;  3HOT A;  1F9N A;  3C18 A;  3EUH A;  2IJL A;  2V6C A;  2OQR A;  5D5V B;  1QGP A;  2FBK A;  3F8M A;  2Q0O A;  5D8K B;  3JW4 A;  1J9I A;  3KEQ A;  2HTS A;  4KT5 C;  4KYW A;  4R1H A;  4BYY A;  3ABT A;  1TLH B;  1R00 A;  4RGR A;  1HBX G;  3FM5 A;  4RB2 C;  2ZXJ A;  2A3S A;  1XB4 A;  2BYV E;  2VC0 A;  4Q47 A;  3I58 A;  3CDH A;  2Z5U A;  5LEJ A;  2STT A;  4RGU A;  4YII A;  1G3T A;  3ZMU A;  4KIB A;  4LGW A;  1MGT A;  1EH6 A;  2LF7 A;  1YW7 A;  2VXZ A;  1KGS A;  4KIF A;  3MWM A;  4DQ2 A;  4I2O A;  4ENK A;  1XMK A;  2L4A A;  2X0L A;  4BH9 A;  1GHC A;  1G4D A;  3GFJ A;  4Q4Z F;  2ISZ A;  5LEK A;  4KMF A;  1TBX A;  1JGS A;  1LEA A;  4XSZ F;  3C3W A;  4E70 A;  2QUF A;  1U2W A;  2YR2 A;  2OBP A;  4U7B A;  3ZMZ A;  1Y0U A;  2QM3 A;  5JFR A;  4IF4 A;  1EH8 A;  1IXS B;  3BPX A;  2TDX A;  3H3Z A;  1Z91 A;  3SXY A;  1MDM B;  3CUO A;  3DPL C;  2EFP A;  1KU9 A;  4HX8 A;  2V9V A;  2O8X A;  2HKO A;  2FRH A;  1T6S A;  3F8B A;  1O7F A;  3U2R A;  2IPQ X;  4FT8 A;  2WV0 A;  2Z3Y A;  1I1S A;  1GXP A;  4ESJ A;  2OA4 A;  5FO5 A;  1XGN A;  3FX3 A;  2JPC A;  2IT0 A;  5DD4 A;  3V8K A;  2RKH A;  1Z1D A;  2XAH A;  1ZLJ A;  2OZU A;  1HW2 A;  2A68 F;  1HKS A;  2Z99 A;  2L01 A;  2IP2 A;  2LF8 A;  5CVU A;  2F5D A;  4YG2 F;  1WWX A;  4I0B A;  4P5O A;  2HGC A;  4HBL A;  3WG9 A;  1YW9 A;  2HWV A;  1ZH5 A;  1BBY A;  4IRI A;  3H3U A;  2O6G E;  1VTN C;  2A69 F;  2Z9O A;  2ZJ2 A;  5LLQ A;  1FPQ A;  4ENN A;  1WSU A;  5HOO A;  3GEZ A;  2XAF A;  3TOB A;  3F3X A;  5J6X A;  4Y13 A;  1XCV A;  3E5X A;  2P5L C;  3VFZ A;  2DK8 A;  4R79 A;  1LNW A;  1ZG3 A;  3HTS B;  3J80 Z;  5DCM B;  1P92 A;  2JTV A;  4BQA A;  1ZLK A;  2EFW A;  3M8F A;  5DCM A;  4CHU A;  1C0W A;  5LGN A;  1FLI A;  5ILS A;  3CLO A;  1HQC A;  4LJZ F;  1ZG5 A;  2E1C A;  4OIP F;  5K5O A;  2EV6 A;  4IJA A;  2IRF G;  2VBZ A;  2KKO A;  2RGV A;  4WWC A;  1L0O C;  2UXX A;  3KP4 A;  2PEX A;  5ICF A;  1O3Q A;  2VBY A;  3H92 A;  5DD8 A;  2EFQ A;  1X3U A;  2XGX A;  1YO5 C;  2BV6 A;  1FC3 A;  1OPC A;  1FWZ A;  4CZZ A;  5F6F A;  1BIB A;  2FE3 A;  3Q5F A;  5JR3 A;  2CSO A;  1MJA A;  1IN7 A;  4HV6 A;  4QWQ A;  1TW2 A;  3FF5 A;  2MLG A;  1OKR A;  1FZP B;  4GYI A;  1ZGA A;  3F22 A;  3KP5 A;  1JHF A;  1XSX A;  1U8R A;  3E6C C;  1YS7 A;  3L09 A;  3I4P A;  1S6L A;  1T0F A;  4OIN F;  4ZYH A;  4I02 A;  1P6R A;  3DFG A;  3M7G A;  2ELH A;  3ML6 A;  2RC4 A;  3RYR A;  2FNA A;  1XGM A;  2H09 A;  5L3C A;  4LK1 F;  2C6Y A;  4AD9 A;  4NB5 A;  4UHT A;  4UVB A;  1SMT A;  3TOA A;  4RGS A;  1F4K A;  5CVR A;  1LDD A;  4M73 A;  4KFC A;  2IA0 A;  3GX4 X;  1K6O A;  2JZY A;  5ED4 A;  3R6S A;  2EJR A;  4P9F A;  4RAZ A;  2RN7 A;  3GVA A;  5D6F A;  1D8J A;  4IVN A;  2Z33 A;  2HR3 A;  3IWF A;  3KLN A;  3O2P E;  3TQN A;  4A12 A;  4LMY A;  1B9M A;  3TO9 A;  1QNT A;  2PQ8 A;  3HUG A;  4O6J A;  2Q8K A;  5FFX A;  4HZF A;  5ICG A;  2GQQ A;  1HKT A;  5BPD A;  3KZZ A;  2UZK A;  4UUV A;  2DT5 A;  1OYI A;  1LB2 A;  4L0Y B;  4O3M A;  3KP6 A;  1H9T A;  3DPT A;  4N9H A;  2A07 F;  5LHG A;  3W6J B;  4CXF A;  1XGS A;  4O5V A;  2NNN A;  3K69 A;  5D4R A;  2MA3 A;  2CG4 A;  3B73 A;  3ZMS A;  4HQM A;  2EK5 A;  1O3T A;  2KRF A;  4LD5 A;  3LFK A;  2VE9 A;  3CUQ B;  3RPQ A;  5AON A;  2NS0 A;  5FFZ A;  4HW0 A;  3F8N A;  3F8F A;  1R1U A;  1LDK B;  2ESH A;  3B02 A;  5L3F A;  5D5W B;  1IN4 A;  2M1B A;  5E8G A;  4IHT A;  2Y0M A;  1W7P D;  4UXN A;  1FBU A;  5E18 F;  1PP7 U;  4L9J A;  2M30 A;  1RUO A;  2VC1 A;  2XAG A;  3C7J A;  1J75 A;  4KN7 X;  4L5J A;  1Z6T A;  3TO7 A;  2GZW A;  2OQG A;  1USS A;  4PZJ A;  5D5X B;  2E7W A;  2KIU A;  3CTA A;  1U78 A;  3I64 A;  1J7K A;  4ENM A;  2K4J A;  1BI1 A;  2ZME B;  5L3G A;  3FXR A;  4KIC A;  3HHG A;  4LLL A;  3R4K A;  5BMZ A;  3TDU C;  4AIK A;  4WF2 A;  4I0A A;  2ZME A;  5DUI A;  1OYY A;  2ETH A;  3DF8 A;  1QQI A;  2DW4 A;  4TV7 A;  4LK0 F;  2PMU A;  3ZMV A;  1GXQ A;  5L3E A;  2XVC A;  2QBY A;  1JE8 A;  4K2E A;  1DPU A;  1TW3 A;  1NHA A;  4HOB A;  4FX0 A;  1FOK A;  1DPR A;  2PJP A;  2V1X A;  5FB2 A;  2DQR A;  2GXB A;  4WX9 A;  1SAX A;  1AOY A;  3QP6 A;  1IAW A;  3JAM Z;  1MJ9 A;  3BY6 A;  4OMZ A;  1J0R A;  3FMR A;  4G9Y A;  4HYE A;  5CVJ A;  4G7H F;  2EA4 A;  3ABU A;  1YS6 A;  2L02 A;  3BRO A;  1KA8 A;  1TQI A;  1ZRE A;  2CQK A;  2FXA A;  3V8J A;  3IC7 A;  1HXD A;  1J5Y A;  4FX4 A;  4HX7 A;  3E6M A;  1I5Z A;  1HW1 A;  4NHJ A;  4CO8 A;  1IZ1 A;  4ZZL A;  3I54 A;  4NQW A;  4GYG A;  3RI4 A;  1ZGJ A;  5LHI A;  4ON0 A;  4ESB A;  3P7N A;  2X4H A;  5LHH A;  3N97 A;  4A2U A;  4L5I A;  1F5T A;  1JXS A;  2DLL A;  3SFZ A;  4Q5S F;  5BPI A;  4XBF A;  2H6C A;  4A6D A;  3BPV A;  4L0Z B;  3E97 A;  2GAU A;  3KP7 A;  4WXH A;  1R1T A;  3K1N A;  1HSJ A;  5E8I A;  2E7X A;  1GVJ A;  3SQN A;  3ECH A;  4MEY F;  1WRJ A;  1FX7 A;  4I01 A;  3TO6 A;  4UVA A;  1QPM A;  3D5L A;  4AVP A;  3WGI A;  4XRF A;  4R8H A;  2GA1 A;  3RYP A;  4MHG A;  4PGH A;  1QZY A;  2YSR A;  4ASN A;  3HOS A;  2WWY A;  1STZ A;  2M5W A;  1RZ4 A;  1B6A A;  3DEU A;  3HTU A;  5ICC A;  3WTV C;  1LDJ A;  2D1V A;  1DDN A;  4N9I A;  2BBY A;  3K1P A;  3LST A;  1B9N A;  1BOA A;  1IRF A;  2XRO A;  3HRU A;  3EQL F;  3CJN A;  2V79 A;  4KNY A;  1WKM A;  3TGN A;  1SD4 A;  5CYV A;  1R23 A;  1J59 A;  2J5P A;  1YYV A;  2QQ9 A;  4ZYE A;  1G3Y A;  4EJU A;  5HDG A;  5E1W A;  3QPH A;  3M9A A;  4EJW A;  2VN2 A;  3FXQ A;  2ZO4 A;  4BXU A;  2H94 A;  2A6H F;  1RI7 A;  4HDU A;  3WTS C;  4RB3 C;  4HX4 A;  4HQE A;  1XSD A;  3KFW X;  3IHU A;  4M71 A;  4IXA A;  1XGO A;  3S2W A;  1K79 A;  3DQV C;  3R60 A;  1TQM A;  3SZP A;  4HF0 A;  4IRG A;  4U0W A;  3LQR A;  3RJP A;  4YFN F;  2LKP A;  3GO5 A;  2FBH A;  4RB1 A;  5HLI A;  1P4A A;  1BI3 A;  1YG2 A;  4HDV A;  1PDN C;  2NRA C;  4Q48 A;  2MLK A;  4HLX A;  4BHB A;  5K1Y A;  4EQQ A;  2F5F A;  3GZ6 A;  4ENJ A;  2EFN A;  2ZCW A;  4UV9 A;  3QAH A;  1RNL A;  2VE8 A;  3WTZ A;  1XSV A;  2EFO A;  5BOX A;  2EV5 A;  2PG4 A;  3OV8 A;  2IW5 A;  3E6D A;  5IT3 A;  1BM9 A;  3CO7 C;  3U1D A;  4U7D A;  4B8X A;  2WC2 A;  3T5X A;  1XCB A;  4G6D A;  1ODD A;  2D45 A;  2YPR A;  3KZY A;  2MC3 A;  3L00 A;  3W6K B;  2EV0 A;  2K02 A;  3HRM A;  1MKM A;  3SHF A;  4ETS A;  2NNY A;  1S29 A;  1ZYR F;  2F5C A;  4RB0 A;  1ZG1 A;  4UNO A;  2DI3 A;  4PGG A;  1W5S A;  4GO1 A;  3WGH A;  4KN4 X;  3PQJ A;  1AWC A;  4N0B A;  5E1X A;  3T8T A;  2FU4 A;  2VT3 A;  2ZKZ A;  2RQP A;  5CVI A;  1RIO H;  2CGP A;  3CUQ C;  1ZRD A;  4MTD A;  4AIJ A;  5HVQ C;  1ZHF A;  2FMY A;  1IN8 A;  1I1G A;  2P7V B;  3WU0 A;  4CDG A;  2XRN A;  2P6T A;  4OMY A;  2VBX A;  3I59 A;  3ECO A;  2G7H A;  4G6Q A;  2P5V A;  1H0M A;  3R0J A;  4OIQ F;  1KU7 A;  3MCZ A;  1RUN A;  2JRT A;  1YW8 A;  1FBS A;  4ZYD A;  2LSO A;  3V7C A;  2QEN A;  3J81 K;  4EJO A;  3RPU A;  1ZRF A;  4EGY A;  3LAP A;  2DAO A;  4GCV A;  3ZMT A;  3ZMD A;  3HSF A;  3ISP A;  5TJJ A;  1KQ9 A;  4HF1 A;  2PFB A;  4A5M A;  2XKO A;  5AIQ A;  2MD5 A;  5HLH A;  3N4M A;  2HFH A;  5CJ9 A;  2RNJ A;  3ZN1 A;  2VOO A;  1D3Y A;  1XDS A;  4Y15 A;  1LJ9 A;  1IW7 F;  5L3B A;  1W4M A;  1FBQ A;  2QYO A;  3V7S A;  5DYM A;  2RVC A;  4WCG A;  1T39 A;  2NAZ A;  1ON1 A;  3BZ6 A;  3F6V A;  3WOD F;  5E17 F;  2PN6 A;  1LVA A;  2W57 A;  4LG0 B;  5F1R A;  5FD6 A;  3HSR A;  1V3F A;  2YX4 A;  2HYF A;  3GF2 A;  4LG0 A;  5L3D A;  3WTY C;  4S04 A;  2RV8 A;  1EV7 A;  2UWM A;  1MDM A;  2XKP A;  2R3S A;  2K27 A;  3WE2 A;  1R1V A;  3MEX A;  2HEO A;  2P4W A;  4EGZ A;  5TRD A;  4UVC A;  4RS8 A;  3DV8 A;  2CO5 A;  3F8C A;  4EM0 B;  3PQK A;  2EA2 A;  3U9G A;  1B59 A;  2FOK A;  2HOE A;  1FY7 A;  5E20 A;  5EEG A;  1FNN A;  3BOQ A;  3QOP A;  4MGR A;  3R0A A;  4JQF A;  2QBY B;  1OYW A;  1R5H A;  2GIV A;  2P6S A;  5HS7 A;  3MZY A;  4A0X A;  5LGT A;  3KE2 A;  2J5O A;  1Z7U A;  3HHH A;  5D8L B;  4ESF A;  4RGX A;  5JHU A;  3EET A;  3O3K A;  4WK8 F;  1XMA A;  3F21 A;  5BS6 A;  5ERI A;  3QPT A;  2FA5 A;  1ONV A;  2LNB A;  2QQB A;  3WTW C;  2DPD A;  2CW0 F;  2ZBK A;  3JSO A;  4KUM A;  2ESN A;  1Q1H A;  2M45 A;  4M9S A;  2DO7 A;  3GZ5 A;  4LB6 B;  2GXG A;  4OOI A;  5DEQ A;  1L3L A;  2XAS A;  2XAJ A;  3RKY A;  2ACJ A;  1PP8 F;  2DFI A;  5K5Q A;  1KYW A;  2BGC A;  2DU9 A;  3HRS A;  2P5K A;  4AWX B;  1G3W A;  2Y48 A;  1B4A A;  3C1D A;  2PBI A;  4YFX F;  3REO A;  1ZN2 A;  3SZT A;  1DUX C;  3WU1 B;  2OU2 A;  1KU2 A;  3MFK A;  4EMS A;  1I27 A;  5FLX Z;  4I7H A;  3Q9S A;  2EWN A;  3V4G A;  1BJA A;  1KU3 A;  2QVO A;  4M74 A;  1IXC A;  3JTG A;  4FHT A;  1R7J A;  5DUK A;  4IHS A;  5K5R A;  1S7O A;  1MJB A;  3LWF A;  3RIR A;  3NEU A;  4L9T A;  4ZYG A;  5JVT A;  1SD5 A;  2AXL A;  4HA8 A;  2GA2 A;  1OR7 A;  4ZZD A;  3BJ6 A;  1O3R A;  2HZT A;  4H0E A;  1REP C;  5H6R A;  4LB5 A;  2OD5 A;  2VOD A;  4M6Y A;  4PCQ A;  2L4M A;  2MH9 A;  4Y17 A;  1R36 A;  1IRG A;  2XV4 S;  5CVV A;  2JT1 A;  3P9I A;  3IL2 A;  3I53 A;  3GFI A;  2EB7 A;  3GFL A;  4QLC U;  3ZP5 A;  3VOD A;  3ROU A;  4EJT A;  3MQ0 A;  2OZ6 A;  5ICE A;  5EEH A;  1XN7 A;  2KJB A;  2BEO A;  3DP7 A;  4P55 A;  2DPU A;  1YIO A;  3HYI A;  4P96 A;  5HDK A;  5A2Q K;  3P9K A;  5DDG A;  3ZQ7 A;  4BHP A;  1SFE A;  3HRT A;  1FSH A;  3FMS A;  4BNC A;  1QZZ A;  4JBA A;  5IT9 Z;  4RAY A;  2GWR A;  2L3D A;  2RDP A;  3JSP A;  4WXD A;  4IRH A;  1U3E M;  2L54 A;  3KET A;  1ZRC A;  3WTU C;  3LA7 A;  3BDD A;  1FYL A;  4WXC A;  3G3Z A;  3E6B A;  4A5N A;  3I5U A;  2PMH A;  3EYY A;  3LAJ A;  2YU3 A;  4I09 A;  1UB9 A;  1R5G A;  3EYI A;  1ULY A;  3K9T A;  4EJV A;  1HST A;  1V4R A;  4L9V A;  5LBQ A;  2O3F A;  2QZ8 A;  3BWG A;  3DXJ F;  2G9W A;  2CYY A;  3FZV A;  5H6Q A;  2FNP A;  1J2X A;  3K1M A;  4YIF A;  4IPA A;  1BC8 C;  2V1U A;  4A0Y A;  5KVR A;  4BHC A;  2DBB A;  1U5T B;  1H9G A;  2F5E A;  2AS5 F;  4HV5 A;  1T98 A;  2A6E F;  4MNU A;  4EVI A;  3J80 K;  3K0L A;  4KIG A;  3LA3 A;  1WI9 A;  1BC7 C;  3GUD A;  2CFX A;  2ZFW A;  4ZH4 F;  3GW2 A;  2IA1 A;  4MQ9 F;  2E1N A;  2BE5 F;  2FQ3 A;  3F6O A;  2O61 A;  3HIF A;  1CGP A;  1QO0 D;  1QBJ A;  1IXR C;  3T8R A;  4P9U A;  1U6G A;  2KIF A;  2IVM A;  4U0Y A;  5HS9 A;  4CYD A;  6PAX A;  3RKW A;  1TNS A;  4HLY A;  1KQ0 A;  2LDU A;  4F7Z A;  4D0P A;  2KJC A;  4M9X A;  4KA4 A;  2WTE A;  1HKQ A;  1FSE A;  2IA2 A;  4YFK F;  1S7A A;  2K86 A;  3F72 A;  1YQA A;  2W85 A;  5LRS A;  5J8F A;  3NRV A;  2DTR A;  3IKT A;  4M72 A;  5CLS A;  5IT9 K;  1O3S A;  4OU0 A;  3I0T A;  1P4X A;  4PDK A;  2V1D A;  3WTX C;  1KQ8 A;  2FSW A;  3IKV A;  2HDC A;  1W7P B;  3ULQ B;  4KMU X;  5FGM A;  3V7R A;  2R7D A;  4LLG F;  1Z6R A;  3OOP A;  1K78 B;  2CWE A;  2VT2 A;  2K4B A;  4I98 B;  4U88 A;  5J8C A;  3ZPL A;  3AAF A;  2OAZ A;  3VB2 A;  1T2K A;  2F2E A;  2JPB A;  3Q9V A;  2B0L A;  2ISY A;  2P8T A;  1R22 A;  1F1Z A;  2H6B A;  4OIR F;  2ADU A;  4XLN F;  2DQL A;  1YLF A;  3K2Z A;  4G94 A;  3ERE D;  5KK1 A;  1UCR A;  2Y75 A;  4A6E A;  3KP2 A;  3NQO A;  4L9N A;  2JSC A;  5A2Q Z;  1OMI A;  4S05 A;  4AIH A;  1TQP A;  1ZAO A;  1KYZ A;  1A04 A;  3RKX A;  3TDZ C;  5ILV A;  2YX7 A;  3V8L A;  4UV8 A;  2XUB A;  4XLP F;  3E5Q A;  3QP5 A;  2A61 A;  3QRF F;  1D8K A;  3FMQ A;  2P7C B;  1XDU A;  3COA C;  3WTT C;  3IRR A;  3KLO A;  3R61 A;  4JK1 X;  3WGG A;  5BQT A;  1SD6 A;  1UFM A;  1BI2 A;  2Q2E A;  5D5U B;  1W7P A;  4GGG A;  3RDI A;  2W25 A;  3BJA A;  3HSE A;  5E1Z B;  4LLN A;  3MZH A;  2W24 A;  4GXO A;  2XIG A;  4B09 A;  1SFU A;  3E3V A;  3JAM K;  5HLG A;  3P9C A;  1EH7 A;  2ZNZ A;  4MQV A;  1YTY A;  2STW A;  2HKX A;  1P2F A;  3M8E A;  4A0Z A;  3J81 Z;  1BN5 A;  2O03 A;  3ZN0 A;  1CF7 B;  1E2X A;  1IN5 A;  2UXN A;  1K7A A;  2H27 A;  1LQ1 A;  2HQR A;  1CF7 A;  2A5Y B;  2QQA A;  1LEB A;  1I6X A;  2QLZ A;  3EDP A;  2D2W A;  1FP2 A;  4M6X A;  4CIC A;  2HTJ A;  3KEO A;  3O6B B;  2M8E A;  3KP3 A;  1S8N A;  2QWW A;  1G6N A;  3DKW A;  1TNT A;  1Z05 A;  4CGZ A;  3FWE A;  1S3J A;  5HDN A;  3LQQ A;  2COM A;  1FYM A;  1WQ2 A;  2O0Y A;  1UHW A;  5H20 A;  3QU3 A;  3PFI A;  1TTY A;  4HAM A;  1FYK A;  1U5T C;  5DV5 A;  3VOE A;  4MEX F;  2XAQ A;  2HS5 A;  3JTH A;  1D5V A;  1O7L A;  1P4W A;  2FF4 A;  1JHH A;  2VOP A;  2W84 A;  3IWZ A;  3T1B A;  5LGU A;  1BIA A;  5HS8 A;  1IUY A;  3J7A O;  1G3S A;  3FXU A;  3KCC A;  2VON A;  1MD0 A;  1Z9C A;  5DCF A;  4OIO F;  5D6E A;  4EV0 A;  1SMY F;  2KIM A;  5F64 A;  2ZNY A;  3MAJ A;  3G73 A;  3BP8 A;  2DK5 A;  1IN6 A;  3GWZ A;  5FD5 A;  2FML A;  2VBW A;  3GYH X;  3CUQ A;  5D4S A;  1W5T A;  4MTE A;  2D1H A;  2FEZ A;  3GXO A;  3IRQ A;  2MH2 A;  2G7U A;  2HYG D;  4EM2 A;  3ELK A;  4EM1 A;  3GLX A;  1ZAR A;  4G8X A;  5ILU A;  2MBF A;  5LRR A;  5JI6 A;  3BJO A;  2FBI A;  2NYX A;  3M1E A;  1FP1 D;  1B1B A;  1YFH A;  3FHZ A;  1XD7 A;  3L9F A;  4L18 B;  2K7L A;  3CO6 C;  3D0S A;  4M9Z A;  3L2C A;  1SD7 A;  3WE3 A;  4HF2 A;  4BAY A;  2R7F A;  1R58 A;  3VEP A;  1O57 A;  3GFM A;  3I59 B;  1ON2 A;  3RTR A;  3FM3 A;  3LA2 A;  4DNC A;  3T0Y A;  1UHM A;  2XHK A;  1HW5 A;  1SFX A;  2PLY A;  1DP7 P;  1T38 A;  4G7O F;  3L7W A;  1IF1 A;  3F23 A;  1UST A;  1BI0 A;  3I71 A;  1E17 A;  2M87 A;  4Z2Y A;  1MZB A;  1FT9 A;  4G7Z F; 
#chains in the Genus database with same CATH topology
 3HOY J;  3S1M J;  2MSY A;  1X4P A;  4XSX F;  2JQ7 A;  2PI0 A;  3LSG A;  3KIO A;  4KDP A;  5FLX K;  4CCN A;  1OCT C;  2M7B A;  4LFU A;  4U0V A;  3TKY A;  2NOG A;  3SJM A;  3QU6 A;  3AKZ A;  1U5T A;  2LFB A;  2Z2S B;  2Y9Y A;  3E5U A;  5AIP A;  5B1A H;  1K78 A;  1PUE E;  2HQN A;  3HOT A;  1F9N A;  1K6Y A;  3BTI A;  1W0U A;  3C18 A;  4RAG A;  3EUH A;  2IJL A;  2FUG 2;  2V6C A;  2RQQ A;  2OQR A;  5D5V B;  1RET A;  1QGP A;  2JUG A;  2FBK A;  3F8M A;  3HM5 A;  3JRI A;  2Q0O A;  5GP9 A;  5D8K B;  2JSP A;  3JW4 A;  1W36 C;  1J9I A;  1IV8 A;  3TW6 A;  2PJR A;  3KEQ A;  2HTS A;  2XB5 A;  4KT5 C;  1D1B A;  4KYW A;  2M8G X;  2I5U A;  4R1H A;  4BYY A;  3ABT A;  3W3C A;  3E0J B;  1TLH B;  1R00 A;  2HXO A;  4RGR A;  3OY9 A;  4AVZ A;  1HBX G;  3FM5 A;  4RB2 C;  1WJF A;  2ZXJ A;  1LE8 A;  4XKW A;  2Y0S A;  3DEE A;  2A3S A;  2OCC H;  4IOA F;  1XB4 A;  2BYV E;  2MD0 A;  2VC0 A;  4Q47 A;  3I58 A;  3CDH A;  2Z5U A;  5LEJ A;  2STT A;  1Z0X A;  4RGU A;  2K40 A;  4YII A;  1G3T A;  3DEW A;  4KIB A;  3ZMU A;  4LGW A;  1MGT A;  4F52 A;  3H3V K;  4PJM A;  1EH6 A;  2LF7 A;  1YW7 A;  2VXZ A;  1KGS A;  4KIF A;  1XTA A;  3MWM A;  4IQJ A;  4DQ2 A;  4I2O A;  4ENK A;  1XMK A;  1X19 A;  2L4A A;  2X0L A;  4BH9 A;  1GHC A;  1G4D A;  4C2M J;  3GFJ A;  2AO9 A;  5B1B H;  4CCL A;  4Q4Z F;  2ISZ A;  2F6C A;  2VIX A;  4E7I A;  2X51 A;  5LEK A;  4KMF A;  1Z21 A;  1TBX A;  1JGS A;  2HQ5 A;  1LEA A;  3RKQ A;  4XSZ F;  3C3W A;  4E70 A;  1P9Q C;  1SAN A;  2HZD A;  3OOU A;  3BR6 A;  2QUF A;  1U2W A;  3OYN A;  4BGD A;  4NDL A;  3SZG A;  2IBD A;  2YR2 A;  2R7U A;  1EKE A;  2OBP A;  4XLC A;  4U7B A;  3H9J A;  3ZMZ A;  3BG5 A;  3Q0V A;  1Y0U A;  1B8I B;  2QM3 A;  5JFR A;  4BAC A;  4IF4 A;  5IP6 A;  1EH8 A;  2DXI A;  1IXS B;  3BPX A;  2TDX A;  3H3Z A;  3NAU A;  1Z91 A;  2Y9Z A;  1K83 J;  3SXY A;  1ZR4 A;  1MDM B;  4AC0 A;  3UNG C;  4U87 A;  2DA7 A;  3CUO A;  3WU2 C;  3DPL C;  2EFP A;  1YX5 A;  1I3Q J;  1KU9 A;  4HX8 A;  2R5Z A;  2V9V A;  4A3B J;  2O8X A;  2KLO A;  2HKO A;  2XGC A;  2FRH A;  3JCU C;  3LSR A;  1T6S A;  3F8B A;  1O7F A;  2JWT A;  1X1A A;  3U2R A;  2IPQ X;  4FT8 A;  2WV0 A;  4II3 A;  2Z3Y A;  1I1S A;  4NC8 A;  1GXP A;  4ESJ A;  2O9L A;  3GTP J;  5GAH J;  3S93 A;  3PIO F;  2OA4 A;  1H88 C;  5FO5 A;  1XGN A;  4HNU A;  3FX3 A;  5C44 J;  2JPC A;  5GAG J;  2GLO A;  5EG0 A;  2IT0 A;  1YRN A;  4BQQ A;  4LIV A;  3K7A J;  5DD4 A;  1A6I A;  3V8K A;  2RKH A;  1Z1D A;  4P1W A;  2YU9 J;  2XAH A;  4XOP A;  1ZLJ A;  4YEL A;  2OZU A;  1HW2 A;  1GV2 A;  1YJW I;  5EG0 B;  2CUE A;  2A68 F;  2BW3 A;  1YE9 A;  1HKS A;  2ID6 A;  2ZME C;  1GV5 A;  2Z99 A;  2L7M P;  4ZC3 A;  2L01 A;  3TP0 A;  2IP2 A;  2LF8 A;  5CVU A;  4ZYA A;  2F5D A;  4YG2 F;  1WWX A;  4I0B A;  5J1Y A;  4RLQ A;  4P5O A;  2HGC A;  2XF6 A;  3MVP A;  4HBL A;  1HOM A;  3BZK A;  3WG9 A;  1YW9 A;  2B9S A;  2K85 A;  4ZTJ A;  2HWV A;  1ZH5 A;  2FX0 A;  3SEZ A;  1BBY A;  4IRI A;  2WB1 A;  3H3U A;  2O6G E;  4A3K J;  1VTN C;  2A69 F;  5F27 A;  3FKI J;  2Z9O A;  2ZJ2 A;  5LLQ A;  1FPQ A;  3ONQ A;  4ENN A;  1WSU A;  5HOO A;  3GEZ A;  2XAF A;  3TOB A;  3F3X A;  5J6X A;  1XS9 A;  4Y13 A;  1XCV A;  4FAS D;  3E5X A;  2JA5 J;  2P5L C;  3VFZ A;  1R6R A;  2DK8 A;  4R79 A;  2MC4 A;  1LNW A;  1ZG3 A;  3LSH A;  3HTS B;  3J80 Z;  3OS2 A;  3DTK A;  5DCM B;  1V5E A;  1ETO A;  3LSK A;  3CJR B;  1P92 A;  2JTV A;  2F4M B;  3DWL E;  4ANJ A;  4X6A J;  1WZ2 A;  1SFK A;  2V1N A;  5E3N A;  1K4S A;  4XLF A;  4BQA A;  1I39 A;  1ZLK A;  2EFW A;  3M8F A;  2ICW G;  2VQC A;  4V2G A;  2JK3 A;  4XOR A;  5DCM A;  5KCM A;  4CHU A;  1C0W A;  5LGN A;  1FLI A;  5ILS A;  3SFI A;  3CLO A;  3OMY A;  1ENH A;  1HQC A;  3I9V 2;  3S14 J;  4LJZ F;  2QKL B;  2NS7 A;  1MIJ A;  1ZG5 A;  1TWH J;  2E1C A;  2IGO A;  5J1U A;  1MBJ A;  4OIP F;  3TMO A;  5K5O A;  2EV6 A;  4IJA A;  4OAZ A;  2IRF G;  4DJA A;  2VBZ A;  2BVM A;  2KKO A;  4IZZ A;  2RGV A;  3UKG A;  4WWC A;  4G6T B;  1JGG A;  3OYD A;  1L0O C;  3OL4 A;  1OIS A;  2UXX A;  5KAF C;  3KP4 A;  2KPM A;  2BXZ A;  2PEX A;  4QSH A;  5ICF A;  2VBY A;  1O3Q A;  1R9T J;  3H92 A;  5DD8 A;  3A03 A;  2EFQ A;  1X3U A;  3HOZ J;  2XGX A;  4W1U A;  3ZQF A;  4BS9 A;  2BV6 A;  5JLW A;  3CCU I;  1YO5 C;  1FC3 A;  1OPC A;  3LMM A;  1FWZ A;  1O4X A;  4V19 K;  1GLN A;  4CZZ A;  3J7Y J;  5F6F A;  1BIB A;  2FE3 A;  3Q5F A;  5JR3 A;  2CSO A;  1MJA A;  3S3M A;  1IN7 A;  4HV6 A;  4QWQ A;  1TW2 A;  3FF5 A;  1SVM A;  1APL C;  2MLG A;  2EZK A;  3PIP F;  1OKR A;  4CCJ A;  3GTJ J;  1PJR A;  1FZP B;  4GYI A;  4Y52 J;  2HXI A;  1ZGA A;  3F22 A;  3AG1 H;  2HOA A;  3KP5 A;  1JHF A;  1XSX A;  1U8R A;  3CMA I;  1KZH A;  3PO2 J;  3E6C C;  2DYR H;  2XGD A;  3PSF A;  3VYS B;  1W36 D;  1YS7 A;  1GDT A;  3L09 A;  2HPI A;  5C4X J;  1S9H A;  4GRI A;  2XF5 A;  3I4P A;  1S6L A;  2ZJR F;  1T0F A;  4V2F A;  3AL0 C;  4OIN F;  4ZYH A;  1S7E A;  4I02 A;  2QF7 A;  3MN2 A;  1N75 A;  1P6R A;  3DFG A;  3KYD B;  3M7G A;  2ELH A;  2V26 A;  3ML6 A;  4QTR A;  3TW7 A;  1W0T A;  1FMV A;  4A69 C;  2RC4 A;  2HNH A;  3RYR A;  3M8J A;  2FNA A;  1XGM A;  2H09 A;  5L3C A;  4LK1 F;  2C6Y A;  4AD9 A;  3X2Q H;  4NB5 A;  4UHT A;  4UVB A;  4CCK A;  2B7E A;  1SMT A;  3TOA A;  4RGS A;  1F4K A;  3DLA A;  2BY0 A;  2WAQ N;  3HB9 A;  5CVR A;  1LDD A;  3PSI A;  3OYC A;  4M73 A;  4KFC A;  2IGK A;  2IA0 A;  3GX4 X;  1K6O A;  2FD5 A;  2JZY A;  5ED4 A;  3R6S A;  2ECC A;  2RRE A;  2EJR A;  1YX3 A;  4P9F A;  5E3M A;  1U8B A;  2R93 J;  3CQZ J;  4RAZ A;  2E71 A;  2RN7 A;  1X3Z B;  3GVA A;  5F08 A;  2JA2 A;  4PK4 A;  5D6F A;  2D5V A;  4JX5 A;  1D8J A;  4IVN A;  2Z33 A;  2HR3 A;  3IWF A;  1TT5 B;  3KLN A;  1ZR2 A;  2V7F A;  3O2P E;  1EA3 A;  3K10 A;  3KX2 A;  2ZXI A;  3TQN A;  4A12 A;  4LMY A;  1B9M A;  4JYK A;  2WA0 A;  4AYB A;  3QPL A;  4I6Z A;  2HOT A;  3ZCO A;  3F0C A;  3TO9 A;  1QNT A;  3ZQI A;  2DA3 A;  2PQ8 A;  3HG9 A;  3HUG A;  4O6J A;  2Q8K A;  5FFX A;  3Q0W A;  3I3L A;  4HZF A;  1B72 B;  5ICG A;  1OCO H;  2GQQ A;  2V9K A;  4A3J J;  1HKT A;  2L7Z A;  5BPD A;  2EIL H;  2OCE A;  5M3F J;  2JA7 J;  3KZZ A;  2UZK A;  4UUV A;  2DT5 A;  1ETW A;  1OYI A;  2Y30 A;  4JX4 A;  1B72 A;  1LB2 A;  4L0Y B;  4O3M A;  3KP6 A;  1AU7 A;  1H9T A;  1ITY A;  3DPT A;  3CCL I;  5TIS C;  3H36 A;  4B3A A;  1HLV A;  3ERM A;  4N9H A;  2A6T A;  2EZH A;  2A07 F;  1X1D A;  5LHG A;  2L2O A;  3W6J B;  2H8R A;  3DTI A;  4CXF A;  5HNF A;  1XGS A;  4O5V A;  5C4J J;  4KIT B;  2EIJ H;  2NNN A;  4XN0 A;  3A1Y A;  3K69 A;  4XRM A;  2P81 A;  4CYC A;  3KZI C;  2ZJQ F;  1MNM C;  3KEY A;  5D4R A;  2MA3 A;  2CG4 A;  3HOV J;  1PUF B;  4CCO A;  3B73 A;  1OFC X;  4HQM A;  3ZMS A;  2VKE A;  2BY2 A;  2RAE A;  4CUG A;  3RZD J;  2EK5 A;  2E1M B;  1O3T A;  2KRF A;  4LD5 A;  3LFK A;  2VE9 A;  3CUQ B;  9ANT A;  2F4O B;  3RPQ A;  5AON A;  2NS0 A;  5FFZ A;  2UUZ A;  2G0E A;  3IH3 A;  3HJE A;  4BJT A;  2F4I A;  4HW0 A;  2E1O A;  3F8N A;  2KZV A;  3F8F A;  1R1U A;  2JA6 J;  1LDK B;  4XIC A;  4BXX J;  1OLT A;  2ESH A;  3B02 A;  5L3F A;  3I55 I;  5GAD J;  1OCZ H;  5D5W B;  1X1B A;  1IN4 A;  2M1B A;  5E8G A;  4IHT A;  2Y0M A;  1W7P D;  5IOY A;  3DBL B;  1AKH A;  4UXN A;  1FBU A;  1AHD P;  1VQK I;  3D1N I;  2QSH X;  4KNY A;  5E18 F;  3HC7 A;  2QSF X;  1PP7 U;  2IXS A;  4L9J A;  2M30 A;  1WJB A;  3SDB A;  1RUO A;  5EDN A;  2NVT J;  3H5A A;  2VC1 A;  2XAG A;  1H8A C;  2CJJ A;  1Z67 A;  1KON A;  3UR3 C;  1OQY A;  3C7J A;  4XLE A;  4FTH A;  5FJ8 J;  1J75 A;  4KN7 X;  4L5J A;  1Z6T A;  5FRM A;  4XMY A;  3CCV I;  3TO7 A;  3BG6 A;  3ABL H;  3FDY A;  2GZW A;  2ZB9 A;  4HPQ A;  2OQG A;  1JKO C;  1USS A;  3H35 A;  4PZJ A;  5IYC J;  2LRE A;  4XID A;  5EYR A;  1VQL I;  3OIP A;  2E7W A;  5D5X B;  1JKR C;  4XKV A;  1N78 A;  2KIU A;  3CTA A;  3CCM I;  1DP3 A;  1Q1V A;  4XN3 A;  1U78 A;  4D1Q A;  3I64 A;  1ORK A;  2X9D A;  2QSG X;  1J7K A;  2OUM A;  4ZDL A;  4ENM A;  2GBY A;  1BI1 A;  2K4J A;  2ZME B;  1UAA A;  2NVQ J;  2ECB A;  1LKX A;  5L3G A;  1JKP C;  3FXR A;  4KIC A;  5F04 A;  2JJ7 A;  3HHG A;  4LLL A;  3R4K A;  5BMZ A;  3TDU C;  4AIK A;  4WF2 A;  2TCT A;  4I0A A;  3CMY A;  2ZME A;  2NVX J;  3IH2 A;  2YS9 A;  5DUI A;  5FKM A;  1OYY A;  2ETH A;  3DF8 A;  1QQI A;  4BEH B;  1ETQ A;  2DW4 A;  4TV7 A;  4LK0 F;  3CJQ B;  5CKT A;  2PMU A;  3ZMV A;  1GXQ A;  5L3E A;  5GTH C;  2XVC A;  1Z77 A;  1VQ8 I;  1JE8 A;  2QBY A;  4K2E A;  1DPU A;  1JI8 A;  1VQ7 I;  3PFY A;  1TW3 A;  4E7Z A;  2OTL I;  4N4O B;  4E6K G;  1NHA A;  4HOB A;  3A01 B;  5CQE A;  4FX0 A;  2E5Z A;  2MAB A;  3QWL A;  1FOK A;  3CCQ I;  1DPR A;  2PJP A;  2V1X A;  5FB2 A;  2DQR A;  2DOF A;  2GXB A;  3ZQQ A;  2VUM J;  4WX9 A;  1SAX A;  4HNT A;  1RPW A;  2LP0 A;  1FMW A;  1AOY A;  1TT0 A;  3QP6 A;  5M5X J;  1IAW A;  2GOX B;  3JAM Z;  1MJ9 A;  3BY6 A;  3A0H C;  4OMZ A;  2ELK A;  1J0R A;  3FMR A;  4G9Y A;  4HYE A;  3BT9 A;  1X2M A;  5CVJ A;  4G7H F;  3QYB A;  2EA4 A;  3ABU A;  1YS6 A;  3MKZ A;  2L02 A;  3BRO A;  1ZTR A;  1KA8 A;  1IDZ A;  1JTY A;  1QPI A;  1HC8 A;  1TQI A;  5GPA A;  1ZRE A;  2CQK A;  5M5W J;  2EPF A;  2FXA A;  1VF9 A;  2JVH A;  4M3E A;  2K5C A;  3NWT A;  1Y0N A;  3V8J A;  2M34 A;  3IC7 A;  3VYU B;  1HXD A;  2EZL A;  1J5Y A;  4FX4 A;  4HX7 A;  5FKK A;  1CQT A;  1FIA A;  3FXJ A;  4A3C J;  3E6M A;  1I5Z A;  1HW1 A;  4NHJ A;  4CO8 A;  2DOE A;  1UJ8 A;  4FET A;  5CPR B;  1LFU P;  2LC2 A;  4Y3O A;  2W1O A;  1IZ1 A;  1ETV A;  3LNQ A;  4ZZL A;  1Z3X A;  1LVK A;  2KFD A;  3I54 A;  3ZQG A;  4A3L J;  4NQW A;  2MGQ A;  2XC7 A;  4GYG A;  4W97 A;  3RI4 A;  1ZGJ A;  1E3H A;  2DMP A;  3IAS 2;  5LHI A;  4ON0 A;  4ESB A;  3P7N A;  2X4H A;  2A05 A;  3S3N A;  5FRN A;  5LHH A;  1IO2 A;  3N97 A;  2EH3 A;  4A2U A;  4L5I A;  3CF2 A;  1FOX A;  1JUM A;  3BCB A;  1F5T A;  2V9P A;  1JXS A;  1WJA A;  5HNH A;  1T95 A;  2DLL A;  3SFZ A;  4Q5S F;  5BPI A;  4I76 A;  5C3E J;  4XBF A;  2HVQ A;  1ZK8 A;  2H6C A;  4A6D A;  3BPV A;  3FBN B;  4L0Z B;  3E97 A;  2GAU A;  3KP7 A;  4WXH A;  1R1T A;  2LY9 A;  1SAU A;  3J7A Y;  3K1N A;  1HSJ A;  5E8I A;  2E7X A;  3OYI A;  1TWG J;  1GVJ A;  3SQN A;  4C3I J;  2M4K A;  3ECH A;  4MEY F;  4A3I J;  3S2H J;  1WRJ A;  1FX7 A;  4I01 A;  3TO6 A;  2DFH A;  2K9L A;  2HI3 A;  2VPR A;  4UVA A;  3DU6 A;  4E7L A;  1SEU A;  2CV0 A;  1QPM A;  4XNF A;  2R0Q C;  4BDZ A;  3D5L A;  4AVP A;  4OAY A;  4E7S A;  3WGI A;  4XOT A;  3A01 A;  4XRF A;  1XPX A;  4R8H A;  2GA1 A;  2XGE A;  2Y31 A;  3RYP A;  4MHG A;  3L2W A;  4B48 A;  2P0W A;  3B6C A;  4PGH A;  2AXT C;  1QZY A;  3TED A;  3PUF A;  2YSR A;  3TP3 A;  4ASN A;  3HOS A;  2E2I J;  1IGN A;  2WWY A;  1VFC A;  1STZ A;  2M5W A;  1RZ4 A;  1B6A A;  1DGR M;  2CQX A;  3DEU A;  2R7X A;  3HTU A;  2W00 A;  1OJL A;  1NG6 A;  2LK2 A;  2XAU A;  5ICC A;  3L2U A;  1S72 I;  3WTV C;  1LDJ A;  3LOC A;  2D1V A;  5E79 C;  2KIQ A;  1RC9 A;  1DDN A;  3OSF A;  1RKW A;  1MMN A;  4N9I A;  2R7R A;  2BBY A;  3K1P A;  3LST A;  1B9N A;  5J40 A;  1BOA A;  1IRF A;  2XRO A;  3HRU A;  5JVG F;  3EQL F;  2DYS H;  3CJN A;  2X85 A;  2AHQ A;  2V79 A;  4DYQ A;  3K70 D;  3SEQ A;  1WKM A;  5CYV A;  1SD4 A;  3TGN A;  4BKX A;  4HNV A;  3HPG A;  1R23 A;  4II2 A;  2J5P A;  5DM7 F;  1J59 A;  2LYC A;  1YYV A;  1EF4 A;  2QQ9 A;  2H8W A;  4OWR B;  4ZYE A;  4ZDP A;  1G3Y A;  5IYB J;  1XX5 A;  4EJU A;  2MFZ A;  3ZGK A;  5HDG A;  4MFE A;  2IS6 A;  5E1W A;  3JRB A;  2IEK A;  2W4S A;  3QPH A;  3M9A A;  2L7F P;  4EJW A;  2KIS A;  1X2N A;  2VN2 A;  4RAF A;  3IAM 2;  3FXQ A;  2ZO4 A;  4BXU A;  1V55 H;  5IP9 J;  2H94 A;  2A6H F;  1RI7 A;  3E7L A;  4E4H A;  4HDU A;  4A3D J;  3QYE A;  1YOV B;  3WTS C;  4RB3 C;  4HX4 A;  2X1D A;  2ZSI B;  4UB6 C;  4HQE A;  4UUS B;  1XSD A;  3H9Q A;  3IHU A;  3KFW X;  2BXY A;  3MKY B;  2L9V A;  4M71 A;  4IXA A;  2KP6 A;  1XGO A;  1BJZ A;  3S2W A;  1T08 B;  1K79 A;  2XRL A;  4E7H A;  3DQV C;  1WPK A;  3R60 A;  3KYL A;  1TQM A;  3CJT B;  1U9N A;  3PNT A;  4D7M A;  2K9Q A;  3SZP A;  4HF0 A;  3ZRG A;  2VQL A;  4IRG A;  4U0W A;  1VQM I;  3LQR A;  1SC7 A;  3CES A;  1U0J A;  3OIQ A;  2KDZ A;  3RJP A;  3ZXS A;  4YFN F;  1VND A;  2LKP A;  3M4O J;  3FK7 A;  3GO5 A;  2FBH A;  4DZP A;  4RB1 A;  2MYS A;  1P4A A;  2L9S A;  5HLI A;  3HOX J;  4BDY A;  1BI3 A;  1YG2 A;  3A2K A;  2LBF A;  3AG3 H;  4UUT A;  2CUZ A;  4HDV A;  4MIM A;  4BUP A;  1PDN C;  3EUA A;  2NRA C;  4Q48 A;  2MLK A;  4HLX A;  4HST A;  2CV1 A;  4MFD A;  4BHB A;  5K1Y A;  2F5F A;  4EQQ A;  2NXN B;  3GZ6 A;  1D0X A;  2L7K A;  1RR7 A;  4ENJ A;  2CH0 A;  3HBL A;  2EFN A;  2ZCW A;  4UV9 A;  3WHB A;  1JT6 A;  5F1J A;  3QAH A;  1RNL A;  2VE8 A;  3S2D J;  2VJI A;  4FQG A;  3WTZ A;  1XSV A;  3CLQ A;  2EFO A;  3H0G J;  5BOX A;  2EV5 A;  1DQU A;  2PG4 A;  3OV8 A;  2IW5 A;  3E6D A;  1PUF A;  3BR5 A;  1NK2 P;  5FKL A;  5IT3 A;  3GBG A;  4PFP A;  1BM9 A;  3CO7 C;  2KHM A;  3U1D A;  4B8X A;  3O8G A;  4U7D A;  2WC2 A;  1LUJ B;  2ZSH B;  3T5X A;  4D9J A;  3U1K A;  5J4Y A;  3QOE A;  1X4O A;  4LIT A;  1QVT A;  2I8D A;  4XON A;  1XCB A;  1MMG A;  2R4G A;  3DPU A;  4PUS A;  4G6D A;  1ODD A;  1ACI A;  3BG7 A;  3JR9 A;  1WI3 A;  3OR2 C;  4DBR A;  1T0F C;  3OYE A;  2D45 A;  2QGU A;  2YPR A;  2PMZ A;  1OCP A;  1ZQ3 P;  3AG2 H;  2Q1Z B;  3HGY A;  3KZY A;  2KRH A;  3U21 A;  2MC3 A;  3S8P A;  1AKH B;  2WB1 N;  3L00 A;  3W6K B;  3K2A A;  2EV0 A;  1IRX A;  1JJ8 C;  3HRM A;  2K02 A;  1MKM A;  3SHF A;  1F43 A;  2BY3 A;  4ETS A;  1I50 J;  2NNY A;  2DDB A;  2V6E A;  1S29 A;  1ZYR F;  2F5C A;  4RM3 A;  1ETX A;  4RB0 A;  3BR3 A;  1ZG1 A;  4UNO A;  3OYG A;  2DI3 A;  3RQI A;  4PGG A;  1VQ6 I;  5FLM J;  5EGO A;  1W5S A;  3BZC A;  4GO1 A;  3WGH A;  4KN4 X;  3PQJ A;  1AWC A;  4N0B A;  5E1X A;  3T8T A;  4C3J J;  3Q0U A;  1XMX A;  3RSN A;  4E7K A;  2FU4 A;  3MKW B;  2OTJ I;  2VT3 A;  2ZKZ A;  2RQP A;  1X1C A;  5CVI A;  1IUF A;  4QPQ A;  1RIO H;  1NK3 P;  2CGP A;  2W48 A;  3CUQ C;  2CQN A;  1ZRD A;  4DIQ A;  1W1W E;  1M1E B;  1POG A;  4HG2 A;  4MTD A;  4AIJ A;  5HVQ C;  1ZHF A;  2FMY A;  1IN8 A;  1I1G A;  3CCE I;  2P7V B;  3WU0 A;  2LRD A;  1PYV A;  4CDG A;  4Y33 A;  2XRN A;  1TL8 A;  2P6T A;  4BQO A;  4OMY A;  2VBX A;  1JKQ C;  3I59 A;  3ECO A;  3FXK A;  2G7H A;  1VQN I;  3MD2 A;  4G6Q A;  2P5V A;  1H0M A;  3R0J A;  4E7J A;  4OIQ F;  2CUJ A;  1KU7 A;  1B8I A;  1E0E A;  3MCZ A;  2O5R A;  2GXA A;  3S16 J;  1RUN A;  2JRT A;  1YW8 A;  1R5I D;  2FQ4 A;  2LKX A;  1FBS A;  4ZYD A;  2LSO A;  2R7V A;  3MMY B;  3V7C A;  3PO3 J;  3RZO J;  2ME0 A;  2QEN A;  5B3S H;  3J81 K;  1BL0 A;  1UEL B;  2CQ7 A;  1VQP I;  3IUO A;  4CSW A;  4EJO A;  2WAQ A;  3RPU A;  1ZRF A;  4DGW B;  1FOW A;  4EGY A;  2CW8 A;  3OS1 A;  4XRS A;  3L2V A;  4DW6 A;  3GTL J;  3LAP A;  2DAO A;  2DMN A;  4IO9 F;  4MO7 A;  4GCV A;  3ZMT A;  4XM3 A;  2X1E A;  3M1C A;  3ZMD A;  3HSF A;  3ISP A;  1WJ5 A;  5TJJ A;  1KQ9 A;  3V42 A;  3EPZ A;  4HF1 A;  2Y69 H;  2PFB A;  4A5M A;  2XKO A;  5AIQ A;  4F92 B;  3PUB A;  1A35 A;  2MD5 A;  2FJ1 A;  1FTZ A;  3LFU A;  2M7A A;  5HLH A;  3N4M A;  4B43 A;  3BCA A;  2HFH A;  5CJ9 A;  2RNJ A;  3ZN1 A;  3OIO A;  2VOO A;  1D3Y A;  2KDO A;  1QVU A;  1XDS A;  3M07 A;  1ZEL A;  3FXL A;  2R92 J;  4Y15 A;  2PJR B;  1LJ9 A;  1IW7 F;  3LL7 A;  5IPA A;  5L3B A;  3I4M J;  1OCC H;  1W4M A;  3VWB A;  2CFO A;  2N8G A;  3GTG J;  1FBQ A;  2NVY J;  2QYO A;  1RES A;  3V7S A;  2VJJ A;  5DYM A;  1MBH A;  2RVC A;  4WCG A;  1T39 A;  2NAZ A;  5E3O A;  1ON1 A;  3BZ6 A;  3F6V A;  3WOD F;  1D1A A;  2K3F A;  5E17 F;  2PN6 A;  4DBQ A;  1LVA A;  2W57 A;  3GCM A;  4LG0 B;  5F1R A;  5FD6 A;  4GFB A;  3HSR A;  1V3F A;  2YX4 A;  1LFB A;  2PX9 A;  3H5N A;  2IAI A;  3CP2 A;  2Y0S N;  2HYF A;  1TC3 C;  4NQW B;  3HL2 A;  4KIS A;  3H0D A;  3GF2 A;  4LG0 A;  1T8I A;  3BQY A;  3CMM A;  5L3D A;  3BLY A;  3WTY C;  2IS1 A;  4S04 A;  1HA8 A;  2RV8 A;  3LSJ A;  1WFX A;  1EV7 A;  2UWM A;  3NAR A;  4YRV A;  5GAE J;  2VPL A;  4S0H B;  3QYF A;  1ERD A;  2OC6 A;  1V5G A;  1MDM A;  2XKP A;  2R3S A;  3I4N J;  2K27 A;  3WE2 A;  1R1V A;  3MEX A;  2HEO A;  4BY1 J;  2P4W A;  5J4V A;  4EGZ A;  2XF7 A;  5TRD A;  4UVC A;  5KNL A;  5K7H A;  4RS8 A;  3DV8 A;  5CQG A;  3DKX A;  2Q2E B;  2CO5 A;  4XLA A;  3F8C A;  3CME I;  4EM0 B;  3PQK A;  1TWA J;  2EA2 A;  2WBM A;  3FXM A;  3U9G A;  1IDY A;  2GOM A;  1B59 A;  3D5R C;  2FOK A;  2E35 A;  2VAS A;  2HOE A;  1ETK A;  3FK6 A;  1Y56 A;  1FY7 A;  2IGN A;  5E20 A;  1YJ9 I;  4G12 A;  3ASN H;  1BR4 A;  1FIP A;  5EEG A;  1FNN A;  4F3Q A;  1G8X A;  2EBI A;  2KZG A;  3BOQ A;  2MG4 A;  2K3P A;  3QOP A;  4MGR A;  5KAI C;  3R0A A;  2EIK H;  4JQF A;  2QBY B;  1OYW A;  1R5H A;  2GIV A;  2ZXW H;  2P6S A;  5HS7 A;  3MZY A;  4A0X A;  2NOJ B;  5LGT A;  2JRM A;  1Y1V J;  2AQE A;  1LPQ A;  3KE2 A;  2J5O A;  1Z7U A;  3HHH A;  5D8L B;  1HDD C;  4ESF A;  2VQG A;  3K4N A;  1Z7L A;  4RGX A;  3S32 A;  5JHU A;  1HF0 A;  3EET A;  3O3K A;  1I6H J;  3HDD A;  3CCR I;  4A3G J;  4WK8 F;  1YRN B;  1XMA A;  3F21 A;  5BS6 A;  3CF5 F;  4XKC A;  5ERI A;  1Z3Y A;  3TL4 X;  3QPT A;  4C30 A;  2FA5 A;  2WY8 Q;  3ZQH A;  1ONV A;  2DFE A;  2HDW A;  3DU5 A;  2LNB A;  2QQB A;  3WTW C;  2DPD A;  2CW0 F;  3WHC A;  2QKM B;  2ZBK A;  3JSO A;  4KUM A;  2ESN A;  5EEA A;  2XPW A;  1Q1H A;  2M45 A;  3SDG A;  4M9S A;  2DO7 A;  3GZ5 A;  4LB6 B;  2GXG A;  3HKZ N;  3CCY A;  3BC8 A;  4OOI A;  4RLF A;  5DEQ A;  1OR7 C;  1L3L A;  2XAS A;  2DMT A;  2LG4 A;  3CD6 I;  2XB0 X;  1WJE A;  2XAJ A;  2K9M A;  3RKY A;  2LMD A;  1RKT A;  4IHW A;  2ACJ A;  1PP8 F;  2DFI A;  5K5Q A;  2ZXH A;  1KYW A;  1X1P A;  5LD2 C;  1MBK A;  2BGC A;  5J47 A;  1MND A;  2CW7 A;  2DU9 A;  3HRS A;  4FE4 A;  2CQQ A;  2P5K A;  3GTM J;  4AWX B;  1BOB A;  2LTP A;  1G3W A;  3OYH A;  4ZTF A;  2Y48 A;  1B4A A;  3VDX A;  1N25 A;  3C1D A;  1YI2 I;  3CZ6 A;  1R71 A;  2PBI A;  2E1M C;  3OWT A;  4YFX F;  3REO A;  2LD5 A;  4NBQ A;  1ZN2 A;  3SZT A;  1DUX C;  3WU1 B;  2OU2 A;  3ABK H;  1KU2 A;  3MFK A;  3JRC A;  4EMS A;  1QA6 A;  3B6A A;  3BTC A;  1WJD A;  3OYA A;  1I27 A;  5FLX Z;  2H1L A;  3HGG A;  4RBO A;  4I7H A;  3BTL A;  3Q9S A;  2EWN A;  4XK4 A;  3Q3S A;  3V4G A;  1BJA A;  2B63 J;  1KU3 A;  1Y8Q B;  1MBG A;  2QVO A;  3OYJ A;  2JA8 J;  4M74 A;  1IXC A;  3HUG B;  2OF7 A;  1HDP A;  3JTG A;  4FHT A;  4XQF A;  1R7J A;  3HPH A;  5DUK A;  4IHS A;  4IHV A;  2LR8 A;  1V5F A;  5K5R A;  1S7O A;  2VLA A;  1WH5 A;  3LSI A;  1MJB A;  3LWF A;  3VYR B;  3RIR A;  3BTJ A;  4M3B A;  5EZG A;  3NEU A;  4L9T A;  1D0Y A;  4JX6 A;  3CP8 A;  4ZYG A;  3W2A A;  5JVT A;  1VZ0 A;  1SD5 A;  2AXL A;  2LLK A;  4CCM A;  1XC5 A;  4HA8 A;  4UY8 I;  2GA2 A;  1FEX A;  3GTK J;  1I3A A;  2COB A;  2TRT A;  4RDU A;  1OR7 A;  5EF6 A;  4ZZD A;  2CMP A;  3BJ6 A;  1O3R A;  2HZT A;  1HCR A;  1DU0 A;  4H0E A;  2KMU A;  4A3F J;  1REP C;  1FJL A;  5H6R A;  4LB5 A;  3OR1 C;  2OD5 A;  4C9Y A;  2VOD A;  4M6Y A;  5GTI C;  3VSK A;  4BBS J;  1DU6 A;  4PCQ A;  1F36 A;  2L4M A;  2MH9 A;  2VKH A;  4Y17 A;  1R36 A;  1IRG A;  1LFP A;  2XV4 S;  3ZQL A;  3K4B A;  3K70 C;  3DLL F;  2A5W A;  2ID3 A;  5CVV A;  1QRY A;  3HXL A;  2I10 A;  2JT1 A;  3P9I A;  3IL2 A;  1TZL A;  1Y1W J;  3I53 A;  5K7Z A;  4Y4R A;  2DJN A;  3CCS I;  4DYR A;  3GFI A;  2EB7 A;  3GFL A;  4QLC U;  3ZP5 A;  3VOD A;  3ROU A;  4EJT A;  4XKB A;  3MQ0 A;  2OZ6 A;  2X6X A;  5ICE A;  3OYF A;  2XSD C;  1Y39 A;  5EEH A;  1XN7 A;  2O7O A;  2KL4 A;  1IV6 A;  4KT6 A;  1D5Y A;  2CV2 A;  2KJB A;  1MMA A;  2BEO A;  3DP7 A;  4B44 A;  3AFH A;  4P55 A;  2DPU A;  1YIO A;  3HYI A;  4P96 A;  4FIS A;  2LH9 A;  5HDK A;  3JRD A;  5A2Q K;  5F0C A;  2WV1 A;  2QQ8 A;  3G6E I;  3BG9 A;  3P9K A;  5DDG A;  2KT0 A;  4B4C A;  3ZQ7 A;  4BHP A;  1SFE A;  3JRE A;  2XSJ C;  3HRT A;  2R5Y A;  4AID A;  1FSH A;  3FMS A;  4BNC A;  1QZZ A;  4F55 A;  2XDV A;  4JBA A;  4D7N A;  5IT9 Z;  5FRO A;  4RAY A;  4I99 C;  2GWR A;  2L3D A;  2RDP A;  3JSP A;  4WXD A;  5DS9 A;  2VB6 A;  1YJN I;  1QU3 A;  4IRH A;  3A0B C;  1U3E M;  2L54 A;  3KET A;  2WAF A;  1ZRC A;  3H1C A;  1IRZ A;  1UG0 A;  3WTU C;  1R4N B;  3LA7 A;  3BDD A;  4PJN A;  1FYL A;  1W5C C;  4IKF A;  4WXC A;  2QA4 I;  3G3Z A;  3ZOB A;  3E6B A;  2ZJP F;  4A5N A;  3I5U A;  2PMH A;  3EYY A;  4NC6 A;  3LAJ A;  3W6V A;  1A36 A;  2YU3 A;  4CH7 A;  3BG3 A;  2K9N A;  1GVD A;  2BZT A;  4I09 A;  4LIU A;  1YIT I;  1MMS A;  2R7O A;  2HQA A;  2LY1 A;  1UB9 A;  2LBF B;  1R5G A;  2WAE A;  1ULY A;  4XR6 A;  3EYI A;  3K9T A;  4EJV A;  1HST A;  1V4R A;  3CC7 I;  4L9V A;  5LBQ A;  2O3F A;  2QZ8 A;  3BWG A;  3DXJ F;  3S17 J;  2G9W A;  2CYY A;  3FZV A;  5H6Q A;  2FNP A;  4MLO A;  1J2X A;  3K1M A;  4YIF A;  1S5L C;  2DCE A;  3JRA A;  4IPA A;  2HPM A;  3FHN A;  2K9S A;  2X6W A;  1BC8 C;  5FLV A;  1UZC A;  4FCY A;  3P5J A;  4CA0 A;  2V1U A;  4A0Y A;  4J01 A;  5KVR A;  1BR2 A;  4M3G A;  4BEH A;  4BHC A;  2DBB A;  1U5T B;  4D5F A;  4XRS G;  4C2U A;  1H9G A;  2BHY A;  2M3A A;  5TGT A;  2F5E A;  3FXO A;  2AS5 F;  1UMQ A;  1BW5 A;  4HV5 A;  2DMQ A;  2XPV A;  1MW7 A;  1T98 A;  4ITV A;  1IJW C;  2A6E F;  2E2H J;  5F0F A;  2RNG A;  2BY1 A;  5DTD A;  4MNU A;  4EVI A;  2ELJ A;  3TBI A;  3J80 K;  1YHQ I;  2L9R A;  3K0L A;  4KIG A;  3IP4 B;  3VYT B;  3FKJ A;  4RM2 A;  2UV1 A;  3LA3 A;  1WI9 A;  1K61 A;  1BC7 C;  3GUD A;  2E19 A;  2HVR A;  2X48 A;  3DBR B;  2CFX A;  1T33 A;  4BJ5 C;  3GME A;  4JOM A;  1T56 A;  1LE8 B;  2ZFW A;  3VPR A;  4ZH4 F;  3GW2 A;  3BR1 A;  4HRI A;  2IA1 A;  2LVS A;  4MQ9 F;  3AL0 B;  2E1N A;  1G2H A;  3EUK L;  1WH7 A;  4FE7 A;  1E3O C;  2BE5 F;  4N4N B;  2FQ3 A;  3F6O A;  2O61 A;  3M3Y J;  3HIF A;  4BJ6 C;  1CGP A;  1MMD A;  2F5V A;  1QO0 D;  1QBJ A;  1IXR C;  4UB8 C;  3T8R A;  2EZI A;  4P9U A;  5IOZ A;  1U6G A;  2KIF A;  2R7Q A;  2IVM A;  5JLX A;  1WVR A;  2QEX I;  1DGW Y;  3IH4 A;  1K4T A;  4U0Y A;  5HS9 A;  4D5C A;  4CYD A;  3WG7 H;  1NG7 A;  1MSE C;  3S1Q J;  4JP0 A;  2HU9 A;  6PAX A;  3RKW A;  1TNS A;  4HLY A;  2W82 A;  1KQ0 A;  2LDU A;  2BOL A;  4D0P A;  4F7Z A;  5EGO B;  1IG7 A;  2DN0 A;  2KJC A;  4M9X A;  5LFA A;  4KA4 A;  3KPH A;  1MH4 A;  2WTE A;  1HKQ A;  5HLT A;  1A31 A;  1FSE A;  3DCF A;  2VKD A;  3C2B A;  2IA2 A;  2R7T A;  4YFK F;  1S7A A;  1XG1 A;  2K86 A;  2L9N A;  1VQO I;  5DM6 F;  3F72 A;  1YQA A;  2W85 A;  5LRS A;  5J8F A;  3NRV A;  3N05 A;  2DTR A;  2M2E A;  2JUC A;  2R7W A;  2DTZ A;  3IKT A;  4M72 A;  5CLS A;  5IT9 K;  1SVL A;  1O3S A;  1G59 A;  4OU0 A;  3PJR A;  3I0T A;  1P4X A;  4PDK A;  1TWF J;  3KYC B;  2V1D A;  4L5E A;  5GPC A;  4XL9 A;  3WTX C;  2R5Z B;  2DA2 A;  2CUF A;  4DYC A;  1FTT A;  4IEJ A;  1KQ8 A;  4AU7 A;  2IS2 A;  2FSW A;  1GUU A;  3IKV A;  2L5Q A;  2O8K A;  1MNE A;  2HDC A;  1W7P B;  3ULQ B;  4KMU X;  4X0G A;  2WAD A;  2BW3 B;  2M9H A;  3IV5 A;  2JN6 A;  5FGM A;  3V7R A;  1WGX A;  2R7D A;  3RPU D;  1TWC J;  4PSX A;  3MKL A;  4LOC A;  1VI0 A;  3C2H A;  3JRG A;  4H4K C;  4PFO A;  4LLG F;  1Z6R A;  4IOC F;  1D1C A;  3OOP A;  1SVO A;  1K78 B;  2CWE A;  2VT2 A;  2K4B A;  4I98 B;  4U88 A;  5J8C A;  1SFO J;  3ZPL A;  3AAF A;  1VQ5 I;  1ETY A;  2OAZ A;  3VB2 A;  1T2K A;  2F2E A;  2JPB A;  1WHU A;  2DA1 A;  5B66 C;  3RQ4 A;  2X6Y A;  3CC2 I;  2BVL A;  4F91 B;  3Q9V A;  3AG4 H;  1A5J A;  2B0L A;  3OS0 A;  3CDL A;  2ISY A;  3FIW A;  1N77 A;  3QOD A;  1R4M B;  2OV7 A;  4A93 J;  2P8T A;  1R22 A;  5F0H A;  3K4M A;  1F1Z A;  3HOU J;  2MW8 A;  3K4K A;  1MBE A;  2H6B A;  2JVG A;  2LY2 A;  4OIR F;  2ADU A;  4XLN F;  2ZFU A;  2EIM H;  1Y8R B;  4XLH A;  3L2R A;  2YUS A;  2DFF A;  2DQL A;  3W2W A;  1YLF A;  3K2Z A;  4A3M J;  4G94 A;  4LG3 A;  3ERE D;  3JRF A;  5KK1 A;  2DT7 B;  1UCR A;  2Y75 A;  4A6E A;  2L0K A;  3KP2 A;  3NQO A;  4L9N A;  2JSC A;  3DBH B;  4M6V A;  2DJI A;  5A2Q Z;  1OMI A;  4S05 A;  2DOA A;  4BXF A;  4AIH A;  5IY5 H;  1QZE A;  2GIZ A;  1TQP A;  2E5N A;  2Z16 A;  1ZAO A;  4QPO A;  1KYZ A;  1A04 A;  2X1C A;  3LSM A;  2M4G A;  3RKX A;  3TDZ C;  1YIJ I;  5ILV A;  3BR0 A;  2YX7 A;  3V8L A;  1ZGW A;  4BY7 J;  4UV8 A;  2XUB A;  3H5R A;  4XLP F;  2DDA A;  2XPU A;  1VQ9 I;  3OYK A;  3E5Q A;  3FBI B;  2IGM A;  3QP5 A;  4AUX A;  2VI6 A;  3ASO H;  2A61 A;  3K4L A;  3G2B A;  2EQR A;  4RMN A;  3L1P A;  3QRF F;  4UUS A;  3ESW B;  3G1M A;  1GT0 C;  2VJ4 A;  3G71 I;  1MSF C;  1D8K A;  3FMQ A;  2P7C B;  1PVE A;  2QCO A;  3L2Q A;  5J3L A;  1A6Q A;  1XDU A;  3COA C;  3CCJ I;  3K4J A;  3WTT C;  3D5S C;  3IRR A;  4IHX A;  3KLO A;  1RR8 C;  4IX7 A;  3PM1 A;  1P7J A;  3R61 A;  1JUS A;  4JK1 X;  3OYL A;  2EIN H;  3WGG A;  4B47 A;  2E34 A;  3GTQ J;  5BQT A;  4PSW A;  4ABZ A;  3F9K A;  1SD6 A;  1UFM A;  1BI2 A;  2E60 A;  5IP7 J;  5FKO A;  1X3W B;  3CDI A;  3VSL A;  2VL8 A;  2HOS A;  1D0Z A;  2Q2E A;  5BNG A;  1W7P A;  4GGG A;  5M5Y J;  5D5U B;  3RDI A;  3I56 I;  3CC4 I;  4IHY A;  2W25 A;  3BJA A;  3DKY A;  3HSE A;  5E1Z B;  4LLN A;  2W7N A;  3MZH A;  1QHG A;  2W24 A;  4GXO A;  2XIG A;  4Z6Y A;  4B09 A;  1SFU A;  1U9O A;  3E3V A;  3SYT A;  4YEJ A;  4BL0 B;  3OSG A;  4EAT A;  3JAM K;  5HLG A;  2CU7 A;  1JJ6 C;  3P9C A;  5EZH A;  1EH7 A;  2ZNZ A;  2NS8 A;  2OJE D;  2Z1D A;  4MQV A;  1YTY A;  2STW A;  2DOD A;  2HKX A;  2DMU A;  1P2F A;  3M8E A;  4EEF G;  4A0Z A;  2X6O A;  3J81 Z;  3RCO A;  1BN5 A;  2O03 A;  3G4S I;  3ZN0 A;  4DOZ A;  5H2F C;  1CF7 B;  1BA5 A;  1E2X A;  1IN5 A;  2UXN A;  2ZC2 A;  2WY7 Q;  2M0C A;  1K7A A;  4HSR A;  4BE0 A;  2PMZ N;  3J7Z I;  2H27 A;  3A02 A;  3A4C A;  4J00 A;  2DA6 A;  1NTC A;  4DZJ A;  1NH3 A;  2HDD A;  1LQ1 A;  2HQR A;  3K4C A;  3HZJ A;  2OPT A;  2DA5 A;  1CF7 A;  2A5Y B;  2QQA A;  1LEB A;  2GM4 A;  1I6X A;  2QLZ A;  3EDP A;  3G1L A;  2D2W A;  1FP2 A;  4QIW N;  3ZQC A;  4M6X A;  4CIC A;  2HTJ A;  3KEO A;  5EJC A;  3O6B B;  4HEA 2;  1BR1 A;  1TP4 A;  1JUP A;  3GTO J;  2M8E A;  2VKV A;  4BE1 A;  3KP3 A;  4ZJZ A;  1RRJ A;  2E2J J;  1S8N A;  2E36 A;  1G6N A;  2QWW A;  3DKW A;  3GLL A;  2KQR A;  3H9G A;  1TNT A;  1EJ9 A;  1IC8 A;  1Z05 A;  3ABM H;  2R7Z J;  1UG2 A;  4BU2 A;  4C2T A;  3S15 J;  3GZN B;  5M3M J;  4CGZ A;  3FWE A;  4B3X A;  1S3J A;  2VJ5 A;  4PJJ A;  5HDN A;  4NUB A;  3LQQ A;  2COM A;  1R49 A;  1FYM A;  1WQ2 A;  3PNV A;  2NVU B;  2O0Y A;  1UHW A;  5H20 A;  3QU3 A;  1H89 C;  3PFI A;  1TTY A;  3HKZ A;  4HAM A;  1FYK A;  1U5T C;  5DV5 A;  4IL6 C;  3VOE A;  4MEX F;  2XAQ A;  1ZKG A;  2HS5 A;  3JTH A;  1D5V A;  1O7L A;  3PNY A;  1P4W A;  2FF4 A;  3HEF A;  1JHH A;  3ZR8 X;  4ZDO A;  2VOP A;  2W84 A;  3IWZ A;  5B5E C;  3T1B A;  5LGU A;  2CS3 A;  1BIA A;  5HS8 A;  2HYJ A;  1IUY A;  3J7A O;  3C2G A;  1G3S A;  1OCR H;  3FXU A;  3KCC A;  2VON A;  1MD0 A;  1Z9C A;  4Y7N J;  4M3F A;  3G1O A;  5DCF A;  2V4J C;  4OIO F;  3PL8 A;  5J1R A;  5D6E A;  1FOY A;  5IYD J;  2CRG A;  4EV0 A;  2F48 A;  4X1E A;  4CZC A;  1Y6I A;  4CYC B;  4AM3 A;  1SMY F;  2KIM A;  5F64 A;  3LSP A;  2ZNY A;  2HVS A;  3MAJ A;  3MZ8 A;  3G73 A;  3S3O A;  3S1N J;  3BP8 A;  2DK5 A;  1IN6 A;  4C3H J;  2FOW A;  2KRC A;  3GWZ A;  5FD5 A;  2FML A;  2IS4 A;  5KHD A;  4A3E J;  2VBW A;  3GYH X;  4AYB N;  3CUQ A;  3QPS A;  1X58 A;  2AQF A;  5D4S A;  1W5T A;  4MTE A;  2D1H A;  2FEZ A;  3GXO A;  3W2V A;  4NNJ A;  3IRQ A;  2MH2 A;  2G7U A;  2HYG D;  4EM2 A;  3ELK A;  4EM1 A;  4M3D A;  1MH3 A;  3OYM A;  3NWS A;  5HOD A;  3GLX A;  1ZAR A;  2DA4 A;  4G8X A;  5ILU A;  1WJC A;  3BR2 A;  2LOO A;  3HOW J;  1MBF A;  2MBF A;  5LRR A;  5JHF A;  4YIR X;  3OYB A;  5JI6 A;  3BJO A;  2FBI A;  2NYX A;  3M1E A;  2ME6 A;  4BBR J;  5E3L A;  5FKN A;  3O8H A;  4PJL A;  1FP1 D;  4J19 A;  1B1B A;  1YFH A;  2M0M A;  3FHZ A;  1XD7 A;  3L9F A;  4KJZ A;  1AA7 A;  4L18 B;  1BW6 A;  4PJ0 C;  1E3P A;  2K7L A;  3CO6 C;  4B1R A;  3E1S A;  4GDF A;  3D0S A;  4M9Z A;  3L2C A;  1SD7 A;  3WE3 A;  1VQ4 I;  3S1R J;  3BQZ A;  3EUH C;  4HF2 A;  1QHH D;  2BHZ A;  4BAY A;  2R7F A;  1R58 A;  2Y2Z A;  5K7F A;  3VEP A;  1O57 A;  2JMW A;  3GFM A;  3I59 B;  1ON2 A;  3RTR A;  3FM3 A;  3LA2 A;  4DNC A;  2DT6 A;  4RA2 A;  3T0Y A;  1UHM A;  2XHK A;  1HW5 A;  4IQ4 A;  2VXD A;  1SFX A;  1JTX A;  2PLY A;  3FIS A;  3OL3 A;  2VQH A;  2R5Y B;  2H1K A;  4NC7 A;  1DP7 P;  1T38 A;  3JRH A;  4G7O F;  2R7S A;  1J09 A;  1UHS A;  4F93 B;  3L7W A;  1JT0 A;  1IF1 A;  3DTE A;  1WCM J;  1UST A;  3F23 A;  3K6G A;  2LKS A;  1V54 H;  1BI0 A;  3I71 A;  3QQA A;  1E17 A;  2M87 A;  1P7I A;  4Z2Y A;  4BE2 A;  1MZB A;  4BQN A;  1FT9 A;  4G7Z F; 
#chains in the Genus database with same CATH homology
 4XSX F;  2PI0 A;  4KDP A;  5FLX K;  4LFU A;  4U0V A;  3TKY A;  3QU6 A;  1U5T A;  5AIP A;  1PUE E;  3E5U A;  1K78 A;  2HQN A;  3HOT A;  1F9N A;  3C18 A;  3EUH A;  2IJL A;  2V6C A;  2OQR A;  5D5V B;  1QGP A;  2FBK A;  3F8M A;  2Q0O A;  5D8K B;  3JW4 A;  1J9I A;  3KEQ A;  2HTS A;  4KT5 C;  4KYW A;  4R1H A;  4BYY A;  3ABT A;  1TLH B;  1R00 A;  4RGR A;  1HBX G;  3FM5 A;  4RB2 C;  2ZXJ A;  2A3S A;  1XB4 A;  2BYV E;  2VC0 A;  4Q47 A;  3I58 A;  3CDH A;  2Z5U A;  5LEJ A;  2STT A;  4RGU A;  4YII A;  1G3T A;  3ZMU A;  4KIB A;  4LGW A;  1MGT A;  1EH6 A;  2LF7 A;  1YW7 A;  2VXZ A;  1KGS A;  4KIF A;  3MWM A;  4DQ2 A;  4I2O A;  4ENK A;  1XMK A;  2L4A A;  2X0L A;  4BH9 A;  1GHC A;  1G4D A;  3GFJ A;  4Q4Z F;  2ISZ A;  5LEK A;  4KMF A;  1TBX A;  1JGS A;  1LEA A;  4XSZ F;  3C3W A;  4E70 A;  2QUF A;  1U2W A;  2YR2 A;  2OBP A;  4U7B A;  3ZMZ A;  1Y0U A;  2QM3 A;  5JFR A;  4IF4 A;  1EH8 A;  1IXS B;  3BPX A;  2TDX A;  3H3Z A;  1Z91 A;  3SXY A;  1MDM B;  3CUO A;  3DPL C;  2EFP A;  1KU9 A;  4HX8 A;  2V9V A;  2O8X A;  2HKO A;  2FRH A;  1T6S A;  3F8B A;  1O7F A;  3U2R A;  2IPQ X;  4FT8 A;  2WV0 A;  2Z3Y A;  1I1S A;  1GXP A;  4ESJ A;  2OA4 A;  5FO5 A;  1XGN A;  3FX3 A;  2JPC A;  2IT0 A;  5DD4 A;  3V8K A;  2RKH A;  1Z1D A;  2XAH A;  1ZLJ A;  2OZU A;  1HW2 A;  2A68 F;  1HKS A;  2Z99 A;  2L01 A;  2IP2 A;  2LF8 A;  5CVU A;  2F5D A;  4YG2 F;  1WWX A;  4I0B A;  4P5O A;  2HGC A;  4HBL A;  3WG9 A;  1YW9 A;  2HWV A;  1ZH5 A;  1BBY A;  4IRI A;  3H3U A;  2O6G E;  1VTN C;  2A69 F;  2Z9O A;  2ZJ2 A;  5LLQ A;  1FPQ A;  4ENN A;  1WSU A;  5HOO A;  3GEZ A;  2XAF A;  3TOB A;  3F3X A;  5J6X A;  4Y13 A;  1XCV A;  3E5X A;  2P5L C;  3VFZ A;  2DK8 A;  4R79 A;  1LNW A;  1ZG3 A;  3HTS B;  3J80 Z;  5DCM B;  1P92 A;  2JTV A;  4BQA A;  1ZLK A;  2EFW A;  3M8F A;  5DCM A;  4CHU A;  1C0W A;  5LGN A;  1FLI A;  5ILS A;  3CLO A;  1HQC A;  4LJZ F;  1ZG5 A;  2E1C A;  4OIP F;  5K5O A;  2EV6 A;  4IJA A;  2IRF G;  2VBZ A;  2KKO A;  2RGV A;  4WWC A;  1L0O C;  2UXX A;  3KP4 A;  2PEX A;  5ICF A;  1O3Q A;  2VBY A;  3H92 A;  5DD8 A;  2EFQ A;  1X3U A;  2XGX A;  1YO5 C;  2BV6 A;  1FC3 A;  1OPC A;  1FWZ A;  4CZZ A;  5F6F A;  1BIB A;  2FE3 A;  3Q5F A;  5JR3 A;  2CSO A;  1MJA A;  1IN7 A;  4HV6 A;  4QWQ A;  1TW2 A;  3FF5 A;  2MLG A;  1OKR A;  1FZP B;  4GYI A;  1ZGA A;  3F22 A;  3KP5 A;  1JHF A;  1XSX A;  1U8R A;  3E6C C;  1YS7 A;  3L09 A;  3I4P A;  1S6L A;  1T0F A;  4OIN F;  4ZYH A;  4I02 A;  1P6R A;  3DFG A;  3M7G A;  2ELH A;  3ML6 A;  2RC4 A;  3RYR A;  2FNA A;  1XGM A;  2H09 A;  5L3C A;  4LK1 F;  2C6Y A;  4AD9 A;  4NB5 A;  4UHT A;  4UVB A;  1SMT A;  3TOA A;  4RGS A;  1F4K A;  5CVR A;  1LDD A;  4M73 A;  4KFC A;  2IA0 A;  3GX4 X;  1K6O A;  2JZY A;  5ED4 A;  3R6S A;  2EJR A;  4P9F A;  4RAZ A;  2RN7 A;  3GVA A;  5D6F A;  1D8J A;  4IVN A;  2Z33 A;  2HR3 A;  3IWF A;  3KLN A;  3O2P E;  3TQN A;  4A12 A;  4LMY A;  1B9M A;  3TO9 A;  1QNT A;  2PQ8 A;  3HUG A;  4O6J A;  2Q8K A;  5FFX A;  4HZF A;  5ICG A;  2GQQ A;  1HKT A;  5BPD A;  3KZZ A;  2UZK A;  4UUV A;  2DT5 A;  1OYI A;  1LB2 A;  4L0Y B;  4O3M A;  3KP6 A;  1H9T A;  3DPT A;  4N9H A;  2A07 F;  5LHG A;  3W6J B;  4CXF A;  1XGS A;  4O5V A;  2NNN A;  3K69 A;  5D4R A;  2MA3 A;  2CG4 A;  3B73 A;  3ZMS A;  4HQM A;  2EK5 A;  1O3T A;  2KRF A;  4LD5 A;  3LFK A;  2VE9 A;  3CUQ B;  3RPQ A;  5AON A;  2NS0 A;  5FFZ A;  4HW0 A;  3F8N A;  3F8F A;  1R1U A;  1LDK B;  2ESH A;  3B02 A;  5L3F A;  5D5W B;  1IN4 A;  2M1B A;  5E8G A;  4IHT A;  2Y0M A;  1W7P D;  4UXN A;  1FBU A;  5E18 F;  1PP7 U;  4L9J A;  2M30 A;  1RUO A;  2VC1 A;  2XAG A;  3C7J A;  1J75 A;  4KN7 X;  4L5J A;  1Z6T A;  3TO7 A;  2GZW A;  2OQG A;  1USS A;  4PZJ A;  5D5X B;  2E7W A;  2KIU A;  3CTA A;  1U78 A;  3I64 A;  1J7K A;  4ENM A;  2K4J A;  1BI1 A;  2ZME B;  5L3G A;  3FXR A;  4KIC A;  3HHG A;  4LLL A;  3R4K A;  5BMZ A;  3TDU C;  4AIK A;  4WF2 A;  4I0A A;  2ZME A;  5DUI A;  1OYY A;  2ETH A;  3DF8 A;  1QQI A;  2DW4 A;  4TV7 A;  4LK0 F;  2PMU A;  3ZMV A;  1GXQ A;  5L3E A;  2XVC A;  2QBY A;  1JE8 A;  4K2E A;  1DPU A;  1TW3 A;  1NHA A;  4HOB A;  4FX0 A;  1FOK A;  1DPR A;  2PJP A;  2V1X A;  5FB2 A;  2DQR A;  2GXB A;  4WX9 A;  1SAX A;  1AOY A;  3QP6 A;  1IAW A;  3JAM Z;  1MJ9 A;  3BY6 A;  4OMZ A;  1J0R A;  3FMR A;  4G9Y A;  4HYE A;  5CVJ A;  4G7H F;  2EA4 A;  3ABU A;  1YS6 A;  2L02 A;  3BRO A;  1KA8 A;  1TQI A;  1ZRE A;  2CQK A;  2FXA A;  3V8J A;  3IC7 A;  1HXD A;  1J5Y A;  4FX4 A;  4HX7 A;  3E6M A;  1I5Z A;  1HW1 A;  4NHJ A;  4CO8 A;  1IZ1 A;  4ZZL A;  3I54 A;  4NQW A;  4GYG A;  3RI4 A;  1ZGJ A;  5LHI A;  4ON0 A;  4ESB A;  3P7N A;  2X4H A;  5LHH A;  3N97 A;  4A2U A;  4L5I A;  1F5T A;  1JXS A;  2DLL A;  3SFZ A;  4Q5S F;  5BPI A;  4XBF A;  2H6C A;  4A6D A;  3BPV A;  4L0Z B;  3E97 A;  2GAU A;  3KP7 A;  4WXH A;  1R1T A;  3K1N A;  1HSJ A;  5E8I A;  2E7X A;  1GVJ A;  3SQN A;  3ECH A;  4MEY F;  1WRJ A;  1FX7 A;  4I01 A;  3TO6 A;  4UVA A;  1QPM A;  3D5L A;  4AVP A;  3WGI A;  4XRF A;  4R8H A;  2GA1 A;  3RYP A;  4MHG A;  4PGH A;  1QZY A;  2YSR A;  4ASN A;  3HOS A;  2WWY A;  1STZ A;  2M5W A;  1RZ4 A;  1B6A A;  3DEU A;  3HTU A;  5ICC A;  3WTV C;  1LDJ A;  2D1V A;  1DDN A;  4N9I A;  2BBY A;  3K1P A;  3LST A;  1B9N A;  1BOA A;  1IRF A;  2XRO A;  3HRU A;  3EQL F;  3CJN A;  2V79 A;  4KNY A;  1WKM A;  3TGN A;  1SD4 A;  5CYV A;  1R23 A;  1J59 A;  2J5P A;  1YYV A;  2QQ9 A;  4ZYE A;  1G3Y A;  4EJU A;  5HDG A;  5E1W A;  3QPH A;  3M9A A;  4EJW A;  2VN2 A;  3FXQ A;  2ZO4 A;  4BXU A;  2H94 A;  2A6H F;  1RI7 A;  4HDU A;  3WTS C;  4RB3 C;  4HX4 A;  4HQE A;  1XSD A;  3KFW X;  3IHU A;  4M71 A;  4IXA A;  1XGO A;  3S2W A;  1K79 A;  3DQV C;  3R60 A;  1TQM A;  3SZP A;  4HF0 A;  4IRG A;  4U0W A;  3LQR A;  3RJP A;  4YFN F;  2LKP A;  3GO5 A;  2FBH A;  4RB1 A;  5HLI A;  1P4A A;  1BI3 A;  1YG2 A;  4HDV A;  1PDN C;  2NRA C;  4Q48 A;  2MLK A;  4HLX A;  4BHB A;  5K1Y A;  4EQQ A;  2F5F A;  3GZ6 A;  4ENJ A;  2EFN A;  2ZCW A;  4UV9 A;  3QAH A;  1RNL A;  2VE8 A;  3WTZ A;  1XSV A;  2EFO A;  5BOX A;  2EV5 A;  2PG4 A;  3OV8 A;  2IW5 A;  3E6D A;  5IT3 A;  1BM9 A;  3CO7 C;  3U1D A;  4U7D A;  4B8X A;  2WC2 A;  3T5X A;  1XCB A;  4G6D A;  1ODD A;  2D45 A;  2YPR A;  3KZY A;  2MC3 A;  3L00 A;  3W6K B;  2EV0 A;  2K02 A;  3HRM A;  1MKM A;  3SHF A;  4ETS A;  2NNY A;  1S29 A;  1ZYR F;  2F5C A;  4RB0 A;  1ZG1 A;  4UNO A;  2DI3 A;  4PGG A;  1W5S A;  4GO1 A;  3WGH A;  4KN4 X;  3PQJ A;  1AWC A;  4N0B A;  5E1X A;  3T8T A;  2FU4 A;  2VT3 A;  2ZKZ A;  2RQP A;  5CVI A;  1RIO H;  2CGP A;  3CUQ C;  1ZRD A;  4MTD A;  4AIJ A;  5HVQ C;  1ZHF A;  2FMY A;  1IN8 A;  1I1G A;  2P7V B;  3WU0 A;  4CDG A;  2XRN A;  2P6T A;  4OMY A;  2VBX A;  3I59 A;  3ECO A;  2G7H A;  4G6Q A;  2P5V A;  1H0M A;  3R0J A;  4OIQ F;  1KU7 A;  3MCZ A;  1RUN A;  2JRT A;  1YW8 A;  1FBS A;  4ZYD A;  2LSO A;  3V7C A;  2QEN A;  3J81 K;  4EJO A;  3RPU A;  1ZRF A;  4EGY A;  3LAP A;  2DAO A;  4GCV A;  3ZMT A;  3ZMD A;  3HSF A;  3ISP A;  5TJJ A;  1KQ9 A;  4HF1 A;  2PFB A;  4A5M A;  2XKO A;  5AIQ A;  2MD5 A;  5HLH A;  3N4M A;  2HFH A;  5CJ9 A;  2RNJ A;  3ZN1 A;  2VOO A;  1D3Y A;  1XDS A;  4Y15 A;  1LJ9 A;  1IW7 F;  5L3B A;  1W4M A;  1FBQ A;  2QYO A;  3V7S A;  5DYM A;  2RVC A;  4WCG A;  1T39 A;  2NAZ A;  1ON1 A;  3BZ6 A;  3F6V A;  3WOD F;  5E17 F;  2PN6 A;  1LVA A;  2W57 A;  4LG0 B;  5F1R A;  5FD6 A;  3HSR A;  1V3F A;  2YX4 A;  2HYF A;  3GF2 A;  4LG0 A;  5L3D A;  3WTY C;  4S04 A;  2RV8 A;  1EV7 A;  2UWM A;  1MDM A;  2XKP A;  2R3S A;  2K27 A;  3WE2 A;  1R1V A;  3MEX A;  2HEO A;  2P4W A;  4EGZ A;  5TRD A;  4UVC A;  4RS8 A;  3DV8 A;  2CO5 A;  3F8C A;  4EM0 B;  3PQK A;  2EA2 A;  3U9G A;  1B59 A;  2FOK A;  2HOE A;  1FY7 A;  5E20 A;  5EEG A;  1FNN A;  3BOQ A;  3QOP A;  4MGR A;  3R0A A;  4JQF A;  2QBY B;  1OYW A;  1R5H A;  2GIV A;  2P6S A;  5HS7 A;  3MZY A;  4A0X A;  5LGT A;  3KE2 A;  2J5O A;  1Z7U A;  3HHH A;  5D8L B;  4ESF A;  4RGX A;  5JHU A;  3EET A;  3O3K A;  4WK8 F;  1XMA A;  3F21 A;  5BS6 A;  5ERI A;  3QPT A;  2FA5 A;  1ONV A;  2LNB A;  2QQB A;  3WTW C;  2DPD A;  2CW0 F;  2ZBK A;  3JSO A;  4KUM A;  2ESN A;  1Q1H A;  2M45 A;  4M9S A;  2DO7 A;  3GZ5 A;  4LB6 B;  2GXG A;  4OOI A;  5DEQ A;  1L3L A;  2XAS A;  2XAJ A;  3RKY A;  2ACJ A;  1PP8 F;  2DFI A;  5K5Q A;  1KYW A;  2BGC A;  2DU9 A;  3HRS A;  2P5K A;  4AWX B;  1G3W A;  2Y48 A;  1B4A A;  3C1D A;  2PBI A;  4YFX F;  3REO A;  1ZN2 A;  3SZT A;  1DUX C;  3WU1 B;  2OU2 A;  1KU2 A;  3MFK A;  4EMS A;  1I27 A;  5FLX Z;  4I7H A;  3Q9S A;  2EWN A;  3V4G A;  1BJA A;  1KU3 A;  2QVO A;  4M74 A;  1IXC A;  3JTG A;  4FHT A;  1R7J A;  5DUK A;  4IHS A;  5K5R A;  1S7O A;  1MJB A;  3LWF A;  3RIR A;  3NEU A;  4L9T A;  4ZYG A;  5JVT A;  1SD5 A;  2AXL A;  4HA8 A;  2GA2 A;  1OR7 A;  4ZZD A;  3BJ6 A;  1O3R A;  2HZT A;  4H0E A;  1REP C;  5H6R A;  4LB5 A;  2OD5 A;  2VOD A;  4M6Y A;  4PCQ A;  2L4M A;  2MH9 A;  4Y17 A;  1R36 A;  1IRG A;  2XV4 S;  5CVV A;  2JT1 A;  3P9I A;  3IL2 A;  3I53 A;  3GFI A;  2EB7 A;  3GFL A;  4QLC U;  3ZP5 A;  3VOD A;  3ROU A;  4EJT A;  3MQ0 A;  2OZ6 A;  5ICE A;  5EEH A;  1XN7 A;  2KJB A;  2BEO A;  3DP7 A;  4P55 A;  2DPU A;  1YIO A;  3HYI A;  4P96 A;  5HDK A;  5A2Q K;  3P9K A;  5DDG A;  3ZQ7 A;  4BHP A;  1SFE A;  3HRT A;  1FSH A;  3FMS A;  4BNC A;  1QZZ A;  4JBA A;  5IT9 Z;  4RAY A;  2GWR A;  2L3D A;  2RDP A;  3JSP A;  4WXD A;  4IRH A;  1U3E M;  2L54 A;  3KET A;  1ZRC A;  3WTU C;  3LA7 A;  3BDD A;  1FYL A;  4WXC A;  3G3Z A;  3E6B A;  4A5N A;  3I5U A;  2PMH A;  3EYY A;  3LAJ A;  2YU3 A;  4I09 A;  1UB9 A;  1R5G A;  3EYI A;  1ULY A;  3K9T A;  4EJV A;  1HST A;  1V4R A;  4L9V A;  5LBQ A;  2O3F A;  2QZ8 A;  3BWG A;  3DXJ F;  2G9W A;  2CYY A;  3FZV A;  5H6Q A;  2FNP A;  1J2X A;  3K1M A;  4YIF A;  4IPA A;  1BC8 C;  2V1U A;  4A0Y A;  5KVR A;  4BHC A;  2DBB A;  1U5T B;  1H9G A;  2F5E A;  2AS5 F;  4HV5 A;  1T98 A;  2A6E F;  4MNU A;  4EVI A;  3J80 K;  3K0L A;  4KIG A;  3LA3 A;  1WI9 A;  1BC7 C;  3GUD A;  2CFX A;  2ZFW A;  4ZH4 F;  3GW2 A;  2IA1 A;  4MQ9 F;  2E1N A;  2BE5 F;  2FQ3 A;  3F6O A;  2O61 A;  3HIF A;  1CGP A;  1QO0 D;  1QBJ A;  1IXR C;  3T8R A;  4P9U A;  1U6G A;  2KIF A;  2IVM A;  4U0Y A;  5HS9 A;  4CYD A;  6PAX A;  3RKW A;  1TNS A;  4HLY A;  1KQ0 A;  2LDU A;  4F7Z A;  4D0P A;  2KJC A;  4M9X A;  4KA4 A;  2WTE A;  1HKQ A;  1FSE A;  2IA2 A;  4YFK F;  1S7A A;  2K86 A;  3F72 A;  1YQA A;  2W85 A;  5LRS A;  5J8F A;  3NRV A;  2DTR A;  3IKT A;  4M72 A;  5CLS A;  5IT9 K;  1O3S A;  4OU0 A;  3I0T A;  1P4X A;  4PDK A;  2V1D A;  3WTX C;  1KQ8 A;  2FSW A;  3IKV A;  2HDC A;  1W7P B;  3ULQ B;  4KMU X;  5FGM A;  3V7R A;  2R7D A;  4LLG F;  1Z6R A;  3OOP A;  1K78 B;  2CWE A;  2VT2 A;  2K4B A;  4I98 B;  4U88 A;  5J8C A;  3ZPL A;  3AAF A;  2OAZ A;  3VB2 A;  1T2K A;  2F2E A;  2JPB A;  3Q9V A;  2B0L A;  2ISY A;  2P8T A;  1R22 A;  1F1Z A;  2H6B A;  4OIR F;  2ADU A;  4XLN F;  2DQL A;  1YLF A;  3K2Z A;  4G94 A;  3ERE D;  5KK1 A;  1UCR A;  2Y75 A;  4A6E A;  3KP2 A;  3NQO A;  4L9N A;  2JSC A;  5A2Q Z;  1OMI A;  4S05 A;  4AIH A;  1TQP A;  1ZAO A;  1KYZ A;  1A04 A;  3RKX A;  3TDZ C;  5ILV A;  2YX7 A;  3V8L A;  4UV8 A;  2XUB A;  4XLP F;  3E5Q A;  3QP5 A;  2A61 A;  3QRF F;  1D8K A;  3FMQ A;  2P7C B;  1XDU A;  3COA C;  3WTT C;  3IRR A;  3KLO A;  3R61 A;  4JK1 X;  3WGG A;  5BQT A;  1SD6 A;  1UFM A;  1BI2 A;  2Q2E A;  5D5U B;  1W7P A;  4GGG A;  3RDI A;  2W25 A;  3BJA A;  3HSE A;  5E1Z B;  4LLN A;  3MZH A;  2W24 A;  4GXO A;  2XIG A;  4B09 A;  1SFU A;  3E3V A;  3JAM K;  5HLG A;  3P9C A;  1EH7 A;  2ZNZ A;  4MQV A;  1YTY A;  2STW A;  2HKX A;  1P2F A;  3M8E A;  4A0Z A;  3J81 Z;  1BN5 A;  2O03 A;  3ZN0 A;  1CF7 B;  1E2X A;  1IN5 A;  2UXN A;  1K7A A;  2H27 A;  1LQ1 A;  2HQR A;  1CF7 A;  2A5Y B;  2QQA A;  1LEB A;  1I6X A;  2QLZ A;  3EDP A;  2D2W A;  1FP2 A;  4M6X A;  4CIC A;  2HTJ A;  3KEO A;  3O6B B;  2M8E A;  3KP3 A;  1S8N A;  2QWW A;  1G6N A;  3DKW A;  1TNT A;  1Z05 A;  4CGZ A;  3FWE A;  1S3J A;  5HDN A;  3LQQ A;  2COM A;  1FYM A;  1WQ2 A;  2O0Y A;  1UHW A;  5H20 A;  3QU3 A;  3PFI A;  1TTY A;  4HAM A;  1FYK A;  1U5T C;  5DV5 A;  3VOE A;  4MEX F;  2XAQ A;  2HS5 A;  3JTH A;  1D5V A;  1O7L A;  1P4W A;  2FF4 A;  1JHH A;  2VOP A;  2W84 A;  3IWZ A;  3T1B A;  5LGU A;  1BIA A;  5HS8 A;  1IUY A;  3J7A O;  1G3S A;  3FXU A;  3KCC A;  2VON A;  1MD0 A;  1Z9C A;  5DCF A;  4OIO F;  5D6E A;  4EV0 A;  1SMY F;  2KIM A;  5F64 A;  2ZNY A;  3MAJ A;  3G73 A;  3BP8 A;  2DK5 A;  1IN6 A;  3GWZ A;  5FD5 A;  2FML A;  2VBW A;  3GYH X;  3CUQ A;  5D4S A;  1W5T A;  4MTE A;  2D1H A;  2FEZ A;  3GXO A;  3IRQ A;  2MH2 A;  2G7U A;  2HYG D;  4EM2 A;  3ELK A;  4EM1 A;  3GLX A;  1ZAR A;  4G8X A;  5ILU A;  2MBF A;  5LRR A;  5JI6 A;  3BJO A;  2FBI A;  2NYX A;  3M1E A;  1FP1 D;  1B1B A;  1YFH A;  3FHZ A;  1XD7 A;  3L9F A;  4L18 B;  2K7L A;  3CO6 C;  3D0S A;  4M9Z A;  3L2C A;  1SD7 A;  3WE3 A;  4HF2 A;  4BAY A;  2R7F A;  1R58 A;  3VEP A;  1O57 A;  3GFM A;  3I59 B;  1ON2 A;  3RTR A;  3FM3 A;  3LA2 A;  4DNC A;  3T0Y A;  1UHM A;  2XHK A;  1HW5 A;  1SFX A;  2PLY A;  1DP7 P;  1T38 A;  4G7O F;  3L7W A;  1IF1 A;  3F23 A;  1UST A;  1BI0 A;  3I71 A;  1E17 A;  2M87 A;  4Z2Y A;  1MZB A;  1FT9 A;  4G7Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...