2XB0X

Dna-binding domain from saccharomyces cerevisiae chromatin- remodelling protein chd1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
265
structure length
233
Chain Sequence
GPLGSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLKKVPGAIHLGRRVDYLLSFLRGGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHROMO DOMAIN-CONTAINING PROTEIN 1
publication title The DNA-Binding Domain of the Chd1 Chromatin- Remodelling Enzyme Contains Sant and Slide Domains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 73
structure length 233
sequence length 265
ec nomenclature ec 3.6.1.-:
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF18196 Cdh1_DBD_1 Chromodomain helicase DNA-binding domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xb0X02
4DYCA 1ZTRA 1BA5A 2ID3A 5C4JJ 2FX0A 4A93J 4D7MA 1WCMJ 3HM5A 1G2HA 3OIOA 2CQXA 4JYKA 5BNGA 3JRIA 2GM4A 1HOMA 2TCTA 1UMQA 5E3OA 4CYCB 2R5ZB 1JKOC 3B6AA 5C3EJ 1VFCA 2XPUA 3HBLA 1JJ6C 3LSJA 3CCYA 1AHDP 1ORKA 2IAIA 4AC0A 4X1EA 3LSRA 2DA2A 1PUFB 2CRGA 3DCFA 2ECCA 2XPWA 1WPKA 3SJMA 2XPVA 2QF7A 5IP9J 3UKGA 3A03A 2HOTA 1F36A 2CU7A 2DA7A 2X6OA 3BR0A 5J3LA 1OFCX 1ETQA 5EGOB 3SDGA 5M5XJ 4A3EJ 1HDPA 5EEAA 2E1OA 1TWGJ 4NDLA 2O7OA 4M3EA 4V2FA 2Y9ZA 5K7ZA 4UUSA 1H88C 2E19A 4MFDA 1ETXA 2DMPA 3A01A 1XC5A 2R93J 1A5JA 4DW6A 3G1OA 4BKXA 3W6VA 5EZHA 2R7ZJ 3VPRA 1MBKA 4JX4A 1DU6A 4M3DA 1T33A 4BBRJ 2XSDC 2X48A 1JJ8C 1JT6A 1RESA 5J1YA 3M3YJ 2LVSA 2AO9A 3Q0WA 5J1UA 3BG3A 4M6VA 3LSPA 2XB5A 2ME6A 1IDYA 1K61A 1B8IB 2LP0A 2H1KA 5F1JA 3FK7A 3I4NJ 1I50J 3RKQA 5E3LA 2R92J 3MVPA 2JA7J 1QPIA 1MBGA 2FQ4A 2HQ5A 4IEJA 1ITYA 3BR2A 5DTDA 2JA5J 4ABZA 3LSGA 4C3IJ 2ZB9A 3TP0A 2NVYJ 1IRZA 1Z77A 2M9HA 2R5YB 5DS9A 3MN2A 4JP0A 2HXOA 2Y31A 1AKHB 4D7NA 1FJLA 3FIWA 3BR6A 5JLXA 4I6ZA 1U8BA 2GLOA 4UUTA 1QVTA 2M8GX 4QTRA 1APLC 1BJZA 3ZQGA 1Y1VJ 1QVUA 2JWTA 5K7HA 1ZR4A 1OCTC 3PO3J 4A3BJ 4FE7A 4LOCA 5EG0B 4C2MJ 1RETA 4A3GJ 2MG4A 4FCYA 2I10A 2NOGA 1TC3C 1CQTA 9ANTA 2LR8A 4J19A 2JMWA 3HOXJ 5M3MJ 1ZR2A 1MBFA 2JN6A 5FKOA 2EQRA 4XRSG 1HDDC 3G1LA 3S14J 2DMUA 1FTTA 1JKPC 2VPRA 3F0CA 4AYBN 2DA3A 2WAQN 2DMTA 3C2BA 2MGQA 2VI6A 3RQIA 2OF7A 1SANA 2EH3A 2MW8A 3TP3A 4XICA 5FJ8J 3IV5A 1TWCJ 1JGGA 2EZKA 3BTLA 1RPWA 2MSYA 1BL0A 4HNVA 1OJLA 3TW7A 3Q3SA 5IP6A 2EZIA 2M2EA 4D5FA 1JUSA 4IHYA 3QQAA 3HOYJ 1SFOJ 1HCRA 3HGGA 1P7IA 2DA4A 2XGCA 1Y1WJ 3S2DJ 3CMYA 2GBYA 4G12A 1W0TA 2X9DA 4BXXJ 5FKKA 3D1NI 3BTIA 2Y0SN 3IH3A 3B6CA 3RZDJ 4XRSA 5GPAA 4RBOA 2HOSA 5IYDJ 5F0HA 4EEFG 2NVQJ 2P81A 2ELKA 5IPAA 1LFUP 2NVXJ 4IHXA 5F0CA 1O4XA 2NS7A 1MNMC 5FKLA 2VKVA 2LKXA 2FD5A 2LLKA 2IEKA 3ZOBA 1OCPA 3S1QJ 5M3FJ 3OSGA 3ZQIA 2B63J 2DA5A 3BR5A 3ZQLA 1F43A 1MSFC 1T56A 1IGNA 1MSEC 2L7ZA 2XRLA 2LFBA 3DEWA 2COBA 1IV6A 3S1NJ 4CYCA 2R5ZA 3BTCA 5GP9A 5EZGA 3L1PA 1ENHA 3WHBA 1TWHJ 3HKZN 4A3FJ 3JRFA 1IDZA 1YRNB 5IP7J 3GTQJ 3G1MA 3HDDA 3BQYA 1B72B 5EYRA 4FISA 3LOCA 2JA6J 3OSFA 3ZQFA 3SFIA 1HF0A 4BBSJ 3S1MJ 5IOZA 2YU9J 3A02A 4B1RA 5EGOA 3S2HJ 2G0EA 1NTCA 1WH5A 2LK2A 4MFEA 1LE8B 5F0FA 3FK6A 1FIPA 3TW6A 3GTJJ 1TWAJ 5F04A 3NAUA 2EBIA 1IJWC 1GUUA 1LFBA 1EF4A 4IHWA 1GDTA 3FISA 5C4XJ 3BG5A 4A3JJ 3JRHA 2W48A 4W1UA 1UG2A 2K40A 4BY1J 3Q0UA 2H8RA 2E2JJ 1X2MA 2N8GA 2LTPA 4DYRA 2HXIA 1MBJA 3MKLA 3HEFA 4DYQA 4D5CA 4QSHA 2TRTA 2YS9A 1D5YA 1ETOA 5HODA 4XRMA 5EDNA 2VUMJ 2XGEA 1JUPA 2HYJA 2DMNA 2IBDA 3WHCA 2EZHA 1VI0A 1TWFJ 5FLMJ 1P7JA 2DN0A 3QPSA 2K9NA 1JUMA 5F08A 4FE4A 2O8KA 3K2AA 2Y30A 2DJNA 2OPTA 2R5YA 3BR1A 3JRDA 4A3LJ 2QCOA 1AKHA 3CDLA 1Q1VA 3GTMJ 1ZQ3P 1Z0XA 1NK2P 2LD5A 1RR7A 1H8AC 4JX6A 3S15J 2M0CA 1DU0A 4XK4A 2XGDA 3QPLA 2E2IJ 4GFBA 2CQQA 4UUSB 1ETYA 1GV5A 4BY7J 4X6AJ 1ZGWA 4JX5A 3HB9A 3A01B 2K9QA 2L9RA 4M3GA 3HOVJ 5EG0A 2XB0X 3HGYA 1AU7A 4C3JJ 1WH7A 4DZJA 4M3FA 3LNQA 4L5EA 5FLVA 1U9OA 2CJJA 3GTGJ 2WV1A 2KT0A 4A3DJ 1A6IA 2L0KA 1H89C 4RDUA 3JR9A 1XS9A 3RZOJ 1MBEA 1MH4A 5IYCJ 2DA1A 2LY9A 1GV2A 4S0HB 2DA6A 2ID6A 3O8HA 3PO2J 4MIMA 1GVDA 2ECBA 5E3NA 4B3AA 5EF6A 1U9NA 2RAEA 3S1RJ 2AHQA 5FKMA 5IOYA 3GTKJ 1E3OC 1ETWA 1BW6A 2CUEA 3BT9A 2CUFA 1BW5A 1RKWA 5F27A 4I76A 5C44J 3GBGA 3JRBA 3FKIJ 1QRYA 3H3VK 3I4MJ 3K7AJ 2NVTJ 2KDZA 1POGA 4QIWN 1UHSA 3E7LA 3O8GA 4A69C 5J1RA 1JT0A 3H0GJ 3S16J 1VF9A 4MO7A 3TEDA 4A3CJ 1PUFA 3JRCA 1VNDA 5M5YJ 2K9SA 2M34A 1FTZA 5JLWA 2VKEA 3HOWJ 4V2GA 2L7FP 3BTJA 1MBHA 5FKNA 1JTYA 3ZQCA 3IH4A 4XIDA 2JK3A 4B4CA 1IC8A 1GT0C 4A3IJ 4W97A 4FTHA 2D5VA 3S17J 2DMQA 1ZK8A 1JKQC 2Y9YA 2ME0A 3ZQHA 1X2NA 5GPCA 4Y7NJ 1XG1A 4DZPA 1WI3A 2DTZA 4IHVA 3JRGA 1FEXA 1U78A 1WGXA 1JTXA 2Y2ZA 2O9LA 2WB1N 1HLVA 4A3MJ 1NK3P 3Q0VA 2YUSA 2FJ1A 3JREA 1MH3A 1ETKA 4M3BA 1B8IA 3OOUA 1JKRC 2E2HJ 5IYBJ 1IG7A 1YRNA 3PM1A 1S7EA 3IH2A 3HOZJ 3M4OJ 2PMZN 2JA8J 3BG9A 5M5WJ 1B72A 3CQZJ 1FIAA 1I3QJ 1IUFA 1K83J 3BQZA 1W0UA 3GTLJ 3JRAA 2R0QC 1R9TJ 4A3KJ 4AUXA 2JJ7A 3NARA 4Y52J 3HOUJ 1LE8A 3BR3A 5K7FA 2HDDA 2EZLA 1I6HJ 3GTOJ 1ZKGA 2L7MP 4MLOA 1ETVA 4C3HJ 1RKTA 5E3MA 2HOAA 1X58A 2NS8A 3GTPJ 2HI3A
chains in the Genus database with same CATH superfamily
4DYCA 1IN7A 2ID3A 4JQFA 3DU5A 1S7OA 1ERDA 1U5TA 3FMQA 2ZC2A 1WCMJ 2HQAA 3H5RA 1R5GA 2GM4A 4Y13A 1Z3YA 4ZYHA 3S32A 4BJTA 4LIVA 1UMQA 2R3SA 5DV5A 3IP4B 5ICCA 1YJ9I 1CF7B 3ONQA 3BC8A 2QSHX 1XGOA 3NEUA 5C3EJ 2L3DA 1LQ1A 2VC1A 1ZREA 1PP8F 1JJ6C 3LSJA 1DDNA 1ORKA 1BOBA 1XN7A 4RGSA 4X1EA 2VQLA 4J01A 2DA2A 4OMYA 2ZXWH 2VXZA 3EYYA 4BQOA 1W5CC 3NQOA 4K2EA 3DCFA 3O6BB 1WWXA 1WPKA 1H9TA 2OCEA 4FQGA 4F55A 3G4SI 4HLYA 5IP9J 2HNHA 4HF1A 3L2UA 1O3TA 1GLNA 2XHKA 2CU7A 4RAGA 2QYOA 3F6OA 4WCGA 2GXBA 2K02A 2P5KA 4HEA2 3LAJA 5DM7F 3ECOA 3CCRI 4MTDA 3HUGA 3WE2A 4UUSA 1W5TA 4BXFA 1ETXA 1XMAA 4CXFA 1RC9A 2ESNA 1YFHA 4I01A 1FBSA 3G1OA 1XTAA 2GXAA 2AQFA 2HKOA 2QQ8A 2EB7A 4M3DA 1T33A 4U7DA 2ZMEC 4BBRJ 2Z1DA 2XSDC 1IUYA 5HLGA 3F8CA 3KFWX 1JJ8C 2EFOA 2ESHA 2AO9A 2BE5F 2OV7A 5J1UA 3LSPA 2VN2A 1IDYA 1SVLA 3PQKA 2W7NA 4EM0B 4RAFA 4M6YA 1U5TC 4LLNA 2A6TA 1I50J 2OUMA 1HA8A 4OWRB 1G3WA 3RKQA 3WG9A 2D1HA 2L9NA 4E6KG 3G73A 4PJLA 3BR2A 5DTDA 2Z99A 4ABZA 1H0MA 2VL8A 4C3IJ 4AIKA 4ENKA 2FXAA 1IRZA 3L2WA 1BC7C 2RDPA 4XSXF 2R5YB 5DS9A 4FASD 4D7NA 3F6VA 1Z67A 2RN7A 4KMUX 3BR6A 2MLKA 5E1ZB 4L9TA 2XGXA 1BJAA 2M8GX 4QTRA 5LFAA 1FY7A 1HKSA 3K4NA 3CUOA 4HQMA 3CMMA 4AWXB 1ZG5A 4A3BJ 2HKXA 1OCTC 3PJRA 2VBWA 2ZXJA 3J7ZI 3P7NA 3MKZA 2QKLB 4CCMA 3S2WA 4C2MJ 5EG0B 1KYZA 2FOWA 2K4JA 2LOOA 4L5JA 4FCYA 2I10A 4UV8A 1F5TA 4UVAA 1X3UA 3G2BA 1VQ9I 3HSEA 4AU7A 5K5OA 1EKEA 4KN7X 5M3MJ 3FWEA 2JN6A 2UWMA 2JRMA 4ZH4F 1XPXA 1QZYA 2WY8Q 3GUDA 1SVOA 5L3EA 1U2WA 3CTAA 2FA5A 3F0CA 2DPDA 4AYBN 3OOPA 3C2BA 4II2A 1DPUA 4ZYDA 2BVMA 3RQIA 1O57A 5D5WB 2OF7A 2PMZA 3L09A 4A6DA 4XLFA 1W4MA 3KEYA 2BHZA 2Z16A 3TP3A 3ZCOA 4XICA 2K3PA 3KIOA 1I1SA 3DP7A 3IV5A 1TWCJ 1JGGA 4P1WA 5J40A 5J4YA 4BDYA 2F5VA 3N4MA 2M7AA 4IVNA 3BROA 3F3XA 2EZIA 2M2EA 1JUSA 3LFUA 2XROA 3CJRB 2DPUA 2EFWA 3L2CA 3HOYJ 1NG7A 1HCRA 1N75A 3HGGA 4QPOA 2XGCA 4G6QA 3M07A 2EJRA 4N9HA 1USTA 4DJAA 2LBFA 1F1ZA 4M74A 2KIQA 5KCMA 3HOSA 1DQUA 2YSRA 3OV8A 2DO7A 3B6CA 3DEUA 4Q47A 5DM6F 1SD5A 4L9JA 4RBOA 2HOSA 2XAFA 5F0HA 4EEFG 1R1TA 2DI3A 2P81A 3HG9A 2Z9OA 2R4GA 3H9QA 2NS7A 1N78A 2ELJA 1P4AA 2FD5A 1J75A 2KLOA 2IEKA 4KISA 2QQAA 3QPTA 3S1QJ 4S05A 3DEEA 5M3FJ 3EUKL 5CJ9A 2OZUA 3B02A 4EM1A 2CG4A 1ZHFA 3VYSB 2W24A 5AONA 5EJCA 3CMAI 1MSFC 2JPCA 4DNCA 4E7IA 2IA1A 2L7ZA 1ONVA 2ZFUA 4EJVA 3IRQA 3WGGA 4IX7A 3LWFA 2BXZA 3OL4A 1YW7A 5E20A 1WJFA 1CF7A 4G7ZF 1HQCA 2FE3A 3I56I 2X6WA 4V19K 4A3FJ 1VQMI 4G8XA 2DFEA 4Y33A 3HSFA 2CQ7A 3HDDA 4BUPA 4NUBA 2A05A 4AD9A 3KP2A 4MTEA 3OSFA 1LFPA 4NB5A 2DXIA 4ZZLA 1HF0A 2VOOA 5HDKA 1V3FA 3DU6A 3K4KA 3KYLA 2HS5A 1QZZA 4B1RA 1YIJI 2G0EA 1G3SA 2AQEA 4IQJA 5F0FA 3FK6A 4E7JA 1FIPA 4UUVA 1S8NA 1IXSB 4CCJA 2DOEA 5F04A 2JSCA 1J5YA 1WKMA 1QHHD 1IJWC 2E5NA 1S6LA 1EF4A 1GDTA 5C4XJ 2EFNA 3BJAA 4A3JJ 2KP6A 4IOAF 2W48A 4F92B 2IRFG 4LFUA 1A31A 2A07F 1RNLA 4BY1J 4IHTA 3JW4A 2R7WA 1R6RA 1R23A 5BPDA 3FXQA 4B43A 4HBLA 4OIQF 3MWMA 4MEXF 1MBJA 3HEFA 4DYQA 2QM3A 3LL7A 1ETOA 2LG4A 4XLCA 3COAC 4NC8A 2MH2A 2DMNA 5DYMA 1VI0A 4F7ZA 4KIBA 2R7VA 4M73A 3FHZA 2FU4A 1X19A 2H09A 2PG4A 4FE4A 3TO7A 2ZNZA 3K2AA 2Y30A 2DJNA 2R5YA 1RR8C 2MYSA 4PJ0C 2F5EA 3GFJA 2QCOA 4KT5C 1X4OA 2NYXA 3VFZA 4PGGA 3T5XA 2LD5A 3B73A 1DU0A 4U87A 3CCJI 2WAEA 2P7CB 2XGDA 3CJNA 3TDZC 4F93B 5IT9Z 2CQQA 3V7SA 2IJLA 1OLTA 1Z7UA 1OCZH 2VE8A 3I3LA 1O3RA 1ZGWA 2IA0A 2P6TA 1YO5C 3RQ4A 1AWCA 3E5UA 5EG0A 1AU7A 2XDVA 3VB2A 2VB6A 2F48A 2V9PA 3LNQA 2WAQA 2OCCH 2DFIA 2WV1A 3FM5A 2BY1A 3G3ZA 4MNUA 2VKDA 1XX5A 4XLAA 3NRVA 2L0KA 4G7OF 3BZ6A 3GEZA 3RZOJ 2CQKA 4LG3A 2VXDA 2W57A 4U0YA 4XQFA 3OYGA 1YTYA 2ID6A 2OA4A 3O8HA 3FXLA 1GVDA 2E5ZA 4X0GA 4B3AA 5EF6A 3LA7A 3WTSC 4HAMA 5CPRB 2RAEA 3WTYC 5FKMA 5IOYA 1ZRFA 3SZGA 4PFPA 4CCKA 1Y8RB 3GTKJ 5IT9K 1V55H 3KP3A 2K9LA 2CUEA 3FBIB 1P2FA 2J5PA 3MAJA 4BE2A 5F27A 1SD6A 1W36C 5C44J 3GBGA 3LSHA 2L01A 1W7PB 3BG7A 1MKMA 3ZQQA 2XSJC 4QIWN 5FROA 2HPMA 3CF2A 3O8GA 4UV9A 4XN0A 4A69C 2OU2A 4NBQA 3L00A 3K4LA 4MO7A 1UHWA 4Q4ZF 4Y17A 1G3YA 5ERIA 1FTZA 4HNTA 4GO1A 1KQ0A 2ZJ2A 4A5MA 2L7FP 4XLPF 2XAGA 4ESBA 2XF7A 3E6MA 1X1DA 4D9JA 1IC8A 3AG4H 1VQ8I 4W97A 4O6JA 5E8GA 3G71I 2G7HA 3WU0A 2Q8KA 3CESA 3AG1H 2E1NA 3K69A 1LNWA 1T39A 1B1BA 3IC7A 1LB2A 1ZH5A 4G94A 1WGXA 1BI2A 2RNGA 3BOQA 3QP6A 2JZYA 4XLNF 2O9LA 3NWTA 1HLVA 3ZXSA 4A3MJ 1NK3P 4EJWA 1IN8A 5FO5A 3TOBA 2W4SA 3P9IA 2JTVA 2NOJB 4M3BA 1B8IA 3CP2A 2L5QA 5J47A 5IYBJ 4A0YA 2MD0A 3PM1A 1S7EA 4Z2YA 4N4OB 3CCMI 1J09A 1FIAA 2CV1A 1FSEA 2VQCA 1N77A 2ZO4A 4YFNF 1IXCA 4BQNA 2EA2A 5LD2C 3E97A 3RJPA 4ZYGA 2P0WA 1W0UA 1FBQA 1FBUA 1WJEA 3ABTA 2NS0A 4I7HA 3W2AA 1E3PA 1MW7A 4IRGA 2BZTA 1ODDA 3NARA 4OIPF 3HOUJ 3TOAA 5GAGJ 5B5EC 3CCSI 2HDDA 2LF7A 3GTOJ 4RB3C 4C3HJ 1VQOI 3GTPJ 4GGGA 3GZNB 3DKYA 5K1YA 3ZGKA 5FRMA 1ZTRA 5C4JJ 3R0JA 2ELHA 3QWLA 2FSWA 4EM2A 4BJ6C 3HM5A 1G2HA 3OIOA 4C2TA 1Z9CA 1ZGAA 5JFRA 3FXKA 1RI7A 5E3OA 4CYCB 3QU3A 4KN4X 2OTLI 2FBIA 1OPCA 2XPUA 3CCYA 4L5IA 2RV8A 4AC0A 3WTVC 4EGZA 3QPHA 3F72A 1MGTA 2AXLA 3OYCA 1EJ9A 1BR4A 4MHGA 4A5NA 4BHPA 2ECCA 2XPWA 4KUMA 3SJMA 3BZKA 1T0FC 1MJBA 2FMLA 2O6GE 4NC7A 2B7EA 3KYCB 1MNEA 2L9VA 2W84A 4WXHA 4BHCA 2HDCA 2X6OA 2DOAA 2EIMH 3BWGA 1DP7P 1MMSA 2Z3YA 4PGHA 1ETQA 4Y3OA 1SFXA 1FMVA 5M5XJ 1HDPA 4U88A 4XLEA 5EGOB 2E7XA 5EEAA 1WRJA 4M3EA 5K7ZA 2GZWA 3CCLI 1BC8C 1PYVA 4MFDA 3U2RA 2XF5A 1XC5A 2R93J 3L2VA 1U8RA 2XVCA 2LSOA 3WG7H 4IHSA 4BKXA 1SEUA 4JX4A 3O3KA 1DU6A 2HYGD 2X48A 3QRFF 4J00A 3DQVC 5HVQC 3M8FA 3BG3A 5DD8A 2ME6A 1GHCA 3J7AO 2LP0A 3J7YJ 3KPHA 3CCUI 2H1KA 3S3MA 3I4PA 5F1JA 4IRIA 3OYDA 2R7DA 2XUBA 3FK7A 3JTGA 2M8EA 1LUJB 3MVPA 3DLLF 1JHHA 2PJRB 2JA7J 1NHAA 2F5DA 1WHUA 2F5CA 2HQ5A 4IEJA 5LEKA 3RTRA 2JA5J 2WADA 1BBYA 3TP0A 1V5EA 2NVYJ 4PDKA 4YIRX 1ZRDA 5FFXA 1XMXA 5CKTA 2JSPA 3DPLC 3OWTA 2IS6A 3E3VA 1QGPA 2FQ3A 1W7PA 1FJLA 3FIWA 4I6ZA 1U8BA 4HLXA 2ZBKA 2WAFA 3HTSB 1BJZA 2NNNA 4PSWA 2NAZA 3D5RC 3H92A 3CC4I 2JWTA 5TGTA 1QBJA 2IGMA 5FD6A 2EK5A 1K4SA 4LOCA 3W6JB 4CH7A 2V1DA 1A6QA 3M8EA 1RETA 5J4VA 4XN3A 1YE9A 2MG4A 3ABUA 1G4DA 2WWYA 1XDUA 3ZR8X 2P4WA 2M87A 2WB1A 4LLLA 1ZR2A 1MBFA 2M30A 3U21A 3OR1C 5BOXA 2I8DA 3PNTA 3FXOA 1JKPC 5GTHC 1R00A 2VPRA 4XKBA 3SYTA 2R7OA 1KU9A 3A2KA 2VI6A 1HKTA 3KZZA 2EH3A 4CO8A 1HSJA 2MW8A 4HW0A 3OY9A 2DODA 5CQEA 1RRJA 1FP2A 4OAZA 2ZJPF 5TRDA 1RPWA 3SQNA 2K85A 5IP6A 3Q3SA 5KNLA 2UV1A 1SAXA 3VYTB 2HU9A 4RS8A 4IHYA 2GAUA 2JRTA 2KJBA 3QQAA 3MZHA 1P7IA 5B3SH 2FUG2 4ZTJA 5LLQA 2BEOA 3HRSA 4G12A 3CC7I 4M9SA 3GLLA 5FKKA 3D1NI 4RAYA 2GIVA 3D5LA 4XRSA 5GPAA 3E5QA 1D0ZA 2F6CA 2B0LA 2R7FA 2ELKA 2IPQX 2ZCWA 1FOYA 1T08B 2NVXJ 5E17F 3HPGA 4IHXA 2Z5UA 4RB0A 1O4XA 5KK1A 4RM2A 1UZCA 1S9HA 2VKVA 1V5FA 4P96A 1UJ8A 2KDOA 3H5AA 3OYLA 1TQMA 3RSNA 3OSGA 2LREA 3ZQIA 3K4MA 2DA5A 3BR5A 1R4NB 2B63J 1S7AA 1F43A 2L02A 4EMSA 1USSA 1T56A 2F4IA 1FX7A 3DXJF 4E70A 2MBFA 1VQLI 3K2ZA 3S1NJ 4CYCA 3A4CA 5GP9A 1ENHA 1TZLA 3HJEA 2R7RA 2RQQA 2XAJA 3HKZN 1KYWA 3DBHB 5E1WA 1T98A 4HSRA 4XKCA 5F6FA 2JUCA 2QGUA 1DP3A 3BQYA 4GYGA 1B72B 1T38A 2UXXA 4E7SA 4FISA 1QHGA 1X1PA 2BHYA 2PMHA 4AIJA 1IXRC 2DQRA 4C30A 3CUQB 3ERMA 3J80Z 4BBSJ 2E7WA 5AIPA 4RMNA 4R79A 3V4GA 2YU9J 3RI4A 3R60A 4AVZA 3L2RA 3QOPA 3H5NA 5EGOA 4TV7A 1VQ7I 1NTCA 1WH5A 5ED4A 3TL4X 4G9YA 4YRVA 2QA4I 4UY8I 2O0YA 4RGUA 1WZ2A 1IN6A 1FYMA 1PUEE 3GTJJ 1REPC 2X0LA 2Y48A 3K4JA 5JVGF 3NAUA 2EBIA 5D6FA 1GUUA 2R7TA 3CMEI 2IS1A 1VQNI 4YELA 1LJ9A 1YLFA 2X6YA 2HVSA 4PCQA 3JRHA 1R5HA 3Q5FA 3TQNA 2E1CA 1BIAA 2XAQA 5LRSA 1TBXA 2KPMA 5HS9A 3LSIA 4HRIA 2YPRA 4AIDA 3T8RA 4CICA 3PL8A 5E1XA 2V4JC 4CZZA 3MKLA 3C3WA 2A68F 3J80K 4BAYA 2VBXA 1ACIA 3HZJA 2IGNA 2PJRA 3WTWC 2OZ6A 5EDNA 2PLYA 2VUMJ 1H9GA 1WJ5A 4NC6A 3PUBA 2IBDA 2GOXB 2EZHA 3DFGA 1TWFJ 1KU2A 4F52A 1P7JA 2DN0A 3QPSA 5FLMJ 1YJNI 5E8IA 4KMFA 2O8KA 1Y39A 2ADUA 4HPQA 2WBMA 1VTNC 2F5FA 4GXOA 1ZG3A 4Q48A 3L9FA 4F3QA 2VIXA 2IT0A 5KAFC 1RR7A 3ABMH 1D5VA 3I58A 1V4RA 2K7LA 4CCNA 3S15J 4ZYAA 1I1GA 4XK4A 3CO7C 1D3YA 4HF0A 4KYWA 4ZZDA 1GV5A 3SFZA 2X1CA 1MD0A 3N97A 1XDSA 3A01B 3M1EA 3E5XA 4M3GA 3FM3A 2O03A 3WTXC 2XB0X 5HOOA 3JCUC 2KZVA 1WH7A 4DZJA 1FOWA 3M8JA 4XLHA 2ISZA 5FLVA 2CJJA 3GTGJ 3E6CC 1A6IA 2L54A 2DT5A 2YU3A 3VODA 1H89C 4HDVA 1XS9A 1YYVA 3PIPF 2WA0A 3MMYB 3VOEA 1MBEA 1TL8A 3KP7A 5IYCJ 4BJ5C 3PNYA 1HSTA 1SVMA 4S0HB 5F1RA 4DBQA 3PQJA 3C7JA 2XAUA 4KJZA 1K79A 2HFHA 2P5LC 3QU6A 2C6YA 2A6HF 4DOZA 3ERED 2AHQA 4M9XA 3K70C 1E3OC 2CUFA 1MMAA 1RKWA 2EV5A 4MEYF 2QLZA 4N4NB 3S93A 1XMKA 3OR2C 4DGWB 3RYPA 2NVTJ 2Y0SA 2KDZA 5FFZA 3BPXA 3E7LA 2BGCA 3RCOA 2W00A 2FOKA 4BE0A 3SEQA 4MGRA 3S16J 4EATA 3JRCA 2ZNYA 4UHTA 2EWNA 1XSVA 3K9TA 5M5YJ 3EUAA 4CHUA 2HQNA 1ZRCA 4L18B 3DLAA 1P6RA 2JA2A 4U7BA 5FKNA 3DF8A 3C2GA 3IH4A 4B09A 4LJZF 3ISPA 2CUZA 1OCRH 4A3IJ 1FWZA 4FTHA 1DGWY 2XKOA 4CSWA 2Y9YA 3FKJA 5DEQA 1X3ZB 2UZKA 5BPIA 4M71A 3NWSA 5LGTA 1XG1A 2Q0OA 4DZPA 1PJRA 1LDJA 4ASNA 4CYDA 4YFXF 2JT1A 1O3SA 3VYRB 1QA6A 1D8JA 3TDUC 1X1CA 4BNCA 1WVRA 4KIFA 3SZTA 1R1UA 3Q0VA 3DKWA 3C2HA 5J6XA 2YUSA 3V42A 2UUZA 2ETHA 4XKWA 3WU2C 4EQQA 6PAXA 1ETKA 4P5OA 5HLTA 1B9MA 4L0ZB 3AL0B 1YW8A 4XNFA 1E0EA 3OOUA 3P9KA 1IG7A 4FETA 4MQVA 1V5GA 3JAMZ 3M4OJ 2PMZN 3KEQA 1B72A 1Z91A 1I3QJ 3IWZA 4U0WA 3PFIA 3LA3A 5L3DA 1MIJA 2NNYA 3IKVA 3CUQA 4KITB 3IHUA 3GTLJ 2F4OB 2LY1A 3JRAA 2R0QC 1R9TJ 2AS5F 3HTUA 2VQHA 1TTYA 4RAZA 4LLGF 3HYIA 1S29A 2RREA 3GZ6A 2EZLA 3AAFA 1YX3A 1Z21A 4I0AA 2EPFA 1ZKGA 2L7MP 2MABA 1XCVA 2QUFA 4JK1X 3HHGA 3KCCA 3N05A 1BA5A 3GX4X 4LB6B 4B8XA 5H6QA 2X51A 1OYWA 2CQXA 4JYKA 5BNGA 1HOMA 2DAOA 5DUIA 3SHFA 3PSFA 4E4HA 2JPBA 2VE9A 3AG2H 1E3HA 1EH7A 1BR2A 1Y56A 3B6AA 4ZDLA 1VFCA 5D8KB 1AHDP 2IAIA 1MMGA 1P4XA 3A1YA 3LSRA 1X4PA 2COMA 3SXYA 1PUFB 3KP4A 2CRGA 5KVRA 1GXQA 3FXJA 1ZELA 3OYEA 3JSPA 1T6SA 4E7KA 2VJ5A 2XPVA 4ITVA 3ELKA 3UKGA 3L7WA 1XSXA 2KIMA 1MMDA 3RDIA 3A03A 3ZMSA 2DA7A 3BR0A 2F4MB 1OFCX 3SDGA 4A3EJ 4ZDPA 2H94A 1FYLA 3CUQC 1TWGJ 4NDLA 1EH8A 2CYYA 2D1VA 3ESWB 3QYBA 1H88C 1ZLKA 3ZMDA 1YIOA 3A01A 4IOCF 4BACA 3BJ6A 1W1WE 1A5JA 4DW6A 3PSIA 3W6VA 2CW7A 5EZHA 3TGNA 3VPRA 1SFKA 2MC4A 4UXNA 4ZYEA 1IW7F 1JT6A 1RESA 2CS3A 5J1YA 4RA2A 3M3YJ 2LVSA 3UR3C 2R7SA 1S3JA 5CLSA 1UELB 4M6VA 4PJNA 2XB5A 5HLHA 1JGSA 3KEOA 4LMYA 3LQRA 4BXUA 2KFDA 1OMIA 4PK4A 2W25A 3I55I 2Q2EB 1X1AA 4N0BA 4R1HA 5CVJA 1MBGA 1QPIA 1MJ9A 1TNSA 3FDYA 3LSGA 1XSDA 3F8MA 4IKFA 4LITA 1A04A 3OIPA 2BBYA 1DGRM 1M1EB 2R7QA 4JP0A 3CJQB 2HXOA 3A0HC 3CLQA 2A3SA 1MNDA 4UUTA 3TO9A 5A2QZ 3RPUA 1T0FA 3S8PA 1W7PD 4YIFA 1IV8A 3P9CA 2STTA 2LMDA 1BI3A 3T1BA 5K7HA 1ZR4A 3PO3J 4S04A 2LYCA 3ASOH 4YG2F 3K6GA 4BL0B 2G7UA 3GZ5A 2BY0A 1T2KA 5HS8A 5D8LB 1L3LA 2GXGA 2QENA 2NOGA 4GCVA 4OINF 1TC3C 2W85A 1CQTA 9ANTA 2KRHA 1WI9A 2V6EA 3W2VA 3I54A 4J19A 3HOXJ 4Y15A 5FKOA 4ETSA 2YX4A 3PFYA 4P55A 2EQRA 4XRSG 4YFKF 2MD5A 4RM3A 5L3CA 3VWBA 2LKPA 3MKWB 4ESFA 3G1LA 5L3GA 1HDDC 3S14J 2DMUA 2QVOA 2TDXA 1YI2I 4QLCU 2BY2A 2X85A 3REOA 1J9IA 2LDUA 3WGIA 4OMZA 2WAQN 2Q1ZB 2FNAA 3F8FA 4HSTA 4IRHA 2IA2A 2HTJA 4PUSA 2EIKH 4C9YA 5A2QK 1SANA 1J0RA 3BCAA 5IT3A 1WQ2A 4QWQA 1HXDA 4H4KC 4D1QA 5HDNA 3PNVA 5FJ8J 1EA3A 2GOMA 5DCMB 3WTZA 3V7CA 2IGOA 2MSYA 1BL0A 3I71A 1YG2A 1IZ1A 3TW7A 2VQGA 4D5FA 5FB2A 2E71A 2H6CA 3EQLF 3R0AA 2DK5A 1VQ4I 3ZMZA 3SZPA 2H8WA 2D2WA 1BI0A 1Y1WJ 5ICGA 2EILH 2O3FA 3CLOA 4B47A 3CMYA 2GBYA 4IPAA 1W0TA 2H6BA 1I6XA 3BTIA 4P9FA 4OOIA 3IH3A 2HPIA 3I9V2 2RNJA 1D8KA 4HX4A 5J8FA 1XCBA 5IPAA 1SD4A 3SDBA 4PFOA 1D1CA 5F0CA 1MNMC 1VQKI 3EYIA 3K0LA 4ZJZA 4PZJA 2QZ8A 3CC2I 3LQQA 2EFQA 1OCPA 1Y0NA 3BY6A 1S5LC 2XIGA 3WODF 4BEHB 1IGNA 1P4WA 2OQGA 2XRLA 2ZJRF 2BOLA 5HLIA 4Z6YA 3MD2A 4IQ4A 4XBFA 2CW0F 3LSKA 2KRCA 2DW4A 5EZGA 1IRXA 2WV0A 3WHBA 1B9NA 2V1NA 1BIBA 4R8HA 1TWHJ 1TLHB 2M7BA 1F9NA 4AVPA 3JRFA 4EJTA 5CVIA 1YRNB 1RZ4A 2CO5A 2HR3A 4LB5A 3BCBA 3GTQJ 3CCEI 2E1MB 2CSOA 3FXMA 3V8JA 3AL0C 1XB4A 1P9QC 1IRFA 5EYRA 4DIQA 5HDGA 1KONA 2FNPA 3ZQFA 3SFIA 2JUGA 1LEAA 4FX0A 4BGDA 3S1MJ 5IOZA 1ULYA 1FT9A 3A02A 1UFMA 3LSMA 4HV6A 5GAEJ 3S2HJ 1RUNA 1A36A 4MFEA 1YHQI 1YITI 2M45A 3TW6A 2ZSHB 1TWAJ 4KNYA 1SMYF 1LFBA 4BQAA 4CCLA 1E17A 2V79A 3BG5A 1X3WB 3KE2A 2VT3A 1N25A 4LGWA 4Q5SF 4W1UA 1O3QA 3GVAA 2CWEA 1R36A 3W6KB 1C0WA 2E2JJ 1G8XA 1UHMA 1X2MA 3GCMA 2LTPA 4G6TB 4O5VA 4DYRA 5FRNA 1IF1A 2P6SA 2HEOA 1ON1A 2G9WA 2V1XA 3DKXA 3H35A 4D5CA 3D0SA 2MLGA 2TRTA 2YS9A 1OQYA 2Q2EA 3CP8A 2XGEA 2P8TA 1JUPA 5IY5H 2BV6A 1LDDA 2Y75A 1QU3A 3BZCA 3WHCA 2DYRH 1UCRA 2K9MA 1I27A 3UNGC 1JUMA 1TW2A 1UG0A 3FZVA 3L2QA 4IZZA 1O7FA 2OPTA 3HC7A 3T0YA 3OS2A 3BR1A 3JRDA 4A3LJ 3CO6C 1SFUA 2O5RA 1YOVB 2K27A 1RIOH 3GTMJ 1ZQ3P 4HX7A 1NK2P 3AFHA 1LDKB 3DBLB 2B9SA 1H8AC 4JX6A 4BS9A 4XR6A 1K6OA 1OISA 3HRUA 2ICWG 4JX5A 5D5VB 1QO0D 3HB9A 4EJUA 4YEJA 2L9RA 1TQPA 1Z05A 1Z3XA 2CUJA 2ZKZA 3H3UA 1I39A 1K6YA 2UXNA 3VEPA 3HGYA 3HOVJ 1AOYA 4C3JJ 1ON2A 3LFKA 4M3FA 1AA7A 1R1VA 4AYBA 4KT6A 4L5EA 5JVTA 2VPLA 1U9OA 2KT0A 4A3DJ 4L0YB 4QPQA 4C2UA 3ABKH 4I98B 3D5SC 3JR9A 1MH4A 3WU1B 2P7VB 5LHGA 3H9GA 2DA1A 1KZHA 1VZ0A 2L2OA 2ACJA 2DA6A 3PO2J 4E7HA 1FLIA 4MIMA 1WJCA 1Z6TA 3VSKA 4HF2A 3ML6A 1TQIA 2NXNB 3HHHA 1U9NA 1WFXA 5TJJA 3S1RJ 1KU7A 2VC0A 1OYYA 1ETWA 2EIJH 3H1CA 4ZDOA 4CZCA 3HRMA 5FD5A 4UVBA 5CQGA 5DCMA 4I76A 5BMZA 2A69F 4B48A 1NG6A 3FKIJ 3H3VK 2HDWA 3OYMA 3QAHA 3K7AJ 2D45A 1UHSA 4CUGA 2QQBA 2QSFX 3OYHA 1VQPI 3R6SA 1ZARA 2OC6A 1VQ5I 1VF9A 3PIOF 2W1OA 3TEDA 3KETA 5ILUA 4MQ9F 1A35A 2WC2A 2DBBA 2RVCA 2M34A 1BN5A 4XSZF 4LG0B 4HYEA 4ENJA 4V2GA 1SC7A 2CQNA 3E6BA 1UB9A 3GYHX 3HIFA 1LPQA 2BY3A 4IF4A 3ZQCA 4XIDA 4B3XA 2JK3A 2CFOA 2K4BA 4B4CA 3KYDB 5KAIC 3S17J 2DMQA 1ZK8A 4O3MA 2MA3A 2ME0A 3ZQHA 1X2NA 4HX8A 2R7XA 3T8TA 5GPCA 4OAYA 3ZMUA 1WI3A 2E36A 2DTZA 4IHVA 3JRGA 1FEXA 3VYUB 2YX7A 1U78A 1WJAA 4BEHA 1G3TA 2FF4A 4A2UA 2QSGX 2Y2ZA 1Y0UA 2WB1N 5BQTA 2HWVA 1KU3A 2A5YB 2M1BA 2A6EF 3BG6A 4N9IA 4CA0A 4XM3A 5EEGA 2M4KA 2MH9A 1IO2A 1MH3A 5J8CA 3W3CA 3LSTA 3F8BA 2JQ7A 2KMUA 2BYVE 2PFBA 2CV0A 2LKSA 4ZTFA 1JKRC 2E2HJ 2BW3B 1YRNA 1QNTA 5KHDA 3ZPLA 3MCZA 3OL3A 3TO6A 3WGHA 1K78B 2JA8J 2RKHA 3DPUA 2IP2A 5D6EA 4HV5A 2X4HA 3OMYA 3DBRB 2ISYA 2XRNA 2BXYA 4P9UA 3ABLH 1W36D 4PJMA 2OAZA 2GWRA 4ENMA 5B1BH 2DJIA 2V9VA 3DPTA 1B6AA 3H9JA 2ZXHA 3KX2A 1QPMA 4AUXA 2JJ7A 2JVGA 5ICEA 4Y52J 3V8LA 1FSHA 4LD5A 4BYYA 5K7FA 3K10A 5TISC 2Y0MA 1G6NA 2DK8A 3DTIA 3RKWA 4H0EA 1ETVA 4IJAA 1RKTA 3C1DA 4IO9F 2W82A 2NS8A 1D0XA 2HI3A 2FBKA 3GMEA 2FX0A 2DU9A 4RLFA 4A93J 4D7MA 1PDNC 2PX9A 3BP8A 3RIRA 3K1PA 1RUOA 3JRIA 4E7LA 2VBZA 1ZAOA 2TCTA 3LMMA 1OYIA 4BHBA 2R5ZB 1JKOC 2P5VA 4ANJA 4XKVA 1HW2A 3ZP5A 3HBLA 3HPHA 1D1BA 2A61A 4HA8A 2VJ4A 1HKQA 3HSRA 5FLXZ 2QQ9A 4HQEA 1BM9A 1TW3A 2HVQA 2PMUA 2ZXIA 3S3OA 1J7KA 4U0VA 1YJWI 4HG2A 2LF8A 2QF7A 3QP5A 2DT7B 2E1MC 2HOTA 1F36A 3RKYA 2KZGA 5J3LA 1XD7A 4I2OA 3OYIA 5D4SA 1Z6RA 2DLLA 2OD5A 2E1OA 5L3FA 4V2FA 2K86A 2O7OA 2EFPA 3ZN0A 2Y9ZA 2KJCA 2QKMB 2E19A 2XAHA 5CVRA 4BDZA 1JE8A 2DMPA 1FC3A 2ZJQF 4G6DA 1HBXG 3J7AY 1ZG1A 3FMSA 4HZFA 2R7ZJ 1XGSA 1S72I 1MBKA 3ZQ7A 3AKZA 2VASA 4M6XA 5F64A 2EV0A 3SEZA 4E7ZA 4BH9A 1HW5A 2DCEA 2VBYA 3OIQA 4BE1A 3Q0WA 3EETA 5FLXK 3IUOA 2O61A 1K61A 5K5RA 3AG3H 3GF2A 1B8IB 1U0JA 2L4AA 3IKTA 1HC8A 4XMYA 4ON0A 4LIUA 3I53A 3I4NJ 5D5XB 2GA2A 4WX9A 1Q1HA 5E3LA 2R92J 4WF2A 3RYRA 5E79C 2FQ4A 1ITYA 1IAWA 4G7HF 4CGZA 1BI1A 1ZLJA 2LH9A 3CF5F 2ZB9A 3QYEA 4XL9A 1Z77A 2M9HA 3MN2A 5L3BA 1QZEA 1GXPA 2Y31A 1LEBA 1AKHB 5ILSA 2EV6A 4BU2A 5JLXA 3OYJA 1R4MB 2GLOA 3M1CA 1QVTA 2VOPA 1APLC 3QYFA 4XORA 4YIIA 4NQWB 5LEJA 1VQ6I 3ZQGA 2MC3A 1Y1VJ 3QODA 5LHIA 1QVUA 2WTEA 3RPUD 3FBNB 1GVJA 2ZFWA 4FE7A 4LG0A 1IRGA 5GADJ 1JHFA 2VJJA 5ILVA 3EUHA 2V6CA 3R61A 2HVRA 4I0BA 4A3GJ 5DDGA 3MEXA 4WK8F 2HZTA 2HYFA 1W5SA 1Y6IA 2ZSIB 3M9AA 5K5QA 3K4BA 2Z33A 4IXAA 3PUFA 2X1DA 2LR8A 2JMWA 1WJDA 3R4KA 4XRFA 5HS7A 2FRHA 3HOTA 1FTTA 1SMTA 5JHFA 2MFZA 3CDHA 2VODA 4WXCA 1CGPA 2GA1A 1F4KA 2L7KA 1T95A 5CYVA 2V1UA 2DA3A 3H0DA 2VONA 1OCOH 2DMTA 2HZDA 2MGQA 4Y4RA 4ZC3A 4CDGA 4FX4A 2OJED 4UB8C 2GQQA 3U1DA 5HNHA 5EEHA 1KGSA 5CVVA 1B4AA 1MMNA 3JAMK 2BVLA 3J81Z 2DDAA 3BPVA 3JTHA 2EZKA 3BTLA 5LRRA 1K4TA 3WTTC 2BW3A 1OJLA 2A5WA 4HNVA 3P5JA 3OYNA 2YR2A 3KLOA 2M3AA 2CMPA 4AIHA 5BS6A 1EH6A 2VLAA 1K78A 2HTSA 2RGVA 4AM3A 3GO5A 4KDPA 2H1LA 1SFOJ 2DA4A 2OQRA 5GTIC 3DWLE 4EGYA 1I5ZA 2E35A 2QEXI 2EA4A 2NRAC 3S2DJ 3CZ6A 1FYKA 3DTKA 1NH3A 2X9DA 2RC4A 2QBYB 4BXXJ 3OYFA 2Y0SN 3GW2A 5DUKA 4NHJA 1FP1D 3RZDJ 1ZYRF 4A0ZA 3VSLA 5IYDJ 1Y8QB 2NVQJ 4PSXA 1LFUP 4FT8A 4OIRF 2VKHA 2K3FA 1QQIA 2KKOA 3EUHC 4UNOA 1KQ9A 4XONA 2XV4S 5FKLA 3I59B 2F2EA 2LKXA 4FHTA 2LLKA 3F9KA 3J81K 5JHUA 1OR7A 3ZOBA 3H3ZA 4DBRA 2KIFA 1FMWA 3TBIA 3ZQLA 2PJPA 4UVCA 1D0YA 1MSEC 2LFBA 3DV8A 2FEZA 3DEWA 1E2XA 2COBA 2M4GA 1IV6A 2R5ZA 1JXSA 3GLXA 3IL2A 3BTCA 2E34A 1PVEA 2PEXA 1O7LA 3L1PA 3ZN1A 3ASNH 3E0JB 1IDZA 2VT2A 3V7RA 5IP7J 1STZA 3G1MA 2IS2A 1MDMB 2R7UA 2PBIA 4XOPA 5LGUA 3JSOA 2IVMA 1G59A 3LOCA 2JA6J 3GWZA 1U3EM 3H36A 3E1SA 2STWA 3FXUA 2DYSH 2KRFA 4GDFA 4L9NA 1TP4A 3LA2A 2LK2A 1LE8B 2KL4A 2E60A 3TMOA 3F22A 2ZMEB 3FX3A 3IRRA 2RQPA 5H20A 5LBQA 3CJTB 3EDPA 2V9KA 2GIZA 3FXRA 4IHWA 3FISA 3GFLA 4A0XA 1BR1A 4LK0F 4EV0A 2QWWA 4KICA 2PN6A 1R7JA 2X1EA 3IAM2 1U5TB 1UG2A 2K40A 4A12A 4I09A 3Q0UA 2H8RA 2FMYA 3U1KA 1X1BA 4HDUA 1FNNA 3OYAA 2N8GA 3LAPA 3CCVI 3WE3A 1YX5A 1OR7C 2KHMA 2HXIA 3Q9VA 1D1AA 2H27A 1XGMA 4JBAA 3F21A 1MZBA 4QSHA 1D5YA 5HODA 4IL6C 3KP5A 3QOEA 4GRIA 4XRMA 3OYBA 2CGPA 1FPQA 3HL2A 3F23A 2HYJA 1R58A 2FBHA 3ZMTA 2KQRA 1Z7LA 4II3A 2K9NA 4F91B 5F08A 1OKRA 1YS6A 2EINH 2M5WA 4RGXA 3U9GA 4M72A 1LVKA 4OU0A 1AKHA 2IW5A 1Q1VA 3CDLA 3GXOA 3GFIA 1Z0XA 4JOMA 3ECHA 5FGMA 5D5UB 4PJJA 2CFXA 5GAHJ 1K7AA 1SAUA 2KIUA 4NQWA 2M0CA 3BDDA 2AXTC 3QPLA 1ZGJA 1YW9A 2E2IJ 4GFBA 3HUGB 3EPZA 4UUSB 1ETYA 1R5ID 5H6RA 4BY7J 4X6AJ 5E18F 4B44A 2K9QA 5JR3A 1LVAA 1BOAA 1ZN2A 4BQQA 3KP6A 1EV7A 1OCCH 1T8IA 5B66C 2XASA 3KLNA 3O2PE 1LKXA 2M0MA 3K1NA 5HNFA 3HRTA 2NVUB 4RDUA 2K5CA 3OS0A 2XKPA 3MQ0A 4EVIA 4RB1A 2PQ8A 3ZRGA 2LY9A 1GV2A 2LRDA 3OS1A 4DQ2A 2ECBA 5E3NA 5CVUA 2V7FA 2L4MA 4RGRA 2LNBA 2VJIA 2XF6A 4NNJA 3MFKA 1R49A 4I02A 1BW6A 3BT9A 1BW5A 2X6XA 3DTEA 3JRBA 1QRYA 2DFFA 3W2WA 3M7GA 4LK1F 3I4MJ 2CH0A 1POGA 3V8KA 2IXSA 5H2FC 4KIGA 3HXLA 2I5UA 4UB6C 2XC7A 5J1RA 1SD7A 1JT0A 1PP7U 3H0GJ 4GYIA 4A3CJ 1PUFA 1VNDA 2KISA 3S3NA 2K9SA 3CDIA 1JI8A 3C18A 5ICFA 1YQAA 4EJOA 4WWCA 5JLWA 2VKEA 1J2XA 2QBYA 1IN5A 4M9ZA 3G6EI 3HOWJ 3F8NA 5DCFA 2DFHA 3BTJA 1MBHA 1UAAA 2CV2A 1JTYA 1FOKA 3VDXA 1YS7A 3CD6I 3BLYA 1KA8A 1Z1DA 4HNUA 1GT0C 3OYKA 2IS4A 2D5VA 1KQ8A 4ENNA 1R71A 1U6GA 1JKQC 3FHNA 1DPRA 2CW8A 1J59A 3I59A 5LGNA 3WTUC 2HGCA 4Y7NJ 2HQRA 4A6EA 1IN4A 2DDBA 2IGKA 5AIQA 5LHHA 1HW1A 2DTRA 2LY2A 5JI6A 3GFMA 3HKZA 1JTXA 1TT0A 1WSUA 3E6DA 3RKXA 4I99C 2Y69H 3CCQI 2DT6A 2FJ1A 3JREA 2OTJI 3X2QH 2LC2A 3I5UA 4RLQA 4XOTA 4ESJA 1XGNA 4KFCA 4RB2C 3FMRA 2O8XA 2Z2SB 1B59A 5B1AH 3Q9SA 3MZ8A 2V26A 3MZYA 4KA4A 3IH2A 1MDMA 3HOZJ 3TKYA 3RPQA 3BG9A 3BJOA 5M5WJ 3KZIC 4D0PA 4OIOF 3CQZJ 2JVHA 3ROUA 3IAS2 2J5OA 1IUFA 1TNTA 3K70D 3K4CA 1V54H 1K83J 1P92A 1L0OC 3BQZA 2OBPA 2LBFB 3KZYA 3I0TA 1WJBA 3K1MA 3MKYB 3FF5A 1FOXA 1MJAA 1SFEA 4A3KJ 1R22A 4HOBA 1I3AA 2WY7Q 2DOFA 3IWFA 4L9VA 3ZMVA 1LE8A 4WXDA 1FZPB 5DD4A 3BR3A 2HOEA 2DQLA 1I6HJ 1TT5B 2ZMEA 4MLOA 1DUXC 5D4RA 3I64A 2L9SA 3ULQB 5E3MA 2HOAA 1X58A 2PI0A 4CCOA 3A0BC
chains in the Genus database with same CATH topology
4DYCA 1ZTRA 1BA5A 2ID3A 5C4JJ 2FX0A 4A93J 4D7MA 1WCMJ 3HM5A 1G2HA 3OIOA 2CQXA 4JYKA 5BNGA 3JRIA 2GM4A 1HOMA 2TCTA 1UMQA 5E3OA 4CYCB 2R5ZB 1JKOC 3B6AA 5C3EJ 1VFCA 2XPUA 3HBLA 1JJ6C 3LSJA 3CCYA 1AHDP 1ORKA 2IAIA 4AC0A 4X1EA 3LSRA 2DA2A 1PUFB 2CRGA 3DCFA 2ECCA 2XPWA 1WPKA 3SJMA 2XPVA 2QF7A 5IP9J 3UKGA 3A03A 2HOTA 1F36A 2CU7A 2DA7A 2X6OA 3BR0A 5J3LA 1OFCX 1ETQA 5EGOB 3SDGA 5M5XJ 4A3EJ 1HDPA 5EEAA 2E1OA 1TWGJ 4NDLA 2O7OA 4M3EA 4V2FA 2Y9ZA 5K7ZA 4UUSA 1H88C 2E19A 4MFDA 1ETXA 2DMPA 3A01A 1XC5A 2R93J 1A5JA 4DW6A 3G1OA 4BKXA 3W6VA 5EZHA 2R7ZJ 3VPRA 1MBKA 4JX4A 1DU6A 4M3DA 1T33A 4BBRJ 2XSDC 2X48A 1JJ8C 1JT6A 1RESA 5J1YA 3M3YJ 2LVSA 2AO9A 3Q0WA 5J1UA 3BG3A 4M6VA 3LSPA 2XB5A 2ME6A 1IDYA 1K61A 1B8IB 2LP0A 2H1KA 5F1JA 3FK7A 3I4NJ 1I50J 3RKQA 5E3LA 2R92J 3MVPA 2JA7J 1QPIA 1MBGA 2FQ4A 2HQ5A 4IEJA 1ITYA 3BR2A 5DTDA 2JA5J 4ABZA 3LSGA 4C3IJ 2ZB9A 3TP0A 2NVYJ 1IRZA 1Z77A 2M9HA 2R5YB 5DS9A 3MN2A 4JP0A 2HXOA 2Y31A 1AKHB 4D7NA 1FJLA 3FIWA 3BR6A 5JLXA 4I6ZA 1U8BA 2GLOA 4UUTA 1QVTA 2M8GX 4QTRA 1APLC 1BJZA 3ZQGA 1Y1VJ 1QVUA 2JWTA 5K7HA 1ZR4A 1OCTC 3PO3J 4A3BJ 4FE7A 4LOCA 5EG0B 4C2MJ 1RETA 4A3GJ 2MG4A 4FCYA 2I10A 2NOGA 1TC3C 1CQTA 9ANTA 2LR8A 4J19A 2JMWA 3HOXJ 5M3MJ 1ZR2A 1MBFA 2JN6A 5FKOA 2EQRA 4XRSG 1HDDC 3G1LA 3S14J 2DMUA 1FTTA 1JKPC 2VPRA 3F0CA 4AYBN 2DA3A 2WAQN 2DMTA 3C2BA 2MGQA 2VI6A 3RQIA 2OF7A 1SANA 2EH3A 2MW8A 3TP3A 4XICA 5FJ8J 3IV5A 1TWCJ 1JGGA 2EZKA 3BTLA 1RPWA 2MSYA 1BL0A 4HNVA 1OJLA 3TW7A 3Q3SA 5IP6A 2EZIA 2M2EA 4D5FA 1JUSA 4IHYA 3QQAA 3HOYJ 1SFOJ 1HCRA 3HGGA 1P7IA 2DA4A 2XGCA 1Y1WJ 3S2DJ 3CMYA 2GBYA 4G12A 1W0TA 2X9DA 4BXXJ 5FKKA 3D1NI 3BTIA 2Y0SN 3IH3A 3B6CA 3RZDJ 4XRSA 5GPAA 4RBOA 2HOSA 5IYDJ 5F0HA 4EEFG 2NVQJ 2P81A 2ELKA 5IPAA 1LFUP 2NVXJ 4IHXA 5F0CA 1O4XA 2NS7A 1MNMC 5FKLA 2VKVA 2LKXA 2FD5A 2LLKA 2IEKA 3ZOBA 1OCPA 3S1QJ 5M3FJ 3OSGA 3ZQIA 2B63J 2DA5A 3BR5A 3ZQLA 1F43A 1MSFC 1T56A 1IGNA 1MSEC 2L7ZA 2XRLA 2LFBA 3DEWA 2COBA 1IV6A 3S1NJ 4CYCA 2R5ZA 3BTCA 5GP9A 5EZGA 3L1PA 1ENHA 3WHBA 1TWHJ 3HKZN 4A3FJ 3JRFA 1IDZA 1YRNB 5IP7J 3GTQJ 3G1MA 3HDDA 3BQYA 1B72B 5EYRA 4FISA 3LOCA 2JA6J 3OSFA 3ZQFA 3SFIA 1HF0A 4BBSJ 3S1MJ 5IOZA 2YU9J 3A02A 4B1RA 5EGOA 3S2HJ 2G0EA 1NTCA 1WH5A 2LK2A 4MFEA 1LE8B 5F0FA 3FK6A 1FIPA 3TW6A 3GTJJ 1TWAJ 5F04A 3NAUA 2EBIA 1IJWC 1GUUA 1LFBA 1EF4A 4IHWA 1GDTA 3FISA 5C4XJ 3BG5A 4A3JJ 3JRHA 2W48A 4W1UA 1UG2A 2K40A 4BY1J 3Q0UA 2H8RA 2E2JJ 1X2MA 2N8GA 2LTPA 4DYRA 2HXIA 1MBJA 3MKLA 3HEFA 4DYQA 4D5CA 4QSHA 2TRTA 2YS9A 1D5YA 1ETOA 5HODA 4XRMA 5EDNA 2VUMJ 2XGEA 1JUPA 2HYJA 2DMNA 2IBDA 3WHCA 2EZHA 1VI0A 1TWFJ 5FLMJ 1P7JA 2DN0A 3QPSA 2K9NA 1JUMA 5F08A 4FE4A 2O8KA 3K2AA 2Y30A 2DJNA 2OPTA 2R5YA 3BR1A 3JRDA 4A3LJ 2QCOA 1AKHA 3CDLA 1Q1VA 3GTMJ 1ZQ3P 1Z0XA 1NK2P 2LD5A 1RR7A 1H8AC 4JX6A 3S15J 2M0CA 1DU0A 4XK4A 2XGDA 3QPLA 2E2IJ 4GFBA 2CQQA 4UUSB 1ETYA 1GV5A 4BY7J 4X6AJ 1ZGWA 4JX5A 3HB9A 3A01B 2K9QA 2L9RA 4M3GA 3HOVJ 5EG0A 2XB0X 3HGYA 1AU7A 4C3JJ 1WH7A 4DZJA 4M3FA 3LNQA 4L5EA 5FLVA 1U9OA 2CJJA 3GTGJ 2WV1A 2KT0A 4A3DJ 1A6IA 2L0KA 1H89C 4RDUA 3JR9A 1XS9A 3RZOJ 1MBEA 1MH4A 5IYCJ 2DA1A 2LY9A 1GV2A 4S0HB 2DA6A 2ID6A 3O8HA 3PO2J 4MIMA 1GVDA 2ECBA 5E3NA 4B3AA 5EF6A 1U9NA 2RAEA 3S1RJ 2AHQA 5FKMA 5IOYA 3GTKJ 1E3OC 1ETWA 1BW6A 2CUEA 3BT9A 2CUFA 1BW5A 1RKWA 5F27A 4I76A 5C44J 3GBGA 3JRBA 3FKIJ 1QRYA 3H3VK 3I4MJ 3K7AJ 2NVTJ 2KDZA 1POGA 4QIWN 1UHSA 3E7LA 3O8GA 4A69C 5J1RA 1JT0A 3H0GJ 3S16J 1VF9A 4MO7A 3TEDA 4A3CJ 1PUFA 3JRCA 1VNDA 5M5YJ 2K9SA 2M34A 1FTZA 5JLWA 2VKEA 3HOWJ 4V2GA 2L7FP 3BTJA 1MBHA 5FKNA 1JTYA 3ZQCA 3IH4A 4XIDA 2JK3A 4B4CA 1IC8A 1GT0C 4A3IJ 4W97A 4FTHA 2D5VA 3S17J 2DMQA 1ZK8A 1JKQC 2Y9YA 2ME0A 3ZQHA 1X2NA 5GPCA 4Y7NJ 1XG1A 4DZPA 1WI3A 2DTZA 4IHVA 3JRGA 1FEXA 1U78A 1WGXA 1JTXA 2Y2ZA 2O9LA 2WB1N 1HLVA 4A3MJ 1NK3P 3Q0VA 2YUSA 2FJ1A 3JREA 1MH3A 1ETKA 4M3BA 1B8IA 3OOUA 1JKRC 2E2HJ 5IYBJ 1IG7A 1YRNA 3PM1A 1S7EA 3IH2A 3HOZJ 3M4OJ 2PMZN 2JA8J 3BG9A 5M5WJ 1B72A 3CQZJ 1FIAA 1I3QJ 1IUFA 1K83J 3BQZA 1W0UA 3GTLJ 3JRAA 2R0QC 1R9TJ 4A3KJ 4AUXA 2JJ7A 3NARA 4Y52J 3HOUJ 1LE8A 3BR3A 5K7FA 2HDDA 2EZLA 1I6HJ 3GTOJ 1ZKGA 2L7MP 4MLOA 1ETVA 4C3HJ 1RKTA 5E3MA 2HOAA 1X58A 2NS8A 3GTPJ 2HI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYC A;  1ZTR A;  1BA5 A;  2ID3 A;  5C4J J;  2FX0 A;  4A93 J;  4D7M A;  1WCM J;  3HM5 A;  1G2H A;  3OIO A;  2CQX A;  4JYK A;  5BNG A;  3JRI A;  2GM4 A;  1HOM A;  2TCT A;  1UMQ A;  5E3O A;  4CYC B;  2R5Z B;  1JKO C;  3B6A A;  5C3E J;  1VFC A;  2XPU A;  3HBL A;  1JJ6 C;  3LSJ A;  3CCY A;  1AHD P;  1ORK A;  2IAI A;  4AC0 A;  4X1E A;  3LSR A;  2DA2 A;  1PUF B;  2CRG A;  3DCF A;  2ECC A;  2XPW A;  1WPK A;  3SJM A;  2XPV A;  2QF7 A;  5IP9 J;  3UKG A;  3A03 A;  2HOT A;  1F36 A;  2CU7 A;  2DA7 A;  2X6O A;  3BR0 A;  5J3L A;  1OFC X;  1ETQ A;  5EGO B;  3SDG A;  5M5X J;  4A3E J;  1HDP A;  5EEA A;  2E1O A;  1TWG J;  4NDL A;  2O7O A;  4M3E A;  4V2F A;  2Y9Z A;  5K7Z A;  4UUS A;  1H88 C;  2E19 A;  4MFD A;  1ETX A;  2DMP A;  3A01 A;  1XC5 A;  2R93 J;  1A5J A;  4DW6 A;  3G1O A;  4BKX A;  3W6V A;  5EZH A;  2R7Z J;  3VPR A;  1MBK A;  4JX4 A;  1DU6 A;  4M3D A;  1T33 A;  4BBR J;  2XSD C;  2X48 A;  1JJ8 C;  1JT6 A;  1RES A;  5J1Y A;  3M3Y J;  2LVS A;  2AO9 A;  3Q0W A;  5J1U A;  3BG3 A;  4M6V A;  3LSP A;  2XB5 A;  2ME6 A;  1IDY A;  1K61 A;  1B8I B;  2LP0 A;  2H1K A;  5F1J A;  3FK7 A;  3I4N J;  1I50 J;  3RKQ A;  5E3L A;  2R92 J;  3MVP A;  2JA7 J;  1QPI A;  1MBG A;  2FQ4 A;  2HQ5 A;  4IEJ A;  1ITY A;  3BR2 A;  5DTD A;  2JA5 J;  4ABZ A;  3LSG A;  4C3I J;  2ZB9 A;  3TP0 A;  2NVY J;  1IRZ A;  1Z77 A;  2M9H A;  2R5Y B;  5DS9 A;  3MN2 A;  4JP0 A;  2HXO A;  2Y31 A;  1AKH B;  4D7N A;  1FJL A;  3FIW A;  3BR6 A;  5JLX A;  4I6Z A;  1U8B A;  2GLO A;  4UUT A;  1QVT A;  2M8G X;  4QTR A;  1APL C;  1BJZ A;  3ZQG A;  1Y1V J;  1QVU A;  2JWT A;  5K7H A;  1ZR4 A;  1OCT C;  3PO3 J;  4A3B J;  4FE7 A;  4LOC A;  5EG0 B;  4C2M J;  1RET A;  4A3G J;  2MG4 A;  4FCY A;  2I10 A;  2NOG A;  1TC3 C;  1CQT A;  9ANT A;  2LR8 A;  4J19 A;  2JMW A;  3HOX J;  5M3M J;  1ZR2 A;  1MBF A;  2JN6 A;  5FKO A;  2EQR A;  4XRS G;  1HDD C;  3G1L A;  3S14 J;  2DMU A;  1FTT A;  1JKP C;  2VPR A;  3F0C A;  4AYB N;  2DA3 A;  2WAQ N;  2DMT A;  3C2B A;  2MGQ A;  2VI6 A;  3RQI A;  2OF7 A;  1SAN A;  2EH3 A;  2MW8 A;  3TP3 A;  4XIC A;  5FJ8 J;  3IV5 A;  1TWC J;  1JGG A;  2EZK A;  3BTL A;  1RPW A;  2MSY A;  1BL0 A;  4HNV A;  1OJL A;  3TW7 A;  3Q3S A;  5IP6 A;  2EZI A;  2M2E A;  4D5F A;  1JUS A;  4IHY A;  3QQA A;  3HOY J;  1SFO J;  1HCR A;  3HGG A;  1P7I A;  2DA4 A;  2XGC A;  1Y1W J;  3S2D J;  3CMY A;  2GBY A;  4G12 A;  1W0T A;  2X9D A;  4BXX J;  5FKK A;  3D1N I;  3BTI A;  2Y0S N;  3IH3 A;  3B6C A;  3RZD J;  4XRS A;  5GPA A;  4RBO A;  2HOS A;  5IYD J;  5F0H A;  4EEF G;  2NVQ J;  2P81 A;  2ELK A;  5IPA A;  1LFU P;  2NVX J;  4IHX A;  5F0C A;  1O4X A;  2NS7 A;  1MNM C;  5FKL A;  2VKV A;  2LKX A;  2FD5 A;  2LLK A;  2IEK A;  3ZOB A;  1OCP A;  3S1Q J;  5M3F J;  3OSG A;  3ZQI A;  2B63 J;  2DA5 A;  3BR5 A;  3ZQL A;  1F43 A;  1MSF C;  1T56 A;  1IGN A;  1MSE C;  2L7Z A;  2XRL A;  2LFB A;  3DEW A;  2COB A;  1IV6 A;  3S1N J;  4CYC A;  2R5Z A;  3BTC A;  5GP9 A;  5EZG A;  3L1P A;  1ENH A;  3WHB A;  1TWH J;  3HKZ N;  4A3F J;  3JRF A;  1IDZ A;  1YRN B;  5IP7 J;  3GTQ J;  3G1M A;  3HDD A;  3BQY A;  1B72 B;  5EYR A;  4FIS A;  3LOC A;  2JA6 J;  3OSF A;  3ZQF A;  3SFI A;  1HF0 A;  4BBS J;  3S1M J;  5IOZ A;  2YU9 J;  3A02 A;  4B1R A;  5EGO A;  3S2H J;  2G0E A;  1NTC A;  1WH5 A;  2LK2 A;  4MFE A;  1LE8 B;  5F0F A;  3FK6 A;  1FIP A;  3TW6 A;  3GTJ J;  1TWA J;  5F04 A;  3NAU A;  2EBI A;  1IJW C;  1GUU A;  1LFB A;  1EF4 A;  4IHW A;  1GDT A;  3FIS A;  5C4X J;  3BG5 A;  4A3J J;  3JRH A;  2W48 A;  4W1U A;  1UG2 A;  2K40 A;  4BY1 J;  3Q0U A;  2H8R A;  2E2J J;  1X2M A;  2N8G A;  2LTP A;  4DYR A;  2HXI A;  1MBJ A;  3MKL A;  3HEF A;  4DYQ A;  4D5C A;  4QSH A;  2TRT A;  2YS9 A;  1D5Y A;  1ETO A;  5HOD A;  4XRM A;  5EDN A;  2VUM J;  2XGE A;  1JUP A;  2HYJ A;  2DMN A;  2IBD A;  3WHC A;  2EZH A;  1VI0 A;  1TWF J;  5FLM J;  1P7J A;  2DN0 A;  3QPS A;  2K9N A;  1JUM A;  5F08 A;  4FE4 A;  2O8K A;  3K2A A;  2Y30 A;  2DJN A;  2OPT A;  2R5Y A;  3BR1 A;  3JRD A;  4A3L J;  2QCO A;  1AKH A;  3CDL A;  1Q1V A;  3GTM J;  1ZQ3 P;  1Z0X A;  1NK2 P;  2LD5 A;  1RR7 A;  1H8A C;  4JX6 A;  3S15 J;  2M0C A;  1DU0 A;  4XK4 A;  2XGD A;  3QPL A;  2E2I J;  4GFB A;  2CQQ A;  4UUS B;  1ETY A;  1GV5 A;  4BY7 J;  4X6A J;  1ZGW A;  4JX5 A;  3HB9 A;  3A01 B;  2K9Q A;  2L9R A;  4M3G A;  3HOV J;  5EG0 A;  2XB0 X;  3HGY A;  1AU7 A;  4C3J J;  1WH7 A;  4DZJ A;  4M3F A;  3LNQ A;  4L5E A;  5FLV A;  1U9O A;  2CJJ A;  3GTG J;  2WV1 A;  2KT0 A;  4A3D J;  1A6I A;  2L0K A;  1H89 C;  4RDU A;  3JR9 A;  1XS9 A;  3RZO J;  1MBE A;  1MH4 A;  5IYC J;  2DA1 A;  2LY9 A;  1GV2 A;  4S0H B;  2DA6 A;  2ID6 A;  3O8H A;  3PO2 J;  4MIM A;  1GVD A;  2ECB A;  5E3N A;  4B3A A;  5EF6 A;  1U9N A;  2RAE A;  3S1R J;  2AHQ A;  5FKM A;  5IOY A;  3GTK J;  1E3O C;  1ETW A;  1BW6 A;  2CUE A;  3BT9 A;  2CUF A;  1BW5 A;  1RKW A;  5F27 A;  4I76 A;  5C44 J;  3GBG A;  3JRB A;  3FKI J;  1QRY A;  3H3V K;  3I4M J;  3K7A J;  2NVT J;  2KDZ A;  1POG A;  4QIW N;  1UHS A;  3E7L A;  3O8G A;  4A69 C;  5J1R A;  1JT0 A;  3H0G J;  3S16 J;  1VF9 A;  4MO7 A;  3TED A;  4A3C J;  1PUF A;  3JRC A;  1VND A;  5M5Y J;  2K9S A;  2M34 A;  1FTZ A;  5JLW A;  2VKE A;  3HOW J;  4V2G A;  2L7F P;  3BTJ A;  1MBH A;  5FKN A;  1JTY A;  3ZQC A;  3IH4 A;  4XID A;  2JK3 A;  4B4C A;  1IC8 A;  1GT0 C;  4A3I J;  4W97 A;  4FTH A;  2D5V A;  3S17 J;  2DMQ A;  1ZK8 A;  1JKQ C;  2Y9Y A;  2ME0 A;  3ZQH A;  1X2N A;  5GPC A;  4Y7N J;  1XG1 A;  4DZP A;  1WI3 A;  2DTZ A;  4IHV A;  3JRG A;  1FEX A;  1U78 A;  1WGX A;  1JTX A;  2Y2Z A;  2O9L A;  2WB1 N;  1HLV A;  4A3M J;  1NK3 P;  3Q0V A;  2YUS A;  2FJ1 A;  3JRE A;  1MH3 A;  1ETK A;  4M3B A;  1B8I A;  3OOU A;  1JKR C;  2E2H J;  5IYB J;  1IG7 A;  1YRN A;  3PM1 A;  1S7E A;  3IH2 A;  3HOZ J;  3M4O J;  2PMZ N;  2JA8 J;  3BG9 A;  5M5W J;  1B72 A;  3CQZ J;  1FIA A;  1I3Q J;  1IUF A;  1K83 J;  3BQZ A;  1W0U A;  3GTL J;  3JRA A;  2R0Q C;  1R9T J;  4A3K J;  4AUX A;  2JJ7 A;  3NAR A;  4Y52 J;  3HOU J;  1LE8 A;  3BR3 A;  5K7F A;  2HDD A;  2EZL A;  1I6H J;  3GTO J;  1ZKG A;  2L7M P;  4MLO A;  1ETV A;  4C3H J;  1RKT A;  5E3M A;  2HOA A;  1X58 A;  2NS8 A;  3GTP J;  2HI3 A; 
#chains in the Genus database with same CATH topology
 4DYC A;  1IN7 A;  2ID3 A;  4JQF A;  3DU5 A;  1S7O A;  1ERD A;  1U5T A;  3FMQ A;  2ZC2 A;  1WCM J;  2HQA A;  3H5R A;  1R5G A;  2GM4 A;  4Y13 A;  1Z3Y A;  4ZYH A;  3S32 A;  4BJT A;  4LIV A;  1UMQ A;  2R3S A;  5DV5 A;  3IP4 B;  5ICC A;  1YJ9 I;  1CF7 B;  3ONQ A;  3BC8 A;  2QSH X;  1XGO A;  3NEU A;  5C3E J;  2L3D A;  1LQ1 A;  2VC1 A;  1ZRE A;  1PP8 F;  1JJ6 C;  3LSJ A;  1DDN A;  1ORK A;  1BOB A;  1XN7 A;  4RGS A;  4X1E A;  2VQL A;  4J01 A;  2DA2 A;  4OMY A;  2ZXW H;  2VXZ A;  3EYY A;  4BQO A;  1W5C C;  3NQO A;  4K2E A;  3DCF A;  3O6B B;  1WWX A;  1WPK A;  1H9T A;  2OCE A;  4FQG A;  4F55 A;  3G4S I;  4HLY A;  5IP9 J;  2HNH A;  4HF1 A;  3L2U A;  1O3T A;  1GLN A;  2XHK A;  2CU7 A;  4RAG A;  2QYO A;  3F6O A;  4WCG A;  2GXB A;  2K02 A;  2P5K A;  4HEA 2;  3LAJ A;  5DM7 F;  3ECO A;  3CCR I;  4MTD A;  3HUG A;  3WE2 A;  4UUS A;  1W5T A;  4BXF A;  1ETX A;  1XMA A;  4CXF A;  1RC9 A;  2ESN A;  1YFH A;  4I01 A;  1FBS A;  3G1O A;  1XTA A;  2GXA A;  2AQF A;  2HKO A;  2QQ8 A;  2EB7 A;  4M3D A;  1T33 A;  4U7D A;  2ZME C;  4BBR J;  2Z1D A;  2XSD C;  1IUY A;  5HLG A;  3F8C A;  3KFW X;  1JJ8 C;  2EFO A;  2ESH A;  2AO9 A;  2BE5 F;  2OV7 A;  5J1U A;  3LSP A;  2VN2 A;  1IDY A;  1SVL A;  3PQK A;  2W7N A;  4EM0 B;  4RAF A;  4M6Y A;  1U5T C;  4LLN A;  2A6T A;  1I50 J;  2OUM A;  1HA8 A;  4OWR B;  1G3W A;  3RKQ A;  3WG9 A;  2D1H A;  2L9N A;  4E6K G;  3G73 A;  4PJL A;  3BR2 A;  5DTD A;  2Z99 A;  4ABZ A;  1H0M A;  2VL8 A;  4C3I J;  4AIK A;  4ENK A;  2FXA A;  1IRZ A;  3L2W A;  1BC7 C;  2RDP A;  4XSX F;  2R5Y B;  5DS9 A;  4FAS D;  4D7N A;  3F6V A;  1Z67 A;  2RN7 A;  4KMU X;  3BR6 A;  2MLK A;  5E1Z B;  4L9T A;  2XGX A;  1BJA A;  2M8G X;  4QTR A;  5LFA A;  1FY7 A;  1HKS A;  3K4N A;  3CUO A;  4HQM A;  3CMM A;  4AWX B;  1ZG5 A;  4A3B J;  2HKX A;  1OCT C;  3PJR A;  2VBW A;  2ZXJ A;  3J7Z I;  3P7N A;  3MKZ A;  2QKL B;  4CCM A;  3S2W A;  4C2M J;  5EG0 B;  1KYZ A;  2FOW A;  2K4J A;  2LOO A;  4L5J A;  4FCY A;  2I10 A;  4UV8 A;  1F5T A;  4UVA A;  1X3U A;  3G2B A;  1VQ9 I;  3HSE A;  4AU7 A;  5K5O A;  1EKE A;  4KN7 X;  5M3M J;  3FWE A;  2JN6 A;  2UWM A;  2JRM A;  4ZH4 F;  1XPX A;  1QZY A;  2WY8 Q;  3GUD A;  1SVO A;  5L3E A;  1U2W A;  3CTA A;  2FA5 A;  3F0C A;  2DPD A;  4AYB N;  3OOP A;  3C2B A;  4II2 A;  1DPU A;  4ZYD A;  2BVM A;  3RQI A;  1O57 A;  5D5W B;  2OF7 A;  2PMZ A;  3L09 A;  4A6D A;  4XLF A;  1W4M A;  3KEY A;  2BHZ A;  2Z16 A;  3TP3 A;  3ZCO A;  4XIC A;  2K3P A;  3KIO A;  1I1S A;  3DP7 A;  3IV5 A;  1TWC J;  1JGG A;  4P1W A;  5J40 A;  5J4Y A;  4BDY A;  2F5V A;  3N4M A;  2M7A A;  4IVN A;  3BRO A;  3F3X A;  2EZI A;  2M2E A;  1JUS A;  3LFU A;  2XRO A;  3CJR B;  2DPU A;  2EFW A;  3L2C A;  3HOY J;  1NG7 A;  1HCR A;  1N75 A;  3HGG A;  4QPO A;  2XGC A;  4G6Q A;  3M07 A;  2EJR A;  4N9H A;  1UST A;  4DJA A;  2LBF A;  1F1Z A;  4M74 A;  2KIQ A;  5KCM A;  3HOS A;  1DQU A;  2YSR A;  3OV8 A;  2DO7 A;  3B6C A;  3DEU A;  4Q47 A;  5DM6 F;  1SD5 A;  4L9J A;  4RBO A;  2HOS A;  2XAF A;  5F0H A;  4EEF G;  1R1T A;  2DI3 A;  2P81 A;  3HG9 A;  2Z9O A;  2R4G A;  3H9Q A;  2NS7 A;  1N78 A;  2ELJ A;  1P4A A;  2FD5 A;  1J75 A;  2KLO A;  2IEK A;  4KIS A;  2QQA A;  3QPT A;  3S1Q J;  4S05 A;  3DEE A;  5M3F J;  3EUK L;  5CJ9 A;  2OZU A;  3B02 A;  4EM1 A;  2CG4 A;  1ZHF A;  3VYS B;  2W24 A;  5AON A;  5EJC A;  3CMA I;  1MSF C;  2JPC A;  4DNC A;  4E7I A;  2IA1 A;  2L7Z A;  1ONV A;  2ZFU A;  4EJV A;  3IRQ A;  3WGG A;  4IX7 A;  3LWF A;  2BXZ A;  3OL4 A;  1YW7 A;  5E20 A;  1WJF A;  1CF7 A;  4G7Z F;  1HQC A;  2FE3 A;  3I56 I;  2X6W A;  4V19 K;  4A3F J;  1VQM I;  4G8X A;  2DFE A;  4Y33 A;  3HSF A;  2CQ7 A;  3HDD A;  4BUP A;  4NUB A;  2A05 A;  4AD9 A;  3KP2 A;  4MTE A;  3OSF A;  1LFP A;  4NB5 A;  2DXI A;  4ZZL A;  1HF0 A;  2VOO A;  5HDK A;  1V3F A;  3DU6 A;  3K4K A;  3KYL A;  2HS5 A;  1QZZ A;  4B1R A;  1YIJ I;  2G0E A;  1G3S A;  2AQE A;  4IQJ A;  5F0F A;  3FK6 A;  4E7J A;  1FIP A;  4UUV A;  1S8N A;  1IXS B;  4CCJ A;  2DOE A;  5F04 A;  2JSC A;  1J5Y A;  1WKM A;  1QHH D;  1IJW C;  2E5N A;  1S6L A;  1EF4 A;  1GDT A;  5C4X J;  2EFN A;  3BJA A;  4A3J J;  2KP6 A;  4IOA F;  2W48 A;  4F92 B;  2IRF G;  4LFU A;  1A31 A;  2A07 F;  1RNL A;  4BY1 J;  4IHT A;  3JW4 A;  2R7W A;  1R6R A;  1R23 A;  5BPD A;  3FXQ A;  4B43 A;  4HBL A;  4OIQ F;  3MWM A;  4MEX F;  1MBJ A;  3HEF A;  4DYQ A;  2QM3 A;  3LL7 A;  1ETO A;  2LG4 A;  4XLC A;  3COA C;  4NC8 A;  2MH2 A;  2DMN A;  5DYM A;  1VI0 A;  4F7Z A;  4KIB A;  2R7V A;  4M73 A;  3FHZ A;  2FU4 A;  1X19 A;  2H09 A;  2PG4 A;  4FE4 A;  3TO7 A;  2ZNZ A;  3K2A A;  2Y30 A;  2DJN A;  2R5Y A;  1RR8 C;  2MYS A;  4PJ0 C;  2F5E A;  3GFJ A;  2QCO A;  4KT5 C;  1X4O A;  2NYX A;  3VFZ A;  4PGG A;  3T5X A;  2LD5 A;  3B73 A;  1DU0 A;  4U87 A;  3CCJ I;  2WAE A;  2P7C B;  2XGD A;  3CJN A;  3TDZ C;  4F93 B;  5IT9 Z;  2CQQ A;  3V7S A;  2IJL A;  1OLT A;  1Z7U A;  1OCZ H;  2VE8 A;  3I3L A;  1O3R A;  1ZGW A;  2IA0 A;  2P6T A;  1YO5 C;  3RQ4 A;  1AWC A;  3E5U A;  5EG0 A;  1AU7 A;  2XDV A;  3VB2 A;  2VB6 A;  2F48 A;  2V9P A;  3LNQ A;  2WAQ A;  2OCC H;  2DFI A;  2WV1 A;  3FM5 A;  2BY1 A;  3G3Z A;  4MNU A;  2VKD A;  1XX5 A;  4XLA A;  3NRV A;  2L0K A;  4G7O F;  3BZ6 A;  3GEZ A;  3RZO J;  2CQK A;  4LG3 A;  2VXD A;  2W57 A;  4U0Y A;  4XQF A;  3OYG A;  1YTY A;  2ID6 A;  2OA4 A;  3O8H A;  3FXL A;  1GVD A;  2E5Z A;  4X0G A;  4B3A A;  5EF6 A;  3LA7 A;  3WTS C;  4HAM A;  5CPR B;  2RAE A;  3WTY C;  5FKM A;  5IOY A;  1ZRF A;  3SZG A;  4PFP A;  4CCK A;  1Y8R B;  3GTK J;  5IT9 K;  1V55 H;  3KP3 A;  2K9L A;  2CUE A;  3FBI B;  1P2F A;  2J5P A;  3MAJ A;  4BE2 A;  5F27 A;  1SD6 A;  1W36 C;  5C44 J;  3GBG A;  3LSH A;  2L01 A;  1W7P B;  3BG7 A;  1MKM A;  3ZQQ A;  2XSJ C;  4QIW N;  5FRO A;  2HPM A;  3CF2 A;  3O8G A;  4UV9 A;  4XN0 A;  4A69 C;  2OU2 A;  4NBQ A;  3L00 A;  3K4L A;  4MO7 A;  1UHW A;  4Q4Z F;  4Y17 A;  1G3Y A;  5ERI A;  1FTZ A;  4HNT A;  4GO1 A;  1KQ0 A;  2ZJ2 A;  4A5M A;  2L7F P;  4XLP F;  2XAG A;  4ESB A;  2XF7 A;  3E6M A;  1X1D A;  4D9J A;  1IC8 A;  3AG4 H;  1VQ8 I;  4W97 A;  4O6J A;  5E8G A;  3G71 I;  2G7H A;  3WU0 A;  2Q8K A;  3CES A;  3AG1 H;  2E1N A;  3K69 A;  1LNW A;  1T39 A;  1B1B A;  3IC7 A;  1LB2 A;  1ZH5 A;  4G94 A;  1WGX A;  1BI2 A;  2RNG A;  3BOQ A;  3QP6 A;  2JZY A;  4XLN F;  2O9L A;  3NWT A;  1HLV A;  3ZXS A;  4A3M J;  1NK3 P;  4EJW A;  1IN8 A;  5FO5 A;  3TOB A;  2W4S A;  3P9I A;  2JTV A;  2NOJ B;  4M3B A;  1B8I A;  3CP2 A;  2L5Q A;  5J47 A;  5IYB J;  4A0Y A;  2MD0 A;  3PM1 A;  1S7E A;  4Z2Y A;  4N4O B;  3CCM I;  1J09 A;  1FIA A;  2CV1 A;  1FSE A;  2VQC A;  1N77 A;  2ZO4 A;  4YFN F;  1IXC A;  4BQN A;  2EA2 A;  5LD2 C;  3E97 A;  3RJP A;  4ZYG A;  2P0W A;  1W0U A;  1FBQ A;  1FBU A;  1WJE A;  3ABT A;  2NS0 A;  4I7H A;  3W2A A;  1E3P A;  1MW7 A;  4IRG A;  2BZT A;  1ODD A;  3NAR A;  4OIP F;  3HOU J;  3TOA A;  5GAG J;  5B5E C;  3CCS I;  2HDD A;  2LF7 A;  3GTO J;  4RB3 C;  4C3H J;  1VQO I;  3GTP J;  4GGG A;  3GZN B;  3DKY A;  5K1Y A;  3ZGK A;  5FRM A;  1ZTR A;  5C4J J;  3R0J A;  2ELH A;  3QWL A;  2FSW A;  4EM2 A;  4BJ6 C;  3HM5 A;  1G2H A;  3OIO A;  4C2T A;  1Z9C A;  1ZGA A;  5JFR A;  3FXK A;  1RI7 A;  5E3O A;  4CYC B;  3QU3 A;  4KN4 X;  2OTL I;  2FBI A;  1OPC A;  2XPU A;  3CCY A;  4L5I A;  2RV8 A;  4AC0 A;  3WTV C;  4EGZ A;  3QPH A;  3F72 A;  1MGT A;  2AXL A;  3OYC A;  1EJ9 A;  1BR4 A;  4MHG A;  4A5N A;  4BHP A;  2ECC A;  2XPW A;  4KUM A;  3SJM A;  3BZK A;  1T0F C;  1MJB A;  2FML A;  2O6G E;  4NC7 A;  2B7E A;  3KYC B;  1MNE A;  2L9V A;  2W84 A;  4WXH A;  4BHC A;  2HDC A;  2X6O A;  2DOA A;  2EIM H;  3BWG A;  1DP7 P;  1MMS A;  2Z3Y A;  4PGH A;  1ETQ A;  4Y3O A;  1SFX A;  1FMV A;  5M5X J;  1HDP A;  4U88 A;  4XLE A;  5EGO B;  2E7X A;  5EEA A;  1WRJ A;  4M3E A;  5K7Z A;  2GZW A;  3CCL I;  1BC8 C;  1PYV A;  4MFD A;  3U2R A;  2XF5 A;  1XC5 A;  2R93 J;  3L2V A;  1U8R A;  2XVC A;  2LSO A;  3WG7 H;  4IHS A;  4BKX A;  1SEU A;  4JX4 A;  3O3K A;  1DU6 A;  2HYG D;  2X48 A;  3QRF F;  4J00 A;  3DQV C;  5HVQ C;  3M8F A;  3BG3 A;  5DD8 A;  2ME6 A;  1GHC A;  3J7A O;  2LP0 A;  3J7Y J;  3KPH A;  3CCU I;  2H1K A;  3S3M A;  3I4P A;  5F1J A;  4IRI A;  3OYD A;  2R7D A;  2XUB A;  3FK7 A;  3JTG A;  2M8E A;  1LUJ B;  3MVP A;  3DLL F;  1JHH A;  2PJR B;  2JA7 J;  1NHA A;  2F5D A;  1WHU A;  2F5C A;  2HQ5 A;  4IEJ A;  5LEK A;  3RTR A;  2JA5 J;  2WAD A;  1BBY A;  3TP0 A;  1V5E A;  2NVY J;  4PDK A;  4YIR X;  1ZRD A;  5FFX A;  1XMX A;  5CKT A;  2JSP A;  3DPL C;  3OWT A;  2IS6 A;  3E3V A;  1QGP A;  2FQ3 A;  1W7P A;  1FJL A;  3FIW A;  4I6Z A;  1U8B A;  4HLX A;  2ZBK A;  2WAF A;  3HTS B;  1BJZ A;  2NNN A;  4PSW A;  2NAZ A;  3D5R C;  3H92 A;  3CC4 I;  2JWT A;  5TGT A;  1QBJ A;  2IGM A;  5FD6 A;  2EK5 A;  1K4S A;  4LOC A;  3W6J B;  4CH7 A;  2V1D A;  1A6Q A;  3M8E A;  1RET A;  5J4V A;  4XN3 A;  1YE9 A;  2MG4 A;  3ABU A;  1G4D A;  2WWY A;  1XDU A;  3ZR8 X;  2P4W A;  2M87 A;  2WB1 A;  4LLL A;  1ZR2 A;  1MBF A;  2M30 A;  3U21 A;  3OR1 C;  5BOX A;  2I8D A;  3PNT A;  3FXO A;  1JKP C;  5GTH C;  1R00 A;  2VPR A;  4XKB A;  3SYT A;  2R7O A;  1KU9 A;  3A2K A;  2VI6 A;  1HKT A;  3KZZ A;  2EH3 A;  4CO8 A;  1HSJ A;  2MW8 A;  4HW0 A;  3OY9 A;  2DOD A;  5CQE A;  1RRJ A;  1FP2 A;  4OAZ A;  2ZJP F;  5TRD A;  1RPW A;  3SQN A;  2K85 A;  5IP6 A;  3Q3S A;  5KNL A;  2UV1 A;  1SAX A;  3VYT B;  2HU9 A;  4RS8 A;  4IHY A;  2GAU A;  2JRT A;  2KJB A;  3QQA A;  3MZH A;  1P7I A;  5B3S H;  2FUG 2;  4ZTJ A;  5LLQ A;  2BEO A;  3HRS A;  4G12 A;  3CC7 I;  4M9S A;  3GLL A;  5FKK A;  3D1N I;  4RAY A;  2GIV A;  3D5L A;  4XRS A;  5GPA A;  3E5Q A;  1D0Z A;  2F6C A;  2B0L A;  2R7F A;  2ELK A;  2IPQ X;  2ZCW A;  1FOY A;  1T08 B;  2NVX J;  5E17 F;  3HPG A;  4IHX A;  2Z5U A;  4RB0 A;  1O4X A;  5KK1 A;  4RM2 A;  1UZC A;  1S9H A;  2VKV A;  1V5F A;  4P96 A;  1UJ8 A;  2KDO A;  3H5A A;  3OYL A;  1TQM A;  3RSN A;  3OSG A;  2LRE A;  3ZQI A;  3K4M A;  2DA5 A;  3BR5 A;  1R4N B;  2B63 J;  1S7A A;  1F43 A;  2L02 A;  4EMS A;  1USS A;  1T56 A;  2F4I A;  1FX7 A;  3DXJ F;  4E70 A;  2MBF A;  1VQL I;  3K2Z A;  3S1N J;  4CYC A;  3A4C A;  5GP9 A;  1ENH A;  1TZL A;  3HJE A;  2R7R A;  2RQQ A;  2XAJ A;  3HKZ N;  1KYW A;  3DBH B;  5E1W A;  1T98 A;  4HSR A;  4XKC A;  5F6F A;  2JUC A;  2QGU A;  1DP3 A;  3BQY A;  4GYG A;  1B72 B;  1T38 A;  2UXX A;  4E7S A;  4FIS A;  1QHG A;  1X1P A;  2BHY A;  2PMH A;  4AIJ A;  1IXR C;  2DQR A;  4C30 A;  3CUQ B;  3ERM A;  3J80 Z;  4BBS J;  2E7W A;  5AIP A;  4RMN A;  4R79 A;  3V4G A;  2YU9 J;  3RI4 A;  3R60 A;  4AVZ A;  3L2R A;  3QOP A;  3H5N A;  5EGO A;  4TV7 A;  1VQ7 I;  1NTC A;  1WH5 A;  5ED4 A;  3TL4 X;  4G9Y A;  4YRV A;  2QA4 I;  4UY8 I;  2O0Y A;  4RGU A;  1WZ2 A;  1IN6 A;  1FYM A;  1PUE E;  3GTJ J;  1REP C;  2X0L A;  2Y48 A;  3K4J A;  5JVG F;  3NAU A;  2EBI A;  5D6F A;  1GUU A;  2R7T A;  3CME I;  2IS1 A;  1VQN I;  4YEL A;  1LJ9 A;  1YLF A;  2X6Y A;  2HVS A;  4PCQ A;  3JRH A;  1R5H A;  3Q5F A;  3TQN A;  2E1C A;  1BIA A;  2XAQ A;  5LRS A;  1TBX A;  2KPM A;  5HS9 A;  3LSI A;  4HRI A;  2YPR A;  4AID A;  3T8R A;  4CIC A;  3PL8 A;  5E1X A;  2V4J C;  4CZZ A;  3MKL A;  3C3W A;  2A68 F;  3J80 K;  4BAY A;  2VBX A;  1ACI A;  3HZJ A;  2IGN A;  2PJR A;  3WTW C;  2OZ6 A;  5EDN A;  2PLY A;  2VUM J;  1H9G A;  1WJ5 A;  4NC6 A;  3PUB A;  2IBD A;  2GOX B;  2EZH A;  3DFG A;  1TWF J;  1KU2 A;  4F52 A;  1P7J A;  2DN0 A;  3QPS A;  5FLM J;  1YJN I;  5E8I A;  4KMF A;  2O8K A;  1Y39 A;  2ADU A;  4HPQ A;  2WBM A;  1VTN C;  2F5F A;  4GXO A;  1ZG3 A;  4Q48 A;  3L9F A;  4F3Q A;  2VIX A;  2IT0 A;  5KAF C;  1RR7 A;  3ABM H;  1D5V A;  3I58 A;  1V4R A;  2K7L A;  4CCN A;  3S15 J;  4ZYA A;  1I1G A;  4XK4 A;  3CO7 C;  1D3Y A;  4HF0 A;  4KYW A;  4ZZD A;  1GV5 A;  3SFZ A;  2X1C A;  1MD0 A;  3N97 A;  1XDS A;  3A01 B;  3M1E A;  3E5X A;  4M3G A;  3FM3 A;  2O03 A;  3WTX C;  2XB0 X;  5HOO A;  3JCU C;  2KZV A;  1WH7 A;  4DZJ A;  1FOW A;  3M8J A;  4XLH A;  2ISZ A;  5FLV A;  2CJJ A;  3GTG J;  3E6C C;  1A6I A;  2L54 A;  2DT5 A;  2YU3 A;  3VOD A;  1H89 C;  4HDV A;  1XS9 A;  1YYV A;  3PIP F;  2WA0 A;  3MMY B;  3VOE A;  1MBE A;  1TL8 A;  3KP7 A;  5IYC J;  4BJ5 C;  3PNY A;  1HST A;  1SVM A;  4S0H B;  5F1R A;  4DBQ A;  3PQJ A;  3C7J A;  2XAU A;  4KJZ A;  1K79 A;  2HFH A;  2P5L C;  3QU6 A;  2C6Y A;  2A6H F;  4DOZ A;  3ERE D;  2AHQ A;  4M9X A;  3K70 C;  1E3O C;  2CUF A;  1MMA A;  1RKW A;  2EV5 A;  4MEY F;  2QLZ A;  4N4N B;  3S93 A;  1XMK A;  3OR2 C;  4DGW B;  3RYP A;  2NVT J;  2Y0S A;  2KDZ A;  5FFZ A;  3BPX A;  3E7L A;  2BGC A;  3RCO A;  2W00 A;  2FOK A;  4BE0 A;  3SEQ A;  4MGR A;  3S16 J;  4EAT A;  3JRC A;  2ZNY A;  4UHT A;  2EWN A;  1XSV A;  3K9T A;  5M5Y J;  3EUA A;  4CHU A;  2HQN A;  1ZRC A;  4L18 B;  3DLA A;  1P6R A;  2JA2 A;  4U7B A;  5FKN A;  3DF8 A;  3C2G A;  3IH4 A;  4B09 A;  4LJZ F;  3ISP A;  2CUZ A;  1OCR H;  4A3I J;  1FWZ A;  4FTH A;  1DGW Y;  2XKO A;  4CSW A;  2Y9Y A;  3FKJ A;  5DEQ A;  1X3Z B;  2UZK A;  5BPI A;  4M71 A;  3NWS A;  5LGT A;  1XG1 A;  2Q0O A;  4DZP A;  1PJR A;  1LDJ A;  4ASN A;  4CYD A;  4YFX F;  2JT1 A;  1O3S A;  3VYR B;  1QA6 A;  1D8J A;  3TDU C;  1X1C A;  4BNC A;  1WVR A;  4KIF A;  3SZT A;  1R1U A;  3Q0V A;  3DKW A;  3C2H A;  5J6X A;  2YUS A;  3V42 A;  2UUZ A;  2ETH A;  4XKW A;  3WU2 C;  4EQQ A;  6PAX A;  1ETK A;  4P5O A;  5HLT A;  1B9M A;  4L0Z B;  3AL0 B;  1YW8 A;  4XNF A;  1E0E A;  3OOU A;  3P9K A;  1IG7 A;  4FET A;  4MQV A;  1V5G A;  3JAM Z;  3M4O J;  2PMZ N;  3KEQ A;  1B72 A;  1Z91 A;  1I3Q J;  3IWZ A;  4U0W A;  3PFI A;  3LA3 A;  5L3D A;  1MIJ A;  2NNY A;  3IKV A;  3CUQ A;  4KIT B;  3IHU A;  3GTL J;  2F4O B;  2LY1 A;  3JRA A;  2R0Q C;  1R9T J;  2AS5 F;  3HTU A;  2VQH A;  1TTY A;  4RAZ A;  4LLG F;  3HYI A;  1S29 A;  2RRE A;  3GZ6 A;  2EZL A;  3AAF A;  1YX3 A;  1Z21 A;  4I0A A;  2EPF A;  1ZKG A;  2L7M P;  2MAB A;  1XCV A;  2QUF A;  4JK1 X;  3HHG A;  3KCC A;  3N05 A;  1BA5 A;  3GX4 X;  4LB6 B;  4B8X A;  5H6Q A;  2X51 A;  1OYW A;  2CQX A;  4JYK A;  5BNG A;  1HOM A;  2DAO A;  5DUI A;  3SHF A;  3PSF A;  4E4H A;  2JPB A;  2VE9 A;  3AG2 H;  1E3H A;  1EH7 A;  1BR2 A;  1Y56 A;  3B6A A;  4ZDL A;  1VFC A;  5D8K B;  1AHD P;  2IAI A;  1MMG A;  1P4X A;  3A1Y A;  3LSR A;  1X4P A;  2COM A;  3SXY A;  1PUF B;  3KP4 A;  2CRG A;  5KVR A;  1GXQ A;  3FXJ A;  1ZEL A;  3OYE A;  3JSP A;  1T6S A;  4E7K A;  2VJ5 A;  2XPV A;  4ITV A;  3ELK A;  3UKG A;  3L7W A;  1XSX A;  2KIM A;  1MMD A;  3RDI A;  3A03 A;  3ZMS A;  2DA7 A;  3BR0 A;  2F4M B;  1OFC X;  3SDG A;  4A3E J;  4ZDP A;  2H94 A;  1FYL A;  3CUQ C;  1TWG J;  4NDL A;  1EH8 A;  2CYY A;  2D1V A;  3ESW B;  3QYB A;  1H88 C;  1ZLK A;  3ZMD A;  1YIO A;  3A01 A;  4IOC F;  4BAC A;  3BJ6 A;  1W1W E;  1A5J A;  4DW6 A;  3PSI A;  3W6V A;  2CW7 A;  5EZH A;  3TGN A;  3VPR A;  1SFK A;  2MC4 A;  4UXN A;  4ZYE A;  1IW7 F;  1JT6 A;  1RES A;  2CS3 A;  5J1Y A;  4RA2 A;  3M3Y J;  2LVS A;  3UR3 C;  2R7S A;  1S3J A;  5CLS A;  1UEL B;  4M6V A;  4PJN A;  2XB5 A;  5HLH A;  1JGS A;  3KEO A;  4LMY A;  3LQR A;  4BXU A;  2KFD A;  1OMI A;  4PK4 A;  2W25 A;  3I55 I;  2Q2E B;  1X1A A;  4N0B A;  4R1H A;  5CVJ A;  1MBG A;  1QPI A;  1MJ9 A;  1TNS A;  3FDY A;  3LSG A;  1XSD A;  3F8M A;  4IKF A;  4LIT A;  1A04 A;  3OIP A;  2BBY A;  1DGR M;  1M1E B;  2R7Q A;  4JP0 A;  3CJQ B;  2HXO A;  3A0H C;  3CLQ A;  2A3S A;  1MND A;  4UUT A;  3TO9 A;  5A2Q Z;  3RPU A;  1T0F A;  3S8P A;  1W7P D;  4YIF A;  1IV8 A;  3P9C A;  2STT A;  2LMD A;  1BI3 A;  3T1B A;  5K7H A;  1ZR4 A;  3PO3 J;  4S04 A;  2LYC A;  3ASO H;  4YG2 F;  3K6G A;  4BL0 B;  2G7U A;  3GZ5 A;  2BY0 A;  1T2K A;  5HS8 A;  5D8L B;  1L3L A;  2GXG A;  2QEN A;  2NOG A;  4GCV A;  4OIN F;  1TC3 C;  2W85 A;  1CQT A;  9ANT A;  2KRH A;  1WI9 A;  2V6E A;  3W2V A;  3I54 A;  4J19 A;  3HOX J;  4Y15 A;  5FKO A;  4ETS A;  2YX4 A;  3PFY A;  4P55 A;  2EQR A;  4XRS G;  4YFK F;  2MD5 A;  4RM3 A;  5L3C A;  3VWB A;  2LKP A;  3MKW B;  4ESF A;  3G1L A;  5L3G A;  1HDD C;  3S14 J;  2DMU A;  2QVO A;  2TDX A;  1YI2 I;  4QLC U;  2BY2 A;  2X85 A;  3REO A;  1J9I A;  2LDU A;  3WGI A;  4OMZ A;  2WAQ N;  2Q1Z B;  2FNA A;  3F8F A;  4HST A;  4IRH A;  2IA2 A;  2HTJ A;  4PUS A;  2EIK H;  4C9Y A;  5A2Q K;  1SAN A;  1J0R A;  3BCA A;  5IT3 A;  1WQ2 A;  4QWQ A;  1HXD A;  4H4K C;  4D1Q A;  5HDN A;  3PNV A;  5FJ8 J;  1EA3 A;  2GOM A;  5DCM B;  3WTZ A;  3V7C A;  2IGO A;  2MSY A;  1BL0 A;  3I71 A;  1YG2 A;  1IZ1 A;  3TW7 A;  2VQG A;  4D5F A;  5FB2 A;  2E71 A;  2H6C A;  3EQL F;  3R0A A;  2DK5 A;  1VQ4 I;  3ZMZ A;  3SZP A;  2H8W A;  2D2W A;  1BI0 A;  1Y1W J;  5ICG A;  2EIL H;  2O3F A;  3CLO A;  4B47 A;  3CMY A;  2GBY A;  4IPA A;  1W0T A;  2H6B A;  1I6X A;  3BTI A;  4P9F A;  4OOI A;  3IH3 A;  2HPI A;  3I9V 2;  2RNJ A;  1D8K A;  4HX4 A;  5J8F A;  1XCB A;  5IPA A;  1SD4 A;  3SDB A;  4PFO A;  1D1C A;  5F0C A;  1MNM C;  1VQK I;  3EYI A;  3K0L A;  4ZJZ A;  4PZJ A;  2QZ8 A;  3CC2 I;  3LQQ A;  2EFQ A;  1OCP A;  1Y0N A;  3BY6 A;  1S5L C;  2XIG A;  3WOD F;  4BEH B;  1IGN A;  1P4W A;  2OQG A;  2XRL A;  2ZJR F;  2BOL A;  5HLI A;  4Z6Y A;  3MD2 A;  4IQ4 A;  4XBF A;  2CW0 F;  3LSK A;  2KRC A;  2DW4 A;  5EZG A;  1IRX A;  2WV0 A;  3WHB A;  1B9N A;  2V1N A;  1BIB A;  4R8H A;  1TWH J;  1TLH B;  2M7B A;  1F9N A;  4AVP A;  3JRF A;  4EJT A;  5CVI A;  1YRN B;  1RZ4 A;  2CO5 A;  2HR3 A;  4LB5 A;  3BCB A;  3GTQ J;  3CCE I;  2E1M B;  2CSO A;  3FXM A;  3V8J A;  3AL0 C;  1XB4 A;  1P9Q C;  1IRF A;  5EYR A;  4DIQ A;  5HDG A;  1KON A;  2FNP A;  3ZQF A;  3SFI A;  2JUG A;  1LEA A;  4FX0 A;  4BGD A;  3S1M J;  5IOZ A;  1ULY A;  1FT9 A;  3A02 A;  1UFM A;  3LSM A;  4HV6 A;  5GAE J;  3S2H J;  1RUN A;  1A36 A;  4MFE A;  1YHQ I;  1YIT I;  2M45 A;  3TW6 A;  2ZSH B;  1TWA J;  4KNY A;  1SMY F;  1LFB A;  4BQA A;  4CCL A;  1E17 A;  2V79 A;  3BG5 A;  1X3W B;  3KE2 A;  2VT3 A;  1N25 A;  4LGW A;  4Q5S F;  4W1U A;  1O3Q A;  3GVA A;  2CWE A;  1R36 A;  3W6K B;  1C0W A;  2E2J J;  1G8X A;  1UHM A;  1X2M A;  3GCM A;  2LTP A;  4G6T B;  4O5V A;  4DYR A;  5FRN A;  1IF1 A;  2P6S A;  2HEO A;  1ON1 A;  2G9W A;  2V1X A;  3DKX A;  3H35 A;  4D5C A;  3D0S A;  2MLG A;  2TRT A;  2YS9 A;  1OQY A;  2Q2E A;  3CP8 A;  2XGE A;  2P8T A;  1JUP A;  5IY5 H;  2BV6 A;  1LDD A;  2Y75 A;  1QU3 A;  3BZC A;  3WHC A;  2DYR H;  1UCR A;  2K9M A;  1I27 A;  3UNG C;  1JUM A;  1TW2 A;  1UG0 A;  3FZV A;  3L2Q A;  4IZZ A;  1O7F A;  2OPT A;  3HC7 A;  3T0Y A;  3OS2 A;  3BR1 A;  3JRD A;  4A3L J;  3CO6 C;  1SFU A;  2O5R A;  1YOV B;  2K27 A;  1RIO H;  3GTM J;  1ZQ3 P;  4HX7 A;  1NK2 P;  3AFH A;  1LDK B;  3DBL B;  2B9S A;  1H8A C;  4JX6 A;  4BS9 A;  4XR6 A;  1K6O A;  1OIS A;  3HRU A;  2ICW G;  4JX5 A;  5D5V B;  1QO0 D;  3HB9 A;  4EJU A;  4YEJ A;  2L9R A;  1TQP A;  1Z05 A;  1Z3X A;  2CUJ A;  2ZKZ A;  3H3U A;  1I39 A;  1K6Y A;  2UXN A;  3VEP A;  3HGY A;  3HOV J;  1AOY A;  4C3J J;  1ON2 A;  3LFK A;  4M3F A;  1AA7 A;  1R1V A;  4AYB A;  4KT6 A;  4L5E A;  5JVT A;  2VPL A;  1U9O A;  2KT0 A;  4A3D J;  4L0Y B;  4QPQ A;  4C2U A;  3ABK H;  4I98 B;  3D5S C;  3JR9 A;  1MH4 A;  3WU1 B;  2P7V B;  5LHG A;  3H9G A;  2DA1 A;  1KZH A;  1VZ0 A;  2L2O A;  2ACJ A;  2DA6 A;  3PO2 J;  4E7H A;  1FLI A;  4MIM A;  1WJC A;  1Z6T A;  3VSK A;  4HF2 A;  3ML6 A;  1TQI A;  2NXN B;  3HHH A;  1U9N A;  1WFX A;  5TJJ A;  3S1R J;  1KU7 A;  2VC0 A;  1OYY A;  1ETW A;  2EIJ H;  3H1C A;  4ZDO A;  4CZC A;  3HRM A;  5FD5 A;  4UVB A;  5CQG A;  5DCM A;  4I76 A;  5BMZ A;  2A69 F;  4B48 A;  1NG6 A;  3FKI J;  3H3V K;  2HDW A;  3OYM A;  3QAH A;  3K7A J;  2D45 A;  1UHS A;  4CUG A;  2QQB A;  2QSF X;  3OYH A;  1VQP I;  3R6S A;  1ZAR A;  2OC6 A;  1VQ5 I;  1VF9 A;  3PIO F;  2W1O A;  3TED A;  3KET A;  5ILU A;  4MQ9 F;  1A35 A;  2WC2 A;  2DBB A;  2RVC A;  2M34 A;  1BN5 A;  4XSZ F;  4LG0 B;  4HYE A;  4ENJ A;  4V2G A;  1SC7 A;  2CQN A;  3E6B A;  1UB9 A;  3GYH X;  3HIF A;  1LPQ A;  2BY3 A;  4IF4 A;  3ZQC A;  4XID A;  4B3X A;  2JK3 A;  2CFO A;  2K4B A;  4B4C A;  3KYD B;  5KAI C;  3S17 J;  2DMQ A;  1ZK8 A;  4O3M A;  2MA3 A;  2ME0 A;  3ZQH A;  1X2N A;  4HX8 A;  2R7X A;  3T8T A;  5GPC A;  4OAY A;  3ZMU A;  1WI3 A;  2E36 A;  2DTZ A;  4IHV A;  3JRG A;  1FEX A;  3VYU B;  2YX7 A;  1U78 A;  1WJA A;  4BEH A;  1G3T A;  2FF4 A;  4A2U A;  2QSG X;  2Y2Z A;  1Y0U A;  2WB1 N;  5BQT A;  2HWV A;  1KU3 A;  2A5Y B;  2M1B A;  2A6E F;  3BG6 A;  4N9I A;  4CA0 A;  4XM3 A;  5EEG A;  2M4K A;  2MH9 A;  1IO2 A;  1MH3 A;  5J8C A;  3W3C A;  3LST A;  3F8B A;  2JQ7 A;  2KMU A;  2BYV E;  2PFB A;  2CV0 A;  2LKS A;  4ZTF A;  1JKR C;  2E2H J;  2BW3 B;  1YRN A;  1QNT A;  5KHD A;  3ZPL A;  3MCZ A;  3OL3 A;  3TO6 A;  3WGH A;  1K78 B;  2JA8 J;  2RKH A;  3DPU A;  2IP2 A;  5D6E A;  4HV5 A;  2X4H A;  3OMY A;  3DBR B;  2ISY A;  2XRN A;  2BXY A;  4P9U A;  3ABL H;  1W36 D;  4PJM A;  2OAZ A;  2GWR A;  4ENM A;  5B1B H;  2DJI A;  2V9V A;  3DPT A;  1B6A A;  3H9J A;  2ZXH A;  3KX2 A;  1QPM A;  4AUX A;  2JJ7 A;  2JVG A;  5ICE A;  4Y52 J;  3V8L A;  1FSH A;  4LD5 A;  4BYY A;  5K7F A;  3K10 A;  5TIS C;  2Y0M A;  1G6N A;  2DK8 A;  3DTI A;  3RKW A;  4H0E A;  1ETV A;  4IJA A;  1RKT A;  3C1D A;  4IO9 F;  2W82 A;  2NS8 A;  1D0X A;  2HI3 A;  2FBK A;  3GME A;  2FX0 A;  2DU9 A;  4RLF A;  4A93 J;  4D7M A;  1PDN C;  2PX9 A;  3BP8 A;  3RIR A;  3K1P A;  1RUO A;  3JRI A;  4E7L A;  2VBZ A;  1ZAO A;  2TCT A;  3LMM A;  1OYI A;  4BHB A;  2R5Z B;  1JKO C;  2P5V A;  4ANJ A;  4XKV A;  1HW2 A;  3ZP5 A;  3HBL A;  3HPH A;  1D1B A;  2A61 A;  4HA8 A;  2VJ4 A;  1HKQ A;  3HSR A;  5FLX Z;  2QQ9 A;  4HQE A;  1BM9 A;  1TW3 A;  2HVQ A;  2PMU A;  2ZXI A;  3S3O A;  1J7K A;  4U0V A;  1YJW I;  4HG2 A;  2LF8 A;  2QF7 A;  3QP5 A;  2DT7 B;  2E1M C;  2HOT A;  1F36 A;  3RKY A;  2KZG A;  5J3L A;  1XD7 A;  4I2O A;  3OYI A;  5D4S A;  1Z6R A;  2DLL A;  2OD5 A;  2E1O A;  5L3F A;  4V2F A;  2K86 A;  2O7O A;  2EFP A;  3ZN0 A;  2Y9Z A;  2KJC A;  2QKM B;  2E19 A;  2XAH A;  5CVR A;  4BDZ A;  1JE8 A;  2DMP A;  1FC3 A;  2ZJQ F;  4G6D A;  1HBX G;  3J7A Y;  1ZG1 A;  3FMS A;  4HZF A;  2R7Z J;  1XGS A;  1S72 I;  1MBK A;  3ZQ7 A;  3AKZ A;  2VAS A;  4M6X A;  5F64 A;  2EV0 A;  3SEZ A;  4E7Z A;  4BH9 A;  1HW5 A;  2DCE A;  2VBY A;  3OIQ A;  4BE1 A;  3Q0W A;  3EET A;  5FLX K;  3IUO A;  2O61 A;  1K61 A;  5K5R A;  3AG3 H;  3GF2 A;  1B8I B;  1U0J A;  2L4A A;  3IKT A;  1HC8 A;  4XMY A;  4ON0 A;  4LIU A;  3I53 A;  3I4N J;  5D5X B;  2GA2 A;  4WX9 A;  1Q1H A;  5E3L A;  2R92 J;  4WF2 A;  3RYR A;  5E79 C;  2FQ4 A;  1ITY A;  1IAW A;  4G7H F;  4CGZ A;  1BI1 A;  1ZLJ A;  2LH9 A;  3CF5 F;  2ZB9 A;  3QYE A;  4XL9 A;  1Z77 A;  2M9H A;  3MN2 A;  5L3B A;  1QZE A;  1GXP A;  2Y31 A;  1LEB A;  1AKH B;  5ILS A;  2EV6 A;  4BU2 A;  5JLX A;  3OYJ A;  1R4M B;  2GLO A;  3M1C A;  1QVT A;  2VOP A;  1APL C;  3QYF A;  4XOR A;  4YII A;  4NQW B;  5LEJ A;  1VQ6 I;  3ZQG A;  2MC3 A;  1Y1V J;  3QOD A;  5LHI A;  1QVU A;  2WTE A;  3RPU D;  3FBN B;  1GVJ A;  2ZFW A;  4FE7 A;  4LG0 A;  1IRG A;  5GAD J;  1JHF A;  2VJJ A;  5ILV A;  3EUH A;  2V6C A;  3R61 A;  2HVR A;  4I0B A;  4A3G J;  5DDG A;  3MEX A;  4WK8 F;  2HZT A;  2HYF A;  1W5S A;  1Y6I A;  2ZSI B;  3M9A A;  5K5Q A;  3K4B A;  2Z33 A;  4IXA A;  3PUF A;  2X1D A;  2LR8 A;  2JMW A;  1WJD A;  3R4K A;  4XRF A;  5HS7 A;  2FRH A;  3HOT A;  1FTT A;  1SMT A;  5JHF A;  2MFZ A;  3CDH A;  2VOD A;  4WXC A;  1CGP A;  2GA1 A;  1F4K A;  2L7K A;  1T95 A;  5CYV A;  2V1U A;  2DA3 A;  3H0D A;  2VON A;  1OCO H;  2DMT A;  2HZD A;  2MGQ A;  4Y4R A;  4ZC3 A;  4CDG A;  4FX4 A;  2OJE D;  4UB8 C;  2GQQ A;  3U1D A;  5HNH A;  5EEH A;  1KGS A;  5CVV A;  1B4A A;  1MMN A;  3JAM K;  2BVL A;  3J81 Z;  2DDA A;  3BPV A;  3JTH A;  2EZK A;  3BTL A;  5LRR A;  1K4T A;  3WTT C;  2BW3 A;  1OJL A;  2A5W A;  4HNV A;  3P5J A;  3OYN A;  2YR2 A;  3KLO A;  2M3A A;  2CMP A;  4AIH A;  5BS6 A;  1EH6 A;  2VLA A;  1K78 A;  2HTS A;  2RGV A;  4AM3 A;  3GO5 A;  4KDP A;  2H1L A;  1SFO J;  2DA4 A;  2OQR A;  5GTI C;  3DWL E;  4EGY A;  1I5Z A;  2E35 A;  2QEX I;  2EA4 A;  2NRA C;  3S2D J;  3CZ6 A;  1FYK A;  3DTK A;  1NH3 A;  2X9D A;  2RC4 A;  2QBY B;  4BXX J;  3OYF A;  2Y0S N;  3GW2 A;  5DUK A;  4NHJ A;  1FP1 D;  3RZD J;  1ZYR F;  4A0Z A;  3VSL A;  5IYD J;  1Y8Q B;  2NVQ J;  4PSX A;  1LFU P;  4FT8 A;  4OIR F;  2VKH A;  2K3F A;  1QQI A;  2KKO A;  3EUH C;  4UNO A;  1KQ9 A;  4XON A;  2XV4 S;  5FKL A;  3I59 B;  2F2E A;  2LKX A;  4FHT A;  2LLK A;  3F9K A;  3J81 K;  5JHU A;  1OR7 A;  3ZOB A;  3H3Z A;  4DBR A;  2KIF A;  1FMW A;  3TBI A;  3ZQL A;  2PJP A;  4UVC A;  1D0Y A;  1MSE C;  2LFB A;  3DV8 A;  2FEZ A;  3DEW A;  1E2X A;  2COB A;  2M4G A;  1IV6 A;  2R5Z A;  1JXS A;  3GLX A;  3IL2 A;  3BTC A;  2E34 A;  1PVE A;  2PEX A;  1O7L A;  3L1P A;  3ZN1 A;  3ASN H;  3E0J B;  1IDZ A;  2VT2 A;  3V7R A;  5IP7 J;  1STZ A;  3G1M A;  2IS2 A;  1MDM B;  2R7U A;  2PBI A;  4XOP A;  5LGU A;  3JSO A;  2IVM A;  1G59 A;  3LOC A;  2JA6 J;  3GWZ A;  1U3E M;  3H36 A;  3E1S A;  2STW A;  3FXU A;  2DYS H;  2KRF A;  4GDF A;  4L9N A;  1TP4 A;  3LA2 A;  2LK2 A;  1LE8 B;  2KL4 A;  2E60 A;  3TMO A;  3F22 A;  2ZME B;  3FX3 A;  3IRR A;  2RQP A;  5H20 A;  5LBQ A;  3CJT B;  3EDP A;  2V9K A;  2GIZ A;  3FXR A;  4IHW A;  3FIS A;  3GFL A;  4A0X A;  1BR1 A;  4LK0 F;  4EV0 A;  2QWW A;  4KIC A;  2PN6 A;  1R7J A;  2X1E A;  3IAM 2;  1U5T B;  1UG2 A;  2K40 A;  4A12 A;  4I09 A;  3Q0U A;  2H8R A;  2FMY A;  3U1K A;  1X1B A;  4HDU A;  1FNN A;  3OYA A;  2N8G A;  3LAP A;  3CCV I;  3WE3 A;  1YX5 A;  1OR7 C;  2KHM A;  2HXI A;  3Q9V A;  1D1A A;  2H27 A;  1XGM A;  4JBA A;  3F21 A;  1MZB A;  4QSH A;  1D5Y A;  5HOD A;  4IL6 C;  3KP5 A;  3QOE A;  4GRI A;  4XRM A;  3OYB A;  2CGP A;  1FPQ A;  3HL2 A;  3F23 A;  2HYJ A;  1R58 A;  2FBH A;  3ZMT A;  2KQR A;  1Z7L A;  4II3 A;  2K9N A;  4F91 B;  5F08 A;  1OKR A;  1YS6 A;  2EIN H;  2M5W A;  4RGX A;  3U9G A;  4M72 A;  1LVK A;  4OU0 A;  1AKH A;  2IW5 A;  1Q1V A;  3CDL A;  3GXO A;  3GFI A;  1Z0X A;  4JOM A;  3ECH A;  5FGM A;  5D5U B;  4PJJ A;  2CFX A;  5GAH J;  1K7A A;  1SAU A;  2KIU A;  4NQW A;  2M0C A;  3BDD A;  2AXT C;  3QPL A;  1ZGJ A;  1YW9 A;  2E2I J;  4GFB A;  3HUG B;  3EPZ A;  4UUS B;  1ETY A;  1R5I D;  5H6R A;  4BY7 J;  4X6A J;  5E18 F;  4B44 A;  2K9Q A;  5JR3 A;  1LVA A;  1BOA A;  1ZN2 A;  4BQQ A;  3KP6 A;  1EV7 A;  1OCC H;  1T8I A;  5B66 C;  2XAS A;  3KLN A;  3O2P E;  1LKX A;  2M0M A;  3K1N A;  5HNF A;  3HRT A;  2NVU B;  4RDU A;  2K5C A;  3OS0 A;  2XKP A;  3MQ0 A;  4EVI A;  4RB1 A;  2PQ8 A;  3ZRG A;  2LY9 A;  1GV2 A;  2LRD A;  3OS1 A;  4DQ2 A;  2ECB A;  5E3N A;  5CVU A;  2V7F A;  2L4M A;  4RGR A;  2LNB A;  2VJI A;  2XF6 A;  4NNJ A;  3MFK A;  1R49 A;  4I02 A;  1BW6 A;  3BT9 A;  1BW5 A;  2X6X A;  3DTE A;  3JRB A;  1QRY A;  2DFF A;  3W2W A;  3M7G A;  4LK1 F;  3I4M J;  2CH0 A;  1POG A;  3V8K A;  2IXS A;  5H2F C;  4KIG A;  3HXL A;  2I5U A;  4UB6 C;  2XC7 A;  5J1R A;  1SD7 A;  1JT0 A;  1PP7 U;  3H0G J;  4GYI A;  4A3C J;  1PUF A;  1VND A;  2KIS A;  3S3N A;  2K9S A;  3CDI A;  1JI8 A;  3C18 A;  5ICF A;  1YQA A;  4EJO A;  4WWC A;  5JLW A;  2VKE A;  1J2X A;  2QBY A;  1IN5 A;  4M9Z A;  3G6E I;  3HOW J;  3F8N A;  5DCF A;  2DFH A;  3BTJ A;  1MBH A;  1UAA A;  2CV2 A;  1JTY A;  1FOK A;  3VDX A;  1YS7 A;  3CD6 I;  3BLY A;  1KA8 A;  1Z1D A;  4HNU A;  1GT0 C;  3OYK A;  2IS4 A;  2D5V A;  1KQ8 A;  4ENN A;  1R71 A;  1U6G A;  1JKQ C;  3FHN A;  1DPR A;  2CW8 A;  1J59 A;  3I59 A;  5LGN A;  3WTU C;  2HGC A;  4Y7N J;  2HQR A;  4A6E A;  1IN4 A;  2DDB A;  2IGK A;  5AIQ A;  5LHH A;  1HW1 A;  2DTR A;  2LY2 A;  5JI6 A;  3GFM A;  3HKZ A;  1JTX A;  1TT0 A;  1WSU A;  3E6D A;  3RKX A;  4I99 C;  2Y69 H;  3CCQ I;  2DT6 A;  2FJ1 A;  3JRE A;  2OTJ I;  3X2Q H;  2LC2 A;  3I5U A;  4RLQ A;  4XOT A;  4ESJ A;  1XGN A;  4KFC A;  4RB2 C;  3FMR A;  2O8X A;  2Z2S B;  1B59 A;  5B1A H;  3Q9S A;  3MZ8 A;  2V26 A;  3MZY A;  4KA4 A;  3IH2 A;  1MDM A;  3HOZ J;  3TKY A;  3RPQ A;  3BG9 A;  3BJO A;  5M5W J;  3KZI C;  4D0P A;  4OIO F;  3CQZ J;  2JVH A;  3ROU A;  3IAS 2;  2J5O A;  1IUF A;  1TNT A;  3K70 D;  3K4C A;  1V54 H;  1K83 J;  1P92 A;  1L0O C;  3BQZ A;  2OBP A;  2LBF B;  3KZY A;  3I0T A;  1WJB A;  3K1M A;  3MKY B;  3FF5 A;  1FOX A;  1MJA A;  1SFE A;  4A3K J;  1R22 A;  4HOB A;  1I3A A;  2WY7 Q;  2DOF A;  3IWF A;  4L9V A;  3ZMV A;  1LE8 A;  4WXD A;  1FZP B;  5DD4 A;  3BR3 A;  2HOE A;  2DQL A;  1I6H J;  1TT5 B;  2ZME A;  4MLO A;  1DUX C;  5D4R A;  3I64 A;  2L9S A;  3ULQ B;  5E3M A;  2HOA A;  1X58 A;  2PI0 A;  4CCO A;  3A0B C; 
#chains in the Genus database with same CATH homology
 4DYC A;  1ZTR A;  1BA5 A;  2ID3 A;  5C4J J;  2FX0 A;  4A93 J;  4D7M A;  1WCM J;  3HM5 A;  1G2H A;  3OIO A;  2CQX A;  4JYK A;  5BNG A;  3JRI A;  2GM4 A;  1HOM A;  2TCT A;  1UMQ A;  5E3O A;  4CYC B;  2R5Z B;  1JKO C;  3B6A A;  5C3E J;  1VFC A;  2XPU A;  3HBL A;  1JJ6 C;  3LSJ A;  3CCY A;  1AHD P;  1ORK A;  2IAI A;  4AC0 A;  4X1E A;  3LSR A;  2DA2 A;  1PUF B;  2CRG A;  3DCF A;  2ECC A;  2XPW A;  1WPK A;  3SJM A;  2XPV A;  2QF7 A;  5IP9 J;  3UKG A;  3A03 A;  2HOT A;  1F36 A;  2CU7 A;  2DA7 A;  2X6O A;  3BR0 A;  5J3L A;  1OFC X;  1ETQ A;  5EGO B;  3SDG A;  5M5X J;  4A3E J;  1HDP A;  5EEA A;  2E1O A;  1TWG J;  4NDL A;  2O7O A;  4M3E A;  4V2F A;  2Y9Z A;  5K7Z A;  4UUS A;  1H88 C;  2E19 A;  4MFD A;  1ETX A;  2DMP A;  3A01 A;  1XC5 A;  2R93 J;  1A5J A;  4DW6 A;  3G1O A;  4BKX A;  3W6V A;  5EZH A;  2R7Z J;  3VPR A;  1MBK A;  4JX4 A;  1DU6 A;  4M3D A;  1T33 A;  4BBR J;  2XSD C;  2X48 A;  1JJ8 C;  1JT6 A;  1RES A;  5J1Y A;  3M3Y J;  2LVS A;  2AO9 A;  3Q0W A;  5J1U A;  3BG3 A;  4M6V A;  3LSP A;  2XB5 A;  2ME6 A;  1IDY A;  1K61 A;  1B8I B;  2LP0 A;  2H1K A;  5F1J A;  3FK7 A;  3I4N J;  1I50 J;  3RKQ A;  5E3L A;  2R92 J;  3MVP A;  2JA7 J;  1QPI A;  1MBG A;  2FQ4 A;  2HQ5 A;  4IEJ A;  1ITY A;  3BR2 A;  5DTD A;  2JA5 J;  4ABZ A;  3LSG A;  4C3I J;  2ZB9 A;  3TP0 A;  2NVY J;  1IRZ A;  1Z77 A;  2M9H A;  2R5Y B;  5DS9 A;  3MN2 A;  4JP0 A;  2HXO A;  2Y31 A;  1AKH B;  4D7N A;  1FJL A;  3FIW A;  3BR6 A;  5JLX A;  4I6Z A;  1U8B A;  2GLO A;  4UUT A;  1QVT A;  2M8G X;  4QTR A;  1APL C;  1BJZ A;  3ZQG A;  1Y1V J;  1QVU A;  2JWT A;  5K7H A;  1ZR4 A;  1OCT C;  3PO3 J;  4A3B J;  4FE7 A;  4LOC A;  5EG0 B;  4C2M J;  1RET A;  4A3G J;  2MG4 A;  4FCY A;  2I10 A;  2NOG A;  1TC3 C;  1CQT A;  9ANT A;  2LR8 A;  4J19 A;  2JMW A;  3HOX J;  5M3M J;  1ZR2 A;  1MBF A;  2JN6 A;  5FKO A;  2EQR A;  4XRS G;  1HDD C;  3G1L A;  3S14 J;  2DMU A;  1FTT A;  1JKP C;  2VPR A;  3F0C A;  4AYB N;  2DA3 A;  2WAQ N;  2DMT A;  3C2B A;  2MGQ A;  2VI6 A;  3RQI A;  2OF7 A;  1SAN A;  2EH3 A;  2MW8 A;  3TP3 A;  4XIC A;  5FJ8 J;  3IV5 A;  1TWC J;  1JGG A;  2EZK A;  3BTL A;  1RPW A;  2MSY A;  1BL0 A;  4HNV A;  1OJL A;  3TW7 A;  3Q3S A;  5IP6 A;  2EZI A;  2M2E A;  4D5F A;  1JUS A;  4IHY A;  3QQA A;  3HOY J;  1SFO J;  1HCR A;  3HGG A;  1P7I A;  2DA4 A;  2XGC A;  1Y1W J;  3S2D J;  3CMY A;  2GBY A;  4G12 A;  1W0T A;  2X9D A;  4BXX J;  5FKK A;  3D1N I;  3BTI A;  2Y0S N;  3IH3 A;  3B6C A;  3RZD J;  4XRS A;  5GPA A;  4RBO A;  2HOS A;  5IYD J;  5F0H A;  4EEF G;  2NVQ J;  2P81 A;  2ELK A;  5IPA A;  1LFU P;  2NVX J;  4IHX A;  5F0C A;  1O4X A;  2NS7 A;  1MNM C;  5FKL A;  2VKV A;  2LKX A;  2FD5 A;  2LLK A;  2IEK A;  3ZOB A;  1OCP A;  3S1Q J;  5M3F J;  3OSG A;  3ZQI A;  2B63 J;  2DA5 A;  3BR5 A;  3ZQL A;  1F43 A;  1MSF C;  1T56 A;  1IGN A;  1MSE C;  2L7Z A;  2XRL A;  2LFB A;  3DEW A;  2COB A;  1IV6 A;  3S1N J;  4CYC A;  2R5Z A;  3BTC A;  5GP9 A;  5EZG A;  3L1P A;  1ENH A;  3WHB A;  1TWH J;  3HKZ N;  4A3F J;  3JRF A;  1IDZ A;  1YRN B;  5IP7 J;  3GTQ J;  3G1M A;  3HDD A;  3BQY A;  1B72 B;  5EYR A;  4FIS A;  3LOC A;  2JA6 J;  3OSF A;  3ZQF A;  3SFI A;  1HF0 A;  4BBS J;  3S1M J;  5IOZ A;  2YU9 J;  3A02 A;  4B1R A;  5EGO A;  3S2H J;  2G0E A;  1NTC A;  1WH5 A;  2LK2 A;  4MFE A;  1LE8 B;  5F0F A;  3FK6 A;  1FIP A;  3TW6 A;  3GTJ J;  1TWA J;  5F04 A;  3NAU A;  2EBI A;  1IJW C;  1GUU A;  1LFB A;  1EF4 A;  4IHW A;  1GDT A;  3FIS A;  5C4X J;  3BG5 A;  4A3J J;  3JRH A;  2W48 A;  4W1U A;  1UG2 A;  2K40 A;  4BY1 J;  3Q0U A;  2H8R A;  2E2J J;  1X2M A;  2N8G A;  2LTP A;  4DYR A;  2HXI A;  1MBJ A;  3MKL A;  3HEF A;  4DYQ A;  4D5C A;  4QSH A;  2TRT A;  2YS9 A;  1D5Y A;  1ETO A;  5HOD A;  4XRM A;  5EDN A;  2VUM J;  2XGE A;  1JUP A;  2HYJ A;  2DMN A;  2IBD A;  3WHC A;  2EZH A;  1VI0 A;  1TWF J;  5FLM J;  1P7J A;  2DN0 A;  3QPS A;  2K9N A;  1JUM A;  5F08 A;  4FE4 A;  2O8K A;  3K2A A;  2Y30 A;  2DJN A;  2OPT A;  2R5Y A;  3BR1 A;  3JRD A;  4A3L J;  2QCO A;  1AKH A;  3CDL A;  1Q1V A;  3GTM J;  1ZQ3 P;  1Z0X A;  1NK2 P;  2LD5 A;  1RR7 A;  1H8A C;  4JX6 A;  3S15 J;  2M0C A;  1DU0 A;  4XK4 A;  2XGD A;  3QPL A;  2E2I J;  4GFB A;  2CQQ A;  4UUS B;  1ETY A;  1GV5 A;  4BY7 J;  4X6A J;  1ZGW A;  4JX5 A;  3HB9 A;  3A01 B;  2K9Q A;  2L9R A;  4M3G A;  3HOV J;  5EG0 A;  2XB0 X;  3HGY A;  1AU7 A;  4C3J J;  1WH7 A;  4DZJ A;  4M3F A;  3LNQ A;  4L5E A;  5FLV A;  1U9O A;  2CJJ A;  3GTG J;  2WV1 A;  2KT0 A;  4A3D J;  1A6I A;  2L0K A;  1H89 C;  4RDU A;  3JR9 A;  1XS9 A;  3RZO J;  1MBE A;  1MH4 A;  5IYC J;  2DA1 A;  2LY9 A;  1GV2 A;  4S0H B;  2DA6 A;  2ID6 A;  3O8H A;  3PO2 J;  4MIM A;  1GVD A;  2ECB A;  5E3N A;  4B3A A;  5EF6 A;  1U9N A;  2RAE A;  3S1R J;  2AHQ A;  5FKM A;  5IOY A;  3GTK J;  1E3O C;  1ETW A;  1BW6 A;  2CUE A;  3BT9 A;  2CUF A;  1BW5 A;  1RKW A;  5F27 A;  4I76 A;  5C44 J;  3GBG A;  3JRB A;  3FKI J;  1QRY A;  3H3V K;  3I4M J;  3K7A J;  2NVT J;  2KDZ A;  1POG A;  4QIW N;  1UHS A;  3E7L A;  3O8G A;  4A69 C;  5J1R A;  1JT0 A;  3H0G J;  3S16 J;  1VF9 A;  4MO7 A;  3TED A;  4A3C J;  1PUF A;  3JRC A;  1VND A;  5M5Y J;  2K9S A;  2M34 A;  1FTZ A;  5JLW A;  2VKE A;  3HOW J;  4V2G A;  2L7F P;  3BTJ A;  1MBH A;  5FKN A;  1JTY A;  3ZQC A;  3IH4 A;  4XID A;  2JK3 A;  4B4C A;  1IC8 A;  1GT0 C;  4A3I J;  4W97 A;  4FTH A;  2D5V A;  3S17 J;  2DMQ A;  1ZK8 A;  1JKQ C;  2Y9Y A;  2ME0 A;  3ZQH A;  1X2N A;  5GPC A;  4Y7N J;  1XG1 A;  4DZP A;  1WI3 A;  2DTZ A;  4IHV A;  3JRG A;  1FEX A;  1U78 A;  1WGX A;  1JTX A;  2Y2Z A;  2O9L A;  2WB1 N;  1HLV A;  4A3M J;  1NK3 P;  3Q0V A;  2YUS A;  2FJ1 A;  3JRE A;  1MH3 A;  1ETK A;  4M3B A;  1B8I A;  3OOU A;  1JKR C;  2E2H J;  5IYB J;  1IG7 A;  1YRN A;  3PM1 A;  1S7E A;  3IH2 A;  3HOZ J;  3M4O J;  2PMZ N;  2JA8 J;  3BG9 A;  5M5W J;  1B72 A;  3CQZ J;  1FIA A;  1I3Q J;  1IUF A;  1K83 J;  3BQZ A;  1W0U A;  3GTL J;  3JRA A;  2R0Q C;  1R9T J;  4A3K J;  4AUX A;  2JJ7 A;  3NAR A;  4Y52 J;  3HOU J;  1LE8 A;  3BR3 A;  5K7F A;  2HDD A;  2EZL A;  1I6H J;  3GTO J;  1ZKG A;  2L7M P;  4MLO A;  1ETV A;  4C3H J;  1RKT A;  5E3M A;  2HOA A;  1X58 A;  2NS8 A;  3GTP J;  2HI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...