2XB0X

Dna-binding domain from saccharomyces cerevisiae chromatin- remodelling protein chd1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
265
structure length
233
Chain Sequence
GPLGSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLKKVPGAIHLGRRVDYLLSFLRGGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHROMO DOMAIN-CONTAINING PROTEIN 1
publication title The DNA-Binding Domain of the Chd1 Chromatin- Remodelling Enzyme Contains Sant and Slide Domains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 73
structure length 233
sequence length 265
ec nomenclature ec 3.6.1.-:
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF18196 Cdh1_DBD_1 Chromodomain helicase DNA-binding domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xb0X02
5HODA 9ANTA 1WI3A 1FEXA 1Z77A 2HXOA 2DA6A 5F08A 1JKPC 1IDZA 2X48A 4AUXA 2HYJA 3BG5A 4UUTA 3G1MA 3BTJA 5E3NA 5M3FJ 1GT0C 1JUPA 3RZDJ 5FKOA 2JA5J 3S2HJ 1SFOJ 1VI0A 1B8IB 1I50J 4B4CA 1ORKA 2AO9A 5EGOB 4BBRJ 3LSRA 3GTQJ 1RKTA 2WV1A 2FX0A 2MG4A 3SFIA 1JTXA 2QF7A 4DYQA 4FE4A 1S7EA 3BR2A 3H0GJ 5IP6A 3NARA 4EEFG 4B3AA 1HDPA 5IPAA 4FCYA 2K9QA 5EZGA 5C3EJ 1POGA 2DMUA 1IGNA 1YRNB 2G0EA 5DTDA 2ECCA 2XGDA 2EZHA 3A03A 4D5CA 2JA7J 2DJNA 1TC3C 2GLOA 4I6ZA 4DW6A 3BR6A 2E2IJ 1U9OA 4XRSA 2VKVA 4M3FA 1MSFC 1MH3A 4FE7A 2KDZA 4JP0A 5EZHA 1ZTRA 2JJ7A 2Y9YA 5IOZA 1JJ8C 2X6OA 2NVTJ 2H1KA 1JUMA 3ZQCA 2LTPA 2FJ1A 2E2JJ 2MGQA 3K2AA 3WHCA 5M3MJ 4X1EA 5FJ8J 1HF0A 3FKIJ 3A02A 2XGCA 3M4OJ 3G1LA 1F43A 2ME0A 3BR3A 3CQZJ 1FTZA 1MBGA 3JRFA 3HOXJ 2NS8A 4HNVA 3S1NJ 3S2DJ 4A3JJ 3S14J 2MW8A 3BTLA 2ZB9A 4DZJA 3HGGA 1JUSA 4AYBN 3HEFA 3M3YJ 1RPWA 2XB0X 4V2GA 3PM1A 4X6AJ 3RKQA 1I3QJ 2LK2A 5GPAA 3HB9A 5F0HA 1H8AC 3TP0A 4IHWA 4MIMA 3SDGA 3MKLA 1B8IA 2EBIA 3JRIA 2GBYA 3GTGJ 1MNMC 3GTJJ 1MBJA 1RKWA 3UKGA 1HOMA 1RR7A 1E3OC 3RQIA 4JX5A 4C3HJ 3HBLA 4Y7NJ 4XK4A 4A3MJ 2CUEA 2M8GX 4JYKA 1R9TJ 2HDDA 3HOYJ 1A5JA 3JRCA 1MBFA 3ZOBA 2EQRA 4C2MJ 2JA6J 2E2HJ 1VNDA 5EDNA 5EF6A 2VUMJ 3JREA 4C3JJ 3BR5A 3CCYA 1FIPA 2ID6A 5FKKA 3HOWJ 3QPLA 2TCTA 1TWGJ 1HDDC 3GTMJ 3HOVJ 2NVXJ 1BJZA 1SANA 2K9NA 1UMQA 1B72B 4CYCA 3LOCA 1W0TA 1ETOA 2R0QC 4GFBA 2JA8J 3GTPJ 2JK3A 1JJ6C 2X9DA 2RAEA 2LKXA 1QVUA 1I6HJ 2M34A 3IV5A 1PUFA 4M3DA 1AHDP 5EG0A 1QPIA 3F0CA 1U9NA 2DA2A 3LSPA 3JRGA 2L7ZA 2DMNA 1JGGA 2DA4A 5F1JA 3GTOJ 3S17J 1OJLA 5IYBJ 2W48A 4B1RA 2Y9ZA 5JLXA 4IHVA 2CRGA 2LY9A 1IC8A 2EZIA 2QCOA 5FLMJ 2R5ZB 2Y30A 1NK2P 2CQXA 1JT6A 3CDLA 4AC0A 1LE8A 2EZKA 2HXIA 4A3CJ 4M3BA 1P7JA 2P81A 1OCTC 3FIWA 2K9SA 1W0UA 2VI6A 3ZQFA 2NVQJ 3GTKJ 2K40A 5FKLA 1ITYA 2O7OA 2DA1A 1WGXA 3IH3A 4XRMA 5E3OA 4FISA 4J19A 2IEKA 2EH3A 1ZKGA 5M5WJ 3OSGA 5JLWA 4CYCB 3HOUJ 1QRYA 3RZOJ 1ETWA 3CMYA 1PUFB 2YUSA 2D5VA 2HI3A 2XB5A 5EG0B 2CU7A 3JRBA 3HDDA 4W97A 3LSGA 1MH4A 2FQ4A 5E3LA 1X2NA 2NVYJ 3LSJA 3B6CA 2WB1N 4BY7J 1B72A 1QVTA 1ZQ3P 1JTYA 3FK7A 3BR1A 3ZQHA 3O8GA 1OCPA 2IAIA 2JMWA 3BG9A 4C3IJ 4BKXA 2IBDA 3C2BA 3D1NI 2L7FP 5J1UA 1ETQA 1BL0A 5E3MA 1LE8B 3IH2A 1VF9A 1MBEA 4NDLA 1H89C 4G12A 1BA5A 2R92J 2DN0A 4V2FA 2DMQA 5F0FA 1VFCA 2XRLA 1WPKA 4I76A 2LLKA 3OOUA 5FKMA 1ZK8A 2R5ZA 3GTLJ 4A3GJ 1OFCX 3JR9A 4D7MA 3S15J 2Y31A 3I4MJ 4BY1J 3BTCA 4MLOA 1JT0A 5FLVA 2DMTA 2R5YA 4ABZA 1XS9A 4A3KJ 1NK3P 3DCFA 3TW6A 2LR8A 5FKNA 1GDTA 1IUFA 1ETVA 4RDUA 5GPCA 1D5YA 3BTIA 4W1UA 2ELKA 3I4NJ 3PO2J 4A3DJ 2CUFA 4MFEA 3Q0WA 2L0KA 1NTCA 4S0HB 5GP9A 2JN6A 1AU7A 2KT0A 4M3GA 3ZQLA 1X2MA 1IV6A 2YU9J 1F36A 4BBSJ 1APLC 3PO3J 5C44J 4JX4A 3BG3A 3WHBA 2LD5A 1P7IA 1MBHA 3Q0UA 3VPRA 5F27A 4DZPA 3O8HA 2VPRA 4DYRA 3E7LA 4LOCA 5IYDJ 2HOAA 4IHXA 1K61A 1K83J 1XG1A 4A3LJ 4BXXJ 2NS7A 2JWTA 1GVDA 3G1OA 4D7NA 2OF7A 4QIWN 1TWFJ 3QQAA 1G2HA 2CJJA 3HOZJ 1FTTA 2COBA 2DA7A 5K7HA 3L1PA 1GUUA 3LNQA 1U8BA 1DU6A 2H8RA 2R5YB 5K7ZA 4XICA 2N8GA 2ECBA 1IRZA 5F0CA 4A69C 3BQZA 3GBGA 2HOTA 3A01A 2LP0A 2MSYA 3S1MJ 3IH4A 1ETYA 4A3FJ 1XC5A 3BQYA 2FD5A 3NAUA 5F04A 5J1YA 3ZQIA 3JRAA 2R93J 1Y1WJ 3FISA 3JRDA 1JKQC 3DEWA 5DS9A 3HM5A 3MN2A 3S16J 3MVPA 1TWHJ 1Z0XA 5J1RA 5C4XJ 3TP3A 5C4JJ 1GV2A 2ID3A 1ETXA 2M9HA 2XPUA 2LVSA 5J3LA 4XIDA 1LFUP 1O4XA 1X58A 3S1QJ 3ZQGA 2O8KA 2CQQA 4D5FA 1A6IA 4UUSA 2I10A 2WAQN 3S1RJ 1JKRC 1WH5A 2L7MP 5M5XJ 3FK6A 3JRHA 2DTZA 3B6AA 5EYRA 2AHQA 5IP9J 1CQTA 3TW7A 1BW5A 4A3BJ 5K7FA 1IDYA 2XPWA 4JX6A 1AKHA 1UHSA 1WCMJ 1IG7A 2OPTA 1ENHA 2Y0SN 1JKOC 2VKEA 1HCRA 1T33A 4M3EA 2DMPA 3HGYA 1U78A 1HLVA 1ZGWA 2NOGA 4MO7A 1DU0A 4XRSG 1IJWC 3OIOA 4DYCA 2LFBA 5IYCJ 3Q0VA 1FJLA 2PMZN 2M2EA 3A01B 3OSFA 2TRTA 1FIAA 1GV5A 2EZLA 3BT9A 3Q3SA 1TWCJ 2E1OA 1BW6A 3TEDA 3QPSA 1Q1VA 5BNGA 4QTRA 2HQ5A 1RETA 4Y52J 2DA5A 2O9LA 4A3IJ 4A93J 3K7AJ 2M0CA 4IHYA 2XGEA 3W6VA 2R7ZJ 5EGOA 2XSDC 2B63J 1UG2A 2ME6A 2GM4A 4M6VA 3H3VK 2E19A 2L9RA 2YS9A 1H88C 1EF4A 4IEJA 3HKZN 5EEAA 4RBOA 1ETKA 4QSHA 4A3EJ 2XPVA 1TWAJ 4UUSB 5IP7J 1WH7A 4FTHA 1MBKA 1ZR4A 3SJMA 1Y1VJ 2DA3A 1LFBA 1YRNA 1T56A 1RESA 4L5EA 1ZR2A 5M5YJ 2Y2ZA 5IOYA 2HOSA 4MFDA 1AKHB 1MSEC 3BR0A
chains in the Genus database with same CATH superfamily
3CZ6A 2KQRA 4N9IA 2HXOA 4YFNF 1JKPC 4RAGA 4AUXA 2HYJA 3K4NA 2IRFG 4BQAA 4D0PA 1HC8A 3BTJA 2CUZA 1J0RA 3VYTB 3S2HJ 4M9XA 2V6CA 3WTVC 4BS9A 2HVQA 3K1NA 2NAZA 3C7JA 1IN7A 2LOOA 5J8CA 1P6RA 3GO5A 1VI0A 1I50J 4L5IA 3B02A 4XLEA 4A6EA 4UVBA 2ZNYA 1FOKA 3GFIA 2P5KA 3QOPA 1OMIA 2A05A 3LSRA 1V4RA 1RKTA 4YEJA 3GTQJ 2WV1A 2FX0A 2UXXA 2MG4A 3SFIA 4XKWA 5IP6A 4II3A 4DYQA 4XL9A 1YIOA 1WJAA 3GWZA 1HDPA 1ZH5A 4ZYEA 2VOOA 3PUFA 4HV5A 2K9QA 2QUFA 2Z16A 5C3EJ 4KISA 2G0EA 5DTDA 4IXAA 3OS0A 1Z6TA 2KP6A 2DYRH 1G6NA 2XGDA 3TKYA 3A03A 4D5CA 1XGMA 2EV5A 3I56I 1T2KA 4MGRA 4E7LA 4BUPA 3A4CA 3BR6A 4CXFA 1Y8RB 1U9OA 2JVHA 2VKVA 1BC7C 2OQRA 4G7ZF 1MSFC 1TT0A 2ZJPF 2WBMA 1TQPA 1MKMA 2R7DA 5EZHA 2QKMB 3HXLA 1JI8A 4OIRF 3OYBA 2K86A 1JUMA 2P6TA 3C1DA 3ZQCA 1YITI 2V1UA 5GAEJ 1LVKA 3L09A 5EEGA 1R7JA 2CSOA 3K2AA 3P9IA 3WHCA 1Z1DA 5GADJ 5CVRA 1HF0A 4BE1A 4BJ5C 4PDKA 3WGIA 1TZLA 2GA1A 3PNTA 2XGCA 2OBPA 2R7XA 2O61A 2W7NA 1BR4A 3UNGC 3AAFA 4HNVA 1O3SA 2STWA 3S2DJ 1U5TA 3BP8A 4A3JJ 3S14J 1E3HA 2ZB9A 1D0XA 5LHGA 4XMYA 1QGPA 1JUSA 1W7PD 5F6FA 2O8XA 1TT5B 3CCMI 3H5NA 4X6AJ 3HHGA 3DKWA 2FE3A 2H09A 5GPAA 1EV7A 2DW4A 3WTXC 1BC8C 1WQ2A 2BXYA 2EBIA 2EFOA 3GFLA 1R00A 4GO1A 1MBJA 4HF0A 3UKGA 1HOMA 5BOXA 5CYVA 1AOYA 4E7ZA 3HBLA 3OYLA 1Z67A 3IL2A 4HSRA 4Y7NJ 2X51A 4A3MJ 1BI1A 2CUEA 3UR3C 3S3NA 2M8GX 1R9TJ 2HDWA 1XGSA 4EGZA 1TL8A 3V8LA 3FXJA 4Y3OA 3CCLI 2OTJI 1ZLJA 3FKJA 1MMDA 1VQKI 1MBFA 3ZOBA 4CZCA 2YSRA 3HJEA 4BYYA 1NH3A 4OMZA 2JZYA 3JW4A 3DEEA 4BL0B 1JXSA 2DJIA 1Z3XA 5CKTA 2L2OA 5D6FA 3VOEA 3I9V2 3OYKA 3GTMJ 1HDDC 2ELHA 2NVXJ 2EJRA 2MLKA 5D5VB 1B72B 2IS4A 4O6JA 5KHDA 1UAAA 3LOCA 4LITA 2F6CA 2JA8J 3ZQQA 2JK3A 5HVQC 1QVUA 4ASNA 3DBLB 2YR2A 4I98B 1KU7A 2VXDA 3QPTA 5F1RA 5EG0A 2UZKA 5FRMA 4LLNA 1RUOA 3JRGA 3D5RC 2WC2A 4EJUA 4M71A 4UXNA 4ZC3A 4UUVA 1P4WA 2LY2A 3ZGKA 5F1JA 2ESHA 3GTOJ 3K4LA 3K10A 3S17J 4XM3A 3CCSI 5ICCA 2IS2A 2Y9ZA 5JLXA 4KICA 2LY9A 3DU6A 1IC8A 2EB7A 2EZIA 2KKOA 2QCOA 5E17F 2HYGD 2CQXA 1JT6A 4LJZF 1SMTA 1H9TA 3CDLA 1BI2A 2VBWA 2JT1A 1M1EB 2GWRA 2HTJA 4NB5A 3V7RA 4BAYA 3NQOA 2P81A 4UB6C 1OCTC 2K9SA 3FMQA 1W0UA 5LEJA 2MABA 3N4MA 3ZXSA 1GHCA 1F9NA 2LNBA 5D8KB 4GCVA 4CCKA 2DA1A 3I5UA 3RYPA 2X1DA 4FISA 1I3AA 4JOMA 5DCFA 2EH3A 1ZKGA 3QYFA 2XASA 1U0JA 3K69A 3O2PE 4PGGA 1GXPA 1FYKA 4KIFA 3RZOJ 3GLXA 2YUSA 2HI3A 1T0FC 2CU7A 2GOXB 1HA8A 1I6XA 2XAJA 3H9JA 2Q8KA 2NNYA 3JRBA 2JTVA 4BXUA 1G3WA 2F5FA 3TDZC 4AVPA 2Z99A 4AYBA 3ZMSA 2R4GA 3E6DA 3J7ZI 2LBFA 3ZQHA 3OYEA 2IPQX 3BCAA 1G3SA 3O8GA 4WXHA 2LG4A 2OU2A 4GDFA 4DBQA 3BG9A 3CJQB 2FMYA 2RC4A 5DV5A 3K4JA 1XX5A 4I02A 3D1NI 3MAJA 2ZFWA 2KDOA 5E3MA 3PUBA 2EFPA 3F23A 1G4DA 2VQHA 2EFWA 1H89C 2VJ4A 4BQNA 1BA5A 2P4WA 4EM0B 3IKVA 1VQLI 5J4VA 5F0FA 1SAXA 4RM3A 3V8JA 2CFXA 2XRLA 1HKQA 3LFKA 2FOKA 3R6SA 4WK8F 5ILVA 2R5ZA 4A3GJ 2BYVE 1K78A 3F9KA 1J7KA 4OINF 4MLOA 4EQQA 3WTYC 1JT0A 5H6QA 1V5EA 3I71A 3IAM2 4ZYAA 4A3KJ 4Y33A 2H27A 5LHIA 2BEOA 3DCFA 1ON1A 3S3OA 2NOJB 2LR8A 3RDIA 3FXRA 1JE8A 4RDUA 3MZYA 3P5JA 1R5ID 1D5YA 3PIOF 2D1VA 3NWSA 3CDIA 4A3DJ 3BPVA 2XC7A 5HOOA 4MFEA 1N78A 1UFMA 2IA0A 4S0HB 4A0YA 5DEQA 3BDDA 5GP9A 4ZTJA 4ENKA 4XSXF 4OAYA 5D4RA 5DUIA 2F5DA 3ABKH 2DFHA 5C44J 4JX4A 3C18A 4ZDPA 1BIAA 1LPQA 3IWFA 2A3SA 3S93A 1IXSB 3Q0UA 3GVAA 1FOXA 1LEAA 3L9FA 4YIRX 3FHZA 4DZPA 3O8HA 2VPRA 1K4TA 2H6BA 5CVUA 4IHXA 2BHZA 3CCQI 2EA2A 1XG1A 1W7PB 2JWTA 2KZVA 4QPQA 4PFPA 3MZHA 3VYSB 2B0LA 1G2HA 3MKYB 1ZGAA 2VC0A 5LHHA 3NEUA 1VQ5I 1FTTA 4AD9A 3DPUA 5K7HA 4UVAA 2VN2A 5LD2C 2M87A 2KZGA 1X3WB 2W57A 4LG0A 2F4OB 4XICA 5GAHJ 2R5YB 3MFKA 3F6OA 4HX8A 1HSTA 3RKYA 3BQZA 3H92A 2ZXJA 3GBGA 1Z6RA 3FMSA 2Z5UA 5JR3A 3CLOA 1YOVB 3S1MJ 2CW0F 2V1DA 3DFGA 5K1YA 1IZ1A 2KLOA 3E97A 5J1YA 3JRAA 4KJZA 3KP7A 4E7JA 2XKOA 1XMAA 1MMAA 3CC2I 4KN4X 3MN2A 4RLFA 1Z0XA 4ZYHA 3IAS2 3I54A 2EFNA 2XPUA 2QZ8A 2CQ7A 1FOWA 1Z7LA 4M74A 3HHHA 3CP8A 2O6GE 3S1QJ 2GIVA 2O8KA 4D5FA 3CP2A 2XDVA 2I10A 3QWLA 4U0WA 2ZO4A 2R7FA 3ABLH 1G59A 2DTZA 5IP9J 2AHQA 1CQTA 3BZCA 3P9CA 2B7EA 4KITB 5K7FA 4A3BJ 1QO0D 2XPWA 2WADA 2CGPA 1IG7A 5JI6A 2XIGA 2QENA 5DM6F 3FXOA 3CMAI 2VONA 3VODA 1FY7A 5JHFA 3G73A 3SEZA 5L3GA 3N97A 1HLVA 2PX9A 2NOGA 4MO7A 5BQTA 5HDNA 3VYUB 2MLGA 2QSGX 3FZVA 1FJLA 2DDAA 2MYSA 1E0EA 4IO9F 2TRTA 2A6HF 1GV5A 2EINH 2HKOA 4GYGA 2BBYA 4B8XA 3Q3SA 4F93B 2WAFA 6PAXA 3QPSA 1Q1VA 4TV7A 4Y52J 1OLTA 2DA5A 5E18F 2O9LA 4AIJA 4YELA 4RGSA 2LMDA 3K4BA 3W6VA 2HGCA 3KLOA 4AU7A 1SD5A 4L0ZB 5EGOA 4R8HA 5DCMA 3DWLE 5F64A 2PI0A 4HNTA 1A36A 1MMNA 2B63J 5E1ZB 4D9JA 3V42A 2FA5A 2P8TA 1X4PA 2NYXA 2R3SA 3FWEA 3KEYA 2KIUA 3M9AA 5EEAA 4QSHA 3KP5A 4GGGA 1WJFA 2F2EA 2XPVA 5IP7J 1WH7A 3ABUA 2AQEA 1MBKA 5AIPA 3B73A 3F72A 3FHNA 1Y1VJ 2DA3A 3FF5A 2HVSA 2A6EF 4PGHA 1O3RA 3PSIA 4L5EA 1ZR2A 1OISA 2O03A 3HPHA 4XKBA 2NS0A 5IOYA 4MFDA 3KYLA 1AKHB 2D1HA 3CTAA 3OIQA 2PLYA 1E2XA 1RRJA 2OCEA 1FMWA 1YFHA 1SD6A 5HS9A 1MDMB 1WI3A 3IP4B 3OYCA 3ELKA 3M1EA 5F08A 1IDZA 3LWFA 4M73A 4HNUA 2P0WA 2X48A 3H9GA 5LBQA 2QYOA 3OYAA 3VDXA 1GT0C 1XSDA 1U3EM 2R7WA 1JUPA 3RZDJ 3EUHA 2XSJC 5FKOA 5H20A 2PG4A 1SFOJ 2DODA 2DOAA 4HQEA 1J2XA 4L9JA 3CDHA 2H6CA 3BJAA 2Q2EA 4LB6B 1XSXA 3WODF 3AG2H 3G4SI 3R60A 1N75A 3VYRB 4BHBA 2BHYA 2CS3A 1BI0A 3OL4A 1CGPA 3Q9SA 4HSTA 3SHFA 1YIJI 2F5EA 2QF7A 3H0GJ 3AL0B 3NARA 1R5GA 3ABMH 4EEFG 2PMHA 2IT0A 2JUGA 1FP1D 3FDYA 4A6DA 2L4MA 1BR1A 4Y13A 3KZYA 1POGA 3I4PA 2DFIA 2ECCA 4RB3C 4ANJA 1FPQA 1W5TA 2EZHA 3OYDA 4DBRA 4RAZA 4EV0A 4XQFA 1FWZA 4XLNF 1MH3A 3RSNA 4RA2A 4FE7A 4Z6YA 1ON2A 1ZTRA 4WXCA 4BHPA 3BJOA 1X19A 2PJRB 4ESJA 1S7AA 2NVTJ 2ISZA 2H1KA 4KUMA 3M8EA 2FJ1A 5LGUA 3MKWB 1G3TA 3A0HC 1WFXA 4DOZA 1Z9CA 2KJCA 4X1EA 5FJ8J 1MMSA 2VASA 2QBYA 4K2EA 3SFZA 2ISYA 5IY5H 2PJPA 1R58A 2GQQA 2NXNB 2OZUA 3CQZJ 1LDDA 1FTZA 4CICA 2JPCA 2NS8A 1SVLA 4RB0A 4U87A 3S1NJ 3PL8A 2RN7A 4N9HA 3AL0C 2RGVA 3BTLA 1GXQA 3HGGA 4NQWA 1PYVA 4BQQA 2JVGA 1RPWA 2A61A 2XB0X 3PM1A 1SFKA 3GFJA 2ZCWA 2LC2A 5F0HA 1BBYA 5DD4A 4MIMA 3SDGA 2XROA 1B8IA 1FBSA 3SQNA 4BE0A 3FXQA 3HKZA 3QPHA 1P4XA 4OIOF 2NNNA 1RR7A 2WTEA 1OCZH 4JX5A 5D4SA 1KA8A 3HSRA 2LDUA 4IF4A 1MNDA 3DEUA 4XK4A 2V6EA 2XKPA 1DGWY 4LIUA 4KIGA 4A0XA 3GMEA 1ZGJA 1A5JA 5AONA 3ZN0A 2FBIA 2L4AA 5HLGA 1O57A 2DT5A 3GLLA 5B1BH 1VQ9I 1F1ZA 4IHSA 2EA4A 3I59B 5B5EC 5EF6A 3JREA 1HBXG 3D5LA 2A5YB 2H8WA 2JUCA 3AG1H 2F48A 3WTUC 1FZPB 2ZBKA 3CCYA 1FIPA 5BPDA 4QPOA 4IOAF 1EJ9A 5FKKA 1TLHB 3O6BB 1D1CA 2R7SA 1BJZA 5H2FC 2K9NA 1UMQA 3RCOA 5FO5A 2DBBA 1KQ8A 2FNPA 1TNTA 4E7HA 3GTPJ 1JJ6C 5KNLA 1LUJB 2X9DA 2DLLA 2LKXA 3DBHB 2M34A 2GZWA 3IV5A 2K4BA 4M3DA 3RYRA 3KFWX 4P5OA 1U9NA 3DTEA 3H1CA 3DPTA 2RNJA 3F8MA 3PNVA 1PP8F 1YS6A 4IRGA 2IXSA 2RKHA 3N05A 2DA4A 2O5RA 2FU4A 5E79C 5CQGA 1OJLA 2BW3B 2FF4A 4RAFA 2KRCA 3OYGA 2M1BA 5ED4A 4IHVA 2R7QA 2FOWA 3TO7A 2VBZA 2CRGA 4I01A 1VQMI 4KIBA 2R5ZB 4M9SA 1NK2P 2XF6A 3ONQA 1OR7A 3HUGA 4XOTA 1Y0UA 4AC0A 4NNJA 5K5RA 3JTGA 2M0MA 4M3BA 1WSUA 4A3CJ 5L3DA 4G7OF 3FIWA 1FSEA 2DXIA 1KYWA 2AXLA 4ZH4F 5HS7A 2K85A 4XLFA 2WAQA 1K79A 3R0JA 5FKLA 1IV8A 5IT3A 2O7OA 3FXLA 2HOEA 3HIFA 3IH3A 1UZCA 5E3OA 2BOLA 4LD5A 2IEKA 1ZARA 2M30A 4CYCB 3HOUJ 5J47A 1X3ZB 4HEA2 3I64A 1QBJA 1ETWA 3KEOA 2Y0MA 1V5GA 3CMYA 1T08B 1PUFB 2D5VA 1N77A 3TL4X 5D8LB 4N4OB 4S05A 2PMZA 4HOBA 4M72A 2DT6A 2Y75A 4W97A 3I3LA 2R7RA 1X2NA 3K4MA 2NVYJ 3LSJA 4BY7J 1ZQ3P 1QPMA 3LQQA 1CF7A 2EFQA 1N25A 3D0SA 2VT2A 4NBQA 1QZZA 2JSCA 2M7BA 4IRIA 1OCPA 4I2OA 1ULYA 4BJTA 1OYIA 2QEXI 2HR3A 4C3IJ 4YFKF 5B3SH 2PFBA 3TO6A 2IA1A 4L9TA 2L7FP 2BGCA 1B4AA 3KP2A 1LE8B 5TRDA 1VF9A 3HOSA 4LG0B 2KIQA 4NDLA 3GF2A 2A6TA 2DK8A 1G8XA 4V2FA 2VC1A 2WY8Q 4PJMA 2X0LA 1D1BA 1WPKA 2DYSH 2W25A 4I76A 3MKZA 3OOUA 3BZ6A 5FKMA 3GFMA 3H9QA 1ZK8A 3C2GA 3F6VA 5FGMA 1DP3A 3U9GA 4BXFA 3GTLJ 1OFCX 1WRJA 3GEZA 4KT5C 3ROUA 4HYEA 2E7WA 3OS2A 4KDPA 1XDSA 4FHTA 3T1BA 4ZYGA 1MGTA 2FXAA 1O7FA 3Q5FA 2DMTA 4ABZA 1XS9A 3Q9VA 1VQPI 3HTSB 4Q47A 4EM1A 3VB2A 3FXKA 5E8GA 4IOCF 3ZMVA 3S2WA 3FX3A 2G7UA 1A31A 5GPCA 3F8NA 2FMLA 3T8RA 3PQKA 4G8XA 3GYHX 3PO2J 4EJOA 1BJAA 4UNOA 4CSWA 1ZRFA 3DBRB 3Q0WA 1NTCA 3OY9A 2JPBA 3M7GA 2KT0A 2L3DA 3ZQLA 3V7SA 1W36C 1F36A 2A69F 2W00A 4BBSJ 4RM2A 2VE9A 1R4NB 3WE3A 3AFHA 2K02A 1P4AA 3WHBA 2ZFUA 2OQGA 4CCNA 2LD5A 3RPQA 1P7IA 2R7UA 1Z91A 3CCUI 2HYFA 2DQLA 1QNTA 5F27A 2Y48A 3BLYA 1OPCA 4DYRA 3E7LA 3W2AA 3KCCA 1D8KA 3JAMZ 4A3LJ 4PUSA 1OCRH 1GVDA 4L0YB 1J59A 3TDUC 4XBFA 1BR2A 2F5VA 1R71A 1QQIA 4HF1A 3R4KA 2E35A 4D1QA 4FT8A 3SZGA 3EYIA 1EH6A 2CQKA 2BY2A 3HZJA 2HQAA 3J7YJ 5D6EA 2N8GA 2ECBA 3J81K 5DCMB 1IRZA 3FBIB 2VPLA 4AVZA 2HTSA 5DD8A 3CUQB 3A01A 4HX4A 2FRHA 1FYLA 2IGOA 3U1DA 3A1YA 1VQNI 1Y1WJ 3LA3A 2PEXA 3JRDA 4ENNA 3DEWA 4X0GA 3F3XA 3HM5A 3P9KA 1XCVA 3E1SA 5C4XJ 1YE9A 5C4JJ 5KCMA 1YHQI 1DUXC 4RAYA 3QP6A 3V4GA 5A2QZ 2YU3A 4XKCA 2LVSA 1K7AA 4A5NA 1X1PA 4LIVA 1LFUP 3V7CA 1PVEA 3FBNB 3HTUA 2WAQN 1JKRC 1WH5A 1XD7A 2ZMEB 3J80K 1S8NA 4QLCU 2M3AA 4N0BA 2E36A 3LA7A 3LA2A 3X2QH 1XB4A 3COAC 4C2UA 1FP2A 1K6YA 1SEUA 2HPMA 2L54A 3RQ4A 2OPTA 4IQJA 2VKEA 5LEKA 1RIOH 1U78A 2Q2EB 2DFFA 3CCJI 3CUQC 1T95A 3H5RA 2HQRA 4MQVA 1R6RA 2VKHA 5IYCJ 1MZBA 2BXZA 2PMZN 2M2EA 4XLHA 1FIAA 1QZEA 1T98A 3E6CC 2PQ8A 4MHGA 2EZLA 5DUKA 4MTDA 1TWCJ 2KJBA 2KRHA 4Z2YA 4RB1A 1BW6A 4CCOA 4DNCA 3MCZA 3KEQA 5BNGA 5IT9K 1RETA 4F92B 1QZYA 3HSEA 3K9TA 5KVRA 4U7DA 2M0CA 4IHYA 2AXTC 1HQCA 5D5XB 4L18B 2XSDC 4H0EA 2VBYA 1VTNC 2E19A 4J00A 3DXJF 4XLAA 4ITVA 5JHUA 2YS9A 1H88C 1JGSA 1EF4A 2L9SA 2KL4A 3ZR8X 3ZP5A 3I0TA 2K4JA 2ZMEC 3L2WA 2E1CA 1ETKA 3K4KA 4A3EJ 1TWAJ 4UUSB 3RIRA 4FTHA 3REOA 2NVUB 2GXGA 2W24A 3OYMA 2V4JC 1RESA 2KPMA 1YI2I 2R7TA 1YO5C 2XRNA 4G7HF 3CF2A 3KZZA 2UXNA 4IZZA 2BZTA 3FM5A 2V7FA 4R79A 1U2WA 3GW2A 1MSEC 1VQOI 2CO5A 2H94A 1D5VA 1MJBA 2JA2A 2FBHA 5GAGJ 2O0YA 5HODA 9ANTA 2E1NA 1R36A 1Z77A 1G3YA 2HNHA 5HS8A 5FRNA 4AIDA 4IL6C 4OOIA 4I09A 3RPUA 2I8DA 1FX7A 3BG5A 3DV8A 2DFEA 1YQAA 4UUTA 1Y6IA 1GLNA 5E3NA 5M3FJ 4HA8A 1SVOA 5CVJA 3PJRA 1R23A 3KETA 4KNYA 4EATA 1S72I 1SVMA 1QU3A 1HXDA 3NRVA 1B8IB 4B4CA 1LKXA 2AO9A 3WGHA 3KP6A 2L9NA 1WJCA 1JTXA 1Y0NA 3LSMA 4Q5SF 5GTHC 1S7EA 1FNNA 3BR2A 2GIZA 1UB9A 3DKYA 4WWCA 3HRMA 5IPAA 4ENMA 4PJLA 3E6BA 4FCYA 2V79A 5EZGA 3TGNA 1FYMA 1AA7A 2DMUA 4RGRA 5B66C 4S04A 1IGNA 1YRNB 1MW7A 2QLZA 2JA7J 5TJJA 3OR2C 2WB1A 3QU6A 4I6ZA 2BE5F 1OYWA 2DO7A 4DW6A 2IJLA 2E2IJ 4RMNA 2COMA 4NC6A 2JRMA 4M3FA 4KMUX 3J7AY 2ZSIB 5HNHA 1B59A 4ZDLA 2B9SA 2JSPA 1H0MA 2KDZA 4JP0A 1BOBA 5IOZA 3JSOA 4OMYA 4CCLA 1JJ8C 4CCJA 4MTEA 2X6OA 4HX7A 5FD5A 2LTPA 4CCMA 2P7VB 2MGQA 2E2JJ 1RZ4A 1KGSA 2YX4A 2VODA 3FKIJ 2HDCA 2PBIA 3A02A 4BDZA 2ZXWH 2A68F 3SEQA 1E3PA 4BEHA 3M4OJ 3G1LA 4LGWA 1QA6A 1F43A 1XMKA 3OOPA 3BR3A 1MBGA 1E17A 2GOMA 2RDPA 3JRFA 3SYTA 4F7ZA 3VEPA 3ERED 3OYNA 2ETHA 4DZJA 1IN6A 2IGNA 2GAUA 2GA2A 4AYBN 4HLXA 3M3YJ 3VSLA 1IXRC 3RKQA 5HNFA 1I3QJ 2LK2A 1H8AC 4L5JA 2K9LA 2QVOA 1T0FA 3WG7H 3OMYA 5ILUA 2GBYA 4ETSA 3CCEI 5LLQA 1MNMC 2EIKH 5KAIC 2K27A 3GTJJ 1RKWA 1FLIA 4B3XA 3RQIA 4A5MA 5EEHA 2XAHA 5K5OA 1HKTA 2DQRA 2W82A 3SZTA 3H3ZA 3TQNA 4HW0A 4XN0A 3PNYA 3L2QA 1XSVA 3RI4A 1RC9A 5FFZA 1U8RA 3MD2A 3LQRA 4UV9A 2DPDA 3JRCA 4JBAA 4WXDA 1YLFA 2EQRA 1MIJA 3CMMA 4I99C 5AIQA 2JA6J 1VNDA 3WTTC 5TISC 3G2BA 2CMPA 1B9NA 1WJDA 4C3JJ 4BJ6C 1D0ZA 3CUOA 1S3JA 2ID6A 2DU9A 3K1MA 1AWCA 1IXCA 5E20A 4G94A 2TCTA 1YW8A 1UG0A 1TQMA 1SANA 2LF7A 2ZXHA 2VJJA 5KAFC 1U5TB 1F4KA 3ZMTA 1W0TA 1ETOA 4GFBA 3F8FA 4BDYA 2XUBA 1UHWA 3ASOH 3C3WA 3M8JA 1LVAA 4P9UA 1MMGA 4EJVA 1I6HJ 4M6XA 3RPUD 3I55I 1AHDP 4ZZDA 4YIIA 1RUNA 1WJBA 3F0CA 3WTWC 3AG4H 3E6MA 1RNLA 2PN6A 1A35A 3CJNA 2L7ZA 1UJ8A 3LMMA 5CVVA 1ZG3A 2K3FA 3ZN1A 3WU2C 2KMUA 2F4MB 1WWXA 5IYBJ 1X1CA 3H36A 2W48A 1ERDA 3BROA 4KN7X 2VT3A 1QHGA 3SDBA 4RGUA 1XDUA 1IN5A 2EILH 5FLMJ 1ZRDA 1SFEA 3E5XA 3KP4A 3A0BC 3W6KB 2M4GA 2DT7B 2HXIA 1BI3A 2DTRA 3V8KA 2RQQA 3CJRB 5E1XA 4C30A 1P92A 3IUOA 2VI6A 3W6JB 2VOPA 3RKXA 5BMZA 1VQ7I 1HW1A 1Y56A 3ZQFA 2NVQJ 2K40A 2X1EA 3F22A 2BVLA 4PSXA 1KU3A 4CZZA 1U5TC 1YS7A 2RNGA 3PFYA 1WGXA 2HS5A 4XRMA 3ISPA 2FBKA 4JQFA 2L5QA 3OSGA 2Y0SA 1QRYA 1LFPA 2M45A 1HSJA 3ZRGA 4AWXB 2XB5A 5EG0B 3H3UA 1TW2A 2MH2A 1EH7A 1WHUA 3HDDA 1D0YA 1UCRA 2ACJA 2FQ4A 4M6YA 4MNUA 4RGXA 3B6CA 1GVJA 2WB1N 3DTKA 4BGDA 1QVTA 3A2KA 5L3EA 3K4CA 4MQ9F 4HF2A 3GCMA 3PFIA 4ESFA 5B1AH 2JQ7A 4J01A 1I39A 3HRUA 1W5SA 4R1HA 2IBDA 2HKXA 4NUBA 2QQ9A 1SD7A 1BL0A 3IH2A 1MBEA 4G12A 1BOAA 3QYBA 5CVIA 3L2CA 1F5TA 1XGNA 2KRFA 4PFOA 2W84A 2ZJQF 1W7PA 2VE8A 3TO9A 3CJTB 3ZQ7A 1ZREA 2R7OA 2ZNZA 2CV1A 2M7AA 2BVMA 1Q1HA 3MMYB 4BE2A 1YX5A 3CMEI 1T8IA 2NRAC 1W1WE 2MC3A 4AIHA 2ESNA 3S15J 1PUEE 2Y31A 4BY1J 1SFXA 2FQ3A 2BY3A 2YPRA 3LAJA 4GXOA 2R5YA 5FLXK 3PIPF 3BG7A 1NK3P 4LB5A 1WJEA 2EV6A 3BCBA 1IF1A 3DLLF 1GDTA 4PCQA 2X6XA 3BTIA 4L9VA 2ELKA 3QOEA 4W1UA 1S29A 2CUFA 2BV6A 2LKSA 4LG3A 5J8FA 3L00A 4IJAA 2QQ8A 2LBFB 1HW5A 1AU7A 4M3GA 4UV8A 1X2MA 3L2RA 2UV1A 3GXOA 3L2VA 2LH9A 2O3FA 3S3MA 3BG3A 3ERMA 4U0VA 3BC8A 2VLAA 4HPQA 1TP4A 2KFDA 4UVCA 3OYIA 2K3PA 3M07A 2Z33A 3MWMA 2VL8A 4RB2C 1MJ9A 2CW8A 5ICGA 5IYDJ 4B47A 1YJ9I 1YX3A 2OUMA 1K61A 5HLHA 2V26A 2LRDA 3MQ0A 4BXXJ 2NS7A 2IS1A 1ZN2A 1WI9A 4EM2A 3G1OA 4D7NA 3CCRI 3RTRA 2OF7A 1OKRA 3TBIA 4QIWN 1TWFJ 2DAOA 3QQAA 1XPXA 2QGUA 4CHUA 2XVCA 1MNEA 2CJJA 1REPC 4O5VA 2COBA 3QYEA 1K78B 3GX4X 3S32A 5FB2A 4HRIA 3ASNH 3LNQA 1DU6A 1BIBA 2H8RA 3WE2A 1DPRA 4PJ0C 3WGGA 3HRSA 4QWQA 5HDKA 2XAQA 4FX4A 3SZPA 2HOTA 5D5UB 1I1SA 2F5CA 4BNCA 3EQLF 3P7NA 5D5WB 3IH4A 1W5CC 4EVIA 4XSZF 5F04A 2FD5A 5EJCA 4G6DA 4L9NA 2R93J 2M5WA 3BPXA 3EETA 3I53A 2X6WA 2HZDA 2W1OA 3FISA 4DJAA 1JKQC 3W3CA 1LB2A 5DS9A 2QM3A 4IRHA 5E8IA 4O3MA 3LSTA 3MVPA 4XN3A 3TP3A 4GYIA 2M9HA 3K2ZA 3F21A 1BM9A 4ZDOA 2E1MB 2RQPA 2A07F 5L3CA 3CF5F 1I27A 2VQGA 2ZJRF 3KE2A 1O4XA 1X58A 2BY1A 1UELB 3ZQGA 4UB8C 1IN4A 1DQUA 4Y15A 3S1RJ 2VXZA 2L7MP 3FK6A 3LSKA 2DOEA 3JRHA 4UY8I 2WA0A 3K70D 1P2FA 3CCVI 3TW7A 2Z2SB 1C0WA 1SMYF 3LL7A 5LRSA 1AKHA 2XV4S 5ERIA 1Z05A 1ENHA 2Y0SN 1T33A 1MDMA 1WZ2A 4M3EA 2DMPA 3HGYA 4RS8A 1OCOH 4E70A 5CQEA 2QWWA 2WY7Q 2XAFA 1DU0A 1KONA 4XRSG 3Q0VA 4OWRB 2DPUA 1IW7F 3OSFA 3E5UA 1S9HA 5FROA 2QSFX 4N4NB 3E0JB 4BHCA 2E1OA 3LFUA 3VSKA 1A6QA 4KT6A 3BJ6A 4M9ZA 4XLCA 3TEDA 2GXAA 4QTRA 2HQ5A 2STTA 3J7AO 2YX7A 3OYJA 4A3IJ 3K7AJ 2P7CB 1RR8C 3BZKA 1IO2A 1UHMA 2E1MC 3H35A 4PJNA 4P96A 5BPIA 1UG2A 1D3YA 2ME6A 3H3VK 3ZMZA 1R22A 2L9RA 2XAGA 1VQ8I 3DKXA 1V5FA 2CV0A 3WG9A 3HKZN 4B48A 5CJ9A 3WU1B 4RBOA 2F4IA 4F91B 3HRTA 4Q4ZF 2OD5A 1DPUA 2H1LA 3TMOA 3CO7C 1B1BA 1D1AA 3BWGA 4CUGA 2IS6A 3L2UA 2VKDA 3OWTA 1LFBA 1T56A 2VJ5A 3E5QA 3OS1A 5BS6A 3CC4I 2AQFA 4P1WA 5M5YJ 4YIFA 3JSPA 2HOSA 1KQ0A 1K4SA 3BR0A 1USTA 4F3QA 4HDUA 3ABTA 4XR6A 4BEHB 2I5UA 3W2WA 3FXMA 1FEXA 4OU0A 1T6SA 3SXYA 4FQGA 2DA6A 4Q48A 2KIFA 2EV0A 2PJRA 4C9YA 1BN5A 2DDBA 3G1MA 1YYVA 4I0AA 2JA5J 3ECOA 4WX9A 4XRFA 1TQIA 2HZTA 3U1KA 1FC3A 3IHUA 2ADUA 5DYMA 2L7KA 3EDPA 4A12A 1ORKA 3OV8A 5EGOB 4BBRJ 1ZRCA 2IW5A 3K6GA 2FNAA 2EK5A 3GZ6A 1SFUA 2Q0OA 4NC8A 3KPHA 1X1AA 4FE4A 3DPLC 4RLQA 2VQCA 4B3AA 2HPIA 1T38A 1S7OA 2OC6A 2K5CA 2RV8A 2OA4A 4DIQA 4LLGF 5HLTA 1ONVA 4FASD 5L3FA 1V3FA 3RJPA 2DJNA 1TC3C 2GLOA 3IC7A 1Y39A 1TW3A 2D45A 4CA0A 3IKTA 3HG9A 3RKWA 4XRSA 1YTYA 2GXBA 4U88A 3MEXA 1MJAA 3T8TA 1XGOA 1O3TA 2JJ7A 2Y9YA 3VFZA 4MEXF 3M8FA 5K5QA 1A04A 3LSHA 5FFXA 2V9VA 3BY6A 3I59A 1YJNI 5M3MJ 4PK4A 1WJ5A 4WF2A 4BQOA 2ME0A 2OCCH 5ICFA 1FBUA 4E4HA 4PZJA 4CGZA 3H0DA 3HOXJ 2E71A 1FMVA 1ZLKA 1W4MA 3K0LA 1VQ4I 4E7IA 2MW8A 5ILSA 2WAEA 2MH9A 3ML6A 5J6XA 2VJIA 1S5LC 3HEFA 3KZIC 1VZ0A 1PDNC 1VQ6I 1FSHA 1KZHA 3HPGA 3ECHA 4V2GA 4OIPF 3HB9A 2DI3A 1MD0A 3TP0A 2KISA 4IHWA 3MKLA 1JHFA 4Y4RA 3JRIA 3GTGJ 3QODA 5LFAA 4HBLA 3KIOA 4XLPF 1E3OC 2BW3A 4C3HJ 2R7VA 4C2TA 2ZXIA 4JYKA 1LDKB 2V1XA 2QQBA 2HDDA 1ZG1A 1J09A 3CC7I 3HOYJ 4HAMA 1PP7U 2CYYA 4G9YA 3EUHC 5FLXZ 1ZELA 4U7BA 4C2MJ 1TTYA 2E2HJ 2BY0A 3HSFA 3O3KA 1KQ9A 5EDNA 2VUMJ 3ULQB 4EJWA 3BR5A 2QKLB 5J4YA 1OQYA 1USSA 2QBYB 3HOWJ 3QPLA 3CD6I 5FD6A 1B9MA 1TWGJ 3HOVJ 2CH0A 1LJ9A 1V54H 4NHJA 1LNWA 4GRIA 2CW7A 1S6LA 4CYCA 1XMXA 2J5PA 1B6AA 5CPRB 2R0QC 1ZYRF 2ZJ2A 2RAEA 2LY1A 4NQWB 4F55A 4JK1X 1PUFA 3L7WA 3G3ZA 1XN7A 5ICEA 1L0OC 2MD5A 1QPIA 3EUKL 4IVNA 4B09A 3OIPA 4XNFA 2XGXA 2DA2A 3BG6A 3LSPA 2ICWG 4CO8A 1H9GA 2KHMA 3PSFA 3ZPLA 2DMNA 2RVCA 4XORA 4LK1F 1JGGA 1IRFA 4LFUA 2ELJA 2IVMA 2M8EA 2QQAA 1T39A 3KLNA 4ON0A 1YG2A 1EKEA 4B1RA 3R0AA 4PJJA 2QSHX 2HVRA 3T5XA 1R1TA 1I5ZA 1ZG5A 1X3UA 1DGRM 4HG2A 2Y30A 3GZNB 3TOAA 4IPAA 2EWNA 2LSOA 4WCGA 3MZ8A 1LE8A 2EZKA 4A0ZA 1V55H 2EIJH 1P7JA 2HU9A 3FMRA 2OZ6A 4HQMA 3GTKJ 1ITYA 2DOFA 3OR1C 5CLSA 2OAZA 4LLLA 3K70C 2Z3YA 4OAZA 1R1UA 2PMUA 3R61A 1HKSA 4J19A 1KU2A 2IGKA 5KK1A 4ZYDA 5M5WJ 4BU2A 5JLWA 3EYYA 3KX2A 3FXUA 1OYYA 1YW7A 3U2RA 3F8CA 1EA3A 2JRTA 2LYCA 4H4KC 1O7LA 2TDXA 4XOPA 3K1PA 2W85A 5HDGA 3ZMDA 2E60A 3LSGA 4LK0F 1MH4A 5E3LA 3HL2A 1ZAOA 1B72A 5DM7F 2UUZA 4DQ2A 1JTYA 3FK7A 3BR1A 4P9FA 3G71I 2FEZA 2OTLI 2HWVA 3WU0A 2IAIA 4E6KG 2JMWA 1KYZA 1PJRA 1I1GA 5JFRA 4BKXA 2Y69H 3C2BA 2CUJA 5J1UA 3S8PA 1ETQA 3HUGB 1J9IA 4CDGA 4AIKA 2Z1DA 2D2WA 4YFXF 1ACIA 2CFOA 1R5HA 2Z9OA 2R92J 1D8JA 2DN0A 1O3QA 3DTIA 2DMQA 1Z21A 1VFCA 1LEBA 2LLKA 2K7LA 2OV7A 4FETA 4ZZLA 4E7KA 1SC7A 4IHTA 3IWZA 5J40A 1IN8A 1R1VA 2G9WA 4D7MA 3I58A 3JR9A 3VWBA 3I4MJ 3BTCA 4EMSA 4HLYA 2E7XA 4UHTA 5FLVA 4ESBA 4U0YA 2KIMA 1YJWI 3OYFA 2VQLA 3KYDB 3TW6A 4A2UA 5FKNA 2MD0A 1KU9A 3CUQA 1IUFA 1ETVA 3OYHA 4KMFA 4HZFA 3DP7A 4LMYA 5JVTA 3I4NJ 1EH8A 3DQVC 3G6EI 3KP3A 1CF7B 3AKZA 2L0KA 5E1WA 4XKVA 1LQ1A 1TNSA 2JN6A 2YU9J 1IV6A 1APLC 3PO3J 1OR7C 1X4OA 4B44A 4KYWA 1LDJA 1MBHA 3U21A 2DCEA 3VPRA 1J75A 3T0YA 4LOCA 2HOAA 2G7HA 1K83J 1TBXA 2V9PA 2UWMA 3D5SC 2ZMEA 1R4MB 3JAMK 2E34A 3IRQA 5DDGA 3HYIA 1XCBA 1QHHD 3E3VA 4ENJA 2W4SA 2P6SA 2V9KA 3EUAA 3HOZJ 3GZ5A 4AM3A 4EGYA 2DA7A 2XHKA 5H6RA 2E5NA 2P5VA 3CESA 3L1PA 4Y17A 1GUUA 2VIXA 2LREA 2X4HA 3F8BA 3J81Z 1U8BA 3OL3A 1W36D 4YRVA 2X1CA 5K7ZA 1SD4A 3ESWB 1J5YA 3DF8A 2OJED 4NC7A 5F0CA 4A69C 2AS5F 1FBQA 1YW9A 2L9VA 2LP0A 2MSYA 2V1NA 3PQJA 3HC7A 2C6YA 2VB6A 4A3FJ 1ETYA 4OIQF 1XC5A 3BQYA 3NAUA 4BACA 2FSWA 3ZQIA 1RI7A 2ZC2A 1Z3YA 1JHHA 2HQNA 3QU3A 4KFCA 4G6QA 1IUYA 2P5LC 4V19K 2EPFA 1NHAA 2Q1ZB 4PSWA 3S16J 1HW2A 1P9QC 1TWHJ 4DGWB 2CWEA 5J1RA 1DP7P 1IRGA 1GV2A 1NG7A 1Y8QB 1ETXA 1ZHFA 2ID3A 4MEYF 3H5AA 1U6GA 3CO6C 5J3LA 3NWTA 4ZJZA 4XIDA 3DLAA 1SAUA 1XTAA 5A2QK 2MA3A 3DU5A 2CQQA 1A6IA 4UUSA 3J80Z 2WWYA 2WV0A 5JVGF 3LAPA 2E5ZA 5M5XJ 4I7HA 3B6AA 3JTHA 5EYRA 4II2A 2RREA 3JCUC 1BW5A 3C2HA 2CG4A 1IDYA 3QP5A 1IRXA 4JX6A 2X6YA 4IX7A 1UHSA 3LSIA 4CH7A 1WCMJ 4IQ4A 3IRRA 4KA4A 4ZTFA 1NG6A 1STZA 3FM3A 1JKOC 1HCRA 3EPZA 2L02A 5LGTA 5HLIA 3ZMUA 2EIMH 1ZGWA 3GUDA 2K9MA 1IJWC 3OIOA 4DYCA 2LFBA 3BOQA 4EJTA 2M4KA 2HFHA 3A01B 3QRFF 5L3BA 4E7SA 1WKMA 3BT9A 2CV2A 2LF8A 4BH9A 1R49A 3WTSC 4P55A 2IA2A 5IT9Z 1FT9A 2MBFA 2ZKZA 3TOBA 1L3LA 2DK5A 4YG2F 4HV6A 4A93J 2LKPA 2XAUA 1OCCH 2XF5A 2XGEA 3KYCB 3ZCOA 2R7ZJ 4FX0A 4I0BA 1Z7UA 2XF7A 2GM4A 4M6VA 5GTIC 1IAWA 3WTZA 2J5OA 4HDVA 2VBXA 4IEJA 2HEOA 4CYDA 1K6OA 1X1DA 3AG3H 2X85A 3QAHA 1ODDA 2CQNA 4IKFA 2IP2A 3M1CA 5LGNA 2MFZA 4G6TB 1ZR4A 3SJMA 1YRNA 2FUG2 2A5WA 5LRRA 4B43A 1DDNA 2Y2ZA 4F52A 1WVRA 2L01A 3HOTA 2MC4A 2IGMA 1X1BA 4XONA 2QA4I 3W2VA 1FOYA 3CLQA 2ZSHB 5TGTA
chains in the Genus database with same CATH topology
5HODA 9ANTA 1WI3A 1FEXA 1Z77A 2HXOA 2DA6A 5F08A 1JKPC 1IDZA 2X48A 4AUXA 2HYJA 3BG5A 4UUTA 3G1MA 3BTJA 5E3NA 5M3FJ 1GT0C 1JUPA 3RZDJ 5FKOA 2JA5J 3S2HJ 1SFOJ 1VI0A 1B8IB 1I50J 4B4CA 1ORKA 2AO9A 5EGOB 4BBRJ 3LSRA 3GTQJ 1RKTA 2WV1A 2FX0A 2MG4A 3SFIA 1JTXA 2QF7A 4DYQA 4FE4A 1S7EA 3BR2A 3H0GJ 5IP6A 3NARA 4EEFG 4B3AA 1HDPA 5IPAA 4FCYA 2K9QA 5EZGA 5C3EJ 1POGA 2DMUA 1IGNA 1YRNB 2G0EA 5DTDA 2ECCA 2XGDA 2EZHA 3A03A 4D5CA 2JA7J 2DJNA 1TC3C 2GLOA 4I6ZA 4DW6A 3BR6A 2E2IJ 1U9OA 4XRSA 2VKVA 4M3FA 1MSFC 1MH3A 4FE7A 2KDZA 4JP0A 5EZHA 1ZTRA 2JJ7A 2Y9YA 5IOZA 1JJ8C 2X6OA 2NVTJ 2H1KA 1JUMA 3ZQCA 2LTPA 2FJ1A 2E2JJ 2MGQA 3K2AA 3WHCA 5M3MJ 4X1EA 5FJ8J 1HF0A 3FKIJ 3A02A 2XGCA 3M4OJ 3G1LA 1F43A 2ME0A 3BR3A 3CQZJ 1FTZA 1MBGA 3JRFA 3HOXJ 2NS8A 4HNVA 3S1NJ 3S2DJ 4A3JJ 3S14J 2MW8A 3BTLA 2ZB9A 4DZJA 3HGGA 1JUSA 4AYBN 3HEFA 3M3YJ 1RPWA 2XB0X 4V2GA 3PM1A 4X6AJ 3RKQA 1I3QJ 2LK2A 5GPAA 3HB9A 5F0HA 1H8AC 3TP0A 4IHWA 4MIMA 3SDGA 3MKLA 1B8IA 2EBIA 3JRIA 2GBYA 3GTGJ 1MNMC 3GTJJ 1MBJA 1RKWA 3UKGA 1HOMA 1RR7A 1E3OC 3RQIA 4JX5A 4C3HJ 3HBLA 4Y7NJ 4XK4A 4A3MJ 2CUEA 2M8GX 4JYKA 1R9TJ 2HDDA 3HOYJ 1A5JA 3JRCA 1MBFA 3ZOBA 2EQRA 4C2MJ 2JA6J 2E2HJ 1VNDA 5EDNA 5EF6A 2VUMJ 3JREA 4C3JJ 3BR5A 3CCYA 1FIPA 2ID6A 5FKKA 3HOWJ 3QPLA 2TCTA 1TWGJ 1HDDC 3GTMJ 3HOVJ 2NVXJ 1BJZA 1SANA 2K9NA 1UMQA 1B72B 4CYCA 3LOCA 1W0TA 1ETOA 2R0QC 4GFBA 2JA8J 3GTPJ 2JK3A 1JJ6C 2X9DA 2RAEA 2LKXA 1QVUA 1I6HJ 2M34A 3IV5A 1PUFA 4M3DA 1AHDP 5EG0A 1QPIA 3F0CA 1U9NA 2DA2A 3LSPA 3JRGA 2L7ZA 2DMNA 1JGGA 2DA4A 5F1JA 3GTOJ 3S17J 1OJLA 5IYBJ 2W48A 4B1RA 2Y9ZA 5JLXA 4IHVA 2CRGA 2LY9A 1IC8A 2EZIA 2QCOA 5FLMJ 2R5ZB 2Y30A 1NK2P 2CQXA 1JT6A 3CDLA 4AC0A 1LE8A 2EZKA 2HXIA 4A3CJ 4M3BA 1P7JA 2P81A 1OCTC 3FIWA 2K9SA 1W0UA 2VI6A 3ZQFA 2NVQJ 3GTKJ 2K40A 5FKLA 1ITYA 2O7OA 2DA1A 1WGXA 3IH3A 4XRMA 5E3OA 4FISA 4J19A 2IEKA 2EH3A 1ZKGA 5M5WJ 3OSGA 5JLWA 4CYCB 3HOUJ 1QRYA 3RZOJ 1ETWA 3CMYA 1PUFB 2YUSA 2D5VA 2HI3A 2XB5A 5EG0B 2CU7A 3JRBA 3HDDA 4W97A 3LSGA 1MH4A 2FQ4A 5E3LA 1X2NA 2NVYJ 3LSJA 3B6CA 2WB1N 4BY7J 1B72A 1QVTA 1ZQ3P 1JTYA 3FK7A 3BR1A 3ZQHA 3O8GA 1OCPA 2IAIA 2JMWA 3BG9A 4C3IJ 4BKXA 2IBDA 3C2BA 3D1NI 2L7FP 5J1UA 1ETQA 1BL0A 5E3MA 1LE8B 3IH2A 1VF9A 1MBEA 4NDLA 1H89C 4G12A 1BA5A 2R92J 2DN0A 4V2FA 2DMQA 5F0FA 1VFCA 2XRLA 1WPKA 4I76A 2LLKA 3OOUA 5FKMA 1ZK8A 2R5ZA 3GTLJ 4A3GJ 1OFCX 3JR9A 4D7MA 3S15J 2Y31A 3I4MJ 4BY1J 3BTCA 4MLOA 1JT0A 5FLVA 2DMTA 2R5YA 4ABZA 1XS9A 4A3KJ 1NK3P 3DCFA 3TW6A 2LR8A 5FKNA 1GDTA 1IUFA 1ETVA 4RDUA 5GPCA 1D5YA 3BTIA 4W1UA 2ELKA 3I4NJ 3PO2J 4A3DJ 2CUFA 4MFEA 3Q0WA 2L0KA 1NTCA 4S0HB 5GP9A 2JN6A 1AU7A 2KT0A 4M3GA 3ZQLA 1X2MA 1IV6A 2YU9J 1F36A 4BBSJ 1APLC 3PO3J 5C44J 4JX4A 3BG3A 3WHBA 2LD5A 1P7IA 1MBHA 3Q0UA 3VPRA 5F27A 4DZPA 3O8HA 2VPRA 4DYRA 3E7LA 4LOCA 5IYDJ 2HOAA 4IHXA 1K61A 1K83J 1XG1A 4A3LJ 4BXXJ 2NS7A 2JWTA 1GVDA 3G1OA 4D7NA 2OF7A 4QIWN 1TWFJ 3QQAA 1G2HA 2CJJA 3HOZJ 1FTTA 2COBA 2DA7A 5K7HA 3L1PA 1GUUA 3LNQA 1U8BA 1DU6A 2H8RA 2R5YB 5K7ZA 4XICA 2N8GA 2ECBA 1IRZA 5F0CA 4A69C 3BQZA 3GBGA 2HOTA 3A01A 2LP0A 2MSYA 3S1MJ 3IH4A 1ETYA 4A3FJ 1XC5A 3BQYA 2FD5A 3NAUA 5F04A 5J1YA 3ZQIA 3JRAA 2R93J 1Y1WJ 3FISA 3JRDA 1JKQC 3DEWA 5DS9A 3HM5A 3MN2A 3S16J 3MVPA 1TWHJ 1Z0XA 5J1RA 5C4XJ 3TP3A 5C4JJ 1GV2A 2ID3A 1ETXA 2M9HA 2XPUA 2LVSA 5J3LA 4XIDA 1LFUP 1O4XA 1X58A 3S1QJ 3ZQGA 2O8KA 2CQQA 4D5FA 1A6IA 4UUSA 2I10A 2WAQN 3S1RJ 1JKRC 1WH5A 2L7MP 5M5XJ 3FK6A 3JRHA 2DTZA 3B6AA 5EYRA 2AHQA 5IP9J 1CQTA 3TW7A 1BW5A 4A3BJ 5K7FA 1IDYA 2XPWA 4JX6A 1AKHA 1UHSA 1WCMJ 1IG7A 2OPTA 1ENHA 2Y0SN 1JKOC 2VKEA 1HCRA 1T33A 4M3EA 2DMPA 3HGYA 1U78A 1HLVA 1ZGWA 2NOGA 4MO7A 1DU0A 4XRSG 1IJWC 3OIOA 4DYCA 2LFBA 5IYCJ 3Q0VA 1FJLA 2PMZN 2M2EA 3A01B 3OSFA 2TRTA 1FIAA 1GV5A 2EZLA 3BT9A 3Q3SA 1TWCJ 2E1OA 1BW6A 3TEDA 3QPSA 1Q1VA 5BNGA 4QTRA 2HQ5A 1RETA 4Y52J 2DA5A 2O9LA 4A3IJ 4A93J 3K7AJ 2M0CA 4IHYA 2XGEA 3W6VA 2R7ZJ 5EGOA 2XSDC 2B63J 1UG2A 2ME6A 2GM4A 4M6VA 3H3VK 2E19A 2L9RA 2YS9A 1H88C 1EF4A 4IEJA 3HKZN 5EEAA 4RBOA 1ETKA 4QSHA 4A3EJ 2XPVA 1TWAJ 4UUSB 5IP7J 1WH7A 4FTHA 1MBKA 1ZR4A 3SJMA 1Y1VJ 2DA3A 1LFBA 1YRNA 1T56A 1RESA 4L5EA 1ZR2A 5M5YJ 2Y2ZA 5IOYA 2HOSA 4MFDA 1AKHB 1MSEC 3BR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HOD A;  9ANT A;  1WI3 A;  1FEX A;  1Z77 A;  2HXO A;  2DA6 A;  5F08 A;  1JKP C;  1IDZ A;  2X48 A;  4AUX A;  2HYJ A;  3BG5 A;  4UUT A;  3G1M A;  3BTJ A;  5E3N A;  5M3F J;  1GT0 C;  1JUP A;  3RZD J;  5FKO A;  2JA5 J;  3S2H J;  1SFO J;  1VI0 A;  1B8I B;  1I50 J;  4B4C A;  1ORK A;  2AO9 A;  5EGO B;  4BBR J;  3LSR A;  3GTQ J;  1RKT A;  2WV1 A;  2FX0 A;  2MG4 A;  3SFI A;  1JTX A;  2QF7 A;  4DYQ A;  4FE4 A;  1S7E A;  3BR2 A;  3H0G J;  5IP6 A;  3NAR A;  4EEF G;  4B3A A;  1HDP A;  5IPA A;  4FCY A;  2K9Q A;  5EZG A;  5C3E J;  1POG A;  2DMU A;  1IGN A;  1YRN B;  2G0E A;  5DTD A;  2ECC A;  2XGD A;  2EZH A;  3A03 A;  4D5C A;  2JA7 J;  2DJN A;  1TC3 C;  2GLO A;  4I6Z A;  4DW6 A;  3BR6 A;  2E2I J;  1U9O A;  4XRS A;  2VKV A;  4M3F A;  1MSF C;  1MH3 A;  4FE7 A;  2KDZ A;  4JP0 A;  5EZH A;  1ZTR A;  2JJ7 A;  2Y9Y A;  5IOZ A;  1JJ8 C;  2X6O A;  2NVT J;  2H1K A;  1JUM A;  3ZQC A;  2LTP A;  2FJ1 A;  2E2J J;  2MGQ A;  3K2A A;  3WHC A;  5M3M J;  4X1E A;  5FJ8 J;  1HF0 A;  3FKI J;  3A02 A;  2XGC A;  3M4O J;  3G1L A;  1F43 A;  2ME0 A;  3BR3 A;  3CQZ J;  1FTZ A;  1MBG A;  3JRF A;  3HOX J;  2NS8 A;  4HNV A;  3S1N J;  3S2D J;  4A3J J;  3S14 J;  2MW8 A;  3BTL A;  2ZB9 A;  4DZJ A;  3HGG A;  1JUS A;  4AYB N;  3HEF A;  3M3Y J;  1RPW A;  2XB0 X;  4V2G A;  3PM1 A;  4X6A J;  3RKQ A;  1I3Q J;  2LK2 A;  5GPA A;  3HB9 A;  5F0H A;  1H8A C;  3TP0 A;  4IHW A;  4MIM A;  3SDG A;  3MKL A;  1B8I A;  2EBI A;  3JRI A;  2GBY A;  3GTG J;  1MNM C;  3GTJ J;  1MBJ A;  1RKW A;  3UKG A;  1HOM A;  1RR7 A;  1E3O C;  3RQI A;  4JX5 A;  4C3H J;  3HBL A;  4Y7N J;  4XK4 A;  4A3M J;  2CUE A;  2M8G X;  4JYK A;  1R9T J;  2HDD A;  3HOY J;  1A5J A;  3JRC A;  1MBF A;  3ZOB A;  2EQR A;  4C2M J;  2JA6 J;  2E2H J;  1VND A;  5EDN A;  5EF6 A;  2VUM J;  3JRE A;  4C3J J;  3BR5 A;  3CCY A;  1FIP A;  2ID6 A;  5FKK A;  3HOW J;  3QPL A;  2TCT A;  1TWG J;  1HDD C;  3GTM J;  3HOV J;  2NVX J;  1BJZ A;  1SAN A;  2K9N A;  1UMQ A;  1B72 B;  4CYC A;  3LOC A;  1W0T A;  1ETO A;  2R0Q C;  4GFB A;  2JA8 J;  3GTP J;  2JK3 A;  1JJ6 C;  2X9D A;  2RAE A;  2LKX A;  1QVU A;  1I6H J;  2M34 A;  3IV5 A;  1PUF A;  4M3D A;  1AHD P;  5EG0 A;  1QPI A;  3F0C A;  1U9N A;  2DA2 A;  3LSP A;  3JRG A;  2L7Z A;  2DMN A;  1JGG A;  2DA4 A;  5F1J A;  3GTO J;  3S17 J;  1OJL A;  5IYB J;  2W48 A;  4B1R A;  2Y9Z A;  5JLX A;  4IHV A;  2CRG A;  2LY9 A;  1IC8 A;  2EZI A;  2QCO A;  5FLM J;  2R5Z B;  2Y30 A;  1NK2 P;  2CQX A;  1JT6 A;  3CDL A;  4AC0 A;  1LE8 A;  2EZK A;  2HXI A;  4A3C J;  4M3B A;  1P7J A;  2P81 A;  1OCT C;  3FIW A;  2K9S A;  1W0U A;  2VI6 A;  3ZQF A;  2NVQ J;  3GTK J;  2K40 A;  5FKL A;  1ITY A;  2O7O A;  2DA1 A;  1WGX A;  3IH3 A;  4XRM A;  5E3O A;  4FIS A;  4J19 A;  2IEK A;  2EH3 A;  1ZKG A;  5M5W J;  3OSG A;  5JLW A;  4CYC B;  3HOU J;  1QRY A;  3RZO J;  1ETW A;  3CMY A;  1PUF B;  2YUS A;  2D5V A;  2HI3 A;  2XB5 A;  5EG0 B;  2CU7 A;  3JRB A;  3HDD A;  4W97 A;  3LSG A;  1MH4 A;  2FQ4 A;  5E3L A;  1X2N A;  2NVY J;  3LSJ A;  3B6C A;  2WB1 N;  4BY7 J;  1B72 A;  1QVT A;  1ZQ3 P;  1JTY A;  3FK7 A;  3BR1 A;  3ZQH A;  3O8G A;  1OCP A;  2IAI A;  2JMW A;  3BG9 A;  4C3I J;  4BKX A;  2IBD A;  3C2B A;  3D1N I;  2L7F P;  5J1U A;  1ETQ A;  1BL0 A;  5E3M A;  1LE8 B;  3IH2 A;  1VF9 A;  1MBE A;  4NDL A;  1H89 C;  4G12 A;  1BA5 A;  2R92 J;  2DN0 A;  4V2F A;  2DMQ A;  5F0F A;  1VFC A;  2XRL A;  1WPK A;  4I76 A;  2LLK A;  3OOU A;  5FKM A;  1ZK8 A;  2R5Z A;  3GTL J;  4A3G J;  1OFC X;  3JR9 A;  4D7M A;  3S15 J;  2Y31 A;  3I4M J;  4BY1 J;  3BTC A;  4MLO A;  1JT0 A;  5FLV A;  2DMT A;  2R5Y A;  4ABZ A;  1XS9 A;  4A3K J;  1NK3 P;  3DCF A;  3TW6 A;  2LR8 A;  5FKN A;  1GDT A;  1IUF A;  1ETV A;  4RDU A;  5GPC A;  1D5Y A;  3BTI A;  4W1U A;  2ELK A;  3I4N J;  3PO2 J;  4A3D J;  2CUF A;  4MFE A;  3Q0W A;  2L0K A;  1NTC A;  4S0H B;  5GP9 A;  2JN6 A;  1AU7 A;  2KT0 A;  4M3G A;  3ZQL A;  1X2M A;  1IV6 A;  2YU9 J;  1F36 A;  4BBS J;  1APL C;  3PO3 J;  5C44 J;  4JX4 A;  3BG3 A;  3WHB A;  2LD5 A;  1P7I A;  1MBH A;  3Q0U A;  3VPR A;  5F27 A;  4DZP A;  3O8H A;  2VPR A;  4DYR A;  3E7L A;  4LOC A;  5IYD J;  2HOA A;  4IHX A;  1K61 A;  1K83 J;  1XG1 A;  4A3L J;  4BXX J;  2NS7 A;  2JWT A;  1GVD A;  3G1O A;  4D7N A;  2OF7 A;  4QIW N;  1TWF J;  3QQA A;  1G2H A;  2CJJ A;  3HOZ J;  1FTT A;  2COB A;  2DA7 A;  5K7H A;  3L1P A;  1GUU A;  3LNQ A;  1U8B A;  1DU6 A;  2H8R A;  2R5Y B;  5K7Z A;  4XIC A;  2N8G A;  2ECB A;  1IRZ A;  5F0C A;  4A69 C;  3BQZ A;  3GBG A;  2HOT A;  3A01 A;  2LP0 A;  2MSY A;  3S1M J;  3IH4 A;  1ETY A;  4A3F J;  1XC5 A;  3BQY A;  2FD5 A;  3NAU A;  5F04 A;  5J1Y A;  3ZQI A;  3JRA A;  2R93 J;  1Y1W J;  3FIS A;  3JRD A;  1JKQ C;  3DEW A;  5DS9 A;  3HM5 A;  3MN2 A;  3S16 J;  3MVP A;  1TWH J;  1Z0X A;  5J1R A;  5C4X J;  3TP3 A;  5C4J J;  1GV2 A;  2ID3 A;  1ETX A;  2M9H A;  2XPU A;  2LVS A;  5J3L A;  4XID A;  1LFU P;  1O4X A;  1X58 A;  3S1Q J;  3ZQG A;  2O8K A;  2CQQ A;  4D5F A;  1A6I A;  4UUS A;  2I10 A;  2WAQ N;  3S1R J;  1JKR C;  1WH5 A;  2L7M P;  5M5X J;  3FK6 A;  3JRH A;  2DTZ A;  3B6A A;  5EYR A;  2AHQ A;  5IP9 J;  1CQT A;  3TW7 A;  1BW5 A;  4A3B J;  5K7F A;  1IDY A;  2XPW A;  4JX6 A;  1AKH A;  1UHS A;  1WCM J;  1IG7 A;  2OPT A;  1ENH A;  2Y0S N;  1JKO C;  2VKE A;  1HCR A;  1T33 A;  4M3E A;  2DMP A;  3HGY A;  1U78 A;  1HLV A;  1ZGW A;  2NOG A;  4MO7 A;  1DU0 A;  4XRS G;  1IJW C;  3OIO A;  4DYC A;  2LFB A;  5IYC J;  3Q0V A;  1FJL A;  2PMZ N;  2M2E A;  3A01 B;  3OSF A;  2TRT A;  1FIA A;  1GV5 A;  2EZL A;  3BT9 A;  3Q3S A;  1TWC J;  2E1O A;  1BW6 A;  3TED A;  3QPS A;  1Q1V A;  5BNG A;  4QTR A;  2HQ5 A;  1RET A;  4Y52 J;  2DA5 A;  2O9L A;  4A3I J;  4A93 J;  3K7A J;  2M0C A;  4IHY A;  2XGE A;  3W6V A;  2R7Z J;  5EGO A;  2XSD C;  2B63 J;  1UG2 A;  2ME6 A;  2GM4 A;  4M6V A;  3H3V K;  2E19 A;  2L9R A;  2YS9 A;  1H88 C;  1EF4 A;  4IEJ A;  3HKZ N;  5EEA A;  4RBO A;  1ETK A;  4QSH A;  4A3E J;  2XPV A;  1TWA J;  4UUS B;  5IP7 J;  1WH7 A;  4FTH A;  1MBK A;  1ZR4 A;  3SJM A;  1Y1V J;  2DA3 A;  1LFB A;  1YRN A;  1T56 A;  1RES A;  4L5E A;  1ZR2 A;  5M5Y J;  2Y2Z A;  5IOY A;  2HOS A;  4MFD A;  1AKH B;  1MSE C;  3BR0 A; 
#chains in the Genus database with same CATH topology
 3CZ6 A;  2KQR A;  4N9I A;  2HXO A;  4YFN F;  1JKP C;  4RAG A;  4AUX A;  2HYJ A;  3K4N A;  2IRF G;  4BQA A;  4D0P A;  1HC8 A;  3BTJ A;  2CUZ A;  1J0R A;  3VYT B;  3S2H J;  4M9X A;  2V6C A;  3WTV C;  4BS9 A;  2HVQ A;  3K1N A;  2NAZ A;  3C7J A;  1IN7 A;  2LOO A;  5J8C A;  1P6R A;  3GO5 A;  1VI0 A;  1I50 J;  4L5I A;  3B02 A;  4XLE A;  4A6E A;  4UVB A;  2ZNY A;  1FOK A;  3GFI A;  2P5K A;  3QOP A;  1OMI A;  2A05 A;  3LSR A;  1V4R A;  1RKT A;  4YEJ A;  3GTQ J;  2WV1 A;  2FX0 A;  2UXX A;  2MG4 A;  3SFI A;  4XKW A;  5IP6 A;  4II3 A;  4DYQ A;  4XL9 A;  1YIO A;  1WJA A;  3GWZ A;  1HDP A;  1ZH5 A;  4ZYE A;  2VOO A;  3PUF A;  4HV5 A;  2K9Q A;  2QUF A;  2Z16 A;  5C3E J;  4KIS A;  2G0E A;  5DTD A;  4IXA A;  3OS0 A;  1Z6T A;  2KP6 A;  2DYR H;  1G6N A;  2XGD A;  3TKY A;  3A03 A;  4D5C A;  1XGM A;  2EV5 A;  3I56 I;  1T2K A;  4MGR A;  4E7L A;  4BUP A;  3A4C A;  3BR6 A;  4CXF A;  1Y8R B;  1U9O A;  2JVH A;  2VKV A;  1BC7 C;  2OQR A;  4G7Z F;  1MSF C;  1TT0 A;  2ZJP F;  2WBM A;  1TQP A;  1MKM A;  2R7D A;  5EZH A;  2QKM B;  3HXL A;  1JI8 A;  4OIR F;  3OYB A;  2K86 A;  1JUM A;  2P6T A;  3C1D A;  3ZQC A;  1YIT I;  2V1U A;  5GAE J;  1LVK A;  3L09 A;  5EEG A;  1R7J A;  2CSO A;  3K2A A;  3P9I A;  3WHC A;  1Z1D A;  5GAD J;  5CVR A;  1HF0 A;  4BE1 A;  4BJ5 C;  4PDK A;  3WGI A;  1TZL A;  2GA1 A;  3PNT A;  2XGC A;  2OBP A;  2R7X A;  2O61 A;  2W7N A;  1BR4 A;  3UNG C;  3AAF A;  4HNV A;  1O3S A;  2STW A;  3S2D J;  1U5T A;  3BP8 A;  4A3J J;  3S14 J;  1E3H A;  2ZB9 A;  1D0X A;  5LHG A;  4XMY A;  1QGP A;  1JUS A;  1W7P D;  5F6F A;  2O8X A;  1TT5 B;  3CCM I;  3H5N A;  4X6A J;  3HHG A;  3DKW A;  2FE3 A;  2H09 A;  5GPA A;  1EV7 A;  2DW4 A;  3WTX C;  1BC8 C;  1WQ2 A;  2BXY A;  2EBI A;  2EFO A;  3GFL A;  1R00 A;  4GO1 A;  1MBJ A;  4HF0 A;  3UKG A;  1HOM A;  5BOX A;  5CYV A;  1AOY A;  4E7Z A;  3HBL A;  3OYL A;  1Z67 A;  3IL2 A;  4HSR A;  4Y7N J;  2X51 A;  4A3M J;  1BI1 A;  2CUE A;  3UR3 C;  3S3N A;  2M8G X;  1R9T J;  2HDW A;  1XGS A;  4EGZ A;  1TL8 A;  3V8L A;  3FXJ A;  4Y3O A;  3CCL I;  2OTJ I;  1ZLJ A;  3FKJ A;  1MMD A;  1VQK I;  1MBF A;  3ZOB A;  4CZC A;  2YSR A;  3HJE A;  4BYY A;  1NH3 A;  4OMZ A;  2JZY A;  3JW4 A;  3DEE A;  4BL0 B;  1JXS A;  2DJI A;  1Z3X A;  5CKT A;  2L2O A;  5D6F A;  3VOE A;  3I9V 2;  3OYK A;  3GTM J;  1HDD C;  2ELH A;  2NVX J;  2EJR A;  2MLK A;  5D5V B;  1B72 B;  2IS4 A;  4O6J A;  5KHD A;  1UAA A;  3LOC A;  4LIT A;  2F6C A;  2JA8 J;  3ZQQ A;  2JK3 A;  5HVQ C;  1QVU A;  4ASN A;  3DBL B;  2YR2 A;  4I98 B;  1KU7 A;  2VXD A;  3QPT A;  5F1R A;  5EG0 A;  2UZK A;  5FRM A;  4LLN A;  1RUO A;  3JRG A;  3D5R C;  2WC2 A;  4EJU A;  4M71 A;  4UXN A;  4ZC3 A;  4UUV A;  1P4W A;  2LY2 A;  3ZGK A;  5F1J A;  2ESH A;  3GTO J;  3K4L A;  3K10 A;  3S17 J;  4XM3 A;  3CCS I;  5ICC A;  2IS2 A;  2Y9Z A;  5JLX A;  4KIC A;  2LY9 A;  3DU6 A;  1IC8 A;  2EB7 A;  2EZI A;  2KKO A;  2QCO A;  5E17 F;  2HYG D;  2CQX A;  1JT6 A;  4LJZ F;  1SMT A;  1H9T A;  3CDL A;  1BI2 A;  2VBW A;  2JT1 A;  1M1E B;  2GWR A;  2HTJ A;  4NB5 A;  3V7R A;  4BAY A;  3NQO A;  2P81 A;  4UB6 C;  1OCT C;  2K9S A;  3FMQ A;  1W0U A;  5LEJ A;  2MAB A;  3N4M A;  3ZXS A;  1GHC A;  1F9N A;  2LNB A;  5D8K B;  4GCV A;  4CCK A;  2DA1 A;  3I5U A;  3RYP A;  2X1D A;  4FIS A;  1I3A A;  4JOM A;  5DCF A;  2EH3 A;  1ZKG A;  3QYF A;  2XAS A;  1U0J A;  3K69 A;  3O2P E;  4PGG A;  1GXP A;  1FYK A;  4KIF A;  3RZO J;  3GLX A;  2YUS A;  2HI3 A;  1T0F C;  2CU7 A;  2GOX B;  1HA8 A;  1I6X A;  2XAJ A;  3H9J A;  2Q8K A;  2NNY A;  3JRB A;  2JTV A;  4BXU A;  1G3W A;  2F5F A;  3TDZ C;  4AVP A;  2Z99 A;  4AYB A;  3ZMS A;  2R4G A;  3E6D A;  3J7Z I;  2LBF A;  3ZQH A;  3OYE A;  2IPQ X;  3BCA A;  1G3S A;  3O8G A;  4WXH A;  2LG4 A;  2OU2 A;  4GDF A;  4DBQ A;  3BG9 A;  3CJQ B;  2FMY A;  2RC4 A;  5DV5 A;  3K4J A;  1XX5 A;  4I02 A;  3D1N I;  3MAJ A;  2ZFW A;  2KDO A;  5E3M A;  3PUB A;  2EFP A;  3F23 A;  1G4D A;  2VQH A;  2EFW A;  1H89 C;  2VJ4 A;  4BQN A;  1BA5 A;  2P4W A;  4EM0 B;  3IKV A;  1VQL I;  5J4V A;  5F0F A;  1SAX A;  4RM3 A;  3V8J A;  2CFX A;  2XRL A;  1HKQ A;  3LFK A;  2FOK A;  3R6S A;  4WK8 F;  5ILV A;  2R5Z A;  4A3G J;  2BYV E;  1K78 A;  3F9K A;  1J7K A;  4OIN F;  4MLO A;  4EQQ A;  3WTY C;  1JT0 A;  5H6Q A;  1V5E A;  3I71 A;  3IAM 2;  4ZYA A;  4A3K J;  4Y33 A;  2H27 A;  5LHI A;  2BEO A;  3DCF A;  1ON1 A;  3S3O A;  2NOJ B;  2LR8 A;  3RDI A;  3FXR A;  1JE8 A;  4RDU A;  3MZY A;  3P5J A;  1R5I D;  1D5Y A;  3PIO F;  2D1V A;  3NWS A;  3CDI A;  4A3D J;  3BPV A;  2XC7 A;  5HOO A;  4MFE A;  1N78 A;  1UFM A;  2IA0 A;  4S0H B;  4A0Y A;  5DEQ A;  3BDD A;  5GP9 A;  4ZTJ A;  4ENK A;  4XSX F;  4OAY A;  5D4R A;  5DUI A;  2F5D A;  3ABK H;  2DFH A;  5C44 J;  4JX4 A;  3C18 A;  4ZDP A;  1BIA A;  1LPQ A;  3IWF A;  2A3S A;  3S93 A;  1IXS B;  3Q0U A;  3GVA A;  1FOX A;  1LEA A;  3L9F A;  4YIR X;  3FHZ A;  4DZP A;  3O8H A;  2VPR A;  1K4T A;  2H6B A;  5CVU A;  4IHX A;  2BHZ A;  3CCQ I;  2EA2 A;  1XG1 A;  1W7P B;  2JWT A;  2KZV A;  4QPQ A;  4PFP A;  3MZH A;  3VYS B;  2B0L A;  1G2H A;  3MKY B;  1ZGA A;  2VC0 A;  5LHH A;  3NEU A;  1VQ5 I;  1FTT A;  4AD9 A;  3DPU A;  5K7H A;  4UVA A;  2VN2 A;  5LD2 C;  2M87 A;  2KZG A;  1X3W B;  2W57 A;  4LG0 A;  2F4O B;  4XIC A;  5GAH J;  2R5Y B;  3MFK A;  3F6O A;  4HX8 A;  1HST A;  3RKY A;  3BQZ A;  3H92 A;  2ZXJ A;  3GBG A;  1Z6R A;  3FMS A;  2Z5U A;  5JR3 A;  3CLO A;  1YOV B;  3S1M J;  2CW0 F;  2V1D A;  3DFG A;  5K1Y A;  1IZ1 A;  2KLO A;  3E97 A;  5J1Y A;  3JRA A;  4KJZ A;  3KP7 A;  4E7J A;  2XKO A;  1XMA A;  1MMA A;  3CC2 I;  4KN4 X;  3MN2 A;  4RLF A;  1Z0X A;  4ZYH A;  3IAS 2;  3I54 A;  2EFN A;  2XPU A;  2QZ8 A;  2CQ7 A;  1FOW A;  1Z7L A;  4M74 A;  3HHH A;  3CP8 A;  2O6G E;  3S1Q J;  2GIV A;  2O8K A;  4D5F A;  3CP2 A;  2XDV A;  2I10 A;  3QWL A;  4U0W A;  2ZO4 A;  2R7F A;  3ABL H;  1G59 A;  2DTZ A;  5IP9 J;  2AHQ A;  1CQT A;  3BZC A;  3P9C A;  2B7E A;  4KIT B;  5K7F A;  4A3B J;  1QO0 D;  2XPW A;  2WAD A;  2CGP A;  1IG7 A;  5JI6 A;  2XIG A;  2QEN A;  5DM6 F;  3FXO A;  3CMA I;  2VON A;  3VOD A;  1FY7 A;  5JHF A;  3G73 A;  3SEZ A;  5L3G A;  3N97 A;  1HLV A;  2PX9 A;  2NOG A;  4MO7 A;  5BQT A;  5HDN A;  3VYU B;  2MLG A;  2QSG X;  3FZV A;  1FJL A;  2DDA A;  2MYS A;  1E0E A;  4IO9 F;  2TRT A;  2A6H F;  1GV5 A;  2EIN H;  2HKO A;  4GYG A;  2BBY A;  4B8X A;  3Q3S A;  4F93 B;  2WAF A;  6PAX A;  3QPS A;  1Q1V A;  4TV7 A;  4Y52 J;  1OLT A;  2DA5 A;  5E18 F;  2O9L A;  4AIJ A;  4YEL A;  4RGS A;  2LMD A;  3K4B A;  3W6V A;  2HGC A;  3KLO A;  4AU7 A;  1SD5 A;  4L0Z B;  5EGO A;  4R8H A;  5DCM A;  3DWL E;  5F64 A;  2PI0 A;  4HNT A;  1A36 A;  1MMN A;  2B63 J;  5E1Z B;  4D9J A;  3V42 A;  2FA5 A;  2P8T A;  1X4P A;  2NYX A;  2R3S A;  3FWE A;  3KEY A;  2KIU A;  3M9A A;  5EEA A;  4QSH A;  3KP5 A;  4GGG A;  1WJF A;  2F2E A;  2XPV A;  5IP7 J;  1WH7 A;  3ABU A;  2AQE A;  1MBK A;  5AIP A;  3B73 A;  3F72 A;  3FHN A;  1Y1V J;  2DA3 A;  3FF5 A;  2HVS A;  2A6E F;  4PGH A;  1O3R A;  3PSI A;  4L5E A;  1ZR2 A;  1OIS A;  2O03 A;  3HPH A;  4XKB A;  2NS0 A;  5IOY A;  4MFD A;  3KYL A;  1AKH B;  2D1H A;  3CTA A;  3OIQ A;  2PLY A;  1E2X A;  1RRJ A;  2OCE A;  1FMW A;  1YFH A;  1SD6 A;  5HS9 A;  1MDM B;  1WI3 A;  3IP4 B;  3OYC A;  3ELK A;  3M1E A;  5F08 A;  1IDZ A;  3LWF A;  4M73 A;  4HNU A;  2P0W A;  2X48 A;  3H9G A;  5LBQ A;  2QYO A;  3OYA A;  3VDX A;  1GT0 C;  1XSD A;  1U3E M;  2R7W A;  1JUP A;  3RZD J;  3EUH A;  2XSJ C;  5FKO A;  5H20 A;  2PG4 A;  1SFO J;  2DOD A;  2DOA A;  4HQE A;  1J2X A;  4L9J A;  3CDH A;  2H6C A;  3BJA A;  2Q2E A;  4LB6 B;  1XSX A;  3WOD F;  3AG2 H;  3G4S I;  3R60 A;  1N75 A;  3VYR B;  4BHB A;  2BHY A;  2CS3 A;  1BI0 A;  3OL4 A;  1CGP A;  3Q9S A;  4HST A;  3SHF A;  1YIJ I;  2F5E A;  2QF7 A;  3H0G J;  3AL0 B;  3NAR A;  1R5G A;  3ABM H;  4EEF G;  2PMH A;  2IT0 A;  2JUG A;  1FP1 D;  3FDY A;  4A6D A;  2L4M A;  1BR1 A;  4Y13 A;  3KZY A;  1POG A;  3I4P A;  2DFI A;  2ECC A;  4RB3 C;  4ANJ A;  1FPQ A;  1W5T A;  2EZH A;  3OYD A;  4DBR A;  4RAZ A;  4EV0 A;  4XQF A;  1FWZ A;  4XLN F;  1MH3 A;  3RSN A;  4RA2 A;  4FE7 A;  4Z6Y A;  1ON2 A;  1ZTR A;  4WXC A;  4BHP A;  3BJO A;  1X19 A;  2PJR B;  4ESJ A;  1S7A A;  2NVT J;  2ISZ A;  2H1K A;  4KUM A;  3M8E A;  2FJ1 A;  5LGU A;  3MKW B;  1G3T A;  3A0H C;  1WFX A;  4DOZ A;  1Z9C A;  2KJC A;  4X1E A;  5FJ8 J;  1MMS A;  2VAS A;  2QBY A;  4K2E A;  3SFZ A;  2ISY A;  5IY5 H;  2PJP A;  1R58 A;  2GQQ A;  2NXN B;  2OZU A;  3CQZ J;  1LDD A;  1FTZ A;  4CIC A;  2JPC A;  2NS8 A;  1SVL A;  4RB0 A;  4U87 A;  3S1N J;  3PL8 A;  2RN7 A;  4N9H A;  3AL0 C;  2RGV A;  3BTL A;  1GXQ A;  3HGG A;  4NQW A;  1PYV A;  4BQQ A;  2JVG A;  1RPW A;  2A61 A;  2XB0 X;  3PM1 A;  1SFK A;  3GFJ A;  2ZCW A;  2LC2 A;  5F0H A;  1BBY A;  5DD4 A;  4MIM A;  3SDG A;  2XRO A;  1B8I A;  1FBS A;  3SQN A;  4BE0 A;  3FXQ A;  3HKZ A;  3QPH A;  1P4X A;  4OIO F;  2NNN A;  1RR7 A;  2WTE A;  1OCZ H;  4JX5 A;  5D4S A;  1KA8 A;  3HSR A;  2LDU A;  4IF4 A;  1MND A;  3DEU A;  4XK4 A;  2V6E A;  2XKP A;  1DGW Y;  4LIU A;  4KIG A;  4A0X A;  3GME A;  1ZGJ A;  1A5J A;  5AON A;  3ZN0 A;  2FBI A;  2L4A A;  5HLG A;  1O57 A;  2DT5 A;  3GLL A;  5B1B H;  1VQ9 I;  1F1Z A;  4IHS A;  2EA4 A;  3I59 B;  5B5E C;  5EF6 A;  3JRE A;  1HBX G;  3D5L A;  2A5Y B;  2H8W A;  2JUC A;  3AG1 H;  2F48 A;  3WTU C;  1FZP B;  2ZBK A;  3CCY A;  1FIP A;  5BPD A;  4QPO A;  4IOA F;  1EJ9 A;  5FKK A;  1TLH B;  3O6B B;  1D1C A;  2R7S A;  1BJZ A;  5H2F C;  2K9N A;  1UMQ A;  3RCO A;  5FO5 A;  2DBB A;  1KQ8 A;  2FNP A;  1TNT A;  4E7H A;  3GTP J;  1JJ6 C;  5KNL A;  1LUJ B;  2X9D A;  2DLL A;  2LKX A;  3DBH B;  2M34 A;  2GZW A;  3IV5 A;  2K4B A;  4M3D A;  3RYR A;  3KFW X;  4P5O A;  1U9N A;  3DTE A;  3H1C A;  3DPT A;  2RNJ A;  3F8M A;  3PNV A;  1PP8 F;  1YS6 A;  4IRG A;  2IXS A;  2RKH A;  3N05 A;  2DA4 A;  2O5R A;  2FU4 A;  5E79 C;  5CQG A;  1OJL A;  2BW3 B;  2FF4 A;  4RAF A;  2KRC A;  3OYG A;  2M1B A;  5ED4 A;  4IHV A;  2R7Q A;  2FOW A;  3TO7 A;  2VBZ A;  2CRG A;  4I01 A;  1VQM I;  4KIB A;  2R5Z B;  4M9S A;  1NK2 P;  2XF6 A;  3ONQ A;  1OR7 A;  3HUG A;  4XOT A;  1Y0U A;  4AC0 A;  4NNJ A;  5K5R A;  3JTG A;  2M0M A;  4M3B A;  1WSU A;  4A3C J;  5L3D A;  4G7O F;  3FIW A;  1FSE A;  2DXI A;  1KYW A;  2AXL A;  4ZH4 F;  5HS7 A;  2K85 A;  4XLF A;  2WAQ A;  1K79 A;  3R0J A;  5FKL A;  1IV8 A;  5IT3 A;  2O7O A;  3FXL A;  2HOE A;  3HIF A;  3IH3 A;  1UZC A;  5E3O A;  2BOL A;  4LD5 A;  2IEK A;  1ZAR A;  2M30 A;  4CYC B;  3HOU J;  5J47 A;  1X3Z B;  4HEA 2;  3I64 A;  1QBJ A;  1ETW A;  3KEO A;  2Y0M A;  1V5G A;  3CMY A;  1T08 B;  1PUF B;  2D5V A;  1N77 A;  3TL4 X;  5D8L B;  4N4O B;  4S05 A;  2PMZ A;  4HOB A;  4M72 A;  2DT6 A;  2Y75 A;  4W97 A;  3I3L A;  2R7R A;  1X2N A;  3K4M A;  2NVY J;  3LSJ A;  4BY7 J;  1ZQ3 P;  1QPM A;  3LQQ A;  1CF7 A;  2EFQ A;  1N25 A;  3D0S A;  2VT2 A;  4NBQ A;  1QZZ A;  2JSC A;  2M7B A;  4IRI A;  1OCP A;  4I2O A;  1ULY A;  4BJT A;  1OYI A;  2QEX I;  2HR3 A;  4C3I J;  4YFK F;  5B3S H;  2PFB A;  3TO6 A;  2IA1 A;  4L9T A;  2L7F P;  2BGC A;  1B4A A;  3KP2 A;  1LE8 B;  5TRD A;  1VF9 A;  3HOS A;  4LG0 B;  2KIQ A;  4NDL A;  3GF2 A;  2A6T A;  2DK8 A;  1G8X A;  4V2F A;  2VC1 A;  2WY8 Q;  4PJM A;  2X0L A;  1D1B A;  1WPK A;  2DYS H;  2W25 A;  4I76 A;  3MKZ A;  3OOU A;  3BZ6 A;  5FKM A;  3GFM A;  3H9Q A;  1ZK8 A;  3C2G A;  3F6V A;  5FGM A;  1DP3 A;  3U9G A;  4BXF A;  3GTL J;  1OFC X;  1WRJ A;  3GEZ A;  4KT5 C;  3ROU A;  4HYE A;  2E7W A;  3OS2 A;  4KDP A;  1XDS A;  4FHT A;  3T1B A;  4ZYG A;  1MGT A;  2FXA A;  1O7F A;  3Q5F A;  2DMT A;  4ABZ A;  1XS9 A;  3Q9V A;  1VQP I;  3HTS B;  4Q47 A;  4EM1 A;  3VB2 A;  3FXK A;  5E8G A;  4IOC F;  3ZMV A;  3S2W A;  3FX3 A;  2G7U A;  1A31 A;  5GPC A;  3F8N A;  2FML A;  3T8R A;  3PQK A;  4G8X A;  3GYH X;  3PO2 J;  4EJO A;  1BJA A;  4UNO A;  4CSW A;  1ZRF A;  3DBR B;  3Q0W A;  1NTC A;  3OY9 A;  2JPB A;  3M7G A;  2KT0 A;  2L3D A;  3ZQL A;  3V7S A;  1W36 C;  1F36 A;  2A69 F;  2W00 A;  4BBS J;  4RM2 A;  2VE9 A;  1R4N B;  3WE3 A;  3AFH A;  2K02 A;  1P4A A;  3WHB A;  2ZFU A;  2OQG A;  4CCN A;  2LD5 A;  3RPQ A;  1P7I A;  2R7U A;  1Z91 A;  3CCU I;  2HYF A;  2DQL A;  1QNT A;  5F27 A;  2Y48 A;  3BLY A;  1OPC A;  4DYR A;  3E7L A;  3W2A A;  3KCC A;  1D8K A;  3JAM Z;  4A3L J;  4PUS A;  1OCR H;  1GVD A;  4L0Y B;  1J59 A;  3TDU C;  4XBF A;  1BR2 A;  2F5V A;  1R71 A;  1QQI A;  4HF1 A;  3R4K A;  2E35 A;  4D1Q A;  4FT8 A;  3SZG A;  3EYI A;  1EH6 A;  2CQK A;  2BY2 A;  3HZJ A;  2HQA A;  3J7Y J;  5D6E A;  2N8G A;  2ECB A;  3J81 K;  5DCM B;  1IRZ A;  3FBI B;  2VPL A;  4AVZ A;  2HTS A;  5DD8 A;  3CUQ B;  3A01 A;  4HX4 A;  2FRH A;  1FYL A;  2IGO A;  3U1D A;  3A1Y A;  1VQN I;  1Y1W J;  3LA3 A;  2PEX A;  3JRD A;  4ENN A;  3DEW A;  4X0G A;  3F3X A;  3HM5 A;  3P9K A;  1XCV A;  3E1S A;  5C4X J;  1YE9 A;  5C4J J;  5KCM A;  1YHQ I;  1DUX C;  4RAY A;  3QP6 A;  3V4G A;  5A2Q Z;  2YU3 A;  4XKC A;  2LVS A;  1K7A A;  4A5N A;  1X1P A;  4LIV A;  1LFU P;  3V7C A;  1PVE A;  3FBN B;  3HTU A;  2WAQ N;  1JKR C;  1WH5 A;  1XD7 A;  2ZME B;  3J80 K;  1S8N A;  4QLC U;  2M3A A;  4N0B A;  2E36 A;  3LA7 A;  3LA2 A;  3X2Q H;  1XB4 A;  3COA C;  4C2U A;  1FP2 A;  1K6Y A;  1SEU A;  2HPM A;  2L54 A;  3RQ4 A;  2OPT A;  4IQJ A;  2VKE A;  5LEK A;  1RIO H;  1U78 A;  2Q2E B;  2DFF A;  3CCJ I;  3CUQ C;  1T95 A;  3H5R A;  2HQR A;  4MQV A;  1R6R A;  2VKH A;  5IYC J;  1MZB A;  2BXZ A;  2PMZ N;  2M2E A;  4XLH A;  1FIA A;  1QZE A;  1T98 A;  3E6C C;  2PQ8 A;  4MHG A;  2EZL A;  5DUK A;  4MTD A;  1TWC J;  2KJB A;  2KRH A;  4Z2Y A;  4RB1 A;  1BW6 A;  4CCO A;  4DNC A;  3MCZ A;  3KEQ A;  5BNG A;  5IT9 K;  1RET A;  4F92 B;  1QZY A;  3HSE A;  3K9T A;  5KVR A;  4U7D A;  2M0C A;  4IHY A;  2AXT C;  1HQC A;  5D5X B;  4L18 B;  2XSD C;  4H0E A;  2VBY A;  1VTN C;  2E19 A;  4J00 A;  3DXJ F;  4XLA A;  4ITV A;  5JHU A;  2YS9 A;  1H88 C;  1JGS A;  1EF4 A;  2L9S A;  2KL4 A;  3ZR8 X;  3ZP5 A;  3I0T A;  2K4J A;  2ZME C;  3L2W A;  2E1C A;  1ETK A;  3K4K A;  4A3E J;  1TWA J;  4UUS B;  3RIR A;  4FTH A;  3REO A;  2NVU B;  2GXG A;  2W24 A;  3OYM A;  2V4J C;  1RES A;  2KPM A;  1YI2 I;  2R7T A;  1YO5 C;  2XRN A;  4G7H F;  3CF2 A;  3KZZ A;  2UXN A;  4IZZ A;  2BZT A;  3FM5 A;  2V7F A;  4R79 A;  1U2W A;  3GW2 A;  1MSE C;  1VQO I;  2CO5 A;  2H94 A;  1D5V A;  1MJB A;  2JA2 A;  2FBH A;  5GAG J;  2O0Y A;  5HOD A;  9ANT A;  2E1N A;  1R36 A;  1Z77 A;  1G3Y A;  2HNH A;  5HS8 A;  5FRN A;  4AID A;  4IL6 C;  4OOI A;  4I09 A;  3RPU A;  2I8D A;  1FX7 A;  3BG5 A;  3DV8 A;  2DFE A;  1YQA A;  4UUT A;  1Y6I A;  1GLN A;  5E3N A;  5M3F J;  4HA8 A;  1SVO A;  5CVJ A;  3PJR A;  1R23 A;  3KET A;  4KNY A;  4EAT A;  1S72 I;  1SVM A;  1QU3 A;  1HXD A;  3NRV A;  1B8I B;  4B4C A;  1LKX A;  2AO9 A;  3WGH A;  3KP6 A;  2L9N A;  1WJC A;  1JTX A;  1Y0N A;  3LSM A;  4Q5S F;  5GTH C;  1S7E A;  1FNN A;  3BR2 A;  2GIZ A;  1UB9 A;  3DKY A;  4WWC A;  3HRM A;  5IPA A;  4ENM A;  4PJL A;  3E6B A;  4FCY A;  2V79 A;  5EZG A;  3TGN A;  1FYM A;  1AA7 A;  2DMU A;  4RGR A;  5B66 C;  4S04 A;  1IGN A;  1YRN B;  1MW7 A;  2QLZ A;  2JA7 J;  5TJJ A;  3OR2 C;  2WB1 A;  3QU6 A;  4I6Z A;  2BE5 F;  1OYW A;  2DO7 A;  4DW6 A;  2IJL A;  2E2I J;  4RMN A;  2COM A;  4NC6 A;  2JRM A;  4M3F A;  4KMU X;  3J7A Y;  2ZSI B;  5HNH A;  1B59 A;  4ZDL A;  2B9S A;  2JSP A;  1H0M A;  2KDZ A;  4JP0 A;  1BOB A;  5IOZ A;  3JSO A;  4OMY A;  4CCL A;  1JJ8 C;  4CCJ A;  4MTE A;  2X6O A;  4HX7 A;  5FD5 A;  2LTP A;  4CCM A;  2P7V B;  2MGQ A;  2E2J J;  1RZ4 A;  1KGS A;  2YX4 A;  2VOD A;  3FKI J;  2HDC A;  2PBI A;  3A02 A;  4BDZ A;  2ZXW H;  2A68 F;  3SEQ A;  1E3P A;  4BEH A;  3M4O J;  3G1L A;  4LGW A;  1QA6 A;  1F43 A;  1XMK A;  3OOP A;  3BR3 A;  1MBG A;  1E17 A;  2GOM A;  2RDP A;  3JRF A;  3SYT A;  4F7Z A;  3VEP A;  3ERE D;  3OYN A;  2ETH A;  4DZJ A;  1IN6 A;  2IGN A;  2GAU A;  2GA2 A;  4AYB N;  4HLX A;  3M3Y J;  3VSL A;  1IXR C;  3RKQ A;  5HNF A;  1I3Q J;  2LK2 A;  1H8A C;  4L5J A;  2K9L A;  2QVO A;  1T0F A;  3WG7 H;  3OMY A;  5ILU A;  2GBY A;  4ETS A;  3CCE I;  5LLQ A;  1MNM C;  2EIK H;  5KAI C;  2K27 A;  3GTJ J;  1RKW A;  1FLI A;  4B3X A;  3RQI A;  4A5M A;  5EEH A;  2XAH A;  5K5O A;  1HKT A;  2DQR A;  2W82 A;  3SZT A;  3H3Z A;  3TQN A;  4HW0 A;  4XN0 A;  3PNY A;  3L2Q A;  1XSV A;  3RI4 A;  1RC9 A;  5FFZ A;  1U8R A;  3MD2 A;  3LQR A;  4UV9 A;  2DPD A;  3JRC A;  4JBA A;  4WXD A;  1YLF A;  2EQR A;  1MIJ A;  3CMM A;  4I99 C;  5AIQ A;  2JA6 J;  1VND A;  3WTT C;  5TIS C;  3G2B A;  2CMP A;  1B9N A;  1WJD A;  4C3J J;  4BJ6 C;  1D0Z A;  3CUO A;  1S3J A;  2ID6 A;  2DU9 A;  3K1M A;  1AWC A;  1IXC A;  5E20 A;  4G94 A;  2TCT A;  1YW8 A;  1UG0 A;  1TQM A;  1SAN A;  2LF7 A;  2ZXH A;  2VJJ A;  5KAF C;  1U5T B;  1F4K A;  3ZMT A;  1W0T A;  1ETO A;  4GFB A;  3F8F A;  4BDY A;  2XUB A;  1UHW A;  3ASO H;  3C3W A;  3M8J A;  1LVA A;  4P9U A;  1MMG A;  4EJV A;  1I6H J;  4M6X A;  3RPU D;  3I55 I;  1AHD P;  4ZZD A;  4YII A;  1RUN A;  1WJB A;  3F0C A;  3WTW C;  3AG4 H;  3E6M A;  1RNL A;  2PN6 A;  1A35 A;  3CJN A;  2L7Z A;  1UJ8 A;  3LMM A;  5CVV A;  1ZG3 A;  2K3F A;  3ZN1 A;  3WU2 C;  2KMU A;  2F4M B;  1WWX A;  5IYB J;  1X1C A;  3H36 A;  2W48 A;  1ERD A;  3BRO A;  4KN7 X;  2VT3 A;  1QHG A;  3SDB A;  4RGU A;  1XDU A;  1IN5 A;  2EIL H;  5FLM J;  1ZRD A;  1SFE A;  3E5X A;  3KP4 A;  3A0B C;  3W6K B;  2M4G A;  2DT7 B;  2HXI A;  1BI3 A;  2DTR A;  3V8K A;  2RQQ A;  3CJR B;  5E1X A;  4C30 A;  1P92 A;  3IUO A;  2VI6 A;  3W6J B;  2VOP A;  3RKX A;  5BMZ A;  1VQ7 I;  1HW1 A;  1Y56 A;  3ZQF A;  2NVQ J;  2K40 A;  2X1E A;  3F22 A;  2BVL A;  4PSX A;  1KU3 A;  4CZZ A;  1U5T C;  1YS7 A;  2RNG A;  3PFY A;  1WGX A;  2HS5 A;  4XRM A;  3ISP A;  2FBK A;  4JQF A;  2L5Q A;  3OSG A;  2Y0S A;  1QRY A;  1LFP A;  2M45 A;  1HSJ A;  3ZRG A;  4AWX B;  2XB5 A;  5EG0 B;  3H3U A;  1TW2 A;  2MH2 A;  1EH7 A;  1WHU A;  3HDD A;  1D0Y A;  1UCR A;  2ACJ A;  2FQ4 A;  4M6Y A;  4MNU A;  4RGX A;  3B6C A;  1GVJ A;  2WB1 N;  3DTK A;  4BGD A;  1QVT A;  3A2K A;  5L3E A;  3K4C A;  4MQ9 F;  4HF2 A;  3GCM A;  3PFI A;  4ESF A;  5B1A H;  2JQ7 A;  4J01 A;  1I39 A;  3HRU A;  1W5S A;  4R1H A;  2IBD A;  2HKX A;  4NUB A;  2QQ9 A;  1SD7 A;  1BL0 A;  3IH2 A;  1MBE A;  4G12 A;  1BOA A;  3QYB A;  5CVI A;  3L2C A;  1F5T A;  1XGN A;  2KRF A;  4PFO A;  2W84 A;  2ZJQ F;  1W7P A;  2VE8 A;  3TO9 A;  3CJT B;  3ZQ7 A;  1ZRE A;  2R7O A;  2ZNZ A;  2CV1 A;  2M7A A;  2BVM A;  1Q1H A;  3MMY B;  4BE2 A;  1YX5 A;  3CME I;  1T8I A;  2NRA C;  1W1W E;  2MC3 A;  4AIH A;  2ESN A;  3S15 J;  1PUE E;  2Y31 A;  4BY1 J;  1SFX A;  2FQ3 A;  2BY3 A;  2YPR A;  3LAJ A;  4GXO A;  2R5Y A;  5FLX K;  3PIP F;  3BG7 A;  1NK3 P;  4LB5 A;  1WJE A;  2EV6 A;  3BCB A;  1IF1 A;  3DLL F;  1GDT A;  4PCQ A;  2X6X A;  3BTI A;  4L9V A;  2ELK A;  3QOE A;  4W1U A;  1S29 A;  2CUF A;  2BV6 A;  2LKS A;  4LG3 A;  5J8F A;  3L00 A;  4IJA A;  2QQ8 A;  2LBF B;  1HW5 A;  1AU7 A;  4M3G A;  4UV8 A;  1X2M A;  3L2R A;  2UV1 A;  3GXO A;  3L2V A;  2LH9 A;  2O3F A;  3S3M A;  3BG3 A;  3ERM A;  4U0V A;  3BC8 A;  2VLA A;  4HPQ A;  1TP4 A;  2KFD A;  4UVC A;  3OYI A;  2K3P A;  3M07 A;  2Z33 A;  3MWM A;  2VL8 A;  4RB2 C;  1MJ9 A;  2CW8 A;  5ICG A;  5IYD J;  4B47 A;  1YJ9 I;  1YX3 A;  2OUM A;  1K61 A;  5HLH A;  2V26 A;  2LRD A;  3MQ0 A;  4BXX J;  2NS7 A;  2IS1 A;  1ZN2 A;  1WI9 A;  4EM2 A;  3G1O A;  4D7N A;  3CCR I;  3RTR A;  2OF7 A;  1OKR A;  3TBI A;  4QIW N;  1TWF J;  2DAO A;  3QQA A;  1XPX A;  2QGU A;  4CHU A;  2XVC A;  1MNE A;  2CJJ A;  1REP C;  4O5V A;  2COB A;  3QYE A;  1K78 B;  3GX4 X;  3S32 A;  5FB2 A;  4HRI A;  3ASN H;  3LNQ A;  1DU6 A;  1BIB A;  2H8R A;  3WE2 A;  1DPR A;  4PJ0 C;  3WGG A;  3HRS A;  4QWQ A;  5HDK A;  2XAQ A;  4FX4 A;  3SZP A;  2HOT A;  5D5U B;  1I1S A;  2F5C A;  4BNC A;  3EQL F;  3P7N A;  5D5W B;  3IH4 A;  1W5C C;  4EVI A;  4XSZ F;  5F04 A;  2FD5 A;  5EJC A;  4G6D A;  4L9N A;  2R93 J;  2M5W A;  3BPX A;  3EET A;  3I53 A;  2X6W A;  2HZD A;  2W1O A;  3FIS A;  4DJA A;  1JKQ C;  3W3C A;  1LB2 A;  5DS9 A;  2QM3 A;  4IRH A;  5E8I A;  4O3M A;  3LST A;  3MVP A;  4XN3 A;  3TP3 A;  4GYI A;  2M9H A;  3K2Z A;  3F21 A;  1BM9 A;  4ZDO A;  2E1M B;  2RQP A;  2A07 F;  5L3C A;  3CF5 F;  1I27 A;  2VQG A;  2ZJR F;  3KE2 A;  1O4X A;  1X58 A;  2BY1 A;  1UEL B;  3ZQG A;  4UB8 C;  1IN4 A;  1DQU A;  4Y15 A;  3S1R J;  2VXZ A;  2L7M P;  3FK6 A;  3LSK A;  2DOE A;  3JRH A;  4UY8 I;  2WA0 A;  3K70 D;  1P2F A;  3CCV I;  3TW7 A;  2Z2S B;  1C0W A;  1SMY F;  3LL7 A;  5LRS A;  1AKH A;  2XV4 S;  5ERI A;  1Z05 A;  1ENH A;  2Y0S N;  1T33 A;  1MDM A;  1WZ2 A;  4M3E A;  2DMP A;  3HGY A;  4RS8 A;  1OCO H;  4E70 A;  5CQE A;  2QWW A;  2WY7 Q;  2XAF A;  1DU0 A;  1KON A;  4XRS G;  3Q0V A;  4OWR B;  2DPU A;  1IW7 F;  3OSF A;  3E5U A;  1S9H A;  5FRO A;  2QSF X;  4N4N B;  3E0J B;  4BHC A;  2E1O A;  3LFU A;  3VSK A;  1A6Q A;  4KT6 A;  3BJ6 A;  4M9Z A;  4XLC A;  3TED A;  2GXA A;  4QTR A;  2HQ5 A;  2STT A;  3J7A O;  2YX7 A;  3OYJ A;  4A3I J;  3K7A J;  2P7C B;  1RR8 C;  3BZK A;  1IO2 A;  1UHM A;  2E1M C;  3H35 A;  4PJN A;  4P96 A;  5BPI A;  1UG2 A;  1D3Y A;  2ME6 A;  3H3V K;  3ZMZ A;  1R22 A;  2L9R A;  2XAG A;  1VQ8 I;  3DKX A;  1V5F A;  2CV0 A;  3WG9 A;  3HKZ N;  4B48 A;  5CJ9 A;  3WU1 B;  4RBO A;  2F4I A;  4F91 B;  3HRT A;  4Q4Z F;  2OD5 A;  1DPU A;  2H1L A;  3TMO A;  3CO7 C;  1B1B A;  1D1A A;  3BWG A;  4CUG A;  2IS6 A;  3L2U A;  2VKD A;  3OWT A;  1LFB A;  1T56 A;  2VJ5 A;  3E5Q A;  3OS1 A;  5BS6 A;  3CC4 I;  2AQF A;  4P1W A;  5M5Y J;  4YIF A;  3JSP A;  2HOS A;  1KQ0 A;  1K4S A;  3BR0 A;  1UST A;  4F3Q A;  4HDU A;  3ABT A;  4XR6 A;  4BEH B;  2I5U A;  3W2W A;  3FXM A;  1FEX A;  4OU0 A;  1T6S A;  3SXY A;  4FQG A;  2DA6 A;  4Q48 A;  2KIF A;  2EV0 A;  2PJR A;  4C9Y A;  1BN5 A;  2DDB A;  3G1M A;  1YYV A;  4I0A A;  2JA5 J;  3ECO A;  4WX9 A;  4XRF A;  1TQI A;  2HZT A;  3U1K A;  1FC3 A;  3IHU A;  2ADU A;  5DYM A;  2L7K A;  3EDP A;  4A12 A;  1ORK A;  3OV8 A;  5EGO B;  4BBR J;  1ZRC A;  2IW5 A;  3K6G A;  2FNA A;  2EK5 A;  3GZ6 A;  1SFU A;  2Q0O A;  4NC8 A;  3KPH A;  1X1A A;  4FE4 A;  3DPL C;  4RLQ A;  2VQC A;  4B3A A;  2HPI A;  1T38 A;  1S7O A;  2OC6 A;  2K5C A;  2RV8 A;  2OA4 A;  4DIQ A;  4LLG F;  5HLT A;  1ONV A;  4FAS D;  5L3F A;  1V3F A;  3RJP A;  2DJN A;  1TC3 C;  2GLO A;  3IC7 A;  1Y39 A;  1TW3 A;  2D45 A;  4CA0 A;  3IKT A;  3HG9 A;  3RKW A;  4XRS A;  1YTY A;  2GXB A;  4U88 A;  3MEX A;  1MJA A;  3T8T A;  1XGO A;  1O3T A;  2JJ7 A;  2Y9Y A;  3VFZ A;  4MEX F;  3M8F A;  5K5Q A;  1A04 A;  3LSH A;  5FFX A;  2V9V A;  3BY6 A;  3I59 A;  1YJN I;  5M3M J;  4PK4 A;  1WJ5 A;  4WF2 A;  4BQO A;  2ME0 A;  2OCC H;  5ICF A;  1FBU A;  4E4H A;  4PZJ A;  4CGZ A;  3H0D A;  3HOX J;  2E71 A;  1FMV A;  1ZLK A;  1W4M A;  3K0L A;  1VQ4 I;  4E7I A;  2MW8 A;  5ILS A;  2WAE A;  2MH9 A;  3ML6 A;  5J6X A;  2VJI A;  1S5L C;  3HEF A;  3KZI C;  1VZ0 A;  1PDN C;  1VQ6 I;  1FSH A;  1KZH A;  3HPG A;  3ECH A;  4V2G A;  4OIP F;  3HB9 A;  2DI3 A;  1MD0 A;  3TP0 A;  2KIS A;  4IHW A;  3MKL A;  1JHF A;  4Y4R A;  3JRI A;  3GTG J;  3QOD A;  5LFA A;  4HBL A;  3KIO A;  4XLP F;  1E3O C;  2BW3 A;  4C3H J;  2R7V A;  4C2T A;  2ZXI A;  4JYK A;  1LDK B;  2V1X A;  2QQB A;  2HDD A;  1ZG1 A;  1J09 A;  3CC7 I;  3HOY J;  4HAM A;  1PP7 U;  2CYY A;  4G9Y A;  3EUH C;  5FLX Z;  1ZEL A;  4U7B A;  4C2M J;  1TTY A;  2E2H J;  2BY0 A;  3HSF A;  3O3K A;  1KQ9 A;  5EDN A;  2VUM J;  3ULQ B;  4EJW A;  3BR5 A;  2QKL B;  5J4Y A;  1OQY A;  1USS A;  2QBY B;  3HOW J;  3QPL A;  3CD6 I;  5FD6 A;  1B9M A;  1TWG J;  3HOV J;  2CH0 A;  1LJ9 A;  1V54 H;  4NHJ A;  1LNW A;  4GRI A;  2CW7 A;  1S6L A;  4CYC A;  1XMX A;  2J5P A;  1B6A A;  5CPR B;  2R0Q C;  1ZYR F;  2ZJ2 A;  2RAE A;  2LY1 A;  4NQW B;  4F55 A;  4JK1 X;  1PUF A;  3L7W A;  3G3Z A;  1XN7 A;  5ICE A;  1L0O C;  2MD5 A;  1QPI A;  3EUK L;  4IVN A;  4B09 A;  3OIP A;  4XNF A;  2XGX A;  2DA2 A;  3BG6 A;  3LSP A;  2ICW G;  4CO8 A;  1H9G A;  2KHM A;  3PSF A;  3ZPL A;  2DMN A;  2RVC A;  4XOR A;  4LK1 F;  1JGG A;  1IRF A;  4LFU A;  2ELJ A;  2IVM A;  2M8E A;  2QQA A;  1T39 A;  3KLN A;  4ON0 A;  1YG2 A;  1EKE A;  4B1R A;  3R0A A;  4PJJ A;  2QSH X;  2HVR A;  3T5X A;  1R1T A;  1I5Z A;  1ZG5 A;  1X3U A;  1DGR M;  4HG2 A;  2Y30 A;  3GZN B;  3TOA A;  4IPA A;  2EWN A;  2LSO A;  4WCG A;  3MZ8 A;  1LE8 A;  2EZK A;  4A0Z A;  1V55 H;  2EIJ H;  1P7J A;  2HU9 A;  3FMR A;  2OZ6 A;  4HQM A;  3GTK J;  1ITY A;  2DOF A;  3OR1 C;  5CLS A;  2OAZ A;  4LLL A;  3K70 C;  2Z3Y A;  4OAZ A;  1R1U A;  2PMU A;  3R61 A;  1HKS A;  4J19 A;  1KU2 A;  2IGK A;  5KK1 A;  4ZYD A;  5M5W J;  4BU2 A;  5JLW A;  3EYY A;  3KX2 A;  3FXU A;  1OYY A;  1YW7 A;  3U2R A;  3F8C A;  1EA3 A;  2JRT A;  2LYC A;  4H4K C;  1O7L A;  2TDX A;  4XOP A;  3K1P A;  2W85 A;  5HDG A;  3ZMD A;  2E60 A;  3LSG A;  4LK0 F;  1MH4 A;  5E3L A;  3HL2 A;  1ZAO A;  1B72 A;  5DM7 F;  2UUZ A;  4DQ2 A;  1JTY A;  3FK7 A;  3BR1 A;  4P9F A;  3G71 I;  2FEZ A;  2OTL I;  2HWV A;  3WU0 A;  2IAI A;  4E6K G;  2JMW A;  1KYZ A;  1PJR A;  1I1G A;  5JFR A;  4BKX A;  2Y69 H;  3C2B A;  2CUJ A;  5J1U A;  3S8P A;  1ETQ A;  3HUG B;  1J9I A;  4CDG A;  4AIK A;  2Z1D A;  2D2W A;  4YFX F;  1ACI A;  2CFO A;  1R5H A;  2Z9O A;  2R92 J;  1D8J A;  2DN0 A;  1O3Q A;  3DTI A;  2DMQ A;  1Z21 A;  1VFC A;  1LEB A;  2LLK A;  2K7L A;  2OV7 A;  4FET A;  4ZZL A;  4E7K A;  1SC7 A;  4IHT A;  3IWZ A;  5J40 A;  1IN8 A;  1R1V A;  2G9W A;  4D7M A;  3I58 A;  3JR9 A;  3VWB A;  3I4M J;  3BTC A;  4EMS A;  4HLY A;  2E7X A;  4UHT A;  5FLV A;  4ESB A;  4U0Y A;  2KIM A;  1YJW I;  3OYF A;  2VQL A;  3KYD B;  3TW6 A;  4A2U A;  5FKN A;  2MD0 A;  1KU9 A;  3CUQ A;  1IUF A;  1ETV A;  3OYH A;  4KMF A;  4HZF A;  3DP7 A;  4LMY A;  5JVT A;  3I4N J;  1EH8 A;  3DQV C;  3G6E I;  3KP3 A;  1CF7 B;  3AKZ A;  2L0K A;  5E1W A;  4XKV A;  1LQ1 A;  1TNS A;  2JN6 A;  2YU9 J;  1IV6 A;  1APL C;  3PO3 J;  1OR7 C;  1X4O A;  4B44 A;  4KYW A;  1LDJ A;  1MBH A;  3U21 A;  2DCE A;  3VPR A;  1J75 A;  3T0Y A;  4LOC A;  2HOA A;  2G7H A;  1K83 J;  1TBX A;  2V9P A;  2UWM A;  3D5S C;  2ZME A;  1R4M B;  3JAM K;  2E34 A;  3IRQ A;  5DDG A;  3HYI A;  1XCB A;  1QHH D;  3E3V A;  4ENJ A;  2W4S A;  2P6S A;  2V9K A;  3EUA A;  3HOZ J;  3GZ5 A;  4AM3 A;  4EGY A;  2DA7 A;  2XHK A;  5H6R A;  2E5N A;  2P5V A;  3CES A;  3L1P A;  4Y17 A;  1GUU A;  2VIX A;  2LRE A;  2X4H A;  3F8B A;  3J81 Z;  1U8B A;  3OL3 A;  1W36 D;  4YRV A;  2X1C A;  5K7Z A;  1SD4 A;  3ESW B;  1J5Y A;  3DF8 A;  2OJE D;  4NC7 A;  5F0C A;  4A69 C;  2AS5 F;  1FBQ A;  1YW9 A;  2L9V A;  2LP0 A;  2MSY A;  2V1N A;  3PQJ A;  3HC7 A;  2C6Y A;  2VB6 A;  4A3F J;  1ETY A;  4OIQ F;  1XC5 A;  3BQY A;  3NAU A;  4BAC A;  2FSW A;  3ZQI A;  1RI7 A;  2ZC2 A;  1Z3Y A;  1JHH A;  2HQN A;  3QU3 A;  4KFC A;  4G6Q A;  1IUY A;  2P5L C;  4V19 K;  2EPF A;  1NHA A;  2Q1Z B;  4PSW A;  3S16 J;  1HW2 A;  1P9Q C;  1TWH J;  4DGW B;  2CWE A;  5J1R A;  1DP7 P;  1IRG A;  1GV2 A;  1NG7 A;  1Y8Q B;  1ETX A;  1ZHF A;  2ID3 A;  4MEY F;  3H5A A;  1U6G A;  3CO6 C;  5J3L A;  3NWT A;  4ZJZ A;  4XID A;  3DLA A;  1SAU A;  1XTA A;  5A2Q K;  2MA3 A;  3DU5 A;  2CQQ A;  1A6I A;  4UUS A;  3J80 Z;  2WWY A;  2WV0 A;  5JVG F;  3LAP A;  2E5Z A;  5M5X J;  4I7H A;  3B6A A;  3JTH A;  5EYR A;  4II2 A;  2RRE A;  3JCU C;  1BW5 A;  3C2H A;  2CG4 A;  1IDY A;  3QP5 A;  1IRX A;  4JX6 A;  2X6Y A;  4IX7 A;  1UHS A;  3LSI A;  4CH7 A;  1WCM J;  4IQ4 A;  3IRR A;  4KA4 A;  4ZTF A;  1NG6 A;  1STZ A;  3FM3 A;  1JKO C;  1HCR A;  3EPZ A;  2L02 A;  5LGT A;  5HLI A;  3ZMU A;  2EIM H;  1ZGW A;  3GUD A;  2K9M A;  1IJW C;  3OIO A;  4DYC A;  2LFB A;  3BOQ A;  4EJT A;  2M4K A;  2HFH A;  3A01 B;  3QRF F;  5L3B A;  4E7S A;  1WKM A;  3BT9 A;  2CV2 A;  2LF8 A;  4BH9 A;  1R49 A;  3WTS C;  4P55 A;  2IA2 A;  5IT9 Z;  1FT9 A;  2MBF A;  2ZKZ A;  3TOB A;  1L3L A;  2DK5 A;  4YG2 F;  4HV6 A;  4A93 J;  2LKP A;  2XAU A;  1OCC H;  2XF5 A;  2XGE A;  3KYC B;  3ZCO A;  2R7Z J;  4FX0 A;  4I0B A;  1Z7U A;  2XF7 A;  2GM4 A;  4M6V A;  5GTI C;  1IAW A;  3WTZ A;  2J5O A;  4HDV A;  2VBX A;  4IEJ A;  2HEO A;  4CYD A;  1K6O A;  1X1D A;  3AG3 H;  2X85 A;  3QAH A;  1ODD A;  2CQN A;  4IKF A;  2IP2 A;  3M1C A;  5LGN A;  2MFZ A;  4G6T B;  1ZR4 A;  3SJM A;  1YRN A;  2FUG 2;  2A5W A;  5LRR A;  4B43 A;  1DDN A;  2Y2Z A;  4F52 A;  1WVR A;  2L01 A;  3HOT A;  2MC4 A;  2IGM A;  1X1B A;  4XON A;  2QA4 I;  3W2V A;  1FOY A;  3CLQ A;  2ZSH B;  5TGT A; 
#chains in the Genus database with same CATH homology
 5HOD A;  9ANT A;  1WI3 A;  1FEX A;  1Z77 A;  2HXO A;  2DA6 A;  5F08 A;  1JKP C;  1IDZ A;  2X48 A;  4AUX A;  2HYJ A;  3BG5 A;  4UUT A;  3G1M A;  3BTJ A;  5E3N A;  5M3F J;  1GT0 C;  1JUP A;  3RZD J;  5FKO A;  2JA5 J;  3S2H J;  1SFO J;  1VI0 A;  1B8I B;  1I50 J;  4B4C A;  1ORK A;  2AO9 A;  5EGO B;  4BBR J;  3LSR A;  3GTQ J;  1RKT A;  2WV1 A;  2FX0 A;  2MG4 A;  3SFI A;  1JTX A;  2QF7 A;  4DYQ A;  4FE4 A;  1S7E A;  3BR2 A;  3H0G J;  5IP6 A;  3NAR A;  4EEF G;  4B3A A;  1HDP A;  5IPA A;  4FCY A;  2K9Q A;  5EZG A;  5C3E J;  1POG A;  2DMU A;  1IGN A;  1YRN B;  2G0E A;  5DTD A;  2ECC A;  2XGD A;  2EZH A;  3A03 A;  4D5C A;  2JA7 J;  2DJN A;  1TC3 C;  2GLO A;  4I6Z A;  4DW6 A;  3BR6 A;  2E2I J;  1U9O A;  4XRS A;  2VKV A;  4M3F A;  1MSF C;  1MH3 A;  4FE7 A;  2KDZ A;  4JP0 A;  5EZH A;  1ZTR A;  2JJ7 A;  2Y9Y A;  5IOZ A;  1JJ8 C;  2X6O A;  2NVT J;  2H1K A;  1JUM A;  3ZQC A;  2LTP A;  2FJ1 A;  2E2J J;  2MGQ A;  3K2A A;  3WHC A;  5M3M J;  4X1E A;  5FJ8 J;  1HF0 A;  3FKI J;  3A02 A;  2XGC A;  3M4O J;  3G1L A;  1F43 A;  2ME0 A;  3BR3 A;  3CQZ J;  1FTZ A;  1MBG A;  3JRF A;  3HOX J;  2NS8 A;  4HNV A;  3S1N J;  3S2D J;  4A3J J;  3S14 J;  2MW8 A;  3BTL A;  2ZB9 A;  4DZJ A;  3HGG A;  1JUS A;  4AYB N;  3HEF A;  3M3Y J;  1RPW A;  2XB0 X;  4V2G A;  3PM1 A;  4X6A J;  3RKQ A;  1I3Q J;  2LK2 A;  5GPA A;  3HB9 A;  5F0H A;  1H8A C;  3TP0 A;  4IHW A;  4MIM A;  3SDG A;  3MKL A;  1B8I A;  2EBI A;  3JRI A;  2GBY A;  3GTG J;  1MNM C;  3GTJ J;  1MBJ A;  1RKW A;  3UKG A;  1HOM A;  1RR7 A;  1E3O C;  3RQI A;  4JX5 A;  4C3H J;  3HBL A;  4Y7N J;  4XK4 A;  4A3M J;  2CUE A;  2M8G X;  4JYK A;  1R9T J;  2HDD A;  3HOY J;  1A5J A;  3JRC A;  1MBF A;  3ZOB A;  2EQR A;  4C2M J;  2JA6 J;  2E2H J;  1VND A;  5EDN A;  5EF6 A;  2VUM J;  3JRE A;  4C3J J;  3BR5 A;  3CCY A;  1FIP A;  2ID6 A;  5FKK A;  3HOW J;  3QPL A;  2TCT A;  1TWG J;  1HDD C;  3GTM J;  3HOV J;  2NVX J;  1BJZ A;  1SAN A;  2K9N A;  1UMQ A;  1B72 B;  4CYC A;  3LOC A;  1W0T A;  1ETO A;  2R0Q C;  4GFB A;  2JA8 J;  3GTP J;  2JK3 A;  1JJ6 C;  2X9D A;  2RAE A;  2LKX A;  1QVU A;  1I6H J;  2M34 A;  3IV5 A;  1PUF A;  4M3D A;  1AHD P;  5EG0 A;  1QPI A;  3F0C A;  1U9N A;  2DA2 A;  3LSP A;  3JRG A;  2L7Z A;  2DMN A;  1JGG A;  2DA4 A;  5F1J A;  3GTO J;  3S17 J;  1OJL A;  5IYB J;  2W48 A;  4B1R A;  2Y9Z A;  5JLX A;  4IHV A;  2CRG A;  2LY9 A;  1IC8 A;  2EZI A;  2QCO A;  5FLM J;  2R5Z B;  2Y30 A;  1NK2 P;  2CQX A;  1JT6 A;  3CDL A;  4AC0 A;  1LE8 A;  2EZK A;  2HXI A;  4A3C J;  4M3B A;  1P7J A;  2P81 A;  1OCT C;  3FIW A;  2K9S A;  1W0U A;  2VI6 A;  3ZQF A;  2NVQ J;  3GTK J;  2K40 A;  5FKL A;  1ITY A;  2O7O A;  2DA1 A;  1WGX A;  3IH3 A;  4XRM A;  5E3O A;  4FIS A;  4J19 A;  2IEK A;  2EH3 A;  1ZKG A;  5M5W J;  3OSG A;  5JLW A;  4CYC B;  3HOU J;  1QRY A;  3RZO J;  1ETW A;  3CMY A;  1PUF B;  2YUS A;  2D5V A;  2HI3 A;  2XB5 A;  5EG0 B;  2CU7 A;  3JRB A;  3HDD A;  4W97 A;  3LSG A;  1MH4 A;  2FQ4 A;  5E3L A;  1X2N A;  2NVY J;  3LSJ A;  3B6C A;  2WB1 N;  4BY7 J;  1B72 A;  1QVT A;  1ZQ3 P;  1JTY A;  3FK7 A;  3BR1 A;  3ZQH A;  3O8G A;  1OCP A;  2IAI A;  2JMW A;  3BG9 A;  4C3I J;  4BKX A;  2IBD A;  3C2B A;  3D1N I;  2L7F P;  5J1U A;  1ETQ A;  1BL0 A;  5E3M A;  1LE8 B;  3IH2 A;  1VF9 A;  1MBE A;  4NDL A;  1H89 C;  4G12 A;  1BA5 A;  2R92 J;  2DN0 A;  4V2F A;  2DMQ A;  5F0F A;  1VFC A;  2XRL A;  1WPK A;  4I76 A;  2LLK A;  3OOU A;  5FKM A;  1ZK8 A;  2R5Z A;  3GTL J;  4A3G J;  1OFC X;  3JR9 A;  4D7M A;  3S15 J;  2Y31 A;  3I4M J;  4BY1 J;  3BTC A;  4MLO A;  1JT0 A;  5FLV A;  2DMT A;  2R5Y A;  4ABZ A;  1XS9 A;  4A3K J;  1NK3 P;  3DCF A;  3TW6 A;  2LR8 A;  5FKN A;  1GDT A;  1IUF A;  1ETV A;  4RDU A;  5GPC A;  1D5Y A;  3BTI A;  4W1U A;  2ELK A;  3I4N J;  3PO2 J;  4A3D J;  2CUF A;  4MFE A;  3Q0W A;  2L0K A;  1NTC A;  4S0H B;  5GP9 A;  2JN6 A;  1AU7 A;  2KT0 A;  4M3G A;  3ZQL A;  1X2M A;  1IV6 A;  2YU9 J;  1F36 A;  4BBS J;  1APL C;  3PO3 J;  5C44 J;  4JX4 A;  3BG3 A;  3WHB A;  2LD5 A;  1P7I A;  1MBH A;  3Q0U A;  3VPR A;  5F27 A;  4DZP A;  3O8H A;  2VPR A;  4DYR A;  3E7L A;  4LOC A;  5IYD J;  2HOA A;  4IHX A;  1K61 A;  1K83 J;  1XG1 A;  4A3L J;  4BXX J;  2NS7 A;  2JWT A;  1GVD A;  3G1O A;  4D7N A;  2OF7 A;  4QIW N;  1TWF J;  3QQA A;  1G2H A;  2CJJ A;  3HOZ J;  1FTT A;  2COB A;  2DA7 A;  5K7H A;  3L1P A;  1GUU A;  3LNQ A;  1U8B A;  1DU6 A;  2H8R A;  2R5Y B;  5K7Z A;  4XIC A;  2N8G A;  2ECB A;  1IRZ A;  5F0C A;  4A69 C;  3BQZ A;  3GBG A;  2HOT A;  3A01 A;  2LP0 A;  2MSY A;  3S1M J;  3IH4 A;  1ETY A;  4A3F J;  1XC5 A;  3BQY A;  2FD5 A;  3NAU A;  5F04 A;  5J1Y A;  3ZQI A;  3JRA A;  2R93 J;  1Y1W J;  3FIS A;  3JRD A;  1JKQ C;  3DEW A;  5DS9 A;  3HM5 A;  3MN2 A;  3S16 J;  3MVP A;  1TWH J;  1Z0X A;  5J1R A;  5C4X J;  3TP3 A;  5C4J J;  1GV2 A;  2ID3 A;  1ETX A;  2M9H A;  2XPU A;  2LVS A;  5J3L A;  4XID A;  1LFU P;  1O4X A;  1X58 A;  3S1Q J;  3ZQG A;  2O8K A;  2CQQ A;  4D5F A;  1A6I A;  4UUS A;  2I10 A;  2WAQ N;  3S1R J;  1JKR C;  1WH5 A;  2L7M P;  5M5X J;  3FK6 A;  3JRH A;  2DTZ A;  3B6A A;  5EYR A;  2AHQ A;  5IP9 J;  1CQT A;  3TW7 A;  1BW5 A;  4A3B J;  5K7F A;  1IDY A;  2XPW A;  4JX6 A;  1AKH A;  1UHS A;  1WCM J;  1IG7 A;  2OPT A;  1ENH A;  2Y0S N;  1JKO C;  2VKE A;  1HCR A;  1T33 A;  4M3E A;  2DMP A;  3HGY A;  1U78 A;  1HLV A;  1ZGW A;  2NOG A;  4MO7 A;  1DU0 A;  4XRS G;  1IJW C;  3OIO A;  4DYC A;  2LFB A;  5IYC J;  3Q0V A;  1FJL A;  2PMZ N;  2M2E A;  3A01 B;  3OSF A;  2TRT A;  1FIA A;  1GV5 A;  2EZL A;  3BT9 A;  3Q3S A;  1TWC J;  2E1O A;  1BW6 A;  3TED A;  3QPS A;  1Q1V A;  5BNG A;  4QTR A;  2HQ5 A;  1RET A;  4Y52 J;  2DA5 A;  2O9L A;  4A3I J;  4A93 J;  3K7A J;  2M0C A;  4IHY A;  2XGE A;  3W6V A;  2R7Z J;  5EGO A;  2XSD C;  2B63 J;  1UG2 A;  2ME6 A;  2GM4 A;  4M6V A;  3H3V K;  2E19 A;  2L9R A;  2YS9 A;  1H88 C;  1EF4 A;  4IEJ A;  3HKZ N;  5EEA A;  4RBO A;  1ETK A;  4QSH A;  4A3E J;  2XPV A;  1TWA J;  4UUS B;  5IP7 J;  1WH7 A;  4FTH A;  1MBK A;  1ZR4 A;  3SJM A;  1Y1V J;  2DA3 A;  1LFB A;  1YRN A;  1T56 A;  1RES A;  4L5E A;  1ZR2 A;  5M5Y J;  2Y2Z A;  5IOY A;  2HOS A;  4MFD A;  1AKH B;  1MSE C;  3BR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...