2XB0X

Dna-binding domain from saccharomyces cerevisiae chromatin- remodelling protein chd1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
265
structure length
233
Chain Sequence
GPLGSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLKKVPGAIHLGRRVDYLLSFLRGGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The DNA-Binding Domain of the Chd1 Chromatin- Remodelling Enzyme Contains Sant and Slide Domains.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords CHROMO DOMAIN-CONTAINING PROTEIN 1
total genus 73
structure length 233
sequence length 265
ec nomenclature ec 3.6.1.-:
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF18196 Cdh1_DBD_1 Chromodomain helicase DNA-binding domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2xb0X02
2M2EA 2GLOA 3JR9A 2H8RA 1GV5A 2YS9A 2IAIA 1FEXA 2W48A 4D7NA 1ETQA 2KT0A 1BW6A 4JYKA 4A3FJ 5IOYA 2CJJA 1NK3P 1POGA 1MBHA 4G12A 1FTTA 3JREA 3GTGJ 3OIOA 2Y9YA 1R9TJ 3TW7A 2DA6A 1T33A 3SJMA 3GTMJ 4B4CA 1B8IA 1RKWA 5C4XJ 2B63J 4BKXA 4C3HJ 4D5CA 3BTIA 1W0TA 1APLC 5EYRA 5IP7J 1Z77A 1AKHA 3TW6A 1BJZA 4BXXJ 3G1MA 1MSEC 4DYRA 3TP3A 3CCYA 2K9NA 3IH4A 4A3IJ 1ORKA 4I76A 2DA7A 4RBOA 3TEDA 1ZQ3P 1Z0XA 3JRBA 1Y1VJ 2LTPA 1WH7A 4NDLA 2HYJA 2DA3A 2H1KA 1NTCA 2LY9A 2TCTA 5IOZA 1MBFA 4UUSA 1UHSA 4IHYA 5EG0B 1GUUA 3O8HA 3WHCA 1X2NA 4X1EA 4Y52J 3JRAA 3HB9A 1K61A 2LFBA 1QVUA 2L7ZA 4MIMA 3ZQIA 5EF6A 3OSFA 2O8KA 4A93J 2RAEA 1OCTC 5FKNA 5IP6A 1TWFJ 3HGYA 3LSPA 5C3EJ 4IHXA 2JN6A 3BG5A 3BTCA 3TP0A 5DTDA 1JKQC 2XSDC 2E1OA 2HDDA 3ZQFA 1EF4A 2Y0SN 3H3VK 3MKLA 1GT0C 1VI0A 2JA8J 3HDDA 2ID6A 1G2HA 3GBGA 4FE7A 1B72B 5EEAA 2IBDA 4MO7A 3S15J 1LFUP 2CUFA 2R0QC 2DMQA 1U9NA 1ZGWA 5J1YA 3CDLA 2NS7A 2IEKA 2DA5A 5IYBJ 3A02A 2HOSA 4FE4A 1MBEA 1QPIA 3BQZA 4M3BA 5EDNA 5C4JJ 3C2BA 1IDZA 3PM1A 1JTXA 1F43A 1HCRA 2HI3A 2GM4A 2VPRA 1BL0A 1YRNA 2X6OA 4QTRA 3OOUA 2X9DA 2NVXJ 2XB5A 5F0CA 1JT0A 1MBGA 3E7LA 2ID3A 2NVQJ 4A3MJ 4X6AJ 1HLVA 3BT9A 2EZLA 4M3GA 3G1LA 1ETKA 3HM5A 2Y9ZA 4MLOA 5K7HA 2EQRA 2Y30A 1A6IA 1WPKA 4A3LJ 4J19A 3HOWJ 3M4OJ 3CMYA 1IG7A 1T56A 2R7ZJ 1DU0A 1HDPA 1TWCJ 1Y1WJ 1MH3A 2XPVA 2R92J 2QCOA 2G0EA 5M3MJ 1WCMJ 3S16J 3DEWA 1VFCA 5J1UA 1F36A 5FLVA 2FJ1A 5F1JA 2PMZN 1LE8A 3DCFA 5GPCA 5F08A 1RPWA 3BTLA 1X2MA 2NS8A 2COBA 3RZOJ 2CQQA 3S1NJ 4A3EJ 3FK7A 2E19A 3HOXJ 5F0FA 1RETA 3S1RJ 3QQAA 3BR2A 3LOCA 5C44J 5FKKA 4UUSB 3JRDA 2VUMJ 5EG0A 1A5JA 3W6VA 3BR0A 1XS9A 4JX6A 1JKRC 2XGDA 1UG2A 2TRTA 3PO3J 1ETYA 3GTKJ 1MSFC 2JA6J 9ANTA 1UMQA 5GP9A 2GBYA 2L9RA 2JK3A 3GTOJ 2D5VA 2AHQA 4CYCB 4JP0A 2M34A 2XGCA 4RDUA 1XC5A 2MGQA 3OSGA 3S1QJ 1ETWA 5JLWA 2L7MP 1WH5A 1JGGA 1ETOA 4QSHA 3LSJA 1JKPC 4GFBA 1MH4A 4A3CJ 3GTJJ 2O7OA 3IV5A 3HBLA 4DW6A 2EZHA 2AO9A 2VI6A 1AHDP 2FX0A 5F27A 4IHWA 3BQYA 2CQXA 3I4NJ 1PUFA 3L1PA 4C3JJ 1P7IA 3UKGA 4XRMA 1VNDA 2E2HJ 1AU7A 2XPWA 1TWGJ 4ABZA 4W97A 4M3EA 3S17J 1PUFB 3RQIA 1I6HJ 2DTZA 1IJWC 3A01A 3BG9A 3K7AJ 2ECBA 4M3DA 1JJ8C 1WGXA 3BTJA 2CUEA 3S2HJ 5HODA 4HNVA 2I10A 1K83J 2JA5J 1FIAA 4BY7J 3S1MJ 4DYQA 3HOZJ 2NOGA 4V2FA 4XK4A 3ZQGA 4JX5A 2OPTA 3I4MJ 2ZB9A 3LSRA 4I6ZA 4AYBN 4A3KJ 1ITYA 3HOUJ 1H89C 2XGEA 3CQZJ 2KDZA 1B72A 3GTLJ 2WAQN 3ZQHA 1WI3A 2MW8A 3S14J 4FTHA 1JUSA 2MG4A 1D5YA 2R5ZB 2XRLA 3A03A 5M3FJ 1FIPA 1I3QJ 3BG3A 1NK2P 1TWHJ 3VPRA 2K40A 1X58A 3FISA 2VKEA 1ENHA 1Q1VA 3BR1A 3BR6A 3HGGA 3SDGA 1W0UA 4XICA 1GV2A 4C2MJ 3ZQCA 2DMTA 2XPUA 2M9HA 3O8GA 2DA4A 1QRYA 2YU9J 1ZK8A 2MSYA 2R5YA 3BR3A 4LOCA 4S0HB 4CYCA 2CRGA 3Q0VA 1OCPA 1IV6A 2LVSA 5FKLA 2EBIA 1XG1A 1LFBA 2N8GA 4V2GA 2YUSA 1RR7A 1SFOJ 4B1RA 3MN2A 1H88C 1FTZA 2FQ4A 1MNMC 1O4XA 1P7JA 2HQ5A 5F04A 3RZDJ 1VF9A 1JUPA 3HKZN 2E2JJ 1RKTA 2JMWA 4A69C 5GPAA 3JRCA 2R93J 3H0GJ 5K7FA 3HEFA 2LKXA 4EEFG 2DJNA 5JLXA 1JUMA 3FIWA 2ME6A 3IH3A 2R5ZA 1E3OC 3LNQA 2DMNA 1HOMA 1AKHB 4BY1J 1IUFA 3WHBA 1HDDC 3QPSA 2DN0A 4M3FA 5IYCJ 2EZKA 3IH2A 4D5FA 4A3DJ 4XRSG 5FKOA 4UUTA 2WV1A 2O9LA 1ZKGA 2R5YB 1IDYA 3QPLA 2EZIA 5F0HA 3JRIA 5E3LA 5M5XJ 3HOVJ 4DYCA 5E3OA 2FD5A 1JKOC 2CU7A 3JRHA 4Y7NJ 4IHVA 3B6CA 2DMPA 5IP9J 3NAUA 2HXIA 2M8GX 3Q0WA 4QIWN 1IRZA 5FLMJ 2M0CA 1OFCX 3Q3SA 3RKQA 5FKMA 1TC3C 1U8BA 2LK2A 1CQTA 3B6AA 2X48A 2JA7J 1IGNA 1GVDA 2LR8A 1DU6A 2JJ7A 5E3MA 4BBSJ 2ELKA 2L0KA 5IYDJ 4M6VA 1JT6A 5E3NA 1RESA 1HF0A 1TWAJ 1LE8B 4C3IJ 1ETXA 4MFEA 4DZJA 5K7ZA 1H8AC 2HOAA 1QVTA 1OJLA 4MFDA 2HXOA 2LLKA 4B3AA 3A01B 1BA5A 3JRFA 5DS9A 2P81A 3FK6A 4IEJA 2NVYJ 3PO2J 2WB1N 5EGOB 1MBJA 1S7EA 3SFIA 2VKVA 3NARA 1ZTRA 4FCYA 1FJLA 3MVPA 4XIDA 1BW5A 3GTQJ 1ZR2A 2NVTJ 4W1UA 4XRSA 4DZPA 5EGOA 1MBKA 2L7FP 2Y2ZA 3F0CA 2JWTA 1SANA 2HOTA 5BNGA 4FISA 3Q0UA 4JX4A 2LD5A 3HOYJ 2QF7A 3M3YJ 3G1OA 1U78A 5M5WJ 4A3BJ 4A3GJ 4AC0A 5EZHA 3S2DJ 4BBRJ 2ME0A 1JTYA 2OF7A 1YRNB 4L5EA 2XB0X 1B8IB 4A3JJ 2DMUA 3JRGA 2ECCA 2K9QA 5FJ8J 3GTPJ 5M5YJ 1GDTA 4AUXA 1U9OA 2DA1A 5IPAA 2Y31A 4D7MA 5EZGA 2E2IJ 3K2AA 2LP0A 1I50J 3BR5A 2DA2A 3LSGA 2K9SA 2EH3A 3D1NI 1JJ6C 3FKIJ 3ZQLA 1ZR4A 5J1RA 3ZOBA 5J3LA 1ETVA 1IC8A
chains in the Genus database with same CATH superfamily
1S72I 2DK5A 3JR9A 2H8RA 2Y69H 1OQYA 2W48A 5ICEA 1ETQA 2KT0A 2DPUA 4RB1A 3S8PA 4BNCA 3NWTA 4HF0A 1G6NA 4JYKA 4IOCF 4A3FJ 3PIPF 5IOYA 3ZP5A 4AWXB 4FX4A 5LD2C 2QENA 4C2UA 1POGA 1UELB 1FTTA 3JREA 4P1WA 2V1XA 1UJ8A 3M1CA 4HQMA 3F21A 2L9VA 1ZREA 2OU2A 1WJAA 3DKYA 4XL9A 4A5MA 4ZDPA 4CDGA 1RKWA 1UB9A 5B1BH 5C4XJ 4C3HJ 4D5CA 1APLC 3NEUA 4XBFA 3VEPA 3TDZC 3X2QH 2W57A 5HDNA 4E7LA 4D9JA 4Q5SF 1FBSA 2CUJA 4NUBA 3GF2A 3MZYA 4IRHA 4RGXA 5ERIA 3CDHA 3V7RA 4LG0B 1D8KA 3PFIA 4IX7A 2M4KA 3U1DA 2JQ7A 4HF2A 4I76A 3WGHA 1OPCA 2FRHA 1R4MB 2DA7A 4HYEA 4RBOA 4I01A 1XSDA 3ISPA 3MZHA 2YX7A 2KIMA 3K4NA 3TEDA 4FETA 2BY3A 3T1BA 1ZQ3P 2P0WA 2BHYA 1S9HA 5DCMB 3JRBA 3K70D 3GO5A 5CVIA 5CVJA 1S3JA 2Z9OA 4LB6B 2VKHA 2P7VB 2QKLB 2A6EF 2JUGA 3H36A 1NTCA 4AIDA 1WZ2A 1DPUA 1TNTA 4UVCA 1D3YA 3CJNA 3O8HA 5JHUA 1G3TA 1GXQA 3GUDA 4LIUA 3TO6A 3WTZA 3IUOA 3L2QA 2LFBA 3M8EA 3CCSI 4L5IA 2XKPA 1T08B 1PDNC 1XGNA 1D5VA 3IWZA 1OCCH 5IP6A 4CO8A 1XGOA 2OC6A 2P6SA 3L09A 4G94A 1FX7A 4B8XA 1BC7C 2BXZA 3GLXA 3BG5A 3BTCA 3ZMDA 1AA7A 4PDKA 4PSXA 2E7XA 3R4KA 3ZQFA 3R0AA 2XAHA 1R36A 2W85A 2Y0MA 1VI0A 3KPHA 5JFRA 1S5LC 4R79A 3I3LA 4MO7A 3S15J 1P9QC 4GGGA 5HS7A 2R4GA 2W00A 2XAJA 3FBIB 1K7AA 1JE8A 2NS0A 4II3A 3A02A 2HOSA 1ZRCA 3FM3A 1IN7A 5LEJA 2HWVA 3BQZA 1V5EA 4BYYA 5E20A 5HNFA 3RSNA 5C4JJ 4V19K 3C2BA 4PCQA 2HKOA 3TOBA 4IQ4A 3AFHA 5HLGA 1Y8RB 2VPRA 2V26A 2GM4A 1BOBA 1D1BA 4KIBA 2EV5A 2H6CA 5D5XB 2LDUA 4QTRA 2X9DA 2NVXJ 2KJBA 3E7LA 5AIQA 4DBRA 3J7YJ 4X6AJ 1HLVA 1PUEE 1RZ4A 2XAUA 3ASNH 2GZWA 3HM5A 1FMVA 2Y30A 3AG1H 3O3KA 3P9IA 3ZRGA 4BL0B 4A3LJ 4LK0F 2VC0A 3W6JB 3LAJA 6PAXA 2CUZA 1R5ID 3M4OJ 2P8TA 3CMYA 3E5UA 2CQ7A 2X51A 4BU2A 5GADJ 3OIQA 4RLQA 2V79A 1Y1WJ 1GLNA 2EFWA 4IHSA 3KETA 5ED4A 2HQRA 1DDNA 2QCOA 3VB2A 1WCMJ 4OIOF 4F93B 3O2PE 5F1JA 3FM5A 2PMZN 1BC8C 3H35A 3KYCB 1YS6A 1X2MA 1P2FA 1OYIA 2HTJA 1W5TA 5K5QA 3L7WA 5L3CA 2I5UA 3S1NJ 4CGZA 3FK7A 1BM9A 3SFZA 2MYSA 3S1RJ 3BR2A 3HJEA 2WV0A 1XCVA 3WE2A 5EG0A 3OYAA 4WWCA 3W6VA 2KFDA 1G3YA 3LAPA 2TRTA 4DOZA 3K4CA 3GTKJ 4CHUA 1FNNA 4RAGA 2VBXA 2ZJPF 4BE1A 2JA6J 2LF8A 2ICWG 2B0LA 2P5VA 1NH3A 4F52A 5LFAA 3QP6A 2CW0F 3SHFA 3EUHA 1RIOH 2ETHA 2NNYA 2XGCA 2CFXA 1V5GA 5K5OA 1XPXA 2FSWA 2V1DA 2A5WA 2XAGA 2BHZA 4CUGA 4BHBA 2ZMEC 2WB1A 3FMRA 1S29A 3EDPA 3GTJJ 4HAMA 4HW0A 1VQ8I 2ESNA 2UUZA 1MNEA 2E60A 2FX0A 3BQYA 4QPOA 3A4CA 4PUSA 1WFXA 5CVVA 3L1PA 4M71A 2LREA 4KUMA 5ICGA 1UHWA 3KP4A 4EQQA 2V1UA 1VNDA 4XOTA 1J9IA 2E1MC 1AU7A 3KZYA 2LNBA 2XPWA 4XLPF 4BACA 1F5TA 1TWGJ 2PBIA 1E3HA 1WQ2A 4M3EA 3VYSB 4A5NA 1FBQA 4FQGA 2KIQA 1PUFB 2R7TA 1IJWC 3TQNA 3N05A 3J80Z 3ZMUA 1L3LA 4H4KC 1JJ8C 5TRDA 2VASA 1O3QA 1LB2A 1WGXA 2IS1A 3GLLA 1ZRDA 4HNVA 3BZ6A 1KA8A 1XGSA 5HDGA 2LKPA 2WTEA 4Y13A 1QO0D 3HRUA 1HW1A 3CC7I 3CJRB 3MWMA 4L9NA 4B44A 3W2VA 1RRJA 4UV9A 1MGTA 3Q5FA 2ZB9A 1MKMA 4LG0A 3TBIA 1HSJA 3S3MA 2QUFA 1HA8A 1ITYA 1H89C 1I6XA 1DUXC 3CQZJ 1B72A 3QPTA 1XSVA 3F6OA 2HS5A 1YE9A 3H92A 3E3VA 3LWFA 5JI6A 1D5YA 3IP4B 4DJAA 1G59A 3CESA 1I3QJ 1SFEA 3I4PA 4B48A 2W25A 4XLAA 1D0ZA 1A6QA 3DWLE 1X58A 4L5JA 4Q47A 3MCZA 3EQLF 1EV7A 2F5VA 3HGGA 3K1NA 4I7HA 1VZ0A 1BJAA 3ZQCA 4FHTA 3H9GA 1N75A 4IL6C 4NC8A 3FF5A 3KLNA 1XMAA 4Q4ZF 1TT5B 1VQNI 4Z2YA 4KISA 3FZVA 3DEUA 4S0HB 3WTYC 2O03A 1WKMA 2AQFA 4XQFA 3CMAI 1AWCA 5FKLA 4S05A 1YO5C 3VYTB 2HVSA 2N8GA 2EA2A 4F91B 2LY2A 4V2GA 2ADUA 2HFHA 1SFOJ 4NB5A 4XSZF 4B1RA 5CKTA 1Y0UA 1RI7A 2FBIA 1FTZA 1ZH5A 3K9TA 3H9JA 1VQ5I 3R61A 5BS6A 2WAQA 5A2QK 3F3XA 5F04A 3QU3A 4BEHA 3DBRB 1RKTA 3CUOA 1HQCA 5D5UB 2ELJA 1MNDA 1X1PA 4RMNA 4OU0A 5FFXA 3H0GJ 1NG7A 3HEFA 5KCMA 4QPQA 2LKXA 3IL2A 5CPRB 4A0ZA 1RUNA 2HVRA 3FIWA 1E3OC 4XN0A 1VQLI 1OYYA 1LDDA 1HOMA 2ZXIA 4ZYEA 1AKHB 4A0XA 1O3TA 1HDDC 4HRIA 3QPSA 3G73A 3HOTA 2VJIA 3IH2A 3WU1B 5J6XA 1V3FA 3RPUD 1REPC 2RREA 1SFUA 3R0JA 4UUTA 2O9LA 2KKOA 2ESHA 3OY9A 2R5YB 2OZUA 4EM0B 2HEOA 4GYIA 5E3OA 3HOVJ 3CLOA 2Z16A 2L02A 4BE0A 2CU7A 2JPCA 1YW9A 4Y33A 5LGNA 5FO5A 2BW3B 3DU6A 4PK4A 3F8NA 3LA7A 1YITI 2QEXI 2HQAA 3CO7C 3Q0WA 3OYIA 1H0MA 2HNHA 1GXPA 2VJ5A 4UY8I 2M0CA 2GOXB 3J7ZI 1BR4A 2VIXA 2MLKA 1U8BA 1W5CC 1NHAA 1T98A 2LK2A 2HQNA 2JA7J 1MMDA 4CZCA 2M3AA 4M73A 2L3DA 4CICA 5DEQA 1X1CA 3QU6A 1ZG3A 2WY7Q 1R1TA 2L0KA 1JT6A 1R71A 4BDYA 2KQRA 2XC7A 4G9YA 2EILH 4KIFA 5BOXA 3DP7A 4N9HA 5K7ZA 2OJED 1QVTA 4IQJA 2HXOA 5DCMA 3L2VA 4B3AA 3A01B 5DS9A 1WWXA 2ZJQF 2P81A 3MD2A 4IEJA 3MEXA 5ICCA 4HV5A 1SFXA 1ZHFA 2NVYJ 3K69A 3P7NA 4BDZA 3PO2J 3TGNA 1S6LA 1W7PB 2F5CA 2MFZA 5AIPA 3L2CA 3SFIA 2VKVA 3NARA 4P5OA 4HNTA 4XIDA 1BBYA 4HNUA 1LPQA 2DBBA 2L7FP 3F0CA 5LHIA 3RYRA 1TBXA 1SD5A 2OV7A 3Q0UA 5LGUA 2LD5A 3HOYJ 3QYBA 3CJTB 5J8FA 2IS6A 4ZYGA 4A3GJ 4YIIA 2QWWA 4BBRJ 1JTYA 2OF7A 4L5EA 5DM7F 3BROA 4UUVA 3GTPJ 1XMXA 4WXDA 2PJPA 1I3AA 3ZQ7A 1U9OA 1BIBA 2DA1A 3IAS2 5IPAA 1SMTA 1R6RA 4D7MA 3L2UA 3RI4A 2C6YA 2E2IJ 2LP0A 5KK1A 3BR5A 2FBKA 3HZJA 3VWBA 3HRSA 3D1NI 1B6AA 5TJJA 1IC8A 1RR8C 4F7ZA 5HS9A 2WAFA 1BN5A 2QKMB 2GLOA 2BY2A 3FXKA 5CQGA 4CYDA 1GV5A 3FX3A 5GTIC 4D7NA 1WRJA 3BOQA 4XLFA 1LEBA 3VDXA 1XB4A 2E5ZA 3F8BA 3FMQA 2VE9A 2CJJA 2Z5UA 3HTUA 1YX5A 3C3WA 3DXJF 5BMZA 4G12A 3H3ZA 2DK8A 3L00A 1ZGAA 2QQ8A 3WG7H 2DA6A 3RKWA 4PSWA 1HKQA 4I0AA 1P4XA 2H8WA 3BDDA 3K2ZA 2GIZA 3CCEI 4HPQA 3IHUA 5ILUA 2B63J 1D0YA 3N97A 1O57A 4OAYA 4BKXA 1ZRFA 3BTIA 5HNHA 2X6WA 3U21A 1MJAA 4ZYHA 2QBYA 5IP7J 3HG9A 1BJZA 3BLYA 1H9TA 3TL4X 3ZGKA 3G1MA 5B66C 4DYRA 3MKZA 2GXBA 4EJVA 2RDPA 3CCYA 3SEZA 4ENJA 4IO9F 3AG4H 2K9NA 1IN5A 3IH4A 4A3IJ 4CCJA 2V9PA 3ZCOA 3U9GA 3LSMA 4CCNA 3SZPA 4HEA2 2Y48A 2D1VA 4YIFA 3LFUA 3CCQI 1LDKB 1YW8A 1X3WB 4CCMA 2LTPA 1Q1HA 1WH7A 3ERMA 5FROA 4Y15A 2HYJA 2RC4A 3KP6A 5ILVA 2BXYA 1B9MA 1FSHA 4LG3A 4IHYA 2IW5A 5EG0B 1GUUA 3FDYA 4KMUX 2A6TA 1PVEA 3DPTA 5E79C 2LG4A 3CCLI 4QLCU 4Y52J 2E36A 2HVQA 1ZLKA 3S3OA 2EFOA 3GWZA 1R22A 3DQVC 3ZQIA 4B3XA 5EF6A 4I09A 3OSFA 2O8KA 2MC3A 2RAEA 4AIHA 4EM2A 2LC2A 2ZKZA 2VN2A 2MD5A 1TWFJ 4IHXA 3GZNB 2XAFA 2Z33A 1USTA 3ZMVA 3TP0A 2CV2A 4KN4X 1M1EB 1EF4A 2CH0A 4OIPF 3R60A 5GAHJ 1RC9A 3NQOA 2L54A 1LQ1A 2WY8Q 5BQTA 4LLLA 4F92B 3HDDA 2RN7A 1SMYF 3OS0A 1QNTA 4ZH4F 1LFUP 1F9NA 1Z91A 2CUFA 4EATA 2DMQA 5JHFA 2HGCA 3A0HC 3M07A 4BE2A 2NS7A 4IPAA 5E8IA 2CW8A 4WK8F 2CQKA 2H94A 2OCCH 3E6DA 4FE4A 4C2TA 2D45A 1QPIA 3CP8A 4M3BA 4F55A 2BW3A 4BGDA 5EDNA 2IS4A 2R7OA 3K10A 5FRMA 1IDZA 3PM1A 1JTXA 2CO5A 1MMNA 2LYCA 2HI3A 2KRCA 1IAWA 1EKEA 2E7WA 3EETA 3ZPLA 3MKYB 2V1NA 2OBPA 1BL0A 4II2A 1YRNA 2L7KA 1IUYA 2K02A 4BS9A 1VQ6I 5DUIA 1WI9A 4XKBA 1MBGA 4GYGA 1TP4A 2QVOA 4RAYA 3JCUC 4BJTA 4M6YA 3BT9A 2EZLA 3G1LA 1E17A 2CYYA 4JK1X 4XN3A 5DCFA 2Y9ZA 4RLFA 2VT2A 4XKVA 1TLHB 4HX4A 4FASD 3OYCA 2FA5A 3GFMA 4KIGA 4RGUA 1T56A 5L3DA 1DU0A 3D5RC 1IRXA 1TWCJ 4I98B 3PNYA 1BR1A 2IGKA 3F9KA 3NWSA 2R92J 2PMHA 2Q2EA 2G0EA 5M3MJ 2MH2A 1VFCA 2DFHA 5H6QA 2FJ1A 2VKDA 3DF8A 2XF7A 2V6EA 1J59A 2E34A 3BTLA 5F08A 4AIKA 3WTWC 1SD6A 1LJ9A 2COBA 4ON0A 1YX3A 2K7LA 3I54A 2GIVA 2CQQA 2IGNA 3RZOJ 3B73A 3HSEA 4IVNA 1FOWA 2QM3A 4BXFA 4UB6C 1RETA 2NVQJ 2X6XA 3LOCA 4UUSB 5FKKA 2R7WA 2NOJB 2OD5A 2QLZA 2RQQA 3MQ0A 1SVMA 2BYVE 4JX6A 4WCGA 2XGDA 1UG2A 4XLEA 1JKRC 2CV0A 2EJRA 3OS2A 1ETYA 1MSFC 4PGGA 2RGVA 4WXCA 2HZTA 4BQNA 2UV1A 4G7HF 3I0TA 4E7KA 1UMQA 3TDUC 3I71A 9ANTA 3LA2A 3KP3A 2PG4A 1B4AA 2H6BA 2JK3A 3GTOJ 3OL3A 2DU9A 1Y0NA 2BBYA 1KU3A 1OR7C 3S1QJ 1N78A 4ZDLA 1S7OA 4G8XA 1JGGA 1ZLJA 1ULYA 3LSJA 4GFBA 2DODA 3ESWB 1XDSA 3E0JB 2AO9A 1AHDP 5HS8A 1D1CA 3I64A 4UV8A 2XRNA 3HPGA 5CVUA 4RGSA 3TO9A 4XRMA 2RQPA 2G7UA 2FOWA 1SD7A 1W36D 1IN8A 2M0MA 3OWTA 1I39A 1MMSA 2FNPA 1MW7A 1SAUA 2NNNA 3E5QA 2M7BA 4ETSA 3JSOA 3RQIA 3A1YA 2PI0A 1YIJI 2DTZA 2W84A 4I0BA 1I6HJ 4ESJA 4P9FA 3PQKA 3B02A 2F4MB 1U2WA 3ZMZA 4P9UA 1LNWA 2HZDA 4RGRA 1T0FC 3BTJA 1FLIA 3HC7A 4LGWA 5HODA 1G3WA 4OINF 3S1MJ 2ZFUA 1LDJA 3HOZJ 1KU2A 4RA2A 2OUMA 2FMYA 3ZQGA 5D8LB 4JX5A 3I4MJ 3ABKH 4XR6A 1XGMA 1DP3A 4KFCA 1KU9A 4A3KJ 3G71I 1O3SA 2DQLA 1ZYRF 3EYYA 1JHFA 2KDZA 1EH7A 2CS3A 2B9SA 3T0YA 2WAQN 4IHTA 1WI3A 4BH9A 4FTHA 2XVCA 5E1XA 5L3FA 5DM6F 2A68F 2MG4A 3RPQA 2R5ZB 2XRLA 1FIPA 4FX0A 3IKTA 3DPUA 1ONVA 1XDUA 3VPRA 1NK2P 1FMWA 1D8JA 2VJJA 2DLLA 2L5QA 4LITA 2ZJRF 1Q1VA 3BR1A 3BR6A 2VQCA 3M8JA 3SDGA 4ENNA 4UNOA 4Y3OA 4KT5C 2XPUA 2DA4A 2EIKH 3H5NA 2Y0SA 1BIAA 2G7HA 4LOCA 1LUJB 5J8CA 3J81Z 1IV6A 1BI0A 1I27A 1WHUA 1LFBA 5FGMA 1FOKA 1FP2A 1JGSA 1A04A 1FZPB 2FMLA 3OOPA 2BOLA 2BVLA 1ZG5A 3MN2A 4PJMA 1S8NA 4XKCA 2L4AA 3WU0A 3WGIA 4MEXF 2FQ4A 1MNMC 2E5NA 2EIJH 4U0YA 2FU4A 1YJWI 1X4PA 2LBFB 4EMSA 2O61A 1OCOH 2AXLA 1VF9A 3H9QA 3JW4A 4A6EA 3HKZN 2JMWA 4A69C 4NBQA 3K70C 3BCBA 3FMSA 3JRCA 4E70A 4HSTA 2EB7A 4HQEA 2QSFX 4EEFG 4XOPA 2DJNA 4QWQA 1TNSA 4HG2A 2ME6A 3LNQA 2STTA 1DQUA 3AG3H 1MJBA 1K4SA 4ZJZA 2GWRA 4O5VA 3AG2H 2R7VA 5IYCJ 2VPLA 2V9VA 2EZKA 4D5FA 4A3DJ 4LD5A 1G8XA 3UR3C 1D1AA 3COAC 4HBLA 5FKOA 2VE8A 3W6KB 4U88A 3J80K 2V9KA 1ZKGA 2EFQA 3F23A 4DIQA 1IDYA 3ECOA 3JRIA 4KMFA 5E3LA 5M5XJ 2M30A 2O5RA 4DYCA 4MTDA 2R7XA 3C2HA 4IOAF 1KU7A 4U7BA 4Y7NJ 5IT9K 3M1EA 1X4OA 2K3PA 1LVKA 4G7OF 3KP7A 1IW7F 5FLMJ 2W82A 2AQEA 3GXOA 2KZVA 2HPMA 4LLNA 3I5UA 2WADA 2Z1DA 4BEHB 3CUQB 1P92A 3BG7A 2JVGA 4ANJA 5AONA 4AD9A 1IGNA 2ZXHA 5L3BA 1GVDA 1TZLA 5E3MA 4RAZA 2A5YB 2ELKA 3WTVC 1EJ9A 2Q2EB 5IYDJ 2A05A 5E17F 3CCUI 1FSEA 1RESA 3BP8A 1QBJA 1TWAJ 5H20A 1O7LA 1FT9A 2PX9A 3GVAA 5F1RA 2EINH 3DLLF 2D2WA 2CV1A 4DZJA 4RB0A 1F4KA 4MFDA 4OOIA 5FFZA 1I1SA 1Z3YA 4XNFA 3JRFA 5DDGA 1R5HA 4L0ZB 2L4MA 2DOAA 1W5SA 2HYGD 4L9VA 2B7EA 5EGOB 2ACJA 2QSHX 1MBJA 3IRQA 3CZ6A 1K6YA 2DXIA 3I9V2 4FCYA 4UVAA 5CJ9A 3V42A 2QYOA 4CH7A 5F6FA 3IAM2 2ZMEB 3ZN1A 3WTUC 2KZGA 1ZR2A 4YEJA 1MZBA 4A12A 1IXCA 2XF5A 3ONQA 1T0FA 2OQGA 3ULQB 2HOTA 4D1QA 4BJ5C 1SVLA 2IGOA 1Z9CA 1CGPA 2FF4A 3G1OA 3S93A 5EZHA 1T95A 2P4WA 1IXSB 4EM1A 3SEQA 2M1BA 4HLXA 4A3JJ 2DMUA 2XASA 2K9QA 2NAZA 3ABTA 2ZSIB 1XMKA 1Z6TA 3U1KA 4AUXA 2UZKA 2K27A 1YJ9I 1T8IA 1T38A 4EGYA 5EZGA 3K2AA 2O8XA 3ML6A 1I50J 2DA2A 2K9SA 2EH3A 3FKIJ 5HOOA 1I1GA 3WODF 1D0XA 5J3LA 1ETVA 3PSFA 2F6CA 3WGGA 1SEUA 4YFNF 5DD4A 3JAMK 1CF7B 1QHGA 2CW7A 2YS9A 1FEXA 3BG6A 1W7PA 3W2WA 1S7AA 2LKSA 4ZYDA 1WSUA 5D8KB 4EJUA 4BQAA 4B47A 1NK3P 1WJCA 2YPRA 3M7GA 5E8GA 3DU5A 3TW7A 2NVUB 1T33A 3KE2A 5E1WA 3OIPA 3TO7A 2HDWA 2OA4A 3SJMA 3GTMJ 2L2OA 4GXOA 1MDMA 1X3ZB 3HHGA 2QGUA 1W0TA 3OYHA 5EYRA 3RTRA 1Z77A 2F5EA 3TW6A 3PIOF 5IY5H 4L18B 1Z6RA 2DYRH 3MAJA 5KVRA 2K86A 1MSEC 3TP3A 2JTVA 1XD7A 1KQ9A 4C9YA 1J5YA 3LA3A 1ORKA 1FYKA 3RDIA 2LBFA 2MLGA 5FB2A 4M9XA 1J2XA 1Z0XA 1XX5A 2V6CA 2DT7B 1FC3A 4MEYF 4NDLA 1RUOA 2ZXWH 2DDAA 2OTLI 2BVMA 2YU3A 2DA3A 1R1UA 3I58A 4GO1A 4EVIA 2H1KA 1MMGA 4FT8A 5IOZA 3VSKA 4UUSA 3WHCA 1X2NA 2DOFA 2RVCA 3HYIA 4X1EA 3JRAA 2X4HA 4XM3A 4HA8A 3VSLA 1K61A 3WTTC 3WE3A 1J09A 3WG9A 2M87A 3KIOA 4MIMA 1T2KA 2IA1A 3PNVA 1LFPA 4IRIA 1OCTC 2AS5F 4M74A 4NC7A 1U8RA 3SZTA 1HKTA 3RCOA 3HGYA 2KP6A 1JI8A 5DD8A 2DTRA 4G6DA 1JKQC 2HDDA 2GA2A 4WX9A 3EUAA 1XTAA 5D6FA 1N25A 2KDOA 2R7RA 4IXAA 1U5TC 5B5EC 1RNLA 3D0SA 3MKLA 2H27A 1YG2A 1ODDA 3T8RA 2JZYA 1YYVA 2O6GE 5KHDA 1G2HA 1TL8A 3DTIA 4EV0A 1B72B 5EEAA 1ON1A 2IBDA 4HF1A 2UXNA 5FD5A 2KMUA 3TMOA 2LH9A 1ZGWA 5EEHA 3L9FA 2X0LA 2VC1A 3CDLA 2MBFA 1U5TA 1SFKA 2IEKA 5IYBJ 4ZDOA 2OQRA 1MBEA 5TISC 2NRAC 3OYKA 2FEZA 3NRVA 2XF6A 3ABMH 3OYGA 2A61A 4KYWA 1F43A 5A2QZ 1HCRA 2PN6A 2RKHA 5LRSA 2X6OA 3F22A 1P4WA 2XB5A 5F0CA 3OYEA 2R7FA 1OLTA 2LY1A 3KEYA 2ID3A 4RM2A 3QYEA 4UVBA 4A3MJ 3E97A 4E7IA 2WAEA 2KISA 2K3FA 4M3GA 4AVZA 1ETKA 4E7ZA 4MLOA 3L2RA 1A6IA 1WPKA 2XROA 1JHHA 3FXOA 1YQAA 2Y75A 2I8DA 4O6JA 1IG7A 2R7ZJ 1HDPA 2D1HA 3KLOA 2JRMA 2QSGX 2XPVA 3CJQB 3CDIA 2GQQA 3DEWA 5J1UA 1F36A 3CUQC 3ECHA 3OYJA 3CCJI 1LE8A 4CSWA 3DCFA 5GPCA 2K4JA 1RPWA 4CCOA 1YFHA 3PNTA 3PFYA 4LLGF 4AYBA 4ZC3A 3ASOH 3FBNB 2ZMEA 4A3EJ 2AXTC 1EH6A 2E19A 3QQAA 5C44J 5DYMA 2VUMJ 1A5JA 2CMPA 3HHHA 4AVPA 1LVAA 5D4RA 2QQ9A 1XS9A 4X0GA 1YW7A 2Q8KA 4PJNA 1SC7A 3KP5A 4UB8C 2DI3A 5HLTA 3DTEA 3IKVA 4GCVA 3AL0B 2GBYA 2L9RA 2VB6A 1TW3A 1KQ8A 1IV8A 1WVRA 2D5VA 2AHQA 1ERDA 2DAOA 4JP0A 2M34A 2DT5A 4RDUA 1XC5A 4U87A 3H3UA 5EJCA 1ETWA 5JLWA 3OS1A 2DO7A 1Y39A 4QSHA 2FOKA 4LB5A 3CMMA 2STWA 4XLNF 4PJJA 4A3CJ 3BC8A 2O7OA 2WWYA 2VT3A 1XSXA 2EZHA 4DW6A 1KQ0A 3E1SA 1IRFA 1CF7A 2NXNB 2VQLA 2VXZA 3Q9SA 3RYPA 4IHWA 5FRNA 1QZEA 1PUFA 4YFKF 4C3JJ 2HOEA 5CYVA 3OYFA 3M8FA 1V5FA 2E2HJ 1W7PD 2BY0A 2H1LA 2K4BA 2XGXA 4W97A 3IC7A 3HUGB 4GRIA 3WTXC 3P5JA 4I02A 1SAXA 3K1MA 3A01A 3EUKL 2F4OB 2PMUA 3E6CC 2LMDA 3BG9A 2ECBA 3K7AJ 4M3DA 4E7SA 3ZMTA 4LMYA 1U3EM 1UHMA 2IP2A 2I10A 1K83J 1FIAA 4BY7J 4ASNA 3JTGA 3KYDB 3KFWX 1U0JA 2F5FA 2O0YA 2VBYA 1SVOA 2NOGA 1STZA 2IJLA 4XK4A 3OYLA 2RNJA 4ESFA 2OPTA 1UCRA 3KZZA 2DJIA 4I6ZA 3A0BC 2KLOA 3HOUJ 4AU7A 3HRMA 2XGEA 3CD6I 2OTJI 2A69F 2HYFA 3GTLJ 3ZMSA 1EA3A 1V55H 4HLYA 1PP7U 3S14J 4HDUA 3KCCA 1DPRA 2EPFA 1BOAA 3FXLA 2YSRA 4MHGA 2MC4A 3MFKA 2K40A 4NC6A 2VKEA 3VYRB 2IGMA 1FYLA 1ENHA 5D4SA 3VODA 4CXFA 1L0OC 1GV2A 1QQIA 2Z99A 2FBHA 5B1AH 2DMTA 3OV8A 3KYLA 3KEOA 3J81K 2M9HA 1AOYA 5JVGF 1ZK8A 5FLXZ 4GDFA 4CYCA 2LVSA 5HLIA 3GFLA 2YUSA 2M45A 1RR7A 5ICFA 4N9IA 2K85A 4IKFA 2V4JC 1R00A 3FXQA 2VJ4A 3DFGA 4HSRA 2J5PA 3DV8A 3GZ6A 4KITB 4PGHA 2VQGA 4RS8A 2BV6A 3E6BA 1P7JA 3K1PA 3RZDJ 5IT9Z 3H5AA 4G6TB 3CC2I 1A35A 5K7FA 4UHTA 1R4NB 4CCLA 3K0LA 1Z1DA 2R5ZA 2PJRA 2ELHA 4OMZA 4TV7A 2DMNA 2QBYB 1WJFA 4BY1J 1A36A 1IUFA 3WHBA 4ZZDA 3GCMA 3ROUA 2QQAA 4M3FA 1E3PA 1VQKI 2DYSH 5IT3A 2CGPA 5J40A 4EJOA 1IN6A 3CCMI 3LSHA 1QGPA 3QPLA 2ZNZA 4A6DA 2EZIA 5LEKA 1J7KA 5BPDA 1H9GA 2FD5A 1JKOC 5DV5A 1R7JA 3GFJA 3JRHA 4IHVA 2R7UA 4ESBA 4ENMA 3B6CA 3OR2C 2RV8A 4XLHA 5TGTA 4EJWA 5DUKA 4E7JA 2GOMA 2M8GX 2W1OA 3ZQQA 2IT0A 1VQPI 1TW2A 1KYWA 3DBLB 3JSPA 1OFCX 1YS7A 5HDKA 2A07F 3LFKA 1FP1D 1VQ9I 1JXSA 2EFNA 5HVQC 3L2WA 1CQTA 2Z3YA 4EGZA 1ZG1A 2PJRB 1YOVB 3G3ZA 3OYMA 4HZFA 4HDVA 4YIRX 1Z05A 4F3QA 2LOOA 2LR8A 1DU6A 3BJOA 3REOA 3FHZA 4IZZA 3QYFA 5CLSA 4OIRF 4LFUA 1HF0A 4XRFA 3ERED 3CCVI 1LE8B 1U6GA 4C3IJ 3K4KA 2PMZA 1MDMB 3V4GA 2HTSA 2DW4A 5LRRA 2HOAA 1K78B 1B1BA 1OJLA 1IO2A 3BPVA 4MGRA 1BA5A 1OR7A 4E7HA 4PFPA 3KEQA 2WB1N 2MD0A 5K5RA 2EV6A 2WBMA 3V7CA 1QA6A 1S7EA 4L9TA 1UAAA 3PSIA 1ZTRA 3T5XA 1R49A 1FJLA 3Q9VA 4BXUA 1KZHA 3V7SA 3MVPA 1WJBA 4N4NB 3OYDA 2X1CA 3FHNA 4I2OA 2CSOA 4DZPA 3R6SA 3LSKA 2Y2ZA 2UXXA 3EYIA 2ZC2A 5CVRA 4FISA 3M3YJ 3PQJA 2X1EA 4OWRB 1U78A 2PLYA 4AC0A 1MIJA 3S2DJ 5D6EA 2ZNYA 1YRNB 5L3GA 1B8IB 3JRGA 2DOEA 2ECCA 3H1CA 4DNCA 3UNGC 5FJ8J 3EUHC 1V4RA 2IA0A 4S04A 2IPQX 3BWGA 3QPHA 5K1YA 3HPHA 1Z67A 3BZKA 2XAQA 3LSGA 1ZR4A 1UG0A 5J1RA 2Z2SB 3ZOBA 3IRRA 1V54H 3HUGA 4DQ2A 2M2EA 5LHHA 2DFFA 1BI3A 1U5TB 4RB3C 1YJNI 2IAIA 4LIVA 1YTYA 3K6GA 2XHKA 3N4MA 2FE3A 1BW6A 3F8CA 2JVHA 2VQHA 3LQQA 2KJCA 1FYMA 3CMEI 1MBHA 2L9SA 1FBUA 3GTGJ 4MQVA 2VL8A 1Z21A 3HSRA 2Y9YA 3OIOA 1R9TJ 1ACIA 1IRGA 4I99C 1NG6A 4HX8A 3V8LA 4H0EA 4B4CA 1X19A 1B8IA 4P55A 2BE5F 4YG2F 4AM3A 3FXMA 2IS2A 1B59A 1AKHA 4BXXJ 2EFPA 1X1BA 3HTSB 5JR3A 2JPBA 2HU9A 1QZYA 2HDCA 3GFIA 2KRHA 2NYXA 4E6KG 3SYTA 2QA4I 2LF7A 4R8HA 2GA1A 3G4SI 1GVJA 3GW2A 4KT6A 3WTSC 2X1DA 4IJAA 3LSTA 2JRTA 4Y4RA 2HPIA 1E0EA 2K9LA 3DLAA 4Z6YA 1Y1VJ 1TTYA 3I53A 2GAUA 5L3EA 1OMIA 2LY9A 2TCTA 1MBFA 1P6RA 1X3UA 2LSOA 2M7AA 1UHSA 3V8JA 3HL2A 4AIJA 3RQ4A 2DDBA 1OCRH 1YLFA 1OISA 3HB9A 2F4IA 1IZ1A 1O7FA 1QVUA 3VOEA 2L7ZA 3DKXA 3BY6A 2VODA 2IVMA 3SXYA 4A93J 2ZSHB 4BUPA 2JT1A 4XSXF 3I55I 1C0WA 2UWMA 5FKNA 2K9MA 4PJ0C 3LSPA 1A31A 2LRDA 2COMA 3F8MA 5C3EJ 2JN6A 3DTKA 4HV6A 5DTDA 4A0YA 3J7AO 2XSDC 2E1OA 2KL4A 2W7NA 4LK1F 2Y0SN 3H3VK 1UZCA 2XKOA 1OKRA 4BQOA 2XV4S 2K5CA 4C30A 3C1DA 3IWFA 3GEZA 1HW5A 5FD6A 2EA4A 1R5GA 3LSIA 1GT0C 2JA8J 2ID6A 4U7DA 3GBGA 4FE7A 3ABLH 5J47A 3CF5F 2XIGA 1IF1A 2R0QC 1U9NA 1HSTA 3ELKA 5J1YA 1UFMA 3U2RA 2DA5A 4KNYA 1Z7UA 2H09A 4K2EA 2EV0A 5GTHC 2P7CB 4XKWA 3E5XA 1G4DA 4NQWB 3QP5A 5BPIA 2F2EA 1HC8A 3ZR8X 4DGWB 3RPUA 4OAZA 1Y6IA 3OOUA 4NNJA 4N0BA 2E1CA 4IF4A 1JT0A 5KNLA 3QOPA 1WJDA 4UXNA 4B43A 2G9WA 5EEGA 1DP7P 3BJAA 5J4VA 1IXRC 2R7SA 3LMMA 1ZAOA 3RKXA 5K7HA 2EQRA 3QAHA 2RNGA 3RKYA 5LHGA 4J19A 3HOWJ 2QZ8A 2XUBA 4KDPA 2J5OA 3CF2A 1K78A 4LJZF 3TKYA 3DPLC 4KICA 1MH3A 2MA3A 5J4YA 2KIUA 1YHQI 3S16J 1WJEA 4ZTFA 2IRFG 1OCZH 5FLVA 1TT0A 1W36C 3ZXSA 3D5LA 3FXRA 3W2AA 3BZCA 2NS8A 2E1NA 2IXSA 2P6TA 3FXJA 1Z3XA 3H0DA 2FUG2 5H6RA 2KPMA 1J0RA 1HKSA 1QZZA 2ZJ2A 3HOXJ 4WF2A 5F0FA 3JRDA 3SQNA 3MMYB 3DBHB 4M9SA 4YRVA 3BR0A 3O6BB 1Y8QB 3SZGA 3PO3J 3S3NA 1YI2I 2M5WA 1FPQA 2DFEA 3FKJA 3HRTA 4BJ6C 3T8TA 2FXAA 3F8FA 2CWEA 5GP9A 2OAZA 2ZBKA 5ILSA 2OCEA 3V8KA 2MH9A 2E1MB 3JTHA 3J7AY 1GHCA 4L9JA 3E6MA 2DQRA 1BR2A 5D5VB 4NHJA 2JUCA 4CYCB 4Y17A 4Q48A 2MGQA 3HIFA 1MJ9A 2EWNA 3OSGA 2L7MP 4PJLA 1WH5A 1ETOA 2PQ8A 3RIRA 1VQOI 4R1HA 1JKPC 2E35A 3SDBA 1MH4A 4M72A 3IV5A 3HBLA 1KONA 4B09A 4OIQF 2XSJC 2VI6A 4XLCA 4XORA 1HW2A 5F27A 1OYWA 1XN7A 2CQXA 3I4NJ 3WU2C 2R3SA 3OYBA 1P7IA 3UKGA 2L01A 1TQPA 3HXLA 3S2WA 3QODA 4ABZA 1QPMA 2W24A 3S17J 1R23A 2P5KA 1E2XA 2ISYA 2JSCA 3D5SC 4J00A 1VQ7I 1T6SA 3AAFA 2DT6A 4PZJA 2VONA 2M4GA 4D0PA 3BPXA 2CUEA 3S2HJ 3HOSA 2JA5J 3CC4I 2DPDA 4HOBA 4DYQA 2VOOA 3OMYA 3OR1C 4V2FA 4M9ZA 1TQMA 1BI2A 1KGSA 5GAEJ 4JQFA 2QQBA 3MKWB 3LSRA 3GX4X 2HKXA 5LBQA 1R1VA 4AYBN 3EPZA 1I5ZA 4N4OB 5E1ZB 3ZQHA 1HXDA 2MW8A 3JAMZ 4MTEA 1JUSA 1LKXA 1PJRA 4ENKA 2R7QA 3A03A 5M3FJ 1VTNC 3K4LA 1X1DA 3BG3A 1TWHJ 1PP8F 3P9KA 3FISA 1ZGJA 5F64A 4CZZA 3I59B 2WA0A 3PUBA 4G6QA 1W0UA 4XICA 3OYNA 3P9CA 4C2MJ 1BI1A 3O8GA 2V7FA 4MQ9F 3FWEA 1ZARA 1QRYA 2YU9J 3TOAA 2MSYA 2R5YA 3BR3A 3VYUB 4ZTJA 4BHCA 2CRGA 4J01A 2GXGA 2VBZA 3Q0VA 1OCPA 5H2FC 1HBXG 1ZELA 2GXAA 2EBIA 1XG1A 3HSFA 3I56I 1K6OA 2WC2A 2KHMA 2VBWA 1WJ5A 3FXUA 2X6YA 1H88C 4YELA 1TQIA 1F1ZA 1W4MA 4IRGA 3KX2A 1G3SA 1O4XA 3W3CA 3DKWA 2HQ5A 3LL7A 3LQRA 3BJ6A 3AL0C 1JUPA 5KAFC 3F72A 2E2JJ 4NQWA 5E18F 2KIFA 5GPAA 3G6EI 2R93J 1MMAA 3M9AA 2KRFA 3HKZA 5JLXA 1JUMA 3K4JA 3IH3A 2A6HF 3I59A 3PUFA 3QOEA 3C7JA 1LEAA 1DGWY 1FWZA 4G7ZF 3GMEA 1X1AA 1N77A 3QWLA 2DN0A 2P5LC 2VOPA 1IN4A 4ZZLA 3ABUA 4KA4A 3DEEA 4XRSG 3CP2A 1J75A 2WV1A 1W1WE 2O3FA 1B9NA 3PL8A 2MABA 3A2KA 5F0HA 1FY7A 2F48A 4ITVA 4O3MA 1XCBA 2YX4A 4CCKA 1SD4A 4YFXF 2DMPA 5IP9J 2ZFWA 4BQQA 3NAUA 2BGCA 2HXIA 5LLQA 1FOXA 2FQ3A 4QIWN 2ZCWA 2ISZA 1IRZA 1USSA 2OZ6A 3K4BA 3Q3SA 3RKQA 5FKMA 1K4TA 1TC3C 2JA2A 3BCAA 3CO6C 2W4SA 1KYZA 3B6AA 2X48A 4U0WA 2VLAA 1O3RA 2EK5A 3AKZA 5KAIC 5JVTA 4PFOA 2JJ7A 4BBSJ 1EH8A 5HLHA 4M6VA 4U0VA 5E3NA 3CCRI 1K79A 1QU3A 2VXDA 3CUQA 1VQMI 3KZIC 3ZN0A 1VQ4I 1ETXA 3F6VA 4MFEA 2M8EA 1H8AC 2PEXA 2CQNA 5D5WB 2LLKA 2ZO4A 3QRFF 2IA2A 1P4AA 2XDVA 3FK6A 2BY1A 2A3SA 2Q0OA 4MNUA 4RM3A 4L0YB 1PYVA 1Y56A 1DGRM 5B3SH 5FLXK 4P96A 2CFOA 2Q1ZB 4HX7A 5GAGJ 4CA0A 1T39A 2BZTA 5LGTA 3S32A 2ZXJA 3G2BA 4XONA 3CTAA 3PJRA 1BW5A 3GTQJ 4XMYA 2YR2A 4ZYAA 2L9NA 4RB2C 4W1UA 3RJPA 4XRSA 2NVTJ 5EGOA 4KN7X 4BHPA 1ZN2A 1MBKA 2JWTA 1SANA 1YIOA 2F5DA 5BNGA 4JX4A 4KJZA 2QF7A 3GZ5A 4WXHA 3KP2A 5M5WJ 3VFZA 4A3BJ 2DFIA 2E71A 2ME0A 3H5RA 4JBAA 4BAYA 4OMYA 3GYHX 1Z7LA 2XB0X 1R58A 1ON2A 2JSPA 3C2GA 1FOYA 4M6XA 2FNAA 2HR3A 4DBQA 2DCEA 5M5YJ 1GDTA 2PFBA 3MZ8A 1MD0A 2TDXA 4E4HA 2CG4A 2X85A 2Y31A 2EIMH 1QHHD 3OL4A 4JOMA 3K4MA 5CQEA 1JJ6C 3ZQLA 4A2UA 4EJTA 2R7DA 3C18A 4RAFA 3CLQA 2BEOA
chains in the Genus database with same CATH topology
2M2EA 2GLOA 3JR9A 2H8RA 1GV5A 2YS9A 2IAIA 1FEXA 2W48A 4D7NA 1ETQA 2KT0A 1BW6A 4JYKA 4A3FJ 5IOYA 2CJJA 1NK3P 1POGA 1MBHA 4G12A 1FTTA 3JREA 3GTGJ 3OIOA 2Y9YA 1R9TJ 3TW7A 2DA6A 1T33A 3SJMA 3GTMJ 4B4CA 1B8IA 1RKWA 5C4XJ 2B63J 4BKXA 4C3HJ 4D5CA 3BTIA 1W0TA 1APLC 5EYRA 5IP7J 1Z77A 1AKHA 3TW6A 1BJZA 4BXXJ 3G1MA 1MSEC 4DYRA 3TP3A 3CCYA 2K9NA 3IH4A 4A3IJ 1ORKA 4I76A 2DA7A 4RBOA 3TEDA 1ZQ3P 1Z0XA 3JRBA 1Y1VJ 2LTPA 1WH7A 4NDLA 2HYJA 2DA3A 2H1KA 1NTCA 2LY9A 2TCTA 5IOZA 1MBFA 4UUSA 1UHSA 4IHYA 5EG0B 1GUUA 3O8HA 3WHCA 1X2NA 4X1EA 4Y52J 3JRAA 3HB9A 1K61A 2LFBA 1QVUA 2L7ZA 4MIMA 3ZQIA 5EF6A 3OSFA 2O8KA 4A93J 2RAEA 1OCTC 5FKNA 5IP6A 1TWFJ 3HGYA 3LSPA 5C3EJ 4IHXA 2JN6A 3BG5A 3BTCA 3TP0A 5DTDA 1JKQC 2XSDC 2E1OA 2HDDA 3ZQFA 1EF4A 2Y0SN 3H3VK 3MKLA 1GT0C 1VI0A 2JA8J 3HDDA 2ID6A 1G2HA 3GBGA 4FE7A 1B72B 5EEAA 2IBDA 4MO7A 3S15J 1LFUP 2CUFA 2R0QC 2DMQA 1U9NA 1ZGWA 5J1YA 3CDLA 2NS7A 2IEKA 2DA5A 5IYBJ 3A02A 2HOSA 4FE4A 1MBEA 1QPIA 3BQZA 4M3BA 5EDNA 5C4JJ 3C2BA 1IDZA 3PM1A 1JTXA 1F43A 1HCRA 2HI3A 2GM4A 2VPRA 1BL0A 1YRNA 2X6OA 4QTRA 3OOUA 2X9DA 2NVXJ 2XB5A 5F0CA 1JT0A 1MBGA 3E7LA 2ID3A 2NVQJ 4A3MJ 4X6AJ 1HLVA 3BT9A 2EZLA 4M3GA 3G1LA 1ETKA 3HM5A 2Y9ZA 4MLOA 5K7HA 2EQRA 2Y30A 1A6IA 1WPKA 4A3LJ 4J19A 3HOWJ 3M4OJ 3CMYA 1IG7A 1T56A 2R7ZJ 1DU0A 1HDPA 1TWCJ 1Y1WJ 1MH3A 2XPVA 2R92J 2QCOA 2G0EA 5M3MJ 1WCMJ 3S16J 3DEWA 1VFCA 5J1UA 1F36A 5FLVA 2FJ1A 5F1JA 2PMZN 1LE8A 3DCFA 5GPCA 5F08A 1RPWA 3BTLA 1X2MA 2NS8A 2COBA 3RZOJ 2CQQA 3S1NJ 4A3EJ 3FK7A 2E19A 3HOXJ 5F0FA 1RETA 3S1RJ 3QQAA 3BR2A 3LOCA 5C44J 5FKKA 4UUSB 3JRDA 2VUMJ 5EG0A 1A5JA 3W6VA 3BR0A 1XS9A 4JX6A 1JKRC 2XGDA 1UG2A 2TRTA 3PO3J 1ETYA 3GTKJ 1MSFC 2JA6J 9ANTA 1UMQA 5GP9A 2GBYA 2L9RA 2JK3A 3GTOJ 2D5VA 2AHQA 4CYCB 4JP0A 2M34A 2XGCA 4RDUA 1XC5A 2MGQA 3OSGA 3S1QJ 1ETWA 5JLWA 2L7MP 1WH5A 1JGGA 1ETOA 4QSHA 3LSJA 1JKPC 4GFBA 1MH4A 4A3CJ 3GTJJ 2O7OA 3IV5A 3HBLA 4DW6A 2EZHA 2AO9A 2VI6A 1AHDP 2FX0A 5F27A 4IHWA 3BQYA 2CQXA 3I4NJ 1PUFA 3L1PA 4C3JJ 1P7IA 3UKGA 4XRMA 1VNDA 2E2HJ 1AU7A 2XPWA 1TWGJ 4ABZA 4W97A 4M3EA 3S17J 1PUFB 3RQIA 1I6HJ 2DTZA 1IJWC 3A01A 3BG9A 3K7AJ 2ECBA 4M3DA 1JJ8C 1WGXA 3BTJA 2CUEA 3S2HJ 5HODA 4HNVA 2I10A 1K83J 2JA5J 1FIAA 4BY7J 3S1MJ 4DYQA 3HOZJ 2NOGA 4V2FA 4XK4A 3ZQGA 4JX5A 2OPTA 3I4MJ 2ZB9A 3LSRA 4I6ZA 4AYBN 4A3KJ 1ITYA 3HOUJ 1H89C 2XGEA 3CQZJ 2KDZA 1B72A 3GTLJ 2WAQN 3ZQHA 1WI3A 2MW8A 3S14J 4FTHA 1JUSA 2MG4A 1D5YA 2R5ZB 2XRLA 3A03A 5M3FJ 1FIPA 1I3QJ 3BG3A 1NK2P 1TWHJ 3VPRA 2K40A 1X58A 3FISA 2VKEA 1ENHA 1Q1VA 3BR1A 3BR6A 3HGGA 3SDGA 1W0UA 4XICA 1GV2A 4C2MJ 3ZQCA 2DMTA 2XPUA 2M9HA 3O8GA 2DA4A 1QRYA 2YU9J 1ZK8A 2MSYA 2R5YA 3BR3A 4LOCA 4S0HB 4CYCA 2CRGA 3Q0VA 1OCPA 1IV6A 2LVSA 5FKLA 2EBIA 1XG1A 1LFBA 2N8GA 4V2GA 2YUSA 1RR7A 1SFOJ 4B1RA 3MN2A 1H88C 1FTZA 2FQ4A 1MNMC 1O4XA 1P7JA 2HQ5A 5F04A 3RZDJ 1VF9A 1JUPA 3HKZN 2E2JJ 1RKTA 2JMWA 4A69C 5GPAA 3JRCA 2R93J 3H0GJ 5K7FA 3HEFA 2LKXA 4EEFG 2DJNA 5JLXA 1JUMA 3FIWA 2ME6A 3IH3A 2R5ZA 1E3OC 3LNQA 2DMNA 1HOMA 1AKHB 4BY1J 1IUFA 3WHBA 1HDDC 3QPSA 2DN0A 4M3FA 5IYCJ 2EZKA 3IH2A 4D5FA 4A3DJ 4XRSG 5FKOA 4UUTA 2WV1A 2O9LA 1ZKGA 2R5YB 1IDYA 3QPLA 2EZIA 5F0HA 3JRIA 5E3LA 5M5XJ 3HOVJ 4DYCA 5E3OA 2FD5A 1JKOC 2CU7A 3JRHA 4Y7NJ 4IHVA 3B6CA 2DMPA 5IP9J 3NAUA 2HXIA 2M8GX 3Q0WA 4QIWN 1IRZA 5FLMJ 2M0CA 1OFCX 3Q3SA 3RKQA 5FKMA 1TC3C 1U8BA 2LK2A 1CQTA 3B6AA 2X48A 2JA7J 1IGNA 1GVDA 2LR8A 1DU6A 2JJ7A 5E3MA 4BBSJ 2ELKA 2L0KA 5IYDJ 4M6VA 1JT6A 5E3NA 1RESA 1HF0A 1TWAJ 1LE8B 4C3IJ 1ETXA 4MFEA 4DZJA 5K7ZA 1H8AC 2HOAA 1QVTA 1OJLA 4MFDA 2HXOA 2LLKA 4B3AA 3A01B 1BA5A 3JRFA 5DS9A 2P81A 3FK6A 4IEJA 2NVYJ 3PO2J 2WB1N 5EGOB 1MBJA 1S7EA 3SFIA 2VKVA 3NARA 1ZTRA 4FCYA 1FJLA 3MVPA 4XIDA 1BW5A 3GTQJ 1ZR2A 2NVTJ 4W1UA 4XRSA 4DZPA 5EGOA 1MBKA 2L7FP 2Y2ZA 3F0CA 2JWTA 1SANA 2HOTA 5BNGA 4FISA 3Q0UA 4JX4A 2LD5A 3HOYJ 2QF7A 3M3YJ 3G1OA 1U78A 5M5WJ 4A3BJ 4A3GJ 4AC0A 5EZHA 3S2DJ 4BBRJ 2ME0A 1JTYA 2OF7A 1YRNB 4L5EA 2XB0X 1B8IB 4A3JJ 2DMUA 3JRGA 2ECCA 2K9QA 5FJ8J 3GTPJ 5M5YJ 1GDTA 4AUXA 1U9OA 2DA1A 5IPAA 2Y31A 4D7MA 5EZGA 2E2IJ 3K2AA 2LP0A 1I50J 3BR5A 2DA2A 3LSGA 2K9SA 2EH3A 3D1NI 1JJ6C 3FKIJ 3ZQLA 1ZR4A 5J1RA 3ZOBA 5J3LA 1ETVA 1IC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2E A;  2GLO A;  3JR9 A;  2H8R A;  1GV5 A;  2YS9 A;  2IAI A;  1FEX A;  2W48 A;  4D7N A;  1ETQ A;  2KT0 A;  1BW6 A;  4JYK A;  4A3F J;  5IOY A;  2CJJ A;  1NK3 P;  1POG A;  1MBH A;  4G12 A;  1FTT A;  3JRE A;  3GTG J;  3OIO A;  2Y9Y A;  1R9T J;  3TW7 A;  2DA6 A;  1T33 A;  3SJM A;  3GTM J;  4B4C A;  1B8I A;  1RKW A;  5C4X J;  2B63 J;  4BKX A;  4C3H J;  4D5C A;  3BTI A;  1W0T A;  1APL C;  5EYR A;  5IP7 J;  1Z77 A;  1AKH A;  3TW6 A;  1BJZ A;  4BXX J;  3G1M A;  1MSE C;  4DYR A;  3TP3 A;  3CCY A;  2K9N A;  3IH4 A;  4A3I J;  1ORK A;  4I76 A;  2DA7 A;  4RBO A;  3TED A;  1ZQ3 P;  1Z0X A;  3JRB A;  1Y1V J;  2LTP A;  1WH7 A;  4NDL A;  2HYJ A;  2DA3 A;  2H1K A;  1NTC A;  2LY9 A;  2TCT A;  5IOZ A;  1MBF A;  4UUS A;  1UHS A;  4IHY A;  5EG0 B;  1GUU A;  3O8H A;  3WHC A;  1X2N A;  4X1E A;  4Y52 J;  3JRA A;  3HB9 A;  1K61 A;  2LFB A;  1QVU A;  2L7Z A;  4MIM A;  3ZQI A;  5EF6 A;  3OSF A;  2O8K A;  4A93 J;  2RAE A;  1OCT C;  5FKN A;  5IP6 A;  1TWF J;  3HGY A;  3LSP A;  5C3E J;  4IHX A;  2JN6 A;  3BG5 A;  3BTC A;  3TP0 A;  5DTD A;  1JKQ C;  2XSD C;  2E1O A;  2HDD A;  3ZQF A;  1EF4 A;  2Y0S N;  3H3V K;  3MKL A;  1GT0 C;  1VI0 A;  2JA8 J;  3HDD A;  2ID6 A;  1G2H A;  3GBG A;  4FE7 A;  1B72 B;  5EEA A;  2IBD A;  4MO7 A;  3S15 J;  1LFU P;  2CUF A;  2R0Q C;  2DMQ A;  1U9N A;  1ZGW A;  5J1Y A;  3CDL A;  2NS7 A;  2IEK A;  2DA5 A;  5IYB J;  3A02 A;  2HOS A;  4FE4 A;  1MBE A;  1QPI A;  3BQZ A;  4M3B A;  5EDN A;  5C4J J;  3C2B A;  1IDZ A;  3PM1 A;  1JTX A;  1F43 A;  1HCR A;  2HI3 A;  2GM4 A;  2VPR A;  1BL0 A;  1YRN A;  2X6O A;  4QTR A;  3OOU A;  2X9D A;  2NVX J;  2XB5 A;  5F0C A;  1JT0 A;  1MBG A;  3E7L A;  2ID3 A;  2NVQ J;  4A3M J;  4X6A J;  1HLV A;  3BT9 A;  2EZL A;  4M3G A;  3G1L A;  1ETK A;  3HM5 A;  2Y9Z A;  4MLO A;  5K7H A;  2EQR A;  2Y30 A;  1A6I A;  1WPK A;  4A3L J;  4J19 A;  3HOW J;  3M4O J;  3CMY A;  1IG7 A;  1T56 A;  2R7Z J;  1DU0 A;  1HDP A;  1TWC J;  1Y1W J;  1MH3 A;  2XPV A;  2R92 J;  2QCO A;  2G0E A;  5M3M J;  1WCM J;  3S16 J;  3DEW A;  1VFC A;  5J1U A;  1F36 A;  5FLV A;  2FJ1 A;  5F1J A;  2PMZ N;  1LE8 A;  3DCF A;  5GPC A;  5F08 A;  1RPW A;  3BTL A;  1X2M A;  2NS8 A;  2COB A;  3RZO J;  2CQQ A;  3S1N J;  4A3E J;  3FK7 A;  2E19 A;  3HOX J;  5F0F A;  1RET A;  3S1R J;  3QQA A;  3BR2 A;  3LOC A;  5C44 J;  5FKK A;  4UUS B;  3JRD A;  2VUM J;  5EG0 A;  1A5J A;  3W6V A;  3BR0 A;  1XS9 A;  4JX6 A;  1JKR C;  2XGD A;  1UG2 A;  2TRT A;  3PO3 J;  1ETY A;  3GTK J;  1MSF C;  2JA6 J;  9ANT A;  1UMQ A;  5GP9 A;  2GBY A;  2L9R A;  2JK3 A;  3GTO J;  2D5V A;  2AHQ A;  4CYC B;  4JP0 A;  2M34 A;  2XGC A;  4RDU A;  1XC5 A;  2MGQ A;  3OSG A;  3S1Q J;  1ETW A;  5JLW A;  2L7M P;  1WH5 A;  1JGG A;  1ETO A;  4QSH A;  3LSJ A;  1JKP C;  4GFB A;  1MH4 A;  4A3C J;  3GTJ J;  2O7O A;  3IV5 A;  3HBL A;  4DW6 A;  2EZH A;  2AO9 A;  2VI6 A;  1AHD P;  2FX0 A;  5F27 A;  4IHW A;  3BQY A;  2CQX A;  3I4N J;  1PUF A;  3L1P A;  4C3J J;  1P7I A;  3UKG A;  4XRM A;  1VND A;  2E2H J;  1AU7 A;  2XPW A;  1TWG J;  4ABZ A;  4W97 A;  4M3E A;  3S17 J;  1PUF B;  3RQI A;  1I6H J;  2DTZ A;  1IJW C;  3A01 A;  3BG9 A;  3K7A J;  2ECB A;  4M3D A;  1JJ8 C;  1WGX A;  3BTJ A;  2CUE A;  3S2H J;  5HOD A;  4HNV A;  2I10 A;  1K83 J;  2JA5 J;  1FIA A;  4BY7 J;  3S1M J;  4DYQ A;  3HOZ J;  2NOG A;  4V2F A;  4XK4 A;  3ZQG A;  4JX5 A;  2OPT A;  3I4M J;  2ZB9 A;  3LSR A;  4I6Z A;  4AYB N;  4A3K J;  1ITY A;  3HOU J;  1H89 C;  2XGE A;  3CQZ J;  2KDZ A;  1B72 A;  3GTL J;  2WAQ N;  3ZQH A;  1WI3 A;  2MW8 A;  3S14 J;  4FTH A;  1JUS A;  2MG4 A;  1D5Y A;  2R5Z B;  2XRL A;  3A03 A;  5M3F J;  1FIP A;  1I3Q J;  3BG3 A;  1NK2 P;  1TWH J;  3VPR A;  2K40 A;  1X58 A;  3FIS A;  2VKE A;  1ENH A;  1Q1V A;  3BR1 A;  3BR6 A;  3HGG A;  3SDG A;  1W0U A;  4XIC A;  1GV2 A;  4C2M J;  3ZQC A;  2DMT A;  2XPU A;  2M9H A;  3O8G A;  2DA4 A;  1QRY A;  2YU9 J;  1ZK8 A;  2MSY A;  2R5Y A;  3BR3 A;  4LOC A;  4S0H B;  4CYC A;  2CRG A;  3Q0V A;  1OCP A;  1IV6 A;  2LVS A;  5FKL A;  2EBI A;  1XG1 A;  1LFB A;  2N8G A;  4V2G A;  2YUS A;  1RR7 A;  1SFO J;  4B1R A;  3MN2 A;  1H88 C;  1FTZ A;  2FQ4 A;  1MNM C;  1O4X A;  1P7J A;  2HQ5 A;  5F04 A;  3RZD J;  1VF9 A;  1JUP A;  3HKZ N;  2E2J J;  1RKT A;  2JMW A;  4A69 C;  5GPA A;  3JRC A;  2R93 J;  3H0G J;  5K7F A;  3HEF A;  2LKX A;  4EEF G;  2DJN A;  5JLX A;  1JUM A;  3FIW A;  2ME6 A;  3IH3 A;  2R5Z A;  1E3O C;  3LNQ A;  2DMN A;  1HOM A;  1AKH B;  4BY1 J;  1IUF A;  3WHB A;  1HDD C;  3QPS A;  2DN0 A;  4M3F A;  5IYC J;  2EZK A;  3IH2 A;  4D5F A;  4A3D J;  4XRS G;  5FKO A;  4UUT A;  2WV1 A;  2O9L A;  1ZKG A;  2R5Y B;  1IDY A;  3QPL A;  2EZI A;  5F0H A;  3JRI A;  5E3L A;  5M5X J;  3HOV J;  4DYC A;  5E3O A;  2FD5 A;  1JKO C;  2CU7 A;  3JRH A;  4Y7N J;  4IHV A;  3B6C A;  2DMP A;  5IP9 J;  3NAU A;  2HXI A;  2M8G X;  3Q0W A;  4QIW N;  1IRZ A;  5FLM J;  2M0C A;  1OFC X;  3Q3S A;  3RKQ A;  5FKM A;  1TC3 C;  1U8B A;  2LK2 A;  1CQT A;  3B6A A;  2X48 A;  2JA7 J;  1IGN A;  1GVD A;  2LR8 A;  1DU6 A;  2JJ7 A;  5E3M A;  4BBS J;  2ELK A;  2L0K A;  5IYD J;  4M6V A;  1JT6 A;  5E3N A;  1RES A;  1HF0 A;  1TWA J;  1LE8 B;  4C3I J;  1ETX A;  4MFE A;  4DZJ A;  5K7Z A;  1H8A C;  2HOA A;  1QVT A;  1OJL A;  4MFD A;  2HXO A;  2LLK A;  4B3A A;  3A01 B;  1BA5 A;  3JRF A;  5DS9 A;  2P81 A;  3FK6 A;  4IEJ A;  2NVY J;  3PO2 J;  2WB1 N;  5EGO B;  1MBJ A;  1S7E A;  3SFI A;  2VKV A;  3NAR A;  1ZTR A;  4FCY A;  1FJL A;  3MVP A;  4XID A;  1BW5 A;  3GTQ J;  1ZR2 A;  2NVT J;  4W1U A;  4XRS A;  4DZP A;  5EGO A;  1MBK A;  2L7F P;  2Y2Z A;  3F0C A;  2JWT A;  1SAN A;  2HOT A;  5BNG A;  4FIS A;  3Q0U A;  4JX4 A;  2LD5 A;  3HOY J;  2QF7 A;  3M3Y J;  3G1O A;  1U78 A;  5M5W J;  4A3B J;  4A3G J;  4AC0 A;  5EZH A;  3S2D J;  4BBR J;  2ME0 A;  1JTY A;  2OF7 A;  1YRN B;  4L5E A;  2XB0 X;  1B8I B;  4A3J J;  2DMU A;  3JRG A;  2ECC A;  2K9Q A;  5FJ8 J;  3GTP J;  5M5Y J;  1GDT A;  4AUX A;  1U9O A;  2DA1 A;  5IPA A;  2Y31 A;  4D7M A;  5EZG A;  2E2I J;  3K2A A;  2LP0 A;  1I50 J;  3BR5 A;  2DA2 A;  3LSG A;  2K9S A;  2EH3 A;  3D1N I;  1JJ6 C;  3FKI J;  3ZQL A;  1ZR4 A;  5J1R A;  3ZOB A;  5J3L A;  1ETV A;  1IC8 A; 
#chains in the Genus database with same CATH topology
 1S72 I;  2DK5 A;  3JR9 A;  2H8R A;  2Y69 H;  1OQY A;  2W48 A;  5ICE A;  1ETQ A;  2KT0 A;  2DPU A;  4RB1 A;  3S8P A;  4BNC A;  3NWT A;  4HF0 A;  1G6N A;  4JYK A;  4IOC F;  4A3F J;  3PIP F;  5IOY A;  3ZP5 A;  4AWX B;  4FX4 A;  5LD2 C;  2QEN A;  4C2U A;  1POG A;  1UEL B;  1FTT A;  3JRE A;  4P1W A;  2V1X A;  1UJ8 A;  3M1C A;  4HQM A;  3F21 A;  2L9V A;  1ZRE A;  2OU2 A;  1WJA A;  3DKY A;  4XL9 A;  4A5M A;  4ZDP A;  4CDG A;  1RKW A;  1UB9 A;  5B1B H;  5C4X J;  4C3H J;  4D5C A;  1APL C;  3NEU A;  4XBF A;  3VEP A;  3TDZ C;  3X2Q H;  2W57 A;  5HDN A;  4E7L A;  4D9J A;  4Q5S F;  1FBS A;  2CUJ A;  4NUB A;  3GF2 A;  3MZY A;  4IRH A;  4RGX A;  5ERI A;  3CDH A;  3V7R A;  4LG0 B;  1D8K A;  3PFI A;  4IX7 A;  2M4K A;  3U1D A;  2JQ7 A;  4HF2 A;  4I76 A;  3WGH A;  1OPC A;  2FRH A;  1R4M B;  2DA7 A;  4HYE A;  4RBO A;  4I01 A;  1XSD A;  3ISP A;  3MZH A;  2YX7 A;  2KIM A;  3K4N A;  3TED A;  4FET A;  2BY3 A;  3T1B A;  1ZQ3 P;  2P0W A;  2BHY A;  1S9H A;  5DCM B;  3JRB A;  3K70 D;  3GO5 A;  5CVI A;  5CVJ A;  1S3J A;  2Z9O A;  4LB6 B;  2VKH A;  2P7V B;  2QKL B;  2A6E F;  2JUG A;  3H36 A;  1NTC A;  4AID A;  1WZ2 A;  1DPU A;  1TNT A;  4UVC A;  1D3Y A;  3CJN A;  3O8H A;  5JHU A;  1G3T A;  1GXQ A;  3GUD A;  4LIU A;  3TO6 A;  3WTZ A;  3IUO A;  3L2Q A;  2LFB A;  3M8E A;  3CCS I;  4L5I A;  2XKP A;  1T08 B;  1PDN C;  1XGN A;  1D5V A;  3IWZ A;  1OCC H;  5IP6 A;  4CO8 A;  1XGO A;  2OC6 A;  2P6S A;  3L09 A;  4G94 A;  1FX7 A;  4B8X A;  1BC7 C;  2BXZ A;  3GLX A;  3BG5 A;  3BTC A;  3ZMD A;  1AA7 A;  4PDK A;  4PSX A;  2E7X A;  3R4K A;  3ZQF A;  3R0A A;  2XAH A;  1R36 A;  2W85 A;  2Y0M A;  1VI0 A;  3KPH A;  5JFR A;  1S5L C;  4R79 A;  3I3L A;  4MO7 A;  3S15 J;  1P9Q C;  4GGG A;  5HS7 A;  2R4G A;  2W00 A;  2XAJ A;  3FBI B;  1K7A A;  1JE8 A;  2NS0 A;  4II3 A;  3A02 A;  2HOS A;  1ZRC A;  3FM3 A;  1IN7 A;  5LEJ A;  2HWV A;  3BQZ A;  1V5E A;  4BYY A;  5E20 A;  5HNF A;  3RSN A;  5C4J J;  4V19 K;  3C2B A;  4PCQ A;  2HKO A;  3TOB A;  4IQ4 A;  3AFH A;  5HLG A;  1Y8R B;  2VPR A;  2V26 A;  2GM4 A;  1BOB A;  1D1B A;  4KIB A;  2EV5 A;  2H6C A;  5D5X B;  2LDU A;  4QTR A;  2X9D A;  2NVX J;  2KJB A;  3E7L A;  5AIQ A;  4DBR A;  3J7Y J;  4X6A J;  1HLV A;  1PUE E;  1RZ4 A;  2XAU A;  3ASN H;  2GZW A;  3HM5 A;  1FMV A;  2Y30 A;  3AG1 H;  3O3K A;  3P9I A;  3ZRG A;  4BL0 B;  4A3L J;  4LK0 F;  2VC0 A;  3W6J B;  3LAJ A;  6PAX A;  2CUZ A;  1R5I D;  3M4O J;  2P8T A;  3CMY A;  3E5U A;  2CQ7 A;  2X51 A;  4BU2 A;  5GAD J;  3OIQ A;  4RLQ A;  2V79 A;  1Y1W J;  1GLN A;  2EFW A;  4IHS A;  3KET A;  5ED4 A;  2HQR A;  1DDN A;  2QCO A;  3VB2 A;  1WCM J;  4OIO F;  4F93 B;  3O2P E;  5F1J A;  3FM5 A;  2PMZ N;  1BC8 C;  3H35 A;  3KYC B;  1YS6 A;  1X2M A;  1P2F A;  1OYI A;  2HTJ A;  1W5T A;  5K5Q A;  3L7W A;  5L3C A;  2I5U A;  3S1N J;  4CGZ A;  3FK7 A;  1BM9 A;  3SFZ A;  2MYS A;  3S1R J;  3BR2 A;  3HJE A;  2WV0 A;  1XCV A;  3WE2 A;  5EG0 A;  3OYA A;  4WWC A;  3W6V A;  2KFD A;  1G3Y A;  3LAP A;  2TRT A;  4DOZ A;  3K4C A;  3GTK J;  4CHU A;  1FNN A;  4RAG A;  2VBX A;  2ZJP F;  4BE1 A;  2JA6 J;  2LF8 A;  2ICW G;  2B0L A;  2P5V A;  1NH3 A;  4F52 A;  5LFA A;  3QP6 A;  2CW0 F;  3SHF A;  3EUH A;  1RIO H;  2ETH A;  2NNY A;  2XGC A;  2CFX A;  1V5G A;  5K5O A;  1XPX A;  2FSW A;  2V1D A;  2A5W A;  2XAG A;  2BHZ A;  4CUG A;  4BHB A;  2ZME C;  2WB1 A;  3FMR A;  1S29 A;  3EDP A;  3GTJ J;  4HAM A;  4HW0 A;  1VQ8 I;  2ESN A;  2UUZ A;  1MNE A;  2E60 A;  2FX0 A;  3BQY A;  4QPO A;  3A4C A;  4PUS A;  1WFX A;  5CVV A;  3L1P A;  4M71 A;  2LRE A;  4KUM A;  5ICG A;  1UHW A;  3KP4 A;  4EQQ A;  2V1U A;  1VND A;  4XOT A;  1J9I A;  2E1M C;  1AU7 A;  3KZY A;  2LNB A;  2XPW A;  4XLP F;  4BAC A;  1F5T A;  1TWG J;  2PBI A;  1E3H A;  1WQ2 A;  4M3E A;  3VYS B;  4A5N A;  1FBQ A;  4FQG A;  2KIQ A;  1PUF B;  2R7T A;  1IJW C;  3TQN A;  3N05 A;  3J80 Z;  3ZMU A;  1L3L A;  4H4K C;  1JJ8 C;  5TRD A;  2VAS A;  1O3Q A;  1LB2 A;  1WGX A;  2IS1 A;  3GLL A;  1ZRD A;  4HNV A;  3BZ6 A;  1KA8 A;  1XGS A;  5HDG A;  2LKP A;  2WTE A;  4Y13 A;  1QO0 D;  3HRU A;  1HW1 A;  3CC7 I;  3CJR B;  3MWM A;  4L9N A;  4B44 A;  3W2V A;  1RRJ A;  4UV9 A;  1MGT A;  3Q5F A;  2ZB9 A;  1MKM A;  4LG0 A;  3TBI A;  1HSJ A;  3S3M A;  2QUF A;  1HA8 A;  1ITY A;  1H89 C;  1I6X A;  1DUX C;  3CQZ J;  1B72 A;  3QPT A;  1XSV A;  3F6O A;  2HS5 A;  1YE9 A;  3H92 A;  3E3V A;  3LWF A;  5JI6 A;  1D5Y A;  3IP4 B;  4DJA A;  1G59 A;  3CES A;  1I3Q J;  1SFE A;  3I4P A;  4B48 A;  2W25 A;  4XLA A;  1D0Z A;  1A6Q A;  3DWL E;  1X58 A;  4L5J A;  4Q47 A;  3MCZ A;  3EQL F;  1EV7 A;  2F5V A;  3HGG A;  3K1N A;  4I7H A;  1VZ0 A;  1BJA A;  3ZQC A;  4FHT A;  3H9G A;  1N75 A;  4IL6 C;  4NC8 A;  3FF5 A;  3KLN A;  1XMA A;  4Q4Z F;  1TT5 B;  1VQN I;  4Z2Y A;  4KIS A;  3FZV A;  3DEU A;  4S0H B;  3WTY C;  2O03 A;  1WKM A;  2AQF A;  4XQF A;  3CMA I;  1AWC A;  5FKL A;  4S05 A;  1YO5 C;  3VYT B;  2HVS A;  2N8G A;  2EA2 A;  4F91 B;  2LY2 A;  4V2G A;  2ADU A;  2HFH A;  1SFO J;  4NB5 A;  4XSZ F;  4B1R A;  5CKT A;  1Y0U A;  1RI7 A;  2FBI A;  1FTZ A;  1ZH5 A;  3K9T A;  3H9J A;  1VQ5 I;  3R61 A;  5BS6 A;  2WAQ A;  5A2Q K;  3F3X A;  5F04 A;  3QU3 A;  4BEH A;  3DBR B;  1RKT A;  3CUO A;  1HQC A;  5D5U B;  2ELJ A;  1MND A;  1X1P A;  4RMN A;  4OU0 A;  5FFX A;  3H0G J;  1NG7 A;  3HEF A;  5KCM A;  4QPQ A;  2LKX A;  3IL2 A;  5CPR B;  4A0Z A;  1RUN A;  2HVR A;  3FIW A;  1E3O C;  4XN0 A;  1VQL I;  1OYY A;  1LDD A;  1HOM A;  2ZXI A;  4ZYE A;  1AKH B;  4A0X A;  1O3T A;  1HDD C;  4HRI A;  3QPS A;  3G73 A;  3HOT A;  2VJI A;  3IH2 A;  3WU1 B;  5J6X A;  1V3F A;  3RPU D;  1REP C;  2RRE A;  1SFU A;  3R0J A;  4UUT A;  2O9L A;  2KKO A;  2ESH A;  3OY9 A;  2R5Y B;  2OZU A;  4EM0 B;  2HEO A;  4GYI A;  5E3O A;  3HOV J;  3CLO A;  2Z16 A;  2L02 A;  4BE0 A;  2CU7 A;  2JPC A;  1YW9 A;  4Y33 A;  5LGN A;  5FO5 A;  2BW3 B;  3DU6 A;  4PK4 A;  3F8N A;  3LA7 A;  1YIT I;  2QEX I;  2HQA A;  3CO7 C;  3Q0W A;  3OYI A;  1H0M A;  2HNH A;  1GXP A;  2VJ5 A;  4UY8 I;  2M0C A;  2GOX B;  3J7Z I;  1BR4 A;  2VIX A;  2MLK A;  1U8B A;  1W5C C;  1NHA A;  1T98 A;  2LK2 A;  2HQN A;  2JA7 J;  1MMD A;  4CZC A;  2M3A A;  4M73 A;  2L3D A;  4CIC A;  5DEQ A;  1X1C A;  3QU6 A;  1ZG3 A;  2WY7 Q;  1R1T A;  2L0K A;  1JT6 A;  1R71 A;  4BDY A;  2KQR A;  2XC7 A;  4G9Y A;  2EIL H;  4KIF A;  5BOX A;  3DP7 A;  4N9H A;  5K7Z A;  2OJE D;  1QVT A;  4IQJ A;  2HXO A;  5DCM A;  3L2V A;  4B3A A;  3A01 B;  5DS9 A;  1WWX A;  2ZJQ F;  2P81 A;  3MD2 A;  4IEJ A;  3MEX A;  5ICC A;  4HV5 A;  1SFX A;  1ZHF A;  2NVY J;  3K69 A;  3P7N A;  4BDZ A;  3PO2 J;  3TGN A;  1S6L A;  1W7P B;  2F5C A;  2MFZ A;  5AIP A;  3L2C A;  3SFI A;  2VKV A;  3NAR A;  4P5O A;  4HNT A;  4XID A;  1BBY A;  4HNU A;  1LPQ A;  2DBB A;  2L7F P;  3F0C A;  5LHI A;  3RYR A;  1TBX A;  1SD5 A;  2OV7 A;  3Q0U A;  5LGU A;  2LD5 A;  3HOY J;  3QYB A;  3CJT B;  5J8F A;  2IS6 A;  4ZYG A;  4A3G J;  4YII A;  2QWW A;  4BBR J;  1JTY A;  2OF7 A;  4L5E A;  5DM7 F;  3BRO A;  4UUV A;  3GTP J;  1XMX A;  4WXD A;  2PJP A;  1I3A A;  3ZQ7 A;  1U9O A;  1BIB A;  2DA1 A;  3IAS 2;  5IPA A;  1SMT A;  1R6R A;  4D7M A;  3L2U A;  3RI4 A;  2C6Y A;  2E2I J;  2LP0 A;  5KK1 A;  3BR5 A;  2FBK A;  3HZJ A;  3VWB A;  3HRS A;  3D1N I;  1B6A A;  5TJJ A;  1IC8 A;  1RR8 C;  4F7Z A;  5HS9 A;  2WAF A;  1BN5 A;  2QKM B;  2GLO A;  2BY2 A;  3FXK A;  5CQG A;  4CYD A;  1GV5 A;  3FX3 A;  5GTI C;  4D7N A;  1WRJ A;  3BOQ A;  4XLF A;  1LEB A;  3VDX A;  1XB4 A;  2E5Z A;  3F8B A;  3FMQ A;  2VE9 A;  2CJJ A;  2Z5U A;  3HTU A;  1YX5 A;  3C3W A;  3DXJ F;  5BMZ A;  4G12 A;  3H3Z A;  2DK8 A;  3L00 A;  1ZGA A;  2QQ8 A;  3WG7 H;  2DA6 A;  3RKW A;  4PSW A;  1HKQ A;  4I0A A;  1P4X A;  2H8W A;  3BDD A;  3K2Z A;  2GIZ A;  3CCE I;  4HPQ A;  3IHU A;  5ILU A;  2B63 J;  1D0Y A;  3N97 A;  1O57 A;  4OAY A;  4BKX A;  1ZRF A;  3BTI A;  5HNH A;  2X6W A;  3U21 A;  1MJA A;  4ZYH A;  2QBY A;  5IP7 J;  3HG9 A;  1BJZ A;  3BLY A;  1H9T A;  3TL4 X;  3ZGK A;  3G1M A;  5B66 C;  4DYR A;  3MKZ A;  2GXB A;  4EJV A;  2RDP A;  3CCY A;  3SEZ A;  4ENJ A;  4IO9 F;  3AG4 H;  2K9N A;  1IN5 A;  3IH4 A;  4A3I J;  4CCJ A;  2V9P A;  3ZCO A;  3U9G A;  3LSM A;  4CCN A;  3SZP A;  4HEA 2;  2Y48 A;  2D1V A;  4YIF A;  3LFU A;  3CCQ I;  1LDK B;  1YW8 A;  1X3W B;  4CCM A;  2LTP A;  1Q1H A;  1WH7 A;  3ERM A;  5FRO A;  4Y15 A;  2HYJ A;  2RC4 A;  3KP6 A;  5ILV A;  2BXY A;  1B9M A;  1FSH A;  4LG3 A;  4IHY A;  2IW5 A;  5EG0 B;  1GUU A;  3FDY A;  4KMU X;  2A6T A;  1PVE A;  3DPT A;  5E79 C;  2LG4 A;  3CCL I;  4QLC U;  4Y52 J;  2E36 A;  2HVQ A;  1ZLK A;  3S3O A;  2EFO A;  3GWZ A;  1R22 A;  3DQV C;  3ZQI A;  4B3X A;  5EF6 A;  4I09 A;  3OSF A;  2O8K A;  2MC3 A;  2RAE A;  4AIH A;  4EM2 A;  2LC2 A;  2ZKZ A;  2VN2 A;  2MD5 A;  1TWF J;  4IHX A;  3GZN B;  2XAF A;  2Z33 A;  1UST A;  3ZMV A;  3TP0 A;  2CV2 A;  4KN4 X;  1M1E B;  1EF4 A;  2CH0 A;  4OIP F;  3R60 A;  5GAH J;  1RC9 A;  3NQO A;  2L54 A;  1LQ1 A;  2WY8 Q;  5BQT A;  4LLL A;  4F92 B;  3HDD A;  2RN7 A;  1SMY F;  3OS0 A;  1QNT A;  4ZH4 F;  1LFU P;  1F9N A;  1Z91 A;  2CUF A;  4EAT A;  2DMQ A;  5JHF A;  2HGC A;  3A0H C;  3M07 A;  4BE2 A;  2NS7 A;  4IPA A;  5E8I A;  2CW8 A;  4WK8 F;  2CQK A;  2H94 A;  2OCC H;  3E6D A;  4FE4 A;  4C2T A;  2D45 A;  1QPI A;  3CP8 A;  4M3B A;  4F55 A;  2BW3 A;  4BGD A;  5EDN A;  2IS4 A;  2R7O A;  3K10 A;  5FRM A;  1IDZ A;  3PM1 A;  1JTX A;  2CO5 A;  1MMN A;  2LYC A;  2HI3 A;  2KRC A;  1IAW A;  1EKE A;  2E7W A;  3EET A;  3ZPL A;  3MKY B;  2V1N A;  2OBP A;  1BL0 A;  4II2 A;  1YRN A;  2L7K A;  1IUY A;  2K02 A;  4BS9 A;  1VQ6 I;  5DUI A;  1WI9 A;  4XKB A;  1MBG A;  4GYG A;  1TP4 A;  2QVO A;  4RAY A;  3JCU C;  4BJT A;  4M6Y A;  3BT9 A;  2EZL A;  3G1L A;  1E17 A;  2CYY A;  4JK1 X;  4XN3 A;  5DCF A;  2Y9Z A;  4RLF A;  2VT2 A;  4XKV A;  1TLH B;  4HX4 A;  4FAS D;  3OYC A;  2FA5 A;  3GFM A;  4KIG A;  4RGU A;  1T56 A;  5L3D A;  1DU0 A;  3D5R C;  1IRX A;  1TWC J;  4I98 B;  3PNY A;  1BR1 A;  2IGK A;  3F9K A;  3NWS A;  2R92 J;  2PMH A;  2Q2E A;  2G0E A;  5M3M J;  2MH2 A;  1VFC A;  2DFH A;  5H6Q A;  2FJ1 A;  2VKD A;  3DF8 A;  2XF7 A;  2V6E A;  1J59 A;  2E34 A;  3BTL A;  5F08 A;  4AIK A;  3WTW C;  1SD6 A;  1LJ9 A;  2COB A;  4ON0 A;  1YX3 A;  2K7L A;  3I54 A;  2GIV A;  2CQQ A;  2IGN A;  3RZO J;  3B73 A;  3HSE A;  4IVN A;  1FOW A;  2QM3 A;  4BXF A;  4UB6 C;  1RET A;  2NVQ J;  2X6X A;  3LOC A;  4UUS B;  5FKK A;  2R7W A;  2NOJ B;  2OD5 A;  2QLZ A;  2RQQ A;  3MQ0 A;  1SVM A;  2BYV E;  4JX6 A;  4WCG A;  2XGD A;  1UG2 A;  4XLE A;  1JKR C;  2CV0 A;  2EJR A;  3OS2 A;  1ETY A;  1MSF C;  4PGG A;  2RGV A;  4WXC A;  2HZT A;  4BQN A;  2UV1 A;  4G7H F;  3I0T A;  4E7K A;  1UMQ A;  3TDU C;  3I71 A;  9ANT A;  3LA2 A;  3KP3 A;  2PG4 A;  1B4A A;  2H6B A;  2JK3 A;  3GTO J;  3OL3 A;  2DU9 A;  1Y0N A;  2BBY A;  1KU3 A;  1OR7 C;  3S1Q J;  1N78 A;  4ZDL A;  1S7O A;  4G8X A;  1JGG A;  1ZLJ A;  1ULY A;  3LSJ A;  4GFB A;  2DOD A;  3ESW B;  1XDS A;  3E0J B;  2AO9 A;  1AHD P;  5HS8 A;  1D1C A;  3I64 A;  4UV8 A;  2XRN A;  3HPG A;  5CVU A;  4RGS A;  3TO9 A;  4XRM A;  2RQP A;  2G7U A;  2FOW A;  1SD7 A;  1W36 D;  1IN8 A;  2M0M A;  3OWT A;  1I39 A;  1MMS A;  2FNP A;  1MW7 A;  1SAU A;  2NNN A;  3E5Q A;  2M7B A;  4ETS A;  3JSO A;  3RQI A;  3A1Y A;  2PI0 A;  1YIJ I;  2DTZ A;  2W84 A;  4I0B A;  1I6H J;  4ESJ A;  4P9F A;  3PQK A;  3B02 A;  2F4M B;  1U2W A;  3ZMZ A;  4P9U A;  1LNW A;  2HZD A;  4RGR A;  1T0F C;  3BTJ A;  1FLI A;  3HC7 A;  4LGW A;  5HOD A;  1G3W A;  4OIN F;  3S1M J;  2ZFU A;  1LDJ A;  3HOZ J;  1KU2 A;  4RA2 A;  2OUM A;  2FMY A;  3ZQG A;  5D8L B;  4JX5 A;  3I4M J;  3ABK H;  4XR6 A;  1XGM A;  1DP3 A;  4KFC A;  1KU9 A;  4A3K J;  3G71 I;  1O3S A;  2DQL A;  1ZYR F;  3EYY A;  1JHF A;  2KDZ A;  1EH7 A;  2CS3 A;  2B9S A;  3T0Y A;  2WAQ N;  4IHT A;  1WI3 A;  4BH9 A;  4FTH A;  2XVC A;  5E1X A;  5L3F A;  5DM6 F;  2A68 F;  2MG4 A;  3RPQ A;  2R5Z B;  2XRL A;  1FIP A;  4FX0 A;  3IKT A;  3DPU A;  1ONV A;  1XDU A;  3VPR A;  1NK2 P;  1FMW A;  1D8J A;  2VJJ A;  2DLL A;  2L5Q A;  4LIT A;  2ZJR F;  1Q1V A;  3BR1 A;  3BR6 A;  2VQC A;  3M8J A;  3SDG A;  4ENN A;  4UNO A;  4Y3O A;  4KT5 C;  2XPU A;  2DA4 A;  2EIK H;  3H5N A;  2Y0S A;  1BIA A;  2G7H A;  4LOC A;  1LUJ B;  5J8C A;  3J81 Z;  1IV6 A;  1BI0 A;  1I27 A;  1WHU A;  1LFB A;  5FGM A;  1FOK A;  1FP2 A;  1JGS A;  1A04 A;  1FZP B;  2FML A;  3OOP A;  2BOL A;  2BVL A;  1ZG5 A;  3MN2 A;  4PJM A;  1S8N A;  4XKC A;  2L4A A;  3WU0 A;  3WGI A;  4MEX F;  2FQ4 A;  1MNM C;  2E5N A;  2EIJ H;  4U0Y A;  2FU4 A;  1YJW I;  1X4P A;  2LBF B;  4EMS A;  2O61 A;  1OCO H;  2AXL A;  1VF9 A;  3H9Q A;  3JW4 A;  4A6E A;  3HKZ N;  2JMW A;  4A69 C;  4NBQ A;  3K70 C;  3BCB A;  3FMS A;  3JRC A;  4E70 A;  4HST A;  2EB7 A;  4HQE A;  2QSF X;  4EEF G;  4XOP A;  2DJN A;  4QWQ A;  1TNS A;  4HG2 A;  2ME6 A;  3LNQ A;  2STT A;  1DQU A;  3AG3 H;  1MJB A;  1K4S A;  4ZJZ A;  2GWR A;  4O5V A;  3AG2 H;  2R7V A;  5IYC J;  2VPL A;  2V9V A;  2EZK A;  4D5F A;  4A3D J;  4LD5 A;  1G8X A;  3UR3 C;  1D1A A;  3COA C;  4HBL A;  5FKO A;  2VE8 A;  3W6K B;  4U88 A;  3J80 K;  2V9K A;  1ZKG A;  2EFQ A;  3F23 A;  4DIQ A;  1IDY A;  3ECO A;  3JRI A;  4KMF A;  5E3L A;  5M5X J;  2M30 A;  2O5R A;  4DYC A;  4MTD A;  2R7X A;  3C2H A;  4IOA F;  1KU7 A;  4U7B A;  4Y7N J;  5IT9 K;  3M1E A;  1X4O A;  2K3P A;  1LVK A;  4G7O F;  3KP7 A;  1IW7 F;  5FLM J;  2W82 A;  2AQE A;  3GXO A;  2KZV A;  2HPM A;  4LLN A;  3I5U A;  2WAD A;  2Z1D A;  4BEH B;  3CUQ B;  1P92 A;  3BG7 A;  2JVG A;  4ANJ A;  5AON A;  4AD9 A;  1IGN A;  2ZXH A;  5L3B A;  1GVD A;  1TZL A;  5E3M A;  4RAZ A;  2A5Y B;  2ELK A;  3WTV C;  1EJ9 A;  2Q2E B;  5IYD J;  2A05 A;  5E17 F;  3CCU I;  1FSE A;  1RES A;  3BP8 A;  1QBJ A;  1TWA J;  5H20 A;  1O7L A;  1FT9 A;  2PX9 A;  3GVA A;  5F1R A;  2EIN H;  3DLL F;  2D2W A;  2CV1 A;  4DZJ A;  4RB0 A;  1F4K A;  4MFD A;  4OOI A;  5FFZ A;  1I1S A;  1Z3Y A;  4XNF A;  3JRF A;  5DDG A;  1R5H A;  4L0Z B;  2L4M A;  2DOA A;  1W5S A;  2HYG D;  4L9V A;  2B7E A;  5EGO B;  2ACJ A;  2QSH X;  1MBJ A;  3IRQ A;  3CZ6 A;  1K6Y A;  2DXI A;  3I9V 2;  4FCY A;  4UVA A;  5CJ9 A;  3V42 A;  2QYO A;  4CH7 A;  5F6F A;  3IAM 2;  2ZME B;  3ZN1 A;  3WTU C;  2KZG A;  1ZR2 A;  4YEJ A;  1MZB A;  4A12 A;  1IXC A;  2XF5 A;  3ONQ A;  1T0F A;  2OQG A;  3ULQ B;  2HOT A;  4D1Q A;  4BJ5 C;  1SVL A;  2IGO A;  1Z9C A;  1CGP A;  2FF4 A;  3G1O A;  3S93 A;  5EZH A;  1T95 A;  2P4W A;  1IXS B;  4EM1 A;  3SEQ A;  2M1B A;  4HLX A;  4A3J J;  2DMU A;  2XAS A;  2K9Q A;  2NAZ A;  3ABT A;  2ZSI B;  1XMK A;  1Z6T A;  3U1K A;  4AUX A;  2UZK A;  2K27 A;  1YJ9 I;  1T8I A;  1T38 A;  4EGY A;  5EZG A;  3K2A A;  2O8X A;  3ML6 A;  1I50 J;  2DA2 A;  2K9S A;  2EH3 A;  3FKI J;  5HOO A;  1I1G A;  3WOD F;  1D0X A;  5J3L A;  1ETV A;  3PSF A;  2F6C A;  3WGG A;  1SEU A;  4YFN F;  5DD4 A;  3JAM K;  1CF7 B;  1QHG A;  2CW7 A;  2YS9 A;  1FEX A;  3BG6 A;  1W7P A;  3W2W A;  1S7A A;  2LKS A;  4ZYD A;  1WSU A;  5D8K B;  4EJU A;  4BQA A;  4B47 A;  1NK3 P;  1WJC A;  2YPR A;  3M7G A;  5E8G A;  3DU5 A;  3TW7 A;  2NVU B;  1T33 A;  3KE2 A;  5E1W A;  3OIP A;  3TO7 A;  2HDW A;  2OA4 A;  3SJM A;  3GTM J;  2L2O A;  4GXO A;  1MDM A;  1X3Z B;  3HHG A;  2QGU A;  1W0T A;  3OYH A;  5EYR A;  3RTR A;  1Z77 A;  2F5E A;  3TW6 A;  3PIO F;  5IY5 H;  4L18 B;  1Z6R A;  2DYR H;  3MAJ A;  5KVR A;  2K86 A;  1MSE C;  3TP3 A;  2JTV A;  1XD7 A;  1KQ9 A;  4C9Y A;  1J5Y A;  3LA3 A;  1ORK A;  1FYK A;  3RDI A;  2LBF A;  2MLG A;  5FB2 A;  4M9X A;  1J2X A;  1Z0X A;  1XX5 A;  2V6C A;  2DT7 B;  1FC3 A;  4MEY F;  4NDL A;  1RUO A;  2ZXW H;  2DDA A;  2OTL I;  2BVM A;  2YU3 A;  2DA3 A;  1R1U A;  3I58 A;  4GO1 A;  4EVI A;  2H1K A;  1MMG A;  4FT8 A;  5IOZ A;  3VSK A;  4UUS A;  3WHC A;  1X2N A;  2DOF A;  2RVC A;  3HYI A;  4X1E A;  3JRA A;  2X4H A;  4XM3 A;  4HA8 A;  3VSL A;  1K61 A;  3WTT C;  3WE3 A;  1J09 A;  3WG9 A;  2M87 A;  3KIO A;  4MIM A;  1T2K A;  2IA1 A;  3PNV A;  1LFP A;  4IRI A;  1OCT C;  2AS5 F;  4M74 A;  4NC7 A;  1U8R A;  3SZT A;  1HKT A;  3RCO A;  3HGY A;  2KP6 A;  1JI8 A;  5DD8 A;  2DTR A;  4G6D A;  1JKQ C;  2HDD A;  2GA2 A;  4WX9 A;  3EUA A;  1XTA A;  5D6F A;  1N25 A;  2KDO A;  2R7R A;  4IXA A;  1U5T C;  5B5E C;  1RNL A;  3D0S A;  3MKL A;  2H27 A;  1YG2 A;  1ODD A;  3T8R A;  2JZY A;  1YYV A;  2O6G E;  5KHD A;  1G2H A;  1TL8 A;  3DTI A;  4EV0 A;  1B72 B;  5EEA A;  1ON1 A;  2IBD A;  4HF1 A;  2UXN A;  5FD5 A;  2KMU A;  3TMO A;  2LH9 A;  1ZGW A;  5EEH A;  3L9F A;  2X0L A;  2VC1 A;  3CDL A;  2MBF A;  1U5T A;  1SFK A;  2IEK A;  5IYB J;  4ZDO A;  2OQR A;  1MBE A;  5TIS C;  2NRA C;  3OYK A;  2FEZ A;  3NRV A;  2XF6 A;  3ABM H;  3OYG A;  2A61 A;  4KYW A;  1F43 A;  5A2Q Z;  1HCR A;  2PN6 A;  2RKH A;  5LRS A;  2X6O A;  3F22 A;  1P4W A;  2XB5 A;  5F0C A;  3OYE A;  2R7F A;  1OLT A;  2LY1 A;  3KEY A;  2ID3 A;  4RM2 A;  3QYE A;  4UVB A;  4A3M J;  3E97 A;  4E7I A;  2WAE A;  2KIS A;  2K3F A;  4M3G A;  4AVZ A;  1ETK A;  4E7Z A;  4MLO A;  3L2R A;  1A6I A;  1WPK A;  2XRO A;  1JHH A;  3FXO A;  1YQA A;  2Y75 A;  2I8D A;  4O6J A;  1IG7 A;  2R7Z J;  1HDP A;  2D1H A;  3KLO A;  2JRM A;  2QSG X;  2XPV A;  3CJQ B;  3CDI A;  2GQQ A;  3DEW A;  5J1U A;  1F36 A;  3CUQ C;  3ECH A;  3OYJ A;  3CCJ I;  1LE8 A;  4CSW A;  3DCF A;  5GPC A;  2K4J A;  1RPW A;  4CCO A;  1YFH A;  3PNT A;  3PFY A;  4LLG F;  4AYB A;  4ZC3 A;  3ASO H;  3FBN B;  2ZME A;  4A3E J;  2AXT C;  1EH6 A;  2E19 A;  3QQA A;  5C44 J;  5DYM A;  2VUM J;  1A5J A;  2CMP A;  3HHH A;  4AVP A;  1LVA A;  5D4R A;  2QQ9 A;  1XS9 A;  4X0G A;  1YW7 A;  2Q8K A;  4PJN A;  1SC7 A;  3KP5 A;  4UB8 C;  2DI3 A;  5HLT A;  3DTE A;  3IKV A;  4GCV A;  3AL0 B;  2GBY A;  2L9R A;  2VB6 A;  1TW3 A;  1KQ8 A;  1IV8 A;  1WVR A;  2D5V A;  2AHQ A;  1ERD A;  2DAO A;  4JP0 A;  2M34 A;  2DT5 A;  4RDU A;  1XC5 A;  4U87 A;  3H3U A;  5EJC A;  1ETW A;  5JLW A;  3OS1 A;  2DO7 A;  1Y39 A;  4QSH A;  2FOK A;  4LB5 A;  3CMM A;  2STW A;  4XLN F;  4PJJ A;  4A3C J;  3BC8 A;  2O7O A;  2WWY A;  2VT3 A;  1XSX A;  2EZH A;  4DW6 A;  1KQ0 A;  3E1S A;  1IRF A;  1CF7 A;  2NXN B;  2VQL A;  2VXZ A;  3Q9S A;  3RYP A;  4IHW A;  5FRN A;  1QZE A;  1PUF A;  4YFK F;  4C3J J;  2HOE A;  5CYV A;  3OYF A;  3M8F A;  1V5F A;  2E2H J;  1W7P D;  2BY0 A;  2H1L A;  2K4B A;  2XGX A;  4W97 A;  3IC7 A;  3HUG B;  4GRI A;  3WTX C;  3P5J A;  4I02 A;  1SAX A;  3K1M A;  3A01 A;  3EUK L;  2F4O B;  2PMU A;  3E6C C;  2LMD A;  3BG9 A;  2ECB A;  3K7A J;  4M3D A;  4E7S A;  3ZMT A;  4LMY A;  1U3E M;  1UHM A;  2IP2 A;  2I10 A;  1K83 J;  1FIA A;  4BY7 J;  4ASN A;  3JTG A;  3KYD B;  3KFW X;  1U0J A;  2F5F A;  2O0Y A;  2VBY A;  1SVO A;  2NOG A;  1STZ A;  2IJL A;  4XK4 A;  3OYL A;  2RNJ A;  4ESF A;  2OPT A;  1UCR A;  3KZZ A;  2DJI A;  4I6Z A;  3A0B C;  2KLO A;  3HOU J;  4AU7 A;  3HRM A;  2XGE A;  3CD6 I;  2OTJ I;  2A69 F;  2HYF A;  3GTL J;  3ZMS A;  1EA3 A;  1V55 H;  4HLY A;  1PP7 U;  3S14 J;  4HDU A;  3KCC A;  1DPR A;  2EPF A;  1BOA A;  3FXL A;  2YSR A;  4MHG A;  2MC4 A;  3MFK A;  2K40 A;  4NC6 A;  2VKE A;  3VYR B;  2IGM A;  1FYL A;  1ENH A;  5D4S A;  3VOD A;  4CXF A;  1L0O C;  1GV2 A;  1QQI A;  2Z99 A;  2FBH A;  5B1A H;  2DMT A;  3OV8 A;  3KYL A;  3KEO A;  3J81 K;  2M9H A;  1AOY A;  5JVG F;  1ZK8 A;  5FLX Z;  4GDF A;  4CYC A;  2LVS A;  5HLI A;  3GFL A;  2YUS A;  2M45 A;  1RR7 A;  5ICF A;  4N9I A;  2K85 A;  4IKF A;  2V4J C;  1R00 A;  3FXQ A;  2VJ4 A;  3DFG A;  4HSR A;  2J5P A;  3DV8 A;  3GZ6 A;  4KIT B;  4PGH A;  2VQG A;  4RS8 A;  2BV6 A;  3E6B A;  1P7J A;  3K1P A;  3RZD J;  5IT9 Z;  3H5A A;  4G6T B;  3CC2 I;  1A35 A;  5K7F A;  4UHT A;  1R4N B;  4CCL A;  3K0L A;  1Z1D A;  2R5Z A;  2PJR A;  2ELH A;  4OMZ A;  4TV7 A;  2DMN A;  2QBY B;  1WJF A;  4BY1 J;  1A36 A;  1IUF A;  3WHB A;  4ZZD A;  3GCM A;  3ROU A;  2QQA A;  4M3F A;  1E3P A;  1VQK I;  2DYS H;  5IT3 A;  2CGP A;  5J40 A;  4EJO A;  1IN6 A;  3CCM I;  3LSH A;  1QGP A;  3QPL A;  2ZNZ A;  4A6D A;  2EZI A;  5LEK A;  1J7K A;  5BPD A;  1H9G A;  2FD5 A;  1JKO C;  5DV5 A;  1R7J A;  3GFJ A;  3JRH A;  4IHV A;  2R7U A;  4ESB A;  4ENM A;  3B6C A;  3OR2 C;  2RV8 A;  4XLH A;  5TGT A;  4EJW A;  5DUK A;  4E7J A;  2GOM A;  2M8G X;  2W1O A;  3ZQQ A;  2IT0 A;  1VQP I;  1TW2 A;  1KYW A;  3DBL B;  3JSP A;  1OFC X;  1YS7 A;  5HDK A;  2A07 F;  3LFK A;  1FP1 D;  1VQ9 I;  1JXS A;  2EFN A;  5HVQ C;  3L2W A;  1CQT A;  2Z3Y A;  4EGZ A;  1ZG1 A;  2PJR B;  1YOV B;  3G3Z A;  3OYM A;  4HZF A;  4HDV A;  4YIR X;  1Z05 A;  4F3Q A;  2LOO A;  2LR8 A;  1DU6 A;  3BJO A;  3REO A;  3FHZ A;  4IZZ A;  3QYF A;  5CLS A;  4OIR F;  4LFU A;  1HF0 A;  4XRF A;  3ERE D;  3CCV I;  1LE8 B;  1U6G A;  4C3I J;  3K4K A;  2PMZ A;  1MDM B;  3V4G A;  2HTS A;  2DW4 A;  5LRR A;  2HOA A;  1K78 B;  1B1B A;  1OJL A;  1IO2 A;  3BPV A;  4MGR A;  1BA5 A;  1OR7 A;  4E7H A;  4PFP A;  3KEQ A;  2WB1 N;  2MD0 A;  5K5R A;  2EV6 A;  2WBM A;  3V7C A;  1QA6 A;  1S7E A;  4L9T A;  1UAA A;  3PSI A;  1ZTR A;  3T5X A;  1R49 A;  1FJL A;  3Q9V A;  4BXU A;  1KZH A;  3V7S A;  3MVP A;  1WJB A;  4N4N B;  3OYD A;  2X1C A;  3FHN A;  4I2O A;  2CSO A;  4DZP A;  3R6S A;  3LSK A;  2Y2Z A;  2UXX A;  3EYI A;  2ZC2 A;  5CVR A;  4FIS A;  3M3Y J;  3PQJ A;  2X1E A;  4OWR B;  1U78 A;  2PLY A;  4AC0 A;  1MIJ A;  3S2D J;  5D6E A;  2ZNY A;  1YRN B;  5L3G A;  1B8I B;  3JRG A;  2DOE A;  2ECC A;  3H1C A;  4DNC A;  3UNG C;  5FJ8 J;  3EUH C;  1V4R A;  2IA0 A;  4S04 A;  2IPQ X;  3BWG A;  3QPH A;  5K1Y A;  3HPH A;  1Z67 A;  3BZK A;  2XAQ A;  3LSG A;  1ZR4 A;  1UG0 A;  5J1R A;  2Z2S B;  3ZOB A;  3IRR A;  1V54 H;  3HUG A;  4DQ2 A;  2M2E A;  5LHH A;  2DFF A;  1BI3 A;  1U5T B;  4RB3 C;  1YJN I;  2IAI A;  4LIV A;  1YTY A;  3K6G A;  2XHK A;  3N4M A;  2FE3 A;  1BW6 A;  3F8C A;  2JVH A;  2VQH A;  3LQQ A;  2KJC A;  1FYM A;  3CME I;  1MBH A;  2L9S A;  1FBU A;  3GTG J;  4MQV A;  2VL8 A;  1Z21 A;  3HSR A;  2Y9Y A;  3OIO A;  1R9T J;  1ACI A;  1IRG A;  4I99 C;  1NG6 A;  4HX8 A;  3V8L A;  4H0E A;  4B4C A;  1X19 A;  1B8I A;  4P55 A;  2BE5 F;  4YG2 F;  4AM3 A;  3FXM A;  2IS2 A;  1B59 A;  1AKH A;  4BXX J;  2EFP A;  1X1B A;  3HTS B;  5JR3 A;  2JPB A;  2HU9 A;  1QZY A;  2HDC A;  3GFI A;  2KRH A;  2NYX A;  4E6K G;  3SYT A;  2QA4 I;  2LF7 A;  4R8H A;  2GA1 A;  3G4S I;  1GVJ A;  3GW2 A;  4KT6 A;  3WTS C;  2X1D A;  4IJA A;  3LST A;  2JRT A;  4Y4R A;  2HPI A;  1E0E A;  2K9L A;  3DLA A;  4Z6Y A;  1Y1V J;  1TTY A;  3I53 A;  2GAU A;  5L3E A;  1OMI A;  2LY9 A;  2TCT A;  1MBF A;  1P6R A;  1X3U A;  2LSO A;  2M7A A;  1UHS A;  3V8J A;  3HL2 A;  4AIJ A;  3RQ4 A;  2DDB A;  1OCR H;  1YLF A;  1OIS A;  3HB9 A;  2F4I A;  1IZ1 A;  1O7F A;  1QVU A;  3VOE A;  2L7Z A;  3DKX A;  3BY6 A;  2VOD A;  2IVM A;  3SXY A;  4A93 J;  2ZSH B;  4BUP A;  2JT1 A;  4XSX F;  3I55 I;  1C0W A;  2UWM A;  5FKN A;  2K9M A;  4PJ0 C;  3LSP A;  1A31 A;  2LRD A;  2COM A;  3F8M A;  5C3E J;  2JN6 A;  3DTK A;  4HV6 A;  5DTD A;  4A0Y A;  3J7A O;  2XSD C;  2E1O A;  2KL4 A;  2W7N A;  4LK1 F;  2Y0S N;  3H3V K;  1UZC A;  2XKO A;  1OKR A;  4BQO A;  2XV4 S;  2K5C A;  4C30 A;  3C1D A;  3IWF A;  3GEZ A;  1HW5 A;  5FD6 A;  2EA4 A;  1R5G A;  3LSI A;  1GT0 C;  2JA8 J;  2ID6 A;  4U7D A;  3GBG A;  4FE7 A;  3ABL H;  5J47 A;  3CF5 F;  2XIG A;  1IF1 A;  2R0Q C;  1U9N A;  1HST A;  3ELK A;  5J1Y A;  1UFM A;  3U2R A;  2DA5 A;  4KNY A;  1Z7U A;  2H09 A;  4K2E A;  2EV0 A;  5GTH C;  2P7C B;  4XKW A;  3E5X A;  1G4D A;  4NQW B;  3QP5 A;  5BPI A;  2F2E A;  1HC8 A;  3ZR8 X;  4DGW B;  3RPU A;  4OAZ A;  1Y6I A;  3OOU A;  4NNJ A;  4N0B A;  2E1C A;  4IF4 A;  1JT0 A;  5KNL A;  3QOP A;  1WJD A;  4UXN A;  4B43 A;  2G9W A;  5EEG A;  1DP7 P;  3BJA A;  5J4V A;  1IXR C;  2R7S A;  3LMM A;  1ZAO A;  3RKX A;  5K7H A;  2EQR A;  3QAH A;  2RNG A;  3RKY A;  5LHG A;  4J19 A;  3HOW J;  2QZ8 A;  2XUB A;  4KDP A;  2J5O A;  3CF2 A;  1K78 A;  4LJZ F;  3TKY A;  3DPL C;  4KIC A;  1MH3 A;  2MA3 A;  5J4Y A;  2KIU A;  1YHQ I;  3S16 J;  1WJE A;  4ZTF A;  2IRF G;  1OCZ H;  5FLV A;  1TT0 A;  1W36 C;  3ZXS A;  3D5L A;  3FXR A;  3W2A A;  3BZC A;  2NS8 A;  2E1N A;  2IXS A;  2P6T A;  3FXJ A;  1Z3X A;  3H0D A;  2FUG 2;  5H6R A;  2KPM A;  1J0R A;  1HKS A;  1QZZ A;  2ZJ2 A;  3HOX J;  4WF2 A;  5F0F A;  3JRD A;  3SQN A;  3MMY B;  3DBH B;  4M9S A;  4YRV A;  3BR0 A;  3O6B B;  1Y8Q B;  3SZG A;  3PO3 J;  3S3N A;  1YI2 I;  2M5W A;  1FPQ A;  2DFE A;  3FKJ A;  3HRT A;  4BJ6 C;  3T8T A;  2FXA A;  3F8F A;  2CWE A;  5GP9 A;  2OAZ A;  2ZBK A;  5ILS A;  2OCE A;  3V8K A;  2MH9 A;  2E1M B;  3JTH A;  3J7A Y;  1GHC A;  4L9J A;  3E6M A;  2DQR A;  1BR2 A;  5D5V B;  4NHJ A;  2JUC A;  4CYC B;  4Y17 A;  4Q48 A;  2MGQ A;  3HIF A;  1MJ9 A;  2EWN A;  3OSG A;  2L7M P;  4PJL A;  1WH5 A;  1ETO A;  2PQ8 A;  3RIR A;  1VQO I;  4R1H A;  1JKP C;  2E35 A;  3SDB A;  1MH4 A;  4M72 A;  3IV5 A;  3HBL A;  1KON A;  4B09 A;  4OIQ F;  2XSJ C;  2VI6 A;  4XLC A;  4XOR A;  1HW2 A;  5F27 A;  1OYW A;  1XN7 A;  2CQX A;  3I4N J;  3WU2 C;  2R3S A;  3OYB A;  1P7I A;  3UKG A;  2L01 A;  1TQP A;  3HXL A;  3S2W A;  3QOD A;  4ABZ A;  1QPM A;  2W24 A;  3S17 J;  1R23 A;  2P5K A;  1E2X A;  2ISY A;  2JSC A;  3D5S C;  4J00 A;  1VQ7 I;  1T6S A;  3AAF A;  2DT6 A;  4PZJ A;  2VON A;  2M4G A;  4D0P A;  3BPX A;  2CUE A;  3S2H J;  3HOS A;  2JA5 J;  3CC4 I;  2DPD A;  4HOB A;  4DYQ A;  2VOO A;  3OMY A;  3OR1 C;  4V2F A;  4M9Z A;  1TQM A;  1BI2 A;  1KGS A;  5GAE J;  4JQF A;  2QQB A;  3MKW B;  3LSR A;  3GX4 X;  2HKX A;  5LBQ A;  1R1V A;  4AYB N;  3EPZ A;  1I5Z A;  4N4O B;  5E1Z B;  3ZQH A;  1HXD A;  2MW8 A;  3JAM Z;  4MTE A;  1JUS A;  1LKX A;  1PJR A;  4ENK A;  2R7Q A;  3A03 A;  5M3F J;  1VTN C;  3K4L A;  1X1D A;  3BG3 A;  1TWH J;  1PP8 F;  3P9K A;  3FIS A;  1ZGJ A;  5F64 A;  4CZZ A;  3I59 B;  2WA0 A;  3PUB A;  4G6Q A;  1W0U A;  4XIC A;  3OYN A;  3P9C A;  4C2M J;  1BI1 A;  3O8G A;  2V7F A;  4MQ9 F;  3FWE A;  1ZAR A;  1QRY A;  2YU9 J;  3TOA A;  2MSY A;  2R5Y A;  3BR3 A;  3VYU B;  4ZTJ A;  4BHC A;  2CRG A;  4J01 A;  2GXG A;  2VBZ A;  3Q0V A;  1OCP A;  5H2F C;  1HBX G;  1ZEL A;  2GXA A;  2EBI A;  1XG1 A;  3HSF A;  3I56 I;  1K6O A;  2WC2 A;  2KHM A;  2VBW A;  1WJ5 A;  3FXU A;  2X6Y A;  1H88 C;  4YEL A;  1TQI A;  1F1Z A;  1W4M A;  4IRG A;  3KX2 A;  1G3S A;  1O4X A;  3W3C A;  3DKW A;  2HQ5 A;  3LL7 A;  3LQR A;  3BJ6 A;  3AL0 C;  1JUP A;  5KAF C;  3F72 A;  2E2J J;  4NQW A;  5E18 F;  2KIF A;  5GPA A;  3G6E I;  2R93 J;  1MMA A;  3M9A A;  2KRF A;  3HKZ A;  5JLX A;  1JUM A;  3K4J A;  3IH3 A;  2A6H F;  3I59 A;  3PUF A;  3QOE A;  3C7J A;  1LEA A;  1DGW Y;  1FWZ A;  4G7Z F;  3GME A;  1X1A A;  1N77 A;  3QWL A;  2DN0 A;  2P5L C;  2VOP A;  1IN4 A;  4ZZL A;  3ABU A;  4KA4 A;  3DEE A;  4XRS G;  3CP2 A;  1J75 A;  2WV1 A;  1W1W E;  2O3F A;  1B9N A;  3PL8 A;  2MAB A;  3A2K A;  5F0H A;  1FY7 A;  2F48 A;  4ITV A;  4O3M A;  1XCB A;  2YX4 A;  4CCK A;  1SD4 A;  4YFX F;  2DMP A;  5IP9 J;  2ZFW A;  4BQQ A;  3NAU A;  2BGC A;  2HXI A;  5LLQ A;  1FOX A;  2FQ3 A;  4QIW N;  2ZCW A;  2ISZ A;  1IRZ A;  1USS A;  2OZ6 A;  3K4B A;  3Q3S A;  3RKQ A;  5FKM A;  1K4T A;  1TC3 C;  2JA2 A;  3BCA A;  3CO6 C;  2W4S A;  1KYZ A;  3B6A A;  2X48 A;  4U0W A;  2VLA A;  1O3R A;  2EK5 A;  3AKZ A;  5KAI C;  5JVT A;  4PFO A;  2JJ7 A;  4BBS J;  1EH8 A;  5HLH A;  4M6V A;  4U0V A;  5E3N A;  3CCR I;  1K79 A;  1QU3 A;  2VXD A;  3CUQ A;  1VQM I;  3KZI C;  3ZN0 A;  1VQ4 I;  1ETX A;  3F6V A;  4MFE A;  2M8E A;  1H8A C;  2PEX A;  2CQN A;  5D5W B;  2LLK A;  2ZO4 A;  3QRF F;  2IA2 A;  1P4A A;  2XDV A;  3FK6 A;  2BY1 A;  2A3S A;  2Q0O A;  4MNU A;  4RM3 A;  4L0Y B;  1PYV A;  1Y56 A;  1DGR M;  5B3S H;  5FLX K;  4P96 A;  2CFO A;  2Q1Z B;  4HX7 A;  5GAG J;  4CA0 A;  1T39 A;  2BZT A;  5LGT A;  3S32 A;  2ZXJ A;  3G2B A;  4XON A;  3CTA A;  3PJR A;  1BW5 A;  3GTQ J;  4XMY A;  2YR2 A;  4ZYA A;  2L9N A;  4RB2 C;  4W1U A;  3RJP A;  4XRS A;  2NVT J;  5EGO A;  4KN7 X;  4BHP A;  1ZN2 A;  1MBK A;  2JWT A;  1SAN A;  1YIO A;  2F5D A;  5BNG A;  4JX4 A;  4KJZ A;  2QF7 A;  3GZ5 A;  4WXH A;  3KP2 A;  5M5W J;  3VFZ A;  4A3B J;  2DFI A;  2E71 A;  2ME0 A;  3H5R A;  4JBA A;  4BAY A;  4OMY A;  3GYH X;  1Z7L A;  2XB0 X;  1R58 A;  1ON2 A;  2JSP A;  3C2G A;  1FOY A;  4M6X A;  2FNA A;  2HR3 A;  4DBQ A;  2DCE A;  5M5Y J;  1GDT A;  2PFB A;  3MZ8 A;  1MD0 A;  2TDX A;  4E4H A;  2CG4 A;  2X85 A;  2Y31 A;  2EIM H;  1QHH D;  3OL4 A;  4JOM A;  3K4M A;  5CQE A;  1JJ6 C;  3ZQL A;  4A2U A;  4EJT A;  2R7D A;  3C18 A;  4RAF A;  3CLQ A;  2BEO A; 
#chains in the Genus database with same CATH homology
 2M2E A;  2GLO A;  3JR9 A;  2H8R A;  1GV5 A;  2YS9 A;  2IAI A;  1FEX A;  2W48 A;  4D7N A;  1ETQ A;  2KT0 A;  1BW6 A;  4JYK A;  4A3F J;  5IOY A;  2CJJ A;  1NK3 P;  1POG A;  1MBH A;  4G12 A;  1FTT A;  3JRE A;  3GTG J;  3OIO A;  2Y9Y A;  1R9T J;  3TW7 A;  2DA6 A;  1T33 A;  3SJM A;  3GTM J;  4B4C A;  1B8I A;  1RKW A;  5C4X J;  2B63 J;  4BKX A;  4C3H J;  4D5C A;  3BTI A;  1W0T A;  1APL C;  5EYR A;  5IP7 J;  1Z77 A;  1AKH A;  3TW6 A;  1BJZ A;  4BXX J;  3G1M A;  1MSE C;  4DYR A;  3TP3 A;  3CCY A;  2K9N A;  3IH4 A;  4A3I J;  1ORK A;  4I76 A;  2DA7 A;  4RBO A;  3TED A;  1ZQ3 P;  1Z0X A;  3JRB A;  1Y1V J;  2LTP A;  1WH7 A;  4NDL A;  2HYJ A;  2DA3 A;  2H1K A;  1NTC A;  2LY9 A;  2TCT A;  5IOZ A;  1MBF A;  4UUS A;  1UHS A;  4IHY A;  5EG0 B;  1GUU A;  3O8H A;  3WHC A;  1X2N A;  4X1E A;  4Y52 J;  3JRA A;  3HB9 A;  1K61 A;  2LFB A;  1QVU A;  2L7Z A;  4MIM A;  3ZQI A;  5EF6 A;  3OSF A;  2O8K A;  4A93 J;  2RAE A;  1OCT C;  5FKN A;  5IP6 A;  1TWF J;  3HGY A;  3LSP A;  5C3E J;  4IHX A;  2JN6 A;  3BG5 A;  3BTC A;  3TP0 A;  5DTD A;  1JKQ C;  2XSD C;  2E1O A;  2HDD A;  3ZQF A;  1EF4 A;  2Y0S N;  3H3V K;  3MKL A;  1GT0 C;  1VI0 A;  2JA8 J;  3HDD A;  2ID6 A;  1G2H A;  3GBG A;  4FE7 A;  1B72 B;  5EEA A;  2IBD A;  4MO7 A;  3S15 J;  1LFU P;  2CUF A;  2R0Q C;  2DMQ A;  1U9N A;  1ZGW A;  5J1Y A;  3CDL A;  2NS7 A;  2IEK A;  2DA5 A;  5IYB J;  3A02 A;  2HOS A;  4FE4 A;  1MBE A;  1QPI A;  3BQZ A;  4M3B A;  5EDN A;  5C4J J;  3C2B A;  1IDZ A;  3PM1 A;  1JTX A;  1F43 A;  1HCR A;  2HI3 A;  2GM4 A;  2VPR A;  1BL0 A;  1YRN A;  2X6O A;  4QTR A;  3OOU A;  2X9D A;  2NVX J;  2XB5 A;  5F0C A;  1JT0 A;  1MBG A;  3E7L A;  2ID3 A;  2NVQ J;  4A3M J;  4X6A J;  1HLV A;  3BT9 A;  2EZL A;  4M3G A;  3G1L A;  1ETK A;  3HM5 A;  2Y9Z A;  4MLO A;  5K7H A;  2EQR A;  2Y30 A;  1A6I A;  1WPK A;  4A3L J;  4J19 A;  3HOW J;  3M4O J;  3CMY A;  1IG7 A;  1T56 A;  2R7Z J;  1DU0 A;  1HDP A;  1TWC J;  1Y1W J;  1MH3 A;  2XPV A;  2R92 J;  2QCO A;  2G0E A;  5M3M J;  1WCM J;  3S16 J;  3DEW A;  1VFC A;  5J1U A;  1F36 A;  5FLV A;  2FJ1 A;  5F1J A;  2PMZ N;  1LE8 A;  3DCF A;  5GPC A;  5F08 A;  1RPW A;  3BTL A;  1X2M A;  2NS8 A;  2COB A;  3RZO J;  2CQQ A;  3S1N J;  4A3E J;  3FK7 A;  2E19 A;  3HOX J;  5F0F A;  1RET A;  3S1R J;  3QQA A;  3BR2 A;  3LOC A;  5C44 J;  5FKK A;  4UUS B;  3JRD A;  2VUM J;  5EG0 A;  1A5J A;  3W6V A;  3BR0 A;  1XS9 A;  4JX6 A;  1JKR C;  2XGD A;  1UG2 A;  2TRT A;  3PO3 J;  1ETY A;  3GTK J;  1MSF C;  2JA6 J;  9ANT A;  1UMQ A;  5GP9 A;  2GBY A;  2L9R A;  2JK3 A;  3GTO J;  2D5V A;  2AHQ A;  4CYC B;  4JP0 A;  2M34 A;  2XGC A;  4RDU A;  1XC5 A;  2MGQ A;  3OSG A;  3S1Q J;  1ETW A;  5JLW A;  2L7M P;  1WH5 A;  1JGG A;  1ETO A;  4QSH A;  3LSJ A;  1JKP C;  4GFB A;  1MH4 A;  4A3C J;  3GTJ J;  2O7O A;  3IV5 A;  3HBL A;  4DW6 A;  2EZH A;  2AO9 A;  2VI6 A;  1AHD P;  2FX0 A;  5F27 A;  4IHW A;  3BQY A;  2CQX A;  3I4N J;  1PUF A;  3L1P A;  4C3J J;  1P7I A;  3UKG A;  4XRM A;  1VND A;  2E2H J;  1AU7 A;  2XPW A;  1TWG J;  4ABZ A;  4W97 A;  4M3E A;  3S17 J;  1PUF B;  3RQI A;  1I6H J;  2DTZ A;  1IJW C;  3A01 A;  3BG9 A;  3K7A J;  2ECB A;  4M3D A;  1JJ8 C;  1WGX A;  3BTJ A;  2CUE A;  3S2H J;  5HOD A;  4HNV A;  2I10 A;  1K83 J;  2JA5 J;  1FIA A;  4BY7 J;  3S1M J;  4DYQ A;  3HOZ J;  2NOG A;  4V2F A;  4XK4 A;  3ZQG A;  4JX5 A;  2OPT A;  3I4M J;  2ZB9 A;  3LSR A;  4I6Z A;  4AYB N;  4A3K J;  1ITY A;  3HOU J;  1H89 C;  2XGE A;  3CQZ J;  2KDZ A;  1B72 A;  3GTL J;  2WAQ N;  3ZQH A;  1WI3 A;  2MW8 A;  3S14 J;  4FTH A;  1JUS A;  2MG4 A;  1D5Y A;  2R5Z B;  2XRL A;  3A03 A;  5M3F J;  1FIP A;  1I3Q J;  3BG3 A;  1NK2 P;  1TWH J;  3VPR A;  2K40 A;  1X58 A;  3FIS A;  2VKE A;  1ENH A;  1Q1V A;  3BR1 A;  3BR6 A;  3HGG A;  3SDG A;  1W0U A;  4XIC A;  1GV2 A;  4C2M J;  3ZQC A;  2DMT A;  2XPU A;  2M9H A;  3O8G A;  2DA4 A;  1QRY A;  2YU9 J;  1ZK8 A;  2MSY A;  2R5Y A;  3BR3 A;  4LOC A;  4S0H B;  4CYC A;  2CRG A;  3Q0V A;  1OCP A;  1IV6 A;  2LVS A;  5FKL A;  2EBI A;  1XG1 A;  1LFB A;  2N8G A;  4V2G A;  2YUS A;  1RR7 A;  1SFO J;  4B1R A;  3MN2 A;  1H88 C;  1FTZ A;  2FQ4 A;  1MNM C;  1O4X A;  1P7J A;  2HQ5 A;  5F04 A;  3RZD J;  1VF9 A;  1JUP A;  3HKZ N;  2E2J J;  1RKT A;  2JMW A;  4A69 C;  5GPA A;  3JRC A;  2R93 J;  3H0G J;  5K7F A;  3HEF A;  2LKX A;  4EEF G;  2DJN A;  5JLX A;  1JUM A;  3FIW A;  2ME6 A;  3IH3 A;  2R5Z A;  1E3O C;  3LNQ A;  2DMN A;  1HOM A;  1AKH B;  4BY1 J;  1IUF A;  3WHB A;  1HDD C;  3QPS A;  2DN0 A;  4M3F A;  5IYC J;  2EZK A;  3IH2 A;  4D5F A;  4A3D J;  4XRS G;  5FKO A;  4UUT A;  2WV1 A;  2O9L A;  1ZKG A;  2R5Y B;  1IDY A;  3QPL A;  2EZI A;  5F0H A;  3JRI A;  5E3L A;  5M5X J;  3HOV J;  4DYC A;  5E3O A;  2FD5 A;  1JKO C;  2CU7 A;  3JRH A;  4Y7N J;  4IHV A;  3B6C A;  2DMP A;  5IP9 J;  3NAU A;  2HXI A;  2M8G X;  3Q0W A;  4QIW N;  1IRZ A;  5FLM J;  2M0C A;  1OFC X;  3Q3S A;  3RKQ A;  5FKM A;  1TC3 C;  1U8B A;  2LK2 A;  1CQT A;  3B6A A;  2X48 A;  2JA7 J;  1IGN A;  1GVD A;  2LR8 A;  1DU6 A;  2JJ7 A;  5E3M A;  4BBS J;  2ELK A;  2L0K A;  5IYD J;  4M6V A;  1JT6 A;  5E3N A;  1RES A;  1HF0 A;  1TWA J;  1LE8 B;  4C3I J;  1ETX A;  4MFE A;  4DZJ A;  5K7Z A;  1H8A C;  2HOA A;  1QVT A;  1OJL A;  4MFD A;  2HXO A;  2LLK A;  4B3A A;  3A01 B;  1BA5 A;  3JRF A;  5DS9 A;  2P81 A;  3FK6 A;  4IEJ A;  2NVY J;  3PO2 J;  2WB1 N;  5EGO B;  1MBJ A;  1S7E A;  3SFI A;  2VKV A;  3NAR A;  1ZTR A;  4FCY A;  1FJL A;  3MVP A;  4XID A;  1BW5 A;  3GTQ J;  1ZR2 A;  2NVT J;  4W1U A;  4XRS A;  4DZP A;  5EGO A;  1MBK A;  2L7F P;  2Y2Z A;  3F0C A;  2JWT A;  1SAN A;  2HOT A;  5BNG A;  4FIS A;  3Q0U A;  4JX4 A;  2LD5 A;  3HOY J;  2QF7 A;  3M3Y J;  3G1O A;  1U78 A;  5M5W J;  4A3B J;  4A3G J;  4AC0 A;  5EZH A;  3S2D J;  4BBR J;  2ME0 A;  1JTY A;  2OF7 A;  1YRN B;  4L5E A;  2XB0 X;  1B8I B;  4A3J J;  2DMU A;  3JRG A;  2ECC A;  2K9Q A;  5FJ8 J;  3GTP J;  5M5Y J;  1GDT A;  4AUX A;  1U9O A;  2DA1 A;  5IPA A;  2Y31 A;  4D7M A;  5EZG A;  2E2I J;  3K2A A;  2LP0 A;  1I50 J;  3BR5 A;  2DA2 A;  3LSG A;  2K9S A;  2EH3 A;  3D1N I;  1JJ6 C;  3FKI J;  3ZQL A;  1ZR4 A;  5J1R A;  3ZOB A;  5J3L A;  1ETV A;  1IC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...