1FSHA

Structural basis of the recognition of the dishevelled dep domain in the wnt signaling pathway
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
EAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the recognition of the dishevelled DEP domain in the Wnt signaling pathway.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords DISHEVELLED-1
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fshA00
4IHTA 4RB2C 2VOPA 2P5LC 2J5OA 3GVAA 3K0LA 1Z91A 2PFBA 5D8KB 4H0EA 4AIKA 4OIPF 2FOKA 3LA3A 1O3TA 2FA5A 1IW7F 5LHGA 2ISZA 1R1UA 1S7OA 4MEYF 2G7UA 2KIUA 2HYFA 2XKPA 4HAMA 4RGXA 2G7HA 3ULQB 2BE5F 3EDPA 1LB2A 3V7SA 1LEBA 5HDNA 1RUOA 3OOPA 2OQGA 3F22A 3HIFA 4IRGA 1EH6A 3V4GA 3QPHA 3I0TA 1Z7UA 3HRUA 4Y13A 2CQKA 3E6MA 5ICEA 2OQRA 1XDSA 1BI0A 1XMKA 3ZMZA 1HW5A 1R58A 5E17F 1UCRA 2G9WA 5HOOA 4E70A 1WI9A 3DF8A 4BH9A 1MGTA 4S04A 1K78B 1YLFA 3SZPA 1XN7A 1O7FA 3ZQ7A 1LEAA 1ZN2A 4RB0A 4BHBA 1GXPA 4YFNF 2OU2A 1WKMA 1W7PD 2JT1A 5CVRA 4EJWA 4ENKA 2LDUA 5AIQA 4WF2A 4M9XA 1FYKA 5IT9K 4N9IA 4KFCA 4KIBA 4M6YA 1FLIA 5FD6A 3R61A 3KLNA 3HSFA 4G6QA 2WWYA 5J8CA 3DXJF 4I01A 3TO9A 3HSRA 3HHGA 1W4MA 3WTYC 3DV8A 2V1XA 3VFZA 5LHHA 1KU9A 1TBXA 3E3VA 4S05A 2UXNA 3H3ZA 2QBYA 2Y48A 3L09A 3T0YA 2O0YA 4U7BA 5HLGA 1G3TA 1DUXC 1U5TB 1CGPA 5CVIA 2HOEA 4KDPA 1IN8A 1T2KA 4Y15A 3KETA 5FD5A 3MWMA 1WWXA 3D0SA 5F1RA 3WE3A 4A0YA 5A2QZ 4CGZA 1IF1A 4L9NA 3NQOA 5H6QA 4MQVA 4AIJA 5HDGA 1LDDA 3GFMA 3F72A 3GZ5A 3J81Z 2D2WA 5BS6A 4O5VA 2GQQA 2W85A 4MTDA 3FMQA 3TDZC 3M1EA 3JTHA 4NB5A 1R1TA 4PGHA 2PMHA 2FBIA 4EGYA 5FO5A 1K78A 4G7OF 2QM3A 1KQ0A 3RKXA 4BHPA 2GA2A 4HA8A 1FP2A 2XAHA 5L3FA 1LDJA 3P9CA 4UXNA 3OV8A 4YIFA 3F8CA 3ISPA 4RB1A 3H3UA 1AWCA 1MD0A 2B0LA 2A61A 1SD6A 5DCFA 1G3WA 4ETSA 3GFIA 3U2RA 4YIIA 1FP1D 4WXDA 1MDMB 1WSUA 2W57A 1QBJA 2LSOA 4CICA 1YQAA 3QRFF 1PP7U 3DFGA 3F21A 1J75A 1KU7A 2VE9A 3F6VA 3I58A 5ICCA 5JI6A 2IW5A 2GWRA 4LLGF 1FBQA 3COAC 2PQ8A 2WC2A 4LB6B 4ZYEA 4Q5SF 3H92A 1P6RA 4M73A 4EM0B 4L5IA 3GYHX 5HVQC 2L4MA 2JPBA 1D5VA 3QAHA 2EK5A 3LFKA 3IC7A 3DPLC 2YR2A 2ZNYA 4M9ZA 4HOBA 2IVMA 1YW9A 2HZTA 2DBBA 2HS5A 1USSA 3JAMZ 3RPQA 1IXCA 4R8HA 3LA2A 3CDHA 2CO5A 2R3SA 2L3DA 2ZCWA 1SFXA 4BYYA 2NAZA 3HUGA 1E2XA 3IRRA 1ZREA 3WG9A 5A2QK 1J0RA 5D6EA 5H20A 1JHFA 3R0JA 3ML6A 1YG2A 4CHUA 2PEXA 4R79A 4U0YA 2H27A 4MGRA 4L9VA 1O3SA 1S6LA 3KCCA 1J2XA 3ABUA 3ROUA 1HQCA 2ZMEA 5DUKA 3ZP5A 2NRAC 3P7NA 5ICGA 3ELKA 2NNNA 3WTWC 4FX4A 1BI2A 1HKQA 2F5FA 1IAWA 4MTEA 2VT3A 5JFRA 2K86A 3E97A 2JRTA 1XSDA 2VN2A 4LB5A 4I98B 1ZRDA 5E18F 1XSXA 1FT9A 3FZVA 1IN4A 2RQPA 4U0WA 1VTNC 4OU0A 4I7HA 4GGGA 3FM3A 1KU2A 3RKYA 3F23A 1FSEA 5EEGA 3HTUA 2K4JA 3I54A 1FC3A 1OMIA 2KRFA 5L3GA 2XUBA 4M9SA 1WRJA 4UV8A 1B4AA 4PCQA 1K79A 1T98A 4G7ZF 1WQ2A 2HQNA 1DP7P 3TQNA 2LKPA 2MLKA 3ZMUA 2FQ3A 2Q8KA 2IP2A 1HSJA 3L00A 4HX7A 5LHIA 1R1VA 3R6SA 1Z6TA 4GYIA 4JQFA 3DPTA 3CUQA 5ILSA 2VODA 1BOAA 4LG0A 3ZMTA 4A5MA 3ZMDA 2L4AA 2KJCA 5E20A 5HLIA 2HR3A 4UV9A 3SXYA 5HS7A 5LEJA 1AOYA 2RDPA 1YIOA 3E6DA 4CYDA 2ACJA 2LNBA 4P55A 1KU3A 5JVTA 3I59A 2AS5F 4G8XA 3GW2A 3MEXA 1JXSA 1J7KA 2V1UA 3F8FA 2Q0OA 3B02A 1FYLA 5FGMA 4LD5A 6PAXA 2X0LA 1OPCA 2IPQX 3RKWA 4A12A 4MEXF 1X3UA 1PUEE 4HDVA 2EFWA 3C18A 5BQTA 4ZYGA 1OYIA 3GLXA 4EQQA 4UNOA 1PP8F 5J6XA 2Z33A 1BI1A 5FB2A 2A5YB 2IRFG 4XLPF 3FWEA 4ZZDA 2ZBKA 4ZH4F 3RI4A 2MH2A 2ESHA 3M7GA 4HF2A 1KQ8A 1I1SA 3KP4A 2XVCA 2OD5A 4DNCA 3FMSA 3EYIA 1DDNA 3LA7A 3WTSC 2XAJA 4P5OA 1IN6A 3R4KA 5AIPA 1BJAA 2P4WA 4HBLA 2DLLA 3RIRA 1HW1A 4UUVA 5J8FA 5ILUA 2A3SA 2HKXA 1TQMA 1R23A 4KIFA 3HSEA 1V3FA 3CUOA 2M1BA 3I59B 1ZG5A 3HYIA 5DUIA 1U6GA 2HWVA 3NEUA 3ZMSA 2P6TA 4IVNA 2L02A 4UVAA 1D8KA 2E7XA 4RGSA 3BY6A 4RS8A 5D4SA 2R7FA 3G73A 4RAYA 3E5QA 2UZKA 2FNAA 4P9FA 4IHSA 3KP3A 4EJOA 3HOTA 1B6AA 2XIGA 5BOXA 1FOKA 3WGIA 4PDKA 1S3JA 3BDDA 1XGNA 2P5VA 2ESNA 4LK1F 1QZYA 1UFMA 3I64A 2P5KA 5DD8A 1NHAA 4ON0A 3FM5A 4HW0A 1YO5C 2PLYA 4EJUA 1Z05A 1O3RA 4EM1A 2OZ6A 5DEQA 4HF1A 3BJOA 5K5RA 4EMSA 2EV6A 1EV7A 2ZXJA 1FPQA 1B9NA 3ZN0A 2A6HF 3KLOA 3GXOA 3J80Z 1QZZA 1I1GA 2QZ8A 2CYYA 4CDGA 3WTZA 1O3QA 4N0BA 5L3BA 1EH8A 3C7JA 3ZPLA 1T0FA 4KT5C 2BBYA 2Y0MA 2L54A 1LVAA 4XLNF 4Y17A 5HS9A 2VE8A 2NYXA 5DV5A 5CJ9A 2V6CA 2QBYB 5DCMA 4HX8A 1MJBA 2XAGA 4AWXB 1TW3A 3S2WA 4FHTA 4EM2A 3Q9VA 3GFJA 3HRTA 3QP5A 3K1NA 1G3YA 1B59A 2QENA 2P7CB 3O3KA 4M72A 5K1YA 2OBPA 1TNSA 2UXXA 1U78A 2F2EA 2HGCA 3TOBA 5CLSA 4OOIA 1YTYA 1MJAA 1BIBA 3BPVA 1TLHB 3DKWA 2WTEA 1JGSA 4MQ9F 4B09A 2EWNA 3U9GA 4I09A 2M45A 2Z5UA 2IJLA 2K4BA 2GXBA 2PMUA 3ABTA 2FNPA 2RV8A 3WU0A 3KEQA 2BEOA 4CXFA 3KP5A 1KGSA 4YG2F 3F3XA 4HQMA 3GO5A 1HKSA 3WE2A 1ODDA 2DU9A 1HBXG 3I4PA 1BBYA 1G6NA 2EFOA 1U8RA 5ERIA 5L3DA 1T6SA 1U2WA 2DFIA 3K1MA 3BJ6A 2P8TA 1BC8C 2HEOA 2ZO4A 3JAMK 1RIOH 5ICFA 4A6EA 3R60A 5HLHA 1YFHA 2EFQA 2AXLA 5E1WA 1S8NA 1SFEA 3KP7A 3WGGA 1ZG3A 4NHJA 4IPAA 2STWA 3FXRA 3K2ZA 2DK8A 3E5UA 1FWZA 3EYYA 1XMAA 3TOAA 4UVCA 3ECHA 1U3EM 3WTXC 4I0AA 3ZMVA 4HLYA 5FLXK 4KNYA 2QUFA 3T1BA 1MDMA 2XROA 1J5YA 2RN7A 3R0AA 2PBIA 2ISYA 3V8LA 5HS8A 2D1VA 1CF7A 1TNTA 2ZKZA 4CZZA 2QQBA 2Y75A 3T8TA 4M71A 3HTSB 1FSHA 4EGZA 1MZBA 2GA1A 4OINF 3FF5A 2D1HA 4O6JA 3SQNA 1IUYA 3CJNA 4Q47A 2XAFA 2PN6A 1BN5A 2VONA 1ZAOA 1FNNA 3B73A 3GX4X 1OYYA 3HHHA 2CFXA 3JSOA 1SMYF 5BPDA 3V8JA 1ZARA 3EQLF 1K7AA 1SMTA 2RC4A 2HTSA 4ZYDA 1I5ZA 2Z9OA 1S29A 4L5JA 1FZPB 1D8JA 2K7LA 3F8BA 3RYRA 2ETHA 2IA1A 4Q48A 1TW2A 1BIAA 3M9AA 3FHZA 3TGNA 3RJPA 2VT2A 1EH7A 3WGHA 1REPC 2YU3A 3KE2A 2O61A 1U5TC 5D4RA 3F6OA 4HX4A 3WTVC 3JW4A 3DQVC 4HZFA 1ZH5A 1PDNC 1QGPA 2QLZA 2BYVE 4ESFA 3AAFA 2PI0A 2DI3A 4NQWA 1Z1DA 3WTTC 2MA3A 3C3WA 4TV7A 3TO7A 2CSOA 1Z9CA 3WTUC 4LFUA 1SD4A 3VEPA 2J5PA 4YFKF 4GXOA 1H9TA 1QPMA 3MZHA 4EVIA 1L3LA 2JSCA 2ZNZA 4L0YB 1R5HA 2QYOA 1XB4A 1IRFA 3LWFA 1I27A 3IRQA 2FRHA 1UHMA 2M8EA 2V1DA 1P92A 4JBAA 2RKHA 1P4AA 2PJPA 5JR3A 4KMFA 2FE3A 3MFKA 5D8LB 4FX0A 3KP6A 1IRGA 4M6XA 2OA4A 1H9GA 2EV5A 4O3MA 3KFWX 4ESJA 2COMA 5L3EA 2KIMA 1ON2A 3Q5FA 3BPXA 4KICA 4KYWA 1LDKB 2VXZA 3BOQA 3QPTA 3N97A 1XCBA 2ZMEB 2VOOA 1ZYRF 2CW0F 2EFPA 1W5TA 1TQPA 3TO6A 4I02A 3T5XA 2HFHA 3RYPA 3VB2A 1LQ1A 3LQRA 1KYZA 5BMZA 3I71A 4KN4X 2RGVA 2F5EA 4P96A 5K5QA 4A6DA 2C6YA 4WCGA 4ENJA 5LRSA 1ZGJA 1QQIA 2BGCA 4IJAA 2MBFA 1OYWA 5F64A 4IRIA 2EA4A 2IT0A 2DW4A 3RTRA 1QO0D 2JZYA 3QOPA 2HDCA 1YS6A 3JTGA 2X4HA 4BHCA 2A69F 2MD5A 3V8KA 1R22A 3VODA 3J81K 2LF7A 2Z99A 2E1NA 4U7DA 4OIOF 4WWCA 2XRNA 2FMYA 4XSZF 3D5LA 2NNYA 4XSXF 4KA4A 1GXQA 2IA2A 3IKTA 1UHWA 3L7WA 4AD9A 5ED4A 4G9YA 2RNJA 1J9IA 3PQKA 4A0ZA 4IRHA 2Q2EA 4KMUX 1P2FA 4GCVA 4MHGA 1XGSA 1QNTA 1GHCA 3O6BB 4IXAA 1DPUA 1LJ9A 2KJBA 2STTA 4FT8A 2MLGA 5TRDA 2EFNA 2ADUA 2VBYA 2QWWA 2VBXA 2NS0A 4LG0B 1SFUA 2DT5A 2HQRA 4OMZA 1D3YA 4HLXA 1SD5A 2DPUA 3GZ6A 4U0VA 4G7HF 4DQ2A 4ENMA 1T38A 4P9UA 1ZG1A 3J7AO 3C1DA 2XASA 3U1DA 2VBWA 2Z3YA 4Q4ZF 1UB9A 3ECOA 3W6KB 1P4WA 2OAZA 1O7LA 4PGGA 4A5NA 4RAZA 2H09A 3V7RA 2M87A 3SZTA 4BQAA 4RB3C 1IZ1A 1B1BA 3IHUA 2ELHA 3E6CC 1FY7A 4LLLA 1XD7A 3T8RA 4RGRA 2QQ9A 2DK5A 4I2OA 1DPRA 5DDGA 3GF2A 1RI7A 2FBHA 1STZA 4OIRF 3K69A 4PZJA 3K1PA 4BXUA 4B8XA 2HYGD 5K5OA 2V9VA 4IF4A 4HQEA 2OZUA 1ONVA 3MZYA 3HRSA 2FF4A 4A0XA 3IL2A 2IA0A 5CVVA 3FMRA 3SHFA 1W7PA 3LSTA 4KUMA 2FBKA 4AVPA 4WK8F 2EV0A 2FEZA 2EB7A 1Q1HA 2O6GE 1R7JA 3NRVA 1BI3A 2KKOA 5BPIA 1U5TA 4R1HA 3EUHA 4M74A 2H94A 1KQ9A 3MQ0A 1P4XA 3LQQA 2H6BA 3EETA 2EJRA 2FU4A 1HSTA 3L2CA 4K2EA 3ERED 2WV0A 2XHKA 4F7ZA 5DD4A 2GAUA 2YSRA 3PQJA 4YFXF 3I53A 5TJJA 2DAOA 3TDUC 4G6DA 4ENNA 2CG4A 3RDIA 1SD7A 4EV0A 5LGUA 1ZRFA 3KZZA 5CVUA 3MAJA 4XRFA 4I0BA 1F4KA 2W84A 3E6BA 4L0ZB 1F9NA 1L0OC 4ESBA 3O2PE 1JE8A 3LAJA 2FXAA 4JK1X 5KVRA 2A6EF 5CYVA 2M5WA 2ZFWA 5FFZA 2P6SA 4ZZLA 1RNLA 4LGWA 5IT9Z 2GXGA 2MH9A 1GVJA 1IN7A 3CLOA 1BC7C 5L3CA 4WXCA 5H6RA 5LBQA 4ASNA 5DCMB 1FYMA 3CO6C 1XGMA 2R7DA 4UVBA 2FMLA 2W24A 4OMYA 3CUQB 4HV5A 1FBUA 2K02A 1FBSA 5JHUA 1USTA 2QVOA 3BWGA 2DQLA 3KZYA 3FX3A 2ZJ2A 1G4DA 2TDXA 2XGXA 3J80K 3QU6A 3TKYA 2LF8A 1ZLKA 1KYWA 4G94A 2CWEA 2XAQA 1XSVA 3W6JB 3K9TA 3IWZA 4XBFA 4L18B 2O03A 3Q9SA 3WODF 5D5WB 3F8MA 3E5XA 3G3ZA 4N9HA 3ZN1A 2E1CA 1V4RA 1C0WA 5DYMA 3KEOA 1IXRC 5D5XB 2O3FA 5HDKA 2BV6A 1SAXA 3HOSA 1ZGAA 4EJTA 3BP8A 4BNCA 5EEHA 1G3SA 5LEKA 3QU3A 1YS7A 1F5TA 1I6XA 4WXHA 2O8XA 2M30A 4QWQA 1RUNA 3CUQC 1JHHA 1O57A 2GIVA 1Z6RA 1E17A 3DP7A 2DQRA 2VC0A 1FX7A 2GZWA 5E1XA 2VBZA 3F8NA 2EA2A 1HW2A 1XDUA 5E8GA 3RPUA 4L9JA 2YX4A 1K6OA 2HKOA 4QLCU 2VC1A 5LGNA 4GYGA 4U88A 1LNWA 5D5VB 1RZ4A 2A68F 2KIFA 1R5GA 4HDUA 3BZ6A 2V79A 1ZLJA 3FXUA 4HV6A 1R00A 3L9FA 4OIQF 3CO7C 5E1ZB 3GEZA 4WX9A 1KA8A 1TQIA 2YX7A 2P7VB 4CO8A 1OR7A 2XKOA 1F1ZA 2JTVA 1OKRA 5CVJA 1YYVA 1XCVA 3P9IA 4KN7X 1Y0UA 4ZYHA 5LLQA 1A04A 3PFIA 1ULYA 5F6FA 1ZRCA 2H6CA 1HKTA 5AONA 4Z2YA 2A07F 4L9TA 3MCZA 3FXQA 5FFXA 5LGTA 2DTRA 3BROA 3JSPA 2F5DA 3CTAA 1R36A 4LJZF 5IT3A 4D0PA 1W5SA 3GUDA 5ILVA 2JPCA 1MKMA 4LMYA 2DO7A 5FLXZ 5D6FA 1IN5A 2QQAA 4LLNA 4RGUA 2E7WA 4A2UA 3SFZA 1B9MA 1J59A 1S7AA 5LRRA 3V7CA 1ON1A 2HTJA 1H0MA 5E8IA 1IXSB 4MNUA 4AIHA 1YW8A 2K27A 3WU1B 3BJAA 2D45A 1CF7B 4KIGA 1T39A 2YPRA 4BAYA 3QP6A 3VOEA 5D5UB 2CGPA 4HF0A 3IKVA 3LAPA 1XGOA 5KK1A 1TTYA 2DPDA 2W25A 3I5UA 2UWMA 4LK0F 2L01A 3M8EA 3IWFA 3HRMA 4UHTA 3GFLA 2PG4A 3REOA 3GWZA 2MC3A 4HYEA 1HXDA 2F5CA 3M8FA 1BM9A 3KP2A 1MJ9A 1YW7A 2FSWA 2RVCA 1ZHFA 3DEUA 3N4MA 4EJVA 1W7PB 3P9KA 2XV4S 4GO1A
chains in the Genus database with same CATH superfamily
2EPFA 4IHTA 3S2HJ 4RB2C 2VOPA 3TW6A 2P5LC 2IS2A 4CCMA 1ETWA 2J5OA 3GVAA 4XN0A 5LFAA 3K0LA 3OYKA 4PFOA 3B6AA 1Z91A 2CV2A 4M6VA 3SDBA 2E35A 2PFBA 1W36C 5D8KB 4H0EA 2BY2A 2E34A 4AIKA 4OIPF 2PJRA 2FOKA 3LA3A 2WV1A 2DMTA 1O3TA 2ELJA 4XRSA 4CSWA 2FA5A 1TWAJ 1IW7F 5LHGA 3I56I 4M3DA 2ISZA 1R1UA 1S7OA 2Y2ZA 4MEYF 2G7UA 2KIUA 4XK4A 2HYFA 2XKPA 4HAMA 1YJWI 4RGXA 2G7HA 1WJFA 3ULQB 2BE5F 3EDPA 2BHZA 2VLAA 1LB2A 4QSHA 3V7SA 3A0BC 3DU5A 2V9KA 1NK3P 2LY9A 1LEBA 2EZHA 4PSWA 5HDNA 4IZZA 1RUOA 3OOPA 4KISA 1A5JA 3O8GA 2OQGA 3F22A 4XQFA 3HOWJ 3HIFA 4IRGA 2YU9J 1EH6A 3V4GA 4CCLA 5J40A 3MMYB 2L9VA 1JKOC 2M34A 5JVGF 2CUEA 3QPHA 2HOSA 5KAFC 2DA2A 3I0TA 1Z7UA 3HRUA 4Y13A 2LYCA 2CQKA 3E6MA 5ICEA 3VYRB 1GUUA 2WAEA 1S72I 2M8GX 2OQRA 1UG2A 1XDSA 4HEA2 2I10A 1BI0A 3PO3J 1XMKA 2HOAA 5K7HA 3ZMZA 1HW5A 1R58A 5TGTA 5E17F 1UCRA 3WU2C 2G9WA 5IP9J 4PK4A 4E6KG 2WBMA 5HOOA 3BR2A 4E70A 1WI9A 1W5CC 1X19A 3KEYA 4MIMA 1B72B 3DF8A 4BH9A 1MGTA 4S04A 1K78B 1YLFA 3SZPA 2MC4A 1XN7A 2K9SA 2DA3A 1O7FA 2KQRA 3TP3A 3ZQ7A 2X1DA 1LEAA 4F3QA 1ZN2A 4RB0A 4BHBA 1GXPA 4YFNF 2OU2A 1WKMA 1W7PD 2JT1A 5CVRA 1MMAA 2OJED 3U1KA 1OLTA 4EJWA 4ENKA 1POGA 2LDUA 3LSGA 4A3BJ 2JA5J 3ABLH 3PFYA 5AIQA 4WF2A 4M9XA 4B3AA 3K4NA 1FYKA 2F4IA 5IT9K 3K4CA 4N9IA 5EZHA 5EGOB 1VQOI 4KFCA 4KIBA 2EZKA 4M6YA 2EH3A 2Z1DA 2F4MB 2PMZA 1FLIA 3FKIJ 3GTLJ 1T8IA 5FD6A 1XMXA 3K10A 3R61A 2JUGA 3KLNA 3HSFA 4G6QA 2WWYA 5J8CA 3DXJF 4CZCA 4I01A 5J4VA 3H5NA 3TO9A 3HSRA 3BCAA 3HHGA 1W4MA 5IYBJ 3WTYC 3DV8A 3OL3A 1ZK8A 2V1XA 3VFZA 5LHHA 3TEDA 4A69C 3S16J 4M3GA 1KU9A 1LE8A 1TBXA 4BE0A 3LNQA 3E3VA 4S05A 2UXNA 3H3ZA 2QBYA 3JRGA 2Y48A 3L09A 3ZRGA 3OIPA 3T0YA 2O0YA 4U7BA 3ZOBA 1BR1A 5HLGA 1G3TA 5FJ8J 1DUXC 2BW3A 1U5TB 1CGPA 3G2BA 4PJMA 5CVIA 3SJMA 2HOEA 4KDPA 3U21A 1IN8A 1T2KA 4Y15A 3KETA 5FD5A 5BNGA 3FXJA 2R7UA 3MWMA 2MD0A 4E7JA 1WWXA 3D0SA 2Y9ZA 5F1RA 3WE3A 4A0YA 3HZJA 3KYLA 2X6OA 5A2QZ 1EKEA 4CGZA 1UMQA 1W1WE 3Q0WA 3LSKA 1TWFJ 1IF1A 4L9NA 4X0GA 3NQOA 2X1EA 5H6QA 4OAZA 2DOAA 4MQVA 4AIJA 1WHUA 4X1EA 3ABKH 5HDGA 1K61A 1LDDA 2OTJI 3GFMA 3F72A 1OR7C 3IAM2 3GZ5A 3J81Z 2HVQA 1ZTRA 2D2WA 3G1OA 1PUFB 2VJIA 1NG6A 1VQ5I 5BS6A 2Z16A 2XPWA 3S15J 4O5VA 2RREA 3IP4B 2GQQA 2W85A 4MTDA 3FMQA 3TDZC 3M1EA 1R4MB 3JTHA 3HOVJ 1VQLI 4NB5A 1E0EA 3ERMA 1R1TA 2MABA 4PGHA 2PMHA 2VI6A 4XR6A 2FBIA 5IYCJ 4EGYA 2DMNA 4I6ZA 2HOTA 5FO5A 3LSHA 3VDXA 1K78A 2VL8A 2QM3A 4G7OF 1W0UA 1KQ0A 3RKXA 3VPRA 4CYCA 4BHPA 4QTRA 4AVZA 2LFBA 2DODA 2GA2A 3CP8A 4HA8A 2M4KA 3RQ4A 2DFHA 2BW3B 2KZVA 1FP2A 1B8IA 1IO2A 2JUCA 2XAHA 5L3FA 2LREA 4FCYA 1OCOH 1LDJA 3P9CA 3OR2C 4M3FA 2R5ZA 3OV8A 4UXNA 4YIFA 3F8CA 3ISPA 3PL8A 4RB1A 4QIWN 3H3UA 1AWCA 1MD0A 1G59A 2KRCA 2A6TA 2OUMA 5CQGA 2B0LA 2A61A 1SD6A 5DCFA 1VQ8I 1G3WA 4J00A 4C2UA 4RM2A 3CCQI 2X48A 1MH3A 2O8KA 1K6YA 1QHHD 2F6CA 3HG9A 4ETSA 3GFIA 3U2RA 3GMEA 4YIIA 3ESWB 1FP1D 4KJZA 4WXDA 2MG4A 3I4MJ 1I50J 1MDMB 1WSUA 2W57A 4IHVA 1QBJA 2QSGX 1WJEA 3BR0A 1DGRM 2LSOA 3VYTB 4BXFA 4CICA 1YQAA 2IGMA 5GTIC 3QRFF 3DEEA 1PP7U 3BG6A 3DFGA 3F21A 1IRZA 2V1NA 3OYJA 1J75A 2VE9A 3F6VA 3I58A 1KU7A 5ICCA 1ZKGA 5JI6A 2DDAA 2IW5A 2BXYA 2GWRA 4LLGF 3A01A 1FBQA 3KIOA 3COAC 2PQ8A 2WC2A 4LB6B 4ZYEA 4Q5SF 3H92A 2WAQN 3SZGA 1P6RA 2KISA 4M73A 4FETA 3GZNB 4EM0B 4L5IA 3K4MA 3GYHX 5HVQC 3G1MA 2L4MA 4V2FA 2JPBA 2ZC2A 1D5VA 5J1UA 4IO9F 1ETXA 3QAHA 2EK5A 1Z3YA 3LFKA 3IC7A 3DPLC 1MBKA 3NWSA 1GV5A 2WAQA 2YR2A 2ZNYA 2XB0X 4XONA 3VYSB 4M9ZA 5E3MA 3DCFA 1KONA 4HOBA 2IVMA 5B1AH 1YW9A 2HZTA 2DBBA 3CCJI 2HS5A 1USSA 3JAMZ 3RPQA 1IXCA 2DMPA 3QYEA 4R8HA 3LA2A 3CDHA 2CO5A 4N4OB 2R3SA 3PJRA 4LIVA 3RZDJ 2L3DA 3ZCOA 2ZCWA 1FJLA 3CCRI 2IS6A 3BLYA 2VASA 3CCMI 3DLLF 1VQ7I 4BEHA 2E2JJ 1SFXA 4BYYA 2CRGA 2KRHA 2R5ZB 2NAZA 1MMGA 1IV6A 3HUGA 1QRYA 1E2XA 2H8WA 3AG3H 4CCOA 4XOTA 3IRRA 1ZREA 3WG9A 5A2QK 1J0RA 5D6EA 2A5WA 1JHFA 5H20A 3BR1A 3R0JA 4M3BA 1Z77A 1SVOA 3K4KA 2BHYA 3ML6A 1YG2A 4CHUA 3A03A 2PEXA 4R79A 2BVLA 2X6YA 1U9NA 5E3LA 1TC3C 1Y56A 4U0YA 2H27A 4MGRA 2ID3A 4L9VA 5M3MJ 5JLWA 4AU7A 1O3SA 2MGQA 2YS9A 1S6LA 3AKZA 3KCCA 5EJCA 2NVXJ 2R92J 1J2XA 1X58A 2LY2A 2VJJA 3ABUA 1HQCA 3ROUA 5C4JJ 3S17J 2PX9A 2JRMA 2ZMEA 3S3NA 1JKPC 5DUKA 1GV2A 3ONQA 3ZP5A 1WZ2A 2NRAC 3P7NA 5ICGA 3ELKA 1QPIA 3PIOF 3L2QA 3PSFA 4F92B 2NNNA 3WTWC 3CDIA 4FX4A 4ANJA 4AC0A 3K4LA 4E7KA 1BI2A 1HKQA 1TZLA 2F5FA 2JWTA 4PFPA 4MTEA 4B48A 3IV5A 2QF7A 1IAWA 2VT3A 5JFRA 2K86A 3CC4I 5IOZA 3E97A 3BR3A 2JRTA 1XSDA 2VN2A 4C30A 5J47A 4LB5A 4I98B 3HM5A 2I8DA 1ZRDA 5E18F 1XSXA 1MBEA 1FT9A 3FZVA 1IN4A 2RQPA 4U0WA 1VTNC 4OU0A 4I7HA 1Z21A 1H8AC 4GGGA 3FM3A 4HNTA 2ZXHA 3OYNA 1KU2A 4D5FA 3RKYA 3F23A 1FSEA 5EEGA 3HTUA 4XN3A 1YOVB 2HZDA 2K4JA 3I54A 1FC3A 1OMIA 4RM3A 2KRFA 5L3GA 1K4TA 2XUBA 2CV1A 1UAAA 4M9SA 2ME6A 1WRJA 1RESA 3HBLA 3DTKA 1EA3A 2BZTA 2CW7A 4UV8A 5FRMA 1B4AA 2HXIA 3C2GA 4PCQA 3BG9A 2HDWA 1K79A 1T98A 4G7ZF 4Y7NJ 1EJ9A 4Y33A 3OS0A 3EUHC 5F0HA 1WQ2A 2HQNA 2ZMEC 1DP7P 3OWTA 3TQNA 2E2HJ 2B9SA 2RAEA 5GADJ 2LKPA 1FMVA 4RBOA 2MLKA 3VWBA 1YX3A 3ZMUA 3FKJA 2FQ3A 2IGNA 2Q8KA 2IP2A 5EYRA 1HSJA 1VQPI 3L00A 1GDTA 2CFOA 4HX7A 5LHIA 2DA4A 1R1VA 2TCTA 4XL9A 3R6SA 1Z6TA 2JSPA 4GYIA 3PNVA 4JQFA 4UUTA 3DPTA 3FXMA 3CUQA 5K7ZA 5ILSA 5B5EC 2R7XA 2VODA 3QYFA 1XPXA 1JTXA 1BOAA 2W1OA 4LG0A 3ZMTA 4A5MA 3OYBA 3ZMDA 2L4AA 2KJCA 5E20A 1HOMA 3SEZA 1LE8B 5HLIA 2HR3A 3BQYA 4UV9A 3SXYA 5HS7A 5LEJA 1AOYA 2RDPA 1YIOA 2X6XA 5CQEA 3BR5A 4DOZA 2JA6J 3E6DA 5IP7J 4CYDA 2ACJA 2LNBA 4P55A 1KU3A 4ZJZA 2VUMJ 2DTZA 5JVTA 1VF9A 4DZJA 2PMZN 3I59A 2AS5F 1NTCA 3DEWA 1WFXA 5DM7F 4G8XA 4DYCA 2IS1A 3GW2A 2FJ1A 3HC7A 3MEXA 1ZR4A 1JXSA 4QPQA 1J7KA 2V1UA 3LSJA 3F8FA 2Q0OA 3L2VA 3B02A 3FHNA 1FYLA 5FGMA 4LD5A 1JI8A 6PAXA 2X0LA 1OPCA 1YHQI 3DLAA 1LFBA 1Y1VJ 3BTIA 4ZC3A 2DFEA 3DU6A 2O5RA 4IQ4A 2JVGA 2IPQX 3RKWA 3D1NI 3CMMA 1IRXA 4A12A 1YX5A 4MEXF 1D1AA 1X3UA 2V7FA 4CA0A 1PUEE 4HDVA 3BG3A 1FMWA 4BDZA 4XOPA 2E71A 2EFWA 3CCSI 2P81A 3C18A 3KPHA 3CMEI 2BY1A 4E7LA 3EUKL 4ZYGA 5BQTA 1U9OA 2Y9YA 1OYIA 3GLXA 3CC7I 3BC8A 4H4KC 4EQQA 2LKSA 2E1MC 4UNOA 1PP8F 5J6XA 2M9HA 2Z33A 1TT0A 1BI1A 2KIQA 3W2VA 3L2WA 2ZSIB 4E4HA 5FB2A 2A5YB 1SFKA 2IRFG 4C2TA 1E3HA 2VB6A 4XLPF 5E79C 3FWEA 3CD6I 4ZZDA 2ZBKA 4ZH4F 3RI4A 4F52A 2MH2A 4NC8A 2ESHA 4L5EA 5GAGJ 3M7GA 4UY8I 4HF2A 1VZ0A 1KQ8A 1I1SA 2JN6A 3KP4A 2L7KA 2XVCA 2OD5A 1BW5A 2HYJA 2WADA 4DNCA 1AKHB 3FMSA 3EYIA 2ELKA 3HKZA 1LUJB 2DA6A 3LA7A 3WTSC 2XAJA 4P5OA 1DDNA 1IN6A 3R4KA 2CQQA 5AIPA 4B43A 5E3NA 2HXOA 2R7OA 1BJAA 2P4WA 4HBLA 2DLLA 2VQGA 4DZPA 4XORA 2L9SA 5FLVA 3RIRA 3GTPJ 1HW1A 2WB1N 4D1QA 4UUVA 1WPKA 3F9KA 5J8FA 5ILUA 3H9GA 1PUFA 1TT5B 2A3SA 2HKXA 5CKTA 3CLQA 1JGGA 4X6AJ 1TQMA 1R23A 4KIFA 3HSEA 3JREA 1VQ6I 3BTLA 5KAIC 5HODA 1VQMI 1VQNI 1V3FA 5TISC 3CUOA 2AO9A 2M1BA 2CS3A 4J19A 3QYBA 3FK6A 3M1CA 3I59B 1ZG5A 3HYIA 5DUIA 1U6GA 2QKLB 2HWVA 3L1PA 3OR1C 4XICA 1IDZA 3NEUA 3ZMSA 4Y52J 2E2IJ 2OF7A 2P6TA 2JMWA 4IVNA 3HDDA 2L02A 4UVAA 1D8KA 2DOFA 3IH2A 2E7XA 4BGDA 1OCCH 5M5YJ 4RGSA 1VQKI 3BY6A 4XKCA 1OFCX 1MIJA 4RS8A 5D4SA 1UJ8A 4XKWA 2R7FA 3ZQFA 1IC8A 3L2UA 2IEKA 3OYEA 2FX0A 3RZOJ 3G73A 1V54H 4CCJA 1FOXA 4RAYA 3RSNA 3E5QA 2L9RA 2UZKA 2R7TA 2NOJB 4ZYAA 2FNAA 4A3CJ 4P9FA 2DT7B 3SEQA 1SC7A 4IHSA 1RR7A 2W82A 3KP3A 4EJOA 5CPRB 4ZTJA 3OYHA 2XIGA 1B6AA 3HOTA 4HRIA 5BOXA 2BY3A 1FOKA 4B44A 4XRMA 5KNLA 3WGIA 1F43A 2XPVA 1JUPA 2PJRB 4PDKA 4JP0A 4ABZA 3S93A 4CCNA 1S3JA 3JRHA 3BDDA 1HCRA 1JJ6C 1XGNA 2P5VA 2X9DA 2ESNA 3O8HA 5FLMJ 2CQXA 4A3IJ 1MBHA 4LK1F 1QZYA 1UFMA 3I64A 1D1CA 1FIAA 2P5KA 5DD8A 4JX4A 1NHAA 3L2RA 1Y1WJ 2O7OA 2MFZA 3PO2J 2CUZA 1D0XA 1N75A 1YJNI 4ON0A 3FM5A 1JKQC 4HW0A 3OSGA 1SVLA 2A05A 1YO5C 2PLYA 2DJIA 4EJUA 1Z05A 1O3RA 4EM1A 2OZ6A 5DEQA 3OSFA 3BJOA 5K5RA 2MYSA 4EMSA 4HF1A 1DU6A 2EV6A 1EV7A 2ZXJA 4FISA 1FPQA 1B9NA 3ZN0A 2A6HF 3MVPA 3KLOA 3GXOA 3I9V2 3J80Z 1QZZA 1P7IA 2JK3A 1M1EB 1I1GA 1YJ9I 1BA5A 1Z0XA 2QZ8A 2DT6A 3LSMA 2LBFA 2CYYA 4CDGA 2LC2A 3WTZA 1XX5A 1P9QC 3FIWA 2E36A 2R7VA 1O3QA 4N0BA 3IUOA 5L3BA 3UNGC 1EH8A 5HNFA 1XC5A 3C7JA 2X85A 3BCBA 3ZPLA 1T0FA 1YRNA 4KT5C 2B63J 2BBYA 2Y0MA 2L54A 1LVAA 1JJ8C 2XPUA 3E1SA 4XLNF 4Y17A 5HS9A 2VE8A 1WJCA 2NYXA 5DV5A 3VYUB 4F91B 5CJ9A 4BQNA 3Q0UA 2V6CA 2QBYB 1TP4A 5DCMA 3OY9A 4HX8A 1MJBA 2K9QA 2XAGA 1H89C 4PJ0C 3IH3A 2D5VA 2Y69H 2ZXIA 4AWXB 1TW3A 3S2WA 4ITVA 2ID6A 4FHTA 3FISA 2OV7A 3PSIA 3Q9VA 3GFJA 2KHMA 3BZKA 3HRTA 3QP5A 4EM2A 5M5WJ 4RAGA 3K1NA 1I6HJ 3GTQJ 1G3YA 4LOCA 3H5AA 4AM3A 1B59A 2QENA 2P7CB 2R93J 2R7WA 3O3KA 1SFOJ 5FKOA 2XGDA 4M72A 4W97A 5K1YA 1W36D 2OBPA 1TNSA 3OYFA 4UUSB 2UXXA 1U78A 2F2EA 2HGCA 2LH9A 3TOBA 4DBQA 5CLSA 3CQZJ 4OOIA 3CMAI 1YTYA 5JLXA 1X1AA 1MJAA 1BIBA 2W00A 3BPVA 2CU7A 2DCEA 2KMUA 1TLHB 1NG7A 2WTEA 3DKWA 1JGSA 2FOWA 4MQ9F 3VSKA 4B09A 2CUFA 2EWNA 1BOBA 3CJTB 1K4SA 3U9GA 4II3A 4I09A 4RLQA 2M45A 1IJWC 1Z3XA 2Z5UA 2IJLA 1PVEA 2K4BA 2GXBA 2PMUA 1FIPA 2VKEA 3ABTA 1X4PA 3AL0B 4P1WA 2WB1A 1VQ4I 2FNPA 2RV8A 3WU0A 3KEQA 2V4JC 2BEOA 3ASNH 4CXFA 3KP5A 1KGSA 3D5SC 4YG2F 3F3XA 4HQMA 3GO5A 4BY1J 2FUG2 5IY5H 1HKSA 3WE2A 5GPCA 2HQ5A 1ODDA 2DU9A 2GIZA 1HBXG 2AQFA 3I4PA 1BBYA 2KZGA 1G6NA 2EFOA 3PUBA 1U8RA 1T56A 5ERIA 1A6QA 3Q0VA 5L3DA 1X3ZB 3QODA 1X1CA 1T6SA 1U2WA 2B7EA 3AG4H 5C44J 1S9HA 3HGGA 2DFIA 3K1MA 4IHXA 2VQHA 2G0EA 3BJ6A 2P8TA 1BC8C 2HEOA 3IAS2 3A01B 2HVSA 3S1QJ 2ZO4A 3JAMK 1MMDA 4XRSG 1YE9A 1RIOH 5ICFA 4A6EA 3R60A 5HLHA 1YFHA 3KX2A 1IGNA 4NC6A 3W6VA 2EFQA 3PM1A 2AXLA 4F93B 5E1WA 3CCLI 1R6RA 4PJLA 1S8NA 1SFEA 3KP7A 3WGGA 1ZG3A 5B1BH 4C3HJ 1Y39A 3MKWB 4NHJA 3S1RJ 4GRIA 4IPAA 2Q1ZB 1SVMA 1F36A 2QSFX 3FXRA 3JRFA 2STWA 3K2ZA 2DK8A 3E5UA 1FWZA 4IOAF 3EYYA 2CW8A 4LIUA 4PJNA 2VIXA 3V42A 1XMAA 3TOAA 1N77A 4RDUA 5F1JA 2KFDA 1OQYA 4UVCA 3G4SI 2VKHA 3BTCA 4W1UA 2XF6A 2LVSA 3ECHA 2K85A 1ZQ3P 3MN2A 1U3EM 3HGYA 3WTXC 4ZDOA 1OCRH 3IH4A 4I0AA 4BJTA 3ZMVA 2LTPA 2L9NA 3PNTA 4HLYA 3HJEA 5FLXK 4KNYA 2WA0A 2QUFA 2BOLA 3T1BA 4YRVA 2EINH 2XROA 2VQLA 1MDMA 1J5YA 4UUSA 2RN7A 3R0AA 2PBIA 2ISYA 3V8LA 5HS8A 2D1VA 1CF7A 2P0WA 1TNTA 2ZKZA 4XIDA 3A2KA 4CZZA 2KL4A 4GFBA 2QQBA 1MBGA 2Y75A 4U87A 3SFIA 3OOUA 5J1RA 3T8TA 4M71A 3HTSB 2V6EA 1FSHA 4EGZA 1OCZH 1MZBA 2LMDA 1HDDC 3OL4A 2GA1A 3WHCA 4OINF 3FF5A 2D1HA 4XMYA 1U8BA 1O4XA 4O6JA 3SQNA 1IUYA 3ASOH 3CJQB 4NDLA 1ACIA 3CJNA 4PJJA 4Q47A 1Y0NA 1ITYA 1H88C 2JJ7A 2DDBA 4BE1A 2XAFA 2R7QA 2PN6A 3AFHA 1BN5A 2VONA 2HDDA 4HSTA 4FTHA 2M4GA 4BL0B 1ZAOA 1FNNA 3B73A 2EIMH 3PNYA 3EPZA 4ZTFA 2HQAA 4XLHA 3GX4X 1OYYA 3HHHA 3HUGB 2CFXA 3OYCA 3JSOA 1VFCA 1SMYF 4IEJA 4D7NA 5BPDA 3V8JA 5EG0A 3MKYB 1ZARA 3DBHB 3EQLF 2R0QC 1SMTA 1K7AA 2ZB9A 2RC4A 4KT6A 2FQ4A 2HTSA 5HLTA 5IYDJ 5H2FC 4ZYDA 1I5ZA 2Z9OA 1S29A 1B72A 4L5JA 2VJ5A 5DS9A 2DJNA 1FZPB 1D8JA 1HF0A 2K7LA 3F8BA 3RYRA 1Q1VA 2ETHA 2IA1A 4Q48A 4D7MA 1TW2A 1BIAA 3WHBA 1X1PA 3M9AA 1RETA 1Y8RB 1DGWY 3FHZA 3TGNA 3RJPA 2VT2A 1EH7A 3WGHA 1REPC 1A6IA 2YU3A 3KE2A 2O61A 5JHFA 2R7SA 4JOMA 1U5TC 1MSEC 2Y0SN 5D4RA 2M7BA 3F6OA 4HX4A 3WTVC 4I76A 3JW4A 3H9JA 2QSHX 2IGOA 1IV8A 2LP0A 3DQVC 4HZFA 4JYKA 1ZH5A 2DFFA 1PDNC 2K9MA 4XLEA 1QGPA 1WH7A 2LRDA 2QLZA 3GTMJ 2BYVE 4ESFA 3FXLA 3OYGA 3FBNB 2X1CA 3GLLA 3AAFA 1GVDA 1NH3A 4MFEA 2PI0A 3M3YJ 2DI3A 1LVKA 1Z1DA 4NQWA 2V26A 3WTTC 3DTEA 2XGEA 2MA3A 3C3WA 4TV7A 3K70D 3TO7A 2CSOA 9ANTA 3RPUD 1X1DA 2HVRA 3CMYA 2BVMA 1Z9CA 1VQ9I 1E3PA 4NQWB 3WTUC 5J4YA 4LFUA 1SD4A 2YUSA 4BKXA 3VEPA 3W2WA 2HPMA 3H3VK 2M3AA 4XLFA 3K2AA 2J5PA 3M8JA 1D1BA 1FEXA 4YFKF 4GXOA 1H9TA 1QPMA 2DMUA 2ZJPF 3MZHA 2E5NA 2F5VA 2AXTC 4JX5A 4EVIA 3HOUJ 1L3LA 2R5YA 2JSCA 2EQRA 4GDFA 2WY8Q 2ZNZA 1ZGWA 4L0YB 2DA1A 1R5HA 2QYOA 1XB4A 1IRFA 2KP6A 3LWFA 1Z67A 1I27A 3IRQA 2FRHA 1OCPA 1RRJA 4J01A 1UHMA 2M8EA 2V1DA 1JUSA 1P92A 3DKYA 4XLAA 4JBAA 4C2MJ 3CCVI 2RKHA 1P4AA 2PJPA 5JR3A 4IHYA 2W4SA 1WJBA 2FE3A 3CJRB 4KMFA 3MFKA 2IXSA 2V9PA 5D8LB 4HPQA 1X4OA 4FX0A 3KP6A 1IRGA 3KYCB 4NUBA 4Y3OA 4M6XA 1QU3A 2OA4A 1H9GA 2EV5A 4O3MA 3KFWX 3ZQGA 4ESJA 1RKWA 2COMA 1PJRA 5L3EA 3H0GJ 2LY1A 2KIMA 1ON2A 5EF6A 3Q5FA 2E1MB 1QVTA 4DIQA 3BPXA 4KICA 1MNEA 1VNDA 1WCMJ 1CQTA 4KYWA 3CCEI 1WJ5A 1LDKB 2VXZA 2KT0A 3BOQA 1ZELA 3QPTA 4HSRA 3N97A 1FTZA 1XCBA 4QPOA 3BZCA 3J7YJ 3LFUA 2ZMEB 3DWLE 2VOOA 2NVYJ 4BXXJ 1W0TA 1ZYRF 2HI3A 3ABMH 2GOXB 1UZCA 2CW0F 2EFPA 1W5TA 3RCOA 3AL0C 1TQPA 3TO6A 2HPIA 3CZ6A 4I02A 3T5XA 2HFHA 1MMSA 3RYPA 1AKHA 3VB2A 2VKVA 1LQ1A 3LQRA 4NBQA 1WVRA 3HPHA 3HOZJ 2Y31A 3HL2A 1KYZA 4C9YA 3CCUI 4CUGA 1UG0A 4A3KJ 5BMZA 1HDPA 3EUAA 3I71A 4KN4X 2RGVA 2F5EA 1WGXA 4P96A 1RC9A 5K5QA 4A6DA 2C6YA 4WCGA 4MFDA 4ENJA 5LRSA 1ZGJA 2K3FA 3W3CA 4BQQA 1QQIA 1QVUA 1IUFA 2BGCA 2X51A 1QZEA 4IJAA 2MBFA 1OYWA 5F64A 1G2HA 1ERDA 1ORKA 2EA4A 4IRIA 2IT0A 4XLCA 2DW4A 3RTRA 1QO0D 2JZYA 3QOPA 2OC6A 1APLC 1I3AA 2HDCA 2CH0A 1JTYA 1YS6A 2LR8A 4AIDA 1RPWA 3JTGA 5DM6F 2X4HA 2DN0A 4BHCA 3JRCA 2A69F 3H5RA 2MD5A 4C3IJ 1UELB 1Z7LA 4LG3A 3CP2A 3V8KA 1R22A 3VODA 3J81K 2LF7A 4BEHB 3BR6A 2Z99A 2E1NA 4U7DA 4OIOF 5K7FA 4WWCA 1JT0A 2XRNA 2FMYA 4XSZF 3A0HC 3D5LA 3FK7A 2NNYA 4XSXF 5F0CA 3Q3SA 4KA4A 1GXQA 1Y6IA 2IA2A 3IKTA 1N78A 1UHWA 4F55A 2KPMA 2TRTA 3HXLA 4D9JA 5GTHC 3L7WA 1WI3A 1EF4A 4AD9A 5ED4A 4G9YA 2RNJA 1J9IA 4XKVA 3PQKA 4A93J 4A0ZA 3WG7H 2COBA 5F0FA 2EZLA 3S14J 4IRHA 2Q2EA 4IL6C 3CESA 4KMUX 3RQIA 1P2FA 4GCVA 4MHGA 1XGSA 3K6GA 5EGOA 2LK2A 3BQZA 3H9QA 3OYMA 1QNTA 1SEUA 3M4OJ 5M3FJ 4BU2A 1YIJI 3KZIC 3HOYJ 1GHCA 3M07A 1JUMA 2IBDA 3HB9A 4E7SA 3O6BB 4IXAA 3OYDA 1DPUA 1LJ9A 2KJBA 1VI0A 4V19K 4RLFA 2STTA 4FT8A 3G71I 2MLGA 5TRDA 2EFNA 2ADUA 4A3DJ 3P5JA 4A3EJ 1TWGJ 2VBYA 2KDOA 3ZQQA 2QWWA 4MLOA 2VBXA 4RMNA 2NS0A 4LG0B 1SFUA 2DT5A 2HQRA 2CQNA 4OMZA 2F48A 3MKLA 1D3YA 4HLXA 4BS9A 1SD5A 4B4CA 3HOXJ 2CMPA 3G6EI 2DPUA 3GZ6A 4U0VA 4G7HF 4DQ2A 4DJAA 4ENMA 1T38A 4IHWA 2DYRH 4N4NB 3X2QH 2E1OA 4MO7A 4P9UA 1ZG1A 3S1MJ 3J7AO 2VKDA 2DA5A 3C1DA 5C4XJ 3TP0A 2XASA 1E3OC 3RKQA 3U1DA 2VBWA 5F27A 2Z3YA 4BDYA 4Q4ZF 2NVTJ 1UB9A 3ECOA 3W6KB 4B47A 1P4WA 4XKBA 2OCCH 5E3OA 2OAZA 1O7LA 4PGGA 4A5NA 3FXOA 4BQOA 1YI2I 4RAZA 2H09A 3V7RA 2M87A 4YIRX 3SZTA 5GP9A 4BQAA 4RB3C 1IZ1A 1B1BA 3IHUA 1DQUA 2ELHA 3E6CC 1FY7A 4B1RA 4AYBA 4G6TB 4LLLA 1XD7A 3T8RA 2R7RA 2H1KA 4RGRA 2QQ9A 2DK5A 4CCKA 3E7LA 4I2OA 1DPRA 2QGUA 5DDGA 2ZFUA 3JRAA 2IS4A 2L5QA 3GF2A 2MW8A 1RI7A 1AU7A 2FBHA 3ZQLA 3BG5A 1STZA 4OIRF 1WH5A 4EATA 4JX6A 3K69A 4PZJA 3MKZA 3I3LA 3K1PA 1MSFC 5KCMA 4BXUA 5IPAA 2CUJA 4B8XA 5M5XJ 3F0CA 4YEJA 1BJZA 2HYGD 4BJ5C 2JA8J 5K5OA 2V9VA 2OPTA 2BXZA 4IF4A 4HQEA 1R9TJ 3S2DJ 2RQQA 2OZUA 1ONVA 4A3JJ 2GXAA 2ME0A 3MZYA 3HRSA 3OIOA 4D5CA 2EIKH 3JRIA 2FF4A 4A0XA 2HNHA 1BR2A 3IL2A 5FKLA 4HNUA 2EILH 2HU9A 2IA0A 3QOEA 1ETOA 3BT9A 2XF7A 5CVVA 3FMRA 1S5LC 4YELA 3SHFA 1W7PA 2QCOA 3LSTA 4KUMA 3UKGA 3S3OA 2FBKA 4AVPA 2UV1A 4WK8F 2EV0A 2FEZA 2BY0A 3A1YA 2EB7A 2L0KA 1D5YA 1Q1HA 2QEXI 4IX7A 1R7JA 2O6GE 3A4CA 3HEFA 3NRVA 1BI3A 2KKOA 3KYDB 5BPIA 2UUZA 2DXIA 1U5TA 4R1HA 3EUHA 4M74A 4RA2A 1GLNA 2CJJA 2XGCA 5FKMA 2H94A 1KQ9A 3MQ0A 2DOEA 2XRLA 1P4XA 3LQQA 2H6BA 3EETA 3OYLA 1B8IB 2EJRA 2FU4A 1HSTA 3FXKA 3L2CA 3H0DA 4K2EA 3ERED 2WV0A 2LOOA 4NNJA 2XHKA 4F7ZA 3GBGA 5DD4A 4DW6A 4AYBN 2GAUA 4ZDLA 2YSRA 3PQJA 1QHGA 4YFXF 1QA6A 3I53A 2GOMA 5TJJA 1MNDA 2FD5A 2DAOA 1D0YA 4G6DA 3TDUC 4ENNA 2CG4A 3K7AJ 3RDIA 1I39A 5F08A 1A35A 1SD7A 4EV0A 3S1NJ 5LGUA 1ZRFA 2H1LA 2IAIA 3KZZA 5CVUA 1J09A 3MAJA 4XRFA 3S8PA 3FBIB 2VXDA 4LITA 1SAUA 4I0BA 2GLOA 1F4KA 2W84A 3E6BA 4L0ZB 4BBSJ 1GT0C 2I5UA 1F9NA 1L0OC 4Y4RA 4ESBA 4E7HA 3O2PE 1JE8A 2JQ7A 2M0MA 4A3MJ 4DBRA 3S3MA 4OWRB 3LAJA 2FXAA 1XTAA 2XSJC 4JK1X 5KVRA 1FOYA 2WAFA 5IOYA 4BUPA 2A6EF 5CYVA 3K4JA 2CV0A 3MD2A 2DYSH 2M5WA 2ZFWA 5FFZA 2DMQA 2P6SA 4ZZLA 4CYCB 1RNLA 4LGWA 2L7MP 1T0FC 2EIJH 5IT9Z 3MZ8A 2GXGA 2MH9A 1R49A 4NC7A 1GVJA 2NS7A 2XB5A 3CDLA 1IN7A 3CLOA 3N05A 2E5ZA 1BC7C 5L3CA 4WXCA 4DGWB 5H6RA 5LBQA 3H35A 1BR4A 4ASNA 4AUXA 5GPAA 2EBIA 5DCMB 2ZJRF 4A3LJ 1FYMA 3CO6C 3B6CA 1XGMA 2R7DA 3LSPA 2ZJQF 4UVBA 2FMLA 2GM4A 4FQGA 2W24A 1HC8A 4OMYA 2AQEA 3CUQB 1FBUA 4HV5A 2K02A 4BJ6C 5B3SH 4IOCF 1FBSA 2EZIA 1USTA 5JHUA 4XNFA 1YRNB 2QVOA 3QPSA 3ZGKA 2E60A 4PUSA 3BWGA 1DP3A 2DQLA 1IDYA 3FX3A 3KZYA 1ZR2A 1JT6A 2ZJ2A 2ECBA 1G4DA 2XDVA 2TDXA 2XGXA 2WY7Q 2E19A 1RKTA 4BE2A 3LL7A 3J80K 3QU6A 4FE7A 3TKYA 2LF8A 3UR3C 1ENHA 1ZLKA 5B66C 1KYWA 3HPGA 2ECCA 4G94A 1HA8A 2CWEA 2XAQA 1XSVA 2NVUB 3W6JB 2AHQA 4E7IA 4S0HB 3K9TA 3IWZA 4I99C 4FE4A 4XBFA 2XC7A 2O03A 4L18B 3SYTA 5FKKA 3Q9SA 4IQJA 3WODF 2DA7A 3ZXSA 5KHDA 5D5WB 4ZDPA 1P7JA 1NK2P 3F8MA 3E5XA 3G3ZA 4A3GJ 4N9HA 2Z2SB 3ZN1A 3FDYA 2E1CA 4HG2A 2ZXWH 1V4RA 5J1YA 1C0WA 5DYMA 5EDNA 3KEOA 1IXRC 5D5XB 2O3FA 3LSIA 5HDKA 2BV6A 3TL4X 1OISA 3DPUA 3HOSA 1SAXA 4IKFA 2N8GA 2NVQJ 1ZGAA 5C3EJ 4EJTA 3BP8A 4BNCA 1SANA 5EEHA 1G3SA 1A31A 5LEKA 3QU3A 1YS7A 1F5TA 1I6XA 5J3LA 4WXHA 5F04A 2O8XA 1N25A 2QKMB 1WJAA 2M30A 4QWQA 1RUNA 5DTDA 3CUQC 3LSRA 1R4NB 1JHHA 1LFPA 1O57A 2GIVA 3OS1A 1Z6RA 1E17A 1AA7A 1MNMC 3DP7A 2DQRA 4XM3A 1X2MA 2VC0A 3DBLB 1S7EA 2L7FP 2ZSHB 3I55I 2NOGA 1FX7A 2GZWA 5E1XA 1ETQA 2VBZA 3F8NA 2EA2A 1HW2A 2L2OA 3OS2A 1XDUA 3J7ZI 2OTLI 3D5RC 3JCUC 5E8GA 1LKXA 3RPUA 4L9JA 1XS9A 1LFUP 2YX4A 5EEAA 1AHDP 1K6OA 2HKOA 3VSLA 4QLCU 2RNGA 5EG0B 4BY7J 2VC1A 1I3QJ 5LGNA 3HKZN 3I4NJ 1K83J 1A36A 2XAUA 1ETYA 3TW7A 4GYGA 4U88A 1LNWA 5D5VB 2LLKA 1RZ4A 2A68F 2KIFA 1R5GA 3JR9A 3E0JB 1OCTC 1T33A 3G1LA 2VPLA 1R5ID 2X6WA 4BACA 5IP6A 2R5YB 1ETVA 3K4BA 1WJDA 4HDUA 1U0JA 5FROA 3BZ6A 5GAHJ 2W7NA 3OYAA 2V79A 1ZLJA 3FXUA 3H1CA 3DKXA 3NWTA 4HV6A 1R00A 2MSYA 2Y30A 3AG2H 5HNHA 2NXNB 3L9FA 4OIQF 1TL8A 3CO7C 5E1ZB 4HNVA 2Q2EB 3GEZA 3H36A 4G12A 5FRNA 3TBIA 3OIQA 4WX9A 4PSXA 1KA8A 1TQIA 2XF5A 2YX7A 2P7VB 1OR7A 1X3WB 4CO8A 1IG7A 3CF2A 1D0ZA 2XKOA 3GCMA 1V5EA 1PYVA 1F1ZA 2JTVA 1OKRA 3QWLA 5CVJA 1YYVA 2VQCA 4EEFG 1XCVA 4B3XA 3P9IA 4KN7X 1TWCJ 4BBRJ 2VPRA 4M3EA 2W48A 3J7AY 1Y0UA 4ZYHA 5LLQA 1A04A 3PFIA 1ULYA 5F6FA 3CF5F 1YITI 2LG4A 4OAYA 2R7ZJ 1MH4A 2JA7J 1KZHA 1ZRCA 2H6CA 3OYIA 2K3PA 1HKTA 3ZR8X 5AONA 4Z2YA 2JA2A 1R71A 2A07F 2K9NA 4UB8C 1X2NA 2F4OB 4L9TA 5FKNA 1V55H 3MCZA 2KLOA 3FXQA 5FFXA 2NS8A 5LGTA 4A3FJ 1JKRC 2DTRA 3BROA 3JSPA 2F5DA 3W2AA 3CTAA 3GTOJ 1V5GA 3C2BA 1R36A 1FTTA 4LJZF 5IT3A 4D0PA 1W5SA 3GUDA 5ILVA 1MMNA 2JPCA 3OMYA 1MKMA 1V5FA 4LMYA 3ZQHA 3K70C 3BTJA 2DO7A 3PUFA 2M7AA 4DYQA 5D6FA 5FLXZ 1IN5A 2QQAA 3DTIA 4LLNA 4RGUA 3DBRB 2CQ7A 1MW7A 2E7WA 2IGKA 4A2UA 1OJLA 3SFZA 4C3JJ 1MBFA 1FOWA 2Y0SA 3GTKJ 4KITB 1LPQA 3NARA 1ETKA 1T08B 1B9MA 1J59A 4RAFA 2K40A 1S7AA 5LRRA 3V7CA 1ON1A 1X1BA 2HTJA 1G8XA 5GAEJ 3GTJJ 1H0MA 4II2A 2JVHA 3S32A 2XSDC 3LMMA 2GBYA 2QA4I 5E8IA 4UB6C 2LBFB 1IXSB 1UHSA 2M0CA 4MNUA 2K9LA 4Z6YA 4AIHA 1YW8A 1HLVA 2K27A 3WU1B 3BJAA 4KIGA 2D45A 1CF7B 2YPRA 4BAYA 2LD5A 3QP6A 1T39A 3VOEA 5D5UB 2CGPA 4HF0A 3JRBA 1Y8QB 3IKVA 5LD2C 3LAPA 1XGOA 5KK1A 1TTYA 2DPDA 3PIPF 2OCEA 3BG7A 3CC2I 2W25A 1BL0A 1TWHJ 3I5UA 3QPLA 2UWMA 1RR8C 2K5CA 3A02A 4LK0F 3QQAA 3CCYA 2LKXA 2L01A 2VJ4A 3M8EA 3IWFA 3NAUA 1XG1A 3HRMA 4UHTA 4E7ZA 3GFLA 2PG4A 3REOA 3GWZA 3ZQIA 2ICWG 2MC3A 2R4GA 3C2HA 4HYEA 2M2EA 4V2GA 5EZGA 1HXDA 2F5CA 3M8FA 1BM9A 3ZQCA 2QQ8A 3KP2A 1MJ9A 1BW6A 1YW7A 1T95A 3JRDA 2FSWA 3AG1H 3LOCA 2O9LA 3TMOA 2RVCA 3SDGA 1ZHFA 1MBJA 3DEUA 3GTGJ 3N4MA 4EJVA 2L7ZA 4CH7A 4FASD 1W7PB 3P9KA 4DYRA 2XV4S 1DU0A 2H8RA 4GO1A 2KDZA
chains in the Genus database with same CATH topology
4IHTA 4RB2C 2VOPA 2P5LC 2J5OA 3GVAA 3K0LA 1Z91A 2PFBA 5D8KB 4H0EA 4AIKA 4OIPF 2FOKA 3LA3A 1O3TA 2FA5A 1IW7F 5LHGA 2ISZA 1R1UA 1S7OA 4MEYF 2G7UA 2KIUA 2HYFA 2XKPA 4HAMA 4RGXA 2G7HA 3ULQB 2BE5F 3EDPA 1LB2A 3V7SA 1LEBA 5HDNA 1RUOA 3OOPA 2OQGA 3F22A 3HIFA 4IRGA 1EH6A 3V4GA 3QPHA 3I0TA 1Z7UA 3HRUA 4Y13A 2CQKA 3E6MA 5ICEA 2OQRA 1XDSA 1BI0A 1XMKA 3ZMZA 1HW5A 1R58A 5E17F 1UCRA 2G9WA 5HOOA 4E70A 1WI9A 3DF8A 4BH9A 1MGTA 4S04A 1K78B 1YLFA 3SZPA 1XN7A 1O7FA 3ZQ7A 1LEAA 1ZN2A 4RB0A 4BHBA 1GXPA 4YFNF 2OU2A 1WKMA 1W7PD 2JT1A 5CVRA 4EJWA 4ENKA 2LDUA 5AIQA 4WF2A 4M9XA 1FYKA 5IT9K 4N9IA 4KFCA 4KIBA 4M6YA 1FLIA 5FD6A 3R61A 3KLNA 3HSFA 4G6QA 2WWYA 5J8CA 3DXJF 4I01A 3TO9A 3HSRA 3HHGA 1W4MA 3WTYC 3DV8A 2V1XA 3VFZA 5LHHA 1KU9A 1TBXA 3E3VA 4S05A 2UXNA 3H3ZA 2QBYA 2Y48A 3L09A 3T0YA 2O0YA 4U7BA 5HLGA 1G3TA 1DUXC 1U5TB 1CGPA 5CVIA 2HOEA 4KDPA 1IN8A 1T2KA 4Y15A 3KETA 5FD5A 3MWMA 1WWXA 3D0SA 5F1RA 3WE3A 4A0YA 5A2QZ 4CGZA 1IF1A 4L9NA 3NQOA 5H6QA 4MQVA 4AIJA 5HDGA 1LDDA 3GFMA 3F72A 3GZ5A 3J81Z 2D2WA 5BS6A 4O5VA 2GQQA 2W85A 4MTDA 3FMQA 3TDZC 3M1EA 3JTHA 4NB5A 1R1TA 4PGHA 2PMHA 2FBIA 4EGYA 5FO5A 1K78A 4G7OF 2QM3A 1KQ0A 3RKXA 4BHPA 2GA2A 4HA8A 1FP2A 2XAHA 5L3FA 1LDJA 3P9CA 4UXNA 3OV8A 4YIFA 3F8CA 3ISPA 4RB1A 3H3UA 1AWCA 1MD0A 2B0LA 2A61A 1SD6A 5DCFA 1G3WA 4ETSA 3GFIA 3U2RA 4YIIA 1FP1D 4WXDA 1MDMB 1WSUA 2W57A 1QBJA 2LSOA 4CICA 1YQAA 3QRFF 1PP7U 3DFGA 3F21A 1J75A 1KU7A 2VE9A 3F6VA 3I58A 5ICCA 5JI6A 2IW5A 2GWRA 4LLGF 1FBQA 3COAC 2PQ8A 2WC2A 4LB6B 4ZYEA 4Q5SF 3H92A 1P6RA 4M73A 4EM0B 4L5IA 3GYHX 5HVQC 2L4MA 2JPBA 1D5VA 3QAHA 2EK5A 3LFKA 3IC7A 3DPLC 2YR2A 2ZNYA 4M9ZA 4HOBA 2IVMA 1YW9A 2HZTA 2DBBA 2HS5A 1USSA 3JAMZ 3RPQA 1IXCA 4R8HA 3LA2A 3CDHA 2CO5A 2R3SA 2L3DA 2ZCWA 1SFXA 4BYYA 2NAZA 3HUGA 1E2XA 3IRRA 1ZREA 3WG9A 5A2QK 1J0RA 5D6EA 5H20A 1JHFA 3R0JA 3ML6A 1YG2A 4CHUA 2PEXA 4R79A 4U0YA 2H27A 4MGRA 4L9VA 1O3SA 1S6LA 3KCCA 1J2XA 3ABUA 3ROUA 1HQCA 2ZMEA 5DUKA 3ZP5A 2NRAC 3P7NA 5ICGA 3ELKA 2NNNA 3WTWC 4FX4A 1BI2A 1HKQA 2F5FA 1IAWA 4MTEA 2VT3A 5JFRA 2K86A 3E97A 2JRTA 1XSDA 2VN2A 4LB5A 4I98B 1ZRDA 5E18F 1XSXA 1FT9A 3FZVA 1IN4A 2RQPA 4U0WA 1VTNC 4OU0A 4I7HA 4GGGA 3FM3A 1KU2A 3RKYA 3F23A 1FSEA 5EEGA 3HTUA 2K4JA 3I54A 1FC3A 1OMIA 2KRFA 5L3GA 2XUBA 4M9SA 1WRJA 4UV8A 1B4AA 4PCQA 1K79A 1T98A 4G7ZF 1WQ2A 2HQNA 1DP7P 3TQNA 2LKPA 2MLKA 3ZMUA 2FQ3A 2Q8KA 2IP2A 1HSJA 3L00A 4HX7A 5LHIA 1R1VA 3R6SA 1Z6TA 4GYIA 4JQFA 3DPTA 3CUQA 5ILSA 2VODA 1BOAA 4LG0A 3ZMTA 4A5MA 3ZMDA 2L4AA 2KJCA 5E20A 5HLIA 2HR3A 4UV9A 3SXYA 5HS7A 5LEJA 1AOYA 2RDPA 1YIOA 3E6DA 4CYDA 2ACJA 2LNBA 4P55A 1KU3A 5JVTA 3I59A 2AS5F 4G8XA 3GW2A 3MEXA 1JXSA 1J7KA 2V1UA 3F8FA 2Q0OA 3B02A 1FYLA 5FGMA 4LD5A 6PAXA 2X0LA 1OPCA 2IPQX 3RKWA 4A12A 4MEXF 1X3UA 1PUEE 4HDVA 2EFWA 3C18A 5BQTA 4ZYGA 1OYIA 3GLXA 4EQQA 4UNOA 1PP8F 5J6XA 2Z33A 1BI1A 5FB2A 2A5YB 2IRFG 4XLPF 3FWEA 4ZZDA 2ZBKA 4ZH4F 3RI4A 2MH2A 2ESHA 3M7GA 4HF2A 1KQ8A 1I1SA 3KP4A 2XVCA 2OD5A 4DNCA 3FMSA 3EYIA 1DDNA 3LA7A 3WTSC 2XAJA 4P5OA 1IN6A 3R4KA 5AIPA 1BJAA 2P4WA 4HBLA 2DLLA 3RIRA 1HW1A 4UUVA 5J8FA 5ILUA 2A3SA 2HKXA 1TQMA 1R23A 4KIFA 3HSEA 1V3FA 3CUOA 2M1BA 3I59B 1ZG5A 3HYIA 5DUIA 1U6GA 2HWVA 3NEUA 3ZMSA 2P6TA 4IVNA 2L02A 4UVAA 1D8KA 2E7XA 4RGSA 3BY6A 4RS8A 5D4SA 2R7FA 3G73A 4RAYA 3E5QA 2UZKA 2FNAA 4P9FA 4IHSA 3KP3A 4EJOA 3HOTA 1B6AA 2XIGA 5BOXA 1FOKA 3WGIA 4PDKA 1S3JA 3BDDA 1XGNA 2P5VA 2ESNA 4LK1F 1QZYA 1UFMA 3I64A 2P5KA 5DD8A 1NHAA 4ON0A 3FM5A 4HW0A 1YO5C 2PLYA 4EJUA 1Z05A 1O3RA 4EM1A 2OZ6A 5DEQA 4HF1A 3BJOA 5K5RA 4EMSA 2EV6A 1EV7A 2ZXJA 1FPQA 1B9NA 3ZN0A 2A6HF 3KLOA 3GXOA 3J80Z 1QZZA 1I1GA 2QZ8A 2CYYA 4CDGA 3WTZA 1O3QA 4N0BA 5L3BA 1EH8A 3C7JA 3ZPLA 1T0FA 4KT5C 2BBYA 2Y0MA 2L54A 1LVAA 4XLNF 4Y17A 5HS9A 2VE8A 2NYXA 5DV5A 5CJ9A 2V6CA 2QBYB 5DCMA 4HX8A 1MJBA 2XAGA 4AWXB 1TW3A 3S2WA 4FHTA 4EM2A 3Q9VA 3GFJA 3HRTA 3QP5A 3K1NA 1G3YA 1B59A 2QENA 2P7CB 3O3KA 4M72A 5K1YA 2OBPA 1TNSA 2UXXA 1U78A 2F2EA 2HGCA 3TOBA 5CLSA 4OOIA 1YTYA 1MJAA 1BIBA 3BPVA 1TLHB 3DKWA 2WTEA 1JGSA 4MQ9F 4B09A 2EWNA 3U9GA 4I09A 2M45A 2Z5UA 2IJLA 2K4BA 2GXBA 2PMUA 3ABTA 2FNPA 2RV8A 3WU0A 3KEQA 2BEOA 4CXFA 3KP5A 1KGSA 4YG2F 3F3XA 4HQMA 3GO5A 1HKSA 3WE2A 1ODDA 2DU9A 1HBXG 3I4PA 1BBYA 1G6NA 2EFOA 1U8RA 5ERIA 5L3DA 1T6SA 1U2WA 2DFIA 3K1MA 3BJ6A 2P8TA 1BC8C 2HEOA 2ZO4A 3JAMK 1RIOH 5ICFA 4A6EA 3R60A 5HLHA 1YFHA 2EFQA 2AXLA 5E1WA 1S8NA 1SFEA 3KP7A 3WGGA 1ZG3A 4NHJA 4IPAA 2STWA 3FXRA 3K2ZA 2DK8A 3E5UA 1FWZA 3EYYA 1XMAA 3TOAA 4UVCA 3ECHA 1U3EM 3WTXC 4I0AA 3ZMVA 4HLYA 5FLXK 4KNYA 2QUFA 3T1BA 1MDMA 2XROA 1J5YA 2RN7A 3R0AA 2PBIA 2ISYA 3V8LA 5HS8A 2D1VA 1CF7A 1TNTA 2ZKZA 4CZZA 2QQBA 2Y75A 3T8TA 4M71A 3HTSB 1FSHA 4EGZA 1MZBA 2GA1A 4OINF 3FF5A 2D1HA 4O6JA 3SQNA 1IUYA 3CJNA 4Q47A 2XAFA 2PN6A 1BN5A 2VONA 1ZAOA 1FNNA 3B73A 3GX4X 1OYYA 3HHHA 2CFXA 3JSOA 1SMYF 5BPDA 3V8JA 1ZARA 3EQLF 1K7AA 1SMTA 2RC4A 2HTSA 4ZYDA 1I5ZA 2Z9OA 1S29A 4L5JA 1FZPB 1D8JA 2K7LA 3F8BA 3RYRA 2ETHA 2IA1A 4Q48A 1TW2A 1BIAA 3M9AA 3FHZA 3TGNA 3RJPA 2VT2A 1EH7A 3WGHA 1REPC 2YU3A 3KE2A 2O61A 1U5TC 5D4RA 3F6OA 4HX4A 3WTVC 3JW4A 3DQVC 4HZFA 1ZH5A 1PDNC 1QGPA 2QLZA 2BYVE 4ESFA 3AAFA 2PI0A 2DI3A 4NQWA 1Z1DA 3WTTC 2MA3A 3C3WA 4TV7A 3TO7A 2CSOA 1Z9CA 3WTUC 4LFUA 1SD4A 3VEPA 2J5PA 4YFKF 4GXOA 1H9TA 1QPMA 3MZHA 4EVIA 1L3LA 2JSCA 2ZNZA 4L0YB 1R5HA 2QYOA 1XB4A 1IRFA 3LWFA 1I27A 3IRQA 2FRHA 1UHMA 2M8EA 2V1DA 1P92A 4JBAA 2RKHA 1P4AA 2PJPA 5JR3A 4KMFA 2FE3A 3MFKA 5D8LB 4FX0A 3KP6A 1IRGA 4M6XA 2OA4A 1H9GA 2EV5A 4O3MA 3KFWX 4ESJA 2COMA 5L3EA 2KIMA 1ON2A 3Q5FA 3BPXA 4KICA 4KYWA 1LDKB 2VXZA 3BOQA 3QPTA 3N97A 1XCBA 2ZMEB 2VOOA 1ZYRF 2CW0F 2EFPA 1W5TA 1TQPA 3TO6A 4I02A 3T5XA 2HFHA 3RYPA 3VB2A 1LQ1A 3LQRA 1KYZA 5BMZA 3I71A 4KN4X 2RGVA 2F5EA 4P96A 5K5QA 4A6DA 2C6YA 4WCGA 4ENJA 5LRSA 1ZGJA 1QQIA 2BGCA 4IJAA 2MBFA 1OYWA 5F64A 4IRIA 2EA4A 2IT0A 2DW4A 3RTRA 1QO0D 2JZYA 3QOPA 2HDCA 1YS6A 3JTGA 2X4HA 4BHCA 2A69F 2MD5A 3V8KA 1R22A 3VODA 3J81K 2LF7A 2Z99A 2E1NA 4U7DA 4OIOF 4WWCA 2XRNA 2FMYA 4XSZF 3D5LA 2NNYA 4XSXF 4KA4A 1GXQA 2IA2A 3IKTA 1UHWA 3L7WA 4AD9A 5ED4A 4G9YA 2RNJA 1J9IA 3PQKA 4A0ZA 4IRHA 2Q2EA 4KMUX 1P2FA 4GCVA 4MHGA 1XGSA 1QNTA 1GHCA 3O6BB 4IXAA 1DPUA 1LJ9A 2KJBA 2STTA 4FT8A 2MLGA 5TRDA 2EFNA 2ADUA 2VBYA 2QWWA 2VBXA 2NS0A 4LG0B 1SFUA 2DT5A 2HQRA 4OMZA 1D3YA 4HLXA 1SD5A 2DPUA 3GZ6A 4U0VA 4G7HF 4DQ2A 4ENMA 1T38A 4P9UA 1ZG1A 3J7AO 3C1DA 2XASA 3U1DA 2VBWA 2Z3YA 4Q4ZF 1UB9A 3ECOA 3W6KB 1P4WA 2OAZA 1O7LA 4PGGA 4A5NA 4RAZA 2H09A 3V7RA 2M87A 3SZTA 4BQAA 4RB3C 1IZ1A 1B1BA 3IHUA 2ELHA 3E6CC 1FY7A 4LLLA 1XD7A 3T8RA 4RGRA 2QQ9A 2DK5A 4I2OA 1DPRA 5DDGA 3GF2A 1RI7A 2FBHA 1STZA 4OIRF 3K69A 4PZJA 3K1PA 4BXUA 4B8XA 2HYGD 5K5OA 2V9VA 4IF4A 4HQEA 2OZUA 1ONVA 3MZYA 3HRSA 2FF4A 4A0XA 3IL2A 2IA0A 5CVVA 3FMRA 3SHFA 1W7PA 3LSTA 4KUMA 2FBKA 4AVPA 4WK8F 2EV0A 2FEZA 2EB7A 1Q1HA 2O6GE 1R7JA 3NRVA 1BI3A 2KKOA 5BPIA 1U5TA 4R1HA 3EUHA 4M74A 2H94A 1KQ9A 3MQ0A 1P4XA 3LQQA 2H6BA 3EETA 2EJRA 2FU4A 1HSTA 3L2CA 4K2EA 3ERED 2WV0A 2XHKA 4F7ZA 5DD4A 2GAUA 2YSRA 3PQJA 4YFXF 3I53A 5TJJA 2DAOA 3TDUC 4G6DA 4ENNA 2CG4A 3RDIA 1SD7A 4EV0A 5LGUA 1ZRFA 3KZZA 5CVUA 3MAJA 4XRFA 4I0BA 1F4KA 2W84A 3E6BA 4L0ZB 1F9NA 1L0OC 4ESBA 3O2PE 1JE8A 3LAJA 2FXAA 4JK1X 5KVRA 2A6EF 5CYVA 2M5WA 2ZFWA 5FFZA 2P6SA 4ZZLA 1RNLA 4LGWA 5IT9Z 2GXGA 2MH9A 1GVJA 1IN7A 3CLOA 1BC7C 5L3CA 4WXCA 5H6RA 5LBQA 4ASNA 5DCMB 1FYMA 3CO6C 1XGMA 2R7DA 4UVBA 2FMLA 2W24A 4OMYA 3CUQB 4HV5A 1FBUA 2K02A 1FBSA 5JHUA 1USTA 2QVOA 3BWGA 2DQLA 3KZYA 3FX3A 2ZJ2A 1G4DA 2TDXA 2XGXA 3J80K 3QU6A 3TKYA 2LF8A 1ZLKA 1KYWA 4G94A 2CWEA 2XAQA 1XSVA 3W6JB 3K9TA 3IWZA 4XBFA 4L18B 2O03A 3Q9SA 3WODF 5D5WB 3F8MA 3E5XA 3G3ZA 4N9HA 3ZN1A 2E1CA 1V4RA 1C0WA 5DYMA 3KEOA 1IXRC 5D5XB 2O3FA 5HDKA 2BV6A 1SAXA 3HOSA 1ZGAA 4EJTA 3BP8A 4BNCA 5EEHA 1G3SA 5LEKA 3QU3A 1YS7A 1F5TA 1I6XA 4WXHA 2O8XA 2M30A 4QWQA 1RUNA 3CUQC 1JHHA 1O57A 2GIVA 1Z6RA 1E17A 3DP7A 2DQRA 2VC0A 1FX7A 2GZWA 5E1XA 2VBZA 3F8NA 2EA2A 1HW2A 1XDUA 5E8GA 3RPUA 4L9JA 2YX4A 1K6OA 2HKOA 4QLCU 2VC1A 5LGNA 4GYGA 4U88A 1LNWA 5D5VB 1RZ4A 2A68F 2KIFA 1R5GA 4HDUA 3BZ6A 2V79A 1ZLJA 3FXUA 4HV6A 1R00A 3L9FA 4OIQF 3CO7C 5E1ZB 3GEZA 4WX9A 1KA8A 1TQIA 2YX7A 2P7VB 4CO8A 1OR7A 2XKOA 1F1ZA 2JTVA 1OKRA 5CVJA 1YYVA 1XCVA 3P9IA 4KN7X 1Y0UA 4ZYHA 5LLQA 1A04A 3PFIA 1ULYA 5F6FA 1ZRCA 2H6CA 1HKTA 5AONA 4Z2YA 2A07F 4L9TA 3MCZA 3FXQA 5FFXA 5LGTA 2DTRA 3BROA 3JSPA 2F5DA 3CTAA 1R36A 4LJZF 5IT3A 4D0PA 1W5SA 3GUDA 5ILVA 2JPCA 1MKMA 4LMYA 2DO7A 5FLXZ 5D6FA 1IN5A 2QQAA 4LLNA 4RGUA 2E7WA 4A2UA 3SFZA 1B9MA 1J59A 1S7AA 5LRRA 3V7CA 1ON1A 2HTJA 1H0MA 5E8IA 1IXSB 4MNUA 4AIHA 1YW8A 2K27A 3WU1B 3BJAA 2D45A 1CF7B 4KIGA 1T39A 2YPRA 4BAYA 3QP6A 3VOEA 5D5UB 2CGPA 4HF0A 3IKVA 3LAPA 1XGOA 5KK1A 1TTYA 2DPDA 2W25A 3I5UA 2UWMA 4LK0F 2L01A 3M8EA 3IWFA 3HRMA 4UHTA 3GFLA 2PG4A 3REOA 3GWZA 2MC3A 4HYEA 1HXDA 2F5CA 3M8FA 1BM9A 3KP2A 1MJ9A 1YW7A 2FSWA 2RVCA 1ZHFA 3DEUA 3N4MA 4EJVA 1W7PB 3P9KA 2XV4S 4GO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHT A;  4RB2 C;  2VOP A;  2P5L C;  2J5O A;  3GVA A;  3K0L A;  1Z91 A;  2PFB A;  5D8K B;  4H0E A;  4AIK A;  4OIP F;  2FOK A;  3LA3 A;  1O3T A;  2FA5 A;  1IW7 F;  5LHG A;  2ISZ A;  1R1U A;  1S7O A;  4MEY F;  2G7U A;  2KIU A;  2HYF A;  2XKP A;  4HAM A;  4RGX A;  2G7H A;  3ULQ B;  2BE5 F;  3EDP A;  1LB2 A;  3V7S A;  1LEB A;  5HDN A;  1RUO A;  3OOP A;  2OQG A;  3F22 A;  3HIF A;  4IRG A;  1EH6 A;  3V4G A;  3QPH A;  3I0T A;  1Z7U A;  3HRU A;  4Y13 A;  2CQK A;  3E6M A;  5ICE A;  2OQR A;  1XDS A;  1BI0 A;  1XMK A;  3ZMZ A;  1HW5 A;  1R58 A;  5E17 F;  1UCR A;  2G9W A;  5HOO A;  4E70 A;  1WI9 A;  3DF8 A;  4BH9 A;  1MGT A;  4S04 A;  1K78 B;  1YLF A;  3SZP A;  1XN7 A;  1O7F A;  3ZQ7 A;  1LEA A;  1ZN2 A;  4RB0 A;  4BHB A;  1GXP A;  4YFN F;  2OU2 A;  1WKM A;  1W7P D;  2JT1 A;  5CVR A;  4EJW A;  4ENK A;  2LDU A;  5AIQ A;  4WF2 A;  4M9X A;  1FYK A;  5IT9 K;  4N9I A;  4KFC A;  4KIB A;  4M6Y A;  1FLI A;  5FD6 A;  3R61 A;  3KLN A;  3HSF A;  4G6Q A;  2WWY A;  5J8C A;  3DXJ F;  4I01 A;  3TO9 A;  3HSR A;  3HHG A;  1W4M A;  3WTY C;  3DV8 A;  2V1X A;  3VFZ A;  5LHH A;  1KU9 A;  1TBX A;  3E3V A;  4S05 A;  2UXN A;  3H3Z A;  2QBY A;  2Y48 A;  3L09 A;  3T0Y A;  2O0Y A;  4U7B A;  5HLG A;  1G3T A;  1DUX C;  1U5T B;  1CGP A;  5CVI A;  2HOE A;  4KDP A;  1IN8 A;  1T2K A;  4Y15 A;  3KET A;  5FD5 A;  3MWM A;  1WWX A;  3D0S A;  5F1R A;  3WE3 A;  4A0Y A;  5A2Q Z;  4CGZ A;  1IF1 A;  4L9N A;  3NQO A;  5H6Q A;  4MQV A;  4AIJ A;  5HDG A;  1LDD A;  3GFM A;  3F72 A;  3GZ5 A;  3J81 Z;  2D2W A;  5BS6 A;  4O5V A;  2GQQ A;  2W85 A;  4MTD A;  3FMQ A;  3TDZ C;  3M1E A;  3JTH A;  4NB5 A;  1R1T A;  4PGH A;  2PMH A;  2FBI A;  4EGY A;  5FO5 A;  1K78 A;  4G7O F;  2QM3 A;  1KQ0 A;  3RKX A;  4BHP A;  2GA2 A;  4HA8 A;  1FP2 A;  2XAH A;  5L3F A;  1LDJ A;  3P9C A;  4UXN A;  3OV8 A;  4YIF A;  3F8C A;  3ISP A;  4RB1 A;  3H3U A;  1AWC A;  1MD0 A;  2B0L A;  2A61 A;  1SD6 A;  5DCF A;  1G3W A;  4ETS A;  3GFI A;  3U2R A;  4YII A;  1FP1 D;  4WXD A;  1MDM B;  1WSU A;  2W57 A;  1QBJ A;  2LSO A;  4CIC A;  1YQA A;  3QRF F;  1PP7 U;  3DFG A;  3F21 A;  1J75 A;  1KU7 A;  2VE9 A;  3F6V A;  3I58 A;  5ICC A;  5JI6 A;  2IW5 A;  2GWR A;  4LLG F;  1FBQ A;  3COA C;  2PQ8 A;  2WC2 A;  4LB6 B;  4ZYE A;  4Q5S F;  3H92 A;  1P6R A;  4M73 A;  4EM0 B;  4L5I A;  3GYH X;  5HVQ C;  2L4M A;  2JPB A;  1D5V A;  3QAH A;  2EK5 A;  3LFK A;  3IC7 A;  3DPL C;  2YR2 A;  2ZNY A;  4M9Z A;  4HOB A;  2IVM A;  1YW9 A;  2HZT A;  2DBB A;  2HS5 A;  1USS A;  3JAM Z;  3RPQ A;  1IXC A;  4R8H A;  3LA2 A;  3CDH A;  2CO5 A;  2R3S A;  2L3D A;  2ZCW A;  1SFX A;  4BYY A;  2NAZ A;  3HUG A;  1E2X A;  3IRR A;  1ZRE A;  3WG9 A;  5A2Q K;  1J0R A;  5D6E A;  5H20 A;  1JHF A;  3R0J A;  3ML6 A;  1YG2 A;  4CHU A;  2PEX A;  4R79 A;  4U0Y A;  2H27 A;  4MGR A;  4L9V A;  1O3S A;  1S6L A;  3KCC A;  1J2X A;  3ABU A;  3ROU A;  1HQC A;  2ZME A;  5DUK A;  3ZP5 A;  2NRA C;  3P7N A;  5ICG A;  3ELK A;  2NNN A;  3WTW C;  4FX4 A;  1BI2 A;  1HKQ A;  2F5F A;  1IAW A;  4MTE A;  2VT3 A;  5JFR A;  2K86 A;  3E97 A;  2JRT A;  1XSD A;  2VN2 A;  4LB5 A;  4I98 B;  1ZRD A;  5E18 F;  1XSX A;  1FT9 A;  3FZV A;  1IN4 A;  2RQP A;  4U0W A;  1VTN C;  4OU0 A;  4I7H A;  4GGG A;  3FM3 A;  1KU2 A;  3RKY A;  3F23 A;  1FSE A;  5EEG A;  3HTU A;  2K4J A;  3I54 A;  1FC3 A;  1OMI A;  2KRF A;  5L3G A;  2XUB A;  4M9S A;  1WRJ A;  4UV8 A;  1B4A A;  4PCQ A;  1K79 A;  1T98 A;  4G7Z F;  1WQ2 A;  2HQN A;  1DP7 P;  3TQN A;  2LKP A;  2MLK A;  3ZMU A;  2FQ3 A;  2Q8K A;  2IP2 A;  1HSJ A;  3L00 A;  4HX7 A;  5LHI A;  1R1V A;  3R6S A;  1Z6T A;  4GYI A;  4JQF A;  3DPT A;  3CUQ A;  5ILS A;  2VOD A;  1BOA A;  4LG0 A;  3ZMT A;  4A5M A;  3ZMD A;  2L4A A;  2KJC A;  5E20 A;  5HLI A;  2HR3 A;  4UV9 A;  3SXY A;  5HS7 A;  5LEJ A;  1AOY A;  2RDP A;  1YIO A;  3E6D A;  4CYD A;  2ACJ A;  2LNB A;  4P55 A;  1KU3 A;  5JVT A;  3I59 A;  2AS5 F;  4G8X A;  3GW2 A;  3MEX A;  1JXS A;  1J7K A;  2V1U A;  3F8F A;  2Q0O A;  3B02 A;  1FYL A;  5FGM A;  4LD5 A;  6PAX A;  2X0L A;  1OPC A;  2IPQ X;  3RKW A;  4A12 A;  4MEX F;  1X3U A;  1PUE E;  4HDV A;  2EFW A;  3C18 A;  5BQT A;  4ZYG A;  1OYI A;  3GLX A;  4EQQ A;  4UNO A;  1PP8 F;  5J6X A;  2Z33 A;  1BI1 A;  5FB2 A;  2A5Y B;  2IRF G;  4XLP F;  3FWE A;  4ZZD A;  2ZBK A;  4ZH4 F;  3RI4 A;  2MH2 A;  2ESH A;  3M7G A;  4HF2 A;  1KQ8 A;  1I1S A;  3KP4 A;  2XVC A;  2OD5 A;  4DNC A;  3FMS A;  3EYI A;  1DDN A;  3LA7 A;  3WTS C;  2XAJ A;  4P5O A;  1IN6 A;  3R4K A;  5AIP A;  1BJA A;  2P4W A;  4HBL A;  2DLL A;  3RIR A;  1HW1 A;  4UUV A;  5J8F A;  5ILU A;  2A3S A;  2HKX A;  1TQM A;  1R23 A;  4KIF A;  3HSE A;  1V3F A;  3CUO A;  2M1B A;  3I59 B;  1ZG5 A;  3HYI A;  5DUI A;  1U6G A;  2HWV A;  3NEU A;  3ZMS A;  2P6T A;  4IVN A;  2L02 A;  4UVA A;  1D8K A;  2E7X A;  4RGS A;  3BY6 A;  4RS8 A;  5D4S A;  2R7F A;  3G73 A;  4RAY A;  3E5Q A;  2UZK A;  2FNA A;  4P9F A;  4IHS A;  3KP3 A;  4EJO A;  3HOT A;  1B6A A;  2XIG A;  5BOX A;  1FOK A;  3WGI A;  4PDK A;  1S3J A;  3BDD A;  1XGN A;  2P5V A;  2ESN A;  4LK1 F;  1QZY A;  1UFM A;  3I64 A;  2P5K A;  5DD8 A;  1NHA A;  4ON0 A;  3FM5 A;  4HW0 A;  1YO5 C;  2PLY A;  4EJU A;  1Z05 A;  1O3R A;  4EM1 A;  2OZ6 A;  5DEQ A;  4HF1 A;  3BJO A;  5K5R A;  4EMS A;  2EV6 A;  1EV7 A;  2ZXJ A;  1FPQ A;  1B9N A;  3ZN0 A;  2A6H F;  3KLO A;  3GXO A;  3J80 Z;  1QZZ A;  1I1G A;  2QZ8 A;  2CYY A;  4CDG A;  3WTZ A;  1O3Q A;  4N0B A;  5L3B A;  1EH8 A;  3C7J A;  3ZPL A;  1T0F A;  4KT5 C;  2BBY A;  2Y0M A;  2L54 A;  1LVA A;  4XLN F;  4Y17 A;  5HS9 A;  2VE8 A;  2NYX A;  5DV5 A;  5CJ9 A;  2V6C A;  2QBY B;  5DCM A;  4HX8 A;  1MJB A;  2XAG A;  4AWX B;  1TW3 A;  3S2W A;  4FHT A;  4EM2 A;  3Q9V A;  3GFJ A;  3HRT A;  3QP5 A;  3K1N A;  1G3Y A;  1B59 A;  2QEN A;  2P7C B;  3O3K A;  4M72 A;  5K1Y A;  2OBP A;  1TNS A;  2UXX A;  1U78 A;  2F2E A;  2HGC A;  3TOB A;  5CLS A;  4OOI A;  1YTY A;  1MJA A;  1BIB A;  3BPV A;  1TLH B;  3DKW A;  2WTE A;  1JGS A;  4MQ9 F;  4B09 A;  2EWN A;  3U9G A;  4I09 A;  2M45 A;  2Z5U A;  2IJL A;  2K4B A;  2GXB A;  2PMU A;  3ABT A;  2FNP A;  2RV8 A;  3WU0 A;  3KEQ A;  2BEO A;  4CXF A;  3KP5 A;  1KGS A;  4YG2 F;  3F3X A;  4HQM A;  3GO5 A;  1HKS A;  3WE2 A;  1ODD A;  2DU9 A;  1HBX G;  3I4P A;  1BBY A;  1G6N A;  2EFO A;  1U8R A;  5ERI A;  5L3D A;  1T6S A;  1U2W A;  2DFI A;  3K1M A;  3BJ6 A;  2P8T A;  1BC8 C;  2HEO A;  2ZO4 A;  3JAM K;  1RIO H;  5ICF A;  4A6E A;  3R60 A;  5HLH A;  1YFH A;  2EFQ A;  2AXL A;  5E1W A;  1S8N A;  1SFE A;  3KP7 A;  3WGG A;  1ZG3 A;  4NHJ A;  4IPA A;  2STW A;  3FXR A;  3K2Z A;  2DK8 A;  3E5U A;  1FWZ A;  3EYY A;  1XMA A;  3TOA A;  4UVC A;  3ECH A;  1U3E M;  3WTX C;  4I0A A;  3ZMV A;  4HLY A;  5FLX K;  4KNY A;  2QUF A;  3T1B A;  1MDM A;  2XRO A;  1J5Y A;  2RN7 A;  3R0A A;  2PBI A;  2ISY A;  3V8L A;  5HS8 A;  2D1V A;  1CF7 A;  1TNT A;  2ZKZ A;  4CZZ A;  2QQB A;  2Y75 A;  3T8T A;  4M71 A;  3HTS B;  1FSH A;  4EGZ A;  1MZB A;  2GA1 A;  4OIN F;  3FF5 A;  2D1H A;  4O6J A;  3SQN A;  1IUY A;  3CJN A;  4Q47 A;  2XAF A;  2PN6 A;  1BN5 A;  2VON A;  1ZAO A;  1FNN A;  3B73 A;  3GX4 X;  1OYY A;  3HHH A;  2CFX A;  3JSO A;  1SMY F;  5BPD A;  3V8J A;  1ZAR A;  3EQL F;  1K7A A;  1SMT A;  2RC4 A;  2HTS A;  4ZYD A;  1I5Z A;  2Z9O A;  1S29 A;  4L5J A;  1FZP B;  1D8J A;  2K7L A;  3F8B A;  3RYR A;  2ETH A;  2IA1 A;  4Q48 A;  1TW2 A;  1BIA A;  3M9A A;  3FHZ A;  3TGN A;  3RJP A;  2VT2 A;  1EH7 A;  3WGH A;  1REP C;  2YU3 A;  3KE2 A;  2O61 A;  1U5T C;  5D4R A;  3F6O A;  4HX4 A;  3WTV C;  3JW4 A;  3DQV C;  4HZF A;  1ZH5 A;  1PDN C;  1QGP A;  2QLZ A;  2BYV E;  4ESF A;  3AAF A;  2PI0 A;  2DI3 A;  4NQW A;  1Z1D A;  3WTT C;  2MA3 A;  3C3W A;  4TV7 A;  3TO7 A;  2CSO A;  1Z9C A;  3WTU C;  4LFU A;  1SD4 A;  3VEP A;  2J5P A;  4YFK F;  4GXO A;  1H9T A;  1QPM A;  3MZH A;  4EVI A;  1L3L A;  2JSC A;  2ZNZ A;  4L0Y B;  1R5H A;  2QYO A;  1XB4 A;  1IRF A;  3LWF A;  1I27 A;  3IRQ A;  2FRH A;  1UHM A;  2M8E A;  2V1D A;  1P92 A;  4JBA A;  2RKH A;  1P4A A;  2PJP A;  5JR3 A;  4KMF A;  2FE3 A;  3MFK A;  5D8L B;  4FX0 A;  3KP6 A;  1IRG A;  4M6X A;  2OA4 A;  1H9G A;  2EV5 A;  4O3M A;  3KFW X;  4ESJ A;  2COM A;  5L3E A;  2KIM A;  1ON2 A;  3Q5F A;  3BPX A;  4KIC A;  4KYW A;  1LDK B;  2VXZ A;  3BOQ A;  3QPT A;  3N97 A;  1XCB A;  2ZME B;  2VOO A;  1ZYR F;  2CW0 F;  2EFP A;  1W5T A;  1TQP A;  3TO6 A;  4I02 A;  3T5X A;  2HFH A;  3RYP A;  3VB2 A;  1LQ1 A;  3LQR A;  1KYZ A;  5BMZ A;  3I71 A;  4KN4 X;  2RGV A;  2F5E A;  4P96 A;  5K5Q A;  4A6D A;  2C6Y A;  4WCG A;  4ENJ A;  5LRS A;  1ZGJ A;  1QQI A;  2BGC A;  4IJA A;  2MBF A;  1OYW A;  5F64 A;  4IRI A;  2EA4 A;  2IT0 A;  2DW4 A;  3RTR A;  1QO0 D;  2JZY A;  3QOP A;  2HDC A;  1YS6 A;  3JTG A;  2X4H A;  4BHC A;  2A69 F;  2MD5 A;  3V8K A;  1R22 A;  3VOD A;  3J81 K;  2LF7 A;  2Z99 A;  2E1N A;  4U7D A;  4OIO F;  4WWC A;  2XRN A;  2FMY A;  4XSZ F;  3D5L A;  2NNY A;  4XSX F;  4KA4 A;  1GXQ A;  2IA2 A;  3IKT A;  1UHW A;  3L7W A;  4AD9 A;  5ED4 A;  4G9Y A;  2RNJ A;  1J9I A;  3PQK A;  4A0Z A;  4IRH A;  2Q2E A;  4KMU X;  1P2F A;  4GCV A;  4MHG A;  1XGS A;  1QNT A;  1GHC A;  3O6B B;  4IXA A;  1DPU A;  1LJ9 A;  2KJB A;  2STT A;  4FT8 A;  2MLG A;  5TRD A;  2EFN A;  2ADU A;  2VBY A;  2QWW A;  2VBX A;  2NS0 A;  4LG0 B;  1SFU A;  2DT5 A;  2HQR A;  4OMZ A;  1D3Y A;  4HLX A;  1SD5 A;  2DPU A;  3GZ6 A;  4U0V A;  4G7H F;  4DQ2 A;  4ENM A;  1T38 A;  4P9U A;  1ZG1 A;  3J7A O;  3C1D A;  2XAS A;  3U1D A;  2VBW A;  2Z3Y A;  4Q4Z F;  1UB9 A;  3ECO A;  3W6K B;  1P4W A;  2OAZ A;  1O7L A;  4PGG A;  4A5N A;  4RAZ A;  2H09 A;  3V7R A;  2M87 A;  3SZT A;  4BQA A;  4RB3 C;  1IZ1 A;  1B1B A;  3IHU A;  2ELH A;  3E6C C;  1FY7 A;  4LLL A;  1XD7 A;  3T8R A;  4RGR A;  2QQ9 A;  2DK5 A;  4I2O A;  1DPR A;  5DDG A;  3GF2 A;  1RI7 A;  2FBH A;  1STZ A;  4OIR F;  3K69 A;  4PZJ A;  3K1P A;  4BXU A;  4B8X A;  2HYG D;  5K5O A;  2V9V A;  4IF4 A;  4HQE A;  2OZU A;  1ONV A;  3MZY A;  3HRS A;  2FF4 A;  4A0X A;  3IL2 A;  2IA0 A;  5CVV A;  3FMR A;  3SHF A;  1W7P A;  3LST A;  4KUM A;  2FBK A;  4AVP A;  4WK8 F;  2EV0 A;  2FEZ A;  2EB7 A;  1Q1H A;  2O6G E;  1R7J A;  3NRV A;  1BI3 A;  2KKO A;  5BPI A;  1U5T A;  4R1H A;  3EUH A;  4M74 A;  2H94 A;  1KQ9 A;  3MQ0 A;  1P4X A;  3LQQ A;  2H6B A;  3EET A;  2EJR A;  2FU4 A;  1HST A;  3L2C A;  4K2E A;  3ERE D;  2WV0 A;  2XHK A;  4F7Z A;  5DD4 A;  2GAU A;  2YSR A;  3PQJ A;  4YFX F;  3I53 A;  5TJJ A;  2DAO A;  3TDU C;  4G6D A;  4ENN A;  2CG4 A;  3RDI A;  1SD7 A;  4EV0 A;  5LGU A;  1ZRF A;  3KZZ A;  5CVU A;  3MAJ A;  4XRF A;  4I0B A;  1F4K A;  2W84 A;  3E6B A;  4L0Z B;  1F9N A;  1L0O C;  4ESB A;  3O2P E;  1JE8 A;  3LAJ A;  2FXA A;  4JK1 X;  5KVR A;  2A6E F;  5CYV A;  2M5W A;  2ZFW A;  5FFZ A;  2P6S A;  4ZZL A;  1RNL A;  4LGW A;  5IT9 Z;  2GXG A;  2MH9 A;  1GVJ A;  1IN7 A;  3CLO A;  1BC7 C;  5L3C A;  4WXC A;  5H6R A;  5LBQ A;  4ASN A;  5DCM B;  1FYM A;  3CO6 C;  1XGM A;  2R7D A;  4UVB A;  2FML A;  2W24 A;  4OMY A;  3CUQ B;  4HV5 A;  1FBU A;  2K02 A;  1FBS A;  5JHU A;  1UST A;  2QVO A;  3BWG A;  2DQL A;  3KZY A;  3FX3 A;  2ZJ2 A;  1G4D A;  2TDX A;  2XGX A;  3J80 K;  3QU6 A;  3TKY A;  2LF8 A;  1ZLK A;  1KYW A;  4G94 A;  2CWE A;  2XAQ A;  1XSV A;  3W6J B;  3K9T A;  3IWZ A;  4XBF A;  4L18 B;  2O03 A;  3Q9S A;  3WOD F;  5D5W B;  3F8M A;  3E5X A;  3G3Z A;  4N9H A;  3ZN1 A;  2E1C A;  1V4R A;  1C0W A;  5DYM A;  3KEO A;  1IXR C;  5D5X B;  2O3F A;  5HDK A;  2BV6 A;  1SAX A;  3HOS A;  1ZGA A;  4EJT A;  3BP8 A;  4BNC A;  5EEH A;  1G3S A;  5LEK A;  3QU3 A;  1YS7 A;  1F5T A;  1I6X A;  4WXH A;  2O8X A;  2M30 A;  4QWQ A;  1RUN A;  3CUQ C;  1JHH A;  1O57 A;  2GIV A;  1Z6R A;  1E17 A;  3DP7 A;  2DQR A;  2VC0 A;  1FX7 A;  2GZW A;  5E1X A;  2VBZ A;  3F8N A;  2EA2 A;  1HW2 A;  1XDU A;  5E8G A;  3RPU A;  4L9J A;  2YX4 A;  1K6O A;  2HKO A;  4QLC U;  2VC1 A;  5LGN A;  4GYG A;  4U88 A;  1LNW A;  5D5V B;  1RZ4 A;  2A68 F;  2KIF A;  1R5G A;  4HDU A;  3BZ6 A;  2V79 A;  1ZLJ A;  3FXU A;  4HV6 A;  1R00 A;  3L9F A;  4OIQ F;  3CO7 C;  5E1Z B;  3GEZ A;  4WX9 A;  1KA8 A;  1TQI A;  2YX7 A;  2P7V B;  4CO8 A;  1OR7 A;  2XKO A;  1F1Z A;  2JTV A;  1OKR A;  5CVJ A;  1YYV A;  1XCV A;  3P9I A;  4KN7 X;  1Y0U A;  4ZYH A;  5LLQ A;  1A04 A;  3PFI A;  1ULY A;  5F6F A;  1ZRC A;  2H6C A;  1HKT A;  5AON A;  4Z2Y A;  2A07 F;  4L9T A;  3MCZ A;  3FXQ A;  5FFX A;  5LGT A;  2DTR A;  3BRO A;  3JSP A;  2F5D A;  3CTA A;  1R36 A;  4LJZ F;  5IT3 A;  4D0P A;  1W5S A;  3GUD A;  5ILV A;  2JPC A;  1MKM A;  4LMY A;  2DO7 A;  5FLX Z;  5D6F A;  1IN5 A;  2QQA A;  4LLN A;  4RGU A;  2E7W A;  4A2U A;  3SFZ A;  1B9M A;  1J59 A;  1S7A A;  5LRR A;  3V7C A;  1ON1 A;  2HTJ A;  1H0M A;  5E8I A;  1IXS B;  4MNU A;  4AIH A;  1YW8 A;  2K27 A;  3WU1 B;  3BJA A;  2D45 A;  1CF7 B;  4KIG A;  1T39 A;  2YPR A;  4BAY A;  3QP6 A;  3VOE A;  5D5U B;  2CGP A;  4HF0 A;  3IKV A;  3LAP A;  1XGO A;  5KK1 A;  1TTY A;  2DPD A;  2W25 A;  3I5U A;  2UWM A;  4LK0 F;  2L01 A;  3M8E A;  3IWF A;  3HRM A;  4UHT A;  3GFL A;  2PG4 A;  3REO A;  3GWZ A;  2MC3 A;  4HYE A;  1HXD A;  2F5C A;  3M8F A;  1BM9 A;  3KP2 A;  1MJ9 A;  1YW7 A;  2FSW A;  2RVC A;  1ZHF A;  3DEU A;  3N4M A;  4EJV A;  1W7P B;  3P9K A;  2XV4 S;  4GO1 A; 
#chains in the Genus database with same CATH topology
 2EPF A;  4IHT A;  3S2H J;  4RB2 C;  2VOP A;  3TW6 A;  2P5L C;  2IS2 A;  4CCM A;  1ETW A;  2J5O A;  3GVA A;  4XN0 A;  5LFA A;  3K0L A;  3OYK A;  4PFO A;  3B6A A;  1Z91 A;  2CV2 A;  4M6V A;  3SDB A;  2E35 A;  2PFB A;  1W36 C;  5D8K B;  4H0E A;  2BY2 A;  2E34 A;  4AIK A;  4OIP F;  2PJR A;  2FOK A;  3LA3 A;  2WV1 A;  2DMT A;  1O3T A;  2ELJ A;  4XRS A;  4CSW A;  2FA5 A;  1TWA J;  1IW7 F;  5LHG A;  3I56 I;  4M3D A;  2ISZ A;  1R1U A;  1S7O A;  2Y2Z A;  4MEY F;  2G7U A;  2KIU A;  4XK4 A;  2HYF A;  2XKP A;  4HAM A;  1YJW I;  4RGX A;  2G7H A;  1WJF A;  3ULQ B;  2BE5 F;  3EDP A;  2BHZ A;  2VLA A;  1LB2 A;  4QSH A;  3V7S A;  3A0B C;  3DU5 A;  2V9K A;  1NK3 P;  2LY9 A;  1LEB A;  2EZH A;  4PSW A;  5HDN A;  4IZZ A;  1RUO A;  3OOP A;  4KIS A;  1A5J A;  3O8G A;  2OQG A;  3F22 A;  4XQF A;  3HOW J;  3HIF A;  4IRG A;  2YU9 J;  1EH6 A;  3V4G A;  4CCL A;  5J40 A;  3MMY B;  2L9V A;  1JKO C;  2M34 A;  5JVG F;  2CUE A;  3QPH A;  2HOS A;  5KAF C;  2DA2 A;  3I0T A;  1Z7U A;  3HRU A;  4Y13 A;  2LYC A;  2CQK A;  3E6M A;  5ICE A;  3VYR B;  1GUU A;  2WAE A;  1S72 I;  2M8G X;  2OQR A;  1UG2 A;  1XDS A;  4HEA 2;  2I10 A;  1BI0 A;  3PO3 J;  1XMK A;  2HOA A;  5K7H A;  3ZMZ A;  1HW5 A;  1R58 A;  5TGT A;  5E17 F;  1UCR A;  3WU2 C;  2G9W A;  5IP9 J;  4PK4 A;  4E6K G;  2WBM A;  5HOO A;  3BR2 A;  4E70 A;  1WI9 A;  1W5C C;  1X19 A;  3KEY A;  4MIM A;  1B72 B;  3DF8 A;  4BH9 A;  1MGT A;  4S04 A;  1K78 B;  1YLF A;  3SZP A;  2MC4 A;  1XN7 A;  2K9S A;  2DA3 A;  1O7F A;  2KQR A;  3TP3 A;  3ZQ7 A;  2X1D A;  1LEA A;  4F3Q A;  1ZN2 A;  4RB0 A;  4BHB A;  1GXP A;  4YFN F;  2OU2 A;  1WKM A;  1W7P D;  2JT1 A;  5CVR A;  1MMA A;  2OJE D;  3U1K A;  1OLT A;  4EJW A;  4ENK A;  1POG A;  2LDU A;  3LSG A;  4A3B J;  2JA5 J;  3ABL H;  3PFY A;  5AIQ A;  4WF2 A;  4M9X A;  4B3A A;  3K4N A;  1FYK A;  2F4I A;  5IT9 K;  3K4C A;  4N9I A;  5EZH A;  5EGO B;  1VQO I;  4KFC A;  4KIB A;  2EZK A;  4M6Y A;  2EH3 A;  2Z1D A;  2F4M B;  2PMZ A;  1FLI A;  3FKI J;  3GTL J;  1T8I A;  5FD6 A;  1XMX A;  3K10 A;  3R61 A;  2JUG A;  3KLN A;  3HSF A;  4G6Q A;  2WWY A;  5J8C A;  3DXJ F;  4CZC A;  4I01 A;  5J4V A;  3H5N A;  3TO9 A;  3HSR A;  3BCA A;  3HHG A;  1W4M A;  5IYB J;  3WTY C;  3DV8 A;  3OL3 A;  1ZK8 A;  2V1X A;  3VFZ A;  5LHH A;  3TED A;  4A69 C;  3S16 J;  4M3G A;  1KU9 A;  1LE8 A;  1TBX A;  4BE0 A;  3LNQ A;  3E3V A;  4S05 A;  2UXN A;  3H3Z A;  2QBY A;  3JRG A;  2Y48 A;  3L09 A;  3ZRG A;  3OIP A;  3T0Y A;  2O0Y A;  4U7B A;  3ZOB A;  1BR1 A;  5HLG A;  1G3T A;  5FJ8 J;  1DUX C;  2BW3 A;  1U5T B;  1CGP A;  3G2B A;  4PJM A;  5CVI A;  3SJM A;  2HOE A;  4KDP A;  3U21 A;  1IN8 A;  1T2K A;  4Y15 A;  3KET A;  5FD5 A;  5BNG A;  3FXJ A;  2R7U A;  3MWM A;  2MD0 A;  4E7J A;  1WWX A;  3D0S A;  2Y9Z A;  5F1R A;  3WE3 A;  4A0Y A;  3HZJ A;  3KYL A;  2X6O A;  5A2Q Z;  1EKE A;  4CGZ A;  1UMQ A;  1W1W E;  3Q0W A;  3LSK A;  1TWF J;  1IF1 A;  4L9N A;  4X0G A;  3NQO A;  2X1E A;  5H6Q A;  4OAZ A;  2DOA A;  4MQV A;  4AIJ A;  1WHU A;  4X1E A;  3ABK H;  5HDG A;  1K61 A;  1LDD A;  2OTJ I;  3GFM A;  3F72 A;  1OR7 C;  3IAM 2;  3GZ5 A;  3J81 Z;  2HVQ A;  1ZTR A;  2D2W A;  3G1O A;  1PUF B;  2VJI A;  1NG6 A;  1VQ5 I;  5BS6 A;  2Z16 A;  2XPW A;  3S15 J;  4O5V A;  2RRE A;  3IP4 B;  2GQQ A;  2W85 A;  4MTD A;  3FMQ A;  3TDZ C;  3M1E A;  1R4M B;  3JTH A;  3HOV J;  1VQL I;  4NB5 A;  1E0E A;  3ERM A;  1R1T A;  2MAB A;  4PGH A;  2PMH A;  2VI6 A;  4XR6 A;  2FBI A;  5IYC J;  4EGY A;  2DMN A;  4I6Z A;  2HOT A;  5FO5 A;  3LSH A;  3VDX A;  1K78 A;  2VL8 A;  2QM3 A;  4G7O F;  1W0U A;  1KQ0 A;  3RKX A;  3VPR A;  4CYC A;  4BHP A;  4QTR A;  4AVZ A;  2LFB A;  2DOD A;  2GA2 A;  3CP8 A;  4HA8 A;  2M4K A;  3RQ4 A;  2DFH A;  2BW3 B;  2KZV A;  1FP2 A;  1B8I A;  1IO2 A;  2JUC A;  2XAH A;  5L3F A;  2LRE A;  4FCY A;  1OCO H;  1LDJ A;  3P9C A;  3OR2 C;  4M3F A;  2R5Z A;  3OV8 A;  4UXN A;  4YIF A;  3F8C A;  3ISP A;  3PL8 A;  4RB1 A;  4QIW N;  3H3U A;  1AWC A;  1MD0 A;  1G59 A;  2KRC A;  2A6T A;  2OUM A;  5CQG A;  2B0L A;  2A61 A;  1SD6 A;  5DCF A;  1VQ8 I;  1G3W A;  4J00 A;  4C2U A;  4RM2 A;  3CCQ I;  2X48 A;  1MH3 A;  2O8K A;  1K6Y A;  1QHH D;  2F6C A;  3HG9 A;  4ETS A;  3GFI A;  3U2R A;  3GME A;  4YII A;  3ESW B;  1FP1 D;  4KJZ A;  4WXD A;  2MG4 A;  3I4M J;  1I50 J;  1MDM B;  1WSU A;  2W57 A;  4IHV A;  1QBJ A;  2QSG X;  1WJE A;  3BR0 A;  1DGR M;  2LSO A;  3VYT B;  4BXF A;  4CIC A;  1YQA A;  2IGM A;  5GTI C;  3QRF F;  3DEE A;  1PP7 U;  3BG6 A;  3DFG A;  3F21 A;  1IRZ A;  2V1N A;  3OYJ A;  1J75 A;  2VE9 A;  3F6V A;  3I58 A;  1KU7 A;  5ICC A;  1ZKG A;  5JI6 A;  2DDA A;  2IW5 A;  2BXY A;  2GWR A;  4LLG F;  3A01 A;  1FBQ A;  3KIO A;  3COA C;  2PQ8 A;  2WC2 A;  4LB6 B;  4ZYE A;  4Q5S F;  3H92 A;  2WAQ N;  3SZG A;  1P6R A;  2KIS A;  4M73 A;  4FET A;  3GZN B;  4EM0 B;  4L5I A;  3K4M A;  3GYH X;  5HVQ C;  3G1M A;  2L4M A;  4V2F A;  2JPB A;  2ZC2 A;  1D5V A;  5J1U A;  4IO9 F;  1ETX A;  3QAH A;  2EK5 A;  1Z3Y A;  3LFK A;  3IC7 A;  3DPL C;  1MBK A;  3NWS A;  1GV5 A;  2WAQ A;  2YR2 A;  2ZNY A;  2XB0 X;  4XON A;  3VYS B;  4M9Z A;  5E3M A;  3DCF A;  1KON A;  4HOB A;  2IVM A;  5B1A H;  1YW9 A;  2HZT A;  2DBB A;  3CCJ I;  2HS5 A;  1USS A;  3JAM Z;  3RPQ A;  1IXC A;  2DMP A;  3QYE A;  4R8H A;  3LA2 A;  3CDH A;  2CO5 A;  4N4O B;  2R3S A;  3PJR A;  4LIV A;  3RZD J;  2L3D A;  3ZCO A;  2ZCW A;  1FJL A;  3CCR I;  2IS6 A;  3BLY A;  2VAS A;  3CCM I;  3DLL F;  1VQ7 I;  4BEH A;  2E2J J;  1SFX A;  4BYY A;  2CRG A;  2KRH A;  2R5Z B;  2NAZ A;  1MMG A;  1IV6 A;  3HUG A;  1QRY A;  1E2X A;  2H8W A;  3AG3 H;  4CCO A;  4XOT A;  3IRR A;  1ZRE A;  3WG9 A;  5A2Q K;  1J0R A;  5D6E A;  2A5W A;  1JHF A;  5H20 A;  3BR1 A;  3R0J A;  4M3B A;  1Z77 A;  1SVO A;  3K4K A;  2BHY A;  3ML6 A;  1YG2 A;  4CHU A;  3A03 A;  2PEX A;  4R79 A;  2BVL A;  2X6Y A;  1U9N A;  5E3L A;  1TC3 C;  1Y56 A;  4U0Y A;  2H27 A;  4MGR A;  2ID3 A;  4L9V A;  5M3M J;  5JLW A;  4AU7 A;  1O3S A;  2MGQ A;  2YS9 A;  1S6L A;  3AKZ A;  3KCC A;  5EJC A;  2NVX J;  2R92 J;  1J2X A;  1X58 A;  2LY2 A;  2VJJ A;  3ABU A;  1HQC A;  3ROU A;  5C4J J;  3S17 J;  2PX9 A;  2JRM A;  2ZME A;  3S3N A;  1JKP C;  5DUK A;  1GV2 A;  3ONQ A;  3ZP5 A;  1WZ2 A;  2NRA C;  3P7N A;  5ICG A;  3ELK A;  1QPI A;  3PIO F;  3L2Q A;  3PSF A;  4F92 B;  2NNN A;  3WTW C;  3CDI A;  4FX4 A;  4ANJ A;  4AC0 A;  3K4L A;  4E7K A;  1BI2 A;  1HKQ A;  1TZL A;  2F5F A;  2JWT A;  4PFP A;  4MTE A;  4B48 A;  3IV5 A;  2QF7 A;  1IAW A;  2VT3 A;  5JFR A;  2K86 A;  3CC4 I;  5IOZ A;  3E97 A;  3BR3 A;  2JRT A;  1XSD A;  2VN2 A;  4C30 A;  5J47 A;  4LB5 A;  4I98 B;  3HM5 A;  2I8D A;  1ZRD A;  5E18 F;  1XSX A;  1MBE A;  1FT9 A;  3FZV A;  1IN4 A;  2RQP A;  4U0W A;  1VTN C;  4OU0 A;  4I7H A;  1Z21 A;  1H8A C;  4GGG A;  3FM3 A;  4HNT A;  2ZXH A;  3OYN A;  1KU2 A;  4D5F A;  3RKY A;  3F23 A;  1FSE A;  5EEG A;  3HTU A;  4XN3 A;  1YOV B;  2HZD A;  2K4J A;  3I54 A;  1FC3 A;  1OMI A;  4RM3 A;  2KRF A;  5L3G A;  1K4T A;  2XUB A;  2CV1 A;  1UAA A;  4M9S A;  2ME6 A;  1WRJ A;  1RES A;  3HBL A;  3DTK A;  1EA3 A;  2BZT A;  2CW7 A;  4UV8 A;  5FRM A;  1B4A A;  2HXI A;  3C2G A;  4PCQ A;  3BG9 A;  2HDW A;  1K79 A;  1T98 A;  4G7Z F;  4Y7N J;  1EJ9 A;  4Y33 A;  3OS0 A;  3EUH C;  5F0H A;  1WQ2 A;  2HQN A;  2ZME C;  1DP7 P;  3OWT A;  3TQN A;  2E2H J;  2B9S A;  2RAE A;  5GAD J;  2LKP A;  1FMV A;  4RBO A;  2MLK A;  3VWB A;  1YX3 A;  3ZMU A;  3FKJ A;  2FQ3 A;  2IGN A;  2Q8K A;  2IP2 A;  5EYR A;  1HSJ A;  1VQP I;  3L00 A;  1GDT A;  2CFO A;  4HX7 A;  5LHI A;  2DA4 A;  1R1V A;  2TCT A;  4XL9 A;  3R6S A;  1Z6T A;  2JSP A;  4GYI A;  3PNV A;  4JQF A;  4UUT A;  3DPT A;  3FXM A;  3CUQ A;  5K7Z A;  5ILS A;  5B5E C;  2R7X A;  2VOD A;  3QYF A;  1XPX A;  1JTX A;  1BOA A;  2W1O A;  4LG0 A;  3ZMT A;  4A5M A;  3OYB A;  3ZMD A;  2L4A A;  2KJC A;  5E20 A;  1HOM A;  3SEZ A;  1LE8 B;  5HLI A;  2HR3 A;  3BQY A;  4UV9 A;  3SXY A;  5HS7 A;  5LEJ A;  1AOY A;  2RDP A;  1YIO A;  2X6X A;  5CQE A;  3BR5 A;  4DOZ A;  2JA6 J;  3E6D A;  5IP7 J;  4CYD A;  2ACJ A;  2LNB A;  4P55 A;  1KU3 A;  4ZJZ A;  2VUM J;  2DTZ A;  5JVT A;  1VF9 A;  4DZJ A;  2PMZ N;  3I59 A;  2AS5 F;  1NTC A;  3DEW A;  1WFX A;  5DM7 F;  4G8X A;  4DYC A;  2IS1 A;  3GW2 A;  2FJ1 A;  3HC7 A;  3MEX A;  1ZR4 A;  1JXS A;  4QPQ A;  1J7K A;  2V1U A;  3LSJ A;  3F8F A;  2Q0O A;  3L2V A;  3B02 A;  3FHN A;  1FYL A;  5FGM A;  4LD5 A;  1JI8 A;  6PAX A;  2X0L A;  1OPC A;  1YHQ I;  3DLA A;  1LFB A;  1Y1V J;  3BTI A;  4ZC3 A;  2DFE A;  3DU6 A;  2O5R A;  4IQ4 A;  2JVG A;  2IPQ X;  3RKW A;  3D1N I;  3CMM A;  1IRX A;  4A12 A;  1YX5 A;  4MEX F;  1D1A A;  1X3U A;  2V7F A;  4CA0 A;  1PUE E;  4HDV A;  3BG3 A;  1FMW A;  4BDZ A;  4XOP A;  2E71 A;  2EFW A;  3CCS I;  2P81 A;  3C18 A;  3KPH A;  3CME I;  2BY1 A;  4E7L A;  3EUK L;  4ZYG A;  5BQT A;  1U9O A;  2Y9Y A;  1OYI A;  3GLX A;  3CC7 I;  3BC8 A;  4H4K C;  4EQQ A;  2LKS A;  2E1M C;  4UNO A;  1PP8 F;  5J6X A;  2M9H A;  2Z33 A;  1TT0 A;  1BI1 A;  2KIQ A;  3W2V A;  3L2W A;  2ZSI B;  4E4H A;  5FB2 A;  2A5Y B;  1SFK A;  2IRF G;  4C2T A;  1E3H A;  2VB6 A;  4XLP F;  5E79 C;  3FWE A;  3CD6 I;  4ZZD A;  2ZBK A;  4ZH4 F;  3RI4 A;  4F52 A;  2MH2 A;  4NC8 A;  2ESH A;  4L5E A;  5GAG J;  3M7G A;  4UY8 I;  4HF2 A;  1VZ0 A;  1KQ8 A;  1I1S A;  2JN6 A;  3KP4 A;  2L7K A;  2XVC A;  2OD5 A;  1BW5 A;  2HYJ A;  2WAD A;  4DNC A;  1AKH B;  3FMS A;  3EYI A;  2ELK A;  3HKZ A;  1LUJ B;  2DA6 A;  3LA7 A;  3WTS C;  2XAJ A;  4P5O A;  1DDN A;  1IN6 A;  3R4K A;  2CQQ A;  5AIP A;  4B43 A;  5E3N A;  2HXO A;  2R7O A;  1BJA A;  2P4W A;  4HBL A;  2DLL A;  2VQG A;  4DZP A;  4XOR A;  2L9S A;  5FLV A;  3RIR A;  3GTP J;  1HW1 A;  2WB1 N;  4D1Q A;  4UUV A;  1WPK A;  3F9K A;  5J8F A;  5ILU A;  3H9G A;  1PUF A;  1TT5 B;  2A3S A;  2HKX A;  5CKT A;  3CLQ A;  1JGG A;  4X6A J;  1TQM A;  1R23 A;  4KIF A;  3HSE A;  3JRE A;  1VQ6 I;  3BTL A;  5KAI C;  5HOD A;  1VQM I;  1VQN I;  1V3F A;  5TIS C;  3CUO A;  2AO9 A;  2M1B A;  2CS3 A;  4J19 A;  3QYB A;  3FK6 A;  3M1C A;  3I59 B;  1ZG5 A;  3HYI A;  5DUI A;  1U6G A;  2QKL B;  2HWV A;  3L1P A;  3OR1 C;  4XIC A;  1IDZ A;  3NEU A;  3ZMS A;  4Y52 J;  2E2I J;  2OF7 A;  2P6T A;  2JMW A;  4IVN A;  3HDD A;  2L02 A;  4UVA A;  1D8K A;  2DOF A;  3IH2 A;  2E7X A;  4BGD A;  1OCC H;  5M5Y J;  4RGS A;  1VQK I;  3BY6 A;  4XKC A;  1OFC X;  1MIJ A;  4RS8 A;  5D4S A;  1UJ8 A;  4XKW A;  2R7F A;  3ZQF A;  1IC8 A;  3L2U A;  2IEK A;  3OYE A;  2FX0 A;  3RZO J;  3G73 A;  1V54 H;  4CCJ A;  1FOX A;  4RAY A;  3RSN A;  3E5Q A;  2L9R A;  2UZK A;  2R7T A;  2NOJ B;  4ZYA A;  2FNA A;  4A3C J;  4P9F A;  2DT7 B;  3SEQ A;  1SC7 A;  4IHS A;  1RR7 A;  2W82 A;  3KP3 A;  4EJO A;  5CPR B;  4ZTJ A;  3OYH A;  2XIG A;  1B6A A;  3HOT A;  4HRI A;  5BOX A;  2BY3 A;  1FOK A;  4B44 A;  4XRM A;  5KNL A;  3WGI A;  1F43 A;  2XPV A;  1JUP A;  2PJR B;  4PDK A;  4JP0 A;  4ABZ A;  3S93 A;  4CCN A;  1S3J A;  3JRH A;  3BDD A;  1HCR A;  1JJ6 C;  1XGN A;  2P5V A;  2X9D A;  2ESN A;  3O8H A;  5FLM J;  2CQX A;  4A3I J;  1MBH A;  4LK1 F;  1QZY A;  1UFM A;  3I64 A;  1D1C A;  1FIA A;  2P5K A;  5DD8 A;  4JX4 A;  1NHA A;  3L2R A;  1Y1W J;  2O7O A;  2MFZ A;  3PO2 J;  2CUZ A;  1D0X A;  1N75 A;  1YJN I;  4ON0 A;  3FM5 A;  1JKQ C;  4HW0 A;  3OSG A;  1SVL A;  2A05 A;  1YO5 C;  2PLY A;  2DJI A;  4EJU A;  1Z05 A;  1O3R A;  4EM1 A;  2OZ6 A;  5DEQ A;  3OSF A;  3BJO A;  5K5R A;  2MYS A;  4EMS A;  4HF1 A;  1DU6 A;  2EV6 A;  1EV7 A;  2ZXJ A;  4FIS A;  1FPQ A;  1B9N A;  3ZN0 A;  2A6H F;  3MVP A;  3KLO A;  3GXO A;  3I9V 2;  3J80 Z;  1QZZ A;  1P7I A;  2JK3 A;  1M1E B;  1I1G A;  1YJ9 I;  1BA5 A;  1Z0X A;  2QZ8 A;  2DT6 A;  3LSM A;  2LBF A;  2CYY A;  4CDG A;  2LC2 A;  3WTZ A;  1XX5 A;  1P9Q C;  3FIW A;  2E36 A;  2R7V A;  1O3Q A;  4N0B A;  3IUO A;  5L3B A;  3UNG C;  1EH8 A;  5HNF A;  1XC5 A;  3C7J A;  2X85 A;  3BCB A;  3ZPL A;  1T0F A;  1YRN A;  4KT5 C;  2B63 J;  2BBY A;  2Y0M A;  2L54 A;  1LVA A;  1JJ8 C;  2XPU A;  3E1S A;  4XLN F;  4Y17 A;  5HS9 A;  2VE8 A;  1WJC A;  2NYX A;  5DV5 A;  3VYU B;  4F91 B;  5CJ9 A;  4BQN A;  3Q0U A;  2V6C A;  2QBY B;  1TP4 A;  5DCM A;  3OY9 A;  4HX8 A;  1MJB A;  2K9Q A;  2XAG A;  1H89 C;  4PJ0 C;  3IH3 A;  2D5V A;  2Y69 H;  2ZXI A;  4AWX B;  1TW3 A;  3S2W A;  4ITV A;  2ID6 A;  4FHT A;  3FIS A;  2OV7 A;  3PSI A;  3Q9V A;  3GFJ A;  2KHM A;  3BZK A;  3HRT A;  3QP5 A;  4EM2 A;  5M5W J;  4RAG A;  3K1N A;  1I6H J;  3GTQ J;  1G3Y A;  4LOC A;  3H5A A;  4AM3 A;  1B59 A;  2QEN A;  2P7C B;  2R93 J;  2R7W A;  3O3K A;  1SFO J;  5FKO A;  2XGD A;  4M72 A;  4W97 A;  5K1Y A;  1W36 D;  2OBP A;  1TNS A;  3OYF A;  4UUS B;  2UXX A;  1U78 A;  2F2E A;  2HGC A;  2LH9 A;  3TOB A;  4DBQ A;  5CLS A;  3CQZ J;  4OOI A;  3CMA I;  1YTY A;  5JLX A;  1X1A A;  1MJA A;  1BIB A;  2W00 A;  3BPV A;  2CU7 A;  2DCE A;  2KMU A;  1TLH B;  1NG7 A;  2WTE A;  3DKW A;  1JGS A;  2FOW A;  4MQ9 F;  3VSK A;  4B09 A;  2CUF A;  2EWN A;  1BOB A;  3CJT B;  1K4S A;  3U9G A;  4II3 A;  4I09 A;  4RLQ A;  2M45 A;  1IJW C;  1Z3X A;  2Z5U A;  2IJL A;  1PVE A;  2K4B A;  2GXB A;  2PMU A;  1FIP A;  2VKE A;  3ABT A;  1X4P A;  3AL0 B;  4P1W A;  2WB1 A;  1VQ4 I;  2FNP A;  2RV8 A;  3WU0 A;  3KEQ A;  2V4J C;  2BEO A;  3ASN H;  4CXF A;  3KP5 A;  1KGS A;  3D5S C;  4YG2 F;  3F3X A;  4HQM A;  3GO5 A;  4BY1 J;  2FUG 2;  5IY5 H;  1HKS A;  3WE2 A;  5GPC A;  2HQ5 A;  1ODD A;  2DU9 A;  2GIZ A;  1HBX G;  2AQF A;  3I4P A;  1BBY A;  2KZG A;  1G6N A;  2EFO A;  3PUB A;  1U8R A;  1T56 A;  5ERI A;  1A6Q A;  3Q0V A;  5L3D A;  1X3Z B;  3QOD A;  1X1C A;  1T6S A;  1U2W A;  2B7E A;  3AG4 H;  5C44 J;  1S9H A;  3HGG A;  2DFI A;  3K1M A;  4IHX A;  2VQH A;  2G0E A;  3BJ6 A;  2P8T A;  1BC8 C;  2HEO A;  3IAS 2;  3A01 B;  2HVS A;  3S1Q J;  2ZO4 A;  3JAM K;  1MMD A;  4XRS G;  1YE9 A;  1RIO H;  5ICF A;  4A6E A;  3R60 A;  5HLH A;  1YFH A;  3KX2 A;  1IGN A;  4NC6 A;  3W6V A;  2EFQ A;  3PM1 A;  2AXL A;  4F93 B;  5E1W A;  3CCL I;  1R6R A;  4PJL A;  1S8N A;  1SFE A;  3KP7 A;  3WGG A;  1ZG3 A;  5B1B H;  4C3H J;  1Y39 A;  3MKW B;  4NHJ A;  3S1R J;  4GRI A;  4IPA A;  2Q1Z B;  1SVM A;  1F36 A;  2QSF X;  3FXR A;  3JRF A;  2STW A;  3K2Z A;  2DK8 A;  3E5U A;  1FWZ A;  4IOA F;  3EYY A;  2CW8 A;  4LIU A;  4PJN A;  2VIX A;  3V42 A;  1XMA A;  3TOA A;  1N77 A;  4RDU A;  5F1J A;  2KFD A;  1OQY A;  4UVC A;  3G4S I;  2VKH A;  3BTC A;  4W1U A;  2XF6 A;  2LVS A;  3ECH A;  2K85 A;  1ZQ3 P;  3MN2 A;  1U3E M;  3HGY A;  3WTX C;  4ZDO A;  1OCR H;  3IH4 A;  4I0A A;  4BJT A;  3ZMV A;  2LTP A;  2L9N A;  3PNT A;  4HLY A;  3HJE A;  5FLX K;  4KNY A;  2WA0 A;  2QUF A;  2BOL A;  3T1B A;  4YRV A;  2EIN H;  2XRO A;  2VQL A;  1MDM A;  1J5Y A;  4UUS A;  2RN7 A;  3R0A A;  2PBI A;  2ISY A;  3V8L A;  5HS8 A;  2D1V A;  1CF7 A;  2P0W A;  1TNT A;  2ZKZ A;  4XID A;  3A2K A;  4CZZ A;  2KL4 A;  4GFB A;  2QQB A;  1MBG A;  2Y75 A;  4U87 A;  3SFI A;  3OOU A;  5J1R A;  3T8T A;  4M71 A;  3HTS B;  2V6E A;  1FSH A;  4EGZ A;  1OCZ H;  1MZB A;  2LMD A;  1HDD C;  3OL4 A;  2GA1 A;  3WHC A;  4OIN F;  3FF5 A;  2D1H A;  4XMY A;  1U8B A;  1O4X A;  4O6J A;  3SQN A;  1IUY A;  3ASO H;  3CJQ B;  4NDL A;  1ACI A;  3CJN A;  4PJJ A;  4Q47 A;  1Y0N A;  1ITY A;  1H88 C;  2JJ7 A;  2DDB A;  4BE1 A;  2XAF A;  2R7Q A;  2PN6 A;  3AFH A;  1BN5 A;  2VON A;  2HDD A;  4HST A;  4FTH A;  2M4G A;  4BL0 B;  1ZAO A;  1FNN A;  3B73 A;  2EIM H;  3PNY A;  3EPZ A;  4ZTF A;  2HQA A;  4XLH A;  3GX4 X;  1OYY A;  3HHH A;  3HUG B;  2CFX A;  3OYC A;  3JSO A;  1VFC A;  1SMY F;  4IEJ A;  4D7N A;  5BPD A;  3V8J A;  5EG0 A;  3MKY B;  1ZAR A;  3DBH B;  3EQL F;  2R0Q C;  1SMT A;  1K7A A;  2ZB9 A;  2RC4 A;  4KT6 A;  2FQ4 A;  2HTS A;  5HLT A;  5IYD J;  5H2F C;  4ZYD A;  1I5Z A;  2Z9O A;  1S29 A;  1B72 A;  4L5J A;  2VJ5 A;  5DS9 A;  2DJN A;  1FZP B;  1D8J A;  1HF0 A;  2K7L A;  3F8B A;  3RYR A;  1Q1V A;  2ETH A;  2IA1 A;  4Q48 A;  4D7M A;  1TW2 A;  1BIA A;  3WHB A;  1X1P A;  3M9A A;  1RET A;  1Y8R B;  1DGW Y;  3FHZ A;  3TGN A;  3RJP A;  2VT2 A;  1EH7 A;  3WGH A;  1REP C;  1A6I A;  2YU3 A;  3KE2 A;  2O61 A;  5JHF A;  2R7S A;  4JOM A;  1U5T C;  1MSE C;  2Y0S N;  5D4R A;  2M7B A;  3F6O A;  4HX4 A;  3WTV C;  4I76 A;  3JW4 A;  3H9J A;  2QSH X;  2IGO A;  1IV8 A;  2LP0 A;  3DQV C;  4HZF A;  4JYK A;  1ZH5 A;  2DFF A;  1PDN C;  2K9M A;  4XLE A;  1QGP A;  1WH7 A;  2LRD A;  2QLZ A;  3GTM J;  2BYV E;  4ESF A;  3FXL A;  3OYG A;  3FBN B;  2X1C A;  3GLL A;  3AAF A;  1GVD A;  1NH3 A;  4MFE A;  2PI0 A;  3M3Y J;  2DI3 A;  1LVK A;  1Z1D A;  4NQW A;  2V26 A;  3WTT C;  3DTE A;  2XGE A;  2MA3 A;  3C3W A;  4TV7 A;  3K70 D;  3TO7 A;  2CSO A;  9ANT A;  3RPU D;  1X1D A;  2HVR A;  3CMY A;  2BVM A;  1Z9C A;  1VQ9 I;  1E3P A;  4NQW B;  3WTU C;  5J4Y A;  4LFU A;  1SD4 A;  2YUS A;  4BKX A;  3VEP A;  3W2W A;  2HPM A;  3H3V K;  2M3A A;  4XLF A;  3K2A A;  2J5P A;  3M8J A;  1D1B A;  1FEX A;  4YFK F;  4GXO A;  1H9T A;  1QPM A;  2DMU A;  2ZJP F;  3MZH A;  2E5N A;  2F5V A;  2AXT C;  4JX5 A;  4EVI A;  3HOU J;  1L3L A;  2R5Y A;  2JSC A;  2EQR A;  4GDF A;  2WY8 Q;  2ZNZ A;  1ZGW A;  4L0Y B;  2DA1 A;  1R5H A;  2QYO A;  1XB4 A;  1IRF A;  2KP6 A;  3LWF A;  1Z67 A;  1I27 A;  3IRQ A;  2FRH A;  1OCP A;  1RRJ A;  4J01 A;  1UHM A;  2M8E A;  2V1D A;  1JUS A;  1P92 A;  3DKY A;  4XLA A;  4JBA A;  4C2M J;  3CCV I;  2RKH A;  1P4A A;  2PJP A;  5JR3 A;  4IHY A;  2W4S A;  1WJB A;  2FE3 A;  3CJR B;  4KMF A;  3MFK A;  2IXS A;  2V9P A;  5D8L B;  4HPQ A;  1X4O A;  4FX0 A;  3KP6 A;  1IRG A;  3KYC B;  4NUB A;  4Y3O A;  4M6X A;  1QU3 A;  2OA4 A;  1H9G A;  2EV5 A;  4O3M A;  3KFW X;  3ZQG A;  4ESJ A;  1RKW A;  2COM A;  1PJR A;  5L3E A;  3H0G J;  2LY1 A;  2KIM A;  1ON2 A;  5EF6 A;  3Q5F A;  2E1M B;  1QVT A;  4DIQ A;  3BPX A;  4KIC A;  1MNE A;  1VND A;  1WCM J;  1CQT A;  4KYW A;  3CCE I;  1WJ5 A;  1LDK B;  2VXZ A;  2KT0 A;  3BOQ A;  1ZEL A;  3QPT A;  4HSR A;  3N97 A;  1FTZ A;  1XCB A;  4QPO A;  3BZC A;  3J7Y J;  3LFU A;  2ZME B;  3DWL E;  2VOO A;  2NVY J;  4BXX J;  1W0T A;  1ZYR F;  2HI3 A;  3ABM H;  2GOX B;  1UZC A;  2CW0 F;  2EFP A;  1W5T A;  3RCO A;  3AL0 C;  1TQP A;  3TO6 A;  2HPI A;  3CZ6 A;  4I02 A;  3T5X A;  2HFH A;  1MMS A;  3RYP A;  1AKH A;  3VB2 A;  2VKV A;  1LQ1 A;  3LQR A;  4NBQ A;  1WVR A;  3HPH A;  3HOZ J;  2Y31 A;  3HL2 A;  1KYZ A;  4C9Y A;  3CCU I;  4CUG A;  1UG0 A;  4A3K J;  5BMZ A;  1HDP A;  3EUA A;  3I71 A;  4KN4 X;  2RGV A;  2F5E A;  1WGX A;  4P96 A;  1RC9 A;  5K5Q A;  4A6D A;  2C6Y A;  4WCG A;  4MFD A;  4ENJ A;  5LRS A;  1ZGJ A;  2K3F A;  3W3C A;  4BQQ A;  1QQI A;  1QVU A;  1IUF A;  2BGC A;  2X51 A;  1QZE A;  4IJA A;  2MBF A;  1OYW A;  5F64 A;  1G2H A;  1ERD A;  1ORK A;  2EA4 A;  4IRI A;  2IT0 A;  4XLC A;  2DW4 A;  3RTR A;  1QO0 D;  2JZY A;  3QOP A;  2OC6 A;  1APL C;  1I3A A;  2HDC A;  2CH0 A;  1JTY A;  1YS6 A;  2LR8 A;  4AID A;  1RPW A;  3JTG A;  5DM6 F;  2X4H A;  2DN0 A;  4BHC A;  3JRC A;  2A69 F;  3H5R A;  2MD5 A;  4C3I J;  1UEL B;  1Z7L A;  4LG3 A;  3CP2 A;  3V8K A;  1R22 A;  3VOD A;  3J81 K;  2LF7 A;  4BEH B;  3BR6 A;  2Z99 A;  2E1N A;  4U7D A;  4OIO F;  5K7F A;  4WWC A;  1JT0 A;  2XRN A;  2FMY A;  4XSZ F;  3A0H C;  3D5L A;  3FK7 A;  2NNY A;  4XSX F;  5F0C A;  3Q3S A;  4KA4 A;  1GXQ A;  1Y6I A;  2IA2 A;  3IKT A;  1N78 A;  1UHW A;  4F55 A;  2KPM A;  2TRT A;  3HXL A;  4D9J A;  5GTH C;  3L7W A;  1WI3 A;  1EF4 A;  4AD9 A;  5ED4 A;  4G9Y A;  2RNJ A;  1J9I A;  4XKV A;  3PQK A;  4A93 J;  4A0Z A;  3WG7 H;  2COB A;  5F0F A;  2EZL A;  3S14 J;  4IRH A;  2Q2E A;  4IL6 C;  3CES A;  4KMU X;  3RQI A;  1P2F A;  4GCV A;  4MHG A;  1XGS A;  3K6G A;  5EGO A;  2LK2 A;  3BQZ A;  3H9Q A;  3OYM A;  1QNT A;  1SEU A;  3M4O J;  5M3F J;  4BU2 A;  1YIJ I;  3KZI C;  3HOY J;  1GHC A;  3M07 A;  1JUM A;  2IBD A;  3HB9 A;  4E7S A;  3O6B B;  4IXA A;  3OYD A;  1DPU A;  1LJ9 A;  2KJB A;  1VI0 A;  4V19 K;  4RLF A;  2STT A;  4FT8 A;  3G71 I;  2MLG A;  5TRD A;  2EFN A;  2ADU A;  4A3D J;  3P5J A;  4A3E J;  1TWG J;  2VBY A;  2KDO A;  3ZQQ A;  2QWW A;  4MLO A;  2VBX A;  4RMN A;  2NS0 A;  4LG0 B;  1SFU A;  2DT5 A;  2HQR A;  2CQN A;  4OMZ A;  2F48 A;  3MKL A;  1D3Y A;  4HLX A;  4BS9 A;  1SD5 A;  4B4C A;  3HOX J;  2CMP A;  3G6E I;  2DPU A;  3GZ6 A;  4U0V A;  4G7H F;  4DQ2 A;  4DJA A;  4ENM A;  1T38 A;  4IHW A;  2DYR H;  4N4N B;  3X2Q H;  2E1O A;  4MO7 A;  4P9U A;  1ZG1 A;  3S1M J;  3J7A O;  2VKD A;  2DA5 A;  3C1D A;  5C4X J;  3TP0 A;  2XAS A;  1E3O C;  3RKQ A;  3U1D A;  2VBW A;  5F27 A;  2Z3Y A;  4BDY A;  4Q4Z F;  2NVT J;  1UB9 A;  3ECO A;  3W6K B;  4B47 A;  1P4W A;  4XKB A;  2OCC H;  5E3O A;  2OAZ A;  1O7L A;  4PGG A;  4A5N A;  3FXO A;  4BQO A;  1YI2 I;  4RAZ A;  2H09 A;  3V7R A;  2M87 A;  4YIR X;  3SZT A;  5GP9 A;  4BQA A;  4RB3 C;  1IZ1 A;  1B1B A;  3IHU A;  1DQU A;  2ELH A;  3E6C C;  1FY7 A;  4B1R A;  4AYB A;  4G6T B;  4LLL A;  1XD7 A;  3T8R A;  2R7R A;  2H1K A;  4RGR A;  2QQ9 A;  2DK5 A;  4CCK A;  3E7L A;  4I2O A;  1DPR A;  2QGU A;  5DDG A;  2ZFU A;  3JRA A;  2IS4 A;  2L5Q A;  3GF2 A;  2MW8 A;  1RI7 A;  1AU7 A;  2FBH A;  3ZQL A;  3BG5 A;  1STZ A;  4OIR F;  1WH5 A;  4EAT A;  4JX6 A;  3K69 A;  4PZJ A;  3MKZ A;  3I3L A;  3K1P A;  1MSF C;  5KCM A;  4BXU A;  5IPA A;  2CUJ A;  4B8X A;  5M5X J;  3F0C A;  4YEJ A;  1BJZ A;  2HYG D;  4BJ5 C;  2JA8 J;  5K5O A;  2V9V A;  2OPT A;  2BXZ A;  4IF4 A;  4HQE A;  1R9T J;  3S2D J;  2RQQ A;  2OZU A;  1ONV A;  4A3J J;  2GXA A;  2ME0 A;  3MZY A;  3HRS A;  3OIO A;  4D5C A;  2EIK H;  3JRI A;  2FF4 A;  4A0X A;  2HNH A;  1BR2 A;  3IL2 A;  5FKL A;  4HNU A;  2EIL H;  2HU9 A;  2IA0 A;  3QOE A;  1ETO A;  3BT9 A;  2XF7 A;  5CVV A;  3FMR A;  1S5L C;  4YEL A;  3SHF A;  1W7P A;  2QCO A;  3LST A;  4KUM A;  3UKG A;  3S3O A;  2FBK A;  4AVP A;  2UV1 A;  4WK8 F;  2EV0 A;  2FEZ A;  2BY0 A;  3A1Y A;  2EB7 A;  2L0K A;  1D5Y A;  1Q1H A;  2QEX I;  4IX7 A;  1R7J A;  2O6G E;  3A4C A;  3HEF A;  3NRV A;  1BI3 A;  2KKO A;  3KYD B;  5BPI A;  2UUZ A;  2DXI A;  1U5T A;  4R1H A;  3EUH A;  4M74 A;  4RA2 A;  1GLN A;  2CJJ A;  2XGC A;  5FKM A;  2H94 A;  1KQ9 A;  3MQ0 A;  2DOE A;  2XRL A;  1P4X A;  3LQQ A;  2H6B A;  3EET A;  3OYL A;  1B8I B;  2EJR A;  2FU4 A;  1HST A;  3FXK A;  3L2C A;  3H0D A;  4K2E A;  3ERE D;  2WV0 A;  2LOO A;  4NNJ A;  2XHK A;  4F7Z A;  3GBG A;  5DD4 A;  4DW6 A;  4AYB N;  2GAU A;  4ZDL A;  2YSR A;  3PQJ A;  1QHG A;  4YFX F;  1QA6 A;  3I53 A;  2GOM A;  5TJJ A;  1MND A;  2FD5 A;  2DAO A;  1D0Y A;  4G6D A;  3TDU C;  4ENN A;  2CG4 A;  3K7A J;  3RDI A;  1I39 A;  5F08 A;  1A35 A;  1SD7 A;  4EV0 A;  3S1N J;  5LGU A;  1ZRF A;  2H1L A;  2IAI A;  3KZZ A;  5CVU A;  1J09 A;  3MAJ A;  4XRF A;  3S8P A;  3FBI B;  2VXD A;  4LIT A;  1SAU A;  4I0B A;  2GLO A;  1F4K A;  2W84 A;  3E6B A;  4L0Z B;  4BBS J;  1GT0 C;  2I5U A;  1F9N A;  1L0O C;  4Y4R A;  4ESB A;  4E7H A;  3O2P E;  1JE8 A;  2JQ7 A;  2M0M A;  4A3M J;  4DBR A;  3S3M A;  4OWR B;  3LAJ A;  2FXA A;  1XTA A;  2XSJ C;  4JK1 X;  5KVR A;  1FOY A;  2WAF A;  5IOY A;  4BUP A;  2A6E F;  5CYV A;  3K4J A;  2CV0 A;  3MD2 A;  2DYS H;  2M5W A;  2ZFW A;  5FFZ A;  2DMQ A;  2P6S A;  4ZZL A;  4CYC B;  1RNL A;  4LGW A;  2L7M P;  1T0F C;  2EIJ H;  5IT9 Z;  3MZ8 A;  2GXG A;  2MH9 A;  1R49 A;  4NC7 A;  1GVJ A;  2NS7 A;  2XB5 A;  3CDL A;  1IN7 A;  3CLO A;  3N05 A;  2E5Z A;  1BC7 C;  5L3C A;  4WXC A;  4DGW B;  5H6R A;  5LBQ A;  3H35 A;  1BR4 A;  4ASN A;  4AUX A;  5GPA A;  2EBI A;  5DCM B;  2ZJR F;  4A3L J;  1FYM A;  3CO6 C;  3B6C A;  1XGM A;  2R7D A;  3LSP A;  2ZJQ F;  4UVB A;  2FML A;  2GM4 A;  4FQG A;  2W24 A;  1HC8 A;  4OMY A;  2AQE A;  3CUQ B;  1FBU A;  4HV5 A;  2K02 A;  4BJ6 C;  5B3S H;  4IOC F;  1FBS A;  2EZI A;  1UST A;  5JHU A;  4XNF A;  1YRN B;  2QVO A;  3QPS A;  3ZGK A;  2E60 A;  4PUS A;  3BWG A;  1DP3 A;  2DQL A;  1IDY A;  3FX3 A;  3KZY A;  1ZR2 A;  1JT6 A;  2ZJ2 A;  2ECB A;  1G4D A;  2XDV A;  2TDX A;  2XGX A;  2WY7 Q;  2E19 A;  1RKT A;  4BE2 A;  3LL7 A;  3J80 K;  3QU6 A;  4FE7 A;  3TKY A;  2LF8 A;  3UR3 C;  1ENH A;  1ZLK A;  5B66 C;  1KYW A;  3HPG A;  2ECC A;  4G94 A;  1HA8 A;  2CWE A;  2XAQ A;  1XSV A;  2NVU B;  3W6J B;  2AHQ A;  4E7I A;  4S0H B;  3K9T A;  3IWZ A;  4I99 C;  4FE4 A;  4XBF A;  2XC7 A;  2O03 A;  4L18 B;  3SYT A;  5FKK A;  3Q9S A;  4IQJ A;  3WOD F;  2DA7 A;  3ZXS A;  5KHD A;  5D5W B;  4ZDP A;  1P7J A;  1NK2 P;  3F8M A;  3E5X A;  3G3Z A;  4A3G J;  4N9H A;  2Z2S B;  3ZN1 A;  3FDY A;  2E1C A;  4HG2 A;  2ZXW H;  1V4R A;  5J1Y A;  1C0W A;  5DYM A;  5EDN A;  3KEO A;  1IXR C;  5D5X B;  2O3F A;  3LSI A;  5HDK A;  2BV6 A;  3TL4 X;  1OIS A;  3DPU A;  3HOS A;  1SAX A;  4IKF A;  2N8G A;  2NVQ J;  1ZGA A;  5C3E J;  4EJT A;  3BP8 A;  4BNC A;  1SAN A;  5EEH A;  1G3S A;  1A31 A;  5LEK A;  3QU3 A;  1YS7 A;  1F5T A;  1I6X A;  5J3L A;  4WXH A;  5F04 A;  2O8X A;  1N25 A;  2QKM B;  1WJA A;  2M30 A;  4QWQ A;  1RUN A;  5DTD A;  3CUQ C;  3LSR A;  1R4N B;  1JHH A;  1LFP A;  1O57 A;  2GIV A;  3OS1 A;  1Z6R A;  1E17 A;  1AA7 A;  1MNM C;  3DP7 A;  2DQR A;  4XM3 A;  1X2M A;  2VC0 A;  3DBL B;  1S7E A;  2L7F P;  2ZSH B;  3I55 I;  2NOG A;  1FX7 A;  2GZW A;  5E1X A;  1ETQ A;  2VBZ A;  3F8N A;  2EA2 A;  1HW2 A;  2L2O A;  3OS2 A;  1XDU A;  3J7Z I;  2OTL I;  3D5R C;  3JCU C;  5E8G A;  1LKX A;  3RPU A;  4L9J A;  1XS9 A;  1LFU P;  2YX4 A;  5EEA A;  1AHD P;  1K6O A;  2HKO A;  3VSL A;  4QLC U;  2RNG A;  5EG0 B;  4BY7 J;  2VC1 A;  1I3Q J;  5LGN A;  3HKZ N;  3I4N J;  1K83 J;  1A36 A;  2XAU A;  1ETY A;  3TW7 A;  4GYG A;  4U88 A;  1LNW A;  5D5V B;  2LLK A;  1RZ4 A;  2A68 F;  2KIF A;  1R5G A;  3JR9 A;  3E0J B;  1OCT C;  1T33 A;  3G1L A;  2VPL A;  1R5I D;  2X6W A;  4BAC A;  5IP6 A;  2R5Y B;  1ETV A;  3K4B A;  1WJD A;  4HDU A;  1U0J A;  5FRO A;  3BZ6 A;  5GAH J;  2W7N A;  3OYA A;  2V79 A;  1ZLJ A;  3FXU A;  3H1C A;  3DKX A;  3NWT A;  4HV6 A;  1R00 A;  2MSY A;  2Y30 A;  3AG2 H;  5HNH A;  2NXN B;  3L9F A;  4OIQ F;  1TL8 A;  3CO7 C;  5E1Z B;  4HNV A;  2Q2E B;  3GEZ A;  3H36 A;  4G12 A;  5FRN A;  3TBI A;  3OIQ A;  4WX9 A;  4PSX A;  1KA8 A;  1TQI A;  2XF5 A;  2YX7 A;  2P7V B;  1OR7 A;  1X3W B;  4CO8 A;  1IG7 A;  3CF2 A;  1D0Z A;  2XKO A;  3GCM A;  1V5E A;  1PYV A;  1F1Z A;  2JTV A;  1OKR A;  3QWL A;  5CVJ A;  1YYV A;  2VQC A;  4EEF G;  1XCV A;  4B3X A;  3P9I A;  4KN7 X;  1TWC J;  4BBR J;  2VPR A;  4M3E A;  2W48 A;  3J7A Y;  1Y0U A;  4ZYH A;  5LLQ A;  1A04 A;  3PFI A;  1ULY A;  5F6F A;  3CF5 F;  1YIT I;  2LG4 A;  4OAY A;  2R7Z J;  1MH4 A;  2JA7 J;  1KZH A;  1ZRC A;  2H6C A;  3OYI A;  2K3P A;  1HKT A;  3ZR8 X;  5AON A;  4Z2Y A;  2JA2 A;  1R71 A;  2A07 F;  2K9N A;  4UB8 C;  1X2N A;  2F4O B;  4L9T A;  5FKN A;  1V55 H;  3MCZ A;  2KLO A;  3FXQ A;  5FFX A;  2NS8 A;  5LGT A;  4A3F J;  1JKR C;  2DTR A;  3BRO A;  3JSP A;  2F5D A;  3W2A A;  3CTA A;  3GTO J;  1V5G A;  3C2B A;  1R36 A;  1FTT A;  4LJZ F;  5IT3 A;  4D0P A;  1W5S A;  3GUD A;  5ILV A;  1MMN A;  2JPC A;  3OMY A;  1MKM A;  1V5F A;  4LMY A;  3ZQH A;  3K70 C;  3BTJ A;  2DO7 A;  3PUF A;  2M7A A;  4DYQ A;  5D6F A;  5FLX Z;  1IN5 A;  2QQA A;  3DTI A;  4LLN A;  4RGU A;  3DBR B;  2CQ7 A;  1MW7 A;  2E7W A;  2IGK A;  4A2U A;  1OJL A;  3SFZ A;  4C3J J;  1MBF A;  1FOW A;  2Y0S A;  3GTK J;  4KIT B;  1LPQ A;  3NAR A;  1ETK A;  1T08 B;  1B9M A;  1J59 A;  4RAF A;  2K40 A;  1S7A A;  5LRR A;  3V7C A;  1ON1 A;  1X1B A;  2HTJ A;  1G8X A;  5GAE J;  3GTJ J;  1H0M A;  4II2 A;  2JVH A;  3S32 A;  2XSD C;  3LMM A;  2GBY A;  2QA4 I;  5E8I A;  4UB6 C;  2LBF B;  1IXS B;  1UHS A;  2M0C A;  4MNU A;  2K9L A;  4Z6Y A;  4AIH A;  1YW8 A;  1HLV A;  2K27 A;  3WU1 B;  3BJA A;  4KIG A;  2D45 A;  1CF7 B;  2YPR A;  4BAY A;  2LD5 A;  3QP6 A;  1T39 A;  3VOE A;  5D5U B;  2CGP A;  4HF0 A;  3JRB A;  1Y8Q B;  3IKV A;  5LD2 C;  3LAP A;  1XGO A;  5KK1 A;  1TTY A;  2DPD A;  3PIP F;  2OCE A;  3BG7 A;  3CC2 I;  2W25 A;  1BL0 A;  1TWH J;  3I5U A;  3QPL A;  2UWM A;  1RR8 C;  2K5C A;  3A02 A;  4LK0 F;  3QQA A;  3CCY A;  2LKX A;  2L01 A;  2VJ4 A;  3M8E A;  3IWF A;  3NAU A;  1XG1 A;  3HRM A;  4UHT A;  4E7Z A;  3GFL A;  2PG4 A;  3REO A;  3GWZ A;  3ZQI A;  2ICW G;  2MC3 A;  2R4G A;  3C2H A;  4HYE A;  2M2E A;  4V2G A;  5EZG A;  1HXD A;  2F5C A;  3M8F A;  1BM9 A;  3ZQC A;  2QQ8 A;  3KP2 A;  1MJ9 A;  1BW6 A;  1YW7 A;  1T95 A;  3JRD A;  2FSW A;  3AG1 H;  3LOC A;  2O9L A;  3TMO A;  2RVC A;  3SDG A;  1ZHF A;  1MBJ A;  3DEU A;  3GTG J;  3N4M A;  4EJV A;  2L7Z A;  4CH7 A;  4FAS D;  1W7P B;  3P9K A;  4DYR A;  2XV4 S;  1DU0 A;  2H8R A;  4GO1 A;  2KDZ A; 
#chains in the Genus database with same CATH homology
 4IHT A;  4RB2 C;  2VOP A;  2P5L C;  2J5O A;  3GVA A;  3K0L A;  1Z91 A;  2PFB A;  5D8K B;  4H0E A;  4AIK A;  4OIP F;  2FOK A;  3LA3 A;  1O3T A;  2FA5 A;  1IW7 F;  5LHG A;  2ISZ A;  1R1U A;  1S7O A;  4MEY F;  2G7U A;  2KIU A;  2HYF A;  2XKP A;  4HAM A;  4RGX A;  2G7H A;  3ULQ B;  2BE5 F;  3EDP A;  1LB2 A;  3V7S A;  1LEB A;  5HDN A;  1RUO A;  3OOP A;  2OQG A;  3F22 A;  3HIF A;  4IRG A;  1EH6 A;  3V4G A;  3QPH A;  3I0T A;  1Z7U A;  3HRU A;  4Y13 A;  2CQK A;  3E6M A;  5ICE A;  2OQR A;  1XDS A;  1BI0 A;  1XMK A;  3ZMZ A;  1HW5 A;  1R58 A;  5E17 F;  1UCR A;  2G9W A;  5HOO A;  4E70 A;  1WI9 A;  3DF8 A;  4BH9 A;  1MGT A;  4S04 A;  1K78 B;  1YLF A;  3SZP A;  1XN7 A;  1O7F A;  3ZQ7 A;  1LEA A;  1ZN2 A;  4RB0 A;  4BHB A;  1GXP A;  4YFN F;  2OU2 A;  1WKM A;  1W7P D;  2JT1 A;  5CVR A;  4EJW A;  4ENK A;  2LDU A;  5AIQ A;  4WF2 A;  4M9X A;  1FYK A;  5IT9 K;  4N9I A;  4KFC A;  4KIB A;  4M6Y A;  1FLI A;  5FD6 A;  3R61 A;  3KLN A;  3HSF A;  4G6Q A;  2WWY A;  5J8C A;  3DXJ F;  4I01 A;  3TO9 A;  3HSR A;  3HHG A;  1W4M A;  3WTY C;  3DV8 A;  2V1X A;  3VFZ A;  5LHH A;  1KU9 A;  1TBX A;  3E3V A;  4S05 A;  2UXN A;  3H3Z A;  2QBY A;  2Y48 A;  3L09 A;  3T0Y A;  2O0Y A;  4U7B A;  5HLG A;  1G3T A;  1DUX C;  1U5T B;  1CGP A;  5CVI A;  2HOE A;  4KDP A;  1IN8 A;  1T2K A;  4Y15 A;  3KET A;  5FD5 A;  3MWM A;  1WWX A;  3D0S A;  5F1R A;  3WE3 A;  4A0Y A;  5A2Q Z;  4CGZ A;  1IF1 A;  4L9N A;  3NQO A;  5H6Q A;  4MQV A;  4AIJ A;  5HDG A;  1LDD A;  3GFM A;  3F72 A;  3GZ5 A;  3J81 Z;  2D2W A;  5BS6 A;  4O5V A;  2GQQ A;  2W85 A;  4MTD A;  3FMQ A;  3TDZ C;  3M1E A;  3JTH A;  4NB5 A;  1R1T A;  4PGH A;  2PMH A;  2FBI A;  4EGY A;  5FO5 A;  1K78 A;  4G7O F;  2QM3 A;  1KQ0 A;  3RKX A;  4BHP A;  2GA2 A;  4HA8 A;  1FP2 A;  2XAH A;  5L3F A;  1LDJ A;  3P9C A;  4UXN A;  3OV8 A;  4YIF A;  3F8C A;  3ISP A;  4RB1 A;  3H3U A;  1AWC A;  1MD0 A;  2B0L A;  2A61 A;  1SD6 A;  5DCF A;  1G3W A;  4ETS A;  3GFI A;  3U2R A;  4YII A;  1FP1 D;  4WXD A;  1MDM B;  1WSU A;  2W57 A;  1QBJ A;  2LSO A;  4CIC A;  1YQA A;  3QRF F;  1PP7 U;  3DFG A;  3F21 A;  1J75 A;  1KU7 A;  2VE9 A;  3F6V A;  3I58 A;  5ICC A;  5JI6 A;  2IW5 A;  2GWR A;  4LLG F;  1FBQ A;  3COA C;  2PQ8 A;  2WC2 A;  4LB6 B;  4ZYE A;  4Q5S F;  3H92 A;  1P6R A;  4M73 A;  4EM0 B;  4L5I A;  3GYH X;  5HVQ C;  2L4M A;  2JPB A;  1D5V A;  3QAH A;  2EK5 A;  3LFK A;  3IC7 A;  3DPL C;  2YR2 A;  2ZNY A;  4M9Z A;  4HOB A;  2IVM A;  1YW9 A;  2HZT A;  2DBB A;  2HS5 A;  1USS A;  3JAM Z;  3RPQ A;  1IXC A;  4R8H A;  3LA2 A;  3CDH A;  2CO5 A;  2R3S A;  2L3D A;  2ZCW A;  1SFX A;  4BYY A;  2NAZ A;  3HUG A;  1E2X A;  3IRR A;  1ZRE A;  3WG9 A;  5A2Q K;  1J0R A;  5D6E A;  5H20 A;  1JHF A;  3R0J A;  3ML6 A;  1YG2 A;  4CHU A;  2PEX A;  4R79 A;  4U0Y A;  2H27 A;  4MGR A;  4L9V A;  1O3S A;  1S6L A;  3KCC A;  1J2X A;  3ABU A;  3ROU A;  1HQC A;  2ZME A;  5DUK A;  3ZP5 A;  2NRA C;  3P7N A;  5ICG A;  3ELK A;  2NNN A;  3WTW C;  4FX4 A;  1BI2 A;  1HKQ A;  2F5F A;  1IAW A;  4MTE A;  2VT3 A;  5JFR A;  2K86 A;  3E97 A;  2JRT A;  1XSD A;  2VN2 A;  4LB5 A;  4I98 B;  1ZRD A;  5E18 F;  1XSX A;  1FT9 A;  3FZV A;  1IN4 A;  2RQP A;  4U0W A;  1VTN C;  4OU0 A;  4I7H A;  4GGG A;  3FM3 A;  1KU2 A;  3RKY A;  3F23 A;  1FSE A;  5EEG A;  3HTU A;  2K4J A;  3I54 A;  1FC3 A;  1OMI A;  2KRF A;  5L3G A;  2XUB A;  4M9S A;  1WRJ A;  4UV8 A;  1B4A A;  4PCQ A;  1K79 A;  1T98 A;  4G7Z F;  1WQ2 A;  2HQN A;  1DP7 P;  3TQN A;  2LKP A;  2MLK A;  3ZMU A;  2FQ3 A;  2Q8K A;  2IP2 A;  1HSJ A;  3L00 A;  4HX7 A;  5LHI A;  1R1V A;  3R6S A;  1Z6T A;  4GYI A;  4JQF A;  3DPT A;  3CUQ A;  5ILS A;  2VOD A;  1BOA A;  4LG0 A;  3ZMT A;  4A5M A;  3ZMD A;  2L4A A;  2KJC A;  5E20 A;  5HLI A;  2HR3 A;  4UV9 A;  3SXY A;  5HS7 A;  5LEJ A;  1AOY A;  2RDP A;  1YIO A;  3E6D A;  4CYD A;  2ACJ A;  2LNB A;  4P55 A;  1KU3 A;  5JVT A;  3I59 A;  2AS5 F;  4G8X A;  3GW2 A;  3MEX A;  1JXS A;  1J7K A;  2V1U A;  3F8F A;  2Q0O A;  3B02 A;  1FYL A;  5FGM A;  4LD5 A;  6PAX A;  2X0L A;  1OPC A;  2IPQ X;  3RKW A;  4A12 A;  4MEX F;  1X3U A;  1PUE E;  4HDV A;  2EFW A;  3C18 A;  5BQT A;  4ZYG A;  1OYI A;  3GLX A;  4EQQ A;  4UNO A;  1PP8 F;  5J6X A;  2Z33 A;  1BI1 A;  5FB2 A;  2A5Y B;  2IRF G;  4XLP F;  3FWE A;  4ZZD A;  2ZBK A;  4ZH4 F;  3RI4 A;  2MH2 A;  2ESH A;  3M7G A;  4HF2 A;  1KQ8 A;  1I1S A;  3KP4 A;  2XVC A;  2OD5 A;  4DNC A;  3FMS A;  3EYI A;  1DDN A;  3LA7 A;  3WTS C;  2XAJ A;  4P5O A;  1IN6 A;  3R4K A;  5AIP A;  1BJA A;  2P4W A;  4HBL A;  2DLL A;  3RIR A;  1HW1 A;  4UUV A;  5J8F A;  5ILU A;  2A3S A;  2HKX A;  1TQM A;  1R23 A;  4KIF A;  3HSE A;  1V3F A;  3CUO A;  2M1B A;  3I59 B;  1ZG5 A;  3HYI A;  5DUI A;  1U6G A;  2HWV A;  3NEU A;  3ZMS A;  2P6T A;  4IVN A;  2L02 A;  4UVA A;  1D8K A;  2E7X A;  4RGS A;  3BY6 A;  4RS8 A;  5D4S A;  2R7F A;  3G73 A;  4RAY A;  3E5Q A;  2UZK A;  2FNA A;  4P9F A;  4IHS A;  3KP3 A;  4EJO A;  3HOT A;  1B6A A;  2XIG A;  5BOX A;  1FOK A;  3WGI A;  4PDK A;  1S3J A;  3BDD A;  1XGN A;  2P5V A;  2ESN A;  4LK1 F;  1QZY A;  1UFM A;  3I64 A;  2P5K A;  5DD8 A;  1NHA A;  4ON0 A;  3FM5 A;  4HW0 A;  1YO5 C;  2PLY A;  4EJU A;  1Z05 A;  1O3R A;  4EM1 A;  2OZ6 A;  5DEQ A;  4HF1 A;  3BJO A;  5K5R A;  4EMS A;  2EV6 A;  1EV7 A;  2ZXJ A;  1FPQ A;  1B9N A;  3ZN0 A;  2A6H F;  3KLO A;  3GXO A;  3J80 Z;  1QZZ A;  1I1G A;  2QZ8 A;  2CYY A;  4CDG A;  3WTZ A;  1O3Q A;  4N0B A;  5L3B A;  1EH8 A;  3C7J A;  3ZPL A;  1T0F A;  4KT5 C;  2BBY A;  2Y0M A;  2L54 A;  1LVA A;  4XLN F;  4Y17 A;  5HS9 A;  2VE8 A;  2NYX A;  5DV5 A;  5CJ9 A;  2V6C A;  2QBY B;  5DCM A;  4HX8 A;  1MJB A;  2XAG A;  4AWX B;  1TW3 A;  3S2W A;  4FHT A;  4EM2 A;  3Q9V A;  3GFJ A;  3HRT A;  3QP5 A;  3K1N A;  1G3Y A;  1B59 A;  2QEN A;  2P7C B;  3O3K A;  4M72 A;  5K1Y A;  2OBP A;  1TNS A;  2UXX A;  1U78 A;  2F2E A;  2HGC A;  3TOB A;  5CLS A;  4OOI A;  1YTY A;  1MJA A;  1BIB A;  3BPV A;  1TLH B;  3DKW A;  2WTE A;  1JGS A;  4MQ9 F;  4B09 A;  2EWN A;  3U9G A;  4I09 A;  2M45 A;  2Z5U A;  2IJL A;  2K4B A;  2GXB A;  2PMU A;  3ABT A;  2FNP A;  2RV8 A;  3WU0 A;  3KEQ A;  2BEO A;  4CXF A;  3KP5 A;  1KGS A;  4YG2 F;  3F3X A;  4HQM A;  3GO5 A;  1HKS A;  3WE2 A;  1ODD A;  2DU9 A;  1HBX G;  3I4P A;  1BBY A;  1G6N A;  2EFO A;  1U8R A;  5ERI A;  5L3D A;  1T6S A;  1U2W A;  2DFI A;  3K1M A;  3BJ6 A;  2P8T A;  1BC8 C;  2HEO A;  2ZO4 A;  3JAM K;  1RIO H;  5ICF A;  4A6E A;  3R60 A;  5HLH A;  1YFH A;  2EFQ A;  2AXL A;  5E1W A;  1S8N A;  1SFE A;  3KP7 A;  3WGG A;  1ZG3 A;  4NHJ A;  4IPA A;  2STW A;  3FXR A;  3K2Z A;  2DK8 A;  3E5U A;  1FWZ A;  3EYY A;  1XMA A;  3TOA A;  4UVC A;  3ECH A;  1U3E M;  3WTX C;  4I0A A;  3ZMV A;  4HLY A;  5FLX K;  4KNY A;  2QUF A;  3T1B A;  1MDM A;  2XRO A;  1J5Y A;  2RN7 A;  3R0A A;  2PBI A;  2ISY A;  3V8L A;  5HS8 A;  2D1V A;  1CF7 A;  1TNT A;  2ZKZ A;  4CZZ A;  2QQB A;  2Y75 A;  3T8T A;  4M71 A;  3HTS B;  1FSH A;  4EGZ A;  1MZB A;  2GA1 A;  4OIN F;  3FF5 A;  2D1H A;  4O6J A;  3SQN A;  1IUY A;  3CJN A;  4Q47 A;  2XAF A;  2PN6 A;  1BN5 A;  2VON A;  1ZAO A;  1FNN A;  3B73 A;  3GX4 X;  1OYY A;  3HHH A;  2CFX A;  3JSO A;  1SMY F;  5BPD A;  3V8J A;  1ZAR A;  3EQL F;  1K7A A;  1SMT A;  2RC4 A;  2HTS A;  4ZYD A;  1I5Z A;  2Z9O A;  1S29 A;  4L5J A;  1FZP B;  1D8J A;  2K7L A;  3F8B A;  3RYR A;  2ETH A;  2IA1 A;  4Q48 A;  1TW2 A;  1BIA A;  3M9A A;  3FHZ A;  3TGN A;  3RJP A;  2VT2 A;  1EH7 A;  3WGH A;  1REP C;  2YU3 A;  3KE2 A;  2O61 A;  1U5T C;  5D4R A;  3F6O A;  4HX4 A;  3WTV C;  3JW4 A;  3DQV C;  4HZF A;  1ZH5 A;  1PDN C;  1QGP A;  2QLZ A;  2BYV E;  4ESF A;  3AAF A;  2PI0 A;  2DI3 A;  4NQW A;  1Z1D A;  3WTT C;  2MA3 A;  3C3W A;  4TV7 A;  3TO7 A;  2CSO A;  1Z9C A;  3WTU C;  4LFU A;  1SD4 A;  3VEP A;  2J5P A;  4YFK F;  4GXO A;  1H9T A;  1QPM A;  3MZH A;  4EVI A;  1L3L A;  2JSC A;  2ZNZ A;  4L0Y B;  1R5H A;  2QYO A;  1XB4 A;  1IRF A;  3LWF A;  1I27 A;  3IRQ A;  2FRH A;  1UHM A;  2M8E A;  2V1D A;  1P92 A;  4JBA A;  2RKH A;  1P4A A;  2PJP A;  5JR3 A;  4KMF A;  2FE3 A;  3MFK A;  5D8L B;  4FX0 A;  3KP6 A;  1IRG A;  4M6X A;  2OA4 A;  1H9G A;  2EV5 A;  4O3M A;  3KFW X;  4ESJ A;  2COM A;  5L3E A;  2KIM A;  1ON2 A;  3Q5F A;  3BPX A;  4KIC A;  4KYW A;  1LDK B;  2VXZ A;  3BOQ A;  3QPT A;  3N97 A;  1XCB A;  2ZME B;  2VOO A;  1ZYR F;  2CW0 F;  2EFP A;  1W5T A;  1TQP A;  3TO6 A;  4I02 A;  3T5X A;  2HFH A;  3RYP A;  3VB2 A;  1LQ1 A;  3LQR A;  1KYZ A;  5BMZ A;  3I71 A;  4KN4 X;  2RGV A;  2F5E A;  4P96 A;  5K5Q A;  4A6D A;  2C6Y A;  4WCG A;  4ENJ A;  5LRS A;  1ZGJ A;  1QQI A;  2BGC A;  4IJA A;  2MBF A;  1OYW A;  5F64 A;  4IRI A;  2EA4 A;  2IT0 A;  2DW4 A;  3RTR A;  1QO0 D;  2JZY A;  3QOP A;  2HDC A;  1YS6 A;  3JTG A;  2X4H A;  4BHC A;  2A69 F;  2MD5 A;  3V8K A;  1R22 A;  3VOD A;  3J81 K;  2LF7 A;  2Z99 A;  2E1N A;  4U7D A;  4OIO F;  4WWC A;  2XRN A;  2FMY A;  4XSZ F;  3D5L A;  2NNY A;  4XSX F;  4KA4 A;  1GXQ A;  2IA2 A;  3IKT A;  1UHW A;  3L7W A;  4AD9 A;  5ED4 A;  4G9Y A;  2RNJ A;  1J9I A;  3PQK A;  4A0Z A;  4IRH A;  2Q2E A;  4KMU X;  1P2F A;  4GCV A;  4MHG A;  1XGS A;  1QNT A;  1GHC A;  3O6B B;  4IXA A;  1DPU A;  1LJ9 A;  2KJB A;  2STT A;  4FT8 A;  2MLG A;  5TRD A;  2EFN A;  2ADU A;  2VBY A;  2QWW A;  2VBX A;  2NS0 A;  4LG0 B;  1SFU A;  2DT5 A;  2HQR A;  4OMZ A;  1D3Y A;  4HLX A;  1SD5 A;  2DPU A;  3GZ6 A;  4U0V A;  4G7H F;  4DQ2 A;  4ENM A;  1T38 A;  4P9U A;  1ZG1 A;  3J7A O;  3C1D A;  2XAS A;  3U1D A;  2VBW A;  2Z3Y A;  4Q4Z F;  1UB9 A;  3ECO A;  3W6K B;  1P4W A;  2OAZ A;  1O7L A;  4PGG A;  4A5N A;  4RAZ A;  2H09 A;  3V7R A;  2M87 A;  3SZT A;  4BQA A;  4RB3 C;  1IZ1 A;  1B1B A;  3IHU A;  2ELH A;  3E6C C;  1FY7 A;  4LLL A;  1XD7 A;  3T8R A;  4RGR A;  2QQ9 A;  2DK5 A;  4I2O A;  1DPR A;  5DDG A;  3GF2 A;  1RI7 A;  2FBH A;  1STZ A;  4OIR F;  3K69 A;  4PZJ A;  3K1P A;  4BXU A;  4B8X A;  2HYG D;  5K5O A;  2V9V A;  4IF4 A;  4HQE A;  2OZU A;  1ONV A;  3MZY A;  3HRS A;  2FF4 A;  4A0X A;  3IL2 A;  2IA0 A;  5CVV A;  3FMR A;  3SHF A;  1W7P A;  3LST A;  4KUM A;  2FBK A;  4AVP A;  4WK8 F;  2EV0 A;  2FEZ A;  2EB7 A;  1Q1H A;  2O6G E;  1R7J A;  3NRV A;  1BI3 A;  2KKO A;  5BPI A;  1U5T A;  4R1H A;  3EUH A;  4M74 A;  2H94 A;  1KQ9 A;  3MQ0 A;  1P4X A;  3LQQ A;  2H6B A;  3EET A;  2EJR A;  2FU4 A;  1HST A;  3L2C A;  4K2E A;  3ERE D;  2WV0 A;  2XHK A;  4F7Z A;  5DD4 A;  2GAU A;  2YSR A;  3PQJ A;  4YFX F;  3I53 A;  5TJJ A;  2DAO A;  3TDU C;  4G6D A;  4ENN A;  2CG4 A;  3RDI A;  1SD7 A;  4EV0 A;  5LGU A;  1ZRF A;  3KZZ A;  5CVU A;  3MAJ A;  4XRF A;  4I0B A;  1F4K A;  2W84 A;  3E6B A;  4L0Z B;  1F9N A;  1L0O C;  4ESB A;  3O2P E;  1JE8 A;  3LAJ A;  2FXA A;  4JK1 X;  5KVR A;  2A6E F;  5CYV A;  2M5W A;  2ZFW A;  5FFZ A;  2P6S A;  4ZZL A;  1RNL A;  4LGW A;  5IT9 Z;  2GXG A;  2MH9 A;  1GVJ A;  1IN7 A;  3CLO A;  1BC7 C;  5L3C A;  4WXC A;  5H6R A;  5LBQ A;  4ASN A;  5DCM B;  1FYM A;  3CO6 C;  1XGM A;  2R7D A;  4UVB A;  2FML A;  2W24 A;  4OMY A;  3CUQ B;  4HV5 A;  1FBU A;  2K02 A;  1FBS A;  5JHU A;  1UST A;  2QVO A;  3BWG A;  2DQL A;  3KZY A;  3FX3 A;  2ZJ2 A;  1G4D A;  2TDX A;  2XGX A;  3J80 K;  3QU6 A;  3TKY A;  2LF8 A;  1ZLK A;  1KYW A;  4G94 A;  2CWE A;  2XAQ A;  1XSV A;  3W6J B;  3K9T A;  3IWZ A;  4XBF A;  4L18 B;  2O03 A;  3Q9S A;  3WOD F;  5D5W B;  3F8M A;  3E5X A;  3G3Z A;  4N9H A;  3ZN1 A;  2E1C A;  1V4R A;  1C0W A;  5DYM A;  3KEO A;  1IXR C;  5D5X B;  2O3F A;  5HDK A;  2BV6 A;  1SAX A;  3HOS A;  1ZGA A;  4EJT A;  3BP8 A;  4BNC A;  5EEH A;  1G3S A;  5LEK A;  3QU3 A;  1YS7 A;  1F5T A;  1I6X A;  4WXH A;  2O8X A;  2M30 A;  4QWQ A;  1RUN A;  3CUQ C;  1JHH A;  1O57 A;  2GIV A;  1Z6R A;  1E17 A;  3DP7 A;  2DQR A;  2VC0 A;  1FX7 A;  2GZW A;  5E1X A;  2VBZ A;  3F8N A;  2EA2 A;  1HW2 A;  1XDU A;  5E8G A;  3RPU A;  4L9J A;  2YX4 A;  1K6O A;  2HKO A;  4QLC U;  2VC1 A;  5LGN A;  4GYG A;  4U88 A;  1LNW A;  5D5V B;  1RZ4 A;  2A68 F;  2KIF A;  1R5G A;  4HDU A;  3BZ6 A;  2V79 A;  1ZLJ A;  3FXU A;  4HV6 A;  1R00 A;  3L9F A;  4OIQ F;  3CO7 C;  5E1Z B;  3GEZ A;  4WX9 A;  1KA8 A;  1TQI A;  2YX7 A;  2P7V B;  4CO8 A;  1OR7 A;  2XKO A;  1F1Z A;  2JTV A;  1OKR A;  5CVJ A;  1YYV A;  1XCV A;  3P9I A;  4KN7 X;  1Y0U A;  4ZYH A;  5LLQ A;  1A04 A;  3PFI A;  1ULY A;  5F6F A;  1ZRC A;  2H6C A;  1HKT A;  5AON A;  4Z2Y A;  2A07 F;  4L9T A;  3MCZ A;  3FXQ A;  5FFX A;  5LGT A;  2DTR A;  3BRO A;  3JSP A;  2F5D A;  3CTA A;  1R36 A;  4LJZ F;  5IT3 A;  4D0P A;  1W5S A;  3GUD A;  5ILV A;  2JPC A;  1MKM A;  4LMY A;  2DO7 A;  5FLX Z;  5D6F A;  1IN5 A;  2QQA A;  4LLN A;  4RGU A;  2E7W A;  4A2U A;  3SFZ A;  1B9M A;  1J59 A;  1S7A A;  5LRR A;  3V7C A;  1ON1 A;  2HTJ A;  1H0M A;  5E8I A;  1IXS B;  4MNU A;  4AIH A;  1YW8 A;  2K27 A;  3WU1 B;  3BJA A;  2D45 A;  1CF7 B;  4KIG A;  1T39 A;  2YPR A;  4BAY A;  3QP6 A;  3VOE A;  5D5U B;  2CGP A;  4HF0 A;  3IKV A;  3LAP A;  1XGO A;  5KK1 A;  1TTY A;  2DPD A;  2W25 A;  3I5U A;  2UWM A;  4LK0 F;  2L01 A;  3M8E A;  3IWF A;  3HRM A;  4UHT A;  3GFL A;  2PG4 A;  3REO A;  3GWZ A;  2MC3 A;  4HYE A;  1HXD A;  2F5C A;  3M8F A;  1BM9 A;  3KP2 A;  1MJ9 A;  1YW7 A;  2FSW A;  2RVC A;  1ZHF A;  3DEU A;  3N4M A;  4EJV A;  1W7P B;  3P9K A;  2XV4 S;  4GO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...