1FSHA

Structural basis of the recognition of the dishevelled dep domain in the wnt signaling pathway
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
EAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISHEVELLED-1
publication title Structural basis of the recognition of the dishevelled DEP domain in the Wnt signaling pathway.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fshA00
2IP2A 2JPCA 3K0LA 4RS8A 3RI4A 1FWZA 2QBYA 3EYIA 1U6GA 2FMLA 3COAC 4BYYA 4HV5A 2V9VA 3HRSA 1HKSA 2FBIA 1D8KA 1R00A 4O6JA 1R7JA 3QPHA 3RKXA 4A6DA 1QGPA 2MC3A 3BROA 4AIJA 5FFZA 1BN5A 4S04A 1WI9A 1HKTA 3BJ6A 4MNUA 1SMTA 3LSTA 1I1GA 2W24A 3WE3A 1J59A 2JPBA 5D5VB 1S8NA 5ERIA 4HDVA 1GVJA 1FX7A 2D1VA 2YPRA 3MZYA 2HTSA 1RNLA 3JSOA 4IJAA 1T98A 4S05A 3KLNA 3BOQA 4DQ2A 1T6SA 4OIRF 4G7OF 1I27A 2VOOA 1J75A 1YS6A 5L3DA 2GXBA 3H3ZA 2FA5A 1Z9CA 4CXFA 5D8LB 3LA3A 2FU4A 4P9UA 5D5UB 3R6SA 2GWRA 3ML6A 3BPXA 5ILVA 2XAGA 1U3EM 1G6NA 1Z6RA 2WTEA 2LNBA 3T0YA 2IA1A 3C1DA 2FF4A 4B09A 2VE9A 2GA1A 2A6EF 1T39A 4LG0A 5TRDA 2P5VA 2QENA 3E6BA 1O57A 2EFWA 2P5LC 2D2WA 3O3KA 1O3QA 2ETHA 3ISPA 3F23A 1ZN2A 2O61A 1PUEE 2K4BA 3HYIA 3R60A 1RIOH 1F5TA 1T2KA 5L3BA 3L2CA 4I2OA 1I6XA 2MBFA 1LDDA 3C7JA 3WTYC 4KDPA 2KRFA 2PN6A 5BPIA 1YQAA 3V7SA 1DDNA 5CVVA 1W4MA 2H09A 1I1SA 5DCMA 4ZZDA 5D6FA 2UXNA 3N97A 2XAJA 2HKOA 2VXZA 1XSVA 2TDXA 2E7XA 3I71A 4LLNA 2DFIA 1PDNC 2W85A 1JGSA 5L3EA 4ENKA 4A0YA 4IRIA 1FP1D 3GX4X 3J80K 2QBYB 4OU0A 1ODDA 1Y0UA 3WTXC 1ZLKA 1WSUA 1DP7P 2NNYA 4LLLA 3ZQ7A 2XUBA 3G3ZA 1OPCA 3ZP5A 1R23A 1L3LA 4IRGA 1O3TA 2ISZA 1XGNA 1XMKA 3FMQA 1IAWA 2DQLA 2H94A 3ULQB 2OA4A 5DYMA 1SFXA 3V8JA 1W5TA 4HW0A 4GYGA 1T38A 2DTRA 4KMUX 1K78A 3RJPA 2BYVE 1BJAA 4LMYA 3HRMA 1J5YA 3GZ5A 4AWXB 3GFIA 2UXXA 3MQ0A 1LDKB 3K69A 2M30A 3QP5A 5LEJA 3V7RA 4OMYA 2LF7A 5TJJA 4B8XA 3IHUA 1P92A 5LGNA 1HSJA 4ENNA 5D4SA 1IUYA 4I02A 5LHHA 1MZBA 1FSHA 2FSWA 4U0VA 4UVCA 4YFNF 1TW2A 1SAXA 1XDSA 2XIGA 2RV8A 5ILSA 4P9FA 3KE2A 2FQ3A 4WF2A 2XGXA 4LG0B 3WTSC 2A68F 5DD4A 4MEXF 3WGHA 2ZXJA 1HW1A 2M8EA 2HEOA 5BMZA 1UCRA 4FX0A 3F22A 2ISYA 4L9JA 3E6MA 1KYZA 2DPDA 1BOAA 2ZMEA 4OIQF 4RGSA 2DI3A 3M8EA 3DPTA 5LBQA 3WTWC 5E17F 3BY6A 5E18F 4M73A 5CVRA 5D5WB 3CTAA 1MKMA 3R61A 3T1BA 1ZG1A 3M7GA 2ESNA 2F2EA 3J81K 2QM3A 3E6DA 5DCMB 5K1YA 2R3SA 1TQPA 1YYVA 1QO0D 1OMIA 1FNNA 3F8NA 3SQNA 4AD9A 3FXRA 1KU3A 3F21A 4QWQA 1B4AA 3MFKA 5H6QA 2Z3YA 4GXOA 5K5QA 4I01A 1O7LA 1YW9A 3HSRA 1OYWA 3LA7A 4HDUA 1VTNC 4EQQA 4WXDA 2BV6A 1HW2A 4M6YA 4N9HA 1SFEA 1FPQA 2GXGA 3KZYA 1G3YA 3R0AA 2HGCA 2RGVA 1FYMA 3V8KA 3IC7A 1OKRA 3HOTA 3I4PA 3HTUA 3JW4A 2IRFG 2FBHA 4U0WA 2KJBA 3SXYA 1KA8A 2IA2A 2QQ9A 2K86A 1KU7A 1YLFA 2YR2A 2W57A 1WQ2A 2E1NA 3MZHA 1K78B 3NRVA 4LB6B 4M9ZA 1YW7A 5K5OA 4G6DA 4YG2F 2KIFA 4U0YA 4WXHA 4LGWA 2XV4S 1TBXA 2NAZA 2L4MA 5FD6A 2RDPA 3ELKA 4HX8A 2VT3A 3NQOA 2R7FA 2V1DA 3TO9A 1WRJA 3KP4A 1U5TC 2PQ8A 3DP7A 5FD5A 1PP7U 2XRNA 1ZREA 1R5HA 4KA4A 1BIAA 3LWFA 4XSXF 5BS6A 4LK1F 1XGMA 2LF8A 4CO8A 1ZGJA 3E5QA 4HX4A 3F8BA 4KN4X 4ASNA 1O3RA 2OQGA 2PI0A 2VBZA 1IZ1A 1FZPB 4NB5A 3K1NA 3FX3A 1SMYF 4BHPA 5HDKA 3RYRA 2PLYA 1BI2A 4ON0A 2FBKA 5ICEA 2RC4A 2ZMEB 1YFHA 4BH9A 2GA2A 5CVUA 3VEPA 4PGGA 1FC3A 1G4DA 2Z9OA 1HSTA 3KETA 2EA4A 1FYLA 4QLCU 2K02A 1O3SA 3I59A 4OOIA 3MAJA 2OBPA 1S6LA 4KMFA 4MEYF 2H6CA 5HS9A 4NHJA 2VN2A 1KU9A 5HDNA 1ON1A 4E70A 1KYWA 2V1XA 4EJOA 4LJZF 5IT9K 3PQJA 2PJPA 1EH8A 5BOXA 4BHCA 3FF5A 1W7PD 2IVMA 4BQAA 3RIRA 4CZZA 3GWZA 3WGGA 2D45A 3QAHA 5LGTA 5FLXK 1UHWA 5DUKA 4EGZA 2O6GE 2EB7A 1ZRFA 4A5NA 1LEBA 1XCBA 1XCVA 2VE8A 3BDDA 5HOOA 1ZRDA 1GHCA 4TV7A 1U5TB 1ZYRF 4IHSA 1EH7A 2Z5UA 4NQWA 3P9IA 4ETSA 2X4HA 3D5LA 3KCCA 3ZMTA 1IW7F 1UB9A 4EM0B 3DV8A 4Z2YA 1LB2A 5E1XA 3GZ6A 3F6VA 1Q1HA 4PZJA 2ZCWA 2LKPA 1IN8A 5L3FA 4KICA 5J8FA 2P7VB 5HS8A 4G7HF 3GXOA 3QRFF 2EFNA 3FMRA 2G7UA 2B0LA 3F3XA 3DF8A 2IPQX 5JR3A 2L3DA 2A6HF 4WXCA 2DU9A 2YU3A 3P9CA 2O03A 2CYYA 3ZMVA 4RB2C 5BPDA 5EEHA 3D0SA 2O0YA 1Z6TA 4HOBA 1LEAA 2FOKA 1W5SA 3HRUA 5CYVA 1MJAA 5E20A 3E6CC 4RB3C 3HRTA 3WG9A 1FLIA 4KIGA 3E5XA 2VOPA 2V1UA 2L02A 3I59B 4I7HA 2RN7A 1IXCA 1T0FA 2HTJA 4A2UA 2Q2EA 5ICGA 2E7WA 2L54A 1XB4A 4UNOA 4HA8A 5E8IA 4IF4A 4Q5SF 1BM9A 4YFKF 3GF2A 2ZNYA 4CHUA 3V7CA 1AOYA 3K1MA 3EUHA 1FBSA 5LRSA 1BC8C 2EV5A 2BE5F 4BNCA 2HZTA 2MH2A 1QNTA 5J6XA 3KP6A 3O6BB 2HS5A 5AONA 5F64A 1ULYA 2COMA 1USTA 1H9GA 2CW0F 4UVAA 2RNJA 1KQ0A 2NNNA 4YIFA 1R1TA 4XLNF 3BJAA 4EM2A 2QVOA 3ZN1A 4M72A 2EFQA 2OAZA 5ICFA 3E97A 2VBXA 1B6AA 3C18A 5JI6A 2EFOA 2Q0OA 3HOSA 1QBJA 1D5VA 1BI1A 1QZZA 4HZFA 2FMYA 2CG4A 2HFHA 3F8MA 4I0AA 3T8TA 2STWA 1H0MA 1LJ9A 3IWZA 4OINF 4IHTA 2UWMA 2DLLA 2HYGD 4JK1X 5KVRA 1REPC 1WKMA 5DEQA 4Y13A 1EV7A 3LAJA 3CUOA 2ESHA 3H92A 2LSOA 3H3UA 5D8KB 1FBUA 2CSOA 2M87A 4R79A 2YX7A 3T8RA 1FOKA 2JZYA 3KEOA 3WGIA 3ECHA 4P5OA 1U2WA 3HSFA 2JSCA 2KIUA 5JFRA 3EYYA 5ILUA 5E8GA 1TNTA 2HYFA 3FWEA 3KEQA 2YX4A 2XASA 1IN5A 5DUIA 2H27A 3QU3A 3IKTA 2P5KA 4GYIA 3QP6A 2H6BA 3FHZA 1IF1A 2R7DA 1SFUA 1J9IA 2GZWA 3CO7C 1XDUA 3HSEA 4EJUA 1RUOA 5ICCA 1GXPA 1QPMA 3I54A 1JE8A 2PBIA 3HHGA 1NHAA 4UXNA 1AWCA 4L0ZB 4FHTA 1BC7C 3QU6A 3BJOA 4WWCA 2CGPA 1HXDA 3JAMZ 3W6KB 2MH9A 4JBAA 5HDGA 5JHUA 5E1ZB 1U8RA 1BBYA 2RKHA 1TNSA 2HQNA 4BXUA 3R0JA 5LLQA 3LQRA 4N9IA 3FMSA 2M1BA 3GO5A 2G9WA 3ROUA 4M9SA 4RGRA 2XHKA 2DBBA 4P55A 2M5WA 2Y0MA 5K5RA 5D4RA 1FSEA 2EA2A 5CVIA 3Q5FA 3ABTA 1XGSA 2VBWA 3KZZA 2ZKZA 4U7BA 4UV9A 1S3JA 4R8HA 5A2QZ 3OV8A 4MQVA 1S7OA 3EETA 2IT0A 3FZVA 4A0XA 3TQNA 4LLGF 3K1PA 2HDCA 2Y48A 4L9VA 4AVPA 4EM1A 3TGNA 4AIHA 2HQRA 2BBYA 1YO5C 2P7CB 2DO7A 1U5TA 3O2PE 3DQVC 3RPUA 3L7WA 4M74A 1XGOA 2LDUA 4R1HA 3E3VA 3ZMDA 1P4AA 2QQAA 4EVIA 5AIPA 5CVJA 3N4MA 2FNAA 1RI7A 2L01A 3L00A 2A69F 4UVBA 2ZO4A 2W25A 4ESFA 1Z05A 2IA0A 3RKYA 3LA2A 3EQLF 3JTHA 4U88A 2JT1A 4KIBA 2QUFA 3GEZA 1IRGA 1B1BA 1RUNA 3F8CA 4OIOF 3DKWA 2OD5A 4LB5A 2XAQA 1G3WA 3GUDA 3HHHA 1CGPA 2EV6A 3Q9VA 1ZHFA 3BPVA 5IT3A 3RYPA 2DW4A 3U1DA 1LVAA 2MA3A 3WTTC 4MHGA 2G7HA 4GGGA 4PDKA 1A04A 1QQIA 4WX9A 4HLYA 4GO1A 4ZH4F 4GCVA 4ESBA 1SD7A 3REOA 4A5MA 5ED4A 4FT8A 4KYWA 3QPTA 3WTUC 1IN4A 1TQMA 3I53A 4FX4A 1PP8F 2AXLA 3W6JB 2V6CA 3SHFA 1R1UA 2PMUA 3SFZA 4A0ZA 3PQKA 1DPRA 1DUXC 5HLGA 3E5UA 1O7FA 4F7ZA 2KJCA 1TQIA 2D1HA 5LHIA 4L0YB 3DXJF 3WU0A 4IRHA 4HV6A 1E2XA 1W7PA 5AIQA 3KP3A 1HBXG 3GFJA 2VC1A 1USSA 1XD7A 3GVAA 1BI0A 1UFMA 2Q8KA 4UUVA 1DPUA 3Q9SA 4MGRA 3ZMZA 2QZ8A 1P4XA 3KLOA 3RKWA 2DQRA 3P7NA 1D8JA 1LNWA 2OU2A 3CUQA 5CLSA 4O3MA 3VOEA 2VODA 4YFXF 2J5OA 4HQMA 5H20A 4EJTA 3GFLA 3I58A 4JQFA 1G3SA 4RAZA 4MQ9F 3J80Z 5DV5A 2DK5A 1KQ8A 1HW5A 3OOPA 4YIIA 3IKVA 3ABUA 2A5YB 1LDJA 3CUQC 2F5CA 4EJVA 3CLOA 3FM5A 4U7DA 4RGUA 3M1EA 1R58A 4HF2A 3J7AO 3LQQA 2WC2A 1MDMB 1C0WA 2EJRA 4L5JA 4G6QA 1MJ9A 2VT2A 3KP5A 3GYHX 3WE2A 5CJ9A 2A3SA 4CICA 1MJBA 3CDHA 2AS5F 1B59A 2DK8A 2ELHA 1P4WA 1TW3A 5L3CA 2NYXA 3K9TA 2OZ6A 5L3GA 3B02A 2PG4A 3I5UA 2JRTA 4BHBA 3VFZA 2WWYA 4I09A 1Z1DA 1Z91A 2NS0A 1EH6A 2JTVA 3VODA 2ADUA 3HUGA 5EEGA 3TO6A 2FXAA 4ZYEA 3M9AA 3TDUC 3QOPA 4L18B 2Z99A 1K7AA 3WTVC 3IRQA 1F1ZA 1X3UA 2PEXA 2Z33A 3KP2A 1U78A 3TOAA 2IW5A 4CDGA 5E1WA 4AIKA 3T5XA 4PGHA 1J2XA 2HWVA 4G9YA 3MCZA 2VC0A 1IN6A 1SD6A 2OQRA 1G3TA 4Q4ZF 1JXSA 3F72A 2QLZA 1ZG3A 2MD5A 4XRFA 2M45A 2HKXA 4O5VA 1B9MA 3CO6C 2CO5A 4CYDA 1YIOA 3I0TA 3PFIA 4OIPF 2YSRA 3MEXA 4ESJA 3JTGA 4DNCA 1W7PB 4IXAA 2K7LA 2EV0A 1FY7A 2P6TA 1ON2A 2EFPA 2GAUA 6PAXA 2O8XA 4IPAA 1BIBA 2K4JA 5H6RA 3GLXA 4G8XA 4RAYA 5HLHA 3U2RA 2J5PA 1ZH5A 3J81Z 4WCGA 4OMZA 2A61A 4KN7X 1RZ4A 4G94A 3CUQB 4P96A 2BEOA 4EV0A 2Y75A 5HLIA 1UHMA 2CFXA 1XN7A 3ERED 5HVQC 1SD4A 4M9XA 3C3WA 4HYEA 5DD8A 3IRRA 4HBLA 4CGZA 2CWEA 3GW2A 4ZYHA 1FP2A 2DPUA 3WTZA 2FRHA 3MWMA 4EJWA 3LAPA 4LFUA 4UV8A 1ZGAA 1J0RA 3CJNA 1IN7A 3KP7A 1D3YA 4HAMA 3U9GA 3K2ZA 4N0BA 4L9NA 2XKPA 1XSXA 1ZG5A 1FT9A 3HTSB 4KUMA 1R1VA 2VONA 1IXRC 2GIVA 4KT5C 1V3FA 2C6YA 3M8FA 2FNPA 1STZA 5JVTA 1ZRCA 1K79A 4I0BA 3RTRA 3L09A 1JHFA 2ZJ2A 5DCFA 2XVCA 2F5EA 1IRFA 1YS7A 3DEUA 4IVNA 4HQEA 1CF7A 1TTYA 3ZMUA 4MTDA 4EMSA 2DAOA 3DPLC 2FE3A 2O3FA 2P4WA 5FB2A 4RGXA 3TOBA 4PCQA 3WODF 4XSZF 1MD0A 3SZTA 3RDIA 2HR3A 2OZUA 1S7AA 1YW8A 5FO5A 1S29A 4D0PA 5F6FA 1F4KA 1MGTA 3F6OA 4BAYA 3B73A 1R36A 2ZFWA 4XLPF 3L9FA 4M71A 2X0LA 2QQBA 4A6EA 1LQ1A 1F9NA 2W84A 3VB2A 2A07F 5FGMA 1ONVA 4RB0A 1QZYA 4L9TA 1ZAOA 3RPQA 1R22A 2RQPA 3EDPA 1ZARA 1Z7UA 4LK0F 2XROA 4Y15A 1OYIA 1L0OC 3ZPLA 4I98B 2FEZA 2QWWA 5IT9Z 2EK5A 4KNYA 2ZNZA 2DT5A 2UZKA 2XAFA 2P8TA 4RB1A 1YG2A 4ZYGA 4MTEA 3BZ6A 4M6XA 2ACJA 1FBQA 3I64A 3TKYA 4Q48A 1KQ9A 2VBYA 1OYYA 4L5IA 5FFXA 4ZZLA 5FLXZ 4ZYDA 1ZLJA 2BGCA 2P6SA 3AAFA 4EGYA 3DFGA 3LFKA 1JHHA 3GFMA 1R5GA 4HF1A 1H9TA 1MDMA 4XBFA 3JSPA 2CQKA 1K6OA 5F1RA 1XMAA 3P9KA 5D6EA 2E1CA 2MLGA 2QYOA 1HQCA 1KGSA 5LRRA 4ENMA 1GXQA 3FXQA 3BWGA 3F8FA 3R4KA 3S2WA 1FYKA 3NEUA 4ENJA 1CF7B 2XKOA 2L4AA 5BQTA 4HX7A 4HF0A 1B9NA 1IXSB 2KKOA 3BP8A 3FXUA 2GQQA 3V4GA 1YTYA 2PFBA 2XAHA 3IWFA 5HS7A 4KFCA 3V8LA 2PMHA 1P6RA 2KIMA 3TO7A 3G73A 4H0EA 5J8CA 4HLXA 3IL2A 3ZMSA 2F5FA 3JAMK 3WU1B 4Q47A 2RVCA 3HIFA 4WK8F 2V79A 5D5XB 2EWNA 2WV0A 1SD5A 4A12A 3FM3A 3ECOA 2F5DA 2MLKA 4Y17A 3ZN0A 5LHGA 2NRAC 1OR7A 2HOEA 5LEKA 1WWXA 5DDGA 1XSDA 2ZBKA 1I5ZA 2K27A 1E17A 4G7ZF 1KU2A 1V4RA 5LGUA 3SZPA 3TDZC 5A2QK 4K2EA 2IJLA 2STTA 4LD5A 1BI3A 3KFWX 1P2FA 5KK1A 1J7KA 4KIFA 1TLHB 4UHTA 1HKQA
chains in the Genus database with same CATH superfamily
2IP2A 2JPCA 3K0LA 4RS8A 3CCJI 3RI4A 1FWZA 1TWGJ 4XRSA 2HOSA 1MBEA 2QBYA 1U6GA 2FMLA 3EYIA 3COAC 2CUZA 1X2MA 4BYYA 5C44J 4HV5A 2V9VA 2QSFX 3HRSA 1IRXA 1HKSA 2FBIA 4NC7A 1A35A 1D8KA 1QVTA 1R00A 4O6JA 1R7JA 3QPHA 4GDFA 3RKXA 1YOVB 4A6DA 3F9KA 3I3LA 1QGPA 1S5LC 2MC3A 3BROA 4J00A 4AIJA 3OS1A 3GMEA 5FFZA 2AHQA 4HRIA 1BN5A 3HG9A 4DYRA 4S04A 2VASA 1WI9A 1HKTA 3BJ6A 4DYQA 3FXLA 1FOYA 4MNUA 5DM7F 1SMTA 3LSTA 1I1GA 2W24A 5TISC 1OCTC 1GV2A 1BR1A 3WE3A 2WADA 3O8HA 1J59A 2JPBA 1WJ5A 5D5VB 3CF2A 3Q3SA 3HPGA 3BC8A 2XDVA 2COBA 1S8NA 2ELKA 5ERIA 3CJQB 4HDVA 4A3IJ 1GVJA 1FX7A 2D1VA 2NXNB 2YPRA 3S1NJ 3H5NA 3MZYA 3MMYB 2HTSA 3DLAA 4NC6A 5FKOA 1RNLA 3QYEA 2E1MC 2JUGA 1O4XA 3JSOA 1IDYA 3EUAA 4IJAA 3OS0A 1T98A 4E7SA 4S05A 3UKGA 3KLNA 3BOQA 4DQ2A 5J3LA 1T6SA 4OIRF 4G7OF 4II2A 1I27A 2VOOA 2DFEA 2FJ1A 3OYNA 1VQ4I 5HNHA 2XRLA 1VFCA 1VQ9I 4Z6YA 2W4SA 3LSIA 3BLYA 2HOTA 1G2HA 1J75A 1YS6A 4A3KJ 5L3DA 2ZFUA 3MD2A 2Y30A 2GXBA 3H3ZA 2FA5A 1Z9CA 4AIDA 4XN3A 3CCVI 2M3AA 4CXFA 5D8LB 3LA3A 2XSJC 2FU4A 4P9UA 4A3JJ 3AG4H 2CQQA 5M5XJ 5D5UB 3R6SA 2GWRA 3PIOF 3PSFA 3ML6A 2LMDA 2DA4A 3BPXA 5ILVA 2XAGA 4PSWA 3PIPF 1G6NA 3JRDA 1Z6RA 5EZGA 1U3EM 3G1MA 2WTEA 2LNBA 3T0YA 2IA1A 2M4GA 3C1DA 1QRYA 3W2VA 2FF4A 3SEQA 5FJ8J 4B09A 2VE9A 2JJ7A 2GA1A 3LSKA 2A6EF 1T39A 2HQ5A 4PFPA 4LG0A 3CCMI 5TRDA 2P5VA 4AYBN 2BVLA 1K61A 2QENA 2E5ZA 1HF0A 3E6BA 1NTCA 1O57A 2CV1A 1NH3A 1QZEA 2EFWA 3W6VA 2P5LC 2D2WA 5TGTA 3O3KA 4DBRA 1O3QA 2ETHA 3ISPA 3F23A 1ZN2A 2O61A 1PUEE 1U9OA 2K4BA 5GAHJ 4L5EA 3L2QA 3S1QJ 3HYIA 3P5JA 3R60A 1RIOH 1F5TA 1T2KA 3DPUA 2MFZA 5L3BA 2XC7A 3L2CA 4I2OA 1I6XA 1SAUA 2LVSA 4X0GA 2MBFA 1LDDA 2JVHA 3OYGA 3C7JA 1D1CA 3IP4B 3WTYC 1APLC 2YS9A 4KDPA 2KRFA 3BR5A 5F0HA 2CQXA 4NBQA 2PN6A 5BPIA 4AU7A 5EGOB 4B44A 3J7AY 3HEFA 1YQAA 1QPIA 2XPWA 2E19A 2E5NA 3QPLA 1WJFA 3V7SA 3A1YA 1DDNA 2IS6A 5CVVA 3OMYA 2R93J 4CYCB 1W4MA 2H09A 1I1SA 4IHXA 5DCMA 4W97A 4ZZDA 5J4VA 5C4JJ 5C4XJ 4QIWN 3BR0A 5D6FA 2UXNA 2WAQN 3N97A 2V6EA 3FBIB 2Y0SA 2XAJA 2WAEA 1FJLA 1PVEA 2HKOA 2VXZA 4YELA 1XSVA 4BQOA 2TDXA 2E7XA 1BW5A 2MC4A 4J19A 3I71A 4LLNA 2DFIA 1PDNC 2W85A 1JGSA 2EPFA 5L3EA 4ENKA 2L9RA 4A0YA 2HXOA 1OCZH 1DP3A 2ICWG 4IRIA 1FP1D 3GX4X 4I76A 1JTXA 1MNEA 2JK3A 2PJRA 3J80K 1Y1WJ 2QBYB 5GADJ 1BR2A 2EIJH 4OU0A 1VQMI 1ODDA 1UHSA 1Y0UA 3WTXC 3ZXSA 1ZLKA 3EUHC 1WSUA 1DP7P 2NNYA 4LLLA 3ZR8X 3HGYA 5GP9A 3ZQ7A 2OUMA 3OR1C 1XX5A 4XOPA 2XUBA 4CCKA 2FD5A 1ETYA 3G3ZA 2LY1A 5K7ZA 1OPCA 2E1MB 3BG7A 3ZP5A 2X1CA 1UG2A 1R23A 1OQYA 3CCSI 1L3LA 4IRGA 1E3PA 1O3TA 2ISZA 1KZHA 1XGNA 1XMKA 3BTIA 3FMQA 1IAWA 1ZR4A 3DTIA 2DQLA 4PJ0C 2GOXB 2H94A 3ULQB 3ZQLA 2OA4A 5DYMA 2JA6J 2DMNA 4JP0A 3C2GA 3PNTA 4RAGA 1SFXA 4ZDLA 2LRDA 2BHZA 4HSRA 3K70D 1VNDA 3ZQHA 4HNTA 3V8JA 1W5TA 4HW0A 4GYGA 4A3EJ 1T38A 4MFDA 2DTRA 4KMUX 1K78A 3RJPA 2DDBA 2Z2SB 4RLFA 2Y9YA 2BYVE 1BJAA 3OYFA 5FLVA 3PUFA 3HRMA 4LMYA 1AKHA 1MSFC 2NVXJ 3DBLB 1J5YA 2O5RA 3GZ5A 2LY9A 4AWXB 4CCOA 4B3XA 3GFIA 2UXXA 3MQ0A 1LDKB 3K69A 2DFFA 2M30A 3QP5A 5LEJA 2RAEA 3V7RA 4OMYA 2LF7A 5TJJA 4B8XA 3IHUA 3H0GJ 2Y9ZA 1P92A 5LGNA 1HSJA 1MMDA 4M3DA 2AXTC 4ENNA 3HBLA 5D4SA 1IUYA 4I02A 5LHHA 1MZBA 2XSDC 1FSHA 2VQCA 2FQ4A 5CQGA 5IPAA 2FSWA 2ID6A 2BVMA 2QGUA 3S93A 2V9PA 4U0VA 4D7MA 4UVCA 1TW2A 4YFNF 1SAXA 1XDSA 2XIGA 5GAEJ 3I9V2 1N77A 2A05A 2RV8A 3SJMA 1XS9A 3HDDA 5ILSA 4P9FA 3CQZJ 4XLFA 3KE2A 3LSGA 4A3CJ 2FQ3A 2FX0A 4WF2A 2XGXA 1VZ0A 3FK6A 2D5VA 2CW7A 1JT0A 3WTSC 4LG0B 4F93B 1XMXA 1RESA 1YJNI 3QQAA 2A68F 5DD4A 4MEXF 3WGHA 2ZXJA 3MKLA 1HW1A 3G4SI 2M8EA 2HEOA 3K4JA 5BMZA 1UCRA 1OISA 1G59A 1IRZA 4FX0A 3F22A 2ISYA 1N75A 4L9JA 2R7UA 3E6MA 1KYZA 2DMQA 4XKCA 1ZGWA 2DPDA 1BOAA 1JUMA 2ZMEA 4OIQF 1Y0NA 1GVDA 1E3OC 1DU6A 2GXAA 1WCMJ 2DI3A 4RGSA 3M8EA 3DPTA 5LBQA 3WTWC 1ENHA 1WH7A 5E17F 3ABLH 1LKXA 4C2UA 3BY6A 5E18F 2Q2EB 2DDAA 2LK2A 4M73A 3OL4A 3S16J 2I8DA 5CVRA 5D5WB 3L2RA 4ZC3A 3CTAA 1MKMA 2LR8A 3R61A 5FLMJ 2KDZA 2LYCA 1YRNA 3T1BA 3GTPJ 3VSLA 1ZG1A 3M7GA 2ESNA 4IHYA 1NG7A 2F2EA 3J81K 1I3AA 2QM3A 2ZXWH 3DEEA 3E6DA 5DCMB 3ZQFA 2ZMEC 1W0TA 2JRMA 5K1YA 2R3SA 1TQPA 1YYVA 2LP0A 1QO0D 3E7LA 3OIQA 1W5CC 1OMIA 3IH3A 1FNNA 1LFUP 3F8NA 3SQNA 4AUXA 1ETWA 4HSTA 2LC2A 4AD9A 1JKOC 3FXRA 1KU3A 2IBDA 3ZCOA 3F21A 2Y31A 4QWQA 4Y3OA 4QSHA 1B4AA 5FRNA 1RRJA 3MFKA 3BCAA 3TMOA 5H6QA 2Z3YA 4GXOA 5K5QA 4I01A 4BBSJ 3D5SC 3PO2J 3BQYA 1O7LA 2F4MB 3CCYA 4ZYAA 4EEFG 5EG0A 1YW9A 3FKJA 2ECBA 1JGGA 3HSRA 1OYWA 3LA7A 4HDUA 1VTNC 2ME6A 4EQQA 1HC8A 4WXDA 3CCEI 2BV6A 3BZKA 1JT6A 1HW2A 3BCBA 3GTJJ 3VPRA 4M6YA 1N25A 1NG6A 4N9HA 1SFEA 1FPQA 4B1RA 2GXGA 3KZYA 1IO2A 1MBKA 2XAUA 4RLQA 2GBYA 3A0BC 2DMUA 1G3YA 2JA2A 1T56A 3CF5F 3R0AA 4C3JJ 3CD6I 2HGCA 2RGVA 1FYMA 4C2TA 3A2KA 4BDZA 2DMPA 1WI3A 4M3FA 3V8KA 3ASOH 3RCOA 4B3AA 3IC7A 1OKRA 3HOTA 3I4PA 3HTUA 3JW4A 2IRFG 1NK3P 2FBHA 3S32A 3WHCA 2R7ZJ 2GOMA 4U0WA 2KJBA 3SXYA 1KA8A 2IA2A 2QQ9A 2K86A 1BR4A 1KU7A 1YLFA 4IHWA 3K2AA 3JRHA 2YR2A 2W57A 1R6RA 1WQ2A 3S1RJ 2E1NA 3MZHA 1UG0A 5KNLA 2VQGA 1K78B 3NRVA 4LB6B 4DOZA 3CMEI 4M9ZA 1I6HJ 2M9HA 2RREA 3WU2C 1YW7A 5GTHC 5K5OA 4YRVA 4G6DA 4YG2F 2KIFA 4XIDA 4U0YA 4JX4A 3KYLA 4WXHA 4LGWA 2XV4S 4XKVA 4A3BJ 1TBXA 2NAZA 2L4MA 5FD6A 2RDPA 3DKYA 3ELKA 4HX8A 2VT3A 3RPUD 1YITI 3NQOA 2R7FA 2V1DA 3TO9A 3OYMA 1ZQ3P 4A3MJ 1WRJA 4CZCA 5FKLA 3FXKA 3KP4A 1U5TC 2PQ8A 3DP7A 5FD5A 3SEZA 2KZVA 2WBMA 5F0FA 1PP7U 1PUFA 2W48A 2XRNA 1ZREA 4LIVA 1R5HA 3MKZA 3HGGA 2IS2A 2IGOA 3G71I 4CH7A 1Y8RB 4KA4A 1A6QA 2EZKA 1BIAA 3LWFA 4XSXF 5BS6A 4LK1F 1XGMA 2LF8A 4CO8A 1TWFJ 4F52A 1ZGJA 3E5QA 4II3A 4HX4A 3CC2I 1ETKA 3HOUJ 3F8BA 3Q0VA 2V26A 4KN4X 4ASNA 1UELB 1O3RA 2CQ7A 2OQGA 2PI0A 2VBZA 3H1CA 1IZ1A 3BG9A 1FZPB 4NB5A 3K1NA 2V9KA 2L7KA 2ME0A 4C2MJ 2Y0SN 3FX3A 1SMYF 4BHPA 5HDKA 3RYRA 3I4MJ 2PLYA 1BI2A 4ON0A 2FBKA 2CV0A 5ICEA 2DA1A 2RC4A 3K7AJ 2ZMEB 3I56I 1YFHA 2JSPA 4JOMA 1VQ8I 4BH9A 2GA2A 5CVUA 3VEPA 2M34A 4PGGA 1FC3A 1G4DA 2Z9OA 1HSTA 3FBNB 3KETA 2HPIA 3BQZA 3OYAA 3LFUA 4FTHA 1WGXA 5FKNA 2EA4A 1MBHA 2DODA 1FYLA 5KAIC 4IO9F 2A5WA 2LLKA 3L1PA 2R7WA 4QLCU 2K02A 3L2VA 1YRNB 2JN6A 1O3SA 3ZRGA 4FASD 2KP6A 1VI0A 3I59A 2PMZA 5JLWA 1V5FA 2R5YA 4OOIA 3MAJA 2DA2A 2OBPA 1S6LA 5IY5H 1X3WB 2WB1A 5GPCA 3LSMA 4KMFA 4H4KC 1TT5B 3CCLI 3OYJA 4MEYF 2VQHA 3JRAA 1GV5A 2H6CA 5HS9A 2JVGA 4NHJA 1MBGA 2VN2A 1X4OA 4RAFA 1KU9A 3GTKJ 2BY3A 5HDNA 1SFKA 1LVKA 5B5EC 3AKZA 1ON1A 4E70A 3HOZJ 2OF7A 5IP6A 1WJEA 1KYWA 2V1XA 1YIJI 4EJOA 4LJZF 1Z7LA 2VIXA 1ZR2A 2DOAA 5EG0B 2X51A 3LSRA 5IT9K 3Q0WA 3PQJA 2PJPA 1EH8A 5BOXA 4BHCA 3FF5A 1W7PD 3ZGKA 1SVMA 1LUJB 3FHNA 1NK2P 2IVMA 4BQAA 3RIRA 4CZZA 1MMAA 3GWZA 2LTPA 3SYTA 3WGGA 3A4CA 2ZXIA 3RQ4A 3LNQA 2D45A 5JLXA 2DN0A 2JA7J 3QAHA 3OL3A 5LGTA 3DU5A 2L7FP 2QSHX 5FLXK 1UHWA 5DUKA 2ID3A 4EGZA 5IOYA 2O6GE 2EB7A 1ZRFA 3H5AA 4A5NA 1LEBA 1XCBA 1XCVA 2VE8A 3BDDA 4E7HA 1T8IA 1LE8B 5HOOA 3MN2A 1ZRDA 1GHCA 4TV7A 1K4TA 1U5TB 1ZYRF 4IHSA 2R7XA 4BU2A 2EIKH 1EH7A 2Z5UA 3AFHA 3CP2A 5J1RA 2XB0X 2X48A 4NQWA 3P9IA 1JJ8C 3U21A 3M3YJ 4ETSA 3IUOA 1OCPA 9ANTA 1ETOA 1BW6A 1MBFA 1WVRA 2HI3A 2X4HA 4F55A 1OJLA 2W1OA 2LH9A 1V5GA 3D5LA 3KCCA 2CFOA 3ZMTA 2NVYJ 2DMTA 1IW7F 2VXDA 3BTLA 1UB9A 5KCMA 1Y56A 2LOOA 1VQ7I 1T33A 2L7MP 1D0XA 4EM0B 3CCRI 3E0JB 1DGWY 3DV8A 4Z2YA 3AG2H 4A69C 4GFBA 1PUFB 1LB2A 5E1XA 3M4OJ 4NUBA 3GZ6A 3F6VA 2HVQA 1Q1HA 4PZJA 2BHYA 3FISA 3UR3C 3ABKH 2ZCWA 4UB6C 2B9SA 2LKPA 1IN8A 4F91B 5L3FA 1IV8A 1S7EA 4KICA 5J8FA 2P7VB 5HS8A 4G7HF 3GXOA 3QRFF 3OS2A 3ZQCA 2EFNA 3FMRA 4FISA 2R7OA 2IXSA 2G7UA 2B0LA 4BE2A 2K5CA 1JKRC 4XR6A 2IS1A 1DQUA 4E4HA 1VQLI 3F3XA 3DF8A 1WJBA 1VQ6I 4QPOA 2IPQX 4BQQA 5JR3A 2L3DA 2A6HF 4PSXA 3S2DJ 2FUG2 3MKYB 2ECCA 2Y69H 4WXCA 1VQPI 2DU9A 3K6GA 1HCRA 2YU3A 3V42A 2E2JJ 3BR1A 2O03A 3P9CA 3GBGA 2VJ4A 2R7QA 2BY2A 2CYYA 3ZMVA 5M5YJ 2NVQJ 4RB2C 5BPDA 5EEHA 3D0SA 2O0YA 5LFAA 1Z6TA 1H88C 4RBOA 4HOBA 1LEAA 2FOKA 1W5SA 3HRUA 5CYVA 1RC9A 1MJAA 5E20A 3E6CC 4RB3C 3HRTA 3WG9A 4G6TB 1FLIA 1FTTA 4KIGA 3E5XA 4XLHA 2VOPA 2CRGA 2V1UA 4AVZA 2L02A 2ZSHB 3UNGC 2LBFA 3I59B 4I7HA 2RN7A 2R5YB 1IXCA 3DLLF 1T0FA 4YEJA 2HTJA 4A2UA 2BW3A 4B47A 1R71A 2Q2EA 3X2QH 1KONA 5ICGA 1OLTA 2E7WA 2L54A 1XB4A 3HPHA 3BG3A 4UNOA 4HA8A 2NVUB 4BKXA 5E8IA 1N78A 1RKTA 4UUSA 4IF4A 3FK7A 3BR3A 4Q5SF 1BM9A 5M3FJ 4YFKF 1JKPC 4DZPA 3GF2A 4IOCF 2ZNYA 2O8KA 3H0DA 1I39A 4CHUA 4E7IA 4BXXJ 4HNVA 3V7CA 2DYSH 3LSPA 1AOYA 2IGMA 3K1MA 1T0FC 2WV1A 1FBSA 3EUHA 5LRSA 1W1WE 3PO3J 2W7NA 2W82A 3K4CA 1A31A 2IS4A 1BC8C 2KZGA 3PNVA 1SVOA 1YX5A 2EV5A 2BE5F 4PJLA 4B43A 4BNCA 2HZTA 2MH2A 4UUTA 5JVGF 1K6YA 1QNTA 4S0HB 5M3MJ 5J6XA 3KP6A 3O6BB 4CA0A 2HS5A 2XPUA 5AONA 5IP7J 5F64A 1ULYA 2VPLA 2COMA 2HVRA 1USTA 2E71A 1BA5A 1H9GA 2DA3A 5E3NA 1Z67A 2CW0F 4UVAA 2RNJA 1KQ0A 2NNNA 4YIFA 1R1TA 2XPVA 5GPAA 4XLNF 5J47A 3BJAA 4EM2A 2HPMA 2QVOA 3ZN1A 3TL4X 4M72A 2QF7A 2EFQA 2OAZA 5ICFA 3SDGA 3E97A 4KITB 1AA7A 2CUJA 2VBXA 1B6AA 3C18A 5EF6A 5JI6A 2EFOA 3LSHA 4MIMA 4XM3A 2Q0OA 1B8IA 2ZJPF 3KEYA 3HOSA 1S72I 3K10A 3K4LA 5EZHA 1QBJA 3RSNA 2AQFA 2KRCA 4NQWB 1B72A 1D5VA 2WY8Q 4DJAA 1R9TJ 1M1EB 1BI1A 3OYIA 2RQQA 1F36A 1QZZA 4HZFA 2VQLA 2FMYA 2CG4A 2HFHA 3F8MA 4I0AA 5KAFC 3T8TA 4U87A 2STWA 4BEHA 5J4YA 1H0MA 1LJ9A 3IWZA 5DTDA 2CU7A 1UAAA 4OINF 2X85A 3K70C 1BOBA 3CC4I 4IHTA 2UWMA 1MBJA 2DLLA 2BOLA 2HYGD 4JK1X 5KVRA 4C30A 1REPC 2XGDA 1WKMA 4NC8A 2MYSA 5DEQA 4Y13A 3RQIA 5GAGJ 1EV7A 3LAJA 3CUOA 2ESHA 3JRIA 1JTYA 4ABZA 3H92A 2EZHA 1LPQA 2LSOA 2Y2ZA 3M8JA 3H3UA 5D8KB 1FBUA 2CSOA 2M87A 4HNUA 4R79A 2KDOA 5IP9J 3FIWA 2R7SA 2YX7A 3WG7H 3T8RA 1TWHJ 1FOKA 4MO7A 2JZYA 2LKSA 3KEOA 3WGIA 2MD0A 3ECHA 4P5OA 1U2WA 2WB1N 3HSFA 3JR9A 2JSCA 2KIUA 4XRMA 2OCEA 3F0CA 3B6AA 2O9LA 3KYCB 5JFRA 4A93J 3EYYA 2HYJA 4M3BA 5K7HA 5ILUA 3JRCA 2X6XA 1TNTA 2CUFA 1U0JA 5E8GA 2HYFA 3FWEA 2H8WA 3KEQA 2YX4A 2XASA 1IN5A 3KZIC 5DUIA 1X1PA 2H27A 3QU3A 2IAIA 4W1UA 3IKTA 2P5KA 4GYIA 3QP6A 2RNGA 2H6BA 3FHZA 4E7LA 4CCLA 2LBFB 1K83J 3OYKA 3PUBA 2R7DA 1IF1A 4N4OB 1SFUA 1H89C 1J9IA 2V1NA 2GZWA 4YIRX 3CO7C 1XDUA 3HSEA 4EJUA 3OYBA 1RUOA 2P81A 2BW3B 1WJCA 5ICCA 3K4KA 1GXPA 4IQ4A 2DCEA 3SFIA 1QPMA 2LY2A 3I54A 1JE8A 2XF7A 4CSWA 2EBIA 1FEXA 3NAUA 2PBIA 4UUSB 3HHGA 1NHAA 2E34A 4UXNA 1UMQA 3VYSB 1AWCA 2R0QC 4BJ5C 4L0ZB 4FHTA 2V7FA 1EF4A 1E0EA 5J1UA 4ITVA 1IUFA 1BC7C 3QU6A 3BJOA 3A01A 1Q1VA 4WWCA 3TEDA 2CGPA 1HXDA 3JAMZ 4BDYA 3W6KB 2MH9A 4M6VA 5HLTA 4JBAA 3KPHA 4A3DJ 5HDGA 5E79C 3L2UA 4BUPA 5JHUA 1IG7A 3CP8A 5E1ZB 1BBYA 1U8RA 2RKHA 3VDXA 1TNSA 2HQNA 4BXUA 3R0JA 5LLQA 4LITA 5F27A 1EA3A 3LQRA 2KT0A 3FMSA 2M1BA 3GO5A 4N9IA 4D1QA 2VLAA 2G9WA 2X1DA 1FIAA 4BS9A 1TWCJ 1WJAA 2KISA 3ROUA 4M9SA 1WJDA 2NOGA 3HL2A 3RZDJ 4RGRA 2XHKA 2DBBA 2VJJA 4P55A 2M5WA 2Y0MA 5K5RA 5D4RA 3VYUB 2YU9J 2CW8A 4ZJZA 1FSEA 2EA2A 4AYBA 4C9YA 5CVIA 1A6IA 3CESA 3Q5FA 3GLLA 1MSEC 3ABTA 1XGSA 4Y33A 2CS3A 4BXFA 4OAZA 2VBWA 3KZZA 2ZKZA 4U7BA 2AQEA 1AHDP 2XB5A 1B8IB 4UV9A 1S3JA 4R8HA 3OOUA 1SFOJ 1ZKGA 2K9LA 5A2QZ 4FQGA 3QYFA 3OV8A 1B72B 3AL0C 3G2BA 4MQVA 1R5ID 1S7OA 2K9NA 3EETA 2IT0A 4IEJA 4BL0B 3FZVA 4A0XA 3I4NJ 2VKHA 2E1OA 3TQNA 4LLGF 3OYEA 1Y6IA 3K1PA 2HDCA 2Y48A 3BR2A 4L9VA 4AVPA 1LE8A 4EM1A 2M2EA 3TGNA 4MFEA 4AIHA 4BEHB 1QU3A 2HQRA 3OSGA 2BBYA 1YO5C 2P7CB 2DO7A 1U5TA 3FDYA 3DQVC 3O2PE 3RPUA 3L7WA 4M74A 1GDTA 1XGOA 2DJNA 2LDUA 4R1HA 4BGDA 1XTAA 3FXJA 3H9JA 3E3VA 3ZMDA 1P4AA 1Z21A 2QQAA 4EVIA 5AIPA 2N8GA 5CVJA 1SEUA 3N4MA 2FNAA 1RI7A 1RPWA 2L01A 2WAQA 3L00A 2A69F 4UVBA 3LL7A 2ZO4A 3VYTB 2W25A 4RMNA 4ESFA 2QKMB 1Z05A 2K40A 3HC7A 2IA0A 2EH3A 2FOWA 3RKYA 1WFXA 2E2HJ 3JCUC 2UV1A 3LA2A 3EQLF 3JTHA 4U88A 2JT1A 2H1KA 1ETXA 4KIBA 2OTLI 2QUFA 3GEZA 2M0CA 2HOAA 1IRGA 3D5RC 1B1BA 3QODA 3J7ZI 2L0KA 1RUNA 2QEXI 3F8CA 3NWSA 4OIOF 3DKWA 2OD5A 4LB5A 3S3OA 3HJEA 2XAQA 1G3WA 3GUDA 3HHHA 1CGPA 2EV6A 4I99C 2VI6A 1ZHFA 3EPZA 3Q9VA 3BPVA 3C2HA 4FE7A 5IT3A 1CQTA 3RYPA 2DW4A 2XF5A 3U1DA 2DT7B 1LVAA 2MA3A 2IEKA 2R7RA 3HOVJ 2K3PA 1T08B 3WHBA 4UB8C 4XORA 3WTTC 5FKMA 4MHGA 1ETVA 2G7HA 2LREA 1ZTRA 4GGGA 2L9VA 2VJ5A 4PDKA 5F0CA 1A04A 1QQIA 4WX9A 4HLYA 1PJRA 4GO1A 4ZH4F 2X6OA 4GCVA 4ESBA 5B3SH 1SD7A 3REOA 4A5MA 5ED4A 4DBQA 1UJ8A 4FT8A 4KYWA 1JUSA 3QPTA 4KT6A 3WTUC 4FCYA 1IN4A 4KJZA 5EEAA 1TQMA 3I53A 4FX4A 5EYRA 1PP8F 2AXLA 4XLCA 1WPKA 5E3LA 2EQRA 3W6JB 1IJWC 2V6CA 4I6ZA 1X58A 3SHFA 1R1UA 4BE1A 4EATA 4BJ6C 2Z16A 1TL8A 1A36A 3A01B 2JQ7A 2PMUA 3SFZA 4A0ZA 3PQKA 3HOWJ 1DPRA 1X1CA 1DUXC 5HLGA 3E5UA 4LOCA 1P7IA 1O7FA 5B1BH 2KJCA 4F7ZA 1TQIA 2IGNA 1V5EA 1R4MB 1Z3YA 1GLNA 3S2HJ 2L7ZA 3JREA 2D1HA 1HDDC 3OYCA 1YX3A 2I5UA 2OC6A 5LHIA 2ZSIB 5CQEA 4L0YB 2EZIA 1Y8QB 3HXLA 3DXJF 5H2FC 1JJ6C 3WU0A 2L5QA 4BACA 4IRHA 5C3EJ 4HV6A 3ZQGA 1E2XA 2B7EA 1W7PA 1TZLA 4PFOA 3IH2A 3KYDB 4BE0A 3CMAI 4PJMA 5AIQA 3KP3A 1HBXG 3GFJA 3AL0B 2F4IA 2VC1A 3M1CA 1USSA 3BG5A 3M07A 5B66C 1WHUA 4QPQA 4PUSA 1OCRH 1XD7A 3GVAA 1BI0A 1UFMA 2Q8KA 4UUVA 2VUMJ 1DPUA 4JX6A 1XG1A 3Q9SA 4MGRA 3ZMZA 2KRHA 1H8AC 2QZ8A 4V2GA 2DT6A 1P4XA 2R7TA 3KLOA 3RKWA 3PJRA 1P9QC 2DQRA 3P7NA 1Z3XA 2QCOA 1D8JA 1Y1VJ 2M7BA 1OR7C 4XQFA 3CJRB 1LNWA 1X1AA 2F6CA 4B48A 2OU2A 3CUQA 5CLSA 4O3MA 3VOEA 2VODA 1I50J 3D1NI 1S9HA 4YFXF 2J5OA 4HQMA 1YHQI 2MGQA 5H20A 1RKWA 4EJTA 3GFLA 2WY7Q 3I58A 2XF6A 4PK4A 4JQFA 1E3HA 1G3SA 2OV7A 1PYVA 3H5RA 4RAZA 5B1AH 4MQ9F 3J80Z 1OCCH 2H1LA 5DV5A 2L9NA 2DK5A 1KQ8A 1HW5A 3QOEA 4IZZA 5F08A 3GZNB 1LFPA 3TW7A 3OOPA 4YIIA 3IKVA 3ABUA 2A5YB 1X1BA 1K4SA 1JUPA 1LDJA 2DA6A 2CH0A 3CUQC 2F5CA 4EJVA 3CLOA 3FM5A 4U7DA 5E3OA 4RGUA 3M1EA 1R58A 1XC5A 4HF2A 2AO9A 3J7AO 3DBRB 3LQQA 4FETA 2WC2A 1MDMB 1C0WA 1IDZA 2EJRA 3BTJA 4L5JA 1D1BA 1TT0A 4G6QA 4XMYA 2CJJA 4DW6A 1MJ9A 2QSGX 2VT2A 3KP5A 4XOTA 3GYHX 3WE2A 5CJ9A 1BL0A 3HKZA 2A3SA 4CICA 1MJBA 3W2WA 1IGNA 3LOCA 5J1YA 3GTOJ 3CDHA 1P7JA 1B59A 2AS5F 1X1DA 1FMWA 2DK8A 1P4WA 1TW3A 2ELHA 2IGKA 5L3CA 4D5FA 4IOAF 2NYXA 3K9TA 2OZ6A 5L3GA 3B02A 3A02A 1V55H 2KIQA 3CZ6A 2PG4A 3I5UA 2JRTA 4BHBA 3VFZA 2WWYA 4I09A 5IYDJ 3PL8A 1Z1DA 2Q1ZB 4Y52J 1Z91A 2NS0A 2A6TA 4HPQA 2TRTA 1EH6A 1EKEA 3HB9A 2DJIA 2JTVA 5FRMA 3VODA 2H8RA 3B6CA 2ADUA 4BJTA 1HLVA 1GT0C 4F3QA 1MMGA 3HUGA 5EEGA 4M3GA 3OY9A 3QWLA 3TO6A 2FXAA 3OIPA 4DZJA 2B63J 1ITYA 4Y4RA 2M8GX 2MG4A 4ZYEA 2X9DA 3M9AA 2CV2A 3TP0A 3TDUC 3QOPA 4L18B 2Z99A 2DA5A 3WTVC 1K7AA 3K4MA 3FXMA 1F1ZA 1X3UA 4DIQA 3IRQA 2PEXA 3LMMA 1Y39A 2Z33A 4QTRA 3KP2A 1U78A 3TOAA 2IW5A 2LKXA 1YJWI 4CDGA 3CLQA 5E1WA 1X2NA 4AIKA 5DS9A 3T5XA 4PGHA 1J2XA 2HWVA 2V4JC 3MCZA 4G9YA 3OYHA 3CC7I 2VC0A 3OIOA 3G1OA 1IN6A 2VJIA 2F48A 1SD6A 2OQRA 3KIOA 1G3TA 4Q4ZF 1JXSA 2XGCA 4HG2A 3S17J 3F72A 3OYDA 2QLZA 1ZG3A 2MD5A 4BY1J 4IX7A 4XRFA 2M45A 2GM4A 2HKXA 1R4NB 4O5VA 1B9MA 3CO6C 2CO5A 2JA5J 4CYDA 1D1AA 1YIOA 4ZDOA 3I0TA 3N05A 3PFIA 2YSRA 4OIPF 1TC3C 2MABA 3MEXA 5FKKA 2L9SA 4XKWA 4ESJA 3JTGA 4NDLA 4DNCA 1W7PB 1SVLA 4IXAA 2VKVA 3OWTA 3DCFA 4IQJA 1MNDA 2K7LA 2EV0A 3HOXJ 4XICA 1DGRM 1FY7A 2UUZA 3MVPA 3DBHB 2P6TA 2CQNA 1ON2A 2EFPA 2GAUA 2X1EA 4N4NB 2QKLB 2OJED 3IAM2 1D5YA 4AC0A 5K7FA 6PAXA 2O8XA 1ORKA 3C2BA 4IPAA 5DM6F 1BIBA 2K4JA 5H6RA 3GLXA 4G8XA 4RAYA 5HLHA 3U2RA 2HU9A 2J5PA 1ZH5A 3J81Z 3IV5A 4WCGA 4OMZA 4X1EA 1UZCA 2A61A 4KN7X 1RZ4A 4G94A 1VQNI 3CUQB 4P96A 2BEOA 3G1LA 4EV0A 2Y75A 5HLIA 1UHMA 3AG1H 3BZCA 2CFXA 1XN7A 3S8PA 3ERED 2EIMH 2QA4I 3JRGA 3DU6A 3S3MA 5HVQC 1SD4A 3BG6A 4M9XA 3OR2C 5IOZA 3HZJA 3H9GA 3C3WA 4HYEA 4XLAA 5DD8A 4C3IJ 3IRRA 2OPTA 2OCCH 1A5JA 2ZJQF 2XGEA 4HBLA 4XL9A 4CGZA 2NS7A 1TP4A 2CWEA 4FE4A 3GW2A 4ZYHA 3VWBA 1YJ9I 2BXZA 2EILH 4V2FA 1WZ2A 2BZTA 3H3VK 3ONQA 3AG3H 1FP2A 2HQAA 2DPUA 3WTZA 2FRHA 3MWMA 4D9JA 4EJWA 3LAPA 1VF9A 4LFUA 4UV8A 1ZGAA 3TP3A 2HVSA 1RETA 2BXYA 2HDDA 1J0RA 3J7YJ 3CJNA 1IN7A 3KP7A 1D3YA 4HAMA 3U9GA 3K2ZA 5JHFA 1WH5A 2LD5A 4N0BA 4L9NA 2XKPA 4XN0A 1XSXA 4XONA 2W00A 4IL6C 1ZG5A 1FT9A 3PSIA 2R5ZA 5M5WJ 3HTSB 4KUMA 4OAYA 1R1VA 2VONA 1IXRC 1FTZA 2GIVA 2M0MA 1JI8A 2KFDA 2PMZN 4KT5C 1V3FA 2C6YA 3M8FA 3H36A 2FNPA 1STZA 3OYLA 4ANJA 5BNGA 1ETQA 3SDBA 5JVTA 4RA2A 1LFBA 3DTEA 3VYRB 1K79A 1ZRCA 4I0BA 2HNHA 3QPSA 4JX5A 3RTRA 3HUGB 5CPRB 3L09A 1JHFA 2ZJ2A 5DCFA 1MH4A 2XVCA 2HXIA 3FKIJ 3HOYJ 1MW7A 2F5EA 1IRFA 1YS7A 3DEUA 4IVNA 4HQEA 1CF7A 1MNMC 2ZJRF 1TTYA 1J09A 3ZMUA 5EDNA 2R4GA 5F04A 3S3NA 4RM3A 4CCJA 4MTDA 4EMSA 2JUCA 2DAOA 3CMMA 3DPLC 5E3MA 2PX9A 2FE3A 2K3FA 2E60A 2O3FA 2P4WA 1D0YA 5FB2A 1X19A 2X6WA 4RGXA 3TOBA 2ZB9A 3PM1A 2KMUA 4PJJA 2R7VA 4PCQA 1BJZA 3WODF 2TCTA 4HEA2 4XSZF 1MD0A 2M7AA 1OFCX 3GCMA 3KX2A 4E7KA 1GUUA 3SZTA 3RDIA 1XPXA 2HR3A 1I3QJ 1FIPA 2GIZA 2OTJI 1TWAJ 2OZUA 1VQKI 1MMSA 1S7AA 1YW8A 2EINH 2F4OB 5FO5A 1QA6A 3PFYA 1S29A 4D0PA 5F6FA 4RDUA 2K9SA 4KISA 1F4KA 1T95A 1MGTA 3PNYA 3F6OA 4X6AJ 1YI2I 1HDPA 2Z1DA 2VL8A 4BAYA 3B73A 1R36A 2KL4A 2ZFWA 2DOFA 1DU0A 4XLPF 3EUKL 2BY0A 2HDWA 2DFHA 3L9FA 4M71A 1IV6A 4XK4A 1YE9A 3BT9A 2X0LA 2QQBA 4A6EA 1LQ1A 1F9NA 1U9NA 4GRIA 2L2OA 2M4KA 2W84A 3VB2A 5IYCJ 2A07F 2DXIA 2KLOA 1R49A 1Z77A 2G0EA 5FGMA 4Y7NJ 1ONVA 4RB0A 1QZYA 2KPMA 4L9TA 1ZAOA 1Z0XA 2O7OA 3ABMH 3H35A 3RPQA 4DYCA 2PJRB 1R22A 3HKZN 2RQPA 3IAS2 3EDPA 1ZARA 2NS8A 2CUEA 3LSJA 4PJNA 1IC8A 1Z7UA 4ZTFA 3K4NA 4LK0F 1RR7A 2XROA 4Y15A 1OYIA 1L0OC 3ZPLA 1HOMA 3ESWB 4I98B 4ZTJA 2FEZA 2QWWA 2VB6A 4C3HJ 3RKQA 3FXOA 5IT9Z 2EK5A 4KNYA 2ZXHA 2ZNZA 4IKFA 3CJTB 2DT5A 4OWRB 1ZELA 2K85A 2UZKA 5F1JA 2XAFA 3TW6A 2P8TA 4RB1A 3A03A 2HZDA 4B4CA 1V54H 4G12A 1YG2A 2JMWA 4ZYGA 4MTEA 3BZ6A 1MIJA 4M6XA 3GTMJ 3NARA 1ZK8A 3OSFA 2ACJA 1FBQA 4XRSG 3I64A 3TKYA 3U1KA 4Q48A 1KQ9A 2I10A 2VKEA 2ELJA 4J01A 2VBYA 4A3GJ 1OYYA 1X4PA 4L5IA 5FFXA 4A3LJ 4ZZLA 5FLXZ 4ZYDA 1ZLJA 2BGCA 2P6SA 2VPRA 4D5CA 3AAFA 4EGYA 4BBRJ 3CDIA 3DFGA 3I55I 1MMNA 3LFKA 1JHHA 3DKXA 3GFMA 1R5GA 3G6EI 3GTGJ 1FMVA 2R5ZB 4HF1A 3MKWB 1H9TA 1AKHB 1MDMA 4XBFA 3JSPA 2CQKA 2DTZA 1K6OA 5F1RA 3CMYA 3CCUI 4E6KG 3JRBA 5CKTA 1XMAA 5GTIC 4MLOA 3P9KA 1ERDA 5D6EA 2E2IJ 2E1CA 4M3EA 5HNFA 1HA8A 2MLGA 2QYOA 1HQCA 1KGSA 5LRRA 4ENMA 4LG3A 4XKBA 3S1MJ 1GXQA 1QVUA 3L2WA 3FXQA 3BWGA 5KHDA 3F8FA 3R4KA 3GTLJ 4ZDPA 3K4BA 2KQRA 3S2WA 3S15J 1FYKA 3NEUA 4ENJA 4E7JA 3ZOBA 1AU7A 2XKOA 1CF7B 3SZGA 2L4AA 2WA0A 5BQTA 3E1SA 1ACIA 4D7NA 4HX7A 3CCQI 4HF0A 4CCMA 2QQ8A 4JYKA 2CMPA 1B9NA 1IXSB 2KKOA 2BY1A 1U8BA 3BP8A 3FXUA 3H9QA 2GQQA 2YUSA 3MZ8A 5IYBJ 2K9QA 4IHVA 1VQ5I 3V4GA 1YTYA 4CCNA 2DYRH 2PFBA 2XAHA 3IWFA 5HS7A 4KFCA 5J40A 3V8LA 2LFBA 3BR6A 2MSYA 2PMHA 1P6RA 2KIMA 4LIUA 2MW8A 3TO7A 3G73A 4H0EA 5J8CA 4HLXA 3TBIA 1QHHD 4XNFA 1D0ZA 3IL2A 1X3ZB 3ASNH 3ERMA 2X6YA 1QHGA 3Q0UA 4AM3A 2E35A 4E7ZA 1RR8C 3A0HC 5FROA 3ZMSA 4F92B 1F43A 3O8GA 2F5FA 2JWTA 3JAMK 4DGWB 4Q47A 2WAFA 3NWTA 3WU1B 1VQOI 2EZLA 2RVCA 3HIFA 2NOJB 3VSKA 2DOEA 4WK8F 2V79A 5D5XB 3DWLE 2EWNA 2LG4A 4CUGA 2WV0A 4BQNA 1EJ9A 1SD5A 2GLOA 4A12A 3JRFA 4UY8I 2KHMA 4A3FJ 2JA8J 1POGA 3ZQIA 3FM3A 3HM5A 1JKQC 1FOXA 3ECOA 2F5DA 1W36D 1MH3A 2MLKA 4P1WA 2NVTJ 4Y17A 3ZN0A 5LHGA 2NRAC 1OR7A 2HOEA 3DTKA 5LEKA 1WWXA 2R92J 5DDGA 5HODA 1W36C 1SANA 2E36A 1FOWA 1XSDA 1W0UA 2ZBKA 4V19K 5EGOA 3W2AA 2P0WA 4XLEA 1I5ZA 3IH4A 1G8XA 3QYBA 3BTCA 4NNJA 3GTQJ 2K27A 1E17A 4BY7J 4G7ZF 4CYCA 1KU2A 1V4RA 5LGUA 2K9MA 1OCOH 3SZPA 3TDZC 3S14J 2ZC2A 5EJCA 5A2QK 4K2EA 2IJLA 3W3CA 2STTA 2F5VA 5LD2C 3RZOJ 4LD5A 1BI3A 4UHTA 1SC7A 3KFWX 1P2FA 5KK1A 2DA7A 3DEWA 1J7KA 4RM2A 4KIFA 1TLHB 2VKDA 3CDLA 3ZQQA 1HKQA
chains in the Genus database with same CATH topology
2IP2A 2JPCA 3K0LA 4RS8A 3RI4A 1FWZA 2QBYA 3EYIA 1U6GA 2FMLA 3COAC 4BYYA 4HV5A 2V9VA 3HRSA 1HKSA 2FBIA 1D8KA 1R00A 4O6JA 1R7JA 3QPHA 3RKXA 4A6DA 1QGPA 2MC3A 3BROA 4AIJA 5FFZA 1BN5A 4S04A 1WI9A 1HKTA 3BJ6A 4MNUA 1SMTA 3LSTA 1I1GA 2W24A 3WE3A 1J59A 2JPBA 5D5VB 1S8NA 5ERIA 4HDVA 1GVJA 1FX7A 2D1VA 2YPRA 3MZYA 2HTSA 1RNLA 3JSOA 4IJAA 1T98A 4S05A 3KLNA 3BOQA 4DQ2A 1T6SA 4OIRF 4G7OF 1I27A 2VOOA 1J75A 1YS6A 5L3DA 2GXBA 3H3ZA 2FA5A 1Z9CA 4CXFA 5D8LB 3LA3A 2FU4A 4P9UA 5D5UB 3R6SA 2GWRA 3ML6A 3BPXA 5ILVA 2XAGA 1U3EM 1G6NA 1Z6RA 2WTEA 2LNBA 3T0YA 2IA1A 3C1DA 2FF4A 4B09A 2VE9A 2GA1A 2A6EF 1T39A 4LG0A 5TRDA 2P5VA 2QENA 3E6BA 1O57A 2EFWA 2P5LC 2D2WA 3O3KA 1O3QA 2ETHA 3ISPA 3F23A 1ZN2A 2O61A 1PUEE 2K4BA 3HYIA 3R60A 1RIOH 1F5TA 1T2KA 5L3BA 3L2CA 4I2OA 1I6XA 2MBFA 1LDDA 3C7JA 3WTYC 4KDPA 2KRFA 2PN6A 5BPIA 1YQAA 3V7SA 1DDNA 5CVVA 1W4MA 2H09A 1I1SA 5DCMA 4ZZDA 5D6FA 2UXNA 3N97A 2XAJA 2HKOA 2VXZA 1XSVA 2TDXA 2E7XA 3I71A 4LLNA 2DFIA 1PDNC 2W85A 1JGSA 5L3EA 4ENKA 4A0YA 4IRIA 1FP1D 3GX4X 3J80K 2QBYB 4OU0A 1ODDA 1Y0UA 3WTXC 1ZLKA 1WSUA 1DP7P 2NNYA 4LLLA 3ZQ7A 2XUBA 3G3ZA 1OPCA 3ZP5A 1R23A 1L3LA 4IRGA 1O3TA 2ISZA 1XGNA 1XMKA 3FMQA 1IAWA 2DQLA 2H94A 3ULQB 2OA4A 5DYMA 1SFXA 3V8JA 1W5TA 4HW0A 4GYGA 1T38A 2DTRA 4KMUX 1K78A 3RJPA 2BYVE 1BJAA 4LMYA 3HRMA 1J5YA 3GZ5A 4AWXB 3GFIA 2UXXA 3MQ0A 1LDKB 3K69A 2M30A 3QP5A 5LEJA 3V7RA 4OMYA 2LF7A 5TJJA 4B8XA 3IHUA 1P92A 5LGNA 1HSJA 4ENNA 5D4SA 1IUYA 4I02A 5LHHA 1MZBA 1FSHA 2FSWA 4U0VA 4UVCA 4YFNF 1TW2A 1SAXA 1XDSA 2XIGA 2RV8A 5ILSA 4P9FA 3KE2A 2FQ3A 4WF2A 2XGXA 4LG0B 3WTSC 2A68F 5DD4A 4MEXF 3WGHA 2ZXJA 1HW1A 2M8EA 2HEOA 5BMZA 1UCRA 4FX0A 3F22A 2ISYA 4L9JA 3E6MA 1KYZA 2DPDA 1BOAA 2ZMEA 4OIQF 4RGSA 2DI3A 3M8EA 3DPTA 5LBQA 3WTWC 5E17F 3BY6A 5E18F 4M73A 5CVRA 5D5WB 3CTAA 1MKMA 3R61A 3T1BA 1ZG1A 3M7GA 2ESNA 2F2EA 3J81K 2QM3A 3E6DA 5DCMB 5K1YA 2R3SA 1TQPA 1YYVA 1QO0D 1OMIA 1FNNA 3F8NA 3SQNA 4AD9A 3FXRA 1KU3A 3F21A 4QWQA 1B4AA 3MFKA 5H6QA 2Z3YA 4GXOA 5K5QA 4I01A 1O7LA 1YW9A 3HSRA 1OYWA 3LA7A 4HDUA 1VTNC 4EQQA 4WXDA 2BV6A 1HW2A 4M6YA 4N9HA 1SFEA 1FPQA 2GXGA 3KZYA 1G3YA 3R0AA 2HGCA 2RGVA 1FYMA 3V8KA 3IC7A 1OKRA 3HOTA 3I4PA 3HTUA 3JW4A 2IRFG 2FBHA 4U0WA 2KJBA 3SXYA 1KA8A 2IA2A 2QQ9A 2K86A 1KU7A 1YLFA 2YR2A 2W57A 1WQ2A 2E1NA 3MZHA 1K78B 3NRVA 4LB6B 4M9ZA 1YW7A 5K5OA 4G6DA 4YG2F 2KIFA 4U0YA 4WXHA 4LGWA 2XV4S 1TBXA 2NAZA 2L4MA 5FD6A 2RDPA 3ELKA 4HX8A 2VT3A 3NQOA 2R7FA 2V1DA 3TO9A 1WRJA 3KP4A 1U5TC 2PQ8A 3DP7A 5FD5A 1PP7U 2XRNA 1ZREA 1R5HA 4KA4A 1BIAA 3LWFA 4XSXF 5BS6A 4LK1F 1XGMA 2LF8A 4CO8A 1ZGJA 3E5QA 4HX4A 3F8BA 4KN4X 4ASNA 1O3RA 2OQGA 2PI0A 2VBZA 1IZ1A 1FZPB 4NB5A 3K1NA 3FX3A 1SMYF 4BHPA 5HDKA 3RYRA 2PLYA 1BI2A 4ON0A 2FBKA 5ICEA 2RC4A 2ZMEB 1YFHA 4BH9A 2GA2A 5CVUA 3VEPA 4PGGA 1FC3A 1G4DA 2Z9OA 1HSTA 3KETA 2EA4A 1FYLA 4QLCU 2K02A 1O3SA 3I59A 4OOIA 3MAJA 2OBPA 1S6LA 4KMFA 4MEYF 2H6CA 5HS9A 4NHJA 2VN2A 1KU9A 5HDNA 1ON1A 4E70A 1KYWA 2V1XA 4EJOA 4LJZF 5IT9K 3PQJA 2PJPA 1EH8A 5BOXA 4BHCA 3FF5A 1W7PD 2IVMA 4BQAA 3RIRA 4CZZA 3GWZA 3WGGA 2D45A 3QAHA 5LGTA 5FLXK 1UHWA 5DUKA 4EGZA 2O6GE 2EB7A 1ZRFA 4A5NA 1LEBA 1XCBA 1XCVA 2VE8A 3BDDA 5HOOA 1ZRDA 1GHCA 4TV7A 1U5TB 1ZYRF 4IHSA 1EH7A 2Z5UA 4NQWA 3P9IA 4ETSA 2X4HA 3D5LA 3KCCA 3ZMTA 1IW7F 1UB9A 4EM0B 3DV8A 4Z2YA 1LB2A 5E1XA 3GZ6A 3F6VA 1Q1HA 4PZJA 2ZCWA 2LKPA 1IN8A 5L3FA 4KICA 5J8FA 2P7VB 5HS8A 4G7HF 3GXOA 3QRFF 2EFNA 3FMRA 2G7UA 2B0LA 3F3XA 3DF8A 2IPQX 5JR3A 2L3DA 2A6HF 4WXCA 2DU9A 2YU3A 3P9CA 2O03A 2CYYA 3ZMVA 4RB2C 5BPDA 5EEHA 3D0SA 2O0YA 1Z6TA 4HOBA 1LEAA 2FOKA 1W5SA 3HRUA 5CYVA 1MJAA 5E20A 3E6CC 4RB3C 3HRTA 3WG9A 1FLIA 4KIGA 3E5XA 2VOPA 2V1UA 2L02A 3I59B 4I7HA 2RN7A 1IXCA 1T0FA 2HTJA 4A2UA 2Q2EA 5ICGA 2E7WA 2L54A 1XB4A 4UNOA 4HA8A 5E8IA 4IF4A 4Q5SF 1BM9A 4YFKF 3GF2A 2ZNYA 4CHUA 3V7CA 1AOYA 3K1MA 3EUHA 1FBSA 5LRSA 1BC8C 2EV5A 2BE5F 4BNCA 2HZTA 2MH2A 1QNTA 5J6XA 3KP6A 3O6BB 2HS5A 5AONA 5F64A 1ULYA 2COMA 1USTA 1H9GA 2CW0F 4UVAA 2RNJA 1KQ0A 2NNNA 4YIFA 1R1TA 4XLNF 3BJAA 4EM2A 2QVOA 3ZN1A 4M72A 2EFQA 2OAZA 5ICFA 3E97A 2VBXA 1B6AA 3C18A 5JI6A 2EFOA 2Q0OA 3HOSA 1QBJA 1D5VA 1BI1A 1QZZA 4HZFA 2FMYA 2CG4A 2HFHA 3F8MA 4I0AA 3T8TA 2STWA 1H0MA 1LJ9A 3IWZA 4OINF 4IHTA 2UWMA 2DLLA 2HYGD 4JK1X 5KVRA 1REPC 1WKMA 5DEQA 4Y13A 1EV7A 3LAJA 3CUOA 2ESHA 3H92A 2LSOA 3H3UA 5D8KB 1FBUA 2CSOA 2M87A 4R79A 2YX7A 3T8RA 1FOKA 2JZYA 3KEOA 3WGIA 3ECHA 4P5OA 1U2WA 3HSFA 2JSCA 2KIUA 5JFRA 3EYYA 5ILUA 5E8GA 1TNTA 2HYFA 3FWEA 3KEQA 2YX4A 2XASA 1IN5A 5DUIA 2H27A 3QU3A 3IKTA 2P5KA 4GYIA 3QP6A 2H6BA 3FHZA 1IF1A 2R7DA 1SFUA 1J9IA 2GZWA 3CO7C 1XDUA 3HSEA 4EJUA 1RUOA 5ICCA 1GXPA 1QPMA 3I54A 1JE8A 2PBIA 3HHGA 1NHAA 4UXNA 1AWCA 4L0ZB 4FHTA 1BC7C 3QU6A 3BJOA 4WWCA 2CGPA 1HXDA 3JAMZ 3W6KB 2MH9A 4JBAA 5HDGA 5JHUA 5E1ZB 1U8RA 1BBYA 2RKHA 1TNSA 2HQNA 4BXUA 3R0JA 5LLQA 3LQRA 4N9IA 3FMSA 2M1BA 3GO5A 2G9WA 3ROUA 4M9SA 4RGRA 2XHKA 2DBBA 4P55A 2M5WA 2Y0MA 5K5RA 5D4RA 1FSEA 2EA2A 5CVIA 3Q5FA 3ABTA 1XGSA 2VBWA 3KZZA 2ZKZA 4U7BA 4UV9A 1S3JA 4R8HA 5A2QZ 3OV8A 4MQVA 1S7OA 3EETA 2IT0A 3FZVA 4A0XA 3TQNA 4LLGF 3K1PA 2HDCA 2Y48A 4L9VA 4AVPA 4EM1A 3TGNA 4AIHA 2HQRA 2BBYA 1YO5C 2P7CB 2DO7A 1U5TA 3O2PE 3DQVC 3RPUA 3L7WA 4M74A 1XGOA 2LDUA 4R1HA 3E3VA 3ZMDA 1P4AA 2QQAA 4EVIA 5AIPA 5CVJA 3N4MA 2FNAA 1RI7A 2L01A 3L00A 2A69F 4UVBA 2ZO4A 2W25A 4ESFA 1Z05A 2IA0A 3RKYA 3LA2A 3EQLF 3JTHA 4U88A 2JT1A 4KIBA 2QUFA 3GEZA 1IRGA 1B1BA 1RUNA 3F8CA 4OIOF 3DKWA 2OD5A 4LB5A 2XAQA 1G3WA 3GUDA 3HHHA 1CGPA 2EV6A 3Q9VA 1ZHFA 3BPVA 5IT3A 3RYPA 2DW4A 3U1DA 1LVAA 2MA3A 3WTTC 4MHGA 2G7HA 4GGGA 4PDKA 1A04A 1QQIA 4WX9A 4HLYA 4GO1A 4ZH4F 4GCVA 4ESBA 1SD7A 3REOA 4A5MA 5ED4A 4FT8A 4KYWA 3QPTA 3WTUC 1IN4A 1TQMA 3I53A 4FX4A 1PP8F 2AXLA 3W6JB 2V6CA 3SHFA 1R1UA 2PMUA 3SFZA 4A0ZA 3PQKA 1DPRA 1DUXC 5HLGA 3E5UA 1O7FA 4F7ZA 2KJCA 1TQIA 2D1HA 5LHIA 4L0YB 3DXJF 3WU0A 4IRHA 4HV6A 1E2XA 1W7PA 5AIQA 3KP3A 1HBXG 3GFJA 2VC1A 1USSA 1XD7A 3GVAA 1BI0A 1UFMA 2Q8KA 4UUVA 1DPUA 3Q9SA 4MGRA 3ZMZA 2QZ8A 1P4XA 3KLOA 3RKWA 2DQRA 3P7NA 1D8JA 1LNWA 2OU2A 3CUQA 5CLSA 4O3MA 3VOEA 2VODA 4YFXF 2J5OA 4HQMA 5H20A 4EJTA 3GFLA 3I58A 4JQFA 1G3SA 4RAZA 4MQ9F 3J80Z 5DV5A 2DK5A 1KQ8A 1HW5A 3OOPA 4YIIA 3IKVA 3ABUA 2A5YB 1LDJA 3CUQC 2F5CA 4EJVA 3CLOA 3FM5A 4U7DA 4RGUA 3M1EA 1R58A 4HF2A 3J7AO 3LQQA 2WC2A 1MDMB 1C0WA 2EJRA 4L5JA 4G6QA 1MJ9A 2VT2A 3KP5A 3GYHX 3WE2A 5CJ9A 2A3SA 4CICA 1MJBA 3CDHA 2AS5F 1B59A 2DK8A 2ELHA 1P4WA 1TW3A 5L3CA 2NYXA 3K9TA 2OZ6A 5L3GA 3B02A 2PG4A 3I5UA 2JRTA 4BHBA 3VFZA 2WWYA 4I09A 1Z1DA 1Z91A 2NS0A 1EH6A 2JTVA 3VODA 2ADUA 3HUGA 5EEGA 3TO6A 2FXAA 4ZYEA 3M9AA 3TDUC 3QOPA 4L18B 2Z99A 1K7AA 3WTVC 3IRQA 1F1ZA 1X3UA 2PEXA 2Z33A 3KP2A 1U78A 3TOAA 2IW5A 4CDGA 5E1WA 4AIKA 3T5XA 4PGHA 1J2XA 2HWVA 4G9YA 3MCZA 2VC0A 1IN6A 1SD6A 2OQRA 1G3TA 4Q4ZF 1JXSA 3F72A 2QLZA 1ZG3A 2MD5A 4XRFA 2M45A 2HKXA 4O5VA 1B9MA 3CO6C 2CO5A 4CYDA 1YIOA 3I0TA 3PFIA 4OIPF 2YSRA 3MEXA 4ESJA 3JTGA 4DNCA 1W7PB 4IXAA 2K7LA 2EV0A 1FY7A 2P6TA 1ON2A 2EFPA 2GAUA 6PAXA 2O8XA 4IPAA 1BIBA 2K4JA 5H6RA 3GLXA 4G8XA 4RAYA 5HLHA 3U2RA 2J5PA 1ZH5A 3J81Z 4WCGA 4OMZA 2A61A 4KN7X 1RZ4A 4G94A 3CUQB 4P96A 2BEOA 4EV0A 2Y75A 5HLIA 1UHMA 2CFXA 1XN7A 3ERED 5HVQC 1SD4A 4M9XA 3C3WA 4HYEA 5DD8A 3IRRA 4HBLA 4CGZA 2CWEA 3GW2A 4ZYHA 1FP2A 2DPUA 3WTZA 2FRHA 3MWMA 4EJWA 3LAPA 4LFUA 4UV8A 1ZGAA 1J0RA 3CJNA 1IN7A 3KP7A 1D3YA 4HAMA 3U9GA 3K2ZA 4N0BA 4L9NA 2XKPA 1XSXA 1ZG5A 1FT9A 3HTSB 4KUMA 1R1VA 2VONA 1IXRC 2GIVA 4KT5C 1V3FA 2C6YA 3M8FA 2FNPA 1STZA 5JVTA 1ZRCA 1K79A 4I0BA 3RTRA 3L09A 1JHFA 2ZJ2A 5DCFA 2XVCA 2F5EA 1IRFA 1YS7A 3DEUA 4IVNA 4HQEA 1CF7A 1TTYA 3ZMUA 4MTDA 4EMSA 2DAOA 3DPLC 2FE3A 2O3FA 2P4WA 5FB2A 4RGXA 3TOBA 4PCQA 3WODF 4XSZF 1MD0A 3SZTA 3RDIA 2HR3A 2OZUA 1S7AA 1YW8A 5FO5A 1S29A 4D0PA 5F6FA 1F4KA 1MGTA 3F6OA 4BAYA 3B73A 1R36A 2ZFWA 4XLPF 3L9FA 4M71A 2X0LA 2QQBA 4A6EA 1LQ1A 1F9NA 2W84A 3VB2A 2A07F 5FGMA 1ONVA 4RB0A 1QZYA 4L9TA 1ZAOA 3RPQA 1R22A 2RQPA 3EDPA 1ZARA 1Z7UA 4LK0F 2XROA 4Y15A 1OYIA 1L0OC 3ZPLA 4I98B 2FEZA 2QWWA 5IT9Z 2EK5A 4KNYA 2ZNZA 2DT5A 2UZKA 2XAFA 2P8TA 4RB1A 1YG2A 4ZYGA 4MTEA 3BZ6A 4M6XA 2ACJA 1FBQA 3I64A 3TKYA 4Q48A 1KQ9A 2VBYA 1OYYA 4L5IA 5FFXA 4ZZLA 5FLXZ 4ZYDA 1ZLJA 2BGCA 2P6SA 3AAFA 4EGYA 3DFGA 3LFKA 1JHHA 3GFMA 1R5GA 4HF1A 1H9TA 1MDMA 4XBFA 3JSPA 2CQKA 1K6OA 5F1RA 1XMAA 3P9KA 5D6EA 2E1CA 2MLGA 2QYOA 1HQCA 1KGSA 5LRRA 4ENMA 1GXQA 3FXQA 3BWGA 3F8FA 3R4KA 3S2WA 1FYKA 3NEUA 4ENJA 1CF7B 2XKOA 2L4AA 5BQTA 4HX7A 4HF0A 1B9NA 1IXSB 2KKOA 3BP8A 3FXUA 2GQQA 3V4GA 1YTYA 2PFBA 2XAHA 3IWFA 5HS7A 4KFCA 3V8LA 2PMHA 1P6RA 2KIMA 3TO7A 3G73A 4H0EA 5J8CA 4HLXA 3IL2A 3ZMSA 2F5FA 3JAMK 3WU1B 4Q47A 2RVCA 3HIFA 4WK8F 2V79A 5D5XB 2EWNA 2WV0A 1SD5A 4A12A 3FM3A 3ECOA 2F5DA 2MLKA 4Y17A 3ZN0A 5LHGA 2NRAC 1OR7A 2HOEA 5LEKA 1WWXA 5DDGA 1XSDA 2ZBKA 1I5ZA 2K27A 1E17A 4G7ZF 1KU2A 1V4RA 5LGUA 3SZPA 3TDZC 5A2QK 4K2EA 2IJLA 2STTA 4LD5A 1BI3A 3KFWX 1P2FA 5KK1A 1J7KA 4KIFA 1TLHB 4UHTA 1HKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IP2 A;  2JPC A;  3K0L A;  4RS8 A;  3RI4 A;  1FWZ A;  2QBY A;  3EYI A;  1U6G A;  2FML A;  3COA C;  4BYY A;  4HV5 A;  2V9V A;  3HRS A;  1HKS A;  2FBI A;  1D8K A;  1R00 A;  4O6J A;  1R7J A;  3QPH A;  3RKX A;  4A6D A;  1QGP A;  2MC3 A;  3BRO A;  4AIJ A;  5FFZ A;  1BN5 A;  4S04 A;  1WI9 A;  1HKT A;  3BJ6 A;  4MNU A;  1SMT A;  3LST A;  1I1G A;  2W24 A;  3WE3 A;  1J59 A;  2JPB A;  5D5V B;  1S8N A;  5ERI A;  4HDV A;  1GVJ A;  1FX7 A;  2D1V A;  2YPR A;  3MZY A;  2HTS A;  1RNL A;  3JSO A;  4IJA A;  1T98 A;  4S05 A;  3KLN A;  3BOQ A;  4DQ2 A;  1T6S A;  4OIR F;  4G7O F;  1I27 A;  2VOO A;  1J75 A;  1YS6 A;  5L3D A;  2GXB A;  3H3Z A;  2FA5 A;  1Z9C A;  4CXF A;  5D8L B;  3LA3 A;  2FU4 A;  4P9U A;  5D5U B;  3R6S A;  2GWR A;  3ML6 A;  3BPX A;  5ILV A;  2XAG A;  1U3E M;  1G6N A;  1Z6R A;  2WTE A;  2LNB A;  3T0Y A;  2IA1 A;  3C1D A;  2FF4 A;  4B09 A;  2VE9 A;  2GA1 A;  2A6E F;  1T39 A;  4LG0 A;  5TRD A;  2P5V A;  2QEN A;  3E6B A;  1O57 A;  2EFW A;  2P5L C;  2D2W A;  3O3K A;  1O3Q A;  2ETH A;  3ISP A;  3F23 A;  1ZN2 A;  2O61 A;  1PUE E;  2K4B A;  3HYI A;  3R60 A;  1RIO H;  1F5T A;  1T2K A;  5L3B A;  3L2C A;  4I2O A;  1I6X A;  2MBF A;  1LDD A;  3C7J A;  3WTY C;  4KDP A;  2KRF A;  2PN6 A;  5BPI A;  1YQA A;  3V7S A;  1DDN A;  5CVV A;  1W4M A;  2H09 A;  1I1S A;  5DCM A;  4ZZD A;  5D6F A;  2UXN A;  3N97 A;  2XAJ A;  2HKO A;  2VXZ A;  1XSV A;  2TDX A;  2E7X A;  3I71 A;  4LLN A;  2DFI A;  1PDN C;  2W85 A;  1JGS A;  5L3E A;  4ENK A;  4A0Y A;  4IRI A;  1FP1 D;  3GX4 X;  3J80 K;  2QBY B;  4OU0 A;  1ODD A;  1Y0U A;  3WTX C;  1ZLK A;  1WSU A;  1DP7 P;  2NNY A;  4LLL A;  3ZQ7 A;  2XUB A;  3G3Z A;  1OPC A;  3ZP5 A;  1R23 A;  1L3L A;  4IRG A;  1O3T A;  2ISZ A;  1XGN A;  1XMK A;  3FMQ A;  1IAW A;  2DQL A;  2H94 A;  3ULQ B;  2OA4 A;  5DYM A;  1SFX A;  3V8J A;  1W5T A;  4HW0 A;  4GYG A;  1T38 A;  2DTR A;  4KMU X;  1K78 A;  3RJP A;  2BYV E;  1BJA A;  4LMY A;  3HRM A;  1J5Y A;  3GZ5 A;  4AWX B;  3GFI A;  2UXX A;  3MQ0 A;  1LDK B;  3K69 A;  2M30 A;  3QP5 A;  5LEJ A;  3V7R A;  4OMY A;  2LF7 A;  5TJJ A;  4B8X A;  3IHU A;  1P92 A;  5LGN A;  1HSJ A;  4ENN A;  5D4S A;  1IUY A;  4I02 A;  5LHH A;  1MZB A;  1FSH A;  2FSW A;  4U0V A;  4UVC A;  4YFN F;  1TW2 A;  1SAX A;  1XDS A;  2XIG A;  2RV8 A;  5ILS A;  4P9F A;  3KE2 A;  2FQ3 A;  4WF2 A;  2XGX A;  4LG0 B;  3WTS C;  2A68 F;  5DD4 A;  4MEX F;  3WGH A;  2ZXJ A;  1HW1 A;  2M8E A;  2HEO A;  5BMZ A;  1UCR A;  4FX0 A;  3F22 A;  2ISY A;  4L9J A;  3E6M A;  1KYZ A;  2DPD A;  1BOA A;  2ZME A;  4OIQ F;  4RGS A;  2DI3 A;  3M8E A;  3DPT A;  5LBQ A;  3WTW C;  5E17 F;  3BY6 A;  5E18 F;  4M73 A;  5CVR A;  5D5W B;  3CTA A;  1MKM A;  3R61 A;  3T1B A;  1ZG1 A;  3M7G A;  2ESN A;  2F2E A;  3J81 K;  2QM3 A;  3E6D A;  5DCM B;  5K1Y A;  2R3S A;  1TQP A;  1YYV A;  1QO0 D;  1OMI A;  1FNN A;  3F8N A;  3SQN A;  4AD9 A;  3FXR A;  1KU3 A;  3F21 A;  4QWQ A;  1B4A A;  3MFK A;  5H6Q A;  2Z3Y A;  4GXO A;  5K5Q A;  4I01 A;  1O7L A;  1YW9 A;  3HSR A;  1OYW A;  3LA7 A;  4HDU A;  1VTN C;  4EQQ A;  4WXD A;  2BV6 A;  1HW2 A;  4M6Y A;  4N9H A;  1SFE A;  1FPQ A;  2GXG A;  3KZY A;  1G3Y A;  3R0A A;  2HGC A;  2RGV A;  1FYM A;  3V8K A;  3IC7 A;  1OKR A;  3HOT A;  3I4P A;  3HTU A;  3JW4 A;  2IRF G;  2FBH A;  4U0W A;  2KJB A;  3SXY A;  1KA8 A;  2IA2 A;  2QQ9 A;  2K86 A;  1KU7 A;  1YLF A;  2YR2 A;  2W57 A;  1WQ2 A;  2E1N A;  3MZH A;  1K78 B;  3NRV A;  4LB6 B;  4M9Z A;  1YW7 A;  5K5O A;  4G6D A;  4YG2 F;  2KIF A;  4U0Y A;  4WXH A;  4LGW A;  2XV4 S;  1TBX A;  2NAZ A;  2L4M A;  5FD6 A;  2RDP A;  3ELK A;  4HX8 A;  2VT3 A;  3NQO A;  2R7F A;  2V1D A;  3TO9 A;  1WRJ A;  3KP4 A;  1U5T C;  2PQ8 A;  3DP7 A;  5FD5 A;  1PP7 U;  2XRN A;  1ZRE A;  1R5H A;  4KA4 A;  1BIA A;  3LWF A;  4XSX F;  5BS6 A;  4LK1 F;  1XGM A;  2LF8 A;  4CO8 A;  1ZGJ A;  3E5Q A;  4HX4 A;  3F8B A;  4KN4 X;  4ASN A;  1O3R A;  2OQG A;  2PI0 A;  2VBZ A;  1IZ1 A;  1FZP B;  4NB5 A;  3K1N A;  3FX3 A;  1SMY F;  4BHP A;  5HDK A;  3RYR A;  2PLY A;  1BI2 A;  4ON0 A;  2FBK A;  5ICE A;  2RC4 A;  2ZME B;  1YFH A;  4BH9 A;  2GA2 A;  5CVU A;  3VEP A;  4PGG A;  1FC3 A;  1G4D A;  2Z9O A;  1HST A;  3KET A;  2EA4 A;  1FYL A;  4QLC U;  2K02 A;  1O3S A;  3I59 A;  4OOI A;  3MAJ A;  2OBP A;  1S6L A;  4KMF A;  4MEY F;  2H6C A;  5HS9 A;  4NHJ A;  2VN2 A;  1KU9 A;  5HDN A;  1ON1 A;  4E70 A;  1KYW A;  2V1X A;  4EJO A;  4LJZ F;  5IT9 K;  3PQJ A;  2PJP A;  1EH8 A;  5BOX A;  4BHC A;  3FF5 A;  1W7P D;  2IVM A;  4BQA A;  3RIR A;  4CZZ A;  3GWZ A;  3WGG A;  2D45 A;  3QAH A;  5LGT A;  5FLX K;  1UHW A;  5DUK A;  4EGZ A;  2O6G E;  2EB7 A;  1ZRF A;  4A5N A;  1LEB A;  1XCB A;  1XCV A;  2VE8 A;  3BDD A;  5HOO A;  1ZRD A;  1GHC A;  4TV7 A;  1U5T B;  1ZYR F;  4IHS A;  1EH7 A;  2Z5U A;  4NQW A;  3P9I A;  4ETS A;  2X4H A;  3D5L A;  3KCC A;  3ZMT A;  1IW7 F;  1UB9 A;  4EM0 B;  3DV8 A;  4Z2Y A;  1LB2 A;  5E1X A;  3GZ6 A;  3F6V A;  1Q1H A;  4PZJ A;  2ZCW A;  2LKP A;  1IN8 A;  5L3F A;  4KIC A;  5J8F A;  2P7V B;  5HS8 A;  4G7H F;  3GXO A;  3QRF F;  2EFN A;  3FMR A;  2G7U A;  2B0L A;  3F3X A;  3DF8 A;  2IPQ X;  5JR3 A;  2L3D A;  2A6H F;  4WXC A;  2DU9 A;  2YU3 A;  3P9C A;  2O03 A;  2CYY A;  3ZMV A;  4RB2 C;  5BPD A;  5EEH A;  3D0S A;  2O0Y A;  1Z6T A;  4HOB A;  1LEA A;  2FOK A;  1W5S A;  3HRU A;  5CYV A;  1MJA A;  5E20 A;  3E6C C;  4RB3 C;  3HRT A;  3WG9 A;  1FLI A;  4KIG A;  3E5X A;  2VOP A;  2V1U A;  2L02 A;  3I59 B;  4I7H A;  2RN7 A;  1IXC A;  1T0F A;  2HTJ A;  4A2U A;  2Q2E A;  5ICG A;  2E7W A;  2L54 A;  1XB4 A;  4UNO A;  4HA8 A;  5E8I A;  4IF4 A;  4Q5S F;  1BM9 A;  4YFK F;  3GF2 A;  2ZNY A;  4CHU A;  3V7C A;  1AOY A;  3K1M A;  3EUH A;  1FBS A;  5LRS A;  1BC8 C;  2EV5 A;  2BE5 F;  4BNC A;  2HZT A;  2MH2 A;  1QNT A;  5J6X A;  3KP6 A;  3O6B B;  2HS5 A;  5AON A;  5F64 A;  1ULY A;  2COM A;  1UST A;  1H9G A;  2CW0 F;  4UVA A;  2RNJ A;  1KQ0 A;  2NNN A;  4YIF A;  1R1T A;  4XLN F;  3BJA A;  4EM2 A;  2QVO A;  3ZN1 A;  4M72 A;  2EFQ A;  2OAZ A;  5ICF A;  3E97 A;  2VBX A;  1B6A A;  3C18 A;  5JI6 A;  2EFO A;  2Q0O A;  3HOS A;  1QBJ A;  1D5V A;  1BI1 A;  1QZZ A;  4HZF A;  2FMY A;  2CG4 A;  2HFH A;  3F8M A;  4I0A A;  3T8T A;  2STW A;  1H0M A;  1LJ9 A;  3IWZ A;  4OIN F;  4IHT A;  2UWM A;  2DLL A;  2HYG D;  4JK1 X;  5KVR A;  1REP C;  1WKM A;  5DEQ A;  4Y13 A;  1EV7 A;  3LAJ A;  3CUO A;  2ESH A;  3H92 A;  2LSO A;  3H3U A;  5D8K B;  1FBU A;  2CSO A;  2M87 A;  4R79 A;  2YX7 A;  3T8R A;  1FOK A;  2JZY A;  3KEO A;  3WGI A;  3ECH A;  4P5O A;  1U2W A;  3HSF A;  2JSC A;  2KIU A;  5JFR A;  3EYY A;  5ILU A;  5E8G A;  1TNT A;  2HYF A;  3FWE A;  3KEQ A;  2YX4 A;  2XAS A;  1IN5 A;  5DUI A;  2H27 A;  3QU3 A;  3IKT A;  2P5K A;  4GYI A;  3QP6 A;  2H6B A;  3FHZ A;  1IF1 A;  2R7D A;  1SFU A;  1J9I A;  2GZW A;  3CO7 C;  1XDU A;  3HSE A;  4EJU A;  1RUO A;  5ICC A;  1GXP A;  1QPM A;  3I54 A;  1JE8 A;  2PBI A;  3HHG A;  1NHA A;  4UXN A;  1AWC A;  4L0Z B;  4FHT A;  1BC7 C;  3QU6 A;  3BJO A;  4WWC A;  2CGP A;  1HXD A;  3JAM Z;  3W6K B;  2MH9 A;  4JBA A;  5HDG A;  5JHU A;  5E1Z B;  1U8R A;  1BBY A;  2RKH A;  1TNS A;  2HQN A;  4BXU A;  3R0J A;  5LLQ A;  3LQR A;  4N9I A;  3FMS A;  2M1B A;  3GO5 A;  2G9W A;  3ROU A;  4M9S A;  4RGR A;  2XHK A;  2DBB A;  4P55 A;  2M5W A;  2Y0M A;  5K5R A;  5D4R A;  1FSE A;  2EA2 A;  5CVI A;  3Q5F A;  3ABT A;  1XGS A;  2VBW A;  3KZZ A;  2ZKZ A;  4U7B A;  4UV9 A;  1S3J A;  4R8H A;  5A2Q Z;  3OV8 A;  4MQV A;  1S7O A;  3EET A;  2IT0 A;  3FZV A;  4A0X A;  3TQN A;  4LLG F;  3K1P A;  2HDC A;  2Y48 A;  4L9V A;  4AVP A;  4EM1 A;  3TGN A;  4AIH A;  2HQR A;  2BBY A;  1YO5 C;  2P7C B;  2DO7 A;  1U5T A;  3O2P E;  3DQV C;  3RPU A;  3L7W A;  4M74 A;  1XGO A;  2LDU A;  4R1H A;  3E3V A;  3ZMD A;  1P4A A;  2QQA A;  4EVI A;  5AIP A;  5CVJ A;  3N4M A;  2FNA A;  1RI7 A;  2L01 A;  3L00 A;  2A69 F;  4UVB A;  2ZO4 A;  2W25 A;  4ESF A;  1Z05 A;  2IA0 A;  3RKY A;  3LA2 A;  3EQL F;  3JTH A;  4U88 A;  2JT1 A;  4KIB A;  2QUF A;  3GEZ A;  1IRG A;  1B1B A;  1RUN A;  3F8C A;  4OIO F;  3DKW A;  2OD5 A;  4LB5 A;  2XAQ A;  1G3W A;  3GUD A;  3HHH A;  1CGP A;  2EV6 A;  3Q9V A;  1ZHF A;  3BPV A;  5IT3 A;  3RYP A;  2DW4 A;  3U1D A;  1LVA A;  2MA3 A;  3WTT C;  4MHG A;  2G7H A;  4GGG A;  4PDK A;  1A04 A;  1QQI A;  4WX9 A;  4HLY A;  4GO1 A;  4ZH4 F;  4GCV A;  4ESB A;  1SD7 A;  3REO A;  4A5M A;  5ED4 A;  4FT8 A;  4KYW A;  3QPT A;  3WTU C;  1IN4 A;  1TQM A;  3I53 A;  4FX4 A;  1PP8 F;  2AXL A;  3W6J B;  2V6C A;  3SHF A;  1R1U A;  2PMU A;  3SFZ A;  4A0Z A;  3PQK A;  1DPR A;  1DUX C;  5HLG A;  3E5U A;  1O7F A;  4F7Z A;  2KJC A;  1TQI A;  2D1H A;  5LHI A;  4L0Y B;  3DXJ F;  3WU0 A;  4IRH A;  4HV6 A;  1E2X A;  1W7P A;  5AIQ A;  3KP3 A;  1HBX G;  3GFJ A;  2VC1 A;  1USS A;  1XD7 A;  3GVA A;  1BI0 A;  1UFM A;  2Q8K A;  4UUV A;  1DPU A;  3Q9S A;  4MGR A;  3ZMZ A;  2QZ8 A;  1P4X A;  3KLO A;  3RKW A;  2DQR A;  3P7N A;  1D8J A;  1LNW A;  2OU2 A;  3CUQ A;  5CLS A;  4O3M A;  3VOE A;  2VOD A;  4YFX F;  2J5O A;  4HQM A;  5H20 A;  4EJT A;  3GFL A;  3I58 A;  4JQF A;  1G3S A;  4RAZ A;  4MQ9 F;  3J80 Z;  5DV5 A;  2DK5 A;  1KQ8 A;  1HW5 A;  3OOP A;  4YII A;  3IKV A;  3ABU A;  2A5Y B;  1LDJ A;  3CUQ C;  2F5C A;  4EJV A;  3CLO A;  3FM5 A;  4U7D A;  4RGU A;  3M1E A;  1R58 A;  4HF2 A;  3J7A O;  3LQQ A;  2WC2 A;  1MDM B;  1C0W A;  2EJR A;  4L5J A;  4G6Q A;  1MJ9 A;  2VT2 A;  3KP5 A;  3GYH X;  3WE2 A;  5CJ9 A;  2A3S A;  4CIC A;  1MJB A;  3CDH A;  2AS5 F;  1B59 A;  2DK8 A;  2ELH A;  1P4W A;  1TW3 A;  5L3C A;  2NYX A;  3K9T A;  2OZ6 A;  5L3G A;  3B02 A;  2PG4 A;  3I5U A;  2JRT A;  4BHB A;  3VFZ A;  2WWY A;  4I09 A;  1Z1D A;  1Z91 A;  2NS0 A;  1EH6 A;  2JTV A;  3VOD A;  2ADU A;  3HUG A;  5EEG A;  3TO6 A;  2FXA A;  4ZYE A;  3M9A A;  3TDU C;  3QOP A;  4L18 B;  2Z99 A;  1K7A A;  3WTV C;  3IRQ A;  1F1Z A;  1X3U A;  2PEX A;  2Z33 A;  3KP2 A;  1U78 A;  3TOA A;  2IW5 A;  4CDG A;  5E1W A;  4AIK A;  3T5X A;  4PGH A;  1J2X A;  2HWV A;  4G9Y A;  3MCZ A;  2VC0 A;  1IN6 A;  1SD6 A;  2OQR A;  1G3T A;  4Q4Z F;  1JXS A;  3F72 A;  2QLZ A;  1ZG3 A;  2MD5 A;  4XRF A;  2M45 A;  2HKX A;  4O5V A;  1B9M A;  3CO6 C;  2CO5 A;  4CYD A;  1YIO A;  3I0T A;  3PFI A;  4OIP F;  2YSR A;  3MEX A;  4ESJ A;  3JTG A;  4DNC A;  1W7P B;  4IXA A;  2K7L A;  2EV0 A;  1FY7 A;  2P6T A;  1ON2 A;  2EFP A;  2GAU A;  6PAX A;  2O8X A;  4IPA A;  1BIB A;  2K4J A;  5H6R A;  3GLX A;  4G8X A;  4RAY A;  5HLH A;  3U2R A;  2J5P A;  1ZH5 A;  3J81 Z;  4WCG A;  4OMZ A;  2A61 A;  4KN7 X;  1RZ4 A;  4G94 A;  3CUQ B;  4P96 A;  2BEO A;  4EV0 A;  2Y75 A;  5HLI A;  1UHM A;  2CFX A;  1XN7 A;  3ERE D;  5HVQ C;  1SD4 A;  4M9X A;  3C3W A;  4HYE A;  5DD8 A;  3IRR A;  4HBL A;  4CGZ A;  2CWE A;  3GW2 A;  4ZYH A;  1FP2 A;  2DPU A;  3WTZ A;  2FRH A;  3MWM A;  4EJW A;  3LAP A;  4LFU A;  4UV8 A;  1ZGA A;  1J0R A;  3CJN A;  1IN7 A;  3KP7 A;  1D3Y A;  4HAM A;  3U9G A;  3K2Z A;  4N0B A;  4L9N A;  2XKP A;  1XSX A;  1ZG5 A;  1FT9 A;  3HTS B;  4KUM A;  1R1V A;  2VON A;  1IXR C;  2GIV A;  4KT5 C;  1V3F A;  2C6Y A;  3M8F A;  2FNP A;  1STZ A;  5JVT A;  1ZRC A;  1K79 A;  4I0B A;  3RTR A;  3L09 A;  1JHF A;  2ZJ2 A;  5DCF A;  2XVC A;  2F5E A;  1IRF A;  1YS7 A;  3DEU A;  4IVN A;  4HQE A;  1CF7 A;  1TTY A;  3ZMU A;  4MTD A;  4EMS A;  2DAO A;  3DPL C;  2FE3 A;  2O3F A;  2P4W A;  5FB2 A;  4RGX A;  3TOB A;  4PCQ A;  3WOD F;  4XSZ F;  1MD0 A;  3SZT A;  3RDI A;  2HR3 A;  2OZU A;  1S7A A;  1YW8 A;  5FO5 A;  1S29 A;  4D0P A;  5F6F A;  1F4K A;  1MGT A;  3F6O A;  4BAY A;  3B73 A;  1R36 A;  2ZFW A;  4XLP F;  3L9F A;  4M71 A;  2X0L A;  2QQB A;  4A6E A;  1LQ1 A;  1F9N A;  2W84 A;  3VB2 A;  2A07 F;  5FGM A;  1ONV A;  4RB0 A;  1QZY A;  4L9T A;  1ZAO A;  3RPQ A;  1R22 A;  2RQP A;  3EDP A;  1ZAR A;  1Z7U A;  4LK0 F;  2XRO A;  4Y15 A;  1OYI A;  1L0O C;  3ZPL A;  4I98 B;  2FEZ A;  2QWW A;  5IT9 Z;  2EK5 A;  4KNY A;  2ZNZ A;  2DT5 A;  2UZK A;  2XAF A;  2P8T A;  4RB1 A;  1YG2 A;  4ZYG A;  4MTE A;  3BZ6 A;  4M6X A;  2ACJ A;  1FBQ A;  3I64 A;  3TKY A;  4Q48 A;  1KQ9 A;  2VBY A;  1OYY A;  4L5I A;  5FFX A;  4ZZL A;  5FLX Z;  4ZYD A;  1ZLJ A;  2BGC A;  2P6S A;  3AAF A;  4EGY A;  3DFG A;  3LFK A;  1JHH A;  3GFM A;  1R5G A;  4HF1 A;  1H9T A;  1MDM A;  4XBF A;  3JSP A;  2CQK A;  1K6O A;  5F1R A;  1XMA A;  3P9K A;  5D6E A;  2E1C A;  2MLG A;  2QYO A;  1HQC A;  1KGS A;  5LRR A;  4ENM A;  1GXQ A;  3FXQ A;  3BWG A;  3F8F A;  3R4K A;  3S2W A;  1FYK A;  3NEU A;  4ENJ A;  1CF7 B;  2XKO A;  2L4A A;  5BQT A;  4HX7 A;  4HF0 A;  1B9N A;  1IXS B;  2KKO A;  3BP8 A;  3FXU A;  2GQQ A;  3V4G A;  1YTY A;  2PFB A;  2XAH A;  3IWF A;  5HS7 A;  4KFC A;  3V8L A;  2PMH A;  1P6R A;  2KIM A;  3TO7 A;  3G73 A;  4H0E A;  5J8C A;  4HLX A;  3IL2 A;  3ZMS A;  2F5F A;  3JAM K;  3WU1 B;  4Q47 A;  2RVC A;  3HIF A;  4WK8 F;  2V79 A;  5D5X B;  2EWN A;  2WV0 A;  1SD5 A;  4A12 A;  3FM3 A;  3ECO A;  2F5D A;  2MLK A;  4Y17 A;  3ZN0 A;  5LHG A;  2NRA C;  1OR7 A;  2HOE A;  5LEK A;  1WWX A;  5DDG A;  1XSD A;  2ZBK A;  1I5Z A;  2K27 A;  1E17 A;  4G7Z F;  1KU2 A;  1V4R A;  5LGU A;  3SZP A;  3TDZ C;  5A2Q K;  4K2E A;  2IJL A;  2STT A;  4LD5 A;  1BI3 A;  3KFW X;  1P2F A;  5KK1 A;  1J7K A;  4KIF A;  1TLH B;  4UHT A;  1HKQ A; 
#chains in the Genus database with same CATH topology
 2IP2 A;  2JPC A;  3K0L A;  4RS8 A;  3CCJ I;  3RI4 A;  1FWZ A;  1TWG J;  4XRS A;  2HOS A;  1MBE A;  2QBY A;  1U6G A;  2FML A;  3EYI A;  3COA C;  2CUZ A;  1X2M A;  4BYY A;  5C44 J;  4HV5 A;  2V9V A;  2QSF X;  3HRS A;  1IRX A;  1HKS A;  2FBI A;  4NC7 A;  1A35 A;  1D8K A;  1QVT A;  1R00 A;  4O6J A;  1R7J A;  3QPH A;  4GDF A;  3RKX A;  1YOV B;  4A6D A;  3F9K A;  3I3L A;  1QGP A;  1S5L C;  2MC3 A;  3BRO A;  4J00 A;  4AIJ A;  3OS1 A;  3GME A;  5FFZ A;  2AHQ A;  4HRI A;  1BN5 A;  3HG9 A;  4DYR A;  4S04 A;  2VAS A;  1WI9 A;  1HKT A;  3BJ6 A;  4DYQ A;  3FXL A;  1FOY A;  4MNU A;  5DM7 F;  1SMT A;  3LST A;  1I1G A;  2W24 A;  5TIS C;  1OCT C;  1GV2 A;  1BR1 A;  3WE3 A;  2WAD A;  3O8H A;  1J59 A;  2JPB A;  1WJ5 A;  5D5V B;  3CF2 A;  3Q3S A;  3HPG A;  3BC8 A;  2XDV A;  2COB A;  1S8N A;  2ELK A;  5ERI A;  3CJQ B;  4HDV A;  4A3I J;  1GVJ A;  1FX7 A;  2D1V A;  2NXN B;  2YPR A;  3S1N J;  3H5N A;  3MZY A;  3MMY B;  2HTS A;  3DLA A;  4NC6 A;  5FKO A;  1RNL A;  3QYE A;  2E1M C;  2JUG A;  1O4X A;  3JSO A;  1IDY A;  3EUA A;  4IJA A;  3OS0 A;  1T98 A;  4E7S A;  4S05 A;  3UKG A;  3KLN A;  3BOQ A;  4DQ2 A;  5J3L A;  1T6S A;  4OIR F;  4G7O F;  4II2 A;  1I27 A;  2VOO A;  2DFE A;  2FJ1 A;  3OYN A;  1VQ4 I;  5HNH A;  2XRL A;  1VFC A;  1VQ9 I;  4Z6Y A;  2W4S A;  3LSI A;  3BLY A;  2HOT A;  1G2H A;  1J75 A;  1YS6 A;  4A3K J;  5L3D A;  2ZFU A;  3MD2 A;  2Y30 A;  2GXB A;  3H3Z A;  2FA5 A;  1Z9C A;  4AID A;  4XN3 A;  3CCV I;  2M3A A;  4CXF A;  5D8L B;  3LA3 A;  2XSJ C;  2FU4 A;  4P9U A;  4A3J J;  3AG4 H;  2CQQ A;  5M5X J;  5D5U B;  3R6S A;  2GWR A;  3PIO F;  3PSF A;  3ML6 A;  2LMD A;  2DA4 A;  3BPX A;  5ILV A;  2XAG A;  4PSW A;  3PIP F;  1G6N A;  3JRD A;  1Z6R A;  5EZG A;  1U3E M;  3G1M A;  2WTE A;  2LNB A;  3T0Y A;  2IA1 A;  2M4G A;  3C1D A;  1QRY A;  3W2V A;  2FF4 A;  3SEQ A;  5FJ8 J;  4B09 A;  2VE9 A;  2JJ7 A;  2GA1 A;  3LSK A;  2A6E F;  1T39 A;  2HQ5 A;  4PFP A;  4LG0 A;  3CCM I;  5TRD A;  2P5V A;  4AYB N;  2BVL A;  1K61 A;  2QEN A;  2E5Z A;  1HF0 A;  3E6B A;  1NTC A;  1O57 A;  2CV1 A;  1NH3 A;  1QZE A;  2EFW A;  3W6V A;  2P5L C;  2D2W A;  5TGT A;  3O3K A;  4DBR A;  1O3Q A;  2ETH A;  3ISP A;  3F23 A;  1ZN2 A;  2O61 A;  1PUE E;  1U9O A;  2K4B A;  5GAH J;  4L5E A;  3L2Q A;  3S1Q J;  3HYI A;  3P5J A;  3R60 A;  1RIO H;  1F5T A;  1T2K A;  3DPU A;  2MFZ A;  5L3B A;  2XC7 A;  3L2C A;  4I2O A;  1I6X A;  1SAU A;  2LVS A;  4X0G A;  2MBF A;  1LDD A;  2JVH A;  3OYG A;  3C7J A;  1D1C A;  3IP4 B;  3WTY C;  1APL C;  2YS9 A;  4KDP A;  2KRF A;  3BR5 A;  5F0H A;  2CQX A;  4NBQ A;  2PN6 A;  5BPI A;  4AU7 A;  5EGO B;  4B44 A;  3J7A Y;  3HEF A;  1YQA A;  1QPI A;  2XPW A;  2E19 A;  2E5N A;  3QPL A;  1WJF A;  3V7S A;  3A1Y A;  1DDN A;  2IS6 A;  5CVV A;  3OMY A;  2R93 J;  4CYC B;  1W4M A;  2H09 A;  1I1S A;  4IHX A;  5DCM A;  4W97 A;  4ZZD A;  5J4V A;  5C4J J;  5C4X J;  4QIW N;  3BR0 A;  5D6F A;  2UXN A;  2WAQ N;  3N97 A;  2V6E A;  3FBI B;  2Y0S A;  2XAJ A;  2WAE A;  1FJL A;  1PVE A;  2HKO A;  2VXZ A;  4YEL A;  1XSV A;  4BQO A;  2TDX A;  2E7X A;  1BW5 A;  2MC4 A;  4J19 A;  3I71 A;  4LLN A;  2DFI A;  1PDN C;  2W85 A;  1JGS A;  2EPF A;  5L3E A;  4ENK A;  2L9R A;  4A0Y A;  2HXO A;  1OCZ H;  1DP3 A;  2ICW G;  4IRI A;  1FP1 D;  3GX4 X;  4I76 A;  1JTX A;  1MNE A;  2JK3 A;  2PJR A;  3J80 K;  1Y1W J;  2QBY B;  5GAD J;  1BR2 A;  2EIJ H;  4OU0 A;  1VQM I;  1ODD A;  1UHS A;  1Y0U A;  3WTX C;  3ZXS A;  1ZLK A;  3EUH C;  1WSU A;  1DP7 P;  2NNY A;  4LLL A;  3ZR8 X;  3HGY A;  5GP9 A;  3ZQ7 A;  2OUM A;  3OR1 C;  1XX5 A;  4XOP A;  2XUB A;  4CCK A;  2FD5 A;  1ETY A;  3G3Z A;  2LY1 A;  5K7Z A;  1OPC A;  2E1M B;  3BG7 A;  3ZP5 A;  2X1C A;  1UG2 A;  1R23 A;  1OQY A;  3CCS I;  1L3L A;  4IRG A;  1E3P A;  1O3T A;  2ISZ A;  1KZH A;  1XGN A;  1XMK A;  3BTI A;  3FMQ A;  1IAW A;  1ZR4 A;  3DTI A;  2DQL A;  4PJ0 C;  2GOX B;  2H94 A;  3ULQ B;  3ZQL A;  2OA4 A;  5DYM A;  2JA6 J;  2DMN A;  4JP0 A;  3C2G A;  3PNT A;  4RAG A;  1SFX A;  4ZDL A;  2LRD A;  2BHZ A;  4HSR A;  3K70 D;  1VND A;  3ZQH A;  4HNT A;  3V8J A;  1W5T A;  4HW0 A;  4GYG A;  4A3E J;  1T38 A;  4MFD A;  2DTR A;  4KMU X;  1K78 A;  3RJP A;  2DDB A;  2Z2S B;  4RLF A;  2Y9Y A;  2BYV E;  1BJA A;  3OYF A;  5FLV A;  3PUF A;  3HRM A;  4LMY A;  1AKH A;  1MSF C;  2NVX J;  3DBL B;  1J5Y A;  2O5R A;  3GZ5 A;  2LY9 A;  4AWX B;  4CCO A;  4B3X A;  3GFI A;  2UXX A;  3MQ0 A;  1LDK B;  3K69 A;  2DFF A;  2M30 A;  3QP5 A;  5LEJ A;  2RAE A;  3V7R A;  4OMY A;  2LF7 A;  5TJJ A;  4B8X A;  3IHU A;  3H0G J;  2Y9Z A;  1P92 A;  5LGN A;  1HSJ A;  1MMD A;  4M3D A;  2AXT C;  4ENN A;  3HBL A;  5D4S A;  1IUY A;  4I02 A;  5LHH A;  1MZB A;  2XSD C;  1FSH A;  2VQC A;  2FQ4 A;  5CQG A;  5IPA A;  2FSW A;  2ID6 A;  2BVM A;  2QGU A;  3S93 A;  2V9P A;  4U0V A;  4D7M A;  4UVC A;  1TW2 A;  4YFN F;  1SAX A;  1XDS A;  2XIG A;  5GAE J;  3I9V 2;  1N77 A;  2A05 A;  2RV8 A;  3SJM A;  1XS9 A;  3HDD A;  5ILS A;  4P9F A;  3CQZ J;  4XLF A;  3KE2 A;  3LSG A;  4A3C J;  2FQ3 A;  2FX0 A;  4WF2 A;  2XGX A;  1VZ0 A;  3FK6 A;  2D5V A;  2CW7 A;  1JT0 A;  3WTS C;  4LG0 B;  4F93 B;  1XMX A;  1RES A;  1YJN I;  3QQA A;  2A68 F;  5DD4 A;  4MEX F;  3WGH A;  2ZXJ A;  3MKL A;  1HW1 A;  3G4S I;  2M8E A;  2HEO A;  3K4J A;  5BMZ A;  1UCR A;  1OIS A;  1G59 A;  1IRZ A;  4FX0 A;  3F22 A;  2ISY A;  1N75 A;  4L9J A;  2R7U A;  3E6M A;  1KYZ A;  2DMQ A;  4XKC A;  1ZGW A;  2DPD A;  1BOA A;  1JUM A;  2ZME A;  4OIQ F;  1Y0N A;  1GVD A;  1E3O C;  1DU6 A;  2GXA A;  1WCM J;  2DI3 A;  4RGS A;  3M8E A;  3DPT A;  5LBQ A;  3WTW C;  1ENH A;  1WH7 A;  5E17 F;  3ABL H;  1LKX A;  4C2U A;  3BY6 A;  5E18 F;  2Q2E B;  2DDA A;  2LK2 A;  4M73 A;  3OL4 A;  3S16 J;  2I8D A;  5CVR A;  5D5W B;  3L2R A;  4ZC3 A;  3CTA A;  1MKM A;  2LR8 A;  3R61 A;  5FLM J;  2KDZ A;  2LYC A;  1YRN A;  3T1B A;  3GTP J;  3VSL A;  1ZG1 A;  3M7G A;  2ESN A;  4IHY A;  1NG7 A;  2F2E A;  3J81 K;  1I3A A;  2QM3 A;  2ZXW H;  3DEE A;  3E6D A;  5DCM B;  3ZQF A;  2ZME C;  1W0T A;  2JRM A;  5K1Y A;  2R3S A;  1TQP A;  1YYV A;  2LP0 A;  1QO0 D;  3E7L A;  3OIQ A;  1W5C C;  1OMI A;  3IH3 A;  1FNN A;  1LFU P;  3F8N A;  3SQN A;  4AUX A;  1ETW A;  4HST A;  2LC2 A;  4AD9 A;  1JKO C;  3FXR A;  1KU3 A;  2IBD A;  3ZCO A;  3F21 A;  2Y31 A;  4QWQ A;  4Y3O A;  4QSH A;  1B4A A;  5FRN A;  1RRJ A;  3MFK A;  3BCA A;  3TMO A;  5H6Q A;  2Z3Y A;  4GXO A;  5K5Q A;  4I01 A;  4BBS J;  3D5S C;  3PO2 J;  3BQY A;  1O7L A;  2F4M B;  3CCY A;  4ZYA A;  4EEF G;  5EG0 A;  1YW9 A;  3FKJ A;  2ECB A;  1JGG A;  3HSR A;  1OYW A;  3LA7 A;  4HDU A;  1VTN C;  2ME6 A;  4EQQ A;  1HC8 A;  4WXD A;  3CCE I;  2BV6 A;  3BZK A;  1JT6 A;  1HW2 A;  3BCB A;  3GTJ J;  3VPR A;  4M6Y A;  1N25 A;  1NG6 A;  4N9H A;  1SFE A;  1FPQ A;  4B1R A;  2GXG A;  3KZY A;  1IO2 A;  1MBK A;  2XAU A;  4RLQ A;  2GBY A;  3A0B C;  2DMU A;  1G3Y A;  2JA2 A;  1T56 A;  3CF5 F;  3R0A A;  4C3J J;  3CD6 I;  2HGC A;  2RGV A;  1FYM A;  4C2T A;  3A2K A;  4BDZ A;  2DMP A;  1WI3 A;  4M3F A;  3V8K A;  3ASO H;  3RCO A;  4B3A A;  3IC7 A;  1OKR A;  3HOT A;  3I4P A;  3HTU A;  3JW4 A;  2IRF G;  1NK3 P;  2FBH A;  3S32 A;  3WHC A;  2R7Z J;  2GOM A;  4U0W A;  2KJB A;  3SXY A;  1KA8 A;  2IA2 A;  2QQ9 A;  2K86 A;  1BR4 A;  1KU7 A;  1YLF A;  4IHW A;  3K2A A;  3JRH A;  2YR2 A;  2W57 A;  1R6R A;  1WQ2 A;  3S1R J;  2E1N A;  3MZH A;  1UG0 A;  5KNL A;  2VQG A;  1K78 B;  3NRV A;  4LB6 B;  4DOZ A;  3CME I;  4M9Z A;  1I6H J;  2M9H A;  2RRE A;  3WU2 C;  1YW7 A;  5GTH C;  5K5O A;  4YRV A;  4G6D A;  4YG2 F;  2KIF A;  4XID A;  4U0Y A;  4JX4 A;  3KYL A;  4WXH A;  4LGW A;  2XV4 S;  4XKV A;  4A3B J;  1TBX A;  2NAZ A;  2L4M A;  5FD6 A;  2RDP A;  3DKY A;  3ELK A;  4HX8 A;  2VT3 A;  3RPU D;  1YIT I;  3NQO A;  2R7F A;  2V1D A;  3TO9 A;  3OYM A;  1ZQ3 P;  4A3M J;  1WRJ A;  4CZC A;  5FKL A;  3FXK A;  3KP4 A;  1U5T C;  2PQ8 A;  3DP7 A;  5FD5 A;  3SEZ A;  2KZV A;  2WBM A;  5F0F A;  1PP7 U;  1PUF A;  2W48 A;  2XRN A;  1ZRE A;  4LIV A;  1R5H A;  3MKZ A;  3HGG A;  2IS2 A;  2IGO A;  3G71 I;  4CH7 A;  1Y8R B;  4KA4 A;  1A6Q A;  2EZK A;  1BIA A;  3LWF A;  4XSX F;  5BS6 A;  4LK1 F;  1XGM A;  2LF8 A;  4CO8 A;  1TWF J;  4F52 A;  1ZGJ A;  3E5Q A;  4II3 A;  4HX4 A;  3CC2 I;  1ETK A;  3HOU J;  3F8B A;  3Q0V A;  2V26 A;  4KN4 X;  4ASN A;  1UEL B;  1O3R A;  2CQ7 A;  2OQG A;  2PI0 A;  2VBZ A;  3H1C A;  1IZ1 A;  3BG9 A;  1FZP B;  4NB5 A;  3K1N A;  2V9K A;  2L7K A;  2ME0 A;  4C2M J;  2Y0S N;  3FX3 A;  1SMY F;  4BHP A;  5HDK A;  3RYR A;  3I4M J;  2PLY A;  1BI2 A;  4ON0 A;  2FBK A;  2CV0 A;  5ICE A;  2DA1 A;  2RC4 A;  3K7A J;  2ZME B;  3I56 I;  1YFH A;  2JSP A;  4JOM A;  1VQ8 I;  4BH9 A;  2GA2 A;  5CVU A;  3VEP A;  2M34 A;  4PGG A;  1FC3 A;  1G4D A;  2Z9O A;  1HST A;  3FBN B;  3KET A;  2HPI A;  3BQZ A;  3OYA A;  3LFU A;  4FTH A;  1WGX A;  5FKN A;  2EA4 A;  1MBH A;  2DOD A;  1FYL A;  5KAI C;  4IO9 F;  2A5W A;  2LLK A;  3L1P A;  2R7W A;  4QLC U;  2K02 A;  3L2V A;  1YRN B;  2JN6 A;  1O3S A;  3ZRG A;  4FAS D;  2KP6 A;  1VI0 A;  3I59 A;  2PMZ A;  5JLW A;  1V5F A;  2R5Y A;  4OOI A;  3MAJ A;  2DA2 A;  2OBP A;  1S6L A;  5IY5 H;  1X3W B;  2WB1 A;  5GPC A;  3LSM A;  4KMF A;  4H4K C;  1TT5 B;  3CCL I;  3OYJ A;  4MEY F;  2VQH A;  3JRA A;  1GV5 A;  2H6C A;  5HS9 A;  2JVG A;  4NHJ A;  1MBG A;  2VN2 A;  1X4O A;  4RAF A;  1KU9 A;  3GTK J;  2BY3 A;  5HDN A;  1SFK A;  1LVK A;  5B5E C;  3AKZ A;  1ON1 A;  4E70 A;  3HOZ J;  2OF7 A;  5IP6 A;  1WJE A;  1KYW A;  2V1X A;  1YIJ I;  4EJO A;  4LJZ F;  1Z7L A;  2VIX A;  1ZR2 A;  2DOA A;  5EG0 B;  2X51 A;  3LSR A;  5IT9 K;  3Q0W A;  3PQJ A;  2PJP A;  1EH8 A;  5BOX A;  4BHC A;  3FF5 A;  1W7P D;  3ZGK A;  1SVM A;  1LUJ B;  3FHN A;  1NK2 P;  2IVM A;  4BQA A;  3RIR A;  4CZZ A;  1MMA A;  3GWZ A;  2LTP A;  3SYT A;  3WGG A;  3A4C A;  2ZXI A;  3RQ4 A;  3LNQ A;  2D45 A;  5JLX A;  2DN0 A;  2JA7 J;  3QAH A;  3OL3 A;  5LGT A;  3DU5 A;  2L7F P;  2QSH X;  5FLX K;  1UHW A;  5DUK A;  2ID3 A;  4EGZ A;  5IOY A;  2O6G E;  2EB7 A;  1ZRF A;  3H5A A;  4A5N A;  1LEB A;  1XCB A;  1XCV A;  2VE8 A;  3BDD A;  4E7H A;  1T8I A;  1LE8 B;  5HOO A;  3MN2 A;  1ZRD A;  1GHC A;  4TV7 A;  1K4T A;  1U5T B;  1ZYR F;  4IHS A;  2R7X A;  4BU2 A;  2EIK H;  1EH7 A;  2Z5U A;  3AFH A;  3CP2 A;  5J1R A;  2XB0 X;  2X48 A;  4NQW A;  3P9I A;  1JJ8 C;  3U21 A;  3M3Y J;  4ETS A;  3IUO A;  1OCP A;  9ANT A;  1ETO A;  1BW6 A;  1MBF A;  1WVR A;  2HI3 A;  2X4H A;  4F55 A;  1OJL A;  2W1O A;  2LH9 A;  1V5G A;  3D5L A;  3KCC A;  2CFO A;  3ZMT A;  2NVY J;  2DMT A;  1IW7 F;  2VXD A;  3BTL A;  1UB9 A;  5KCM A;  1Y56 A;  2LOO A;  1VQ7 I;  1T33 A;  2L7M P;  1D0X A;  4EM0 B;  3CCR I;  3E0J B;  1DGW Y;  3DV8 A;  4Z2Y A;  3AG2 H;  4A69 C;  4GFB A;  1PUF B;  1LB2 A;  5E1X A;  3M4O J;  4NUB A;  3GZ6 A;  3F6V A;  2HVQ A;  1Q1H A;  4PZJ A;  2BHY A;  3FIS A;  3UR3 C;  3ABK H;  2ZCW A;  4UB6 C;  2B9S A;  2LKP A;  1IN8 A;  4F91 B;  5L3F A;  1IV8 A;  1S7E A;  4KIC A;  5J8F A;  2P7V B;  5HS8 A;  4G7H F;  3GXO A;  3QRF F;  3OS2 A;  3ZQC A;  2EFN A;  3FMR A;  4FIS A;  2R7O A;  2IXS A;  2G7U A;  2B0L A;  4BE2 A;  2K5C A;  1JKR C;  4XR6 A;  2IS1 A;  1DQU A;  4E4H A;  1VQL I;  3F3X A;  3DF8 A;  1WJB A;  1VQ6 I;  4QPO A;  2IPQ X;  4BQQ A;  5JR3 A;  2L3D A;  2A6H F;  4PSX A;  3S2D J;  2FUG 2;  3MKY B;  2ECC A;  2Y69 H;  4WXC A;  1VQP I;  2DU9 A;  3K6G A;  1HCR A;  2YU3 A;  3V42 A;  2E2J J;  3BR1 A;  2O03 A;  3P9C A;  3GBG A;  2VJ4 A;  2R7Q A;  2BY2 A;  2CYY A;  3ZMV A;  5M5Y J;  2NVQ J;  4RB2 C;  5BPD A;  5EEH A;  3D0S A;  2O0Y A;  5LFA A;  1Z6T A;  1H88 C;  4RBO A;  4HOB A;  1LEA A;  2FOK A;  1W5S A;  3HRU A;  5CYV A;  1RC9 A;  1MJA A;  5E20 A;  3E6C C;  4RB3 C;  3HRT A;  3WG9 A;  4G6T B;  1FLI A;  1FTT A;  4KIG A;  3E5X A;  4XLH A;  2VOP A;  2CRG A;  2V1U A;  4AVZ A;  2L02 A;  2ZSH B;  3UNG C;  2LBF A;  3I59 B;  4I7H A;  2RN7 A;  2R5Y B;  1IXC A;  3DLL F;  1T0F A;  4YEJ A;  2HTJ A;  4A2U A;  2BW3 A;  4B47 A;  1R71 A;  2Q2E A;  3X2Q H;  1KON A;  5ICG A;  1OLT A;  2E7W A;  2L54 A;  1XB4 A;  3HPH A;  3BG3 A;  4UNO A;  4HA8 A;  2NVU B;  4BKX A;  5E8I A;  1N78 A;  1RKT A;  4UUS A;  4IF4 A;  3FK7 A;  3BR3 A;  4Q5S F;  1BM9 A;  5M3F J;  4YFK F;  1JKP C;  4DZP A;  3GF2 A;  4IOC F;  2ZNY A;  2O8K A;  3H0D A;  1I39 A;  4CHU A;  4E7I A;  4BXX J;  4HNV A;  3V7C A;  2DYS H;  3LSP A;  1AOY A;  2IGM A;  3K1M A;  1T0F C;  2WV1 A;  1FBS A;  3EUH A;  5LRS A;  1W1W E;  3PO3 J;  2W7N A;  2W82 A;  3K4C A;  1A31 A;  2IS4 A;  1BC8 C;  2KZG A;  3PNV A;  1SVO A;  1YX5 A;  2EV5 A;  2BE5 F;  4PJL A;  4B43 A;  4BNC A;  2HZT A;  2MH2 A;  4UUT A;  5JVG F;  1K6Y A;  1QNT A;  4S0H B;  5M3M J;  5J6X A;  3KP6 A;  3O6B B;  4CA0 A;  2HS5 A;  2XPU A;  5AON A;  5IP7 J;  5F64 A;  1ULY A;  2VPL A;  2COM A;  2HVR A;  1UST A;  2E71 A;  1BA5 A;  1H9G A;  2DA3 A;  5E3N A;  1Z67 A;  2CW0 F;  4UVA A;  2RNJ A;  1KQ0 A;  2NNN A;  4YIF A;  1R1T A;  2XPV A;  5GPA A;  4XLN F;  5J47 A;  3BJA A;  4EM2 A;  2HPM A;  2QVO A;  3ZN1 A;  3TL4 X;  4M72 A;  2QF7 A;  2EFQ A;  2OAZ A;  5ICF A;  3SDG A;  3E97 A;  4KIT B;  1AA7 A;  2CUJ A;  2VBX A;  1B6A A;  3C18 A;  5EF6 A;  5JI6 A;  2EFO A;  3LSH A;  4MIM A;  4XM3 A;  2Q0O A;  1B8I A;  2ZJP F;  3KEY A;  3HOS A;  1S72 I;  3K10 A;  3K4L A;  5EZH A;  1QBJ A;  3RSN A;  2AQF A;  2KRC A;  4NQW B;  1B72 A;  1D5V A;  2WY8 Q;  4DJA A;  1R9T J;  1M1E B;  1BI1 A;  3OYI A;  2RQQ A;  1F36 A;  1QZZ A;  4HZF A;  2VQL A;  2FMY A;  2CG4 A;  2HFH A;  3F8M A;  4I0A A;  5KAF C;  3T8T A;  4U87 A;  2STW A;  4BEH A;  5J4Y A;  1H0M A;  1LJ9 A;  3IWZ A;  5DTD A;  2CU7 A;  1UAA A;  4OIN F;  2X85 A;  3K70 C;  1BOB A;  3CC4 I;  4IHT A;  2UWM A;  1MBJ A;  2DLL A;  2BOL A;  2HYG D;  4JK1 X;  5KVR A;  4C30 A;  1REP C;  2XGD A;  1WKM A;  4NC8 A;  2MYS A;  5DEQ A;  4Y13 A;  3RQI A;  5GAG J;  1EV7 A;  3LAJ A;  3CUO A;  2ESH A;  3JRI A;  1JTY A;  4ABZ A;  3H92 A;  2EZH A;  1LPQ A;  2LSO A;  2Y2Z A;  3M8J A;  3H3U A;  5D8K B;  1FBU A;  2CSO A;  2M87 A;  4HNU A;  4R79 A;  2KDO A;  5IP9 J;  3FIW A;  2R7S A;  2YX7 A;  3WG7 H;  3T8R A;  1TWH J;  1FOK A;  4MO7 A;  2JZY A;  2LKS A;  3KEO A;  3WGI A;  2MD0 A;  3ECH A;  4P5O A;  1U2W A;  2WB1 N;  3HSF A;  3JR9 A;  2JSC A;  2KIU A;  4XRM A;  2OCE A;  3F0C A;  3B6A A;  2O9L A;  3KYC B;  5JFR A;  4A93 J;  3EYY A;  2HYJ A;  4M3B A;  5K7H A;  5ILU A;  3JRC A;  2X6X A;  1TNT A;  2CUF A;  1U0J A;  5E8G A;  2HYF A;  3FWE A;  2H8W A;  3KEQ A;  2YX4 A;  2XAS A;  1IN5 A;  3KZI C;  5DUI A;  1X1P A;  2H27 A;  3QU3 A;  2IAI A;  4W1U A;  3IKT A;  2P5K A;  4GYI A;  3QP6 A;  2RNG A;  2H6B A;  3FHZ A;  4E7L A;  4CCL A;  2LBF B;  1K83 J;  3OYK A;  3PUB A;  2R7D A;  1IF1 A;  4N4O B;  1SFU A;  1H89 C;  1J9I A;  2V1N A;  2GZW A;  4YIR X;  3CO7 C;  1XDU A;  3HSE A;  4EJU A;  3OYB A;  1RUO A;  2P81 A;  2BW3 B;  1WJC A;  5ICC A;  3K4K A;  1GXP A;  4IQ4 A;  2DCE A;  3SFI A;  1QPM A;  2LY2 A;  3I54 A;  1JE8 A;  2XF7 A;  4CSW A;  2EBI A;  1FEX A;  3NAU A;  2PBI A;  4UUS B;  3HHG A;  1NHA A;  2E34 A;  4UXN A;  1UMQ A;  3VYS B;  1AWC A;  2R0Q C;  4BJ5 C;  4L0Z B;  4FHT A;  2V7F A;  1EF4 A;  1E0E A;  5J1U A;  4ITV A;  1IUF A;  1BC7 C;  3QU6 A;  3BJO A;  3A01 A;  1Q1V A;  4WWC A;  3TED A;  2CGP A;  1HXD A;  3JAM Z;  4BDY A;  3W6K B;  2MH9 A;  4M6V A;  5HLT A;  4JBA A;  3KPH A;  4A3D J;  5HDG A;  5E79 C;  3L2U A;  4BUP A;  5JHU A;  1IG7 A;  3CP8 A;  5E1Z B;  1BBY A;  1U8R A;  2RKH A;  3VDX A;  1TNS A;  2HQN A;  4BXU A;  3R0J A;  5LLQ A;  4LIT A;  5F27 A;  1EA3 A;  3LQR A;  2KT0 A;  3FMS A;  2M1B A;  3GO5 A;  4N9I A;  4D1Q A;  2VLA A;  2G9W A;  2X1D A;  1FIA A;  4BS9 A;  1TWC J;  1WJA A;  2KIS A;  3ROU A;  4M9S A;  1WJD A;  2NOG A;  3HL2 A;  3RZD J;  4RGR A;  2XHK A;  2DBB A;  2VJJ A;  4P55 A;  2M5W A;  2Y0M A;  5K5R A;  5D4R A;  3VYU B;  2YU9 J;  2CW8 A;  4ZJZ A;  1FSE A;  2EA2 A;  4AYB A;  4C9Y A;  5CVI A;  1A6I A;  3CES A;  3Q5F A;  3GLL A;  1MSE C;  3ABT A;  1XGS A;  4Y33 A;  2CS3 A;  4BXF A;  4OAZ A;  2VBW A;  3KZZ A;  2ZKZ A;  4U7B A;  2AQE A;  1AHD P;  2XB5 A;  1B8I B;  4UV9 A;  1S3J A;  4R8H A;  3OOU A;  1SFO J;  1ZKG A;  2K9L A;  5A2Q Z;  4FQG A;  3QYF A;  3OV8 A;  1B72 B;  3AL0 C;  3G2B A;  4MQV A;  1R5I D;  1S7O A;  2K9N A;  3EET A;  2IT0 A;  4IEJ A;  4BL0 B;  3FZV A;  4A0X A;  3I4N J;  2VKH A;  2E1O A;  3TQN A;  4LLG F;  3OYE A;  1Y6I A;  3K1P A;  2HDC A;  2Y48 A;  3BR2 A;  4L9V A;  4AVP A;  1LE8 A;  4EM1 A;  2M2E A;  3TGN A;  4MFE A;  4AIH A;  4BEH B;  1QU3 A;  2HQR A;  3OSG A;  2BBY A;  1YO5 C;  2P7C B;  2DO7 A;  1U5T A;  3FDY A;  3DQV C;  3O2P E;  3RPU A;  3L7W A;  4M74 A;  1GDT A;  1XGO A;  2DJN A;  2LDU A;  4R1H A;  4BGD A;  1XTA A;  3FXJ A;  3H9J A;  3E3V A;  3ZMD A;  1P4A A;  1Z21 A;  2QQA A;  4EVI A;  5AIP A;  2N8G A;  5CVJ A;  1SEU A;  3N4M A;  2FNA A;  1RI7 A;  1RPW A;  2L01 A;  2WAQ A;  3L00 A;  2A69 F;  4UVB A;  3LL7 A;  2ZO4 A;  3VYT B;  2W25 A;  4RMN A;  4ESF A;  2QKM B;  1Z05 A;  2K40 A;  3HC7 A;  2IA0 A;  2EH3 A;  2FOW A;  3RKY A;  1WFX A;  2E2H J;  3JCU C;  2UV1 A;  3LA2 A;  3EQL F;  3JTH A;  4U88 A;  2JT1 A;  2H1K A;  1ETX A;  4KIB A;  2OTL I;  2QUF A;  3GEZ A;  2M0C A;  2HOA A;  1IRG A;  3D5R C;  1B1B A;  3QOD A;  3J7Z I;  2L0K A;  1RUN A;  2QEX I;  3F8C A;  3NWS A;  4OIO F;  3DKW A;  2OD5 A;  4LB5 A;  3S3O A;  3HJE A;  2XAQ A;  1G3W A;  3GUD A;  3HHH A;  1CGP A;  2EV6 A;  4I99 C;  2VI6 A;  1ZHF A;  3EPZ A;  3Q9V A;  3BPV A;  3C2H A;  4FE7 A;  5IT3 A;  1CQT A;  3RYP A;  2DW4 A;  2XF5 A;  3U1D A;  2DT7 B;  1LVA A;  2MA3 A;  2IEK A;  2R7R A;  3HOV J;  2K3P A;  1T08 B;  3WHB A;  4UB8 C;  4XOR A;  3WTT C;  5FKM A;  4MHG A;  1ETV A;  2G7H A;  2LRE A;  1ZTR A;  4GGG A;  2L9V A;  2VJ5 A;  4PDK A;  5F0C A;  1A04 A;  1QQI A;  4WX9 A;  4HLY A;  1PJR A;  4GO1 A;  4ZH4 F;  2X6O A;  4GCV A;  4ESB A;  5B3S H;  1SD7 A;  3REO A;  4A5M A;  5ED4 A;  4DBQ A;  1UJ8 A;  4FT8 A;  4KYW A;  1JUS A;  3QPT A;  4KT6 A;  3WTU C;  4FCY A;  1IN4 A;  4KJZ A;  5EEA A;  1TQM A;  3I53 A;  4FX4 A;  5EYR A;  1PP8 F;  2AXL A;  4XLC A;  1WPK A;  5E3L A;  2EQR A;  3W6J B;  1IJW C;  2V6C A;  4I6Z A;  1X58 A;  3SHF A;  1R1U A;  4BE1 A;  4EAT A;  4BJ6 C;  2Z16 A;  1TL8 A;  1A36 A;  3A01 B;  2JQ7 A;  2PMU A;  3SFZ A;  4A0Z A;  3PQK A;  3HOW J;  1DPR A;  1X1C A;  1DUX C;  5HLG A;  3E5U A;  4LOC A;  1P7I A;  1O7F A;  5B1B H;  2KJC A;  4F7Z A;  1TQI A;  2IGN A;  1V5E A;  1R4M B;  1Z3Y A;  1GLN A;  3S2H J;  2L7Z A;  3JRE A;  2D1H A;  1HDD C;  3OYC A;  1YX3 A;  2I5U A;  2OC6 A;  5LHI A;  2ZSI B;  5CQE A;  4L0Y B;  2EZI A;  1Y8Q B;  3HXL A;  3DXJ F;  5H2F C;  1JJ6 C;  3WU0 A;  2L5Q A;  4BAC A;  4IRH A;  5C3E J;  4HV6 A;  3ZQG A;  1E2X A;  2B7E A;  1W7P A;  1TZL A;  4PFO A;  3IH2 A;  3KYD B;  4BE0 A;  3CMA I;  4PJM A;  5AIQ A;  3KP3 A;  1HBX G;  3GFJ A;  3AL0 B;  2F4I A;  2VC1 A;  3M1C A;  1USS A;  3BG5 A;  3M07 A;  5B66 C;  1WHU A;  4QPQ A;  4PUS A;  1OCR H;  1XD7 A;  3GVA A;  1BI0 A;  1UFM A;  2Q8K A;  4UUV A;  2VUM J;  1DPU A;  4JX6 A;  1XG1 A;  3Q9S A;  4MGR A;  3ZMZ A;  2KRH A;  1H8A C;  2QZ8 A;  4V2G A;  2DT6 A;  1P4X A;  2R7T A;  3KLO A;  3RKW A;  3PJR A;  1P9Q C;  2DQR A;  3P7N A;  1Z3X A;  2QCO A;  1D8J A;  1Y1V J;  2M7B A;  1OR7 C;  4XQF A;  3CJR B;  1LNW A;  1X1A A;  2F6C A;  4B48 A;  2OU2 A;  3CUQ A;  5CLS A;  4O3M A;  3VOE A;  2VOD A;  1I50 J;  3D1N I;  1S9H A;  4YFX F;  2J5O A;  4HQM A;  1YHQ I;  2MGQ A;  5H20 A;  1RKW A;  4EJT A;  3GFL A;  2WY7 Q;  3I58 A;  2XF6 A;  4PK4 A;  4JQF A;  1E3H A;  1G3S A;  2OV7 A;  1PYV A;  3H5R A;  4RAZ A;  5B1A H;  4MQ9 F;  3J80 Z;  1OCC H;  2H1L A;  5DV5 A;  2L9N A;  2DK5 A;  1KQ8 A;  1HW5 A;  3QOE A;  4IZZ A;  5F08 A;  3GZN B;  1LFP A;  3TW7 A;  3OOP A;  4YII A;  3IKV A;  3ABU A;  2A5Y B;  1X1B A;  1K4S A;  1JUP A;  1LDJ A;  2DA6 A;  2CH0 A;  3CUQ C;  2F5C A;  4EJV A;  3CLO A;  3FM5 A;  4U7D A;  5E3O A;  4RGU A;  3M1E A;  1R58 A;  1XC5 A;  4HF2 A;  2AO9 A;  3J7A O;  3DBR B;  3LQQ A;  4FET A;  2WC2 A;  1MDM B;  1C0W A;  1IDZ A;  2EJR A;  3BTJ A;  4L5J A;  1D1B A;  1TT0 A;  4G6Q A;  4XMY A;  2CJJ A;  4DW6 A;  1MJ9 A;  2QSG X;  2VT2 A;  3KP5 A;  4XOT A;  3GYH X;  3WE2 A;  5CJ9 A;  1BL0 A;  3HKZ A;  2A3S A;  4CIC A;  1MJB A;  3W2W A;  1IGN A;  3LOC A;  5J1Y A;  3GTO J;  3CDH A;  1P7J A;  1B59 A;  2AS5 F;  1X1D A;  1FMW A;  2DK8 A;  1P4W A;  1TW3 A;  2ELH A;  2IGK A;  5L3C A;  4D5F A;  4IOA F;  2NYX A;  3K9T A;  2OZ6 A;  5L3G A;  3B02 A;  3A02 A;  1V55 H;  2KIQ A;  3CZ6 A;  2PG4 A;  3I5U A;  2JRT A;  4BHB A;  3VFZ A;  2WWY A;  4I09 A;  5IYD J;  3PL8 A;  1Z1D A;  2Q1Z B;  4Y52 J;  1Z91 A;  2NS0 A;  2A6T A;  4HPQ A;  2TRT A;  1EH6 A;  1EKE A;  3HB9 A;  2DJI A;  2JTV A;  5FRM A;  3VOD A;  2H8R A;  3B6C A;  2ADU A;  4BJT A;  1HLV A;  1GT0 C;  4F3Q A;  1MMG A;  3HUG A;  5EEG A;  4M3G A;  3OY9 A;  3QWL A;  3TO6 A;  2FXA A;  3OIP A;  4DZJ A;  2B63 J;  1ITY A;  4Y4R A;  2M8G X;  2MG4 A;  4ZYE A;  2X9D A;  3M9A A;  2CV2 A;  3TP0 A;  3TDU C;  3QOP A;  4L18 B;  2Z99 A;  2DA5 A;  3WTV C;  1K7A A;  3K4M A;  3FXM A;  1F1Z A;  1X3U A;  4DIQ A;  3IRQ A;  2PEX A;  3LMM A;  1Y39 A;  2Z33 A;  4QTR A;  3KP2 A;  1U78 A;  3TOA A;  2IW5 A;  2LKX A;  1YJW I;  4CDG A;  3CLQ A;  5E1W A;  1X2N A;  4AIK A;  5DS9 A;  3T5X A;  4PGH A;  1J2X A;  2HWV A;  2V4J C;  3MCZ A;  4G9Y A;  3OYH A;  3CC7 I;  2VC0 A;  3OIO A;  3G1O A;  1IN6 A;  2VJI A;  2F48 A;  1SD6 A;  2OQR A;  3KIO A;  1G3T A;  4Q4Z F;  1JXS A;  2XGC A;  4HG2 A;  3S17 J;  3F72 A;  3OYD A;  2QLZ A;  1ZG3 A;  2MD5 A;  4BY1 J;  4IX7 A;  4XRF A;  2M45 A;  2GM4 A;  2HKX A;  1R4N B;  4O5V A;  1B9M A;  3CO6 C;  2CO5 A;  2JA5 J;  4CYD A;  1D1A A;  1YIO A;  4ZDO A;  3I0T A;  3N05 A;  3PFI A;  2YSR A;  4OIP F;  1TC3 C;  2MAB A;  3MEX A;  5FKK A;  2L9S A;  4XKW A;  4ESJ A;  3JTG A;  4NDL A;  4DNC A;  1W7P B;  1SVL A;  4IXA A;  2VKV A;  3OWT A;  3DCF A;  4IQJ A;  1MND A;  2K7L A;  2EV0 A;  3HOX J;  4XIC A;  1DGR M;  1FY7 A;  2UUZ A;  3MVP A;  3DBH B;  2P6T A;  2CQN A;  1ON2 A;  2EFP A;  2GAU A;  2X1E A;  4N4N B;  2QKL B;  2OJE D;  3IAM 2;  1D5Y A;  4AC0 A;  5K7F A;  6PAX A;  2O8X A;  1ORK A;  3C2B A;  4IPA A;  5DM6 F;  1BIB A;  2K4J A;  5H6R A;  3GLX A;  4G8X A;  4RAY A;  5HLH A;  3U2R A;  2HU9 A;  2J5P A;  1ZH5 A;  3J81 Z;  3IV5 A;  4WCG A;  4OMZ A;  4X1E A;  1UZC A;  2A61 A;  4KN7 X;  1RZ4 A;  4G94 A;  1VQN I;  3CUQ B;  4P96 A;  2BEO A;  3G1L A;  4EV0 A;  2Y75 A;  5HLI A;  1UHM A;  3AG1 H;  3BZC A;  2CFX A;  1XN7 A;  3S8P A;  3ERE D;  2EIM H;  2QA4 I;  3JRG A;  3DU6 A;  3S3M A;  5HVQ C;  1SD4 A;  3BG6 A;  4M9X A;  3OR2 C;  5IOZ A;  3HZJ A;  3H9G A;  3C3W A;  4HYE A;  4XLA A;  5DD8 A;  4C3I J;  3IRR A;  2OPT A;  2OCC H;  1A5J A;  2ZJQ F;  2XGE A;  4HBL A;  4XL9 A;  4CGZ A;  2NS7 A;  1TP4 A;  2CWE A;  4FE4 A;  3GW2 A;  4ZYH A;  3VWB A;  1YJ9 I;  2BXZ A;  2EIL H;  4V2F A;  1WZ2 A;  2BZT A;  3H3V K;  3ONQ A;  3AG3 H;  1FP2 A;  2HQA A;  2DPU A;  3WTZ A;  2FRH A;  3MWM A;  4D9J A;  4EJW A;  3LAP A;  1VF9 A;  4LFU A;  4UV8 A;  1ZGA A;  3TP3 A;  2HVS A;  1RET A;  2BXY A;  2HDD A;  1J0R A;  3J7Y J;  3CJN A;  1IN7 A;  3KP7 A;  1D3Y A;  4HAM A;  3U9G A;  3K2Z A;  5JHF A;  1WH5 A;  2LD5 A;  4N0B A;  4L9N A;  2XKP A;  4XN0 A;  1XSX A;  4XON A;  2W00 A;  4IL6 C;  1ZG5 A;  1FT9 A;  3PSI A;  2R5Z A;  5M5W J;  3HTS B;  4KUM A;  4OAY A;  1R1V A;  2VON A;  1IXR C;  1FTZ A;  2GIV A;  2M0M A;  1JI8 A;  2KFD A;  2PMZ N;  4KT5 C;  1V3F A;  2C6Y A;  3M8F A;  3H36 A;  2FNP A;  1STZ A;  3OYL A;  4ANJ A;  5BNG A;  1ETQ A;  3SDB A;  5JVT A;  4RA2 A;  1LFB A;  3DTE A;  3VYR B;  1K79 A;  1ZRC A;  4I0B A;  2HNH A;  3QPS A;  4JX5 A;  3RTR A;  3HUG B;  5CPR B;  3L09 A;  1JHF A;  2ZJ2 A;  5DCF A;  1MH4 A;  2XVC A;  2HXI A;  3FKI J;  3HOY J;  1MW7 A;  2F5E A;  1IRF A;  1YS7 A;  3DEU A;  4IVN A;  4HQE A;  1CF7 A;  1MNM C;  2ZJR F;  1TTY A;  1J09 A;  3ZMU A;  5EDN A;  2R4G A;  5F04 A;  3S3N A;  4RM3 A;  4CCJ A;  4MTD A;  4EMS A;  2JUC A;  2DAO A;  3CMM A;  3DPL C;  5E3M A;  2PX9 A;  2FE3 A;  2K3F A;  2E60 A;  2O3F A;  2P4W A;  1D0Y A;  5FB2 A;  1X19 A;  2X6W A;  4RGX A;  3TOB A;  2ZB9 A;  3PM1 A;  2KMU A;  4PJJ A;  2R7V A;  4PCQ A;  1BJZ A;  3WOD F;  2TCT A;  4HEA 2;  4XSZ F;  1MD0 A;  2M7A A;  1OFC X;  3GCM A;  3KX2 A;  4E7K A;  1GUU A;  3SZT A;  3RDI A;  1XPX A;  2HR3 A;  1I3Q J;  1FIP A;  2GIZ A;  2OTJ I;  1TWA J;  2OZU A;  1VQK I;  1MMS A;  1S7A A;  1YW8 A;  2EIN H;  2F4O B;  5FO5 A;  1QA6 A;  3PFY A;  1S29 A;  4D0P A;  5F6F A;  4RDU A;  2K9S A;  4KIS A;  1F4K A;  1T95 A;  1MGT A;  3PNY A;  3F6O A;  4X6A J;  1YI2 I;  1HDP A;  2Z1D A;  2VL8 A;  4BAY A;  3B73 A;  1R36 A;  2KL4 A;  2ZFW A;  2DOF A;  1DU0 A;  4XLP F;  3EUK L;  2BY0 A;  2HDW A;  2DFH A;  3L9F A;  4M71 A;  1IV6 A;  4XK4 A;  1YE9 A;  3BT9 A;  2X0L A;  2QQB A;  4A6E A;  1LQ1 A;  1F9N A;  1U9N A;  4GRI A;  2L2O A;  2M4K A;  2W84 A;  3VB2 A;  5IYC J;  2A07 F;  2DXI A;  2KLO A;  1R49 A;  1Z77 A;  2G0E A;  5FGM A;  4Y7N J;  1ONV A;  4RB0 A;  1QZY A;  2KPM A;  4L9T A;  1ZAO A;  1Z0X A;  2O7O A;  3ABM H;  3H35 A;  3RPQ A;  4DYC A;  2PJR B;  1R22 A;  3HKZ N;  2RQP A;  3IAS 2;  3EDP A;  1ZAR A;  2NS8 A;  2CUE A;  3LSJ A;  4PJN A;  1IC8 A;  1Z7U A;  4ZTF A;  3K4N A;  4LK0 F;  1RR7 A;  2XRO A;  4Y15 A;  1OYI A;  1L0O C;  3ZPL A;  1HOM A;  3ESW B;  4I98 B;  4ZTJ A;  2FEZ A;  2QWW A;  2VB6 A;  4C3H J;  3RKQ A;  3FXO A;  5IT9 Z;  2EK5 A;  4KNY A;  2ZXH A;  2ZNZ A;  4IKF A;  3CJT B;  2DT5 A;  4OWR B;  1ZEL A;  2K85 A;  2UZK A;  5F1J A;  2XAF A;  3TW6 A;  2P8T A;  4RB1 A;  3A03 A;  2HZD A;  4B4C A;  1V54 H;  4G12 A;  1YG2 A;  2JMW A;  4ZYG A;  4MTE A;  3BZ6 A;  1MIJ A;  4M6X A;  3GTM J;  3NAR A;  1ZK8 A;  3OSF A;  2ACJ A;  1FBQ A;  4XRS G;  3I64 A;  3TKY A;  3U1K A;  4Q48 A;  1KQ9 A;  2I10 A;  2VKE A;  2ELJ A;  4J01 A;  2VBY A;  4A3G J;  1OYY A;  1X4P A;  4L5I A;  5FFX A;  4A3L J;  4ZZL A;  5FLX Z;  4ZYD A;  1ZLJ A;  2BGC A;  2P6S A;  2VPR A;  4D5C A;  3AAF A;  4EGY A;  4BBR J;  3CDI A;  3DFG A;  3I55 I;  1MMN A;  3LFK A;  1JHH A;  3DKX A;  3GFM A;  1R5G A;  3G6E I;  3GTG J;  1FMV A;  2R5Z B;  4HF1 A;  3MKW B;  1H9T A;  1AKH B;  1MDM A;  4XBF A;  3JSP A;  2CQK A;  2DTZ A;  1K6O A;  5F1R A;  3CMY A;  3CCU I;  4E6K G;  3JRB A;  5CKT A;  1XMA A;  5GTI C;  4MLO A;  3P9K A;  1ERD A;  5D6E A;  2E2I J;  2E1C A;  4M3E A;  5HNF A;  1HA8 A;  2MLG A;  2QYO A;  1HQC A;  1KGS A;  5LRR A;  4ENM A;  4LG3 A;  4XKB A;  3S1M J;  1GXQ A;  1QVU A;  3L2W A;  3FXQ A;  3BWG A;  5KHD A;  3F8F A;  3R4K A;  3GTL J;  4ZDP A;  3K4B A;  2KQR A;  3S2W A;  3S15 J;  1FYK A;  3NEU A;  4ENJ A;  4E7J A;  3ZOB A;  1AU7 A;  2XKO A;  1CF7 B;  3SZG A;  2L4A A;  2WA0 A;  5BQT A;  3E1S A;  1ACI A;  4D7N A;  4HX7 A;  3CCQ I;  4HF0 A;  4CCM A;  2QQ8 A;  4JYK A;  2CMP A;  1B9N A;  1IXS B;  2KKO A;  2BY1 A;  1U8B A;  3BP8 A;  3FXU A;  3H9Q A;  2GQQ A;  2YUS A;  3MZ8 A;  5IYB J;  2K9Q A;  4IHV A;  1VQ5 I;  3V4G A;  1YTY A;  4CCN A;  2DYR H;  2PFB A;  2XAH A;  3IWF A;  5HS7 A;  4KFC A;  5J40 A;  3V8L A;  2LFB A;  3BR6 A;  2MSY A;  2PMH A;  1P6R A;  2KIM A;  4LIU A;  2MW8 A;  3TO7 A;  3G73 A;  4H0E A;  5J8C A;  4HLX A;  3TBI A;  1QHH D;  4XNF A;  1D0Z A;  3IL2 A;  1X3Z B;  3ASN H;  3ERM A;  2X6Y A;  1QHG A;  3Q0U A;  4AM3 A;  2E35 A;  4E7Z A;  1RR8 C;  3A0H C;  5FRO A;  3ZMS A;  4F92 B;  1F43 A;  3O8G A;  2F5F A;  2JWT A;  3JAM K;  4DGW B;  4Q47 A;  2WAF A;  3NWT A;  3WU1 B;  1VQO I;  2EZL A;  2RVC A;  3HIF A;  2NOJ B;  3VSK A;  2DOE A;  4WK8 F;  2V79 A;  5D5X B;  3DWL E;  2EWN A;  2LG4 A;  4CUG A;  2WV0 A;  4BQN A;  1EJ9 A;  1SD5 A;  2GLO A;  4A12 A;  3JRF A;  4UY8 I;  2KHM A;  4A3F J;  2JA8 J;  1POG A;  3ZQI A;  3FM3 A;  3HM5 A;  1JKQ C;  1FOX A;  3ECO A;  2F5D A;  1W36 D;  1MH3 A;  2MLK A;  4P1W A;  2NVT J;  4Y17 A;  3ZN0 A;  5LHG A;  2NRA C;  1OR7 A;  2HOE A;  3DTK A;  5LEK A;  1WWX A;  2R92 J;  5DDG A;  5HOD A;  1W36 C;  1SAN A;  2E36 A;  1FOW A;  1XSD A;  1W0U A;  2ZBK A;  4V19 K;  5EGO A;  3W2A A;  2P0W A;  4XLE A;  1I5Z A;  3IH4 A;  1G8X A;  3QYB A;  3BTC A;  4NNJ A;  3GTQ J;  2K27 A;  1E17 A;  4BY7 J;  4G7Z F;  4CYC A;  1KU2 A;  1V4R A;  5LGU A;  2K9M A;  1OCO H;  3SZP A;  3TDZ C;  3S14 J;  2ZC2 A;  5EJC A;  5A2Q K;  4K2E A;  2IJL A;  3W3C A;  2STT A;  2F5V A;  5LD2 C;  3RZO J;  4LD5 A;  1BI3 A;  4UHT A;  1SC7 A;  3KFW X;  1P2F A;  5KK1 A;  2DA7 A;  3DEW A;  1J7K A;  4RM2 A;  4KIF A;  1TLH B;  2VKD A;  3CDL A;  3ZQQ A;  1HKQ A; 
#chains in the Genus database with same CATH homology
 2IP2 A;  2JPC A;  3K0L A;  4RS8 A;  3RI4 A;  1FWZ A;  2QBY A;  3EYI A;  1U6G A;  2FML A;  3COA C;  4BYY A;  4HV5 A;  2V9V A;  3HRS A;  1HKS A;  2FBI A;  1D8K A;  1R00 A;  4O6J A;  1R7J A;  3QPH A;  3RKX A;  4A6D A;  1QGP A;  2MC3 A;  3BRO A;  4AIJ A;  5FFZ A;  1BN5 A;  4S04 A;  1WI9 A;  1HKT A;  3BJ6 A;  4MNU A;  1SMT A;  3LST A;  1I1G A;  2W24 A;  3WE3 A;  1J59 A;  2JPB A;  5D5V B;  1S8N A;  5ERI A;  4HDV A;  1GVJ A;  1FX7 A;  2D1V A;  2YPR A;  3MZY A;  2HTS A;  1RNL A;  3JSO A;  4IJA A;  1T98 A;  4S05 A;  3KLN A;  3BOQ A;  4DQ2 A;  1T6S A;  4OIR F;  4G7O F;  1I27 A;  2VOO A;  1J75 A;  1YS6 A;  5L3D A;  2GXB A;  3H3Z A;  2FA5 A;  1Z9C A;  4CXF A;  5D8L B;  3LA3 A;  2FU4 A;  4P9U A;  5D5U B;  3R6S A;  2GWR A;  3ML6 A;  3BPX A;  5ILV A;  2XAG A;  1U3E M;  1G6N A;  1Z6R A;  2WTE A;  2LNB A;  3T0Y A;  2IA1 A;  3C1D A;  2FF4 A;  4B09 A;  2VE9 A;  2GA1 A;  2A6E F;  1T39 A;  4LG0 A;  5TRD A;  2P5V A;  2QEN A;  3E6B A;  1O57 A;  2EFW A;  2P5L C;  2D2W A;  3O3K A;  1O3Q A;  2ETH A;  3ISP A;  3F23 A;  1ZN2 A;  2O61 A;  1PUE E;  2K4B A;  3HYI A;  3R60 A;  1RIO H;  1F5T A;  1T2K A;  5L3B A;  3L2C A;  4I2O A;  1I6X A;  2MBF A;  1LDD A;  3C7J A;  3WTY C;  4KDP A;  2KRF A;  2PN6 A;  5BPI A;  1YQA A;  3V7S A;  1DDN A;  5CVV A;  1W4M A;  2H09 A;  1I1S A;  5DCM A;  4ZZD A;  5D6F A;  2UXN A;  3N97 A;  2XAJ A;  2HKO A;  2VXZ A;  1XSV A;  2TDX A;  2E7X A;  3I71 A;  4LLN A;  2DFI A;  1PDN C;  2W85 A;  1JGS A;  5L3E A;  4ENK A;  4A0Y A;  4IRI A;  1FP1 D;  3GX4 X;  3J80 K;  2QBY B;  4OU0 A;  1ODD A;  1Y0U A;  3WTX C;  1ZLK A;  1WSU A;  1DP7 P;  2NNY A;  4LLL A;  3ZQ7 A;  2XUB A;  3G3Z A;  1OPC A;  3ZP5 A;  1R23 A;  1L3L A;  4IRG A;  1O3T A;  2ISZ A;  1XGN A;  1XMK A;  3FMQ A;  1IAW A;  2DQL A;  2H94 A;  3ULQ B;  2OA4 A;  5DYM A;  1SFX A;  3V8J A;  1W5T A;  4HW0 A;  4GYG A;  1T38 A;  2DTR A;  4KMU X;  1K78 A;  3RJP A;  2BYV E;  1BJA A;  4LMY A;  3HRM A;  1J5Y A;  3GZ5 A;  4AWX B;  3GFI A;  2UXX A;  3MQ0 A;  1LDK B;  3K69 A;  2M30 A;  3QP5 A;  5LEJ A;  3V7R A;  4OMY A;  2LF7 A;  5TJJ A;  4B8X A;  3IHU A;  1P92 A;  5LGN A;  1HSJ A;  4ENN A;  5D4S A;  1IUY A;  4I02 A;  5LHH A;  1MZB A;  1FSH A;  2FSW A;  4U0V A;  4UVC A;  4YFN F;  1TW2 A;  1SAX A;  1XDS A;  2XIG A;  2RV8 A;  5ILS A;  4P9F A;  3KE2 A;  2FQ3 A;  4WF2 A;  2XGX A;  4LG0 B;  3WTS C;  2A68 F;  5DD4 A;  4MEX F;  3WGH A;  2ZXJ A;  1HW1 A;  2M8E A;  2HEO A;  5BMZ A;  1UCR A;  4FX0 A;  3F22 A;  2ISY A;  4L9J A;  3E6M A;  1KYZ A;  2DPD A;  1BOA A;  2ZME A;  4OIQ F;  4RGS A;  2DI3 A;  3M8E A;  3DPT A;  5LBQ A;  3WTW C;  5E17 F;  3BY6 A;  5E18 F;  4M73 A;  5CVR A;  5D5W B;  3CTA A;  1MKM A;  3R61 A;  3T1B A;  1ZG1 A;  3M7G A;  2ESN A;  2F2E A;  3J81 K;  2QM3 A;  3E6D A;  5DCM B;  5K1Y A;  2R3S A;  1TQP A;  1YYV A;  1QO0 D;  1OMI A;  1FNN A;  3F8N A;  3SQN A;  4AD9 A;  3FXR A;  1KU3 A;  3F21 A;  4QWQ A;  1B4A A;  3MFK A;  5H6Q A;  2Z3Y A;  4GXO A;  5K5Q A;  4I01 A;  1O7L A;  1YW9 A;  3HSR A;  1OYW A;  3LA7 A;  4HDU A;  1VTN C;  4EQQ A;  4WXD A;  2BV6 A;  1HW2 A;  4M6Y A;  4N9H A;  1SFE A;  1FPQ A;  2GXG A;  3KZY A;  1G3Y A;  3R0A A;  2HGC A;  2RGV A;  1FYM A;  3V8K A;  3IC7 A;  1OKR A;  3HOT A;  3I4P A;  3HTU A;  3JW4 A;  2IRF G;  2FBH A;  4U0W A;  2KJB A;  3SXY A;  1KA8 A;  2IA2 A;  2QQ9 A;  2K86 A;  1KU7 A;  1YLF A;  2YR2 A;  2W57 A;  1WQ2 A;  2E1N A;  3MZH A;  1K78 B;  3NRV A;  4LB6 B;  4M9Z A;  1YW7 A;  5K5O A;  4G6D A;  4YG2 F;  2KIF A;  4U0Y A;  4WXH A;  4LGW A;  2XV4 S;  1TBX A;  2NAZ A;  2L4M A;  5FD6 A;  2RDP A;  3ELK A;  4HX8 A;  2VT3 A;  3NQO A;  2R7F A;  2V1D A;  3TO9 A;  1WRJ A;  3KP4 A;  1U5T C;  2PQ8 A;  3DP7 A;  5FD5 A;  1PP7 U;  2XRN A;  1ZRE A;  1R5H A;  4KA4 A;  1BIA A;  3LWF A;  4XSX F;  5BS6 A;  4LK1 F;  1XGM A;  2LF8 A;  4CO8 A;  1ZGJ A;  3E5Q A;  4HX4 A;  3F8B A;  4KN4 X;  4ASN A;  1O3R A;  2OQG A;  2PI0 A;  2VBZ A;  1IZ1 A;  1FZP B;  4NB5 A;  3K1N A;  3FX3 A;  1SMY F;  4BHP A;  5HDK A;  3RYR A;  2PLY A;  1BI2 A;  4ON0 A;  2FBK A;  5ICE A;  2RC4 A;  2ZME B;  1YFH A;  4BH9 A;  2GA2 A;  5CVU A;  3VEP A;  4PGG A;  1FC3 A;  1G4D A;  2Z9O A;  1HST A;  3KET A;  2EA4 A;  1FYL A;  4QLC U;  2K02 A;  1O3S A;  3I59 A;  4OOI A;  3MAJ A;  2OBP A;  1S6L A;  4KMF A;  4MEY F;  2H6C A;  5HS9 A;  4NHJ A;  2VN2 A;  1KU9 A;  5HDN A;  1ON1 A;  4E70 A;  1KYW A;  2V1X A;  4EJO A;  4LJZ F;  5IT9 K;  3PQJ A;  2PJP A;  1EH8 A;  5BOX A;  4BHC A;  3FF5 A;  1W7P D;  2IVM A;  4BQA A;  3RIR A;  4CZZ A;  3GWZ A;  3WGG A;  2D45 A;  3QAH A;  5LGT A;  5FLX K;  1UHW A;  5DUK A;  4EGZ A;  2O6G E;  2EB7 A;  1ZRF A;  4A5N A;  1LEB A;  1XCB A;  1XCV A;  2VE8 A;  3BDD A;  5HOO A;  1ZRD A;  1GHC A;  4TV7 A;  1U5T B;  1ZYR F;  4IHS A;  1EH7 A;  2Z5U A;  4NQW A;  3P9I A;  4ETS A;  2X4H A;  3D5L A;  3KCC A;  3ZMT A;  1IW7 F;  1UB9 A;  4EM0 B;  3DV8 A;  4Z2Y A;  1LB2 A;  5E1X A;  3GZ6 A;  3F6V A;  1Q1H A;  4PZJ A;  2ZCW A;  2LKP A;  1IN8 A;  5L3F A;  4KIC A;  5J8F A;  2P7V B;  5HS8 A;  4G7H F;  3GXO A;  3QRF F;  2EFN A;  3FMR A;  2G7U A;  2B0L A;  3F3X A;  3DF8 A;  2IPQ X;  5JR3 A;  2L3D A;  2A6H F;  4WXC A;  2DU9 A;  2YU3 A;  3P9C A;  2O03 A;  2CYY A;  3ZMV A;  4RB2 C;  5BPD A;  5EEH A;  3D0S A;  2O0Y A;  1Z6T A;  4HOB A;  1LEA A;  2FOK A;  1W5S A;  3HRU A;  5CYV A;  1MJA A;  5E20 A;  3E6C C;  4RB3 C;  3HRT A;  3WG9 A;  1FLI A;  4KIG A;  3E5X A;  2VOP A;  2V1U A;  2L02 A;  3I59 B;  4I7H A;  2RN7 A;  1IXC A;  1T0F A;  2HTJ A;  4A2U A;  2Q2E A;  5ICG A;  2E7W A;  2L54 A;  1XB4 A;  4UNO A;  4HA8 A;  5E8I A;  4IF4 A;  4Q5S F;  1BM9 A;  4YFK F;  3GF2 A;  2ZNY A;  4CHU A;  3V7C A;  1AOY A;  3K1M A;  3EUH A;  1FBS A;  5LRS A;  1BC8 C;  2EV5 A;  2BE5 F;  4BNC A;  2HZT A;  2MH2 A;  1QNT A;  5J6X A;  3KP6 A;  3O6B B;  2HS5 A;  5AON A;  5F64 A;  1ULY A;  2COM A;  1UST A;  1H9G A;  2CW0 F;  4UVA A;  2RNJ A;  1KQ0 A;  2NNN A;  4YIF A;  1R1T A;  4XLN F;  3BJA A;  4EM2 A;  2QVO A;  3ZN1 A;  4M72 A;  2EFQ A;  2OAZ A;  5ICF A;  3E97 A;  2VBX A;  1B6A A;  3C18 A;  5JI6 A;  2EFO A;  2Q0O A;  3HOS A;  1QBJ A;  1D5V A;  1BI1 A;  1QZZ A;  4HZF A;  2FMY A;  2CG4 A;  2HFH A;  3F8M A;  4I0A A;  3T8T A;  2STW A;  1H0M A;  1LJ9 A;  3IWZ A;  4OIN F;  4IHT A;  2UWM A;  2DLL A;  2HYG D;  4JK1 X;  5KVR A;  1REP C;  1WKM A;  5DEQ A;  4Y13 A;  1EV7 A;  3LAJ A;  3CUO A;  2ESH A;  3H92 A;  2LSO A;  3H3U A;  5D8K B;  1FBU A;  2CSO A;  2M87 A;  4R79 A;  2YX7 A;  3T8R A;  1FOK A;  2JZY A;  3KEO A;  3WGI A;  3ECH A;  4P5O A;  1U2W A;  3HSF A;  2JSC A;  2KIU A;  5JFR A;  3EYY A;  5ILU A;  5E8G A;  1TNT A;  2HYF A;  3FWE A;  3KEQ A;  2YX4 A;  2XAS A;  1IN5 A;  5DUI A;  2H27 A;  3QU3 A;  3IKT A;  2P5K A;  4GYI A;  3QP6 A;  2H6B A;  3FHZ A;  1IF1 A;  2R7D A;  1SFU A;  1J9I A;  2GZW A;  3CO7 C;  1XDU A;  3HSE A;  4EJU A;  1RUO A;  5ICC A;  1GXP A;  1QPM A;  3I54 A;  1JE8 A;  2PBI A;  3HHG A;  1NHA A;  4UXN A;  1AWC A;  4L0Z B;  4FHT A;  1BC7 C;  3QU6 A;  3BJO A;  4WWC A;  2CGP A;  1HXD A;  3JAM Z;  3W6K B;  2MH9 A;  4JBA A;  5HDG A;  5JHU A;  5E1Z B;  1U8R A;  1BBY A;  2RKH A;  1TNS A;  2HQN A;  4BXU A;  3R0J A;  5LLQ A;  3LQR A;  4N9I A;  3FMS A;  2M1B A;  3GO5 A;  2G9W A;  3ROU A;  4M9S A;  4RGR A;  2XHK A;  2DBB A;  4P55 A;  2M5W A;  2Y0M A;  5K5R A;  5D4R A;  1FSE A;  2EA2 A;  5CVI A;  3Q5F A;  3ABT A;  1XGS A;  2VBW A;  3KZZ A;  2ZKZ A;  4U7B A;  4UV9 A;  1S3J A;  4R8H A;  5A2Q Z;  3OV8 A;  4MQV A;  1S7O A;  3EET A;  2IT0 A;  3FZV A;  4A0X A;  3TQN A;  4LLG F;  3K1P A;  2HDC A;  2Y48 A;  4L9V A;  4AVP A;  4EM1 A;  3TGN A;  4AIH A;  2HQR A;  2BBY A;  1YO5 C;  2P7C B;  2DO7 A;  1U5T A;  3O2P E;  3DQV C;  3RPU A;  3L7W A;  4M74 A;  1XGO A;  2LDU A;  4R1H A;  3E3V A;  3ZMD A;  1P4A A;  2QQA A;  4EVI A;  5AIP A;  5CVJ A;  3N4M A;  2FNA A;  1RI7 A;  2L01 A;  3L00 A;  2A69 F;  4UVB A;  2ZO4 A;  2W25 A;  4ESF A;  1Z05 A;  2IA0 A;  3RKY A;  3LA2 A;  3EQL F;  3JTH A;  4U88 A;  2JT1 A;  4KIB A;  2QUF A;  3GEZ A;  1IRG A;  1B1B A;  1RUN A;  3F8C A;  4OIO F;  3DKW A;  2OD5 A;  4LB5 A;  2XAQ A;  1G3W A;  3GUD A;  3HHH A;  1CGP A;  2EV6 A;  3Q9V A;  1ZHF A;  3BPV A;  5IT3 A;  3RYP A;  2DW4 A;  3U1D A;  1LVA A;  2MA3 A;  3WTT C;  4MHG A;  2G7H A;  4GGG A;  4PDK A;  1A04 A;  1QQI A;  4WX9 A;  4HLY A;  4GO1 A;  4ZH4 F;  4GCV A;  4ESB A;  1SD7 A;  3REO A;  4A5M A;  5ED4 A;  4FT8 A;  4KYW A;  3QPT A;  3WTU C;  1IN4 A;  1TQM A;  3I53 A;  4FX4 A;  1PP8 F;  2AXL A;  3W6J B;  2V6C A;  3SHF A;  1R1U A;  2PMU A;  3SFZ A;  4A0Z A;  3PQK A;  1DPR A;  1DUX C;  5HLG A;  3E5U A;  1O7F A;  4F7Z A;  2KJC A;  1TQI A;  2D1H A;  5LHI A;  4L0Y B;  3DXJ F;  3WU0 A;  4IRH A;  4HV6 A;  1E2X A;  1W7P A;  5AIQ A;  3KP3 A;  1HBX G;  3GFJ A;  2VC1 A;  1USS A;  1XD7 A;  3GVA A;  1BI0 A;  1UFM A;  2Q8K A;  4UUV A;  1DPU A;  3Q9S A;  4MGR A;  3ZMZ A;  2QZ8 A;  1P4X A;  3KLO A;  3RKW A;  2DQR A;  3P7N A;  1D8J A;  1LNW A;  2OU2 A;  3CUQ A;  5CLS A;  4O3M A;  3VOE A;  2VOD A;  4YFX F;  2J5O A;  4HQM A;  5H20 A;  4EJT A;  3GFL A;  3I58 A;  4JQF A;  1G3S A;  4RAZ A;  4MQ9 F;  3J80 Z;  5DV5 A;  2DK5 A;  1KQ8 A;  1HW5 A;  3OOP A;  4YII A;  3IKV A;  3ABU A;  2A5Y B;  1LDJ A;  3CUQ C;  2F5C A;  4EJV A;  3CLO A;  3FM5 A;  4U7D A;  4RGU A;  3M1E A;  1R58 A;  4HF2 A;  3J7A O;  3LQQ A;  2WC2 A;  1MDM B;  1C0W A;  2EJR A;  4L5J A;  4G6Q A;  1MJ9 A;  2VT2 A;  3KP5 A;  3GYH X;  3WE2 A;  5CJ9 A;  2A3S A;  4CIC A;  1MJB A;  3CDH A;  2AS5 F;  1B59 A;  2DK8 A;  2ELH A;  1P4W A;  1TW3 A;  5L3C A;  2NYX A;  3K9T A;  2OZ6 A;  5L3G A;  3B02 A;  2PG4 A;  3I5U A;  2JRT A;  4BHB A;  3VFZ A;  2WWY A;  4I09 A;  1Z1D A;  1Z91 A;  2NS0 A;  1EH6 A;  2JTV A;  3VOD A;  2ADU A;  3HUG A;  5EEG A;  3TO6 A;  2FXA A;  4ZYE A;  3M9A A;  3TDU C;  3QOP A;  4L18 B;  2Z99 A;  1K7A A;  3WTV C;  3IRQ A;  1F1Z A;  1X3U A;  2PEX A;  2Z33 A;  3KP2 A;  1U78 A;  3TOA A;  2IW5 A;  4CDG A;  5E1W A;  4AIK A;  3T5X A;  4PGH A;  1J2X A;  2HWV A;  4G9Y A;  3MCZ A;  2VC0 A;  1IN6 A;  1SD6 A;  2OQR A;  1G3T A;  4Q4Z F;  1JXS A;  3F72 A;  2QLZ A;  1ZG3 A;  2MD5 A;  4XRF A;  2M45 A;  2HKX A;  4O5V A;  1B9M A;  3CO6 C;  2CO5 A;  4CYD A;  1YIO A;  3I0T A;  3PFI A;  4OIP F;  2YSR A;  3MEX A;  4ESJ A;  3JTG A;  4DNC A;  1W7P B;  4IXA A;  2K7L A;  2EV0 A;  1FY7 A;  2P6T A;  1ON2 A;  2EFP A;  2GAU A;  6PAX A;  2O8X A;  4IPA A;  1BIB A;  2K4J A;  5H6R A;  3GLX A;  4G8X A;  4RAY A;  5HLH A;  3U2R A;  2J5P A;  1ZH5 A;  3J81 Z;  4WCG A;  4OMZ A;  2A61 A;  4KN7 X;  1RZ4 A;  4G94 A;  3CUQ B;  4P96 A;  2BEO A;  4EV0 A;  2Y75 A;  5HLI A;  1UHM A;  2CFX A;  1XN7 A;  3ERE D;  5HVQ C;  1SD4 A;  4M9X A;  3C3W A;  4HYE A;  5DD8 A;  3IRR A;  4HBL A;  4CGZ A;  2CWE A;  3GW2 A;  4ZYH A;  1FP2 A;  2DPU A;  3WTZ A;  2FRH A;  3MWM A;  4EJW A;  3LAP A;  4LFU A;  4UV8 A;  1ZGA A;  1J0R A;  3CJN A;  1IN7 A;  3KP7 A;  1D3Y A;  4HAM A;  3U9G A;  3K2Z A;  4N0B A;  4L9N A;  2XKP A;  1XSX A;  1ZG5 A;  1FT9 A;  3HTS B;  4KUM A;  1R1V A;  2VON A;  1IXR C;  2GIV A;  4KT5 C;  1V3F A;  2C6Y A;  3M8F A;  2FNP A;  1STZ A;  5JVT A;  1ZRC A;  1K79 A;  4I0B A;  3RTR A;  3L09 A;  1JHF A;  2ZJ2 A;  5DCF A;  2XVC A;  2F5E A;  1IRF A;  1YS7 A;  3DEU A;  4IVN A;  4HQE A;  1CF7 A;  1TTY A;  3ZMU A;  4MTD A;  4EMS A;  2DAO A;  3DPL C;  2FE3 A;  2O3F A;  2P4W A;  5FB2 A;  4RGX A;  3TOB A;  4PCQ A;  3WOD F;  4XSZ F;  1MD0 A;  3SZT A;  3RDI A;  2HR3 A;  2OZU A;  1S7A A;  1YW8 A;  5FO5 A;  1S29 A;  4D0P A;  5F6F A;  1F4K A;  1MGT A;  3F6O A;  4BAY A;  3B73 A;  1R36 A;  2ZFW A;  4XLP F;  3L9F A;  4M71 A;  2X0L A;  2QQB A;  4A6E A;  1LQ1 A;  1F9N A;  2W84 A;  3VB2 A;  2A07 F;  5FGM A;  1ONV A;  4RB0 A;  1QZY A;  4L9T A;  1ZAO A;  3RPQ A;  1R22 A;  2RQP A;  3EDP A;  1ZAR A;  1Z7U A;  4LK0 F;  2XRO A;  4Y15 A;  1OYI A;  1L0O C;  3ZPL A;  4I98 B;  2FEZ A;  2QWW A;  5IT9 Z;  2EK5 A;  4KNY A;  2ZNZ A;  2DT5 A;  2UZK A;  2XAF A;  2P8T A;  4RB1 A;  1YG2 A;  4ZYG A;  4MTE A;  3BZ6 A;  4M6X A;  2ACJ A;  1FBQ A;  3I64 A;  3TKY A;  4Q48 A;  1KQ9 A;  2VBY A;  1OYY A;  4L5I A;  5FFX A;  4ZZL A;  5FLX Z;  4ZYD A;  1ZLJ A;  2BGC A;  2P6S A;  3AAF A;  4EGY A;  3DFG A;  3LFK A;  1JHH A;  3GFM A;  1R5G A;  4HF1 A;  1H9T A;  1MDM A;  4XBF A;  3JSP A;  2CQK A;  1K6O A;  5F1R A;  1XMA A;  3P9K A;  5D6E A;  2E1C A;  2MLG A;  2QYO A;  1HQC A;  1KGS A;  5LRR A;  4ENM A;  1GXQ A;  3FXQ A;  3BWG A;  3F8F A;  3R4K A;  3S2W A;  1FYK A;  3NEU A;  4ENJ A;  1CF7 B;  2XKO A;  2L4A A;  5BQT A;  4HX7 A;  4HF0 A;  1B9N A;  1IXS B;  2KKO A;  3BP8 A;  3FXU A;  2GQQ A;  3V4G A;  1YTY A;  2PFB A;  2XAH A;  3IWF A;  5HS7 A;  4KFC A;  3V8L A;  2PMH A;  1P6R A;  2KIM A;  3TO7 A;  3G73 A;  4H0E A;  5J8C A;  4HLX A;  3IL2 A;  3ZMS A;  2F5F A;  3JAM K;  3WU1 B;  4Q47 A;  2RVC A;  3HIF A;  4WK8 F;  2V79 A;  5D5X B;  2EWN A;  2WV0 A;  1SD5 A;  4A12 A;  3FM3 A;  3ECO A;  2F5D A;  2MLK A;  4Y17 A;  3ZN0 A;  5LHG A;  2NRA C;  1OR7 A;  2HOE A;  5LEK A;  1WWX A;  5DDG A;  1XSD A;  2ZBK A;  1I5Z A;  2K27 A;  1E17 A;  4G7Z F;  1KU2 A;  1V4R A;  5LGU A;  3SZP A;  3TDZ C;  5A2Q K;  4K2E A;  2IJL A;  2STT A;  4LD5 A;  1BI3 A;  3KFW X;  1P2F A;  5KK1 A;  1J7K A;  4KIF A;  1TLH B;  4UHT A;  1HKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...