1FSHA

Structural basis of the recognition of the dishevelled dep domain in the wnt signaling pathway
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
EAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords DISHEVELLED-1
publication title Structural basis of the recognition of the dishevelled DEP domain in the Wnt signaling pathway.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fshA00
4WXDA 2AXLA 2XKOA 2VBYA 5FB2A 2YU3A 5D5VB 2HS5A 1R5HA 1FX7A 5L3BA 4CHUA 2L3DA 5CVVA 4LFUA 4OIQF 5FLXK 2QZ8A 4KICA 3V8LA 2J5OA 3ECOA 2L01A 3GFIA 3DF8A 2D2WA 4A5MA 4ON0A 1V4RA 3FF5A 3WG9A 4YFNF 2NNNA 1QBJA 1OPCA 2H27A 2PN6A 3GFLA 2F5DA 2R7FA 2R7DA 2EK5A 1JHFA 1HW2A 1TQIA 5ERIA 3O3KA 2X4HA 5BPDA 3WU1B 2W25A 1J7KA 3Q9SA 2O3FA 1G3YA 5D6EA 2OQGA 1E17A 1XGSA 5L3FA 1W4MA 5BS6A 3M8FA 4YG2F 2XGXA 4YFKF 4P55A 5H20A 1TNTA 3EQLF 3WGGA 5DDGA 2QUFA 3J7AO 2Z3YA 3Q9VA 4ETSA 1PP7U 5E17F 2HKXA 3HUGA 3SFZA 4L9VA 5D6FA 3LAJA 3BOQA 1R1TA 4KIBA 1ZG5A 3ZMVA 4OIOF 1TBXA 4BAYA 2HDCA 2K7LA 1A04A 2M87A 2EB7A 2FF4A 3V7SA 3KP7A 1LDJA 2C6YA 4F7ZA 4NB5A 4K2EA 3G73A 4PGHA 4Y17A 1BIBA 5LGUA 2GWRA 1IN7A 1BN5A 1J9IA 3JTHA 3L9FA 2O61A 3BZ6A 1ZARA 4RB2C 4LLNA 1ZREA 1ZHFA 4OINF 2MD5A 2XAQA 1D8KA 3NQOA 3T0YA 2UXNA 1MDMA 2STTA 1HSTA 4Z2YA 1W5SA 4KT5C 3P9CA 4Y15A 3R0AA 4L0YB 2CFXA 1IAWA 4HQMA 1OYWA 3VODA 4ZYEA 5TJJA 2YR2A 1OR7A 1TQMA 3LFKA 4IJAA 4HX4A 1SD5A 2P5KA 2NNYA 1BM9A 3I54A 5ILUA 2FEZA 2AS5F 1HKTA 1HBXG 4JK1X 2LNBA 1FP2A 3KP5A 3K2ZA 4N9HA 2HQNA 3WGHA 1UB9A 3L00A 2KIMA 4PGGA 5LRRA 4LLGF 3E5UA 3FM5A 3J80K 1LNWA 2WC2A 1D5VA 2W84A 1YS6A 4O3MA 5DYMA 4BXUA 3FXQA 4UVCA 5HDNA 2STWA 5IT9Z 3SQNA 3R6SA 5LBQA 1GHCA 3FWEA 3PFIA 4G94A 4UV8A 2EJRA 2EFPA 4G6QA 3H3UA 2Y0MA 3M7GA 3QPHA 4ESBA 4HAMA 3BP8A 1T38A 3DPTA 1KQ8A 3IC7A 3LA7A 4EJUA 1YO5C 5JFRA 1O3QA 3QAHA 5D5UB 3GLXA 1ZLKA 3TDUC 2QLZA 3KP2A 2V1XA 1IN5A 3GVAA 2LF7A 2XIGA 5HLGA 2K27A 3GW2A 2EV0A 2JRTA 1DUXC 4B8XA 1JE8A 3KZZA 4ENJA 4I0AA 1ZRDA 1NHAA 2RGVA 2NRAC 4L9NA 3TO9A 5BQTA 4AD9A 1IXCA 2PFBA 2XV4S 3E6MA 3U9GA 3LAPA 4IRHA 2D1VA 3I59A 5LEJA 2DI3A 2HZTA 2ZCWA 3WTYC 1USTA 3RKWA 2BBYA 3GYHX 1P6RA 3LQRA 1F4KA 2FNAA 3W6JB 1OYYA 3JSOA 2BEOA 2IVMA 5J6XA 4LMYA 1EH6A 2K02A 5LGNA 1X3UA 4YIIA 4IVNA 4LLLA 3FMSA 1ON1A 3IWFA 3L2CA 3HHHA 1K79A 5FFXA 3VFZA 3E6CC 2HGCA 2QQAA 2OZUA 1IN8A 2M5WA 4I09A 1WI9A 1UHMA 4RGUA 1JHHA 3WTTC 1TNSA 4B09A 2L54A 3WTXC 1TQPA 3KFWX 4ZYDA 4BNCA 3WE2A 3KP6A 1FBUA 2FSWA 1S7OA 4A0XA 4L5JA 3WTVC 1W7PB 2V9VA 3C3WA 2P5LC 2ISZA 3ZN1A 3P7NA 3RYRA 2EA2A 5E1WA 1R5GA 3BPXA 1YW7A 1W7PD 4HA8A 1R23A 2DQLA 3GZ6A 4A2UA 4N0BA 4KNYA 1FZPB 1FYKA 3HIFA 4HDUA 3F8CA 4MEYF 5LHIA 5KVRA 1P92A 3ULQB 1FP1D 3ROUA 1I1GA 3H3ZA 3KEOA 1LB2A 5LRSA 4GGGA 4RGSA 4RGRA 2H6BA 2FNPA 3ZMUA 1MZBA 1S29A 2L4MA 2DFIA 2FOKA 4GYIA 2MLGA 3R61A 2HTSA 2W57A 1ZH5A 1I6XA 5L3CA 3FXUA 3GO5A 2A6HF 1QO0D 2ESHA 1WWXA 1RUNA 3IL2A 2W85A 1UCRA 2ISYA 4DQ2A 4ENMA 4XLNF 3TO7A 2OAZA 4EJVA 2DQRA 3CJNA 3BY6A 1ZGJA 1FBQA 4RB3C 5ILSA 4HW0A 4OIPF 3CLOA 2XASA 3I64A 1FYMA 3U1DA 1UFMA 2XUBA 2P6TA 5J8CA 1LEAA 2DO7A 5DV5A 3GX4X 4I02A 4IXAA 2P8TA 3LA2A 3QU6A 4M9XA 5ICCA 4L9JA 1RNLA 4I98B 3QP5A 1HW1A 3DV8A 4CICA 1ZG1A 3E97A 3I71A 1XSDA 2FMYA 4U0WA 3T5XA 5E1XA 4P5OA 1FC3A 1AOYA 3R0JA 3MWMA 3O6BB 1S7AA 1CF7A 5E1ZB 1PUEE 3K1PA 3JAMK 3SZPA 1C0WA 2DTRA 2FQ3A 4PDKA 4LK0F 5E8GA 1PP8F 3M8EA 4HLYA 3K69A 3IKVA 2QBYA 4U0VA 4FT8A 2ZO4A 5HLIA 1T6SA 4QLCU 2MA3A 4ZH4F 2NS0A 1BI2A 3TQNA 4Q47A 2CQKA 1P2FA 2ZNZA 1TTYA 4CXFA 3LWFA 4Y13A 1XDUA 1J59A 1Q1HA 2ZFWA 2PEXA 2OD5A 3V7RA 3HYIA 3V8JA 1OKRA 2IA1A 4ZYGA 2HEOA 1S6LA 2A5YB 2MC3A 2EFQA 4JBAA 4HF0A 3K1MA 1T2KA 4CDGA 2QM3A 1HKSA 2F5EA 4G7OF 5FO5A 1FY7A 3KLNA 3F6OA 2O8XA 1XCVA 3FMRA 1DDNA 2H94A 4UNOA 3ZP5A 3GF2A 3L7WA 2FE3A 1U3EM 1QPMA 2G7HA 3RI4A 2HTJA 2E7WA 1QZYA 3FZVA 2V1UA 3LSTA 2DBBA 1D3YA 1OYIA 1KU3A 1BI3A 3GEZA 1RUOA 1SD7A 1XN7A 2FBHA 5A2QK 1BC7C 4BHCA 3DP7A 5HS7A 2LSOA 4EMSA 1HXDA 3QOPA 3HOSA 1SD4A 3S2WA 3DQVC 3HRSA 4G7HF 2HKOA 3T8TA 5ICGA 2OA4A 1IN4A 1FSHA 3V4GA 3ABTA 4O6JA 3GFJA 4EM1A 1RI7A 1G3SA 1R7JA 1IXSB 4HX7A 2XAGA 4KFCA 6PAXA 2DW4A 2P5VA 4ZZLA 2EV5A 3WGIA 3N4MA 5L3GA 4G7ZF 1B6AA 3N97A 3PQJA 4A5NA 4WXHA 3WODF 1S3JA 4ESJA 2LKPA 4MQVA 3BPVA 3HRTA 5DUKA 4FHTA 2PLYA 3Q5FA 1B59A 1XMAA 4ZZDA 1ZN2A 3CUQB 2R3SA 4FX4A 2XVCA 3U2RA 3KP4A 1B9MA 3F6VA 4FX0A 1YIOA 1KGSA 2VC1A 2OU2A 3CUQC 3I4PA 2QYOA 4ENKA 2O0YA 2RDPA 1ZRCA 4XBFA 1VTNC 2VE8A 3B73A 1XSXA 1MKMA 2PMHA 5D4RA 4AIJA 2WWYA 2PBIA 2ESNA 3RIRA 4KYWA 3T1BA 5FLXZ 4BQAA 4WCGA 2ZBKA 3MEXA 3BDDA 2ZMEB 3IRRA 4M6YA 2CG4A 5LHHA 1QGPA 2A07F 2XROA 1O7FA 2UZKA 3ZQ7A 4UUVA 3LA3A 1G3WA 5HVQC 3WTUC 1IUYA 2H09A 5JI6A 3KP3A 5LLQA 1YG2A 4WWCA 3HSFA 2XRNA 4WF2A 4ASNA 4HBLA 4EGYA 3J81K 5FD6A 2ETHA 2UWMA 2IA0A 2PQ8A 1LJ9A 3C7JA 2ZJ2A 3SZTA 4CZZA 1G3TA 1YS7A 2GA2A 1KU2A 1MJAA 2F5FA 2KJBA 2RNJA 3RKXA 2IP2A 3E3VA 1KYWA 1LDDA 3MAJA 1HW5A 2Z99A 5AIPA 1KA8A 2RQPA 5L3DA 5JHUA 1U6GA 3I5UA 3SXYA 1XB4A 3CDHA 1TW2A 3WTSC 2UXXA 2V79A 4P96A 1O3RA 3CO7C 4HX8A 4EJTA 4CGZA 5EEGA 2V1DA 2EFNA 4UVAA 4AIHA 2M30A 4L5IA 3MQ0A 2HYFA 4ENNA 2JTVA 4EM0B 4LG0A 5CVRA 1R58A 1W7PA 1QQIA 2GXBA 4JQFA 2KKOA 2MLKA 4UVBA 5CVUA 2DU9A 1RIOH 3F8MA 2EA4A 3COAC 5DCMB 5ICEA 4LJZF 2JZYA 3RPUA 2Q8KA 4HF1A 4AWXB 2RC4A 3KZYA 3BROA 2Z33A 1XD7A 3F8NA 2DK8A 4KMFA 5DD8A 2JT1A 2CYYA 1ZG3A 4EV0A 3MZHA 4UHTA 2A61A 2VOPA 3JTGA 1R00A 4IRIA 1SD6A 4EM2A 1MJBA 4MEXF 3ZPLA 3ZMZA 4L18B 3F72A 1SFXA 1LVAA 4BH9A 1BJAA 2KIUA 4D0PA 1SFUA 4MGRA 2HYGD 1Z6TA 3I59B 4BHBA 1U5TB 5JR3A 3ERED 1Z9CA 5HS9A 5HOOA 5D8LB 4KN4X 3J80Z 4IPAA 4PCQA 1ZGAA 1B4AA 1LQ1A 3RTRA 2ELHA 3GXOA 5DCFA 2ADUA 1FBSA 4IRGA 4GXOA 5AONA 2CWEA 1U5TC 1U8RA 4A0YA 4DNCA 3ML6A 2ZXJA 2ZNYA 3QRFF 3W6KB 4P9FA 4WXCA 2IJLA 2JPCA 5ICFA 4L9TA 3V7CA 1L0OC 1DP7P 3HRUA 5BOXA 1T39A 1IRGA 3F8BA 1O57A 1B1BA 2VXZA 4A6EA 2CW0F 2QENA 2DK5A 2FBKA 5L3EA 1LDKB 3GWZA 2RN7A 5E8IA 4LD5A 2P7CB 4GCVA 1ULYA 2J5PA 2A3SA 3H92A 1KQ9A 5BPIA 5D8KB 2P6SA 1J75A 2CSOA 1RZ4A 3RDIA 2O6GE 5DUIA 2DT5A 2LDUA 1KYZA 2GAUA 1XGNA 2VBXA 4OIRF 4R8HA 3TGNA 4OMZA 1XGOA 2OBPA 4RS8A 4R79A 1O7LA 1MD0A 2GZWA 2VBWA 2DPUA 5HLHA 2RKHA 4XLPF 1H0MA 2VODA 3E6DA 1R36A 3WTWC 1LEBA 1YYVA 2M8EA 3M9AA 2MBFA 1Z7UA 1BC8C 1XSVA 2KRFA 4M72A 2XKPA 5D4SA 1H9TA 4GYGA 4XRFA 1BI0A 1ODDA 1BBYA 1OMIA 2YX4A 3P9IA 3K9TA 1UHWA 3EETA 1FPQA 3TKYA 4HQEA 2WV0A 2LF8A 1U78A 1WKMA 3TOAA 2RVCA 1WQ2A 4P9UA 3ZMSA 4CO8A 2ACJA 1KQ0A 4KN7X 1E2XA 1K7AA 4HF2A 4BHPA 3EYIA 2VBZA 4BYYA 1P4WA 4RB0A 2W24A 4E70A 2XAHA 1DPRA 4QWQA 4LB6B 2A6EF 4TV7A 3FHZA 4I7HA 1I27A 1R1VA 2EV6A 1G6NA 3JSPA 1K78B 2HQRA 2TDXA 3F23A 3DKWA 4IF4A 3G3ZA 4EQQA 4RB1A 2D45A 1YFHA 1Z1DA 2XAFA 1IXRC 1CF7B 3ECHA 1F1ZA 4ZYHA 3GFMA 3PQKA 2FXAA 2FRHA 4HZFA 5ED4A 1Z6RA 3RPQA 3DPLC 3MCZA 4A12A 2QQ9A 2QBYB 4G8XA 2HR3A 4NHJA 4HV6A 3QU3A 1GXQA 4MHGA 2MH2A 3OV8A 4Q5SF 4M73A 4O5VA 3KEQA 2M1BA 3WTZA 2HWVA 1W5TA 1QNTA 2F5CA 3O2PE 2JPBA 3BJOA 5IT9K 3VB2A 1SAXA 1IW7F 1FT9A 1EV7A 2VN2A 1B9NA 5LEKA 4A6DA 5LGTA 3CUQA 2HOEA 2OZ6A 3V8KA 4WX9A 2Y48A 4M6XA 5KK1A 1EH8A 4KUMA 1HQCA 2M45A 3DXJF 4KIGA 2IPQX 5HDKA 3HHGA 2BE5F 3ZMDA 3TDZC 3ABUA 3BJAA 4OOIA 4A0ZA 5DEQA 4OU0A 1FWZA 3IHUA 3FX3A 2E1CA 4EJWA 3CTAA 4XSZF 4MTEA 1FYLA 4YFXF 1QZZA 1YW9A 2ZMEA 3RKYA 1GXPA 3JAMZ 1D8JA 4M9SA 3D0SA 2PI0A 4S04A 2P4WA 3R60A 2X0LA 3FMQA 3AAFA 3GUDA 3KETA 4AIKA 2BV6A 2YPRA 1KU9A 4OMYA 1TW3A 2G7UA 3KCCA 5HS8A 1R1UA 4IHTA 1XGMA 4MQ9F 5AIQA 1FOKA 3I58A 1PDNC 1P4XA 3IKTA 5H6QA 2FU4A 5E20A 3E5QA 1WRJA 2L4AA 1ON2A 3QP6A 1WSUA 2IRFG 4M71A 3VOEA 3KE2A 2Q2EA 2V6CA 1SMTA 3IRQA 3VEPA 1I5ZA 2K4JA 4HV5A 1IRFA 2VONA 1MDMB 5F1RA 2QQBA 3BWGA 2COMA 3ISPA 2GQQA 2QWWA 4KIFA 1YQAA 4HLXA 1K6OA 2FBIA 5K1YA 3HOTA 2PMUA 2DPDA 1ZRFA 3I53A 4HDVA 2K4BA 2NYXA 1HKQA 5A2QZ 1BI1A 1SMYF 2A68F 4CYDA 5FGMA 5FFZA 2PG4A 5DCMA 2MH9A 1J0RA 5H6RA 4L0ZB 3ZN0A 3M1EA 1O3TA 2GIVA 1XDSA 2H6CA 1GVJA 1CGPA 5CVIA 3NEUA 3HTUA 2PJPA 1USSA 2EFOA 5J8FA 3SHFA 3F22A 3EDPA 3C1DA 2GXGA 1REPC 3MFKA 3FXRA 3EUHA 3EYYA 4UXNA 1I1SA 3JW4A 1G4DA 2VT3A 5DD4A 4N9IA 5ILVA 2JSCA 4HYEA 1FNNA 3P9KA 1L3LA 1SFEA 1ONVA 1XMKA 4R1HA 5K5QA 2YSRA 4YIFA 2O03A 1ZYRF 3HSEA 1U5TA 1R22A 4LK1F 1ZLJA 1MGTA 1U2WA 2DAOA 1MJ9A 3CUOA 2IA2A 4H0EA 2XAJA 3BJ6A 4M9ZA 2BYVE 3NRVA 1H9GA 2Z5UA 4MNUA 2WTEA 5CJ9A 1KU7A 2FA5A 4MTDA 4M74A 5BMZA 4EVIA 4GO1A 3E6BA 3WE3A 3D5LA 3RJPA 2L02A 2VT2A 3DFGA 3HSRA 3RYPA 4I2OA 3DEUA 3C18A 2E7XA 4KDPA 2RV8A 2A69F 3GZ5A 4EGZA 1JGSA 4LG0B 1EH7A 4HOBA 4U7BA 4WK8F 1YTYA 2K86A 2CO5A 4I0BA 1BIAA 2GA1A 4LGWA 5JVTA 2G9WA 1V3FA 1O3SA 1BOAA 2E1NA 3KLOA 4Q48A 2DLLA 1F5TA 1S8NA 2QVOA 4LB5A 4G6DA 1T0FA 4U0YA 3ZMTA 1STZA 1IF1A 3K0LA 2IW5A 2VOOA 4RAYA 3J81Z 2ZKZA 2KJCA 1YLFA 4XSXF 3I0TA 5HDGA 3HRMA 2F2EA 1P4AA 5IT3A 4IHSA 1Y0UA 1ZAOA 1AWCA 2OQRA 5CLSA 3REOA 5D5WB 3TO6A 1DPUA 3MZYA 5LHGA 3E5XA 2KIFA 3F8FA 1J5YA 3K1NA 3HTSB 3LQQA 3L09A 1Z05A 1HSJA 2FMLA 5F6FA 3B02A 4AVPA 3QPTA 1FLIA 1TLHB 4S05A 2Y75A 2BGCA 2D1HA 3FM3A 4ESFA 4RAZA 3R4KA 3TOBA 3F21A 5FD5A 3OOPA 4KA4A 3WU0A 5F64A 2IT0A 4U7DA 1IZ1A 1J2XA 5CVJA 5E18F 2Z9OA 1YW8A 2VE9A 1FSEA 4UV9A 4G9YA 1K78A 2B0LA 2P7VB 3F3XA 2CGPA 5K5RA 1XCBA 4NQWA 5TRDA 5K5OA 3T8RA 4U88A 2HFHA 2XHKA 5CYVA 5EEHA 2NAZA 3ELKA 2EWNA 4EJOA 1F9NA 2VC0A 3IWZA 4I01A 3CO6C 4PZJA 5D5XB 2Q0OA 2EFWA 1JXSA 1IN6A 4RGXA 2YX7A 1T98A 1Z91A 4KMUX 4Q4ZF
chains in the Genus database with same CATH superfamily
1YITI 2HQ5A 4WXDA 4IQ4A 2AXLA 2XKOA 2VBYA 5FB2A 2YU3A 3ZQIA 5D5VB 1MBEA 2HS5A 4KJZA 4XLEA 3RKQA 1R5HA 4IO9F 1FX7A 4BBRJ 5L3BA 4CHUA 4BE1A 3RZOJ 2IS1A 2L3DA 5CVVA 3CCVI 3BTIA 4LFUA 1YX3A 4OIQF 5FLXK 2QZ8A 2FQ4A 2M7AA 3DBLB 4KICA 3V8LA 2OCCH 3L2VA 1AA7A 3GBGA 2DA4A 2J5OA 3ECOA 2E5ZA 1HF0A 2NVXJ 4IOCF 2L01A 3GFIA 1VQNI 3DF8A 1E0EA 2D2WA 4A5MA 4ON0A 1V4RA 3FF5A 3WG9A 2LTPA 3TMOA 4YFNF 2NNNA 3AG4H 1OPCA 1X4OA 1QBJA 2PN6A 1TWCJ 3JRBA 2H27A 3GFLA 5IP7J 1VQ9I 1UAAA 2F5DA 2R7FA 1BR4A 2R7DA 2O7OA 1JKRC 3EUAA 2LC2A 2EK5A 1JHFA 2RREA 1HOMA 1HW2A 1TQIA 3BG9A 3PJRA 1WGXA 5ERIA 4QPQA 3S3MA 1TWHJ 2X4HA 3O3KA 3H5NA 5BPDA 3LSPA 2XRLA 4XQFA 3WU1B 3BZKA 2W25A 1J7KA 3CJQB 1XG1A 3Q9SA 2O3FA 4PFOA 1GUUA 1G3YA 5D6EA 1LUJB 1WJBA 4RLFA 2I8DA 2OQGA 1B72A 1E17A 1XGSA 2JVHA 4IHYA 4JYKA 3K4BA 1YI2I 4XRSA 5L3FA 1W4MA 5BS6A 3M8FA 4BDZA 2VJ5A 3S14J 3IAS2 2EIKH 3H0GJ 2QGUA 4YG2F 2XGXA 4YFKF 4CCKA 3MMYB 2OPTA 4P55A 3KX2A 5H20A 4P1WA 2X48A 1TNTA 3EQLF 5E3OA 3WGGA 5DDGA 2DJNA 2QUFA 3BC8A 1G59A 3J7AO 1W36D 2K9QA 2F4OB 2WAEA 2Z3YA 3Q9VA 4PJJA 4QSHA 1KZHA 4ETSA 1PP7U 2XPUA 5E17F 2HKXA 1W36C 2JSPA 3S32A 1K83J 4E7SA 3HUGA 2K3PA 3QODA 4A3IJ 3I9V2 5FRNA 2RNGA 1ETQA 2GBYA 2Q1ZB 3SFZA 5F08A 2HVRA 4L9VA 5D6FA 3LAJA 2DFHA 3PNTA 3BOQA 4KT6A 1R1TA 3ABMH 4KIBA 1EA3A 2O9LA 2LY1A 3ZMVA 1ZG5A 4OIOF 1TBXA 3KYDB 4BAYA 2HDCA 2R7UA 1G2HA 2K7LA 1A04A 3DKYA 1PJRA 3CQZJ 2HOAA 2M87A 3FKIJ 3Q0UA 1K4TA 1HDPA 2VB6A 2EB7A 1N25A 2FF4A 3DTKA 3V7SA 3KP7A 1H89C 1LDJA 3HOXJ 2ID6A 4Y7NJ 2AHQA 3N05A 2C6YA 4F7ZA 2CJJA 2COBA 4NB5A 5K7ZA 2JK3A 4K2EA 3G73A 4PGHA 4Y17A 1BIBA 2IEKA 2M0CA 5LGUA 3MKZA 4F92B 2XSDC 2GWRA 1IN7A 1BN5A 1J9IA 2DFEA 3JTHA 5EG0A 3L9FA 4BEHA 3ZR8X 2O61A 2ME6A 3BZ6A 3HKZA 1ZARA 4RB2C 4LLNA 5J1RA 1ZREA 1ZHFA 4OINF 2XF5A 1WI3A 3A0BC 3OIOA 2MD5A 2XAQA 1D8KA 2LBFB 3NQOA 3T0YA 2UXNA 4XK4A 3LSIA 1MDMA 2STTA 3OYBA 5C4JJ 1HSTA 2R0QC 4Z2YA 4D7MA 1W5SA 2EIJH 4KT5C 3P9CA 4Y15A 1P7JA 3QPSA 4CCLA 4I6ZA 3R0AA 4L0YB 2CFXA 1QRYA 3DKXA 1IAWA 4HQMA 2NXNB 1OYWA 3VODA 2MG4A 2FOWA 4ZYEA 5TJJA 4BJTA 2L0KA 2YR2A 1QVTA 2F4MB 5GPCA 5KHDA 1OR7A 2D5VA 1A6IA 1TQMA 2E2IJ 3LFKA 3OS0A 1WCMJ 2NVQJ 3PM1A 3W2AA 4IJAA 4GDFA 4HX4A 1SD5A 2P5KA 4BY7J 2NNYA 1JKQC 3EUKL 1A35A 2B7EA 2BOLA 1BM9A 1MSEC 3I54A 5ILUA 2L9SA 2FEZA 2AS5F 1TT5B 2R5ZB 1HKTA 1HBXG 4JK1X 2LNBA 1FP2A 1IUFA 4FISA 3FXLA 3KP5A 2VKHA 3K2ZA 5E3LA 4N9HA 1GV5A 3SEQA 2ID3A 2YUSA 2HQNA 3WGHA 2TRTA 1UB9A 3L00A 2KIMA 1W0TA 2NVTJ 4PGGA 1APLC 5LRRA 4LLGF 3E5UA 4E7ZA 3HG9A 3FM5A 2JA8J 2LKSA 3ASNH 3CMYA 3C2BA 1R6RA 3J80K 1LNWA 5J4VA 3JRCA 3OSGA 1WJEA 3PNYA 3CCUI 2EPFA 3UKGA 2WC2A 2EINH 1D5VA 2W84A 2RQQA 1YS6A 2X85A 1NK3P 1AHDP 3OOUA 4A3JJ 4O3MA 5DYMA 1V54H 3MD2A 1RKTA 4BXUA 3FXQA 2O8KA 4UVCA 5HDNA 1XMXA 1D0ZA 2QEXI 5JLXA 1MIJA 1JI8A 5J40A 4F91B 2LVSA 2STWA 1OJLA 5IT9Z 4AU7A 3SQNA 3R6SA 5LBQA 2DXIA 1GHCA 1NH3A 3FWEA 3ZQLA 3JRGA 2MD0A 2WA0A 3PFIA 1Y56A 3S2DJ 1IDYA 2XB5A 4G94A 2MFZA 4UV8A 4EEFG 2EJRA 2EFPA 4G6QA 3H3UA 4XKVA 2Y0MA 3M7GA 3QPHA 5GTIC 4ESBA 2Q2EB 4HAMA 1K61A 2IS2A 5F0CA 3BP8A 1T38A 1A31A 3DPTA 4BQNA 1KQ8A 3IC7A 1OFCX 3LA7A 4EJUA 1YO5C 5JFRA 2OF7A 1O3QA 4RDUA 3QAHA 4MIMA 5D5UB 5HLTA 3GLXA 1ZLKA 1JTYA 2DYRH 1YX5A 2DDAA 4XOTA 2BY0A 3TDUC 5EDNA 2QLZA 1ZQ3P 3KP2A 2V1XA 2XF7A 4BS9A 3L1PA 1IN5A 1S9HA 3BQYA 1O4XA 2B63J 1ORKA 2ZJQF 1VNDA 3M3YJ 3GVAA 1SFKA 2LF7A 4XRMA 3CF2A 2XIGA 5HLGA 3S3OA 2K27A 3HGGA 3GW2A 4IHWA 3K4NA 1ETWA 2EV0A 4XORA 4BU2A 4UB6C 2JRTA 4HG2A 1NK2P 1DUXC 4B8XA 1JE8A 3KZZA 4ENJA 4I0AA 1N77A 1NHAA 2CUFA 2RGVA 1ZRDA 2CV1A 1TWGJ 2NRAC 4L9NA 1YJNI 1S5LC 3TO9A 2OTLI 2VPLA 5BQTA 3SJMA 1ZR4A 4AD9A 1IXCA 2BHYA 2PFBA 2XV4S 3E6MA 1V5FA 3OYAA 3U9GA 3LAPA 4IRHA 2D1VA 3I59A 5LEJA 2PMZN 2DI3A 2HZTA 2ZCWA 3WTYC 5M5WJ 1IRXA 4XLHA 1USTA 1WVRA 3RKWA 2JJ7A 3GZNB 1AKHB 2BBYA 3GYHX 1FJLA 3FK7A 1P6RA 3LQRA 3D1NI 2HYJA 1JT0A 5HODA 1RR8C 1F4KA 2FNAA 3W6JB 1OYYA 3JSOA 1ZELA 2BEOA 2IVMA 3G71I 5J6XA 4LMYA 4C2UA 3W3CA 1EH6A 2K02A 5LGNA 2WAQN 1X3UA 4YIIA 2LKXA 2VUMJ 2R7SA 2L9RA 2X9DA 4IVNA 4LLLA 3FMSA 3JRIA 3G1MA 1ON1A 5B3SH 3IWFA 3AG3H 3L2CA 2QQ8A 3DEWA 3HHHA 1K79A 5FFXA 2R7ZJ 5DTDA 3VFZA 4X1EA 4PK4A 1R4NB 4Y4RA 3E6CC 2E35A 3GMEA 2HGCA 2F48A 2QQAA 2OZUA 3H36A 2L7MP 1IN8A 2M5WA 4I09A 5FLVA 1WI9A 2KMUA 3BR3A 1UHMA 2JA5J 5KNLA 3RQ4A 4RGUA 1JHHA 4C3HJ 3WTTC 3NARA 1TNSA 1NG6A 4B09A 2L54A 2VL8A 3WTXC 3F9KA 2WAQA 3H5RA 1TQPA 3GTQJ 3KFWX 4ZYDA 4BNCA 2WB1A 3WE2A 3KP6A 1FBUA 1U9OA 4E7IA 2FSWA 1S7OA 4A0XA 4L5JA 3WTVC 1W7PB 4BBSJ 2V9VA 3C3WA 3FXJA 2BW3A 2P5LC 2ISZA 3VDXA 2CMPA 4XLAA 2JWTA 3ZN1A 3P7NA 3RYRA 2EA2A 1FOYA 3S16J 4FTHA 5E1WA 1R5GA 1IGNA 3OYGA 3BPXA 3GTLJ 1YW7A 3HC7A 1W7PD 4HA8A 4A3FJ 4S0HB 3CCQI 2X6OA 4M6VA 1R23A 1IV8A 2DQLA 3GZ6A 4D5CA 4A2UA 2WAFA 4N0BA 4KNYA 1FZPB 2KZGA 1FYKA 3HIFA 2XGCA 4HDUA 2DA1A 3F8CA 4MEYF 5LHIA 5KVRA 2JA6J 4LIUA 3LL7A 1P92A 1YE9A 4HSTA 3ULQB 4XR6A 1R4MB 1FP1D 3ROUA 1I1GA 3H3ZA 3BG6A 5EGOB 1HA8A 2DFFA 2KHMA 1F36A 3A2KA 4BQQA 3KEOA 2LREA 4OWRB 1ZR2A 1DU6A 1LB2A 2KP6A 3LOCA 3FDYA 3RPUD 4DZJA 1Y0NA 3IV5A 5LRSA 4GGGA 1SVLA 4RGSA 1BR1A 2H6BA 4RGRA 2VJJA 2FNPA 3G1LA 3ZMUA 3HM5A 1MZBA 5F0HA 1S29A 2E1MC 2L4MA 1QA6A 2DFIA 4DJAA 2FOKA 3PSIA 3KYLA 4GYIA 2DA5A 3P5JA 3CCRI 2MLGA 3CF5F 2Y31A 3ZQFA 3FISA 2DMPA 2HDWA 3R61A 2HTSA 2JN6A 2L7KA 5F1JA 5M3MJ 3W6VA 2W57A 1ZH5A 1I6XA 4HPQA 5L3CA 3FXUA 5M3FJ 3GO5A 3TP3A 2A6HF 1QO0D 2WY7Q 3GTMJ 4CCOA 2ESHA 5FKOA 1WWXA 1RUNA 3IL2A 2W85A 3H9JA 3BTLA 1UCRA 2ISYA 4DQ2A 4ENMA 4XLNF 3TO7A 2OAZA 2M0MA 4EJVA 1SVMA 1ZK8A 2GOXB 2LY2A 2DQRA 4Y3OA 4B3AA 3CJNA 2E1OA 1SANA 1X1CA 3BY6A 1ZGJA 2IGOA 1FBQA 3ABKH 3NWTA 4M3DA 4HW0A 5ILSA 4RB3C 1PUFA 2IBDA 1IG7A 4OIPF 2DMUA 3CLOA 2X6WA 4RAGA 2HDDA 2XASA 4C2TA 3I64A 4CA0A 4IHXA 1FYMA 2VIXA 1WPKA 1UFMA 2XUBA 3U1DA 2P6TA 1MBFA 5J8CA 1LEAA 2DO7A 5DV5A 5FJ8J 3GX4X 1UHSA 2IGKA 4I02A 4IXAA 2P8TA 2UUZA 4ZDOA 3BR1A 3LA2A 3JCUC 2NS8A 2X6YA 3QU6A 4DYRA 3JRDA 2HPIA 4M9XA 1A6QA 2E5NA 5B1BH 3OYFA 5ICCA 3JRFA 3S1RJ 1TC3C 2OC6A 4XMYA 1VQOI 2JUGA 4L9JA 3HPGA 2GM4A 1MMNA 1RNLA 3OYKA 5GPAA 4I98B 3QP5A 1HW1A 3WHBA 1WFXA 3DV8A 1K6YA 1JJ6C 3KPHA 4CICA 4JP0A 3LSHA 2QCOA 3HZJA 1ZG1A 3E97A 3I71A 1XSDA 1LPQA 2FMYA 2V6EA 1YIJI 4U0WA 1JKPC 3T5XA 5E1XA 4P5OA 2FJ1A 1FC3A 1AOYA 2LY9A 3D5SC 3R0JA 3MWMA 3O6BB 1S7AA 1CF7A 4YIRX 4UUSA 4FE4A 5E1ZB 1WJDA 2XF6A 4MLOA 3K1PA 3DLAA 1PUEE 4QIWN 3JAMK 1D1AA 3SZPA 4UUTA 5JVGF 3BZCA 1C0WA 2DTRA 3K7AJ 2FQ3A 4PDKA 4LK0F 1OQYA 3G4SI 2L9VA 3A4CA 1LKXA 5E8GA 1P7IA 1PP8F 2R93J 3M8EA 3FKJA 2XPWA 4HLYA 1T56A 2V26A 3K69A 2KZVA 3IKVA 2QBYA 4RLQA 4U0VA 3BR6A 4FT8A 4IOAF 2ZO4A 5HLIA 1T6SA 4CUGA 4QLCU 2OJED 1MMDA 1X3WB 2MA3A 5FKMA 4ZH4F 4A3DJ 3HJEA 1GDTA 2NS0A 1BI2A 3TQNA 4Q47A 2MW8A 2CQKA 2R4GA 1OCRH 5GAEJ 1NG7A 1P2FA 4NC8A 2ZNZA 2H8WA 1TTYA 1WZ2A 4CXFA 2VKEA 3OIPA 3LWFA 5J4YA 1B8IA 2R7WA 4Y13A 1XDUA 1J59A 3PUBA 4XIDA 3I4MJ 1Q1HA 5B5EC 4UB8C 2ZFWA 2PEXA 2OD5A 4ZYAA 4HSRA 3V7RA 3F0CA 3HYIA 1IJWC 3BG3A 3V8JA 1JJ8C 2L5QA 1OKRA 5IOZA 2IA1A 4ZYGA 2HEOA 1S6LA 4E7HA 2A5YB 2M2EA 2MC3A 2EFQA 4JBAA 4HF0A 2KISA 2LK2A 3K1MA 2KDZA 1XTAA 4CDGA 3CMAI 2DYSH 1T2KA 1Z77A 4J00A 2QM3A 3CCSI 4Y33A 1OCZH 1HKSA 2F5EA 4G7OF 5FO5A 1FY7A 3KLNA 3F6OA 3BR5A 2GXAA 4NNJA 2O8XA 4CYCB 2Y9ZA 1XCVA 2X1CA 2X1EA 2A5WA 3FMRA 4OAZA 5CQEA 3ZCOA 1DDNA 2H94A 4UNOA 3DTIA 3ZP5A 3GF2A 3L7WA 1TWAJ 2FE3A 5FLMJ 1U3EM 1QPMA 2G7HA 3RI4A 3DU6A 3J7ZI 2HTJA 2E7WA 3ERMA 3H9GA 1QZYA 2KQRA 3FZVA 2V1UA 3HOZJ 3BCBA 1X19A 3LSTA 2DBBA 1D3YA 1OYIA 4Q4ZF 1IDZA 1TWFJ 3BQZA 1KU3A 1BI3A 3GEZA 1S72I 2QKLB 1RUOA 1SD7A 1XN7A 3KYCB 3AL0B 4A3CJ 2FBHA 2DA7A 3WU2C 1IC8A 2N8GA 5A2QK 1FMVA 1EJ9A 1BC7C 1Z3YA 4BHCA 3DP7A 5HS7A 1DGWY 4BE2A 2LSOA 1QVUA 4EMSA 5KAIC 3PL8A 3PSFA 5B1AH 1HXDA 2MABA 3QOPA 3W2VA 3HOSA 1SD4A 2QSFX 3S2WA 3CDLA 3DQVC 3K4LA 3HRSA 4G7HF 2WY8Q 2HKOA 3T8TA 5ICGA 3VYUB 2OA4A 4ZTFA 4D5FA 1IN4A 1FSHA 3V4GA 3ABTA 4BXXJ 4O6JA 3SYTA 1R71A 2W4SA 4PSXA 3GFJA 3I56I 2F4IA 4EM1A 1RI7A 1G3SA 4XLFA 4ABZA 4II2A 1R7JA 3BR2A 1IXSB 2LOOA 3HKZN 4HX7A 2XAGA 4KFCA 6PAXA 2CFOA 2DW4A 2AO9A 1I39A 4NBQA 2GOMA 2P5VA 2NOJB 3DLLF 2KRHA 4ZZLA 1AU7A 1GT0C 2EV5A 3WGIA 3TEDA 3N4MA 4PJ0C 5L3GA 4G7ZF 3CP8A 4M3BA 1B6AA 3N97A 3PQJA 3BTCA 4A5NA 4WXHA 3CMMA 3OS2A 3QPLA 1OCPA 3OYJA 3L2QA 4XN0A 3CC2I 2HNHA 4DIQA 1OLTA 3HPHA 3BTJA 2XSJC 4W97A 3L2UA 1ZGWA 3CCMI 2EZIA 3OYEA 1WH7A 4HRIA 3WODF 1VQ6I 3HDDA 3OSFA 2QF7A 2E34A 5E3MA 2B9SA 5JLWA 1S3JA 4ESJA 3I55I 1UG2A 1QU3A 2QKMB 3RSNA 2LKPA 4DGWB 4MQVA 3BPVA 3HRTA 5DUKA 4FHTA 5IPAA 3OR2C 4YELA 2PLYA 3Q5FA 1B59A 1XMAA 3DU5A 2M3AA 3FXKA 4ZZDA 5LD2C 2IS4A 1ZN2A 3CUQB 2R3SA 4FX4A 3CCEI 2ZJPF 2XVCA 4PJLA 3U2RA 1BJZA 3E7LA 5M5YJ 3KP4A 1B9MA 3F6VA 4FX0A 1JGGA 2WADA 1YIOA 1KGSA 3HUGB 3CC7I 2Y0SA 2DN0A 4NC6A 2VC1A 5C44J 3M4OJ 2OU2A 4DBQA 3CUQC 1JT6A 3I4PA 2QA4I 2QYOA 4ENKA 2O0YA 2RDPA 4B4CA 3K6GA 2M7BA 5IP6A 4XBFA 1ZRCA 1VTNC 2VE8A 5K7FA 4JX4A 4XL9A 3IAM2 1X1AA 1DQUA 3B73A 1XSXA 2BZTA 3OS1A 4FQGA 1IV6A 1MKMA 2PMHA 5LFAA 2CQ7A 5D4RA 4AIJA 2WWYA 2PBIA 2ESNA 3RIRA 1MNMC 1FMWA 4KYWA 3T1BA 3VSLA 5FLXZ 2LG4A 4BQAA 4WCGA 2ZBKA 4A93J 3JRHA 3MEXA 3K10A 1MBHA 2K40A 3BDDA 1P9QC 2ZMEB 3IRRA 1D0XA 1X1BA 2CG4A 4M6YA 5LHHA 1QGPA 4G12A 2A07F 2XROA 5TGTA 1MH3A 1O7FA 2UZKA 3ZQ7A 2DODA 3H35A 3K4JA 4B3XA 5EG0B 1JKOC 4BEHB 4UUVA 3S8PA 4ZJZA 3LA3A 4C2MJ 1ETKA 1G3WA 5HVQC 3WTUC 4Y52J 1IUYA 1VQMI 2H09A 3OYLA 5JI6A 2ZMEC 3KP3A 2KLOA 3PO3J 1Y6IA 5LLQA 5HNFA 1EF4A 1YG2A 4WWCA 3HSFA 3K2AA 2XRNA 4RM2A 4WF2A 4ASNA 1XC5A 3HBLA 1LFUP 4AUXA 1UMQA 4HBLA 4M3EA 3IH3A 1VQ4I 3OIQA 4EGYA 4XKWA 2NOGA 3J81K 5FD6A 1OCCH 2ETHA 5K7HA 2K3FA 2UWMA 2IA0A 2PQ8A 1LJ9A 3C7JA 4LG3A 4KISA 2Y69H 4BGDA 4UY8I 2ZJ2A 4MFDA 3SZTA 3VPRA 4CZZA 1G3TA 1YS7A 2GA2A 2R7QA 4AIDA 2VQGA 4IQJA 1KU2A 1AKHA 3S3NA 2VQLA 1MJAA 2F5FA 1Z3XA 1H88C 2KJBA 2EQRA 2RNJA 3RKXA 2IP2A 3LNQA 3E3VA 1KYWA 1LDDA 3MAJA 4J01A 4BXFA 1HW5A 2Z99A 2CU7A 5AIPA 1KA8A 2RQPA 2DOAA 1JUPA 4IEJA 1MBJA 5L3DA 5FKLA 3U21A 2W1OA 5JHUA 1U6GA 3DPUA 3I5UA 3SXYA 1XB4A 3PFYA 3CDHA 3Q0VA 1H8AC 1TW2A 3TP0A 2XGEA 4H4KC 3WTSC 2UXXA 2ICWG 2DA3A 2V79A 4P96A 1O3RA 1MNEA 2AQFA 4Z6YA 3CO7C 4HX8A 3DCFA 4EJTA 4CGZA 5EEGA 2JA2A 1U0JA 2V1DA 2EFNA 4RMNA 2R7XA 4W1UA 1UZCA 4G6TB 3FBIB 4UVAA 3FK6A 4AIHA 1T95A 2M30A 4PFPA 4L5IA 2MC4A 3MQ0A 3MN2A 2HZDA 2JMWA 2HYFA 4ENNA 2JTVA 2VQHA 4EM0B 1YRNA 4LG0A 5CVRA 1R58A 1W7PA 2LYCA 1K4SA 1QQIA 2GXBA 4JQFA 2KKOA 5GP9A 1VQ7I 5EZHA 2MLKA 4UVBA 5CVUA 1OCTC 2XAUA 2DU9A 1X1PA 1RIOH 3F8MA 2EA4A 4BKXA 2CRGA 3COAC 5DCMB 3ZOBA 3KEYA 5ICEA 1FIAA 2IS6A 4LJZF 5FROA 2CQXA 4B48A 2WB1N 2QSHX 2JZYA 2JUCA 2CV2A 3OYCA 3CZ6A 3OY9A 2DDBA 3RPUA 2Q8KA 2PJRA 4HF1A 4AWXB 2RC4A 2EIMH 5EGOA 3GTGJ 3KZYA 4CH7A 3BROA 4AYBA 2ELKA 5J3LA 2Z33A 2DMQA 1N78A 2AXTC 1W1WE 1XD7A 1D5YA 3BLYA 2VKVA 3BG7A 3F8NA 4JOMA 1FOXA 2DK8A 1X2NA 3CD6I 1HDDC 5E3NA 4KMFA 5DD8A 2JT1A 3PUFA 2CYYA 3AG2H 1ZG3A 3TW6A 4EV0A 3MZHA 2EBIA 4JX5A 3MZ8A 4CZCA 4UHTA 3Q3SA 2A61A 2VOPA 3D5RC 3JTGA 1R00A 2W00A 2KFDA 4IRIA 1SD6A 4EM2A 1MJBA 4MEXF 3ZPLA 3ZMZA 1HC8A 3ZXSA 4L18B 3EUHC 3F72A 1SFXA 1LVAA 4BH9A 1BJAA 2KIUA 4D0PA 2DT6A 1SFUA 4MGRA 2HYGD 3A02A 1Z6TA 2L7ZA 3I59B 3TBIA 2VLAA 1WHUA 4MFEA 3FXMA 4BHBA 1U5TB 5JR3A 2V9PA 3ERED 1Z9CA 3TL4X 5HS9A 5JHFA 4BDYA 5HOOA 3VWBA 5D8LB 4KN4X 3J80Z 1S7EA 4IPAA 3G2BA 4PCQA 1ZGAA 3H9QA 1B4AA 1OISA 1LQ1A 3RTRA 2ELHA 2KT0A 2X1DA 2ADUA 3GXOA 5DCFA 1VQ5I 2WV1A 1FBSA 4IRGA 3K70C 1RC9A 4XM3A 2LRDA 4GXOA 5AONA 2CWEA 1U5TC 3U1KA 1U8RA 3S17J 5DS9A 1RESA 1FTTA 5GTHC 2ZXWH 1MMAA 4A0YA 2P81A 4DNCA 3ML6A 1X3ZB 2ZXJA 2W82A 2ZNYA 2HOSA 2ZFUA 2TCTA 3SDGA 3QRFF 5J47A 1VQ8I 4FE7A 3PNVA 3W6KB 2R7TA 4P9FA 4WXCA 1TZLA 2IJLA 2JPCA 5GAGJ 3OL3A 5ICFA 1RETA 2LLKA 4X6AJ 1I50J 2E60A 1OCOH 3A0HC 1MH4A 4L9TA 3OYNA 3V7CA 3G1OA 1L0OC 2CW7A 1DP7P 3GTJJ 2BW3B 3BT9A 3HRUA 5BOXA 3ZGKA 1T39A 2JRMA 1IRGA 2F6CA 1I6HJ 3F8BA 1ETOA 4B47A 1O57A 1B1BA 2VXZA 4BY1J 4A6EA 3GTKJ 2VASA 2CW0F 1W5CC 4PJNA 5EJCA 3ASOH 2QENA 2HOTA 2HXOA 1BOBA 1Q1VA 1A36A 3TW7A 2DK5A 2FBKA 5L3EA 4RM3A 3OMYA 4HEA2 2E2HJ 1XPXA 1Y1VJ 1LDKB 2ZC2A 3GWZA 2RN7A 5E8IA 4LD5A 2P7CB 3A01A 4GCVA 2ME0A 2M9HA 1ULYA 2J5PA 2A3SA 1LVKA 3H92A 1YJ9I 1KQ9A 5BPIA 5D8KB 2P6SA 1J75A 2YU9J 4IZZA 4DW6A 5CKTA 4E7KA 2CSOA 3LSRA 4MO7A 1RZ4A 3RDIA 1POGA 3VYTB 5DUIA 2O6GE 3B6CA 2IGNA 1BW5A 1MBKA 1QPIA 2DT5A 2LDUA 1KYZA 2GAUA 1T0FC 1XGNA 2VBXA 4OIRF 1VQLI 4R8HA 1I3QJ 1TL8A 3TGNA 4OMZA 1XGOA 2OBPA 4RS8A 4R79A 1O7LA 1MD0A 2GZWA 2VBWA 2XPVA 1Y39A 2ZSIB 2DPUA 5HLHA 2RKHA 1U9NA 2NVYJ 4XLPF 1H0MA 2VODA 1SEUA 2H1LA 1R36A 3E6DA 3WTWC 2CUZA 2GLOA 2L7FP 1LEBA 1YYVA 2M8EA 3M9AA 4RAFA 1DP3A 2MBFA 1Y1WJ 1Z7UA 1VQPI 1BR2A 1BC8C 2JQ7A 3QOEA 1XSVA 2KRFA 4M72A 2XKPA 5D4SA 4E7LA 3H1CA 1H9TA 4GYGA 1UJ8A 4XRFA 1BI0A 1HCRA 1ODDA 2NS7A 3LFUA 1BBYA 2K9LA 1OMIA 2YX4A 3LSJA 3P9IA 5GAHJ 3K9TA 2V4JC 1PUFB 1UHWA 3EETA 2DMNA 2O5RA 3K4CA 4YRVA 3PIOF 2IXSA 2Z1DA 1FPQA 3TKYA 4HQEA 2WV0A 3QYFA 2LF8A 2W7NA 2X51A 2JA7J 1U78A 1WKMA 3ZRGA 1BL0A 3TOAA 4E7JA 1HLVA 2RVCA 2LP0A 3HOYJ 1WQ2A 1N75A 4P9UA 1LFPA 3ZMSA 4CO8A 4D7NA 4XKBA 2ACJA 1KQ0A 2OV7A 4KN7X 4C3JJ 1RR7A 1X58A 1E2XA 1K7AA 4HF2A 3C2GA 9ANTA 3WHCA 3AG1H 4BHPA 3EYIA 2VBZA 4BYYA 1P4WA 4RB0A 2W24A 4FCYA 5BNGA 4E70A 2XAHA 1DPRA 4J19A 4QWQA 1SFOJ 1UELB 1UG0A 4LB6B 2V1NA 2A6EF 4PJMA 4TV7A 3FHZA 4I7HA 1I27A 1R1VA 3KIOA 2EV6A 1G6NA 4ANJA 3JSPA 2ECCA 1K78B 2HQRA 4QTRA 2HXIA 5J1UA 2E19A 2TDXA 3F23A 4D1QA 3DKWA 4IF4A 4M3FA 4X0GA 3G3ZA 3L2RA 4EQQA 4RB1A 2D45A 1YFHA 1Z1DA 2BHZA 2XAFA 3LSMA 4NQWB 1IXRC 3RZDJ 3ECHA 4UUSB 1CF7B 3H0DA 1F1ZA 2R5YB 3HOUJ 4ZYHA 3HOVJ 3GFMA 1WJAA 3PQKA 4ZDPA 2FXAA 1FTZA 2M4KA 2FRHA 4HZFA 1QHHD 1E3PA 2HU9A 3IP4B 5ED4A 1Z6RA 3RPQA 4XICA 3CCLI 1LE8B 3DPLC 3MCZA 4A12A 3ZQCA 1V5GA 2QQ9A 2QBYB 4G8XA 2HR3A 3OYHA 3DTEA 4HV6A 4NHJA 2VJ4A 2WBMA 1J09A 1SVOA 3QU3A 3CMEI 1GXQA 4XKCA 1ETVA 2MH2A 4MHGA 3OV8A 3FXOA 4Q5SF 4M73A 4O5VA 3KEQA 2BVLA 5DM7F 2M1BA 4BE0A 3WTZA 2G0EA 5B66C 2HWVA 1W5TA 3M1CA 1QNTA 2ZXIA 4RBOA 2F5CA 3O2PE 2JPBA 3BJOA 5IT9K 3VB2A 1SAXA 2CS3A 2DJIA 5C3EJ 1TP4A 2GIZA 2LBFA 1IW7F 1B8IB 1FT9A 1EV7A 4LIVA 1WJCA 3AL0C 2VN2A 4N4OB 3S15J 1B9NA 3A03A 4XN3A 1RKWA 5LEKA 4A6DA 5LGTA 3CUQA 1ENHA 2HOEA 2MGQA 2OZ6A 1RPWA 2I10A 3V8KA 2Y48A 4WX9A 4M6XA 5KK1A 1EH8A 4E4HA 3DWLE 2HVQA 4KUMA 1HQCA 2M45A 2V7FA 3DXJF 4KIGA 1WJFA 2KRCA 5TISC 2IPQX 2I5UA 5HNHA 5HDKA 3HHGA 2BE5F 3ZMDA 4EATA 3TDZC 3ABUA 3BJAA 2XC7A 3H3VK 4OOIA 3ONQA 4A0ZA 1Z21A 5DEQA 5EZGA 3IH2A 4OU0A 3NAUA 4DZPA 1FWZA 3IHUA 3OYIA 3BCAA 2R5ZA 3FX3A 1B72B 2E1CA 4D9JA 4EJWA 3CTAA 2Y0SN 4XSZF 4MTEA 3OYMA 5F0FA 2KDOA 1FYLA 4AM3A 5F04A 4YFXF 1QZZA 3BR0A 1YW9A 1ZTRA 2ZMEA 3RKYA 1CQTA 1MBGA 1GXPA 3S93A 2BY3A 2LMDA 2W48A 4GRIA 1VF9A 2Y30A 3JAMZ 1D8JA 1V55H 3HB9A 4M9SA 4V2FA 1GVDA 3D0SA 2PI0A 4S04A 2P4WA 3R60A 3I4NJ 1GV2A 2X0LA 4QPOA 4ZC3A 3FMQA 3AAFA 5IYDJ 2KPMA 3GUDA 4CCJA 3UR3C 3KETA 4YEJA 4AIKA 2BV6A 2YPRA 1IRZA 1KU9A 4OMYA 4NC7A 1TW3A 2G7UA 4OAYA 3FHNA 3KCCA 1WH5A 2EZKA 5HS8A 2VKDA 2MYSA 1QHGA 1R1UA 1YJWI 4IHTA 4B1RA 5IYBJ 1XGMA 1SAUA 3ZQHA 2XB0X 4MQ9F 5AIQA 1FOKA 4DYQA 3S1MJ 3I58A 1PDNC 3G6EI 1P4XA 3IKTA 3CJTB 1U8BA 5IOYA 2X6XA 2JVGA 5H6QA 1JUSA 2FU4A 4PUSA 2FX0A 1LFBA 5E20A 3E5QA 1WRJA 4XRSG 2L4AA 2OCEA 1ON2A 3J7YJ 2XDVA 5H2FC 3QP6A 2R7VA 1WSUA 4A3BJ 4HNVA 2ZJRF 3PIPF 2IRFG 4U87A 4M71A 3QQAA 3VOEA 1FIPA 2CQQA 3KE2A 2Q2EA 2V6CA 4F93B 1VI0A 2VPRA 1SMTA 4E6KG 2DOEA 3IRQA 3VEPA 2DCEA 1I5ZA 4HNUA 4XNFA 2EZHA 1ACIA 1TT0A 2CQNA 1F43A 2K4JA 4HV5A 1IRFA 3MKLA 2VONA 3JRAA 1MDMB 4FETA 4C9YA 5F1RA 3SEZA 2QQBA 3BWGA 2COMA 3ISPA 2EILH 2GQQA 4I76A 2QWWA 2KL4A 5FKKA 3UNGC 4KIFA 4BUPA 1YQAA 4HLXA 1K6OA 2FBIA 1ITYA 5K1YA 5KCMA 5DM6F 3HOTA 3WG7H 1E3OC 2PMUA 1MW7A 3C2HA 1ZRFA 2DPDA 2XGDA 3HL2A 3I53A 3ZQQA 1W0UA 4HDVA 3JR9A 2K4BA 2M4GA 2NYXA 1HKQA 5EF6A 4BJ5C 5A2QZ 1BI1A 1D0YA 2OTJI 3AKZA 1SMYF 3FIWA 2HQAA 3HEFA 2A68F 5E79C 5FKNA 4CYDA 5FGMA 4CCMA 5FFZA 1PYVA 2PG4A 4RA2A 1FEXA 4CSWA 3BG5A 1Y8QB 5DCMA 2MH9A 1J0RA 5H6RA 4L0ZB 1YHQI 1EKEA 1OR7C 2BVMA 2ZB9A 2Y9YA 3M1EA 3ZN0A 1O3TA 2GIVA 1XDSA 4A3EJ 2M8GX 4C30A 3CJRB 2AQEA 2A6TA 2H6CA 3FBNB 2H8RA 3J7AY 4V2GA 1GVJA 5CQGA 1CGPA 5CVIA 3NEUA 3HTUA 2PJPA 1USSA 2EFOA 5J8FA 3SHFA 2P0WA 2QSGX 3F22A 3EDPA 2PX9A 5IY5H 3C1DA 2GXGA 2HPMA 1REPC 3MFKA 5IYCJ 4M3GA 3FXRA 3EUHA 3EYYA 4UXNA 1DU0A 4A3MJ 1I1SA 3JW4A 3OR1C 1G4DA 2VT3A 1M1EB 4NDLA 5DD4A 4N9IA 5ILVA 2DMTA 4BACA 2JSCA 4HYEA 1VFCA 1T33A 3S1QJ 1FNNA 3SDBA 4AYBN 3P9KA 2NVUB 3ZQGA 2LFBA 1ETXA 1JTXA 1L3LA 1SFEA 1D1BA 1KONA 1ONVA 1XMKA 4R1HA 5K5QA 2YSRA 4YIFA 1SC7A 2O03A 1ZYRF 2E71A 3HSEA 1DGRM 2LR8A 3OL4A 1U5TA 2HI3A 1R22A 3OWTA 1ZLJA 1MGTA 4LK1F 1U2WA 4CCNA 5CPRB 2DAOA 4I99C 1MJ9A 3CUOA 4A3GJ 2IA2A 4H0EA 3CP2A 2XAJA 2ECBA 2K85A 3BJ6A 3E1SA 3QYEA 4M9ZA 4DOZA 2BYVE 3NRVA 1H9GA 2Z5UA 3IUOA 1FOWA 5IP9J 3M8JA 4MNUA 2WTEA 2Y2ZA 5CJ9A 1KU7A 3A1YA 2FA5A 1E3HA 2Z2SB 4FASD 4MTDA 4M74A 1MMGA 1R5ID 2F5VA 5F27A 5BMZA 2L9NA 3EPZA 4EVIA 2DT7B 2PMZA 3CESA 4GO1A 3E6BA 1BW6A 3WE3A 1Z0XA 3D5LA 2FUG2 3RJPA 2BXZA 2L02A 3E0JB 3CDIA 2VT2A 2CH0A 4XOPA 1Y8RB 4DBRA 3DFGA 2BXYA 3HSRA 4XLCA 3RYPA 5M5XJ 1VZ0A 4I2OA 3DEUA 2BY1A 2ZSHB 3IH4A 4N4NB 3ABLH 3C18A 2M34A 2E7XA 3CCYA 4KDPA 3DEEA 2RV8A 1VQKI 4GFBA 2A69F 5GADJ 3GZ5A 1G8XA 4EGZA 1YRNB 4V19K 1JGSA 4LG0B 1EH7A 4HOBA 1XX5A 3KZIC 4U7BA 4WK8F 1YTYA 2K86A 2LH9A 3ESWB 2CO5A 3MVPA 4I0BA 1BIAA 1JUMA 2GA1A 4LGWA 1ZKGA 1MSFC 3MKWB 5JVTA 2G9WA 1V3FA 1O3SA 2VJIA 3K70D 1BOAA 2E1NA 3KLOA 4Q48A 4A3LJ 4A69C 2HVSA 2DLLA 2UV1A 3M07A 1F5TA 4IL6C 1S8NA 4BL0B 4II3A 2IAIA 2QVOA 1R9TJ 4LB5A 4G6DA 1MNDA 2K9MA 1T0FA 4U0YA 2E1MB 3K4KA 3ZMTA 1STZA 3Q0WA 1IF1A 2PJRB 2R7OA 3K0LA 2V9KA 3CC4I 2IW5A 2VOOA 4RAYA 3J81Z 4IX7A 2ZKZA 1T08B 2KJCA 2RAEA 3LMMA 1YLFA 4XSXF 2Z16A 3I0TA 3GLLA 3B6AA 3L2WA 2L2OA 1X4PA 3HRMA 2F2EA 5HDGA 1P4AA 4A3KJ 2VXDA 2DA2A 1IO2A 5IT3A 4IHSA 2IGMA 1Y0UA 2VI6A 1ZAOA 1AWCA 2OQRA 5CLSA 2CUEA 3REOA 4ZDLA 2EZLA 3TO6A 4HNTA 5D5WB 2H1KA 1DPUA 3QYBA 4ZTJA 3NWSA 4IHVA 3HOWJ 3MZYA 1D1CA 3VYRB 3VYSB 5LHGA 3S2HJ 3DBRB 3E5XA 1Z67A 2KIFA 1BA5A 3F8FA 1T8IA 1J5YA 3CCJI 1GLNA 3HGYA 3W2WA 2KIQA 5EEAA 3K1NA 3I3LA 2CW8A 1V5EA 3HTSB 3LQQA 3L09A 1Z05A 1HSJA 2EH3A 4ITVA 2FMLA 5F6FA 3MKYB 1MMSA 3B02A 4AVPA 3QPTA 3RCOA 1FLIA 2A05A 1TLHB 4BQOA 2CV0A 3CLQA 3HXLA 3OYDA 2E2JJ 4F55A 4AVZA 1Z7LA 3VSKA 2Y75A 4S05A 2VQCA 1ETYA 2BGCA 2D1HA 3V42A 1ERDA 2DOFA 3FM3A 4AC0A 4XONA 1WJ5A 4ESFA 4KITB 4RAZA 3R4KA 1QZEA 1X2MA 3TOBA 3F21A 1YOVB 5FD5A 3OOPA 4KA4A 2R92J 3WU0A 2DTZA 3LSGA 5F64A 4BJ6C 3H5AA 4F52A 2ELJA 2DA6A 4PSWA 4LOCA 2IT0A 4U7DA 2YS9A 4B43A 1X1DA 4JX6A 2CUJA 1IZ1A 1J2XA 2E36A 5CVJA 5E18F 1YW8A 2Z9OA 4LITA 2VE9A 1FSEA 4UV9A 2MSYA 5C4XJ 3GTPJ 2K9NA 4G9YA 3S1NJ 2R7RA 2B0LA 1K78A 3O8GA 5J1YA 5EYRA 2P7VB 3LSKA 3F3XA 2CGPA 3GCMA 3PO2J 3AFHA 5K5RA 4DYCA 3JREA 5FRMA 1XCBA 1I3AA 3SFIA 4NQWA 5TRDA 3SZGA 4F3QA 5K5OA 3T8RA 4U88A 2FD5A 2HFHA 2XHKA 4C3IJ 4CYCA 5CYVA 2R5YA 4IKFA 2K9SA 5EEHA 2NAZA 3ELKA 3RQIA 1R49A 1XS9A 4NUBA 3X2QH 2EWNA 3O8HA 3QWLA 4EJOA 2BY2A 3DBHB 2ZXHA 1F9NA 2VC0A 3IWZA 4I01A 1RRJA 2K5CA 3CO6C 3GTOJ 3K4MA 5KAFC 4L5EA 1LE8A 1PVEA 2LD5A 4PZJA 5D5XB 4B44A 2OUMA 3A01B 2Q0OA 2EFWA 1JXSA 1IN6A 4RGXA 2YX7A 1T98A 1Z91A 1A5JA 4KMUX 1NTCA
chains in the Genus database with same CATH topology
4WXDA 2AXLA 2XKOA 2VBYA 5FB2A 2YU3A 5D5VB 2HS5A 1R5HA 1FX7A 5L3BA 4CHUA 2L3DA 5CVVA 4LFUA 4OIQF 5FLXK 2QZ8A 4KICA 3V8LA 2J5OA 3ECOA 2L01A 3GFIA 3DF8A 2D2WA 4A5MA 4ON0A 1V4RA 3FF5A 3WG9A 4YFNF 2NNNA 1QBJA 1OPCA 2H27A 2PN6A 3GFLA 2F5DA 2R7FA 2R7DA 2EK5A 1JHFA 1HW2A 1TQIA 5ERIA 3O3KA 2X4HA 5BPDA 3WU1B 2W25A 1J7KA 3Q9SA 2O3FA 1G3YA 5D6EA 2OQGA 1E17A 1XGSA 5L3FA 1W4MA 5BS6A 3M8FA 4YG2F 2XGXA 4YFKF 4P55A 5H20A 1TNTA 3EQLF 3WGGA 5DDGA 2QUFA 3J7AO 2Z3YA 3Q9VA 4ETSA 1PP7U 5E17F 2HKXA 3HUGA 3SFZA 4L9VA 5D6FA 3LAJA 3BOQA 1R1TA 4KIBA 1ZG5A 3ZMVA 4OIOF 1TBXA 4BAYA 2HDCA 2K7LA 1A04A 2M87A 2EB7A 2FF4A 3V7SA 3KP7A 1LDJA 2C6YA 4F7ZA 4NB5A 4K2EA 3G73A 4PGHA 4Y17A 1BIBA 5LGUA 2GWRA 1IN7A 1BN5A 1J9IA 3JTHA 3L9FA 2O61A 3BZ6A 1ZARA 4RB2C 4LLNA 1ZREA 1ZHFA 4OINF 2MD5A 2XAQA 1D8KA 3NQOA 3T0YA 2UXNA 1MDMA 2STTA 1HSTA 4Z2YA 1W5SA 4KT5C 3P9CA 4Y15A 3R0AA 4L0YB 2CFXA 1IAWA 4HQMA 1OYWA 3VODA 4ZYEA 5TJJA 2YR2A 1OR7A 1TQMA 3LFKA 4IJAA 4HX4A 1SD5A 2P5KA 2NNYA 1BM9A 3I54A 5ILUA 2FEZA 2AS5F 1HKTA 1HBXG 4JK1X 2LNBA 1FP2A 3KP5A 3K2ZA 4N9HA 2HQNA 3WGHA 1UB9A 3L00A 2KIMA 4PGGA 5LRRA 4LLGF 3E5UA 3FM5A 3J80K 1LNWA 2WC2A 1D5VA 2W84A 1YS6A 4O3MA 5DYMA 4BXUA 3FXQA 4UVCA 5HDNA 2STWA 5IT9Z 3SQNA 3R6SA 5LBQA 1GHCA 3FWEA 3PFIA 4G94A 4UV8A 2EJRA 2EFPA 4G6QA 3H3UA 2Y0MA 3M7GA 3QPHA 4ESBA 4HAMA 3BP8A 1T38A 3DPTA 1KQ8A 3IC7A 3LA7A 4EJUA 1YO5C 5JFRA 1O3QA 3QAHA 5D5UB 3GLXA 1ZLKA 3TDUC 2QLZA 3KP2A 2V1XA 1IN5A 3GVAA 2LF7A 2XIGA 5HLGA 2K27A 3GW2A 2EV0A 2JRTA 1DUXC 4B8XA 1JE8A 3KZZA 4ENJA 4I0AA 1ZRDA 1NHAA 2RGVA 2NRAC 4L9NA 3TO9A 5BQTA 4AD9A 1IXCA 2PFBA 2XV4S 3E6MA 3U9GA 3LAPA 4IRHA 2D1VA 3I59A 5LEJA 2DI3A 2HZTA 2ZCWA 3WTYC 1USTA 3RKWA 2BBYA 3GYHX 1P6RA 3LQRA 1F4KA 2FNAA 3W6JB 1OYYA 3JSOA 2BEOA 2IVMA 5J6XA 4LMYA 1EH6A 2K02A 5LGNA 1X3UA 4YIIA 4IVNA 4LLLA 3FMSA 1ON1A 3IWFA 3L2CA 3HHHA 1K79A 5FFXA 3VFZA 3E6CC 2HGCA 2QQAA 2OZUA 1IN8A 2M5WA 4I09A 1WI9A 1UHMA 4RGUA 1JHHA 3WTTC 1TNSA 4B09A 2L54A 3WTXC 1TQPA 3KFWX 4ZYDA 4BNCA 3WE2A 3KP6A 1FBUA 2FSWA 1S7OA 4A0XA 4L5JA 3WTVC 1W7PB 2V9VA 3C3WA 2P5LC 2ISZA 3ZN1A 3P7NA 3RYRA 2EA2A 5E1WA 1R5GA 3BPXA 1YW7A 1W7PD 4HA8A 1R23A 2DQLA 3GZ6A 4A2UA 4N0BA 4KNYA 1FZPB 1FYKA 3HIFA 4HDUA 3F8CA 4MEYF 5LHIA 5KVRA 1P92A 3ULQB 1FP1D 3ROUA 1I1GA 3H3ZA 3KEOA 1LB2A 5LRSA 4GGGA 4RGSA 4RGRA 2H6BA 2FNPA 3ZMUA 1MZBA 1S29A 2L4MA 2DFIA 2FOKA 4GYIA 2MLGA 3R61A 2HTSA 2W57A 1ZH5A 1I6XA 5L3CA 3FXUA 3GO5A 2A6HF 1QO0D 2ESHA 1WWXA 1RUNA 3IL2A 2W85A 1UCRA 2ISYA 4DQ2A 4ENMA 4XLNF 3TO7A 2OAZA 4EJVA 2DQRA 3CJNA 3BY6A 1ZGJA 1FBQA 4RB3C 5ILSA 4HW0A 4OIPF 3CLOA 2XASA 3I64A 1FYMA 3U1DA 1UFMA 2XUBA 2P6TA 5J8CA 1LEAA 2DO7A 5DV5A 3GX4X 4I02A 4IXAA 2P8TA 3LA2A 3QU6A 4M9XA 5ICCA 4L9JA 1RNLA 4I98B 3QP5A 1HW1A 3DV8A 4CICA 1ZG1A 3E97A 3I71A 1XSDA 2FMYA 4U0WA 3T5XA 5E1XA 4P5OA 1FC3A 1AOYA 3R0JA 3MWMA 3O6BB 1S7AA 1CF7A 5E1ZB 1PUEE 3K1PA 3JAMK 3SZPA 1C0WA 2DTRA 2FQ3A 4PDKA 4LK0F 5E8GA 1PP8F 3M8EA 4HLYA 3K69A 3IKVA 2QBYA 4U0VA 4FT8A 2ZO4A 5HLIA 1T6SA 4QLCU 2MA3A 4ZH4F 2NS0A 1BI2A 3TQNA 4Q47A 2CQKA 1P2FA 2ZNZA 1TTYA 4CXFA 3LWFA 4Y13A 1XDUA 1J59A 1Q1HA 2ZFWA 2PEXA 2OD5A 3V7RA 3HYIA 3V8JA 1OKRA 2IA1A 4ZYGA 2HEOA 1S6LA 2A5YB 2MC3A 2EFQA 4JBAA 4HF0A 3K1MA 1T2KA 4CDGA 2QM3A 1HKSA 2F5EA 4G7OF 5FO5A 1FY7A 3KLNA 3F6OA 2O8XA 1XCVA 3FMRA 1DDNA 2H94A 4UNOA 3ZP5A 3GF2A 3L7WA 2FE3A 1U3EM 1QPMA 2G7HA 3RI4A 2HTJA 2E7WA 1QZYA 3FZVA 2V1UA 3LSTA 2DBBA 1D3YA 1OYIA 1KU3A 1BI3A 3GEZA 1RUOA 1SD7A 1XN7A 2FBHA 5A2QK 1BC7C 4BHCA 3DP7A 5HS7A 2LSOA 4EMSA 1HXDA 3QOPA 3HOSA 1SD4A 3S2WA 3DQVC 3HRSA 4G7HF 2HKOA 3T8TA 5ICGA 2OA4A 1IN4A 1FSHA 3V4GA 3ABTA 4O6JA 3GFJA 4EM1A 1RI7A 1G3SA 1R7JA 1IXSB 4HX7A 2XAGA 4KFCA 6PAXA 2DW4A 2P5VA 4ZZLA 2EV5A 3WGIA 3N4MA 5L3GA 4G7ZF 1B6AA 3N97A 3PQJA 4A5NA 4WXHA 3WODF 1S3JA 4ESJA 2LKPA 4MQVA 3BPVA 3HRTA 5DUKA 4FHTA 2PLYA 3Q5FA 1B59A 1XMAA 4ZZDA 1ZN2A 3CUQB 2R3SA 4FX4A 2XVCA 3U2RA 3KP4A 1B9MA 3F6VA 4FX0A 1YIOA 1KGSA 2VC1A 2OU2A 3CUQC 3I4PA 2QYOA 4ENKA 2O0YA 2RDPA 1ZRCA 4XBFA 1VTNC 2VE8A 3B73A 1XSXA 1MKMA 2PMHA 5D4RA 4AIJA 2WWYA 2PBIA 2ESNA 3RIRA 4KYWA 3T1BA 5FLXZ 4BQAA 4WCGA 2ZBKA 3MEXA 3BDDA 2ZMEB 3IRRA 4M6YA 2CG4A 5LHHA 1QGPA 2A07F 2XROA 1O7FA 2UZKA 3ZQ7A 4UUVA 3LA3A 1G3WA 5HVQC 3WTUC 1IUYA 2H09A 5JI6A 3KP3A 5LLQA 1YG2A 4WWCA 3HSFA 2XRNA 4WF2A 4ASNA 4HBLA 4EGYA 3J81K 5FD6A 2ETHA 2UWMA 2IA0A 2PQ8A 1LJ9A 3C7JA 2ZJ2A 3SZTA 4CZZA 1G3TA 1YS7A 2GA2A 1KU2A 1MJAA 2F5FA 2KJBA 2RNJA 3RKXA 2IP2A 3E3VA 1KYWA 1LDDA 3MAJA 1HW5A 2Z99A 5AIPA 1KA8A 2RQPA 5L3DA 5JHUA 1U6GA 3I5UA 3SXYA 1XB4A 3CDHA 1TW2A 3WTSC 2UXXA 2V79A 4P96A 1O3RA 3CO7C 4HX8A 4EJTA 4CGZA 5EEGA 2V1DA 2EFNA 4UVAA 4AIHA 2M30A 4L5IA 3MQ0A 2HYFA 4ENNA 2JTVA 4EM0B 4LG0A 5CVRA 1R58A 1W7PA 1QQIA 2GXBA 4JQFA 2KKOA 2MLKA 4UVBA 5CVUA 2DU9A 1RIOH 3F8MA 2EA4A 3COAC 5DCMB 5ICEA 4LJZF 2JZYA 3RPUA 2Q8KA 4HF1A 4AWXB 2RC4A 3KZYA 3BROA 2Z33A 1XD7A 3F8NA 2DK8A 4KMFA 5DD8A 2JT1A 2CYYA 1ZG3A 4EV0A 3MZHA 4UHTA 2A61A 2VOPA 3JTGA 1R00A 4IRIA 1SD6A 4EM2A 1MJBA 4MEXF 3ZPLA 3ZMZA 4L18B 3F72A 1SFXA 1LVAA 4BH9A 1BJAA 2KIUA 4D0PA 1SFUA 4MGRA 2HYGD 1Z6TA 3I59B 4BHBA 1U5TB 5JR3A 3ERED 1Z9CA 5HS9A 5HOOA 5D8LB 4KN4X 3J80Z 4IPAA 4PCQA 1ZGAA 1B4AA 1LQ1A 3RTRA 2ELHA 3GXOA 5DCFA 2ADUA 1FBSA 4IRGA 4GXOA 5AONA 2CWEA 1U5TC 1U8RA 4A0YA 4DNCA 3ML6A 2ZXJA 2ZNYA 3QRFF 3W6KB 4P9FA 4WXCA 2IJLA 2JPCA 5ICFA 4L9TA 3V7CA 1L0OC 1DP7P 3HRUA 5BOXA 1T39A 1IRGA 3F8BA 1O57A 1B1BA 2VXZA 4A6EA 2CW0F 2QENA 2DK5A 2FBKA 5L3EA 1LDKB 3GWZA 2RN7A 5E8IA 4LD5A 2P7CB 4GCVA 1ULYA 2J5PA 2A3SA 3H92A 1KQ9A 5BPIA 5D8KB 2P6SA 1J75A 2CSOA 1RZ4A 3RDIA 2O6GE 5DUIA 2DT5A 2LDUA 1KYZA 2GAUA 1XGNA 2VBXA 4OIRF 4R8HA 3TGNA 4OMZA 1XGOA 2OBPA 4RS8A 4R79A 1O7LA 1MD0A 2GZWA 2VBWA 2DPUA 5HLHA 2RKHA 4XLPF 1H0MA 2VODA 3E6DA 1R36A 3WTWC 1LEBA 1YYVA 2M8EA 3M9AA 2MBFA 1Z7UA 1BC8C 1XSVA 2KRFA 4M72A 2XKPA 5D4SA 1H9TA 4GYGA 4XRFA 1BI0A 1ODDA 1BBYA 1OMIA 2YX4A 3P9IA 3K9TA 1UHWA 3EETA 1FPQA 3TKYA 4HQEA 2WV0A 2LF8A 1U78A 1WKMA 3TOAA 2RVCA 1WQ2A 4P9UA 3ZMSA 4CO8A 2ACJA 1KQ0A 4KN7X 1E2XA 1K7AA 4HF2A 4BHPA 3EYIA 2VBZA 4BYYA 1P4WA 4RB0A 2W24A 4E70A 2XAHA 1DPRA 4QWQA 4LB6B 2A6EF 4TV7A 3FHZA 4I7HA 1I27A 1R1VA 2EV6A 1G6NA 3JSPA 1K78B 2HQRA 2TDXA 3F23A 3DKWA 4IF4A 3G3ZA 4EQQA 4RB1A 2D45A 1YFHA 1Z1DA 2XAFA 1IXRC 1CF7B 3ECHA 1F1ZA 4ZYHA 3GFMA 3PQKA 2FXAA 2FRHA 4HZFA 5ED4A 1Z6RA 3RPQA 3DPLC 3MCZA 4A12A 2QQ9A 2QBYB 4G8XA 2HR3A 4NHJA 4HV6A 3QU3A 1GXQA 4MHGA 2MH2A 3OV8A 4Q5SF 4M73A 4O5VA 3KEQA 2M1BA 3WTZA 2HWVA 1W5TA 1QNTA 2F5CA 3O2PE 2JPBA 3BJOA 5IT9K 3VB2A 1SAXA 1IW7F 1FT9A 1EV7A 2VN2A 1B9NA 5LEKA 4A6DA 5LGTA 3CUQA 2HOEA 2OZ6A 3V8KA 4WX9A 2Y48A 4M6XA 5KK1A 1EH8A 4KUMA 1HQCA 2M45A 3DXJF 4KIGA 2IPQX 5HDKA 3HHGA 2BE5F 3ZMDA 3TDZC 3ABUA 3BJAA 4OOIA 4A0ZA 5DEQA 4OU0A 1FWZA 3IHUA 3FX3A 2E1CA 4EJWA 3CTAA 4XSZF 4MTEA 1FYLA 4YFXF 1QZZA 1YW9A 2ZMEA 3RKYA 1GXPA 3JAMZ 1D8JA 4M9SA 3D0SA 2PI0A 4S04A 2P4WA 3R60A 2X0LA 3FMQA 3AAFA 3GUDA 3KETA 4AIKA 2BV6A 2YPRA 1KU9A 4OMYA 1TW3A 2G7UA 3KCCA 5HS8A 1R1UA 4IHTA 1XGMA 4MQ9F 5AIQA 1FOKA 3I58A 1PDNC 1P4XA 3IKTA 5H6QA 2FU4A 5E20A 3E5QA 1WRJA 2L4AA 1ON2A 3QP6A 1WSUA 2IRFG 4M71A 3VOEA 3KE2A 2Q2EA 2V6CA 1SMTA 3IRQA 3VEPA 1I5ZA 2K4JA 4HV5A 1IRFA 2VONA 1MDMB 5F1RA 2QQBA 3BWGA 2COMA 3ISPA 2GQQA 2QWWA 4KIFA 1YQAA 4HLXA 1K6OA 2FBIA 5K1YA 3HOTA 2PMUA 2DPDA 1ZRFA 3I53A 4HDVA 2K4BA 2NYXA 1HKQA 5A2QZ 1BI1A 1SMYF 2A68F 4CYDA 5FGMA 5FFZA 2PG4A 5DCMA 2MH9A 1J0RA 5H6RA 4L0ZB 3ZN0A 3M1EA 1O3TA 2GIVA 1XDSA 2H6CA 1GVJA 1CGPA 5CVIA 3NEUA 3HTUA 2PJPA 1USSA 2EFOA 5J8FA 3SHFA 3F22A 3EDPA 3C1DA 2GXGA 1REPC 3MFKA 3FXRA 3EUHA 3EYYA 4UXNA 1I1SA 3JW4A 1G4DA 2VT3A 5DD4A 4N9IA 5ILVA 2JSCA 4HYEA 1FNNA 3P9KA 1L3LA 1SFEA 1ONVA 1XMKA 4R1HA 5K5QA 2YSRA 4YIFA 2O03A 1ZYRF 3HSEA 1U5TA 1R22A 4LK1F 1ZLJA 1MGTA 1U2WA 2DAOA 1MJ9A 3CUOA 2IA2A 4H0EA 2XAJA 3BJ6A 4M9ZA 2BYVE 3NRVA 1H9GA 2Z5UA 4MNUA 2WTEA 5CJ9A 1KU7A 2FA5A 4MTDA 4M74A 5BMZA 4EVIA 4GO1A 3E6BA 3WE3A 3D5LA 3RJPA 2L02A 2VT2A 3DFGA 3HSRA 3RYPA 4I2OA 3DEUA 3C18A 2E7XA 4KDPA 2RV8A 2A69F 3GZ5A 4EGZA 1JGSA 4LG0B 1EH7A 4HOBA 4U7BA 4WK8F 1YTYA 2K86A 2CO5A 4I0BA 1BIAA 2GA1A 4LGWA 5JVTA 2G9WA 1V3FA 1O3SA 1BOAA 2E1NA 3KLOA 4Q48A 2DLLA 1F5TA 1S8NA 2QVOA 4LB5A 4G6DA 1T0FA 4U0YA 3ZMTA 1STZA 1IF1A 3K0LA 2IW5A 2VOOA 4RAYA 3J81Z 2ZKZA 2KJCA 1YLFA 4XSXF 3I0TA 5HDGA 3HRMA 2F2EA 1P4AA 5IT3A 4IHSA 1Y0UA 1ZAOA 1AWCA 2OQRA 5CLSA 3REOA 5D5WB 3TO6A 1DPUA 3MZYA 5LHGA 3E5XA 2KIFA 3F8FA 1J5YA 3K1NA 3HTSB 3LQQA 3L09A 1Z05A 1HSJA 2FMLA 5F6FA 3B02A 4AVPA 3QPTA 1FLIA 1TLHB 4S05A 2Y75A 2BGCA 2D1HA 3FM3A 4ESFA 4RAZA 3R4KA 3TOBA 3F21A 5FD5A 3OOPA 4KA4A 3WU0A 5F64A 2IT0A 4U7DA 1IZ1A 1J2XA 5CVJA 5E18F 2Z9OA 1YW8A 2VE9A 1FSEA 4UV9A 4G9YA 1K78A 2B0LA 2P7VB 3F3XA 2CGPA 5K5RA 1XCBA 4NQWA 5TRDA 5K5OA 3T8RA 4U88A 2HFHA 2XHKA 5CYVA 5EEHA 2NAZA 3ELKA 2EWNA 4EJOA 1F9NA 2VC0A 3IWZA 4I01A 3CO6C 4PZJA 5D5XB 2Q0OA 2EFWA 1JXSA 1IN6A 4RGXA 2YX7A 1T98A 1Z91A 4KMUX 4Q4ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WXD A;  2AXL A;  2XKO A;  2VBY A;  5FB2 A;  2YU3 A;  5D5V B;  2HS5 A;  1R5H A;  1FX7 A;  5L3B A;  4CHU A;  2L3D A;  5CVV A;  4LFU A;  4OIQ F;  5FLX K;  2QZ8 A;  4KIC A;  3V8L A;  2J5O A;  3ECO A;  2L01 A;  3GFI A;  3DF8 A;  2D2W A;  4A5M A;  4ON0 A;  1V4R A;  3FF5 A;  3WG9 A;  4YFN F;  2NNN A;  1QBJ A;  1OPC A;  2H27 A;  2PN6 A;  3GFL A;  2F5D A;  2R7F A;  2R7D A;  2EK5 A;  1JHF A;  1HW2 A;  1TQI A;  5ERI A;  3O3K A;  2X4H A;  5BPD A;  3WU1 B;  2W25 A;  1J7K A;  3Q9S A;  2O3F A;  1G3Y A;  5D6E A;  2OQG A;  1E17 A;  1XGS A;  5L3F A;  1W4M A;  5BS6 A;  3M8F A;  4YG2 F;  2XGX A;  4YFK F;  4P55 A;  5H20 A;  1TNT A;  3EQL F;  3WGG A;  5DDG A;  2QUF A;  3J7A O;  2Z3Y A;  3Q9V A;  4ETS A;  1PP7 U;  5E17 F;  2HKX A;  3HUG A;  3SFZ A;  4L9V A;  5D6F A;  3LAJ A;  3BOQ A;  1R1T A;  4KIB A;  1ZG5 A;  3ZMV A;  4OIO F;  1TBX A;  4BAY A;  2HDC A;  2K7L A;  1A04 A;  2M87 A;  2EB7 A;  2FF4 A;  3V7S A;  3KP7 A;  1LDJ A;  2C6Y A;  4F7Z A;  4NB5 A;  4K2E A;  3G73 A;  4PGH A;  4Y17 A;  1BIB A;  5LGU A;  2GWR A;  1IN7 A;  1BN5 A;  1J9I A;  3JTH A;  3L9F A;  2O61 A;  3BZ6 A;  1ZAR A;  4RB2 C;  4LLN A;  1ZRE A;  1ZHF A;  4OIN F;  2MD5 A;  2XAQ A;  1D8K A;  3NQO A;  3T0Y A;  2UXN A;  1MDM A;  2STT A;  1HST A;  4Z2Y A;  1W5S A;  4KT5 C;  3P9C A;  4Y15 A;  3R0A A;  4L0Y B;  2CFX A;  1IAW A;  4HQM A;  1OYW A;  3VOD A;  4ZYE A;  5TJJ A;  2YR2 A;  1OR7 A;  1TQM A;  3LFK A;  4IJA A;  4HX4 A;  1SD5 A;  2P5K A;  2NNY A;  1BM9 A;  3I54 A;  5ILU A;  2FEZ A;  2AS5 F;  1HKT A;  1HBX G;  4JK1 X;  2LNB A;  1FP2 A;  3KP5 A;  3K2Z A;  4N9H A;  2HQN A;  3WGH A;  1UB9 A;  3L00 A;  2KIM A;  4PGG A;  5LRR A;  4LLG F;  3E5U A;  3FM5 A;  3J80 K;  1LNW A;  2WC2 A;  1D5V A;  2W84 A;  1YS6 A;  4O3M A;  5DYM A;  4BXU A;  3FXQ A;  4UVC A;  5HDN A;  2STW A;  5IT9 Z;  3SQN A;  3R6S A;  5LBQ A;  1GHC A;  3FWE A;  3PFI A;  4G94 A;  4UV8 A;  2EJR A;  2EFP A;  4G6Q A;  3H3U A;  2Y0M A;  3M7G A;  3QPH A;  4ESB A;  4HAM A;  3BP8 A;  1T38 A;  3DPT A;  1KQ8 A;  3IC7 A;  3LA7 A;  4EJU A;  1YO5 C;  5JFR A;  1O3Q A;  3QAH A;  5D5U B;  3GLX A;  1ZLK A;  3TDU C;  2QLZ A;  3KP2 A;  2V1X A;  1IN5 A;  3GVA A;  2LF7 A;  2XIG A;  5HLG A;  2K27 A;  3GW2 A;  2EV0 A;  2JRT A;  1DUX C;  4B8X A;  1JE8 A;  3KZZ A;  4ENJ A;  4I0A A;  1ZRD A;  1NHA A;  2RGV A;  2NRA C;  4L9N A;  3TO9 A;  5BQT A;  4AD9 A;  1IXC A;  2PFB A;  2XV4 S;  3E6M A;  3U9G A;  3LAP A;  4IRH A;  2D1V A;  3I59 A;  5LEJ A;  2DI3 A;  2HZT A;  2ZCW A;  3WTY C;  1UST A;  3RKW A;  2BBY A;  3GYH X;  1P6R A;  3LQR A;  1F4K A;  2FNA A;  3W6J B;  1OYY A;  3JSO A;  2BEO A;  2IVM A;  5J6X A;  4LMY A;  1EH6 A;  2K02 A;  5LGN A;  1X3U A;  4YII A;  4IVN A;  4LLL A;  3FMS A;  1ON1 A;  3IWF A;  3L2C A;  3HHH A;  1K79 A;  5FFX A;  3VFZ A;  3E6C C;  2HGC A;  2QQA A;  2OZU A;  1IN8 A;  2M5W A;  4I09 A;  1WI9 A;  1UHM A;  4RGU A;  1JHH A;  3WTT C;  1TNS A;  4B09 A;  2L54 A;  3WTX C;  1TQP A;  3KFW X;  4ZYD A;  4BNC A;  3WE2 A;  3KP6 A;  1FBU A;  2FSW A;  1S7O A;  4A0X A;  4L5J A;  3WTV C;  1W7P B;  2V9V A;  3C3W A;  2P5L C;  2ISZ A;  3ZN1 A;  3P7N A;  3RYR A;  2EA2 A;  5E1W A;  1R5G A;  3BPX A;  1YW7 A;  1W7P D;  4HA8 A;  1R23 A;  2DQL A;  3GZ6 A;  4A2U A;  4N0B A;  4KNY A;  1FZP B;  1FYK A;  3HIF A;  4HDU A;  3F8C A;  4MEY F;  5LHI A;  5KVR A;  1P92 A;  3ULQ B;  1FP1 D;  3ROU A;  1I1G A;  3H3Z A;  3KEO A;  1LB2 A;  5LRS A;  4GGG A;  4RGS A;  4RGR A;  2H6B A;  2FNP A;  3ZMU A;  1MZB A;  1S29 A;  2L4M A;  2DFI A;  2FOK A;  4GYI A;  2MLG A;  3R61 A;  2HTS A;  2W57 A;  1ZH5 A;  1I6X A;  5L3C A;  3FXU A;  3GO5 A;  2A6H F;  1QO0 D;  2ESH A;  1WWX A;  1RUN A;  3IL2 A;  2W85 A;  1UCR A;  2ISY A;  4DQ2 A;  4ENM A;  4XLN F;  3TO7 A;  2OAZ A;  4EJV A;  2DQR A;  3CJN A;  3BY6 A;  1ZGJ A;  1FBQ A;  4RB3 C;  5ILS A;  4HW0 A;  4OIP F;  3CLO A;  2XAS A;  3I64 A;  1FYM A;  3U1D A;  1UFM A;  2XUB A;  2P6T A;  5J8C A;  1LEA A;  2DO7 A;  5DV5 A;  3GX4 X;  4I02 A;  4IXA A;  2P8T A;  3LA2 A;  3QU6 A;  4M9X A;  5ICC A;  4L9J A;  1RNL A;  4I98 B;  3QP5 A;  1HW1 A;  3DV8 A;  4CIC A;  1ZG1 A;  3E97 A;  3I71 A;  1XSD A;  2FMY A;  4U0W A;  3T5X A;  5E1X A;  4P5O A;  1FC3 A;  1AOY A;  3R0J A;  3MWM A;  3O6B B;  1S7A A;  1CF7 A;  5E1Z B;  1PUE E;  3K1P A;  3JAM K;  3SZP A;  1C0W A;  2DTR A;  2FQ3 A;  4PDK A;  4LK0 F;  5E8G A;  1PP8 F;  3M8E A;  4HLY A;  3K69 A;  3IKV A;  2QBY A;  4U0V A;  4FT8 A;  2ZO4 A;  5HLI A;  1T6S A;  4QLC U;  2MA3 A;  4ZH4 F;  2NS0 A;  1BI2 A;  3TQN A;  4Q47 A;  2CQK A;  1P2F A;  2ZNZ A;  1TTY A;  4CXF A;  3LWF A;  4Y13 A;  1XDU A;  1J59 A;  1Q1H A;  2ZFW A;  2PEX A;  2OD5 A;  3V7R A;  3HYI A;  3V8J A;  1OKR A;  2IA1 A;  4ZYG A;  2HEO A;  1S6L A;  2A5Y B;  2MC3 A;  2EFQ A;  4JBA A;  4HF0 A;  3K1M A;  1T2K A;  4CDG A;  2QM3 A;  1HKS A;  2F5E A;  4G7O F;  5FO5 A;  1FY7 A;  3KLN A;  3F6O A;  2O8X A;  1XCV A;  3FMR A;  1DDN A;  2H94 A;  4UNO A;  3ZP5 A;  3GF2 A;  3L7W A;  2FE3 A;  1U3E M;  1QPM A;  2G7H A;  3RI4 A;  2HTJ A;  2E7W A;  1QZY A;  3FZV A;  2V1U A;  3LST A;  2DBB A;  1D3Y A;  1OYI A;  1KU3 A;  1BI3 A;  3GEZ A;  1RUO A;  1SD7 A;  1XN7 A;  2FBH A;  5A2Q K;  1BC7 C;  4BHC A;  3DP7 A;  5HS7 A;  2LSO A;  4EMS A;  1HXD A;  3QOP A;  3HOS A;  1SD4 A;  3S2W A;  3DQV C;  3HRS A;  4G7H F;  2HKO A;  3T8T A;  5ICG A;  2OA4 A;  1IN4 A;  1FSH A;  3V4G A;  3ABT A;  4O6J A;  3GFJ A;  4EM1 A;  1RI7 A;  1G3S A;  1R7J A;  1IXS B;  4HX7 A;  2XAG A;  4KFC A;  6PAX A;  2DW4 A;  2P5V A;  4ZZL A;  2EV5 A;  3WGI A;  3N4M A;  5L3G A;  4G7Z F;  1B6A A;  3N97 A;  3PQJ A;  4A5N A;  4WXH A;  3WOD F;  1S3J A;  4ESJ A;  2LKP A;  4MQV A;  3BPV A;  3HRT A;  5DUK A;  4FHT A;  2PLY A;  3Q5F A;  1B59 A;  1XMA A;  4ZZD A;  1ZN2 A;  3CUQ B;  2R3S A;  4FX4 A;  2XVC A;  3U2R A;  3KP4 A;  1B9M A;  3F6V A;  4FX0 A;  1YIO A;  1KGS A;  2VC1 A;  2OU2 A;  3CUQ C;  3I4P A;  2QYO A;  4ENK A;  2O0Y A;  2RDP A;  1ZRC A;  4XBF A;  1VTN C;  2VE8 A;  3B73 A;  1XSX A;  1MKM A;  2PMH A;  5D4R A;  4AIJ A;  2WWY A;  2PBI A;  2ESN A;  3RIR A;  4KYW A;  3T1B A;  5FLX Z;  4BQA A;  4WCG A;  2ZBK A;  3MEX A;  3BDD A;  2ZME B;  3IRR A;  4M6Y A;  2CG4 A;  5LHH A;  1QGP A;  2A07 F;  2XRO A;  1O7F A;  2UZK A;  3ZQ7 A;  4UUV A;  3LA3 A;  1G3W A;  5HVQ C;  3WTU C;  1IUY A;  2H09 A;  5JI6 A;  3KP3 A;  5LLQ A;  1YG2 A;  4WWC A;  3HSF A;  2XRN A;  4WF2 A;  4ASN A;  4HBL A;  4EGY A;  3J81 K;  5FD6 A;  2ETH A;  2UWM A;  2IA0 A;  2PQ8 A;  1LJ9 A;  3C7J A;  2ZJ2 A;  3SZT A;  4CZZ A;  1G3T A;  1YS7 A;  2GA2 A;  1KU2 A;  1MJA A;  2F5F A;  2KJB A;  2RNJ A;  3RKX A;  2IP2 A;  3E3V A;  1KYW A;  1LDD A;  3MAJ A;  1HW5 A;  2Z99 A;  5AIP A;  1KA8 A;  2RQP A;  5L3D A;  5JHU A;  1U6G A;  3I5U A;  3SXY A;  1XB4 A;  3CDH A;  1TW2 A;  3WTS C;  2UXX A;  2V79 A;  4P96 A;  1O3R A;  3CO7 C;  4HX8 A;  4EJT A;  4CGZ A;  5EEG A;  2V1D A;  2EFN A;  4UVA A;  4AIH A;  2M30 A;  4L5I A;  3MQ0 A;  2HYF A;  4ENN A;  2JTV A;  4EM0 B;  4LG0 A;  5CVR A;  1R58 A;  1W7P A;  1QQI A;  2GXB A;  4JQF A;  2KKO A;  2MLK A;  4UVB A;  5CVU A;  2DU9 A;  1RIO H;  3F8M A;  2EA4 A;  3COA C;  5DCM B;  5ICE A;  4LJZ F;  2JZY A;  3RPU A;  2Q8K A;  4HF1 A;  4AWX B;  2RC4 A;  3KZY A;  3BRO A;  2Z33 A;  1XD7 A;  3F8N A;  2DK8 A;  4KMF A;  5DD8 A;  2JT1 A;  2CYY A;  1ZG3 A;  4EV0 A;  3MZH A;  4UHT A;  2A61 A;  2VOP A;  3JTG A;  1R00 A;  4IRI A;  1SD6 A;  4EM2 A;  1MJB A;  4MEX F;  3ZPL A;  3ZMZ A;  4L18 B;  3F72 A;  1SFX A;  1LVA A;  4BH9 A;  1BJA A;  2KIU A;  4D0P A;  1SFU A;  4MGR A;  2HYG D;  1Z6T A;  3I59 B;  4BHB A;  1U5T B;  5JR3 A;  3ERE D;  1Z9C A;  5HS9 A;  5HOO A;  5D8L B;  4KN4 X;  3J80 Z;  4IPA A;  4PCQ A;  1ZGA A;  1B4A A;  1LQ1 A;  3RTR A;  2ELH A;  3GXO A;  5DCF A;  2ADU A;  1FBS A;  4IRG A;  4GXO A;  5AON A;  2CWE A;  1U5T C;  1U8R A;  4A0Y A;  4DNC A;  3ML6 A;  2ZXJ A;  2ZNY A;  3QRF F;  3W6K B;  4P9F A;  4WXC A;  2IJL A;  2JPC A;  5ICF A;  4L9T A;  3V7C A;  1L0O C;  1DP7 P;  3HRU A;  5BOX A;  1T39 A;  1IRG A;  3F8B A;  1O57 A;  1B1B A;  2VXZ A;  4A6E A;  2CW0 F;  2QEN A;  2DK5 A;  2FBK A;  5L3E A;  1LDK B;  3GWZ A;  2RN7 A;  5E8I A;  4LD5 A;  2P7C B;  4GCV A;  1ULY A;  2J5P A;  2A3S A;  3H92 A;  1KQ9 A;  5BPI A;  5D8K B;  2P6S A;  1J75 A;  2CSO A;  1RZ4 A;  3RDI A;  2O6G E;  5DUI A;  2DT5 A;  2LDU A;  1KYZ A;  2GAU A;  1XGN A;  2VBX A;  4OIR F;  4R8H A;  3TGN A;  4OMZ A;  1XGO A;  2OBP A;  4RS8 A;  4R79 A;  1O7L A;  1MD0 A;  2GZW A;  2VBW A;  2DPU A;  5HLH A;  2RKH A;  4XLP F;  1H0M A;  2VOD A;  3E6D A;  1R36 A;  3WTW C;  1LEB A;  1YYV A;  2M8E A;  3M9A A;  2MBF A;  1Z7U A;  1BC8 C;  1XSV A;  2KRF A;  4M72 A;  2XKP A;  5D4S A;  1H9T A;  4GYG A;  4XRF A;  1BI0 A;  1ODD A;  1BBY A;  1OMI A;  2YX4 A;  3P9I A;  3K9T A;  1UHW A;  3EET A;  1FPQ A;  3TKY A;  4HQE A;  2WV0 A;  2LF8 A;  1U78 A;  1WKM A;  3TOA A;  2RVC A;  1WQ2 A;  4P9U A;  3ZMS A;  4CO8 A;  2ACJ A;  1KQ0 A;  4KN7 X;  1E2X A;  1K7A A;  4HF2 A;  4BHP A;  3EYI A;  2VBZ A;  4BYY A;  1P4W A;  4RB0 A;  2W24 A;  4E70 A;  2XAH A;  1DPR A;  4QWQ A;  4LB6 B;  2A6E F;  4TV7 A;  3FHZ A;  4I7H A;  1I27 A;  1R1V A;  2EV6 A;  1G6N A;  3JSP A;  1K78 B;  2HQR A;  2TDX A;  3F23 A;  3DKW A;  4IF4 A;  3G3Z A;  4EQQ A;  4RB1 A;  2D45 A;  1YFH A;  1Z1D A;  2XAF A;  1IXR C;  1CF7 B;  3ECH A;  1F1Z A;  4ZYH A;  3GFM A;  3PQK A;  2FXA A;  2FRH A;  4HZF A;  5ED4 A;  1Z6R A;  3RPQ A;  3DPL C;  3MCZ A;  4A12 A;  2QQ9 A;  2QBY B;  4G8X A;  2HR3 A;  4NHJ A;  4HV6 A;  3QU3 A;  1GXQ A;  4MHG A;  2MH2 A;  3OV8 A;  4Q5S F;  4M73 A;  4O5V A;  3KEQ A;  2M1B A;  3WTZ A;  2HWV A;  1W5T A;  1QNT A;  2F5C A;  3O2P E;  2JPB A;  3BJO A;  5IT9 K;  3VB2 A;  1SAX A;  1IW7 F;  1FT9 A;  1EV7 A;  2VN2 A;  1B9N A;  5LEK A;  4A6D A;  5LGT A;  3CUQ A;  2HOE A;  2OZ6 A;  3V8K A;  4WX9 A;  2Y48 A;  4M6X A;  5KK1 A;  1EH8 A;  4KUM A;  1HQC A;  2M45 A;  3DXJ F;  4KIG A;  2IPQ X;  5HDK A;  3HHG A;  2BE5 F;  3ZMD A;  3TDZ C;  3ABU A;  3BJA A;  4OOI A;  4A0Z A;  5DEQ A;  4OU0 A;  1FWZ A;  3IHU A;  3FX3 A;  2E1C A;  4EJW A;  3CTA A;  4XSZ F;  4MTE A;  1FYL A;  4YFX F;  1QZZ A;  1YW9 A;  2ZME A;  3RKY A;  1GXP A;  3JAM Z;  1D8J A;  4M9S A;  3D0S A;  2PI0 A;  4S04 A;  2P4W A;  3R60 A;  2X0L A;  3FMQ A;  3AAF A;  3GUD A;  3KET A;  4AIK A;  2BV6 A;  2YPR A;  1KU9 A;  4OMY A;  1TW3 A;  2G7U A;  3KCC A;  5HS8 A;  1R1U A;  4IHT A;  1XGM A;  4MQ9 F;  5AIQ A;  1FOK A;  3I58 A;  1PDN C;  1P4X A;  3IKT A;  5H6Q A;  2FU4 A;  5E20 A;  3E5Q A;  1WRJ A;  2L4A A;  1ON2 A;  3QP6 A;  1WSU A;  2IRF G;  4M71 A;  3VOE A;  3KE2 A;  2Q2E A;  2V6C A;  1SMT A;  3IRQ A;  3VEP A;  1I5Z A;  2K4J A;  4HV5 A;  1IRF A;  2VON A;  1MDM B;  5F1R A;  2QQB A;  3BWG A;  2COM A;  3ISP A;  2GQQ A;  2QWW A;  4KIF A;  1YQA A;  4HLX A;  1K6O A;  2FBI A;  5K1Y A;  3HOT A;  2PMU A;  2DPD A;  1ZRF A;  3I53 A;  4HDV A;  2K4B A;  2NYX A;  1HKQ A;  5A2Q Z;  1BI1 A;  1SMY F;  2A68 F;  4CYD A;  5FGM A;  5FFZ A;  2PG4 A;  5DCM A;  2MH9 A;  1J0R A;  5H6R A;  4L0Z B;  3ZN0 A;  3M1E A;  1O3T A;  2GIV A;  1XDS A;  2H6C A;  1GVJ A;  1CGP A;  5CVI A;  3NEU A;  3HTU A;  2PJP A;  1USS A;  2EFO A;  5J8F A;  3SHF A;  3F22 A;  3EDP A;  3C1D A;  2GXG A;  1REP C;  3MFK A;  3FXR A;  3EUH A;  3EYY A;  4UXN A;  1I1S A;  3JW4 A;  1G4D A;  2VT3 A;  5DD4 A;  4N9I A;  5ILV A;  2JSC A;  4HYE A;  1FNN A;  3P9K A;  1L3L A;  1SFE A;  1ONV A;  1XMK A;  4R1H A;  5K5Q A;  2YSR A;  4YIF A;  2O03 A;  1ZYR F;  3HSE A;  1U5T A;  1R22 A;  4LK1 F;  1ZLJ A;  1MGT A;  1U2W A;  2DAO A;  1MJ9 A;  3CUO A;  2IA2 A;  4H0E A;  2XAJ A;  3BJ6 A;  4M9Z A;  2BYV E;  3NRV A;  1H9G A;  2Z5U A;  4MNU A;  2WTE A;  5CJ9 A;  1KU7 A;  2FA5 A;  4MTD A;  4M74 A;  5BMZ A;  4EVI A;  4GO1 A;  3E6B A;  3WE3 A;  3D5L A;  3RJP A;  2L02 A;  2VT2 A;  3DFG A;  3HSR A;  3RYP A;  4I2O A;  3DEU A;  3C18 A;  2E7X A;  4KDP A;  2RV8 A;  2A69 F;  3GZ5 A;  4EGZ A;  1JGS A;  4LG0 B;  1EH7 A;  4HOB A;  4U7B A;  4WK8 F;  1YTY A;  2K86 A;  2CO5 A;  4I0B A;  1BIA A;  2GA1 A;  4LGW A;  5JVT A;  2G9W A;  1V3F A;  1O3S A;  1BOA A;  2E1N A;  3KLO A;  4Q48 A;  2DLL A;  1F5T A;  1S8N A;  2QVO A;  4LB5 A;  4G6D A;  1T0F A;  4U0Y A;  3ZMT A;  1STZ A;  1IF1 A;  3K0L A;  2IW5 A;  2VOO A;  4RAY A;  3J81 Z;  2ZKZ A;  2KJC A;  1YLF A;  4XSX F;  3I0T A;  5HDG A;  3HRM A;  2F2E A;  1P4A A;  5IT3 A;  4IHS A;  1Y0U A;  1ZAO A;  1AWC A;  2OQR A;  5CLS A;  3REO A;  5D5W B;  3TO6 A;  1DPU A;  3MZY A;  5LHG A;  3E5X A;  2KIF A;  3F8F A;  1J5Y A;  3K1N A;  3HTS B;  3LQQ A;  3L09 A;  1Z05 A;  1HSJ A;  2FML A;  5F6F A;  3B02 A;  4AVP A;  3QPT A;  1FLI A;  1TLH B;  4S05 A;  2Y75 A;  2BGC A;  2D1H A;  3FM3 A;  4ESF A;  4RAZ A;  3R4K A;  3TOB A;  3F21 A;  5FD5 A;  3OOP A;  4KA4 A;  3WU0 A;  5F64 A;  2IT0 A;  4U7D A;  1IZ1 A;  1J2X A;  5CVJ A;  5E18 F;  2Z9O A;  1YW8 A;  2VE9 A;  1FSE A;  4UV9 A;  4G9Y A;  1K78 A;  2B0L A;  2P7V B;  3F3X A;  2CGP A;  5K5R A;  1XCB A;  4NQW A;  5TRD A;  5K5O A;  3T8R A;  4U88 A;  2HFH A;  2XHK A;  5CYV A;  5EEH A;  2NAZ A;  3ELK A;  2EWN A;  4EJO A;  1F9N A;  2VC0 A;  3IWZ A;  4I01 A;  3CO6 C;  4PZJ A;  5D5X B;  2Q0O A;  2EFW A;  1JXS A;  1IN6 A;  4RGX A;  2YX7 A;  1T98 A;  1Z91 A;  4KMU X;  4Q4Z F; 
#chains in the Genus database with same CATH topology
 1YIT I;  2HQ5 A;  4WXD A;  4IQ4 A;  2AXL A;  2XKO A;  2VBY A;  5FB2 A;  2YU3 A;  3ZQI A;  5D5V B;  1MBE A;  2HS5 A;  4KJZ A;  4XLE A;  3RKQ A;  1R5H A;  4IO9 F;  1FX7 A;  4BBR J;  5L3B A;  4CHU A;  4BE1 A;  3RZO J;  2IS1 A;  2L3D A;  5CVV A;  3CCV I;  3BTI A;  4LFU A;  1YX3 A;  4OIQ F;  5FLX K;  2QZ8 A;  2FQ4 A;  2M7A A;  3DBL B;  4KIC A;  3V8L A;  2OCC H;  3L2V A;  1AA7 A;  3GBG A;  2DA4 A;  2J5O A;  3ECO A;  2E5Z A;  1HF0 A;  2NVX J;  4IOC F;  2L01 A;  3GFI A;  1VQN I;  3DF8 A;  1E0E A;  2D2W A;  4A5M A;  4ON0 A;  1V4R A;  3FF5 A;  3WG9 A;  2LTP A;  3TMO A;  4YFN F;  2NNN A;  3AG4 H;  1OPC A;  1X4O A;  1QBJ A;  2PN6 A;  1TWC J;  3JRB A;  2H27 A;  3GFL A;  5IP7 J;  1VQ9 I;  1UAA A;  2F5D A;  2R7F A;  1BR4 A;  2R7D A;  2O7O A;  1JKR C;  3EUA A;  2LC2 A;  2EK5 A;  1JHF A;  2RRE A;  1HOM A;  1HW2 A;  1TQI A;  3BG9 A;  3PJR A;  1WGX A;  5ERI A;  4QPQ A;  3S3M A;  1TWH J;  2X4H A;  3O3K A;  3H5N A;  5BPD A;  3LSP A;  2XRL A;  4XQF A;  3WU1 B;  3BZK A;  2W25 A;  1J7K A;  3CJQ B;  1XG1 A;  3Q9S A;  2O3F A;  4PFO A;  1GUU A;  1G3Y A;  5D6E A;  1LUJ B;  1WJB A;  4RLF A;  2I8D A;  2OQG A;  1B72 A;  1E17 A;  1XGS A;  2JVH A;  4IHY A;  4JYK A;  3K4B A;  1YI2 I;  4XRS A;  5L3F A;  1W4M A;  5BS6 A;  3M8F A;  4BDZ A;  2VJ5 A;  3S14 J;  3IAS 2;  2EIK H;  3H0G J;  2QGU A;  4YG2 F;  2XGX A;  4YFK F;  4CCK A;  3MMY B;  2OPT A;  4P55 A;  3KX2 A;  5H20 A;  4P1W A;  2X48 A;  1TNT A;  3EQL F;  5E3O A;  3WGG A;  5DDG A;  2DJN A;  2QUF A;  3BC8 A;  1G59 A;  3J7A O;  1W36 D;  2K9Q A;  2F4O B;  2WAE A;  2Z3Y A;  3Q9V A;  4PJJ A;  4QSH A;  1KZH A;  4ETS A;  1PP7 U;  2XPU A;  5E17 F;  2HKX A;  1W36 C;  2JSP A;  3S32 A;  1K83 J;  4E7S A;  3HUG A;  2K3P A;  3QOD A;  4A3I J;  3I9V 2;  5FRN A;  2RNG A;  1ETQ A;  2GBY A;  2Q1Z B;  3SFZ A;  5F08 A;  2HVR A;  4L9V A;  5D6F A;  3LAJ A;  2DFH A;  3PNT A;  3BOQ A;  4KT6 A;  1R1T A;  3ABM H;  4KIB A;  1EA3 A;  2O9L A;  2LY1 A;  3ZMV A;  1ZG5 A;  4OIO F;  1TBX A;  3KYD B;  4BAY A;  2HDC A;  2R7U A;  1G2H A;  2K7L A;  1A04 A;  3DKY A;  1PJR A;  3CQZ J;  2HOA A;  2M87 A;  3FKI J;  3Q0U A;  1K4T A;  1HDP A;  2VB6 A;  2EB7 A;  1N25 A;  2FF4 A;  3DTK A;  3V7S A;  3KP7 A;  1H89 C;  1LDJ A;  3HOX J;  2ID6 A;  4Y7N J;  2AHQ A;  3N05 A;  2C6Y A;  4F7Z A;  2CJJ A;  2COB A;  4NB5 A;  5K7Z A;  2JK3 A;  4K2E A;  3G73 A;  4PGH A;  4Y17 A;  1BIB A;  2IEK A;  2M0C A;  5LGU A;  3MKZ A;  4F92 B;  2XSD C;  2GWR A;  1IN7 A;  1BN5 A;  1J9I A;  2DFE A;  3JTH A;  5EG0 A;  3L9F A;  4BEH A;  3ZR8 X;  2O61 A;  2ME6 A;  3BZ6 A;  3HKZ A;  1ZAR A;  4RB2 C;  4LLN A;  5J1R A;  1ZRE A;  1ZHF A;  4OIN F;  2XF5 A;  1WI3 A;  3A0B C;  3OIO A;  2MD5 A;  2XAQ A;  1D8K A;  2LBF B;  3NQO A;  3T0Y A;  2UXN A;  4XK4 A;  3LSI A;  1MDM A;  2STT A;  3OYB A;  5C4J J;  1HST A;  2R0Q C;  4Z2Y A;  4D7M A;  1W5S A;  2EIJ H;  4KT5 C;  3P9C A;  4Y15 A;  1P7J A;  3QPS A;  4CCL A;  4I6Z A;  3R0A A;  4L0Y B;  2CFX A;  1QRY A;  3DKX A;  1IAW A;  4HQM A;  2NXN B;  1OYW A;  3VOD A;  2MG4 A;  2FOW A;  4ZYE A;  5TJJ A;  4BJT A;  2L0K A;  2YR2 A;  1QVT A;  2F4M B;  5GPC A;  5KHD A;  1OR7 A;  2D5V A;  1A6I A;  1TQM A;  2E2I J;  3LFK A;  3OS0 A;  1WCM J;  2NVQ J;  3PM1 A;  3W2A A;  4IJA A;  4GDF A;  4HX4 A;  1SD5 A;  2P5K A;  4BY7 J;  2NNY A;  1JKQ C;  3EUK L;  1A35 A;  2B7E A;  2BOL A;  1BM9 A;  1MSE C;  3I54 A;  5ILU A;  2L9S A;  2FEZ A;  2AS5 F;  1TT5 B;  2R5Z B;  1HKT A;  1HBX G;  4JK1 X;  2LNB A;  1FP2 A;  1IUF A;  4FIS A;  3FXL A;  3KP5 A;  2VKH A;  3K2Z A;  5E3L A;  4N9H A;  1GV5 A;  3SEQ A;  2ID3 A;  2YUS A;  2HQN A;  3WGH A;  2TRT A;  1UB9 A;  3L00 A;  2KIM A;  1W0T A;  2NVT J;  4PGG A;  1APL C;  5LRR A;  4LLG F;  3E5U A;  4E7Z A;  3HG9 A;  3FM5 A;  2JA8 J;  2LKS A;  3ASN H;  3CMY A;  3C2B A;  1R6R A;  3J80 K;  1LNW A;  5J4V A;  3JRC A;  3OSG A;  1WJE A;  3PNY A;  3CCU I;  2EPF A;  3UKG A;  2WC2 A;  2EIN H;  1D5V A;  2W84 A;  2RQQ A;  1YS6 A;  2X85 A;  1NK3 P;  1AHD P;  3OOU A;  4A3J J;  4O3M A;  5DYM A;  1V54 H;  3MD2 A;  1RKT A;  4BXU A;  3FXQ A;  2O8K A;  4UVC A;  5HDN A;  1XMX A;  1D0Z A;  2QEX I;  5JLX A;  1MIJ A;  1JI8 A;  5J40 A;  4F91 B;  2LVS A;  2STW A;  1OJL A;  5IT9 Z;  4AU7 A;  3SQN A;  3R6S A;  5LBQ A;  2DXI A;  1GHC A;  1NH3 A;  3FWE A;  3ZQL A;  3JRG A;  2MD0 A;  2WA0 A;  3PFI A;  1Y56 A;  3S2D J;  1IDY A;  2XB5 A;  4G94 A;  2MFZ A;  4UV8 A;  4EEF G;  2EJR A;  2EFP A;  4G6Q A;  3H3U A;  4XKV A;  2Y0M A;  3M7G A;  3QPH A;  5GTI C;  4ESB A;  2Q2E B;  4HAM A;  1K61 A;  2IS2 A;  5F0C A;  3BP8 A;  1T38 A;  1A31 A;  3DPT A;  4BQN A;  1KQ8 A;  3IC7 A;  1OFC X;  3LA7 A;  4EJU A;  1YO5 C;  5JFR A;  2OF7 A;  1O3Q A;  4RDU A;  3QAH A;  4MIM A;  5D5U B;  5HLT A;  3GLX A;  1ZLK A;  1JTY A;  2DYR H;  1YX5 A;  2DDA A;  4XOT A;  2BY0 A;  3TDU C;  5EDN A;  2QLZ A;  1ZQ3 P;  3KP2 A;  2V1X A;  2XF7 A;  4BS9 A;  3L1P A;  1IN5 A;  1S9H A;  3BQY A;  1O4X A;  2B63 J;  1ORK A;  2ZJQ F;  1VND A;  3M3Y J;  3GVA A;  1SFK A;  2LF7 A;  4XRM A;  3CF2 A;  2XIG A;  5HLG A;  3S3O A;  2K27 A;  3HGG A;  3GW2 A;  4IHW A;  3K4N A;  1ETW A;  2EV0 A;  4XOR A;  4BU2 A;  4UB6 C;  2JRT A;  4HG2 A;  1NK2 P;  1DUX C;  4B8X A;  1JE8 A;  3KZZ A;  4ENJ A;  4I0A A;  1N77 A;  1NHA A;  2CUF A;  2RGV A;  1ZRD A;  2CV1 A;  1TWG J;  2NRA C;  4L9N A;  1YJN I;  1S5L C;  3TO9 A;  2OTL I;  2VPL A;  5BQT A;  3SJM A;  1ZR4 A;  4AD9 A;  1IXC A;  2BHY A;  2PFB A;  2XV4 S;  3E6M A;  1V5F A;  3OYA A;  3U9G A;  3LAP A;  4IRH A;  2D1V A;  3I59 A;  5LEJ A;  2PMZ N;  2DI3 A;  2HZT A;  2ZCW A;  3WTY C;  5M5W J;  1IRX A;  4XLH A;  1UST A;  1WVR A;  3RKW A;  2JJ7 A;  3GZN B;  1AKH B;  2BBY A;  3GYH X;  1FJL A;  3FK7 A;  1P6R A;  3LQR A;  3D1N I;  2HYJ A;  1JT0 A;  5HOD A;  1RR8 C;  1F4K A;  2FNA A;  3W6J B;  1OYY A;  3JSO A;  1ZEL A;  2BEO A;  2IVM A;  3G71 I;  5J6X A;  4LMY A;  4C2U A;  3W3C A;  1EH6 A;  2K02 A;  5LGN A;  2WAQ N;  1X3U A;  4YII A;  2LKX A;  2VUM J;  2R7S A;  2L9R A;  2X9D A;  4IVN A;  4LLL A;  3FMS A;  3JRI A;  3G1M A;  1ON1 A;  5B3S H;  3IWF A;  3AG3 H;  3L2C A;  2QQ8 A;  3DEW A;  3HHH A;  1K79 A;  5FFX A;  2R7Z J;  5DTD A;  3VFZ A;  4X1E A;  4PK4 A;  1R4N B;  4Y4R A;  3E6C C;  2E35 A;  3GME A;  2HGC A;  2F48 A;  2QQA A;  2OZU A;  3H36 A;  2L7M P;  1IN8 A;  2M5W A;  4I09 A;  5FLV A;  1WI9 A;  2KMU A;  3BR3 A;  1UHM A;  2JA5 J;  5KNL A;  3RQ4 A;  4RGU A;  1JHH A;  4C3H J;  3WTT C;  3NAR A;  1TNS A;  1NG6 A;  4B09 A;  2L54 A;  2VL8 A;  3WTX C;  3F9K A;  2WAQ A;  3H5R A;  1TQP A;  3GTQ J;  3KFW X;  4ZYD A;  4BNC A;  2WB1 A;  3WE2 A;  3KP6 A;  1FBU A;  1U9O A;  4E7I A;  2FSW A;  1S7O A;  4A0X A;  4L5J A;  3WTV C;  1W7P B;  4BBS J;  2V9V A;  3C3W A;  3FXJ A;  2BW3 A;  2P5L C;  2ISZ A;  3VDX A;  2CMP A;  4XLA A;  2JWT A;  3ZN1 A;  3P7N A;  3RYR A;  2EA2 A;  1FOY A;  3S16 J;  4FTH A;  5E1W A;  1R5G A;  1IGN A;  3OYG A;  3BPX A;  3GTL J;  1YW7 A;  3HC7 A;  1W7P D;  4HA8 A;  4A3F J;  4S0H B;  3CCQ I;  2X6O A;  4M6V A;  1R23 A;  1IV8 A;  2DQL A;  3GZ6 A;  4D5C A;  4A2U A;  2WAF A;  4N0B A;  4KNY A;  1FZP B;  2KZG A;  1FYK A;  3HIF A;  2XGC A;  4HDU A;  2DA1 A;  3F8C A;  4MEY F;  5LHI A;  5KVR A;  2JA6 J;  4LIU A;  3LL7 A;  1P92 A;  1YE9 A;  4HST A;  3ULQ B;  4XR6 A;  1R4M B;  1FP1 D;  3ROU A;  1I1G A;  3H3Z A;  3BG6 A;  5EGO B;  1HA8 A;  2DFF A;  2KHM A;  1F36 A;  3A2K A;  4BQQ A;  3KEO A;  2LRE A;  4OWR B;  1ZR2 A;  1DU6 A;  1LB2 A;  2KP6 A;  3LOC A;  3FDY A;  3RPU D;  4DZJ A;  1Y0N A;  3IV5 A;  5LRS A;  4GGG A;  1SVL A;  4RGS A;  1BR1 A;  2H6B A;  4RGR A;  2VJJ A;  2FNP A;  3G1L A;  3ZMU A;  3HM5 A;  1MZB A;  5F0H A;  1S29 A;  2E1M C;  2L4M A;  1QA6 A;  2DFI A;  4DJA A;  2FOK A;  3PSI A;  3KYL A;  4GYI A;  2DA5 A;  3P5J A;  3CCR I;  2MLG A;  3CF5 F;  2Y31 A;  3ZQF A;  3FIS A;  2DMP A;  2HDW A;  3R61 A;  2HTS A;  2JN6 A;  2L7K A;  5F1J A;  5M3M J;  3W6V A;  2W57 A;  1ZH5 A;  1I6X A;  4HPQ A;  5L3C A;  3FXU A;  5M3F J;  3GO5 A;  3TP3 A;  2A6H F;  1QO0 D;  2WY7 Q;  3GTM J;  4CCO A;  2ESH A;  5FKO A;  1WWX A;  1RUN A;  3IL2 A;  2W85 A;  3H9J A;  3BTL A;  1UCR A;  2ISY A;  4DQ2 A;  4ENM A;  4XLN F;  3TO7 A;  2OAZ A;  2M0M A;  4EJV A;  1SVM A;  1ZK8 A;  2GOX B;  2LY2 A;  2DQR A;  4Y3O A;  4B3A A;  3CJN A;  2E1O A;  1SAN A;  1X1C A;  3BY6 A;  1ZGJ A;  2IGO A;  1FBQ A;  3ABK H;  3NWT A;  4M3D A;  4HW0 A;  5ILS A;  4RB3 C;  1PUF A;  2IBD A;  1IG7 A;  4OIP F;  2DMU A;  3CLO A;  2X6W A;  4RAG A;  2HDD A;  2XAS A;  4C2T A;  3I64 A;  4CA0 A;  4IHX A;  1FYM A;  2VIX A;  1WPK A;  1UFM A;  2XUB A;  3U1D A;  2P6T A;  1MBF A;  5J8C A;  1LEA A;  2DO7 A;  5DV5 A;  5FJ8 J;  3GX4 X;  1UHS A;  2IGK A;  4I02 A;  4IXA A;  2P8T A;  2UUZ A;  4ZDO A;  3BR1 A;  3LA2 A;  3JCU C;  2NS8 A;  2X6Y A;  3QU6 A;  4DYR A;  3JRD A;  2HPI A;  4M9X A;  1A6Q A;  2E5N A;  5B1B H;  3OYF A;  5ICC A;  3JRF A;  3S1R J;  1TC3 C;  2OC6 A;  4XMY A;  1VQO I;  2JUG A;  4L9J A;  3HPG A;  2GM4 A;  1MMN A;  1RNL A;  3OYK A;  5GPA A;  4I98 B;  3QP5 A;  1HW1 A;  3WHB A;  1WFX A;  3DV8 A;  1K6Y A;  1JJ6 C;  3KPH A;  4CIC A;  4JP0 A;  3LSH A;  2QCO A;  3HZJ A;  1ZG1 A;  3E97 A;  3I71 A;  1XSD A;  1LPQ A;  2FMY A;  2V6E A;  1YIJ I;  4U0W A;  1JKP C;  3T5X A;  5E1X A;  4P5O A;  2FJ1 A;  1FC3 A;  1AOY A;  2LY9 A;  3D5S C;  3R0J A;  3MWM A;  3O6B B;  1S7A A;  1CF7 A;  4YIR X;  4UUS A;  4FE4 A;  5E1Z B;  1WJD A;  2XF6 A;  4MLO A;  3K1P A;  3DLA A;  1PUE E;  4QIW N;  3JAM K;  1D1A A;  3SZP A;  4UUT A;  5JVG F;  3BZC A;  1C0W A;  2DTR A;  3K7A J;  2FQ3 A;  4PDK A;  4LK0 F;  1OQY A;  3G4S I;  2L9V A;  3A4C A;  1LKX A;  5E8G A;  1P7I A;  1PP8 F;  2R93 J;  3M8E A;  3FKJ A;  2XPW A;  4HLY A;  1T56 A;  2V26 A;  3K69 A;  2KZV A;  3IKV A;  2QBY A;  4RLQ A;  4U0V A;  3BR6 A;  4FT8 A;  4IOA F;  2ZO4 A;  5HLI A;  1T6S A;  4CUG A;  4QLC U;  2OJE D;  1MMD A;  1X3W B;  2MA3 A;  5FKM A;  4ZH4 F;  4A3D J;  3HJE A;  1GDT A;  2NS0 A;  1BI2 A;  3TQN A;  4Q47 A;  2MW8 A;  2CQK A;  2R4G A;  1OCR H;  5GAE J;  1NG7 A;  1P2F A;  4NC8 A;  2ZNZ A;  2H8W A;  1TTY A;  1WZ2 A;  4CXF A;  2VKE A;  3OIP A;  3LWF A;  5J4Y A;  1B8I A;  2R7W A;  4Y13 A;  1XDU A;  1J59 A;  3PUB A;  4XID A;  3I4M J;  1Q1H A;  5B5E C;  4UB8 C;  2ZFW A;  2PEX A;  2OD5 A;  4ZYA A;  4HSR A;  3V7R A;  3F0C A;  3HYI A;  1IJW C;  3BG3 A;  3V8J A;  1JJ8 C;  2L5Q A;  1OKR A;  5IOZ A;  2IA1 A;  4ZYG A;  2HEO A;  1S6L A;  4E7H A;  2A5Y B;  2M2E A;  2MC3 A;  2EFQ A;  4JBA A;  4HF0 A;  2KIS A;  2LK2 A;  3K1M A;  2KDZ A;  1XTA A;  4CDG A;  3CMA I;  2DYS H;  1T2K A;  1Z77 A;  4J00 A;  2QM3 A;  3CCS I;  4Y33 A;  1OCZ H;  1HKS A;  2F5E A;  4G7O F;  5FO5 A;  1FY7 A;  3KLN A;  3F6O A;  3BR5 A;  2GXA A;  4NNJ A;  2O8X A;  4CYC B;  2Y9Z A;  1XCV A;  2X1C A;  2X1E A;  2A5W A;  3FMR A;  4OAZ A;  5CQE A;  3ZCO A;  1DDN A;  2H94 A;  4UNO A;  3DTI A;  3ZP5 A;  3GF2 A;  3L7W A;  1TWA J;  2FE3 A;  5FLM J;  1U3E M;  1QPM A;  2G7H A;  3RI4 A;  3DU6 A;  3J7Z I;  2HTJ A;  2E7W A;  3ERM A;  3H9G A;  1QZY A;  2KQR A;  3FZV A;  2V1U A;  3HOZ J;  3BCB A;  1X19 A;  3LST A;  2DBB A;  1D3Y A;  1OYI A;  4Q4Z F;  1IDZ A;  1TWF J;  3BQZ A;  1KU3 A;  1BI3 A;  3GEZ A;  1S72 I;  2QKL B;  1RUO A;  1SD7 A;  1XN7 A;  3KYC B;  3AL0 B;  4A3C J;  2FBH A;  2DA7 A;  3WU2 C;  1IC8 A;  2N8G A;  5A2Q K;  1FMV A;  1EJ9 A;  1BC7 C;  1Z3Y A;  4BHC A;  3DP7 A;  5HS7 A;  1DGW Y;  4BE2 A;  2LSO A;  1QVU A;  4EMS A;  5KAI C;  3PL8 A;  3PSF A;  5B1A H;  1HXD A;  2MAB A;  3QOP A;  3W2V A;  3HOS A;  1SD4 A;  2QSF X;  3S2W A;  3CDL A;  3DQV C;  3K4L A;  3HRS A;  4G7H F;  2WY8 Q;  2HKO A;  3T8T A;  5ICG A;  3VYU B;  2OA4 A;  4ZTF A;  4D5F A;  1IN4 A;  1FSH A;  3V4G A;  3ABT A;  4BXX J;  4O6J A;  3SYT A;  1R71 A;  2W4S A;  4PSX A;  3GFJ A;  3I56 I;  2F4I A;  4EM1 A;  1RI7 A;  1G3S A;  4XLF A;  4ABZ A;  4II2 A;  1R7J A;  3BR2 A;  1IXS B;  2LOO A;  3HKZ N;  4HX7 A;  2XAG A;  4KFC A;  6PAX A;  2CFO A;  2DW4 A;  2AO9 A;  1I39 A;  4NBQ A;  2GOM A;  2P5V A;  2NOJ B;  3DLL F;  2KRH A;  4ZZL A;  1AU7 A;  1GT0 C;  2EV5 A;  3WGI A;  3TED A;  3N4M A;  4PJ0 C;  5L3G A;  4G7Z F;  3CP8 A;  4M3B A;  1B6A A;  3N97 A;  3PQJ A;  3BTC A;  4A5N A;  4WXH A;  3CMM A;  3OS2 A;  3QPL A;  1OCP A;  3OYJ A;  3L2Q A;  4XN0 A;  3CC2 I;  2HNH A;  4DIQ A;  1OLT A;  3HPH A;  3BTJ A;  2XSJ C;  4W97 A;  3L2U A;  1ZGW A;  3CCM I;  2EZI A;  3OYE A;  1WH7 A;  4HRI A;  3WOD F;  1VQ6 I;  3HDD A;  3OSF A;  2QF7 A;  2E34 A;  5E3M A;  2B9S A;  5JLW A;  1S3J A;  4ESJ A;  3I55 I;  1UG2 A;  1QU3 A;  2QKM B;  3RSN A;  2LKP A;  4DGW B;  4MQV A;  3BPV A;  3HRT A;  5DUK A;  4FHT A;  5IPA A;  3OR2 C;  4YEL A;  2PLY A;  3Q5F A;  1B59 A;  1XMA A;  3DU5 A;  2M3A A;  3FXK A;  4ZZD A;  5LD2 C;  2IS4 A;  1ZN2 A;  3CUQ B;  2R3S A;  4FX4 A;  3CCE I;  2ZJP F;  2XVC A;  4PJL A;  3U2R A;  1BJZ A;  3E7L A;  5M5Y J;  3KP4 A;  1B9M A;  3F6V A;  4FX0 A;  1JGG A;  2WAD A;  1YIO A;  1KGS A;  3HUG B;  3CC7 I;  2Y0S A;  2DN0 A;  4NC6 A;  2VC1 A;  5C44 J;  3M4O J;  2OU2 A;  4DBQ A;  3CUQ C;  1JT6 A;  3I4P A;  2QA4 I;  2QYO A;  4ENK A;  2O0Y A;  2RDP A;  4B4C A;  3K6G A;  2M7B A;  5IP6 A;  4XBF A;  1ZRC A;  1VTN C;  2VE8 A;  5K7F A;  4JX4 A;  4XL9 A;  3IAM 2;  1X1A A;  1DQU A;  3B73 A;  1XSX A;  2BZT A;  3OS1 A;  4FQG A;  1IV6 A;  1MKM A;  2PMH A;  5LFA A;  2CQ7 A;  5D4R A;  4AIJ A;  2WWY A;  2PBI A;  2ESN A;  3RIR A;  1MNM C;  1FMW A;  4KYW A;  3T1B A;  3VSL A;  5FLX Z;  2LG4 A;  4BQA A;  4WCG A;  2ZBK A;  4A93 J;  3JRH A;  3MEX A;  3K10 A;  1MBH A;  2K40 A;  3BDD A;  1P9Q C;  2ZME B;  3IRR A;  1D0X A;  1X1B A;  2CG4 A;  4M6Y A;  5LHH A;  1QGP A;  4G12 A;  2A07 F;  2XRO A;  5TGT A;  1MH3 A;  1O7F A;  2UZK A;  3ZQ7 A;  2DOD A;  3H35 A;  3K4J A;  4B3X A;  5EG0 B;  1JKO C;  4BEH B;  4UUV A;  3S8P A;  4ZJZ A;  3LA3 A;  4C2M J;  1ETK A;  1G3W A;  5HVQ C;  3WTU C;  4Y52 J;  1IUY A;  1VQM I;  2H09 A;  3OYL A;  5JI6 A;  2ZME C;  3KP3 A;  2KLO A;  3PO3 J;  1Y6I A;  5LLQ A;  5HNF A;  1EF4 A;  1YG2 A;  4WWC A;  3HSF A;  3K2A A;  2XRN A;  4RM2 A;  4WF2 A;  4ASN A;  1XC5 A;  3HBL A;  1LFU P;  4AUX A;  1UMQ A;  4HBL A;  4M3E A;  3IH3 A;  1VQ4 I;  3OIQ A;  4EGY A;  4XKW A;  2NOG A;  3J81 K;  5FD6 A;  1OCC H;  2ETH A;  5K7H A;  2K3F A;  2UWM A;  2IA0 A;  2PQ8 A;  1LJ9 A;  3C7J A;  4LG3 A;  4KIS A;  2Y69 H;  4BGD A;  4UY8 I;  2ZJ2 A;  4MFD A;  3SZT A;  3VPR A;  4CZZ A;  1G3T A;  1YS7 A;  2GA2 A;  2R7Q A;  4AID A;  2VQG A;  4IQJ A;  1KU2 A;  1AKH A;  3S3N A;  2VQL A;  1MJA A;  2F5F A;  1Z3X A;  1H88 C;  2KJB A;  2EQR A;  2RNJ A;  3RKX A;  2IP2 A;  3LNQ A;  3E3V A;  1KYW A;  1LDD A;  3MAJ A;  4J01 A;  4BXF A;  1HW5 A;  2Z99 A;  2CU7 A;  5AIP A;  1KA8 A;  2RQP A;  2DOA A;  1JUP A;  4IEJ A;  1MBJ A;  5L3D A;  5FKL A;  3U21 A;  2W1O A;  5JHU A;  1U6G A;  3DPU A;  3I5U A;  3SXY A;  1XB4 A;  3PFY A;  3CDH A;  3Q0V A;  1H8A C;  1TW2 A;  3TP0 A;  2XGE A;  4H4K C;  3WTS C;  2UXX A;  2ICW G;  2DA3 A;  2V79 A;  4P96 A;  1O3R A;  1MNE A;  2AQF A;  4Z6Y A;  3CO7 C;  4HX8 A;  3DCF A;  4EJT A;  4CGZ A;  5EEG A;  2JA2 A;  1U0J A;  2V1D A;  2EFN A;  4RMN A;  2R7X A;  4W1U A;  1UZC A;  4G6T B;  3FBI B;  4UVA A;  3FK6 A;  4AIH A;  1T95 A;  2M30 A;  4PFP A;  4L5I A;  2MC4 A;  3MQ0 A;  3MN2 A;  2HZD A;  2JMW A;  2HYF A;  4ENN A;  2JTV A;  2VQH A;  4EM0 B;  1YRN A;  4LG0 A;  5CVR A;  1R58 A;  1W7P A;  2LYC A;  1K4S A;  1QQI A;  2GXB A;  4JQF A;  2KKO A;  5GP9 A;  1VQ7 I;  5EZH A;  2MLK A;  4UVB A;  5CVU A;  1OCT C;  2XAU A;  2DU9 A;  1X1P A;  1RIO H;  3F8M A;  2EA4 A;  4BKX A;  2CRG A;  3COA C;  5DCM B;  3ZOB A;  3KEY A;  5ICE A;  1FIA A;  2IS6 A;  4LJZ F;  5FRO A;  2CQX A;  4B48 A;  2WB1 N;  2QSH X;  2JZY A;  2JUC A;  2CV2 A;  3OYC A;  3CZ6 A;  3OY9 A;  2DDB A;  3RPU A;  2Q8K A;  2PJR A;  4HF1 A;  4AWX B;  2RC4 A;  2EIM H;  5EGO A;  3GTG J;  3KZY A;  4CH7 A;  3BRO A;  4AYB A;  2ELK A;  5J3L A;  2Z33 A;  2DMQ A;  1N78 A;  2AXT C;  1W1W E;  1XD7 A;  1D5Y A;  3BLY A;  2VKV A;  3BG7 A;  3F8N A;  4JOM A;  1FOX A;  2DK8 A;  1X2N A;  3CD6 I;  1HDD C;  5E3N A;  4KMF A;  5DD8 A;  2JT1 A;  3PUF A;  2CYY A;  3AG2 H;  1ZG3 A;  3TW6 A;  4EV0 A;  3MZH A;  2EBI A;  4JX5 A;  3MZ8 A;  4CZC A;  4UHT A;  3Q3S A;  2A61 A;  2VOP A;  3D5R C;  3JTG A;  1R00 A;  2W00 A;  2KFD A;  4IRI A;  1SD6 A;  4EM2 A;  1MJB A;  4MEX F;  3ZPL A;  3ZMZ A;  1HC8 A;  3ZXS A;  4L18 B;  3EUH C;  3F72 A;  1SFX A;  1LVA A;  4BH9 A;  1BJA A;  2KIU A;  4D0P A;  2DT6 A;  1SFU A;  4MGR A;  2HYG D;  3A02 A;  1Z6T A;  2L7Z A;  3I59 B;  3TBI A;  2VLA A;  1WHU A;  4MFE A;  3FXM A;  4BHB A;  1U5T B;  5JR3 A;  2V9P A;  3ERE D;  1Z9C A;  3TL4 X;  5HS9 A;  5JHF A;  4BDY A;  5HOO A;  3VWB A;  5D8L B;  4KN4 X;  3J80 Z;  1S7E A;  4IPA A;  3G2B A;  4PCQ A;  1ZGA A;  3H9Q A;  1B4A A;  1OIS A;  1LQ1 A;  3RTR A;  2ELH A;  2KT0 A;  2X1D A;  2ADU A;  3GXO A;  5DCF A;  1VQ5 I;  2WV1 A;  1FBS A;  4IRG A;  3K70 C;  1RC9 A;  4XM3 A;  2LRD A;  4GXO A;  5AON A;  2CWE A;  1U5T C;  3U1K A;  1U8R A;  3S17 J;  5DS9 A;  1RES A;  1FTT A;  5GTH C;  2ZXW H;  1MMA A;  4A0Y A;  2P81 A;  4DNC A;  3ML6 A;  1X3Z B;  2ZXJ A;  2W82 A;  2ZNY A;  2HOS A;  2ZFU A;  2TCT A;  3SDG A;  3QRF F;  5J47 A;  1VQ8 I;  4FE7 A;  3PNV A;  3W6K B;  2R7T A;  4P9F A;  4WXC A;  1TZL A;  2IJL A;  2JPC A;  5GAG J;  3OL3 A;  5ICF A;  1RET A;  2LLK A;  4X6A J;  1I50 J;  2E60 A;  1OCO H;  3A0H C;  1MH4 A;  4L9T A;  3OYN A;  3V7C A;  3G1O A;  1L0O C;  2CW7 A;  1DP7 P;  3GTJ J;  2BW3 B;  3BT9 A;  3HRU A;  5BOX A;  3ZGK A;  1T39 A;  2JRM A;  1IRG A;  2F6C A;  1I6H J;  3F8B A;  1ETO A;  4B47 A;  1O57 A;  1B1B A;  2VXZ A;  4BY1 J;  4A6E A;  3GTK J;  2VAS A;  2CW0 F;  1W5C C;  4PJN A;  5EJC A;  3ASO H;  2QEN A;  2HOT A;  2HXO A;  1BOB A;  1Q1V A;  1A36 A;  3TW7 A;  2DK5 A;  2FBK A;  5L3E A;  4RM3 A;  3OMY A;  4HEA 2;  2E2H J;  1XPX A;  1Y1V J;  1LDK B;  2ZC2 A;  3GWZ A;  2RN7 A;  5E8I A;  4LD5 A;  2P7C B;  3A01 A;  4GCV A;  2ME0 A;  2M9H A;  1ULY A;  2J5P A;  2A3S A;  1LVK A;  3H92 A;  1YJ9 I;  1KQ9 A;  5BPI A;  5D8K B;  2P6S A;  1J75 A;  2YU9 J;  4IZZ A;  4DW6 A;  5CKT A;  4E7K A;  2CSO A;  3LSR A;  4MO7 A;  1RZ4 A;  3RDI A;  1POG A;  3VYT B;  5DUI A;  2O6G E;  3B6C A;  2IGN A;  1BW5 A;  1MBK A;  1QPI A;  2DT5 A;  2LDU A;  1KYZ A;  2GAU A;  1T0F C;  1XGN A;  2VBX A;  4OIR F;  1VQL I;  4R8H A;  1I3Q J;  1TL8 A;  3TGN A;  4OMZ A;  1XGO A;  2OBP A;  4RS8 A;  4R79 A;  1O7L A;  1MD0 A;  2GZW A;  2VBW A;  2XPV A;  1Y39 A;  2ZSI B;  2DPU A;  5HLH A;  2RKH A;  1U9N A;  2NVY J;  4XLP F;  1H0M A;  2VOD A;  1SEU A;  2H1L A;  1R36 A;  3E6D A;  3WTW C;  2CUZ A;  2GLO A;  2L7F P;  1LEB A;  1YYV A;  2M8E A;  3M9A A;  4RAF A;  1DP3 A;  2MBF A;  1Y1W J;  1Z7U A;  1VQP I;  1BR2 A;  1BC8 C;  2JQ7 A;  3QOE A;  1XSV A;  2KRF A;  4M72 A;  2XKP A;  5D4S A;  4E7L A;  3H1C A;  1H9T A;  4GYG A;  1UJ8 A;  4XRF A;  1BI0 A;  1HCR A;  1ODD A;  2NS7 A;  3LFU A;  1BBY A;  2K9L A;  1OMI A;  2YX4 A;  3LSJ A;  3P9I A;  5GAH J;  3K9T A;  2V4J C;  1PUF B;  1UHW A;  3EET A;  2DMN A;  2O5R A;  3K4C A;  4YRV A;  3PIO F;  2IXS A;  2Z1D A;  1FPQ A;  3TKY A;  4HQE A;  2WV0 A;  3QYF A;  2LF8 A;  2W7N A;  2X51 A;  2JA7 J;  1U78 A;  1WKM A;  3ZRG A;  1BL0 A;  3TOA A;  4E7J A;  1HLV A;  2RVC A;  2LP0 A;  3HOY J;  1WQ2 A;  1N75 A;  4P9U A;  1LFP A;  3ZMS A;  4CO8 A;  4D7N A;  4XKB A;  2ACJ A;  1KQ0 A;  2OV7 A;  4KN7 X;  4C3J J;  1RR7 A;  1X58 A;  1E2X A;  1K7A A;  4HF2 A;  3C2G A;  9ANT A;  3WHC A;  3AG1 H;  4BHP A;  3EYI A;  2VBZ A;  4BYY A;  1P4W A;  4RB0 A;  2W24 A;  4FCY A;  5BNG A;  4E70 A;  2XAH A;  1DPR A;  4J19 A;  4QWQ A;  1SFO J;  1UEL B;  1UG0 A;  4LB6 B;  2V1N A;  2A6E F;  4PJM A;  4TV7 A;  3FHZ A;  4I7H A;  1I27 A;  1R1V A;  3KIO A;  2EV6 A;  1G6N A;  4ANJ A;  3JSP A;  2ECC A;  1K78 B;  2HQR A;  4QTR A;  2HXI A;  5J1U A;  2E19 A;  2TDX A;  3F23 A;  4D1Q A;  3DKW A;  4IF4 A;  4M3F A;  4X0G A;  3G3Z A;  3L2R A;  4EQQ A;  4RB1 A;  2D45 A;  1YFH A;  1Z1D A;  2BHZ A;  2XAF A;  3LSM A;  4NQW B;  1IXR C;  3RZD J;  3ECH A;  4UUS B;  1CF7 B;  3H0D A;  1F1Z A;  2R5Y B;  3HOU J;  4ZYH A;  3HOV J;  3GFM A;  1WJA A;  3PQK A;  4ZDP A;  2FXA A;  1FTZ A;  2M4K A;  2FRH A;  4HZF A;  1QHH D;  1E3P A;  2HU9 A;  3IP4 B;  5ED4 A;  1Z6R A;  3RPQ A;  4XIC A;  3CCL I;  1LE8 B;  3DPL C;  3MCZ A;  4A12 A;  3ZQC A;  1V5G A;  2QQ9 A;  2QBY B;  4G8X A;  2HR3 A;  3OYH A;  3DTE A;  4HV6 A;  4NHJ A;  2VJ4 A;  2WBM A;  1J09 A;  1SVO A;  3QU3 A;  3CME I;  1GXQ A;  4XKC A;  1ETV A;  2MH2 A;  4MHG A;  3OV8 A;  3FXO A;  4Q5S F;  4M73 A;  4O5V A;  3KEQ A;  2BVL A;  5DM7 F;  2M1B A;  4BE0 A;  3WTZ A;  2G0E A;  5B66 C;  2HWV A;  1W5T A;  3M1C A;  1QNT A;  2ZXI A;  4RBO A;  2F5C A;  3O2P E;  2JPB A;  3BJO A;  5IT9 K;  3VB2 A;  1SAX A;  2CS3 A;  2DJI A;  5C3E J;  1TP4 A;  2GIZ A;  2LBF A;  1IW7 F;  1B8I B;  1FT9 A;  1EV7 A;  4LIV A;  1WJC A;  3AL0 C;  2VN2 A;  4N4O B;  3S15 J;  1B9N A;  3A03 A;  4XN3 A;  1RKW A;  5LEK A;  4A6D A;  5LGT A;  3CUQ A;  1ENH A;  2HOE A;  2MGQ A;  2OZ6 A;  1RPW A;  2I10 A;  3V8K A;  2Y48 A;  4WX9 A;  4M6X A;  5KK1 A;  1EH8 A;  4E4H A;  3DWL E;  2HVQ A;  4KUM A;  1HQC A;  2M45 A;  2V7F A;  3DXJ F;  4KIG A;  1WJF A;  2KRC A;  5TIS C;  2IPQ X;  2I5U A;  5HNH A;  5HDK A;  3HHG A;  2BE5 F;  3ZMD A;  4EAT A;  3TDZ C;  3ABU A;  3BJA A;  2XC7 A;  3H3V K;  4OOI A;  3ONQ A;  4A0Z A;  1Z21 A;  5DEQ A;  5EZG A;  3IH2 A;  4OU0 A;  3NAU A;  4DZP A;  1FWZ A;  3IHU A;  3OYI A;  3BCA A;  2R5Z A;  3FX3 A;  1B72 B;  2E1C A;  4D9J A;  4EJW A;  3CTA A;  2Y0S N;  4XSZ F;  4MTE A;  3OYM A;  5F0F A;  2KDO A;  1FYL A;  4AM3 A;  5F04 A;  4YFX F;  1QZZ A;  3BR0 A;  1YW9 A;  1ZTR A;  2ZME A;  3RKY A;  1CQT A;  1MBG A;  1GXP A;  3S93 A;  2BY3 A;  2LMD A;  2W48 A;  4GRI A;  1VF9 A;  2Y30 A;  3JAM Z;  1D8J A;  1V55 H;  3HB9 A;  4M9S A;  4V2F A;  1GVD A;  3D0S A;  2PI0 A;  4S04 A;  2P4W A;  3R60 A;  3I4N J;  1GV2 A;  2X0L A;  4QPO A;  4ZC3 A;  3FMQ A;  3AAF A;  5IYD J;  2KPM A;  3GUD A;  4CCJ A;  3UR3 C;  3KET A;  4YEJ A;  4AIK A;  2BV6 A;  2YPR A;  1IRZ A;  1KU9 A;  4OMY A;  4NC7 A;  1TW3 A;  2G7U A;  4OAY A;  3FHN A;  3KCC A;  1WH5 A;  2EZK A;  5HS8 A;  2VKD A;  2MYS A;  1QHG A;  1R1U A;  1YJW I;  4IHT A;  4B1R A;  5IYB J;  1XGM A;  1SAU A;  3ZQH A;  2XB0 X;  4MQ9 F;  5AIQ A;  1FOK A;  4DYQ A;  3S1M J;  3I58 A;  1PDN C;  3G6E I;  1P4X A;  3IKT A;  3CJT B;  1U8B A;  5IOY A;  2X6X A;  2JVG A;  5H6Q A;  1JUS A;  2FU4 A;  4PUS A;  2FX0 A;  1LFB A;  5E20 A;  3E5Q A;  1WRJ A;  4XRS G;  2L4A A;  2OCE A;  1ON2 A;  3J7Y J;  2XDV A;  5H2F C;  3QP6 A;  2R7V A;  1WSU A;  4A3B J;  4HNV A;  2ZJR F;  3PIP F;  2IRF G;  4U87 A;  4M71 A;  3QQA A;  3VOE A;  1FIP A;  2CQQ A;  3KE2 A;  2Q2E A;  2V6C A;  4F93 B;  1VI0 A;  2VPR A;  1SMT A;  4E6K G;  2DOE A;  3IRQ A;  3VEP A;  2DCE A;  1I5Z A;  4HNU A;  4XNF A;  2EZH A;  1ACI A;  1TT0 A;  2CQN A;  1F43 A;  2K4J A;  4HV5 A;  1IRF A;  3MKL A;  2VON A;  3JRA A;  1MDM B;  4FET A;  4C9Y A;  5F1R A;  3SEZ A;  2QQB A;  3BWG A;  2COM A;  3ISP A;  2EIL H;  2GQQ A;  4I76 A;  2QWW A;  2KL4 A;  5FKK A;  3UNG C;  4KIF A;  4BUP A;  1YQA A;  4HLX A;  1K6O A;  2FBI A;  1ITY A;  5K1Y A;  5KCM A;  5DM6 F;  3HOT A;  3WG7 H;  1E3O C;  2PMU A;  1MW7 A;  3C2H A;  1ZRF A;  2DPD A;  2XGD A;  3HL2 A;  3I53 A;  3ZQQ A;  1W0U A;  4HDV A;  3JR9 A;  2K4B A;  2M4G A;  2NYX A;  1HKQ A;  5EF6 A;  4BJ5 C;  5A2Q Z;  1BI1 A;  1D0Y A;  2OTJ I;  3AKZ A;  1SMY F;  3FIW A;  2HQA A;  3HEF A;  2A68 F;  5E79 C;  5FKN A;  4CYD A;  5FGM A;  4CCM A;  5FFZ A;  1PYV A;  2PG4 A;  4RA2 A;  1FEX A;  4CSW A;  3BG5 A;  1Y8Q B;  5DCM A;  2MH9 A;  1J0R A;  5H6R A;  4L0Z B;  1YHQ I;  1EKE A;  1OR7 C;  2BVM A;  2ZB9 A;  2Y9Y A;  3M1E A;  3ZN0 A;  1O3T A;  2GIV A;  1XDS A;  4A3E J;  2M8G X;  4C30 A;  3CJR B;  2AQE A;  2A6T A;  2H6C A;  3FBN B;  2H8R A;  3J7A Y;  4V2G A;  1GVJ A;  5CQG A;  1CGP A;  5CVI A;  3NEU A;  3HTU A;  2PJP A;  1USS A;  2EFO A;  5J8F A;  3SHF A;  2P0W A;  2QSG X;  3F22 A;  3EDP A;  2PX9 A;  5IY5 H;  3C1D A;  2GXG A;  2HPM A;  1REP C;  3MFK A;  5IYC J;  4M3G A;  3FXR A;  3EUH A;  3EYY A;  4UXN A;  1DU0 A;  4A3M J;  1I1S A;  3JW4 A;  3OR1 C;  1G4D A;  2VT3 A;  1M1E B;  4NDL A;  5DD4 A;  4N9I A;  5ILV A;  2DMT A;  4BAC A;  2JSC A;  4HYE A;  1VFC A;  1T33 A;  3S1Q J;  1FNN A;  3SDB A;  4AYB N;  3P9K A;  2NVU B;  3ZQG A;  2LFB A;  1ETX A;  1JTX A;  1L3L A;  1SFE A;  1D1B A;  1KON A;  1ONV A;  1XMK A;  4R1H A;  5K5Q A;  2YSR A;  4YIF A;  1SC7 A;  2O03 A;  1ZYR F;  2E71 A;  3HSE A;  1DGR M;  2LR8 A;  3OL4 A;  1U5T A;  2HI3 A;  1R22 A;  3OWT A;  1ZLJ A;  1MGT A;  4LK1 F;  1U2W A;  4CCN A;  5CPR B;  2DAO A;  4I99 C;  1MJ9 A;  3CUO A;  4A3G J;  2IA2 A;  4H0E A;  3CP2 A;  2XAJ A;  2ECB A;  2K85 A;  3BJ6 A;  3E1S A;  3QYE A;  4M9Z A;  4DOZ A;  2BYV E;  3NRV A;  1H9G A;  2Z5U A;  3IUO A;  1FOW A;  5IP9 J;  3M8J A;  4MNU A;  2WTE A;  2Y2Z A;  5CJ9 A;  1KU7 A;  3A1Y A;  2FA5 A;  1E3H A;  2Z2S B;  4FAS D;  4MTD A;  4M74 A;  1MMG A;  1R5I D;  2F5V A;  5F27 A;  5BMZ A;  2L9N A;  3EPZ A;  4EVI A;  2DT7 B;  2PMZ A;  3CES A;  4GO1 A;  3E6B A;  1BW6 A;  3WE3 A;  1Z0X A;  3D5L A;  2FUG 2;  3RJP A;  2BXZ A;  2L02 A;  3E0J B;  3CDI A;  2VT2 A;  2CH0 A;  4XOP A;  1Y8R B;  4DBR A;  3DFG A;  2BXY A;  3HSR A;  4XLC A;  3RYP A;  5M5X J;  1VZ0 A;  4I2O A;  3DEU A;  2BY1 A;  2ZSH B;  3IH4 A;  4N4N B;  3ABL H;  3C18 A;  2M34 A;  2E7X A;  3CCY A;  4KDP A;  3DEE A;  2RV8 A;  1VQK I;  4GFB A;  2A69 F;  5GAD J;  3GZ5 A;  1G8X A;  4EGZ A;  1YRN B;  4V19 K;  1JGS A;  4LG0 B;  1EH7 A;  4HOB A;  1XX5 A;  3KZI C;  4U7B A;  4WK8 F;  1YTY A;  2K86 A;  2LH9 A;  3ESW B;  2CO5 A;  3MVP A;  4I0B A;  1BIA A;  1JUM A;  2GA1 A;  4LGW A;  1ZKG A;  1MSF C;  3MKW B;  5JVT A;  2G9W A;  1V3F A;  1O3S A;  2VJI A;  3K70 D;  1BOA A;  2E1N A;  3KLO A;  4Q48 A;  4A3L J;  4A69 C;  2HVS A;  2DLL A;  2UV1 A;  3M07 A;  1F5T A;  4IL6 C;  1S8N A;  4BL0 B;  4II3 A;  2IAI A;  2QVO A;  1R9T J;  4LB5 A;  4G6D A;  1MND A;  2K9M A;  1T0F A;  4U0Y A;  2E1M B;  3K4K A;  3ZMT A;  1STZ A;  3Q0W A;  1IF1 A;  2PJR B;  2R7O A;  3K0L A;  2V9K A;  3CC4 I;  2IW5 A;  2VOO A;  4RAY A;  3J81 Z;  4IX7 A;  2ZKZ A;  1T08 B;  2KJC A;  2RAE A;  3LMM A;  1YLF A;  4XSX F;  2Z16 A;  3I0T A;  3GLL A;  3B6A A;  3L2W A;  2L2O A;  1X4P A;  3HRM A;  2F2E A;  5HDG A;  1P4A A;  4A3K J;  2VXD A;  2DA2 A;  1IO2 A;  5IT3 A;  4IHS A;  2IGM A;  1Y0U A;  2VI6 A;  1ZAO A;  1AWC A;  2OQR A;  5CLS A;  2CUE A;  3REO A;  4ZDL A;  2EZL A;  3TO6 A;  4HNT A;  5D5W B;  2H1K A;  1DPU A;  3QYB A;  4ZTJ A;  3NWS A;  4IHV A;  3HOW J;  3MZY A;  1D1C A;  3VYR B;  3VYS B;  5LHG A;  3S2H J;  3DBR B;  3E5X A;  1Z67 A;  2KIF A;  1BA5 A;  3F8F A;  1T8I A;  1J5Y A;  3CCJ I;  1GLN A;  3HGY A;  3W2W A;  2KIQ A;  5EEA A;  3K1N A;  3I3L A;  2CW8 A;  1V5E A;  3HTS B;  3LQQ A;  3L09 A;  1Z05 A;  1HSJ A;  2EH3 A;  4ITV A;  2FML A;  5F6F A;  3MKY B;  1MMS A;  3B02 A;  4AVP A;  3QPT A;  3RCO A;  1FLI A;  2A05 A;  1TLH B;  4BQO A;  2CV0 A;  3CLQ A;  3HXL A;  3OYD A;  2E2J J;  4F55 A;  4AVZ A;  1Z7L A;  3VSK A;  2Y75 A;  4S05 A;  2VQC A;  1ETY A;  2BGC A;  2D1H A;  3V42 A;  1ERD A;  2DOF A;  3FM3 A;  4AC0 A;  4XON A;  1WJ5 A;  4ESF A;  4KIT B;  4RAZ A;  3R4K A;  1QZE A;  1X2M A;  3TOB A;  3F21 A;  1YOV B;  5FD5 A;  3OOP A;  4KA4 A;  2R92 J;  3WU0 A;  2DTZ A;  3LSG A;  5F64 A;  4BJ6 C;  3H5A A;  4F52 A;  2ELJ A;  2DA6 A;  4PSW A;  4LOC A;  2IT0 A;  4U7D A;  2YS9 A;  4B43 A;  1X1D A;  4JX6 A;  2CUJ A;  1IZ1 A;  1J2X A;  2E36 A;  5CVJ A;  5E18 F;  1YW8 A;  2Z9O A;  4LIT A;  2VE9 A;  1FSE A;  4UV9 A;  2MSY A;  5C4X J;  3GTP J;  2K9N A;  4G9Y A;  3S1N J;  2R7R A;  2B0L A;  1K78 A;  3O8G A;  5J1Y A;  5EYR A;  2P7V B;  3LSK A;  3F3X A;  2CGP A;  3GCM A;  3PO2 J;  3AFH A;  5K5R A;  4DYC A;  3JRE A;  5FRM A;  1XCB A;  1I3A A;  3SFI A;  4NQW A;  5TRD A;  3SZG A;  4F3Q A;  5K5O A;  3T8R A;  4U88 A;  2FD5 A;  2HFH A;  2XHK A;  4C3I J;  4CYC A;  5CYV A;  2R5Y A;  4IKF A;  2K9S A;  5EEH A;  2NAZ A;  3ELK A;  3RQI A;  1R49 A;  1XS9 A;  4NUB A;  3X2Q H;  2EWN A;  3O8H A;  3QWL A;  4EJO A;  2BY2 A;  3DBH B;  2ZXH A;  1F9N A;  2VC0 A;  3IWZ A;  4I01 A;  1RRJ A;  2K5C A;  3CO6 C;  3GTO J;  3K4M A;  5KAF C;  4L5E A;  1LE8 A;  1PVE A;  2LD5 A;  4PZJ A;  5D5X B;  4B44 A;  2OUM A;  3A01 B;  2Q0O A;  2EFW A;  1JXS A;  1IN6 A;  4RGX A;  2YX7 A;  1T98 A;  1Z91 A;  1A5J A;  4KMU X;  1NTC A; 
#chains in the Genus database with same CATH homology
 4WXD A;  2AXL A;  2XKO A;  2VBY A;  5FB2 A;  2YU3 A;  5D5V B;  2HS5 A;  1R5H A;  1FX7 A;  5L3B A;  4CHU A;  2L3D A;  5CVV A;  4LFU A;  4OIQ F;  5FLX K;  2QZ8 A;  4KIC A;  3V8L A;  2J5O A;  3ECO A;  2L01 A;  3GFI A;  3DF8 A;  2D2W A;  4A5M A;  4ON0 A;  1V4R A;  3FF5 A;  3WG9 A;  4YFN F;  2NNN A;  1QBJ A;  1OPC A;  2H27 A;  2PN6 A;  3GFL A;  2F5D A;  2R7F A;  2R7D A;  2EK5 A;  1JHF A;  1HW2 A;  1TQI A;  5ERI A;  3O3K A;  2X4H A;  5BPD A;  3WU1 B;  2W25 A;  1J7K A;  3Q9S A;  2O3F A;  1G3Y A;  5D6E A;  2OQG A;  1E17 A;  1XGS A;  5L3F A;  1W4M A;  5BS6 A;  3M8F A;  4YG2 F;  2XGX A;  4YFK F;  4P55 A;  5H20 A;  1TNT A;  3EQL F;  3WGG A;  5DDG A;  2QUF A;  3J7A O;  2Z3Y A;  3Q9V A;  4ETS A;  1PP7 U;  5E17 F;  2HKX A;  3HUG A;  3SFZ A;  4L9V A;  5D6F A;  3LAJ A;  3BOQ A;  1R1T A;  4KIB A;  1ZG5 A;  3ZMV A;  4OIO F;  1TBX A;  4BAY A;  2HDC A;  2K7L A;  1A04 A;  2M87 A;  2EB7 A;  2FF4 A;  3V7S A;  3KP7 A;  1LDJ A;  2C6Y A;  4F7Z A;  4NB5 A;  4K2E A;  3G73 A;  4PGH A;  4Y17 A;  1BIB A;  5LGU A;  2GWR A;  1IN7 A;  1BN5 A;  1J9I A;  3JTH A;  3L9F A;  2O61 A;  3BZ6 A;  1ZAR A;  4RB2 C;  4LLN A;  1ZRE A;  1ZHF A;  4OIN F;  2MD5 A;  2XAQ A;  1D8K A;  3NQO A;  3T0Y A;  2UXN A;  1MDM A;  2STT A;  1HST A;  4Z2Y A;  1W5S A;  4KT5 C;  3P9C A;  4Y15 A;  3R0A A;  4L0Y B;  2CFX A;  1IAW A;  4HQM A;  1OYW A;  3VOD A;  4ZYE A;  5TJJ A;  2YR2 A;  1OR7 A;  1TQM A;  3LFK A;  4IJA A;  4HX4 A;  1SD5 A;  2P5K A;  2NNY A;  1BM9 A;  3I54 A;  5ILU A;  2FEZ A;  2AS5 F;  1HKT A;  1HBX G;  4JK1 X;  2LNB A;  1FP2 A;  3KP5 A;  3K2Z A;  4N9H A;  2HQN A;  3WGH A;  1UB9 A;  3L00 A;  2KIM A;  4PGG A;  5LRR A;  4LLG F;  3E5U A;  3FM5 A;  3J80 K;  1LNW A;  2WC2 A;  1D5V A;  2W84 A;  1YS6 A;  4O3M A;  5DYM A;  4BXU A;  3FXQ A;  4UVC A;  5HDN A;  2STW A;  5IT9 Z;  3SQN A;  3R6S A;  5LBQ A;  1GHC A;  3FWE A;  3PFI A;  4G94 A;  4UV8 A;  2EJR A;  2EFP A;  4G6Q A;  3H3U A;  2Y0M A;  3M7G A;  3QPH A;  4ESB A;  4HAM A;  3BP8 A;  1T38 A;  3DPT A;  1KQ8 A;  3IC7 A;  3LA7 A;  4EJU A;  1YO5 C;  5JFR A;  1O3Q A;  3QAH A;  5D5U B;  3GLX A;  1ZLK A;  3TDU C;  2QLZ A;  3KP2 A;  2V1X A;  1IN5 A;  3GVA A;  2LF7 A;  2XIG A;  5HLG A;  2K27 A;  3GW2 A;  2EV0 A;  2JRT A;  1DUX C;  4B8X A;  1JE8 A;  3KZZ A;  4ENJ A;  4I0A A;  1ZRD A;  1NHA A;  2RGV A;  2NRA C;  4L9N A;  3TO9 A;  5BQT A;  4AD9 A;  1IXC A;  2PFB A;  2XV4 S;  3E6M A;  3U9G A;  3LAP A;  4IRH A;  2D1V A;  3I59 A;  5LEJ A;  2DI3 A;  2HZT A;  2ZCW A;  3WTY C;  1UST A;  3RKW A;  2BBY A;  3GYH X;  1P6R A;  3LQR A;  1F4K A;  2FNA A;  3W6J B;  1OYY A;  3JSO A;  2BEO A;  2IVM A;  5J6X A;  4LMY A;  1EH6 A;  2K02 A;  5LGN A;  1X3U A;  4YII A;  4IVN A;  4LLL A;  3FMS A;  1ON1 A;  3IWF A;  3L2C A;  3HHH A;  1K79 A;  5FFX A;  3VFZ A;  3E6C C;  2HGC A;  2QQA A;  2OZU A;  1IN8 A;  2M5W A;  4I09 A;  1WI9 A;  1UHM A;  4RGU A;  1JHH A;  3WTT C;  1TNS A;  4B09 A;  2L54 A;  3WTX C;  1TQP A;  3KFW X;  4ZYD A;  4BNC A;  3WE2 A;  3KP6 A;  1FBU A;  2FSW A;  1S7O A;  4A0X A;  4L5J A;  3WTV C;  1W7P B;  2V9V A;  3C3W A;  2P5L C;  2ISZ A;  3ZN1 A;  3P7N A;  3RYR A;  2EA2 A;  5E1W A;  1R5G A;  3BPX A;  1YW7 A;  1W7P D;  4HA8 A;  1R23 A;  2DQL A;  3GZ6 A;  4A2U A;  4N0B A;  4KNY A;  1FZP B;  1FYK A;  3HIF A;  4HDU A;  3F8C A;  4MEY F;  5LHI A;  5KVR A;  1P92 A;  3ULQ B;  1FP1 D;  3ROU A;  1I1G A;  3H3Z A;  3KEO A;  1LB2 A;  5LRS A;  4GGG A;  4RGS A;  4RGR A;  2H6B A;  2FNP A;  3ZMU A;  1MZB A;  1S29 A;  2L4M A;  2DFI A;  2FOK A;  4GYI A;  2MLG A;  3R61 A;  2HTS A;  2W57 A;  1ZH5 A;  1I6X A;  5L3C A;  3FXU A;  3GO5 A;  2A6H F;  1QO0 D;  2ESH A;  1WWX A;  1RUN A;  3IL2 A;  2W85 A;  1UCR A;  2ISY A;  4DQ2 A;  4ENM A;  4XLN F;  3TO7 A;  2OAZ A;  4EJV A;  2DQR A;  3CJN A;  3BY6 A;  1ZGJ A;  1FBQ A;  4RB3 C;  5ILS A;  4HW0 A;  4OIP F;  3CLO A;  2XAS A;  3I64 A;  1FYM A;  3U1D A;  1UFM A;  2XUB A;  2P6T A;  5J8C A;  1LEA A;  2DO7 A;  5DV5 A;  3GX4 X;  4I02 A;  4IXA A;  2P8T A;  3LA2 A;  3QU6 A;  4M9X A;  5ICC A;  4L9J A;  1RNL A;  4I98 B;  3QP5 A;  1HW1 A;  3DV8 A;  4CIC A;  1ZG1 A;  3E97 A;  3I71 A;  1XSD A;  2FMY A;  4U0W A;  3T5X A;  5E1X A;  4P5O A;  1FC3 A;  1AOY A;  3R0J A;  3MWM A;  3O6B B;  1S7A A;  1CF7 A;  5E1Z B;  1PUE E;  3K1P A;  3JAM K;  3SZP A;  1C0W A;  2DTR A;  2FQ3 A;  4PDK A;  4LK0 F;  5E8G A;  1PP8 F;  3M8E A;  4HLY A;  3K69 A;  3IKV A;  2QBY A;  4U0V A;  4FT8 A;  2ZO4 A;  5HLI A;  1T6S A;  4QLC U;  2MA3 A;  4ZH4 F;  2NS0 A;  1BI2 A;  3TQN A;  4Q47 A;  2CQK A;  1P2F A;  2ZNZ A;  1TTY A;  4CXF A;  3LWF A;  4Y13 A;  1XDU A;  1J59 A;  1Q1H A;  2ZFW A;  2PEX A;  2OD5 A;  3V7R A;  3HYI A;  3V8J A;  1OKR A;  2IA1 A;  4ZYG A;  2HEO A;  1S6L A;  2A5Y B;  2MC3 A;  2EFQ A;  4JBA A;  4HF0 A;  3K1M A;  1T2K A;  4CDG A;  2QM3 A;  1HKS A;  2F5E A;  4G7O F;  5FO5 A;  1FY7 A;  3KLN A;  3F6O A;  2O8X A;  1XCV A;  3FMR A;  1DDN A;  2H94 A;  4UNO A;  3ZP5 A;  3GF2 A;  3L7W A;  2FE3 A;  1U3E M;  1QPM A;  2G7H A;  3RI4 A;  2HTJ A;  2E7W A;  1QZY A;  3FZV A;  2V1U A;  3LST A;  2DBB A;  1D3Y A;  1OYI A;  1KU3 A;  1BI3 A;  3GEZ A;  1RUO A;  1SD7 A;  1XN7 A;  2FBH A;  5A2Q K;  1BC7 C;  4BHC A;  3DP7 A;  5HS7 A;  2LSO A;  4EMS A;  1HXD A;  3QOP A;  3HOS A;  1SD4 A;  3S2W A;  3DQV C;  3HRS A;  4G7H F;  2HKO A;  3T8T A;  5ICG A;  2OA4 A;  1IN4 A;  1FSH A;  3V4G A;  3ABT A;  4O6J A;  3GFJ A;  4EM1 A;  1RI7 A;  1G3S A;  1R7J A;  1IXS B;  4HX7 A;  2XAG A;  4KFC A;  6PAX A;  2DW4 A;  2P5V A;  4ZZL A;  2EV5 A;  3WGI A;  3N4M A;  5L3G A;  4G7Z F;  1B6A A;  3N97 A;  3PQJ A;  4A5N A;  4WXH A;  3WOD F;  1S3J A;  4ESJ A;  2LKP A;  4MQV A;  3BPV A;  3HRT A;  5DUK A;  4FHT A;  2PLY A;  3Q5F A;  1B59 A;  1XMA A;  4ZZD A;  1ZN2 A;  3CUQ B;  2R3S A;  4FX4 A;  2XVC A;  3U2R A;  3KP4 A;  1B9M A;  3F6V A;  4FX0 A;  1YIO A;  1KGS A;  2VC1 A;  2OU2 A;  3CUQ C;  3I4P A;  2QYO A;  4ENK A;  2O0Y A;  2RDP A;  1ZRC A;  4XBF A;  1VTN C;  2VE8 A;  3B73 A;  1XSX A;  1MKM A;  2PMH A;  5D4R A;  4AIJ A;  2WWY A;  2PBI A;  2ESN A;  3RIR A;  4KYW A;  3T1B A;  5FLX Z;  4BQA A;  4WCG A;  2ZBK A;  3MEX A;  3BDD A;  2ZME B;  3IRR A;  4M6Y A;  2CG4 A;  5LHH A;  1QGP A;  2A07 F;  2XRO A;  1O7F A;  2UZK A;  3ZQ7 A;  4UUV A;  3LA3 A;  1G3W A;  5HVQ C;  3WTU C;  1IUY A;  2H09 A;  5JI6 A;  3KP3 A;  5LLQ A;  1YG2 A;  4WWC A;  3HSF A;  2XRN A;  4WF2 A;  4ASN A;  4HBL A;  4EGY A;  3J81 K;  5FD6 A;  2ETH A;  2UWM A;  2IA0 A;  2PQ8 A;  1LJ9 A;  3C7J A;  2ZJ2 A;  3SZT A;  4CZZ A;  1G3T A;  1YS7 A;  2GA2 A;  1KU2 A;  1MJA A;  2F5F A;  2KJB A;  2RNJ A;  3RKX A;  2IP2 A;  3E3V A;  1KYW A;  1LDD A;  3MAJ A;  1HW5 A;  2Z99 A;  5AIP A;  1KA8 A;  2RQP A;  5L3D A;  5JHU A;  1U6G A;  3I5U A;  3SXY A;  1XB4 A;  3CDH A;  1TW2 A;  3WTS C;  2UXX A;  2V79 A;  4P96 A;  1O3R A;  3CO7 C;  4HX8 A;  4EJT A;  4CGZ A;  5EEG A;  2V1D A;  2EFN A;  4UVA A;  4AIH A;  2M30 A;  4L5I A;  3MQ0 A;  2HYF A;  4ENN A;  2JTV A;  4EM0 B;  4LG0 A;  5CVR A;  1R58 A;  1W7P A;  1QQI A;  2GXB A;  4JQF A;  2KKO A;  2MLK A;  4UVB A;  5CVU A;  2DU9 A;  1RIO H;  3F8M A;  2EA4 A;  3COA C;  5DCM B;  5ICE A;  4LJZ F;  2JZY A;  3RPU A;  2Q8K A;  4HF1 A;  4AWX B;  2RC4 A;  3KZY A;  3BRO A;  2Z33 A;  1XD7 A;  3F8N A;  2DK8 A;  4KMF A;  5DD8 A;  2JT1 A;  2CYY A;  1ZG3 A;  4EV0 A;  3MZH A;  4UHT A;  2A61 A;  2VOP A;  3JTG A;  1R00 A;  4IRI A;  1SD6 A;  4EM2 A;  1MJB A;  4MEX F;  3ZPL A;  3ZMZ A;  4L18 B;  3F72 A;  1SFX A;  1LVA A;  4BH9 A;  1BJA A;  2KIU A;  4D0P A;  1SFU A;  4MGR A;  2HYG D;  1Z6T A;  3I59 B;  4BHB A;  1U5T B;  5JR3 A;  3ERE D;  1Z9C A;  5HS9 A;  5HOO A;  5D8L B;  4KN4 X;  3J80 Z;  4IPA A;  4PCQ A;  1ZGA A;  1B4A A;  1LQ1 A;  3RTR A;  2ELH A;  3GXO A;  5DCF A;  2ADU A;  1FBS A;  4IRG A;  4GXO A;  5AON A;  2CWE A;  1U5T C;  1U8R A;  4A0Y A;  4DNC A;  3ML6 A;  2ZXJ A;  2ZNY A;  3QRF F;  3W6K B;  4P9F A;  4WXC A;  2IJL A;  2JPC A;  5ICF A;  4L9T A;  3V7C A;  1L0O C;  1DP7 P;  3HRU A;  5BOX A;  1T39 A;  1IRG A;  3F8B A;  1O57 A;  1B1B A;  2VXZ A;  4A6E A;  2CW0 F;  2QEN A;  2DK5 A;  2FBK A;  5L3E A;  1LDK B;  3GWZ A;  2RN7 A;  5E8I A;  4LD5 A;  2P7C B;  4GCV A;  1ULY A;  2J5P A;  2A3S A;  3H92 A;  1KQ9 A;  5BPI A;  5D8K B;  2P6S A;  1J75 A;  2CSO A;  1RZ4 A;  3RDI A;  2O6G E;  5DUI A;  2DT5 A;  2LDU A;  1KYZ A;  2GAU A;  1XGN A;  2VBX A;  4OIR F;  4R8H A;  3TGN A;  4OMZ A;  1XGO A;  2OBP A;  4RS8 A;  4R79 A;  1O7L A;  1MD0 A;  2GZW A;  2VBW A;  2DPU A;  5HLH A;  2RKH A;  4XLP F;  1H0M A;  2VOD A;  3E6D A;  1R36 A;  3WTW C;  1LEB A;  1YYV A;  2M8E A;  3M9A A;  2MBF A;  1Z7U A;  1BC8 C;  1XSV A;  2KRF A;  4M72 A;  2XKP A;  5D4S A;  1H9T A;  4GYG A;  4XRF A;  1BI0 A;  1ODD A;  1BBY A;  1OMI A;  2YX4 A;  3P9I A;  3K9T A;  1UHW A;  3EET A;  1FPQ A;  3TKY A;  4HQE A;  2WV0 A;  2LF8 A;  1U78 A;  1WKM A;  3TOA A;  2RVC A;  1WQ2 A;  4P9U A;  3ZMS A;  4CO8 A;  2ACJ A;  1KQ0 A;  4KN7 X;  1E2X A;  1K7A A;  4HF2 A;  4BHP A;  3EYI A;  2VBZ A;  4BYY A;  1P4W A;  4RB0 A;  2W24 A;  4E70 A;  2XAH A;  1DPR A;  4QWQ A;  4LB6 B;  2A6E F;  4TV7 A;  3FHZ A;  4I7H A;  1I27 A;  1R1V A;  2EV6 A;  1G6N A;  3JSP A;  1K78 B;  2HQR A;  2TDX A;  3F23 A;  3DKW A;  4IF4 A;  3G3Z A;  4EQQ A;  4RB1 A;  2D45 A;  1YFH A;  1Z1D A;  2XAF A;  1IXR C;  1CF7 B;  3ECH A;  1F1Z A;  4ZYH A;  3GFM A;  3PQK A;  2FXA A;  2FRH A;  4HZF A;  5ED4 A;  1Z6R A;  3RPQ A;  3DPL C;  3MCZ A;  4A12 A;  2QQ9 A;  2QBY B;  4G8X A;  2HR3 A;  4NHJ A;  4HV6 A;  3QU3 A;  1GXQ A;  4MHG A;  2MH2 A;  3OV8 A;  4Q5S F;  4M73 A;  4O5V A;  3KEQ A;  2M1B A;  3WTZ A;  2HWV A;  1W5T A;  1QNT A;  2F5C A;  3O2P E;  2JPB A;  3BJO A;  5IT9 K;  3VB2 A;  1SAX A;  1IW7 F;  1FT9 A;  1EV7 A;  2VN2 A;  1B9N A;  5LEK A;  4A6D A;  5LGT A;  3CUQ A;  2HOE A;  2OZ6 A;  3V8K A;  4WX9 A;  2Y48 A;  4M6X A;  5KK1 A;  1EH8 A;  4KUM A;  1HQC A;  2M45 A;  3DXJ F;  4KIG A;  2IPQ X;  5HDK A;  3HHG A;  2BE5 F;  3ZMD A;  3TDZ C;  3ABU A;  3BJA A;  4OOI A;  4A0Z A;  5DEQ A;  4OU0 A;  1FWZ A;  3IHU A;  3FX3 A;  2E1C A;  4EJW A;  3CTA A;  4XSZ F;  4MTE A;  1FYL A;  4YFX F;  1QZZ A;  1YW9 A;  2ZME A;  3RKY A;  1GXP A;  3JAM Z;  1D8J A;  4M9S A;  3D0S A;  2PI0 A;  4S04 A;  2P4W A;  3R60 A;  2X0L A;  3FMQ A;  3AAF A;  3GUD A;  3KET A;  4AIK A;  2BV6 A;  2YPR A;  1KU9 A;  4OMY A;  1TW3 A;  2G7U A;  3KCC A;  5HS8 A;  1R1U A;  4IHT A;  1XGM A;  4MQ9 F;  5AIQ A;  1FOK A;  3I58 A;  1PDN C;  1P4X A;  3IKT A;  5H6Q A;  2FU4 A;  5E20 A;  3E5Q A;  1WRJ A;  2L4A A;  1ON2 A;  3QP6 A;  1WSU A;  2IRF G;  4M71 A;  3VOE A;  3KE2 A;  2Q2E A;  2V6C A;  1SMT A;  3IRQ A;  3VEP A;  1I5Z A;  2K4J A;  4HV5 A;  1IRF A;  2VON A;  1MDM B;  5F1R A;  2QQB A;  3BWG A;  2COM A;  3ISP A;  2GQQ A;  2QWW A;  4KIF A;  1YQA A;  4HLX A;  1K6O A;  2FBI A;  5K1Y A;  3HOT A;  2PMU A;  2DPD A;  1ZRF A;  3I53 A;  4HDV A;  2K4B A;  2NYX A;  1HKQ A;  5A2Q Z;  1BI1 A;  1SMY F;  2A68 F;  4CYD A;  5FGM A;  5FFZ A;  2PG4 A;  5DCM A;  2MH9 A;  1J0R A;  5H6R A;  4L0Z B;  3ZN0 A;  3M1E A;  1O3T A;  2GIV A;  1XDS A;  2H6C A;  1GVJ A;  1CGP A;  5CVI A;  3NEU A;  3HTU A;  2PJP A;  1USS A;  2EFO A;  5J8F A;  3SHF A;  3F22 A;  3EDP A;  3C1D A;  2GXG A;  1REP C;  3MFK A;  3FXR A;  3EUH A;  3EYY A;  4UXN A;  1I1S A;  3JW4 A;  1G4D A;  2VT3 A;  5DD4 A;  4N9I A;  5ILV A;  2JSC A;  4HYE A;  1FNN A;  3P9K A;  1L3L A;  1SFE A;  1ONV A;  1XMK A;  4R1H A;  5K5Q A;  2YSR A;  4YIF A;  2O03 A;  1ZYR F;  3HSE A;  1U5T A;  1R22 A;  4LK1 F;  1ZLJ A;  1MGT A;  1U2W A;  2DAO A;  1MJ9 A;  3CUO A;  2IA2 A;  4H0E A;  2XAJ A;  3BJ6 A;  4M9Z A;  2BYV E;  3NRV A;  1H9G A;  2Z5U A;  4MNU A;  2WTE A;  5CJ9 A;  1KU7 A;  2FA5 A;  4MTD A;  4M74 A;  5BMZ A;  4EVI A;  4GO1 A;  3E6B A;  3WE3 A;  3D5L A;  3RJP A;  2L02 A;  2VT2 A;  3DFG A;  3HSR A;  3RYP A;  4I2O A;  3DEU A;  3C18 A;  2E7X A;  4KDP A;  2RV8 A;  2A69 F;  3GZ5 A;  4EGZ A;  1JGS A;  4LG0 B;  1EH7 A;  4HOB A;  4U7B A;  4WK8 F;  1YTY A;  2K86 A;  2CO5 A;  4I0B A;  1BIA A;  2GA1 A;  4LGW A;  5JVT A;  2G9W A;  1V3F A;  1O3S A;  1BOA A;  2E1N A;  3KLO A;  4Q48 A;  2DLL A;  1F5T A;  1S8N A;  2QVO A;  4LB5 A;  4G6D A;  1T0F A;  4U0Y A;  3ZMT A;  1STZ A;  1IF1 A;  3K0L A;  2IW5 A;  2VOO A;  4RAY A;  3J81 Z;  2ZKZ A;  2KJC A;  1YLF A;  4XSX F;  3I0T A;  5HDG A;  3HRM A;  2F2E A;  1P4A A;  5IT3 A;  4IHS A;  1Y0U A;  1ZAO A;  1AWC A;  2OQR A;  5CLS A;  3REO A;  5D5W B;  3TO6 A;  1DPU A;  3MZY A;  5LHG A;  3E5X A;  2KIF A;  3F8F A;  1J5Y A;  3K1N A;  3HTS B;  3LQQ A;  3L09 A;  1Z05 A;  1HSJ A;  2FML A;  5F6F A;  3B02 A;  4AVP A;  3QPT A;  1FLI A;  1TLH B;  4S05 A;  2Y75 A;  2BGC A;  2D1H A;  3FM3 A;  4ESF A;  4RAZ A;  3R4K A;  3TOB A;  3F21 A;  5FD5 A;  3OOP A;  4KA4 A;  3WU0 A;  5F64 A;  2IT0 A;  4U7D A;  1IZ1 A;  1J2X A;  5CVJ A;  5E18 F;  2Z9O A;  1YW8 A;  2VE9 A;  1FSE A;  4UV9 A;  4G9Y A;  1K78 A;  2B0L A;  2P7V B;  3F3X A;  2CGP A;  5K5R A;  1XCB A;  4NQW A;  5TRD A;  5K5O A;  3T8R A;  4U88 A;  2HFH A;  2XHK A;  5CYV A;  5EEH A;  2NAZ A;  3ELK A;  2EWN A;  4EJO A;  1F9N A;  2VC0 A;  3IWZ A;  4I01 A;  3CO6 C;  4PZJ A;  5D5X B;  2Q0O A;  2EFW A;  1JXS A;  1IN6 A;  4RGX A;  2YX7 A;  1T98 A;  1Z91 A;  4KMU X;  4Q4Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...