1FSHA

Structural basis of the recognition of the dishevelled dep domain in the wnt signaling pathway
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
EAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISHEVELLED-1
publication title Structural basis of the recognition of the dishevelled DEP domain in the Wnt signaling pathway.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 13
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fshA00
1ZG5A 1XMKA 3E6MA 3WGGA 1P4XA 3MZYA 4UNOA 2FSWA 2Q0OA 1Z9CA 3VOEA 1MDMA 2B0LA 4BH9A 1FY7A 1S7AA 3GFIA 5AIPA 3KFWX 2Q8KA 3CDHA 2ZKZA 1USTA 3MEXA 3VB2A 4P9UA 3SZPA 3RKXA 1HSJA 2HGCA 1CGPA 3L00A 3C3WA 3KP7A 5ERIA 1I27A 2A69F 2MLKA 1IXCA 2F2EA 2W24A 1TBXA 1BM9A 3I0TA 1FX7A 3ECOA 1BN5A 3FMQA 3ML6A 3IKVA 1KU3A 3TGNA 4NHJA 1IN6A 1Z6RA 3BJOA 1QNTA 2XAGA 1KA8A 3G3ZA 2H6CA 3BPXA 4MHGA 1WI9A 1O3QA 3BOQA 2YSRA 4BHPA 5JVTA 4BNCA 4Y13A 2P8TA 3EETA 4RGRA 2P6TA 1UCRA 3E97A 4KIGA 1IRFA 3P9CA 4KA4A 4U7BA 2QLZA 2W57A 2FEZA 3ULQB 2VBYA 1OYIA 4L9JA 2ESNA 1R1TA 2MC3A 4Q5SF 2KKOA 3GX4X 4CHUA 3BY6A 5ICGA 2PMHA 1SFEA 2V1XA 1LDDA 4A6DA 1R1UA 3HRUA 2Y48A 5L3FA 3MWMA 2WC2A 1LQ1A 2PLYA 3FXUA 1MZBA 4A5MA 1T6SA 2RC4A 3V8JA 2JTVA 3M8EA 4HV5A 2XRNA 3QPHA 4EGZA 2RQPA 3FX3A 2LF7A 2DO7A 4OOIA 2K27A 2STTA 1D5VA 4LGWA 3VEPA 2H94A 5LHGA 2MA3A 2ESHA 2K4JA 2JZYA 1OR7A 1MD0A 2FOKA 2HEOA 3WTWC 1FP1D 1R5HA 2ZJ2A 3BROA 1ZYRF 1B9NA 2J5OA 1S8NA 2OZUA 4AIJA 1Z1DA 4U7DA 3GZ5A 3ZQ7A 3CUQC 2HWVA 5D4RA 3U9GA 4HA8A 1CF7A 5FO5A 3I53A 3R4KA 2HTSA 1ZGJA 2K7LA 2O03A 2RKHA 4KDPA 3HSRA 3ZMUA 4Q47A 4RAZA 5HLGA 5FD5A 1R7JA 2IT0A 4P96A 5HS7A 5K5OA 3GYHX 2D2WA 2MD5A 1IN7A 1Z7UA 3V4GA 5ILUA 4KN4X 5K5QA 1TQIA 1YW9A 1YFHA 3DXJF 3ZPLA 5ICCA 2XKOA 3FMSA 1W5TA 3IRRA 1MKMA 3F22A 4G6DA 2V1UA 1QQIA 1IXRC 5CVUA 3WTSC 2OAZA 2R7FA 4RS8A 3HTUA 2P5VA 5FGMA 3EYYA 3NRVA 4XSXF 2K86A 4FX0A 1BIAA 5KVRA 3DEUA 1R22A 3R6SA 2FRHA 2NRAC 5DDGA 3BWGA 4N9HA 1YQAA 3VODA 4I2OA 1HXDA 3L7WA 2HKXA 2YX7A 1ZLJA 2RDPA 3BDDA 1E2XA 1HW1A 3F8CA 3HIFA 5L3CA 1GXQA 2VOPA 4EJTA 2GQQA 3EYIA 5LRRA 3RIRA 5FFZA 2NNNA 3QU3A 1F1ZA 3HRMA 2QQ9A 5HLIA 3IKTA 2AXLA 3GWZA 4I02A 1PP8F 5HDGA 2VBWA 4M72A 3CJNA 4G9YA 1H9GA 1S3JA 1FYMA 4L5IA 1B4AA 2A07F 4OINF 3JAMZ 4XBFA 1J2XA 3GFMA 1IN5A 1G3SA 3F72A 4IRHA 1W4MA 3WGIA 2XUBA 2GA2A 2PI0A 1FYKA 4HLXA 3C1DA 1J9IA 5L3GA 5D8LB 4EGYA 2D45A 3HOSA 3WTYC 4I0BA 4BHCA 1TQPA 1F9NA 1LEBA 5DUIA 3PFIA 1IAWA 3J7AO 4YIIA 5D5UB 1DPRA 4NQWA 3QPTA 1UFMA 1YW8A 4ZZLA 2VXZA 4ZYGA 5TRDA 2V6CA 4YIFA 1BOAA 2OBPA 2FBKA 2IP2A 4Y17A 1XGOA 3IC7A 1KU7A 2DK5A 3BZ6A 5DEQA 4LK1F 3WTUC 2OU2A 1ON2A 4MGRA 3FHZA 4LG0B 4MNUA 4IVNA 3Q5FA 2HQRA 1K78B 3KEQA 3NEUA 2Z33A 4LD5A 4LLGF 3SZTA 5LRSA 1DPUA 3ABTA 4ZYEA 3GZ6A 5D4SA 2QWWA 4BAYA 1LVAA 2G9WA 2HTJA 4OMZA 3F8BA 3FM5A 1DDNA 3FZVA 2CG4A 4OU0A 1GHCA 3B02A 2HYGD 5F64A 3GLXA 1JGSA 2EA4A 3GUDA 3I64A 2XVCA 3FXQA 1FOKA 1XN7A 3QOPA 1XDUA 2JPCA 2ELHA 4AWXB 5CVRA 1U5TB 1IRGA 4EQQA 1V3FA 1HW2A 4H0EA 5DCFA 2KJCA 3PQKA 5EEHA 2DI3A 2MH9A 1RUOA 1SMYF 1S29A 2FXAA 1U6GA 2EV0A 2ZCWA 3R0AA 3I59B 2DAOA 1TW2A 1BC7C 2DPUA 2DT5A 5FFXA 4I7HA 1ZG3A 2E7XA 5HDKA 3BJ6A 3FF5A 5LGTA 3ISPA 3C7JA 3V8LA 4ZH4F 2PQ8A 3LFKA 1G4DA 3ZN1A 3E6DA 2DW4A 5BOXA 4HF2A 4R1HA 1W5SA 1G3WA 2EA2A 2YX4A 1WSUA 1X3UA 2ZBKA 1YS6A 2Z3YA 3TO9A 2QUFA 4WCGA 3K1NA 3P7NA 2X4HA 3O2PE 2KIFA 2JT1A 4D0PA 3I5UA 3TOAA 4IXAA 1B9MA 3D5LA 3F8FA 1T98A 2E1NA 1D3YA 4S04A 3QP5A 4EM1A 1KQ0A 1U3EM 3K9TA 4GO1A 3B73A 3KZYA 4HX8A 4L0ZB 2BBYA 4HQEA 4OIRF 2XKPA 4PCQA 1FSHA 1EH8A 4G8XA 4I01A 2IRFG 4IPAA 3E5QA 5DD4A 1ZAOA 1J5YA 1SD6A 4WX9A 5D6EA 2W85A 2ETHA 3O6BB 2UZKA 2LF8A 4OIQF 5LLQA 2H6BA 4R79A 2DPDA 1LDJA 2EB7A 5BQTA 2VONA 1XGNA 4Z2YA 1PUEE 1U2WA 2LKPA 4OIPF 5CLSA 1ZARA 4S05A 4O5VA 2L4AA 2F5FA 5ICEA 4JK1X 5BMZA 5J8FA 5DCMA 5LGUA 2VE9A 5DYMA 1HKSA 4ETSA 4ASNA 5ICFA 3TDUC 1J75A 2AS5F 4U0WA 1WWXA 2E1CA 2STWA 3ABUA 1H0MA 1U8RA 2A5YB 4KYWA 1FNNA 3TQNA 2IJLA 3LWFA 3T8RA 2CWEA 1O7LA 4UVBA 2D1HA 3FWEA 1BC8C 2PMUA 2BEOA 1XCVA 2ZMEB 2PEXA 3F8NA 1LJ9A 1ZN2A 1B1BA 4HYEA 1HKTA 1LNWA 1O3TA 4A0ZA 4PZJA 2JPBA 2XAQA 5K1YA 1NHAA 1YLFA 4RGSA 1W7PA 3DKWA 1BIBA 2WV0A 1XD7A 4EJVA 4BHBA 2P5LC 1TQMA 2OD5A 2ACJA 2HYFA 5L3EA 4YFKF 4AVPA 5LHHA 5ED4A 3K1PA 3CUQB 1IUYA 3PQJA 4MTEA 2H09A 4AD9A 1EH6A 5E8IA 2L4MA 5D6FA 2G7UA 4K2EA 4ESFA 4FHTA 4DQ2A 1KGSA 3CTAA 3I58A 3RKWA 2FNPA 4EM0B 1KU2A 2DLLA 3WTZA 1BJAA 5E1WA 4ENMA 3KETA 2VT3A 2OZ6A 2QVOA 5BPIA 1R5GA 1SD5A 1XMAA 2O6GE 4LLLA 4ESBA 5D5WB 4KT5C 3KE2A 5HLHA 2UXNA 3T0YA 5E17F 2QBYB 3EUHA 1FWZA 5DV5A 3ZMDA 1JXSA 1YG2A 4RGXA 1UHWA 2L54A 1QPMA 1DP7P 4I0AA 2P7VB 2O0YA 5ILVA 5J6XA 5LEJA 3K0LA 1K79A 2PN6A 2W25A 1HW5A 1EH7A 2R3SA 2WWYA 4LLNA 4U0YA 1GVJA 5HVQC 4WXHA 5AONA 1I5ZA 3I71A 1REPC 5K5RA 3RI4A 2FE3A 2O3FA 2VC1A 1WKMA 2V79A 4KICA 1FBQA 5H6QA 5HS9A 1TNSA 4UUVA 4HX7A 3RYRA 4WXCA 3EDPA 1QGPA 5D8KB 4R8HA 2O61A 2FMYA 1BBYA 5F6FA 4GXOA 3IRQA 3LQQA 1XB4A 3TO6A 5CVJA 2HFHA 1OMIA 2DTRA 1JHHA 2EFNA 4M9XA 2FBIA 4RB3C 1H9TA 1QZZA 1B59A 1VTNC 4MTDA 3DPTA 1OPCA 3HSEA 3ZP5A 2EK5A 4F7ZA 1TW3A 3I54A 2GA1A 2EWNA 1JHFA 1STZA 2PG4A 2KRFA 1R36A 2IA0A 3E5XA 1P4WA 3VFZA 4O6JA 1ZG1A 3COAC 3IWZA 2YPRA 2A61A 4L0YB 2M87A 4CICA 1TLHB 3SHFA 4EMSA 3KLNA 2NS0A 3KCCA 1YO5C 1ZHFA 3QRFF 2MH2A 5CVIA 1D8JA 3V8KA 1MGTA 4Y15A 3JSOA 4HAMA 4XLNF 1ZH5A 3E6BA 4CGZA 2M45A 4XLPF 1B6AA 4G7OF 1KQ8A 3O3KA 2NYXA 3U1DA 3L2CA 1K6OA 3IWFA 3ECHA 3ZMVA 3DF8A 1R58A 1FYLA 2VODA 3LA2A 4LB6B 5JFRA 3HHGA 1J7KA 2GXGA 5HOOA 1J59A 4FX4A 1MDMB 3Q9SA 2XGXA 1RZ4A 3TO7A 1QZYA 3ERED 2VBXA 2L01A 4QWQA 1FZPB 4ON0A 2CFXA 2R7DA 3F6OA 3GEZA 3WTXC 3LSTA 2M1BA 4M9ZA 1S7OA 2MLGA 2OQRA 3ZMZA 1S6LA 1RNLA 2LSOA 2GZWA 5IT3A 4KNYA 1Q1HA 1KQ9A 2IA1A 2YU3A 1AWCA 3T1BA 1KYWA 3RDIA 1O3SA 1YTYA 2RN7A 3E5UA 3KP4A 3F23A 5KK1A 5EEGA 2QYOA 1AOYA 3HSFA 3HOTA 1USSA 2HDCA 4KIBA 2EV5A 4HOBA 1QBJA 1G6NA 4YG2F 3IL2A 3F8MA 5LBQA 1R23A 5A2QK 4GYIA 2ZO4A 5FLXK 4UVCA 1U78A 1RUNA 1YIOA 1Y0UA 4G7HF 3E6CC 2P5KA 1A04A 2DFIA 4LK0F 2YR2A 4M74A 3U2RA 2G7HA 3SXYA 1SMTA 4OIOF 4EV0A 3K2ZA 1L3LA 3ZMTA 3JTHA 5A2QZ 5J8CA 5FLXZ 4HQMA 4DNCA 3Q9VA 3OOPA 1FPQA 4YFXF 2ISZA 3SFZA 3LAJA 4HBLA 2BGCA 3BJAA 2QENA 1Z6TA 1IF1A 3KP5A 2E7WA 1ZLKA 2M30A 3R60A 4AIKA 2RNJA 2NAZA 5JR3A 2CO5A 4L9TA 2V1DA 1FT9A 3QU6A 3G73A 1XDSA 1I1GA 2GIVA 2QQBA 4GGGA 1BI0A 2EFPA 3HHHA 1O7FA 2DK8A 4I09A 4EVIA 2A6EF 3K69A 5L3DA 4NB5A 1W7PD 1FP2A 4BXUA 2VN2A 5JHUA 2QZ8A 2GAUA 4KMFA 1CF7B 4HW0A 4GCVA 3JSPA 1ODDA 4MQ9F 2VE8A 4ENKA 2Y0MA 4E70A 2HR3A 2ISYA 2FNAA 3MAJA 2M8EA 4CYDA 1ULYA 3HTSB 4MQVA 4O3MA 3N4MA 3KP6A 1OYYA 2XHKA 3WE2A 3R61A 4ESJA 3TDZC 2Z9OA 3WODF 3M8FA 1F5TA 3M1EA 3M9AA 2QQAA 1XGMA 3FXRA 4TV7A 5D5VB 5L3BA 2EV6A 4N0BA 4UVAA 4ENJA 2DQLA 3MCZA 2BV6A 4BQAA 3H3ZA 4CDGA 3GXOA 5E1XA 2IW5A 4GYGA 2CGPA 3TKYA 3F6VA 1IW7F 1I6XA 4LG0A 4L5JA 4FT8A 3ELKA 2VOOA 1ZREA 1K78A 3D0SA 1D8KA 1I1SA 2A3SA 3OV8A 2RV8A 5CVVA 3GFLA 4G94A 3MFKA 1ZGAA 4B09A 1G3TA 4MEXF 3WE3A 4EM2A 1IZ1A 4HX4A 4G7ZF 3CO7C 3P9KA 1DUXC 4ENNA 2D1VA 3GO5A 3V7CA 3H92A 4EJWA 4JBAA 2F5EA 4Q4ZF 1R1VA 2XAHA 4RB1A 5F1RA 4BYYA 1XSVA 3L09A 1JE8A 2XV4S 2X0LA 2RVCA 3BPVA 3FMRA 3L9FA 3DP7A 2FU4A 1U5TA 1FLIA 3I4PA 3W6KB 2EFWA 1P92A 2V9VA 4YFNF 4LFUA 4CO8A 1Z91A 1LEAA 2TDXA 4UV8A 4P55A 4ZYDA 3I59A 3MZHA 2F5DA 3RTRA 3GF2A 4HZFA 5FD6A 2PBIA 1K7AA 4A2UA 1ZRFA 3HYIA 4LJZF 2IA2A 3IHUA 4PDKA 2COMA 5LGNA 3F3XA 2PJPA 3QAHA 3V7RA 5H6RA 3JW4A 3LA7A 2GWRA 4A12A 2Z5UA 2QM3A 3FM3A 1L0OC 5E8GA 3KEOA 3WTTC 3WU1B 2Q2EA 4WF2A 4KN7X 1YYVA 2EFQA 4UV9A 4M73A 5DUKA 3J80K 1KU9A 2CW0F 1T39A 4JQFA 1ZRCA 1BI3A 4PGGA 1WQ2A 2P7CB 2C6YA 2HKOA 5BPDA 3N97A 2XROA 4EJOA 4HDVA 2K02A 4IHTA 5HS8A 2JSCA 1SFUA 4RGUA 2Z99A 1HKQA 3GW2A 3CLOA 4A5NA 3J80Z 4ZYHA 1O3RA 5LHIA 3F21A 4IRGA 2EFOA 2ZXJA 3GFJA 1OKRA 2VC0A 4M6XA 4WXDA 4CZZA 2W84A 1IN4A 3M7GA 4HDUA 4N9IA 4I98B 2P4WA 5JI6A 2KIUA 1SAXA 3LAPA 1MJBA 2MBFA 2ZFWA 3LA3A 3RPUA 1T2KA 3WU0A 2XAFA 4CXFA 2UWMA 4XSZF 3RJPA 4L9NA 4RAYA 4L18B 3LQRA 2A6HF 4MEYF 4LMYA 3P9IA 1P4AA 3V7SA 2ZNZA 3DV8A 3E3VA 4A0YA 3BP8A 2PFBA 1F4KA 3DQVC 3KLOA 3JAMK 4OMYA 3ROUA 1PP7U 1EV7A 1BI1A 4A6EA 1V4RA 2ZMEA 2H27A 2BYVE 5TJJA 5HDNA 2XAJA 1P2FA 1FBSA 2L3DA 4WWCA 2P6SA 3HRSA 1GXPA 1RIOH 3MQ0A 4UXNA 3DPLC 3TOBA 2Y75A 4U0VA 2XASA 1OYWA 1KYZA 1ZRDA 3EQLF 2M5WA 1MJ9A 2OA4A 2VBZA 3CUQA 1XCBA 2NNYA 1RI7A 2F5CA 1WRJA 4M9SA 4IJAA 5IT9K 4IHSA 3NQOA 5LEKA 1G3YA 1SD7A 2FMLA 2J5PA 4HF0A 2KJBA 1TNTA 3HUGA 4U88A 2KIMA 3CUOA 2RGVA 3WG9A 1IXSB 5ILSA 6PAXA 2HOEA 3DFGA 4G6QA 3KP3A 3T8TA 2XIGA 4RB2C 1E17A 4KUMA 4M71A 4IRIA 1T38A 3ZMSA 2FF4A 5IT9Z 2QBYA 4ZZDA 4A0XA 2DU9A 3GVAA 2O8XA 3WGHA 1ONVA 2HQNA 1SFXA 5DCMB 2JRTA 3ZN0A 2BE5F 3K1MA 3RYPA 1FBUA 1FC3A 2GXBA 3REOA 4M6YA 3H3UA 2HS5A 3SQNA 4P9FA 2A68F 4HF1A 2DQRA 2UXXA 3C18A 3T5XA 1LDKB 2CQKA 3J81K 4HV6A 4LB5A 5E18F 1IN8A 3JTGA 2K4BA 3W6JB 3KZZA 5AIQA 1ON1A 1FSEA 1MJAA 4XRFA 3QP6A 5E1ZB 2L02A 1YW7A 1HBXG 5CJ9A 5DD8A 3HRTA 1SD4A 3S2WA 1R00A 1C0WA 1W7PB 3J81Z 4EJUA 2LNBA 2CSOA 4AIHA 2FQ3A 1BI2A 3WTVC 2FBHA 4RB0A 1U5TC 3RKYA 2EJRA 5H20A 5D5XB 4P5OA 2ZNYA 1O57A 5CYVA 2ADUA 4KMUX 1TTYA 1T0FA 4QLCU 2VT2A 1UB9A 2CYYA 1PDNC 1XSXA 3AAFA 4PGHA 4UHTA 4B8XA 5BS6A 1XSDA 1UHMA 1LB2A 2WTEA 1Z05A 1XGSA 4WK8F 4L9VA 4HLYA 1HSTA 5FB2A 3RPQA 4KIFA 4IF4A 2IVMA 2IPQX 1P6RA 4KFCA 1YS7A 2HZTA 1QO0D 1HQCA 5E20A 3R0JA 2LDUA 2OQGA 2FA5A 3KP2A 4Q48A 2DBBA 1J0RA 3CO6C
chains in the Genus database with same CATH superfamily
4FE7A 1ZG5A 1XMKA 3E6MA 3FBNB 4W97A 3WGGA 5KNLA 1P4XA 3MZYA 5E3NA 4UNOA 2FSWA 2Q0OA 1ITYA 1Z9CA 3VOEA 3MVPA 1MDMA 2B0LA 4DZJA 4BH9A 2P81A 2MG4A 4OWRB 2GM4A 1FY7A 5E3LA 4GFBA 2B63J 1S7AA 1MBEA 1A6QA 1ACIA 3GFIA 5AIPA 4YIRX 3KFWX 4P1WA 2BHYA 2E5NA 2Q8KA 3CDHA 3OL3A 2ZKZA 4IQ4A 1USTA 1OCPA 1QRYA 4F91B 3CCLI 1ZKGA 3MEXA 3VB2A 4P9UA 3SZPA 1ZR2A 2E5ZA 2XGDA 3RKXA 3KPHA 1TWFJ 1HSJA 2HGCA 1CGPA 3L00A 2YS9A 3C3WA 3KP7A 2MYSA 5ERIA 1I27A 2MABA 5B5EC 2A69F 2MLKA 2DODA 1IXCA 2F2EA 1NG7A 2W24A 2AQFA 1H8AC 1TWAJ 3MKLA 2IS6A 1TBXA 1BM9A 3I0TA 1FX7A 3ECOA 4ZYAA 2VQCA 5GTIC 1BN5A 3FMQA 3ML6A 3IKVA 1KU3A 3F9KA 3TGNA 3W2VA 4NHJA 2R7RA 1UJ8A 2JUGA 3K4NA 1IN6A 2ZC2A 1Z6RA 3BJOA 1QNTA 2WB1A 2XAGA 4HNUA 3S32A 1KA8A 3G3ZA 3OYEA 3AL0C 2H6CA 3BPXA 4MHGA 2KDZA 1WI9A 1D0XA 3PNVA 5EYRA 3A0BC 1O3QA 3BOQA 3ZQQA 2M7BA 2YSRA 3Q0UA 4BHPA 5JVTA 3A2KA 2L7ZA 2E2HJ 4BNCA 4Y13A 2P8TA 3EETA 4RGRA 2P6TA 1UCRA 3C2HA 3I9V2 3BR0A 2HVRA 2HVSA 3E97A 4KIGA 1IRFA 1NTCA 3P9CA 1B72A 3CMEI 2EINH 4KA4A 1OCTC 1O4XA 4U7BA 3CCMI 2QLZA 2CU7A 3FXJA 4NC6A 3K4CA 2W57A 5DTDA 2FEZA 5FLMJ 3ULQB 2JVHA 2VBYA 1OYIA 4L9JA 2ESNA 3O8HA 1AKHB 1R1TA 2MC3A 4Q5SF 3RPUD 1X3WB 2KKOA 2X48A 3OS1A 3GX4X 4CHUA 1U0JA 3BY6A 5ICGA 2PMHA 3L2WA 1SFEA 2V1XA 2P0WA 2JWTA 1LDDA 1TP4A 1TL8A 5KCMA 4A6DA 3OYGA 1R1UA 1MBKA 3HRUA 2Y48A 1VI0A 1IO2A 2R93J 5L3FA 1TC3C 3Q0VA 5EDNA 1MMSA 3MWMA 1Z77A 2WC2A 1LQ1A 2PLYA 1VQLI 2WY8Q 3FXUA 1MZBA 3JRGA 1YI2I 2ZMEC 4A5MA 1T6SA 3TW7A 4JX4A 3S16J 2RC4A 3V8JA 2JTVA 3M8EA 2WADA 4HV5A 2XRNA 1JTXA 3QPHA 5KAFC 1YJWI 4EGZA 1U8BA 2RQPA 1V54H 3FX3A 2LF7A 2DO7A 4OOIA 4U87A 3ZQCA 2K27A 1HDDC 4DBQA 2K9QA 1TWGJ 2STTA 2OCCH 4XLEA 1D5VA 4LGWA 3VEPA 5DM6F 3LNQA 2H94A 5LHGA 2MA3A 1YE9A 2DMQA 1UAAA 1XTAA 2ESHA 4Y52J 2X9DA 4W1UA 2K4JA 2JZYA 1OR7A 2DOFA 2X85A 1MD0A 2FOKA 5B1BH 5GAEJ 2HEOA 3WTWC 1OLTA 3M1CA 1FP1D 1R5HA 3BROA 2ZJ2A 4ZTFA 2I5UA 1ZYRF 1B9NA 2J5OA 3SZGA 2V26A 1V5EA 1S8NA 2OZUA 4AIJA 1Z1DA 4A3GJ 2E1MB 4U7DA 3GZ5A 2NOJB 3ZQ7A 3CUQC 2HWVA 2BXYA 3L2RA 5D4RA 2LTPA 3U9GA 2G0EA 4HA8A 1BR2A 5FO5A 3I53A 1CF7A 3R4KA 2HTSA 1ZGJA 4OAYA 3CC4I 2KPMA 1XG1A 2HPIA 2K7LA 2O03A 2RKHA 4KDPA 5F0CA 3WG7H 3HSRA 4JX5A 2K3FA 4NUBA 1HA8A 3ZMUA 2NS8A 4Q47A 2R7SA 2PMZN 4RAZA 2KZGA 3H9QA 2ELJA 3VSKA 5HLGA 5FD5A 3PSFA 2EIJH 2MGQA 5F1JA 2VUMJ 2E1MC 2EILH 3JRCA 1R7JA 2IT0A 3S2DJ 4P96A 5HS7A 5K5OA 3GYHX 3BR2A 2D2WA 4F93B 2MD5A 1IN7A 1SEUA 2ZSHB 1Z7UA 1MW7A 3FKIJ 3V4GA 2CV1A 2KMUA 3GTGJ 1XC5A 2W7NA 3H5NA 2V7FA 4F3QA 1MSEC 5ILUA 4KN4X 3VDXA 1HLVA 1FEXA 2VQLA 5K5QA 3CMYA 1TQIA 3HOVJ 2VASA 2JN6A 4IHVA 2V9PA 1TT5B 1YW9A 1WH5A 3DXJF 1YFHA 5KAIC 1JUPA 2OC6A 5DS9A 4C3JJ 3ZPLA 5ICCA 2XKOA 3FMSA 2F4IA 1W5TA 2M8GX 2OUMA 3IRRA 2M9HA 1MKMA 3EUKL 3F22A 4G6DA 1K6YA 2V1UA 3L2UA 1QQIA 4A3BJ 3MKZA 1IXRC 5CVUA 4CCKA 3WTSC 2OAZA 9ANTA 2R7FA 4RS8A 3HTUA 1POGA 2P5VA 2R5YB 3EYYA 5FGMA 3NRVA 4XSXF 2K86A 4BE0A 4FX0A 4B48A 1Z3YA 1D1BA 2RAEA 4NBQA 1BIAA 4IX7A 1DU0A 5KVRA 3DEUA 2JA2A 2B7EA 1R22A 1UG0A 3R6SA 2FRHA 3OOUA 1MMDA 2DA4A 2NRAC 2DN0A 5DDGA 3BWGA 4N9HA 1NH3A 1YQAA 2EZKA 1X1DA 3VODA 4I2OA 1HXDA 3L7WA 1U9OA 1Z7LA 2HKXA 2YX7A 1PUFB 1ZLJA 2OF7A 4CYCA 2RDPA 2ZXHA 3HOUJ 3BDDA 1E2XA 1HW1A 1OCCH 3F8CA 3HIFA 3PSIA 2VPRA 5L3CA 1GXQA 4A93J 2VOPA 4D7MA 4EJTA 2GQQA 1M1EB 2DCEA 5GPCA 3EYIA 2VI6A 5LRRA 3RIRA 5FFZA 2NNNA 2XPWA 3QU3A 4FISA 1F1ZA 3HRMA 1SVOA 2CQXA 1P7IA 4A3KJ 2QQ9A 2R5ZB 2IS4A 5HLIA 3CCEI 3IKTA 2OTLI 2AXLA 1CQTA 1MBJA 3GWZA 3BTLA 3LFUA 4I02A 1PP8F 4ZJZA 2DA2A 5GP9A 5HDGA 3G4SI 2VBWA 4M72A 1R6RA 5J3LA 3CJNA 4G9YA 3SFIA 1FOWA 3LSIA 1H9GA 1S3JA 2Z16A 1RR8C 1FYMA 3GTMJ 4L5IA 1B4AA 2A07F 3VSLA 4OINF 3JAMZ 4LG3A 3CC2I 4KITB 4XBFA 1J2XA 3L2QA 5EGOB 2KL4A 5GPAA 3GFMA 5EJCA 1EJ9A 2LYCA 1IN5A 1G3SA 3F72A 3NARA 4IRHA 4JYKA 3A4CA 1QHHD 1W4MA 3WGIA 2XUBA 2GA2A 4FE4A 2PI0A 1FYKA 4HLXA 3C1DA 1IDZA 1JKQC 1J9IA 2DOAA 5L3GA 5D8LB 3D5RC 5J4VA 1IRXA 3TMOA 4S0HB 1T0FC 4KJZA 4I76A 4EGYA 2D45A 3HOSA 2ZB9A 3LSJA 4I0BA 3WTYC 4LOCA 2L7FP 4BHCA 3QPSA 1TQPA 5K7ZA 4JP0A 5JLXA 2VL8A 4F92B 1F9NA 1LEBA 2L5QA 5DUIA 3PFIA 2VQGA 3H5RA 2X6OA 2BY1A 2CUFA 4D1QA 1IAWA 2LVSA 4C2MJ 3J7AO 4YIIA 2WA0A 2LFBA 5D5UB 1EF4A 1DPRA 4NQWA 1JUMA 4B1RA 3QPTA 4BEHB 2ID3A 4V2GA 1UFMA 1YW8A 4ZZLA 2VXZA 4ZYGA 5TRDA 3H9JA 4A3CJ 3G1LA 1ZR4A 4UUSA 3CMAI 1TZLA 2V6CA 1BOAA 2OBPA 4YIFA 2DDAA 1ETXA 2FBKA 2R7WA 2EZHA 2IP2A 4Y17A 1IUFA 3D5SC 5J40A 4BUPA 1ETVA 1XGOA 2K5CA 4CZCA 2DOEA 1EA3A 4II2A 3IC7A 2X1DA 2XC7A 1S5LC 4CCMA 4I99C 1AU7A 1KU7A 2AO9A 2DK5A 3BZ6A 4PFOA 5DEQA 4LK1F 3GTPJ 3WTUC 2OU2A 1GDTA 1ON2A 3FK7A 4MGRA 3ABLH 3FHZA 4LG0B 4MNUA 4IVNA 1BJZA 3U1KA 1JJ8C 1YRNB 2BY3A 3Q5FA 4XKBA 1YIJI 1HC8A 2HQRA 1OJLA 2LY1A 2EH3A 4RAGA 1K78B 2R7XA 3KEQA 3RQ4A 3NEUA 4BBRJ 2W48A 3I56I 2ELKA 4LD5A 4LLGF 2Z33A 1B8IA 3SZTA 5LRSA 1DPUA 1FOXA 3ABTA 3BTCA 3KYLA 2D5VA 4XM3A 3OL4A 4ZYEA 5D4SA 3GZ6A 2EZIA 2QWWA 4BAYA 4QTRA 1LVAA 2G9WA 2QSHX 2HTJA 4OMZA 3F8BA 3FM5A 1DDNA 3FZVA 2CG4A 4OU0A 4C2TA 1GHCA 2Y2ZA 4C3IJ 2OCEA 3B02A 1QVUA 4DZPA 4E7KA 2HYGD 5F64A 4L5EA 4RA2A 3GLXA 1JGSA 4E7LA 2IEKA 2EA4A 3GUDA 1I39A 3K4KA 2VKVA 2Y0SA 3I64A 3A01B 2XVCA 3FXQA 2WY7Q 2BHZA 2ID6A 1FOKA 1XN7A 3QOPA 1WH7A 4BS9A 1XDUA 3BG7A 2JPCA 2ELHA 3HPHA 1NK3P 2XPVA 4AWXB 5CVRA 1U5TB 1IRGA 2DMUA 4EQQA 1TWCJ 1Z21A 1X4OA 1V3FA 1HW2A 2KISA 4H0EA 4A3FJ 4PSWA 5DCFA 2KJCA 3PQKA 5EEHA 2DI3A 3IH4A 2MH9A 1RUOA 2QSFX 1SMYF 5K7FA 1S29A 2FXAA 1U6GA 2EV0A 2ZCWA 1VNDA 3CJRB 4BU2A 3R0AA 3I59B 2DAOA 1TW2A 1BC7C 2DPUA 2KQRA 2DT5A 5FFXA 2X6WA 1LE8B 4I7HA 1T8IA 1ZG3A 2E7XA 5HDKA 1HF0A 3BJ6A 3M07A 3FF5A 5LGTA 1UZCA 5EZHA 3ISPA 4CCOA 3C7JA 3V8LA 5BNGA 2E2JJ 4ZH4F 1DGWY 1Y1VJ 4FASD 2CH0A 4QPOA 2PQ8A 3LFKA 4XK4A 1G4DA 3ZN1A 1FMWA 2WV1A 3E6DA 4QSHA 2DW4A 5BOXA 4HF2A 2HDDA 3CF5F 1RETA 4R1HA 2XPUA 2LBFA 3H1CA 1W5SA 1G3WA 2GOMA 3GTKJ 2L9VA 2EA2A 3VWBA 2YX4A 2X1CA 2IGNA 1WSUA 1X3UA 2A6TA 2ZBKA 2X1EA 1YS6A 2Z3YA 3TO9A 2QUFA 4WCGA 3K1NA 3P7NA 2Q2EB 2X4HA 2E36A 3O2PE 1RKTA 1YHQI 1D1CA 2KIFA 3ZGKA 2K9NA 2JT1A 4D0PA 3KYDB 3I5UA 3TOAA 4PJJA 4IXAA 1B9MA 2HI3A 3D5LA 2XAUA 2H1LA 1T98A 2E35A 3F8FA 5IYCJ 2CQQA 5JLWA 5C4XJ 2DMTA 3HXLA 4MFEA 2E1NA 3KZIC 1BW6A 1D3YA 4S04A 3OY9A 5FRMA 3QP5A 2E71A 1MBGA 2QKLB 3K4BA 4EM1A 1KQ0A 3DTIA 1U3EM 1R9TJ 3K9TA 4GO1A 3B73A 1ZK8A 3KZYA 2IGMA 4HX8A 4L0ZB 2BBYA 4HQEA 4OIRF 2JVGA 3CDIA 1OR7C 2XKPA 1T33A 4PCQA 1FSHA 1EH8A 1WJDA 4G8XA 4HG2A 1A35A 4E7HA 5CKTA 2CJJA 4XKWA 1SAUA 5IP7J 1R5ID 4I01A 3PNTA 3RQIA 2IRFG 4IPAA 3S93A 3E5QA 1WI3A 5DD4A 1ZAOA 1J5YA 4RM3A 1E3OC 2H8RA 1SD6A 4C30A 4WX9A 3GMEA 1VQ9I 3TBIA 5D6EA 2W85A 3DU6A 3OIOA 2ETHA 1T56A 3ZQHA 2HOAA 1UMQA 3O6BB 2UZKA 1ORKA 4M6VA 1QU3A 2LF8A 5CPRB 3OR2C 3SEZA 2VXDA 4OIQF 2N8GA 4DIQA 5LLQA 3AL0B 5EG0A 4OAZA 2H6BA 1V55H 4H4KC 4R79A 2DPDA 1LDJA 2EB7A 1IC8A 3LSRA 5F27A 5BQTA 1TWHJ 3LSHA 4Z6YA 3K70C 2VONA 1XGNA 4Z2YA 1PUEE 4HSTA 1U2WA 2LKPA 3AG4H 3CESA 4OIPF 3Q0WA 5CLSA 1ZARA 3FHNA 3MZ8A 4PJ0C 4S05A 4O5VA 2L4AA 2F5FA 2AHQA 5ICEA 1OFCX 4JK1X 4XORA 5BMZA 1WCMJ 5J8FA 4HNVA 5DCMA 5LGUA 3H0DA 3RCOA 2VE9A 3MN2A 2IAIA 2M34A 2F5VA 5DYMA 3PJRA 1HKSA 4ETSA 4ASNA 2CW8A 5B1AH 1QZEA 5GAHJ 1IGNA 2UV1A 5ICFA 1NG6A 1R4NB 1Z3XA 3IP4B 3TDUC 4ZTJA 1Y8RB 4E7ZA 3IH3A 1J75A 2AS5F 4U0WA 1WWXA 2E1CA 2STWA 4AU7A 3ABUA 3PFYA 4B44A 1H0MA 1YJ9I 2IGKA 1Y1WJ 1U8RA 2A5YB 2BY2A 4KYWA 1FNNA 3TQNA 2HVQA 2IJLA 4ZDPA 3LWFA 2HNHA 4XOPA 3T8RA 2CWEA 2ZXWH 1RESA 2LKSA 2HQAA 1O7LA 4UVBA 4Y4RA 2D1HA 3FWEA 2IGOA 1BC8C 2PMUA 2BEOA 1XCVA 2HYJA 4HNTA 3OSFA 2ZMEB 2PEXA 3F8NA 1LJ9A 1ZN2A 1B1BA 4HYEA 3CCQI 1HKTA 1WZ2A 1LNWA 4F55A 4C2UA 4HPQA 1O3TA 4IEJA 1XPXA 3C2BA 4M3FA 4ZC3A 4A0ZA 3OS2A 2Y9ZA 2R7QA 4XKCA 2B9SA 3AKZA 1SVMA 3BG6A 4PZJA 1JKOC 1RR7A 2JPBA 2BZTA 2XAQA 5K1YA 2M4GA 1SVLA 3IV5A 4D5CA 1NHAA 1YLFA 4RGSA 1W7PA 1J09A 3DKWA 1LUJB 2VKEA 1BIBA 5J1YA 2WV0A 1XD7A 4FQGA 4EJVA 1X1BA 4BHBA 2P5LC 1TQMA 2OD5A 3CCSI 2ACJA 4X1EA 2HYFA 5L3EA 3BG5A 3DEWA 4YFKF 2MSYA 4AVPA 2VIXA 2W4SA 5LHHA 2HPMA 4BJ5C 5ED4A 3K1PA 3CUQB 1GT0C 2LLKA 1WJFA 1IUYA 2FOWA 2HU9A 3PQJA 3IUOA 4MTEA 2H09A 4AD9A 3P5JA 3LSKA 1EH6A 2R4GA 5IYDJ 2DDBA 1WPKA 5E8IA 2WAQN 1SC7A 1LPQA 2L4MA 3HBLA 5D6FA 3H5AA 2G7UA 3ZQIA 2L2OA 4K2EA 1DQUA 3CP8A 4FHTA 4ESFA 2QSGX 2IS2A 3KX2A 4DQ2A 3HUGB 2BW3A 1KGSA 5EZGA 3CTAA 3I58A 4C3HJ 2HQ5A 3RKWA 3J7ZI 2FNPA 1Y0NA 3OYBA 1U9NA 3G1MA 4EM0B 3DWLE 1KU2A 3G71I 2DLLA 2ZJPF 3WTZA 1BJAA 2HOTA 3OYNA 3QQAA 5E1WA 5IP9J 4ENMA 3ABKH 1WJBA 3KETA 1MSFC 2VT3A 3LSGA 2OZ6A 2QVOA 1D0ZA 2HXIA 2NS7A 5BPIA 4CSWA 3IAS2 1R5GA 1SD5A 1XMAA 2O6GE 4LLLA 4ESBA 5D5WB 4ITVA 4KT5C 3KE2A 2LD5A 1BA5A 3CF2A 5HLHA 2UXNA 4BE1A 3SJMA 3T0YA 2YUSA 3JRHA 5E17F 2QBYB 1K61A 3EUHA 1FWZA 5DV5A 3ZMDA 3E7LA 2JQ7A 1W0TA 1JXSA 1IV8A 1YG2A 5CQEA 3BT9A 4RGXA 1UHWA 2L54A 1UHSA 1Z0XA 3HM5A 1QPMA 2L7KA 1DP7P 3FBIB 2CUZA 4I0AA 2P7VB 1IDYA 4ZDLA 2O0YA 5ILVA 5J6XA 3DBRB 5FLVA 5LEJA 3K0LA 1WJEA 4XNFA 4DYCA 2PN6A 1K79A 2W25A 1GVDA 3GZNB 1HW5A 4HRIA 4IHYA 1EH7A 4PUSA 4CUGA 2R3SA 1SFKA 3CC7I 3G6EI 4BY1J 2WWYA 4LLNA 3OYAA 4U0YA 2NVQJ 1VQMI 4PSXA 2LP0A 1GVJA 5HVQC 4WXHA 2XB0X 5AONA 4AYBA 3AFHA 4ANJA 1I5ZA 3I55I 5F0FA 3I71A 1REPC 2XGCA 1MNMC 5K5RA 3RI4A 2FE3A 3DCFA 2O3FA 4G12A 3BZKA 2VC1A 3I3LA 5DM7F 1WKMA 5JVGF 1JT6A 3CZ6A 2V79A 3DTEA 1FBQA 4KICA 5H6QA 2CUEA 4RDUA 3HKZA 1X19A 5HS9A 1DP3A 2NVTJ 1TNSA 4UUVA 2ZXIA 4HX7A 2QQ8A 2JRMA 3H36A 1K4TA 3RYRA 3K4MA 3OYDA 4WXCA 3EDPA 1GLNA 3X2QH 1LKXA 4A3DJ 1QGPA 5D8KB 4XLCA 4R8HA 2O61A 2FMYA 1BBYA 5F6FA 4GXOA 5FKNA 2I8DA 2K9SA 1FIAA 3IRQA 1ETOA 3LQQA 3ZOBA 1XB4A 3TO6A 3BQYA 1WFXA 3S2HJ 4XIDA 3LMMA 3GBGA 3OIPA 1JUSA 2HFHA 5CVJA 1MH3A 1OMIA 2DTRA 2PJRB 1JHHA 2E2IJ 1MMNA 2UUZA 4E4HA 2EFNA 4M9XA 2FBIA 5HNFA 4RB3C 1H9TA 1QZZA 4CCNA 2LKXA 2XF7A 1B59A 3FXKA 1VTNC 4MTDA 2QCOA 3DPTA 2ECBA 1OPCA 4B43A 3HSEA 5IOYA 3ZP5A 2EK5A 3PUFA 2OV7A 3ZQFA 1TW3A 4F7ZA 3I54A 1R71A 1X58A 3OYHA 2CV0A 3QOEA 4N4NB 3DKYA 2VJJA 2GA1A 2EWNA 5FKMA 4GRIA 3BR6A 1ZGWA 4J19A 1AKHA 1JHFA 4IL6C 3WHCA 1STZA 3LSMA 2PG4A 1AA7A 2KRFA 1R36A 2IA0A 1HDPA 3EPZA 2XF6A 3E5XA 1P4WA 4XRSG 3VFZA 4O6JA 1ZG1A 3COAC 3BCBA 3IWZA 2YPRA 2A61A 4L0YB 2M87A 5IOZA 2CQNA 4CICA 4AC0A 1TLHB 4DBRA 2DMNA 3S15J 1E3PA 1JI8A 1ENHA 3SHFA 3S1MJ 5F08A 4EMSA 1R49A 3KLNA 2NS0A 2A5WA 3KCCA 1YO5C 2R92J 3N05A 1BR4A 1ZHFA 3QRFF 2MH2A 5CVIA 4XL9A 1D8JA 3V8KA 1MGTA 2V1NA 4YRVA 4Y15A 3JSOA 4HAMA 4XLNF 1ZH5A 1N25A 3CJQB 3E6BA 3H0GJ 5FKKA 4CGZA 2M45A 4XLPF 1B6AA 5HLTA 4G7OF 1P9QC 3DBLB 1KQ8A 1K83J 3O3KA 2NYXA 3U1DA 3L2CA 1K6OA 3IWFA 3ECHA 4HEA2 1ZQ3P 3ZMVA 2Y9YA 3DF8A 1R58A 3RKQA 1D5YA 1IRZA 1EKEA 1FYLA 1JJ6C 2VODA 2XB5A 3LA2A 4LB6B 5JFRA 2EPFA 2K40A 3HGGA 3HHGA 3BR3A 1J7KA 2DA1A 2WB1N 2GXGA 5HOOA 1J59A 1WJ5A 3BTIA 4FX4A 1MDMB 3Q9SA 3S8PA 2XGXA 1A5JA 1RZ4A 1VQ6I 2AQEA 4NNJA 3TO7A 3ZR8X 1QZYA 3ERED 2VBXA 1MMAA 2L01A 3OMYA 4QWQA 5M3FJ 3GTLJ 1FOYA 3GTJJ 1FZPB 4XR6A 3ZRGA 2HOSA 2F4OB 4ON0A 2CFXA 3UKGA 2R7DA 2QF7A 4X0GA 3F6OA 3GEZA 3WTXC 3LSTA 2M1BA 3OYCA 4M9ZA 1WJCA 2CV2A 2XSJC 5E3OA 3BC8A 3MKYB 1S7OA 4BDZA 2MLGA 2OQRA 4CCLA 1E0EA 4BJ6C 3ZMZA 4BXFA 3RZOJ 1S6LA 2VLAA 1RNLA 1TT0A 2LSOA 2GZWA 4A3EJ 1A31A 5IT3A 1OCZH 1VQ5I 2VJ5A 3OYLA 4KNYA 1Q1HA 2EZLA 1KQ9A 5TISC 3LOCA 2IA1A 1MNDA 3JRAA 2YU3A 1AWCA 3T1BA 4BDYA 5TGTA 1KYWA 3PNYA 2MD0A 3RDIA 1O3SA 1YTYA 2RN7A 3E5UA 1X3ZB 2EIMH 3KP4A 5LFAA 3CP2A 3F23A 5KK1A 5EEGA 2KDOA 2QYOA 2KZVA 2H1KA 5B66C 1AOYA 3HSFA 3HOTA 1USSA 2DT6A 2HDCA 4KIBA 2EV5A 4HOBA 4PK4A 2JA6J 1QBJA 1G6NA 4YG2F 2HZDA 3IL2A 3F8MA 2DTZA 5LBQA 2XSDC 1R23A 5A2QK 4GYIA 1ETYA 2ZO4A 2X6YA 5FLXK 3QYBA 4E7IA 4QPQA 4UVCA 3S17J 1U78A 1N77A 2EIKH 1B72B 1N75A 1RUNA 2FUG2 1YIOA 3TW6A 4CH7A 1Y0UA 4G7HF 3E6CC 1ZELA 1Z67A 5E79C 3BZCA 2R5YA 2P5KA 4B47A 1A04A 2R7VA 2NVXJ 2VQHA 1OCOH 2DFIA 4LK0F 2YR2A 4M74A 2K3PA 3U2RA 3VPRA 2G7HA 1WVRA 3SYTA 4XN3A 3SXYA 3PL8A 1SMTA 2L9RA 1WGXA 2K85A 5FKOA 1MIJA 4OIOF 3NWTA 2Z2SB 4EV0A 3K2ZA 4RBOA 3M3YJ 2QGUA 2LREA 3ZMTA 1L3LA 2DFFA 3JTHA 1VQKI 5A2QZ 5J8CA 5FLXZ 1YX5A 3IAM2 4HQMA 4DNCA 2ICWG 3Q9VA 2M4KA 4ZDOA 5C3EJ 3HOYJ 1FIPA 2JUCA 2Z1DA 3OWTA 3OOPA 4F52A 1FPQA 4YFXF 2ISZA 3SFZA 3WHBA 5IP6A 3VYRB 3KEYA 1BW5A 3LAJA 2MC4A 2BGCA 2DYSH 2QENA 1Z6TA 3BJAA 3FK6A 4HBLA 1IF1A 1IV6A 3QODA 3KP5A 1K4SA 2E7WA 1ZLKA 2M30A 3R60A 2R5ZA 4AIKA 2RNJA 2ZJRF 4XMYA 2NAZA 3S1QJ 3B6CA 3B6AA 3ASOH 2BVLA 2I10A 2CO5A 2V1DA 2BVMA 1FT9A 1X1PA 4L9TA 3TP0A 5JR3A 3S3OA 3QU6A 3G73A 4N4OB 2R7UA 1JGGA 1XDSA 1I1GA 3OYIA 1S7EA 4XOTA 3AG1H 3ONQA 2V6EA 2BW3B 2GIVA 2QQBA 4HSRA 5HNHA 4GGGA 1BI0A 2CFOA 2EFPA 3HHHA 1O7FA 3QYFA 2DK8A 4I09A 4EVIA 2A6EF 3K69A 5L3DA 3HB9A 4NB5A 5E3MA 1W7PD 1FP2A 4M3EA 4BXUA 2VN2A 5JHUA 3JREA 2QZ8A 2GAUA 5EGOA 4BQOA 4B4CA 4KISA 1RPWA 4D5FA 4KMFA 5J47A 1CF7B 5C4JJ 4HW0A 3W2WA 4GCVA 2NOGA 3JSPA 1ODDA 4MQ9F 3BR1A 3K7AJ 3FXLA 2VE8A 3HJEA 4ENKA 2Y0MA 3IH2A 4E70A 5CQGA 5K7HA 2HR3A 2ISYA 2FNAA 3MAJA 2M8EA 3ZQGA 2V4JC 3UNGC 4CYDA 3MKWB 1ULYA 4AM3A 1W1WE 3HTSB 1V5GA 4MQVA 4O3MA 4BL0B 3KP6A 3N4MA 1OYYA 2XHKA 3WE2A 3A0HC 3SEQA 3R61A 3JRDA 1LFUP 2KT0A 2R7TA 2FJ1A 1MMGA 4ESJA 3TDZC 4I6ZA 2Z9OA 2WAEA 3AG3H 3WODF 1LFPA 3M8FA 1F5TA 2DYRH 3M1EA 2JA8J 4BEHA 3M9AA 2QQAA 3LSPA 4BXXJ 1XGMA 3FXRA 4TV7A 1VQPI 2FQ4A 4V2FA 5J1UA 5D5VB 3EUHC 5L3BA 3A02A 2EV6A 4IO9F 2WBMA 4N0BA 4UVAA 4ENJA 2DQLA 2HDWA 3MCZA 2BV6A 1KZHA 2KRHA 3ZQLA 3K4JA 5H2FC 4BQAA 3H3ZA 4CDGA 2COBA 3GXOA 5E1XA 2IW5A 4GYGA 2CGPA 3TKYA 3HC7A 3F6VA 4B3AA 4IHXA 2TCTA 1IW7F 4BQQA 1I6XA 1KONA 4LG0A 4L5JA 4RMNA 4FT8A 1VQ7I 3ELKA 1YRNA 2VOOA 3K70D 1ZREA 4A3IJ 1K78A 3D0SA 1D8KA 1I1SA 2A3SA 1T95A 3VYTB 3OV8A 2Y31A 2RV8A 5CVVA 1I3AA 3GFLA 3L2VA 2E60A 2RREA 3QYEA 1F36A 4G94A 4XLFA 5FJ8J 3MFKA 4IKFA 2BOLA 4FTHA 2K9MA 1ZGAA 3TL4X 1A36A 4B09A 5IPAA 1G3TA 2CW7A 4MEXF 3WE3A 2KRCA 4EM2A 3BTJA 2Q1ZB 4XKVA 1IZ1A 4QIWN 4HX4A 1Y56A 4G7ZF 3CO7C 3P9KA 1DUXC 4D9JA 4ENNA 5B3SH 2ZJQF 4CYCB 4J01A 1YX3A 2D1VA 3K2AA 4UB8C 2O7OA 3GO5A 4UUTA 1ETKA 3V7CA 2VJIA 3H92A 4EJWA 4JBAA 1S9HA 3A01A 3WU2C 2F5EA 4DOZA 4Q4ZF 1R1VA 2XAHA 4RB1A 2LC2A 2Y30A 5F1RA 4BYYA 1XSVA 3L09A 1JE8A 2XV4S 2X0LA 3CDLA 2RVCA 3H35A 1JT0A 3BPVA 2MW8A 3FMRA 3L9FA 1ERDA 3K6GA 3DP7A 2FU4A 3PIOF 1MH4A 1U5TA 4E7JA 1FLIA 3I4PA 3W6KB 2EFWA 2KFDA 1P92A 1JKRC 2V9VA 4YFNF 4LFUA 4CO8A 1I6HJ 1Z91A 1LEAA 1OISA 2XDVA 3GLLA 3JCUC 1RRJA 2TDXA 4UV8A 4BJTA 4BY7J 4P55A 1W5CC 3CCYA 4ZYDA 1T08B 3I59A 1RC9A 1VF9A 5J1RA 2M2EA 3MZHA 3BR5A 2F5DA 1LE8A 2DA7A 3RTRA 3GF2A 3VYUB 4JX6A 2E1OA 4IOAF 4HZFA 5IY5H 2Y69H 3O8GA 5FD6A 2PBIA 4BKXA 4RLFA 1K7AA 4A2UA 3OYJA 2M3AA 3HYIA 1ZRFA 3HOZJ 3NWSA 4LJZF 1ZTRA 2IA2A 3J7AY 4XN0A 3IHUA 2IBDA 4PDKA 2COMA 3DBHB 5LGNA 3F3XA 3TEDA 2PJPA 3QAHA 3V7RA 1H88C 4MO7A 5H6RA 3JW4A 3FXOA 3LA7A 2GWRA 4A12A 2Z5UA 5EF6A 4Y3OA 2GOXB 4BGDA 3H9GA 4ABZA 4A3MJ 2XF5A 4GDFA 1QPIA 3RSNA 4IHWA 2QM3A 2ZSIB 2F48A 3FM3A 1L0OC 5E8GA 3KEOA 3WTTC 3WU1B 1FMVA 1G59A 2Q2EA 4WF2A 4BE2A 2LG4A 4KN7X 1YYVA 4NQWB 1GV5A 2EFQA 1FTTA 1I50J 5JHFA 1RKWA 3CQZJ 4UV9A 1G2HA 2JA7J 3HOXJ 2EBIA 2E34A 4M73A 4UUSB 2Y0SN 2ME0A 5DUKA 3J80K 1MNEA 3W2AA 1KU9A 2CW0F 1T39A 2QKMB 4JQFA 1IG7A 1LFBA 1BI3A 2JJ7A 4PGGA 1WQ2A 1QA6A 1ZRCA 2OJED 2P7CB 1HOMA 1OQYA 1D1AA 3A1YA 4A69C 3DEEA 2C6YA 2HKOA 5BPDA 3N97A 1IJWC 3CJTB 5LD2C 2XROA 2GBYA 1Y8QB 4EJOA 4HDVA 2K02A 5GAGJ 3CCJI 3S3NA 2VJ4A 4IHTA 5HS8A 2L0KA 2JSCA 1SFUA 2CS3A 3CMMA 1QHGA 1FJLA 1B8IB 4RGUA 2Z99A 1X1CA 3QPLA 1HKQA 4IOCF 2KP6A 3GTOJ 3GW2A 3BQZA 3CLOA 2GIZA 4A5NA 2BY0A 1YJNI 3J80Z 3S1NJ 2X51A 2ECCA 4ZYHA 4EATA 1O3RA 4XICA 4DYRA 2KHMA 5LHIA 1X2NA 3F21A 1I3QJ 3I4MJ 4IRGA 2WAFA 2MFZA 3LL7A 4JOMA 2EFOA 2L9SA 2ZXJA 3SDBA 4AVZA 3GFJA 5M5YJ 1D0YA 2R0QC 3HG9A 1OKRA 2VC0A 2GLOA 4M6XA 2GXAA 4DYQA 2L9NA 4WXDA 4CZZA 2W84A 1IN4A 1UG2A 4PJNA 5IYBJ 3M7GA 3EUAA 4HDUA 4N9IA 2O8KA 2M7AA 4Y33A 3C2GA 3PM1A 4I98B 2P4WA 5GTHC 5JI6A 3NAUA 3DLLF 2KIUA 5J4YA 1SAXA 3TP3A 1F43A 3LAPA 1MJBA 2ZFWA 2MBFA 2A05A 3LA3A 3RPUA 5HODA 1X2MA 2RQQA 1V5FA 1T2KA 4X6AJ 2DJIA 3WU0A 2VKHA 2XAFA 4MLOA 2QA4I 3L1PA 4CXFA 4BQNA 2UWMA 2DXIA 4XSZF 4IQJA 2W82A 3PUBA 2ZFUA 3RJPA 4L9NA 4LITA 4RAYA 1S72I 4L18B 1VZ0A 3M8JA 3LQRA 4Y7NJ 2M0MA 3BCAA 2A6HF 1UELB 4MEYF 2LY9A 4LMYA 3P9IA 3U21A 1P4AA 2YU9J 3V7SA 2ZNZA 3DV8A 3E3VA 3RZDJ 4A0YA 3BP8A 1XS9A 1W36C 2LH9A 2PFBA 1F4KA 2CUJA 3DQVC 3KLOA 2DA5A 3JAMK 4OMYA 1LVKA 3ROUA 4G6TB 1PP7U 1EV7A 2E19A 1BI1A 4A6EA 1V4RA 2ZMEA 2H27A 1XX5A 4V19K 2DA3A 2BYVE 5TJJA 4XQFA 2LBFB 3DU5A 3CLQA 5HDNA 3K10A 1SANA 2XAJA 1W36D 1P2FA 1FBSA 3OS0A 2R7OA 2L3DA 4WWCA 4B3XA 2P6SA 3HRSA 1GXPA 1RIOH 2JA5J 3MQ0A 4BACA 1H89C 1PJRA 4UXNA 3PO2J 2PX9A 3DPLC 3AG2H 3TOBA 3MMYB 2R7ZJ 2Y75A 4A3LJ 2DA6A 4U0VA 4C9YA 1YITI 2XASA 3HDDA 1OYWA 1KYZA 2DFHA 3DTKA 2LMDA 1ZRDA 2V9KA 1BOBA 3CCUI 2KLOA 3EQLF 2XRLA 3J7YJ 1Y39A 5M3MJ 5M5WJ 2M5WA 1MJ9A 2OA4A 2VBZA 3CUQA 4YELA 3VYSB 2LY2A 1XCBA 2LRDA 2TRTA 2NNYA 4DJAA 1RI7A 2F5CA 2W00A 1WRJA 4M9SA 3W3CA 4IJAA 5IT9K 1WJAA 4IHSA 3NQOA 2KIQA 5LEKA 1G3YA 1SD7A 3S3MA 1SFOJ 3S14J 2FMLA 2J5PA 1BR1A 4HF0A 2KJBA 3OR1C 1TNTA 3HUGA 4XRMA 4U88A 2KIMA 3DKXA 4EEFG 3CUOA 2RGVA 2QEXI 3G2BA 4IZZA 3BLYA 3HPGA 3WG9A 2K9LA 3OYMA 1IXSB 4LIVA 5ILSA 5C44J 3ABMH 3MD2A 6PAXA 2HOEA 3V42A 1QVTA 3DFGA 4XONA 4G6QA 2NVUB 1Q1VA 3KP3A 4PJLA 4AIDA 1XMXA 3T8TA 2XIGA 1NK2P 1ETQA 3ERMA 4XLHA 1W0UA 1P7JA 4RB2C 4KT6A 4RM2A 1E17A 4KUMA 1FTZA 4M71A 4IRIA 1WHUA 3ZMSA 5EG0B 4J00A 3KIOA 1T38A 2OPTA 2H8WA 4M3BA 4MIMA 1VQNI 2FF4A 5IT9Z 4M3DA 2QBYA 1MBHA 2JK3A 4E6KG 4ZZDA 2VPLA 3PIPF 4A0XA 3OYKA 2DU9A 2JMWA 2FD5A 3UR3C 3GVAA 2CMPA 2O8XA 3WGHA 1ONVA 3S1RJ 3SDGA 1ETWA 2W1OA 3E0JB 2VB6A 2HQNA 5F04A 1MBFA 1SFXA 1PVEA 3A03A 3ZXSA 1VFCA 3PO3J 4E7SA 2WAQA 5DCMB 2JRTA 3ZN0A 2BE5F 2NXNB 3K1MA 3RYPA 1FBUA 1BL0A 1FC3A 2O9LA 2GXBA 3REOA 4M6YA 2DT7B 3H3UA 1G8XA 2HS5A 4CA0A 3BG9A 4UB6C 3SQNA 2JSPA 4P9FA 2A68F 5M5XJ 3JRIA 4HF1A 3DPUA 2DQRA 3E1SA 3KYCB 3G1OA 4PJMA 2UXXA 1X1AA 3C18A 4FCYA 1AHDP 4D7NA 4NC8A 3JRFA 3T5XA 1LDKB 2CQKA 3J81K 1HCRA 3FXMA 4HV6A 1DGRM 3BG3A 1JTYA 4LB5A 4DGWB 5FKLA 5E18F 1IN8A 3GTQJ 3FKJA 1Y6IA 3K4LA 2DJNA 2OTJI 4II3A 3JTGA 2K4BA 2RNGA 4RAFA 3W6JB 3KZZA 1E3HA 2PMZA 5AIQA 1ON1A 1FSEA 1MJAA 2IS1A 4XRFA 4UY8I 3QP6A 5FROA 2LR8A 5E1ZB 2L7MP 3JRBA 1VQ8I 2L02A 1YW7A 1VQ4I 1HBXG 1A6IA 4BBSJ 5CJ9A 1YOVB 5FRNA 5DD8A 3HRTA 1SD4A 3HL2A 3S2WA 4MFDA 1R00A 1GV2A 1PUFA 4XRSA 1C0WA 2M0CA 3HEFA 3HZJA 1W7PB 3J81Z 4EJUA 3QWLA 5EEAA 2X6XA 2LNBA 2CSOA 3FISA 4AIHA 2PJRA 2EQRA 2NVYJ 3ZCOA 2FQ3A 1BI2A 1OCRH 3WTVC 3GCMA 3H3VK 2FBHA 2LOOA 3F0CA 1U5TC 4RB0A 3RKYA 3Q3SA 2HXOA 2EJRA 2FX0A 2CQ7A 5H20A 3OSGA 5D5XB 4P5OA 4NDLA 2VKDA 2ZNYA 1O57A 2BXZA 3ESWB 3CCRI 2F4MB 5CYVA 2ADUA 4KMUX 4M3GA 5GADJ 4RLQA 4XLAA 1TTYA 2DMPA 4A3JJ 1T0FA 4QLCU 3M4OJ 2VT2A 3DLAA 4YEJA 1UB9A 2CYYA 1PDNC 1XSXA 3AAFA 4PGHA 2DFEA 4PFPA 3CCVI 4UHTA 4AYBN 4B8XA 5BS6A 1GUUA 1XSDA 1UHMA 1LB2A 2F6CA 2WTEA 4DW6A 3ASNH 4LIUA 1Z05A 1XGSA 4WK8F 4L9VA 4HLYA 2CRGA 2XGEA 1R4MB 4FETA 3HOWJ 1HSTA 2AXTC 5FB2A 3OIQA 3RPQA 3JR9A 4KIFA 4IF4A 2IVMA 2IPQX 3W6VA 3HGYA 1P6RA 4NC7A 1APLC 5F0HA 4KFCA 3HKZN 1N78A 2LK2A 1YS7A 2ME6A 2HZTA 2IXSA 4CCJA 1QO0D 1HQCA 1VQOI 5E20A 5KHDA 3CD6I 1PYVA 2O5RA 3R0JA 1X4PA 4AUXA 2LDUA 2OQGA 1JKPC 1DU6A 3OYFA 2FA5A 3KP2A 4Q48A 3D1NI 2DBBA 1J0RA 3I4NJ 3FDYA 3FIWA 3CO6C
chains in the Genus database with same CATH topology
1ZG5A 1XMKA 3E6MA 3WGGA 1P4XA 3MZYA 4UNOA 2FSWA 2Q0OA 1Z9CA 3VOEA 1MDMA 2B0LA 4BH9A 1FY7A 1S7AA 3GFIA 5AIPA 3KFWX 2Q8KA 3CDHA 2ZKZA 1USTA 3MEXA 3VB2A 4P9UA 3SZPA 3RKXA 1HSJA 2HGCA 1CGPA 3L00A 3C3WA 3KP7A 5ERIA 1I27A 2A69F 2MLKA 1IXCA 2F2EA 2W24A 1TBXA 1BM9A 3I0TA 1FX7A 3ECOA 1BN5A 3FMQA 3ML6A 3IKVA 1KU3A 3TGNA 4NHJA 1IN6A 1Z6RA 3BJOA 1QNTA 2XAGA 1KA8A 3G3ZA 2H6CA 3BPXA 4MHGA 1WI9A 1O3QA 3BOQA 2YSRA 4BHPA 5JVTA 4BNCA 4Y13A 2P8TA 3EETA 4RGRA 2P6TA 1UCRA 3E97A 4KIGA 1IRFA 3P9CA 4KA4A 4U7BA 2QLZA 2W57A 2FEZA 3ULQB 2VBYA 1OYIA 4L9JA 2ESNA 1R1TA 2MC3A 4Q5SF 2KKOA 3GX4X 4CHUA 3BY6A 5ICGA 2PMHA 1SFEA 2V1XA 1LDDA 4A6DA 1R1UA 3HRUA 2Y48A 5L3FA 3MWMA 2WC2A 1LQ1A 2PLYA 3FXUA 1MZBA 4A5MA 1T6SA 2RC4A 3V8JA 2JTVA 3M8EA 4HV5A 2XRNA 3QPHA 4EGZA 2RQPA 3FX3A 2LF7A 2DO7A 4OOIA 2K27A 2STTA 1D5VA 4LGWA 3VEPA 2H94A 5LHGA 2MA3A 2ESHA 2K4JA 2JZYA 1OR7A 1MD0A 2FOKA 2HEOA 3WTWC 1FP1D 1R5HA 2ZJ2A 3BROA 1ZYRF 1B9NA 2J5OA 1S8NA 2OZUA 4AIJA 1Z1DA 4U7DA 3GZ5A 3ZQ7A 3CUQC 2HWVA 5D4RA 3U9GA 4HA8A 1CF7A 5FO5A 3I53A 3R4KA 2HTSA 1ZGJA 2K7LA 2O03A 2RKHA 4KDPA 3HSRA 3ZMUA 4Q47A 4RAZA 5HLGA 5FD5A 1R7JA 2IT0A 4P96A 5HS7A 5K5OA 3GYHX 2D2WA 2MD5A 1IN7A 1Z7UA 3V4GA 5ILUA 4KN4X 5K5QA 1TQIA 1YW9A 1YFHA 3DXJF 3ZPLA 5ICCA 2XKOA 3FMSA 1W5TA 3IRRA 1MKMA 3F22A 4G6DA 2V1UA 1QQIA 1IXRC 5CVUA 3WTSC 2OAZA 2R7FA 4RS8A 3HTUA 2P5VA 5FGMA 3EYYA 3NRVA 4XSXF 2K86A 4FX0A 1BIAA 5KVRA 3DEUA 1R22A 3R6SA 2FRHA 2NRAC 5DDGA 3BWGA 4N9HA 1YQAA 3VODA 4I2OA 1HXDA 3L7WA 2HKXA 2YX7A 1ZLJA 2RDPA 3BDDA 1E2XA 1HW1A 3F8CA 3HIFA 5L3CA 1GXQA 2VOPA 4EJTA 2GQQA 3EYIA 5LRRA 3RIRA 5FFZA 2NNNA 3QU3A 1F1ZA 3HRMA 2QQ9A 5HLIA 3IKTA 2AXLA 3GWZA 4I02A 1PP8F 5HDGA 2VBWA 4M72A 3CJNA 4G9YA 1H9GA 1S3JA 1FYMA 4L5IA 1B4AA 2A07F 4OINF 3JAMZ 4XBFA 1J2XA 3GFMA 1IN5A 1G3SA 3F72A 4IRHA 1W4MA 3WGIA 2XUBA 2GA2A 2PI0A 1FYKA 4HLXA 3C1DA 1J9IA 5L3GA 5D8LB 4EGYA 2D45A 3HOSA 3WTYC 4I0BA 4BHCA 1TQPA 1F9NA 1LEBA 5DUIA 3PFIA 1IAWA 3J7AO 4YIIA 5D5UB 1DPRA 4NQWA 3QPTA 1UFMA 1YW8A 4ZZLA 2VXZA 4ZYGA 5TRDA 2V6CA 4YIFA 1BOAA 2OBPA 2FBKA 2IP2A 4Y17A 1XGOA 3IC7A 1KU7A 2DK5A 3BZ6A 5DEQA 4LK1F 3WTUC 2OU2A 1ON2A 4MGRA 3FHZA 4LG0B 4MNUA 4IVNA 3Q5FA 2HQRA 1K78B 3KEQA 3NEUA 2Z33A 4LD5A 4LLGF 3SZTA 5LRSA 1DPUA 3ABTA 4ZYEA 3GZ6A 5D4SA 2QWWA 4BAYA 1LVAA 2G9WA 2HTJA 4OMZA 3F8BA 3FM5A 1DDNA 3FZVA 2CG4A 4OU0A 1GHCA 3B02A 2HYGD 5F64A 3GLXA 1JGSA 2EA4A 3GUDA 3I64A 2XVCA 3FXQA 1FOKA 1XN7A 3QOPA 1XDUA 2JPCA 2ELHA 4AWXB 5CVRA 1U5TB 1IRGA 4EQQA 1V3FA 1HW2A 4H0EA 5DCFA 2KJCA 3PQKA 5EEHA 2DI3A 2MH9A 1RUOA 1SMYF 1S29A 2FXAA 1U6GA 2EV0A 2ZCWA 3R0AA 3I59B 2DAOA 1TW2A 1BC7C 2DPUA 2DT5A 5FFXA 4I7HA 1ZG3A 2E7XA 5HDKA 3BJ6A 3FF5A 5LGTA 3ISPA 3C7JA 3V8LA 4ZH4F 2PQ8A 3LFKA 1G4DA 3ZN1A 3E6DA 2DW4A 5BOXA 4HF2A 4R1HA 1W5SA 1G3WA 2EA2A 2YX4A 1WSUA 1X3UA 2ZBKA 1YS6A 2Z3YA 3TO9A 2QUFA 4WCGA 3K1NA 3P7NA 2X4HA 3O2PE 2KIFA 2JT1A 4D0PA 3I5UA 3TOAA 4IXAA 1B9MA 3D5LA 3F8FA 1T98A 2E1NA 1D3YA 4S04A 3QP5A 4EM1A 1KQ0A 1U3EM 3K9TA 4GO1A 3B73A 3KZYA 4HX8A 4L0ZB 2BBYA 4HQEA 4OIRF 2XKPA 4PCQA 1FSHA 1EH8A 4G8XA 4I01A 2IRFG 4IPAA 3E5QA 5DD4A 1ZAOA 1J5YA 1SD6A 4WX9A 5D6EA 2W85A 2ETHA 3O6BB 2UZKA 2LF8A 4OIQF 5LLQA 2H6BA 4R79A 2DPDA 1LDJA 2EB7A 5BQTA 2VONA 1XGNA 4Z2YA 1PUEE 1U2WA 2LKPA 4OIPF 5CLSA 1ZARA 4S05A 4O5VA 2L4AA 2F5FA 5ICEA 4JK1X 5BMZA 5J8FA 5DCMA 5LGUA 2VE9A 5DYMA 1HKSA 4ETSA 4ASNA 5ICFA 3TDUC 1J75A 2AS5F 4U0WA 1WWXA 2E1CA 2STWA 3ABUA 1H0MA 1U8RA 2A5YB 4KYWA 1FNNA 3TQNA 2IJLA 3LWFA 3T8RA 2CWEA 1O7LA 4UVBA 2D1HA 3FWEA 1BC8C 2PMUA 2BEOA 1XCVA 2ZMEB 2PEXA 3F8NA 1LJ9A 1ZN2A 1B1BA 4HYEA 1HKTA 1LNWA 1O3TA 4A0ZA 4PZJA 2JPBA 2XAQA 5K1YA 1NHAA 1YLFA 4RGSA 1W7PA 3DKWA 1BIBA 2WV0A 1XD7A 4EJVA 4BHBA 2P5LC 1TQMA 2OD5A 2ACJA 2HYFA 5L3EA 4YFKF 4AVPA 5LHHA 5ED4A 3K1PA 3CUQB 1IUYA 3PQJA 4MTEA 2H09A 4AD9A 1EH6A 5E8IA 2L4MA 5D6FA 2G7UA 4K2EA 4ESFA 4FHTA 4DQ2A 1KGSA 3CTAA 3I58A 3RKWA 2FNPA 4EM0B 1KU2A 2DLLA 3WTZA 1BJAA 5E1WA 4ENMA 3KETA 2VT3A 2OZ6A 2QVOA 5BPIA 1R5GA 1SD5A 1XMAA 2O6GE 4LLLA 4ESBA 5D5WB 4KT5C 3KE2A 5HLHA 2UXNA 3T0YA 5E17F 2QBYB 3EUHA 1FWZA 5DV5A 3ZMDA 1JXSA 1YG2A 4RGXA 1UHWA 2L54A 1QPMA 1DP7P 4I0AA 2P7VB 2O0YA 5ILVA 5J6XA 5LEJA 3K0LA 1K79A 2PN6A 2W25A 1HW5A 1EH7A 2R3SA 2WWYA 4LLNA 4U0YA 1GVJA 5HVQC 4WXHA 5AONA 1I5ZA 3I71A 1REPC 5K5RA 3RI4A 2FE3A 2O3FA 2VC1A 1WKMA 2V79A 4KICA 1FBQA 5H6QA 5HS9A 1TNSA 4UUVA 4HX7A 3RYRA 4WXCA 3EDPA 1QGPA 5D8KB 4R8HA 2O61A 2FMYA 1BBYA 5F6FA 4GXOA 3IRQA 3LQQA 1XB4A 3TO6A 5CVJA 2HFHA 1OMIA 2DTRA 1JHHA 2EFNA 4M9XA 2FBIA 4RB3C 1H9TA 1QZZA 1B59A 1VTNC 4MTDA 3DPTA 1OPCA 3HSEA 3ZP5A 2EK5A 4F7ZA 1TW3A 3I54A 2GA1A 2EWNA 1JHFA 1STZA 2PG4A 2KRFA 1R36A 2IA0A 3E5XA 1P4WA 3VFZA 4O6JA 1ZG1A 3COAC 3IWZA 2YPRA 2A61A 4L0YB 2M87A 4CICA 1TLHB 3SHFA 4EMSA 3KLNA 2NS0A 3KCCA 1YO5C 1ZHFA 3QRFF 2MH2A 5CVIA 1D8JA 3V8KA 1MGTA 4Y15A 3JSOA 4HAMA 4XLNF 1ZH5A 3E6BA 4CGZA 2M45A 4XLPF 1B6AA 4G7OF 1KQ8A 3O3KA 2NYXA 3U1DA 3L2CA 1K6OA 3IWFA 3ECHA 3ZMVA 3DF8A 1R58A 1FYLA 2VODA 3LA2A 4LB6B 5JFRA 3HHGA 1J7KA 2GXGA 5HOOA 1J59A 4FX4A 1MDMB 3Q9SA 2XGXA 1RZ4A 3TO7A 1QZYA 3ERED 2VBXA 2L01A 4QWQA 1FZPB 4ON0A 2CFXA 2R7DA 3F6OA 3GEZA 3WTXC 3LSTA 2M1BA 4M9ZA 1S7OA 2MLGA 2OQRA 3ZMZA 1S6LA 1RNLA 2LSOA 2GZWA 5IT3A 4KNYA 1Q1HA 1KQ9A 2IA1A 2YU3A 1AWCA 3T1BA 1KYWA 3RDIA 1O3SA 1YTYA 2RN7A 3E5UA 3KP4A 3F23A 5KK1A 5EEGA 2QYOA 1AOYA 3HSFA 3HOTA 1USSA 2HDCA 4KIBA 2EV5A 4HOBA 1QBJA 1G6NA 4YG2F 3IL2A 3F8MA 5LBQA 1R23A 5A2QK 4GYIA 2ZO4A 5FLXK 4UVCA 1U78A 1RUNA 1YIOA 1Y0UA 4G7HF 3E6CC 2P5KA 1A04A 2DFIA 4LK0F 2YR2A 4M74A 3U2RA 2G7HA 3SXYA 1SMTA 4OIOF 4EV0A 3K2ZA 1L3LA 3ZMTA 3JTHA 5A2QZ 5J8CA 5FLXZ 4HQMA 4DNCA 3Q9VA 3OOPA 1FPQA 4YFXF 2ISZA 3SFZA 3LAJA 4HBLA 2BGCA 3BJAA 2QENA 1Z6TA 1IF1A 3KP5A 2E7WA 1ZLKA 2M30A 3R60A 4AIKA 2RNJA 2NAZA 5JR3A 2CO5A 4L9TA 2V1DA 1FT9A 3QU6A 3G73A 1XDSA 1I1GA 2GIVA 2QQBA 4GGGA 1BI0A 2EFPA 3HHHA 1O7FA 2DK8A 4I09A 4EVIA 2A6EF 3K69A 5L3DA 4NB5A 1W7PD 1FP2A 4BXUA 2VN2A 5JHUA 2QZ8A 2GAUA 4KMFA 1CF7B 4HW0A 4GCVA 3JSPA 1ODDA 4MQ9F 2VE8A 4ENKA 2Y0MA 4E70A 2HR3A 2ISYA 2FNAA 3MAJA 2M8EA 4CYDA 1ULYA 3HTSB 4MQVA 4O3MA 3N4MA 3KP6A 1OYYA 2XHKA 3WE2A 3R61A 4ESJA 3TDZC 2Z9OA 3WODF 3M8FA 1F5TA 3M1EA 3M9AA 2QQAA 1XGMA 3FXRA 4TV7A 5D5VB 5L3BA 2EV6A 4N0BA 4UVAA 4ENJA 2DQLA 3MCZA 2BV6A 4BQAA 3H3ZA 4CDGA 3GXOA 5E1XA 2IW5A 4GYGA 2CGPA 3TKYA 3F6VA 1IW7F 1I6XA 4LG0A 4L5JA 4FT8A 3ELKA 2VOOA 1ZREA 1K78A 3D0SA 1D8KA 1I1SA 2A3SA 3OV8A 2RV8A 5CVVA 3GFLA 4G94A 3MFKA 1ZGAA 4B09A 1G3TA 4MEXF 3WE3A 4EM2A 1IZ1A 4HX4A 4G7ZF 3CO7C 3P9KA 1DUXC 4ENNA 2D1VA 3GO5A 3V7CA 3H92A 4EJWA 4JBAA 2F5EA 4Q4ZF 1R1VA 2XAHA 4RB1A 5F1RA 4BYYA 1XSVA 3L09A 1JE8A 2XV4S 2X0LA 2RVCA 3BPVA 3FMRA 3L9FA 3DP7A 2FU4A 1U5TA 1FLIA 3I4PA 3W6KB 2EFWA 1P92A 2V9VA 4YFNF 4LFUA 4CO8A 1Z91A 1LEAA 2TDXA 4UV8A 4P55A 4ZYDA 3I59A 3MZHA 2F5DA 3RTRA 3GF2A 4HZFA 5FD6A 2PBIA 1K7AA 4A2UA 1ZRFA 3HYIA 4LJZF 2IA2A 3IHUA 4PDKA 2COMA 5LGNA 3F3XA 2PJPA 3QAHA 3V7RA 5H6RA 3JW4A 3LA7A 2GWRA 4A12A 2Z5UA 2QM3A 3FM3A 1L0OC 5E8GA 3KEOA 3WTTC 3WU1B 2Q2EA 4WF2A 4KN7X 1YYVA 2EFQA 4UV9A 4M73A 5DUKA 3J80K 1KU9A 2CW0F 1T39A 4JQFA 1ZRCA 1BI3A 4PGGA 1WQ2A 2P7CB 2C6YA 2HKOA 5BPDA 3N97A 2XROA 4EJOA 4HDVA 2K02A 4IHTA 5HS8A 2JSCA 1SFUA 4RGUA 2Z99A 1HKQA 3GW2A 3CLOA 4A5NA 3J80Z 4ZYHA 1O3RA 5LHIA 3F21A 4IRGA 2EFOA 2ZXJA 3GFJA 1OKRA 2VC0A 4M6XA 4WXDA 4CZZA 2W84A 1IN4A 3M7GA 4HDUA 4N9IA 4I98B 2P4WA 5JI6A 2KIUA 1SAXA 3LAPA 1MJBA 2MBFA 2ZFWA 3LA3A 3RPUA 1T2KA 3WU0A 2XAFA 4CXFA 2UWMA 4XSZF 3RJPA 4L9NA 4RAYA 4L18B 3LQRA 2A6HF 4MEYF 4LMYA 3P9IA 1P4AA 3V7SA 2ZNZA 3DV8A 3E3VA 4A0YA 3BP8A 2PFBA 1F4KA 3DQVC 3KLOA 3JAMK 4OMYA 3ROUA 1PP7U 1EV7A 1BI1A 4A6EA 1V4RA 2ZMEA 2H27A 2BYVE 5TJJA 5HDNA 2XAJA 1P2FA 1FBSA 2L3DA 4WWCA 2P6SA 3HRSA 1GXPA 1RIOH 3MQ0A 4UXNA 3DPLC 3TOBA 2Y75A 4U0VA 2XASA 1OYWA 1KYZA 1ZRDA 3EQLF 2M5WA 1MJ9A 2OA4A 2VBZA 3CUQA 1XCBA 2NNYA 1RI7A 2F5CA 1WRJA 4M9SA 4IJAA 5IT9K 4IHSA 3NQOA 5LEKA 1G3YA 1SD7A 2FMLA 2J5PA 4HF0A 2KJBA 1TNTA 3HUGA 4U88A 2KIMA 3CUOA 2RGVA 3WG9A 1IXSB 5ILSA 6PAXA 2HOEA 3DFGA 4G6QA 3KP3A 3T8TA 2XIGA 4RB2C 1E17A 4KUMA 4M71A 4IRIA 1T38A 3ZMSA 2FF4A 5IT9Z 2QBYA 4ZZDA 4A0XA 2DU9A 3GVAA 2O8XA 3WGHA 1ONVA 2HQNA 1SFXA 5DCMB 2JRTA 3ZN0A 2BE5F 3K1MA 3RYPA 1FBUA 1FC3A 2GXBA 3REOA 4M6YA 3H3UA 2HS5A 3SQNA 4P9FA 2A68F 4HF1A 2DQRA 2UXXA 3C18A 3T5XA 1LDKB 2CQKA 3J81K 4HV6A 4LB5A 5E18F 1IN8A 3JTGA 2K4BA 3W6JB 3KZZA 5AIQA 1ON1A 1FSEA 1MJAA 4XRFA 3QP6A 5E1ZB 2L02A 1YW7A 1HBXG 5CJ9A 5DD8A 3HRTA 1SD4A 3S2WA 1R00A 1C0WA 1W7PB 3J81Z 4EJUA 2LNBA 2CSOA 4AIHA 2FQ3A 1BI2A 3WTVC 2FBHA 4RB0A 1U5TC 3RKYA 2EJRA 5H20A 5D5XB 4P5OA 2ZNYA 1O57A 5CYVA 2ADUA 4KMUX 1TTYA 1T0FA 4QLCU 2VT2A 1UB9A 2CYYA 1PDNC 1XSXA 3AAFA 4PGHA 4UHTA 4B8XA 5BS6A 1XSDA 1UHMA 1LB2A 2WTEA 1Z05A 1XGSA 4WK8F 4L9VA 4HLYA 1HSTA 5FB2A 3RPQA 4KIFA 4IF4A 2IVMA 2IPQX 1P6RA 4KFCA 1YS7A 2HZTA 1QO0D 1HQCA 5E20A 3R0JA 2LDUA 2OQGA 2FA5A 3KP2A 4Q48A 2DBBA 1J0RA 3CO6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG5 A;  1XMK A;  3E6M A;  3WGG A;  1P4X A;  3MZY A;  4UNO A;  2FSW A;  2Q0O A;  1Z9C A;  3VOE A;  1MDM A;  2B0L A;  4BH9 A;  1FY7 A;  1S7A A;  3GFI A;  5AIP A;  3KFW X;  2Q8K A;  3CDH A;  2ZKZ A;  1UST A;  3MEX A;  3VB2 A;  4P9U A;  3SZP A;  3RKX A;  1HSJ A;  2HGC A;  1CGP A;  3L00 A;  3C3W A;  3KP7 A;  5ERI A;  1I27 A;  2A69 F;  2MLK A;  1IXC A;  2F2E A;  2W24 A;  1TBX A;  1BM9 A;  3I0T A;  1FX7 A;  3ECO A;  1BN5 A;  3FMQ A;  3ML6 A;  3IKV A;  1KU3 A;  3TGN A;  4NHJ A;  1IN6 A;  1Z6R A;  3BJO A;  1QNT A;  2XAG A;  1KA8 A;  3G3Z A;  2H6C A;  3BPX A;  4MHG A;  1WI9 A;  1O3Q A;  3BOQ A;  2YSR A;  4BHP A;  5JVT A;  4BNC A;  4Y13 A;  2P8T A;  3EET A;  4RGR A;  2P6T A;  1UCR A;  3E97 A;  4KIG A;  1IRF A;  3P9C A;  4KA4 A;  4U7B A;  2QLZ A;  2W57 A;  2FEZ A;  3ULQ B;  2VBY A;  1OYI A;  4L9J A;  2ESN A;  1R1T A;  2MC3 A;  4Q5S F;  2KKO A;  3GX4 X;  4CHU A;  3BY6 A;  5ICG A;  2PMH A;  1SFE A;  2V1X A;  1LDD A;  4A6D A;  1R1U A;  3HRU A;  2Y48 A;  5L3F A;  3MWM A;  2WC2 A;  1LQ1 A;  2PLY A;  3FXU A;  1MZB A;  4A5M A;  1T6S A;  2RC4 A;  3V8J A;  2JTV A;  3M8E A;  4HV5 A;  2XRN A;  3QPH A;  4EGZ A;  2RQP A;  3FX3 A;  2LF7 A;  2DO7 A;  4OOI A;  2K27 A;  2STT A;  1D5V A;  4LGW A;  3VEP A;  2H94 A;  5LHG A;  2MA3 A;  2ESH A;  2K4J A;  2JZY A;  1OR7 A;  1MD0 A;  2FOK A;  2HEO A;  3WTW C;  1FP1 D;  1R5H A;  2ZJ2 A;  3BRO A;  1ZYR F;  1B9N A;  2J5O A;  1S8N A;  2OZU A;  4AIJ A;  1Z1D A;  4U7D A;  3GZ5 A;  3ZQ7 A;  3CUQ C;  2HWV A;  5D4R A;  3U9G A;  4HA8 A;  1CF7 A;  5FO5 A;  3I53 A;  3R4K A;  2HTS A;  1ZGJ A;  2K7L A;  2O03 A;  2RKH A;  4KDP A;  3HSR A;  3ZMU A;  4Q47 A;  4RAZ A;  5HLG A;  5FD5 A;  1R7J A;  2IT0 A;  4P96 A;  5HS7 A;  5K5O A;  3GYH X;  2D2W A;  2MD5 A;  1IN7 A;  1Z7U A;  3V4G A;  5ILU A;  4KN4 X;  5K5Q A;  1TQI A;  1YW9 A;  1YFH A;  3DXJ F;  3ZPL A;  5ICC A;  2XKO A;  3FMS A;  1W5T A;  3IRR A;  1MKM A;  3F22 A;  4G6D A;  2V1U A;  1QQI A;  1IXR C;  5CVU A;  3WTS C;  2OAZ A;  2R7F A;  4RS8 A;  3HTU A;  2P5V A;  5FGM A;  3EYY A;  3NRV A;  4XSX F;  2K86 A;  4FX0 A;  1BIA A;  5KVR A;  3DEU A;  1R22 A;  3R6S A;  2FRH A;  2NRA C;  5DDG A;  3BWG A;  4N9H A;  1YQA A;  3VOD A;  4I2O A;  1HXD A;  3L7W A;  2HKX A;  2YX7 A;  1ZLJ A;  2RDP A;  3BDD A;  1E2X A;  1HW1 A;  3F8C A;  3HIF A;  5L3C A;  1GXQ A;  2VOP A;  4EJT A;  2GQQ A;  3EYI A;  5LRR A;  3RIR A;  5FFZ A;  2NNN A;  3QU3 A;  1F1Z A;  3HRM A;  2QQ9 A;  5HLI A;  3IKT A;  2AXL A;  3GWZ A;  4I02 A;  1PP8 F;  5HDG A;  2VBW A;  4M72 A;  3CJN A;  4G9Y A;  1H9G A;  1S3J A;  1FYM A;  4L5I A;  1B4A A;  2A07 F;  4OIN F;  3JAM Z;  4XBF A;  1J2X A;  3GFM A;  1IN5 A;  1G3S A;  3F72 A;  4IRH A;  1W4M A;  3WGI A;  2XUB A;  2GA2 A;  2PI0 A;  1FYK A;  4HLX A;  3C1D A;  1J9I A;  5L3G A;  5D8L B;  4EGY A;  2D45 A;  3HOS A;  3WTY C;  4I0B A;  4BHC A;  1TQP A;  1F9N A;  1LEB A;  5DUI A;  3PFI A;  1IAW A;  3J7A O;  4YII A;  5D5U B;  1DPR A;  4NQW A;  3QPT A;  1UFM A;  1YW8 A;  4ZZL A;  2VXZ A;  4ZYG A;  5TRD A;  2V6C A;  4YIF A;  1BOA A;  2OBP A;  2FBK A;  2IP2 A;  4Y17 A;  1XGO A;  3IC7 A;  1KU7 A;  2DK5 A;  3BZ6 A;  5DEQ A;  4LK1 F;  3WTU C;  2OU2 A;  1ON2 A;  4MGR A;  3FHZ A;  4LG0 B;  4MNU A;  4IVN A;  3Q5F A;  2HQR A;  1K78 B;  3KEQ A;  3NEU A;  2Z33 A;  4LD5 A;  4LLG F;  3SZT A;  5LRS A;  1DPU A;  3ABT A;  4ZYE A;  3GZ6 A;  5D4S A;  2QWW A;  4BAY A;  1LVA A;  2G9W A;  2HTJ A;  4OMZ A;  3F8B A;  3FM5 A;  1DDN A;  3FZV A;  2CG4 A;  4OU0 A;  1GHC A;  3B02 A;  2HYG D;  5F64 A;  3GLX A;  1JGS A;  2EA4 A;  3GUD A;  3I64 A;  2XVC A;  3FXQ A;  1FOK A;  1XN7 A;  3QOP A;  1XDU A;  2JPC A;  2ELH A;  4AWX B;  5CVR A;  1U5T B;  1IRG A;  4EQQ A;  1V3F A;  1HW2 A;  4H0E A;  5DCF A;  2KJC A;  3PQK A;  5EEH A;  2DI3 A;  2MH9 A;  1RUO A;  1SMY F;  1S29 A;  2FXA A;  1U6G A;  2EV0 A;  2ZCW A;  3R0A A;  3I59 B;  2DAO A;  1TW2 A;  1BC7 C;  2DPU A;  2DT5 A;  5FFX A;  4I7H A;  1ZG3 A;  2E7X A;  5HDK A;  3BJ6 A;  3FF5 A;  5LGT A;  3ISP A;  3C7J A;  3V8L A;  4ZH4 F;  2PQ8 A;  3LFK A;  1G4D A;  3ZN1 A;  3E6D A;  2DW4 A;  5BOX A;  4HF2 A;  4R1H A;  1W5S A;  1G3W A;  2EA2 A;  2YX4 A;  1WSU A;  1X3U A;  2ZBK A;  1YS6 A;  2Z3Y A;  3TO9 A;  2QUF A;  4WCG A;  3K1N A;  3P7N A;  2X4H A;  3O2P E;  2KIF A;  2JT1 A;  4D0P A;  3I5U A;  3TOA A;  4IXA A;  1B9M A;  3D5L A;  3F8F A;  1T98 A;  2E1N A;  1D3Y A;  4S04 A;  3QP5 A;  4EM1 A;  1KQ0 A;  1U3E M;  3K9T A;  4GO1 A;  3B73 A;  3KZY A;  4HX8 A;  4L0Z B;  2BBY A;  4HQE A;  4OIR F;  2XKP A;  4PCQ A;  1FSH A;  1EH8 A;  4G8X A;  4I01 A;  2IRF G;  4IPA A;  3E5Q A;  5DD4 A;  1ZAO A;  1J5Y A;  1SD6 A;  4WX9 A;  5D6E A;  2W85 A;  2ETH A;  3O6B B;  2UZK A;  2LF8 A;  4OIQ F;  5LLQ A;  2H6B A;  4R79 A;  2DPD A;  1LDJ A;  2EB7 A;  5BQT A;  2VON A;  1XGN A;  4Z2Y A;  1PUE E;  1U2W A;  2LKP A;  4OIP F;  5CLS A;  1ZAR A;  4S05 A;  4O5V A;  2L4A A;  2F5F A;  5ICE A;  4JK1 X;  5BMZ A;  5J8F A;  5DCM A;  5LGU A;  2VE9 A;  5DYM A;  1HKS A;  4ETS A;  4ASN A;  5ICF A;  3TDU C;  1J75 A;  2AS5 F;  4U0W A;  1WWX A;  2E1C A;  2STW A;  3ABU A;  1H0M A;  1U8R A;  2A5Y B;  4KYW A;  1FNN A;  3TQN A;  2IJL A;  3LWF A;  3T8R A;  2CWE A;  1O7L A;  4UVB A;  2D1H A;  3FWE A;  1BC8 C;  2PMU A;  2BEO A;  1XCV A;  2ZME B;  2PEX A;  3F8N A;  1LJ9 A;  1ZN2 A;  1B1B A;  4HYE A;  1HKT A;  1LNW A;  1O3T A;  4A0Z A;  4PZJ A;  2JPB A;  2XAQ A;  5K1Y A;  1NHA A;  1YLF A;  4RGS A;  1W7P A;  3DKW A;  1BIB A;  2WV0 A;  1XD7 A;  4EJV A;  4BHB A;  2P5L C;  1TQM A;  2OD5 A;  2ACJ A;  2HYF A;  5L3E A;  4YFK F;  4AVP A;  5LHH A;  5ED4 A;  3K1P A;  3CUQ B;  1IUY A;  3PQJ A;  4MTE A;  2H09 A;  4AD9 A;  1EH6 A;  5E8I A;  2L4M A;  5D6F A;  2G7U A;  4K2E A;  4ESF A;  4FHT A;  4DQ2 A;  1KGS A;  3CTA A;  3I58 A;  3RKW A;  2FNP A;  4EM0 B;  1KU2 A;  2DLL A;  3WTZ A;  1BJA A;  5E1W A;  4ENM A;  3KET A;  2VT3 A;  2OZ6 A;  2QVO A;  5BPI A;  1R5G A;  1SD5 A;  1XMA A;  2O6G E;  4LLL A;  4ESB A;  5D5W B;  4KT5 C;  3KE2 A;  5HLH A;  2UXN A;  3T0Y A;  5E17 F;  2QBY B;  3EUH A;  1FWZ A;  5DV5 A;  3ZMD A;  1JXS A;  1YG2 A;  4RGX A;  1UHW A;  2L54 A;  1QPM A;  1DP7 P;  4I0A A;  2P7V B;  2O0Y A;  5ILV A;  5J6X A;  5LEJ A;  3K0L A;  1K79 A;  2PN6 A;  2W25 A;  1HW5 A;  1EH7 A;  2R3S A;  2WWY A;  4LLN A;  4U0Y A;  1GVJ A;  5HVQ C;  4WXH A;  5AON A;  1I5Z A;  3I71 A;  1REP C;  5K5R A;  3RI4 A;  2FE3 A;  2O3F A;  2VC1 A;  1WKM A;  2V79 A;  4KIC A;  1FBQ A;  5H6Q A;  5HS9 A;  1TNS A;  4UUV A;  4HX7 A;  3RYR A;  4WXC A;  3EDP A;  1QGP A;  5D8K B;  4R8H A;  2O61 A;  2FMY A;  1BBY A;  5F6F A;  4GXO A;  3IRQ A;  3LQQ A;  1XB4 A;  3TO6 A;  5CVJ A;  2HFH A;  1OMI A;  2DTR A;  1JHH A;  2EFN A;  4M9X A;  2FBI A;  4RB3 C;  1H9T A;  1QZZ A;  1B59 A;  1VTN C;  4MTD A;  3DPT A;  1OPC A;  3HSE A;  3ZP5 A;  2EK5 A;  4F7Z A;  1TW3 A;  3I54 A;  2GA1 A;  2EWN A;  1JHF A;  1STZ A;  2PG4 A;  2KRF A;  1R36 A;  2IA0 A;  3E5X A;  1P4W A;  3VFZ A;  4O6J A;  1ZG1 A;  3COA C;  3IWZ A;  2YPR A;  2A61 A;  4L0Y B;  2M87 A;  4CIC A;  1TLH B;  3SHF A;  4EMS A;  3KLN A;  2NS0 A;  3KCC A;  1YO5 C;  1ZHF A;  3QRF F;  2MH2 A;  5CVI A;  1D8J A;  3V8K A;  1MGT A;  4Y15 A;  3JSO A;  4HAM A;  4XLN F;  1ZH5 A;  3E6B A;  4CGZ A;  2M45 A;  4XLP F;  1B6A A;  4G7O F;  1KQ8 A;  3O3K A;  2NYX A;  3U1D A;  3L2C A;  1K6O A;  3IWF A;  3ECH A;  3ZMV A;  3DF8 A;  1R58 A;  1FYL A;  2VOD A;  3LA2 A;  4LB6 B;  5JFR A;  3HHG A;  1J7K A;  2GXG A;  5HOO A;  1J59 A;  4FX4 A;  1MDM B;  3Q9S A;  2XGX A;  1RZ4 A;  3TO7 A;  1QZY A;  3ERE D;  2VBX A;  2L01 A;  4QWQ A;  1FZP B;  4ON0 A;  2CFX A;  2R7D A;  3F6O A;  3GEZ A;  3WTX C;  3LST A;  2M1B A;  4M9Z A;  1S7O A;  2MLG A;  2OQR A;  3ZMZ A;  1S6L A;  1RNL A;  2LSO A;  2GZW A;  5IT3 A;  4KNY A;  1Q1H A;  1KQ9 A;  2IA1 A;  2YU3 A;  1AWC A;  3T1B A;  1KYW A;  3RDI A;  1O3S A;  1YTY A;  2RN7 A;  3E5U A;  3KP4 A;  3F23 A;  5KK1 A;  5EEG A;  2QYO A;  1AOY A;  3HSF A;  3HOT A;  1USS A;  2HDC A;  4KIB A;  2EV5 A;  4HOB A;  1QBJ A;  1G6N A;  4YG2 F;  3IL2 A;  3F8M A;  5LBQ A;  1R23 A;  5A2Q K;  4GYI A;  2ZO4 A;  5FLX K;  4UVC A;  1U78 A;  1RUN A;  1YIO A;  1Y0U A;  4G7H F;  3E6C C;  2P5K A;  1A04 A;  2DFI A;  4LK0 F;  2YR2 A;  4M74 A;  3U2R A;  2G7H A;  3SXY A;  1SMT A;  4OIO F;  4EV0 A;  3K2Z A;  1L3L A;  3ZMT A;  3JTH A;  5A2Q Z;  5J8C A;  5FLX Z;  4HQM A;  4DNC A;  3Q9V A;  3OOP A;  1FPQ A;  4YFX F;  2ISZ A;  3SFZ A;  3LAJ A;  4HBL A;  2BGC A;  3BJA A;  2QEN A;  1Z6T A;  1IF1 A;  3KP5 A;  2E7W A;  1ZLK A;  2M30 A;  3R60 A;  4AIK A;  2RNJ A;  2NAZ A;  5JR3 A;  2CO5 A;  4L9T A;  2V1D A;  1FT9 A;  3QU6 A;  3G73 A;  1XDS A;  1I1G A;  2GIV A;  2QQB A;  4GGG A;  1BI0 A;  2EFP A;  3HHH A;  1O7F A;  2DK8 A;  4I09 A;  4EVI A;  2A6E F;  3K69 A;  5L3D A;  4NB5 A;  1W7P D;  1FP2 A;  4BXU A;  2VN2 A;  5JHU A;  2QZ8 A;  2GAU A;  4KMF A;  1CF7 B;  4HW0 A;  4GCV A;  3JSP A;  1ODD A;  4MQ9 F;  2VE8 A;  4ENK A;  2Y0M A;  4E70 A;  2HR3 A;  2ISY A;  2FNA A;  3MAJ A;  2M8E A;  4CYD A;  1ULY A;  3HTS B;  4MQV A;  4O3M A;  3N4M A;  3KP6 A;  1OYY A;  2XHK A;  3WE2 A;  3R61 A;  4ESJ A;  3TDZ C;  2Z9O A;  3WOD F;  3M8F A;  1F5T A;  3M1E A;  3M9A A;  2QQA A;  1XGM A;  3FXR A;  4TV7 A;  5D5V B;  5L3B A;  2EV6 A;  4N0B A;  4UVA A;  4ENJ A;  2DQL A;  3MCZ A;  2BV6 A;  4BQA A;  3H3Z A;  4CDG A;  3GXO A;  5E1X A;  2IW5 A;  4GYG A;  2CGP A;  3TKY A;  3F6V A;  1IW7 F;  1I6X A;  4LG0 A;  4L5J A;  4FT8 A;  3ELK A;  2VOO A;  1ZRE A;  1K78 A;  3D0S A;  1D8K A;  1I1S A;  2A3S A;  3OV8 A;  2RV8 A;  5CVV A;  3GFL A;  4G94 A;  3MFK A;  1ZGA A;  4B09 A;  1G3T A;  4MEX F;  3WE3 A;  4EM2 A;  1IZ1 A;  4HX4 A;  4G7Z F;  3CO7 C;  3P9K A;  1DUX C;  4ENN A;  2D1V A;  3GO5 A;  3V7C A;  3H92 A;  4EJW A;  4JBA A;  2F5E A;  4Q4Z F;  1R1V A;  2XAH A;  4RB1 A;  5F1R A;  4BYY A;  1XSV A;  3L09 A;  1JE8 A;  2XV4 S;  2X0L A;  2RVC A;  3BPV A;  3FMR A;  3L9F A;  3DP7 A;  2FU4 A;  1U5T A;  1FLI A;  3I4P A;  3W6K B;  2EFW A;  1P92 A;  2V9V A;  4YFN F;  4LFU A;  4CO8 A;  1Z91 A;  1LEA A;  2TDX A;  4UV8 A;  4P55 A;  4ZYD A;  3I59 A;  3MZH A;  2F5D A;  3RTR A;  3GF2 A;  4HZF A;  5FD6 A;  2PBI A;  1K7A A;  4A2U A;  1ZRF A;  3HYI A;  4LJZ F;  2IA2 A;  3IHU A;  4PDK A;  2COM A;  5LGN A;  3F3X A;  2PJP A;  3QAH A;  3V7R A;  5H6R A;  3JW4 A;  3LA7 A;  2GWR A;  4A12 A;  2Z5U A;  2QM3 A;  3FM3 A;  1L0O C;  5E8G A;  3KEO A;  3WTT C;  3WU1 B;  2Q2E A;  4WF2 A;  4KN7 X;  1YYV A;  2EFQ A;  4UV9 A;  4M73 A;  5DUK A;  3J80 K;  1KU9 A;  2CW0 F;  1T39 A;  4JQF A;  1ZRC A;  1BI3 A;  4PGG A;  1WQ2 A;  2P7C B;  2C6Y A;  2HKO A;  5BPD A;  3N97 A;  2XRO A;  4EJO A;  4HDV A;  2K02 A;  4IHT A;  5HS8 A;  2JSC A;  1SFU A;  4RGU A;  2Z99 A;  1HKQ A;  3GW2 A;  3CLO A;  4A5N A;  3J80 Z;  4ZYH A;  1O3R A;  5LHI A;  3F21 A;  4IRG A;  2EFO A;  2ZXJ A;  3GFJ A;  1OKR A;  2VC0 A;  4M6X A;  4WXD A;  4CZZ A;  2W84 A;  1IN4 A;  3M7G A;  4HDU A;  4N9I A;  4I98 B;  2P4W A;  5JI6 A;  2KIU A;  1SAX A;  3LAP A;  1MJB A;  2MBF A;  2ZFW A;  3LA3 A;  3RPU A;  1T2K A;  3WU0 A;  2XAF A;  4CXF A;  2UWM A;  4XSZ F;  3RJP A;  4L9N A;  4RAY A;  4L18 B;  3LQR A;  2A6H F;  4MEY F;  4LMY A;  3P9I A;  1P4A A;  3V7S A;  2ZNZ A;  3DV8 A;  3E3V A;  4A0Y A;  3BP8 A;  2PFB A;  1F4K A;  3DQV C;  3KLO A;  3JAM K;  4OMY A;  3ROU A;  1PP7 U;  1EV7 A;  1BI1 A;  4A6E A;  1V4R A;  2ZME A;  2H27 A;  2BYV E;  5TJJ A;  5HDN A;  2XAJ A;  1P2F A;  1FBS A;  2L3D A;  4WWC A;  2P6S A;  3HRS A;  1GXP A;  1RIO H;  3MQ0 A;  4UXN A;  3DPL C;  3TOB A;  2Y75 A;  4U0V A;  2XAS A;  1OYW A;  1KYZ A;  1ZRD A;  3EQL F;  2M5W A;  1MJ9 A;  2OA4 A;  2VBZ A;  3CUQ A;  1XCB A;  2NNY A;  1RI7 A;  2F5C A;  1WRJ A;  4M9S A;  4IJA A;  5IT9 K;  4IHS A;  3NQO A;  5LEK A;  1G3Y A;  1SD7 A;  2FML A;  2J5P A;  4HF0 A;  2KJB A;  1TNT A;  3HUG A;  4U88 A;  2KIM A;  3CUO A;  2RGV A;  3WG9 A;  1IXS B;  5ILS A;  6PAX A;  2HOE A;  3DFG A;  4G6Q A;  3KP3 A;  3T8T A;  2XIG A;  4RB2 C;  1E17 A;  4KUM A;  4M71 A;  4IRI A;  1T38 A;  3ZMS A;  2FF4 A;  5IT9 Z;  2QBY A;  4ZZD A;  4A0X A;  2DU9 A;  3GVA A;  2O8X A;  3WGH A;  1ONV A;  2HQN A;  1SFX A;  5DCM B;  2JRT A;  3ZN0 A;  2BE5 F;  3K1M A;  3RYP A;  1FBU A;  1FC3 A;  2GXB A;  3REO A;  4M6Y A;  3H3U A;  2HS5 A;  3SQN A;  4P9F A;  2A68 F;  4HF1 A;  2DQR A;  2UXX A;  3C18 A;  3T5X A;  1LDK B;  2CQK A;  3J81 K;  4HV6 A;  4LB5 A;  5E18 F;  1IN8 A;  3JTG A;  2K4B A;  3W6J B;  3KZZ A;  5AIQ A;  1ON1 A;  1FSE A;  1MJA A;  4XRF A;  3QP6 A;  5E1Z B;  2L02 A;  1YW7 A;  1HBX G;  5CJ9 A;  5DD8 A;  3HRT A;  1SD4 A;  3S2W A;  1R00 A;  1C0W A;  1W7P B;  3J81 Z;  4EJU A;  2LNB A;  2CSO A;  4AIH A;  2FQ3 A;  1BI2 A;  3WTV C;  2FBH A;  4RB0 A;  1U5T C;  3RKY A;  2EJR A;  5H20 A;  5D5X B;  4P5O A;  2ZNY A;  1O57 A;  5CYV A;  2ADU A;  4KMU X;  1TTY A;  1T0F A;  4QLC U;  2VT2 A;  1UB9 A;  2CYY A;  1PDN C;  1XSX A;  3AAF A;  4PGH A;  4UHT A;  4B8X A;  5BS6 A;  1XSD A;  1UHM A;  1LB2 A;  2WTE A;  1Z05 A;  1XGS A;  4WK8 F;  4L9V A;  4HLY A;  1HST A;  5FB2 A;  3RPQ A;  4KIF A;  4IF4 A;  2IVM A;  2IPQ X;  1P6R A;  4KFC A;  1YS7 A;  2HZT A;  1QO0 D;  1HQC A;  5E20 A;  3R0J A;  2LDU A;  2OQG A;  2FA5 A;  3KP2 A;  4Q48 A;  2DBB A;  1J0R A;  3CO6 C; 
#chains in the Genus database with same CATH topology
 4FE7 A;  1ZG5 A;  1XMK A;  3E6M A;  3FBN B;  4W97 A;  3WGG A;  5KNL A;  1P4X A;  3MZY A;  5E3N A;  4UNO A;  2FSW A;  2Q0O A;  1ITY A;  1Z9C A;  3VOE A;  3MVP A;  1MDM A;  2B0L A;  4DZJ A;  4BH9 A;  2P81 A;  2MG4 A;  4OWR B;  2GM4 A;  1FY7 A;  5E3L A;  4GFB A;  2B63 J;  1S7A A;  1MBE A;  1A6Q A;  1ACI A;  3GFI A;  5AIP A;  4YIR X;  3KFW X;  4P1W A;  2BHY A;  2E5N A;  2Q8K A;  3CDH A;  3OL3 A;  2ZKZ A;  4IQ4 A;  1UST A;  1OCP A;  1QRY A;  4F91 B;  3CCL I;  1ZKG A;  3MEX A;  3VB2 A;  4P9U A;  3SZP A;  1ZR2 A;  2E5Z A;  2XGD A;  3RKX A;  3KPH A;  1TWF J;  1HSJ A;  2HGC A;  1CGP A;  3L00 A;  2YS9 A;  3C3W A;  3KP7 A;  2MYS A;  5ERI A;  1I27 A;  2MAB A;  5B5E C;  2A69 F;  2MLK A;  2DOD A;  1IXC A;  2F2E A;  1NG7 A;  2W24 A;  2AQF A;  1H8A C;  1TWA J;  3MKL A;  2IS6 A;  1TBX A;  1BM9 A;  3I0T A;  1FX7 A;  3ECO A;  4ZYA A;  2VQC A;  5GTI C;  1BN5 A;  3FMQ A;  3ML6 A;  3IKV A;  1KU3 A;  3F9K A;  3TGN A;  3W2V A;  4NHJ A;  2R7R A;  1UJ8 A;  2JUG A;  3K4N A;  1IN6 A;  2ZC2 A;  1Z6R A;  3BJO A;  1QNT A;  2WB1 A;  2XAG A;  4HNU A;  3S32 A;  1KA8 A;  3G3Z A;  3OYE A;  3AL0 C;  2H6C A;  3BPX A;  4MHG A;  2KDZ A;  1WI9 A;  1D0X A;  3PNV A;  5EYR A;  3A0B C;  1O3Q A;  3BOQ A;  3ZQQ A;  2M7B A;  2YSR A;  3Q0U A;  4BHP A;  5JVT A;  3A2K A;  2L7Z A;  2E2H J;  4BNC A;  4Y13 A;  2P8T A;  3EET A;  4RGR A;  2P6T A;  1UCR A;  3C2H A;  3I9V 2;  3BR0 A;  2HVR A;  2HVS A;  3E97 A;  4KIG A;  1IRF A;  1NTC A;  3P9C A;  1B72 A;  3CME I;  2EIN H;  4KA4 A;  1OCT C;  1O4X A;  4U7B A;  3CCM I;  2QLZ A;  2CU7 A;  3FXJ A;  4NC6 A;  3K4C A;  2W57 A;  5DTD A;  2FEZ A;  5FLM J;  3ULQ B;  2JVH A;  2VBY A;  1OYI A;  4L9J A;  2ESN A;  3O8H A;  1AKH B;  1R1T A;  2MC3 A;  4Q5S F;  3RPU D;  1X3W B;  2KKO A;  2X48 A;  3OS1 A;  3GX4 X;  4CHU A;  1U0J A;  3BY6 A;  5ICG A;  2PMH A;  3L2W A;  1SFE A;  2V1X A;  2P0W A;  2JWT A;  1LDD A;  1TP4 A;  1TL8 A;  5KCM A;  4A6D A;  3OYG A;  1R1U A;  1MBK A;  3HRU A;  2Y48 A;  1VI0 A;  1IO2 A;  2R93 J;  5L3F A;  1TC3 C;  3Q0V A;  5EDN A;  1MMS A;  3MWM A;  1Z77 A;  2WC2 A;  1LQ1 A;  2PLY A;  1VQL I;  2WY8 Q;  3FXU A;  1MZB A;  3JRG A;  1YI2 I;  2ZME C;  4A5M A;  1T6S A;  3TW7 A;  4JX4 A;  3S16 J;  2RC4 A;  3V8J A;  2JTV A;  3M8E A;  2WAD A;  4HV5 A;  2XRN A;  1JTX A;  3QPH A;  5KAF C;  1YJW I;  4EGZ A;  1U8B A;  2RQP A;  1V54 H;  3FX3 A;  2LF7 A;  2DO7 A;  4OOI A;  4U87 A;  3ZQC A;  2K27 A;  1HDD C;  4DBQ A;  2K9Q A;  1TWG J;  2STT A;  2OCC H;  4XLE A;  1D5V A;  4LGW A;  3VEP A;  5DM6 F;  3LNQ A;  2H94 A;  5LHG A;  2MA3 A;  1YE9 A;  2DMQ A;  1UAA A;  1XTA A;  2ESH A;  4Y52 J;  2X9D A;  4W1U A;  2K4J A;  2JZY A;  1OR7 A;  2DOF A;  2X85 A;  1MD0 A;  2FOK A;  5B1B H;  5GAE J;  2HEO A;  3WTW C;  1OLT A;  3M1C A;  1FP1 D;  1R5H A;  3BRO A;  2ZJ2 A;  4ZTF A;  2I5U A;  1ZYR F;  1B9N A;  2J5O A;  3SZG A;  2V26 A;  1V5E A;  1S8N A;  2OZU A;  4AIJ A;  1Z1D A;  4A3G J;  2E1M B;  4U7D A;  3GZ5 A;  2NOJ B;  3ZQ7 A;  3CUQ C;  2HWV A;  2BXY A;  3L2R A;  5D4R A;  2LTP A;  3U9G A;  2G0E A;  4HA8 A;  1BR2 A;  5FO5 A;  3I53 A;  1CF7 A;  3R4K A;  2HTS A;  1ZGJ A;  4OAY A;  3CC4 I;  2KPM A;  1XG1 A;  2HPI A;  2K7L A;  2O03 A;  2RKH A;  4KDP A;  5F0C A;  3WG7 H;  3HSR A;  4JX5 A;  2K3F A;  4NUB A;  1HA8 A;  3ZMU A;  2NS8 A;  4Q47 A;  2R7S A;  2PMZ N;  4RAZ A;  2KZG A;  3H9Q A;  2ELJ A;  3VSK A;  5HLG A;  5FD5 A;  3PSF A;  2EIJ H;  2MGQ A;  5F1J A;  2VUM J;  2E1M C;  2EIL H;  3JRC A;  1R7J A;  2IT0 A;  3S2D J;  4P96 A;  5HS7 A;  5K5O A;  3GYH X;  3BR2 A;  2D2W A;  4F93 B;  2MD5 A;  1IN7 A;  1SEU A;  2ZSH B;  1Z7U A;  1MW7 A;  3FKI J;  3V4G A;  2CV1 A;  2KMU A;  3GTG J;  1XC5 A;  2W7N A;  3H5N A;  2V7F A;  4F3Q A;  1MSE C;  5ILU A;  4KN4 X;  3VDX A;  1HLV A;  1FEX A;  2VQL A;  5K5Q A;  3CMY A;  1TQI A;  3HOV J;  2VAS A;  2JN6 A;  4IHV A;  2V9P A;  1TT5 B;  1YW9 A;  1WH5 A;  3DXJ F;  1YFH A;  5KAI C;  1JUP A;  2OC6 A;  5DS9 A;  4C3J J;  3ZPL A;  5ICC A;  2XKO A;  3FMS A;  2F4I A;  1W5T A;  2M8G X;  2OUM A;  3IRR A;  2M9H A;  1MKM A;  3EUK L;  3F22 A;  4G6D A;  1K6Y A;  2V1U A;  3L2U A;  1QQI A;  4A3B J;  3MKZ A;  1IXR C;  5CVU A;  4CCK A;  3WTS C;  2OAZ A;  9ANT A;  2R7F A;  4RS8 A;  3HTU A;  1POG A;  2P5V A;  2R5Y B;  3EYY A;  5FGM A;  3NRV A;  4XSX F;  2K86 A;  4BE0 A;  4FX0 A;  4B48 A;  1Z3Y A;  1D1B A;  2RAE A;  4NBQ A;  1BIA A;  4IX7 A;  1DU0 A;  5KVR A;  3DEU A;  2JA2 A;  2B7E A;  1R22 A;  1UG0 A;  3R6S A;  2FRH A;  3OOU A;  1MMD A;  2DA4 A;  2NRA C;  2DN0 A;  5DDG A;  3BWG A;  4N9H A;  1NH3 A;  1YQA A;  2EZK A;  1X1D A;  3VOD A;  4I2O A;  1HXD A;  3L7W A;  1U9O A;  1Z7L A;  2HKX A;  2YX7 A;  1PUF B;  1ZLJ A;  2OF7 A;  4CYC A;  2RDP A;  2ZXH A;  3HOU J;  3BDD A;  1E2X A;  1HW1 A;  1OCC H;  3F8C A;  3HIF A;  3PSI A;  2VPR A;  5L3C A;  1GXQ A;  4A93 J;  2VOP A;  4D7M A;  4EJT A;  2GQQ A;  1M1E B;  2DCE A;  5GPC A;  3EYI A;  2VI6 A;  5LRR A;  3RIR A;  5FFZ A;  2NNN A;  2XPW A;  3QU3 A;  4FIS A;  1F1Z A;  3HRM A;  1SVO A;  2CQX A;  1P7I A;  4A3K J;  2QQ9 A;  2R5Z B;  2IS4 A;  5HLI A;  3CCE I;  3IKT A;  2OTL I;  2AXL A;  1CQT A;  1MBJ A;  3GWZ A;  3BTL A;  3LFU A;  4I02 A;  1PP8 F;  4ZJZ A;  2DA2 A;  5GP9 A;  5HDG A;  3G4S I;  2VBW A;  4M72 A;  1R6R A;  5J3L A;  3CJN A;  4G9Y A;  3SFI A;  1FOW A;  3LSI A;  1H9G A;  1S3J A;  2Z16 A;  1RR8 C;  1FYM A;  3GTM J;  4L5I A;  1B4A A;  2A07 F;  3VSL A;  4OIN F;  3JAM Z;  4LG3 A;  3CC2 I;  4KIT B;  4XBF A;  1J2X A;  3L2Q A;  5EGO B;  2KL4 A;  5GPA A;  3GFM A;  5EJC A;  1EJ9 A;  2LYC A;  1IN5 A;  1G3S A;  3F72 A;  3NAR A;  4IRH A;  4JYK A;  3A4C A;  1QHH D;  1W4M A;  3WGI A;  2XUB A;  2GA2 A;  4FE4 A;  2PI0 A;  1FYK A;  4HLX A;  3C1D A;  1IDZ A;  1JKQ C;  1J9I A;  2DOA A;  5L3G A;  5D8L B;  3D5R C;  5J4V A;  1IRX A;  3TMO A;  4S0H B;  1T0F C;  4KJZ A;  4I76 A;  4EGY A;  2D45 A;  3HOS A;  2ZB9 A;  3LSJ A;  4I0B A;  3WTY C;  4LOC A;  2L7F P;  4BHC A;  3QPS A;  1TQP A;  5K7Z A;  4JP0 A;  5JLX A;  2VL8 A;  4F92 B;  1F9N A;  1LEB A;  2L5Q A;  5DUI A;  3PFI A;  2VQG A;  3H5R A;  2X6O A;  2BY1 A;  2CUF A;  4D1Q A;  1IAW A;  2LVS A;  4C2M J;  3J7A O;  4YII A;  2WA0 A;  2LFB A;  5D5U B;  1EF4 A;  1DPR A;  4NQW A;  1JUM A;  4B1R A;  3QPT A;  4BEH B;  2ID3 A;  4V2G A;  1UFM A;  1YW8 A;  4ZZL A;  2VXZ A;  4ZYG A;  5TRD A;  3H9J A;  4A3C J;  3G1L A;  1ZR4 A;  4UUS A;  3CMA I;  1TZL A;  2V6C A;  1BOA A;  2OBP A;  4YIF A;  2DDA A;  1ETX A;  2FBK A;  2R7W A;  2EZH A;  2IP2 A;  4Y17 A;  1IUF A;  3D5S C;  5J40 A;  4BUP A;  1ETV A;  1XGO A;  2K5C A;  4CZC A;  2DOE A;  1EA3 A;  4II2 A;  3IC7 A;  2X1D A;  2XC7 A;  1S5L C;  4CCM A;  4I99 C;  1AU7 A;  1KU7 A;  2AO9 A;  2DK5 A;  3BZ6 A;  4PFO A;  5DEQ A;  4LK1 F;  3GTP J;  3WTU C;  2OU2 A;  1GDT A;  1ON2 A;  3FK7 A;  4MGR A;  3ABL H;  3FHZ A;  4LG0 B;  4MNU A;  4IVN A;  1BJZ A;  3U1K A;  1JJ8 C;  1YRN B;  2BY3 A;  3Q5F A;  4XKB A;  1YIJ I;  1HC8 A;  2HQR A;  1OJL A;  2LY1 A;  2EH3 A;  4RAG A;  1K78 B;  2R7X A;  3KEQ A;  3RQ4 A;  3NEU A;  4BBR J;  2W48 A;  3I56 I;  2ELK A;  4LD5 A;  4LLG F;  2Z33 A;  1B8I A;  3SZT A;  5LRS A;  1DPU A;  1FOX A;  3ABT A;  3BTC A;  3KYL A;  2D5V A;  4XM3 A;  3OL4 A;  4ZYE A;  5D4S A;  3GZ6 A;  2EZI A;  2QWW A;  4BAY A;  4QTR A;  1LVA A;  2G9W A;  2QSH X;  2HTJ A;  4OMZ A;  3F8B A;  3FM5 A;  1DDN A;  3FZV A;  2CG4 A;  4OU0 A;  4C2T A;  1GHC A;  2Y2Z A;  4C3I J;  2OCE A;  3B02 A;  1QVU A;  4DZP A;  4E7K A;  2HYG D;  5F64 A;  4L5E A;  4RA2 A;  3GLX A;  1JGS A;  4E7L A;  2IEK A;  2EA4 A;  3GUD A;  1I39 A;  3K4K A;  2VKV A;  2Y0S A;  3I64 A;  3A01 B;  2XVC A;  3FXQ A;  2WY7 Q;  2BHZ A;  2ID6 A;  1FOK A;  1XN7 A;  3QOP A;  1WH7 A;  4BS9 A;  1XDU A;  3BG7 A;  2JPC A;  2ELH A;  3HPH A;  1NK3 P;  2XPV A;  4AWX B;  5CVR A;  1U5T B;  1IRG A;  2DMU A;  4EQQ A;  1TWC J;  1Z21 A;  1X4O A;  1V3F A;  1HW2 A;  2KIS A;  4H0E A;  4A3F J;  4PSW A;  5DCF A;  2KJC A;  3PQK A;  5EEH A;  2DI3 A;  3IH4 A;  2MH9 A;  1RUO A;  2QSF X;  1SMY F;  5K7F A;  1S29 A;  2FXA A;  1U6G A;  2EV0 A;  2ZCW A;  1VND A;  3CJR B;  4BU2 A;  3R0A A;  3I59 B;  2DAO A;  1TW2 A;  1BC7 C;  2DPU A;  2KQR A;  2DT5 A;  5FFX A;  2X6W A;  1LE8 B;  4I7H A;  1T8I A;  1ZG3 A;  2E7X A;  5HDK A;  1HF0 A;  3BJ6 A;  3M07 A;  3FF5 A;  5LGT A;  1UZC A;  5EZH A;  3ISP A;  4CCO A;  3C7J A;  3V8L A;  5BNG A;  2E2J J;  4ZH4 F;  1DGW Y;  1Y1V J;  4FAS D;  2CH0 A;  4QPO A;  2PQ8 A;  3LFK A;  4XK4 A;  1G4D A;  3ZN1 A;  1FMW A;  2WV1 A;  3E6D A;  4QSH A;  2DW4 A;  5BOX A;  4HF2 A;  2HDD A;  3CF5 F;  1RET A;  4R1H A;  2XPU A;  2LBF A;  3H1C A;  1W5S A;  1G3W A;  2GOM A;  3GTK J;  2L9V A;  2EA2 A;  3VWB A;  2YX4 A;  2X1C A;  2IGN A;  1WSU A;  1X3U A;  2A6T A;  2ZBK A;  2X1E A;  1YS6 A;  2Z3Y A;  3TO9 A;  2QUF A;  4WCG A;  3K1N A;  3P7N A;  2Q2E B;  2X4H A;  2E36 A;  3O2P E;  1RKT A;  1YHQ I;  1D1C A;  2KIF A;  3ZGK A;  2K9N A;  2JT1 A;  4D0P A;  3KYD B;  3I5U A;  3TOA A;  4PJJ A;  4IXA A;  1B9M A;  2HI3 A;  3D5L A;  2XAU A;  2H1L A;  1T98 A;  2E35 A;  3F8F A;  5IYC J;  2CQQ A;  5JLW A;  5C4X J;  2DMT A;  3HXL A;  4MFE A;  2E1N A;  3KZI C;  1BW6 A;  1D3Y A;  4S04 A;  3OY9 A;  5FRM A;  3QP5 A;  2E71 A;  1MBG A;  2QKL B;  3K4B A;  4EM1 A;  1KQ0 A;  3DTI A;  1U3E M;  1R9T J;  3K9T A;  4GO1 A;  3B73 A;  1ZK8 A;  3KZY A;  2IGM A;  4HX8 A;  4L0Z B;  2BBY A;  4HQE A;  4OIR F;  2JVG A;  3CDI A;  1OR7 C;  2XKP A;  1T33 A;  4PCQ A;  1FSH A;  1EH8 A;  1WJD A;  4G8X A;  4HG2 A;  1A35 A;  4E7H A;  5CKT A;  2CJJ A;  4XKW A;  1SAU A;  5IP7 J;  1R5I D;  4I01 A;  3PNT A;  3RQI A;  2IRF G;  4IPA A;  3S93 A;  3E5Q A;  1WI3 A;  5DD4 A;  1ZAO A;  1J5Y A;  4RM3 A;  1E3O C;  2H8R A;  1SD6 A;  4C30 A;  4WX9 A;  3GME A;  1VQ9 I;  3TBI A;  5D6E A;  2W85 A;  3DU6 A;  3OIO A;  2ETH A;  1T56 A;  3ZQH A;  2HOA A;  1UMQ A;  3O6B B;  2UZK A;  1ORK A;  4M6V A;  1QU3 A;  2LF8 A;  5CPR B;  3OR2 C;  3SEZ A;  2VXD A;  4OIQ F;  2N8G A;  4DIQ A;  5LLQ A;  3AL0 B;  5EG0 A;  4OAZ A;  2H6B A;  1V55 H;  4H4K C;  4R79 A;  2DPD A;  1LDJ A;  2EB7 A;  1IC8 A;  3LSR A;  5F27 A;  5BQT A;  1TWH J;  3LSH A;  4Z6Y A;  3K70 C;  2VON A;  1XGN A;  4Z2Y A;  1PUE E;  4HST A;  1U2W A;  2LKP A;  3AG4 H;  3CES A;  4OIP F;  3Q0W A;  5CLS A;  1ZAR A;  3FHN A;  3MZ8 A;  4PJ0 C;  4S05 A;  4O5V A;  2L4A A;  2F5F A;  2AHQ A;  5ICE A;  1OFC X;  4JK1 X;  4XOR A;  5BMZ A;  1WCM J;  5J8F A;  4HNV A;  5DCM A;  5LGU A;  3H0D A;  3RCO A;  2VE9 A;  3MN2 A;  2IAI A;  2M34 A;  2F5V A;  5DYM A;  3PJR A;  1HKS A;  4ETS A;  4ASN A;  2CW8 A;  5B1A H;  1QZE A;  5GAH J;  1IGN A;  2UV1 A;  5ICF A;  1NG6 A;  1R4N B;  1Z3X A;  3IP4 B;  3TDU C;  4ZTJ A;  1Y8R B;  4E7Z A;  3IH3 A;  1J75 A;  2AS5 F;  4U0W A;  1WWX A;  2E1C A;  2STW A;  4AU7 A;  3ABU A;  3PFY A;  4B44 A;  1H0M A;  1YJ9 I;  2IGK A;  1Y1W J;  1U8R A;  2A5Y B;  2BY2 A;  4KYW A;  1FNN A;  3TQN A;  2HVQ A;  2IJL A;  4ZDP A;  3LWF A;  2HNH A;  4XOP A;  3T8R A;  2CWE A;  2ZXW H;  1RES A;  2LKS A;  2HQA A;  1O7L A;  4UVB A;  4Y4R A;  2D1H A;  3FWE A;  2IGO A;  1BC8 C;  2PMU A;  2BEO A;  1XCV A;  2HYJ A;  4HNT A;  3OSF A;  2ZME B;  2PEX A;  3F8N A;  1LJ9 A;  1ZN2 A;  1B1B A;  4HYE A;  3CCQ I;  1HKT A;  1WZ2 A;  1LNW A;  4F55 A;  4C2U A;  4HPQ A;  1O3T A;  4IEJ A;  1XPX A;  3C2B A;  4M3F A;  4ZC3 A;  4A0Z A;  3OS2 A;  2Y9Z A;  2R7Q A;  4XKC A;  2B9S A;  3AKZ A;  1SVM A;  3BG6 A;  4PZJ A;  1JKO C;  1RR7 A;  2JPB A;  2BZT A;  2XAQ A;  5K1Y A;  2M4G A;  1SVL A;  3IV5 A;  4D5C A;  1NHA A;  1YLF A;  4RGS A;  1W7P A;  1J09 A;  3DKW A;  1LUJ B;  2VKE A;  1BIB A;  5J1Y A;  2WV0 A;  1XD7 A;  4FQG A;  4EJV A;  1X1B A;  4BHB A;  2P5L C;  1TQM A;  2OD5 A;  3CCS I;  2ACJ A;  4X1E A;  2HYF A;  5L3E A;  3BG5 A;  3DEW A;  4YFK F;  2MSY A;  4AVP A;  2VIX A;  2W4S A;  5LHH A;  2HPM A;  4BJ5 C;  5ED4 A;  3K1P A;  3CUQ B;  1GT0 C;  2LLK A;  1WJF A;  1IUY A;  2FOW A;  2HU9 A;  3PQJ A;  3IUO A;  4MTE A;  2H09 A;  4AD9 A;  3P5J A;  3LSK A;  1EH6 A;  2R4G A;  5IYD J;  2DDB A;  1WPK A;  5E8I A;  2WAQ N;  1SC7 A;  1LPQ A;  2L4M A;  3HBL A;  5D6F A;  3H5A A;  2G7U A;  3ZQI A;  2L2O A;  4K2E A;  1DQU A;  3CP8 A;  4FHT A;  4ESF A;  2QSG X;  2IS2 A;  3KX2 A;  4DQ2 A;  3HUG B;  2BW3 A;  1KGS A;  5EZG A;  3CTA A;  3I58 A;  4C3H J;  2HQ5 A;  3RKW A;  3J7Z I;  2FNP A;  1Y0N A;  3OYB A;  1U9N A;  3G1M A;  4EM0 B;  3DWL E;  1KU2 A;  3G71 I;  2DLL A;  2ZJP F;  3WTZ A;  1BJA A;  2HOT A;  3OYN A;  3QQA A;  5E1W A;  5IP9 J;  4ENM A;  3ABK H;  1WJB A;  3KET A;  1MSF C;  2VT3 A;  3LSG A;  2OZ6 A;  2QVO A;  1D0Z A;  2HXI A;  2NS7 A;  5BPI A;  4CSW A;  3IAS 2;  1R5G A;  1SD5 A;  1XMA A;  2O6G E;  4LLL A;  4ESB A;  5D5W B;  4ITV A;  4KT5 C;  3KE2 A;  2LD5 A;  1BA5 A;  3CF2 A;  5HLH A;  2UXN A;  4BE1 A;  3SJM A;  3T0Y A;  2YUS A;  3JRH A;  5E17 F;  2QBY B;  1K61 A;  3EUH A;  1FWZ A;  5DV5 A;  3ZMD A;  3E7L A;  2JQ7 A;  1W0T A;  1JXS A;  1IV8 A;  1YG2 A;  5CQE A;  3BT9 A;  4RGX A;  1UHW A;  2L54 A;  1UHS A;  1Z0X A;  3HM5 A;  1QPM A;  2L7K A;  1DP7 P;  3FBI B;  2CUZ A;  4I0A A;  2P7V B;  1IDY A;  4ZDL A;  2O0Y A;  5ILV A;  5J6X A;  3DBR B;  5FLV A;  5LEJ A;  3K0L A;  1WJE A;  4XNF A;  4DYC A;  2PN6 A;  1K79 A;  2W25 A;  1GVD A;  3GZN B;  1HW5 A;  4HRI A;  4IHY A;  1EH7 A;  4PUS A;  4CUG A;  2R3S A;  1SFK A;  3CC7 I;  3G6E I;  4BY1 J;  2WWY A;  4LLN A;  3OYA A;  4U0Y A;  2NVQ J;  1VQM I;  4PSX A;  2LP0 A;  1GVJ A;  5HVQ C;  4WXH A;  2XB0 X;  5AON A;  4AYB A;  3AFH A;  4ANJ A;  1I5Z A;  3I55 I;  5F0F A;  3I71 A;  1REP C;  2XGC A;  1MNM C;  5K5R A;  3RI4 A;  2FE3 A;  3DCF A;  2O3F A;  4G12 A;  3BZK A;  2VC1 A;  3I3L A;  5DM7 F;  1WKM A;  5JVG F;  1JT6 A;  3CZ6 A;  2V79 A;  3DTE A;  1FBQ A;  4KIC A;  5H6Q A;  2CUE A;  4RDU A;  3HKZ A;  1X19 A;  5HS9 A;  1DP3 A;  2NVT J;  1TNS A;  4UUV A;  2ZXI A;  4HX7 A;  2QQ8 A;  2JRM A;  3H36 A;  1K4T A;  3RYR A;  3K4M A;  3OYD A;  4WXC A;  3EDP A;  1GLN A;  3X2Q H;  1LKX A;  4A3D J;  1QGP A;  5D8K B;  4XLC A;  4R8H A;  2O61 A;  2FMY A;  1BBY A;  5F6F A;  4GXO A;  5FKN A;  2I8D A;  2K9S A;  1FIA A;  3IRQ A;  1ETO A;  3LQQ A;  3ZOB A;  1XB4 A;  3TO6 A;  3BQY A;  1WFX A;  3S2H J;  4XID A;  3LMM A;  3GBG A;  3OIP A;  1JUS A;  2HFH A;  5CVJ A;  1MH3 A;  1OMI A;  2DTR A;  2PJR B;  1JHH A;  2E2I J;  1MMN A;  2UUZ A;  4E4H A;  2EFN A;  4M9X A;  2FBI A;  5HNF A;  4RB3 C;  1H9T A;  1QZZ A;  4CCN A;  2LKX A;  2XF7 A;  1B59 A;  3FXK A;  1VTN C;  4MTD A;  2QCO A;  3DPT A;  2ECB A;  1OPC A;  4B43 A;  3HSE A;  5IOY A;  3ZP5 A;  2EK5 A;  3PUF A;  2OV7 A;  3ZQF A;  1TW3 A;  4F7Z A;  3I54 A;  1R71 A;  1X58 A;  3OYH A;  2CV0 A;  3QOE A;  4N4N B;  3DKY A;  2VJJ A;  2GA1 A;  2EWN A;  5FKM A;  4GRI A;  3BR6 A;  1ZGW A;  4J19 A;  1AKH A;  1JHF A;  4IL6 C;  3WHC A;  1STZ A;  3LSM A;  2PG4 A;  1AA7 A;  2KRF A;  1R36 A;  2IA0 A;  1HDP A;  3EPZ A;  2XF6 A;  3E5X A;  1P4W A;  4XRS G;  3VFZ A;  4O6J A;  1ZG1 A;  3COA C;  3BCB A;  3IWZ A;  2YPR A;  2A61 A;  4L0Y B;  2M87 A;  5IOZ A;  2CQN A;  4CIC A;  4AC0 A;  1TLH B;  4DBR A;  2DMN A;  3S15 J;  1E3P A;  1JI8 A;  1ENH A;  3SHF A;  3S1M J;  5F08 A;  4EMS A;  1R49 A;  3KLN A;  2NS0 A;  2A5W A;  3KCC A;  1YO5 C;  2R92 J;  3N05 A;  1BR4 A;  1ZHF A;  3QRF F;  2MH2 A;  5CVI A;  4XL9 A;  1D8J A;  3V8K A;  1MGT A;  2V1N A;  4YRV A;  4Y15 A;  3JSO A;  4HAM A;  4XLN F;  1ZH5 A;  1N25 A;  3CJQ B;  3E6B A;  3H0G J;  5FKK A;  4CGZ A;  2M45 A;  4XLP F;  1B6A A;  5HLT A;  4G7O F;  1P9Q C;  3DBL B;  1KQ8 A;  1K83 J;  3O3K A;  2NYX A;  3U1D A;  3L2C A;  1K6O A;  3IWF A;  3ECH A;  4HEA 2;  1ZQ3 P;  3ZMV A;  2Y9Y A;  3DF8 A;  1R58 A;  3RKQ A;  1D5Y A;  1IRZ A;  1EKE A;  1FYL A;  1JJ6 C;  2VOD A;  2XB5 A;  3LA2 A;  4LB6 B;  5JFR A;  2EPF A;  2K40 A;  3HGG A;  3HHG A;  3BR3 A;  1J7K A;  2DA1 A;  2WB1 N;  2GXG A;  5HOO A;  1J59 A;  1WJ5 A;  3BTI A;  4FX4 A;  1MDM B;  3Q9S A;  3S8P A;  2XGX A;  1A5J A;  1RZ4 A;  1VQ6 I;  2AQE A;  4NNJ A;  3TO7 A;  3ZR8 X;  1QZY A;  3ERE D;  2VBX A;  1MMA A;  2L01 A;  3OMY A;  4QWQ A;  5M3F J;  3GTL J;  1FOY A;  3GTJ J;  1FZP B;  4XR6 A;  3ZRG A;  2HOS A;  2F4O B;  4ON0 A;  2CFX A;  3UKG A;  2R7D A;  2QF7 A;  4X0G A;  3F6O A;  3GEZ A;  3WTX C;  3LST A;  2M1B A;  3OYC A;  4M9Z A;  1WJC A;  2CV2 A;  2XSJ C;  5E3O A;  3BC8 A;  3MKY B;  1S7O A;  4BDZ A;  2MLG A;  2OQR A;  4CCL A;  1E0E A;  4BJ6 C;  3ZMZ A;  4BXF A;  3RZO J;  1S6L A;  2VLA A;  1RNL A;  1TT0 A;  2LSO A;  2GZW A;  4A3E J;  1A31 A;  5IT3 A;  1OCZ H;  1VQ5 I;  2VJ5 A;  3OYL A;  4KNY A;  1Q1H A;  2EZL A;  1KQ9 A;  5TIS C;  3LOC A;  2IA1 A;  1MND A;  3JRA A;  2YU3 A;  1AWC A;  3T1B A;  4BDY A;  5TGT A;  1KYW A;  3PNY A;  2MD0 A;  3RDI A;  1O3S A;  1YTY A;  2RN7 A;  3E5U A;  1X3Z B;  2EIM H;  3KP4 A;  5LFA A;  3CP2 A;  3F23 A;  5KK1 A;  5EEG A;  2KDO A;  2QYO A;  2KZV A;  2H1K A;  5B66 C;  1AOY A;  3HSF A;  3HOT A;  1USS A;  2DT6 A;  2HDC A;  4KIB A;  2EV5 A;  4HOB A;  4PK4 A;  2JA6 J;  1QBJ A;  1G6N A;  4YG2 F;  2HZD A;  3IL2 A;  3F8M A;  2DTZ A;  5LBQ A;  2XSD C;  1R23 A;  5A2Q K;  4GYI A;  1ETY A;  2ZO4 A;  2X6Y A;  5FLX K;  3QYB A;  4E7I A;  4QPQ A;  4UVC A;  3S17 J;  1U78 A;  1N77 A;  2EIK H;  1B72 B;  1N75 A;  1RUN A;  2FUG 2;  1YIO A;  3TW6 A;  4CH7 A;  1Y0U A;  4G7H F;  3E6C C;  1ZEL A;  1Z67 A;  5E79 C;  3BZC A;  2R5Y A;  2P5K A;  4B47 A;  1A04 A;  2R7V A;  2NVX J;  2VQH A;  1OCO H;  2DFI A;  4LK0 F;  2YR2 A;  4M74 A;  2K3P A;  3U2R A;  3VPR A;  2G7H A;  1WVR A;  3SYT A;  4XN3 A;  3SXY A;  3PL8 A;  1SMT A;  2L9R A;  1WGX A;  2K85 A;  5FKO A;  1MIJ A;  4OIO F;  3NWT A;  2Z2S B;  4EV0 A;  3K2Z A;  4RBO A;  3M3Y J;  2QGU A;  2LRE A;  3ZMT A;  1L3L A;  2DFF A;  3JTH A;  1VQK I;  5A2Q Z;  5J8C A;  5FLX Z;  1YX5 A;  3IAM 2;  4HQM A;  4DNC A;  2ICW G;  3Q9V A;  2M4K A;  4ZDO A;  5C3E J;  3HOY J;  1FIP A;  2JUC A;  2Z1D A;  3OWT A;  3OOP A;  4F52 A;  1FPQ A;  4YFX F;  2ISZ A;  3SFZ A;  3WHB A;  5IP6 A;  3VYR B;  3KEY A;  1BW5 A;  3LAJ A;  2MC4 A;  2BGC A;  2DYS H;  2QEN A;  1Z6T A;  3BJA A;  3FK6 A;  4HBL A;  1IF1 A;  1IV6 A;  3QOD A;  3KP5 A;  1K4S A;  2E7W A;  1ZLK A;  2M30 A;  3R60 A;  2R5Z A;  4AIK A;  2RNJ A;  2ZJR F;  4XMY A;  2NAZ A;  3S1Q J;  3B6C A;  3B6A A;  3ASO H;  2BVL A;  2I10 A;  2CO5 A;  2V1D A;  2BVM A;  1FT9 A;  1X1P A;  4L9T A;  3TP0 A;  5JR3 A;  3S3O A;  3QU6 A;  3G73 A;  4N4O B;  2R7U A;  1JGG A;  1XDS A;  1I1G A;  3OYI A;  1S7E A;  4XOT A;  3AG1 H;  3ONQ A;  2V6E A;  2BW3 B;  2GIV A;  2QQB A;  4HSR A;  5HNH A;  4GGG A;  1BI0 A;  2CFO A;  2EFP A;  3HHH A;  1O7F A;  3QYF A;  2DK8 A;  4I09 A;  4EVI A;  2A6E F;  3K69 A;  5L3D A;  3HB9 A;  4NB5 A;  5E3M A;  1W7P D;  1FP2 A;  4M3E A;  4BXU A;  2VN2 A;  5JHU A;  3JRE A;  2QZ8 A;  2GAU A;  5EGO A;  4BQO A;  4B4C A;  4KIS A;  1RPW A;  4D5F A;  4KMF A;  5J47 A;  1CF7 B;  5C4J J;  4HW0 A;  3W2W A;  4GCV A;  2NOG A;  3JSP A;  1ODD A;  4MQ9 F;  3BR1 A;  3K7A J;  3FXL A;  2VE8 A;  3HJE A;  4ENK A;  2Y0M A;  3IH2 A;  4E70 A;  5CQG A;  5K7H A;  2HR3 A;  2ISY A;  2FNA A;  3MAJ A;  2M8E A;  3ZQG A;  2V4J C;  3UNG C;  4CYD A;  3MKW B;  1ULY A;  4AM3 A;  1W1W E;  3HTS B;  1V5G A;  4MQV A;  4O3M A;  4BL0 B;  3KP6 A;  3N4M A;  1OYY A;  2XHK A;  3WE2 A;  3A0H C;  3SEQ A;  3R61 A;  3JRD A;  1LFU P;  2KT0 A;  2R7T A;  2FJ1 A;  1MMG A;  4ESJ A;  3TDZ C;  4I6Z A;  2Z9O A;  2WAE A;  3AG3 H;  3WOD F;  1LFP A;  3M8F A;  1F5T A;  2DYR H;  3M1E A;  2JA8 J;  4BEH A;  3M9A A;  2QQA A;  3LSP A;  4BXX J;  1XGM A;  3FXR A;  4TV7 A;  1VQP I;  2FQ4 A;  4V2F A;  5J1U A;  5D5V B;  3EUH C;  5L3B A;  3A02 A;  2EV6 A;  4IO9 F;  2WBM A;  4N0B A;  4UVA A;  4ENJ A;  2DQL A;  2HDW A;  3MCZ A;  2BV6 A;  1KZH A;  2KRH A;  3ZQL A;  3K4J A;  5H2F C;  4BQA A;  3H3Z A;  4CDG A;  2COB A;  3GXO A;  5E1X A;  2IW5 A;  4GYG A;  2CGP A;  3TKY A;  3HC7 A;  3F6V A;  4B3A A;  4IHX A;  2TCT A;  1IW7 F;  4BQQ A;  1I6X A;  1KON A;  4LG0 A;  4L5J A;  4RMN A;  4FT8 A;  1VQ7 I;  3ELK A;  1YRN A;  2VOO A;  3K70 D;  1ZRE A;  4A3I J;  1K78 A;  3D0S A;  1D8K A;  1I1S A;  2A3S A;  1T95 A;  3VYT B;  3OV8 A;  2Y31 A;  2RV8 A;  5CVV A;  1I3A A;  3GFL A;  3L2V A;  2E60 A;  2RRE A;  3QYE A;  1F36 A;  4G94 A;  4XLF A;  5FJ8 J;  3MFK A;  4IKF A;  2BOL A;  4FTH A;  2K9M A;  1ZGA A;  3TL4 X;  1A36 A;  4B09 A;  5IPA A;  1G3T A;  2CW7 A;  4MEX F;  3WE3 A;  2KRC A;  4EM2 A;  3BTJ A;  2Q1Z B;  4XKV A;  1IZ1 A;  4QIW N;  4HX4 A;  1Y56 A;  4G7Z F;  3CO7 C;  3P9K A;  1DUX C;  4D9J A;  4ENN A;  5B3S H;  2ZJQ F;  4CYC B;  4J01 A;  1YX3 A;  2D1V A;  3K2A A;  4UB8 C;  2O7O A;  3GO5 A;  4UUT A;  1ETK A;  3V7C A;  2VJI A;  3H92 A;  4EJW A;  4JBA A;  1S9H A;  3A01 A;  3WU2 C;  2F5E A;  4DOZ A;  4Q4Z F;  1R1V A;  2XAH A;  4RB1 A;  2LC2 A;  2Y30 A;  5F1R A;  4BYY A;  1XSV A;  3L09 A;  1JE8 A;  2XV4 S;  2X0L A;  3CDL A;  2RVC A;  3H35 A;  1JT0 A;  3BPV A;  2MW8 A;  3FMR A;  3L9F A;  1ERD A;  3K6G A;  3DP7 A;  2FU4 A;  3PIO F;  1MH4 A;  1U5T A;  4E7J A;  1FLI A;  3I4P A;  3W6K B;  2EFW A;  2KFD A;  1P92 A;  1JKR C;  2V9V A;  4YFN F;  4LFU A;  4CO8 A;  1I6H J;  1Z91 A;  1LEA A;  1OIS A;  2XDV A;  3GLL A;  3JCU C;  1RRJ A;  2TDX A;  4UV8 A;  4BJT A;  4BY7 J;  4P55 A;  1W5C C;  3CCY A;  4ZYD A;  1T08 B;  3I59 A;  1RC9 A;  1VF9 A;  5J1R A;  2M2E A;  3MZH A;  3BR5 A;  2F5D A;  1LE8 A;  2DA7 A;  3RTR A;  3GF2 A;  3VYU B;  4JX6 A;  2E1O A;  4IOA F;  4HZF A;  5IY5 H;  2Y69 H;  3O8G A;  5FD6 A;  2PBI A;  4BKX A;  4RLF A;  1K7A A;  4A2U A;  3OYJ A;  2M3A A;  3HYI A;  1ZRF A;  3HOZ J;  3NWS A;  4LJZ F;  1ZTR A;  2IA2 A;  3J7A Y;  4XN0 A;  3IHU A;  2IBD A;  4PDK A;  2COM A;  3DBH B;  5LGN A;  3F3X A;  3TED A;  2PJP A;  3QAH A;  3V7R A;  1H88 C;  4MO7 A;  5H6R A;  3JW4 A;  3FXO A;  3LA7 A;  2GWR A;  4A12 A;  2Z5U A;  5EF6 A;  4Y3O A;  2GOX B;  4BGD A;  3H9G A;  4ABZ A;  4A3M J;  2XF5 A;  4GDF A;  1QPI A;  3RSN A;  4IHW A;  2QM3 A;  2ZSI B;  2F48 A;  3FM3 A;  1L0O C;  5E8G A;  3KEO A;  3WTT C;  3WU1 B;  1FMV A;  1G59 A;  2Q2E A;  4WF2 A;  4BE2 A;  2LG4 A;  4KN7 X;  1YYV A;  4NQW B;  1GV5 A;  2EFQ A;  1FTT A;  1I50 J;  5JHF A;  1RKW A;  3CQZ J;  4UV9 A;  1G2H A;  2JA7 J;  3HOX J;  2EBI A;  2E34 A;  4M73 A;  4UUS B;  2Y0S N;  2ME0 A;  5DUK A;  3J80 K;  1MNE A;  3W2A A;  1KU9 A;  2CW0 F;  1T39 A;  2QKM B;  4JQF A;  1IG7 A;  1LFB A;  1BI3 A;  2JJ7 A;  4PGG A;  1WQ2 A;  1QA6 A;  1ZRC A;  2OJE D;  2P7C B;  1HOM A;  1OQY A;  1D1A A;  3A1Y A;  4A69 C;  3DEE A;  2C6Y A;  2HKO A;  5BPD A;  3N97 A;  1IJW C;  3CJT B;  5LD2 C;  2XRO A;  2GBY A;  1Y8Q B;  4EJO A;  4HDV A;  2K02 A;  5GAG J;  3CCJ I;  3S3N A;  2VJ4 A;  4IHT A;  5HS8 A;  2L0K A;  2JSC A;  1SFU A;  2CS3 A;  3CMM A;  1QHG A;  1FJL A;  1B8I B;  4RGU A;  2Z99 A;  1X1C A;  3QPL A;  1HKQ A;  4IOC F;  2KP6 A;  3GTO J;  3GW2 A;  3BQZ A;  3CLO A;  2GIZ A;  4A5N A;  2BY0 A;  1YJN I;  3J80 Z;  3S1N J;  2X51 A;  2ECC A;  4ZYH A;  4EAT A;  1O3R A;  4XIC A;  4DYR A;  2KHM A;  5LHI A;  1X2N A;  3F21 A;  1I3Q J;  3I4M J;  4IRG A;  2WAF A;  2MFZ A;  3LL7 A;  4JOM A;  2EFO A;  2L9S A;  2ZXJ A;  3SDB A;  4AVZ A;  3GFJ A;  5M5Y J;  1D0Y A;  2R0Q C;  3HG9 A;  1OKR A;  2VC0 A;  2GLO A;  4M6X A;  2GXA A;  4DYQ A;  2L9N A;  4WXD A;  4CZZ A;  2W84 A;  1IN4 A;  1UG2 A;  4PJN A;  5IYB J;  3M7G A;  3EUA A;  4HDU A;  4N9I A;  2O8K A;  2M7A A;  4Y33 A;  3C2G A;  3PM1 A;  4I98 B;  2P4W A;  5GTH C;  5JI6 A;  3NAU A;  3DLL F;  2KIU A;  5J4Y A;  1SAX A;  3TP3 A;  1F43 A;  3LAP A;  1MJB A;  2ZFW A;  2MBF A;  2A05 A;  3LA3 A;  3RPU A;  5HOD A;  1X2M A;  2RQQ A;  1V5F A;  1T2K A;  4X6A J;  2DJI A;  3WU0 A;  2VKH A;  2XAF A;  4MLO A;  2QA4 I;  3L1P A;  4CXF A;  4BQN A;  2UWM A;  2DXI A;  4XSZ F;  4IQJ A;  2W82 A;  3PUB A;  2ZFU A;  3RJP A;  4L9N A;  4LIT A;  4RAY A;  1S72 I;  4L18 B;  1VZ0 A;  3M8J A;  3LQR A;  4Y7N J;  2M0M A;  3BCA A;  2A6H F;  1UEL B;  4MEY F;  2LY9 A;  4LMY A;  3P9I A;  3U21 A;  1P4A A;  2YU9 J;  3V7S A;  2ZNZ A;  3DV8 A;  3E3V A;  3RZD J;  4A0Y A;  3BP8 A;  1XS9 A;  1W36 C;  2LH9 A;  2PFB A;  1F4K A;  2CUJ A;  3DQV C;  3KLO A;  2DA5 A;  3JAM K;  4OMY A;  1LVK A;  3ROU A;  4G6T B;  1PP7 U;  1EV7 A;  2E19 A;  1BI1 A;  4A6E A;  1V4R A;  2ZME A;  2H27 A;  1XX5 A;  4V19 K;  2DA3 A;  2BYV E;  5TJJ A;  4XQF A;  2LBF B;  3DU5 A;  3CLQ A;  5HDN A;  3K10 A;  1SAN A;  2XAJ A;  1W36 D;  1P2F A;  1FBS A;  3OS0 A;  2R7O A;  2L3D A;  4WWC A;  4B3X A;  2P6S A;  3HRS A;  1GXP A;  1RIO H;  2JA5 J;  3MQ0 A;  4BAC A;  1H89 C;  1PJR A;  4UXN A;  3PO2 J;  2PX9 A;  3DPL C;  3AG2 H;  3TOB A;  3MMY B;  2R7Z J;  2Y75 A;  4A3L J;  2DA6 A;  4U0V A;  4C9Y A;  1YIT I;  2XAS A;  3HDD A;  1OYW A;  1KYZ A;  2DFH A;  3DTK A;  2LMD A;  1ZRD A;  2V9K A;  1BOB A;  3CCU I;  2KLO A;  3EQL F;  2XRL A;  3J7Y J;  1Y39 A;  5M3M J;  5M5W J;  2M5W A;  1MJ9 A;  2OA4 A;  2VBZ A;  3CUQ A;  4YEL A;  3VYS B;  2LY2 A;  1XCB A;  2LRD A;  2TRT A;  2NNY A;  4DJA A;  1RI7 A;  2F5C A;  2W00 A;  1WRJ A;  4M9S A;  3W3C A;  4IJA A;  5IT9 K;  1WJA A;  4IHS A;  3NQO A;  2KIQ A;  5LEK A;  1G3Y A;  1SD7 A;  3S3M A;  1SFO J;  3S14 J;  2FML A;  2J5P A;  1BR1 A;  4HF0 A;  2KJB A;  3OR1 C;  1TNT A;  3HUG A;  4XRM A;  4U88 A;  2KIM A;  3DKX A;  4EEF G;  3CUO A;  2RGV A;  2QEX I;  3G2B A;  4IZZ A;  3BLY A;  3HPG A;  3WG9 A;  2K9L A;  3OYM A;  1IXS B;  4LIV A;  5ILS A;  5C44 J;  3ABM H;  3MD2 A;  6PAX A;  2HOE A;  3V42 A;  1QVT A;  3DFG A;  4XON A;  4G6Q A;  2NVU B;  1Q1V A;  3KP3 A;  4PJL A;  4AID A;  1XMX A;  3T8T A;  2XIG A;  1NK2 P;  1ETQ A;  3ERM A;  4XLH A;  1W0U A;  1P7J A;  4RB2 C;  4KT6 A;  4RM2 A;  1E17 A;  4KUM A;  1FTZ A;  4M71 A;  4IRI A;  1WHU A;  3ZMS A;  5EG0 B;  4J00 A;  3KIO A;  1T38 A;  2OPT A;  2H8W A;  4M3B A;  4MIM A;  1VQN I;  2FF4 A;  5IT9 Z;  4M3D A;  2QBY A;  1MBH A;  2JK3 A;  4E6K G;  4ZZD A;  2VPL A;  3PIP F;  4A0X A;  3OYK A;  2DU9 A;  2JMW A;  2FD5 A;  3UR3 C;  3GVA A;  2CMP A;  2O8X A;  3WGH A;  1ONV A;  3S1R J;  3SDG A;  1ETW A;  2W1O A;  3E0J B;  2VB6 A;  2HQN A;  5F04 A;  1MBF A;  1SFX A;  1PVE A;  3A03 A;  3ZXS A;  1VFC A;  3PO3 J;  4E7S A;  2WAQ A;  5DCM B;  2JRT A;  3ZN0 A;  2BE5 F;  2NXN B;  3K1M A;  3RYP A;  1FBU A;  1BL0 A;  1FC3 A;  2O9L A;  2GXB A;  3REO A;  4M6Y A;  2DT7 B;  3H3U A;  1G8X A;  2HS5 A;  4CA0 A;  3BG9 A;  4UB6 C;  3SQN A;  2JSP A;  4P9F A;  2A68 F;  5M5X J;  3JRI A;  4HF1 A;  3DPU A;  2DQR A;  3E1S A;  3KYC B;  3G1O A;  4PJM A;  2UXX A;  1X1A A;  3C18 A;  4FCY A;  1AHD P;  4D7N A;  4NC8 A;  3JRF A;  3T5X A;  1LDK B;  2CQK A;  3J81 K;  1HCR A;  3FXM A;  4HV6 A;  1DGR M;  3BG3 A;  1JTY A;  4LB5 A;  4DGW B;  5FKL A;  5E18 F;  1IN8 A;  3GTQ J;  3FKJ A;  1Y6I A;  3K4L A;  2DJN A;  2OTJ I;  4II3 A;  3JTG A;  2K4B A;  2RNG A;  4RAF A;  3W6J B;  3KZZ A;  1E3H A;  2PMZ A;  5AIQ A;  1ON1 A;  1FSE A;  1MJA A;  2IS1 A;  4XRF A;  4UY8 I;  3QP6 A;  5FRO A;  2LR8 A;  5E1Z B;  2L7M P;  3JRB A;  1VQ8 I;  2L02 A;  1YW7 A;  1VQ4 I;  1HBX G;  1A6I A;  4BBS J;  5CJ9 A;  1YOV B;  5FRN A;  5DD8 A;  3HRT A;  1SD4 A;  3HL2 A;  3S2W A;  4MFD A;  1R00 A;  1GV2 A;  1PUF A;  4XRS A;  1C0W A;  2M0C A;  3HEF A;  3HZJ A;  1W7P B;  3J81 Z;  4EJU A;  3QWL A;  5EEA A;  2X6X A;  2LNB A;  2CSO A;  3FIS A;  4AIH A;  2PJR A;  2EQR A;  2NVY J;  3ZCO A;  2FQ3 A;  1BI2 A;  1OCR H;  3WTV C;  3GCM A;  3H3V K;  2FBH A;  2LOO A;  3F0C A;  1U5T C;  4RB0 A;  3RKY A;  3Q3S A;  2HXO A;  2EJR A;  2FX0 A;  2CQ7 A;  5H20 A;  3OSG A;  5D5X B;  4P5O A;  4NDL A;  2VKD A;  2ZNY A;  1O57 A;  2BXZ A;  3ESW B;  3CCR I;  2F4M B;  5CYV A;  2ADU A;  4KMU X;  4M3G A;  5GAD J;  4RLQ A;  4XLA A;  1TTY A;  2DMP A;  4A3J J;  1T0F A;  4QLC U;  3M4O J;  2VT2 A;  3DLA A;  4YEJ A;  1UB9 A;  2CYY A;  1PDN C;  1XSX A;  3AAF A;  4PGH A;  2DFE A;  4PFP A;  3CCV I;  4UHT A;  4AYB N;  4B8X A;  5BS6 A;  1GUU A;  1XSD A;  1UHM A;  1LB2 A;  2F6C A;  2WTE A;  4DW6 A;  3ASN H;  4LIU A;  1Z05 A;  1XGS A;  4WK8 F;  4L9V A;  4HLY A;  2CRG A;  2XGE A;  1R4M B;  4FET A;  3HOW J;  1HST A;  2AXT C;  5FB2 A;  3OIQ A;  3RPQ A;  3JR9 A;  4KIF A;  4IF4 A;  2IVM A;  2IPQ X;  3W6V A;  3HGY A;  1P6R A;  4NC7 A;  1APL C;  5F0H A;  4KFC A;  3HKZ N;  1N78 A;  2LK2 A;  1YS7 A;  2ME6 A;  2HZT A;  2IXS A;  4CCJ A;  1QO0 D;  1HQC A;  1VQO I;  5E20 A;  5KHD A;  3CD6 I;  1PYV A;  2O5R A;  3R0J A;  1X4P A;  4AUX A;  2LDU A;  2OQG A;  1JKP C;  1DU6 A;  3OYF A;  2FA5 A;  3KP2 A;  4Q48 A;  3D1N I;  2DBB A;  1J0R A;  3I4N J;  3FDY A;  3FIW A;  3CO6 C; 
#chains in the Genus database with same CATH homology
 1ZG5 A;  1XMK A;  3E6M A;  3WGG A;  1P4X A;  3MZY A;  4UNO A;  2FSW A;  2Q0O A;  1Z9C A;  3VOE A;  1MDM A;  2B0L A;  4BH9 A;  1FY7 A;  1S7A A;  3GFI A;  5AIP A;  3KFW X;  2Q8K A;  3CDH A;  2ZKZ A;  1UST A;  3MEX A;  3VB2 A;  4P9U A;  3SZP A;  3RKX A;  1HSJ A;  2HGC A;  1CGP A;  3L00 A;  3C3W A;  3KP7 A;  5ERI A;  1I27 A;  2A69 F;  2MLK A;  1IXC A;  2F2E A;  2W24 A;  1TBX A;  1BM9 A;  3I0T A;  1FX7 A;  3ECO A;  1BN5 A;  3FMQ A;  3ML6 A;  3IKV A;  1KU3 A;  3TGN A;  4NHJ A;  1IN6 A;  1Z6R A;  3BJO A;  1QNT A;  2XAG A;  1KA8 A;  3G3Z A;  2H6C A;  3BPX A;  4MHG A;  1WI9 A;  1O3Q A;  3BOQ A;  2YSR A;  4BHP A;  5JVT A;  4BNC A;  4Y13 A;  2P8T A;  3EET A;  4RGR A;  2P6T A;  1UCR A;  3E97 A;  4KIG A;  1IRF A;  3P9C A;  4KA4 A;  4U7B A;  2QLZ A;  2W57 A;  2FEZ A;  3ULQ B;  2VBY A;  1OYI A;  4L9J A;  2ESN A;  1R1T A;  2MC3 A;  4Q5S F;  2KKO A;  3GX4 X;  4CHU A;  3BY6 A;  5ICG A;  2PMH A;  1SFE A;  2V1X A;  1LDD A;  4A6D A;  1R1U A;  3HRU A;  2Y48 A;  5L3F A;  3MWM A;  2WC2 A;  1LQ1 A;  2PLY A;  3FXU A;  1MZB A;  4A5M A;  1T6S A;  2RC4 A;  3V8J A;  2JTV A;  3M8E A;  4HV5 A;  2XRN A;  3QPH A;  4EGZ A;  2RQP A;  3FX3 A;  2LF7 A;  2DO7 A;  4OOI A;  2K27 A;  2STT A;  1D5V A;  4LGW A;  3VEP A;  2H94 A;  5LHG A;  2MA3 A;  2ESH A;  2K4J A;  2JZY A;  1OR7 A;  1MD0 A;  2FOK A;  2HEO A;  3WTW C;  1FP1 D;  1R5H A;  2ZJ2 A;  3BRO A;  1ZYR F;  1B9N A;  2J5O A;  1S8N A;  2OZU A;  4AIJ A;  1Z1D A;  4U7D A;  3GZ5 A;  3ZQ7 A;  3CUQ C;  2HWV A;  5D4R A;  3U9G A;  4HA8 A;  1CF7 A;  5FO5 A;  3I53 A;  3R4K A;  2HTS A;  1ZGJ A;  2K7L A;  2O03 A;  2RKH A;  4KDP A;  3HSR A;  3ZMU A;  4Q47 A;  4RAZ A;  5HLG A;  5FD5 A;  1R7J A;  2IT0 A;  4P96 A;  5HS7 A;  5K5O A;  3GYH X;  2D2W A;  2MD5 A;  1IN7 A;  1Z7U A;  3V4G A;  5ILU A;  4KN4 X;  5K5Q A;  1TQI A;  1YW9 A;  1YFH A;  3DXJ F;  3ZPL A;  5ICC A;  2XKO A;  3FMS A;  1W5T A;  3IRR A;  1MKM A;  3F22 A;  4G6D A;  2V1U A;  1QQI A;  1IXR C;  5CVU A;  3WTS C;  2OAZ A;  2R7F A;  4RS8 A;  3HTU A;  2P5V A;  5FGM A;  3EYY A;  3NRV A;  4XSX F;  2K86 A;  4FX0 A;  1BIA A;  5KVR A;  3DEU A;  1R22 A;  3R6S A;  2FRH A;  2NRA C;  5DDG A;  3BWG A;  4N9H A;  1YQA A;  3VOD A;  4I2O A;  1HXD A;  3L7W A;  2HKX A;  2YX7 A;  1ZLJ A;  2RDP A;  3BDD A;  1E2X A;  1HW1 A;  3F8C A;  3HIF A;  5L3C A;  1GXQ A;  2VOP A;  4EJT A;  2GQQ A;  3EYI A;  5LRR A;  3RIR A;  5FFZ A;  2NNN A;  3QU3 A;  1F1Z A;  3HRM A;  2QQ9 A;  5HLI A;  3IKT A;  2AXL A;  3GWZ A;  4I02 A;  1PP8 F;  5HDG A;  2VBW A;  4M72 A;  3CJN A;  4G9Y A;  1H9G A;  1S3J A;  1FYM A;  4L5I A;  1B4A A;  2A07 F;  4OIN F;  3JAM Z;  4XBF A;  1J2X A;  3GFM A;  1IN5 A;  1G3S A;  3F72 A;  4IRH A;  1W4M A;  3WGI A;  2XUB A;  2GA2 A;  2PI0 A;  1FYK A;  4HLX A;  3C1D A;  1J9I A;  5L3G A;  5D8L B;  4EGY A;  2D45 A;  3HOS A;  3WTY C;  4I0B A;  4BHC A;  1TQP A;  1F9N A;  1LEB A;  5DUI A;  3PFI A;  1IAW A;  3J7A O;  4YII A;  5D5U B;  1DPR A;  4NQW A;  3QPT A;  1UFM A;  1YW8 A;  4ZZL A;  2VXZ A;  4ZYG A;  5TRD A;  2V6C A;  4YIF A;  1BOA A;  2OBP A;  2FBK A;  2IP2 A;  4Y17 A;  1XGO A;  3IC7 A;  1KU7 A;  2DK5 A;  3BZ6 A;  5DEQ A;  4LK1 F;  3WTU C;  2OU2 A;  1ON2 A;  4MGR A;  3FHZ A;  4LG0 B;  4MNU A;  4IVN A;  3Q5F A;  2HQR A;  1K78 B;  3KEQ A;  3NEU A;  2Z33 A;  4LD5 A;  4LLG F;  3SZT A;  5LRS A;  1DPU A;  3ABT A;  4ZYE A;  3GZ6 A;  5D4S A;  2QWW A;  4BAY A;  1LVA A;  2G9W A;  2HTJ A;  4OMZ A;  3F8B A;  3FM5 A;  1DDN A;  3FZV A;  2CG4 A;  4OU0 A;  1GHC A;  3B02 A;  2HYG D;  5F64 A;  3GLX A;  1JGS A;  2EA4 A;  3GUD A;  3I64 A;  2XVC A;  3FXQ A;  1FOK A;  1XN7 A;  3QOP A;  1XDU A;  2JPC A;  2ELH A;  4AWX B;  5CVR A;  1U5T B;  1IRG A;  4EQQ A;  1V3F A;  1HW2 A;  4H0E A;  5DCF A;  2KJC A;  3PQK A;  5EEH A;  2DI3 A;  2MH9 A;  1RUO A;  1SMY F;  1S29 A;  2FXA A;  1U6G A;  2EV0 A;  2ZCW A;  3R0A A;  3I59 B;  2DAO A;  1TW2 A;  1BC7 C;  2DPU A;  2DT5 A;  5FFX A;  4I7H A;  1ZG3 A;  2E7X A;  5HDK A;  3BJ6 A;  3FF5 A;  5LGT A;  3ISP A;  3C7J A;  3V8L A;  4ZH4 F;  2PQ8 A;  3LFK A;  1G4D A;  3ZN1 A;  3E6D A;  2DW4 A;  5BOX A;  4HF2 A;  4R1H A;  1W5S A;  1G3W A;  2EA2 A;  2YX4 A;  1WSU A;  1X3U A;  2ZBK A;  1YS6 A;  2Z3Y A;  3TO9 A;  2QUF A;  4WCG A;  3K1N A;  3P7N A;  2X4H A;  3O2P E;  2KIF A;  2JT1 A;  4D0P A;  3I5U A;  3TOA A;  4IXA A;  1B9M A;  3D5L A;  3F8F A;  1T98 A;  2E1N A;  1D3Y A;  4S04 A;  3QP5 A;  4EM1 A;  1KQ0 A;  1U3E M;  3K9T A;  4GO1 A;  3B73 A;  3KZY A;  4HX8 A;  4L0Z B;  2BBY A;  4HQE A;  4OIR F;  2XKP A;  4PCQ A;  1FSH A;  1EH8 A;  4G8X A;  4I01 A;  2IRF G;  4IPA A;  3E5Q A;  5DD4 A;  1ZAO A;  1J5Y A;  1SD6 A;  4WX9 A;  5D6E A;  2W85 A;  2ETH A;  3O6B B;  2UZK A;  2LF8 A;  4OIQ F;  5LLQ A;  2H6B A;  4R79 A;  2DPD A;  1LDJ A;  2EB7 A;  5BQT A;  2VON A;  1XGN A;  4Z2Y A;  1PUE E;  1U2W A;  2LKP A;  4OIP F;  5CLS A;  1ZAR A;  4S05 A;  4O5V A;  2L4A A;  2F5F A;  5ICE A;  4JK1 X;  5BMZ A;  5J8F A;  5DCM A;  5LGU A;  2VE9 A;  5DYM A;  1HKS A;  4ETS A;  4ASN A;  5ICF A;  3TDU C;  1J75 A;  2AS5 F;  4U0W A;  1WWX A;  2E1C A;  2STW A;  3ABU A;  1H0M A;  1U8R A;  2A5Y B;  4KYW A;  1FNN A;  3TQN A;  2IJL A;  3LWF A;  3T8R A;  2CWE A;  1O7L A;  4UVB A;  2D1H A;  3FWE A;  1BC8 C;  2PMU A;  2BEO A;  1XCV A;  2ZME B;  2PEX A;  3F8N A;  1LJ9 A;  1ZN2 A;  1B1B A;  4HYE A;  1HKT A;  1LNW A;  1O3T A;  4A0Z A;  4PZJ A;  2JPB A;  2XAQ A;  5K1Y A;  1NHA A;  1YLF A;  4RGS A;  1W7P A;  3DKW A;  1BIB A;  2WV0 A;  1XD7 A;  4EJV A;  4BHB A;  2P5L C;  1TQM A;  2OD5 A;  2ACJ A;  2HYF A;  5L3E A;  4YFK F;  4AVP A;  5LHH A;  5ED4 A;  3K1P A;  3CUQ B;  1IUY A;  3PQJ A;  4MTE A;  2H09 A;  4AD9 A;  1EH6 A;  5E8I A;  2L4M A;  5D6F A;  2G7U A;  4K2E A;  4ESF A;  4FHT A;  4DQ2 A;  1KGS A;  3CTA A;  3I58 A;  3RKW A;  2FNP A;  4EM0 B;  1KU2 A;  2DLL A;  3WTZ A;  1BJA A;  5E1W A;  4ENM A;  3KET A;  2VT3 A;  2OZ6 A;  2QVO A;  5BPI A;  1R5G A;  1SD5 A;  1XMA A;  2O6G E;  4LLL A;  4ESB A;  5D5W B;  4KT5 C;  3KE2 A;  5HLH A;  2UXN A;  3T0Y A;  5E17 F;  2QBY B;  3EUH A;  1FWZ A;  5DV5 A;  3ZMD A;  1JXS A;  1YG2 A;  4RGX A;  1UHW A;  2L54 A;  1QPM A;  1DP7 P;  4I0A A;  2P7V B;  2O0Y A;  5ILV A;  5J6X A;  5LEJ A;  3K0L A;  1K79 A;  2PN6 A;  2W25 A;  1HW5 A;  1EH7 A;  2R3S A;  2WWY A;  4LLN A;  4U0Y A;  1GVJ A;  5HVQ C;  4WXH A;  5AON A;  1I5Z A;  3I71 A;  1REP C;  5K5R A;  3RI4 A;  2FE3 A;  2O3F A;  2VC1 A;  1WKM A;  2V79 A;  4KIC A;  1FBQ A;  5H6Q A;  5HS9 A;  1TNS A;  4UUV A;  4HX7 A;  3RYR A;  4WXC A;  3EDP A;  1QGP A;  5D8K B;  4R8H A;  2O61 A;  2FMY A;  1BBY A;  5F6F A;  4GXO A;  3IRQ A;  3LQQ A;  1XB4 A;  3TO6 A;  5CVJ A;  2HFH A;  1OMI A;  2DTR A;  1JHH A;  2EFN A;  4M9X A;  2FBI A;  4RB3 C;  1H9T A;  1QZZ A;  1B59 A;  1VTN C;  4MTD A;  3DPT A;  1OPC A;  3HSE A;  3ZP5 A;  2EK5 A;  4F7Z A;  1TW3 A;  3I54 A;  2GA1 A;  2EWN A;  1JHF A;  1STZ A;  2PG4 A;  2KRF A;  1R36 A;  2IA0 A;  3E5X A;  1P4W A;  3VFZ A;  4O6J A;  1ZG1 A;  3COA C;  3IWZ A;  2YPR A;  2A61 A;  4L0Y B;  2M87 A;  4CIC A;  1TLH B;  3SHF A;  4EMS A;  3KLN A;  2NS0 A;  3KCC A;  1YO5 C;  1ZHF A;  3QRF F;  2MH2 A;  5CVI A;  1D8J A;  3V8K A;  1MGT A;  4Y15 A;  3JSO A;  4HAM A;  4XLN F;  1ZH5 A;  3E6B A;  4CGZ A;  2M45 A;  4XLP F;  1B6A A;  4G7O F;  1KQ8 A;  3O3K A;  2NYX A;  3U1D A;  3L2C A;  1K6O A;  3IWF A;  3ECH A;  3ZMV A;  3DF8 A;  1R58 A;  1FYL A;  2VOD A;  3LA2 A;  4LB6 B;  5JFR A;  3HHG A;  1J7K A;  2GXG A;  5HOO A;  1J59 A;  4FX4 A;  1MDM B;  3Q9S A;  2XGX A;  1RZ4 A;  3TO7 A;  1QZY A;  3ERE D;  2VBX A;  2L01 A;  4QWQ A;  1FZP B;  4ON0 A;  2CFX A;  2R7D A;  3F6O A;  3GEZ A;  3WTX C;  3LST A;  2M1B A;  4M9Z A;  1S7O A;  2MLG A;  2OQR A;  3ZMZ A;  1S6L A;  1RNL A;  2LSO A;  2GZW A;  5IT3 A;  4KNY A;  1Q1H A;  1KQ9 A;  2IA1 A;  2YU3 A;  1AWC A;  3T1B A;  1KYW A;  3RDI A;  1O3S A;  1YTY A;  2RN7 A;  3E5U A;  3KP4 A;  3F23 A;  5KK1 A;  5EEG A;  2QYO A;  1AOY A;  3HSF A;  3HOT A;  1USS A;  2HDC A;  4KIB A;  2EV5 A;  4HOB A;  1QBJ A;  1G6N A;  4YG2 F;  3IL2 A;  3F8M A;  5LBQ A;  1R23 A;  5A2Q K;  4GYI A;  2ZO4 A;  5FLX K;  4UVC A;  1U78 A;  1RUN A;  1YIO A;  1Y0U A;  4G7H F;  3E6C C;  2P5K A;  1A04 A;  2DFI A;  4LK0 F;  2YR2 A;  4M74 A;  3U2R A;  2G7H A;  3SXY A;  1SMT A;  4OIO F;  4EV0 A;  3K2Z A;  1L3L A;  3ZMT A;  3JTH A;  5A2Q Z;  5J8C A;  5FLX Z;  4HQM A;  4DNC A;  3Q9V A;  3OOP A;  1FPQ A;  4YFX F;  2ISZ A;  3SFZ A;  3LAJ A;  4HBL A;  2BGC A;  3BJA A;  2QEN A;  1Z6T A;  1IF1 A;  3KP5 A;  2E7W A;  1ZLK A;  2M30 A;  3R60 A;  4AIK A;  2RNJ A;  2NAZ A;  5JR3 A;  2CO5 A;  4L9T A;  2V1D A;  1FT9 A;  3QU6 A;  3G73 A;  1XDS A;  1I1G A;  2GIV A;  2QQB A;  4GGG A;  1BI0 A;  2EFP A;  3HHH A;  1O7F A;  2DK8 A;  4I09 A;  4EVI A;  2A6E F;  3K69 A;  5L3D A;  4NB5 A;  1W7P D;  1FP2 A;  4BXU A;  2VN2 A;  5JHU A;  2QZ8 A;  2GAU A;  4KMF A;  1CF7 B;  4HW0 A;  4GCV A;  3JSP A;  1ODD A;  4MQ9 F;  2VE8 A;  4ENK A;  2Y0M A;  4E70 A;  2HR3 A;  2ISY A;  2FNA A;  3MAJ A;  2M8E A;  4CYD A;  1ULY A;  3HTS B;  4MQV A;  4O3M A;  3N4M A;  3KP6 A;  1OYY A;  2XHK A;  3WE2 A;  3R61 A;  4ESJ A;  3TDZ C;  2Z9O A;  3WOD F;  3M8F A;  1F5T A;  3M1E A;  3M9A A;  2QQA A;  1XGM A;  3FXR A;  4TV7 A;  5D5V B;  5L3B A;  2EV6 A;  4N0B A;  4UVA A;  4ENJ A;  2DQL A;  3MCZ A;  2BV6 A;  4BQA A;  3H3Z A;  4CDG A;  3GXO A;  5E1X A;  2IW5 A;  4GYG A;  2CGP A;  3TKY A;  3F6V A;  1IW7 F;  1I6X A;  4LG0 A;  4L5J A;  4FT8 A;  3ELK A;  2VOO A;  1ZRE A;  1K78 A;  3D0S A;  1D8K A;  1I1S A;  2A3S A;  3OV8 A;  2RV8 A;  5CVV A;  3GFL A;  4G94 A;  3MFK A;  1ZGA A;  4B09 A;  1G3T A;  4MEX F;  3WE3 A;  4EM2 A;  1IZ1 A;  4HX4 A;  4G7Z F;  3CO7 C;  3P9K A;  1DUX C;  4ENN A;  2D1V A;  3GO5 A;  3V7C A;  3H92 A;  4EJW A;  4JBA A;  2F5E A;  4Q4Z F;  1R1V A;  2XAH A;  4RB1 A;  5F1R A;  4BYY A;  1XSV A;  3L09 A;  1JE8 A;  2XV4 S;  2X0L A;  2RVC A;  3BPV A;  3FMR A;  3L9F A;  3DP7 A;  2FU4 A;  1U5T A;  1FLI A;  3I4P A;  3W6K B;  2EFW A;  1P92 A;  2V9V A;  4YFN F;  4LFU A;  4CO8 A;  1Z91 A;  1LEA A;  2TDX A;  4UV8 A;  4P55 A;  4ZYD A;  3I59 A;  3MZH A;  2F5D A;  3RTR A;  3GF2 A;  4HZF A;  5FD6 A;  2PBI A;  1K7A A;  4A2U A;  1ZRF A;  3HYI A;  4LJZ F;  2IA2 A;  3IHU A;  4PDK A;  2COM A;  5LGN A;  3F3X A;  2PJP A;  3QAH A;  3V7R A;  5H6R A;  3JW4 A;  3LA7 A;  2GWR A;  4A12 A;  2Z5U A;  2QM3 A;  3FM3 A;  1L0O C;  5E8G A;  3KEO A;  3WTT C;  3WU1 B;  2Q2E A;  4WF2 A;  4KN7 X;  1YYV A;  2EFQ A;  4UV9 A;  4M73 A;  5DUK A;  3J80 K;  1KU9 A;  2CW0 F;  1T39 A;  4JQF A;  1ZRC A;  1BI3 A;  4PGG A;  1WQ2 A;  2P7C B;  2C6Y A;  2HKO A;  5BPD A;  3N97 A;  2XRO A;  4EJO A;  4HDV A;  2K02 A;  4IHT A;  5HS8 A;  2JSC A;  1SFU A;  4RGU A;  2Z99 A;  1HKQ A;  3GW2 A;  3CLO A;  4A5N A;  3J80 Z;  4ZYH A;  1O3R A;  5LHI A;  3F21 A;  4IRG A;  2EFO A;  2ZXJ A;  3GFJ A;  1OKR A;  2VC0 A;  4M6X A;  4WXD A;  4CZZ A;  2W84 A;  1IN4 A;  3M7G A;  4HDU A;  4N9I A;  4I98 B;  2P4W A;  5JI6 A;  2KIU A;  1SAX A;  3LAP A;  1MJB A;  2MBF A;  2ZFW A;  3LA3 A;  3RPU A;  1T2K A;  3WU0 A;  2XAF A;  4CXF A;  2UWM A;  4XSZ F;  3RJP A;  4L9N A;  4RAY A;  4L18 B;  3LQR A;  2A6H F;  4MEY F;  4LMY A;  3P9I A;  1P4A A;  3V7S A;  2ZNZ A;  3DV8 A;  3E3V A;  4A0Y A;  3BP8 A;  2PFB A;  1F4K A;  3DQV C;  3KLO A;  3JAM K;  4OMY A;  3ROU A;  1PP7 U;  1EV7 A;  1BI1 A;  4A6E A;  1V4R A;  2ZME A;  2H27 A;  2BYV E;  5TJJ A;  5HDN A;  2XAJ A;  1P2F A;  1FBS A;  2L3D A;  4WWC A;  2P6S A;  3HRS A;  1GXP A;  1RIO H;  3MQ0 A;  4UXN A;  3DPL C;  3TOB A;  2Y75 A;  4U0V A;  2XAS A;  1OYW A;  1KYZ A;  1ZRD A;  3EQL F;  2M5W A;  1MJ9 A;  2OA4 A;  2VBZ A;  3CUQ A;  1XCB A;  2NNY A;  1RI7 A;  2F5C A;  1WRJ A;  4M9S A;  4IJA A;  5IT9 K;  4IHS A;  3NQO A;  5LEK A;  1G3Y A;  1SD7 A;  2FML A;  2J5P A;  4HF0 A;  2KJB A;  1TNT A;  3HUG A;  4U88 A;  2KIM A;  3CUO A;  2RGV A;  3WG9 A;  1IXS B;  5ILS A;  6PAX A;  2HOE A;  3DFG A;  4G6Q A;  3KP3 A;  3T8T A;  2XIG A;  4RB2 C;  1E17 A;  4KUM A;  4M71 A;  4IRI A;  1T38 A;  3ZMS A;  2FF4 A;  5IT9 Z;  2QBY A;  4ZZD A;  4A0X A;  2DU9 A;  3GVA A;  2O8X A;  3WGH A;  1ONV A;  2HQN A;  1SFX A;  5DCM B;  2JRT A;  3ZN0 A;  2BE5 F;  3K1M A;  3RYP A;  1FBU A;  1FC3 A;  2GXB A;  3REO A;  4M6Y A;  3H3U A;  2HS5 A;  3SQN A;  4P9F A;  2A68 F;  4HF1 A;  2DQR A;  2UXX A;  3C18 A;  3T5X A;  1LDK B;  2CQK A;  3J81 K;  4HV6 A;  4LB5 A;  5E18 F;  1IN8 A;  3JTG A;  2K4B A;  3W6J B;  3KZZ A;  5AIQ A;  1ON1 A;  1FSE A;  1MJA A;  4XRF A;  3QP6 A;  5E1Z B;  2L02 A;  1YW7 A;  1HBX G;  5CJ9 A;  5DD8 A;  3HRT A;  1SD4 A;  3S2W A;  1R00 A;  1C0W A;  1W7P B;  3J81 Z;  4EJU A;  2LNB A;  2CSO A;  4AIH A;  2FQ3 A;  1BI2 A;  3WTV C;  2FBH A;  4RB0 A;  1U5T C;  3RKY A;  2EJR A;  5H20 A;  5D5X B;  4P5O A;  2ZNY A;  1O57 A;  5CYV A;  2ADU A;  4KMU X;  1TTY A;  1T0F A;  4QLC U;  2VT2 A;  1UB9 A;  2CYY A;  1PDN C;  1XSX A;  3AAF A;  4PGH A;  4UHT A;  4B8X A;  5BS6 A;  1XSD A;  1UHM A;  1LB2 A;  2WTE A;  1Z05 A;  1XGS A;  4WK8 F;  4L9V A;  4HLY A;  1HST A;  5FB2 A;  3RPQ A;  4KIF A;  4IF4 A;  2IVM A;  2IPQ X;  1P6R A;  4KFC A;  1YS7 A;  2HZT A;  1QO0 D;  1HQC A;  5E20 A;  3R0J A;  2LDU A;  2OQG A;  2FA5 A;  3KP2 A;  4Q48 A;  2DBB A;  1J0R A;  3CO6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...