1YRNA

Crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
49
structure length
49
Chain Sequence
b'ISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*TP*AP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 20
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1995-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1yrnA00
5M3MJ 4XICA 4BBRJ 4A3MJ 1IDYA 4M3EA 2MG4A 1JTYA 3ZQCA 1D5YA 2COBA 4JP0A 2H1KA 1TWCJ 3FIWA 2JA6J 3RZDJ 3SDGA 2DA7A 2X6OA 3NAUA 3HM5A 1U8BA 5DS9A 2LVSA 3BR0A 3G1MA 1FIPA 1FEXA 1MSEC 1NK3P 1T56A 2YUSA 1MBKA 3UKGA 2DMQA 4IHWA 3ZQFA 2FQ4A 2JA5J 3SJMA 4BXXJ 3D1NI 1B8IB 3GBGA 2EH3A 2O7OA 3FKIJ 4D5FA 1ZKGA 4MFEA 4S0HB 2HI3A 3GTOJ 2EBIA 3VPRA 1UG2A 1GT0C 1F43A 2NVTJ 5EGOA 2LLKA 2DTZA 4I76A 1JT0A 3BTLA 2E1OA 1DU6A 2CU7A 1JJ6C 3PO3J 3S1RJ 1X58A 1OJLA 2EZHA 1APLC 3G1OA 2GLOA 1K83J 4BY7J 5J1RA 1SANA 2DN0A 5EG0A 1IGNA 3OSFA 1GV5A 2XSDC 4A3EJ 2P81A 4LOCA 5FKKA 1TWHJ 2M9HA 3CQZJ 1ORKA 3S2HJ 2RAEA 4DZPA 3W6VA 2DMTA 5F0FA 4JX6A 4BY1J 2DA5A 1OCPA 3OSGA 4A3GJ 3BTCA 1BW5A 2K9NA 1ITYA 4D5CA 2VKEA 5EGOB 4DZJA 3HOWJ 2Y9ZA 1TWAJ 3BTJA 2KT0A 1ETQA 3CMYA 3BTIA 3HOYJ 1HLVA 1P7JA 4XK4A 2G0EA 3TEDA 2DMPA 1ZQ3P 1FTTA 5EG0B 5EZHA 5IYBJ 2WB1N 1ETWA 3BR1A 2CRGA 3GTGJ 1ZR4A 4FISA 1RESA 1F36A 2JA8J 4D7MA 4XRSA 3OIOA 2DA3A 4MLOA 2LD5A 5EYRA 3I4NJ 3HGYA 2HOTA 3MKLA 3MN2A 4A3KJ 1NTCA 1DU0A 1P7IA 2B63J 1GUUA 5M3FJ 1BL0A 4JYKA 3TW7A 3HOXJ 2XB5A 1T33A 3S1MJ 2ELKA 1WGXA 5E3MA 3Q0UA 1K61A 2IBDA 3HOUJ 1Q1VA 2O9LA 2W48A 4C2MJ 1XG1A 4M3GA 1FJLA 2QCOA 2LP0A 2OPTA 1YRNA 1JGGA 1R9TJ 2Y9YA 1ETKA 2K40A 5J1UA 1JT6A 1WH7A 3S15J 3NARA 2IEKA 1IRZA 2E19A 1LFUP 4B4CA 3JRDA 5C44J 3RKQA 4JX4A 3BQYA 2KDZA 3DEWA 2DJNA 2DA4A 4B3AA 3ZQIA 4DYRA 5EF6A 1X2MA 1MBFA 3QQAA 2AO9A 2EZIA 1RKWA 2MSYA 1QVUA 2XPUA 3B6AA 1ETOA 3IH4A 5M5XJ 5EDNA 3CCYA 2TRTA 5GP9A 3QPLA 4XIDA 3JRAA 4A3JJ 3GTMJ 2DMUA 2EQRA 3BT9A 1POGA 2CJJA 2XGDA 2R92J 1RPWA 3RQIA 3TP0A 1YRNB 4AC0A 2E2IJ 3Q0WA 2CUEA 1RKTA 2TCTA 4UUTA 2E2JJ 5E3LA 1ETXA 3O8GA 2E2HJ 1HDPA 5IP6A 2I10A 3JRIA 1H89C 2K9SA 3ZQHA 1IC8A 3F0CA 4M3DA 1VF9A 2HXIA 2ME6A 4DYQA 5F04A 2R5YA 3HDDA 4QIWN 2JA7J 2JJ7A 2LR8A 4V2GA 1QVTA 4FTHA 2M8GX 1VFCA 3S16J 3BR2A 4XRMA 5IYCJ 3JR9A 2FX0A 5FKNA 4IEJA 2JN6A 1ETYA 1CQTA 3M4OJ 2X9DA 1LE8A 3H3VK 1FIAA 2LK2A 3OOUA 3L1PA 1VI0A 5FKLA 4DYCA 1H88C 2ECBA 4MFDA 1H8AC 2NS7A 3ZQLA 2QF7A 4XRSG 3A01A 3BQZA 5F0CA 2HDDA 1JTXA 2NVXJ 3G1LA 1HF0A 2L7ZA 2N8GA 2Y31A 2WAQN 3BG5A 2Y2ZA 2GBYA 2R5YB 1ZK8A 2MW8A 1RETA 1WPKA 3HGGA 4W1UA 1JJ8C 3WHCA 2R0QC 5JLWA 1ETVA 1SFOJ 1I3QJ 1MBEA 1MBHA 2K9QA 2LFBA 2VKVA 4MIMA 1LE8B 2GM4A 2FJ1A 1I6HJ 1JKOC 3PO2J 5IOZA 1ZR2A 3GTJJ 2O8KA 5K7HA 1S7EA 3A01B 2ID6A 4A3IJ 4A3BJ 2M2EA 5C4XJ 1MBGA 1U9OA 4CYCA 2R5ZA 2JWTA 5M5YJ 2CQXA 2XPVA 3JRHA 4A3DJ 2JK3A 2LY9A 1BA5A 1GVDA 2XRLA 1E3OC 4A69C 5E3OA 3S1NJ 3RZOJ 2CQQA 4A3LJ 3FISA 1O4XA 5EEAA 2HOSA 2VI6A 1PUFA 2DA1A 2R7ZJ 3S1QJ 3FK7A 4M6VA 4FCYA 2L0KA 1QPIA 3H0GJ 4A3CJ 4C3JJ 1JUPA 1IV6A 2OF7A 2VUMJ 4G12A 3O8HA 2R93J 4CYCB 2R5ZB 3HKZN 2L9RA 3A03A 4HNVA 1JUSA 3FK6A 2D5VA 1A5JA 1MH3A 1BW6A 1ENHA 1B72A 4Y52J 4D7NA 1TC3C 5J1YA 4BBSJ 1MH4A 2NOGA 4A3FJ 4AYBN 5HODA 1OCTC 3LOCA 1JUMA 5C3EJ 3C2BA 4I6ZA 1EF4A 1HOMA 1U9NA 1JKRC 2NVQJ 2XB0X 4UUSA 2EZKA 1G2HA 4FE7A 1AKHA 5IOYA 2NS8A 2L7FP 3HOZJ 3QPSA 3PM1A 3GTPJ 3IV5A 2IAIA 2AHQA 3BG9A 1XS9A 4M3FA 3GTQJ 3JRGA 3JRBA 5EZGA 1AU7A 2HQ5A 1A6IA 3ZQGA 3S2DJ 1B72B 3K7AJ 1WI3A 2LTPA 3LSRA 3BG3A 1UMQA 4QSHA 1LFBA 3HEFA 1UHSA 2M34A 4UUSB 2ME0A 1VNDA 3JRCA 5IP7J 4RDUA 1AKHB 3S17J 4W97A 5JLXA 1BJZA 5GPAA 4BKXA 3WHBA 1HCRA 1WH5A 1IUFA 2ECCA 4FE4A 3GTKJ 4B1RA 5F27A 2XPWA 2DMNA 3S14J 2XGEA 4C3IJ 1I50J 3DCFA 1MNMC 3LNQA 4JX5A 2NVYJ 1IJWC 2MGQA 4IHYA 4C3HJ 2HOAA 4AUXA 4X1EA 5FLVA 2DA2A 4A93J 3LSPA 3IH3A 1XC5A 2EZLA 3JRFA 2HXOA 5DTDA 3B6CA 1IG7A 4RBOA 1MSFC 5K7ZA 1W0TA 3BR5A 4L5EA 1Y1WJ 5J3LA 2ID3A 1HDDC 2ZB9A 1MBJA 1U78A 2PMZN 3Q3SA 2M0CA 1TWFJ 2VPRA 1TWGJ 1OFCX 4X6AJ 1JKPC 5FJ8J 4J19A 5IYDJ 5GPCA 5M5WJ 3GTLJ 5C4JJ 2Y0SN 1ZTRA 2YS9A 3BR3A 5FLMJ 4DW6A 4QTRA 4IHXA 2DA6A 3TP3A 3Q0VA 3LSGA 1IDZA 4V2FA 3K2AA 2JMWA 3CDLA 9ANTA 2CUFA 3BR6A 3LSJA 5F08A 4Y7NJ 3SFIA 5IPAA 1AHDP 2XGCA 2Y30A 4M3BA 1W0UA 3E7LA 1GV2A 3TW6A 5F1JA 3A02A 1RR7A 1FTZA 3I4MJ 1ZGWA 5K7FA 1Z77A 4NDLA 5E3NA 5FKMA 4IHVA 5F0HA 3MVPA 4GFBA 3HOVJ 4MO7A 3HBLA 2X48A 1Y1VJ 1X2NA 2LKXA 2FD5A 1QRYA 4ABZA 2L7MP 2WV1A 4EEFG 1PUFB 3HB9A 5BNGA 2H8RA 3M3YJ 3ZOBA 1GDTA 5FKOA 2HYJA 1Z0XA 1B8IA 3IH2A 1NK2P 5IP9J 1JKQC 3JREA 2YU9J 1WCMJ
chains in the Genus database with same CATH superfamily
5M3MJ 4PGGA 4BBRJ 2NAZA 3I54A 1LDKB 3F6OA 4M3EA 2HFHA 4NB5A 1LEBA 1V5GA 2P6TA 5DCFA 3DLLF 4OAZA 4G7HF 2JA6J 3F8FA 3NAUA 2Q8KA 5CJ9A 4ON0A 1TTYA 5JHUA 3BR0A 4G7ZF 1K6YA 3RI4A 2M7BA 1DP3A 2E1CA 1NK3P 2KIMA 1G3YA 4E7HA 3CC7I 2YUSA 1BC7C 1U5TB 2E5ZA 1IN5A 4BXXJ 3EUHC 1YW7A 3GBGA 2EH3A 3F9KA 1Z6RA 1KYWA 3FKIJ 4D5FA 2A61A 1FYLA 1XDSA 1ZKGA 3H3ZA 2A6EF 1HA8A 5E8IA 3U21A 3VPRA 1UG2A 4YIFA 2NVTJ 5EGOA 1SFKA 4ZJZA 4I76A 1WRJA 5HLGA 1FLIA 1KONA 2E1OA 2GAUA 3BTLA 2CU7A 2IS4A 2GQQA 4E70A 2EZHA 4U88A 3D0SA 3EETA 1RC9A 4KA4A 3ECHA 2QYOA 4N4OB 4UVCA 3ISPA 2XSDC 1BOBA 2BVLA 3L2VA 3OYDA 2RN7A 2P81A 4HF2A 1X1BA 2QLZA 1TWHJ 2W85A 5BS6A 2YX7A 4IPAA 3CQZJ 4LG0B 1ORKA 3EDPA 3S2HJ 2JSPA 2L2OA 2XAJA 2AQFA 4KIFA 2UV1A 4BY1J 2DA5A 1MJAA 2IPQX 5LEKA 5J8FA 1HBXG 4A3GJ 1A35A 1BW5A 3DBHB 1J0RA 4HSRA 2K9NA 4D5CA 3DWLE 3HRUA 4EM0B 1FY7A 3IKVA 1RUNA 3K9TA 2CUJA 4DZJA 4KIBA 2QA4I 3OYIA 3S2WA 4OMYA 2K4BA 2R7VA 2OBPA 2ZJRF 2RREA 1EA3A 3OWTA 3TEDA 2DMPA 5EG0B 2IGMA 3PUFA 5EZHA 3V8JA 1E17A 3SFZA 1DPRA 3KEOA 4BEHA 3BWGA 4PK4A 5EJCA 2CV1A 3A4CA 1RESA 1D8KA 1F36A 4HNUA 4XRSA 2DA3A 2LDUA 3QYBA 1KA8A 3H92A 2DT7B 4IQJA 2GZWA 4Y4RA 3ZQ7A 3MKWB 1T2KA 5M3FJ 1QHGA 1U2WA 4GDFA 3NWSA 4U7DA 2R7OA 2XB5A 3S1MJ 2ELKA 3K2ZA 3KP4A 4IJAA 3TDUC 1K61A 3Q0UA 4PSXA 3L09A 5CVRA 1Q1VA 3K4JA 3RKYA 2QKMB 4M3GA 1V5EA 1YIOA 1WQ2A 3OL3A 1YRNA 1ETKA 3ERED 5J1UA 2IRFG 1JT6A 4RAFA 3DTEA 3NARA 1IRZA 4GRIA 5IT9K 1UCRA 3ZPLA 3JRDA 4Y17A 2V1XA 3RKQA 1PP7U 4JX4A 3BQYA 1YI2I 4BL0B 1W7PB 3VB2A 1RNLA 2DA4A 4BHBA 3DEUA 5FFZA 1DQUA 1Z7LA 1X2MA 4XONA 4HOBA 1GVJA 2P7CB 1RKWA 1RIOH 2KPMA 1OYIA 4XIDA 3QPLA 3GTMJ 4RGXA 3BT9A 3HRTA 1POGA 1QU3A 3CCSI 1BR2A 3R60A 2DOAA 5DEQA 3RQIA 1OPCA 4L9NA 2IS6A 4ETSA 2GOXB 2E2JJ 4I0BA 5E3LA 2FMYA 1VTNC 1ZLKA 4LIUA 1TBXA 2E7WA 4KDPA 5ICCA 2RC4A 4BDZA 4HA8A 2FRHA 3UNGC 4EATA 3D5RC 3L9FA 3WE3A 1IC8A 2ZO4A 4WK8F 1VF9A 3GVAA 3AG2H 3IL2A 2ME6A 4DYQA 4PSWA 2R5YA 1K7AA 4QIWN 2JA7J 5E17F 2JJ7A 2LR8A 5K5OA 4NNJA 3S16J 2O8XA 1Y8QB 4P55A 3PSFA 4CCOA 2IXSA 2J5OA 3CP2A 3IHUA 4O3MA 1MZBA 1ZREA 3BZKA 1U5TC 4II3A 2X9DA 4BJ6C 3NQOA 1FIAA 3OOUA 1VI0A 2ECBA 3LSKA 4MFDA 1H8AC 3CP8A 3ZQLA 1IXCA 1USSA 3A01A 5F0CA 2XAGA 4A0XA 2PMHA 4CCMA 3RYRA 3Q9SA 1HF0A 4YIRX 2HKXA 4L18B 2L3DA 4CCJA 1WVRA 1WPKA 2BBYA 3HGGA 3MD2A 3K4NA 1JJ8C 3WHCA 3BJOA 2BHYA 3M9AA 1WFXA 1C0WA 4F7ZA 2F48A 1BI0A 2VKVA 4U7BA 5D4SA 5L3BA 2GM4A 1Z9CA 1JHHA 2FJ1A 3MWMA 1I6HJ 3SZTA 1JKOC 1DGRM 1MGTA 4BQAA 4WXHA 3QP6A 5HS8A 4A3IJ 2RQQA 3I71A 1OMIA 3CC2I 3GFMA 2X1EA 2ZJQF 2EPFA 1YS7A 4MNUA 1X4PA 1AOYA 4IF4A 2R5ZA 2JWTA 2E34A 3G4SI 1T0FA 3TL4X 4RA2A 4XSXF 4A3DJ 3KZIC 1VQLI 2DJIA 3FHZA 2H27A 2XRLA 2FEZA 2VODA 1L0OC 5E3OA 3RZOJ 4A3LJ 2M0MA 3FISA 2PJRB 1QNTA 2EV5A 3CCLI 1PUFA 2DA1A 2R7ZJ 3S1QJ 3FK7A 4FCYA 4HV6A 4E4HA 2LKPA 5HLHA 1YITI 2L0KA 1QPIA 4A3CJ 1K79A 3HYIA 4CZZA 1XSDA 4XKVA 4MHGA 3FMQA 4H0EA 4KMUX 5LRRA 4B3XA 3K1NA 2EWNA 3E97A 1R71A 3IRQA 2W84A 2XDVA 4E6KG 4PGHA 4HAMA 2D5VA 1A5JA 1MH3A 1OCOH 2KLOA 2VBWA 4BS9A 1IF1A 3I55I 1TC3C 4XN0A 5LGNA 4A3FJ 2H6CA 1FMVA 4AYBN 1OCTC 3ZRGA 1Z6TA 4I6ZA 4E7IA 1EF4A 1FNNA 4P1WA 1U9NA 1HOMA 3CESA 3MCZA 1T08B 2EZKA 3HHHA 5IOYA 2MC4A 3HOZJ 1Y0UA 3QPSA 5JVGF 2R7XA 3PM1A 2QSGX 3IV5A 3RKWA 2M5WA 4XBFA 3TGNA 2IAIA 3F72A 2VKHA 2KZVA 2KRFA 2IGOA 4Q47A 3GXOA 5HNHA 1AU7A 2I8DA 2IA1A 2HQ5A 3W2VA 5HLTA 3HIFA 4JQFA 5GTHC 3K7AJ 3KZZA 3LSTA 3V4GA 2XC7A 1J59A 3U1DA 3E1SA 1WJDA 1ZGAA 1VQ5I 3CJNA 3ZMZA 3IC7A 2BZTA 2M8EA 3CCRI 5DDGA 2RDPA 3OYHA 1YG2A 4KMFA 4E7SA 3JRCA 3KPHA 1AKHB 3T0YA 1TQPA 1OCZH 5GPAA 1QZEA 3ABLH 1HW5A 2ECCA 3REOA 1OKRA 3ZN0A 3KYLA 2FOKA 5F27A 5GAGJ 5DD4A 2DMNA 3W6KB 3H9JA 3KYCB 3Q9VA 2DBBA 4AIDA 2FUG2 3OL4A 4QPQA 3CCMI 3F23A 3QWLA 4C3IJ 1MNMC 1D1AA 2NVYJ 4IVNA 3HJEA 3WODF 3MZHA 2VJ4A 1IJWC 4U0VA 4AUXA 3LA2A 3E6MA 5FLVA 3LA3A 4LMYA 3V8LA 5GAEJ 2RGVA 1TQMA 3VYTB 4P9FA 4EV0A 3LSPA 4HF1A 5CVIA 1Y0NA 2EZLA 3QPTA 1UHMA 4TV7A 5HDNA 3LA7A 2ZNYA 3I0TA 1LPQA 2A3SA 3S32A 2CH0A 1MSFC 2X1CA 3RPUA 3LMMA 1FC3A 3QOPA 3TO9A 1Y1WJ 2EFOA 1MBJA 4I0AA 3Q3SA 1XSVA 5J8CA 4AVPA 4CO8A 3M1EA 4X6AJ 4U87A 2LOOA 1YJWI 4EJUA 5LGTA 2W25A 5FRMA 1SD7A 5GPCA 3HRSA 2NRAC 4E7KA 5C4JJ 1ZTRA 4C2TA 3TO7A 2E5NA 2DA6A 3GFJA 3LSGA 5FGMA 2PBIA 2R4GA 1XN7A 4LJZF 4PUSA 3CMEI 3ZMSA 2FBIA 2HVSA 3AG3H 3L00A 4GO1A 5ICEA 2XKOA 2NOJB 1B9MA 3K0LA 2Y30A 1KQ0A 2F6CA 3E5QA 1GV2A 3A02A 2PEXA 3I4MJ 1IZ1A 1IRGA 3F8NA 1SVLA 4IHVA 4Y3OA 2XAHA 4GFBA 2R7RA 3OS1A 1BI2A 1NH3A 2QQ9A 3HBLA 4UV8A 2PN6A 3OYFA 2ZMEB 2V1UA 2ZSHB 1E3HA 4XOTA 4HQEA 2FD5A 4LLLA 2QUFA 6PAXA 4EEFG 3CCEI 2O61A 4HDVA 3M8FA 3HB9A 4M9SA 2WC2A 3HOSA 3DKYA 2D1VA 1X1AA 4R1HA 3DBLB 3BZ6A 2EINH 2RNJA 4BGDA 2TDXA 1F5TA 1Z0XA 2Z33A 1NK2P 2VQCA 1JKQC 1ZN2A 1T38A 2K3PA 2WADA 3U9GA 3LFKA 1ZAOA 3TBIA 3CMMA 2BY1A 1Q1HA 2KJCA 2KIFA 1SD5A 1IDYA 1LDDA 2MG4A 2W24A 1D5YA 3CCUI 2ZFWA 5DM7F 2H1KA 2ELJA 1T6SA 3LSIA 3RZDJ 2DA7A 2X6OA 5L3DA 4OINF 2ADUA 2HEOA 4HW0A 1YO5C 2PG4A 3FM5A 2OD5A 3CCQI 3GFLA 2HVRA 1S7OA 3WTUC 1MSEC 3I58A 4MQ9F 2KDOA 1T56A 2ZXWH 5ERIA 1MBKA 3SEZA 3UKGA 5LGUA 1LEAA 2G9WA 4OWRB 4CH7A 3WG9A 1ON1A 1B8IB 5DCMB 3Q5FA 3IAS2 4DGWB 2V4JC 1R36A 2DPUA 4G9YA 2DI3A 3H5RA 2OA4A 4B09A 4HDUA 2OU2A 1A36A 2JRTA 3PIOF 3LAPA 3DV8A 3GCMA 3HTSB 1DU6A 3MZYA 2L9NA 1JJ6C 5FROA 3S1RJ 1X58A 1A31A 4G6QA 1GLNA 1APLC 3ESWB 3G1OA 2VE9A 2GLOA 3LSMA 1BC8C 1SANA 1IGNA 3DQVC 4KITB 3OSFA 2GXAA 1XMKA 1V5FA 1TNTA 4YELA 4LOCA 1ZYRF 4KICA 5FKKA 4M74A 2MABA 2M9HA 2VQGA 3OYMA 4UUVA 3T5XA 1HSTA 4MQVA 2DMTA 2L9SA 5FO5A 5F0FA 2CUZA 3OSGA 2WAFA 3BTCA 3NWTA 2MC3A 4A12A 1FZPB 1ITYA 2LC2A 5E20A 5AIQA 1SVMA 5HS7A 5EGOB 3HOWJ 4XLPF 2OQRA 5BMZA 1TWAJ 2VC0A 2IA0A 2OV7A 3CMYA 2ZJ2A 3BG7A 3BTIA 4ZYGA 3HOYJ 4U0YA 4G94A 4XORA 1O3QA 3DU5A 5ICFA 2VC1A 4B47A 1XCBA 4KN7X 3PQKA 3FM3A 5KAIC 1T98A 3C1DA 1ETWA 2JVHA 2VB6A 3BR1A 2F5VA 2QSHX 2EA2A 3HOTA 1Y56A 1Z05A 2R7TA 4D7MA 3OIOA 1EJ9A 1Y8RB 4M9ZA 4DIQA 2LD5A 1U3EM 4I09A 1YOVB 1W5CC 3MKLA 5HLIA 2QQBA 2DXIA 2JRMA 3ZCOA 1UFMA 1W36D 3VWBA 4V19K 1ACIA 2QEXI 3HOXJ 4KIGA 2PJPA 4XNFA 5ED4A 3BOQA 5E3MA 1K6OA 3GLLA 3HPHA 2L9VA 2UUZA 4M6YA 4A5NA 2O9LA 4C2MJ 1XG1A 1FJLA 1I3AA 2QCOA 4D0PA 2LP0A 2OPTA 2LBFA 3CUOA 2MLGA 2Y9YA 2K40A 1QGPA 5KNLA 3BP8A 4RAGA 4KISA 1WH7A 1EV7A 5H20A 2Y75A 2E19A 4BEHB 4YG2F 4NC8A 5C44J 3EUAA 2IGKA 1ZHFA 2KL4A 3C2HA 1MMDA 3BCAA 2CV2A 1XGOA 3VSKA 2DU9A 1B6AA 4DYRA 1MBFA 1XCVA 1V54H 4LIVA 2EILH 2ZMEC 1B59A 2X0LA 3B6AA 2MSYA 1MMAA 5L3FA 1ETOA 2O03A 1SMYF 5EDNA 3CCYA 4XM3A 1KQ9A 2HU9A 3A0BC 5GP9A 3ZMVA 3JRAA 2HZTA 1A6QA 2XGDA 5FRNA 1RPWA 2D45A 1L3LA 1QQIA 1Z3YA 1YRNB 2E2IJ 3FXKA 3H9GA 3Q0WA 2Y69H 1RKTA 2A68F 2E1MC 3K4KA 4BE1A 2H6BA 1KYZA 1FWZA 1HW1A 2JUGA 5TGTA 3SZPA 2X6YA 1LJ9A 3ZQHA 3BC8A 3F0CA 2Z2SB 4M3DA 1R1VA 2JTVA 3CJQB 1OCRH 5D5WB 1P92A 2M30A 2VJ5A 5F04A 3QAHA 3HDDA 4UHTA 1QVTA 3FMRA 4FTHA 5ILVA 1IV8A 5IYCJ 3JR9A 3ZQQA 2Z9OA 5LHIA 3WTWC 3HC7A 2JPBA 1S8NA 3RDIA 2JN6A 1QO0D 3FXUA 5DV5A 3DLAA 4O5VA 1YTYA 4UVBA 2FSWA 4DYCA 2YX4A 1O3SA 5E1ZB 1H88C 3ROUA 2OUMA 4EQQA 2NS7A 2QF7A 3BY6A 3FZVA 4HZFA 3BQZA 2KQRA 4XRSG 1H0MA 3CJTB 2R7SA 1JTXA 4HLYA 2CV0A 1UG0A 1SFXA 3TDZC 2R7FA 3H5AA 2FMLA 3IAM2 5CKTA 2WAQN 1YJ9I 3BG5A 4BQOA 2Z5UA 4F52A 4HV5A 2GXGA 2R5YB 3GW2A 2BHZA 2MW8A 1HXDA 1RETA 3O6BB 4DOZA 5BPIA 4ZYDA 2P8TA 1WJFA 2YSRA 2R0QC 3KIOA 2F5FA 1I3QJ 1U6GA 2B9SA 2VQHA 1MBHA 3BDDA 4UB6C 2K9QA 1MJ9A 2FNAA 2LFBA 3HUGA 2ETHA 3ABMH 3DKWA 1S6LA 2A6TA 2WAEA 3JTHA 2DAOA 2BW3A 1MMNA 2AXLA 1D1BA 4A2UA 4IOCF 5D5VB 5IOZA 3PO2J 3KX2A 1IAWA 1WHUA 2C6YA 2O8KA 3A01B 2ID6A 3FHNA 2QGUA 2M2EA 2P7VB 3FF5A 5EEHA 1U9OA 1X1DA 5M5YJ 3JRHA 4LB5A 2FU4A 2Q0OA 3CZ6A 3PQJA 3TOAA 4L0ZB 2Z99A 3K1MA 5FD6A 2CQQA 1OYWA 5EEAA 1I1SA 5JHFA 2V1NA 3QU6A 1BR1A 2VI6A 1X1CA 1NG7A 2MH9A 1HKQA 4BHCA 5JVTA 4ZDOA 3P7NA 2MBFA 1T39A 3H0GJ 3GZNB 1FOYA 4P5OA 4Y33A 5FLXZ 1V3FA 4XLNF 4IX7A 2O3FA 2COMA 2R5ZB 3WTTC 3V8KA 3O2PE 2OTJI 2M3AA 4NQWA 4OIPF 5DUKA 3FMSA 1F4KA 2UZKA 1BW6A 1QZYA 2BXZA 4GYGA 4D7NA 1MH4A 2NOGA 3BJ6A 3I4PA 2XHKA 4ZH4F 2CO5A 3LOCA 4GYIA 2NVUB 3C2BA 1P4AA 3ONQA 1IRFA 1JKRC 2L01A 4XKBA 4DJAA 1G3TA 1IUYA 2FBKA 1G2HA 1XTAA 4U0WA 2WBMA 2L7FP 3KEYA 2EIJH 4XLAA 2D2WA 3TOBA 5LRSA 4P96A 3HL2A 3J81Z 1W1WE 2AHQA 1XS9A 3KP5A 1U0JA 3OYGA 3JRBA 5EZGA 5J40A 2DFIA 3WTSC 1O7LA 2EJRA 3ZQGA 3CC4I 5F6FA 4Y15A 1TLHB 1YS6A 3J7ZI 1GXPA 1LFPA 3H9QA 3HPGA 3HHGA 1LFBA 2ZXHA 3HEFA 4S05A 3OS2A 3DPTA 3MMYB 1KU7A 1UHSA 2KJBA 2M34A 1VNDA 3AL0B 3L7WA 4W97A 4LG0A 1FSEA 3GF2A 3J7AO 4G6DA 4OOIA 3WHBA 4AU7A 2LF7A 5LEJA 3VSLA 4IKFA 1WH5A 3WU0A 2IJLA 3OYCA 4B1RA 3FXOA 1TW3A 5B5EC 1G8XA 3LAJA 2XPWA 1VQPI 4MEYF 2K86A 3C3WA 3OYKA 1O7FA 4QPOA 4GXOA 1XMXA 2JPCA 1USTA 3PSIA 1R23A 3DCFA 4B44A 1R22A 4HYEA 1YQAA 3LNQA 3R6SA 1BR4A 1FP2A 3GZ5A 4C3HJ 2HOAA 5FFXA 3S3OA 3L2QA 1D0YA 1XC5A 2G7UA 2HXOA 2KMUA 2BV6A 2V9KA 5CPRB 3AG1H 3OYNA 4RBOA 1MDMA 1FOWA 4FQGA 4NBQA 4UXNA 2NXNB 3SXYA 1YLFA 4LD5A 2ZB9A 1AWCA 4LGWA 5CQGA 5ILSA 4N0BA 4UY8I 3S93A 2M0CA 2W82A 1ZARA 3VDXA 1FOXA 2ZJPF 4HX8A 4B48A 1JKPC 2HWVA 1XMAA 5FJ8J 4J19A 5IYDJ 5K1YA 1Z21A 2V9VA 2YS9A 1ULYA 5FLMJ 4DW6A 5LFAA 4G8XA 3Q0VA 1XX5A 3K2AA 4KN4X 1U8RA 4RB3C 4AVZA 2XGXA 3CDLA 3UR3C 3BJAA 1YW8A 1B1BA 2CUFA 2KRHA 3BR6A 1G4DA 5IT3A 2IP2A 3LSJA 5F08A 3FDYA 4WX9A 1YIJI 3R0JA 1AHDP 3VEPA 2DDAA 3WU2C 5DUIA 3TW6A 5F1JA 3L2WA 1ZGWA 1Z77A 4NDLA 1YE9A 2JSCA 5FKMA 4M71A 5F0HA 1IXRC 1DGWY 2UXXA 2AS5F 1FMWA 3DU6A 4MO7A 1BN5A 4OU0A 2RNGA 2M4GA 1X2NA 3LQQA 1QRYA 3MKYB 1GXQA 1IO2A 2X1DA 3V42A 2AQEA 2L7KA 5BNGA 2H8RA 3ZOBA 3IWZA 2JQ7A 5FKOA 1X3UA 5FLXK 1WJEA 4RM3A 3VOEA 2HYJA 4LLGF 5F64A 4PZJA 1W7PD 5IP9J 3JREA 1T0FC 1WCMJ 1PJRA 2ZBKA 3TMOA 4A3MJ 4BJ5C 2HYGD 2DFFA 3O3KA 3ZQCA 1CF7B 4JP0A 2MD0A 2DYRH 2GOMA 2WB1A 3QYEA 3FIWA 4BDYA 2HQRA 2KFDA 1EH6A 3SDGA 3WTXC 5CYVA 3G2BA 5DS9A 1UELB 3G1MA 2DDBA 3JSOA 1OLTA 5KVRA 5BOXA 2E1NA 4LITA 2LMDA 3MAJA 2QBYA 1EH8A 1KU3A 4CCNA 4P9UA 4ITVA 4I98B 4IHWA 4NUBA 4ZDLA 4I99C 2JA5J 4ENNA 1OR7A 3J81K 4Q4ZF 3ELKA 2BVMA 2ZKZA 2BXYA 3L2CA 4EMSA 2FXAA 4MFEA 1DP7P 4S0HB 2ZNZA 3COAC 3GTOJ 2HR3A 3AG4H 1T95A 5D6EA 1GT0C 1O57A 2XKPA 1F43A 4F3QA 2IA2A 3FBIB 3PNVA 2DTZA 3GMEA 1JT0A 2NYXA 1ODDA 4HNTA 1R00A 4EJWA 1R1UA 4OAYA 2W7NA 2V79A 1ONVA 2EV6A 1BI3A 1PVEA 3AL0C 2UWMA 3CDHA 3KP6A 2OTLI 3K10A 4R8HA 2ZXIA 4LFUA 1XDUA 3LSHA 3ASNH 1I5ZA 2NNNA 4CGZA 1P2FA 4DZPA 2HDCA 2M7AA 1WJ5A 1OCPA 2H1LA 4IRGA 3L2UA 4XL9A 3G6EI 2F4MB 4RLQA 3HSFA 4ENKA 2XAQA 1OQYA 5E1WA 2OZ6A 5D8LB 1SFUA 2PJRA 3GFIA 3ABUA 3PUBA 2VKEA 4KJZA 1R49A 2K3FA 5HVQC 2O5RA 1IN8A 1ETQA 2DODA 2VXZA 1HLVA 1H9TA 2KISA 4AM3A 1NHAA 1A04A 5B1AH 1IN4A 4EJOA 2LY1A 2OJED 1FTTA 1ZRCA 3A0HC 3PNTA 2W57A 1JI8A 4FHTA 4NC7A 1OISA 2WB1N 3E6CC 2E7XA 1Z91A 3RSNA 3WTZA 3GTGJ 1ZR4A 3RYPA 1HKSA 3ZMTA 1VQ8I 4C30A 5J4VA 4MLOA 1TW2A 4XR6A 5EYRA 3FX3A 3LFUA 3OYEA 5GTIC 3FXRA 2HOTA 3MN2A 5L3CA 1DU0A 1P7IA 1BL0A 2ZXJA 2XROA 3RTRA 3EUKL 3QU3A 2VIXA 2JZYA 4XSZF 2LSOA 3MKZA 1BI1A 1WGXA 3QOEA 3GZ6A 2XF7A 2W48A 3BG6A 1NG6A 1JGGA 3GUDA 3JW4A 1R9TJ 1J75A 4CZCA 5E18F 3EQLF 4IZZA 2GIZA 2HOEA 1X3ZB 1LFUP 1I39A 1WKMA 4IHSA 5HDGA 4KFCA 2E1MB 2BOLA 2KDZA 2WY7Q 3DEWA 1MIJA 1WJAA 1SAXA 5A2QZ 3M7GA 3IWFA 2EZIA 1QVUA 3IH4A 5M5XJ 4WF2A 4YFXF 3OS0A 2ZFUA 5D5XB 4A3JJ 2DMUA 2WA0A 2VBXA 2GA2A 1TP4A 2CJJA 1I6XA 2CQKA 4ESFA 4RAYA 4AC0A 2CUEA 5CVVA 2GA1A 1ETXA 2K4JA 5AIPA 2E2HJ 2RVCA 1D8JA 5KAFC 2H09A 3FXQA 4YFKF 4XLCA 5DM6F 1RZ4A 3R0AA 4L9TA 3JRIA 3JSPA 4ZTJA 1E3PA 1X1PA 2DQLA 3DP7A 3QYFA 1HC8A 4EVIA 2DT6A 4OIRF 3GO5A 4HPQA 4V2GA 4RGSA 1YYVA 2F4IA 4ZTFA 1G3WA 1VFCA 1MJBA 5LBQA 2OCCH 4XRMA 4GCVA 2KKOA 2VBZA 2KIQA 5FKNA 3HKZA 3TKYA 2EB7A 2X6WA 2BEOA 1ETYA 2JVGA 1CQTA 3ZXSA 2V1DA 1S9HA 2QENA 1LE8A 2XAFA 1B4AA 5FKLA 1JHFA 4F93B 1R5HA 2W1OA 5TRDA 1W5TA 2HDDA 1SMTA 3P9CA 3G1LA 1UJ8A 1WSUA 1J09A 2L7ZA 4II2A 2KZGA 2M1BA 3P5JA 1Z3XA 1BM9A 4A5MA 2VBYA 3OOPA 2NS0A 4IQ4A 3QPHA 4BE0A 1ZK8A 4PCQA 2VJIA 1YJNI 5HOOA 4W1UA 2ZSIB 1R6RA 2MA3A 1XGSA 2LYCA 1SFOJ 2IGNA 2A5WA 2VASA 1J7KA 4QLCU 5ILUA 4ESBA 3VFZA 3W3CA 2OCEA 2P4WA 3CCJI 4XKWA 3ZMUA 4OIQF 3CUQA 1PDNC 1MNEA 4XMYA 2V6CA 4BAYA 1S7EA 3WGHA 5K7HA 4HBLA 5FD5A 4A3BJ 2VQLA 5K5RA 4M72A 4IOAF 5C4XJ 3C2GA 3GEZA 1MBGA 4CYCA 2CQXA 2PX9A 4ANJA 5CLSA 3KE2A 3ZP5A 5HS9A 3ECOA 2XASA 2QQ8A 2LY9A 4G6TB 1GVDA 2V7FA 3HSRA 1O4XA 1J9IA 2HQAA 3P9IA 2MYSA 2HOSA 5KHDA 3DXJF 3M07A 3GWZA 3M1CA 1W4MA 1LB2A 2RKHA 3SHFA 3OR1C 2R7QA 1XPXA 2X51A 1S5LC 2P6SA 2OF7A 2VUMJ 4PJJA 2IS2A 3O8HA 2I5UA 3EUHA 3HG9A 1ZG3A 3A2KA 3HKZN 4EJVA 2KHMA 1WJBA 1SFEA 4Z2YA 1XGNA 4HNVA 1JUSA 3FK6A 1MW7A 1VQ9I 1HKTA 2MH2A 3ASOH 1B72A 2VXDA 3VYSB 4Y52J 5J1YA 1HSJA 1P4XA 5HDKA 3SDBA 4RMNA 2ICWG 3CO7C 3ULQB 5C3EJ 2CW7A 2PMZA 2FA5A 1Y6IA 2W00A 4O6JA 2Q2EA 1D1CA 4UUSA 3CDIA 2R7WA 3K6GA 1N77A 4XN3A 2VKDA 5FB2A 2V26A 2LRDA 1LKXA 1ERDA 1BIBA 4M9XA 3GTPJ 2DCEA 1STZA 1UZCA 1VQKI 4EGYA 2VLAA 2VT3A 5A2QK 4WWCA 3WTVC 4AIJA 3KLNA 4NQWB 2CGPA 5L3EA 3JRGA 4YIIA 3NEUA 1CGPA 4EM2A 3OIQA 1E2XA 1A6IA 1H9GA 1Z1DA 3E3VA 3S2DJ 1K78A 1PYVA 5BPDA 3HRMA 4BUPA 2KIUA 2FBHA 2CSOA 3LSRA 3MQ0A 3F21A 1UMQA 4QSHA 3JCUC 4E7ZA 3AKZA 4AIKA 3W2AA 2ME0A 5IP7J 4RDUA 3S17J 1PUEE 1F1ZA 4BKXA 3H3UA 1N78A 4RGUA 4CCKA 3IKTA 1HCRA 1IUFA 1FBUA 4FE4A 3KP2A 3H5NA 3WGIA 2FF4A 2Q1ZB 3CLQA 4JK1X 3L2RA 3S14J 2IS1A 3BZCA 3DPLC 4RLFA 4CHUA 2WV0A 2XIGA 4ESJA 4WCGA 1J5YA 1ZRFA 5D8KB 1Z7UA 3DTIA 3KCCA 4JX5A 1RI7A 1R7JA 2MGQA 4XLFA 1R58A 4X1EA 3M8JA 3IRRA 1BBYA 3PJRA 4A93J 5DTDA 3B6CA 1ZGJA 2MFZA 2XUBA 1IN7A 3DEEA 4PFOA 1X19A 3I59A 1W0TA 4L5EA 2FE3A 2J5PA 3GLXA 3K70D 2DO7A 4YEJA 1U78A 2PMZN 3J7YJ 2M87A 1LUJB 1BJAA 2VPRA 2CFOA 3FXMA 2VOOA 3K70C 1OFCX 2AXTC 4IO9F 4F91B 3H1CA 3TQNA 2JUCA 2EK5A 1TZLA 4ZYHA 3KEQA 4N4NB 3KFWX 3F8CA 5ICGA 3BR3A 3B02A 4L5JA 3JAMZ 4IHXA 3TP3A 2HTJA 2STTA 1IDZA 4M6XA 4V2FA 3G73A 1R5ID 2DYSH 2JMWA 3KZYA 5JFRA 5B66C 9ANTA 1ZG1A 4OIOF 1G3SA 3K69A 2QWWA 2IVMA 2PLYA 2ISYA 5IY5H 3CO6C 3AFHA 3I64A 1MDMB 2HPMA 4N9IA 3LQRA 4M3BA 2L4AA 1XB4A 4ZYAA 3WU1B 2L4MA 5E3NA 3A1YA 1KQ8A 3K1PA 1LVKA 5KK1A 4HEA2 4I02A 3LL7A 5J4YA 2HS5A 3HOVJ 4KT5C 4XRFA 2L7MP 1LNWA 1YX3A 1IXSB 2WV1A 5CVJA 2M4KA 3E6DA 2OZUA 1PUFB 2FOWA 3I53A 4E7JA 2ESHA 1GDTA 2BY3A 2XF6A 1U5TA 3WE2A 3F8BA 2XAUA 2K27A 4RB1A 4H4KC 2Y0MA 1JXSA 2UXNA 1LVAA 1RUOA 2YU9J 1WJCA 3VYUB 1O3TA 2KP6A 3FKJA 2M45A 4XICA 1VQ4I 5E1XA 4Z6YA 4E7LA 1S7AA 1JTYA 2HQNA 1FYKA 2COBA 3CLOA 1TWCJ 2Z3YA 3HM5A 1U8BA 3BPXA 2GXBA 4XKCA 2LVSA 3PL8A 4D1QA 2PMUA 3EYYA 4A6EA 2VPLA 1XGMA 3K4BA 1OYYA 1FIPA 1M1EB 1FEXA 2B0LA 4FASD 4PJMA 2CS3A 3BLYA 2IT0A 3OMYA 2STWA 1TT5B 1ZH5A 2DMQA 2YPRA 3DBRB 1D0ZA 3ZQFA 2FQ4A 4WXDA 5H6RA 3SJMA 4IHTA 1JGSA 3B73A 3OR2C 4L5IA 3D1NI 3WG7H 2K85A 2X85A 2O7OA 2R7DA 4BACA 4PJNA 4ZDPA 4J00A 1TNSA 3P9KA 1BOAA 2K02A 3N97A 2A5YB 2HI3A 1ZELA 1SD6A 2EBIA 4QWQA 2O0YA 4JBAA 4BXFA 1J2XA 5EEGA 1ZLJA 2LLKA 2DOEA 1VQOI 4CCLA 2R3SA 3RJPA 3OYBA 3PO3J 3KETA 1OJLA 5KCMA 1VQ7I 1K83J 4BY7J 5J1RA 2DN0A 5EG0A 1P6RA 2HYFA 3ML6A 1GV5A 2KRCA 3S8PA 2QBYB 5D5UB 4A3EJ 3I3LA 4AYBA 3N4MA 4RM2A 4UB8C 3ZMDA 3HZJA 3I5UA 3QRFF 2K9MA 2RAEA 4S04A 4UVAA 3SYTA 1MKMA 4IL6C 3W6VA 2YU3A 1SVOA 4JX6A 3PFYA 1YFHA 5H6QA 2BE5F 3NRVA 2F4OB 2Y9ZA 4A6DA 2B7EA 3BTJA 3C7JA 4UV9A 2KT0A 2DQRA 1P7JA 2QM3A 2CW0F 4IRHA 2G0EA 4XK4A 4CXFA 1IN6A 3F22A 1ZQ3P 2DW4A 3F6VA 3N05A 1N25A 5E8GA 2O6GE 5IYBJ 4LK1F 1MMGA 4RGRA 1R5GA 4BE2A 4ZC3A 1QZZA 3SZGA 1X4OA 2CRGA 2DLLA 2DOFA 3I9V2 3ZR8X 4FISA 1QBJA 2JA8J 3I4NJ 3PIPF 1W7PA 5JI6A 3CF5F 1S72I 4MTEA 3HGYA 3J80Z 4G7OF 4A3KJ 1NTCA 4IXAA 2HDWA 3TO6A 2B63J 1GUUA 1TQIA 4DBRA 4Q48A 4JYKA 3TW7A 2G7HA 2XSJC 2RV8A 1T33A 2MD5A 2DK5A 3MEXA 3JAMK 4ENJA 1YX5A 1ON2A 3HOUJ 2IBDA 4FT8A 4HLXA 1F9NA 1LDJA 3RPQA 4C9YA 2BGCA 5LLQA 2XV4S 3S15J 2DFEA 3WGGA 3D5SC 2IEKA 4A0ZA 2E60A 4L9VA 4B4CA 2A6HF 2EV0A 2DFHA 4BHPA 3OIPA 2ELHA 4XLEA 2DJNA 3OYAA 4KUMA 2ACJA 4HRIA 4B3AA 3ZQIA 2LF8A 3PNYA 5EF6A 3QQAA 2F5CA 2AO9A 2X6XA 2XPUA 3G3ZA 3IP4B 4RAZA 4HSTA 2TRTA 1X3WB 5H2FC 3V7CA 3RCOA 2EQRA 5CVUA 3E6BA 2E35A 2LNBA 5HNFA 4ZZLA 3V7SA 2R92J 3BPVA 1D3YA 3FWEA 3U1KA 2VN2A 3TP0A 2K5CA 4ZZDA 5DYMA 2TCTA 2K9LA 4UUTA 3T1BA 3MFKA 3O8GA 1VQMI 4KT6A 1O3RA 1UHWA 1FP1D 4AWXB 4CDGA 1HDPA 1IRXA 2A05A 5IP6A 4CUGA 4OMZA 2I10A 3RKXA 3HXLA 2HZDA 2K9SA 1H89C 3EYIA 1TT0A 3RIRA 2BYVE 4HX4A 4LK0F 4B8XA 3ABTA 2JT1A 3DTKA 2HXIA 3E0JB 4HG2A 2VONA 3S3NA 4C2UA 1N75A 4XOPA 1EKEA 2L02A 1D5VA 2M8GX 2X4HA 3BR2A 1G59A 1ZG5A 3M8EA 3SQNA 2CQNA 2FX0A 2Y48A 2P5LC 4IEJA 5DD8A 3M4OJ 2LH9A 3IUOA 3H3VK 2LK2A 3L1PA 2BY0A 2F5EA 4ENMA 2MLKA 3U2RA 3SEQA 4XQFA 1MD0A 3OYLA 2NVXJ 2L5QA 4GGGA 2BY2A 4BNCA 2NNYA 2N8GA 1P4WA 5L3GA 2Y31A 2E71A 1EH7A 5F1RA 2EFPA 5B3SH 2CYYA 4IRIA 3KYDB 2Y2ZA 3K4MA 4JOMA 2GBYA 3WTYC 2JA2A 2VT2A 1R4NB 3ERMA 1FBSA 3K4LA 4HQMA 2CMPA 1IW7F 1UAAA 4CYDA 5JLWA 5K5QA 3CMAI 2FQ3A 1ETVA 2HPIA 3BCBA 3CD6I 1WZ2A 1MBEA 2VL8A 2ZCWA 2LKSA 3GX4X 4KYWA 2P5VA 2PQ8A 2LY2A 5GADJ 2F2EA 2A07F 4MIMA 1RR8C 1LE8B 2DT5A 1HQCA 1S3JA 4UNOA 1OR7C 2YR2A 3ZGKA 5LHHA 3ZN1A 1ZR2A 3GTJJ 1MMSA 1VZ0A 5BQTA 1AA7A 1FT9A 3R4KA 4N9HA 1XD7A 2LREA 2EFWA 1GHCA 2XPVA 1FX7A 4BQNA 1KU9A 4RB2C 2JK3A 4I01A 3H0DA 3K4CA 4BXUA 1BA5A 1E3OC 3S1NJ 4A69C 2HTSA 1HW2A 1FOKA 1B9NA 4L0YB 2H94A 1VQNI 5TJJA 1T8IA 2QQAA 4M6VA 4X0GA 4FX4A 1Z67A 2WY8Q 4NC6A 3JTGA 3HSEA 3F3XA 4HF0A 4A0YA 3CUQB 4C3JJ 1JUPA 5LHGA 1VQ6I 2OC6A 3RPUD 4FX0A 1IV6A 5AONA 4EGZA 4G12A 4YRVA 4FETA 1I27A 3CF2A 4BQQA 4CYCB 1FBQA 2GIVA 2R93J 1Y39A 3HTUA 3J80K 2L9RA 1CF7A 3A03A 2PI0A 2IW5A 4PDKA 4CSWA 3ABKH 2Z1DA 1YW9A 1ENHA 3CTAA 3RQ4A 1E0EA 1R1TA 2GWRA 4BBSJ 3BROA 5HODA 1K4SA 4CICA 1JUMA 3DFGA 2CG4A 1LQ1A 4RB0A 3T8TA 4BJTA 2E36A 2W4SA 2NVQJ 2F5DA 2XB0X 2LBFB 4FE7A 2WTEA 1AKHA 4XLHA 2NS8A 2EA4A 3C18A 2DPDA 1FPQA 3OY9A 2Y0SA 4WXCA 3BG9A 3E5XA 5TISC 3LWFA 4M3FA 2OAZA 3GTQJ 4BYYA 2CWEA 2ESNA 3X2QH 3R61A 2VJJA 3FXLA 3OYJA 1QA6A 1DDNA 4MGRA 4PJLA 4Q5SF 1XSXA 1B72B 2QKLB 2HKOA 3H36A 1WI3A 4BU2A 2LTPA 4BH9A 2WWYA 4EJTA 2Z16A 3BG3A 2LG4A 3T8RA 5CQEA 1YHQI 1QPMA 2EFQA 5D4RA 1SAUA 3F8MA 4AD9A 2Q2EB 1MNDA 4UUSB 5JLXA 1BJZA 4MEXF 4L9JA 2HNHA 2QZ8A 4B43A 5B1BH 2FNPA 1I1GA 2QSFX 2QVOA 3EPZA 4ASNA 3GTKJ 1FYMA 2VE8A 4LG3A 3GYHX 3CJRB 2CFXA 2XGEA 3KLOA 5J47A 1K78B 1OCCH 1I50J 2R7UA 4RS8A 1QHHD 2K7LA 4IHYA 1FSHA 4DNCA 4LLNA 4K2EA 4I2OA 2DA2A 1V55H 2V9PA 1WWXA 2CQ7A 5GAHJ 4PFPA 3QODA 3IH3A 5LD2C 3JRFA 3G71I 4I7HA 3QP5A 2XF5A 4YFNF 1IG7A 3S3MA 2P5KA 1V4RA 3PFIA 3DPUA 1SD4A 2VOPA 5E79C 5K7ZA 3BR5A 2EFNA 2XRNA 5J3LA 4DBQA 2ID3A 3MZ8A 4Y13A 1K4TA 4HX7A 1HDDC 1ZRDA 2RQPA 1DPUA 1TWFJ 4F55A 1TWGJ 3I56I 1D0XA 2EIKH 1TL8A 2L54A 2ZMEA 1JE8A 1S29A 3FXJA 5D6FA 2ISZA 1KGSA 4DQ2A 5M5WJ 3GTLJ 2Y0SN 4ZYEA 4QTRA 1SC7A 4F92B 1KU2A 2OQGA 2V6EA 1R4MB 2PFBA 1RRJA 3HUGB 3AAFA 1KZHA 3VODA 1PP8F 1UB9A 2BW3B 2ZC2A 4Y7NJ 1G6NA 3H35A 2D1HA 3SFIA 5IPAA 1WI9A 3W6JB 2XGCA 5IT9Z 4KNYA 3I59B 1DUXC 2HVQA 4J01A 3E7LA 1W0UA 2H8WA 1SEUA 1REPC 3DKXA 1RR7A 1FTZA 5K7FA 1BIAA 3J7AY 3MVPA 3E5UA 4CA0A 2HGCA 2CW8A 4LB6B 2X48A 4M73A 1W36C 1Y1VJ 4R79A 4MTDA 2LKXA 5JR3A 4ABZA 4D9JA 2XVCA 2WAQA 3KP7A 3OV8A 2A69F 2DTRA 3CUQC 3DF8A 3M3YJ 3VYRB 4AIHA 4PJ0C 3KP3A 1W5SA 3CCVI 3D5LA 3FBNB 3W2WA 2P0WA 4EM1A 1B8IA 2DK8A 5DCMA 3IH2A 3V7RA 4NHJA 1P9QC 2EIMH 5J6XA
chains in the Genus database with same CATH topology
5M3MJ 4XICA 4BBRJ 4A3MJ 1IDYA 4M3EA 2MG4A 1JTYA 3ZQCA 1D5YA 2COBA 4JP0A 2H1KA 1TWCJ 3FIWA 2JA6J 3RZDJ 3SDGA 2DA7A 2X6OA 3NAUA 3HM5A 1U8BA 5DS9A 2LVSA 3BR0A 3G1MA 1FIPA 1FEXA 1MSEC 1NK3P 1T56A 2YUSA 1MBKA 3UKGA 2DMQA 4IHWA 3ZQFA 2FQ4A 2JA5J 3SJMA 4BXXJ 3D1NI 1B8IB 3GBGA 2EH3A 2O7OA 3FKIJ 4D5FA 1ZKGA 4MFEA 4S0HB 2HI3A 3GTOJ 2EBIA 3VPRA 1UG2A 1GT0C 1F43A 2NVTJ 5EGOA 2LLKA 2DTZA 4I76A 1JT0A 3BTLA 2E1OA 1DU6A 2CU7A 1JJ6C 3PO3J 3S1RJ 1X58A 1OJLA 2EZHA 1APLC 3G1OA 2GLOA 1K83J 4BY7J 5J1RA 1SANA 2DN0A 5EG0A 1IGNA 3OSFA 1GV5A 2XSDC 4A3EJ 2P81A 4LOCA 5FKKA 1TWHJ 2M9HA 3CQZJ 1ORKA 3S2HJ 2RAEA 4DZPA 3W6VA 2DMTA 5F0FA 4JX6A 4BY1J 2DA5A 1OCPA 3OSGA 4A3GJ 3BTCA 1BW5A 2K9NA 1ITYA 4D5CA 2VKEA 5EGOB 4DZJA 3HOWJ 2Y9ZA 1TWAJ 3BTJA 2KT0A 1ETQA 3CMYA 3BTIA 3HOYJ 1HLVA 1P7JA 4XK4A 2G0EA 3TEDA 2DMPA 1ZQ3P 1FTTA 5EG0B 5EZHA 5IYBJ 2WB1N 1ETWA 3BR1A 2CRGA 3GTGJ 1ZR4A 4FISA 1RESA 1F36A 2JA8J 4D7MA 4XRSA 3OIOA 2DA3A 4MLOA 2LD5A 5EYRA 3I4NJ 3HGYA 2HOTA 3MKLA 3MN2A 4A3KJ 1NTCA 1DU0A 1P7IA 2B63J 1GUUA 5M3FJ 1BL0A 4JYKA 3TW7A 3HOXJ 2XB5A 1T33A 3S1MJ 2ELKA 1WGXA 5E3MA 3Q0UA 1K61A 2IBDA 3HOUJ 1Q1VA 2O9LA 2W48A 4C2MJ 1XG1A 4M3GA 1FJLA 2QCOA 2LP0A 2OPTA 1YRNA 1JGGA 1R9TJ 2Y9YA 1ETKA 2K40A 5J1UA 1JT6A 1WH7A 3S15J 3NARA 2IEKA 1IRZA 2E19A 1LFUP 4B4CA 3JRDA 5C44J 3RKQA 4JX4A 3BQYA 2KDZA 3DEWA 2DJNA 2DA4A 4B3AA 3ZQIA 4DYRA 5EF6A 1X2MA 1MBFA 3QQAA 2AO9A 2EZIA 1RKWA 2MSYA 1QVUA 2XPUA 3B6AA 1ETOA 3IH4A 5M5XJ 5EDNA 3CCYA 2TRTA 5GP9A 3QPLA 4XIDA 3JRAA 4A3JJ 3GTMJ 2DMUA 2EQRA 3BT9A 1POGA 2CJJA 2XGDA 2R92J 1RPWA 3RQIA 3TP0A 1YRNB 4AC0A 2E2IJ 3Q0WA 2CUEA 1RKTA 2TCTA 4UUTA 2E2JJ 5E3LA 1ETXA 3O8GA 2E2HJ 1HDPA 5IP6A 2I10A 3JRIA 1H89C 2K9SA 3ZQHA 1IC8A 3F0CA 4M3DA 1VF9A 2HXIA 2ME6A 4DYQA 5F04A 2R5YA 3HDDA 4QIWN 2JA7J 2JJ7A 2LR8A 4V2GA 1QVTA 4FTHA 2M8GX 1VFCA 3S16J 3BR2A 4XRMA 5IYCJ 3JR9A 2FX0A 5FKNA 4IEJA 2JN6A 1ETYA 1CQTA 3M4OJ 2X9DA 1LE8A 3H3VK 1FIAA 2LK2A 3OOUA 3L1PA 1VI0A 5FKLA 4DYCA 1H88C 2ECBA 4MFDA 1H8AC 2NS7A 3ZQLA 2QF7A 4XRSG 3A01A 3BQZA 5F0CA 2HDDA 1JTXA 2NVXJ 3G1LA 1HF0A 2L7ZA 2N8GA 2Y31A 2WAQN 3BG5A 2Y2ZA 2GBYA 2R5YB 1ZK8A 2MW8A 1RETA 1WPKA 3HGGA 4W1UA 1JJ8C 3WHCA 2R0QC 5JLWA 1ETVA 1SFOJ 1I3QJ 1MBEA 1MBHA 2K9QA 2LFBA 2VKVA 4MIMA 1LE8B 2GM4A 2FJ1A 1I6HJ 1JKOC 3PO2J 5IOZA 1ZR2A 3GTJJ 2O8KA 5K7HA 1S7EA 3A01B 2ID6A 4A3IJ 4A3BJ 2M2EA 5C4XJ 1MBGA 1U9OA 4CYCA 2R5ZA 2JWTA 5M5YJ 2CQXA 2XPVA 3JRHA 4A3DJ 2JK3A 2LY9A 1BA5A 1GVDA 2XRLA 1E3OC 4A69C 5E3OA 3S1NJ 3RZOJ 2CQQA 4A3LJ 3FISA 1O4XA 5EEAA 2HOSA 2VI6A 1PUFA 2DA1A 2R7ZJ 3S1QJ 3FK7A 4M6VA 4FCYA 2L0KA 1QPIA 3H0GJ 4A3CJ 4C3JJ 1JUPA 1IV6A 2OF7A 2VUMJ 4G12A 3O8HA 2R93J 4CYCB 2R5ZB 3HKZN 2L9RA 3A03A 4HNVA 1JUSA 3FK6A 2D5VA 1A5JA 1MH3A 1BW6A 1ENHA 1B72A 4Y52J 4D7NA 1TC3C 5J1YA 4BBSJ 1MH4A 2NOGA 4A3FJ 4AYBN 5HODA 1OCTC 3LOCA 1JUMA 5C3EJ 3C2BA 4I6ZA 1EF4A 1HOMA 1U9NA 1JKRC 2NVQJ 2XB0X 4UUSA 2EZKA 1G2HA 4FE7A 1AKHA 5IOYA 2NS8A 2L7FP 3HOZJ 3QPSA 3PM1A 3GTPJ 3IV5A 2IAIA 2AHQA 3BG9A 1XS9A 4M3FA 3GTQJ 3JRGA 3JRBA 5EZGA 1AU7A 2HQ5A 1A6IA 3ZQGA 3S2DJ 1B72B 3K7AJ 1WI3A 2LTPA 3LSRA 3BG3A 1UMQA 4QSHA 1LFBA 3HEFA 1UHSA 2M34A 4UUSB 2ME0A 1VNDA 3JRCA 5IP7J 4RDUA 1AKHB 3S17J 4W97A 5JLXA 1BJZA 5GPAA 4BKXA 3WHBA 1HCRA 1WH5A 1IUFA 2ECCA 4FE4A 3GTKJ 4B1RA 5F27A 2XPWA 2DMNA 3S14J 2XGEA 4C3IJ 1I50J 3DCFA 1MNMC 3LNQA 4JX5A 2NVYJ 1IJWC 2MGQA 4IHYA 4C3HJ 2HOAA 4AUXA 4X1EA 5FLVA 2DA2A 4A93J 3LSPA 3IH3A 1XC5A 2EZLA 3JRFA 2HXOA 5DTDA 3B6CA 1IG7A 4RBOA 1MSFC 5K7ZA 1W0TA 3BR5A 4L5EA 1Y1WJ 5J3LA 2ID3A 1HDDC 2ZB9A 1MBJA 1U78A 2PMZN 3Q3SA 2M0CA 1TWFJ 2VPRA 1TWGJ 1OFCX 4X6AJ 1JKPC 5FJ8J 4J19A 5IYDJ 5GPCA 5M5WJ 3GTLJ 5C4JJ 2Y0SN 1ZTRA 2YS9A 3BR3A 5FLMJ 4DW6A 4QTRA 4IHXA 2DA6A 3TP3A 3Q0VA 3LSGA 1IDZA 4V2FA 3K2AA 2JMWA 3CDLA 9ANTA 2CUFA 3BR6A 3LSJA 5F08A 4Y7NJ 3SFIA 5IPAA 1AHDP 2XGCA 2Y30A 4M3BA 1W0UA 3E7LA 1GV2A 3TW6A 5F1JA 3A02A 1RR7A 1FTZA 3I4MJ 1ZGWA 5K7FA 1Z77A 4NDLA 5E3NA 5FKMA 4IHVA 5F0HA 3MVPA 4GFBA 3HOVJ 4MO7A 3HBLA 2X48A 1Y1VJ 1X2NA 2LKXA 2FD5A 1QRYA 4ABZA 2L7MP 2WV1A 4EEFG 1PUFB 3HB9A 5BNGA 2H8RA 3M3YJ 3ZOBA 1GDTA 5FKOA 2HYJA 1Z0XA 1B8IA 3IH2A 1NK2P 5IP9J 1JKQC 3JREA 2YU9J 1WCMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M J;  4XIC A;  4BBR J;  4A3M J;  1IDY A;  4M3E A;  2MG4 A;  1JTY A;  3ZQC A;  1D5Y A;  2COB A;  4JP0 A;  2H1K A;  1TWC J;  3FIW A;  2JA6 J;  3RZD J;  3SDG A;  2DA7 A;  2X6O A;  3NAU A;  3HM5 A;  1U8B A;  5DS9 A;  2LVS A;  3BR0 A;  3G1M A;  1FIP A;  1FEX A;  1MSE C;  1NK3 P;  1T56 A;  2YUS A;  1MBK A;  3UKG A;  2DMQ A;  4IHW A;  3ZQF A;  2FQ4 A;  2JA5 J;  3SJM A;  4BXX J;  3D1N I;  1B8I B;  3GBG A;  2EH3 A;  2O7O A;  3FKI J;  4D5F A;  1ZKG A;  4MFE A;  4S0H B;  2HI3 A;  3GTO J;  2EBI A;  3VPR A;  1UG2 A;  1GT0 C;  1F43 A;  2NVT J;  5EGO A;  2LLK A;  2DTZ A;  4I76 A;  1JT0 A;  3BTL A;  2E1O A;  1DU6 A;  2CU7 A;  1JJ6 C;  3PO3 J;  3S1R J;  1X58 A;  1OJL A;  2EZH A;  1APL C;  3G1O A;  2GLO A;  1K83 J;  4BY7 J;  5J1R A;  1SAN A;  2DN0 A;  5EG0 A;  1IGN A;  3OSF A;  1GV5 A;  2XSD C;  4A3E J;  2P81 A;  4LOC A;  5FKK A;  1TWH J;  2M9H A;  3CQZ J;  1ORK A;  3S2H J;  2RAE A;  4DZP A;  3W6V A;  2DMT A;  5F0F A;  4JX6 A;  4BY1 J;  2DA5 A;  1OCP A;  3OSG A;  4A3G J;  3BTC A;  1BW5 A;  2K9N A;  1ITY A;  4D5C A;  2VKE A;  5EGO B;  4DZJ A;  3HOW J;  2Y9Z A;  1TWA J;  3BTJ A;  2KT0 A;  1ETQ A;  3CMY A;  3BTI A;  3HOY J;  1HLV A;  1P7J A;  4XK4 A;  2G0E A;  3TED A;  2DMP A;  1ZQ3 P;  1FTT A;  5EG0 B;  5EZH A;  5IYB J;  2WB1 N;  1ETW A;  3BR1 A;  2CRG A;  3GTG J;  1ZR4 A;  4FIS A;  1RES A;  1F36 A;  2JA8 J;  4D7M A;  4XRS A;  3OIO A;  2DA3 A;  4MLO A;  2LD5 A;  5EYR A;  3I4N J;  3HGY A;  2HOT A;  3MKL A;  3MN2 A;  4A3K J;  1NTC A;  1DU0 A;  1P7I A;  2B63 J;  1GUU A;  5M3F J;  1BL0 A;  4JYK A;  3TW7 A;  3HOX J;  2XB5 A;  1T33 A;  3S1M J;  2ELK A;  1WGX A;  5E3M A;  3Q0U A;  1K61 A;  2IBD A;  3HOU J;  1Q1V A;  2O9L A;  2W48 A;  4C2M J;  1XG1 A;  4M3G A;  1FJL A;  2QCO A;  2LP0 A;  2OPT A;  1YRN A;  1JGG A;  1R9T J;  2Y9Y A;  1ETK A;  2K40 A;  5J1U A;  1JT6 A;  1WH7 A;  3S15 J;  3NAR A;  2IEK A;  1IRZ A;  2E19 A;  1LFU P;  4B4C A;  3JRD A;  5C44 J;  3RKQ A;  4JX4 A;  3BQY A;  2KDZ A;  3DEW A;  2DJN A;  2DA4 A;  4B3A A;  3ZQI A;  4DYR A;  5EF6 A;  1X2M A;  1MBF A;  3QQA A;  2AO9 A;  2EZI A;  1RKW A;  2MSY A;  1QVU A;  2XPU A;  3B6A A;  1ETO A;  3IH4 A;  5M5X J;  5EDN A;  3CCY A;  2TRT A;  5GP9 A;  3QPL A;  4XID A;  3JRA A;  4A3J J;  3GTM J;  2DMU A;  2EQR A;  3BT9 A;  1POG A;  2CJJ A;  2XGD A;  2R92 J;  1RPW A;  3RQI A;  3TP0 A;  1YRN B;  4AC0 A;  2E2I J;  3Q0W A;  2CUE A;  1RKT A;  2TCT A;  4UUT A;  2E2J J;  5E3L A;  1ETX A;  3O8G A;  2E2H J;  1HDP A;  5IP6 A;  2I10 A;  3JRI A;  1H89 C;  2K9S A;  3ZQH A;  1IC8 A;  3F0C A;  4M3D A;  1VF9 A;  2HXI A;  2ME6 A;  4DYQ A;  5F04 A;  2R5Y A;  3HDD A;  4QIW N;  2JA7 J;  2JJ7 A;  2LR8 A;  4V2G A;  1QVT A;  4FTH A;  2M8G X;  1VFC A;  3S16 J;  3BR2 A;  4XRM A;  5IYC J;  3JR9 A;  2FX0 A;  5FKN A;  4IEJ A;  2JN6 A;  1ETY A;  1CQT A;  3M4O J;  2X9D A;  1LE8 A;  3H3V K;  1FIA A;  2LK2 A;  3OOU A;  3L1P A;  1VI0 A;  5FKL A;  4DYC A;  1H88 C;  2ECB A;  4MFD A;  1H8A C;  2NS7 A;  3ZQL A;  2QF7 A;  4XRS G;  3A01 A;  3BQZ A;  5F0C A;  2HDD A;  1JTX A;  2NVX J;  3G1L A;  1HF0 A;  2L7Z A;  2N8G A;  2Y31 A;  2WAQ N;  3BG5 A;  2Y2Z A;  2GBY A;  2R5Y B;  1ZK8 A;  2MW8 A;  1RET A;  1WPK A;  3HGG A;  4W1U A;  1JJ8 C;  3WHC A;  2R0Q C;  5JLW A;  1ETV A;  1SFO J;  1I3Q J;  1MBE A;  1MBH A;  2K9Q A;  2LFB A;  2VKV A;  4MIM A;  1LE8 B;  2GM4 A;  2FJ1 A;  1I6H J;  1JKO C;  3PO2 J;  5IOZ A;  1ZR2 A;  3GTJ J;  2O8K A;  5K7H A;  1S7E A;  3A01 B;  2ID6 A;  4A3I J;  4A3B J;  2M2E A;  5C4X J;  1MBG A;  1U9O A;  4CYC A;  2R5Z A;  2JWT A;  5M5Y J;  2CQX A;  2XPV A;  3JRH A;  4A3D J;  2JK3 A;  2LY9 A;  1BA5 A;  1GVD A;  2XRL A;  1E3O C;  4A69 C;  5E3O A;  3S1N J;  3RZO J;  2CQQ A;  4A3L J;  3FIS A;  1O4X A;  5EEA A;  2HOS A;  2VI6 A;  1PUF A;  2DA1 A;  2R7Z J;  3S1Q J;  3FK7 A;  4M6V A;  4FCY A;  2L0K A;  1QPI A;  3H0G J;  4A3C J;  4C3J J;  1JUP A;  1IV6 A;  2OF7 A;  2VUM J;  4G12 A;  3O8H A;  2R93 J;  4CYC B;  2R5Z B;  3HKZ N;  2L9R A;  3A03 A;  4HNV A;  1JUS A;  3FK6 A;  2D5V A;  1A5J A;  1MH3 A;  1BW6 A;  1ENH A;  1B72 A;  4Y52 J;  4D7N A;  1TC3 C;  5J1Y A;  4BBS J;  1MH4 A;  2NOG A;  4A3F J;  4AYB N;  5HOD A;  1OCT C;  3LOC A;  1JUM A;  5C3E J;  3C2B A;  4I6Z A;  1EF4 A;  1HOM A;  1U9N A;  1JKR C;  2NVQ J;  2XB0 X;  4UUS A;  2EZK A;  1G2H A;  4FE7 A;  1AKH A;  5IOY A;  2NS8 A;  2L7F P;  3HOZ J;  3QPS A;  3PM1 A;  3GTP J;  3IV5 A;  2IAI A;  2AHQ A;  3BG9 A;  1XS9 A;  4M3F A;  3GTQ J;  3JRG A;  3JRB A;  5EZG A;  1AU7 A;  2HQ5 A;  1A6I A;  3ZQG A;  3S2D J;  1B72 B;  3K7A J;  1WI3 A;  2LTP A;  3LSR A;  3BG3 A;  1UMQ A;  4QSH A;  1LFB A;  3HEF A;  1UHS A;  2M34 A;  4UUS B;  2ME0 A;  1VND A;  3JRC A;  5IP7 J;  4RDU A;  1AKH B;  3S17 J;  4W97 A;  5JLX A;  1BJZ A;  5GPA A;  4BKX A;  3WHB A;  1HCR A;  1WH5 A;  1IUF A;  2ECC A;  4FE4 A;  3GTK J;  4B1R A;  5F27 A;  2XPW A;  2DMN A;  3S14 J;  2XGE A;  4C3I J;  1I50 J;  3DCF A;  1MNM C;  3LNQ A;  4JX5 A;  2NVY J;  1IJW C;  2MGQ A;  4IHY A;  4C3H J;  2HOA A;  4AUX A;  4X1E A;  5FLV A;  2DA2 A;  4A93 J;  3LSP A;  3IH3 A;  1XC5 A;  2EZL A;  3JRF A;  2HXO A;  5DTD A;  3B6C A;  1IG7 A;  4RBO A;  1MSF C;  5K7Z A;  1W0T A;  3BR5 A;  4L5E A;  1Y1W J;  5J3L A;  2ID3 A;  1HDD C;  2ZB9 A;  1MBJ A;  1U78 A;  2PMZ N;  3Q3S A;  2M0C A;  1TWF J;  2VPR A;  1TWG J;  1OFC X;  4X6A J;  1JKP C;  5FJ8 J;  4J19 A;  5IYD J;  5GPC A;  5M5W J;  3GTL J;  5C4J J;  2Y0S N;  1ZTR A;  2YS9 A;  3BR3 A;  5FLM J;  4DW6 A;  4QTR A;  4IHX A;  2DA6 A;  3TP3 A;  3Q0V A;  3LSG A;  1IDZ A;  4V2F A;  3K2A A;  2JMW A;  3CDL A;  9ANT A;  2CUF A;  3BR6 A;  3LSJ A;  5F08 A;  4Y7N J;  3SFI A;  5IPA A;  1AHD P;  2XGC A;  2Y30 A;  4M3B A;  1W0U A;  3E7L A;  1GV2 A;  3TW6 A;  5F1J A;  3A02 A;  1RR7 A;  1FTZ A;  3I4M J;  1ZGW A;  5K7F A;  1Z77 A;  4NDL A;  5E3N A;  5FKM A;  4IHV A;  5F0H A;  3MVP A;  4GFB A;  3HOV J;  4MO7 A;  3HBL A;  2X48 A;  1Y1V J;  1X2N A;  2LKX A;  2FD5 A;  1QRY A;  4ABZ A;  2L7M P;  2WV1 A;  4EEF G;  1PUF B;  3HB9 A;  5BNG A;  2H8R A;  3M3Y J;  3ZOB A;  1GDT A;  5FKO A;  2HYJ A;  1Z0X A;  1B8I A;  3IH2 A;  1NK2 P;  5IP9 J;  1JKQ C;  3JRE A;  2YU9 J;  1WCM J; 
#chains in the Genus database with same CATH topology
 5M3M J;  4PGG A;  4BBR J;  2NAZ A;  3I54 A;  1LDK B;  3F6O A;  4M3E A;  2HFH A;  4NB5 A;  1LEB A;  1V5G A;  2P6T A;  5DCF A;  3DLL F;  4OAZ A;  4G7H F;  2JA6 J;  3F8F A;  3NAU A;  2Q8K A;  5CJ9 A;  4ON0 A;  1TTY A;  5JHU A;  3BR0 A;  4G7Z F;  1K6Y A;  3RI4 A;  2M7B A;  1DP3 A;  2E1C A;  1NK3 P;  2KIM A;  1G3Y A;  4E7H A;  3CC7 I;  2YUS A;  1BC7 C;  1U5T B;  2E5Z A;  1IN5 A;  4BXX J;  3EUH C;  1YW7 A;  3GBG A;  2EH3 A;  3F9K A;  1Z6R A;  1KYW A;  3FKI J;  4D5F A;  2A61 A;  1FYL A;  1XDS A;  1ZKG A;  3H3Z A;  2A6E F;  1HA8 A;  5E8I A;  3U21 A;  3VPR A;  1UG2 A;  4YIF A;  2NVT J;  5EGO A;  1SFK A;  4ZJZ A;  4I76 A;  1WRJ A;  5HLG A;  1FLI A;  1KON A;  2E1O A;  2GAU A;  3BTL A;  2CU7 A;  2IS4 A;  2GQQ A;  4E70 A;  2EZH A;  4U88 A;  3D0S A;  3EET A;  1RC9 A;  4KA4 A;  3ECH A;  2QYO A;  4N4O B;  4UVC A;  3ISP A;  2XSD C;  1BOB A;  2BVL A;  3L2V A;  3OYD A;  2RN7 A;  2P81 A;  4HF2 A;  1X1B A;  2QLZ A;  1TWH J;  2W85 A;  5BS6 A;  2YX7 A;  4IPA A;  3CQZ J;  4LG0 B;  1ORK A;  3EDP A;  3S2H J;  2JSP A;  2L2O A;  2XAJ A;  2AQF A;  4KIF A;  2UV1 A;  4BY1 J;  2DA5 A;  1MJA A;  2IPQ X;  5LEK A;  5J8F A;  1HBX G;  4A3G J;  1A35 A;  1BW5 A;  3DBH B;  1J0R A;  4HSR A;  2K9N A;  4D5C A;  3DWL E;  3HRU A;  4EM0 B;  1FY7 A;  3IKV A;  1RUN A;  3K9T A;  2CUJ A;  4DZJ A;  4KIB A;  2QA4 I;  3OYI A;  3S2W A;  4OMY A;  2K4B A;  2R7V A;  2OBP A;  2ZJR F;  2RRE A;  1EA3 A;  3OWT A;  3TED A;  2DMP A;  5EG0 B;  2IGM A;  3PUF A;  5EZH A;  3V8J A;  1E17 A;  3SFZ A;  1DPR A;  3KEO A;  4BEH A;  3BWG A;  4PK4 A;  5EJC A;  2CV1 A;  3A4C A;  1RES A;  1D8K A;  1F36 A;  4HNU A;  4XRS A;  2DA3 A;  2LDU A;  3QYB A;  1KA8 A;  3H92 A;  2DT7 B;  4IQJ A;  2GZW A;  4Y4R A;  3ZQ7 A;  3MKW B;  1T2K A;  5M3F J;  1QHG A;  1U2W A;  4GDF A;  3NWS A;  4U7D A;  2R7O A;  2XB5 A;  3S1M J;  2ELK A;  3K2Z A;  3KP4 A;  4IJA A;  3TDU C;  1K61 A;  3Q0U A;  4PSX A;  3L09 A;  5CVR A;  1Q1V A;  3K4J A;  3RKY A;  2QKM B;  4M3G A;  1V5E A;  1YIO A;  1WQ2 A;  3OL3 A;  1YRN A;  1ETK A;  3ERE D;  5J1U A;  2IRF G;  1JT6 A;  4RAF A;  3DTE A;  3NAR A;  1IRZ A;  4GRI A;  5IT9 K;  1UCR A;  3ZPL A;  3JRD A;  4Y17 A;  2V1X A;  3RKQ A;  1PP7 U;  4JX4 A;  3BQY A;  1YI2 I;  4BL0 B;  1W7P B;  3VB2 A;  1RNL A;  2DA4 A;  4BHB A;  3DEU A;  5FFZ A;  1DQU A;  1Z7L A;  1X2M A;  4XON A;  4HOB A;  1GVJ A;  2P7C B;  1RKW A;  1RIO H;  2KPM A;  1OYI A;  4XID A;  3QPL A;  3GTM J;  4RGX A;  3BT9 A;  3HRT A;  1POG A;  1QU3 A;  3CCS I;  1BR2 A;  3R60 A;  2DOA A;  5DEQ A;  3RQI A;  1OPC A;  4L9N A;  2IS6 A;  4ETS A;  2GOX B;  2E2J J;  4I0B A;  5E3L A;  2FMY A;  1VTN C;  1ZLK A;  4LIU A;  1TBX A;  2E7W A;  4KDP A;  5ICC A;  2RC4 A;  4BDZ A;  4HA8 A;  2FRH A;  3UNG C;  4EAT A;  3D5R C;  3L9F A;  3WE3 A;  1IC8 A;  2ZO4 A;  4WK8 F;  1VF9 A;  3GVA A;  3AG2 H;  3IL2 A;  2ME6 A;  4DYQ A;  4PSW A;  2R5Y A;  1K7A A;  4QIW N;  2JA7 J;  5E17 F;  2JJ7 A;  2LR8 A;  5K5O A;  4NNJ A;  3S16 J;  2O8X A;  1Y8Q B;  4P55 A;  3PSF A;  4CCO A;  2IXS A;  2J5O A;  3CP2 A;  3IHU A;  4O3M A;  1MZB A;  1ZRE A;  3BZK A;  1U5T C;  4II3 A;  2X9D A;  4BJ6 C;  3NQO A;  1FIA A;  3OOU A;  1VI0 A;  2ECB A;  3LSK A;  4MFD A;  1H8A C;  3CP8 A;  3ZQL A;  1IXC A;  1USS A;  3A01 A;  5F0C A;  2XAG A;  4A0X A;  2PMH A;  4CCM A;  3RYR A;  3Q9S A;  1HF0 A;  4YIR X;  2HKX A;  4L18 B;  2L3D A;  4CCJ A;  1WVR A;  1WPK A;  2BBY A;  3HGG A;  3MD2 A;  3K4N A;  1JJ8 C;  3WHC A;  3BJO A;  2BHY A;  3M9A A;  1WFX A;  1C0W A;  4F7Z A;  2F48 A;  1BI0 A;  2VKV A;  4U7B A;  5D4S A;  5L3B A;  2GM4 A;  1Z9C A;  1JHH A;  2FJ1 A;  3MWM A;  1I6H J;  3SZT A;  1JKO C;  1DGR M;  1MGT A;  4BQA A;  4WXH A;  3QP6 A;  5HS8 A;  4A3I J;  2RQQ A;  3I71 A;  1OMI A;  3CC2 I;  3GFM A;  2X1E A;  2ZJQ F;  2EPF A;  1YS7 A;  4MNU A;  1X4P A;  1AOY A;  4IF4 A;  2R5Z A;  2JWT A;  2E34 A;  3G4S I;  1T0F A;  3TL4 X;  4RA2 A;  4XSX F;  4A3D J;  3KZI C;  1VQL I;  2DJI A;  3FHZ A;  2H27 A;  2XRL A;  2FEZ A;  2VOD A;  1L0O C;  5E3O A;  3RZO J;  4A3L J;  2M0M A;  3FIS A;  2PJR B;  1QNT A;  2EV5 A;  3CCL I;  1PUF A;  2DA1 A;  2R7Z J;  3S1Q J;  3FK7 A;  4FCY A;  4HV6 A;  4E4H A;  2LKP A;  5HLH A;  1YIT I;  2L0K A;  1QPI A;  4A3C J;  1K79 A;  3HYI A;  4CZZ A;  1XSD A;  4XKV A;  4MHG A;  3FMQ A;  4H0E A;  4KMU X;  5LRR A;  4B3X A;  3K1N A;  2EWN A;  3E97 A;  1R71 A;  3IRQ A;  2W84 A;  2XDV A;  4E6K G;  4PGH A;  4HAM A;  2D5V A;  1A5J A;  1MH3 A;  1OCO H;  2KLO A;  2VBW A;  4BS9 A;  1IF1 A;  3I55 I;  1TC3 C;  4XN0 A;  5LGN A;  4A3F J;  2H6C A;  1FMV A;  4AYB N;  1OCT C;  3ZRG A;  1Z6T A;  4I6Z A;  4E7I A;  1EF4 A;  1FNN A;  4P1W A;  1U9N A;  1HOM A;  3CES A;  3MCZ A;  1T08 B;  2EZK A;  3HHH A;  5IOY A;  2MC4 A;  3HOZ J;  1Y0U A;  3QPS A;  5JVG F;  2R7X A;  3PM1 A;  2QSG X;  3IV5 A;  3RKW A;  2M5W A;  4XBF A;  3TGN A;  2IAI A;  3F72 A;  2VKH A;  2KZV A;  2KRF A;  2IGO A;  4Q47 A;  3GXO A;  5HNH A;  1AU7 A;  2I8D A;  2IA1 A;  2HQ5 A;  3W2V A;  5HLT A;  3HIF A;  4JQF A;  5GTH C;  3K7A J;  3KZZ A;  3LST A;  3V4G A;  2XC7 A;  1J59 A;  3U1D A;  3E1S A;  1WJD A;  1ZGA A;  1VQ5 I;  3CJN A;  3ZMZ A;  3IC7 A;  2BZT A;  2M8E A;  3CCR I;  5DDG A;  2RDP A;  3OYH A;  1YG2 A;  4KMF A;  4E7S A;  3JRC A;  3KPH A;  1AKH B;  3T0Y A;  1TQP A;  1OCZ H;  5GPA A;  1QZE A;  3ABL H;  1HW5 A;  2ECC A;  3REO A;  1OKR A;  3ZN0 A;  3KYL A;  2FOK A;  5F27 A;  5GAG J;  5DD4 A;  2DMN A;  3W6K B;  3H9J A;  3KYC B;  3Q9V A;  2DBB A;  4AID A;  2FUG 2;  3OL4 A;  4QPQ A;  3CCM I;  3F23 A;  3QWL A;  4C3I J;  1MNM C;  1D1A A;  2NVY J;  4IVN A;  3HJE A;  3WOD F;  3MZH A;  2VJ4 A;  1IJW C;  4U0V A;  4AUX A;  3LA2 A;  3E6M A;  5FLV A;  3LA3 A;  4LMY A;  3V8L A;  5GAE J;  2RGV A;  1TQM A;  3VYT B;  4P9F A;  4EV0 A;  3LSP A;  4HF1 A;  5CVI A;  1Y0N A;  2EZL A;  3QPT A;  1UHM A;  4TV7 A;  5HDN A;  3LA7 A;  2ZNY A;  3I0T A;  1LPQ A;  2A3S A;  3S32 A;  2CH0 A;  1MSF C;  2X1C A;  3RPU A;  3LMM A;  1FC3 A;  3QOP A;  3TO9 A;  1Y1W J;  2EFO A;  1MBJ A;  4I0A A;  3Q3S A;  1XSV A;  5J8C A;  4AVP A;  4CO8 A;  3M1E A;  4X6A J;  4U87 A;  2LOO A;  1YJW I;  4EJU A;  5LGT A;  2W25 A;  5FRM A;  1SD7 A;  5GPC A;  3HRS A;  2NRA C;  4E7K A;  5C4J J;  1ZTR A;  4C2T A;  3TO7 A;  2E5N A;  2DA6 A;  3GFJ A;  3LSG A;  5FGM A;  2PBI A;  2R4G A;  1XN7 A;  4LJZ F;  4PUS A;  3CME I;  3ZMS A;  2FBI A;  2HVS A;  3AG3 H;  3L00 A;  4GO1 A;  5ICE A;  2XKO A;  2NOJ B;  1B9M A;  3K0L A;  2Y30 A;  1KQ0 A;  2F6C A;  3E5Q A;  1GV2 A;  3A02 A;  2PEX A;  3I4M J;  1IZ1 A;  1IRG A;  3F8N A;  1SVL A;  4IHV A;  4Y3O A;  2XAH A;  4GFB A;  2R7R A;  3OS1 A;  1BI2 A;  1NH3 A;  2QQ9 A;  3HBL A;  4UV8 A;  2PN6 A;  3OYF A;  2ZME B;  2V1U A;  2ZSH B;  1E3H A;  4XOT A;  4HQE A;  2FD5 A;  4LLL A;  2QUF A;  6PAX A;  4EEF G;  3CCE I;  2O61 A;  4HDV A;  3M8F A;  3HB9 A;  4M9S A;  2WC2 A;  3HOS A;  3DKY A;  2D1V A;  1X1A A;  4R1H A;  3DBL B;  3BZ6 A;  2EIN H;  2RNJ A;  4BGD A;  2TDX A;  1F5T A;  1Z0X A;  2Z33 A;  1NK2 P;  2VQC A;  1JKQ C;  1ZN2 A;  1T38 A;  2K3P A;  2WAD A;  3U9G A;  3LFK A;  1ZAO A;  3TBI A;  3CMM A;  2BY1 A;  1Q1H A;  2KJC A;  2KIF A;  1SD5 A;  1IDY A;  1LDD A;  2MG4 A;  2W24 A;  1D5Y A;  3CCU I;  2ZFW A;  5DM7 F;  2H1K A;  2ELJ A;  1T6S A;  3LSI A;  3RZD J;  2DA7 A;  2X6O A;  5L3D A;  4OIN F;  2ADU A;  2HEO A;  4HW0 A;  1YO5 C;  2PG4 A;  3FM5 A;  2OD5 A;  3CCQ I;  3GFL A;  2HVR A;  1S7O A;  3WTU C;  1MSE C;  3I58 A;  4MQ9 F;  2KDO A;  1T56 A;  2ZXW H;  5ERI A;  1MBK A;  3SEZ A;  3UKG A;  5LGU A;  1LEA A;  2G9W A;  4OWR B;  4CH7 A;  3WG9 A;  1ON1 A;  1B8I B;  5DCM B;  3Q5F A;  3IAS 2;  4DGW B;  2V4J C;  1R36 A;  2DPU A;  4G9Y A;  2DI3 A;  3H5R A;  2OA4 A;  4B09 A;  4HDU A;  2OU2 A;  1A36 A;  2JRT A;  3PIO F;  3LAP A;  3DV8 A;  3GCM A;  3HTS B;  1DU6 A;  3MZY A;  2L9N A;  1JJ6 C;  5FRO A;  3S1R J;  1X58 A;  1A31 A;  4G6Q A;  1GLN A;  1APL C;  3ESW B;  3G1O A;  2VE9 A;  2GLO A;  3LSM A;  1BC8 C;  1SAN A;  1IGN A;  3DQV C;  4KIT B;  3OSF A;  2GXA A;  1XMK A;  1V5F A;  1TNT A;  4YEL A;  4LOC A;  1ZYR F;  4KIC A;  5FKK A;  4M74 A;  2MAB A;  2M9H A;  2VQG A;  3OYM A;  4UUV A;  3T5X A;  1HST A;  4MQV A;  2DMT A;  2L9S A;  5FO5 A;  5F0F A;  2CUZ A;  3OSG A;  2WAF A;  3BTC A;  3NWT A;  2MC3 A;  4A12 A;  1FZP B;  1ITY A;  2LC2 A;  5E20 A;  5AIQ A;  1SVM A;  5HS7 A;  5EGO B;  3HOW J;  4XLP F;  2OQR A;  5BMZ A;  1TWA J;  2VC0 A;  2IA0 A;  2OV7 A;  3CMY A;  2ZJ2 A;  3BG7 A;  3BTI A;  4ZYG A;  3HOY J;  4U0Y A;  4G94 A;  4XOR A;  1O3Q A;  3DU5 A;  5ICF A;  2VC1 A;  4B47 A;  1XCB A;  4KN7 X;  3PQK A;  3FM3 A;  5KAI C;  1T98 A;  3C1D A;  1ETW A;  2JVH A;  2VB6 A;  3BR1 A;  2F5V A;  2QSH X;  2EA2 A;  3HOT A;  1Y56 A;  1Z05 A;  2R7T A;  4D7M A;  3OIO A;  1EJ9 A;  1Y8R B;  4M9Z A;  4DIQ A;  2LD5 A;  1U3E M;  4I09 A;  1YOV B;  1W5C C;  3MKL A;  5HLI A;  2QQB A;  2DXI A;  2JRM A;  3ZCO A;  1UFM A;  1W36 D;  3VWB A;  4V19 K;  1ACI A;  2QEX I;  3HOX J;  4KIG A;  2PJP A;  4XNF A;  5ED4 A;  3BOQ A;  5E3M A;  1K6O A;  3GLL A;  3HPH A;  2L9V A;  2UUZ A;  4M6Y A;  4A5N A;  2O9L A;  4C2M J;  1XG1 A;  1FJL A;  1I3A A;  2QCO A;  4D0P A;  2LP0 A;  2OPT A;  2LBF A;  3CUO A;  2MLG A;  2Y9Y A;  2K40 A;  1QGP A;  5KNL A;  3BP8 A;  4RAG A;  4KIS A;  1WH7 A;  1EV7 A;  5H20 A;  2Y75 A;  2E19 A;  4BEH B;  4YG2 F;  4NC8 A;  5C44 J;  3EUA A;  2IGK A;  1ZHF A;  2KL4 A;  3C2H A;  1MMD A;  3BCA A;  2CV2 A;  1XGO A;  3VSK A;  2DU9 A;  1B6A A;  4DYR A;  1MBF A;  1XCV A;  1V54 H;  4LIV A;  2EIL H;  2ZME C;  1B59 A;  2X0L A;  3B6A A;  2MSY A;  1MMA A;  5L3F A;  1ETO A;  2O03 A;  1SMY F;  5EDN A;  3CCY A;  4XM3 A;  1KQ9 A;  2HU9 A;  3A0B C;  5GP9 A;  3ZMV A;  3JRA A;  2HZT A;  1A6Q A;  2XGD A;  5FRN A;  1RPW A;  2D45 A;  1L3L A;  1QQI A;  1Z3Y A;  1YRN B;  2E2I J;  3FXK A;  3H9G A;  3Q0W A;  2Y69 H;  1RKT A;  2A68 F;  2E1M C;  3K4K A;  4BE1 A;  2H6B A;  1KYZ A;  1FWZ A;  1HW1 A;  2JUG A;  5TGT A;  3SZP A;  2X6Y A;  1LJ9 A;  3ZQH A;  3BC8 A;  3F0C A;  2Z2S B;  4M3D A;  1R1V A;  2JTV A;  3CJQ B;  1OCR H;  5D5W B;  1P92 A;  2M30 A;  2VJ5 A;  5F04 A;  3QAH A;  3HDD A;  4UHT A;  1QVT A;  3FMR A;  4FTH A;  5ILV A;  1IV8 A;  5IYC J;  3JR9 A;  3ZQQ A;  2Z9O A;  5LHI A;  3WTW C;  3HC7 A;  2JPB A;  1S8N A;  3RDI A;  2JN6 A;  1QO0 D;  3FXU A;  5DV5 A;  3DLA A;  4O5V A;  1YTY A;  4UVB A;  2FSW A;  4DYC A;  2YX4 A;  1O3S A;  5E1Z B;  1H88 C;  3ROU A;  2OUM A;  4EQQ A;  2NS7 A;  2QF7 A;  3BY6 A;  3FZV A;  4HZF A;  3BQZ A;  2KQR A;  4XRS G;  1H0M A;  3CJT B;  2R7S A;  1JTX A;  4HLY A;  2CV0 A;  1UG0 A;  1SFX A;  3TDZ C;  2R7F A;  3H5A A;  2FML A;  3IAM 2;  5CKT A;  2WAQ N;  1YJ9 I;  3BG5 A;  4BQO A;  2Z5U A;  4F52 A;  4HV5 A;  2GXG A;  2R5Y B;  3GW2 A;  2BHZ A;  2MW8 A;  1HXD A;  1RET A;  3O6B B;  4DOZ A;  5BPI A;  4ZYD A;  2P8T A;  1WJF A;  2YSR A;  2R0Q C;  3KIO A;  2F5F A;  1I3Q J;  1U6G A;  2B9S A;  2VQH A;  1MBH A;  3BDD A;  4UB6 C;  2K9Q A;  1MJ9 A;  2FNA A;  2LFB A;  3HUG A;  2ETH A;  3ABM H;  3DKW A;  1S6L A;  2A6T A;  2WAE A;  3JTH A;  2DAO A;  2BW3 A;  1MMN A;  2AXL A;  1D1B A;  4A2U A;  4IOC F;  5D5V B;  5IOZ A;  3PO2 J;  3KX2 A;  1IAW A;  1WHU A;  2C6Y A;  2O8K A;  3A01 B;  2ID6 A;  3FHN A;  2QGU A;  2M2E A;  2P7V B;  3FF5 A;  5EEH A;  1U9O A;  1X1D A;  5M5Y J;  3JRH A;  4LB5 A;  2FU4 A;  2Q0O A;  3CZ6 A;  3PQJ A;  3TOA A;  4L0Z B;  2Z99 A;  3K1M A;  5FD6 A;  2CQQ A;  1OYW A;  5EEA A;  1I1S A;  5JHF A;  2V1N A;  3QU6 A;  1BR1 A;  2VI6 A;  1X1C A;  1NG7 A;  2MH9 A;  1HKQ A;  4BHC A;  5JVT A;  4ZDO A;  3P7N A;  2MBF A;  1T39 A;  3H0G J;  3GZN B;  1FOY A;  4P5O A;  4Y33 A;  5FLX Z;  1V3F A;  4XLN F;  4IX7 A;  2O3F A;  2COM A;  2R5Z B;  3WTT C;  3V8K A;  3O2P E;  2OTJ I;  2M3A A;  4NQW A;  4OIP F;  5DUK A;  3FMS A;  1F4K A;  2UZK A;  1BW6 A;  1QZY A;  2BXZ A;  4GYG A;  4D7N A;  1MH4 A;  2NOG A;  3BJ6 A;  3I4P A;  2XHK A;  4ZH4 F;  2CO5 A;  3LOC A;  4GYI A;  2NVU B;  3C2B A;  1P4A A;  3ONQ A;  1IRF A;  1JKR C;  2L01 A;  4XKB A;  4DJA A;  1G3T A;  1IUY A;  2FBK A;  1G2H A;  1XTA A;  4U0W A;  2WBM A;  2L7F P;  3KEY A;  2EIJ H;  4XLA A;  2D2W A;  3TOB A;  5LRS A;  4P96 A;  3HL2 A;  3J81 Z;  1W1W E;  2AHQ A;  1XS9 A;  3KP5 A;  1U0J A;  3OYG A;  3JRB A;  5EZG A;  5J40 A;  2DFI A;  3WTS C;  1O7L A;  2EJR A;  3ZQG A;  3CC4 I;  5F6F A;  4Y15 A;  1TLH B;  1YS6 A;  3J7Z I;  1GXP A;  1LFP A;  3H9Q A;  3HPG A;  3HHG A;  1LFB A;  2ZXH A;  3HEF A;  4S05 A;  3OS2 A;  3DPT A;  3MMY B;  1KU7 A;  1UHS A;  2KJB A;  2M34 A;  1VND A;  3AL0 B;  3L7W A;  4W97 A;  4LG0 A;  1FSE A;  3GF2 A;  3J7A O;  4G6D A;  4OOI A;  3WHB A;  4AU7 A;  2LF7 A;  5LEJ A;  3VSL A;  4IKF A;  1WH5 A;  3WU0 A;  2IJL A;  3OYC A;  4B1R A;  3FXO A;  1TW3 A;  5B5E C;  1G8X A;  3LAJ A;  2XPW A;  1VQP I;  4MEY F;  2K86 A;  3C3W A;  3OYK A;  1O7F A;  4QPO A;  4GXO A;  1XMX A;  2JPC A;  1UST A;  3PSI A;  1R23 A;  3DCF A;  4B44 A;  1R22 A;  4HYE A;  1YQA A;  3LNQ A;  3R6S A;  1BR4 A;  1FP2 A;  3GZ5 A;  4C3H J;  2HOA A;  5FFX A;  3S3O A;  3L2Q A;  1D0Y A;  1XC5 A;  2G7U A;  2HXO A;  2KMU A;  2BV6 A;  2V9K A;  5CPR B;  3AG1 H;  3OYN A;  4RBO A;  1MDM A;  1FOW A;  4FQG A;  4NBQ A;  4UXN A;  2NXN B;  3SXY A;  1YLF A;  4LD5 A;  2ZB9 A;  1AWC A;  4LGW A;  5CQG A;  5ILS A;  4N0B A;  4UY8 I;  3S93 A;  2M0C A;  2W82 A;  1ZAR A;  3VDX A;  1FOX A;  2ZJP F;  4HX8 A;  4B48 A;  1JKP C;  2HWV A;  1XMA A;  5FJ8 J;  4J19 A;  5IYD J;  5K1Y A;  1Z21 A;  2V9V A;  2YS9 A;  1ULY A;  5FLM J;  4DW6 A;  5LFA A;  4G8X A;  3Q0V A;  1XX5 A;  3K2A A;  4KN4 X;  1U8R A;  4RB3 C;  4AVZ A;  2XGX A;  3CDL A;  3UR3 C;  3BJA A;  1YW8 A;  1B1B A;  2CUF A;  2KRH A;  3BR6 A;  1G4D A;  5IT3 A;  2IP2 A;  3LSJ A;  5F08 A;  3FDY A;  4WX9 A;  1YIJ I;  3R0J A;  1AHD P;  3VEP A;  2DDA A;  3WU2 C;  5DUI A;  3TW6 A;  5F1J A;  3L2W A;  1ZGW A;  1Z77 A;  4NDL A;  1YE9 A;  2JSC A;  5FKM A;  4M71 A;  5F0H A;  1IXR C;  1DGW Y;  2UXX A;  2AS5 F;  1FMW A;  3DU6 A;  4MO7 A;  1BN5 A;  4OU0 A;  2RNG A;  2M4G A;  1X2N A;  3LQQ A;  1QRY A;  3MKY B;  1GXQ A;  1IO2 A;  2X1D A;  3V42 A;  2AQE A;  2L7K A;  5BNG A;  2H8R A;  3ZOB A;  3IWZ A;  2JQ7 A;  5FKO A;  1X3U A;  5FLX K;  1WJE A;  4RM3 A;  3VOE A;  2HYJ A;  4LLG F;  5F64 A;  4PZJ A;  1W7P D;  5IP9 J;  3JRE A;  1T0F C;  1WCM J;  1PJR A;  2ZBK A;  3TMO A;  4A3M J;  4BJ5 C;  2HYG D;  2DFF A;  3O3K A;  3ZQC A;  1CF7 B;  4JP0 A;  2MD0 A;  2DYR H;  2GOM A;  2WB1 A;  3QYE A;  3FIW A;  4BDY A;  2HQR A;  2KFD A;  1EH6 A;  3SDG A;  3WTX C;  5CYV A;  3G2B A;  5DS9 A;  1UEL B;  3G1M A;  2DDB A;  3JSO A;  1OLT A;  5KVR A;  5BOX A;  2E1N A;  4LIT A;  2LMD A;  3MAJ A;  2QBY A;  1EH8 A;  1KU3 A;  4CCN A;  4P9U A;  4ITV A;  4I98 B;  4IHW A;  4NUB A;  4ZDL A;  4I99 C;  2JA5 J;  4ENN A;  1OR7 A;  3J81 K;  4Q4Z F;  3ELK A;  2BVM A;  2ZKZ A;  2BXY A;  3L2C A;  4EMS A;  2FXA A;  4MFE A;  1DP7 P;  4S0H B;  2ZNZ A;  3COA C;  3GTO J;  2HR3 A;  3AG4 H;  1T95 A;  5D6E A;  1GT0 C;  1O57 A;  2XKP A;  1F43 A;  4F3Q A;  2IA2 A;  3FBI B;  3PNV A;  2DTZ A;  3GME A;  1JT0 A;  2NYX A;  1ODD A;  4HNT A;  1R00 A;  4EJW A;  1R1U A;  4OAY A;  2W7N A;  2V79 A;  1ONV A;  2EV6 A;  1BI3 A;  1PVE A;  3AL0 C;  2UWM A;  3CDH A;  3KP6 A;  2OTL I;  3K10 A;  4R8H A;  2ZXI A;  4LFU A;  1XDU A;  3LSH A;  3ASN H;  1I5Z A;  2NNN A;  4CGZ A;  1P2F A;  4DZP A;  2HDC A;  2M7A A;  1WJ5 A;  1OCP A;  2H1L A;  4IRG A;  3L2U A;  4XL9 A;  3G6E I;  2F4M B;  4RLQ A;  3HSF A;  4ENK A;  2XAQ A;  1OQY A;  5E1W A;  2OZ6 A;  5D8L B;  1SFU A;  2PJR A;  3GFI A;  3ABU A;  3PUB A;  2VKE A;  4KJZ A;  1R49 A;  2K3F A;  5HVQ C;  2O5R A;  1IN8 A;  1ETQ A;  2DOD A;  2VXZ A;  1HLV A;  1H9T A;  2KIS A;  4AM3 A;  1NHA A;  1A04 A;  5B1A H;  1IN4 A;  4EJO A;  2LY1 A;  2OJE D;  1FTT A;  1ZRC A;  3A0H C;  3PNT A;  2W57 A;  1JI8 A;  4FHT A;  4NC7 A;  1OIS A;  2WB1 N;  3E6C C;  2E7X A;  1Z91 A;  3RSN A;  3WTZ A;  3GTG J;  1ZR4 A;  3RYP A;  1HKS A;  3ZMT A;  1VQ8 I;  4C30 A;  5J4V A;  4MLO A;  1TW2 A;  4XR6 A;  5EYR A;  3FX3 A;  3LFU A;  3OYE A;  5GTI C;  3FXR A;  2HOT A;  3MN2 A;  5L3C A;  1DU0 A;  1P7I A;  1BL0 A;  2ZXJ A;  2XRO A;  3RTR A;  3EUK L;  3QU3 A;  2VIX A;  2JZY A;  4XSZ F;  2LSO A;  3MKZ A;  1BI1 A;  1WGX A;  3QOE A;  3GZ6 A;  2XF7 A;  2W48 A;  3BG6 A;  1NG6 A;  1JGG A;  3GUD A;  3JW4 A;  1R9T J;  1J75 A;  4CZC A;  5E18 F;  3EQL F;  4IZZ A;  2GIZ A;  2HOE A;  1X3Z B;  1LFU P;  1I39 A;  1WKM A;  4IHS A;  5HDG A;  4KFC A;  2E1M B;  2BOL A;  2KDZ A;  2WY7 Q;  3DEW A;  1MIJ A;  1WJA A;  1SAX A;  5A2Q Z;  3M7G A;  3IWF A;  2EZI A;  1QVU A;  3IH4 A;  5M5X J;  4WF2 A;  4YFX F;  3OS0 A;  2ZFU A;  5D5X B;  4A3J J;  2DMU A;  2WA0 A;  2VBX A;  2GA2 A;  1TP4 A;  2CJJ A;  1I6X A;  2CQK A;  4ESF A;  4RAY A;  4AC0 A;  2CUE A;  5CVV A;  2GA1 A;  1ETX A;  2K4J A;  5AIP A;  2E2H J;  2RVC A;  1D8J A;  5KAF C;  2H09 A;  3FXQ A;  4YFK F;  4XLC A;  5DM6 F;  1RZ4 A;  3R0A A;  4L9T A;  3JRI A;  3JSP A;  4ZTJ A;  1E3P A;  1X1P A;  2DQL A;  3DP7 A;  3QYF A;  1HC8 A;  4EVI A;  2DT6 A;  4OIR F;  3GO5 A;  4HPQ A;  4V2G A;  4RGS A;  1YYV A;  2F4I A;  4ZTF A;  1G3W A;  1VFC A;  1MJB A;  5LBQ A;  2OCC H;  4XRM A;  4GCV A;  2KKO A;  2VBZ A;  2KIQ A;  5FKN A;  3HKZ A;  3TKY A;  2EB7 A;  2X6W A;  2BEO A;  1ETY A;  2JVG A;  1CQT A;  3ZXS A;  2V1D A;  1S9H A;  2QEN A;  1LE8 A;  2XAF A;  1B4A A;  5FKL A;  1JHF A;  4F93 B;  1R5H A;  2W1O A;  5TRD A;  1W5T A;  2HDD A;  1SMT A;  3P9C A;  3G1L A;  1UJ8 A;  1WSU A;  1J09 A;  2L7Z A;  4II2 A;  2KZG A;  2M1B A;  3P5J A;  1Z3X A;  1BM9 A;  4A5M A;  2VBY A;  3OOP A;  2NS0 A;  4IQ4 A;  3QPH A;  4BE0 A;  1ZK8 A;  4PCQ A;  2VJI A;  1YJN I;  5HOO A;  4W1U A;  2ZSI B;  1R6R A;  2MA3 A;  1XGS A;  2LYC A;  1SFO J;  2IGN A;  2A5W A;  2VAS A;  1J7K A;  4QLC U;  5ILU A;  4ESB A;  3VFZ A;  3W3C A;  2OCE A;  2P4W A;  3CCJ I;  4XKW A;  3ZMU A;  4OIQ F;  3CUQ A;  1PDN C;  1MNE A;  4XMY A;  2V6C A;  4BAY A;  1S7E A;  3WGH A;  5K7H A;  4HBL A;  5FD5 A;  4A3B J;  2VQL A;  5K5R A;  4M72 A;  4IOA F;  5C4X J;  3C2G A;  3GEZ A;  1MBG A;  4CYC A;  2CQX A;  2PX9 A;  4ANJ A;  5CLS A;  3KE2 A;  3ZP5 A;  5HS9 A;  3ECO A;  2XAS A;  2QQ8 A;  2LY9 A;  4G6T B;  1GVD A;  2V7F A;  3HSR A;  1O4X A;  1J9I A;  2HQA A;  3P9I A;  2MYS A;  2HOS A;  5KHD A;  3DXJ F;  3M07 A;  3GWZ A;  3M1C A;  1W4M A;  1LB2 A;  2RKH A;  3SHF A;  3OR1 C;  2R7Q A;  1XPX A;  2X51 A;  1S5L C;  2P6S A;  2OF7 A;  2VUM J;  4PJJ A;  2IS2 A;  3O8H A;  2I5U A;  3EUH A;  3HG9 A;  1ZG3 A;  3A2K A;  3HKZ N;  4EJV A;  2KHM A;  1WJB A;  1SFE A;  4Z2Y A;  1XGN A;  4HNV A;  1JUS A;  3FK6 A;  1MW7 A;  1VQ9 I;  1HKT A;  2MH2 A;  3ASO H;  1B72 A;  2VXD A;  3VYS B;  4Y52 J;  5J1Y A;  1HSJ A;  1P4X A;  5HDK A;  3SDB A;  4RMN A;  2ICW G;  3CO7 C;  3ULQ B;  5C3E J;  2CW7 A;  2PMZ A;  2FA5 A;  1Y6I A;  2W00 A;  4O6J A;  2Q2E A;  1D1C A;  4UUS A;  3CDI A;  2R7W A;  3K6G A;  1N77 A;  4XN3 A;  2VKD A;  5FB2 A;  2V26 A;  2LRD A;  1LKX A;  1ERD A;  1BIB A;  4M9X A;  3GTP J;  2DCE A;  1STZ A;  1UZC A;  1VQK I;  4EGY A;  2VLA A;  2VT3 A;  5A2Q K;  4WWC A;  3WTV C;  4AIJ A;  3KLN A;  4NQW B;  2CGP A;  5L3E A;  3JRG A;  4YII A;  3NEU A;  1CGP A;  4EM2 A;  3OIQ A;  1E2X A;  1A6I A;  1H9G A;  1Z1D A;  3E3V A;  3S2D J;  1K78 A;  1PYV A;  5BPD A;  3HRM A;  4BUP A;  2KIU A;  2FBH A;  2CSO A;  3LSR A;  3MQ0 A;  3F21 A;  1UMQ A;  4QSH A;  3JCU C;  4E7Z A;  3AKZ A;  4AIK A;  3W2A A;  2ME0 A;  5IP7 J;  4RDU A;  3S17 J;  1PUE E;  1F1Z A;  4BKX A;  3H3U A;  1N78 A;  4RGU A;  4CCK A;  3IKT A;  1HCR A;  1IUF A;  1FBU A;  4FE4 A;  3KP2 A;  3H5N A;  3WGI A;  2FF4 A;  2Q1Z B;  3CLQ A;  4JK1 X;  3L2R A;  3S14 J;  2IS1 A;  3BZC A;  3DPL C;  4RLF A;  4CHU A;  2WV0 A;  2XIG A;  4ESJ A;  4WCG A;  1J5Y A;  1ZRF A;  5D8K B;  1Z7U A;  3DTI A;  3KCC A;  4JX5 A;  1RI7 A;  1R7J A;  2MGQ A;  4XLF A;  1R58 A;  4X1E A;  3M8J A;  3IRR A;  1BBY A;  3PJR A;  4A93 J;  5DTD A;  3B6C A;  1ZGJ A;  2MFZ A;  2XUB A;  1IN7 A;  3DEE A;  4PFO A;  1X19 A;  3I59 A;  1W0T A;  4L5E A;  2FE3 A;  2J5P A;  3GLX A;  3K70 D;  2DO7 A;  4YEJ A;  1U78 A;  2PMZ N;  3J7Y J;  2M87 A;  1LUJ B;  1BJA A;  2VPR A;  2CFO A;  3FXM A;  2VOO A;  3K70 C;  1OFC X;  2AXT C;  4IO9 F;  4F91 B;  3H1C A;  3TQN A;  2JUC A;  2EK5 A;  1TZL A;  4ZYH A;  3KEQ A;  4N4N B;  3KFW X;  3F8C A;  5ICG A;  3BR3 A;  3B02 A;  4L5J A;  3JAM Z;  4IHX A;  3TP3 A;  2HTJ A;  2STT A;  1IDZ A;  4M6X A;  4V2F A;  3G73 A;  1R5I D;  2DYS H;  2JMW A;  3KZY A;  5JFR A;  5B66 C;  9ANT A;  1ZG1 A;  4OIO F;  1G3S A;  3K69 A;  2QWW A;  2IVM A;  2PLY A;  2ISY A;  5IY5 H;  3CO6 C;  3AFH A;  3I64 A;  1MDM B;  2HPM A;  4N9I A;  3LQR A;  4M3B A;  2L4A A;  1XB4 A;  4ZYA A;  3WU1 B;  2L4M A;  5E3N A;  3A1Y A;  1KQ8 A;  3K1P A;  1LVK A;  5KK1 A;  4HEA 2;  4I02 A;  3LL7 A;  5J4Y A;  2HS5 A;  3HOV J;  4KT5 C;  4XRF A;  2L7M P;  1LNW A;  1YX3 A;  1IXS B;  2WV1 A;  5CVJ A;  2M4K A;  3E6D A;  2OZU A;  1PUF B;  2FOW A;  3I53 A;  4E7J A;  2ESH A;  1GDT A;  2BY3 A;  2XF6 A;  1U5T A;  3WE2 A;  3F8B A;  2XAU A;  2K27 A;  4RB1 A;  4H4K C;  2Y0M A;  1JXS A;  2UXN A;  1LVA A;  1RUO A;  2YU9 J;  1WJC A;  3VYU B;  1O3T A;  2KP6 A;  3FKJ A;  2M45 A;  4XIC A;  1VQ4 I;  5E1X A;  4Z6Y A;  4E7L A;  1S7A A;  1JTY A;  2HQN A;  1FYK A;  2COB A;  3CLO A;  1TWC J;  2Z3Y A;  3HM5 A;  1U8B A;  3BPX A;  2GXB A;  4XKC A;  2LVS A;  3PL8 A;  4D1Q A;  2PMU A;  3EYY A;  4A6E A;  2VPL A;  1XGM A;  3K4B A;  1OYY A;  1FIP A;  1M1E B;  1FEX A;  2B0L A;  4FAS D;  4PJM A;  2CS3 A;  3BLY A;  2IT0 A;  3OMY A;  2STW A;  1TT5 B;  1ZH5 A;  2DMQ A;  2YPR A;  3DBR B;  1D0Z A;  3ZQF A;  2FQ4 A;  4WXD A;  5H6R A;  3SJM A;  4IHT A;  1JGS A;  3B73 A;  3OR2 C;  4L5I A;  3D1N I;  3WG7 H;  2K85 A;  2X85 A;  2O7O A;  2R7D A;  4BAC A;  4PJN A;  4ZDP A;  4J00 A;  1TNS A;  3P9K A;  1BOA A;  2K02 A;  3N97 A;  2A5Y B;  2HI3 A;  1ZEL A;  1SD6 A;  2EBI A;  4QWQ A;  2O0Y A;  4JBA A;  4BXF A;  1J2X A;  5EEG A;  1ZLJ A;  2LLK A;  2DOE A;  1VQO I;  4CCL A;  2R3S A;  3RJP A;  3OYB A;  3PO3 J;  3KET A;  1OJL A;  5KCM A;  1VQ7 I;  1K83 J;  4BY7 J;  5J1R A;  2DN0 A;  5EG0 A;  1P6R A;  2HYF A;  3ML6 A;  1GV5 A;  2KRC A;  3S8P A;  2QBY B;  5D5U B;  4A3E J;  3I3L A;  4AYB A;  3N4M A;  4RM2 A;  4UB8 C;  3ZMD A;  3HZJ A;  3I5U A;  3QRF F;  2K9M A;  2RAE A;  4S04 A;  4UVA A;  3SYT A;  1MKM A;  4IL6 C;  3W6V A;  2YU3 A;  1SVO A;  4JX6 A;  3PFY A;  1YFH A;  5H6Q A;  2BE5 F;  3NRV A;  2F4O B;  2Y9Z A;  4A6D A;  2B7E A;  3BTJ A;  3C7J A;  4UV9 A;  2KT0 A;  2DQR A;  1P7J A;  2QM3 A;  2CW0 F;  4IRH A;  2G0E A;  4XK4 A;  4CXF A;  1IN6 A;  3F22 A;  1ZQ3 P;  2DW4 A;  3F6V A;  3N05 A;  1N25 A;  5E8G A;  2O6G E;  5IYB J;  4LK1 F;  1MMG A;  4RGR A;  1R5G A;  4BE2 A;  4ZC3 A;  1QZZ A;  3SZG A;  1X4O A;  2CRG A;  2DLL A;  2DOF A;  3I9V 2;  3ZR8 X;  4FIS A;  1QBJ A;  2JA8 J;  3I4N J;  3PIP F;  1W7P A;  5JI6 A;  3CF5 F;  1S72 I;  4MTE A;  3HGY A;  3J80 Z;  4G7O F;  4A3K J;  1NTC A;  4IXA A;  2HDW A;  3TO6 A;  2B63 J;  1GUU A;  1TQI A;  4DBR A;  4Q48 A;  4JYK A;  3TW7 A;  2G7H A;  2XSJ C;  2RV8 A;  1T33 A;  2MD5 A;  2DK5 A;  3MEX A;  3JAM K;  4ENJ A;  1YX5 A;  1ON2 A;  3HOU J;  2IBD A;  4FT8 A;  4HLX A;  1F9N A;  1LDJ A;  3RPQ A;  4C9Y A;  2BGC A;  5LLQ A;  2XV4 S;  3S15 J;  2DFE A;  3WGG A;  3D5S C;  2IEK A;  4A0Z A;  2E60 A;  4L9V A;  4B4C A;  2A6H F;  2EV0 A;  2DFH A;  4BHP A;  3OIP A;  2ELH A;  4XLE A;  2DJN A;  3OYA A;  4KUM A;  2ACJ A;  4HRI A;  4B3A A;  3ZQI A;  2LF8 A;  3PNY A;  5EF6 A;  3QQA A;  2F5C A;  2AO9 A;  2X6X A;  2XPU A;  3G3Z A;  3IP4 B;  4RAZ A;  4HST A;  2TRT A;  1X3W B;  5H2F C;  3V7C A;  3RCO A;  2EQR A;  5CVU A;  3E6B A;  2E35 A;  2LNB A;  5HNF A;  4ZZL A;  3V7S A;  2R92 J;  3BPV A;  1D3Y A;  3FWE A;  3U1K A;  2VN2 A;  3TP0 A;  2K5C A;  4ZZD A;  5DYM A;  2TCT A;  2K9L A;  4UUT A;  3T1B A;  3MFK A;  3O8G A;  1VQM I;  4KT6 A;  1O3R A;  1UHW A;  1FP1 D;  4AWX B;  4CDG A;  1HDP A;  1IRX A;  2A05 A;  5IP6 A;  4CUG A;  4OMZ A;  2I10 A;  3RKX A;  3HXL A;  2HZD A;  2K9S A;  1H89 C;  3EYI A;  1TT0 A;  3RIR A;  2BYV E;  4HX4 A;  4LK0 F;  4B8X A;  3ABT A;  2JT1 A;  3DTK A;  2HXI A;  3E0J B;  4HG2 A;  2VON A;  3S3N A;  4C2U A;  1N75 A;  4XOP A;  1EKE A;  2L02 A;  1D5V A;  2M8G X;  2X4H A;  3BR2 A;  1G59 A;  1ZG5 A;  3M8E A;  3SQN A;  2CQN A;  2FX0 A;  2Y48 A;  2P5L C;  4IEJ A;  5DD8 A;  3M4O J;  2LH9 A;  3IUO A;  3H3V K;  2LK2 A;  3L1P A;  2BY0 A;  2F5E A;  4ENM A;  2MLK A;  3U2R A;  3SEQ A;  4XQF A;  1MD0 A;  3OYL A;  2NVX J;  2L5Q A;  4GGG A;  2BY2 A;  4BNC A;  2NNY A;  2N8G A;  1P4W A;  5L3G A;  2Y31 A;  2E71 A;  1EH7 A;  5F1R A;  2EFP A;  5B3S H;  2CYY A;  4IRI A;  3KYD B;  2Y2Z A;  3K4M A;  4JOM A;  2GBY A;  3WTY C;  2JA2 A;  2VT2 A;  1R4N B;  3ERM A;  1FBS A;  3K4L A;  4HQM A;  2CMP A;  1IW7 F;  1UAA A;  4CYD A;  5JLW A;  5K5Q A;  3CMA I;  2FQ3 A;  1ETV A;  2HPI A;  3BCB A;  3CD6 I;  1WZ2 A;  1MBE A;  2VL8 A;  2ZCW A;  2LKS A;  3GX4 X;  4KYW A;  2P5V A;  2PQ8 A;  2LY2 A;  5GAD J;  2F2E A;  2A07 F;  4MIM A;  1RR8 C;  1LE8 B;  2DT5 A;  1HQC A;  1S3J A;  4UNO A;  1OR7 C;  2YR2 A;  3ZGK A;  5LHH A;  3ZN1 A;  1ZR2 A;  3GTJ J;  1MMS A;  1VZ0 A;  5BQT A;  1AA7 A;  1FT9 A;  3R4K A;  4N9H A;  1XD7 A;  2LRE A;  2EFW A;  1GHC A;  2XPV A;  1FX7 A;  4BQN A;  1KU9 A;  4RB2 C;  2JK3 A;  4I01 A;  3H0D A;  3K4C A;  4BXU A;  1BA5 A;  1E3O C;  3S1N J;  4A69 C;  2HTS A;  1HW2 A;  1FOK A;  1B9N A;  4L0Y B;  2H94 A;  1VQN I;  5TJJ A;  1T8I A;  2QQA A;  4M6V A;  4X0G A;  4FX4 A;  1Z67 A;  2WY8 Q;  4NC6 A;  3JTG A;  3HSE A;  3F3X A;  4HF0 A;  4A0Y A;  3CUQ B;  4C3J J;  1JUP A;  5LHG A;  1VQ6 I;  2OC6 A;  3RPU D;  4FX0 A;  1IV6 A;  5AON A;  4EGZ A;  4G12 A;  4YRV A;  4FET A;  1I27 A;  3CF2 A;  4BQQ A;  4CYC B;  1FBQ A;  2GIV A;  2R93 J;  1Y39 A;  3HTU A;  3J80 K;  2L9R A;  1CF7 A;  3A03 A;  2PI0 A;  2IW5 A;  4PDK A;  4CSW A;  3ABK H;  2Z1D A;  1YW9 A;  1ENH A;  3CTA A;  3RQ4 A;  1E0E A;  1R1T A;  2GWR A;  4BBS J;  3BRO A;  5HOD A;  1K4S A;  4CIC A;  1JUM A;  3DFG A;  2CG4 A;  1LQ1 A;  4RB0 A;  3T8T A;  4BJT A;  2E36 A;  2W4S A;  2NVQ J;  2F5D A;  2XB0 X;  2LBF B;  4FE7 A;  2WTE A;  1AKH A;  4XLH A;  2NS8 A;  2EA4 A;  3C18 A;  2DPD A;  1FPQ A;  3OY9 A;  2Y0S A;  4WXC A;  3BG9 A;  3E5X A;  5TIS C;  3LWF A;  4M3F A;  2OAZ A;  3GTQ J;  4BYY A;  2CWE A;  2ESN A;  3X2Q H;  3R61 A;  2VJJ A;  3FXL A;  3OYJ A;  1QA6 A;  1DDN A;  4MGR A;  4PJL A;  4Q5S F;  1XSX A;  1B72 B;  2QKL B;  2HKO A;  3H36 A;  1WI3 A;  4BU2 A;  2LTP A;  4BH9 A;  2WWY A;  4EJT A;  2Z16 A;  3BG3 A;  2LG4 A;  3T8R A;  5CQE A;  1YHQ I;  1QPM A;  2EFQ A;  5D4R A;  1SAU A;  3F8M A;  4AD9 A;  2Q2E B;  1MND A;  4UUS B;  5JLX A;  1BJZ A;  4MEX F;  4L9J A;  2HNH A;  2QZ8 A;  4B43 A;  5B1B H;  2FNP A;  1I1G A;  2QSF X;  2QVO A;  3EPZ A;  4ASN A;  3GTK J;  1FYM A;  2VE8 A;  4LG3 A;  3GYH X;  3CJR B;  2CFX A;  2XGE A;  3KLO A;  5J47 A;  1K78 B;  1OCC H;  1I50 J;  2R7U A;  4RS8 A;  1QHH D;  2K7L A;  4IHY A;  1FSH A;  4DNC A;  4LLN A;  4K2E A;  4I2O A;  2DA2 A;  1V55 H;  2V9P A;  1WWX A;  2CQ7 A;  5GAH J;  4PFP A;  3QOD A;  3IH3 A;  5LD2 C;  3JRF A;  3G71 I;  4I7H A;  3QP5 A;  2XF5 A;  4YFN F;  1IG7 A;  3S3M A;  2P5K A;  1V4R A;  3PFI A;  3DPU A;  1SD4 A;  2VOP A;  5E79 C;  5K7Z A;  3BR5 A;  2EFN A;  2XRN A;  5J3L A;  4DBQ A;  2ID3 A;  3MZ8 A;  4Y13 A;  1K4T A;  4HX7 A;  1HDD C;  1ZRD A;  2RQP A;  1DPU A;  1TWF J;  4F55 A;  1TWG J;  3I56 I;  1D0X A;  2EIK H;  1TL8 A;  2L54 A;  2ZME A;  1JE8 A;  1S29 A;  3FXJ A;  5D6F A;  2ISZ A;  1KGS A;  4DQ2 A;  5M5W J;  3GTL J;  2Y0S N;  4ZYE A;  4QTR A;  1SC7 A;  4F92 B;  1KU2 A;  2OQG A;  2V6E A;  1R4M B;  2PFB A;  1RRJ A;  3HUG B;  3AAF A;  1KZH A;  3VOD A;  1PP8 F;  1UB9 A;  2BW3 B;  2ZC2 A;  4Y7N J;  1G6N A;  3H35 A;  2D1H A;  3SFI A;  5IPA A;  1WI9 A;  3W6J B;  2XGC A;  5IT9 Z;  4KNY A;  3I59 B;  1DUX C;  2HVQ A;  4J01 A;  3E7L A;  1W0U A;  2H8W A;  1SEU A;  1REP C;  3DKX A;  1RR7 A;  1FTZ A;  5K7F A;  1BIA A;  3J7A Y;  3MVP A;  3E5U A;  4CA0 A;  2HGC A;  2CW8 A;  4LB6 B;  2X48 A;  4M73 A;  1W36 C;  1Y1V J;  4R79 A;  4MTD A;  2LKX A;  5JR3 A;  4ABZ A;  4D9J A;  2XVC A;  2WAQ A;  3KP7 A;  3OV8 A;  2A69 F;  2DTR A;  3CUQ C;  3DF8 A;  3M3Y J;  3VYR B;  4AIH A;  4PJ0 C;  3KP3 A;  1W5S A;  3CCV I;  3D5L A;  3FBN B;  3W2W A;  2P0W A;  4EM1 A;  1B8I A;  2DK8 A;  5DCM A;  3IH2 A;  3V7R A;  4NHJ A;  1P9Q C;  2EIM H;  5J6X A; 
#chains in the Genus database with same CATH homology
 5M3M J;  4XIC A;  4BBR J;  4A3M J;  1IDY A;  4M3E A;  2MG4 A;  1JTY A;  3ZQC A;  1D5Y A;  2COB A;  4JP0 A;  2H1K A;  1TWC J;  3FIW A;  2JA6 J;  3RZD J;  3SDG A;  2DA7 A;  2X6O A;  3NAU A;  3HM5 A;  1U8B A;  5DS9 A;  2LVS A;  3BR0 A;  3G1M A;  1FIP A;  1FEX A;  1MSE C;  1NK3 P;  1T56 A;  2YUS A;  1MBK A;  3UKG A;  2DMQ A;  4IHW A;  3ZQF A;  2FQ4 A;  2JA5 J;  3SJM A;  4BXX J;  3D1N I;  1B8I B;  3GBG A;  2EH3 A;  2O7O A;  3FKI J;  4D5F A;  1ZKG A;  4MFE A;  4S0H B;  2HI3 A;  3GTO J;  2EBI A;  3VPR A;  1UG2 A;  1GT0 C;  1F43 A;  2NVT J;  5EGO A;  2LLK A;  2DTZ A;  4I76 A;  1JT0 A;  3BTL A;  2E1O A;  1DU6 A;  2CU7 A;  1JJ6 C;  3PO3 J;  3S1R J;  1X58 A;  1OJL A;  2EZH A;  1APL C;  3G1O A;  2GLO A;  1K83 J;  4BY7 J;  5J1R A;  1SAN A;  2DN0 A;  5EG0 A;  1IGN A;  3OSF A;  1GV5 A;  2XSD C;  4A3E J;  2P81 A;  4LOC A;  5FKK A;  1TWH J;  2M9H A;  3CQZ J;  1ORK A;  3S2H J;  2RAE A;  4DZP A;  3W6V A;  2DMT A;  5F0F A;  4JX6 A;  4BY1 J;  2DA5 A;  1OCP A;  3OSG A;  4A3G J;  3BTC A;  1BW5 A;  2K9N A;  1ITY A;  4D5C A;  2VKE A;  5EGO B;  4DZJ A;  3HOW J;  2Y9Z A;  1TWA J;  3BTJ A;  2KT0 A;  1ETQ A;  3CMY A;  3BTI A;  3HOY J;  1HLV A;  1P7J A;  4XK4 A;  2G0E A;  3TED A;  2DMP A;  1ZQ3 P;  1FTT A;  5EG0 B;  5EZH A;  5IYB J;  2WB1 N;  1ETW A;  3BR1 A;  2CRG A;  3GTG J;  1ZR4 A;  4FIS A;  1RES A;  1F36 A;  2JA8 J;  4D7M A;  4XRS A;  3OIO A;  2DA3 A;  4MLO A;  2LD5 A;  5EYR A;  3I4N J;  3HGY A;  2HOT A;  3MKL A;  3MN2 A;  4A3K J;  1NTC A;  1DU0 A;  1P7I A;  2B63 J;  1GUU A;  5M3F J;  1BL0 A;  4JYK A;  3TW7 A;  3HOX J;  2XB5 A;  1T33 A;  3S1M J;  2ELK A;  1WGX A;  5E3M A;  3Q0U A;  1K61 A;  2IBD A;  3HOU J;  1Q1V A;  2O9L A;  2W48 A;  4C2M J;  1XG1 A;  4M3G A;  1FJL A;  2QCO A;  2LP0 A;  2OPT A;  1YRN A;  1JGG A;  1R9T J;  2Y9Y A;  1ETK A;  2K40 A;  5J1U A;  1JT6 A;  1WH7 A;  3S15 J;  3NAR A;  2IEK A;  1IRZ A;  2E19 A;  1LFU P;  4B4C A;  3JRD A;  5C44 J;  3RKQ A;  4JX4 A;  3BQY A;  2KDZ A;  3DEW A;  2DJN A;  2DA4 A;  4B3A A;  3ZQI A;  4DYR A;  5EF6 A;  1X2M A;  1MBF A;  3QQA A;  2AO9 A;  2EZI A;  1RKW A;  2MSY A;  1QVU A;  2XPU A;  3B6A A;  1ETO A;  3IH4 A;  5M5X J;  5EDN A;  3CCY A;  2TRT A;  5GP9 A;  3QPL A;  4XID A;  3JRA A;  4A3J J;  3GTM J;  2DMU A;  2EQR A;  3BT9 A;  1POG A;  2CJJ A;  2XGD A;  2R92 J;  1RPW A;  3RQI A;  3TP0 A;  1YRN B;  4AC0 A;  2E2I J;  3Q0W A;  2CUE A;  1RKT A;  2TCT A;  4UUT A;  2E2J J;  5E3L A;  1ETX A;  3O8G A;  2E2H J;  1HDP A;  5IP6 A;  2I10 A;  3JRI A;  1H89 C;  2K9S A;  3ZQH A;  1IC8 A;  3F0C A;  4M3D A;  1VF9 A;  2HXI A;  2ME6 A;  4DYQ A;  5F04 A;  2R5Y A;  3HDD A;  4QIW N;  2JA7 J;  2JJ7 A;  2LR8 A;  4V2G A;  1QVT A;  4FTH A;  2M8G X;  1VFC A;  3S16 J;  3BR2 A;  4XRM A;  5IYC J;  3JR9 A;  2FX0 A;  5FKN A;  4IEJ A;  2JN6 A;  1ETY A;  1CQT A;  3M4O J;  2X9D A;  1LE8 A;  3H3V K;  1FIA A;  2LK2 A;  3OOU A;  3L1P A;  1VI0 A;  5FKL A;  4DYC A;  1H88 C;  2ECB A;  4MFD A;  1H8A C;  2NS7 A;  3ZQL A;  2QF7 A;  4XRS G;  3A01 A;  3BQZ A;  5F0C A;  2HDD A;  1JTX A;  2NVX J;  3G1L A;  1HF0 A;  2L7Z A;  2N8G A;  2Y31 A;  2WAQ N;  3BG5 A;  2Y2Z A;  2GBY A;  2R5Y B;  1ZK8 A;  2MW8 A;  1RET A;  1WPK A;  3HGG A;  4W1U A;  1JJ8 C;  3WHC A;  2R0Q C;  5JLW A;  1ETV A;  1SFO J;  1I3Q J;  1MBE A;  1MBH A;  2K9Q A;  2LFB A;  2VKV A;  4MIM A;  1LE8 B;  2GM4 A;  2FJ1 A;  1I6H J;  1JKO C;  3PO2 J;  5IOZ A;  1ZR2 A;  3GTJ J;  2O8K A;  5K7H A;  1S7E A;  3A01 B;  2ID6 A;  4A3I J;  4A3B J;  2M2E A;  5C4X J;  1MBG A;  1U9O A;  4CYC A;  2R5Z A;  2JWT A;  5M5Y J;  2CQX A;  2XPV A;  3JRH A;  4A3D J;  2JK3 A;  2LY9 A;  1BA5 A;  1GVD A;  2XRL A;  1E3O C;  4A69 C;  5E3O A;  3S1N J;  3RZO J;  2CQQ A;  4A3L J;  3FIS A;  1O4X A;  5EEA A;  2HOS A;  2VI6 A;  1PUF A;  2DA1 A;  2R7Z J;  3S1Q J;  3FK7 A;  4M6V A;  4FCY A;  2L0K A;  1QPI A;  3H0G J;  4A3C J;  4C3J J;  1JUP A;  1IV6 A;  2OF7 A;  2VUM J;  4G12 A;  3O8H A;  2R93 J;  4CYC B;  2R5Z B;  3HKZ N;  2L9R A;  3A03 A;  4HNV A;  1JUS A;  3FK6 A;  2D5V A;  1A5J A;  1MH3 A;  1BW6 A;  1ENH A;  1B72 A;  4Y52 J;  4D7N A;  1TC3 C;  5J1Y A;  4BBS J;  1MH4 A;  2NOG A;  4A3F J;  4AYB N;  5HOD A;  1OCT C;  3LOC A;  1JUM A;  5C3E J;  3C2B A;  4I6Z A;  1EF4 A;  1HOM A;  1U9N A;  1JKR C;  2NVQ J;  2XB0 X;  4UUS A;  2EZK A;  1G2H A;  4FE7 A;  1AKH A;  5IOY A;  2NS8 A;  2L7F P;  3HOZ J;  3QPS A;  3PM1 A;  3GTP J;  3IV5 A;  2IAI A;  2AHQ A;  3BG9 A;  1XS9 A;  4M3F A;  3GTQ J;  3JRG A;  3JRB A;  5EZG A;  1AU7 A;  2HQ5 A;  1A6I A;  3ZQG A;  3S2D J;  1B72 B;  3K7A J;  1WI3 A;  2LTP A;  3LSR A;  3BG3 A;  1UMQ A;  4QSH A;  1LFB A;  3HEF A;  1UHS A;  2M34 A;  4UUS B;  2ME0 A;  1VND A;  3JRC A;  5IP7 J;  4RDU A;  1AKH B;  3S17 J;  4W97 A;  5JLX A;  1BJZ A;  5GPA A;  4BKX A;  3WHB A;  1HCR A;  1WH5 A;  1IUF A;  2ECC A;  4FE4 A;  3GTK J;  4B1R A;  5F27 A;  2XPW A;  2DMN A;  3S14 J;  2XGE A;  4C3I J;  1I50 J;  3DCF A;  1MNM C;  3LNQ A;  4JX5 A;  2NVY J;  1IJW C;  2MGQ A;  4IHY A;  4C3H J;  2HOA A;  4AUX A;  4X1E A;  5FLV A;  2DA2 A;  4A93 J;  3LSP A;  3IH3 A;  1XC5 A;  2EZL A;  3JRF A;  2HXO A;  5DTD A;  3B6C A;  1IG7 A;  4RBO A;  1MSF C;  5K7Z A;  1W0T A;  3BR5 A;  4L5E A;  1Y1W J;  5J3L A;  2ID3 A;  1HDD C;  2ZB9 A;  1MBJ A;  1U78 A;  2PMZ N;  3Q3S A;  2M0C A;  1TWF J;  2VPR A;  1TWG J;  1OFC X;  4X6A J;  1JKP C;  5FJ8 J;  4J19 A;  5IYD J;  5GPC A;  5M5W J;  3GTL J;  5C4J J;  2Y0S N;  1ZTR A;  2YS9 A;  3BR3 A;  5FLM J;  4DW6 A;  4QTR A;  4IHX A;  2DA6 A;  3TP3 A;  3Q0V A;  3LSG A;  1IDZ A;  4V2F A;  3K2A A;  2JMW A;  3CDL A;  9ANT A;  2CUF A;  3BR6 A;  3LSJ A;  5F08 A;  4Y7N J;  3SFI A;  5IPA A;  1AHD P;  2XGC A;  2Y30 A;  4M3B A;  1W0U A;  3E7L A;  1GV2 A;  3TW6 A;  5F1J A;  3A02 A;  1RR7 A;  1FTZ A;  3I4M J;  1ZGW A;  5K7F A;  1Z77 A;  4NDL A;  5E3N A;  5FKM A;  4IHV A;  5F0H A;  3MVP A;  4GFB A;  3HOV J;  4MO7 A;  3HBL A;  2X48 A;  1Y1V J;  1X2N A;  2LKX A;  2FD5 A;  1QRY A;  4ABZ A;  2L7M P;  2WV1 A;  4EEF G;  1PUF B;  3HB9 A;  5BNG A;  2H8R A;  3M3Y J;  3ZOB A;  1GDT A;  5FKO A;  2HYJ A;  1Z0X A;  1B8I A;  3IH2 A;  1NK2 P;  5IP9 J;  1JKQ C;  3JRE A;  2YU9 J;  1WCM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...