1YRNA

Crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
49
structure length
49
Chain Sequence
ISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*TP*AP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA.
pubmed rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1995-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1yrnA00
5IP6A 2X9DA 4FE4A 4W1UA 2M34A 1FEXA 2MSYA 2ME6A 2KDZA 3HBLA 1TWFJ 3I4NJ 1VFCA 2N8GA 1UG2A 2E2JJ 1FIPA 1XS9A 1RKWA 2O7OA 5GPAA 2P81A 1ENHA 2D5VA 1QVTA 3JRHA 5EG0A 1MBJA 5K7HA 4JX5A 2R93J 3GTGJ 1JGGA 1HCRA 3A02A 2L7MP 1G2HA 3GTQJ 1MBKA 2TRTA 3CCYA 5EF6A 5E3NA 4XRMA 2Y9ZA 1HDDC 4AUXA 2Y31A 2LK2A 3ZQGA 2YS9A 5FLMJ 2LP0A 1FJLA 4GFBA 2HI3A 3BTIA 1E3OC 3S16J 2WV1A 1ZK8A 4MO7A 5JLWA 3S1MJ 5IOZA 4MFEA 5E3LA 2MGQA 4B3AA 4M3BA 5M3MJ 1HDPA 2CQQA 2LY9A 1JKQC 2HDDA 3D1NI 2PMZN 5EZHA 4B1RA 1ZTRA 2H8RA 3HGGA 2G0EA 3LSRA 4L5EA 3HDDA 2DTZA 3K7AJ 3BG5A 2YU9J 2LLKA 1I50J 2JA7J 1ZQ3P 4DYQA 4MIMA 2OF7A 4A3MJ 2WB1N 4DZJA 1K61A 4A93J 4W97A 2GLOA 1I3QJ 3TP0A 3JRGA 1JUMA 5J1RA 1AKHB 2L7ZA 4XRSA 1TWGJ 4DZPA 2XPWA 2NVXJ 2NVTJ 4DW6A 1P7IA 1SANA 3E7LA 1IGNA 1YRNA 3BR6A 5F1JA 1LE8B 1MBFA 2DA2A 2XPUA 3IH2A 1X58A 3VPRA 3S2DJ 4MFDA 5J3LA 3NARA 3GTOJ 3H0GJ 4A3DJ 4UUSA 2HYJA 1JJ8C 5BNGA 1TC3C 3IH4A 5E3OA 1U9NA 2Y30A 3WHBA 2AO9A 3M4OJ 1Y1WJ 5EDNA 3GTLJ 3OSGA 3QPLA 2TCTA 2LR8A 4DYRA 5EGOA 1JKOC 4IHXA 5K7FA 3Q0UA 5FLVA 3QQAA 1A6IA 3BR5A 4J19A 5GP9A 1RESA 3JRBA 4D7MA 2LD5A 3BG9A 2L9RA 5FKOA 1S7EA 1JT6A 1RKTA 1PUFA 1B72A 1XC5A 2NVYJ 3Q0WA 4QTRA 2OPTA 1JKPC 5IYBJ 4AC0A 3OOUA 3SJMA 1MH3A 5FKMA 4B4CA 5FKKA 2LTPA 3HOXJ 3OSFA 3L1PA 1APLC 1VI0A 1VNDA 5FKNA 1QVUA 2WAQN 3RKQA 1ETYA 1BW6A 4XIDA 1FTTA 2JJ7A 1X2MA 1NK2P 3BQZA 3G1MA 4M6VA 2O9LA 3M3YJ 3PM1A 1WI3A 3HOZJ 1R9TJ 3Q3SA 2JMWA 2XB0X 5C44J 5F0HA 1P7JA 3DEWA 3RZDJ 1T56A 2H1KA 2E2HJ 1IRZA 1MBHA 4RDUA 2KT0A 3ZQHA 4A3FJ 1BA5A 1WH5A 1ETKA 5EEAA 1RPWA 1O4XA 2XB5A 1BJZA 3A03A 4JYKA 3CQZJ 4A3EJ 5C3EJ 3S1RJ 3UKGA 1NTCA 3O8GA 1JKRC 3BR3A 3G1LA 1Z0XA 2HQ5A 1ORKA 2HOAA 3ZQLA 3FKIJ 4LOCA 2O8KA 1B8IB 2X48A 2CUEA 1VF9A 4M3FA 1QPIA 3C2BA 5M5YJ 5IPAA 2XGDA 1T33A 5IOYA 3S14J 3PO2J 2COBA 2QCOA 3WHCA 1AU7A 2Y2ZA 3HB9A 1BL0A 4G12A 1GVDA 4FCYA 3A01B 1AKHA 5FKLA 4Y7NJ 1HLVA 1ETOA 1AHDP 1IJWC 3LSJA 4I6ZA 1A5JA 3ZQIA 3JR9A 1SFOJ 2R5YB 5F27A 2EQRA 2LVSA 5J1YA 4M3DA 2GM4A 1DU0A 1LE8A 2ELKA 1OFCX 3HOVJ 1BW5A 1MSFC 5FJ8J 2E19A 1HF0A 1CQTA 2ME0A 1FIAA 4QIWN 1ZR4A 3HEFA 1GUUA 4A3KJ 1UMQA 1OCPA 2I10A 5IYDJ 2NS8A 2FX0A 1GV5A 4XICA 3MKLA 4IHVA 2JA8J 2IBDA 3S1NJ 2DA5A 1HOMA 3MN2A 5C4XJ 3BR0A 4A69C 2DA3A 2DMPA 4D7NA 5DTDA 3TW6A 3GTKJ 2ID3A 2XSDC 1RETA 2FD5A 4V2FA 1F36A 1GV2A 2AHQA 2VKEA 4NDLA 3SFIA 2ZB9A 5IP9J 1YRNB 2QF7A 3LOCA 2JN6A 3HOWJ 3HOYJ 1QRYA 2NOGA 3I4MJ 4CYCB 5M3FJ 5HODA 3RZOJ 4RBOA 4S0HB 5F0FA 3BR1A 4UUSB 5JLXA 1IG7A 5EZGA 1ZR2A 4X6AJ 2CQXA 2L0KA 4M3GA 2M2EA 5IYCJ 4IHWA 3IV5A 2B63J 4FTHA 3TW7A 1DU6A 2DMTA 3BT9A 2K9NA 1IUFA 5DS9A 3JRCA 2R5ZB 1D5YA 4BKXA 1LFUP 3JRFA 3S17J 2HXOA 1OJLA 1JTYA 4XRSG 1Z77A 5IP7J 4A3CJ 2DMNA 3LSGA 2ID6A 3S15J 1I6HJ 2HOSA 2CJJA 2ECBA 1H8AC 2ECCA 2W48A 3HM5A 2DMUA 4M3EA 4DYCA 5GPCA 1W0TA 1MH4A 1PUFB 3GTPJ 2R7ZJ 4A3JJ 4C3IJ 3JRDA 1F43A 4C3JJ 1LFBA 3H3VK 2DA1A 4V2GA 3IH3A 1NK3P 1K83J 1JT0A 1ETWA 3BG3A 4JP0A 3S1QJ 3SDGA 2EZKA 2VKVA 2NVQJ 1ITYA 4D5FA 1WPKA 3OIOA 3RQIA 3JREA 4EEFG 2E1OA 3GBGA 3BR2A 3LNQA 2IAIA 2XGEA 3B6CA 4C2MJ 3BQYA 4FE7A 3S2HJ 1B8IA 5EYRA 3F0CA 1GDTA 3HGYA 2EZLA 2JWTA 1ETQA 4A3LJ 3CMYA 1IC8A 1WH7A 1XG1A 1MBGA 1GT0C 3DCFA 5EG0B 4D5CA 2EZHA 2MW8A 3B6AA 3QPSA 4BY7J 3FK6A 5F0CA 3A01A 2CRGA 2DA7A 3GTJJ 3BTJA 5F08A 5C4JJ 3TEDA 2EBIA 3G1OA 4UUTA 4BBRJ 9ANTA 1U9OA 2R5YA 3HKZN 1ETXA 1TWCJ 3BTCA 2VUMJ 1FTZA 2VPRA 3CDLA 3FISA 4I76A 2M9HA 3ZQFA 3JRIA 2EH3A 1UHSA 1X2NA 1ZGWA 1H88C 1ETVA 2GBYA 3PO3J 1JUPA 2YUSA 1POGA 1U8BA 2Y0SN 4BBSJ 4BY1J 2JA6J 4JX6A 2DMQA 3TP3A 3O8HA 1JUSA 2K9SA 1RR7A 2X6OA 2LFBA 2DJNA 2XPVA 4IEJA 4QSHA 2FJ1A 5K7ZA 2CU7A 2R92J 3MVPA 1H89C 2EZIA 4JX4A 1MNMC 1EF4A 2K40A 2XGCA 1MBEA 2M0CA 1TWAJ 1WCMJ 2MG4A 5M5WJ 4Y52J 3GTMJ 1WGXA 3W6VA 3LSPA 4A3GJ 4HNVA 1OCTC 1Y1VJ 4CYCA 4ABZA 2HXIA 2XRLA 3ZQCA 1W0UA 1IDYA 2FQ4A 2HOTA 2E2IJ 2L7FP 2R0QC 2JA5J 2M8GX 1IV6A 2RAEA 1JJ6C 1ZKGA 2DN0A 3NAUA 4AYBN 3ZOBA 2CUFA 2Y9YA 2R5ZA 1U78A 2K9QA 2NS7A 2DA6A 1MSEC 3K2AA 5F04A 2LKXA 2JK3A 1JTXA 2IEKA 4MLOA 4IHYA 1IDZA 1Q1VA 4A3BJ 5EGOB 5J1UA 4XK4A 5M5XJ 4A3IJ 3HOUJ 2VI6A 3JRAA 2DA4A 1TWHJ 4BXXJ 3FIWA 4C3HJ 3BTLA 3Q0VA 4X1EA 1B72B 4FISA 5E3MA 3FK7A
chains in the Genus database with same CATH superfamily
3OL4A 2GAUA 4OU0A 3CMEI 4FE4A 3OYGA 2V79A 3IUOA 2HQAA 5E8GA 3HL2A 1M1EB 4XBFA 3HYIA 5H6RA 2P8TA 3HZJA 2Y75A 3LSTA 2DXIA 1ON1A 1YJNI 3ROUA 2IW5A 1XS9A 3LL7A 4LK0F 2CO5A 3WU0A 4XKCA 1OR7C 3HOTA 2VOOA 3T8TA 3JRHA 4WWCA 1MBJA 4JX5A 2DLLA 3FMSA 1EH8A 2EV6A 1I5ZA 2L7MP 3A02A 4CCKA 3CC7I 1G2HA 1MBKA 2Y9ZA 1VQNI 2VXZA 4AUXA 4XL9A 1ZG1A 3ZMUA 1Y0UA 1U6GA 3FXUA 4IXAA 1ZRFA 1U0JA 2NXNB 3BTIA 4R79A 3QPHA 3OS2A 2WV1A 1T39A 1E3OC 1ZK8A 2IS4A 4XSZF 1SAXA 2MGQA 3SXYA 4B3AA 2EWNA 5CQEA 1S5LC 1HDPA 3PJRA 4GYIA 1IN8A 2CQQA 2LY9A 5HLHA 2ZC2A 2HDDA 4Q48A 3M3YJ 1RC9A 4B1RA 5CYVA 3I58A 1U8RA 2I8DA 2DYRH 4BEHA 3DEEA 4BS9A 2QA4I 3WU1B 3K7AJ 4OAZA 3H9GA 2YU9J 2LLKA 2YPRA 3JTGA 3W6KB 2JA7J 1ZQ3P 1RIOH 4MIMA 1Z3XA 3D5RC 3I0TA 4R8HA 1BOAA 4Y17A 3VDXA 2W25A 2OQGA 5D6FA 3HXLA 4LIVA 3KYDB 4XLCA 2P5KA 4EVIA 1KZHA 1R58A 2DFFA 1AKHB 1OPCA 4EM2A 2XPWA 2BZTA 1SANA 1QBJA 3E7LA 1T2KA 1USSA 1YW7A 3BR6A 3VYRB 3L2UA 3KYCB 2NNNA 2XPUA 4AU7A 5L3BA 4L5JA 5GTHC 4XLFA 1XMKA 4FASD 2DAOA 3FF5A 1L3LA 2QBYB 2K02A 1RR8C 3AG2H 2JVHA 4V19K 2A6EF 3FWEA 2XVCA 3CZ6A 1R1TA 1IUYA 2J5OA 4M9XA 2VT2A 1Z6RA 2VPLA 1FSHA 1MIJA 2IA0A 3OYCA 1VZ0A 3HG9A 2R7DA 1W5TA 3E6MA 4ESFA 4IF4A 5FLVA 3G6EI 4E7KA 5FB2A 1FOXA 4J19A 2BBYA 2K4BA 3IRRA 2LD5A 2EK5A 1MJ9A 2M1BA 3HUGB 2DPDA 2PLYA 1JT6A 2FMLA 2CW7A 3QOPA 1G3TA 2QQAA 4I7HA 1LQ1A 1L0OC 3LSMA 4BDZA 2NVYJ 1ODDA 4P5OA 5DYMA 4G6TB 3HSEA 1J7KA 2KISA 5IYBJ 5L3EA 3SJMA 4WX9A 1O7FA 3NWTA 4B4CA 2Z33A 2LTPA 3HRSA 1APLC 3TQNA 2QM3A 3QAHA 2XF7A 1VNDA 5FKNA 4YFNF 3CCRI 2F5VA 1ETYA 1LEBA 3DEUA 3S3MA 1FTTA 2M7BA 3C1DA 3F9KA 2O9LA 3HOZJ 1EH6A 3RSNA 1R9TJ 5GAHJ 3CMAI 1QZYA 1W7PB 5F0HA 1P7JA 2BVMA 4NC8A 5F1RA 2OU2A 5D5XB 4YFXF 3RZDJ 1IRXA 2H1KA 3I56I 4XM3A 3H3UA 4RGUA 1Y56A 3WODF 2PMUA 2GQQA 3CLOA 1QA6A 1BJZA 5LRRA 1YHQI 1WJEA 4E6KG 3DTEA 1NTCA 3G71I 1P4WA 2ZNYA 2EIJH 3O8GA 2DT5A 1Z0XA 5TJJA 4XN3A 2HOAA 1D3YA 1BI2A 4IRIA 3F8NA 4DJAA 4DNCA 2XGXA 4RAFA 2CUZA 3F22A 2CUEA 3BJ6A 4NUBA 4EJOA 2V1NA 5M5YJ 5IPAA 1T33A 3MEXA 1FX7A 1AU7A 5E1XA 4OIQF 3Q9SA 1X1BA 4C9YA 4G12A 3J7YJ 3MFKA 1P9QC 4ANJA 4IO9F 3A01B 1K78A 5FKLA 3IKTA 4IOCF 2O6GE 1AHDP 4BQQA 3LSJA 1JHHA 4I6ZA 1A5JA 5JR3A 1Z91A 3M7GA 2LVSA 2VKDA 4KICA 5J1YA 4M3DA 3H9JA 2ELKA 1A31A 1S3JA 3OR1C 3CCLI 1U5TA 2MD5A 3M9AA 2ME0A 5ICFA 2KFDA 1ZR4A 2ETHA 3HEFA 4BE0A 1MDMB 4A2UA 1OCPA 3JSOA 4KIGA 4HSRA 1UFMA 2K9MA 1ZLJA 3CJQB 2CWEA 4IHVA 4NQWA 2IBDA 2DA5A 3EPZA 1HOMA 3V7RA 2ZCWA 1UG0A 4M9ZA 5C4XJ 1ZELA 3KEYA 3PUBA 3GTKJ 1ACIA 2A3SA 2XSDC 1G8XA 1RETA 1O3RA 1Y8RB 1ZN2A 3KEQA 1GV2A 3LSIA 3FXJA 4LGWA 3CP2A 3SFIA 3HOWJ 3WGIA 2HPMA 2BXZA 3GFJA 1DGRM 4MQVA 4ESJA 5JLXA 1IG7A 2DPUA 2BHYA 4YRVA 3CCJI 4X6AJ 2JPCA 5CPRB 2L0KA 1J0RA 2B7EA 1U2WA 3CF2A 4M3GA 5GTIC 3IV5A 1WRJA 3TW7A 4UVBA 2VXDA 1W4MA 2ISYA 3HKZA 1XX5A 3R4KA 5HS7A 3WE3A 5HDKA 3E6CC 3JRCA 5DS9A 5B1BH 2AS5F 3GCMA 1LFUP 1B9MA 1MW7A 4YFKF 3JRFA 4KITB 5IP7J 4ZYHA 2L4MA 4OMZA 1I6HJ 2KIQA 3RKYA 2R7TA 3WG9A 5LHIA 4BU2A 1BI3A 1GXQA 2PQ8A 1W36C 2RNGA 1VQOI 5GPCA 3GTPJ 2F4IA 3QODA 1G6NA 2W00A 4C3IJ 1OCOH 2WBMA 4C3JJ 1XSVA 2LREA 4PGGA 4GDFA 3IH3A 3ZCOA 1NK3P 1K83J 2HKOA 2STWA 2IXSA 2JVGA 1ITYA 3A2KA 1WPKA 2GXAA 3JREA 4NC6A 3PNYA 2QSHX 3LNQA 1HSJA 2K7LA 3B6CA 4C2MJ 3BQYA 3FM3A 5EYRA 1DGWY 2F48A 1TQPA 4ZYAA 2RKHA 2EZLA 4B09A 2JWTA 1ETQA 2VT3A 2VC1A 1IC8A 4PFOA 2IGMA 1MBGA 2JTVA 3RQ4A 4D5CA 4DGWB 5E17F 2MW8A 3B6AA 3FK6A 5B5EC 5F0CA 2VJ4A 3GTJJ 4WXCA 2X51A 5F08A 5KHDA 2VODA 4FETA 2IGOA 1K79A 3ZMVA 3V8JA 4ZYEA 1HA8A 3G1OA 3VODA 4IJAA 1C0WA 1LDKB 1I1GA 5LHGA 1R1VA 2HVRA 3HKZN 5E1ZB 4ZH4F 3CDLA 3K4JA 3QP5A 2VJ5A 2M9HA 3ZQFA 4XLNF 2R7SA 4EGZA 2STTA 3GZ5A 1ETVA 2GBYA 3PO3J 1SVLA 4IRGA 1AWCA 1ZG5A 1IRGA 2CGPA 2QBYA 3OWTA 3BPXA 4BEHB 2K9SA 1STZA 2JSPA 1RR7A 2VBYA 1JHFA 5L3DA 3DQVC 4BJ5C 2KMUA 2DJNA 2PFBA 1FY7A 5J47A 2FJ1A 4AWXB 1FBSA 3EYIA 3MVPA 2EZIA 2NOJB 2OBPA 4HA8A 2K40A 4L18B 3CP8A 2XGCA 5CQGA 3G2BA 2V26A 3GUDA 1NH3A 4G7ZF 4ITVA 3FXOA 2X1EA 2X4HA 2HEOA 4OAYA 2P7VB 1OCTC 1S29A 2EA2A 5D5VB 4XOPA 4B43A 3BCBA 1SMYF 2HKXA 2WAFA 4WXDA 4CCNA 2HOTA 3FBNB 1O57A 1XCVA 2D1VA 2FQ3A 2L7FP 2D45A 4CICA 3K2ZA 2JA5J 4XKVA 3J81Z 2IPQX 2RAEA 2PEXA 1J09A 1ZRCA 1ZKGA 2Y48A 3QOEA 3K10A 2MA3A 2DDBA 3G3ZA 2FA5A 4G6DA 5LHHA 4S05A 1BIAA 2LKSA 3FBIB 5GADJ 4YIRX 1R22A 3OYAA 3HHGA 3K2AA 2JK3A 2IEKA 4IHYA 1Q1VA 1USTA 1YS6A 4BJTA 4ZZLA 3BPVA 2F5EA 5J1UA 3HSFA 3OYFA 2AXLA 4A3IJ 3F6OA 2IA1A 1PP7U 3LFKA 1IV8A 2X1DA 2FBIA 4AM3A 2K4JA 3VB2A 1FWZA 3MMYB 3P9KA 2DA4A 3DV8A 2EV0A 1OCRH 1BC7C 3FIWA 4M74A 2VONA 4E7JA 5FD5A 4LD5A 3CF5F 4KFCA 4LFUA 1G3SA 2MLGA 2X9DA 2OC6A 2EPFA 2MSYA 2Q2EA 1PDNC 2LOOA 4KMUX 3UR3C 2KDZA 5KVRA 5BPDA 4IHTA 4GGGA 1TWFJ 1VFCA 1XPXA 1UG2A 2W24A 1FIPA 3PQJA 1RKWA 2CW8A 2UXNA 4NC7A 4WK8F 2DW4A 3SQNA 1XDSA 1FC3A 1LDJA 1JGSA 2A05A 4HZFA 1R5HA 4N9HA 4HYEA 4ENKA 2EFWA 1X1AA 2GXGA 2CFXA 4JK1X 4EQQA 3GTGJ 2QQ8A 3IP4B 2ADUA 1H9TA 3K69A 2DCEA 3LQRA 2KRFA 5E3NA 4CZCA 2MBFA 1TP4A 2L2OA 5K5QA 4B44A 3ZQGA 5DUIA 2YS9A 2JZYA 5GAEJ 4AD9A 1FJLA 1FSEA 1P6RA 3WGHA 1A35A 5JLWA 3OYLA 4YEJA 1FT9A 3S1MJ 3HPHA 4MFEA 5IOZA 1UJ8A 1XMXA 1R6RA 3QRFF 1Z7LA 1ZYRF 3E5UA 3W2WA 1SVOA 2VQHA 2ZXIA 3SZPA 2P7CB 2ZXWH 4BXUA 3D1NI 4PUSA 3M1CA 2P5VA 3TOBA 1EV7A 4ASNA 1ZTRA 3GFMA 2G0EA 1J75A 1MJAA 1FMVA 2GA2A 4I02A 1MDMA 3S3OA 3HDDA 3RPQA 2DTZA 1OMIA 4RB0A 3U1DA 4AIJA 2R7XA 4RAZA 1I50J 4A6EA 5GAGJ 4J00A 2R7VA 2UXXA 1WJBA 3DFGA 2EFNA 5AIQA 3PNVA 4KN4X 1MNEA 1X4PA 1XN7A 2BGCA 3QWLA 4PK4A 2WAQA 3OYKA 1WSUA 1Y0NA 4L9VA 5TISC 4N4OB 3C18A 5J1RA 1K78B 5CVJA 2QSFX 2OZUA 4DW6A 2BE5F 1EH7A 1P7IA 2KL4A 4LG0A 2F4OB 3HJEA 3SEQA 3TOAA 2K5CA 3ABTA 3BCAA 4KJZA 4EATA 4F92B 2OD5A 1R5ID 3N97A 1YIJI 4BNCA 2W1OA 2YX7A 1FOYA 4MFDA 3VOEA 4A0XA 4M9SA 4FT8A 3MZYA 1XCBA 4A3DJ 1QO0D 3LAPA 2HTJA 4L9NA 1VTNC 5HLTA 4GYGA 2NVUB 5DD8A 5BNGA 2EINH 2KHMA 3MKZA 2OZ6A 3H5AA 5JI6A 2KKOA 3CLQA 1UAAA 2XAHA 2XAJA 4CDGA 3M4OJ 1BIBA 2AO9A 2VIXA 4YG2F 4UVAA 2F5CA 3QPLA 2Z2SB 3GLXA 4DYRA 1JKOC 2W7NA 1IN7A 1PVEA 5E18F 3BR5A 4KIBA 4EJWA 5GP9A 3AL0C 1FP1D 1B59A 3JRBA 2E71A 2Z16A 3TO6A 2HDCA 3NRVA 3DKYA 1YG2A 2E1MC 2HZTA 2L9SA 2KQRA 3E1SA 4ZDPA 3WTZA 1CF7B 3Q0WA 3ULQB 1YW8A 1R23A 1IW7F 2OPTA 2R7UA 3M8EA 2UWMA 4AC0A 4AVZA 5A2QZ 1ZHFA 1TLHB 3HOXJ 5FKKA 2EV5A 3OSFA 2MC3A 4PJJA 1VI0A 1R71A 1QVUA 2WAQN 2FXAA 2GOMA 2V9PA 2HWVA 2WC2A 1NK2P 4Q4ZF 2Q1ZB 2RREA 2YX4A 4GO1A 2K86A 3PM1A 5FO5A 1HBXG 2JA2A 2MLKA 2JRTA 1SFUA 2Z3YA 1X4OA 3K0LA 4G6QA 3J7AO 2JMWA 2JUGA 4XLHA 5E79C 3IHUA 1IXSB 2E35A 3DEWA 4LB6B 4I01A 1R5GA 1Z1DA 2YSRA 4U0VA 2IT0A 3HOSA 1IRZA 3KP2A 1FOWA 2M0MA 2DK8A 4A3FJ 1ETKA 1LPQA 1VQ9I 5EEAA 4A0ZA 2LG4A 1EKEA 3TO7A 3REOA 1B6AA 3CQZJ 4A3EJ 2QYOA 5C3EJ 3S1RJ 1NG6A 3M1EA 3LSHA 4U0YA 1B1BA 3BR3A 3P9IA 1D0XA 2BVLA 2EFOA 2O03A 3CUQA 2M4KA 4LOCA 2M7AA 1D0ZA 1VF9A 1A36A 2CYYA 3K4LA 5HS8A 3OR2C 2HFHA 2QCOA 3WHCA 1PJRA 1G3YA 3H3ZA 3T8RA 4KNYA 1MMAA 1ETOA 5DV5A 4RM2A 4PCQA 5HNHA 3ZQIA 3JR9A 5F27A 1RRJA 2E1NA 3E3VA 2ZMEA 1WHUA 2LRDA 3F72A 1HC8A 4MGRA 4KMFA 4WCGA 5FJ8J 3R0JA 1QHHD 2FRHA 5J8CA 1FIAA 1CQTA 1PYVA 1GUUA 3LMMA 4A3KJ 2HYGD 2RC4A 3BLYA 3EUHA 2FSWA 3E5XA 3KLNA 4QPOA 1N77A 1HKSA 4C2TA 2V1XA 2BY0A 1T08B 2H6CA 2I10A 5IYDJ 4E7SA 1YE9A 5L3GA 4M72A 3W2AA 4EMSA 3MKLA 3VYSB 4HQMA 4KUMA 4HF2A 3BR0A 2DA3A 4D7NA 5DTDA 3OS0A 1OQYA 1P4AA 2VN2A 3KIOA 4UHTA 1QGPA 1F36A 4GRIA 3WTUC 4NDLA 2CQNA 2MFZA 2ZB9A 1XTAA 2ZJRF 4I0BA 2DOEA 3DPLC 1XDUA 2QF7A 1XD7A 4KT5C 3RDIA 3HOYJ 2NOGA 3I4MJ 2XV4S 5M3FJ 5HODA 3CCMI 2DT6A 3BR1A 5HVQC 5H20A 4MNUA 2D1HA 1SD4A 4A0YA 5JVGF 2IS1A 2EFPA 3OYNA 4DQ2A 2RGVA 4IHWA 5E20A 4CCJA 4HNUA 3JW4A 2DMTA 1KQ9A 3KCCA 2K9NA 1IUFA 2FBKA 2PG4A 4CCOA 2HYFA 4F7ZA 3SZGA 3F23A 3TDZC 2A68F 2HXOA 4RGRA 2HZDA 3PSFA 1OJLA 1JTYA 2JUCA 1WVRA 1TW3A 2DI3A 4A3CJ 2DMNA 2Y0SA 4BXFA 2HOSA 2IRFG 2MH9A 2CJJA 1WJAA 1H8AC 1G4DA 2KPMA 1ON2A 3HM5A 4DYCA 5DM7F 4XLPF 1IRFA 2PJPA 3I5UA 3JRDA 1F43A 3I54A 3K70D 1I39A 3H3VK 1T6SA 3FXMA 3LSKA 3OYDA 4BDYA 2DA1A 4V2GA 2CMPA 3KZYA 1YFHA 3AG4H 1Y8QB 4JP0A 4L9JA 3S1QJ 2ESNA 2EIKH 3CDIA 5FGMA 4D0PA 4XKWA 4D5FA 3ABUA 2Q2EB 3KP6A 1N78A 4MEYF 5CJ9A 2FOKA 1RZ4A 3BR2A 2IAIA 1U3EM 1KQ8A 3BJAA 3MKYB 2RV8A 2BY3A 3BZ6A 2CV1A 1P92A 2EA4A 1U5TC 1T98A 2ZFWA 2CV2A 4Q5SF 4A3LJ 2ELHA 1WH7A 2DJIA 4AIDA 1T38A 2LF7A 4RGXA 4I0AA 2Q0OA 1RUOA 1LDDA 1BJAA 5E8IA 4UB8C 2PN6A 3BOQA 3Q9VA 3BTJA 4RAYA 4L0YB 1X1CA 1X3UA 2XRNA 1FLIA 2L54A 5L3CA 2VLAA 3O2PE 2BYVE 4BBRJ 1U9OA 4QPQA 2VKHA 3E6BA 5K1YA 1BI1A 3FXKA 3I64A 2QENA 4CH7A 3FZVA 2M8EA 2H09A 3L7WA 2VUMJ 2VPRA 2Z99A 3PQKA 4P9FA 3LA3A 4D1QA 3ERMA 3OIPA 5HS9A 1ZGWA 1H88C 1JUPA 1U8BA 5CVRA 4U87A 3M07A 1S9HA 2Y0SN 4IKFA 4BBSJ 4L5IA 5JHFA 3MAJA 3QP6A 4JX6A 1WJDA 2WAEA 3F8CA 1REPC 4II3A 3LQQA 2ZJ2A 4OIPF 3I55I 4ZTFA 5ICGA 1D8KA 4IEJA 3CUOA 5K7ZA 2CU7A 2E7XA 5FROA 2GA1A 3P5JA 3PIOF 1YYVA 4O5VA 5LRSA 2WWYA 2UZKA 3R6SA 1MBEA 1KU7A 3TGNA 2P5LC 2QGUA 1ONVA 1WGXA 5FLXK 4BJ6C 4XN0A 1YLFA 5DDGA 4PSWA 1Y1VJ 3DLLF 4LG0B 2HXIA 1NHAA 4RB1A 3SZTA 3L2CA 1W0UA 1FPQA 1IDYA 3HRTA 2DT7B 2E2IJ 4F55A 1CF7A 1AOYA 3CESA 4RM3A 1PP8F 1B9NA 1SFEA 2ELJA 2OV7A 4UV9A 3DU5A 2B0LA 1IV6A 5CVVA 4CYDA 3WG7H 2DN0A 2DBBA 2M45A 1WJCA 1SD7A 2COMA 1KGSA 4H4KC 2R5ZA 1ZGJA 3ZPLA 1U78A 3ZMDA 1MZBA 1MSEC 4N0BA 3K4KA 1DDNA 4LITA 1J9IA 5F04A 1JTXA 3OYEA 2L5QA 4A3BJ 2VBWA 1V55H 3QYFA 1A04A 4IQJA 4M6XA 4HDUA 3HOUJ 2PJRA 4QLCU 3KZZA 4Y4RA 4KYWA 2IA2A 4LB5A 3N05A 3F3XA 1F4KA 2H6BA 5D5WB 3K1NA 1TTYA 4X1EA 4BUPA 3FKJA 4FISA 1W1WE 2PI0A 3FK7A 5IP6A 3ZMZA 3RIRA 2M34A 1EA3A 1FEXA 3CJNA 3AAFA 2IS2A 3HBLA 3K4NA 1FYMA 2LNBA 1IAWA 3I4NJ 2KDOA 2N8GA 5IT9K 5D4SA 2O7OA 3ZN0A 4HF1A 4IPAA 3E6DA 4ESBA 2P81A 4ZTJA 2FU4A 2Q8KA 4HX7A 4LG3A 5JVTA 2R7RA 1KU2A 1ENHA 3C2GA 2JT1A 3JAMZ 5FD6A 1P2FA 4YIIA 1TBXA 1MMSA 3W3CA 3OV8A 1JGGA 2W85A 2XAFA 2MYSA 1TNTA 4G7HF 3CCYA 5EF6A 2EJRA 2Y0MA 4QWQA 4MTDA 1HDDC 4PSXA 4C2UA 4E7IA 1VQMI 4EJTA 1QZEA 3HTSB 4HX8A 4YIFA 5FLMJ 2LP0A 2GIZA 2VOPA 1ERDA 3MCZA 3BJOA 3C7JA 4MO7A 2GXBA 3KFWX 3V4GA 4BHBA 3SHFA 4XSXF 2BEOA 1UZCA 2K3FA 4HX4A 3EYYA 4HG2A 2QZ8A 2AQEA 5DUKA 5M3MJ 2ISZA 3VEPA 5B66C 1VQ4I 3GLLA 4TV7A 1JKQC 1ZAOA 1UHMA 2BY1A 1E17A 1BBYA 1SEUA 5KAFC 3CUQB 2AXTC 3N4MA 4XONA 4ENNA 1I3AA 3BG5A 1BR4A 3HRMA 2W57A 3DKWA 4AIKA 2ESHA 2YU3A 4A3MJ 1IXCA 3DXJF 3RKWA 1RUNA 3IAS2 1K61A 4A93J 3G73A 5EEHA 2M4GA 2GLOA 1I3QJ 3TP0A 3JRGA 2L7ZA 4XRSA 2L9VA 3RKXA 3H36A 2NVTJ 5HLIA 2JSCA 1NG7A 4BQAA 3FXLA 3ABLH 1EJ9A 3MZ8A 2ZMEB 3TBIA 5IY5H 5HLGA 2DA2A 3IH2A 4I09A 1X58A 2HPIA 1JI8A 1OKRA 2RQPA 4LJZF 4E7HA 5J3LA 3GTOJ 3MD2A 2H1LA 1I27A 2R7FA 3TMOA 2HYJA 3B02A 5ILVA 4IZZA 2CV0A 4F91B 5ICEA 2V9KA 5E3OA 3V8LA 2Y30A 1HXDA 3WHBA 1Y1WJ 2XF6A 3GTLJ 4RGSA 3OSGA 1E2XA 5EGOA 3H92A 1UCRA 2LDUA 5K7FA 5AIPA 3K6GA 4HBLA 1F5TA 3HSRA 2MD0A 1FBUA 1UELB 3OIQA 4E4HA 3G4SI 4BACA 1QPMA 4D7MA 3RPUD 2L9RA 5LGUA 5FKOA 1S7EA 1QQIA 1XSXA 3H35A 1RKTA 1Z21A 3L2VA 5BPIA 1YI2I 3DF8A 4XLAA 3CDHA 2BHZA 4KDPA 1UHWA 1JKPC 4MQ9F 2FF4A 3HRUA 5JHUA 5FKMA 2IS6A 2A07F 1SMTA 1A6QA 3L1PA 3J80Z 1OYIA 1O3SA 1DUXC 3RKQA 1G59A 2XAUA 1FBQA 2JJ7A 2Z5UA 2CH0A 3OOPA 3QU6A 4HEA2 4OWRB 5CVUA 4ZJZA 2Z9OA 2E1CA 3BQZA 3G1MA 1WI3A 2IGKA 2X6WA 3PNTA 4GXOA 2E36A 2GOXB 5LLQA 1IN4A 1YO5C 2KIMA 3Q3SA 2FE3A 3CJTB 3F6VA 1JXSA 3CCEI 1DPUA 5C44J 2VBXA 3ECHA 2ZSHB 3ABMH 2NS0A 2XF5A 1YJ9I 2XAQA 2L4AA 2E2HJ 3FMRA 2A6HF 1MBHA 3KEOA 2KT0A 3OL3A 2DFHA 5LGNA 2KJBA 1RPWA 1SD5A 1O4XA 2XB5A 3A03A 4JYKA 3UNGC 3CCVI 5EJCA 4PJLA 2YR2A 2J5PA 1IN5A 3G1LA 3F8MA 3MZHA 2LKPA 3FKIJ 4I98B 3M8JA 4EM0B 6PAXA 2D2WA 1FOKA 2E5ZA 2JQ7A 3IC7A 1OYWA 4M3FA 1HW1A 1V5FA 3C2BA 1QPIA 3R61A 4HW0A 3VYTB 2XGDA 2RVCA 4CO8A 4DOZA 4EGYA 3ABKH 3V7SA 2XROA 1D0YA 2Y2ZA 3HB9A 1OYYA 2L9NA 1GVDA 2HTSA 1YQAA 3I9V2 4XLEA 4FCYA 4XKBA 4Y7NJ 1HLVA 3C2HA 1MNDA 3P9CA 3FHZA 2GM4A 3WTWC 1LE8A 1OFCX 3HOVJ 3GFIA 3FXRA 3AKZA 1YTYA 1MSFC 1KA8A 1SD6A 2WA0A 2HVSA 3BWGA 2XSJC 4IX7A 3J81K 4QIWN 4EV0A 1DPRA 2LY2A 4I2OA 1UMQA 2DODA 1IO2A 3X2QH 1X3ZB 3PSIA 1WZ2A 1W36D 3GMEA 4BE1A 2DTRA 2FX0A 4IVNA 4CUGA 1GV5A 4XICA 4ETSA 3V7CA 1QNTA 3CMMA 1OCZH 4UUVA 3S1NJ 1WFXA 4KIFA 5LGTA 1E3HA 4M71A 1LEAA 3GVAA 2BY2A 2DMPA 3OMYA 3TW6A 2UV1A 2KIUA 3F8BA 3IKVA 3HTUA 3KPHA 1J5YA 2FD5A 5HDNA 3VYUB 4V2FA 1WQ2A 2OJED 2DFEA 2VKEA 3RYRA 3WE2A 5IP9J 1YRNB 1ZGAA 2EB7A 2JN6A 5BOXA 1MJBA 5FRMA 2ZNZA 4CGZA 4IRHA 2G7HA 4S0HB 2LBFA 4UUSB 3JTHA 4WXHA 4IOAF 1VQLI 2R3SA 4BQOA 1SFKA 3ZR8X 1MMGA 3DBHB 2M2EA 1T0FA 4L9TA 1T8IA 2B63J 2JPBA 2LC2A 4FTHA 1QU3A 1TZLA 1HSTA 2CQ7A 1DU6A 4NB5A 4PGHA 4MTEA 4UY8I 3BT9A 2L01A 1Z05A 2XAGA 2R5ZB 4BKXA 1X19A 2KZVA 4XRSG 1ZG3A 3EUAA 1Z77A 4OMYA 3RCOA 3CCUI 1WKMA 2ID6A 3KP7A 3OS1A 3EQLF 3QU3A 2DO7A 2RNJA 4G94A 2ECBA 1MD0A 3NQOA 2W48A 3A4CA 3ONQA 2PJRB 1MGTA 2R7QA 2DMUA 4FHTA 4JQFA 4X0GA 1PUFB 1DQUA 1MH4A 1J59A 2DQLA 3T1BA 2KZGA 5H2FC 3SEZA 3FM5A 4HNTA 1X1DA 1SVMA 2Y69H 2ZJQF 3WTSC 1LFBA 5LBQA 4UV8A 1JT0A 1ETWA 3BG3A 5B3SH 1BC8C 3SDGA 3QPTA 1FZPB 1N25A 4Y33A 2QKLB 4E7ZA 2G9WA 2DU9A 3OIOA 3RQIA 4Y13A 4EEFG 2BXYA 2E1OA 3DBLB 4HOBA 4ZYDA 3IRQA 2OCCH 1GLNA 2ZMEC 2V1UA 1HKTA 1B8IA 3F0CA 2R7WA 5BS6A 1GDTA 3HGYA 2X6XA 2NRAC 3GO5A 4EJUA 1W7PD 1VQ6I 3CMYA 4BAYA 3WTYC 1GT0C 5DD4A 3DCFA 3DKXA 1S8NA 3EUHC 2O61A 1Y39A 4CHUA 3QPSA 2VQCA 4H0EA 2DA7A 3GYHX 1LVKA 3TEDA 2VQGA 1FP2A 3LWFA 9ANTA 4G9YA 2R5YA 2PMHA 2XASA 5DEQA 1HW5A 1ETXA 1TWCJ 2EFQA 1WI9A 4OIRF 1OR7A 4I76A 3ZGKA 3JRIA 3K9TA 3J7AY 2EH3A 1UHSA 1X2NA 1D1BA 2YUSA 3K1PA 1POGA 3L00A 3CTAA 4DBRA 4II2A 3IAM2 3H5NA 5KAIC 4BY1J 2FBHA 3K1MA 2JA6J 1DP3A 2DMQA 3TP3A 1UB9A 4HRIA 1BR1A 2QLZA 3O8HA 4E7LA 1IF1A 3BDDA 1JUSA 2GWRA 3T0YA 3A1YA 3O3KA 2PX9A 2LF8A 1VQPI 2QKMB 4A6DA 2LFBA 4QSHA 2R92J 2CQKA 1X3WB 2X0LA 1H89C 3MQ0A 2HQNA 3ELKA 4JX4A 1MNMC 3S32A 1WJFA 2DQRA 1V54H 2DOFA 5CKTA 1WCMJ 1V5GA 2IVMA 3CCQI 3BZCA 1SAUA 3LA2A 5M5WJ 4HQEA 4Y52J 4Z2YA 5J4YA 3GTMJ 4A3GJ 2O0YA 3I71A 2K3PA 4EJVA 4C30A 1BN5A 4CYCA 1FYLA 1XGSA 1D5VA 1ULYA 2XRLA 2QVOA 3PFYA 3LAJA 5TRDA 2ZBKA 3ERED 2LH9A 1YJWI 1KONA 2VB6A 4K2EA 5A2QK 4F52A 5EEGA 2ZKZA 5KCMA 2QUFA 5LFAA 1JJ6C 2V6CA 2DK5A 3OYIA 4HLXA 2VJIA 2HOEA 2QQBA 1K4SA 2Y9YA 2F6CA 1E0EA 1Q1HA 2DA6A 2QQ9A 2HNHA 1MKMA 4UB6C 3KETA 1FYKA 1IDZA 4XNFA 4B48A 5EGOB 2PMZA 3KYLA 1RI7A 3COAC 5D8LB 2X6YA 3DLAA 4XK4A 2M5WA 2DYSH 5FLXZ 2RN7A 2VI6A 3DTIA 5HNFA 3JRAA 2WY8Q 1VQKI 5ED4A 2HVQA 4ZC3A 3ECOA 2CW0F 1TW2A 2V1DA 1V5EA 3LA7A 5JFRA 2QEXI 1TT0A 2IP2A 3AG1H 3BTLA 3ZMSA 2WB1A 1FNNA 2K9LA 2XHKA 4XOTA 2F5DA 3TDUC 5IT3A 3PUFA 4M6YA 2DOAA 3WTVC 3KP3A 5DM6F 5E3MA 4CA0A 4W1UA 3WTXC 5ICCA 1SC7A 3GZ6A 4LK1F 2ME6A 3ASNH 3ZQ7A 1IZ1A 2G7UA 2LYCA 4ZDLA 3BG6A 2E2JJ 1GXPA 3FHNA 1TT5B 1QHGA 4XORA 5GPAA 2HR3A 3T5XA 4Q47A 2UUZA 3JSPA 2WADA 2D5VA 1QVTA 1YX3A 3RYPA 5EG0A 3U2RA 3S3NA 2A69F 2M30A 1F1ZA 5K7HA 1YOVB 2R93J 1IN6A 5H6QA 1HCRA 2HU9A 3KX2A 3GTQJ 2TRTA 1OCCH 4XRMA 2WTEA 2Y31A 2BW3A 2LK2A 1F9NA 3ZQQA 3WTTC 3ZP5A 4GFBA 1HKQA 2W4SA 2HI3A 3S16J 3E97A 3ISPA 3ML6A 4JOMA 2P6TA 3L9FA 5E3LA 5K5RA 2M3AA 1PUEE 3O6BB 4M3BA 4ZYGA 3ZRGA 1JE8A 4HSTA 4P1WA 5IT9Z 1LNWA 3EDPA 1E3PA 4L0ZB 2PMZN 1BM9A 1Z3YA 3GW2A 3QYBA 3R60A 4XR6A 5EZHA 2LMDA 2H8RA 3CD6I 3HGGA 1W5CC 1LJ9A 3LSRA 4L5EA 1R49A 4MEXF 2OAZA 3H0DA 2KJCA 1SFXA 4YELA 3S93A 1G3WA 3ZN1A 3NWSA 1Z7UA 2VE8A 4DYQA 2OF7A 4U88A 5HDGA 2WB1N 4DZJA 2KRCA 1IXRC 4W97A 1TQMA 2MABA 4JBAA 1V3FA 3EETA 4XRFA 2H27A 3RTRA 4ON0A 1JUMA 5D6EA 4RA2A 3RI4A 1TWGJ 4DZPA 2NVXJ 3GZNB 3RPUA 1XSDA 1YX5A 3FX3A 1IGNA 1YRNA 2A5WA 5FFZA 3H5RA 5D5UB 3KP5A 5F1JA 1LE8B 3S2WA 1MBFA 3VPRA 3S2DJ 1Z67A 2IGNA 4ENMA 3AFHA 2H94A 3F8FA 3DP7A 3ESWB 5F6FA 3NARA 4Y3OA 2CUJA 3H0GJ 4UUSA 3GX4X 3L2QA 4M73A 4RS8A 1JJ8C 2NNYA 1TC3C 3Q5FA 1DP7P 3FXQA 3M8FA 3IH4A 4GCVA 1U9NA 2V6EA 3AG3H 2X85A 2ZFUA 2V7FA 1ZARA 3VFZA 3GF2A 5AONA 5L3FA 5EDNA 3CO6C 1ZRDA 2TCTA 2LR8A 4IHXA 3Q0UA 3KLOA 5E1WA 4FX0A 3OYHA 3QQAA 1A6IA 4NNJA 1O3QA 1BI0A 1S72I 1WWXA 4A5NA 1RESA 4RAGA 4N4NB 1KYWA 3BG9A 1YW9A 2WV0A 1GHCA 5DCMA 4BL0B 1QZZA 1PUFA 4Y15A 3PIPF 1B72A 3DBRB 1XC5A 1LB2A 2ZO4A 4QTRA 2ZXHA 4KN7X 3VSKA 1HQCA 3B73A 2NYXA 2RDPA 2LBFB 4BGDA 4NBQA 4ZDOA 4P96A 1KU9A 2P0WA 1MH3A 3OOUA 3L2RA 2FNAA 3KZIC 4B47A 3I59B 2P6SA 3D5SC 1S6LA 1BW6A 4XIDA 4RLFA 1Z9CA 4KISA 1X2MA 3DPUA 2V4JC 2HS5A 4LLGF 2H8WA 4M6VA 1XGNA 2ACJA 2BV6A 2KRHA 1K4TA 3PL8A 1AA7A 4ZZDA 2XB0X 4U7BA 4LLLA 1T56A 3CC4I 1V4RA 5J8FA 3BROA 4RDUA 1LFPA 2ZSIB 3ZQHA 1BA5A 3F21A 1WH5A 3IWZA 4WF2A 4LLNA 3SYTA 4NHJA 5LEKA 3IL2A 3K4MA 3UKGA 3D0SA 4PJMA 3SDBA 2LY1A 1JKRC 3OY9A 3AL0B 2HQ5A 1ORKA 2F2EA 3ZQLA 5K5OA 4HV6A 2K85A 5KK1A 2O8KA 1KU3A 1MMDA 2E1MB 3I3LA 1B8IB 1YIOA 3HC7A 2X48A 4RB3C 4BE2A 1CGPA 4ENJA 3OYJA 2V9VA 4BQNA 4IHSA 5IOYA 3S14J 3PO2J 3DTKA 2COBA 5LEJA 1BL0A 2O5RA 3K4CA 1S7OA 2OTJI 4PDKA 1AKHA 4LMYA 1OLTA 5BQTA 3CCSI 2A5YB 1ZLKA 3CJRB 1IJWC 3KE2A 2XKPA 4AVPA 2F4MB 3A0HC 2R5YB 2XC7A 1SFOJ 2EQRA 1Z6TA 1DU0A 1BW5A 1RNLA 1BOBA 3GWZA 2E19A 3D5LA 1HF0A 2CSOA 4CCLA 4EM1A 3PFIA 1H9GA 1MMNA 2L7KA 2VBZA 5CVIA 2VQLA 4UVCA 4DIQA 4P55A 2XDVA 4HDVA 2NS8A 1TQIA 2R4GA 2JA8J 2XIGA 2E34A 3MN2A 4IQ4A 4A69C 2TDXA 4HLYA 5J4VA 2MC4A 2E5NA 1X1PA 2ID3A 1D1CA 2W82A 4XMYA 3HUGA 2AHQA 2XKOA 3BP8A 2VASA 3GEZA 2E60A 3LOCA 4OINF 1J2XA 3EUKL 1QRYA 1Y6IA 5KNLA 4CYCB 2LSOA 3RZOJ 4RBOA 2ZXJA 2EIMH 3JCUC 5F0FA 3S8PA 4F3QA 4A5MA 5LD2C 2QSGX 3DWLE 5EZGA 1ZR2A 2F5FA 2VL8A 2P4WA 4PZJA 2CQXA 3H1CA 3VWBA 4BHCA 5IYCJ 3R0AA 4A12A 1I1SA 2XUBA 3HPGA 4OIOF 1ZREA 1D5YA 3P7NA 2HDWA 2L02A 3LFUA 2OTLI 3S17J 4HF0A 2FUG2 2FMYA 3JAMK 2L3DA 1ZH5A 4U0WA 5CLSA 2VC0A 2CFOA 3LSGA 3TKYA 3S15J 1W7PA 2HGCA 2VE9A 1XGMA 4DBQA 4BHPA 2ECCA 4B3XA 2M87A 3ZXSA 4B8XA 3OYBA 1W0TA 3DPTA 4M3EA 2R7ZJ 2VJJA 4A3JJ 2ICWG 2W84A 3U1KA 1R4NB 1R4MB 2OUMA 2FEZA 1B4AA 4S04A 1K6OA 2EZKA 2VKVA 4F93B 3U9GA 5BMZA 1VQ8I 2NVQJ 4Z6YA 3ASOH 5J6XA 1YITI 4RLQA 3GBGA 2GZWA 2XGEA 3WGGA 4FE7A 2Z1DA 3S2HJ 2NAZA 4MHGA 4O6JA 2CG4A 2R7OA 1XG1A 2CS3A 2JRMA 3QYEA 5EG0B 3BY6A 3A0BC 4FX4A 2EZHA 5FFXA 1TL8A 4HPQA 4BY7J 1N75A 4AYBA 3GFLA 3A01A 2CRGA 2MH2A 1LKXA 1W5SA 4I99C 3SFZA 5C4JJ 3HIFA 2EBIA 3GXOA 3L09A 2BW3B 4E70A 4U7DA 4UUTA 5B1AH 4R1HA 1KYZA 4UNOA 3IWFA 1R00A 3NEUA 1YS7A 3C3WA 3W6JB 4CZZA 3BTCA 2GIVA 1FTZA 3FISA 3J7ZI 4OOIA 3MKWB 2EILH 4BYYA 3U21A 5DCFA 4AIHA 3I4PA 4P9UA 3VSLA 2BOLA 2KIFA 3FMQA 3L2WA 5F64A 2KLOA 2WY7Q 3WU2C 2DDAA 3K70C 1XMAA 1H0MA 2X6OA 4HAMA 4KT6A 2XPVA 2HQRA 3E0JB 1LUJB 4PJ0C 3K4BA 3E5QA 4HV5A 1T0FC 1P4XA 1KQ0A 1EF4A 4G8XA 1GVJA 2M0CA 1TWAJ 5HOOA 4G7OF 4XQFA 1VQ5I 1R36A 1LVAA 2AQFA 2MG4A 1HW2A 4LIUA 2O3FA 3ZMTA 1VQ7I 3W6VA 1XB4A 3LSPA 3TL4X 4HNVA 1T95A 2PBIA 1O7LA 2QWWA 4KA4A 1U5TB 1XGOA 3H9QA 4ABZA 4FQGA 4PFPA 3BC8A 3ZQCA 1K6YA 2O8XA 2FQ4A 3RJPA 2IJLA 3W2VA 2C6YA 3KP4A 1D1AA 2R0QC 3DU6A 5FRNA 2M8GX 2A6TA 4N9IA 1FMWA 4O3MA 1R1UA 3J80K 2KP6A 2B9SA 3CO7C 2K27A 3NAUA 5ILUA 4AYBN 3ZOBA 2CUFA 4CXFA 4RB2C 4NQWB 3HHHA 5ILSA 2K9QA 2NS7A 3FDYA 2ZJPF 3I59A 3I53A 2E7WA 1TNSA 3BZKA 1S7AA 2OQRA 4CSWA 2LKXA 1K7AA 4MLOA 2FNPA 5J40A 1O3TA 4IL6C 4UXNA 4PJNA 1R7JA 5ERIA 5D8KB 5M5XJ 4RMNA 3CC2I 2OCEA 1BR2A 2X1CA 5TGTA 4CCMA 1D8JA 2I5UA 3TO9A 2DFIA 4BH9A 3CUQC 2FOWA 3MWMA 5D4RA 1TWHJ 3V42A 5DCMB 4BXXJ 1WJ5A 4J01A 1OISA 4C3HJ 3Q0VA 1B72B 1I6XA 4D9JA 3BG7A 2OA4A 3OYMA 2RQQA 3V8KA 2A61A
chains in the Genus database with same CATH topology
5IP6A 2X9DA 4FE4A 4W1UA 2M34A 1FEXA 2MSYA 2ME6A 2KDZA 3HBLA 1TWFJ 3I4NJ 1VFCA 2N8GA 1UG2A 2E2JJ 1FIPA 1XS9A 1RKWA 2O7OA 5GPAA 2P81A 1ENHA 2D5VA 1QVTA 3JRHA 5EG0A 1MBJA 5K7HA 4JX5A 2R93J 3GTGJ 1JGGA 1HCRA 3A02A 2L7MP 1G2HA 3GTQJ 1MBKA 2TRTA 3CCYA 5EF6A 5E3NA 4XRMA 2Y9ZA 1HDDC 4AUXA 2Y31A 2LK2A 3ZQGA 2YS9A 5FLMJ 2LP0A 1FJLA 4GFBA 2HI3A 3BTIA 1E3OC 3S16J 2WV1A 1ZK8A 4MO7A 5JLWA 3S1MJ 5IOZA 4MFEA 5E3LA 2MGQA 4B3AA 4M3BA 5M3MJ 1HDPA 2CQQA 2LY9A 1JKQC 2HDDA 3D1NI 2PMZN 5EZHA 4B1RA 1ZTRA 2H8RA 3HGGA 2G0EA 3LSRA 4L5EA 3HDDA 2DTZA 3K7AJ 3BG5A 2YU9J 2LLKA 1I50J 2JA7J 1ZQ3P 4DYQA 4MIMA 2OF7A 4A3MJ 2WB1N 4DZJA 1K61A 4A93J 4W97A 2GLOA 1I3QJ 3TP0A 3JRGA 1JUMA 5J1RA 1AKHB 2L7ZA 4XRSA 1TWGJ 4DZPA 2XPWA 2NVXJ 2NVTJ 4DW6A 1P7IA 1SANA 3E7LA 1IGNA 1YRNA 3BR6A 5F1JA 1LE8B 1MBFA 2DA2A 2XPUA 3IH2A 1X58A 3VPRA 3S2DJ 4MFDA 5J3LA 3NARA 3GTOJ 3H0GJ 4A3DJ 4UUSA 2HYJA 1JJ8C 5BNGA 1TC3C 3IH4A 5E3OA 1U9NA 2Y30A 3WHBA 2AO9A 3M4OJ 1Y1WJ 5EDNA 3GTLJ 3OSGA 3QPLA 2TCTA 2LR8A 4DYRA 5EGOA 1JKOC 4IHXA 5K7FA 3Q0UA 5FLVA 3QQAA 1A6IA 3BR5A 4J19A 5GP9A 1RESA 3JRBA 4D7MA 2LD5A 3BG9A 2L9RA 5FKOA 1S7EA 1JT6A 1RKTA 1PUFA 1B72A 1XC5A 2NVYJ 3Q0WA 4QTRA 2OPTA 1JKPC 5IYBJ 4AC0A 3OOUA 3SJMA 1MH3A 5FKMA 4B4CA 5FKKA 2LTPA 3HOXJ 3OSFA 3L1PA 1APLC 1VI0A 1VNDA 5FKNA 1QVUA 2WAQN 3RKQA 1ETYA 1BW6A 4XIDA 1FTTA 2JJ7A 1X2MA 1NK2P 3BQZA 3G1MA 4M6VA 2O9LA 3M3YJ 3PM1A 1WI3A 3HOZJ 1R9TJ 3Q3SA 2JMWA 2XB0X 5C44J 5F0HA 1P7JA 3DEWA 3RZDJ 1T56A 2H1KA 2E2HJ 1IRZA 1MBHA 4RDUA 2KT0A 3ZQHA 4A3FJ 1BA5A 1WH5A 1ETKA 5EEAA 1RPWA 1O4XA 2XB5A 1BJZA 3A03A 4JYKA 3CQZJ 4A3EJ 5C3EJ 3S1RJ 3UKGA 1NTCA 3O8GA 1JKRC 3BR3A 3G1LA 1Z0XA 2HQ5A 1ORKA 2HOAA 3ZQLA 3FKIJ 4LOCA 2O8KA 1B8IB 2X48A 2CUEA 1VF9A 4M3FA 1QPIA 3C2BA 5M5YJ 5IPAA 2XGDA 1T33A 5IOYA 3S14J 3PO2J 2COBA 2QCOA 3WHCA 1AU7A 2Y2ZA 3HB9A 1BL0A 4G12A 1GVDA 4FCYA 3A01B 1AKHA 5FKLA 4Y7NJ 1HLVA 1ETOA 1AHDP 1IJWC 3LSJA 4I6ZA 1A5JA 3ZQIA 3JR9A 1SFOJ 2R5YB 5F27A 2EQRA 2LVSA 5J1YA 4M3DA 2GM4A 1DU0A 1LE8A 2ELKA 1OFCX 3HOVJ 1BW5A 1MSFC 5FJ8J 2E19A 1HF0A 1CQTA 2ME0A 1FIAA 4QIWN 1ZR4A 3HEFA 1GUUA 4A3KJ 1UMQA 1OCPA 2I10A 5IYDJ 2NS8A 2FX0A 1GV5A 4XICA 3MKLA 4IHVA 2JA8J 2IBDA 3S1NJ 2DA5A 1HOMA 3MN2A 5C4XJ 3BR0A 4A69C 2DA3A 2DMPA 4D7NA 5DTDA 3TW6A 3GTKJ 2ID3A 2XSDC 1RETA 2FD5A 4V2FA 1F36A 1GV2A 2AHQA 2VKEA 4NDLA 3SFIA 2ZB9A 5IP9J 1YRNB 2QF7A 3LOCA 2JN6A 3HOWJ 3HOYJ 1QRYA 2NOGA 3I4MJ 4CYCB 5M3FJ 5HODA 3RZOJ 4RBOA 4S0HB 5F0FA 3BR1A 4UUSB 5JLXA 1IG7A 5EZGA 1ZR2A 4X6AJ 2CQXA 2L0KA 4M3GA 2M2EA 5IYCJ 4IHWA 3IV5A 2B63J 4FTHA 3TW7A 1DU6A 2DMTA 3BT9A 2K9NA 1IUFA 5DS9A 3JRCA 2R5ZB 1D5YA 4BKXA 1LFUP 3JRFA 3S17J 2HXOA 1OJLA 1JTYA 4XRSG 1Z77A 5IP7J 4A3CJ 2DMNA 3LSGA 2ID6A 3S15J 1I6HJ 2HOSA 2CJJA 2ECBA 1H8AC 2ECCA 2W48A 3HM5A 2DMUA 4M3EA 4DYCA 5GPCA 1W0TA 1MH4A 1PUFB 3GTPJ 2R7ZJ 4A3JJ 4C3IJ 3JRDA 1F43A 4C3JJ 1LFBA 3H3VK 2DA1A 4V2GA 3IH3A 1NK3P 1K83J 1JT0A 1ETWA 3BG3A 4JP0A 3S1QJ 3SDGA 2EZKA 2VKVA 2NVQJ 1ITYA 4D5FA 1WPKA 3OIOA 3RQIA 3JREA 4EEFG 2E1OA 3GBGA 3BR2A 3LNQA 2IAIA 2XGEA 3B6CA 4C2MJ 3BQYA 4FE7A 3S2HJ 1B8IA 5EYRA 3F0CA 1GDTA 3HGYA 2EZLA 2JWTA 1ETQA 4A3LJ 3CMYA 1IC8A 1WH7A 1XG1A 1MBGA 1GT0C 3DCFA 5EG0B 4D5CA 2EZHA 2MW8A 3B6AA 3QPSA 4BY7J 3FK6A 5F0CA 3A01A 2CRGA 2DA7A 3GTJJ 3BTJA 5F08A 5C4JJ 3TEDA 2EBIA 3G1OA 4UUTA 4BBRJ 9ANTA 1U9OA 2R5YA 3HKZN 1ETXA 1TWCJ 3BTCA 2VUMJ 1FTZA 2VPRA 3CDLA 3FISA 4I76A 2M9HA 3ZQFA 3JRIA 2EH3A 1UHSA 1X2NA 1ZGWA 1H88C 1ETVA 2GBYA 3PO3J 1JUPA 2YUSA 1POGA 1U8BA 2Y0SN 4BBSJ 4BY1J 2JA6J 4JX6A 2DMQA 3TP3A 3O8HA 1JUSA 2K9SA 1RR7A 2X6OA 2LFBA 2DJNA 2XPVA 4IEJA 4QSHA 2FJ1A 5K7ZA 2CU7A 2R92J 3MVPA 1H89C 2EZIA 4JX4A 1MNMC 1EF4A 2K40A 2XGCA 1MBEA 2M0CA 1TWAJ 1WCMJ 2MG4A 5M5WJ 4Y52J 3GTMJ 1WGXA 3W6VA 3LSPA 4A3GJ 4HNVA 1OCTC 1Y1VJ 4CYCA 4ABZA 2HXIA 2XRLA 3ZQCA 1W0UA 1IDYA 2FQ4A 2HOTA 2E2IJ 2L7FP 2R0QC 2JA5J 2M8GX 1IV6A 2RAEA 1JJ6C 1ZKGA 2DN0A 3NAUA 4AYBN 3ZOBA 2CUFA 2Y9YA 2R5ZA 1U78A 2K9QA 2NS7A 2DA6A 1MSEC 3K2AA 5F04A 2LKXA 2JK3A 1JTXA 2IEKA 4MLOA 4IHYA 1IDZA 1Q1VA 4A3BJ 5EGOB 5J1UA 4XK4A 5M5XJ 4A3IJ 3HOUJ 2VI6A 3JRAA 2DA4A 1TWHJ 4BXXJ 3FIWA 4C3HJ 3BTLA 3Q0VA 4X1EA 1B72B 4FISA 5E3MA 3FK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP6 A;  2X9D A;  4FE4 A;  4W1U A;  2M34 A;  1FEX A;  2MSY A;  2ME6 A;  2KDZ A;  3HBL A;  1TWF J;  3I4N J;  1VFC A;  2N8G A;  1UG2 A;  2E2J J;  1FIP A;  1XS9 A;  1RKW A;  2O7O A;  5GPA A;  2P81 A;  1ENH A;  2D5V A;  1QVT A;  3JRH A;  5EG0 A;  1MBJ A;  5K7H A;  4JX5 A;  2R93 J;  3GTG J;  1JGG A;  1HCR A;  3A02 A;  2L7M P;  1G2H A;  3GTQ J;  1MBK A;  2TRT A;  3CCY A;  5EF6 A;  5E3N A;  4XRM A;  2Y9Z A;  1HDD C;  4AUX A;  2Y31 A;  2LK2 A;  3ZQG A;  2YS9 A;  5FLM J;  2LP0 A;  1FJL A;  4GFB A;  2HI3 A;  3BTI A;  1E3O C;  3S16 J;  2WV1 A;  1ZK8 A;  4MO7 A;  5JLW A;  3S1M J;  5IOZ A;  4MFE A;  5E3L A;  2MGQ A;  4B3A A;  4M3B A;  5M3M J;  1HDP A;  2CQQ A;  2LY9 A;  1JKQ C;  2HDD A;  3D1N I;  2PMZ N;  5EZH A;  4B1R A;  1ZTR A;  2H8R A;  3HGG A;  2G0E A;  3LSR A;  4L5E A;  3HDD A;  2DTZ A;  3K7A J;  3BG5 A;  2YU9 J;  2LLK A;  1I50 J;  2JA7 J;  1ZQ3 P;  4DYQ A;  4MIM A;  2OF7 A;  4A3M J;  2WB1 N;  4DZJ A;  1K61 A;  4A93 J;  4W97 A;  2GLO A;  1I3Q J;  3TP0 A;  3JRG A;  1JUM A;  5J1R A;  1AKH B;  2L7Z A;  4XRS A;  1TWG J;  4DZP A;  2XPW A;  2NVX J;  2NVT J;  4DW6 A;  1P7I A;  1SAN A;  3E7L A;  1IGN A;  1YRN A;  3BR6 A;  5F1J A;  1LE8 B;  1MBF A;  2DA2 A;  2XPU A;  3IH2 A;  1X58 A;  3VPR A;  3S2D J;  4MFD A;  5J3L A;  3NAR A;  3GTO J;  3H0G J;  4A3D J;  4UUS A;  2HYJ A;  1JJ8 C;  5BNG A;  1TC3 C;  3IH4 A;  5E3O A;  1U9N A;  2Y30 A;  3WHB A;  2AO9 A;  3M4O J;  1Y1W J;  5EDN A;  3GTL J;  3OSG A;  3QPL A;  2TCT A;  2LR8 A;  4DYR A;  5EGO A;  1JKO C;  4IHX A;  5K7F A;  3Q0U A;  5FLV A;  3QQA A;  1A6I A;  3BR5 A;  4J19 A;  5GP9 A;  1RES A;  3JRB A;  4D7M A;  2LD5 A;  3BG9 A;  2L9R A;  5FKO A;  1S7E A;  1JT6 A;  1RKT A;  1PUF A;  1B72 A;  1XC5 A;  2NVY J;  3Q0W A;  4QTR A;  2OPT A;  1JKP C;  5IYB J;  4AC0 A;  3OOU A;  3SJM A;  1MH3 A;  5FKM A;  4B4C A;  5FKK A;  2LTP A;  3HOX J;  3OSF A;  3L1P A;  1APL C;  1VI0 A;  1VND A;  5FKN A;  1QVU A;  2WAQ N;  3RKQ A;  1ETY A;  1BW6 A;  4XID A;  1FTT A;  2JJ7 A;  1X2M A;  1NK2 P;  3BQZ A;  3G1M A;  4M6V A;  2O9L A;  3M3Y J;  3PM1 A;  1WI3 A;  3HOZ J;  1R9T J;  3Q3S A;  2JMW A;  2XB0 X;  5C44 J;  5F0H A;  1P7J A;  3DEW A;  3RZD J;  1T56 A;  2H1K A;  2E2H J;  1IRZ A;  1MBH A;  4RDU A;  2KT0 A;  3ZQH A;  4A3F J;  1BA5 A;  1WH5 A;  1ETK A;  5EEA A;  1RPW A;  1O4X A;  2XB5 A;  1BJZ A;  3A03 A;  4JYK A;  3CQZ J;  4A3E J;  5C3E J;  3S1R J;  3UKG A;  1NTC A;  3O8G A;  1JKR C;  3BR3 A;  3G1L A;  1Z0X A;  2HQ5 A;  1ORK A;  2HOA A;  3ZQL A;  3FKI J;  4LOC A;  2O8K A;  1B8I B;  2X48 A;  2CUE A;  1VF9 A;  4M3F A;  1QPI A;  3C2B A;  5M5Y J;  5IPA A;  2XGD A;  1T33 A;  5IOY A;  3S14 J;  3PO2 J;  2COB A;  2QCO A;  3WHC A;  1AU7 A;  2Y2Z A;  3HB9 A;  1BL0 A;  4G12 A;  1GVD A;  4FCY A;  3A01 B;  1AKH A;  5FKL A;  4Y7N J;  1HLV A;  1ETO A;  1AHD P;  1IJW C;  3LSJ A;  4I6Z A;  1A5J A;  3ZQI A;  3JR9 A;  1SFO J;  2R5Y B;  5F27 A;  2EQR A;  2LVS A;  5J1Y A;  4M3D A;  2GM4 A;  1DU0 A;  1LE8 A;  2ELK A;  1OFC X;  3HOV J;  1BW5 A;  1MSF C;  5FJ8 J;  2E19 A;  1HF0 A;  1CQT A;  2ME0 A;  1FIA A;  4QIW N;  1ZR4 A;  3HEF A;  1GUU A;  4A3K J;  1UMQ A;  1OCP A;  2I10 A;  5IYD J;  2NS8 A;  2FX0 A;  1GV5 A;  4XIC A;  3MKL A;  4IHV A;  2JA8 J;  2IBD A;  3S1N J;  2DA5 A;  1HOM A;  3MN2 A;  5C4X J;  3BR0 A;  4A69 C;  2DA3 A;  2DMP A;  4D7N A;  5DTD A;  3TW6 A;  3GTK J;  2ID3 A;  2XSD C;  1RET A;  2FD5 A;  4V2F A;  1F36 A;  1GV2 A;  2AHQ A;  2VKE A;  4NDL A;  3SFI A;  2ZB9 A;  5IP9 J;  1YRN B;  2QF7 A;  3LOC A;  2JN6 A;  3HOW J;  3HOY J;  1QRY A;  2NOG A;  3I4M J;  4CYC B;  5M3F J;  5HOD A;  3RZO J;  4RBO A;  4S0H B;  5F0F A;  3BR1 A;  4UUS B;  5JLX A;  1IG7 A;  5EZG A;  1ZR2 A;  4X6A J;  2CQX A;  2L0K A;  4M3G A;  2M2E A;  5IYC J;  4IHW A;  3IV5 A;  2B63 J;  4FTH A;  3TW7 A;  1DU6 A;  2DMT A;  3BT9 A;  2K9N A;  1IUF A;  5DS9 A;  3JRC A;  2R5Z B;  1D5Y A;  4BKX A;  1LFU P;  3JRF A;  3S17 J;  2HXO A;  1OJL A;  1JTY A;  4XRS G;  1Z77 A;  5IP7 J;  4A3C J;  2DMN A;  3LSG A;  2ID6 A;  3S15 J;  1I6H J;  2HOS A;  2CJJ A;  2ECB A;  1H8A C;  2ECC A;  2W48 A;  3HM5 A;  2DMU A;  4M3E A;  4DYC A;  5GPC A;  1W0T A;  1MH4 A;  1PUF B;  3GTP J;  2R7Z J;  4A3J J;  4C3I J;  3JRD A;  1F43 A;  4C3J J;  1LFB A;  3H3V K;  2DA1 A;  4V2G A;  3IH3 A;  1NK3 P;  1K83 J;  1JT0 A;  1ETW A;  3BG3 A;  4JP0 A;  3S1Q J;  3SDG A;  2EZK A;  2VKV A;  2NVQ J;  1ITY A;  4D5F A;  1WPK A;  3OIO A;  3RQI A;  3JRE A;  4EEF G;  2E1O A;  3GBG A;  3BR2 A;  3LNQ A;  2IAI A;  2XGE A;  3B6C A;  4C2M J;  3BQY A;  4FE7 A;  3S2H J;  1B8I A;  5EYR A;  3F0C A;  1GDT A;  3HGY A;  2EZL A;  2JWT A;  1ETQ A;  4A3L J;  3CMY A;  1IC8 A;  1WH7 A;  1XG1 A;  1MBG A;  1GT0 C;  3DCF A;  5EG0 B;  4D5C A;  2EZH A;  2MW8 A;  3B6A A;  3QPS A;  4BY7 J;  3FK6 A;  5F0C A;  3A01 A;  2CRG A;  2DA7 A;  3GTJ J;  3BTJ A;  5F08 A;  5C4J J;  3TED A;  2EBI A;  3G1O A;  4UUT A;  4BBR J;  9ANT A;  1U9O A;  2R5Y A;  3HKZ N;  1ETX A;  1TWC J;  3BTC A;  2VUM J;  1FTZ A;  2VPR A;  3CDL A;  3FIS A;  4I76 A;  2M9H A;  3ZQF A;  3JRI A;  2EH3 A;  1UHS A;  1X2N A;  1ZGW A;  1H88 C;  1ETV A;  2GBY A;  3PO3 J;  1JUP A;  2YUS A;  1POG A;  1U8B A;  2Y0S N;  4BBS J;  4BY1 J;  2JA6 J;  4JX6 A;  2DMQ A;  3TP3 A;  3O8H A;  1JUS A;  2K9S A;  1RR7 A;  2X6O A;  2LFB A;  2DJN A;  2XPV A;  4IEJ A;  4QSH A;  2FJ1 A;  5K7Z A;  2CU7 A;  2R92 J;  3MVP A;  1H89 C;  2EZI A;  4JX4 A;  1MNM C;  1EF4 A;  2K40 A;  2XGC A;  1MBE A;  2M0C A;  1TWA J;  1WCM J;  2MG4 A;  5M5W J;  4Y52 J;  3GTM J;  1WGX A;  3W6V A;  3LSP A;  4A3G J;  4HNV A;  1OCT C;  1Y1V J;  4CYC A;  4ABZ A;  2HXI A;  2XRL A;  3ZQC A;  1W0U A;  1IDY A;  2FQ4 A;  2HOT A;  2E2I J;  2L7F P;  2R0Q C;  2JA5 J;  2M8G X;  1IV6 A;  2RAE A;  1JJ6 C;  1ZKG A;  2DN0 A;  3NAU A;  4AYB N;  3ZOB A;  2CUF A;  2Y9Y A;  2R5Z A;  1U78 A;  2K9Q A;  2NS7 A;  2DA6 A;  1MSE C;  3K2A A;  5F04 A;  2LKX A;  2JK3 A;  1JTX A;  2IEK A;  4MLO A;  4IHY A;  1IDZ A;  1Q1V A;  4A3B J;  5EGO B;  5J1U A;  4XK4 A;  5M5X J;  4A3I J;  3HOU J;  2VI6 A;  3JRA A;  2DA4 A;  1TWH J;  4BXX J;  3FIW A;  4C3H J;  3BTL A;  3Q0V A;  4X1E A;  1B72 B;  4FIS A;  5E3M A;  3FK7 A; 
#chains in the Genus database with same CATH topology
 3OL4 A;  2GAU A;  4OU0 A;  3CME I;  4FE4 A;  3OYG A;  2V79 A;  3IUO A;  2HQA A;  5E8G A;  3HL2 A;  1M1E B;  4XBF A;  3HYI A;  5H6R A;  2P8T A;  3HZJ A;  2Y75 A;  3LST A;  2DXI A;  1ON1 A;  1YJN I;  3ROU A;  2IW5 A;  1XS9 A;  3LL7 A;  4LK0 F;  2CO5 A;  3WU0 A;  4XKC A;  1OR7 C;  3HOT A;  2VOO A;  3T8T A;  3JRH A;  4WWC A;  1MBJ A;  4JX5 A;  2DLL A;  3FMS A;  1EH8 A;  2EV6 A;  1I5Z A;  2L7M P;  3A02 A;  4CCK A;  3CC7 I;  1G2H A;  1MBK A;  2Y9Z A;  1VQN I;  2VXZ A;  4AUX A;  4XL9 A;  1ZG1 A;  3ZMU A;  1Y0U A;  1U6G A;  3FXU A;  4IXA A;  1ZRF A;  1U0J A;  2NXN B;  3BTI A;  4R79 A;  3QPH A;  3OS2 A;  2WV1 A;  1T39 A;  1E3O C;  1ZK8 A;  2IS4 A;  4XSZ F;  1SAX A;  2MGQ A;  3SXY A;  4B3A A;  2EWN A;  5CQE A;  1S5L C;  1HDP A;  3PJR A;  4GYI A;  1IN8 A;  2CQQ A;  2LY9 A;  5HLH A;  2ZC2 A;  2HDD A;  4Q48 A;  3M3Y J;  1RC9 A;  4B1R A;  5CYV A;  3I58 A;  1U8R A;  2I8D A;  2DYR H;  4BEH A;  3DEE A;  4BS9 A;  2QA4 I;  3WU1 B;  3K7A J;  4OAZ A;  3H9G A;  2YU9 J;  2LLK A;  2YPR A;  3JTG A;  3W6K B;  2JA7 J;  1ZQ3 P;  1RIO H;  4MIM A;  1Z3X A;  3D5R C;  3I0T A;  4R8H A;  1BOA A;  4Y17 A;  3VDX A;  2W25 A;  2OQG A;  5D6F A;  3HXL A;  4LIV A;  3KYD B;  4XLC A;  2P5K A;  4EVI A;  1KZH A;  1R58 A;  2DFF A;  1AKH B;  1OPC A;  4EM2 A;  2XPW A;  2BZT A;  1SAN A;  1QBJ A;  3E7L A;  1T2K A;  1USS A;  1YW7 A;  3BR6 A;  3VYR B;  3L2U A;  3KYC B;  2NNN A;  2XPU A;  4AU7 A;  5L3B A;  4L5J A;  5GTH C;  4XLF A;  1XMK A;  4FAS D;  2DAO A;  3FF5 A;  1L3L A;  2QBY B;  2K02 A;  1RR8 C;  3AG2 H;  2JVH A;  4V19 K;  2A6E F;  3FWE A;  2XVC A;  3CZ6 A;  1R1T A;  1IUY A;  2J5O A;  4M9X A;  2VT2 A;  1Z6R A;  2VPL A;  1FSH A;  1MIJ A;  2IA0 A;  3OYC A;  1VZ0 A;  3HG9 A;  2R7D A;  1W5T A;  3E6M A;  4ESF A;  4IF4 A;  5FLV A;  3G6E I;  4E7K A;  5FB2 A;  1FOX A;  4J19 A;  2BBY A;  2K4B A;  3IRR A;  2LD5 A;  2EK5 A;  1MJ9 A;  2M1B A;  3HUG B;  2DPD A;  2PLY A;  1JT6 A;  2FML A;  2CW7 A;  3QOP A;  1G3T A;  2QQA A;  4I7H A;  1LQ1 A;  1L0O C;  3LSM A;  4BDZ A;  2NVY J;  1ODD A;  4P5O A;  5DYM A;  4G6T B;  3HSE A;  1J7K A;  2KIS A;  5IYB J;  5L3E A;  3SJM A;  4WX9 A;  1O7F A;  3NWT A;  4B4C A;  2Z33 A;  2LTP A;  3HRS A;  1APL C;  3TQN A;  2QM3 A;  3QAH A;  2XF7 A;  1VND A;  5FKN A;  4YFN F;  3CCR I;  2F5V A;  1ETY A;  1LEB A;  3DEU A;  3S3M A;  1FTT A;  2M7B A;  3C1D A;  3F9K A;  2O9L A;  3HOZ J;  1EH6 A;  3RSN A;  1R9T J;  5GAH J;  3CMA I;  1QZY A;  1W7P B;  5F0H A;  1P7J A;  2BVM A;  4NC8 A;  5F1R A;  2OU2 A;  5D5X B;  4YFX F;  3RZD J;  1IRX A;  2H1K A;  3I56 I;  4XM3 A;  3H3U A;  4RGU A;  1Y56 A;  3WOD F;  2PMU A;  2GQQ A;  3CLO A;  1QA6 A;  1BJZ A;  5LRR A;  1YHQ I;  1WJE A;  4E6K G;  3DTE A;  1NTC A;  3G71 I;  1P4W A;  2ZNY A;  2EIJ H;  3O8G A;  2DT5 A;  1Z0X A;  5TJJ A;  4XN3 A;  2HOA A;  1D3Y A;  1BI2 A;  4IRI A;  3F8N A;  4DJA A;  4DNC A;  2XGX A;  4RAF A;  2CUZ A;  3F22 A;  2CUE A;  3BJ6 A;  4NUB A;  4EJO A;  2V1N A;  5M5Y J;  5IPA A;  1T33 A;  3MEX A;  1FX7 A;  1AU7 A;  5E1X A;  4OIQ F;  3Q9S A;  1X1B A;  4C9Y A;  4G12 A;  3J7Y J;  3MFK A;  1P9Q C;  4ANJ A;  4IO9 F;  3A01 B;  1K78 A;  5FKL A;  3IKT A;  4IOC F;  2O6G E;  1AHD P;  4BQQ A;  3LSJ A;  1JHH A;  4I6Z A;  1A5J A;  5JR3 A;  1Z91 A;  3M7G A;  2LVS A;  2VKD A;  4KIC A;  5J1Y A;  4M3D A;  3H9J A;  2ELK A;  1A31 A;  1S3J A;  3OR1 C;  3CCL I;  1U5T A;  2MD5 A;  3M9A A;  2ME0 A;  5ICF A;  2KFD A;  1ZR4 A;  2ETH A;  3HEF A;  4BE0 A;  1MDM B;  4A2U A;  1OCP A;  3JSO A;  4KIG A;  4HSR A;  1UFM A;  2K9M A;  1ZLJ A;  3CJQ B;  2CWE A;  4IHV A;  4NQW A;  2IBD A;  2DA5 A;  3EPZ A;  1HOM A;  3V7R A;  2ZCW A;  1UG0 A;  4M9Z A;  5C4X J;  1ZEL A;  3KEY A;  3PUB A;  3GTK J;  1ACI A;  2A3S A;  2XSD C;  1G8X A;  1RET A;  1O3R A;  1Y8R B;  1ZN2 A;  3KEQ A;  1GV2 A;  3LSI A;  3FXJ A;  4LGW A;  3CP2 A;  3SFI A;  3HOW J;  3WGI A;  2HPM A;  2BXZ A;  3GFJ A;  1DGR M;  4MQV A;  4ESJ A;  5JLX A;  1IG7 A;  2DPU A;  2BHY A;  4YRV A;  3CCJ I;  4X6A J;  2JPC A;  5CPR B;  2L0K A;  1J0R A;  2B7E A;  1U2W A;  3CF2 A;  4M3G A;  5GTI C;  3IV5 A;  1WRJ A;  3TW7 A;  4UVB A;  2VXD A;  1W4M A;  2ISY A;  3HKZ A;  1XX5 A;  3R4K A;  5HS7 A;  3WE3 A;  5HDK A;  3E6C C;  3JRC A;  5DS9 A;  5B1B H;  2AS5 F;  3GCM A;  1LFU P;  1B9M A;  1MW7 A;  4YFK F;  3JRF A;  4KIT B;  5IP7 J;  4ZYH A;  2L4M A;  4OMZ A;  1I6H J;  2KIQ A;  3RKY A;  2R7T A;  3WG9 A;  5LHI A;  4BU2 A;  1BI3 A;  1GXQ A;  2PQ8 A;  1W36 C;  2RNG A;  1VQO I;  5GPC A;  3GTP J;  2F4I A;  3QOD A;  1G6N A;  2W00 A;  4C3I J;  1OCO H;  2WBM A;  4C3J J;  1XSV A;  2LRE A;  4PGG A;  4GDF A;  3IH3 A;  3ZCO A;  1NK3 P;  1K83 J;  2HKO A;  2STW A;  2IXS A;  2JVG A;  1ITY A;  3A2K A;  1WPK A;  2GXA A;  3JRE A;  4NC6 A;  3PNY A;  2QSH X;  3LNQ A;  1HSJ A;  2K7L A;  3B6C A;  4C2M J;  3BQY A;  3FM3 A;  5EYR A;  1DGW Y;  2F48 A;  1TQP A;  4ZYA A;  2RKH A;  2EZL A;  4B09 A;  2JWT A;  1ETQ A;  2VT3 A;  2VC1 A;  1IC8 A;  4PFO A;  2IGM A;  1MBG A;  2JTV A;  3RQ4 A;  4D5C A;  4DGW B;  5E17 F;  2MW8 A;  3B6A A;  3FK6 A;  5B5E C;  5F0C A;  2VJ4 A;  3GTJ J;  4WXC A;  2X51 A;  5F08 A;  5KHD A;  2VOD A;  4FET A;  2IGO A;  1K79 A;  3ZMV A;  3V8J A;  4ZYE A;  1HA8 A;  3G1O A;  3VOD A;  4IJA A;  1C0W A;  1LDK B;  1I1G A;  5LHG A;  1R1V A;  2HVR A;  3HKZ N;  5E1Z B;  4ZH4 F;  3CDL A;  3K4J A;  3QP5 A;  2VJ5 A;  2M9H A;  3ZQF A;  4XLN F;  2R7S A;  4EGZ A;  2STT A;  3GZ5 A;  1ETV A;  2GBY A;  3PO3 J;  1SVL A;  4IRG A;  1AWC A;  1ZG5 A;  1IRG A;  2CGP A;  2QBY A;  3OWT A;  3BPX A;  4BEH B;  2K9S A;  1STZ A;  2JSP A;  1RR7 A;  2VBY A;  1JHF A;  5L3D A;  3DQV C;  4BJ5 C;  2KMU A;  2DJN A;  2PFB A;  1FY7 A;  5J47 A;  2FJ1 A;  4AWX B;  1FBS A;  3EYI A;  3MVP A;  2EZI A;  2NOJ B;  2OBP A;  4HA8 A;  2K40 A;  4L18 B;  3CP8 A;  2XGC A;  5CQG A;  3G2B A;  2V26 A;  3GUD A;  1NH3 A;  4G7Z F;  4ITV A;  3FXO A;  2X1E A;  2X4H A;  2HEO A;  4OAY A;  2P7V B;  1OCT C;  1S29 A;  2EA2 A;  5D5V B;  4XOP A;  4B43 A;  3BCB A;  1SMY F;  2HKX A;  2WAF A;  4WXD A;  4CCN A;  2HOT A;  3FBN B;  1O57 A;  1XCV A;  2D1V A;  2FQ3 A;  2L7F P;  2D45 A;  4CIC A;  3K2Z A;  2JA5 J;  4XKV A;  3J81 Z;  2IPQ X;  2RAE A;  2PEX A;  1J09 A;  1ZRC A;  1ZKG A;  2Y48 A;  3QOE A;  3K10 A;  2MA3 A;  2DDB A;  3G3Z A;  2FA5 A;  4G6D A;  5LHH A;  4S05 A;  1BIA A;  2LKS A;  3FBI B;  5GAD J;  4YIR X;  1R22 A;  3OYA A;  3HHG A;  3K2A A;  2JK3 A;  2IEK A;  4IHY A;  1Q1V A;  1UST A;  1YS6 A;  4BJT A;  4ZZL A;  3BPV A;  2F5E A;  5J1U A;  3HSF A;  3OYF A;  2AXL A;  4A3I J;  3F6O A;  2IA1 A;  1PP7 U;  3LFK A;  1IV8 A;  2X1D A;  2FBI A;  4AM3 A;  2K4J A;  3VB2 A;  1FWZ A;  3MMY B;  3P9K A;  2DA4 A;  3DV8 A;  2EV0 A;  1OCR H;  1BC7 C;  3FIW A;  4M74 A;  2VON A;  4E7J A;  5FD5 A;  4LD5 A;  3CF5 F;  4KFC A;  4LFU A;  1G3S A;  2MLG A;  2X9D A;  2OC6 A;  2EPF A;  2MSY A;  2Q2E A;  1PDN C;  2LOO A;  4KMU X;  3UR3 C;  2KDZ A;  5KVR A;  5BPD A;  4IHT A;  4GGG A;  1TWF J;  1VFC A;  1XPX A;  1UG2 A;  2W24 A;  1FIP A;  3PQJ A;  1RKW A;  2CW8 A;  2UXN A;  4NC7 A;  4WK8 F;  2DW4 A;  3SQN A;  1XDS A;  1FC3 A;  1LDJ A;  1JGS A;  2A05 A;  4HZF A;  1R5H A;  4N9H A;  4HYE A;  4ENK A;  2EFW A;  1X1A A;  2GXG A;  2CFX A;  4JK1 X;  4EQQ A;  3GTG J;  2QQ8 A;  3IP4 B;  2ADU A;  1H9T A;  3K69 A;  2DCE A;  3LQR A;  2KRF A;  5E3N A;  4CZC A;  2MBF A;  1TP4 A;  2L2O A;  5K5Q A;  4B44 A;  3ZQG A;  5DUI A;  2YS9 A;  2JZY A;  5GAE J;  4AD9 A;  1FJL A;  1FSE A;  1P6R A;  3WGH A;  1A35 A;  5JLW A;  3OYL A;  4YEJ A;  1FT9 A;  3S1M J;  3HPH A;  4MFE A;  5IOZ A;  1UJ8 A;  1XMX A;  1R6R A;  3QRF F;  1Z7L A;  1ZYR F;  3E5U A;  3W2W A;  1SVO A;  2VQH A;  2ZXI A;  3SZP A;  2P7C B;  2ZXW H;  4BXU A;  3D1N I;  4PUS A;  3M1C A;  2P5V A;  3TOB A;  1EV7 A;  4ASN A;  1ZTR A;  3GFM A;  2G0E A;  1J75 A;  1MJA A;  1FMV A;  2GA2 A;  4I02 A;  1MDM A;  3S3O A;  3HDD A;  3RPQ A;  2DTZ A;  1OMI A;  4RB0 A;  3U1D A;  4AIJ A;  2R7X A;  4RAZ A;  1I50 J;  4A6E A;  5GAG J;  4J00 A;  2R7V A;  2UXX A;  1WJB A;  3DFG A;  2EFN A;  5AIQ A;  3PNV A;  4KN4 X;  1MNE A;  1X4P A;  1XN7 A;  2BGC A;  3QWL A;  4PK4 A;  2WAQ A;  3OYK A;  1WSU A;  1Y0N A;  4L9V A;  5TIS C;  4N4O B;  3C18 A;  5J1R A;  1K78 B;  5CVJ A;  2QSF X;  2OZU A;  4DW6 A;  2BE5 F;  1EH7 A;  1P7I A;  2KL4 A;  4LG0 A;  2F4O B;  3HJE A;  3SEQ A;  3TOA A;  2K5C A;  3ABT A;  3BCA A;  4KJZ A;  4EAT A;  4F92 B;  2OD5 A;  1R5I D;  3N97 A;  1YIJ I;  4BNC A;  2W1O A;  2YX7 A;  1FOY A;  4MFD A;  3VOE A;  4A0X A;  4M9S A;  4FT8 A;  3MZY A;  1XCB A;  4A3D J;  1QO0 D;  3LAP A;  2HTJ A;  4L9N A;  1VTN C;  5HLT A;  4GYG A;  2NVU B;  5DD8 A;  5BNG A;  2EIN H;  2KHM A;  3MKZ A;  2OZ6 A;  3H5A A;  5JI6 A;  2KKO A;  3CLQ A;  1UAA A;  2XAH A;  2XAJ A;  4CDG A;  3M4O J;  1BIB A;  2AO9 A;  2VIX A;  4YG2 F;  4UVA A;  2F5C A;  3QPL A;  2Z2S B;  3GLX A;  4DYR A;  1JKO C;  2W7N A;  1IN7 A;  1PVE A;  5E18 F;  3BR5 A;  4KIB A;  4EJW A;  5GP9 A;  3AL0 C;  1FP1 D;  1B59 A;  3JRB A;  2E71 A;  2Z16 A;  3TO6 A;  2HDC A;  3NRV A;  3DKY A;  1YG2 A;  2E1M C;  2HZT A;  2L9S A;  2KQR A;  3E1S A;  4ZDP A;  3WTZ A;  1CF7 B;  3Q0W A;  3ULQ B;  1YW8 A;  1R23 A;  1IW7 F;  2OPT A;  2R7U A;  3M8E A;  2UWM A;  4AC0 A;  4AVZ A;  5A2Q Z;  1ZHF A;  1TLH B;  3HOX J;  5FKK A;  2EV5 A;  3OSF A;  2MC3 A;  4PJJ A;  1VI0 A;  1R71 A;  1QVU A;  2WAQ N;  2FXA A;  2GOM A;  2V9P A;  2HWV A;  2WC2 A;  1NK2 P;  4Q4Z F;  2Q1Z B;  2RRE A;  2YX4 A;  4GO1 A;  2K86 A;  3PM1 A;  5FO5 A;  1HBX G;  2JA2 A;  2MLK A;  2JRT A;  1SFU A;  2Z3Y A;  1X4O A;  3K0L A;  4G6Q A;  3J7A O;  2JMW A;  2JUG A;  4XLH A;  5E79 C;  3IHU A;  1IXS B;  2E35 A;  3DEW A;  4LB6 B;  4I01 A;  1R5G A;  1Z1D A;  2YSR A;  4U0V A;  2IT0 A;  3HOS A;  1IRZ A;  3KP2 A;  1FOW A;  2M0M A;  2DK8 A;  4A3F J;  1ETK A;  1LPQ A;  1VQ9 I;  5EEA A;  4A0Z A;  2LG4 A;  1EKE A;  3TO7 A;  3REO A;  1B6A A;  3CQZ J;  4A3E J;  2QYO A;  5C3E J;  3S1R J;  1NG6 A;  3M1E A;  3LSH A;  4U0Y A;  1B1B A;  3BR3 A;  3P9I A;  1D0X A;  2BVL A;  2EFO A;  2O03 A;  3CUQ A;  2M4K A;  4LOC A;  2M7A A;  1D0Z A;  1VF9 A;  1A36 A;  2CYY A;  3K4L A;  5HS8 A;  3OR2 C;  2HFH A;  2QCO A;  3WHC A;  1PJR A;  1G3Y A;  3H3Z A;  3T8R A;  4KNY A;  1MMA A;  1ETO A;  5DV5 A;  4RM2 A;  4PCQ A;  5HNH A;  3ZQI A;  3JR9 A;  5F27 A;  1RRJ A;  2E1N A;  3E3V A;  2ZME A;  1WHU A;  2LRD A;  3F72 A;  1HC8 A;  4MGR A;  4KMF A;  4WCG A;  5FJ8 J;  3R0J A;  1QHH D;  2FRH A;  5J8C A;  1FIA A;  1CQT A;  1PYV A;  1GUU A;  3LMM A;  4A3K J;  2HYG D;  2RC4 A;  3BLY A;  3EUH A;  2FSW A;  3E5X A;  3KLN A;  4QPO A;  1N77 A;  1HKS A;  4C2T A;  2V1X A;  2BY0 A;  1T08 B;  2H6C A;  2I10 A;  5IYD J;  4E7S A;  1YE9 A;  5L3G A;  4M72 A;  3W2A A;  4EMS A;  3MKL A;  3VYS B;  4HQM A;  4KUM A;  4HF2 A;  3BR0 A;  2DA3 A;  4D7N A;  5DTD A;  3OS0 A;  1OQY A;  1P4A A;  2VN2 A;  3KIO A;  4UHT A;  1QGP A;  1F36 A;  4GRI A;  3WTU C;  4NDL A;  2CQN A;  2MFZ A;  2ZB9 A;  1XTA A;  2ZJR F;  4I0B A;  2DOE A;  3DPL C;  1XDU A;  2QF7 A;  1XD7 A;  4KT5 C;  3RDI A;  3HOY J;  2NOG A;  3I4M J;  2XV4 S;  5M3F J;  5HOD A;  3CCM I;  2DT6 A;  3BR1 A;  5HVQ C;  5H20 A;  4MNU A;  2D1H A;  1SD4 A;  4A0Y A;  5JVG F;  2IS1 A;  2EFP A;  3OYN A;  4DQ2 A;  2RGV A;  4IHW A;  5E20 A;  4CCJ A;  4HNU A;  3JW4 A;  2DMT A;  1KQ9 A;  3KCC A;  2K9N A;  1IUF A;  2FBK A;  2PG4 A;  4CCO A;  2HYF A;  4F7Z A;  3SZG A;  3F23 A;  3TDZ C;  2A68 F;  2HXO A;  4RGR A;  2HZD A;  3PSF A;  1OJL A;  1JTY A;  2JUC A;  1WVR A;  1TW3 A;  2DI3 A;  4A3C J;  2DMN A;  2Y0S A;  4BXF A;  2HOS A;  2IRF G;  2MH9 A;  2CJJ A;  1WJA A;  1H8A C;  1G4D A;  2KPM A;  1ON2 A;  3HM5 A;  4DYC A;  5DM7 F;  4XLP F;  1IRF A;  2PJP A;  3I5U A;  3JRD A;  1F43 A;  3I54 A;  3K70 D;  1I39 A;  3H3V K;  1T6S A;  3FXM A;  3LSK A;  3OYD A;  4BDY A;  2DA1 A;  4V2G A;  2CMP A;  3KZY A;  1YFH A;  3AG4 H;  1Y8Q B;  4JP0 A;  4L9J A;  3S1Q J;  2ESN A;  2EIK H;  3CDI A;  5FGM A;  4D0P A;  4XKW A;  4D5F A;  3ABU A;  2Q2E B;  3KP6 A;  1N78 A;  4MEY F;  5CJ9 A;  2FOK A;  1RZ4 A;  3BR2 A;  2IAI A;  1U3E M;  1KQ8 A;  3BJA A;  3MKY B;  2RV8 A;  2BY3 A;  3BZ6 A;  2CV1 A;  1P92 A;  2EA4 A;  1U5T C;  1T98 A;  2ZFW A;  2CV2 A;  4Q5S F;  4A3L J;  2ELH A;  1WH7 A;  2DJI A;  4AID A;  1T38 A;  2LF7 A;  4RGX A;  4I0A A;  2Q0O A;  1RUO A;  1LDD A;  1BJA A;  5E8I A;  4UB8 C;  2PN6 A;  3BOQ A;  3Q9V A;  3BTJ A;  4RAY A;  4L0Y B;  1X1C A;  1X3U A;  2XRN A;  1FLI A;  2L54 A;  5L3C A;  2VLA A;  3O2P E;  2BYV E;  4BBR J;  1U9O A;  4QPQ A;  2VKH A;  3E6B A;  5K1Y A;  1BI1 A;  3FXK A;  3I64 A;  2QEN A;  4CH7 A;  3FZV A;  2M8E A;  2H09 A;  3L7W A;  2VUM J;  2VPR A;  2Z99 A;  3PQK A;  4P9F A;  3LA3 A;  4D1Q A;  3ERM A;  3OIP A;  5HS9 A;  1ZGW A;  1H88 C;  1JUP A;  1U8B A;  5CVR A;  4U87 A;  3M07 A;  1S9H A;  2Y0S N;  4IKF A;  4BBS J;  4L5I A;  5JHF A;  3MAJ A;  3QP6 A;  4JX6 A;  1WJD A;  2WAE A;  3F8C A;  1REP C;  4II3 A;  3LQQ A;  2ZJ2 A;  4OIP F;  3I55 I;  4ZTF A;  5ICG A;  1D8K A;  4IEJ A;  3CUO A;  5K7Z A;  2CU7 A;  2E7X A;  5FRO A;  2GA1 A;  3P5J A;  3PIO F;  1YYV A;  4O5V A;  5LRS A;  2WWY A;  2UZK A;  3R6S A;  1MBE A;  1KU7 A;  3TGN A;  2P5L C;  2QGU A;  1ONV A;  1WGX A;  5FLX K;  4BJ6 C;  4XN0 A;  1YLF A;  5DDG A;  4PSW A;  1Y1V J;  3DLL F;  4LG0 B;  2HXI A;  1NHA A;  4RB1 A;  3SZT A;  3L2C A;  1W0U A;  1FPQ A;  1IDY A;  3HRT A;  2DT7 B;  2E2I J;  4F55 A;  1CF7 A;  1AOY A;  3CES A;  4RM3 A;  1PP8 F;  1B9N A;  1SFE A;  2ELJ A;  2OV7 A;  4UV9 A;  3DU5 A;  2B0L A;  1IV6 A;  5CVV A;  4CYD A;  3WG7 H;  2DN0 A;  2DBB A;  2M45 A;  1WJC A;  1SD7 A;  2COM A;  1KGS A;  4H4K C;  2R5Z A;  1ZGJ A;  3ZPL A;  1U78 A;  3ZMD A;  1MZB A;  1MSE C;  4N0B A;  3K4K A;  1DDN A;  4LIT A;  1J9I A;  5F04 A;  1JTX A;  3OYE A;  2L5Q A;  4A3B J;  2VBW A;  1V55 H;  3QYF A;  1A04 A;  4IQJ A;  4M6X A;  4HDU A;  3HOU J;  2PJR A;  4QLC U;  3KZZ A;  4Y4R A;  4KYW A;  2IA2 A;  4LB5 A;  3N05 A;  3F3X A;  1F4K A;  2H6B A;  5D5W B;  3K1N A;  1TTY A;  4X1E A;  4BUP A;  3FKJ A;  4FIS A;  1W1W E;  2PI0 A;  3FK7 A;  5IP6 A;  3ZMZ A;  3RIR A;  2M34 A;  1EA3 A;  1FEX A;  3CJN A;  3AAF A;  2IS2 A;  3HBL A;  3K4N A;  1FYM A;  2LNB A;  1IAW A;  3I4N J;  2KDO A;  2N8G A;  5IT9 K;  5D4S A;  2O7O A;  3ZN0 A;  4HF1 A;  4IPA A;  3E6D A;  4ESB A;  2P81 A;  4ZTJ A;  2FU4 A;  2Q8K A;  4HX7 A;  4LG3 A;  5JVT A;  2R7R A;  1KU2 A;  1ENH A;  3C2G A;  2JT1 A;  3JAM Z;  5FD6 A;  1P2F A;  4YII A;  1TBX A;  1MMS A;  3W3C A;  3OV8 A;  1JGG A;  2W85 A;  2XAF A;  2MYS A;  1TNT A;  4G7H F;  3CCY A;  5EF6 A;  2EJR A;  2Y0M A;  4QWQ A;  4MTD A;  1HDD C;  4PSX A;  4C2U A;  4E7I A;  1VQM I;  4EJT A;  1QZE A;  3HTS B;  4HX8 A;  4YIF A;  5FLM J;  2LP0 A;  2GIZ A;  2VOP A;  1ERD A;  3MCZ A;  3BJO A;  3C7J A;  4MO7 A;  2GXB A;  3KFW X;  3V4G A;  4BHB A;  3SHF A;  4XSX F;  2BEO A;  1UZC A;  2K3F A;  4HX4 A;  3EYY A;  4HG2 A;  2QZ8 A;  2AQE A;  5DUK A;  5M3M J;  2ISZ A;  3VEP A;  5B66 C;  1VQ4 I;  3GLL A;  4TV7 A;  1JKQ C;  1ZAO A;  1UHM A;  2BY1 A;  1E17 A;  1BBY A;  1SEU A;  5KAF C;  3CUQ B;  2AXT C;  3N4M A;  4XON A;  4ENN A;  1I3A A;  3BG5 A;  1BR4 A;  3HRM A;  2W57 A;  3DKW A;  4AIK A;  2ESH A;  2YU3 A;  4A3M J;  1IXC A;  3DXJ F;  3RKW A;  1RUN A;  3IAS 2;  1K61 A;  4A93 J;  3G73 A;  5EEH A;  2M4G A;  2GLO A;  1I3Q J;  3TP0 A;  3JRG A;  2L7Z A;  4XRS A;  2L9V A;  3RKX A;  3H36 A;  2NVT J;  5HLI A;  2JSC A;  1NG7 A;  4BQA A;  3FXL A;  3ABL H;  1EJ9 A;  3MZ8 A;  2ZME B;  3TBI A;  5IY5 H;  5HLG A;  2DA2 A;  3IH2 A;  4I09 A;  1X58 A;  2HPI A;  1JI8 A;  1OKR A;  2RQP A;  4LJZ F;  4E7H A;  5J3L A;  3GTO J;  3MD2 A;  2H1L A;  1I27 A;  2R7F A;  3TMO A;  2HYJ A;  3B02 A;  5ILV A;  4IZZ A;  2CV0 A;  4F91 B;  5ICE A;  2V9K A;  5E3O A;  3V8L A;  2Y30 A;  1HXD A;  3WHB A;  1Y1W J;  2XF6 A;  3GTL J;  4RGS A;  3OSG A;  1E2X A;  5EGO A;  3H92 A;  1UCR A;  2LDU A;  5K7F A;  5AIP A;  3K6G A;  4HBL A;  1F5T A;  3HSR A;  2MD0 A;  1FBU A;  1UEL B;  3OIQ A;  4E4H A;  3G4S I;  4BAC A;  1QPM A;  4D7M A;  3RPU D;  2L9R A;  5LGU A;  5FKO A;  1S7E A;  1QQI A;  1XSX A;  3H35 A;  1RKT A;  1Z21 A;  3L2V A;  5BPI A;  1YI2 I;  3DF8 A;  4XLA A;  3CDH A;  2BHZ A;  4KDP A;  1UHW A;  1JKP C;  4MQ9 F;  2FF4 A;  3HRU A;  5JHU A;  5FKM A;  2IS6 A;  2A07 F;  1SMT A;  1A6Q A;  3L1P A;  3J80 Z;  1OYI A;  1O3S A;  1DUX C;  3RKQ A;  1G59 A;  2XAU A;  1FBQ A;  2JJ7 A;  2Z5U A;  2CH0 A;  3OOP A;  3QU6 A;  4HEA 2;  4OWR B;  5CVU A;  4ZJZ A;  2Z9O A;  2E1C A;  3BQZ A;  3G1M A;  1WI3 A;  2IGK A;  2X6W A;  3PNT A;  4GXO A;  2E36 A;  2GOX B;  5LLQ A;  1IN4 A;  1YO5 C;  2KIM A;  3Q3S A;  2FE3 A;  3CJT B;  3F6V A;  1JXS A;  3CCE I;  1DPU A;  5C44 J;  2VBX A;  3ECH A;  2ZSH B;  3ABM H;  2NS0 A;  2XF5 A;  1YJ9 I;  2XAQ A;  2L4A A;  2E2H J;  3FMR A;  2A6H F;  1MBH A;  3KEO A;  2KT0 A;  3OL3 A;  2DFH A;  5LGN A;  2KJB A;  1RPW A;  1SD5 A;  1O4X A;  2XB5 A;  3A03 A;  4JYK A;  3UNG C;  3CCV I;  5EJC A;  4PJL A;  2YR2 A;  2J5P A;  1IN5 A;  3G1L A;  3F8M A;  3MZH A;  2LKP A;  3FKI J;  4I98 B;  3M8J A;  4EM0 B;  6PAX A;  2D2W A;  1FOK A;  2E5Z A;  2JQ7 A;  3IC7 A;  1OYW A;  4M3F A;  1HW1 A;  1V5F A;  3C2B A;  1QPI A;  3R61 A;  4HW0 A;  3VYT B;  2XGD A;  2RVC A;  4CO8 A;  4DOZ A;  4EGY A;  3ABK H;  3V7S A;  2XRO A;  1D0Y A;  2Y2Z A;  3HB9 A;  1OYY A;  2L9N A;  1GVD A;  2HTS A;  1YQA A;  3I9V 2;  4XLE A;  4FCY A;  4XKB A;  4Y7N J;  1HLV A;  3C2H A;  1MND A;  3P9C A;  3FHZ A;  2GM4 A;  3WTW C;  1LE8 A;  1OFC X;  3HOV J;  3GFI A;  3FXR A;  3AKZ A;  1YTY A;  1MSF C;  1KA8 A;  1SD6 A;  2WA0 A;  2HVS A;  3BWG A;  2XSJ C;  4IX7 A;  3J81 K;  4QIW N;  4EV0 A;  1DPR A;  2LY2 A;  4I2O A;  1UMQ A;  2DOD A;  1IO2 A;  3X2Q H;  1X3Z B;  3PSI A;  1WZ2 A;  1W36 D;  3GME A;  4BE1 A;  2DTR A;  2FX0 A;  4IVN A;  4CUG A;  1GV5 A;  4XIC A;  4ETS A;  3V7C A;  1QNT A;  3CMM A;  1OCZ H;  4UUV A;  3S1N J;  1WFX A;  4KIF A;  5LGT A;  1E3H A;  4M71 A;  1LEA A;  3GVA A;  2BY2 A;  2DMP A;  3OMY A;  3TW6 A;  2UV1 A;  2KIU A;  3F8B A;  3IKV A;  3HTU A;  3KPH A;  1J5Y A;  2FD5 A;  5HDN A;  3VYU B;  4V2F A;  1WQ2 A;  2OJE D;  2DFE A;  2VKE A;  3RYR A;  3WE2 A;  5IP9 J;  1YRN B;  1ZGA A;  2EB7 A;  2JN6 A;  5BOX A;  1MJB A;  5FRM A;  2ZNZ A;  4CGZ A;  4IRH A;  2G7H A;  4S0H B;  2LBF A;  4UUS B;  3JTH A;  4WXH A;  4IOA F;  1VQL I;  2R3S A;  4BQO A;  1SFK A;  3ZR8 X;  1MMG A;  3DBH B;  2M2E A;  1T0F A;  4L9T A;  1T8I A;  2B63 J;  2JPB A;  2LC2 A;  4FTH A;  1QU3 A;  1TZL A;  1HST A;  2CQ7 A;  1DU6 A;  4NB5 A;  4PGH A;  4MTE A;  4UY8 I;  3BT9 A;  2L01 A;  1Z05 A;  2XAG A;  2R5Z B;  4BKX A;  1X19 A;  2KZV A;  4XRS G;  1ZG3 A;  3EUA A;  1Z77 A;  4OMY A;  3RCO A;  3CCU I;  1WKM A;  2ID6 A;  3KP7 A;  3OS1 A;  3EQL F;  3QU3 A;  2DO7 A;  2RNJ A;  4G94 A;  2ECB A;  1MD0 A;  3NQO A;  2W48 A;  3A4C A;  3ONQ A;  2PJR B;  1MGT A;  2R7Q A;  2DMU A;  4FHT A;  4JQF A;  4X0G A;  1PUF B;  1DQU A;  1MH4 A;  1J59 A;  2DQL A;  3T1B A;  2KZG A;  5H2F C;  3SEZ A;  3FM5 A;  4HNT A;  1X1D A;  1SVM A;  2Y69 H;  2ZJQ F;  3WTS C;  1LFB A;  5LBQ A;  4UV8 A;  1JT0 A;  1ETW A;  3BG3 A;  5B3S H;  1BC8 C;  3SDG A;  3QPT A;  1FZP B;  1N25 A;  4Y33 A;  2QKL B;  4E7Z A;  2G9W A;  2DU9 A;  3OIO A;  3RQI A;  4Y13 A;  4EEF G;  2BXY A;  2E1O A;  3DBL B;  4HOB A;  4ZYD A;  3IRQ A;  2OCC H;  1GLN A;  2ZME C;  2V1U A;  1HKT A;  1B8I A;  3F0C A;  2R7W A;  5BS6 A;  1GDT A;  3HGY A;  2X6X A;  2NRA C;  3GO5 A;  4EJU A;  1W7P D;  1VQ6 I;  3CMY A;  4BAY A;  3WTY C;  1GT0 C;  5DD4 A;  3DCF A;  3DKX A;  1S8N A;  3EUH C;  2O61 A;  1Y39 A;  4CHU A;  3QPS A;  2VQC A;  4H0E A;  2DA7 A;  3GYH X;  1LVK A;  3TED A;  2VQG A;  1FP2 A;  3LWF A;  9ANT A;  4G9Y A;  2R5Y A;  2PMH A;  2XAS A;  5DEQ A;  1HW5 A;  1ETX A;  1TWC J;  2EFQ A;  1WI9 A;  4OIR F;  1OR7 A;  4I76 A;  3ZGK A;  3JRI A;  3K9T A;  3J7A Y;  2EH3 A;  1UHS A;  1X2N A;  1D1B A;  2YUS A;  3K1P A;  1POG A;  3L00 A;  3CTA A;  4DBR A;  4II2 A;  3IAM 2;  3H5N A;  5KAI C;  4BY1 J;  2FBH A;  3K1M A;  2JA6 J;  1DP3 A;  2DMQ A;  3TP3 A;  1UB9 A;  4HRI A;  1BR1 A;  2QLZ A;  3O8H A;  4E7L A;  1IF1 A;  3BDD A;  1JUS A;  2GWR A;  3T0Y A;  3A1Y A;  3O3K A;  2PX9 A;  2LF8 A;  1VQP I;  2QKM B;  4A6D A;  2LFB A;  4QSH A;  2R92 J;  2CQK A;  1X3W B;  2X0L A;  1H89 C;  3MQ0 A;  2HQN A;  3ELK A;  4JX4 A;  1MNM C;  3S32 A;  1WJF A;  2DQR A;  1V54 H;  2DOF A;  5CKT A;  1WCM J;  1V5G A;  2IVM A;  3CCQ I;  3BZC A;  1SAU A;  3LA2 A;  5M5W J;  4HQE A;  4Y52 J;  4Z2Y A;  5J4Y A;  3GTM J;  4A3G J;  2O0Y A;  3I71 A;  2K3P A;  4EJV A;  4C30 A;  1BN5 A;  4CYC A;  1FYL A;  1XGS A;  1D5V A;  1ULY A;  2XRL A;  2QVO A;  3PFY A;  3LAJ A;  5TRD A;  2ZBK A;  3ERE D;  2LH9 A;  1YJW I;  1KON A;  2VB6 A;  4K2E A;  5A2Q K;  4F52 A;  5EEG A;  2ZKZ A;  5KCM A;  2QUF A;  5LFA A;  1JJ6 C;  2V6C A;  2DK5 A;  3OYI A;  4HLX A;  2VJI A;  2HOE A;  2QQB A;  1K4S A;  2Y9Y A;  2F6C A;  1E0E A;  1Q1H A;  2DA6 A;  2QQ9 A;  2HNH A;  1MKM A;  4UB6 C;  3KET A;  1FYK A;  1IDZ A;  4XNF A;  4B48 A;  5EGO B;  2PMZ A;  3KYL A;  1RI7 A;  3COA C;  5D8L B;  2X6Y A;  3DLA A;  4XK4 A;  2M5W A;  2DYS H;  5FLX Z;  2RN7 A;  2VI6 A;  3DTI A;  5HNF A;  3JRA A;  2WY8 Q;  1VQK I;  5ED4 A;  2HVQ A;  4ZC3 A;  3ECO A;  2CW0 F;  1TW2 A;  2V1D A;  1V5E A;  3LA7 A;  5JFR A;  2QEX I;  1TT0 A;  2IP2 A;  3AG1 H;  3BTL A;  3ZMS A;  2WB1 A;  1FNN A;  2K9L A;  2XHK A;  4XOT A;  2F5D A;  3TDU C;  5IT3 A;  3PUF A;  4M6Y A;  2DOA A;  3WTV C;  3KP3 A;  5DM6 F;  5E3M A;  4CA0 A;  4W1U A;  3WTX C;  5ICC A;  1SC7 A;  3GZ6 A;  4LK1 F;  2ME6 A;  3ASN H;  3ZQ7 A;  1IZ1 A;  2G7U A;  2LYC A;  4ZDL A;  3BG6 A;  2E2J J;  1GXP A;  3FHN A;  1TT5 B;  1QHG A;  4XOR A;  5GPA A;  2HR3 A;  3T5X A;  4Q47 A;  2UUZ A;  3JSP A;  2WAD A;  2D5V A;  1QVT A;  1YX3 A;  3RYP A;  5EG0 A;  3U2R A;  3S3N A;  2A69 F;  2M30 A;  1F1Z A;  5K7H A;  1YOV B;  2R93 J;  1IN6 A;  5H6Q A;  1HCR A;  2HU9 A;  3KX2 A;  3GTQ J;  2TRT A;  1OCC H;  4XRM A;  2WTE A;  2Y31 A;  2BW3 A;  2LK2 A;  1F9N A;  3ZQQ A;  3WTT C;  3ZP5 A;  4GFB A;  1HKQ A;  2W4S A;  2HI3 A;  3S16 J;  3E97 A;  3ISP A;  3ML6 A;  4JOM A;  2P6T A;  3L9F A;  5E3L A;  5K5R A;  2M3A A;  1PUE E;  3O6B B;  4M3B A;  4ZYG A;  3ZRG A;  1JE8 A;  4HST A;  4P1W A;  5IT9 Z;  1LNW A;  3EDP A;  1E3P A;  4L0Z B;  2PMZ N;  1BM9 A;  1Z3Y A;  3GW2 A;  3QYB A;  3R60 A;  4XR6 A;  5EZH A;  2LMD A;  2H8R A;  3CD6 I;  3HGG A;  1W5C C;  1LJ9 A;  3LSR A;  4L5E A;  1R49 A;  4MEX F;  2OAZ A;  3H0D A;  2KJC A;  1SFX A;  4YEL A;  3S93 A;  1G3W A;  3ZN1 A;  3NWS A;  1Z7U A;  2VE8 A;  4DYQ A;  2OF7 A;  4U88 A;  5HDG A;  2WB1 N;  4DZJ A;  2KRC A;  1IXR C;  4W97 A;  1TQM A;  2MAB A;  4JBA A;  1V3F A;  3EET A;  4XRF A;  2H27 A;  3RTR A;  4ON0 A;  1JUM A;  5D6E A;  4RA2 A;  3RI4 A;  1TWG J;  4DZP A;  2NVX J;  3GZN B;  3RPU A;  1XSD A;  1YX5 A;  3FX3 A;  1IGN A;  1YRN A;  2A5W A;  5FFZ A;  3H5R A;  5D5U B;  3KP5 A;  5F1J A;  1LE8 B;  3S2W A;  1MBF A;  3VPR A;  3S2D J;  1Z67 A;  2IGN A;  4ENM A;  3AFH A;  2H94 A;  3F8F A;  3DP7 A;  3ESW B;  5F6F A;  3NAR A;  4Y3O A;  2CUJ A;  3H0G J;  4UUS A;  3GX4 X;  3L2Q A;  4M73 A;  4RS8 A;  1JJ8 C;  2NNY A;  1TC3 C;  3Q5F A;  1DP7 P;  3FXQ A;  3M8F A;  3IH4 A;  4GCV A;  1U9N A;  2V6E A;  3AG3 H;  2X85 A;  2ZFU A;  2V7F A;  1ZAR A;  3VFZ A;  3GF2 A;  5AON A;  5L3F A;  5EDN A;  3CO6 C;  1ZRD A;  2TCT A;  2LR8 A;  4IHX A;  3Q0U A;  3KLO A;  5E1W A;  4FX0 A;  3OYH A;  3QQA A;  1A6I A;  4NNJ A;  1O3Q A;  1BI0 A;  1S72 I;  1WWX A;  4A5N A;  1RES A;  4RAG A;  4N4N B;  1KYW A;  3BG9 A;  1YW9 A;  2WV0 A;  1GHC A;  5DCM A;  4BL0 B;  1QZZ A;  1PUF A;  4Y15 A;  3PIP F;  1B72 A;  3DBR B;  1XC5 A;  1LB2 A;  2ZO4 A;  4QTR A;  2ZXH A;  4KN7 X;  3VSK A;  1HQC A;  3B73 A;  2NYX A;  2RDP A;  2LBF B;  4BGD A;  4NBQ A;  4ZDO A;  4P96 A;  1KU9 A;  2P0W A;  1MH3 A;  3OOU A;  3L2R A;  2FNA A;  3KZI C;  4B47 A;  3I59 B;  2P6S A;  3D5S C;  1S6L A;  1BW6 A;  4XID A;  4RLF A;  1Z9C A;  4KIS A;  1X2M A;  3DPU A;  2V4J C;  2HS5 A;  4LLG F;  2H8W A;  4M6V A;  1XGN A;  2ACJ A;  2BV6 A;  2KRH A;  1K4T A;  3PL8 A;  1AA7 A;  4ZZD A;  2XB0 X;  4U7B A;  4LLL A;  1T56 A;  3CC4 I;  1V4R A;  5J8F A;  3BRO A;  4RDU A;  1LFP A;  2ZSI B;  3ZQH A;  1BA5 A;  3F21 A;  1WH5 A;  3IWZ A;  4WF2 A;  4LLN A;  3SYT A;  4NHJ A;  5LEK A;  3IL2 A;  3K4M A;  3UKG A;  3D0S A;  4PJM A;  3SDB A;  2LY1 A;  1JKR C;  3OY9 A;  3AL0 B;  2HQ5 A;  1ORK A;  2F2E A;  3ZQL A;  5K5O A;  4HV6 A;  2K85 A;  5KK1 A;  2O8K A;  1KU3 A;  1MMD A;  2E1M B;  3I3L A;  1B8I B;  1YIO A;  3HC7 A;  2X48 A;  4RB3 C;  4BE2 A;  1CGP A;  4ENJ A;  3OYJ A;  2V9V A;  4BQN A;  4IHS A;  5IOY A;  3S14 J;  3PO2 J;  3DTK A;  2COB A;  5LEJ A;  1BL0 A;  2O5R A;  3K4C A;  1S7O A;  2OTJ I;  4PDK A;  1AKH A;  4LMY A;  1OLT A;  5BQT A;  3CCS I;  2A5Y B;  1ZLK A;  3CJR B;  1IJW C;  3KE2 A;  2XKP A;  4AVP A;  2F4M B;  3A0H C;  2R5Y B;  2XC7 A;  1SFO J;  2EQR A;  1Z6T A;  1DU0 A;  1BW5 A;  1RNL A;  1BOB A;  3GWZ A;  2E19 A;  3D5L A;  1HF0 A;  2CSO A;  4CCL A;  4EM1 A;  3PFI A;  1H9G A;  1MMN A;  2L7K A;  2VBZ A;  5CVI A;  2VQL A;  4UVC A;  4DIQ A;  4P55 A;  2XDV A;  4HDV A;  2NS8 A;  1TQI A;  2R4G A;  2JA8 J;  2XIG A;  2E34 A;  3MN2 A;  4IQ4 A;  4A69 C;  2TDX A;  4HLY A;  5J4V A;  2MC4 A;  2E5N A;  1X1P A;  2ID3 A;  1D1C A;  2W82 A;  4XMY A;  3HUG A;  2AHQ A;  2XKO A;  3BP8 A;  2VAS A;  3GEZ A;  2E60 A;  3LOC A;  4OIN F;  1J2X A;  3EUK L;  1QRY A;  1Y6I A;  5KNL A;  4CYC B;  2LSO A;  3RZO J;  4RBO A;  2ZXJ A;  2EIM H;  3JCU C;  5F0F A;  3S8P A;  4F3Q A;  4A5M A;  5LD2 C;  2QSG X;  3DWL E;  5EZG A;  1ZR2 A;  2F5F A;  2VL8 A;  2P4W A;  4PZJ A;  2CQX A;  3H1C A;  3VWB A;  4BHC A;  5IYC J;  3R0A A;  4A12 A;  1I1S A;  2XUB A;  3HPG A;  4OIO F;  1ZRE A;  1D5Y A;  3P7N A;  2HDW A;  2L02 A;  3LFU A;  2OTL I;  3S17 J;  4HF0 A;  2FUG 2;  2FMY A;  3JAM K;  2L3D A;  1ZH5 A;  4U0W A;  5CLS A;  2VC0 A;  2CFO A;  3LSG A;  3TKY A;  3S15 J;  1W7P A;  2HGC A;  2VE9 A;  1XGM A;  4DBQ A;  4BHP A;  2ECC A;  4B3X A;  2M87 A;  3ZXS A;  4B8X A;  3OYB A;  1W0T A;  3DPT A;  4M3E A;  2R7Z J;  2VJJ A;  4A3J J;  2ICW G;  2W84 A;  3U1K A;  1R4N B;  1R4M B;  2OUM A;  2FEZ A;  1B4A A;  4S04 A;  1K6O A;  2EZK A;  2VKV A;  4F93 B;  3U9G A;  5BMZ A;  1VQ8 I;  2NVQ J;  4Z6Y A;  3ASO H;  5J6X A;  1YIT I;  4RLQ A;  3GBG A;  2GZW A;  2XGE A;  3WGG A;  4FE7 A;  2Z1D A;  3S2H J;  2NAZ A;  4MHG A;  4O6J A;  2CG4 A;  2R7O A;  1XG1 A;  2CS3 A;  2JRM A;  3QYE A;  5EG0 B;  3BY6 A;  3A0B C;  4FX4 A;  2EZH A;  5FFX A;  1TL8 A;  4HPQ A;  4BY7 J;  1N75 A;  4AYB A;  3GFL A;  3A01 A;  2CRG A;  2MH2 A;  1LKX A;  1W5S A;  4I99 C;  3SFZ A;  5C4J J;  3HIF A;  2EBI A;  3GXO A;  3L09 A;  2BW3 B;  4E70 A;  4U7D A;  4UUT A;  5B1A H;  4R1H A;  1KYZ A;  4UNO A;  3IWF A;  1R00 A;  3NEU A;  1YS7 A;  3C3W A;  3W6J B;  4CZZ A;  3BTC A;  2GIV A;  1FTZ A;  3FIS A;  3J7Z I;  4OOI A;  3MKW B;  2EIL H;  4BYY A;  3U21 A;  5DCF A;  4AIH A;  3I4P A;  4P9U A;  3VSL A;  2BOL A;  2KIF A;  3FMQ A;  3L2W A;  5F64 A;  2KLO A;  2WY7 Q;  3WU2 C;  2DDA A;  3K70 C;  1XMA A;  1H0M A;  2X6O A;  4HAM A;  4KT6 A;  2XPV A;  2HQR A;  3E0J B;  1LUJ B;  4PJ0 C;  3K4B A;  3E5Q A;  4HV5 A;  1T0F C;  1P4X A;  1KQ0 A;  1EF4 A;  4G8X A;  1GVJ A;  2M0C A;  1TWA J;  5HOO A;  4G7O F;  4XQF A;  1VQ5 I;  1R36 A;  1LVA A;  2AQF A;  2MG4 A;  1HW2 A;  4LIU A;  2O3F A;  3ZMT A;  1VQ7 I;  3W6V A;  1XB4 A;  3LSP A;  3TL4 X;  4HNV A;  1T95 A;  2PBI A;  1O7L A;  2QWW A;  4KA4 A;  1U5T B;  1XGO A;  3H9Q A;  4ABZ A;  4FQG A;  4PFP A;  3BC8 A;  3ZQC A;  1K6Y A;  2O8X A;  2FQ4 A;  3RJP A;  2IJL A;  3W2V A;  2C6Y A;  3KP4 A;  1D1A A;  2R0Q C;  3DU6 A;  5FRN A;  2M8G X;  2A6T A;  4N9I A;  1FMW A;  4O3M A;  1R1U A;  3J80 K;  2KP6 A;  2B9S A;  3CO7 C;  2K27 A;  3NAU A;  5ILU A;  4AYB N;  3ZOB A;  2CUF A;  4CXF A;  4RB2 C;  4NQW B;  3HHH A;  5ILS A;  2K9Q A;  2NS7 A;  3FDY A;  2ZJP F;  3I59 A;  3I53 A;  2E7W A;  1TNS A;  3BZK A;  1S7A A;  2OQR A;  4CSW A;  2LKX A;  1K7A A;  4MLO A;  2FNP A;  5J40 A;  1O3T A;  4IL6 C;  4UXN A;  4PJN A;  1R7J A;  5ERI A;  5D8K B;  5M5X J;  4RMN A;  3CC2 I;  2OCE A;  1BR2 A;  2X1C A;  5TGT A;  4CCM A;  1D8J A;  2I5U A;  3TO9 A;  2DFI A;  4BH9 A;  3CUQ C;  2FOW A;  3MWM A;  5D4R A;  1TWH J;  3V42 A;  5DCM B;  4BXX J;  1WJ5 A;  4J01 A;  1OIS A;  4C3H J;  3Q0V A;  1B72 B;  1I6X A;  4D9J A;  3BG7 A;  2OA4 A;  3OYM A;  2RQQ A;  3V8K A;  2A61 A; 
#chains in the Genus database with same CATH homology
 5IP6 A;  2X9D A;  4FE4 A;  4W1U A;  2M34 A;  1FEX A;  2MSY A;  2ME6 A;  2KDZ A;  3HBL A;  1TWF J;  3I4N J;  1VFC A;  2N8G A;  1UG2 A;  2E2J J;  1FIP A;  1XS9 A;  1RKW A;  2O7O A;  5GPA A;  2P81 A;  1ENH A;  2D5V A;  1QVT A;  3JRH A;  5EG0 A;  1MBJ A;  5K7H A;  4JX5 A;  2R93 J;  3GTG J;  1JGG A;  1HCR A;  3A02 A;  2L7M P;  1G2H A;  3GTQ J;  1MBK A;  2TRT A;  3CCY A;  5EF6 A;  5E3N A;  4XRM A;  2Y9Z A;  1HDD C;  4AUX A;  2Y31 A;  2LK2 A;  3ZQG A;  2YS9 A;  5FLM J;  2LP0 A;  1FJL A;  4GFB A;  2HI3 A;  3BTI A;  1E3O C;  3S16 J;  2WV1 A;  1ZK8 A;  4MO7 A;  5JLW A;  3S1M J;  5IOZ A;  4MFE A;  5E3L A;  2MGQ A;  4B3A A;  4M3B A;  5M3M J;  1HDP A;  2CQQ A;  2LY9 A;  1JKQ C;  2HDD A;  3D1N I;  2PMZ N;  5EZH A;  4B1R A;  1ZTR A;  2H8R A;  3HGG A;  2G0E A;  3LSR A;  4L5E A;  3HDD A;  2DTZ A;  3K7A J;  3BG5 A;  2YU9 J;  2LLK A;  1I50 J;  2JA7 J;  1ZQ3 P;  4DYQ A;  4MIM A;  2OF7 A;  4A3M J;  2WB1 N;  4DZJ A;  1K61 A;  4A93 J;  4W97 A;  2GLO A;  1I3Q J;  3TP0 A;  3JRG A;  1JUM A;  5J1R A;  1AKH B;  2L7Z A;  4XRS A;  1TWG J;  4DZP A;  2XPW A;  2NVX J;  2NVT J;  4DW6 A;  1P7I A;  1SAN A;  3E7L A;  1IGN A;  1YRN A;  3BR6 A;  5F1J A;  1LE8 B;  1MBF A;  2DA2 A;  2XPU A;  3IH2 A;  1X58 A;  3VPR A;  3S2D J;  4MFD A;  5J3L A;  3NAR A;  3GTO J;  3H0G J;  4A3D J;  4UUS A;  2HYJ A;  1JJ8 C;  5BNG A;  1TC3 C;  3IH4 A;  5E3O A;  1U9N A;  2Y30 A;  3WHB A;  2AO9 A;  3M4O J;  1Y1W J;  5EDN A;  3GTL J;  3OSG A;  3QPL A;  2TCT A;  2LR8 A;  4DYR A;  5EGO A;  1JKO C;  4IHX A;  5K7F A;  3Q0U A;  5FLV A;  3QQA A;  1A6I A;  3BR5 A;  4J19 A;  5GP9 A;  1RES A;  3JRB A;  4D7M A;  2LD5 A;  3BG9 A;  2L9R A;  5FKO A;  1S7E A;  1JT6 A;  1RKT A;  1PUF A;  1B72 A;  1XC5 A;  2NVY J;  3Q0W A;  4QTR A;  2OPT A;  1JKP C;  5IYB J;  4AC0 A;  3OOU A;  3SJM A;  1MH3 A;  5FKM A;  4B4C A;  5FKK A;  2LTP A;  3HOX J;  3OSF A;  3L1P A;  1APL C;  1VI0 A;  1VND A;  5FKN A;  1QVU A;  2WAQ N;  3RKQ A;  1ETY A;  1BW6 A;  4XID A;  1FTT A;  2JJ7 A;  1X2M A;  1NK2 P;  3BQZ A;  3G1M A;  4M6V A;  2O9L A;  3M3Y J;  3PM1 A;  1WI3 A;  3HOZ J;  1R9T J;  3Q3S A;  2JMW A;  2XB0 X;  5C44 J;  5F0H A;  1P7J A;  3DEW A;  3RZD J;  1T56 A;  2H1K A;  2E2H J;  1IRZ A;  1MBH A;  4RDU A;  2KT0 A;  3ZQH A;  4A3F J;  1BA5 A;  1WH5 A;  1ETK A;  5EEA A;  1RPW A;  1O4X A;  2XB5 A;  1BJZ A;  3A03 A;  4JYK A;  3CQZ J;  4A3E J;  5C3E J;  3S1R J;  3UKG A;  1NTC A;  3O8G A;  1JKR C;  3BR3 A;  3G1L A;  1Z0X A;  2HQ5 A;  1ORK A;  2HOA A;  3ZQL A;  3FKI J;  4LOC A;  2O8K A;  1B8I B;  2X48 A;  2CUE A;  1VF9 A;  4M3F A;  1QPI A;  3C2B A;  5M5Y J;  5IPA A;  2XGD A;  1T33 A;  5IOY A;  3S14 J;  3PO2 J;  2COB A;  2QCO A;  3WHC A;  1AU7 A;  2Y2Z A;  3HB9 A;  1BL0 A;  4G12 A;  1GVD A;  4FCY A;  3A01 B;  1AKH A;  5FKL A;  4Y7N J;  1HLV A;  1ETO A;  1AHD P;  1IJW C;  3LSJ A;  4I6Z A;  1A5J A;  3ZQI A;  3JR9 A;  1SFO J;  2R5Y B;  5F27 A;  2EQR A;  2LVS A;  5J1Y A;  4M3D A;  2GM4 A;  1DU0 A;  1LE8 A;  2ELK A;  1OFC X;  3HOV J;  1BW5 A;  1MSF C;  5FJ8 J;  2E19 A;  1HF0 A;  1CQT A;  2ME0 A;  1FIA A;  4QIW N;  1ZR4 A;  3HEF A;  1GUU A;  4A3K J;  1UMQ A;  1OCP A;  2I10 A;  5IYD J;  2NS8 A;  2FX0 A;  1GV5 A;  4XIC A;  3MKL A;  4IHV A;  2JA8 J;  2IBD A;  3S1N J;  2DA5 A;  1HOM A;  3MN2 A;  5C4X J;  3BR0 A;  4A69 C;  2DA3 A;  2DMP A;  4D7N A;  5DTD A;  3TW6 A;  3GTK J;  2ID3 A;  2XSD C;  1RET A;  2FD5 A;  4V2F A;  1F36 A;  1GV2 A;  2AHQ A;  2VKE A;  4NDL A;  3SFI A;  2ZB9 A;  5IP9 J;  1YRN B;  2QF7 A;  3LOC A;  2JN6 A;  3HOW J;  3HOY J;  1QRY A;  2NOG A;  3I4M J;  4CYC B;  5M3F J;  5HOD A;  3RZO J;  4RBO A;  4S0H B;  5F0F A;  3BR1 A;  4UUS B;  5JLX A;  1IG7 A;  5EZG A;  1ZR2 A;  4X6A J;  2CQX A;  2L0K A;  4M3G A;  2M2E A;  5IYC J;  4IHW A;  3IV5 A;  2B63 J;  4FTH A;  3TW7 A;  1DU6 A;  2DMT A;  3BT9 A;  2K9N A;  1IUF A;  5DS9 A;  3JRC A;  2R5Z B;  1D5Y A;  4BKX A;  1LFU P;  3JRF A;  3S17 J;  2HXO A;  1OJL A;  1JTY A;  4XRS G;  1Z77 A;  5IP7 J;  4A3C J;  2DMN A;  3LSG A;  2ID6 A;  3S15 J;  1I6H J;  2HOS A;  2CJJ A;  2ECB A;  1H8A C;  2ECC A;  2W48 A;  3HM5 A;  2DMU A;  4M3E A;  4DYC A;  5GPC A;  1W0T A;  1MH4 A;  1PUF B;  3GTP J;  2R7Z J;  4A3J J;  4C3I J;  3JRD A;  1F43 A;  4C3J J;  1LFB A;  3H3V K;  2DA1 A;  4V2G A;  3IH3 A;  1NK3 P;  1K83 J;  1JT0 A;  1ETW A;  3BG3 A;  4JP0 A;  3S1Q J;  3SDG A;  2EZK A;  2VKV A;  2NVQ J;  1ITY A;  4D5F A;  1WPK A;  3OIO A;  3RQI A;  3JRE A;  4EEF G;  2E1O A;  3GBG A;  3BR2 A;  3LNQ A;  2IAI A;  2XGE A;  3B6C A;  4C2M J;  3BQY A;  4FE7 A;  3S2H J;  1B8I A;  5EYR A;  3F0C A;  1GDT A;  3HGY A;  2EZL A;  2JWT A;  1ETQ A;  4A3L J;  3CMY A;  1IC8 A;  1WH7 A;  1XG1 A;  1MBG A;  1GT0 C;  3DCF A;  5EG0 B;  4D5C A;  2EZH A;  2MW8 A;  3B6A A;  3QPS A;  4BY7 J;  3FK6 A;  5F0C A;  3A01 A;  2CRG A;  2DA7 A;  3GTJ J;  3BTJ A;  5F08 A;  5C4J J;  3TED A;  2EBI A;  3G1O A;  4UUT A;  4BBR J;  9ANT A;  1U9O A;  2R5Y A;  3HKZ N;  1ETX A;  1TWC J;  3BTC A;  2VUM J;  1FTZ A;  2VPR A;  3CDL A;  3FIS A;  4I76 A;  2M9H A;  3ZQF A;  3JRI A;  2EH3 A;  1UHS A;  1X2N A;  1ZGW A;  1H88 C;  1ETV A;  2GBY A;  3PO3 J;  1JUP A;  2YUS A;  1POG A;  1U8B A;  2Y0S N;  4BBS J;  4BY1 J;  2JA6 J;  4JX6 A;  2DMQ A;  3TP3 A;  3O8H A;  1JUS A;  2K9S A;  1RR7 A;  2X6O A;  2LFB A;  2DJN A;  2XPV A;  4IEJ A;  4QSH A;  2FJ1 A;  5K7Z A;  2CU7 A;  2R92 J;  3MVP A;  1H89 C;  2EZI A;  4JX4 A;  1MNM C;  1EF4 A;  2K40 A;  2XGC A;  1MBE A;  2M0C A;  1TWA J;  1WCM J;  2MG4 A;  5M5W J;  4Y52 J;  3GTM J;  1WGX A;  3W6V A;  3LSP A;  4A3G J;  4HNV A;  1OCT C;  1Y1V J;  4CYC A;  4ABZ A;  2HXI A;  2XRL A;  3ZQC A;  1W0U A;  1IDY A;  2FQ4 A;  2HOT A;  2E2I J;  2L7F P;  2R0Q C;  2JA5 J;  2M8G X;  1IV6 A;  2RAE A;  1JJ6 C;  1ZKG A;  2DN0 A;  3NAU A;  4AYB N;  3ZOB A;  2CUF A;  2Y9Y A;  2R5Z A;  1U78 A;  2K9Q A;  2NS7 A;  2DA6 A;  1MSE C;  3K2A A;  5F04 A;  2LKX A;  2JK3 A;  1JTX A;  2IEK A;  4MLO A;  4IHY A;  1IDZ A;  1Q1V A;  4A3B J;  5EGO B;  5J1U A;  4XK4 A;  5M5X J;  4A3I J;  3HOU J;  2VI6 A;  3JRA A;  2DA4 A;  1TWH J;  4BXX J;  3FIW A;  4C3H J;  3BTL A;  3Q0V A;  4X1E A;  1B72 B;  4FIS A;  5E3M A;  3FK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...