1VQNI

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqnI00
3J7YJ 4IOCF 3PIPF 3CCLI 3CMAI 3CD6I 1FOWA 4IOAF 1VQ7I 2E36A 3I56I 1YJNI 2E34A 4IO9F 1VQ4I 2ZJQF 2OTLI 2E35A 3CCQI 1VQOI 3G6EI 3CCEI 3CCMI 1ACIA 5GAGJ 2ZJPF 3CCVI 3CCUI 1Y39A 2OTJI 3CCRI 3CF5F 1VQNI 2K3FA 2H8WA 3DLLF 1VQLI 1HC8A 1YJ9I 3G4SI 2NXNB 1VQ9I 1VQPI 1YIJI 3CCSI 1FOYA 1QA6A 3CC7I 1VQKI 1YJWI 2FOWA 2JQ7A 5GAHJ 5DM7F 3I55I 1S72I 5GADJ 3CC2I 3G71I 1YITI 5JVGF 4V19K 1VQ8I 1VQMI 4UY8I 1FOXA 2QA4I 5DM6F 3J7ZI 3PIOF 5GAEJ 1VQ5I 3CMEI 3CCJI 1YHQI 2QEXI 1YI2I 3CJTB 2ZJRF 3CC4I 1VQ6I 1MMSA
chains in the Genus database with same CATH superfamily
2XC7A 1I6XA 2VKDA 2DCEA 3QOEA 3I56I 1UAAA 2AQFA 3QPHA 5K5QA 5DCMA 1OCCH 2MG4A 5IY5H 1FBUA 2WAEA 1IJWC 1G8XA 4I6ZA 3P9CA 3JTGA 1CQTA 4CDGA 2L9VA 1OPCA 3H5AA 3IRQA 2DXIA 5D6EA 4B4CA 2XSDC 2K86A 3I64A 1I27A 1SD7A 1SEUA 1P4XA 1XSVA 2I10A 1WSUA 2YPRA 3NRVA 5E79C 2O6GE 3BZCA 1LE8A 2VBWA 3TMOA 3K7AJ 3B73A 4IVNA 1SFUA 5C4JJ 4EJWA 1RUOA 2HKOA 3S32A 3F8BA 1KU9A 4I98B 3RPUA 5J8FA 3QPLA 1KYZA 2HPIA 2E2IJ 4EM1A 3KZIC 2K40A 4YG2F 4UHTA 3K0LA 4IHVA 3SFZA 2COMA 5F08A 2HPMA 2HEOA 1YW7A 2A3SA 5IYBJ 4HAMA 3CCJI 1MBEA 3OL3A 2V26A 4E7HA 3M8FA 3I53A 2ID3A 3K4LA 2R7SA 4Y33A 4JP0A 3G1MA 3E6CC 4UV9A 2IBDA 3BOQA 5KCMA 3HTSB 3CCUI 1O7LA 5BOXA 3LMMA 4L0YB 2W00A 3O2PE 2DTZA 4UXNA 2E5NA 3FXOA 4RAGA 4A3KJ 2RNJA 1AU7A 2PFBA 3HTUA 5DM7F 4C2UA 5CVUA 1JE8A 4LB5A 1RESA 1OJLA 4FHTA 1CGPA 3ZGKA 3LL7A 2WBMA 2MD0A 5ERIA 2BXYA 2X6YA 3E0JB 2D1HA 3OOUA 4GXOA 3ZN0A 4DBRA 1HSTA 2P7VB 3FM3A 5HDGA 4X1EA 3RZOJ 5LGTA 1FOYA 4W97A 2FBIA 5CJ9A 3UR3C 5DTDA 4CCMA 2JA5J 5JVTA 3V4GA 3CUQC 1S72I 4UY8I 2BV6A 2VLAA 2LFBA 3MKLA 3E6MA 4IRHA 1R1TA 3PJRA 1MBJA 4E6KG 2OCEA 4RB3C 3OL4A 2JK3A 2Z16A 1IV8A 4KICA 3I4NJ 3IKTA 1J5YA 5D8LB 3PQJA 4LLGF 4M73A 4UUVA 2ZNYA 3M1EA 1MGTA 5FKLA 4Y3OA 5IT3A 2VKHA 2CG4A 3C2BA 1HKSA 2W57A 2EB7A 2ZSIB 2X9DA 4N9HA 1YE9A 2KDOA 3L2WA 2HQRA 3K9TA 2M7BA 5D5XB 4G7OF 3CO7C 4OIQF 2FMLA 1AA7A 2P5LC 4C2TA 3OYJA 4ZTFA 2X4HA 3JRIA 3V7RA 4GFBA 5B5EC 1ZN2A 4QPOA 3ZP5A 3C1DA 2DA1A 2LK2A 1ZAOA 3HRUA 3DFGA 5E1XA 3HJEA 4EM2A 2Y48A 5H20A 2VN2A 5IT9Z 1BI3A 4EEFG 2P6SA 1MMNA 1EV7A 4ESBA 3WGHA 1UG2A 3KP4A 2M3AA 1QGPA 1R4MB 4XORA 4OOIA 5LEJA 3JREA 3IC7A 1WHUA 1X3WB 1OKRA 5EG0A 3I4PA 4A6EA 2ETHA 2XF7A 5JFRA 1FYKA 3F9KA 1L0OC 3L2RA 3I5UA 1YFHA 5ICCA 5BMZA 1S5LC 1V54H 2ZKZA 1IRGA 3DTEA 2R7OA 2O7OA 4MTEA 1LPQA 2ESHA 3QOPA 1UMQA 2K3FA 3HGYA 3GBGA 2WV1A 4U0WA 4LLLA 1MNMC 4ENMA 4IEJA 2KHMA 2V9KA 3FF5A 1D0ZA 4DYCA 1FP2A 2DJIA 4MNUA 4UUSB 3I55I 5JVGF 1D8JA 2ZMEB 3I59B 4XMYA 4I99C 3REOA 4WWCA 2QLZA 2XF5A 3KP3A 4CZZA 4BJTA 1QPMA 1SFKA 1W0UA 1IF1A 2R7UA 3FXKA 1XMAA 2HZDA 3Q0VA 3VYSB 1BIBA 1O3QA 2K27A 2X1DA 1RUNA 2LKXA 3FXUA 1VQLI 2EA4A 1TT5B 4NBQA 2V79A 3WTVC 4A3GJ 5GTIC 4GCVA 1R6RA 1U9NA 2F4OB 4HW0A 3GTQJ 5E18F 4E7IA 4RAZA 3LSJA 1SAUA 3T1BA 5KK1A 4CICA 1H89C 1V5GA 1WGXA 2E5ZA 2VXZA 1B4AA 2CQXA 4PSXA 3WGGA 5F1JA 1FP1D 5J3LA 2M4GA 4IOCF 1MH4A 3WE2A 3AL0B 1POGA 2ECCA 2X0LA 3K69A 2IS2A 1DQUA 2QM3A 3MFKA 2JA7J 2XSJC 2LBFB 2JRTA 5EGOB 3IWFA 4EVIA 3GXOA 1I50J 2K7LA 1OQYA 2M8EA 3LFUA 4AYBA 2GLOA 5IYCJ 1ZARA 2QKLB 2JUCA 4Q4ZF 1PP7U 5E1ZB 3I58A 5FGMA 5F64A 2HYGD 5LHGA 1Z9CA 3GTGJ 1VQ8I 1JGSA 2OAZA 2X85A 3WU0A 4PUSA 1SVMA 5F04A 3MVPA 2RNGA 1FYLA 5LRRA 1ZREA 3ZPLA 4NNJA 1R4NB 3ZQHA 1G59A 5EGOA 1IGNA 2MH2A 1Y6IA 5L3EA 3OYFA 2QUFA 4ZYGA 1VTNC 1XDUA 5BNGA 2E7WA 3ZOBA 5D5UB 1F4KA 1WJAA 1R9TJ 2QQ9A 3ABLH 3Q9SA 1EF4A 4RGRA 3HOWJ 1BOBA 2Z99A 3HHGA 1RR7A 3WGIA 1OCOH 3H1CA 3NAUA 3L2VA 4PDKA 1YRNB 2RGVA 1APLC 2JN6A 4B09A 2MYSA 2LREA 2CW0F 4YRVA 1ZKGA 1YS6A 5JLXA 3DU6A 2LY1A 5JR3A 1YHQI 4D5CA 1FPQA 3BG3A 5HDNA 1MMGA 5J1UA 1UHMA 4AUXA 4BY1J 4ZYAA 3BQZA 4S05A 3PO3J 2WB1N 2QKMB 4PFOA 4G8XA 1VZ0A 4HF0A 3FXQA 3CCEI 3E5UA 2DAOA 2IT0A 1ON2A 1P4AA 3QAHA 4LITA 3GZ5A 2NS7A 1XN7A 5LHHA 2B63J 1TZLA 4P55A 1NHAA 1P4WA 4XKCA 1IW7F 2AXTC 2EZHA 2X6WA 2HNHA 5CVIA 1W5SA 4UVAA 1DU0A 1U2WA 4CO8A 1CF7A 2NRAC 4QWQA 4FISA 1FJLA 1JKPC 2K4JA 1I1GA 1O3TA 3CQZJ 2OC6A 4L5IA 2QSHX 2G0EA 3F21A 3G73A 1P9QC 2JVGA 4JOMA 5JHFA 3DPUA 3BR1A 3GO5A 4F52A 1MJ9A 3BZ6A 2CQKA 3ZMZA 3PNTA 3KP5A 2PX9A 3TL4X 2IRFG 1VQ9I 3G4SI 3BCAA 3NWSA 5JI6A 1JTXA 4KDPA 1N78A 2BXZA 4BQQA 3HOVJ 4ZYDA 3FIWA 4WXDA 4CCNA 2XPVA 4M3GA 4B43A 3G1LA 2HOAA 1FOXA 2HDDA 3TQNA 2ZXIA 4XK4A 1HDDC 5A2QK 1DPUA 1LFPA 2DPUA 3J7YJ 5FRNA 3GFLA 1X58A 3TEDA 3VOEA 5D5VB 2R93J 3MAJA 3SHFA 4HSRA 2K9NA 2W84A 2QQAA 3M8JA 3CUQB 4LIVA 1USTA 2L2OA 4Q48A 4XQFA 3ZMUA 3ZRGA 4XSZF 2NVXJ 4MO7A 1FIAA 2VJIA 1XGNA 2A6HF 2MD5A 2LYCA 4GO1A 5DV5A 5GAHJ 1QHHD 2Q8KA 1HLVA 2B7EA 1U0JA 1K6YA 3IH4A 2JSCA 1Z1DA 1IUFA 4C9YA 3KFWX 3KE2A 2G9WA 1FOKA 3GTOJ 1QHGA 4ETSA 1UELB 1Z7UA 1W36D 1XGOA 1LVKA 4KMUX 1WCMJ 4M6VA 2XPWA 2M8GX 2YSRA 2L9NA 3CJRB 5H2FC 2KPMA 5L3BA 1J0RA 1EJ9A 1E0EA 1YLFA 1ZGWA 3F6OA 1IN8A 2CS3A 5LGNA 1R00A 2VKVA 2VI6A 5HS9A 3FHZA 4FX4A 4ESJA 2W48A 2Y0MA 4BDYA 4BQNA 4LD5A 1FMVA 3TO7A 4KNYA 1A36A 1D0YA 2JA2A 3WU1B 3B6AA 4U87A 3WHCA 2CUJA 1Z6RA 4L18B 2CRGA 2EJRA 4HV5A 5F6FA 3HOYJ 1U5TA 5H6QA 4N0BA 1UFMA 5M5WJ 4WXCA 2UXNA 4R1HA 4PJMA 3RCOA 3F8CA 1VF9A 2ACJA 2CW7A 4I09A 2NOJB 4QLCU 4EATA 2CQQA 4PCQA 2J5OA 1QU3A 3TDUC 1LNWA 1B1BA 1EKEA 4IHYA 4LIUA 2FNPA 3KYLA 4HLXA 2VJ5A 4Y7NJ 1FWZA 1KONA 4DQ2A 1Z3YA 4BXFA 4ZZLA 2Z33A 3VDXA 4E7JA 1GHCA 1T8IA 1HW5A 4RM2A 3PQKA 2VUMJ 1H9GA 4E7SA 1RI7A 2DOAA 2B9SA 3N05A 5DYMA 2DA2A 2LKSA 3K1MA 2DPDA 4EM0B 1X4OA 1OCZH 3IHUA 1TWCJ 2K02A 3K4NA 4AIHA 4ZZDA 4A3MJ 2O61A 3BROA 1XDSA 4BE0A 1BJAA 2I5UA 1G6NA 4XLPF 2IJLA 3KETA 4OMZA 1LVAA 2HTJA 3AFHA 3OYHA 4ITVA 5GTHC 3S1MJ 5E3LA 2F5DA 3O3KA 3QQAA 3QYBA 2DK8A 2BZTA 3K2AA 2LOOA 1W7PB 2Q0OA 1O4XA 2AQEA 4P96A 1IUYA 2R7QA 4I7HA 2BOLA 2TDXA 2LF8A 4MGRA 2M87A 3OYDA 2VIXA 2UUZA 2HOTA 4GDFA 3RZDJ 2R5ZB 4YFNF 5AIPA 3MZ8A 1HBXG 1O3RA 1IO2A 1WI3A 1K4TA 1LDKB 2F2EA 4RBOA 1I3AA 1X2NA 3BCBA 4CCJA 2ZSHB 2FBHA 2OD5A 3LQQA 1MW7A 2ZXWH 3BJ6A 2V7FA 4E7LA 1YYVA 3QU6A 3GTMJ 3ML6A 3NARA 5JLWA 2BW3A 2WAQN 4M3DA 1XPXA 2NXNB 2KL4A 3BG9A 4ZTJA 4AD9A 1ZRFA 5HNHA 3FXJA 3LAJA 2Y9YA 1BBYA 1GV5A 1Z21A 4B3AA 2XHKA 2IPQX 2ZMEC 3A0HC 4BU2A 4CUGA 3WTUC 3E1SA 3K4JA 4JBAA 2K5CA 3OIPA 4DIQA 4RB1A 1MMDA 2P7CB 4OINF 3RQIA 5F0HA 3HRMA 2DMQA 2MSYA 4C3HJ 3GFIA 3H0DA 3SDBA 1MBKA 4A3CJ 2ZNZA 4EJOA 4HF1A 1OR7A 5HLHA 4LB6B 4HEA2 2HTSA 2OA4A 3S1RJ 4OAZA 4BXXJ 3CP2A 2F4IA 2QVOA 2CWEA 4XONA 4Y4RA 3SEZA 1RZ4A 2YU3A 4CCKA 5KNLA 4U0YA 1GVJA 1B6AA 3VSKA 5FD6A 3J7ZI 3ZMVA 4ZYHA 3CO6C 1T0FA 1VQ5I 4M6YA 5FKNA 5FLXZ 1YRNA 2F5FA 4UUSA 3PNVA 2HYJA 2D45A 3KLNA 5ILSA 4V2FA 5FLVA 1E17A 1WQ2A 3FXMA 3DU5A 4A5MA 4M72A 1IN6A 3C18A 1YX5A 3HIFA 1TTYA 2A68F 4ENKA 5CPRB 4LLNA 3GTJJ 2HOEA 4NHJA 5K5RA 1VQPI 2DMNA 3SQNA 2PJRA 2I8DA 1FY7A 1K78B 1EH7A 4B48A 1BW6A 2IAIA 3SEQA 3EQLF 1ETOA 3A0BC 5A2QZ 2VODA 3V8JA 2YS9A 1U5TB 3U21A 2OF7A 1QNTA 3BY6A 1F36A 2XRLA 4PZJA 3ROUA 4YIFA 2B0LA 3OYKA 3JRDA 1JUMA 5EZGA 2P5KA 2EZKA 4FE4A 4IHSA 2YR2A 3OYBA 1BJZA 4I02A 1P2FA 2VONA 1ULYA 3BTCA 2IS6A 1UZCA 2FOKA 2O8KA 2Q2EB 3H9JA 3A02A 3I54A 1MIJA 4XLAA 4IRGA 5B66C 4HYEA 2DFFA 1P92A 3CESA 4Q47A 2UXXA 1SAXA 4EMSA 1Z67A 4UUTA 5IP6A 5J47A 1A35A 3S14J 2CMPA 2Y31A 3S3NA 4RLFA 2L7MP 1AHDP 1VQ7I 1CF7B 3F8MA 5FB2A 1JKRC 2DA7A 1Q1HA 2L02A 4CCLA 1LE8B 4MLOA 2DA4A 1G3SA 1K4SA 1PP8F 2GZWA 3H36A 4PGGA 1R49A 5FKKA 3L9FA 4V19K 3CJNA 3HZJA 1BR2A 5CVVA 2DQLA 5FRMA 2H6CA 4L0ZB 1E3HA 1WJ5A 3BG7A 3HC7A 1HCRA 3U1DA 4LJZF 1JT0A 2H09A 2PBIA 2DT6A 2EZLA 2QYOA 3BR5A 3RKWA 4A3EJ 4XLFA 1MNDA 1O7FA 1B9NA 3LSHA 3HB9A 4FX0A 1TW2A 2PEXA 4PK4A 1ZYRF 1IC8A 4XOTA 4AIDA 2CYYA 4AVPA 3GF2A 1LQ1A 4JX6A 4F91B 4M9SA 2NYXA 5FJ8J 3ZQLA 1GUUA 2KFDA 2XASA 3TDZC 2IEKA 2DA5A 1WVRA 2QQBA 4CZCA 2Y75A 2ECBA 1Z6TA 4BE1A 5ICEA 4L9JA 1D1CA 3SFIA 4A69C 1KU2A 4I01A 4P5OA 5D6FA 1OYIA 3COAC 4HX4A 2EINH 4EV0A 2W4SA 2PG4A 4BACA 1SVLA 2K4BA 2V4JC 4LG3A 5EZHA 1ZLKA 2LBFA 3CDLA 3F22A 1XGMA 4AU7A 2MC4A 4C30A 1GV2A 1HXDA 2PQ8A 2EFWA 1MMSA 1WFXA 4H0EA 2Z9OA 3Q9VA 4Y17A 2HOSA 2EFOA 3HKZA 3BT9A 3K70C 1XMKA 3LSPA 4MQ9F 5M3MJ 3ELKA 2X48A 3ESWB 4BAYA 2KP6A 5D5WB 3E6DA 3LSKA 1TL8A 4RA2A 3Q5FA 1RKTA 4XLNF 4YFKF 5EJCA 4HF2A 1I6HJ 2QGUA 4C2MJ 4RB0A 3GZ6A 3ULQB 3UNGC 5JHUA 4WF2A 4BY7J 4OIRF 1XSXA 2ZB9A 5GAEJ 1G3YA 1LEAA 1U5TC 1WJEA 1QZZA 5K1YA 4YIRX 1B72A 2W1OA 1C0WA 2PMZN 5CKTA 5LRSA 4G6DA 4LMYA 2OJED 3KEOA 1MNEA 2DFEA 3AG2H 4K2EA 3ERED 2R7TA 4NC6A 4DZJA 4E70A 3CF5F 2GXGA 3WODF 4J00A 1TQIA 2MLGA 3LFKA 2WV0A 1UHWA 4ASNA 2FNAA 5AIQA 1HOMA 1BC7C 2DDBA 3BR0A 1JT6A 2H6BA 2JPBA 3M7GA 2LRDA 3I4MJ 2WADA 5E1WA 4S0HB 4IHWA 2VQLA 1IN5A 1WJBA 1BL0A 2W25A 5E8GA 4XRSG 2IGNA 2MW8A 1YS7A 3M8EA 5EEGA 2KIQA 2X51A 2BGCA 3JAMK 2KZVA 3ERMA 2DT7B 4M6XA 1TLHB 3MMYB 1ZRCA 2IGMA 2EFQA 1F9NA 1ZLJA 3OS1A 4ENJA 4KN4X 3TP0A 3BLYA 4EGZA 4PSWA 4D7NA 4RS8A 4HX7A 4HG2A 3C7JA 1A5JA 1Y0UA 3PO2J 2BW3B 4NQWB 1E3OC 4Q5SF 4N4OB 2EV6A 1F1ZA 2OTJI 1HKQA 4U0VA 3L00A 4V2GA 2R7ZJ 5HNFA 2NVQJ 3F0CA 3HOXJ 2PLYA 4CA0A 3JW4A 1N75A 3MEXA 1UG0A 2E1CA 1HSJA 1TQPA 2L0KA 3DF8A 1ACIA 2M9HA 5TRDA 2DFHA 2FE3A 2JA6J 2CFXA 2KQRA 1H9TA 5E8IA 1T56A 4KMFA 5IPAA 2JZYA 3E6BA 4J19A 3O8HA 3LWFA 4GYIA 1V4RA 2BY3A 1OYYA 2Y30A 4B3XA 4I2OA 3BP8A 4M71A 2VKEA 2VT2A 2BVMA 3GFMA 2KRFA 3BR3A 3LSMA 3TBIA 5E3NA 4OIOF 1KQ0A 2DA3A 2WWYA 4BQAA 5D4RA 2GOMA 3SJMA 3ASNH 4F7ZA 2H8RA 2E71A 4DJAA 4XIDA 3KYCB 1IRFA 1B8IB 3CMMA 3RYPA 5HS8A 4X6AJ 4ZDLA 3BR6A 2LKPA 2QWWA 2LNBA 2QCOA 4XNFA 3ASOH 5L3FA 1K61A 2L7KA 5L3GA 1OMIA 1R36A 2IW5A 3PFYA 2FSWA 1Z77A 2JWTA 4XR6A 5EEHA 2GQQA 2WY7Q 4BBSJ 1T39A 4C3JJ 2BY0A 4D0PA 2A61A 3EUHA 2L7ZA 4CGZA 3FWEA 4UB6C 3AG4H 3H92A 4NB5A 2E35A 1XB4A 3T8RA 1OCPA 3EUHC 3V8LA 1JHHA 3TGNA 3OSFA 3RPUD 3PL8A 1PUFB 3IKVA 3ABKH 2LY2A 4O3MA 3GLXA 2LF7A 2NNYA 3GLLA 1MZBA 4U7DA 3IL2A 3DBLB 4RLQA 1ZG3A 1USSA 2FQ4A 3J81Z 3VPRA 2K9SA 2ZJRF 1ZR2A 2Y0SN 3H5NA 3CD6I 1FSHA 3W6KB 4F55A 1WJCA 4B47A 3CCQI 1OCTC 1T08B 3P5JA 2HR3A 2P81A 3C3WA 3LQRA 3A01A 2XGXA 3UKGA 3M3YJ 1KU3A 3FX3A 3S8PA 1IXSB 3S2HJ 3CCSI 3OYGA 3RJPA 3CLOA 5J4YA 2J5PA 3HRSA 2M30A 4AIJA 2E1OA 3JRBA 2DMTA 3I3LA 1YO5C 3K1PA 5GPCA 2QQ8A 1QO0D 1A31A 5K5OA 3H3ZA 2GM4A 1JKQC 3H35A 2COBA 2P0WA 1XD7A 3U2RA 4WXHA 3F72A 4EJUA 1JXSA 1QRYA 3HSFA 4B8XA 1J09A 3S1QJ 2HGCA 2HI3A 1WH5A 4M74A 2F5VA 5K7FA 2CGPA 5KAIC 2LSOA 3ZQGA 3KZYA 1G3TA 5EYRA 1KA8A 3TW6A 1FTTA 4BDZA 2IA2A 2D1VA 1WPKA 1YW9A 2L4MA 3FKJA 5ED4A 4KISA 4LG0B 2DT5A 3MWMA 2PMUA 3N97A 3IAS2 5IOZA 1LB2A 1RIOH 2Y2ZA 3FISA 2F4MB 3ZMTA 3D5SC 3LNQA 4IO9F 5HLIA 4KJZA 2M4KA 1KZHA 5EG0B 3HOTA 1TWHJ 2EBIA 1X3UA 3FKIJ 2CUZA 3HBLA 3OYAA 5DCFA 3VFZA 3S93A 3ZMDA 4CXFA 5DUKA 3ZXSA 5FLMJ 2M0MA 4M3FA 2F5CA 1IXCA 3S15J 4CCOA 3KZZA 2EK5A 1BN5A 3T0YA 1WJDA 2OUMA 5FROA 4CH7A 1PVEA 3BWGA 3QYEA 2DDAA 3BG6A 4D5FA 4A93J 3CCLI 1PUEE 2CSOA 2ICWG 1L3LA 1MSFC 3RI4A 2IXSA 4BHBA 2A05A 4NUBA 3L2UA 3BG5A 4BEHA 1IN4A 5EDNA 2R5ZA 4HLYA 1D3YA 4LK0F 1T95A 1UHSA 1U78A 4L9TA 1QBJA 2R7WA 3H3VK 2O0YA 1YX3A 4A3LJ 2M45A 4IRIA 2OU2A 4BH9A 2W7NA 1W7PD 4IOAF 2E2HJ 1NK2P 3ZR8X 2ISZA 4J01A 2BHYA 2R3SA 3H9QA 1Y1VJ 5BPIA 2KLOA 3OR2C 3WE3A 4BGDA 2ZMEA 3GEZA 1YJ9I 5TJJA 4YIIA 4N4NB 4MHGA 1NK3P 2E1MC 2FEZA 2RN7A 1FMWA 1FNNA 4HA8A 4MEXF 4FT8A 2O8XA 2EFNA 4XRMA 3PSIA 2X6XA 4A6DA 2GAUA 1T6SA 4KA4A 4HZFA 2VXDA 4UB8C 2HQAA 5D8KB 1IDYA 3G2BA 2FMYA 5M5YJ 1REPC 2XB0X 4HNUA 3R4KA 4XN3A 4RAYA 5LD2C 3PFIA 2JSPA 4KT5C 2KISA 2Y69H 1JTYA 2GWRA 3CDHA 4AYBN 4RB2C 1FIPA 1H8AC 1QVTA 2R4GA 4HQEA 2ELKA 2M2EA 2OZUA 1YOVB 1ENHA 2HDWA 2KJBA 1YG2A 2FBKA 3FHNA 3M07A 4KUMA 2DODA 1WH7A 2ME6A 2R7XA 5HVQC 4KIGA 4PGHA 2UZKA 3H0GJ 4OIPF 2Q2EA 5KVRA 2O3FA 4KYWA 3ABTA 2EFPA 3B6CA 1Z7LA 3ZQ7A 4MFDA 3QP5A 3U9GA 1Z0XA 1S29A 1MH3A 1I3QJ 2R7RA 1Z3XA 1WRJA 2MH9A 3S2DJ 1D5YA 3GZNB 1E2XA 1F5TA 4MFEA 3HOSA 2DJNA 1SD5A 1X4PA 1J7KA 2JVHA 3W6JB 3OYIA 3DV8A 2CUEA 3C2GA 4AC0A 4CYDA 2W85A 5J8CA 2IS4A 3KP2A 3DBRB 1YI2I 6PAXA 1VQ6I 1HW1A 4NC7A 1PYVA 5H6RA 2OQGA 2RV8A 1XGSA 5AONA 4IQJA 1ZG5A 5FFXA 2FF4A 5C44J 1FSEA 2JT1A 2QF7A 4D1QA 2HS5A 3DEEA 1JKOC 1FLIA 3BDDA 1KQ9A 1I5ZA 2E60A 1VI0A 1UJ8A 5HOOA 3W2VA 4BNCA 5F0CA 5TGTA 3BR2A 5CVJA 1DP7P 4AIKA 2R92J 3LOCA 2ZXHA 3RTRA 2A69F 4MIMA 4R8HA 2QEXI 2RVCA 2Z3YA 4FTHA 3OYNA 3VWBA 3D5RC 1X1DA 4ON0A 3OYCA 3K4MA 1RC9A 3F8NA 1ZK8A 3A4CA 4QPQA 3CCMI 2DMUA 5J40A 3E7LA 2CV1A 4O6JA 4HPQA 5K7ZA 3M9AA 1W0TA 1FYMA 2CV2A 3M1CA 3ZQCA 2R0QC 2HXIA 3QPTA 2K9MA 4HNVA 3IP4B 2GXAA 3PIOF 1YTYA 2HFHA 3AG1H 4XM3A 2NVYJ 4JX4A 2QSGX 1QZYA 1H0MA 4HX8A 2DQRA 2XF6A 5M5XJ 2XB5A 3PSFA 2KIUA 3CUOA 3HG9A 2L7FP 3G3ZA 4EJTA 2KRCA 3E3VA 2ZFWA 2XKPA 1SFXA 2RDPA 3OS2A 4IX7A 3ABMH 3HHHA 5FD5A 1ZGJA 1IZ1A 2XAHA 3Q3SA 4ENNA 1FEXA 2NS8A 1S7EA 4BHPA 5J1RA 2BHZA 4HRIA 3W2WA 4DYRA 5IYDJ 4D9JA 1K78A 1MD0A 1OYWA 3DBHB 4RM3A 3GVAA 2JRMA 3D0SA 1VNDA 3KEQA 3FXRA 3DKYA 3CZ6A 1O57A 1ETVA 3G1OA 1YIOA 5J1YA 4XKVA 2VOPA 1S6LA 3FK7A 3R6SA 3VYRB 2L9SA 3VB2A 4AWXB 1JJ8C 4IJAA 2XAUA 3WTSC 5CYVA 2L3DA 2JMWA 4JK1X 1ZH5A 1E3PA 1LDJA 3I71A 1JUSA 3DTKA 2DMPA 5DCMB 4XBFA 1IXRC 1ON1A 1Y1WJ 1LEBA 2O03A 1AWCA 3S3MA 3H9GA 3SDGA 1A6QA 3IUOA 1Y0NA 3QRFF 3K6GA 4KFCA 2G7HA 3OYMA 2F6CA 2LMDA 1LFBA 3WG9A 4HBLA 3JRCA 1AKHA 4F3QA 1DGWY 3V42A 1TC3C 2L54A 3B02A 4HDVA 2ZXJA 2YUSA 4CHUA 4R79A 2MGQA 2VASA 1WI9A 1JHFA 1XMXA 2LLKA 3FXLA 4A0ZA 5K7HA 4ZDOA 3TOAA 5DD4A 2PMHA 3MD2A 4OMYA 2BYVE 4GYGA 2CJJA 3D5LA 3ZMSA 1S7AA 2WA0A 3IV5A 2OBPA 1HF0A 4JQFA 2DA6A 4ZYEA 3LSRA 2GIVA 2Q1ZB 4UVCA 2JQ7A 2KZGA 3W2AA 4I0BA 5EF6A 2L4AA 1XTAA 4II3A 1YW8A 3HM5A 5FFZA 2KIFA 4CYCA 2M7AA 4O5VA 2LC2A 1MKMA 2DYRH 2MFZA 2DOFA 3DEWA 2OCCH 4FE7A 2H1LA 1EH8A 4HQMA 1BM9A 5HLGA 3RKQA 1SVOA 2JPCA 3V7SA 2GIZA 2CH0A 2FQ3A 1V5FA 4ZC3A 3RPQA 4IZZA 2PJPA 4I0AA 2A5YB 3NQOA 1VFCA 4BJ6C 2RAEA 4E7KA 1ZR4A 3JCUC 2VQCA 2E34A 1VQ4I 2XAJA 1TWAJ 5KHDA 5C3EJ 1ERDA 3CLQA 1ODDA 3EYIA 1TQMA 1TNTA 2WAQA 4DBQA 1MJAA 1R1UA 3EDPA 1ETXA 2XV4S 3CC2I 1R7JA 3LA2A 1N25A 2CV0A 3RKYA 3O8GA 3FMRA 4QIWN 2E7XA 4ZDPA 3CMEI 1KQ8A 4IQ4A 1XX5A 2RQPA 2V9VA 1OR7C 3V7CA 4ZJZA 3GX4X 5B1BH 2TRTA 3R0JA 1HQCA 3A2KA 2AHQA 4HNTA 3R61A 4BHCA 3N4MA 1RNLA 2UV1A 1W36C 3BQYA 1FT9A 4ESFA 1NG7A 1SC7A 2TCTA 3CDIA 3TO6A 2DLLA 2IGKA 5GPAA 2FRHA 2XROA 3VEPA 2LD5A 2ELHA 2XGCA 2YX7A 3RIRA 2PJRB 3LA3A 3OY9A 2OTLI 4G9YA 3EUKL 3W6VA 2R7VA 4U88A 1N77A 2E36A 2DW4A 2DK5A 2RKHA 5KAFC 2ZJQF 4D7MA 1O3SA 2VBZA 2JA8J 1J59A 1QZEA 4A0XA 5HLTA 2CFOA 2RC4A 2VPLA 2HWVA 3X2QH 4EQQA 4PJLA 2BBYA 3L7WA 5E20A 3BZKA 5L3CA 3P9KA 2BVLA 5J6XA 2STWA 3IRRA 3TOBA 5DM6F 2IP2A 3BTIA 4XN0A 2YU9J 2F5EA 3LSIA 1G3WA 4IPAA 2VBXA 2WB1A 4XICA 4II2A 1R1VA 3BJOA 1SFOJ 3HSRA 3IWZA 4M9ZA 4FQGA 1TNSA 1Y39A 3F23A 3JSPA 5DD8A 5M3FJ 4IHXA 3FDYA 3JRAA 3OR1C 3T8TA 5F0FA 1R5GA 3GMEA 3L2QA 4LGWA 1ETKA 9ANTA 2ELJA 3KLOA 1ETWA 2HKXA 2VT3A 2ME0A 3KPHA 3L1PA 1QQIA 2QBYB 2DO7A 4RGUA 2A6TA 1Y8QB 3GCMA 4HSTA 2HVQA 1FZPB 1DPRA 2L5QA 3AAFA 2M0CA 4PJNA 2VOOA 1V5EA 2EQRA 4UVBA 4XKWA 3G6EI 2XVCA 1FX7A 3LAPA 2ADUA 3VYTB 4OWRB 4YEJA 3QU3A 2EWNA 1J2XA 2IVMA 3O6BB 2V6EA 1MJBA 4KITB 3DQVC 2K9QA 3KP7A 1DU6A 1TBXA 2P8TA 4N9IA 3ECHA 5ICGA 5LFAA 3OMYA 1ZG1A 1HKTA 3WHBA 2DN0A 5E3MA 2DFIA 3JAMZ 2OV7A 5IOYA 4RMNA 3BTJA 2HVRA 3KYDB 1OISA 4U7BA 3JR9A 1MDMA 1ONVA 4PJJA 4RGSA 2R5YB 3EPZA 3CCVI 2CQNA 1IDZA 2LP0A 3BC8A 1U3EM 1S7OA 2QENA 2XIGA 3OIQA 3HEFA 1VQKI 2XUBA 3PUFA 4M9XA 3BJAA 4XLEA 4IXAA 3Q0UA 4EGYA 1BW5A 2IA1A 1P7IA 2XKOA 3JTHA 1K79A 1PJRA 3K4BA 1OFCX 3CC4I 1W5CC 4BS9A 4HV6A 1ZTRA 2V9PA 1GLNA 3T5XA 2E2JJ 3DEUA 3H5RA 2KMUA 1IN7A 1FOWA 4L9NA 4BQOA 3S17J 1IRZA 1B59A 3P7NA 1A04A 2ZJPF 2ZO4A 4IF4A 4FASD 1LFUP 4A0YA 2CU7A 2GXBA 1X2MA 1T33A 2R5YA 4CSWA 5IP7J 2PI0A 2JUGA 3HDDA 2VBYA 2HDCA 1D1BA 1LDDA 3F8FA 3HUGA 2XDVA 1ETQA 4B1RA 4A3BJ 1DGRM 5FKOA 3GUDA 1KGSA 4A5NA 2NNNA 1A6IA 1WJFA 1LUJB 2DOEA 2P5VA 3J80K 3NWTA 3R60A 4Y52J 3OWTA 3QYFA 3EETA 1NH3A 4DNCA 5F1RA 2QSFX 3ISPA 1TWGJ 4RDUA 2DI3A 2XGDA 2VQGA 3HKZN 3S1NJ 1NG6A 3JSOA 4GRIA 4OAYA 1SMTA 2BY1A 3DKXA 3K4KA 2RREA 3GTLJ 4MEYF 1G2HA 2MABA 2QZ8A 4A3IJ 2Z1DA 4BXUA 4DOZA 2ESNA 2VJJA 3G71I 3DKWA 3QPSA 4A2UA 3F3XA 2EV0A 3DCFA 2D2WA 2XPUA 3GW2A 3EYYA 2JJ7A 2OQRA 2BE5F 3OS0A 3LSTA 1IG7A 2PMZA 1XG1A 1JGGA 4IKFA 1SD6A 4XOPA 3WTWC 5LGUA 3WTZA 1S9HA 1R58A 3I59A 3DP7A 5CQEA 4Y15A 3AG3H 3K4CA 1WZ2A 1JI8A 1W7PA 3HPGA 4C3IJ 5B3SH 3JRGA 3KX2A 4XRSA 4L5JA 2M5WA 3AKZA 1TT0A 2GA1A 2Z5UA 4AM3A 5FLXK 2CO5A 5IT9K 3RQ4A 1BA5A 3KCCA 2NVTJ 2NS0A 4M3EA 1ZELA 1ZGAA 3GFJA 4DGWB 5EEAA 1GT0C 3MKZA 5FO5A 2CW8A 3WTTC 2W82A 1VQOI 3H3UA 1UB9A 1AKHB 3CMYA 3OOPA 5ILVA 3L2CA 4CYCB 3BPXA 1S8NA 4A3DJ 3HSEA 1Z91A 2JTVA 1BI0A 2O9LA 1HDPA 4ZH4F 3A01B 3MKYB 5B1AH 4WCGA 3OIOA 1RPWA 1U8RA 3J81K 4M3BA 3HRTA 3IAM2 3MCZA 4NDLA 2EV5A 3U1KA 1ZRDA 4AVZA 4MTDA 3CMAI 2FA5A 2ZCWA 5DEQA 2FJ1A 4TV7A 1T0FC 2RQQA 3PNYA 3SZPA 1DUXC 2FXAA 2E1NA 3ZQIA 1OCRH 1EA3A 1QA6A 3J7AY 2QBYA 4UNOA 1BIAA 2UWMA 2VE9A 5HODA 2IA0A 2EILH 4G6TB 4BJ5C 2HQ5A 1BR1A 1ETYA 4S04A 3RYRA 2HVSA 1FTZA 3L09A 2MBFA 5C4XJ 2W24A 3DPTA 4XLHA 5DUIA 2R7FA 2VJ4A 1W5TA 2E1MB 3S2WA 3DPLC 4L5EA 4RAFA 2AO9A 2DBBA 4WX9A 1U8BA 4G7ZF 4KT6A 3CCYA 2HXOA 2LVSA 5CLSA 5GAGJ 3MZHA 4Y13A 3CCRI 2K85A 1ORKA 5IP9J 3RKXA 5DDGA 2X1EA 1LKXA 4E7ZA 4RGXA 1ZHFA 1UCRA 3TKYA 1MBHA 1P7JA 4BKXA 1K7AA 1R23A 3FBNB 2WC2A 3K70D 5GADJ 2ZBKA 1Y8RB 3CF2A 3TW7A 4NC8A 1ITYA 1P6RA 4IHTA 2FD5A 1RRJA 3MN2A 1MDMB 1IRXA 1U9OA 4IL6C 2G7UA 1QVUA 3HOUJ 1STZA 3BTLA 1QPIA 3K1NA 4DYQA 5LBQA 4XRFA 2P4WA 1R22A 1D1AA 2H8WA 4BYYA 3MKWB 1HC8A 3F6VA 2R7DA 2HYFA 3BPVA 2H94A 2STTA 2IGOA 1OLTA 2KRHA 2L9RA 5GP9A 1W4MA 1W1WE 2OZ6A 1YITI 2QA4I 4BEHB 2P6TA 3I0TA 1H88C 1MSEC 3A03A 5CVRA 2OPTA 5D4SA 1T2KA 3PM1A 3MQ0A 1I1SA 3PIPF 2PN6A 2Y0SA 1J75A 1SFEA 3FM5A 2ID6A 4P1WA 2EPFA 3A1YA 1X1AA 3I9V2 3WTXC 2H1KA 2CQ7A 3HUGB 1R5HA 5DS9A 3CC7I 1TWFJ 1D5VA 1Y56A 1AOYA 3C2HA 1T98A 3V8KA 1XC5A 4KIFA 5E17F 3FMSA 2VB6A 4BBRJ 1D8KA 2VC0A 3HPHA 2Z2SB 4BE2A 4P9FA 1HW2A 3SYTA 4PJ0C 3CJQB 5FKMA 4G6QA 1B9MA 3IH3A 4KIBA 3CTAA 3OYLA 3ABUA 1YJNI 3SXYA 3NEUA 2ZC2A 4QSHA 5HS7A 4Z2YA 3EUAA 4G94A 2VC1A 2A07F 1I39A 1XS9A 3DLLF 4G12A 2AS5F 3ECOA 3FMQA 4F92B 3W3CA 4FCYA 1GXPA 2L01A 2M1BA 3P9IA 1EH6A 3E5QA 1PDNC 1S3JA 2K3PA 2WTEA 2XAGA 3MZYA 5ICFA 3WG7H 4BUPA 3K10A 2Y9ZA 3LSGA 4A3FJ 3M4OJ 2ISYA 2CUFA 3E5XA 1X19A 3Q0WA 2AXLA 3PUBA 1J9IA 1RKWA 2DTRA 1Z05A 1XCVA 4XKBA 3GTPJ 1D0XA 1FC3A 1SANA 5TISC 2YX4A 1KU7A 4E4HA 3S16J 2O5RA 2IS1A 3QP6A 1RETA 4UV8A 3VSLA 4B44A 4XLCA 4QTRA 2FUG2 4NQWA 5L3DA 1MBGA 4LFUA 2D5VA 2FX0A 1GVDA 1MBFA 1WWXA 2V6CA 1BC8C 3CUQA 2DU9A 4DZPA 4XSXF 2MA3A 1SMYF 3VYUB 4G7HF 3LA7A 2MLKA 2DYSH 1BR4A 2VPRA 2LG4A 3ZCOA 4FETA 4XL9A 1X1PA 3HOZJ 2XAQA 1R5ID 5F27A 4Z6YA 5LEKA 1G4DA 1PUFA 4DW6A 4GGGA 3CP8A 3DWLE 2ZJ2A 3HGGA 3RSNA 3OYEA 4ABZA 3GWZA 4H4KC 3KEYA 1VQNI 3R0AA 3FK6A 2XGEA 3FBIB 1GXQA 3OSGA 1SD4A 2VL8A 3ONQA 4YELA 2H27A 4L9VA 5ILUA 1MMAA 2FOWA 2E19A 1YJWI 4HOBA 1T38A 4JYKA 1M1EB 1VQMI 5BQTA 3KIOA 1U6GA 3ZQFA 3JRFA 2NOGA 2NVUB 3QWLA 2HQNA 1DDNA 1X1BA 5BPDA 4JX5A 3DLAA 2V1NA 4KN7X 2A6EF 4HDUA 1NTCA 2LY9A 1F43A 2NAZA 1B72B 2X6OA 3AL0C 3WU2C 2HU9A 1R71A 3J7AO 3J80Z 3OV8A 1YIJI 3SZGA 2EH3A 2BY2A 4P9UA 1FBSA 2FU4A 2KJCA 3WTYC 2LR8A 2A5WA 1HA8A 2GA2A 1BOAA 2KT0A 5BS6A 2VE8A 1B8IA 1X3ZB 4PFPA 3QODA 2K9LA 3CJTB 2LDUA 4W1UA 3TO9A 3D1NI 3GTKJ 2EA2A 1XSDA 4WK8F 2BEOA 1JUPA 3IH2A 3HXLA 1X1CA 1V55H 2KDZA 1RR8C 2M34A 3HYIA 3FZVA 3SZTA 5HDKA 1BI2A 3KP6A 1DP3A 2V1XA 1KYWA 4ANJA 4BL0B 1TW3A 4OU0A 2ZFUA 2KKOA 2GBYA 4LOCA 1FBQA 1TP4A 1YQAA 4A3JJ 1V3FA 4YFXF 4A12A 2N8GA 1Q1VA 4EJVA 4F93B 2VQHA 4LK1F 2XAFA 2EZIA 2LTPA 4MQVA 5LHIA 3DXJF 2HZTA 3DTIA 2WAFA 2EIMH 3HL2A 4LG0A 2GOXB 3ZN1A 3ZQQA 5LLQA 1IV6A 1JJ6C 3TP3A 1IAWA 5CQGA 2EIKH 2V1DA 3JRHA 2X1CA 1K6OA 2V1UA 1K83J 2XRNA 3GYHX 2EIJH 2F48A 4I76A 1LJ9A 3K2ZA 3RDIA 2WY8Q 1ZQ3P 2KIMA 1XCBA 3E97A 2LH9A 3S3OA 1WKMA 1BI1A 4X0GA 5E3OA 3VODA 1GDTA 2C6YA 2MC3A 5J4VA
chains in the Genus database with same CATH topology
3J7YJ 4IOCF 3PIPF 3CCLI 3CMAI 3CD6I 1FOWA 4IOAF 1VQ7I 2E36A 3I56I 1YJNI 2E34A 4IO9F 1VQ4I 2ZJQF 2OTLI 2E35A 3CCQI 1VQOI 3G6EI 3CCEI 3CCMI 1ACIA 5GAGJ 2ZJPF 3CCVI 3CCUI 1Y39A 2OTJI 3CCRI 3CF5F 1VQNI 2K3FA 2H8WA 3DLLF 1VQLI 1HC8A 1YJ9I 3G4SI 2NXNB 1VQ9I 1VQPI 1YIJI 3CCSI 1FOYA 1QA6A 3CC7I 1VQKI 1YJWI 2FOWA 2JQ7A 5GAHJ 5DM7F 3I55I 1S72I 5GADJ 3CC2I 3G71I 1YITI 5JVGF 4V19K 1VQ8I 1VQMI 4UY8I 1FOXA 2QA4I 5DM6F 3J7ZI 3PIOF 5GAEJ 1VQ5I 3CMEI 3CCJI 1YHQI 2QEXI 1YI2I 3CJTB 2ZJRF 3CC4I 1VQ6I 1MMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y J;  4IOC F;  3PIP F;  3CCL I;  3CMA I;  3CD6 I;  1FOW A;  4IOA F;  1VQ7 I;  2E36 A;  3I56 I;  1YJN I;  2E34 A;  4IO9 F;  1VQ4 I;  2ZJQ F;  2OTL I;  2E35 A;  3CCQ I;  1VQO I;  3G6E I;  3CCE I;  3CCM I;  1ACI A;  5GAG J;  2ZJP F;  3CCV I;  3CCU I;  1Y39 A;  2OTJ I;  3CCR I;  3CF5 F;  1VQN I;  2K3F A;  2H8W A;  3DLL F;  1VQL I;  1HC8 A;  1YJ9 I;  3G4S I;  2NXN B;  1VQ9 I;  1VQP I;  1YIJ I;  3CCS I;  1FOY A;  1QA6 A;  3CC7 I;  1VQK I;  1YJW I;  2FOW A;  2JQ7 A;  5GAH J;  5DM7 F;  3I55 I;  1S72 I;  5GAD J;  3CC2 I;  3G71 I;  1YIT I;  5JVG F;  4V19 K;  1VQ8 I;  1VQM I;  4UY8 I;  1FOX A;  2QA4 I;  5DM6 F;  3J7Z I;  3PIO F;  5GAE J;  1VQ5 I;  3CME I;  3CCJ I;  1YHQ I;  2QEX I;  1YI2 I;  3CJT B;  2ZJR F;  3CC4 I;  1VQ6 I;  1MMS A; 
#chains in the Genus database with same CATH topology
 2XC7 A;  1I6X A;  2VKD A;  2DCE A;  3QOE A;  3I56 I;  1UAA A;  2AQF A;  3QPH A;  5K5Q A;  5DCM A;  1OCC H;  2MG4 A;  5IY5 H;  1FBU A;  2WAE A;  1IJW C;  1G8X A;  4I6Z A;  3P9C A;  3JTG A;  1CQT A;  4CDG A;  2L9V A;  1OPC A;  3H5A A;  3IRQ A;  2DXI A;  5D6E A;  4B4C A;  2XSD C;  2K86 A;  3I64 A;  1I27 A;  1SD7 A;  1SEU A;  1P4X A;  1XSV A;  2I10 A;  1WSU A;  2YPR A;  3NRV A;  5E79 C;  2O6G E;  3BZC A;  1LE8 A;  2VBW A;  3TMO A;  3K7A J;  3B73 A;  4IVN A;  1SFU A;  5C4J J;  4EJW A;  1RUO A;  2HKO A;  3S32 A;  3F8B A;  1KU9 A;  4I98 B;  3RPU A;  5J8F A;  3QPL A;  1KYZ A;  2HPI A;  2E2I J;  4EM1 A;  3KZI C;  2K40 A;  4YG2 F;  4UHT A;  3K0L A;  4IHV A;  3SFZ A;  2COM A;  5F08 A;  2HPM A;  2HEO A;  1YW7 A;  2A3S A;  5IYB J;  4HAM A;  3CCJ I;  1MBE A;  3OL3 A;  2V26 A;  4E7H A;  3M8F A;  3I53 A;  2ID3 A;  3K4L A;  2R7S A;  4Y33 A;  4JP0 A;  3G1M A;  3E6C C;  4UV9 A;  2IBD A;  3BOQ A;  5KCM A;  3HTS B;  3CCU I;  1O7L A;  5BOX A;  3LMM A;  4L0Y B;  2W00 A;  3O2P E;  2DTZ A;  4UXN A;  2E5N A;  3FXO A;  4RAG A;  4A3K J;  2RNJ A;  1AU7 A;  2PFB A;  3HTU A;  5DM7 F;  4C2U A;  5CVU A;  1JE8 A;  4LB5 A;  1RES A;  1OJL A;  4FHT A;  1CGP A;  3ZGK A;  3LL7 A;  2WBM A;  2MD0 A;  5ERI A;  2BXY A;  2X6Y A;  3E0J B;  2D1H A;  3OOU A;  4GXO A;  3ZN0 A;  4DBR A;  1HST A;  2P7V B;  3FM3 A;  5HDG A;  4X1E A;  3RZO J;  5LGT A;  1FOY A;  4W97 A;  2FBI A;  5CJ9 A;  3UR3 C;  5DTD A;  4CCM A;  2JA5 J;  5JVT A;  3V4G A;  3CUQ C;  1S72 I;  4UY8 I;  2BV6 A;  2VLA A;  2LFB A;  3MKL A;  3E6M A;  4IRH A;  1R1T A;  3PJR A;  1MBJ A;  4E6K G;  2OCE A;  4RB3 C;  3OL4 A;  2JK3 A;  2Z16 A;  1IV8 A;  4KIC A;  3I4N J;  3IKT A;  1J5Y A;  5D8L B;  3PQJ A;  4LLG F;  4M73 A;  4UUV A;  2ZNY A;  3M1E A;  1MGT A;  5FKL A;  4Y3O A;  5IT3 A;  2VKH A;  2CG4 A;  3C2B A;  1HKS A;  2W57 A;  2EB7 A;  2ZSI B;  2X9D A;  4N9H A;  1YE9 A;  2KDO A;  3L2W A;  2HQR A;  3K9T A;  2M7B A;  5D5X B;  4G7O F;  3CO7 C;  4OIQ F;  2FML A;  1AA7 A;  2P5L C;  4C2T A;  3OYJ A;  4ZTF A;  2X4H A;  3JRI A;  3V7R A;  4GFB A;  5B5E C;  1ZN2 A;  4QPO A;  3ZP5 A;  3C1D A;  2DA1 A;  2LK2 A;  1ZAO A;  3HRU A;  3DFG A;  5E1X A;  3HJE A;  4EM2 A;  2Y48 A;  5H20 A;  2VN2 A;  5IT9 Z;  1BI3 A;  4EEF G;  2P6S A;  1MMN A;  1EV7 A;  4ESB A;  3WGH A;  1UG2 A;  3KP4 A;  2M3A A;  1QGP A;  1R4M B;  4XOR A;  4OOI A;  5LEJ A;  3JRE A;  3IC7 A;  1WHU A;  1X3W B;  1OKR A;  5EG0 A;  3I4P A;  4A6E A;  2ETH A;  2XF7 A;  5JFR A;  1FYK A;  3F9K A;  1L0O C;  3L2R A;  3I5U A;  1YFH A;  5ICC A;  5BMZ A;  1S5L C;  1V54 H;  2ZKZ A;  1IRG A;  3DTE A;  2R7O A;  2O7O A;  4MTE A;  1LPQ A;  2ESH A;  3QOP A;  1UMQ A;  2K3F A;  3HGY A;  3GBG A;  2WV1 A;  4U0W A;  4LLL A;  1MNM C;  4ENM A;  4IEJ A;  2KHM A;  2V9K A;  3FF5 A;  1D0Z A;  4DYC A;  1FP2 A;  2DJI A;  4MNU A;  4UUS B;  3I55 I;  5JVG F;  1D8J A;  2ZME B;  3I59 B;  4XMY A;  4I99 C;  3REO A;  4WWC A;  2QLZ A;  2XF5 A;  3KP3 A;  4CZZ A;  4BJT A;  1QPM A;  1SFK A;  1W0U A;  1IF1 A;  2R7U A;  3FXK A;  1XMA A;  2HZD A;  3Q0V A;  3VYS B;  1BIB A;  1O3Q A;  2K27 A;  2X1D A;  1RUN A;  2LKX A;  3FXU A;  1VQL I;  2EA4 A;  1TT5 B;  4NBQ A;  2V79 A;  3WTV C;  4A3G J;  5GTI C;  4GCV A;  1R6R A;  1U9N A;  2F4O B;  4HW0 A;  3GTQ J;  5E18 F;  4E7I A;  4RAZ A;  3LSJ A;  1SAU A;  3T1B A;  5KK1 A;  4CIC A;  1H89 C;  1V5G A;  1WGX A;  2E5Z A;  2VXZ A;  1B4A A;  2CQX A;  4PSX A;  3WGG A;  5F1J A;  1FP1 D;  5J3L A;  2M4G A;  4IOC F;  1MH4 A;  3WE2 A;  3AL0 B;  1POG A;  2ECC A;  2X0L A;  3K69 A;  2IS2 A;  1DQU A;  2QM3 A;  3MFK A;  2JA7 J;  2XSJ C;  2LBF B;  2JRT A;  5EGO B;  3IWF A;  4EVI A;  3GXO A;  1I50 J;  2K7L A;  1OQY A;  2M8E A;  3LFU A;  4AYB A;  2GLO A;  5IYC J;  1ZAR A;  2QKL B;  2JUC A;  4Q4Z F;  1PP7 U;  5E1Z B;  3I58 A;  5FGM A;  5F64 A;  2HYG D;  5LHG A;  1Z9C A;  3GTG J;  1VQ8 I;  1JGS A;  2OAZ A;  2X85 A;  3WU0 A;  4PUS A;  1SVM A;  5F04 A;  3MVP A;  2RNG A;  1FYL A;  5LRR A;  1ZRE A;  3ZPL A;  4NNJ A;  1R4N B;  3ZQH A;  1G59 A;  5EGO A;  1IGN A;  2MH2 A;  1Y6I A;  5L3E A;  3OYF A;  2QUF A;  4ZYG A;  1VTN C;  1XDU A;  5BNG A;  2E7W A;  3ZOB A;  5D5U B;  1F4K A;  1WJA A;  1R9T J;  2QQ9 A;  3ABL H;  3Q9S A;  1EF4 A;  4RGR A;  3HOW J;  1BOB A;  2Z99 A;  3HHG A;  1RR7 A;  3WGI A;  1OCO H;  3H1C A;  3NAU A;  3L2V A;  4PDK A;  1YRN B;  2RGV A;  1APL C;  2JN6 A;  4B09 A;  2MYS A;  2LRE A;  2CW0 F;  4YRV A;  1ZKG A;  1YS6 A;  5JLX A;  3DU6 A;  2LY1 A;  5JR3 A;  1YHQ I;  4D5C A;  1FPQ A;  3BG3 A;  5HDN A;  1MMG A;  5J1U A;  1UHM A;  4AUX A;  4BY1 J;  4ZYA A;  3BQZ A;  4S05 A;  3PO3 J;  2WB1 N;  2QKM B;  4PFO A;  4G8X A;  1VZ0 A;  4HF0 A;  3FXQ A;  3CCE I;  3E5U A;  2DAO A;  2IT0 A;  1ON2 A;  1P4A A;  3QAH A;  4LIT A;  3GZ5 A;  2NS7 A;  1XN7 A;  5LHH A;  2B63 J;  1TZL A;  4P55 A;  1NHA A;  1P4W A;  4XKC A;  1IW7 F;  2AXT C;  2EZH A;  2X6W A;  2HNH A;  5CVI A;  1W5S A;  4UVA A;  1DU0 A;  1U2W A;  4CO8 A;  1CF7 A;  2NRA C;  4QWQ A;  4FIS A;  1FJL A;  1JKP C;  2K4J A;  1I1G A;  1O3T A;  3CQZ J;  2OC6 A;  4L5I A;  2QSH X;  2G0E A;  3F21 A;  3G73 A;  1P9Q C;  2JVG A;  4JOM A;  5JHF A;  3DPU A;  3BR1 A;  3GO5 A;  4F52 A;  1MJ9 A;  3BZ6 A;  2CQK A;  3ZMZ A;  3PNT A;  3KP5 A;  2PX9 A;  3TL4 X;  2IRF G;  1VQ9 I;  3G4S I;  3BCA A;  3NWS A;  5JI6 A;  1JTX A;  4KDP A;  1N78 A;  2BXZ A;  4BQQ A;  3HOV J;  4ZYD A;  3FIW A;  4WXD A;  4CCN A;  2XPV A;  4M3G A;  4B43 A;  3G1L A;  2HOA A;  1FOX A;  2HDD A;  3TQN A;  2ZXI A;  4XK4 A;  1HDD C;  5A2Q K;  1DPU A;  1LFP A;  2DPU A;  3J7Y J;  5FRN A;  3GFL A;  1X58 A;  3TED A;  3VOE A;  5D5V B;  2R93 J;  3MAJ A;  3SHF A;  4HSR A;  2K9N A;  2W84 A;  2QQA A;  3M8J A;  3CUQ B;  4LIV A;  1UST A;  2L2O A;  4Q48 A;  4XQF A;  3ZMU A;  3ZRG A;  4XSZ F;  2NVX J;  4MO7 A;  1FIA A;  2VJI A;  1XGN A;  2A6H F;  2MD5 A;  2LYC A;  4GO1 A;  5DV5 A;  5GAH J;  1QHH D;  2Q8K A;  1HLV A;  2B7E A;  1U0J A;  1K6Y A;  3IH4 A;  2JSC A;  1Z1D A;  1IUF A;  4C9Y A;  3KFW X;  3KE2 A;  2G9W A;  1FOK A;  3GTO J;  1QHG A;  4ETS A;  1UEL B;  1Z7U A;  1W36 D;  1XGO A;  1LVK A;  4KMU X;  1WCM J;  4M6V A;  2XPW A;  2M8G X;  2YSR A;  2L9N A;  3CJR B;  5H2F C;  2KPM A;  5L3B A;  1J0R A;  1EJ9 A;  1E0E A;  1YLF A;  1ZGW A;  3F6O A;  1IN8 A;  2CS3 A;  5LGN A;  1R00 A;  2VKV A;  2VI6 A;  5HS9 A;  3FHZ A;  4FX4 A;  4ESJ A;  2W48 A;  2Y0M A;  4BDY A;  4BQN A;  4LD5 A;  1FMV A;  3TO7 A;  4KNY A;  1A36 A;  1D0Y A;  2JA2 A;  3WU1 B;  3B6A A;  4U87 A;  3WHC A;  2CUJ A;  1Z6R A;  4L18 B;  2CRG A;  2EJR A;  4HV5 A;  5F6F A;  3HOY J;  1U5T A;  5H6Q A;  4N0B A;  1UFM A;  5M5W J;  4WXC A;  2UXN A;  4R1H A;  4PJM A;  3RCO A;  3F8C A;  1VF9 A;  2ACJ A;  2CW7 A;  4I09 A;  2NOJ B;  4QLC U;  4EAT A;  2CQQ A;  4PCQ A;  2J5O A;  1QU3 A;  3TDU C;  1LNW A;  1B1B A;  1EKE A;  4IHY A;  4LIU A;  2FNP A;  3KYL A;  4HLX A;  2VJ5 A;  4Y7N J;  1FWZ A;  1KON A;  4DQ2 A;  1Z3Y A;  4BXF A;  4ZZL A;  2Z33 A;  3VDX A;  4E7J A;  1GHC A;  1T8I A;  1HW5 A;  4RM2 A;  3PQK A;  2VUM J;  1H9G A;  4E7S A;  1RI7 A;  2DOA A;  2B9S A;  3N05 A;  5DYM A;  2DA2 A;  2LKS A;  3K1M A;  2DPD A;  4EM0 B;  1X4O A;  1OCZ H;  3IHU A;  1TWC J;  2K02 A;  3K4N A;  4AIH A;  4ZZD A;  4A3M J;  2O61 A;  3BRO A;  1XDS A;  4BE0 A;  1BJA A;  2I5U A;  1G6N A;  4XLP F;  2IJL A;  3KET A;  4OMZ A;  1LVA A;  2HTJ A;  3AFH A;  3OYH A;  4ITV A;  5GTH C;  3S1M J;  5E3L A;  2F5D A;  3O3K A;  3QQA A;  3QYB A;  2DK8 A;  2BZT A;  3K2A A;  2LOO A;  1W7P B;  2Q0O A;  1O4X A;  2AQE A;  4P96 A;  1IUY A;  2R7Q A;  4I7H A;  2BOL A;  2TDX A;  2LF8 A;  4MGR A;  2M87 A;  3OYD A;  2VIX A;  2UUZ A;  2HOT A;  4GDF A;  3RZD J;  2R5Z B;  4YFN F;  5AIP A;  3MZ8 A;  1HBX G;  1O3R A;  1IO2 A;  1WI3 A;  1K4T A;  1LDK B;  2F2E A;  4RBO A;  1I3A A;  1X2N A;  3BCB A;  4CCJ A;  2ZSH B;  2FBH A;  2OD5 A;  3LQQ A;  1MW7 A;  2ZXW H;  3BJ6 A;  2V7F A;  4E7L A;  1YYV A;  3QU6 A;  3GTM J;  3ML6 A;  3NAR A;  5JLW A;  2BW3 A;  2WAQ N;  4M3D A;  1XPX A;  2NXN B;  2KL4 A;  3BG9 A;  4ZTJ A;  4AD9 A;  1ZRF A;  5HNH A;  3FXJ A;  3LAJ A;  2Y9Y A;  1BBY A;  1GV5 A;  1Z21 A;  4B3A A;  2XHK A;  2IPQ X;  2ZME C;  3A0H C;  4BU2 A;  4CUG A;  3WTU C;  3E1S A;  3K4J A;  4JBA A;  2K5C A;  3OIP A;  4DIQ A;  4RB1 A;  1MMD A;  2P7C B;  4OIN F;  3RQI A;  5F0H A;  3HRM A;  2DMQ A;  2MSY A;  4C3H J;  3GFI A;  3H0D A;  3SDB A;  1MBK A;  4A3C J;  2ZNZ A;  4EJO A;  4HF1 A;  1OR7 A;  5HLH A;  4LB6 B;  4HEA 2;  2HTS A;  2OA4 A;  3S1R J;  4OAZ A;  4BXX J;  3CP2 A;  2F4I A;  2QVO A;  2CWE A;  4XON A;  4Y4R A;  3SEZ A;  1RZ4 A;  2YU3 A;  4CCK A;  5KNL A;  4U0Y A;  1GVJ A;  1B6A A;  3VSK A;  5FD6 A;  3J7Z I;  3ZMV A;  4ZYH A;  3CO6 C;  1T0F A;  1VQ5 I;  4M6Y A;  5FKN A;  5FLX Z;  1YRN A;  2F5F A;  4UUS A;  3PNV A;  2HYJ A;  2D45 A;  3KLN A;  5ILS A;  4V2F A;  5FLV A;  1E17 A;  1WQ2 A;  3FXM A;  3DU5 A;  4A5M A;  4M72 A;  1IN6 A;  3C18 A;  1YX5 A;  3HIF A;  1TTY A;  2A68 F;  4ENK A;  5CPR B;  4LLN A;  3GTJ J;  2HOE A;  4NHJ A;  5K5R A;  1VQP I;  2DMN A;  3SQN A;  2PJR A;  2I8D A;  1FY7 A;  1K78 B;  1EH7 A;  4B48 A;  1BW6 A;  2IAI A;  3SEQ A;  3EQL F;  1ETO A;  3A0B C;  5A2Q Z;  2VOD A;  3V8J A;  2YS9 A;  1U5T B;  3U21 A;  2OF7 A;  1QNT A;  3BY6 A;  1F36 A;  2XRL A;  4PZJ A;  3ROU A;  4YIF A;  2B0L A;  3OYK A;  3JRD A;  1JUM A;  5EZG A;  2P5K A;  2EZK A;  4FE4 A;  4IHS A;  2YR2 A;  3OYB A;  1BJZ A;  4I02 A;  1P2F A;  2VON A;  1ULY A;  3BTC A;  2IS6 A;  1UZC A;  2FOK A;  2O8K A;  2Q2E B;  3H9J A;  3A02 A;  3I54 A;  1MIJ A;  4XLA A;  4IRG A;  5B66 C;  4HYE A;  2DFF A;  1P92 A;  3CES A;  4Q47 A;  2UXX A;  1SAX A;  4EMS A;  1Z67 A;  4UUT A;  5IP6 A;  5J47 A;  1A35 A;  3S14 J;  2CMP A;  2Y31 A;  3S3N A;  4RLF A;  2L7M P;  1AHD P;  1VQ7 I;  1CF7 B;  3F8M A;  5FB2 A;  1JKR C;  2DA7 A;  1Q1H A;  2L02 A;  4CCL A;  1LE8 B;  4MLO A;  2DA4 A;  1G3S A;  1K4S A;  1PP8 F;  2GZW A;  3H36 A;  4PGG A;  1R49 A;  5FKK A;  3L9F A;  4V19 K;  3CJN A;  3HZJ A;  1BR2 A;  5CVV A;  2DQL A;  5FRM A;  2H6C A;  4L0Z B;  1E3H A;  1WJ5 A;  3BG7 A;  3HC7 A;  1HCR A;  3U1D A;  4LJZ F;  1JT0 A;  2H09 A;  2PBI A;  2DT6 A;  2EZL A;  2QYO A;  3BR5 A;  3RKW A;  4A3E J;  4XLF A;  1MND A;  1O7F A;  1B9N A;  3LSH A;  3HB9 A;  4FX0 A;  1TW2 A;  2PEX A;  4PK4 A;  1ZYR F;  1IC8 A;  4XOT A;  4AID A;  2CYY A;  4AVP A;  3GF2 A;  1LQ1 A;  4JX6 A;  4F91 B;  4M9S A;  2NYX A;  5FJ8 J;  3ZQL A;  1GUU A;  2KFD A;  2XAS A;  3TDZ C;  2IEK A;  2DA5 A;  1WVR A;  2QQB A;  4CZC A;  2Y75 A;  2ECB A;  1Z6T A;  4BE1 A;  5ICE A;  4L9J A;  1D1C A;  3SFI A;  4A69 C;  1KU2 A;  4I01 A;  4P5O A;  5D6F A;  1OYI A;  3COA C;  4HX4 A;  2EIN H;  4EV0 A;  2W4S A;  2PG4 A;  4BAC A;  1SVL A;  2K4B A;  2V4J C;  4LG3 A;  5EZH A;  1ZLK A;  2LBF A;  3CDL A;  3F22 A;  1XGM A;  4AU7 A;  2MC4 A;  4C30 A;  1GV2 A;  1HXD A;  2PQ8 A;  2EFW A;  1MMS A;  1WFX A;  4H0E A;  2Z9O A;  3Q9V A;  4Y17 A;  2HOS A;  2EFO A;  3HKZ A;  3BT9 A;  3K70 C;  1XMK A;  3LSP A;  4MQ9 F;  5M3M J;  3ELK A;  2X48 A;  3ESW B;  4BAY A;  2KP6 A;  5D5W B;  3E6D A;  3LSK A;  1TL8 A;  4RA2 A;  3Q5F A;  1RKT A;  4XLN F;  4YFK F;  5EJC A;  4HF2 A;  1I6H J;  2QGU A;  4C2M J;  4RB0 A;  3GZ6 A;  3ULQ B;  3UNG C;  5JHU A;  4WF2 A;  4BY7 J;  4OIR F;  1XSX A;  2ZB9 A;  5GAE J;  1G3Y A;  1LEA A;  1U5T C;  1WJE A;  1QZZ A;  5K1Y A;  4YIR X;  1B72 A;  2W1O A;  1C0W A;  2PMZ N;  5CKT A;  5LRS A;  4G6D A;  4LMY A;  2OJE D;  3KEO A;  1MNE A;  2DFE A;  3AG2 H;  4K2E A;  3ERE D;  2R7T A;  4NC6 A;  4DZJ A;  4E70 A;  3CF5 F;  2GXG A;  3WOD F;  4J00 A;  1TQI A;  2MLG A;  3LFK A;  2WV0 A;  1UHW A;  4ASN A;  2FNA A;  5AIQ A;  1HOM A;  1BC7 C;  2DDB A;  3BR0 A;  1JT6 A;  2H6B A;  2JPB A;  3M7G A;  2LRD A;  3I4M J;  2WAD A;  5E1W A;  4S0H B;  4IHW A;  2VQL A;  1IN5 A;  1WJB A;  1BL0 A;  2W25 A;  5E8G A;  4XRS G;  2IGN A;  2MW8 A;  1YS7 A;  3M8E A;  5EEG A;  2KIQ A;  2X51 A;  2BGC A;  3JAM K;  2KZV A;  3ERM A;  2DT7 B;  4M6X A;  1TLH B;  3MMY B;  1ZRC A;  2IGM A;  2EFQ A;  1F9N A;  1ZLJ A;  3OS1 A;  4ENJ A;  4KN4 X;  3TP0 A;  3BLY A;  4EGZ A;  4PSW A;  4D7N A;  4RS8 A;  4HX7 A;  4HG2 A;  3C7J A;  1A5J A;  1Y0U A;  3PO2 J;  2BW3 B;  4NQW B;  1E3O C;  4Q5S F;  4N4O B;  2EV6 A;  1F1Z A;  2OTJ I;  1HKQ A;  4U0V A;  3L00 A;  4V2G A;  2R7Z J;  5HNF A;  2NVQ J;  3F0C A;  3HOX J;  2PLY A;  4CA0 A;  3JW4 A;  1N75 A;  3MEX A;  1UG0 A;  2E1C A;  1HSJ A;  1TQP A;  2L0K A;  3DF8 A;  1ACI A;  2M9H A;  5TRD A;  2DFH A;  2FE3 A;  2JA6 J;  2CFX A;  2KQR A;  1H9T A;  5E8I A;  1T56 A;  4KMF A;  5IPA A;  2JZY A;  3E6B A;  4J19 A;  3O8H A;  3LWF A;  4GYI A;  1V4R A;  2BY3 A;  1OYY A;  2Y30 A;  4B3X A;  4I2O A;  3BP8 A;  4M71 A;  2VKE A;  2VT2 A;  2BVM A;  3GFM A;  2KRF A;  3BR3 A;  3LSM A;  3TBI A;  5E3N A;  4OIO F;  1KQ0 A;  2DA3 A;  2WWY A;  4BQA A;  5D4R A;  2GOM A;  3SJM A;  3ASN H;  4F7Z A;  2H8R A;  2E71 A;  4DJA A;  4XID A;  3KYC B;  1IRF A;  1B8I B;  3CMM A;  3RYP A;  5HS8 A;  4X6A J;  4ZDL A;  3BR6 A;  2LKP A;  2QWW A;  2LNB A;  2QCO A;  4XNF A;  3ASO H;  5L3F A;  1K61 A;  2L7K A;  5L3G A;  1OMI A;  1R36 A;  2IW5 A;  3PFY A;  2FSW A;  1Z77 A;  2JWT A;  4XR6 A;  5EEH A;  2GQQ A;  2WY7 Q;  4BBS J;  1T39 A;  4C3J J;  2BY0 A;  4D0P A;  2A61 A;  3EUH A;  2L7Z A;  4CGZ A;  3FWE A;  4UB6 C;  3AG4 H;  3H92 A;  4NB5 A;  2E35 A;  1XB4 A;  3T8R A;  1OCP A;  3EUH C;  3V8L A;  1JHH A;  3TGN A;  3OSF A;  3RPU D;  3PL8 A;  1PUF B;  3IKV A;  3ABK H;  2LY2 A;  4O3M A;  3GLX A;  2LF7 A;  2NNY A;  3GLL A;  1MZB A;  4U7D A;  3IL2 A;  3DBL B;  4RLQ A;  1ZG3 A;  1USS A;  2FQ4 A;  3J81 Z;  3VPR A;  2K9S A;  2ZJR F;  1ZR2 A;  2Y0S N;  3H5N A;  3CD6 I;  1FSH A;  3W6K B;  4F55 A;  1WJC A;  4B47 A;  3CCQ I;  1OCT C;  1T08 B;  3P5J A;  2HR3 A;  2P81 A;  3C3W A;  3LQR A;  3A01 A;  2XGX A;  3UKG A;  3M3Y J;  1KU3 A;  3FX3 A;  3S8P A;  1IXS B;  3S2H J;  3CCS I;  3OYG A;  3RJP A;  3CLO A;  5J4Y A;  2J5P A;  3HRS A;  2M30 A;  4AIJ A;  2E1O A;  3JRB A;  2DMT A;  3I3L A;  1YO5 C;  3K1P A;  5GPC A;  2QQ8 A;  1QO0 D;  1A31 A;  5K5O A;  3H3Z A;  2GM4 A;  1JKQ C;  3H35 A;  2COB A;  2P0W A;  1XD7 A;  3U2R A;  4WXH A;  3F72 A;  4EJU A;  1JXS A;  1QRY A;  3HSF A;  4B8X A;  1J09 A;  3S1Q J;  2HGC A;  2HI3 A;  1WH5 A;  4M74 A;  2F5V A;  5K7F A;  2CGP A;  5KAI C;  2LSO A;  3ZQG A;  3KZY A;  1G3T A;  5EYR A;  1KA8 A;  3TW6 A;  1FTT A;  4BDZ A;  2IA2 A;  2D1V A;  1WPK A;  1YW9 A;  2L4M A;  3FKJ A;  5ED4 A;  4KIS A;  4LG0 B;  2DT5 A;  3MWM A;  2PMU A;  3N97 A;  3IAS 2;  5IOZ A;  1LB2 A;  1RIO H;  2Y2Z A;  3FIS A;  2F4M B;  3ZMT A;  3D5S C;  3LNQ A;  4IO9 F;  5HLI A;  4KJZ A;  2M4K A;  1KZH A;  5EG0 B;  3HOT A;  1TWH J;  2EBI A;  1X3U A;  3FKI J;  2CUZ A;  3HBL A;  3OYA A;  5DCF A;  3VFZ A;  3S93 A;  3ZMD A;  4CXF A;  5DUK A;  3ZXS A;  5FLM J;  2M0M A;  4M3F A;  2F5C A;  1IXC A;  3S15 J;  4CCO A;  3KZZ A;  2EK5 A;  1BN5 A;  3T0Y A;  1WJD A;  2OUM A;  5FRO A;  4CH7 A;  1PVE A;  3BWG A;  3QYE A;  2DDA A;  3BG6 A;  4D5F A;  4A93 J;  3CCL I;  1PUE E;  2CSO A;  2ICW G;  1L3L A;  1MSF C;  3RI4 A;  2IXS A;  4BHB A;  2A05 A;  4NUB A;  3L2U A;  3BG5 A;  4BEH A;  1IN4 A;  5EDN A;  2R5Z A;  4HLY A;  1D3Y A;  4LK0 F;  1T95 A;  1UHS A;  1U78 A;  4L9T A;  1QBJ A;  2R7W A;  3H3V K;  2O0Y A;  1YX3 A;  4A3L J;  2M45 A;  4IRI A;  2OU2 A;  4BH9 A;  2W7N A;  1W7P D;  4IOA F;  2E2H J;  1NK2 P;  3ZR8 X;  2ISZ A;  4J01 A;  2BHY A;  2R3S A;  3H9Q A;  1Y1V J;  5BPI A;  2KLO A;  3OR2 C;  3WE3 A;  4BGD A;  2ZME A;  3GEZ A;  1YJ9 I;  5TJJ A;  4YII A;  4N4N B;  4MHG A;  1NK3 P;  2E1M C;  2FEZ A;  2RN7 A;  1FMW A;  1FNN A;  4HA8 A;  4MEX F;  4FT8 A;  2O8X A;  2EFN A;  4XRM A;  3PSI A;  2X6X A;  4A6D A;  2GAU A;  1T6S A;  4KA4 A;  4HZF A;  2VXD A;  4UB8 C;  2HQA A;  5D8K B;  1IDY A;  3G2B A;  2FMY A;  5M5Y J;  1REP C;  2XB0 X;  4HNU A;  3R4K A;  4XN3 A;  4RAY A;  5LD2 C;  3PFI A;  2JSP A;  4KT5 C;  2KIS A;  2Y69 H;  1JTY A;  2GWR A;  3CDH A;  4AYB N;  4RB2 C;  1FIP A;  1H8A C;  1QVT A;  2R4G A;  4HQE A;  2ELK A;  2M2E A;  2OZU A;  1YOV B;  1ENH A;  2HDW A;  2KJB A;  1YG2 A;  2FBK A;  3FHN A;  3M07 A;  4KUM A;  2DOD A;  1WH7 A;  2ME6 A;  2R7X A;  5HVQ C;  4KIG A;  4PGH A;  2UZK A;  3H0G J;  4OIP F;  2Q2E A;  5KVR A;  2O3F A;  4KYW A;  3ABT A;  2EFP A;  3B6C A;  1Z7L A;  3ZQ7 A;  4MFD A;  3QP5 A;  3U9G A;  1Z0X A;  1S29 A;  1MH3 A;  1I3Q J;  2R7R A;  1Z3X A;  1WRJ A;  2MH9 A;  3S2D J;  1D5Y A;  3GZN B;  1E2X A;  1F5T A;  4MFE A;  3HOS A;  2DJN A;  1SD5 A;  1X4P A;  1J7K A;  2JVH A;  3W6J B;  3OYI A;  3DV8 A;  2CUE A;  3C2G A;  4AC0 A;  4CYD A;  2W85 A;  5J8C A;  2IS4 A;  3KP2 A;  3DBR B;  1YI2 I;  6PAX A;  1VQ6 I;  1HW1 A;  4NC7 A;  1PYV A;  5H6R A;  2OQG A;  2RV8 A;  1XGS A;  5AON A;  4IQJ A;  1ZG5 A;  5FFX A;  2FF4 A;  5C44 J;  1FSE A;  2JT1 A;  2QF7 A;  4D1Q A;  2HS5 A;  3DEE A;  1JKO C;  1FLI A;  3BDD A;  1KQ9 A;  1I5Z A;  2E60 A;  1VI0 A;  1UJ8 A;  5HOO A;  3W2V A;  4BNC A;  5F0C A;  5TGT A;  3BR2 A;  5CVJ A;  1DP7 P;  4AIK A;  2R92 J;  3LOC A;  2ZXH A;  3RTR A;  2A69 F;  4MIM A;  4R8H A;  2QEX I;  2RVC A;  2Z3Y A;  4FTH A;  3OYN A;  3VWB A;  3D5R C;  1X1D A;  4ON0 A;  3OYC A;  3K4M A;  1RC9 A;  3F8N A;  1ZK8 A;  3A4C A;  4QPQ A;  3CCM I;  2DMU A;  5J40 A;  3E7L A;  2CV1 A;  4O6J A;  4HPQ A;  5K7Z A;  3M9A A;  1W0T A;  1FYM A;  2CV2 A;  3M1C A;  3ZQC A;  2R0Q C;  2HXI A;  3QPT A;  2K9M A;  4HNV A;  3IP4 B;  2GXA A;  3PIO F;  1YTY A;  2HFH A;  3AG1 H;  4XM3 A;  2NVY J;  4JX4 A;  2QSG X;  1QZY A;  1H0M A;  4HX8 A;  2DQR A;  2XF6 A;  5M5X J;  2XB5 A;  3PSF A;  2KIU A;  3CUO A;  3HG9 A;  2L7F P;  3G3Z A;  4EJT A;  2KRC A;  3E3V A;  2ZFW A;  2XKP A;  1SFX A;  2RDP A;  3OS2 A;  4IX7 A;  3ABM H;  3HHH A;  5FD5 A;  1ZGJ A;  1IZ1 A;  2XAH A;  3Q3S A;  4ENN A;  1FEX A;  2NS8 A;  1S7E A;  4BHP A;  5J1R A;  2BHZ A;  4HRI A;  3W2W A;  4DYR A;  5IYD J;  4D9J A;  1K78 A;  1MD0 A;  1OYW A;  3DBH B;  4RM3 A;  3GVA A;  2JRM A;  3D0S A;  1VND A;  3KEQ A;  3FXR A;  3DKY A;  3CZ6 A;  1O57 A;  1ETV A;  3G1O A;  1YIO A;  5J1Y A;  4XKV A;  2VOP A;  1S6L A;  3FK7 A;  3R6S A;  3VYR B;  2L9S A;  3VB2 A;  4AWX B;  1JJ8 C;  4IJA A;  2XAU A;  3WTS C;  5CYV A;  2L3D A;  2JMW A;  4JK1 X;  1ZH5 A;  1E3P A;  1LDJ A;  3I71 A;  1JUS A;  3DTK A;  2DMP A;  5DCM B;  4XBF A;  1IXR C;  1ON1 A;  1Y1W J;  1LEB A;  2O03 A;  1AWC A;  3S3M A;  3H9G A;  3SDG A;  1A6Q A;  3IUO A;  1Y0N A;  3QRF F;  3K6G A;  4KFC A;  2G7H A;  3OYM A;  2F6C A;  2LMD A;  1LFB A;  3WG9 A;  4HBL A;  3JRC A;  1AKH A;  4F3Q A;  1DGW Y;  3V42 A;  1TC3 C;  2L54 A;  3B02 A;  4HDV A;  2ZXJ A;  2YUS A;  4CHU A;  4R79 A;  2MGQ A;  2VAS A;  1WI9 A;  1JHF A;  1XMX A;  2LLK A;  3FXL A;  4A0Z A;  5K7H A;  4ZDO A;  3TOA A;  5DD4 A;  2PMH A;  3MD2 A;  4OMY A;  2BYV E;  4GYG A;  2CJJ A;  3D5L A;  3ZMS A;  1S7A A;  2WA0 A;  3IV5 A;  2OBP A;  1HF0 A;  4JQF A;  2DA6 A;  4ZYE A;  3LSR A;  2GIV A;  2Q1Z B;  4UVC A;  2JQ7 A;  2KZG A;  3W2A A;  4I0B A;  5EF6 A;  2L4A A;  1XTA A;  4II3 A;  1YW8 A;  3HM5 A;  5FFZ A;  2KIF A;  4CYC A;  2M7A A;  4O5V A;  2LC2 A;  1MKM A;  2DYR H;  2MFZ A;  2DOF A;  3DEW A;  2OCC H;  4FE7 A;  2H1L A;  1EH8 A;  4HQM A;  1BM9 A;  5HLG A;  3RKQ A;  1SVO A;  2JPC A;  3V7S A;  2GIZ A;  2CH0 A;  2FQ3 A;  1V5F A;  4ZC3 A;  3RPQ A;  4IZZ A;  2PJP A;  4I0A A;  2A5Y B;  3NQO A;  1VFC A;  4BJ6 C;  2RAE A;  4E7K A;  1ZR4 A;  3JCU C;  2VQC A;  2E34 A;  1VQ4 I;  2XAJ A;  1TWA J;  5KHD A;  5C3E J;  1ERD A;  3CLQ A;  1ODD A;  3EYI A;  1TQM A;  1TNT A;  2WAQ A;  4DBQ A;  1MJA A;  1R1U A;  3EDP A;  1ETX A;  2XV4 S;  3CC2 I;  1R7J A;  3LA2 A;  1N25 A;  2CV0 A;  3RKY A;  3O8G A;  3FMR A;  4QIW N;  2E7X A;  4ZDP A;  3CME I;  1KQ8 A;  4IQ4 A;  1XX5 A;  2RQP A;  2V9V A;  1OR7 C;  3V7C A;  4ZJZ A;  3GX4 X;  5B1B H;  2TRT A;  3R0J A;  1HQC A;  3A2K A;  2AHQ A;  4HNT A;  3R61 A;  4BHC A;  3N4M A;  1RNL A;  2UV1 A;  1W36 C;  3BQY A;  1FT9 A;  4ESF A;  1NG7 A;  1SC7 A;  2TCT A;  3CDI A;  3TO6 A;  2DLL A;  2IGK A;  5GPA A;  2FRH A;  2XRO A;  3VEP A;  2LD5 A;  2ELH A;  2XGC A;  2YX7 A;  3RIR A;  2PJR B;  3LA3 A;  3OY9 A;  2OTL I;  4G9Y A;  3EUK L;  3W6V A;  2R7V A;  4U88 A;  1N77 A;  2E36 A;  2DW4 A;  2DK5 A;  2RKH A;  5KAF C;  2ZJQ F;  4D7M A;  1O3S A;  2VBZ A;  2JA8 J;  1J59 A;  1QZE A;  4A0X A;  5HLT A;  2CFO A;  2RC4 A;  2VPL A;  2HWV A;  3X2Q H;  4EQQ A;  4PJL A;  2BBY A;  3L7W A;  5E20 A;  3BZK A;  5L3C A;  3P9K A;  2BVL A;  5J6X A;  2STW A;  3IRR A;  3TOB A;  5DM6 F;  2IP2 A;  3BTI A;  4XN0 A;  2YU9 J;  2F5E A;  3LSI A;  1G3W A;  4IPA A;  2VBX A;  2WB1 A;  4XIC A;  4II2 A;  1R1V A;  3BJO A;  1SFO J;  3HSR A;  3IWZ A;  4M9Z A;  4FQG A;  1TNS A;  1Y39 A;  3F23 A;  3JSP A;  5DD8 A;  5M3F J;  4IHX A;  3FDY A;  3JRA A;  3OR1 C;  3T8T A;  5F0F A;  1R5G A;  3GME A;  3L2Q A;  4LGW A;  1ETK A;  9ANT A;  2ELJ A;  3KLO A;  1ETW A;  2HKX A;  2VT3 A;  2ME0 A;  3KPH A;  3L1P A;  1QQI A;  2QBY B;  2DO7 A;  4RGU A;  2A6T A;  1Y8Q B;  3GCM A;  4HST A;  2HVQ A;  1FZP B;  1DPR A;  2L5Q A;  3AAF A;  2M0C A;  4PJN A;  2VOO A;  1V5E A;  2EQR A;  4UVB A;  4XKW A;  3G6E I;  2XVC A;  1FX7 A;  3LAP A;  2ADU A;  3VYT B;  4OWR B;  4YEJ A;  3QU3 A;  2EWN A;  1J2X A;  2IVM A;  3O6B B;  2V6E A;  1MJB A;  4KIT B;  3DQV C;  2K9Q A;  3KP7 A;  1DU6 A;  1TBX A;  2P8T A;  4N9I A;  3ECH A;  5ICG A;  5LFA A;  3OMY A;  1ZG1 A;  1HKT A;  3WHB A;  2DN0 A;  5E3M A;  2DFI A;  3JAM Z;  2OV7 A;  5IOY A;  4RMN A;  3BTJ A;  2HVR A;  3KYD B;  1OIS A;  4U7B A;  3JR9 A;  1MDM A;  1ONV A;  4PJJ A;  4RGS A;  2R5Y B;  3EPZ A;  3CCV I;  2CQN A;  1IDZ A;  2LP0 A;  3BC8 A;  1U3E M;  1S7O A;  2QEN A;  2XIG A;  3OIQ A;  3HEF A;  1VQK I;  2XUB A;  3PUF A;  4M9X A;  3BJA A;  4XLE A;  4IXA A;  3Q0U A;  4EGY A;  1BW5 A;  2IA1 A;  1P7I A;  2XKO A;  3JTH A;  1K79 A;  1PJR A;  3K4B A;  1OFC X;  3CC4 I;  1W5C C;  4BS9 A;  4HV6 A;  1ZTR A;  2V9P A;  1GLN A;  3T5X A;  2E2J J;  3DEU A;  3H5R A;  2KMU A;  1IN7 A;  1FOW A;  4L9N A;  4BQO A;  3S17 J;  1IRZ A;  1B59 A;  3P7N A;  1A04 A;  2ZJP F;  2ZO4 A;  4IF4 A;  4FAS D;  1LFU P;  4A0Y A;  2CU7 A;  2GXB A;  1X2M A;  1T33 A;  2R5Y A;  4CSW A;  5IP7 J;  2PI0 A;  2JUG A;  3HDD A;  2VBY A;  2HDC A;  1D1B A;  1LDD A;  3F8F A;  3HUG A;  2XDV A;  1ETQ A;  4B1R A;  4A3B J;  1DGR M;  5FKO A;  3GUD A;  1KGS A;  4A5N A;  2NNN A;  1A6I A;  1WJF A;  1LUJ B;  2DOE A;  2P5V A;  3J80 K;  3NWT A;  3R60 A;  4Y52 J;  3OWT A;  3QYF A;  3EET A;  1NH3 A;  4DNC A;  5F1R A;  2QSF X;  3ISP A;  1TWG J;  4RDU A;  2DI3 A;  2XGD A;  2VQG A;  3HKZ N;  3S1N J;  1NG6 A;  3JSO A;  4GRI A;  4OAY A;  1SMT A;  2BY1 A;  3DKX A;  3K4K A;  2RRE A;  3GTL J;  4MEY F;  1G2H A;  2MAB A;  2QZ8 A;  4A3I J;  2Z1D A;  4BXU A;  4DOZ A;  2ESN A;  2VJJ A;  3G71 I;  3DKW A;  3QPS A;  4A2U A;  3F3X A;  2EV0 A;  3DCF A;  2D2W A;  2XPU A;  3GW2 A;  3EYY A;  2JJ7 A;  2OQR A;  2BE5 F;  3OS0 A;  3LST A;  1IG7 A;  2PMZ A;  1XG1 A;  1JGG A;  4IKF A;  1SD6 A;  4XOP A;  3WTW C;  5LGU A;  3WTZ A;  1S9H A;  1R58 A;  3I59 A;  3DP7 A;  5CQE A;  4Y15 A;  3AG3 H;  3K4C A;  1WZ2 A;  1JI8 A;  1W7P A;  3HPG A;  4C3I J;  5B3S H;  3JRG A;  3KX2 A;  4XRS A;  4L5J A;  2M5W A;  3AKZ A;  1TT0 A;  2GA1 A;  2Z5U A;  4AM3 A;  5FLX K;  2CO5 A;  5IT9 K;  3RQ4 A;  1BA5 A;  3KCC A;  2NVT J;  2NS0 A;  4M3E A;  1ZEL A;  1ZGA A;  3GFJ A;  4DGW B;  5EEA A;  1GT0 C;  3MKZ A;  5FO5 A;  2CW8 A;  3WTT C;  2W82 A;  1VQO I;  3H3U A;  1UB9 A;  1AKH B;  3CMY A;  3OOP A;  5ILV A;  3L2C A;  4CYC B;  3BPX A;  1S8N A;  4A3D J;  3HSE A;  1Z91 A;  2JTV A;  1BI0 A;  2O9L A;  1HDP A;  4ZH4 F;  3A01 B;  3MKY B;  5B1A H;  4WCG A;  3OIO A;  1RPW A;  1U8R A;  3J81 K;  4M3B A;  3HRT A;  3IAM 2;  3MCZ A;  4NDL A;  2EV5 A;  3U1K A;  1ZRD A;  4AVZ A;  4MTD A;  3CMA I;  2FA5 A;  2ZCW A;  5DEQ A;  2FJ1 A;  4TV7 A;  1T0F C;  2RQQ A;  3PNY A;  3SZP A;  1DUX C;  2FXA A;  2E1N A;  3ZQI A;  1OCR H;  1EA3 A;  1QA6 A;  3J7A Y;  2QBY A;  4UNO A;  1BIA A;  2UWM A;  2VE9 A;  5HOD A;  2IA0 A;  2EIL H;  4G6T B;  4BJ5 C;  2HQ5 A;  1BR1 A;  1ETY A;  4S04 A;  3RYR A;  2HVS A;  1FTZ A;  3L09 A;  2MBF A;  5C4X J;  2W24 A;  3DPT A;  4XLH A;  5DUI A;  2R7F A;  2VJ4 A;  1W5T A;  2E1M B;  3S2W A;  3DPL C;  4L5E A;  4RAF A;  2AO9 A;  2DBB A;  4WX9 A;  1U8B A;  4G7Z F;  4KT6 A;  3CCY A;  2HXO A;  2LVS A;  5CLS A;  5GAG J;  3MZH A;  4Y13 A;  3CCR I;  2K85 A;  1ORK A;  5IP9 J;  3RKX A;  5DDG A;  2X1E A;  1LKX A;  4E7Z A;  4RGX A;  1ZHF A;  1UCR A;  3TKY A;  1MBH A;  1P7J A;  4BKX A;  1K7A A;  1R23 A;  3FBN B;  2WC2 A;  3K70 D;  5GAD J;  2ZBK A;  1Y8R B;  3CF2 A;  3TW7 A;  4NC8 A;  1ITY A;  1P6R A;  4IHT A;  2FD5 A;  1RRJ A;  3MN2 A;  1MDM B;  1IRX A;  1U9O A;  4IL6 C;  2G7U A;  1QVU A;  3HOU J;  1STZ A;  3BTL A;  1QPI A;  3K1N A;  4DYQ A;  5LBQ A;  4XRF A;  2P4W A;  1R22 A;  1D1A A;  2H8W A;  4BYY A;  3MKW B;  1HC8 A;  3F6V A;  2R7D A;  2HYF A;  3BPV A;  2H94 A;  2STT A;  2IGO A;  1OLT A;  2KRH A;  2L9R A;  5GP9 A;  1W4M A;  1W1W E;  2OZ6 A;  1YIT I;  2QA4 I;  4BEH B;  2P6T A;  3I0T A;  1H88 C;  1MSE C;  3A03 A;  5CVR A;  2OPT A;  5D4S A;  1T2K A;  3PM1 A;  3MQ0 A;  1I1S A;  3PIP F;  2PN6 A;  2Y0S A;  1J75 A;  1SFE A;  3FM5 A;  2ID6 A;  4P1W A;  2EPF A;  3A1Y A;  1X1A A;  3I9V 2;  3WTX C;  2H1K A;  2CQ7 A;  3HUG B;  1R5H A;  5DS9 A;  3CC7 I;  1TWF J;  1D5V A;  1Y56 A;  1AOY A;  3C2H A;  1T98 A;  3V8K A;  1XC5 A;  4KIF A;  5E17 F;  3FMS A;  2VB6 A;  4BBR J;  1D8K A;  2VC0 A;  3HPH A;  2Z2S B;  4BE2 A;  4P9F A;  1HW2 A;  3SYT A;  4PJ0 C;  3CJQ B;  5FKM A;  4G6Q A;  1B9M A;  3IH3 A;  4KIB A;  3CTA A;  3OYL A;  3ABU A;  1YJN I;  3SXY A;  3NEU A;  2ZC2 A;  4QSH A;  5HS7 A;  4Z2Y A;  3EUA A;  4G94 A;  2VC1 A;  2A07 F;  1I39 A;  1XS9 A;  3DLL F;  4G12 A;  2AS5 F;  3ECO A;  3FMQ A;  4F92 B;  3W3C A;  4FCY A;  1GXP A;  2L01 A;  2M1B A;  3P9I A;  1EH6 A;  3E5Q A;  1PDN C;  1S3J A;  2K3P A;  2WTE A;  2XAG A;  3MZY A;  5ICF A;  3WG7 H;  4BUP A;  3K10 A;  2Y9Z A;  3LSG A;  4A3F J;  3M4O J;  2ISY A;  2CUF A;  3E5X A;  1X19 A;  3Q0W A;  2AXL A;  3PUB A;  1J9I A;  1RKW A;  2DTR A;  1Z05 A;  1XCV A;  4XKB A;  3GTP J;  1D0X A;  1FC3 A;  1SAN A;  5TIS C;  2YX4 A;  1KU7 A;  4E4H A;  3S16 J;  2O5R A;  2IS1 A;  3QP6 A;  1RET A;  4UV8 A;  3VSL A;  4B44 A;  4XLC A;  4QTR A;  2FUG 2;  4NQW A;  5L3D A;  1MBG A;  4LFU A;  2D5V A;  2FX0 A;  1GVD A;  1MBF A;  1WWX A;  2V6C A;  1BC8 C;  3CUQ A;  2DU9 A;  4DZP A;  4XSX F;  2MA3 A;  1SMY F;  3VYU B;  4G7H F;  3LA7 A;  2MLK A;  2DYS H;  1BR4 A;  2VPR A;  2LG4 A;  3ZCO A;  4FET A;  4XL9 A;  1X1P A;  3HOZ J;  2XAQ A;  1R5I D;  5F27 A;  4Z6Y A;  5LEK A;  1G4D A;  1PUF A;  4DW6 A;  4GGG A;  3CP8 A;  3DWL E;  2ZJ2 A;  3HGG A;  3RSN A;  3OYE A;  4ABZ A;  3GWZ A;  4H4K C;  3KEY A;  1VQN I;  3R0A A;  3FK6 A;  2XGE A;  3FBI B;  1GXQ A;  3OSG A;  1SD4 A;  2VL8 A;  3ONQ A;  4YEL A;  2H27 A;  4L9V A;  5ILU A;  1MMA A;  2FOW A;  2E19 A;  1YJW I;  4HOB A;  1T38 A;  4JYK A;  1M1E B;  1VQM I;  5BQT A;  3KIO A;  1U6G A;  3ZQF A;  3JRF A;  2NOG A;  2NVU B;  3QWL A;  2HQN A;  1DDN A;  1X1B A;  5BPD A;  4JX5 A;  3DLA A;  2V1N A;  4KN7 X;  2A6E F;  4HDU A;  1NTC A;  2LY9 A;  1F43 A;  2NAZ A;  1B72 B;  2X6O A;  3AL0 C;  3WU2 C;  2HU9 A;  1R71 A;  3J7A O;  3J80 Z;  3OV8 A;  1YIJ I;  3SZG A;  2EH3 A;  2BY2 A;  4P9U A;  1FBS A;  2FU4 A;  2KJC A;  3WTY C;  2LR8 A;  2A5W A;  1HA8 A;  2GA2 A;  1BOA A;  2KT0 A;  5BS6 A;  2VE8 A;  1B8I A;  1X3Z B;  4PFP A;  3QOD A;  2K9L A;  3CJT B;  2LDU A;  4W1U A;  3TO9 A;  3D1N I;  3GTK J;  2EA2 A;  1XSD A;  4WK8 F;  2BEO A;  1JUP A;  3IH2 A;  3HXL A;  1X1C A;  1V55 H;  2KDZ A;  1RR8 C;  2M34 A;  3HYI A;  3FZV A;  3SZT A;  5HDK A;  1BI2 A;  3KP6 A;  1DP3 A;  2V1X A;  1KYW A;  4ANJ A;  4BL0 B;  1TW3 A;  4OU0 A;  2ZFU A;  2KKO A;  2GBY A;  4LOC A;  1FBQ A;  1TP4 A;  1YQA A;  4A3J J;  1V3F A;  4YFX F;  4A12 A;  2N8G A;  1Q1V A;  4EJV A;  4F93 B;  2VQH A;  4LK1 F;  2XAF A;  2EZI A;  2LTP A;  4MQV A;  5LHI A;  3DXJ F;  2HZT A;  3DTI A;  2WAF A;  2EIM H;  3HL2 A;  4LG0 A;  2GOX B;  3ZN1 A;  3ZQQ A;  5LLQ A;  1IV6 A;  1JJ6 C;  3TP3 A;  1IAW A;  5CQG A;  2EIK H;  2V1D A;  3JRH A;  2X1C A;  1K6O A;  2V1U A;  1K83 J;  2XRN A;  3GYH X;  2EIJ H;  2F48 A;  4I76 A;  1LJ9 A;  3K2Z A;  3RDI A;  2WY8 Q;  1ZQ3 P;  2KIM A;  1XCB A;  3E97 A;  2LH9 A;  3S3O A;  1WKM A;  1BI1 A;  4X0G A;  5E3O A;  3VOD A;  1GDT A;  2C6Y A;  2MC3 A;  5J4V A; 
#chains in the Genus database with same CATH homology
 3J7Y J;  4IOC F;  3PIP F;  3CCL I;  3CMA I;  3CD6 I;  1FOW A;  4IOA F;  1VQ7 I;  2E36 A;  3I56 I;  1YJN I;  2E34 A;  4IO9 F;  1VQ4 I;  2ZJQ F;  2OTL I;  2E35 A;  3CCQ I;  1VQO I;  3G6E I;  3CCE I;  3CCM I;  1ACI A;  5GAG J;  2ZJP F;  3CCV I;  3CCU I;  1Y39 A;  2OTJ I;  3CCR I;  3CF5 F;  1VQN I;  2K3F A;  2H8W A;  3DLL F;  1VQL I;  1HC8 A;  1YJ9 I;  3G4S I;  2NXN B;  1VQ9 I;  1VQP I;  1YIJ I;  3CCS I;  1FOY A;  1QA6 A;  3CC7 I;  1VQK I;  1YJW I;  2FOW A;  2JQ7 A;  5GAH J;  5DM7 F;  3I55 I;  1S72 I;  5GAD J;  3CC2 I;  3G71 I;  1YIT I;  5JVG F;  4V19 K;  1VQ8 I;  1VQM I;  4UY8 I;  1FOX A;  2QA4 I;  5DM6 F;  3J7Z I;  3PIO F;  5GAE J;  1VQ5 I;  3CME I;  3CCJ I;  1YHQ I;  2QEX I;  1YI2 I;  3CJT B;  2ZJR F;  3CC4 I;  1VQ6 I;  1MMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...