1VQNI

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqnI00
2NXNB 3PIPF 1VQOI 3CCUI 1VQ4I 3G71I 4V19K 1VQ6I 3CMAI 4UY8I 2ZJPF 3CD6I 1VQ9I 1MMSA 2OTLI 5DM6F 2E34A 1FOWA 3I56I 1VQ5I 1Y39A 3CMEI 3CCJI 5DM7F 3CCMI 2K3FA 3DLLF 3CF5F 1FOXA 1YJNI 1VQKI 4IO9F 1HC8A 2H8WA 2ZJRF 1FOYA 2QEXI 3CCEI 4IOCF 2E35A 1YHQI 1YI2I 1S72I 3CCSI 5GADJ 1VQ7I 1ACIA 2FOWA 3CCRI 3G4SI 1YIJI 3G6EI 3CCLI 2JQ7A 2QA4I 1YITI 2ZJQF 5GAGJ 1YJ9I 1VQNI 2E36A 1VQMI 3CCQI 3I55I 1VQ8I 3CC7I 2OTJI 5GAEJ 3CJTB 3CC4I 4IOAF 5JVGF 1VQPI 3J7ZI 3CCVI 3CC2I 3PIOF 5GAHJ 1YJWI 1QA6A 3J7YJ 1VQLI
chains in the Genus database with same CATH superfamily
1Z7UA 5J3LA 3O8HA 2FF4A 3TGNA 2ZC2A 1LE8B 4NQWA 4I0AA 3GW2A 5D8KB 1BC7C 2ELJA 4E7IA 5CVUA 1TBXA 3PUBA 2IS1A 1AA7A 1XX5A 3BCBA 4ABZA 4C3IJ 3CJNA 1XGNA 1ZN2A 3H5RA 2V1XA 4M3BA 2CH0A 4HNVA 4HX4A 2DMPA 3LNQA 4NUBA 5DV5A 1GLNA 1FYLA 3FWEA 5D5UB 4BDYA 4XSXF 3I5UA 4HQMA 3CO6C 2LF8A 4IEJA 3RYRA 3D1NI 4ZDLA 1B9MA 3CDIA 5J1UA 2KIMA 1W36C 4BKXA 3RQIA 4HX7A 2OJED 2LREA 5D8LB 4BUPA 2XF7A 2Q8KA 1FP2A 1U2WA 1IRXA 3V7CA 2HOTA 3L2VA 1IN8A 1P7JA 2FU4A 3AG2H 1MSFC 1UCRA 5FLVA 4PGHA 2LF7A 4I76A 3IKTA 3GTMJ 1V54H 2RC4A 1J09A 5ICFA 3K70C 3KZZA 4ON0A 3FMRA 1MMNA 2WAQN 2RGVA 1SVOA 4B8XA 1H0MA 1R7JA 2LY2A 1Q1HA 2EIJH 2ZNYA 4DYRA 3C2GA 1GDTA 4QPOA 1TWHJ 5FKMA 2R7QA 3K7AJ 1QGPA 5E1WA 3HOTA 1TC3C 2F4OB 3OSGA 1XPXA 2HS5A 1SD6A 5IT9K 1LDJA 1KU3A 4I6ZA 2QSHX 4CCJA 1L0OC 2QKLB 2F5EA 4RB1A 1D5VA 2W7NA 4GXOA 4A3BJ 1BA5A 1ZYRF 2BEOA 3G1LA 2AQFA 3HG9A 4E7ZA 2PI0A 3P9KA 3CCUI 3CUQC 5TJJA 4E7LA 2LP0A 5D4SA 2CWEA 2WV1A 2KJCA 3GYHX 1ZREA 2CV2A 3BPXA 1BI1A 3L2UA 2H6CA 3K1MA 4FQGA 1R9TJ 4EM0B 1S7OA 2L4AA 2W82A 2YPRA 3ABLH 3WGIA 2R7VA 2HOSA 2JMWA 3QU6A 1R4MB 3KLNA 4HW0A 2OQRA 3JAMZ 4ENJA 5HS9A 4DQ2A 1F43A 3EDPA 4JBAA 4JQFA 2QENA 4YEJA 2M4GA 3JRBA 4ENNA 1Z3XA 3O8GA 1E3HA 3PO3J 3QP5A 3I53A 1D0XA 2L3DA 1R1TA 4EJWA 2R7FA 4U0YA 2K27A 1VQ7I 4M73A 1RI7A 2XRNA 3M07A 3OYNA 1PYVA 4CICA 1YJ9I 3GTQJ 2M34A 1A04A 4UNOA 3ABUA 1BR1A 2JZYA 2L4MA 1LQ1A 1V3FA 1VQOI 1YRNA 2ECCA 2HI3A 2K40A 3CD6I 2K85A 2JUGA 2VJJA 4XSZF 3E7LA 3E6MA 2IPQX 2Y30A 2E7WA 4YG2F 3OYLA 2D5VA 1HXDA 2H94A 5C44J 4EJOA 1PUFB 4UV9A 4ESBA 1TWGJ 3ABMH 4BHPA 3HYIA 2QUFA 3SHFA 3MKWB 2G7HA 2VC0A 2PQ8A 2IA2A 5H20A 5D5WB 4HF1A 3OIOA 5TISC 1CGPA 1J9IA 2G0EA 2I5UA 4XLHA 1BN5A 4RGSA 5EF6A 1ULYA 4RB0A 2OC6A 1ZR2A 2HVSA 3FKJA 1YFHA 2DK8A 2Z5UA 2V9VA 4AC0A 1B8IB 3QPLA 5DM7F 3CF5F 3DWLE 1F9NA 2VLAA 3WTSC 2HXIA 3DPTA 1MMDA 1X1AA 4G6DA 4DBQA 2FD5A 2VPRA 3JRCA 4FISA 4PSWA 4XLPF 4C3JJ 5JLXA 4L9JA 2DLLA 2F4IA 4CUGA 1SEUA 1G3WA 1MBFA 2W84A 1VQMI 3GFMA 2M0MA 4JYKA 3K1PA 2V79A 5M5YJ 4KFCA 5L3EA 5DEQA 3DBRB 2XKPA 1FLIA 4IRIA 4II3A 4PJMA 5JR3A 3IC7A 3Q9VA 4II2A 2DO7A 1XMAA 5M5XJ 2IVMA 3R60A 5GPAA 3MD2A 3VODA 3I64A 1FPQA 4EJTA 1I50J 4LK1F 1U5TC 2CUEA 4RGXA 4OIRF 1Y0UA 4AIJA 5D6EA 4NHJA 4BYYA 4RB2C 2EFNA 4LIUA 1YTYA 2M8EA 3EUHA 3WG7H 2VI6A 3HUGA 3HTUA 3J80K 2X9DA 3L2CA 3BR6A 4LJZF 2QZ8A 3HOVJ 5FKOA 1RKTA 3F0CA 1DU6A 4ZYDA 3I71A 2BW3A 2NAZA 2WAEA 1MJ9A 2OAZA 3ZXSA 5B1AH 3H0DA 2E7XA 3KZIC 2X6OA 1JJ8C 4LD5A 1O7LA 1RNLA 3RDIA 4KDPA 3ZMUA 5K5QA 2NOGA 2M9HA 3K4KA 3REOA 1JTXA 4EV0A 1UAAA 3V7RA 3OYFA 1ON2A 2WBMA 3I58A 1ZG1A 3FM3A 3WTXC 1TT0A 1JKQC 1NTCA 1YW8A 2E1OA 1FSEA 1X3WB 2J5PA 4GCVA 3S3OA 1LUJB 4HSTA 4UXNA 2NS0A 1ZH5A 2IP2A 2STTA 1ETOA 1K7AA 3UNGC 2M30A 4PJNA 4U0VA 2MD5A 1MSEC 5ILVA 1OFCX 1BBYA 3JW4A 2MYSA 2Q2EB 4IXAA 3GTOJ 4GYGA 1FBQA 5F04A 3PFIA 2RAEA 3BG6A 2HEOA 1UG2A 1HF0A 3DKWA 2O6GE 3F8MA 1D0YA 2FUG2 4WXHA 3S93A 5LGTA 2K3PA 3LFKA 2IA0A 3MMYB 3WG9A 3NAUA 4ZTJA 4A0YA 2ZJPF 4Y13A 2OTLI 3CP8A 1HKQA 4OAYA 2DI3A 1SFEA 1MDMA 3MKYB 1W7PD 2EBIA 3DTIA 4A3KJ 1F36A 2CQQA 3ONQA 5M5WJ 5K7HA 2WA0A 4KMUX 2ADUA 2YR2A 5FB2A 4CDGA 1ETVA 2KLOA 2KZGA 4Z6YA 2P5LC 1TQIA 2JA5J 4RGRA 3L2RA 3TW7A 3CC7I 2CMPA 4U7BA 4XKVA 3OYDA 2JPBA 3GFJA 4BXXJ 1WFXA 2W24A 3LSGA 1O4XA 3KCCA 4M3FA 3TP0A 2HTSA 5ICEA 1FTZA 4HA8A 2OUMA 3BPVA 5D5VB 1STZA 1P9QC 3IH2A 2R7SA 1U5TA 2MH2A 2V1UA 2A6HF 1FP1D 5J1YA 3SXYA 1WJBA 1FYMA 5F27A 2ETHA 3MEXA 4MTDA 1YIJI 1K78A 4EGZA 2XSJC 2NVYJ 1PVEA 2CU7A 1J0RA 1X1PA 1OCZH 1QBJA 3HOSA 1LPQA 6PAXA 1APLC 3CMMA 2Y9YA 1ZG5A 1GT0C 1O3SA 1HKTA 4JX5A 1KU9A 4OIOF 2HDDA 5EEGA 3E5UA 1UFMA 3I9V2 2EH3A 2P6SA 2BY2A 3E6DA 2CSOA 4KNYA 3CLOA 5KAIC 3S2HJ 3B73A 5FKKA 1FIAA 3DPUA 3MAJA 4B1RA 2QBYB 4F3QA 4ZC3A 1XGSA 1EH6A 2W1OA 3CLQA 3CQZJ 4ZZLA 1MBKA 1Y8RB 1P6RA 3TO6A 1R00A 3WGHA 4LG3A 3ROUA 2VJ5A 1R49A 1LB2A 4KN7X 3A1YA 4JX4A 3PNTA 3UKGA 1QNTA 3I3LA 2LTPA 3R6SA 3V7SA 3CCSI 1G2HA 1RUOA 4WWCA 3K4CA 3AG1H 1S29A 4P9UA 2QA4I 1HBXG 2GA2A 1P7IA 1FZPB 3FKIJ 3T0YA 2VONA 2DPUA 1ZQ3P 2R0QC 3KEYA 5DCMA 3CCVI 3W2WA 1TTYA 4YIIA 3CDLA 2JWTA 3LAPA 3F21A 2GAUA 2O0YA 2CGPA 2ME0A 1DUXC 4A93J 2CW8A 3DEUA 5H2FC 1HDDC 2EQRA 4AYBA 3HZJA 3F23A 1Z7LA 4AIHA 2QSFX 1S9HA 3RJPA 1B72B 1VQKI 4XLCA 5LBQA 3OSFA 1WWXA 3S2WA 4BE0A 2FMLA 4IRGA 1YI2I 1IDYA 2HXOA 4B4CA 2DA2A 4ZTFA 2RNGA 3TDZC 1YO5C 4Q47A 5K5OA 3KEQA 5IOZA 2E2HJ 3FHNA 1XDSA 2CYYA 2LBFA 5EEAA 2JSPA 2IS4A 2EV5A 2QQ9A 4XKWA 1JXSA 2DA3A 1X58A 2ZBKA 1QVUA 4LMYA 5HDNA 2CQ7A 2E34A 4PJ0C 1LFBA 1T0FA 1DP7P 1FMWA 4GYIA 3VPRA 1AU7A 4XLFA 1POGA 4MO7A 3V42A 2EB7A 5HS8A 1DU0A 3MZ8A 3CMYA 4UHTA 4D1QA 3GLLA 1F5TA 2P7CB 1H9GA 4U88A 2KDOA 3BJOA 2ME6A 3TEDA 1EH7A 1QQIA 1JKPC 2W25A 1IG7A 1FEXA 2VC1A 1LVKA 3U1KA 2LMDA 1DPRA 1G3TA 4KISA 3ECHA 5GPCA 1IW7F 5FGMA 5FD6A 3NWTA 2EFQA 4PK4A 2BY1A 3VYUB 3H5NA 3OV8A 3BY6A 4XORA 3FZVA 1MH3A 4HX8A 1ZLJA 2KRFA 2DA4A 4BL0B 4IPAA 2NNYA 1HC8A 4KIGA 4XLEA 4JK1X 4UB8C 3FXKA 3IP4B 2QSGX 2R5ZB 2WY7Q 4OU0A 1KQ0A 4XRSA 5EGOA 3CCLI 4AIKA 3F6OA 1MMSA 3ML6A 5FJ8J 1USTA 1FTTA 2QVOA 1WRJA 3SDGA 2LNBA 3E6BA 4Y4RA 4CCOA 2UXXA 1YX3A 4S0HB 1R5GA 5F1JA 1OCTC 3NARA 4RM2A 4N0BA 1AWCA 3SFIA 5ERIA 1OCOH 3BR1A 1H9TA 1YQAA 2EA4A 1BOBA 5FROA 3GTPJ 2FA5A 3OS0A 2BHZA 2LFBA 2KIQA 3WHBA 5GAGJ 1YW9A 1A36A 3NRVA 4L0YB 3J7ZI 2CRGA 2EIMH 4NDLA 1WJCA 3ISPA 3TMOA 1X2MA 4L9VA 4WXCA 2K02A 4XOPA 3AAFA 2P7VB 2VODA 3WTZA 4WF2A 3H35A 1W1WE 2EIKH 4M9SA 3L00A 4M6VA 3PQKA 1W5TA 2DA5A 4IHVA 4S04A 4E4HA 3WU1B 4XNFA 3JR9A 1PJRA 4CZCA 3V8LA 4AVPA 1MDMB 3CCYA 2HYJA 5GAHJ 4F91B 3LQQA 3A01B 1HW2A 1W7PB 3IAM2 2KQRA 1VI0A 2HKOA 3COAC 2HNHA 4RAFA 4GGGA 2XGCA 2XASA 1IJWC 1BJZA 1LFPA 3WODF 2OCCH 3I4PA 4YELA 5CYVA 1YRNB 1FOKA 3HSEA 3QWLA 3OR1C 5LGUA 1YJNI 2X0LA 1D1CA 4R79A 4IHTA 4CCNA 1IUYA 3KEOA 4G9YA 3BR3A 3LQRA 5FKLA 2RV8A 3J7AO 2CUJA 3WHCA 3S1MJ 4HSRA 2DAOA 3ZQHA 3QODA 5LHHA 3V8JA 4IJAA 3FMQA 2FX0A 2F5DA 3OL3A 4IHSA 2QM3A 2XAGA 1MJBA 1XN7A 3B6CA 3CTAA 1IC8A 3W2AA 5B5EC 4DBRA 1NK2P 1JT0A 3DBHB 4BBSJ 3FK7A 4U87A 1BI2A 4M9XA 3DLLF 3GVAA 5IPAA 4C9YA 5AONA 1TP4A 3O6BB 4J00A 1IZ1A 4EEFG 3FISA 3PUFA 2Z33A 2K4BA 2X6WA 1E3PA 1ETWA 3F72A 2YU9J 2LG4A 2VKVA 3RKQA 4IQ4A 3DEWA 3RI4A 4UVBA 1ERDA 1JHHA 2A68F 4RLQA 4AIDA 2V9KA 1OLTA 1T0FC 1U8BA 2BHYA 5JHUA 1IRGA 2KL4A 2WV0A 5AIQA 4I2OA 3CCJI 1JUMA 4EJUA 2FJ1A 2XB0X 5L3GA 4Y15A 3HHGA 3H36A 3KETA 5B3SH 3HSFA 3DF8A 3OYKA 3LSIA 2AXTC 2BBYA 2GOMA 2FQ3A 3BJ6A 3H1CA 3QPTA 3W6KB 1E3OC 4U7DA 1T38A 1Q1VA 3CC4I 2PJPA 2HQNA 2DYSH 2O03A 3P7NA 3DQVC 4A3EJ 2NXNB 3GZNB 2ACJA 2PMZN 2DMQA 1RPWA 1S7AA 3U1DA 2NVXJ 1T56A 3IRQA 4LB6B 4HAMA 2ZXJA 3H9JA 5DM6F 2XAHA 2HQRA 4BY7J 4AUXA 3HOZJ 2IS6A 2OZ6A 3ZMVA 1Z0XA 2K3FA 1UHMA 2QQAA 5LLQA 4XN0A 3N05A 4XN3A 1ZG3A 3HPGA 3C18A 3A0BC 3BTCA 3A03A 5GADJ 4XQFA 1V4RA 3HOWJ 4BU2A 3MKLA 3WTWC 2DOEA 2XF5A 4XMYA 2HYFA 4I02A 4IQJA 1XCBA 1BW5A 4QLCU 1TLHB 4M6XA 2XF6A 4PSXA 9ANTA 2M7BA 5LFAA 1FOWA 1Z6RA 1W0TA 3RTRA 1CF7B 1HSJA 3JRFA 4EM1A 1WZ2A 3E3VA 3BC8A 1QRYA 4UV8A 2HVRA 4IKFA 2LKXA 2H1KA 4BS9A 2Y2ZA 1TNTA 3K1NA 1ORKA 4ZDOA 1N78A 2VASA 1T95A 5F6FA 3ULQB 3F8NA 1WJFA 3CC2I 3KP5A 2MH9A 2EZHA 2Z2SB 4D5CA 4A3FJ 2VQHA 5TRDA 1RESA 2W48A 3G71I 2E19A 5E3LA 2VXDA 2VJIA 4RA2A 4H0EA 5JFRA 2YS9A 2R3SA 2CW0F 2V6CA 2TCTA 3IWFA 2H8WA 4CYCA 5A2QZ 1HCRA 1X3UA 3JSPA 1BW6A 2GWRA 3UR3C 1NHAA 2ZJQF 2D1HA 2LK2A 3HC7A 2ELKA 5E1ZB 2Y31A 1D1AA 2HVQA 5IYDJ 1GV2A 2L0KA 2A05A 3BWGA 2FBKA 2ZXHA 2KFDA 3MCZA 1MBEA 2VXZA 1W5CC 2O3FA 3JRGA 4UB6C 4M3EA 5GP9A 4P96A 1ZAOA 3CJQB 1LVAA 3DLAA 3ZQQA 1S5LC 1KQ9A 4ZYHA 2ZKZA 2LOOA 2D45A 4Y3OA 1DPUA 4CCLA 3JREA 4A2UA 1ZARA 1H8AC 1K6YA 2VKHA 3OYMA 4KITB 4HLXA 3JRDA 2PBIA 3J81Z 2M1BA 1JUPA 1YIOA 2EZLA 3D5RC 2CFXA 1G59A 1WPKA 5C3EJ 5C4XJ 4MLOA 1TL8A 1QZYA 4Y52J 4Y17A 4D7NA 2O7OA 1EKEA 3DCFA 2GQQA 2RVCA 1MNDA 4HG2A 1XG1A 4LFUA 3W3CA 2K5CA 2Y9ZA 3T5XA 1B9NA 5EDNA 4BH9A 1A5JA 2R5YA 1EF4A 4AD9A 2LH9A 5J1RA 1SMYF 2EFPA 1QVTA 3S16J 2X1CA 3O3KA 1TW2A 2WWYA 2UZKA 2M4KA 5KHDA 3PSFA 4MEYF 1JKOC 5JVGF 1OQYA 4V2FA 2V1DA 1R23A 1P4XA 3CF2A 5KVRA 2R5ZA 3E0JB 2VIXA 1Z05A 3FXLA 2AHQA 4MFEA 2X6XA 2KDZA 3BR2A 3WE2A 5BQTA 3L2WA 2BY3A 1U78A 5LRRA 2NVTJ 1HW1A 4ZYAA 4G7HF 1U5TB 2F4MB 3K4JA 3GLXA 3D0SA 1K4TA 4OAZA 1V55H 3M8FA 2XHKA 4MFDA 2YU3A 2DTZA 1YE9A 3OYEA 1HKSA 2IGOA 4F52A 2DQRA 2PX9A 4Q4ZF 1CF7A 2JA7J 5JI6A 1DQUA 1D3YA 3AKZA 1ETKA 4EMSA 4A3CJ 4BBRJ 5HLTA 2DMUA 2R7RA 1FSHA 4WK8F 3B02A 3ESWB 3JTGA 1Y39A 2E5ZA 2XGXA 5E3MA 3CCMI 1BC8C 4BQAA 3S2DJ 3OL4A 1OISA 1ZHFA 3F8CA 4HNTA 1S72I 2V9PA 3DPLC 5J47A 2HOAA 2TDXA 5H6RA 2O61A 1IN4A 2DMNA 2F5VA 5FRNA 4ZH4F 3M8EA 2RN7A 3I59B 2VT2A 1G4DA 2VBXA 3OOUA 3KPHA 4M9ZA 1QA6A 2COMA 4ZYEA 5BPIA 2K9LA 1KGSA 2QBYA 5H6QA 1C0WA 1J7KA 2IA1A 2R7OA 3LAJA 1X1CA 2Y0MA 2Y75A 3JCUC 1E0EA 2ESHA 5HLIA 1IN6A 4KMFA 2MW8A 3CCEI 1MGTA 4PDKA 2MC3A 1BR4A 1XB4A 4E7JA 1G3SA 2L54A 3F8FA 1JE8A 2PJRB 2VUMJ 3PNYA 1JHFA 4FX4A 5GAEJ 3CJTB 5HDGA 3FMSA 2E1NA 4JP0A 2V7FA 4LB5A 4C3HJ 1YW7A 3M9AA 4MNUA 1NK3P 1VQ6I 2KZVA 5IOYA 4KT6A 3JRAA 3M4OJ 2KHMA 4HRIA 4DZJA 1T33A 3ZQGA 1LNWA 2JVHA 1IXSB 1MBJA 2NNNA 3FM5A 3IKVA 5FRMA 1QPIA 2YX7A 4BJ5C 5DTDA 1KQ8A 4XRFA 4B44A 4X6AJ 5ILUA 2DOAA 4HZFA 4KJZA 1XMKA 4M3DA 4WXDA 4R1HA 1N75A 3LFUA 3TQNA 4DYCA 3WE3A 2L9NA 4NQWB 5DCFA 1KU2A 2F5CA 2RQQA 5L3FA 3OS1A 4BHBA 2GLOA 2KRHA 3S3NA 4XBFA 3VB2A 5J4VA 5E3NA 1V5EA 2JPCA 5EG0A 2C6YA 3H3UA 4Z2YA 2EJRA 2GM4A 2PMZA 1FOXA 2MABA 1O3TA 1X19A 1D8KA 1ZGWA 1EV7A 1OR7A 5FO5A 1YHQI 3SZPA 3ZN1A 5J8CA 2DOFA 1TQMA 3ZMDA 2JA6J 4BEHA 5CLSA 1ZTRA 4A5NA 2P5KA 4V2GA 1ZRFA 3CUQB 2HZTA 2HZDA 2YSRA 2HWVA 3ASNH 3BTLA 2B63J 1OCCH 1H88C 4P1WA 1AHDP 2JSCA 4GFBA 1BIBA 1D5YA 3A4CA 4AYBN 4UVCA 2Z3YA 3A0HC 2QGUA 2ZJ2A 3HKZA 3EUKL 1CQTA 3ZRGA 4L18B 2BGCA 3PSIA 1E17A 2F6CA 4M6YA 3GEZA 2FMYA 3DV8A 1Y56A 2UUZA 2KJBA 1DGWY 1TWCJ 3KE2A 1LDDA 1AOYA 2XIGA 2DJNA 3B6AA 1IO2A 5EEHA 1LKXA 1S3JA 4LITA 2E1CA 3R0JA 4MQ9F 2X48A 2FOKA 5L3DA 5CVIA 1XMXA 5GTIC 1EJ9A 4KIBA 3G3ZA 2BVMA 4NBQA 4XOTA 1WH7A 3HRSA 2E36A 3WU0A 2LBFB 3OS2A 3F3XA 3IH3A 3BG3A 1PUEE 1U3EM 2WAFA 3KYCB 2KIFA 2OQGA 2RDPA 2O9LA 2CUFA 1UJ8A 2DCEA 3F22A 3IH4A 3S32A 5D4RA 1B1BA 1OYIA 1ETQA 2P81A 2WB1A 1B72A 5IT9Z 3DBLB 2UXNA 5LD2C 1TT5B 2KP6A 4RDUA 2R7UA 2QWWA 3SJMA 2XPUA 2RNJA 2GBYA 4XONA 3KLOA 2M2EA 2LY9A 3M1EA 4YRVA 3KFWX 5KAFC 2G7UA 3PQJA 3RPQA 3ZMZA 4DOZA 1WVRA 1FMVA 3AL0B 1A31A 3IL2A 2VT3A 3RSNA 2EV6A 2L02A 5HS7A 4E7HA 2L9VA 4YIFA 4DW6A 4E6KG 4A3GJ 4EM2A 1A6QA 2K7LA 3DTKA 2MLKA 4KYWA 3AFHA 2CO5A 2AS5F 2CV1A 1QHHD 4ASNA 4C2MJ 1HW5A 1SVLA 3GWZA 1MMGA 3C2BA 3EUAA 1XDUA 1XCVA 2VBYA 3QQAA 2Z16A 1B8IA 3MVPA 2ZFUA 3DU5A 1FWZA 4BNCA 1MMAA 3L09A 3CO7C 4CA0A 2XROA 2NS8A 1T6SA 1JT6A 1SFUA 5EZGA 1ZGJA 2RQPA 3QPSA 1F4KA 4F55A 3W2VA 4NB5A 2HQAA 1ZK8A 1P2FA 3HL2A 1U8RA 2JK3A 2WC2A 3WTUC 3OY9A 2FBHA 2BXZA 3PM1A 1TNSA 3HIFA 3BTJA 2FRHA 1RETA 1W5SA 1PUFA 2W4SA 3WGGA 4QTRA 3SFZA 5J6XA 1R58A 3JTHA 2HGCA 3P9IA 1FT9A 4BXFA 1WGXA 2R4GA 5IY5H 1VQ8I 2A61A 3CZ6A 5FLXK 4UUSB 2D1VA 1YJWI 2DA1A 2HPMA 3A2KA 5HDKA 4JOMA 4E70A 2JJ7A 2DPDA 4HNUA 2XV4S 4WX9A 4RLFA 4IL6C 5KK1A 3JSOA 1K79A 1FJLA 2EINH 2UV1A 2GXBA 2VOOA 3H0GJ 4OIPF 2HR3A 2IJLA 4BQQA 3VFZA 2GZWA 4ANJA 4WCGA 4GRIA 2VOPA 3FIWA 4RS8A 3JRHA 2M7AA 3S3MA 3QAHA 5A2QK 3ZGKA 2ZO4A 1X4OA 4EQQA 2CW7A 2ZMEB 2DFEA 5ED4A 1FY7A 2P8TA 1SD4A 1UMQA 1J59A 3I0TA 1Y8QB 3HRTA 5DD4A 2M87A 3PIPF 1I39A 1TQPA 1K61A 1P4AA 1A35A 2Z99A 3Q9SA 4BQNA 3FBNB 2R7ZJ 5FFXA 2COBA 2V1NA 4RM3A 4LIVA 2DDAA 2DFIA 4RMNA 1Z91A 5JHFA 2PN6A 1J5YA 2HTJA 4IHYA 2K9NA 1X1DA 1R36A 3FXJA 4R8HA 3MN2A 3JAMK 3BTIA 3X2QH 4OMYA 2Y69H 2MC4A 3DTEA 4MQVA 4EVIA 3K2AA 3VYSB 1HQCA 3J7YJ 3ZQ7A 1FC3A 4HF0A 1I3QJ 2ID6A 3M3YJ 3IAS2 3KP3A 5J8FA 3ABKH 3NWSA 5K5RA 3QRFF 2R5YB 2N8GA 2FQ4A 3LWFA 3GMEA 3T1BA 1R1VA 3E6CC 2XC7A 5EZHA 5EGOB 2JUCA 4F93B 4HBLA 3V4GA 1U9NA 3K4LA 3C2HA 4IOAF 1I3AA 1VQPI 2TRTA 3ZP5A 3CDHA 3HB9A 2A3SA 2VKEA 3OYJA 1R5HA 3RPUA 3Q3SA 1JUSA 2CJJA 3HSRA 3OYAA 2IAIA 5M3FJ 3BOQA 1T2KA 5LEJA 4OMZA 2CQKA 5FKNA 3TL4X 3LOCA 1B4AA 3ZQIA 4L5EA 4RAGA 2HDCA 2KISA 1OYWA 3BP8A 1Z9CA 2NYXA 3LSRA 1BL0A 1QO0D 4IHWA 2VKDA 3CCRI 3G4SI 3BG7A 4HPQA 1WSUA 3E5XA 3OIQA 1WHUA 4OOIA 2WADA 4ZDPA 1GXPA 2FXAA 3H3ZA 4FETA 2CUZA 4LG0B 1ENHA 3KP6A 4OWRB 5FLXZ 4P5OA 2DU9A 4A3IJ 2EZIA 4I09A 3VSLA 5IP9J 2ESNA 2KKOA 2KT0A 4YFNF 4HDVA 1GV5A 2Z1DA 3Q5FA 1FOYA 4W1UA 4D7MA 3HKZN 2QYOA 4FTHA 2Z9OA 4B09A 4PZJA 3ECOA 1OJLA 3TKYA 1YITI 2EILH 3LSPA 1EH8A 1RR7A 3ZQLA 2EA2A 4XLAA 1O57A 3QOEA 3IUOA 1HLVA 2WAQA 3U21A 2H6BA 4LLNA 3A01A 3CUQA 4G7OF 1KYZA 3ZQCA 2HU9A 2LD5A 4A5MA 2GIVA 1BM9A 2WB1N 3S14J 5F0CA 3F8BA 2E2JJ 2EK5A 4RB3C 1MD0A 1MIJA 3GO5A 4M74A 1RUNA 4QSHA 3ZQFA 3HOXJ 4A6EA 5E8GA 2OPTA 3R0AA 2E2IJ 1N25A 2ZSHB 3DP7A 3SEQA 1D0ZA 3V8KA 2L7KA 1Y1VJ 1XGOA 3E5QA 4C2TA 2HOEA 4YIRX 4UUVA 1TW3A 1K83J 4N4OB 3PIOF 2PLYA 4OIQF 2GXAA 2LVSA 3EETA 3CP2A 5LEKA 4A6DA 3ERMA 2E5NA 2STWA 1NH3A 1VQ9I 3LA2A 1H89C 5GTHC 3EYIA 2PMUA 1SFKA 3SZTA 3S17J 3HOYJ 4CH7A 3I54A 2E60A 3HJEA 1WJEA 1LE8A 1ZLKA 5DUIA 2K9SA 1R4NB 1Y0NA 3K4BA 2GOXB 5C4JJ 1P4WA 3RIRA 3S1NJ 5FFZA 3I4NJ 4BE2A 5DDGA 2CFOA 4G8XA 1MNMC 2ICWG 5B66C 2MSYA 3GCMA 4X1EA 1SAXA 4K2EA 2ZSIB 1GVJA 3FXMA 2L9RA 4ESFA 1G3YA 1VTNC 3S1QJ 4LOCA 1TWFJ 4Y7NJ 3AG3H 3BG5A 2R92J 4L9NA 5DUKA 2A6TA 5CKTA 3G73A 5EG0B 3AG4H 1WJAA 4RGUA 4CYCB 3FXUA 4L9TA 4N9HA 1GXQA 4ENKA 5E79C 4IVNA 2XVCA 2ZFWA 4FT8A 5ILSA 1AKHA 2W00A 4UUTA 1NG6A 4A69C 3MKZA 5BOXA 2ZMEC 1IRFA 3C7JA 4HEA2 1JKRC 4IHXA 2BY0A 2K9QA 4B48A 3I59A 4D0PA 1I1GA 1XC5A 1XTAA 3D5LA 4ETSA 1SMTA 3RYPA 2OU2A 1RRJA 2L7FP 4IO9F 3K70D 3OYCA 3HRMA 2QEXI 3H3VK 3HUGB 2LKPA 3QP6A 1IAWA 1WKMA 3BJAA 1SFOJ 1IRZA 5J40A 4F92B 1T08B 4J19A 1BR2A 3ZCOA 3GZ6A 1VF9A 4RBOA 3K4MA 5LHGA 1BIAA 4O5VA 4W97A 3SEZA 2CS3A 1Z67A 2PFBA 4DGWB 5ICCA 2R7XA 2CQNA 2JRMA 3TOBA 5F0FA 3OYHA 2ISZA 5ICGA 2M5WA 4HV5A 2IEKA 2A5WA 2F5FA 4A3MJ 2I8DA 2EZKA 4LGWA 5CJ9A 3BZ6A 3CESA 1B6AA 4MEXF 2DT5A 4RAYA 2BOLA 1JJ6C 2H09A 2W57A 3E97A 3N4MA 3GXOA 3S15J 1HSTA 1QZZA 1X4PA 1IDZA 4PFOA 2BZTA 3DKYA 2IGMA 1P92A 3ZOBA 3KIOA 5EJCA 3PNVA 2PMHA 4PJJA 1J2XA 2HQ5A 2KRCA 3FX3A 3FXOA 2FE3A 3SYTA 3VOEA 1MBHA 2MG4A 4FCYA 2XGEA 4PFPA 3VSKA 3OYBA 1B59A 2MD0A 2MFZA 2DJIA 3VYTB 4CHUA 4O6JA 4PJLA 4BGDA 3K4NA 1J75A 1VNDA 2BXYA 1GUUA 4HV6A 2F48A 2X51A 2X1EA 4LLLA 1W4MA 3IHUA 1SFXA 3LL7A 2XAUA 3LMMA 5DS9A 2VQCA 2DYRH 3FF5A 2DK5A 1MBGA 5IT3A 4L5JA 4XRMA 1VQ4I 1F1ZA 2R7DA 4G12A 4XKCA 4CO8A 4XR6A 4A12A 3BQYA 4CXFA 2OBPA 3FHZA 1G6NA 1Z21A 2VN2A 3K0LA 1D8JA 1I6XA 3IWZA 4XLNF 3SZGA 4ZYGA 3HDDA 1R1UA 4DYQA 4AU7A 5HNFA 1JTYA 5IP6A 1WI9A 2KPMA 1I27A 3EUHC 2BVLA 4B47A 4F7ZA 1NG7A 1WQ2A 1VFCA 4KIFA 2L7ZA 1ETXA 2H27A 4D9JA 2GXGA 2CG4A 1YOVB 4C30A 5IP7J 1HA8A 1UG0A 3JRIA 1V5GA 3QYFA 2QQBA 3G1MA 4LK0F 5TGTA 4FASD 2R93J 2XPWA 3C3WA 2CV0A 2QQ8A 1T98A 3VWBA 4EGYA 2E1MB 1A6IA 2H8RA 3HOUJ 1BOAA 1RC9A 2BE5F 5JVTA 1XSXA 2DTRA 2LSOA 1K78B 2Q0OA 4B3AA 1R6RA 4P9FA 2Y48A 2XUBA 2K4JA 4P55A 4IX7A 3QU3A 1BI0A 3H5AA 3R4KA 1DDNA 1UZCA 2L2OA 2VB6A 2K9MA 1WJ5A 1L3LA 3GTKJ 3BZKA 5J4YA 2M0CA 1KZHA 3DKXA 3WTTC 2VBZA 3HTSB 2IGNA 4I98B 4KUMA 1JGGA 2OTJI 1XSDA 4DZPA 4QIWN 2DQLA 3CJRB 5BMZA 2DW4A 2LDUA 1BJAA 3I56I 3TO9A 3I4MJ 2O8KA 3BG9A 5E17F 2PEXA 5E1XA 2GIZA 1S6LA 1OKRA 4QPQA 1O7FA 3GX4X 3IRRA 3RKWA 2QLZA 2AO9A 3T8RA 4RAZA 2M45A 5HODA 2X1DA 5K1YA 3QYEA 4HLYA 4H4KC 2IXSA 2OD5A 3RKYA 2IT0A 1Z6TA 2OF7A 5CQGA 2GA1A 1K6OA 3KYLA 1EA3A 1X2NA 3OMYA 2A6EF 1ZKGA 2VE9A 1WI3A 1U6GA 2VE8A 2XRLA 3BR0A 3PO2J 1O3QA 3P9CA 3K6GA 4Q48A 1UHWA 1VQ5I 1QHGA 2XAFA 3L2QA 1RIOH 4GO1A 2XAJA 1OR7C 2OCEA 4CZZA 2FNAA 2VJ4A 4BJTA 2W85A 4FX0A 1K4SA 1AKHB 3MZYA 3GBGA 2JN6A 3FK6A 2LLKA 1LEAA 4M71A 2QF7A 1MNEA 1KYWA 4OINF 4I01A 1SC7A 1WJDA 4N9IA 1LDKB 4KN4X 3ERED 2LKSA 3BZCA 1IN5A 1Z3YA 3GFIA 1FNNA 3DEEA 4AWXB 4HF2A 4XK4A 3ASOH 3QOPA 4XL9A 3HM5A 3GTGJ 3MQ0A 1YG2A 3RZOJ 4C2UA 2JA8J 4MGRA 1SANA 2MLGA 5E20A 4HDUA 1SD7A 3Q0VA 1IUFA 2NRAC 4CGZA 1XD7A 3HGGA 3BR5A 3FXQA 3AL0C 2FSWA 4Y33A 2DN0A 1O3RA 3E1SA 4AM3A 5LRSA 2B9SA 1RR8C 2YUSA 3M8JA 3OYIA 5L3CA 2JTVA 2Y0SA 2IRFG 1FBSA 2AQEA 3GZ5A 2DFFA 2X6YA 1OCPA 2K86A 3BT9A 3TO7A 1T8IA 4XKBA 4I0BA 2LRDA 2QKMB 3OYGA 3G1OA 2MA3A 4G6QA 4BACA 1YYVA 3PFYA 2RREA 2LR8A 3N97A 2ZXIA 2VQGA 1UELB 2H1LA 2EFOA 2LYCA 1M1EB 1MH4A 3S8PA 1ZR4A 4DJAA 3Q0WA 3H92A 1R5ID 2P6TA 1VQNI 4NC8A 1R22A 3HXLA 1TWAJ 5HLGA 1FX7A 3QYBA 4NC7A 5HLHA 3S1RJ 3ZPLA 5F64A 1RKWA 5DYMA 1ZGAA 1MW7A 4M3GA 4HOBA 2ID3A 2VQLA 3LA3A 1YS6A 2IBDA 3H9GA 2FBIA 3DU6A 3SQNA 5D5XB 4PUSA 1ITYA 2DT6A 2YX4A 4FE7A 1IV6A 2D2WA 3RKXA 4G6TB 3WTYC 5LGNA 3G6EI 3ZMSA 2IGKA 2VBWA 4L0ZB 1W7PA 2P5VA 2V26A 2EFWA 1ON1A 1GHCA 5DCMB 1PP7U 2MGQA 4LG0A 1SAUA 2XB5A 3U2RA 3KZYA 4PGGA 4V19K 2XSDC 3CUOA 3K2ZA 4DIQA 3U9GA 2A5YB 3HHHA 3PL8A 1WH5A 3OIPA 3G2BA 1W0UA 3HGYA 3MWMA 4ZZDA 2E35A 4D5FA 4XICA 1YS7A 1ACIA 3J81K 3KX2A 3ABTA 2XKOA 3FXRA 1PP8F 1Y6IA 1DP3A 2J5OA 2VPLA 4N4NB 2DMTA 2EWNA 3A02A 2BW3B 3TBIA 1SVMA 2HKXA 2BV6A 4KT5C 5IYBJ 3PJRA 1VZ0A 4BE1A 5L3BA 4I99C 2DXIA 1MJAA 5HNHA 5KNLA 2ZJRF 3GUDA 5HVQC 5CQEA 5F0HA 4O3MA 2IW5A 1BI3A 5BPDA 4X0GA 2PJRA 2OV7A 2OZUA 1KONA 2JA2A 2MBFA 4HQEA 3CCQI 1RZ4A 5FD5A 5HOOA 3LA7A 2Q2EA 1LJ9A 3Q0UA 4UVAA 1IF1A 4BJ6C 1U0JA 2X4HA 1E2XA 1I1SA 4UY8I 2B0LA 1OCRH 4MTEA 2ZCWA 1N77A 4MIMA 2ECBA 4ESJA 2PG4A 1FBUA 4A0ZA 3OWTA 4BDZA 1IXCA 4HYEA 2DODA 2ELHA 4BXUA 4CCMA 5B1BH 3O2PE 4BAYA 2LY1A 2M3AA 2HYGD 3I55I 2B7EA 3RCOA 3WU2C 2RKHA 2XGDA 3HEFA 5JLWA 3BDDA 2G9WA 2VL8A 1VQLI 4NNJA 4J01A 2DA6A 1TZLA 2DFHA 3CMAI 2O8XA 1X1BA 4XM3A 2XAQA 3J7AY 4U0WA 2Q1ZB 1DGRM 4EATA 1IGNA 2ZXWH 2M8GX 5M3MJ 3K10A 5F08A 4B43A 1V5FA 2L9SA 5E18F 4NC6A 3R61A 4Q5SF 1U9OA 1OYYA 1IN7A 1ETYA 3MZHA 3NQOA 2DT7B 2XDVA 4AVZA 1X3ZB 1KA8A 3F6VA 4IF4A 2F2EA 2FNPA 3L7WA 1HOMA 3MFKA 2HDWA 1OMIA 1ZELA 3GTLJ 2KIUA 3BCAA 3WTVC 4TV7A 3CMEI 4BY1J 2ISYA 3LSTA 3EYYA 1LFUP 2XPVA 2ZNZA 3W6VA 2FOWA 4I7HA 3TP3A 3VDXA 2WY8Q 1Z77A 2AXLA 2QCOA 4XRSG 4MHGA 3HPHA 4IRHA 3VYRB 4B3XA 2E71A 1GVDA 1S7EA 5F1RA 4IZZA 3RZDJ 3DFGA 1T39A 3LSKA 1PDNC 2DA7A 1FIPA 4EJVA 3J80Z 1I6HJ 3EQLF 3EPZA 5FLMJ 1IXRC 4S05A 1ONVA 2ZMEA 5IYCJ 4G7ZF 5CVJA 2P4WA 4YFKF 1JI8A 5K7ZA 2I10A 4PCQA 1UHSA 4XIDA 2EPFA 2L01A 3M7GA 5CPRB 3RQ4A 3F9KA 1S8NA 4M72A 4IOCF 2DDBA 1R71A 4E7SA 5DD8A 3D5SC 1XSVA 4ITVA 2ZB9A 4JX6A 2L5QA 3L1PA 5K7FA 4YFXF 3LSJA 3KP4A 5KCMA 2Y0SN 1USSA 3HBLA 1QPMA 3T8TA 3KYDB 4A3LJ 1UB9A 1LEBA 2A69F 3DXJF 1ZRDA 3KP2A 4CCKA 3NEUA 4FHTA 5BNGA 1D1BA 2LC2A 5E8IA 3GTJJ 2X85A 2KMUA 2E1MC 2L7MP 3SDBA 2HFHA 2EV0A 3ZN0A 2JT1A 1XGMA 3GF2A 3FBIB 2BYVE 4A3DJ 1YLFA 2V6EA 1I5ZA 4CYDA 2NVUB 1G8XA 2O5RA 5E3OA 1MKMA 4DNCA 2R7WA 3OR2C 4A3JJ 1XS9A 4GDFA 4KA4A 3TW6A 3H9QA 1MZBA 4CSWA 2HPIA 4LLGF 2FEZA 3M1CA 5EYRA 2WTEA 1ZRCA 3K69A 1JGSA 5AIPA 2JVGA 4FE4A 3BROA 3FDYA 4QWQA 2DBBA 2NOJB 1KU7A 1OPCA 1QZEA 3LSHA 2A07F 2V4JC 3VEPA 5LHIA 1REPC 1QU3A 2JRTA 1Y1WJ 3C1DA 1IV8A 4L5IA 2UWMA 3K9TA 4BHCA 1ODDA 4E7KA 4ENMA 2IS2A 4G94A 3TDUC 2OA4A 3HRUA 1FYKA 5CVVA 1YX5A 3LSMA 2R7TA 3ZR8X 2NS7A 5CVRA 1WCMJ 2CQXA 4A0XA 2NVQJ 4ZJZA 1SD5A 4BEHB 3ELKA 3TOAA 3RPUD 5D6FA 1W36D 3OOPA 1HDPA 2P0WA 3QPHA 4BQOA 3L9FA 3P5JA 4KICA 2JQ7A 3KP7A 3GFLA 1Z1DA 3IV5A 3BLYA 3ZMTA 3W6JB 4UUSA 5BS6A 3BQZA
chains in the Genus database with same CATH topology
2NXNB 3PIPF 1VQOI 3CCUI 1VQ4I 3G71I 4V19K 1VQ6I 3CMAI 4UY8I 2ZJPF 3CD6I 1VQ9I 1MMSA 2OTLI 5DM6F 2E34A 1FOWA 3I56I 1VQ5I 1Y39A 3CMEI 3CCJI 5DM7F 3CCMI 2K3FA 3DLLF 3CF5F 1FOXA 1YJNI 1VQKI 4IO9F 1HC8A 2H8WA 2ZJRF 1FOYA 2QEXI 3CCEI 4IOCF 2E35A 1YHQI 1YI2I 1S72I 3CCSI 5GADJ 1VQ7I 1ACIA 2FOWA 3CCRI 3G4SI 1YIJI 3G6EI 3CCLI 2JQ7A 2QA4I 1YITI 2ZJQF 5GAGJ 1YJ9I 1VQNI 2E36A 1VQMI 3CCQI 3I55I 1VQ8I 3CC7I 2OTJI 5GAEJ 3CJTB 3CC4I 4IOAF 5JVGF 1VQPI 3J7ZI 3CCVI 3CC2I 3PIOF 5GAHJ 1YJWI 1QA6A 3J7YJ 1VQLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXN B;  3PIP F;  1VQO I;  3CCU I;  1VQ4 I;  3G71 I;  4V19 K;  1VQ6 I;  3CMA I;  4UY8 I;  2ZJP F;  3CD6 I;  1VQ9 I;  1MMS A;  2OTL I;  5DM6 F;  2E34 A;  1FOW A;  3I56 I;  1VQ5 I;  1Y39 A;  3CME I;  3CCJ I;  5DM7 F;  3CCM I;  2K3F A;  3DLL F;  3CF5 F;  1FOX A;  1YJN I;  1VQK I;  4IO9 F;  1HC8 A;  2H8W A;  2ZJR F;  1FOY A;  2QEX I;  3CCE I;  4IOC F;  2E35 A;  1YHQ I;  1YI2 I;  1S72 I;  3CCS I;  5GAD J;  1VQ7 I;  1ACI A;  2FOW A;  3CCR I;  3G4S I;  1YIJ I;  3G6E I;  3CCL I;  2JQ7 A;  2QA4 I;  1YIT I;  2ZJQ F;  5GAG J;  1YJ9 I;  1VQN I;  2E36 A;  1VQM I;  3CCQ I;  3I55 I;  1VQ8 I;  3CC7 I;  2OTJ I;  5GAE J;  3CJT B;  3CC4 I;  4IOA F;  5JVG F;  1VQP I;  3J7Z I;  3CCV I;  3CC2 I;  3PIO F;  5GAH J;  1YJW I;  1QA6 A;  3J7Y J;  1VQL I; 
#chains in the Genus database with same CATH topology
 1Z7U A;  5J3L A;  3O8H A;  2FF4 A;  3TGN A;  2ZC2 A;  1LE8 B;  4NQW A;  4I0A A;  3GW2 A;  5D8K B;  1BC7 C;  2ELJ A;  4E7I A;  5CVU A;  1TBX A;  3PUB A;  2IS1 A;  1AA7 A;  1XX5 A;  3BCB A;  4ABZ A;  4C3I J;  3CJN A;  1XGN A;  1ZN2 A;  3H5R A;  2V1X A;  4M3B A;  2CH0 A;  4HNV A;  4HX4 A;  2DMP A;  3LNQ A;  4NUB A;  5DV5 A;  1GLN A;  1FYL A;  3FWE A;  5D5U B;  4BDY A;  4XSX F;  3I5U A;  4HQM A;  3CO6 C;  2LF8 A;  4IEJ A;  3RYR A;  3D1N I;  4ZDL A;  1B9M A;  3CDI A;  5J1U A;  2KIM A;  1W36 C;  4BKX A;  3RQI A;  4HX7 A;  2OJE D;  2LRE A;  5D8L B;  4BUP A;  2XF7 A;  2Q8K A;  1FP2 A;  1U2W A;  1IRX A;  3V7C A;  2HOT A;  3L2V A;  1IN8 A;  1P7J A;  2FU4 A;  3AG2 H;  1MSF C;  1UCR A;  5FLV A;  4PGH A;  2LF7 A;  4I76 A;  3IKT A;  3GTM J;  1V54 H;  2RC4 A;  1J09 A;  5ICF A;  3K70 C;  3KZZ A;  4ON0 A;  3FMR A;  1MMN A;  2WAQ N;  2RGV A;  1SVO A;  4B8X A;  1H0M A;  1R7J A;  2LY2 A;  1Q1H A;  2EIJ H;  2ZNY A;  4DYR A;  3C2G A;  1GDT A;  4QPO A;  1TWH J;  5FKM A;  2R7Q A;  3K7A J;  1QGP A;  5E1W A;  3HOT A;  1TC3 C;  2F4O B;  3OSG A;  1XPX A;  2HS5 A;  1SD6 A;  5IT9 K;  1LDJ A;  1KU3 A;  4I6Z A;  2QSH X;  4CCJ A;  1L0O C;  2QKL B;  2F5E A;  4RB1 A;  1D5V A;  2W7N A;  4GXO A;  4A3B J;  1BA5 A;  1ZYR F;  2BEO A;  3G1L A;  2AQF A;  3HG9 A;  4E7Z A;  2PI0 A;  3P9K A;  3CCU I;  3CUQ C;  5TJJ A;  4E7L A;  2LP0 A;  5D4S A;  2CWE A;  2WV1 A;  2KJC A;  3GYH X;  1ZRE A;  2CV2 A;  3BPX A;  1BI1 A;  3L2U A;  2H6C A;  3K1M A;  4FQG A;  1R9T J;  4EM0 B;  1S7O A;  2L4A A;  2W82 A;  2YPR A;  3ABL H;  3WGI A;  2R7V A;  2HOS A;  2JMW A;  3QU6 A;  1R4M B;  3KLN A;  4HW0 A;  2OQR A;  3JAM Z;  4ENJ A;  5HS9 A;  4DQ2 A;  1F43 A;  3EDP A;  4JBA A;  4JQF A;  2QEN A;  4YEJ A;  2M4G A;  3JRB A;  4ENN A;  1Z3X A;  3O8G A;  1E3H A;  3PO3 J;  3QP5 A;  3I53 A;  1D0X A;  2L3D A;  1R1T A;  4EJW A;  2R7F A;  4U0Y A;  2K27 A;  1VQ7 I;  4M73 A;  1RI7 A;  2XRN A;  3M07 A;  3OYN A;  1PYV A;  4CIC A;  1YJ9 I;  3GTQ J;  2M34 A;  1A04 A;  4UNO A;  3ABU A;  1BR1 A;  2JZY A;  2L4M A;  1LQ1 A;  1V3F A;  1VQO I;  1YRN A;  2ECC A;  2HI3 A;  2K40 A;  3CD6 I;  2K85 A;  2JUG A;  2VJJ A;  4XSZ F;  3E7L A;  3E6M A;  2IPQ X;  2Y30 A;  2E7W A;  4YG2 F;  3OYL A;  2D5V A;  1HXD A;  2H94 A;  5C44 J;  4EJO A;  1PUF B;  4UV9 A;  4ESB A;  1TWG J;  3ABM H;  4BHP A;  3HYI A;  2QUF A;  3SHF A;  3MKW B;  2G7H A;  2VC0 A;  2PQ8 A;  2IA2 A;  5H20 A;  5D5W B;  4HF1 A;  3OIO A;  5TIS C;  1CGP A;  1J9I A;  2G0E A;  2I5U A;  4XLH A;  1BN5 A;  4RGS A;  5EF6 A;  1ULY A;  4RB0 A;  2OC6 A;  1ZR2 A;  2HVS A;  3FKJ A;  1YFH A;  2DK8 A;  2Z5U A;  2V9V A;  4AC0 A;  1B8I B;  3QPL A;  5DM7 F;  3CF5 F;  3DWL E;  1F9N A;  2VLA A;  3WTS C;  2HXI A;  3DPT A;  1MMD A;  1X1A A;  4G6D A;  4DBQ A;  2FD5 A;  2VPR A;  3JRC A;  4FIS A;  4PSW A;  4XLP F;  4C3J J;  5JLX A;  4L9J A;  2DLL A;  2F4I A;  4CUG A;  1SEU A;  1G3W A;  1MBF A;  2W84 A;  1VQM I;  3GFM A;  2M0M A;  4JYK A;  3K1P A;  2V79 A;  5M5Y J;  4KFC A;  5L3E A;  5DEQ A;  3DBR B;  2XKP A;  1FLI A;  4IRI A;  4II3 A;  4PJM A;  5JR3 A;  3IC7 A;  3Q9V A;  4II2 A;  2DO7 A;  1XMA A;  5M5X J;  2IVM A;  3R60 A;  5GPA A;  3MD2 A;  3VOD A;  3I64 A;  1FPQ A;  4EJT A;  1I50 J;  4LK1 F;  1U5T C;  2CUE A;  4RGX A;  4OIR F;  1Y0U A;  4AIJ A;  5D6E A;  4NHJ A;  4BYY A;  4RB2 C;  2EFN A;  4LIU A;  1YTY A;  2M8E A;  3EUH A;  3WG7 H;  2VI6 A;  3HUG A;  3HTU A;  3J80 K;  2X9D A;  3L2C A;  3BR6 A;  4LJZ F;  2QZ8 A;  3HOV J;  5FKO A;  1RKT A;  3F0C A;  1DU6 A;  4ZYD A;  3I71 A;  2BW3 A;  2NAZ A;  2WAE A;  1MJ9 A;  2OAZ A;  3ZXS A;  5B1A H;  3H0D A;  2E7X A;  3KZI C;  2X6O A;  1JJ8 C;  4LD5 A;  1O7L A;  1RNL A;  3RDI A;  4KDP A;  3ZMU A;  5K5Q A;  2NOG A;  2M9H A;  3K4K A;  3REO A;  1JTX A;  4EV0 A;  1UAA A;  3V7R A;  3OYF A;  1ON2 A;  2WBM A;  3I58 A;  1ZG1 A;  3FM3 A;  3WTX C;  1TT0 A;  1JKQ C;  1NTC A;  1YW8 A;  2E1O A;  1FSE A;  1X3W B;  2J5P A;  4GCV A;  3S3O A;  1LUJ B;  4HST A;  4UXN A;  2NS0 A;  1ZH5 A;  2IP2 A;  2STT A;  1ETO A;  1K7A A;  3UNG C;  2M30 A;  4PJN A;  4U0V A;  2MD5 A;  1MSE C;  5ILV A;  1OFC X;  1BBY A;  3JW4 A;  2MYS A;  2Q2E B;  4IXA A;  3GTO J;  4GYG A;  1FBQ A;  5F04 A;  3PFI A;  2RAE A;  3BG6 A;  2HEO A;  1UG2 A;  1HF0 A;  3DKW A;  2O6G E;  3F8M A;  1D0Y A;  2FUG 2;  4WXH A;  3S93 A;  5LGT A;  2K3P A;  3LFK A;  2IA0 A;  3MMY B;  3WG9 A;  3NAU A;  4ZTJ A;  4A0Y A;  2ZJP F;  4Y13 A;  2OTL I;  3CP8 A;  1HKQ A;  4OAY A;  2DI3 A;  1SFE A;  1MDM A;  3MKY B;  1W7P D;  2EBI A;  3DTI A;  4A3K J;  1F36 A;  2CQQ A;  3ONQ A;  5M5W J;  5K7H A;  2WA0 A;  4KMU X;  2ADU A;  2YR2 A;  5FB2 A;  4CDG A;  1ETV A;  2KLO A;  2KZG A;  4Z6Y A;  2P5L C;  1TQI A;  2JA5 J;  4RGR A;  3L2R A;  3TW7 A;  3CC7 I;  2CMP A;  4U7B A;  4XKV A;  3OYD A;  2JPB A;  3GFJ A;  4BXX J;  1WFX A;  2W24 A;  3LSG A;  1O4X A;  3KCC A;  4M3F A;  3TP0 A;  2HTS A;  5ICE A;  1FTZ A;  4HA8 A;  2OUM A;  3BPV A;  5D5V B;  1STZ A;  1P9Q C;  3IH2 A;  2R7S A;  1U5T A;  2MH2 A;  2V1U A;  2A6H F;  1FP1 D;  5J1Y A;  3SXY A;  1WJB A;  1FYM A;  5F27 A;  2ETH A;  3MEX A;  4MTD A;  1YIJ I;  1K78 A;  4EGZ A;  2XSJ C;  2NVY J;  1PVE A;  2CU7 A;  1J0R A;  1X1P A;  1OCZ H;  1QBJ A;  3HOS A;  1LPQ A;  6PAX A;  1APL C;  3CMM A;  2Y9Y A;  1ZG5 A;  1GT0 C;  1O3S A;  1HKT A;  4JX5 A;  1KU9 A;  4OIO F;  2HDD A;  5EEG A;  3E5U A;  1UFM A;  3I9V 2;  2EH3 A;  2P6S A;  2BY2 A;  3E6D A;  2CSO A;  4KNY A;  3CLO A;  5KAI C;  3S2H J;  3B73 A;  5FKK A;  1FIA A;  3DPU A;  3MAJ A;  4B1R A;  2QBY B;  4F3Q A;  4ZC3 A;  1XGS A;  1EH6 A;  2W1O A;  3CLQ A;  3CQZ J;  4ZZL A;  1MBK A;  1Y8R B;  1P6R A;  3TO6 A;  1R00 A;  3WGH A;  4LG3 A;  3ROU A;  2VJ5 A;  1R49 A;  1LB2 A;  4KN7 X;  3A1Y A;  4JX4 A;  3PNT A;  3UKG A;  1QNT A;  3I3L A;  2LTP A;  3R6S A;  3V7S A;  3CCS I;  1G2H A;  1RUO A;  4WWC A;  3K4C A;  3AG1 H;  1S29 A;  4P9U A;  2QA4 I;  1HBX G;  2GA2 A;  1P7I A;  1FZP B;  3FKI J;  3T0Y A;  2VON A;  2DPU A;  1ZQ3 P;  2R0Q C;  3KEY A;  5DCM A;  3CCV I;  3W2W A;  1TTY A;  4YII A;  3CDL A;  2JWT A;  3LAP A;  3F21 A;  2GAU A;  2O0Y A;  2CGP A;  2ME0 A;  1DUX C;  4A93 J;  2CW8 A;  3DEU A;  5H2F C;  1HDD C;  2EQR A;  4AYB A;  3HZJ A;  3F23 A;  1Z7L A;  4AIH A;  2QSF X;  1S9H A;  3RJP A;  1B72 B;  1VQK I;  4XLC A;  5LBQ A;  3OSF A;  1WWX A;  3S2W A;  4BE0 A;  2FML A;  4IRG A;  1YI2 I;  1IDY A;  2HXO A;  4B4C A;  2DA2 A;  4ZTF A;  2RNG A;  3TDZ C;  1YO5 C;  4Q47 A;  5K5O A;  3KEQ A;  5IOZ A;  2E2H J;  3FHN A;  1XDS A;  2CYY A;  2LBF A;  5EEA A;  2JSP A;  2IS4 A;  2EV5 A;  2QQ9 A;  4XKW A;  1JXS A;  2DA3 A;  1X58 A;  2ZBK A;  1QVU A;  4LMY A;  5HDN A;  2CQ7 A;  2E34 A;  4PJ0 C;  1LFB A;  1T0F A;  1DP7 P;  1FMW A;  4GYI A;  3VPR A;  1AU7 A;  4XLF A;  1POG A;  4MO7 A;  3V42 A;  2EB7 A;  5HS8 A;  1DU0 A;  3MZ8 A;  3CMY A;  4UHT A;  4D1Q A;  3GLL A;  1F5T A;  2P7C B;  1H9G A;  4U88 A;  2KDO A;  3BJO A;  2ME6 A;  3TED A;  1EH7 A;  1QQI A;  1JKP C;  2W25 A;  1IG7 A;  1FEX A;  2VC1 A;  1LVK A;  3U1K A;  2LMD A;  1DPR A;  1G3T A;  4KIS A;  3ECH A;  5GPC A;  1IW7 F;  5FGM A;  5FD6 A;  3NWT A;  2EFQ A;  4PK4 A;  2BY1 A;  3VYU B;  3H5N A;  3OV8 A;  3BY6 A;  4XOR A;  3FZV A;  1MH3 A;  4HX8 A;  1ZLJ A;  2KRF A;  2DA4 A;  4BL0 B;  4IPA A;  2NNY A;  1HC8 A;  4KIG A;  4XLE A;  4JK1 X;  4UB8 C;  3FXK A;  3IP4 B;  2QSG X;  2R5Z B;  2WY7 Q;  4OU0 A;  1KQ0 A;  4XRS A;  5EGO A;  3CCL I;  4AIK A;  3F6O A;  1MMS A;  3ML6 A;  5FJ8 J;  1UST A;  1FTT A;  2QVO A;  1WRJ A;  3SDG A;  2LNB A;  3E6B A;  4Y4R A;  4CCO A;  2UXX A;  1YX3 A;  4S0H B;  1R5G A;  5F1J A;  1OCT C;  3NAR A;  4RM2 A;  4N0B A;  1AWC A;  3SFI A;  5ERI A;  1OCO H;  3BR1 A;  1H9T A;  1YQA A;  2EA4 A;  1BOB A;  5FRO A;  3GTP J;  2FA5 A;  3OS0 A;  2BHZ A;  2LFB A;  2KIQ A;  3WHB A;  5GAG J;  1YW9 A;  1A36 A;  3NRV A;  4L0Y B;  3J7Z I;  2CRG A;  2EIM H;  4NDL A;  1WJC A;  3ISP A;  3TMO A;  1X2M A;  4L9V A;  4WXC A;  2K02 A;  4XOP A;  3AAF A;  2P7V B;  2VOD A;  3WTZ A;  4WF2 A;  3H35 A;  1W1W E;  2EIK H;  4M9S A;  3L00 A;  4M6V A;  3PQK A;  1W5T A;  2DA5 A;  4IHV A;  4S04 A;  4E4H A;  3WU1 B;  4XNF A;  3JR9 A;  1PJR A;  4CZC A;  3V8L A;  4AVP A;  1MDM B;  3CCY A;  2HYJ A;  5GAH J;  4F91 B;  3LQQ A;  3A01 B;  1HW2 A;  1W7P B;  3IAM 2;  2KQR A;  1VI0 A;  2HKO A;  3COA C;  2HNH A;  4RAF A;  4GGG A;  2XGC A;  2XAS A;  1IJW C;  1BJZ A;  1LFP A;  3WOD F;  2OCC H;  3I4P A;  4YEL A;  5CYV A;  1YRN B;  1FOK A;  3HSE A;  3QWL A;  3OR1 C;  5LGU A;  1YJN I;  2X0L A;  1D1C A;  4R79 A;  4IHT A;  4CCN A;  1IUY A;  3KEO A;  4G9Y A;  3BR3 A;  3LQR A;  5FKL A;  2RV8 A;  3J7A O;  2CUJ A;  3WHC A;  3S1M J;  4HSR A;  2DAO A;  3ZQH A;  3QOD A;  5LHH A;  3V8J A;  4IJA A;  3FMQ A;  2FX0 A;  2F5D A;  3OL3 A;  4IHS A;  2QM3 A;  2XAG A;  1MJB A;  1XN7 A;  3B6C A;  3CTA A;  1IC8 A;  3W2A A;  5B5E C;  4DBR A;  1NK2 P;  1JT0 A;  3DBH B;  4BBS J;  3FK7 A;  4U87 A;  1BI2 A;  4M9X A;  3DLL F;  3GVA A;  5IPA A;  4C9Y A;  5AON A;  1TP4 A;  3O6B B;  4J00 A;  1IZ1 A;  4EEF G;  3FIS A;  3PUF A;  2Z33 A;  2K4B A;  2X6W A;  1E3P A;  1ETW A;  3F72 A;  2YU9 J;  2LG4 A;  2VKV A;  3RKQ A;  4IQ4 A;  3DEW A;  3RI4 A;  4UVB A;  1ERD A;  1JHH A;  2A68 F;  4RLQ A;  4AID A;  2V9K A;  1OLT A;  1T0F C;  1U8B A;  2BHY A;  5JHU A;  1IRG A;  2KL4 A;  2WV0 A;  5AIQ A;  4I2O A;  3CCJ I;  1JUM A;  4EJU A;  2FJ1 A;  2XB0 X;  5L3G A;  4Y15 A;  3HHG A;  3H36 A;  3KET A;  5B3S H;  3HSF A;  3DF8 A;  3OYK A;  3LSI A;  2AXT C;  2BBY A;  2GOM A;  2FQ3 A;  3BJ6 A;  3H1C A;  3QPT A;  3W6K B;  1E3O C;  4U7D A;  1T38 A;  1Q1V A;  3CC4 I;  2PJP A;  2HQN A;  2DYS H;  2O03 A;  3P7N A;  3DQV C;  4A3E J;  2NXN B;  3GZN B;  2ACJ A;  2PMZ N;  2DMQ A;  1RPW A;  1S7A A;  3U1D A;  2NVX J;  1T56 A;  3IRQ A;  4LB6 B;  4HAM A;  2ZXJ A;  3H9J A;  5DM6 F;  2XAH A;  2HQR A;  4BY7 J;  4AUX A;  3HOZ J;  2IS6 A;  2OZ6 A;  3ZMV A;  1Z0X A;  2K3F A;  1UHM A;  2QQA A;  5LLQ A;  4XN0 A;  3N05 A;  4XN3 A;  1ZG3 A;  3HPG A;  3C18 A;  3A0B C;  3BTC A;  3A03 A;  5GAD J;  4XQF A;  1V4R A;  3HOW J;  4BU2 A;  3MKL A;  3WTW C;  2DOE A;  2XF5 A;  4XMY A;  2HYF A;  4I02 A;  4IQJ A;  1XCB A;  1BW5 A;  4QLC U;  1TLH B;  4M6X A;  2XF6 A;  4PSX A;  9ANT A;  2M7B A;  5LFA A;  1FOW A;  1Z6R A;  1W0T A;  3RTR A;  1CF7 B;  1HSJ A;  3JRF A;  4EM1 A;  1WZ2 A;  3E3V A;  3BC8 A;  1QRY A;  4UV8 A;  2HVR A;  4IKF A;  2LKX A;  2H1K A;  4BS9 A;  2Y2Z A;  1TNT A;  3K1N A;  1ORK A;  4ZDO A;  1N78 A;  2VAS A;  1T95 A;  5F6F A;  3ULQ B;  3F8N A;  1WJF A;  3CC2 I;  3KP5 A;  2MH9 A;  2EZH A;  2Z2S B;  4D5C A;  4A3F J;  2VQH A;  5TRD A;  1RES A;  2W48 A;  3G71 I;  2E19 A;  5E3L A;  2VXD A;  2VJI A;  4RA2 A;  4H0E A;  5JFR A;  2YS9 A;  2R3S A;  2CW0 F;  2V6C A;  2TCT A;  3IWF A;  2H8W A;  4CYC A;  5A2Q Z;  1HCR A;  1X3U A;  3JSP A;  1BW6 A;  2GWR A;  3UR3 C;  1NHA A;  2ZJQ F;  2D1H A;  2LK2 A;  3HC7 A;  2ELK A;  5E1Z B;  2Y31 A;  1D1A A;  2HVQ A;  5IYD J;  1GV2 A;  2L0K A;  2A05 A;  3BWG A;  2FBK A;  2ZXH A;  2KFD A;  3MCZ A;  1MBE A;  2VXZ A;  1W5C C;  2O3F A;  3JRG A;  4UB6 C;  4M3E A;  5GP9 A;  4P96 A;  1ZAO A;  3CJQ B;  1LVA A;  3DLA A;  3ZQQ A;  1S5L C;  1KQ9 A;  4ZYH A;  2ZKZ A;  2LOO A;  2D45 A;  4Y3O A;  1DPU A;  4CCL A;  3JRE A;  4A2U A;  1ZAR A;  1H8A C;  1K6Y A;  2VKH A;  3OYM A;  4KIT B;  4HLX A;  3JRD A;  2PBI A;  3J81 Z;  2M1B A;  1JUP A;  1YIO A;  2EZL A;  3D5R C;  2CFX A;  1G59 A;  1WPK A;  5C3E J;  5C4X J;  4MLO A;  1TL8 A;  1QZY A;  4Y52 J;  4Y17 A;  4D7N A;  2O7O A;  1EKE A;  3DCF A;  2GQQ A;  2RVC A;  1MND A;  4HG2 A;  1XG1 A;  4LFU A;  3W3C A;  2K5C A;  2Y9Z A;  3T5X A;  1B9N A;  5EDN A;  4BH9 A;  1A5J A;  2R5Y A;  1EF4 A;  4AD9 A;  2LH9 A;  5J1R A;  1SMY F;  2EFP A;  1QVT A;  3S16 J;  2X1C A;  3O3K A;  1TW2 A;  2WWY A;  2UZK A;  2M4K A;  5KHD A;  3PSF A;  4MEY F;  1JKO C;  5JVG F;  1OQY A;  4V2F A;  2V1D A;  1R23 A;  1P4X A;  3CF2 A;  5KVR A;  2R5Z A;  3E0J B;  2VIX A;  1Z05 A;  3FXL A;  2AHQ A;  4MFE A;  2X6X A;  2KDZ A;  3BR2 A;  3WE2 A;  5BQT A;  3L2W A;  2BY3 A;  1U78 A;  5LRR A;  2NVT J;  1HW1 A;  4ZYA A;  4G7H F;  1U5T B;  2F4M B;  3K4J A;  3GLX A;  3D0S A;  1K4T A;  4OAZ A;  1V55 H;  3M8F A;  2XHK A;  4MFD A;  2YU3 A;  2DTZ A;  1YE9 A;  3OYE A;  1HKS A;  2IGO A;  4F52 A;  2DQR A;  2PX9 A;  4Q4Z F;  1CF7 A;  2JA7 J;  5JI6 A;  1DQU A;  1D3Y A;  3AKZ A;  1ETK A;  4EMS A;  4A3C J;  4BBR J;  5HLT A;  2DMU A;  2R7R A;  1FSH A;  4WK8 F;  3B02 A;  3ESW B;  3JTG A;  1Y39 A;  2E5Z A;  2XGX A;  5E3M A;  3CCM I;  1BC8 C;  4BQA A;  3S2D J;  3OL4 A;  1OIS A;  1ZHF A;  3F8C A;  4HNT A;  1S72 I;  2V9P A;  3DPL C;  5J47 A;  2HOA A;  2TDX A;  5H6R A;  2O61 A;  1IN4 A;  2DMN A;  2F5V A;  5FRN A;  4ZH4 F;  3M8E A;  2RN7 A;  3I59 B;  2VT2 A;  1G4D A;  2VBX A;  3OOU A;  3KPH A;  4M9Z A;  1QA6 A;  2COM A;  4ZYE A;  5BPI A;  2K9L A;  1KGS A;  2QBY A;  5H6Q A;  1C0W A;  1J7K A;  2IA1 A;  2R7O A;  3LAJ A;  1X1C A;  2Y0M A;  2Y75 A;  3JCU C;  1E0E A;  2ESH A;  5HLI A;  1IN6 A;  4KMF A;  2MW8 A;  3CCE I;  1MGT A;  4PDK A;  2MC3 A;  1BR4 A;  1XB4 A;  4E7J A;  1G3S A;  2L54 A;  3F8F A;  1JE8 A;  2PJR B;  2VUM J;  3PNY A;  1JHF A;  4FX4 A;  5GAE J;  3CJT B;  5HDG A;  3FMS A;  2E1N A;  4JP0 A;  2V7F A;  4LB5 A;  4C3H J;  1YW7 A;  3M9A A;  4MNU A;  1NK3 P;  1VQ6 I;  2KZV A;  5IOY A;  4KT6 A;  3JRA A;  3M4O J;  2KHM A;  4HRI A;  4DZJ A;  1T33 A;  3ZQG A;  1LNW A;  2JVH A;  1IXS B;  1MBJ A;  2NNN A;  3FM5 A;  3IKV A;  5FRM A;  1QPI A;  2YX7 A;  4BJ5 C;  5DTD A;  1KQ8 A;  4XRF A;  4B44 A;  4X6A J;  5ILU A;  2DOA A;  4HZF A;  4KJZ A;  1XMK A;  4M3D A;  4WXD A;  4R1H A;  1N75 A;  3LFU A;  3TQN A;  4DYC A;  3WE3 A;  2L9N A;  4NQW B;  5DCF A;  1KU2 A;  2F5C A;  2RQQ A;  5L3F A;  3OS1 A;  4BHB A;  2GLO A;  2KRH A;  3S3N A;  4XBF A;  3VB2 A;  5J4V A;  5E3N A;  1V5E A;  2JPC A;  5EG0 A;  2C6Y A;  3H3U A;  4Z2Y A;  2EJR A;  2GM4 A;  2PMZ A;  1FOX A;  2MAB A;  1O3T A;  1X19 A;  1D8K A;  1ZGW A;  1EV7 A;  1OR7 A;  5FO5 A;  1YHQ I;  3SZP A;  3ZN1 A;  5J8C A;  2DOF A;  1TQM A;  3ZMD A;  2JA6 J;  4BEH A;  5CLS A;  1ZTR A;  4A5N A;  2P5K A;  4V2G A;  1ZRF A;  3CUQ B;  2HZT A;  2HZD A;  2YSR A;  2HWV A;  3ASN H;  3BTL A;  2B63 J;  1OCC H;  1H88 C;  4P1W A;  1AHD P;  2JSC A;  4GFB A;  1BIB A;  1D5Y A;  3A4C A;  4AYB N;  4UVC A;  2Z3Y A;  3A0H C;  2QGU A;  2ZJ2 A;  3HKZ A;  3EUK L;  1CQT A;  3ZRG A;  4L18 B;  2BGC A;  3PSI A;  1E17 A;  2F6C A;  4M6Y A;  3GEZ A;  2FMY A;  3DV8 A;  1Y56 A;  2UUZ A;  2KJB A;  1DGW Y;  1TWC J;  3KE2 A;  1LDD A;  1AOY A;  2XIG A;  2DJN A;  3B6A A;  1IO2 A;  5EEH A;  1LKX A;  1S3J A;  4LIT A;  2E1C A;  3R0J A;  4MQ9 F;  2X48 A;  2FOK A;  5L3D A;  5CVI A;  1XMX A;  5GTI C;  1EJ9 A;  4KIB A;  3G3Z A;  2BVM A;  4NBQ A;  4XOT A;  1WH7 A;  3HRS A;  2E36 A;  3WU0 A;  2LBF B;  3OS2 A;  3F3X A;  3IH3 A;  3BG3 A;  1PUE E;  1U3E M;  2WAF A;  3KYC B;  2KIF A;  2OQG A;  2RDP A;  2O9L A;  2CUF A;  1UJ8 A;  2DCE A;  3F22 A;  3IH4 A;  3S32 A;  5D4R A;  1B1B A;  1OYI A;  1ETQ A;  2P81 A;  2WB1 A;  1B72 A;  5IT9 Z;  3DBL B;  2UXN A;  5LD2 C;  1TT5 B;  2KP6 A;  4RDU A;  2R7U A;  2QWW A;  3SJM A;  2XPU A;  2RNJ A;  2GBY A;  4XON A;  3KLO A;  2M2E A;  2LY9 A;  3M1E A;  4YRV A;  3KFW X;  5KAF C;  2G7U A;  3PQJ A;  3RPQ A;  3ZMZ A;  4DOZ A;  1WVR A;  1FMV A;  3AL0 B;  1A31 A;  3IL2 A;  2VT3 A;  3RSN A;  2EV6 A;  2L02 A;  5HS7 A;  4E7H A;  2L9V A;  4YIF A;  4DW6 A;  4E6K G;  4A3G J;  4EM2 A;  1A6Q A;  2K7L A;  3DTK A;  2MLK A;  4KYW A;  3AFH A;  2CO5 A;  2AS5 F;  2CV1 A;  1QHH D;  4ASN A;  4C2M J;  1HW5 A;  1SVL A;  3GWZ A;  1MMG A;  3C2B A;  3EUA A;  1XDU A;  1XCV A;  2VBY A;  3QQA A;  2Z16 A;  1B8I A;  3MVP A;  2ZFU A;  3DU5 A;  1FWZ A;  4BNC A;  1MMA A;  3L09 A;  3CO7 C;  4CA0 A;  2XRO A;  2NS8 A;  1T6S A;  1JT6 A;  1SFU A;  5EZG A;  1ZGJ A;  2RQP A;  3QPS A;  1F4K A;  4F55 A;  3W2V A;  4NB5 A;  2HQA A;  1ZK8 A;  1P2F A;  3HL2 A;  1U8R A;  2JK3 A;  2WC2 A;  3WTU C;  3OY9 A;  2FBH A;  2BXZ A;  3PM1 A;  1TNS A;  3HIF A;  3BTJ A;  2FRH A;  1RET A;  1W5S A;  1PUF A;  2W4S A;  3WGG A;  4QTR A;  3SFZ A;  5J6X A;  1R58 A;  3JTH A;  2HGC A;  3P9I A;  1FT9 A;  4BXF A;  1WGX A;  2R4G A;  5IY5 H;  1VQ8 I;  2A61 A;  3CZ6 A;  5FLX K;  4UUS B;  2D1V A;  1YJW I;  2DA1 A;  2HPM A;  3A2K A;  5HDK A;  4JOM A;  4E70 A;  2JJ7 A;  2DPD A;  4HNU A;  2XV4 S;  4WX9 A;  4RLF A;  4IL6 C;  5KK1 A;  3JSO A;  1K79 A;  1FJL A;  2EIN H;  2UV1 A;  2GXB A;  2VOO A;  3H0G J;  4OIP F;  2HR3 A;  2IJL A;  4BQQ A;  3VFZ A;  2GZW A;  4ANJ A;  4WCG A;  4GRI A;  2VOP A;  3FIW A;  4RS8 A;  3JRH A;  2M7A A;  3S3M A;  3QAH A;  5A2Q K;  3ZGK A;  2ZO4 A;  1X4O A;  4EQQ A;  2CW7 A;  2ZME B;  2DFE A;  5ED4 A;  1FY7 A;  2P8T A;  1SD4 A;  1UMQ A;  1J59 A;  3I0T A;  1Y8Q B;  3HRT A;  5DD4 A;  2M87 A;  3PIP F;  1I39 A;  1TQP A;  1K61 A;  1P4A A;  1A35 A;  2Z99 A;  3Q9S A;  4BQN A;  3FBN B;  2R7Z J;  5FFX A;  2COB A;  2V1N A;  4RM3 A;  4LIV A;  2DDA A;  2DFI A;  4RMN A;  1Z91 A;  5JHF A;  2PN6 A;  1J5Y A;  2HTJ A;  4IHY A;  2K9N A;  1X1D A;  1R36 A;  3FXJ A;  4R8H A;  3MN2 A;  3JAM K;  3BTI A;  3X2Q H;  4OMY A;  2Y69 H;  2MC4 A;  3DTE A;  4MQV A;  4EVI A;  3K2A A;  3VYS B;  1HQC A;  3J7Y J;  3ZQ7 A;  1FC3 A;  4HF0 A;  1I3Q J;  2ID6 A;  3M3Y J;  3IAS 2;  3KP3 A;  5J8F A;  3ABK H;  3NWS A;  5K5R A;  3QRF F;  2R5Y B;  2N8G A;  2FQ4 A;  3LWF A;  3GME A;  3T1B A;  1R1V A;  3E6C C;  2XC7 A;  5EZH A;  5EGO B;  2JUC A;  4F93 B;  4HBL A;  3V4G A;  1U9N A;  3K4L A;  3C2H A;  4IOA F;  1I3A A;  1VQP I;  2TRT A;  3ZP5 A;  3CDH A;  3HB9 A;  2A3S A;  2VKE A;  3OYJ A;  1R5H A;  3RPU A;  3Q3S A;  1JUS A;  2CJJ A;  3HSR A;  3OYA A;  2IAI A;  5M3F J;  3BOQ A;  1T2K A;  5LEJ A;  4OMZ A;  2CQK A;  5FKN A;  3TL4 X;  3LOC A;  1B4A A;  3ZQI A;  4L5E A;  4RAG A;  2HDC A;  2KIS A;  1OYW A;  3BP8 A;  1Z9C A;  2NYX A;  3LSR A;  1BL0 A;  1QO0 D;  4IHW A;  2VKD A;  3CCR I;  3G4S I;  3BG7 A;  4HPQ A;  1WSU A;  3E5X A;  3OIQ A;  1WHU A;  4OOI A;  2WAD A;  4ZDP A;  1GXP A;  2FXA A;  3H3Z A;  4FET A;  2CUZ A;  4LG0 B;  1ENH A;  3KP6 A;  4OWR B;  5FLX Z;  4P5O A;  2DU9 A;  4A3I J;  2EZI A;  4I09 A;  3VSL A;  5IP9 J;  2ESN A;  2KKO A;  2KT0 A;  4YFN F;  4HDV A;  1GV5 A;  2Z1D A;  3Q5F A;  1FOY A;  4W1U A;  4D7M A;  3HKZ N;  2QYO A;  4FTH A;  2Z9O A;  4B09 A;  4PZJ A;  3ECO A;  1OJL A;  3TKY A;  1YIT I;  2EIL H;  3LSP A;  1EH8 A;  1RR7 A;  3ZQL A;  2EA2 A;  4XLA A;  1O57 A;  3QOE A;  3IUO A;  1HLV A;  2WAQ A;  3U21 A;  2H6B A;  4LLN A;  3A01 A;  3CUQ A;  4G7O F;  1KYZ A;  3ZQC A;  2HU9 A;  2LD5 A;  4A5M A;  2GIV A;  1BM9 A;  2WB1 N;  3S14 J;  5F0C A;  3F8B A;  2E2J J;  2EK5 A;  4RB3 C;  1MD0 A;  1MIJ A;  3GO5 A;  4M74 A;  1RUN A;  4QSH A;  3ZQF A;  3HOX J;  4A6E A;  5E8G A;  2OPT A;  3R0A A;  2E2I J;  1N25 A;  2ZSH B;  3DP7 A;  3SEQ A;  1D0Z A;  3V8K A;  2L7K A;  1Y1V J;  1XGO A;  3E5Q A;  4C2T A;  2HOE A;  4YIR X;  4UUV A;  1TW3 A;  1K83 J;  4N4O B;  3PIO F;  2PLY A;  4OIQ F;  2GXA A;  2LVS A;  3EET A;  3CP2 A;  5LEK A;  4A6D A;  3ERM A;  2E5N A;  2STW A;  1NH3 A;  1VQ9 I;  3LA2 A;  1H89 C;  5GTH C;  3EYI A;  2PMU A;  1SFK A;  3SZT A;  3S17 J;  3HOY J;  4CH7 A;  3I54 A;  2E60 A;  3HJE A;  1WJE A;  1LE8 A;  1ZLK A;  5DUI A;  2K9S A;  1R4N B;  1Y0N A;  3K4B A;  2GOX B;  5C4J J;  1P4W A;  3RIR A;  3S1N J;  5FFZ A;  3I4N J;  4BE2 A;  5DDG A;  2CFO A;  4G8X A;  1MNM C;  2ICW G;  5B66 C;  2MSY A;  3GCM A;  4X1E A;  1SAX A;  4K2E A;  2ZSI B;  1GVJ A;  3FXM A;  2L9R A;  4ESF A;  1G3Y A;  1VTN C;  3S1Q J;  4LOC A;  1TWF J;  4Y7N J;  3AG3 H;  3BG5 A;  2R92 J;  4L9N A;  5DUK A;  2A6T A;  5CKT A;  3G73 A;  5EG0 B;  3AG4 H;  1WJA A;  4RGU A;  4CYC B;  3FXU A;  4L9T A;  4N9H A;  1GXQ A;  4ENK A;  5E79 C;  4IVN A;  2XVC A;  2ZFW A;  4FT8 A;  5ILS A;  1AKH A;  2W00 A;  4UUT A;  1NG6 A;  4A69 C;  3MKZ A;  5BOX A;  2ZME C;  1IRF A;  3C7J A;  4HEA 2;  1JKR C;  4IHX A;  2BY0 A;  2K9Q A;  4B48 A;  3I59 A;  4D0P A;  1I1G A;  1XC5 A;  1XTA A;  3D5L A;  4ETS A;  1SMT A;  3RYP A;  2OU2 A;  1RRJ A;  2L7F P;  4IO9 F;  3K70 D;  3OYC A;  3HRM A;  2QEX I;  3H3V K;  3HUG B;  2LKP A;  3QP6 A;  1IAW A;  1WKM A;  3BJA A;  1SFO J;  1IRZ A;  5J40 A;  4F92 B;  1T08 B;  4J19 A;  1BR2 A;  3ZCO A;  3GZ6 A;  1VF9 A;  4RBO A;  3K4M A;  5LHG A;  1BIA A;  4O5V A;  4W97 A;  3SEZ A;  2CS3 A;  1Z67 A;  2PFB A;  4DGW B;  5ICC A;  2R7X A;  2CQN A;  2JRM A;  3TOB A;  5F0F A;  3OYH A;  2ISZ A;  5ICG A;  2M5W A;  4HV5 A;  2IEK A;  2A5W A;  2F5F A;  4A3M J;  2I8D A;  2EZK A;  4LGW A;  5CJ9 A;  3BZ6 A;  3CES A;  1B6A A;  4MEX F;  2DT5 A;  4RAY A;  2BOL A;  1JJ6 C;  2H09 A;  2W57 A;  3E97 A;  3N4M A;  3GXO A;  3S15 J;  1HST A;  1QZZ A;  1X4P A;  1IDZ A;  4PFO A;  2BZT A;  3DKY A;  2IGM A;  1P92 A;  3ZOB A;  3KIO A;  5EJC A;  3PNV A;  2PMH A;  4PJJ A;  1J2X A;  2HQ5 A;  2KRC A;  3FX3 A;  3FXO A;  2FE3 A;  3SYT A;  3VOE A;  1MBH A;  2MG4 A;  4FCY A;  2XGE A;  4PFP A;  3VSK A;  3OYB A;  1B59 A;  2MD0 A;  2MFZ A;  2DJI A;  3VYT B;  4CHU A;  4O6J A;  4PJL A;  4BGD A;  3K4N A;  1J75 A;  1VND A;  2BXY A;  1GUU A;  4HV6 A;  2F48 A;  2X51 A;  2X1E A;  4LLL A;  1W4M A;  3IHU A;  1SFX A;  3LL7 A;  2XAU A;  3LMM A;  5DS9 A;  2VQC A;  2DYR H;  3FF5 A;  2DK5 A;  1MBG A;  5IT3 A;  4L5J A;  4XRM A;  1VQ4 I;  1F1Z A;  2R7D A;  4G12 A;  4XKC A;  4CO8 A;  4XR6 A;  4A12 A;  3BQY A;  4CXF A;  2OBP A;  3FHZ A;  1G6N A;  1Z21 A;  2VN2 A;  3K0L A;  1D8J A;  1I6X A;  3IWZ A;  4XLN F;  3SZG A;  4ZYG A;  3HDD A;  1R1U A;  4DYQ A;  4AU7 A;  5HNF A;  1JTY A;  5IP6 A;  1WI9 A;  2KPM A;  1I27 A;  3EUH C;  2BVL A;  4B47 A;  4F7Z A;  1NG7 A;  1WQ2 A;  1VFC A;  4KIF A;  2L7Z A;  1ETX A;  2H27 A;  4D9J A;  2GXG A;  2CG4 A;  1YOV B;  4C30 A;  5IP7 J;  1HA8 A;  1UG0 A;  3JRI A;  1V5G A;  3QYF A;  2QQB A;  3G1M A;  4LK0 F;  5TGT A;  4FAS D;  2R93 J;  2XPW A;  3C3W A;  2CV0 A;  2QQ8 A;  1T98 A;  3VWB A;  4EGY A;  2E1M B;  1A6I A;  2H8R A;  3HOU J;  1BOA A;  1RC9 A;  2BE5 F;  5JVT A;  1XSX A;  2DTR A;  2LSO A;  1K78 B;  2Q0O A;  4B3A A;  1R6R A;  4P9F A;  2Y48 A;  2XUB A;  2K4J A;  4P55 A;  4IX7 A;  3QU3 A;  1BI0 A;  3H5A A;  3R4K A;  1DDN A;  1UZC A;  2L2O A;  2VB6 A;  2K9M A;  1WJ5 A;  1L3L A;  3GTK J;  3BZK A;  5J4Y A;  2M0C A;  1KZH A;  3DKX A;  3WTT C;  2VBZ A;  3HTS B;  2IGN A;  4I98 B;  4KUM A;  1JGG A;  2OTJ I;  1XSD A;  4DZP A;  4QIW N;  2DQL A;  3CJR B;  5BMZ A;  2DW4 A;  2LDU A;  1BJA A;  3I56 I;  3TO9 A;  3I4M J;  2O8K A;  3BG9 A;  5E17 F;  2PEX A;  5E1X A;  2GIZ A;  1S6L A;  1OKR A;  4QPQ A;  1O7F A;  3GX4 X;  3IRR A;  3RKW A;  2QLZ A;  2AO9 A;  3T8R A;  4RAZ A;  2M45 A;  5HOD A;  2X1D A;  5K1Y A;  3QYE A;  4HLY A;  4H4K C;  2IXS A;  2OD5 A;  3RKY A;  2IT0 A;  1Z6T A;  2OF7 A;  5CQG A;  2GA1 A;  1K6O A;  3KYL A;  1EA3 A;  1X2N A;  3OMY A;  2A6E F;  1ZKG A;  2VE9 A;  1WI3 A;  1U6G A;  2VE8 A;  2XRL A;  3BR0 A;  3PO2 J;  1O3Q A;  3P9C A;  3K6G A;  4Q48 A;  1UHW A;  1VQ5 I;  1QHG A;  2XAF A;  3L2Q A;  1RIO H;  4GO1 A;  2XAJ A;  1OR7 C;  2OCE A;  4CZZ A;  2FNA A;  2VJ4 A;  4BJT A;  2W85 A;  4FX0 A;  1K4S A;  1AKH B;  3MZY A;  3GBG A;  2JN6 A;  3FK6 A;  2LLK A;  1LEA A;  4M71 A;  2QF7 A;  1MNE A;  1KYW A;  4OIN F;  4I01 A;  1SC7 A;  1WJD A;  4N9I A;  1LDK B;  4KN4 X;  3ERE D;  2LKS A;  3BZC A;  1IN5 A;  1Z3Y A;  3GFI A;  1FNN A;  3DEE A;  4AWX B;  4HF2 A;  4XK4 A;  3ASO H;  3QOP A;  4XL9 A;  3HM5 A;  3GTG J;  3MQ0 A;  1YG2 A;  3RZO J;  4C2U A;  2JA8 J;  4MGR A;  1SAN A;  2MLG A;  5E20 A;  4HDU A;  1SD7 A;  3Q0V A;  1IUF A;  2NRA C;  4CGZ A;  1XD7 A;  3HGG A;  3BR5 A;  3FXQ A;  3AL0 C;  2FSW A;  4Y33 A;  2DN0 A;  1O3R A;  3E1S A;  4AM3 A;  5LRS A;  2B9S A;  1RR8 C;  2YUS A;  3M8J A;  3OYI A;  5L3C A;  2JTV A;  2Y0S A;  2IRF G;  1FBS A;  2AQE A;  3GZ5 A;  2DFF A;  2X6Y A;  1OCP A;  2K86 A;  3BT9 A;  3TO7 A;  1T8I A;  4XKB A;  4I0B A;  2LRD A;  2QKM B;  3OYG A;  3G1O A;  2MA3 A;  4G6Q A;  4BAC A;  1YYV A;  3PFY A;  2RRE A;  2LR8 A;  3N97 A;  2ZXI A;  2VQG A;  1UEL B;  2H1L A;  2EFO A;  2LYC A;  1M1E B;  1MH4 A;  3S8P A;  1ZR4 A;  4DJA A;  3Q0W A;  3H92 A;  1R5I D;  2P6T A;  1VQN I;  4NC8 A;  1R22 A;  3HXL A;  1TWA J;  5HLG A;  1FX7 A;  3QYB A;  4NC7 A;  5HLH A;  3S1R J;  3ZPL A;  5F64 A;  1RKW A;  5DYM A;  1ZGA A;  1MW7 A;  4M3G A;  4HOB A;  2ID3 A;  2VQL A;  3LA3 A;  1YS6 A;  2IBD A;  3H9G A;  2FBI A;  3DU6 A;  3SQN A;  5D5X B;  4PUS A;  1ITY A;  2DT6 A;  2YX4 A;  4FE7 A;  1IV6 A;  2D2W A;  3RKX A;  4G6T B;  3WTY C;  5LGN A;  3G6E I;  3ZMS A;  2IGK A;  2VBW A;  4L0Z B;  1W7P A;  2P5V A;  2V26 A;  2EFW A;  1ON1 A;  1GHC A;  5DCM B;  1PP7 U;  2MGQ A;  4LG0 A;  1SAU A;  2XB5 A;  3U2R A;  3KZY A;  4PGG A;  4V19 K;  2XSD C;  3CUO A;  3K2Z A;  4DIQ A;  3U9G A;  2A5Y B;  3HHH A;  3PL8 A;  1WH5 A;  3OIP A;  3G2B A;  1W0U A;  3HGY A;  3MWM A;  4ZZD A;  2E35 A;  4D5F A;  4XIC A;  1YS7 A;  1ACI A;  3J81 K;  3KX2 A;  3ABT A;  2XKO A;  3FXR A;  1PP8 F;  1Y6I A;  1DP3 A;  2J5O A;  2VPL A;  4N4N B;  2DMT A;  2EWN A;  3A02 A;  2BW3 B;  3TBI A;  1SVM A;  2HKX A;  2BV6 A;  4KT5 C;  5IYB J;  3PJR A;  1VZ0 A;  4BE1 A;  5L3B A;  4I99 C;  2DXI A;  1MJA A;  5HNH A;  5KNL A;  2ZJR F;  3GUD A;  5HVQ C;  5CQE A;  5F0H A;  4O3M A;  2IW5 A;  1BI3 A;  5BPD A;  4X0G A;  2PJR A;  2OV7 A;  2OZU A;  1KON A;  2JA2 A;  2MBF A;  4HQE A;  3CCQ I;  1RZ4 A;  5FD5 A;  5HOO A;  3LA7 A;  2Q2E A;  1LJ9 A;  3Q0U A;  4UVA A;  1IF1 A;  4BJ6 C;  1U0J A;  2X4H A;  1E2X A;  1I1S A;  4UY8 I;  2B0L A;  1OCR H;  4MTE A;  2ZCW A;  1N77 A;  4MIM A;  2ECB A;  4ESJ A;  2PG4 A;  1FBU A;  4A0Z A;  3OWT A;  4BDZ A;  1IXC A;  4HYE A;  2DOD A;  2ELH A;  4BXU A;  4CCM A;  5B1B H;  3O2P E;  4BAY A;  2LY1 A;  2M3A A;  2HYG D;  3I55 I;  2B7E A;  3RCO A;  3WU2 C;  2RKH A;  2XGD A;  3HEF A;  5JLW A;  3BDD A;  2G9W A;  2VL8 A;  1VQL I;  4NNJ A;  4J01 A;  2DA6 A;  1TZL A;  2DFH A;  3CMA I;  2O8X A;  1X1B A;  4XM3 A;  2XAQ A;  3J7A Y;  4U0W A;  2Q1Z B;  1DGR M;  4EAT A;  1IGN A;  2ZXW H;  2M8G X;  5M3M J;  3K10 A;  5F08 A;  4B43 A;  1V5F A;  2L9S A;  5E18 F;  4NC6 A;  3R61 A;  4Q5S F;  1U9O A;  1OYY A;  1IN7 A;  1ETY A;  3MZH A;  3NQO A;  2DT7 B;  2XDV A;  4AVZ A;  1X3Z B;  1KA8 A;  3F6V A;  4IF4 A;  2F2E A;  2FNP A;  3L7W A;  1HOM A;  3MFK A;  2HDW A;  1OMI A;  1ZEL A;  3GTL J;  2KIU A;  3BCA A;  3WTV C;  4TV7 A;  3CME I;  4BY1 J;  2ISY A;  3LST A;  3EYY A;  1LFU P;  2XPV A;  2ZNZ A;  3W6V A;  2FOW A;  4I7H A;  3TP3 A;  3VDX A;  2WY8 Q;  1Z77 A;  2AXL A;  2QCO A;  4XRS G;  4MHG A;  3HPH A;  4IRH A;  3VYR B;  4B3X A;  2E71 A;  1GVD A;  1S7E A;  5F1R A;  4IZZ A;  3RZD J;  3DFG A;  1T39 A;  3LSK A;  1PDN C;  2DA7 A;  1FIP A;  4EJV A;  3J80 Z;  1I6H J;  3EQL F;  3EPZ A;  5FLM J;  1IXR C;  4S05 A;  1ONV A;  2ZME A;  5IYC J;  4G7Z F;  5CVJ A;  2P4W A;  4YFK F;  1JI8 A;  5K7Z A;  2I10 A;  4PCQ A;  1UHS A;  4XID A;  2EPF A;  2L01 A;  3M7G A;  5CPR B;  3RQ4 A;  3F9K A;  1S8N A;  4M72 A;  4IOC F;  2DDB A;  1R71 A;  4E7S A;  5DD8 A;  3D5S C;  1XSV A;  4ITV A;  2ZB9 A;  4JX6 A;  2L5Q A;  3L1P A;  5K7F A;  4YFX F;  3LSJ A;  3KP4 A;  5KCM A;  2Y0S N;  1USS A;  3HBL A;  1QPM A;  3T8T A;  3KYD B;  4A3L J;  1UB9 A;  1LEB A;  2A69 F;  3DXJ F;  1ZRD A;  3KP2 A;  4CCK A;  3NEU A;  4FHT A;  5BNG A;  1D1B A;  2LC2 A;  5E8I A;  3GTJ J;  2X85 A;  2KMU A;  2E1M C;  2L7M P;  3SDB A;  2HFH A;  2EV0 A;  3ZN0 A;  2JT1 A;  1XGM A;  3GF2 A;  3FBI B;  2BYV E;  4A3D J;  1YLF A;  2V6E A;  1I5Z A;  4CYD A;  2NVU B;  1G8X A;  2O5R A;  5E3O A;  1MKM A;  4DNC A;  2R7W A;  3OR2 C;  4A3J J;  1XS9 A;  4GDF A;  4KA4 A;  3TW6 A;  3H9Q A;  1MZB A;  4CSW A;  2HPI A;  4LLG F;  2FEZ A;  3M1C A;  5EYR A;  2WTE A;  1ZRC A;  3K69 A;  1JGS A;  5AIP A;  2JVG A;  4FE4 A;  3BRO A;  3FDY A;  4QWQ A;  2DBB A;  2NOJ B;  1KU7 A;  1OPC A;  1QZE A;  3LSH A;  2A07 F;  2V4J C;  3VEP A;  5LHI A;  1REP C;  1QU3 A;  2JRT A;  1Y1W J;  3C1D A;  1IV8 A;  4L5I A;  2UWM A;  3K9T A;  4BHC A;  1ODD A;  4E7K A;  4ENM A;  2IS2 A;  4G94 A;  3TDU C;  2OA4 A;  3HRU A;  1FYK A;  5CVV A;  1YX5 A;  3LSM A;  2R7T A;  3ZR8 X;  2NS7 A;  5CVR A;  1WCM J;  2CQX A;  4A0X A;  2NVQ J;  4ZJZ A;  1SD5 A;  4BEH B;  3ELK A;  3TOA A;  3RPU D;  5D6F A;  1W36 D;  3OOP A;  1HDP A;  2P0W A;  3QPH A;  4BQO A;  3L9F A;  3P5J A;  4KIC A;  2JQ7 A;  3KP7 A;  3GFL A;  1Z1D A;  3IV5 A;  3BLY A;  3ZMT A;  3W6J B;  4UUS A;  5BS6 A;  3BQZ A; 
#chains in the Genus database with same CATH homology
 2NXN B;  3PIP F;  1VQO I;  3CCU I;  1VQ4 I;  3G71 I;  4V19 K;  1VQ6 I;  3CMA I;  4UY8 I;  2ZJP F;  3CD6 I;  1VQ9 I;  1MMS A;  2OTL I;  5DM6 F;  2E34 A;  1FOW A;  3I56 I;  1VQ5 I;  1Y39 A;  3CME I;  3CCJ I;  5DM7 F;  3CCM I;  2K3F A;  3DLL F;  3CF5 F;  1FOX A;  1YJN I;  1VQK I;  4IO9 F;  1HC8 A;  2H8W A;  2ZJR F;  1FOY A;  2QEX I;  3CCE I;  4IOC F;  2E35 A;  1YHQ I;  1YI2 I;  1S72 I;  3CCS I;  5GAD J;  1VQ7 I;  1ACI A;  2FOW A;  3CCR I;  3G4S I;  1YIJ I;  3G6E I;  3CCL I;  2JQ7 A;  2QA4 I;  1YIT I;  2ZJQ F;  5GAG J;  1YJ9 I;  1VQN I;  2E36 A;  1VQM I;  3CCQ I;  3I55 I;  1VQ8 I;  3CC7 I;  2OTJ I;  5GAE J;  3CJT B;  3CC4 I;  4IOA F;  5JVG F;  1VQP I;  3J7Z I;  3CCV I;  3CC2 I;  3PIO F;  5GAH J;  1YJW I;  1QA6 A;  3J7Y J;  1VQL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...