1VQNI

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqnI00
3CMAI 2E34A 3G71I 5DM6F 3J7YJ 3CCEI 5JVGF 1VQLI 3I55I 1YJWI 1QA6A 1VQMI 1YJNI 3CJTB 1S72I 3PIOF 2QEXI 1HC8A 3CCJI 3CMEI 2NXNB 3CCLI 2OTJI 4UY8I 3CC2I 1VQPI 2JQ7A 2OTLI 1Y39A 1YJ9I 5GADJ 3G6EI 1VQ7I 3J7ZI 1VQ8I 3CD6I 1MMSA 5GAGJ 1VQ5I 1VQ4I 2E35A 1VQNI 3CCSI 5GAHJ 2ZJPF 5GAEJ 1VQKI 2E36A 3CC4I 1YITI 2QA4I 1YI2I 3CCVI 1ACIA 3CCQI 4V19K 2ZJQF 1FOXA 4IO9F 1VQ9I 3DLLF 1FOWA 2FOWA 1YIJI 3CF5F 2H8WA 1YHQI 1VQOI 4IOCF 4IOAF 3PIPF 3CCMI 1VQ6I 3CCRI 3CCUI 1FOYA 3G4SI 2ZJRF 5DM7F 2K3FA 3I56I 3CC7I
chains in the Genus database with same CATH superfamily
2KHMA 4A3KJ 2VQHA 1TLHB 3CDIA 3QOEA 4Y4RA 4M9XA 2X48A 4M72A 1OYWA 3I3LA 4HF0A 5LEJA 2BXYA 2LY1A 2R7ZJ 2VPRA 1B8IB 5J1YA 2VE8A 1TNSA 3ZXSA 5FO5A 3H5RA 4MQVA 1S72I 5HLTA 4RAGA 2PJRB 4FE7A 4NBQA 3GTJJ 4BE0A 2A68F 2E5ZA 2V6CA 1SFUA 3V42A 2LC2A 4L5IA 3RPUA 3FIWA 1SEUA 1F43A 3KP7A 5E3MA 4S04A 4BQNA 1Y8QB 4FE4A 1NK3P 4DGWB 1UB9A 1HQCA 1EH8A 4BL0B 1R49A 2OTLI 2NYXA 3DPLC 1XB4A 4LOCA 1QNTA 3VEPA 4HQEA 2HKXA 4E7JA 2ZXHA 3FX3A 1BL0A 4IHXA 3LSIA 5A2QK 2O8KA 2HZTA 2M8EA 4J01A 5GAHJ 3HOUJ 4EV0A 4Y13A 2ZJPF 3TGNA 3U9GA 3TEDA 4HA8A 2QWWA 1Q1VA 3AG2H 2E36A 2VI6A 1YITI 1R1VA 3JAMZ 3IUOA 2QA4I 4IKFA 1PYVA 3NWTA 2HOSA 4A3JJ 5LGNA 2F4IA 4I01A 2Z16A 1GVJA 3BROA 3V4GA 2A6TA 3LL7A 1LVKA 5GPAA 5LHIA 2X51A 2CFOA 3P9KA 1Y56A 2FD5A 3MZYA 2YX4A 1KGSA 3S1RJ 1UHSA 2DQRA 4QLCU 2R4GA 2Y0SA 3BJOA 1DP7P 2HQNA 5M5YJ 4A0XA 3HXLA 3WTZA 2R92J 3JCUC 2F4MB 2GZWA 2NS0A 3I53A 1HCRA 1YQAA 2DXIA 4JP0A 3NAUA 5JI6A 3CESA 4HG2A 3M7GA 1B72A 3T5XA 2KDZA 2MGQA 3ZMTA 2AQFA 3F8MA 2LG4A 4G6DA 1MJ9A 1PUFA 1O7LA 1OJLA 3OSFA 3BCBA 1QZZA 4MFEA 3WTYC 3O8HA 1WH5A 4IRHA 3G73A 2HR3A 3HOZJ 2KRFA 4UUSA 4XLAA 4RBOA 1OYIA 1R4NB 2YX7A 2BE5F 3DBRB 2JPBA 2XGCA 1YJNI 1WHUA 4U87A 3PNVA 2OC6A 1R5GA 2KJCA 1IN4A 4L5JA 2AS5F 2KKOA 3HUGB 4CH7A 2DPDA 4IQJA 1R7JA 3K4KA 4YIIA 4F52A 3EYYA 5CVVA 3UKGA 1LKXA 1IO2A 3KP4A 3KFWX 3LMMA 5EG0B 3M4OJ 1GVDA 3BP8A 4KN4X 3IH4A 3L2UA 5HS7A 5FB2A 2HOAA 3I64A 2GXGA 1MMSA 2IXSA 2EJRA 1E3PA 5ILSA 2WWYA 4LG3A 2KPMA 2ECCA 1BC8C 1IRFA 4X1EA 3S3OA 5D4SA 3J7AY 5E18F 1J0RA 2E7WA 1P9QC 2CQ7A 5E8GA 2XF7A 2PN6A 2STTA 1HKSA 1SANA 1BW5A 1FTTA 1IRZA 2HGCA 4CGZA 4QIWN 3RJPA 4U7DA 2I10A 2Z3YA 4O3MA 4HW0A 2VKEA 2KMUA 4Y52J 2QQ8A 3E0JB 5DTDA 3VYSB 1NG6A 2OBPA 1ITYA 4I0BA 3SQNA 5IP7J 1X1CA 3GZNB 4IXAA 2V9KA 4LD5A 2QENA 5AIPA 5L3EA 1A6IA 2UV1A 2HOEA 1F5TA 2Y30A 2FOWA 2B9SA 4A3DJ 3CF5F 2KRHA 4XKVA 3BZKA 3DEWA 4UV9A 2PX9A 3OYJA 3PFYA 1BR4A 1FC3A 1OCRH 3RKYA 1EV7A 4PGGA 5K5QA 2ZFWA 2VXDA 3E6BA 3FHNA 2HDCA 3ZPLA 4L9JA 5B1AH 3HDDA 1JJ6C 2P81A 1O3TA 2DI3A 3TKYA 3OV8A 1USSA 2D1HA 3E6MA 3L09A 3HBLA 3H36A 4A0YA 2DOFA 2W4SA 4RDUA 3KP6A 1REPC 2BY2A 2KZGA 2LLKA 1U0JA 5D4RA 3HM5A 2NS8A 2WA0A 2WAQA 5LFAA 4DQ2A 1K78B 2R7WA 2CW0F 2F5FA 1MSEC 4E70A 3ZP5A 1AKHB 4EM2A 3GFMA 3OIPA 2L9SA 2A07F 2A6EF 5L3FA 2DTRA 2M0CA 3HOTA 4KT5C 2QEXI 2Z9OA 4CCLA 5M5XJ 1UAAA 3ZQIA 2STWA 1PJRA 1IDYA 2KIQA 3QAHA 1STZA 3KLNA 3JRHA 3I5UA 3BPXA 2H6BA 4YFNF 3QODA 2MW8A 4OIOF 2X6XA 3HOSA 3BJAA 4LITA 1TT5B 1W1WE 3JTHA 3PO2J 2JRTA 1H9TA 1LUJB 2JT1A 4PJJA 1D3YA 1IN6A 2XPUA 2XKPA 3ZMDA 1O3RA 3TL4X 2ELKA 2H09A 5EEHA 5KVRA 4F91B 4EJUA 4C3IJ 1RZ4A 2LD5A 4ZDPA 5IYBJ 1J59A 4B09A 3K4NA 2XB0X 3VB2A 3JRGA 1XC5A 3TMOA 4L18B 2GOMA 3ESWB 1SD4A 1WCMJ 2CO5A 2XB5A 3GLXA 3JSPA 4FX4A 4DZPA 2QKLB 2P5KA 2KIUA 4GGGA 2BHZA 2CU7A 2HYGD 4G94A 1HF0A 4XM3A 1B4AA 1HBXG 1FNNA 3HKZN 2R7RA 2P6SA 2DFFA 2V9PA 1OYYA 1X3ZB 2DA6A 2HKOA 2LDUA 3CCQI 4WK8F 4FX0A 2ZJQF 4L9VA 2EIMH 4U88A 2R7SA 1JGSA 1SMTA 4WWCA 1OPCA 3ECHA 2R7VA 4M6YA 5E1ZB 4Q4ZF 4ZZLA 1LDKB 3D5SC 3H9GA 1FYKA 1J09A 5IT9K 4XQFA 1FYLA 2RDPA 1AHDP 4ZTJA 4M73A 3REOA 3A2KA 3H0GJ 4NC7A 2KJBA 3CP2A 2XDVA 1KZHA 3ZQHA 3ZMSA 1IV6A 1QVUA 3I9V2 4IHTA 2EA4A 1WPKA 2LYCA 2X9DA 1USTA 4HZFA 4IRGA 3OL3A 2K4JA 4EGYA 5FKOA 2FNPA 3W6JB 1T2KA 4S0HB 3T1BA 1GXPA 3BG3A 3P5JA 5FLMJ 2DK5A 1X3UA 4L5EA 2OQRA 4RM3A 5HLIA 5IOZA 4YRVA 3I56I 2RGVA 4UVCA 4ENKA 4X6AJ 3CZ6A 4PGHA 4MO7A 1MIJA 1HW5A 5EYRA 2VQLA 2ZBKA 2E34A 3ZQ7A 3M8JA 1SMYF 4JOMA 1LVAA 4C3HJ 3FM5A 2VASA 1BJZA 4PJNA 4AC0A 1IV8A 4IHYA 1P2FA 4PSWA 5F1RA 1POGA 2DBBA 2OF7A 1H89C 5DDGA 2NNNA 3LFKA 2VC0A 5LLQA 1TW2A 1QO0D 2LBFA 3A0HC 3G3ZA 2A6HF 3K4MA 3U21A 3S2DJ 3HEFA 3CJQB 3O2PE 1HSJA 5LGUA 2FNAA 1K6OA 1TWCJ 3H9JA 2E2JJ 1E3HA 1V5EA 1TWHJ 3OYMA 1PP7U 1SD5A 4UY8I 3IRRA 1WKMA 4M6VA 1VQPI 3EDPA 2VC1A 3OMYA 2P7CB 1V3FA 2E19A 4XLNF 3DBHB 4QWQA 3V8KA 2A3SA 3OYIA 5HOOA 2IS6A 3GUDA 5E3LA 3J80Z 2ZJ2A 5GADJ 2E2IJ 4G7OF 3DPUA 2OAZA 1QHGA 3PJRA 2VJ5A 1TW3A 1XN7A 1G3TA 1XGOA 4Z6YA 2IP2A 4UVAA 2DW4A 3H3VK 3MEXA 3D1NI 2IBDA 1HW2A 3JTGA 3FMSA 3N05A 4B47A 1W5CC 2HDWA 4G7ZF 4FISA 4LK1F 3LFUA 2ZMEB 4XKBA 1X58A 4EMSA 2JA2A 2M4KA 3QP5A 2OQGA 1LDJA 1BM9A 1KYWA 2Z1DA 5JR3A 2PG4A 3X2QH 2QQ9A 4ZJZA 5ED4A 1AU7A 2QGUA 4RGRA 2BVMA 4WCGA 4HV5A 1W5SA 3MD2A 2M87A 3TQNA 1JKPC 2R7XA 3ZMZA 1WVRA 4FASD 4O5VA 4Y15A 3QYEA 3HOXJ 3GTLJ 2O61A 4AIJA 2DFHA 4IJAA 5IP6A 2HPIA 3VYRB 2HQ5A 1AA7A 4QPQA 2NRAC 2GOXB 4BBRJ 1UG0A 2HS5A 2BYVE 1JHHA 3GZ6A 1SFEA 2CJJA 2FOKA 1I6XA 3HB9A 2HXIA 3F23A 4IPAA 3K4CA 4NNJA 4CSWA 1U3EM 3L2RA 1FOYA 1J9IA 2OUMA 3W3CA 3S32A 3I59B 5LBQA 5AONA 1FTZA 4KN7X 3G4SI 1F4KA 2CQQA 3DKWA 3ZGKA 2L01A 2K3FA 3KEOA 5FFXA 1ZGWA 1J5YA 2FE3A 2DMPA 4KA4A 3DWLE 5TGTA 1P4AA 2DA4A 4II3A 1QPIA 1R4MB 4E7HA 4MHGA 3FXOA 4BQOA 4EEFG 1LQ1A 2O8XA 5FKNA 4A12A 2RC4A 1MMAA 2ID3A 4B8XA 2DA5A 3ZQQA 1AWCA 5J3LA 2IGMA 4KIGA 3M8EA 2CW8A 2DA7A 2W85A 1MMDA 3A02A 5J6XA 1IUYA 2L9VA 3LSRA 5FJ8J 1I5ZA 5HLGA 2L9RA 5F04A 4NC6A 2JA5J 2D45A 5J1RA 4WXDA 2HI3A 5E79C 4EVIA 1P4XA 3ABLH 5DUKA 2XSJC 3IWZA 2LRDA 3WGIA 3PNTA 4B1RA 1XMKA 5HLHA 1QQIA 3BJ6A 5D6FA 5BQTA 5D5WB 1DPUA 3IHUA 2H8RA 2V1DA 2DMUA 1Y1WJ 4KIBA 4ITVA 1YIOA 5EGOA 1JT0A 1MMGA 4L0YB 1S6LA 4P5OA 1N78A 3AG3H 2M5WA 1HKTA 3IWFA 2DT5A 1RR7A 3ERED 1GXQA 3KLOA 2BBYA 2KISA 2IAIA 2RREA 3C7JA 4QPOA 5C44J 3CJNA 2BXZA 4BQQA 4XBFA 3HJEA 2DPUA 3I4PA 2JA6J 1YI2I 2WB1A 1JKRC 1UELB 2ZC2A 2NVYJ 1BIAA 2GM4A 2L7FP 3L1PA 4ESBA 2QF7A 1FOXA 1OKRA 2EQRA 1KYZA 3ZQLA 1VQ9I 2LREA 3JAMK 3MKYB 3WTSC 2PMHA 4RAYA 1EJ9A 2IRFG 1PVEA 2UZKA 2QCOA 4XN3A 5J1UA 4BEHA 5LRSA 3LOCA 4BKXA 3ONQA 2EFPA 3PSFA 2QQAA 4YIFA 4HSTA 3TDZC 3GF2A 3CQZJ 2NVTJ 2RN7A 3E97A 2Z5UA 1FSHA 1APLC 4EGZA 3MZHA 4AIDA 3ABKH 2CW7A 2DMTA 4XRSA 2VT2A 3L00A 4YG2F 2DMQA 2EINH 1ZK8A 2ZNZA 2FSWA 5E20A 1B72B 3S14J 1FLIA 3RIRA 3DFGA 1Z21A 3I4MJ 3S15J 3D0SA 3Q9SA 3HTSB 3FZVA 5TISC 1R9TJ 4E7ZA 1ON1A 5F1JA 3EUHC 2HPMA 5DCFA 2L9NA 2EV5A 3ECOA 4G7HF 1YJWI 1V5FA 1LNWA 3IC7A 4Y7NJ 1U8RA 3OYEA 4HF2A 3VPRA 1LJ9A 2E1MB 4XICA 2XSDC 2FF4A 1XGMA 5CPRB 4RB2C 2QZ8A 1ORKA 2D1VA 2BY3A 3SEZA 4HV6A 2X6WA 3GX4X 4QSHA 2XGEA 2K9MA 2JPCA 3FXKA 1SFKA 3VYUB 5H6QA 2K9LA 2CV1A 5CQGA 3Q0UA 4CCKA 1S8NA 2NS7A 2Q1ZB 3FK7A 5CVUA 3H92A 4EJWA 1FIAA 3K1PA 4HBLA 5J40A 5B66C 5CLSA 4E4HA 4HOBA 3MWMA 3UNGC 1N77A 1YS7A 1A31A 2QM3A 1K6YA 3OYDA 2DFEA 3OOPA 1ETKA 4JX4A 5GAGJ 1KA8A 1KONA 2R7QA 4P55A 3O6BB 1MBHA 2Y0SN 1D0ZA 4DNCA 1XDSA 1HXDA 5C3EJ 1R00A 4AUXA 3DTEA 5D5XB 3Q0VA 3HTUA 2PMZA 5GAEJ 5K1YA 1ZRDA 2FXAA 1HSTA 1EA3A 2C6YA 1S7EA 2EPFA 2IJLA 3SEQA 1FJLA 1YRNB 4ZYEA 3WTWC 3PNYA 2LMDA 1IC8A 3A4CA 2HVSA 1RUNA 1ACIA 3KYDB 3EUHA 3K2ZA 1P7IA 1U5TB 4XLEA 2H1LA 2GAUA 2G0EA 4NUBA 3BT9A 4XRFA 1EKEA 3DLLF 4ESJA 3FK6A 3OSGA 1TL8A 5FRMA 5E17F 1MW7A 2DOEA 4L9NA 3OYNA 1K4SA 3SFZA 1UFMA 1YHQI 3H35A 4MLOA 4GO1A 1IGNA 1KU9A 4CYCB 2VPLA 3LSPA 2E1OA 3IAS2 2JJ7A 4OU0A 4Y3OA 4LG0A 3RYRA 4U0YA 2WADA 2H94A 4LMYA 1O7FA 1WJEA 2Q2EB 1HA8A 3WE2A 2VOPA 3S1MJ 3FKIJ 1X1DA 4UB6C 4XRSG 5H2FC 5DCMA 4LLLA 3CUQB 1XMAA 1P92A 1H0MA 5DM7F 2DCEA 1RIOH 3SZGA 4MEXF 3WTVC 3ISPA 1A35A 3CC7I 1MZBA 3FXQA 3HIFA 1I27A 5GPCA 2ETHA 4MFDA 5ICFA 5DM6F 2XPVA 3H9QA 1UMQA 2PEXA 3PM1A 4EM1A 4YFXF 4OMYA 3DKYA 2GXBA 4I99C 2QBYB 1GUUA 3A03A 2JA8J 2IGNA 1U2WA 2X0LA 2ISYA 2KT0A 4EATA 4RA2A 3C18A 1MJAA 1YW7A 2MC4A 1JXSA 1SAUA 1XD7A 2ESNA 2VJJA 4W97A 4AIKA 1JKOC 2W00A 3H1CA 3HHGA 2DMNA 2W82A 4ZH4F 1W5TA 1VTNC 1FT9A 2OPTA 4HNTA 2F48A 5IP9J 1RC9A 4BH9A 3F8CA 4ZZDA 2ZNYA 1P7JA 3P9IA 2XAJA 5JLXA 1Y39A 2H27A 2QSFX 3LSMA 1YJ9I 4IF4A 3MN2A 2JUCA 1ZR4A 1E2XA 4N0BA 3RQIA 1JHFA 2CS3A 3DU5A 2R5ZB 3VYTB 1R71A 3QYFA 4XL9A 2R7UA 2N8GA 1MDMB 3AAFA 3FXUA 4PUSA 5HNFA 4DBQA 3UR3C 4P9UA 3GXOA 3GBGA 2CGPA 4KUMA 3OR2C 4B43A 4A2UA 1DP3A 3BPVA 2XF5A 4ZYGA 2R7TA 2CQNA 2EB7A 1SAXA 2Z33A 1R6RA 3IRQA 5FLXZ 1YS6A 4CCOA 4C2MJ 1DGRM 3F3XA 3ZQGA 3A01B 4BDYA 2L3DA 2CUJA 4RS8A 5J4VA 3M8FA 4E7KA 2VXZA 4GRIA 2WAQN 3EQLF 3Q9VA 2EZLA 2K86A 3S3MA 4IHWA 2MG4A 4N9IA 2MC3A 2ADUA 3B02A 2PJRA 3FWEA 5DD4A 1OCOH 4RLQA 3E5XA 1B9MA 2BGCA 3GFJA 1K79A 4KFCA 1MNDA 3ERMA 1J75A 3AG1H 1NTCA 3K2AA 3DKXA 2XHKA 5EDNA 2DYSH 2HQRA 5JLWA 2DA1A 3K6GA 6PAXA 3AL0C 2ECBA 3KPHA 3QP6A 2OCCH 3CLOA 2M2EA 3ASNH 2P5VA 5L3BA 4FCYA 5E3OA 2M9HA 2X1CA 3OS1A 4PFPA 2DT7B 4D5CA 4BY7J 2F6CA 1Y1VJ 5LD2C 1C0WA 2MD0A 1OISA 2CSOA 2FEZA 1BI2A 2BW3A 5LHHA 4BJ6C 5DEQA 2VKVA 3PIOF 3R60A 4KNYA 1KQ0A 1RESA 3TOBA 2HVRA 1A6QA 4L0ZB 1X4OA 2NXNB 2GBYA 2LBFB 3IKTA 1HKQA 1SD6A 2LNBA 1ONVA 3DXJF 4HNUA 5JFRA 2Q8KA 4E7LA 4EQQA 3FXLA 4Z2YA 3RDIA 2R5YB 4CCNA 3OYFA 1BC7C 2WTEA 1CF7B 4I76A 1OCCH 3NWSA 2I8DA 2DDBA 4CA0A 4A3IJ 1ETXA 1GHCA 1JUSA 4Y17A 1MBJA 1ZN2A 4LB6B 3S8PA 1YFHA 3BOQA 4B3XA 2DAOA 2H1KA 4A3LJ 3RZDJ 3QQAA 4E6KG 4R8HA 1O3QA 5L3DA 2VN2A 3HOWJ 3KP5A 3J80K 2JVHA 5IPAA 3MZ8A 3VODA 4J00A 3CCSI 5BPIA 4D1QA 1F36A 3V7SA 2QSHX 1E0EA 5HODA 5D8KB 5GP9A 2K9NA 1T39A 2YPRA 4L9TA 1W7PB 4U0VA 2ACJA 3FMQA 2XAFA 2Q0OA 1MBFA 3PO3J 4II2A 3F22A 3M1EA 4OIQF 5FFZA 3FHZA 3BR5A 1FZPB 2R7OA 2JTVA 1I1SA 2HEOA 1W0UA 1RETA 2M7BA 1LEAA 3PFIA 1A36A 4XLFA 3LWFA 1XPXA 3GZ5A 1R1UA 2JRMA 3DTKA 2EIJH 3EPZA 2HU9A 2EIKH 1T33A 4CICA 1JE8A 2XVCA 2DTZA 3KEYA 2W25A 2M8GX 4DJAA 4BS9A 4AWXB 2XAQA 2AO9A 2R93J 3NRVA 5FD5A 1NG7A 2HXOA 4PFOA 1G6NA 1RKTA 2XPWA 1W36D 2AXTC 4GFBA 3CDHA 4LJZF 3S1NJ 2ZJRF 1XSDA 2BOLA 3GCMA 4BAYA 5EG0A 5H6RA 2M3AA 2CYYA 2AXLA 2ELHA 2K02A 1BOBA 1QBJA 2DLLA 4A3BJ 3ABMH 3SXYA 2ZSIB 1FY7A 2EFWA 3GTPJ 1DGWY 3I58A 1T6SA 2EH3A 2B63J 5CVJA 5CKTA 1VQMI 3K9TA 1WH7A 3EYIA 4BE1A 2HFHA 4RAFA 2K4BA 1XS9A 3NARA 1TP4A 1IF1A 1E3OC 2PFBA 4BHCA 1HC8A 1LB2A 3TW6A 2BVLA 2EILH 2DO7A 4JX6A 3CCJI 2KLOA 4GYIA 3F21A 2DFIA 3O8GA 4DIQA 4AYBA 3TO6A 5TRDA 2TCTA 2A5WA 3H0DA 1IXSB 2PJPA 1LFUP 1QGPA 1TC3C 2V6EA 1GT0C 3F8NA 2Z99A 1GV5A 5DYMA 2FX0A 3PUFA 1JKQC 2VB6A 2EV6A 4LK0F 4RM2A 2FRHA 4UUVA 3IH3A 4D5FA 4MTDA 1KU2A 3MKLA 2XV4S 1XDUA 1FEXA 1FWZA 3IL2A 3HOVJ 2PI0A 3SDBA 2E1NA 1KU7A 1F9NA 3I4NJ 4XN0A 1L0OC 2R0QC 1D1CA 5KK1A 3KCCA 4PCQA 3FKJA 3NQOA 4F92B 2CH0A 1LEBA 3GFLA 3ZN0A 1S29A 4RLFA 3WHBA 3T8RA 1RRJA 1WRJA 1JUPA 4BUPA 1R22A 3OIOA 3KE2A 2M45A 3M9AA 2IS1A 2VKHA 4HDVA 5EF6A 3F6OA 2RQPA 3C3WA 3SZPA 2TDXA 4XOPA 1ETQA 1T38A 2M34A 2ZXIA 3VFZA 2FJ1A 1K78A 2QYOA 3LSJA 1T56A 1FOWA 2MA3A 2YU3A 3EETA 1YIJI 3G2BA 1AKHA 2EFOA 3W2AA 4HX4A 2Y31A 3RPQA 4ZYAA 2KFDA 3CCYA 2XRNA 3F8FA 3CUOA 3KP3A 4D0PA 1VQ6I 1FBUA 2D2WA 2FBHA 2W7NA 1B1BA 4XK4A 4A0ZA 3CP8A 1W4MA 1SFOJ 5JHUA 4KMFA 2PLYA 1Z91A 3WU1B 1FBQA 2VONA 4B3AA 2OV7A 3KX2A 3BR3A 4M9ZA 3SYTA 3DQVC 4BXXJ 4IRIA 3LQQA 2VBWA 3F0CA 1HDDC 4M71A 1FMWA 3BR0A 4Q48A 3K10A 1BJAA 2G9WA 4I2OA 1QU3A 4EJOA 3Q5FA 2CUEA 4DZJA 2JA7J 4JQFA 4DBRA 2K85A 1Z1DA 1FX7A 3DBLB 1FIPA 1YOVB 5IYCJ 3ZMVA 3LA2A 5L3GA 4JX5A 4M3FA 4AVPA 5F08A 5HDNA 2EFQA 2VBYA 3ELKA 1P4WA 2IS4A 1WGXA 2ISZA 4FQGA 1NH3A 2XAHA 5FLVA 1UCRA 2IW5A 3C1DA 2COMA 3PL8A 2NVQJ 2ZKZA 1MH4A 4K2EA 3OYKA 2IT0A 1RUOA 3RYPA 1YTYA 3CC2I 2E71A 3CMMA 4XMYA 2JN6A 3F6VA 4M3DA 4WXHA 5HVQC 3JW4A 2WB1N 2BY1A 2K9QA 3J81Z 1U9NA 1DUXC 3QPHA 4A3EJ 4ASNA 1GDTA 1T95A 4GXOA 1O3SA 1ON2A 2ZXWH 1MKMA 3GLLA 1TQPA 2CQXA 5LHGA 3AKZA 1VQ7I 2QVOA 3GTQJ 2RAEA 5EJCA 2XASA 3U1DA 2CMPA 3CD6I 2JMWA 2HYFA 5E3NA 2LY2A 2E35A 1G59A 3GTKJ 4CZCA 4UVBA 3SDGA 1W36C 3QU3A 3ROUA 5CYVA 3CTAA 3DCFA 3LNQA 2XRLA 4MQ9F 1D1AA 2FA5A 2ID6A 5ILUA 3GVAA 4A3GJ 2OJED 4LB5A 3LSTA 3K0LA 4ENNA 2K5CA 4NQWA 1YW9A 2Y48A 2COBA 3DTIA 3CCVI 2P8TA 5FKLA 2MYSA 4A93J 4N4NB 3S93A 1DDNA 1T08B 4XORA 3W2WA 2R7DA 1IZ1A 1AOYA 4NDLA 4UXNA 3WTXC 3Q0WA 3OS2A 3L2WA 4PJLA 5BOXA 1OLTA 3KEQA 1K61A 2HZDA 2VLAA 4IHSA 2ZB9A 4YFKF 2DT6A 4EM0B 4BJ5C 4M3GA 1IJWC 2JSCA 1ZG3A 3F8BA 1X1AA 3E3VA 5FGMA 4JK1X 1N75A 3LA7A 4V2FA 5IYDJ 3P9CA 3ZR8X 4I0AA 2CV0A 1VFCA 1R5HA 1T98A 2BV6A 4RGXA 1KQ9A 1X2MA 3E6DA 2GA2A 4KT6A 3QU6A 3SZTA 3K4BA 2ME0A 3WGGA 3OYHA 3BG7A 4OIPF 2DU9A 1Z7UA 2WY7Q 3BR2A 4AD9A 5GTIC 3J7YJ 3WGHA 5ICEA 3ABUA 4NHJA 1BBYA 1BR1A 3V8LA 4DYRA 4H0EA 4HNVA 1VQLI 3S2HJ 2MLKA 3BG9A 3LSGA 4A3FJ 1ZAOA 4KDPA 3HHHA 3K69A 2LKXA 1X3WB 4BGDA 3SFIA 3NEUA 2AQEA 3WU0A 4HYEA 3L7WA 3E7LA 2BHYA 2KIMA 4ZDLA 1WI3A 2PMZN 3OYAA 4BY1J 1O57A 2L4AA 1Z6RA 4XR6A 4BACA 1Z7LA 4NB5A 1TWAJ 2F5VA 3ZMUA 4D7MA 4RMNA 4A5MA 2LTPA 4F93B 2GA1A 3DF8A 3FISA 4I6ZA 2HOTA 2IA2A 2JQ7A 4AIHA 2R3SA 1H9GA 1PUFB 2QKMB 2Y2ZA 1Z9CA 4D9JA 1XTAA 4RB0A 3G6EI 1K83J 4ETSA 2XUBA 2F5CA 1TBXA 4UUSB 5EEGA 3H5AA 2HQAA 3A0BC 3VSKA 3HRSA 3L9FA 2Y69H 5EEAA 3CO6C 2CWEA 3TO7A 4DYQA 1ZTRA 3GYHX 1CQTA 2CFXA 2JWTA 3C2GA 5ILVA 1Y0UA 3ASOH 2X85A 1VQNI 1I1GA 4E7SA 4CUGA 1R36A 4UNOA 1U8BA 2WV0A 2W48A 1PP8F 1WJDA 4EJVA 2OZ6A 3I59A 3VWBA 5M3FJ 1Q1HA 1E17A 1EH7A 2YS9A 3OR1C 1NHAA 1R58A 3TP0A 2L7ZA 1QRYA 3JRDA 1V54H 4UB8C 2ESHA 1ZR2A 1JJ8C 4V19K 4RB3C 2NAZA 4JBAA 2R7FA 1X2NA 4I09A 2K3PA 1DQUA 4OINF 1K4TA 1QZEA 2KP6A 3B6AA 3QPLA 4BHPA 2D5VA 1PUEE 2MABA 4B48A 2JUGA 5BNGA 3DU6A 3KIOA 1VQOI 4CDGA 4IOCF 2WY8Q 3LQRA 3JR9A 3ZQCA 3KETA 1V55H 2L5QA 3OY9A 3JRIA 1QHHD 3H3UA 3CCMI 1X19A 1SD7A 3FMRA 3GFIA 2XGXA 3C2HA 1BI1A 3JRFA 5AIQA 4XKCA 2NOGA 3RKQA 2W84A 3ABTA 1ZGJA 2DA2A 1ETYA 2IA0A 3HPHA 3BG6A 3ZRGA 1MBEA 1N25A 1M1EB 4XSZF 2CUZA 2LKSA 4DOZA 3PQJA 5E1XA 4A3MJ 1MNMC 4FT8A 3GO5A 4V2GA 3MKZA 2F4OB 1S7OA 4XLPF 3QYBA 2QQBA 1QA6A 3GMEA 4ENMA 4ENJA 2PMUA 1ENHA 2VUMJ 5HS8A 2J5PA 3MFKA 3GTGJ 2IS2A 2E1MC 4MGRA 3I54A 3C2BA 1MH3A 5F0HA 5BMZA 5KNLA 4IHVA 3COAC 3S3NA 2BW3B 3CMEI 1LE8A 1KQ8A 2ZXJA 3CCLI 2GIZA 1S7AA 1ERDA 2FQ4A 4LGWA 3OYLA 5BPDA 2GXAA 2F2EA 2MH9A 5F64A 2DDAA 4FETA 4BJTA 2V26A 3R6SA 2CRGA 3M07A 2FMYA 4LLGF 3HYIA 1ZRCA 1SVMA 4G6QA 9ANTA 3HRTA 3CDLA 2HNHA 2JK3A 4XOTA 3JSOA 1D0YA 3WG7H 2EV0A 3ZQFA 3M1CA 1H88C 3K1MA 2IEKA 3IH2A 3CO7C 4A69C 1IXRC 3HSFA 1IW7F 3WODF 1B6AA 1JT6A 1VQ4I 4KITB 5KAFC 3HGGA 1D8KA 1TQIA 2V9VA 3CLQA 2E60A 2B0LA 3FBIB 2G7UA 1BW6A 3BCAA 2UXNA 2VIXA 4M3EA 2X1EA 1HLVA 1TTYA 4RB1A 2L0KA 2LSOA 3GTOJ 3AL0B 1MGTA 1S5LC 3FDYA 2E2HJ 4WF2A 2L7KA 3BTIA 4AVZA 4PSXA 1SVLA 1YW8A 2V7FA 2KIFA 2NOJB 1SVOA 3I71A 1WI9A 2Y9YA 4GCVA 1U5TC 3RZOJ 3LSHA 1D0XA 3W2VA 4BXFA 2HTJA 1FBSA 2H8WA 5KHDA 4ZYDA 5CVIA 2MLGA 3OYCA 4IOAF 5L3CA 2L54A 3WG9A 2CG4A 1PDNC 4F55A 2H6CA 1R23A 5FD6A 4R79A 1CGPA 1Z67A 2LKPA 3RKWA 3CCUI 1T0FC 1XSVA 4HX8A 4F3QA 2M4GA 3R4KA 2P4WA 3V7RA 2XF6A 1QVTA 2M1BA 3F9KA 5J8CA 5HDKA 4Q5SF 3G1LA 2V79A 1A5JA 4HPQA 4KIFA 1YE9A 1FSEA 5IT3A 3BG5A 3CUQC 1UJ8A 1OCPA 1IN7A 1B8IA 3CMAI 1ZREA 1JI8A 2W57A 4BHBA 1W7PD 3JRCA 2O7OA 1MJBA 3MKWB 4RAZA 5J47A 5K5RA 1JTYA 1WJBA 2B7EA 2IVMA 1FOKA 1OQYA 2FBKA 3HZJA 3I55I 2VKDA 2DODA 2LK2A 4KMUX 4O6JA 2RNGA 2E5NA 1ULYA 5DS9A 3KYLA 1RKWA 4C2TA 4UHTA 3SHFA 4YEJA 1R1TA 2FQ3A 2EK5A 3VDXA 5K7ZA 2IGKA 2ZFUA 4CO8A 1ETOA 2VOOA 5LEKA 4ZDOA 2XIGA 2CV2A 4UV8A 5LRRA 1OCTC 1YRNA 4D7NA 4XLHA 4PJMA 4BXUA 1Y0NA 1VNDA 3WHCA 5LGTA 3PSIA 1ZGAA 1U5TA 4GYGA 2DYRH 1HW1A 4UUTA 4P96A 3HL2A 1ZG5A 4ABZA 4C9YA 2IGOA 5A2QZ 1X1PA 4HEA2 4B44A 2YUSA 3QWLA 3BZ6A 3BR6A 2MFZA 1Z05A 4Q47A 4ANJA 2AHQA 2V4JC 3S16J 2GWRA 2Y9ZA 1WJCA 1ZRFA 3RCOA 1VI0A 2GQQA 4CYCA 3G1MA 4BDZA 2ELJA 2MSYA 1T0FA 1BOAA 4NC8A 2UXXA 3E6CC 5H20A 4LIVA 4HF1A 5FKMA 2Q2EA 3T0YA 4EJTA 2A5YB 3JRBA 1XSXA 2TRTA 4IL6C 4OWRB 3MVPA 4ZYHA 2NNYA 3CUQA 1YO5C 3BR1A 2EZKA 5IOYA 2KQRA 4CCJA 1P6RA 2IPQX 5EZHA 3G1OA 4LIUA 3L2CA 2A05A 3OWTA 1MMNA 1R5ID 1XCVA 2E7XA 1D5VA 5J4YA 2A61A 4DW6A 1KU3A 2OU2A 3JRAA 2QBYA 1UHWA 2Y0MA 3CMYA 4KYWA 4G8XA 1ZQ3P 3OIQA 2VBXA 5D5UB 3OOUA 2EFNA 5F0FA 5BS6A 1MD0A 1G8XA 2DQLA 2LFBA 5ICGA 2HWVA 3KZZA 2BY0A 2VJ4A 2WC2A 3K7AJ 4IQ4A 4KICA 1U6GA 3ULQB 1LDDA 1UG2A 3DV8A 2YSRA 1FPQA 4U0WA 4M9SA 3BDDA 4AYBN 4PJ0C 1D5YA 1TNTA 1G2HA 4AM3A 2LY9A 2OA4A 5DD8A 3QPSA 1V5GA 1WQ2A 3K4JA 3G71I 4BNCA 4IEJA 3CCEI 5HS9A 3H5NA 2R5ZA 3S17J 4M3BA 2FU4A 5CJ9A 1ETWA 3W6KB 1MDMA 3WTTC 3IAM2 3HUGA 3CJTB 2QSGX 4G6TB 1OCZH 1ZARA 2XC7A 3HG9A 4YELA 1TT0A 4MNUA 2LR8A 2V1NA 1Z0XA 4HSRA 5JHFA 4HLYA 3K4LA 4MIMA 5CVRA 3LSKA 2G7HA 5K7HA 5FRNA 3M3YJ 3BQZA 2E1CA 2WAEA 2EBIA 3CF2A 4OAYA 3A01A 2O03A 2MBFA 3N4MA 2K7LA 3TBIA 3RKXA 1XCBA 4B4CA 4KISA 3S2WA 3OS0A 3R0JA 3S1QJ 4HDUA 4HRIA 4J19A 2RKHA 3IKVA 4X0GA 1H8AC 2L7MP 3J81K 2HDDA 1LFPA 1HOMA 3U1KA 2V1UA 4BQAA 1K7AA 2DJNA 3FBNB 2EZHA 2K9SA 3L2VA 3DP7A 3MQ0A 3BTLA 3KZYA 1U9OA 1HDPA 1Y8RB 3EUAA 3K1NA 4LLNA 5F6FA 1QZYA 2P5LC 5EZGA 4HLXA 1IUFA 5M3MJ 1BI3A 1V4RA 5TJJA 4A6EA 3Q3SA 4H4KC 4A5NA 4IVNA 3ZOBA 2XGDA 1I39A 1VZ0A 5B3SH 1D8JA 4RGSA 2IA1A 4NQWB 1IG7A 1RPWA 4ZC3A 4ESFA 4PDKA 1Z77A 5KCMA 2NVUB 5GTHC 3E1SA 3LAPA 1EF4A 4ZTFA 4KJZA 1ZLJA 3RQ4A 5EGOB 1GV2A 3I0TA 3QOPA 4I98B 3LA3A 2CUFA 4LFUA 2GLOA 3BQYA 3N97A 2UUZA 1MBKA 3RSNA 4CZZA 3MCZA 3SJMA 3HPGA 2X6OA 3HKZA 5IY5H 3QRFF 2O9LA 4XRMA 3WTUC 1WSUA 1YLFA 3H3ZA 3TW7A 2R5YA 3F72A 2DN0A 3HC7A 3OYGA 4PK4A 3R61A 1XG1A 4M74A 4HX7A 1CF7A 1BI0A 2MD5A 5FKKA 2J5OA 1UHMA 2W1OA 5KAIC 3MAJA 1XGNA 3DPTA 3RPUD 3HOYJ 3BLYA 1I50J 1OR7C 2VE9A 1X1BA 4W1UA 5D8LB 5JVGF 1IRXA 1UZCA 2M0MA 1ZH5A 2RNJA 2Z2SB 5C4XJ 4CXFA 4C30A 2F5DA 2VBZA 3TDUC 4BEHB 4U7BA 4E7IA 3GW2A 3O3KA 1T8IA 1FP2A 1YYVA 2ME6A 3U2RA 2HTSA 2WBMA 3HSRA 1ZYRF 3R0AA 2GIVA 1W7PA 3HSEA 2X4HA 2L4MA 2EZIA 1RI7A 3B73A 1NK2P 2QUFA 1WJ5A 3FF5A 2VT3A 3E5UA 2EA2A 1D1BA 1FP1D 1S9HA 4G9YA 1B9NA 3BTCA 3BZCA 1IDZA 2VQCA 3D5RC 3GEZA 2LVSA 1W0TA 3K70D 2P6TA 1OFCX 5DUIA 4HAMA 4IX7A 1A04A 1YX3A 3HGYA 2O0YA 3FXJA 2O3FA 5DV5A 3VSLA 2XROA 1YG2A 1MSFC 5F0CA 1ZHFA 1IRGA 3A1YA 1VQ5I 1RNLA 5B1BH 3BTJA 1DPRA 1WJFA 2MH2A 1DU0A 1VF9A 4P1WA 1WZ2A 2BZTA 2DJIA 2V1XA 3PQKA 2F5EA 3AFHA 3IV5A 4OOIA 2LOOA 1U78A 1IN8A 1G3SA 1TQMA 3FM3A 1BIBA 2NVXJ 2K40A 4XLCA 5IT9Z 4R1HA 1I6HJ 2YR2A 1IN5A 2OCEA 3DEEA 5J8FA 5D5VB 3AG4H 1J2XA 1G3YA 1OR7A 3IP4B 3BY6A 3PUBA 3GTMJ 3QPTA 2LF8A 2M7AA 1FMVA 1TWGJ 1F1ZA 4OAZA 2O5RA 1MNEA 2BEOA 2WV1A 4XSXF 3HRUA 5B5EC 5FROA 4XIDA 1G4DA 2XKOA 2DOAA 3FXRA 3VOEA 1IAWA 3P7NA 2LF7A 4S05A 1ZELA 2VODA 2XAGA 3ML6A 2WAFA 2X6YA 2DK8A 4FHTA 2W24A 4I02A 1Z6TA 2ZMEC 5CQEA 3CCRI 2DA3A 2FUG2 5D6EA 1QPMA 3V8JA 5HNHA 2P7VB 3V7CA 1WFXA 3W6VA 2CQKA 3MMYB 2ZCWA 1WWXA 4C3JJ 4ON0A 3KP2A 3B6CA 2HVQA 4XKWA 1EH6A 1OMIA 2OD5A 2VQGA 4XNFA 3WE3A 1O4XA 2KDOA 1G3WA 2QLZA 2EWNA 2UWMA 5ICCA 3J7AO 2JSPA 4MEYF 1S3JA 2RQQA 2K27A 5E8IA 1X4PA 2KRCA 4QTRA 3GWZA 4BBSJ 2L2OA 2RV8A 3OYBA 2P0WA 4C2UA 5HDGA 2VJIA 1JTXA 3ZCOA 2A69F 4CHUA 4BYYA 2Y75A 1JUMA 2X1DA 1BN5A 2HYJA 2KL4A 3EUKL 4LG0B 1TWFJ 2ZSHB 1MBGA 4IZZA 2FMLA 1ZG1A 5C4JJ 2OTJI 3TP3A 4RGUA 4CYDA 4CCMA 4G12A 5DCMB 4N9HA 3RTRA 4BE2A 2RVCA 2ZO4A 3RI4A 3KZIC 3OL4A 1LE8B 3HRMA 4YIRX 2L02A 4N4OB 1DU6A 3WU2C 1JGGA 4P9FA 1RR8C 5JVTA 4OMZA 1XX5A 3D5LA 3T8TA 3J7ZI 1B59A 1VQ8I 3LAJA 1TZLA 2OZUA 1SFXA 3JREA 4OIRF 2ZMEA 1J7KA 3DEUA 4GDFA 4Y33A 2JVGA 2ICWG 1LFBA 5K5OA 3CJRB 5M5WJ 1VQKI 4MTEA 2PQ8A 4HQMA 2M30A 3KYCB 5F27A 2FBIA 3ZN1A 2YU9J 3CC4I 1I3AA 1SC7A 3E5QA 4A6DA 3DLAA 1IXCA 1ETVA 4WX9A 1L3LA 5K7FA 4IO9F 4M6XA 3TOAA 4XONA 2O6GE 4TV7A 1ODDA 1XMXA 2KZVA 1ZKGA 2I5UA 2XAUA 1LPQA 4FTHA 1YX5A 4JYKA 2LH9A 1I3QJ 1FYMA 4F7ZA 3PIPF 4AU7A 2VL8A 4WXCA 4A3CJ 1Y6IA 2JZYA 4DYCA 1WJAA 1Z3XA 2PBIA 1Z3YA 3FXMA 4I7HA 1BA5A 5E1WA 4BU2A 3L2QA 1XGSA 4PZJA 2LP0A 3BWGA 3TO9A 1GLNA 1ZLKA 5ERIA 3K70C 5FLXK 3BC8A 1BR2A
chains in the Genus database with same CATH topology
3CMAI 2E34A 3G71I 5DM6F 3J7YJ 3CCEI 5JVGF 1VQLI 3I55I 1YJWI 1QA6A 1VQMI 1YJNI 3CJTB 1S72I 3PIOF 2QEXI 1HC8A 3CCJI 3CMEI 2NXNB 3CCLI 2OTJI 4UY8I 3CC2I 1VQPI 2JQ7A 2OTLI 1Y39A 1YJ9I 5GADJ 3G6EI 1VQ7I 3J7ZI 1VQ8I 3CD6I 1MMSA 5GAGJ 1VQ5I 1VQ4I 2E35A 1VQNI 3CCSI 5GAHJ 2ZJPF 5GAEJ 1VQKI 2E36A 3CC4I 1YITI 2QA4I 1YI2I 3CCVI 1ACIA 3CCQI 4V19K 2ZJQF 1FOXA 4IO9F 1VQ9I 3DLLF 1FOWA 2FOWA 1YIJI 3CF5F 2H8WA 1YHQI 1VQOI 4IOCF 4IOAF 3PIPF 3CCMI 1VQ6I 3CCRI 3CCUI 1FOYA 3G4SI 2ZJRF 5DM7F 2K3FA 3I56I 3CC7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA I;  2E34 A;  3G71 I;  5DM6 F;  3J7Y J;  3CCE I;  5JVG F;  1VQL I;  3I55 I;  1YJW I;  1QA6 A;  1VQM I;  1YJN I;  3CJT B;  1S72 I;  3PIO F;  2QEX I;  1HC8 A;  3CCJ I;  3CME I;  2NXN B;  3CCL I;  2OTJ I;  4UY8 I;  3CC2 I;  1VQP I;  2JQ7 A;  2OTL I;  1Y39 A;  1YJ9 I;  5GAD J;  3G6E I;  1VQ7 I;  3J7Z I;  1VQ8 I;  3CD6 I;  1MMS A;  5GAG J;  1VQ5 I;  1VQ4 I;  2E35 A;  1VQN I;  3CCS I;  5GAH J;  2ZJP F;  5GAE J;  1VQK I;  2E36 A;  3CC4 I;  1YIT I;  2QA4 I;  1YI2 I;  3CCV I;  1ACI A;  3CCQ I;  4V19 K;  2ZJQ F;  1FOX A;  4IO9 F;  1VQ9 I;  3DLL F;  1FOW A;  2FOW A;  1YIJ I;  3CF5 F;  2H8W A;  1YHQ I;  1VQO I;  4IOC F;  4IOA F;  3PIP F;  3CCM I;  1VQ6 I;  3CCR I;  3CCU I;  1FOY A;  3G4S I;  2ZJR F;  5DM7 F;  2K3F A;  3I56 I;  3CC7 I; 
#chains in the Genus database with same CATH topology
 2KHM A;  4A3K J;  2VQH A;  1TLH B;  3CDI A;  3QOE A;  4Y4R A;  4M9X A;  2X48 A;  4M72 A;  1OYW A;  3I3L A;  4HF0 A;  5LEJ A;  2BXY A;  2LY1 A;  2R7Z J;  2VPR A;  1B8I B;  5J1Y A;  2VE8 A;  1TNS A;  3ZXS A;  5FO5 A;  3H5R A;  4MQV A;  1S72 I;  5HLT A;  4RAG A;  2PJR B;  4FE7 A;  4NBQ A;  3GTJ J;  4BE0 A;  2A68 F;  2E5Z A;  2V6C A;  1SFU A;  3V42 A;  2LC2 A;  4L5I A;  3RPU A;  3FIW A;  1SEU A;  1F43 A;  3KP7 A;  5E3M A;  4S04 A;  4BQN A;  1Y8Q B;  4FE4 A;  1NK3 P;  4DGW B;  1UB9 A;  1HQC A;  1EH8 A;  4BL0 B;  1R49 A;  2OTL I;  2NYX A;  3DPL C;  1XB4 A;  4LOC A;  1QNT A;  3VEP A;  4HQE A;  2HKX A;  4E7J A;  2ZXH A;  3FX3 A;  1BL0 A;  4IHX A;  3LSI A;  5A2Q K;  2O8K A;  2HZT A;  2M8E A;  4J01 A;  5GAH J;  3HOU J;  4EV0 A;  4Y13 A;  2ZJP F;  3TGN A;  3U9G A;  3TED A;  4HA8 A;  2QWW A;  1Q1V A;  3AG2 H;  2E36 A;  2VI6 A;  1YIT I;  1R1V A;  3JAM Z;  3IUO A;  2QA4 I;  4IKF A;  1PYV A;  3NWT A;  2HOS A;  4A3J J;  5LGN A;  2F4I A;  4I01 A;  2Z16 A;  1GVJ A;  3BRO A;  3V4G A;  2A6T A;  3LL7 A;  1LVK A;  5GPA A;  5LHI A;  2X51 A;  2CFO A;  3P9K A;  1Y56 A;  2FD5 A;  3MZY A;  2YX4 A;  1KGS A;  3S1R J;  1UHS A;  2DQR A;  4QLC U;  2R4G A;  2Y0S A;  3BJO A;  1DP7 P;  2HQN A;  5M5Y J;  4A0X A;  3HXL A;  3WTZ A;  2R92 J;  3JCU C;  2F4M B;  2GZW A;  2NS0 A;  3I53 A;  1HCR A;  1YQA A;  2DXI A;  4JP0 A;  3NAU A;  5JI6 A;  3CES A;  4HG2 A;  3M7G A;  1B72 A;  3T5X A;  2KDZ A;  2MGQ A;  3ZMT A;  2AQF A;  3F8M A;  2LG4 A;  4G6D A;  1MJ9 A;  1PUF A;  1O7L A;  1OJL A;  3OSF A;  3BCB A;  1QZZ A;  4MFE A;  3WTY C;  3O8H A;  1WH5 A;  4IRH A;  3G73 A;  2HR3 A;  3HOZ J;  2KRF A;  4UUS A;  4XLA A;  4RBO A;  1OYI A;  1R4N B;  2YX7 A;  2BE5 F;  3DBR B;  2JPB A;  2XGC A;  1YJN I;  1WHU A;  4U87 A;  3PNV A;  2OC6 A;  1R5G A;  2KJC A;  1IN4 A;  4L5J A;  2AS5 F;  2KKO A;  3HUG B;  4CH7 A;  2DPD A;  4IQJ A;  1R7J A;  3K4K A;  4YII A;  4F52 A;  3EYY A;  5CVV A;  3UKG A;  1LKX A;  1IO2 A;  3KP4 A;  3KFW X;  3LMM A;  5EG0 B;  3M4O J;  1GVD A;  3BP8 A;  4KN4 X;  3IH4 A;  3L2U A;  5HS7 A;  5FB2 A;  2HOA A;  3I64 A;  2GXG A;  1MMS A;  2IXS A;  2EJR A;  1E3P A;  5ILS A;  2WWY A;  4LG3 A;  2KPM A;  2ECC A;  1BC8 C;  1IRF A;  4X1E A;  3S3O A;  5D4S A;  3J7A Y;  5E18 F;  1J0R A;  2E7W A;  1P9Q C;  2CQ7 A;  5E8G A;  2XF7 A;  2PN6 A;  2STT A;  1HKS A;  1SAN A;  1BW5 A;  1FTT A;  1IRZ A;  2HGC A;  4CGZ A;  4QIW N;  3RJP A;  4U7D A;  2I10 A;  2Z3Y A;  4O3M A;  4HW0 A;  2VKE A;  2KMU A;  4Y52 J;  2QQ8 A;  3E0J B;  5DTD A;  3VYS B;  1NG6 A;  2OBP A;  1ITY A;  4I0B A;  3SQN A;  5IP7 J;  1X1C A;  3GZN B;  4IXA A;  2V9K A;  4LD5 A;  2QEN A;  5AIP A;  5L3E A;  1A6I A;  2UV1 A;  2HOE A;  1F5T A;  2Y30 A;  2FOW A;  2B9S A;  4A3D J;  3CF5 F;  2KRH A;  4XKV A;  3BZK A;  3DEW A;  4UV9 A;  2PX9 A;  3OYJ A;  3PFY A;  1BR4 A;  1FC3 A;  1OCR H;  3RKY A;  1EV7 A;  4PGG A;  5K5Q A;  2ZFW A;  2VXD A;  3E6B A;  3FHN A;  2HDC A;  3ZPL A;  4L9J A;  5B1A H;  3HDD A;  1JJ6 C;  2P81 A;  1O3T A;  2DI3 A;  3TKY A;  3OV8 A;  1USS A;  2D1H A;  3E6M A;  3L09 A;  3HBL A;  3H36 A;  4A0Y A;  2DOF A;  2W4S A;  4RDU A;  3KP6 A;  1REP C;  2BY2 A;  2KZG A;  2LLK A;  1U0J A;  5D4R A;  3HM5 A;  2NS8 A;  2WA0 A;  2WAQ A;  5LFA A;  4DQ2 A;  1K78 B;  2R7W A;  2CW0 F;  2F5F A;  1MSE C;  4E70 A;  3ZP5 A;  1AKH B;  4EM2 A;  3GFM A;  3OIP A;  2L9S A;  2A07 F;  2A6E F;  5L3F A;  2DTR A;  2M0C A;  3HOT A;  4KT5 C;  2QEX I;  2Z9O A;  4CCL A;  5M5X J;  1UAA A;  3ZQI A;  2STW A;  1PJR A;  1IDY A;  2KIQ A;  3QAH A;  1STZ A;  3KLN A;  3JRH A;  3I5U A;  3BPX A;  2H6B A;  4YFN F;  3QOD A;  2MW8 A;  4OIO F;  2X6X A;  3HOS A;  3BJA A;  4LIT A;  1TT5 B;  1W1W E;  3JTH A;  3PO2 J;  2JRT A;  1H9T A;  1LUJ B;  2JT1 A;  4PJJ A;  1D3Y A;  1IN6 A;  2XPU A;  2XKP A;  3ZMD A;  1O3R A;  3TL4 X;  2ELK A;  2H09 A;  5EEH A;  5KVR A;  4F91 B;  4EJU A;  4C3I J;  1RZ4 A;  2LD5 A;  4ZDP A;  5IYB J;  1J59 A;  4B09 A;  3K4N A;  2XB0 X;  3VB2 A;  3JRG A;  1XC5 A;  3TMO A;  4L18 B;  2GOM A;  3ESW B;  1SD4 A;  1WCM J;  2CO5 A;  2XB5 A;  3GLX A;  3JSP A;  4FX4 A;  4DZP A;  2QKL B;  2P5K A;  2KIU A;  4GGG A;  2BHZ A;  2CU7 A;  2HYG D;  4G94 A;  1HF0 A;  4XM3 A;  1B4A A;  1HBX G;  1FNN A;  3HKZ N;  2R7R A;  2P6S A;  2DFF A;  2V9P A;  1OYY A;  1X3Z B;  2DA6 A;  2HKO A;  2LDU A;  3CCQ I;  4WK8 F;  4FX0 A;  2ZJQ F;  4L9V A;  2EIM H;  4U88 A;  2R7S A;  1JGS A;  1SMT A;  4WWC A;  1OPC A;  3ECH A;  2R7V A;  4M6Y A;  5E1Z B;  4Q4Z F;  4ZZL A;  1LDK B;  3D5S C;  3H9G A;  1FYK A;  1J09 A;  5IT9 K;  4XQF A;  1FYL A;  2RDP A;  1AHD P;  4ZTJ A;  4M73 A;  3REO A;  3A2K A;  3H0G J;  4NC7 A;  2KJB A;  3CP2 A;  2XDV A;  1KZH A;  3ZQH A;  3ZMS A;  1IV6 A;  1QVU A;  3I9V 2;  4IHT A;  2EA4 A;  1WPK A;  2LYC A;  2X9D A;  1UST A;  4HZF A;  4IRG A;  3OL3 A;  2K4J A;  4EGY A;  5FKO A;  2FNP A;  3W6J B;  1T2K A;  4S0H B;  3T1B A;  1GXP A;  3BG3 A;  3P5J A;  5FLM J;  2DK5 A;  1X3U A;  4L5E A;  2OQR A;  4RM3 A;  5HLI A;  5IOZ A;  4YRV A;  3I56 I;  2RGV A;  4UVC A;  4ENK A;  4X6A J;  3CZ6 A;  4PGH A;  4MO7 A;  1MIJ A;  1HW5 A;  5EYR A;  2VQL A;  2ZBK A;  2E34 A;  3ZQ7 A;  3M8J A;  1SMY F;  4JOM A;  1LVA A;  4C3H J;  3FM5 A;  2VAS A;  1BJZ A;  4PJN A;  4AC0 A;  1IV8 A;  4IHY A;  1P2F A;  4PSW A;  5F1R A;  1POG A;  2DBB A;  2OF7 A;  1H89 C;  5DDG A;  2NNN A;  3LFK A;  2VC0 A;  5LLQ A;  1TW2 A;  1QO0 D;  2LBF A;  3A0H C;  3G3Z A;  2A6H F;  3K4M A;  3U21 A;  3S2D J;  3HEF A;  3CJQ B;  3O2P E;  1HSJ A;  5LGU A;  2FNA A;  1K6O A;  1TWC J;  3H9J A;  2E2J J;  1E3H A;  1V5E A;  1TWH J;  3OYM A;  1PP7 U;  1SD5 A;  4UY8 I;  3IRR A;  1WKM A;  4M6V A;  1VQP I;  3EDP A;  2VC1 A;  3OMY A;  2P7C B;  1V3F A;  2E19 A;  4XLN F;  3DBH B;  4QWQ A;  3V8K A;  2A3S A;  3OYI A;  5HOO A;  2IS6 A;  3GUD A;  5E3L A;  3J80 Z;  2ZJ2 A;  5GAD J;  2E2I J;  4G7O F;  3DPU A;  2OAZ A;  1QHG A;  3PJR A;  2VJ5 A;  1TW3 A;  1XN7 A;  1G3T A;  1XGO A;  4Z6Y A;  2IP2 A;  4UVA A;  2DW4 A;  3H3V K;  3MEX A;  3D1N I;  2IBD A;  1HW2 A;  3JTG A;  3FMS A;  3N05 A;  4B47 A;  1W5C C;  2HDW A;  4G7Z F;  4FIS A;  4LK1 F;  3LFU A;  2ZME B;  4XKB A;  1X58 A;  4EMS A;  2JA2 A;  2M4K A;  3QP5 A;  2OQG A;  1LDJ A;  1BM9 A;  1KYW A;  2Z1D A;  5JR3 A;  2PG4 A;  3X2Q H;  2QQ9 A;  4ZJZ A;  5ED4 A;  1AU7 A;  2QGU A;  4RGR A;  2BVM A;  4WCG A;  4HV5 A;  1W5S A;  3MD2 A;  2M87 A;  3TQN A;  1JKP C;  2R7X A;  3ZMZ A;  1WVR A;  4FAS D;  4O5V A;  4Y15 A;  3QYE A;  3HOX J;  3GTL J;  2O61 A;  4AIJ A;  2DFH A;  4IJA A;  5IP6 A;  2HPI A;  3VYR B;  2HQ5 A;  1AA7 A;  4QPQ A;  2NRA C;  2GOX B;  4BBR J;  1UG0 A;  2HS5 A;  2BYV E;  1JHH A;  3GZ6 A;  1SFE A;  2CJJ A;  2FOK A;  1I6X A;  3HB9 A;  2HXI A;  3F23 A;  4IPA A;  3K4C A;  4NNJ A;  4CSW A;  1U3E M;  3L2R A;  1FOY A;  1J9I A;  2OUM A;  3W3C A;  3S32 A;  3I59 B;  5LBQ A;  5AON A;  1FTZ A;  4KN7 X;  3G4S I;  1F4K A;  2CQQ A;  3DKW A;  3ZGK A;  2L01 A;  2K3F A;  3KEO A;  5FFX A;  1ZGW A;  1J5Y A;  2FE3 A;  2DMP A;  4KA4 A;  3DWL E;  5TGT A;  1P4A A;  2DA4 A;  4II3 A;  1QPI A;  1R4M B;  4E7H A;  4MHG A;  3FXO A;  4BQO A;  4EEF G;  1LQ1 A;  2O8X A;  5FKN A;  4A12 A;  2RC4 A;  1MMA A;  2ID3 A;  4B8X A;  2DA5 A;  3ZQQ A;  1AWC A;  5J3L A;  2IGM A;  4KIG A;  3M8E A;  2CW8 A;  2DA7 A;  2W85 A;  1MMD A;  3A02 A;  5J6X A;  1IUY A;  2L9V A;  3LSR A;  5FJ8 J;  1I5Z A;  5HLG A;  2L9R A;  5F04 A;  4NC6 A;  2JA5 J;  2D45 A;  5J1R A;  4WXD A;  2HI3 A;  5E79 C;  4EVI A;  1P4X A;  3ABL H;  5DUK A;  2XSJ C;  3IWZ A;  2LRD A;  3WGI A;  3PNT A;  4B1R A;  1XMK A;  5HLH A;  1QQI A;  3BJ6 A;  5D6F A;  5BQT A;  5D5W B;  1DPU A;  3IHU A;  2H8R A;  2V1D A;  2DMU A;  1Y1W J;  4KIB A;  4ITV A;  1YIO A;  5EGO A;  1JT0 A;  1MMG A;  4L0Y B;  1S6L A;  4P5O A;  1N78 A;  3AG3 H;  2M5W A;  1HKT A;  3IWF A;  2DT5 A;  1RR7 A;  3ERE D;  1GXQ A;  3KLO A;  2BBY A;  2KIS A;  2IAI A;  2RRE A;  3C7J A;  4QPO A;  5C44 J;  3CJN A;  2BXZ A;  4BQQ A;  4XBF A;  3HJE A;  2DPU A;  3I4P A;  2JA6 J;  1YI2 I;  2WB1 A;  1JKR C;  1UEL B;  2ZC2 A;  2NVY J;  1BIA A;  2GM4 A;  2L7F P;  3L1P A;  4ESB A;  2QF7 A;  1FOX A;  1OKR A;  2EQR A;  1KYZ A;  3ZQL A;  1VQ9 I;  2LRE A;  3JAM K;  3MKY B;  3WTS C;  2PMH A;  4RAY A;  1EJ9 A;  2IRF G;  1PVE A;  2UZK A;  2QCO A;  4XN3 A;  5J1U A;  4BEH A;  5LRS A;  3LOC A;  4BKX A;  3ONQ A;  2EFP A;  3PSF A;  2QQA A;  4YIF A;  4HST A;  3TDZ C;  3GF2 A;  3CQZ J;  2NVT J;  2RN7 A;  3E97 A;  2Z5U A;  1FSH A;  1APL C;  4EGZ A;  3MZH A;  4AID A;  3ABK H;  2CW7 A;  2DMT A;  4XRS A;  2VT2 A;  3L00 A;  4YG2 F;  2DMQ A;  2EIN H;  1ZK8 A;  2ZNZ A;  2FSW A;  5E20 A;  1B72 B;  3S14 J;  1FLI A;  3RIR A;  3DFG A;  1Z21 A;  3I4M J;  3S15 J;  3D0S A;  3Q9S A;  3HTS B;  3FZV A;  5TIS C;  1R9T J;  4E7Z A;  1ON1 A;  5F1J A;  3EUH C;  2HPM A;  5DCF A;  2L9N A;  2EV5 A;  3ECO A;  4G7H F;  1YJW I;  1V5F A;  1LNW A;  3IC7 A;  4Y7N J;  1U8R A;  3OYE A;  4HF2 A;  3VPR A;  1LJ9 A;  2E1M B;  4XIC A;  2XSD C;  2FF4 A;  1XGM A;  5CPR B;  4RB2 C;  2QZ8 A;  1ORK A;  2D1V A;  2BY3 A;  3SEZ A;  4HV6 A;  2X6W A;  3GX4 X;  4QSH A;  2XGE A;  2K9M A;  2JPC A;  3FXK A;  1SFK A;  3VYU B;  5H6Q A;  2K9L A;  2CV1 A;  5CQG A;  3Q0U A;  4CCK A;  1S8N A;  2NS7 A;  2Q1Z B;  3FK7 A;  5CVU A;  3H92 A;  4EJW A;  1FIA A;  3K1P A;  4HBL A;  5J40 A;  5B66 C;  5CLS A;  4E4H A;  4HOB A;  3MWM A;  3UNG C;  1N77 A;  1YS7 A;  1A31 A;  2QM3 A;  1K6Y A;  3OYD A;  2DFE A;  3OOP A;  1ETK A;  4JX4 A;  5GAG J;  1KA8 A;  1KON A;  2R7Q A;  4P55 A;  3O6B B;  1MBH A;  2Y0S N;  1D0Z A;  4DNC A;  1XDS A;  1HXD A;  5C3E J;  1R00 A;  4AUX A;  3DTE A;  5D5X B;  3Q0V A;  3HTU A;  2PMZ A;  5GAE J;  5K1Y A;  1ZRD A;  2FXA A;  1HST A;  1EA3 A;  2C6Y A;  1S7E A;  2EPF A;  2IJL A;  3SEQ A;  1FJL A;  1YRN B;  4ZYE A;  3WTW C;  3PNY A;  2LMD A;  1IC8 A;  3A4C A;  2HVS A;  1RUN A;  1ACI A;  3KYD B;  3EUH A;  3K2Z A;  1P7I A;  1U5T B;  4XLE A;  2H1L A;  2GAU A;  2G0E A;  4NUB A;  3BT9 A;  4XRF A;  1EKE A;  3DLL F;  4ESJ A;  3FK6 A;  3OSG A;  1TL8 A;  5FRM A;  5E17 F;  1MW7 A;  2DOE A;  4L9N A;  3OYN A;  1K4S A;  3SFZ A;  1UFM A;  1YHQ I;  3H35 A;  4MLO A;  4GO1 A;  1IGN A;  1KU9 A;  4CYC B;  2VPL A;  3LSP A;  2E1O A;  3IAS 2;  2JJ7 A;  4OU0 A;  4Y3O A;  4LG0 A;  3RYR A;  4U0Y A;  2WAD A;  2H94 A;  4LMY A;  1O7F A;  1WJE A;  2Q2E B;  1HA8 A;  3WE2 A;  2VOP A;  3S1M J;  3FKI J;  1X1D A;  4UB6 C;  4XRS G;  5H2F C;  5DCM A;  4LLL A;  3CUQ B;  1XMA A;  1P92 A;  1H0M A;  5DM7 F;  2DCE A;  1RIO H;  3SZG A;  4MEX F;  3WTV C;  3ISP A;  1A35 A;  3CC7 I;  1MZB A;  3FXQ A;  3HIF A;  1I27 A;  5GPC A;  2ETH A;  4MFD A;  5ICF A;  5DM6 F;  2XPV A;  3H9Q A;  1UMQ A;  2PEX A;  3PM1 A;  4EM1 A;  4YFX F;  4OMY A;  3DKY A;  2GXB A;  4I99 C;  2QBY B;  1GUU A;  3A03 A;  2JA8 J;  2IGN A;  1U2W A;  2X0L A;  2ISY A;  2KT0 A;  4EAT A;  4RA2 A;  3C18 A;  1MJA A;  1YW7 A;  2MC4 A;  1JXS A;  1SAU A;  1XD7 A;  2ESN A;  2VJJ A;  4W97 A;  4AIK A;  1JKO C;  2W00 A;  3H1C A;  3HHG A;  2DMN A;  2W82 A;  4ZH4 F;  1W5T A;  1VTN C;  1FT9 A;  2OPT A;  4HNT A;  2F48 A;  5IP9 J;  1RC9 A;  4BH9 A;  3F8C A;  4ZZD A;  2ZNY A;  1P7J A;  3P9I A;  2XAJ A;  5JLX A;  1Y39 A;  2H27 A;  2QSF X;  3LSM A;  1YJ9 I;  4IF4 A;  3MN2 A;  2JUC A;  1ZR4 A;  1E2X A;  4N0B A;  3RQI A;  1JHF A;  2CS3 A;  3DU5 A;  2R5Z B;  3VYT B;  1R71 A;  3QYF A;  4XL9 A;  2R7U A;  2N8G A;  1MDM B;  3AAF A;  3FXU A;  4PUS A;  5HNF A;  4DBQ A;  3UR3 C;  4P9U A;  3GXO A;  3GBG A;  2CGP A;  4KUM A;  3OR2 C;  4B43 A;  4A2U A;  1DP3 A;  3BPV A;  2XF5 A;  4ZYG A;  2R7T A;  2CQN A;  2EB7 A;  1SAX A;  2Z33 A;  1R6R A;  3IRQ A;  5FLX Z;  1YS6 A;  4CCO A;  4C2M J;  1DGR M;  3F3X A;  3ZQG A;  3A01 B;  4BDY A;  2L3D A;  2CUJ A;  4RS8 A;  5J4V A;  3M8F A;  4E7K A;  2VXZ A;  4GRI A;  2WAQ N;  3EQL F;  3Q9V A;  2EZL A;  2K86 A;  3S3M A;  4IHW A;  2MG4 A;  4N9I A;  2MC3 A;  2ADU A;  3B02 A;  2PJR A;  3FWE A;  5DD4 A;  1OCO H;  4RLQ A;  3E5X A;  1B9M A;  2BGC A;  3GFJ A;  1K79 A;  4KFC A;  1MND A;  3ERM A;  1J75 A;  3AG1 H;  1NTC A;  3K2A A;  3DKX A;  2XHK A;  5EDN A;  2DYS H;  2HQR A;  5JLW A;  2DA1 A;  3K6G A;  6PAX A;  3AL0 C;  2ECB A;  3KPH A;  3QP6 A;  2OCC H;  3CLO A;  2M2E A;  3ASN H;  2P5V A;  5L3B A;  4FCY A;  5E3O A;  2M9H A;  2X1C A;  3OS1 A;  4PFP A;  2DT7 B;  4D5C A;  4BY7 J;  2F6C A;  1Y1V J;  5LD2 C;  1C0W A;  2MD0 A;  1OIS A;  2CSO A;  2FEZ A;  1BI2 A;  2BW3 A;  5LHH A;  4BJ6 C;  5DEQ A;  2VKV A;  3PIO F;  3R60 A;  4KNY A;  1KQ0 A;  1RES A;  3TOB A;  2HVR A;  1A6Q A;  4L0Z B;  1X4O A;  2NXN B;  2GBY A;  2LBF B;  3IKT A;  1HKQ A;  1SD6 A;  2LNB A;  1ONV A;  3DXJ F;  4HNU A;  5JFR A;  2Q8K A;  4E7L A;  4EQQ A;  3FXL A;  4Z2Y A;  3RDI A;  2R5Y B;  4CCN A;  3OYF A;  1BC7 C;  2WTE A;  1CF7 B;  4I76 A;  1OCC H;  3NWS A;  2I8D A;  2DDB A;  4CA0 A;  4A3I J;  1ETX A;  1GHC A;  1JUS A;  4Y17 A;  1MBJ A;  1ZN2 A;  4LB6 B;  3S8P A;  1YFH A;  3BOQ A;  4B3X A;  2DAO A;  2H1K A;  4A3L J;  3RZD J;  3QQA A;  4E6K G;  4R8H A;  1O3Q A;  5L3D A;  2VN2 A;  3HOW J;  3KP5 A;  3J80 K;  2JVH A;  5IPA A;  3MZ8 A;  3VOD A;  4J00 A;  3CCS I;  5BPI A;  4D1Q A;  1F36 A;  3V7S A;  2QSH X;  1E0E A;  5HOD A;  5D8K B;  5GP9 A;  2K9N A;  1T39 A;  2YPR A;  4L9T A;  1W7P B;  4U0V A;  2ACJ A;  3FMQ A;  2XAF A;  2Q0O A;  1MBF A;  3PO3 J;  4II2 A;  3F22 A;  3M1E A;  4OIQ F;  5FFZ A;  3FHZ A;  3BR5 A;  1FZP B;  2R7O A;  2JTV A;  1I1S A;  2HEO A;  1W0U A;  1RET A;  2M7B A;  1LEA A;  3PFI A;  1A36 A;  4XLF A;  3LWF A;  1XPX A;  3GZ5 A;  1R1U A;  2JRM A;  3DTK A;  2EIJ H;  3EPZ A;  2HU9 A;  2EIK H;  1T33 A;  4CIC A;  1JE8 A;  2XVC A;  2DTZ A;  3KEY A;  2W25 A;  2M8G X;  4DJA A;  4BS9 A;  4AWX B;  2XAQ A;  2AO9 A;  2R93 J;  3NRV A;  5FD5 A;  1NG7 A;  2HXO A;  4PFO A;  1G6N A;  1RKT A;  2XPW A;  1W36 D;  2AXT C;  4GFB A;  3CDH A;  4LJZ F;  3S1N J;  2ZJR F;  1XSD A;  2BOL A;  3GCM A;  4BAY A;  5EG0 A;  5H6R A;  2M3A A;  2CYY A;  2AXL A;  2ELH A;  2K02 A;  1BOB A;  1QBJ A;  2DLL A;  4A3B J;  3ABM H;  3SXY A;  2ZSI B;  1FY7 A;  2EFW A;  3GTP J;  1DGW Y;  3I58 A;  1T6S A;  2EH3 A;  2B63 J;  5CVJ A;  5CKT A;  1VQM I;  3K9T A;  1WH7 A;  3EYI A;  4BE1 A;  2HFH A;  4RAF A;  2K4B A;  1XS9 A;  3NAR A;  1TP4 A;  1IF1 A;  1E3O C;  2PFB A;  4BHC A;  1HC8 A;  1LB2 A;  3TW6 A;  2BVL A;  2EIL H;  2DO7 A;  4JX6 A;  3CCJ I;  2KLO A;  4GYI A;  3F21 A;  2DFI A;  3O8G A;  4DIQ A;  4AYB A;  3TO6 A;  5TRD A;  2TCT A;  2A5W A;  3H0D A;  1IXS B;  2PJP A;  1LFU P;  1QGP A;  1TC3 C;  2V6E A;  1GT0 C;  3F8N A;  2Z99 A;  1GV5 A;  5DYM A;  2FX0 A;  3PUF A;  1JKQ C;  2VB6 A;  2EV6 A;  4LK0 F;  4RM2 A;  2FRH A;  4UUV A;  3IH3 A;  4D5F A;  4MTD A;  1KU2 A;  3MKL A;  2XV4 S;  1XDU A;  1FEX A;  1FWZ A;  3IL2 A;  3HOV J;  2PI0 A;  3SDB A;  2E1N A;  1KU7 A;  1F9N A;  3I4N J;  4XN0 A;  1L0O C;  2R0Q C;  1D1C A;  5KK1 A;  3KCC A;  4PCQ A;  3FKJ A;  3NQO A;  4F92 B;  2CH0 A;  1LEB A;  3GFL A;  3ZN0 A;  1S29 A;  4RLF A;  3WHB A;  3T8R A;  1RRJ A;  1WRJ A;  1JUP A;  4BUP A;  1R22 A;  3OIO A;  3KE2 A;  2M45 A;  3M9A A;  2IS1 A;  2VKH A;  4HDV A;  5EF6 A;  3F6O A;  2RQP A;  3C3W A;  3SZP A;  2TDX A;  4XOP A;  1ETQ A;  1T38 A;  2M34 A;  2ZXI A;  3VFZ A;  2FJ1 A;  1K78 A;  2QYO A;  3LSJ A;  1T56 A;  1FOW A;  2MA3 A;  2YU3 A;  3EET A;  1YIJ I;  3G2B A;  1AKH A;  2EFO A;  3W2A A;  4HX4 A;  2Y31 A;  3RPQ A;  4ZYA A;  2KFD A;  3CCY A;  2XRN A;  3F8F A;  3CUO A;  3KP3 A;  4D0P A;  1VQ6 I;  1FBU A;  2D2W A;  2FBH A;  2W7N A;  1B1B A;  4XK4 A;  4A0Z A;  3CP8 A;  1W4M A;  1SFO J;  5JHU A;  4KMF A;  2PLY A;  1Z91 A;  3WU1 B;  1FBQ A;  2VON A;  4B3A A;  2OV7 A;  3KX2 A;  3BR3 A;  4M9Z A;  3SYT A;  3DQV C;  4BXX J;  4IRI A;  3LQQ A;  2VBW A;  3F0C A;  1HDD C;  4M71 A;  1FMW A;  3BR0 A;  4Q48 A;  3K10 A;  1BJA A;  2G9W A;  4I2O A;  1QU3 A;  4EJO A;  3Q5F A;  2CUE A;  4DZJ A;  2JA7 J;  4JQF A;  4DBR A;  2K85 A;  1Z1D A;  1FX7 A;  3DBL B;  1FIP A;  1YOV B;  5IYC J;  3ZMV A;  3LA2 A;  5L3G A;  4JX5 A;  4M3F A;  4AVP A;  5F08 A;  5HDN A;  2EFQ A;  2VBY A;  3ELK A;  1P4W A;  2IS4 A;  1WGX A;  2ISZ A;  4FQG A;  1NH3 A;  2XAH A;  5FLV A;  1UCR A;  2IW5 A;  3C1D A;  2COM A;  3PL8 A;  2NVQ J;  2ZKZ A;  1MH4 A;  4K2E A;  3OYK A;  2IT0 A;  1RUO A;  3RYP A;  1YTY A;  3CC2 I;  2E71 A;  3CMM A;  4XMY A;  2JN6 A;  3F6V A;  4M3D A;  4WXH A;  5HVQ C;  3JW4 A;  2WB1 N;  2BY1 A;  2K9Q A;  3J81 Z;  1U9N A;  1DUX C;  3QPH A;  4A3E J;  4ASN A;  1GDT A;  1T95 A;  4GXO A;  1O3S A;  1ON2 A;  2ZXW H;  1MKM A;  3GLL A;  1TQP A;  2CQX A;  5LHG A;  3AKZ A;  1VQ7 I;  2QVO A;  3GTQ J;  2RAE A;  5EJC A;  2XAS A;  3U1D A;  2CMP A;  3CD6 I;  2JMW A;  2HYF A;  5E3N A;  2LY2 A;  2E35 A;  1G59 A;  3GTK J;  4CZC A;  4UVB A;  3SDG A;  1W36 C;  3QU3 A;  3ROU A;  5CYV A;  3CTA A;  3DCF A;  3LNQ A;  2XRL A;  4MQ9 F;  1D1A A;  2FA5 A;  2ID6 A;  5ILU A;  3GVA A;  4A3G J;  2OJE D;  4LB5 A;  3LST A;  3K0L A;  4ENN A;  2K5C A;  4NQW A;  1YW9 A;  2Y48 A;  2COB A;  3DTI A;  3CCV I;  2P8T A;  5FKL A;  2MYS A;  4A93 J;  4N4N B;  3S93 A;  1DDN A;  1T08 B;  4XOR A;  3W2W A;  2R7D A;  1IZ1 A;  1AOY A;  4NDL A;  4UXN A;  3WTX C;  3Q0W A;  3OS2 A;  3L2W A;  4PJL A;  5BOX A;  1OLT A;  3KEQ A;  1K61 A;  2HZD A;  2VLA A;  4IHS A;  2ZB9 A;  4YFK F;  2DT6 A;  4EM0 B;  4BJ5 C;  4M3G A;  1IJW C;  2JSC A;  1ZG3 A;  3F8B A;  1X1A A;  3E3V A;  5FGM A;  4JK1 X;  1N75 A;  3LA7 A;  4V2F A;  5IYD J;  3P9C A;  3ZR8 X;  4I0A A;  2CV0 A;  1VFC A;  1R5H A;  1T98 A;  2BV6 A;  4RGX A;  1KQ9 A;  1X2M A;  3E6D A;  2GA2 A;  4KT6 A;  3QU6 A;  3SZT A;  3K4B A;  2ME0 A;  3WGG A;  3OYH A;  3BG7 A;  4OIP F;  2DU9 A;  1Z7U A;  2WY7 Q;  3BR2 A;  4AD9 A;  5GTI C;  3J7Y J;  3WGH A;  5ICE A;  3ABU A;  4NHJ A;  1BBY A;  1BR1 A;  3V8L A;  4DYR A;  4H0E A;  4HNV A;  1VQL I;  3S2H J;  2MLK A;  3BG9 A;  3LSG A;  4A3F J;  1ZAO A;  4KDP A;  3HHH A;  3K69 A;  2LKX A;  1X3W B;  4BGD A;  3SFI A;  3NEU A;  2AQE A;  3WU0 A;  4HYE A;  3L7W A;  3E7L A;  2BHY A;  2KIM A;  4ZDL A;  1WI3 A;  2PMZ N;  3OYA A;  4BY1 J;  1O57 A;  2L4A A;  1Z6R A;  4XR6 A;  4BAC A;  1Z7L A;  4NB5 A;  1TWA J;  2F5V A;  3ZMU A;  4D7M A;  4RMN A;  4A5M A;  2LTP A;  4F93 B;  2GA1 A;  3DF8 A;  3FIS A;  4I6Z A;  2HOT A;  2IA2 A;  2JQ7 A;  4AIH A;  2R3S A;  1H9G A;  1PUF B;  2QKM B;  2Y2Z A;  1Z9C A;  4D9J A;  1XTA A;  4RB0 A;  3G6E I;  1K83 J;  4ETS A;  2XUB A;  2F5C A;  1TBX A;  4UUS B;  5EEG A;  3H5A A;  2HQA A;  3A0B C;  3VSK A;  3HRS A;  3L9F A;  2Y69 H;  5EEA A;  3CO6 C;  2CWE A;  3TO7 A;  4DYQ A;  1ZTR A;  3GYH X;  1CQT A;  2CFX A;  2JWT A;  3C2G A;  5ILV A;  1Y0U A;  3ASO H;  2X85 A;  1VQN I;  1I1G A;  4E7S A;  4CUG A;  1R36 A;  4UNO A;  1U8B A;  2WV0 A;  2W48 A;  1PP8 F;  1WJD A;  4EJV A;  2OZ6 A;  3I59 A;  3VWB A;  5M3F J;  1Q1H A;  1E17 A;  1EH7 A;  2YS9 A;  3OR1 C;  1NHA A;  1R58 A;  3TP0 A;  2L7Z A;  1QRY A;  3JRD A;  1V54 H;  4UB8 C;  2ESH A;  1ZR2 A;  1JJ8 C;  4V19 K;  4RB3 C;  2NAZ A;  4JBA A;  2R7F A;  1X2N A;  4I09 A;  2K3P A;  1DQU A;  4OIN F;  1K4T A;  1QZE A;  2KP6 A;  3B6A A;  3QPL A;  4BHP A;  2D5V A;  1PUE E;  2MAB A;  4B48 A;  2JUG A;  5BNG A;  3DU6 A;  3KIO A;  1VQO I;  4CDG A;  4IOC F;  2WY8 Q;  3LQR A;  3JR9 A;  3ZQC A;  3KET A;  1V55 H;  2L5Q A;  3OY9 A;  3JRI A;  1QHH D;  3H3U A;  3CCM I;  1X19 A;  1SD7 A;  3FMR A;  3GFI A;  2XGX A;  3C2H A;  1BI1 A;  3JRF A;  5AIQ A;  4XKC A;  2NOG A;  3RKQ A;  2W84 A;  3ABT A;  1ZGJ A;  2DA2 A;  1ETY A;  2IA0 A;  3HPH A;  3BG6 A;  3ZRG A;  1MBE A;  1N25 A;  1M1E B;  4XSZ F;  2CUZ A;  2LKS A;  4DOZ A;  3PQJ A;  5E1X A;  4A3M J;  1MNM C;  4FT8 A;  3GO5 A;  4V2G A;  3MKZ A;  2F4O B;  1S7O A;  4XLP F;  3QYB A;  2QQB A;  1QA6 A;  3GME A;  4ENM A;  4ENJ A;  2PMU A;  1ENH A;  2VUM J;  5HS8 A;  2J5P A;  3MFK A;  3GTG J;  2IS2 A;  2E1M C;  4MGR A;  3I54 A;  3C2B A;  1MH3 A;  5F0H A;  5BMZ A;  5KNL A;  4IHV A;  3COA C;  3S3N A;  2BW3 B;  3CME I;  1LE8 A;  1KQ8 A;  2ZXJ A;  3CCL I;  2GIZ A;  1S7A A;  1ERD A;  2FQ4 A;  4LGW A;  3OYL A;  5BPD A;  2GXA A;  2F2E A;  2MH9 A;  5F64 A;  2DDA A;  4FET A;  4BJT A;  2V26 A;  3R6S A;  2CRG A;  3M07 A;  2FMY A;  4LLG F;  3HYI A;  1ZRC A;  1SVM A;  4G6Q A;  9ANT A;  3HRT A;  3CDL A;  2HNH A;  2JK3 A;  4XOT A;  3JSO A;  1D0Y A;  3WG7 H;  2EV0 A;  3ZQF A;  3M1C A;  1H88 C;  3K1M A;  2IEK A;  3IH2 A;  3CO7 C;  4A69 C;  1IXR C;  3HSF A;  1IW7 F;  3WOD F;  1B6A A;  1JT6 A;  1VQ4 I;  4KIT B;  5KAF C;  3HGG A;  1D8K A;  1TQI A;  2V9V A;  3CLQ A;  2E60 A;  2B0L A;  3FBI B;  2G7U A;  1BW6 A;  3BCA A;  2UXN A;  2VIX A;  4M3E A;  2X1E A;  1HLV A;  1TTY A;  4RB1 A;  2L0K A;  2LSO A;  3GTO J;  3AL0 B;  1MGT A;  1S5L C;  3FDY A;  2E2H J;  4WF2 A;  2L7K A;  3BTI A;  4AVZ A;  4PSX A;  1SVL A;  1YW8 A;  2V7F A;  2KIF A;  2NOJ B;  1SVO A;  3I71 A;  1WI9 A;  2Y9Y A;  4GCV A;  1U5T C;  3RZO J;  3LSH A;  1D0X A;  3W2V A;  4BXF A;  2HTJ A;  1FBS A;  2H8W A;  5KHD A;  4ZYD A;  5CVI A;  2MLG A;  3OYC A;  4IOA F;  5L3C A;  2L54 A;  3WG9 A;  2CG4 A;  1PDN C;  4F55 A;  2H6C A;  1R23 A;  5FD6 A;  4R79 A;  1CGP A;  1Z67 A;  2LKP A;  3RKW A;  3CCU I;  1T0F C;  1XSV A;  4HX8 A;  4F3Q A;  2M4G A;  3R4K A;  2P4W A;  3V7R A;  2XF6 A;  1QVT A;  2M1B A;  3F9K A;  5J8C A;  5HDK A;  4Q5S F;  3G1L A;  2V79 A;  1A5J A;  4HPQ A;  4KIF A;  1YE9 A;  1FSE A;  5IT3 A;  3BG5 A;  3CUQ C;  1UJ8 A;  1OCP A;  1IN7 A;  1B8I A;  3CMA I;  1ZRE A;  1JI8 A;  2W57 A;  4BHB A;  1W7P D;  3JRC A;  2O7O A;  1MJB A;  3MKW B;  4RAZ A;  5J47 A;  5K5R A;  1JTY A;  1WJB A;  2B7E A;  2IVM A;  1FOK A;  1OQY A;  2FBK A;  3HZJ A;  3I55 I;  2VKD A;  2DOD A;  2LK2 A;  4KMU X;  4O6J A;  2RNG A;  2E5N A;  1ULY A;  5DS9 A;  3KYL A;  1RKW A;  4C2T A;  4UHT A;  3SHF A;  4YEJ A;  1R1T A;  2FQ3 A;  2EK5 A;  3VDX A;  5K7Z A;  2IGK A;  2ZFU A;  4CO8 A;  1ETO A;  2VOO A;  5LEK A;  4ZDO A;  2XIG A;  2CV2 A;  4UV8 A;  5LRR A;  1OCT C;  1YRN A;  4D7N A;  4XLH A;  4PJM A;  4BXU A;  1Y0N A;  1VND A;  3WHC A;  5LGT A;  3PSI A;  1ZGA A;  1U5T A;  4GYG A;  2DYR H;  1HW1 A;  4UUT A;  4P96 A;  3HL2 A;  1ZG5 A;  4ABZ A;  4C9Y A;  2IGO A;  5A2Q Z;  1X1P A;  4HEA 2;  4B44 A;  2YUS A;  3QWL A;  3BZ6 A;  3BR6 A;  2MFZ A;  1Z05 A;  4Q47 A;  4ANJ A;  2AHQ A;  2V4J C;  3S16 J;  2GWR A;  2Y9Z A;  1WJC A;  1ZRF A;  3RCO A;  1VI0 A;  2GQQ A;  4CYC A;  3G1M A;  4BDZ A;  2ELJ A;  2MSY A;  1T0F A;  1BOA A;  4NC8 A;  2UXX A;  3E6C C;  5H20 A;  4LIV A;  4HF1 A;  5FKM A;  2Q2E A;  3T0Y A;  4EJT A;  2A5Y B;  3JRB A;  1XSX A;  2TRT A;  4IL6 C;  4OWR B;  3MVP A;  4ZYH A;  2NNY A;  3CUQ A;  1YO5 C;  3BR1 A;  2EZK A;  5IOY A;  2KQR A;  4CCJ A;  1P6R A;  2IPQ X;  5EZH A;  3G1O A;  4LIU A;  3L2C A;  2A05 A;  3OWT A;  1MMN A;  1R5I D;  1XCV A;  2E7X A;  1D5V A;  5J4Y A;  2A61 A;  4DW6 A;  1KU3 A;  2OU2 A;  3JRA A;  2QBY A;  1UHW A;  2Y0M A;  3CMY A;  4KYW A;  4G8X A;  1ZQ3 P;  3OIQ A;  2VBX A;  5D5U B;  3OOU A;  2EFN A;  5F0F A;  5BS6 A;  1MD0 A;  1G8X A;  2DQL A;  2LFB A;  5ICG A;  2HWV A;  3KZZ A;  2BY0 A;  2VJ4 A;  2WC2 A;  3K7A J;  4IQ4 A;  4KIC A;  1U6G A;  3ULQ B;  1LDD A;  1UG2 A;  3DV8 A;  2YSR A;  1FPQ A;  4U0W A;  4M9S A;  3BDD A;  4AYB N;  4PJ0 C;  1D5Y A;  1TNT A;  1G2H A;  4AM3 A;  2LY9 A;  2OA4 A;  5DD8 A;  3QPS A;  1V5G A;  1WQ2 A;  3K4J A;  3G71 I;  4BNC A;  4IEJ A;  3CCE I;  5HS9 A;  3H5N A;  2R5Z A;  3S17 J;  4M3B A;  2FU4 A;  5CJ9 A;  1ETW A;  3W6K B;  1MDM A;  3WTT C;  3IAM 2;  3HUG A;  3CJT B;  2QSG X;  4G6T B;  1OCZ H;  1ZAR A;  2XC7 A;  3HG9 A;  4YEL A;  1TT0 A;  4MNU A;  2LR8 A;  2V1N A;  1Z0X A;  4HSR A;  5JHF A;  4HLY A;  3K4L A;  4MIM A;  5CVR A;  3LSK A;  2G7H A;  5K7H A;  5FRN A;  3M3Y J;  3BQZ A;  2E1C A;  2WAE A;  2EBI A;  3CF2 A;  4OAY A;  3A01 A;  2O03 A;  2MBF A;  3N4M A;  2K7L A;  3TBI A;  3RKX A;  1XCB A;  4B4C A;  4KIS A;  3S2W A;  3OS0 A;  3R0J A;  3S1Q J;  4HDU A;  4HRI A;  4J19 A;  2RKH A;  3IKV A;  4X0G A;  1H8A C;  2L7M P;  3J81 K;  2HDD A;  1LFP A;  1HOM A;  3U1K A;  2V1U A;  4BQA A;  1K7A A;  2DJN A;  3FBN B;  2EZH A;  2K9S A;  3L2V A;  3DP7 A;  3MQ0 A;  3BTL A;  3KZY A;  1U9O A;  1HDP A;  1Y8R B;  3EUA A;  3K1N A;  4LLN A;  5F6F A;  1QZY A;  2P5L C;  5EZG A;  4HLX A;  1IUF A;  5M3M J;  1BI3 A;  1V4R A;  5TJJ A;  4A6E A;  3Q3S A;  4H4K C;  4A5N A;  4IVN A;  3ZOB A;  2XGD A;  1I39 A;  1VZ0 A;  5B3S H;  1D8J A;  4RGS A;  2IA1 A;  4NQW B;  1IG7 A;  1RPW A;  4ZC3 A;  4ESF A;  4PDK A;  1Z77 A;  5KCM A;  2NVU B;  5GTH C;  3E1S A;  3LAP A;  1EF4 A;  4ZTF A;  4KJZ A;  1ZLJ A;  3RQ4 A;  5EGO B;  1GV2 A;  3I0T A;  3QOP A;  4I98 B;  3LA3 A;  2CUF A;  4LFU A;  2GLO A;  3BQY A;  3N97 A;  2UUZ A;  1MBK A;  3RSN A;  4CZZ A;  3MCZ A;  3SJM A;  3HPG A;  2X6O A;  3HKZ A;  5IY5 H;  3QRF F;  2O9L A;  4XRM A;  3WTU C;  1WSU A;  1YLF A;  3H3Z A;  3TW7 A;  2R5Y A;  3F72 A;  2DN0 A;  3HC7 A;  3OYG A;  4PK4 A;  3R61 A;  1XG1 A;  4M74 A;  4HX7 A;  1CF7 A;  1BI0 A;  2MD5 A;  5FKK A;  2J5O A;  1UHM A;  2W1O A;  5KAI C;  3MAJ A;  1XGN A;  3DPT A;  3RPU D;  3HOY J;  3BLY A;  1I50 J;  1OR7 C;  2VE9 A;  1X1B A;  4W1U A;  5D8L B;  5JVG F;  1IRX A;  1UZC A;  2M0M A;  1ZH5 A;  2RNJ A;  2Z2S B;  5C4X J;  4CXF A;  4C30 A;  2F5D A;  2VBZ A;  3TDU C;  4BEH B;  4U7B A;  4E7I A;  3GW2 A;  3O3K A;  1T8I A;  1FP2 A;  1YYV A;  2ME6 A;  3U2R A;  2HTS A;  2WBM A;  3HSR A;  1ZYR F;  3R0A A;  2GIV A;  1W7P A;  3HSE A;  2X4H A;  2L4M A;  2EZI A;  1RI7 A;  3B73 A;  1NK2 P;  2QUF A;  1WJ5 A;  3FF5 A;  2VT3 A;  3E5U A;  2EA2 A;  1D1B A;  1FP1 D;  1S9H A;  4G9Y A;  1B9N A;  3BTC A;  3BZC A;  1IDZ A;  2VQC A;  3D5R C;  3GEZ A;  2LVS A;  1W0T A;  3K70 D;  2P6T A;  1OFC X;  5DUI A;  4HAM A;  4IX7 A;  1A04 A;  1YX3 A;  3HGY A;  2O0Y A;  3FXJ A;  2O3F A;  5DV5 A;  3VSL A;  2XRO A;  1YG2 A;  1MSF C;  5F0C A;  1ZHF A;  1IRG A;  3A1Y A;  1VQ5 I;  1RNL A;  5B1B H;  3BTJ A;  1DPR A;  1WJF A;  2MH2 A;  1DU0 A;  1VF9 A;  4P1W A;  1WZ2 A;  2BZT A;  2DJI A;  2V1X A;  3PQK A;  2F5E A;  3AFH A;  3IV5 A;  4OOI A;  2LOO A;  1U78 A;  1IN8 A;  1G3S A;  1TQM A;  3FM3 A;  1BIB A;  2NVX J;  2K40 A;  4XLC A;  5IT9 Z;  4R1H A;  1I6H J;  2YR2 A;  1IN5 A;  2OCE A;  3DEE A;  5J8F A;  5D5V B;  3AG4 H;  1J2X A;  1G3Y A;  1OR7 A;  3IP4 B;  3BY6 A;  3PUB A;  3GTM J;  3QPT A;  2LF8 A;  2M7A A;  1FMV A;  1TWG J;  1F1Z A;  4OAZ A;  2O5R A;  1MNE A;  2BEO A;  2WV1 A;  4XSX F;  3HRU A;  5B5E C;  5FRO A;  4XID A;  1G4D A;  2XKO A;  2DOA A;  3FXR A;  3VOE A;  1IAW A;  3P7N A;  2LF7 A;  4S05 A;  1ZEL A;  2VOD A;  2XAG A;  3ML6 A;  2WAF A;  2X6Y A;  2DK8 A;  4FHT A;  2W24 A;  4I02 A;  1Z6T A;  2ZME C;  5CQE A;  3CCR I;  2DA3 A;  2FUG 2;  5D6E A;  1QPM A;  3V8J A;  5HNH A;  2P7V B;  3V7C A;  1WFX A;  3W6V A;  2CQK A;  3MMY B;  2ZCW A;  1WWX A;  4C3J J;  4ON0 A;  3KP2 A;  3B6C A;  2HVQ A;  4XKW A;  1EH6 A;  1OMI A;  2OD5 A;  2VQG A;  4XNF A;  3WE3 A;  1O4X A;  2KDO A;  1G3W A;  2QLZ A;  2EWN A;  2UWM A;  5ICC A;  3J7A O;  2JSP A;  4MEY F;  1S3J A;  2RQQ A;  2K27 A;  5E8I A;  1X4P A;  2KRC A;  4QTR A;  3GWZ A;  4BBS J;  2L2O A;  2RV8 A;  3OYB A;  2P0W A;  4C2U A;  5HDG A;  2VJI A;  1JTX A;  3ZCO A;  2A69 F;  4CHU A;  4BYY A;  2Y75 A;  1JUM A;  2X1D A;  1BN5 A;  2HYJ A;  2KL4 A;  3EUK L;  4LG0 B;  1TWF J;  2ZSH B;  1MBG A;  4IZZ A;  2FML A;  1ZG1 A;  5C4J J;  2OTJ I;  3TP3 A;  4RGU A;  4CYD A;  4CCM A;  4G12 A;  5DCM B;  4N9H A;  3RTR A;  4BE2 A;  2RVC A;  2ZO4 A;  3RI4 A;  3KZI C;  3OL4 A;  1LE8 B;  3HRM A;  4YIR X;  2L02 A;  4N4O B;  1DU6 A;  3WU2 C;  1JGG A;  4P9F A;  1RR8 C;  5JVT A;  4OMZ A;  1XX5 A;  3D5L A;  3T8T A;  3J7Z I;  1B59 A;  1VQ8 I;  3LAJ A;  1TZL A;  2OZU A;  1SFX A;  3JRE A;  4OIR F;  2ZME A;  1J7K A;  3DEU A;  4GDF A;  4Y33 A;  2JVG A;  2ICW G;  1LFB A;  5K5O A;  3CJR B;  5M5W J;  1VQK I;  4MTE A;  2PQ8 A;  4HQM A;  2M30 A;  3KYC B;  5F27 A;  2FBI A;  3ZN1 A;  2YU9 J;  3CC4 I;  1I3A A;  1SC7 A;  3E5Q A;  4A6D A;  3DLA A;  1IXC A;  1ETV A;  4WX9 A;  1L3L A;  5K7F A;  4IO9 F;  4M6X A;  3TOA A;  4XON A;  2O6G E;  4TV7 A;  1ODD A;  1XMX A;  2KZV A;  1ZKG A;  2I5U A;  2XAU A;  1LPQ A;  4FTH A;  1YX5 A;  4JYK A;  2LH9 A;  1I3Q J;  1FYM A;  4F7Z A;  3PIP F;  4AU7 A;  2VL8 A;  4WXC A;  4A3C J;  1Y6I A;  2JZY A;  4DYC A;  1WJA A;  1Z3X A;  2PBI A;  1Z3Y A;  3FXM A;  4I7H A;  1BA5 A;  5E1W A;  4BU2 A;  3L2Q A;  1XGS A;  4PZJ A;  2LP0 A;  3BWG A;  3TO9 A;  1GLN A;  1ZLK A;  5ERI A;  3K70 C;  5FLX K;  3BC8 A;  1BR2 A; 
#chains in the Genus database with same CATH homology
 3CMA I;  2E34 A;  3G71 I;  5DM6 F;  3J7Y J;  3CCE I;  5JVG F;  1VQL I;  3I55 I;  1YJW I;  1QA6 A;  1VQM I;  1YJN I;  3CJT B;  1S72 I;  3PIO F;  2QEX I;  1HC8 A;  3CCJ I;  3CME I;  2NXN B;  3CCL I;  2OTJ I;  4UY8 I;  3CC2 I;  1VQP I;  2JQ7 A;  2OTL I;  1Y39 A;  1YJ9 I;  5GAD J;  3G6E I;  1VQ7 I;  3J7Z I;  1VQ8 I;  3CD6 I;  1MMS A;  5GAG J;  1VQ5 I;  1VQ4 I;  2E35 A;  1VQN I;  3CCS I;  5GAH J;  2ZJP F;  5GAE J;  1VQK I;  2E36 A;  3CC4 I;  1YIT I;  2QA4 I;  1YI2 I;  3CCV I;  1ACI A;  3CCQ I;  4V19 K;  2ZJQ F;  1FOX A;  4IO9 F;  1VQ9 I;  3DLL F;  1FOW A;  2FOW A;  1YIJ I;  3CF5 F;  2H8W A;  1YHQ I;  1VQO I;  4IOC F;  4IOA F;  3PIP F;  3CCM I;  1VQ6 I;  3CCR I;  3CCU I;  1FOY A;  3G4S I;  2ZJR F;  5DM7 F;  2K3F A;  3I56 I;  3CC7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...