1VQNI

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqnI00
1VQLI 2ZJRF 1YJWI 1VQPI 1VQNI 1YHQI 2OTLI 3CCLI 1VQ7I 2ZJQF 3CMEI 4IOAF 3I55I 5DM6F 1YJNI 2E36A 1VQ8I 3G6EI 1YITI 1YIJI 2NXNB 1VQ9I 2FOWA 3CJTB 1VQ4I 3DLLF 1FOWA 2H8WA 2ZJPF 2JQ7A 3I56I 3CCRI 3CC2I 5GADJ 1FOYA 3CCSI 3CMAI 4V19K 1Y39A 3CC7I 3CCVI 2QEXI 1MMSA 4IOCF 1QA6A 1VQ5I 1VQOI 3CD6I 2E34A 3CC4I 2E35A 1YJ9I 5GAGJ 2OTJI 5GAEJ 2QA4I 5JVGF 3J7YJ 1HC8A 3CCQI 3CCEI 3PIPF 1YI2I 2K3FA 1VQKI 3CCJI 3PIOF 4UY8I 3J7ZI 5GAHJ 3CCUI 5DM7F 3CCMI 4IO9F 1VQMI 1VQ6I 1FOXA 3G71I 1S72I 3G4SI 3CF5F 1ACIA
chains in the Genus database with same CATH superfamily
2F4MB 3RIRA 1WI9A 2BGCA 2G7UA 2NVXJ 5B1BH 1W4MA 4M74A 4I0BA 2ZC2A 3OR2C 2QKLB 4Y3OA 2KRCA 1ETXA 1ZGAA 2RQPA 2R5ZB 3VDXA 2P5VA 4KN4X 3CMEI 2W1OA 2MSYA 3K2ZA 1OLTA 1XC5A 4M3EA 5EGOA 3WTYC 4ESFA 1Z9CA 5FFXA 4HNTA 4GDFA 2Y48A 5C4XJ 1G2HA 4MGRA 3FXKA 1SAXA 3OIOA 4PJMA 5JFRA 3DBLB 4RS8A 3LA2A 1YITI 4DIQA 4IHSA 1ZR2A 4XRMA 3CLQA 3Q3SA 2HYFA 2M30A 1Y56A 2XHKA 2Q2EB 4ZDLA 2DMTA 1Z67A 2DFEA 3JTGA 2WAEA 2K7LA 2QBYA 2H09A 4MFEA 2X85A 2CUEA 2OAZA 3WGIA 2KJCA 1V5EA 3LOCA 2CW8A 5KAFC 2M0CA 1YS7A 1Y39A 3F6OA 2BEOA 2VI6A 3ZQCA 3VSKA 3NARA 3ZMDA 1LDKB 1MJBA 4XRSG 5LHHA 2UV1A 3FK7A 4JBAA 3K1PA 5AONA 3V42A 1MSEC 3L2WA 4N9HA 1ONVA 1SMTA 2F48A 1X3UA 2VOPA 2K27A 1TTYA 3W3CA 1YW7A 5JHFA 2E1OA 4I0AA 4IJAA 1LUJB 3Q0WA 4H4KC 1IGNA 1QPMA 1MJ9A 3DKXA 2PQ8A 1J7KA 1IN4A 2BV6A 3IH4A 5E3OA 3KP6A 1BW5A 5D5UB 2EFPA 3HRUA 3K1NA 5C44J 2JPCA 4AVPA 3J7YJ 4HLYA 4FASD 1BR4A 2JA8J 1X2NA 3HTUA 4XOTA 1KU2A 3KP2A 2QKMB 4YG2F 2ID3A 4MNUA 1WQ2A 2DT7B 1GXPA 3CJNA 4BJTA 5LHIA 4AYBA 1YRNB 3DLAA 3I59A 2FBHA 3OYFA 3HRMA 3UNGC 1P7IA 3OL3A 2VASA 3F9KA 1KYZA 3TOAA 3KFWX 2GXBA 1BR1A 3M9AA 4XR6A 5L3BA 3MCZA 1WI3A 2ZXWH 4Y17A 3C2GA 3IRQA 3BY6A 3H9QA 4M6VA 2K5CA 1R58A 3PQKA 2OZ6A 3FBNB 3ULQB 2KP6A 4LJZF 1WJFA 3S2HJ 1MBEA 4GO1A 2XGXA 1TW3A 1EKEA 4R79A 1ETOA 3F8MA 5KHDA 5M3FJ 1BOAA 1VQPI 3DPTA 3LFUA 2O9LA 4BQQA 3FMRA 2FUG2 3H9GA 4H0EA 4E7KA 3KEYA 5DCMB 5EGOB 4PJLA 1FOKA 1EH8A 3KP3A 3VYTB 4PDKA 1YLFA 1USTA 3OIQA 2JSCA 5F6FA 2ZKZA 2E36A 4ZJZA 1XN7A 2BYVE 3MKLA 1B9MA 2QYOA 3SEZA 2FBKA 5IP7J 2HVRA 2EV5A 3KIOA 4BNCA 4BY7J 4O6JA 2ICWG 1SMYF 4HA8A 5HLIA 4E7SA 3KCCA 1S8NA 5CJ9A 2PX9A 2VB6A 4D0PA 2DA1A 1YW8A 5D8KB 4MQVA 1RKTA 4HV5A 5FLXK 3FWEA 4BHBA 2HZDA 2MLKA 2YS9A 3S14J 3CC7I 3R0JA 1MNMC 4KICA 4RM3A 4XQFA 2VBXA 3B6AA 1JE8A 1G8XA 2QCOA 2QEXI 3F21A 4CCLA 2A5YB 4WF2A 2M0MA 3KP4A 2NOJB 4HV6A 3GTQJ 1AU7A 4WK8F 3DCFA 4IQJA 6PAXA 3SHFA 1HBXG 4LD5A 1D1AA 4PFPA 2J5PA 2VL8A 4G6QA 4FQGA 1JTXA 1Z91A 1USSA 2ZSIB 1ETYA 2NYXA 2COMA 3T5XA 3H5NA 5TGTA 4AC0A 3IL2A 1RRJA 2HEOA 5GAEJ 2XV4S 3I3LA 3OYKA 4LITA 1OCPA 4MO7A 2M5WA 4EJOA 1NK2P 1KZHA 2AQEA 4IF4A 3HGYA 4F7ZA 2E2HJ 2E5ZA 4PUSA 4V2FA 1UELB 3DBRB 1TT0A 2FNAA 1MW7A 3IH3A 2HTJA 1R22A 2KMUA 2Y0SA 3QYEA 3I59B 3VODA 2IS4A 3K9TA 3OS0A 4L9JA 4E6KG 2O8XA 3KX2A 1LB2A 3VEPA 5HLGA 4KT5C 5FLMJ 5F0HA 4CA0A 3WU0A 4E7ZA 4PCQA 2M7AA 1J0RA 2KZGA 1LKXA 4L9NA 3TMOA 4XNFA 3HRSA 2IBDA 3S1MJ 2QWWA 3RKWA 5J8FA 3SFIA 3G4SI 1V54H 1MD0A 1LFBA 1I3AA 1Z77A 2KIUA 1P9QC 3HC7A 1FYLA 4EM1A 4A0YA 1B59A 2ETHA 3PQJA 4A69C 4P9UA 2X1EA 2HOEA 1JI8A 3I4PA 3M7GA 4BU2A 1R1UA 2X6XA 4RGSA 2I10A 2OTLI 2EA2A 2KRHA 3H0DA 2VJ5A 3FKIJ 3I5UA 5M5WJ 4HF2A 3E5UA 2E7XA 3KEOA 2EZLA 2XKPA 3FHZA 4A3JJ 3REOA 3ZOBA 3SDBA 4M73A 1DP3A 2EIKH 4CHUA 1W7PD 3BP8A 4EM0B 2EQRA 2XF6A 3MD2A 3M8JA 4E7HA 2G0EA 1YJNI 3RPUA 4II3A 2NNYA 1D0YA 3QYFA 5D4SA 2IS1A 4HDUA 1IXCA 1SVMA 5HLHA 4CICA 4I98B 4EJTA 1J75A 2QLZA 3H5RA 1HF0A 2V1UA 1TBXA 3P7NA 4HBLA 3H3ZA 1SVOA 4ESJA 3AG3H 4WXHA 3LSRA 2AHQA 1WVRA 3HL2A 1E17A 4Q5SF 2JSPA 1ZELA 3VPRA 2H94A 1S5LC 3BG3A 2CYYA 3E5QA 3EQLF 3FXRA 3HG9A 4BBRJ 1QZYA 2DA7A 2FQ3A 2XB5A 2A6HF 3ZQHA 1VQOI 4IHXA 2O5RA 3BQYA 3FK6A 4UUVA 2Y75A 5J47A 2ZXHA 2FNPA 5CVUA 3OR1C 1EH7A 2GQQA 2MYSA 1IRGA 1S3JA 5DS9A 2K4BA 1FIAA 2L9NA 4P1WA 4D7NA 4DYQA 3DKYA 4CH7A 1WFXA 4KIGA 2MH9A 5LBQA 4IKFA 3OV8A 1BJZA 1SFUA 2R7VA 2NAZA 5C4JJ 2VOOA 2R4GA 1TWGJ 3MVPA 2HVSA 1G6NA 4CCOA 4OIOF 3EPZA 3ABLH 3BC8A 1PYVA 3EUAA 2COBA 5CYVA 3IAS2 3J7ZI 2FF4A 2M1BA 1OPCA 4O3MA 3FIWA 2V6CA 3ZMSA 5FD6A 4ON0A 1T2KA 3JCUC 2JT1A 3Q9SA 2BY3A 4ETSA 2X6WA 1O7LA 3G73A 4C2MJ 3J7AO 3IKTA 3NWSA 1FYKA 3C18A 4CYCA 3K7AJ 2DODA 1ZG5A 1IC8A 2XF5A 3U21A 4G7HF 4BAYA 2L7MP 1R5ID 2P8TA 1R1TA 1X19A 1XSVA 1QVUA 2MH2A 3HDDA 1WWXA 3L2VA 3K70D 4BUPA 3ECOA 2JVHA 1ZGJA 3DEWA 2BOLA 1MSFC 2A05A 2EV6A 4UVAA 2DFHA 3KYCB 3HOTA 2JMWA 3V8LA 3TO7A 3K2AA 3I55I 3GTGJ 4YELA 3S32A 3Q0VA 4D5CA 4HNUA 2R7WA 4PGHA 4FX0A 2KQRA 1XG1A 2F5CA 3FXOA 2L9RA 4HRIA 2DMQA 3QU6A 4QIWN 5H6RA 2V4JC 1ORKA 1K4SA 4NB5A 2RDPA 5J1RA 4RAFA 3BCBA 2LLKA 4KNYA 4XRSA 3A02A 2LSOA 1X4OA 4EEFG 2H8WA 3CCRI 1GDTA 2O8KA 1XGMA 3FXMA 3A0HC 4LK0F 4XONA 3ASNH 2GA1A 3ABTA 2YSRA 2CV1A 4KMFA 2M7BA 1F5TA 3KETA 5F64A 2XIGA 3SYTA 3TOBA 4BKXA 1P4AA 4W1UA 1PUFA 5HLTA 1ZRCA 3TO9A 3QWLA 4QPOA 1UAAA 3ZMVA 1DQUA 2STTA 1SFXA 3ZMTA 3TDZC 3G2BA 1OFCX 5FGMA 4OIRF 2DJNA 1IN8A 3PUFA 1X1BA 1MJAA 1GXQA 1YE9A 2A6TA 4RLQA 1REPC 4LG0B 1BIAA 3CMMA 1MBKA 3E6CC 2DDBA 4J19A 4HEA2 1R5GA 2V26A 2HVQA 1G4DA 5F0CA 5DCFA 5LGUA 1C0WA 1W5TA 1Z6TA 5IOZA 1RR8C 4GYGA 3A01A 2XGDA 2L2OA 2XRNA 5EF6A 5KK1A 4U0YA 1ZYRF 2HFHA 3EYIA 2AS5F 5J3LA 5H20A 4IHTA 1GLNA 3S3MA 1NG7A 2LKSA 3VYRB 2CH0A 2HQRA 1KQ0A 3HB9A 2HDDA 5EZGA 3LSTA 5FKKA 3FZVA 4YIFA 4RDUA 2JUCA 2E60A 3JSPA 4HW0A 2HXOA 1N25A 4O5VA 4L9TA 3W6KB 1G3SA 3OYGA 3LFKA 1IN7A 5E1XA 4CYCB 2BZTA 1Y6IA 4B8XA 4M9SA 2DPDA 3VWBA 4WCGA 2O7OA 3WE3A 2R0QC 2FD5A 4XICA 5CVJA 4F3QA 1CQTA 3W2AA 1Z21A 2IEKA 2WAQA 4B48A 3GVAA 1B4AA 3DTIA 3FKJA 1SD4A 4XKCA 4RGUA 1SVLA 2DLLA 3ISPA 4JYKA 5KNLA 3AKZA 4A3MJ 5L3GA 3IC7A 2HOSA 5DM6F 2FMLA 4G7ZF 1K83J 2V6EA 3UKGA 5FLXZ 1R7JA 2I8DA 3O2PE 4IEJA 4X0GA 5FD5A 2UZKA 4NC6A 3CTAA 3PL8A 3H35A 5C3EJ 2FMYA 5J4VA 1TWCJ 2NXNB 3BWGA 2WB1A 4DQ2A 2LMDA 3E6BA 1HW5A 2VC1A 1Z05A 3OY9A 3JAMK 3ZPLA 4ZZDA 1JUMA 4F92B 3GFJA 3FBIB 5ED4A 2GA2A 1K79A 2R5YB 2P6TA 3CJQB 4B3XA 2HOTA 4PJJA 1I5ZA 3IV5A 2R5ZA 2Y9ZA 3FISA 3RKXA 1O3QA 2DYSH 3VFZA 2ME6A 4KA4A 5ICGA 3DEUA 4JOMA 3S8PA 5HDNA 4IHWA 2A69F 2P4WA 1ZG3A 4LK1F 5K5RA 1PUFB 3HOZJ 4ASNA 1H0MA 2LYCA 4UVCA 2GLOA 4D9JA 2TCTA 4A6DA 3MZ8A 2M8EA 2VLAA 2MW8A 3BT9A 1WJBA 3MEXA 3CO6C 1YFHA 4A3CJ 3HEFA 4M6XA 2LG4A 4HQMA 3D5RC 1U8RA 1BN5A 2FOKA 2GIVA 1P6RA 4A5NA 2Y0SN 1SC7A 3CZ6A 2LBFB 4V2GA 2EK5A 2W48A 4S0HB 2L7FP 2QSFX 2XAJA 3ZQ7A 1JUPA 3A01B 2GBYA 2GOMA 2K3FA 3TP3A 1ZREA 2BXYA 4GRIA 2R7TA 2JUGA 1IG7A 4XK4A 1O3SA 3HOXJ 1FSEA 2HQNA 2YU3A 1ZTRA 1W1WE 3WE2A 1U78A 3CMYA 4UV8A 5CQEA 4L0YB 1BOBA 2EV0A 3L7WA 2AO9A 3ERMA 1JHFA 4EGZA 4RLFA 4MHGA 2WAFA 1RI7A 4U7DA 4B47A 2XUBA 3KYDB 3S93A 2QUFA 4PSXA 5BNGA 1HW1A 3L2RA 1A04A 2UXNA 2X6YA 3K4CA 1HCRA 3N4MA 1V4RA 5IY5H 3K10A 3IAM2 5B1AH 1VQLI 3L00A 1ENHA 5GTHC 1YJWI 3BTIA 3KEQA 3LSHA 1S7AA 3MZHA 3GFIA 1QGPA 1IV8A 3KZYA 1WGXA 2M4GA 4KITB 4G7OF 1W5SA 2E71A 3GLLA 3QRFF 1GV2A 3TDUC 1DPUA 2E2JJ 3G3ZA 1U2WA 1KQ8A 3I58A 5FRMA 2XKOA 1VFCA 2ESHA 5AIPA 3PNTA 2VKHA 4HZFA 1WSUA 3PSFA 1VNDA 2PJRA 4DJAA 2ACJA 1XB4A 2MC4A 1R1VA 4BS9A 4NC8A 1R4NB 3SZGA 2V1DA 4G8XA 5IYBJ 4L18B 5DEQA 3AL0B 4AIJA 4CCJA 4ZH4F 1FTTA 3GUDA 4BEHA 3ZMZA 5DCMA 3OYIA 4IZZA 1ETWA 1XCBA 3OYMA 1I6HJ 3JR9A 2OJED 1W7PB 3BZ6A 3FXQA 2Q0OA 3VYSB 1RR7A 4EGYA 3CCVI 2QQ8A 1N77A 4B44A 2JN6A 2IS6A 1JT0A 4LGWA 2E34A 2R7FA 5HS7A 1TLHB 4Y13A 2IS2A 1MNDA 4AU7A 3C2HA 4W97A 5HNHA 1K6YA 2QVOA 3TEDA 1Y0UA 3MFKA 4G6TB 3BG7A 5L3EA 2NS7A 5B3SH 4XM3A 3R60A 1PVEA 2NNNA 2XAHA 1DUXC 4F55A 3CCQI 3BR3A 3D1NI 2L0KA 3HOUJ 2Y31A 1SFKA 3NWTA 1YIOA 3FF5A 4IX7A 2A6EF 4AUXA 2X9DA 1FJLA 3FXUA 5ILVA 2PBIA 1H8AC 3H36A 2DA2A 5IP6A 3RTRA 3BR1A 2LVSA 5DM7F 2WWYA 1P2FA 1X1CA 1UHSA 2R7DA 2AXTC 4ZC3A 3T0YA 5E3MA 2NVUB 3HTSB 4XKVA 1FP2A 3WG9A 1VQMI 1QPIA 4A3GJ 2NS8A 2K02A 3A1YA 1T08B 4DZJA 2RQQA 1B9NA 4EM2A 1RZ4A 1F1ZA 2K9QA 2C6YA 4JX5A 4XORA 4BXFA 4F93B 1Q1HA 5ICCA 4UV9A 4TV7A 1V55H 1I50J 4KMUX 2GXGA 4HSRA 4LLLA 5LHGA 3HHGA 2ADUA 2MBFA 4R1HA 5FKOA 4KIBA 2RNGA 3CF2A 4YIRX 1XDUA 5LFAA 4CCMA 1ZRDA 3F8BA 1D5YA 3BR6A 1OKRA 1KONA 2K85A 3BDDA 3QOPA 3P5JA 3U1KA 3I9V2 5IYDJ 4ZDPA 4GGGA 2ELHA 1ETVA 3CJRB 4B43A 1I6XA 1FIPA 1RETA 4QTRA 5M3MJ 2PJRB 1DGWY 5HODA 2RC4A 1E3HA 3L1PA 3X2QH 1S6LA 2EH3A 4D5FA 4HX4A 1RIOH 3S1QJ 3VB2A 5FO5A 4QLCU 3OSGA 3GW2A 4KUMA 2QSHX 2BVLA 3CJTB 3LQQA 2VBYA 2DI3A 3RPQA 2CQNA 4BEHB 2QSGX 3OYJA 1U9OA 2XDVA 4YFNF 1SD7A 3MWMA 5CVVA 3FXLA 4OAZA 1TNSA 4A12A 1ZHFA 1SAUA 5K5QA 1BIBA 2QENA 5BMZA 1X1DA 1ZKGA 1QA6A 1QO0D 2JRTA 3TQNA 1I1SA 5F0FA 4YRVA 2VKEA 4LFUA 5F1RA 5HS9A 4NDLA 1SD6A 2F6CA 2K86A 2PFBA 2W82A 2KIQA 3IWFA 2FSWA 2Y0MA 3LSIA 1FNNA 3M8FA 1MMNA 3M3YJ 4RB2C 4XLEA 4BACA 1NH3A 3ZR8X 4HYEA 3RYRA 4A3BJ 4IRGA 3K4BA 2LTPA 2PLYA 3S15J 2CU7A 2Y9YA 1HC8A 2EIJH 2B9SA 1S7EA 2JTVA 4A0ZA 2W00A 1H9GA 3HYIA 3I71A 1YI2I 4PSWA 2XC7A 2XAGA 5GP9A 2STWA 1V5GA 1IW7F 3LSPA 3LA3A 5BPIA 5D5VB 4EQQA 1EH6A 4WXCA 4M6YA 3QAHA 1IXRC 3CQZJ 4ITVA 4C30A 3ZP5A 1HA8A 2DK8A 4ENKA 2PMZN 1ON1A 2LOOA 2HQ5A 1SANA 3KP7A 3HKZA 1XTAA 4XBFA 1XS9A 1NTCA 3PFIA 4CCKA 2DA4A 3OYBA 2OU2A 1WJAA 4OINF 1RUNA 5FRNA 2FBIA 1XGNA 1P4XA 3ZXSA 2W24A 1HW2A 1I1GA 1W5CC 3VYUB 1XX5A 3OS2A 2AQFA 1XCVA 2ZJRF 2LR8A 1W36D 3L09A 1K4TA 2DO7A 3GLXA 2BXZA 1OISA 2NS0A 1E0EA 1OCZH 2PEXA 3CCLI 1VQ7I 3E97A 3WTWC 1JJ6C 2YX7A 3JAMZ 5J1UA 4CYDA 1QZZA 2DOFA 4ESBA 4YIIA 1NHAA 4P9FA 1GV5A 2Z5UA 1UHMA 2BHZA 1IF1A 1Z7LA 4M3DA 4N9IA 1KA8A 1ETKA 4EV0A 5ICEA 1WJDA 2VPLA 2XB0X 3CUOA 2E2IJ 2RV8A 4FE4A 2P7VB 4DGWB 4BGDA 2B7EA 3D5LA 3ROUA 5JLXA 2M45A 3CUQA 3WG7H 2ZO4A 2DT5A 1BI3A 1RC9A 1MBHA 3SZPA 3OSFA 2K3PA 3MKZA 1F36A 4ENNA 3MKWB 2HQAA 1A35A 3LSMA 2EFQA 2DN0A 3L2QA 4HQEA 3WTUC 3I64A 2JWTA 9ANTA 2ECCA 2L54A 4IOCF 5H6QA 1G59A 1A31A 3P9KA 2LFBA 1T95A 2ZNZA 3ZN1A 4I2OA 2Z3YA 3RJPA 3GO5A 1R71A 2HR3A 3DTEA 1J9IA 3BTLA 3KYLA 3EYYA 3HOSA 4HDVA 2DOAA 3BROA 2L9VA 1TWFJ 1D5VA 3ZRGA 2K40A 3W6JB 1OR7A 1WJ5A 2F5VA 2CG4A 2WA0A 4U0VA 1S7OA 1AKHA 1YOVB 2M87A 1DU0A 3OYLA 1LQ1A 2DOEA 4JP0A 1MBFA 4JX4A 3V4GA 1HKTA 2ME0A 1IXSB 2V79A 2VN2A 3BOQA 3G1OA 3V8JA 5IP9J 1LDJA 2E7WA 3RQIA 3CDLA 3PM1A 1ZAOA 4M3GA 1SD5A 3CO7C 4LG0A 1V5FA 2A68F 1ZGWA 2DCEA 5J4YA 4IHVA 2VE8A 2XGEA 2ZFUA 2UUZA 1ITYA 2P81A 1HLVA 3KZZA 1RPWA 3V7RA 3RQ4A 2XVCA 3GWZA 1B8IA 3RZDJ 1OCRH 2P0WA 2HYJA 4CZCA 3OYAA 2QF7A 4AVZA 4Z2YA 2CW0F 2QM3A 2ZMEA 3B73A 2V9VA 4Y15A 1E3PA 2NVTJ 3OYHA 1O57A 1H89C 2ZJQF 1W0TA 3SJMA 4XSZF 2VBWA 1MIJA 2DTZA 5GTIC 3S2DJ 2OCEA 3O8GA 1HKQA 2KJBA 1FMWA 2L7ZA 4RB1A 2R7RA 2IGKA 1TP4A 4BQNA 4CSWA 3U1DA 4RAYA 2OD5A 1XSXA 1BJAA 1FY7A 4A6EA 4BHPA 5HNFA 2OC6A 1RUOA 1GVJA 2GZWA 3EUKL 3HSFA 5FLVA 3TP0A 1DU6A 5LGNA 1L3LA 1DDNA 1S9HA 3JREA 1VTNC 4XOPA 1UZCA 2VIXA 3QP5A 2QQ9A 1WJCA 2E5NA 4HF1A 3KLNA 2YUSA 5CVRA 1J59A 1LVAA 3AG4H 2TDXA 1KU9A 3CUQB 3O3KA 3DLLF 1IAWA 4XKWA 3CESA 5BOXA 5J1YA 3WODF 1U9NA 2DA5A 4Q4ZF 4KYWA 4ZYGA 4AIKA 4AIDA 2X4HA 4R8HA 3SXYA 1ZARA 4MTDA 4QWQA 2RVCA 3FXJA 1U3EM 1U8BA 1STZA 4C9YA 1XMKA 2HXIA 1JGSA 2CQXA 2LDUA 1VI0A 1OJLA 2EZKA 2XAUA 5HS8A 2E1CA 1FBQA 3LWFA 1KYWA 2YX4A 4DW6A 2WY7Q 5CQGA 1J5YA 4CDGA 4F91B 2KIFA 1XSDA 4BY1J 2W84A 5E1ZB 3L2UA 1DGRM 2HGCA 1X4PA 2E1MB 1IRFA 4XKBA 3S3NA 1F43A 2R5YA 1OYIA 4LIUA 1JGGA 4RB0A 4BQAA 1K6OA 2H6CA 1S29A 2QGUA 3M1EA 2F4IA 2ZSHB 3CDIA 5D6FA 1T33A 3MMYB 2GWRA 3PO3J 2WV1A 1SFEA 1AKHB 1BBYA 3IUOA 5J8CA 4KT6A 5TISC 3FDYA 3WU1B 1OCTC 3GZNB 5L3DA 3PIOF 3GZ6A 2LREA 3Q9VA 4I01A 2I5UA 3HRTA 3CP8A 1UB9A 4FTHA 1R49A 4LOCA 2DYRH 2X48A 5IYCJ 4B4CA 4QPQA 5K7FA 2IAIA 1BI0A 4RGXA 2VC0A 3J80K 1FP1D 1A5JA 2IA1A 5AIQA 1RNLA 1GVDA 1FYMA 3EDPA 4AYBN 4BJ6C 4PGGA 4DBRA 3GYHX 2LBFA 2ISZA 4M3FA 3D0SA 3DP7A 2NRAC 1B8IB 4FT8A 2DA3A 5D5XB 2JVGA 3DEEA 2EINH 1MKMA 2ZMEB 3JRCA 2HPMA 1IUFA 3RI4A 4Y52J 1A6QA 2VJ4A 3ZGKA 3A4CA 3AL0C 4CUGA 5JVTA 1Z3YA 1FC3A 3JSOA 2KIMA 4A3DJ 5IT9K 1LVKA 5HDGA 2XPWA 5JHUA 5D5WB 3E7LA 3DXJF 5LEKA 2JZYA 3DQVC 3GF2A 2LD5A 1X1PA 2VKVA 1J09A 3I53A 4JX6A 1IN5A 1YW9A 1OCOH 2VQLA 4I99C 2V9PA 3K4JA 2QQBA 4FE7A 4IL6C 1UJ8A 5ILUA 2L4AA 4BE2A 1BC7C 5F08A 4B09A 2RAEA 3ZQFA 1UG2A 1JTYA 1WRJA 1LNWA 3WU2C 2KFDA 4NC7A 1UHWA 1BI2A 1FLIA 3DTKA 3TKYA 2JK3A 2H1LA 2WY8Q 2YU9J 5LD2C 3NRVA 1T56A 4BH9A 2K4JA 4XLCA 4DYRA 1HSJA 3R0AA 2L3DA 3NQOA 3CC4I 1YG2A 3HPGA 4IRHA 2HU9A 4ZYDA 3SDGA 4EJUA 2XSDC 3GXOA 2YPRA 1CF7A 2DMUA 4NBQA 4PJ0C 2D45A 1ON2A 1K78B 4BL0B 2QA4I 3QP6A 2ESNA 1ZH5A 4G94A 1D8JA 1EJ9A 2BY2A 1FPQA 3K4NA 3P9IA 4K2EA 2IA0A 3ZQGA 1U5TA 1W7PA 4G9YA 4BDZA 2CUZA 3ELKA 1YTYA 4KFCA 2V7FA 1VQKI 2H27A 2VT3A 3I0TA 3HXLA 1Z7UA 2IP2A 2K9MA 3LAPA 3R61A 1GUUA 5LRRA 4OU0A 3BG6A 5KCMA 2HPIA 2XASA 2DU9A 2LK2A 2OQGA 5CPRB 3GFLA 2CFXA 1O3RA 1IDZA 4BXUA 4EMSA 5LRSA 3TW7A 2EZHA 4HF0A 2CGPA 1ZN2A 4D1QA 3QPSA 4LLNA 1LPQA 3EETA 3ZN0A 1H9TA 1X3WB 3K70C 1QZEA 4EVIA 5DTDA 3GTKJ 4XN0A 2IW5A 3TO6A 3S1NJ 4MIMA 3JRAA 3C7JA 1B6AA 1FT9A 2Z9OA 2VE9A 3OMYA 2HOAA 4HX7A 4A2UA 4BE0A 4ZYEA 1Y0NA 2DPUA 2IA2A 2OF7A 4UHTA 4AD9A 4Z6YA 1X2MA 3N05A 3LAJA 1Y8QB 3H92A 2VJJA 3RCOA 2FA5A 2XGCA 1ETQA 4RGRA 2VBZA 5DUKA 5K7HA 1BR2A 2FOWA 2CS3A 5LLQA 3JRHA 2JA5J 3PJRA 4I6ZA 3GTPJ 5E17F 1GT0C 1R23A 2CW7A 3PNVA 1WKMA 2BVMA 2ZJPF 2JQ7A 4LLGF 2KDZA 3CC2I 2L9SA 3CCSI 4ENJA 2OCCH 3LSKA 2VONA 1F9NA 1DP7P 4AIHA 3JRGA 2D1VA 2WADA 2P5LC 3H0GJ 2BE5F 2GOXB 1HSTA 3J81K 4DNCA 1JXSA 1Z3XA 3SQNA 2M2EA 4OIPF 1PP8F 4ABZA 3K1MA 4HOBA 3ECHA 1T8IA 3PO2J 1IRZA 1CF7B 1APLC 3BR2A 4LB5A 3AG1H 4EATA 3J7AY 2VPRA 2OQRA 2Y30A 4N4OB 1TWAJ 2CUJA 3LL7A 5JVGF 1K61A 4L5JA 1E3OC 3R6SA 1U5TB 4EJVA 3BTJA 4NHJA 3K69A 3EUHA 2CSOA 2LF7A 2PJPA 4M9XA 5IOYA 1XD7A 4GXOA 1D1CA 3WGHA 1ZLJA 3TL4X 2DTRA 2FEZA 1T0FC 3ZMUA 2KKOA 1VF9A 2F5FA 3ERED 3A2KA 4ZDOA 1WPKA 1BI1A 4Y33A 3T1BA 2N8GA 3BJ6A 2DMNA 2EFOA 1RKWA 2A5WA 2KISA 4MTEA 5HOOA 4HPQA 3I4MJ 1ULYA 2R7ZJ 3K4LA 1VQ6I 3WTZA 1BC8C 1S72I 2CV0A 4FETA 4UB8C 4UNOA 3CF5F 5D4RA 4J01A 2EJRA 1MMDA 3V7SA 3HOVJ 4AWXB 5LGTA 2VJIA 4RA2A 4GCVA 4MLOA 2VQGA 1LE8A 2BY1A 4ENMA 1Y1VJ 3RZOJ 1B1BA 1DPRA 5L3FA 3K6GA 2O61A 2XSJC 3E6MA 2W25A 2IT0A 2D2WA 3BZKA 1QBJA 2LY1A 3DPLC 3GX4X 1MGTA 4OMYA 5TRDA 2DXIA 5DDGA 2BBYA 3V8KA 3G1LA 2CFOA 1ZLKA 1Q1VA 3PFYA 4MEYF 3TGNA 3BJAA 3KP5A 3KE2A 1MMAA 5EDNA 4HAMA 1FX7A 4NUBA 2EB7A 2P6SA 4XIDA 1HDPA 3GZ5A 4Y7NJ 3CCYA 2MD5A 1T0FA 2EIMH 2NVQJ 1LFPA 1V3FA 5A2QK 1HDDC 1FOWA 4YFXF 1G3YA 1FBUA 1MNEA 2A3SA 3C3WA 5JLWA 1TQMA 2RREA 1P4WA 2Z16A 5CVIA 1JT6A 4XN3A 1JJ8C 3L2CA 2EPFA 5M5YJ 4E7JA 2WV0A 1EF4A 3S17J 2GIZA 3GTMJ 3CDHA 3U2RA 2FXAA 3MZYA 3T8RA 2E35A 2L5QA 3S16J 2LNBA 1JUSA 1T39A 4JK1X 2O0YA 1T38A 1L0OC 1G3TA 1XPXA 3BG5A 3O6BB 4WWCA 2LH9A 4BE1A 1R9TJ 2R92J 1EA3A 3OYDA 2R7SA 5GPCA 3VSLA 3K4MA 4IXAA 3J80Z 4A3FJ 2BW3A 2L01A 2QZ8A 2ZXIA 2Z2SB 2V9KA 3LA7A 1A36A 3CLOA 1BL0A 2D1HA 4CGZA 2ELKA 4KIFA 1QNTA 5K1YA 4DOZA 1Y8RB 3CCJI 2HWVA 5E1WA 4MEXF 1QHGA 5FJ8J 2DMPA 1MH3A 1Z0XA 1QQIA 2JPBA 2KPMA 1ODDA 3BR5A 1ZRFA 1UG0A 1TL8A 2H1KA 4E4HA 2UWMA 4FISA 5EZHA 5GPAA 1HKSA 4IO9F 1R36A 4C2TA 5IT9Z 2NVYJ 4XLAA 5K7ZA 2J5OA 2W7NA 3I4NJ 4WX9A 2HZTA 1XDSA 3HSRA 3F8CA 3WTXC 2CQQA 3ZQQA 1UMQA 1RESA 1WJEA 1PUEE 3BR0A 4OMZA 4NNJA 3TBIA 2QBYB 3F72A 4U0WA 1VQNI 4AM3A 1LE8B 4Q47A 4XL9A 3COAC 3CUQC 2ZB9A 3OIPA 1WH5A 4PK4A 1BM9A 3HIFA 2Q8KA 4X6AJ 5KVRA 4LMYA 2CUFA 5EEGA 1MMGA 1WCMJ 5ERIA 1PDNC 3OYEA 2JRMA 2XPUA 2B63J 2TRTA 2WAQN 2V1NA 4A0XA 4HLXA 1VQ8I 3GTJJ 4BQOA 2MC3A 3G6EI 4P55A 1IJWC 1TWHJ 1SEUA 3QQAA 4OAYA 1LJ9A 3F8NA 5JR3A 2AXLA 3BZCA 4BHCA 3S1RJ 4OIQF 2E1MC 1X3ZB 4WXDA 2EFNA 1OQYA 3DU6A 4BJ5C 1MBJA 5L3CA 4U87A 3CMAI 2EA4A 1OR7C 2GAUA 2WB1N 3AFHA 2F5DA 4S05A 2E19A 2ISYA 4KJZA 3U9GA 3MQ0A 1JKRC 1O7FA 2W4SA 1WZ2A 2CWEA 3FM5A 2VODA 5F27A 1TQIA 2DFFA 2Y2ZA 2WTEA 3KPHA 3JRFA 1YJ9I 5GAGJ 1FBSA 2R7XA 4P96A 4E7LA 2R3SA 2L4MA 4B3AA 3I54A 3HPHA 2CO5A 1R6RA 2ELJA 2ZBKA 5DYMA 4LB6B 4UB6C 3HM5A 1IDYA 2Y69H 1JKOC 4HNVA 4MQ9F 4S04A 5HDKA 2BW3B 2JJ7A 2W57A 5E3NA 2JA2A 3H9JA 3OYNA 2DDAA 2OZUA 3PIPF 3E3VA 4C2UA 4FCYA 3B02A 3F0CA 2VXDA 3A03A 1YS6A 1JHHA 2ZMEC 4HG2A 1TZLA 2VQCA 1F4KA 4UY8I 4KN7X 3F22A 4DBQA 4MFDA 2H8RA 2NOGA 5GAHJ 4XMYA 1A6IA 1EV7A 3DBHB 4I02A 2P5KA 2EFWA 1R5HA 2CQKA 2MABA 4E7IA 4UUSA 2KZVA 4EJWA 3M1CA 1LEAA 4II2A 3SZTA 4ZTFA 2KRFA 1IN6A 2XAFA 3Q0UA 4IHYA 3G71I 2Z33A 2PG4A 2IVMA 3LSGA 3O8HA 3MKYB 4KISA 3FMSA 2LP0A 3BJOA 3BPVA 5DD8A 1KU7A 3N97A 5E18F 3NEUA 2OV7A 2OPTA 2JA7J 1D1BA 3SEQA 1M1EB 1YHQI 3BLYA 4LG3A 2LY2A 2RKHA 4IOAF 4C3JJ 5EJCA 1D0XA 4HX8A 5FKLA 4N4NB 1KQ9A 1TQPA 2K9NA 3DV8A 4M71A 1X58A 3M07A 4A3KJ 1OYYA 1MH4A 2H6BA 4IVNA 2Q1ZB 1TC3C 2VQHA 2IGNA 3G1MA 2X0LA 1D3YA 2W85A 2KHMA 1G3WA 4HSTA 1PJRA 2R7OA 3P9CA 5D6EA 2M8GX 3S2WA 1W0UA 1MDMA 4ZTJA 3J81Z 1VQ9I 2JA6J 3QPTA 2KL4A 2KDOA 2M4KA 1FMVA 3IHUA 3UR3C 5LEJA 3VOEA 4BXXJ 2CRGA 4G6DA 1BA5A 3HUGA 3CP2A 2O03A 3I56I 5GADJ 1U6GA 1FOYA 3F23A 1J2XA 4PZJA 4X1EA 1Z1DA 4FX4A 2Z99A 1MMSA 1Y1WJ 2DBBA 2V1XA 1B72A 4CO8A 2QQAA 1JKPC 4A93J 2CQ7A 1WH7A 2LY9A 4DZPA 3IH2A 2OTJI 3NAUA 4PFOA 2LC2A 3FMQA 2HKXA 4IPAA 3SFZA 2MA3A 1GHCA 1D8KA 2HYGD 5F04A 1MBGA 1UCRA 4C3HJ 4ZYAA 1ZQ3P 1QVTA 4OWRB 1XMAA 2XROA 3WTSC 5FROA 1UFMA 1TW2A 3A0BC 2D5VA 3WTTC 1IRXA 2VUMJ 4BDYA 3CCEI 3KLOA 3F3XA 5M5XJ 5EEAA 2RN7A 4M9ZA 5K5OA 3ONQA 1XGSA 4L5EA 3H3UA 5EYRA 4CZZA 3ESWB 3OOUA 3RKYA 3HSEA 3DU5A 3BQZA 5B5EC 2WBMA 4UUSB 5IT3A 4U88A 4QSHA 1K78A 4XLPF 3GMEA 1N78A 2BY0A 2ECBA 5H2FC 4A3EJ 1AWCA 4XRFA 2EWNA 4Y4RA 3HHHA 1I27A 3RDIA 1WHUA 3WTVC 2XAQA 3HJEA 4I7HA 4NQWA 2ZXJA 2RGVA 3MN2A 1T98A 1YO5C 2PN6A 4XLNF 1W36C 3OL4A 1P92A 1IZ1A 2F2EA 3HZJA 4F52A 5BQTA 2DW4A 1D0ZA 5CLSA 4LIVA 4CXFA 4IRIA 2CMPA 4JQFA 2ID6A 3WHCA 4RBOA 3M4OJ 5DV5A 1AOYA 2ZCWA 3W2WA 2DA6A 2E1NA 5A2QZ 3ASOH 4UVBA 5CKTA 3PNYA 1OYWA 3MAJA 5EG0A 1FTZA 3M8EA 1FWZA 1QHHD 3FHNA 2MD0A 3JRIA 2CJJA 1NK3P 1JKQC 4OOIA 3JW4A 4P5OA 1I3QJ 4XLHA 5DUIA 4XSXF 4A3IJ 1YIJI 1MDMB 2VXZA 1R00A 2ZJ2A 3LSJA 3E6DA 2DQLA 2IPQX 5E79C 2MGQA 3RSNA 2WC2A 3F6VA 3HUGB 4PJNA 2XRLA 4YEJA 1TT5B 2LRDA 2VT2A 3E1SA 1YX5A 2HNHA 3JRBA 5D8LB 1T6SA 3E0JB 1FEXA 4V19K 1U5TC 2YR2A 4RMNA 2P7CB 1ZG1A 2X6OA 3K0LA 3WHBA 3OYCA 2A61A 3ZCOA 1B72B 1ZK8A 2R7QA 4A5MA 5F1JA 2Z1DA 3V7CA 2FE3A 2B0LA 1YX3A 3QPHA 3DPUA 2MFZA 2M34A 1X1AA 1HQCA 1SFOJ 5E20A 3IP4B 4UUTA 3F8FA 1LEBA 4BBSJ 1NG6A 2FJ1A 3W6VA 3ABUA 1FSHA 2DAOA 1P7JA 3JRDA 4CCNA 2IJLA 3S3OA 3IRRA 2GXAA 2L7KA 2DQRA 4I09A 2F4OB 2IXSA 2M9HA 1R4MB 2PMZA 4M72A 1QRYA 2KT0A 4IQ4A 3W2VA 3TW6A 4J00A 4RAZA 2FRHA 4ZYHA 3HBLA 4RM2A 4DYCA 2X1CA 3L9FA 1XMXA 2ZNYA 5E8GA 1Z6RA 3JTHA 2DJIA 3CCUI 4M3BA 2FQ4A 2OUMA 2DFIA 2F5EA 3CCMI 5JI6A 3QU3A 4XLFA 3H5AA 3D5SC 1POGA 2X1DA 4G12A 3BCAA 1XGOA 2PMHA 2FU4A 2DK5A 3RKQA 1OMIA 2OA4A 5J40A 1FOXA 1ZR4A 4RB3C 2LKXA 3Q5FA 1O3TA 2XF7A 4NQWB 2PI0A 3H3VK 1ACIA 4YFKF 4L9VA 3B6CA 4C3IJ 3HKZN 3ABKH 1PP7U 4B1RA 4UXNA 4GFBA 4U7BA 3OOPA 2IGMA 3AG2H 5FB2A 1O4XA 1E2XA 2OBPA 2GM4A 4KDPA 2LKPA 3GFMA 5E8IA 1HXDA 5EG0B 2EILH 4Q48A 1LFUP 5EEHA 2RNJA 4N0BA 3RYPA 3T8TA 2XPVA 2M3AA 4RAGA 1VZ0A 3FM3A 1IV6A 1KU3A 2R93J 1H88C 1CGPA 3BTCA 2HDCA 3GEZA 2G7HA 2FX0A 3HGGA 3QODA 3HOWJ 1LDDA 2Q2EA 5FKNA 3LQRA 4E70A 1FZPB 3GCMA 1MZBA 3QYBA 2L02A 1VQ4I 3PUBA 2G9WA 5BPDA 1HOMA 1YQAA 5E3LA 5BS6A 2HKOA 2HS5A 3PSIA 1ERDA 1IUYA 1IO2A 1YYVA 3AAFA 3EUHC 3DFGA 4BYYA 3HOYJ 5DD4A 4A3LJ 1VQ5I 3E5XA 5B66C 3CD6I 1OCCH 2MLGA 3FX3A 4L0ZB 4L5IA 2O6GE 2BHYA 3QOEA 4D7MA 2R7UA 2CV2A 3ZQLA 3K4KA 3DWLE 1K7AA 1TNTA 3BG9A 5J6XA 4GYIA 3IKVA 1N75A 2HTSA 4ANJA 5ILSA 1KGSA 3KZIC 2IRFG 1I39A 2KLOA 1BW6A 3DF8A 4I76A 1AA7A 2LF8A 2X51A 5IPAA 5FFZA 3OWTA 1AHDP 5ICFA 4ZZLA 2A07F 5HVQC 3ML6A 2ZFWA 3C1DA 3OS1A 2PMUA 3LNQA 3GBGA 3QPLA 1YRNA 1QU3A 5KAIC 3ABMH 2K9SA 3C2BA 2EBIA 2IGOA 3LMMA 4FHTA 5TJJA 3IWZA 3DKWA 2MG4A 3ZQIA 2K9LA 3R4KA 2HDWA 3WGGA 3GTOJ 3BPXA 3RPUD 2DT6A 3GTLJ 3H1CA 2HI3A 2O3FA 2VKDA 2EZIA 2UXXA 5FKMA 1U0JA
chains in the Genus database with same CATH topology
1VQLI 2ZJRF 1YJWI 1VQPI 1VQNI 1YHQI 2OTLI 3CCLI 1VQ7I 2ZJQF 3CMEI 4IOAF 3I55I 5DM6F 1YJNI 2E36A 1VQ8I 3G6EI 1YITI 1YIJI 2NXNB 1VQ9I 2FOWA 3CJTB 1VQ4I 3DLLF 1FOWA 2H8WA 2ZJPF 2JQ7A 3I56I 3CCRI 3CC2I 5GADJ 1FOYA 3CCSI 3CMAI 4V19K 1Y39A 3CC7I 3CCVI 2QEXI 1MMSA 4IOCF 1QA6A 1VQ5I 1VQOI 3CD6I 2E34A 3CC4I 2E35A 1YJ9I 5GAGJ 2OTJI 5GAEJ 2QA4I 5JVGF 3J7YJ 1HC8A 3CCQI 3CCEI 3PIPF 1YI2I 2K3FA 1VQKI 3CCJI 3PIOF 4UY8I 3J7ZI 5GAHJ 3CCUI 5DM7F 3CCMI 4IO9F 1VQMI 1VQ6I 1FOXA 3G71I 1S72I 3G4SI 3CF5F 1ACIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL I;  2ZJR F;  1YJW I;  1VQP I;  1VQN I;  1YHQ I;  2OTL I;  3CCL I;  1VQ7 I;  2ZJQ F;  3CME I;  4IOA F;  3I55 I;  5DM6 F;  1YJN I;  2E36 A;  1VQ8 I;  3G6E I;  1YIT I;  1YIJ I;  2NXN B;  1VQ9 I;  2FOW A;  3CJT B;  1VQ4 I;  3DLL F;  1FOW A;  2H8W A;  2ZJP F;  2JQ7 A;  3I56 I;  3CCR I;  3CC2 I;  5GAD J;  1FOY A;  3CCS I;  3CMA I;  4V19 K;  1Y39 A;  3CC7 I;  3CCV I;  2QEX I;  1MMS A;  4IOC F;  1QA6 A;  1VQ5 I;  1VQO I;  3CD6 I;  2E34 A;  3CC4 I;  2E35 A;  1YJ9 I;  5GAG J;  2OTJ I;  5GAE J;  2QA4 I;  5JVG F;  3J7Y J;  1HC8 A;  3CCQ I;  3CCE I;  3PIP F;  1YI2 I;  2K3F A;  1VQK I;  3CCJ I;  3PIO F;  4UY8 I;  3J7Z I;  5GAH J;  3CCU I;  5DM7 F;  3CCM I;  4IO9 F;  1VQM I;  1VQ6 I;  1FOX A;  3G71 I;  1S72 I;  3G4S I;  3CF5 F;  1ACI A; 
#chains in the Genus database with same CATH topology
 2F4M B;  3RIR A;  1WI9 A;  2BGC A;  2G7U A;  2NVX J;  5B1B H;  1W4M A;  4M74 A;  4I0B A;  2ZC2 A;  3OR2 C;  2QKL B;  4Y3O A;  2KRC A;  1ETX A;  1ZGA A;  2RQP A;  2R5Z B;  3VDX A;  2P5V A;  4KN4 X;  3CME I;  2W1O A;  2MSY A;  3K2Z A;  1OLT A;  1XC5 A;  4M3E A;  5EGO A;  3WTY C;  4ESF A;  1Z9C A;  5FFX A;  4HNT A;  4GDF A;  2Y48 A;  5C4X J;  1G2H A;  4MGR A;  3FXK A;  1SAX A;  3OIO A;  4PJM A;  5JFR A;  3DBL B;  4RS8 A;  3LA2 A;  1YIT I;  4DIQ A;  4IHS A;  1ZR2 A;  4XRM A;  3CLQ A;  3Q3S A;  2HYF A;  2M30 A;  1Y56 A;  2XHK A;  2Q2E B;  4ZDL A;  2DMT A;  1Z67 A;  2DFE A;  3JTG A;  2WAE A;  2K7L A;  2QBY A;  2H09 A;  4MFE A;  2X85 A;  2CUE A;  2OAZ A;  3WGI A;  2KJC A;  1V5E A;  3LOC A;  2CW8 A;  5KAF C;  2M0C A;  1YS7 A;  1Y39 A;  3F6O A;  2BEO A;  2VI6 A;  3ZQC A;  3VSK A;  3NAR A;  3ZMD A;  1LDK B;  1MJB A;  4XRS G;  5LHH A;  2UV1 A;  3FK7 A;  4JBA A;  3K1P A;  5AON A;  3V42 A;  1MSE C;  3L2W A;  4N9H A;  1ONV A;  1SMT A;  2F48 A;  1X3U A;  2VOP A;  2K27 A;  1TTY A;  3W3C A;  1YW7 A;  5JHF A;  2E1O A;  4I0A A;  4IJA A;  1LUJ B;  3Q0W A;  4H4K C;  1IGN A;  1QPM A;  1MJ9 A;  3DKX A;  2PQ8 A;  1J7K A;  1IN4 A;  2BV6 A;  3IH4 A;  5E3O A;  3KP6 A;  1BW5 A;  5D5U B;  2EFP A;  3HRU A;  3K1N A;  5C44 J;  2JPC A;  4AVP A;  3J7Y J;  4HLY A;  4FAS D;  1BR4 A;  2JA8 J;  1X2N A;  3HTU A;  4XOT A;  1KU2 A;  3KP2 A;  2QKM B;  4YG2 F;  2ID3 A;  4MNU A;  1WQ2 A;  2DT7 B;  1GXP A;  3CJN A;  4BJT A;  5LHI A;  4AYB A;  1YRN B;  3DLA A;  3I59 A;  2FBH A;  3OYF A;  3HRM A;  3UNG C;  1P7I A;  3OL3 A;  2VAS A;  3F9K A;  1KYZ A;  3TOA A;  3KFW X;  2GXB A;  1BR1 A;  3M9A A;  4XR6 A;  5L3B A;  3MCZ A;  1WI3 A;  2ZXW H;  4Y17 A;  3C2G A;  3IRQ A;  3BY6 A;  3H9Q A;  4M6V A;  2K5C A;  1R58 A;  3PQK A;  2OZ6 A;  3FBN B;  3ULQ B;  2KP6 A;  4LJZ F;  1WJF A;  3S2H J;  1MBE A;  4GO1 A;  2XGX A;  1TW3 A;  1EKE A;  4R79 A;  1ETO A;  3F8M A;  5KHD A;  5M3F J;  1BOA A;  1VQP I;  3DPT A;  3LFU A;  2O9L A;  4BQQ A;  3FMR A;  2FUG 2;  3H9G A;  4H0E A;  4E7K A;  3KEY A;  5DCM B;  5EGO B;  4PJL A;  1FOK A;  1EH8 A;  3KP3 A;  3VYT B;  4PDK A;  1YLF A;  1UST A;  3OIQ A;  2JSC A;  5F6F A;  2ZKZ A;  2E36 A;  4ZJZ A;  1XN7 A;  2BYV E;  3MKL A;  1B9M A;  2QYO A;  3SEZ A;  2FBK A;  5IP7 J;  2HVR A;  2EV5 A;  3KIO A;  4BNC A;  4BY7 J;  4O6J A;  2ICW G;  1SMY F;  4HA8 A;  5HLI A;  4E7S A;  3KCC A;  1S8N A;  5CJ9 A;  2PX9 A;  2VB6 A;  4D0P A;  2DA1 A;  1YW8 A;  5D8K B;  4MQV A;  1RKT A;  4HV5 A;  5FLX K;  3FWE A;  4BHB A;  2HZD A;  2MLK A;  2YS9 A;  3S14 J;  3CC7 I;  3R0J A;  1MNM C;  4KIC A;  4RM3 A;  4XQF A;  2VBX A;  3B6A A;  1JE8 A;  1G8X A;  2QCO A;  2QEX I;  3F21 A;  4CCL A;  2A5Y B;  4WF2 A;  2M0M A;  3KP4 A;  2NOJ B;  4HV6 A;  3GTQ J;  1AU7 A;  4WK8 F;  3DCF A;  4IQJ A;  6PAX A;  3SHF A;  1HBX G;  4LD5 A;  1D1A A;  4PFP A;  2J5P A;  2VL8 A;  4G6Q A;  4FQG A;  1JTX A;  1Z91 A;  1USS A;  2ZSI B;  1ETY A;  2NYX A;  2COM A;  3T5X A;  3H5N A;  5TGT A;  4AC0 A;  3IL2 A;  1RRJ A;  2HEO A;  5GAE J;  2XV4 S;  3I3L A;  3OYK A;  4LIT A;  1OCP A;  4MO7 A;  2M5W A;  4EJO A;  1NK2 P;  1KZH A;  2AQE A;  4IF4 A;  3HGY A;  4F7Z A;  2E2H J;  2E5Z A;  4PUS A;  4V2F A;  1UEL B;  3DBR B;  1TT0 A;  2FNA A;  1MW7 A;  3IH3 A;  2HTJ A;  1R22 A;  2KMU A;  2Y0S A;  3QYE A;  3I59 B;  3VOD A;  2IS4 A;  3K9T A;  3OS0 A;  4L9J A;  4E6K G;  2O8X A;  3KX2 A;  1LB2 A;  3VEP A;  5HLG A;  4KT5 C;  5FLM J;  5F0H A;  4CA0 A;  3WU0 A;  4E7Z A;  4PCQ A;  2M7A A;  1J0R A;  2KZG A;  1LKX A;  4L9N A;  3TMO A;  4XNF A;  3HRS A;  2IBD A;  3S1M J;  2QWW A;  3RKW A;  5J8F A;  3SFI A;  3G4S I;  1V54 H;  1MD0 A;  1LFB A;  1I3A A;  1Z77 A;  2KIU A;  1P9Q C;  3HC7 A;  1FYL A;  4EM1 A;  4A0Y A;  1B59 A;  2ETH A;  3PQJ A;  4A69 C;  4P9U A;  2X1E A;  2HOE A;  1JI8 A;  3I4P A;  3M7G A;  4BU2 A;  1R1U A;  2X6X A;  4RGS A;  2I10 A;  2OTL I;  2EA2 A;  2KRH A;  3H0D A;  2VJ5 A;  3FKI J;  3I5U A;  5M5W J;  4HF2 A;  3E5U A;  2E7X A;  3KEO A;  2EZL A;  2XKP A;  3FHZ A;  4A3J J;  3REO A;  3ZOB A;  3SDB A;  4M73 A;  1DP3 A;  2EIK H;  4CHU A;  1W7P D;  3BP8 A;  4EM0 B;  2EQR A;  2XF6 A;  3MD2 A;  3M8J A;  4E7H A;  2G0E A;  1YJN I;  3RPU A;  4II3 A;  2NNY A;  1D0Y A;  3QYF A;  5D4S A;  2IS1 A;  4HDU A;  1IXC A;  1SVM A;  5HLH A;  4CIC A;  4I98 B;  4EJT A;  1J75 A;  2QLZ A;  3H5R A;  1HF0 A;  2V1U A;  1TBX A;  3P7N A;  4HBL A;  3H3Z A;  1SVO A;  4ESJ A;  3AG3 H;  4WXH A;  3LSR A;  2AHQ A;  1WVR A;  3HL2 A;  1E17 A;  4Q5S F;  2JSP A;  1ZEL A;  3VPR A;  2H94 A;  1S5L C;  3BG3 A;  2CYY A;  3E5Q A;  3EQL F;  3FXR A;  3HG9 A;  4BBR J;  1QZY A;  2DA7 A;  2FQ3 A;  2XB5 A;  2A6H F;  3ZQH A;  1VQO I;  4IHX A;  2O5R A;  3BQY A;  3FK6 A;  4UUV A;  2Y75 A;  5J47 A;  2ZXH A;  2FNP A;  5CVU A;  3OR1 C;  1EH7 A;  2GQQ A;  2MYS A;  1IRG A;  1S3J A;  5DS9 A;  2K4B A;  1FIA A;  2L9N A;  4P1W A;  4D7N A;  4DYQ A;  3DKY A;  4CH7 A;  1WFX A;  4KIG A;  2MH9 A;  5LBQ A;  4IKF A;  3OV8 A;  1BJZ A;  1SFU A;  2R7V A;  2NAZ A;  5C4J J;  2VOO A;  2R4G A;  1TWG J;  3MVP A;  2HVS A;  1G6N A;  4CCO A;  4OIO F;  3EPZ A;  3ABL H;  3BC8 A;  1PYV A;  3EUA A;  2COB A;  5CYV A;  3IAS 2;  3J7Z I;  2FF4 A;  2M1B A;  1OPC A;  4O3M A;  3FIW A;  2V6C A;  3ZMS A;  5FD6 A;  4ON0 A;  1T2K A;  3JCU C;  2JT1 A;  3Q9S A;  2BY3 A;  4ETS A;  2X6W A;  1O7L A;  3G73 A;  4C2M J;  3J7A O;  3IKT A;  3NWS A;  1FYK A;  3C18 A;  4CYC A;  3K7A J;  2DOD A;  1ZG5 A;  1IC8 A;  2XF5 A;  3U21 A;  4G7H F;  4BAY A;  2L7M P;  1R5I D;  2P8T A;  1R1T A;  1X19 A;  1XSV A;  1QVU A;  2MH2 A;  3HDD A;  1WWX A;  3L2V A;  3K70 D;  4BUP A;  3ECO A;  2JVH A;  1ZGJ A;  3DEW A;  2BOL A;  1MSF C;  2A05 A;  2EV6 A;  4UVA A;  2DFH A;  3KYC B;  3HOT A;  2JMW A;  3V8L A;  3TO7 A;  3K2A A;  3I55 I;  3GTG J;  4YEL A;  3S32 A;  3Q0V A;  4D5C A;  4HNU A;  2R7W A;  4PGH A;  4FX0 A;  2KQR A;  1XG1 A;  2F5C A;  3FXO A;  2L9R A;  4HRI A;  2DMQ A;  3QU6 A;  4QIW N;  5H6R A;  2V4J C;  1ORK A;  1K4S A;  4NB5 A;  2RDP A;  5J1R A;  4RAF A;  3BCB A;  2LLK A;  4KNY A;  4XRS A;  3A02 A;  2LSO A;  1X4O A;  4EEF G;  2H8W A;  3CCR I;  1GDT A;  2O8K A;  1XGM A;  3FXM A;  3A0H C;  4LK0 F;  4XON A;  3ASN H;  2GA1 A;  3ABT A;  2YSR A;  2CV1 A;  4KMF A;  2M7B A;  1F5T A;  3KET A;  5F64 A;  2XIG A;  3SYT A;  3TOB A;  4BKX A;  1P4A A;  4W1U A;  1PUF A;  5HLT A;  1ZRC A;  3TO9 A;  3QWL A;  4QPO A;  1UAA A;  3ZMV A;  1DQU A;  2STT A;  1SFX A;  3ZMT A;  3TDZ C;  3G2B A;  1OFC X;  5FGM A;  4OIR F;  2DJN A;  1IN8 A;  3PUF A;  1X1B A;  1MJA A;  1GXQ A;  1YE9 A;  2A6T A;  4RLQ A;  1REP C;  4LG0 B;  1BIA A;  3CMM A;  1MBK A;  3E6C C;  2DDB A;  4J19 A;  4HEA 2;  1R5G A;  2V26 A;  2HVQ A;  1G4D A;  5F0C A;  5DCF A;  5LGU A;  1C0W A;  1W5T A;  1Z6T A;  5IOZ A;  1RR8 C;  4GYG A;  3A01 A;  2XGD A;  2L2O A;  2XRN A;  5EF6 A;  5KK1 A;  4U0Y A;  1ZYR F;  2HFH A;  3EYI A;  2AS5 F;  5J3L A;  5H20 A;  4IHT A;  1GLN A;  3S3M A;  1NG7 A;  2LKS A;  3VYR B;  2CH0 A;  2HQR A;  1KQ0 A;  3HB9 A;  2HDD A;  5EZG A;  3LST A;  5FKK A;  3FZV A;  4YIF A;  4RDU A;  2JUC A;  2E60 A;  3JSP A;  4HW0 A;  2HXO A;  1N25 A;  4O5V A;  4L9T A;  3W6K B;  1G3S A;  3OYG A;  3LFK A;  1IN7 A;  5E1X A;  4CYC B;  2BZT A;  1Y6I A;  4B8X A;  4M9S A;  2DPD A;  3VWB A;  4WCG A;  2O7O A;  3WE3 A;  2R0Q C;  2FD5 A;  4XIC A;  5CVJ A;  4F3Q A;  1CQT A;  3W2A A;  1Z21 A;  2IEK A;  2WAQ A;  4B48 A;  3GVA A;  1B4A A;  3DTI A;  3FKJ A;  1SD4 A;  4XKC A;  4RGU A;  1SVL A;  2DLL A;  3ISP A;  4JYK A;  5KNL A;  3AKZ A;  4A3M J;  5L3G A;  3IC7 A;  2HOS A;  5DM6 F;  2FML A;  4G7Z F;  1K83 J;  2V6E A;  3UKG A;  5FLX Z;  1R7J A;  2I8D A;  3O2P E;  4IEJ A;  4X0G A;  5FD5 A;  2UZK A;  4NC6 A;  3CTA A;  3PL8 A;  3H35 A;  5C3E J;  2FMY A;  5J4V A;  1TWC J;  2NXN B;  3BWG A;  2WB1 A;  4DQ2 A;  2LMD A;  3E6B A;  1HW5 A;  2VC1 A;  1Z05 A;  3OY9 A;  3JAM K;  3ZPL A;  4ZZD A;  1JUM A;  4F92 B;  3GFJ A;  3FBI B;  5ED4 A;  2GA2 A;  1K79 A;  2R5Y B;  2P6T A;  3CJQ B;  4B3X A;  2HOT A;  4PJJ A;  1I5Z A;  3IV5 A;  2R5Z A;  2Y9Z A;  3FIS A;  3RKX A;  1O3Q A;  2DYS H;  3VFZ A;  2ME6 A;  4KA4 A;  5ICG A;  3DEU A;  4JOM A;  3S8P A;  5HDN A;  4IHW A;  2A69 F;  2P4W A;  1ZG3 A;  4LK1 F;  5K5R A;  1PUF B;  3HOZ J;  4ASN A;  1H0M A;  2LYC A;  4UVC A;  2GLO A;  4D9J A;  2TCT A;  4A6D A;  3MZ8 A;  2M8E A;  2VLA A;  2MW8 A;  3BT9 A;  1WJB A;  3MEX A;  3CO6 C;  1YFH A;  4A3C J;  3HEF A;  4M6X A;  2LG4 A;  4HQM A;  3D5R C;  1U8R A;  1BN5 A;  2FOK A;  2GIV A;  1P6R A;  4A5N A;  2Y0S N;  1SC7 A;  3CZ6 A;  2LBF B;  4V2G A;  2EK5 A;  2W48 A;  4S0H B;  2L7F P;  2QSF X;  2XAJ A;  3ZQ7 A;  1JUP A;  3A01 B;  2GBY A;  2GOM A;  2K3F A;  3TP3 A;  1ZRE A;  2BXY A;  4GRI A;  2R7T A;  2JUG A;  1IG7 A;  4XK4 A;  1O3S A;  3HOX J;  1FSE A;  2HQN A;  2YU3 A;  1ZTR A;  1W1W E;  3WE2 A;  1U78 A;  3CMY A;  4UV8 A;  5CQE A;  4L0Y B;  1BOB A;  2EV0 A;  3L7W A;  2AO9 A;  3ERM A;  1JHF A;  4EGZ A;  4RLF A;  4MHG A;  2WAF A;  1RI7 A;  4U7D A;  4B47 A;  2XUB A;  3KYD B;  3S93 A;  2QUF A;  4PSX A;  5BNG A;  1HW1 A;  3L2R A;  1A04 A;  2UXN A;  2X6Y A;  3K4C A;  1HCR A;  3N4M A;  1V4R A;  5IY5 H;  3K10 A;  3IAM 2;  5B1A H;  1VQL I;  3L00 A;  1ENH A;  5GTH C;  1YJW I;  3BTI A;  3KEQ A;  3LSH A;  1S7A A;  3MZH A;  3GFI A;  1QGP A;  1IV8 A;  3KZY A;  1WGX A;  2M4G A;  4KIT B;  4G7O F;  1W5S A;  2E71 A;  3GLL A;  3QRF F;  1GV2 A;  3TDU C;  1DPU A;  2E2J J;  3G3Z A;  1U2W A;  1KQ8 A;  3I58 A;  5FRM A;  2XKO A;  1VFC A;  2ESH A;  5AIP A;  3PNT A;  2VKH A;  4HZF A;  1WSU A;  3PSF A;  1VND A;  2PJR A;  4DJA A;  2ACJ A;  1XB4 A;  2MC4 A;  1R1V A;  4BS9 A;  4NC8 A;  1R4N B;  3SZG A;  2V1D A;  4G8X A;  5IYB J;  4L18 B;  5DEQ A;  3AL0 B;  4AIJ A;  4CCJ A;  4ZH4 F;  1FTT A;  3GUD A;  4BEH A;  3ZMZ A;  5DCM A;  3OYI A;  4IZZ A;  1ETW A;  1XCB A;  3OYM A;  1I6H J;  3JR9 A;  2OJE D;  1W7P B;  3BZ6 A;  3FXQ A;  2Q0O A;  3VYS B;  1RR7 A;  4EGY A;  3CCV I;  2QQ8 A;  1N77 A;  4B44 A;  2JN6 A;  2IS6 A;  1JT0 A;  4LGW A;  2E34 A;  2R7F A;  5HS7 A;  1TLH B;  4Y13 A;  2IS2 A;  1MND A;  4AU7 A;  3C2H A;  4W97 A;  5HNH A;  1K6Y A;  2QVO A;  3TED A;  1Y0U A;  3MFK A;  4G6T B;  3BG7 A;  5L3E A;  2NS7 A;  5B3S H;  4XM3 A;  3R60 A;  1PVE A;  2NNN A;  2XAH A;  1DUX C;  4F55 A;  3CCQ I;  3BR3 A;  3D1N I;  2L0K A;  3HOU J;  2Y31 A;  1SFK A;  3NWT A;  1YIO A;  3FF5 A;  4IX7 A;  2A6E F;  4AUX A;  2X9D A;  1FJL A;  3FXU A;  5ILV A;  2PBI A;  1H8A C;  3H36 A;  2DA2 A;  5IP6 A;  3RTR A;  3BR1 A;  2LVS A;  5DM7 F;  2WWY A;  1P2F A;  1X1C A;  1UHS A;  2R7D A;  2AXT C;  4ZC3 A;  3T0Y A;  5E3M A;  2NVU B;  3HTS B;  4XKV A;  1FP2 A;  3WG9 A;  1VQM I;  1QPI A;  4A3G J;  2NS8 A;  2K02 A;  3A1Y A;  1T08 B;  4DZJ A;  2RQQ A;  1B9N A;  4EM2 A;  1RZ4 A;  1F1Z A;  2K9Q A;  2C6Y A;  4JX5 A;  4XOR A;  4BXF A;  4F93 B;  1Q1H A;  5ICC A;  4UV9 A;  4TV7 A;  1V55 H;  1I50 J;  4KMU X;  2GXG A;  4HSR A;  4LLL A;  5LHG A;  3HHG A;  2ADU A;  2MBF A;  4R1H A;  5FKO A;  4KIB A;  2RNG A;  3CF2 A;  4YIR X;  1XDU A;  5LFA A;  4CCM A;  1ZRD A;  3F8B A;  1D5Y A;  3BR6 A;  1OKR A;  1KON A;  2K85 A;  3BDD A;  3QOP A;  3P5J A;  3U1K A;  3I9V 2;  5IYD J;  4ZDP A;  4GGG A;  2ELH A;  1ETV A;  3CJR B;  4B43 A;  1I6X A;  1FIP A;  1RET A;  4QTR A;  5M3M J;  2PJR B;  1DGW Y;  5HOD A;  2RC4 A;  1E3H A;  3L1P A;  3X2Q H;  1S6L A;  2EH3 A;  4D5F A;  4HX4 A;  1RIO H;  3S1Q J;  3VB2 A;  5FO5 A;  4QLC U;  3OSG A;  3GW2 A;  4KUM A;  2QSH X;  2BVL A;  3CJT B;  3LQQ A;  2VBY A;  2DI3 A;  3RPQ A;  2CQN A;  4BEH B;  2QSG X;  3OYJ A;  1U9O A;  2XDV A;  4YFN F;  1SD7 A;  3MWM A;  5CVV A;  3FXL A;  4OAZ A;  1TNS A;  4A12 A;  1ZHF A;  1SAU A;  5K5Q A;  1BIB A;  2QEN A;  5BMZ A;  1X1D A;  1ZKG A;  1QA6 A;  1QO0 D;  2JRT A;  3TQN A;  1I1S A;  5F0F A;  4YRV A;  2VKE A;  4LFU A;  5F1R A;  5HS9 A;  4NDL A;  1SD6 A;  2F6C A;  2K86 A;  2PFB A;  2W82 A;  2KIQ A;  3IWF A;  2FSW A;  2Y0M A;  3LSI A;  1FNN A;  3M8F A;  1MMN A;  3M3Y J;  4RB2 C;  4XLE A;  4BAC A;  1NH3 A;  3ZR8 X;  4HYE A;  3RYR A;  4A3B J;  4IRG A;  3K4B A;  2LTP A;  2PLY A;  3S15 J;  2CU7 A;  2Y9Y A;  1HC8 A;  2EIJ H;  2B9S A;  1S7E A;  2JTV A;  4A0Z A;  2W00 A;  1H9G A;  3HYI A;  3I71 A;  1YI2 I;  4PSW A;  2XC7 A;  2XAG A;  5GP9 A;  2STW A;  1V5G A;  1IW7 F;  3LSP A;  3LA3 A;  5BPI A;  5D5V B;  4EQQ A;  1EH6 A;  4WXC A;  4M6Y A;  3QAH A;  1IXR C;  3CQZ J;  4ITV A;  4C30 A;  3ZP5 A;  1HA8 A;  2DK8 A;  4ENK A;  2PMZ N;  1ON1 A;  2LOO A;  2HQ5 A;  1SAN A;  3KP7 A;  3HKZ A;  1XTA A;  4XBF A;  1XS9 A;  1NTC A;  3PFI A;  4CCK A;  2DA4 A;  3OYB A;  2OU2 A;  1WJA A;  4OIN F;  1RUN A;  5FRN A;  2FBI A;  1XGN A;  1P4X A;  3ZXS A;  2W24 A;  1HW2 A;  1I1G A;  1W5C C;  3VYU B;  1XX5 A;  3OS2 A;  2AQF A;  1XCV A;  2ZJR F;  2LR8 A;  1W36 D;  3L09 A;  1K4T A;  2DO7 A;  3GLX A;  2BXZ A;  1OIS A;  2NS0 A;  1E0E A;  1OCZ H;  2PEX A;  3CCL I;  1VQ7 I;  3E97 A;  3WTW C;  1JJ6 C;  2YX7 A;  3JAM Z;  5J1U A;  4CYD A;  1QZZ A;  2DOF A;  4ESB A;  4YII A;  1NHA A;  4P9F A;  1GV5 A;  2Z5U A;  1UHM A;  2BHZ A;  1IF1 A;  1Z7L A;  4M3D A;  4N9I A;  1KA8 A;  1ETK A;  4EV0 A;  5ICE A;  1WJD A;  2VPL A;  2XB0 X;  3CUO A;  2E2I J;  2RV8 A;  4FE4 A;  2P7V B;  4DGW B;  4BGD A;  2B7E A;  3D5L A;  3ROU A;  5JLX A;  2M45 A;  3CUQ A;  3WG7 H;  2ZO4 A;  2DT5 A;  1BI3 A;  1RC9 A;  1MBH A;  3SZP A;  3OSF A;  2K3P A;  3MKZ A;  1F36 A;  4ENN A;  3MKW B;  2HQA A;  1A35 A;  3LSM A;  2EFQ A;  2DN0 A;  3L2Q A;  4HQE A;  3WTU C;  3I64 A;  2JWT A;  9ANT A;  2ECC A;  2L54 A;  4IOC F;  5H6Q A;  1G59 A;  1A31 A;  3P9K A;  2LFB A;  1T95 A;  2ZNZ A;  3ZN1 A;  4I2O A;  2Z3Y A;  3RJP A;  3GO5 A;  1R71 A;  2HR3 A;  3DTE A;  1J9I A;  3BTL A;  3KYL A;  3EYY A;  3HOS A;  4HDV A;  2DOA A;  3BRO A;  2L9V A;  1TWF J;  1D5V A;  3ZRG A;  2K40 A;  3W6J B;  1OR7 A;  1WJ5 A;  2F5V A;  2CG4 A;  2WA0 A;  4U0V A;  1S7O A;  1AKH A;  1YOV B;  2M87 A;  1DU0 A;  3OYL A;  1LQ1 A;  2DOE A;  4JP0 A;  1MBF A;  4JX4 A;  3V4G A;  1HKT A;  2ME0 A;  1IXS B;  2V79 A;  2VN2 A;  3BOQ A;  3G1O A;  3V8J A;  5IP9 J;  1LDJ A;  2E7W A;  3RQI A;  3CDL A;  3PM1 A;  1ZAO A;  4M3G A;  1SD5 A;  3CO7 C;  4LG0 A;  1V5F A;  2A68 F;  1ZGW A;  2DCE A;  5J4Y A;  4IHV A;  2VE8 A;  2XGE A;  2ZFU A;  2UUZ A;  1ITY A;  2P81 A;  1HLV A;  3KZZ A;  1RPW A;  3V7R A;  3RQ4 A;  2XVC A;  3GWZ A;  1B8I A;  3RZD J;  1OCR H;  2P0W A;  2HYJ A;  4CZC A;  3OYA A;  2QF7 A;  4AVZ A;  4Z2Y A;  2CW0 F;  2QM3 A;  2ZME A;  3B73 A;  2V9V A;  4Y15 A;  1E3P A;  2NVT J;  3OYH A;  1O57 A;  1H89 C;  2ZJQ F;  1W0T A;  3SJM A;  4XSZ F;  2VBW A;  1MIJ A;  2DTZ A;  5GTI C;  3S2D J;  2OCE A;  3O8G A;  1HKQ A;  2KJB A;  1FMW A;  2L7Z A;  4RB1 A;  2R7R A;  2IGK A;  1TP4 A;  4BQN A;  4CSW A;  3U1D A;  4RAY A;  2OD5 A;  1XSX A;  1BJA A;  1FY7 A;  4A6E A;  4BHP A;  5HNF A;  2OC6 A;  1RUO A;  1GVJ A;  2GZW A;  3EUK L;  3HSF A;  5FLV A;  3TP0 A;  1DU6 A;  5LGN A;  1L3L A;  1DDN A;  1S9H A;  3JRE A;  1VTN C;  4XOP A;  1UZC A;  2VIX A;  3QP5 A;  2QQ9 A;  1WJC A;  2E5N A;  4HF1 A;  3KLN A;  2YUS A;  5CVR A;  1J59 A;  1LVA A;  3AG4 H;  2TDX A;  1KU9 A;  3CUQ B;  3O3K A;  3DLL F;  1IAW A;  4XKW A;  3CES A;  5BOX A;  5J1Y A;  3WOD F;  1U9N A;  2DA5 A;  4Q4Z F;  4KYW A;  4ZYG A;  4AIK A;  4AID A;  2X4H A;  4R8H A;  3SXY A;  1ZAR A;  4MTD A;  4QWQ A;  2RVC A;  3FXJ A;  1U3E M;  1U8B A;  1STZ A;  4C9Y A;  1XMK A;  2HXI A;  1JGS A;  2CQX A;  2LDU A;  1VI0 A;  1OJL A;  2EZK A;  2XAU A;  5HS8 A;  2E1C A;  1FBQ A;  3LWF A;  1KYW A;  2YX4 A;  4DW6 A;  2WY7 Q;  5CQG A;  1J5Y A;  4CDG A;  4F91 B;  2KIF A;  1XSD A;  4BY1 J;  2W84 A;  5E1Z B;  3L2U A;  1DGR M;  2HGC A;  1X4P A;  2E1M B;  1IRF A;  4XKB A;  3S3N A;  1F43 A;  2R5Y A;  1OYI A;  4LIU A;  1JGG A;  4RB0 A;  4BQA A;  1K6O A;  2H6C A;  1S29 A;  2QGU A;  3M1E A;  2F4I A;  2ZSH B;  3CDI A;  5D6F A;  1T33 A;  3MMY B;  2GWR A;  3PO3 J;  2WV1 A;  1SFE A;  1AKH B;  1BBY A;  3IUO A;  5J8C A;  4KT6 A;  5TIS C;  3FDY A;  3WU1 B;  1OCT C;  3GZN B;  5L3D A;  3PIO F;  3GZ6 A;  2LRE A;  3Q9V A;  4I01 A;  2I5U A;  3HRT A;  3CP8 A;  1UB9 A;  4FTH A;  1R49 A;  4LOC A;  2DYR H;  2X48 A;  5IYC J;  4B4C A;  4QPQ A;  5K7F A;  2IAI A;  1BI0 A;  4RGX A;  2VC0 A;  3J80 K;  1FP1 D;  1A5J A;  2IA1 A;  5AIQ A;  1RNL A;  1GVD A;  1FYM A;  3EDP A;  4AYB N;  4BJ6 C;  4PGG A;  4DBR A;  3GYH X;  2LBF A;  2ISZ A;  4M3F A;  3D0S A;  3DP7 A;  2NRA C;  1B8I B;  4FT8 A;  2DA3 A;  5D5X B;  2JVG A;  3DEE A;  2EIN H;  1MKM A;  2ZME B;  3JRC A;  2HPM A;  1IUF A;  3RI4 A;  4Y52 J;  1A6Q A;  2VJ4 A;  3ZGK A;  3A4C A;  3AL0 C;  4CUG A;  5JVT A;  1Z3Y A;  1FC3 A;  3JSO A;  2KIM A;  4A3D J;  5IT9 K;  1LVK A;  5HDG A;  2XPW A;  5JHU A;  5D5W B;  3E7L A;  3DXJ F;  5LEK A;  2JZY A;  3DQV C;  3GF2 A;  2LD5 A;  1X1P A;  2VKV A;  1J09 A;  3I53 A;  4JX6 A;  1IN5 A;  1YW9 A;  1OCO H;  2VQL A;  4I99 C;  2V9P A;  3K4J A;  2QQB A;  4FE7 A;  4IL6 C;  1UJ8 A;  5ILU A;  2L4A A;  4BE2 A;  1BC7 C;  5F08 A;  4B09 A;  2RAE A;  3ZQF A;  1UG2 A;  1JTY A;  1WRJ A;  1LNW A;  3WU2 C;  2KFD A;  4NC7 A;  1UHW A;  1BI2 A;  1FLI A;  3DTK A;  3TKY A;  2JK3 A;  2H1L A;  2WY8 Q;  2YU9 J;  5LD2 C;  3NRV A;  1T56 A;  4BH9 A;  2K4J A;  4XLC A;  4DYR A;  1HSJ A;  3R0A A;  2L3D A;  3NQO A;  3CC4 I;  1YG2 A;  3HPG A;  4IRH A;  2HU9 A;  4ZYD A;  3SDG A;  4EJU A;  2XSD C;  3GXO A;  2YPR A;  1CF7 A;  2DMU A;  4NBQ A;  4PJ0 C;  2D45 A;  1ON2 A;  1K78 B;  4BL0 B;  2QA4 I;  3QP6 A;  2ESN A;  1ZH5 A;  4G94 A;  1D8J A;  1EJ9 A;  2BY2 A;  1FPQ A;  3K4N A;  3P9I A;  4K2E A;  2IA0 A;  3ZQG A;  1U5T A;  1W7P A;  4G9Y A;  4BDZ A;  2CUZ A;  3ELK A;  1YTY A;  4KFC A;  2V7F A;  1VQK I;  2H27 A;  2VT3 A;  3I0T A;  3HXL A;  1Z7U A;  2IP2 A;  2K9M A;  3LAP A;  3R61 A;  1GUU A;  5LRR A;  4OU0 A;  3BG6 A;  5KCM A;  2HPI A;  2XAS A;  2DU9 A;  2LK2 A;  2OQG A;  5CPR B;  3GFL A;  2CFX A;  1O3R A;  1IDZ A;  4BXU A;  4EMS A;  5LRS A;  3TW7 A;  2EZH A;  4HF0 A;  2CGP A;  1ZN2 A;  4D1Q A;  3QPS A;  4LLN A;  1LPQ A;  3EET A;  3ZN0 A;  1H9T A;  1X3W B;  3K70 C;  1QZE A;  4EVI A;  5DTD A;  3GTK J;  4XN0 A;  2IW5 A;  3TO6 A;  3S1N J;  4MIM A;  3JRA A;  3C7J A;  1B6A A;  1FT9 A;  2Z9O A;  2VE9 A;  3OMY A;  2HOA A;  4HX7 A;  4A2U A;  4BE0 A;  4ZYE A;  1Y0N A;  2DPU A;  2IA2 A;  2OF7 A;  4UHT A;  4AD9 A;  4Z6Y A;  1X2M A;  3N05 A;  3LAJ A;  1Y8Q B;  3H92 A;  2VJJ A;  3RCO A;  2FA5 A;  2XGC A;  1ETQ A;  4RGR A;  2VBZ A;  5DUK A;  5K7H A;  1BR2 A;  2FOW A;  2CS3 A;  5LLQ A;  3JRH A;  2JA5 J;  3PJR A;  4I6Z A;  3GTP J;  5E17 F;  1GT0 C;  1R23 A;  2CW7 A;  3PNV A;  1WKM A;  2BVM A;  2ZJP F;  2JQ7 A;  4LLG F;  2KDZ A;  3CC2 I;  2L9S A;  3CCS I;  4ENJ A;  2OCC H;  3LSK A;  2VON A;  1F9N A;  1DP7 P;  4AIH A;  3JRG A;  2D1V A;  2WAD A;  2P5L C;  3H0G J;  2BE5 F;  2GOX B;  1HST A;  3J81 K;  4DNC A;  1JXS A;  1Z3X A;  3SQN A;  2M2E A;  4OIP F;  1PP8 F;  4ABZ A;  3K1M A;  4HOB A;  3ECH A;  1T8I A;  3PO2 J;  1IRZ A;  1CF7 B;  1APL C;  3BR2 A;  4LB5 A;  3AG1 H;  4EAT A;  3J7A Y;  2VPR A;  2OQR A;  2Y30 A;  4N4O B;  1TWA J;  2CUJ A;  3LL7 A;  5JVG F;  1K61 A;  4L5J A;  1E3O C;  3R6S A;  1U5T B;  4EJV A;  3BTJ A;  4NHJ A;  3K69 A;  3EUH A;  2CSO A;  2LF7 A;  2PJP A;  4M9X A;  5IOY A;  1XD7 A;  4GXO A;  1D1C A;  3WGH A;  1ZLJ A;  3TL4 X;  2DTR A;  2FEZ A;  1T0F C;  3ZMU A;  2KKO A;  1VF9 A;  2F5F A;  3ERE D;  3A2K A;  4ZDO A;  1WPK A;  1BI1 A;  4Y33 A;  3T1B A;  2N8G A;  3BJ6 A;  2DMN A;  2EFO A;  1RKW A;  2A5W A;  2KIS A;  4MTE A;  5HOO A;  4HPQ A;  3I4M J;  1ULY A;  2R7Z J;  3K4L A;  1VQ6 I;  3WTZ A;  1BC8 C;  1S72 I;  2CV0 A;  4FET A;  4UB8 C;  4UNO A;  3CF5 F;  5D4R A;  4J01 A;  2EJR A;  1MMD A;  3V7S A;  3HOV J;  4AWX B;  5LGT A;  2VJI A;  4RA2 A;  4GCV A;  4MLO A;  2VQG A;  1LE8 A;  2BY1 A;  4ENM A;  1Y1V J;  3RZO J;  1B1B A;  1DPR A;  5L3F A;  3K6G A;  2O61 A;  2XSJ C;  3E6M A;  2W25 A;  2IT0 A;  2D2W A;  3BZK A;  1QBJ A;  2LY1 A;  3DPL C;  3GX4 X;  1MGT A;  4OMY A;  5TRD A;  2DXI A;  5DDG A;  2BBY A;  3V8K A;  3G1L A;  2CFO A;  1ZLK A;  1Q1V A;  3PFY A;  4MEY F;  3TGN A;  3BJA A;  3KP5 A;  3KE2 A;  1MMA A;  5EDN A;  4HAM A;  1FX7 A;  4NUB A;  2EB7 A;  2P6S A;  4XID A;  1HDP A;  3GZ5 A;  4Y7N J;  3CCY A;  2MD5 A;  1T0F A;  2EIM H;  2NVQ J;  1LFP A;  1V3F A;  5A2Q K;  1HDD C;  1FOW A;  4YFX F;  1G3Y A;  1FBU A;  1MNE A;  2A3S A;  3C3W A;  5JLW A;  1TQM A;  2RRE A;  1P4W A;  2Z16 A;  5CVI A;  1JT6 A;  4XN3 A;  1JJ8 C;  3L2C A;  2EPF A;  5M5Y J;  4E7J A;  2WV0 A;  1EF4 A;  3S17 J;  2GIZ A;  3GTM J;  3CDH A;  3U2R A;  2FXA A;  3MZY A;  3T8R A;  2E35 A;  2L5Q A;  3S16 J;  2LNB A;  1JUS A;  1T39 A;  4JK1 X;  2O0Y A;  1T38 A;  1L0O C;  1G3T A;  1XPX A;  3BG5 A;  3O6B B;  4WWC A;  2LH9 A;  4BE1 A;  1R9T J;  2R92 J;  1EA3 A;  3OYD A;  2R7S A;  5GPC A;  3VSL A;  3K4M A;  4IXA A;  3J80 Z;  4A3F J;  2BW3 A;  2L01 A;  2QZ8 A;  2ZXI A;  2Z2S B;  2V9K A;  3LA7 A;  1A36 A;  3CLO A;  1BL0 A;  2D1H A;  4CGZ A;  2ELK A;  4KIF A;  1QNT A;  5K1Y A;  4DOZ A;  1Y8R B;  3CCJ I;  2HWV A;  5E1W A;  4MEX F;  1QHG A;  5FJ8 J;  2DMP A;  1MH3 A;  1Z0X A;  1QQI A;  2JPB A;  2KPM A;  1ODD A;  3BR5 A;  1ZRF A;  1UG0 A;  1TL8 A;  2H1K A;  4E4H A;  2UWM A;  4FIS A;  5EZH A;  5GPA A;  1HKS A;  4IO9 F;  1R36 A;  4C2T A;  5IT9 Z;  2NVY J;  4XLA A;  5K7Z A;  2J5O A;  2W7N A;  3I4N J;  4WX9 A;  2HZT A;  1XDS A;  3HSR A;  3F8C A;  3WTX C;  2CQQ A;  3ZQQ A;  1UMQ A;  1RES A;  1WJE A;  1PUE E;  3BR0 A;  4OMZ A;  4NNJ A;  3TBI A;  2QBY B;  3F72 A;  4U0W A;  1VQN I;  4AM3 A;  1LE8 B;  4Q47 A;  4XL9 A;  3COA C;  3CUQ C;  2ZB9 A;  3OIP A;  1WH5 A;  4PK4 A;  1BM9 A;  3HIF A;  2Q8K A;  4X6A J;  5KVR A;  4LMY A;  2CUF A;  5EEG A;  1MMG A;  1WCM J;  5ERI A;  1PDN C;  3OYE A;  2JRM A;  2XPU A;  2B63 J;  2TRT A;  2WAQ N;  2V1N A;  4A0X A;  4HLX A;  1VQ8 I;  3GTJ J;  4BQO A;  2MC3 A;  3G6E I;  4P55 A;  1IJW C;  1TWH J;  1SEU A;  3QQA A;  4OAY A;  1LJ9 A;  3F8N A;  5JR3 A;  2AXL A;  3BZC A;  4BHC A;  3S1R J;  4OIQ F;  2E1M C;  1X3Z B;  4WXD A;  2EFN A;  1OQY A;  3DU6 A;  4BJ5 C;  1MBJ A;  5L3C A;  4U87 A;  3CMA I;  2EA4 A;  1OR7 C;  2GAU A;  2WB1 N;  3AFH A;  2F5D A;  4S05 A;  2E19 A;  2ISY A;  4KJZ A;  3U9G A;  3MQ0 A;  1JKR C;  1O7F A;  2W4S A;  1WZ2 A;  2CWE A;  3FM5 A;  2VOD A;  5F27 A;  1TQI A;  2DFF A;  2Y2Z A;  2WTE A;  3KPH A;  3JRF A;  1YJ9 I;  5GAG J;  1FBS A;  2R7X A;  4P96 A;  4E7L A;  2R3S A;  2L4M A;  4B3A A;  3I54 A;  3HPH A;  2CO5 A;  1R6R A;  2ELJ A;  2ZBK A;  5DYM A;  4LB6 B;  4UB6 C;  3HM5 A;  1IDY A;  2Y69 H;  1JKO C;  4HNV A;  4MQ9 F;  4S04 A;  5HDK A;  2BW3 B;  2JJ7 A;  2W57 A;  5E3N A;  2JA2 A;  3H9J A;  3OYN A;  2DDA A;  2OZU A;  3PIP F;  3E3V A;  4C2U A;  4FCY A;  3B02 A;  3F0C A;  2VXD A;  3A03 A;  1YS6 A;  1JHH A;  2ZME C;  4HG2 A;  1TZL A;  2VQC A;  1F4K A;  4UY8 I;  4KN7 X;  3F22 A;  4DBQ A;  4MFD A;  2H8R A;  2NOG A;  5GAH J;  4XMY A;  1A6I A;  1EV7 A;  3DBH B;  4I02 A;  2P5K A;  2EFW A;  1R5H A;  2CQK A;  2MAB A;  4E7I A;  4UUS A;  2KZV A;  4EJW A;  3M1C A;  1LEA A;  4II2 A;  3SZT A;  4ZTF A;  2KRF A;  1IN6 A;  2XAF A;  3Q0U A;  4IHY A;  3G71 I;  2Z33 A;  2PG4 A;  2IVM A;  3LSG A;  3O8H A;  3MKY B;  4KIS A;  3FMS A;  2LP0 A;  3BJO A;  3BPV A;  5DD8 A;  1KU7 A;  3N97 A;  5E18 F;  3NEU A;  2OV7 A;  2OPT A;  2JA7 J;  1D1B A;  3SEQ A;  1M1E B;  1YHQ I;  3BLY A;  4LG3 A;  2LY2 A;  2RKH A;  4IOA F;  4C3J J;  5EJC A;  1D0X A;  4HX8 A;  5FKL A;  4N4N B;  1KQ9 A;  1TQP A;  2K9N A;  3DV8 A;  4M71 A;  1X58 A;  3M07 A;  4A3K J;  1OYY A;  1MH4 A;  2H6B A;  4IVN A;  2Q1Z B;  1TC3 C;  2VQH A;  2IGN A;  3G1M A;  2X0L A;  1D3Y A;  2W85 A;  2KHM A;  1G3W A;  4HST A;  1PJR A;  2R7O A;  3P9C A;  5D6E A;  2M8G X;  3S2W A;  1W0U A;  1MDM A;  4ZTJ A;  3J81 Z;  1VQ9 I;  2JA6 J;  3QPT A;  2KL4 A;  2KDO A;  2M4K A;  1FMV A;  3IHU A;  3UR3 C;  5LEJ A;  3VOE A;  4BXX J;  2CRG A;  4G6D A;  1BA5 A;  3HUG A;  3CP2 A;  2O03 A;  3I56 I;  5GAD J;  1U6G A;  1FOY A;  3F23 A;  1J2X A;  4PZJ A;  4X1E A;  1Z1D A;  4FX4 A;  2Z99 A;  1MMS A;  1Y1W J;  2DBB A;  2V1X A;  1B72 A;  4CO8 A;  2QQA A;  1JKP C;  4A93 J;  2CQ7 A;  1WH7 A;  2LY9 A;  4DZP A;  3IH2 A;  2OTJ I;  3NAU A;  4PFO A;  2LC2 A;  3FMQ A;  2HKX A;  4IPA A;  3SFZ A;  2MA3 A;  1GHC A;  1D8K A;  2HYG D;  5F04 A;  1MBG A;  1UCR A;  4C3H J;  4ZYA A;  1ZQ3 P;  1QVT A;  4OWR B;  1XMA A;  2XRO A;  3WTS C;  5FRO A;  1UFM A;  1TW2 A;  3A0B C;  2D5V A;  3WTT C;  1IRX A;  2VUM J;  4BDY A;  3CCE I;  3KLO A;  3F3X A;  5M5X J;  5EEA A;  2RN7 A;  4M9Z A;  5K5O A;  3ONQ A;  1XGS A;  4L5E A;  3H3U A;  5EYR A;  4CZZ A;  3ESW B;  3OOU A;  3RKY A;  3HSE A;  3DU5 A;  3BQZ A;  5B5E C;  2WBM A;  4UUS B;  5IT3 A;  4U88 A;  4QSH A;  1K78 A;  4XLP F;  3GME A;  1N78 A;  2BY0 A;  2ECB A;  5H2F C;  4A3E J;  1AWC A;  4XRF A;  2EWN A;  4Y4R A;  3HHH A;  1I27 A;  3RDI A;  1WHU A;  3WTV C;  2XAQ A;  3HJE A;  4I7H A;  4NQW A;  2ZXJ A;  2RGV A;  3MN2 A;  1T98 A;  1YO5 C;  2PN6 A;  4XLN F;  1W36 C;  3OL4 A;  1P92 A;  1IZ1 A;  2F2E A;  3HZJ A;  4F52 A;  5BQT A;  2DW4 A;  1D0Z A;  5CLS A;  4LIV A;  4CXF A;  4IRI A;  2CMP A;  4JQF A;  2ID6 A;  3WHC A;  4RBO A;  3M4O J;  5DV5 A;  1AOY A;  2ZCW A;  3W2W A;  2DA6 A;  2E1N A;  5A2Q Z;  3ASO H;  4UVB A;  5CKT A;  3PNY A;  1OYW A;  3MAJ A;  5EG0 A;  1FTZ A;  3M8E A;  1FWZ A;  1QHH D;  3FHN A;  2MD0 A;  3JRI A;  2CJJ A;  1NK3 P;  1JKQ C;  4OOI A;  3JW4 A;  4P5O A;  1I3Q J;  4XLH A;  5DUI A;  4XSX F;  4A3I J;  1YIJ I;  1MDM B;  2VXZ A;  1R00 A;  2ZJ2 A;  3LSJ A;  3E6D A;  2DQL A;  2IPQ X;  5E79 C;  2MGQ A;  3RSN A;  2WC2 A;  3F6V A;  3HUG B;  4PJN A;  2XRL A;  4YEJ A;  1TT5 B;  2LRD A;  2VT2 A;  3E1S A;  1YX5 A;  2HNH A;  3JRB A;  5D8L B;  1T6S A;  3E0J B;  1FEX A;  4V19 K;  1U5T C;  2YR2 A;  4RMN A;  2P7C B;  1ZG1 A;  2X6O A;  3K0L A;  3WHB A;  3OYC A;  2A61 A;  3ZCO A;  1B72 B;  1ZK8 A;  2R7Q A;  4A5M A;  5F1J A;  2Z1D A;  3V7C A;  2FE3 A;  2B0L A;  1YX3 A;  3QPH A;  3DPU A;  2MFZ A;  2M34 A;  1X1A A;  1HQC A;  1SFO J;  5E20 A;  3IP4 B;  4UUT A;  3F8F A;  1LEB A;  4BBS J;  1NG6 A;  2FJ1 A;  3W6V A;  3ABU A;  1FSH A;  2DAO A;  1P7J A;  3JRD A;  4CCN A;  2IJL A;  3S3O A;  3IRR A;  2GXA A;  2L7K A;  2DQR A;  4I09 A;  2F4O B;  2IXS A;  2M9H A;  1R4M B;  2PMZ A;  4M72 A;  1QRY A;  2KT0 A;  4IQ4 A;  3W2V A;  3TW6 A;  4J00 A;  4RAZ A;  2FRH A;  4ZYH A;  3HBL A;  4RM2 A;  4DYC A;  2X1C A;  3L9F A;  1XMX A;  2ZNY A;  5E8G A;  1Z6R A;  3JTH A;  2DJI A;  3CCU I;  4M3B A;  2FQ4 A;  2OUM A;  2DFI A;  2F5E A;  3CCM I;  5JI6 A;  3QU3 A;  4XLF A;  3H5A A;  3D5S C;  1POG A;  2X1D A;  4G12 A;  3BCA A;  1XGO A;  2PMH A;  2FU4 A;  2DK5 A;  3RKQ A;  1OMI A;  2OA4 A;  5J40 A;  1FOX A;  1ZR4 A;  4RB3 C;  2LKX A;  3Q5F A;  1O3T A;  2XF7 A;  4NQW B;  2PI0 A;  3H3V K;  1ACI A;  4YFK F;  4L9V A;  3B6C A;  4C3I J;  3HKZ N;  3ABK H;  1PP7 U;  4B1R A;  4UXN A;  4GFB A;  4U7B A;  3OOP A;  2IGM A;  3AG2 H;  5FB2 A;  1O4X A;  1E2X A;  2OBP A;  2GM4 A;  4KDP A;  2LKP A;  3GFM A;  5E8I A;  1HXD A;  5EG0 B;  2EIL H;  4Q48 A;  1LFU P;  5EEH A;  2RNJ A;  4N0B A;  3RYP A;  3T8T A;  2XPV A;  2M3A A;  4RAG A;  1VZ0 A;  3FM3 A;  1IV6 A;  1KU3 A;  2R93 J;  1H88 C;  1CGP A;  3BTC A;  2HDC A;  3GEZ A;  2G7H A;  2FX0 A;  3HGG A;  3QOD A;  3HOW J;  1LDD A;  2Q2E A;  5FKN A;  3LQR A;  4E70 A;  1FZP B;  3GCM A;  1MZB A;  3QYB A;  2L02 A;  1VQ4 I;  3PUB A;  2G9W A;  5BPD A;  1HOM A;  1YQA A;  5E3L A;  5BS6 A;  2HKO A;  2HS5 A;  3PSI A;  1ERD A;  1IUY A;  1IO2 A;  1YYV A;  3AAF A;  3EUH C;  3DFG A;  4BYY A;  3HOY J;  5DD4 A;  4A3L J;  1VQ5 I;  3E5X A;  5B66 C;  3CD6 I;  1OCC H;  2MLG A;  3FX3 A;  4L0Z B;  4L5I A;  2O6G E;  2BHY A;  3QOE A;  4D7M A;  2R7U A;  2CV2 A;  3ZQL A;  3K4K A;  3DWL E;  1K7A A;  1TNT A;  3BG9 A;  5J6X A;  4GYI A;  3IKV A;  1N75 A;  2HTS A;  4ANJ A;  5ILS A;  1KGS A;  3KZI C;  2IRF G;  1I39 A;  2KLO A;  1BW6 A;  3DF8 A;  4I76 A;  1AA7 A;  2LF8 A;  2X51 A;  5IPA A;  5FFZ A;  3OWT A;  1AHD P;  5ICF A;  4ZZL A;  2A07 F;  5HVQ C;  3ML6 A;  2ZFW A;  3C1D A;  3OS1 A;  2PMU A;  3LNQ A;  3GBG A;  3QPL A;  1YRN A;  1QU3 A;  5KAI C;  3ABM H;  2K9S A;  3C2B A;  2EBI A;  2IGO A;  3LMM A;  4FHT A;  5TJJ A;  3IWZ A;  3DKW A;  2MG4 A;  3ZQI A;  2K9L A;  3R4K A;  2HDW A;  3WGG A;  3GTO J;  3BPX A;  3RPU D;  2DT6 A;  3GTL J;  3H1C A;  2HI3 A;  2O3F A;  2VKD A;  2EZI A;  2UXX A;  5FKM A;  1U0J A; 
#chains in the Genus database with same CATH homology
 1VQL I;  2ZJR F;  1YJW I;  1VQP I;  1VQN I;  1YHQ I;  2OTL I;  3CCL I;  1VQ7 I;  2ZJQ F;  3CME I;  4IOA F;  3I55 I;  5DM6 F;  1YJN I;  2E36 A;  1VQ8 I;  3G6E I;  1YIT I;  1YIJ I;  2NXN B;  1VQ9 I;  2FOW A;  3CJT B;  1VQ4 I;  3DLL F;  1FOW A;  2H8W A;  2ZJP F;  2JQ7 A;  3I56 I;  3CCR I;  3CC2 I;  5GAD J;  1FOY A;  3CCS I;  3CMA I;  4V19 K;  1Y39 A;  3CC7 I;  3CCV I;  2QEX I;  1MMS A;  4IOC F;  1QA6 A;  1VQ5 I;  1VQO I;  3CD6 I;  2E34 A;  3CC4 I;  2E35 A;  1YJ9 I;  5GAG J;  2OTJ I;  5GAE J;  2QA4 I;  5JVG F;  3J7Y J;  1HC8 A;  3CCQ I;  3CCE I;  3PIP F;  1YI2 I;  2K3F A;  1VQK I;  3CCJ I;  3PIO F;  4UY8 I;  3J7Z I;  5GAH J;  3CCU I;  5DM7 F;  3CCM I;  4IO9 F;  1VQM I;  1VQ6 I;  1FOX A;  3G71 I;  1S72 I;  3G4S I;  3CF5 F;  1ACI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...