2LSOA

Solution nmr structure of the globular domain of human histone h1x, northeast structural genomics consortium (nesg) target hr7057a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
b'SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H1x
publication title Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A
rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lsoA00
1AWCA 1T98A 3BDDA 3V7CA 2CG4A 3V7RA 1BN5A 3F22A 3MZHA 3CO7C 2UXNA 3VFZA 5CYVA 2RQPA 4ZYHA 4EJTA 2EFWA 2A61A 1JE8A 1R7JA 2QVOA 2W25A 1SAXA 3ZQ7A 2HDCA 1TNSA 1YW8A 2XAGA 1LJ9A 1HKTA 3F6OA 2NNNA 3K9TA 2X0LA 2G9WA 3GVAA 2JRTA 4BHPA 3IKVA 3N4MA 2O61A 2DPUA 3QP6A 4IXAA 3HRTA 1IXSB 4OIQF 3FF5A 2BGCA 1OMIA 3RKXA 3J81Z 1JHFA 3LAJA 2VT3A 2WV0A 3Q9SA 1U8RA 1MKMA 1QZYA 4B8XA 3GYHX 5BPDA 3E6MA 5F1RA 3M1EA 1V3FA 3WGGA 2RKHA 4MEXF 2E7WA 4OINF 4WK8F 3F21A 2A3SA 2P7VB 1IN8A 3I5UA 3F72A 5E8GA 2VONA 5E8IA 3C3WA 4HF0A 2F5DA 2W84A 4I02A 3VB2A 5E1XA 2NRAC 3GFMA 2P4WA 2FA5A 3ISPA 3JTGA 1FX7A 1XD7A 4CO8A 5IT9K 3COAC 2XRNA 1MDMB 1D5VA 2J5PA 3L7WA 2V9VA 5LRSA 2K27A 2F2EA 1R1VA 3ECHA 1RUNA 2XGXA 4L9NA 3FM5A 3KE2A 4HQMA 1ZGAA 2HQNA 1DUXC 3WU1B 5AIPA 1CF7B 4I09A 4RB0A 1U6GA 2PMUA 1SFEA 4LG0A 3TOBA 1REPC 3TOAA 1ZREA 3HSFA 3V8KA 1GVJA 2Z99A 4HZFA 2EFPA 2L01A 5ICFA 1J5YA 3HOTA 4M6XA 1SD4A 2PJPA 1OYIA 3VEPA 4AIHA 3BPVA 5CVUA 1W5SA 1I5ZA 4LMYA 3WGIA 3FMQA 5D5XB 1FBQA 1W7PB 2FQ3A 1YW7A 5E17F 1Z9CA 2YR2A 3IWFA 1KU3A 3TO7A 5D8LB 4AIKA 4WCGA 3E3VA 2IJLA 3QPHA 2XAQA 2HQRA 2A5YB 1OYYA 3T0YA 5J8FA 3QRFF 4KNYA 4RS8A 1EH7A 4IRHA 2QBYA 3R61A 2A6EF 4A6DA 1Q1HA 2G7UA 1AOYA 2KIMA 3HTUA 2MH9A 2W24A 3GUDA 3JSOA 3FX3A 2M45A 2FBKA 3I59B 3EETA 4GYIA 1XDSA 3F8MA 4A0XA 3U9GA 4K2EA 1U78A 4G6QA 1XB4A 2FOKA 1HW5A 4KN7X 5K5QA 1TQIA 3QOPA 1WRJA 1W4MA 1S6LA 3WG9A 1XGSA 3GX4X 5CVRA 5HDGA 1JGSA 2XIGA 2IA2A 2H6CA 2H27A 2HR3A 4HDUA 1SFUA 2L4MA 5CVIA 4MQVA 3H3ZA 4HX4A 2CGPA 3HSRA 1W7PD 5FFZA 4HV6A 2DQLA 5KVRA 3M9AA 3AAFA 4EGYA 3BP8A 2R7DA 4R8HA 5ICCA 3P7NA 5D5WB 2IA1A 1MZBA 1IRFA 4L5JA 3MFKA 1C0WA 4HX7A 3TO6A 4EJVA 1BI0A 4G94A 3KZYA 4ETSA 1J75A 5DCFA 1B6AA 1GHCA 3I64A 2VC0A 4XBFA 1ON1A 3CDHA 1O3RA 4LK0F 2H94A 3EYIA 5IT3A 1P2FA 1XMKA 4IRGA 1BC7C 1KYWA 1O3TA 1E17A 3RJPA 3K0LA 2Z5UA 1YFHA 1Y0UA 1STZA 1O7LA 3Q9VA 2F5EA 1YQAA 1XN7A 2ZNZA 4WF2A 2CW0F 3WTZA 2EJRA 1S29A 3ELKA 2P5LC 3KP5A 4I0AA 5ERIA 2KJBA 2MBFA 3BOQA 5HDNA 5LEKA 3PQJA 2O0YA 2M8EA 1FYMA 4Q4ZF 2A07F 2D45A 4MGRA 2CFXA 1D8JA 1SD6A 1LDDA 5LHGA 4GYGA 1XCVA 3W6JB 4L18B 2RDPA 1FPQA 3WGHA 2CO5A 2Q8KA 3ZMSA 2R3SA 5LGTA 3ZMZA 2V6CA 5FO5A 5HVQC 5D4RA 4MTEA 1BJAA 1R1UA 2WWYA 5FGMA 1SFXA 3ULQB 1PP8F 4LK1F 3P9KA 2VBZA 5BMZA 1KU2A 1O7FA 3J81K 3HTSB 1P4XA 4YFXF 2FXAA 5HLGA 3WE2A 2VN2A 1TQPA 2VXZA 3RKWA 4KDPA 1QQIA 4CXFA 1KQ9A 2HYFA 3I54A 4FHTA 4GGGA 1Z6RA 4P9FA 4AWXB 1SMYF 2IW5A 5HLHA 1O3SA 2M30A 3HYIA 3VODA 3DQVC 4D0PA 1S8NA 2P6TA 1HW2A 2OU2A 3CO6C 2NYXA 5L3BA 1YIOA 3EDPA 2RGVA 2BEOA 3KEQA 2YX7A 2STWA 2ZMEB 1IN5A 1YS7A 2H6BA 3GXOA 4EJUA 1J2XA 1FBUA 3FMRA 1RIOH 3LWFA 5D5VB 4UVCA 1PDNC 1P4AA 1Z7UA 3LQRA 4P55A 1CF7A 3P9CA 1UB9A 4UNOA 4P96A 3JTHA 3DV8A 1WI9A 4Y17A 1R36A 3R0AA 5DUKA 5AIQA 1ZGJA 1H0MA 3E97A 3FZVA 5LGUA 3MWMA 1IN4A 2DQRA 1FP1D 4M6YA 2HFHA 5TJJA 4ZZLA 3M8FA 2LF8A 3LFKA 3CJNA 5H6RA 1QNTA 1LQ1A 2XHKA 1F5TA 2PQ8A 4LB5A 1XGNA 5E20A 4HOBA 5A2QZ 1K78B 2BV6A 3BY6A 5E18F 3JSPA 1USTA 2QENA 4PDKA 1XGOA 4FT8A 2GZWA 5HS9A 1Z91A 3E5XA 5EEGA 3K1PA 1MD0A 4L0ZB 4HLXA 1QO0D 4Z2YA 5DCMA 2BE5F 4RGXA 3FHZA 3IC7A 1ZYRF 2VBYA 2ADUA 2DK8A 4OIPF 2GA2A 2W57A 4KICA 1GXQA 4RB3C 1JHHA 4A6EA 3R0JA 3RTRA 2YX4A 4U88A 4PZJA 1LEAA 4M71A 1D8KA 1WKMA 4ESFA 4WXCA 4KFCA 5CJ9A 2IP2A 2H09A 4CICA 2NAZA 1ZARA 3OV8A 2VE9A 4BQAA 2B0LA 2FRHA 4RB2C 3L9FA 3MAJA 1U5TA 2V1UA 3LSTA 2X4HA 5JHUA 4YFKF 2IVMA 4JK1X 4GXOA 4LJZF 3WU0A 3EUHA 1S7OA 4EM2A 5BQTA 2HKXA 2FMYA 3FMSA 4ENKA 2Z33A 3WTXC 4M9XA 3H3UA 3GW2A 5HLIA 4UV8A 1RZ4A 2EK5A 3HRSA 1TLHB 1EH6A 1FC3A 4KIFA 1T0FA 1FNNA 3M7GA 4O5VA 2QZ8A 2FEZA 3CUQA 4M72A 1K7AA 2QYOA 4MQ9F 2CYYA 2KRFA 4KIGA 2ISZA 2HTSA 1RNLA 3U2RA 4EM0B 2VT2A 4KT5C 3DPLC 3EYYA 1U3EM 2HYGD 1MJBA 2GQQA 4QWQA 2OZ6A 3HRUA 2ZO4A 1YW9A 3QAHA 4YIIA 5H20A 4UXNA 1FOKA 3QU3A 2E1NA 2G7HA 3GEZA 4M9SA 1GXPA 4KMFA 5JR3A 2Y0MA 3V8LA 4MEYF 5BPIA 3U1DA 3LAPA 4AD9A 2FE3A 4WX9A 2DBBA 2L4AA 3ZMDA 3E6CC 3KLOA 1FSHA 3ZMVA 1ODDA 4G9YA 5F64A 3DXJF 2VODA 4A5NA 1PP7U 1EH8A 3P9IA 1XGMA 4JBAA 1DPUA 3I71A 1IUYA 1G3SA 5BOXA 2PMHA 4KMUX 3IRRA 2NNYA 1R23A 5D5UB 1EV7A 5LGNA 4HQEA 2OA4A 5DUIA 4OU0A 1Z05A 4P5OA 2HZTA 3DPTA 3KEOA 4KYWA 1ZRFA 4XLPF 3QP5A 2EB7A 1L3LA 4LLLA 3MEXA 2FF4A 3RKYA 3WTVC 1LB2A 3IHUA 1F9NA 2EWNA 2CWEA 3RYPA 4HX8A 5HOOA 4L5IA 2D2WA 3R6SA 4Q47A 2DFIA 5CVVA 4I98B 2XKOA 2ZJ2A 4U0WA 5J6XA 1MJAA 3CLOA 2M5WA 2DT5A 2XVCA 2ETHA 2DI3A 5DD4A 2MLGA 2A6HF 1RUOA 4WXDA 3F8FA 1YTYA 1NHAA 4G7ZF 3KP4A 2O8XA 4WWCA 4F7ZA 1OPCA 5E1ZB 4L9VA 5BS6A 4RAYA 3ZP5A 4LG0B 2XAFA 4BNCA 1TW2A 1FT9A 4I01A 1XSVA 3F8BA 4MTDA 1KYZA 2ESNA 2EV5A 1BIBA 2O3FA 1U5TC 1PUEE 4Q48A 1X3UA 3O3KA 5L3DA 1LVAA 1F1ZA 3BZ6A 4HAMA 2VC1A 5E1WA 4P9UA 1ZLKA 3K69A 3N97A 4HF1A 1T2KA 2LSOA 1MJ9A 3GWZA 4IF4A 4ENJA 1UHMA 1UCRA 5LRRA 1ON2A 4I2OA 4ZYDA 5CLSA 3CUQC 4NQWA 2R7FA 4EMSA 5L3EA 3VOEA 5A2QK 2EFOA 2FBHA 2CSOA 2J5OA 3IRQA 4R79A 1HSTA 2LNBA 1R58A 3I4PA 5D4SA 2P8TA 3GFLA 3HUGA 3D5LA 2RVCA 1QPMA 1ZHFA 4HF2A 2XROA 2VBXA 1FZPB 5K5OA 1P6RA 4FX4A 4OIOF 1USSA 3ERED 3JW4A 1TQMA 4A12A 5KK1A 3T5XA 3RPUA 5LLQA 3I58A 1LEBA 4UHTA 1R00A 1HQCA 1B1BA 4PCQA 1TTYA 3BWGA 3SFZA 1J9IA 1KQ8A 1OKRA 3R60A 5D6EA 5D6FA 3V8JA 2DAOA 4IRIA 3HIFA 2Y48A 1IXRC 3ABUA 4ESBA 2QQAA 2RNJA 3L2CA 5ILVA 4UUVA 3SZTA 1KGSA 2ESHA 2VOOA 4ESJA 4LLGF 1YG2A 5K1YA 4L9JA 1K79A 1MDMA 1YLFA 5FLXZ 1YO5C 2XV4S 2OZUA 1K6OA 2OD5A 1G6NA 1W5TA 3DP7A 3HHHA 4H0EA 3ZMUA 1XSDA 2FBIA 3G3ZA 1BI3A 2TDXA 4ON0A 2PI0A 4GCVA 3JAMZ 3IL2A 2LKPA 4M9ZA 1XSXA 2MH2A 5L3CA 2EFQA 3RI4A 3I53A 2NS0A 3C7JA 1BC8C 2QWWA 2VOPA 2D1VA 1I6XA 2HS5A 2EFNA 4E70A 1S3JA 1XDUA 2OAZA 1SMTA 4KIBA 4Y13A 3GFIA 3J80Z 1S7AA 1IRGA 1W7PA 3B73A 3SZPA 1RI7A 1I27A 2KKOA 3B02A 4RGRA 1LDKB 1I1GA 2GWRA 1DP7P 4LB6B 2V79A 1J59A 1FWZA 3O2PE 3WODF 2P5VA 2EA2A 3SQNA 2LDUA 3BJAA 3BROA 1ZRCA 3GZ5A 4S05A 2GXBA 1BI2A 4OOIA 3KETA 1JXSA 4XSXF 3EQLF 2XUBA 2K02A 2F5CA 3K2ZA 2MLKA 4AVPA 1ZG1A 1HBXG 3D0SA 1FYLA 1B59A 3LQQA 4CGZA 4BXUA 3K1NA 4EV0A 5ILUA 3Q5FA 1BIAA 3ZPLA 1E2XA 3ZMTA 2FNPA 3H92A 3NEUA 2E1CA 2K4JA 3I59A 4MNUA 2GA1A 5H6QA 5CVJA 3KP7A 4LLNA 3RDIA 1UFMA 4OMYA 1G3YA 2M1BA 5ED4A 2IA0A 3MZYA 1KU9A 2KIFA 3DFGA 3LA3A 3KP6A 1P92A 4ZYEA 5HS8A 3CUOA 1QGPA 4PGHA 4JQFA 2BYVE 2KIUA 3K1MA 5ICGA 2IRFG 4KA4A 4ENMA 2QUFA 2VE8A 2HKOA 2RV8A 3E5QA 4CZZA 2GXGA 3O6BB 1DDNA 3TGNA 4IHSA 4HV5A 2OBPA 1O57A 4HW0A 1FY7A 2YSRA 1CGPA 2HOEA 5DV5A 2JT1A 2OQGA 1LNWA 5FFXA 3FXRA 3HOSA 1QBJA 1KA8A 2KJCA 5HDKA 3F23A 1BI1A 1G4DA 2HEOA 1VTNC 3TDZC 4I7HA 2C6YA 4DNCA 3LA7A 3ZN1A 5TRDA 1IN6A 2FNAA 2K7LA 4ZYGA 5ICEA 3DKWA 5F6FA 3HHGA 4GO1A 2UWMA 2Q0OA 3PFIA 2ZKZA 5DYMA 2HWVA 3TDUC 4IHTA 1UHWA 4U0VA 1QZZA 3OOPA 4MHGA 4A5MA 5EEHA 2JPCA 2FSWA 3MCZA 2AS5F 3GLXA 3W6KB 2L54A 4B09A 3QPTA 3BJOA 3BPXA 2OQRA 1FSEA 5L3FA 2DPDA 1HW1A 3GZ6A 1LDJA 3V4GA 3TO9A 1ZG3A 4LD5A 4UVAA 1OYWA 4BHCA 4QLCU 2ACJA 2PBIA 5L3GA 3LA2A 3IKTA 1IW7F 2L02A 4L0YB 4OIRF 1T6SA 2XKPA 2MD5A 5DD8A 4NHJA 4Q5SF 1ZG5A 4Y15A 1HXDA 3ZN0A 2AXLA 2MA3A 1ZAOA 3ABTA 5DCMB 4EJOA 4N0BA 1IF1A 2HTJA 4BH9A 1TW3A 1DPRA 4CYDA 1I1SA 2ZFWA 5D8KB 5ILSA 4HLYA 2Z3YA 4EQQA 4YG2F 3FXUA 4XSZF 5JVTA 1O3QA 3WTUC 2CQKA 4UV9A 4RGUA 3F6VA 1H9TA 4OMZA 1FP2A 2DK5A 4ZH4F 3KLNA 2W85A 1WSUA 1TNTA 4HA8A 5AONA 1ZLJA 2K86A 1IAWA 2O03A 2JPBA 1Z6TA 4O6JA 2PFBA 2LF7A 3RYRA 5LBQA 1ZRDA 5IT9Z 3NQOA 1WQ2A 2IT0A 4M73A 4S04A 1U5TB 2WTEA 2ZNYA 1T38A 1ZN2A 2P7CB 2EA4A 3E6BA 2E7XA 2QQ9A 2JTVA 2ZMEA 2A69F 3V7SA 2ZXJA 4YIFA 2Z9OA 2WC2A 2FMLA 2L3DA 5JFRA 2EV0A 1XMAA 3IWZA 3GF2A 2DU9A 3PQKA 2PLYA 3SHFA 5FLXK 2DTRA 2UXXA 1WWXA 4G7OF 4IVNA 4BAYA 3I0TA 5J8CA 2QQBA 1J0RA 3L00A 2PG4A 2ZBKA 5K5RA 3GO5A 5FD5A 2V1XA 1IN7A 1BBYA 1YS6A 4RB1A 2XAJA 3KP3A 3CUQB 3NRVA 4I0BA 4O3MA 3JAMK 2JSCA 4RAZA 1FBSA 2K4BA 4BHBA 2COMA 1B4AA 2Y75A 3C18A 6PAXA 1TBXA 3J7AO 1BM9A 3T1BA 3F8CA 5HS7A 4N9IA 2D1HA 4ASNA 3RIRA 4LFUA 4KUMA 1K78A 3DF8A 1IXCA 3L09A 3J80K 4BYYA 2P5KA 4XRFA 1FLIA 3T8TA 5FD6A 1SD5A 2ISYA 2A68F 4G8XA 3REOA 1MGTA 1D3YA 3ML6A 3QU6A 4IPAA 3HRMA 1BOAA 3GFJA 5DEQA 2F5FA 4R1HA 4N9HA 4CHUA 4EVIA 4G7HF 2PEXA 3G73A 2XASA 5LHIA 3F3XA 2QBYB 1R1TA 4EM1A 1SD7A 4TV7A 2IPQX 2BBYA 2VBWA 3F8NA 2M87A 4EGZA 3KP2A 1XCBA 1Z1DA 3E5UA 3S2WA 4HBLA 1IZ1A 5LHHA 1A04A 3TQNA 4U7BA 1V4RA 4RGSA 1H9GA 4EJWA 2UZKA 1ONVA 4A0YA 2YU3A 3MQ0A 1OR7A 2MC3A 1ULYA 2YPRA 1B9MA 4ENNA 5FB2A 2PN6A 1R5HA 3FM3A 4U0YA 3FWEA 3R4KA 3TKYA 1HKQA 2ZCWA 2FU4A 1B9NA 1U2WA 4A2UA 1J7KA 3SXYA 3WE3A 4NB5A 1R5GA 4CDGA 2ELHA 3DEUA 2GAUA 4ZZDA 4AIJA 4UVBA 1P4WA 3WTTC 4YFNF 4PGGA 3RPQA 3KCCA 4A0ZA 3WTWC 1F4KA 4IJAA 2GIVA 2DLLA 3BJ6A 3ROUA 4XLNF 5LEJA 1KQ0A 4WXHA 3ECOA 4KN4X 4LGWA 1KU7A 3KZZA 2RC4A 1T39A 3T8RA 2EV6A 4M74A 5DDGA 2V1DA 2O6GE 2QLZA 3C1DA 3WTSC 3E6DA 3KFWX 2DW4A 1ZH5A 2XAHA 4FX0A 1HSJA 4L9TA 2HGCA 2JZYA 2DO7A 4G6DA 2STTA 2Q2EA 4HDVA 2P6SA 3HSEA 5JI6A 3M8EA 1YYVA 4HYEA 1L0OC 2QM3A 1FYKA 1R22A 4DQ2A 3FXQA 1G3WA 1HKSA 4U7DA 1G3TA 3CTAA 3WTYC 2RN7A
chains in the Genus database with same CATH superfamily
1AWCA 1T98A 4CCNA 3BC8A 2WBMA 3BDDA 3V7CA 4DGWB 2CG4A 3V7RA 1BN5A 2CV1A 3F22A 3MZHA 3CO7C 2UXNA 3VFZA 5CYVA 2XF7A 2RQPA 4ZYHA 4FTHA 3U21A 2R5YA 4EJTA 2EFWA 1GV5A 2HNHA 3CQZJ 2A61A 1JE8A 1R7JA 4HPQA 4BY7J 4PJ0C 2QVOA 3F0CA 2BY0A 2OF7A 1Z3XA 5EF6A 5EDNA 2FD5A 3DTEA 2R4GA 2W25A 3BR5A 3OL3A 2BHYA 3ZOBA 3ZQ7A 1SAXA 2P0WA 2HDCA 1TNSA 1YW8A 2XAGA 1LJ9A 2WAEA 1HA8A 1HKTA 4XRSA 3F6OA 3CF5F 2NNNA 4BXFA 3DBLB 3K9TA 2AO9A 2X0LA 3BG7A 2G9WA 2P81A 1MSFC 3GVAA 1VFCA 3I3LA 2H8WA 2JRTA 2L7FP 2R7XA 4BHPA 3IKVA 3N4MA 2O61A 2DFEA 3S15J 2DPUA 3QP6A 4IXAA 3HRTA 3HUGB 1IXSB 3VWBA 2Y30A 4OIQF 3MVPA 3FF5A 2BGCA 1OMIA 4RAGA 3RKXA 3J81Z 1JHFA 3LAJA 1Z67A 2KT0A 2JSPA 2VT3A 4ZTJA 2WV0A 1HDPA 3Q9SA 4F93B 1U8RA 2M8GX 1MKMA 1JT6A 1QZYA 2IBDA 4L5EA 3GMEA 2LY1A 4XR6A 4X6AJ 1I3QJ 4B8XA 3GYHX 3KYDB 5BPDA 3E6MA 3KPHA 3ASOH 3K6GA 5F1RA 3IAS2 2NVYJ 3M1EA 1V3FA 2V6EA 2E1MC 3WGGA 2RKHA 2MC4A 4MEXF 3K4CA 2E7WA 4OINF 1TC3C 3TEDA 2JA5J 4WK8F 3DTIA 3F21A 2A3SA 2WAQA 2ZFUA 3JRBA 2P7VB 1IN8A 3I5UA 3F72A 4BJ5C 1LVKA 1DGRM 1U0JA 1I39A 3QOEA 5E8GA 3K7AJ 2VONA 4II2A 3KX2A 5E8IA 3CDIA 4FE4A 5EJCA 4IHVA 4HNTA 3C3WA 4HF0A 2F5DA 2W84A 4H4KC 4I02A 3VB2A 5E1XA 5IYDJ 2R7UA 2NRAC 5B66C 3GFMA 2P4WA 2FA5A 3ISPA 3JTGA 3CCLI 1FX7A 2E19A 3HOYJ 1XD7A 4FETA 4CO8A 5E3MA 5IT9K 3COAC 3VYTB 2XRNA 5CQGA 1MDMB 4B43A 1MNEA 1D5VA 2J5PA 3L7WA 1A6QA 2EZLA 2WA0A 2V9VA 3H5NA 5LRSA 5EGOB 1Z77A 2K9NA 2FOWA 4PJMA 2EZKA 4M6VA 2K27A 2V26A 3BR6A 2F2EA 1R1VA 2TRTA 3ECHA 3HM5A 3S3OA 1RUNA 1WJFA 2XGXA 4L9NA 3B6CA 3FM5A 3CC7I 2V1NA 3KE2A 4HQMA 1YOVB 1DGWY 1ZGAA 2HQNA 1DUXC 3WU1B 5AIPA 1CF7B 1FTTA 4I09A 4RB0A 1OR7C 5DS9A 3CCQI 1W5CC 1I50J 1BR2A 1U6GA 4DW6A 2PMUA 1ZGWA 1SFEA 2JUCA 4LG0A 3TOBA 1REPC 3TOAA 2HI3A 1ZREA 1QU3A 3HSFA 3V8KA 1GVJA 2Z99A 4HZFA 2EFPA 2L01A 5ICFA 1J5YA 2DJIA 3HOTA 4EEFG 5DM7F 4M6XA 4QIWN 3UKGA 1SD4A 3H9QA 2PJPA 2GOXB 1OYIA 3VEPA 1N77A 4AIHA 2OPTA 3BPVA 5CVUA 1W5SA 2B9SA 1I5ZA 4LMYA 2LY2A 2LYCA 2M7BA 2Z2SB 3GCMA 1X4OA 3S32A 4BEHB 1LPQA 2LFBA 2M7AA 5B5EC 2CH0A 3RQIA 1R49A 3IH4A 3WGIA 1APLC 3FMQA 5D5XB 5FKKA 2A5WA 2QKMB 1K6YA 1XTAA 3BTJA 3CLQA 3VPRA 3OYCA 1HOMA 1FBQA 2XF6A 4E7HA 3S3NA 2QA4I 1XS9A 4BBSJ 5EZGA 2LREA 1W7PB 2FQ3A 1YW7A 3D5SC 1MBHA 4E4HA 4IHWA 2IGNA 5E17F 1R4NB 3RPUD 5HNHA 1Z9CA 2XC7A 1Y39A 1T08B 2YR2A 2GIZA 3IWFA 2K3PA 1KU3A 1ZKGA 4XKBA 3FXJA 3TO7A 5D8LB 2ID6A 4AIKA 1TT5B 3BQZA 1YITI 5J4VA 4WCGA 3A02A 3E3VA 3VDXA 1W36D 3FIWA 4BKXA 2IJLA 1K4SA 3QPHA 2R7WA 1JKRC 3GTKJ 1HC8A 2XAQA 2HQRA 4A3DJ 4XKCA 2NS8A 4HSRA 3CMEI 3G1OA 3DLLF 1XPXA 2R7SA 1OFCX 2A5YB 2CU7A 1OYYA 3T0YA 3VSKA 5J8FA 2HYJA 2X85A 3QRFF 4KNYA 5EG0A 4RS8A 1EH7A 2ZXWH 2WV1A 4IRHA 2QBYA 3R61A 2YU9J 4IKFA 2A6EF 4A6DA 2CQXA 2MW8A 1Q1HA 5J40A 2G7UA 2DFFA 1AOYA 1X1PA 2KIMA 3ABLH 3BZCA 3HTUA 2MH9A 4XORA 3BR2A 2F4MB 2W24A 4MO7A 3JRAA 3GUDA 3CMYA 3JSOA 2GM4A 5F0FA 3FX3A 2M45A 2IAIA 2EH3A 2FBKA 4ITVA 3K70D 2R7TA 3I59B 3EETA 4GYIA 4NDLA 1XDSA 3F8MA 4V2GA 2DT7B 1G8XA 4A0XA 1TWAJ 3U9GA 4K2EA 1U78A 4G6QA 4A69C 1XB4A 4NC7A 1U8BA 1X4PA 3LFUA 1X2NA 1AA7A 2FOKA 4J00A 1HW5A 4KN7X 5K5QA 1ACIA 1TQIA 4DBRA 3OR1C 3QOPA 4XN0A 1WRJA 1W4MA 1S6LA 5K7HA 2R7RA 2L2OA 3FBIB 1XGSA 3WG9A 3GX4X 5CVRA 1W0TA 1X1AA 4XLHA 5HDGA 3QYFA 2IGKA 1JGSA 3RZDJ 4HRIA 2XIGA 2IA2A 2H6CA 3JRCA 2H27A 2HR3A 4HDUA 2FUG2 1SFUA 2L4MA 5CVIA 3FK6A 4XLEA 4MQVA 2F4OB 1MIJA 2X6XA 2DFHA 3H3ZA 4HX4A 3A03A 2CGPA 3HSRA 4NC8A 1W7PD 5FFZA 4HV6A 5J1UA 3ABKH 2DQLA 5KVRA 3M9AA 4ZTFA 3AAFA 4A3JJ 4EATA 2PJRA 2B63J 3HPGA 4EGYA 1JKPC 3NAUA 5C4JJ 3BP8A 2R7DA 4R8HA 5ICCA 3P7NA 5D5WB 4UUSA 2IA1A 1MZBA 4RLFA 1IRFA 2L7MP 4XRSG 3VSLA 1TT0A 2DA1A 2DMNA 4L5JA 5IOZA 3AG4H 4YRVA 3MFKA 1C0WA 4HX7A 2AQEA 3TO6A 2WB1N 4EJVA 3DKYA 4BL0B 2R0QC 1A36A 1BI0A 3E7LA 2LD5A 3JRIA 4G94A 2JRMA 3KZYA 4D5CA 1K83J 4ETSA 1J75A 3M3YJ 5DCFA 2MG4A 1A35A 1B6AA 1GHCA 1VQ5I 2QSFX 3VYRB 2NVUB 2R7QA 3I64A 5EZHA 2VC0A 4XBFA 1R6RA 2KPMA 1WGXA 3H5AA 2CW7A 1ON1A 3CDHA 4W1UA 2E2HJ 1O3RA 4LK0F 1NG6A 2H94A 2K9LA 5IYBJ 4A3MJ 3EUAA 3EYIA 2O5RA 5IT3A 1EA3A 1P2FA 3LSPA 2XSJC 1XMXA 2ID3A 2E34A 1XMKA 4HNVA 4IRGA 1BC7C 1KYWA 2Y2ZA 1D0YA 3LSRA 1O3TA 1E17A 3S16J 4I6ZA 3RJPA 4JX5A 3K0LA 3H9GA 3OYDA 2DXIA 2Z5UA 1YFHA 2B7EA 2LVSA 2X6WA 4PJNA 3W2VA 1T8IA 1Y0UA 1STZA 1O7LA 3Q9VA 1ETXA 2F5EA 1YQAA 1XN7A 2ZNZA 1VQ6I 1VZ0A 2KZGA 1YRNA 3BT9A 4WF2A 2CW0F 5JLXA 3SDBA 9ANTA 2KZVA 2K40A 3WTZA 2EJRA 1TWGJ 3BG6A 1P7JA 1S29A 1V5FA 3ELKA 1OCCH 2Z1DA 4B48A 2P5LC 3KP5A 4I0AA 4PSWA 3DBRB 5JHFA 5ERIA 1WJBA 2KJBA 2MBFA 3ONQA 1ORKA 3BOQA 5HDNA 5LEKA 3PQJA 4X0GA 3JREA 2CJJA 2O0YA 2LOOA 2M8EA 5EEAA 1FYMA 2QSGX 4Q4ZF 2A07F 2D45A 2E36A 4MGRA 4ZC3A 2CFXA 1D8JA 1SD6A 1LDDA 4CCLA 4GYGA 1XCVA 3W6JB 5LHGA 2RDPA 1FPQA 4L18B 4CSWA 3WGHA 2L9NA 2CO5A 2Q8KA 3ZMSA 4AVZA 1SANA 3FISA 4P1WA 2R3SA 5LGTA 3ZMZA 1SFKA 1IG7A 4NNJA 3GTPJ 5J1YA 1HDDC 2V6CA 1WH5A 5FO5A 5HVQC 1DP3A 2DTZA 2TCTA 5D4RA 4MTEA 2F6CA 2VIXA 3OS1A 1BJAA 3NWSA 1R1UA 3OSFA 3PNTA 2Z16A 4XLCA 2WWYA 1B72A 5FGMA 1SFXA 3ULQB 3MN2A 3QODA 4D1QA 1PP8F 4LK1F 3P9KA 2NXNB 2VBZA 2DDAA 5BMZA 1KU2A 1O7FA 5C44J 1RC9A 1ETQA 2DCEA 3J81K 3CF2A 3HTSB 2LP0A 2PX9A 1P4XA 4F92B 1LKXA 3S1RJ 3OS0A 3A0HC 4YFXF 2FXAA 3ZQLA 5HLGA 3WE2A 2M0CA 2VN2A 1TQPA 2KP6A 1GUUA 4ABZA 2NVQJ 2KLOA 5F27A 4LITA 2VXZA 4D5FA 3RKWA 4KDPA 1QQIA 1RETA 4CXFA 3CCMI 2DMUA 1KQ9A 2HYFA 3I54A 4AYBA 4FHTA 4GGGA 1Z6RA 4P9FA 1Y0NA 4AWXB 1SMYF 2IW5A 3BTCA 5HLHA 1O3SA 2M30A 3HYIA 3VODA 1QVUA 3DQVC 4D0PA 1BL0A 1S8NA 2P6TA 1RPWA 1HW2A 2OU2A 3CO6C 2NYXA 5L3BA 3LSIA 1YIOA 3EDPA 2RGVA 4BU2A 2BEOA 2O7OA 3KEQA 2OTLI 1WVRA 2YX7A 3ZCOA 4MIMA 2NOGA 4LOCA 5GP9A 2E35A 2WAQN 2STWA 2ZMEB 1IN5A 1YS7A 2H6BA 3GXOA 2KQRA 3J7ZI 4XN3A 4EJUA 1ETOA 1J2XA 1FBUA 5C3EJ 3FMRA 1RIOH 3LWFA 2VXDA 1VQ9I 2VJIA 4IQJA 4NUBA 5D5VB 4UVCA 1HLVA 3A0BC 2L7ZA 1PDNC 2BW3B 3K4LA 5CKTA 2XRLA 4F91B 1P4AA 4PFPA 3QYBA 1PUFA 4CCJA 1H88C 1Z7UA 1BR1A 3KYCB 2ELKA 3LQRA 1LFUP 1WZ2A 2Y9YA 2LC2A 4P55A 1VQMI 1CF7A 3P9CA 3PL8A 4JYKA 1UB9A 3DPUA 2DA2A 4UNOA 4P96A 3ZQGA 3H0DA 4F55A 3WHCA 3L2WA 3BLYA 3JTHA 3DV8A 2KMUA 1WI9A 3C2GA 4Y17A 4RBOA 1R36A 3R0AA 1M1EB 2VQGA 3TBIA 3ZXSA 3GTLJ 5DUKA 5C4XJ 2BVMA 1TWCJ 4QPOA 1RRJA 4LIVA 1TL8A 4B1RA 1X1BA 1VQ7I 5AIQA 3S1MJ 1ZGJA 1H0MA 3E97A 3FZVA 1ZTRA 2EILH 1SEUA 5LGUA 1A5JA 3CJTB 3MWMA 1IN4A 4I76A 2DQRA 3PO3J 1FP1D 4M6YA 2HFHA 5IYCJ 5TJJA 4ZZLA 3Q0UA 2O8KA 3M8FA 1OCRH 3BR3A 2LF8A 3I56I 3OR2C 2WAFA 3LFKA 2ECCA 3CJNA 1U9OA 5H6RA 1QNTA 1LQ1A 1SVOA 1JT0A 2L5QA 2LKSA 2XHKA 4M3BA 1F5TA 1N25A 4Y52J 2XGCA 2PQ8A 4LB5A 1XGNA 5E20A 2DODA 4HOBA 5A2QZ 1O4XA 1QPIA 1FJLA 3BZKA 5FLMJ 1K78B 2BV6A 4B47A 2E1MB 2OUMA 1MMNA 3PIPF 3BY6A 4BQQA 5E18F 1FOYA 4NQWB 3JSPA 1USTA 1AKHA 2QENA 4PDKA 1XGOA 3O8GA 2XPVA 3IUOA 3H5RA 2BY2A 2GZWA 4FT8A 4BJTA 3OYFA 5HS9A 1Z91A 3E5XA 1F43A 5EEGA 3K1PA 4RAFA 1MD0A 1D0XA 4HLXA 4IL6C 4L0ZB 2XDVA 1WCMJ 1QO0D 2K85A 4Z2YA 2E2IJ 1TWFJ 5DCMA 2BE5F 4M3EA 4RGXA 3JRHA 3FHZA 2CV2A 3IC7A 1ZYRF 2VBYA 4IZZA 2ADUA 3BTLA 2DK8A 4OIPF 2GA2A 2W57A 2AXTC 4KICA 2XAUA 1D1BA 1GXQA 2LRDA 3K2AA 1JJ6C 3CCSI 1UAAA 1RR8C 5HLTA 3FK7A 1UHSA 4XRMA 2OCEA 4RB3C 4AU7A 4IX7A 2I10A 1JHHA 4DYQA 4A6EA 3R0JA 3RTRA 3U1KA 4XOPA 2YX4A 4U88A 2HOAA 2DA5A 3H3VK 2LBFA 4JP0A 4RDUA 4PZJA 1LEAA 3KIOA 1LFBA 1NK2P 2RAEA 4M71A 4PJLA 1D8KA 3C2BA 1WKMA 4ESFA 4XIDA 1NTCA 4LIUA 4WXCA 4BE2A 1GT0C 5KAFC 4KFCA 2JA6J 4PFOA 5CJ9A 3ZQCA 2IP2A 2CRGA 2DMQA 2H09A 4CICA 2IS4A 2NAZA 3OYIA 4BE1A 1ZARA 2QCOA 2DA6A 1WHUA 3OV8A 2VE9A 4BQAA 3CJQB 1JTYA 2B0LA 3SEZA 2FRHA 1LFPA 4RB2C 3L9FA 3MAJA 1U5TA 2A6TA 1S72I 2V1UA 2JA7J 3LSTA 4J01A 2X4HA 5JHUA 4YFKF 4A93J 2IVMA 2DYSH 2HZDA 4JK1X 4GXOA 4LJZF 1OCPA 3AG3H 4B44A 3WU0A 3SZGA 3EUHA 1S7OA 2QEXI 4EM2A 5F04A 1UJ8A 3M8JA 2XB5A 5BQTA 2HKXA 2FMYA 3FMSA 2X1EA 3OS2A 4ENKA 2Z33A 2KISA 1AU7A 4XICA 3G1MA 2E60A 4XMYA 3WTXC 4M9XA 5B3SH 3H3UA 3GW2A 5HLIA 4UV8A 1EKEA 1X58A 1RZ4A 2OJED 2EK5A 1T56A 3HRSA 1QHGA 3PIOF 1TLHB 1EH6A 1FC3A 4KIFA 1T0FA 1FNNA 3M7GA 1JJ8C 3BTIA 4O5VA 5E79C 2QZ8A 2FEZA 1ENHA 3CUQA 4M72A 1K7AA 2QYOA 1WPKA 4DJAA 4JX4A 4MQ9F 2ZJRF 3AFHA 5M3MJ 2CYYA 2KRFA 4KIGA 2ISZA 2W00A 4IHXA 2HTSA 3FXLA 1RNLA 3U2RA 2X48A 1WFXA 4EM0B 2VT2A 3L1PA 4KT5C 3DPLC 3EYYA 1U3EM 2F4IA 2HYGD 1MJBA 2GQQA 4RM3A 4QWQA 4CH7A 2OZ6A 4V19K 2XPUA 2ZO4A 3HRUA 3HL2A 1YW9A 2Q2EB 4A3KJ 1QHHD 1B8IB 3QAHA 4YIIA 5FKNA 1N78A 2VQCA 4CCMA 4QPQA 3OYHA 1PJRA 1IDYA 5H20A 4UXNA 1FOKA 3QU3A 2XGDA 3AL0B 2E1NA 2G7HA 3GEZA 2LKXA 4M9SA 3MKZA 1GXPA 4KMFA 2HU9A 3JRFA 5JR3A 2R7ZJ 3IAM2 4OAZA 4CYCA 2CQNA 2HQAA 2Y0MA 1WJEA 3V8LA 3S8PA 1LE8B 4MEYF 5BPIA 3U1DA 3LAPA 2JWTA 4AD9A 3PJRA 2FE3A 1YIJI 1Z3YA 1VI0A 4IEJA 4WX9A 5FJ8J 2DBBA 2VKHA 1OCOH 5FKMA 1JGGA 2L4AA 3ZMDA 3ZQIA 3CCUI 3E6CC 4F3QA 1UG0A 3PM1A 3OYJA 4HNUA 2EZHA 3RZOJ 3KLOA 2DYRH 1FSHA 3ZMVA 2MFZA 4OAYA 3IV5A 3J7AY 1ODDA 3M1CA 2MSYA 3PUFA 4G9YA 3DXJF 1NG7A 5F64A 3TP0A 4A5NA 4E7ZA 1EH8A 4C3IJ 1PP7U 2VODA 2F48A 3P9IA 2XGEA 1XGMA 2X6OA 4JBAA 1A6IA 1DPUA 3I71A 1BJZA 2X9DA 1FOWA 4Z6YA 1IUYA 1G3SA 3OIOA 3IP4B 5KAIC 2MGQA 3DEWA 2ZJQF 5BOXA 3HGYA 2PMHA 3H1CA 2GBYA 4KMUX 2OC6A 2HOSA 3IRRA 2NNYA 1ETKA 4J19A 1R23A 1MMGA 4IOCF 1OLTA 5D5UB 1EV7A 1S7EA 5LGNA 4HQEA 2OA4A 5F0HA 2NVTJ 2W48A 3I9V2 1Z0XA 3BG3A 1WH7A 5E3LA 5DUIA 2MYSA 2KDOA 4OU0A 1Z05A 2EBIA 1EJ9A 4P5OA 2HZTA 3LSMA 3M07A 3MKYB 3LSJA 1WJAA 2LH9A 3DPTA 3HKZA 4QTRA 4FE7A 3KEOA 4KYWA 3H9JA 1ZRFA 4XLPF 2QF7A 2L9SA 2OV7A 3QP5A 4IQ4A 2GLOA 1MMSA 2EB7A 3I4NJ 2VQHA 1L3LA 4LLLA 3WTYC 3MEXA 2DMTA 2FF4A 3RKYA 4CCKA 3WTVC 3OYAA 1UZCA 3JRGA 1LB2A 1UMQA 3IHUA 4ZJZA 1F9NA 2EWNA 2CWEA 3HOVJ 3RYPA 4HX8A 5HOOA 1UG2A 1ERDA 4L5IA 2D2WA 3R6SA 2E71A 4Q47A 2ICWG 4HSTA 3Q0VA 2DFIA 5J4YA 3S2HJ 3H35A 5CVVA 3LSGA 4I98B 3W3CA 3CP2A 2XKOA 2UUZA 2ZJ2A 5KCMA 4U0WA 5J6XA 1MJAA 1SVLA 1Z21A 2YUSA 3S93A 1FOXA 3CLOA 4DYCA 5K7FA 2ZC2A 1XX5A 2M5WA 3NARA 2DT5A 2XVCA 5GTHC 3IH3A 2ETHA 3CDLA 2DI3A 3GTGJ 2Y31A 3G4SI 2VL8A 5DD4A 4XLFA 5M5YJ 1TP4A 1E3OC 3SJMA 2MLGA 2HPIA 2A6HF 2ZSHB 4MLOA 4AYBN 4WXDA 1RUOA 3N05A 2ELJA 2WY7Q 3F8FA 3PNYA 1YTYA 1NHAA 4S0HB 4G7ZF 1ZK8A 2BXYA 3S14J 2FX0A 5F08A 4E7KA 3KP4A 2O8XA 4WWCA 4F7ZA 2V9PA 1UELB 1OPCA 1X1CA 5IPAA 5E1ZB 1MH3A 1MBEA 4L9VA 5BS6A 2JQ7A 3BR0A 4RAYA 3ZP5A 3WG7H 4LG0B 2XAFA 1BW6A 4C3HJ 1QRYA 5IY5H 4BNCA 1TW2A 3S3MA 1FT9A 2QQ8A 4I01A 3QWLA 1XSVA 2IGOA 3F8BA 4MTDA 1KYZA 5FLVA 4II3A 2F5VA 1VQOI 3HXLA 2ESNA 3X2QH 2EV5A 3Q0WA 1BIBA 2O3FA 1U5TC 1VNDA 1PUEE 4Q48A 4NBQA 1Y8QB 1X3UA 4PK4A 2ZSIB 4C2MJ 3O3KA 4DYRA 5L3DA 1LVAA 2HXOA 1F1ZA 2Q1ZB 3EUHC 3BZ6A 4HAMA 3P5JA 2VC1A 1YJ9I 5E1WA 2K9QA 3DTKA 2H1LA 3L2UA 2XF5A 4P9UA 1ZLKA 3L2VA 3K69A 3N97A 1YJWI 4HF1A 1HF0A 1T2KA 1ETYA 2LSOA 1MJ9A 3GWZA 4FISA 1SVMA 4IF4A 4ENJA 3FXOA 4KISA 1UHMA 1UCRA 5LRRA 5LD2C 1T0FC 1ON2A 4I2OA 4GFBA 2W1OA 3ZRGA 3OSGA 2E1OA 4ZYDA 2VPLA 2ME6A 5CLSA 3CUQC 4NQWA 2R7FA 1PVEA 4EMSA 4A3GJ 5L3EA 3VOEA 3FDYA 4AC0A 3JR9A 3QPLA 5A2QK 3B6AA 4RLQA 4A3IJ 2EFOA 2FBHA 2CSOA 2J5OA 3IRQA 4R79A 2HDWA 2PMZN 5IP7J 1HSTA 2IS6A 1K61A 4C2TA 1H89C 2Y69H 3LSHA 2VUMJ 2LNBA 1KZHA 4YELA 1R58A 3I4PA 5D4SA 2P8TA 5EG0B 4Y7NJ 3GFLA 3HUGA 3D5LA 1VQNI 3CESA 1NH3A 2BVLA 2RREA 5HNFA 2IXSA 2RVCA 1QPMA 1ZHFA 4HF2A 2XROA 2VBXA 1GDTA 2DN0A 1FZPB 5K5OA 1P6RA 2HVQA 2CUEA 3W2AA 4FX4A 3HDDA 4CA0A 2D5VA 4PSXA 4OIOF 5FRMA 1USSA 4B4CA 3ERED 2NS7A 3JW4A 1TQMA 3QPSA 4A12A 1R71A 5KK1A 3T5XA 1FMVA 3RPUA 4JX6A 5LLQA 3I58A 1E3HA 2M3AA 1LEBA 2VJJA 3OOUA 3WU2C 2DA7A 4UHTA 1R00A 1HQCA 1B1BA 4M3FA 3CMAI 4PCQA 1TTYA 3DLAA 5B1BH 3BWGA 3SFZA 1J9IA 2H8RA 1KQ8A 2CQ7A 1OKRA 3R60A 5D6EA 1IV8A 1CQTA 5D6FA 2R7VA 3V8JA 2DAOA 4IRIA 3UNGC 1X3ZB 3CP8A 3HIFA 2Y48A 4PJJA 1IXRC 3ABUA 4ESBA 2QQAA 3OL4A 2RNJA 3L2CA 5ILVA 4UUVA 3ESWB 4AIDA 1POGA 3SZTA 1KGSA 2ESHA 2VOOA 4ESJA 4LLGF 3HGGA 1YG2A 2JMWA 3FKJA 5K1YA 2E5NA 3FXMA 4L9JA 3SYTA 1K79A 1ITYA 1MDMA 1GLNA 1YLFA 5FLXZ 1YO5C 1IGNA 1U9NA 2ZXIA 5CQEA 2XV4S 2OZUA 1YI2I 1K6OA 4N4NB 5EGOA 2OD5A 1G6NA 1W5TA 3DP7A 3HHHA 4XONA 2EINH 1W0UA 2X1DA 2PJRB 3BG9A 4H0EA 3ZMUA 3OYMA 1XSDA 2FBIA 3G3ZA 4C2UA 1BI3A 1YX5A 2K5CA 2JVHA 4BQNA 1WJCA 4UUSB 2TDXA 1IC8A 4E7IA 3BCBA 4ON0A 4DBQA 1QZEA 2PI0A 1W1WE 3K4KA 2NOJB 4GCVA 1R5ID 3PNVA 3JAMZ 3IL2A 2HDDA 3S1QJ 4D7MA 3KYLA 2LKPA 2VKVA 4M9ZA 2X6YA 1YX3A 1ZQ3P 4N4OB 1XC5A 1XSXA 2A05A 2VASA 4NC6A 2MH2A 4C9YA 5L3CA 2EFQA 1ETWA 4D7NA 3RI4A 3I53A 4XKWA 2NS0A 5H2FC 1F36A 3C7JA 1BC8C 2VQLA 2QGUA 4BEHA 3K4MA 2QWWA 2VOPA 2D1VA 1I6XA 2HS5A 2EFNA 3ZR8X 3HOWJ 2M0MA 4E70A 5FRNA 3GTOJ 1I3AA 1S3JA 1XDUA 1PYVA 2OAZA 1SMTA 4KIBA 2KIQA 2WY8Q 3HEFA 5DTDA 4Y13A 1WI3A 1WJ5A 2ZXHA 3GFIA 3FKIJ 4DOZA 3FBNB 3J80Z 1S7AA 1IRGA 4XL9A 1Q1VA 1W7PA 4RA2A 3LNQA 3B73A 3SZPA 4DZJA 1RI7A 1T95A 2PMZA 4BDYA 2CQQA 1I27A 2KKOA 4KT6A 3G2BA 1K4TA 2VLAA 3B02A 4RGRA 3H0GJ 1LDKB 1I1GA 2GWRA 1DP7P 3MMYB 4LB6B 1XG1A 2V79A 4A3LJ 3DU5A 1FWZA 1J59A 3O2PE 4V2FA 2P5VA 2EA2A 3WODF 5GAHJ 1YE9A 1YRNB 1S5LC 3SQNA 2LDUA 3BJAA 3BROA 1ZRCA 3GZ5A 2R5ZB 4S05A 2GXBA 3GLLA 1R4MB 1BI2A 4OOIA 4IHYA 3KETA 2HVRA 1JXSA 3MZ8A 4XSXF 3EQLF 2XUBA 2K02A 4ZYAA 1VQ8I 2F5CA 2M34A 3K2ZA 5KHDA 2BY3A 1Z7LA 2MLKA 2LLKA 3ERMA 2EPFA 3HC7A 4AVPA 1ZG1A 5GAEJ 2BXZA 1HBXG 3D0SA 1FYLA 1VF9A 1OQYA 1B59A 3LQQA 3VYUB 4RMNA 2RQQA 4D9JA 4JOMA 4BXUA 4CGZA 2E2JJ 4M3DA 3C2HA 3A1YA 3K1NA 4EV0A 2R7OA 5ILUA 4B3AA 3Q5FA 1FEXA 3CCJI 1JUSA 4XQFA 1BIAA 1Y1VJ 3ZPLA 1E2XA 3ZMTA 2FNPA 2L7KA 1X3WB 3H92A 3NEUA 2E1CA 2K4JA 3I59A 4MNUA 3G1LA 2GA1A 5EYRA 5H6QA 5CVJA 2UV1A 3KP7A 3OY9A 4LLNA 4Y4RA 3RDIA 1UFMA 4OMYA 1G3YA 4X1EA 1B72B 2M1BA 5ED4A 2IA0A 3MZYA 1KU9A 2KIFA 3DFGA 4CZCA 4UY8I 3V42A 3LA3A 2JK3A 1MBGA 2V4JC 3SEQA 1SC7A 3CCRI 2WADA 3KP6A 1P92A 1SAUA 4ZYEA 5HS8A 3NWTA 3CUOA 1QGPA 2FQ4A 4PGHA 1RKTA 5J1RA 4JQFA 2YS9A 4XKVA 1A31A 2BYVE 2KIUA 2VKDA 2M9HA 5F1JA 3MKWB 3K1MA 2XB0X 5ICGA 2IRFG 4KA4A 4ENMA 2QUFA 2VE8A 2JA2A 2M2EA 5J3LA 2GOMA 4OWRB 2HKOA 2RV8A 2HQ5A 3GTQJ 3QYEA 3E5QA 4Y33A 1WJDA 2L9VA 4ZDPA 4CZZA 2GXGA 2W7NA 3O6BB 2KFDA 1DDNA 3TGNA 4IHSA 4HV5A 4Y3OA 3HKZN 2OBPA 1O57A 2MABA 4HW0A 4FQGA 1FY7A 2YSRA 1QA6A 4AUXA 1CGPA 2I8DA 2HOEA 5DV5A 2JT1A 2OQGA 1LNWA 5FFXA 4GDFA 3OYNA 3FXRA 1MBJA 3HOSA 1QBJA 1KA8A 2KJCA 4E7SA 1D0ZA 2IEKA 1SFOJ 4BXXJ 4E7JA 5HDKA 2V9KA 2GXAA 2VJ4A 3F23A 1BI1A 1G4DA 1GV2A 1MNDA 2HEOA 5TGTA 1VTNC 1PUFB 1S9HA 1MBKA 3W6VA 1MW7A 4ZDLA 3TDZC 4I7HA 3ZGKA 4DNCA 2C6YA 3LA7A 3ZN1A 2R93J 5TRDA 1IN6A 2FNAA 2K7LA 4ZYGA 3OYLA 3A01B 5ICEA 2E5ZA 2K9SA 1HCRA 3DKWA 5F6FA 3HHGA 1W36C 4GO1A 2UWMA 3G6EI 1T33A 1X2MA 2Q0OA 3PFIA 2JUGA 1IJWC 1FMWA 2VPRA 2HPMA 5E3OA 1Y1WJ 3PO2J 4XLAA 1OCTC 2VKEA 2ZKZA 5DYMA 2HWVA 4UB6C 3TDUC 3CC4I 4IHTA 3M4OJ 1UHWA 3OYKA 4BGDA 4U0VA 1MMAA 1QZZA 3OOPA 4MHGA 4A5MA 1IRZA 5EEHA 1AHDP 2JPCA 2FSWA 3HZJA 2DA3A 3MCZA 5IP9J 2AS5F 3OYBA 1RESA 3GLXA 3W6KB 2L54A 4B09A 2IGMA 3QPTA 3SDGA 1MSEC 3BJOA 5FKOA 3TMOA 1JKQC 3KEYA 3AG1H 3BPXA 2JJ7A 3JRDA 3OIQA 2OQRA 1FSEA 5L3FA 2DPDA 4F52A 1HW1A 4LG3A 3GZ6A 5K7ZA 2BY1A 1LDJA 1EF4A 3V4GA 3TO9A 1ZG3A 2O9LA 4LD5A 2FJ1A 4UVAA 4G6TB 1OYWA 5TISC 1ZR2A 2CV0A 1IUFA 4BHCA 4QLCU 4G12A 3AG2H 3MD2A 4M3GA 3K70C 2R5YB 2ACJA 3HBLA 4FCYA 2PBIA 1GVDA 3TL4X 2KHMA 5L3GA 3VYSB 1YJNI 2M4GA 3DBHB 3LA2A 3IKTA 2HXIA 1IW7F 3PFYA 2I5UA 2ZB9A 3CJRB 1AKHB 3BQYA 2L02A 2QKLB 4L0YB 4OIRF 1T6SA 3K4JA 2XKPA 3EPZA 2MD5A 5DD8A 2K9MA 4NHJA 1ETVA 4Q5SF 1ZG5A 4Y15A 5DM6F 2ME0A 4UB8C 1HXDA 3W2WA 4HG2A 3ZN0A 2AXLA 4B3XA 2MA3A 1ZAOA 3ABTA 5DCMB 4EJOA 3LL7A 4N0BA 1IF1A 2HTJA 3DCFA 4BH9A 3ABMH 1TW3A 4BDZA 4IOAF 1DPRA 1TWHJ 4CYDA 3D1NI 1I1SA 2ZFWA 5D8KB 3AKZA 5ILSA 3CCYA 2Z3YA 4HLYA 3H36A 2KRCA 4EQQA 3DKXA 4YG2F 2L9RA 1D1CA 3AL0C 5F0CA 3FXUA 4XSZF 5JVTA 3HOUJ 1O3QA 3WTUC 4BQOA 2CQKA 4UV9A 1BR4A 3CCEI 4RGUA 3F6VA 1H9TA 4OMZA 2LBFB 4XM3A 1J09A 4HEA2 3ASNH 1FP2A 3O8HA 2DK5A 3HOXJ 4ZH4F 3KLNA 2W85A 1WSUA 1BA5A 1TNTA 4HA8A 5AONA 1ZLJA 5GPCA 2K86A 1IAWA 3HOZJ 2O03A 2JPBA 2JN6A 3TW6A 2EIJH 1JKOC 4C30A 1OISA 1Z6TA 5M3FJ 4CCOA 1VQLI 4O6JA 2PFBA 2LF7A 3RYRA 5LBQA 1ZRDA 5IT9Z 2W82A 3NQOA 1WQ2A 1E3PA 2H1KA 2CFOA 3RKQA 1NK3P 2IT0A 4M73A 4S04A 5IOYA 3FHNA 1TZLA 1U5TB 2WTEA 2ZNYA 1T38A 1ZN2A 1QVTA 1OCZH 2P7CB 5JLWA 2EA4A 3E6BA 2E7XA 2QQ9A 2JTVA 4IO9F 1IO2A 2W4SA 2ZMEA 5HODA 2A69F 1V5GA 3V7SA 1E0EA 2ZXJA 1VQKI 2Y0SN 3S1NJ 5JVGF 4YIFA 2Z9OA 2N8GA 1JUMA 2VB6A 2WC2A 4KJZA 2FMLA 2L3DA 5JFRA 2EIMH 2DOFA 2LTPA 3RCOA 3D5RC 2KDZA 2EV0A 3HB9A 2L0KA 2BW3A 3DU6A 3K10A 3BCAA 1XMAA 3IWZA 3GF2A 2DU9A 3PQKA 2PLYA 3SHFA 1FIAA 5FLXK 1G59A 2DTRA 5M5WJ 2G0EA 2HOTA 2LY9A 2UXXA 2BZTA 3J7YJ 5GPAA 1MH4A 1WWXA 4G7OF 4IVNA 5BNGA 3I0TA 4BAYA 5J8CA 2QQBA 1J0RA 3L00A 2PG4A 2ZBKA 5K5RA 1G2HA 3GO5A 5FD5A 5FKLA 2V1XA 1IN7A 1BBYA 1YS6A 4RB1A 4A3CJ 2LMDA 2XAJA 5GADJ 3KP3A 2Y9ZA 3CUQB 3I4MJ 1H8AC 1DQUA 3NRVA 4I0BA 1P9QC 4O3MA 3HPHA 4RM2A 3JAMK 1V54H 3IH2A 2JSCA 2LK2A 1DU0A 4RAZA 1FBSA 5GAGJ 2K4BA 4BHBA 3TW7A 2COMA 4A3BJ 1B4AA 2Y75A 5GTIC 3GZNB 3CCVI 3E0JB 2XSDC 1R9TJ 1V5EA 1MBFA 4A3FJ 5FROA 3C18A 2KL4A 3A4CA 6PAXA 4E7LA 2AHQA 2CMPA 1TBXA 1ZELA 4XK4A 3J7AO 1JUPA 1BM9A 3KZIC 3T1BA 3OYGA 2QSHX 3F8CA 2EQRA 3DEEA 5HS7A 4N9IA 2D1HA 4ASNA 3RIRA 1VQPI 4LFUA 3DWLE 4CYCB 4KUMA 1K78A 2COBA 4ZDOA 3DF8A 4BBRJ 1IXCA 3L09A 3J80K 3LOCA 4BYYA 2P5KA 1Y56A 4XRFA 1FLIA 3T8TA 2DDBA 4W97A 5FD6A 4BS9A 1SD5A 2ISYA 2A68F 4G8XA 3REOA 1MGTA 1D1AA 1D3YA 4CUGA 3ML6A 3PSIA 2R5ZA 1DU6A 3QU6A 4IPAA 2XPWA 1N75A 1LUJB 2OTJI 3K4NA 3I55I 3HRMA 1BOAA 3GFJA 5DEQA 4XNFA 4DZPA 2F5FA 4R1HA 4N9HA 4YEJA 4BUPA 4CHUA 4EVIA 4G7HF 2BHZA 4XOTA 3SFIA 2PEXA 1I6HJ 3G73A 3F9KA 3CMMA 2XASA 5LHIA 3OIPA 5LFAA 4PUSA 3F3XA 5KNLA 2QBYB 4ANJA 2LR8A 1R1TA 3WHBA 4EM1A 1IRXA 1SD7A 4TV7A 3A2KA 5IP6A 4MFDA 2IPQX 2CW8A 1FTZA 2X51A 2BBYA 2VBWA 3F8NA 2M87A 4EGZA 4MFEA 4I99C 3BG5A 3KP2A 2CUJA 3S17J 1XCBA 1Z1DA 2JA8J 3E5UA 2R92J 3PUBA 3S2WA 4HBLA 1IZ1A 5LHHA 1A04A 3TQNA 4U7BA 1D5YA 1V4RA 4RGSA 1H9GA 3L2RA 2DOAA 1ZR4A 4EJWA 2UZKA 5M5XJ 1ONVA 4A0YA 3ZQQA 2YU3A 1Y6IA 3MQ0A 3Q3SA 3UR3C 2Y0SA 1OR7A 4BY1J 2MC3A 2KRHA 3ZQHA 3HG9A 1ULYA 4A3EJ 2YPRA 1B9MA 4ENNA 2M4KA 3EUKL 5FB2A 2PN6A 1R5HA 3GBGA 3FM3A 4U0YA 3OMYA 3FWEA 2RNGA 3GTMJ 3R4KA 3TKYA 1HKQA 2ZCWA 1JTXA 2FU4A 3LMMA 2IS2A 1B9NA 1U2WA 2LG4A 1J7KA 3SXYA 1KONA 3WE3A 4QSHA 4A2UA 1BW5A 3OWTA 4NB5A 5CPRB 1R5GA 4CDGA 2ELHA 3G71I 4AM3A 3DEUA 2HVSA 2GAUA 2K3FA 4KITB 3CD6I 3LSKA 4ZZDA 2WB1A 4FASD 4AIJA 4UVBA 1P4WA 4GRIA 2CS3A 3RSNA 3WTTC 1OJLA 4E6KG 4YFNF 1YHQI 4PGGA 3RPQA 3KCCA 4A0ZA 4C3JJ 3WTWC 2CUZA 4DIQA 4IJAA 3CZ6A 1F4KA 4UUTA 3S2DJ 2BOLA 2GIVA 2DMPA 4U87A 2DLLA 3MKLA 4YIRX 3BJ6A 3ROUA 2IS1A 4XLNF 5LEJA 1KQ0A 2VJ5A 4WXHA 3ECOA 3GTJJ 4KN4X 4LGWA 1KU7A 3KZZA 1X1DA 2RC4A 1T39A 3T8RA 2EV6A 4M74A 5DDGA 1MNMC 3TP3A 1MMDA 2V1DA 2O6GE 2QLZA 3C1DA 1VQ4I 2AQFA 3WTSC 2DT6A 3E6DA 2DOEA 1JI8A 2V7FA 3OYEA 3KFWX 3BR1A 1Y8RB 2DW4A 1ZH5A 2XAHA 4FX0A 1HSJA 2X1CA 4L9TA 5B1AH 2JVGA 2OCCH 2CUFA 3A01A 2HGCA 3FXKA 1RR7A 2JZYA 2NVXJ 2VI6A 2DO7A 1X19A 1V55H 4G6DA 3JCUC 1P7IA 3HJEA 1IDZA 2EIKH 2STTA 2Q2EA 5J47A 2ZJPF 4BJ6C 1B8IA 1FIPA 4HDVA 3RQ4A 2P6SA 3E1SA 3HSEA 1BOBA 5JI6A 1IV6A 3M8EA 1YYVA 4HYEA 1L0OC 2QM3A 1FYKA 1R22A 4DQ2A 3FXQA 4BACA 1G3WA 2DA4A 3PSFA 1HKSA 2EZIA 2ECBA 5E3NA 3QQAA 2ZMEC 4U7DA 1RKWA 4BE0A 3L2QA 1G3TA 2MD0A 3CTAA 1LE8A 3CC2I 2DJNA 3K4BA 3ZQFA 2RN7A
chains in the Genus database with same CATH topology
1AWCA 1T98A 3BDDA 3V7CA 2CG4A 3V7RA 1BN5A 3F22A 3MZHA 3CO7C 2UXNA 3VFZA 5CYVA 2RQPA 4ZYHA 4EJTA 2EFWA 2A61A 1JE8A 1R7JA 2QVOA 2W25A 1SAXA 3ZQ7A 2HDCA 1TNSA 1YW8A 2XAGA 1LJ9A 1HKTA 3F6OA 2NNNA 3K9TA 2X0LA 2G9WA 3GVAA 2JRTA 4BHPA 3IKVA 3N4MA 2O61A 2DPUA 3QP6A 4IXAA 3HRTA 1IXSB 4OIQF 3FF5A 2BGCA 1OMIA 3RKXA 3J81Z 1JHFA 3LAJA 2VT3A 2WV0A 3Q9SA 1U8RA 1MKMA 1QZYA 4B8XA 3GYHX 5BPDA 3E6MA 5F1RA 3M1EA 1V3FA 3WGGA 2RKHA 4MEXF 2E7WA 4OINF 4WK8F 3F21A 2A3SA 2P7VB 1IN8A 3I5UA 3F72A 5E8GA 2VONA 5E8IA 3C3WA 4HF0A 2F5DA 2W84A 4I02A 3VB2A 5E1XA 2NRAC 3GFMA 2P4WA 2FA5A 3ISPA 3JTGA 1FX7A 1XD7A 4CO8A 5IT9K 3COAC 2XRNA 1MDMB 1D5VA 2J5PA 3L7WA 2V9VA 5LRSA 2K27A 2F2EA 1R1VA 3ECHA 1RUNA 2XGXA 4L9NA 3FM5A 3KE2A 4HQMA 1ZGAA 2HQNA 1DUXC 3WU1B 5AIPA 1CF7B 4I09A 4RB0A 1U6GA 2PMUA 1SFEA 4LG0A 3TOBA 1REPC 3TOAA 1ZREA 3HSFA 3V8KA 1GVJA 2Z99A 4HZFA 2EFPA 2L01A 5ICFA 1J5YA 3HOTA 4M6XA 1SD4A 2PJPA 1OYIA 3VEPA 4AIHA 3BPVA 5CVUA 1W5SA 1I5ZA 4LMYA 3WGIA 3FMQA 5D5XB 1FBQA 1W7PB 2FQ3A 1YW7A 5E17F 1Z9CA 2YR2A 3IWFA 1KU3A 3TO7A 5D8LB 4AIKA 4WCGA 3E3VA 2IJLA 3QPHA 2XAQA 2HQRA 2A5YB 1OYYA 3T0YA 5J8FA 3QRFF 4KNYA 4RS8A 1EH7A 4IRHA 2QBYA 3R61A 2A6EF 4A6DA 1Q1HA 2G7UA 1AOYA 2KIMA 3HTUA 2MH9A 2W24A 3GUDA 3JSOA 3FX3A 2M45A 2FBKA 3I59B 3EETA 4GYIA 1XDSA 3F8MA 4A0XA 3U9GA 4K2EA 1U78A 4G6QA 1XB4A 2FOKA 1HW5A 4KN7X 5K5QA 1TQIA 3QOPA 1WRJA 1W4MA 1S6LA 3WG9A 1XGSA 3GX4X 5CVRA 5HDGA 1JGSA 2XIGA 2IA2A 2H6CA 2H27A 2HR3A 4HDUA 1SFUA 2L4MA 5CVIA 4MQVA 3H3ZA 4HX4A 2CGPA 3HSRA 1W7PD 5FFZA 4HV6A 2DQLA 5KVRA 3M9AA 3AAFA 4EGYA 3BP8A 2R7DA 4R8HA 5ICCA 3P7NA 5D5WB 2IA1A 1MZBA 1IRFA 4L5JA 3MFKA 1C0WA 4HX7A 3TO6A 4EJVA 1BI0A 4G94A 3KZYA 4ETSA 1J75A 5DCFA 1B6AA 1GHCA 3I64A 2VC0A 4XBFA 1ON1A 3CDHA 1O3RA 4LK0F 2H94A 3EYIA 5IT3A 1P2FA 1XMKA 4IRGA 1BC7C 1KYWA 1O3TA 1E17A 3RJPA 3K0LA 2Z5UA 1YFHA 1Y0UA 1STZA 1O7LA 3Q9VA 2F5EA 1YQAA 1XN7A 2ZNZA 4WF2A 2CW0F 3WTZA 2EJRA 1S29A 3ELKA 2P5LC 3KP5A 4I0AA 5ERIA 2KJBA 2MBFA 3BOQA 5HDNA 5LEKA 3PQJA 2O0YA 2M8EA 1FYMA 4Q4ZF 2A07F 2D45A 4MGRA 2CFXA 1D8JA 1SD6A 1LDDA 5LHGA 4GYGA 1XCVA 3W6JB 4L18B 2RDPA 1FPQA 3WGHA 2CO5A 2Q8KA 3ZMSA 2R3SA 5LGTA 3ZMZA 2V6CA 5FO5A 5HVQC 5D4RA 4MTEA 1BJAA 1R1UA 2WWYA 5FGMA 1SFXA 3ULQB 1PP8F 4LK1F 3P9KA 2VBZA 5BMZA 1KU2A 1O7FA 3J81K 3HTSB 1P4XA 4YFXF 2FXAA 5HLGA 3WE2A 2VN2A 1TQPA 2VXZA 3RKWA 4KDPA 1QQIA 4CXFA 1KQ9A 2HYFA 3I54A 4FHTA 4GGGA 1Z6RA 4P9FA 4AWXB 1SMYF 2IW5A 5HLHA 1O3SA 2M30A 3HYIA 3VODA 3DQVC 4D0PA 1S8NA 2P6TA 1HW2A 2OU2A 3CO6C 2NYXA 5L3BA 1YIOA 3EDPA 2RGVA 2BEOA 3KEQA 2YX7A 2STWA 2ZMEB 1IN5A 1YS7A 2H6BA 3GXOA 4EJUA 1J2XA 1FBUA 3FMRA 1RIOH 3LWFA 5D5VB 4UVCA 1PDNC 1P4AA 1Z7UA 3LQRA 4P55A 1CF7A 3P9CA 1UB9A 4UNOA 4P96A 3JTHA 3DV8A 1WI9A 4Y17A 1R36A 3R0AA 5DUKA 5AIQA 1ZGJA 1H0MA 3E97A 3FZVA 5LGUA 3MWMA 1IN4A 2DQRA 1FP1D 4M6YA 2HFHA 5TJJA 4ZZLA 3M8FA 2LF8A 3LFKA 3CJNA 5H6RA 1QNTA 1LQ1A 2XHKA 1F5TA 2PQ8A 4LB5A 1XGNA 5E20A 4HOBA 5A2QZ 1K78B 2BV6A 3BY6A 5E18F 3JSPA 1USTA 2QENA 4PDKA 1XGOA 4FT8A 2GZWA 5HS9A 1Z91A 3E5XA 5EEGA 3K1PA 1MD0A 4L0ZB 4HLXA 1QO0D 4Z2YA 5DCMA 2BE5F 4RGXA 3FHZA 3IC7A 1ZYRF 2VBYA 2ADUA 2DK8A 4OIPF 2GA2A 2W57A 4KICA 1GXQA 4RB3C 1JHHA 4A6EA 3R0JA 3RTRA 2YX4A 4U88A 4PZJA 1LEAA 4M71A 1D8KA 1WKMA 4ESFA 4WXCA 4KFCA 5CJ9A 2IP2A 2H09A 4CICA 2NAZA 1ZARA 3OV8A 2VE9A 4BQAA 2B0LA 2FRHA 4RB2C 3L9FA 3MAJA 1U5TA 2V1UA 3LSTA 2X4HA 5JHUA 4YFKF 2IVMA 4JK1X 4GXOA 4LJZF 3WU0A 3EUHA 1S7OA 4EM2A 5BQTA 2HKXA 2FMYA 3FMSA 4ENKA 2Z33A 3WTXC 4M9XA 3H3UA 3GW2A 5HLIA 4UV8A 1RZ4A 2EK5A 3HRSA 1TLHB 1EH6A 1FC3A 4KIFA 1T0FA 1FNNA 3M7GA 4O5VA 2QZ8A 2FEZA 3CUQA 4M72A 1K7AA 2QYOA 4MQ9F 2CYYA 2KRFA 4KIGA 2ISZA 2HTSA 1RNLA 3U2RA 4EM0B 2VT2A 4KT5C 3DPLC 3EYYA 1U3EM 2HYGD 1MJBA 2GQQA 4QWQA 2OZ6A 3HRUA 2ZO4A 1YW9A 3QAHA 4YIIA 5H20A 4UXNA 1FOKA 3QU3A 2E1NA 2G7HA 3GEZA 4M9SA 1GXPA 4KMFA 5JR3A 2Y0MA 3V8LA 4MEYF 5BPIA 3U1DA 3LAPA 4AD9A 2FE3A 4WX9A 2DBBA 2L4AA 3ZMDA 3E6CC 3KLOA 1FSHA 3ZMVA 1ODDA 4G9YA 5F64A 3DXJF 2VODA 4A5NA 1PP7U 1EH8A 3P9IA 1XGMA 4JBAA 1DPUA 3I71A 1IUYA 1G3SA 5BOXA 2PMHA 4KMUX 3IRRA 2NNYA 1R23A 5D5UB 1EV7A 5LGNA 4HQEA 2OA4A 5DUIA 4OU0A 1Z05A 4P5OA 2HZTA 3DPTA 3KEOA 4KYWA 1ZRFA 4XLPF 3QP5A 2EB7A 1L3LA 4LLLA 3MEXA 2FF4A 3RKYA 3WTVC 1LB2A 3IHUA 1F9NA 2EWNA 2CWEA 3RYPA 4HX8A 5HOOA 4L5IA 2D2WA 3R6SA 4Q47A 2DFIA 5CVVA 4I98B 2XKOA 2ZJ2A 4U0WA 5J6XA 1MJAA 3CLOA 2M5WA 2DT5A 2XVCA 2ETHA 2DI3A 5DD4A 2MLGA 2A6HF 1RUOA 4WXDA 3F8FA 1YTYA 1NHAA 4G7ZF 3KP4A 2O8XA 4WWCA 4F7ZA 1OPCA 5E1ZB 4L9VA 5BS6A 4RAYA 3ZP5A 4LG0B 2XAFA 4BNCA 1TW2A 1FT9A 4I01A 1XSVA 3F8BA 4MTDA 1KYZA 2ESNA 2EV5A 1BIBA 2O3FA 1U5TC 1PUEE 4Q48A 1X3UA 3O3KA 5L3DA 1LVAA 1F1ZA 3BZ6A 4HAMA 2VC1A 5E1WA 4P9UA 1ZLKA 3K69A 3N97A 4HF1A 1T2KA 2LSOA 1MJ9A 3GWZA 4IF4A 4ENJA 1UHMA 1UCRA 5LRRA 1ON2A 4I2OA 4ZYDA 5CLSA 3CUQC 4NQWA 2R7FA 4EMSA 5L3EA 3VOEA 5A2QK 2EFOA 2FBHA 2CSOA 2J5OA 3IRQA 4R79A 1HSTA 2LNBA 1R58A 3I4PA 5D4SA 2P8TA 3GFLA 3HUGA 3D5LA 2RVCA 1QPMA 1ZHFA 4HF2A 2XROA 2VBXA 1FZPB 5K5OA 1P6RA 4FX4A 4OIOF 1USSA 3ERED 3JW4A 1TQMA 4A12A 5KK1A 3T5XA 3RPUA 5LLQA 3I58A 1LEBA 4UHTA 1R00A 1HQCA 1B1BA 4PCQA 1TTYA 3BWGA 3SFZA 1J9IA 1KQ8A 1OKRA 3R60A 5D6EA 5D6FA 3V8JA 2DAOA 4IRIA 3HIFA 2Y48A 1IXRC 3ABUA 4ESBA 2QQAA 2RNJA 3L2CA 5ILVA 4UUVA 3SZTA 1KGSA 2ESHA 2VOOA 4ESJA 4LLGF 1YG2A 5K1YA 4L9JA 1K79A 1MDMA 1YLFA 5FLXZ 1YO5C 2XV4S 2OZUA 1K6OA 2OD5A 1G6NA 1W5TA 3DP7A 3HHHA 4H0EA 3ZMUA 1XSDA 2FBIA 3G3ZA 1BI3A 2TDXA 4ON0A 2PI0A 4GCVA 3JAMZ 3IL2A 2LKPA 4M9ZA 1XSXA 2MH2A 5L3CA 2EFQA 3RI4A 3I53A 2NS0A 3C7JA 1BC8C 2QWWA 2VOPA 2D1VA 1I6XA 2HS5A 2EFNA 4E70A 1S3JA 1XDUA 2OAZA 1SMTA 4KIBA 4Y13A 3GFIA 3J80Z 1S7AA 1IRGA 1W7PA 3B73A 3SZPA 1RI7A 1I27A 2KKOA 3B02A 4RGRA 1LDKB 1I1GA 2GWRA 1DP7P 4LB6B 2V79A 1J59A 1FWZA 3O2PE 3WODF 2P5VA 2EA2A 3SQNA 2LDUA 3BJAA 3BROA 1ZRCA 3GZ5A 4S05A 2GXBA 1BI2A 4OOIA 3KETA 1JXSA 4XSXF 3EQLF 2XUBA 2K02A 2F5CA 3K2ZA 2MLKA 4AVPA 1ZG1A 1HBXG 3D0SA 1FYLA 1B59A 3LQQA 4CGZA 4BXUA 3K1NA 4EV0A 5ILUA 3Q5FA 1BIAA 3ZPLA 1E2XA 3ZMTA 2FNPA 3H92A 3NEUA 2E1CA 2K4JA 3I59A 4MNUA 2GA1A 5H6QA 5CVJA 3KP7A 4LLNA 3RDIA 1UFMA 4OMYA 1G3YA 2M1BA 5ED4A 2IA0A 3MZYA 1KU9A 2KIFA 3DFGA 3LA3A 3KP6A 1P92A 4ZYEA 5HS8A 3CUOA 1QGPA 4PGHA 4JQFA 2BYVE 2KIUA 3K1MA 5ICGA 2IRFG 4KA4A 4ENMA 2QUFA 2VE8A 2HKOA 2RV8A 3E5QA 4CZZA 2GXGA 3O6BB 1DDNA 3TGNA 4IHSA 4HV5A 2OBPA 1O57A 4HW0A 1FY7A 2YSRA 1CGPA 2HOEA 5DV5A 2JT1A 2OQGA 1LNWA 5FFXA 3FXRA 3HOSA 1QBJA 1KA8A 2KJCA 5HDKA 3F23A 1BI1A 1G4DA 2HEOA 1VTNC 3TDZC 4I7HA 2C6YA 4DNCA 3LA7A 3ZN1A 5TRDA 1IN6A 2FNAA 2K7LA 4ZYGA 5ICEA 3DKWA 5F6FA 3HHGA 4GO1A 2UWMA 2Q0OA 3PFIA 2ZKZA 5DYMA 2HWVA 3TDUC 4IHTA 1UHWA 4U0VA 1QZZA 3OOPA 4MHGA 4A5MA 5EEHA 2JPCA 2FSWA 3MCZA 2AS5F 3GLXA 3W6KB 2L54A 4B09A 3QPTA 3BJOA 3BPXA 2OQRA 1FSEA 5L3FA 2DPDA 1HW1A 3GZ6A 1LDJA 3V4GA 3TO9A 1ZG3A 4LD5A 4UVAA 1OYWA 4BHCA 4QLCU 2ACJA 2PBIA 5L3GA 3LA2A 3IKTA 1IW7F 2L02A 4L0YB 4OIRF 1T6SA 2XKPA 2MD5A 5DD8A 4NHJA 4Q5SF 1ZG5A 4Y15A 1HXDA 3ZN0A 2AXLA 2MA3A 1ZAOA 3ABTA 5DCMB 4EJOA 4N0BA 1IF1A 2HTJA 4BH9A 1TW3A 1DPRA 4CYDA 1I1SA 2ZFWA 5D8KB 5ILSA 4HLYA 2Z3YA 4EQQA 4YG2F 3FXUA 4XSZF 5JVTA 1O3QA 3WTUC 2CQKA 4UV9A 4RGUA 3F6VA 1H9TA 4OMZA 1FP2A 2DK5A 4ZH4F 3KLNA 2W85A 1WSUA 1TNTA 4HA8A 5AONA 1ZLJA 2K86A 1IAWA 2O03A 2JPBA 1Z6TA 4O6JA 2PFBA 2LF7A 3RYRA 5LBQA 1ZRDA 5IT9Z 3NQOA 1WQ2A 2IT0A 4M73A 4S04A 1U5TB 2WTEA 2ZNYA 1T38A 1ZN2A 2P7CB 2EA4A 3E6BA 2E7XA 2QQ9A 2JTVA 2ZMEA 2A69F 3V7SA 2ZXJA 4YIFA 2Z9OA 2WC2A 2FMLA 2L3DA 5JFRA 2EV0A 1XMAA 3IWZA 3GF2A 2DU9A 3PQKA 2PLYA 3SHFA 5FLXK 2DTRA 2UXXA 1WWXA 4G7OF 4IVNA 4BAYA 3I0TA 5J8CA 2QQBA 1J0RA 3L00A 2PG4A 2ZBKA 5K5RA 3GO5A 5FD5A 2V1XA 1IN7A 1BBYA 1YS6A 4RB1A 2XAJA 3KP3A 3CUQB 3NRVA 4I0BA 4O3MA 3JAMK 2JSCA 4RAZA 1FBSA 2K4BA 4BHBA 2COMA 1B4AA 2Y75A 3C18A 6PAXA 1TBXA 3J7AO 1BM9A 3T1BA 3F8CA 5HS7A 4N9IA 2D1HA 4ASNA 3RIRA 4LFUA 4KUMA 1K78A 3DF8A 1IXCA 3L09A 3J80K 4BYYA 2P5KA 4XRFA 1FLIA 3T8TA 5FD6A 1SD5A 2ISYA 2A68F 4G8XA 3REOA 1MGTA 1D3YA 3ML6A 3QU6A 4IPAA 3HRMA 1BOAA 3GFJA 5DEQA 2F5FA 4R1HA 4N9HA 4CHUA 4EVIA 4G7HF 2PEXA 3G73A 2XASA 5LHIA 3F3XA 2QBYB 1R1TA 4EM1A 1SD7A 4TV7A 2IPQX 2BBYA 2VBWA 3F8NA 2M87A 4EGZA 3KP2A 1XCBA 1Z1DA 3E5UA 3S2WA 4HBLA 1IZ1A 5LHHA 1A04A 3TQNA 4U7BA 1V4RA 4RGSA 1H9GA 4EJWA 2UZKA 1ONVA 4A0YA 2YU3A 3MQ0A 1OR7A 2MC3A 1ULYA 2YPRA 1B9MA 4ENNA 5FB2A 2PN6A 1R5HA 3FM3A 4U0YA 3FWEA 3R4KA 3TKYA 1HKQA 2ZCWA 2FU4A 1B9NA 1U2WA 4A2UA 1J7KA 3SXYA 3WE3A 4NB5A 1R5GA 4CDGA 2ELHA 3DEUA 2GAUA 4ZZDA 4AIJA 4UVBA 1P4WA 3WTTC 4YFNF 4PGGA 3RPQA 3KCCA 4A0ZA 3WTWC 1F4KA 4IJAA 2GIVA 2DLLA 3BJ6A 3ROUA 4XLNF 5LEJA 1KQ0A 4WXHA 3ECOA 4KN4X 4LGWA 1KU7A 3KZZA 2RC4A 1T39A 3T8RA 2EV6A 4M74A 5DDGA 2V1DA 2O6GE 2QLZA 3C1DA 3WTSC 3E6DA 3KFWX 2DW4A 1ZH5A 2XAHA 4FX0A 1HSJA 4L9TA 2HGCA 2JZYA 2DO7A 4G6DA 2STTA 2Q2EA 4HDVA 2P6SA 3HSEA 5JI6A 3M8EA 1YYVA 4HYEA 1L0OC 2QM3A 1FYKA 1R22A 4DQ2A 3FXQA 1G3WA 1HKSA 4U7DA 1G3TA 3CTAA 3WTYC 2RN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWC A;  1T98 A;  3BDD A;  3V7C A;  2CG4 A;  3V7R A;  1BN5 A;  3F22 A;  3MZH A;  3CO7 C;  2UXN A;  3VFZ A;  5CYV A;  2RQP A;  4ZYH A;  4EJT A;  2EFW A;  2A61 A;  1JE8 A;  1R7J A;  2QVO A;  2W25 A;  1SAX A;  3ZQ7 A;  2HDC A;  1TNS A;  1YW8 A;  2XAG A;  1LJ9 A;  1HKT A;  3F6O A;  2NNN A;  3K9T A;  2X0L A;  2G9W A;  3GVA A;  2JRT A;  4BHP A;  3IKV A;  3N4M A;  2O61 A;  2DPU A;  3QP6 A;  4IXA A;  3HRT A;  1IXS B;  4OIQ F;  3FF5 A;  2BGC A;  1OMI A;  3RKX A;  3J81 Z;  1JHF A;  3LAJ A;  2VT3 A;  2WV0 A;  3Q9S A;  1U8R A;  1MKM A;  1QZY A;  4B8X A;  3GYH X;  5BPD A;  3E6M A;  5F1R A;  3M1E A;  1V3F A;  3WGG A;  2RKH A;  4MEX F;  2E7W A;  4OIN F;  4WK8 F;  3F21 A;  2A3S A;  2P7V B;  1IN8 A;  3I5U A;  3F72 A;  5E8G A;  2VON A;  5E8I A;  3C3W A;  4HF0 A;  2F5D A;  2W84 A;  4I02 A;  3VB2 A;  5E1X A;  2NRA C;  3GFM A;  2P4W A;  2FA5 A;  3ISP A;  3JTG A;  1FX7 A;  1XD7 A;  4CO8 A;  5IT9 K;  3COA C;  2XRN A;  1MDM B;  1D5V A;  2J5P A;  3L7W A;  2V9V A;  5LRS A;  2K27 A;  2F2E A;  1R1V A;  3ECH A;  1RUN A;  2XGX A;  4L9N A;  3FM5 A;  3KE2 A;  4HQM A;  1ZGA A;  2HQN A;  1DUX C;  3WU1 B;  5AIP A;  1CF7 B;  4I09 A;  4RB0 A;  1U6G A;  2PMU A;  1SFE A;  4LG0 A;  3TOB A;  1REP C;  3TOA A;  1ZRE A;  3HSF A;  3V8K A;  1GVJ A;  2Z99 A;  4HZF A;  2EFP A;  2L01 A;  5ICF A;  1J5Y A;  3HOT A;  4M6X A;  1SD4 A;  2PJP A;  1OYI A;  3VEP A;  4AIH A;  3BPV A;  5CVU A;  1W5S A;  1I5Z A;  4LMY A;  3WGI A;  3FMQ A;  5D5X B;  1FBQ A;  1W7P B;  2FQ3 A;  1YW7 A;  5E17 F;  1Z9C A;  2YR2 A;  3IWF A;  1KU3 A;  3TO7 A;  5D8L B;  4AIK A;  4WCG A;  3E3V A;  2IJL A;  3QPH A;  2XAQ A;  2HQR A;  2A5Y B;  1OYY A;  3T0Y A;  5J8F A;  3QRF F;  4KNY A;  4RS8 A;  1EH7 A;  4IRH A;  2QBY A;  3R61 A;  2A6E F;  4A6D A;  1Q1H A;  2G7U A;  1AOY A;  2KIM A;  3HTU A;  2MH9 A;  2W24 A;  3GUD A;  3JSO A;  3FX3 A;  2M45 A;  2FBK A;  3I59 B;  3EET A;  4GYI A;  1XDS A;  3F8M A;  4A0X A;  3U9G A;  4K2E A;  1U78 A;  4G6Q A;  1XB4 A;  2FOK A;  1HW5 A;  4KN7 X;  5K5Q A;  1TQI A;  3QOP A;  1WRJ A;  1W4M A;  1S6L A;  3WG9 A;  1XGS A;  3GX4 X;  5CVR A;  5HDG A;  1JGS A;  2XIG A;  2IA2 A;  2H6C A;  2H27 A;  2HR3 A;  4HDU A;  1SFU A;  2L4M A;  5CVI A;  4MQV A;  3H3Z A;  4HX4 A;  2CGP A;  3HSR A;  1W7P D;  5FFZ A;  4HV6 A;  2DQL A;  5KVR A;  3M9A A;  3AAF A;  4EGY A;  3BP8 A;  2R7D A;  4R8H A;  5ICC A;  3P7N A;  5D5W B;  2IA1 A;  1MZB A;  1IRF A;  4L5J A;  3MFK A;  1C0W A;  4HX7 A;  3TO6 A;  4EJV A;  1BI0 A;  4G94 A;  3KZY A;  4ETS A;  1J75 A;  5DCF A;  1B6A A;  1GHC A;  3I64 A;  2VC0 A;  4XBF A;  1ON1 A;  3CDH A;  1O3R A;  4LK0 F;  2H94 A;  3EYI A;  5IT3 A;  1P2F A;  1XMK A;  4IRG A;  1BC7 C;  1KYW A;  1O3T A;  1E17 A;  3RJP A;  3K0L A;  2Z5U A;  1YFH A;  1Y0U A;  1STZ A;  1O7L A;  3Q9V A;  2F5E A;  1YQA A;  1XN7 A;  2ZNZ A;  4WF2 A;  2CW0 F;  3WTZ A;  2EJR A;  1S29 A;  3ELK A;  2P5L C;  3KP5 A;  4I0A A;  5ERI A;  2KJB A;  2MBF A;  3BOQ A;  5HDN A;  5LEK A;  3PQJ A;  2O0Y A;  2M8E A;  1FYM A;  4Q4Z F;  2A07 F;  2D45 A;  4MGR A;  2CFX A;  1D8J A;  1SD6 A;  1LDD A;  5LHG A;  4GYG A;  1XCV A;  3W6J B;  4L18 B;  2RDP A;  1FPQ A;  3WGH A;  2CO5 A;  2Q8K A;  3ZMS A;  2R3S A;  5LGT A;  3ZMZ A;  2V6C A;  5FO5 A;  5HVQ C;  5D4R A;  4MTE A;  1BJA A;  1R1U A;  2WWY A;  5FGM A;  1SFX A;  3ULQ B;  1PP8 F;  4LK1 F;  3P9K A;  2VBZ A;  5BMZ A;  1KU2 A;  1O7F A;  3J81 K;  3HTS B;  1P4X A;  4YFX F;  2FXA A;  5HLG A;  3WE2 A;  2VN2 A;  1TQP A;  2VXZ A;  3RKW A;  4KDP A;  1QQI A;  4CXF A;  1KQ9 A;  2HYF A;  3I54 A;  4FHT A;  4GGG A;  1Z6R A;  4P9F A;  4AWX B;  1SMY F;  2IW5 A;  5HLH A;  1O3S A;  2M30 A;  3HYI A;  3VOD A;  3DQV C;  4D0P A;  1S8N A;  2P6T A;  1HW2 A;  2OU2 A;  3CO6 C;  2NYX A;  5L3B A;  1YIO A;  3EDP A;  2RGV A;  2BEO A;  3KEQ A;  2YX7 A;  2STW A;  2ZME B;  1IN5 A;  1YS7 A;  2H6B A;  3GXO A;  4EJU A;  1J2X A;  1FBU A;  3FMR A;  1RIO H;  3LWF A;  5D5V B;  4UVC A;  1PDN C;  1P4A A;  1Z7U A;  3LQR A;  4P55 A;  1CF7 A;  3P9C A;  1UB9 A;  4UNO A;  4P96 A;  3JTH A;  3DV8 A;  1WI9 A;  4Y17 A;  1R36 A;  3R0A A;  5DUK A;  5AIQ A;  1ZGJ A;  1H0M A;  3E97 A;  3FZV A;  5LGU A;  3MWM A;  1IN4 A;  2DQR A;  1FP1 D;  4M6Y A;  2HFH A;  5TJJ A;  4ZZL A;  3M8F A;  2LF8 A;  3LFK A;  3CJN A;  5H6R A;  1QNT A;  1LQ1 A;  2XHK A;  1F5T A;  2PQ8 A;  4LB5 A;  1XGN A;  5E20 A;  4HOB A;  5A2Q Z;  1K78 B;  2BV6 A;  3BY6 A;  5E18 F;  3JSP A;  1UST A;  2QEN A;  4PDK A;  1XGO A;  4FT8 A;  2GZW A;  5HS9 A;  1Z91 A;  3E5X A;  5EEG A;  3K1P A;  1MD0 A;  4L0Z B;  4HLX A;  1QO0 D;  4Z2Y A;  5DCM A;  2BE5 F;  4RGX A;  3FHZ A;  3IC7 A;  1ZYR F;  2VBY A;  2ADU A;  2DK8 A;  4OIP F;  2GA2 A;  2W57 A;  4KIC A;  1GXQ A;  4RB3 C;  1JHH A;  4A6E A;  3R0J A;  3RTR A;  2YX4 A;  4U88 A;  4PZJ A;  1LEA A;  4M71 A;  1D8K A;  1WKM A;  4ESF A;  4WXC A;  4KFC A;  5CJ9 A;  2IP2 A;  2H09 A;  4CIC A;  2NAZ A;  1ZAR A;  3OV8 A;  2VE9 A;  4BQA A;  2B0L A;  2FRH A;  4RB2 C;  3L9F A;  3MAJ A;  1U5T A;  2V1U A;  3LST A;  2X4H A;  5JHU A;  4YFK F;  2IVM A;  4JK1 X;  4GXO A;  4LJZ F;  3WU0 A;  3EUH A;  1S7O A;  4EM2 A;  5BQT A;  2HKX A;  2FMY A;  3FMS A;  4ENK A;  2Z33 A;  3WTX C;  4M9X A;  3H3U A;  3GW2 A;  5HLI A;  4UV8 A;  1RZ4 A;  2EK5 A;  3HRS A;  1TLH B;  1EH6 A;  1FC3 A;  4KIF A;  1T0F A;  1FNN A;  3M7G A;  4O5V A;  2QZ8 A;  2FEZ A;  3CUQ A;  4M72 A;  1K7A A;  2QYO A;  4MQ9 F;  2CYY A;  2KRF A;  4KIG A;  2ISZ A;  2HTS A;  1RNL A;  3U2R A;  4EM0 B;  2VT2 A;  4KT5 C;  3DPL C;  3EYY A;  1U3E M;  2HYG D;  1MJB A;  2GQQ A;  4QWQ A;  2OZ6 A;  3HRU A;  2ZO4 A;  1YW9 A;  3QAH A;  4YII A;  5H20 A;  4UXN A;  1FOK A;  3QU3 A;  2E1N A;  2G7H A;  3GEZ A;  4M9S A;  1GXP A;  4KMF A;  5JR3 A;  2Y0M A;  3V8L A;  4MEY F;  5BPI A;  3U1D A;  3LAP A;  4AD9 A;  2FE3 A;  4WX9 A;  2DBB A;  2L4A A;  3ZMD A;  3E6C C;  3KLO A;  1FSH A;  3ZMV A;  1ODD A;  4G9Y A;  5F64 A;  3DXJ F;  2VOD A;  4A5N A;  1PP7 U;  1EH8 A;  3P9I A;  1XGM A;  4JBA A;  1DPU A;  3I71 A;  1IUY A;  1G3S A;  5BOX A;  2PMH A;  4KMU X;  3IRR A;  2NNY A;  1R23 A;  5D5U B;  1EV7 A;  5LGN A;  4HQE A;  2OA4 A;  5DUI A;  4OU0 A;  1Z05 A;  4P5O A;  2HZT A;  3DPT A;  3KEO A;  4KYW A;  1ZRF A;  4XLP F;  3QP5 A;  2EB7 A;  1L3L A;  4LLL A;  3MEX A;  2FF4 A;  3RKY A;  3WTV C;  1LB2 A;  3IHU A;  1F9N A;  2EWN A;  2CWE A;  3RYP A;  4HX8 A;  5HOO A;  4L5I A;  2D2W A;  3R6S A;  4Q47 A;  2DFI A;  5CVV A;  4I98 B;  2XKO A;  2ZJ2 A;  4U0W A;  5J6X A;  1MJA A;  3CLO A;  2M5W A;  2DT5 A;  2XVC A;  2ETH A;  2DI3 A;  5DD4 A;  2MLG A;  2A6H F;  1RUO A;  4WXD A;  3F8F A;  1YTY A;  1NHA A;  4G7Z F;  3KP4 A;  2O8X A;  4WWC A;  4F7Z A;  1OPC A;  5E1Z B;  4L9V A;  5BS6 A;  4RAY A;  3ZP5 A;  4LG0 B;  2XAF A;  4BNC A;  1TW2 A;  1FT9 A;  4I01 A;  1XSV A;  3F8B A;  4MTD A;  1KYZ A;  2ESN A;  2EV5 A;  1BIB A;  2O3F A;  1U5T C;  1PUE E;  4Q48 A;  1X3U A;  3O3K A;  5L3D A;  1LVA A;  1F1Z A;  3BZ6 A;  4HAM A;  2VC1 A;  5E1W A;  4P9U A;  1ZLK A;  3K69 A;  3N97 A;  4HF1 A;  1T2K A;  2LSO A;  1MJ9 A;  3GWZ A;  4IF4 A;  4ENJ A;  1UHM A;  1UCR A;  5LRR A;  1ON2 A;  4I2O A;  4ZYD A;  5CLS A;  3CUQ C;  4NQW A;  2R7F A;  4EMS A;  5L3E A;  3VOE A;  5A2Q K;  2EFO A;  2FBH A;  2CSO A;  2J5O A;  3IRQ A;  4R79 A;  1HST A;  2LNB A;  1R58 A;  3I4P A;  5D4S A;  2P8T A;  3GFL A;  3HUG A;  3D5L A;  2RVC A;  1QPM A;  1ZHF A;  4HF2 A;  2XRO A;  2VBX A;  1FZP B;  5K5O A;  1P6R A;  4FX4 A;  4OIO F;  1USS A;  3ERE D;  3JW4 A;  1TQM A;  4A12 A;  5KK1 A;  3T5X A;  3RPU A;  5LLQ A;  3I58 A;  1LEB A;  4UHT A;  1R00 A;  1HQC A;  1B1B A;  4PCQ A;  1TTY A;  3BWG A;  3SFZ A;  1J9I A;  1KQ8 A;  1OKR A;  3R60 A;  5D6E A;  5D6F A;  3V8J A;  2DAO A;  4IRI A;  3HIF A;  2Y48 A;  1IXR C;  3ABU A;  4ESB A;  2QQA A;  2RNJ A;  3L2C A;  5ILV A;  4UUV A;  3SZT A;  1KGS A;  2ESH A;  2VOO A;  4ESJ A;  4LLG F;  1YG2 A;  5K1Y A;  4L9J A;  1K79 A;  1MDM A;  1YLF A;  5FLX Z;  1YO5 C;  2XV4 S;  2OZU A;  1K6O A;  2OD5 A;  1G6N A;  1W5T A;  3DP7 A;  3HHH A;  4H0E A;  3ZMU A;  1XSD A;  2FBI A;  3G3Z A;  1BI3 A;  2TDX A;  4ON0 A;  2PI0 A;  4GCV A;  3JAM Z;  3IL2 A;  2LKP A;  4M9Z A;  1XSX A;  2MH2 A;  5L3C A;  2EFQ A;  3RI4 A;  3I53 A;  2NS0 A;  3C7J A;  1BC8 C;  2QWW A;  2VOP A;  2D1V A;  1I6X A;  2HS5 A;  2EFN A;  4E70 A;  1S3J A;  1XDU A;  2OAZ A;  1SMT A;  4KIB A;  4Y13 A;  3GFI A;  3J80 Z;  1S7A A;  1IRG A;  1W7P A;  3B73 A;  3SZP A;  1RI7 A;  1I27 A;  2KKO A;  3B02 A;  4RGR A;  1LDK B;  1I1G A;  2GWR A;  1DP7 P;  4LB6 B;  2V79 A;  1J59 A;  1FWZ A;  3O2P E;  3WOD F;  2P5V A;  2EA2 A;  3SQN A;  2LDU A;  3BJA A;  3BRO A;  1ZRC A;  3GZ5 A;  4S05 A;  2GXB A;  1BI2 A;  4OOI A;  3KET A;  1JXS A;  4XSX F;  3EQL F;  2XUB A;  2K02 A;  2F5C A;  3K2Z A;  2MLK A;  4AVP A;  1ZG1 A;  1HBX G;  3D0S A;  1FYL A;  1B59 A;  3LQQ A;  4CGZ A;  4BXU A;  3K1N A;  4EV0 A;  5ILU A;  3Q5F A;  1BIA A;  3ZPL A;  1E2X A;  3ZMT A;  2FNP A;  3H92 A;  3NEU A;  2E1C A;  2K4J A;  3I59 A;  4MNU A;  2GA1 A;  5H6Q A;  5CVJ A;  3KP7 A;  4LLN A;  3RDI A;  1UFM A;  4OMY A;  1G3Y A;  2M1B A;  5ED4 A;  2IA0 A;  3MZY A;  1KU9 A;  2KIF A;  3DFG A;  3LA3 A;  3KP6 A;  1P92 A;  4ZYE A;  5HS8 A;  3CUO A;  1QGP A;  4PGH A;  4JQF A;  2BYV E;  2KIU A;  3K1M A;  5ICG A;  2IRF G;  4KA4 A;  4ENM A;  2QUF A;  2VE8 A;  2HKO A;  2RV8 A;  3E5Q A;  4CZZ A;  2GXG A;  3O6B B;  1DDN A;  3TGN A;  4IHS A;  4HV5 A;  2OBP A;  1O57 A;  4HW0 A;  1FY7 A;  2YSR A;  1CGP A;  2HOE A;  5DV5 A;  2JT1 A;  2OQG A;  1LNW A;  5FFX A;  3FXR A;  3HOS A;  1QBJ A;  1KA8 A;  2KJC A;  5HDK A;  3F23 A;  1BI1 A;  1G4D A;  2HEO A;  1VTN C;  3TDZ C;  4I7H A;  2C6Y A;  4DNC A;  3LA7 A;  3ZN1 A;  5TRD A;  1IN6 A;  2FNA A;  2K7L A;  4ZYG A;  5ICE A;  3DKW A;  5F6F A;  3HHG A;  4GO1 A;  2UWM A;  2Q0O A;  3PFI A;  2ZKZ A;  5DYM A;  2HWV A;  3TDU C;  4IHT A;  1UHW A;  4U0V A;  1QZZ A;  3OOP A;  4MHG A;  4A5M A;  5EEH A;  2JPC A;  2FSW A;  3MCZ A;  2AS5 F;  3GLX A;  3W6K B;  2L54 A;  4B09 A;  3QPT A;  3BJO A;  3BPX A;  2OQR A;  1FSE A;  5L3F A;  2DPD A;  1HW1 A;  3GZ6 A;  1LDJ A;  3V4G A;  3TO9 A;  1ZG3 A;  4LD5 A;  4UVA A;  1OYW A;  4BHC A;  4QLC U;  2ACJ A;  2PBI A;  5L3G A;  3LA2 A;  3IKT A;  1IW7 F;  2L02 A;  4L0Y B;  4OIR F;  1T6S A;  2XKP A;  2MD5 A;  5DD8 A;  4NHJ A;  4Q5S F;  1ZG5 A;  4Y15 A;  1HXD A;  3ZN0 A;  2AXL A;  2MA3 A;  1ZAO A;  3ABT A;  5DCM B;  4EJO A;  4N0B A;  1IF1 A;  2HTJ A;  4BH9 A;  1TW3 A;  1DPR A;  4CYD A;  1I1S A;  2ZFW A;  5D8K B;  5ILS A;  4HLY A;  2Z3Y A;  4EQQ A;  4YG2 F;  3FXU A;  4XSZ F;  5JVT A;  1O3Q A;  3WTU C;  2CQK A;  4UV9 A;  4RGU A;  3F6V A;  1H9T A;  4OMZ A;  1FP2 A;  2DK5 A;  4ZH4 F;  3KLN A;  2W85 A;  1WSU A;  1TNT A;  4HA8 A;  5AON A;  1ZLJ A;  2K86 A;  1IAW A;  2O03 A;  2JPB A;  1Z6T A;  4O6J A;  2PFB A;  2LF7 A;  3RYR A;  5LBQ A;  1ZRD A;  5IT9 Z;  3NQO A;  1WQ2 A;  2IT0 A;  4M73 A;  4S04 A;  1U5T B;  2WTE A;  2ZNY A;  1T38 A;  1ZN2 A;  2P7C B;  2EA4 A;  3E6B A;  2E7X A;  2QQ9 A;  2JTV A;  2ZME A;  2A69 F;  3V7S A;  2ZXJ A;  4YIF A;  2Z9O A;  2WC2 A;  2FML A;  2L3D A;  5JFR A;  2EV0 A;  1XMA A;  3IWZ A;  3GF2 A;  2DU9 A;  3PQK A;  2PLY A;  3SHF A;  5FLX K;  2DTR A;  2UXX A;  1WWX A;  4G7O F;  4IVN A;  4BAY A;  3I0T A;  5J8C A;  2QQB A;  1J0R A;  3L00 A;  2PG4 A;  2ZBK A;  5K5R A;  3GO5 A;  5FD5 A;  2V1X A;  1IN7 A;  1BBY A;  1YS6 A;  4RB1 A;  2XAJ A;  3KP3 A;  3CUQ B;  3NRV A;  4I0B A;  4O3M A;  3JAM K;  2JSC A;  4RAZ A;  1FBS A;  2K4B A;  4BHB A;  2COM A;  1B4A A;  2Y75 A;  3C18 A;  6PAX A;  1TBX A;  3J7A O;  1BM9 A;  3T1B A;  3F8C A;  5HS7 A;  4N9I A;  2D1H A;  4ASN A;  3RIR A;  4LFU A;  4KUM A;  1K78 A;  3DF8 A;  1IXC A;  3L09 A;  3J80 K;  4BYY A;  2P5K A;  4XRF A;  1FLI A;  3T8T A;  5FD6 A;  1SD5 A;  2ISY A;  2A68 F;  4G8X A;  3REO A;  1MGT A;  1D3Y A;  3ML6 A;  3QU6 A;  4IPA A;  3HRM A;  1BOA A;  3GFJ A;  5DEQ A;  2F5F A;  4R1H A;  4N9H A;  4CHU A;  4EVI A;  4G7H F;  2PEX A;  3G73 A;  2XAS A;  5LHI A;  3F3X A;  2QBY B;  1R1T A;  4EM1 A;  1SD7 A;  4TV7 A;  2IPQ X;  2BBY A;  2VBW A;  3F8N A;  2M87 A;  4EGZ A;  3KP2 A;  1XCB A;  1Z1D A;  3E5U A;  3S2W A;  4HBL A;  1IZ1 A;  5LHH A;  1A04 A;  3TQN A;  4U7B A;  1V4R A;  4RGS A;  1H9G A;  4EJW A;  2UZK A;  1ONV A;  4A0Y A;  2YU3 A;  3MQ0 A;  1OR7 A;  2MC3 A;  1ULY A;  2YPR A;  1B9M A;  4ENN A;  5FB2 A;  2PN6 A;  1R5H A;  3FM3 A;  4U0Y A;  3FWE A;  3R4K A;  3TKY A;  1HKQ A;  2ZCW A;  2FU4 A;  1B9N A;  1U2W A;  4A2U A;  1J7K A;  3SXY A;  3WE3 A;  4NB5 A;  1R5G A;  4CDG A;  2ELH A;  3DEU A;  2GAU A;  4ZZD A;  4AIJ A;  4UVB A;  1P4W A;  3WTT C;  4YFN F;  4PGG A;  3RPQ A;  3KCC A;  4A0Z A;  3WTW C;  1F4K A;  4IJA A;  2GIV A;  2DLL A;  3BJ6 A;  3ROU A;  4XLN F;  5LEJ A;  1KQ0 A;  4WXH A;  3ECO A;  4KN4 X;  4LGW A;  1KU7 A;  3KZZ A;  2RC4 A;  1T39 A;  3T8R A;  2EV6 A;  4M74 A;  5DDG A;  2V1D A;  2O6G E;  2QLZ A;  3C1D A;  3WTS C;  3E6D A;  3KFW X;  2DW4 A;  1ZH5 A;  2XAH A;  4FX0 A;  1HSJ A;  4L9T A;  2HGC A;  2JZY A;  2DO7 A;  4G6D A;  2STT A;  2Q2E A;  4HDV A;  2P6S A;  3HSE A;  5JI6 A;  3M8E A;  1YYV A;  4HYE A;  1L0O C;  2QM3 A;  1FYK A;  1R22 A;  4DQ2 A;  3FXQ A;  1G3W A;  1HKS A;  4U7D A;  1G3T A;  3CTA A;  3WTY C;  2RN7 A; 
#chains in the Genus database with same CATH topology
 1AWC A;  1T98 A;  4CCN A;  3BC8 A;  2WBM A;  3BDD A;  3V7C A;  4DGW B;  2CG4 A;  3V7R A;  1BN5 A;  2CV1 A;  3F22 A;  3MZH A;  3CO7 C;  2UXN A;  3VFZ A;  5CYV A;  2XF7 A;  2RQP A;  4ZYH A;  4FTH A;  3U21 A;  2R5Y A;  4EJT A;  2EFW A;  1GV5 A;  2HNH A;  3CQZ J;  2A61 A;  1JE8 A;  1R7J A;  4HPQ A;  4BY7 J;  4PJ0 C;  2QVO A;  3F0C A;  2BY0 A;  2OF7 A;  1Z3X A;  5EF6 A;  5EDN A;  2FD5 A;  3DTE A;  2R4G A;  2W25 A;  3BR5 A;  3OL3 A;  2BHY A;  3ZOB A;  3ZQ7 A;  1SAX A;  2P0W A;  2HDC A;  1TNS A;  1YW8 A;  2XAG A;  1LJ9 A;  2WAE A;  1HA8 A;  1HKT A;  4XRS A;  3F6O A;  3CF5 F;  2NNN A;  4BXF A;  3DBL B;  3K9T A;  2AO9 A;  2X0L A;  3BG7 A;  2G9W A;  2P81 A;  1MSF C;  3GVA A;  1VFC A;  3I3L A;  2H8W A;  2JRT A;  2L7F P;  2R7X A;  4BHP A;  3IKV A;  3N4M A;  2O61 A;  2DFE A;  3S15 J;  2DPU A;  3QP6 A;  4IXA A;  3HRT A;  3HUG B;  1IXS B;  3VWB A;  2Y30 A;  4OIQ F;  3MVP A;  3FF5 A;  2BGC A;  1OMI A;  4RAG A;  3RKX A;  3J81 Z;  1JHF A;  3LAJ A;  1Z67 A;  2KT0 A;  2JSP A;  2VT3 A;  4ZTJ A;  2WV0 A;  1HDP A;  3Q9S A;  4F93 B;  1U8R A;  2M8G X;  1MKM A;  1JT6 A;  1QZY A;  2IBD A;  4L5E A;  3GME A;  2LY1 A;  4XR6 A;  4X6A J;  1I3Q J;  4B8X A;  3GYH X;  3KYD B;  5BPD A;  3E6M A;  3KPH A;  3ASO H;  3K6G A;  5F1R A;  3IAS 2;  2NVY J;  3M1E A;  1V3F A;  2V6E A;  2E1M C;  3WGG A;  2RKH A;  2MC4 A;  4MEX F;  3K4C A;  2E7W A;  4OIN F;  1TC3 C;  3TED A;  2JA5 J;  4WK8 F;  3DTI A;  3F21 A;  2A3S A;  2WAQ A;  2ZFU A;  3JRB A;  2P7V B;  1IN8 A;  3I5U A;  3F72 A;  4BJ5 C;  1LVK A;  1DGR M;  1U0J A;  1I39 A;  3QOE A;  5E8G A;  3K7A J;  2VON A;  4II2 A;  3KX2 A;  5E8I A;  3CDI A;  4FE4 A;  5EJC A;  4IHV A;  4HNT A;  3C3W A;  4HF0 A;  2F5D A;  2W84 A;  4H4K C;  4I02 A;  3VB2 A;  5E1X A;  5IYD J;  2R7U A;  2NRA C;  5B66 C;  3GFM A;  2P4W A;  2FA5 A;  3ISP A;  3JTG A;  3CCL I;  1FX7 A;  2E19 A;  3HOY J;  1XD7 A;  4FET A;  4CO8 A;  5E3M A;  5IT9 K;  3COA C;  3VYT B;  2XRN A;  5CQG A;  1MDM B;  4B43 A;  1MNE A;  1D5V A;  2J5P A;  3L7W A;  1A6Q A;  2EZL A;  2WA0 A;  2V9V A;  3H5N A;  5LRS A;  5EGO B;  1Z77 A;  2K9N A;  2FOW A;  4PJM A;  2EZK A;  4M6V A;  2K27 A;  2V26 A;  3BR6 A;  2F2E A;  1R1V A;  2TRT A;  3ECH A;  3HM5 A;  3S3O A;  1RUN A;  1WJF A;  2XGX A;  4L9N A;  3B6C A;  3FM5 A;  3CC7 I;  2V1N A;  3KE2 A;  4HQM A;  1YOV B;  1DGW Y;  1ZGA A;  2HQN A;  1DUX C;  3WU1 B;  5AIP A;  1CF7 B;  1FTT A;  4I09 A;  4RB0 A;  1OR7 C;  5DS9 A;  3CCQ I;  1W5C C;  1I50 J;  1BR2 A;  1U6G A;  4DW6 A;  2PMU A;  1ZGW A;  1SFE A;  2JUC A;  4LG0 A;  3TOB A;  1REP C;  3TOA A;  2HI3 A;  1ZRE A;  1QU3 A;  3HSF A;  3V8K A;  1GVJ A;  2Z99 A;  4HZF A;  2EFP A;  2L01 A;  5ICF A;  1J5Y A;  2DJI A;  3HOT A;  4EEF G;  5DM7 F;  4M6X A;  4QIW N;  3UKG A;  1SD4 A;  3H9Q A;  2PJP A;  2GOX B;  1OYI A;  3VEP A;  1N77 A;  4AIH A;  2OPT A;  3BPV A;  5CVU A;  1W5S A;  2B9S A;  1I5Z A;  4LMY A;  2LY2 A;  2LYC A;  2M7B A;  2Z2S B;  3GCM A;  1X4O A;  3S32 A;  4BEH B;  1LPQ A;  2LFB A;  2M7A A;  5B5E C;  2CH0 A;  3RQI A;  1R49 A;  3IH4 A;  3WGI A;  1APL C;  3FMQ A;  5D5X B;  5FKK A;  2A5W A;  2QKM B;  1K6Y A;  1XTA A;  3BTJ A;  3CLQ A;  3VPR A;  3OYC A;  1HOM A;  1FBQ A;  2XF6 A;  4E7H A;  3S3N A;  2QA4 I;  1XS9 A;  4BBS J;  5EZG A;  2LRE A;  1W7P B;  2FQ3 A;  1YW7 A;  3D5S C;  1MBH A;  4E4H A;  4IHW A;  2IGN A;  5E17 F;  1R4N B;  3RPU D;  5HNH A;  1Z9C A;  2XC7 A;  1Y39 A;  1T08 B;  2YR2 A;  2GIZ A;  3IWF A;  2K3P A;  1KU3 A;  1ZKG A;  4XKB A;  3FXJ A;  3TO7 A;  5D8L B;  2ID6 A;  4AIK A;  1TT5 B;  3BQZ A;  1YIT I;  5J4V A;  4WCG A;  3A02 A;  3E3V A;  3VDX A;  1W36 D;  3FIW A;  4BKX A;  2IJL A;  1K4S A;  3QPH A;  2R7W A;  1JKR C;  3GTK J;  1HC8 A;  2XAQ A;  2HQR A;  4A3D J;  4XKC A;  2NS8 A;  4HSR A;  3CME I;  3G1O A;  3DLL F;  1XPX A;  2R7S A;  1OFC X;  2A5Y B;  2CU7 A;  1OYY A;  3T0Y A;  3VSK A;  5J8F A;  2HYJ A;  2X85 A;  3QRF F;  4KNY A;  5EG0 A;  4RS8 A;  1EH7 A;  2ZXW H;  2WV1 A;  4IRH A;  2QBY A;  3R61 A;  2YU9 J;  4IKF A;  2A6E F;  4A6D A;  2CQX A;  2MW8 A;  1Q1H A;  5J40 A;  2G7U A;  2DFF A;  1AOY A;  1X1P A;  2KIM A;  3ABL H;  3BZC A;  3HTU A;  2MH9 A;  4XOR A;  3BR2 A;  2F4M B;  2W24 A;  4MO7 A;  3JRA A;  3GUD A;  3CMY A;  3JSO A;  2GM4 A;  5F0F A;  3FX3 A;  2M45 A;  2IAI A;  2EH3 A;  2FBK A;  4ITV A;  3K70 D;  2R7T A;  3I59 B;  3EET A;  4GYI A;  4NDL A;  1XDS A;  3F8M A;  4V2G A;  2DT7 B;  1G8X A;  4A0X A;  1TWA J;  3U9G A;  4K2E A;  1U78 A;  4G6Q A;  4A69 C;  1XB4 A;  4NC7 A;  1U8B A;  1X4P A;  3LFU A;  1X2N A;  1AA7 A;  2FOK A;  4J00 A;  1HW5 A;  4KN7 X;  5K5Q A;  1ACI A;  1TQI A;  4DBR A;  3OR1 C;  3QOP A;  4XN0 A;  1WRJ A;  1W4M A;  1S6L A;  5K7H A;  2R7R A;  2L2O A;  3FBI B;  1XGS A;  3WG9 A;  3GX4 X;  5CVR A;  1W0T A;  1X1A A;  4XLH A;  5HDG A;  3QYF A;  2IGK A;  1JGS A;  3RZD J;  4HRI A;  2XIG A;  2IA2 A;  2H6C A;  3JRC A;  2H27 A;  2HR3 A;  4HDU A;  2FUG 2;  1SFU A;  2L4M A;  5CVI A;  3FK6 A;  4XLE A;  4MQV A;  2F4O B;  1MIJ A;  2X6X A;  2DFH A;  3H3Z A;  4HX4 A;  3A03 A;  2CGP A;  3HSR A;  4NC8 A;  1W7P D;  5FFZ A;  4HV6 A;  5J1U A;  3ABK H;  2DQL A;  5KVR A;  3M9A A;  4ZTF A;  3AAF A;  4A3J J;  4EAT A;  2PJR A;  2B63 J;  3HPG A;  4EGY A;  1JKP C;  3NAU A;  5C4J J;  3BP8 A;  2R7D A;  4R8H A;  5ICC A;  3P7N A;  5D5W B;  4UUS A;  2IA1 A;  1MZB A;  4RLF A;  1IRF A;  2L7M P;  4XRS G;  3VSL A;  1TT0 A;  2DA1 A;  2DMN A;  4L5J A;  5IOZ A;  3AG4 H;  4YRV A;  3MFK A;  1C0W A;  4HX7 A;  2AQE A;  3TO6 A;  2WB1 N;  4EJV A;  3DKY A;  4BL0 B;  2R0Q C;  1A36 A;  1BI0 A;  3E7L A;  2LD5 A;  3JRI A;  4G94 A;  2JRM A;  3KZY A;  4D5C A;  1K83 J;  4ETS A;  1J75 A;  3M3Y J;  5DCF A;  2MG4 A;  1A35 A;  1B6A A;  1GHC A;  1VQ5 I;  2QSF X;  3VYR B;  2NVU B;  2R7Q A;  3I64 A;  5EZH A;  2VC0 A;  4XBF A;  1R6R A;  2KPM A;  1WGX A;  3H5A A;  2CW7 A;  1ON1 A;  3CDH A;  4W1U A;  2E2H J;  1O3R A;  4LK0 F;  1NG6 A;  2H94 A;  2K9L A;  5IYB J;  4A3M J;  3EUA A;  3EYI A;  2O5R A;  5IT3 A;  1EA3 A;  1P2F A;  3LSP A;  2XSJ C;  1XMX A;  2ID3 A;  2E34 A;  1XMK A;  4HNV A;  4IRG A;  1BC7 C;  1KYW A;  2Y2Z A;  1D0Y A;  3LSR A;  1O3T A;  1E17 A;  3S16 J;  4I6Z A;  3RJP A;  4JX5 A;  3K0L A;  3H9G A;  3OYD A;  2DXI A;  2Z5U A;  1YFH A;  2B7E A;  2LVS A;  2X6W A;  4PJN A;  3W2V A;  1T8I A;  1Y0U A;  1STZ A;  1O7L A;  3Q9V A;  1ETX A;  2F5E A;  1YQA A;  1XN7 A;  2ZNZ A;  1VQ6 I;  1VZ0 A;  2KZG A;  1YRN A;  3BT9 A;  4WF2 A;  2CW0 F;  5JLX A;  3SDB A;  9ANT A;  2KZV A;  2K40 A;  3WTZ A;  2EJR A;  1TWG J;  3BG6 A;  1P7J A;  1S29 A;  1V5F A;  3ELK A;  1OCC H;  2Z1D A;  4B48 A;  2P5L C;  3KP5 A;  4I0A A;  4PSW A;  3DBR B;  5JHF A;  5ERI A;  1WJB A;  2KJB A;  2MBF A;  3ONQ A;  1ORK A;  3BOQ A;  5HDN A;  5LEK A;  3PQJ A;  4X0G A;  3JRE A;  2CJJ A;  2O0Y A;  2LOO A;  2M8E A;  5EEA A;  1FYM A;  2QSG X;  4Q4Z F;  2A07 F;  2D45 A;  2E36 A;  4MGR A;  4ZC3 A;  2CFX A;  1D8J A;  1SD6 A;  1LDD A;  4CCL A;  4GYG A;  1XCV A;  3W6J B;  5LHG A;  2RDP A;  1FPQ A;  4L18 B;  4CSW A;  3WGH A;  2L9N A;  2CO5 A;  2Q8K A;  3ZMS A;  4AVZ A;  1SAN A;  3FIS A;  4P1W A;  2R3S A;  5LGT A;  3ZMZ A;  1SFK A;  1IG7 A;  4NNJ A;  3GTP J;  5J1Y A;  1HDD C;  2V6C A;  1WH5 A;  5FO5 A;  5HVQ C;  1DP3 A;  2DTZ A;  2TCT A;  5D4R A;  4MTE A;  2F6C A;  2VIX A;  3OS1 A;  1BJA A;  3NWS A;  1R1U A;  3OSF A;  3PNT A;  2Z16 A;  4XLC A;  2WWY A;  1B72 A;  5FGM A;  1SFX A;  3ULQ B;  3MN2 A;  3QOD A;  4D1Q A;  1PP8 F;  4LK1 F;  3P9K A;  2NXN B;  2VBZ A;  2DDA A;  5BMZ A;  1KU2 A;  1O7F A;  5C44 J;  1RC9 A;  1ETQ A;  2DCE A;  3J81 K;  3CF2 A;  3HTS B;  2LP0 A;  2PX9 A;  1P4X A;  4F92 B;  1LKX A;  3S1R J;  3OS0 A;  3A0H C;  4YFX F;  2FXA A;  3ZQL A;  5HLG A;  3WE2 A;  2M0C A;  2VN2 A;  1TQP A;  2KP6 A;  1GUU A;  4ABZ A;  2NVQ J;  2KLO A;  5F27 A;  4LIT A;  2VXZ A;  4D5F A;  3RKW A;  4KDP A;  1QQI A;  1RET A;  4CXF A;  3CCM I;  2DMU A;  1KQ9 A;  2HYF A;  3I54 A;  4AYB A;  4FHT A;  4GGG A;  1Z6R A;  4P9F A;  1Y0N A;  4AWX B;  1SMY F;  2IW5 A;  3BTC A;  5HLH A;  1O3S A;  2M30 A;  3HYI A;  3VOD A;  1QVU A;  3DQV C;  4D0P A;  1BL0 A;  1S8N A;  2P6T A;  1RPW A;  1HW2 A;  2OU2 A;  3CO6 C;  2NYX A;  5L3B A;  3LSI A;  1YIO A;  3EDP A;  2RGV A;  4BU2 A;  2BEO A;  2O7O A;  3KEQ A;  2OTL I;  1WVR A;  2YX7 A;  3ZCO A;  4MIM A;  2NOG A;  4LOC A;  5GP9 A;  2E35 A;  2WAQ N;  2STW A;  2ZME B;  1IN5 A;  1YS7 A;  2H6B A;  3GXO A;  2KQR A;  3J7Z I;  4XN3 A;  4EJU A;  1ETO A;  1J2X A;  1FBU A;  5C3E J;  3FMR A;  1RIO H;  3LWF A;  2VXD A;  1VQ9 I;  2VJI A;  4IQJ A;  4NUB A;  5D5V B;  4UVC A;  1HLV A;  3A0B C;  2L7Z A;  1PDN C;  2BW3 B;  3K4L A;  5CKT A;  2XRL A;  4F91 B;  1P4A A;  4PFP A;  3QYB A;  1PUF A;  4CCJ A;  1H88 C;  1Z7U A;  1BR1 A;  3KYC B;  2ELK A;  3LQR A;  1LFU P;  1WZ2 A;  2Y9Y A;  2LC2 A;  4P55 A;  1VQM I;  1CF7 A;  3P9C A;  3PL8 A;  4JYK A;  1UB9 A;  3DPU A;  2DA2 A;  4UNO A;  4P96 A;  3ZQG A;  3H0D A;  4F55 A;  3WHC A;  3L2W A;  3BLY A;  3JTH A;  3DV8 A;  2KMU A;  1WI9 A;  3C2G A;  4Y17 A;  4RBO A;  1R36 A;  3R0A A;  1M1E B;  2VQG A;  3TBI A;  3ZXS A;  3GTL J;  5DUK A;  5C4X J;  2BVM A;  1TWC J;  4QPO A;  1RRJ A;  4LIV A;  1TL8 A;  4B1R A;  1X1B A;  1VQ7 I;  5AIQ A;  3S1M J;  1ZGJ A;  1H0M A;  3E97 A;  3FZV A;  1ZTR A;  2EIL H;  1SEU A;  5LGU A;  1A5J A;  3CJT B;  3MWM A;  1IN4 A;  4I76 A;  2DQR A;  3PO3 J;  1FP1 D;  4M6Y A;  2HFH A;  5IYC J;  5TJJ A;  4ZZL A;  3Q0U A;  2O8K A;  3M8F A;  1OCR H;  3BR3 A;  2LF8 A;  3I56 I;  3OR2 C;  2WAF A;  3LFK A;  2ECC A;  3CJN A;  1U9O A;  5H6R A;  1QNT A;  1LQ1 A;  1SVO A;  1JT0 A;  2L5Q A;  2LKS A;  2XHK A;  4M3B A;  1F5T A;  1N25 A;  4Y52 J;  2XGC A;  2PQ8 A;  4LB5 A;  1XGN A;  5E20 A;  2DOD A;  4HOB A;  5A2Q Z;  1O4X A;  1QPI A;  1FJL A;  3BZK A;  5FLM J;  1K78 B;  2BV6 A;  4B47 A;  2E1M B;  2OUM A;  1MMN A;  3PIP F;  3BY6 A;  4BQQ A;  5E18 F;  1FOY A;  4NQW B;  3JSP A;  1UST A;  1AKH A;  2QEN A;  4PDK A;  1XGO A;  3O8G A;  2XPV A;  3IUO A;  3H5R A;  2BY2 A;  2GZW A;  4FT8 A;  4BJT A;  3OYF A;  5HS9 A;  1Z91 A;  3E5X A;  1F43 A;  5EEG A;  3K1P A;  4RAF A;  1MD0 A;  1D0X A;  4HLX A;  4IL6 C;  4L0Z B;  2XDV A;  1WCM J;  1QO0 D;  2K85 A;  4Z2Y A;  2E2I J;  1TWF J;  5DCM A;  2BE5 F;  4M3E A;  4RGX A;  3JRH A;  3FHZ A;  2CV2 A;  3IC7 A;  1ZYR F;  2VBY A;  4IZZ A;  2ADU A;  3BTL A;  2DK8 A;  4OIP F;  2GA2 A;  2W57 A;  2AXT C;  4KIC A;  2XAU A;  1D1B A;  1GXQ A;  2LRD A;  3K2A A;  1JJ6 C;  3CCS I;  1UAA A;  1RR8 C;  5HLT A;  3FK7 A;  1UHS A;  4XRM A;  2OCE A;  4RB3 C;  4AU7 A;  4IX7 A;  2I10 A;  1JHH A;  4DYQ A;  4A6E A;  3R0J A;  3RTR A;  3U1K A;  4XOP A;  2YX4 A;  4U88 A;  2HOA A;  2DA5 A;  3H3V K;  2LBF A;  4JP0 A;  4RDU A;  4PZJ A;  1LEA A;  3KIO A;  1LFB A;  1NK2 P;  2RAE A;  4M71 A;  4PJL A;  1D8K A;  3C2B A;  1WKM A;  4ESF A;  4XID A;  1NTC A;  4LIU A;  4WXC A;  4BE2 A;  1GT0 C;  5KAF C;  4KFC A;  2JA6 J;  4PFO A;  5CJ9 A;  3ZQC A;  2IP2 A;  2CRG A;  2DMQ A;  2H09 A;  4CIC A;  2IS4 A;  2NAZ A;  3OYI A;  4BE1 A;  1ZAR A;  2QCO A;  2DA6 A;  1WHU A;  3OV8 A;  2VE9 A;  4BQA A;  3CJQ B;  1JTY A;  2B0L A;  3SEZ A;  2FRH A;  1LFP A;  4RB2 C;  3L9F A;  3MAJ A;  1U5T A;  2A6T A;  1S72 I;  2V1U A;  2JA7 J;  3LST A;  4J01 A;  2X4H A;  5JHU A;  4YFK F;  4A93 J;  2IVM A;  2DYS H;  2HZD A;  4JK1 X;  4GXO A;  4LJZ F;  1OCP A;  3AG3 H;  4B44 A;  3WU0 A;  3SZG A;  3EUH A;  1S7O A;  2QEX I;  4EM2 A;  5F04 A;  1UJ8 A;  3M8J A;  2XB5 A;  5BQT A;  2HKX A;  2FMY A;  3FMS A;  2X1E A;  3OS2 A;  4ENK A;  2Z33 A;  2KIS A;  1AU7 A;  4XIC A;  3G1M A;  2E60 A;  4XMY A;  3WTX C;  4M9X A;  5B3S H;  3H3U A;  3GW2 A;  5HLI A;  4UV8 A;  1EKE A;  1X58 A;  1RZ4 A;  2OJE D;  2EK5 A;  1T56 A;  3HRS A;  1QHG A;  3PIO F;  1TLH B;  1EH6 A;  1FC3 A;  4KIF A;  1T0F A;  1FNN A;  3M7G A;  1JJ8 C;  3BTI A;  4O5V A;  5E79 C;  2QZ8 A;  2FEZ A;  1ENH A;  3CUQ A;  4M72 A;  1K7A A;  2QYO A;  1WPK A;  4DJA A;  4JX4 A;  4MQ9 F;  2ZJR F;  3AFH A;  5M3M J;  2CYY A;  2KRF A;  4KIG A;  2ISZ A;  2W00 A;  4IHX A;  2HTS A;  3FXL A;  1RNL A;  3U2R A;  2X48 A;  1WFX A;  4EM0 B;  2VT2 A;  3L1P A;  4KT5 C;  3DPL C;  3EYY A;  1U3E M;  2F4I A;  2HYG D;  1MJB A;  2GQQ A;  4RM3 A;  4QWQ A;  4CH7 A;  2OZ6 A;  4V19 K;  2XPU A;  2ZO4 A;  3HRU A;  3HL2 A;  1YW9 A;  2Q2E B;  4A3K J;  1QHH D;  1B8I B;  3QAH A;  4YII A;  5FKN A;  1N78 A;  2VQC A;  4CCM A;  4QPQ A;  3OYH A;  1PJR A;  1IDY A;  5H20 A;  4UXN A;  1FOK A;  3QU3 A;  2XGD A;  3AL0 B;  2E1N A;  2G7H A;  3GEZ A;  2LKX A;  4M9S A;  3MKZ A;  1GXP A;  4KMF A;  2HU9 A;  3JRF A;  5JR3 A;  2R7Z J;  3IAM 2;  4OAZ A;  4CYC A;  2CQN A;  2HQA A;  2Y0M A;  1WJE A;  3V8L A;  3S8P A;  1LE8 B;  4MEY F;  5BPI A;  3U1D A;  3LAP A;  2JWT A;  4AD9 A;  3PJR A;  2FE3 A;  1YIJ I;  1Z3Y A;  1VI0 A;  4IEJ A;  4WX9 A;  5FJ8 J;  2DBB A;  2VKH A;  1OCO H;  5FKM A;  1JGG A;  2L4A A;  3ZMD A;  3ZQI A;  3CCU I;  3E6C C;  4F3Q A;  1UG0 A;  3PM1 A;  3OYJ A;  4HNU A;  2EZH A;  3RZO J;  3KLO A;  2DYR H;  1FSH A;  3ZMV A;  2MFZ A;  4OAY A;  3IV5 A;  3J7A Y;  1ODD A;  3M1C A;  2MSY A;  3PUF A;  4G9Y A;  3DXJ F;  1NG7 A;  5F64 A;  3TP0 A;  4A5N A;  4E7Z A;  1EH8 A;  4C3I J;  1PP7 U;  2VOD A;  2F48 A;  3P9I A;  2XGE A;  1XGM A;  2X6O A;  4JBA A;  1A6I A;  1DPU A;  3I71 A;  1BJZ A;  2X9D A;  1FOW A;  4Z6Y A;  1IUY A;  1G3S A;  3OIO A;  3IP4 B;  5KAI C;  2MGQ A;  3DEW A;  2ZJQ F;  5BOX A;  3HGY A;  2PMH A;  3H1C A;  2GBY A;  4KMU X;  2OC6 A;  2HOS A;  3IRR A;  2NNY A;  1ETK A;  4J19 A;  1R23 A;  1MMG A;  4IOC F;  1OLT A;  5D5U B;  1EV7 A;  1S7E A;  5LGN A;  4HQE A;  2OA4 A;  5F0H A;  2NVT J;  2W48 A;  3I9V 2;  1Z0X A;  3BG3 A;  1WH7 A;  5E3L A;  5DUI A;  2MYS A;  2KDO A;  4OU0 A;  1Z05 A;  2EBI A;  1EJ9 A;  4P5O A;  2HZT A;  3LSM A;  3M07 A;  3MKY B;  3LSJ A;  1WJA A;  2LH9 A;  3DPT A;  3HKZ A;  4QTR A;  4FE7 A;  3KEO A;  4KYW A;  3H9J A;  1ZRF A;  4XLP F;  2QF7 A;  2L9S A;  2OV7 A;  3QP5 A;  4IQ4 A;  2GLO A;  1MMS A;  2EB7 A;  3I4N J;  2VQH A;  1L3L A;  4LLL A;  3WTY C;  3MEX A;  2DMT A;  2FF4 A;  3RKY A;  4CCK A;  3WTV C;  3OYA A;  1UZC A;  3JRG A;  1LB2 A;  1UMQ A;  3IHU A;  4ZJZ A;  1F9N A;  2EWN A;  2CWE A;  3HOV J;  3RYP A;  4HX8 A;  5HOO A;  1UG2 A;  1ERD A;  4L5I A;  2D2W A;  3R6S A;  2E71 A;  4Q47 A;  2ICW G;  4HST A;  3Q0V A;  2DFI A;  5J4Y A;  3S2H J;  3H35 A;  5CVV A;  3LSG A;  4I98 B;  3W3C A;  3CP2 A;  2XKO A;  2UUZ A;  2ZJ2 A;  5KCM A;  4U0W A;  5J6X A;  1MJA A;  1SVL A;  1Z21 A;  2YUS A;  3S93 A;  1FOX A;  3CLO A;  4DYC A;  5K7F A;  2ZC2 A;  1XX5 A;  2M5W A;  3NAR A;  2DT5 A;  2XVC A;  5GTH C;  3IH3 A;  2ETH A;  3CDL A;  2DI3 A;  3GTG J;  2Y31 A;  3G4S I;  2VL8 A;  5DD4 A;  4XLF A;  5M5Y J;  1TP4 A;  1E3O C;  3SJM A;  2MLG A;  2HPI A;  2A6H F;  2ZSH B;  4MLO A;  4AYB N;  4WXD A;  1RUO A;  3N05 A;  2ELJ A;  2WY7 Q;  3F8F A;  3PNY A;  1YTY A;  1NHA A;  4S0H B;  4G7Z F;  1ZK8 A;  2BXY A;  3S14 J;  2FX0 A;  5F08 A;  4E7K A;  3KP4 A;  2O8X A;  4WWC A;  4F7Z A;  2V9P A;  1UEL B;  1OPC A;  1X1C A;  5IPA A;  5E1Z B;  1MH3 A;  1MBE A;  4L9V A;  5BS6 A;  2JQ7 A;  3BR0 A;  4RAY A;  3ZP5 A;  3WG7 H;  4LG0 B;  2XAF A;  1BW6 A;  4C3H J;  1QRY A;  5IY5 H;  4BNC A;  1TW2 A;  3S3M A;  1FT9 A;  2QQ8 A;  4I01 A;  3QWL A;  1XSV A;  2IGO A;  3F8B A;  4MTD A;  1KYZ A;  5FLV A;  4II3 A;  2F5V A;  1VQO I;  3HXL A;  2ESN A;  3X2Q H;  2EV5 A;  3Q0W A;  1BIB A;  2O3F A;  1U5T C;  1VND A;  1PUE E;  4Q48 A;  4NBQ A;  1Y8Q B;  1X3U A;  4PK4 A;  2ZSI B;  4C2M J;  3O3K A;  4DYR A;  5L3D A;  1LVA A;  2HXO A;  1F1Z A;  2Q1Z B;  3EUH C;  3BZ6 A;  4HAM A;  3P5J A;  2VC1 A;  1YJ9 I;  5E1W A;  2K9Q A;  3DTK A;  2H1L A;  3L2U A;  2XF5 A;  4P9U A;  1ZLK A;  3L2V A;  3K69 A;  3N97 A;  1YJW I;  4HF1 A;  1HF0 A;  1T2K A;  1ETY A;  2LSO A;  1MJ9 A;  3GWZ A;  4FIS A;  1SVM A;  4IF4 A;  4ENJ A;  3FXO A;  4KIS A;  1UHM A;  1UCR A;  5LRR A;  5LD2 C;  1T0F C;  1ON2 A;  4I2O A;  4GFB A;  2W1O A;  3ZRG A;  3OSG A;  2E1O A;  4ZYD A;  2VPL A;  2ME6 A;  5CLS A;  3CUQ C;  4NQW A;  2R7F A;  1PVE A;  4EMS A;  4A3G J;  5L3E A;  3VOE A;  3FDY A;  4AC0 A;  3JR9 A;  3QPL A;  5A2Q K;  3B6A A;  4RLQ A;  4A3I J;  2EFO A;  2FBH A;  2CSO A;  2J5O A;  3IRQ A;  4R79 A;  2HDW A;  2PMZ N;  5IP7 J;  1HST A;  2IS6 A;  1K61 A;  4C2T A;  1H89 C;  2Y69 H;  3LSH A;  2VUM J;  2LNB A;  1KZH A;  4YEL A;  1R58 A;  3I4P A;  5D4S A;  2P8T A;  5EG0 B;  4Y7N J;  3GFL A;  3HUG A;  3D5L A;  1VQN I;  3CES A;  1NH3 A;  2BVL A;  2RRE A;  5HNF A;  2IXS A;  2RVC A;  1QPM A;  1ZHF A;  4HF2 A;  2XRO A;  2VBX A;  1GDT A;  2DN0 A;  1FZP B;  5K5O A;  1P6R A;  2HVQ A;  2CUE A;  3W2A A;  4FX4 A;  3HDD A;  4CA0 A;  2D5V A;  4PSX A;  4OIO F;  5FRM A;  1USS A;  4B4C A;  3ERE D;  2NS7 A;  3JW4 A;  1TQM A;  3QPS A;  4A12 A;  1R71 A;  5KK1 A;  3T5X A;  1FMV A;  3RPU A;  4JX6 A;  5LLQ A;  3I58 A;  1E3H A;  2M3A A;  1LEB A;  2VJJ A;  3OOU A;  3WU2 C;  2DA7 A;  4UHT A;  1R00 A;  1HQC A;  1B1B A;  4M3F A;  3CMA I;  4PCQ A;  1TTY A;  3DLA A;  5B1B H;  3BWG A;  3SFZ A;  1J9I A;  2H8R A;  1KQ8 A;  2CQ7 A;  1OKR A;  3R60 A;  5D6E A;  1IV8 A;  1CQT A;  5D6F A;  2R7V A;  3V8J A;  2DAO A;  4IRI A;  3UNG C;  1X3Z B;  3CP8 A;  3HIF A;  2Y48 A;  4PJJ A;  1IXR C;  3ABU A;  4ESB A;  2QQA A;  3OL4 A;  2RNJ A;  3L2C A;  5ILV A;  4UUV A;  3ESW B;  4AID A;  1POG A;  3SZT A;  1KGS A;  2ESH A;  2VOO A;  4ESJ A;  4LLG F;  3HGG A;  1YG2 A;  2JMW A;  3FKJ A;  5K1Y A;  2E5N A;  3FXM A;  4L9J A;  3SYT A;  1K79 A;  1ITY A;  1MDM A;  1GLN A;  1YLF A;  5FLX Z;  1YO5 C;  1IGN A;  1U9N A;  2ZXI A;  5CQE A;  2XV4 S;  2OZU A;  1YI2 I;  1K6O A;  4N4N B;  5EGO A;  2OD5 A;  1G6N A;  1W5T A;  3DP7 A;  3HHH A;  4XON A;  2EIN H;  1W0U A;  2X1D A;  2PJR B;  3BG9 A;  4H0E A;  3ZMU A;  3OYM A;  1XSD A;  2FBI A;  3G3Z A;  4C2U A;  1BI3 A;  1YX5 A;  2K5C A;  2JVH A;  4BQN A;  1WJC A;  4UUS B;  2TDX A;  1IC8 A;  4E7I A;  3BCB A;  4ON0 A;  4DBQ A;  1QZE A;  2PI0 A;  1W1W E;  3K4K A;  2NOJ B;  4GCV A;  1R5I D;  3PNV A;  3JAM Z;  3IL2 A;  2HDD A;  3S1Q J;  4D7M A;  3KYL A;  2LKP A;  2VKV A;  4M9Z A;  2X6Y A;  1YX3 A;  1ZQ3 P;  4N4O B;  1XC5 A;  1XSX A;  2A05 A;  2VAS A;  4NC6 A;  2MH2 A;  4C9Y A;  5L3C A;  2EFQ A;  1ETW A;  4D7N A;  3RI4 A;  3I53 A;  4XKW A;  2NS0 A;  5H2F C;  1F36 A;  3C7J A;  1BC8 C;  2VQL A;  2QGU A;  4BEH A;  3K4M A;  2QWW A;  2VOP A;  2D1V A;  1I6X A;  2HS5 A;  2EFN A;  3ZR8 X;  3HOW J;  2M0M A;  4E70 A;  5FRN A;  3GTO J;  1I3A A;  1S3J A;  1XDU A;  1PYV A;  2OAZ A;  1SMT A;  4KIB A;  2KIQ A;  2WY8 Q;  3HEF A;  5DTD A;  4Y13 A;  1WI3 A;  1WJ5 A;  2ZXH A;  3GFI A;  3FKI J;  4DOZ A;  3FBN B;  3J80 Z;  1S7A A;  1IRG A;  4XL9 A;  1Q1V A;  1W7P A;  4RA2 A;  3LNQ A;  3B73 A;  3SZP A;  4DZJ A;  1RI7 A;  1T95 A;  2PMZ A;  4BDY A;  2CQQ A;  1I27 A;  2KKO A;  4KT6 A;  3G2B A;  1K4T A;  2VLA A;  3B02 A;  4RGR A;  3H0G J;  1LDK B;  1I1G A;  2GWR A;  1DP7 P;  3MMY B;  4LB6 B;  1XG1 A;  2V79 A;  4A3L J;  3DU5 A;  1FWZ A;  1J59 A;  3O2P E;  4V2F A;  2P5V A;  2EA2 A;  3WOD F;  5GAH J;  1YE9 A;  1YRN B;  1S5L C;  3SQN A;  2LDU A;  3BJA A;  3BRO A;  1ZRC A;  3GZ5 A;  2R5Z B;  4S05 A;  2GXB A;  3GLL A;  1R4M B;  1BI2 A;  4OOI A;  4IHY A;  3KET A;  2HVR A;  1JXS A;  3MZ8 A;  4XSX F;  3EQL F;  2XUB A;  2K02 A;  4ZYA A;  1VQ8 I;  2F5C A;  2M34 A;  3K2Z A;  5KHD A;  2BY3 A;  1Z7L A;  2MLK A;  2LLK A;  3ERM A;  2EPF A;  3HC7 A;  4AVP A;  1ZG1 A;  5GAE J;  2BXZ A;  1HBX G;  3D0S A;  1FYL A;  1VF9 A;  1OQY A;  1B59 A;  3LQQ A;  3VYU B;  4RMN A;  2RQQ A;  4D9J A;  4JOM A;  4BXU A;  4CGZ A;  2E2J J;  4M3D A;  3C2H A;  3A1Y A;  3K1N A;  4EV0 A;  2R7O A;  5ILU A;  4B3A A;  3Q5F A;  1FEX A;  3CCJ I;  1JUS A;  4XQF A;  1BIA A;  1Y1V J;  3ZPL A;  1E2X A;  3ZMT A;  2FNP A;  2L7K A;  1X3W B;  3H92 A;  3NEU A;  2E1C A;  2K4J A;  3I59 A;  4MNU A;  3G1L A;  2GA1 A;  5EYR A;  5H6Q A;  5CVJ A;  2UV1 A;  3KP7 A;  3OY9 A;  4LLN A;  4Y4R A;  3RDI A;  1UFM A;  4OMY A;  1G3Y A;  4X1E A;  1B72 B;  2M1B A;  5ED4 A;  2IA0 A;  3MZY A;  1KU9 A;  2KIF A;  3DFG A;  4CZC A;  4UY8 I;  3V42 A;  3LA3 A;  2JK3 A;  1MBG A;  2V4J C;  3SEQ A;  1SC7 A;  3CCR I;  2WAD A;  3KP6 A;  1P92 A;  1SAU A;  4ZYE A;  5HS8 A;  3NWT A;  3CUO A;  1QGP A;  2FQ4 A;  4PGH A;  1RKT A;  5J1R A;  4JQF A;  2YS9 A;  4XKV A;  1A31 A;  2BYV E;  2KIU A;  2VKD A;  2M9H A;  5F1J A;  3MKW B;  3K1M A;  2XB0 X;  5ICG A;  2IRF G;  4KA4 A;  4ENM A;  2QUF A;  2VE8 A;  2JA2 A;  2M2E A;  5J3L A;  2GOM A;  4OWR B;  2HKO A;  2RV8 A;  2HQ5 A;  3GTQ J;  3QYE A;  3E5Q A;  4Y33 A;  1WJD A;  2L9V A;  4ZDP A;  4CZZ A;  2GXG A;  2W7N A;  3O6B B;  2KFD A;  1DDN A;  3TGN A;  4IHS A;  4HV5 A;  4Y3O A;  3HKZ N;  2OBP A;  1O57 A;  2MAB A;  4HW0 A;  4FQG A;  1FY7 A;  2YSR A;  1QA6 A;  4AUX A;  1CGP A;  2I8D A;  2HOE A;  5DV5 A;  2JT1 A;  2OQG A;  1LNW A;  5FFX A;  4GDF A;  3OYN A;  3FXR A;  1MBJ A;  3HOS A;  1QBJ A;  1KA8 A;  2KJC A;  4E7S A;  1D0Z A;  2IEK A;  1SFO J;  4BXX J;  4E7J A;  5HDK A;  2V9K A;  2GXA A;  2VJ4 A;  3F23 A;  1BI1 A;  1G4D A;  1GV2 A;  1MND A;  2HEO A;  5TGT A;  1VTN C;  1PUF B;  1S9H A;  1MBK A;  3W6V A;  1MW7 A;  4ZDL A;  3TDZ C;  4I7H A;  3ZGK A;  4DNC A;  2C6Y A;  3LA7 A;  3ZN1 A;  2R93 J;  5TRD A;  1IN6 A;  2FNA A;  2K7L A;  4ZYG A;  3OYL A;  3A01 B;  5ICE A;  2E5Z A;  2K9S A;  1HCR A;  3DKW A;  5F6F A;  3HHG A;  1W36 C;  4GO1 A;  2UWM A;  3G6E I;  1T33 A;  1X2M A;  2Q0O A;  3PFI A;  2JUG A;  1IJW C;  1FMW A;  2VPR A;  2HPM A;  5E3O A;  1Y1W J;  3PO2 J;  4XLA A;  1OCT C;  2VKE A;  2ZKZ A;  5DYM A;  2HWV A;  4UB6 C;  3TDU C;  3CC4 I;  4IHT A;  3M4O J;  1UHW A;  3OYK A;  4BGD A;  4U0V A;  1MMA A;  1QZZ A;  3OOP A;  4MHG A;  4A5M A;  1IRZ A;  5EEH A;  1AHD P;  2JPC A;  2FSW A;  3HZJ A;  2DA3 A;  3MCZ A;  5IP9 J;  2AS5 F;  3OYB A;  1RES A;  3GLX A;  3W6K B;  2L54 A;  4B09 A;  2IGM A;  3QPT A;  3SDG A;  1MSE C;  3BJO A;  5FKO A;  3TMO A;  1JKQ C;  3KEY A;  3AG1 H;  3BPX A;  2JJ7 A;  3JRD A;  3OIQ A;  2OQR A;  1FSE A;  5L3F A;  2DPD A;  4F52 A;  1HW1 A;  4LG3 A;  3GZ6 A;  5K7Z A;  2BY1 A;  1LDJ A;  1EF4 A;  3V4G A;  3TO9 A;  1ZG3 A;  2O9L A;  4LD5 A;  2FJ1 A;  4UVA A;  4G6T B;  1OYW A;  5TIS C;  1ZR2 A;  2CV0 A;  1IUF A;  4BHC A;  4QLC U;  4G12 A;  3AG2 H;  3MD2 A;  4M3G A;  3K70 C;  2R5Y B;  2ACJ A;  3HBL A;  4FCY A;  2PBI A;  1GVD A;  3TL4 X;  2KHM A;  5L3G A;  3VYS B;  1YJN I;  2M4G A;  3DBH B;  3LA2 A;  3IKT A;  2HXI A;  1IW7 F;  3PFY A;  2I5U A;  2ZB9 A;  3CJR B;  1AKH B;  3BQY A;  2L02 A;  2QKL B;  4L0Y B;  4OIR F;  1T6S A;  3K4J A;  2XKP A;  3EPZ A;  2MD5 A;  5DD8 A;  2K9M A;  4NHJ A;  1ETV A;  4Q5S F;  1ZG5 A;  4Y15 A;  5DM6 F;  2ME0 A;  4UB8 C;  1HXD A;  3W2W A;  4HG2 A;  3ZN0 A;  2AXL A;  4B3X A;  2MA3 A;  1ZAO A;  3ABT A;  5DCM B;  4EJO A;  3LL7 A;  4N0B A;  1IF1 A;  2HTJ A;  3DCF A;  4BH9 A;  3ABM H;  1TW3 A;  4BDZ A;  4IOA F;  1DPR A;  1TWH J;  4CYD A;  3D1N I;  1I1S A;  2ZFW A;  5D8K B;  3AKZ A;  5ILS A;  3CCY A;  2Z3Y A;  4HLY A;  3H36 A;  2KRC A;  4EQQ A;  3DKX A;  4YG2 F;  2L9R A;  1D1C A;  3AL0 C;  5F0C A;  3FXU A;  4XSZ F;  5JVT A;  3HOU J;  1O3Q A;  3WTU C;  4BQO A;  2CQK A;  4UV9 A;  1BR4 A;  3CCE I;  4RGU A;  3F6V A;  1H9T A;  4OMZ A;  2LBF B;  4XM3 A;  1J09 A;  4HEA 2;  3ASN H;  1FP2 A;  3O8H A;  2DK5 A;  3HOX J;  4ZH4 F;  3KLN A;  2W85 A;  1WSU A;  1BA5 A;  1TNT A;  4HA8 A;  5AON A;  1ZLJ A;  5GPC A;  2K86 A;  1IAW A;  3HOZ J;  2O03 A;  2JPB A;  2JN6 A;  3TW6 A;  2EIJ H;  1JKO C;  4C30 A;  1OIS A;  1Z6T A;  5M3F J;  4CCO A;  1VQL I;  4O6J A;  2PFB A;  2LF7 A;  3RYR A;  5LBQ A;  1ZRD A;  5IT9 Z;  2W82 A;  3NQO A;  1WQ2 A;  1E3P A;  2H1K A;  2CFO A;  3RKQ A;  1NK3 P;  2IT0 A;  4M73 A;  4S04 A;  5IOY A;  3FHN A;  1TZL A;  1U5T B;  2WTE A;  2ZNY A;  1T38 A;  1ZN2 A;  1QVT A;  1OCZ H;  2P7C B;  5JLW A;  2EA4 A;  3E6B A;  2E7X A;  2QQ9 A;  2JTV A;  4IO9 F;  1IO2 A;  2W4S A;  2ZME A;  5HOD A;  2A69 F;  1V5G A;  3V7S A;  1E0E A;  2ZXJ A;  1VQK I;  2Y0S N;  3S1N J;  5JVG F;  4YIF A;  2Z9O A;  2N8G A;  1JUM A;  2VB6 A;  2WC2 A;  4KJZ A;  2FML A;  2L3D A;  5JFR A;  2EIM H;  2DOF A;  2LTP A;  3RCO A;  3D5R C;  2KDZ A;  2EV0 A;  3HB9 A;  2L0K A;  2BW3 A;  3DU6 A;  3K10 A;  3BCA A;  1XMA A;  3IWZ A;  3GF2 A;  2DU9 A;  3PQK A;  2PLY A;  3SHF A;  1FIA A;  5FLX K;  1G59 A;  2DTR A;  5M5W J;  2G0E A;  2HOT A;  2LY9 A;  2UXX A;  2BZT A;  3J7Y J;  5GPA A;  1MH4 A;  1WWX A;  4G7O F;  4IVN A;  5BNG A;  3I0T A;  4BAY A;  5J8C A;  2QQB A;  1J0R A;  3L00 A;  2PG4 A;  2ZBK A;  5K5R A;  1G2H A;  3GO5 A;  5FD5 A;  5FKL A;  2V1X A;  1IN7 A;  1BBY A;  1YS6 A;  4RB1 A;  4A3C J;  2LMD A;  2XAJ A;  5GAD J;  3KP3 A;  2Y9Z A;  3CUQ B;  3I4M J;  1H8A C;  1DQU A;  3NRV A;  4I0B A;  1P9Q C;  4O3M A;  3HPH A;  4RM2 A;  3JAM K;  1V54 H;  3IH2 A;  2JSC A;  2LK2 A;  1DU0 A;  4RAZ A;  1FBS A;  5GAG J;  2K4B A;  4BHB A;  3TW7 A;  2COM A;  4A3B J;  1B4A A;  2Y75 A;  5GTI C;  3GZN B;  3CCV I;  3E0J B;  2XSD C;  1R9T J;  1V5E A;  1MBF A;  4A3F J;  5FRO A;  3C18 A;  2KL4 A;  3A4C A;  6PAX A;  4E7L A;  2AHQ A;  2CMP A;  1TBX A;  1ZEL A;  4XK4 A;  3J7A O;  1JUP A;  1BM9 A;  3KZI C;  3T1B A;  3OYG A;  2QSH X;  3F8C A;  2EQR A;  3DEE A;  5HS7 A;  4N9I A;  2D1H A;  4ASN A;  3RIR A;  1VQP I;  4LFU A;  3DWL E;  4CYC B;  4KUM A;  1K78 A;  2COB A;  4ZDO A;  3DF8 A;  4BBR J;  1IXC A;  3L09 A;  3J80 K;  3LOC A;  4BYY A;  2P5K A;  1Y56 A;  4XRF A;  1FLI A;  3T8T A;  2DDB A;  4W97 A;  5FD6 A;  4BS9 A;  1SD5 A;  2ISY A;  2A68 F;  4G8X A;  3REO A;  1MGT A;  1D1A A;  1D3Y A;  4CUG A;  3ML6 A;  3PSI A;  2R5Z A;  1DU6 A;  3QU6 A;  4IPA A;  2XPW A;  1N75 A;  1LUJ B;  2OTJ I;  3K4N A;  3I55 I;  3HRM A;  1BOA A;  3GFJ A;  5DEQ A;  4XNF A;  4DZP A;  2F5F A;  4R1H A;  4N9H A;  4YEJ A;  4BUP A;  4CHU A;  4EVI A;  4G7H F;  2BHZ A;  4XOT A;  3SFI A;  2PEX A;  1I6H J;  3G73 A;  3F9K A;  3CMM A;  2XAS A;  5LHI A;  3OIP A;  5LFA A;  4PUS A;  3F3X A;  5KNL A;  2QBY B;  4ANJ A;  2LR8 A;  1R1T A;  3WHB A;  4EM1 A;  1IRX A;  1SD7 A;  4TV7 A;  3A2K A;  5IP6 A;  4MFD A;  2IPQ X;  2CW8 A;  1FTZ A;  2X51 A;  2BBY A;  2VBW A;  3F8N A;  2M87 A;  4EGZ A;  4MFE A;  4I99 C;  3BG5 A;  3KP2 A;  2CUJ A;  3S17 J;  1XCB A;  1Z1D A;  2JA8 J;  3E5U A;  2R92 J;  3PUB A;  3S2W A;  4HBL A;  1IZ1 A;  5LHH A;  1A04 A;  3TQN A;  4U7B A;  1D5Y A;  1V4R A;  4RGS A;  1H9G A;  3L2R A;  2DOA A;  1ZR4 A;  4EJW A;  2UZK A;  5M5X J;  1ONV A;  4A0Y A;  3ZQQ A;  2YU3 A;  1Y6I A;  3MQ0 A;  3Q3S A;  3UR3 C;  2Y0S A;  1OR7 A;  4BY1 J;  2MC3 A;  2KRH A;  3ZQH A;  3HG9 A;  1ULY A;  4A3E J;  2YPR A;  1B9M A;  4ENN A;  2M4K A;  3EUK L;  5FB2 A;  2PN6 A;  1R5H A;  3GBG A;  3FM3 A;  4U0Y A;  3OMY A;  3FWE A;  2RNG A;  3GTM J;  3R4K A;  3TKY A;  1HKQ A;  2ZCW A;  1JTX A;  2FU4 A;  3LMM A;  2IS2 A;  1B9N A;  1U2W A;  2LG4 A;  1J7K A;  3SXY A;  1KON A;  3WE3 A;  4QSH A;  4A2U A;  1BW5 A;  3OWT A;  4NB5 A;  5CPR B;  1R5G A;  4CDG A;  2ELH A;  3G71 I;  4AM3 A;  3DEU A;  2HVS A;  2GAU A;  2K3F A;  4KIT B;  3CD6 I;  3LSK A;  4ZZD A;  2WB1 A;  4FAS D;  4AIJ A;  4UVB A;  1P4W A;  4GRI A;  2CS3 A;  3RSN A;  3WTT C;  1OJL A;  4E6K G;  4YFN F;  1YHQ I;  4PGG A;  3RPQ A;  3KCC A;  4A0Z A;  4C3J J;  3WTW C;  2CUZ A;  4DIQ A;  4IJA A;  3CZ6 A;  1F4K A;  4UUT A;  3S2D J;  2BOL A;  2GIV A;  2DMP A;  4U87 A;  2DLL A;  3MKL A;  4YIR X;  3BJ6 A;  3ROU A;  2IS1 A;  4XLN F;  5LEJ A;  1KQ0 A;  2VJ5 A;  4WXH A;  3ECO A;  3GTJ J;  4KN4 X;  4LGW A;  1KU7 A;  3KZZ A;  1X1D A;  2RC4 A;  1T39 A;  3T8R A;  2EV6 A;  4M74 A;  5DDG A;  1MNM C;  3TP3 A;  1MMD A;  2V1D A;  2O6G E;  2QLZ A;  3C1D A;  1VQ4 I;  2AQF A;  3WTS C;  2DT6 A;  3E6D A;  2DOE A;  1JI8 A;  2V7F A;  3OYE A;  3KFW X;  3BR1 A;  1Y8R B;  2DW4 A;  1ZH5 A;  2XAH A;  4FX0 A;  1HSJ A;  2X1C A;  4L9T A;  5B1A H;  2JVG A;  2OCC H;  2CUF A;  3A01 A;  2HGC A;  3FXK A;  1RR7 A;  2JZY A;  2NVX J;  2VI6 A;  2DO7 A;  1X19 A;  1V55 H;  4G6D A;  3JCU C;  1P7I A;  3HJE A;  1IDZ A;  2EIK H;  2STT A;  2Q2E A;  5J47 A;  2ZJP F;  4BJ6 C;  1B8I A;  1FIP A;  4HDV A;  3RQ4 A;  2P6S A;  3E1S A;  3HSE A;  1BOB A;  5JI6 A;  1IV6 A;  3M8E A;  1YYV A;  4HYE A;  1L0O C;  2QM3 A;  1FYK A;  1R22 A;  4DQ2 A;  3FXQ A;  4BAC A;  1G3W A;  2DA4 A;  3PSF A;  1HKS A;  2EZI A;  2ECB A;  5E3N A;  3QQA A;  2ZME C;  4U7D A;  1RKW A;  4BE0 A;  3L2Q A;  1G3T A;  2MD0 A;  3CTA A;  1LE8 A;  3CC2 I;  2DJN A;  3K4B A;  3ZQF A;  2RN7 A; 
#chains in the Genus database with same CATH homology
 1AWC A;  1T98 A;  3BDD A;  3V7C A;  2CG4 A;  3V7R A;  1BN5 A;  3F22 A;  3MZH A;  3CO7 C;  2UXN A;  3VFZ A;  5CYV A;  2RQP A;  4ZYH A;  4EJT A;  2EFW A;  2A61 A;  1JE8 A;  1R7J A;  2QVO A;  2W25 A;  1SAX A;  3ZQ7 A;  2HDC A;  1TNS A;  1YW8 A;  2XAG A;  1LJ9 A;  1HKT A;  3F6O A;  2NNN A;  3K9T A;  2X0L A;  2G9W A;  3GVA A;  2JRT A;  4BHP A;  3IKV A;  3N4M A;  2O61 A;  2DPU A;  3QP6 A;  4IXA A;  3HRT A;  1IXS B;  4OIQ F;  3FF5 A;  2BGC A;  1OMI A;  3RKX A;  3J81 Z;  1JHF A;  3LAJ A;  2VT3 A;  2WV0 A;  3Q9S A;  1U8R A;  1MKM A;  1QZY A;  4B8X A;  3GYH X;  5BPD A;  3E6M A;  5F1R A;  3M1E A;  1V3F A;  3WGG A;  2RKH A;  4MEX F;  2E7W A;  4OIN F;  4WK8 F;  3F21 A;  2A3S A;  2P7V B;  1IN8 A;  3I5U A;  3F72 A;  5E8G A;  2VON A;  5E8I A;  3C3W A;  4HF0 A;  2F5D A;  2W84 A;  4I02 A;  3VB2 A;  5E1X A;  2NRA C;  3GFM A;  2P4W A;  2FA5 A;  3ISP A;  3JTG A;  1FX7 A;  1XD7 A;  4CO8 A;  5IT9 K;  3COA C;  2XRN A;  1MDM B;  1D5V A;  2J5P A;  3L7W A;  2V9V A;  5LRS A;  2K27 A;  2F2E A;  1R1V A;  3ECH A;  1RUN A;  2XGX A;  4L9N A;  3FM5 A;  3KE2 A;  4HQM A;  1ZGA A;  2HQN A;  1DUX C;  3WU1 B;  5AIP A;  1CF7 B;  4I09 A;  4RB0 A;  1U6G A;  2PMU A;  1SFE A;  4LG0 A;  3TOB A;  1REP C;  3TOA A;  1ZRE A;  3HSF A;  3V8K A;  1GVJ A;  2Z99 A;  4HZF A;  2EFP A;  2L01 A;  5ICF A;  1J5Y A;  3HOT A;  4M6X A;  1SD4 A;  2PJP A;  1OYI A;  3VEP A;  4AIH A;  3BPV A;  5CVU A;  1W5S A;  1I5Z A;  4LMY A;  3WGI A;  3FMQ A;  5D5X B;  1FBQ A;  1W7P B;  2FQ3 A;  1YW7 A;  5E17 F;  1Z9C A;  2YR2 A;  3IWF A;  1KU3 A;  3TO7 A;  5D8L B;  4AIK A;  4WCG A;  3E3V A;  2IJL A;  3QPH A;  2XAQ A;  2HQR A;  2A5Y B;  1OYY A;  3T0Y A;  5J8F A;  3QRF F;  4KNY A;  4RS8 A;  1EH7 A;  4IRH A;  2QBY A;  3R61 A;  2A6E F;  4A6D A;  1Q1H A;  2G7U A;  1AOY A;  2KIM A;  3HTU A;  2MH9 A;  2W24 A;  3GUD A;  3JSO A;  3FX3 A;  2M45 A;  2FBK A;  3I59 B;  3EET A;  4GYI A;  1XDS A;  3F8M A;  4A0X A;  3U9G A;  4K2E A;  1U78 A;  4G6Q A;  1XB4 A;  2FOK A;  1HW5 A;  4KN7 X;  5K5Q A;  1TQI A;  3QOP A;  1WRJ A;  1W4M A;  1S6L A;  3WG9 A;  1XGS A;  3GX4 X;  5CVR A;  5HDG A;  1JGS A;  2XIG A;  2IA2 A;  2H6C A;  2H27 A;  2HR3 A;  4HDU A;  1SFU A;  2L4M A;  5CVI A;  4MQV A;  3H3Z A;  4HX4 A;  2CGP A;  3HSR A;  1W7P D;  5FFZ A;  4HV6 A;  2DQL A;  5KVR A;  3M9A A;  3AAF A;  4EGY A;  3BP8 A;  2R7D A;  4R8H A;  5ICC A;  3P7N A;  5D5W B;  2IA1 A;  1MZB A;  1IRF A;  4L5J A;  3MFK A;  1C0W A;  4HX7 A;  3TO6 A;  4EJV A;  1BI0 A;  4G94 A;  3KZY A;  4ETS A;  1J75 A;  5DCF A;  1B6A A;  1GHC A;  3I64 A;  2VC0 A;  4XBF A;  1ON1 A;  3CDH A;  1O3R A;  4LK0 F;  2H94 A;  3EYI A;  5IT3 A;  1P2F A;  1XMK A;  4IRG A;  1BC7 C;  1KYW A;  1O3T A;  1E17 A;  3RJP A;  3K0L A;  2Z5U A;  1YFH A;  1Y0U A;  1STZ A;  1O7L A;  3Q9V A;  2F5E A;  1YQA A;  1XN7 A;  2ZNZ A;  4WF2 A;  2CW0 F;  3WTZ A;  2EJR A;  1S29 A;  3ELK A;  2P5L C;  3KP5 A;  4I0A A;  5ERI A;  2KJB A;  2MBF A;  3BOQ A;  5HDN A;  5LEK A;  3PQJ A;  2O0Y A;  2M8E A;  1FYM A;  4Q4Z F;  2A07 F;  2D45 A;  4MGR A;  2CFX A;  1D8J A;  1SD6 A;  1LDD A;  5LHG A;  4GYG A;  1XCV A;  3W6J B;  4L18 B;  2RDP A;  1FPQ A;  3WGH A;  2CO5 A;  2Q8K A;  3ZMS A;  2R3S A;  5LGT A;  3ZMZ A;  2V6C A;  5FO5 A;  5HVQ C;  5D4R A;  4MTE A;  1BJA A;  1R1U A;  2WWY A;  5FGM A;  1SFX A;  3ULQ B;  1PP8 F;  4LK1 F;  3P9K A;  2VBZ A;  5BMZ A;  1KU2 A;  1O7F A;  3J81 K;  3HTS B;  1P4X A;  4YFX F;  2FXA A;  5HLG A;  3WE2 A;  2VN2 A;  1TQP A;  2VXZ A;  3RKW A;  4KDP A;  1QQI A;  4CXF A;  1KQ9 A;  2HYF A;  3I54 A;  4FHT A;  4GGG A;  1Z6R A;  4P9F A;  4AWX B;  1SMY F;  2IW5 A;  5HLH A;  1O3S A;  2M30 A;  3HYI A;  3VOD A;  3DQV C;  4D0P A;  1S8N A;  2P6T A;  1HW2 A;  2OU2 A;  3CO6 C;  2NYX A;  5L3B A;  1YIO A;  3EDP A;  2RGV A;  2BEO A;  3KEQ A;  2YX7 A;  2STW A;  2ZME B;  1IN5 A;  1YS7 A;  2H6B A;  3GXO A;  4EJU A;  1J2X A;  1FBU A;  3FMR A;  1RIO H;  3LWF A;  5D5V B;  4UVC A;  1PDN C;  1P4A A;  1Z7U A;  3LQR A;  4P55 A;  1CF7 A;  3P9C A;  1UB9 A;  4UNO A;  4P96 A;  3JTH A;  3DV8 A;  1WI9 A;  4Y17 A;  1R36 A;  3R0A A;  5DUK A;  5AIQ A;  1ZGJ A;  1H0M A;  3E97 A;  3FZV A;  5LGU A;  3MWM A;  1IN4 A;  2DQR A;  1FP1 D;  4M6Y A;  2HFH A;  5TJJ A;  4ZZL A;  3M8F A;  2LF8 A;  3LFK A;  3CJN A;  5H6R A;  1QNT A;  1LQ1 A;  2XHK A;  1F5T A;  2PQ8 A;  4LB5 A;  1XGN A;  5E20 A;  4HOB A;  5A2Q Z;  1K78 B;  2BV6 A;  3BY6 A;  5E18 F;  3JSP A;  1UST A;  2QEN A;  4PDK A;  1XGO A;  4FT8 A;  2GZW A;  5HS9 A;  1Z91 A;  3E5X A;  5EEG A;  3K1P A;  1MD0 A;  4L0Z B;  4HLX A;  1QO0 D;  4Z2Y A;  5DCM A;  2BE5 F;  4RGX A;  3FHZ A;  3IC7 A;  1ZYR F;  2VBY A;  2ADU A;  2DK8 A;  4OIP F;  2GA2 A;  2W57 A;  4KIC A;  1GXQ A;  4RB3 C;  1JHH A;  4A6E A;  3R0J A;  3RTR A;  2YX4 A;  4U88 A;  4PZJ A;  1LEA A;  4M71 A;  1D8K A;  1WKM A;  4ESF A;  4WXC A;  4KFC A;  5CJ9 A;  2IP2 A;  2H09 A;  4CIC A;  2NAZ A;  1ZAR A;  3OV8 A;  2VE9 A;  4BQA A;  2B0L A;  2FRH A;  4RB2 C;  3L9F A;  3MAJ A;  1U5T A;  2V1U A;  3LST A;  2X4H A;  5JHU A;  4YFK F;  2IVM A;  4JK1 X;  4GXO A;  4LJZ F;  3WU0 A;  3EUH A;  1S7O A;  4EM2 A;  5BQT A;  2HKX A;  2FMY A;  3FMS A;  4ENK A;  2Z33 A;  3WTX C;  4M9X A;  3H3U A;  3GW2 A;  5HLI A;  4UV8 A;  1RZ4 A;  2EK5 A;  3HRS A;  1TLH B;  1EH6 A;  1FC3 A;  4KIF A;  1T0F A;  1FNN A;  3M7G A;  4O5V A;  2QZ8 A;  2FEZ A;  3CUQ A;  4M72 A;  1K7A A;  2QYO A;  4MQ9 F;  2CYY A;  2KRF A;  4KIG A;  2ISZ A;  2HTS A;  1RNL A;  3U2R A;  4EM0 B;  2VT2 A;  4KT5 C;  3DPL C;  3EYY A;  1U3E M;  2HYG D;  1MJB A;  2GQQ A;  4QWQ A;  2OZ6 A;  3HRU A;  2ZO4 A;  1YW9 A;  3QAH A;  4YII A;  5H20 A;  4UXN A;  1FOK A;  3QU3 A;  2E1N A;  2G7H A;  3GEZ A;  4M9S A;  1GXP A;  4KMF A;  5JR3 A;  2Y0M A;  3V8L A;  4MEY F;  5BPI A;  3U1D A;  3LAP A;  4AD9 A;  2FE3 A;  4WX9 A;  2DBB A;  2L4A A;  3ZMD A;  3E6C C;  3KLO A;  1FSH A;  3ZMV A;  1ODD A;  4G9Y A;  5F64 A;  3DXJ F;  2VOD A;  4A5N A;  1PP7 U;  1EH8 A;  3P9I A;  1XGM A;  4JBA A;  1DPU A;  3I71 A;  1IUY A;  1G3S A;  5BOX A;  2PMH A;  4KMU X;  3IRR A;  2NNY A;  1R23 A;  5D5U B;  1EV7 A;  5LGN A;  4HQE A;  2OA4 A;  5DUI A;  4OU0 A;  1Z05 A;  4P5O A;  2HZT A;  3DPT A;  3KEO A;  4KYW A;  1ZRF A;  4XLP F;  3QP5 A;  2EB7 A;  1L3L A;  4LLL A;  3MEX A;  2FF4 A;  3RKY A;  3WTV C;  1LB2 A;  3IHU A;  1F9N A;  2EWN A;  2CWE A;  3RYP A;  4HX8 A;  5HOO A;  4L5I A;  2D2W A;  3R6S A;  4Q47 A;  2DFI A;  5CVV A;  4I98 B;  2XKO A;  2ZJ2 A;  4U0W A;  5J6X A;  1MJA A;  3CLO A;  2M5W A;  2DT5 A;  2XVC A;  2ETH A;  2DI3 A;  5DD4 A;  2MLG A;  2A6H F;  1RUO A;  4WXD A;  3F8F A;  1YTY A;  1NHA A;  4G7Z F;  3KP4 A;  2O8X A;  4WWC A;  4F7Z A;  1OPC A;  5E1Z B;  4L9V A;  5BS6 A;  4RAY A;  3ZP5 A;  4LG0 B;  2XAF A;  4BNC A;  1TW2 A;  1FT9 A;  4I01 A;  1XSV A;  3F8B A;  4MTD A;  1KYZ A;  2ESN A;  2EV5 A;  1BIB A;  2O3F A;  1U5T C;  1PUE E;  4Q48 A;  1X3U A;  3O3K A;  5L3D A;  1LVA A;  1F1Z A;  3BZ6 A;  4HAM A;  2VC1 A;  5E1W A;  4P9U A;  1ZLK A;  3K69 A;  3N97 A;  4HF1 A;  1T2K A;  2LSO A;  1MJ9 A;  3GWZ A;  4IF4 A;  4ENJ A;  1UHM A;  1UCR A;  5LRR A;  1ON2 A;  4I2O A;  4ZYD A;  5CLS A;  3CUQ C;  4NQW A;  2R7F A;  4EMS A;  5L3E A;  3VOE A;  5A2Q K;  2EFO A;  2FBH A;  2CSO A;  2J5O A;  3IRQ A;  4R79 A;  1HST A;  2LNB A;  1R58 A;  3I4P A;  5D4S A;  2P8T A;  3GFL A;  3HUG A;  3D5L A;  2RVC A;  1QPM A;  1ZHF A;  4HF2 A;  2XRO A;  2VBX A;  1FZP B;  5K5O A;  1P6R A;  4FX4 A;  4OIO F;  1USS A;  3ERE D;  3JW4 A;  1TQM A;  4A12 A;  5KK1 A;  3T5X A;  3RPU A;  5LLQ A;  3I58 A;  1LEB A;  4UHT A;  1R00 A;  1HQC A;  1B1B A;  4PCQ A;  1TTY A;  3BWG A;  3SFZ A;  1J9I A;  1KQ8 A;  1OKR A;  3R60 A;  5D6E A;  5D6F A;  3V8J A;  2DAO A;  4IRI A;  3HIF A;  2Y48 A;  1IXR C;  3ABU A;  4ESB A;  2QQA A;  2RNJ A;  3L2C A;  5ILV A;  4UUV A;  3SZT A;  1KGS A;  2ESH A;  2VOO A;  4ESJ A;  4LLG F;  1YG2 A;  5K1Y A;  4L9J A;  1K79 A;  1MDM A;  1YLF A;  5FLX Z;  1YO5 C;  2XV4 S;  2OZU A;  1K6O A;  2OD5 A;  1G6N A;  1W5T A;  3DP7 A;  3HHH A;  4H0E A;  3ZMU A;  1XSD A;  2FBI A;  3G3Z A;  1BI3 A;  2TDX A;  4ON0 A;  2PI0 A;  4GCV A;  3JAM Z;  3IL2 A;  2LKP A;  4M9Z A;  1XSX A;  2MH2 A;  5L3C A;  2EFQ A;  3RI4 A;  3I53 A;  2NS0 A;  3C7J A;  1BC8 C;  2QWW A;  2VOP A;  2D1V A;  1I6X A;  2HS5 A;  2EFN A;  4E70 A;  1S3J A;  1XDU A;  2OAZ A;  1SMT A;  4KIB A;  4Y13 A;  3GFI A;  3J80 Z;  1S7A A;  1IRG A;  1W7P A;  3B73 A;  3SZP A;  1RI7 A;  1I27 A;  2KKO A;  3B02 A;  4RGR A;  1LDK B;  1I1G A;  2GWR A;  1DP7 P;  4LB6 B;  2V79 A;  1J59 A;  1FWZ A;  3O2P E;  3WOD F;  2P5V A;  2EA2 A;  3SQN A;  2LDU A;  3BJA A;  3BRO A;  1ZRC A;  3GZ5 A;  4S05 A;  2GXB A;  1BI2 A;  4OOI A;  3KET A;  1JXS A;  4XSX F;  3EQL F;  2XUB A;  2K02 A;  2F5C A;  3K2Z A;  2MLK A;  4AVP A;  1ZG1 A;  1HBX G;  3D0S A;  1FYL A;  1B59 A;  3LQQ A;  4CGZ A;  4BXU A;  3K1N A;  4EV0 A;  5ILU A;  3Q5F A;  1BIA A;  3ZPL A;  1E2X A;  3ZMT A;  2FNP A;  3H92 A;  3NEU A;  2E1C A;  2K4J A;  3I59 A;  4MNU A;  2GA1 A;  5H6Q A;  5CVJ A;  3KP7 A;  4LLN A;  3RDI A;  1UFM A;  4OMY A;  1G3Y A;  2M1B A;  5ED4 A;  2IA0 A;  3MZY A;  1KU9 A;  2KIF A;  3DFG A;  3LA3 A;  3KP6 A;  1P92 A;  4ZYE A;  5HS8 A;  3CUO A;  1QGP A;  4PGH A;  4JQF A;  2BYV E;  2KIU A;  3K1M A;  5ICG A;  2IRF G;  4KA4 A;  4ENM A;  2QUF A;  2VE8 A;  2HKO A;  2RV8 A;  3E5Q A;  4CZZ A;  2GXG A;  3O6B B;  1DDN A;  3TGN A;  4IHS A;  4HV5 A;  2OBP A;  1O57 A;  4HW0 A;  1FY7 A;  2YSR A;  1CGP A;  2HOE A;  5DV5 A;  2JT1 A;  2OQG A;  1LNW A;  5FFX A;  3FXR A;  3HOS A;  1QBJ A;  1KA8 A;  2KJC A;  5HDK A;  3F23 A;  1BI1 A;  1G4D A;  2HEO A;  1VTN C;  3TDZ C;  4I7H A;  2C6Y A;  4DNC A;  3LA7 A;  3ZN1 A;  5TRD A;  1IN6 A;  2FNA A;  2K7L A;  4ZYG A;  5ICE A;  3DKW A;  5F6F A;  3HHG A;  4GO1 A;  2UWM A;  2Q0O A;  3PFI A;  2ZKZ A;  5DYM A;  2HWV A;  3TDU C;  4IHT A;  1UHW A;  4U0V A;  1QZZ A;  3OOP A;  4MHG A;  4A5M A;  5EEH A;  2JPC A;  2FSW A;  3MCZ A;  2AS5 F;  3GLX A;  3W6K B;  2L54 A;  4B09 A;  3QPT A;  3BJO A;  3BPX A;  2OQR A;  1FSE A;  5L3F A;  2DPD A;  1HW1 A;  3GZ6 A;  1LDJ A;  3V4G A;  3TO9 A;  1ZG3 A;  4LD5 A;  4UVA A;  1OYW A;  4BHC A;  4QLC U;  2ACJ A;  2PBI A;  5L3G A;  3LA2 A;  3IKT A;  1IW7 F;  2L02 A;  4L0Y B;  4OIR F;  1T6S A;  2XKP A;  2MD5 A;  5DD8 A;  4NHJ A;  4Q5S F;  1ZG5 A;  4Y15 A;  1HXD A;  3ZN0 A;  2AXL A;  2MA3 A;  1ZAO A;  3ABT A;  5DCM B;  4EJO A;  4N0B A;  1IF1 A;  2HTJ A;  4BH9 A;  1TW3 A;  1DPR A;  4CYD A;  1I1S A;  2ZFW A;  5D8K B;  5ILS A;  4HLY A;  2Z3Y A;  4EQQ A;  4YG2 F;  3FXU A;  4XSZ F;  5JVT A;  1O3Q A;  3WTU C;  2CQK A;  4UV9 A;  4RGU A;  3F6V A;  1H9T A;  4OMZ A;  1FP2 A;  2DK5 A;  4ZH4 F;  3KLN A;  2W85 A;  1WSU A;  1TNT A;  4HA8 A;  5AON A;  1ZLJ A;  2K86 A;  1IAW A;  2O03 A;  2JPB A;  1Z6T A;  4O6J A;  2PFB A;  2LF7 A;  3RYR A;  5LBQ A;  1ZRD A;  5IT9 Z;  3NQO A;  1WQ2 A;  2IT0 A;  4M73 A;  4S04 A;  1U5T B;  2WTE A;  2ZNY A;  1T38 A;  1ZN2 A;  2P7C B;  2EA4 A;  3E6B A;  2E7X A;  2QQ9 A;  2JTV A;  2ZME A;  2A69 F;  3V7S A;  2ZXJ A;  4YIF A;  2Z9O A;  2WC2 A;  2FML A;  2L3D A;  5JFR A;  2EV0 A;  1XMA A;  3IWZ A;  3GF2 A;  2DU9 A;  3PQK A;  2PLY A;  3SHF A;  5FLX K;  2DTR A;  2UXX A;  1WWX A;  4G7O F;  4IVN A;  4BAY A;  3I0T A;  5J8C A;  2QQB A;  1J0R A;  3L00 A;  2PG4 A;  2ZBK A;  5K5R A;  3GO5 A;  5FD5 A;  2V1X A;  1IN7 A;  1BBY A;  1YS6 A;  4RB1 A;  2XAJ A;  3KP3 A;  3CUQ B;  3NRV A;  4I0B A;  4O3M A;  3JAM K;  2JSC A;  4RAZ A;  1FBS A;  2K4B A;  4BHB A;  2COM A;  1B4A A;  2Y75 A;  3C18 A;  6PAX A;  1TBX A;  3J7A O;  1BM9 A;  3T1B A;  3F8C A;  5HS7 A;  4N9I A;  2D1H A;  4ASN A;  3RIR A;  4LFU A;  4KUM A;  1K78 A;  3DF8 A;  1IXC A;  3L09 A;  3J80 K;  4BYY A;  2P5K A;  4XRF A;  1FLI A;  3T8T A;  5FD6 A;  1SD5 A;  2ISY A;  2A68 F;  4G8X A;  3REO A;  1MGT A;  1D3Y A;  3ML6 A;  3QU6 A;  4IPA A;  3HRM A;  1BOA A;  3GFJ A;  5DEQ A;  2F5F A;  4R1H A;  4N9H A;  4CHU A;  4EVI A;  4G7H F;  2PEX A;  3G73 A;  2XAS A;  5LHI A;  3F3X A;  2QBY B;  1R1T A;  4EM1 A;  1SD7 A;  4TV7 A;  2IPQ X;  2BBY A;  2VBW A;  3F8N A;  2M87 A;  4EGZ A;  3KP2 A;  1XCB A;  1Z1D A;  3E5U A;  3S2W A;  4HBL A;  1IZ1 A;  5LHH A;  1A04 A;  3TQN A;  4U7B A;  1V4R A;  4RGS A;  1H9G A;  4EJW A;  2UZK A;  1ONV A;  4A0Y A;  2YU3 A;  3MQ0 A;  1OR7 A;  2MC3 A;  1ULY A;  2YPR A;  1B9M A;  4ENN A;  5FB2 A;  2PN6 A;  1R5H A;  3FM3 A;  4U0Y A;  3FWE A;  3R4K A;  3TKY A;  1HKQ A;  2ZCW A;  2FU4 A;  1B9N A;  1U2W A;  4A2U A;  1J7K A;  3SXY A;  3WE3 A;  4NB5 A;  1R5G A;  4CDG A;  2ELH A;  3DEU A;  2GAU A;  4ZZD A;  4AIJ A;  4UVB A;  1P4W A;  3WTT C;  4YFN F;  4PGG A;  3RPQ A;  3KCC A;  4A0Z A;  3WTW C;  1F4K A;  4IJA A;  2GIV A;  2DLL A;  3BJ6 A;  3ROU A;  4XLN F;  5LEJ A;  1KQ0 A;  4WXH A;  3ECO A;  4KN4 X;  4LGW A;  1KU7 A;  3KZZ A;  2RC4 A;  1T39 A;  3T8R A;  2EV6 A;  4M74 A;  5DDG A;  2V1D A;  2O6G E;  2QLZ A;  3C1D A;  3WTS C;  3E6D A;  3KFW X;  2DW4 A;  1ZH5 A;  2XAH A;  4FX0 A;  1HSJ A;  4L9T A;  2HGC A;  2JZY A;  2DO7 A;  4G6D A;  2STT A;  2Q2E A;  4HDV A;  2P6S A;  3HSE A;  5JI6 A;  3M8E A;  1YYV A;  4HYE A;  1L0O C;  2QM3 A;  1FYK A;  1R22 A;  4DQ2 A;  3FXQ A;  1G3W A;  1HKS A;  4U7D A;  1G3T A;  3CTA A;  3WTY C;  2RN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...