2LSOA

Solution nmr structure of the globular domain of human histone h1x, northeast structural genomics consortium (nesg) target hr7057a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H1x
publication title Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A
rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lsoA00
2V6CA 1SMYF 1UHMA 4LGWA 1BIAA 1MDMA 2DPDA 4IRIA 2O03A 3GF2A 3KP3A 3MAJA 3F8MA 4L5JA 1IF1A 1J2XA 1XCBA 3HRTA 4O6JA 4HX7A 2P7VB 2O8XA 1O3QA 3WGHA 2A5YB 5DDGA 2NS0A 3NEUA 3F72A 4BHBA 4O5VA 2XKPA 4Y13A 4EGZA 3FXUA 3HYIA 1SFXA 5LEJA 3FF5A 2ZXJA 3F8BA 4EVIA 2D1HA 2AS5F 3FMQA 5K1YA 3WODF 3I4PA 2A69F 2JPBA 5J8FA 4RS8A 1TBXA 3T1BA 4OIQF 5FFXA 1J9IA 2OU2A 3EYIA 1IXRC 3T5XA 1Y0UA 4Y15A 2HYFA 3LA3A 2DAOA 1FX7A 4Q5SF 3P9IA 4A5MA 3M7GA 4CGZA 4NHJA 3ML6A 1FP1D 1OKRA 2OZUA 4UVAA 4FX0A 2RKHA 5LBQA 1XGNA 2XRNA 2O0YA 2NYXA 5JR3A 4HBLA 1RIOH 3K1PA 2VE9A 3CLOA 3K0LA 3RKXA 1EH6A 1J5YA 3EDPA 2E7XA 3PQJA 1KQ0A 2VXZA 5ERIA 4AIJA 3P7NA 4XSXF 2H94A 2NAZA 1IN8A 1E17A 3LQRA 2IW5A 5LGTA 1XN7A 4KFCA 2HOEA 4U7BA 1MJ9A 4I09A 3H3UA 4PCQA 3L7WA 3EQLF 1R5GA 1SD5A 3O3KA 4L9NA 2HZTA 4Y17A 2VBWA 3BY6A 2VOPA 1ULYA 5D4RA 5DUIA 4P96A 1XGSA 2QYOA 5DCMB 3Q5FA 5DV5A 1PUEE 3LSTA 4EQQA 2ISZA 1V4RA 4FX4A 4M9ZA 3AAFA 3CUQA 4U7DA 3HIFA 4M9XA 4G6DA 1O3RA 1H0MA 2EB7A 3ZN1A 1R23A 2FF4A 5HS8A 1XGOA 1SD6A 2BEOA 3CTAA 2FBIA 3GW2A 3C18A 4A0ZA 3IWZA 1KYWA 1U5TA 1TNSA 2EFOA 4RGXA 4M73A 2FE3A 4OU0A 1W7PD 4HX8A 4EJWA 2QVOA 1IN4A 4OIRF 5ICGA 1KU9A 1SD7A 2VODA 5CVIA 3HRSA 1T0FA 2M5WA 2KJBA 4A12A 2KIFA 3F21A 1FY7A 5HLGA 3E6BA 1UB9A 1MD0A 2ZMEB 1OR7A 3WTYC 2NNYA 2D1VA 3T8RA 2QWWA 1ZHFA 3J80Z 2O6GE 3B02A 4M74A 1ZLKA 3SXYA 1RI7A 2K86A 5HDNA 3VFZA 2CWEA 1YS6A 2GWRA 3TGNA 3PFIA 3OV8A 1DPRA 4S04A 1U2WA 2V79A 1FYKA 3P9CA 3TKYA 4Q48A 1UHWA 2BBYA 3KZYA 4MGRA 2P6TA 1HQCA 2ETHA 3SZTA 4KUMA 2FNPA 2VBXA 4I0BA 1TW2A 1IRGA 2EWNA 3F3XA 1D8KA 4IXAA 2FSWA 2JZYA 2XAFA 1TLHB 3DEUA 4ETSA 3QRFF 5ICFA 1I5ZA 2FNAA 2LNBA 3BWGA 4ZYEA 1OYIA 3ULQB 2GXGA 4M71A 1IXCA 4HQMA 3I58A 4RGUA 5L3DA 2HDCA 5DD8A 1ON2A 2IVMA 4XBFA 1LB2A 3L9FA 2MA3A 4G94A 5D6EA 3QU6A 2F5FA 2GQQA 3VOEA 2VONA 2L4AA 4I01A 3V7SA 1FBQA 2ESNA 4HYEA 3RPUA 4ZH4F 4P9FA 1HW1A 4MNUA 4EM1A 1BIBA 2V1XA 1K6OA 1EV7A 2DLLA 4HF0A 3TDZC 4TV7A 1Z05A 5IT9K 3NQOA 5FD6A 3I54A 3F8CA 3ROUA 3SQNA 5FO5A 3QOPA 1TNTA 2XVCA 4MHGA 3TO6A 1Q1HA 3QU3A 5A2QZ 1XDUA 4HAMA 3M9AA 1F1ZA 4ENNA 4LB6B 2V1DA 4B09A 4LG0A 1K78A 3R0JA 3CJNA 4YG2F 1YYVA 5LRRA 1OPCA 2F5EA 1G3YA 2DFIA 3FMRA 2PMHA 4EJOA 2HTJA 1D8JA 1E2XA 3VB2A 5LHIA 2W57A 1U5TC 1UFMA 3F6OA 3U9GA 2IA0A 4ZZLA 1ZGJA 4RGRA 2E1CA 4MEYF 2FA5A 2JTVA 1HKTA 5ICEA 2DK5A 3U2RA 3IRRA 3G73A 2IA1A 2EV6A 4N9HA 3IRQA 4Q47A 4IRHA 3WG9A 5E1WA 2KIMA 1ZLJA 2CO5A 1LDJA 2IT0A 3HTUA 3ZQ7A 5BMZA 2HKOA 2HQNA 1FPQA 3TQNA 2XUBA 2Y0MA 2HYGD 1CGPA 3ELKA 5EEHA 1HXDA 1XSVA 5HVQC 4IPAA 4U0VA 4OIOF 3GO5A 2ZO4A 3V4GA 1ZAOA 1LNWA 2W24A 5LHGA 2DBBA 3TOBA 3J80K 1HSTA 1T38A 2UWMA 5D8LB 3E3VA 4WF2A 4JQFA 4IF4A 1Z91A 4CXFA 2ZBKA 3F8NA 4ESBA 4MQ9F 2XV4S 4MEXF 4AIKA 4YFKF 5DCFA 3ABUA 1FT9A 5BQTA 1STZA 2V1UA 2YPRA 3IHUA 4HLYA 3ZP5A 2X4HA 5ILSA 2L4MA 1DP7P 2VBZA 1BC8C 1OMIA 2EFQA 3F22A 3BJOA 3RDIA 2VN2A 2Y48A 4EMSA 3WTXC 1SAXA 1R5HA 4ON0A 1XGMA 2DPUA 4A6DA 4PGHA 2PN6A 4BHCA 1W7PA 5H6QA 1IN7A 1G3WA 4CO8A 5CLSA 2STTA 3IKVA 1FLIA 1W5SA 5JI6A 2Z33A 4ENMA 2XROA 1JE8A 1HSJA 1FBSA 3EYYA 1L3LA 2F2EA 4Z2YA 4HDUA 3ZMDA 3ZMTA 1RUNA 3JAMZ 1WRJA 4IJAA 1U3EM 3GWZA 4WXCA 2K4BA 3HUGA 4KDPA 2RVCA 1YLFA 1A04A 4KT5C 2Q8KA 4R8HA 3F8FA 5LHHA 3E6MA 5ILUA 4HOBA 3P9KA 1J7KA 2JT1A 3GFIA 3RYRA 1IAWA 5A2QK 4IHTA 3MZYA 3TDUC 1Z7UA 2W85A 4YIFA 1R7JA 4XLNF 1XMAA 2QZ8A 5H6RA 3I5UA 3JSOA 4R79A 3QP6A 1BI2A 3M8FA 3HOTA 3RKWA 1L0OC 2L54A 1R36A 2RN7A 3B73A 3WE2A 1TQMA 3F23A 5AONA 3RKYA 2DT5A 1IW7F 2QQ9A 5ED4A 3BROA 5D5XB 4HF2A 1T2KA 2Q2EA 1FOKA 5D6FA 1YG2A 2HQRA 5E17F 1TQIA 1ONVA 5LRSA 2QBYA 2XGXA 1B4AA 4E70A 2RC4A 4IVNA 3C1DA 4P55A 3DXJF 4AIHA 3TO9A 1BJAA 5IT9Z 3MEXA 2NNNA 3LAPA 1F5TA 1I1SA 3WTVC 2R7DA 4P9UA 3R4KA 3HSRA 2FOKA 3LWFA 3KEOA 1QQIA 4GYIA 4D0PA 2H27A 3DF8A 4HX4A 4RAYA 4HF1A 4O3MA 1KYZA 2DI3A 3ZMZA 4RB0A 2K02A 4LB5A 2XASA 1G3SA 3E5QA 1P6RA 1USTA 3R6SA 1XB4A 3J7AO 4BH9A 1O7LA 1CF7B 5CJ9A 2VC0A 1PP8F 2PFBA 2A6EF 5BPDA 2IJLA 1BBYA 2M45A 5L3GA 1WI9A 1FBUA 4OIPF 4UHTA 2P6SA 3JSPA 4KIBA 1SFUA 2RV8A 4JK1X 3WU0A 4CYDA 1FYMA 1H9TA 4P5OA 3LFKA 4KN4X 3GZ5A 4UV9A 5E1ZB 2OAZA 2LKPA 4RAZA 4NQWA 4ASNA 3C3WA 5D8KB 5FD5A 3H3ZA 3JAMK 2FMYA 2A3SA 2CGPA 1K79A 3LA7A 2FQ3A 4A0XA 4LMYA 4BXUA 3EUHA 4UXNA 3M8EA 1KA8A 2L01A 4WXDA 1WQ2A 1IXSB 5CYVA 1WSUA 1MJAA 1XDSA 1F4KA 4GYGA 2R3SA 2OZ6A 1Z6RA 2QQAA 2EA4A 4LLLA 3O6BB 1MZBA 5D4SA 4U0YA 5H20A 4L9TA 3KLNA 1W5TA 2LSOA 2ZNZA 2Q0OA 3IC7A 4IRGA 2FMLA 2G7UA 4KNYA 5HOOA 4LK0F 4HLXA 4A2UA 2XAGA 3RPQA 3WTUC 1NHAA 4IHSA 2QLZA 4BQAA 4H0EA 2PI0A 4PGGA 4YFXF 3E6CC 2BV6A 4L0ZB 3S2WA 4L0YB 2P5VA 1P4AA 3IL2A 4I02A 2A61A 4YFNF 5AIQA 5F6FA 4AWXB 3KE2A 2DQRA 4JBAA 2IP2A 2DU9A 4HW0A 3E6DA 3LAJA 2HFHA 5D5UB 3HOSA 3RYPA 5BOXA 4G7HF 3MWMA 2QENA 1ZN2A 5JFRA 5J6XA 3KP6A 4EM0B 5FLXK 4ESFA 4PZJA 1MDMB 2Z5UA 1ZYRF 4OOIA 2A6HF 3C7JA 1XD7A 1D5VA 4M72A 2P7CB 3I0TA 2EJRA 3MQ0A 3ZMUA 2PMUA 5DCMA 3FZVA 4KMUX 3ERED 1RZ4A 4KICA 3WTTC 3CUQC 3WTSC 1ZG5A 2D45A 1YTYA 2ADUA 1PP7U 1AOYA 1Z1DA 5F64A 5K5QA 3E5UA 2ZNYA 1HKSA 4M6YA 3E97A 3I59B 2M8EA 3CO7C 4CZZA 3M1EA 3Q9SA 3WTWC 4Q4ZF 3KP4A 1ZREA 2HTSA 3H92A 2MC3A 3IWFA 1LDDA 4EJTA 1EH7A 1ODDA 1LVAA 3DKWA 2YU3A 3KCCA 2W25A 5DYMA 2XHKA 2XAQA 2OQRA 4ZYHA 3I64A 2ELHA 2V9VA 2DW4A 5JVTA 1IRFA 1P4XA 2VT3A 5E8IA 3T8TA 2KKOA 1BI3A 2G9WA 5DD4A 4L5IA 2XAHA 2ZMEA 1G3TA 2RDPA 2KIUA 1T6SA 1R22A 5LLQA 3ZMSA 4R1HA 1OYYA 3R0AA 2O61A 1H9GA 1T98A 3D0SA 4RGSA 1QBJA 4G6QA 3R60A 1O3TA 5HS7A 5E8GA 2UXNA 5HLIA 4G7OF 1TW3A 2D2WA 2RQPA 2ISYA 2P5KA 4I0AA 2CW0F 1ZARA 2UXXA 2OA4A 2YX7A 2WWYA 1ON1A 2RNJA 1P92A 1GXQA 3ZN0A 2EA2A 3O2PE 2IA2A 5TRDA 1S7AA 2C6YA 3WGIA 3MZHA 1BOAA 2DTRA 2BGCA 2GXBA 3FXQA 1QO0D 3T0YA 3RI4A 5HDGA 1VTNC 3Q9VA 1FYLA 2QQBA 3L2CA 1U78A 1KQ9A 4XRFA 4N0BA 1KQ8A 4WX9A 2Z99A 2HEOA 2H6BA 4M9SA 5F1RA 5BPIA 1EH8A 4S05A 4G9YA 3BZ6A 3CO6C 2EV0A 3BPXA 1QZYA 3QPTA 4EJVA 2HWVA 4CICA 3SFZA 2GIVA 2OQGA 1DDNA 5ICCA 1USSA 3BJAA 1KU7A 5TJJA 3TO7A 5BS6A 4EV0A 5FFZA 3LA2A 2LDUA 1Z6TA 1MGTA 1U5TB 2F5DA 2DO7A 3KP7A 4RB3C 3JTHA 1J59A 4WCGA 1JGSA 3MFKA 1QNTA 4M6XA 3DQVC 1FC3A 3RIRA 3I53A 3WU1B 4OINF 3DV8A 1LEAA 2HS5A 2FEZA 5IT3A 2K27A 4LK1F 4A0YA 4XLPF 3N4MA 2BYVE 3NRVA 4ZYGA 1PDNC 3K1NA 2WV0A 2JSCA 1BC7C 3GEZA 3GX4X 2EFNA 3I59A 3V8JA 5D5WB 1MKMA 2EFWA 1FZPB 1B59A 2L02A 1C0WA 3VEPA 1F9NA 1B9MA 3HHGA 4GCVA 4LD5A 2PLYA 1SFEA 1DUXC 4ZYDA 2FXAA 3V8LA 1B9NA 2P4WA 4L18B 1TQPA 5E18F 2VT2A 1FNNA 2VC1A 1FWZA 3ECOA 2IPQX 3DPTA 4KIFA 4GGGA 1SD4A 1R1VA 2WTEA 1S29A 1IUYA 1I6XA 2A68F 5LGUA 1ZG3A 5E1XA 3GZ6A 3EETA 3WE3A 3J81Z 3OOPA 3G3ZA 5E20A 3KETA 1ZGAA 2RGVA 3COAC 3K1MA 3FM3A 2MLKA 1SMTA 2Z3YA 3TOAA 5FLXZ 2E7WA 5K5OA 4ENKA 2L3DA 1J0RA 3FM5A 3DP7A 1LDKB 5KVRA 2ZCWA 3FHZA 3KEQA 3K69A 4L9VA 2ESHA 5D5VB 3QP5A 1YW8A 2P8TA 1BI0A 3SHFA 3PQKA 4MTEA 5DEQA 1B6AA 2PJPA 1V3FA 4LLNA 4FT8A 2LF7A 4KA4A 1O3SA 3HSEA 2GA2A 3R61A 3GYHX 4U0WA 1B1BA 1S6LA 1XMKA 2ZFWA 1ZRFA 2ACJA 1QZZA 1WKMA 2YX4A 2W84A 4A6EA 6PAXA 3ISPA 4HDVA 1GVJA 2OD5A 4GO1A 4CHUA 1RNLA 1FSHA 2AXLA 4LJZF 2FU4A 3ECHA 5ILVA 5HS9A 3BDDA 4LG0B 4RB1A 1ZRCA 1K78B 3L00A 3FX3A 1MJBA 2ZJ2A 3RTRA 2KJCA 1QPMA 5HLHA 3GLXA 2PQ8A 1LEBA 2MD5A 2HR3A 1KU3A 3BJ6A 2WC2A 2F5CA 4AD9A 5L3EA 1YS7A 2E1NA 1S8NA 3WGGA 4ZZDA 4HZFA 2JRTA 1WWXA 4I7HA 4OMYA 3N97A 5LGNA 3WTZA 5AIPA 1JHFA 4UVBA 1XSDA 2MH9A 4QLCU 2OBPA 5KK1A 1I27A 2XKOA 1TTYA 1KU2A 2CFXA 2XIGA 3HHHA 5K5RA 2GAUA 1ZRDA 1S3JA 3K9TA 3D5LA 5L3FA 4U88A 4LLGF 4KIGA 1P4WA 3KZZA 3MCZA 3LQQA 4OMZA 2P5LC 3FMSA 4RB2C 4ESJA 2UZKA 1RUOA 1U8RA 2CQKA 4K2EA 3GUDA 2VOOA 4DQ2A 2IRFG 3DFGA 1J75A 2HKXA 4UUVA 1S7OA 4G7ZF 1XSXA 4YIIA 3ZMVA 2VBYA 3GFMA 2XAJA 1FP2A 4EJUA 1YQAA 5CVRA 4BYYA 1YIOA 3JW4A 2A07F 5FB2A 3HRUA 4MQVA 2MLGA 3F6VA 1HW2A 3GXOA 1ZG1A 2CYYA 1O7FA 1OYWA 2YR2A 1D3YA 1I1GA 3KP2A 1KGSA 3REOA 2J5PA 3J81K 2H09A 4UVCA 4G8XA 2HGCA 3V7CA 4UV8A 3KFWX 2DQLA 2FBKA 2MBFA 5CVJA 5FGMA 3SZPA 1IZ1A 1YW7A 1W7PB 1HKQA 3RJPA 4XSZF 2PG4A 4PDKA 5CVVA 1U6GA 3DPLC 1X3UA 2PBIA 2X0LA 5J8CA 4QWQA 2CG4A 2PEXA 1R1UA 2H6CA 1AWCA 2FBHA 2GZWA 3HTSB 1LQ1A 3HSFA 4CDGA 3W6KB 3BPVA 3KLOA 2VE8A 2FRHA 2R7FA 4B8XA 2Y75A 4FHTA 4UNOA 1YFHA 4L9JA 3GVAA 1LJ9A 3K2ZA 3V8KA 4EM2A 4DNCA 1W4MA 3CDHA 1CF7A 2TDXA 3BP8A 1JHHA 2M87A 4BHPA 1IN5A 2ZKZA 1YW9A 4KN7X 4F7ZA 1FSEA 1BN5A 2EFPA 4I98B 3I71A 1XCVA 4EGYA 1DPUA 4HQEA 1BM9A 1G6NA 2BE5F 2QUFA 5L3CA 4WXHA 3QPHA 1BI1A 2M1BA 3VODA 1O57A 2MH2A 1HBXG 2Z9OA 3U1DA 2G7HA 2K7LA 4ENJA 3FXRA 3ABTA 1K7AA 3E5XA 1P2FA 4A5NA 1QGPA 2CSOA 3V7RA 2NRAC 5LEKA 3KP5A 1IN6A 5L3BA 4NB5A 4BAYA 2COMA 1ZH5A 2STWA 1GXPA 1GHCA 2GA1A 1JXSA 4HV6A 2JPCA 2O3FA 2YSRA 4WWCA 2DK8A 3ZPLA 2QBYB 5JHUA 1T39A 4I2OA 2K4JA 3L09A 2EV5A 2KRFA 1REPC 4GXOA 4N9IA 4MTDA 1R00A 1UCRA 4AVPA 2J5OA 3CUOA 1G4DA 3W6JB 5EEGA 4WK8F 2EK5A 3IKTA 1R1TA 2M30A 5CVUA 3QAHA 2LF8A 1YO5C 4HA8A 4HV5A 4LFUA 4BNCA 3CUQB 1HW5A 3JTGA 1Z9CA 4KMFA 3GFJA 5HDKA 4KYWA 2B0LA 3GFLA 3FWEA 3HRMA 1R58A 3BOQA 2QM3A 5DUKA
chains in the Genus database with same CATH superfamily
2V6CA 2OTLI 4DYCA 1BR1A 2Z16A 3OMYA 1SMYF 1UHMA 5F1JA 1TWFJ 3OS2A 1JKRC 4LGWA 1BIAA 4A3JJ 1MDMA 1YJ9I 2DPDA 4IRIA 1JGGA 2GOXB 2O03A 2LC2A 3OWTA 3GF2A 2R7VA 2A5WA 3KP3A 3MAJA 1D1BA 3F8MA 2K9QA 2M7BA 4L5JA 2JSPA 1IF1A 1J2XA 3RPUD 1XCBA 3HRTA 1R71A 4O6JA 4HX7A 3W2VA 2P7VB 2O8XA 4IQ4A 1O3QA 3WGHA 2A5YB 1D1CA 5DDGA 1U9OA 3PL8A 2NS0A 5E3OA 4NQWB 3NEUA 3F72A 2BZTA 5F0FA 4BHBA 4O5VA 2XKPA 4BE2A 3GBGA 3HOWJ 4Y13A 3H0DA 4EGZA 3FXUA 3HYIA 4OAYA 1SFXA 3EUAA 5LEJA 3FF5A 4F91B 2ZXJA 2DDBA 3J7AY 3F8BA 4EVIA 1X3ZB 2D1HA 2FD5A 1X58A 2WAQN 5FLMJ 2AS5F 4A3BJ 3FMQA 4BJ5C 5K1YA 3WODF 3I4PA 4B3AA 2A69F 2JPBA 5J8FA 4XMYA 1YRNA 4RS8A 3ZQQA 3JR9A 1TBXA 3T1BA 4OIQF 2ECBA 5FFXA 3QYBA 1MBHA 2K9MA 1J9IA 2OU2A 4A3GJ 1G2HA 1SFOJ 3EYIA 2IS1A 1IXRC 3T5XA 5J47A 3KYDB 3A01B 1Y0UA 4Y15A 2HYFA 3DPUA 1LFUP 3LSIA 3LA3A 4DZPA 5IP7J 2DAOA 2JJ7A 1FX7A 2ZJQF 3HJEA 4DBQA 4Q5SF 3P9IA 4A5MA 2XPUA 3M7GA 4CGZA 3AKZA 3KPHA 2HOAA 4NHJA 3ML6A 1ETWA 1FP1D 2X6XA 1OKRA 2OZUA 4UVAA 3K10A 3FXJA 3LSKA 4FX0A 3KYLA 2RKHA 1YHQI 3DBRB 5LBQA 1XGNA 2XRNA 3TBIA 2O0YA 2NYXA 5JR3A 3JRIA 2F48A 4HBLA 1NG7A 1RIOH 2CUZA 3OS0A 1AU7A 1PUFB 1WJDA 2ME6A 4M3EA 5LD2C 3K1PA 2VE9A 3CLOA 3K0LA 1K6YA 3RKXA 1EH6A 3BC8A 1J5YA 3EDPA 2E7XA 1PYVA 1IG7A 2XF7A 2QSGX 3PQJA 1KQ0A 1TWGJ 2Y30A 3SJMA 2GM4A 2VXZA 4XN3A 1T33A 2LOOA 5ERIA 4PFOA 2HOSA 2M4GA 4AIJA 2WADA 3P7NA 4PSWA 4XSXF 2H94A 2DA6A 3K4NA 3I55I 2NAZA 1IN8A 2OUMA 2QEXI 1E17A 3OR1C 3LQRA 1BW5A 2IW5A 2WB1N 5LGTA 1XN7A 4KFCA 5DS9A 2HOEA 3H5AA 4U7BA 4UUSB 1MJ9A 4I09A 3H3UA 4PCQA 3L7WA 2V9KA 2NVTJ 3W2AA 3EQLF 2DA3A 3QOEA 1R5GA 3VPRA 4XOTA 2KRCA 1ZELA 1DQUA 1SD5A 3O3KA 4L9NA 3EUKL 4FE7A 3L2UA 2HZTA 4Y17A 4XIDA 2VBWA 3BY6A 2XPWA 2JA6J 3BR6A 4ZDOA 2VOPA 1ULYA 5D4RA 2XGDA 2VQLA 1YOVB 5DUIA 1MNMC 4P96A 1V54H 1XGSA 4D9JA 2I5UA 1WH7A 2XF5A 4QPOA 1DP3A 5C44J 5DM6F 2QYOA 3GTMJ 3JCUC 5DCMB 5J1RA 3Q5FA 1WPKA 5DV5A 1PUEE 2DDAA 3GTLJ 3LSTA 2DCEA 4EQQA 3DTIA 3L2WA 2ISZA 1V4RA 4FX4A 4M9ZA 1W0TA 3AAFA 5B3SH 3CUQA 1A6QA 4U7DA 4AVZA 3HIFA 2Y0SN 2E60A 3DWLE 4M9XA 4G6DA 4B44A 2VJ4A 1O3RA 1H0MA 3TW7A 2EB7A 3ZN1A 1R23A 2FF4A 3CCVI 3BTCA 3PNVA 1XGOA 5HS8A 1SD6A 2HPIA 3QYFA 2BEOA 3CTAA 2FBIA 4FTHA 1K83J 2I8DA 4Y52J 4ITVA 2OJED 3PUFA 3GW2A 1OCRH 3C18A 1IO2A 4XRMA 4A0ZA 4X0GA 3C2BA 4XLAA 3Q3SA 3IWZA 3QPSA 1KYWA 5M3FJ 1FEXA 1U5TA 1VQ5I 4B3XA 1TNSA 2EFOA 4RGXA 2H8WA 2E19A 4M73A 2FE3A 5LFAA 2QA4I 4OU0A 1W7PD 4HX8A 3OYAA 4EJWA 4RM2A 2EIMH 2QVOA 1IN4A 4OIRF 5ICGA 2VKEA 1KU9A 1SD7A 3PNTA 3RKQA 2VODA 3GTQJ 5CVIA 4LIVA 4PK4A 3HRSA 3CP8A 1T0FA 3WHCA 2EILH 3IH4A 2ZXHA 1R4MB 2M5WA 5M5YJ 3CCUI 2KJBA 2W4SA 4A12A 2KIFA 3I4NJ 2E71A 3JRAA 2JA7J 3EPZA 2DXIA 3F21A 2LRDA 1FY7A 4PJJA 3ASOH 3S17J 3TMOA 2UUZA 5HLGA 3E6BA 1UB9A 1MD0A 1OLTA 2ZMEB 5FKLA 3OYCA 1OR7A 3ZQFA 3WTYC 2NNYA 2X6WA 2D1VA 3T8RA 2QWWA 1ZHFA 3J80Z 2O6GE 2QGUA 2X6YA 3B02A 1IC8A 4M74A 5GAGJ 3OR2C 1ZLKA 4Z6YA 2L2OA 3SXYA 1RI7A 2K86A 1SAUA 5HDNA 4QSHA 2CWEA 1YS6A 2GWRA 3VFZA 1JJ6C 3L2VA 3TGNA 3PFIA 3CCLI 3OV8A 1DPRA 5B1AH 4S04A 4CUGA 1U2WA 2V79A 1FYKA 1E3HA 4ZDLA 3P9CA 2WAEA 2X85A 3TKYA 3OYKA 2JK3A 3BT9A 1UHWA 4Q48A 1SC7A 2BBYA 2BXZA 3KZYA 4MGRA 1IV6A 2P6TA 3Q0UA 1HQCA 2ETHA 3I9V2 3SZTA 4KUMA 2FNPA 1GLNA 2M7AA 1TW2A 2VBXA 4I0BA 1IRGA 1WJBA 2EWNA 3F3XA 3KIOA 1DGWY 1D8KA 2VJIA 4IXAA 3CMMA 2FSWA 2NVQJ 3SFIA 1ZR2A 3BG6A 2JZYA 2XAFA 1TLHB 3DEUA 1DU6A 3TL4X 1GUUA 4ETSA 3QRFF 5ICFA 1I5ZA 3CC4I 2FNAA 2LNBA 2E2HJ 2X1EA 5IPAA 3BWGA 4ZYEA 2Y69H 5IYDJ 1OYIA 2R7RA 3ULQB 3WG7H 4XK4A 2GXGA 2JA8J 4M71A 1IXCA 1D0XA 1A35A 1YE9A 3W6VA 4HQMA 1WH5A 1T08B 3I58A 3BCBA 4RGUA 4C9YA 1T56A 5L3DA 2HDCA 5DD8A 2CFOA 4CCNA 4XL9A 1ON2A 4E7LA 4CCMA 2IVMA 4XBFA 2XAUA 2ZSHB 1LB2A 3L9FA 2MA3A 4BQNA 4Y7NJ 4G94A 5D6EA 3QU6A 3NARA 2F5FA 2GQQA 3VOEA 2VONA 4F52A 4FISA 2LH9A 2L4AA 4I01A 1WGXA 3V7SA 1YI2I 1FBQA 4XORA 2NVXJ 1LFPA 2KZGA 2ESNA 1WVRA 4HYEA 1SANA 3RPUA 4ZH4F 4E4HA 1SVOA 4P9FA 1HW1A 4MNUA 4EM1A 1TWAJ 1BIBA 2V1XA 3VYTB 3CF5F 1K6OA 1D0YA 1EV7A 2DLLA 4HF0A 3TDZC 3FXMA 4TV7A 1Z05A 2MW8A 4AIDA 1MMGA 5IT9K 3NQOA 5FD6A 2E36A 3I54A 3OS1A 5EYRA 3M4OJ 2ZXIA 2RNGA 3F8CA 2PMZA 4XKBA 3ROUA 3SQNA 1RRJA 3FBNB 3X2QH 1S7EA 1YX3A 2DA5A 3HZJA 5FO5A 3QOPA 1TNTA 3OIOA 5FKKA 2XVCA 4MHGA 3TO6A 1Q1HA 3QU3A 5A2QZ 1XDUA 1T95A 2Q1ZB 4HAMA 4XKVA 3G1OA 3HB9A 2MFZA 3M9AA 1MNDA 1SFKA 5KHDA 1F1ZA 4XNFA 2GIZA 4BBSJ 4ENNA 2AQFA 4LB6B 2V1DA 3PFYA 4B09A 2DMPA 4LG0A 1K78A 3R0JA 3BR5A 4II3A 3CJNA 4YG2F 5IYCJ 1YYVA 1E0EA 1AA7A 3JRCA 2R5ZA 5LRRA 2QQ8A 1OPCA 3L2QA 2FUG2 2F5EA 2XSDC 3PIPF 1G3YA 2DFIA 3FMRA 2PMHA 2M3AA 2HTJA 4EJOA 1E2XA 3VB2A 3WU2C 1D8JA 5LHIA 2W57A 1U5TC 1UFMA 4FQGA 3F6OA 3U9GA 2CV1A 2IA0A 1H88C 2KZVA 4ZZLA 1ZGJA 4RGRA 2E1CA 2MSYA 4MEYF 2FA5A 1Z0XA 2JTVA 1HKTA 5ICEA 4B48A 3GCMA 2DK5A 2LY2A 5F27A 3U2RA 1RKWA 3IRRA 3G73A 2IA1A 2EV6A 4N9HA 1JKQC 3IRQA 2R7ZJ 2AXTC 4Q47A 2E34A 2E2JJ 4KJZA 4IRHA 3LSPA 3IH3A 3WG9A 3Q0VA 2KIMA 5E1WA 1ZLJA 3VYUB 3RCOA 2F4OB 2CO5A 1LDJA 1T0FC 1TWHJ 3BQZA 4QTRA 2IT0A 3HTUA 1VQNI 2IAIA 2JA2A 4ZYAA 3ZQ7A 3FKIJ 5BMZA 2HKOA 3IUOA 2WAFA 2HQNA 2K5CA 1FPQA 5TISC 3TQNA 3KYCB 4XLHA 2VUMJ 4M3BA 2XUBA 2Y0MA 3CD6I 5CQGA 1FIAA 2HYGD 2OCCH 1CGPA 3OYBA 2B63J 1OR7C 3ELKA 3K4CA 5EEHA 3IAM2 1HXDA 1XSVA 5HVQC 4IPAA 3VYRB 5EGOA 3OYIA 4U0VA 1WJEA 4OIOF 3GO5A 2ZO4A 4PJNA 3OOUA 2NOJB 2YS9A 2R7QA 3DKYA 3V4GA 5J1YA 1ZAOA 1LNWA 4RLFA 4P1WA 1H8AC 2W24A 2KIQA 2LBFB 3L2RA 3S2DJ 5LHGA 2DBBA 3TOBA 3J80K 1Y6IA 1HSTA 2E35A 2XDVA 1T38A 1RETA 4A3KJ 2QCOA 2UWMA 2DOFA 3DLAA 5GADJ 5EEAA 5D8LB 1W36C 1TC3C 2DT7B 3CP2A 3E3VA 4WF2A 4XKWA 4KITB 2TRTA 3HPGA 1WJAA 2DJIA 5F08A 4CCOA 2IGOA 2OV7A 3S3OA 4JQFA 4IF4A 1Z91A 4CXFA 2JWTA 2ZBKA 1UG0A 3DBHB 1ZK8A 3F8NA 4MQ9F 4ESBA 2XV4S 4MEXF 2ECCA 3MKYB 1I3QJ 3HOXJ 4AIKA 3A0HC 2O5RA 1S5LC 4YFKF 1A36A 5DCFA 3ABUA 1U9NA 1R4NB 5IY5H 1FT9A 2LYCA 3TW6A 5BQTA 3DTEA 3M8JA 1STZA 2V1UA 4F55A 1MMNA 3GLLA 2YPRA 2ZB9A 2LY1A 3IHUA 3BTJA 1VF9A 2X4HA 2L4MA 3A02A 5ILSA 3ZP5A 4HLYA 1DP7P 2VBZA 1Z67A 1ETVA 4XR6A 3F0CA 1BC8C 1P7IA 1OMIA 2EFQA 3P5JA 3F22A 2ICWG 2VJJA 1X1AA 1QZEA 2A05A 2VN2A 2Y48A 1JUSA 3BJOA 4PJMA 3RDIA 3W2WA 4EMSA 3WTXC 1WZ2A 1SAXA 1R5HA 2BVLA 1AKHB 4ABZA 4ON0A 1XGMA 2DPUA 4NC8A 2JUCA 4PJ0C 2R7TA 1J09A 1XMXA 2K9SA 2KLOA 1HLVA 3M07A 4X6AJ 1ZTRA 1F36A 4A6DA 3ONQA 4ANJA 2OTJI 4PGHA 3CCSI 2PN6A 4JP0A 3VSLA 4BHCA 1W7PA 5H6QA 1IN7A 1G3WA 3H9JA 4CO8A 5HNFA 1UAAA 5CLSA 2STTA 5FKNA 3AG2H 3IKVA 5KNLA 4IQJA 2LREA 1FLIA 1Y56A 1JI8A 3PNYA 1W5SA 5JI6A 2Z33A 4ENMA 2XROA 1JE8A 2FJ1A 1MMSA 3FK6A 4FETA 1VQMI 1FBSA 1HSJA 1APLC 3EYYA 1L3LA 2F2EA 4Z2YA 2IGKA 3WHBA 1MW7A 4IHWA 4HDUA 3PO2J 3FHNA 3ZMDA 3ZMTA 2KDOA 3HOYJ 2XC7A 1SVLA 1POGA 1RUNA 1WRJA 3JAMZ 4IJAA 1VFCA 3GWZA 1U3EM 4E7SA 3LSJA 4WXCA 3G6EI 2K4BA 3HUGA 2MGQA 3LL7A 1MH4A 4KDPA 2RVCA 1VQOI 1QVTA 3BTLA 1ETYA 1YLFA 4BJ6C 2F6CA 4FE4A 1A04A 1B8IA 4KT5C 2Q8KA 4R8HA 1B72B 2DN0A 1JT0A 3F8FA 1Y1VJ 5LHHA 1D0ZA 3E6MA 1ENHA 3VWBA 5ILUA 3UR3C 4HOBA 3P9KA 1J7KA 2N8GA 5KCMA 2JT1A 2KFDA 5CPRB 4MFEA 3GFIA 2XGEA 3RYRA 1IAWA 1G8XA 2PMZN 5A2QK 1RC9A 2QSHX 4IHTA 3IH2A 3CCEI 1P9QC 3MZYA 3MD2A 3TDUC 3OSFA 4N4OB 5KAFC 3CCYA 2HU9A 1Z7UA 5EZHA 2L9RA 1FOYA 2W85A 4YIFA 1LPQA 1R7JA 4XLNF 1XMAA 1LE8B 2QZ8A 5H6RA 2NXNB 1AHDP 3FXLA 2BY3A 3I5UA 3JSOA 4R79A 3QP6A 1YJWI 1BI2A 2DYRH 2FX0A 2E1OA 3M8FA 3HOTA 4AM3A 2DJNA 3RKWA 1L0OC 5EG0A 2L54A 1R36A 2RN7A 5J4YA 4E7KA 1X3WB 3B73A 3WE2A 1TQMA 2YUSA 3F23A 4A3EJ 5AONA 2DT6A 3RKYA 2DT5A 1IW7F 2QQ9A 5ED4A 3BROA 4B47A 5D5XB 2I10A 4YEJA 2BW3B 4HEA2 4HF2A 3GMEA 2V26A 1BJZA 4BXXJ 1T2KA 2Q2EA 1FOKA 2IS2A 5D6FA 1YG2A 3HEFA 4CYCA 4NC7A 2HQRA 5E17F 3I3LA 4F3QA 1TQIA 2EIKH 1ONVA 2XB0X 3H9QA 5LRSA 2QBYA 2XGXA 1WI3A 1B4AA 4E70A 3CCMI 2RC4A 3AG1H 4IVNA 2NVUB 3C1DA 2PJRA 4P55A 1WFXA 3DXJF 2LD5A 2O8KA 4AIHA 4PUSA 3FIWA 1HC8A 3TO9A 3UNGC 3MMYB 1BJAA 1JUPA 5IT9Z 2X48A 2DA1A 2DTZA 3MEXA 2NNNA 3DLLF 3LAPA 1F5TA 4PFPA 4MLOA 1I1SA 3WTVC 1OCOH 2R7DA 5M5WJ 3C2HA 4P9UA 3R4KA 3A0BC 3HSRA 2FOKA 3LWFA 3G71I 1KZHA 2WA0A 1X19A 3KEOA 1QQIA 4GYIA 3RZOJ 3N05A 2CS3A 3KX2A 4D0PA 2H27A 3DF8A 4HX4A 4RAYA 4HF1A 4O3MA 1I3AA 2MC4A 3GTKJ 1KYZA 2DI3A 3MKLA 2E5NA 3ZMZA 1YJNI 4BEHB 4RB0A 1ETXA 4XKCA 2K02A 3IP4B 4LB5A 4YELA 2XASA 3AL0C 1G3SA 3QQAA 2X1DA 3E5QA 1TWCJ 1P6RA 2DFFA 1USTA 1U0JA 3IV5A 3R6SA 2QKMB 3HOUJ 1XB4A 3J7AO 2DYSH 4IZZA 4BH9A 1O7LA 1X4OA 3CCRI 1TZLA 4V2GA 1ZGWA 1CF7B 5CJ9A 2VC0A 1PP8F 2PFBA 2HVRA 2JA5J 2EZHA 5E3LA 3BG5A 1AKHA 3QODA 2A6EF 1ORKA 1VZ0A 5BPDA 2IJLA 1BBYA 1LUJB 3H36A 3BLYA 2M45A 1E3OC 4BXFA 3DBLB 2EH3A 1I50J 5L3GA 2FOWA 2WY8Q 3RSNA 2RAEA 1WI9A 1W0UA 1FBUA 2LKSA 2G0EA 2K85A 2VKVA 4OIPF 4UHTA 2P6SA 3JSPA 4KIBA 1SFUA 4C3JJ 4Y4RA 2RV8A 2W82A 1FJLA 4JK1X 3WU0A 4CYDA 4RAGA 1FYMA 1SVMA 1H9TA 4JOMA 4P5OA 2QKLB 3LFKA 2ME0A 4KN4X 2BVMA 3GZ5A 3HM5A 4UV9A 4BGDA 3BZKA 2W00A 3O8GA 2L9VA 2OAZA 4L5EA 2LKPA 5E1ZB 1GVDA 2CQQA 4RAZA 4NQWA 4ASNA 1BA5A 3C3WA 5D8KB 5FLVA 5FD5A 1XPXA 5FRNA 4MO7A 1MMAA 3RZDJ 3H3ZA 2Z2SB 3JAMK 2FMYA 2K3PA 2A3SA 4HNVA 1Z7LA 2CGPA 1K79A 3D1NI 2M2EA 1ETKA 3LA7A 5EDNA 2FQ3A 3DKXA 3QWLA 2LKXA 2E1MC 4A0XA 1Y8RB 4DBRA 3K4BA 4LMYA 4BXUA 2Y9YA 3EUHA 1R49A 2HDWA 4UXNA 5F0CA 3M8EA 2L5QA 1KA8A 2L01A 4WXDA 1WQ2A 1IXSB 5CYVA 3JRFA 1WSUA 3ASNH 1MJAA 1XDSA 2ZC2A 1F4KA 4GYGA 5EF6A 4XONA 1OCPA 2R3SA 2OZ6A 4CCJA 1Z6RA 2ZJPF 4IHVA 4OAZA 4XRSA 2QQAA 3S1MJ 3CC7I 2EA4A 2DMNA 4LLLA 3O6BB 1VQPI 1MZBA 1MSFC 2VQCA 5D4SA 4U0YA 5H20A 1IJWC 2NOGA 2AHQA 1VQ9I 3A01A 4L9TA 3KLNA 5DTDA 1W5TA 3TEDA 2LSOA 2ZNZA 2AQEA 2M0CA 2CJJA 2Q0OA 3IC7A 3K4KA 2CQXA 4IRGA 2FMLA 2G7UA 4KNYA 2DFEA 5HOOA 4LK0F 4D7NA 4DOZA 3D5SC 1VQ8I 4HLXA 4A2UA 2XAGA 3RPQA 3OYGA 3WTUC 1I6HJ 1NHAA 3JREA 4IHSA 2QLZA 4BQAA 1W5CC 4H0EA 2PI0A 4BACA 4PGGA 4YFXF 3E6CC 2BV6A 4L0ZB 3S2WA 3A1YA 2MG4A 4NBQA 5FRMA 4L0YB 2P5VA 1P4AA 3IL2A 4I02A 1Y8QB 2A61A 4YFNF 5AIQA 2R5YB 1PUFA 3OSGA 5F6FA 4AWXB 5K7ZA 3KE2A 2DQRA 2VKDA 4JBAA 1QA6A 2IP2A 1EF4A 1RKTA 4F93B 2QSFX 5M5XJ 4IKFA 2DU9A 2K40A 2WV1A 3BG3A 2EPFA 3HXLA 4HW0A 2K3FA 3E6DA 2R93J 3CZ6A 3K6GA 3LAJA 2HI3A 1X1BA 3UKGA 5FKOA 2HOTA 3PUBA 1N25A 2HFHA 5D5UB 3K4LA 2R7WA 3HOSA 3RYPA 1BOBA 4NNJA 4XOPA 4BQOA 5BOXA 3U1KA 4CCKA 4HSTA 4XLEA 4D5FA 3S1RJ 4AYBA 3TP3A 2XF6A 1BR2A 4G7HF 3MWMA 2IS6A 2QENA 4HRIA 2HPMA 3I56I 4UUSA 1VQKI 1ETOA 4BUPA 1ZN2A 5JFRA 5J6XA 1UELB 4NUBA 3KP6A 4EM0B 3F9KA 3A4CA 4CCLA 5FLXK 1RPWA 3ESWB 4ESFA 3PSFA 3JRHA 4PZJA 1X1DA 3VYSB 1MDMB 2Z5UA 1ZYRF 4OOIA 2A6HF 3C7JA 3HKZA 1XD7A 3BQYA 1D5VA 4M72A 4UB6C 2M8GX 3I0TA 2P7CB 2KMUA 3NWSA 3BG7A 2EJRA 3MQ0A 2DA4A 3ZMUA 3BCAA 2PMUA 2ELKA 5DCMA 3FZVA 4KMUX 3FBIB 1RZ4A 3ERED 3BG9A 4A3LJ 4KICA 3WTTC 3CUQC 3WTSC 1ZG5A 2B9SA 2D45A 1YTYA 3K70C 2DA7A 5BNGA 3H9GA 2ADUA 1PP7U 3CCQI 1AOYA 1Z1DA 5F64A 5K5QA 3CESA 3MN2A 3DCFA 2LTPA 5GAEJ 1HCRA 4OWRB 2VPLA 2ZFUA 2IGNA 3E5UA 4C2MJ 2ZNYA 1MMDA 1HKSA 4M6YA 2XB5A 3S32A 4DGWB 4E7JA 3E97A 3I59B 2M8EA 4UY8I 3CO7C 1A31A 4CZZA 4E7IA 2BY1A 3M1EA 1BW6A 3S15J 3A2KA 3Q9SA 3WTWC 4LIUA 1FOXA 2HZDA 3KP4A 4Q4ZF 1FMVA 1S72I 4A3DJ 1ZREA 2HTSA 1Y0NA 1ZQ3P 3H92A 4I99C 2GXAA 2MC3A 3IWFA 4EEFG 1Z3YA 2CQNA 1YRNB 1LDDA 5JLXA 4YRVA 4EJTA 1HOMA 1EH7A 1ODDA 4BBRJ 4J19A 3CDIA 1LVAA 3SEZA 3SYTA 3DKWA 2YU3A 4DIQA 2OC6A 4RDUA 3KCCA 9ANTA 2W25A 3OIQA 5DYMA 2XHKA 2XAQA 1XTAA 2ELJA 2OQRA 4ZYHA 3E0JB 3I64A 3GTGJ 2ELHA 2GLOA 3G2BA 2LY9A 1WJ5A 2V9VA 2DW4A 3B6CA 5JVTA 1IRFA 1P4XA 2VT3A 1KONA 2XPVA 5E8IA 3T8TA 2MABA 2KKOA 2V6EA 1BI3A 2JUGA 4IO9F 2G9WA 4BY7J 2HQ5A 3KEYA 4H4KC 1WJFA 3PO3J 2WY7Q 5DD4A 2JVHA 4PSXA 4L5IA 2XAHA 2ZMEA 2ZJRF 1G3TA 2RDPA 2KIUA 1T6SA 1R22A 2MD0A 4A69C 1X1CA 4A3FJ 3EUHC 5LLQA 2WB1A 3BR3A 3ZMSA 5GPAA 4R1HA 1OYYA 3R0AA 2O61A 3CJTB 4HNUA 1O4XA 1H9GA 1T98A 4C3IJ 3D0SA 3VDXA 4RGSA 2CU7A 1QBJA 1V5EA 2IXSA 4G6QA 4C2TA 3I4MJ 3R60A 1O3TA 1UZCA 5HS7A 3U21A 5E8GA 1D5YA 4RBOA 2UXNA 3HGYA 5HLIA 1SEUA 2EINH 1OCCH 2MYSA 4G7OF 1TW3A 3K4MA 2D2WA 2RQPA 4DYRA 2ISYA 2P5KA 3CMYA 1VQ4I 4I0AA 5GTHC 2E2IJ 2CW0F 1ZARA 3CJRB 3BZCA 2UXXA 3CDLA 5B66C 4BDYA 2M4KA 1NH3A 2OA4A 2YX7A 1Z3XA 2WWYA 4IOAF 1ON1A 2RNJA 1P92A 2O7OA 3G1LA 1GXQA 3ZN0A 2EA2A 3O2PE 2IA2A 5TRDA 1S7AA 2C6YA 3WGIA 3MZHA 4GFBA 1BOAA 4UB8C 2DTRA 2BGCA 4RAFA 3J7YJ 1HA8A 2W1OA 2GXBA 3FXQA 1QO0D 3T0YA 3RI4A 5HDGA 1VTNC 3Q9VA 1FYLA 2QQBA 3JRDA 3L2CA 1U78A 1KQ9A 3DEEA 4XRFA 3OYLA 4G12A 4N0BA 2JN6A 1KQ8A 4WX9A 2BXYA 2VQGA 1U8BA 2Z99A 1X2NA 2EZKA 3ABKH 1DU0A 2HEOA 2H6BA 4BQQA 5CQEA 3LSHA 4M9SA 5F1RA 5BPIA 2XRLA 1EH8A 4S05A 4G9YA 3BZ6A 3CO6C 4LOCA 2EV0A 4BL0B 3BPXA 1QZYA 1A6IA 4A3MJ 3QPTA 4EATA 3S1QJ 2CV0A 1QRYA 4EJVA 2HWVA 2JRMA 4CICA 3SFZA 2GIVA 2OQGA 1FMWA 1DDNA 4XLCA 1YITI 3K7AJ 5ICCA 1USSA 3O8HA 1R9TJ 3FKJA 3BJAA 1KU7A 5TJJA 1IUFA 3TO7A 5BS6A 4EV0A 5FFZA 3ZRGA 1LVKA 3HGGA 3LA2A 2CV2A 2LFBA 2FQ4A 2LDUA 2JQ7A 1Z6TA 4RA2A 2JVGA 5J40A 1MGTA 2Y9ZA 5E3MA 1U5TB 2BY2A 2F5DA 2L9NA 2DO7A 3KP7A 3S2HJ 4RB3C 1GV5A 3JTHA 3NWTA 1J59A 4WCGA 4II2A 5C3EJ 4B43A 3AFHA 3G1MA 1JGSA 3SDGA 4S0HB 3MFKA 3CMAI 3GTPJ 4AYBN 1QNTA 3M3YJ 2KRHA 4FCYA 4M6XA 3DQVC 3RQ4A 4DYQA 1FC3A 3RIRA 3I53A 3WU1B 4OINF 3DV8A 1LEAA 2X1CA 3B6AA 4XICA 2HS5A 5C4JJ 3CLQA 2FEZA 5IT3A 2K27A 4LK1F 1YX5A 4A0YA 4XLPF 3N4MA 2BYVE 3NRVA 2EIJH 4ZYGA 1PDNC 2B7EA 2CH0A 3K1NA 2WV0A 1IDYA 4ZC3A 3HKZN 2OPTA 3OYNA 2JSCA 4DJAA 2IGMA 1BC7C 3GEZA 3AG3H 1RESA 1X4PA 2NS7A 2EBIA 4C30A 2HXIA 3GX4X 5IOYA 3OYFA 2EFNA 3I59A 3V8JA 3SZGA 5D5WB 1MKMA 2EFWA 1W1WE 2HXOA 1FZPB 3PIOF 4QIWN 1B59A 5IOZA 4ZDPA 1ACIA 2L02A 1C0WA 3H5NA 3LSGA 3VEPA 3OL3A 1F9NA 5FJ8J 1B9MA 3HHGA 4GCVA 4LD5A 2OF7A 3CC2I 1T8IA 3PJRA 2PLYA 1SFEA 2VJ5A 5GAHJ 5HNHA 5CKTA 1UMQA 1DUXC 3H5RA 2VLAA 2V9PA 2BHYA 4ZYDA 2FXAA 1JUMA 3V8LA 4BU2A 1B9NA 1CQTA 2P4WA 1I39A 4L18B 1TQPA 2L7KA 5E18F 2VT2A 1FNNA 3L1PA 2VC1A 1FWZA 4A3IJ 3HOZJ 1OFCX 1QHGA 3ECOA 2IPQX 3DPTA 3ZQGA 1IGNA 3LOCA 4KIFA 1JTXA 1SD4A 2QF7A 4GGGA 3S1NJ 3HG9A 1R1VA 4M6VA 2HVSA 2WTEA 2BOLA 1S29A 1IUYA 1MBJA 3BR1A 1I6XA 2A68F 5LGUA 1ZG3A 5E1XA 2HYJA 3GZ6A 1R5ID 3EETA 1Y1WJ 3WE3A 3J81Z 3AG4H 1NK3P 3OOPA 2ZMEC 1MBKA 3G3ZA 3QYEA 4MFDA 1BL0A 1GT0C 5E20A 3KETA 2KISA 1ZGAA 1D1AA 2DMTA 2RGVA 3COAC 3HOVJ 5TGTA 4AUXA 1M1EB 3K1MA 3FM3A 2MLKA 4KT6A 1Y39A 1FIPA 1SMTA 2V1NA 2Z3YA 3SEQA 3TOAA 5FLXZ 1UHSA 2CUEA 2GBYA 2E7WA 5K5OA 4ENKA 4XRSG 2L3DA 1J0RA 2ZSIB 3FM5A 5F04A 2LBFA 3DP7A 1XC5A 1LDKB 1MBGA 3H3VK 5KVRA 2ZCWA 1EA3A 4A93J 2L7ZA 3FHZA 2VL8A 3KEQA 3K69A 3ZGKA 4L9VA 2ESHA 1RR7A 5D5VB 3CCJI 3QP5A 1MBFA 2NS8A 1VI0A 1YW8A 2P8TA 1BI0A 3SHFA 1V5GA 3PQKA 4W97A 2YU9J 4MTEA 5DEQA 1B6AA 2PJPA 1V3FA 1N75A 4LLNA 4FT8A 2LF7A 4KA4A 1O3SA 1HDPA 3HDDA 3A03A 2GA2A 3HSEA 5DM7F 3R61A 2BHZA 3GYHX 4U0WA 1B1BA 4J00A 4CA0A 4FASD 5GPCA 3ZCOA 1S6LA 1XMKA 2ZFWA 1ZRFA 2ACJA 3HC7A 1QZZA 1WKMA 2YX4A 2W84A 4A6EA 1VQ7I 6PAXA 3ISPA 1ETQA 4IL6C 4HNTA 3S3MA 4HDVA 1GVJA 1IV8A 2OD5A 4ZJZA 4GO1A 1TL8A 2JMWA 4DZJA 4GDFA 4CHUA 1RNLA 3K4JA 1N77A 1FSHA 3HBLA 1ITYA 2AXLA 2HVQA 1WJCA 4LJZF 2LP0A 2FU4A 3ECHA 3Q0WA 5ILVA 3OY9A 2L7FP 4XM3A 5J3LA 5HS9A 3BDDA 3FDYA 2IS4A 4LG0B 4RB1A 3V42A 1ZRCA 4I6ZA 1K78B 2LR8A 3L00A 3FX3A 1MJBA 2AO9A 3D5RC 2CUJA 2ZJ2A 3RTRA 5HODA 3E7LA 3G4SI 2R5ZB 2IEKA 2KJCA 1QPMA 3KZIC 5HLHA 2VB6A 5IP9J 3CMEI 2M9HA 3GLXA 2PQ8A 1LEBA 2MD5A 2HR3A 4J01A 1KU3A 2CW7A 2F4IA 3BJ6A 2WC2A 3BTIA 1JKOC 4BDZA 2F5CA 2A6TA 4XN0A 4AD9A 3MKZA 5L3EA 1YS7A 2E1NA 4UUTA 3CQZJ 2R7XA 4QPQA 1NG6A 1S8NA 1QPIA 3WGGA 5FROA 4ZZDA 2R0QC 2CMPA 5C4XJ 4M3DA 4HZFA 3SDBA 2JRTA 4BY1J 3ZQHA 4E7HA 3OYEA 4CH7A 2HQAA 3ZQIA 1NTCA 1WWXA 3H1CA 2V7FA 4I7HA 4OMYA 3N97A 2X9DA 5LGNA 3WTZA 3ZQLA 2R7OA 5AIPA 2Y2ZA 1JHFA 2EZLA 4UVBA 1B72A 1XSDA 2MH9A 4QLCU 2OBPA 5KK1A 3ZOBA 1I27A 2XKOA 2LG4A 1Q1VA 3OYHA 1TTYA 2KT0A 1KU2A 2NVYJ 2CFXA 2XIGA 3HHHA 2WBMA 1GDTA 1NK2P 4JX6A 4F92B 5K5RA 5K7FA 1FTTA 2GAUA 1R6RA 2CUFA 4BE1A 1ZRDA 1S3JA 4RLQA 3ABMH 3C2GA 3LSMA 2K9NA 3K9TA 1FOWA 5EGOB 3D5LA 4IOCF 2DFHA 5L3FA 5B1BH 3RQIA 4U88A 3S93A 4LLGF 2P81A 4KIGA 1P4WA 3KZZA 1E3PA 4IHXA 3MCZA 3LQQA 2E5ZA 4OMZA 2IBDA 2LMDA 2P5LC 2DODA 1JT6A 3FMSA 4RB2C 4ESJA 1LE8A 4Y3OA 2TCTA 4D1QA 4ZTJA 2UZKA 1RUOA 4C3HJ 1U8RA 4PJLA 2CQKA 2ID3A 4U87A 4K2EA 3GUDA 5EJCA 2VOOA 4DQ2A 2IRFG 3DFGA 1J75A 2HKXA 4UUVA 1S7OA 4G7ZF 4BE0A 3S3NA 1XSXA 4YIIA 3ZMVA 2VBYA 1BR4A 3GFMA 2XAJA 1FP2A 1Z21A 4EJUA 2R92J 1N78A 1YQAA 4HPQA 5CVRA 4BYYA 3LSRA 1YIOA 3MKWB 3JW4A 2A07F 5KAIC 2W7NA 1S9HA 2CW8A 5B5EC 2BW3A 5FB2A 2RREA 5E3NA 3LNQA 3HRUA 4MQVA 1K61A 1H89C 3E1SA 2MLGA 4E6KG 3H0GJ 3F6VA 4GRIA 1JKPC 1HW2A 3GXOA 1TT5B 1ZG1A 4C2UA 2CYYA 1O7FA 1OYWA 2DOAA 2YR2A 3AL0B 1D3YA 1I1GA 3KP2A 1KGSA 3REOA 2ID6A 2Z1DA 1X2MA 1V5FA 2J5PA 2H1LA 3J81K 3ABLH 2H09A 4UVCA 2VXDA 1P7JA 2COBA 2HGCA 4G8XA 1QHHD 3V7CA 4UV8A 2F4MB 2D5VA 3DTKA 4XQFA 2LVSA 3KFWX 4BJTA 2DQLA 2FBKA 2MBFA 5JHFA 3OYJA 5IP6A 5CVJA 5FGMA 5JLWA 2F5VA 3LFUA 1OISA 3K2AA 5H2FC 1EKEA 4CSWA 3SZPA 3QPLA 1IZ1A 1YW7A 1W7PB 2HNHA 3MZ8A 4AU7A 1HKQA 3HPHA 3RJPA 4XSZF 1RR8C 2PG4A 2DA2A 2KP6A 2L7MP 1U6GA 4MIMA 1IRXA 4PDKA 5CVVA 4A3CJ 3DPLC 1X3UA 2PBIA 2X0LA 5J8CA 4RMNA 4QWQA 2DOEA 1JJ8C 2CG4A 2PEXA 1R1UA 2H6CA 5GP9A 4XLFA 2KQRA 2L0KA 1PJRA 1K4TA 1AWCA 3S8PA 2FBHA 2GZWA 3HTSB 2XSJC 3DU6A 2VIXA 3HSFA 1LQ1A 4CDGA 4BEHA 3W6KB 3H35A 3BPVA 3KLOA 1VQLI 2VE8A 1OQYA 2X6OA 3GZNB 2WAQA 3NAUA 2FRHA 5EZGA 1VNDA 2R7FA 2VASA 2KL4A 3HUGB 2EQRA 4B8XA 2Y75A 3FISA 4FHTA 4UNOA 3JRGA 1YFHA 4L9JA 4AC0A 5GTIC 3GVAA 1LJ9A 3K2ZA 3V8KA 4EM2A 1HDDC 4DNCA 1W4MA 3CDHA 4DW6A 1VQ6I 2HDDA 5F0HA 1B8IB 1CF7A 2VQHA 2TDXA 2VKHA 4ZTFA 4X1EA 3BP8A 1JHHA 2M87A 4BHPA 1K4SA 1IN5A 2ZKZA 1LKXA 2KPMA 3CJQB 4W1UA 1F43A 1YW9A 2E1MB 2LLKA 3LMMA 1FTZA 4KN7X 4F7ZA 1FSEA 1BN5A 2EFPA 3K70D 3FK7A 3PSIA 4I98B 2GOMA 3I71A 4B4CA 3J7ZI 4NDLA 1XCVA 2M0MA 4EGYA 3S16J 1DPUA 3IAS2 4HQEA 1ZKGA 2W48A 1X1PA 5FKMA 3GTOJ 1BM9A 3DU5A 1G6NA 2BE5F 2QUFA 2M34A 5L3CA 4WXHA 3QPHA 1BI1A 2M1BA 2R7SA 3VODA 1MH3A 1O57A 2MH2A 4V2FA 1HBXG 3OYMA 2Z9OA 3U1DA 1QU3A 2G7HA 2K7LA 4RM3A 3OL4A 2UV1A 1G59A 4IHYA 5J4VA 4ENJA 4HG2A 3FXRA 3ABTA 1K7AA 3ERMA 3E5XA 1P2FA 5M3MJ 2OCEA 2K9LA 4JX4A 4A5NA 5EG0B 1QGPA 2CSOA 5IYBJ 2H8RA 2KDZA 3V7RA 2NRAC 2CRGA 3S14J 1LFBA 1IRZA 1MNEA 5LEKA 3ZXSA 1PVEA 3KP5A 1IN6A 1UJ8A 4E7ZA 1IDZA 4KISA 3MVPA 3OIPA 4G6TB 5L3BA 4NB5A 2V4JC 4BAYA 3HL2A 1A5JA 4M3GA 2COMA 3GTJJ 1ZH5A 2R7UA 2STWA 4D7MA 1GXPA 1GHCA 2GA1A 2Q2EB 1JTYA 2RQQA 4M3FA 2X51A 1QVUA 1ZR4A 5J1UA 1JXSA 4HV6A 2LK2A 2JPCA 2O3FA 2YSRA 2P0WA 2PX9A 4WWCA 2DK8A 4CYCB 3ZPLA 1MSEC 1WCMJ 5HLTA 2QBYB 5JHUA 2H1KA 2PJRB 1T39A 1YIJI 4I2OA 3ZR8X 2VI6A 2BY0A 2K4JA 3ZQCA 2Y31A 4V19K 2ZXWH 4BS9A 3FXOA 3TP0A 3L09A 2EV5A 5JVGF 4NC6A 3BR2A 2O9LA 2KRFA 1XX5A 1OCZH 2KHMA 1OCTC 1UG2A 4D5CA 1REPC 4BKXA 4GXOA 4N9IA 5E79C 4MTDA 4HSRA 1R00A 3VSKA 1UCRA 4AVPA 1GV2A 3PM1A 2J5OA 1TT0A 3CUOA 1OJLA 1G4DA 3W6JB 3DEWA 4IX7A 5EEGA 2DMQA 3OYDA 2Y0SA 1W36D 4IEJA 4WK8F 4I76A 1MIJA 2EK5A 3IKTA 1TP4A 4LITA 2R5YA 1XG1A 1R1TA 2M30A 5CVUA 4JX5A 5K7HA 3JRBA 2DMUA 2CQ7A 3QAHA 4JYKA 2LF8A 3CF2A 1MBEA 1YO5C 4HA8A 4HV5A 1ERDA 4LFUA 1DGRM 4BNCA 3CUQB 3M1CA 1HW5A 1V55H 1WHUA 2R4GA 3JTGA 1Z9CA 4KMFA 2VPRA 2EZIA 1XS9A 3FXKA 3GFJA 5HDKA 4CZCA 4KYWA 2L9SA 2B0LA 1EJ9A 3GFLA 3BR0A 3FWEA 1HF0A 4N4NB 3HRMA 4YIRX 4LG3A 4B1RA 1R58A 3BOQA 2XGCA 4Y33A 2QM3A 1Z77A 5DUKA 3W3CA
chains in the Genus database with same CATH topology
2V6CA 1SMYF 1UHMA 4LGWA 1BIAA 1MDMA 2DPDA 4IRIA 2O03A 3GF2A 3KP3A 3MAJA 3F8MA 4L5JA 1IF1A 1J2XA 1XCBA 3HRTA 4O6JA 4HX7A 2P7VB 2O8XA 1O3QA 3WGHA 2A5YB 5DDGA 2NS0A 3NEUA 3F72A 4BHBA 4O5VA 2XKPA 4Y13A 4EGZA 3FXUA 3HYIA 1SFXA 5LEJA 3FF5A 2ZXJA 3F8BA 4EVIA 2D1HA 2AS5F 3FMQA 5K1YA 3WODF 3I4PA 2A69F 2JPBA 5J8FA 4RS8A 1TBXA 3T1BA 4OIQF 5FFXA 1J9IA 2OU2A 3EYIA 1IXRC 3T5XA 1Y0UA 4Y15A 2HYFA 3LA3A 2DAOA 1FX7A 4Q5SF 3P9IA 4A5MA 3M7GA 4CGZA 4NHJA 3ML6A 1FP1D 1OKRA 2OZUA 4UVAA 4FX0A 2RKHA 5LBQA 1XGNA 2XRNA 2O0YA 2NYXA 5JR3A 4HBLA 1RIOH 3K1PA 2VE9A 3CLOA 3K0LA 3RKXA 1EH6A 1J5YA 3EDPA 2E7XA 3PQJA 1KQ0A 2VXZA 5ERIA 4AIJA 3P7NA 4XSXF 2H94A 2NAZA 1IN8A 1E17A 3LQRA 2IW5A 5LGTA 1XN7A 4KFCA 2HOEA 4U7BA 1MJ9A 4I09A 3H3UA 4PCQA 3L7WA 3EQLF 1R5GA 1SD5A 3O3KA 4L9NA 2HZTA 4Y17A 2VBWA 3BY6A 2VOPA 1ULYA 5D4RA 5DUIA 4P96A 1XGSA 2QYOA 5DCMB 3Q5FA 5DV5A 1PUEE 3LSTA 4EQQA 2ISZA 1V4RA 4FX4A 4M9ZA 3AAFA 3CUQA 4U7DA 3HIFA 4M9XA 4G6DA 1O3RA 1H0MA 2EB7A 3ZN1A 1R23A 2FF4A 5HS8A 1XGOA 1SD6A 2BEOA 3CTAA 2FBIA 3GW2A 3C18A 4A0ZA 3IWZA 1KYWA 1U5TA 1TNSA 2EFOA 4RGXA 4M73A 2FE3A 4OU0A 1W7PD 4HX8A 4EJWA 2QVOA 1IN4A 4OIRF 5ICGA 1KU9A 1SD7A 2VODA 5CVIA 3HRSA 1T0FA 2M5WA 2KJBA 4A12A 2KIFA 3F21A 1FY7A 5HLGA 3E6BA 1UB9A 1MD0A 2ZMEB 1OR7A 3WTYC 2NNYA 2D1VA 3T8RA 2QWWA 1ZHFA 3J80Z 2O6GE 3B02A 4M74A 1ZLKA 3SXYA 1RI7A 2K86A 5HDNA 3VFZA 2CWEA 1YS6A 2GWRA 3TGNA 3PFIA 3OV8A 1DPRA 4S04A 1U2WA 2V79A 1FYKA 3P9CA 3TKYA 4Q48A 1UHWA 2BBYA 3KZYA 4MGRA 2P6TA 1HQCA 2ETHA 3SZTA 4KUMA 2FNPA 2VBXA 4I0BA 1TW2A 1IRGA 2EWNA 3F3XA 1D8KA 4IXAA 2FSWA 2JZYA 2XAFA 1TLHB 3DEUA 4ETSA 3QRFF 5ICFA 1I5ZA 2FNAA 2LNBA 3BWGA 4ZYEA 1OYIA 3ULQB 2GXGA 4M71A 1IXCA 4HQMA 3I58A 4RGUA 5L3DA 2HDCA 5DD8A 1ON2A 2IVMA 4XBFA 1LB2A 3L9FA 2MA3A 4G94A 5D6EA 3QU6A 2F5FA 2GQQA 3VOEA 2VONA 2L4AA 4I01A 3V7SA 1FBQA 2ESNA 4HYEA 3RPUA 4ZH4F 4P9FA 1HW1A 4MNUA 4EM1A 1BIBA 2V1XA 1K6OA 1EV7A 2DLLA 4HF0A 3TDZC 4TV7A 1Z05A 5IT9K 3NQOA 5FD6A 3I54A 3F8CA 3ROUA 3SQNA 5FO5A 3QOPA 1TNTA 2XVCA 4MHGA 3TO6A 1Q1HA 3QU3A 5A2QZ 1XDUA 4HAMA 3M9AA 1F1ZA 4ENNA 4LB6B 2V1DA 4B09A 4LG0A 1K78A 3R0JA 3CJNA 4YG2F 1YYVA 5LRRA 1OPCA 2F5EA 1G3YA 2DFIA 3FMRA 2PMHA 4EJOA 2HTJA 1D8JA 1E2XA 3VB2A 5LHIA 2W57A 1U5TC 1UFMA 3F6OA 3U9GA 2IA0A 4ZZLA 1ZGJA 4RGRA 2E1CA 4MEYF 2FA5A 2JTVA 1HKTA 5ICEA 2DK5A 3U2RA 3IRRA 3G73A 2IA1A 2EV6A 4N9HA 3IRQA 4Q47A 4IRHA 3WG9A 5E1WA 2KIMA 1ZLJA 2CO5A 1LDJA 2IT0A 3HTUA 3ZQ7A 5BMZA 2HKOA 2HQNA 1FPQA 3TQNA 2XUBA 2Y0MA 2HYGD 1CGPA 3ELKA 5EEHA 1HXDA 1XSVA 5HVQC 4IPAA 4U0VA 4OIOF 3GO5A 2ZO4A 3V4GA 1ZAOA 1LNWA 2W24A 5LHGA 2DBBA 3TOBA 3J80K 1HSTA 1T38A 2UWMA 5D8LB 3E3VA 4WF2A 4JQFA 4IF4A 1Z91A 4CXFA 2ZBKA 3F8NA 4ESBA 4MQ9F 2XV4S 4MEXF 4AIKA 4YFKF 5DCFA 3ABUA 1FT9A 5BQTA 1STZA 2V1UA 2YPRA 3IHUA 4HLYA 3ZP5A 2X4HA 5ILSA 2L4MA 1DP7P 2VBZA 1BC8C 1OMIA 2EFQA 3F22A 3BJOA 3RDIA 2VN2A 2Y48A 4EMSA 3WTXC 1SAXA 1R5HA 4ON0A 1XGMA 2DPUA 4A6DA 4PGHA 2PN6A 4BHCA 1W7PA 5H6QA 1IN7A 1G3WA 4CO8A 5CLSA 2STTA 3IKVA 1FLIA 1W5SA 5JI6A 2Z33A 4ENMA 2XROA 1JE8A 1HSJA 1FBSA 3EYYA 1L3LA 2F2EA 4Z2YA 4HDUA 3ZMDA 3ZMTA 1RUNA 3JAMZ 1WRJA 4IJAA 1U3EM 3GWZA 4WXCA 2K4BA 3HUGA 4KDPA 2RVCA 1YLFA 1A04A 4KT5C 2Q8KA 4R8HA 3F8FA 5LHHA 3E6MA 5ILUA 4HOBA 3P9KA 1J7KA 2JT1A 3GFIA 3RYRA 1IAWA 5A2QK 4IHTA 3MZYA 3TDUC 1Z7UA 2W85A 4YIFA 1R7JA 4XLNF 1XMAA 2QZ8A 5H6RA 3I5UA 3JSOA 4R79A 3QP6A 1BI2A 3M8FA 3HOTA 3RKWA 1L0OC 2L54A 1R36A 2RN7A 3B73A 3WE2A 1TQMA 3F23A 5AONA 3RKYA 2DT5A 1IW7F 2QQ9A 5ED4A 3BROA 5D5XB 4HF2A 1T2KA 2Q2EA 1FOKA 5D6FA 1YG2A 2HQRA 5E17F 1TQIA 1ONVA 5LRSA 2QBYA 2XGXA 1B4AA 4E70A 2RC4A 4IVNA 3C1DA 4P55A 3DXJF 4AIHA 3TO9A 1BJAA 5IT9Z 3MEXA 2NNNA 3LAPA 1F5TA 1I1SA 3WTVC 2R7DA 4P9UA 3R4KA 3HSRA 2FOKA 3LWFA 3KEOA 1QQIA 4GYIA 4D0PA 2H27A 3DF8A 4HX4A 4RAYA 4HF1A 4O3MA 1KYZA 2DI3A 3ZMZA 4RB0A 2K02A 4LB5A 2XASA 1G3SA 3E5QA 1P6RA 1USTA 3R6SA 1XB4A 3J7AO 4BH9A 1O7LA 1CF7B 5CJ9A 2VC0A 1PP8F 2PFBA 2A6EF 5BPDA 2IJLA 1BBYA 2M45A 5L3GA 1WI9A 1FBUA 4OIPF 4UHTA 2P6SA 3JSPA 4KIBA 1SFUA 2RV8A 4JK1X 3WU0A 4CYDA 1FYMA 1H9TA 4P5OA 3LFKA 4KN4X 3GZ5A 4UV9A 5E1ZB 2OAZA 2LKPA 4RAZA 4NQWA 4ASNA 3C3WA 5D8KB 5FD5A 3H3ZA 3JAMK 2FMYA 2A3SA 2CGPA 1K79A 3LA7A 2FQ3A 4A0XA 4LMYA 4BXUA 3EUHA 4UXNA 3M8EA 1KA8A 2L01A 4WXDA 1WQ2A 1IXSB 5CYVA 1WSUA 1MJAA 1XDSA 1F4KA 4GYGA 2R3SA 2OZ6A 1Z6RA 2QQAA 2EA4A 4LLLA 3O6BB 1MZBA 5D4SA 4U0YA 5H20A 4L9TA 3KLNA 1W5TA 2LSOA 2ZNZA 2Q0OA 3IC7A 4IRGA 2FMLA 2G7UA 4KNYA 5HOOA 4LK0F 4HLXA 4A2UA 2XAGA 3RPQA 3WTUC 1NHAA 4IHSA 2QLZA 4BQAA 4H0EA 2PI0A 4PGGA 4YFXF 3E6CC 2BV6A 4L0ZB 3S2WA 4L0YB 2P5VA 1P4AA 3IL2A 4I02A 2A61A 4YFNF 5AIQA 5F6FA 4AWXB 3KE2A 2DQRA 4JBAA 2IP2A 2DU9A 4HW0A 3E6DA 3LAJA 2HFHA 5D5UB 3HOSA 3RYPA 5BOXA 4G7HF 3MWMA 2QENA 1ZN2A 5JFRA 5J6XA 3KP6A 4EM0B 5FLXK 4ESFA 4PZJA 1MDMB 2Z5UA 1ZYRF 4OOIA 2A6HF 3C7JA 1XD7A 1D5VA 4M72A 2P7CB 3I0TA 2EJRA 3MQ0A 3ZMUA 2PMUA 5DCMA 3FZVA 4KMUX 3ERED 1RZ4A 4KICA 3WTTC 3CUQC 3WTSC 1ZG5A 2D45A 1YTYA 2ADUA 1PP7U 1AOYA 1Z1DA 5F64A 5K5QA 3E5UA 2ZNYA 1HKSA 4M6YA 3E97A 3I59B 2M8EA 3CO7C 4CZZA 3M1EA 3Q9SA 3WTWC 4Q4ZF 3KP4A 1ZREA 2HTSA 3H92A 2MC3A 3IWFA 1LDDA 4EJTA 1EH7A 1ODDA 1LVAA 3DKWA 2YU3A 3KCCA 2W25A 5DYMA 2XHKA 2XAQA 2OQRA 4ZYHA 3I64A 2ELHA 2V9VA 2DW4A 5JVTA 1IRFA 1P4XA 2VT3A 5E8IA 3T8TA 2KKOA 1BI3A 2G9WA 5DD4A 4L5IA 2XAHA 2ZMEA 1G3TA 2RDPA 2KIUA 1T6SA 1R22A 5LLQA 3ZMSA 4R1HA 1OYYA 3R0AA 2O61A 1H9GA 1T98A 3D0SA 4RGSA 1QBJA 4G6QA 3R60A 1O3TA 5HS7A 5E8GA 2UXNA 5HLIA 4G7OF 1TW3A 2D2WA 2RQPA 2ISYA 2P5KA 4I0AA 2CW0F 1ZARA 2UXXA 2OA4A 2YX7A 2WWYA 1ON1A 2RNJA 1P92A 1GXQA 3ZN0A 2EA2A 3O2PE 2IA2A 5TRDA 1S7AA 2C6YA 3WGIA 3MZHA 1BOAA 2DTRA 2BGCA 2GXBA 3FXQA 1QO0D 3T0YA 3RI4A 5HDGA 1VTNC 3Q9VA 1FYLA 2QQBA 3L2CA 1U78A 1KQ9A 4XRFA 4N0BA 1KQ8A 4WX9A 2Z99A 2HEOA 2H6BA 4M9SA 5F1RA 5BPIA 1EH8A 4S05A 4G9YA 3BZ6A 3CO6C 2EV0A 3BPXA 1QZYA 3QPTA 4EJVA 2HWVA 4CICA 3SFZA 2GIVA 2OQGA 1DDNA 5ICCA 1USSA 3BJAA 1KU7A 5TJJA 3TO7A 5BS6A 4EV0A 5FFZA 3LA2A 2LDUA 1Z6TA 1MGTA 1U5TB 2F5DA 2DO7A 3KP7A 4RB3C 3JTHA 1J59A 4WCGA 1JGSA 3MFKA 1QNTA 4M6XA 3DQVC 1FC3A 3RIRA 3I53A 3WU1B 4OINF 3DV8A 1LEAA 2HS5A 2FEZA 5IT3A 2K27A 4LK1F 4A0YA 4XLPF 3N4MA 2BYVE 3NRVA 4ZYGA 1PDNC 3K1NA 2WV0A 2JSCA 1BC7C 3GEZA 3GX4X 2EFNA 3I59A 3V8JA 5D5WB 1MKMA 2EFWA 1FZPB 1B59A 2L02A 1C0WA 3VEPA 1F9NA 1B9MA 3HHGA 4GCVA 4LD5A 2PLYA 1SFEA 1DUXC 4ZYDA 2FXAA 3V8LA 1B9NA 2P4WA 4L18B 1TQPA 5E18F 2VT2A 1FNNA 2VC1A 1FWZA 3ECOA 2IPQX 3DPTA 4KIFA 4GGGA 1SD4A 1R1VA 2WTEA 1S29A 1IUYA 1I6XA 2A68F 5LGUA 1ZG3A 5E1XA 3GZ6A 3EETA 3WE3A 3J81Z 3OOPA 3G3ZA 5E20A 3KETA 1ZGAA 2RGVA 3COAC 3K1MA 3FM3A 2MLKA 1SMTA 2Z3YA 3TOAA 5FLXZ 2E7WA 5K5OA 4ENKA 2L3DA 1J0RA 3FM5A 3DP7A 1LDKB 5KVRA 2ZCWA 3FHZA 3KEQA 3K69A 4L9VA 2ESHA 5D5VB 3QP5A 1YW8A 2P8TA 1BI0A 3SHFA 3PQKA 4MTEA 5DEQA 1B6AA 2PJPA 1V3FA 4LLNA 4FT8A 2LF7A 4KA4A 1O3SA 3HSEA 2GA2A 3R61A 3GYHX 4U0WA 1B1BA 1S6LA 1XMKA 2ZFWA 1ZRFA 2ACJA 1QZZA 1WKMA 2YX4A 2W84A 4A6EA 6PAXA 3ISPA 4HDVA 1GVJA 2OD5A 4GO1A 4CHUA 1RNLA 1FSHA 2AXLA 4LJZF 2FU4A 3ECHA 5ILVA 5HS9A 3BDDA 4LG0B 4RB1A 1ZRCA 1K78B 3L00A 3FX3A 1MJBA 2ZJ2A 3RTRA 2KJCA 1QPMA 5HLHA 3GLXA 2PQ8A 1LEBA 2MD5A 2HR3A 1KU3A 3BJ6A 2WC2A 2F5CA 4AD9A 5L3EA 1YS7A 2E1NA 1S8NA 3WGGA 4ZZDA 4HZFA 2JRTA 1WWXA 4I7HA 4OMYA 3N97A 5LGNA 3WTZA 5AIPA 1JHFA 4UVBA 1XSDA 2MH9A 4QLCU 2OBPA 5KK1A 1I27A 2XKOA 1TTYA 1KU2A 2CFXA 2XIGA 3HHHA 5K5RA 2GAUA 1ZRDA 1S3JA 3K9TA 3D5LA 5L3FA 4U88A 4LLGF 4KIGA 1P4WA 3KZZA 3MCZA 3LQQA 4OMZA 2P5LC 3FMSA 4RB2C 4ESJA 2UZKA 1RUOA 1U8RA 2CQKA 4K2EA 3GUDA 2VOOA 4DQ2A 2IRFG 3DFGA 1J75A 2HKXA 4UUVA 1S7OA 4G7ZF 1XSXA 4YIIA 3ZMVA 2VBYA 3GFMA 2XAJA 1FP2A 4EJUA 1YQAA 5CVRA 4BYYA 1YIOA 3JW4A 2A07F 5FB2A 3HRUA 4MQVA 2MLGA 3F6VA 1HW2A 3GXOA 1ZG1A 2CYYA 1O7FA 1OYWA 2YR2A 1D3YA 1I1GA 3KP2A 1KGSA 3REOA 2J5PA 3J81K 2H09A 4UVCA 4G8XA 2HGCA 3V7CA 4UV8A 3KFWX 2DQLA 2FBKA 2MBFA 5CVJA 5FGMA 3SZPA 1IZ1A 1YW7A 1W7PB 1HKQA 3RJPA 4XSZF 2PG4A 4PDKA 5CVVA 1U6GA 3DPLC 1X3UA 2PBIA 2X0LA 5J8CA 4QWQA 2CG4A 2PEXA 1R1UA 2H6CA 1AWCA 2FBHA 2GZWA 3HTSB 1LQ1A 3HSFA 4CDGA 3W6KB 3BPVA 3KLOA 2VE8A 2FRHA 2R7FA 4B8XA 2Y75A 4FHTA 4UNOA 1YFHA 4L9JA 3GVAA 1LJ9A 3K2ZA 3V8KA 4EM2A 4DNCA 1W4MA 3CDHA 1CF7A 2TDXA 3BP8A 1JHHA 2M87A 4BHPA 1IN5A 2ZKZA 1YW9A 4KN7X 4F7ZA 1FSEA 1BN5A 2EFPA 4I98B 3I71A 1XCVA 4EGYA 1DPUA 4HQEA 1BM9A 1G6NA 2BE5F 2QUFA 5L3CA 4WXHA 3QPHA 1BI1A 2M1BA 3VODA 1O57A 2MH2A 1HBXG 2Z9OA 3U1DA 2G7HA 2K7LA 4ENJA 3FXRA 3ABTA 1K7AA 3E5XA 1P2FA 4A5NA 1QGPA 2CSOA 3V7RA 2NRAC 5LEKA 3KP5A 1IN6A 5L3BA 4NB5A 4BAYA 2COMA 1ZH5A 2STWA 1GXPA 1GHCA 2GA1A 1JXSA 4HV6A 2JPCA 2O3FA 2YSRA 4WWCA 2DK8A 3ZPLA 2QBYB 5JHUA 1T39A 4I2OA 2K4JA 3L09A 2EV5A 2KRFA 1REPC 4GXOA 4N9IA 4MTDA 1R00A 1UCRA 4AVPA 2J5OA 3CUOA 1G4DA 3W6JB 5EEGA 4WK8F 2EK5A 3IKTA 1R1TA 2M30A 5CVUA 3QAHA 2LF8A 1YO5C 4HA8A 4HV5A 4LFUA 4BNCA 3CUQB 1HW5A 3JTGA 1Z9CA 4KMFA 3GFJA 5HDKA 4KYWA 2B0LA 3GFLA 3FWEA 3HRMA 1R58A 3BOQA 2QM3A 5DUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6C A;  1SMY F;  1UHM A;  4LGW A;  1BIA A;  1MDM A;  2DPD A;  4IRI A;  2O03 A;  3GF2 A;  3KP3 A;  3MAJ A;  3F8M A;  4L5J A;  1IF1 A;  1J2X A;  1XCB A;  3HRT A;  4O6J A;  4HX7 A;  2P7V B;  2O8X A;  1O3Q A;  3WGH A;  2A5Y B;  5DDG A;  2NS0 A;  3NEU A;  3F72 A;  4BHB A;  4O5V A;  2XKP A;  4Y13 A;  4EGZ A;  3FXU A;  3HYI A;  1SFX A;  5LEJ A;  3FF5 A;  2ZXJ A;  3F8B A;  4EVI A;  2D1H A;  2AS5 F;  3FMQ A;  5K1Y A;  3WOD F;  3I4P A;  2A69 F;  2JPB A;  5J8F A;  4RS8 A;  1TBX A;  3T1B A;  4OIQ F;  5FFX A;  1J9I A;  2OU2 A;  3EYI A;  1IXR C;  3T5X A;  1Y0U A;  4Y15 A;  2HYF A;  3LA3 A;  2DAO A;  1FX7 A;  4Q5S F;  3P9I A;  4A5M A;  3M7G A;  4CGZ A;  4NHJ A;  3ML6 A;  1FP1 D;  1OKR A;  2OZU A;  4UVA A;  4FX0 A;  2RKH A;  5LBQ A;  1XGN A;  2XRN A;  2O0Y A;  2NYX A;  5JR3 A;  4HBL A;  1RIO H;  3K1P A;  2VE9 A;  3CLO A;  3K0L A;  3RKX A;  1EH6 A;  1J5Y A;  3EDP A;  2E7X A;  3PQJ A;  1KQ0 A;  2VXZ A;  5ERI A;  4AIJ A;  3P7N A;  4XSX F;  2H94 A;  2NAZ A;  1IN8 A;  1E17 A;  3LQR A;  2IW5 A;  5LGT A;  1XN7 A;  4KFC A;  2HOE A;  4U7B A;  1MJ9 A;  4I09 A;  3H3U A;  4PCQ A;  3L7W A;  3EQL F;  1R5G A;  1SD5 A;  3O3K A;  4L9N A;  2HZT A;  4Y17 A;  2VBW A;  3BY6 A;  2VOP A;  1ULY A;  5D4R A;  5DUI A;  4P96 A;  1XGS A;  2QYO A;  5DCM B;  3Q5F A;  5DV5 A;  1PUE E;  3LST A;  4EQQ A;  2ISZ A;  1V4R A;  4FX4 A;  4M9Z A;  3AAF A;  3CUQ A;  4U7D A;  3HIF A;  4M9X A;  4G6D A;  1O3R A;  1H0M A;  2EB7 A;  3ZN1 A;  1R23 A;  2FF4 A;  5HS8 A;  1XGO A;  1SD6 A;  2BEO A;  3CTA A;  2FBI A;  3GW2 A;  3C18 A;  4A0Z A;  3IWZ A;  1KYW A;  1U5T A;  1TNS A;  2EFO A;  4RGX A;  4M73 A;  2FE3 A;  4OU0 A;  1W7P D;  4HX8 A;  4EJW A;  2QVO A;  1IN4 A;  4OIR F;  5ICG A;  1KU9 A;  1SD7 A;  2VOD A;  5CVI A;  3HRS A;  1T0F A;  2M5W A;  2KJB A;  4A12 A;  2KIF A;  3F21 A;  1FY7 A;  5HLG A;  3E6B A;  1UB9 A;  1MD0 A;  2ZME B;  1OR7 A;  3WTY C;  2NNY A;  2D1V A;  3T8R A;  2QWW A;  1ZHF A;  3J80 Z;  2O6G E;  3B02 A;  4M74 A;  1ZLK A;  3SXY A;  1RI7 A;  2K86 A;  5HDN A;  3VFZ A;  2CWE A;  1YS6 A;  2GWR A;  3TGN A;  3PFI A;  3OV8 A;  1DPR A;  4S04 A;  1U2W A;  2V79 A;  1FYK A;  3P9C A;  3TKY A;  4Q48 A;  1UHW A;  2BBY A;  3KZY A;  4MGR A;  2P6T A;  1HQC A;  2ETH A;  3SZT A;  4KUM A;  2FNP A;  2VBX A;  4I0B A;  1TW2 A;  1IRG A;  2EWN A;  3F3X A;  1D8K A;  4IXA A;  2FSW A;  2JZY A;  2XAF A;  1TLH B;  3DEU A;  4ETS A;  3QRF F;  5ICF A;  1I5Z A;  2FNA A;  2LNB A;  3BWG A;  4ZYE A;  1OYI A;  3ULQ B;  2GXG A;  4M71 A;  1IXC A;  4HQM A;  3I58 A;  4RGU A;  5L3D A;  2HDC A;  5DD8 A;  1ON2 A;  2IVM A;  4XBF A;  1LB2 A;  3L9F A;  2MA3 A;  4G94 A;  5D6E A;  3QU6 A;  2F5F A;  2GQQ A;  3VOE A;  2VON A;  2L4A A;  4I01 A;  3V7S A;  1FBQ A;  2ESN A;  4HYE A;  3RPU A;  4ZH4 F;  4P9F A;  1HW1 A;  4MNU A;  4EM1 A;  1BIB A;  2V1X A;  1K6O A;  1EV7 A;  2DLL A;  4HF0 A;  3TDZ C;  4TV7 A;  1Z05 A;  5IT9 K;  3NQO A;  5FD6 A;  3I54 A;  3F8C A;  3ROU A;  3SQN A;  5FO5 A;  3QOP A;  1TNT A;  2XVC A;  4MHG A;  3TO6 A;  1Q1H A;  3QU3 A;  5A2Q Z;  1XDU A;  4HAM A;  3M9A A;  1F1Z A;  4ENN A;  4LB6 B;  2V1D A;  4B09 A;  4LG0 A;  1K78 A;  3R0J A;  3CJN A;  4YG2 F;  1YYV A;  5LRR A;  1OPC A;  2F5E A;  1G3Y A;  2DFI A;  3FMR A;  2PMH A;  4EJO A;  2HTJ A;  1D8J A;  1E2X A;  3VB2 A;  5LHI A;  2W57 A;  1U5T C;  1UFM A;  3F6O A;  3U9G A;  2IA0 A;  4ZZL A;  1ZGJ A;  4RGR A;  2E1C A;  4MEY F;  2FA5 A;  2JTV A;  1HKT A;  5ICE A;  2DK5 A;  3U2R A;  3IRR A;  3G73 A;  2IA1 A;  2EV6 A;  4N9H A;  3IRQ A;  4Q47 A;  4IRH A;  3WG9 A;  5E1W A;  2KIM A;  1ZLJ A;  2CO5 A;  1LDJ A;  2IT0 A;  3HTU A;  3ZQ7 A;  5BMZ A;  2HKO A;  2HQN A;  1FPQ A;  3TQN A;  2XUB A;  2Y0M A;  2HYG D;  1CGP A;  3ELK A;  5EEH A;  1HXD A;  1XSV A;  5HVQ C;  4IPA A;  4U0V A;  4OIO F;  3GO5 A;  2ZO4 A;  3V4G A;  1ZAO A;  1LNW A;  2W24 A;  5LHG A;  2DBB A;  3TOB A;  3J80 K;  1HST A;  1T38 A;  2UWM A;  5D8L B;  3E3V A;  4WF2 A;  4JQF A;  4IF4 A;  1Z91 A;  4CXF A;  2ZBK A;  3F8N A;  4ESB A;  4MQ9 F;  2XV4 S;  4MEX F;  4AIK A;  4YFK F;  5DCF A;  3ABU A;  1FT9 A;  5BQT A;  1STZ A;  2V1U A;  2YPR A;  3IHU A;  4HLY A;  3ZP5 A;  2X4H A;  5ILS A;  2L4M A;  1DP7 P;  2VBZ A;  1BC8 C;  1OMI A;  2EFQ A;  3F22 A;  3BJO A;  3RDI A;  2VN2 A;  2Y48 A;  4EMS A;  3WTX C;  1SAX A;  1R5H A;  4ON0 A;  1XGM A;  2DPU A;  4A6D A;  4PGH A;  2PN6 A;  4BHC A;  1W7P A;  5H6Q A;  1IN7 A;  1G3W A;  4CO8 A;  5CLS A;  2STT A;  3IKV A;  1FLI A;  1W5S A;  5JI6 A;  2Z33 A;  4ENM A;  2XRO A;  1JE8 A;  1HSJ A;  1FBS A;  3EYY A;  1L3L A;  2F2E A;  4Z2Y A;  4HDU A;  3ZMD A;  3ZMT A;  1RUN A;  3JAM Z;  1WRJ A;  4IJA A;  1U3E M;  3GWZ A;  4WXC A;  2K4B A;  3HUG A;  4KDP A;  2RVC A;  1YLF A;  1A04 A;  4KT5 C;  2Q8K A;  4R8H A;  3F8F A;  5LHH A;  3E6M A;  5ILU A;  4HOB A;  3P9K A;  1J7K A;  2JT1 A;  3GFI A;  3RYR A;  1IAW A;  5A2Q K;  4IHT A;  3MZY A;  3TDU C;  1Z7U A;  2W85 A;  4YIF A;  1R7J A;  4XLN F;  1XMA A;  2QZ8 A;  5H6R A;  3I5U A;  3JSO A;  4R79 A;  3QP6 A;  1BI2 A;  3M8F A;  3HOT A;  3RKW A;  1L0O C;  2L54 A;  1R36 A;  2RN7 A;  3B73 A;  3WE2 A;  1TQM A;  3F23 A;  5AON A;  3RKY A;  2DT5 A;  1IW7 F;  2QQ9 A;  5ED4 A;  3BRO A;  5D5X B;  4HF2 A;  1T2K A;  2Q2E A;  1FOK A;  5D6F A;  1YG2 A;  2HQR A;  5E17 F;  1TQI A;  1ONV A;  5LRS A;  2QBY A;  2XGX A;  1B4A A;  4E70 A;  2RC4 A;  4IVN A;  3C1D A;  4P55 A;  3DXJ F;  4AIH A;  3TO9 A;  1BJA A;  5IT9 Z;  3MEX A;  2NNN A;  3LAP A;  1F5T A;  1I1S A;  3WTV C;  2R7D A;  4P9U A;  3R4K A;  3HSR A;  2FOK A;  3LWF A;  3KEO A;  1QQI A;  4GYI A;  4D0P A;  2H27 A;  3DF8 A;  4HX4 A;  4RAY A;  4HF1 A;  4O3M A;  1KYZ A;  2DI3 A;  3ZMZ A;  4RB0 A;  2K02 A;  4LB5 A;  2XAS A;  1G3S A;  3E5Q A;  1P6R A;  1UST A;  3R6S A;  1XB4 A;  3J7A O;  4BH9 A;  1O7L A;  1CF7 B;  5CJ9 A;  2VC0 A;  1PP8 F;  2PFB A;  2A6E F;  5BPD A;  2IJL A;  1BBY A;  2M45 A;  5L3G A;  1WI9 A;  1FBU A;  4OIP F;  4UHT A;  2P6S A;  3JSP A;  4KIB A;  1SFU A;  2RV8 A;  4JK1 X;  3WU0 A;  4CYD A;  1FYM A;  1H9T A;  4P5O A;  3LFK A;  4KN4 X;  3GZ5 A;  4UV9 A;  5E1Z B;  2OAZ A;  2LKP A;  4RAZ A;  4NQW A;  4ASN A;  3C3W A;  5D8K B;  5FD5 A;  3H3Z A;  3JAM K;  2FMY A;  2A3S A;  2CGP A;  1K79 A;  3LA7 A;  2FQ3 A;  4A0X A;  4LMY A;  4BXU A;  3EUH A;  4UXN A;  3M8E A;  1KA8 A;  2L01 A;  4WXD A;  1WQ2 A;  1IXS B;  5CYV A;  1WSU A;  1MJA A;  1XDS A;  1F4K A;  4GYG A;  2R3S A;  2OZ6 A;  1Z6R A;  2QQA A;  2EA4 A;  4LLL A;  3O6B B;  1MZB A;  5D4S A;  4U0Y A;  5H20 A;  4L9T A;  3KLN A;  1W5T A;  2LSO A;  2ZNZ A;  2Q0O A;  3IC7 A;  4IRG A;  2FML A;  2G7U A;  4KNY A;  5HOO A;  4LK0 F;  4HLX A;  4A2U A;  2XAG A;  3RPQ A;  3WTU C;  1NHA A;  4IHS A;  2QLZ A;  4BQA A;  4H0E A;  2PI0 A;  4PGG A;  4YFX F;  3E6C C;  2BV6 A;  4L0Z B;  3S2W A;  4L0Y B;  2P5V A;  1P4A A;  3IL2 A;  4I02 A;  2A61 A;  4YFN F;  5AIQ A;  5F6F A;  4AWX B;  3KE2 A;  2DQR A;  4JBA A;  2IP2 A;  2DU9 A;  4HW0 A;  3E6D A;  3LAJ A;  2HFH A;  5D5U B;  3HOS A;  3RYP A;  5BOX A;  4G7H F;  3MWM A;  2QEN A;  1ZN2 A;  5JFR A;  5J6X A;  3KP6 A;  4EM0 B;  5FLX K;  4ESF A;  4PZJ A;  1MDM B;  2Z5U A;  1ZYR F;  4OOI A;  2A6H F;  3C7J A;  1XD7 A;  1D5V A;  4M72 A;  2P7C B;  3I0T A;  2EJR A;  3MQ0 A;  3ZMU A;  2PMU A;  5DCM A;  3FZV A;  4KMU X;  3ERE D;  1RZ4 A;  4KIC A;  3WTT C;  3CUQ C;  3WTS C;  1ZG5 A;  2D45 A;  1YTY A;  2ADU A;  1PP7 U;  1AOY A;  1Z1D A;  5F64 A;  5K5Q A;  3E5U A;  2ZNY A;  1HKS A;  4M6Y A;  3E97 A;  3I59 B;  2M8E A;  3CO7 C;  4CZZ A;  3M1E A;  3Q9S A;  3WTW C;  4Q4Z F;  3KP4 A;  1ZRE A;  2HTS A;  3H92 A;  2MC3 A;  3IWF A;  1LDD A;  4EJT A;  1EH7 A;  1ODD A;  1LVA A;  3DKW A;  2YU3 A;  3KCC A;  2W25 A;  5DYM A;  2XHK A;  2XAQ A;  2OQR A;  4ZYH A;  3I64 A;  2ELH A;  2V9V A;  2DW4 A;  5JVT A;  1IRF A;  1P4X A;  2VT3 A;  5E8I A;  3T8T A;  2KKO A;  1BI3 A;  2G9W A;  5DD4 A;  4L5I A;  2XAH A;  2ZME A;  1G3T A;  2RDP A;  2KIU A;  1T6S A;  1R22 A;  5LLQ A;  3ZMS A;  4R1H A;  1OYY A;  3R0A A;  2O61 A;  1H9G A;  1T98 A;  3D0S A;  4RGS A;  1QBJ A;  4G6Q A;  3R60 A;  1O3T A;  5HS7 A;  5E8G A;  2UXN A;  5HLI A;  4G7O F;  1TW3 A;  2D2W A;  2RQP A;  2ISY A;  2P5K A;  4I0A A;  2CW0 F;  1ZAR A;  2UXX A;  2OA4 A;  2YX7 A;  2WWY A;  1ON1 A;  2RNJ A;  1P92 A;  1GXQ A;  3ZN0 A;  2EA2 A;  3O2P E;  2IA2 A;  5TRD A;  1S7A A;  2C6Y A;  3WGI A;  3MZH A;  1BOA A;  2DTR A;  2BGC A;  2GXB A;  3FXQ A;  1QO0 D;  3T0Y A;  3RI4 A;  5HDG A;  1VTN C;  3Q9V A;  1FYL A;  2QQB A;  3L2C A;  1U78 A;  1KQ9 A;  4XRF A;  4N0B A;  1KQ8 A;  4WX9 A;  2Z99 A;  2HEO A;  2H6B A;  4M9S A;  5F1R A;  5BPI A;  1EH8 A;  4S05 A;  4G9Y A;  3BZ6 A;  3CO6 C;  2EV0 A;  3BPX A;  1QZY A;  3QPT A;  4EJV A;  2HWV A;  4CIC A;  3SFZ A;  2GIV A;  2OQG A;  1DDN A;  5ICC A;  1USS A;  3BJA A;  1KU7 A;  5TJJ A;  3TO7 A;  5BS6 A;  4EV0 A;  5FFZ A;  3LA2 A;  2LDU A;  1Z6T A;  1MGT A;  1U5T B;  2F5D A;  2DO7 A;  3KP7 A;  4RB3 C;  3JTH A;  1J59 A;  4WCG A;  1JGS A;  3MFK A;  1QNT A;  4M6X A;  3DQV C;  1FC3 A;  3RIR A;  3I53 A;  3WU1 B;  4OIN F;  3DV8 A;  1LEA A;  2HS5 A;  2FEZ A;  5IT3 A;  2K27 A;  4LK1 F;  4A0Y A;  4XLP F;  3N4M A;  2BYV E;  3NRV A;  4ZYG A;  1PDN C;  3K1N A;  2WV0 A;  2JSC A;  1BC7 C;  3GEZ A;  3GX4 X;  2EFN A;  3I59 A;  3V8J A;  5D5W B;  1MKM A;  2EFW A;  1FZP B;  1B59 A;  2L02 A;  1C0W A;  3VEP A;  1F9N A;  1B9M A;  3HHG A;  4GCV A;  4LD5 A;  2PLY A;  1SFE A;  1DUX C;  4ZYD A;  2FXA A;  3V8L A;  1B9N A;  2P4W A;  4L18 B;  1TQP A;  5E18 F;  2VT2 A;  1FNN A;  2VC1 A;  1FWZ A;  3ECO A;  2IPQ X;  3DPT A;  4KIF A;  4GGG A;  1SD4 A;  1R1V A;  2WTE A;  1S29 A;  1IUY A;  1I6X A;  2A68 F;  5LGU A;  1ZG3 A;  5E1X A;  3GZ6 A;  3EET A;  3WE3 A;  3J81 Z;  3OOP A;  3G3Z A;  5E20 A;  3KET A;  1ZGA A;  2RGV A;  3COA C;  3K1M A;  3FM3 A;  2MLK A;  1SMT A;  2Z3Y A;  3TOA A;  5FLX Z;  2E7W A;  5K5O A;  4ENK A;  2L3D A;  1J0R A;  3FM5 A;  3DP7 A;  1LDK B;  5KVR A;  2ZCW A;  3FHZ A;  3KEQ A;  3K69 A;  4L9V A;  2ESH A;  5D5V B;  3QP5 A;  1YW8 A;  2P8T A;  1BI0 A;  3SHF A;  3PQK A;  4MTE A;  5DEQ A;  1B6A A;  2PJP A;  1V3F A;  4LLN A;  4FT8 A;  2LF7 A;  4KA4 A;  1O3S A;  3HSE A;  2GA2 A;  3R61 A;  3GYH X;  4U0W A;  1B1B A;  1S6L A;  1XMK A;  2ZFW A;  1ZRF A;  2ACJ A;  1QZZ A;  1WKM A;  2YX4 A;  2W84 A;  4A6E A;  6PAX A;  3ISP A;  4HDV A;  1GVJ A;  2OD5 A;  4GO1 A;  4CHU A;  1RNL A;  1FSH A;  2AXL A;  4LJZ F;  2FU4 A;  3ECH A;  5ILV A;  5HS9 A;  3BDD A;  4LG0 B;  4RB1 A;  1ZRC A;  1K78 B;  3L00 A;  3FX3 A;  1MJB A;  2ZJ2 A;  3RTR A;  2KJC A;  1QPM A;  5HLH A;  3GLX A;  2PQ8 A;  1LEB A;  2MD5 A;  2HR3 A;  1KU3 A;  3BJ6 A;  2WC2 A;  2F5C A;  4AD9 A;  5L3E A;  1YS7 A;  2E1N A;  1S8N A;  3WGG A;  4ZZD A;  4HZF A;  2JRT A;  1WWX A;  4I7H A;  4OMY A;  3N97 A;  5LGN A;  3WTZ A;  5AIP A;  1JHF A;  4UVB A;  1XSD A;  2MH9 A;  4QLC U;  2OBP A;  5KK1 A;  1I27 A;  2XKO A;  1TTY A;  1KU2 A;  2CFX A;  2XIG A;  3HHH A;  5K5R A;  2GAU A;  1ZRD A;  1S3J A;  3K9T A;  3D5L A;  5L3F A;  4U88 A;  4LLG F;  4KIG A;  1P4W A;  3KZZ A;  3MCZ A;  3LQQ A;  4OMZ A;  2P5L C;  3FMS A;  4RB2 C;  4ESJ A;  2UZK A;  1RUO A;  1U8R A;  2CQK A;  4K2E A;  3GUD A;  2VOO A;  4DQ2 A;  2IRF G;  3DFG A;  1J75 A;  2HKX A;  4UUV A;  1S7O A;  4G7Z F;  1XSX A;  4YII A;  3ZMV A;  2VBY A;  3GFM A;  2XAJ A;  1FP2 A;  4EJU A;  1YQA A;  5CVR A;  4BYY A;  1YIO A;  3JW4 A;  2A07 F;  5FB2 A;  3HRU A;  4MQV A;  2MLG A;  3F6V A;  1HW2 A;  3GXO A;  1ZG1 A;  2CYY A;  1O7F A;  1OYW A;  2YR2 A;  1D3Y A;  1I1G A;  3KP2 A;  1KGS A;  3REO A;  2J5P A;  3J81 K;  2H09 A;  4UVC A;  4G8X A;  2HGC A;  3V7C A;  4UV8 A;  3KFW X;  2DQL A;  2FBK A;  2MBF A;  5CVJ A;  5FGM A;  3SZP A;  1IZ1 A;  1YW7 A;  1W7P B;  1HKQ A;  3RJP A;  4XSZ F;  2PG4 A;  4PDK A;  5CVV A;  1U6G A;  3DPL C;  1X3U A;  2PBI A;  2X0L A;  5J8C A;  4QWQ A;  2CG4 A;  2PEX A;  1R1U A;  2H6C A;  1AWC A;  2FBH A;  2GZW A;  3HTS B;  1LQ1 A;  3HSF A;  4CDG A;  3W6K B;  3BPV A;  3KLO A;  2VE8 A;  2FRH A;  2R7F A;  4B8X A;  2Y75 A;  4FHT A;  4UNO A;  1YFH A;  4L9J A;  3GVA A;  1LJ9 A;  3K2Z A;  3V8K A;  4EM2 A;  4DNC A;  1W4M A;  3CDH A;  1CF7 A;  2TDX A;  3BP8 A;  1JHH A;  2M87 A;  4BHP A;  1IN5 A;  2ZKZ A;  1YW9 A;  4KN7 X;  4F7Z A;  1FSE A;  1BN5 A;  2EFP A;  4I98 B;  3I71 A;  1XCV A;  4EGY A;  1DPU A;  4HQE A;  1BM9 A;  1G6N A;  2BE5 F;  2QUF A;  5L3C A;  4WXH A;  3QPH A;  1BI1 A;  2M1B A;  3VOD A;  1O57 A;  2MH2 A;  1HBX G;  2Z9O A;  3U1D A;  2G7H A;  2K7L A;  4ENJ A;  3FXR A;  3ABT A;  1K7A A;  3E5X A;  1P2F A;  4A5N A;  1QGP A;  2CSO A;  3V7R A;  2NRA C;  5LEK A;  3KP5 A;  1IN6 A;  5L3B A;  4NB5 A;  4BAY A;  2COM A;  1ZH5 A;  2STW A;  1GXP A;  1GHC A;  2GA1 A;  1JXS A;  4HV6 A;  2JPC A;  2O3F A;  2YSR A;  4WWC A;  2DK8 A;  3ZPL A;  2QBY B;  5JHU A;  1T39 A;  4I2O A;  2K4J A;  3L09 A;  2EV5 A;  2KRF A;  1REP C;  4GXO A;  4N9I A;  4MTD A;  1R00 A;  1UCR A;  4AVP A;  2J5O A;  3CUO A;  1G4D A;  3W6J B;  5EEG A;  4WK8 F;  2EK5 A;  3IKT A;  1R1T A;  2M30 A;  5CVU A;  3QAH A;  2LF8 A;  1YO5 C;  4HA8 A;  4HV5 A;  4LFU A;  4BNC A;  3CUQ B;  1HW5 A;  3JTG A;  1Z9C A;  4KMF A;  3GFJ A;  5HDK A;  4KYW A;  2B0L A;  3GFL A;  3FWE A;  3HRM A;  1R58 A;  3BOQ A;  2QM3 A;  5DUK A; 
#chains in the Genus database with same CATH topology
 2V6C A;  2OTL I;  4DYC A;  1BR1 A;  2Z16 A;  3OMY A;  1SMY F;  1UHM A;  5F1J A;  1TWF J;  3OS2 A;  1JKR C;  4LGW A;  1BIA A;  4A3J J;  1MDM A;  1YJ9 I;  2DPD A;  4IRI A;  1JGG A;  2GOX B;  2O03 A;  2LC2 A;  3OWT A;  3GF2 A;  2R7V A;  2A5W A;  3KP3 A;  3MAJ A;  1D1B A;  3F8M A;  2K9Q A;  2M7B A;  4L5J A;  2JSP A;  1IF1 A;  1J2X A;  3RPU D;  1XCB A;  3HRT A;  1R71 A;  4O6J A;  4HX7 A;  3W2V A;  2P7V B;  2O8X A;  4IQ4 A;  1O3Q A;  3WGH A;  2A5Y B;  1D1C A;  5DDG A;  1U9O A;  3PL8 A;  2NS0 A;  5E3O A;  4NQW B;  3NEU A;  3F72 A;  2BZT A;  5F0F A;  4BHB A;  4O5V A;  2XKP A;  4BE2 A;  3GBG A;  3HOW J;  4Y13 A;  3H0D A;  4EGZ A;  3FXU A;  3HYI A;  4OAY A;  1SFX A;  3EUA A;  5LEJ A;  3FF5 A;  4F91 B;  2ZXJ A;  2DDB A;  3J7A Y;  3F8B A;  4EVI A;  1X3Z B;  2D1H A;  2FD5 A;  1X58 A;  2WAQ N;  5FLM J;  2AS5 F;  4A3B J;  3FMQ A;  4BJ5 C;  5K1Y A;  3WOD F;  3I4P A;  4B3A A;  2A69 F;  2JPB A;  5J8F A;  4XMY A;  1YRN A;  4RS8 A;  3ZQQ A;  3JR9 A;  1TBX A;  3T1B A;  4OIQ F;  2ECB A;  5FFX A;  3QYB A;  1MBH A;  2K9M A;  1J9I A;  2OU2 A;  4A3G J;  1G2H A;  1SFO J;  3EYI A;  2IS1 A;  1IXR C;  3T5X A;  5J47 A;  3KYD B;  3A01 B;  1Y0U A;  4Y15 A;  2HYF A;  3DPU A;  1LFU P;  3LSI A;  3LA3 A;  4DZP A;  5IP7 J;  2DAO A;  2JJ7 A;  1FX7 A;  2ZJQ F;  3HJE A;  4DBQ A;  4Q5S F;  3P9I A;  4A5M A;  2XPU A;  3M7G A;  4CGZ A;  3AKZ A;  3KPH A;  2HOA A;  4NHJ A;  3ML6 A;  1ETW A;  1FP1 D;  2X6X A;  1OKR A;  2OZU A;  4UVA A;  3K10 A;  3FXJ A;  3LSK A;  4FX0 A;  3KYL A;  2RKH A;  1YHQ I;  3DBR B;  5LBQ A;  1XGN A;  2XRN A;  3TBI A;  2O0Y A;  2NYX A;  5JR3 A;  3JRI A;  2F48 A;  4HBL A;  1NG7 A;  1RIO H;  2CUZ A;  3OS0 A;  1AU7 A;  1PUF B;  1WJD A;  2ME6 A;  4M3E A;  5LD2 C;  3K1P A;  2VE9 A;  3CLO A;  3K0L A;  1K6Y A;  3RKX A;  1EH6 A;  3BC8 A;  1J5Y A;  3EDP A;  2E7X A;  1PYV A;  1IG7 A;  2XF7 A;  2QSG X;  3PQJ A;  1KQ0 A;  1TWG J;  2Y30 A;  3SJM A;  2GM4 A;  2VXZ A;  4XN3 A;  1T33 A;  2LOO A;  5ERI A;  4PFO A;  2HOS A;  2M4G A;  4AIJ A;  2WAD A;  3P7N A;  4PSW A;  4XSX F;  2H94 A;  2DA6 A;  3K4N A;  3I55 I;  2NAZ A;  1IN8 A;  2OUM A;  2QEX I;  1E17 A;  3OR1 C;  3LQR A;  1BW5 A;  2IW5 A;  2WB1 N;  5LGT A;  1XN7 A;  4KFC A;  5DS9 A;  2HOE A;  3H5A A;  4U7B A;  4UUS B;  1MJ9 A;  4I09 A;  3H3U A;  4PCQ A;  3L7W A;  2V9K A;  2NVT J;  3W2A A;  3EQL F;  2DA3 A;  3QOE A;  1R5G A;  3VPR A;  4XOT A;  2KRC A;  1ZEL A;  1DQU A;  1SD5 A;  3O3K A;  4L9N A;  3EUK L;  4FE7 A;  3L2U A;  2HZT A;  4Y17 A;  4XID A;  2VBW A;  3BY6 A;  2XPW A;  2JA6 J;  3BR6 A;  4ZDO A;  2VOP A;  1ULY A;  5D4R A;  2XGD A;  2VQL A;  1YOV B;  5DUI A;  1MNM C;  4P96 A;  1V54 H;  1XGS A;  4D9J A;  2I5U A;  1WH7 A;  2XF5 A;  4QPO A;  1DP3 A;  5C44 J;  5DM6 F;  2QYO A;  3GTM J;  3JCU C;  5DCM B;  5J1R A;  3Q5F A;  1WPK A;  5DV5 A;  1PUE E;  2DDA A;  3GTL J;  3LST A;  2DCE A;  4EQQ A;  3DTI A;  3L2W A;  2ISZ A;  1V4R A;  4FX4 A;  4M9Z A;  1W0T A;  3AAF A;  5B3S H;  3CUQ A;  1A6Q A;  4U7D A;  4AVZ A;  3HIF A;  2Y0S N;  2E60 A;  3DWL E;  4M9X A;  4G6D A;  4B44 A;  2VJ4 A;  1O3R A;  1H0M A;  3TW7 A;  2EB7 A;  3ZN1 A;  1R23 A;  2FF4 A;  3CCV I;  3BTC A;  3PNV A;  1XGO A;  5HS8 A;  1SD6 A;  2HPI A;  3QYF A;  2BEO A;  3CTA A;  2FBI A;  4FTH A;  1K83 J;  2I8D A;  4Y52 J;  4ITV A;  2OJE D;  3PUF A;  3GW2 A;  1OCR H;  3C18 A;  1IO2 A;  4XRM A;  4A0Z A;  4X0G A;  3C2B A;  4XLA A;  3Q3S A;  3IWZ A;  3QPS A;  1KYW A;  5M3F J;  1FEX A;  1U5T A;  1VQ5 I;  4B3X A;  1TNS A;  2EFO A;  4RGX A;  2H8W A;  2E19 A;  4M73 A;  2FE3 A;  5LFA A;  2QA4 I;  4OU0 A;  1W7P D;  4HX8 A;  3OYA A;  4EJW A;  4RM2 A;  2EIM H;  2QVO A;  1IN4 A;  4OIR F;  5ICG A;  2VKE A;  1KU9 A;  1SD7 A;  3PNT A;  3RKQ A;  2VOD A;  3GTQ J;  5CVI A;  4LIV A;  4PK4 A;  3HRS A;  3CP8 A;  1T0F A;  3WHC A;  2EIL H;  3IH4 A;  2ZXH A;  1R4M B;  2M5W A;  5M5Y J;  3CCU I;  2KJB A;  2W4S A;  4A12 A;  2KIF A;  3I4N J;  2E71 A;  3JRA A;  2JA7 J;  3EPZ A;  2DXI A;  3F21 A;  2LRD A;  1FY7 A;  4PJJ A;  3ASO H;  3S17 J;  3TMO A;  2UUZ A;  5HLG A;  3E6B A;  1UB9 A;  1MD0 A;  1OLT A;  2ZME B;  5FKL A;  3OYC A;  1OR7 A;  3ZQF A;  3WTY C;  2NNY A;  2X6W A;  2D1V A;  3T8R A;  2QWW A;  1ZHF A;  3J80 Z;  2O6G E;  2QGU A;  2X6Y A;  3B02 A;  1IC8 A;  4M74 A;  5GAG J;  3OR2 C;  1ZLK A;  4Z6Y A;  2L2O A;  3SXY A;  1RI7 A;  2K86 A;  1SAU A;  5HDN A;  4QSH A;  2CWE A;  1YS6 A;  2GWR A;  3VFZ A;  1JJ6 C;  3L2V A;  3TGN A;  3PFI A;  3CCL I;  3OV8 A;  1DPR A;  5B1A H;  4S04 A;  4CUG A;  1U2W A;  2V79 A;  1FYK A;  1E3H A;  4ZDL A;  3P9C A;  2WAE A;  2X85 A;  3TKY A;  3OYK A;  2JK3 A;  3BT9 A;  1UHW A;  4Q48 A;  1SC7 A;  2BBY A;  2BXZ A;  3KZY A;  4MGR A;  1IV6 A;  2P6T A;  3Q0U A;  1HQC A;  2ETH A;  3I9V 2;  3SZT A;  4KUM A;  2FNP A;  1GLN A;  2M7A A;  1TW2 A;  2VBX A;  4I0B A;  1IRG A;  1WJB A;  2EWN A;  3F3X A;  3KIO A;  1DGW Y;  1D8K A;  2VJI A;  4IXA A;  3CMM A;  2FSW A;  2NVQ J;  3SFI A;  1ZR2 A;  3BG6 A;  2JZY A;  2XAF A;  1TLH B;  3DEU A;  1DU6 A;  3TL4 X;  1GUU A;  4ETS A;  3QRF F;  5ICF A;  1I5Z A;  3CC4 I;  2FNA A;  2LNB A;  2E2H J;  2X1E A;  5IPA A;  3BWG A;  4ZYE A;  2Y69 H;  5IYD J;  1OYI A;  2R7R A;  3ULQ B;  3WG7 H;  4XK4 A;  2GXG A;  2JA8 J;  4M71 A;  1IXC A;  1D0X A;  1A35 A;  1YE9 A;  3W6V A;  4HQM A;  1WH5 A;  1T08 B;  3I58 A;  3BCB A;  4RGU A;  4C9Y A;  1T56 A;  5L3D A;  2HDC A;  5DD8 A;  2CFO A;  4CCN A;  4XL9 A;  1ON2 A;  4E7L A;  4CCM A;  2IVM A;  4XBF A;  2XAU A;  2ZSH B;  1LB2 A;  3L9F A;  2MA3 A;  4BQN A;  4Y7N J;  4G94 A;  5D6E A;  3QU6 A;  3NAR A;  2F5F A;  2GQQ A;  3VOE A;  2VON A;  4F52 A;  4FIS A;  2LH9 A;  2L4A A;  4I01 A;  1WGX A;  3V7S A;  1YI2 I;  1FBQ A;  4XOR A;  2NVX J;  1LFP A;  2KZG A;  2ESN A;  1WVR A;  4HYE A;  1SAN A;  3RPU A;  4ZH4 F;  4E4H A;  1SVO A;  4P9F A;  1HW1 A;  4MNU A;  4EM1 A;  1TWA J;  1BIB A;  2V1X A;  3VYT B;  3CF5 F;  1K6O A;  1D0Y A;  1EV7 A;  2DLL A;  4HF0 A;  3TDZ C;  3FXM A;  4TV7 A;  1Z05 A;  2MW8 A;  4AID A;  1MMG A;  5IT9 K;  3NQO A;  5FD6 A;  2E36 A;  3I54 A;  3OS1 A;  5EYR A;  3M4O J;  2ZXI A;  2RNG A;  3F8C A;  2PMZ A;  4XKB A;  3ROU A;  3SQN A;  1RRJ A;  3FBN B;  3X2Q H;  1S7E A;  1YX3 A;  2DA5 A;  3HZJ A;  5FO5 A;  3QOP A;  1TNT A;  3OIO A;  5FKK A;  2XVC A;  4MHG A;  3TO6 A;  1Q1H A;  3QU3 A;  5A2Q Z;  1XDU A;  1T95 A;  2Q1Z B;  4HAM A;  4XKV A;  3G1O A;  3HB9 A;  2MFZ A;  3M9A A;  1MND A;  1SFK A;  5KHD A;  1F1Z A;  4XNF A;  2GIZ A;  4BBS J;  4ENN A;  2AQF A;  4LB6 B;  2V1D A;  3PFY A;  4B09 A;  2DMP A;  4LG0 A;  1K78 A;  3R0J A;  3BR5 A;  4II3 A;  3CJN A;  4YG2 F;  5IYC J;  1YYV A;  1E0E A;  1AA7 A;  3JRC A;  2R5Z A;  5LRR A;  2QQ8 A;  1OPC A;  3L2Q A;  2FUG 2;  2F5E A;  2XSD C;  3PIP F;  1G3Y A;  2DFI A;  3FMR A;  2PMH A;  2M3A A;  2HTJ A;  4EJO A;  1E2X A;  3VB2 A;  3WU2 C;  1D8J A;  5LHI A;  2W57 A;  1U5T C;  1UFM A;  4FQG A;  3F6O A;  3U9G A;  2CV1 A;  2IA0 A;  1H88 C;  2KZV A;  4ZZL A;  1ZGJ A;  4RGR A;  2E1C A;  2MSY A;  4MEY F;  2FA5 A;  1Z0X A;  2JTV A;  1HKT A;  5ICE A;  4B48 A;  3GCM A;  2DK5 A;  2LY2 A;  5F27 A;  3U2R A;  1RKW A;  3IRR A;  3G73 A;  2IA1 A;  2EV6 A;  4N9H A;  1JKQ C;  3IRQ A;  2R7Z J;  2AXT C;  4Q47 A;  2E34 A;  2E2J J;  4KJZ A;  4IRH A;  3LSP A;  3IH3 A;  3WG9 A;  3Q0V A;  2KIM A;  5E1W A;  1ZLJ A;  3VYU B;  3RCO A;  2F4O B;  2CO5 A;  1LDJ A;  1T0F C;  1TWH J;  3BQZ A;  4QTR A;  2IT0 A;  3HTU A;  1VQN I;  2IAI A;  2JA2 A;  4ZYA A;  3ZQ7 A;  3FKI J;  5BMZ A;  2HKO A;  3IUO A;  2WAF A;  2HQN A;  2K5C A;  1FPQ A;  5TIS C;  3TQN A;  3KYC B;  4XLH A;  2VUM J;  4M3B A;  2XUB A;  2Y0M A;  3CD6 I;  5CQG A;  1FIA A;  2HYG D;  2OCC H;  1CGP A;  3OYB A;  2B63 J;  1OR7 C;  3ELK A;  3K4C A;  5EEH A;  3IAM 2;  1HXD A;  1XSV A;  5HVQ C;  4IPA A;  3VYR B;  5EGO A;  3OYI A;  4U0V A;  1WJE A;  4OIO F;  3GO5 A;  2ZO4 A;  4PJN A;  3OOU A;  2NOJ B;  2YS9 A;  2R7Q A;  3DKY A;  3V4G A;  5J1Y A;  1ZAO A;  1LNW A;  4RLF A;  4P1W A;  1H8A C;  2W24 A;  2KIQ A;  2LBF B;  3L2R A;  3S2D J;  5LHG A;  2DBB A;  3TOB A;  3J80 K;  1Y6I A;  1HST A;  2E35 A;  2XDV A;  1T38 A;  1RET A;  4A3K J;  2QCO A;  2UWM A;  2DOF A;  3DLA A;  5GAD J;  5EEA A;  5D8L B;  1W36 C;  1TC3 C;  2DT7 B;  3CP2 A;  3E3V A;  4WF2 A;  4XKW A;  4KIT B;  2TRT A;  3HPG A;  1WJA A;  2DJI A;  5F08 A;  4CCO A;  2IGO A;  2OV7 A;  3S3O A;  4JQF A;  4IF4 A;  1Z91 A;  4CXF A;  2JWT A;  2ZBK A;  1UG0 A;  3DBH B;  1ZK8 A;  3F8N A;  4MQ9 F;  4ESB A;  2XV4 S;  4MEX F;  2ECC A;  3MKY B;  1I3Q J;  3HOX J;  4AIK A;  3A0H C;  2O5R A;  1S5L C;  4YFK F;  1A36 A;  5DCF A;  3ABU A;  1U9N A;  1R4N B;  5IY5 H;  1FT9 A;  2LYC A;  3TW6 A;  5BQT A;  3DTE A;  3M8J A;  1STZ A;  2V1U A;  4F55 A;  1MMN A;  3GLL A;  2YPR A;  2ZB9 A;  2LY1 A;  3IHU A;  3BTJ A;  1VF9 A;  2X4H A;  2L4M A;  3A02 A;  5ILS A;  3ZP5 A;  4HLY A;  1DP7 P;  2VBZ A;  1Z67 A;  1ETV A;  4XR6 A;  3F0C A;  1BC8 C;  1P7I A;  1OMI A;  2EFQ A;  3P5J A;  3F22 A;  2ICW G;  2VJJ A;  1X1A A;  1QZE A;  2A05 A;  2VN2 A;  2Y48 A;  1JUS A;  3BJO A;  4PJM A;  3RDI A;  3W2W A;  4EMS A;  3WTX C;  1WZ2 A;  1SAX A;  1R5H A;  2BVL A;  1AKH B;  4ABZ A;  4ON0 A;  1XGM A;  2DPU A;  4NC8 A;  2JUC A;  4PJ0 C;  2R7T A;  1J09 A;  1XMX A;  2K9S A;  2KLO A;  1HLV A;  3M07 A;  4X6A J;  1ZTR A;  1F36 A;  4A6D A;  3ONQ A;  4ANJ A;  2OTJ I;  4PGH A;  3CCS I;  2PN6 A;  4JP0 A;  3VSL A;  4BHC A;  1W7P A;  5H6Q A;  1IN7 A;  1G3W A;  3H9J A;  4CO8 A;  5HNF A;  1UAA A;  5CLS A;  2STT A;  5FKN A;  3AG2 H;  3IKV A;  5KNL A;  4IQJ A;  2LRE A;  1FLI A;  1Y56 A;  1JI8 A;  3PNY A;  1W5S A;  5JI6 A;  2Z33 A;  4ENM A;  2XRO A;  1JE8 A;  2FJ1 A;  1MMS A;  3FK6 A;  4FET A;  1VQM I;  1FBS A;  1HSJ A;  1APL C;  3EYY A;  1L3L A;  2F2E A;  4Z2Y A;  2IGK A;  3WHB A;  1MW7 A;  4IHW A;  4HDU A;  3PO2 J;  3FHN A;  3ZMD A;  3ZMT A;  2KDO A;  3HOY J;  2XC7 A;  1SVL A;  1POG A;  1RUN A;  1WRJ A;  3JAM Z;  4IJA A;  1VFC A;  3GWZ A;  1U3E M;  4E7S A;  3LSJ A;  4WXC A;  3G6E I;  2K4B A;  3HUG A;  2MGQ A;  3LL7 A;  1MH4 A;  4KDP A;  2RVC A;  1VQO I;  1QVT A;  3BTL A;  1ETY A;  1YLF A;  4BJ6 C;  2F6C A;  4FE4 A;  1A04 A;  1B8I A;  4KT5 C;  2Q8K A;  4R8H A;  1B72 B;  2DN0 A;  1JT0 A;  3F8F A;  1Y1V J;  5LHH A;  1D0Z A;  3E6M A;  1ENH A;  3VWB A;  5ILU A;  3UR3 C;  4HOB A;  3P9K A;  1J7K A;  2N8G A;  5KCM A;  2JT1 A;  2KFD A;  5CPR B;  4MFE A;  3GFI A;  2XGE A;  3RYR A;  1IAW A;  1G8X A;  2PMZ N;  5A2Q K;  1RC9 A;  2QSH X;  4IHT A;  3IH2 A;  3CCE I;  1P9Q C;  3MZY A;  3MD2 A;  3TDU C;  3OSF A;  4N4O B;  5KAF C;  3CCY A;  2HU9 A;  1Z7U A;  5EZH A;  2L9R A;  1FOY A;  2W85 A;  4YIF A;  1LPQ A;  1R7J A;  4XLN F;  1XMA A;  1LE8 B;  2QZ8 A;  5H6R A;  2NXN B;  1AHD P;  3FXL A;  2BY3 A;  3I5U A;  3JSO A;  4R79 A;  3QP6 A;  1YJW I;  1BI2 A;  2DYR H;  2FX0 A;  2E1O A;  3M8F A;  3HOT A;  4AM3 A;  2DJN A;  3RKW A;  1L0O C;  5EG0 A;  2L54 A;  1R36 A;  2RN7 A;  5J4Y A;  4E7K A;  1X3W B;  3B73 A;  3WE2 A;  1TQM A;  2YUS A;  3F23 A;  4A3E J;  5AON A;  2DT6 A;  3RKY A;  2DT5 A;  1IW7 F;  2QQ9 A;  5ED4 A;  3BRO A;  4B47 A;  5D5X B;  2I10 A;  4YEJ A;  2BW3 B;  4HEA 2;  4HF2 A;  3GME A;  2V26 A;  1BJZ A;  4BXX J;  1T2K A;  2Q2E A;  1FOK A;  2IS2 A;  5D6F A;  1YG2 A;  3HEF A;  4CYC A;  4NC7 A;  2HQR A;  5E17 F;  3I3L A;  4F3Q A;  1TQI A;  2EIK H;  1ONV A;  2XB0 X;  3H9Q A;  5LRS A;  2QBY A;  2XGX A;  1WI3 A;  1B4A A;  4E70 A;  3CCM I;  2RC4 A;  3AG1 H;  4IVN A;  2NVU B;  3C1D A;  2PJR A;  4P55 A;  1WFX A;  3DXJ F;  2LD5 A;  2O8K A;  4AIH A;  4PUS A;  3FIW A;  1HC8 A;  3TO9 A;  3UNG C;  3MMY B;  1BJA A;  1JUP A;  5IT9 Z;  2X48 A;  2DA1 A;  2DTZ A;  3MEX A;  2NNN A;  3DLL F;  3LAP A;  1F5T A;  4PFP A;  4MLO A;  1I1S A;  3WTV C;  1OCO H;  2R7D A;  5M5W J;  3C2H A;  4P9U A;  3R4K A;  3A0B C;  3HSR A;  2FOK A;  3LWF A;  3G71 I;  1KZH A;  2WA0 A;  1X19 A;  3KEO A;  1QQI A;  4GYI A;  3RZO J;  3N05 A;  2CS3 A;  3KX2 A;  4D0P A;  2H27 A;  3DF8 A;  4HX4 A;  4RAY A;  4HF1 A;  4O3M A;  1I3A A;  2MC4 A;  3GTK J;  1KYZ A;  2DI3 A;  3MKL A;  2E5N A;  3ZMZ A;  1YJN I;  4BEH B;  4RB0 A;  1ETX A;  4XKC A;  2K02 A;  3IP4 B;  4LB5 A;  4YEL A;  2XAS A;  3AL0 C;  1G3S A;  3QQA A;  2X1D A;  3E5Q A;  1TWC J;  1P6R A;  2DFF A;  1UST A;  1U0J A;  3IV5 A;  3R6S A;  2QKM B;  3HOU J;  1XB4 A;  3J7A O;  2DYS H;  4IZZ A;  4BH9 A;  1O7L A;  1X4O A;  3CCR I;  1TZL A;  4V2G A;  1ZGW A;  1CF7 B;  5CJ9 A;  2VC0 A;  1PP8 F;  2PFB A;  2HVR A;  2JA5 J;  2EZH A;  5E3L A;  3BG5 A;  1AKH A;  3QOD A;  2A6E F;  1ORK A;  1VZ0 A;  5BPD A;  2IJL A;  1BBY A;  1LUJ B;  3H36 A;  3BLY A;  2M45 A;  1E3O C;  4BXF A;  3DBL B;  2EH3 A;  1I50 J;  5L3G A;  2FOW A;  2WY8 Q;  3RSN A;  2RAE A;  1WI9 A;  1W0U A;  1FBU A;  2LKS A;  2G0E A;  2K85 A;  2VKV A;  4OIP F;  4UHT A;  2P6S A;  3JSP A;  4KIB A;  1SFU A;  4C3J J;  4Y4R A;  2RV8 A;  2W82 A;  1FJL A;  4JK1 X;  3WU0 A;  4CYD A;  4RAG A;  1FYM A;  1SVM A;  1H9T A;  4JOM A;  4P5O A;  2QKL B;  3LFK A;  2ME0 A;  4KN4 X;  2BVM A;  3GZ5 A;  3HM5 A;  4UV9 A;  4BGD A;  3BZK A;  2W00 A;  3O8G A;  2L9V A;  2OAZ A;  4L5E A;  2LKP A;  5E1Z B;  1GVD A;  2CQQ A;  4RAZ A;  4NQW A;  4ASN A;  1BA5 A;  3C3W A;  5D8K B;  5FLV A;  5FD5 A;  1XPX A;  5FRN A;  4MO7 A;  1MMA A;  3RZD J;  3H3Z A;  2Z2S B;  3JAM K;  2FMY A;  2K3P A;  2A3S A;  4HNV A;  1Z7L A;  2CGP A;  1K79 A;  3D1N I;  2M2E A;  1ETK A;  3LA7 A;  5EDN A;  2FQ3 A;  3DKX A;  3QWL A;  2LKX A;  2E1M C;  4A0X A;  1Y8R B;  4DBR A;  3K4B A;  4LMY A;  4BXU A;  2Y9Y A;  3EUH A;  1R49 A;  2HDW A;  4UXN A;  5F0C A;  3M8E A;  2L5Q A;  1KA8 A;  2L01 A;  4WXD A;  1WQ2 A;  1IXS B;  5CYV A;  3JRF A;  1WSU A;  3ASN H;  1MJA A;  1XDS A;  2ZC2 A;  1F4K A;  4GYG A;  5EF6 A;  4XON A;  1OCP A;  2R3S A;  2OZ6 A;  4CCJ A;  1Z6R A;  2ZJP F;  4IHV A;  4OAZ A;  4XRS A;  2QQA A;  3S1M J;  3CC7 I;  2EA4 A;  2DMN A;  4LLL A;  3O6B B;  1VQP I;  1MZB A;  1MSF C;  2VQC A;  5D4S A;  4U0Y A;  5H20 A;  1IJW C;  2NOG A;  2AHQ A;  1VQ9 I;  3A01 A;  4L9T A;  3KLN A;  5DTD A;  1W5T A;  3TED A;  2LSO A;  2ZNZ A;  2AQE A;  2M0C A;  2CJJ A;  2Q0O A;  3IC7 A;  3K4K A;  2CQX A;  4IRG A;  2FML A;  2G7U A;  4KNY A;  2DFE A;  5HOO A;  4LK0 F;  4D7N A;  4DOZ A;  3D5S C;  1VQ8 I;  4HLX A;  4A2U A;  2XAG A;  3RPQ A;  3OYG A;  3WTU C;  1I6H J;  1NHA A;  3JRE A;  4IHS A;  2QLZ A;  4BQA A;  1W5C C;  4H0E A;  2PI0 A;  4BAC A;  4PGG A;  4YFX F;  3E6C C;  2BV6 A;  4L0Z B;  3S2W A;  3A1Y A;  2MG4 A;  4NBQ A;  5FRM A;  4L0Y B;  2P5V A;  1P4A A;  3IL2 A;  4I02 A;  1Y8Q B;  2A61 A;  4YFN F;  5AIQ A;  2R5Y B;  1PUF A;  3OSG A;  5F6F A;  4AWX B;  5K7Z A;  3KE2 A;  2DQR A;  2VKD A;  4JBA A;  1QA6 A;  2IP2 A;  1EF4 A;  1RKT A;  4F93 B;  2QSF X;  5M5X J;  4IKF A;  2DU9 A;  2K40 A;  2WV1 A;  3BG3 A;  2EPF A;  3HXL A;  4HW0 A;  2K3F A;  3E6D A;  2R93 J;  3CZ6 A;  3K6G A;  3LAJ A;  2HI3 A;  1X1B A;  3UKG A;  5FKO A;  2HOT A;  3PUB A;  1N25 A;  2HFH A;  5D5U B;  3K4L A;  2R7W A;  3HOS A;  3RYP A;  1BOB A;  4NNJ A;  4XOP A;  4BQO A;  5BOX A;  3U1K A;  4CCK A;  4HST A;  4XLE A;  4D5F A;  3S1R J;  4AYB A;  3TP3 A;  2XF6 A;  1BR2 A;  4G7H F;  3MWM A;  2IS6 A;  2QEN A;  4HRI A;  2HPM A;  3I56 I;  4UUS A;  1VQK I;  1ETO A;  4BUP A;  1ZN2 A;  5JFR A;  5J6X A;  1UEL B;  4NUB A;  3KP6 A;  4EM0 B;  3F9K A;  3A4C A;  4CCL A;  5FLX K;  1RPW A;  3ESW B;  4ESF A;  3PSF A;  3JRH A;  4PZJ A;  1X1D A;  3VYS B;  1MDM B;  2Z5U A;  1ZYR F;  4OOI A;  2A6H F;  3C7J A;  3HKZ A;  1XD7 A;  3BQY A;  1D5V A;  4M72 A;  4UB6 C;  2M8G X;  3I0T A;  2P7C B;  2KMU A;  3NWS A;  3BG7 A;  2EJR A;  3MQ0 A;  2DA4 A;  3ZMU A;  3BCA A;  2PMU A;  2ELK A;  5DCM A;  3FZV A;  4KMU X;  3FBI B;  1RZ4 A;  3ERE D;  3BG9 A;  4A3L J;  4KIC A;  3WTT C;  3CUQ C;  3WTS C;  1ZG5 A;  2B9S A;  2D45 A;  1YTY A;  3K70 C;  2DA7 A;  5BNG A;  3H9G A;  2ADU A;  1PP7 U;  3CCQ I;  1AOY A;  1Z1D A;  5F64 A;  5K5Q A;  3CES A;  3MN2 A;  3DCF A;  2LTP A;  5GAE J;  1HCR A;  4OWR B;  2VPL A;  2ZFU A;  2IGN A;  3E5U A;  4C2M J;  2ZNY A;  1MMD A;  1HKS A;  4M6Y A;  2XB5 A;  3S32 A;  4DGW B;  4E7J A;  3E97 A;  3I59 B;  2M8E A;  4UY8 I;  3CO7 C;  1A31 A;  4CZZ A;  4E7I A;  2BY1 A;  3M1E A;  1BW6 A;  3S15 J;  3A2K A;  3Q9S A;  3WTW C;  4LIU A;  1FOX A;  2HZD A;  3KP4 A;  4Q4Z F;  1FMV A;  1S72 I;  4A3D J;  1ZRE A;  2HTS A;  1Y0N A;  1ZQ3 P;  3H92 A;  4I99 C;  2GXA A;  2MC3 A;  3IWF A;  4EEF G;  1Z3Y A;  2CQN A;  1YRN B;  1LDD A;  5JLX A;  4YRV A;  4EJT A;  1HOM A;  1EH7 A;  1ODD A;  4BBR J;  4J19 A;  3CDI A;  1LVA A;  3SEZ A;  3SYT A;  3DKW A;  2YU3 A;  4DIQ A;  2OC6 A;  4RDU A;  3KCC A;  9ANT A;  2W25 A;  3OIQ A;  5DYM A;  2XHK A;  2XAQ A;  1XTA A;  2ELJ A;  2OQR A;  4ZYH A;  3E0J B;  3I64 A;  3GTG J;  2ELH A;  2GLO A;  3G2B A;  2LY9 A;  1WJ5 A;  2V9V A;  2DW4 A;  3B6C A;  5JVT A;  1IRF A;  1P4X A;  2VT3 A;  1KON A;  2XPV A;  5E8I A;  3T8T A;  2MAB A;  2KKO A;  2V6E A;  1BI3 A;  2JUG A;  4IO9 F;  2G9W A;  4BY7 J;  2HQ5 A;  3KEY A;  4H4K C;  1WJF A;  3PO3 J;  2WY7 Q;  5DD4 A;  2JVH A;  4PSX A;  4L5I A;  2XAH A;  2ZME A;  2ZJR F;  1G3T A;  2RDP A;  2KIU A;  1T6S A;  1R22 A;  2MD0 A;  4A69 C;  1X1C A;  4A3F J;  3EUH C;  5LLQ A;  2WB1 A;  3BR3 A;  3ZMS A;  5GPA A;  4R1H A;  1OYY A;  3R0A A;  2O61 A;  3CJT B;  4HNU A;  1O4X A;  1H9G A;  1T98 A;  4C3I J;  3D0S A;  3VDX A;  4RGS A;  2CU7 A;  1QBJ A;  1V5E A;  2IXS A;  4G6Q A;  4C2T A;  3I4M J;  3R60 A;  1O3T A;  1UZC A;  5HS7 A;  3U21 A;  5E8G A;  1D5Y A;  4RBO A;  2UXN A;  3HGY A;  5HLI A;  1SEU A;  2EIN H;  1OCC H;  2MYS A;  4G7O F;  1TW3 A;  3K4M A;  2D2W A;  2RQP A;  4DYR A;  2ISY A;  2P5K A;  3CMY A;  1VQ4 I;  4I0A A;  5GTH C;  2E2I J;  2CW0 F;  1ZAR A;  3CJR B;  3BZC A;  2UXX A;  3CDL A;  5B66 C;  4BDY A;  2M4K A;  1NH3 A;  2OA4 A;  2YX7 A;  1Z3X A;  2WWY A;  4IOA F;  1ON1 A;  2RNJ A;  1P92 A;  2O7O A;  3G1L A;  1GXQ A;  3ZN0 A;  2EA2 A;  3O2P E;  2IA2 A;  5TRD A;  1S7A A;  2C6Y A;  3WGI A;  3MZH A;  4GFB A;  1BOA A;  4UB8 C;  2DTR A;  2BGC A;  4RAF A;  3J7Y J;  1HA8 A;  2W1O A;  2GXB A;  3FXQ A;  1QO0 D;  3T0Y A;  3RI4 A;  5HDG A;  1VTN C;  3Q9V A;  1FYL A;  2QQB A;  3JRD A;  3L2C A;  1U78 A;  1KQ9 A;  3DEE A;  4XRF A;  3OYL A;  4G12 A;  4N0B A;  2JN6 A;  1KQ8 A;  4WX9 A;  2BXY A;  2VQG A;  1U8B A;  2Z99 A;  1X2N A;  2EZK A;  3ABK H;  1DU0 A;  2HEO A;  2H6B A;  4BQQ A;  5CQE A;  3LSH A;  4M9S A;  5F1R A;  5BPI A;  2XRL A;  1EH8 A;  4S05 A;  4G9Y A;  3BZ6 A;  3CO6 C;  4LOC A;  2EV0 A;  4BL0 B;  3BPX A;  1QZY A;  1A6I A;  4A3M J;  3QPT A;  4EAT A;  3S1Q J;  2CV0 A;  1QRY A;  4EJV A;  2HWV A;  2JRM A;  4CIC A;  3SFZ A;  2GIV A;  2OQG A;  1FMW A;  1DDN A;  4XLC A;  1YIT I;  3K7A J;  5ICC A;  1USS A;  3O8H A;  1R9T J;  3FKJ A;  3BJA A;  1KU7 A;  5TJJ A;  1IUF A;  3TO7 A;  5BS6 A;  4EV0 A;  5FFZ A;  3ZRG A;  1LVK A;  3HGG A;  3LA2 A;  2CV2 A;  2LFB A;  2FQ4 A;  2LDU A;  2JQ7 A;  1Z6T A;  4RA2 A;  2JVG A;  5J40 A;  1MGT A;  2Y9Z A;  5E3M A;  1U5T B;  2BY2 A;  2F5D A;  2L9N A;  2DO7 A;  3KP7 A;  3S2H J;  4RB3 C;  1GV5 A;  3JTH A;  3NWT A;  1J59 A;  4WCG A;  4II2 A;  5C3E J;  4B43 A;  3AFH A;  3G1M A;  1JGS A;  3SDG A;  4S0H B;  3MFK A;  3CMA I;  3GTP J;  4AYB N;  1QNT A;  3M3Y J;  2KRH A;  4FCY A;  4M6X A;  3DQV C;  3RQ4 A;  4DYQ A;  1FC3 A;  3RIR A;  3I53 A;  3WU1 B;  4OIN F;  3DV8 A;  1LEA A;  2X1C A;  3B6A A;  4XIC A;  2HS5 A;  5C4J J;  3CLQ A;  2FEZ A;  5IT3 A;  2K27 A;  4LK1 F;  1YX5 A;  4A0Y A;  4XLP F;  3N4M A;  2BYV E;  3NRV A;  2EIJ H;  4ZYG A;  1PDN C;  2B7E A;  2CH0 A;  3K1N A;  2WV0 A;  1IDY A;  4ZC3 A;  3HKZ N;  2OPT A;  3OYN A;  2JSC A;  4DJA A;  2IGM A;  1BC7 C;  3GEZ A;  3AG3 H;  1RES A;  1X4P A;  2NS7 A;  2EBI A;  4C30 A;  2HXI A;  3GX4 X;  5IOY A;  3OYF A;  2EFN A;  3I59 A;  3V8J A;  3SZG A;  5D5W B;  1MKM A;  2EFW A;  1W1W E;  2HXO A;  1FZP B;  3PIO F;  4QIW N;  1B59 A;  5IOZ A;  4ZDP A;  1ACI A;  2L02 A;  1C0W A;  3H5N A;  3LSG A;  3VEP A;  3OL3 A;  1F9N A;  5FJ8 J;  1B9M A;  3HHG A;  4GCV A;  4LD5 A;  2OF7 A;  3CC2 I;  1T8I A;  3PJR A;  2PLY A;  1SFE A;  2VJ5 A;  5GAH J;  5HNH A;  5CKT A;  1UMQ A;  1DUX C;  3H5R A;  2VLA A;  2V9P A;  2BHY A;  4ZYD A;  2FXA A;  1JUM A;  3V8L A;  4BU2 A;  1B9N A;  1CQT A;  2P4W A;  1I39 A;  4L18 B;  1TQP A;  2L7K A;  5E18 F;  2VT2 A;  1FNN A;  3L1P A;  2VC1 A;  1FWZ A;  4A3I J;  3HOZ J;  1OFC X;  1QHG A;  3ECO A;  2IPQ X;  3DPT A;  3ZQG A;  1IGN A;  3LOC A;  4KIF A;  1JTX A;  1SD4 A;  2QF7 A;  4GGG A;  3S1N J;  3HG9 A;  1R1V A;  4M6V A;  2HVS A;  2WTE A;  2BOL A;  1S29 A;  1IUY A;  1MBJ A;  3BR1 A;  1I6X A;  2A68 F;  5LGU A;  1ZG3 A;  5E1X A;  2HYJ A;  3GZ6 A;  1R5I D;  3EET A;  1Y1W J;  3WE3 A;  3J81 Z;  3AG4 H;  1NK3 P;  3OOP A;  2ZME C;  1MBK A;  3G3Z A;  3QYE A;  4MFD A;  1BL0 A;  1GT0 C;  5E20 A;  3KET A;  2KIS A;  1ZGA A;  1D1A A;  2DMT A;  2RGV A;  3COA C;  3HOV J;  5TGT A;  4AUX A;  1M1E B;  3K1M A;  3FM3 A;  2MLK A;  4KT6 A;  1Y39 A;  1FIP A;  1SMT A;  2V1N A;  2Z3Y A;  3SEQ A;  3TOA A;  5FLX Z;  1UHS A;  2CUE A;  2GBY A;  2E7W A;  5K5O A;  4ENK A;  4XRS G;  2L3D A;  1J0R A;  2ZSI B;  3FM5 A;  5F04 A;  2LBF A;  3DP7 A;  1XC5 A;  1LDK B;  1MBG A;  3H3V K;  5KVR A;  2ZCW A;  1EA3 A;  4A93 J;  2L7Z A;  3FHZ A;  2VL8 A;  3KEQ A;  3K69 A;  3ZGK A;  4L9V A;  2ESH A;  1RR7 A;  5D5V B;  3CCJ I;  3QP5 A;  1MBF A;  2NS8 A;  1VI0 A;  1YW8 A;  2P8T A;  1BI0 A;  3SHF A;  1V5G A;  3PQK A;  4W97 A;  2YU9 J;  4MTE A;  5DEQ A;  1B6A A;  2PJP A;  1V3F A;  1N75 A;  4LLN A;  4FT8 A;  2LF7 A;  4KA4 A;  1O3S A;  1HDP A;  3HDD A;  3A03 A;  2GA2 A;  3HSE A;  5DM7 F;  3R61 A;  2BHZ A;  3GYH X;  4U0W A;  1B1B A;  4J00 A;  4CA0 A;  4FAS D;  5GPC A;  3ZCO A;  1S6L A;  1XMK A;  2ZFW A;  1ZRF A;  2ACJ A;  3HC7 A;  1QZZ A;  1WKM A;  2YX4 A;  2W84 A;  4A6E A;  1VQ7 I;  6PAX A;  3ISP A;  1ETQ A;  4IL6 C;  4HNT A;  3S3M A;  4HDV A;  1GVJ A;  1IV8 A;  2OD5 A;  4ZJZ A;  4GO1 A;  1TL8 A;  2JMW A;  4DZJ A;  4GDF A;  4CHU A;  1RNL A;  3K4J A;  1N77 A;  1FSH A;  3HBL A;  1ITY A;  2AXL A;  2HVQ A;  1WJC A;  4LJZ F;  2LP0 A;  2FU4 A;  3ECH A;  3Q0W A;  5ILV A;  3OY9 A;  2L7F P;  4XM3 A;  5J3L A;  5HS9 A;  3BDD A;  3FDY A;  2IS4 A;  4LG0 B;  4RB1 A;  3V42 A;  1ZRC A;  4I6Z A;  1K78 B;  2LR8 A;  3L00 A;  3FX3 A;  1MJB A;  2AO9 A;  3D5R C;  2CUJ A;  2ZJ2 A;  3RTR A;  5HOD A;  3E7L A;  3G4S I;  2R5Z B;  2IEK A;  2KJC A;  1QPM A;  3KZI C;  5HLH A;  2VB6 A;  5IP9 J;  3CME I;  2M9H A;  3GLX A;  2PQ8 A;  1LEB A;  2MD5 A;  2HR3 A;  4J01 A;  1KU3 A;  2CW7 A;  2F4I A;  3BJ6 A;  2WC2 A;  3BTI A;  1JKO C;  4BDZ A;  2F5C A;  2A6T A;  4XN0 A;  4AD9 A;  3MKZ A;  5L3E A;  1YS7 A;  2E1N A;  4UUT A;  3CQZ J;  2R7X A;  4QPQ A;  1NG6 A;  1S8N A;  1QPI A;  3WGG A;  5FRO A;  4ZZD A;  2R0Q C;  2CMP A;  5C4X J;  4M3D A;  4HZF A;  3SDB A;  2JRT A;  4BY1 J;  3ZQH A;  4E7H A;  3OYE A;  4CH7 A;  2HQA A;  3ZQI A;  1NTC A;  1WWX A;  3H1C A;  2V7F A;  4I7H A;  4OMY A;  3N97 A;  2X9D A;  5LGN A;  3WTZ A;  3ZQL A;  2R7O A;  5AIP A;  2Y2Z A;  1JHF A;  2EZL A;  4UVB A;  1B72 A;  1XSD A;  2MH9 A;  4QLC U;  2OBP A;  5KK1 A;  3ZOB A;  1I27 A;  2XKO A;  2LG4 A;  1Q1V A;  3OYH A;  1TTY A;  2KT0 A;  1KU2 A;  2NVY J;  2CFX A;  2XIG A;  3HHH A;  2WBM A;  1GDT A;  1NK2 P;  4JX6 A;  4F92 B;  5K5R A;  5K7F A;  1FTT A;  2GAU A;  1R6R A;  2CUF A;  4BE1 A;  1ZRD A;  1S3J A;  4RLQ A;  3ABM H;  3C2G A;  3LSM A;  2K9N A;  3K9T A;  1FOW A;  5EGO B;  3D5L A;  4IOC F;  2DFH A;  5L3F A;  5B1B H;  3RQI A;  4U88 A;  3S93 A;  4LLG F;  2P81 A;  4KIG A;  1P4W A;  3KZZ A;  1E3P A;  4IHX A;  3MCZ A;  3LQQ A;  2E5Z A;  4OMZ A;  2IBD A;  2LMD A;  2P5L C;  2DOD A;  1JT6 A;  3FMS A;  4RB2 C;  4ESJ A;  1LE8 A;  4Y3O A;  2TCT A;  4D1Q A;  4ZTJ A;  2UZK A;  1RUO A;  4C3H J;  1U8R A;  4PJL A;  2CQK A;  2ID3 A;  4U87 A;  4K2E A;  3GUD A;  5EJC A;  2VOO A;  4DQ2 A;  2IRF G;  3DFG A;  1J75 A;  2HKX A;  4UUV A;  1S7O A;  4G7Z F;  4BE0 A;  3S3N A;  1XSX A;  4YII A;  3ZMV A;  2VBY A;  1BR4 A;  3GFM A;  2XAJ A;  1FP2 A;  1Z21 A;  4EJU A;  2R92 J;  1N78 A;  1YQA A;  4HPQ A;  5CVR A;  4BYY A;  3LSR A;  1YIO A;  3MKW B;  3JW4 A;  2A07 F;  5KAI C;  2W7N A;  1S9H A;  2CW8 A;  5B5E C;  2BW3 A;  5FB2 A;  2RRE A;  5E3N A;  3LNQ A;  3HRU A;  4MQV A;  1K61 A;  1H89 C;  3E1S A;  2MLG A;  4E6K G;  3H0G J;  3F6V A;  4GRI A;  1JKP C;  1HW2 A;  3GXO A;  1TT5 B;  1ZG1 A;  4C2U A;  2CYY A;  1O7F A;  1OYW A;  2DOA A;  2YR2 A;  3AL0 B;  1D3Y A;  1I1G A;  3KP2 A;  1KGS A;  3REO A;  2ID6 A;  2Z1D A;  1X2M A;  1V5F A;  2J5P A;  2H1L A;  3J81 K;  3ABL H;  2H09 A;  4UVC A;  2VXD A;  1P7J A;  2COB A;  2HGC A;  4G8X A;  1QHH D;  3V7C A;  4UV8 A;  2F4M B;  2D5V A;  3DTK A;  4XQF A;  2LVS A;  3KFW X;  4BJT A;  2DQL A;  2FBK A;  2MBF A;  5JHF A;  3OYJ A;  5IP6 A;  5CVJ A;  5FGM A;  5JLW A;  2F5V A;  3LFU A;  1OIS A;  3K2A A;  5H2F C;  1EKE A;  4CSW A;  3SZP A;  3QPL A;  1IZ1 A;  1YW7 A;  1W7P B;  2HNH A;  3MZ8 A;  4AU7 A;  1HKQ A;  3HPH A;  3RJP A;  4XSZ F;  1RR8 C;  2PG4 A;  2DA2 A;  2KP6 A;  2L7M P;  1U6G A;  4MIM A;  1IRX A;  4PDK A;  5CVV A;  4A3C J;  3DPL C;  1X3U A;  2PBI A;  2X0L A;  5J8C A;  4RMN A;  4QWQ A;  2DOE A;  1JJ8 C;  2CG4 A;  2PEX A;  1R1U A;  2H6C A;  5GP9 A;  4XLF A;  2KQR A;  2L0K A;  1PJR A;  1K4T A;  1AWC A;  3S8P A;  2FBH A;  2GZW A;  3HTS B;  2XSJ C;  3DU6 A;  2VIX A;  3HSF A;  1LQ1 A;  4CDG A;  4BEH A;  3W6K B;  3H35 A;  3BPV A;  3KLO A;  1VQL I;  2VE8 A;  1OQY A;  2X6O A;  3GZN B;  2WAQ A;  3NAU A;  2FRH A;  5EZG A;  1VND A;  2R7F A;  2VAS A;  2KL4 A;  3HUG B;  2EQR A;  4B8X A;  2Y75 A;  3FIS A;  4FHT A;  4UNO A;  3JRG A;  1YFH A;  4L9J A;  4AC0 A;  5GTI C;  3GVA A;  1LJ9 A;  3K2Z A;  3V8K A;  4EM2 A;  1HDD C;  4DNC A;  1W4M A;  3CDH A;  4DW6 A;  1VQ6 I;  2HDD A;  5F0H A;  1B8I B;  1CF7 A;  2VQH A;  2TDX A;  2VKH A;  4ZTF A;  4X1E A;  3BP8 A;  1JHH A;  2M87 A;  4BHP A;  1K4S A;  1IN5 A;  2ZKZ A;  1LKX A;  2KPM A;  3CJQ B;  4W1U A;  1F43 A;  1YW9 A;  2E1M B;  2LLK A;  3LMM A;  1FTZ A;  4KN7 X;  4F7Z A;  1FSE A;  1BN5 A;  2EFP A;  3K70 D;  3FK7 A;  3PSI A;  4I98 B;  2GOM A;  3I71 A;  4B4C A;  3J7Z I;  4NDL A;  1XCV A;  2M0M A;  4EGY A;  3S16 J;  1DPU A;  3IAS 2;  4HQE A;  1ZKG A;  2W48 A;  1X1P A;  5FKM A;  3GTO J;  1BM9 A;  3DU5 A;  1G6N A;  2BE5 F;  2QUF A;  2M34 A;  5L3C A;  4WXH A;  3QPH A;  1BI1 A;  2M1B A;  2R7S A;  3VOD A;  1MH3 A;  1O57 A;  2MH2 A;  4V2F A;  1HBX G;  3OYM A;  2Z9O A;  3U1D A;  1QU3 A;  2G7H A;  2K7L A;  4RM3 A;  3OL4 A;  2UV1 A;  1G59 A;  4IHY A;  5J4V A;  4ENJ A;  4HG2 A;  3FXR A;  3ABT A;  1K7A A;  3ERM A;  3E5X A;  1P2F A;  5M3M J;  2OCE A;  2K9L A;  4JX4 A;  4A5N A;  5EG0 B;  1QGP A;  2CSO A;  5IYB J;  2H8R A;  2KDZ A;  3V7R A;  2NRA C;  2CRG A;  3S14 J;  1LFB A;  1IRZ A;  1MNE A;  5LEK A;  3ZXS A;  1PVE A;  3KP5 A;  1IN6 A;  1UJ8 A;  4E7Z A;  1IDZ A;  4KIS A;  3MVP A;  3OIP A;  4G6T B;  5L3B A;  4NB5 A;  2V4J C;  4BAY A;  3HL2 A;  1A5J A;  4M3G A;  2COM A;  3GTJ J;  1ZH5 A;  2R7U A;  2STW A;  4D7M A;  1GXP A;  1GHC A;  2GA1 A;  2Q2E B;  1JTY A;  2RQQ A;  4M3F A;  2X51 A;  1QVU A;  1ZR4 A;  5J1U A;  1JXS A;  4HV6 A;  2LK2 A;  2JPC A;  2O3F A;  2YSR A;  2P0W A;  2PX9 A;  4WWC A;  2DK8 A;  4CYC B;  3ZPL A;  1MSE C;  1WCM J;  5HLT A;  2QBY B;  5JHU A;  2H1K A;  2PJR B;  1T39 A;  1YIJ I;  4I2O A;  3ZR8 X;  2VI6 A;  2BY0 A;  2K4J A;  3ZQC A;  2Y31 A;  4V19 K;  2ZXW H;  4BS9 A;  3FXO A;  3TP0 A;  3L09 A;  2EV5 A;  5JVG F;  4NC6 A;  3BR2 A;  2O9L A;  2KRF A;  1XX5 A;  1OCZ H;  2KHM A;  1OCT C;  1UG2 A;  4D5C A;  1REP C;  4BKX A;  4GXO A;  4N9I A;  5E79 C;  4MTD A;  4HSR A;  1R00 A;  3VSK A;  1UCR A;  4AVP A;  1GV2 A;  3PM1 A;  2J5O A;  1TT0 A;  3CUO A;  1OJL A;  1G4D A;  3W6J B;  3DEW A;  4IX7 A;  5EEG A;  2DMQ A;  3OYD A;  2Y0S A;  1W36 D;  4IEJ A;  4WK8 F;  4I76 A;  1MIJ A;  2EK5 A;  3IKT A;  1TP4 A;  4LIT A;  2R5Y A;  1XG1 A;  1R1T A;  2M30 A;  5CVU A;  4JX5 A;  5K7H A;  3JRB A;  2DMU A;  2CQ7 A;  3QAH A;  4JYK A;  2LF8 A;  3CF2 A;  1MBE A;  1YO5 C;  4HA8 A;  4HV5 A;  1ERD A;  4LFU A;  1DGR M;  4BNC A;  3CUQ B;  3M1C A;  1HW5 A;  1V55 H;  1WHU A;  2R4G A;  3JTG A;  1Z9C A;  4KMF A;  2VPR A;  2EZI A;  1XS9 A;  3FXK A;  3GFJ A;  5HDK A;  4CZC A;  4KYW A;  2L9S A;  2B0L A;  1EJ9 A;  3GFL A;  3BR0 A;  3FWE A;  1HF0 A;  4N4N B;  3HRM A;  4YIR X;  4LG3 A;  4B1R A;  1R58 A;  3BOQ A;  2XGC A;  4Y33 A;  2QM3 A;  1Z77 A;  5DUK A;  3W3C A; 
#chains in the Genus database with same CATH homology
 2V6C A;  1SMY F;  1UHM A;  4LGW A;  1BIA A;  1MDM A;  2DPD A;  4IRI A;  2O03 A;  3GF2 A;  3KP3 A;  3MAJ A;  3F8M A;  4L5J A;  1IF1 A;  1J2X A;  1XCB A;  3HRT A;  4O6J A;  4HX7 A;  2P7V B;  2O8X A;  1O3Q A;  3WGH A;  2A5Y B;  5DDG A;  2NS0 A;  3NEU A;  3F72 A;  4BHB A;  4O5V A;  2XKP A;  4Y13 A;  4EGZ A;  3FXU A;  3HYI A;  1SFX A;  5LEJ A;  3FF5 A;  2ZXJ A;  3F8B A;  4EVI A;  2D1H A;  2AS5 F;  3FMQ A;  5K1Y A;  3WOD F;  3I4P A;  2A69 F;  2JPB A;  5J8F A;  4RS8 A;  1TBX A;  3T1B A;  4OIQ F;  5FFX A;  1J9I A;  2OU2 A;  3EYI A;  1IXR C;  3T5X A;  1Y0U A;  4Y15 A;  2HYF A;  3LA3 A;  2DAO A;  1FX7 A;  4Q5S F;  3P9I A;  4A5M A;  3M7G A;  4CGZ A;  4NHJ A;  3ML6 A;  1FP1 D;  1OKR A;  2OZU A;  4UVA A;  4FX0 A;  2RKH A;  5LBQ A;  1XGN A;  2XRN A;  2O0Y A;  2NYX A;  5JR3 A;  4HBL A;  1RIO H;  3K1P A;  2VE9 A;  3CLO A;  3K0L A;  3RKX A;  1EH6 A;  1J5Y A;  3EDP A;  2E7X A;  3PQJ A;  1KQ0 A;  2VXZ A;  5ERI A;  4AIJ A;  3P7N A;  4XSX F;  2H94 A;  2NAZ A;  1IN8 A;  1E17 A;  3LQR A;  2IW5 A;  5LGT A;  1XN7 A;  4KFC A;  2HOE A;  4U7B A;  1MJ9 A;  4I09 A;  3H3U A;  4PCQ A;  3L7W A;  3EQL F;  1R5G A;  1SD5 A;  3O3K A;  4L9N A;  2HZT A;  4Y17 A;  2VBW A;  3BY6 A;  2VOP A;  1ULY A;  5D4R A;  5DUI A;  4P96 A;  1XGS A;  2QYO A;  5DCM B;  3Q5F A;  5DV5 A;  1PUE E;  3LST A;  4EQQ A;  2ISZ A;  1V4R A;  4FX4 A;  4M9Z A;  3AAF A;  3CUQ A;  4U7D A;  3HIF A;  4M9X A;  4G6D A;  1O3R A;  1H0M A;  2EB7 A;  3ZN1 A;  1R23 A;  2FF4 A;  5HS8 A;  1XGO A;  1SD6 A;  2BEO A;  3CTA A;  2FBI A;  3GW2 A;  3C18 A;  4A0Z A;  3IWZ A;  1KYW A;  1U5T A;  1TNS A;  2EFO A;  4RGX A;  4M73 A;  2FE3 A;  4OU0 A;  1W7P D;  4HX8 A;  4EJW A;  2QVO A;  1IN4 A;  4OIR F;  5ICG A;  1KU9 A;  1SD7 A;  2VOD A;  5CVI A;  3HRS A;  1T0F A;  2M5W A;  2KJB A;  4A12 A;  2KIF A;  3F21 A;  1FY7 A;  5HLG A;  3E6B A;  1UB9 A;  1MD0 A;  2ZME B;  1OR7 A;  3WTY C;  2NNY A;  2D1V A;  3T8R A;  2QWW A;  1ZHF A;  3J80 Z;  2O6G E;  3B02 A;  4M74 A;  1ZLK A;  3SXY A;  1RI7 A;  2K86 A;  5HDN A;  3VFZ A;  2CWE A;  1YS6 A;  2GWR A;  3TGN A;  3PFI A;  3OV8 A;  1DPR A;  4S04 A;  1U2W A;  2V79 A;  1FYK A;  3P9C A;  3TKY A;  4Q48 A;  1UHW A;  2BBY A;  3KZY A;  4MGR A;  2P6T A;  1HQC A;  2ETH A;  3SZT A;  4KUM A;  2FNP A;  2VBX A;  4I0B A;  1TW2 A;  1IRG A;  2EWN A;  3F3X A;  1D8K A;  4IXA A;  2FSW A;  2JZY A;  2XAF A;  1TLH B;  3DEU A;  4ETS A;  3QRF F;  5ICF A;  1I5Z A;  2FNA A;  2LNB A;  3BWG A;  4ZYE A;  1OYI A;  3ULQ B;  2GXG A;  4M71 A;  1IXC A;  4HQM A;  3I58 A;  4RGU A;  5L3D A;  2HDC A;  5DD8 A;  1ON2 A;  2IVM A;  4XBF A;  1LB2 A;  3L9F A;  2MA3 A;  4G94 A;  5D6E A;  3QU6 A;  2F5F A;  2GQQ A;  3VOE A;  2VON A;  2L4A A;  4I01 A;  3V7S A;  1FBQ A;  2ESN A;  4HYE A;  3RPU A;  4ZH4 F;  4P9F A;  1HW1 A;  4MNU A;  4EM1 A;  1BIB A;  2V1X A;  1K6O A;  1EV7 A;  2DLL A;  4HF0 A;  3TDZ C;  4TV7 A;  1Z05 A;  5IT9 K;  3NQO A;  5FD6 A;  3I54 A;  3F8C A;  3ROU A;  3SQN A;  5FO5 A;  3QOP A;  1TNT A;  2XVC A;  4MHG A;  3TO6 A;  1Q1H A;  3QU3 A;  5A2Q Z;  1XDU A;  4HAM A;  3M9A A;  1F1Z A;  4ENN A;  4LB6 B;  2V1D A;  4B09 A;  4LG0 A;  1K78 A;  3R0J A;  3CJN A;  4YG2 F;  1YYV A;  5LRR A;  1OPC A;  2F5E A;  1G3Y A;  2DFI A;  3FMR A;  2PMH A;  4EJO A;  2HTJ A;  1D8J A;  1E2X A;  3VB2 A;  5LHI A;  2W57 A;  1U5T C;  1UFM A;  3F6O A;  3U9G A;  2IA0 A;  4ZZL A;  1ZGJ A;  4RGR A;  2E1C A;  4MEY F;  2FA5 A;  2JTV A;  1HKT A;  5ICE A;  2DK5 A;  3U2R A;  3IRR A;  3G73 A;  2IA1 A;  2EV6 A;  4N9H A;  3IRQ A;  4Q47 A;  4IRH A;  3WG9 A;  5E1W A;  2KIM A;  1ZLJ A;  2CO5 A;  1LDJ A;  2IT0 A;  3HTU A;  3ZQ7 A;  5BMZ A;  2HKO A;  2HQN A;  1FPQ A;  3TQN A;  2XUB A;  2Y0M A;  2HYG D;  1CGP A;  3ELK A;  5EEH A;  1HXD A;  1XSV A;  5HVQ C;  4IPA A;  4U0V A;  4OIO F;  3GO5 A;  2ZO4 A;  3V4G A;  1ZAO A;  1LNW A;  2W24 A;  5LHG A;  2DBB A;  3TOB A;  3J80 K;  1HST A;  1T38 A;  2UWM A;  5D8L B;  3E3V A;  4WF2 A;  4JQF A;  4IF4 A;  1Z91 A;  4CXF A;  2ZBK A;  3F8N A;  4ESB A;  4MQ9 F;  2XV4 S;  4MEX F;  4AIK A;  4YFK F;  5DCF A;  3ABU A;  1FT9 A;  5BQT A;  1STZ A;  2V1U A;  2YPR A;  3IHU A;  4HLY A;  3ZP5 A;  2X4H A;  5ILS A;  2L4M A;  1DP7 P;  2VBZ A;  1BC8 C;  1OMI A;  2EFQ A;  3F22 A;  3BJO A;  3RDI A;  2VN2 A;  2Y48 A;  4EMS A;  3WTX C;  1SAX A;  1R5H A;  4ON0 A;  1XGM A;  2DPU A;  4A6D A;  4PGH A;  2PN6 A;  4BHC A;  1W7P A;  5H6Q A;  1IN7 A;  1G3W A;  4CO8 A;  5CLS A;  2STT A;  3IKV A;  1FLI A;  1W5S A;  5JI6 A;  2Z33 A;  4ENM A;  2XRO A;  1JE8 A;  1HSJ A;  1FBS A;  3EYY A;  1L3L A;  2F2E A;  4Z2Y A;  4HDU A;  3ZMD A;  3ZMT A;  1RUN A;  3JAM Z;  1WRJ A;  4IJA A;  1U3E M;  3GWZ A;  4WXC A;  2K4B A;  3HUG A;  4KDP A;  2RVC A;  1YLF A;  1A04 A;  4KT5 C;  2Q8K A;  4R8H A;  3F8F A;  5LHH A;  3E6M A;  5ILU A;  4HOB A;  3P9K A;  1J7K A;  2JT1 A;  3GFI A;  3RYR A;  1IAW A;  5A2Q K;  4IHT A;  3MZY A;  3TDU C;  1Z7U A;  2W85 A;  4YIF A;  1R7J A;  4XLN F;  1XMA A;  2QZ8 A;  5H6R A;  3I5U A;  3JSO A;  4R79 A;  3QP6 A;  1BI2 A;  3M8F A;  3HOT A;  3RKW A;  1L0O C;  2L54 A;  1R36 A;  2RN7 A;  3B73 A;  3WE2 A;  1TQM A;  3F23 A;  5AON A;  3RKY A;  2DT5 A;  1IW7 F;  2QQ9 A;  5ED4 A;  3BRO A;  5D5X B;  4HF2 A;  1T2K A;  2Q2E A;  1FOK A;  5D6F A;  1YG2 A;  2HQR A;  5E17 F;  1TQI A;  1ONV A;  5LRS A;  2QBY A;  2XGX A;  1B4A A;  4E70 A;  2RC4 A;  4IVN A;  3C1D A;  4P55 A;  3DXJ F;  4AIH A;  3TO9 A;  1BJA A;  5IT9 Z;  3MEX A;  2NNN A;  3LAP A;  1F5T A;  1I1S A;  3WTV C;  2R7D A;  4P9U A;  3R4K A;  3HSR A;  2FOK A;  3LWF A;  3KEO A;  1QQI A;  4GYI A;  4D0P A;  2H27 A;  3DF8 A;  4HX4 A;  4RAY A;  4HF1 A;  4O3M A;  1KYZ A;  2DI3 A;  3ZMZ A;  4RB0 A;  2K02 A;  4LB5 A;  2XAS A;  1G3S A;  3E5Q A;  1P6R A;  1UST A;  3R6S A;  1XB4 A;  3J7A O;  4BH9 A;  1O7L A;  1CF7 B;  5CJ9 A;  2VC0 A;  1PP8 F;  2PFB A;  2A6E F;  5BPD A;  2IJL A;  1BBY A;  2M45 A;  5L3G A;  1WI9 A;  1FBU A;  4OIP F;  4UHT A;  2P6S A;  3JSP A;  4KIB A;  1SFU A;  2RV8 A;  4JK1 X;  3WU0 A;  4CYD A;  1FYM A;  1H9T A;  4P5O A;  3LFK A;  4KN4 X;  3GZ5 A;  4UV9 A;  5E1Z B;  2OAZ A;  2LKP A;  4RAZ A;  4NQW A;  4ASN A;  3C3W A;  5D8K B;  5FD5 A;  3H3Z A;  3JAM K;  2FMY A;  2A3S A;  2CGP A;  1K79 A;  3LA7 A;  2FQ3 A;  4A0X A;  4LMY A;  4BXU A;  3EUH A;  4UXN A;  3M8E A;  1KA8 A;  2L01 A;  4WXD A;  1WQ2 A;  1IXS B;  5CYV A;  1WSU A;  1MJA A;  1XDS A;  1F4K A;  4GYG A;  2R3S A;  2OZ6 A;  1Z6R A;  2QQA A;  2EA4 A;  4LLL A;  3O6B B;  1MZB A;  5D4S A;  4U0Y A;  5H20 A;  4L9T A;  3KLN A;  1W5T A;  2LSO A;  2ZNZ A;  2Q0O A;  3IC7 A;  4IRG A;  2FML A;  2G7U A;  4KNY A;  5HOO A;  4LK0 F;  4HLX A;  4A2U A;  2XAG A;  3RPQ A;  3WTU C;  1NHA A;  4IHS A;  2QLZ A;  4BQA A;  4H0E A;  2PI0 A;  4PGG A;  4YFX F;  3E6C C;  2BV6 A;  4L0Z B;  3S2W A;  4L0Y B;  2P5V A;  1P4A A;  3IL2 A;  4I02 A;  2A61 A;  4YFN F;  5AIQ A;  5F6F A;  4AWX B;  3KE2 A;  2DQR A;  4JBA A;  2IP2 A;  2DU9 A;  4HW0 A;  3E6D A;  3LAJ A;  2HFH A;  5D5U B;  3HOS A;  3RYP A;  5BOX A;  4G7H F;  3MWM A;  2QEN A;  1ZN2 A;  5JFR A;  5J6X A;  3KP6 A;  4EM0 B;  5FLX K;  4ESF A;  4PZJ A;  1MDM B;  2Z5U A;  1ZYR F;  4OOI A;  2A6H F;  3C7J A;  1XD7 A;  1D5V A;  4M72 A;  2P7C B;  3I0T A;  2EJR A;  3MQ0 A;  3ZMU A;  2PMU A;  5DCM A;  3FZV A;  4KMU X;  3ERE D;  1RZ4 A;  4KIC A;  3WTT C;  3CUQ C;  3WTS C;  1ZG5 A;  2D45 A;  1YTY A;  2ADU A;  1PP7 U;  1AOY A;  1Z1D A;  5F64 A;  5K5Q A;  3E5U A;  2ZNY A;  1HKS A;  4M6Y A;  3E97 A;  3I59 B;  2M8E A;  3CO7 C;  4CZZ A;  3M1E A;  3Q9S A;  3WTW C;  4Q4Z F;  3KP4 A;  1ZRE A;  2HTS A;  3H92 A;  2MC3 A;  3IWF A;  1LDD A;  4EJT A;  1EH7 A;  1ODD A;  1LVA A;  3DKW A;  2YU3 A;  3KCC A;  2W25 A;  5DYM A;  2XHK A;  2XAQ A;  2OQR A;  4ZYH A;  3I64 A;  2ELH A;  2V9V A;  2DW4 A;  5JVT A;  1IRF A;  1P4X A;  2VT3 A;  5E8I A;  3T8T A;  2KKO A;  1BI3 A;  2G9W A;  5DD4 A;  4L5I A;  2XAH A;  2ZME A;  1G3T A;  2RDP A;  2KIU A;  1T6S A;  1R22 A;  5LLQ A;  3ZMS A;  4R1H A;  1OYY A;  3R0A A;  2O61 A;  1H9G A;  1T98 A;  3D0S A;  4RGS A;  1QBJ A;  4G6Q A;  3R60 A;  1O3T A;  5HS7 A;  5E8G A;  2UXN A;  5HLI A;  4G7O F;  1TW3 A;  2D2W A;  2RQP A;  2ISY A;  2P5K A;  4I0A A;  2CW0 F;  1ZAR A;  2UXX A;  2OA4 A;  2YX7 A;  2WWY A;  1ON1 A;  2RNJ A;  1P92 A;  1GXQ A;  3ZN0 A;  2EA2 A;  3O2P E;  2IA2 A;  5TRD A;  1S7A A;  2C6Y A;  3WGI A;  3MZH A;  1BOA A;  2DTR A;  2BGC A;  2GXB A;  3FXQ A;  1QO0 D;  3T0Y A;  3RI4 A;  5HDG A;  1VTN C;  3Q9V A;  1FYL A;  2QQB A;  3L2C A;  1U78 A;  1KQ9 A;  4XRF A;  4N0B A;  1KQ8 A;  4WX9 A;  2Z99 A;  2HEO A;  2H6B A;  4M9S A;  5F1R A;  5BPI A;  1EH8 A;  4S05 A;  4G9Y A;  3BZ6 A;  3CO6 C;  2EV0 A;  3BPX A;  1QZY A;  3QPT A;  4EJV A;  2HWV A;  4CIC A;  3SFZ A;  2GIV A;  2OQG A;  1DDN A;  5ICC A;  1USS A;  3BJA A;  1KU7 A;  5TJJ A;  3TO7 A;  5BS6 A;  4EV0 A;  5FFZ A;  3LA2 A;  2LDU A;  1Z6T A;  1MGT A;  1U5T B;  2F5D A;  2DO7 A;  3KP7 A;  4RB3 C;  3JTH A;  1J59 A;  4WCG A;  1JGS A;  3MFK A;  1QNT A;  4M6X A;  3DQV C;  1FC3 A;  3RIR A;  3I53 A;  3WU1 B;  4OIN F;  3DV8 A;  1LEA A;  2HS5 A;  2FEZ A;  5IT3 A;  2K27 A;  4LK1 F;  4A0Y A;  4XLP F;  3N4M A;  2BYV E;  3NRV A;  4ZYG A;  1PDN C;  3K1N A;  2WV0 A;  2JSC A;  1BC7 C;  3GEZ A;  3GX4 X;  2EFN A;  3I59 A;  3V8J A;  5D5W B;  1MKM A;  2EFW A;  1FZP B;  1B59 A;  2L02 A;  1C0W A;  3VEP A;  1F9N A;  1B9M A;  3HHG A;  4GCV A;  4LD5 A;  2PLY A;  1SFE A;  1DUX C;  4ZYD A;  2FXA A;  3V8L A;  1B9N A;  2P4W A;  4L18 B;  1TQP A;  5E18 F;  2VT2 A;  1FNN A;  2VC1 A;  1FWZ A;  3ECO A;  2IPQ X;  3DPT A;  4KIF A;  4GGG A;  1SD4 A;  1R1V A;  2WTE A;  1S29 A;  1IUY A;  1I6X A;  2A68 F;  5LGU A;  1ZG3 A;  5E1X A;  3GZ6 A;  3EET A;  3WE3 A;  3J81 Z;  3OOP A;  3G3Z A;  5E20 A;  3KET A;  1ZGA A;  2RGV A;  3COA C;  3K1M A;  3FM3 A;  2MLK A;  1SMT A;  2Z3Y A;  3TOA A;  5FLX Z;  2E7W A;  5K5O A;  4ENK A;  2L3D A;  1J0R A;  3FM5 A;  3DP7 A;  1LDK B;  5KVR A;  2ZCW A;  3FHZ A;  3KEQ A;  3K69 A;  4L9V A;  2ESH A;  5D5V B;  3QP5 A;  1YW8 A;  2P8T A;  1BI0 A;  3SHF A;  3PQK A;  4MTE A;  5DEQ A;  1B6A A;  2PJP A;  1V3F A;  4LLN A;  4FT8 A;  2LF7 A;  4KA4 A;  1O3S A;  3HSE A;  2GA2 A;  3R61 A;  3GYH X;  4U0W A;  1B1B A;  1S6L A;  1XMK A;  2ZFW A;  1ZRF A;  2ACJ A;  1QZZ A;  1WKM A;  2YX4 A;  2W84 A;  4A6E A;  6PAX A;  3ISP A;  4HDV A;  1GVJ A;  2OD5 A;  4GO1 A;  4CHU A;  1RNL A;  1FSH A;  2AXL A;  4LJZ F;  2FU4 A;  3ECH A;  5ILV A;  5HS9 A;  3BDD A;  4LG0 B;  4RB1 A;  1ZRC A;  1K78 B;  3L00 A;  3FX3 A;  1MJB A;  2ZJ2 A;  3RTR A;  2KJC A;  1QPM A;  5HLH A;  3GLX A;  2PQ8 A;  1LEB A;  2MD5 A;  2HR3 A;  1KU3 A;  3BJ6 A;  2WC2 A;  2F5C A;  4AD9 A;  5L3E A;  1YS7 A;  2E1N A;  1S8N A;  3WGG A;  4ZZD A;  4HZF A;  2JRT A;  1WWX A;  4I7H A;  4OMY A;  3N97 A;  5LGN A;  3WTZ A;  5AIP A;  1JHF A;  4UVB A;  1XSD A;  2MH9 A;  4QLC U;  2OBP A;  5KK1 A;  1I27 A;  2XKO A;  1TTY A;  1KU2 A;  2CFX A;  2XIG A;  3HHH A;  5K5R A;  2GAU A;  1ZRD A;  1S3J A;  3K9T A;  3D5L A;  5L3F A;  4U88 A;  4LLG F;  4KIG A;  1P4W A;  3KZZ A;  3MCZ A;  3LQQ A;  4OMZ A;  2P5L C;  3FMS A;  4RB2 C;  4ESJ A;  2UZK A;  1RUO A;  1U8R A;  2CQK A;  4K2E A;  3GUD A;  2VOO A;  4DQ2 A;  2IRF G;  3DFG A;  1J75 A;  2HKX A;  4UUV A;  1S7O A;  4G7Z F;  1XSX A;  4YII A;  3ZMV A;  2VBY A;  3GFM A;  2XAJ A;  1FP2 A;  4EJU A;  1YQA A;  5CVR A;  4BYY A;  1YIO A;  3JW4 A;  2A07 F;  5FB2 A;  3HRU A;  4MQV A;  2MLG A;  3F6V A;  1HW2 A;  3GXO A;  1ZG1 A;  2CYY A;  1O7F A;  1OYW A;  2YR2 A;  1D3Y A;  1I1G A;  3KP2 A;  1KGS A;  3REO A;  2J5P A;  3J81 K;  2H09 A;  4UVC A;  4G8X A;  2HGC A;  3V7C A;  4UV8 A;  3KFW X;  2DQL A;  2FBK A;  2MBF A;  5CVJ A;  5FGM A;  3SZP A;  1IZ1 A;  1YW7 A;  1W7P B;  1HKQ A;  3RJP A;  4XSZ F;  2PG4 A;  4PDK A;  5CVV A;  1U6G A;  3DPL C;  1X3U A;  2PBI A;  2X0L A;  5J8C A;  4QWQ A;  2CG4 A;  2PEX A;  1R1U A;  2H6C A;  1AWC A;  2FBH A;  2GZW A;  3HTS B;  1LQ1 A;  3HSF A;  4CDG A;  3W6K B;  3BPV A;  3KLO A;  2VE8 A;  2FRH A;  2R7F A;  4B8X A;  2Y75 A;  4FHT A;  4UNO A;  1YFH A;  4L9J A;  3GVA A;  1LJ9 A;  3K2Z A;  3V8K A;  4EM2 A;  4DNC A;  1W4M A;  3CDH A;  1CF7 A;  2TDX A;  3BP8 A;  1JHH A;  2M87 A;  4BHP A;  1IN5 A;  2ZKZ A;  1YW9 A;  4KN7 X;  4F7Z A;  1FSE A;  1BN5 A;  2EFP A;  4I98 B;  3I71 A;  1XCV A;  4EGY A;  1DPU A;  4HQE A;  1BM9 A;  1G6N A;  2BE5 F;  2QUF A;  5L3C A;  4WXH A;  3QPH A;  1BI1 A;  2M1B A;  3VOD A;  1O57 A;  2MH2 A;  1HBX G;  2Z9O A;  3U1D A;  2G7H A;  2K7L A;  4ENJ A;  3FXR A;  3ABT A;  1K7A A;  3E5X A;  1P2F A;  4A5N A;  1QGP A;  2CSO A;  3V7R A;  2NRA C;  5LEK A;  3KP5 A;  1IN6 A;  5L3B A;  4NB5 A;  4BAY A;  2COM A;  1ZH5 A;  2STW A;  1GXP A;  1GHC A;  2GA1 A;  1JXS A;  4HV6 A;  2JPC A;  2O3F A;  2YSR A;  4WWC A;  2DK8 A;  3ZPL A;  2QBY B;  5JHU A;  1T39 A;  4I2O A;  2K4J A;  3L09 A;  2EV5 A;  2KRF A;  1REP C;  4GXO A;  4N9I A;  4MTD A;  1R00 A;  1UCR A;  4AVP A;  2J5O A;  3CUO A;  1G4D A;  3W6J B;  5EEG A;  4WK8 F;  2EK5 A;  3IKT A;  1R1T A;  2M30 A;  5CVU A;  3QAH A;  2LF8 A;  1YO5 C;  4HA8 A;  4HV5 A;  4LFU A;  4BNC A;  3CUQ B;  1HW5 A;  3JTG A;  1Z9C A;  4KMF A;  3GFJ A;  5HDK A;  4KYW A;  2B0L A;  3GFL A;  3FWE A;  3HRM A;  1R58 A;  3BOQ A;  2QM3 A;  5DUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...