2LSOA

Solution nmr structure of the globular domain of human histone h1x, northeast structural genomics consortium (nesg) target hr7057a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A
rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords Histone H1x
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lsoA00
4L9TA 1SD5A 1TQMA 2G7HA 2HKXA 3VOEA 1U6GA 3I0TA 3I59A 5HLIA 3S2WA 1ZRCA 4S05A 1YO5C 1C0WA 2IP2A 1BI0A 4F7ZA 4HF2A 4MEXF 1OYYA 1WQ2A 1I6XA 5E18F 2VT3A 2IA0A 4MQ9F 1F4KA 1LEAA 1ZLKA 2E7XA 1S6LA 3E5QA 3I5UA 2RV8A 4RGRA 4HV6A 2J5PA 4G6DA 5FLXZ 1O3TA 3BZ6A 1HSJA 3O2PE 1Z91A 3BDDA 4EJUA 3F3XA 4LLGF 2UXXA 1MD0A 3C7JA 5J8FA 1B59A 3RTRA 3P7NA 3GZ5A 1RIOH 3KLOA 1YQAA 4G8XA 5E8IA 4ZYEA 1RI7A 4BHBA 4R8HA 5A2QZ 3RI4A 2L54A 1XSDA 1Z7UA 2DTRA 3ZMZA 1BI2A 2A69F 3T8TA 3MQ0A 3WGGA 1G3SA 2DW4A 2XV4S 2OZUA 3F72A 1J59A 2FBHA 2HKOA 5H6QA 1ON2A 1OR7A 2DPDA 2Z99A 5HVQC 1P4WA 1JXSA 2O03A 4A0YA 2GA2A 4I98B 1KU7A 1TNSA 5LRRA 2FA5A 2XUBA 2KRFA 3FM3A 1P4XA 3E6CC 1XN7A 3ERED 1R00A 3KFWX 4ENKA 1DP7P 1IXCA 4O3MA 2H09A 4HBLA 5D4RA 1FY7A 4UXNA 2XKPA 4MQVA 2HTJA 2QM3A 4A0XA 3BY6A 1DPUA 3L00A 4ZH4F 4NB5A 2FBIA 2ZMEB 3KP6A 1ZGAA 1O57A 1OKRA 1EV7A 2W25A 2Y48A 4GO1A 4AIJA 5D6FA 5IT9K 2EA4A 1HW2A 1H9TA 2LNBA 2P5KA 5DCFA 3TGNA 2V1XA 3H92A 2WTEA 1W7PA 4LK1F 3HRMA 3FXUA 1Z05A 4QLCU 3WTTC 4KYWA 2GWRA 3ZMTA 1SD6A 5F64A 4XBFA 1W5SA 1GHCA 3I64A 3WE3A 4KN7X 3QOPA 1A04A 3DEUA 3QAHA 4LD5A 3I54A 1BN5A 5H6RA 2IA2A 1R7JA 1IN5A 4I2OA 4PGGA 4M74A 3O6BB 5FB2A 4A6EA 2DU9A 4WCGA 4I0BA 2YU3A 2LDUA 2XGXA 1QO0D 3HOTA 2OAZA 1LQ1A 1RZ4A 2ZBKA 2D45A 1J0RA 3HUGA 3ECOA 4S04A 1FOKA 2H94A 2HYFA 5ICCA 1STZA 1T39A 1B4AA 3TO7A 3KCCA 3FMQA 4OOIA 3W6KB 2H6BA 5JR3A 3JTHA 4IRIA 1FBQA 1H0MA 1OYIA 4LB6B 5CVRA 3BJOA 4RAYA 2HOEA 4M6XA 2E1NA 4Y17A 2HFHA 4KIBA 2KIMA 1HKTA 1OPCA 3RYPA 4LG0A 2CYYA 1IW7F 2WWYA 2VE9A 4AD9A 4KFCA 2WC2A 1IN6A 3LA3A 1BC7C 1OYWA 3VODA 3GYHX 1P6RA 2IVMA 2EFNA 3HTSB 5D6EA 3GW2A 5HS9A 4N9HA 3I4PA 3HYIA 4ZYDA 1IRGA 1ZYRF 2EFOA 2RKHA 4AVPA 3HRUA 4CHUA 1KGSA 1RNLA 2O0YA 5AONA 2OBPA 3WE2A 4MTDA 4HA8A 1UHWA 3IWFA 1FP2A 1G3TA 1AWCA 1K7AA 5FD5A 5FO5A 5L3GA 3M8EA 3NQOA 2V1DA 1R5HA 2HEOA 5K5QA 2G7UA 1XCVA 1HBXG 1B6AA 4AIHA 3FHZA 2ZNZA 5L3EA 5D8KB 1J2XA 3ISPA 2EWNA 1FX7A 2M45A 2EV0A 3KP7A 3U1DA 3C18A 4CGZA 4WK8F 3VB2A 3WU1B 3ZMDA 2P6TA 1LVAA 1ONVA 2JT1A 2MBFA 3CTAA 2O6GE 2QWWA 2IA1A 2CW0F 3P9KA 3GZ6A 4M6YA 2MLKA 2MC3A 3U2RA 4N9IA 2Z33A 1SFUA 3KP4A 3C3WA 1PDNC 4E70A 4IRHA 2ZCWA 1T2KA 3HSEA 3HRSA 3CDHA 2OZ6A 2NNYA 2HDCA 4KICA 2AXLA 2DAOA 4YIFA 1SAXA 4BQAA 1MDMA 4FX0A 3K1MA 5LHHA 1HXDA 3MEXA 1E17A 1HKQA 2HWVA 3DPTA 2Z5UA 2CSOA 2F2EA 2UZKA 4B8XA 1SFXA 2FNAA 2K86A 1ZGJA 2K02A 1L3LA 3F8FA 4NQWA 1K79A 1EH7A 6PAXA 2Z9OA 1MZBA 4ENNA 2JRTA 5E8GA 4EJVA 1RUOA 1FNNA 1DDNA 3PQJA 2W84A 3G73A 4LLNA 2DO7A 1JE8A 2MLGA 2ETHA 1R1TA 4UV9A 5LEJA 2Z3YA 4Q4ZF 4GCVA 3GLXA 1KU2A 1IN4A 3I53A 2XIGA 4ESBA 3J81K 3WTYC 2WV0A 1IAWA 1OMIA 2HYGD 5DUIA 1WSUA 2FOKA 1XGOA 2HZTA 1YS7A 4PGHA 4MTEA 4DQ2A 2VC1A 1O7FA 3V4GA 1O3RA 2KKOA 4P9FA 3U9GA 4U0YA 3QPHA 2XKOA 4BAYA 1S3JA 3CUQC 1UB9A 2MH2A 3F8BA 2DQRA 1IXRC 1BI3A 5E1XA 5KVRA 2RN7A 3OV8A 1ZG5A 2LSOA 2RNJA 3BWGA 2K27A 3KZZA 4HOBA 3F8MA 4BHCA 4WXCA 3MCZA 2VBZA 3SZPA 2GIVA 1SMTA 3V7RA 4L9JA 5BPDA 1YFHA 1Z9CA 3EETA 1ZG3A 4IVNA 5JHUA 2XAGA 5E17F 2IRFG 5ILVA 1KQ0A 3V7SA 5AIQA 1R36A 1U5TB 3W6JB 3FMSA 3EYYA 3LSTA 2NRAC 4FHTA 4RS8A 2MH9A 4HX7A 3ZN1A 3DQVC 1VTNC 2ZKZA 3TOBA 4XLNF 5JVTA 3VFZA 3WTSC 3MAJA 3D0SA 5EEHA 3TOAA 5DCMB 1SD4A 1J7KA 2QQ9A 1QQIA 4OINF 1U2WA 3BOQA 2FE3A 1K6OA 2DFIA 2LF8A 2GQQA 4L0YB 4A12A 4YG2F 4A5NA 1UFMA 1EH6A 4OMZA 4G6QA 4GGGA 3E6DA 1O7LA 4YFXF 4ESFA 2QZ8A 3COAC 1XDSA 4LG0B 3QU6A 5CVVA 1W4MA 4YFKF 2EV6A 4UV8A 1MJAA 2A6EF 5LRSA 3IRRA 1LJ9A 4WXHA 3R0JA 5CVIA 3GX4X 4PZJA 2F5DA 4IXAA 1XGNA 2LF7A 2F5FA 4RB3C 3KZYA 3H3UA 4BH9A 3ML6A 2XAFA 4MEYF 2DK5A 3QPTA 1Z1DA 2QQBA 1FBUA 4P9UA 1X3UA 4O5VA 4EGZA 4Y13A 1KQ9A 1HW5A 4KMFA 4BHPA 5TRDA 5ILUA 4AWXB 4I7HA 5HDKA 1FSHA 2QENA 2UXNA 1JHHA 3WTUC 1PP7U 5ILSA 3JSPA 4CO8A 4UNOA 2IJLA 3JAMZ 3B02A 3KEOA 4OU0A 4EM1A 4KDPA 5HLGA 4M72A 1REPC 2XROA 1W7PB 4IJAA 2L4MA 1BC8C 4LJZF 4L18B 5D5XB 5LBQA 2JPBA 3FM5A 1MJ9A 1FPQA 3WG9A 2CO5A 1IRFA 5K5RA 4G7OF 2RC4A 5CVUA 4HF0A 1R1UA 1ZN2A 1TQPA 1IUYA 1IF1A 4HZFA 2ADUA 2DK8A 4MGRA 2FXAA 5LGUA 1DUXC 2VBXA 3NEUA 2FF4A 3GFJA 2O3FA 3BP8A 2NS0A 1ZHFA 4A2UA 2A5YB 5A2QK 2STTA 2QVOA 4HQEA 2A68F 2GXGA 1MGTA 3CUOA 3DPLC 3DXJF 3LQQA 4Q48A 2VT2A 3L9FA 5DD8A 4RGXA 4G7ZF 1KQ8A 3F6VA 3KEQA 5LGNA 2XASA 2XAJA 4I09A 4WWCA 4GYIA 3KP2A 3FZVA 4KIFA 3T5XA 1U5TA 4BYYA 3DV8A 1G3WA 1TQIA 2PG4A 3F22A 2PLYA 2RQPA 3J80Z 3K1NA 3RIRA 5D5VB 1D8JA 1XMAA 4OIOF 1B1BA 1Z6RA 2MA3A 5DYMA 4B09A 4Q5SF 2QBYA 2R7FA 3I58A 2DPUA 2IT0A 4KA4A 3HTUA 2FNPA 4L9VA 4EGYA 3MZHA 3T1BA 1FSEA 2P7VB 4HX4A 1TBXA 1WI9A 2AS5F 2FU4A 1SD7A 5LHIA 4RGUA 5ERIA 3ZN0A 1Y0UA 3I59B 1QZZA 2ZXJA 3MFKA 2NAZA 3VEPA 1T98A 2XRNA 1YW8A 2EB7A 4CDGA 2R3SA 3RDIA 2ACJA 4CXFA 3DF8A 3J80K 1FYMA 1W5TA 4OMYA 3V8JA 3WTWC 3J7AO 4M73A 5IT3A 2F5CA 2BEOA 5ICFA 4U0WA 2EFPA 2A07F 2K7LA 3LAJA 4YFNF 1IXSB 2V1UA 2PMUA 4Y15A 2BE5F 2O8XA 2VXZA 3EYIA 4HV5A 1IN7A 3P9IA 4U0VA 5HLHA 1BJAA 1USSA 3V8LA 1J5YA 2VN2A 3EQLF 1XB4A 4IHTA 2V9VA 1RUNA 3QP5A 2XHKA 3WU0A 3ZMVA 2W85A 3GWZA 3L7WA 4UVBA 2K4JA 2CQKA 3WGHA 5CYVA 5D5UB 2VBYA 2COMA 2MD5A 5H20A 3M9AA 4A6DA 3R0AA 5DUKA 2HR3A 3LA2A 3ZQ7A 2HQRA 3GFIA 1USTA 3E6MA 3K1PA 5K5OA 1CGPA 3LQRA 1TW2A 2F5EA 1ULYA 4JBAA 4CZZA 2B0LA 1MJBA 2QQAA 3PFIA 3BJAA 1E2XA 2FMYA 3MZYA 3F8NA 2D1HA 2M30A 1HQCA 3F8CA 2EJRA 4KMUX 3H3ZA 4EQQA 3RKXA 3F6OA 3T8RA 1BI1A 3EDPA 1QZYA 4LK0F 3E3VA 4KUMA 1IZ1A 2EA2A 2D2WA 4QWQA 2CG4A 4U7BA 2QLZA 5F6FA 4GYGA 1O3SA 1R23A 3HSFA 1I5ZA 3RJPA 3IL2A 5LEKA 2DBBA 2OQRA 1FC3A 4UVCA 1P2FA 1ZARA 3RPUA 4WXDA 3DFGA 3HOSA 1BBYA 2XAQA 1KU3A 3ULQB 3BJ6A 3WTXC 3CO6C 3TDZC 5LHGA 1Q1HA 2Q2EA 4RB2C 1S8NA 3SXYA 1HW1A 3WODF 2GAUA 3GFLA 3CUQB 3JW4A 1GXQA 1S7AA 4IRGA 3LFKA 1BIBA 4ENJA 1TNTA 2BBYA 2KJBA 3DP7A 4FX4A 2YX4A 4HLXA 1NHAA 2OD5A 5CLSA 4ZYHA 4P55A 1XCBA 4MNUA 2Y0MA 5LGTA 1FP1D 2P5VA 5D8LB 1W7PD 3GVAA 1XGSA 3GEZA 3WTZA 3K2ZA 1V3FA 2M1BA 3SZTA 3GO5A 3R60A 3KE2A 5BS6A 1L0OC 5L3FA 2Y75A 3E6BA 3IKVA 3HSRA 5E20A 4EV0A 1ODDA 4WF2A 1XDUA 1UCRA 1QNTA 4ZYGA 4IHSA 4OIPF 5EEGA 2ISYA 3GF2A 4CICA 4M9ZA 2YPRA 4EJTA 1QBJA 2YR2A 3KETA 1LEBA 4ZZDA 4L5JA 3E5XA 2VONA 2EV5A 4Z2YA 1JHFA 1KA8A 2ZFWA 5DEQA 1B9MA 1AOYA 1QGPA 3R61A 2PI0A 3FXQA 3P9CA 3FMRA 3HHHA 5HS7A 2GZWA 1IN8A 4XSZF 2YSRA 3E97A 4D0PA 1R22A 3TKYA 4KT5C 4KNYA 2RDPA 3O3KA 3J81Z 1D8KA 1T38A 2CWEA 4EMSA 5HDNA 1F9NA 3K69A 4GXOA 3BPVA 3TDUC 3ZPLA 4G94A 2G9WA 2VBWA 4FT8A 2FRHA 2EK5A 1ZH5A 4BNCA 3HRTA 2CFXA 1R1VA 3SHFA 3AAFA 2JZYA 3KP3A 2VE8A 2IW5A 2XAHA 2YX7A 1GVJA 1LNWA 2QYOA 4ON0A 5J8CA 4UVAA 2NNNA 3Q9VA 1D3YA 2L01A 4L9NA 1K78A 2X0LA 1J9IA 2OQGA 4TV7A 3R6SA 3LAPA 2RGVA 4HDVA 2STWA 3BROA 1U5TC 4A5MA 3LWFA 3KLNA 5BMZA 4HLYA 4P5OA 5L3CA 1PUEE 2M8EA 1WWXA 3M1EA 3EUHA 5HOOA 1SMYF 2PQ8A 2O61A 5BOXA 2TDXA 5FD6A 3HIFA 1BOAA 4OIQF 5CJ9A 4WX9A 2P5LC 3I71A 2ESHA 4YIIA 3PQKA 3FX3A 2DLLA 4L5IA 1ZG1A 3BPXA 5DCMA 3ABTA 1FBSA 2EFQA 2ELHA 4HW0A 5CVJA 4JK1X 1YS6A 4EM2A 4G9YA 1P92A 2BYVE 1YG2A 5LLQA 1GXPA 3Q5FA 2M87A 1K78B 3N97A 1LB2A 3D5LA 4ENMA 4ESJA 1H9GA 1XMKA 4LFUA 1QPMA 1R5GA 2W57A 4H0EA 3C1DA 1P4AA 1G3YA 1XSXA 4LMYA 4RB0A 1XGMA 5BQTA 3RPQA 4RGSA 3TO6A 2KIUA 4PDKA 4M71A 3KP5A 1LDKB 4OIRF 2E1CA 4HAMA 5HS8A 3ZP5A 4HQMA 4N0BA 4R79A 1XSVA 3TQNA 5ICGA 3CLOA 3CJNA 3MWMA 5E1WA 3FXRA 2PEXA 4M9SA 5HDGA 3IC7A 3QU3A 2ZMEA 3QRFF 1F5TA 2L02A 5JI6A 1TLHB 3N4MA 2VOOA 4Q47A 1DPRA 2DQLA 3IHUA 3RYRA 2ZNYA 4P96A 4ZZLA 2XVCA 4EJOA 2GA1A 4A0ZA 3JTGA 2E7WA 2KJCA 4I02A 1I1GA 2R7DA 4KIGA 3RKYA 2H27A 4LLLA 4PCQA 5IT9Z 1U3EM 3K0LA 4U88A 1YYVA 2QUFA 3RKWA 2CGPA 4M9XA 3WGIA 4EVIA 3GUDA 2KIFA 3V8KA 2UWMA 2ISZA 3ZMUA 2DT5A 4K2EA 2D1VA 4JQFA 2W24A 3F23A 4R1HA 1J75A 2V79A 1ZAOA 4I0AA 5TJJA 4BXUA 1CF7B 2ESNA 4XSXF 2P8TA 1V4RA 1I27A 3G3ZA 5FLXK 1S7OA 1G6NA 1FYLA 4HYEA 2FMLA 4IF4A 4G7HF 1U8RA 1KYWA 1BIAA 3FWEA 3ABUA 2M5WA 1JGSA 1T6SA 2FEZA 2JTVA 4XLPF 4RAZA 2K4BA 2PN6A 2JPCA 2L4AA 3CUQA 2HGCA 5KK1A 2VC0A 3L2CA 2HS5A 2PFBA 4CYDA 5D5WB 2P4WA 3JAMK 2EFWA 5DDGA 5ED4A 4HX8A 3M7GA 3IKTA 5FFXA 4AIKA 3ELKA 4EJWA 1UHMA 3QP6A 1FT9A 2FBKA 1HKSA 3T0YA 2LKPA 2ZO4A 4DNCA 1HSTA 4O6JA 2BGCA 3V7CA 1F1ZA 1LDJA 4HDUA 4IPAA 3WTVC 3NRVA 4LB5A 1MKMA 1ZRFA 3JSOA 2DI3A 2GXBA 2Q8KA 3SQNA 2HTSA 4I01A 1Z6TA 2PBIA 3REOA 4HF1A 1PP8F 1YLFA 1ZLJA 1T0FA 3ROUA 1YW9A 5D4SA 3LA7A 5JFRA 2RVCA 4MHGA 3E5UA 1LDDA 2A61A 1D5VA 1FZPB 1U78A 3CO7C 1WRJA 1B9NA 1WKMA 3K9TA 1BM9A 1KYZA 4RB1A 2P7CB 2NYXA 1FWZA 5J6XA 2PMHA 2A3SA 5FGMA 3GFMA 2QBYB 1TW3A 3FF5A 2VOPA 4NHJA 3HHGA 2BV6A 3R4KA 3ZMSA 2PJPA 4LGWA 1EH8A 1ZRDA 4EM0B 1CF7A 5L3DA 5FFZA 2OA4A 2H6CA 4ETSA 1FYKA 5DV5A 5L3BA 2IPQX 5DD4A 1SFEA 5E1ZB 3B73A 2V6CA 3DKWA 2HQNA 5K1YA 1I1SA 1ZREA 2FSWA 2J5OA 1FLIA 3GXOA 2C6YA 2OU2A 3M8FA 2ZJ2A 2X4HA 3L09A 2L3DA 1R58A 5F1RA 1O3QA 3IRQA 1XD7A 2A6HF 1TTYA 4ASNA 1S29A 3F21A 2Q0OA 3Q9SA 4UUVA 1MDMB 2FQ3A 4XRFA 3TO9A 2VODA 3OOPA 3ECHA 1YTYA 1KU9A 5AIPA 5ICEA 2P6SA 1G4DA 1YIOA 1YW7A 1ON1A 5BPIA 2JSCA 4U7DA 4UHTA 3IWZA 4KN4X 3SFZA 4L0ZB
chains in the Genus database with same CATH superfamily
4L9TA 1SD5A 1TQMA 2G7HA 2HKXA 3A1YA 3VOEA 1U6GA 1FEXA 2P0WA 4MFDA 4BQOA 3I0TA 3I59A 5HLIA 2K3FA 1SVLA 3S2WA 1ZRCA 1WJ5A 4S05A 4L5EA 1YO5C 1C0WA 3H9GA 2IP2A 2V9KA 1BI0A 5IP7J 4F7ZA 4S0HB 5KCMA 4HF2A 1V5FA 4MEXF 2DA7A 1OYYA 3FHNA 1E0EA 1T8IA 1WQ2A 4ZTFA 2DA5A 1I6XA 2E35A 1WGXA 2HDWA 5E18F 3QQAA 2VT3A 1BR4A 2IA0A 1BOBA 4MQ9F 2E2HJ 1F4KA 1LEAA 1ZLKA 3PUBA 2KFDA 5FKLA 2E7XA 4GFBA 1S6LA 4M6VA 1GT0C 3L2RA 3AL0B 3D5SC 3E5QA 2RAEA 3I5UA 2RV8A 2Y30A 4XRSA 3RKQA 2QSHX 4XLFA 2B63J 4LIVA 4RGRA 5IOYA 2HVSA 1XPXA 4HV6A 1OISA 1WPKA 2J5PA 4G6DA 3CQZJ 5FLXZ 3VSLA 1O3TA 3BZ6A 1HSJA 3O2PE 2ECBA 3ERMA 2VKDA 2R5ZA 1Z91A 3BDDA 4EJUA 1T0FC 1ZR2A 2K3PA 3F3XA 1W0TA 4LLGF 2UXXA 1MD0A 3C7JA 3BZKA 4B3XA 1ITYA 5J8FA 5JHFA 2ICWG 1B59A 3A03A 3CMYA 1JT0A 3RTRA 5M3FJ 3P7NA 3GZ5A 3M8JA 5TISC 1RIOH 3KLOA 1YQAA 5L3FA 3IAS2 2MD0A 3CJQB 2EPFA 4FTHA 1X3WB 4PSXA 1R4NB 1YX3A 2VPRA 1ETYA 4G8XA 3S16J 4HG2A 2FUG2 3QYBA 5M5XJ 3PFYA 5E8IA 4Y3OA 2GM4A 1AA7A 1RI7A 4BHBA 3UNGC 4R8HA 4ZYEA 4XL9A 5GP9A 5A2QZ 3RI4A 2L54A 1XSDA 2W7NA 1Z7UA 2DTRA 1IRXA 2JK3A 1B72A 3ZMZA 1BI2A 2A69F 2D5VA 3T8TA 1UELB 3MQ0A 3WGGA 1GVDA 5BNGA 2LRDA 1FOWA 3DTKA 2GLOA 1G3SA 2DW4A 2XV4S 2DYRH 3I4MJ 3CDLA 4PUSA 4XLCA 2CRGA 2OZUA 3F72A 1J59A 2FBHA 2HKOA 4V2FA 1WJDA 4ZC3A 1ON2A 5H6QA 1OR7A 2DPDA 1IRZA 2Z99A 5HVQC 5FKOA 1RR8C 2HPMA 2O8KA 1P4WA 1X1AA 1JXSA 3ZQHA 1I3QJ 2O03A 1NH3A 4A0YA 2RNGA 1D0XA 5B3SH 2GA2A 3OYFA 4I98B 1KU7A 3A0HC 1TNSA 4G6TB 1N25A 5LRRA 3Q0VA 4HSTA 2FA5A 2XUBA 2KRFA 1LPQA 1UHSA 1YE9A 3OYKA 2VB6A 3FM3A 1P4XA 3E6CC 2CV0A 1IO2A 1XN7A 3AG2H 4ANJA 3RCOA 3OYDA 3ERED 1R00A 2LY1A 3KFWX 4C30A 3F9KA 4A3DJ 2K9SA 4BL0B 4ENKA 2YS9A 1DP7P 1IXCA 4O3MA 2JA5J 2H09A 4HBLA 5D4RA 5HODA 4XRMA 1BL0A 3H0DA 2E1OA 1FY7A 1VNDA 4UXNA 2XKPA 4MQVA 2HTJA 4LOCA 1Q1VA 4PJLA 2QM3A 4A0XA 3BY6A 3PSFA 2IS6A 1DPUA 2ZXIA 3HPHA 4DOZA 3L00A 4ZH4F 4NB5A 2OTJI 2FBIA 2ZMEB 3KP6A 1IV6A 2IBDA 1ZGAA 1JTXA 1O57A 1OKRA 5F04A 1EV7A 2W25A 1LUJB 2Y48A 2K85A 3P5JA 4GO1A 4DYCA 4AIJA 3BR6A 4BUPA 5D6FA 4HPQA 5IT9K 2LD5A 1PYVA 2EA4A 5EF6A 2HVQA 1HW2A 1H9TA 2LNBA 2QSGX 2P5KA 5DCFA 5FLMJ 3PUFA 5CPRB 4NBQA 3TGNA 1X1BA 1QZEA 3VYSB 3TP3A 2VI6A 4G12A 2V1XA 4CUGA 4CCKA 3ZGKA 3H92A 2WTEA 1JTYA 1TWFJ 1W7PA 4LK1F 5J1RA 3HRMA 3FXUA 1Z05A 4QLCU 3WTTC 4KYWA 4BDYA 2GWRA 3ZMTA 3LSPA 4F3QA 1YX5A 1HCRA 2LTPA 1SD6A 5F64A 4XBFA 1W5SA 1GHCA 1R9TJ 2K9NA 3I64A 3WE3A 4KN7X 2X48A 1A04A 3DEUA 1W1WE 3QAHA 3QOPA 4LD5A 5E79C 3JRDA 3I54A 1BN5A 4JYKA 5H6RA 2XSDC 5DTDA 2IA2A 1R7JA 1IN5A 3MVPA 1DGRM 4I2OA 4PGGA 2K9MA 4E7LA 3ZCOA 3AFHA 3I56I 2BZTA 4M74A 4RM3A 3O6BB 5FB2A 1OCRH 4A6EA 5H2FC 2DU9A 1DP3A 5FRMA 4WCGA 4I0BA 2L9SA 2YU3A 2JVHA 2LDUA 3IP4B 3BT9A 2XGXA 4J00A 4D1QA 1QO0D 3HOTA 2OAZA 1LQ1A 1RZ4A 2ZBKA 3DTIA 2D45A 3BCAA 2IEKA 1QPIA 1J0RA 2JSPA 3TMOA 3HUGA 2VQLA 3ECOA 4S04A 2DA2A 1FOKA 2H94A 2HYFA 5ICCA 1STZA 3JRFA 2QQ8A 2R0QC 1T39A 1TWHJ 1B4AA 4XKCA 3TO7A 3KCCA 3FMQA 4OOIA 3W6KB 4NQWB 2H6BA 2LH9A 5J47A 1VQ6I 2XGEA 5JR3A 3JTHA 1H0MA 1FBQA 4IRIA 2LYCA 1OYIA 4LB6B 5CVRA 3WHCA 3BJOA 4RAYA 2HOEA 1VQKI 4M6XA 1Y8RB 2E1NA 1MNMC 3CLQA 4BKXA 1W36D 2WB1N 4J01A 2R93J 4Y17A 1WJEA 3Q0UA 2HFHA 4KIBA 4E6KG 2KIMA 1HKTA 1OPCA 2R5ZB 2JA6J 3RYPA 4LG0A 2CYYA 4HSRA 1IW7F 2WWYA 2VE9A 2Q2EB 5CKTA 4AD9A 2ZB9A 4KFCA 1X4OA 2WC2A 1IN6A 3LA3A 1K4TA 1ZKGA 4CSWA 1BC7C 1OYWA 3DLAA 2OV7A 1PUFA 3VODA 3GYHX 1P6RA 2IVMA 2EFNA 3HTSB 4NUBA 1MSFC 4A3JJ 5D6EA 1BR1A 1QHGA 1VQLI 2M4GA 3GW2A 5HS9A 4N9HA 3I4PA 4IHVA 1W5CC 2OUMA 3HYIA 1WI3A 1Z67A 3FBIB 4ZYDA 3CD6I 2WAEA 2JA2A 1IRGA 1G59A 1ETVA 1ZYRF 2EFOA 2RKHA 4AVPA 1M1EB 4PSWA 2MG4A 1SANA 5FROA 3HRUA 4FE4A 3OYNA 4CHUA 1QRYA 1KGSA 1RNLA 2O0YA 3LSKA 5AONA 2OBPA 3KYDB 3WE2A 4MTDA 4HA8A 3S14J 1WJBA 4PJ0C 1UHWA 3IWFA 1FP2A 2JWTA 4AU7A 4XLAA 1K61A 1JKRC 1U9OA 3A2KA 1G3TA 2NVXJ 3DKXA 4RMNA 1AWCA 3M1CA 3BQZA 1K7AA 1ENHA 1SFKA 2HPIA 2XC7A 3RZOJ 1NTCA 3JR9A 5FD5A 5FO5A 4XM3A 5L3GA 1F43A 3HOYJ 3CCVI 1VF9A 3M8EA 3NQOA 2V1DA 5C4JJ 1R5HA 1Z3XA 2HEOA 2G7UA 5K5QA 1XCVA 3VYUB 1B6AA 3H5RA 4AIHA 4DBQA 3FHZA 1HBXG 1T08B 2ZNZA 3TW7A 5L3EA 5D8KB 1J2XA 2LG4A 2VUMJ 3ISPA 2ELJA 4Y7NJ 2JVGA 2EWNA 1FX7A 2M45A 3DBRB 2EV0A 3KP7A 3OR1C 3CP8A 1D1AA 1X2MA 2JA8J 1A5JA 3U1DA 3C18A 2DOEA 4CGZA 2CV1A 3RQ4A 3HGGA 4WK8F 3SJMA 3VB2A 3WU1B 3ZMDA 2P6TA 1LVAA 3C2GA 1ONVA 1BR2A 2Q1ZB 2JT1A 2MBFA 3CTAA 2O6GE 3DEWA 2E1MB 2QWWA 2IA1A 2CW0F 3P9KA 3GZ6A 1LFUP 4FISA 4M6YA 2MLKA 2MC3A 2XF7A 3U2RA 4N9IA 1NK2P 2Z33A 1FOXA 1SFUA 3KP4A 2CW8A 1ERDA 3C3WA 4II3A 1PDNC 3KYLA 4E70A 1RC9A 1MMGA 4IRHA 3W2VA 2ZCWA 1T2KA 2X6OA 3HSEA 3HRSA 3CDHA 2OZ6A 2NNYA 2HDCA 3L2VA 4KICA 2AXLA 1MNEA 2AQFA 2VJ4A 2DAOA 4YIFA 1MNDA 3FXJA 3M4OJ 1SAXA 4BQAA 1MDMA 3OL4A 4JOMA 1LE8B 4FX0A 4AYBN 3K1MA 5LHHA 2CUEA 2DFHA 2CJJA 1HXDA 3MEXA 2OF7A 3RSNA 3MZ8A 3IH2A 3S17J 4M3GA 4E7SA 1E17A 4C2UA 1HKQA 2HWVA 2PMZA 3DPTA 4C3JJ 2Z5UA 4A69C 2CSOA 2F2EA 2UZKA 4B8XA 2HXOA 2FOWA 1SFXA 4IKFA 3QYFA 2FNAA 5FRNA 2LR8A 3I9V2 2K86A 1ZGJA 4JX6A 3OYHA 5FLVA 2K02A 1L3LA 1QA6A 3F8FA 4NQWA 1Y8QB 5EEAA 1K79A 4HNTA 1EH7A 6PAXA 2Z9OA 1JI8A 1MZBA 5J3LA 3ZQFA 3ZQCA 4ENNA 1U8BA 4IZZA 3HUGB 2JRTA 4DIQA 1TP4A 5E8GA 4EJVA 1RUOA 2DXIA 1FNNA 1DDNA 3PQJA 2W84A 4C3IJ 3AL0C 2E60A 3G73A 2ELKA 2GBYA 4KT6A 4LLNA 2DO7A 1JE8A 3LSMA 2MLGA 2ETHA 1EA3A 1XX5A 1R1TA 4UV9A 1F36A 2IGKA 2CU7A 5LEJA 2Z3YA 2KLOA 2DODA 2M2EA 4Q4ZF 1YI2I 3CC7I 1LFPA 4GCVA 3GLXA 1KU2A 4FCYA 4DJAA 2DDBA 4E7JA 2JMWA 1IN4A 1ZK8A 3I53A 1HDPA 1UG0A 1VQ7I 4CCOA 2XIGA 3BR2A 3A01A 4ESBA 1OCCH 2L7ZA 2KIQA 3CF5F 1OR7C 3J81K 3WTYC 2WV0A 1IAWA 1G2HA 1OMIA 2TRTA 2BHYA 1WZ2A 2HYGD 5DUIA 4E7ZA 2FOKA 3S3NA 1KONA 1WSUA 5KHDA 1GV5A 1XGOA 5LD2C 3GTLJ 2HZTA 1OFCX 1YS7A 2IS1A 4PGHA 4MTEA 4DQ2A 2VC1A 4Y33A 1JKOC 1O7FA 3V4GA 2L9VA 2WADA 1O3RA 2KKOA 1XC5A 1K83J 4P9FA 3U9GA 4U0YA 5JLXA 1T56A 4YELA 3VSKA 3QPHA 1SAUA 2XKOA 4UB8C 4BAYA 1S3JA 3CUQC 4XICA 1UB9A 2MH2A 3L1PA 1T33A 3F8BA 2DMUA 1IXRC 2DQRA 3LSJA 1BI3A 5E1XA 1ZQ3P 2R7TA 5KVRA 3K10A 3H9JA 2RN7A 4DYRA 3BCBA 3OV8A 1ZG5A 2LSOA 2RNJA 1R6RA 2XSJC 3BWGA 2K27A 3KZZA 3CP2A 1JT6A 4HOBA 3PNVA 3S1MJ 3F8MA 4BHCA 4WXCA 3MCZA 2VBZA 3SZPA 2EQRA 2GIVA 1VQMI 2DMNA 1RETA 1SMTA 3V7RA 4L9JA 5BPDA 2HQAA 3OIPA 1YFHA 1Z9CA 3EETA 3KYCB 1ZG3A 2LVSA 4IVNA 1X1DA 5GPAA 1AHDP 2WA0A 4AIDA 5JHUA 2XAGA 5E17F 4XK4A 2EIMH 4ABZA 2X9DA 2F4IA 2AHQA 4II2A 1IUFA 3CCQI 2IRFG 5ILVA 1KQ0A 3CMAI 3V7SA 3DU6A 5AIQA 2IGOA 4A3GJ 3PL8A 1R36A 4XLEA 3J7YJ 1U5TB 3W6JB 2NOJB 3FMSA 2IS2A 3EYYA 3LSTA 3PNTA 3W2WA 2NRAC 4FHTA 3HBLA 4RS8A 4M3DA 3MN2A 2MH9A 4HX7A 1UG2A 4NC6A 2QF7A 2WBMA 3ZN1A 3DQVC 1VTNC 2ZKZA 2DA3A 2X6YA 3TOBA 5EG0A 5C44J 4XLNF 4HNUA 2L9NA 3VFZA 5JVTA 3MAJA 3WTSC 3D0SA 2RQQA 5EEHA 3TOAA 3A01B 4RA2A 2LFBA 5DCMB 4PK4A 3JRGA 1SD4A 3I3LA 4D7NA 1J7KA 1P9QC 2QQ9A 1QQIA 2DCEA 1VFCA 5M5YJ 4OINF 1O4XA 1MMSA 4UUSA 4X6AJ 1YRNB 1E3HA 1U2WA 3CCLI 4FETA 1VQOI 3HJEA 4PFOA 2ZJQF 3BOQA 2FE3A 1K6OA 2DFIA 1ETKA 2VKVA 4D5FA 2LF8A 2GQQA 4A12A 1IC8A 3VDXA 4L0YB 4ZJZA 4YG2F 4A5NA 1HOMA 1UFMA 1WFXA 2HNHA 1EH6A 4OMZA 4G6QA 4GGGA 3E6DA 3JRHA 1O7LA 4YFXF 4ESFA 2QZ8A 3COAC 1XDSA 1V54H 2XPVA 4LG0B 1ZGWA 3QU6A 5EGOA 1MBEA 5CVVA 1W4MA 4YFKF 4MLOA 2HDDA 2EV6A 4UV8A 1MJAA 1P7IA 2A6EF 5LRSA 2OTLI 1PVEA 3IRRA 1LJ9A 4WXHA 3R0JA 1QVUA 2E5NA 1Z3YA 4B4CA 2ECCA 3S3MA 5CVIA 2R7SA 2HVRA 3GX4X 1JKQC 4PZJA 4CH7A 2F5DA 4IXAA 1RESA 1XGNA 2LF7A 2F5FA 4RB3C 3KZYA 3H3UA 2X6WA 4BH9A 3ML6A 3G1MA 1MSEC 2TCTA 2XAFA 4MEYF 4U87A 2DK5A 2NVYJ 1WCMJ 3S8PA 3QPTA 3OSGA 4XN3A 1Z1DA 2COBA 2QQBA 1FBUA 3H5NA 4P9UA 3HKZA 3OR2C 3BG5A 1X3UA 4O5VA 4EGZA 4Y13A 1KQ9A 1I50J 1HW5A 2A5WA 4KMFA 4BHPA 3N05A 3PSIA 4D9JA 5TRDA 4HRIA 1TWGJ 3VWBA 5ILUA 3LSHA 4AWXB 4I7HA 5HDKA 1FSHA 2QENA 2UXNA 4X0GA 4XORA 4A3MJ 1JHHA 3WTUC 2VQCA 2BXZA 1DU0A 4IO9F 2VQHA 4QPOA 2LREA 1PP7U 5ILSA 2ZMEC 3JSPA 2Y0SA 3TL4X 4CO8A 1LFBA 1JJ6C 2FD5A 3ABKH 2IJLA 3JAMZ 4UNOA 3B02A 3Q0WA 3KEOA 4OU0A 1WJFA 3DBLB 4EM1A 4KDPA 3FXLA 5HLGA 4M72A 1REPC 3ZQLA 2NVTJ 2XROA 4XKBA 3E1SA 3S1NJ 1A35A 1W7PB 4IJAA 3CC2I 3LSIA 3ZR8X 2L4MA 3H9QA 1BC8C 4LJZF 4L18B 5D5XB 2R7VA 1XG1A 2V26A 5LBQA 1MMNA 2JPBA 2Y9YA 3FM5A 1MJ9A 2MC4A 2CUJA 1FPQA 1IGNA 3WG9A 2CO5A 1IRFA 2EH3A 3AG4H 5EZHA 5K5RA 2CQQA 4G7OF 5GAHJ 5DM6F 2Y0SN 2CUFA 2RC4A 2K9LA 1HF0A 2V1NA 3ZQIA 3OY9A 3KPHA 5CVUA 3O8GA 4YEJA 4KJZA 4HF0A 1R1UA 1ZN2A 5GPCA 1TQPA 4XR6A 3S93A 1IUYA 1IF1A 2PJRB 5E3NA 5JLWA 3G1LA 4HZFA 2ADUA 2BW3A 4BXFA 1A6QA 2DK8A 4MGRA 1OCPA 2FXAA 5LGUA 4DGWB 3W2AA 1DUXC 1UAAA 1B8IA 2VBXA 3NEUA 1FOYA 1R5ID 2FF4A 2MSYA 2O3FA 3GFJA 3Q3SA 4A3CJ 3BP8A 2NS0A 4NNJA 1Z77A 1ZHFA 1E3OC 4A2UA 4B44A 2A5YB 4DZJA 2F4OB 3G1OA 2JN6A 5A2QK 4N4OB 3PJRA 2STTA 2ZXHA 2QVOA 4BEHA 2XB0X 4FQGA 2A68F 2GXGA 4HQEA 1MGTA 1GDTA 2ID3A 2X1EA 3CUOA 3DPLC 1B72B 3DXJF 3LQQA 1OCZH 2VT2A 4Q48A 3L9FA 1BJZA 5DD8A 4B47A 4RGXA 2M8GX 5DM7F 5F0FA 4G7ZF 2WV1A 4XNFA 2L7FP 3F6VA 2MGQA 3KEQA 1KQ8A 2GOXB 5LGNA 3PIOF 2XASA 1T95A 2XF5A 2L0KA 5B1AH 2LKXA 2XAJA 4I09A 4RLQA 4WWCA 4NC7A 4GYIA 3KP2A 3FZVA 4KIFA 3T5XA 2VKHA 4D7MA 1U5TA 4BYYA 3DV8A 3KIOA 1ZELA 4Y4RA 2I10A 1G3WA 1TQIA 2YUSA 2PG4A 3F22A 4P1WA 1XS9A 1S9HA 2PLYA 2RQPA 2K9QA 3J80Z 1RPWA 5IPAA 3K1NA 1X19A 3RIRA 3K4LA 5D5VB 3JRIA 1B8IB 1D8JA 1XMAA 4B1RA 4OIOF 4H4KC 3GTJJ 1B1BA 5J40A 2DJIA 4Y52J 1Z6RA 2MA3A 3A0BC 1RKWA 5DYMA 4B09A 4Q5SF 3LFUA 3OIQA 2QBYA 2R7FA 4RM2A 3I58A 4M3FA 3RQIA 2IGMA 2EZLA 2DPUA 1EJ9A 2IT0A 4KA4A 3M3YJ 2Y69H 3HTUA 3I4NJ 4CA0A 2FNPA 1HA8A 2CQNA 4GRIA 2VJJA 2HOAA 4L9VA 2UV1A 4EGYA 3MZHA 1JUMA 3T1BA 2CW7A 3ZXSA 4QIWN 1FSEA 2P7VB 4HX4A 1TBXA 4W1UA 1Y56A 1WI9A 1JUSA 1MBHA 3LMMA 5EG0B 2VLAA 2WAQA 4A3KJ 2AS5F 2FU4A 3PNYA 5M5WJ 1SD7A 2DT6A 2P81A 3GZNB 5LHIA 1TZLA 1OQYA 4RGUA 3H3VK 2H8WA 5ERIA 3ZN0A 1Y0UA 2HU9A 3I59B 1QZZA 3K4NA 2ZXJA 3J7AY 3MFKA 2NAZA 4F91B 4GDFA 2V7FA 2O7OA 3VEPA 3G71I 1T98A 2XRNA 1YW8A 2KZGA 2VJ5A 4V2GA 2EB7A 3HL2A 2R7ZJ 5EDNA 4CDGA 2R3SA 3RDIA 4F93B 2XAUA 3OYCA 2ACJA 1BW5A 4CXFA 3DF8A 3J80K 2L7MP 1XTAA 2EIJH 3F0CA 1FYMA 1FIAA 5KAFC 2FJ1A 1W5TA 3CCUI 4PJNA 4OMYA 4UUTA 1W36C 1SVMA 3V8JA 2R7XA 1GUUA 1U0JA 3WTWC 3J7AO 2M0CA 4M73A 5IT3A 2CS3A 3OYLA 5CQGA 3GTKJ 2F5CA 2KDZA 3M07A 3EUKL 2DFEA 1TWCJ 4F92B 1MIJA 5E3LA 3OYMA 2BEOA 5ICFA 2VIXA 4U0WA 2VXDA 2EFPA 4YIRX 3L2UA 2A07F 2K7LA 3LAJA 4B43A 4YFNF 2XF6A 3OWTA 1IXSB 2QKLB 4MIMA 2PMUA 2V1UA 1HC8A 4Y15A 4C9YA 2BE5F 2O8XA 2VXZA 3EYIA 4HV5A 1IN7A 3DU5A 3P9IA 3EPZA 4U0VA 5HLHA 3HDDA 1BJAA 2GOMA 4MFEA 1USSA 3QWLA 3V8LA 2DJNA 4E4HA 1J5YA 2VN2A 3EQLF 2XB5A 1XB4A 4IHTA 3BR5A 4IEJA 2V9VA 1RUNA 3QP5A 2XHKA 2KT0A 3WU0A 3TW6A 3ZMVA 1YJNI 3LL7A 2W85A 3DBHB 1LE8A 2Y9ZA 3AG1H 5K7FA 3IUOA 1DQUA 3GWZA 3L7WA 4CCMA 2BY1A 9ANTA 4A3BJ 4UVBA 3LSGA 2OJED 1N75A 1UMQA 2M3AA 2EIKH 1P7JA 1FMVA 2K4JA 2CQKA 3WGHA 5GTHC 5CYVA 5D5UB 4BXXJ 2CFOA 2VBYA 2COMA 2M7AA 2E2JJ 2MD5A 3GTQJ 2AXTC 5H20A 3M9AA 4A6DA 5B1BH 3R0AA 3RZDJ 5DUKA 2O5RA 1YRNA 2HR3A 3LA2A 3DCFA 3CJTB 3ZQ7A 2KPMA 4IQ4A 2HQRA 3K4JA 2E19A 3GFIA 1USTA 2OCCH 3E6MA 5GAGJ 3JRAA 2E71A 3K1PA 1ETOA 2R92J 2X85A 5K5OA 1OCTC 1CGPA 3LQRA 4BE2A 1TW2A 2F5EA 1ULYA 3SEQA 4JBAA 4CZZA 1DU6A 3G4SI 2BVMA 2B0LA 3NWSA 1MJBA 2QQAA 1JUPA 3PFIA 4JX4A 2QGUA 2VQGA 3S15J 3BJAA 1E2XA 3AKZA 3CCJI 1NK3P 2FMYA 4C2TA 2RREA 3MZYA 3F8NA 2XGCA 4PFPA 2D1HA 1VQ9I 2M30A 3K70C 1HQCA 1Y1VJ 3F8CA 2EJRA 4KMUX 3H3ZA 4EQQA 3RKXA 3F6OA 3T8RA 3DKYA 1BI1A 4ZDPA 3IAM2 3S2DJ 3EDPA 1QZYA 4IOCF 5EJCA 4LK0F 4M3BA 1R4MB 1VQ4I 3E3VA 3CCSI 5EYRA 4KUMA 2BXYA 4RLFA 1IZ1A 2EA2A 2D2WA 2V6EA 4QWQA 2CG4A 4U7BA 5KNLA 2QLZA 1N78A 4JP0A 5F6FA 2LC2A 4CYCA 4GYGA 3UR3C 5J4YA 1O3SA 1R23A 3HSFA 1I5ZA 1X1CA 2M7BA 3RJPA 5FKMA 2H8RA 3VYRB 2DMPA 2L5QA 3IL2A 5LEKA 4RDUA 2DBBA 2JQ7A 3PO3J 2OQRA 1FC3A 4UVCA 1SFOJ 1P2FA 1ZARA 3ZRGA 3RPUD 3WG7H 1RKTA 3CESA 3RPUA 2A05A 4WXDA 3DFGA 3HOSA 1TL8A 3DWLE 1BBYA 2XAQA 1KU3A 3C2HA 3ULQB 3BJ6A 1Z7LA 3WTXC 3CO6C 3TDZC 5LHGA 2VL8A 1Q1HA 2KISA 2Q2EA 1S7EA 4RB2C 3CC4I 2HQ5A 1S8NA 3SXYA 1HW1A 3HGYA 3WODF 3FIWA 2XGDA 2GAUA 2E34A 3GFLA 1I3AA 3SYTA 3CUQB 3JW4A 4EEFG 1GXQA 1S7AA 5FKKA 3NAUA 4IRGA 1R71A 1A36A 2F48A 3IH3A 4B3AA 1SVOA 3HG9A 1X4PA 2A6TA 3LFKA 1BIBA 4ENJA 1TNTA 3MMYB 5EZGA 2BBYA 2KJBA 3DP7A 4FX4A 2BOLA 2YX4A 5TGTA 3L2WA 3FK7A 2ZJPF 4HLXA 1NHAA 3BG9A 2OD5A 1PUFB 5CLSA 3BC8A 4ZYHA 1JJ8C 2R7WA 3S1QJ 4P55A 1XCBA 4MNUA 2Y0MA 2M0MA 2QSFX 4BU2A 5LGTA 1CQTA 2LMDA 2LBFB 1FP1D 4OWRB 2P5VA 1QU3A 4ZDOA 3FKIJ 3OYAA 5D8LB 3ZOBA 5GAEJ 1W7PD 1E3PA 3D1NI 4A3IJ 1UZCA 2EINH 1QHHD 3GVAA 1JGGA 1XGSA 2NS8A 3K4MA 3I55I 3KEYA 3DTEA 4F52A 2HI3A 3GEZA 1APLC 2NVUB 3WTZA 3K2ZA 5IP6A 1V3FA 2M1BA 3SZTA 1ZTRA 3HB9A 3GO5A 2F6CA 4M3EA 3ASOH 3R60A 3KE2A 5BS6A 1L0OC 5K7HA 4FE7A 2Y75A 2BHZA 3CDIA 3E6BA 3HSRA 3IKVA 5E20A 3SEZA 1ODDA 3C2BA 4WF2A 4EV0A 1XDUA 1QVTA 1UCRA 1QNTA 2WB1A 4ZYGA 2I5UA 4LIUA 3S2HJ 1DGWY 4IHSA 2ME0A 4OIPF 5EEGA 2DFFA 2ISYA 2R4GA 2KMUA 3GF2A 4CICA 2L9RA 4M9ZA 2YPRA 3U1KA 3ZQQA 5FJ8J 4ZDLA 2IAIA 3FISA 4EJTA 1QBJA 4XRSG 3PIPF 4DYQA 2YR2A 4BEHB 3KETA 4UB6C 2DT7B 4ZZDA 1LEBA 4L5JA 3E5XA 1WHUA 2VONA 5M3MJ 2EV5A 4Z2YA 1JHFA 1KA8A 3L2QA 2R7UA 3LSRA 2ZFWA 3WHBA 5DEQA 2Z2SB 4QSHA 4F55A 4XONA 5E3MA 1EF4A 1J09A 2BY2A 2WY7Q 3BR3A 5FKNA 2X1CA 1K4SA 4IHYA 1B9MA 1IDYA 1AOYA 1QGPA 5F0CA 3R61A 3SDBA 4FASD 4CCNA 2ZXWH 2O9LA 5IYDJ 4MO7A 4EATA 5HNHA 2PI0A 2R5YB 2PJRA 3TP0A 3FXQA 1VQ8I 3P9CA 3FMRA 1LKXA 2W48A 1MH4A 2FQ4A 3HHHA 4PJMA 2GZWA 2MFZA 4XKVA 5HS7A 3HOXJ 1IN8A 4E7KA 1I6HJ 3PO2J 2X51A 1IV8A 2XPUA 4XSZF 2YSRA 3E97A 4BE0A 4D0PA 1R22A 3TKYA 2DOAA 2VPLA 4KT5C 4KNYA 2RDPA 2E1MC 3HOUJ 4DW6A 3O3KA 4XLHA 1D8KA 3J81Z 1X1PA 1T38A 2CWEA 4EMSA 5HDNA 1F9NA 3K69A 5B5EC 4GXOA 1D0ZA 3BPVA 3EUAA 1FTZA 3TDUC 3ZPLA 4G94A 2G9WA 2VBWA 1VI0A 4FT8A 2FRHA 2EK5A 1ZH5A 5F08A 4BNCA 1S72I 1BW6A 2OPTA 3HRTA 4AUXA 2CFXA 4E7IA 1R1VA 3SHFA 3AAFA 2ZJRF 2JZYA 2QKMB 3KP3A 1KZHA 2EBIA 4ITVA 2VE8A 2IW5A 2XAHA 3OS1A 1ORKA 2YX7A 2N8GA 4X1EA 1H8AC 4C2MJ 1GVJA 1LNWA 2QYOA 4ON0A 2R7RA 3B6CA 5J8CA 4UVAA 2NNNA 3Q9VA 1HLVA 1D3YA 2L01A 4BBSJ 1YIJI 4L9NA 1K78A 2X0LA 1MBKA 1J9IA 2OQGA 4TV7A 3K4KA 3FBNB 3R6SA 3LAPA 2RGVA 4HDVA 2STWA 3BROA 2QEXI 3GTOJ 5F0HA 2LKSA 1U5TC 4A5MA 2NVQJ 3LWFA 3KLNA 3MKYB 4HLYA 5BMZA 4P5OA 5L3CA 1PUEE 2M8EA 2HYJA 1WWXA 3M1EA 4DBRA 2NOGA 2KHMA 3EUHA 3SZGA 5HOOA 1SMYF 2PQ8A 4PJJA 2O61A 4OAZA 5BOXA 1FIPA 4J19A 1MH3A 1X3ZB 2HZDA 3OS0A 2TDXA 4BS9A 4A3FJ 2OC6A 5FD6A 2QCOA 4V19K 3HIFA 1BOAA 4OIQF 2DDAA 2KP6A 5CJ9A 2K5CA 4WX9A 4BQQA 2DTZA 4A3LJ 2P5LC 3OYIA 2Z16A 3OYEA 2XPWA 2H1KA 1WH5A 2BY3A 1OLTA 2FX0A 3K4CA 3I71A 2ESHA 2DA6A 4YIIA 3LNQA 2K40A 3PQKA 3VPRA 4BDZA 3X2QH 3FX3A 2DLLA 2H1LA 1POGA 2EZKA 5EGOB 4L5IA 1ZG1A 4OAYA 3NARA 3BPXA 2G0EA 5DCMA 3ABMH 5KAIC 3ABTA 1FBSA 2EFQA 1JKPC 2ELHA 4HW0A 5IYCJ 1OJLA 4JK1X 5CVJA 1YS6A 4NDLA 4EM2A 3HC7A 3WU2C 4G9YA 1P92A 3TBIA 3MKWB 2BYVE 1YG2A 5LLQA 2KRCA 1GXPA 1ACIA 5IY5H 3Q5FA 1YJWI 3BG3A 4Z6YA 2M87A 1K78B 2JUGA 2GXAA 1WH7A 3H36A 4UY8I 2CUZA 2MABA 3N97A 1IJWC 1LB2A 3D5LA 4BJ6C 4ENMA 4ESJA 1H9GA 1XMKA 4LITA 5HLTA 1RRJA 2CV2A 4LFUA 1QPMA 1R5GA 2W57A 2DMTA 3K6GA 2E5ZA 2BW3B 4H0EA 3C1DA 3QYEA 3BR1A 1P4AA 1G3YA 1XSXA 4LMYA 4RB0A 1XGMA 3BTLA 2EZHA 1Z21A 5BQTA 4BE1A 3RPQA 4RGSA 3TO6A 2KIUA 4PDKA 1D5YA 4M71A 3KP5A 1LDKB 4OIRF 3AG3H 2E1CA 4LG3A 4XMYA 4HAMA 5J1UA 1WJCA 3W3CA 5HS8A 3ZP5A 3ZQGA 3HKZN 2JUCA 4KISA 2F4MB 1AKHA 4HQMA 3BZCA 4YRVA 1VZ0A 4N0BA 3BTJA 4R79A 1XSVA 3BQYA 1XMXA 4BY1J 4QTRA 3TQNA 5ICGA 3CLOA 3CJNA 3MWMA 5E1WA 3FXRA 4AVZA 3OYJA 1YJ9I 2PEXA 4M9SA 2LY9A 3BG6A 1A31A 1VQ5I 5HDGA 2OCEA 3IC7A 3VYTB 3QU3A 3G6EI 4D5CA 2ZMEA 3CCMI 3O8HA 3TEDA 3QRFF 1F5TA 1Y0NA 2L02A 5JI6A 1TLHB 3N4MA 4XQFA 2VOOA 4Q47A 1G8XA 4A3EJ 2MYSA 2LLKA 5DS9A 3K70D 3S1RJ 2Y2ZA 4IHWA 1DPRA 2DQLA 3IHUA 1X2NA 3RYRA 2I8DA 2ZNYA 4BBRJ 1H88C 4P96A 3BLYA 1A6IA 4BJTA 2XVCA 4ZZLA 4EJOA 1N77A 2GA1A 4A0ZA 1HDDC 1AKHB 3H0GJ 3CCRI 3JTGA 1D1CA 2E7WA 3H35A 2KZVA 2KJCA 4I02A 1I1GA 3OYBA 2R7DA 3H1CA 4KIGA 3CMMA 3RKYA 1FMWA 2LY2A 2H27A 4LLLA 1U9NA 4PCQA 5IT9Z 1U3EM 4CZCA 2B7EA 3K0LA 1K6YA 3CMEI 3CCYA 3FKJA 3SFIA 3FXMA 4U88A 1YYVA 2KRHA 2QUFA 4QPQA 3RKWA 3MKLA 2CGPA 4M9XA 3WGIA 2Y31A 3JRBA 3MKZA 3E0JB 3GTMJ 4EVIA 3GUDA 2KIFA 4XKWA 2CQ7A 1BA5A 5HNFA 1AU7A 2LBFA 3QPSA 3V8KA 2UWMA 2ISZA 4IL6C 1S5LC 3ZMUA 1FTTA 2QA4I 1TT0A 4ZYAA 1TC3C 2DT5A 4K2EA 2D1VA 4JQFA 4IHXA 2W24A 3LOCA 3F23A 4R1HA 4UUSB 3ABLH 4A93J 1V5EA 1J75A 5GADJ 2V79A 1ZAOA 2NS7A 4I0AA 5TJJA 2ME6A 3MD2A 1TT5B 1MBJA 4BXUA 2ESNA 1CF7B 2IGNA 2YU9J 4XSXF 2IXSA 4BY7J 2P8TA 3OSFA 3ASNH 1V4RA 1I27A 3G3ZA 3GCMA 5FLXK 1S7OA 1G6NA 4XOPA 1FYLA 4HYEA 3QPLA 5E3OA 2FMLA 4IF4A 1OCOH 3GBGA 3HPGA 3B6AA 3SDGA 4G7HF 1U8RA 2AO9A 1YITI 1KYWA 3EUHC 1BIAA 5K7ZA 3FWEA 3ABUA 2M5WA 1JGSA 1T6SA 5LFAA 1NG7A 4BGDA 2FEZA 3OIOA 2JTVA 4IOAF 2W4SA 4XLPF 4RAZA 3PM1A 2K4BA 2PN6A 1VQPI 3HOWJ 3CF2A 2JPCA 2L4AA 3CUQA 3OL3A 1Y39A 2HGCA 4RAFA 5KK1A 2VC0A 5F1JA 3L2CA 2HS5A 2PFBA 4CYDA 1SC7A 5C3EJ 1MBFA 5D5WB 2P4WA 3JAMK 2JA7J 2JJ7A 2PX9A 4BQNA 2W00A 2EFWA 5DDGA 2X1DA 2R7QA 1TWAJ 4HX8A 2KQRA 3M7GA 5ED4A 2VASA 3GTPJ 3U21A 3IKTA 5FFXA 2W1OA 3HM5A 4AIKA 1YOVB 4I76A 2MW8A 3ELKA 4EJWA 1UHMA 5J1YA 3QP6A 1FT9A 2FBKA 1HKSA 2LK2A 1SEUA 3T0YA 2BVLA 4E7HA 3CCEI 1X58A 3FK6A 2LKPA 2ZO4A 2M4KA 4DNCA 1HSTA 4O6JA 2BGCA 3V7CA 3JCUC 1F1ZA 1RR7A 2R7OA 3J7ZI 1LDJA 4HDUA 4IPAA 4CYCB 3WTVC 2WAFA 3NRVA 4LB5A 1W0UA 2XDVA 1MKMA 1ZRFA 1I39A 3JSOA 2VKEA 5CQEA 3K2AA 2ZSHB 2DI3A 1ZR4A 2Q8KA 2GXBA 3HOVJ 3SQNA 2HTSA 2AQEA 1ETQA 2CH0A 3CZ6A 3D5RC 2GIZA 3FDYA 4I01A 1Z6TA 3HZJA 5IOZA 3QODA 3OS2A 2PBIA 3REOA 4HF1A 1PP8F 1YLFA 4BJ5C 4CCLA 2DYSH 1ZLJA 4IQJA 1T0FA 4JX5A 3S32A 3ROUA 1YW9A 3CJRB 5D4SA 4IX7A 3LA7A 1YHQI 5JFRA 3S3OA 2RVCA 4MHGA 3E5UA 1LDDA 4RBOA 3GMEA 3BR0A 4RAGA 2A61A 1D5VA 3DEEA 1WVRA 4AM3A 2ZC2A 2W82A 1FZPB 4XN0A 1MMAA 4W97A 2Z1DA 3CO7C 1U78A 1WRJA 2LP0A 1B9NA 1WKMA 3K9TA 4N4NB 1BM9A 1KYZA 2DOFA 1MW7A 4BACA 1IDZA 4RB1A 4XIDA 2NYXA 2P7CB 1FWZA 5J6XA 2PMHA 2A3SA 2R5YA 5FGMA 3GFMA 2QBYB 1TW3A 2IS4A 3V42A 3FF5A 3BTCA 4KITB 2VOPA 4NHJA 3HHGA 2BV6A 2CMPA 3H5AA 1D0YA 2HOTA 1LVKA 3R4KA 4AC0A 4C3HJ 3ZMSA 2PJPA 4LGWA 3IV5A 1EH8A 2ID6A 5B66C 1ZRDA 1Y6IA 4EM0B 1CF7A 5L3DA 2NXNB 4AYBA 5FFZA 2KDOA 2OA4A 2X6XA 1IG7A 4B48A 2H6CA 2M34A 5IP9J 5JVGF 3A4CA 4ETSA 2WY8Q 4ZTJA 2WAQN 1FYKA 3DPUA 2HXIA 2DMQA 4HEA2 3KZIC 2KL4A 2E36A 1GLNA 5DV5A 1WJAA 2DA1A 5L3BA 2IPQX 5DD4A 2VJIA 1SFEA 1V5GA 3NWTA 5E1ZB 2PMZN 2ZSIB 3B73A 4HNVA 2CQXA 2V6CA 3DKWA 3ESWB 2HQNA 5K1YA 1I1SA 1ZREA 2FSWA 2J5OA 1V55H 2UUZA 1FLIA 3GXOA 2C6YA 2OU2A 3HEFA 3M8FA 2ZJ2A 4DZPA 2X4HA 3DLLF 3A02A 3L09A 4NC8A 2L3DA 3IH4A 3BTIA 1ETWA 1R58A 2JRMA 5F1RA 1O3QA 1D1BA 3IRQA 1Y1WJ 2DA4A 1XD7A 3OOUA 3G2BA 3KX2A 5IYBJ 2A6HF 3E7LA 3JRCA 1R49A 1TTYA 1EKEA 4ASNA 2XRLA 1S29A 3F21A 5J4VA 3HOZJ 2Q0OA 3Q9SA 4XOTA 4UUVA 2M9HA 2LOOA 2L7KA 3K7AJ 3FXKA 3HXLA 3JREA 1MDMB 1ETXA 1GV2A 2FQ3A 2B9SA 3ONQA 4XRFA 3TO9A 4I99C 3GTGJ 2VODA 3FXOA 3OYGA 5GTIC 3OOPA 2L2OA 3ECHA 1YTYA 1KU9A 1UJ8A 4I6ZA 2V4JC 2HOSA 5AIPA 3OMYA 5ICEA 2P6SA 1G4DA 2E2IJ 1NG6A 1Z0XA 1H89C 3UKGA 1MMDA 1YIOA 1YW7A 2EZIA 3W6VA 1ON1A 2EILH 1MBGA 5BPIA 3K4BA 4CCJA 3BG7A 5F27A 2BY0A 2JSCA 5C4XJ 4U7DA 4UHTA 2DN0A 2V9PA 3IWZA 4KN4X 1FJLA 2F5VA 2ZFUA 1VQNI 3SFZA 3GLLA 4L0ZB 3QOEA 1PJRA
chains in the Genus database with same CATH topology
4L9TA 1SD5A 1TQMA 2G7HA 2HKXA 3VOEA 1U6GA 3I0TA 3I59A 5HLIA 3S2WA 1ZRCA 4S05A 1YO5C 1C0WA 2IP2A 1BI0A 4F7ZA 4HF2A 4MEXF 1OYYA 1WQ2A 1I6XA 5E18F 2VT3A 2IA0A 4MQ9F 1F4KA 1LEAA 1ZLKA 2E7XA 1S6LA 3E5QA 3I5UA 2RV8A 4RGRA 4HV6A 2J5PA 4G6DA 5FLXZ 1O3TA 3BZ6A 1HSJA 3O2PE 1Z91A 3BDDA 4EJUA 3F3XA 4LLGF 2UXXA 1MD0A 3C7JA 5J8FA 1B59A 3RTRA 3P7NA 3GZ5A 1RIOH 3KLOA 1YQAA 4G8XA 5E8IA 4ZYEA 1RI7A 4BHBA 4R8HA 5A2QZ 3RI4A 2L54A 1XSDA 1Z7UA 2DTRA 3ZMZA 1BI2A 2A69F 3T8TA 3MQ0A 3WGGA 1G3SA 2DW4A 2XV4S 2OZUA 3F72A 1J59A 2FBHA 2HKOA 5H6QA 1ON2A 1OR7A 2DPDA 2Z99A 5HVQC 1P4WA 1JXSA 2O03A 4A0YA 2GA2A 4I98B 1KU7A 1TNSA 5LRRA 2FA5A 2XUBA 2KRFA 3FM3A 1P4XA 3E6CC 1XN7A 3ERED 1R00A 3KFWX 4ENKA 1DP7P 1IXCA 4O3MA 2H09A 4HBLA 5D4RA 1FY7A 4UXNA 2XKPA 4MQVA 2HTJA 2QM3A 4A0XA 3BY6A 1DPUA 3L00A 4ZH4F 4NB5A 2FBIA 2ZMEB 3KP6A 1ZGAA 1O57A 1OKRA 1EV7A 2W25A 2Y48A 4GO1A 4AIJA 5D6FA 5IT9K 2EA4A 1HW2A 1H9TA 2LNBA 2P5KA 5DCFA 3TGNA 2V1XA 3H92A 2WTEA 1W7PA 4LK1F 3HRMA 3FXUA 1Z05A 4QLCU 3WTTC 4KYWA 2GWRA 3ZMTA 1SD6A 5F64A 4XBFA 1W5SA 1GHCA 3I64A 3WE3A 4KN7X 3QOPA 1A04A 3DEUA 3QAHA 4LD5A 3I54A 1BN5A 5H6RA 2IA2A 1R7JA 1IN5A 4I2OA 4PGGA 4M74A 3O6BB 5FB2A 4A6EA 2DU9A 4WCGA 4I0BA 2YU3A 2LDUA 2XGXA 1QO0D 3HOTA 2OAZA 1LQ1A 1RZ4A 2ZBKA 2D45A 1J0RA 3HUGA 3ECOA 4S04A 1FOKA 2H94A 2HYFA 5ICCA 1STZA 1T39A 1B4AA 3TO7A 3KCCA 3FMQA 4OOIA 3W6KB 2H6BA 5JR3A 3JTHA 4IRIA 1FBQA 1H0MA 1OYIA 4LB6B 5CVRA 3BJOA 4RAYA 2HOEA 4M6XA 2E1NA 4Y17A 2HFHA 4KIBA 2KIMA 1HKTA 1OPCA 3RYPA 4LG0A 2CYYA 1IW7F 2WWYA 2VE9A 4AD9A 4KFCA 2WC2A 1IN6A 3LA3A 1BC7C 1OYWA 3VODA 3GYHX 1P6RA 2IVMA 2EFNA 3HTSB 5D6EA 3GW2A 5HS9A 4N9HA 3I4PA 3HYIA 4ZYDA 1IRGA 1ZYRF 2EFOA 2RKHA 4AVPA 3HRUA 4CHUA 1KGSA 1RNLA 2O0YA 5AONA 2OBPA 3WE2A 4MTDA 4HA8A 1UHWA 3IWFA 1FP2A 1G3TA 1AWCA 1K7AA 5FD5A 5FO5A 5L3GA 3M8EA 3NQOA 2V1DA 1R5HA 2HEOA 5K5QA 2G7UA 1XCVA 1HBXG 1B6AA 4AIHA 3FHZA 2ZNZA 5L3EA 5D8KB 1J2XA 3ISPA 2EWNA 1FX7A 2M45A 2EV0A 3KP7A 3U1DA 3C18A 4CGZA 4WK8F 3VB2A 3WU1B 3ZMDA 2P6TA 1LVAA 1ONVA 2JT1A 2MBFA 3CTAA 2O6GE 2QWWA 2IA1A 2CW0F 3P9KA 3GZ6A 4M6YA 2MLKA 2MC3A 3U2RA 4N9IA 2Z33A 1SFUA 3KP4A 3C3WA 1PDNC 4E70A 4IRHA 2ZCWA 1T2KA 3HSEA 3HRSA 3CDHA 2OZ6A 2NNYA 2HDCA 4KICA 2AXLA 2DAOA 4YIFA 1SAXA 4BQAA 1MDMA 4FX0A 3K1MA 5LHHA 1HXDA 3MEXA 1E17A 1HKQA 2HWVA 3DPTA 2Z5UA 2CSOA 2F2EA 2UZKA 4B8XA 1SFXA 2FNAA 2K86A 1ZGJA 2K02A 1L3LA 3F8FA 4NQWA 1K79A 1EH7A 6PAXA 2Z9OA 1MZBA 4ENNA 2JRTA 5E8GA 4EJVA 1RUOA 1FNNA 1DDNA 3PQJA 2W84A 3G73A 4LLNA 2DO7A 1JE8A 2MLGA 2ETHA 1R1TA 4UV9A 5LEJA 2Z3YA 4Q4ZF 4GCVA 3GLXA 1KU2A 1IN4A 3I53A 2XIGA 4ESBA 3J81K 3WTYC 2WV0A 1IAWA 1OMIA 2HYGD 5DUIA 1WSUA 2FOKA 1XGOA 2HZTA 1YS7A 4PGHA 4MTEA 4DQ2A 2VC1A 1O7FA 3V4GA 1O3RA 2KKOA 4P9FA 3U9GA 4U0YA 3QPHA 2XKOA 4BAYA 1S3JA 3CUQC 1UB9A 2MH2A 3F8BA 2DQRA 1IXRC 1BI3A 5E1XA 5KVRA 2RN7A 3OV8A 1ZG5A 2LSOA 2RNJA 3BWGA 2K27A 3KZZA 4HOBA 3F8MA 4BHCA 4WXCA 3MCZA 2VBZA 3SZPA 2GIVA 1SMTA 3V7RA 4L9JA 5BPDA 1YFHA 1Z9CA 3EETA 1ZG3A 4IVNA 5JHUA 2XAGA 5E17F 2IRFG 5ILVA 1KQ0A 3V7SA 5AIQA 1R36A 1U5TB 3W6JB 3FMSA 3EYYA 3LSTA 2NRAC 4FHTA 4RS8A 2MH9A 4HX7A 3ZN1A 3DQVC 1VTNC 2ZKZA 3TOBA 4XLNF 5JVTA 3VFZA 3WTSC 3MAJA 3D0SA 5EEHA 3TOAA 5DCMB 1SD4A 1J7KA 2QQ9A 1QQIA 4OINF 1U2WA 3BOQA 2FE3A 1K6OA 2DFIA 2LF8A 2GQQA 4L0YB 4A12A 4YG2F 4A5NA 1UFMA 1EH6A 4OMZA 4G6QA 4GGGA 3E6DA 1O7LA 4YFXF 4ESFA 2QZ8A 3COAC 1XDSA 4LG0B 3QU6A 5CVVA 1W4MA 4YFKF 2EV6A 4UV8A 1MJAA 2A6EF 5LRSA 3IRRA 1LJ9A 4WXHA 3R0JA 5CVIA 3GX4X 4PZJA 2F5DA 4IXAA 1XGNA 2LF7A 2F5FA 4RB3C 3KZYA 3H3UA 4BH9A 3ML6A 2XAFA 4MEYF 2DK5A 3QPTA 1Z1DA 2QQBA 1FBUA 4P9UA 1X3UA 4O5VA 4EGZA 4Y13A 1KQ9A 1HW5A 4KMFA 4BHPA 5TRDA 5ILUA 4AWXB 4I7HA 5HDKA 1FSHA 2QENA 2UXNA 1JHHA 3WTUC 1PP7U 5ILSA 3JSPA 4CO8A 4UNOA 2IJLA 3JAMZ 3B02A 3KEOA 4OU0A 4EM1A 4KDPA 5HLGA 4M72A 1REPC 2XROA 1W7PB 4IJAA 2L4MA 1BC8C 4LJZF 4L18B 5D5XB 5LBQA 2JPBA 3FM5A 1MJ9A 1FPQA 3WG9A 2CO5A 1IRFA 5K5RA 4G7OF 2RC4A 5CVUA 4HF0A 1R1UA 1ZN2A 1TQPA 1IUYA 1IF1A 4HZFA 2ADUA 2DK8A 4MGRA 2FXAA 5LGUA 1DUXC 2VBXA 3NEUA 2FF4A 3GFJA 2O3FA 3BP8A 2NS0A 1ZHFA 4A2UA 2A5YB 5A2QK 2STTA 2QVOA 4HQEA 2A68F 2GXGA 1MGTA 3CUOA 3DPLC 3DXJF 3LQQA 4Q48A 2VT2A 3L9FA 5DD8A 4RGXA 4G7ZF 1KQ8A 3F6VA 3KEQA 5LGNA 2XASA 2XAJA 4I09A 4WWCA 4GYIA 3KP2A 3FZVA 4KIFA 3T5XA 1U5TA 4BYYA 3DV8A 1G3WA 1TQIA 2PG4A 3F22A 2PLYA 2RQPA 3J80Z 3K1NA 3RIRA 5D5VB 1D8JA 1XMAA 4OIOF 1B1BA 1Z6RA 2MA3A 5DYMA 4B09A 4Q5SF 2QBYA 2R7FA 3I58A 2DPUA 2IT0A 4KA4A 3HTUA 2FNPA 4L9VA 4EGYA 3MZHA 3T1BA 1FSEA 2P7VB 4HX4A 1TBXA 1WI9A 2AS5F 2FU4A 1SD7A 5LHIA 4RGUA 5ERIA 3ZN0A 1Y0UA 3I59B 1QZZA 2ZXJA 3MFKA 2NAZA 3VEPA 1T98A 2XRNA 1YW8A 2EB7A 4CDGA 2R3SA 3RDIA 2ACJA 4CXFA 3DF8A 3J80K 1FYMA 1W5TA 4OMYA 3V8JA 3WTWC 3J7AO 4M73A 5IT3A 2F5CA 2BEOA 5ICFA 4U0WA 2EFPA 2A07F 2K7LA 3LAJA 4YFNF 1IXSB 2V1UA 2PMUA 4Y15A 2BE5F 2O8XA 2VXZA 3EYIA 4HV5A 1IN7A 3P9IA 4U0VA 5HLHA 1BJAA 1USSA 3V8LA 1J5YA 2VN2A 3EQLF 1XB4A 4IHTA 2V9VA 1RUNA 3QP5A 2XHKA 3WU0A 3ZMVA 2W85A 3GWZA 3L7WA 4UVBA 2K4JA 2CQKA 3WGHA 5CYVA 5D5UB 2VBYA 2COMA 2MD5A 5H20A 3M9AA 4A6DA 3R0AA 5DUKA 2HR3A 3LA2A 3ZQ7A 2HQRA 3GFIA 1USTA 3E6MA 3K1PA 5K5OA 1CGPA 3LQRA 1TW2A 2F5EA 1ULYA 4JBAA 4CZZA 2B0LA 1MJBA 2QQAA 3PFIA 3BJAA 1E2XA 2FMYA 3MZYA 3F8NA 2D1HA 2M30A 1HQCA 3F8CA 2EJRA 4KMUX 3H3ZA 4EQQA 3RKXA 3F6OA 3T8RA 1BI1A 3EDPA 1QZYA 4LK0F 3E3VA 4KUMA 1IZ1A 2EA2A 2D2WA 4QWQA 2CG4A 4U7BA 2QLZA 5F6FA 4GYGA 1O3SA 1R23A 3HSFA 1I5ZA 3RJPA 3IL2A 5LEKA 2DBBA 2OQRA 1FC3A 4UVCA 1P2FA 1ZARA 3RPUA 4WXDA 3DFGA 3HOSA 1BBYA 2XAQA 1KU3A 3ULQB 3BJ6A 3WTXC 3CO6C 3TDZC 5LHGA 1Q1HA 2Q2EA 4RB2C 1S8NA 3SXYA 1HW1A 3WODF 2GAUA 3GFLA 3CUQB 3JW4A 1GXQA 1S7AA 4IRGA 3LFKA 1BIBA 4ENJA 1TNTA 2BBYA 2KJBA 3DP7A 4FX4A 2YX4A 4HLXA 1NHAA 2OD5A 5CLSA 4ZYHA 4P55A 1XCBA 4MNUA 2Y0MA 5LGTA 1FP1D 2P5VA 5D8LB 1W7PD 3GVAA 1XGSA 3GEZA 3WTZA 3K2ZA 1V3FA 2M1BA 3SZTA 3GO5A 3R60A 3KE2A 5BS6A 1L0OC 5L3FA 2Y75A 3E6BA 3IKVA 3HSRA 5E20A 4EV0A 1ODDA 4WF2A 1XDUA 1UCRA 1QNTA 4ZYGA 4IHSA 4OIPF 5EEGA 2ISYA 3GF2A 4CICA 4M9ZA 2YPRA 4EJTA 1QBJA 2YR2A 3KETA 1LEBA 4ZZDA 4L5JA 3E5XA 2VONA 2EV5A 4Z2YA 1JHFA 1KA8A 2ZFWA 5DEQA 1B9MA 1AOYA 1QGPA 3R61A 2PI0A 3FXQA 3P9CA 3FMRA 3HHHA 5HS7A 2GZWA 1IN8A 4XSZF 2YSRA 3E97A 4D0PA 1R22A 3TKYA 4KT5C 4KNYA 2RDPA 3O3KA 3J81Z 1D8KA 1T38A 2CWEA 4EMSA 5HDNA 1F9NA 3K69A 4GXOA 3BPVA 3TDUC 3ZPLA 4G94A 2G9WA 2VBWA 4FT8A 2FRHA 2EK5A 1ZH5A 4BNCA 3HRTA 2CFXA 1R1VA 3SHFA 3AAFA 2JZYA 3KP3A 2VE8A 2IW5A 2XAHA 2YX7A 1GVJA 1LNWA 2QYOA 4ON0A 5J8CA 4UVAA 2NNNA 3Q9VA 1D3YA 2L01A 4L9NA 1K78A 2X0LA 1J9IA 2OQGA 4TV7A 3R6SA 3LAPA 2RGVA 4HDVA 2STWA 3BROA 1U5TC 4A5MA 3LWFA 3KLNA 5BMZA 4HLYA 4P5OA 5L3CA 1PUEE 2M8EA 1WWXA 3M1EA 3EUHA 5HOOA 1SMYF 2PQ8A 2O61A 5BOXA 2TDXA 5FD6A 3HIFA 1BOAA 4OIQF 5CJ9A 4WX9A 2P5LC 3I71A 2ESHA 4YIIA 3PQKA 3FX3A 2DLLA 4L5IA 1ZG1A 3BPXA 5DCMA 3ABTA 1FBSA 2EFQA 2ELHA 4HW0A 5CVJA 4JK1X 1YS6A 4EM2A 4G9YA 1P92A 2BYVE 1YG2A 5LLQA 1GXPA 3Q5FA 2M87A 1K78B 3N97A 1LB2A 3D5LA 4ENMA 4ESJA 1H9GA 1XMKA 4LFUA 1QPMA 1R5GA 2W57A 4H0EA 3C1DA 1P4AA 1G3YA 1XSXA 4LMYA 4RB0A 1XGMA 5BQTA 3RPQA 4RGSA 3TO6A 2KIUA 4PDKA 4M71A 3KP5A 1LDKB 4OIRF 2E1CA 4HAMA 5HS8A 3ZP5A 4HQMA 4N0BA 4R79A 1XSVA 3TQNA 5ICGA 3CLOA 3CJNA 3MWMA 5E1WA 3FXRA 2PEXA 4M9SA 5HDGA 3IC7A 3QU3A 2ZMEA 3QRFF 1F5TA 2L02A 5JI6A 1TLHB 3N4MA 2VOOA 4Q47A 1DPRA 2DQLA 3IHUA 3RYRA 2ZNYA 4P96A 4ZZLA 2XVCA 4EJOA 2GA1A 4A0ZA 3JTGA 2E7WA 2KJCA 4I02A 1I1GA 2R7DA 4KIGA 3RKYA 2H27A 4LLLA 4PCQA 5IT9Z 1U3EM 3K0LA 4U88A 1YYVA 2QUFA 3RKWA 2CGPA 4M9XA 3WGIA 4EVIA 3GUDA 2KIFA 3V8KA 2UWMA 2ISZA 3ZMUA 2DT5A 4K2EA 2D1VA 4JQFA 2W24A 3F23A 4R1HA 1J75A 2V79A 1ZAOA 4I0AA 5TJJA 4BXUA 1CF7B 2ESNA 4XSXF 2P8TA 1V4RA 1I27A 3G3ZA 5FLXK 1S7OA 1G6NA 1FYLA 4HYEA 2FMLA 4IF4A 4G7HF 1U8RA 1KYWA 1BIAA 3FWEA 3ABUA 2M5WA 1JGSA 1T6SA 2FEZA 2JTVA 4XLPF 4RAZA 2K4BA 2PN6A 2JPCA 2L4AA 3CUQA 2HGCA 5KK1A 2VC0A 3L2CA 2HS5A 2PFBA 4CYDA 5D5WB 2P4WA 3JAMK 2EFWA 5DDGA 5ED4A 4HX8A 3M7GA 3IKTA 5FFXA 4AIKA 3ELKA 4EJWA 1UHMA 3QP6A 1FT9A 2FBKA 1HKSA 3T0YA 2LKPA 2ZO4A 4DNCA 1HSTA 4O6JA 2BGCA 3V7CA 1F1ZA 1LDJA 4HDUA 4IPAA 3WTVC 3NRVA 4LB5A 1MKMA 1ZRFA 3JSOA 2DI3A 2GXBA 2Q8KA 3SQNA 2HTSA 4I01A 1Z6TA 2PBIA 3REOA 4HF1A 1PP8F 1YLFA 1ZLJA 1T0FA 3ROUA 1YW9A 5D4SA 3LA7A 5JFRA 2RVCA 4MHGA 3E5UA 1LDDA 2A61A 1D5VA 1FZPB 1U78A 3CO7C 1WRJA 1B9NA 1WKMA 3K9TA 1BM9A 1KYZA 4RB1A 2P7CB 2NYXA 1FWZA 5J6XA 2PMHA 2A3SA 5FGMA 3GFMA 2QBYB 1TW3A 3FF5A 2VOPA 4NHJA 3HHGA 2BV6A 3R4KA 3ZMSA 2PJPA 4LGWA 1EH8A 1ZRDA 4EM0B 1CF7A 5L3DA 5FFZA 2OA4A 2H6CA 4ETSA 1FYKA 5DV5A 5L3BA 2IPQX 5DD4A 1SFEA 5E1ZB 3B73A 2V6CA 3DKWA 2HQNA 5K1YA 1I1SA 1ZREA 2FSWA 2J5OA 1FLIA 3GXOA 2C6YA 2OU2A 3M8FA 2ZJ2A 2X4HA 3L09A 2L3DA 1R58A 5F1RA 1O3QA 3IRQA 1XD7A 2A6HF 1TTYA 4ASNA 1S29A 3F21A 2Q0OA 3Q9SA 4UUVA 1MDMB 2FQ3A 4XRFA 3TO9A 2VODA 3OOPA 3ECHA 1YTYA 1KU9A 5AIPA 5ICEA 2P6SA 1G4DA 1YIOA 1YW7A 1ON1A 5BPIA 2JSCA 4U7DA 4UHTA 3IWZA 4KN4X 3SFZA 4L0ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9T A;  1SD5 A;  1TQM A;  2G7H A;  2HKX A;  3VOE A;  1U6G A;  3I0T A;  3I59 A;  5HLI A;  3S2W A;  1ZRC A;  4S05 A;  1YO5 C;  1C0W A;  2IP2 A;  1BI0 A;  4F7Z A;  4HF2 A;  4MEX F;  1OYY A;  1WQ2 A;  1I6X A;  5E18 F;  2VT3 A;  2IA0 A;  4MQ9 F;  1F4K A;  1LEA A;  1ZLK A;  2E7X A;  1S6L A;  3E5Q A;  3I5U A;  2RV8 A;  4RGR A;  4HV6 A;  2J5P A;  4G6D A;  5FLX Z;  1O3T A;  3BZ6 A;  1HSJ A;  3O2P E;  1Z91 A;  3BDD A;  4EJU A;  3F3X A;  4LLG F;  2UXX A;  1MD0 A;  3C7J A;  5J8F A;  1B59 A;  3RTR A;  3P7N A;  3GZ5 A;  1RIO H;  3KLO A;  1YQA A;  4G8X A;  5E8I A;  4ZYE A;  1RI7 A;  4BHB A;  4R8H A;  5A2Q Z;  3RI4 A;  2L54 A;  1XSD A;  1Z7U A;  2DTR A;  3ZMZ A;  1BI2 A;  2A69 F;  3T8T A;  3MQ0 A;  3WGG A;  1G3S A;  2DW4 A;  2XV4 S;  2OZU A;  3F72 A;  1J59 A;  2FBH A;  2HKO A;  5H6Q A;  1ON2 A;  1OR7 A;  2DPD A;  2Z99 A;  5HVQ C;  1P4W A;  1JXS A;  2O03 A;  4A0Y A;  2GA2 A;  4I98 B;  1KU7 A;  1TNS A;  5LRR A;  2FA5 A;  2XUB A;  2KRF A;  3FM3 A;  1P4X A;  3E6C C;  1XN7 A;  3ERE D;  1R00 A;  3KFW X;  4ENK A;  1DP7 P;  1IXC A;  4O3M A;  2H09 A;  4HBL A;  5D4R A;  1FY7 A;  4UXN A;  2XKP A;  4MQV A;  2HTJ A;  2QM3 A;  4A0X A;  3BY6 A;  1DPU A;  3L00 A;  4ZH4 F;  4NB5 A;  2FBI A;  2ZME B;  3KP6 A;  1ZGA A;  1O57 A;  1OKR A;  1EV7 A;  2W25 A;  2Y48 A;  4GO1 A;  4AIJ A;  5D6F A;  5IT9 K;  2EA4 A;  1HW2 A;  1H9T A;  2LNB A;  2P5K A;  5DCF A;  3TGN A;  2V1X A;  3H92 A;  2WTE A;  1W7P A;  4LK1 F;  3HRM A;  3FXU A;  1Z05 A;  4QLC U;  3WTT C;  4KYW A;  2GWR A;  3ZMT A;  1SD6 A;  5F64 A;  4XBF A;  1W5S A;  1GHC A;  3I64 A;  3WE3 A;  4KN7 X;  3QOP A;  1A04 A;  3DEU A;  3QAH A;  4LD5 A;  3I54 A;  1BN5 A;  5H6R A;  2IA2 A;  1R7J A;  1IN5 A;  4I2O A;  4PGG A;  4M74 A;  3O6B B;  5FB2 A;  4A6E A;  2DU9 A;  4WCG A;  4I0B A;  2YU3 A;  2LDU A;  2XGX A;  1QO0 D;  3HOT A;  2OAZ A;  1LQ1 A;  1RZ4 A;  2ZBK A;  2D45 A;  1J0R A;  3HUG A;  3ECO A;  4S04 A;  1FOK A;  2H94 A;  2HYF A;  5ICC A;  1STZ A;  1T39 A;  1B4A A;  3TO7 A;  3KCC A;  3FMQ A;  4OOI A;  3W6K B;  2H6B A;  5JR3 A;  3JTH A;  4IRI A;  1FBQ A;  1H0M A;  1OYI A;  4LB6 B;  5CVR A;  3BJO A;  4RAY A;  2HOE A;  4M6X A;  2E1N A;  4Y17 A;  2HFH A;  4KIB A;  2KIM A;  1HKT A;  1OPC A;  3RYP A;  4LG0 A;  2CYY A;  1IW7 F;  2WWY A;  2VE9 A;  4AD9 A;  4KFC A;  2WC2 A;  1IN6 A;  3LA3 A;  1BC7 C;  1OYW A;  3VOD A;  3GYH X;  1P6R A;  2IVM A;  2EFN A;  3HTS B;  5D6E A;  3GW2 A;  5HS9 A;  4N9H A;  3I4P A;  3HYI A;  4ZYD A;  1IRG A;  1ZYR F;  2EFO A;  2RKH A;  4AVP A;  3HRU A;  4CHU A;  1KGS A;  1RNL A;  2O0Y A;  5AON A;  2OBP A;  3WE2 A;  4MTD A;  4HA8 A;  1UHW A;  3IWF A;  1FP2 A;  1G3T A;  1AWC A;  1K7A A;  5FD5 A;  5FO5 A;  5L3G A;  3M8E A;  3NQO A;  2V1D A;  1R5H A;  2HEO A;  5K5Q A;  2G7U A;  1XCV A;  1HBX G;  1B6A A;  4AIH A;  3FHZ A;  2ZNZ A;  5L3E A;  5D8K B;  1J2X A;  3ISP A;  2EWN A;  1FX7 A;  2M45 A;  2EV0 A;  3KP7 A;  3U1D A;  3C18 A;  4CGZ A;  4WK8 F;  3VB2 A;  3WU1 B;  3ZMD A;  2P6T A;  1LVA A;  1ONV A;  2JT1 A;  2MBF A;  3CTA A;  2O6G E;  2QWW A;  2IA1 A;  2CW0 F;  3P9K A;  3GZ6 A;  4M6Y A;  2MLK A;  2MC3 A;  3U2R A;  4N9I A;  2Z33 A;  1SFU A;  3KP4 A;  3C3W A;  1PDN C;  4E70 A;  4IRH A;  2ZCW A;  1T2K A;  3HSE A;  3HRS A;  3CDH A;  2OZ6 A;  2NNY A;  2HDC A;  4KIC A;  2AXL A;  2DAO A;  4YIF A;  1SAX A;  4BQA A;  1MDM A;  4FX0 A;  3K1M A;  5LHH A;  1HXD A;  3MEX A;  1E17 A;  1HKQ A;  2HWV A;  3DPT A;  2Z5U A;  2CSO A;  2F2E A;  2UZK A;  4B8X A;  1SFX A;  2FNA A;  2K86 A;  1ZGJ A;  2K02 A;  1L3L A;  3F8F A;  4NQW A;  1K79 A;  1EH7 A;  6PAX A;  2Z9O A;  1MZB A;  4ENN A;  2JRT A;  5E8G A;  4EJV A;  1RUO A;  1FNN A;  1DDN A;  3PQJ A;  2W84 A;  3G73 A;  4LLN A;  2DO7 A;  1JE8 A;  2MLG A;  2ETH A;  1R1T A;  4UV9 A;  5LEJ A;  2Z3Y A;  4Q4Z F;  4GCV A;  3GLX A;  1KU2 A;  1IN4 A;  3I53 A;  2XIG A;  4ESB A;  3J81 K;  3WTY C;  2WV0 A;  1IAW A;  1OMI A;  2HYG D;  5DUI A;  1WSU A;  2FOK A;  1XGO A;  2HZT A;  1YS7 A;  4PGH A;  4MTE A;  4DQ2 A;  2VC1 A;  1O7F A;  3V4G A;  1O3R A;  2KKO A;  4P9F A;  3U9G A;  4U0Y A;  3QPH A;  2XKO A;  4BAY A;  1S3J A;  3CUQ C;  1UB9 A;  2MH2 A;  3F8B A;  2DQR A;  1IXR C;  1BI3 A;  5E1X A;  5KVR A;  2RN7 A;  3OV8 A;  1ZG5 A;  2LSO A;  2RNJ A;  3BWG A;  2K27 A;  3KZZ A;  4HOB A;  3F8M A;  4BHC A;  4WXC A;  3MCZ A;  2VBZ A;  3SZP A;  2GIV A;  1SMT A;  3V7R A;  4L9J A;  5BPD A;  1YFH A;  1Z9C A;  3EET A;  1ZG3 A;  4IVN A;  5JHU A;  2XAG A;  5E17 F;  2IRF G;  5ILV A;  1KQ0 A;  3V7S A;  5AIQ A;  1R36 A;  1U5T B;  3W6J B;  3FMS A;  3EYY A;  3LST A;  2NRA C;  4FHT A;  4RS8 A;  2MH9 A;  4HX7 A;  3ZN1 A;  3DQV C;  1VTN C;  2ZKZ A;  3TOB A;  4XLN F;  5JVT A;  3VFZ A;  3WTS C;  3MAJ A;  3D0S A;  5EEH A;  3TOA A;  5DCM B;  1SD4 A;  1J7K A;  2QQ9 A;  1QQI A;  4OIN F;  1U2W A;  3BOQ A;  2FE3 A;  1K6O A;  2DFI A;  2LF8 A;  2GQQ A;  4L0Y B;  4A12 A;  4YG2 F;  4A5N A;  1UFM A;  1EH6 A;  4OMZ A;  4G6Q A;  4GGG A;  3E6D A;  1O7L A;  4YFX F;  4ESF A;  2QZ8 A;  3COA C;  1XDS A;  4LG0 B;  3QU6 A;  5CVV A;  1W4M A;  4YFK F;  2EV6 A;  4UV8 A;  1MJA A;  2A6E F;  5LRS A;  3IRR A;  1LJ9 A;  4WXH A;  3R0J A;  5CVI A;  3GX4 X;  4PZJ A;  2F5D A;  4IXA A;  1XGN A;  2LF7 A;  2F5F A;  4RB3 C;  3KZY A;  3H3U A;  4BH9 A;  3ML6 A;  2XAF A;  4MEY F;  2DK5 A;  3QPT A;  1Z1D A;  2QQB A;  1FBU A;  4P9U A;  1X3U A;  4O5V A;  4EGZ A;  4Y13 A;  1KQ9 A;  1HW5 A;  4KMF A;  4BHP A;  5TRD A;  5ILU A;  4AWX B;  4I7H A;  5HDK A;  1FSH A;  2QEN A;  2UXN A;  1JHH A;  3WTU C;  1PP7 U;  5ILS A;  3JSP A;  4CO8 A;  4UNO A;  2IJL A;  3JAM Z;  3B02 A;  3KEO A;  4OU0 A;  4EM1 A;  4KDP A;  5HLG A;  4M72 A;  1REP C;  2XRO A;  1W7P B;  4IJA A;  2L4M A;  1BC8 C;  4LJZ F;  4L18 B;  5D5X B;  5LBQ A;  2JPB A;  3FM5 A;  1MJ9 A;  1FPQ A;  3WG9 A;  2CO5 A;  1IRF A;  5K5R A;  4G7O F;  2RC4 A;  5CVU A;  4HF0 A;  1R1U A;  1ZN2 A;  1TQP A;  1IUY A;  1IF1 A;  4HZF A;  2ADU A;  2DK8 A;  4MGR A;  2FXA A;  5LGU A;  1DUX C;  2VBX A;  3NEU A;  2FF4 A;  3GFJ A;  2O3F A;  3BP8 A;  2NS0 A;  1ZHF A;  4A2U A;  2A5Y B;  5A2Q K;  2STT A;  2QVO A;  4HQE A;  2A68 F;  2GXG A;  1MGT A;  3CUO A;  3DPL C;  3DXJ F;  3LQQ A;  4Q48 A;  2VT2 A;  3L9F A;  5DD8 A;  4RGX A;  4G7Z F;  1KQ8 A;  3F6V A;  3KEQ A;  5LGN A;  2XAS A;  2XAJ A;  4I09 A;  4WWC A;  4GYI A;  3KP2 A;  3FZV A;  4KIF A;  3T5X A;  1U5T A;  4BYY A;  3DV8 A;  1G3W A;  1TQI A;  2PG4 A;  3F22 A;  2PLY A;  2RQP A;  3J80 Z;  3K1N A;  3RIR A;  5D5V B;  1D8J A;  1XMA A;  4OIO F;  1B1B A;  1Z6R A;  2MA3 A;  5DYM A;  4B09 A;  4Q5S F;  2QBY A;  2R7F A;  3I58 A;  2DPU A;  2IT0 A;  4KA4 A;  3HTU A;  2FNP A;  4L9V A;  4EGY A;  3MZH A;  3T1B A;  1FSE A;  2P7V B;  4HX4 A;  1TBX A;  1WI9 A;  2AS5 F;  2FU4 A;  1SD7 A;  5LHI A;  4RGU A;  5ERI A;  3ZN0 A;  1Y0U A;  3I59 B;  1QZZ A;  2ZXJ A;  3MFK A;  2NAZ A;  3VEP A;  1T98 A;  2XRN A;  1YW8 A;  2EB7 A;  4CDG A;  2R3S A;  3RDI A;  2ACJ A;  4CXF A;  3DF8 A;  3J80 K;  1FYM A;  1W5T A;  4OMY A;  3V8J A;  3WTW C;  3J7A O;  4M73 A;  5IT3 A;  2F5C A;  2BEO A;  5ICF A;  4U0W A;  2EFP A;  2A07 F;  2K7L A;  3LAJ A;  4YFN F;  1IXS B;  2V1U A;  2PMU A;  4Y15 A;  2BE5 F;  2O8X A;  2VXZ A;  3EYI A;  4HV5 A;  1IN7 A;  3P9I A;  4U0V A;  5HLH A;  1BJA A;  1USS A;  3V8L A;  1J5Y A;  2VN2 A;  3EQL F;  1XB4 A;  4IHT A;  2V9V A;  1RUN A;  3QP5 A;  2XHK A;  3WU0 A;  3ZMV A;  2W85 A;  3GWZ A;  3L7W A;  4UVB A;  2K4J A;  2CQK A;  3WGH A;  5CYV A;  5D5U B;  2VBY A;  2COM A;  2MD5 A;  5H20 A;  3M9A A;  4A6D A;  3R0A A;  5DUK A;  2HR3 A;  3LA2 A;  3ZQ7 A;  2HQR A;  3GFI A;  1UST A;  3E6M A;  3K1P A;  5K5O A;  1CGP A;  3LQR A;  1TW2 A;  2F5E A;  1ULY A;  4JBA A;  4CZZ A;  2B0L A;  1MJB A;  2QQA A;  3PFI A;  3BJA A;  1E2X A;  2FMY A;  3MZY A;  3F8N A;  2D1H A;  2M30 A;  1HQC A;  3F8C A;  2EJR A;  4KMU X;  3H3Z A;  4EQQ A;  3RKX A;  3F6O A;  3T8R A;  1BI1 A;  3EDP A;  1QZY A;  4LK0 F;  3E3V A;  4KUM A;  1IZ1 A;  2EA2 A;  2D2W A;  4QWQ A;  2CG4 A;  4U7B A;  2QLZ A;  5F6F A;  4GYG A;  1O3S A;  1R23 A;  3HSF A;  1I5Z A;  3RJP A;  3IL2 A;  5LEK A;  2DBB A;  2OQR A;  1FC3 A;  4UVC A;  1P2F A;  1ZAR A;  3RPU A;  4WXD A;  3DFG A;  3HOS A;  1BBY A;  2XAQ A;  1KU3 A;  3ULQ B;  3BJ6 A;  3WTX C;  3CO6 C;  3TDZ C;  5LHG A;  1Q1H A;  2Q2E A;  4RB2 C;  1S8N A;  3SXY A;  1HW1 A;  3WOD F;  2GAU A;  3GFL A;  3CUQ B;  3JW4 A;  1GXQ A;  1S7A A;  4IRG A;  3LFK A;  1BIB A;  4ENJ A;  1TNT A;  2BBY A;  2KJB A;  3DP7 A;  4FX4 A;  2YX4 A;  4HLX A;  1NHA A;  2OD5 A;  5CLS A;  4ZYH A;  4P55 A;  1XCB A;  4MNU A;  2Y0M A;  5LGT A;  1FP1 D;  2P5V A;  5D8L B;  1W7P D;  3GVA A;  1XGS A;  3GEZ A;  3WTZ A;  3K2Z A;  1V3F A;  2M1B A;  3SZT A;  3GO5 A;  3R60 A;  3KE2 A;  5BS6 A;  1L0O C;  5L3F A;  2Y75 A;  3E6B A;  3IKV A;  3HSR A;  5E20 A;  4EV0 A;  1ODD A;  4WF2 A;  1XDU A;  1UCR A;  1QNT A;  4ZYG A;  4IHS A;  4OIP F;  5EEG A;  2ISY A;  3GF2 A;  4CIC A;  4M9Z A;  2YPR A;  4EJT A;  1QBJ A;  2YR2 A;  3KET A;  1LEB A;  4ZZD A;  4L5J A;  3E5X A;  2VON A;  2EV5 A;  4Z2Y A;  1JHF A;  1KA8 A;  2ZFW A;  5DEQ A;  1B9M A;  1AOY A;  1QGP A;  3R61 A;  2PI0 A;  3FXQ A;  3P9C A;  3FMR A;  3HHH A;  5HS7 A;  2GZW A;  1IN8 A;  4XSZ F;  2YSR A;  3E97 A;  4D0P A;  1R22 A;  3TKY A;  4KT5 C;  4KNY A;  2RDP A;  3O3K A;  3J81 Z;  1D8K A;  1T38 A;  2CWE A;  4EMS A;  5HDN A;  1F9N A;  3K69 A;  4GXO A;  3BPV A;  3TDU C;  3ZPL A;  4G94 A;  2G9W A;  2VBW A;  4FT8 A;  2FRH A;  2EK5 A;  1ZH5 A;  4BNC A;  3HRT A;  2CFX A;  1R1V A;  3SHF A;  3AAF A;  2JZY A;  3KP3 A;  2VE8 A;  2IW5 A;  2XAH A;  2YX7 A;  1GVJ A;  1LNW A;  2QYO A;  4ON0 A;  5J8C A;  4UVA A;  2NNN A;  3Q9V A;  1D3Y A;  2L01 A;  4L9N A;  1K78 A;  2X0L A;  1J9I A;  2OQG A;  4TV7 A;  3R6S A;  3LAP A;  2RGV A;  4HDV A;  2STW A;  3BRO A;  1U5T C;  4A5M A;  3LWF A;  3KLN A;  5BMZ A;  4HLY A;  4P5O A;  5L3C A;  1PUE E;  2M8E A;  1WWX A;  3M1E A;  3EUH A;  5HOO A;  1SMY F;  2PQ8 A;  2O61 A;  5BOX A;  2TDX A;  5FD6 A;  3HIF A;  1BOA A;  4OIQ F;  5CJ9 A;  4WX9 A;  2P5L C;  3I71 A;  2ESH A;  4YII A;  3PQK A;  3FX3 A;  2DLL A;  4L5I A;  1ZG1 A;  3BPX A;  5DCM A;  3ABT A;  1FBS A;  2EFQ A;  2ELH A;  4HW0 A;  5CVJ A;  4JK1 X;  1YS6 A;  4EM2 A;  4G9Y A;  1P92 A;  2BYV E;  1YG2 A;  5LLQ A;  1GXP A;  3Q5F A;  2M87 A;  1K78 B;  3N97 A;  1LB2 A;  3D5L A;  4ENM A;  4ESJ A;  1H9G A;  1XMK A;  4LFU A;  1QPM A;  1R5G A;  2W57 A;  4H0E A;  3C1D A;  1P4A A;  1G3Y A;  1XSX A;  4LMY A;  4RB0 A;  1XGM A;  5BQT A;  3RPQ A;  4RGS A;  3TO6 A;  2KIU A;  4PDK A;  4M71 A;  3KP5 A;  1LDK B;  4OIR F;  2E1C A;  4HAM A;  5HS8 A;  3ZP5 A;  4HQM A;  4N0B A;  4R79 A;  1XSV A;  3TQN A;  5ICG A;  3CLO A;  3CJN A;  3MWM A;  5E1W A;  3FXR A;  2PEX A;  4M9S A;  5HDG A;  3IC7 A;  3QU3 A;  2ZME A;  3QRF F;  1F5T A;  2L02 A;  5JI6 A;  1TLH B;  3N4M A;  2VOO A;  4Q47 A;  1DPR A;  2DQL A;  3IHU A;  3RYR A;  2ZNY A;  4P96 A;  4ZZL A;  2XVC A;  4EJO A;  2GA1 A;  4A0Z A;  3JTG A;  2E7W A;  2KJC A;  4I02 A;  1I1G A;  2R7D A;  4KIG A;  3RKY A;  2H27 A;  4LLL A;  4PCQ A;  5IT9 Z;  1U3E M;  3K0L A;  4U88 A;  1YYV A;  2QUF A;  3RKW A;  2CGP A;  4M9X A;  3WGI A;  4EVI A;  3GUD A;  2KIF A;  3V8K A;  2UWM A;  2ISZ A;  3ZMU A;  2DT5 A;  4K2E A;  2D1V A;  4JQF A;  2W24 A;  3F23 A;  4R1H A;  1J75 A;  2V79 A;  1ZAO A;  4I0A A;  5TJJ A;  4BXU A;  1CF7 B;  2ESN A;  4XSX F;  2P8T A;  1V4R A;  1I27 A;  3G3Z A;  5FLX K;  1S7O A;  1G6N A;  1FYL A;  4HYE A;  2FML A;  4IF4 A;  4G7H F;  1U8R A;  1KYW A;  1BIA A;  3FWE A;  3ABU A;  2M5W A;  1JGS A;  1T6S A;  2FEZ A;  2JTV A;  4XLP F;  4RAZ A;  2K4B A;  2PN6 A;  2JPC A;  2L4A A;  3CUQ A;  2HGC A;  5KK1 A;  2VC0 A;  3L2C A;  2HS5 A;  2PFB A;  4CYD A;  5D5W B;  2P4W A;  3JAM K;  2EFW A;  5DDG A;  5ED4 A;  4HX8 A;  3M7G A;  3IKT A;  5FFX A;  4AIK A;  3ELK A;  4EJW A;  1UHM A;  3QP6 A;  1FT9 A;  2FBK A;  1HKS A;  3T0Y A;  2LKP A;  2ZO4 A;  4DNC A;  1HST A;  4O6J A;  2BGC A;  3V7C A;  1F1Z A;  1LDJ A;  4HDU A;  4IPA A;  3WTV C;  3NRV A;  4LB5 A;  1MKM A;  1ZRF A;  3JSO A;  2DI3 A;  2GXB A;  2Q8K A;  3SQN A;  2HTS A;  4I01 A;  1Z6T A;  2PBI A;  3REO A;  4HF1 A;  1PP8 F;  1YLF A;  1ZLJ A;  1T0F A;  3ROU A;  1YW9 A;  5D4S A;  3LA7 A;  5JFR A;  2RVC A;  4MHG A;  3E5U A;  1LDD A;  2A61 A;  1D5V A;  1FZP B;  1U78 A;  3CO7 C;  1WRJ A;  1B9N A;  1WKM A;  3K9T A;  1BM9 A;  1KYZ A;  4RB1 A;  2P7C B;  2NYX A;  1FWZ A;  5J6X A;  2PMH A;  2A3S A;  5FGM A;  3GFM A;  2QBY B;  1TW3 A;  3FF5 A;  2VOP A;  4NHJ A;  3HHG A;  2BV6 A;  3R4K A;  3ZMS A;  2PJP A;  4LGW A;  1EH8 A;  1ZRD A;  4EM0 B;  1CF7 A;  5L3D A;  5FFZ A;  2OA4 A;  2H6C A;  4ETS A;  1FYK A;  5DV5 A;  5L3B A;  2IPQ X;  5DD4 A;  1SFE A;  5E1Z B;  3B73 A;  2V6C A;  3DKW A;  2HQN A;  5K1Y A;  1I1S A;  1ZRE A;  2FSW A;  2J5O A;  1FLI A;  3GXO A;  2C6Y A;  2OU2 A;  3M8F A;  2ZJ2 A;  2X4H A;  3L09 A;  2L3D A;  1R58 A;  5F1R A;  1O3Q A;  3IRQ A;  1XD7 A;  2A6H F;  1TTY A;  4ASN A;  1S29 A;  3F21 A;  2Q0O A;  3Q9S A;  4UUV A;  1MDM B;  2FQ3 A;  4XRF A;  3TO9 A;  2VOD A;  3OOP A;  3ECH A;  1YTY A;  1KU9 A;  5AIP A;  5ICE A;  2P6S A;  1G4D A;  1YIO A;  1YW7 A;  1ON1 A;  5BPI A;  2JSC A;  4U7D A;  4UHT A;  3IWZ A;  4KN4 X;  3SFZ A;  4L0Z B; 
#chains in the Genus database with same CATH topology
 4L9T A;  1SD5 A;  1TQM A;  2G7H A;  2HKX A;  3A1Y A;  3VOE A;  1U6G A;  1FEX A;  2P0W A;  4MFD A;  4BQO A;  3I0T A;  3I59 A;  5HLI A;  2K3F A;  1SVL A;  3S2W A;  1ZRC A;  1WJ5 A;  4S05 A;  4L5E A;  1YO5 C;  1C0W A;  3H9G A;  2IP2 A;  2V9K A;  1BI0 A;  5IP7 J;  4F7Z A;  4S0H B;  5KCM A;  4HF2 A;  1V5F A;  4MEX F;  2DA7 A;  1OYY A;  3FHN A;  1E0E A;  1T8I A;  1WQ2 A;  4ZTF A;  2DA5 A;  1I6X A;  2E35 A;  1WGX A;  2HDW A;  5E18 F;  3QQA A;  2VT3 A;  1BR4 A;  2IA0 A;  1BOB A;  4MQ9 F;  2E2H J;  1F4K A;  1LEA A;  1ZLK A;  3PUB A;  2KFD A;  5FKL A;  2E7X A;  4GFB A;  1S6L A;  4M6V A;  1GT0 C;  3L2R A;  3AL0 B;  3D5S C;  3E5Q A;  2RAE A;  3I5U A;  2RV8 A;  2Y30 A;  4XRS A;  3RKQ A;  2QSH X;  4XLF A;  2B63 J;  4LIV A;  4RGR A;  5IOY A;  2HVS A;  1XPX A;  4HV6 A;  1OIS A;  1WPK A;  2J5P A;  4G6D A;  3CQZ J;  5FLX Z;  3VSL A;  1O3T A;  3BZ6 A;  1HSJ A;  3O2P E;  2ECB A;  3ERM A;  2VKD A;  2R5Z A;  1Z91 A;  3BDD A;  4EJU A;  1T0F C;  1ZR2 A;  2K3P A;  3F3X A;  1W0T A;  4LLG F;  2UXX A;  1MD0 A;  3C7J A;  3BZK A;  4B3X A;  1ITY A;  5J8F A;  5JHF A;  2ICW G;  1B59 A;  3A03 A;  3CMY A;  1JT0 A;  3RTR A;  5M3F J;  3P7N A;  3GZ5 A;  3M8J A;  5TIS C;  1RIO H;  3KLO A;  1YQA A;  5L3F A;  3IAS 2;  2MD0 A;  3CJQ B;  2EPF A;  4FTH A;  1X3W B;  4PSX A;  1R4N B;  1YX3 A;  2VPR A;  1ETY A;  4G8X A;  3S16 J;  4HG2 A;  2FUG 2;  3QYB A;  5M5X J;  3PFY A;  5E8I A;  4Y3O A;  2GM4 A;  1AA7 A;  1RI7 A;  4BHB A;  3UNG C;  4R8H A;  4ZYE A;  4XL9 A;  5GP9 A;  5A2Q Z;  3RI4 A;  2L54 A;  1XSD A;  2W7N A;  1Z7U A;  2DTR A;  1IRX A;  2JK3 A;  1B72 A;  3ZMZ A;  1BI2 A;  2A69 F;  2D5V A;  3T8T A;  1UEL B;  3MQ0 A;  3WGG A;  1GVD A;  5BNG A;  2LRD A;  1FOW A;  3DTK A;  2GLO A;  1G3S A;  2DW4 A;  2XV4 S;  2DYR H;  3I4M J;  3CDL A;  4PUS A;  4XLC A;  2CRG A;  2OZU A;  3F72 A;  1J59 A;  2FBH A;  2HKO A;  4V2F A;  1WJD A;  4ZC3 A;  1ON2 A;  5H6Q A;  1OR7 A;  2DPD A;  1IRZ A;  2Z99 A;  5HVQ C;  5FKO A;  1RR8 C;  2HPM A;  2O8K A;  1P4W A;  1X1A A;  1JXS A;  3ZQH A;  1I3Q J;  2O03 A;  1NH3 A;  4A0Y A;  2RNG A;  1D0X A;  5B3S H;  2GA2 A;  3OYF A;  4I98 B;  1KU7 A;  3A0H C;  1TNS A;  4G6T B;  1N25 A;  5LRR A;  3Q0V A;  4HST A;  2FA5 A;  2XUB A;  2KRF A;  1LPQ A;  1UHS A;  1YE9 A;  3OYK A;  2VB6 A;  3FM3 A;  1P4X A;  3E6C C;  2CV0 A;  1IO2 A;  1XN7 A;  3AG2 H;  4ANJ A;  3RCO A;  3OYD A;  3ERE D;  1R00 A;  2LY1 A;  3KFW X;  4C30 A;  3F9K A;  4A3D J;  2K9S A;  4BL0 B;  4ENK A;  2YS9 A;  1DP7 P;  1IXC A;  4O3M A;  2JA5 J;  2H09 A;  4HBL A;  5D4R A;  5HOD A;  4XRM A;  1BL0 A;  3H0D A;  2E1O A;  1FY7 A;  1VND A;  4UXN A;  2XKP A;  4MQV A;  2HTJ A;  4LOC A;  1Q1V A;  4PJL A;  2QM3 A;  4A0X A;  3BY6 A;  3PSF A;  2IS6 A;  1DPU A;  2ZXI A;  3HPH A;  4DOZ A;  3L00 A;  4ZH4 F;  4NB5 A;  2OTJ I;  2FBI A;  2ZME B;  3KP6 A;  1IV6 A;  2IBD A;  1ZGA A;  1JTX A;  1O57 A;  1OKR A;  5F04 A;  1EV7 A;  2W25 A;  1LUJ B;  2Y48 A;  2K85 A;  3P5J A;  4GO1 A;  4DYC A;  4AIJ A;  3BR6 A;  4BUP A;  5D6F A;  4HPQ A;  5IT9 K;  2LD5 A;  1PYV A;  2EA4 A;  5EF6 A;  2HVQ A;  1HW2 A;  1H9T A;  2LNB A;  2QSG X;  2P5K A;  5DCF A;  5FLM J;  3PUF A;  5CPR B;  4NBQ A;  3TGN A;  1X1B A;  1QZE A;  3VYS B;  3TP3 A;  2VI6 A;  4G12 A;  2V1X A;  4CUG A;  4CCK A;  3ZGK A;  3H92 A;  2WTE A;  1JTY A;  1TWF J;  1W7P A;  4LK1 F;  5J1R A;  3HRM A;  3FXU A;  1Z05 A;  4QLC U;  3WTT C;  4KYW A;  4BDY A;  2GWR A;  3ZMT A;  3LSP A;  4F3Q A;  1YX5 A;  1HCR A;  2LTP A;  1SD6 A;  5F64 A;  4XBF A;  1W5S A;  1GHC A;  1R9T J;  2K9N A;  3I64 A;  3WE3 A;  4KN7 X;  2X48 A;  1A04 A;  3DEU A;  1W1W E;  3QAH A;  3QOP A;  4LD5 A;  5E79 C;  3JRD A;  3I54 A;  1BN5 A;  4JYK A;  5H6R A;  2XSD C;  5DTD A;  2IA2 A;  1R7J A;  1IN5 A;  3MVP A;  1DGR M;  4I2O A;  4PGG A;  2K9M A;  4E7L A;  3ZCO A;  3AFH A;  3I56 I;  2BZT A;  4M74 A;  4RM3 A;  3O6B B;  5FB2 A;  1OCR H;  4A6E A;  5H2F C;  2DU9 A;  1DP3 A;  5FRM A;  4WCG A;  4I0B A;  2L9S A;  2YU3 A;  2JVH A;  2LDU A;  3IP4 B;  3BT9 A;  2XGX A;  4J00 A;  4D1Q A;  1QO0 D;  3HOT A;  2OAZ A;  1LQ1 A;  1RZ4 A;  2ZBK A;  3DTI A;  2D45 A;  3BCA A;  2IEK A;  1QPI A;  1J0R A;  2JSP A;  3TMO A;  3HUG A;  2VQL A;  3ECO A;  4S04 A;  2DA2 A;  1FOK A;  2H94 A;  2HYF A;  5ICC A;  1STZ A;  3JRF A;  2QQ8 A;  2R0Q C;  1T39 A;  1TWH J;  1B4A A;  4XKC A;  3TO7 A;  3KCC A;  3FMQ A;  4OOI A;  3W6K B;  4NQW B;  2H6B A;  2LH9 A;  5J47 A;  1VQ6 I;  2XGE A;  5JR3 A;  3JTH A;  1H0M A;  1FBQ A;  4IRI A;  2LYC A;  1OYI A;  4LB6 B;  5CVR A;  3WHC A;  3BJO A;  4RAY A;  2HOE A;  1VQK I;  4M6X A;  1Y8R B;  2E1N A;  1MNM C;  3CLQ A;  4BKX A;  1W36 D;  2WB1 N;  4J01 A;  2R93 J;  4Y17 A;  1WJE A;  3Q0U A;  2HFH A;  4KIB A;  4E6K G;  2KIM A;  1HKT A;  1OPC A;  2R5Z B;  2JA6 J;  3RYP A;  4LG0 A;  2CYY A;  4HSR A;  1IW7 F;  2WWY A;  2VE9 A;  2Q2E B;  5CKT A;  4AD9 A;  2ZB9 A;  4KFC A;  1X4O A;  2WC2 A;  1IN6 A;  3LA3 A;  1K4T A;  1ZKG A;  4CSW A;  1BC7 C;  1OYW A;  3DLA A;  2OV7 A;  1PUF A;  3VOD A;  3GYH X;  1P6R A;  2IVM A;  2EFN A;  3HTS B;  4NUB A;  1MSF C;  4A3J J;  5D6E A;  1BR1 A;  1QHG A;  1VQL I;  2M4G A;  3GW2 A;  5HS9 A;  4N9H A;  3I4P A;  4IHV A;  1W5C C;  2OUM A;  3HYI A;  1WI3 A;  1Z67 A;  3FBI B;  4ZYD A;  3CD6 I;  2WAE A;  2JA2 A;  1IRG A;  1G59 A;  1ETV A;  1ZYR F;  2EFO A;  2RKH A;  4AVP A;  1M1E B;  4PSW A;  2MG4 A;  1SAN A;  5FRO A;  3HRU A;  4FE4 A;  3OYN A;  4CHU A;  1QRY A;  1KGS A;  1RNL A;  2O0Y A;  3LSK A;  5AON A;  2OBP A;  3KYD B;  3WE2 A;  4MTD A;  4HA8 A;  3S14 J;  1WJB A;  4PJ0 C;  1UHW A;  3IWF A;  1FP2 A;  2JWT A;  4AU7 A;  4XLA A;  1K61 A;  1JKR C;  1U9O A;  3A2K A;  1G3T A;  2NVX J;  3DKX A;  4RMN A;  1AWC A;  3M1C A;  3BQZ A;  1K7A A;  1ENH A;  1SFK A;  2HPI A;  2XC7 A;  3RZO J;  1NTC A;  3JR9 A;  5FD5 A;  5FO5 A;  4XM3 A;  5L3G A;  1F43 A;  3HOY J;  3CCV I;  1VF9 A;  3M8E A;  3NQO A;  2V1D A;  5C4J J;  1R5H A;  1Z3X A;  2HEO A;  2G7U A;  5K5Q A;  1XCV A;  3VYU B;  1B6A A;  3H5R A;  4AIH A;  4DBQ A;  3FHZ A;  1HBX G;  1T08 B;  2ZNZ A;  3TW7 A;  5L3E A;  5D8K B;  1J2X A;  2LG4 A;  2VUM J;  3ISP A;  2ELJ A;  4Y7N J;  2JVG A;  2EWN A;  1FX7 A;  2M45 A;  3DBR B;  2EV0 A;  3KP7 A;  3OR1 C;  3CP8 A;  1D1A A;  1X2M A;  2JA8 J;  1A5J A;  3U1D A;  3C18 A;  2DOE A;  4CGZ A;  2CV1 A;  3RQ4 A;  3HGG A;  4WK8 F;  3SJM A;  3VB2 A;  3WU1 B;  3ZMD A;  2P6T A;  1LVA A;  3C2G A;  1ONV A;  1BR2 A;  2Q1Z B;  2JT1 A;  2MBF A;  3CTA A;  2O6G E;  3DEW A;  2E1M B;  2QWW A;  2IA1 A;  2CW0 F;  3P9K A;  3GZ6 A;  1LFU P;  4FIS A;  4M6Y A;  2MLK A;  2MC3 A;  2XF7 A;  3U2R A;  4N9I A;  1NK2 P;  2Z33 A;  1FOX A;  1SFU A;  3KP4 A;  2CW8 A;  1ERD A;  3C3W A;  4II3 A;  1PDN C;  3KYL A;  4E70 A;  1RC9 A;  1MMG A;  4IRH A;  3W2V A;  2ZCW A;  1T2K A;  2X6O A;  3HSE A;  3HRS A;  3CDH A;  2OZ6 A;  2NNY A;  2HDC A;  3L2V A;  4KIC A;  2AXL A;  1MNE A;  2AQF A;  2VJ4 A;  2DAO A;  4YIF A;  1MND A;  3FXJ A;  3M4O J;  1SAX A;  4BQA A;  1MDM A;  3OL4 A;  4JOM A;  1LE8 B;  4FX0 A;  4AYB N;  3K1M A;  5LHH A;  2CUE A;  2DFH A;  2CJJ A;  1HXD A;  3MEX A;  2OF7 A;  3RSN A;  3MZ8 A;  3IH2 A;  3S17 J;  4M3G A;  4E7S A;  1E17 A;  4C2U A;  1HKQ A;  2HWV A;  2PMZ A;  3DPT A;  4C3J J;  2Z5U A;  4A69 C;  2CSO A;  2F2E A;  2UZK A;  4B8X A;  2HXO A;  2FOW A;  1SFX A;  4IKF A;  3QYF A;  2FNA A;  5FRN A;  2LR8 A;  3I9V 2;  2K86 A;  1ZGJ A;  4JX6 A;  3OYH A;  5FLV A;  2K02 A;  1L3L A;  1QA6 A;  3F8F A;  4NQW A;  1Y8Q B;  5EEA A;  1K79 A;  4HNT A;  1EH7 A;  6PAX A;  2Z9O A;  1JI8 A;  1MZB A;  5J3L A;  3ZQF A;  3ZQC A;  4ENN A;  1U8B A;  4IZZ A;  3HUG B;  2JRT A;  4DIQ A;  1TP4 A;  5E8G A;  4EJV A;  1RUO A;  2DXI A;  1FNN A;  1DDN A;  3PQJ A;  2W84 A;  4C3I J;  3AL0 C;  2E60 A;  3G73 A;  2ELK A;  2GBY A;  4KT6 A;  4LLN A;  2DO7 A;  1JE8 A;  3LSM A;  2MLG A;  2ETH A;  1EA3 A;  1XX5 A;  1R1T A;  4UV9 A;  1F36 A;  2IGK A;  2CU7 A;  5LEJ A;  2Z3Y A;  2KLO A;  2DOD A;  2M2E A;  4Q4Z F;  1YI2 I;  3CC7 I;  1LFP A;  4GCV A;  3GLX A;  1KU2 A;  4FCY A;  4DJA A;  2DDB A;  4E7J A;  2JMW A;  1IN4 A;  1ZK8 A;  3I53 A;  1HDP A;  1UG0 A;  1VQ7 I;  4CCO A;  2XIG A;  3BR2 A;  3A01 A;  4ESB A;  1OCC H;  2L7Z A;  2KIQ A;  3CF5 F;  1OR7 C;  3J81 K;  3WTY C;  2WV0 A;  1IAW A;  1G2H A;  1OMI A;  2TRT A;  2BHY A;  1WZ2 A;  2HYG D;  5DUI A;  4E7Z A;  2FOK A;  3S3N A;  1KON A;  1WSU A;  5KHD A;  1GV5 A;  1XGO A;  5LD2 C;  3GTL J;  2HZT A;  1OFC X;  1YS7 A;  2IS1 A;  4PGH A;  4MTE A;  4DQ2 A;  2VC1 A;  4Y33 A;  1JKO C;  1O7F A;  3V4G A;  2L9V A;  2WAD A;  1O3R A;  2KKO A;  1XC5 A;  1K83 J;  4P9F A;  3U9G A;  4U0Y A;  5JLX A;  1T56 A;  4YEL A;  3VSK A;  3QPH A;  1SAU A;  2XKO A;  4UB8 C;  4BAY A;  1S3J A;  3CUQ C;  4XIC A;  1UB9 A;  2MH2 A;  3L1P A;  1T33 A;  3F8B A;  2DMU A;  1IXR C;  2DQR A;  3LSJ A;  1BI3 A;  5E1X A;  1ZQ3 P;  2R7T A;  5KVR A;  3K10 A;  3H9J A;  2RN7 A;  4DYR A;  3BCB A;  3OV8 A;  1ZG5 A;  2LSO A;  2RNJ A;  1R6R A;  2XSJ C;  3BWG A;  2K27 A;  3KZZ A;  3CP2 A;  1JT6 A;  4HOB A;  3PNV A;  3S1M J;  3F8M A;  4BHC A;  4WXC A;  3MCZ A;  2VBZ A;  3SZP A;  2EQR A;  2GIV A;  1VQM I;  2DMN A;  1RET A;  1SMT A;  3V7R A;  4L9J A;  5BPD A;  2HQA A;  3OIP A;  1YFH A;  1Z9C A;  3EET A;  3KYC B;  1ZG3 A;  2LVS A;  4IVN A;  1X1D A;  5GPA A;  1AHD P;  2WA0 A;  4AID A;  5JHU A;  2XAG A;  5E17 F;  4XK4 A;  2EIM H;  4ABZ A;  2X9D A;  2F4I A;  2AHQ A;  4II2 A;  1IUF A;  3CCQ I;  2IRF G;  5ILV A;  1KQ0 A;  3CMA I;  3V7S A;  3DU6 A;  5AIQ A;  2IGO A;  4A3G J;  3PL8 A;  1R36 A;  4XLE A;  3J7Y J;  1U5T B;  3W6J B;  2NOJ B;  3FMS A;  2IS2 A;  3EYY A;  3LST A;  3PNT A;  3W2W A;  2NRA C;  4FHT A;  3HBL A;  4RS8 A;  4M3D A;  3MN2 A;  2MH9 A;  4HX7 A;  1UG2 A;  4NC6 A;  2QF7 A;  2WBM A;  3ZN1 A;  3DQV C;  1VTN C;  2ZKZ A;  2DA3 A;  2X6Y A;  3TOB A;  5EG0 A;  5C44 J;  4XLN F;  4HNU A;  2L9N A;  3VFZ A;  5JVT A;  3MAJ A;  3WTS C;  3D0S A;  2RQQ A;  5EEH A;  3TOA A;  3A01 B;  4RA2 A;  2LFB A;  5DCM B;  4PK4 A;  3JRG A;  1SD4 A;  3I3L A;  4D7N A;  1J7K A;  1P9Q C;  2QQ9 A;  1QQI A;  2DCE A;  1VFC A;  5M5Y J;  4OIN F;  1O4X A;  1MMS A;  4UUS A;  4X6A J;  1YRN B;  1E3H A;  1U2W A;  3CCL I;  4FET A;  1VQO I;  3HJE A;  4PFO A;  2ZJQ F;  3BOQ A;  2FE3 A;  1K6O A;  2DFI A;  1ETK A;  2VKV A;  4D5F A;  2LF8 A;  2GQQ A;  4A12 A;  1IC8 A;  3VDX A;  4L0Y B;  4ZJZ A;  4YG2 F;  4A5N A;  1HOM A;  1UFM A;  1WFX A;  2HNH A;  1EH6 A;  4OMZ A;  4G6Q A;  4GGG A;  3E6D A;  3JRH A;  1O7L A;  4YFX F;  4ESF A;  2QZ8 A;  3COA C;  1XDS A;  1V54 H;  2XPV A;  4LG0 B;  1ZGW A;  3QU6 A;  5EGO A;  1MBE A;  5CVV A;  1W4M A;  4YFK F;  4MLO A;  2HDD A;  2EV6 A;  4UV8 A;  1MJA A;  1P7I A;  2A6E F;  5LRS A;  2OTL I;  1PVE A;  3IRR A;  1LJ9 A;  4WXH A;  3R0J A;  1QVU A;  2E5N A;  1Z3Y A;  4B4C A;  2ECC A;  3S3M A;  5CVI A;  2R7S A;  2HVR A;  3GX4 X;  1JKQ C;  4PZJ A;  4CH7 A;  2F5D A;  4IXA A;  1RES A;  1XGN A;  2LF7 A;  2F5F A;  4RB3 C;  3KZY A;  3H3U A;  2X6W A;  4BH9 A;  3ML6 A;  3G1M A;  1MSE C;  2TCT A;  2XAF A;  4MEY F;  4U87 A;  2DK5 A;  2NVY J;  1WCM J;  3S8P A;  3QPT A;  3OSG A;  4XN3 A;  1Z1D A;  2COB A;  2QQB A;  1FBU A;  3H5N A;  4P9U A;  3HKZ A;  3OR2 C;  3BG5 A;  1X3U A;  4O5V A;  4EGZ A;  4Y13 A;  1KQ9 A;  1I50 J;  1HW5 A;  2A5W A;  4KMF A;  4BHP A;  3N05 A;  3PSI A;  4D9J A;  5TRD A;  4HRI A;  1TWG J;  3VWB A;  5ILU A;  3LSH A;  4AWX B;  4I7H A;  5HDK A;  1FSH A;  2QEN A;  2UXN A;  4X0G A;  4XOR A;  4A3M J;  1JHH A;  3WTU C;  2VQC A;  2BXZ A;  1DU0 A;  4IO9 F;  2VQH A;  4QPO A;  2LRE A;  1PP7 U;  5ILS A;  2ZME C;  3JSP A;  2Y0S A;  3TL4 X;  4CO8 A;  1LFB A;  1JJ6 C;  2FD5 A;  3ABK H;  2IJL A;  3JAM Z;  4UNO A;  3B02 A;  3Q0W A;  3KEO A;  4OU0 A;  1WJF A;  3DBL B;  4EM1 A;  4KDP A;  3FXL A;  5HLG A;  4M72 A;  1REP C;  3ZQL A;  2NVT J;  2XRO A;  4XKB A;  3E1S A;  3S1N J;  1A35 A;  1W7P B;  4IJA A;  3CC2 I;  3LSI A;  3ZR8 X;  2L4M A;  3H9Q A;  1BC8 C;  4LJZ F;  4L18 B;  5D5X B;  2R7V A;  1XG1 A;  2V26 A;  5LBQ A;  1MMN A;  2JPB A;  2Y9Y A;  3FM5 A;  1MJ9 A;  2MC4 A;  2CUJ A;  1FPQ A;  1IGN A;  3WG9 A;  2CO5 A;  1IRF A;  2EH3 A;  3AG4 H;  5EZH A;  5K5R A;  2CQQ A;  4G7O F;  5GAH J;  5DM6 F;  2Y0S N;  2CUF A;  2RC4 A;  2K9L A;  1HF0 A;  2V1N A;  3ZQI A;  3OY9 A;  3KPH A;  5CVU A;  3O8G A;  4YEJ A;  4KJZ A;  4HF0 A;  1R1U A;  1ZN2 A;  5GPC A;  1TQP A;  4XR6 A;  3S93 A;  1IUY A;  1IF1 A;  2PJR B;  5E3N A;  5JLW A;  3G1L A;  4HZF A;  2ADU A;  2BW3 A;  4BXF A;  1A6Q A;  2DK8 A;  4MGR A;  1OCP A;  2FXA A;  5LGU A;  4DGW B;  3W2A A;  1DUX C;  1UAA A;  1B8I A;  2VBX A;  3NEU A;  1FOY A;  1R5I D;  2FF4 A;  2MSY A;  2O3F A;  3GFJ A;  3Q3S A;  4A3C J;  3BP8 A;  2NS0 A;  4NNJ A;  1Z77 A;  1ZHF A;  1E3O C;  4A2U A;  4B44 A;  2A5Y B;  4DZJ A;  2F4O B;  3G1O A;  2JN6 A;  5A2Q K;  4N4O B;  3PJR A;  2STT A;  2ZXH A;  2QVO A;  4BEH A;  2XB0 X;  4FQG A;  2A68 F;  2GXG A;  4HQE A;  1MGT A;  1GDT A;  2ID3 A;  2X1E A;  3CUO A;  3DPL C;  1B72 B;  3DXJ F;  3LQQ A;  1OCZ H;  2VT2 A;  4Q48 A;  3L9F A;  1BJZ A;  5DD8 A;  4B47 A;  4RGX A;  2M8G X;  5DM7 F;  5F0F A;  4G7Z F;  2WV1 A;  4XNF A;  2L7F P;  3F6V A;  2MGQ A;  3KEQ A;  1KQ8 A;  2GOX B;  5LGN A;  3PIO F;  2XAS A;  1T95 A;  2XF5 A;  2L0K A;  5B1A H;  2LKX A;  2XAJ A;  4I09 A;  4RLQ A;  4WWC A;  4NC7 A;  4GYI A;  3KP2 A;  3FZV A;  4KIF A;  3T5X A;  2VKH A;  4D7M A;  1U5T A;  4BYY A;  3DV8 A;  3KIO A;  1ZEL A;  4Y4R A;  2I10 A;  1G3W A;  1TQI A;  2YUS A;  2PG4 A;  3F22 A;  4P1W A;  1XS9 A;  1S9H A;  2PLY A;  2RQP A;  2K9Q A;  3J80 Z;  1RPW A;  5IPA A;  3K1N A;  1X19 A;  3RIR A;  3K4L A;  5D5V B;  3JRI A;  1B8I B;  1D8J A;  1XMA A;  4B1R A;  4OIO F;  4H4K C;  3GTJ J;  1B1B A;  5J40 A;  2DJI A;  4Y52 J;  1Z6R A;  2MA3 A;  3A0B C;  1RKW A;  5DYM A;  4B09 A;  4Q5S F;  3LFU A;  3OIQ A;  2QBY A;  2R7F A;  4RM2 A;  3I58 A;  4M3F A;  3RQI A;  2IGM A;  2EZL A;  2DPU A;  1EJ9 A;  2IT0 A;  4KA4 A;  3M3Y J;  2Y69 H;  3HTU A;  3I4N J;  4CA0 A;  2FNP A;  1HA8 A;  2CQN A;  4GRI A;  2VJJ A;  2HOA A;  4L9V A;  2UV1 A;  4EGY A;  3MZH A;  1JUM A;  3T1B A;  2CW7 A;  3ZXS A;  4QIW N;  1FSE A;  2P7V B;  4HX4 A;  1TBX A;  4W1U A;  1Y56 A;  1WI9 A;  1JUS A;  1MBH A;  3LMM A;  5EG0 B;  2VLA A;  2WAQ A;  4A3K J;  2AS5 F;  2FU4 A;  3PNY A;  5M5W J;  1SD7 A;  2DT6 A;  2P81 A;  3GZN B;  5LHI A;  1TZL A;  1OQY A;  4RGU A;  3H3V K;  2H8W A;  5ERI A;  3ZN0 A;  1Y0U A;  2HU9 A;  3I59 B;  1QZZ A;  3K4N A;  2ZXJ A;  3J7A Y;  3MFK A;  2NAZ A;  4F91 B;  4GDF A;  2V7F A;  2O7O A;  3VEP A;  3G71 I;  1T98 A;  2XRN A;  1YW8 A;  2KZG A;  2VJ5 A;  4V2G A;  2EB7 A;  3HL2 A;  2R7Z J;  5EDN A;  4CDG A;  2R3S A;  3RDI A;  4F93 B;  2XAU A;  3OYC A;  2ACJ A;  1BW5 A;  4CXF A;  3DF8 A;  3J80 K;  2L7M P;  1XTA A;  2EIJ H;  3F0C A;  1FYM A;  1FIA A;  5KAF C;  2FJ1 A;  1W5T A;  3CCU I;  4PJN A;  4OMY A;  4UUT A;  1W36 C;  1SVM A;  3V8J A;  2R7X A;  1GUU A;  1U0J A;  3WTW C;  3J7A O;  2M0C A;  4M73 A;  5IT3 A;  2CS3 A;  3OYL A;  5CQG A;  3GTK J;  2F5C A;  2KDZ A;  3M07 A;  3EUK L;  2DFE A;  1TWC J;  4F92 B;  1MIJ A;  5E3L A;  3OYM A;  2BEO A;  5ICF A;  2VIX A;  4U0W A;  2VXD A;  2EFP A;  4YIR X;  3L2U A;  2A07 F;  2K7L A;  3LAJ A;  4B43 A;  4YFN F;  2XF6 A;  3OWT A;  1IXS B;  2QKL B;  4MIM A;  2PMU A;  2V1U A;  1HC8 A;  4Y15 A;  4C9Y A;  2BE5 F;  2O8X A;  2VXZ A;  3EYI A;  4HV5 A;  1IN7 A;  3DU5 A;  3P9I A;  3EPZ A;  4U0V A;  5HLH A;  3HDD A;  1BJA A;  2GOM A;  4MFE A;  1USS A;  3QWL A;  3V8L A;  2DJN A;  4E4H A;  1J5Y A;  2VN2 A;  3EQL F;  2XB5 A;  1XB4 A;  4IHT A;  3BR5 A;  4IEJ A;  2V9V A;  1RUN A;  3QP5 A;  2XHK A;  2KT0 A;  3WU0 A;  3TW6 A;  3ZMV A;  1YJN I;  3LL7 A;  2W85 A;  3DBH B;  1LE8 A;  2Y9Z A;  3AG1 H;  5K7F A;  3IUO A;  1DQU A;  3GWZ A;  3L7W A;  4CCM A;  2BY1 A;  9ANT A;  4A3B J;  4UVB A;  3LSG A;  2OJE D;  1N75 A;  1UMQ A;  2M3A A;  2EIK H;  1P7J A;  1FMV A;  2K4J A;  2CQK A;  3WGH A;  5GTH C;  5CYV A;  5D5U B;  4BXX J;  2CFO A;  2VBY A;  2COM A;  2M7A A;  2E2J J;  2MD5 A;  3GTQ J;  2AXT C;  5H20 A;  3M9A A;  4A6D A;  5B1B H;  3R0A A;  3RZD J;  5DUK A;  2O5R A;  1YRN A;  2HR3 A;  3LA2 A;  3DCF A;  3CJT B;  3ZQ7 A;  2KPM A;  4IQ4 A;  2HQR A;  3K4J A;  2E19 A;  3GFI A;  1UST A;  2OCC H;  3E6M A;  5GAG J;  3JRA A;  2E71 A;  3K1P A;  1ETO A;  2R92 J;  2X85 A;  5K5O A;  1OCT C;  1CGP A;  3LQR A;  4BE2 A;  1TW2 A;  2F5E A;  1ULY A;  3SEQ A;  4JBA A;  4CZZ A;  1DU6 A;  3G4S I;  2BVM A;  2B0L A;  3NWS A;  1MJB A;  2QQA A;  1JUP A;  3PFI A;  4JX4 A;  2QGU A;  2VQG A;  3S15 J;  3BJA A;  1E2X A;  3AKZ A;  3CCJ I;  1NK3 P;  2FMY A;  4C2T A;  2RRE A;  3MZY A;  3F8N A;  2XGC A;  4PFP A;  2D1H A;  1VQ9 I;  2M30 A;  3K70 C;  1HQC A;  1Y1V J;  3F8C A;  2EJR A;  4KMU X;  3H3Z A;  4EQQ A;  3RKX A;  3F6O A;  3T8R A;  3DKY A;  1BI1 A;  4ZDP A;  3IAM 2;  3S2D J;  3EDP A;  1QZY A;  4IOC F;  5EJC A;  4LK0 F;  4M3B A;  1R4M B;  1VQ4 I;  3E3V A;  3CCS I;  5EYR A;  4KUM A;  2BXY A;  4RLF A;  1IZ1 A;  2EA2 A;  2D2W A;  2V6E A;  4QWQ A;  2CG4 A;  4U7B A;  5KNL A;  2QLZ A;  1N78 A;  4JP0 A;  5F6F A;  2LC2 A;  4CYC A;  4GYG A;  3UR3 C;  5J4Y A;  1O3S A;  1R23 A;  3HSF A;  1I5Z A;  1X1C A;  2M7B A;  3RJP A;  5FKM A;  2H8R A;  3VYR B;  2DMP A;  2L5Q A;  3IL2 A;  5LEK A;  4RDU A;  2DBB A;  2JQ7 A;  3PO3 J;  2OQR A;  1FC3 A;  4UVC A;  1SFO J;  1P2F A;  1ZAR A;  3ZRG A;  3RPU D;  3WG7 H;  1RKT A;  3CES A;  3RPU A;  2A05 A;  4WXD A;  3DFG A;  3HOS A;  1TL8 A;  3DWL E;  1BBY A;  2XAQ A;  1KU3 A;  3C2H A;  3ULQ B;  3BJ6 A;  1Z7L A;  3WTX C;  3CO6 C;  3TDZ C;  5LHG A;  2VL8 A;  1Q1H A;  2KIS A;  2Q2E A;  1S7E A;  4RB2 C;  3CC4 I;  2HQ5 A;  1S8N A;  3SXY A;  1HW1 A;  3HGY A;  3WOD F;  3FIW A;  2XGD A;  2GAU A;  2E34 A;  3GFL A;  1I3A A;  3SYT A;  3CUQ B;  3JW4 A;  4EEF G;  1GXQ A;  1S7A A;  5FKK A;  3NAU A;  4IRG A;  1R71 A;  1A36 A;  2F48 A;  3IH3 A;  4B3A A;  1SVO A;  3HG9 A;  1X4P A;  2A6T A;  3LFK A;  1BIB A;  4ENJ A;  1TNT A;  3MMY B;  5EZG A;  2BBY A;  2KJB A;  3DP7 A;  4FX4 A;  2BOL A;  2YX4 A;  5TGT A;  3L2W A;  3FK7 A;  2ZJP F;  4HLX A;  1NHA A;  3BG9 A;  2OD5 A;  1PUF B;  5CLS A;  3BC8 A;  4ZYH A;  1JJ8 C;  2R7W A;  3S1Q J;  4P55 A;  1XCB A;  4MNU A;  2Y0M A;  2M0M A;  2QSF X;  4BU2 A;  5LGT A;  1CQT A;  2LMD A;  2LBF B;  1FP1 D;  4OWR B;  2P5V A;  1QU3 A;  4ZDO A;  3FKI J;  3OYA A;  5D8L B;  3ZOB A;  5GAE J;  1W7P D;  1E3P A;  3D1N I;  4A3I J;  1UZC A;  2EIN H;  1QHH D;  3GVA A;  1JGG A;  1XGS A;  2NS8 A;  3K4M A;  3I55 I;  3KEY A;  3DTE A;  4F52 A;  2HI3 A;  3GEZ A;  1APL C;  2NVU B;  3WTZ A;  3K2Z A;  5IP6 A;  1V3F A;  2M1B A;  3SZT A;  1ZTR A;  3HB9 A;  3GO5 A;  2F6C A;  4M3E A;  3ASO H;  3R60 A;  3KE2 A;  5BS6 A;  1L0O C;  5K7H A;  4FE7 A;  2Y75 A;  2BHZ A;  3CDI A;  3E6B A;  3HSR A;  3IKV A;  5E20 A;  3SEZ A;  1ODD A;  3C2B A;  4WF2 A;  4EV0 A;  1XDU A;  1QVT A;  1UCR A;  1QNT A;  2WB1 A;  4ZYG A;  2I5U A;  4LIU A;  3S2H J;  1DGW Y;  4IHS A;  2ME0 A;  4OIP F;  5EEG A;  2DFF A;  2ISY A;  2R4G A;  2KMU A;  3GF2 A;  4CIC A;  2L9R A;  4M9Z A;  2YPR A;  3U1K A;  3ZQQ A;  5FJ8 J;  4ZDL A;  2IAI A;  3FIS A;  4EJT A;  1QBJ A;  4XRS G;  3PIP F;  4DYQ A;  2YR2 A;  4BEH B;  3KET A;  4UB6 C;  2DT7 B;  4ZZD A;  1LEB A;  4L5J A;  3E5X A;  1WHU A;  2VON A;  5M3M J;  2EV5 A;  4Z2Y A;  1JHF A;  1KA8 A;  3L2Q A;  2R7U A;  3LSR A;  2ZFW A;  3WHB A;  5DEQ A;  2Z2S B;  4QSH A;  4F55 A;  4XON A;  5E3M A;  1EF4 A;  1J09 A;  2BY2 A;  2WY7 Q;  3BR3 A;  5FKN A;  2X1C A;  1K4S A;  4IHY A;  1B9M A;  1IDY A;  1AOY A;  1QGP A;  5F0C A;  3R61 A;  3SDB A;  4FAS D;  4CCN A;  2ZXW H;  2O9L A;  5IYD J;  4MO7 A;  4EAT A;  5HNH A;  2PI0 A;  2R5Y B;  2PJR A;  3TP0 A;  3FXQ A;  1VQ8 I;  3P9C A;  3FMR A;  1LKX A;  2W48 A;  1MH4 A;  2FQ4 A;  3HHH A;  4PJM A;  2GZW A;  2MFZ A;  4XKV A;  5HS7 A;  3HOX J;  1IN8 A;  4E7K A;  1I6H J;  3PO2 J;  2X51 A;  1IV8 A;  2XPU A;  4XSZ F;  2YSR A;  3E97 A;  4BE0 A;  4D0P A;  1R22 A;  3TKY A;  2DOA A;  2VPL A;  4KT5 C;  4KNY A;  2RDP A;  2E1M C;  3HOU J;  4DW6 A;  3O3K A;  4XLH A;  1D8K A;  3J81 Z;  1X1P A;  1T38 A;  2CWE A;  4EMS A;  5HDN A;  1F9N A;  3K69 A;  5B5E C;  4GXO A;  1D0Z A;  3BPV A;  3EUA A;  1FTZ A;  3TDU C;  3ZPL A;  4G94 A;  2G9W A;  2VBW A;  1VI0 A;  4FT8 A;  2FRH A;  2EK5 A;  1ZH5 A;  5F08 A;  4BNC A;  1S72 I;  1BW6 A;  2OPT A;  3HRT A;  4AUX A;  2CFX A;  4E7I A;  1R1V A;  3SHF A;  3AAF A;  2ZJR F;  2JZY A;  2QKM B;  3KP3 A;  1KZH A;  2EBI A;  4ITV A;  2VE8 A;  2IW5 A;  2XAH A;  3OS1 A;  1ORK A;  2YX7 A;  2N8G A;  4X1E A;  1H8A C;  4C2M J;  1GVJ A;  1LNW A;  2QYO A;  4ON0 A;  2R7R A;  3B6C A;  5J8C A;  4UVA A;  2NNN A;  3Q9V A;  1HLV A;  1D3Y A;  2L01 A;  4BBS J;  1YIJ I;  4L9N A;  1K78 A;  2X0L A;  1MBK A;  1J9I A;  2OQG A;  4TV7 A;  3K4K A;  3FBN B;  3R6S A;  3LAP A;  2RGV A;  4HDV A;  2STW A;  3BRO A;  2QEX I;  3GTO J;  5F0H A;  2LKS A;  1U5T C;  4A5M A;  2NVQ J;  3LWF A;  3KLN A;  3MKY B;  4HLY A;  5BMZ A;  4P5O A;  5L3C A;  1PUE E;  2M8E A;  2HYJ A;  1WWX A;  3M1E A;  4DBR A;  2NOG A;  2KHM A;  3EUH A;  3SZG A;  5HOO A;  1SMY F;  2PQ8 A;  4PJJ A;  2O61 A;  4OAZ A;  5BOX A;  1FIP A;  4J19 A;  1MH3 A;  1X3Z B;  2HZD A;  3OS0 A;  2TDX A;  4BS9 A;  4A3F J;  2OC6 A;  5FD6 A;  2QCO A;  4V19 K;  3HIF A;  1BOA A;  4OIQ F;  2DDA A;  2KP6 A;  5CJ9 A;  2K5C A;  4WX9 A;  4BQQ A;  2DTZ A;  4A3L J;  2P5L C;  3OYI A;  2Z16 A;  3OYE A;  2XPW A;  2H1K A;  1WH5 A;  2BY3 A;  1OLT A;  2FX0 A;  3K4C A;  3I71 A;  2ESH A;  2DA6 A;  4YII A;  3LNQ A;  2K40 A;  3PQK A;  3VPR A;  4BDZ A;  3X2Q H;  3FX3 A;  2DLL A;  2H1L A;  1POG A;  2EZK A;  5EGO B;  4L5I A;  1ZG1 A;  4OAY A;  3NAR A;  3BPX A;  2G0E A;  5DCM A;  3ABM H;  5KAI C;  3ABT A;  1FBS A;  2EFQ A;  1JKP C;  2ELH A;  4HW0 A;  5IYC J;  1OJL A;  4JK1 X;  5CVJ A;  1YS6 A;  4NDL A;  4EM2 A;  3HC7 A;  3WU2 C;  4G9Y A;  1P92 A;  3TBI A;  3MKW B;  2BYV E;  1YG2 A;  5LLQ A;  2KRC A;  1GXP A;  1ACI A;  5IY5 H;  3Q5F A;  1YJW I;  3BG3 A;  4Z6Y A;  2M87 A;  1K78 B;  2JUG A;  2GXA A;  1WH7 A;  3H36 A;  4UY8 I;  2CUZ A;  2MAB A;  3N97 A;  1IJW C;  1LB2 A;  3D5L A;  4BJ6 C;  4ENM A;  4ESJ A;  1H9G A;  1XMK A;  4LIT A;  5HLT A;  1RRJ A;  2CV2 A;  4LFU A;  1QPM A;  1R5G A;  2W57 A;  2DMT A;  3K6G A;  2E5Z A;  2BW3 B;  4H0E A;  3C1D A;  3QYE A;  3BR1 A;  1P4A A;  1G3Y A;  1XSX A;  4LMY A;  4RB0 A;  1XGM A;  3BTL A;  2EZH A;  1Z21 A;  5BQT A;  4BE1 A;  3RPQ A;  4RGS A;  3TO6 A;  2KIU A;  4PDK A;  1D5Y A;  4M71 A;  3KP5 A;  1LDK B;  4OIR F;  3AG3 H;  2E1C A;  4LG3 A;  4XMY A;  4HAM A;  5J1U A;  1WJC A;  3W3C A;  5HS8 A;  3ZP5 A;  3ZQG A;  3HKZ N;  2JUC A;  4KIS A;  2F4M B;  1AKH A;  4HQM A;  3BZC A;  4YRV A;  1VZ0 A;  4N0B A;  3BTJ A;  4R79 A;  1XSV A;  3BQY A;  1XMX A;  4BY1 J;  4QTR A;  3TQN A;  5ICG A;  3CLO A;  3CJN A;  3MWM A;  5E1W A;  3FXR A;  4AVZ A;  3OYJ A;  1YJ9 I;  2PEX A;  4M9S A;  2LY9 A;  3BG6 A;  1A31 A;  1VQ5 I;  5HDG A;  2OCE A;  3IC7 A;  3VYT B;  3QU3 A;  3G6E I;  4D5C A;  2ZME A;  3CCM I;  3O8H A;  3TED A;  3QRF F;  1F5T A;  1Y0N A;  2L02 A;  5JI6 A;  1TLH B;  3N4M A;  4XQF A;  2VOO A;  4Q47 A;  1G8X A;  4A3E J;  2MYS A;  2LLK A;  5DS9 A;  3K70 D;  3S1R J;  2Y2Z A;  4IHW A;  1DPR A;  2DQL A;  3IHU A;  1X2N A;  3RYR A;  2I8D A;  2ZNY A;  4BBR J;  1H88 C;  4P96 A;  3BLY A;  1A6I A;  4BJT A;  2XVC A;  4ZZL A;  4EJO A;  1N77 A;  2GA1 A;  4A0Z A;  1HDD C;  1AKH B;  3H0G J;  3CCR I;  3JTG A;  1D1C A;  2E7W A;  3H35 A;  2KZV A;  2KJC A;  4I02 A;  1I1G A;  3OYB A;  2R7D A;  3H1C A;  4KIG A;  3CMM A;  3RKY A;  1FMW A;  2LY2 A;  2H27 A;  4LLL A;  1U9N A;  4PCQ A;  5IT9 Z;  1U3E M;  4CZC A;  2B7E A;  3K0L A;  1K6Y A;  3CME I;  3CCY A;  3FKJ A;  3SFI A;  3FXM A;  4U88 A;  1YYV A;  2KRH A;  2QUF A;  4QPQ A;  3RKW A;  3MKL A;  2CGP A;  4M9X A;  3WGI A;  2Y31 A;  3JRB A;  3MKZ A;  3E0J B;  3GTM J;  4EVI A;  3GUD A;  2KIF A;  4XKW A;  2CQ7 A;  1BA5 A;  5HNF A;  1AU7 A;  2LBF A;  3QPS A;  3V8K A;  2UWM A;  2ISZ A;  4IL6 C;  1S5L C;  3ZMU A;  1FTT A;  2QA4 I;  1TT0 A;  4ZYA A;  1TC3 C;  2DT5 A;  4K2E A;  2D1V A;  4JQF A;  4IHX A;  2W24 A;  3LOC A;  3F23 A;  4R1H A;  4UUS B;  3ABL H;  4A93 J;  1V5E A;  1J75 A;  5GAD J;  2V79 A;  1ZAO A;  2NS7 A;  4I0A A;  5TJJ A;  2ME6 A;  3MD2 A;  1TT5 B;  1MBJ A;  4BXU A;  2ESN A;  1CF7 B;  2IGN A;  2YU9 J;  4XSX F;  2IXS A;  4BY7 J;  2P8T A;  3OSF A;  3ASN H;  1V4R A;  1I27 A;  3G3Z A;  3GCM A;  5FLX K;  1S7O A;  1G6N A;  4XOP A;  1FYL A;  4HYE A;  3QPL A;  5E3O A;  2FML A;  4IF4 A;  1OCO H;  3GBG A;  3HPG A;  3B6A A;  3SDG A;  4G7H F;  1U8R A;  2AO9 A;  1YIT I;  1KYW A;  3EUH C;  1BIA A;  5K7Z A;  3FWE A;  3ABU A;  2M5W A;  1JGS A;  1T6S A;  5LFA A;  1NG7 A;  4BGD A;  2FEZ A;  3OIO A;  2JTV A;  4IOA F;  2W4S A;  4XLP F;  4RAZ A;  3PM1 A;  2K4B A;  2PN6 A;  1VQP I;  3HOW J;  3CF2 A;  2JPC A;  2L4A A;  3CUQ A;  3OL3 A;  1Y39 A;  2HGC A;  4RAF A;  5KK1 A;  2VC0 A;  5F1J A;  3L2C A;  2HS5 A;  2PFB A;  4CYD A;  1SC7 A;  5C3E J;  1MBF A;  5D5W B;  2P4W A;  3JAM K;  2JA7 J;  2JJ7 A;  2PX9 A;  4BQN A;  2W00 A;  2EFW A;  5DDG A;  2X1D A;  2R7Q A;  1TWA J;  4HX8 A;  2KQR A;  3M7G A;  5ED4 A;  2VAS A;  3GTP J;  3U21 A;  3IKT A;  5FFX A;  2W1O A;  3HM5 A;  4AIK A;  1YOV B;  4I76 A;  2MW8 A;  3ELK A;  4EJW A;  1UHM A;  5J1Y A;  3QP6 A;  1FT9 A;  2FBK A;  1HKS A;  2LK2 A;  1SEU A;  3T0Y A;  2BVL A;  4E7H A;  3CCE I;  1X58 A;  3FK6 A;  2LKP A;  2ZO4 A;  2M4K A;  4DNC A;  1HST A;  4O6J A;  2BGC A;  3V7C A;  3JCU C;  1F1Z A;  1RR7 A;  2R7O A;  3J7Z I;  1LDJ A;  4HDU A;  4IPA A;  4CYC B;  3WTV C;  2WAF A;  3NRV A;  4LB5 A;  1W0U A;  2XDV A;  1MKM A;  1ZRF A;  1I39 A;  3JSO A;  2VKE A;  5CQE A;  3K2A A;  2ZSH B;  2DI3 A;  1ZR4 A;  2Q8K A;  2GXB A;  3HOV J;  3SQN A;  2HTS A;  2AQE A;  1ETQ A;  2CH0 A;  3CZ6 A;  3D5R C;  2GIZ A;  3FDY A;  4I01 A;  1Z6T A;  3HZJ A;  5IOZ A;  3QOD A;  3OS2 A;  2PBI A;  3REO A;  4HF1 A;  1PP8 F;  1YLF A;  4BJ5 C;  4CCL A;  2DYS H;  1ZLJ A;  4IQJ A;  1T0F A;  4JX5 A;  3S32 A;  3ROU A;  1YW9 A;  3CJR B;  5D4S A;  4IX7 A;  3LA7 A;  1YHQ I;  5JFR A;  3S3O A;  2RVC A;  4MHG A;  3E5U A;  1LDD A;  4RBO A;  3GME A;  3BR0 A;  4RAG A;  2A61 A;  1D5V A;  3DEE A;  1WVR A;  4AM3 A;  2ZC2 A;  2W82 A;  1FZP B;  4XN0 A;  1MMA A;  4W97 A;  2Z1D A;  3CO7 C;  1U78 A;  1WRJ A;  2LP0 A;  1B9N A;  1WKM A;  3K9T A;  4N4N B;  1BM9 A;  1KYZ A;  2DOF A;  1MW7 A;  4BAC A;  1IDZ A;  4RB1 A;  4XID A;  2NYX A;  2P7C B;  1FWZ A;  5J6X A;  2PMH A;  2A3S A;  2R5Y A;  5FGM A;  3GFM A;  2QBY B;  1TW3 A;  2IS4 A;  3V42 A;  3FF5 A;  3BTC A;  4KIT B;  2VOP A;  4NHJ A;  3HHG A;  2BV6 A;  2CMP A;  3H5A A;  1D0Y A;  2HOT A;  1LVK A;  3R4K A;  4AC0 A;  4C3H J;  3ZMS A;  2PJP A;  4LGW A;  3IV5 A;  1EH8 A;  2ID6 A;  5B66 C;  1ZRD A;  1Y6I A;  4EM0 B;  1CF7 A;  5L3D A;  2NXN B;  4AYB A;  5FFZ A;  2KDO A;  2OA4 A;  2X6X A;  1IG7 A;  4B48 A;  2H6C A;  2M34 A;  5IP9 J;  5JVG F;  3A4C A;  4ETS A;  2WY8 Q;  4ZTJ A;  2WAQ N;  1FYK A;  3DPU A;  2HXI A;  2DMQ A;  4HEA 2;  3KZI C;  2KL4 A;  2E36 A;  1GLN A;  5DV5 A;  1WJA A;  2DA1 A;  5L3B A;  2IPQ X;  5DD4 A;  2VJI A;  1SFE A;  1V5G A;  3NWT A;  5E1Z B;  2PMZ N;  2ZSI B;  3B73 A;  4HNV A;  2CQX A;  2V6C A;  3DKW A;  3ESW B;  2HQN A;  5K1Y A;  1I1S A;  1ZRE A;  2FSW A;  2J5O A;  1V55 H;  2UUZ A;  1FLI A;  3GXO A;  2C6Y A;  2OU2 A;  3HEF A;  3M8F A;  2ZJ2 A;  4DZP A;  2X4H A;  3DLL F;  3A02 A;  3L09 A;  4NC8 A;  2L3D A;  3IH4 A;  3BTI A;  1ETW A;  1R58 A;  2JRM A;  5F1R A;  1O3Q A;  1D1B A;  3IRQ A;  1Y1W J;  2DA4 A;  1XD7 A;  3OOU A;  3G2B A;  3KX2 A;  5IYB J;  2A6H F;  3E7L A;  3JRC A;  1R49 A;  1TTY A;  1EKE A;  4ASN A;  2XRL A;  1S29 A;  3F21 A;  5J4V A;  3HOZ J;  2Q0O A;  3Q9S A;  4XOT A;  4UUV A;  2M9H A;  2LOO A;  2L7K A;  3K7A J;  3FXK A;  3HXL A;  3JRE A;  1MDM B;  1ETX A;  1GV2 A;  2FQ3 A;  2B9S A;  3ONQ A;  4XRF A;  3TO9 A;  4I99 C;  3GTG J;  2VOD A;  3FXO A;  3OYG A;  5GTI C;  3OOP A;  2L2O A;  3ECH A;  1YTY A;  1KU9 A;  1UJ8 A;  4I6Z A;  2V4J C;  2HOS A;  5AIP A;  3OMY A;  5ICE A;  2P6S A;  1G4D A;  2E2I J;  1NG6 A;  1Z0X A;  1H89 C;  3UKG A;  1MMD A;  1YIO A;  1YW7 A;  2EZI A;  3W6V A;  1ON1 A;  2EIL H;  1MBG A;  5BPI A;  3K4B A;  4CCJ A;  3BG7 A;  5F27 A;  2BY0 A;  2JSC A;  5C4X J;  4U7D A;  4UHT A;  2DN0 A;  2V9P A;  3IWZ A;  4KN4 X;  1FJL A;  2F5V A;  2ZFU A;  1VQN I;  3SFZ A;  3GLL A;  4L0Z B;  3QOE A;  1PJR A; 
#chains in the Genus database with same CATH homology
 4L9T A;  1SD5 A;  1TQM A;  2G7H A;  2HKX A;  3VOE A;  1U6G A;  3I0T A;  3I59 A;  5HLI A;  3S2W A;  1ZRC A;  4S05 A;  1YO5 C;  1C0W A;  2IP2 A;  1BI0 A;  4F7Z A;  4HF2 A;  4MEX F;  1OYY A;  1WQ2 A;  1I6X A;  5E18 F;  2VT3 A;  2IA0 A;  4MQ9 F;  1F4K A;  1LEA A;  1ZLK A;  2E7X A;  1S6L A;  3E5Q A;  3I5U A;  2RV8 A;  4RGR A;  4HV6 A;  2J5P A;  4G6D A;  5FLX Z;  1O3T A;  3BZ6 A;  1HSJ A;  3O2P E;  1Z91 A;  3BDD A;  4EJU A;  3F3X A;  4LLG F;  2UXX A;  1MD0 A;  3C7J A;  5J8F A;  1B59 A;  3RTR A;  3P7N A;  3GZ5 A;  1RIO H;  3KLO A;  1YQA A;  4G8X A;  5E8I A;  4ZYE A;  1RI7 A;  4BHB A;  4R8H A;  5A2Q Z;  3RI4 A;  2L54 A;  1XSD A;  1Z7U A;  2DTR A;  3ZMZ A;  1BI2 A;  2A69 F;  3T8T A;  3MQ0 A;  3WGG A;  1G3S A;  2DW4 A;  2XV4 S;  2OZU A;  3F72 A;  1J59 A;  2FBH A;  2HKO A;  5H6Q A;  1ON2 A;  1OR7 A;  2DPD A;  2Z99 A;  5HVQ C;  1P4W A;  1JXS A;  2O03 A;  4A0Y A;  2GA2 A;  4I98 B;  1KU7 A;  1TNS A;  5LRR A;  2FA5 A;  2XUB A;  2KRF A;  3FM3 A;  1P4X A;  3E6C C;  1XN7 A;  3ERE D;  1R00 A;  3KFW X;  4ENK A;  1DP7 P;  1IXC A;  4O3M A;  2H09 A;  4HBL A;  5D4R A;  1FY7 A;  4UXN A;  2XKP A;  4MQV A;  2HTJ A;  2QM3 A;  4A0X A;  3BY6 A;  1DPU A;  3L00 A;  4ZH4 F;  4NB5 A;  2FBI A;  2ZME B;  3KP6 A;  1ZGA A;  1O57 A;  1OKR A;  1EV7 A;  2W25 A;  2Y48 A;  4GO1 A;  4AIJ A;  5D6F A;  5IT9 K;  2EA4 A;  1HW2 A;  1H9T A;  2LNB A;  2P5K A;  5DCF A;  3TGN A;  2V1X A;  3H92 A;  2WTE A;  1W7P A;  4LK1 F;  3HRM A;  3FXU A;  1Z05 A;  4QLC U;  3WTT C;  4KYW A;  2GWR A;  3ZMT A;  1SD6 A;  5F64 A;  4XBF A;  1W5S A;  1GHC A;  3I64 A;  3WE3 A;  4KN7 X;  3QOP A;  1A04 A;  3DEU A;  3QAH A;  4LD5 A;  3I54 A;  1BN5 A;  5H6R A;  2IA2 A;  1R7J A;  1IN5 A;  4I2O A;  4PGG A;  4M74 A;  3O6B B;  5FB2 A;  4A6E A;  2DU9 A;  4WCG A;  4I0B A;  2YU3 A;  2LDU A;  2XGX A;  1QO0 D;  3HOT A;  2OAZ A;  1LQ1 A;  1RZ4 A;  2ZBK A;  2D45 A;  1J0R A;  3HUG A;  3ECO A;  4S04 A;  1FOK A;  2H94 A;  2HYF A;  5ICC A;  1STZ A;  1T39 A;  1B4A A;  3TO7 A;  3KCC A;  3FMQ A;  4OOI A;  3W6K B;  2H6B A;  5JR3 A;  3JTH A;  4IRI A;  1FBQ A;  1H0M A;  1OYI A;  4LB6 B;  5CVR A;  3BJO A;  4RAY A;  2HOE A;  4M6X A;  2E1N A;  4Y17 A;  2HFH A;  4KIB A;  2KIM A;  1HKT A;  1OPC A;  3RYP A;  4LG0 A;  2CYY A;  1IW7 F;  2WWY A;  2VE9 A;  4AD9 A;  4KFC A;  2WC2 A;  1IN6 A;  3LA3 A;  1BC7 C;  1OYW A;  3VOD A;  3GYH X;  1P6R A;  2IVM A;  2EFN A;  3HTS B;  5D6E A;  3GW2 A;  5HS9 A;  4N9H A;  3I4P A;  3HYI A;  4ZYD A;  1IRG A;  1ZYR F;  2EFO A;  2RKH A;  4AVP A;  3HRU A;  4CHU A;  1KGS A;  1RNL A;  2O0Y A;  5AON A;  2OBP A;  3WE2 A;  4MTD A;  4HA8 A;  1UHW A;  3IWF A;  1FP2 A;  1G3T A;  1AWC A;  1K7A A;  5FD5 A;  5FO5 A;  5L3G A;  3M8E A;  3NQO A;  2V1D A;  1R5H A;  2HEO A;  5K5Q A;  2G7U A;  1XCV A;  1HBX G;  1B6A A;  4AIH A;  3FHZ A;  2ZNZ A;  5L3E A;  5D8K B;  1J2X A;  3ISP A;  2EWN A;  1FX7 A;  2M45 A;  2EV0 A;  3KP7 A;  3U1D A;  3C18 A;  4CGZ A;  4WK8 F;  3VB2 A;  3WU1 B;  3ZMD A;  2P6T A;  1LVA A;  1ONV A;  2JT1 A;  2MBF A;  3CTA A;  2O6G E;  2QWW A;  2IA1 A;  2CW0 F;  3P9K A;  3GZ6 A;  4M6Y A;  2MLK A;  2MC3 A;  3U2R A;  4N9I A;  2Z33 A;  1SFU A;  3KP4 A;  3C3W A;  1PDN C;  4E70 A;  4IRH A;  2ZCW A;  1T2K A;  3HSE A;  3HRS A;  3CDH A;  2OZ6 A;  2NNY A;  2HDC A;  4KIC A;  2AXL A;  2DAO A;  4YIF A;  1SAX A;  4BQA A;  1MDM A;  4FX0 A;  3K1M A;  5LHH A;  1HXD A;  3MEX A;  1E17 A;  1HKQ A;  2HWV A;  3DPT A;  2Z5U A;  2CSO A;  2F2E A;  2UZK A;  4B8X A;  1SFX A;  2FNA A;  2K86 A;  1ZGJ A;  2K02 A;  1L3L A;  3F8F A;  4NQW A;  1K79 A;  1EH7 A;  6PAX A;  2Z9O A;  1MZB A;  4ENN A;  2JRT A;  5E8G A;  4EJV A;  1RUO A;  1FNN A;  1DDN A;  3PQJ A;  2W84 A;  3G73 A;  4LLN A;  2DO7 A;  1JE8 A;  2MLG A;  2ETH A;  1R1T A;  4UV9 A;  5LEJ A;  2Z3Y A;  4Q4Z F;  4GCV A;  3GLX A;  1KU2 A;  1IN4 A;  3I53 A;  2XIG A;  4ESB A;  3J81 K;  3WTY C;  2WV0 A;  1IAW A;  1OMI A;  2HYG D;  5DUI A;  1WSU A;  2FOK A;  1XGO A;  2HZT A;  1YS7 A;  4PGH A;  4MTE A;  4DQ2 A;  2VC1 A;  1O7F A;  3V4G A;  1O3R A;  2KKO A;  4P9F A;  3U9G A;  4U0Y A;  3QPH A;  2XKO A;  4BAY A;  1S3J A;  3CUQ C;  1UB9 A;  2MH2 A;  3F8B A;  2DQR A;  1IXR C;  1BI3 A;  5E1X A;  5KVR A;  2RN7 A;  3OV8 A;  1ZG5 A;  2LSO A;  2RNJ A;  3BWG A;  2K27 A;  3KZZ A;  4HOB A;  3F8M A;  4BHC A;  4WXC A;  3MCZ A;  2VBZ A;  3SZP A;  2GIV A;  1SMT A;  3V7R A;  4L9J A;  5BPD A;  1YFH A;  1Z9C A;  3EET A;  1ZG3 A;  4IVN A;  5JHU A;  2XAG A;  5E17 F;  2IRF G;  5ILV A;  1KQ0 A;  3V7S A;  5AIQ A;  1R36 A;  1U5T B;  3W6J B;  3FMS A;  3EYY A;  3LST A;  2NRA C;  4FHT A;  4RS8 A;  2MH9 A;  4HX7 A;  3ZN1 A;  3DQV C;  1VTN C;  2ZKZ A;  3TOB A;  4XLN F;  5JVT A;  3VFZ A;  3WTS C;  3MAJ A;  3D0S A;  5EEH A;  3TOA A;  5DCM B;  1SD4 A;  1J7K A;  2QQ9 A;  1QQI A;  4OIN F;  1U2W A;  3BOQ A;  2FE3 A;  1K6O A;  2DFI A;  2LF8 A;  2GQQ A;  4L0Y B;  4A12 A;  4YG2 F;  4A5N A;  1UFM A;  1EH6 A;  4OMZ A;  4G6Q A;  4GGG A;  3E6D A;  1O7L A;  4YFX F;  4ESF A;  2QZ8 A;  3COA C;  1XDS A;  4LG0 B;  3QU6 A;  5CVV A;  1W4M A;  4YFK F;  2EV6 A;  4UV8 A;  1MJA A;  2A6E F;  5LRS A;  3IRR A;  1LJ9 A;  4WXH A;  3R0J A;  5CVI A;  3GX4 X;  4PZJ A;  2F5D A;  4IXA A;  1XGN A;  2LF7 A;  2F5F A;  4RB3 C;  3KZY A;  3H3U A;  4BH9 A;  3ML6 A;  2XAF A;  4MEY F;  2DK5 A;  3QPT A;  1Z1D A;  2QQB A;  1FBU A;  4P9U A;  1X3U A;  4O5V A;  4EGZ A;  4Y13 A;  1KQ9 A;  1HW5 A;  4KMF A;  4BHP A;  5TRD A;  5ILU A;  4AWX B;  4I7H A;  5HDK A;  1FSH A;  2QEN A;  2UXN A;  1JHH A;  3WTU C;  1PP7 U;  5ILS A;  3JSP A;  4CO8 A;  4UNO A;  2IJL A;  3JAM Z;  3B02 A;  3KEO A;  4OU0 A;  4EM1 A;  4KDP A;  5HLG A;  4M72 A;  1REP C;  2XRO A;  1W7P B;  4IJA A;  2L4M A;  1BC8 C;  4LJZ F;  4L18 B;  5D5X B;  5LBQ A;  2JPB A;  3FM5 A;  1MJ9 A;  1FPQ A;  3WG9 A;  2CO5 A;  1IRF A;  5K5R A;  4G7O F;  2RC4 A;  5CVU A;  4HF0 A;  1R1U A;  1ZN2 A;  1TQP A;  1IUY A;  1IF1 A;  4HZF A;  2ADU A;  2DK8 A;  4MGR A;  2FXA A;  5LGU A;  1DUX C;  2VBX A;  3NEU A;  2FF4 A;  3GFJ A;  2O3F A;  3BP8 A;  2NS0 A;  1ZHF A;  4A2U A;  2A5Y B;  5A2Q K;  2STT A;  2QVO A;  4HQE A;  2A68 F;  2GXG A;  1MGT A;  3CUO A;  3DPL C;  3DXJ F;  3LQQ A;  4Q48 A;  2VT2 A;  3L9F A;  5DD8 A;  4RGX A;  4G7Z F;  1KQ8 A;  3F6V A;  3KEQ A;  5LGN A;  2XAS A;  2XAJ A;  4I09 A;  4WWC A;  4GYI A;  3KP2 A;  3FZV A;  4KIF A;  3T5X A;  1U5T A;  4BYY A;  3DV8 A;  1G3W A;  1TQI A;  2PG4 A;  3F22 A;  2PLY A;  2RQP A;  3J80 Z;  3K1N A;  3RIR A;  5D5V B;  1D8J A;  1XMA A;  4OIO F;  1B1B A;  1Z6R A;  2MA3 A;  5DYM A;  4B09 A;  4Q5S F;  2QBY A;  2R7F A;  3I58 A;  2DPU A;  2IT0 A;  4KA4 A;  3HTU A;  2FNP A;  4L9V A;  4EGY A;  3MZH A;  3T1B A;  1FSE A;  2P7V B;  4HX4 A;  1TBX A;  1WI9 A;  2AS5 F;  2FU4 A;  1SD7 A;  5LHI A;  4RGU A;  5ERI A;  3ZN0 A;  1Y0U A;  3I59 B;  1QZZ A;  2ZXJ A;  3MFK A;  2NAZ A;  3VEP A;  1T98 A;  2XRN A;  1YW8 A;  2EB7 A;  4CDG A;  2R3S A;  3RDI A;  2ACJ A;  4CXF A;  3DF8 A;  3J80 K;  1FYM A;  1W5T A;  4OMY A;  3V8J A;  3WTW C;  3J7A O;  4M73 A;  5IT3 A;  2F5C A;  2BEO A;  5ICF A;  4U0W A;  2EFP A;  2A07 F;  2K7L A;  3LAJ A;  4YFN F;  1IXS B;  2V1U A;  2PMU A;  4Y15 A;  2BE5 F;  2O8X A;  2VXZ A;  3EYI A;  4HV5 A;  1IN7 A;  3P9I A;  4U0V A;  5HLH A;  1BJA A;  1USS A;  3V8L A;  1J5Y A;  2VN2 A;  3EQL F;  1XB4 A;  4IHT A;  2V9V A;  1RUN A;  3QP5 A;  2XHK A;  3WU0 A;  3ZMV A;  2W85 A;  3GWZ A;  3L7W A;  4UVB A;  2K4J A;  2CQK A;  3WGH A;  5CYV A;  5D5U B;  2VBY A;  2COM A;  2MD5 A;  5H20 A;  3M9A A;  4A6D A;  3R0A A;  5DUK A;  2HR3 A;  3LA2 A;  3ZQ7 A;  2HQR A;  3GFI A;  1UST A;  3E6M A;  3K1P A;  5K5O A;  1CGP A;  3LQR A;  1TW2 A;  2F5E A;  1ULY A;  4JBA A;  4CZZ A;  2B0L A;  1MJB A;  2QQA A;  3PFI A;  3BJA A;  1E2X A;  2FMY A;  3MZY A;  3F8N A;  2D1H A;  2M30 A;  1HQC A;  3F8C A;  2EJR A;  4KMU X;  3H3Z A;  4EQQ A;  3RKX A;  3F6O A;  3T8R A;  1BI1 A;  3EDP A;  1QZY A;  4LK0 F;  3E3V A;  4KUM A;  1IZ1 A;  2EA2 A;  2D2W A;  4QWQ A;  2CG4 A;  4U7B A;  2QLZ A;  5F6F A;  4GYG A;  1O3S A;  1R23 A;  3HSF A;  1I5Z A;  3RJP A;  3IL2 A;  5LEK A;  2DBB A;  2OQR A;  1FC3 A;  4UVC A;  1P2F A;  1ZAR A;  3RPU A;  4WXD A;  3DFG A;  3HOS A;  1BBY A;  2XAQ A;  1KU3 A;  3ULQ B;  3BJ6 A;  3WTX C;  3CO6 C;  3TDZ C;  5LHG A;  1Q1H A;  2Q2E A;  4RB2 C;  1S8N A;  3SXY A;  1HW1 A;  3WOD F;  2GAU A;  3GFL A;  3CUQ B;  3JW4 A;  1GXQ A;  1S7A A;  4IRG A;  3LFK A;  1BIB A;  4ENJ A;  1TNT A;  2BBY A;  2KJB A;  3DP7 A;  4FX4 A;  2YX4 A;  4HLX A;  1NHA A;  2OD5 A;  5CLS A;  4ZYH A;  4P55 A;  1XCB A;  4MNU A;  2Y0M A;  5LGT A;  1FP1 D;  2P5V A;  5D8L B;  1W7P D;  3GVA A;  1XGS A;  3GEZ A;  3WTZ A;  3K2Z A;  1V3F A;  2M1B A;  3SZT A;  3GO5 A;  3R60 A;  3KE2 A;  5BS6 A;  1L0O C;  5L3F A;  2Y75 A;  3E6B A;  3IKV A;  3HSR A;  5E20 A;  4EV0 A;  1ODD A;  4WF2 A;  1XDU A;  1UCR A;  1QNT A;  4ZYG A;  4IHS A;  4OIP F;  5EEG A;  2ISY A;  3GF2 A;  4CIC A;  4M9Z A;  2YPR A;  4EJT A;  1QBJ A;  2YR2 A;  3KET A;  1LEB A;  4ZZD A;  4L5J A;  3E5X A;  2VON A;  2EV5 A;  4Z2Y A;  1JHF A;  1KA8 A;  2ZFW A;  5DEQ A;  1B9M A;  1AOY A;  1QGP A;  3R61 A;  2PI0 A;  3FXQ A;  3P9C A;  3FMR A;  3HHH A;  5HS7 A;  2GZW A;  1IN8 A;  4XSZ F;  2YSR A;  3E97 A;  4D0P A;  1R22 A;  3TKY A;  4KT5 C;  4KNY A;  2RDP A;  3O3K A;  3J81 Z;  1D8K A;  1T38 A;  2CWE A;  4EMS A;  5HDN A;  1F9N A;  3K69 A;  4GXO A;  3BPV A;  3TDU C;  3ZPL A;  4G94 A;  2G9W A;  2VBW A;  4FT8 A;  2FRH A;  2EK5 A;  1ZH5 A;  4BNC A;  3HRT A;  2CFX A;  1R1V A;  3SHF A;  3AAF A;  2JZY A;  3KP3 A;  2VE8 A;  2IW5 A;  2XAH A;  2YX7 A;  1GVJ A;  1LNW A;  2QYO A;  4ON0 A;  5J8C A;  4UVA A;  2NNN A;  3Q9V A;  1D3Y A;  2L01 A;  4L9N A;  1K78 A;  2X0L A;  1J9I A;  2OQG A;  4TV7 A;  3R6S A;  3LAP A;  2RGV A;  4HDV A;  2STW A;  3BRO A;  1U5T C;  4A5M A;  3LWF A;  3KLN A;  5BMZ A;  4HLY A;  4P5O A;  5L3C A;  1PUE E;  2M8E A;  1WWX A;  3M1E A;  3EUH A;  5HOO A;  1SMY F;  2PQ8 A;  2O61 A;  5BOX A;  2TDX A;  5FD6 A;  3HIF A;  1BOA A;  4OIQ F;  5CJ9 A;  4WX9 A;  2P5L C;  3I71 A;  2ESH A;  4YII A;  3PQK A;  3FX3 A;  2DLL A;  4L5I A;  1ZG1 A;  3BPX A;  5DCM A;  3ABT A;  1FBS A;  2EFQ A;  2ELH A;  4HW0 A;  5CVJ A;  4JK1 X;  1YS6 A;  4EM2 A;  4G9Y A;  1P92 A;  2BYV E;  1YG2 A;  5LLQ A;  1GXP A;  3Q5F A;  2M87 A;  1K78 B;  3N97 A;  1LB2 A;  3D5L A;  4ENM A;  4ESJ A;  1H9G A;  1XMK A;  4LFU A;  1QPM A;  1R5G A;  2W57 A;  4H0E A;  3C1D A;  1P4A A;  1G3Y A;  1XSX A;  4LMY A;  4RB0 A;  1XGM A;  5BQT A;  3RPQ A;  4RGS A;  3TO6 A;  2KIU A;  4PDK A;  4M71 A;  3KP5 A;  1LDK B;  4OIR F;  2E1C A;  4HAM A;  5HS8 A;  3ZP5 A;  4HQM A;  4N0B A;  4R79 A;  1XSV A;  3TQN A;  5ICG A;  3CLO A;  3CJN A;  3MWM A;  5E1W A;  3FXR A;  2PEX A;  4M9S A;  5HDG A;  3IC7 A;  3QU3 A;  2ZME A;  3QRF F;  1F5T A;  2L02 A;  5JI6 A;  1TLH B;  3N4M A;  2VOO A;  4Q47 A;  1DPR A;  2DQL A;  3IHU A;  3RYR A;  2ZNY A;  4P96 A;  4ZZL A;  2XVC A;  4EJO A;  2GA1 A;  4A0Z A;  3JTG A;  2E7W A;  2KJC A;  4I02 A;  1I1G A;  2R7D A;  4KIG A;  3RKY A;  2H27 A;  4LLL A;  4PCQ A;  5IT9 Z;  1U3E M;  3K0L A;  4U88 A;  1YYV A;  2QUF A;  3RKW A;  2CGP A;  4M9X A;  3WGI A;  4EVI A;  3GUD A;  2KIF A;  3V8K A;  2UWM A;  2ISZ A;  3ZMU A;  2DT5 A;  4K2E A;  2D1V A;  4JQF A;  2W24 A;  3F23 A;  4R1H A;  1J75 A;  2V79 A;  1ZAO A;  4I0A A;  5TJJ A;  4BXU A;  1CF7 B;  2ESN A;  4XSX F;  2P8T A;  1V4R A;  1I27 A;  3G3Z A;  5FLX K;  1S7O A;  1G6N A;  1FYL A;  4HYE A;  2FML A;  4IF4 A;  4G7H F;  1U8R A;  1KYW A;  1BIA A;  3FWE A;  3ABU A;  2M5W A;  1JGS A;  1T6S A;  2FEZ A;  2JTV A;  4XLP F;  4RAZ A;  2K4B A;  2PN6 A;  2JPC A;  2L4A A;  3CUQ A;  2HGC A;  5KK1 A;  2VC0 A;  3L2C A;  2HS5 A;  2PFB A;  4CYD A;  5D5W B;  2P4W A;  3JAM K;  2EFW A;  5DDG A;  5ED4 A;  4HX8 A;  3M7G A;  3IKT A;  5FFX A;  4AIK A;  3ELK A;  4EJW A;  1UHM A;  3QP6 A;  1FT9 A;  2FBK A;  1HKS A;  3T0Y A;  2LKP A;  2ZO4 A;  4DNC A;  1HST A;  4O6J A;  2BGC A;  3V7C A;  1F1Z A;  1LDJ A;  4HDU A;  4IPA A;  3WTV C;  3NRV A;  4LB5 A;  1MKM A;  1ZRF A;  3JSO A;  2DI3 A;  2GXB A;  2Q8K A;  3SQN A;  2HTS A;  4I01 A;  1Z6T A;  2PBI A;  3REO A;  4HF1 A;  1PP8 F;  1YLF A;  1ZLJ A;  1T0F A;  3ROU A;  1YW9 A;  5D4S A;  3LA7 A;  5JFR A;  2RVC A;  4MHG A;  3E5U A;  1LDD A;  2A61 A;  1D5V A;  1FZP B;  1U78 A;  3CO7 C;  1WRJ A;  1B9N A;  1WKM A;  3K9T A;  1BM9 A;  1KYZ A;  4RB1 A;  2P7C B;  2NYX A;  1FWZ A;  5J6X A;  2PMH A;  2A3S A;  5FGM A;  3GFM A;  2QBY B;  1TW3 A;  3FF5 A;  2VOP A;  4NHJ A;  3HHG A;  2BV6 A;  3R4K A;  3ZMS A;  2PJP A;  4LGW A;  1EH8 A;  1ZRD A;  4EM0 B;  1CF7 A;  5L3D A;  5FFZ A;  2OA4 A;  2H6C A;  4ETS A;  1FYK A;  5DV5 A;  5L3B A;  2IPQ X;  5DD4 A;  1SFE A;  5E1Z B;  3B73 A;  2V6C A;  3DKW A;  2HQN A;  5K1Y A;  1I1S A;  1ZRE A;  2FSW A;  2J5O A;  1FLI A;  3GXO A;  2C6Y A;  2OU2 A;  3M8F A;  2ZJ2 A;  2X4H A;  3L09 A;  2L3D A;  1R58 A;  5F1R A;  1O3Q A;  3IRQ A;  1XD7 A;  2A6H F;  1TTY A;  4ASN A;  1S29 A;  3F21 A;  2Q0O A;  3Q9S A;  4UUV A;  1MDM B;  2FQ3 A;  4XRF A;  3TO9 A;  2VOD A;  3OOP A;  3ECH A;  1YTY A;  1KU9 A;  5AIP A;  5ICE A;  2P6S A;  1G4D A;  1YIO A;  1YW7 A;  1ON1 A;  5BPI A;  2JSC A;  4U7D A;  4UHT A;  3IWZ A;  4KN4 X;  3SFZ A;  4L0Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...