2LSOA

Solution nmr structure of the globular domain of human histone h1x, northeast structural genomics consortium (nesg) target hr7057a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords Histone H1x
publication title Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A
rcsb
source organism Homo sapiens
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lsoA00
1J59A 3GZ6A 4U7BA 2K4BA 4M9SA 1Z1DA 3SZTA 2QUFA 4UVBA 3RDIA 5DD8A 2FSWA 4Y13A 3P9KA 4U7DA 1QQIA 5D8KB 3HRUA 2STTA 2WTEA 1SD7A 1XD7A 3MWMA 5HS8A 4HX4A 1QO0D 4I2OA 1P4XA 2RDPA 4RGXA 3VB2A 1FYLA 4F7ZA 1CGPA 2DLLA 2MLKA 3ABTA 4OIQF 4IRHA 2JPBA 5BPIA 2VOPA 4Z2YA 4S05A 2GXBA 2ETHA 3EQLF 2FRHA 5L3CA 2HQRA 2M30A 1R22A 1LQ1A 2XVCA 2BYVE 3BJOA 1MZBA 2X4HA 4G7ZF 3CUQC 4KMUX 5HS9A 3RPUA 3RIRA 4G6DA 3K1NA 2IA0A 3KZYA 2HYFA 4DNCA 1RNLA 4P96A 4NHJA 2H09A 3LA2A 3TO9A 2YX4A 4HF0A 5IT3A 1FSHA 4M72A 1W7PA 2QQBA 1XSDA 1JXSA 2A61A 4XRFA 2GAUA 1QGPA 2LNBA 3GO5A 1XDSA 1H9TA 4U0WA 2NNNA 2QYOA 5A2QK 3FM3A 3P7NA 4EM0B 1XGMA 3E5XA 1IN7A 2FF4A 4P9FA 2PFBA 1IXRC 4HV6A 5JHUA 4UNOA 5J8CA 4EGYA 1QZZA 1FNNA 4BAYA 2A6EF 4HX7A 1JE8A 5ICGA 4RGRA 2E7XA 4BH9A 1BC8C 3C1DA 2CFXA 2HEOA 1ONVA 4A12A 3WE3A 2R7FA 3F8FA 3HSEA 4UVCA 1TNSA 4YIFA 3FHZA 4DQ2A 2GXGA 2PI0A 2OZUA 2BEOA 4LK0F 2LSOA 1XN7A 4HYEA 4IF4A 3IC7A 3R4KA 2W85A 1LB2A 1K78A 1BOAA 1VTNC 5HOOA 2L01A 2OA4A 2P5VA 3H92A 3WU0A 3TO7A 3ZPLA 3I58A 5FD6A 3T1BA 3ZMTA 4ESBA 1ZREA 5FGMA 1IF1A 2K4JA 3ZMUA 2CO5A 3LSTA 1LJ9A 1ZRDA 3WTYC 5D5VB 3R0AA 4IXAA 3WTTC 1SFEA 3JAMK 3HOTA 1TW2A 4UV9A 1XSXA 2O0YA 4RAZA 3FMRA 4XLNF 4EM1A 5LHHA 3PQJA 4M71A 2COMA 5E1ZB 3NQOA 1MD0A 4PDKA 4IRIA 1OR7A 5HDKA 2K86A 3JAMZ 2ISYA 1Z91A 5E20A 4TV7A 4LFUA 1U2WA 5D6EA 3M9AA 2Z99A 5E8GA 3I71A 2DU9A 4MGRA 4KICA 1REPC 4K2EA 4RS8A 3JTGA 4KMFA 2ZJ2A 1YG2A 1HW2A 2XHKA 3KEQA 3OV8A 5FFXA 3MFKA 4IVNA 5BOXA 5BS6A 1GXPA 3IWZA 3F22A 2NS0A 3GXOA 2P7CB 4RB3C 3COAC 2PEXA 4XBFA 4BXUA 4MTDA 3WODF 1O7FA 1XDUA 1F4KA 1V3FA 2DW4A 4AVPA 3HYIA 3RYPA 2R7DA 5LLQA 3KP4A 4GO1A 2M5WA 3DXJF 4A5MA 2CG4A 3L00A 3DEUA 2QQ9A 4UUVA 1ZG1A 4PGGA 2VBYA 3C7JA 1U8RA 2E1NA 1P4WA 2BBYA 2IRFG 1WQ2A 5TRDA 4ON0A 2QENA 1I5ZA 4CZZA 1QZYA 1JHFA 4KT5C 4ESFA 4ZYHA 2LF7A 4EV0A 3KLNA 2ADUA 4LLLA 4LG0B 1D5VA 1O3QA 1STZA 4ESJA 4B09A 4P9UA 1O3SA 2F5DA 4KYWA 4OMZA 3CUQB 1HSJA 4EVIA 1CF7B 2L54A 1UCRA 1FSEA 4WWCA 2VE8A 4HA8A 3RI4A 3J81K 4QLCU 1DPRA 3GFLA 3J80K 2HZTA 3R6SA 1U3EM 3F6VA 3WE2A 4N9HA 5D4RA 2OQRA 1RUOA 3BROA 1OKRA 4R8HA 4RGSA 3FZVA 1OPCA 2FE3A 2A07F 2P5KA 4IPAA 2B0LA 3LWFA 1EH8A 3TDUC 4S04A 4KN7X 4BYYA 4HBLA 3I5UA 3J81Z 1DPUA 3J80Z 2A3SA 3JSPA 2MBFA 1P4AA 1R7JA 2FNPA 3I54A 3SZPA 1YLFA 2ISZA 1IUYA 3V8JA 4HAMA 2XKPA 4HF1A 1G3YA 2XASA 2PQ8A 1YW9A 2YX7A 5JR3A 4L5JA 3O2PE 3KCCA 4I01A 1J7KA 3ML6A 2NYXA 2ACJA 5DCMA 2H6CA 3O6BB 3RTRA 1KU7A 3QAHA 4I98B 1YFHA 1ULYA 1HKQA 1AWCA 3LAPA 4LD5A 2CYYA 1K79A 1F5TA 3CJNA 3M1EA 3G3ZA 1FPQA 2VT2A 3HRTA 4FT8A 2VOOA 5E1XA 3DP7A 1KU2A 5TJJA 4LMYA 1WRJA 3LAJA 2RV8A 4I7HA 2M45A 4MQVA 4WXCA 5CVUA 4HF2A 1BI3A 2XAFA 2OU2A 3P9IA 2YPRA 3ELKA 5D8LB 4KIFA 3LFKA 3B73A 3LQRA 1Q1HA 3TQNA 4ZZDA 1MJAA 1DUXC 3M8FA 2VONA 2A5YB 2DQLA 4EJUA 5L3GA 3KP7A 1SMYF 2Q0OA 4Y15A 1GVJA 1YS7A 3BP8A 2ZO4A 2VE9A 1H9GA 2F5EA 2EV6A 3V7CA 2GQQA 3V4GA 2DO7A 2IP2A 2FXAA 2JSCA 4L0YB 1R5GA 3LA7A 4XSXF 1WKMA 3F8BA 3WTXC 3EYYA 3D5LA 2P7VB 4CGZA 3GWZA 3ZP5A 2HKXA 2O03A 3I59A 2DBBA 3I53A 1ZRCA 2DQRA 3BJAA 4P55A 5D4SA 1WSUA 4WXDA 4ZH4F 2W57A 3MAJA 1K6OA 3ZQ7A 1LDDA 3V7SA 2PBIA 1IN4A 3WTZA 1I1SA 5ILSA 3J7AO 1JHHA 2KIMA 4CO8A 1TQIA 2CGPA 2RGVA 1SAXA 1BBYA 4ZZLA 3GVAA 4N9IA 4KDPA 2BE5F 1FLIA 5FO5A 1MJ9A 1B1BA 1T6SA 2P4WA 3MQ0A 2NNYA 5EEHA 3ULQB 1T98A 4WF2A 2L3DA 2GWRA 1TNTA 1LVAA 3PFIA 1XCBA 1R1UA 2P6SA 1S7AA 2M1BA 2RQPA 3ZMDA 2QBYB 2UWMA 3V7RA 3HTSB 4WXHA 2W25A 3EUHA 3FXRA 4AIHA 3WGIA 3JW4A 2D2WA 1ZLJA 2F5FA 4HZFA 5JI6A 2MLGA 1ON1A 1C0WA 2EV5A 4E70A 4YFNF 4EQQA 1KYWA 3BPXA 5E8IA 1GXQA 3W6KB 2OZ6A 3TDZC 1I1GA 3M7GA 1MDMB 1KQ0A 5K5OA 2VXZA 3F8NA 5LEJA 2JZYA 2GA2A 2ZFWA 1IXCA 2IA1A 2TDXA 4FHTA 2EA4A 1WI9A 3BOQA 1TLHB 4NB5A 2FA5A 3FMSA 4HOBA 4MQ9F 2Z9OA 1TQMA 3HHHA 5H6RA 1HW5A 1R5HA 3JSOA 3GFIA 4IHSA 4AIKA 3BJ6A 2OAZA 3E97A 2F2EA 3HHGA 5FFZA 4HX8A 1BI0A 1HKSA 3N4MA 3E6MA 1XGOA 4U0YA 3GX4X 2M8EA 2W24A 1SFUA 1G3SA 3DV8A 1PP8F 1G6NA 1KU9A 2E7WA 5F64A 1J9IA 4G8XA 4GYIA 2XAGA 4I0BA 5ILUA 3HRSA 3C3WA 1ZGAA 2HR3A 3GUDA 5IT9K 1ZAOA 3GEZA 2RKHA 4A5NA 2EFPA 1GHCA 4EJOA 3QPTA 5J8FA 2RNJA 3GLXA 3TOBA 4LK1F 4AD9A 2DK5A 2KIFA 4L5IA 3DFGA 1T0FA 1ZN2A 4LB5A 4Q4ZF 3BZ6A 4ENMA 2QVOA 4UHTA 5IT9Z 4KA4A 3F72A 2XAQA 2Y75A 3G73A 1XGNA 1ZLKA 4EJWA 1ZG3A 3HUGA 2R3SA 2OD5A 2HTJA 4WX9A 4BNCA 4L18B 3FXUA 1RZ4A 3DKWA 4M74A 3WTSC 5ICCA 1Y0UA 2ZNZA 2VC0A 2FQ3A 1BJAA 2EB7A 2DI3A 4IJAA 1TQPA 1IN8A 2J5OA 3T0YA 3SQNA 2V1UA 1UHMA 1S6LA 1BN5A 2K7LA 2XRNA 3FF5A 5ILVA 1UHWA 5ED4A 1D3YA 1BI2A 1KQ8A 4XLPF 4EJTA 2C6YA 2PJPA 4B8XA 3REOA 2UXXA 4D0PA 2XROA 4UXNA 3K1PA 3K0LA 4FX4A 4EM2A 1P2FA 2JTVA 4OIRF 2RVCA 1MJBA 5LHIA 3E5UA 4I02A 3WTUC 2JPCA 4YFKF 4M6XA 1G4DA 4RB2C 1K7AA 1U5TA 2YSRA 4EMSA 5CVVA 2MA3A 4HDUA 2FMYA 3KZZA 1YW7A 2XAHA 3EETA 2GZWA 2OQGA 1ZRFA 4HLYA 4HQEA 2ZKZA 3PQKA 1LDKB 2G7UA 1BIAA 4BHPA 1EH7A 2ZBKA 2W84A 3KP5A 5BQTA 2IVMA 2IT0A 3IKVA 3Q5FA 1FYMA 5LRSA 2EWNA 2V9VA 3JTHA 2ZMEB 2BV6A 1RI7A 3ZMSA 2XIGA 1KA8A 3IHUA 3WU1B 3F23A 3GFJA 4KUMA 1JGSA 5L3BA 5KK1A 1Z9CA 1XMAA 3ZN0A 5JVTA 1FP2A 4G94A 2NRAC 2P8TA 3TKYA 1PUEE 4KIGA 3U2RA 5HS7A 5AIQA 3RJPA 3SXYA 4A2UA 4ENKA 4I09A 3KP3A 1A04A 3K69A 2Z3YA 2O3FA 3DF8A 4G7HF 3HSRA 3L09A 5CLSA 1ODDA 4M73A 1QPMA 5LGNA 2QLZA 3U9GA 3QU6A 2UXNA 2HTSA 2K02A 3D0SA 1F1ZA 2P6TA 2GA1A 3ECOA 4OU0A 3TO6A 1O3RA 4Q47A 4BHCA 2Y48A 3S2WA 3R60A 2H94A 5AONA 4LG0A 3ERED 1J75A 2FU4A 2ZCWA 3BPVA 2Q8KA 1EV7A 3I59B 3IWFA 2VODA 3CUQA 1CF7A 4M9ZA 2PMUA 5K1YA 2RC4A 3I64A 5JFRA 2VC1A 2VBXA 1BIBA 2L4MA 4L9TA 1KQ9A 1XGSA 5HLGA 5FLXZ 3T8TA 1U5TC 1Z6RA 4PCQA 2YR2A 1XCVA 4XSZF 4LB6B 1KYZA 3U1DA 4KNYA 4CHUA 4JK1X 4MTEA 3R61A 3NRVA 5F6FA 4G9YA 5LEKA 2D1HA 4HLXA 2EJRA 1KGSA 5H6QA 2NAZA 4GCVA 1QBJA 3FM5A 3B02A 4M9XA 3H3UA 2V1DA 5LRRA 4OINF 3EYIA 3CO6C 1RUNA 2CSOA 2Y0MA 1B59A 4ZYGA 2ZNYA 4ZYEA 1BC7C 1D8KA 2F5CA 4ASNA 2D45A 1W7PB 3HOSA 4KFCA 3GW2A 3DPTA 4RAYA 4RB0A 1TBXA 4LGWA 1LNWA 1R1VA 4IRGA 5KVRA 1YW8A 3VEPA 3SFZA 4JQFA 6PAXA 3KLOA 2LKPA 5CJ9A 4BHBA 1XMKA 2G9WA 3F8MA 2QZ8A 1J5YA 1MKMA 3FXQA 2YU3A 4CDGA 1U6GA 4ENNA 3L2CA 1FT9A 2CQKA 2STWA 1PDNC 4HQMA 4L0ZB 1SD4A 4L9JA 2HKOA 2WV0A 3QP6A 4ENJA 2UZKA 3F21A 3NEUA 2AS5F 1FYKA 3BDDA 3ECHA 2WC2A 1E17A 5HLHA 3I4PA 1PP7U 1T38A 4OMYA 1DDNA 3RKXA 2XV4S 1H0MA 1I6XA 2FBKA 1K78B 3DQVC 3GZ5A 3LQQA 3GFMA 2P5LC 3HRMA 3QOPA 3ABUA 1LEAA 1W5TA 2QWWA 3QPHA 5K5QA 1UB9A 4MEXF 1FBQA 4A6EA 2DTRA 2DK8A 3IRRA 2PG4A 2IJLA 1HBXG 4RGUA 2X0LA 3QU3A 3LA3A 3VOEA 1O57A 2A69F 5H20A 3KP2A 2EFWA 1OYWA 3HSFA 1T39A 1FY7A 4O6JA 5HDNA 1USSA 3F6OA 1BI1A 1B4AA 1W4MA 5D5WB 2KIUA 3QP5A 4Q48A 3CLOA 4JBAA 5K5RA 4P5OA 4CYDA 1ON2A 3VODA 5LHGA 5A2QZ 5ICFA 2LDUA 1Z7UA 1I27A 3K1MA 1HKTA 3FX3A 3MZHA 4U88A 2IW5A 2O8XA 1D8JA 2L02A 3I0TA 4MEYF 2EV0A 2MC3A 2DFIA 4PGHA 3KE2A 3WGHA 4R79A 5ERIA 3M8EA 1YTYA 2QBYA 2G7HA 1L0OC 3ZMZA 1FWZA 1R1TA 2JRTA 3CDHA 4IHTA 3WG9A 4LJZF 3IL2A 5D5XB 3FWEA 5DCFA 2VBZA 2M87A 1FX7A 1ZGJA 2HYGD 2HOEA 2WWYA 3BY6A 3KP6A 4UVAA 2DAOA 2IPQX 4L9VA 1SFXA 1IN5A 1MDMA 2ZXJA 3MEXA 4N0BA 3EDPA 2KKOA 5L3DA 4ETSA 3RKWA 1P92A 2CW0F 3WGGA 5LGTA 3QRFF 2BGCA 1KU3A 3K2ZA 5BMZA 2V6CA 1HSTA 1W7PD 5ICEA 3C18A 5L3EA 4RB1A 1U5TB 2LF8A 5DD4A 5F1RA 2KJCA 1ZYRF 3O3KA 2FEZA 2VT3A 1S8NA 2A6HF 1B6AA 1P6RA 1SD6A 1LEBA 2PLYA 1SMTA 3WTWC 2FNAA 2EFQA 2FOKA 5DEQA 5J6XA 1R23A 1J2XA 2PN6A 3OOPA 2DPDA 3T8RA 2ESNA 1FBUA 2HDCA 2Z33A 5AIPA 1IXSB 1ZG5A 4I0AA 3HIFA 4OIPF 3CO7C 2OBPA 2HGCA 3E6CC 1R58A 2HFHA 1IRGA 3R0JA 3E6DA 1MGTA 3Q9SA 4PZJA 3MCZA 2AXLA 4M6YA 5CVIA 3CTAA 1FC3A 2ELHA 4HDVA 5HLIA 1F9NA 2XKOA 5CVRA 1T2KA 1G3TA 1YYVA 2EFOA 2QM3A 4AWXB 2HS5A 4EJVA 5CVJA 1IW7F 4UV8A 1Z6TA 4OIOF 1B9NA 3FMQA 3V8LA 3RPQA 1IRFA 3KETA 5D6FA 1W5SA 2V79A 3TOAA 3T5XA 1TW3A 2XUBA 2RN7A 2PMHA 3MZYA 1USTA 1R36A 3Q9VA 1RIOH 2O6GE 4G6QA 4A6DA 2VN2A 2O61A 5DYMA 4YFXF 2KJBA 4KIBA 3AAFA 3ZN1A 5DCMB 3E3VA 1E2XA 4MNUA 1ZH5A 4KN4X 3F8CA 4HW0A 1YO5C 4Q5SF 4O5VA 4U0VA 5CYVA 1IZ1A 2EK5A 3L9FA 2MH2A 2EFNA 4H0EA 4L9NA 3SHFA 1XSVA 2K27A 2H6BA 1DP7P 1FOKA 5FB2A 1ZARA 4WCGA 2EA2A 2HQNA 1FZPB 1HW1A 1IN6A 4BQAA 4R1HA 4OOIA 4G7OF 2QQAA 4ZYDA 3GYHX 2KRFA 2XGXA 4LLGF 4QWQA 1WWXA 3W6JB 1HXDA 5L3FA 2CWEA 2VBWA 1O3TA 3GF2A 1QNTA 5HDGA 4YG2F 5BPDA 3VFZA 1R00A 1IAWA 3F3XA 4NQWA 5EEGA 3KFWX 2DT5A 1YS6A 1BM9A 2GIVA 3HTUA 4Y17A 1O7LA 4CICA 2V1XA 1OYYA 1SD5A 1LDJA 2IA2A 4YIIA 1TTYA 1EH6A 5E18F 1X3UA 2FMLA 3ISPA 5FLXK 4GGGA 3L7WA 3BWGA 3IRQA 1XB4A 1G3WA 1L3LA 2Z5UA 3IKTA 3E6BA 4MHGA 4CXFA 3RYRA 3CUOA 1S3JA 2J5PA 4AIJA 1AOYA 3TGNA 2DPUA 2Q2EA 1OYIA 1S7OA 1YIOA 2H27A 4A0ZA 3K9TA 1FBSA 2HWVA 3P9CA 3DPLC 5DUIA 2D1VA 5FD5A 5HVQC 3RKYA 2JT1A 3ZMVA 1S29A 2A68F 5E17F 1B9MA 2FBHA 5DV5A 2ZMEA 1YQAA 1UFMA 3ROUA 2XAJA 4HV5A 5LBQA 1ZHFA 4GYGA 3H3ZA 5DDGA 5E1WA 5D5UB 3N97A 1J0RA 2MD5A 3KEOA 4LLNA 2ESHA 2FBIA 4FX0A 1U78A 2E1CA 1HQCA 1V4RA 1NHAA 1OMIA 2L4AA 4GXOA 4O3MA 3WTVC 4WK8F 1Z05A 1FP1D 4EGZA 2MH9A 4A0XA 5LGUA 3V8KA 5DUKA 3E5QA 4A0YA
chains in the Genus database with same CATH superfamily
3LSJA 2E5ZA 1J59A 3GZ6A 4U7BA 2K4BA 3A0HC 3VPRA 4M9SA 2ECCA 3W6VA 2HVSA 1Z1DA 1OCRH 4XLEA 1S9HA 3SZTA 2YU9J 1MW7A 1X3WB 2QUFA 2DMTA 2ICWG 4UVBA 2HOSA 2K3FA 3RDIA 1W0TA 4IHYA 4DZJA 1JT0A 2MD0A 1MH4A 4W1UA 1WJBA 3BR2A 2FSWA 5DD8A 4Y13A 5EGOA 3P9KA 1R4MB 3M1CA 4U7DA 4QPQA 2LKXA 1QQIA 2H8WA 5D8KB 2V7FA 4X0GA 3OYLA 3HRUA 2STTA 2WTEA 1NTCA 3IH3A 1MNDA 1SD7A 2ZFUA 1XD7A 3MWMA 3JR9A 5HS8A 4HX4A 1YHQI 3PSIA 1QO0D 4CYCA 4BY1J 4I2OA 1DQUA 1P4XA 2V6EA 2RDPA 1TWGJ 4RGXA 3VB2A 1FYLA 4F7ZA 1GDTA 3FHNA 3FBIB 1CGPA 2DLLA 1OFCX 2MLKA 2HVRA 3ABTA 1RPWA 4OIQF 4IRHA 2JPBA 4Y4RA 5BPIA 1SAUA 3M4OJ 2R7RA 1WJDA 2VOPA 1LFBA 4Z2YA 2ZXIA 4KITB 3H5NA 4S05A 2GXBA 2ETHA 3EQLF 2FRHA 5L3CA 3RZDJ 2HQRA 2M30A 1RR7A 3ZQHA 4J01A 1R22A 1LQ1A 2Y2ZA 2IBDA 3SFIA 5J40A 2XVCA 2BYVE 3BJOA 1MZBA 1W5CC 3DTKA 2F5VA 2JSPA 1TT0A 2X4HA 3G4SI 4A3FJ 4G7ZF 3CUQC 4KMUX 5HS9A 3RPUA 3RIRA 4G6DA 1ITYA 3K1NA 2IA0A 3B6CA 3KZYA 2HYFA 1ETXA 2R7ZJ 1S5LC 4DNCA 1RNLA 2EH3A 4P96A 3GZNB 2V9PA 4NHJA 2H09A 3LA2A 2HOAA 3TO9A 1HDDC 2YX4A 3OL4A 4HF0A 5IT3A 1UG0A 3CCSI 4FQGA 2JVHA 4LOCA 4C30A 1FSHA 1VNDA 3OSGA 2VLAA 1PUFB 4M72A 1YJWI 2F4MB 4ZTFA 3HOZJ 1W7PA 2QQBA 5DS9A 1XSDA 2A61A 1JXSA 4XQFA 2CW7A 4XRFA 2NVYJ 2GAUA 3IH2A 1QGPA 1SVOA 4XLCA 4D7NA 2FOWA 2LNBA 3QPSA 3GO5A 2DMNA 1XDSA 1N25A 1H9TA 4U0WA 5BNGA 2LVSA 3OYCA 2E60A 2AXTC 2NNNA 1GUUA 2QYOA 2K3PA 5A2QK 2DT6A 3FM3A 3P7NA 2M2EA 4EM0B 1XGMA 5E3MA 2E5NA 3W3CA 4M3GA 3E5XA 2BY1A 1IN7A 4UUSA 4A3JJ 2FF4A 4P9FA 4LG3A 2PFBA 2OCCH 1IXRC 5EG0B 1B8IA 1JGGA 1AHDP 4HV6A 5JHUA 2IGOA 2B9SA 4E7IA 4UNOA 5CQGA 5J8CA 2GM4A 4EGYA 1QZZA 1I6HJ 1FNNA 4BAYA 3CMAI 2A6EF 1IUFA 4HX7A 3JRIA 3OY9A 2Y9ZA 5ICGA 1JE8A 4RGRA 5B1AH 1LKXA 2E7XA 4BH9A 3IP4B 1F36A 1BC8C 3C1DA 1K4SA 1PJRA 2CFXA 2HEOA 1UELB 1ONVA 2BVLA 4A12A 3WE3A 2FX0A 2R7QA 2OV7A 2L7FP 2R7FA 3OYHA 3F8FA 3HSEA 3ZQQA 3J7ZI 3CCLI 3CJRB 2JA8J 4ZYAA 1MMSA 4UVCA 1YI2I 1TNSA 2WY7Q 3CCVI 4YIFA 2LR8A 4RAFA 4DQ2A 3FHZA 2GXGA 2K85A 2PI0A 5LFAA 2OZUA 4XKVA 1DP3A 2BEOA 2PJRA 4LK0F 4E6KG 2A05A 2LSOA 3VYTB 1XN7A 2L7MP 4HYEA 5H2FC 4IF4A 2CW8A 4A3MJ 2QF7A 5DM6F 4YRVA 2M4GA 3IC7A 1N78A 3R4KA 2NS7A 2W85A 3DBRB 5LD2C 4OAZA 1XPXA 1LB2A 1K78A 1JUSA 1BOAA 5HNFA 1VTNC 2DOEA 2L01A 2OA4A 5HOOA 3LSIA 2P5VA 2X6XA 2F48A 4CZCA 1I39A 3H92A 2IGKA 3WU0A 4BGDA 1VQPI 1OCOH 2AQEA 3TO7A 2O9LA 4NC7A 1FIPA 3ZPLA 3I58A 5FD6A 3T1BA 3CF2A 2ELJA 1BJZA 1RC9A 3ZMTA 2EZIA 4ESBA 1ZREA 5FGMA 1IF1A 2K4JA 3ZMUA 2CO5A 3LSTA 4FISA 4A3KJ 1LJ9A 2CQ7A 2XRLA 1ZRDA 1J09A 3WTYC 2LH9A 1ZKGA 4PSWA 5D5VB 1IV6A 3R0AA 4IXAA 3WTTC 1SFEA 1XX5A 1A6QA 1RESA 4PK4A 2JRMA 3DU5A 3I4NJ 2DA1A 1HA8A 2HU9A 3OYFA 3RQIA 3JAMK 3S15J 1TWCJ 3HOTA 1TW2A 4UV9A 1XSXA 2BHZA 4B47A 3MKYB 4M3EA 2O0YA 4RAZA 3FMRA 4XLNF 2VKHA 4EM1A 3NARA 5LHHA 3PQJA 1D1CA 4C3IJ 4IOCF 4QTRA 4M71A 4E7ZA 2CQNA 2COMA 3GTPJ 1U9NA 5E1ZB 2WADA 2EQRA 3S17J 3NQOA 2WAQA 1ZQ3P 1MD0A 4Y33A 3OYBA 4PDKA 1SC7A 4IRIA 3MD2A 3K4CA 1OR7A 4XLAA 5B5EC 1AU7A 2CUZA 4KT6A 5HDKA 1OISA 3L2QA 2K86A 2E1OA 3JAMZ 2ISYA 1Z91A 5E20A 3GTLJ 4TV7A 1W36D 5K7ZA 4LFUA 3HL2A 1YIJI 3E0JB 1UG2A 1U2WA 4IZZA 5D6EA 2DYRH 1V5EA 3M9AA 1F43A 3OS0A 1MNMC 2KPMA 2Z99A 5E8GA 3I71A 3FBNB 3EPZA 2HYJA 2DU9A 4MGRA 3CD6I 4KICA 1REPC 2Y69H 2L7KA 2CRGA 4K2EA 1JUMA 2DJNA 4RS8A 2LBFA 3JTGA 4KMFA 1V54H 2JMWA 2IGMA 4AUXA 1DU6A 2ZJ2A 1YG2A 1R49A 3BTJA 3BT9A 1HW2A 2H8RA 1XTAA 5GAHJ 3PIOF 3LSGA 3S8PA 2XHKA 3KEQA 4JX5A 3ASNH 1EKEA 3OV8A 5FFXA 3MFKA 3GTOJ 1WJEA 4IVNA 5BOXA 1ZR2A 4BXFA 5BS6A 1GXPA 3IWZA 3F22A 2NS0A 3GXOA 2P7CB 4RB3C 1JKOC 3COAC 2PEXA 1YITI 4XBFA 2XC7A 4BXUA 4MTDA 3ABLH 3WODF 4RM3A 1U8BA 1O7FA 1XDUA 1F4KA 3X2QH 1V3FA 1YOVB 2DW4A 3DEEA 4AVPA 1GV5A 3HYIA 1X1CA 3RYPA 1I50J 1RKWA 2R7DA 5LLQA 3CESA 3KP4A 4GO1A 2M5WA 3DXJF 1YJ9I 1TP4A 3CLQA 2XSJC 4OAYA 1MBFA 4A5MA 4BUPA 2CG4A 3JRGA 2X1DA 3L00A 1Z67A 4ZTJA 4XKWA 3M07A 3HXLA 2Y30A 3DEUA 2QQ9A 4UUVA 1ZG1A 1NH3A 4PGGA 2H1LA 2VBYA 4BJTA 1ZR4A 2QSFX 3C7JA 1U8RA 2E1NA 1P4WA 2BBYA 2IRFG 2R7VA 3RKQA 1WQ2A 2W00A 4C2MJ 5TRDA 4ON0A 2QENA 1I5ZA 2WAEA 3CCEI 2CU7A 4CZZA 1QZYA 3IAS2 3OS2A 1JHFA 4KT5C 4IOAF 2HI3A 2M0MA 4ESFA 4ZYHA 1T8IA 3A4CA 3OYNA 4DGWB 2LF7A 4EV0A 2ECBA 2KT0A 2ADUA 3KLNA 3OSFA 4LLLA 4LG0B 1D5VA 1O3QA 1STZA 2CMPA 4ESJA 3MZ8A 3BTIA 4B09A 1WFXA 4XMYA 1Z3XA 1D0ZA 4P9UA 3IAM2 2F5DA 1O3SA 4KYWA 3CJQB 3CUQB 1HSJA 3DU6A 4OMZA 2VUMJ 4EVIA 1CF7B 2L0KA 3IUOA 2L54A 1UCRA 4UY8I 3BG5A 1MBEA 3I4MJ 2Q2EB 1FSEA 2VJJA 4WWCA 2VE8A 1WZ2A 4HA8A 3RI4A 4JOMA 4BQQA 3G1LA 4JX4A 4QLCU 3J81K 1A5JA 4J19A 1DPRA 3GFLA 3J80K 3J7YJ 3K7AJ 2E35A 2HZTA 3S16J 5GPAA 3R6SA 1U3EM 3QODA 3FK6A 2M34A 3F6VA 4E4HA 1D1BA 4XONA 3WE2A 3E7LA 4XN0A 3ZXSA 1UAAA 4N9HA 2LG4A 5D4RA 1E0EA 2OQRA 3HC7A 3CCQI 1RUOA 3HB9A 3BROA 1OKRA 1P9QC 4R8HA 4RGSA 3FZVA 1OPCA 2FE3A 1PYVA 4J00A 5FKOA 2A07F 2OF7A 2P5KA 4IPAA 2B0LA 3LWFA 1EH8A 2CJJA 4CA0A 3TDUC 5B66C 4S04A 3CCMI 2RQQA 4BJ6C 4KN7X 4BYYA 1WJFA 1U0JA 4HBLA 3I5UA 4BY7J 3J81Z 4XM3A 1HC8A 1DPUA 1H88C 2KDZA 2YUSA 1X1DA 3J80Z 2DA4A 2A3SA 3JSPA 2NXNB 2TCTA 3H1CA 3K4LA 3LOCA 2MBFA 2JJ7A 1XS9A 1P4AA 1R7JA 2EIMH 2FNPA 3I54A 3LSMA 3SZPA 2A6TA 1YLFA 2HVQA 3Q0WA 4AC0A 2ISZA 1IUYA 4NBQA 5C44J 3FXLA 3V8JA 3L1PA 4HAMA 2XKPA 4IKFA 2R7OA 4HF1A 2JQ7A 5EF6A 2BXZA 4JX6A 1G3YA 2XASA 1Y1VJ 2PQ8A 1YW9A 2VQHA 1FJLA 5IP7J 2YX7A 5GADJ 5JR3A 4L5JA 3O2PE 4F91B 2M7BA 2GLOA 3KCCA 4I01A 3CMMA 1J7KA 3HOXJ 3CDIA 1NK2P 3ML6A 2NYXA 2ACJA 1P7JA 1TL8A 5DCMA 2H6CA 3O6BB 3RTRA 1KU7A 3QAHA 4I98B 3JRDA 3CCJI 4FE4A 1YFHA 4MFDA 1ULYA 1X2NA 1HKQA 2IAIA 4D9JA 1AWCA 3RZOJ 3LAPA 4LD5A 2CYYA 3D1NI 4AYBA 1K79A 2L9NA 2M7AA 1F5TA 1I3AA 3CJNA 3M1EA 3G3ZA 1FPQA 4YELA 2VT2A 3HRTA 4FT8A 2EPFA 2DJIA 3OR1C 2VOOA 1JUPA 5E1XA 3DP7A 4CYCB 1KU2A 4HNUA 5TJJA 2OCEA 4LMYA 1WRJA 5F04A 4BDYA 3H5AA 1WI3A 1B72A 3LAJA 2RV8A 4I7HA 5FLMJ 2DT7B 2LY2A 1N77A 2M45A 4MQVA 4WXCA 4HNTA 4FCYA 5CVUA 4D1QA 3H3VK 3SYTA 4HF2A 2R0QC 1BI3A 2XAFA 2DA6A 2OU2A 3P9IA 2YPRA 3ELKA 5D8LB 2W82A 4KIFA 3LFKA 3B73A 3LQRA 1X4OA 1Q1HA 3TQNA 2CH0A 3LSRA 4ZZDA 2I5UA 1MJAA 2ZSIB 1DUXC 3M8FA 2VONA 2DMQA 2A5YB 1QA6A 3J7AY 4A69C 4F52A 2NVXJ 2LMDA 3JRCA 2KIQA 2DQLA 4EJUA 5L3GA 4NNJA 3KP7A 1SMYF 2Q0OA 2QGUA 1GVJA 3P5JA 4Y15A 1YS7A 3BP8A 3S14J 3U21A 2ZO4A 1TWFJ 3K70D 2MGQA 3TMOA 1SEUA 2R93J 2VE9A 1H9GA 2F5EA 1GVDA 2EV6A 3BCAA 3V7CA 2JA5J 2JWTA 4FASD 2DTZA 2GQQA 3V4GA 3H9JA 2DO7A 2ME6A 2IP2A 2FXAA 2JSCA 4L0YB 1R5GA 3LA7A 4ZC3A 3OIOA 3HDDA 4XSXF 1WKMA 3F8BA 3WTXC 1LUJB 2HPMA 1EJ9A 2X51A 3QOEA 2OTLI 1OJLA 1MBGA 5J1UA 3WG7H 3EYYA 3OYMA 4A3BJ 4V19K 2IS4A 4XNFA 3D5LA 1ENHA 2P7VB 4F55A 4CGZA 3GWZA 3ZP5A 2HKXA 2O03A 2P0WA 3DBHB 3I59A 5E3OA 3DPUA 2DBBA 3I53A 1ZRCA 2DA3A 5IPAA 3K4JA 2VJ4A 2DQRA 2HXOA 3BJAA 4P55A 5D4SA 1MBHA 1WSUA 4X1EA 4XOPA 4WXDA 3FKIJ 4ZH4F 2W57A 1JJ6C 3CC7I 2NVTJ 3HOYJ 3MAJA 1K6OA 4ANJA 3ZQ7A 2O8KA 1LDDA 3V7SA 2PBIA 4CCNA 2BXYA 3MN2A 1JKRC 1IN4A 3WTZA 1I1SA 4RLQA 4UUSB 3BLYA 5ILSA 3J7AO 3NAUA 3FXJA 4CCLA 5GPCA 1JHHA 2KIMA 4DYRA 4CO8A 3JRFA 1QZEA 3S1MJ 2GXAA 2ME0A 1TQIA 2CGPA 2RGVA 1KONA 4RAGA 1SAXA 3GTQJ 1BBYA 4XKCA 1ORKA 2QA4I 3DCFA 3WHBA 4ZZLA 2E71A 3GVAA 1Y8RB 4N9IA 4KDPA 2BE5F 1FLIA 3F0CA 5FO5A 1MJ9A 1B1BA 3B6AA 1T6SA 2P4WA 3MQ0A 2NNYA 2CUJA 5EEHA 3ULQB 1T98A 3BG3A 4WF2A 2L3DA 3VYUB 2GWRA 1AKHA 1TNTA 5J47A 4ZDOA 1D1AA 5EYRA 2M8GX 4F92B 1LVAA 1T08B 3PFIA 1XCBA 1R1UA 2P6SA 3DBLB 3K6GA 3SEZA 1QHHD 2E1MC 4PJMA 1S7AA 2M1BA 2RQPA 2LY9A 4XKBA 3PNTA 3ZMDA 2QBYB 2K5CA 2UWMA 3V7RA 3HTSB 5M5YJ 4WXHA 4W97A 2W25A 3EUHA 3FXRA 2ZXWH 4AIHA 4V2GA 1JJ8C 3WGIA 1DGWY 2D2WA 3JW4A 3OIQA 1ZLJA 2F5FA 2ZMEC 4HZFA 5JI6A 1YRNA 2MLGA 5HODA 1ON1A 1C0WA 2EV5A 1WJ5A 3D5RC 4E70A 4XK4A 4XRSA 4YFNF 4EQQA 1GT0C 1BW6A 4AM3A 1KYWA 4Y3OA 1XC5A 3BPXA 5E8IA 3ZQFA 2VQGA 1GXQA 3QWLA 3W6KB 2OZ6A 3TDZC 4AYBN 3PUBA 1I1GA 3M7GA 1X19A 1MDMB 1KQ0A 5TISC 5K5OA 4BKXA 2Q1ZB 2VXZA 2K9NA 3F8NA 5LEJA 2JZYA 2GA2A 1BOBA 1IXCA 2IA1A 2TDXA 2ZFWA 4FHTA 2EA4A 1WI9A 4BJ5C 3BOQA 3LSPA 2LLKA 3BTLA 1TLHB 3BQZA 3H0DA 4NB5A 3A1YA 2FA5A 3FMSA 4HOBA 4MQ9F 1ETVA 5HLTA 2Z9OA 1TQMA 3OYKA 3IV5A 3AG1H 2BY0A 2BY3A 3HHHA 5H6RA 1HW5A 3DWLE 1R5HA 4HEA2 3JSOA 3GFIA 4IHSA 3SDGA 1RR8C 3HOWJ 2R92J 4AIKA 1K83J 2VB6A 2ZJRF 3BJ6A 2OAZA 2M3AA 2ZXHA 3E97A 2F2EA 3HHGA 1OLTA 2LOOA 5FFZA 4HX8A 4C3HJ 5E3LA 1BI0A 1X1PA 3PL8A 2WB1N 1HKSA 3N4MA 1ACIA 1SFKA 2DMPA 2I10A 2WV1A 3E6MA 1XGOA 3CC4I 4U0YA 1Y1WJ 2HOTA 2X1EA 3KEYA 2W48A 3GX4X 2M8EA 4E7LA 2W24A 1SFUA 4AVZA 3UR3C 1G3SA 3DV8A 1QU3A 4ABZA 1PP8F 2KQRA 1E3OC 1G6NA 4IHVA 1KU9A 2KMUA 2E7WA 5F64A 1EF4A 1J9IA 1D0XA 4YEJA 2LBFB 3LSHA 5GP9A 5DM7F 3OWTA 4G8XA 3HBLA 2Y0SA 4GYIA 2GIZA 2BY2A 2XAGA 3PO2J 3DKYA 4I0BA 4ITVA 2KZVA 5ILUA 3HRSA 4F93B 3UNGC 3C3WA 1ZGAA 5GTIC 4LIUA 2HR3A 4N4NB 3GUDA 2OTJI 5IT9K 5K7HA 1R4NB 1ZAOA 3GEZA 4C9YA 3S3NA 4QIWN 2RKHA 4A5NA 2DDAA 5E79C 1GV2A 1YE9A 2EFPA 1GHCA 4EJOA 1UHSA 3QPTA 5J8FA 2RNJA 3JCUC 2LP0A 3GLXA 3TOBA 4LK1F 3PIPF 2CQQA 2LD5A 4AD9A 2DK5A 2KIFA 4L5IA 3L2UA 3DFGA 1T0FA 1ZN2A 4HRIA 2KP6A 2ZJPF 4Q4ZF 4LB5A 3BZ6A 4ENMA 1ETKA 2QVOA 1Y0NA 4D5CA 2X48A 5C4JJ 4UHTA 2BW3B 4KA4A 5IT9Z 2KL4A 2VPRA 3F72A 2XAQA 3K4BA 2DXIA 2Y75A 2XGDA 3L2RA 3G73A 4PJ0C 3KIOA 1XGNA 2R5YA 1D0YA 2EZLA 1VQ6I 1ZLKA 4B44A 2LKSA 4EJWA 1ZG3A 3HUGA 5GAEJ 1D5YA 2R3SA 2OD5A 2A5WA 1SVMA 4G12A 1JKPC 2HTJA 4WX9A 3BR0A 4BNCA 4MFEA 4L18B 3FXUA 1RZ4A 3DKWA 2ID6A 1QRYA 4M74A 2W7NA 3WTSC 1NK3P 3AL0C 5ICCA 1Y0UA 2ZNZA 2X85A 3L2WA 2VC0A 2V9KA 2FQ3A 1BJAA 2EB7A 2XF6A 4B48A 1RETA 2DI3A 4E7SA 1R6RA 3W2VA 1G8XA 4IJAA 1TQPA 1IN8A 2J5OA 4D5FA 3T0YA 3SQNA 5J1YA 2E36A 4DYCA 2V1UA 1UHMA 4A3LJ 3W2WA 1S6LA 3E1SA 3VYSB 3ERMA 1BN5A 2K7LA 2NVQJ 3FXOA 3OOUA 4CCOA 2XRNA 2KDOA 3FF5A 4BQOA 2K9MA 5ILVA 1UHWA 1JTXA 5ED4A 3I9V2 3ABMH 3HM5A 1D3YA 2JA7J 2HNHA 1BI2A 1KQ8A 2VJ5A 4XLPF 3GMEA 4F3QA 3O8HA 4EJTA 3LFUA 1BR4A 3MMYB 2JA2A 2C6YA 2PJPA 2MABA 4B8XA 1S7EA 3OS1A 3REOA 4PJNA 1E3HA 2UXXA 4IX7A 4D0PA 2XROA 2M4KA 4UXNA 2ZSHB 2O7OA 4PSXA 3K1PA 3K0LA 1V55H 3A01A 2DA5A 4FX4A 4EM2A 1VQ4I 2IS6A 1P2FA 2JTVA 4A3GJ 3SJMA 4OIRF 2RVCA 1ZTRA 3AFHA 1MJBA 4NQWB 5LHIA 3VDXA 4Y52J 2QSGX 3E5UA 2IEKA 1BR1A 4I02A 3WTUC 1VQ5I 2JPCA 4IEJA 4D7MA 2JA6J 4YFKF 4M6XA 1G4DA 3HZJA 4RB2C 1Y6IA 2EIKH 1BW5A 1YJNI 1K7AA 1U5TA 3FIWA 2YSRA 4EMSA 5CVVA 4B4CA 3ZQLA 1TZLA 2MA3A 4HDUA 2FMYA 4PFOA 3KZZA 1X2MA 1YW7A 2XAHA 3EETA 2GZWA 2OQGA 2CV0A 1ZRFA 4HLYA 2XAUA 3N05A 4HQEA 2VI6A 2ZKZA 3M8JA 3PQKA 4IL6C 3S3OA 1LDKB 2G7UA 4XRSG 1BIAA 4BHPA 1EH7A 2DDBA 1KZHA 2ZBKA 2W84A 3KP5A 5BQTA 3HPHA 5EJCA 3HGYA 2HPIA 2VXDA 2K9QA 2IVMA 3H0GJ 2JN6A 5FJ8J 2Y0SN 2IS2A 1A36A 4DBRA 2IT0A 2E1MB 2G0EA 3IKVA 2V4JC 3Q5FA 1P7IA 1FYMA 3M3YJ 1LVKA 3DLLF 3ZGKA 3IH4A 5LRSA 2EWNA 5E3NA 1YX5A 2HDDA 2V9VA 2D5VA 2KHMA 3JTHA 4BEHB 1OR7C 1JT6A 2HQAA 3KYCB 3OYEA 3H35A 2ZMEB 2BV6A 1IDYA 3BR5A 1RI7A 4P1WA 3ZMSA 2NS8A 3WHCA 2E19A 2X6OA 4NC8A 1VQKI 2XIGA 2R7WA 2P81A 3HKZN 1KA8A 3IHUA 3WU1B 3F23A 3GFJA 2R5ZB 3SDBA 3FDYA 2DN0A 4KUMA 1JGSA 1VQ9I 5L3BA 4DJAA 4DBQA 5KK1A 1Z9CA 1XMAA 1VQ8I 3TP0A 3ZN0A 5J3LA 2XB0X 5JVTA 1FP2A 1QVTA 1MBKA 1BR2A 3HGGA 4G94A 2NRAC 2P8TA 3TKYA 3K2AA 2HDWA 1PUEE 1ETYA 4JYKA 4KIGA 3U2RA 5HS7A 2UUZA 5AIQA 3RCOA 3RJPA 4DYQA 3MVPA 3SXYA 3ZOBA 4HSTA 4A2UA 4ENKA 4I09A 3KP3A 5FKLA 2PMZA 1QHGA 1A04A 3K69A 3PJRA 2Z3YA 5FLVA 2O3FA 3DF8A 4G7HF 2B63J 3HSRA 3L09A 5CLSA 3U1KA 3ZRGA 1ODDA 4M73A 1MMDA 1QPMA 1IV8A 3LSKA 4UUTA 9ANTA 5LGNA 2QLZA 3U9GA 3QU6A 2UXNA 5K7FA 2HTSA 2K02A 4II3A 4RA2A 3D0SA 1A31A 1F1ZA 2P6TA 2L9RA 3CZ6A 2GA1A 3ECOA 4PFPA 2JUGA 3CP2A 1A6IA 4OU0A 5EZHA 3TO6A 4LIVA 1O3RA 4NUBA 4Q47A 4BHCA 2Y48A 3S2WA 1ZK8A 3R60A 2H94A 5AONA 3JRHA 4LG0A 3ERED 5EGOB 1J75A 2FU4A 2ZCWA 3BPVA 2Q8KA 4IHWA 1EV7A 5F08A 3I59B 3IWFA 2VODA 4XORA 1FTZA 4M3DA 4BQNA 2EINH 2NOGA 2HZDA 3CUQA 3GTMJ 4E7JA 2DCEA 1JI8A 1CF7A 1Z0XA 4M9ZA 2PMUA 5K1YA 1Z77A 2LRDA 2RC4A 2ZC2A 3BG7A 1SFOJ 3I64A 4CCMA 3QYEA 4PUSA 1VQOI 4B43A 5JFRA 2VC1A 2VBXA 5JVGF 4Z6YA 1BIBA 3ASOH 2L4MA 3PO3J 4L9TA 1KQ9A 1XGSA 5GAGJ 1OCPA 5HLGA 2EBIA 5FLXZ 4XIDA 3T8TA 1U5TC 3H9QA 5J1RA 1Z6RA 2L5QA 4PCQA 3QPLA 2YR2A 1XCVA 4XSZF 4LB6B 1KYZA 3U1DA 2VJIA 4KNYA 3C2HA 4CHUA 4JK1X 3QQAA 4MTEA 1G59A 1VQ7I 3R61A 3NRVA 5F6FA 4GRIA 4G9YA 5LEKA 2D1HA 4HLXA 1Z21A 2EJRA 1KGSA 5H6QA 1K6YA 1NG6A 2NAZA 2WB1A 4HG2A 3Q3SA 4GCVA 5M3MJ 4A0YA 2K40A 4I76A 1QBJA 3FM5A 2DODA 3B02A 4H4KC 4M9XA 3H3UA 4JP0A 1W0UA 3ZR8X 3MKWB 2V1DA 5LRRA 4OINF 1VQNI 3ABKH 2AO9A 3EYIA 4RDUA 2JVGA 3CO6C 1Y39A 1OCTC 4CH7A 1RUNA 2CSOA 2Y0MA 1B59A 4ZYGA 2VPLA 2GOMA 2VKDA 1WGXA 2ZNYA 2DA2A 4V2FA 2AHQA 4ZYEA 1LE8A 1BC7C 1D8KA 4RM2A 4CCJA 2F5CA 4ASNA 4DOZA 2D45A 5FKMA 2DA7A 1W7PB 3HOSA 3PM1A 1WJCA 3DTEA 4KFCA 5CKTA 1WCMJ 1XMXA 2FD5A 3GW2A 3DPTA 4RAYA 3S3MA 4RB0A 5KCMA 1Q1VA 3BR3A 3VWBA 1TBXA 1X1AA 4LGWA 3AL0B 3OYGA 1LNWA 2MW8A 1R1VA 4IRGA 5KVRA 1YW8A 4G6TB 3VEPA 4E7KA 3SFZA 3OR2C 2E2IJ 3S1QJ 4XN3A 2MSYA 4JQFA 6PAXA 1V5FA 4BBRJ 2XGCA 3KLOA 2LKPA 1B8IB 3Q0UA 4RLFA 4YIRX 2L9SA 5CJ9A 1IGNA 4BHBA 2WBMA 1R5ID 1XMKA 2ID3A 3JREA 2G9WA 3F8MA 2QZ8A 4NDLA 1APLC 5J4VA 3HOUJ 1J5YA 2KZGA 1MH3A 3DKXA 1MKMA 1WH5A 3FXQA 3K4MA 2YU3A 4CDGA 1U6GA 4ENNA 3L2CA 5EEAA 1FT9A 2CQKA 3HEFA 1VZ0A 2STWA 5JLXA 1PDNC 1K4TA 1UZCA 5JLWA 4HQMA 4L0ZB 1SD4A 2QSHX 2NOJB 4L9JA 2COBA 2HKOA 2WV0A 3QP6A 4ENJA 2UZKA 2JUCA 3F21A 3NEUA 3S93A 2VQCA 3TW7A 4IHXA 3O8GA 2AS5F 1FYKA 1JTYA 3BDDA 3ECHA 2WC2A 3KX2A 1E17A 2PJRB 2PMZN 3FXMA 3NWTA 2EIJH 5HLHA 3AG3H 3I4PA 1PP7U 4MLOA 1T38A 4OMYA 3D5SC 1DDNA 3RKXA 2X9DA 2XV4S 2WY8Q 2YS9A 1H0MA 1I6XA 3TBIA 2FBKA 5J4YA 3G6EI 3LL7A 5TGTA 1K78B 1VQLI 3WU2C 3DQVC 3GZ5A 4DIQA 1H8AC 1X4PA 3LQQA 3GFMA 2RREA 2XPWA 4ZDLA 4AU7A 2P5LC 3FKJA 2VQLA 3A0BC 3HRMA 4KJZA 3QOPA 3ABUA 3Q0VA 1LEAA 1W5TA 2QWWA 3QPHA 5K5QA 2X1CA 1UB9A 3H5RA 4MEXF 1MSEC 1FBQA 4A6EA 4XICA 2GBYA 2H1KA 2DTRA 2DK8A 3VSLA 3IRRA 2PG4A 2IJLA 2BOLA 4OWRB 3TW6A 1HBXG 4RGUA 2X0LA 4C2TA 1WVRA 2IGNA 3QU3A 1T56A 3LA3A 2E2HJ 3I55I 2ZJQF 3VOEA 1O57A 2L9VA 2QKLB 1BA5A 2A69F 5H20A 2MYSA 3KZIC 3KP2A 2L2OA 4B3AA 2EFWA 1OYWA 2Y31A 1Y56A 2LREA 4ZJZA 1IDZA 3HSFA 2Z1DA 1T39A 1FY7A 2IS1A 4O6JA 5HDNA 5KHDA 1USSA 1OCZH 2O5RA 1HF0A 2CV1A 4PJJA 1T95A 2FQ4A 3F6OA 1G2HA 1BI1A 1UMQA 4DW6A 1B4AA 2XB5A 1POGA 4I99C 1W4MA 5IY5H 2V26A 5FRNA 5D5WB 3K4NA 4IQJA 1E3PA 2KIUA 2XGEA 3QP5A 5FKKA 2R5YB 4Q48A 1VF9A 1WH7A 5M5XJ 4BBSJ 5FRMA 5IP6A 3TL4X 1TWHJ 2MG4A 3VSKA 3CLOA 4JBAA 5K5RA 4P5OA 3HUGB 4CYDA 4C2UA 1ON2A 3CCUI 3VODA 5LHGA 5A2QZ 5ICFA 2LDUA 2XSDC 1Z7UA 2KLOA 1I27A 2EZKA 3K1MA 3FX3A 1HKTA 2MFZA 3MZHA 1WJAA 4U88A 2IW5A 2O8XA 3LNQA 3GTJJ 5M3FJ 1D8JA 2L02A 3I0TA 2R7XA 4MEYF 3GLLA 1T33A 2EV0A 4A3CJ 2MC3A 2WA0A 3CMEI 2DFIA 1Y8QB 4PGHA 4BE0A 1YX3A 3KE2A 3RQ4A 3WGHA 4R79A 5ERIA 2LC2A 5FKNA 3M8EA 1YTYA 2QBYA 2G7HA 1R9TJ 1DGRM 1L0OC 3ZMZA 1JKQC 1QPIA 1FWZA 2OC6A 2UV1A 3AKZA 1LFUP 3A02A 1R1TA 2CS3A 2DMUA 2GOXB 2JRTA 3H9GA 1UJ8A 3SEQA 3CDHA 5C4XJ 1PUFA 2DYSH 4IQ4A 4XOTA 1ERDA 2LK2A 4IHTA 3WG9A 2QCOA 4LJZF 3QYBA 5D5XB 3IL2A 4E7HA 1ETOA 3FWEA 5DCFA 2VBZA 2M87A 1FX7A 4A93J 1ZGJA 1FEXA 2HYGD 2HOEA 2WWYA 3BQYA 2ELKA 3BY6A 3KP6A 4UVAA 1V5GA 2DAOA 2IPQX 3RPUD 3HKZA 3OYJA 3G71I 4KISA 4L9VA 4ZDPA 1SFXA 1MNEA 1CQTA 1IN5A 1MDMA 2ZXJA 3MEXA 1IO2A 4GDFA 4N0BA 5EG0A 3JRAA 3EDPA 3A01B 2EZHA 3ZQIA 2KKOA 5L3DA 4ETSA 2W4SA 3C2GA 3C2BA 3OMYA 3RKWA 1P92A 2CW0F 3WGGA 5LGTA 3QRFF 2BGCA 3EUHC 3OIPA 1KU3A 3K2ZA 4NC6A 2BZTA 5BMZA 2V6CA 1HSTA 2OUMA 1W7PD 1ETWA 5ICEA 3S1NJ 1TC3C 1MSFC 3CCRI 1MMNA 3C18A 5L3EA 4RB1A 5HNHA 2AQFA 1U9OA 3BCBA 5KAIC 3G1OA 2F4OB 1U5TB 2R4GA 3HOVJ 2LF8A 5DD4A 1IC8A 1OQYA 1FMVA 5DTDA 1S72I 5F1RA 3FK7A 2KJCA 2LYCA 1ZYRF 3O3KA 4A3IJ 2FEZA 2KRHA 2XF5A 2VT3A 1S8NA 3S32A 2A6HF 1VQMI 4CCKA 3ZCOA 1B6AA 1P6RA 2K9LA 1SD6A 3AG4H 1LEBA 2PLYA 4CSWA 1Z7LA 1SMTA 2NVUB 3WTWC 2QKMB 4GFBA 2FNAA 1W36C 2EFQA 2FOKA 5DEQA 1RKTA 1TWAJ 5J6XA 4BDZA 1R23A 1J2XA 2PN6A 3OOPA 1X58A 2DPDA 3T8RA 2ESNA 4RBOA 1FBUA 2HDCA 2Z33A 5AIPA 1IXSB 4RMNA 5EDNA 3PNYA 1ZG5A 2M9HA 1AA7A 4I0AA 2DOFA 2XDVA 3HIFA 1IG7A 4OIPF 2R7SA 1IRZA 3CO7C 2OBPA 5F27A 2HGCA 3E6CC 1R58A 1PVEA 3HG9A 4C3JJ 1ZELA 2HFHA 1IRGA 1FIAA 3R0JA 1LFPA 2KRCA 3FISA 3E6DA 1MGTA 3Q9SA 4PZJA 3MCZA 2CFOA 2AXLA 2V1NA 4HNVA 4M6YA 5CVIA 3CTAA 3CQZJ 4EATA 2XF7A 1FC3A 2ELHA 2VIXA 2EILH 1MIJA 4HDVA 3H36A 5HLIA 1F9NA 3CCYA 3A03A 4CUGA 2XKOA 1O4XA 1ETQA 5CVRA 3ZQGA 3GBGA 4BXXJ 1T2KA 4B3XA 3GTGJ 1M1EB 5FROA 1G3TA 1YYVA 2EFOA 2QM3A 2OPTA 2B7EA 4AWXB 3OL3A 2HS5A 1HDPA 5F0HA 4EJVA 2PX9A 5CVJA 3RSNA 1IW7F 2LFBA 4UV8A 1Z6TA 4OIOF 1B9NA 4HSRA 3FMQA 3V8LA 1FOYA 3RPQA 1IRFA 3KETA 5D6FA 1FTTA 1W5SA 4BACA 2V79A 4UB8C 1IJWC 2ZB9A 5C3EJ 3TOAA 2BW3A 2E2JJ 3T5XA 1TW3A 5EZGA 1DU0A 1WPKA 2TRTA 2XUBA 2QEXI 2RN7A 3AG2H 3DTIA 4I6ZA 1BL0A 4HPQA 2Z2SB 2PMHA 2VKEA 3HJEA 4M3BA 4M6VA 4U87A 3MZYA 3CMYA 1USTA 2Z16A 5IYCJ 3VYRB 3BR6A 1R36A 3Q9VA 3UKGA 2XPVA 1RIOH 2O6GE 4G6QA 4A6DA 2XPUA 5B3SH 2VN2A 2O61A 5DYMA 4YFXF 1FMWA 2KJBA 4KIBA 3BR1A 2K9SA 1H89C 3AAFA 3ZN1A 5DCMB 2VASA 4QPOA 5F0CA 2BHYA 3E3VA 1E2XA 2RNGA 4MNUA 1EA3A 1K61A 1IRXA 1ZH5A 3OYDA 5IOYA 1T0FC 4KN4X 3F8CA 4HW0A 1YO5C 4Q5SF 4O5VA 3DEWA 4U0VA 5IP9J 2VL8A 3BZKA 5CYVA 5M5WJ 1IZ1A 2EK5A 3L9FA 2MH2A 2Y9YA 2EFNA 2N8GA 2CUFA 3F9KA 4H0EA 4L9NA 3SHFA 1XSVA 4Y7NJ 2K27A 2H6BA 4X6AJ 2I8DA 1DP7P 1FOKA 3PNVA 5FB2A 1ZARA 4WCGA 2EA2A 2HQNA 2CV2A 3JRBA 1FZPB 1B72B 1HW1A 3KYDB 1IN6A 4BQAA 1ZGWA 3CDLA 2FJ1A 4R1HA 3K4KA 4OOIA 3TP3A 1RRJA 4S0HB 4G7OF 3QYFA 2QQAA 3PUFA 4XLHA 4ZYDA 3G1MA 2FUG2 3GYHX 2KRFA 1SANA 2XGXA 3CJTB 3CF5F 3BC8A 4LLGF 2JK3A 3EUKL 5IYDJ 4QWQA 1WWXA 3W6JB 1HXDA 1HOMA 4EEFG 5L3FA 2CWEA 3ZQCA 5IYBJ 2VBWA 2R7UA 3V42A 1GLNA 1O3TA 3GF2A 1QNTA 3W2AA 5HDGA 2CUEA 3KPHA 4YG2F 5BPDA 2R7TA 1WHUA 2DOAA 3VFZA 1R00A 3SZGA 4BS9A 2DFFA 1IAWA 2DFHA 2MC4A 4BU2A 3F3XA 5CPRB 4NQWA 5GTHC 3PSFA 3A2KA 5EEGA 2LTPA 3KFWX 2DT5A 1YS6A 1BM9A 2WAQN 1Z3YA 2IXSA 2GIVA 3EUAA 3HTUA 2HQ5A 3PFYA 4Y17A 1VI0A 1O7LA 4CICA 2V1XA 1OYYA 1OCCH 3S2DJ 1SD5A 4BE1A 1LDJA 2IA2A 4YIIA 1TTYA 1EH6A 2M0CA 1MMGA 3I56I 5E18F 5IOZA 1X3UA 1N75A 3FXKA 5F0FA 3K10A 5CQEA 1LE8B 1FOXA 2FMLA 4LITA 3LMMA 3BG6A 3ISPA 4GGGA 2X6YA 4AIDA 3HPGA 3L7WA 5FLXK 4L5EA 3BWGA 2QQ8A 3IRQA 1XB4A 2X6WA 4QSHA 3OYIA 1G3WA 4M3FA 2F6CA 1L3LA 2Z5UA 3IKTA 4BE2A 3E6BA 4MO7A 4MHGA 3GTKJ 4CXFA 1FOWA 1MMAA 3RYRA 3CUOA 4FTHA 1S3JA 2J5PA 3DLAA 4AIJA 1AOYA 5KAFC 3TGNA 1VFCA 2DPUA 5KNLA 2Q2EA 3S1RJ 5JHFA 1OYIA 1S7OA 1YIOA 3G2BA 2H27A 4A0ZA 2DFEA 1FBSA 2HWVA 3K9TA 3NWSA 4BL0B 3TEDA 3P9CA 3DPLC 5DUIA 2D1VA 5FD5A 5HVQC 4XLFA 3RKYA 2JT1A 1MBJA 3ZMVA 4II2A 1S29A 1XG1A 2A68F 4BEHA 2LY1A 5E17F 4A3EJ 4XRMA 1B9MA 2FBHA 1X3ZB 4FETA 5DV5A 2ZMEA 1YQAA 1NG7A 1QVUA 1I3QJ 2OJED 1UFMA 3ROUA 2XAJA 1HCRA 4HV5A 2W1OA 5LBQA 4A3DJ 2BVMA 2R5ZA 4XL9A 2HXIA 4IO9F 1HLVA 1ZHFA 4GYGA 3H3ZA 4B1RA 4FE7A 5DDGA 2CQXA 3ONQA 1AKHB 2E34A 5E1WA 1R71A 5D5UB 3L2VA 4PJLA 3N97A 1J0RA 2MD5A 3KEOA 2F4IA 2KISA 1TT5B 4LLNA 2ESHA 3MKZA 1X1BA 2FBIA 4FX0A 1U78A 2E1CA 1HQCA 3CC2I 1V4RA 3S2HJ 2L7ZA 3ESWB 1NHAA 1OMIA 2KFDA 2L4AA 4GXOA 1LPQA 3CP8A 4MIMA 3BZCA 3GCMA 4O3MA 3WTVC 4WK8F 1A35A 1Z05A 3OYAA 3BG9A 1FP1D 4UB6C 4EGZA 4DZPA 3MKLA 2MH9A 4A0XA 3KYLA 5LGUA 3BTCA 3K70C 1SVLA 3V8KA 2WAFA 1W1WE 5F1JA 4XR6A 3E5QA 5DUKA 5B1BH 2VKVA 3I3LA 4N4OB 1YRNB 2RAEA
chains in the Genus database with same CATH topology
1J59A 3GZ6A 4U7BA 2K4BA 4M9SA 1Z1DA 3SZTA 2QUFA 4UVBA 3RDIA 5DD8A 2FSWA 4Y13A 3P9KA 4U7DA 1QQIA 5D8KB 3HRUA 2STTA 2WTEA 1SD7A 1XD7A 3MWMA 5HS8A 4HX4A 1QO0D 4I2OA 1P4XA 2RDPA 4RGXA 3VB2A 1FYLA 4F7ZA 1CGPA 2DLLA 2MLKA 3ABTA 4OIQF 4IRHA 2JPBA 5BPIA 2VOPA 4Z2YA 4S05A 2GXBA 2ETHA 3EQLF 2FRHA 5L3CA 2HQRA 2M30A 1R22A 1LQ1A 2XVCA 2BYVE 3BJOA 1MZBA 2X4HA 4G7ZF 3CUQC 4KMUX 5HS9A 3RPUA 3RIRA 4G6DA 3K1NA 2IA0A 3KZYA 2HYFA 4DNCA 1RNLA 4P96A 4NHJA 2H09A 3LA2A 3TO9A 2YX4A 4HF0A 5IT3A 1FSHA 4M72A 1W7PA 2QQBA 1XSDA 1JXSA 2A61A 4XRFA 2GAUA 1QGPA 2LNBA 3GO5A 1XDSA 1H9TA 4U0WA 2NNNA 2QYOA 5A2QK 3FM3A 3P7NA 4EM0B 1XGMA 3E5XA 1IN7A 2FF4A 4P9FA 2PFBA 1IXRC 4HV6A 5JHUA 4UNOA 5J8CA 4EGYA 1QZZA 1FNNA 4BAYA 2A6EF 4HX7A 1JE8A 5ICGA 4RGRA 2E7XA 4BH9A 1BC8C 3C1DA 2CFXA 2HEOA 1ONVA 4A12A 3WE3A 2R7FA 3F8FA 3HSEA 4UVCA 1TNSA 4YIFA 3FHZA 4DQ2A 2GXGA 2PI0A 2OZUA 2BEOA 4LK0F 2LSOA 1XN7A 4HYEA 4IF4A 3IC7A 3R4KA 2W85A 1LB2A 1K78A 1BOAA 1VTNC 5HOOA 2L01A 2OA4A 2P5VA 3H92A 3WU0A 3TO7A 3ZPLA 3I58A 5FD6A 3T1BA 3ZMTA 4ESBA 1ZREA 5FGMA 1IF1A 2K4JA 3ZMUA 2CO5A 3LSTA 1LJ9A 1ZRDA 3WTYC 5D5VB 3R0AA 4IXAA 3WTTC 1SFEA 3JAMK 3HOTA 1TW2A 4UV9A 1XSXA 2O0YA 4RAZA 3FMRA 4XLNF 4EM1A 5LHHA 3PQJA 4M71A 2COMA 5E1ZB 3NQOA 1MD0A 4PDKA 4IRIA 1OR7A 5HDKA 2K86A 3JAMZ 2ISYA 1Z91A 5E20A 4TV7A 4LFUA 1U2WA 5D6EA 3M9AA 2Z99A 5E8GA 3I71A 2DU9A 4MGRA 4KICA 1REPC 4K2EA 4RS8A 3JTGA 4KMFA 2ZJ2A 1YG2A 1HW2A 2XHKA 3KEQA 3OV8A 5FFXA 3MFKA 4IVNA 5BOXA 5BS6A 1GXPA 3IWZA 3F22A 2NS0A 3GXOA 2P7CB 4RB3C 3COAC 2PEXA 4XBFA 4BXUA 4MTDA 3WODF 1O7FA 1XDUA 1F4KA 1V3FA 2DW4A 4AVPA 3HYIA 3RYPA 2R7DA 5LLQA 3KP4A 4GO1A 2M5WA 3DXJF 4A5MA 2CG4A 3L00A 3DEUA 2QQ9A 4UUVA 1ZG1A 4PGGA 2VBYA 3C7JA 1U8RA 2E1NA 1P4WA 2BBYA 2IRFG 1WQ2A 5TRDA 4ON0A 2QENA 1I5ZA 4CZZA 1QZYA 1JHFA 4KT5C 4ESFA 4ZYHA 2LF7A 4EV0A 3KLNA 2ADUA 4LLLA 4LG0B 1D5VA 1O3QA 1STZA 4ESJA 4B09A 4P9UA 1O3SA 2F5DA 4KYWA 4OMZA 3CUQB 1HSJA 4EVIA 1CF7B 2L54A 1UCRA 1FSEA 4WWCA 2VE8A 4HA8A 3RI4A 3J81K 4QLCU 1DPRA 3GFLA 3J80K 2HZTA 3R6SA 1U3EM 3F6VA 3WE2A 4N9HA 5D4RA 2OQRA 1RUOA 3BROA 1OKRA 4R8HA 4RGSA 3FZVA 1OPCA 2FE3A 2A07F 2P5KA 4IPAA 2B0LA 3LWFA 1EH8A 3TDUC 4S04A 4KN7X 4BYYA 4HBLA 3I5UA 3J81Z 1DPUA 3J80Z 2A3SA 3JSPA 2MBFA 1P4AA 1R7JA 2FNPA 3I54A 3SZPA 1YLFA 2ISZA 1IUYA 3V8JA 4HAMA 2XKPA 4HF1A 1G3YA 2XASA 2PQ8A 1YW9A 2YX7A 5JR3A 4L5JA 3O2PE 3KCCA 4I01A 1J7KA 3ML6A 2NYXA 2ACJA 5DCMA 2H6CA 3O6BB 3RTRA 1KU7A 3QAHA 4I98B 1YFHA 1ULYA 1HKQA 1AWCA 3LAPA 4LD5A 2CYYA 1K79A 1F5TA 3CJNA 3M1EA 3G3ZA 1FPQA 2VT2A 3HRTA 4FT8A 2VOOA 5E1XA 3DP7A 1KU2A 5TJJA 4LMYA 1WRJA 3LAJA 2RV8A 4I7HA 2M45A 4MQVA 4WXCA 5CVUA 4HF2A 1BI3A 2XAFA 2OU2A 3P9IA 2YPRA 3ELKA 5D8LB 4KIFA 3LFKA 3B73A 3LQRA 1Q1HA 3TQNA 4ZZDA 1MJAA 1DUXC 3M8FA 2VONA 2A5YB 2DQLA 4EJUA 5L3GA 3KP7A 1SMYF 2Q0OA 4Y15A 1GVJA 1YS7A 3BP8A 2ZO4A 2VE9A 1H9GA 2F5EA 2EV6A 3V7CA 2GQQA 3V4GA 2DO7A 2IP2A 2FXAA 2JSCA 4L0YB 1R5GA 3LA7A 4XSXF 1WKMA 3F8BA 3WTXC 3EYYA 3D5LA 2P7VB 4CGZA 3GWZA 3ZP5A 2HKXA 2O03A 3I59A 2DBBA 3I53A 1ZRCA 2DQRA 3BJAA 4P55A 5D4SA 1WSUA 4WXDA 4ZH4F 2W57A 3MAJA 1K6OA 3ZQ7A 1LDDA 3V7SA 2PBIA 1IN4A 3WTZA 1I1SA 5ILSA 3J7AO 1JHHA 2KIMA 4CO8A 1TQIA 2CGPA 2RGVA 1SAXA 1BBYA 4ZZLA 3GVAA 4N9IA 4KDPA 2BE5F 1FLIA 5FO5A 1MJ9A 1B1BA 1T6SA 2P4WA 3MQ0A 2NNYA 5EEHA 3ULQB 1T98A 4WF2A 2L3DA 2GWRA 1TNTA 1LVAA 3PFIA 1XCBA 1R1UA 2P6SA 1S7AA 2M1BA 2RQPA 3ZMDA 2QBYB 2UWMA 3V7RA 3HTSB 4WXHA 2W25A 3EUHA 3FXRA 4AIHA 3WGIA 3JW4A 2D2WA 1ZLJA 2F5FA 4HZFA 5JI6A 2MLGA 1ON1A 1C0WA 2EV5A 4E70A 4YFNF 4EQQA 1KYWA 3BPXA 5E8IA 1GXQA 3W6KB 2OZ6A 3TDZC 1I1GA 3M7GA 1MDMB 1KQ0A 5K5OA 2VXZA 3F8NA 5LEJA 2JZYA 2GA2A 2ZFWA 1IXCA 2IA1A 2TDXA 4FHTA 2EA4A 1WI9A 3BOQA 1TLHB 4NB5A 2FA5A 3FMSA 4HOBA 4MQ9F 2Z9OA 1TQMA 3HHHA 5H6RA 1HW5A 1R5HA 3JSOA 3GFIA 4IHSA 4AIKA 3BJ6A 2OAZA 3E97A 2F2EA 3HHGA 5FFZA 4HX8A 1BI0A 1HKSA 3N4MA 3E6MA 1XGOA 4U0YA 3GX4X 2M8EA 2W24A 1SFUA 1G3SA 3DV8A 1PP8F 1G6NA 1KU9A 2E7WA 5F64A 1J9IA 4G8XA 4GYIA 2XAGA 4I0BA 5ILUA 3HRSA 3C3WA 1ZGAA 2HR3A 3GUDA 5IT9K 1ZAOA 3GEZA 2RKHA 4A5NA 2EFPA 1GHCA 4EJOA 3QPTA 5J8FA 2RNJA 3GLXA 3TOBA 4LK1F 4AD9A 2DK5A 2KIFA 4L5IA 3DFGA 1T0FA 1ZN2A 4LB5A 4Q4ZF 3BZ6A 4ENMA 2QVOA 4UHTA 5IT9Z 4KA4A 3F72A 2XAQA 2Y75A 3G73A 1XGNA 1ZLKA 4EJWA 1ZG3A 3HUGA 2R3SA 2OD5A 2HTJA 4WX9A 4BNCA 4L18B 3FXUA 1RZ4A 3DKWA 4M74A 3WTSC 5ICCA 1Y0UA 2ZNZA 2VC0A 2FQ3A 1BJAA 2EB7A 2DI3A 4IJAA 1TQPA 1IN8A 2J5OA 3T0YA 3SQNA 2V1UA 1UHMA 1S6LA 1BN5A 2K7LA 2XRNA 3FF5A 5ILVA 1UHWA 5ED4A 1D3YA 1BI2A 1KQ8A 4XLPF 4EJTA 2C6YA 2PJPA 4B8XA 3REOA 2UXXA 4D0PA 2XROA 4UXNA 3K1PA 3K0LA 4FX4A 4EM2A 1P2FA 2JTVA 4OIRF 2RVCA 1MJBA 5LHIA 3E5UA 4I02A 3WTUC 2JPCA 4YFKF 4M6XA 1G4DA 4RB2C 1K7AA 1U5TA 2YSRA 4EMSA 5CVVA 2MA3A 4HDUA 2FMYA 3KZZA 1YW7A 2XAHA 3EETA 2GZWA 2OQGA 1ZRFA 4HLYA 4HQEA 2ZKZA 3PQKA 1LDKB 2G7UA 1BIAA 4BHPA 1EH7A 2ZBKA 2W84A 3KP5A 5BQTA 2IVMA 2IT0A 3IKVA 3Q5FA 1FYMA 5LRSA 2EWNA 2V9VA 3JTHA 2ZMEB 2BV6A 1RI7A 3ZMSA 2XIGA 1KA8A 3IHUA 3WU1B 3F23A 3GFJA 4KUMA 1JGSA 5L3BA 5KK1A 1Z9CA 1XMAA 3ZN0A 5JVTA 1FP2A 4G94A 2NRAC 2P8TA 3TKYA 1PUEE 4KIGA 3U2RA 5HS7A 5AIQA 3RJPA 3SXYA 4A2UA 4ENKA 4I09A 3KP3A 1A04A 3K69A 2Z3YA 2O3FA 3DF8A 4G7HF 3HSRA 3L09A 5CLSA 1ODDA 4M73A 1QPMA 5LGNA 2QLZA 3U9GA 3QU6A 2UXNA 2HTSA 2K02A 3D0SA 1F1ZA 2P6TA 2GA1A 3ECOA 4OU0A 3TO6A 1O3RA 4Q47A 4BHCA 2Y48A 3S2WA 3R60A 2H94A 5AONA 4LG0A 3ERED 1J75A 2FU4A 2ZCWA 3BPVA 2Q8KA 1EV7A 3I59B 3IWFA 2VODA 3CUQA 1CF7A 4M9ZA 2PMUA 5K1YA 2RC4A 3I64A 5JFRA 2VC1A 2VBXA 1BIBA 2L4MA 4L9TA 1KQ9A 1XGSA 5HLGA 5FLXZ 3T8TA 1U5TC 1Z6RA 4PCQA 2YR2A 1XCVA 4XSZF 4LB6B 1KYZA 3U1DA 4KNYA 4CHUA 4JK1X 4MTEA 3R61A 3NRVA 5F6FA 4G9YA 5LEKA 2D1HA 4HLXA 2EJRA 1KGSA 5H6QA 2NAZA 4GCVA 1QBJA 3FM5A 3B02A 4M9XA 3H3UA 2V1DA 5LRRA 4OINF 3EYIA 3CO6C 1RUNA 2CSOA 2Y0MA 1B59A 4ZYGA 2ZNYA 4ZYEA 1BC7C 1D8KA 2F5CA 4ASNA 2D45A 1W7PB 3HOSA 4KFCA 3GW2A 3DPTA 4RAYA 4RB0A 1TBXA 4LGWA 1LNWA 1R1VA 4IRGA 5KVRA 1YW8A 3VEPA 3SFZA 4JQFA 6PAXA 3KLOA 2LKPA 5CJ9A 4BHBA 1XMKA 2G9WA 3F8MA 2QZ8A 1J5YA 1MKMA 3FXQA 2YU3A 4CDGA 1U6GA 4ENNA 3L2CA 1FT9A 2CQKA 2STWA 1PDNC 4HQMA 4L0ZB 1SD4A 4L9JA 2HKOA 2WV0A 3QP6A 4ENJA 2UZKA 3F21A 3NEUA 2AS5F 1FYKA 3BDDA 3ECHA 2WC2A 1E17A 5HLHA 3I4PA 1PP7U 1T38A 4OMYA 1DDNA 3RKXA 2XV4S 1H0MA 1I6XA 2FBKA 1K78B 3DQVC 3GZ5A 3LQQA 3GFMA 2P5LC 3HRMA 3QOPA 3ABUA 1LEAA 1W5TA 2QWWA 3QPHA 5K5QA 1UB9A 4MEXF 1FBQA 4A6EA 2DTRA 2DK8A 3IRRA 2PG4A 2IJLA 1HBXG 4RGUA 2X0LA 3QU3A 3LA3A 3VOEA 1O57A 2A69F 5H20A 3KP2A 2EFWA 1OYWA 3HSFA 1T39A 1FY7A 4O6JA 5HDNA 1USSA 3F6OA 1BI1A 1B4AA 1W4MA 5D5WB 2KIUA 3QP5A 4Q48A 3CLOA 4JBAA 5K5RA 4P5OA 4CYDA 1ON2A 3VODA 5LHGA 5A2QZ 5ICFA 2LDUA 1Z7UA 1I27A 3K1MA 1HKTA 3FX3A 3MZHA 4U88A 2IW5A 2O8XA 1D8JA 2L02A 3I0TA 4MEYF 2EV0A 2MC3A 2DFIA 4PGHA 3KE2A 3WGHA 4R79A 5ERIA 3M8EA 1YTYA 2QBYA 2G7HA 1L0OC 3ZMZA 1FWZA 1R1TA 2JRTA 3CDHA 4IHTA 3WG9A 4LJZF 3IL2A 5D5XB 3FWEA 5DCFA 2VBZA 2M87A 1FX7A 1ZGJA 2HYGD 2HOEA 2WWYA 3BY6A 3KP6A 4UVAA 2DAOA 2IPQX 4L9VA 1SFXA 1IN5A 1MDMA 2ZXJA 3MEXA 4N0BA 3EDPA 2KKOA 5L3DA 4ETSA 3RKWA 1P92A 2CW0F 3WGGA 5LGTA 3QRFF 2BGCA 1KU3A 3K2ZA 5BMZA 2V6CA 1HSTA 1W7PD 5ICEA 3C18A 5L3EA 4RB1A 1U5TB 2LF8A 5DD4A 5F1RA 2KJCA 1ZYRF 3O3KA 2FEZA 2VT3A 1S8NA 2A6HF 1B6AA 1P6RA 1SD6A 1LEBA 2PLYA 1SMTA 3WTWC 2FNAA 2EFQA 2FOKA 5DEQA 5J6XA 1R23A 1J2XA 2PN6A 3OOPA 2DPDA 3T8RA 2ESNA 1FBUA 2HDCA 2Z33A 5AIPA 1IXSB 1ZG5A 4I0AA 3HIFA 4OIPF 3CO7C 2OBPA 2HGCA 3E6CC 1R58A 2HFHA 1IRGA 3R0JA 3E6DA 1MGTA 3Q9SA 4PZJA 3MCZA 2AXLA 4M6YA 5CVIA 3CTAA 1FC3A 2ELHA 4HDVA 5HLIA 1F9NA 2XKOA 5CVRA 1T2KA 1G3TA 1YYVA 2EFOA 2QM3A 4AWXB 2HS5A 4EJVA 5CVJA 1IW7F 4UV8A 1Z6TA 4OIOF 1B9NA 3FMQA 3V8LA 3RPQA 1IRFA 3KETA 5D6FA 1W5SA 2V79A 3TOAA 3T5XA 1TW3A 2XUBA 2RN7A 2PMHA 3MZYA 1USTA 1R36A 3Q9VA 1RIOH 2O6GE 4G6QA 4A6DA 2VN2A 2O61A 5DYMA 4YFXF 2KJBA 4KIBA 3AAFA 3ZN1A 5DCMB 3E3VA 1E2XA 4MNUA 1ZH5A 4KN4X 3F8CA 4HW0A 1YO5C 4Q5SF 4O5VA 4U0VA 5CYVA 1IZ1A 2EK5A 3L9FA 2MH2A 2EFNA 4H0EA 4L9NA 3SHFA 1XSVA 2K27A 2H6BA 1DP7P 1FOKA 5FB2A 1ZARA 4WCGA 2EA2A 2HQNA 1FZPB 1HW1A 1IN6A 4BQAA 4R1HA 4OOIA 4G7OF 2QQAA 4ZYDA 3GYHX 2KRFA 2XGXA 4LLGF 4QWQA 1WWXA 3W6JB 1HXDA 5L3FA 2CWEA 2VBWA 1O3TA 3GF2A 1QNTA 5HDGA 4YG2F 5BPDA 3VFZA 1R00A 1IAWA 3F3XA 4NQWA 5EEGA 3KFWX 2DT5A 1YS6A 1BM9A 2GIVA 3HTUA 4Y17A 1O7LA 4CICA 2V1XA 1OYYA 1SD5A 1LDJA 2IA2A 4YIIA 1TTYA 1EH6A 5E18F 1X3UA 2FMLA 3ISPA 5FLXK 4GGGA 3L7WA 3BWGA 3IRQA 1XB4A 1G3WA 1L3LA 2Z5UA 3IKTA 3E6BA 4MHGA 4CXFA 3RYRA 3CUOA 1S3JA 2J5PA 4AIJA 1AOYA 3TGNA 2DPUA 2Q2EA 1OYIA 1S7OA 1YIOA 2H27A 4A0ZA 3K9TA 1FBSA 2HWVA 3P9CA 3DPLC 5DUIA 2D1VA 5FD5A 5HVQC 3RKYA 2JT1A 3ZMVA 1S29A 2A68F 5E17F 1B9MA 2FBHA 5DV5A 2ZMEA 1YQAA 1UFMA 3ROUA 2XAJA 4HV5A 5LBQA 1ZHFA 4GYGA 3H3ZA 5DDGA 5E1WA 5D5UB 3N97A 1J0RA 2MD5A 3KEOA 4LLNA 2ESHA 2FBIA 4FX0A 1U78A 2E1CA 1HQCA 1V4RA 1NHAA 1OMIA 2L4AA 4GXOA 4O3MA 3WTVC 4WK8F 1Z05A 1FP1D 4EGZA 2MH9A 4A0XA 5LGUA 3V8KA 5DUKA 3E5QA 4A0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J59 A;  3GZ6 A;  4U7B A;  2K4B A;  4M9S A;  1Z1D A;  3SZT A;  2QUF A;  4UVB A;  3RDI A;  5DD8 A;  2FSW A;  4Y13 A;  3P9K A;  4U7D A;  1QQI A;  5D8K B;  3HRU A;  2STT A;  2WTE A;  1SD7 A;  1XD7 A;  3MWM A;  5HS8 A;  4HX4 A;  1QO0 D;  4I2O A;  1P4X A;  2RDP A;  4RGX A;  3VB2 A;  1FYL A;  4F7Z A;  1CGP A;  2DLL A;  2MLK A;  3ABT A;  4OIQ F;  4IRH A;  2JPB A;  5BPI A;  2VOP A;  4Z2Y A;  4S05 A;  2GXB A;  2ETH A;  3EQL F;  2FRH A;  5L3C A;  2HQR A;  2M30 A;  1R22 A;  1LQ1 A;  2XVC A;  2BYV E;  3BJO A;  1MZB A;  2X4H A;  4G7Z F;  3CUQ C;  4KMU X;  5HS9 A;  3RPU A;  3RIR A;  4G6D A;  3K1N A;  2IA0 A;  3KZY A;  2HYF A;  4DNC A;  1RNL A;  4P96 A;  4NHJ A;  2H09 A;  3LA2 A;  3TO9 A;  2YX4 A;  4HF0 A;  5IT3 A;  1FSH A;  4M72 A;  1W7P A;  2QQB A;  1XSD A;  1JXS A;  2A61 A;  4XRF A;  2GAU A;  1QGP A;  2LNB A;  3GO5 A;  1XDS A;  1H9T A;  4U0W A;  2NNN A;  2QYO A;  5A2Q K;  3FM3 A;  3P7N A;  4EM0 B;  1XGM A;  3E5X A;  1IN7 A;  2FF4 A;  4P9F A;  2PFB A;  1IXR C;  4HV6 A;  5JHU A;  4UNO A;  5J8C A;  4EGY A;  1QZZ A;  1FNN A;  4BAY A;  2A6E F;  4HX7 A;  1JE8 A;  5ICG A;  4RGR A;  2E7X A;  4BH9 A;  1BC8 C;  3C1D A;  2CFX A;  2HEO A;  1ONV A;  4A12 A;  3WE3 A;  2R7F A;  3F8F A;  3HSE A;  4UVC A;  1TNS A;  4YIF A;  3FHZ A;  4DQ2 A;  2GXG A;  2PI0 A;  2OZU A;  2BEO A;  4LK0 F;  2LSO A;  1XN7 A;  4HYE A;  4IF4 A;  3IC7 A;  3R4K A;  2W85 A;  1LB2 A;  1K78 A;  1BOA A;  1VTN C;  5HOO A;  2L01 A;  2OA4 A;  2P5V A;  3H92 A;  3WU0 A;  3TO7 A;  3ZPL A;  3I58 A;  5FD6 A;  3T1B A;  3ZMT A;  4ESB A;  1ZRE A;  5FGM A;  1IF1 A;  2K4J A;  3ZMU A;  2CO5 A;  3LST A;  1LJ9 A;  1ZRD A;  3WTY C;  5D5V B;  3R0A A;  4IXA A;  3WTT C;  1SFE A;  3JAM K;  3HOT A;  1TW2 A;  4UV9 A;  1XSX A;  2O0Y A;  4RAZ A;  3FMR A;  4XLN F;  4EM1 A;  5LHH A;  3PQJ A;  4M71 A;  2COM A;  5E1Z B;  3NQO A;  1MD0 A;  4PDK A;  4IRI A;  1OR7 A;  5HDK A;  2K86 A;  3JAM Z;  2ISY A;  1Z91 A;  5E20 A;  4TV7 A;  4LFU A;  1U2W A;  5D6E A;  3M9A A;  2Z99 A;  5E8G A;  3I71 A;  2DU9 A;  4MGR A;  4KIC A;  1REP C;  4K2E A;  4RS8 A;  3JTG A;  4KMF A;  2ZJ2 A;  1YG2 A;  1HW2 A;  2XHK A;  3KEQ A;  3OV8 A;  5FFX A;  3MFK A;  4IVN A;  5BOX A;  5BS6 A;  1GXP A;  3IWZ A;  3F22 A;  2NS0 A;  3GXO A;  2P7C B;  4RB3 C;  3COA C;  2PEX A;  4XBF A;  4BXU A;  4MTD A;  3WOD F;  1O7F A;  1XDU A;  1F4K A;  1V3F A;  2DW4 A;  4AVP A;  3HYI A;  3RYP A;  2R7D A;  5LLQ A;  3KP4 A;  4GO1 A;  2M5W A;  3DXJ F;  4A5M A;  2CG4 A;  3L00 A;  3DEU A;  2QQ9 A;  4UUV A;  1ZG1 A;  4PGG A;  2VBY A;  3C7J A;  1U8R A;  2E1N A;  1P4W A;  2BBY A;  2IRF G;  1WQ2 A;  5TRD A;  4ON0 A;  2QEN A;  1I5Z A;  4CZZ A;  1QZY A;  1JHF A;  4KT5 C;  4ESF A;  4ZYH A;  2LF7 A;  4EV0 A;  3KLN A;  2ADU A;  4LLL A;  4LG0 B;  1D5V A;  1O3Q A;  1STZ A;  4ESJ A;  4B09 A;  4P9U A;  1O3S A;  2F5D A;  4KYW A;  4OMZ A;  3CUQ B;  1HSJ A;  4EVI A;  1CF7 B;  2L54 A;  1UCR A;  1FSE A;  4WWC A;  2VE8 A;  4HA8 A;  3RI4 A;  3J81 K;  4QLC U;  1DPR A;  3GFL A;  3J80 K;  2HZT A;  3R6S A;  1U3E M;  3F6V A;  3WE2 A;  4N9H A;  5D4R A;  2OQR A;  1RUO A;  3BRO A;  1OKR A;  4R8H A;  4RGS A;  3FZV A;  1OPC A;  2FE3 A;  2A07 F;  2P5K A;  4IPA A;  2B0L A;  3LWF A;  1EH8 A;  3TDU C;  4S04 A;  4KN7 X;  4BYY A;  4HBL A;  3I5U A;  3J81 Z;  1DPU A;  3J80 Z;  2A3S A;  3JSP A;  2MBF A;  1P4A A;  1R7J A;  2FNP A;  3I54 A;  3SZP A;  1YLF A;  2ISZ A;  1IUY A;  3V8J A;  4HAM A;  2XKP A;  4HF1 A;  1G3Y A;  2XAS A;  2PQ8 A;  1YW9 A;  2YX7 A;  5JR3 A;  4L5J A;  3O2P E;  3KCC A;  4I01 A;  1J7K A;  3ML6 A;  2NYX A;  2ACJ A;  5DCM A;  2H6C A;  3O6B B;  3RTR A;  1KU7 A;  3QAH A;  4I98 B;  1YFH A;  1ULY A;  1HKQ A;  1AWC A;  3LAP A;  4LD5 A;  2CYY A;  1K79 A;  1F5T A;  3CJN A;  3M1E A;  3G3Z A;  1FPQ A;  2VT2 A;  3HRT A;  4FT8 A;  2VOO A;  5E1X A;  3DP7 A;  1KU2 A;  5TJJ A;  4LMY A;  1WRJ A;  3LAJ A;  2RV8 A;  4I7H A;  2M45 A;  4MQV A;  4WXC A;  5CVU A;  4HF2 A;  1BI3 A;  2XAF A;  2OU2 A;  3P9I A;  2YPR A;  3ELK A;  5D8L B;  4KIF A;  3LFK A;  3B73 A;  3LQR A;  1Q1H A;  3TQN A;  4ZZD A;  1MJA A;  1DUX C;  3M8F A;  2VON A;  2A5Y B;  2DQL A;  4EJU A;  5L3G A;  3KP7 A;  1SMY F;  2Q0O A;  4Y15 A;  1GVJ A;  1YS7 A;  3BP8 A;  2ZO4 A;  2VE9 A;  1H9G A;  2F5E A;  2EV6 A;  3V7C A;  2GQQ A;  3V4G A;  2DO7 A;  2IP2 A;  2FXA A;  2JSC A;  4L0Y B;  1R5G A;  3LA7 A;  4XSX F;  1WKM A;  3F8B A;  3WTX C;  3EYY A;  3D5L A;  2P7V B;  4CGZ A;  3GWZ A;  3ZP5 A;  2HKX A;  2O03 A;  3I59 A;  2DBB A;  3I53 A;  1ZRC A;  2DQR A;  3BJA A;  4P55 A;  5D4S A;  1WSU A;  4WXD A;  4ZH4 F;  2W57 A;  3MAJ A;  1K6O A;  3ZQ7 A;  1LDD A;  3V7S A;  2PBI A;  1IN4 A;  3WTZ A;  1I1S A;  5ILS A;  3J7A O;  1JHH A;  2KIM A;  4CO8 A;  1TQI A;  2CGP A;  2RGV A;  1SAX A;  1BBY A;  4ZZL A;  3GVA A;  4N9I A;  4KDP A;  2BE5 F;  1FLI A;  5FO5 A;  1MJ9 A;  1B1B A;  1T6S A;  2P4W A;  3MQ0 A;  2NNY A;  5EEH A;  3ULQ B;  1T98 A;  4WF2 A;  2L3D A;  2GWR A;  1TNT A;  1LVA A;  3PFI A;  1XCB A;  1R1U A;  2P6S A;  1S7A A;  2M1B A;  2RQP A;  3ZMD A;  2QBY B;  2UWM A;  3V7R A;  3HTS B;  4WXH A;  2W25 A;  3EUH A;  3FXR A;  4AIH A;  3WGI A;  3JW4 A;  2D2W A;  1ZLJ A;  2F5F A;  4HZF A;  5JI6 A;  2MLG A;  1ON1 A;  1C0W A;  2EV5 A;  4E70 A;  4YFN F;  4EQQ A;  1KYW A;  3BPX A;  5E8I A;  1GXQ A;  3W6K B;  2OZ6 A;  3TDZ C;  1I1G A;  3M7G A;  1MDM B;  1KQ0 A;  5K5O A;  2VXZ A;  3F8N A;  5LEJ A;  2JZY A;  2GA2 A;  2ZFW A;  1IXC A;  2IA1 A;  2TDX A;  4FHT A;  2EA4 A;  1WI9 A;  3BOQ A;  1TLH B;  4NB5 A;  2FA5 A;  3FMS A;  4HOB A;  4MQ9 F;  2Z9O A;  1TQM A;  3HHH A;  5H6R A;  1HW5 A;  1R5H A;  3JSO A;  3GFI A;  4IHS A;  4AIK A;  3BJ6 A;  2OAZ A;  3E97 A;  2F2E A;  3HHG A;  5FFZ A;  4HX8 A;  1BI0 A;  1HKS A;  3N4M A;  3E6M A;  1XGO A;  4U0Y A;  3GX4 X;  2M8E A;  2W24 A;  1SFU A;  1G3S A;  3DV8 A;  1PP8 F;  1G6N A;  1KU9 A;  2E7W A;  5F64 A;  1J9I A;  4G8X A;  4GYI A;  2XAG A;  4I0B A;  5ILU A;  3HRS A;  3C3W A;  1ZGA A;  2HR3 A;  3GUD A;  5IT9 K;  1ZAO A;  3GEZ A;  2RKH A;  4A5N A;  2EFP A;  1GHC A;  4EJO A;  3QPT A;  5J8F A;  2RNJ A;  3GLX A;  3TOB A;  4LK1 F;  4AD9 A;  2DK5 A;  2KIF A;  4L5I A;  3DFG A;  1T0F A;  1ZN2 A;  4LB5 A;  4Q4Z F;  3BZ6 A;  4ENM A;  2QVO A;  4UHT A;  5IT9 Z;  4KA4 A;  3F72 A;  2XAQ A;  2Y75 A;  3G73 A;  1XGN A;  1ZLK A;  4EJW A;  1ZG3 A;  3HUG A;  2R3S A;  2OD5 A;  2HTJ A;  4WX9 A;  4BNC A;  4L18 B;  3FXU A;  1RZ4 A;  3DKW A;  4M74 A;  3WTS C;  5ICC A;  1Y0U A;  2ZNZ A;  2VC0 A;  2FQ3 A;  1BJA A;  2EB7 A;  2DI3 A;  4IJA A;  1TQP A;  1IN8 A;  2J5O A;  3T0Y A;  3SQN A;  2V1U A;  1UHM A;  1S6L A;  1BN5 A;  2K7L A;  2XRN A;  3FF5 A;  5ILV A;  1UHW A;  5ED4 A;  1D3Y A;  1BI2 A;  1KQ8 A;  4XLP F;  4EJT A;  2C6Y A;  2PJP A;  4B8X A;  3REO A;  2UXX A;  4D0P A;  2XRO A;  4UXN A;  3K1P A;  3K0L A;  4FX4 A;  4EM2 A;  1P2F A;  2JTV A;  4OIR F;  2RVC A;  1MJB A;  5LHI A;  3E5U A;  4I02 A;  3WTU C;  2JPC A;  4YFK F;  4M6X A;  1G4D A;  4RB2 C;  1K7A A;  1U5T A;  2YSR A;  4EMS A;  5CVV A;  2MA3 A;  4HDU A;  2FMY A;  3KZZ A;  1YW7 A;  2XAH A;  3EET A;  2GZW A;  2OQG A;  1ZRF A;  4HLY A;  4HQE A;  2ZKZ A;  3PQK A;  1LDK B;  2G7U A;  1BIA A;  4BHP A;  1EH7 A;  2ZBK A;  2W84 A;  3KP5 A;  5BQT A;  2IVM A;  2IT0 A;  3IKV A;  3Q5F A;  1FYM A;  5LRS A;  2EWN A;  2V9V A;  3JTH A;  2ZME B;  2BV6 A;  1RI7 A;  3ZMS A;  2XIG A;  1KA8 A;  3IHU A;  3WU1 B;  3F23 A;  3GFJ A;  4KUM A;  1JGS A;  5L3B A;  5KK1 A;  1Z9C A;  1XMA A;  3ZN0 A;  5JVT A;  1FP2 A;  4G94 A;  2NRA C;  2P8T A;  3TKY A;  1PUE E;  4KIG A;  3U2R A;  5HS7 A;  5AIQ A;  3RJP A;  3SXY A;  4A2U A;  4ENK A;  4I09 A;  3KP3 A;  1A04 A;  3K69 A;  2Z3Y A;  2O3F A;  3DF8 A;  4G7H F;  3HSR A;  3L09 A;  5CLS A;  1ODD A;  4M73 A;  1QPM A;  5LGN A;  2QLZ A;  3U9G A;  3QU6 A;  2UXN A;  2HTS A;  2K02 A;  3D0S A;  1F1Z A;  2P6T A;  2GA1 A;  3ECO A;  4OU0 A;  3TO6 A;  1O3R A;  4Q47 A;  4BHC A;  2Y48 A;  3S2W A;  3R60 A;  2H94 A;  5AON A;  4LG0 A;  3ERE D;  1J75 A;  2FU4 A;  2ZCW A;  3BPV A;  2Q8K A;  1EV7 A;  3I59 B;  3IWF A;  2VOD A;  3CUQ A;  1CF7 A;  4M9Z A;  2PMU A;  5K1Y A;  2RC4 A;  3I64 A;  5JFR A;  2VC1 A;  2VBX A;  1BIB A;  2L4M A;  4L9T A;  1KQ9 A;  1XGS A;  5HLG A;  5FLX Z;  3T8T A;  1U5T C;  1Z6R A;  4PCQ A;  2YR2 A;  1XCV A;  4XSZ F;  4LB6 B;  1KYZ A;  3U1D A;  4KNY A;  4CHU A;  4JK1 X;  4MTE A;  3R61 A;  3NRV A;  5F6F A;  4G9Y A;  5LEK A;  2D1H A;  4HLX A;  2EJR A;  1KGS A;  5H6Q A;  2NAZ A;  4GCV A;  1QBJ A;  3FM5 A;  3B02 A;  4M9X A;  3H3U A;  2V1D A;  5LRR A;  4OIN F;  3EYI A;  3CO6 C;  1RUN A;  2CSO A;  2Y0M A;  1B59 A;  4ZYG A;  2ZNY A;  4ZYE A;  1BC7 C;  1D8K A;  2F5C A;  4ASN A;  2D45 A;  1W7P B;  3HOS A;  4KFC A;  3GW2 A;  3DPT A;  4RAY A;  4RB0 A;  1TBX A;  4LGW A;  1LNW A;  1R1V A;  4IRG A;  5KVR A;  1YW8 A;  3VEP A;  3SFZ A;  4JQF A;  6PAX A;  3KLO A;  2LKP A;  5CJ9 A;  4BHB A;  1XMK A;  2G9W A;  3F8M A;  2QZ8 A;  1J5Y A;  1MKM A;  3FXQ A;  2YU3 A;  4CDG A;  1U6G A;  4ENN A;  3L2C A;  1FT9 A;  2CQK A;  2STW A;  1PDN C;  4HQM A;  4L0Z B;  1SD4 A;  4L9J A;  2HKO A;  2WV0 A;  3QP6 A;  4ENJ A;  2UZK A;  3F21 A;  3NEU A;  2AS5 F;  1FYK A;  3BDD A;  3ECH A;  2WC2 A;  1E17 A;  5HLH A;  3I4P A;  1PP7 U;  1T38 A;  4OMY A;  1DDN A;  3RKX A;  2XV4 S;  1H0M A;  1I6X A;  2FBK A;  1K78 B;  3DQV C;  3GZ5 A;  3LQQ A;  3GFM A;  2P5L C;  3HRM A;  3QOP A;  3ABU A;  1LEA A;  1W5T A;  2QWW A;  3QPH A;  5K5Q A;  1UB9 A;  4MEX F;  1FBQ A;  4A6E A;  2DTR A;  2DK8 A;  3IRR A;  2PG4 A;  2IJL A;  1HBX G;  4RGU A;  2X0L A;  3QU3 A;  3LA3 A;  3VOE A;  1O57 A;  2A69 F;  5H20 A;  3KP2 A;  2EFW A;  1OYW A;  3HSF A;  1T39 A;  1FY7 A;  4O6J A;  5HDN A;  1USS A;  3F6O A;  1BI1 A;  1B4A A;  1W4M A;  5D5W B;  2KIU A;  3QP5 A;  4Q48 A;  3CLO A;  4JBA A;  5K5R A;  4P5O A;  4CYD A;  1ON2 A;  3VOD A;  5LHG A;  5A2Q Z;  5ICF A;  2LDU A;  1Z7U A;  1I27 A;  3K1M A;  1HKT A;  3FX3 A;  3MZH A;  4U88 A;  2IW5 A;  2O8X A;  1D8J A;  2L02 A;  3I0T A;  4MEY F;  2EV0 A;  2MC3 A;  2DFI A;  4PGH A;  3KE2 A;  3WGH A;  4R79 A;  5ERI A;  3M8E A;  1YTY A;  2QBY A;  2G7H A;  1L0O C;  3ZMZ A;  1FWZ A;  1R1T A;  2JRT A;  3CDH A;  4IHT A;  3WG9 A;  4LJZ F;  3IL2 A;  5D5X B;  3FWE A;  5DCF A;  2VBZ A;  2M87 A;  1FX7 A;  1ZGJ A;  2HYG D;  2HOE A;  2WWY A;  3BY6 A;  3KP6 A;  4UVA A;  2DAO A;  2IPQ X;  4L9V A;  1SFX A;  1IN5 A;  1MDM A;  2ZXJ A;  3MEX A;  4N0B A;  3EDP A;  2KKO A;  5L3D A;  4ETS A;  3RKW A;  1P92 A;  2CW0 F;  3WGG A;  5LGT A;  3QRF F;  2BGC A;  1KU3 A;  3K2Z A;  5BMZ A;  2V6C A;  1HST A;  1W7P D;  5ICE A;  3C18 A;  5L3E A;  4RB1 A;  1U5T B;  2LF8 A;  5DD4 A;  5F1R A;  2KJC A;  1ZYR F;  3O3K A;  2FEZ A;  2VT3 A;  1S8N A;  2A6H F;  1B6A A;  1P6R A;  1SD6 A;  1LEB A;  2PLY A;  1SMT A;  3WTW C;  2FNA A;  2EFQ A;  2FOK A;  5DEQ A;  5J6X A;  1R23 A;  1J2X A;  2PN6 A;  3OOP A;  2DPD A;  3T8R A;  2ESN A;  1FBU A;  2HDC A;  2Z33 A;  5AIP A;  1IXS B;  1ZG5 A;  4I0A A;  3HIF A;  4OIP F;  3CO7 C;  2OBP A;  2HGC A;  3E6C C;  1R58 A;  2HFH A;  1IRG A;  3R0J A;  3E6D A;  1MGT A;  3Q9S A;  4PZJ A;  3MCZ A;  2AXL A;  4M6Y A;  5CVI A;  3CTA A;  1FC3 A;  2ELH A;  4HDV A;  5HLI A;  1F9N A;  2XKO A;  5CVR A;  1T2K A;  1G3T A;  1YYV A;  2EFO A;  2QM3 A;  4AWX B;  2HS5 A;  4EJV A;  5CVJ A;  1IW7 F;  4UV8 A;  1Z6T A;  4OIO F;  1B9N A;  3FMQ A;  3V8L A;  3RPQ A;  1IRF A;  3KET A;  5D6F A;  1W5S A;  2V79 A;  3TOA A;  3T5X A;  1TW3 A;  2XUB A;  2RN7 A;  2PMH A;  3MZY A;  1UST A;  1R36 A;  3Q9V A;  1RIO H;  2O6G E;  4G6Q A;  4A6D A;  2VN2 A;  2O61 A;  5DYM A;  4YFX F;  2KJB A;  4KIB A;  3AAF A;  3ZN1 A;  5DCM B;  3E3V A;  1E2X A;  4MNU A;  1ZH5 A;  4KN4 X;  3F8C A;  4HW0 A;  1YO5 C;  4Q5S F;  4O5V A;  4U0V A;  5CYV A;  1IZ1 A;  2EK5 A;  3L9F A;  2MH2 A;  2EFN A;  4H0E A;  4L9N A;  3SHF A;  1XSV A;  2K27 A;  2H6B A;  1DP7 P;  1FOK A;  5FB2 A;  1ZAR A;  4WCG A;  2EA2 A;  2HQN A;  1FZP B;  1HW1 A;  1IN6 A;  4BQA A;  4R1H A;  4OOI A;  4G7O F;  2QQA A;  4ZYD A;  3GYH X;  2KRF A;  2XGX A;  4LLG F;  4QWQ A;  1WWX A;  3W6J B;  1HXD A;  5L3F A;  2CWE A;  2VBW A;  1O3T A;  3GF2 A;  1QNT A;  5HDG A;  4YG2 F;  5BPD A;  3VFZ A;  1R00 A;  1IAW A;  3F3X A;  4NQW A;  5EEG A;  3KFW X;  2DT5 A;  1YS6 A;  1BM9 A;  2GIV A;  3HTU A;  4Y17 A;  1O7L A;  4CIC A;  2V1X A;  1OYY A;  1SD5 A;  1LDJ A;  2IA2 A;  4YII A;  1TTY A;  1EH6 A;  5E18 F;  1X3U A;  2FML A;  3ISP A;  5FLX K;  4GGG A;  3L7W A;  3BWG A;  3IRQ A;  1XB4 A;  1G3W A;  1L3L A;  2Z5U A;  3IKT A;  3E6B A;  4MHG A;  4CXF A;  3RYR A;  3CUO A;  1S3J A;  2J5P A;  4AIJ A;  1AOY A;  3TGN A;  2DPU A;  2Q2E A;  1OYI A;  1S7O A;  1YIO A;  2H27 A;  4A0Z A;  3K9T A;  1FBS A;  2HWV A;  3P9C A;  3DPL C;  5DUI A;  2D1V A;  5FD5 A;  5HVQ C;  3RKY A;  2JT1 A;  3ZMV A;  1S29 A;  2A68 F;  5E17 F;  1B9M A;  2FBH A;  5DV5 A;  2ZME A;  1YQA A;  1UFM A;  3ROU A;  2XAJ A;  4HV5 A;  5LBQ A;  1ZHF A;  4GYG A;  3H3Z A;  5DDG A;  5E1W A;  5D5U B;  3N97 A;  1J0R A;  2MD5 A;  3KEO A;  4LLN A;  2ESH A;  2FBI A;  4FX0 A;  1U78 A;  2E1C A;  1HQC A;  1V4R A;  1NHA A;  1OMI A;  2L4A A;  4GXO A;  4O3M A;  3WTV C;  4WK8 F;  1Z05 A;  1FP1 D;  4EGZ A;  2MH9 A;  4A0X A;  5LGU A;  3V8K A;  5DUK A;  3E5Q A;  4A0Y A; 
#chains in the Genus database with same CATH topology
 3LSJ A;  2E5Z A;  1J59 A;  3GZ6 A;  4U7B A;  2K4B A;  3A0H C;  3VPR A;  4M9S A;  2ECC A;  3W6V A;  2HVS A;  1Z1D A;  1OCR H;  4XLE A;  1S9H A;  3SZT A;  2YU9 J;  1MW7 A;  1X3W B;  2QUF A;  2DMT A;  2ICW G;  4UVB A;  2HOS A;  2K3F A;  3RDI A;  1W0T A;  4IHY A;  4DZJ A;  1JT0 A;  2MD0 A;  1MH4 A;  4W1U A;  1WJB A;  3BR2 A;  2FSW A;  5DD8 A;  4Y13 A;  5EGO A;  3P9K A;  1R4M B;  3M1C A;  4U7D A;  4QPQ A;  2LKX A;  1QQI A;  2H8W A;  5D8K B;  2V7F A;  4X0G A;  3OYL A;  3HRU A;  2STT A;  2WTE A;  1NTC A;  3IH3 A;  1MND A;  1SD7 A;  2ZFU A;  1XD7 A;  3MWM A;  3JR9 A;  5HS8 A;  4HX4 A;  1YHQ I;  3PSI A;  1QO0 D;  4CYC A;  4BY1 J;  4I2O A;  1DQU A;  1P4X A;  2V6E A;  2RDP A;  1TWG J;  4RGX A;  3VB2 A;  1FYL A;  4F7Z A;  1GDT A;  3FHN A;  3FBI B;  1CGP A;  2DLL A;  1OFC X;  2MLK A;  2HVR A;  3ABT A;  1RPW A;  4OIQ F;  4IRH A;  2JPB A;  4Y4R A;  5BPI A;  1SAU A;  3M4O J;  2R7R A;  1WJD A;  2VOP A;  1LFB A;  4Z2Y A;  2ZXI A;  4KIT B;  3H5N A;  4S05 A;  2GXB A;  2ETH A;  3EQL F;  2FRH A;  5L3C A;  3RZD J;  2HQR A;  2M30 A;  1RR7 A;  3ZQH A;  4J01 A;  1R22 A;  1LQ1 A;  2Y2Z A;  2IBD A;  3SFI A;  5J40 A;  2XVC A;  2BYV E;  3BJO A;  1MZB A;  1W5C C;  3DTK A;  2F5V A;  2JSP A;  1TT0 A;  2X4H A;  3G4S I;  4A3F J;  4G7Z F;  3CUQ C;  4KMU X;  5HS9 A;  3RPU A;  3RIR A;  4G6D A;  1ITY A;  3K1N A;  2IA0 A;  3B6C A;  3KZY A;  2HYF A;  1ETX A;  2R7Z J;  1S5L C;  4DNC A;  1RNL A;  2EH3 A;  4P96 A;  3GZN B;  2V9P A;  4NHJ A;  2H09 A;  3LA2 A;  2HOA A;  3TO9 A;  1HDD C;  2YX4 A;  3OL4 A;  4HF0 A;  5IT3 A;  1UG0 A;  3CCS I;  4FQG A;  2JVH A;  4LOC A;  4C30 A;  1FSH A;  1VND A;  3OSG A;  2VLA A;  1PUF B;  4M72 A;  1YJW I;  2F4M B;  4ZTF A;  3HOZ J;  1W7P A;  2QQB A;  5DS9 A;  1XSD A;  2A61 A;  1JXS A;  4XQF A;  2CW7 A;  4XRF A;  2NVY J;  2GAU A;  3IH2 A;  1QGP A;  1SVO A;  4XLC A;  4D7N A;  2FOW A;  2LNB A;  3QPS A;  3GO5 A;  2DMN A;  1XDS A;  1N25 A;  1H9T A;  4U0W A;  5BNG A;  2LVS A;  3OYC A;  2E60 A;  2AXT C;  2NNN A;  1GUU A;  2QYO A;  2K3P A;  5A2Q K;  2DT6 A;  3FM3 A;  3P7N A;  2M2E A;  4EM0 B;  1XGM A;  5E3M A;  2E5N A;  3W3C A;  4M3G A;  3E5X A;  2BY1 A;  1IN7 A;  4UUS A;  4A3J J;  2FF4 A;  4P9F A;  4LG3 A;  2PFB A;  2OCC H;  1IXR C;  5EG0 B;  1B8I A;  1JGG A;  1AHD P;  4HV6 A;  5JHU A;  2IGO A;  2B9S A;  4E7I A;  4UNO A;  5CQG A;  5J8C A;  2GM4 A;  4EGY A;  1QZZ A;  1I6H J;  1FNN A;  4BAY A;  3CMA I;  2A6E F;  1IUF A;  4HX7 A;  3JRI A;  3OY9 A;  2Y9Z A;  5ICG A;  1JE8 A;  4RGR A;  5B1A H;  1LKX A;  2E7X A;  4BH9 A;  3IP4 B;  1F36 A;  1BC8 C;  3C1D A;  1K4S A;  1PJR A;  2CFX A;  2HEO A;  1UEL B;  1ONV A;  2BVL A;  4A12 A;  3WE3 A;  2FX0 A;  2R7Q A;  2OV7 A;  2L7F P;  2R7F A;  3OYH A;  3F8F A;  3HSE A;  3ZQQ A;  3J7Z I;  3CCL I;  3CJR B;  2JA8 J;  4ZYA A;  1MMS A;  4UVC A;  1YI2 I;  1TNS A;  2WY7 Q;  3CCV I;  4YIF A;  2LR8 A;  4RAF A;  4DQ2 A;  3FHZ A;  2GXG A;  2K85 A;  2PI0 A;  5LFA A;  2OZU A;  4XKV A;  1DP3 A;  2BEO A;  2PJR A;  4LK0 F;  4E6K G;  2A05 A;  2LSO A;  3VYT B;  1XN7 A;  2L7M P;  4HYE A;  5H2F C;  4IF4 A;  2CW8 A;  4A3M J;  2QF7 A;  5DM6 F;  4YRV A;  2M4G A;  3IC7 A;  1N78 A;  3R4K A;  2NS7 A;  2W85 A;  3DBR B;  5LD2 C;  4OAZ A;  1XPX A;  1LB2 A;  1K78 A;  1JUS A;  1BOA A;  5HNF A;  1VTN C;  2DOE A;  2L01 A;  2OA4 A;  5HOO A;  3LSI A;  2P5V A;  2X6X A;  2F48 A;  4CZC A;  1I39 A;  3H92 A;  2IGK A;  3WU0 A;  4BGD A;  1VQP I;  1OCO H;  2AQE A;  3TO7 A;  2O9L A;  4NC7 A;  1FIP A;  3ZPL A;  3I58 A;  5FD6 A;  3T1B A;  3CF2 A;  2ELJ A;  1BJZ A;  1RC9 A;  3ZMT A;  2EZI A;  4ESB A;  1ZRE A;  5FGM A;  1IF1 A;  2K4J A;  3ZMU A;  2CO5 A;  3LST A;  4FIS A;  4A3K J;  1LJ9 A;  2CQ7 A;  2XRL A;  1ZRD A;  1J09 A;  3WTY C;  2LH9 A;  1ZKG A;  4PSW A;  5D5V B;  1IV6 A;  3R0A A;  4IXA A;  3WTT C;  1SFE A;  1XX5 A;  1A6Q A;  1RES A;  4PK4 A;  2JRM A;  3DU5 A;  3I4N J;  2DA1 A;  1HA8 A;  2HU9 A;  3OYF A;  3RQI A;  3JAM K;  3S15 J;  1TWC J;  3HOT A;  1TW2 A;  4UV9 A;  1XSX A;  2BHZ A;  4B47 A;  3MKY B;  4M3E A;  2O0Y A;  4RAZ A;  3FMR A;  4XLN F;  2VKH A;  4EM1 A;  3NAR A;  5LHH A;  3PQJ A;  1D1C A;  4C3I J;  4IOC F;  4QTR A;  4M71 A;  4E7Z A;  2CQN A;  2COM A;  3GTP J;  1U9N A;  5E1Z B;  2WAD A;  2EQR A;  3S17 J;  3NQO A;  2WAQ A;  1ZQ3 P;  1MD0 A;  4Y33 A;  3OYB A;  4PDK A;  1SC7 A;  4IRI A;  3MD2 A;  3K4C A;  1OR7 A;  4XLA A;  5B5E C;  1AU7 A;  2CUZ A;  4KT6 A;  5HDK A;  1OIS A;  3L2Q A;  2K86 A;  2E1O A;  3JAM Z;  2ISY A;  1Z91 A;  5E20 A;  3GTL J;  4TV7 A;  1W36 D;  5K7Z A;  4LFU A;  3HL2 A;  1YIJ I;  3E0J B;  1UG2 A;  1U2W A;  4IZZ A;  5D6E A;  2DYR H;  1V5E A;  3M9A A;  1F43 A;  3OS0 A;  1MNM C;  2KPM A;  2Z99 A;  5E8G A;  3I71 A;  3FBN B;  3EPZ A;  2HYJ A;  2DU9 A;  4MGR A;  3CD6 I;  4KIC A;  1REP C;  2Y69 H;  2L7K A;  2CRG A;  4K2E A;  1JUM A;  2DJN A;  4RS8 A;  2LBF A;  3JTG A;  4KMF A;  1V54 H;  2JMW A;  2IGM A;  4AUX A;  1DU6 A;  2ZJ2 A;  1YG2 A;  1R49 A;  3BTJ A;  3BT9 A;  1HW2 A;  2H8R A;  1XTA A;  5GAH J;  3PIO F;  3LSG A;  3S8P A;  2XHK A;  3KEQ A;  4JX5 A;  3ASN H;  1EKE A;  3OV8 A;  5FFX A;  3MFK A;  3GTO J;  1WJE A;  4IVN A;  5BOX A;  1ZR2 A;  4BXF A;  5BS6 A;  1GXP A;  3IWZ A;  3F22 A;  2NS0 A;  3GXO A;  2P7C B;  4RB3 C;  1JKO C;  3COA C;  2PEX A;  1YIT I;  4XBF A;  2XC7 A;  4BXU A;  4MTD A;  3ABL H;  3WOD F;  4RM3 A;  1U8B A;  1O7F A;  1XDU A;  1F4K A;  3X2Q H;  1V3F A;  1YOV B;  2DW4 A;  3DEE A;  4AVP A;  1GV5 A;  3HYI A;  1X1C A;  3RYP A;  1I50 J;  1RKW A;  2R7D A;  5LLQ A;  3CES A;  3KP4 A;  4GO1 A;  2M5W A;  3DXJ F;  1YJ9 I;  1TP4 A;  3CLQ A;  2XSJ C;  4OAY A;  1MBF A;  4A5M A;  4BUP A;  2CG4 A;  3JRG A;  2X1D A;  3L00 A;  1Z67 A;  4ZTJ A;  4XKW A;  3M07 A;  3HXL A;  2Y30 A;  3DEU A;  2QQ9 A;  4UUV A;  1ZG1 A;  1NH3 A;  4PGG A;  2H1L A;  2VBY A;  4BJT A;  1ZR4 A;  2QSF X;  3C7J A;  1U8R A;  2E1N A;  1P4W A;  2BBY A;  2IRF G;  2R7V A;  3RKQ A;  1WQ2 A;  2W00 A;  4C2M J;  5TRD A;  4ON0 A;  2QEN A;  1I5Z A;  2WAE A;  3CCE I;  2CU7 A;  4CZZ A;  1QZY A;  3IAS 2;  3OS2 A;  1JHF A;  4KT5 C;  4IOA F;  2HI3 A;  2M0M A;  4ESF A;  4ZYH A;  1T8I A;  3A4C A;  3OYN A;  4DGW B;  2LF7 A;  4EV0 A;  2ECB A;  2KT0 A;  2ADU A;  3KLN A;  3OSF A;  4LLL A;  4LG0 B;  1D5V A;  1O3Q A;  1STZ A;  2CMP A;  4ESJ A;  3MZ8 A;  3BTI A;  4B09 A;  1WFX A;  4XMY A;  1Z3X A;  1D0Z A;  4P9U A;  3IAM 2;  2F5D A;  1O3S A;  4KYW A;  3CJQ B;  3CUQ B;  1HSJ A;  3DU6 A;  4OMZ A;  2VUM J;  4EVI A;  1CF7 B;  2L0K A;  3IUO A;  2L54 A;  1UCR A;  4UY8 I;  3BG5 A;  1MBE A;  3I4M J;  2Q2E B;  1FSE A;  2VJJ A;  4WWC A;  2VE8 A;  1WZ2 A;  4HA8 A;  3RI4 A;  4JOM A;  4BQQ A;  3G1L A;  4JX4 A;  4QLC U;  3J81 K;  1A5J A;  4J19 A;  1DPR A;  3GFL A;  3J80 K;  3J7Y J;  3K7A J;  2E35 A;  2HZT A;  3S16 J;  5GPA A;  3R6S A;  1U3E M;  3QOD A;  3FK6 A;  2M34 A;  3F6V A;  4E4H A;  1D1B A;  4XON A;  3WE2 A;  3E7L A;  4XN0 A;  3ZXS A;  1UAA A;  4N9H A;  2LG4 A;  5D4R A;  1E0E A;  2OQR A;  3HC7 A;  3CCQ I;  1RUO A;  3HB9 A;  3BRO A;  1OKR A;  1P9Q C;  4R8H A;  4RGS A;  3FZV A;  1OPC A;  2FE3 A;  1PYV A;  4J00 A;  5FKO A;  2A07 F;  2OF7 A;  2P5K A;  4IPA A;  2B0L A;  3LWF A;  1EH8 A;  2CJJ A;  4CA0 A;  3TDU C;  5B66 C;  4S04 A;  3CCM I;  2RQQ A;  4BJ6 C;  4KN7 X;  4BYY A;  1WJF A;  1U0J A;  4HBL A;  3I5U A;  4BY7 J;  3J81 Z;  4XM3 A;  1HC8 A;  1DPU A;  1H88 C;  2KDZ A;  2YUS A;  1X1D A;  3J80 Z;  2DA4 A;  2A3S A;  3JSP A;  2NXN B;  2TCT A;  3H1C A;  3K4L A;  3LOC A;  2MBF A;  2JJ7 A;  1XS9 A;  1P4A A;  1R7J A;  2EIM H;  2FNP A;  3I54 A;  3LSM A;  3SZP A;  2A6T A;  1YLF A;  2HVQ A;  3Q0W A;  4AC0 A;  2ISZ A;  1IUY A;  4NBQ A;  5C44 J;  3FXL A;  3V8J A;  3L1P A;  4HAM A;  2XKP A;  4IKF A;  2R7O A;  4HF1 A;  2JQ7 A;  5EF6 A;  2BXZ A;  4JX6 A;  1G3Y A;  2XAS A;  1Y1V J;  2PQ8 A;  1YW9 A;  2VQH A;  1FJL A;  5IP7 J;  2YX7 A;  5GAD J;  5JR3 A;  4L5J A;  3O2P E;  4F91 B;  2M7B A;  2GLO A;  3KCC A;  4I01 A;  3CMM A;  1J7K A;  3HOX J;  3CDI A;  1NK2 P;  3ML6 A;  2NYX A;  2ACJ A;  1P7J A;  1TL8 A;  5DCM A;  2H6C A;  3O6B B;  3RTR A;  1KU7 A;  3QAH A;  4I98 B;  3JRD A;  3CCJ I;  4FE4 A;  1YFH A;  4MFD A;  1ULY A;  1X2N A;  1HKQ A;  2IAI A;  4D9J A;  1AWC A;  3RZO J;  3LAP A;  4LD5 A;  2CYY A;  3D1N I;  4AYB A;  1K79 A;  2L9N A;  2M7A A;  1F5T A;  1I3A A;  3CJN A;  3M1E A;  3G3Z A;  1FPQ A;  4YEL A;  2VT2 A;  3HRT A;  4FT8 A;  2EPF A;  2DJI A;  3OR1 C;  2VOO A;  1JUP A;  5E1X A;  3DP7 A;  4CYC B;  1KU2 A;  4HNU A;  5TJJ A;  2OCE A;  4LMY A;  1WRJ A;  5F04 A;  4BDY A;  3H5A A;  1WI3 A;  1B72 A;  3LAJ A;  2RV8 A;  4I7H A;  5FLM J;  2DT7 B;  2LY2 A;  1N77 A;  2M45 A;  4MQV A;  4WXC A;  4HNT A;  4FCY A;  5CVU A;  4D1Q A;  3H3V K;  3SYT A;  4HF2 A;  2R0Q C;  1BI3 A;  2XAF A;  2DA6 A;  2OU2 A;  3P9I A;  2YPR A;  3ELK A;  5D8L B;  2W82 A;  4KIF A;  3LFK A;  3B73 A;  3LQR A;  1X4O A;  1Q1H A;  3TQN A;  2CH0 A;  3LSR A;  4ZZD A;  2I5U A;  1MJA A;  2ZSI B;  1DUX C;  3M8F A;  2VON A;  2DMQ A;  2A5Y B;  1QA6 A;  3J7A Y;  4A69 C;  4F52 A;  2NVX J;  2LMD A;  3JRC A;  2KIQ A;  2DQL A;  4EJU A;  5L3G A;  4NNJ A;  3KP7 A;  1SMY F;  2Q0O A;  2QGU A;  1GVJ A;  3P5J A;  4Y15 A;  1YS7 A;  3BP8 A;  3S14 J;  3U21 A;  2ZO4 A;  1TWF J;  3K70 D;  2MGQ A;  3TMO A;  1SEU A;  2R93 J;  2VE9 A;  1H9G A;  2F5E A;  1GVD A;  2EV6 A;  3BCA A;  3V7C A;  2JA5 J;  2JWT A;  4FAS D;  2DTZ A;  2GQQ A;  3V4G A;  3H9J A;  2DO7 A;  2ME6 A;  2IP2 A;  2FXA A;  2JSC A;  4L0Y B;  1R5G A;  3LA7 A;  4ZC3 A;  3OIO A;  3HDD A;  4XSX F;  1WKM A;  3F8B A;  3WTX C;  1LUJ B;  2HPM A;  1EJ9 A;  2X51 A;  3QOE A;  2OTL I;  1OJL A;  1MBG A;  5J1U A;  3WG7 H;  3EYY A;  3OYM A;  4A3B J;  4V19 K;  2IS4 A;  4XNF A;  3D5L A;  1ENH A;  2P7V B;  4F55 A;  4CGZ A;  3GWZ A;  3ZP5 A;  2HKX A;  2O03 A;  2P0W A;  3DBH B;  3I59 A;  5E3O A;  3DPU A;  2DBB A;  3I53 A;  1ZRC A;  2DA3 A;  5IPA A;  3K4J A;  2VJ4 A;  2DQR A;  2HXO A;  3BJA A;  4P55 A;  5D4S A;  1MBH A;  1WSU A;  4X1E A;  4XOP A;  4WXD A;  3FKI J;  4ZH4 F;  2W57 A;  1JJ6 C;  3CC7 I;  2NVT J;  3HOY J;  3MAJ A;  1K6O A;  4ANJ A;  3ZQ7 A;  2O8K A;  1LDD A;  3V7S A;  2PBI A;  4CCN A;  2BXY A;  3MN2 A;  1JKR C;  1IN4 A;  3WTZ A;  1I1S A;  4RLQ A;  4UUS B;  3BLY A;  5ILS A;  3J7A O;  3NAU A;  3FXJ A;  4CCL A;  5GPC A;  1JHH A;  2KIM A;  4DYR A;  4CO8 A;  3JRF A;  1QZE A;  3S1M J;  2GXA A;  2ME0 A;  1TQI A;  2CGP A;  2RGV A;  1KON A;  4RAG A;  1SAX A;  3GTQ J;  1BBY A;  4XKC A;  1ORK A;  2QA4 I;  3DCF A;  3WHB A;  4ZZL A;  2E71 A;  3GVA A;  1Y8R B;  4N9I A;  4KDP A;  2BE5 F;  1FLI A;  3F0C A;  5FO5 A;  1MJ9 A;  1B1B A;  3B6A A;  1T6S A;  2P4W A;  3MQ0 A;  2NNY A;  2CUJ A;  5EEH A;  3ULQ B;  1T98 A;  3BG3 A;  4WF2 A;  2L3D A;  3VYU B;  2GWR A;  1AKH A;  1TNT A;  5J47 A;  4ZDO A;  1D1A A;  5EYR A;  2M8G X;  4F92 B;  1LVA A;  1T08 B;  3PFI A;  1XCB A;  1R1U A;  2P6S A;  3DBL B;  3K6G A;  3SEZ A;  1QHH D;  2E1M C;  4PJM A;  1S7A A;  2M1B A;  2RQP A;  2LY9 A;  4XKB A;  3PNT A;  3ZMD A;  2QBY B;  2K5C A;  2UWM A;  3V7R A;  3HTS B;  5M5Y J;  4WXH A;  4W97 A;  2W25 A;  3EUH A;  3FXR A;  2ZXW H;  4AIH A;  4V2G A;  1JJ8 C;  3WGI A;  1DGW Y;  2D2W A;  3JW4 A;  3OIQ A;  1ZLJ A;  2F5F A;  2ZME C;  4HZF A;  5JI6 A;  1YRN A;  2MLG A;  5HOD A;  1ON1 A;  1C0W A;  2EV5 A;  1WJ5 A;  3D5R C;  4E70 A;  4XK4 A;  4XRS A;  4YFN F;  4EQQ A;  1GT0 C;  1BW6 A;  4AM3 A;  1KYW A;  4Y3O A;  1XC5 A;  3BPX A;  5E8I A;  3ZQF A;  2VQG A;  1GXQ A;  3QWL A;  3W6K B;  2OZ6 A;  3TDZ C;  4AYB N;  3PUB A;  1I1G A;  3M7G A;  1X19 A;  1MDM B;  1KQ0 A;  5TIS C;  5K5O A;  4BKX A;  2Q1Z B;  2VXZ A;  2K9N A;  3F8N A;  5LEJ A;  2JZY A;  2GA2 A;  1BOB A;  1IXC A;  2IA1 A;  2TDX A;  2ZFW A;  4FHT A;  2EA4 A;  1WI9 A;  4BJ5 C;  3BOQ A;  3LSP A;  2LLK A;  3BTL A;  1TLH B;  3BQZ A;  3H0D A;  4NB5 A;  3A1Y A;  2FA5 A;  3FMS A;  4HOB A;  4MQ9 F;  1ETV A;  5HLT A;  2Z9O A;  1TQM A;  3OYK A;  3IV5 A;  3AG1 H;  2BY0 A;  2BY3 A;  3HHH A;  5H6R A;  1HW5 A;  3DWL E;  1R5H A;  4HEA 2;  3JSO A;  3GFI A;  4IHS A;  3SDG A;  1RR8 C;  3HOW J;  2R92 J;  4AIK A;  1K83 J;  2VB6 A;  2ZJR F;  3BJ6 A;  2OAZ A;  2M3A A;  2ZXH A;  3E97 A;  2F2E A;  3HHG A;  1OLT A;  2LOO A;  5FFZ A;  4HX8 A;  4C3H J;  5E3L A;  1BI0 A;  1X1P A;  3PL8 A;  2WB1 N;  1HKS A;  3N4M A;  1ACI A;  1SFK A;  2DMP A;  2I10 A;  2WV1 A;  3E6M A;  1XGO A;  3CC4 I;  4U0Y A;  1Y1W J;  2HOT A;  2X1E A;  3KEY A;  2W48 A;  3GX4 X;  2M8E A;  4E7L A;  2W24 A;  1SFU A;  4AVZ A;  3UR3 C;  1G3S A;  3DV8 A;  1QU3 A;  4ABZ A;  1PP8 F;  2KQR A;  1E3O C;  1G6N A;  4IHV A;  1KU9 A;  2KMU A;  2E7W A;  5F64 A;  1EF4 A;  1J9I A;  1D0X A;  4YEJ A;  2LBF B;  3LSH A;  5GP9 A;  5DM7 F;  3OWT A;  4G8X A;  3HBL A;  2Y0S A;  4GYI A;  2GIZ A;  2BY2 A;  2XAG A;  3PO2 J;  3DKY A;  4I0B A;  4ITV A;  2KZV A;  5ILU A;  3HRS A;  4F93 B;  3UNG C;  3C3W A;  1ZGA A;  5GTI C;  4LIU A;  2HR3 A;  4N4N B;  3GUD A;  2OTJ I;  5IT9 K;  5K7H A;  1R4N B;  1ZAO A;  3GEZ A;  4C9Y A;  3S3N A;  4QIW N;  2RKH A;  4A5N A;  2DDA A;  5E79 C;  1GV2 A;  1YE9 A;  2EFP A;  1GHC A;  4EJO A;  1UHS A;  3QPT A;  5J8F A;  2RNJ A;  3JCU C;  2LP0 A;  3GLX A;  3TOB A;  4LK1 F;  3PIP F;  2CQQ A;  2LD5 A;  4AD9 A;  2DK5 A;  2KIF A;  4L5I A;  3L2U A;  3DFG A;  1T0F A;  1ZN2 A;  4HRI A;  2KP6 A;  2ZJP F;  4Q4Z F;  4LB5 A;  3BZ6 A;  4ENM A;  1ETK A;  2QVO A;  1Y0N A;  4D5C A;  2X48 A;  5C4J J;  4UHT A;  2BW3 B;  4KA4 A;  5IT9 Z;  2KL4 A;  2VPR A;  3F72 A;  2XAQ A;  3K4B A;  2DXI A;  2Y75 A;  2XGD A;  3L2R A;  3G73 A;  4PJ0 C;  3KIO A;  1XGN A;  2R5Y A;  1D0Y A;  2EZL A;  1VQ6 I;  1ZLK A;  4B44 A;  2LKS A;  4EJW A;  1ZG3 A;  3HUG A;  5GAE J;  1D5Y A;  2R3S A;  2OD5 A;  2A5W A;  1SVM A;  4G12 A;  1JKP C;  2HTJ A;  4WX9 A;  3BR0 A;  4BNC A;  4MFE A;  4L18 B;  3FXU A;  1RZ4 A;  3DKW A;  2ID6 A;  1QRY A;  4M74 A;  2W7N A;  3WTS C;  1NK3 P;  3AL0 C;  5ICC A;  1Y0U A;  2ZNZ A;  2X85 A;  3L2W A;  2VC0 A;  2V9K A;  2FQ3 A;  1BJA A;  2EB7 A;  2XF6 A;  4B48 A;  1RET A;  2DI3 A;  4E7S A;  1R6R A;  3W2V A;  1G8X A;  4IJA A;  1TQP A;  1IN8 A;  2J5O A;  4D5F A;  3T0Y A;  3SQN A;  5J1Y A;  2E36 A;  4DYC A;  2V1U A;  1UHM A;  4A3L J;  3W2W A;  1S6L A;  3E1S A;  3VYS B;  3ERM A;  1BN5 A;  2K7L A;  2NVQ J;  3FXO A;  3OOU A;  4CCO A;  2XRN A;  2KDO A;  3FF5 A;  4BQO A;  2K9M A;  5ILV A;  1UHW A;  1JTX A;  5ED4 A;  3I9V 2;  3ABM H;  3HM5 A;  1D3Y A;  2JA7 J;  2HNH A;  1BI2 A;  1KQ8 A;  2VJ5 A;  4XLP F;  3GME A;  4F3Q A;  3O8H A;  4EJT A;  3LFU A;  1BR4 A;  3MMY B;  2JA2 A;  2C6Y A;  2PJP A;  2MAB A;  4B8X A;  1S7E A;  3OS1 A;  3REO A;  4PJN A;  1E3H A;  2UXX A;  4IX7 A;  4D0P A;  2XRO A;  2M4K A;  4UXN A;  2ZSH B;  2O7O A;  4PSX A;  3K1P A;  3K0L A;  1V55 H;  3A01 A;  2DA5 A;  4FX4 A;  4EM2 A;  1VQ4 I;  2IS6 A;  1P2F A;  2JTV A;  4A3G J;  3SJM A;  4OIR F;  2RVC A;  1ZTR A;  3AFH A;  1MJB A;  4NQW B;  5LHI A;  3VDX A;  4Y52 J;  2QSG X;  3E5U A;  2IEK A;  1BR1 A;  4I02 A;  3WTU C;  1VQ5 I;  2JPC A;  4IEJ A;  4D7M A;  2JA6 J;  4YFK F;  4M6X A;  1G4D A;  3HZJ A;  4RB2 C;  1Y6I A;  2EIK H;  1BW5 A;  1YJN I;  1K7A A;  1U5T A;  3FIW A;  2YSR A;  4EMS A;  5CVV A;  4B4C A;  3ZQL A;  1TZL A;  2MA3 A;  4HDU A;  2FMY A;  4PFO A;  3KZZ A;  1X2M A;  1YW7 A;  2XAH A;  3EET A;  2GZW A;  2OQG A;  2CV0 A;  1ZRF A;  4HLY A;  2XAU A;  3N05 A;  4HQE A;  2VI6 A;  2ZKZ A;  3M8J A;  3PQK A;  4IL6 C;  3S3O A;  1LDK B;  2G7U A;  4XRS G;  1BIA A;  4BHP A;  1EH7 A;  2DDB A;  1KZH A;  2ZBK A;  2W84 A;  3KP5 A;  5BQT A;  3HPH A;  5EJC A;  3HGY A;  2HPI A;  2VXD A;  2K9Q A;  2IVM A;  3H0G J;  2JN6 A;  5FJ8 J;  2Y0S N;  2IS2 A;  1A36 A;  4DBR A;  2IT0 A;  2E1M B;  2G0E A;  3IKV A;  2V4J C;  3Q5F A;  1P7I A;  1FYM A;  3M3Y J;  1LVK A;  3DLL F;  3ZGK A;  3IH4 A;  5LRS A;  2EWN A;  5E3N A;  1YX5 A;  2HDD A;  2V9V A;  2D5V A;  2KHM A;  3JTH A;  4BEH B;  1OR7 C;  1JT6 A;  2HQA A;  3KYC B;  3OYE A;  3H35 A;  2ZME B;  2BV6 A;  1IDY A;  3BR5 A;  1RI7 A;  4P1W A;  3ZMS A;  2NS8 A;  3WHC A;  2E19 A;  2X6O A;  4NC8 A;  1VQK I;  2XIG A;  2R7W A;  2P81 A;  3HKZ N;  1KA8 A;  3IHU A;  3WU1 B;  3F23 A;  3GFJ A;  2R5Z B;  3SDB A;  3FDY A;  2DN0 A;  4KUM A;  1JGS A;  1VQ9 I;  5L3B A;  4DJA A;  4DBQ A;  5KK1 A;  1Z9C A;  1XMA A;  1VQ8 I;  3TP0 A;  3ZN0 A;  5J3L A;  2XB0 X;  5JVT A;  1FP2 A;  1QVT A;  1MBK A;  1BR2 A;  3HGG A;  4G94 A;  2NRA C;  2P8T A;  3TKY A;  3K2A A;  2HDW A;  1PUE E;  1ETY A;  4JYK A;  4KIG A;  3U2R A;  5HS7 A;  2UUZ A;  5AIQ A;  3RCO A;  3RJP A;  4DYQ A;  3MVP A;  3SXY A;  3ZOB A;  4HST A;  4A2U A;  4ENK A;  4I09 A;  3KP3 A;  5FKL A;  2PMZ A;  1QHG A;  1A04 A;  3K69 A;  3PJR A;  2Z3Y A;  5FLV A;  2O3F A;  3DF8 A;  4G7H F;  2B63 J;  3HSR A;  3L09 A;  5CLS A;  3U1K A;  3ZRG A;  1ODD A;  4M73 A;  1MMD A;  1QPM A;  1IV8 A;  3LSK A;  4UUT A;  9ANT A;  5LGN A;  2QLZ A;  3U9G A;  3QU6 A;  2UXN A;  5K7F A;  2HTS A;  2K02 A;  4II3 A;  4RA2 A;  3D0S A;  1A31 A;  1F1Z A;  2P6T A;  2L9R A;  3CZ6 A;  2GA1 A;  3ECO A;  4PFP A;  2JUG A;  3CP2 A;  1A6I A;  4OU0 A;  5EZH A;  3TO6 A;  4LIV A;  1O3R A;  4NUB A;  4Q47 A;  4BHC A;  2Y48 A;  3S2W A;  1ZK8 A;  3R60 A;  2H94 A;  5AON A;  3JRH A;  4LG0 A;  3ERE D;  5EGO B;  1J75 A;  2FU4 A;  2ZCW A;  3BPV A;  2Q8K A;  4IHW A;  1EV7 A;  5F08 A;  3I59 B;  3IWF A;  2VOD A;  4XOR A;  1FTZ A;  4M3D A;  4BQN A;  2EIN H;  2NOG A;  2HZD A;  3CUQ A;  3GTM J;  4E7J A;  2DCE A;  1JI8 A;  1CF7 A;  1Z0X A;  4M9Z A;  2PMU A;  5K1Y A;  1Z77 A;  2LRD A;  2RC4 A;  2ZC2 A;  3BG7 A;  1SFO J;  3I64 A;  4CCM A;  3QYE A;  4PUS A;  1VQO I;  4B43 A;  5JFR A;  2VC1 A;  2VBX A;  5JVG F;  4Z6Y A;  1BIB A;  3ASO H;  2L4M A;  3PO3 J;  4L9T A;  1KQ9 A;  1XGS A;  5GAG J;  1OCP A;  5HLG A;  2EBI A;  5FLX Z;  4XID A;  3T8T A;  1U5T C;  3H9Q A;  5J1R A;  1Z6R A;  2L5Q A;  4PCQ A;  3QPL A;  2YR2 A;  1XCV A;  4XSZ F;  4LB6 B;  1KYZ A;  3U1D A;  2VJI A;  4KNY A;  3C2H A;  4CHU A;  4JK1 X;  3QQA A;  4MTE A;  1G59 A;  1VQ7 I;  3R61 A;  3NRV A;  5F6F A;  4GRI A;  4G9Y A;  5LEK A;  2D1H A;  4HLX A;  1Z21 A;  2EJR A;  1KGS A;  5H6Q A;  1K6Y A;  1NG6 A;  2NAZ A;  2WB1 A;  4HG2 A;  3Q3S A;  4GCV A;  5M3M J;  4A0Y A;  2K40 A;  4I76 A;  1QBJ A;  3FM5 A;  2DOD A;  3B02 A;  4H4K C;  4M9X A;  3H3U A;  4JP0 A;  1W0U A;  3ZR8 X;  3MKW B;  2V1D A;  5LRR A;  4OIN F;  1VQN I;  3ABK H;  2AO9 A;  3EYI A;  4RDU A;  2JVG A;  3CO6 C;  1Y39 A;  1OCT C;  4CH7 A;  1RUN A;  2CSO A;  2Y0M A;  1B59 A;  4ZYG A;  2VPL A;  2GOM A;  2VKD A;  1WGX A;  2ZNY A;  2DA2 A;  4V2F A;  2AHQ A;  4ZYE A;  1LE8 A;  1BC7 C;  1D8K A;  4RM2 A;  4CCJ A;  2F5C A;  4ASN A;  4DOZ A;  2D45 A;  5FKM A;  2DA7 A;  1W7P B;  3HOS A;  3PM1 A;  1WJC A;  3DTE A;  4KFC A;  5CKT A;  1WCM J;  1XMX A;  2FD5 A;  3GW2 A;  3DPT A;  4RAY A;  3S3M A;  4RB0 A;  5KCM A;  1Q1V A;  3BR3 A;  3VWB A;  1TBX A;  1X1A A;  4LGW A;  3AL0 B;  3OYG A;  1LNW A;  2MW8 A;  1R1V A;  4IRG A;  5KVR A;  1YW8 A;  4G6T B;  3VEP A;  4E7K A;  3SFZ A;  3OR2 C;  2E2I J;  3S1Q J;  4XN3 A;  2MSY A;  4JQF A;  6PAX A;  1V5F A;  4BBR J;  2XGC A;  3KLO A;  2LKP A;  1B8I B;  3Q0U A;  4RLF A;  4YIR X;  2L9S A;  5CJ9 A;  1IGN A;  4BHB A;  2WBM A;  1R5I D;  1XMK A;  2ID3 A;  3JRE A;  2G9W A;  3F8M A;  2QZ8 A;  4NDL A;  1APL C;  5J4V A;  3HOU J;  1J5Y A;  2KZG A;  1MH3 A;  3DKX A;  1MKM A;  1WH5 A;  3FXQ A;  3K4M A;  2YU3 A;  4CDG A;  1U6G A;  4ENN A;  3L2C A;  5EEA A;  1FT9 A;  2CQK A;  3HEF A;  1VZ0 A;  2STW A;  5JLX A;  1PDN C;  1K4T A;  1UZC A;  5JLW A;  4HQM A;  4L0Z B;  1SD4 A;  2QSH X;  2NOJ B;  4L9J A;  2COB A;  2HKO A;  2WV0 A;  3QP6 A;  4ENJ A;  2UZK A;  2JUC A;  3F21 A;  3NEU A;  3S93 A;  2VQC A;  3TW7 A;  4IHX A;  3O8G A;  2AS5 F;  1FYK A;  1JTY A;  3BDD A;  3ECH A;  2WC2 A;  3KX2 A;  1E17 A;  2PJR B;  2PMZ N;  3FXM A;  3NWT A;  2EIJ H;  5HLH A;  3AG3 H;  3I4P A;  1PP7 U;  4MLO A;  1T38 A;  4OMY A;  3D5S C;  1DDN A;  3RKX A;  2X9D A;  2XV4 S;  2WY8 Q;  2YS9 A;  1H0M A;  1I6X A;  3TBI A;  2FBK A;  5J4Y A;  3G6E I;  3LL7 A;  5TGT A;  1K78 B;  1VQL I;  3WU2 C;  3DQV C;  3GZ5 A;  4DIQ A;  1H8A C;  1X4P A;  3LQQ A;  3GFM A;  2RRE A;  2XPW A;  4ZDL A;  4AU7 A;  2P5L C;  3FKJ A;  2VQL A;  3A0B C;  3HRM A;  4KJZ A;  3QOP A;  3ABU A;  3Q0V A;  1LEA A;  1W5T A;  2QWW A;  3QPH A;  5K5Q A;  2X1C A;  1UB9 A;  3H5R A;  4MEX F;  1MSE C;  1FBQ A;  4A6E A;  4XIC A;  2GBY A;  2H1K A;  2DTR A;  2DK8 A;  3VSL A;  3IRR A;  2PG4 A;  2IJL A;  2BOL A;  4OWR B;  3TW6 A;  1HBX G;  4RGU A;  2X0L A;  4C2T A;  1WVR A;  2IGN A;  3QU3 A;  1T56 A;  3LA3 A;  2E2H J;  3I55 I;  2ZJQ F;  3VOE A;  1O57 A;  2L9V A;  2QKL B;  1BA5 A;  2A69 F;  5H20 A;  2MYS A;  3KZI C;  3KP2 A;  2L2O A;  4B3A A;  2EFW A;  1OYW A;  2Y31 A;  1Y56 A;  2LRE A;  4ZJZ A;  1IDZ A;  3HSF A;  2Z1D A;  1T39 A;  1FY7 A;  2IS1 A;  4O6J A;  5HDN A;  5KHD A;  1USS A;  1OCZ H;  2O5R A;  1HF0 A;  2CV1 A;  4PJJ A;  1T95 A;  2FQ4 A;  3F6O A;  1G2H A;  1BI1 A;  1UMQ A;  4DW6 A;  1B4A A;  2XB5 A;  1POG A;  4I99 C;  1W4M A;  5IY5 H;  2V26 A;  5FRN A;  5D5W B;  3K4N A;  4IQJ A;  1E3P A;  2KIU A;  2XGE A;  3QP5 A;  5FKK A;  2R5Y B;  4Q48 A;  1VF9 A;  1WH7 A;  5M5X J;  4BBS J;  5FRM A;  5IP6 A;  3TL4 X;  1TWH J;  2MG4 A;  3VSK A;  3CLO A;  4JBA A;  5K5R A;  4P5O A;  3HUG B;  4CYD A;  4C2U A;  1ON2 A;  3CCU I;  3VOD A;  5LHG A;  5A2Q Z;  5ICF A;  2LDU A;  2XSD C;  1Z7U A;  2KLO A;  1I27 A;  2EZK A;  3K1M A;  3FX3 A;  1HKT A;  2MFZ A;  3MZH A;  1WJA A;  4U88 A;  2IW5 A;  2O8X A;  3LNQ A;  3GTJ J;  5M3F J;  1D8J A;  2L02 A;  3I0T A;  2R7X A;  4MEY F;  3GLL A;  1T33 A;  2EV0 A;  4A3C J;  2MC3 A;  2WA0 A;  3CME I;  2DFI A;  1Y8Q B;  4PGH A;  4BE0 A;  1YX3 A;  3KE2 A;  3RQ4 A;  3WGH A;  4R79 A;  5ERI A;  2LC2 A;  5FKN A;  3M8E A;  1YTY A;  2QBY A;  2G7H A;  1R9T J;  1DGR M;  1L0O C;  3ZMZ A;  1JKQ C;  1QPI A;  1FWZ A;  2OC6 A;  2UV1 A;  3AKZ A;  1LFU P;  3A02 A;  1R1T A;  2CS3 A;  2DMU A;  2GOX B;  2JRT A;  3H9G A;  1UJ8 A;  3SEQ A;  3CDH A;  5C4X J;  1PUF A;  2DYS H;  4IQ4 A;  4XOT A;  1ERD A;  2LK2 A;  4IHT A;  3WG9 A;  2QCO A;  4LJZ F;  3QYB A;  5D5X B;  3IL2 A;  4E7H A;  1ETO A;  3FWE A;  5DCF A;  2VBZ A;  2M87 A;  1FX7 A;  4A93 J;  1ZGJ A;  1FEX A;  2HYG D;  2HOE A;  2WWY A;  3BQY A;  2ELK A;  3BY6 A;  3KP6 A;  4UVA A;  1V5G A;  2DAO A;  2IPQ X;  3RPU D;  3HKZ A;  3OYJ A;  3G71 I;  4KIS A;  4L9V A;  4ZDP A;  1SFX A;  1MNE A;  1CQT A;  1IN5 A;  1MDM A;  2ZXJ A;  3MEX A;  1IO2 A;  4GDF A;  4N0B A;  5EG0 A;  3JRA A;  3EDP A;  3A01 B;  2EZH A;  3ZQI A;  2KKO A;  5L3D A;  4ETS A;  2W4S A;  3C2G A;  3C2B A;  3OMY A;  3RKW A;  1P92 A;  2CW0 F;  3WGG A;  5LGT A;  3QRF F;  2BGC A;  3EUH C;  3OIP A;  1KU3 A;  3K2Z A;  4NC6 A;  2BZT A;  5BMZ A;  2V6C A;  1HST A;  2OUM A;  1W7P D;  1ETW A;  5ICE A;  3S1N J;  1TC3 C;  1MSF C;  3CCR I;  1MMN A;  3C18 A;  5L3E A;  4RB1 A;  5HNH A;  2AQF A;  1U9O A;  3BCB A;  5KAI C;  3G1O A;  2F4O B;  1U5T B;  2R4G A;  3HOV J;  2LF8 A;  5DD4 A;  1IC8 A;  1OQY A;  1FMV A;  5DTD A;  1S72 I;  5F1R A;  3FK7 A;  2KJC A;  2LYC A;  1ZYR F;  3O3K A;  4A3I J;  2FEZ A;  2KRH A;  2XF5 A;  2VT3 A;  1S8N A;  3S32 A;  2A6H F;  1VQM I;  4CCK A;  3ZCO A;  1B6A A;  1P6R A;  2K9L A;  1SD6 A;  3AG4 H;  1LEB A;  2PLY A;  4CSW A;  1Z7L A;  1SMT A;  2NVU B;  3WTW C;  2QKM B;  4GFB A;  2FNA A;  1W36 C;  2EFQ A;  2FOK A;  5DEQ A;  1RKT A;  1TWA J;  5J6X A;  4BDZ A;  1R23 A;  1J2X A;  2PN6 A;  3OOP A;  1X58 A;  2DPD A;  3T8R A;  2ESN A;  4RBO A;  1FBU A;  2HDC A;  2Z33 A;  5AIP A;  1IXS B;  4RMN A;  5EDN A;  3PNY A;  1ZG5 A;  2M9H A;  1AA7 A;  4I0A A;  2DOF A;  2XDV A;  3HIF A;  1IG7 A;  4OIP F;  2R7S A;  1IRZ A;  3CO7 C;  2OBP A;  5F27 A;  2HGC A;  3E6C C;  1R58 A;  1PVE A;  3HG9 A;  4C3J J;  1ZEL A;  2HFH A;  1IRG A;  1FIA A;  3R0J A;  1LFP A;  2KRC A;  3FIS A;  3E6D A;  1MGT A;  3Q9S A;  4PZJ A;  3MCZ A;  2CFO A;  2AXL A;  2V1N A;  4HNV A;  4M6Y A;  5CVI A;  3CTA A;  3CQZ J;  4EAT A;  2XF7 A;  1FC3 A;  2ELH A;  2VIX A;  2EIL H;  1MIJ A;  4HDV A;  3H36 A;  5HLI A;  1F9N A;  3CCY A;  3A03 A;  4CUG A;  2XKO A;  1O4X A;  1ETQ A;  5CVR A;  3ZQG A;  3GBG A;  4BXX J;  1T2K A;  4B3X A;  3GTG J;  1M1E B;  5FRO A;  1G3T A;  1YYV A;  2EFO A;  2QM3 A;  2OPT A;  2B7E A;  4AWX B;  3OL3 A;  2HS5 A;  1HDP A;  5F0H A;  4EJV A;  2PX9 A;  5CVJ A;  3RSN A;  1IW7 F;  2LFB A;  4UV8 A;  1Z6T A;  4OIO F;  1B9N A;  4HSR A;  3FMQ A;  3V8L A;  1FOY A;  3RPQ A;  1IRF A;  3KET A;  5D6F A;  1FTT A;  1W5S A;  4BAC A;  2V79 A;  4UB8 C;  1IJW C;  2ZB9 A;  5C3E J;  3TOA A;  2BW3 A;  2E2J J;  3T5X A;  1TW3 A;  5EZG A;  1DU0 A;  1WPK A;  2TRT A;  2XUB A;  2QEX I;  2RN7 A;  3AG2 H;  3DTI A;  4I6Z A;  1BL0 A;  4HPQ A;  2Z2S B;  2PMH A;  2VKE A;  3HJE A;  4M3B A;  4M6V A;  4U87 A;  3MZY A;  3CMY A;  1UST A;  2Z16 A;  5IYC J;  3VYR B;  3BR6 A;  1R36 A;  3Q9V A;  3UKG A;  2XPV A;  1RIO H;  2O6G E;  4G6Q A;  4A6D A;  2XPU A;  5B3S H;  2VN2 A;  2O61 A;  5DYM A;  4YFX F;  1FMW A;  2KJB A;  4KIB A;  3BR1 A;  2K9S A;  1H89 C;  3AAF A;  3ZN1 A;  5DCM B;  2VAS A;  4QPO A;  5F0C A;  2BHY A;  3E3V A;  1E2X A;  2RNG A;  4MNU A;  1EA3 A;  1K61 A;  1IRX A;  1ZH5 A;  3OYD A;  5IOY A;  1T0F C;  4KN4 X;  3F8C A;  4HW0 A;  1YO5 C;  4Q5S F;  4O5V A;  3DEW A;  4U0V A;  5IP9 J;  2VL8 A;  3BZK A;  5CYV A;  5M5W J;  1IZ1 A;  2EK5 A;  3L9F A;  2MH2 A;  2Y9Y A;  2EFN A;  2N8G A;  2CUF A;  3F9K A;  4H0E A;  4L9N A;  3SHF A;  1XSV A;  4Y7N J;  2K27 A;  2H6B A;  4X6A J;  2I8D A;  1DP7 P;  1FOK A;  3PNV A;  5FB2 A;  1ZAR A;  4WCG A;  2EA2 A;  2HQN A;  2CV2 A;  3JRB A;  1FZP B;  1B72 B;  1HW1 A;  3KYD B;  1IN6 A;  4BQA A;  1ZGW A;  3CDL A;  2FJ1 A;  4R1H A;  3K4K A;  4OOI A;  3TP3 A;  1RRJ A;  4S0H B;  4G7O F;  3QYF A;  2QQA A;  3PUF A;  4XLH A;  4ZYD A;  3G1M A;  2FUG 2;  3GYH X;  2KRF A;  1SAN A;  2XGX A;  3CJT B;  3CF5 F;  3BC8 A;  4LLG F;  2JK3 A;  3EUK L;  5IYD J;  4QWQ A;  1WWX A;  3W6J B;  1HXD A;  1HOM A;  4EEF G;  5L3F A;  2CWE A;  3ZQC A;  5IYB J;  2VBW A;  2R7U A;  3V42 A;  1GLN A;  1O3T A;  3GF2 A;  1QNT A;  3W2A A;  5HDG A;  2CUE A;  3KPH A;  4YG2 F;  5BPD A;  2R7T A;  1WHU A;  2DOA A;  3VFZ A;  1R00 A;  3SZG A;  4BS9 A;  2DFF A;  1IAW A;  2DFH A;  2MC4 A;  4BU2 A;  3F3X A;  5CPR B;  4NQW A;  5GTH C;  3PSF A;  3A2K A;  5EEG A;  2LTP A;  3KFW X;  2DT5 A;  1YS6 A;  1BM9 A;  2WAQ N;  1Z3Y A;  2IXS A;  2GIV A;  3EUA A;  3HTU A;  2HQ5 A;  3PFY A;  4Y17 A;  1VI0 A;  1O7L A;  4CIC A;  2V1X A;  1OYY A;  1OCC H;  3S2D J;  1SD5 A;  4BE1 A;  1LDJ A;  2IA2 A;  4YII A;  1TTY A;  1EH6 A;  2M0C A;  1MMG A;  3I56 I;  5E18 F;  5IOZ A;  1X3U A;  1N75 A;  3FXK A;  5F0F A;  3K10 A;  5CQE A;  1LE8 B;  1FOX A;  2FML A;  4LIT A;  3LMM A;  3BG6 A;  3ISP A;  4GGG A;  2X6Y A;  4AID A;  3HPG A;  3L7W A;  5FLX K;  4L5E A;  3BWG A;  2QQ8 A;  3IRQ A;  1XB4 A;  2X6W A;  4QSH A;  3OYI A;  1G3W A;  4M3F A;  2F6C A;  1L3L A;  2Z5U A;  3IKT A;  4BE2 A;  3E6B A;  4MO7 A;  4MHG A;  3GTK J;  4CXF A;  1FOW A;  1MMA A;  3RYR A;  3CUO A;  4FTH A;  1S3J A;  2J5P A;  3DLA A;  4AIJ A;  1AOY A;  5KAF C;  3TGN A;  1VFC A;  2DPU A;  5KNL A;  2Q2E A;  3S1R J;  5JHF A;  1OYI A;  1S7O A;  1YIO A;  3G2B A;  2H27 A;  4A0Z A;  2DFE A;  1FBS A;  2HWV A;  3K9T A;  3NWS A;  4BL0 B;  3TED A;  3P9C A;  3DPL C;  5DUI A;  2D1V A;  5FD5 A;  5HVQ C;  4XLF A;  3RKY A;  2JT1 A;  1MBJ A;  3ZMV A;  4II2 A;  1S29 A;  1XG1 A;  2A68 F;  4BEH A;  2LY1 A;  5E17 F;  4A3E J;  4XRM A;  1B9M A;  2FBH A;  1X3Z B;  4FET A;  5DV5 A;  2ZME A;  1YQA A;  1NG7 A;  1QVU A;  1I3Q J;  2OJE D;  1UFM A;  3ROU A;  2XAJ A;  1HCR A;  4HV5 A;  2W1O A;  5LBQ A;  4A3D J;  2BVM A;  2R5Z A;  4XL9 A;  2HXI A;  4IO9 F;  1HLV A;  1ZHF A;  4GYG A;  3H3Z A;  4B1R A;  4FE7 A;  5DDG A;  2CQX A;  3ONQ A;  1AKH B;  2E34 A;  5E1W A;  1R71 A;  5D5U B;  3L2V A;  4PJL A;  3N97 A;  1J0R A;  2MD5 A;  3KEO A;  2F4I A;  2KIS A;  1TT5 B;  4LLN A;  2ESH A;  3MKZ A;  1X1B A;  2FBI A;  4FX0 A;  1U78 A;  2E1C A;  1HQC A;  3CC2 I;  1V4R A;  3S2H J;  2L7Z A;  3ESW B;  1NHA A;  1OMI A;  2KFD A;  2L4A A;  4GXO A;  1LPQ A;  3CP8 A;  4MIM A;  3BZC A;  3GCM A;  4O3M A;  3WTV C;  4WK8 F;  1A35 A;  1Z05 A;  3OYA A;  3BG9 A;  1FP1 D;  4UB6 C;  4EGZ A;  4DZP A;  3MKL A;  2MH9 A;  4A0X A;  3KYL A;  5LGU A;  3BTC A;  3K70 C;  1SVL A;  3V8K A;  2WAF A;  1W1W E;  5F1J A;  4XR6 A;  3E5Q A;  5DUK A;  5B1B H;  2VKV A;  3I3L A;  4N4O B;  1YRN B;  2RAE A; 
#chains in the Genus database with same CATH homology
 1J59 A;  3GZ6 A;  4U7B A;  2K4B A;  4M9S A;  1Z1D A;  3SZT A;  2QUF A;  4UVB A;  3RDI A;  5DD8 A;  2FSW A;  4Y13 A;  3P9K A;  4U7D A;  1QQI A;  5D8K B;  3HRU A;  2STT A;  2WTE A;  1SD7 A;  1XD7 A;  3MWM A;  5HS8 A;  4HX4 A;  1QO0 D;  4I2O A;  1P4X A;  2RDP A;  4RGX A;  3VB2 A;  1FYL A;  4F7Z A;  1CGP A;  2DLL A;  2MLK A;  3ABT A;  4OIQ F;  4IRH A;  2JPB A;  5BPI A;  2VOP A;  4Z2Y A;  4S05 A;  2GXB A;  2ETH A;  3EQL F;  2FRH A;  5L3C A;  2HQR A;  2M30 A;  1R22 A;  1LQ1 A;  2XVC A;  2BYV E;  3BJO A;  1MZB A;  2X4H A;  4G7Z F;  3CUQ C;  4KMU X;  5HS9 A;  3RPU A;  3RIR A;  4G6D A;  3K1N A;  2IA0 A;  3KZY A;  2HYF A;  4DNC A;  1RNL A;  4P96 A;  4NHJ A;  2H09 A;  3LA2 A;  3TO9 A;  2YX4 A;  4HF0 A;  5IT3 A;  1FSH A;  4M72 A;  1W7P A;  2QQB A;  1XSD A;  1JXS A;  2A61 A;  4XRF A;  2GAU A;  1QGP A;  2LNB A;  3GO5 A;  1XDS A;  1H9T A;  4U0W A;  2NNN A;  2QYO A;  5A2Q K;  3FM3 A;  3P7N A;  4EM0 B;  1XGM A;  3E5X A;  1IN7 A;  2FF4 A;  4P9F A;  2PFB A;  1IXR C;  4HV6 A;  5JHU A;  4UNO A;  5J8C A;  4EGY A;  1QZZ A;  1FNN A;  4BAY A;  2A6E F;  4HX7 A;  1JE8 A;  5ICG A;  4RGR A;  2E7X A;  4BH9 A;  1BC8 C;  3C1D A;  2CFX A;  2HEO A;  1ONV A;  4A12 A;  3WE3 A;  2R7F A;  3F8F A;  3HSE A;  4UVC A;  1TNS A;  4YIF A;  3FHZ A;  4DQ2 A;  2GXG A;  2PI0 A;  2OZU A;  2BEO A;  4LK0 F;  2LSO A;  1XN7 A;  4HYE A;  4IF4 A;  3IC7 A;  3R4K A;  2W85 A;  1LB2 A;  1K78 A;  1BOA A;  1VTN C;  5HOO A;  2L01 A;  2OA4 A;  2P5V A;  3H92 A;  3WU0 A;  3TO7 A;  3ZPL A;  3I58 A;  5FD6 A;  3T1B A;  3ZMT A;  4ESB A;  1ZRE A;  5FGM A;  1IF1 A;  2K4J A;  3ZMU A;  2CO5 A;  3LST A;  1LJ9 A;  1ZRD A;  3WTY C;  5D5V B;  3R0A A;  4IXA A;  3WTT C;  1SFE A;  3JAM K;  3HOT A;  1TW2 A;  4UV9 A;  1XSX A;  2O0Y A;  4RAZ A;  3FMR A;  4XLN F;  4EM1 A;  5LHH A;  3PQJ A;  4M71 A;  2COM A;  5E1Z B;  3NQO A;  1MD0 A;  4PDK A;  4IRI A;  1OR7 A;  5HDK A;  2K86 A;  3JAM Z;  2ISY A;  1Z91 A;  5E20 A;  4TV7 A;  4LFU A;  1U2W A;  5D6E A;  3M9A A;  2Z99 A;  5E8G A;  3I71 A;  2DU9 A;  4MGR A;  4KIC A;  1REP C;  4K2E A;  4RS8 A;  3JTG A;  4KMF A;  2ZJ2 A;  1YG2 A;  1HW2 A;  2XHK A;  3KEQ A;  3OV8 A;  5FFX A;  3MFK A;  4IVN A;  5BOX A;  5BS6 A;  1GXP A;  3IWZ A;  3F22 A;  2NS0 A;  3GXO A;  2P7C B;  4RB3 C;  3COA C;  2PEX A;  4XBF A;  4BXU A;  4MTD A;  3WOD F;  1O7F A;  1XDU A;  1F4K A;  1V3F A;  2DW4 A;  4AVP A;  3HYI A;  3RYP A;  2R7D A;  5LLQ A;  3KP4 A;  4GO1 A;  2M5W A;  3DXJ F;  4A5M A;  2CG4 A;  3L00 A;  3DEU A;  2QQ9 A;  4UUV A;  1ZG1 A;  4PGG A;  2VBY A;  3C7J A;  1U8R A;  2E1N A;  1P4W A;  2BBY A;  2IRF G;  1WQ2 A;  5TRD A;  4ON0 A;  2QEN A;  1I5Z A;  4CZZ A;  1QZY A;  1JHF A;  4KT5 C;  4ESF A;  4ZYH A;  2LF7 A;  4EV0 A;  3KLN A;  2ADU A;  4LLL A;  4LG0 B;  1D5V A;  1O3Q A;  1STZ A;  4ESJ A;  4B09 A;  4P9U A;  1O3S A;  2F5D A;  4KYW A;  4OMZ A;  3CUQ B;  1HSJ A;  4EVI A;  1CF7 B;  2L54 A;  1UCR A;  1FSE A;  4WWC A;  2VE8 A;  4HA8 A;  3RI4 A;  3J81 K;  4QLC U;  1DPR A;  3GFL A;  3J80 K;  2HZT A;  3R6S A;  1U3E M;  3F6V A;  3WE2 A;  4N9H A;  5D4R A;  2OQR A;  1RUO A;  3BRO A;  1OKR A;  4R8H A;  4RGS A;  3FZV A;  1OPC A;  2FE3 A;  2A07 F;  2P5K A;  4IPA A;  2B0L A;  3LWF A;  1EH8 A;  3TDU C;  4S04 A;  4KN7 X;  4BYY A;  4HBL A;  3I5U A;  3J81 Z;  1DPU A;  3J80 Z;  2A3S A;  3JSP A;  2MBF A;  1P4A A;  1R7J A;  2FNP A;  3I54 A;  3SZP A;  1YLF A;  2ISZ A;  1IUY A;  3V8J A;  4HAM A;  2XKP A;  4HF1 A;  1G3Y A;  2XAS A;  2PQ8 A;  1YW9 A;  2YX7 A;  5JR3 A;  4L5J A;  3O2P E;  3KCC A;  4I01 A;  1J7K A;  3ML6 A;  2NYX A;  2ACJ A;  5DCM A;  2H6C A;  3O6B B;  3RTR A;  1KU7 A;  3QAH A;  4I98 B;  1YFH A;  1ULY A;  1HKQ A;  1AWC A;  3LAP A;  4LD5 A;  2CYY A;  1K79 A;  1F5T A;  3CJN A;  3M1E A;  3G3Z A;  1FPQ A;  2VT2 A;  3HRT A;  4FT8 A;  2VOO A;  5E1X A;  3DP7 A;  1KU2 A;  5TJJ A;  4LMY A;  1WRJ A;  3LAJ A;  2RV8 A;  4I7H A;  2M45 A;  4MQV A;  4WXC A;  5CVU A;  4HF2 A;  1BI3 A;  2XAF A;  2OU2 A;  3P9I A;  2YPR A;  3ELK A;  5D8L B;  4KIF A;  3LFK A;  3B73 A;  3LQR A;  1Q1H A;  3TQN A;  4ZZD A;  1MJA A;  1DUX C;  3M8F A;  2VON A;  2A5Y B;  2DQL A;  4EJU A;  5L3G A;  3KP7 A;  1SMY F;  2Q0O A;  4Y15 A;  1GVJ A;  1YS7 A;  3BP8 A;  2ZO4 A;  2VE9 A;  1H9G A;  2F5E A;  2EV6 A;  3V7C A;  2GQQ A;  3V4G A;  2DO7 A;  2IP2 A;  2FXA A;  2JSC A;  4L0Y B;  1R5G A;  3LA7 A;  4XSX F;  1WKM A;  3F8B A;  3WTX C;  3EYY A;  3D5L A;  2P7V B;  4CGZ A;  3GWZ A;  3ZP5 A;  2HKX A;  2O03 A;  3I59 A;  2DBB A;  3I53 A;  1ZRC A;  2DQR A;  3BJA A;  4P55 A;  5D4S A;  1WSU A;  4WXD A;  4ZH4 F;  2W57 A;  3MAJ A;  1K6O A;  3ZQ7 A;  1LDD A;  3V7S A;  2PBI A;  1IN4 A;  3WTZ A;  1I1S A;  5ILS A;  3J7A O;  1JHH A;  2KIM A;  4CO8 A;  1TQI A;  2CGP A;  2RGV A;  1SAX A;  1BBY A;  4ZZL A;  3GVA A;  4N9I A;  4KDP A;  2BE5 F;  1FLI A;  5FO5 A;  1MJ9 A;  1B1B A;  1T6S A;  2P4W A;  3MQ0 A;  2NNY A;  5EEH A;  3ULQ B;  1T98 A;  4WF2 A;  2L3D A;  2GWR A;  1TNT A;  1LVA A;  3PFI A;  1XCB A;  1R1U A;  2P6S A;  1S7A A;  2M1B A;  2RQP A;  3ZMD A;  2QBY B;  2UWM A;  3V7R A;  3HTS B;  4WXH A;  2W25 A;  3EUH A;  3FXR A;  4AIH A;  3WGI A;  3JW4 A;  2D2W A;  1ZLJ A;  2F5F A;  4HZF A;  5JI6 A;  2MLG A;  1ON1 A;  1C0W A;  2EV5 A;  4E70 A;  4YFN F;  4EQQ A;  1KYW A;  3BPX A;  5E8I A;  1GXQ A;  3W6K B;  2OZ6 A;  3TDZ C;  1I1G A;  3M7G A;  1MDM B;  1KQ0 A;  5K5O A;  2VXZ A;  3F8N A;  5LEJ A;  2JZY A;  2GA2 A;  2ZFW A;  1IXC A;  2IA1 A;  2TDX A;  4FHT A;  2EA4 A;  1WI9 A;  3BOQ A;  1TLH B;  4NB5 A;  2FA5 A;  3FMS A;  4HOB A;  4MQ9 F;  2Z9O A;  1TQM A;  3HHH A;  5H6R A;  1HW5 A;  1R5H A;  3JSO A;  3GFI A;  4IHS A;  4AIK A;  3BJ6 A;  2OAZ A;  3E97 A;  2F2E A;  3HHG A;  5FFZ A;  4HX8 A;  1BI0 A;  1HKS A;  3N4M A;  3E6M A;  1XGO A;  4U0Y A;  3GX4 X;  2M8E A;  2W24 A;  1SFU A;  1G3S A;  3DV8 A;  1PP8 F;  1G6N A;  1KU9 A;  2E7W A;  5F64 A;  1J9I A;  4G8X A;  4GYI A;  2XAG A;  4I0B A;  5ILU A;  3HRS A;  3C3W A;  1ZGA A;  2HR3 A;  3GUD A;  5IT9 K;  1ZAO A;  3GEZ A;  2RKH A;  4A5N A;  2EFP A;  1GHC A;  4EJO A;  3QPT A;  5J8F A;  2RNJ A;  3GLX A;  3TOB A;  4LK1 F;  4AD9 A;  2DK5 A;  2KIF A;  4L5I A;  3DFG A;  1T0F A;  1ZN2 A;  4LB5 A;  4Q4Z F;  3BZ6 A;  4ENM A;  2QVO A;  4UHT A;  5IT9 Z;  4KA4 A;  3F72 A;  2XAQ A;  2Y75 A;  3G73 A;  1XGN A;  1ZLK A;  4EJW A;  1ZG3 A;  3HUG A;  2R3S A;  2OD5 A;  2HTJ A;  4WX9 A;  4BNC A;  4L18 B;  3FXU A;  1RZ4 A;  3DKW A;  4M74 A;  3WTS C;  5ICC A;  1Y0U A;  2ZNZ A;  2VC0 A;  2FQ3 A;  1BJA A;  2EB7 A;  2DI3 A;  4IJA A;  1TQP A;  1IN8 A;  2J5O A;  3T0Y A;  3SQN A;  2V1U A;  1UHM A;  1S6L A;  1BN5 A;  2K7L A;  2XRN A;  3FF5 A;  5ILV A;  1UHW A;  5ED4 A;  1D3Y A;  1BI2 A;  1KQ8 A;  4XLP F;  4EJT A;  2C6Y A;  2PJP A;  4B8X A;  3REO A;  2UXX A;  4D0P A;  2XRO A;  4UXN A;  3K1P A;  3K0L A;  4FX4 A;  4EM2 A;  1P2F A;  2JTV A;  4OIR F;  2RVC A;  1MJB A;  5LHI A;  3E5U A;  4I02 A;  3WTU C;  2JPC A;  4YFK F;  4M6X A;  1G4D A;  4RB2 C;  1K7A A;  1U5T A;  2YSR A;  4EMS A;  5CVV A;  2MA3 A;  4HDU A;  2FMY A;  3KZZ A;  1YW7 A;  2XAH A;  3EET A;  2GZW A;  2OQG A;  1ZRF A;  4HLY A;  4HQE A;  2ZKZ A;  3PQK A;  1LDK B;  2G7U A;  1BIA A;  4BHP A;  1EH7 A;  2ZBK A;  2W84 A;  3KP5 A;  5BQT A;  2IVM A;  2IT0 A;  3IKV A;  3Q5F A;  1FYM A;  5LRS A;  2EWN A;  2V9V A;  3JTH A;  2ZME B;  2BV6 A;  1RI7 A;  3ZMS A;  2XIG A;  1KA8 A;  3IHU A;  3WU1 B;  3F23 A;  3GFJ A;  4KUM A;  1JGS A;  5L3B A;  5KK1 A;  1Z9C A;  1XMA A;  3ZN0 A;  5JVT A;  1FP2 A;  4G94 A;  2NRA C;  2P8T A;  3TKY A;  1PUE E;  4KIG A;  3U2R A;  5HS7 A;  5AIQ A;  3RJP A;  3SXY A;  4A2U A;  4ENK A;  4I09 A;  3KP3 A;  1A04 A;  3K69 A;  2Z3Y A;  2O3F A;  3DF8 A;  4G7H F;  3HSR A;  3L09 A;  5CLS A;  1ODD A;  4M73 A;  1QPM A;  5LGN A;  2QLZ A;  3U9G A;  3QU6 A;  2UXN A;  2HTS A;  2K02 A;  3D0S A;  1F1Z A;  2P6T A;  2GA1 A;  3ECO A;  4OU0 A;  3TO6 A;  1O3R A;  4Q47 A;  4BHC A;  2Y48 A;  3S2W A;  3R60 A;  2H94 A;  5AON A;  4LG0 A;  3ERE D;  1J75 A;  2FU4 A;  2ZCW A;  3BPV A;  2Q8K A;  1EV7 A;  3I59 B;  3IWF A;  2VOD A;  3CUQ A;  1CF7 A;  4M9Z A;  2PMU A;  5K1Y A;  2RC4 A;  3I64 A;  5JFR A;  2VC1 A;  2VBX A;  1BIB A;  2L4M A;  4L9T A;  1KQ9 A;  1XGS A;  5HLG A;  5FLX Z;  3T8T A;  1U5T C;  1Z6R A;  4PCQ A;  2YR2 A;  1XCV A;  4XSZ F;  4LB6 B;  1KYZ A;  3U1D A;  4KNY A;  4CHU A;  4JK1 X;  4MTE A;  3R61 A;  3NRV A;  5F6F A;  4G9Y A;  5LEK A;  2D1H A;  4HLX A;  2EJR A;  1KGS A;  5H6Q A;  2NAZ A;  4GCV A;  1QBJ A;  3FM5 A;  3B02 A;  4M9X A;  3H3U A;  2V1D A;  5LRR A;  4OIN F;  3EYI A;  3CO6 C;  1RUN A;  2CSO A;  2Y0M A;  1B59 A;  4ZYG A;  2ZNY A;  4ZYE A;  1BC7 C;  1D8K A;  2F5C A;  4ASN A;  2D45 A;  1W7P B;  3HOS A;  4KFC A;  3GW2 A;  3DPT A;  4RAY A;  4RB0 A;  1TBX A;  4LGW A;  1LNW A;  1R1V A;  4IRG A;  5KVR A;  1YW8 A;  3VEP A;  3SFZ A;  4JQF A;  6PAX A;  3KLO A;  2LKP A;  5CJ9 A;  4BHB A;  1XMK A;  2G9W A;  3F8M A;  2QZ8 A;  1J5Y A;  1MKM A;  3FXQ A;  2YU3 A;  4CDG A;  1U6G A;  4ENN A;  3L2C A;  1FT9 A;  2CQK A;  2STW A;  1PDN C;  4HQM A;  4L0Z B;  1SD4 A;  4L9J A;  2HKO A;  2WV0 A;  3QP6 A;  4ENJ A;  2UZK A;  3F21 A;  3NEU A;  2AS5 F;  1FYK A;  3BDD A;  3ECH A;  2WC2 A;  1E17 A;  5HLH A;  3I4P A;  1PP7 U;  1T38 A;  4OMY A;  1DDN A;  3RKX A;  2XV4 S;  1H0M A;  1I6X A;  2FBK A;  1K78 B;  3DQV C;  3GZ5 A;  3LQQ A;  3GFM A;  2P5L C;  3HRM A;  3QOP A;  3ABU A;  1LEA A;  1W5T A;  2QWW A;  3QPH A;  5K5Q A;  1UB9 A;  4MEX F;  1FBQ A;  4A6E A;  2DTR A;  2DK8 A;  3IRR A;  2PG4 A;  2IJL A;  1HBX G;  4RGU A;  2X0L A;  3QU3 A;  3LA3 A;  3VOE A;  1O57 A;  2A69 F;  5H20 A;  3KP2 A;  2EFW A;  1OYW A;  3HSF A;  1T39 A;  1FY7 A;  4O6J A;  5HDN A;  1USS A;  3F6O A;  1BI1 A;  1B4A A;  1W4M A;  5D5W B;  2KIU A;  3QP5 A;  4Q48 A;  3CLO A;  4JBA A;  5K5R A;  4P5O A;  4CYD A;  1ON2 A;  3VOD A;  5LHG A;  5A2Q Z;  5ICF A;  2LDU A;  1Z7U A;  1I27 A;  3K1M A;  1HKT A;  3FX3 A;  3MZH A;  4U88 A;  2IW5 A;  2O8X A;  1D8J A;  2L02 A;  3I0T A;  4MEY F;  2EV0 A;  2MC3 A;  2DFI A;  4PGH A;  3KE2 A;  3WGH A;  4R79 A;  5ERI A;  3M8E A;  1YTY A;  2QBY A;  2G7H A;  1L0O C;  3ZMZ A;  1FWZ A;  1R1T A;  2JRT A;  3CDH A;  4IHT A;  3WG9 A;  4LJZ F;  3IL2 A;  5D5X B;  3FWE A;  5DCF A;  2VBZ A;  2M87 A;  1FX7 A;  1ZGJ A;  2HYG D;  2HOE A;  2WWY A;  3BY6 A;  3KP6 A;  4UVA A;  2DAO A;  2IPQ X;  4L9V A;  1SFX A;  1IN5 A;  1MDM A;  2ZXJ A;  3MEX A;  4N0B A;  3EDP A;  2KKO A;  5L3D A;  4ETS A;  3RKW A;  1P92 A;  2CW0 F;  3WGG A;  5LGT A;  3QRF F;  2BGC A;  1KU3 A;  3K2Z A;  5BMZ A;  2V6C A;  1HST A;  1W7P D;  5ICE A;  3C18 A;  5L3E A;  4RB1 A;  1U5T B;  2LF8 A;  5DD4 A;  5F1R A;  2KJC A;  1ZYR F;  3O3K A;  2FEZ A;  2VT3 A;  1S8N A;  2A6H F;  1B6A A;  1P6R A;  1SD6 A;  1LEB A;  2PLY A;  1SMT A;  3WTW C;  2FNA A;  2EFQ A;  2FOK A;  5DEQ A;  5J6X A;  1R23 A;  1J2X A;  2PN6 A;  3OOP A;  2DPD A;  3T8R A;  2ESN A;  1FBU A;  2HDC A;  2Z33 A;  5AIP A;  1IXS B;  1ZG5 A;  4I0A A;  3HIF A;  4OIP F;  3CO7 C;  2OBP A;  2HGC A;  3E6C C;  1R58 A;  2HFH A;  1IRG A;  3R0J A;  3E6D A;  1MGT A;  3Q9S A;  4PZJ A;  3MCZ A;  2AXL A;  4M6Y A;  5CVI A;  3CTA A;  1FC3 A;  2ELH A;  4HDV A;  5HLI A;  1F9N A;  2XKO A;  5CVR A;  1T2K A;  1G3T A;  1YYV A;  2EFO A;  2QM3 A;  4AWX B;  2HS5 A;  4EJV A;  5CVJ A;  1IW7 F;  4UV8 A;  1Z6T A;  4OIO F;  1B9N A;  3FMQ A;  3V8L A;  3RPQ A;  1IRF A;  3KET A;  5D6F A;  1W5S A;  2V79 A;  3TOA A;  3T5X A;  1TW3 A;  2XUB A;  2RN7 A;  2PMH A;  3MZY A;  1UST A;  1R36 A;  3Q9V A;  1RIO H;  2O6G E;  4G6Q A;  4A6D A;  2VN2 A;  2O61 A;  5DYM A;  4YFX F;  2KJB A;  4KIB A;  3AAF A;  3ZN1 A;  5DCM B;  3E3V A;  1E2X A;  4MNU A;  1ZH5 A;  4KN4 X;  3F8C A;  4HW0 A;  1YO5 C;  4Q5S F;  4O5V A;  4U0V A;  5CYV A;  1IZ1 A;  2EK5 A;  3L9F A;  2MH2 A;  2EFN A;  4H0E A;  4L9N A;  3SHF A;  1XSV A;  2K27 A;  2H6B A;  1DP7 P;  1FOK A;  5FB2 A;  1ZAR A;  4WCG A;  2EA2 A;  2HQN A;  1FZP B;  1HW1 A;  1IN6 A;  4BQA A;  4R1H A;  4OOI A;  4G7O F;  2QQA A;  4ZYD A;  3GYH X;  2KRF A;  2XGX A;  4LLG F;  4QWQ A;  1WWX A;  3W6J B;  1HXD A;  5L3F A;  2CWE A;  2VBW A;  1O3T A;  3GF2 A;  1QNT A;  5HDG A;  4YG2 F;  5BPD A;  3VFZ A;  1R00 A;  1IAW A;  3F3X A;  4NQW A;  5EEG A;  3KFW X;  2DT5 A;  1YS6 A;  1BM9 A;  2GIV A;  3HTU A;  4Y17 A;  1O7L A;  4CIC A;  2V1X A;  1OYY A;  1SD5 A;  1LDJ A;  2IA2 A;  4YII A;  1TTY A;  1EH6 A;  5E18 F;  1X3U A;  2FML A;  3ISP A;  5FLX K;  4GGG A;  3L7W A;  3BWG A;  3IRQ A;  1XB4 A;  1G3W A;  1L3L A;  2Z5U A;  3IKT A;  3E6B A;  4MHG A;  4CXF A;  3RYR A;  3CUO A;  1S3J A;  2J5P A;  4AIJ A;  1AOY A;  3TGN A;  2DPU A;  2Q2E A;  1OYI A;  1S7O A;  1YIO A;  2H27 A;  4A0Z A;  3K9T A;  1FBS A;  2HWV A;  3P9C A;  3DPL C;  5DUI A;  2D1V A;  5FD5 A;  5HVQ C;  3RKY A;  2JT1 A;  3ZMV A;  1S29 A;  2A68 F;  5E17 F;  1B9M A;  2FBH A;  5DV5 A;  2ZME A;  1YQA A;  1UFM A;  3ROU A;  2XAJ A;  4HV5 A;  5LBQ A;  1ZHF A;  4GYG A;  3H3Z A;  5DDG A;  5E1W A;  5D5U B;  3N97 A;  1J0R A;  2MD5 A;  3KEO A;  4LLN A;  2ESH A;  2FBI A;  4FX0 A;  1U78 A;  2E1C A;  1HQC A;  1V4R A;  1NHA A;  1OMI A;  2L4A A;  4GXO A;  4O3M A;  3WTV C;  4WK8 F;  1Z05 A;  1FP1 D;  4EGZ A;  2MH9 A;  4A0X A;  5LGU A;  3V8K A;  5DUK A;  3E5Q A;  4A0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...