2LSOA

Solution nmr structure of the globular domain of human histone h1x, northeast structural genomics consortium (nesg) target hr7057a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H1x
publication title Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A
rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lsoA00
1TLHB 2MLKA 1HKQA 3ELKA 4MEXF 4B09A 1MDMB 5LHHA 4KMUX 3TOBA 2Z33A 2STWA 1O7LA 3GO5A 2H09A 4HYEA 1J0RA 1S6LA 3IHUA 5FD5A 1TBXA 3GUDA 4Q4ZF 3IRRA 3F23A 3FMRA 2CSOA 1JHHA 4ETSA 1W7PA 3AAFA 4KIFA 3P7NA 4M74A 2A07F 3I58A 3P9CA 4AD9A 2R7FA 5J6XA 1LQ1A 1H0MA 2QWWA 1LDDA 1ZG5A 4WK8F 3T8TA 2KIUA 2EV6A 2MH9A 2Z3YA 1B1BA 4TV7A 4CXFA 2OD5A 1QQIA 5FFZA 3DFGA 4EJWA 5H6QA 2VBWA 2FA5A 3HHGA 2K27A 2Z5UA 1ZRCA 1XB4A 1QBJA 4F7ZA 1BI3A 4YIIA 3DP7A 1J59A 1MD0A 1XDSA 4PZJA 3U2RA 4M71A 1KQ0A 5TRDA 1MGTA 2XHKA 2K4BA 1QPMA 4RAYA 1TW3A 5J8FA 1OR7A 4RGSA 1XCBA 3HTUA 1WRJA 4M9XA 2PMUA 2GA1A 2RNJA 2KIFA 1F4KA 1S3JA 4OIQF 1ODDA 2ZFWA 3FF5A 1FLIA 2MBFA 2EJRA 1J2XA 3ECOA 5CVIA 2LNBA 4CHUA 3C1DA 4M72A 1ULYA 2XV4S 3E5XA 4HZFA 3M8EA 4KYWA 5JHUA 2XROA 1ZREA 3MCZA 1X3UA 1FBQA 2W85A 3CO6C 2LKPA 1KQ9A 4BH9A 2J5OA 2VC1A 3T0YA 2XGXA 4NB5A 2FMLA 2RGVA 3IKTA 5ERIA 3QRFF 4AIJA 3HSEA 1BC7C 3V7SA 1U3EM 3K1MA 1T2KA 1YTYA 5L3DA 1QZZA 4BQAA 4IVNA 4MQ9F 5E18F 4UVBA 1G3SA 3R4KA 2KJCA 1LNWA 5DD4A 4P9UA 5BOXA 1V4RA 5JVTA 5HS7A 2M45A 1JHFA 2A68F 3DPTA 3E5QA 2V1UA 1Q1HA 1L0OC 1KGSA 3GFLA 4Z2YA 3CLOA 2FBIA 4LG0A 1HQCA 2ZCWA 3R61A 1R5HA 5LGUA 2V1DA 3GLXA 5ICCA 1U5TC 2WC2A 3R60A 2RVCA 2HKOA 1W7PB 1I6XA 2HWVA 1OYIA 3DKWA 4ON0A 5D8KB 2HYFA 1K7AA 2FOKA 3HOTA 2D2WA 2PI0A 4Y15A 1IUYA 4BAYA 1Z6RA 4IRGA 2DBBA 5ILUA 1EV7A 3RYPA 5LRRA 2ISYA 1BN5A 4ESFA 3E6BA 3J81Z 1YW8A 3RKXA 4FX0A 3LFKA 3KP6A 4WXCA 4KICA 4MTDA 3GZ6A 1ZN2A 3H3UA 4GGGA 1HW5A 1GHCA 5F1RA 4WF2A 3CTAA 4OMZA 3HOSA 3EQLF 4FHTA 4HOBA 4AWXB 1USTA 4P5OA 2NYXA 3J81K 2IW5A 3QU3A 2VOPA 1U8RA 3OV8A 3HHHA 4G9YA 4I98B 3ULQB 2DFIA 3LSTA 4B8XA 2FRHA 3WE3A 4CZZA 2O8XA 3O6BB 3E6MA 2Y75A 1NHAA 2XASA 3LAPA 1PUEE 5HDKA 4LD5A 2XAFA 1W5SA 1W5TA 1OYWA 4KT5C 3HSRA 2A6HF 1LDJA 2DPDA 3WU1B 5CVUA 2MC3A 4M9SA 4UV8A 1Y0UA 1O3RA 3FZVA 1SMTA 1BJAA 3PQKA 1PP7U 3QU6A 1S29A 1LEBA 4MQVA 4RS8A 5AIPA 1LJ9A 2VBYA 3M8FA 2X0LA 5HDNA 2YR2A 3T8RA 4BYYA 4IXAA 2IJLA 3HYIA 1WKMA 2YX4A 1FWZA 4U0VA 1ON1A 2EK5A 3FXUA 1QGPA 2VXZA 1H9TA 2MA3A 2LSOA 4G7HF 3BJAA 5FGMA 1YS7A 3C7JA 2G9WA 2OZ6A 1ZHFA 5DV5A 4EGZA 2PLYA 4R79A 1IXCA 2RV8A 4LG0B 3TKYA 5CLSA 2CW0F 5E20A 1QZYA 2BGCA 2DTRA 4S05A 4L5JA 4M6YA 3TO9A 5HOOA 3WTUC 2IP2A 2BBYA 1DP7P 1U6GA 2GQQA 1ZGAA 2L54A 2HR3A 2CO5A 3WTYC 1B59A 1XGOA 3KP3A 1TNSA 3ROUA 3J80Z 1IN6A 2COMA 1U5TA 2PQ8A 2QVOA 3J7AO 5DDGA 1CF7A 4MHGA 1G3YA 1SD4A 3MWMA 2CWEA 4MEYF 3I54A 1YW9A 5DEQA 5H6RA 1Z6TA 4RB1A 1KU3A 1HKTA 1XMKA 3F21A 2Q2EA 4ASNA 2NRAC 1RZ4A 5HVQC 2EFOA 1I1GA 1FZPB 3NRVA 3WTXC 1XN7A 3J80K 3QAHA 1B9MA 1RUNA 5TJJA 1UHMA 3KP7A 3V7RA 1XSDA 3FM5A 2RKHA 3I59A 3H3ZA 3ZMZA 2G7HA 2ZMEA 1FPQA 2IRFG 3O3KA 5HLHA 3F3XA 4YFXF 4EJVA 1FX7A 4I09A 1TQMA 3ML6A 3KZZA 4EM1A 3REOA 5ILVA 2HS5A 2ZXJA 4MGRA 3JTGA 4OIRF 4HQEA 4L9TA 5DCMA 2L01A 2LDUA 3PFIA 3GW2A 3N97A 4EVIA 1IRFA 1XGSA 2QENA 5LHGA 2L02A 1D8KA 1V3FA 2HFHA 1LEAA 1FYLA 2HTJA 3N4MA 4QLCU 1P92A 5E8IA 4LLNA 4HF0A 3ABUA 3V8LA 2F5FA 3DXJF 5FFXA 3G3ZA 3I71A 3R6SA 3M1EA 4A12A 1J9IA 2OA4A 3MZHA 3V4GA 3ZN0A 1XSVA 2EFNA 1WQ2A 5FD6A 3KP5A 1XCVA 2DAOA 4P9FA 2KKOA 2K86A 1U2WA 2FE3A 3RIRA 5ICFA 2HTSA 2A61A 3EETA 2C6YA 2NS0A 2JTVA 2ESHA 3R0JA 2E1NA 3C3WA 4EMSA 2K4JA 2DU9A 4LK1F 4HV5A 4KN7X 1ZYRF 1T0FA 1REPC 2CFXA 4U0WA 3SQNA 3IC7A 2DK8A 3HRMA 1OYYA 2ESNA 2D45A 3COAC 4L0YB 2RC4A 1E17A 3HIFA 1YS6A 3M7GA 4O3MA 3GXOA 2EA4A 3IWFA 5F64A 1I27A 4ZH4F 3S2WA 2RDPA 2O6GE 4ENNA 1G3WA 4HBLA 5BMZA 1P6RA 4EJOA 4XBFA 1YO5C 3LA2A 2ETHA 1ONVA 4WWCA 1W7PD 4LJZF 3E97A 3CUQC 1CGPA 4BNCA 3E6CC 1BC8C 3BDDA 2YX7A 1S7AA 1U5TB 1UCRA 2EFWA 1Z7UA 1CF7B 4RGXA 2OU2A 5EEGA 3CUOA 2K02A 3B02A 1ZRFA 5DUKA 1BIAA 3MZYA 5BPDA 1YYVA 4JBAA 5D4SA 1I5ZA 3GZ5A 3I59B 1SD5A 2ZKZA 4L9VA 1MJAA 2ZMEB 3LQQA 5CVVA 5D5XB 5E8GA 4NHJA 2RQPA 1T98A 2XAHA 4ENJA 1F9NA 3F8NA 4HX8A 2VBXA 1FBUA 4PCQA 2GA2A 1R5GA 1HKSA 1ZGJA 3OOPA 4L18B 5E1XA 1S7OA 3EYIA 1U78A 3K1PA 3ERED 2VN2A 1JGSA 3SXYA 1OPCA 4BHCA 1KQ8A 1E2XA 3IWZA 4OMYA 3JAMZ 2K7LA 4YG2F 4LLGF 3GX4X 3WTSC 4M9ZA 3SHFA 3DV8A 2ADUA 2JT1A 2EFQA 2VC0A 3VOEA 2E1CA 1PP8F 4U0YA 4E70A 1FP2A 4U7BA 4HLYA 3F22A 2W57A 2F2EA 2BE5F 3I4PA 5ILSA 5KK1A 1S8NA 1SD6A 4U88A 3JW4A 5D4RA 3RDIA 4WXDA 3F6OA 4L9JA 2V1XA 4K2EA 4P96A 1DPUA 4EM2A 2HGCA 3EDPA 2VE9A 5AONA 4DNCA 4KA4A 1IN7A 4GYGA 1GXPA 1RI7A 4JQFA 2VBZA 5L3FA 3HSFA 5J8CA 2QQAA 2V6CA 1QO0D 2OAZA 2H6CA 3FX3A 2M30A 4A6EA 1IW7F 1T39A 2FMYA 3IL2A 1YW7A 3K9TA 4LB6B 4I2OA 1YLFA 1R1UA 1XGMA 2EV5A 3SZTA 4HF1A 2OZUA 4EGYA 2FNAA 4GCVA 3BOQA 1R1TA 2Z99A 3W6JB 4LLLA 1STZA 2CG4A 3MEXA 1VTNC 5D6FA 2A6EF 1KYZA 1O3QA 2B0LA 1ZH5A 4YIFA 2UXNA 3Q5FA 4XLPF 1F5TA 2G7UA 4YFNF 3ISPA 3CUQA 4UNOA 1R36A 2IA1A 2P4WA 4HW0A 4N0BA 2P5VA 3WTZA 5BS6A 5L3CA 4G6DA 2DLLA 4GYIA 3U9GA 4I0BA 3ZMVA 2WWYA 1F1ZA 3GFMA 1DDNA 1A04A 3U1DA 4PDKA 3QP6A 2QM3A 5JI6A 5L3BA 5D8LB 4A0XA 3P9KA 3D0SA 2Q8KA 3TQNA 1IXSB 1IN4A 3TGNA 3FXRA 2XAQA 3Q9SA 3WE2A 3TOAA 2PJPA 4HDVA 4I0AA 2KRFA 2O0YA 5AIQA 6PAXA 2E7XA 2FXAA 1O7FA 1Z1DA 2LF7A 1BI1A 2PG4A 3HRTA 2PFBA 4XSZF 5D5UB 3I64A 1FT9A 4OIOF 3V8JA 2VOOA 1R7JA 3M9AA 4MNUA 1R00A 4ENMA 4UV9A 3RJPA 2XVCA 4XRFA 3EUHA 3KE2A 2EB7A 5LGTA 2WTEA 4CDGA 2JRTA 3CJNA 3QOPA 4PGHA 2AS5F 1BM9A 2QZ8A 2HYGD 1TW2A 4IJAA 3SZPA 3P9IA 3H92A 2DO7A 4I7HA 1ZRDA 3RPUA 4I01A 4CYDA 3KETA 4LK0F 2IVMA 3F8MA 4H0EA 3F72A 3KZYA 3HRSA 4EJUA 1SFUA 4ZYHA 1XD7A 1IRGA 3ZMDA 3GFJA 2D1VA 5CYVA 4MTEA 4A6DA 5H20A 2P8TA 5FLXZ 1YIOA 2L4MA 5D5VB 4ZZLA 2L4AA 1R23A 1WI9A 2H94A 3L7WA 2XAJA 4RB2C 4Q47A 3G73A 1O3SA 1YQAA 1H9GA 5E1WA 4WCGA 1UHWA 5D6EA 4Q5SF 4ZYDA 3LQRA 3FMQA 4KFCA 3ZPLA 3W6KB 3FHZA 1ON2A 1KU7A 2V9VA 2GXBA 1B6AA 4GO1A 2UWMA 1Z05A 4IRHA 5LEKA 2FNPA 2M8EA 2W24A 3DEUA 4BXUA 2XAGA 2DI3A 3DF8A 1IN5A 1HXDA 4AVPA 5LEJA 2F5DA 1HSJA 5LRSA 5E17F 3L00A 2IT0A 4S04A 3WTTC 2YU3A 4AIHA 4KIGA 1ZLKA 3ZQ7A 3MFKA 1FC3A 3CUQB 4HAMA 4EV0A 2P5KA 2X4HA 3TDZC 2VT3A 5LGNA 1QNTA 2DQLA 2MD5A 3FMSA 4LMYA 1RIOH 2DT5A 3MAJA 4ESJA 3QPTA 1HW2A 2JPCA 4OINF 4HX4A 1AOYA 5EEHA 3FWEA 4GXOA 3LA7A 1R22A 3SFZA 2O61A 1ZAOA 2QQBA 4IF4A 5BQTA 2XRNA 5K5OA 2BEOA 3WODF 4CO8A 3TO6A 1MJ9A 2GXGA 1TQIA 4ZZDA 2EFPA 4YFKF 1Z91A 2L3DA 1K78A 3WG9A 1K79A 1UB9A 1BIBA 4A5MA 2QBYA 3VEPA 2NNYA 4R8HA 5KVRA 1BI0A 3GWZA 4IHSA 4RB0A 2DK5A 1XMAA 2H6BA 4KUMA 4BHBA 3IKVA 1W4MA 4Q48A 2P6TA 2V79A 1IXRC 1FSEA 4HV6A 4L5IA 1ZG3A 3QP5A 3ZMSA 1FBSA 4NQWA 1KU9A 3L2CA 2Z9OA 2M5WA 3DPLC 5JFRA 3GYHX 5CJ9A 1DPRA 2OQGA 3E5UA 3TO7A 3FM3A 4UVCA 5K1YA 2VODA 4EQQA 5L3GA 1IN8A 3GF2A 4M6XA 5CVJA 2VE8A 3RTRA 1FOKA 4G94A 3ZP5A 1TQPA 4LB5A 1KYWA 2LF8A 1GXQA 2JPBA 4AIKA 3I5UA 1USSA 4P55A 3T1BA 5JR3A 1GVJA 3GFIA 2IPQX 3B73A 1IF1A 1B9NA 2GWRA 4OIPF 2Y0MA 4A0ZA 2P6SA 4A2UA 2FEZA 2HQNA 1FYMA 5LLQA 2ZBKA 1C0WA 5DUIA 4RAZA 3CO7C 3MQ0A 3E6DA 4XLNF 3LWFA 2KIMA 2DQRA 1J7KA 2QLZA 3WTWC 4G8XA 2QUFA 5DCMB 3BROA 3QPHA 3BY6A 5DCFA 3WGHA 1YFHA 1O57A 3K2ZA 4UHTA 3O2PE 2EA2A 1HBXG 1XDUA 4Y17A 1R58A 1RNLA 3LAJA 4CGZA 3KP2A 1D8JA 2PBIA 1KU2A 3I0TA 1UFMA 2DW4A 4O5VA 4RB3C 2FBKA 4G7ZF 2ZO4A 2QQ9A 2FF4A 2HQRA 4QWQA 2XUBA 1JE8A 2XKPA 2IA0A 3F8CA 1LB2A 4LFUA 1MZBA 2ZNYA 1BBYA 3BPXA 2YPRA 4A0YA 5IT9Z 2ELHA 3JSPA 1J5YA 1EH8A 4HF2A 1IZ1A 4OOIA 2HDCA 1G4DA 1SFXA 2FBHA 3KLNA 1ZARA 2PEXA 1DUXC 2P7CB 3JAMK 2FSWA 2HEOA 1KA8A 5IT3A 3KCCA 3V8KA 1MKMA 3WGGA 3ECHA 2M1BA 1FSHA 2R7DA 3BJOA 5A2QZ 3L09A 5HDGA 1SFEA 4CICA 1G6NA 4HLXA 5L3EA 5ICGA 2VT2A 2EWNA 3ZMUA 3CDHA 5HS9A 4KNYA 5IT9K 1K78B 2EV0A 2YSRA 2ACJA 1P4XA 1D5VA 2QBYB 2A5YB 4WXHA 1TNTA 5K5QA 3Q9VA 5A2QK 2GZWA 1P4WA 1OMIA 4RGUA 1WWXA 4LGWA 3GEZA 4I02A 2VONA 2RN7A 3KEQA 2DPUA 2BV6A 3GVAA 4IPAA 2W25A 4PGGA 2FQ3A 1ZG1A 5D5WB 1O3TA 1HW1A 4IHTA 1HSTA 2P5LC 5HLIA 3I53A 3R0AA 3VB2A 3F6VA 2HOEA 5DD8A 3D5LA 1L3LA 2PN6A 5E1ZB 3WU0A 5LBQA 3F8BA 4ESBA 4DQ2A 2W84A 2FU4A 2HKXA 2F5EA 3BJ6A 5F6FA 4M73A 1MDMA 2ZJ2A 3JTHA 1SAXA 1WSUA 3HUGA 2NNNA 2IA2A 5ED4A 5DYMA 2MH2A 2CGPA 2A3SA 4UUVA 4G7OF 1FYKA 3C18A 3RPQA 3NEUA 4ZYGA 4KN4X 2D1HA 2GIVA 3PQJA 1B4AA 2AXLA 1I1SA 5BPIA 4HA8A 4EM0B 3L9FA 1SMYF 3K1NA 5FB2A 2A69F 3ABTA 2J5PA 2KJBA 1J75A 1D3YA 2MLGA 2O03A 4R1HA 3RYRA 5K5RA 4KMFA 3VODA 2XIGA 4ENKA 2Y48A 4HDUA 3BP8A 4RGRA 3WGIA 1P2FA 4FT8A 4L0ZB 2E7WA 3FXQA 4HX7A 2O3FA 4N9HA 2NAZA 4BHPA 3IRQA 1T38A 5ICEA 3RI4A 2P7VB 4OU0A 3LA3A 5LHIA 1FP1D 3RKYA 1MJBA 3E3VA 4IRIA 1ZLJA 2Q0OA 4O6JA 1RUOA 3KEOA 2STTA 2OBPA 3VFZA 1BI2A 1AWCA 4UVAA 1YG2A 3KFWX 3HRUA 1EH7A 4U7DA 1BOAA 4EJTA 3BPVA 1T6SA 3RKWA 1XGNA 2HZTA 2UXXA 3ZMTA 3KLOA 5HLGA 2BYVE 4WX9A 1JXSA 3BWGA 4UXNA 4FX4A 3KP4A 4L9NA 5FO5A 2XKOA 4ZYEA 4JK1X 2TDXA 2UZKA 1PDNC 2JZYA 3NQOA 1FY7A 1EH6A 1SD7A 1LVAA 3WTVC 4KIBA 3K69A 3K0LA 1G3TA 4XSXF 3JSOA 1TTYA 5FLXK 3F8FA 4KDPA 3T5XA 4Y13A 2ISZA 3V7CA 1IAWA 2F5CA 5CVRA 4A5NA 2QYOA 2OQRA 4D0PA 1P4AA 5HS8A 2M87A 4N9IA 1XSXA 3EYYA 2CQKA 2H27A 2WV0A 3HTSB 2R3SA 2ZNZA 4G6QA 1LDKB 2GAUA 1OKRA 1FNNA 2JSCA 2PMHA 3TDUC 1K6OA 3BZ6A 3DQVC 2CYYA 3ZN1A 4HQMA 1Z9CA 1R1VA
chains in the Genus database with same CATH superfamily
1DGWY 2FD5A 1GDTA 4BBSJ 4ZJZA 1TLHB 2XGCA 3K10A 2M7BA 2MLKA 2GLOA 1JT6A 2NVYJ 1HKQA 3ELKA 4MEXF 4B09A 1MDMB 2LMDA 5LHHA 4E7LA 4KMUX 3TOBA 2Z33A 2STWA 2EILH 3HUGB 4NC6A 1O7LA 5J1YA 2Y2ZA 4JYKA 3UKGA 1MMSA 1BJZA 3GO5A 2R7QA 2H09A 4DIQA 2ZXIA 1X1DA 2X1EA 2W4SA 4HYEA 1J0RA 2R7UA 1S6LA 3IHUA 1VQ9I 1B72A 2B63J 2R7VA 3K7AJ 5FD5A 3AG1H 1TBXA 3QWLA 3GUDA 4Q4ZF 3IRRA 2R0QC 3HB9A 4KT6A 3F23A 3M4OJ 3ASNH 3ZQLA 3FMRA 2CSOA 1JHHA 4ETSA 1W7PA 2NVTJ 3AAFA 4KIFA 3BZKA 1A31A 3TW6A 3P7NA 4M74A 2A07F 3I58A 3P9CA 1GVDA 5GAGJ 2BZTA 3IP4B 4FISA 4AD9A 4GRIA 2R7FA 3EUKL 1WJFA 5J6XA 1LQ1A 1H0MA 1D0XA 3CD6I 3BTCA 1QHHD 2JUGA 2QWWA 1LDDA 1ZG5A 4WK8F 2FUG2 3PUBA 3T8TA 1ITYA 2KIUA 2EV6A 2MH9A 3LMMA 1RKTA 2Z3YA 4H4KC 1B1BA 4TV7A 1XC5A 4X0GA 2CS3A 1TWHJ 4CXFA 1YHQI 2OD5A 1QQIA 2VJ5A 5FFZA 2JA6J 3TBIA 4XLEA 5CQGA 3ABKH 5FKKA 3DFGA 2JVGA 4EJWA 5H6QA 4F93B 2VBWA 2FA5A 1HOMA 4IHWA 1VQ6I 2HVQA 1NTCA 2X6WA 3HHGA 2K27A 1MNDA 2Z5UA 2L7MP 4C30A 1ZRCA 3BR6A 3BG9A 1W5CC 2W7NA 1XB4A 3FK7A 2A6TA 4F7ZA 1QBJA 1V55H 1BI3A 4CCLA 2E1MC 3QQAA 2QKLB 4YIIA 3DP7A 1J59A 3SJMA 3N05A 1MD0A 1XDSA 2LYCA 4PZJA 2DDBA 5FRNA 5C4XJ 4E7JA 2DDAA 5J3LA 1HF0A 3U2RA 4IHVA 4X6AJ 3CZ6A 2KT0A 2MGQA 2V9PA 4M71A 5J4YA 4CCJA 1DP3A 1KQ0A 3A02A 2HDWA 1MGTA 5TRDA 2XHKA 2K4BA 1QPMA 4RAYA 1TW3A 5J8FA 4GFBA 2F48A 1OR7A 4RGSA 1ZELA 4ZDLA 1XCBA 1D0YA 5IP6A 3HTUA 3CCLI 4F91B 4CCKA 4B4CA 1SFOJ 1WRJA 3H9GA 4M9XA 3B6CA 2PMUA 4Y4RA 5BNGA 2GA1A 2RNJA 3ZQIA 2KIFA 3D5SC 1F4KA 1S3JA 4OIQF 3GTLJ 4BGDA 1ODDA 5J1RA 2ZFWA 3OIOA 5IYCJ 2VLAA 3OR2C 3FF5A 1FLIA 2MBFA 4LIUA 2EJRA 3OYLA 1W0TA 1J2XA 3ECOA 1VQOI 5CVIA 2DYRH 1SVLA 1J09A 2LNBA 4XLFA 4CHUA 3C1DA 3ESWB 4M72A 3BZCA 1IC8A 1ULYA 2L7ZA 2XV4S 3E5XA 5IOZA 4PSXA 4HZFA 3M8EA 1QVTA 1VI0A 3A4CA 1TWGJ 3OR1C 4KYWA 5JHUA 3CCVI 1Z77A 2XROA 1ZREA 3MCZA 1X3UA 1IV8A 1XMXA 3ZQHA 2R7XA 1OCZH 2EIMH 1FBQA 4B43A 2W85A 1R49A 3CO6C 2XSDC 2H8WA 2LKPA 5F0HA 1E3OC 4MIMA 1KQ9A 2RREA 4BH9A 2HVRA 2J5OA 2VC1A 1YRNA 3T0YA 1G59A 2XGXA 3PM1A 4NB5A 1S7EA 2XF7A 4XKWA 2FMLA 2RGVA 2K3PA 3HKZA 5ERIA 2VQGA 4PJNA 3IKTA 3ZQGA 3QRFF 4GDFA 2BY3A 4AIJA 3J7YJ 3HSEA 5K7ZA 1BC7C 3V7SA 4YELA 5M3FJ 1U3EM 1MH4A 3K1MA 3CCYA 1T2KA 1YTYA 4XKBA 5L3DA 1QZZA 3K4CA 1K4TA 1KZHA 4BQAA 4IVNA 4Y33A 2WB1N 4MQ9F 2EBIA 4HNVA 1FMVA 2MD0A 3ONQA 2Z1DA 5E18F 4UVBA 4ZTJA 5B66C 1G3SA 5LD2C 3KYDB 3BCAA 3R4KA 4PFOA 2KJCA 4XNFA 1GT0C 3BTIA 4BJTA 2HOSA 2WAQN 1LNWA 5DD4A 4A3JJ 2LOOA 4P9UA 1BA5A 5BOXA 1V4RA 5J1UA 3G4SI 4V2GA 3LOCA 2IS2A 3TP3A 5JVTA 3DWLE 5HS7A 2M45A 5C3EJ 4S0HB 1JHFA 4A3MJ 1LFBA 2A68F 1N78A 3DPTA 4A3KJ 3MVPA 2M4KA 3E5QA 2V1UA 3BR2A 1Q1HA 2AQFA 2CQ7A 1L0OC 2ZC2A 1I39A 1KGSA 2W48A 2Y69H 2O5RA 1CQTA 3GFLA 4Z2YA 3CLOA 1A36A 2FBIA 4CA0A 4LG0A 1HQCA 2KPMA 2ZCWA 3R61A 1R5HA 5E3NA 5LGUA 3IH4A 1B72B 1MH3A 2K9MA 2L7KA 1X1AA 2V1DA 3GLXA 5ICCA 1U5TC 2WC2A 3R60A 1R5ID 1VQ8I 2RVCA 1XX5A 2LREA 2HKOA 3OS2A 1W7PB 1MSEC 2VJIA 1I6XA 1WH7A 2HWVA 1OYIA 2BVLA 3DKWA 2CUEA 1W0UA 4ON0A 2E5ZA 4E7SA 5D8KB 3AKZA 2HYFA 4ANJA 2CH0A 2PJRA 1K7AA 2FOKA 3H9JA 3HOTA 3FBIB 2D2WA 1BR4A 5KAIC 2PI0A 1RR7A 4Y15A 5B1BH 1IUYA 4BAYA 1K4SA 1Z6RA 4IRGA 2BHZA 1TP4A 4F92B 2DBBA 4IQ4A 5ILUA 1EV7A 3H36A 2DA3A 4XN0A 3JRIA 1U8BA 1E3PA 2KRHA 2HVSA 3RYPA 1V5EA 5LRRA 2ISYA 1BN5A 2NOJB 1AHDP 4ESFA 3E6BA 2M34A 2ZMEC 4A3LJ 3MZ8A 5FKNA 3J81Z 1YW8A 3LL7A 4CSWA 2O8KA 3RKXA 3GTQJ 4FX0A 2VJJA 3LFKA 3KP6A 2KISA 4XONA 4WXCA 2VUMJ 4KICA 4MTDA 2W00A 4AU7A 3GZ6A 1ZN2A 3H3UA 2ECBA 1HW5A 4GGGA 4AYBN 1GHCA 5F1RA 4WF2A 1S9HA 3CTAA 1RETA 3HOXJ 4OMZA 3I55I 3HOSA 3EQLF 3JR9A 3C2GA 2VL8A 4FHTA 4HOBA 3JCUC 4AWXB 1USTA 1U9OA 1SC7A 4P5OA 1XPXA 3HJEA 4FQGA 3K4LA 2NYXA 3PUFA 5JVGF 1LPQA 2DA7A 3J81K 4HG2A 3X2QH 2IW5A 3QU3A 4NUBA 2VOPA 1A6IA 1HLVA 3WHCA 3IAS2 1Z3YA 1AU7A 3A01A 2B7EA 1WH5A 4BBRJ 1ZKGA 5HNHA 2JN6A 2E60A 1U8RA 1N77A 2ME0A 3HHHA 3OV8A 4G9YA 1U0JA 2MFZA 4I98B 3ULQB 2DFIA 3LSTA 4B8XA 2FRHA 1IJWC 3AG4H 4G12A 3WE3A 2XB0X 4BE0A 2BXYA 4CZZA 2O8XA 3O6BB 3OSFA 4FTHA 3S1NJ 4PJMA 5EDNA 1Y8QB 3E6MA 3LFUA 2Y75A 3BQZA 4BQOA 1BL0A 1NHAA 2G0EA 1YITI 4C9YA 2XASA 3LAPA 3K4MA 2V1NA 1PUEE 5HDKA 4LD5A 4E7KA 2XAFA 4B3AA 1W5SA 5KHDA 1W5TA 1POGA 1OYWA 4KT5C 3HSRA 2A6HF 1LDJA 2DPDA 2E2HJ 3WU1B 5CVUA 2MC3A 4FETA 4M9SA 3A1YA 4B44A 4UV8A 1Y0UA 1O3RA 3FZVA 3OIQA 2EINH 1YRNB 1SMTA 1E0EA 1BJAA 2WAFA 3PQKA 5FROA 1PP7U 3ZQCA 1NK3P 3OYCA 3QU6A 1S29A 1SANA 1T0FC 1LEBA 1TT0A 4MQVA 4RS8A 5AIPA 1LJ9A 3DBHB 1K6YA 2VBYA 3M8FA 4NDLA 3V42A 2P81A 3WU2C 2X0LA 4BKXA 5HDNA 3DCFA 3FK6A 2LVSA 2LBFA 2YR2A 5TISC 3SEZA 2MG4A 1UMQA 4D7NA 3T8RA 3HGGA 4BYYA 4Y52J 4IXAA 2IJLA 3HYIA 1FIAA 4BUPA 1WKMA 2JK3A 2YX4A 3L2QA 1FWZA 3H5RA 4HPQA 4U0VA 1HC8A 1ON1A 2EK5A 4W1UA 3JRDA 2RAEA 3BC8A 3FXUA 4AVZA 1X3WB 2DJIA 1QGPA 1SAUA 1WJAA 2VXZA 1H9TA 5DM7F 2MA3A 2LSOA 4ABZA 4G7HF 2B9SA 4IHXA 3BJAA 4DZPA 3ASOH 5FGMA 3KX2A 1YS7A 4BJ5C 4IOCF 3S17J 2KRCA 3C7JA 4AIDA 1JT0A 5HNFA 2G9WA 2OZ6A 2CV1A 1T08B 1ZHFA 5DV5A 4EGZA 3MD2A 3OYJA 1ENHA 4V19K 3QYBA 1OR7C 3VSLA 2DN0A 3M8JA 4BQNA 4R79A 2PLYA 2LY9A 1IXCA 4EATA 1MSFC 2R93J 1QU3A 2FX0A 2LFBA 2CQQA 2RV8A 5DTDA 3TW7A 3TKYA 4LG0B 4XOPA 5CLSA 3UNGC 2CW0F 2LG4A 3ZCOA 5E20A 2BHYA 3UR3C 1QZYA 4XL9A 2BGCA 1R4MB 1FJLA 2DTRA 4S05A 2XGDA 3CP8A 4L5JA 4M6YA 3TO9A 2JUCA 5HOOA 3WTUC 2CV0A 2IP2A 1ZR4A 4I99C 2XPVA 4HEA2 3L2WA 5EJCA 2BBYA 4BE2A 1DP7P 1U6GA 2GQQA 2I5UA 1ZGAA 4Z6YA 2L54A 2HR3A 2CO5A 3WTYC 1VQKI 1B59A 1Y8RB 1MW7A 1XGOA 4CUGA 4RDUA 2KQRA 1ETOA 3KP3A 3CCMI 3C2HA 1D5YA 2GXAA 1TNSA 3ROUA 2PJRB 2E34A 4RLQA 3OMYA 3J80Z 1IN6A 2R7RA 2COMA 1U5TA 3K6GA 3PNYA 3A03A 2PQ8A 9ANTA 2AQEA 1H89C 2QVOA 3J7AO 5DDGA 1CF7A 5FJ8J 4MHGA 4D5CA 1G3YA 1SD4A 3VYTB 3MWMA 2LKXA 2CWEA 5HLTA 4MEYF 3I54A 2LKSA 1YW9A 5DEQA 5FKMA 5H6RA 5B5EC 1Z6TA 2ICWG 2ZSIB 4RB1A 1BR2A 4BQQA 1KU3A 1HKTA 2IAIA 2CUFA 3F9KA 1TC3C 1XMKA 3F21A 2Q2EA 5GPCA 4ASNA 2NRAC 1RZ4A 5HVQC 2EFOA 2CFOA 2F4OB 2DYSH 1I1GA 1FZPB 3NRVA 3WTXC 2VQHA 1YX3A 1XN7A 2LTPA 2KLOA 3QAHA 3J80K 1B9MA 1RUNA 2XB5A 5TJJA 1UHMA 3QYFA 1QA6A 3KP7A 3V7RA 1WGXA 1XSDA 1BR1A 3QODA 5EF6A 3FM5A 2LRDA 2BY2A 2RKHA 1X3ZB 1RKWA 3I59A 3H3ZA 3ZMZA 2G7HA 4N4OB 1LKXA 2CW7A 3PSFA 2ZMEA 2Z2SB 1FPQA 2IRFG 3O3KA 2JJ7A 5HLHA 3F3XA 1WVRA 2ZJRF 4A3DJ 4YFXF 4JOMA 2AO9A 4EJVA 1FX7A 4I09A 4EEFG 1TQMA 3ML6A 3KZZA 4EM1A 3REOA 5ILVA 2HS5A 2ZXJA 3K4JA 4MGRA 3MKZA 3JTGA 4OIRF 4L9TA 2L01A 1MBFA 2LDUA 3PFIA 5DCMA 3GW2A 4HQEA 1UJ8A 1V5FA 3S2HJ 2CJJA 3A01B 3N97A 1GLNA 3QYEA 2JA2A 2R7WA 1F43A 4EVIA 4BDYA 4OWRB 4C2UA 2X51A 2V4JC 2R5ZA 1IRFA 2XAUA 3CJRB 1XGSA 2QENA 5LHGA 3OYNA 2L02A 2H8RA 1D8KA 1V3FA 3K2AA 1Q1VA 2HFHA 2BW3A 1LEAA 2VKEA 4IEJA 2FOWA 1FYLA 2HTJA 1ZK8A 2IGNA 3N4MA 2WV1A 4QLCU 1P92A 5E8IA 3FXOA 3IV5A 4LLNA 4HF0A 2DXIA 3VPRA 4DBRA 2JQ7A 4JX4A 3ABUA 2EIKH 3V8LA 2F5FA 2LK2A 3DXJF 5FFXA 3G3ZA 3I71A 3R6SA 1FIPA 3M1EA 5EZGA 1WHUA 4RA2A 3CCJI 4A12A 1J9IA 2OA4A 4DYCA 2M4GA 3ZXSA 3MZHA 3V4GA 3ZQFA 3ZN0A 1Z67A 1XSVA 1OISA 2EFNA 1WQ2A 2VPLA 3BCBA 2X1DA 3DEEA 4ITVA 2UV1A 5FD6A 1MMDA 2VIXA 3A0HC 3FIWA 3KP5A 1XCVA 2DAOA 4P9FA 2KKOA 1A35A 2VKDA 2K86A 2HXIA 1U2WA 2JA7J 2FE3A 1BW5A 3RIRA 2FQ4A 1YJNI 2O7OA 2HTSA 2A61A 3EETA 5ICFA 3I56I 2DODA 3HKZN 2NS0A 2C6YA 3W3CA 2JTVA 2ESHA 2LBFB 3R0JA 2E1NA 3FBNB 3C3WA 4EMSA 2K4JA 2DU9A 4LK1F 1ETQA 3QPLA 4C3HJ 4HV5A 4KN7X 5JHFA 1VQ5I 1ZYRF 1T0FA 5IPAA 1REPC 2WADA 5C44J 2CFXA 4FE4A 4U0WA 1VQ4I 3SQNA 1VNDA 3IC7A 3HGYA 2DK8A 3HRMA 1VQPI 1OYYA 2ESNA 2RQQA 2D45A 3COAC 1YI2I 4PK4A 3RQIA 4NC8A 1PYVA 4D7MA 3HOYJ 1KONA 4L0YB 2RC4A 5F08A 1E17A 3HIFA 1YS6A 3M7GA 2R7TA 4O3MA 2L2OA 4F3QA 1LFPA 3GXOA 1OCTC 2EA4A 3IWFA 4A3EJ 5F64A 3TP0A 1RRJA 4AM3A 5KCMA 3DKXA 1I27A 4ZH4F 3S2WA 2RDPA 2O6GE 4ENNA 1G3WA 4XLCA 3I9V2 4HBLA 1ETYA 2L7FP 1P6RA 5BMZA 1VQMI 4EJOA 4XBFA 2E5NA 1YO5C 3S16J 1A6QA 3LA2A 5CKTA 2ETHA 2KZGA 1ONVA 2EZIA 1MMGA 4WWCA 1W7PD 4LJZF 3E97A 2M7AA 1FTTA 3LSJA 5FLMJ 1F36A 3CUQC 1X1CA 1CGPA 4BNCA 4C3IJ 3E6CC 3H0GJ 1BC8C 1WJCA 3BDDA 1JUPA 2YX7A 2R5YA 1IDYA 1S7AA 1U5TB 2ECCA 1UCRA 1ZQ3P 1IG7A 4YIRX 2DA6A 2EFWA 1Z7UA 2LC2A 1CF7B 2F4MB 4RGXA 3S93A 3BR1A 2X9DA 3HEFA 2OU2A 2EQRA 5EEGA 1R9TJ 2CRGA 3BG5A 1YIJI 3CUOA 2K02A 3DTKA 2RNGA 1ORKA 1YX5A 3B02A 1ZRFA 1MMNA 2HYJA 5DUKA 1BIAA 2EH3A 4JX6A 2MW8A 2K9LA 3SFIA 2Y0SA 3VYRB 2M2EA 2Q2EB 3MZYA 2EZKA 1X58A 3SDGA 5BPDA 3PSIA 2EZHA 1YYVA 3CCEI 2GOXB 4JBAA 4KISA 1JKPC 1WPKA 5D4SA 2K9NA 1I5ZA 3GZ5A 3I59B 4P1WA 1SD5A 1Z7LA 4J19A 1XTAA 2V9KA 2ZKZA 4L9VA 3HOVJ 3O8GA 1MJAA 2ZMEB 1DU0A 3LQQA 4UB6C 3JRAA 5CVVA 1P7IA 2NS7A 5D5XB 3EPZA 5E8GA 1YOVB 4NHJA 2RQPA 3HG9A 4PSWA 1T98A 3BR0A 2XAHA 3G71I 4ENJA 3H35A 2DMQA 1F9NA 3F8NA 3HL2A 4HX8A 2VBXA 1FBUA 4PCQA 2GA2A 1ERDA 2NVUB 1R5GA 1X1PA 2ELJA 1K61A 3KEYA 1T95A 2W82A 2M9HA 1HKSA 1ZGJA 3OOPA 3PFYA 2R5ZB 1P9QC 3EUHC 4L18B 3ABLH 2LY1A 1NH3A 1Z21A 5E1XA 2BW3B 1XS9A 3KPHA 1S7OA 1VQ7I 3EYIA 4PJJA 4A3IJ 1U78A 3GTOJ 3BQYA 3DU6A 3K1PA 4HNUA 3ERED 2VN2A 2I8DA 1JGSA 4E7IA 3MMYB 3Q0WA 3SXYA 1OPCA 4BHCA 1KQ8A 2KFDA 1NG7A 1E2XA 2HZDA 3IWZA 4C3JJ 4OMYA 3JAMZ 2K7LA 1Z0XA 4YG2F 3OOUA 4MO7A 4YEJA 4II3A 4LLGF 3WTSC 4M9ZA 4RBOA 3GX4X 4ZDOA 3SHFA 3DV8A 2ADUA 2JT1A 4U87A 5KNLA 2HQ5A 2EFQA 2ZSHB 2VC0A 3VOEA 2VKVA 1EA3A 1HDDC 3FKJA 1MBJA 2JA8J 2E1CA 2EIJH 1PP8F 4XN3A 4U0YA 4E70A 2COBA 5M5WJ 2ID3A 3CC7I 1FP2A 1OQYA 4U7BA 2JSPA 3L2UA 1B8IA 3PIPF 4HLYA 3GCMA 3F22A 2W57A 4G6TB 2F2EA 5J4VA 2BE5F 3I4PA 3G1LA 1TZLA 5ILSA 3HDDA 5KK1A 1S8NA 1SD6A 4U88A 2CMPA 3JW4A 5D4RA 3RDIA 4WXDA 2CQXA 2HXOA 4QTRA 3F6OA 3U21A 4L9JA 2NOGA 2Z16A 1WJ5A 2V1XA 4K2EA 3CDLA 4P96A 1DPUA 4EM2A 2HGCA 3EDPA 2R7OA 2VE9A 2DFHA 5AONA 4DNCA 4KA4A 3H1CA 2QEXI 4HSTA 4UUTA 4NC7A 4M3DA 1IO2A 4BY7J 4XLHA 1IN7A 1MBEA 3PNTA 4GYGA 1GXPA 1RI7A 4JQFA 2VBZA 5L3FA 4QSHA 2XC7A 3HSFA 4XMYA 4QIWN 5J8CA 2QQAA 2V6CA 1QO0D 1I3AA 1N25A 2OAZA 2H6CA 3EUAA 3OS1A 3FX3A 5KAFC 2M30A 3NARA 3OYKA 4A6EA 1TT5B 4AUXA 1IW7F 1T39A 3PO3J 2FMYA 3IL2A 1YW7A 4JP0A 3K9TA 4LB6B 4I2OA 1YLFA 4QPQA 1R1UA 1XGMA 1IDZA 2EV5A 3RZOJ 3SZTA 4HF1A 2OZUA 3BG7A 4EGYA 3WG7H 2FNAA 3D1NI 4GCVA 3U1KA 4HNTA 3BOQA 1GV2A 1R1TA 1IRXA 2BVMA 2Z99A 3VSKA 3W6JB 4LLLA 1STZA 3DPUA 3FXLA 2OV7A 3W6VA 4BXXJ 4B1RA 2CG4A 3ZR8X 2VPRA 3MEXA 1VTNC 5D6FA 3H5NA 2ZJQF 1OLTA 3A2KA 2A6EF 4XRSA 2VASA 1WJDA 1KYZA 1LFUP 1TWAJ 2OF7A 1O3QA 2B0LA 2L9NA 1ZH5A 3JRCA 1Z3XA 4YIFA 2R5YB 2QQ8A 3S3OA 1AKHA 2QKMB 2UXNA 3Q5FA 4XLPF 1F5TA 2G7UA 1WJEA 2LD5A 1WI3A 2X1CA 4FASD 1GV5A 4RAGA 4YFNF 2BY0A 2QF7A 3CQZJ 3ISPA 3CUQA 4D5FA 5FKOA 4DZJA 1R36A 4UNOA 2IA1A 5JLWA 2M3AA 3LSKA 2P4WA 5FRMA 1A5JA 2QGUA 4LITA 2BOLA 4HW0A 5B3SH 1RESA 4N0BA 2P5VA 3WTZA 5BS6A 5L3CA 3OYAA 1MMAA 4G6DA 1FTZA 2NVXJ 4XK4A 2CV2A 2DLLA 4IX7A 4GYIA 5F0CA 3VYSB 4J00A 4BE1A 1PUFA 3U9GA 5M3MJ 4I0BA 2F4IA 3ZMVA 2NVQJ 2WWYA 2QSHX 1OCOH 1F1ZA 3DU5A 2EPFA 3GFMA 1DDNA 1A04A 3U1DA 4PDKA 1RC9A 1T8IA 3DBLB 3QP6A 4DOZA 3RZDJ 2QM3A 5JI6A 3OL3A 5L3BA 5D8LB 4A0XA 3P9KA 3D0SA 2Q8KA 3TQNA 2LR8A 1IXSB 2AHQA 1IN4A 3TGNA 3OYEA 3FXRA 2XAQA 3Q9SA 3WE2A 3HPHA 3TOAA 2JRMA 4HDVA 2PJPA 5EG0A 4I0AA 2IGKA 1FOYA 2KRFA 1K83J 2O0YA 3C2BA 5AIQA 3GTJJ 6PAXA 2E7XA 2DMTA 2FXAA 1O7FA 2OTLI 4II2A 1Z1DA 2K85A 2LF7A 2KZVA 4BJ6C 1BI1A 3VYUB 2PG4A 1WZ2A 3HRTA 1OCRH 2E19A 5CQEA 2PFBA 4XSZF 5D5UB 2PMZA 4IL6C 2HDDA 4OAYA 4XQFA 3HXLA 3I64A 3CF5F 1FT9A 2A05A 4OIOF 3S1MJ 3V8JA 1W1WE 2VOOA 1R7JA 3M9AA 4MNUA 3BG6A 1JJ8C 2WBMA 3DBRB 3VWBA 2BY1A 1R00A 4ENMA 2IS4A 4A3GJ 4UV9A 3DTEA 4LIVA 3RJPA 2XVCA 1HCRA 4MFEA 4XRFA 3EUHA 2K40A 2V26A 3I4NJ 2O9LA 3KE2A 4V2FA 2EB7A 5LGTA 2WTEA 4CDGA 2JRTA 3ZQQA 1H88C 3CJNA 3QOPA 3CDIA 3E1SA 3MN2A 3CC2I 3G2BA 4PGHA 3MKYB 2AS5F 3H3VK 1BM9A 2QZ8A 2HYGD 1TW2A 4IJAA 3SZPA 1B8IB 3P9IA 4UUSA 3H92A 3H0DA 4RLFA 2DO7A 4I7HA 1ZRDA 1ZR2A 3RPUA 4I01A 3LSPA 1DU6A 3ERMA 2MC4A 4CYDA 3KETA 4A93J 3NWTA 4LK0F 2IVMA 3FXKA 3F8MA 4H0EA 3F72A 3KZYA 3HRSA 4EJUA 1SFUA 2HU9A 4ZYHA 1XD7A 3G1MA 2R7ZJ 1IRGA 3ZMDA 4B3XA 3GFJA 1VZ0A 2D1VA 5CYVA 3KIOA 4MTEA 4A6DA 3GMEA 2P8TA 5H20A 5FLXZ 1YIOA 2X48A 1ETXA 2NS8A 2L4MA 4J01A 2E2JJ 3KYCB 3Q0VA 2CU7A 3AG2H 5D5VB 4ZZLA 2L4AA 1R23A 1WI9A 2H94A 1VQNI 3L7WA 2XAJA 4RB2C 4Q47A 3G73A 1O3SA 1YQAA 3SZGA 1I50J 2AXTC 1H9GA 3E0JB 4PJLA 5E1WA 4WCGA 1UHWA 3HM5A 5D6EA 3OWTA 3CJTB 2KHMA 4Q5SF 1OJLA 2H1LA 3FDYA 4ZYDA 3LQRA 2VJ4A 3CLQA 3FMQA 4KFCA 3ZPLA 3E7LA 2OUMA 3W6KB 3FHZA 1ON2A 1KU7A 3DLAA 2V9VA 3IUOA 2QSGX 5GTHC 3G1OA 2GXBA 1B6AA 4GO1A 2R92J 1Z05A 4IRHA 5LEKA 2UWMA 2FNPA 1Y0NA 2M8EA 2W24A 4BY1J 3DEUA 4BXUA 2XAGA 2M0MA 2DI3A 1LE8A 4KITB 3DF8A 1IV6A 1IN5A 1HXDA 4AVPA 5LEJA 3K70C 3LSMA 5HODA 3GTPJ 2F5DA 2KIQA 2LY2A 1HSJA 5LRSA 3S32A 5E17F 2WY7Q 3L00A 2IT0A 1AKHB 4S04A 3AL0C 3ABMH 3WTTC 2ID6A 2YU3A 3CJQB 2DOFA 3JRHA 4AIHA 4KIGA 4DYQA 1ZLKA 3ZQ7A 3AG3H 1ZGWA 4XRSG 1D1AA 3MFKA 2D5VA 1V54H 5F0FA 4CZCA 1FC3A 3P5JA 3CUQB 2XRLA 4HAMA 2DFEA 3RCOA 2P5KA 2X4HA 4EV0A 3TDZC 4IKFA 1D1BA 3GTGJ 2VT3A 2QCOA 4XIDA 5E3OA 5LGNA 1QNTA 2DQLA 2MD5A 3FMSA 4LMYA 1RIOH 2DT5A 2X6YA 3MAJA 4LG3A 4ESJA 3QPTA 3GTMJ 2GBYA 1FOXA 1LUJB 5J47A 1JTXA 3F0CA 3AFHA 2Y0SN 1HW2A 3FXMA 5IP9J 1Y1WJ 3L2RA 3CMAI 2OPTA 3RQ4A 4CCMA 2JPCA 4OINF 4HX4A 1AOYA 2L0KA 5EEHA 1PUFB 3FWEA 2DOAA 4GXOA 4PFPA 3LA7A 2ME6A 5GPAA 1R22A 3LSGA 1QZEA 1UELB 3SFZA 3OYGA 1X2NA 5IP7J 2O61A 1Y1VJ 1W36C 1ZAOA 2QQBA 1Y39A 4IF4A 5BQTA 2XRNA 2DA4A 1OCPA 2VB6A 5K5OA 2BEOA 3WODF 4CO8A 3TO6A 4KJZA 1MJ9A 2GXGA 1TQIA 2GM4A 4ZZDA 3IH3A 4MFDA 3LSIA 2EFPA 4UB8C 2ZB9A 4YFKF 1Z91A 5GAHJ 2YUSA 4ZTFA 4CCNA 1PVEA 3J7ZI 2L3DA 1K78A 5EG0B 3WG9A 1K79A 1UB9A 1BIBA 4A5MA 2WA0A 3VEPA 2QBYA 5K7HA 2NNYA 4R8HA 5KVRA 2FJ1A 2XSJC 2X6XA 2K3FA 1WFXA 3S15J 1BI0A 4CYCA 2E2IJ 1RR8C 1QRYA 3GWZA 4IHSA 4RB0A 2DK5A 2M8GX 1XMAA 1S72I 2H6BA 4E7ZA 4KUMA 3Q3SA 3IKVA 4BHBA 3J7AY 3M3YJ 2MYSA 3BT9A 2XPWA 5F04A 1W4MA 1O4XA 4DBQA 4Q48A 2P6TA 2VKHA 2V79A 2HQAA 1IXRC 3W2AA 1JUSA 1JI8A 1FSEA 2IGOA 4HV6A 1JJ6C 1YJWI 4L5IA 3S1RJ 2X6OA 1ZG3A 1VQLI 2K9SA 4DW6A 3QP5A 3ZMSA 1FBSA 4NQWA 3Q0UA 1KU9A 3L2CA 2Z9OA 2M5WA 3SDBA 5EEAA 3DPLC 5JFRA 3GYHX 5CJ9A 1DPRA 2EZLA 2OQGA 3E5UA 4W97A 4E6KG 4D9JA 3RSNA 4OAZA 3A0BC 1QVUA 4UUSB 3TEDA 1UG0A 2K5CA 2VQCA 3TO7A 4IZZA 3FM3A 4UVCA 2PX9A 2E35A 5K1YA 3MKWB 2VODA 2GOMA 4EQQA 3JRGA 1SEUA 5L3GA 1IN8A 1DQUA 2WAEA 3GF2A 4M6XA 5CVJA 5DS9A 2VE8A 2BXZA 2TCTA 3RTRA 1TWFJ 1FOKA 4CH7A 2JMWA 4G94A 3OYMA 3ZP5A 4A3BJ 1TQPA 4LB5A 1VFCA 1KYWA 2OCCH 2LF8A 1GXQA 3DKYA 2V6EA 5LFAA 1IGNA 1RPWA 2JPBA 4AIKA 5IYBJ 3I5UA 1X2MA 1USSA 4P55A 3T1BA 2Y9YA 5JR3A 3CMMA 1GVJA 3GFIA 2IPQX 5K7FA 1JGGA 4QPOA 5E79C 3B73A 3OSGA 4E4HA 1MBGA 2IS1A 1IF1A 1B9NA 2GWRA 4OIPF 2F6CA 2Y0MA 4A0ZA 2P6SA 4A2UA 2FEZA 3S1QJ 2KP6A 1H8AC 4N4NB 3MKLA 4A3CJ 4DGWB 2HQNA 1FYMA 5LLQA 1UZCA 1R4NB 1T33A 2ZBKA 2E71A 1BW6A 1QHGA 1V5GA 1C0WA 3WHBA 5DUIA 4RAZA 2A5WA 3D5RC 3HZJA 3CO7C 3MQ0A 5C4JJ 3PO2J 3E6DA 4XLNF 3LWFA 1X4PA 1Y56A 2KIMA 1GUUA 2DQRA 1J7KA 2CUJA 2QLZA 3WTWC 1NK2P 1LE8B 4XLAA 4G8XA 2QUFA 5FLVA 5DCMB 1X1BA 1X4OA 3BROA 3QPHA 4FCYA 3BY6A 1UAAA 5DCFA 3WGHA 4FE7A 3O8HA 1YFHA 1O57A 3K2ZA 5E3MA 1R71A 2ZFUA 3O2PE 2DOEA 2EA2A 3IH2A 1XDUA 4UHTA 1HBXG 3IAM2 3HOWJ 4Y17A 1R58A 3W2WA 3JRBA 1RNLA 3LAJA 4CGZA 2XF5A 3KP2A 4Y3OA 1D8JA 1APLC 2PBIA 1KU2A 3I0TA 1UFMA 2L9RA 1QPIA 2DW4A 4O5VA 2X85A 3OIPA 2JWTA 2FBKA 4RB3C 1JUMA 3FKIJ 4G7ZF 2ZO4A 3LSHA 4RMNA 3PJRA 1OCCH 2CW8A 3QOEA 2QQ9A 5B1AH 2FF4A 2HQRA 2HNHA 2L9SA 4QWQA 2XUBA 2VI6A 5M5YJ 1JE8A 3OYDA 2XKPA 4ZYAA 4BEHA 2L5QA 3BLYA 2HOAA 3SEQA 3DLLF 2IA0A 4YRVA 5GP9A 3F8CA 4IOAF 4BACA 1LB2A 5IYDJ 1I3QJ 4LFUA 3OL4A 3OYFA 1SVMA 1MZBA 2K9QA 3S3NA 2DMNA 2ZNYA 1BBYA 3BPXA 2Y9ZA 1WJBA 2YPRA 4A0YA 2OC6A 5IT9Z 3OYHA 4E7HA 3FISA 2ELHA 1HDPA 3JSPA 1J5YA 1EH8A 4HF2A 4PUSA 4BXFA 1IZ1A 4OOIA 2HDCA 3TL4X 3KZIC 1SFXA 2FBHA 2DMUA 2V7FA 1G4DA 3KLNA 3H5AA 3CESA 1ZARA 2KL4A 2PEXA 1DUXC 2P7CB 3JAMK 2FSWA 1T56A 1KA8A 5IT3A 4XRMA 2HEOA 3KCCA 3V8KA 1MKMA 2L9VA 3ECHA 2M1BA 3GLLA 3K4NA 2R7DA 3BJOA 3WGGA 5A2QZ 1FSHA 3L09A 2HPMA 5HDGA 1SFEA 4BDZA 2IBDA 4M6VA 4CICA 1G6NA 4HLXA 3LSRA 5L3EA 2DA1A 4HRIA 1MNEA 5ICGA 5GADJ 3K4KA 2VT2A 2EWNA 1X19A 3OY9A 1S5LC 3ZMUA 2R4GA 1EKEA 3CDHA 5HS9A 1K78B 4KNYA 2EV0A 2YSRA 2ACJA 5IT9K 4JX5A 1P4XA 4XR6A 1D5VA 2QBYB 2DJNA 2A5YB 3CF2A 3LNQA 3HPGA 4WXHA 5JLXA 4BS9A 4CYCB 3L1PA 1TNTA 5K5QA 3Q9VA 2W1OA 3CCRI 1MIJA 2R7SA 5A2QK 4C2TA 2DCEA 2GZWA 1P4WA 5EGOA 2OCEA 2IS6A 1OMIA 4RGUA 3K70D 1WWXA 4LGWA 2JVHA 2PMZN 3S3MA 3GEZA 4I02A 2VONA 2RN7A 4B48A 5IOYA 1SFKA 4XM3A 3KEQA 3KYLA 2DPUA 2CQNA 2BV6A 2E36A 1E3HA 3W2VA 4F55A 3I4MJ 1FEXA 2LP0A 2TRTA 2ZJPF 3GVAA 2Y30A 4IPAA 2W25A 4NQWB 2F5VA 2YS9A 1XG1A 5J40A 3PIOF 4PGGA 2FQ3A 2KDOA 4RM2A 1N75A 3JRFA 3CCUI 1BOBA 1ETVA 3OS0A 3S8PA 1ZG1A 3CMEI 5D5WB 1O3TA 3DTIA 2NXNB 1HW1A 1WCMJ 4IHTA 3H9QA 1HSTA 1Y6IA 2WB1A 2P5LC 5HLIA 2IXSA 4MLOA 3I53A 4A3FJ 3R0AA 4LOCA 3VB2A 2DT7B 3F6VA 2DMPA 2I10A 2HOEA 1YJ9I 2IGMA 5DD8A 5TGTA 3D5LA 1L3LA 2PN6A 5E1ZB 1M1EB 2DA5A 3WU0A 5LBQA 2Q1ZB 3F8BA 1MBKA 2WAQA 5CPRB 4BU2A 4ESBA 2JA5J 2XDVA 4IQJA 1IUFA 4DQ2A 2W84A 4Y7NJ 2UUZA 3CC4I 1W36D 3PL8A 2FU4A 2HKXA 2F5EA 3BJ6A 2QSFX 1ZTRA 3SYTA 1ETWA 5F1JA 3PNVA 1EF4A 1JTYA 3I3LA 5F6FA 4M73A 1MDMA 2ZJ2A 3JTHA 3OYIA 1SAXA 5GTIC 5M5XJ 3RKQA 3HUGA 1WSUA 2Y31A 2NNNA 2P0WA 3BTLA 2ZXWH 1LVKA 2IA2A 2XGEA 4NNJA 3ZOBA 5ED4A 1EJ9A 1AA7A 1JKOC 2XPUA 5DYMA 1DGRM 4BL0B 3FHNA 4AC0A 4XORA 4B47A 2MH2A 2CGPA 2A3SA 4UUVA 3DEWA 1G2HA 4X1EA 4G7OF 1FYKA 3C18A 1R6RA 3RPQA 3BG3A 2CUZA 3CMYA 3NEUA 2ZXHA 4ZYGA 4I6ZA 4KN4X 2D1HA 2GIVA 2YU9J 3PQJA 1B4AA 2AXLA 4PJ0C 5BPIA 1I1SA 4HA8A 2ELKA 1YE9A 4RAFA 1UG2A 4EM0B 3L9FA 1SMYF 3K1NA 5FB2A 2A69F 2LLKA 3ABTA 2J5PA 2KJBA 1J75A 5GAEJ 1HA8A 1D3YA 2MLGA 2O03A 4R1HA 3RYRA 5K5RA 4KMFA 3HBLA 3VODA 1D0ZA 3K4BA 5FKLA 2XIGA 4ENKA 3G6EI 2Y48A 4HDUA 3BP8A 3L2VA 4RGRA 3WGIA 1MNMC 1P2FA 2IEKA 3B6AA 4FT8A 4M3EA 4L0ZB 2E7WA 2HOTA 1FOWA 3FXQA 4NBQA 4HX7A 2O3FA 4N9HA 2NAZA 4BHPA 3IRQA 4M3FA 4BEHB 3AL0B 1T38A 4XOTA 3GBGA 1SVOA 2WY8Q 5ICEA 3RI4A 4AYBA 2P7VB 4OU0A 3LA3A 5LHIA 1FP1D 5H2FC 3RKYA 4UY8I 2LH9A 1I6HJ 3GZNB 1MJBA 3E3VA 4IRIA 2MABA 1ZLJA 2XF6A 2Q0OA 3NAUA 4O6JA 1RUOA 3KEOA 2STTA 2OBPA 2DT6A 3VFZA 1BI2A 1JKRC 1AWCA 4UVAA 1YG2A 3KFWX 3BTJA 4I76A 2MSYA 3HRUA 1EH7A 3JREA 2DFFA 4U7DA 1BOAA 4EJTA 3ZGKA 3BPVA 1T6SA 3RKWA 4CCOA 2DTZA 1JKQC 1XGNA 2HZTA 2UXXA 3ZMTA 3KLOA 5HLGA 2BYVE 3GTKJ 3CP2A 1D1CA 4WX9A 5E3LA 4RM3A 1JXSA 3BWGA 4UXNA 3CCSI 4FX4A 3KP4A 4L9NA 5FO5A 2XKOA 2N8GA 3QPSA 4ZYEA 4F52A 4XKCA 1IRZA 4JK1X 4XICA 2TDXA 2UZKA 3S14J 4ZDPA 3FXJA 1PDNC 5EGOB 2JZYA 3NQOA 1FY7A 1EH6A 1MBHA 1SD7A 4DJAA 5IY5H 4C2MJ 2DA2A 1LVAA 3OYBA 4M3GA 2KDZA 3WTVC 3M1CA 3K69A 4KIBA 3K0LA 4ZC3A 2VXDA 1UHSA 2E1OA 1G3TA 2HPIA 3BR3A 4XSXF 3JSOA 2HI3A 1TTYA 5FLXK 3F8FA 2GIZA 4KDPA 3T5XA 4IO9F 4M3BA 1ETKA 4Y13A 4HSRA 2ISZA 3V7CA 4D1QA 1IAWA 4L5EA 3VDXA 2F5CA 5CVRA 4A5NA 2QYOA 3HC7A 2OJED 2OQRA 4A69C 3TMOA 4D0PA 3M07A 1FMWA 1P4AA 2M0CA 1U9NA 3CCQI 1TWCJ 5HS8A 2M87A 1ACIA 4N9IA 3RPUD 5DM6F 3BR5A 3NWSA 1P7JA 2H1KA 1OFCX 1XSXA 1G8XA 3EYYA 2CQKA 4DYRA 2WV0A 3ZRGA 2R3SA 2H27A 3HTSB 2ZNZA 4G6QA 3HOUJ 1TL8A 2E1MB 1LDKB 3HOZJ 2OTJI 1NG6A 2GAUA 5F27A 1OKRA 5EYRA 1FNNA 4IHYA 5EZHA 2JSCA 2PMHA 2KMUA 3S2DJ 1VF9A 2VQLA 3TDUC 1K6OA 3BZ6A 3DQVC 2CYYA 3ZN1A 4HQMA 2QA4I 4XKVA 1PJRA 1Z9CA 1R1VA
chains in the Genus database with same CATH topology
1TLHB 2MLKA 1HKQA 3ELKA 4MEXF 4B09A 1MDMB 5LHHA 4KMUX 3TOBA 2Z33A 2STWA 1O7LA 3GO5A 2H09A 4HYEA 1J0RA 1S6LA 3IHUA 5FD5A 1TBXA 3GUDA 4Q4ZF 3IRRA 3F23A 3FMRA 2CSOA 1JHHA 4ETSA 1W7PA 3AAFA 4KIFA 3P7NA 4M74A 2A07F 3I58A 3P9CA 4AD9A 2R7FA 5J6XA 1LQ1A 1H0MA 2QWWA 1LDDA 1ZG5A 4WK8F 3T8TA 2KIUA 2EV6A 2MH9A 2Z3YA 1B1BA 4TV7A 4CXFA 2OD5A 1QQIA 5FFZA 3DFGA 4EJWA 5H6QA 2VBWA 2FA5A 3HHGA 2K27A 2Z5UA 1ZRCA 1XB4A 1QBJA 4F7ZA 1BI3A 4YIIA 3DP7A 1J59A 1MD0A 1XDSA 4PZJA 3U2RA 4M71A 1KQ0A 5TRDA 1MGTA 2XHKA 2K4BA 1QPMA 4RAYA 1TW3A 5J8FA 1OR7A 4RGSA 1XCBA 3HTUA 1WRJA 4M9XA 2PMUA 2GA1A 2RNJA 2KIFA 1F4KA 1S3JA 4OIQF 1ODDA 2ZFWA 3FF5A 1FLIA 2MBFA 2EJRA 1J2XA 3ECOA 5CVIA 2LNBA 4CHUA 3C1DA 4M72A 1ULYA 2XV4S 3E5XA 4HZFA 3M8EA 4KYWA 5JHUA 2XROA 1ZREA 3MCZA 1X3UA 1FBQA 2W85A 3CO6C 2LKPA 1KQ9A 4BH9A 2J5OA 2VC1A 3T0YA 2XGXA 4NB5A 2FMLA 2RGVA 3IKTA 5ERIA 3QRFF 4AIJA 3HSEA 1BC7C 3V7SA 1U3EM 3K1MA 1T2KA 1YTYA 5L3DA 1QZZA 4BQAA 4IVNA 4MQ9F 5E18F 4UVBA 1G3SA 3R4KA 2KJCA 1LNWA 5DD4A 4P9UA 5BOXA 1V4RA 5JVTA 5HS7A 2M45A 1JHFA 2A68F 3DPTA 3E5QA 2V1UA 1Q1HA 1L0OC 1KGSA 3GFLA 4Z2YA 3CLOA 2FBIA 4LG0A 1HQCA 2ZCWA 3R61A 1R5HA 5LGUA 2V1DA 3GLXA 5ICCA 1U5TC 2WC2A 3R60A 2RVCA 2HKOA 1W7PB 1I6XA 2HWVA 1OYIA 3DKWA 4ON0A 5D8KB 2HYFA 1K7AA 2FOKA 3HOTA 2D2WA 2PI0A 4Y15A 1IUYA 4BAYA 1Z6RA 4IRGA 2DBBA 5ILUA 1EV7A 3RYPA 5LRRA 2ISYA 1BN5A 4ESFA 3E6BA 3J81Z 1YW8A 3RKXA 4FX0A 3LFKA 3KP6A 4WXCA 4KICA 4MTDA 3GZ6A 1ZN2A 3H3UA 4GGGA 1HW5A 1GHCA 5F1RA 4WF2A 3CTAA 4OMZA 3HOSA 3EQLF 4FHTA 4HOBA 4AWXB 1USTA 4P5OA 2NYXA 3J81K 2IW5A 3QU3A 2VOPA 1U8RA 3OV8A 3HHHA 4G9YA 4I98B 3ULQB 2DFIA 3LSTA 4B8XA 2FRHA 3WE3A 4CZZA 2O8XA 3O6BB 3E6MA 2Y75A 1NHAA 2XASA 3LAPA 1PUEE 5HDKA 4LD5A 2XAFA 1W5SA 1W5TA 1OYWA 4KT5C 3HSRA 2A6HF 1LDJA 2DPDA 3WU1B 5CVUA 2MC3A 4M9SA 4UV8A 1Y0UA 1O3RA 3FZVA 1SMTA 1BJAA 3PQKA 1PP7U 3QU6A 1S29A 1LEBA 4MQVA 4RS8A 5AIPA 1LJ9A 2VBYA 3M8FA 2X0LA 5HDNA 2YR2A 3T8RA 4BYYA 4IXAA 2IJLA 3HYIA 1WKMA 2YX4A 1FWZA 4U0VA 1ON1A 2EK5A 3FXUA 1QGPA 2VXZA 1H9TA 2MA3A 2LSOA 4G7HF 3BJAA 5FGMA 1YS7A 3C7JA 2G9WA 2OZ6A 1ZHFA 5DV5A 4EGZA 2PLYA 4R79A 1IXCA 2RV8A 4LG0B 3TKYA 5CLSA 2CW0F 5E20A 1QZYA 2BGCA 2DTRA 4S05A 4L5JA 4M6YA 3TO9A 5HOOA 3WTUC 2IP2A 2BBYA 1DP7P 1U6GA 2GQQA 1ZGAA 2L54A 2HR3A 2CO5A 3WTYC 1B59A 1XGOA 3KP3A 1TNSA 3ROUA 3J80Z 1IN6A 2COMA 1U5TA 2PQ8A 2QVOA 3J7AO 5DDGA 1CF7A 4MHGA 1G3YA 1SD4A 3MWMA 2CWEA 4MEYF 3I54A 1YW9A 5DEQA 5H6RA 1Z6TA 4RB1A 1KU3A 1HKTA 1XMKA 3F21A 2Q2EA 4ASNA 2NRAC 1RZ4A 5HVQC 2EFOA 1I1GA 1FZPB 3NRVA 3WTXC 1XN7A 3J80K 3QAHA 1B9MA 1RUNA 5TJJA 1UHMA 3KP7A 3V7RA 1XSDA 3FM5A 2RKHA 3I59A 3H3ZA 3ZMZA 2G7HA 2ZMEA 1FPQA 2IRFG 3O3KA 5HLHA 3F3XA 4YFXF 4EJVA 1FX7A 4I09A 1TQMA 3ML6A 3KZZA 4EM1A 3REOA 5ILVA 2HS5A 2ZXJA 4MGRA 3JTGA 4OIRF 4HQEA 4L9TA 5DCMA 2L01A 2LDUA 3PFIA 3GW2A 3N97A 4EVIA 1IRFA 1XGSA 2QENA 5LHGA 2L02A 1D8KA 1V3FA 2HFHA 1LEAA 1FYLA 2HTJA 3N4MA 4QLCU 1P92A 5E8IA 4LLNA 4HF0A 3ABUA 3V8LA 2F5FA 3DXJF 5FFXA 3G3ZA 3I71A 3R6SA 3M1EA 4A12A 1J9IA 2OA4A 3MZHA 3V4GA 3ZN0A 1XSVA 2EFNA 1WQ2A 5FD6A 3KP5A 1XCVA 2DAOA 4P9FA 2KKOA 2K86A 1U2WA 2FE3A 3RIRA 5ICFA 2HTSA 2A61A 3EETA 2C6YA 2NS0A 2JTVA 2ESHA 3R0JA 2E1NA 3C3WA 4EMSA 2K4JA 2DU9A 4LK1F 4HV5A 4KN7X 1ZYRF 1T0FA 1REPC 2CFXA 4U0WA 3SQNA 3IC7A 2DK8A 3HRMA 1OYYA 2ESNA 2D45A 3COAC 4L0YB 2RC4A 1E17A 3HIFA 1YS6A 3M7GA 4O3MA 3GXOA 2EA4A 3IWFA 5F64A 1I27A 4ZH4F 3S2WA 2RDPA 2O6GE 4ENNA 1G3WA 4HBLA 5BMZA 1P6RA 4EJOA 4XBFA 1YO5C 3LA2A 2ETHA 1ONVA 4WWCA 1W7PD 4LJZF 3E97A 3CUQC 1CGPA 4BNCA 3E6CC 1BC8C 3BDDA 2YX7A 1S7AA 1U5TB 1UCRA 2EFWA 1Z7UA 1CF7B 4RGXA 2OU2A 5EEGA 3CUOA 2K02A 3B02A 1ZRFA 5DUKA 1BIAA 3MZYA 5BPDA 1YYVA 4JBAA 5D4SA 1I5ZA 3GZ5A 3I59B 1SD5A 2ZKZA 4L9VA 1MJAA 2ZMEB 3LQQA 5CVVA 5D5XB 5E8GA 4NHJA 2RQPA 1T98A 2XAHA 4ENJA 1F9NA 3F8NA 4HX8A 2VBXA 1FBUA 4PCQA 2GA2A 1R5GA 1HKSA 1ZGJA 3OOPA 4L18B 5E1XA 1S7OA 3EYIA 1U78A 3K1PA 3ERED 2VN2A 1JGSA 3SXYA 1OPCA 4BHCA 1KQ8A 1E2XA 3IWZA 4OMYA 3JAMZ 2K7LA 4YG2F 4LLGF 3GX4X 3WTSC 4M9ZA 3SHFA 3DV8A 2ADUA 2JT1A 2EFQA 2VC0A 3VOEA 2E1CA 1PP8F 4U0YA 4E70A 1FP2A 4U7BA 4HLYA 3F22A 2W57A 2F2EA 2BE5F 3I4PA 5ILSA 5KK1A 1S8NA 1SD6A 4U88A 3JW4A 5D4RA 3RDIA 4WXDA 3F6OA 4L9JA 2V1XA 4K2EA 4P96A 1DPUA 4EM2A 2HGCA 3EDPA 2VE9A 5AONA 4DNCA 4KA4A 1IN7A 4GYGA 1GXPA 1RI7A 4JQFA 2VBZA 5L3FA 3HSFA 5J8CA 2QQAA 2V6CA 1QO0D 2OAZA 2H6CA 3FX3A 2M30A 4A6EA 1IW7F 1T39A 2FMYA 3IL2A 1YW7A 3K9TA 4LB6B 4I2OA 1YLFA 1R1UA 1XGMA 2EV5A 3SZTA 4HF1A 2OZUA 4EGYA 2FNAA 4GCVA 3BOQA 1R1TA 2Z99A 3W6JB 4LLLA 1STZA 2CG4A 3MEXA 1VTNC 5D6FA 2A6EF 1KYZA 1O3QA 2B0LA 1ZH5A 4YIFA 2UXNA 3Q5FA 4XLPF 1F5TA 2G7UA 4YFNF 3ISPA 3CUQA 4UNOA 1R36A 2IA1A 2P4WA 4HW0A 4N0BA 2P5VA 3WTZA 5BS6A 5L3CA 4G6DA 2DLLA 4GYIA 3U9GA 4I0BA 3ZMVA 2WWYA 1F1ZA 3GFMA 1DDNA 1A04A 3U1DA 4PDKA 3QP6A 2QM3A 5JI6A 5L3BA 5D8LB 4A0XA 3P9KA 3D0SA 2Q8KA 3TQNA 1IXSB 1IN4A 3TGNA 3FXRA 2XAQA 3Q9SA 3WE2A 3TOAA 2PJPA 4HDVA 4I0AA 2KRFA 2O0YA 5AIQA 6PAXA 2E7XA 2FXAA 1O7FA 1Z1DA 2LF7A 1BI1A 2PG4A 3HRTA 2PFBA 4XSZF 5D5UB 3I64A 1FT9A 4OIOF 3V8JA 2VOOA 1R7JA 3M9AA 4MNUA 1R00A 4ENMA 4UV9A 3RJPA 2XVCA 4XRFA 3EUHA 3KE2A 2EB7A 5LGTA 2WTEA 4CDGA 2JRTA 3CJNA 3QOPA 4PGHA 2AS5F 1BM9A 2QZ8A 2HYGD 1TW2A 4IJAA 3SZPA 3P9IA 3H92A 2DO7A 4I7HA 1ZRDA 3RPUA 4I01A 4CYDA 3KETA 4LK0F 2IVMA 3F8MA 4H0EA 3F72A 3KZYA 3HRSA 4EJUA 1SFUA 4ZYHA 1XD7A 1IRGA 3ZMDA 3GFJA 2D1VA 5CYVA 4MTEA 4A6DA 5H20A 2P8TA 5FLXZ 1YIOA 2L4MA 5D5VB 4ZZLA 2L4AA 1R23A 1WI9A 2H94A 3L7WA 2XAJA 4RB2C 4Q47A 3G73A 1O3SA 1YQAA 1H9GA 5E1WA 4WCGA 1UHWA 5D6EA 4Q5SF 4ZYDA 3LQRA 3FMQA 4KFCA 3ZPLA 3W6KB 3FHZA 1ON2A 1KU7A 2V9VA 2GXBA 1B6AA 4GO1A 2UWMA 1Z05A 4IRHA 5LEKA 2FNPA 2M8EA 2W24A 3DEUA 4BXUA 2XAGA 2DI3A 3DF8A 1IN5A 1HXDA 4AVPA 5LEJA 2F5DA 1HSJA 5LRSA 5E17F 3L00A 2IT0A 4S04A 3WTTC 2YU3A 4AIHA 4KIGA 1ZLKA 3ZQ7A 3MFKA 1FC3A 3CUQB 4HAMA 4EV0A 2P5KA 2X4HA 3TDZC 2VT3A 5LGNA 1QNTA 2DQLA 2MD5A 3FMSA 4LMYA 1RIOH 2DT5A 3MAJA 4ESJA 3QPTA 1HW2A 2JPCA 4OINF 4HX4A 1AOYA 5EEHA 3FWEA 4GXOA 3LA7A 1R22A 3SFZA 2O61A 1ZAOA 2QQBA 4IF4A 5BQTA 2XRNA 5K5OA 2BEOA 3WODF 4CO8A 3TO6A 1MJ9A 2GXGA 1TQIA 4ZZDA 2EFPA 4YFKF 1Z91A 2L3DA 1K78A 3WG9A 1K79A 1UB9A 1BIBA 4A5MA 2QBYA 3VEPA 2NNYA 4R8HA 5KVRA 1BI0A 3GWZA 4IHSA 4RB0A 2DK5A 1XMAA 2H6BA 4KUMA 4BHBA 3IKVA 1W4MA 4Q48A 2P6TA 2V79A 1IXRC 1FSEA 4HV6A 4L5IA 1ZG3A 3QP5A 3ZMSA 1FBSA 4NQWA 1KU9A 3L2CA 2Z9OA 2M5WA 3DPLC 5JFRA 3GYHX 5CJ9A 1DPRA 2OQGA 3E5UA 3TO7A 3FM3A 4UVCA 5K1YA 2VODA 4EQQA 5L3GA 1IN8A 3GF2A 4M6XA 5CVJA 2VE8A 3RTRA 1FOKA 4G94A 3ZP5A 1TQPA 4LB5A 1KYWA 2LF8A 1GXQA 2JPBA 4AIKA 3I5UA 1USSA 4P55A 3T1BA 5JR3A 1GVJA 3GFIA 2IPQX 3B73A 1IF1A 1B9NA 2GWRA 4OIPF 2Y0MA 4A0ZA 2P6SA 4A2UA 2FEZA 2HQNA 1FYMA 5LLQA 2ZBKA 1C0WA 5DUIA 4RAZA 3CO7C 3MQ0A 3E6DA 4XLNF 3LWFA 2KIMA 2DQRA 1J7KA 2QLZA 3WTWC 4G8XA 2QUFA 5DCMB 3BROA 3QPHA 3BY6A 5DCFA 3WGHA 1YFHA 1O57A 3K2ZA 4UHTA 3O2PE 2EA2A 1HBXG 1XDUA 4Y17A 1R58A 1RNLA 3LAJA 4CGZA 3KP2A 1D8JA 2PBIA 1KU2A 3I0TA 1UFMA 2DW4A 4O5VA 4RB3C 2FBKA 4G7ZF 2ZO4A 2QQ9A 2FF4A 2HQRA 4QWQA 2XUBA 1JE8A 2XKPA 2IA0A 3F8CA 1LB2A 4LFUA 1MZBA 2ZNYA 1BBYA 3BPXA 2YPRA 4A0YA 5IT9Z 2ELHA 3JSPA 1J5YA 1EH8A 4HF2A 1IZ1A 4OOIA 2HDCA 1G4DA 1SFXA 2FBHA 3KLNA 1ZARA 2PEXA 1DUXC 2P7CB 3JAMK 2FSWA 2HEOA 1KA8A 5IT3A 3KCCA 3V8KA 1MKMA 3WGGA 3ECHA 2M1BA 1FSHA 2R7DA 3BJOA 5A2QZ 3L09A 5HDGA 1SFEA 4CICA 1G6NA 4HLXA 5L3EA 5ICGA 2VT2A 2EWNA 3ZMUA 3CDHA 5HS9A 4KNYA 5IT9K 1K78B 2EV0A 2YSRA 2ACJA 1P4XA 1D5VA 2QBYB 2A5YB 4WXHA 1TNTA 5K5QA 3Q9VA 5A2QK 2GZWA 1P4WA 1OMIA 4RGUA 1WWXA 4LGWA 3GEZA 4I02A 2VONA 2RN7A 3KEQA 2DPUA 2BV6A 3GVAA 4IPAA 2W25A 4PGGA 2FQ3A 1ZG1A 5D5WB 1O3TA 1HW1A 4IHTA 1HSTA 2P5LC 5HLIA 3I53A 3R0AA 3VB2A 3F6VA 2HOEA 5DD8A 3D5LA 1L3LA 2PN6A 5E1ZB 3WU0A 5LBQA 3F8BA 4ESBA 4DQ2A 2W84A 2FU4A 2HKXA 2F5EA 3BJ6A 5F6FA 4M73A 1MDMA 2ZJ2A 3JTHA 1SAXA 1WSUA 3HUGA 2NNNA 2IA2A 5ED4A 5DYMA 2MH2A 2CGPA 2A3SA 4UUVA 4G7OF 1FYKA 3C18A 3RPQA 3NEUA 4ZYGA 4KN4X 2D1HA 2GIVA 3PQJA 1B4AA 2AXLA 1I1SA 5BPIA 4HA8A 4EM0B 3L9FA 1SMYF 3K1NA 5FB2A 2A69F 3ABTA 2J5PA 2KJBA 1J75A 1D3YA 2MLGA 2O03A 4R1HA 3RYRA 5K5RA 4KMFA 3VODA 2XIGA 4ENKA 2Y48A 4HDUA 3BP8A 4RGRA 3WGIA 1P2FA 4FT8A 4L0ZB 2E7WA 3FXQA 4HX7A 2O3FA 4N9HA 2NAZA 4BHPA 3IRQA 1T38A 5ICEA 3RI4A 2P7VB 4OU0A 3LA3A 5LHIA 1FP1D 3RKYA 1MJBA 3E3VA 4IRIA 1ZLJA 2Q0OA 4O6JA 1RUOA 3KEOA 2STTA 2OBPA 3VFZA 1BI2A 1AWCA 4UVAA 1YG2A 3KFWX 3HRUA 1EH7A 4U7DA 1BOAA 4EJTA 3BPVA 1T6SA 3RKWA 1XGNA 2HZTA 2UXXA 3ZMTA 3KLOA 5HLGA 2BYVE 4WX9A 1JXSA 3BWGA 4UXNA 4FX4A 3KP4A 4L9NA 5FO5A 2XKOA 4ZYEA 4JK1X 2TDXA 2UZKA 1PDNC 2JZYA 3NQOA 1FY7A 1EH6A 1SD7A 1LVAA 3WTVC 4KIBA 3K69A 3K0LA 1G3TA 4XSXF 3JSOA 1TTYA 5FLXK 3F8FA 4KDPA 3T5XA 4Y13A 2ISZA 3V7CA 1IAWA 2F5CA 5CVRA 4A5NA 2QYOA 2OQRA 4D0PA 1P4AA 5HS8A 2M87A 4N9IA 1XSXA 3EYYA 2CQKA 2H27A 2WV0A 3HTSB 2R3SA 2ZNZA 4G6QA 1LDKB 2GAUA 1OKRA 1FNNA 2JSCA 2PMHA 3TDUC 1K6OA 3BZ6A 3DQVC 2CYYA 3ZN1A 4HQMA 1Z9CA 1R1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TLH B;  2MLK A;  1HKQ A;  3ELK A;  4MEX F;  4B09 A;  1MDM B;  5LHH A;  4KMU X;  3TOB A;  2Z33 A;  2STW A;  1O7L A;  3GO5 A;  2H09 A;  4HYE A;  1J0R A;  1S6L A;  3IHU A;  5FD5 A;  1TBX A;  3GUD A;  4Q4Z F;  3IRR A;  3F23 A;  3FMR A;  2CSO A;  1JHH A;  4ETS A;  1W7P A;  3AAF A;  4KIF A;  3P7N A;  4M74 A;  2A07 F;  3I58 A;  3P9C A;  4AD9 A;  2R7F A;  5J6X A;  1LQ1 A;  1H0M A;  2QWW A;  1LDD A;  1ZG5 A;  4WK8 F;  3T8T A;  2KIU A;  2EV6 A;  2MH9 A;  2Z3Y A;  1B1B A;  4TV7 A;  4CXF A;  2OD5 A;  1QQI A;  5FFZ A;  3DFG A;  4EJW A;  5H6Q A;  2VBW A;  2FA5 A;  3HHG A;  2K27 A;  2Z5U A;  1ZRC A;  1XB4 A;  1QBJ A;  4F7Z A;  1BI3 A;  4YII A;  3DP7 A;  1J59 A;  1MD0 A;  1XDS A;  4PZJ A;  3U2R A;  4M71 A;  1KQ0 A;  5TRD A;  1MGT A;  2XHK A;  2K4B A;  1QPM A;  4RAY A;  1TW3 A;  5J8F A;  1OR7 A;  4RGS A;  1XCB A;  3HTU A;  1WRJ A;  4M9X A;  2PMU A;  2GA1 A;  2RNJ A;  2KIF A;  1F4K A;  1S3J A;  4OIQ F;  1ODD A;  2ZFW A;  3FF5 A;  1FLI A;  2MBF A;  2EJR A;  1J2X A;  3ECO A;  5CVI A;  2LNB A;  4CHU A;  3C1D A;  4M72 A;  1ULY A;  2XV4 S;  3E5X A;  4HZF A;  3M8E A;  4KYW A;  5JHU A;  2XRO A;  1ZRE A;  3MCZ A;  1X3U A;  1FBQ A;  2W85 A;  3CO6 C;  2LKP A;  1KQ9 A;  4BH9 A;  2J5O A;  2VC1 A;  3T0Y A;  2XGX A;  4NB5 A;  2FML A;  2RGV A;  3IKT A;  5ERI A;  3QRF F;  4AIJ A;  3HSE A;  1BC7 C;  3V7S A;  1U3E M;  3K1M A;  1T2K A;  1YTY A;  5L3D A;  1QZZ A;  4BQA A;  4IVN A;  4MQ9 F;  5E18 F;  4UVB A;  1G3S A;  3R4K A;  2KJC A;  1LNW A;  5DD4 A;  4P9U A;  5BOX A;  1V4R A;  5JVT A;  5HS7 A;  2M45 A;  1JHF A;  2A68 F;  3DPT A;  3E5Q A;  2V1U A;  1Q1H A;  1L0O C;  1KGS A;  3GFL A;  4Z2Y A;  3CLO A;  2FBI A;  4LG0 A;  1HQC A;  2ZCW A;  3R61 A;  1R5H A;  5LGU A;  2V1D A;  3GLX A;  5ICC A;  1U5T C;  2WC2 A;  3R60 A;  2RVC A;  2HKO A;  1W7P B;  1I6X A;  2HWV A;  1OYI A;  3DKW A;  4ON0 A;  5D8K B;  2HYF A;  1K7A A;  2FOK A;  3HOT A;  2D2W A;  2PI0 A;  4Y15 A;  1IUY A;  4BAY A;  1Z6R A;  4IRG A;  2DBB A;  5ILU A;  1EV7 A;  3RYP A;  5LRR A;  2ISY A;  1BN5 A;  4ESF A;  3E6B A;  3J81 Z;  1YW8 A;  3RKX A;  4FX0 A;  3LFK A;  3KP6 A;  4WXC A;  4KIC A;  4MTD A;  3GZ6 A;  1ZN2 A;  3H3U A;  4GGG A;  1HW5 A;  1GHC A;  5F1R A;  4WF2 A;  3CTA A;  4OMZ A;  3HOS A;  3EQL F;  4FHT A;  4HOB A;  4AWX B;  1UST A;  4P5O A;  2NYX A;  3J81 K;  2IW5 A;  3QU3 A;  2VOP A;  1U8R A;  3OV8 A;  3HHH A;  4G9Y A;  4I98 B;  3ULQ B;  2DFI A;  3LST A;  4B8X A;  2FRH A;  3WE3 A;  4CZZ A;  2O8X A;  3O6B B;  3E6M A;  2Y75 A;  1NHA A;  2XAS A;  3LAP A;  1PUE E;  5HDK A;  4LD5 A;  2XAF A;  1W5S A;  1W5T A;  1OYW A;  4KT5 C;  3HSR A;  2A6H F;  1LDJ A;  2DPD A;  3WU1 B;  5CVU A;  2MC3 A;  4M9S A;  4UV8 A;  1Y0U A;  1O3R A;  3FZV A;  1SMT A;  1BJA A;  3PQK A;  1PP7 U;  3QU6 A;  1S29 A;  1LEB A;  4MQV A;  4RS8 A;  5AIP A;  1LJ9 A;  2VBY A;  3M8F A;  2X0L A;  5HDN A;  2YR2 A;  3T8R A;  4BYY A;  4IXA A;  2IJL A;  3HYI A;  1WKM A;  2YX4 A;  1FWZ A;  4U0V A;  1ON1 A;  2EK5 A;  3FXU A;  1QGP A;  2VXZ A;  1H9T A;  2MA3 A;  2LSO A;  4G7H F;  3BJA A;  5FGM A;  1YS7 A;  3C7J A;  2G9W A;  2OZ6 A;  1ZHF A;  5DV5 A;  4EGZ A;  2PLY A;  4R79 A;  1IXC A;  2RV8 A;  4LG0 B;  3TKY A;  5CLS A;  2CW0 F;  5E20 A;  1QZY A;  2BGC A;  2DTR A;  4S05 A;  4L5J A;  4M6Y A;  3TO9 A;  5HOO A;  3WTU C;  2IP2 A;  2BBY A;  1DP7 P;  1U6G A;  2GQQ A;  1ZGA A;  2L54 A;  2HR3 A;  2CO5 A;  3WTY C;  1B59 A;  1XGO A;  3KP3 A;  1TNS A;  3ROU A;  3J80 Z;  1IN6 A;  2COM A;  1U5T A;  2PQ8 A;  2QVO A;  3J7A O;  5DDG A;  1CF7 A;  4MHG A;  1G3Y A;  1SD4 A;  3MWM A;  2CWE A;  4MEY F;  3I54 A;  1YW9 A;  5DEQ A;  5H6R A;  1Z6T A;  4RB1 A;  1KU3 A;  1HKT A;  1XMK A;  3F21 A;  2Q2E A;  4ASN A;  2NRA C;  1RZ4 A;  5HVQ C;  2EFO A;  1I1G A;  1FZP B;  3NRV A;  3WTX C;  1XN7 A;  3J80 K;  3QAH A;  1B9M A;  1RUN A;  5TJJ A;  1UHM A;  3KP7 A;  3V7R A;  1XSD A;  3FM5 A;  2RKH A;  3I59 A;  3H3Z A;  3ZMZ A;  2G7H A;  2ZME A;  1FPQ A;  2IRF G;  3O3K A;  5HLH A;  3F3X A;  4YFX F;  4EJV A;  1FX7 A;  4I09 A;  1TQM A;  3ML6 A;  3KZZ A;  4EM1 A;  3REO A;  5ILV A;  2HS5 A;  2ZXJ A;  4MGR A;  3JTG A;  4OIR F;  4HQE A;  4L9T A;  5DCM A;  2L01 A;  2LDU A;  3PFI A;  3GW2 A;  3N97 A;  4EVI A;  1IRF A;  1XGS A;  2QEN A;  5LHG A;  2L02 A;  1D8K A;  1V3F A;  2HFH A;  1LEA A;  1FYL A;  2HTJ A;  3N4M A;  4QLC U;  1P92 A;  5E8I A;  4LLN A;  4HF0 A;  3ABU A;  3V8L A;  2F5F A;  3DXJ F;  5FFX A;  3G3Z A;  3I71 A;  3R6S A;  3M1E A;  4A12 A;  1J9I A;  2OA4 A;  3MZH A;  3V4G A;  3ZN0 A;  1XSV A;  2EFN A;  1WQ2 A;  5FD6 A;  3KP5 A;  1XCV A;  2DAO A;  4P9F A;  2KKO A;  2K86 A;  1U2W A;  2FE3 A;  3RIR A;  5ICF A;  2HTS A;  2A61 A;  3EET A;  2C6Y A;  2NS0 A;  2JTV A;  2ESH A;  3R0J A;  2E1N A;  3C3W A;  4EMS A;  2K4J A;  2DU9 A;  4LK1 F;  4HV5 A;  4KN7 X;  1ZYR F;  1T0F A;  1REP C;  2CFX A;  4U0W A;  3SQN A;  3IC7 A;  2DK8 A;  3HRM A;  1OYY A;  2ESN A;  2D45 A;  3COA C;  4L0Y B;  2RC4 A;  1E17 A;  3HIF A;  1YS6 A;  3M7G A;  4O3M A;  3GXO A;  2EA4 A;  3IWF A;  5F64 A;  1I27 A;  4ZH4 F;  3S2W A;  2RDP A;  2O6G E;  4ENN A;  1G3W A;  4HBL A;  5BMZ A;  1P6R A;  4EJO A;  4XBF A;  1YO5 C;  3LA2 A;  2ETH A;  1ONV A;  4WWC A;  1W7P D;  4LJZ F;  3E97 A;  3CUQ C;  1CGP A;  4BNC A;  3E6C C;  1BC8 C;  3BDD A;  2YX7 A;  1S7A A;  1U5T B;  1UCR A;  2EFW A;  1Z7U A;  1CF7 B;  4RGX A;  2OU2 A;  5EEG A;  3CUO A;  2K02 A;  3B02 A;  1ZRF A;  5DUK A;  1BIA A;  3MZY A;  5BPD A;  1YYV A;  4JBA A;  5D4S A;  1I5Z A;  3GZ5 A;  3I59 B;  1SD5 A;  2ZKZ A;  4L9V A;  1MJA A;  2ZME B;  3LQQ A;  5CVV A;  5D5X B;  5E8G A;  4NHJ A;  2RQP A;  1T98 A;  2XAH A;  4ENJ A;  1F9N A;  3F8N A;  4HX8 A;  2VBX A;  1FBU A;  4PCQ A;  2GA2 A;  1R5G A;  1HKS A;  1ZGJ A;  3OOP A;  4L18 B;  5E1X A;  1S7O A;  3EYI A;  1U78 A;  3K1P A;  3ERE D;  2VN2 A;  1JGS A;  3SXY A;  1OPC A;  4BHC A;  1KQ8 A;  1E2X A;  3IWZ A;  4OMY A;  3JAM Z;  2K7L A;  4YG2 F;  4LLG F;  3GX4 X;  3WTS C;  4M9Z A;  3SHF A;  3DV8 A;  2ADU A;  2JT1 A;  2EFQ A;  2VC0 A;  3VOE A;  2E1C A;  1PP8 F;  4U0Y A;  4E70 A;  1FP2 A;  4U7B A;  4HLY A;  3F22 A;  2W57 A;  2F2E A;  2BE5 F;  3I4P A;  5ILS A;  5KK1 A;  1S8N A;  1SD6 A;  4U88 A;  3JW4 A;  5D4R A;  3RDI A;  4WXD A;  3F6O A;  4L9J A;  2V1X A;  4K2E A;  4P96 A;  1DPU A;  4EM2 A;  2HGC A;  3EDP A;  2VE9 A;  5AON A;  4DNC A;  4KA4 A;  1IN7 A;  4GYG A;  1GXP A;  1RI7 A;  4JQF A;  2VBZ A;  5L3F A;  3HSF A;  5J8C A;  2QQA A;  2V6C A;  1QO0 D;  2OAZ A;  2H6C A;  3FX3 A;  2M30 A;  4A6E A;  1IW7 F;  1T39 A;  2FMY A;  3IL2 A;  1YW7 A;  3K9T A;  4LB6 B;  4I2O A;  1YLF A;  1R1U A;  1XGM A;  2EV5 A;  3SZT A;  4HF1 A;  2OZU A;  4EGY A;  2FNA A;  4GCV A;  3BOQ A;  1R1T A;  2Z99 A;  3W6J B;  4LLL A;  1STZ A;  2CG4 A;  3MEX A;  1VTN C;  5D6F A;  2A6E F;  1KYZ A;  1O3Q A;  2B0L A;  1ZH5 A;  4YIF A;  2UXN A;  3Q5F A;  4XLP F;  1F5T A;  2G7U A;  4YFN F;  3ISP A;  3CUQ A;  4UNO A;  1R36 A;  2IA1 A;  2P4W A;  4HW0 A;  4N0B A;  2P5V A;  3WTZ A;  5BS6 A;  5L3C A;  4G6D A;  2DLL A;  4GYI A;  3U9G A;  4I0B A;  3ZMV A;  2WWY A;  1F1Z A;  3GFM A;  1DDN A;  1A04 A;  3U1D A;  4PDK A;  3QP6 A;  2QM3 A;  5JI6 A;  5L3B A;  5D8L B;  4A0X A;  3P9K A;  3D0S A;  2Q8K A;  3TQN A;  1IXS B;  1IN4 A;  3TGN A;  3FXR A;  2XAQ A;  3Q9S A;  3WE2 A;  3TOA A;  2PJP A;  4HDV A;  4I0A A;  2KRF A;  2O0Y A;  5AIQ A;  6PAX A;  2E7X A;  2FXA A;  1O7F A;  1Z1D A;  2LF7 A;  1BI1 A;  2PG4 A;  3HRT A;  2PFB A;  4XSZ F;  5D5U B;  3I64 A;  1FT9 A;  4OIO F;  3V8J A;  2VOO A;  1R7J A;  3M9A A;  4MNU A;  1R00 A;  4ENM A;  4UV9 A;  3RJP A;  2XVC A;  4XRF A;  3EUH A;  3KE2 A;  2EB7 A;  5LGT A;  2WTE A;  4CDG A;  2JRT A;  3CJN A;  3QOP A;  4PGH A;  2AS5 F;  1BM9 A;  2QZ8 A;  2HYG D;  1TW2 A;  4IJA A;  3SZP A;  3P9I A;  3H92 A;  2DO7 A;  4I7H A;  1ZRD A;  3RPU A;  4I01 A;  4CYD A;  3KET A;  4LK0 F;  2IVM A;  3F8M A;  4H0E A;  3F72 A;  3KZY A;  3HRS A;  4EJU A;  1SFU A;  4ZYH A;  1XD7 A;  1IRG A;  3ZMD A;  3GFJ A;  2D1V A;  5CYV A;  4MTE A;  4A6D A;  5H20 A;  2P8T A;  5FLX Z;  1YIO A;  2L4M A;  5D5V B;  4ZZL A;  2L4A A;  1R23 A;  1WI9 A;  2H94 A;  3L7W A;  2XAJ A;  4RB2 C;  4Q47 A;  3G73 A;  1O3S A;  1YQA A;  1H9G A;  5E1W A;  4WCG A;  1UHW A;  5D6E A;  4Q5S F;  4ZYD A;  3LQR A;  3FMQ A;  4KFC A;  3ZPL A;  3W6K B;  3FHZ A;  1ON2 A;  1KU7 A;  2V9V A;  2GXB A;  1B6A A;  4GO1 A;  2UWM A;  1Z05 A;  4IRH A;  5LEK A;  2FNP A;  2M8E A;  2W24 A;  3DEU A;  4BXU A;  2XAG A;  2DI3 A;  3DF8 A;  1IN5 A;  1HXD A;  4AVP A;  5LEJ A;  2F5D A;  1HSJ A;  5LRS A;  5E17 F;  3L00 A;  2IT0 A;  4S04 A;  3WTT C;  2YU3 A;  4AIH A;  4KIG A;  1ZLK A;  3ZQ7 A;  3MFK A;  1FC3 A;  3CUQ B;  4HAM A;  4EV0 A;  2P5K A;  2X4H A;  3TDZ C;  2VT3 A;  5LGN A;  1QNT A;  2DQL A;  2MD5 A;  3FMS A;  4LMY A;  1RIO H;  2DT5 A;  3MAJ A;  4ESJ A;  3QPT A;  1HW2 A;  2JPC A;  4OIN F;  4HX4 A;  1AOY A;  5EEH A;  3FWE A;  4GXO A;  3LA7 A;  1R22 A;  3SFZ A;  2O61 A;  1ZAO A;  2QQB A;  4IF4 A;  5BQT A;  2XRN A;  5K5O A;  2BEO A;  3WOD F;  4CO8 A;  3TO6 A;  1MJ9 A;  2GXG A;  1TQI A;  4ZZD A;  2EFP A;  4YFK F;  1Z91 A;  2L3D A;  1K78 A;  3WG9 A;  1K79 A;  1UB9 A;  1BIB A;  4A5M A;  2QBY A;  3VEP A;  2NNY A;  4R8H A;  5KVR A;  1BI0 A;  3GWZ A;  4IHS A;  4RB0 A;  2DK5 A;  1XMA A;  2H6B A;  4KUM A;  4BHB A;  3IKV A;  1W4M A;  4Q48 A;  2P6T A;  2V79 A;  1IXR C;  1FSE A;  4HV6 A;  4L5I A;  1ZG3 A;  3QP5 A;  3ZMS A;  1FBS A;  4NQW A;  1KU9 A;  3L2C A;  2Z9O A;  2M5W A;  3DPL C;  5JFR A;  3GYH X;  5CJ9 A;  1DPR A;  2OQG A;  3E5U A;  3TO7 A;  3FM3 A;  4UVC A;  5K1Y A;  2VOD A;  4EQQ A;  5L3G A;  1IN8 A;  3GF2 A;  4M6X A;  5CVJ A;  2VE8 A;  3RTR A;  1FOK A;  4G94 A;  3ZP5 A;  1TQP A;  4LB5 A;  1KYW A;  2LF8 A;  1GXQ A;  2JPB A;  4AIK A;  3I5U A;  1USS A;  4P55 A;  3T1B A;  5JR3 A;  1GVJ A;  3GFI A;  2IPQ X;  3B73 A;  1IF1 A;  1B9N A;  2GWR A;  4OIP F;  2Y0M A;  4A0Z A;  2P6S A;  4A2U A;  2FEZ A;  2HQN A;  1FYM A;  5LLQ A;  2ZBK A;  1C0W A;  5DUI A;  4RAZ A;  3CO7 C;  3MQ0 A;  3E6D A;  4XLN F;  3LWF A;  2KIM A;  2DQR A;  1J7K A;  2QLZ A;  3WTW C;  4G8X A;  2QUF A;  5DCM B;  3BRO A;  3QPH A;  3BY6 A;  5DCF A;  3WGH A;  1YFH A;  1O57 A;  3K2Z A;  4UHT A;  3O2P E;  2EA2 A;  1HBX G;  1XDU A;  4Y17 A;  1R58 A;  1RNL A;  3LAJ A;  4CGZ A;  3KP2 A;  1D8J A;  2PBI A;  1KU2 A;  3I0T A;  1UFM A;  2DW4 A;  4O5V A;  4RB3 C;  2FBK A;  4G7Z F;  2ZO4 A;  2QQ9 A;  2FF4 A;  2HQR A;  4QWQ A;  2XUB A;  1JE8 A;  2XKP A;  2IA0 A;  3F8C A;  1LB2 A;  4LFU A;  1MZB A;  2ZNY A;  1BBY A;  3BPX A;  2YPR A;  4A0Y A;  5IT9 Z;  2ELH A;  3JSP A;  1J5Y A;  1EH8 A;  4HF2 A;  1IZ1 A;  4OOI A;  2HDC A;  1G4D A;  1SFX A;  2FBH A;  3KLN A;  1ZAR A;  2PEX A;  1DUX C;  2P7C B;  3JAM K;  2FSW A;  2HEO A;  1KA8 A;  5IT3 A;  3KCC A;  3V8K A;  1MKM A;  3WGG A;  3ECH A;  2M1B A;  1FSH A;  2R7D A;  3BJO A;  5A2Q Z;  3L09 A;  5HDG A;  1SFE A;  4CIC A;  1G6N A;  4HLX A;  5L3E A;  5ICG A;  2VT2 A;  2EWN A;  3ZMU A;  3CDH A;  5HS9 A;  4KNY A;  5IT9 K;  1K78 B;  2EV0 A;  2YSR A;  2ACJ A;  1P4X A;  1D5V A;  2QBY B;  2A5Y B;  4WXH A;  1TNT A;  5K5Q A;  3Q9V A;  5A2Q K;  2GZW A;  1P4W A;  1OMI A;  4RGU A;  1WWX A;  4LGW A;  3GEZ A;  4I02 A;  2VON A;  2RN7 A;  3KEQ A;  2DPU A;  2BV6 A;  3GVA A;  4IPA A;  2W25 A;  4PGG A;  2FQ3 A;  1ZG1 A;  5D5W B;  1O3T A;  1HW1 A;  4IHT A;  1HST A;  2P5L C;  5HLI A;  3I53 A;  3R0A A;  3VB2 A;  3F6V A;  2HOE A;  5DD8 A;  3D5L A;  1L3L A;  2PN6 A;  5E1Z B;  3WU0 A;  5LBQ A;  3F8B A;  4ESB A;  4DQ2 A;  2W84 A;  2FU4 A;  2HKX A;  2F5E A;  3BJ6 A;  5F6F A;  4M73 A;  1MDM A;  2ZJ2 A;  3JTH A;  1SAX A;  1WSU A;  3HUG A;  2NNN A;  2IA2 A;  5ED4 A;  5DYM A;  2MH2 A;  2CGP A;  2A3S A;  4UUV A;  4G7O F;  1FYK A;  3C18 A;  3RPQ A;  3NEU A;  4ZYG A;  4KN4 X;  2D1H A;  2GIV A;  3PQJ A;  1B4A A;  2AXL A;  1I1S A;  5BPI A;  4HA8 A;  4EM0 B;  3L9F A;  1SMY F;  3K1N A;  5FB2 A;  2A69 F;  3ABT A;  2J5P A;  2KJB A;  1J75 A;  1D3Y A;  2MLG A;  2O03 A;  4R1H A;  3RYR A;  5K5R A;  4KMF A;  3VOD A;  2XIG A;  4ENK A;  2Y48 A;  4HDU A;  3BP8 A;  4RGR A;  3WGI A;  1P2F A;  4FT8 A;  4L0Z B;  2E7W A;  3FXQ A;  4HX7 A;  2O3F A;  4N9H A;  2NAZ A;  4BHP A;  3IRQ A;  1T38 A;  5ICE A;  3RI4 A;  2P7V B;  4OU0 A;  3LA3 A;  5LHI A;  1FP1 D;  3RKY A;  1MJB A;  3E3V A;  4IRI A;  1ZLJ A;  2Q0O A;  4O6J A;  1RUO A;  3KEO A;  2STT A;  2OBP A;  3VFZ A;  1BI2 A;  1AWC A;  4UVA A;  1YG2 A;  3KFW X;  3HRU A;  1EH7 A;  4U7D A;  1BOA A;  4EJT A;  3BPV A;  1T6S A;  3RKW A;  1XGN A;  2HZT A;  2UXX A;  3ZMT A;  3KLO A;  5HLG A;  2BYV E;  4WX9 A;  1JXS A;  3BWG A;  4UXN A;  4FX4 A;  3KP4 A;  4L9N A;  5FO5 A;  2XKO A;  4ZYE A;  4JK1 X;  2TDX A;  2UZK A;  1PDN C;  2JZY A;  3NQO A;  1FY7 A;  1EH6 A;  1SD7 A;  1LVA A;  3WTV C;  4KIB A;  3K69 A;  3K0L A;  1G3T A;  4XSX F;  3JSO A;  1TTY A;  5FLX K;  3F8F A;  4KDP A;  3T5X A;  4Y13 A;  2ISZ A;  3V7C A;  1IAW A;  2F5C A;  5CVR A;  4A5N A;  2QYO A;  2OQR A;  4D0P A;  1P4A A;  5HS8 A;  2M87 A;  4N9I A;  1XSX A;  3EYY A;  2CQK A;  2H27 A;  2WV0 A;  3HTS B;  2R3S A;  2ZNZ A;  4G6Q A;  1LDK B;  2GAU A;  1OKR A;  1FNN A;  2JSC A;  2PMH A;  3TDU C;  1K6O A;  3BZ6 A;  3DQV C;  2CYY A;  3ZN1 A;  4HQM A;  1Z9C A;  1R1V A; 
#chains in the Genus database with same CATH topology
 1DGW Y;  2FD5 A;  1GDT A;  4BBS J;  4ZJZ A;  1TLH B;  2XGC A;  3K10 A;  2M7B A;  2MLK A;  2GLO A;  1JT6 A;  2NVY J;  1HKQ A;  3ELK A;  4MEX F;  4B09 A;  1MDM B;  2LMD A;  5LHH A;  4E7L A;  4KMU X;  3TOB A;  2Z33 A;  2STW A;  2EIL H;  3HUG B;  4NC6 A;  1O7L A;  5J1Y A;  2Y2Z A;  4JYK A;  3UKG A;  1MMS A;  1BJZ A;  3GO5 A;  2R7Q A;  2H09 A;  4DIQ A;  2ZXI A;  1X1D A;  2X1E A;  2W4S A;  4HYE A;  1J0R A;  2R7U A;  1S6L A;  3IHU A;  1VQ9 I;  1B72 A;  2B63 J;  2R7V A;  3K7A J;  5FD5 A;  3AG1 H;  1TBX A;  3QWL A;  3GUD A;  4Q4Z F;  3IRR A;  2R0Q C;  3HB9 A;  4KT6 A;  3F23 A;  3M4O J;  3ASN H;  3ZQL A;  3FMR A;  2CSO A;  1JHH A;  4ETS A;  1W7P A;  2NVT J;  3AAF A;  4KIF A;  3BZK A;  1A31 A;  3TW6 A;  3P7N A;  4M74 A;  2A07 F;  3I58 A;  3P9C A;  1GVD A;  5GAG J;  2BZT A;  3IP4 B;  4FIS A;  4AD9 A;  4GRI A;  2R7F A;  3EUK L;  1WJF A;  5J6X A;  1LQ1 A;  1H0M A;  1D0X A;  3CD6 I;  3BTC A;  1QHH D;  2JUG A;  2QWW A;  1LDD A;  1ZG5 A;  4WK8 F;  2FUG 2;  3PUB A;  3T8T A;  1ITY A;  2KIU A;  2EV6 A;  2MH9 A;  3LMM A;  1RKT A;  2Z3Y A;  4H4K C;  1B1B A;  4TV7 A;  1XC5 A;  4X0G A;  2CS3 A;  1TWH J;  4CXF A;  1YHQ I;  2OD5 A;  1QQI A;  2VJ5 A;  5FFZ A;  2JA6 J;  3TBI A;  4XLE A;  5CQG A;  3ABK H;  5FKK A;  3DFG A;  2JVG A;  4EJW A;  5H6Q A;  4F93 B;  2VBW A;  2FA5 A;  1HOM A;  4IHW A;  1VQ6 I;  2HVQ A;  1NTC A;  2X6W A;  3HHG A;  2K27 A;  1MND A;  2Z5U A;  2L7M P;  4C30 A;  1ZRC A;  3BR6 A;  3BG9 A;  1W5C C;  2W7N A;  1XB4 A;  3FK7 A;  2A6T A;  4F7Z A;  1QBJ A;  1V55 H;  1BI3 A;  4CCL A;  2E1M C;  3QQA A;  2QKL B;  4YII A;  3DP7 A;  1J59 A;  3SJM A;  3N05 A;  1MD0 A;  1XDS A;  2LYC A;  4PZJ A;  2DDB A;  5FRN A;  5C4X J;  4E7J A;  2DDA A;  5J3L A;  1HF0 A;  3U2R A;  4IHV A;  4X6A J;  3CZ6 A;  2KT0 A;  2MGQ A;  2V9P A;  4M71 A;  5J4Y A;  4CCJ A;  1DP3 A;  1KQ0 A;  3A02 A;  2HDW A;  1MGT A;  5TRD A;  2XHK A;  2K4B A;  1QPM A;  4RAY A;  1TW3 A;  5J8F A;  4GFB A;  2F48 A;  1OR7 A;  4RGS A;  1ZEL A;  4ZDL A;  1XCB A;  1D0Y A;  5IP6 A;  3HTU A;  3CCL I;  4F91 B;  4CCK A;  4B4C A;  1SFO J;  1WRJ A;  3H9G A;  4M9X A;  3B6C A;  2PMU A;  4Y4R A;  5BNG A;  2GA1 A;  2RNJ A;  3ZQI A;  2KIF A;  3D5S C;  1F4K A;  1S3J A;  4OIQ F;  3GTL J;  4BGD A;  1ODD A;  5J1R A;  2ZFW A;  3OIO A;  5IYC J;  2VLA A;  3OR2 C;  3FF5 A;  1FLI A;  2MBF A;  4LIU A;  2EJR A;  3OYL A;  1W0T A;  1J2X A;  3ECO A;  1VQO I;  5CVI A;  2DYR H;  1SVL A;  1J09 A;  2LNB A;  4XLF A;  4CHU A;  3C1D A;  3ESW B;  4M72 A;  3BZC A;  1IC8 A;  1ULY A;  2L7Z A;  2XV4 S;  3E5X A;  5IOZ A;  4PSX A;  4HZF A;  3M8E A;  1QVT A;  1VI0 A;  3A4C A;  1TWG J;  3OR1 C;  4KYW A;  5JHU A;  3CCV I;  1Z77 A;  2XRO A;  1ZRE A;  3MCZ A;  1X3U A;  1IV8 A;  1XMX A;  3ZQH A;  2R7X A;  1OCZ H;  2EIM H;  1FBQ A;  4B43 A;  2W85 A;  1R49 A;  3CO6 C;  2XSD C;  2H8W A;  2LKP A;  5F0H A;  1E3O C;  4MIM A;  1KQ9 A;  2RRE A;  4BH9 A;  2HVR A;  2J5O A;  2VC1 A;  1YRN A;  3T0Y A;  1G59 A;  2XGX A;  3PM1 A;  4NB5 A;  1S7E A;  2XF7 A;  4XKW A;  2FML A;  2RGV A;  2K3P A;  3HKZ A;  5ERI A;  2VQG A;  4PJN A;  3IKT A;  3ZQG A;  3QRF F;  4GDF A;  2BY3 A;  4AIJ A;  3J7Y J;  3HSE A;  5K7Z A;  1BC7 C;  3V7S A;  4YEL A;  5M3F J;  1U3E M;  1MH4 A;  3K1M A;  3CCY A;  1T2K A;  1YTY A;  4XKB A;  5L3D A;  1QZZ A;  3K4C A;  1K4T A;  1KZH A;  4BQA A;  4IVN A;  4Y33 A;  2WB1 N;  4MQ9 F;  2EBI A;  4HNV A;  1FMV A;  2MD0 A;  3ONQ A;  2Z1D A;  5E18 F;  4UVB A;  4ZTJ A;  5B66 C;  1G3S A;  5LD2 C;  3KYD B;  3BCA A;  3R4K A;  4PFO A;  2KJC A;  4XNF A;  1GT0 C;  3BTI A;  4BJT A;  2HOS A;  2WAQ N;  1LNW A;  5DD4 A;  4A3J J;  2LOO A;  4P9U A;  1BA5 A;  5BOX A;  1V4R A;  5J1U A;  3G4S I;  4V2G A;  3LOC A;  2IS2 A;  3TP3 A;  5JVT A;  3DWL E;  5HS7 A;  2M45 A;  5C3E J;  4S0H B;  1JHF A;  4A3M J;  1LFB A;  2A68 F;  1N78 A;  3DPT A;  4A3K J;  3MVP A;  2M4K A;  3E5Q A;  2V1U A;  3BR2 A;  1Q1H A;  2AQF A;  2CQ7 A;  1L0O C;  2ZC2 A;  1I39 A;  1KGS A;  2W48 A;  2Y69 H;  2O5R A;  1CQT A;  3GFL A;  4Z2Y A;  3CLO A;  1A36 A;  2FBI A;  4CA0 A;  4LG0 A;  1HQC A;  2KPM A;  2ZCW A;  3R61 A;  1R5H A;  5E3N A;  5LGU A;  3IH4 A;  1B72 B;  1MH3 A;  2K9M A;  2L7K A;  1X1A A;  2V1D A;  3GLX A;  5ICC A;  1U5T C;  2WC2 A;  3R60 A;  1R5I D;  1VQ8 I;  2RVC A;  1XX5 A;  2LRE A;  2HKO A;  3OS2 A;  1W7P B;  1MSE C;  2VJI A;  1I6X A;  1WH7 A;  2HWV A;  1OYI A;  2BVL A;  3DKW A;  2CUE A;  1W0U A;  4ON0 A;  2E5Z A;  4E7S A;  5D8K B;  3AKZ A;  2HYF A;  4ANJ A;  2CH0 A;  2PJR A;  1K7A A;  2FOK A;  3H9J A;  3HOT A;  3FBI B;  2D2W A;  1BR4 A;  5KAI C;  2PI0 A;  1RR7 A;  4Y15 A;  5B1B H;  1IUY A;  4BAY A;  1K4S A;  1Z6R A;  4IRG A;  2BHZ A;  1TP4 A;  4F92 B;  2DBB A;  4IQ4 A;  5ILU A;  1EV7 A;  3H36 A;  2DA3 A;  4XN0 A;  3JRI A;  1U8B A;  1E3P A;  2KRH A;  2HVS A;  3RYP A;  1V5E A;  5LRR A;  2ISY A;  1BN5 A;  2NOJ B;  1AHD P;  4ESF A;  3E6B A;  2M34 A;  2ZME C;  4A3L J;  3MZ8 A;  5FKN A;  3J81 Z;  1YW8 A;  3LL7 A;  4CSW A;  2O8K A;  3RKX A;  3GTQ J;  4FX0 A;  2VJJ A;  3LFK A;  3KP6 A;  2KIS A;  4XON A;  4WXC A;  2VUM J;  4KIC A;  4MTD A;  2W00 A;  4AU7 A;  3GZ6 A;  1ZN2 A;  3H3U A;  2ECB A;  1HW5 A;  4GGG A;  4AYB N;  1GHC A;  5F1R A;  4WF2 A;  1S9H A;  3CTA A;  1RET A;  3HOX J;  4OMZ A;  3I55 I;  3HOS A;  3EQL F;  3JR9 A;  3C2G A;  2VL8 A;  4FHT A;  4HOB A;  3JCU C;  4AWX B;  1UST A;  1U9O A;  1SC7 A;  4P5O A;  1XPX A;  3HJE A;  4FQG A;  3K4L A;  2NYX A;  3PUF A;  5JVG F;  1LPQ A;  2DA7 A;  3J81 K;  4HG2 A;  3X2Q H;  2IW5 A;  3QU3 A;  4NUB A;  2VOP A;  1A6I A;  1HLV A;  3WHC A;  3IAS 2;  1Z3Y A;  1AU7 A;  3A01 A;  2B7E A;  1WH5 A;  4BBR J;  1ZKG A;  5HNH A;  2JN6 A;  2E60 A;  1U8R A;  1N77 A;  2ME0 A;  3HHH A;  3OV8 A;  4G9Y A;  1U0J A;  2MFZ A;  4I98 B;  3ULQ B;  2DFI A;  3LST A;  4B8X A;  2FRH A;  1IJW C;  3AG4 H;  4G12 A;  3WE3 A;  2XB0 X;  4BE0 A;  2BXY A;  4CZZ A;  2O8X A;  3O6B B;  3OSF A;  4FTH A;  3S1N J;  4PJM A;  5EDN A;  1Y8Q B;  3E6M A;  3LFU A;  2Y75 A;  3BQZ A;  4BQO A;  1BL0 A;  1NHA A;  2G0E A;  1YIT I;  4C9Y A;  2XAS A;  3LAP A;  3K4M A;  2V1N A;  1PUE E;  5HDK A;  4LD5 A;  4E7K A;  2XAF A;  4B3A A;  1W5S A;  5KHD A;  1W5T A;  1POG A;  1OYW A;  4KT5 C;  3HSR A;  2A6H F;  1LDJ A;  2DPD A;  2E2H J;  3WU1 B;  5CVU A;  2MC3 A;  4FET A;  4M9S A;  3A1Y A;  4B44 A;  4UV8 A;  1Y0U A;  1O3R A;  3FZV A;  3OIQ A;  2EIN H;  1YRN B;  1SMT A;  1E0E A;  1BJA A;  2WAF A;  3PQK A;  5FRO A;  1PP7 U;  3ZQC A;  1NK3 P;  3OYC A;  3QU6 A;  1S29 A;  1SAN A;  1T0F C;  1LEB A;  1TT0 A;  4MQV A;  4RS8 A;  5AIP A;  1LJ9 A;  3DBH B;  1K6Y A;  2VBY A;  3M8F A;  4NDL A;  3V42 A;  2P81 A;  3WU2 C;  2X0L A;  4BKX A;  5HDN A;  3DCF A;  3FK6 A;  2LVS A;  2LBF A;  2YR2 A;  5TIS C;  3SEZ A;  2MG4 A;  1UMQ A;  4D7N A;  3T8R A;  3HGG A;  4BYY A;  4Y52 J;  4IXA A;  2IJL A;  3HYI A;  1FIA A;  4BUP A;  1WKM A;  2JK3 A;  2YX4 A;  3L2Q A;  1FWZ A;  3H5R A;  4HPQ A;  4U0V A;  1HC8 A;  1ON1 A;  2EK5 A;  4W1U A;  3JRD A;  2RAE A;  3BC8 A;  3FXU A;  4AVZ A;  1X3W B;  2DJI A;  1QGP A;  1SAU A;  1WJA A;  2VXZ A;  1H9T A;  5DM7 F;  2MA3 A;  2LSO A;  4ABZ A;  4G7H F;  2B9S A;  4IHX A;  3BJA A;  4DZP A;  3ASO H;  5FGM A;  3KX2 A;  1YS7 A;  4BJ5 C;  4IOC F;  3S17 J;  2KRC A;  3C7J A;  4AID A;  1JT0 A;  5HNF A;  2G9W A;  2OZ6 A;  2CV1 A;  1T08 B;  1ZHF A;  5DV5 A;  4EGZ A;  3MD2 A;  3OYJ A;  1ENH A;  4V19 K;  3QYB A;  1OR7 C;  3VSL A;  2DN0 A;  3M8J A;  4BQN A;  4R79 A;  2PLY A;  2LY9 A;  1IXC A;  4EAT A;  1MSF C;  2R93 J;  1QU3 A;  2FX0 A;  2LFB A;  2CQQ A;  2RV8 A;  5DTD A;  3TW7 A;  3TKY A;  4LG0 B;  4XOP A;  5CLS A;  3UNG C;  2CW0 F;  2LG4 A;  3ZCO A;  5E20 A;  2BHY A;  3UR3 C;  1QZY A;  4XL9 A;  2BGC A;  1R4M B;  1FJL A;  2DTR A;  4S05 A;  2XGD A;  3CP8 A;  4L5J A;  4M6Y A;  3TO9 A;  2JUC A;  5HOO A;  3WTU C;  2CV0 A;  2IP2 A;  1ZR4 A;  4I99 C;  2XPV A;  4HEA 2;  3L2W A;  5EJC A;  2BBY A;  4BE2 A;  1DP7 P;  1U6G A;  2GQQ A;  2I5U A;  1ZGA A;  4Z6Y A;  2L54 A;  2HR3 A;  2CO5 A;  3WTY C;  1VQK I;  1B59 A;  1Y8R B;  1MW7 A;  1XGO A;  4CUG A;  4RDU A;  2KQR A;  1ETO A;  3KP3 A;  3CCM I;  3C2H A;  1D5Y A;  2GXA A;  1TNS A;  3ROU A;  2PJR B;  2E34 A;  4RLQ A;  3OMY A;  3J80 Z;  1IN6 A;  2R7R A;  2COM A;  1U5T A;  3K6G A;  3PNY A;  3A03 A;  2PQ8 A;  9ANT A;  2AQE A;  1H89 C;  2QVO A;  3J7A O;  5DDG A;  1CF7 A;  5FJ8 J;  4MHG A;  4D5C A;  1G3Y A;  1SD4 A;  3VYT B;  3MWM A;  2LKX A;  2CWE A;  5HLT A;  4MEY F;  3I54 A;  2LKS A;  1YW9 A;  5DEQ A;  5FKM A;  5H6R A;  5B5E C;  1Z6T A;  2ICW G;  2ZSI B;  4RB1 A;  1BR2 A;  4BQQ A;  1KU3 A;  1HKT A;  2IAI A;  2CUF A;  3F9K A;  1TC3 C;  1XMK A;  3F21 A;  2Q2E A;  5GPC A;  4ASN A;  2NRA C;  1RZ4 A;  5HVQ C;  2EFO A;  2CFO A;  2F4O B;  2DYS H;  1I1G A;  1FZP B;  3NRV A;  3WTX C;  2VQH A;  1YX3 A;  1XN7 A;  2LTP A;  2KLO A;  3QAH A;  3J80 K;  1B9M A;  1RUN A;  2XB5 A;  5TJJ A;  1UHM A;  3QYF A;  1QA6 A;  3KP7 A;  3V7R A;  1WGX A;  1XSD A;  1BR1 A;  3QOD A;  5EF6 A;  3FM5 A;  2LRD A;  2BY2 A;  2RKH A;  1X3Z B;  1RKW A;  3I59 A;  3H3Z A;  3ZMZ A;  2G7H A;  4N4O B;  1LKX A;  2CW7 A;  3PSF A;  2ZME A;  2Z2S B;  1FPQ A;  2IRF G;  3O3K A;  2JJ7 A;  5HLH A;  3F3X A;  1WVR A;  2ZJR F;  4A3D J;  4YFX F;  4JOM A;  2AO9 A;  4EJV A;  1FX7 A;  4I09 A;  4EEF G;  1TQM A;  3ML6 A;  3KZZ A;  4EM1 A;  3REO A;  5ILV A;  2HS5 A;  2ZXJ A;  3K4J A;  4MGR A;  3MKZ A;  3JTG A;  4OIR F;  4L9T A;  2L01 A;  1MBF A;  2LDU A;  3PFI A;  5DCM A;  3GW2 A;  4HQE A;  1UJ8 A;  1V5F A;  3S2H J;  2CJJ A;  3A01 B;  3N97 A;  1GLN A;  3QYE A;  2JA2 A;  2R7W A;  1F43 A;  4EVI A;  4BDY A;  4OWR B;  4C2U A;  2X51 A;  2V4J C;  2R5Z A;  1IRF A;  2XAU A;  3CJR B;  1XGS A;  2QEN A;  5LHG A;  3OYN A;  2L02 A;  2H8R A;  1D8K A;  1V3F A;  3K2A A;  1Q1V A;  2HFH A;  2BW3 A;  1LEA A;  2VKE A;  4IEJ A;  2FOW A;  1FYL A;  2HTJ A;  1ZK8 A;  2IGN A;  3N4M A;  2WV1 A;  4QLC U;  1P92 A;  5E8I A;  3FXO A;  3IV5 A;  4LLN A;  4HF0 A;  2DXI A;  3VPR A;  4DBR A;  2JQ7 A;  4JX4 A;  3ABU A;  2EIK H;  3V8L A;  2F5F A;  2LK2 A;  3DXJ F;  5FFX A;  3G3Z A;  3I71 A;  3R6S A;  1FIP A;  3M1E A;  5EZG A;  1WHU A;  4RA2 A;  3CCJ I;  4A12 A;  1J9I A;  2OA4 A;  4DYC A;  2M4G A;  3ZXS A;  3MZH A;  3V4G A;  3ZQF A;  3ZN0 A;  1Z67 A;  1XSV A;  1OIS A;  2EFN A;  1WQ2 A;  2VPL A;  3BCB A;  2X1D A;  3DEE A;  4ITV A;  2UV1 A;  5FD6 A;  1MMD A;  2VIX A;  3A0H C;  3FIW A;  3KP5 A;  1XCV A;  2DAO A;  4P9F A;  2KKO A;  1A35 A;  2VKD A;  2K86 A;  2HXI A;  1U2W A;  2JA7 J;  2FE3 A;  1BW5 A;  3RIR A;  2FQ4 A;  1YJN I;  2O7O A;  2HTS A;  2A61 A;  3EET A;  5ICF A;  3I56 I;  2DOD A;  3HKZ N;  2NS0 A;  2C6Y A;  3W3C A;  2JTV A;  2ESH A;  2LBF B;  3R0J A;  2E1N A;  3FBN B;  3C3W A;  4EMS A;  2K4J A;  2DU9 A;  4LK1 F;  1ETQ A;  3QPL A;  4C3H J;  4HV5 A;  4KN7 X;  5JHF A;  1VQ5 I;  1ZYR F;  1T0F A;  5IPA A;  1REP C;  2WAD A;  5C44 J;  2CFX A;  4FE4 A;  4U0W A;  1VQ4 I;  3SQN A;  1VND A;  3IC7 A;  3HGY A;  2DK8 A;  3HRM A;  1VQP I;  1OYY A;  2ESN A;  2RQQ A;  2D45 A;  3COA C;  1YI2 I;  4PK4 A;  3RQI A;  4NC8 A;  1PYV A;  4D7M A;  3HOY J;  1KON A;  4L0Y B;  2RC4 A;  5F08 A;  1E17 A;  3HIF A;  1YS6 A;  3M7G A;  2R7T A;  4O3M A;  2L2O A;  4F3Q A;  1LFP A;  3GXO A;  1OCT C;  2EA4 A;  3IWF A;  4A3E J;  5F64 A;  3TP0 A;  1RRJ A;  4AM3 A;  5KCM A;  3DKX A;  1I27 A;  4ZH4 F;  3S2W A;  2RDP A;  2O6G E;  4ENN A;  1G3W A;  4XLC A;  3I9V 2;  4HBL A;  1ETY A;  2L7F P;  1P6R A;  5BMZ A;  1VQM I;  4EJO A;  4XBF A;  2E5N A;  1YO5 C;  3S16 J;  1A6Q A;  3LA2 A;  5CKT A;  2ETH A;  2KZG A;  1ONV A;  2EZI A;  1MMG A;  4WWC A;  1W7P D;  4LJZ F;  3E97 A;  2M7A A;  1FTT A;  3LSJ A;  5FLM J;  1F36 A;  3CUQ C;  1X1C A;  1CGP A;  4BNC A;  4C3I J;  3E6C C;  3H0G J;  1BC8 C;  1WJC A;  3BDD A;  1JUP A;  2YX7 A;  2R5Y A;  1IDY A;  1S7A A;  1U5T B;  2ECC A;  1UCR A;  1ZQ3 P;  1IG7 A;  4YIR X;  2DA6 A;  2EFW A;  1Z7U A;  2LC2 A;  1CF7 B;  2F4M B;  4RGX A;  3S93 A;  3BR1 A;  2X9D A;  3HEF A;  2OU2 A;  2EQR A;  5EEG A;  1R9T J;  2CRG A;  3BG5 A;  1YIJ I;  3CUO A;  2K02 A;  3DTK A;  2RNG A;  1ORK A;  1YX5 A;  3B02 A;  1ZRF A;  1MMN A;  2HYJ A;  5DUK A;  1BIA A;  2EH3 A;  4JX6 A;  2MW8 A;  2K9L A;  3SFI A;  2Y0S A;  3VYR B;  2M2E A;  2Q2E B;  3MZY A;  2EZK A;  1X58 A;  3SDG A;  5BPD A;  3PSI A;  2EZH A;  1YYV A;  3CCE I;  2GOX B;  4JBA A;  4KIS A;  1JKP C;  1WPK A;  5D4S A;  2K9N A;  1I5Z A;  3GZ5 A;  3I59 B;  4P1W A;  1SD5 A;  1Z7L A;  4J19 A;  1XTA A;  2V9K A;  2ZKZ A;  4L9V A;  3HOV J;  3O8G A;  1MJA A;  2ZME B;  1DU0 A;  3LQQ A;  4UB6 C;  3JRA A;  5CVV A;  1P7I A;  2NS7 A;  5D5X B;  3EPZ A;  5E8G A;  1YOV B;  4NHJ A;  2RQP A;  3HG9 A;  4PSW A;  1T98 A;  3BR0 A;  2XAH A;  3G71 I;  4ENJ A;  3H35 A;  2DMQ A;  1F9N A;  3F8N A;  3HL2 A;  4HX8 A;  2VBX A;  1FBU A;  4PCQ A;  2GA2 A;  1ERD A;  2NVU B;  1R5G A;  1X1P A;  2ELJ A;  1K61 A;  3KEY A;  1T95 A;  2W82 A;  2M9H A;  1HKS A;  1ZGJ A;  3OOP A;  3PFY A;  2R5Z B;  1P9Q C;  3EUH C;  4L18 B;  3ABL H;  2LY1 A;  1NH3 A;  1Z21 A;  5E1X A;  2BW3 B;  1XS9 A;  3KPH A;  1S7O A;  1VQ7 I;  3EYI A;  4PJJ A;  4A3I J;  1U78 A;  3GTO J;  3BQY A;  3DU6 A;  3K1P A;  4HNU A;  3ERE D;  2VN2 A;  2I8D A;  1JGS A;  4E7I A;  3MMY B;  3Q0W A;  3SXY A;  1OPC A;  4BHC A;  1KQ8 A;  2KFD A;  1NG7 A;  1E2X A;  2HZD A;  3IWZ A;  4C3J J;  4OMY A;  3JAM Z;  2K7L A;  1Z0X A;  4YG2 F;  3OOU A;  4MO7 A;  4YEJ A;  4II3 A;  4LLG F;  3WTS C;  4M9Z A;  4RBO A;  3GX4 X;  4ZDO A;  3SHF A;  3DV8 A;  2ADU A;  2JT1 A;  4U87 A;  5KNL A;  2HQ5 A;  2EFQ A;  2ZSH B;  2VC0 A;  3VOE A;  2VKV A;  1EA3 A;  1HDD C;  3FKJ A;  1MBJ A;  2JA8 J;  2E1C A;  2EIJ H;  1PP8 F;  4XN3 A;  4U0Y A;  4E70 A;  2COB A;  5M5W J;  2ID3 A;  3CC7 I;  1FP2 A;  1OQY A;  4U7B A;  2JSP A;  3L2U A;  1B8I A;  3PIP F;  4HLY A;  3GCM A;  3F22 A;  2W57 A;  4G6T B;  2F2E A;  5J4V A;  2BE5 F;  3I4P A;  3G1L A;  1TZL A;  5ILS A;  3HDD A;  5KK1 A;  1S8N A;  1SD6 A;  4U88 A;  2CMP A;  3JW4 A;  5D4R A;  3RDI A;  4WXD A;  2CQX A;  2HXO A;  4QTR A;  3F6O A;  3U21 A;  4L9J A;  2NOG A;  2Z16 A;  1WJ5 A;  2V1X A;  4K2E A;  3CDL A;  4P96 A;  1DPU A;  4EM2 A;  2HGC A;  3EDP A;  2R7O A;  2VE9 A;  2DFH A;  5AON A;  4DNC A;  4KA4 A;  3H1C A;  2QEX I;  4HST A;  4UUT A;  4NC7 A;  4M3D A;  1IO2 A;  4BY7 J;  4XLH A;  1IN7 A;  1MBE A;  3PNT A;  4GYG A;  1GXP A;  1RI7 A;  4JQF A;  2VBZ A;  5L3F A;  4QSH A;  2XC7 A;  3HSF A;  4XMY A;  4QIW N;  5J8C A;  2QQA A;  2V6C A;  1QO0 D;  1I3A A;  1N25 A;  2OAZ A;  2H6C A;  3EUA A;  3OS1 A;  3FX3 A;  5KAF C;  2M30 A;  3NAR A;  3OYK A;  4A6E A;  1TT5 B;  4AUX A;  1IW7 F;  1T39 A;  3PO3 J;  2FMY A;  3IL2 A;  1YW7 A;  4JP0 A;  3K9T A;  4LB6 B;  4I2O A;  1YLF A;  4QPQ A;  1R1U A;  1XGM A;  1IDZ A;  2EV5 A;  3RZO J;  3SZT A;  4HF1 A;  2OZU A;  3BG7 A;  4EGY A;  3WG7 H;  2FNA A;  3D1N I;  4GCV A;  3U1K A;  4HNT A;  3BOQ A;  1GV2 A;  1R1T A;  1IRX A;  2BVM A;  2Z99 A;  3VSK A;  3W6J B;  4LLL A;  1STZ A;  3DPU A;  3FXL A;  2OV7 A;  3W6V A;  4BXX J;  4B1R A;  2CG4 A;  3ZR8 X;  2VPR A;  3MEX A;  1VTN C;  5D6F A;  3H5N A;  2ZJQ F;  1OLT A;  3A2K A;  2A6E F;  4XRS A;  2VAS A;  1WJD A;  1KYZ A;  1LFU P;  1TWA J;  2OF7 A;  1O3Q A;  2B0L A;  2L9N A;  1ZH5 A;  3JRC A;  1Z3X A;  4YIF A;  2R5Y B;  2QQ8 A;  3S3O A;  1AKH A;  2QKM B;  2UXN A;  3Q5F A;  4XLP F;  1F5T A;  2G7U A;  1WJE A;  2LD5 A;  1WI3 A;  2X1C A;  4FAS D;  1GV5 A;  4RAG A;  4YFN F;  2BY0 A;  2QF7 A;  3CQZ J;  3ISP A;  3CUQ A;  4D5F A;  5FKO A;  4DZJ A;  1R36 A;  4UNO A;  2IA1 A;  5JLW A;  2M3A A;  3LSK A;  2P4W A;  5FRM A;  1A5J A;  2QGU A;  4LIT A;  2BOL A;  4HW0 A;  5B3S H;  1RES A;  4N0B A;  2P5V A;  3WTZ A;  5BS6 A;  5L3C A;  3OYA A;  1MMA A;  4G6D A;  1FTZ A;  2NVX J;  4XK4 A;  2CV2 A;  2DLL A;  4IX7 A;  4GYI A;  5F0C A;  3VYS B;  4J00 A;  4BE1 A;  1PUF A;  3U9G A;  5M3M J;  4I0B A;  2F4I A;  3ZMV A;  2NVQ J;  2WWY A;  2QSH X;  1OCO H;  1F1Z A;  3DU5 A;  2EPF A;  3GFM A;  1DDN A;  1A04 A;  3U1D A;  4PDK A;  1RC9 A;  1T8I A;  3DBL B;  3QP6 A;  4DOZ A;  3RZD J;  2QM3 A;  5JI6 A;  3OL3 A;  5L3B A;  5D8L B;  4A0X A;  3P9K A;  3D0S A;  2Q8K A;  3TQN A;  2LR8 A;  1IXS B;  2AHQ A;  1IN4 A;  3TGN A;  3OYE A;  3FXR A;  2XAQ A;  3Q9S A;  3WE2 A;  3HPH A;  3TOA A;  2JRM A;  4HDV A;  2PJP A;  5EG0 A;  4I0A A;  2IGK A;  1FOY A;  2KRF A;  1K83 J;  2O0Y A;  3C2B A;  5AIQ A;  3GTJ J;  6PAX A;  2E7X A;  2DMT A;  2FXA A;  1O7F A;  2OTL I;  4II2 A;  1Z1D A;  2K85 A;  2LF7 A;  2KZV A;  4BJ6 C;  1BI1 A;  3VYU B;  2PG4 A;  1WZ2 A;  3HRT A;  1OCR H;  2E19 A;  5CQE A;  2PFB A;  4XSZ F;  5D5U B;  2PMZ A;  4IL6 C;  2HDD A;  4OAY A;  4XQF A;  3HXL A;  3I64 A;  3CF5 F;  1FT9 A;  2A05 A;  4OIO F;  3S1M J;  3V8J A;  1W1W E;  2VOO A;  1R7J A;  3M9A A;  4MNU A;  3BG6 A;  1JJ8 C;  2WBM A;  3DBR B;  3VWB A;  2BY1 A;  1R00 A;  4ENM A;  2IS4 A;  4A3G J;  4UV9 A;  3DTE A;  4LIV A;  3RJP A;  2XVC A;  1HCR A;  4MFE A;  4XRF A;  3EUH A;  2K40 A;  2V26 A;  3I4N J;  2O9L A;  3KE2 A;  4V2F A;  2EB7 A;  5LGT A;  2WTE A;  4CDG A;  2JRT A;  3ZQQ A;  1H88 C;  3CJN A;  3QOP A;  3CDI A;  3E1S A;  3MN2 A;  3CC2 I;  3G2B A;  4PGH A;  3MKY B;  2AS5 F;  3H3V K;  1BM9 A;  2QZ8 A;  2HYG D;  1TW2 A;  4IJA A;  3SZP A;  1B8I B;  3P9I A;  4UUS A;  3H92 A;  3H0D A;  4RLF A;  2DO7 A;  4I7H A;  1ZRD A;  1ZR2 A;  3RPU A;  4I01 A;  3LSP A;  1DU6 A;  3ERM A;  2MC4 A;  4CYD A;  3KET A;  4A93 J;  3NWT A;  4LK0 F;  2IVM A;  3FXK A;  3F8M A;  4H0E A;  3F72 A;  3KZY A;  3HRS A;  4EJU A;  1SFU A;  2HU9 A;  4ZYH A;  1XD7 A;  3G1M A;  2R7Z J;  1IRG A;  3ZMD A;  4B3X A;  3GFJ A;  1VZ0 A;  2D1V A;  5CYV A;  3KIO A;  4MTE A;  4A6D A;  3GME A;  2P8T A;  5H20 A;  5FLX Z;  1YIO A;  2X48 A;  1ETX A;  2NS8 A;  2L4M A;  4J01 A;  2E2J J;  3KYC B;  3Q0V A;  2CU7 A;  3AG2 H;  5D5V B;  4ZZL A;  2L4A A;  1R23 A;  1WI9 A;  2H94 A;  1VQN I;  3L7W A;  2XAJ A;  4RB2 C;  4Q47 A;  3G73 A;  1O3S A;  1YQA A;  3SZG A;  1I50 J;  2AXT C;  1H9G A;  3E0J B;  4PJL A;  5E1W A;  4WCG A;  1UHW A;  3HM5 A;  5D6E A;  3OWT A;  3CJT B;  2KHM A;  4Q5S F;  1OJL A;  2H1L A;  3FDY A;  4ZYD A;  3LQR A;  2VJ4 A;  3CLQ A;  3FMQ A;  4KFC A;  3ZPL A;  3E7L A;  2OUM A;  3W6K B;  3FHZ A;  1ON2 A;  1KU7 A;  3DLA A;  2V9V A;  3IUO A;  2QSG X;  5GTH C;  3G1O A;  2GXB A;  1B6A A;  4GO1 A;  2R92 J;  1Z05 A;  4IRH A;  5LEK A;  2UWM A;  2FNP A;  1Y0N A;  2M8E A;  2W24 A;  4BY1 J;  3DEU A;  4BXU A;  2XAG A;  2M0M A;  2DI3 A;  1LE8 A;  4KIT B;  3DF8 A;  1IV6 A;  1IN5 A;  1HXD A;  4AVP A;  5LEJ A;  3K70 C;  3LSM A;  5HOD A;  3GTP J;  2F5D A;  2KIQ A;  2LY2 A;  1HSJ A;  5LRS A;  3S32 A;  5E17 F;  2WY7 Q;  3L00 A;  2IT0 A;  1AKH B;  4S04 A;  3AL0 C;  3ABM H;  3WTT C;  2ID6 A;  2YU3 A;  3CJQ B;  2DOF A;  3JRH A;  4AIH A;  4KIG A;  4DYQ A;  1ZLK A;  3ZQ7 A;  3AG3 H;  1ZGW A;  4XRS G;  1D1A A;  3MFK A;  2D5V A;  1V54 H;  5F0F A;  4CZC A;  1FC3 A;  3P5J A;  3CUQ B;  2XRL A;  4HAM A;  2DFE A;  3RCO A;  2P5K A;  2X4H A;  4EV0 A;  3TDZ C;  4IKF A;  1D1B A;  3GTG J;  2VT3 A;  2QCO A;  4XID A;  5E3O A;  5LGN A;  1QNT A;  2DQL A;  2MD5 A;  3FMS A;  4LMY A;  1RIO H;  2DT5 A;  2X6Y A;  3MAJ A;  4LG3 A;  4ESJ A;  3QPT A;  3GTM J;  2GBY A;  1FOX A;  1LUJ B;  5J47 A;  1JTX A;  3F0C A;  3AFH A;  2Y0S N;  1HW2 A;  3FXM A;  5IP9 J;  1Y1W J;  3L2R A;  3CMA I;  2OPT A;  3RQ4 A;  4CCM A;  2JPC A;  4OIN F;  4HX4 A;  1AOY A;  2L0K A;  5EEH A;  1PUF B;  3FWE A;  2DOA A;  4GXO A;  4PFP A;  3LA7 A;  2ME6 A;  5GPA A;  1R22 A;  3LSG A;  1QZE A;  1UEL B;  3SFZ A;  3OYG A;  1X2N A;  5IP7 J;  2O61 A;  1Y1V J;  1W36 C;  1ZAO A;  2QQB A;  1Y39 A;  4IF4 A;  5BQT A;  2XRN A;  2DA4 A;  1OCP A;  2VB6 A;  5K5O A;  2BEO A;  3WOD F;  4CO8 A;  3TO6 A;  4KJZ A;  1MJ9 A;  2GXG A;  1TQI A;  2GM4 A;  4ZZD A;  3IH3 A;  4MFD A;  3LSI A;  2EFP A;  4UB8 C;  2ZB9 A;  4YFK F;  1Z91 A;  5GAH J;  2YUS A;  4ZTF A;  4CCN A;  1PVE A;  3J7Z I;  2L3D A;  1K78 A;  5EG0 B;  3WG9 A;  1K79 A;  1UB9 A;  1BIB A;  4A5M A;  2WA0 A;  3VEP A;  2QBY A;  5K7H A;  2NNY A;  4R8H A;  5KVR A;  2FJ1 A;  2XSJ C;  2X6X A;  2K3F A;  1WFX A;  3S15 J;  1BI0 A;  4CYC A;  2E2I J;  1RR8 C;  1QRY A;  3GWZ A;  4IHS A;  4RB0 A;  2DK5 A;  2M8G X;  1XMA A;  1S72 I;  2H6B A;  4E7Z A;  4KUM A;  3Q3S A;  3IKV A;  4BHB A;  3J7A Y;  3M3Y J;  2MYS A;  3BT9 A;  2XPW A;  5F04 A;  1W4M A;  1O4X A;  4DBQ A;  4Q48 A;  2P6T A;  2VKH A;  2V79 A;  2HQA A;  1IXR C;  3W2A A;  1JUS A;  1JI8 A;  1FSE A;  2IGO A;  4HV6 A;  1JJ6 C;  1YJW I;  4L5I A;  3S1R J;  2X6O A;  1ZG3 A;  1VQL I;  2K9S A;  4DW6 A;  3QP5 A;  3ZMS A;  1FBS A;  4NQW A;  3Q0U A;  1KU9 A;  3L2C A;  2Z9O A;  2M5W A;  3SDB A;  5EEA A;  3DPL C;  5JFR A;  3GYH X;  5CJ9 A;  1DPR A;  2EZL A;  2OQG A;  3E5U A;  4W97 A;  4E6K G;  4D9J A;  3RSN A;  4OAZ A;  3A0B C;  1QVU A;  4UUS B;  3TED A;  1UG0 A;  2K5C A;  2VQC A;  3TO7 A;  4IZZ A;  3FM3 A;  4UVC A;  2PX9 A;  2E35 A;  5K1Y A;  3MKW B;  2VOD A;  2GOM A;  4EQQ A;  3JRG A;  1SEU A;  5L3G A;  1IN8 A;  1DQU A;  2WAE A;  3GF2 A;  4M6X A;  5CVJ A;  5DS9 A;  2VE8 A;  2BXZ A;  2TCT A;  3RTR A;  1TWF J;  1FOK A;  4CH7 A;  2JMW A;  4G94 A;  3OYM A;  3ZP5 A;  4A3B J;  1TQP A;  4LB5 A;  1VFC A;  1KYW A;  2OCC H;  2LF8 A;  1GXQ A;  3DKY A;  2V6E A;  5LFA A;  1IGN A;  1RPW A;  2JPB A;  4AIK A;  5IYB J;  3I5U A;  1X2M A;  1USS A;  4P55 A;  3T1B A;  2Y9Y A;  5JR3 A;  3CMM A;  1GVJ A;  3GFI A;  2IPQ X;  5K7F A;  1JGG A;  4QPO A;  5E79 C;  3B73 A;  3OSG A;  4E4H A;  1MBG A;  2IS1 A;  1IF1 A;  1B9N A;  2GWR A;  4OIP F;  2F6C A;  2Y0M A;  4A0Z A;  2P6S A;  4A2U A;  2FEZ A;  3S1Q J;  2KP6 A;  1H8A C;  4N4N B;  3MKL A;  4A3C J;  4DGW B;  2HQN A;  1FYM A;  5LLQ A;  1UZC A;  1R4N B;  1T33 A;  2ZBK A;  2E71 A;  1BW6 A;  1QHG A;  1V5G A;  1C0W A;  3WHB A;  5DUI A;  4RAZ A;  2A5W A;  3D5R C;  3HZJ A;  3CO7 C;  3MQ0 A;  5C4J J;  3PO2 J;  3E6D A;  4XLN F;  3LWF A;  1X4P A;  1Y56 A;  2KIM A;  1GUU A;  2DQR A;  1J7K A;  2CUJ A;  2QLZ A;  3WTW C;  1NK2 P;  1LE8 B;  4XLA A;  4G8X A;  2QUF A;  5FLV A;  5DCM B;  1X1B A;  1X4O A;  3BRO A;  3QPH A;  4FCY A;  3BY6 A;  1UAA A;  5DCF A;  3WGH A;  4FE7 A;  3O8H A;  1YFH A;  1O57 A;  3K2Z A;  5E3M A;  1R71 A;  2ZFU A;  3O2P E;  2DOE A;  2EA2 A;  3IH2 A;  1XDU A;  4UHT A;  1HBX G;  3IAM 2;  3HOW J;  4Y17 A;  1R58 A;  3W2W A;  3JRB A;  1RNL A;  3LAJ A;  4CGZ A;  2XF5 A;  3KP2 A;  4Y3O A;  1D8J A;  1APL C;  2PBI A;  1KU2 A;  3I0T A;  1UFM A;  2L9R A;  1QPI A;  2DW4 A;  4O5V A;  2X85 A;  3OIP A;  2JWT A;  2FBK A;  4RB3 C;  1JUM A;  3FKI J;  4G7Z F;  2ZO4 A;  3LSH A;  4RMN A;  3PJR A;  1OCC H;  2CW8 A;  3QOE A;  2QQ9 A;  5B1A H;  2FF4 A;  2HQR A;  2HNH A;  2L9S A;  4QWQ A;  2XUB A;  2VI6 A;  5M5Y J;  1JE8 A;  3OYD A;  2XKP A;  4ZYA A;  4BEH A;  2L5Q A;  3BLY A;  2HOA A;  3SEQ A;  3DLL F;  2IA0 A;  4YRV A;  5GP9 A;  3F8C A;  4IOA F;  4BAC A;  1LB2 A;  5IYD J;  1I3Q J;  4LFU A;  3OL4 A;  3OYF A;  1SVM A;  1MZB A;  2K9Q A;  3S3N A;  2DMN A;  2ZNY A;  1BBY A;  3BPX A;  2Y9Z A;  1WJB A;  2YPR A;  4A0Y A;  2OC6 A;  5IT9 Z;  3OYH A;  4E7H A;  3FIS A;  2ELH A;  1HDP A;  3JSP A;  1J5Y A;  1EH8 A;  4HF2 A;  4PUS A;  4BXF A;  1IZ1 A;  4OOI A;  2HDC A;  3TL4 X;  3KZI C;  1SFX A;  2FBH A;  2DMU A;  2V7F A;  1G4D A;  3KLN A;  3H5A A;  3CES A;  1ZAR A;  2KL4 A;  2PEX A;  1DUX C;  2P7C B;  3JAM K;  2FSW A;  1T56 A;  1KA8 A;  5IT3 A;  4XRM A;  2HEO A;  3KCC A;  3V8K A;  1MKM A;  2L9V A;  3ECH A;  2M1B A;  3GLL A;  3K4N A;  2R7D A;  3BJO A;  3WGG A;  5A2Q Z;  1FSH A;  3L09 A;  2HPM A;  5HDG A;  1SFE A;  4BDZ A;  2IBD A;  4M6V A;  4CIC A;  1G6N A;  4HLX A;  3LSR A;  5L3E A;  2DA1 A;  4HRI A;  1MNE A;  5ICG A;  5GAD J;  3K4K A;  2VT2 A;  2EWN A;  1X19 A;  3OY9 A;  1S5L C;  3ZMU A;  2R4G A;  1EKE A;  3CDH A;  5HS9 A;  1K78 B;  4KNY A;  2EV0 A;  2YSR A;  2ACJ A;  5IT9 K;  4JX5 A;  1P4X A;  4XR6 A;  1D5V A;  2QBY B;  2DJN A;  2A5Y B;  3CF2 A;  3LNQ A;  3HPG A;  4WXH A;  5JLX A;  4BS9 A;  4CYC B;  3L1P A;  1TNT A;  5K5Q A;  3Q9V A;  2W1O A;  3CCR I;  1MIJ A;  2R7S A;  5A2Q K;  4C2T A;  2DCE A;  2GZW A;  1P4W A;  5EGO A;  2OCE A;  2IS6 A;  1OMI A;  4RGU A;  3K70 D;  1WWX A;  4LGW A;  2JVH A;  2PMZ N;  3S3M A;  3GEZ A;  4I02 A;  2VON A;  2RN7 A;  4B48 A;  5IOY A;  1SFK A;  4XM3 A;  3KEQ A;  3KYL A;  2DPU A;  2CQN A;  2BV6 A;  2E36 A;  1E3H A;  3W2V A;  4F55 A;  3I4M J;  1FEX A;  2LP0 A;  2TRT A;  2ZJP F;  3GVA A;  2Y30 A;  4IPA A;  2W25 A;  4NQW B;  2F5V A;  2YS9 A;  1XG1 A;  5J40 A;  3PIO F;  4PGG A;  2FQ3 A;  2KDO A;  4RM2 A;  1N75 A;  3JRF A;  3CCU I;  1BOB A;  1ETV A;  3OS0 A;  3S8P A;  1ZG1 A;  3CME I;  5D5W B;  1O3T A;  3DTI A;  2NXN B;  1HW1 A;  1WCM J;  4IHT A;  3H9Q A;  1HST A;  1Y6I A;  2WB1 A;  2P5L C;  5HLI A;  2IXS A;  4MLO A;  3I53 A;  4A3F J;  3R0A A;  4LOC A;  3VB2 A;  2DT7 B;  3F6V A;  2DMP A;  2I10 A;  2HOE A;  1YJ9 I;  2IGM A;  5DD8 A;  5TGT A;  3D5L A;  1L3L A;  2PN6 A;  5E1Z B;  1M1E B;  2DA5 A;  3WU0 A;  5LBQ A;  2Q1Z B;  3F8B A;  1MBK A;  2WAQ A;  5CPR B;  4BU2 A;  4ESB A;  2JA5 J;  2XDV A;  4IQJ A;  1IUF A;  4DQ2 A;  2W84 A;  4Y7N J;  2UUZ A;  3CC4 I;  1W36 D;  3PL8 A;  2FU4 A;  2HKX A;  2F5E A;  3BJ6 A;  2QSF X;  1ZTR A;  3SYT A;  1ETW A;  5F1J A;  3PNV A;  1EF4 A;  1JTY A;  3I3L A;  5F6F A;  4M73 A;  1MDM A;  2ZJ2 A;  3JTH A;  3OYI A;  1SAX A;  5GTI C;  5M5X J;  3RKQ A;  3HUG A;  1WSU A;  2Y31 A;  2NNN A;  2P0W A;  3BTL A;  2ZXW H;  1LVK A;  2IA2 A;  2XGE A;  4NNJ A;  3ZOB A;  5ED4 A;  1EJ9 A;  1AA7 A;  1JKO C;  2XPU A;  5DYM A;  1DGR M;  4BL0 B;  3FHN A;  4AC0 A;  4XOR A;  4B47 A;  2MH2 A;  2CGP A;  2A3S A;  4UUV A;  3DEW A;  1G2H A;  4X1E A;  4G7O F;  1FYK A;  3C18 A;  1R6R A;  3RPQ A;  3BG3 A;  2CUZ A;  3CMY A;  3NEU A;  2ZXH A;  4ZYG A;  4I6Z A;  4KN4 X;  2D1H A;  2GIV A;  2YU9 J;  3PQJ A;  1B4A A;  2AXL A;  4PJ0 C;  5BPI A;  1I1S A;  4HA8 A;  2ELK A;  1YE9 A;  4RAF A;  1UG2 A;  4EM0 B;  3L9F A;  1SMY F;  3K1N A;  5FB2 A;  2A69 F;  2LLK A;  3ABT A;  2J5P A;  2KJB A;  1J75 A;  5GAE J;  1HA8 A;  1D3Y A;  2MLG A;  2O03 A;  4R1H A;  3RYR A;  5K5R A;  4KMF A;  3HBL A;  3VOD A;  1D0Z A;  3K4B A;  5FKL A;  2XIG A;  4ENK A;  3G6E I;  2Y48 A;  4HDU A;  3BP8 A;  3L2V A;  4RGR A;  3WGI A;  1MNM C;  1P2F A;  2IEK A;  3B6A A;  4FT8 A;  4M3E A;  4L0Z B;  2E7W A;  2HOT A;  1FOW A;  3FXQ A;  4NBQ A;  4HX7 A;  2O3F A;  4N9H A;  2NAZ A;  4BHP A;  3IRQ A;  4M3F A;  4BEH B;  3AL0 B;  1T38 A;  4XOT A;  3GBG A;  1SVO A;  2WY8 Q;  5ICE A;  3RI4 A;  4AYB A;  2P7V B;  4OU0 A;  3LA3 A;  5LHI A;  1FP1 D;  5H2F C;  3RKY A;  4UY8 I;  2LH9 A;  1I6H J;  3GZN B;  1MJB A;  3E3V A;  4IRI A;  2MAB A;  1ZLJ A;  2XF6 A;  2Q0O A;  3NAU A;  4O6J A;  1RUO A;  3KEO A;  2STT A;  2OBP A;  2DT6 A;  3VFZ A;  1BI2 A;  1JKR C;  1AWC A;  4UVA A;  1YG2 A;  3KFW X;  3BTJ A;  4I76 A;  2MSY A;  3HRU A;  1EH7 A;  3JRE A;  2DFF A;  4U7D A;  1BOA A;  4EJT A;  3ZGK A;  3BPV A;  1T6S A;  3RKW A;  4CCO A;  2DTZ A;  1JKQ C;  1XGN A;  2HZT A;  2UXX A;  3ZMT A;  3KLO A;  5HLG A;  2BYV E;  3GTK J;  3CP2 A;  1D1C A;  4WX9 A;  5E3L A;  4RM3 A;  1JXS A;  3BWG A;  4UXN A;  3CCS I;  4FX4 A;  3KP4 A;  4L9N A;  5FO5 A;  2XKO A;  2N8G A;  3QPS A;  4ZYE A;  4F52 A;  4XKC A;  1IRZ A;  4JK1 X;  4XIC A;  2TDX A;  2UZK A;  3S14 J;  4ZDP A;  3FXJ A;  1PDN C;  5EGO B;  2JZY A;  3NQO A;  1FY7 A;  1EH6 A;  1MBH A;  1SD7 A;  4DJA A;  5IY5 H;  4C2M J;  2DA2 A;  1LVA A;  3OYB A;  4M3G A;  2KDZ A;  3WTV C;  3M1C A;  3K69 A;  4KIB A;  3K0L A;  4ZC3 A;  2VXD A;  1UHS A;  2E1O A;  1G3T A;  2HPI A;  3BR3 A;  4XSX F;  3JSO A;  2HI3 A;  1TTY A;  5FLX K;  3F8F A;  2GIZ A;  4KDP A;  3T5X A;  4IO9 F;  4M3B A;  1ETK A;  4Y13 A;  4HSR A;  2ISZ A;  3V7C A;  4D1Q A;  1IAW A;  4L5E A;  3VDX A;  2F5C A;  5CVR A;  4A5N A;  2QYO A;  3HC7 A;  2OJE D;  2OQR A;  4A69 C;  3TMO A;  4D0P A;  3M07 A;  1FMW A;  1P4A A;  2M0C A;  1U9N A;  3CCQ I;  1TWC J;  5HS8 A;  2M87 A;  1ACI A;  4N9I A;  3RPU D;  5DM6 F;  3BR5 A;  3NWS A;  1P7J A;  2H1K A;  1OFC X;  1XSX A;  1G8X A;  3EYY A;  2CQK A;  4DYR A;  2WV0 A;  3ZRG A;  2R3S A;  2H27 A;  3HTS B;  2ZNZ A;  4G6Q A;  3HOU J;  1TL8 A;  2E1M B;  1LDK B;  3HOZ J;  2OTJ I;  1NG6 A;  2GAU A;  5F27 A;  1OKR A;  5EYR A;  1FNN A;  4IHY A;  5EZH A;  2JSC A;  2PMH A;  2KMU A;  3S2D J;  1VF9 A;  2VQL A;  3TDU C;  1K6O A;  3BZ6 A;  3DQV C;  2CYY A;  3ZN1 A;  4HQM A;  2QA4 I;  4XKV A;  1PJR A;  1Z9C A;  1R1V A; 
#chains in the Genus database with same CATH homology
 1TLH B;  2MLK A;  1HKQ A;  3ELK A;  4MEX F;  4B09 A;  1MDM B;  5LHH A;  4KMU X;  3TOB A;  2Z33 A;  2STW A;  1O7L A;  3GO5 A;  2H09 A;  4HYE A;  1J0R A;  1S6L A;  3IHU A;  5FD5 A;  1TBX A;  3GUD A;  4Q4Z F;  3IRR A;  3F23 A;  3FMR A;  2CSO A;  1JHH A;  4ETS A;  1W7P A;  3AAF A;  4KIF A;  3P7N A;  4M74 A;  2A07 F;  3I58 A;  3P9C A;  4AD9 A;  2R7F A;  5J6X A;  1LQ1 A;  1H0M A;  2QWW A;  1LDD A;  1ZG5 A;  4WK8 F;  3T8T A;  2KIU A;  2EV6 A;  2MH9 A;  2Z3Y A;  1B1B A;  4TV7 A;  4CXF A;  2OD5 A;  1QQI A;  5FFZ A;  3DFG A;  4EJW A;  5H6Q A;  2VBW A;  2FA5 A;  3HHG A;  2K27 A;  2Z5U A;  1ZRC A;  1XB4 A;  1QBJ A;  4F7Z A;  1BI3 A;  4YII A;  3DP7 A;  1J59 A;  1MD0 A;  1XDS A;  4PZJ A;  3U2R A;  4M71 A;  1KQ0 A;  5TRD A;  1MGT A;  2XHK A;  2K4B A;  1QPM A;  4RAY A;  1TW3 A;  5J8F A;  1OR7 A;  4RGS A;  1XCB A;  3HTU A;  1WRJ A;  4M9X A;  2PMU A;  2GA1 A;  2RNJ A;  2KIF A;  1F4K A;  1S3J A;  4OIQ F;  1ODD A;  2ZFW A;  3FF5 A;  1FLI A;  2MBF A;  2EJR A;  1J2X A;  3ECO A;  5CVI A;  2LNB A;  4CHU A;  3C1D A;  4M72 A;  1ULY A;  2XV4 S;  3E5X A;  4HZF A;  3M8E A;  4KYW A;  5JHU A;  2XRO A;  1ZRE A;  3MCZ A;  1X3U A;  1FBQ A;  2W85 A;  3CO6 C;  2LKP A;  1KQ9 A;  4BH9 A;  2J5O A;  2VC1 A;  3T0Y A;  2XGX A;  4NB5 A;  2FML A;  2RGV A;  3IKT A;  5ERI A;  3QRF F;  4AIJ A;  3HSE A;  1BC7 C;  3V7S A;  1U3E M;  3K1M A;  1T2K A;  1YTY A;  5L3D A;  1QZZ A;  4BQA A;  4IVN A;  4MQ9 F;  5E18 F;  4UVB A;  1G3S A;  3R4K A;  2KJC A;  1LNW A;  5DD4 A;  4P9U A;  5BOX A;  1V4R A;  5JVT A;  5HS7 A;  2M45 A;  1JHF A;  2A68 F;  3DPT A;  3E5Q A;  2V1U A;  1Q1H A;  1L0O C;  1KGS A;  3GFL A;  4Z2Y A;  3CLO A;  2FBI A;  4LG0 A;  1HQC A;  2ZCW A;  3R61 A;  1R5H A;  5LGU A;  2V1D A;  3GLX A;  5ICC A;  1U5T C;  2WC2 A;  3R60 A;  2RVC A;  2HKO A;  1W7P B;  1I6X A;  2HWV A;  1OYI A;  3DKW A;  4ON0 A;  5D8K B;  2HYF A;  1K7A A;  2FOK A;  3HOT A;  2D2W A;  2PI0 A;  4Y15 A;  1IUY A;  4BAY A;  1Z6R A;  4IRG A;  2DBB A;  5ILU A;  1EV7 A;  3RYP A;  5LRR A;  2ISY A;  1BN5 A;  4ESF A;  3E6B A;  3J81 Z;  1YW8 A;  3RKX A;  4FX0 A;  3LFK A;  3KP6 A;  4WXC A;  4KIC A;  4MTD A;  3GZ6 A;  1ZN2 A;  3H3U A;  4GGG A;  1HW5 A;  1GHC A;  5F1R A;  4WF2 A;  3CTA A;  4OMZ A;  3HOS A;  3EQL F;  4FHT A;  4HOB A;  4AWX B;  1UST A;  4P5O A;  2NYX A;  3J81 K;  2IW5 A;  3QU3 A;  2VOP A;  1U8R A;  3OV8 A;  3HHH A;  4G9Y A;  4I98 B;  3ULQ B;  2DFI A;  3LST A;  4B8X A;  2FRH A;  3WE3 A;  4CZZ A;  2O8X A;  3O6B B;  3E6M A;  2Y75 A;  1NHA A;  2XAS A;  3LAP A;  1PUE E;  5HDK A;  4LD5 A;  2XAF A;  1W5S A;  1W5T A;  1OYW A;  4KT5 C;  3HSR A;  2A6H F;  1LDJ A;  2DPD A;  3WU1 B;  5CVU A;  2MC3 A;  4M9S A;  4UV8 A;  1Y0U A;  1O3R A;  3FZV A;  1SMT A;  1BJA A;  3PQK A;  1PP7 U;  3QU6 A;  1S29 A;  1LEB A;  4MQV A;  4RS8 A;  5AIP A;  1LJ9 A;  2VBY A;  3M8F A;  2X0L A;  5HDN A;  2YR2 A;  3T8R A;  4BYY A;  4IXA A;  2IJL A;  3HYI A;  1WKM A;  2YX4 A;  1FWZ A;  4U0V A;  1ON1 A;  2EK5 A;  3FXU A;  1QGP A;  2VXZ A;  1H9T A;  2MA3 A;  2LSO A;  4G7H F;  3BJA A;  5FGM A;  1YS7 A;  3C7J A;  2G9W A;  2OZ6 A;  1ZHF A;  5DV5 A;  4EGZ A;  2PLY A;  4R79 A;  1IXC A;  2RV8 A;  4LG0 B;  3TKY A;  5CLS A;  2CW0 F;  5E20 A;  1QZY A;  2BGC A;  2DTR A;  4S05 A;  4L5J A;  4M6Y A;  3TO9 A;  5HOO A;  3WTU C;  2IP2 A;  2BBY A;  1DP7 P;  1U6G A;  2GQQ A;  1ZGA A;  2L54 A;  2HR3 A;  2CO5 A;  3WTY C;  1B59 A;  1XGO A;  3KP3 A;  1TNS A;  3ROU A;  3J80 Z;  1IN6 A;  2COM A;  1U5T A;  2PQ8 A;  2QVO A;  3J7A O;  5DDG A;  1CF7 A;  4MHG A;  1G3Y A;  1SD4 A;  3MWM A;  2CWE A;  4MEY F;  3I54 A;  1YW9 A;  5DEQ A;  5H6R A;  1Z6T A;  4RB1 A;  1KU3 A;  1HKT A;  1XMK A;  3F21 A;  2Q2E A;  4ASN A;  2NRA C;  1RZ4 A;  5HVQ C;  2EFO A;  1I1G A;  1FZP B;  3NRV A;  3WTX C;  1XN7 A;  3J80 K;  3QAH A;  1B9M A;  1RUN A;  5TJJ A;  1UHM A;  3KP7 A;  3V7R A;  1XSD A;  3FM5 A;  2RKH A;  3I59 A;  3H3Z A;  3ZMZ A;  2G7H A;  2ZME A;  1FPQ A;  2IRF G;  3O3K A;  5HLH A;  3F3X A;  4YFX F;  4EJV A;  1FX7 A;  4I09 A;  1TQM A;  3ML6 A;  3KZZ A;  4EM1 A;  3REO A;  5ILV A;  2HS5 A;  2ZXJ A;  4MGR A;  3JTG A;  4OIR F;  4HQE A;  4L9T A;  5DCM A;  2L01 A;  2LDU A;  3PFI A;  3GW2 A;  3N97 A;  4EVI A;  1IRF A;  1XGS A;  2QEN A;  5LHG A;  2L02 A;  1D8K A;  1V3F A;  2HFH A;  1LEA A;  1FYL A;  2HTJ A;  3N4M A;  4QLC U;  1P92 A;  5E8I A;  4LLN A;  4HF0 A;  3ABU A;  3V8L A;  2F5F A;  3DXJ F;  5FFX A;  3G3Z A;  3I71 A;  3R6S A;  3M1E A;  4A12 A;  1J9I A;  2OA4 A;  3MZH A;  3V4G A;  3ZN0 A;  1XSV A;  2EFN A;  1WQ2 A;  5FD6 A;  3KP5 A;  1XCV A;  2DAO A;  4P9F A;  2KKO A;  2K86 A;  1U2W A;  2FE3 A;  3RIR A;  5ICF A;  2HTS A;  2A61 A;  3EET A;  2C6Y A;  2NS0 A;  2JTV A;  2ESH A;  3R0J A;  2E1N A;  3C3W A;  4EMS A;  2K4J A;  2DU9 A;  4LK1 F;  4HV5 A;  4KN7 X;  1ZYR F;  1T0F A;  1REP C;  2CFX A;  4U0W A;  3SQN A;  3IC7 A;  2DK8 A;  3HRM A;  1OYY A;  2ESN A;  2D45 A;  3COA C;  4L0Y B;  2RC4 A;  1E17 A;  3HIF A;  1YS6 A;  3M7G A;  4O3M A;  3GXO A;  2EA4 A;  3IWF A;  5F64 A;  1I27 A;  4ZH4 F;  3S2W A;  2RDP A;  2O6G E;  4ENN A;  1G3W A;  4HBL A;  5BMZ A;  1P6R A;  4EJO A;  4XBF A;  1YO5 C;  3LA2 A;  2ETH A;  1ONV A;  4WWC A;  1W7P D;  4LJZ F;  3E97 A;  3CUQ C;  1CGP A;  4BNC A;  3E6C C;  1BC8 C;  3BDD A;  2YX7 A;  1S7A A;  1U5T B;  1UCR A;  2EFW A;  1Z7U A;  1CF7 B;  4RGX A;  2OU2 A;  5EEG A;  3CUO A;  2K02 A;  3B02 A;  1ZRF A;  5DUK A;  1BIA A;  3MZY A;  5BPD A;  1YYV A;  4JBA A;  5D4S A;  1I5Z A;  3GZ5 A;  3I59 B;  1SD5 A;  2ZKZ A;  4L9V A;  1MJA A;  2ZME B;  3LQQ A;  5CVV A;  5D5X B;  5E8G A;  4NHJ A;  2RQP A;  1T98 A;  2XAH A;  4ENJ A;  1F9N A;  3F8N A;  4HX8 A;  2VBX A;  1FBU A;  4PCQ A;  2GA2 A;  1R5G A;  1HKS A;  1ZGJ A;  3OOP A;  4L18 B;  5E1X A;  1S7O A;  3EYI A;  1U78 A;  3K1P A;  3ERE D;  2VN2 A;  1JGS A;  3SXY A;  1OPC A;  4BHC A;  1KQ8 A;  1E2X A;  3IWZ A;  4OMY A;  3JAM Z;  2K7L A;  4YG2 F;  4LLG F;  3GX4 X;  3WTS C;  4M9Z A;  3SHF A;  3DV8 A;  2ADU A;  2JT1 A;  2EFQ A;  2VC0 A;  3VOE A;  2E1C A;  1PP8 F;  4U0Y A;  4E70 A;  1FP2 A;  4U7B A;  4HLY A;  3F22 A;  2W57 A;  2F2E A;  2BE5 F;  3I4P A;  5ILS A;  5KK1 A;  1S8N A;  1SD6 A;  4U88 A;  3JW4 A;  5D4R A;  3RDI A;  4WXD A;  3F6O A;  4L9J A;  2V1X A;  4K2E A;  4P96 A;  1DPU A;  4EM2 A;  2HGC A;  3EDP A;  2VE9 A;  5AON A;  4DNC A;  4KA4 A;  1IN7 A;  4GYG A;  1GXP A;  1RI7 A;  4JQF A;  2VBZ A;  5L3F A;  3HSF A;  5J8C A;  2QQA A;  2V6C A;  1QO0 D;  2OAZ A;  2H6C A;  3FX3 A;  2M30 A;  4A6E A;  1IW7 F;  1T39 A;  2FMY A;  3IL2 A;  1YW7 A;  3K9T A;  4LB6 B;  4I2O A;  1YLF A;  1R1U A;  1XGM A;  2EV5 A;  3SZT A;  4HF1 A;  2OZU A;  4EGY A;  2FNA A;  4GCV A;  3BOQ A;  1R1T A;  2Z99 A;  3W6J B;  4LLL A;  1STZ A;  2CG4 A;  3MEX A;  1VTN C;  5D6F A;  2A6E F;  1KYZ A;  1O3Q A;  2B0L A;  1ZH5 A;  4YIF A;  2UXN A;  3Q5F A;  4XLP F;  1F5T A;  2G7U A;  4YFN F;  3ISP A;  3CUQ A;  4UNO A;  1R36 A;  2IA1 A;  2P4W A;  4HW0 A;  4N0B A;  2P5V A;  3WTZ A;  5BS6 A;  5L3C A;  4G6D A;  2DLL A;  4GYI A;  3U9G A;  4I0B A;  3ZMV A;  2WWY A;  1F1Z A;  3GFM A;  1DDN A;  1A04 A;  3U1D A;  4PDK A;  3QP6 A;  2QM3 A;  5JI6 A;  5L3B A;  5D8L B;  4A0X A;  3P9K A;  3D0S A;  2Q8K A;  3TQN A;  1IXS B;  1IN4 A;  3TGN A;  3FXR A;  2XAQ A;  3Q9S A;  3WE2 A;  3TOA A;  2PJP A;  4HDV A;  4I0A A;  2KRF A;  2O0Y A;  5AIQ A;  6PAX A;  2E7X A;  2FXA A;  1O7F A;  1Z1D A;  2LF7 A;  1BI1 A;  2PG4 A;  3HRT A;  2PFB A;  4XSZ F;  5D5U B;  3I64 A;  1FT9 A;  4OIO F;  3V8J A;  2VOO A;  1R7J A;  3M9A A;  4MNU A;  1R00 A;  4ENM A;  4UV9 A;  3RJP A;  2XVC A;  4XRF A;  3EUH A;  3KE2 A;  2EB7 A;  5LGT A;  2WTE A;  4CDG A;  2JRT A;  3CJN A;  3QOP A;  4PGH A;  2AS5 F;  1BM9 A;  2QZ8 A;  2HYG D;  1TW2 A;  4IJA A;  3SZP A;  3P9I A;  3H92 A;  2DO7 A;  4I7H A;  1ZRD A;  3RPU A;  4I01 A;  4CYD A;  3KET A;  4LK0 F;  2IVM A;  3F8M A;  4H0E A;  3F72 A;  3KZY A;  3HRS A;  4EJU A;  1SFU A;  4ZYH A;  1XD7 A;  1IRG A;  3ZMD A;  3GFJ A;  2D1V A;  5CYV A;  4MTE A;  4A6D A;  5H20 A;  2P8T A;  5FLX Z;  1YIO A;  2L4M A;  5D5V B;  4ZZL A;  2L4A A;  1R23 A;  1WI9 A;  2H94 A;  3L7W A;  2XAJ A;  4RB2 C;  4Q47 A;  3G73 A;  1O3S A;  1YQA A;  1H9G A;  5E1W A;  4WCG A;  1UHW A;  5D6E A;  4Q5S F;  4ZYD A;  3LQR A;  3FMQ A;  4KFC A;  3ZPL A;  3W6K B;  3FHZ A;  1ON2 A;  1KU7 A;  2V9V A;  2GXB A;  1B6A A;  4GO1 A;  2UWM A;  1Z05 A;  4IRH A;  5LEK A;  2FNP A;  2M8E A;  2W24 A;  3DEU A;  4BXU A;  2XAG A;  2DI3 A;  3DF8 A;  1IN5 A;  1HXD A;  4AVP A;  5LEJ A;  2F5D A;  1HSJ A;  5LRS A;  5E17 F;  3L00 A;  2IT0 A;  4S04 A;  3WTT C;  2YU3 A;  4AIH A;  4KIG A;  1ZLK A;  3ZQ7 A;  3MFK A;  1FC3 A;  3CUQ B;  4HAM A;  4EV0 A;  2P5K A;  2X4H A;  3TDZ C;  2VT3 A;  5LGN A;  1QNT A;  2DQL A;  2MD5 A;  3FMS A;  4LMY A;  1RIO H;  2DT5 A;  3MAJ A;  4ESJ A;  3QPT A;  1HW2 A;  2JPC A;  4OIN F;  4HX4 A;  1AOY A;  5EEH A;  3FWE A;  4GXO A;  3LA7 A;  1R22 A;  3SFZ A;  2O61 A;  1ZAO A;  2QQB A;  4IF4 A;  5BQT A;  2XRN A;  5K5O A;  2BEO A;  3WOD F;  4CO8 A;  3TO6 A;  1MJ9 A;  2GXG A;  1TQI A;  4ZZD A;  2EFP A;  4YFK F;  1Z91 A;  2L3D A;  1K78 A;  3WG9 A;  1K79 A;  1UB9 A;  1BIB A;  4A5M A;  2QBY A;  3VEP A;  2NNY A;  4R8H A;  5KVR A;  1BI0 A;  3GWZ A;  4IHS A;  4RB0 A;  2DK5 A;  1XMA A;  2H6B A;  4KUM A;  4BHB A;  3IKV A;  1W4M A;  4Q48 A;  2P6T A;  2V79 A;  1IXR C;  1FSE A;  4HV6 A;  4L5I A;  1ZG3 A;  3QP5 A;  3ZMS A;  1FBS A;  4NQW A;  1KU9 A;  3L2C A;  2Z9O A;  2M5W A;  3DPL C;  5JFR A;  3GYH X;  5CJ9 A;  1DPR A;  2OQG A;  3E5U A;  3TO7 A;  3FM3 A;  4UVC A;  5K1Y A;  2VOD A;  4EQQ A;  5L3G A;  1IN8 A;  3GF2 A;  4M6X A;  5CVJ A;  2VE8 A;  3RTR A;  1FOK A;  4G94 A;  3ZP5 A;  1TQP A;  4LB5 A;  1KYW A;  2LF8 A;  1GXQ A;  2JPB A;  4AIK A;  3I5U A;  1USS A;  4P55 A;  3T1B A;  5JR3 A;  1GVJ A;  3GFI A;  2IPQ X;  3B73 A;  1IF1 A;  1B9N A;  2GWR A;  4OIP F;  2Y0M A;  4A0Z A;  2P6S A;  4A2U A;  2FEZ A;  2HQN A;  1FYM A;  5LLQ A;  2ZBK A;  1C0W A;  5DUI A;  4RAZ A;  3CO7 C;  3MQ0 A;  3E6D A;  4XLN F;  3LWF A;  2KIM A;  2DQR A;  1J7K A;  2QLZ A;  3WTW C;  4G8X A;  2QUF A;  5DCM B;  3BRO A;  3QPH A;  3BY6 A;  5DCF A;  3WGH A;  1YFH A;  1O57 A;  3K2Z A;  4UHT A;  3O2P E;  2EA2 A;  1HBX G;  1XDU A;  4Y17 A;  1R58 A;  1RNL A;  3LAJ A;  4CGZ A;  3KP2 A;  1D8J A;  2PBI A;  1KU2 A;  3I0T A;  1UFM A;  2DW4 A;  4O5V A;  4RB3 C;  2FBK A;  4G7Z F;  2ZO4 A;  2QQ9 A;  2FF4 A;  2HQR A;  4QWQ A;  2XUB A;  1JE8 A;  2XKP A;  2IA0 A;  3F8C A;  1LB2 A;  4LFU A;  1MZB A;  2ZNY A;  1BBY A;  3BPX A;  2YPR A;  4A0Y A;  5IT9 Z;  2ELH A;  3JSP A;  1J5Y A;  1EH8 A;  4HF2 A;  1IZ1 A;  4OOI A;  2HDC A;  1G4D A;  1SFX A;  2FBH A;  3KLN A;  1ZAR A;  2PEX A;  1DUX C;  2P7C B;  3JAM K;  2FSW A;  2HEO A;  1KA8 A;  5IT3 A;  3KCC A;  3V8K A;  1MKM A;  3WGG A;  3ECH A;  2M1B A;  1FSH A;  2R7D A;  3BJO A;  5A2Q Z;  3L09 A;  5HDG A;  1SFE A;  4CIC A;  1G6N A;  4HLX A;  5L3E A;  5ICG A;  2VT2 A;  2EWN A;  3ZMU A;  3CDH A;  5HS9 A;  4KNY A;  5IT9 K;  1K78 B;  2EV0 A;  2YSR A;  2ACJ A;  1P4X A;  1D5V A;  2QBY B;  2A5Y B;  4WXH A;  1TNT A;  5K5Q A;  3Q9V A;  5A2Q K;  2GZW A;  1P4W A;  1OMI A;  4RGU A;  1WWX A;  4LGW A;  3GEZ A;  4I02 A;  2VON A;  2RN7 A;  3KEQ A;  2DPU A;  2BV6 A;  3GVA A;  4IPA A;  2W25 A;  4PGG A;  2FQ3 A;  1ZG1 A;  5D5W B;  1O3T A;  1HW1 A;  4IHT A;  1HST A;  2P5L C;  5HLI A;  3I53 A;  3R0A A;  3VB2 A;  3F6V A;  2HOE A;  5DD8 A;  3D5L A;  1L3L A;  2PN6 A;  5E1Z B;  3WU0 A;  5LBQ A;  3F8B A;  4ESB A;  4DQ2 A;  2W84 A;  2FU4 A;  2HKX A;  2F5E A;  3BJ6 A;  5F6F A;  4M73 A;  1MDM A;  2ZJ2 A;  3JTH A;  1SAX A;  1WSU A;  3HUG A;  2NNN A;  2IA2 A;  5ED4 A;  5DYM A;  2MH2 A;  2CGP A;  2A3S A;  4UUV A;  4G7O F;  1FYK A;  3C18 A;  3RPQ A;  3NEU A;  4ZYG A;  4KN4 X;  2D1H A;  2GIV A;  3PQJ A;  1B4A A;  2AXL A;  1I1S A;  5BPI A;  4HA8 A;  4EM0 B;  3L9F A;  1SMY F;  3K1N A;  5FB2 A;  2A69 F;  3ABT A;  2J5P A;  2KJB A;  1J75 A;  1D3Y A;  2MLG A;  2O03 A;  4R1H A;  3RYR A;  5K5R A;  4KMF A;  3VOD A;  2XIG A;  4ENK A;  2Y48 A;  4HDU A;  3BP8 A;  4RGR A;  3WGI A;  1P2F A;  4FT8 A;  4L0Z B;  2E7W A;  3FXQ A;  4HX7 A;  2O3F A;  4N9H A;  2NAZ A;  4BHP A;  3IRQ A;  1T38 A;  5ICE A;  3RI4 A;  2P7V B;  4OU0 A;  3LA3 A;  5LHI A;  1FP1 D;  3RKY A;  1MJB A;  3E3V A;  4IRI A;  1ZLJ A;  2Q0O A;  4O6J A;  1RUO A;  3KEO A;  2STT A;  2OBP A;  3VFZ A;  1BI2 A;  1AWC A;  4UVA A;  1YG2 A;  3KFW X;  3HRU A;  1EH7 A;  4U7D A;  1BOA A;  4EJT A;  3BPV A;  1T6S A;  3RKW A;  1XGN A;  2HZT A;  2UXX A;  3ZMT A;  3KLO A;  5HLG A;  2BYV E;  4WX9 A;  1JXS A;  3BWG A;  4UXN A;  4FX4 A;  3KP4 A;  4L9N A;  5FO5 A;  2XKO A;  4ZYE A;  4JK1 X;  2TDX A;  2UZK A;  1PDN C;  2JZY A;  3NQO A;  1FY7 A;  1EH6 A;  1SD7 A;  1LVA A;  3WTV C;  4KIB A;  3K69 A;  3K0L A;  1G3T A;  4XSX F;  3JSO A;  1TTY A;  5FLX K;  3F8F A;  4KDP A;  3T5X A;  4Y13 A;  2ISZ A;  3V7C A;  1IAW A;  2F5C A;  5CVR A;  4A5N A;  2QYO A;  2OQR A;  4D0P A;  1P4A A;  5HS8 A;  2M87 A;  4N9I A;  1XSX A;  3EYY A;  2CQK A;  2H27 A;  2WV0 A;  3HTS B;  2R3S A;  2ZNZ A;  4G6Q A;  1LDK B;  2GAU A;  1OKR A;  1FNN A;  2JSC A;  2PMH A;  3TDU C;  1K6O A;  3BZ6 A;  3DQV C;  2CYY A;  3ZN1 A;  4HQM A;  1Z9C A;  1R1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...