2LSOA

Solution nmr structure of the globular domain of human histone h1x, northeast structural genomics consortium (nesg) target hr7057a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
SHMQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of the Globular Domain of Human Histone H1x, Northeast Structural Genomics Consortium (NESG) Target HR7057A
rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords Histone H1x
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lsoA00
3COAC 2Z5UA 5BQTA 4NHJA 3ZP5A 2NAZA 2ZCWA 3ULQB 1G6NA 3KZZA 4ENMA 4HV6A 2LF7A 1B4AA 4DNCA 2L54A 3MZYA 1EH8A 1HSTA 3LFKA 4H0EA 1YG2A 1TQMA 2Q0OA 2FMLA 3QAHA 3SZPA 5KVRA 4G6DA 4MNUA 2RC4A 1UB9A 4AWXB 5E8IA 4Q5SF 2HKOA 4IRGA 3L7WA 4ESJA 2A6HF 1XCVA 1MDMA 1XDSA 4RB1A 3ECOA 3GX4X 3K2ZA 3I71A 1SFXA 1FYMA 1J2XA 3GFJA 4FT8A 2PI0A 1IXSB 3J7AO 1U5TC 4EGZA 2CWEA 5E1ZB 3HUGA 1J75A 3FF5A 4A0XA 3H92A 2DQRA 2VONA 3WG9A 1V3FA 1P4AA 2YSRA 1IN5A 1YO5C 3WGIA 1JXSA 2IT0A 1HW2A 3C3WA 1XGSA 1TW3A 4E70A 4ENNA 4BXUA 3JSPA 5HVQC 3RJPA 4BAYA 1FSEA 3D5LA 3R60A 1U78A 2G7HA 4A5MA 2DAOA 3IL2A 1DUXC 5D5VB 2EV0A 1U2WA 2ACJA 1HSJA 2XAJA 3ZMSA 2DU9A 4IHSA 2DTRA 3RKXA 2GXBA 5FGMA 5ICCA 3JAMK 2OD5A 2MH9A 4M73A 4OOIA 2FBIA 1TLHB 2FSWA 3REOA 1T38A 5ED4A 3CUOA 1S7AA 1JHFA 2FA5A 1QPMA 2L02A 4G94A 1QO0D 1QGPA 5JFRA 4HYEA 2XIGA 2R3SA 3B73A 1XGNA 4XLNF 3H3UA 1V4RA 2FMYA 2CW0F 1ONVA 3KZYA 4YIFA 1IN7A 1BOAA 3WE3A 2TDXA 4GXOA 1IRFA 2E1NA 4M6YA 3O2PE 1IN4A 1D8JA 2PJPA 4G7OF 2X0LA 4KNYA 3CJNA 4B8XA 1KU7A 3HHHA 3EETA 1MGTA 4UV8A 2GAUA 2PQ8A 5DCMA 2ADUA 1YS6A 4Q47A 1G4DA 2COMA 3FM5A 1Y0UA 2BV6A 1NHAA 1MJ9A 1O7FA 1K78A 3LQQA 4A0YA 4OIRF 1XDUA 3L09A 3HHGA 1ZG3A 4QWQA 4N9HA 2IW5A 2D1HA 4KA4A 3TO7A 2FE3A 4HZFA 2GIVA 3QP6A 4R79A 3CO7C 2OU2A 2VE8A 5HS9A 1E2XA 1OKRA 2DLLA 2EA4A 3Q9SA 2CYYA 4U7BA 2EFNA 1SFEA 1S8NA 4A12A 1ULYA 3ZMZA 4HX7A 4NQWA 4CZZA 2AXLA 4KIBA 3EQLF 4RS8A 1Z91A 2FXAA 5H6QA 3L00A 4OIOF 4G8XA 1BI2A 3I58A 1UHMA 4WXDA 3VB2A 5K1YA 2DFIA 2OQRA 1ZN2A 4GYIA 3ROUA 4RAYA 1LVAA 1MDMB 5HLGA 4Y17A 1XB4A 2K27A 2YX4A 4BHBA 2XVCA 2E7WA 1R22A 2VT3A 2HEOA 4LK0F 1KYZA 2XAQA 5HLHA 2GZWA 1IN8A 4EV0A 3FXQA 3ZMTA 2DBBA 1ZREA 1GXPA 2IA0A 2VT2A 1BI3A 4U7DA 2XAFA 2RQPA 4CXFA 2J5OA 3ZN0A 5K5QA 2QLZA 4GGGA 5AIQA 1CF7A 1WRJA 1YLFA 3F6VA 2HS5A 1L0OC 1ZG5A 5FO5A 2MH2A 3VEPA 1TBXA 1HW5A 3GWZA 4EJTA 1LDJA 3S2WA 3ABTA 2KJBA 3M9AA 3T8TA 4HF1A 2GA1A 4Y15A 3BZ6A 4RGSA 1KA8A 1MJAA 3SZTA 3F8MA 4N9IA 5HDGA 1A04A 5BPDA 2P4WA 1K6OA 1F1ZA 3BWGA 4KIGA 2V1UA 3EYIA 2DK5A 4HA8A 2FF4A 3T5XA 1EV7A 2KIFA 4EJUA 3QRFF 2DPUA 5FFXA 2MA3A 4PZJA 4RGRA 4LG0A 1U8RA 3RTRA 1TQPA 2WV0A 4WWCA 2IRFG 4IVNA 2K7LA 1HKQA 1R5HA 3BP8A 2EWNA 3T0YA 2ETHA 1DDNA 2RNJA 4L9JA 1J59A 3P9CA 3KETA 1YQAA 2W85A 1FBUA 2BYVE 3WTYC 5FD6A 3M1EA 2XAHA 1XD7A 3RDIA 1IN6A 1VTNC 5CVRA 3TDUC 2OZ6A 2P6TA 1F5TA 2JPCA 3E97A 3FMRA 1W5SA 5L3DA 4KMFA 1XCBA 1JE8A 4PCQA 3GEZA 2E1CA 3DPLC 5L3CA 2XGXA 1R7JA 3RKYA 3TGNA 1OPCA 1QQIA 4L5IA 1JGSA 2ZNYA 4XLPF 5ILSA 4HX4A 3DEUA 4IJAA 1C0WA 4I02A 1ZAOA 2B0LA 4ETSA 2M1BA 1H9TA 2VE9A 2NNNA 1B9MA 2ZMEB 5LGUA 1IZ1A 5LLQA 2O0YA 3BDDA 3RIRA 1FSHA 3V7CA 3GZ5A 5DCFA 4I2OA 1J7KA 1O3QA 2FU4A 2NS0A 3BPXA 3Q5FA 1K7AA 3GLXA 5CYVA 3I64A 4UV9A 4HQEA 1U5TB 3TOAA 4CGZA 3FM3A 2PN6A 1BM9A 4IRIA 6PAXA 1SMYF 3P9KA 2PMUA 3QPTA 2EFWA 3WTWC 5JVTA 3PFIA 1F4KA 3SQNA 3V7RA 1OYIA 3B02A 4EM0B 4L5JA 2MLGA 3F72A 5BMZA 3I59A 2ZJ2A 1USTA 4IHTA 3GFIA 1QZYA 3M7GA 1P4XA 2BEOA 5J8FA 1BC7C 1ZGJA 1T39A 2XAGA 4B09A 4M6XA 2XKPA 4P96A 3GF2A 1RUOA 2O8XA 1IUYA 2XROA 5DUKA 1ZLKA 1XN7A 2FBKA 3J81K 4RGUA 5F6FA 1GHCA 1FBSA 2MD5A 3NQOA 5E17F 3K1NA 1XSVA 4LK1F 1IXRC 3KLNA 1QBJA 2GA2A 2XASA 2R7FA 2A6EF 2Z33A 3KFWX 1FPQA 3V7SA 1G3YA 3HRMA 3MFKA 3LAPA 1USSA 4XSZF 4MGRA 3KLOA 4YIIA 4EM2A 3WTSC 2AS5F 2H94A 2M87A 2A5YB 2HFHA 1EH7A 3P9IA 4AIKA 4BHPA 3KEQA 2L4AA 2ESHA 1GXQA 1ZRFA 2D2WA 4P9FA 2QQBA 1MKMA 4L9NA 2BE5F 5BPIA 1ZH5A 1WQ2A 1KU3A 3GVAA 1G3TA 5E18F 4BH9A 2FOKA 4BQAA 2L3DA 3BJ6A 3O3KA 2QUFA 4Q48A 2F5DA 3W6KB 5CVIA 4HF0A 4S05A 4LB6B 3ERED 4AVPA 4AIJA 1BN5A 1IXCA 2RVCA 3Q9VA 3BROA 4BYYA 3F23A 4KT5C 3HRTA 3QU6A 2JZYA 3QU3A 4IF4A 3I59B 3E6CC 1FT9A 3NEUA 5DUIA 1KGSA 3KP4A 2G7UA 4CHUA 2LSOA 4XBFA 1J9IA 2A61A 3KEOA 2A3SA 4I98B 3MCZA 2FEZA 3HRUA 1UCRA 1FC3A 4FX0A 2QM3A 1KU9A 3JAMZ 1LDDA 3IWZA 4YG2F 1P6RA 2X4HA 4ZYEA 5F64A 2J5PA 2EJRA 2K86A 3R6SA 4M9ZA 2RGVA 2QQ9A 1TW2A 1R1UA 1HKSA 3C7JA 2Z3YA 4UUVA 1CGPA 2L01A 3FX3A 4O3MA 4A5NA 2YR2A 1SD4A 5AIPA 1U6GA 1MZBA 1YW9A 2H09A 4KN7X 3J80Z 5HLIA 3WTZA 3VFZA 2IA1A 1HQCA 5LEJA 2HQNA 1H0MA 3F22A 4UVAA 4KICA 2CGPA 4JQFA 3P7NA 4OINF 4O5VA 5D4RA 1QZZA 3K69A 2ZNZA 2WTEA 3FMSA 3MEXA 1T2KA 1FLIA 2P5VA 3ZMVA 3H3ZA 5LRSA 3O6BB 4I7HA 3HOSA 2QQAA 1R23A 2O3FA 1FBQA 5CLSA 3F8NA 3G73A 4I0BA 4PGGA 4ESBA 5D5UB 2VODA 5D6EA 3MZHA 1O3TA 3BOQA 3I5UA 4HQMA 2VBXA 4LMYA 3IKVA 4HOBA 5TRDA 5ILVA 4JBAA 1I1GA 3E6MA 1LJ9A 4ENJA 2VOOA 3U1DA 2DK8A 3IHUA 2HTJA 4EGYA 3E3VA 4I0AA 3WE2A 5D5WB 1ZRDA 2KIUA 1TQIA 1R58A 3I53A 4GO1A 2KKOA 2FNPA 1G3SA 1AOYA 1FX7A 2QBYA 1J5YA 4OIQF 2A69F 1RUNA 2ZBKA 1PP8F 3JSOA 5F1RA 1XSDA 2KIMA 1T98A 3CUQC 3FXUA 5H6RA 3HSRA 2W84A 4KIFA 3M8FA 2D45A 3C1DA 2VC0A 2QZ8A 3DFGA 3J80K 1IF1A 1HBXG 2DPDA 5BS6A 4G7HF 5ICEA 4M74A 2OQGA 4OMYA 4L0YB 3PQKA 3E5XA 2P7VB 1G3WA 1PUEE 5L3GA 1KQ9A 4ON0A 4L9TA 4Z2YA 3E6DA 3LWFA 2ELHA 1W4MA 1ZARA 2NRAC 3T1BA 3WTXC 3KCCA 5HS8A 1ZRCA 5CJ9A 2Z99A 2ZKZA 4ZH4F 5HOOA 4LFUA 5D5XB 2FRHA 4U88A 1BC8C 3GFLA 1XGMA 1F9NA 5E1XA 3LSTA 5LGNA 2OZUA 1KQ0A 1Z6RA 4HLXA 1RNLA 2CSOA 5K5OA 5D8LB 2IJLA 1XSXA 4PGHA 3HTSB 3TDZC 4QLCU 1YIOA 4P55A 1W7PA 4F7ZA 2HR3A 2EA2A 1O3SA 1YFHA 1I1SA 2FBHA 3DXJF 4A6EA 3R61A 2DQLA 2Y75A 3MAJA 2C6YA 1B1BA 1W5TA 3R0JA 4A6DA 1S7OA 1TNTA 3WTUC 5LHGA 3F21A 2Y48A 2HKXA 1P2FA 2VXZA 1D5VA 2R7DA 2UXNA 3F6OA 4RB0A 2XUBA 2OAZA 3HYIA 5A2QZ 4UXNA 1SD6A 3RI4A 2OA4A 3WGHA 4DQ2A 4LG0B 1ON2A 2GWRA 3F8CA 3ABUA 5ICFA 1YW7A 1YS7A 2RN7A 2VOPA 2ZFWA 3QPHA 3EDPA 3KE2A 2H6BA 1YTYA 1SD7A 3BJOA 3N97A 2QYOA 3JTGA 2NYXA 1O57A 1S29A 4LLLA 2IVMA 5L3EA 3ISPA 1FP1D 5D4SA 1STZA 3RKWA 2IPQX 1BBYA 3HOTA 4L0ZB 3IC7A 4L9VA 4KYWA 2PLYA 2MC3A 2V9VA 1REPC 1PDNC 1T0FA 5LEKA 1FYLA 3FHZA 1Z1DA 2HYFA 3K1MA 1S3JA 2DO7A 2H6CA 1UFMA 3D0SA 3HRSA 1PP7U 1P92A 1HKTA 3CO6C 1RZ4A 4HW0A 4EM1A 4N0BA 4G6QA 1O3RA 2EB7A 4BHCA 3LA3A 2F2EA 5J8CA 2JRTA 3V8LA 4LGWA 2EFOA 3K0LA 2A07F 1UHWA 3LQRA 4OMZA 2HQRA 1LDKB 1GVJA 4ZZDA 5CVVA 1FOKA 4I09A 4M72A 1Z7UA 2QBYB 4OU0A 5D6FA 3NRVA 1RIOH 2XKOA 1LB2A 3LA7A 2XRNA 3ELKA 4IPAA 2VN2A 1I6XA 2LDUA 4P5OA 3TOBA 2ZXJA 4EMSA 5FFZA 4EJVA 1LEBA 1K79A 4ZYHA 3RYRA 4CYDA 2P5KA 1SD5A 4R8HA 5IT9Z 3DV8A 4EVIA 2HZTA 1BIBA 2EFQA 2STTA 1YYVA 4UHTA 1WSUA 2VBYA 3DP7A 2DI3A 4Q4ZF 2LNBA 2ESNA 3RPQA 3BJAA 3QP5A 1Q1HA 1MD0A 4NB5A 3OOPA 5E1WA 4U0VA 3FXRA 3OV8A 4HF2A 3R0AA 1FY7A 2HYGD 2O03A 1T6SA 2ISZA 3G3ZA 3DQVC 1IW7F 5DEQA 1YW8A 3LA2A 2P8TA 2YU3A 4WXCA 3V4GA 3IKTA 3SFZA 1ZG1A 4KMUX 3FMQA 2E7XA 2OBPA 5DCMB 5BOXA 4HLYA 5HDKA 3TKYA 1BI0A 3F8BA 2M8EA 2UXXA 3U2RA 2V79A 2V1XA 4HX8A 5LGTA 5FLXZ 5CVUA 1I5ZA 3C18A 3F8FA 3HIFA 2RDPA 2HOEA 3KP5A 4WXHA 1K78B 1TTYA 3IRRA 3WU0A 3J81Z 2G9WA 3K1PA 2JTVA 5LHHA 4R1HA 2M30A 1OYYA 2EV6A 5L3FA 2XHKA 1LQ1A 3I0TA 3QOPA 2P5LC 3HSFA 2VBZA 1KU2A 2CQKA 4HDUA 4HDVA 1B6AA 3KP6A 3EYYA 5AONA 3KP2A 3KP3A 5LHIA 2EFPA 5D8KB 4RAZA 5H20A 1O7LA 1R00A 3V8JA 4MHGA 4TV7A 1MJBA 4LJZF 3T8RA 1ODDA 4M9SA 1W7PD 1ON1A 3HTUA 3WTTC 5K5RA 2YPRA 4KFCA 5FLXK 2W57A 2A68F 4IRHA 1JHHA 2FNAA 3FWEA 5DDGA 3L2CA 1W7PB 2VC1A 2BBYA 1Z05A 4O6JA 2WWYA 3AAFA 3V8KA 1FZPB 5E20A 1EH6A 3WODF 1J0RA 4EJOA 1ZLJA 3U9GA 2K02A 2HTSA 4YFNF 1SMTA 3GW2A 3ZQ7A 4EJWA 4OIPF 3LAJA 2Q2EA 1SFUA 3BY6A 1B59A 5ILUA 3CDHA 2HWVA 5FB2A 5ICGA 4RB2C 4U0WA 3GZ6A 2FQ3A 2EV5A 4KUMA 3F3XA 2D1VA 2O61A 3FZVA 5A2QK 2V6CA 5LRRA 2UWMA 2ISYA 2Q8KA 3VODA 2H27A 1Z6TA 4CDGA 2JT1A 5ERIA 4JK1X 4I01A 5IT9K 1U5TA 3CUQA 1ZGAA 2ZO4A 1AWCA 2F5CA 2P7CB 5FD5A 2M45A 5JI6A 4M9XA 4U0YA 4MEYF 1R1VA 5L3BA 4ENKA 3BPVA 3IWFA 2GQQA 4MTDA 2HGCA 5TJJA 2RKHA 3MWMA 4CICA 3ZN1A 1H9GA 4FHTA 2WC2A 4PDKA 2PEXA 1CF7B 2IA2A 2DT5A 4WF2A 4L18B 5JHUA 4WX9A 2LF8A 3JTHA 1L3LA 4ZYDA 4GYGA 3CTAA 1BI1A 4ZYGA 1HW1A 4ESFA 2PFBA 4LD5A 3TQNA 1FWZA 1WI9A 2Z9OA 2JSCA 2P6SA 5DD8A 4FX4A 3E5QA 2KJCA 4EQQA 3JW4A 2CFXA 3MQ0A 1XMAA 4BNCA 1LNWA 3TO6A 5E8GA 3SXYA 1Z9CA 2M5WA 1SAXA 5HDNA 4ASNA 4M71A 4RB3C 2QENA 3DKWA 5LBQA 4RGXA 2STWA 3E5UA 2NNYA 2PMHA 2BGCA 4LLGF 1XGOA 4UVBA 5DV5A 3DF8A 2CG4A 3IRQA 5KK1A 3ZMUA 1KQ8A 3GFMA 2ZMEA 3CLOA 4D0PA 3WU1B 2K4JA 3EUHA 3N4MA 4UNOA 1BJAA 1LEAA 3W6JB 5DYMA 3ECHA 3KP7A 4XRFA 3WTVC 3R4KA 1R5GA 2QWWA 1HXDA 1R36A 1FNNA 2F5EA 2HDCA 4HBLA 1D3YA 4G9YA 4GCVA 4LLNA 2IP2A 2XV4S 4P9UA 2K4BA 5J6XA 4S04A 3RYPA 1TNSA 4K2EA 4MEXF 5HS7A 1OMIA 1D8KA 4A0ZA 4A2UA 2MBFA 3GYHX 1DP7P 2GXGA 1WKMA 2DW4A 2EK5A 1P4WA 1U3EM 3GUDA 1XMKA 5CVJA 1RI7A 2W24A 2Y0MA 3K9TA 3I54A 3PQJA 4ZZLA 1OYWA 2JPBA 3SHFA 2MLKA 1X3UA 5JR3A 1IRGA 3GXOA 2V1DA 1B9NA 4CO8A 2RV8A 2L4MA 4MQVA 1S6LA 4KN4X 2VBWA 5DD4A 4AIHA 3VOEA 3E6BA 2CO5A 1R1TA 4YFKF 4IXAA 5IT3A 4XSXF 1E17A 4WK8F 2PBIA 2KRFA 4MTEA 3GO5A 3WGGA 3I4PA 4HV5A 4MQ9F 2YX7A 5EEGA 1FP2A 3ML6A 3L9FA 4WCGA 4HAMA 3TO9A 1DPRA 4KDPA 1BIAA 4Y13A 2W25A 3ZPLA 4YFXF 2UZKA 5EEHA 4LB5A 4G7ZF 2PG4A 4UVCA 3ZMDA 4AD9A 2QVOA 1ZHFA 3HSEA 2LKPA 2F5FA 1KYWA 2O6GE 3CUQB 1I27A 1WWXA 1IAWA 1QNTA 3M8EA 3DPTA 1DPUA 1ZYRF 1OR7A 3RPUA 1FYKA
chains in the Genus database with same CATH superfamily
2DJNA 4C3IJ 3COAC 1ITYA 1FOWA 2Z5UA 3ZQHA 5BQTA 1PYVA 4RM2A 4NHJA 5CQEA 2I5UA 3ZP5A 2NAZA 2ZCWA 3ULQB 1G6NA 3KZZA 4ENMA 2OCEA 1BW5A 2LKXA 4HV6A 1RKWA 4BXXJ 2LF7A 2PJRA 1B4AA 4UB6C 2LKSA 4DNCA 2L54A 3MZYA 1EH8A 1HSTA 3LFKA 3LL7A 3AL0C 1S9HA 2KIQA 3KEYA 1N25A 2JA6J 2ECBA 2TRTA 3MN2A 3AG3H 4H0EA 1YG2A 2XGCA 1TQMA 3CLQA 2Q0OA 1ORKA 1XMXA 2FMLA 4B43A 4DYQA 2E71A 3QAHA 3SZPA 5KVRA 4B4CA 3CD6I 4G6DA 2DOAA 4MNUA 2RC4A 1I39A 2W1OA 2DMQA 2V9PA 1UB9A 4LG3A 4AWXB 5E8IA 1YX3A 1PVEA 2X9DA 2W00A 1W0UA 4Q5SF 3IH2A 2HKOA 1MSFC 3FDYA 4IRGA 4E7ZA 1MNMC 2BZTA 3L7WA 4V2FA 3HGYA 1TL8A 4PJLA 4B48A 4ESJA 4MFDA 3OYEA 4F55A 2JUCA 2A6HF 4ZTJA 1XCVA 1BW6A 1MDMA 2R92J 1XDSA 4RB1A 4PUSA 1A35A 3ECOA 1JKRC 3GX4X 3K2ZA 2R7XA 3I71A 1SFXA 5IY5H 1FYMA 1J2XA 3GFJA 2LY2A 4FT8A 4YIRX 2EH3A 3NARA 4AIDA 2F5VA 1ZTRA 2KDOA 2HOAA 2PI0A 1IXSB 2X6OA 3J7AO 2VQHA 1U5TC 2DJIA 1AU7A 5F04A 4B3XA 1U8BA 1MBHA 3BG5A 4EGZA 1SVOA 4ANJA 2CWEA 5E1ZB 1HF0A 3HUGA 5EDNA 3A02A 2IS6A 1J75A 3FF5A 4A0XA 1VQOI 1B8IB 3H92A 2DQRA 2VONA 2GXAA 3WG9A 1V3FA 1P4AA 2YSRA 1IN5A 3CCLI 3TW7A 2RQQA 1Y8RB 1YO5C 3L1PA 4A93J 3WGIA 1JXSA 2EQRA 3RQIA 3G6EI 2IT0A 1HW2A 3A03A 3C3WA 2HVQA 1XGSA 3KYDB 1TW3A 5J4VA 1MBFA 2DYSH 4E70A 1WPKA 3S17J 2Y2ZA 1GUUA 3LSKA 4ENNA 1LFUP 1F36A 4BXUA 1WJBA 3UNGC 3JSPA 5HVQC 2L7FP 1QU3A 2CV0A 3RJPA 4BAYA 5FRMA 4HNUA 4M3EA 4C2UA 1BR4A 4RM3A 1ENHA 1FSEA 1V55H 3D5LA 3M07A 3R60A 3OYLA 4F52A 3S3NA 1U78A 2G7HA 4A5MA 4BEHA 5KHDA 5HNFA 2DAOA 2VKVA 3IL2A 4RDUA 1DUXC 1H88C 5D5VB 2EV0A 1U2WA 4W97A 2B7EA 2ACJA 2F48A 1ETVA 1HSJA 2E2HJ 2V26A 2XAJA 5K7ZA 4PJ0C 4NC7A 3ZMSA 3I56I 2DU9A 4IHSA 2DTRA 3CP8A 4PJNA 3RKXA 2DMUA 2KL4A 2GXBA 4XK4A 5FGMA 3PO2J 2UV1A 5ICCA 3JAMK 1FJLA 2CV2A 4N4OB 2IS4A 2CFOA 3OYIA 3FBNB 1XTAA 2OD5A 2MH9A 4M73A 4OOIA 3AKZA 1K61A 2FBIA 2P81A 1TLHB 2FSWA 2VXDA 3REOA 4HRIA 4DBQA 1RC9A 4BJTA 1T38A 5ED4A 3CUOA 4DW6A 1S7AA 3ABMH 5FKOA 4BACA 2BY1A 1JHFA 3QPLA 3OS0A 2FA5A 5IOZA 1QPMA 2MYSA 4F3QA 1OCCH 3HM5A 2L02A 4G94A 1WH7A 1QO0D 1QA6A 1QGPA 3S1RJ 3FK6A 2R4GA 2IS2A 5JFRA 4HYEA 4AYBN 2XIGA 2R3SA 4G12A 3ZQFA 3B73A 1XGNA 4XLNF 4NC6A 2LLKA 2M7BA 3H3UA 1V4RA 4BBSJ 3BG6A 2CW0F 1ONVA 2FMYA 3KZYA 3HG9A 4YIFA 1IN7A 1BOAA 3G4SI 4IOCF 3WE3A 3G2BA 4UUSA 2TDXA 3OL3A 3MKZA 5HLTA 4GXOA 1IRFA 1VI0A 3DKXA 2E1NA 4M6YA 2JUGA 1IN4A 3O2PE 2QA4I 2DCEA 1D8JA 5EF6A 1WJAA 2PJPA 4G7OF 2X0LA 4KNYA 1TWAJ 2DMPA 3CJNA 2LVSA 2X6YA 3VYRB 3C2BA 3CCSI 4B8XA 1AKHA 1KU7A 3HZJA 1BR1A 4M3FA 3CMAI 1XPXA 3HHHA 1K83J 2DMTA 3EETA 1VQ6I 2EBIA 3AL0B 1MGTA 1MMGA 3PFYA 4FCYA 4XQFA 4UV8A 5M5WJ 2GAUA 2PQ8A 1WJ5A 2DA3A 5DCMA 2ADUA 3GTPJ 4ZTFA 4JX4A 1YS6A 3JRGA 3CZ6A 3UR3C 4Q47A 2R93J 2OUMA 3CJRB 3SDBA 1B8IA 1G4DA 2COMA 2Q2EB 2ZXIA 3FM5A 2R5YB 1D1CA 1Y0UA 1NHAA 2BV6A 1FTTA 1MJ9A 1H8AC 1O7FA 2QGUA 3LQQA 4A0YA 1K78A 3HDDA 1MMDA 4OIRF 1XDUA 2R7UA 3D5RC 1DGRM 3L09A 3F9KA 2DOEA 3HHGA 1ZG3A 4BU2A 4QWQA 4N9HA 2IW5A 2D1HA 4KA4A 1ZKGA 4IEJA 3TO7A 4I76A 3S16J 3DPUA 1U9NA 3A1YA 2FE3A 4B44A 2E36A 4HZFA 3DTKA 2GIVA 3QP6A 4R79A 1WVRA 5LFAA 4KT6A 3CO7C 2OU2A 2VE8A 3CCVI 5HS9A 1E2XA 1OKRA 2DLLA 2A6TA 2EA4A 3RSNA 2KISA 3Q9SA 2CYYA 4MFEA 4U7BA 1G59A 3HXLA 4KJZA 2EFNA 1SFEA 3GBGA 4HPQA 1S8NA 4A12A 2ECCA 1DU0A 3BTLA 1ULYA 3ZMZA 4HX7A 4NQWA 4CZZA 1DQUA 2AXLA 4KIBA 1FMWA 3EQLF 4RS8A 2R7ZJ 1Z91A 2FXAA 5H6QA 1KZHA 3L00A 4OIOF 4G8XA 2E1OA 2N8GA 4J00A 1BI2A 3I58A 3NAUA 2KMUA 2I10A 1UHMA 1M1EB 4WXDA 3VB2A 1Z77A 5K1YA 2DFIA 1E0EA 2OQRA 1ZN2A 1JT6A 4GYIA 4ZDPA 3ROUA 4RAYA 2AXTC 1LVAA 4UY8I 1MDMB 5HLGA 4Y17A 4S0HB 1XB4A 2DFFA 2K27A 3ASNH 2X1EA 2YX4A 4B1RA 2GOXB 4BHBA 4D5CA 2XVCA 2E7WA 1R22A 2DTZA 2VT3A 2HEOA 4LK0F 1KYZA 2XAQA 1TWGJ 1QHGA 5HLHA 2GZWA 1IN8A 4EV0A 4AM3A 3H0DA 3SZGA 1FOXA 1VF9A 3FXQA 1A5JA 4FISA 3ZMTA 2DBBA 1ZREA 3PSFA 4DYCA 4IZZA 3Q3SA 1GXPA 1TT0A 3DEWA 4PSWA 2IGMA 2IA0A 3DLLF 3BG3A 2VT2A 1BI3A 4U7DA 4MLOA 2W7NA 2XAFA 2RQPA 4CXFA 4CYCA 2J5OA 3ZN0A 5K5QA 2LOOA 2QLZA 1OISA 4GGGA 3GTJJ 3E1SA 4FETA 5AIQA 1CF7A 1WRJA 1YLFA 3F6VA 1WJDA 2HS5A 2VQCA 4HSTA 1L0OC 1ZG5A 2NVTJ 1OFCX 5FO5A 2MH2A 3VEPA 1TBXA 2E35A 1HW5A 3GWZA 4EJTA 2QQ8A 1LDJA 3S2WA 1YJWI 1A6QA 3ABTA 2K3FA 2KJBA 2JN6A 1A31A 2COBA 3M9AA 3T8TA 3U21A 2ZJPF 4HF1A 2GA1A 4Y15A 1ERDA 3BZ6A 1MH3A 4RGSA 1KA8A 1MJAA 2KP6A 3SZTA 3E0JB 4IHVA 5B3SH 1P9QC 3F8MA 4N9IA 4ITVA 5HDGA 2DA1A 3OY9A 1A04A 1OCRH 5BPDA 3QYFA 2P4WA 1K6OA 1VQMI 4BDZA 1F1ZA 4C2MJ 3PM1A 1Y39A 3BWGA 1XX5A 3BT9A 2IEKA 4KIGA 2V1UA 3EYIA 2LTPA 2DK5A 2BVMA 2MD0A 4HA8A 2FF4A 3T5XA 1EV7A 2KIFA 4IQ4A 2LD5A 3ESWB 1TC3C 4EJUA 3JRBA 3QRFF 1VQPI 3WHBA 1D1AA 3GZNB 1TWCJ 1FEXA 2KPMA 3QYBA 2DPUA 5FFXA 2MA3A 2F4MB 4PZJA 4X6AJ 4RGRA 2QSHX 4LG0A 4ZC3A 1U8RA 3RTRA 3J7YJ 2PMZA 1TQPA 2WV0A 5KNLA 4WWCA 5J1UA 2IRFG 4IVNA 2IGOA 2K7LA 2PX9A 1HKQA 2ELJA 3DU6A 1P7JA 1R5HA 3H9QA 3CCJI 2AQEA 3BP8A 2EWNA 5F1JA 3T0YA 3K7AJ 2XF5A 4CYCB 2ETHA 4E7SA 1DDNA 2RNJA 4L9JA 3UKGA 2QKMB 3P9CA 2BW3A 3KETA 4IX7A 1J59A 3BR0A 1NH3A 1YQAA 5FROA 2W85A 1FBUA 2BYVE 3WTYC 1WGXA 5FD6A 1XG1A 3M1EA 4A3IJ 2XAHA 1ZGWA 4DGWB 2K5CA 2PMZN 3DTEA 2VKHA 1XD7A 3RDIA 4FASD 1IN6A 1VTNC 5CVRA 2L5QA 3TDUC 2CUFA 1JJ8C 5C4XJ 2OZ6A 2P6TA 1TWFJ 2LRDA 3LSIA 1N77A 1F5TA 2CS3A 2JPCA 3E97A 1JJ6C 2KQRA 3FMRA 2O7OA 3S32A 1W5SA 1R4MB 2LC2A 5L3DA 4KMFA 3HJEA 1XCBA 2ID3A 1JE8A 4A3DJ 2JVHA 1FTZA 1X3ZB 3H0GJ 4PCQA 1FIPA 3GEZA 1GVDA 2VLAA 2E1CA 3DPLC 5L3CA 2XGXA 1R7JA 3BG7A 3RKYA 3TGNA 1OPCA 1QQIA 4L5IA 1JGSA 4DJAA 2ZNYA 3K10A 4XLPF 5ILSA 3OYAA 4HX4A 3DEUA 4IJAA 2CV1A 2CW8A 3A01B 2M0CA 5J1YA 1SVMA 2EIMH 1C0WA 5JHFA 3L2QA 4I02A 1ZAOA 2B0LA 3HKZN 4ETSA 2M1BA 3PSIA 2R5YA 1H9TA 3FKJA 2VE9A 1BL0A 2NNNA 1B9MA 2HOTA 4EATA 2ZMEB 5LGUA 1IZ1A 5LLQA 4G6TB 1OCOH 2O0YA 3BDDA 3RIRA 4A3MJ 2ZSHB 2YU9J 4XOTA 1FSHA 1I3AA 4CZCA 3V7CA 3GZ5A 1Y0NA 2HI3A 5DCFA 3ASOH 4A3BJ 1SVLA 4I2OA 1J7KA 2GIZA 2ZC2A 1O3QA 4AC0A 2FU4A 2NS0A 3BPXA 3Q5FA 1HDDC 1K7AA 3GLXA 4BEHB 5CYVA 2WV1A 3I64A 4UV9A 1EF4A 4HQEA 1U5TB 3K4MA 3MKLA 3O8HA 3TOAA 4CGZA 3GTLJ 3FM3A 2WAQA 2PN6A 2XF6A 4BQQA 4BE2A 1BM9A 2HVRA 4IRIA 1TZLA 6PAXA 1SMYF 4BJ6C 3DCFA 3P9KA 1OCTC 3DWLE 4EEFG 2PMUA 3QPTA 2EFWA 3WTWC 5IP9J 5JVTA 5K7HA 3PFIA 1F4KA 3SQNA 3V7RA 1OYIA 4RBOA 3S15J 3B02A 4EM0B 4L5JA 5HODA 3DKYA 1VQ7I 2MLGA 4BQNA 3F72A 5BMZA 4D1QA 3I59A 1UAAA 3ABKH 3K2AA 2MFZA 2ZJ2A 2L9NA 3CF5F 1USTA 2JJ7A 4IHTA 3GFIA 1IDZA 2WBMA 4DOZA 4QSHA 1QZYA 4DYRA 4ZYAA 3M7GA 3HC7A 1JKQC 3WU2C 1P4XA 3K4BA 2BEOA 2FD5A 3VYSB 5J8FA 1JKOC 1BC7C 3H9GA 3BZCA 1ZGJA 1T39A 1H89C 2XAGA 4B09A 4M6XA 2XKPA 4P96A 1VQKI 2LMDA 4NNJA 3D5SC 3GF2A 2H1KA 4XL9A 4BE1A 3FXJA 1RUOA 1X1DA 2O8XA 2IS1A 4RAFA 1RRJA 1IUYA 2M34A 2XROA 5DUKA 1ZLKA 5EJCA 3QPSA 1XN7A 2WB1N 1HOMA 4FE4A 4N4NB 3BR5A 3HL2A 1VQLI 2E5ZA 2FBKA 2MC4A 2VJIA 1LUJB 2VQLA 3JRDA 3J81K 4ZDLA 1G8XA 4LIVA 4RGUA 3O8GA 3A0HC 5F6FA 5FKLA 1GHCA 1FBSA 2L7MP 2MD5A 3Q0VA 4BS9A 3NQOA 2E60A 1I6HJ 3K1NA 5E17F 1XSVA 3HBLA 1U0JA 4LK1F 3HPGA 4I99C 1YRNB 1IXRC 3KLNA 1QBJA 2IAIA 2XSJC 1HLVA 2GA2A 3DBRB 1YJ9I 2XASA 3CCEI 2R7FA 2A6EF 2Z33A 3KFWX 1FPQA 2MGQA 4IQJA 3V7SA 1J09A 1G3YA 3HRMA 3MFKA 1E3HA 3LAPA 3FXMA 1USSA 4Y4RA 1D5YA 4XSZF 4MGRA 2VPLA 4FTHA 3KLOA 4YIIA 4EM2A 3WTSC 4NC8A 3CMYA 2AS5F 3CJTB 2LY1A 2H94A 3PJRA 2M87A 2A5YB 2H1LA 1BR2A 1WZ2A 2HFHA 1POGA 1EH7A 2DT7B 1K4SA 3P9IA 3SFIA 2MSYA 4OAZA 4AIKA 4BHPA 1NK2P 4X1EA 2RREA 2M2EA 3KEQA 4XRMA 2IXSA 2L4AA 1FMVA 3HEFA 1T08B 3RKQA 1RPWA 4AVZA 5E3OA 2ESHA 1GXQA 1ZRFA 2D2WA 4P9FA 2QQBA 4CCJA 4GDFA 1MKMA 4L9NA 2BE5F 2K85A 2DDAA 5BPIA 1ZH5A 2HPIA 1WQ2A 1KU3A 4ZJZA 1WFXA 3GVAA 3J7AY 3ZXSA 1G3TA 2NVYJ 5E18F 4BH9A 2FOKA 4BQAA 2L3DA 4BBRJ 3BJ6A 3G1LA 2QUFA 2R7QA 3O3KA 4Q48A 3GTOJ 3OIQA 1VNDA 2H8WA 2F5DA 3W6KB 4QIWN 5CVIA 1A6IA 4HF0A 3HKZA 2DYRH 3CCQI 1T95A 3Q0WA 4S05A 3K4NA 1UG0A 5EZHA 4LB6B 2CQQA 4D7NA 2QKLB 3ERED 3JRCA 1JUMA 3PIPF 4AVPA 4AIJA 1BN5A 1IXCA 2RVCA 3Q9VA 3BROA 4BYYA 2A5WA 3F23A 3FKIJ 3M8JA 3HRTA 3QU6A 2JZYA 4KT5C 3QU3A 4IF4A 3I59B 3E6CC 1FT9A 2WY7Q 2GM4A 3NEUA 5DUIA 1EA3A 1KGSA 1NG7A 1NTCA 3OYGA 3DBHB 3KP4A 2E2IJ 2V9KA 2NVQJ 2G7UA 4PSXA 4CHUA 2LSOA 4XBFA 3M1CA 2CW7A 1J9IA 3CCUI 3BLYA 2A61A 3KEOA 2Z1DA 3OIPA 2R0QC 1QVUA 2A3SA 4I98B 3MCZA 2FEZA 3HRUA 2LFBA 1LVKA 1UCRA 2VQGA 2DT6A 3LNQA 1FC3A 4FX0A 2QF7A 2IBDA 4HG2A 3B6CA 2LR8A 1KU9A 2QM3A 3JAMZ 3CCRI 1UMQA 1OLTA 1LDDA 4I6ZA 1U9OA 1IG7A 3IWZA 2GLOA 3MKWB 2L9SA 4YG2F 1P6RA 2X4HA 4XIDA 1I50J 5LD2C 4BQOA 5B1AH 1ETXA 2YUSA 3ZRGA 4ZYEA 5F64A 2O9LA 2J5PA 3EUAA 3TP3A 1OJLA 1S7EA 3OYKA 2EJRA 1JGGA 5F08A 2K86A 3R6SA 3MZ8A 3ABLH 5J4YA 4PK4A 3QODA 3A4CA 4M9ZA 2RGVA 3SJMA 2QQ9A 3EPZA 2M0MA 1BOBA 4XMYA 1TW2A 4C30A 1R1UA 4U87A 1HKSA 3K6GA 3C7JA 2K9NA 2Z3YA 4UUVA 1CGPA 2L01A 3FX3A 2X51A 4O3MA 1RESA 2E34A 4A5NA 2YR2A 1SD4A 5AIPA 1U6GA 4XRSA 2DA7A 2LG4A 1PUFB 1MZBA 4BY7J 1YW9A 2H09A 4KN7X 4IO9F 3J80Z 5HLIA 3WTZA 2BXYA 3VFZA 3I55I 5J47A 2IA1A 1HQCA 5LEJA 3N05A 2HQNA 2DA5A 1H0MA 3F22A 4UVAA 1ETKA 1V5FA 2XGEA 2M4KA 4KICA 2CGPA 4JQFA 3P7NA 1IJWC 2KHMA 4OINF 1AKHB 4O5VA 2EIKH 1DU6A 5D4RA 1W1WE 1QZZA 3DEEA 3K69A 2ZNZA 2LBFB 3ZR8X 3I3LA 3HOWJ 2WTEA 3CP2A 2X85A 1SANA 3IAS2 3FMSA 3K4CA 3MEXA 1X1BA 1T2KA 1FLIA 2P5VA 4YEJA 3BR2A 3VWBA 3SDGA 3ZMVA 1T56A 5IYBJ 2XB0X 1I3QJ 3H3ZA 5LRSA 2QEXI 2BHYA 1X58A 3O6BB 4I7HA 3HOSA 4BE0A 2QQAA 3EUHC 1R49A 2VKEA 3CC2I 1R23A 2O3FA 1FBQA 5CLSA 1JUSA 3F8NA 3I4MJ 5EGOB 1OCZH 3OR2C 2HVSA 2M3AA 3G73A 4I0BA 4PGGA 4ESBA 5D5UB 2VODA 3PIOF 5D6EA 3MZHA 3M4OJ 1O3TA 2CQXA 4XORA 3BOQA 2K9SA 3I5UA 2HQAA 2VBXA 4HQMA 4LMYA 3CMEI 3IKVA 4HOBA 5TRDA 5ILVA 4JBAA 3IP4B 1I1GA 4X0GA 3E6MA 3L2VA 1LJ9A 4ENJA 3RZDJ 2VOOA 5IOYA 2HXIA 2HYJA 3U1DA 3OIOA 2DK8A 4CCKA 3IHUA 1YITI 2EZKA 3ZQCA 2HTJA 4XKWA 4EGYA 3E3VA 4IHYA 4I0AA 2V7FA 3WE2A 5D5WB 1ZRDA 2KIUA 3H1CA 1TQIA 1R58A 3I53A 4GO1A 2E2JJ 2KKOA 4AYBA 3LSGA 1QZEA 2FNPA 1G3SA 2JWTA 1AOYA 1FX7A 2QBYA 1J5YA 2VI6A 1IRXA 1YX5A 1BJZA 1VQ9I 4OIQF 2A69F 2FQ4A 2XPUA 1RUNA 2ZBKA 1PP8F 5GAHJ 3JSOA 2R5ZB 1W36D 2Q1ZB 5F1RA 5IYCJ 1XSDA 2KIMA 4A3CJ 1T98A 3IUOA 2QCOA 1VZ0A 3CUQC 5B1BH 3FXUA 5H6RA 3HSRA 2W84A 4C9YA 4KIFA 3MD2A 3AG4H 1X1AA 2IGNA 3M8FA 2E1MB 3C1DA 2D45A 2VC0A 1NG6A 3NWSA 2QZ8A 5M5XJ 3DFGA 1MBGA 3JRAA 3J80K 1IF1A 1HBXG 2DPDA 3CMMA 1O4XA 5BS6A 4G7HF 3CESA 5ICEA 4M74A 1QRYA 2OQGA 4OMYA 2L9RA 3BR1A 3PQKA 4L0YB 1IDYA 2CUEA 4V19K 3E5XA 2P7VB 2WADA 2V4JC 2KLOA 5E3LA 1G3WA 5J1RA 1PUEE 1WH5A 1B72A 1JTXA 5L3GA 1KQ9A 2DA4A 3HUGB 2DODA 1K6YA 2MABA 4L9TA 4Z2YA 4ON0A 5EG0A 3E6DA 2EZIA 3LWFA 2WAEA 1DGWY 1MMSA 3VSKA 4GRIA 4F92B 3GTKJ 4QPOA 2ELHA 1W4MA 1ZARA 2NVXJ 4E6KG 3MMYB 3QQAA 5GADJ 4II2A 2R7SA 2ZSIB 1PUFA 1VQ8I 2NRAC 3T1BA 4XONA 3WTXC 2WB1A 3KCCA 5HS8A 3M3YJ 2ZJQF 3IH3A 1ZRCA 1MBEA 5CJ9A 2Z99A 2ZKZA 2KDZA 3G71I 1TP4A 4C2TA 4ZH4F 1NK3P 5HOOA 4DZPA 4LFUA 5D5XB 2FRHA 2B9SA 3LMMA 3CC4I 2Y0SA 4U88A 1BC8C 3GFLA 2OPTA 2CJJA 1XGMA 1F9NA 3E7LA 3OR1C 5E1XA 3LSTA 5LGNA 2OZUA 1KQ0A 1MW7A 4JP0A 1Z6RA 2K40A 4HLXA 3LOCA 5M5YJ 2L7KA 1RNLA 2CSOA 4BXFA 2AQFA 5K5OA 2KRHA 5D8LB 2IJLA 2FUG2 3HOXJ 1XSXA 5FJ8J 4NUBA 4PGHA 4Y7NJ 4XKCA 3HTSB 3Q0UA 5FKKA 1LE8A 2ELKA 2OV7A 3TDZC 4QLCU 1YIOA 1XC5A 4P55A 1W7PA 4F7ZA 2HR3A 2EA2A 5J3LA 1YFHA 1O3SA 2BOLA 2FBHA 2X1DA 1I1SA 3DXJF 3BTCA 1IO2A 1D1BA 4XNFA 4YRVA 1CQTA 4A6EA 3R61A 1R9TJ 2DQLA 1XS9A 2JA2A 1B72B 3W6VA 2Y75A 2KT0A 3MAJA 4CCNA 3PL8A 2ZXWH 2C6YA 1UJ8A 1B1BA 1W5TA 3R0JA 3V42A 4A6DA 1JTYA 1MSEC 1S7OA 1TNTA 1Z3XA 3QWLA 5EGOA 2ZJRF 2HOSA 1YJNI 1TWHJ 5LHGA 3WTUC 3L2WA 3F21A 2Y48A 5C44J 1T33A 1WJEA 1X2NA 2HKXA 5TISC 1P2FA 2R7WA 4XRSG 2VXZA 1D5VA 2R7DA 2UXNA 2M8GX 3F6OA 4RB0A 3ZQGA 2XUBA 2OAZA 3HYIA 4B3AA 3A01A 5A2QZ 4QPQA 4UXNA 1SD6A 2NOJB 3DTIA 3TW6A 2OA4A 2VJ4A 3WGHA 3RI4A 3PNTA 3GTGJ 4DQ2A 4LG0B 1ON2A 2GWRA 4UUSB 3F8CA 4RLQA 3ABUA 4CCLA 4IOAF 1F43A 5ICFA 3OL4A 1YW7A 1YS7A 5GAGJ 2RN7A 4A3KJ 2VOPA 2ZFWA 5E3NA 2CRGA 3OYBA 3QPHA 4PFPA 3JRFA 3EDPA 2KZVA 3KE2A 2VIXA 3GMEA 2DXIA 2A05A 3W2VA 2H6BA 1YTYA 1N78A 1AA7A 1ETQA 1SD7A 3BJOA 5JVGF 4C3JJ 2PJRB 3N97A 2QYOA 4PJJA 2NYXA 3JTGA 1FOYA 1Z7LA 1O57A 1S29A 1SFOJ 2VASA 3H9JA 4LLLA 1EKEA 1X2MA 2IVMA 3FIWA 5L3EA 2NOGA 4M3GA 1YE9A 3ISPA 1FP1D 5D4SA 1E3OC 5CPRB 5B5EC 1STZA 5B66C 3RKWA 3CDLA 2IPQX 5GAEJ 1BBYA 3HOTA 3CCMI 4L0ZB 3IC7A 2X6XA 4L9VA 4RMNA 1D0ZA 4JX5A 4KYWA 4AU7A 2PLYA 2MC3A 2V9VA 3PNVA 1REPC 1SAUA 3J7ZI 1PDNC 1T0FA 5LEKA 1FYLA 3FHZA 1Z1DA 2HYFA 3K1MA 1IC8A 1S3JA 2DO7A 3X2QH 2H6CA 2VJJA 1UFMA 3BC8A 3D0SA 3HRSA 2LP0A 2VJ5A 1PP7U 2JA5J 1P92A 1HKTA 3HPHA 3GLLA 1RZ4A 3CO6C 4HW0A 4EM1A 4N0BA 4F91B 4G6QA 4Y3OA 1O3RA 2EB7A 3LSMA 3GTQJ 4BHCA 3BZKA 1MH4A 3LA3A 1ZELA 2F2EA 2FJ1A 5J8CA 2JRTA 3V8LA 1FIAA 4LGWA 4A3FJ 2EFOA 3K0LA 4M3BA 2A07F 1K4TA 1LFPA 2ME6A 1UHWA 4IKFA 3LQRA 4OMZA 2HQRA 4D9JA 1VQNI 1LDKB 1GVJA 5F0CA 2KZGA 1QHHD 4ZZDA 5CVVA 4AUXA 1FOKA 4I09A 1GV2A 2BVLA 5EEAA 4M72A 2DOFA 2L2OA 5FKMA 1Z7UA 2HNHA 2QBYB 4OU0A 3K4LA 5JLWA 5D6FA 3NRVA 1RIOH 2XKOA 2LBFA 1MNEA 2JVGA 1N75A 1LB2A 2JQ7A 2HDWA 3LA7A 2DDBA 2BY2A 1RR7A 2XRNA 3ELKA 3LSHA 4IPAA 4MO7A 2VN2A 5DM7F 1Q1VA 1I6XA 3OYDA 1A36A 2LDUA 1D0YA 5GP9A 2ZB9A 2CH0A 3S8PA 4P5OA 4ABZA 1QPIA 3TOBA 4LOCA 2ZXJA 4EMSA 5FFZA 4EJVA 2JSPA 1Z3YA 1LEBA 4B47A 3JCUC 1K79A 4ZYHA 2OF7A 2CMPA 2CUZA 3B6AA 3RYRA 4CYDA 3CJQB 2R7RA 2Y30A 1Z0XA 2P5KA 2NVUB 2V6EA 1SD5A 4R8HA 2R7TA 3DV8A 5IT9Z 4EVIA 2HZTA 1BIBA 4XLHA 2EFQA 1Y56A 2STTA 1YYVA 1R5ID 4UHTA 1WSUA 2VBYA 2H8RA 4RLFA 3DP7A 1IV6A 4CSWA 2VPRA 1R71A 2EILH 2DI3A 4Q4ZF 2G0EA 2LNBA 1VQ4I 1ACIA 3S3OA 2FOWA 4GFBA 2E5NA 2ESNA 4ZDOA 2CU7A 3RPQA 2K3PA 4KISA 3S1QJ 2WAQN 3BJAA 4YELA 4JX6A 4FQGA 3QP5A 1Q1HA 4A3EJ 1MD0A 4NB5A 5GPAA 1HCRA 2LYCA 4XKBA 3OOPA 3IH4A 3H5NA 5E1WA 3SYTA 4U0VA 3FXRA 3RQ4A 1HC8A 3S14J 1YOVB 2X48A 2HXOA 3OV8A 2OTJI 4HF2A 5EG0B 5E3MA 1VFCA 3R0AA 2GOMA 2KRCA 3BR6A 1W0TA 3KIOA 1FY7A 1GV5A 2HYGD 2O03A 2XC7A 5DM6F 1T6SA 2ISZA 3G3ZA 3DQVC 3CC7I 1IW7F 3TMOA 4IHWA 1Z21A 3S2DJ 5DEQA 5F27A 3CDIA 2Y31A 1YW8A 3LA2A 5J40A 2P8TA 2YU3A 4WXCA 3V4GA 5FLMJ 2P0WA 2BXZA 3VPRA 3IKTA 3SFZA 1UELB 3C2HA 4KMUX 1ZG1A 2NS7A 2ID6A 1SEUA 4NQWB 3FMQA 2E7XA 2OBPA 5DCMB 1ZR2A 3BQYA 5BOXA 4P1WA 4HLYA 1IRZA 5HDKA 3K70C 3TKYA 1BI0A 3F8BA 2M8EA 2UXXA 3U2RA 1V54H 2V79A 2V1XA 4HX8A 1Y6IA 1WJFA 2EINH 5LGTA 3SEZA 5FLXZ 1SC7A 3OYNA 5CVUA 2DFHA 1I5ZA 3C18A 3F8FA 2EIJH 4E7HA 3HIFA 2XAUA 2RDPA 4CA0A 3WHCA 5C3EJ 2HOEA 3KP5A 4WXHA 1K78B 4RA2A 3K4KA 1YHQI 1TTYA 1HA8A 2F4IA 2L0KA 3IRRA 2XPVA 3WU0A 3J81Z 2G9WA 3K1PA 2JTVA 5K7FA 2JK3A 5LHHA 4R1HA 4XLAA 2BY0A 2M30A 4HNTA 1OYYA 2EV6A 2HU9A 4MIMA 3GCMA 5L3FA 2XHKA 2Z16A 3H35A 3HOZJ 5FKNA 3AG2H 1LQ1A 2AHQA 2K9LA 2W82A 4HNVA 3I0TA 2Y0SN 3QOPA 2VB6A 2JA7J 3VYTB 3WG7H 2P5LC 1MIJA 3HSFA 1AHDP 2M7AA 2VBZA 3VSLA 5M3MJ 1KU2A 2F6CA 3TP0A 2CQKA 3BTJA 1OR7C 3FXLA 4HDUA 4HDVA 3LSJA 1S5LC 1B6AA 3KP6A 3EYYA 2HDDA 3LSRA 5DS9A 3S93A 5AONA 3KP2A 3KP3A 1X1PA 4F93B 5LHIA 2JA8J 2EFPA 5D8KB 4RAZA 1MMNA 4RAGA 5H20A 2DA2A 4QTRA 1O7LA 2MG4A 2VL8A 4BL0B 2XSDC 3HOUJ 1R00A 3V8JA 4MHGA 2R7VA 4TV7A 1MJBA 4LJZF 3T8RA 1ODDA 3BG9A 3I4NJ 2MW8A 2NXNB 1WHUA 2LREA 3MVPA 1X19A 1MBJA 5HNHA 4M9SA 3JR9A 4XLEA 4BDYA 1X4OA 1W7PD 2XGDA 1ON1A 2NS8A 3HTUA 3WTTC 1R6RA 2Y9ZA 5K5RA 2E19A 2YPRA 3OYHA 1Y1VJ 4E7KA 1WJCA 4KFCA 2RAEA 5FLXK 2W57A 4J01A 2A68F 3LFUA 4IRHA 3LSPA 4CCOA 3RCOA 1JHHA 2FNAA 3FWEA 4V2GA 2WAFA 4Z6YA 3OYCA 3DU5A 3OSGA 5DDGA 1LPQA 3L2CA 1W7PB 2M4GA 2VC1A 2XB5A 2BBYA 3ZQIA 2I8DA 3KPHA 5TGTA 1Z05A 4O6JA 4DZJA 2WWYA 1GLNA 2W48A 3AAFA 3ZQLA 3V8KA 1FZPB 5E20A 5KCMA 1EH6A 3WODF 2FX0A 5IP6A 1S72I 3RZOJ 3H5RA 2HZDA 1J0RA 2OJED 3EUKL 4XLFA 4EJOA 1ZLJA 3U9GA 1T8IA 2K02A 2HTSA 2BW3B 4YFNF 3AFHA 4CCMA 1SMTA 1HDPA 3GW2A 3ZQ7A 4EJWA 4OIPF 3LAJA 2Q2EA 1YIJI 2B63J 2QSFX 1Y1WJ 1SFUA 3BY6A 4HSRA 1B59A 1APLC 3ZCOA 5ILUA 3OYJA 1ZK8A 4E7LA 5FRNA 3CDHA 2HWVA 4KITB 5FB2A 2OTLI 2XPWA 5ICGA 4RB2C 3S2HJ 1WI3A 4U0WA 3GZ6A 4UB8C 5GPCA 2FQ3A 2EV5A 3W3CA 4KUMA 3F3XA 1G2HA 2D1VA 2O61A 5CQGA 4BY1J 3FZVA 2ICWG 4IL6C 5A2QK 2V6CA 3BTIA 5LRRA 2UWMA 2ISYA 4UUTA 2VKDA 3QOEA 2Q8KA 2E1MC 3VODA 4A3GJ 2H27A 1Z6TA 4OAYA 4CDGA 2JT1A 5ERIA 4JK1X 3FK7A 4I01A 1TT5B 5IT9K 1U5TA 3CUQA 1ZGAA 3FXKA 4M3DA 4XICA 3FBIB 3I9V2 2ZO4A 1AWCA 1PJRA 2QSGX 1R4NB 3FHNA 2F5CA 3NWTA 2P7CB 5FD5A 2M45A 4XN0A 5F0HA 5JI6A 1KONA 4M9XA 4U0YA 3JRHA 1JI8A 1T0FC 1JT0A 4MEYF 1R1VA 2JMWA 2D5VA 3G1OA 5L3BA 2YS9A 4ENKA 3BPVA 4IHXA 3IWFA 2GQQA 3W2WA 4MTDA 1ZR4A 2HGCA 5TJJA 4D7MA 3QYEA 3DLAA 2RKHA 3MWMA 4CICA 1MBKA 2RNGA 3ZN1A 1H9GA 4JYKA 4FHTA 4BJ5C 2WC2A 4PDKA 2PEXA 2XF7A 1CF7B 2IA2A 2DT5A 4WF2A 4L18B 5JHUA 3ONQA 4WX9A 4Y52J 2LF8A 3JTHA 1L3LA 1W5CC 4ZYDA 1MMAA 3DBLB 3L2RA 9ANTA 4GYGA 3CTAA 2EZLA 3S1NJ 1BI1A 4DBRA 4ZYGA 1ETYA 1HW1A 4JOMA 3OOUA 2V1NA 4ESFA 2PFBA 2WY8Q 4XLCA 4LD5A 1IV8A 3TQNA 1FWZA 1WI9A 5KAFC 2Z9OA 3P5JA 2JSCA 5FLVA 2P6SA 2Y69H 1P7IA 1Y8QB 2O8KA 5DD8A 4FX4A 3E5QA 3ZOBA 2KJCA 4EQQA 2X6WA 3JW4A 4C3HJ 2CFXA 3KYCB 3MQ0A 1XMAA 3VYUB 1WCMJ 1LNWA 4HEA2 3TO6A 4BNCA 3BCBA 5E8GA 5EZGA 1ZQ3P 3BR3A 3SXYA 1Z9CA 1ETWA 3HB9A 4Y33A 2M5WA 2Y9YA 1SAXA 4PJMA 2F4OB 2DFEA 1OQYA 1X1CA 5HDNA 4ASNA 5IP7J 5GTHC 4M71A 2L7ZA 4RB3C 4XR6A 3FXOA 5DTDA 1D0XA 2QENA 3DKWA 5LBQA 4RGXA 2STWA 3E5UA 2NNYA 2PMHA 3PUBA 4PFOA 2BGCA 4D5FA 5F0FA 5H2FC 3A0BC 4LLGF 1XGOA 4UVBA 5DV5A 5IYDJ 3OYFA 2HQ5A 3DF8A 5JLXA 2K9QA 3PO3J 2CG4A 3H36A 3ERMA 5KK1A 3ZMUA 3IRQA 2BY3A 1UZCA 1KQ8A 3KZIC 3GFMA 3CCYA 2R7OA 1GDTA 2Z2SB 2ZMEA 3CLOA 4D0PA 3PNYA 2K4JA 3EUHA 3WU1B 3RPUD 2W4SA 2BHZA 3AG1H 2ME0A 3HOYJ 3N4MA 1EJ9A 2L9VA 2DN0A 4UNOA 1BJAA 2ZXHA 1LEAA 1UG2A 4L5EA 3W6JB 2LH9A 5DYMA 3ECHA 1LE8B 3KP7A 1Z67A 3VDXA 2X1CA 4XRFA 1QVTA 3WTVC 3R4KA 1R5GA 2QWWA 1HXDA 3ZGKA 4J19A 3OMYA 4BUPA 1X4PA 4DIQA 3IV5A 1R36A 2UUZA 4II3A 2EZHA 4BGDA 1FNNA 2F5EA 4HBLA 2HDCA 1D3YA 2ZFUA 4CH7A 4G9YA 4XKVA 5BNGA 4GCVA 3KYLA 1VQ5I 4LLNA 2IP2A 3KX2A 2XV4S 3HGGA 3HOVJ 4P9UA 2K4BA 3PUFA 5J6XA 1IGNA 4S04A 2CQ7A 4FE7A 4E7IA 4LIUA 4XOPA 2TCTA 3RYPA 2HPMA 1TNSA 3H5AA 4K2EA 2DA6A 4OWRB 3K70D 4MEXF 4M6VA 5HS7A 1OMIA 1D8KA 4A0ZA 2IGKA 4A2UA 2K9MA 2MBFA 3GYHX 1DP7P 2LY9A 3TEDA 4A3JJ 4A69C 3H3VK 2OC6A 2GXGA 1WKMA 2DW4A 2EK5A 1P4WA 1U3EM 3GUDA 1XMKA 3OYMA 5CVJA 3TBIA 3GTMJ 3CQZJ 1IUFA 1RI7A 2W24A 2Y0MA 3K9TA 3OS2A 3D1NI 1JUPA 1LFBA 3I54A 1E3PA 3PQJA 4ZZLA 2EPFA 1OYWA 2JPBA 2KFDA 3S1MJ 1DP3A 3SHFA 3OWTA 2VUMJ 2MLKA 1V5EA 1X3UA 3OSFA 4NDLA 5JR3A 1IRGA 1MNDA 2V1DA 2JRMA 3GXOA 5IPAA 1B9NA 2AO9A 4CO8A 1RR8C 2RV8A 2L4MA 4MQVA 2WA0A 3K4JA 1S6LA 2CQNA 3F0CA 1GT0C 4KN4X 2VBWA 1LKXA 5DD4A 4AIHA 3VOEA 1RKTA 3E6BA 2CO5A 5CKTA 3SEQA 1YRNA 1R1TA 4YFKF 4IXAA 5E79C 5IT3A 4XSXF 3JREA 4XM3A 1E17A 4WK8F 2PBIA 2KRFA 4MTEA 2GBYA 3GO5A 3I4PA 4HV5A 1V5GA 3WGGA 3ZQQA 1UHSA 4MQ9F 2YX7A 1X3WB 2O5RA 3OS1A 5EEGA 4NBQA 1FP2A 3ML6A 3L9FA 4E4HA 2XDVA 4WCGA 4HAMA 3TO9A 2R5ZA 1DPRA 2LK2A 3C2GA 5GTIC 3BQZA 1RETA 1BA5A 2M9HA 1SFKA 4XN3A 4KDPA 1W36C 1BIAA 1OCPA 4Y13A 1YI2I 1JKPC 2W25A 5C4JJ 3L2UA 3ZPLA 4YFXF 4BKXA 3BCAA 3S3MA 2UZKA 4H4KC 5EEHA 4LB5A 3FISA 4G7ZF 3A2KA 2PG4A 5KAIC 4UVCA 3ZMDA 4AD9A 4LITA 2QVOA 1ZHFA 3HSEA 4E7JA 3TL4X 3MKYB 2LKPA 4CUGA 2F5FA 2DMNA 4W1UA 1KYWA 1ETOA 2O6GE 3CUQB 1I27A 3JRIA 1WWXA 4A3LJ 5EYRA 2CUJA 2XRLA 5M3FJ 3IAM2 3U1KA 2ZMEC 1IAWA 1QNTA 3CF2A 3M8EA 3W2AA 3G1MA 3DPTA 1DPUA 2OCCH 1ZYRF 1OR7A 3RPUA 1FYKA
chains in the Genus database with same CATH topology
3COAC 2Z5UA 5BQTA 4NHJA 3ZP5A 2NAZA 2ZCWA 3ULQB 1G6NA 3KZZA 4ENMA 4HV6A 2LF7A 1B4AA 4DNCA 2L54A 3MZYA 1EH8A 1HSTA 3LFKA 4H0EA 1YG2A 1TQMA 2Q0OA 2FMLA 3QAHA 3SZPA 5KVRA 4G6DA 4MNUA 2RC4A 1UB9A 4AWXB 5E8IA 4Q5SF 2HKOA 4IRGA 3L7WA 4ESJA 2A6HF 1XCVA 1MDMA 1XDSA 4RB1A 3ECOA 3GX4X 3K2ZA 3I71A 1SFXA 1FYMA 1J2XA 3GFJA 4FT8A 2PI0A 1IXSB 3J7AO 1U5TC 4EGZA 2CWEA 5E1ZB 3HUGA 1J75A 3FF5A 4A0XA 3H92A 2DQRA 2VONA 3WG9A 1V3FA 1P4AA 2YSRA 1IN5A 1YO5C 3WGIA 1JXSA 2IT0A 1HW2A 3C3WA 1XGSA 1TW3A 4E70A 4ENNA 4BXUA 3JSPA 5HVQC 3RJPA 4BAYA 1FSEA 3D5LA 3R60A 1U78A 2G7HA 4A5MA 2DAOA 3IL2A 1DUXC 5D5VB 2EV0A 1U2WA 2ACJA 1HSJA 2XAJA 3ZMSA 2DU9A 4IHSA 2DTRA 3RKXA 2GXBA 5FGMA 5ICCA 3JAMK 2OD5A 2MH9A 4M73A 4OOIA 2FBIA 1TLHB 2FSWA 3REOA 1T38A 5ED4A 3CUOA 1S7AA 1JHFA 2FA5A 1QPMA 2L02A 4G94A 1QO0D 1QGPA 5JFRA 4HYEA 2XIGA 2R3SA 3B73A 1XGNA 4XLNF 3H3UA 1V4RA 2FMYA 2CW0F 1ONVA 3KZYA 4YIFA 1IN7A 1BOAA 3WE3A 2TDXA 4GXOA 1IRFA 2E1NA 4M6YA 3O2PE 1IN4A 1D8JA 2PJPA 4G7OF 2X0LA 4KNYA 3CJNA 4B8XA 1KU7A 3HHHA 3EETA 1MGTA 4UV8A 2GAUA 2PQ8A 5DCMA 2ADUA 1YS6A 4Q47A 1G4DA 2COMA 3FM5A 1Y0UA 2BV6A 1NHAA 1MJ9A 1O7FA 1K78A 3LQQA 4A0YA 4OIRF 1XDUA 3L09A 3HHGA 1ZG3A 4QWQA 4N9HA 2IW5A 2D1HA 4KA4A 3TO7A 2FE3A 4HZFA 2GIVA 3QP6A 4R79A 3CO7C 2OU2A 2VE8A 5HS9A 1E2XA 1OKRA 2DLLA 2EA4A 3Q9SA 2CYYA 4U7BA 2EFNA 1SFEA 1S8NA 4A12A 1ULYA 3ZMZA 4HX7A 4NQWA 4CZZA 2AXLA 4KIBA 3EQLF 4RS8A 1Z91A 2FXAA 5H6QA 3L00A 4OIOF 4G8XA 1BI2A 3I58A 1UHMA 4WXDA 3VB2A 5K1YA 2DFIA 2OQRA 1ZN2A 4GYIA 3ROUA 4RAYA 1LVAA 1MDMB 5HLGA 4Y17A 1XB4A 2K27A 2YX4A 4BHBA 2XVCA 2E7WA 1R22A 2VT3A 2HEOA 4LK0F 1KYZA 2XAQA 5HLHA 2GZWA 1IN8A 4EV0A 3FXQA 3ZMTA 2DBBA 1ZREA 1GXPA 2IA0A 2VT2A 1BI3A 4U7DA 2XAFA 2RQPA 4CXFA 2J5OA 3ZN0A 5K5QA 2QLZA 4GGGA 5AIQA 1CF7A 1WRJA 1YLFA 3F6VA 2HS5A 1L0OC 1ZG5A 5FO5A 2MH2A 3VEPA 1TBXA 1HW5A 3GWZA 4EJTA 1LDJA 3S2WA 3ABTA 2KJBA 3M9AA 3T8TA 4HF1A 2GA1A 4Y15A 3BZ6A 4RGSA 1KA8A 1MJAA 3SZTA 3F8MA 4N9IA 5HDGA 1A04A 5BPDA 2P4WA 1K6OA 1F1ZA 3BWGA 4KIGA 2V1UA 3EYIA 2DK5A 4HA8A 2FF4A 3T5XA 1EV7A 2KIFA 4EJUA 3QRFF 2DPUA 5FFXA 2MA3A 4PZJA 4RGRA 4LG0A 1U8RA 3RTRA 1TQPA 2WV0A 4WWCA 2IRFG 4IVNA 2K7LA 1HKQA 1R5HA 3BP8A 2EWNA 3T0YA 2ETHA 1DDNA 2RNJA 4L9JA 1J59A 3P9CA 3KETA 1YQAA 2W85A 1FBUA 2BYVE 3WTYC 5FD6A 3M1EA 2XAHA 1XD7A 3RDIA 1IN6A 1VTNC 5CVRA 3TDUC 2OZ6A 2P6TA 1F5TA 2JPCA 3E97A 3FMRA 1W5SA 5L3DA 4KMFA 1XCBA 1JE8A 4PCQA 3GEZA 2E1CA 3DPLC 5L3CA 2XGXA 1R7JA 3RKYA 3TGNA 1OPCA 1QQIA 4L5IA 1JGSA 2ZNYA 4XLPF 5ILSA 4HX4A 3DEUA 4IJAA 1C0WA 4I02A 1ZAOA 2B0LA 4ETSA 2M1BA 1H9TA 2VE9A 2NNNA 1B9MA 2ZMEB 5LGUA 1IZ1A 5LLQA 2O0YA 3BDDA 3RIRA 1FSHA 3V7CA 3GZ5A 5DCFA 4I2OA 1J7KA 1O3QA 2FU4A 2NS0A 3BPXA 3Q5FA 1K7AA 3GLXA 5CYVA 3I64A 4UV9A 4HQEA 1U5TB 3TOAA 4CGZA 3FM3A 2PN6A 1BM9A 4IRIA 6PAXA 1SMYF 3P9KA 2PMUA 3QPTA 2EFWA 3WTWC 5JVTA 3PFIA 1F4KA 3SQNA 3V7RA 1OYIA 3B02A 4EM0B 4L5JA 2MLGA 3F72A 5BMZA 3I59A 2ZJ2A 1USTA 4IHTA 3GFIA 1QZYA 3M7GA 1P4XA 2BEOA 5J8FA 1BC7C 1ZGJA 1T39A 2XAGA 4B09A 4M6XA 2XKPA 4P96A 3GF2A 1RUOA 2O8XA 1IUYA 2XROA 5DUKA 1ZLKA 1XN7A 2FBKA 3J81K 4RGUA 5F6FA 1GHCA 1FBSA 2MD5A 3NQOA 5E17F 3K1NA 1XSVA 4LK1F 1IXRC 3KLNA 1QBJA 2GA2A 2XASA 2R7FA 2A6EF 2Z33A 3KFWX 1FPQA 3V7SA 1G3YA 3HRMA 3MFKA 3LAPA 1USSA 4XSZF 4MGRA 3KLOA 4YIIA 4EM2A 3WTSC 2AS5F 2H94A 2M87A 2A5YB 2HFHA 1EH7A 3P9IA 4AIKA 4BHPA 3KEQA 2L4AA 2ESHA 1GXQA 1ZRFA 2D2WA 4P9FA 2QQBA 1MKMA 4L9NA 2BE5F 5BPIA 1ZH5A 1WQ2A 1KU3A 3GVAA 1G3TA 5E18F 4BH9A 2FOKA 4BQAA 2L3DA 3BJ6A 3O3KA 2QUFA 4Q48A 2F5DA 3W6KB 5CVIA 4HF0A 4S05A 4LB6B 3ERED 4AVPA 4AIJA 1BN5A 1IXCA 2RVCA 3Q9VA 3BROA 4BYYA 3F23A 4KT5C 3HRTA 3QU6A 2JZYA 3QU3A 4IF4A 3I59B 3E6CC 1FT9A 3NEUA 5DUIA 1KGSA 3KP4A 2G7UA 4CHUA 2LSOA 4XBFA 1J9IA 2A61A 3KEOA 2A3SA 4I98B 3MCZA 2FEZA 3HRUA 1UCRA 1FC3A 4FX0A 2QM3A 1KU9A 3JAMZ 1LDDA 3IWZA 4YG2F 1P6RA 2X4HA 4ZYEA 5F64A 2J5PA 2EJRA 2K86A 3R6SA 4M9ZA 2RGVA 2QQ9A 1TW2A 1R1UA 1HKSA 3C7JA 2Z3YA 4UUVA 1CGPA 2L01A 3FX3A 4O3MA 4A5NA 2YR2A 1SD4A 5AIPA 1U6GA 1MZBA 1YW9A 2H09A 4KN7X 3J80Z 5HLIA 3WTZA 3VFZA 2IA1A 1HQCA 5LEJA 2HQNA 1H0MA 3F22A 4UVAA 4KICA 2CGPA 4JQFA 3P7NA 4OINF 4O5VA 5D4RA 1QZZA 3K69A 2ZNZA 2WTEA 3FMSA 3MEXA 1T2KA 1FLIA 2P5VA 3ZMVA 3H3ZA 5LRSA 3O6BB 4I7HA 3HOSA 2QQAA 1R23A 2O3FA 1FBQA 5CLSA 3F8NA 3G73A 4I0BA 4PGGA 4ESBA 5D5UB 2VODA 5D6EA 3MZHA 1O3TA 3BOQA 3I5UA 4HQMA 2VBXA 4LMYA 3IKVA 4HOBA 5TRDA 5ILVA 4JBAA 1I1GA 3E6MA 1LJ9A 4ENJA 2VOOA 3U1DA 2DK8A 3IHUA 2HTJA 4EGYA 3E3VA 4I0AA 3WE2A 5D5WB 1ZRDA 2KIUA 1TQIA 1R58A 3I53A 4GO1A 2KKOA 2FNPA 1G3SA 1AOYA 1FX7A 2QBYA 1J5YA 4OIQF 2A69F 1RUNA 2ZBKA 1PP8F 3JSOA 5F1RA 1XSDA 2KIMA 1T98A 3CUQC 3FXUA 5H6RA 3HSRA 2W84A 4KIFA 3M8FA 2D45A 3C1DA 2VC0A 2QZ8A 3DFGA 3J80K 1IF1A 1HBXG 2DPDA 5BS6A 4G7HF 5ICEA 4M74A 2OQGA 4OMYA 4L0YB 3PQKA 3E5XA 2P7VB 1G3WA 1PUEE 5L3GA 1KQ9A 4ON0A 4L9TA 4Z2YA 3E6DA 3LWFA 2ELHA 1W4MA 1ZARA 2NRAC 3T1BA 3WTXC 3KCCA 5HS8A 1ZRCA 5CJ9A 2Z99A 2ZKZA 4ZH4F 5HOOA 4LFUA 5D5XB 2FRHA 4U88A 1BC8C 3GFLA 1XGMA 1F9NA 5E1XA 3LSTA 5LGNA 2OZUA 1KQ0A 1Z6RA 4HLXA 1RNLA 2CSOA 5K5OA 5D8LB 2IJLA 1XSXA 4PGHA 3HTSB 3TDZC 4QLCU 1YIOA 4P55A 1W7PA 4F7ZA 2HR3A 2EA2A 1O3SA 1YFHA 1I1SA 2FBHA 3DXJF 4A6EA 3R61A 2DQLA 2Y75A 3MAJA 2C6YA 1B1BA 1W5TA 3R0JA 4A6DA 1S7OA 1TNTA 3WTUC 5LHGA 3F21A 2Y48A 2HKXA 1P2FA 2VXZA 1D5VA 2R7DA 2UXNA 3F6OA 4RB0A 2XUBA 2OAZA 3HYIA 5A2QZ 4UXNA 1SD6A 3RI4A 2OA4A 3WGHA 4DQ2A 4LG0B 1ON2A 2GWRA 3F8CA 3ABUA 5ICFA 1YW7A 1YS7A 2RN7A 2VOPA 2ZFWA 3QPHA 3EDPA 3KE2A 2H6BA 1YTYA 1SD7A 3BJOA 3N97A 2QYOA 3JTGA 2NYXA 1O57A 1S29A 4LLLA 2IVMA 5L3EA 3ISPA 1FP1D 5D4SA 1STZA 3RKWA 2IPQX 1BBYA 3HOTA 4L0ZB 3IC7A 4L9VA 4KYWA 2PLYA 2MC3A 2V9VA 1REPC 1PDNC 1T0FA 5LEKA 1FYLA 3FHZA 1Z1DA 2HYFA 3K1MA 1S3JA 2DO7A 2H6CA 1UFMA 3D0SA 3HRSA 1PP7U 1P92A 1HKTA 3CO6C 1RZ4A 4HW0A 4EM1A 4N0BA 4G6QA 1O3RA 2EB7A 4BHCA 3LA3A 2F2EA 5J8CA 2JRTA 3V8LA 4LGWA 2EFOA 3K0LA 2A07F 1UHWA 3LQRA 4OMZA 2HQRA 1LDKB 1GVJA 4ZZDA 5CVVA 1FOKA 4I09A 4M72A 1Z7UA 2QBYB 4OU0A 5D6FA 3NRVA 1RIOH 2XKOA 1LB2A 3LA7A 2XRNA 3ELKA 4IPAA 2VN2A 1I6XA 2LDUA 4P5OA 3TOBA 2ZXJA 4EMSA 5FFZA 4EJVA 1LEBA 1K79A 4ZYHA 3RYRA 4CYDA 2P5KA 1SD5A 4R8HA 5IT9Z 3DV8A 4EVIA 2HZTA 1BIBA 2EFQA 2STTA 1YYVA 4UHTA 1WSUA 2VBYA 3DP7A 2DI3A 4Q4ZF 2LNBA 2ESNA 3RPQA 3BJAA 3QP5A 1Q1HA 1MD0A 4NB5A 3OOPA 5E1WA 4U0VA 3FXRA 3OV8A 4HF2A 3R0AA 1FY7A 2HYGD 2O03A 1T6SA 2ISZA 3G3ZA 3DQVC 1IW7F 5DEQA 1YW8A 3LA2A 2P8TA 2YU3A 4WXCA 3V4GA 3IKTA 3SFZA 1ZG1A 4KMUX 3FMQA 2E7XA 2OBPA 5DCMB 5BOXA 4HLYA 5HDKA 3TKYA 1BI0A 3F8BA 2M8EA 2UXXA 3U2RA 2V79A 2V1XA 4HX8A 5LGTA 5FLXZ 5CVUA 1I5ZA 3C18A 3F8FA 3HIFA 2RDPA 2HOEA 3KP5A 4WXHA 1K78B 1TTYA 3IRRA 3WU0A 3J81Z 2G9WA 3K1PA 2JTVA 5LHHA 4R1HA 2M30A 1OYYA 2EV6A 5L3FA 2XHKA 1LQ1A 3I0TA 3QOPA 2P5LC 3HSFA 2VBZA 1KU2A 2CQKA 4HDUA 4HDVA 1B6AA 3KP6A 3EYYA 5AONA 3KP2A 3KP3A 5LHIA 2EFPA 5D8KB 4RAZA 5H20A 1O7LA 1R00A 3V8JA 4MHGA 4TV7A 1MJBA 4LJZF 3T8RA 1ODDA 4M9SA 1W7PD 1ON1A 3HTUA 3WTTC 5K5RA 2YPRA 4KFCA 5FLXK 2W57A 2A68F 4IRHA 1JHHA 2FNAA 3FWEA 5DDGA 3L2CA 1W7PB 2VC1A 2BBYA 1Z05A 4O6JA 2WWYA 3AAFA 3V8KA 1FZPB 5E20A 1EH6A 3WODF 1J0RA 4EJOA 1ZLJA 3U9GA 2K02A 2HTSA 4YFNF 1SMTA 3GW2A 3ZQ7A 4EJWA 4OIPF 3LAJA 2Q2EA 1SFUA 3BY6A 1B59A 5ILUA 3CDHA 2HWVA 5FB2A 5ICGA 4RB2C 4U0WA 3GZ6A 2FQ3A 2EV5A 4KUMA 3F3XA 2D1VA 2O61A 3FZVA 5A2QK 2V6CA 5LRRA 2UWMA 2ISYA 2Q8KA 3VODA 2H27A 1Z6TA 4CDGA 2JT1A 5ERIA 4JK1X 4I01A 5IT9K 1U5TA 3CUQA 1ZGAA 2ZO4A 1AWCA 2F5CA 2P7CB 5FD5A 2M45A 5JI6A 4M9XA 4U0YA 4MEYF 1R1VA 5L3BA 4ENKA 3BPVA 3IWFA 2GQQA 4MTDA 2HGCA 5TJJA 2RKHA 3MWMA 4CICA 3ZN1A 1H9GA 4FHTA 2WC2A 4PDKA 2PEXA 1CF7B 2IA2A 2DT5A 4WF2A 4L18B 5JHUA 4WX9A 2LF8A 3JTHA 1L3LA 4ZYDA 4GYGA 3CTAA 1BI1A 4ZYGA 1HW1A 4ESFA 2PFBA 4LD5A 3TQNA 1FWZA 1WI9A 2Z9OA 2JSCA 2P6SA 5DD8A 4FX4A 3E5QA 2KJCA 4EQQA 3JW4A 2CFXA 3MQ0A 1XMAA 4BNCA 1LNWA 3TO6A 5E8GA 3SXYA 1Z9CA 2M5WA 1SAXA 5HDNA 4ASNA 4M71A 4RB3C 2QENA 3DKWA 5LBQA 4RGXA 2STWA 3E5UA 2NNYA 2PMHA 2BGCA 4LLGF 1XGOA 4UVBA 5DV5A 3DF8A 2CG4A 3IRQA 5KK1A 3ZMUA 1KQ8A 3GFMA 2ZMEA 3CLOA 4D0PA 3WU1B 2K4JA 3EUHA 3N4MA 4UNOA 1BJAA 1LEAA 3W6JB 5DYMA 3ECHA 3KP7A 4XRFA 3WTVC 3R4KA 1R5GA 2QWWA 1HXDA 1R36A 1FNNA 2F5EA 2HDCA 4HBLA 1D3YA 4G9YA 4GCVA 4LLNA 2IP2A 2XV4S 4P9UA 2K4BA 5J6XA 4S04A 3RYPA 1TNSA 4K2EA 4MEXF 5HS7A 1OMIA 1D8KA 4A0ZA 4A2UA 2MBFA 3GYHX 1DP7P 2GXGA 1WKMA 2DW4A 2EK5A 1P4WA 1U3EM 3GUDA 1XMKA 5CVJA 1RI7A 2W24A 2Y0MA 3K9TA 3I54A 3PQJA 4ZZLA 1OYWA 2JPBA 3SHFA 2MLKA 1X3UA 5JR3A 1IRGA 3GXOA 2V1DA 1B9NA 4CO8A 2RV8A 2L4MA 4MQVA 1S6LA 4KN4X 2VBWA 5DD4A 4AIHA 3VOEA 3E6BA 2CO5A 1R1TA 4YFKF 4IXAA 5IT3A 4XSXF 1E17A 4WK8F 2PBIA 2KRFA 4MTEA 3GO5A 3WGGA 3I4PA 4HV5A 4MQ9F 2YX7A 5EEGA 1FP2A 3ML6A 3L9FA 4WCGA 4HAMA 3TO9A 1DPRA 4KDPA 1BIAA 4Y13A 2W25A 3ZPLA 4YFXF 2UZKA 5EEHA 4LB5A 4G7ZF 2PG4A 4UVCA 3ZMDA 4AD9A 2QVOA 1ZHFA 3HSEA 2LKPA 2F5FA 1KYWA 2O6GE 3CUQB 1I27A 1WWXA 1IAWA 1QNTA 3M8EA 3DPTA 1DPUA 1ZYRF 1OR7A 3RPUA 1FYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3COA C;  2Z5U A;  5BQT A;  4NHJ A;  3ZP5 A;  2NAZ A;  2ZCW A;  3ULQ B;  1G6N A;  3KZZ A;  4ENM A;  4HV6 A;  2LF7 A;  1B4A A;  4DNC A;  2L54 A;  3MZY A;  1EH8 A;  1HST A;  3LFK A;  4H0E A;  1YG2 A;  1TQM A;  2Q0O A;  2FML A;  3QAH A;  3SZP A;  5KVR A;  4G6D A;  4MNU A;  2RC4 A;  1UB9 A;  4AWX B;  5E8I A;  4Q5S F;  2HKO A;  4IRG A;  3L7W A;  4ESJ A;  2A6H F;  1XCV A;  1MDM A;  1XDS A;  4RB1 A;  3ECO A;  3GX4 X;  3K2Z A;  3I71 A;  1SFX A;  1FYM A;  1J2X A;  3GFJ A;  4FT8 A;  2PI0 A;  1IXS B;  3J7A O;  1U5T C;  4EGZ A;  2CWE A;  5E1Z B;  3HUG A;  1J75 A;  3FF5 A;  4A0X A;  3H92 A;  2DQR A;  2VON A;  3WG9 A;  1V3F A;  1P4A A;  2YSR A;  1IN5 A;  1YO5 C;  3WGI A;  1JXS A;  2IT0 A;  1HW2 A;  3C3W A;  1XGS A;  1TW3 A;  4E70 A;  4ENN A;  4BXU A;  3JSP A;  5HVQ C;  3RJP A;  4BAY A;  1FSE A;  3D5L A;  3R60 A;  1U78 A;  2G7H A;  4A5M A;  2DAO A;  3IL2 A;  1DUX C;  5D5V B;  2EV0 A;  1U2W A;  2ACJ A;  1HSJ A;  2XAJ A;  3ZMS A;  2DU9 A;  4IHS A;  2DTR A;  3RKX A;  2GXB A;  5FGM A;  5ICC A;  3JAM K;  2OD5 A;  2MH9 A;  4M73 A;  4OOI A;  2FBI A;  1TLH B;  2FSW A;  3REO A;  1T38 A;  5ED4 A;  3CUO A;  1S7A A;  1JHF A;  2FA5 A;  1QPM A;  2L02 A;  4G94 A;  1QO0 D;  1QGP A;  5JFR A;  4HYE A;  2XIG A;  2R3S A;  3B73 A;  1XGN A;  4XLN F;  3H3U A;  1V4R A;  2FMY A;  2CW0 F;  1ONV A;  3KZY A;  4YIF A;  1IN7 A;  1BOA A;  3WE3 A;  2TDX A;  4GXO A;  1IRF A;  2E1N A;  4M6Y A;  3O2P E;  1IN4 A;  1D8J A;  2PJP A;  4G7O F;  2X0L A;  4KNY A;  3CJN A;  4B8X A;  1KU7 A;  3HHH A;  3EET A;  1MGT A;  4UV8 A;  2GAU A;  2PQ8 A;  5DCM A;  2ADU A;  1YS6 A;  4Q47 A;  1G4D A;  2COM A;  3FM5 A;  1Y0U A;  2BV6 A;  1NHA A;  1MJ9 A;  1O7F A;  1K78 A;  3LQQ A;  4A0Y A;  4OIR F;  1XDU A;  3L09 A;  3HHG A;  1ZG3 A;  4QWQ A;  4N9H A;  2IW5 A;  2D1H A;  4KA4 A;  3TO7 A;  2FE3 A;  4HZF A;  2GIV A;  3QP6 A;  4R79 A;  3CO7 C;  2OU2 A;  2VE8 A;  5HS9 A;  1E2X A;  1OKR A;  2DLL A;  2EA4 A;  3Q9S A;  2CYY A;  4U7B A;  2EFN A;  1SFE A;  1S8N A;  4A12 A;  1ULY A;  3ZMZ A;  4HX7 A;  4NQW A;  4CZZ A;  2AXL A;  4KIB A;  3EQL F;  4RS8 A;  1Z91 A;  2FXA A;  5H6Q A;  3L00 A;  4OIO F;  4G8X A;  1BI2 A;  3I58 A;  1UHM A;  4WXD A;  3VB2 A;  5K1Y A;  2DFI A;  2OQR A;  1ZN2 A;  4GYI A;  3ROU A;  4RAY A;  1LVA A;  1MDM B;  5HLG A;  4Y17 A;  1XB4 A;  2K27 A;  2YX4 A;  4BHB A;  2XVC A;  2E7W A;  1R22 A;  2VT3 A;  2HEO A;  4LK0 F;  1KYZ A;  2XAQ A;  5HLH A;  2GZW A;  1IN8 A;  4EV0 A;  3FXQ A;  3ZMT A;  2DBB A;  1ZRE A;  1GXP A;  2IA0 A;  2VT2 A;  1BI3 A;  4U7D A;  2XAF A;  2RQP A;  4CXF A;  2J5O A;  3ZN0 A;  5K5Q A;  2QLZ A;  4GGG A;  5AIQ A;  1CF7 A;  1WRJ A;  1YLF A;  3F6V A;  2HS5 A;  1L0O C;  1ZG5 A;  5FO5 A;  2MH2 A;  3VEP A;  1TBX A;  1HW5 A;  3GWZ A;  4EJT A;  1LDJ A;  3S2W A;  3ABT A;  2KJB A;  3M9A A;  3T8T A;  4HF1 A;  2GA1 A;  4Y15 A;  3BZ6 A;  4RGS A;  1KA8 A;  1MJA A;  3SZT A;  3F8M A;  4N9I A;  5HDG A;  1A04 A;  5BPD A;  2P4W A;  1K6O A;  1F1Z A;  3BWG A;  4KIG A;  2V1U A;  3EYI A;  2DK5 A;  4HA8 A;  2FF4 A;  3T5X A;  1EV7 A;  2KIF A;  4EJU A;  3QRF F;  2DPU A;  5FFX A;  2MA3 A;  4PZJ A;  4RGR A;  4LG0 A;  1U8R A;  3RTR A;  1TQP A;  2WV0 A;  4WWC A;  2IRF G;  4IVN A;  2K7L A;  1HKQ A;  1R5H A;  3BP8 A;  2EWN A;  3T0Y A;  2ETH A;  1DDN A;  2RNJ A;  4L9J A;  1J59 A;  3P9C A;  3KET A;  1YQA A;  2W85 A;  1FBU A;  2BYV E;  3WTY C;  5FD6 A;  3M1E A;  2XAH A;  1XD7 A;  3RDI A;  1IN6 A;  1VTN C;  5CVR A;  3TDU C;  2OZ6 A;  2P6T A;  1F5T A;  2JPC A;  3E97 A;  3FMR A;  1W5S A;  5L3D A;  4KMF A;  1XCB A;  1JE8 A;  4PCQ A;  3GEZ A;  2E1C A;  3DPL C;  5L3C A;  2XGX A;  1R7J A;  3RKY A;  3TGN A;  1OPC A;  1QQI A;  4L5I A;  1JGS A;  2ZNY A;  4XLP F;  5ILS A;  4HX4 A;  3DEU A;  4IJA A;  1C0W A;  4I02 A;  1ZAO A;  2B0L A;  4ETS A;  2M1B A;  1H9T A;  2VE9 A;  2NNN A;  1B9M A;  2ZME B;  5LGU A;  1IZ1 A;  5LLQ A;  2O0Y A;  3BDD A;  3RIR A;  1FSH A;  3V7C A;  3GZ5 A;  5DCF A;  4I2O A;  1J7K A;  1O3Q A;  2FU4 A;  2NS0 A;  3BPX A;  3Q5F A;  1K7A A;  3GLX A;  5CYV A;  3I64 A;  4UV9 A;  4HQE A;  1U5T B;  3TOA A;  4CGZ A;  3FM3 A;  2PN6 A;  1BM9 A;  4IRI A;  6PAX A;  1SMY F;  3P9K A;  2PMU A;  3QPT A;  2EFW A;  3WTW C;  5JVT A;  3PFI A;  1F4K A;  3SQN A;  3V7R A;  1OYI A;  3B02 A;  4EM0 B;  4L5J A;  2MLG A;  3F72 A;  5BMZ A;  3I59 A;  2ZJ2 A;  1UST A;  4IHT A;  3GFI A;  1QZY A;  3M7G A;  1P4X A;  2BEO A;  5J8F A;  1BC7 C;  1ZGJ A;  1T39 A;  2XAG A;  4B09 A;  4M6X A;  2XKP A;  4P96 A;  3GF2 A;  1RUO A;  2O8X A;  1IUY A;  2XRO A;  5DUK A;  1ZLK A;  1XN7 A;  2FBK A;  3J81 K;  4RGU A;  5F6F A;  1GHC A;  1FBS A;  2MD5 A;  3NQO A;  5E17 F;  3K1N A;  1XSV A;  4LK1 F;  1IXR C;  3KLN A;  1QBJ A;  2GA2 A;  2XAS A;  2R7F A;  2A6E F;  2Z33 A;  3KFW X;  1FPQ A;  3V7S A;  1G3Y A;  3HRM A;  3MFK A;  3LAP A;  1USS A;  4XSZ F;  4MGR A;  3KLO A;  4YII A;  4EM2 A;  3WTS C;  2AS5 F;  2H94 A;  2M87 A;  2A5Y B;  2HFH A;  1EH7 A;  3P9I A;  4AIK A;  4BHP A;  3KEQ A;  2L4A A;  2ESH A;  1GXQ A;  1ZRF A;  2D2W A;  4P9F A;  2QQB A;  1MKM A;  4L9N A;  2BE5 F;  5BPI A;  1ZH5 A;  1WQ2 A;  1KU3 A;  3GVA A;  1G3T A;  5E18 F;  4BH9 A;  2FOK A;  4BQA A;  2L3D A;  3BJ6 A;  3O3K A;  2QUF A;  4Q48 A;  2F5D A;  3W6K B;  5CVI A;  4HF0 A;  4S05 A;  4LB6 B;  3ERE D;  4AVP A;  4AIJ A;  1BN5 A;  1IXC A;  2RVC A;  3Q9V A;  3BRO A;  4BYY A;  3F23 A;  4KT5 C;  3HRT A;  3QU6 A;  2JZY A;  3QU3 A;  4IF4 A;  3I59 B;  3E6C C;  1FT9 A;  3NEU A;  5DUI A;  1KGS A;  3KP4 A;  2G7U A;  4CHU A;  2LSO A;  4XBF A;  1J9I A;  2A61 A;  3KEO A;  2A3S A;  4I98 B;  3MCZ A;  2FEZ A;  3HRU A;  1UCR A;  1FC3 A;  4FX0 A;  2QM3 A;  1KU9 A;  3JAM Z;  1LDD A;  3IWZ A;  4YG2 F;  1P6R A;  2X4H A;  4ZYE A;  5F64 A;  2J5P A;  2EJR A;  2K86 A;  3R6S A;  4M9Z A;  2RGV A;  2QQ9 A;  1TW2 A;  1R1U A;  1HKS A;  3C7J A;  2Z3Y A;  4UUV A;  1CGP A;  2L01 A;  3FX3 A;  4O3M A;  4A5N A;  2YR2 A;  1SD4 A;  5AIP A;  1U6G A;  1MZB A;  1YW9 A;  2H09 A;  4KN7 X;  3J80 Z;  5HLI A;  3WTZ A;  3VFZ A;  2IA1 A;  1HQC A;  5LEJ A;  2HQN A;  1H0M A;  3F22 A;  4UVA A;  4KIC A;  2CGP A;  4JQF A;  3P7N A;  4OIN F;  4O5V A;  5D4R A;  1QZZ A;  3K69 A;  2ZNZ A;  2WTE A;  3FMS A;  3MEX A;  1T2K A;  1FLI A;  2P5V A;  3ZMV A;  3H3Z A;  5LRS A;  3O6B B;  4I7H A;  3HOS A;  2QQA A;  1R23 A;  2O3F A;  1FBQ A;  5CLS A;  3F8N A;  3G73 A;  4I0B A;  4PGG A;  4ESB A;  5D5U B;  2VOD A;  5D6E A;  3MZH A;  1O3T A;  3BOQ A;  3I5U A;  4HQM A;  2VBX A;  4LMY A;  3IKV A;  4HOB A;  5TRD A;  5ILV A;  4JBA A;  1I1G A;  3E6M A;  1LJ9 A;  4ENJ A;  2VOO A;  3U1D A;  2DK8 A;  3IHU A;  2HTJ A;  4EGY A;  3E3V A;  4I0A A;  3WE2 A;  5D5W B;  1ZRD A;  2KIU A;  1TQI A;  1R58 A;  3I53 A;  4GO1 A;  2KKO A;  2FNP A;  1G3S A;  1AOY A;  1FX7 A;  2QBY A;  1J5Y A;  4OIQ F;  2A69 F;  1RUN A;  2ZBK A;  1PP8 F;  3JSO A;  5F1R A;  1XSD A;  2KIM A;  1T98 A;  3CUQ C;  3FXU A;  5H6R A;  3HSR A;  2W84 A;  4KIF A;  3M8F A;  2D45 A;  3C1D A;  2VC0 A;  2QZ8 A;  3DFG A;  3J80 K;  1IF1 A;  1HBX G;  2DPD A;  5BS6 A;  4G7H F;  5ICE A;  4M74 A;  2OQG A;  4OMY A;  4L0Y B;  3PQK A;  3E5X A;  2P7V B;  1G3W A;  1PUE E;  5L3G A;  1KQ9 A;  4ON0 A;  4L9T A;  4Z2Y A;  3E6D A;  3LWF A;  2ELH A;  1W4M A;  1ZAR A;  2NRA C;  3T1B A;  3WTX C;  3KCC A;  5HS8 A;  1ZRC A;  5CJ9 A;  2Z99 A;  2ZKZ A;  4ZH4 F;  5HOO A;  4LFU A;  5D5X B;  2FRH A;  4U88 A;  1BC8 C;  3GFL A;  1XGM A;  1F9N A;  5E1X A;  3LST A;  5LGN A;  2OZU A;  1KQ0 A;  1Z6R A;  4HLX A;  1RNL A;  2CSO A;  5K5O A;  5D8L B;  2IJL A;  1XSX A;  4PGH A;  3HTS B;  3TDZ C;  4QLC U;  1YIO A;  4P55 A;  1W7P A;  4F7Z A;  2HR3 A;  2EA2 A;  1O3S A;  1YFH A;  1I1S A;  2FBH A;  3DXJ F;  4A6E A;  3R61 A;  2DQL A;  2Y75 A;  3MAJ A;  2C6Y A;  1B1B A;  1W5T A;  3R0J A;  4A6D A;  1S7O A;  1TNT A;  3WTU C;  5LHG A;  3F21 A;  2Y48 A;  2HKX A;  1P2F A;  2VXZ A;  1D5V A;  2R7D A;  2UXN A;  3F6O A;  4RB0 A;  2XUB A;  2OAZ A;  3HYI A;  5A2Q Z;  4UXN A;  1SD6 A;  3RI4 A;  2OA4 A;  3WGH A;  4DQ2 A;  4LG0 B;  1ON2 A;  2GWR A;  3F8C A;  3ABU A;  5ICF A;  1YW7 A;  1YS7 A;  2RN7 A;  2VOP A;  2ZFW A;  3QPH A;  3EDP A;  3KE2 A;  2H6B A;  1YTY A;  1SD7 A;  3BJO A;  3N97 A;  2QYO A;  3JTG A;  2NYX A;  1O57 A;  1S29 A;  4LLL A;  2IVM A;  5L3E A;  3ISP A;  1FP1 D;  5D4S A;  1STZ A;  3RKW A;  2IPQ X;  1BBY A;  3HOT A;  4L0Z B;  3IC7 A;  4L9V A;  4KYW A;  2PLY A;  2MC3 A;  2V9V A;  1REP C;  1PDN C;  1T0F A;  5LEK A;  1FYL A;  3FHZ A;  1Z1D A;  2HYF A;  3K1M A;  1S3J A;  2DO7 A;  2H6C A;  1UFM A;  3D0S A;  3HRS A;  1PP7 U;  1P92 A;  1HKT A;  3CO6 C;  1RZ4 A;  4HW0 A;  4EM1 A;  4N0B A;  4G6Q A;  1O3R A;  2EB7 A;  4BHC A;  3LA3 A;  2F2E A;  5J8C A;  2JRT A;  3V8L A;  4LGW A;  2EFO A;  3K0L A;  2A07 F;  1UHW A;  3LQR A;  4OMZ A;  2HQR A;  1LDK B;  1GVJ A;  4ZZD A;  5CVV A;  1FOK A;  4I09 A;  4M72 A;  1Z7U A;  2QBY B;  4OU0 A;  5D6F A;  3NRV A;  1RIO H;  2XKO A;  1LB2 A;  3LA7 A;  2XRN A;  3ELK A;  4IPA A;  2VN2 A;  1I6X A;  2LDU A;  4P5O A;  3TOB A;  2ZXJ A;  4EMS A;  5FFZ A;  4EJV A;  1LEB A;  1K79 A;  4ZYH A;  3RYR A;  4CYD A;  2P5K A;  1SD5 A;  4R8H A;  5IT9 Z;  3DV8 A;  4EVI A;  2HZT A;  1BIB A;  2EFQ A;  2STT A;  1YYV A;  4UHT A;  1WSU A;  2VBY A;  3DP7 A;  2DI3 A;  4Q4Z F;  2LNB A;  2ESN A;  3RPQ A;  3BJA A;  3QP5 A;  1Q1H A;  1MD0 A;  4NB5 A;  3OOP A;  5E1W A;  4U0V A;  3FXR A;  3OV8 A;  4HF2 A;  3R0A A;  1FY7 A;  2HYG D;  2O03 A;  1T6S A;  2ISZ A;  3G3Z A;  3DQV C;  1IW7 F;  5DEQ A;  1YW8 A;  3LA2 A;  2P8T A;  2YU3 A;  4WXC A;  3V4G A;  3IKT A;  3SFZ A;  1ZG1 A;  4KMU X;  3FMQ A;  2E7X A;  2OBP A;  5DCM B;  5BOX A;  4HLY A;  5HDK A;  3TKY A;  1BI0 A;  3F8B A;  2M8E A;  2UXX A;  3U2R A;  2V79 A;  2V1X A;  4HX8 A;  5LGT A;  5FLX Z;  5CVU A;  1I5Z A;  3C18 A;  3F8F A;  3HIF A;  2RDP A;  2HOE A;  3KP5 A;  4WXH A;  1K78 B;  1TTY A;  3IRR A;  3WU0 A;  3J81 Z;  2G9W A;  3K1P A;  2JTV A;  5LHH A;  4R1H A;  2M30 A;  1OYY A;  2EV6 A;  5L3F A;  2XHK A;  1LQ1 A;  3I0T A;  3QOP A;  2P5L C;  3HSF A;  2VBZ A;  1KU2 A;  2CQK A;  4HDU A;  4HDV A;  1B6A A;  3KP6 A;  3EYY A;  5AON A;  3KP2 A;  3KP3 A;  5LHI A;  2EFP A;  5D8K B;  4RAZ A;  5H20 A;  1O7L A;  1R00 A;  3V8J A;  4MHG A;  4TV7 A;  1MJB A;  4LJZ F;  3T8R A;  1ODD A;  4M9S A;  1W7P D;  1ON1 A;  3HTU A;  3WTT C;  5K5R A;  2YPR A;  4KFC A;  5FLX K;  2W57 A;  2A68 F;  4IRH A;  1JHH A;  2FNA A;  3FWE A;  5DDG A;  3L2C A;  1W7P B;  2VC1 A;  2BBY A;  1Z05 A;  4O6J A;  2WWY A;  3AAF A;  3V8K A;  1FZP B;  5E20 A;  1EH6 A;  3WOD F;  1J0R A;  4EJO A;  1ZLJ A;  3U9G A;  2K02 A;  2HTS A;  4YFN F;  1SMT A;  3GW2 A;  3ZQ7 A;  4EJW A;  4OIP F;  3LAJ A;  2Q2E A;  1SFU A;  3BY6 A;  1B59 A;  5ILU A;  3CDH A;  2HWV A;  5FB2 A;  5ICG A;  4RB2 C;  4U0W A;  3GZ6 A;  2FQ3 A;  2EV5 A;  4KUM A;  3F3X A;  2D1V A;  2O61 A;  3FZV A;  5A2Q K;  2V6C A;  5LRR A;  2UWM A;  2ISY A;  2Q8K A;  3VOD A;  2H27 A;  1Z6T A;  4CDG A;  2JT1 A;  5ERI A;  4JK1 X;  4I01 A;  5IT9 K;  1U5T A;  3CUQ A;  1ZGA A;  2ZO4 A;  1AWC A;  2F5C A;  2P7C B;  5FD5 A;  2M45 A;  5JI6 A;  4M9X A;  4U0Y A;  4MEY F;  1R1V A;  5L3B A;  4ENK A;  3BPV A;  3IWF A;  2GQQ A;  4MTD A;  2HGC A;  5TJJ A;  2RKH A;  3MWM A;  4CIC A;  3ZN1 A;  1H9G A;  4FHT A;  2WC2 A;  4PDK A;  2PEX A;  1CF7 B;  2IA2 A;  2DT5 A;  4WF2 A;  4L18 B;  5JHU A;  4WX9 A;  2LF8 A;  3JTH A;  1L3L A;  4ZYD A;  4GYG A;  3CTA A;  1BI1 A;  4ZYG A;  1HW1 A;  4ESF A;  2PFB A;  4LD5 A;  3TQN A;  1FWZ A;  1WI9 A;  2Z9O A;  2JSC A;  2P6S A;  5DD8 A;  4FX4 A;  3E5Q A;  2KJC A;  4EQQ A;  3JW4 A;  2CFX A;  3MQ0 A;  1XMA A;  4BNC A;  1LNW A;  3TO6 A;  5E8G A;  3SXY A;  1Z9C A;  2M5W A;  1SAX A;  5HDN A;  4ASN A;  4M71 A;  4RB3 C;  2QEN A;  3DKW A;  5LBQ A;  4RGX A;  2STW A;  3E5U A;  2NNY A;  2PMH A;  2BGC A;  4LLG F;  1XGO A;  4UVB A;  5DV5 A;  3DF8 A;  2CG4 A;  3IRQ A;  5KK1 A;  3ZMU A;  1KQ8 A;  3GFM A;  2ZME A;  3CLO A;  4D0P A;  3WU1 B;  2K4J A;  3EUH A;  3N4M A;  4UNO A;  1BJA A;  1LEA A;  3W6J B;  5DYM A;  3ECH A;  3KP7 A;  4XRF A;  3WTV C;  3R4K A;  1R5G A;  2QWW A;  1HXD A;  1R36 A;  1FNN A;  2F5E A;  2HDC A;  4HBL A;  1D3Y A;  4G9Y A;  4GCV A;  4LLN A;  2IP2 A;  2XV4 S;  4P9U A;  2K4B A;  5J6X A;  4S04 A;  3RYP A;  1TNS A;  4K2E A;  4MEX F;  5HS7 A;  1OMI A;  1D8K A;  4A0Z A;  4A2U A;  2MBF A;  3GYH X;  1DP7 P;  2GXG A;  1WKM A;  2DW4 A;  2EK5 A;  1P4W A;  1U3E M;  3GUD A;  1XMK A;  5CVJ A;  1RI7 A;  2W24 A;  2Y0M A;  3K9T A;  3I54 A;  3PQJ A;  4ZZL A;  1OYW A;  2JPB A;  3SHF A;  2MLK A;  1X3U A;  5JR3 A;  1IRG A;  3GXO A;  2V1D A;  1B9N A;  4CO8 A;  2RV8 A;  2L4M A;  4MQV A;  1S6L A;  4KN4 X;  2VBW A;  5DD4 A;  4AIH A;  3VOE A;  3E6B A;  2CO5 A;  1R1T A;  4YFK F;  4IXA A;  5IT3 A;  4XSX F;  1E17 A;  4WK8 F;  2PBI A;  2KRF A;  4MTE A;  3GO5 A;  3WGG A;  3I4P A;  4HV5 A;  4MQ9 F;  2YX7 A;  5EEG A;  1FP2 A;  3ML6 A;  3L9F A;  4WCG A;  4HAM A;  3TO9 A;  1DPR A;  4KDP A;  1BIA A;  4Y13 A;  2W25 A;  3ZPL A;  4YFX F;  2UZK A;  5EEH A;  4LB5 A;  4G7Z F;  2PG4 A;  4UVC A;  3ZMD A;  4AD9 A;  2QVO A;  1ZHF A;  3HSE A;  2LKP A;  2F5F A;  1KYW A;  2O6G E;  3CUQ B;  1I27 A;  1WWX A;  1IAW A;  1QNT A;  3M8E A;  3DPT A;  1DPU A;  1ZYR F;  1OR7 A;  3RPU A;  1FYK A; 
#chains in the Genus database with same CATH topology
 2DJN A;  4C3I J;  3COA C;  1ITY A;  1FOW A;  2Z5U A;  3ZQH A;  5BQT A;  1PYV A;  4RM2 A;  4NHJ A;  5CQE A;  2I5U A;  3ZP5 A;  2NAZ A;  2ZCW A;  3ULQ B;  1G6N A;  3KZZ A;  4ENM A;  2OCE A;  1BW5 A;  2LKX A;  4HV6 A;  1RKW A;  4BXX J;  2LF7 A;  2PJR A;  1B4A A;  4UB6 C;  2LKS A;  4DNC A;  2L54 A;  3MZY A;  1EH8 A;  1HST A;  3LFK A;  3LL7 A;  3AL0 C;  1S9H A;  2KIQ A;  3KEY A;  1N25 A;  2JA6 J;  2ECB A;  2TRT A;  3MN2 A;  3AG3 H;  4H0E A;  1YG2 A;  2XGC A;  1TQM A;  3CLQ A;  2Q0O A;  1ORK A;  1XMX A;  2FML A;  4B43 A;  4DYQ A;  2E71 A;  3QAH A;  3SZP A;  5KVR A;  4B4C A;  3CD6 I;  4G6D A;  2DOA A;  4MNU A;  2RC4 A;  1I39 A;  2W1O A;  2DMQ A;  2V9P A;  1UB9 A;  4LG3 A;  4AWX B;  5E8I A;  1YX3 A;  1PVE A;  2X9D A;  2W00 A;  1W0U A;  4Q5S F;  3IH2 A;  2HKO A;  1MSF C;  3FDY A;  4IRG A;  4E7Z A;  1MNM C;  2BZT A;  3L7W A;  4V2F A;  3HGY A;  1TL8 A;  4PJL A;  4B48 A;  4ESJ A;  4MFD A;  3OYE A;  4F55 A;  2JUC A;  2A6H F;  4ZTJ A;  1XCV A;  1BW6 A;  1MDM A;  2R92 J;  1XDS A;  4RB1 A;  4PUS A;  1A35 A;  3ECO A;  1JKR C;  3GX4 X;  3K2Z A;  2R7X A;  3I71 A;  1SFX A;  5IY5 H;  1FYM A;  1J2X A;  3GFJ A;  2LY2 A;  4FT8 A;  4YIR X;  2EH3 A;  3NAR A;  4AID A;  2F5V A;  1ZTR A;  2KDO A;  2HOA A;  2PI0 A;  1IXS B;  2X6O A;  3J7A O;  2VQH A;  1U5T C;  2DJI A;  1AU7 A;  5F04 A;  4B3X A;  1U8B A;  1MBH A;  3BG5 A;  4EGZ A;  1SVO A;  4ANJ A;  2CWE A;  5E1Z B;  1HF0 A;  3HUG A;  5EDN A;  3A02 A;  2IS6 A;  1J75 A;  3FF5 A;  4A0X A;  1VQO I;  1B8I B;  3H92 A;  2DQR A;  2VON A;  2GXA A;  3WG9 A;  1V3F A;  1P4A A;  2YSR A;  1IN5 A;  3CCL I;  3TW7 A;  2RQQ A;  1Y8R B;  1YO5 C;  3L1P A;  4A93 J;  3WGI A;  1JXS A;  2EQR A;  3RQI A;  3G6E I;  2IT0 A;  1HW2 A;  3A03 A;  3C3W A;  2HVQ A;  1XGS A;  3KYD B;  1TW3 A;  5J4V A;  1MBF A;  2DYS H;  4E70 A;  1WPK A;  3S17 J;  2Y2Z A;  1GUU A;  3LSK A;  4ENN A;  1LFU P;  1F36 A;  4BXU A;  1WJB A;  3UNG C;  3JSP A;  5HVQ C;  2L7F P;  1QU3 A;  2CV0 A;  3RJP A;  4BAY A;  5FRM A;  4HNU A;  4M3E A;  4C2U A;  1BR4 A;  4RM3 A;  1ENH A;  1FSE A;  1V55 H;  3D5L A;  3M07 A;  3R60 A;  3OYL A;  4F52 A;  3S3N A;  1U78 A;  2G7H A;  4A5M A;  4BEH A;  5KHD A;  5HNF A;  2DAO A;  2VKV A;  3IL2 A;  4RDU A;  1DUX C;  1H88 C;  5D5V B;  2EV0 A;  1U2W A;  4W97 A;  2B7E A;  2ACJ A;  2F48 A;  1ETV A;  1HSJ A;  2E2H J;  2V26 A;  2XAJ A;  5K7Z A;  4PJ0 C;  4NC7 A;  3ZMS A;  3I56 I;  2DU9 A;  4IHS A;  2DTR A;  3CP8 A;  4PJN A;  3RKX A;  2DMU A;  2KL4 A;  2GXB A;  4XK4 A;  5FGM A;  3PO2 J;  2UV1 A;  5ICC A;  3JAM K;  1FJL A;  2CV2 A;  4N4O B;  2IS4 A;  2CFO A;  3OYI A;  3FBN B;  1XTA A;  2OD5 A;  2MH9 A;  4M73 A;  4OOI A;  3AKZ A;  1K61 A;  2FBI A;  2P81 A;  1TLH B;  2FSW A;  2VXD A;  3REO A;  4HRI A;  4DBQ A;  1RC9 A;  4BJT A;  1T38 A;  5ED4 A;  3CUO A;  4DW6 A;  1S7A A;  3ABM H;  5FKO A;  4BAC A;  2BY1 A;  1JHF A;  3QPL A;  3OS0 A;  2FA5 A;  5IOZ A;  1QPM A;  2MYS A;  4F3Q A;  1OCC H;  3HM5 A;  2L02 A;  4G94 A;  1WH7 A;  1QO0 D;  1QA6 A;  1QGP A;  3S1R J;  3FK6 A;  2R4G A;  2IS2 A;  5JFR A;  4HYE A;  4AYB N;  2XIG A;  2R3S A;  4G12 A;  3ZQF A;  3B73 A;  1XGN A;  4XLN F;  4NC6 A;  2LLK A;  2M7B A;  3H3U A;  1V4R A;  4BBS J;  3BG6 A;  2CW0 F;  1ONV A;  2FMY A;  3KZY A;  3HG9 A;  4YIF A;  1IN7 A;  1BOA A;  3G4S I;  4IOC F;  3WE3 A;  3G2B A;  4UUS A;  2TDX A;  3OL3 A;  3MKZ A;  5HLT A;  4GXO A;  1IRF A;  1VI0 A;  3DKX A;  2E1N A;  4M6Y A;  2JUG A;  1IN4 A;  3O2P E;  2QA4 I;  2DCE A;  1D8J A;  5EF6 A;  1WJA A;  2PJP A;  4G7O F;  2X0L A;  4KNY A;  1TWA J;  2DMP A;  3CJN A;  2LVS A;  2X6Y A;  3VYR B;  3C2B A;  3CCS I;  4B8X A;  1AKH A;  1KU7 A;  3HZJ A;  1BR1 A;  4M3F A;  3CMA I;  1XPX A;  3HHH A;  1K83 J;  2DMT A;  3EET A;  1VQ6 I;  2EBI A;  3AL0 B;  1MGT A;  1MMG A;  3PFY A;  4FCY A;  4XQF A;  4UV8 A;  5M5W J;  2GAU A;  2PQ8 A;  1WJ5 A;  2DA3 A;  5DCM A;  2ADU A;  3GTP J;  4ZTF A;  4JX4 A;  1YS6 A;  3JRG A;  3CZ6 A;  3UR3 C;  4Q47 A;  2R93 J;  2OUM A;  3CJR B;  3SDB A;  1B8I A;  1G4D A;  2COM A;  2Q2E B;  2ZXI A;  3FM5 A;  2R5Y B;  1D1C A;  1Y0U A;  1NHA A;  2BV6 A;  1FTT A;  1MJ9 A;  1H8A C;  1O7F A;  2QGU A;  3LQQ A;  4A0Y A;  1K78 A;  3HDD A;  1MMD A;  4OIR F;  1XDU A;  2R7U A;  3D5R C;  1DGR M;  3L09 A;  3F9K A;  2DOE A;  3HHG A;  1ZG3 A;  4BU2 A;  4QWQ A;  4N9H A;  2IW5 A;  2D1H A;  4KA4 A;  1ZKG A;  4IEJ A;  3TO7 A;  4I76 A;  3S16 J;  3DPU A;  1U9N A;  3A1Y A;  2FE3 A;  4B44 A;  2E36 A;  4HZF A;  3DTK A;  2GIV A;  3QP6 A;  4R79 A;  1WVR A;  5LFA A;  4KT6 A;  3CO7 C;  2OU2 A;  2VE8 A;  3CCV I;  5HS9 A;  1E2X A;  1OKR A;  2DLL A;  2A6T A;  2EA4 A;  3RSN A;  2KIS A;  3Q9S A;  2CYY A;  4MFE A;  4U7B A;  1G59 A;  3HXL A;  4KJZ A;  2EFN A;  1SFE A;  3GBG A;  4HPQ A;  1S8N A;  4A12 A;  2ECC A;  1DU0 A;  3BTL A;  1ULY A;  3ZMZ A;  4HX7 A;  4NQW A;  4CZZ A;  1DQU A;  2AXL A;  4KIB A;  1FMW A;  3EQL F;  4RS8 A;  2R7Z J;  1Z91 A;  2FXA A;  5H6Q A;  1KZH A;  3L00 A;  4OIO F;  4G8X A;  2E1O A;  2N8G A;  4J00 A;  1BI2 A;  3I58 A;  3NAU A;  2KMU A;  2I10 A;  1UHM A;  1M1E B;  4WXD A;  3VB2 A;  1Z77 A;  5K1Y A;  2DFI A;  1E0E A;  2OQR A;  1ZN2 A;  1JT6 A;  4GYI A;  4ZDP A;  3ROU A;  4RAY A;  2AXT C;  1LVA A;  4UY8 I;  1MDM B;  5HLG A;  4Y17 A;  4S0H B;  1XB4 A;  2DFF A;  2K27 A;  3ASN H;  2X1E A;  2YX4 A;  4B1R A;  2GOX B;  4BHB A;  4D5C A;  2XVC A;  2E7W A;  1R22 A;  2DTZ A;  2VT3 A;  2HEO A;  4LK0 F;  1KYZ A;  2XAQ A;  1TWG J;  1QHG A;  5HLH A;  2GZW A;  1IN8 A;  4EV0 A;  4AM3 A;  3H0D A;  3SZG A;  1FOX A;  1VF9 A;  3FXQ A;  1A5J A;  4FIS A;  3ZMT A;  2DBB A;  1ZRE A;  3PSF A;  4DYC A;  4IZZ A;  3Q3S A;  1GXP A;  1TT0 A;  3DEW A;  4PSW A;  2IGM A;  2IA0 A;  3DLL F;  3BG3 A;  2VT2 A;  1BI3 A;  4U7D A;  4MLO A;  2W7N A;  2XAF A;  2RQP A;  4CXF A;  4CYC A;  2J5O A;  3ZN0 A;  5K5Q A;  2LOO A;  2QLZ A;  1OIS A;  4GGG A;  3GTJ J;  3E1S A;  4FET A;  5AIQ A;  1CF7 A;  1WRJ A;  1YLF A;  3F6V A;  1WJD A;  2HS5 A;  2VQC A;  4HST A;  1L0O C;  1ZG5 A;  2NVT J;  1OFC X;  5FO5 A;  2MH2 A;  3VEP A;  1TBX A;  2E35 A;  1HW5 A;  3GWZ A;  4EJT A;  2QQ8 A;  1LDJ A;  3S2W A;  1YJW I;  1A6Q A;  3ABT A;  2K3F A;  2KJB A;  2JN6 A;  1A31 A;  2COB A;  3M9A A;  3T8T A;  3U21 A;  2ZJP F;  4HF1 A;  2GA1 A;  4Y15 A;  1ERD A;  3BZ6 A;  1MH3 A;  4RGS A;  1KA8 A;  1MJA A;  2KP6 A;  3SZT A;  3E0J B;  4IHV A;  5B3S H;  1P9Q C;  3F8M A;  4N9I A;  4ITV A;  5HDG A;  2DA1 A;  3OY9 A;  1A04 A;  1OCR H;  5BPD A;  3QYF A;  2P4W A;  1K6O A;  1VQM I;  4BDZ A;  1F1Z A;  4C2M J;  3PM1 A;  1Y39 A;  3BWG A;  1XX5 A;  3BT9 A;  2IEK A;  4KIG A;  2V1U A;  3EYI A;  2LTP A;  2DK5 A;  2BVM A;  2MD0 A;  4HA8 A;  2FF4 A;  3T5X A;  1EV7 A;  2KIF A;  4IQ4 A;  2LD5 A;  3ESW B;  1TC3 C;  4EJU A;  3JRB A;  3QRF F;  1VQP I;  3WHB A;  1D1A A;  3GZN B;  1TWC J;  1FEX A;  2KPM A;  3QYB A;  2DPU A;  5FFX A;  2MA3 A;  2F4M B;  4PZJ A;  4X6A J;  4RGR A;  2QSH X;  4LG0 A;  4ZC3 A;  1U8R A;  3RTR A;  3J7Y J;  2PMZ A;  1TQP A;  2WV0 A;  5KNL A;  4WWC A;  5J1U A;  2IRF G;  4IVN A;  2IGO A;  2K7L A;  2PX9 A;  1HKQ A;  2ELJ A;  3DU6 A;  1P7J A;  1R5H A;  3H9Q A;  3CCJ I;  2AQE A;  3BP8 A;  2EWN A;  5F1J A;  3T0Y A;  3K7A J;  2XF5 A;  4CYC B;  2ETH A;  4E7S A;  1DDN A;  2RNJ A;  4L9J A;  3UKG A;  2QKM B;  3P9C A;  2BW3 A;  3KET A;  4IX7 A;  1J59 A;  3BR0 A;  1NH3 A;  1YQA A;  5FRO A;  2W85 A;  1FBU A;  2BYV E;  3WTY C;  1WGX A;  5FD6 A;  1XG1 A;  3M1E A;  4A3I J;  2XAH A;  1ZGW A;  4DGW B;  2K5C A;  2PMZ N;  3DTE A;  2VKH A;  1XD7 A;  3RDI A;  4FAS D;  1IN6 A;  1VTN C;  5CVR A;  2L5Q A;  3TDU C;  2CUF A;  1JJ8 C;  5C4X J;  2OZ6 A;  2P6T A;  1TWF J;  2LRD A;  3LSI A;  1N77 A;  1F5T A;  2CS3 A;  2JPC A;  3E97 A;  1JJ6 C;  2KQR A;  3FMR A;  2O7O A;  3S32 A;  1W5S A;  1R4M B;  2LC2 A;  5L3D A;  4KMF A;  3HJE A;  1XCB A;  2ID3 A;  1JE8 A;  4A3D J;  2JVH A;  1FTZ A;  1X3Z B;  3H0G J;  4PCQ A;  1FIP A;  3GEZ A;  1GVD A;  2VLA A;  2E1C A;  3DPL C;  5L3C A;  2XGX A;  1R7J A;  3BG7 A;  3RKY A;  3TGN A;  1OPC A;  1QQI A;  4L5I A;  1JGS A;  4DJA A;  2ZNY A;  3K10 A;  4XLP F;  5ILS A;  3OYA A;  4HX4 A;  3DEU A;  4IJA A;  2CV1 A;  2CW8 A;  3A01 B;  2M0C A;  5J1Y A;  1SVM A;  2EIM H;  1C0W A;  5JHF A;  3L2Q A;  4I02 A;  1ZAO A;  2B0L A;  3HKZ N;  4ETS A;  2M1B A;  3PSI A;  2R5Y A;  1H9T A;  3FKJ A;  2VE9 A;  1BL0 A;  2NNN A;  1B9M A;  2HOT A;  4EAT A;  2ZME B;  5LGU A;  1IZ1 A;  5LLQ A;  4G6T B;  1OCO H;  2O0Y A;  3BDD A;  3RIR A;  4A3M J;  2ZSH B;  2YU9 J;  4XOT A;  1FSH A;  1I3A A;  4CZC A;  3V7C A;  3GZ5 A;  1Y0N A;  2HI3 A;  5DCF A;  3ASO H;  4A3B J;  1SVL A;  4I2O A;  1J7K A;  2GIZ A;  2ZC2 A;  1O3Q A;  4AC0 A;  2FU4 A;  2NS0 A;  3BPX A;  3Q5F A;  1HDD C;  1K7A A;  3GLX A;  4BEH B;  5CYV A;  2WV1 A;  3I64 A;  4UV9 A;  1EF4 A;  4HQE A;  1U5T B;  3K4M A;  3MKL A;  3O8H A;  3TOA A;  4CGZ A;  3GTL J;  3FM3 A;  2WAQ A;  2PN6 A;  2XF6 A;  4BQQ A;  4BE2 A;  1BM9 A;  2HVR A;  4IRI A;  1TZL A;  6PAX A;  1SMY F;  4BJ6 C;  3DCF A;  3P9K A;  1OCT C;  3DWL E;  4EEF G;  2PMU A;  3QPT A;  2EFW A;  3WTW C;  5IP9 J;  5JVT A;  5K7H A;  3PFI A;  1F4K A;  3SQN A;  3V7R A;  1OYI A;  4RBO A;  3S15 J;  3B02 A;  4EM0 B;  4L5J A;  5HOD A;  3DKY A;  1VQ7 I;  2MLG A;  4BQN A;  3F72 A;  5BMZ A;  4D1Q A;  3I59 A;  1UAA A;  3ABK H;  3K2A A;  2MFZ A;  2ZJ2 A;  2L9N A;  3CF5 F;  1UST A;  2JJ7 A;  4IHT A;  3GFI A;  1IDZ A;  2WBM A;  4DOZ A;  4QSH A;  1QZY A;  4DYR A;  4ZYA A;  3M7G A;  3HC7 A;  1JKQ C;  3WU2 C;  1P4X A;  3K4B A;  2BEO A;  2FD5 A;  3VYS B;  5J8F A;  1JKO C;  1BC7 C;  3H9G A;  3BZC A;  1ZGJ A;  1T39 A;  1H89 C;  2XAG A;  4B09 A;  4M6X A;  2XKP A;  4P96 A;  1VQK I;  2LMD A;  4NNJ A;  3D5S C;  3GF2 A;  2H1K A;  4XL9 A;  4BE1 A;  3FXJ A;  1RUO A;  1X1D A;  2O8X A;  2IS1 A;  4RAF A;  1RRJ A;  1IUY A;  2M34 A;  2XRO A;  5DUK A;  1ZLK A;  5EJC A;  3QPS A;  1XN7 A;  2WB1 N;  1HOM A;  4FE4 A;  4N4N B;  3BR5 A;  3HL2 A;  1VQL I;  2E5Z A;  2FBK A;  2MC4 A;  2VJI A;  1LUJ B;  2VQL A;  3JRD A;  3J81 K;  4ZDL A;  1G8X A;  4LIV A;  4RGU A;  3O8G A;  3A0H C;  5F6F A;  5FKL A;  1GHC A;  1FBS A;  2L7M P;  2MD5 A;  3Q0V A;  4BS9 A;  3NQO A;  2E60 A;  1I6H J;  3K1N A;  5E17 F;  1XSV A;  3HBL A;  1U0J A;  4LK1 F;  3HPG A;  4I99 C;  1YRN B;  1IXR C;  3KLN A;  1QBJ A;  2IAI A;  2XSJ C;  1HLV A;  2GA2 A;  3DBR B;  1YJ9 I;  2XAS A;  3CCE I;  2R7F A;  2A6E F;  2Z33 A;  3KFW X;  1FPQ A;  2MGQ A;  4IQJ A;  3V7S A;  1J09 A;  1G3Y A;  3HRM A;  3MFK A;  1E3H A;  3LAP A;  3FXM A;  1USS A;  4Y4R A;  1D5Y A;  4XSZ F;  4MGR A;  2VPL A;  4FTH A;  3KLO A;  4YII A;  4EM2 A;  3WTS C;  4NC8 A;  3CMY A;  2AS5 F;  3CJT B;  2LY1 A;  2H94 A;  3PJR A;  2M87 A;  2A5Y B;  2H1L A;  1BR2 A;  1WZ2 A;  2HFH A;  1POG A;  1EH7 A;  2DT7 B;  1K4S A;  3P9I A;  3SFI A;  2MSY A;  4OAZ A;  4AIK A;  4BHP A;  1NK2 P;  4X1E A;  2RRE A;  2M2E A;  3KEQ A;  4XRM A;  2IXS A;  2L4A A;  1FMV A;  3HEF A;  1T08 B;  3RKQ A;  1RPW A;  4AVZ A;  5E3O A;  2ESH A;  1GXQ A;  1ZRF A;  2D2W A;  4P9F A;  2QQB A;  4CCJ A;  4GDF A;  1MKM A;  4L9N A;  2BE5 F;  2K85 A;  2DDA A;  5BPI A;  1ZH5 A;  2HPI A;  1WQ2 A;  1KU3 A;  4ZJZ A;  1WFX A;  3GVA A;  3J7A Y;  3ZXS A;  1G3T A;  2NVY J;  5E18 F;  4BH9 A;  2FOK A;  4BQA A;  2L3D A;  4BBR J;  3BJ6 A;  3G1L A;  2QUF A;  2R7Q A;  3O3K A;  4Q48 A;  3GTO J;  3OIQ A;  1VND A;  2H8W A;  2F5D A;  3W6K B;  4QIW N;  5CVI A;  1A6I A;  4HF0 A;  3HKZ A;  2DYR H;  3CCQ I;  1T95 A;  3Q0W A;  4S05 A;  3K4N A;  1UG0 A;  5EZH A;  4LB6 B;  2CQQ A;  4D7N A;  2QKL B;  3ERE D;  3JRC A;  1JUM A;  3PIP F;  4AVP A;  4AIJ A;  1BN5 A;  1IXC A;  2RVC A;  3Q9V A;  3BRO A;  4BYY A;  2A5W A;  3F23 A;  3FKI J;  3M8J A;  3HRT A;  3QU6 A;  2JZY A;  4KT5 C;  3QU3 A;  4IF4 A;  3I59 B;  3E6C C;  1FT9 A;  2WY7 Q;  2GM4 A;  3NEU A;  5DUI A;  1EA3 A;  1KGS A;  1NG7 A;  1NTC A;  3OYG A;  3DBH B;  3KP4 A;  2E2I J;  2V9K A;  2NVQ J;  2G7U A;  4PSX A;  4CHU A;  2LSO A;  4XBF A;  3M1C A;  2CW7 A;  1J9I A;  3CCU I;  3BLY A;  2A61 A;  3KEO A;  2Z1D A;  3OIP A;  2R0Q C;  1QVU A;  2A3S A;  4I98 B;  3MCZ A;  2FEZ A;  3HRU A;  2LFB A;  1LVK A;  1UCR A;  2VQG A;  2DT6 A;  3LNQ A;  1FC3 A;  4FX0 A;  2QF7 A;  2IBD A;  4HG2 A;  3B6C A;  2LR8 A;  1KU9 A;  2QM3 A;  3JAM Z;  3CCR I;  1UMQ A;  1OLT A;  1LDD A;  4I6Z A;  1U9O A;  1IG7 A;  3IWZ A;  2GLO A;  3MKW B;  2L9S A;  4YG2 F;  1P6R A;  2X4H A;  4XID A;  1I50 J;  5LD2 C;  4BQO A;  5B1A H;  1ETX A;  2YUS A;  3ZRG A;  4ZYE A;  5F64 A;  2O9L A;  2J5P A;  3EUA A;  3TP3 A;  1OJL A;  1S7E A;  3OYK A;  2EJR A;  1JGG A;  5F08 A;  2K86 A;  3R6S A;  3MZ8 A;  3ABL H;  5J4Y A;  4PK4 A;  3QOD A;  3A4C A;  4M9Z A;  2RGV A;  3SJM A;  2QQ9 A;  3EPZ A;  2M0M A;  1BOB A;  4XMY A;  1TW2 A;  4C30 A;  1R1U A;  4U87 A;  1HKS A;  3K6G A;  3C7J A;  2K9N A;  2Z3Y A;  4UUV A;  1CGP A;  2L01 A;  3FX3 A;  2X51 A;  4O3M A;  1RES A;  2E34 A;  4A5N A;  2YR2 A;  1SD4 A;  5AIP A;  1U6G A;  4XRS A;  2DA7 A;  2LG4 A;  1PUF B;  1MZB A;  4BY7 J;  1YW9 A;  2H09 A;  4KN7 X;  4IO9 F;  3J80 Z;  5HLI A;  3WTZ A;  2BXY A;  3VFZ A;  3I55 I;  5J47 A;  2IA1 A;  1HQC A;  5LEJ A;  3N05 A;  2HQN A;  2DA5 A;  1H0M A;  3F22 A;  4UVA A;  1ETK A;  1V5F A;  2XGE A;  2M4K A;  4KIC A;  2CGP A;  4JQF A;  3P7N A;  1IJW C;  2KHM A;  4OIN F;  1AKH B;  4O5V A;  2EIK H;  1DU6 A;  5D4R A;  1W1W E;  1QZZ A;  3DEE A;  3K69 A;  2ZNZ A;  2LBF B;  3ZR8 X;  3I3L A;  3HOW J;  2WTE A;  3CP2 A;  2X85 A;  1SAN A;  3IAS 2;  3FMS A;  3K4C A;  3MEX A;  1X1B A;  1T2K A;  1FLI A;  2P5V A;  4YEJ A;  3BR2 A;  3VWB A;  3SDG A;  3ZMV A;  1T56 A;  5IYB J;  2XB0 X;  1I3Q J;  3H3Z A;  5LRS A;  2QEX I;  2BHY A;  1X58 A;  3O6B B;  4I7H A;  3HOS A;  4BE0 A;  2QQA A;  3EUH C;  1R49 A;  2VKE A;  3CC2 I;  1R23 A;  2O3F A;  1FBQ A;  5CLS A;  1JUS A;  3F8N A;  3I4M J;  5EGO B;  1OCZ H;  3OR2 C;  2HVS A;  2M3A A;  3G73 A;  4I0B A;  4PGG A;  4ESB A;  5D5U B;  2VOD A;  3PIO F;  5D6E A;  3MZH A;  3M4O J;  1O3T A;  2CQX A;  4XOR A;  3BOQ A;  2K9S A;  3I5U A;  2HQA A;  2VBX A;  4HQM A;  4LMY A;  3CME I;  3IKV A;  4HOB A;  5TRD A;  5ILV A;  4JBA A;  3IP4 B;  1I1G A;  4X0G A;  3E6M A;  3L2V A;  1LJ9 A;  4ENJ A;  3RZD J;  2VOO A;  5IOY A;  2HXI A;  2HYJ A;  3U1D A;  3OIO A;  2DK8 A;  4CCK A;  3IHU A;  1YIT I;  2EZK A;  3ZQC A;  2HTJ A;  4XKW A;  4EGY A;  3E3V A;  4IHY A;  4I0A A;  2V7F A;  3WE2 A;  5D5W B;  1ZRD A;  2KIU A;  3H1C A;  1TQI A;  1R58 A;  3I53 A;  4GO1 A;  2E2J J;  2KKO A;  4AYB A;  3LSG A;  1QZE A;  2FNP A;  1G3S A;  2JWT A;  1AOY A;  1FX7 A;  2QBY A;  1J5Y A;  2VI6 A;  1IRX A;  1YX5 A;  1BJZ A;  1VQ9 I;  4OIQ F;  2A69 F;  2FQ4 A;  2XPU A;  1RUN A;  2ZBK A;  1PP8 F;  5GAH J;  3JSO A;  2R5Z B;  1W36 D;  2Q1Z B;  5F1R A;  5IYC J;  1XSD A;  2KIM A;  4A3C J;  1T98 A;  3IUO A;  2QCO A;  1VZ0 A;  3CUQ C;  5B1B H;  3FXU A;  5H6R A;  3HSR A;  2W84 A;  4C9Y A;  4KIF A;  3MD2 A;  3AG4 H;  1X1A A;  2IGN A;  3M8F A;  2E1M B;  3C1D A;  2D45 A;  2VC0 A;  1NG6 A;  3NWS A;  2QZ8 A;  5M5X J;  3DFG A;  1MBG A;  3JRA A;  3J80 K;  1IF1 A;  1HBX G;  2DPD A;  3CMM A;  1O4X A;  5BS6 A;  4G7H F;  3CES A;  5ICE A;  4M74 A;  1QRY A;  2OQG A;  4OMY A;  2L9R A;  3BR1 A;  3PQK A;  4L0Y B;  1IDY A;  2CUE A;  4V19 K;  3E5X A;  2P7V B;  2WAD A;  2V4J C;  2KLO A;  5E3L A;  1G3W A;  5J1R A;  1PUE E;  1WH5 A;  1B72 A;  1JTX A;  5L3G A;  1KQ9 A;  2DA4 A;  3HUG B;  2DOD A;  1K6Y A;  2MAB A;  4L9T A;  4Z2Y A;  4ON0 A;  5EG0 A;  3E6D A;  2EZI A;  3LWF A;  2WAE A;  1DGW Y;  1MMS A;  3VSK A;  4GRI A;  4F92 B;  3GTK J;  4QPO A;  2ELH A;  1W4M A;  1ZAR A;  2NVX J;  4E6K G;  3MMY B;  3QQA A;  5GAD J;  4II2 A;  2R7S A;  2ZSI B;  1PUF A;  1VQ8 I;  2NRA C;  3T1B A;  4XON A;  3WTX C;  2WB1 A;  3KCC A;  5HS8 A;  3M3Y J;  2ZJQ F;  3IH3 A;  1ZRC A;  1MBE A;  5CJ9 A;  2Z99 A;  2ZKZ A;  2KDZ A;  3G71 I;  1TP4 A;  4C2T A;  4ZH4 F;  1NK3 P;  5HOO A;  4DZP A;  4LFU A;  5D5X B;  2FRH A;  2B9S A;  3LMM A;  3CC4 I;  2Y0S A;  4U88 A;  1BC8 C;  3GFL A;  2OPT A;  2CJJ A;  1XGM A;  1F9N A;  3E7L A;  3OR1 C;  5E1X A;  3LST A;  5LGN A;  2OZU A;  1KQ0 A;  1MW7 A;  4JP0 A;  1Z6R A;  2K40 A;  4HLX A;  3LOC A;  5M5Y J;  2L7K A;  1RNL A;  2CSO A;  4BXF A;  2AQF A;  5K5O A;  2KRH A;  5D8L B;  2IJL A;  2FUG 2;  3HOX J;  1XSX A;  5FJ8 J;  4NUB A;  4PGH A;  4Y7N J;  4XKC A;  3HTS B;  3Q0U A;  5FKK A;  1LE8 A;  2ELK A;  2OV7 A;  3TDZ C;  4QLC U;  1YIO A;  1XC5 A;  4P55 A;  1W7P A;  4F7Z A;  2HR3 A;  2EA2 A;  5J3L A;  1YFH A;  1O3S A;  2BOL A;  2FBH A;  2X1D A;  1I1S A;  3DXJ F;  3BTC A;  1IO2 A;  1D1B A;  4XNF A;  4YRV A;  1CQT A;  4A6E A;  3R61 A;  1R9T J;  2DQL A;  1XS9 A;  2JA2 A;  1B72 B;  3W6V A;  2Y75 A;  2KT0 A;  3MAJ A;  4CCN A;  3PL8 A;  2ZXW H;  2C6Y A;  1UJ8 A;  1B1B A;  1W5T A;  3R0J A;  3V42 A;  4A6D A;  1JTY A;  1MSE C;  1S7O A;  1TNT A;  1Z3X A;  3QWL A;  5EGO A;  2ZJR F;  2HOS A;  1YJN I;  1TWH J;  5LHG A;  3WTU C;  3L2W A;  3F21 A;  2Y48 A;  5C44 J;  1T33 A;  1WJE A;  1X2N A;  2HKX A;  5TIS C;  1P2F A;  2R7W A;  4XRS G;  2VXZ A;  1D5V A;  2R7D A;  2UXN A;  2M8G X;  3F6O A;  4RB0 A;  3ZQG A;  2XUB A;  2OAZ A;  3HYI A;  4B3A A;  3A01 A;  5A2Q Z;  4QPQ A;  4UXN A;  1SD6 A;  2NOJ B;  3DTI A;  3TW6 A;  2OA4 A;  2VJ4 A;  3WGH A;  3RI4 A;  3PNT A;  3GTG J;  4DQ2 A;  4LG0 B;  1ON2 A;  2GWR A;  4UUS B;  3F8C A;  4RLQ A;  3ABU A;  4CCL A;  4IOA F;  1F43 A;  5ICF A;  3OL4 A;  1YW7 A;  1YS7 A;  5GAG J;  2RN7 A;  4A3K J;  2VOP A;  2ZFW A;  5E3N A;  2CRG A;  3OYB A;  3QPH A;  4PFP A;  3JRF A;  3EDP A;  2KZV A;  3KE2 A;  2VIX A;  3GME A;  2DXI A;  2A05 A;  3W2V A;  2H6B A;  1YTY A;  1N78 A;  1AA7 A;  1ETQ A;  1SD7 A;  3BJO A;  5JVG F;  4C3J J;  2PJR B;  3N97 A;  2QYO A;  4PJJ A;  2NYX A;  3JTG A;  1FOY A;  1Z7L A;  1O57 A;  1S29 A;  1SFO J;  2VAS A;  3H9J A;  4LLL A;  1EKE A;  1X2M A;  2IVM A;  3FIW A;  5L3E A;  2NOG A;  4M3G A;  1YE9 A;  3ISP A;  1FP1 D;  5D4S A;  1E3O C;  5CPR B;  5B5E C;  1STZ A;  5B66 C;  3RKW A;  3CDL A;  2IPQ X;  5GAE J;  1BBY A;  3HOT A;  3CCM I;  4L0Z B;  3IC7 A;  2X6X A;  4L9V A;  4RMN A;  1D0Z A;  4JX5 A;  4KYW A;  4AU7 A;  2PLY A;  2MC3 A;  2V9V A;  3PNV A;  1REP C;  1SAU A;  3J7Z I;  1PDN C;  1T0F A;  5LEK A;  1FYL A;  3FHZ A;  1Z1D A;  2HYF A;  3K1M A;  1IC8 A;  1S3J A;  2DO7 A;  3X2Q H;  2H6C A;  2VJJ A;  1UFM A;  3BC8 A;  3D0S A;  3HRS A;  2LP0 A;  2VJ5 A;  1PP7 U;  2JA5 J;  1P92 A;  1HKT A;  3HPH A;  3GLL A;  1RZ4 A;  3CO6 C;  4HW0 A;  4EM1 A;  4N0B A;  4F91 B;  4G6Q A;  4Y3O A;  1O3R A;  2EB7 A;  3LSM A;  3GTQ J;  4BHC A;  3BZK A;  1MH4 A;  3LA3 A;  1ZEL A;  2F2E A;  2FJ1 A;  5J8C A;  2JRT A;  3V8L A;  1FIA A;  4LGW A;  4A3F J;  2EFO A;  3K0L A;  4M3B A;  2A07 F;  1K4T A;  1LFP A;  2ME6 A;  1UHW A;  4IKF A;  3LQR A;  4OMZ A;  2HQR A;  4D9J A;  1VQN I;  1LDK B;  1GVJ A;  5F0C A;  2KZG A;  1QHH D;  4ZZD A;  5CVV A;  4AUX A;  1FOK A;  4I09 A;  1GV2 A;  2BVL A;  5EEA A;  4M72 A;  2DOF A;  2L2O A;  5FKM A;  1Z7U A;  2HNH A;  2QBY B;  4OU0 A;  3K4L A;  5JLW A;  5D6F A;  3NRV A;  1RIO H;  2XKO A;  2LBF A;  1MNE A;  2JVG A;  1N75 A;  1LB2 A;  2JQ7 A;  2HDW A;  3LA7 A;  2DDB A;  2BY2 A;  1RR7 A;  2XRN A;  3ELK A;  3LSH A;  4IPA A;  4MO7 A;  2VN2 A;  5DM7 F;  1Q1V A;  1I6X A;  3OYD A;  1A36 A;  2LDU A;  1D0Y A;  5GP9 A;  2ZB9 A;  2CH0 A;  3S8P A;  4P5O A;  4ABZ A;  1QPI A;  3TOB A;  4LOC A;  2ZXJ A;  4EMS A;  5FFZ A;  4EJV A;  2JSP A;  1Z3Y A;  1LEB A;  4B47 A;  3JCU C;  1K79 A;  4ZYH A;  2OF7 A;  2CMP A;  2CUZ A;  3B6A A;  3RYR A;  4CYD A;  3CJQ B;  2R7R A;  2Y30 A;  1Z0X A;  2P5K A;  2NVU B;  2V6E A;  1SD5 A;  4R8H A;  2R7T A;  3DV8 A;  5IT9 Z;  4EVI A;  2HZT A;  1BIB A;  4XLH A;  2EFQ A;  1Y56 A;  2STT A;  1YYV A;  1R5I D;  4UHT A;  1WSU A;  2VBY A;  2H8R A;  4RLF A;  3DP7 A;  1IV6 A;  4CSW A;  2VPR A;  1R71 A;  2EIL H;  2DI3 A;  4Q4Z F;  2G0E A;  2LNB A;  1VQ4 I;  1ACI A;  3S3O A;  2FOW A;  4GFB A;  2E5N A;  2ESN A;  4ZDO A;  2CU7 A;  3RPQ A;  2K3P A;  4KIS A;  3S1Q J;  2WAQ N;  3BJA A;  4YEL A;  4JX6 A;  4FQG A;  3QP5 A;  1Q1H A;  4A3E J;  1MD0 A;  4NB5 A;  5GPA A;  1HCR A;  2LYC A;  4XKB A;  3OOP A;  3IH4 A;  3H5N A;  5E1W A;  3SYT A;  4U0V A;  3FXR A;  3RQ4 A;  1HC8 A;  3S14 J;  1YOV B;  2X48 A;  2HXO A;  3OV8 A;  2OTJ I;  4HF2 A;  5EG0 B;  5E3M A;  1VFC A;  3R0A A;  2GOM A;  2KRC A;  3BR6 A;  1W0T A;  3KIO A;  1FY7 A;  1GV5 A;  2HYG D;  2O03 A;  2XC7 A;  5DM6 F;  1T6S A;  2ISZ A;  3G3Z A;  3DQV C;  3CC7 I;  1IW7 F;  3TMO A;  4IHW A;  1Z21 A;  3S2D J;  5DEQ A;  5F27 A;  3CDI A;  2Y31 A;  1YW8 A;  3LA2 A;  5J40 A;  2P8T A;  2YU3 A;  4WXC A;  3V4G A;  5FLM J;  2P0W A;  2BXZ A;  3VPR A;  3IKT A;  3SFZ A;  1UEL B;  3C2H A;  4KMU X;  1ZG1 A;  2NS7 A;  2ID6 A;  1SEU A;  4NQW B;  3FMQ A;  2E7X A;  2OBP A;  5DCM B;  1ZR2 A;  3BQY A;  5BOX A;  4P1W A;  4HLY A;  1IRZ A;  5HDK A;  3K70 C;  3TKY A;  1BI0 A;  3F8B A;  2M8E A;  2UXX A;  3U2R A;  1V54 H;  2V79 A;  2V1X A;  4HX8 A;  1Y6I A;  1WJF A;  2EIN H;  5LGT A;  3SEZ A;  5FLX Z;  1SC7 A;  3OYN A;  5CVU A;  2DFH A;  1I5Z A;  3C18 A;  3F8F A;  2EIJ H;  4E7H A;  3HIF A;  2XAU A;  2RDP A;  4CA0 A;  3WHC A;  5C3E J;  2HOE A;  3KP5 A;  4WXH A;  1K78 B;  4RA2 A;  3K4K A;  1YHQ I;  1TTY A;  1HA8 A;  2F4I A;  2L0K A;  3IRR A;  2XPV A;  3WU0 A;  3J81 Z;  2G9W A;  3K1P A;  2JTV A;  5K7F A;  2JK3 A;  5LHH A;  4R1H A;  4XLA A;  2BY0 A;  2M30 A;  4HNT A;  1OYY A;  2EV6 A;  2HU9 A;  4MIM A;  3GCM A;  5L3F A;  2XHK A;  2Z16 A;  3H35 A;  3HOZ J;  5FKN A;  3AG2 H;  1LQ1 A;  2AHQ A;  2K9L A;  2W82 A;  4HNV A;  3I0T A;  2Y0S N;  3QOP A;  2VB6 A;  2JA7 J;  3VYT B;  3WG7 H;  2P5L C;  1MIJ A;  3HSF A;  1AHD P;  2M7A A;  2VBZ A;  3VSL A;  5M3M J;  1KU2 A;  2F6C A;  3TP0 A;  2CQK A;  3BTJ A;  1OR7 C;  3FXL A;  4HDU A;  4HDV A;  3LSJ A;  1S5L C;  1B6A A;  3KP6 A;  3EYY A;  2HDD A;  3LSR A;  5DS9 A;  3S93 A;  5AON A;  3KP2 A;  3KP3 A;  1X1P A;  4F93 B;  5LHI A;  2JA8 J;  2EFP A;  5D8K B;  4RAZ A;  1MMN A;  4RAG A;  5H20 A;  2DA2 A;  4QTR A;  1O7L A;  2MG4 A;  2VL8 A;  4BL0 B;  2XSD C;  3HOU J;  1R00 A;  3V8J A;  4MHG A;  2R7V A;  4TV7 A;  1MJB A;  4LJZ F;  3T8R A;  1ODD A;  3BG9 A;  3I4N J;  2MW8 A;  2NXN B;  1WHU A;  2LRE A;  3MVP A;  1X19 A;  1MBJ A;  5HNH A;  4M9S A;  3JR9 A;  4XLE A;  4BDY A;  1X4O A;  1W7P D;  2XGD A;  1ON1 A;  2NS8 A;  3HTU A;  3WTT C;  1R6R A;  2Y9Z A;  5K5R A;  2E19 A;  2YPR A;  3OYH A;  1Y1V J;  4E7K A;  1WJC A;  4KFC A;  2RAE A;  5FLX K;  2W57 A;  4J01 A;  2A68 F;  3LFU A;  4IRH A;  3LSP A;  4CCO A;  3RCO A;  1JHH A;  2FNA A;  3FWE A;  4V2G A;  2WAF A;  4Z6Y A;  3OYC A;  3DU5 A;  3OSG A;  5DDG A;  1LPQ A;  3L2C A;  1W7P B;  2M4G A;  2VC1 A;  2XB5 A;  2BBY A;  3ZQI A;  2I8D A;  3KPH A;  5TGT A;  1Z05 A;  4O6J A;  4DZJ A;  2WWY A;  1GLN A;  2W48 A;  3AAF A;  3ZQL A;  3V8K A;  1FZP B;  5E20 A;  5KCM A;  1EH6 A;  3WOD F;  2FX0 A;  5IP6 A;  1S72 I;  3RZO J;  3H5R A;  2HZD A;  1J0R A;  2OJE D;  3EUK L;  4XLF A;  4EJO A;  1ZLJ A;  3U9G A;  1T8I A;  2K02 A;  2HTS A;  2BW3 B;  4YFN F;  3AFH A;  4CCM A;  1SMT A;  1HDP A;  3GW2 A;  3ZQ7 A;  4EJW A;  4OIP F;  3LAJ A;  2Q2E A;  1YIJ I;  2B63 J;  2QSF X;  1Y1W J;  1SFU A;  3BY6 A;  4HSR A;  1B59 A;  1APL C;  3ZCO A;  5ILU A;  3OYJ A;  1ZK8 A;  4E7L A;  5FRN A;  3CDH A;  2HWV A;  4KIT B;  5FB2 A;  2OTL I;  2XPW A;  5ICG A;  4RB2 C;  3S2H J;  1WI3 A;  4U0W A;  3GZ6 A;  4UB8 C;  5GPC A;  2FQ3 A;  2EV5 A;  3W3C A;  4KUM A;  3F3X A;  1G2H A;  2D1V A;  2O61 A;  5CQG A;  4BY1 J;  3FZV A;  2ICW G;  4IL6 C;  5A2Q K;  2V6C A;  3BTI A;  5LRR A;  2UWM A;  2ISY A;  4UUT A;  2VKD A;  3QOE A;  2Q8K A;  2E1M C;  3VOD A;  4A3G J;  2H27 A;  1Z6T A;  4OAY A;  4CDG A;  2JT1 A;  5ERI A;  4JK1 X;  3FK7 A;  4I01 A;  1TT5 B;  5IT9 K;  1U5T A;  3CUQ A;  1ZGA A;  3FXK A;  4M3D A;  4XIC A;  3FBI B;  3I9V 2;  2ZO4 A;  1AWC A;  1PJR A;  2QSG X;  1R4N B;  3FHN A;  2F5C A;  3NWT A;  2P7C B;  5FD5 A;  2M45 A;  4XN0 A;  5F0H A;  5JI6 A;  1KON A;  4M9X A;  4U0Y A;  3JRH A;  1JI8 A;  1T0F C;  1JT0 A;  4MEY F;  1R1V A;  2JMW A;  2D5V A;  3G1O A;  5L3B A;  2YS9 A;  4ENK A;  3BPV A;  4IHX A;  3IWF A;  2GQQ A;  3W2W A;  4MTD A;  1ZR4 A;  2HGC A;  5TJJ A;  4D7M A;  3QYE A;  3DLA A;  2RKH A;  3MWM A;  4CIC A;  1MBK A;  2RNG A;  3ZN1 A;  1H9G A;  4JYK A;  4FHT A;  4BJ5 C;  2WC2 A;  4PDK A;  2PEX A;  2XF7 A;  1CF7 B;  2IA2 A;  2DT5 A;  4WF2 A;  4L18 B;  5JHU A;  3ONQ A;  4WX9 A;  4Y52 J;  2LF8 A;  3JTH A;  1L3L A;  1W5C C;  4ZYD A;  1MMA A;  3DBL B;  3L2R A;  9ANT A;  4GYG A;  3CTA A;  2EZL A;  3S1N J;  1BI1 A;  4DBR A;  4ZYG A;  1ETY A;  1HW1 A;  4JOM A;  3OOU A;  2V1N A;  4ESF A;  2PFB A;  2WY8 Q;  4XLC A;  4LD5 A;  1IV8 A;  3TQN A;  1FWZ A;  1WI9 A;  5KAF C;  2Z9O A;  3P5J A;  2JSC A;  5FLV A;  2P6S A;  2Y69 H;  1P7I A;  1Y8Q B;  2O8K A;  5DD8 A;  4FX4 A;  3E5Q A;  3ZOB A;  2KJC A;  4EQQ A;  2X6W A;  3JW4 A;  4C3H J;  2CFX A;  3KYC B;  3MQ0 A;  1XMA A;  3VYU B;  1WCM J;  1LNW A;  4HEA 2;  3TO6 A;  4BNC A;  3BCB A;  5E8G A;  5EZG A;  1ZQ3 P;  3BR3 A;  3SXY A;  1Z9C A;  1ETW A;  3HB9 A;  4Y33 A;  2M5W A;  2Y9Y A;  1SAX A;  4PJM A;  2F4O B;  2DFE A;  1OQY A;  1X1C A;  5HDN A;  4ASN A;  5IP7 J;  5GTH C;  4M71 A;  2L7Z A;  4RB3 C;  4XR6 A;  3FXO A;  5DTD A;  1D0X A;  2QEN A;  3DKW A;  5LBQ A;  4RGX A;  2STW A;  3E5U A;  2NNY A;  2PMH A;  3PUB A;  4PFO A;  2BGC A;  4D5F A;  5F0F A;  5H2F C;  3A0B C;  4LLG F;  1XGO A;  4UVB A;  5DV5 A;  5IYD J;  3OYF A;  2HQ5 A;  3DF8 A;  5JLX A;  2K9Q A;  3PO3 J;  2CG4 A;  3H36 A;  3ERM A;  5KK1 A;  3ZMU A;  3IRQ A;  2BY3 A;  1UZC A;  1KQ8 A;  3KZI C;  3GFM A;  3CCY A;  2R7O A;  1GDT A;  2Z2S B;  2ZME A;  3CLO A;  4D0P A;  3PNY A;  2K4J A;  3EUH A;  3WU1 B;  3RPU D;  2W4S A;  2BHZ A;  3AG1 H;  2ME0 A;  3HOY J;  3N4M A;  1EJ9 A;  2L9V A;  2DN0 A;  4UNO A;  1BJA A;  2ZXH A;  1LEA A;  1UG2 A;  4L5E A;  3W6J B;  2LH9 A;  5DYM A;  3ECH A;  1LE8 B;  3KP7 A;  1Z67 A;  3VDX A;  2X1C A;  4XRF A;  1QVT A;  3WTV C;  3R4K A;  1R5G A;  2QWW A;  1HXD A;  3ZGK A;  4J19 A;  3OMY A;  4BUP A;  1X4P A;  4DIQ A;  3IV5 A;  1R36 A;  2UUZ A;  4II3 A;  2EZH A;  4BGD A;  1FNN A;  2F5E A;  4HBL A;  2HDC A;  1D3Y A;  2ZFU A;  4CH7 A;  4G9Y A;  4XKV A;  5BNG A;  4GCV A;  3KYL A;  1VQ5 I;  4LLN A;  2IP2 A;  3KX2 A;  2XV4 S;  3HGG A;  3HOV J;  4P9U A;  2K4B A;  3PUF A;  5J6X A;  1IGN A;  4S04 A;  2CQ7 A;  4FE7 A;  4E7I A;  4LIU A;  4XOP A;  2TCT A;  3RYP A;  2HPM A;  1TNS A;  3H5A A;  4K2E A;  2DA6 A;  4OWR B;  3K70 D;  4MEX F;  4M6V A;  5HS7 A;  1OMI A;  1D8K A;  4A0Z A;  2IGK A;  4A2U A;  2K9M A;  2MBF A;  3GYH X;  1DP7 P;  2LY9 A;  3TED A;  4A3J J;  4A69 C;  3H3V K;  2OC6 A;  2GXG A;  1WKM A;  2DW4 A;  2EK5 A;  1P4W A;  1U3E M;  3GUD A;  1XMK A;  3OYM A;  5CVJ A;  3TBI A;  3GTM J;  3CQZ J;  1IUF A;  1RI7 A;  2W24 A;  2Y0M A;  3K9T A;  3OS2 A;  3D1N I;  1JUP A;  1LFB A;  3I54 A;  1E3P A;  3PQJ A;  4ZZL A;  2EPF A;  1OYW A;  2JPB A;  2KFD A;  3S1M J;  1DP3 A;  3SHF A;  3OWT A;  2VUM J;  2MLK A;  1V5E A;  1X3U A;  3OSF A;  4NDL A;  5JR3 A;  1IRG A;  1MND A;  2V1D A;  2JRM A;  3GXO A;  5IPA A;  1B9N A;  2AO9 A;  4CO8 A;  1RR8 C;  2RV8 A;  2L4M A;  4MQV A;  2WA0 A;  3K4J A;  1S6L A;  2CQN A;  3F0C A;  1GT0 C;  4KN4 X;  2VBW A;  1LKX A;  5DD4 A;  4AIH A;  3VOE A;  1RKT A;  3E6B A;  2CO5 A;  5CKT A;  3SEQ A;  1YRN A;  1R1T A;  4YFK F;  4IXA A;  5E79 C;  5IT3 A;  4XSX F;  3JRE A;  4XM3 A;  1E17 A;  4WK8 F;  2PBI A;  2KRF A;  4MTE A;  2GBY A;  3GO5 A;  3I4P A;  4HV5 A;  1V5G A;  3WGG A;  3ZQQ A;  1UHS A;  4MQ9 F;  2YX7 A;  1X3W B;  2O5R A;  3OS1 A;  5EEG A;  4NBQ A;  1FP2 A;  3ML6 A;  3L9F A;  4E4H A;  2XDV A;  4WCG A;  4HAM A;  3TO9 A;  2R5Z A;  1DPR A;  2LK2 A;  3C2G A;  5GTI C;  3BQZ A;  1RET A;  1BA5 A;  2M9H A;  1SFK A;  4XN3 A;  4KDP A;  1W36 C;  1BIA A;  1OCP A;  4Y13 A;  1YI2 I;  1JKP C;  2W25 A;  5C4J J;  3L2U A;  3ZPL A;  4YFX F;  4BKX A;  3BCA A;  3S3M A;  2UZK A;  4H4K C;  5EEH A;  4LB5 A;  3FIS A;  4G7Z F;  3A2K A;  2PG4 A;  5KAI C;  4UVC A;  3ZMD A;  4AD9 A;  4LIT A;  2QVO A;  1ZHF A;  3HSE A;  4E7J A;  3TL4 X;  3MKY B;  2LKP A;  4CUG A;  2F5F A;  2DMN A;  4W1U A;  1KYW A;  1ETO A;  2O6G E;  3CUQ B;  1I27 A;  3JRI A;  1WWX A;  4A3L J;  5EYR A;  2CUJ A;  2XRL A;  5M3F J;  3IAM 2;  3U1K A;  2ZME C;  1IAW A;  1QNT A;  3CF2 A;  3M8E A;  3W2A A;  3G1M A;  3DPT A;  1DPU A;  2OCC H;  1ZYR F;  1OR7 A;  3RPU A;  1FYK A; 
#chains in the Genus database with same CATH homology
 3COA C;  2Z5U A;  5BQT A;  4NHJ A;  3ZP5 A;  2NAZ A;  2ZCW A;  3ULQ B;  1G6N A;  3KZZ A;  4ENM A;  4HV6 A;  2LF7 A;  1B4A A;  4DNC A;  2L54 A;  3MZY A;  1EH8 A;  1HST A;  3LFK A;  4H0E A;  1YG2 A;  1TQM A;  2Q0O A;  2FML A;  3QAH A;  3SZP A;  5KVR A;  4G6D A;  4MNU A;  2RC4 A;  1UB9 A;  4AWX B;  5E8I A;  4Q5S F;  2HKO A;  4IRG A;  3L7W A;  4ESJ A;  2A6H F;  1XCV A;  1MDM A;  1XDS A;  4RB1 A;  3ECO A;  3GX4 X;  3K2Z A;  3I71 A;  1SFX A;  1FYM A;  1J2X A;  3GFJ A;  4FT8 A;  2PI0 A;  1IXS B;  3J7A O;  1U5T C;  4EGZ A;  2CWE A;  5E1Z B;  3HUG A;  1J75 A;  3FF5 A;  4A0X A;  3H92 A;  2DQR A;  2VON A;  3WG9 A;  1V3F A;  1P4A A;  2YSR A;  1IN5 A;  1YO5 C;  3WGI A;  1JXS A;  2IT0 A;  1HW2 A;  3C3W A;  1XGS A;  1TW3 A;  4E70 A;  4ENN A;  4BXU A;  3JSP A;  5HVQ C;  3RJP A;  4BAY A;  1FSE A;  3D5L A;  3R60 A;  1U78 A;  2G7H A;  4A5M A;  2DAO A;  3IL2 A;  1DUX C;  5D5V B;  2EV0 A;  1U2W A;  2ACJ A;  1HSJ A;  2XAJ A;  3ZMS A;  2DU9 A;  4IHS A;  2DTR A;  3RKX A;  2GXB A;  5FGM A;  5ICC A;  3JAM K;  2OD5 A;  2MH9 A;  4M73 A;  4OOI A;  2FBI A;  1TLH B;  2FSW A;  3REO A;  1T38 A;  5ED4 A;  3CUO A;  1S7A A;  1JHF A;  2FA5 A;  1QPM A;  2L02 A;  4G94 A;  1QO0 D;  1QGP A;  5JFR A;  4HYE A;  2XIG A;  2R3S A;  3B73 A;  1XGN A;  4XLN F;  3H3U A;  1V4R A;  2FMY A;  2CW0 F;  1ONV A;  3KZY A;  4YIF A;  1IN7 A;  1BOA A;  3WE3 A;  2TDX A;  4GXO A;  1IRF A;  2E1N A;  4M6Y A;  3O2P E;  1IN4 A;  1D8J A;  2PJP A;  4G7O F;  2X0L A;  4KNY A;  3CJN A;  4B8X A;  1KU7 A;  3HHH A;  3EET A;  1MGT A;  4UV8 A;  2GAU A;  2PQ8 A;  5DCM A;  2ADU A;  1YS6 A;  4Q47 A;  1G4D A;  2COM A;  3FM5 A;  1Y0U A;  2BV6 A;  1NHA A;  1MJ9 A;  1O7F A;  1K78 A;  3LQQ A;  4A0Y A;  4OIR F;  1XDU A;  3L09 A;  3HHG A;  1ZG3 A;  4QWQ A;  4N9H A;  2IW5 A;  2D1H A;  4KA4 A;  3TO7 A;  2FE3 A;  4HZF A;  2GIV A;  3QP6 A;  4R79 A;  3CO7 C;  2OU2 A;  2VE8 A;  5HS9 A;  1E2X A;  1OKR A;  2DLL A;  2EA4 A;  3Q9S A;  2CYY A;  4U7B A;  2EFN A;  1SFE A;  1S8N A;  4A12 A;  1ULY A;  3ZMZ A;  4HX7 A;  4NQW A;  4CZZ A;  2AXL A;  4KIB A;  3EQL F;  4RS8 A;  1Z91 A;  2FXA A;  5H6Q A;  3L00 A;  4OIO F;  4G8X A;  1BI2 A;  3I58 A;  1UHM A;  4WXD A;  3VB2 A;  5K1Y A;  2DFI A;  2OQR A;  1ZN2 A;  4GYI A;  3ROU A;  4RAY A;  1LVA A;  1MDM B;  5HLG A;  4Y17 A;  1XB4 A;  2K27 A;  2YX4 A;  4BHB A;  2XVC A;  2E7W A;  1R22 A;  2VT3 A;  2HEO A;  4LK0 F;  1KYZ A;  2XAQ A;  5HLH A;  2GZW A;  1IN8 A;  4EV0 A;  3FXQ A;  3ZMT A;  2DBB A;  1ZRE A;  1GXP A;  2IA0 A;  2VT2 A;  1BI3 A;  4U7D A;  2XAF A;  2RQP A;  4CXF A;  2J5O A;  3ZN0 A;  5K5Q A;  2QLZ A;  4GGG A;  5AIQ A;  1CF7 A;  1WRJ A;  1YLF A;  3F6V A;  2HS5 A;  1L0O C;  1ZG5 A;  5FO5 A;  2MH2 A;  3VEP A;  1TBX A;  1HW5 A;  3GWZ A;  4EJT A;  1LDJ A;  3S2W A;  3ABT A;  2KJB A;  3M9A A;  3T8T A;  4HF1 A;  2GA1 A;  4Y15 A;  3BZ6 A;  4RGS A;  1KA8 A;  1MJA A;  3SZT A;  3F8M A;  4N9I A;  5HDG A;  1A04 A;  5BPD A;  2P4W A;  1K6O A;  1F1Z A;  3BWG A;  4KIG A;  2V1U A;  3EYI A;  2DK5 A;  4HA8 A;  2FF4 A;  3T5X A;  1EV7 A;  2KIF A;  4EJU A;  3QRF F;  2DPU A;  5FFX A;  2MA3 A;  4PZJ A;  4RGR A;  4LG0 A;  1U8R A;  3RTR A;  1TQP A;  2WV0 A;  4WWC A;  2IRF G;  4IVN A;  2K7L A;  1HKQ A;  1R5H A;  3BP8 A;  2EWN A;  3T0Y A;  2ETH A;  1DDN A;  2RNJ A;  4L9J A;  1J59 A;  3P9C A;  3KET A;  1YQA A;  2W85 A;  1FBU A;  2BYV E;  3WTY C;  5FD6 A;  3M1E A;  2XAH A;  1XD7 A;  3RDI A;  1IN6 A;  1VTN C;  5CVR A;  3TDU C;  2OZ6 A;  2P6T A;  1F5T A;  2JPC A;  3E97 A;  3FMR A;  1W5S A;  5L3D A;  4KMF A;  1XCB A;  1JE8 A;  4PCQ A;  3GEZ A;  2E1C A;  3DPL C;  5L3C A;  2XGX A;  1R7J A;  3RKY A;  3TGN A;  1OPC A;  1QQI A;  4L5I A;  1JGS A;  2ZNY A;  4XLP F;  5ILS A;  4HX4 A;  3DEU A;  4IJA A;  1C0W A;  4I02 A;  1ZAO A;  2B0L A;  4ETS A;  2M1B A;  1H9T A;  2VE9 A;  2NNN A;  1B9M A;  2ZME B;  5LGU A;  1IZ1 A;  5LLQ A;  2O0Y A;  3BDD A;  3RIR A;  1FSH A;  3V7C A;  3GZ5 A;  5DCF A;  4I2O A;  1J7K A;  1O3Q A;  2FU4 A;  2NS0 A;  3BPX A;  3Q5F A;  1K7A A;  3GLX A;  5CYV A;  3I64 A;  4UV9 A;  4HQE A;  1U5T B;  3TOA A;  4CGZ A;  3FM3 A;  2PN6 A;  1BM9 A;  4IRI A;  6PAX A;  1SMY F;  3P9K A;  2PMU A;  3QPT A;  2EFW A;  3WTW C;  5JVT A;  3PFI A;  1F4K A;  3SQN A;  3V7R A;  1OYI A;  3B02 A;  4EM0 B;  4L5J A;  2MLG A;  3F72 A;  5BMZ A;  3I59 A;  2ZJ2 A;  1UST A;  4IHT A;  3GFI A;  1QZY A;  3M7G A;  1P4X A;  2BEO A;  5J8F A;  1BC7 C;  1ZGJ A;  1T39 A;  2XAG A;  4B09 A;  4M6X A;  2XKP A;  4P96 A;  3GF2 A;  1RUO A;  2O8X A;  1IUY A;  2XRO A;  5DUK A;  1ZLK A;  1XN7 A;  2FBK A;  3J81 K;  4RGU A;  5F6F A;  1GHC A;  1FBS A;  2MD5 A;  3NQO A;  5E17 F;  3K1N A;  1XSV A;  4LK1 F;  1IXR C;  3KLN A;  1QBJ A;  2GA2 A;  2XAS A;  2R7F A;  2A6E F;  2Z33 A;  3KFW X;  1FPQ A;  3V7S A;  1G3Y A;  3HRM A;  3MFK A;  3LAP A;  1USS A;  4XSZ F;  4MGR A;  3KLO A;  4YII A;  4EM2 A;  3WTS C;  2AS5 F;  2H94 A;  2M87 A;  2A5Y B;  2HFH A;  1EH7 A;  3P9I A;  4AIK A;  4BHP A;  3KEQ A;  2L4A A;  2ESH A;  1GXQ A;  1ZRF A;  2D2W A;  4P9F A;  2QQB A;  1MKM A;  4L9N A;  2BE5 F;  5BPI A;  1ZH5 A;  1WQ2 A;  1KU3 A;  3GVA A;  1G3T A;  5E18 F;  4BH9 A;  2FOK A;  4BQA A;  2L3D A;  3BJ6 A;  3O3K A;  2QUF A;  4Q48 A;  2F5D A;  3W6K B;  5CVI A;  4HF0 A;  4S05 A;  4LB6 B;  3ERE D;  4AVP A;  4AIJ A;  1BN5 A;  1IXC A;  2RVC A;  3Q9V A;  3BRO A;  4BYY A;  3F23 A;  4KT5 C;  3HRT A;  3QU6 A;  2JZY A;  3QU3 A;  4IF4 A;  3I59 B;  3E6C C;  1FT9 A;  3NEU A;  5DUI A;  1KGS A;  3KP4 A;  2G7U A;  4CHU A;  2LSO A;  4XBF A;  1J9I A;  2A61 A;  3KEO A;  2A3S A;  4I98 B;  3MCZ A;  2FEZ A;  3HRU A;  1UCR A;  1FC3 A;  4FX0 A;  2QM3 A;  1KU9 A;  3JAM Z;  1LDD A;  3IWZ A;  4YG2 F;  1P6R A;  2X4H A;  4ZYE A;  5F64 A;  2J5P A;  2EJR A;  2K86 A;  3R6S A;  4M9Z A;  2RGV A;  2QQ9 A;  1TW2 A;  1R1U A;  1HKS A;  3C7J A;  2Z3Y A;  4UUV A;  1CGP A;  2L01 A;  3FX3 A;  4O3M A;  4A5N A;  2YR2 A;  1SD4 A;  5AIP A;  1U6G A;  1MZB A;  1YW9 A;  2H09 A;  4KN7 X;  3J80 Z;  5HLI A;  3WTZ A;  3VFZ A;  2IA1 A;  1HQC A;  5LEJ A;  2HQN A;  1H0M A;  3F22 A;  4UVA A;  4KIC A;  2CGP A;  4JQF A;  3P7N A;  4OIN F;  4O5V A;  5D4R A;  1QZZ A;  3K69 A;  2ZNZ A;  2WTE A;  3FMS A;  3MEX A;  1T2K A;  1FLI A;  2P5V A;  3ZMV A;  3H3Z A;  5LRS A;  3O6B B;  4I7H A;  3HOS A;  2QQA A;  1R23 A;  2O3F A;  1FBQ A;  5CLS A;  3F8N A;  3G73 A;  4I0B A;  4PGG A;  4ESB A;  5D5U B;  2VOD A;  5D6E A;  3MZH A;  1O3T A;  3BOQ A;  3I5U A;  4HQM A;  2VBX A;  4LMY A;  3IKV A;  4HOB A;  5TRD A;  5ILV A;  4JBA A;  1I1G A;  3E6M A;  1LJ9 A;  4ENJ A;  2VOO A;  3U1D A;  2DK8 A;  3IHU A;  2HTJ A;  4EGY A;  3E3V A;  4I0A A;  3WE2 A;  5D5W B;  1ZRD A;  2KIU A;  1TQI A;  1R58 A;  3I53 A;  4GO1 A;  2KKO A;  2FNP A;  1G3S A;  1AOY A;  1FX7 A;  2QBY A;  1J5Y A;  4OIQ F;  2A69 F;  1RUN A;  2ZBK A;  1PP8 F;  3JSO A;  5F1R A;  1XSD A;  2KIM A;  1T98 A;  3CUQ C;  3FXU A;  5H6R A;  3HSR A;  2W84 A;  4KIF A;  3M8F A;  2D45 A;  3C1D A;  2VC0 A;  2QZ8 A;  3DFG A;  3J80 K;  1IF1 A;  1HBX G;  2DPD A;  5BS6 A;  4G7H F;  5ICE A;  4M74 A;  2OQG A;  4OMY A;  4L0Y B;  3PQK A;  3E5X A;  2P7V B;  1G3W A;  1PUE E;  5L3G A;  1KQ9 A;  4ON0 A;  4L9T A;  4Z2Y A;  3E6D A;  3LWF A;  2ELH A;  1W4M A;  1ZAR A;  2NRA C;  3T1B A;  3WTX C;  3KCC A;  5HS8 A;  1ZRC A;  5CJ9 A;  2Z99 A;  2ZKZ A;  4ZH4 F;  5HOO A;  4LFU A;  5D5X B;  2FRH A;  4U88 A;  1BC8 C;  3GFL A;  1XGM A;  1F9N A;  5E1X A;  3LST A;  5LGN A;  2OZU A;  1KQ0 A;  1Z6R A;  4HLX A;  1RNL A;  2CSO A;  5K5O A;  5D8L B;  2IJL A;  1XSX A;  4PGH A;  3HTS B;  3TDZ C;  4QLC U;  1YIO A;  4P55 A;  1W7P A;  4F7Z A;  2HR3 A;  2EA2 A;  1O3S A;  1YFH A;  1I1S A;  2FBH A;  3DXJ F;  4A6E A;  3R61 A;  2DQL A;  2Y75 A;  3MAJ A;  2C6Y A;  1B1B A;  1W5T A;  3R0J A;  4A6D A;  1S7O A;  1TNT A;  3WTU C;  5LHG A;  3F21 A;  2Y48 A;  2HKX A;  1P2F A;  2VXZ A;  1D5V A;  2R7D A;  2UXN A;  3F6O A;  4RB0 A;  2XUB A;  2OAZ A;  3HYI A;  5A2Q Z;  4UXN A;  1SD6 A;  3RI4 A;  2OA4 A;  3WGH A;  4DQ2 A;  4LG0 B;  1ON2 A;  2GWR A;  3F8C A;  3ABU A;  5ICF A;  1YW7 A;  1YS7 A;  2RN7 A;  2VOP A;  2ZFW A;  3QPH A;  3EDP A;  3KE2 A;  2H6B A;  1YTY A;  1SD7 A;  3BJO A;  3N97 A;  2QYO A;  3JTG A;  2NYX A;  1O57 A;  1S29 A;  4LLL A;  2IVM A;  5L3E A;  3ISP A;  1FP1 D;  5D4S A;  1STZ A;  3RKW A;  2IPQ X;  1BBY A;  3HOT A;  4L0Z B;  3IC7 A;  4L9V A;  4KYW A;  2PLY A;  2MC3 A;  2V9V A;  1REP C;  1PDN C;  1T0F A;  5LEK A;  1FYL A;  3FHZ A;  1Z1D A;  2HYF A;  3K1M A;  1S3J A;  2DO7 A;  2H6C A;  1UFM A;  3D0S A;  3HRS A;  1PP7 U;  1P92 A;  1HKT A;  3CO6 C;  1RZ4 A;  4HW0 A;  4EM1 A;  4N0B A;  4G6Q A;  1O3R A;  2EB7 A;  4BHC A;  3LA3 A;  2F2E A;  5J8C A;  2JRT A;  3V8L A;  4LGW A;  2EFO A;  3K0L A;  2A07 F;  1UHW A;  3LQR A;  4OMZ A;  2HQR A;  1LDK B;  1GVJ A;  4ZZD A;  5CVV A;  1FOK A;  4I09 A;  4M72 A;  1Z7U A;  2QBY B;  4OU0 A;  5D6F A;  3NRV A;  1RIO H;  2XKO A;  1LB2 A;  3LA7 A;  2XRN A;  3ELK A;  4IPA A;  2VN2 A;  1I6X A;  2LDU A;  4P5O A;  3TOB A;  2ZXJ A;  4EMS A;  5FFZ A;  4EJV A;  1LEB A;  1K79 A;  4ZYH A;  3RYR A;  4CYD A;  2P5K A;  1SD5 A;  4R8H A;  5IT9 Z;  3DV8 A;  4EVI A;  2HZT A;  1BIB A;  2EFQ A;  2STT A;  1YYV A;  4UHT A;  1WSU A;  2VBY A;  3DP7 A;  2DI3 A;  4Q4Z F;  2LNB A;  2ESN A;  3RPQ A;  3BJA A;  3QP5 A;  1Q1H A;  1MD0 A;  4NB5 A;  3OOP A;  5E1W A;  4U0V A;  3FXR A;  3OV8 A;  4HF2 A;  3R0A A;  1FY7 A;  2HYG D;  2O03 A;  1T6S A;  2ISZ A;  3G3Z A;  3DQV C;  1IW7 F;  5DEQ A;  1YW8 A;  3LA2 A;  2P8T A;  2YU3 A;  4WXC A;  3V4G A;  3IKT A;  3SFZ A;  1ZG1 A;  4KMU X;  3FMQ A;  2E7X A;  2OBP A;  5DCM B;  5BOX A;  4HLY A;  5HDK A;  3TKY A;  1BI0 A;  3F8B A;  2M8E A;  2UXX A;  3U2R A;  2V79 A;  2V1X A;  4HX8 A;  5LGT A;  5FLX Z;  5CVU A;  1I5Z A;  3C18 A;  3F8F A;  3HIF A;  2RDP A;  2HOE A;  3KP5 A;  4WXH A;  1K78 B;  1TTY A;  3IRR A;  3WU0 A;  3J81 Z;  2G9W A;  3K1P A;  2JTV A;  5LHH A;  4R1H A;  2M30 A;  1OYY A;  2EV6 A;  5L3F A;  2XHK A;  1LQ1 A;  3I0T A;  3QOP A;  2P5L C;  3HSF A;  2VBZ A;  1KU2 A;  2CQK A;  4HDU A;  4HDV A;  1B6A A;  3KP6 A;  3EYY A;  5AON A;  3KP2 A;  3KP3 A;  5LHI A;  2EFP A;  5D8K B;  4RAZ A;  5H20 A;  1O7L A;  1R00 A;  3V8J A;  4MHG A;  4TV7 A;  1MJB A;  4LJZ F;  3T8R A;  1ODD A;  4M9S A;  1W7P D;  1ON1 A;  3HTU A;  3WTT C;  5K5R A;  2YPR A;  4KFC A;  5FLX K;  2W57 A;  2A68 F;  4IRH A;  1JHH A;  2FNA A;  3FWE A;  5DDG A;  3L2C A;  1W7P B;  2VC1 A;  2BBY A;  1Z05 A;  4O6J A;  2WWY A;  3AAF A;  3V8K A;  1FZP B;  5E20 A;  1EH6 A;  3WOD F;  1J0R A;  4EJO A;  1ZLJ A;  3U9G A;  2K02 A;  2HTS A;  4YFN F;  1SMT A;  3GW2 A;  3ZQ7 A;  4EJW A;  4OIP F;  3LAJ A;  2Q2E A;  1SFU A;  3BY6 A;  1B59 A;  5ILU A;  3CDH A;  2HWV A;  5FB2 A;  5ICG A;  4RB2 C;  4U0W A;  3GZ6 A;  2FQ3 A;  2EV5 A;  4KUM A;  3F3X A;  2D1V A;  2O61 A;  3FZV A;  5A2Q K;  2V6C A;  5LRR A;  2UWM A;  2ISY A;  2Q8K A;  3VOD A;  2H27 A;  1Z6T A;  4CDG A;  2JT1 A;  5ERI A;  4JK1 X;  4I01 A;  5IT9 K;  1U5T A;  3CUQ A;  1ZGA A;  2ZO4 A;  1AWC A;  2F5C A;  2P7C B;  5FD5 A;  2M45 A;  5JI6 A;  4M9X A;  4U0Y A;  4MEY F;  1R1V A;  5L3B A;  4ENK A;  3BPV A;  3IWF A;  2GQQ A;  4MTD A;  2HGC A;  5TJJ A;  2RKH A;  3MWM A;  4CIC A;  3ZN1 A;  1H9G A;  4FHT A;  2WC2 A;  4PDK A;  2PEX A;  1CF7 B;  2IA2 A;  2DT5 A;  4WF2 A;  4L18 B;  5JHU A;  4WX9 A;  2LF8 A;  3JTH A;  1L3L A;  4ZYD A;  4GYG A;  3CTA A;  1BI1 A;  4ZYG A;  1HW1 A;  4ESF A;  2PFB A;  4LD5 A;  3TQN A;  1FWZ A;  1WI9 A;  2Z9O A;  2JSC A;  2P6S A;  5DD8 A;  4FX4 A;  3E5Q A;  2KJC A;  4EQQ A;  3JW4 A;  2CFX A;  3MQ0 A;  1XMA A;  4BNC A;  1LNW A;  3TO6 A;  5E8G A;  3SXY A;  1Z9C A;  2M5W A;  1SAX A;  5HDN A;  4ASN A;  4M71 A;  4RB3 C;  2QEN A;  3DKW A;  5LBQ A;  4RGX A;  2STW A;  3E5U A;  2NNY A;  2PMH A;  2BGC A;  4LLG F;  1XGO A;  4UVB A;  5DV5 A;  3DF8 A;  2CG4 A;  3IRQ A;  5KK1 A;  3ZMU A;  1KQ8 A;  3GFM A;  2ZME A;  3CLO A;  4D0P A;  3WU1 B;  2K4J A;  3EUH A;  3N4M A;  4UNO A;  1BJA A;  1LEA A;  3W6J B;  5DYM A;  3ECH A;  3KP7 A;  4XRF A;  3WTV C;  3R4K A;  1R5G A;  2QWW A;  1HXD A;  1R36 A;  1FNN A;  2F5E A;  2HDC A;  4HBL A;  1D3Y A;  4G9Y A;  4GCV A;  4LLN A;  2IP2 A;  2XV4 S;  4P9U A;  2K4B A;  5J6X A;  4S04 A;  3RYP A;  1TNS A;  4K2E A;  4MEX F;  5HS7 A;  1OMI A;  1D8K A;  4A0Z A;  4A2U A;  2MBF A;  3GYH X;  1DP7 P;  2GXG A;  1WKM A;  2DW4 A;  2EK5 A;  1P4W A;  1U3E M;  3GUD A;  1XMK A;  5CVJ A;  1RI7 A;  2W24 A;  2Y0M A;  3K9T A;  3I54 A;  3PQJ A;  4ZZL A;  1OYW A;  2JPB A;  3SHF A;  2MLK A;  1X3U A;  5JR3 A;  1IRG A;  3GXO A;  2V1D A;  1B9N A;  4CO8 A;  2RV8 A;  2L4M A;  4MQV A;  1S6L A;  4KN4 X;  2VBW A;  5DD4 A;  4AIH A;  3VOE A;  3E6B A;  2CO5 A;  1R1T A;  4YFK F;  4IXA A;  5IT3 A;  4XSX F;  1E17 A;  4WK8 F;  2PBI A;  2KRF A;  4MTE A;  3GO5 A;  3WGG A;  3I4P A;  4HV5 A;  4MQ9 F;  2YX7 A;  5EEG A;  1FP2 A;  3ML6 A;  3L9F A;  4WCG A;  4HAM A;  3TO9 A;  1DPR A;  4KDP A;  1BIA A;  4Y13 A;  2W25 A;  3ZPL A;  4YFX F;  2UZK A;  5EEH A;  4LB5 A;  4G7Z F;  2PG4 A;  4UVC A;  3ZMD A;  4AD9 A;  2QVO A;  1ZHF A;  3HSE A;  2LKP A;  2F5F A;  1KYW A;  2O6G E;  3CUQ B;  1I27 A;  1WWX A;  1IAW A;  1QNT A;  3M8E A;  3DPT A;  1DPU A;  1ZYR F;  1OR7 A;  3RPU A;  1FYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...