2E1OA

Solution structure of rsgi ruh-028, a homeobox domain from human cdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Homeobox protein PRH
publication title Solution structure of RSGI RUH-028, a homeobox domain from human cDNA
rcsb
source organism Homo sapiens
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e1oA01
2NS8A 1UMQA 4XK4A 2DMQA 4D7NA 2P81A 1I3QJ 2KT0A 4JX4A 3IH4A 3BG5A 2M34A 2QF7A 2JA6J 1Y1VJ 4XRMA 2DJNA 4LOCA 1GUUA 2WV1A 4BY7J 4DZJA 1W0TA 1JGGA 1BL0A 2K9QA 2R93J 2ECCA 3G1LA 3Q0VA 4MLOA 5E3OA 4A3EJ 2LR8A 2FJ1A 3HM5A 2R7ZJ 2QCOA 1H89C 3HOYJ 5F08A 3H3VK 5C4XJ 3Q0WA 1JT6A 2DA4A 4D5CA 4IHVA 3HOXJ 1QPIA 1B72A 3M3YJ 3TW6A 2YS9A 2DA5A 2DMTA 4GFBA 3S1QJ 4Y52J 4XRSA 2DA1A 3TP0A 2DMUA 1JJ6C 3G1OA 2OF7A 3PO2J 2R5ZB 2NVYJ 1VNDA 2FX0A 2XPWA 3JRGA 1AKHB 4BBRJ 2TCTA 2X48A 3TEDA 5C4JJ 1WI3A 2LLKA 2JA7J 3GTMJ 1LFUP 5EF6A 4A93J 3JRAA 5FJ8J 1AHDP 4XICA 1Q1VA 4A69C 2XB0X 1WH5A 3JRDA 1XS9A 2EZHA 3S1RJ 2XRLA 2MGQA 4HNVA 4JX6A 3PM1A 3LSRA 3IH3A 3Q3SA 1JTYA 1Z77A 5FKMA 5EYRA 1QVUA 1T33A 5EGOA 4Y7NJ 3HDDA 1ETVA 5HODA 2DA3A 1ITYA 1SANA 2E19A 4BBSJ 2GLOA 3BT9A 2H8RA 4IHXA 1IDYA 4D7MA 2EQRA 2I10A 3I4NJ 3BR5A 2E2IJ 3SJMA 5F27A 5JLXA 1RKTA 5FKLA 1OFCX 3BTCA 3S2HJ 4S0HB 4D5FA 9ANTA 1D5YA 4CYCA 4W1UA 4M6VA 1PUFA 1UHSA 2DMNA 3QQAA 5K7ZA 2Y9YA 2JA8J 3HKZN 2GBYA 3B6AA 4MIMA 3LSGA 2LK2A 2DN0A 2FQ4A 2MSYA 1FIAA 3HOWJ 1IRZA 1BW5A 4JYKA 2CUEA 2E1OA 1APLC 2VUMJ 4DYRA 4A3FJ 1QVTA 5IP6A 4NDLA 5GPAA 1IUFA 4XRSG 5DTDA 1JUMA 3BG9A 3QPSA 2XPVA 3BTIA 2G0EA 1IJWC 2M2EA 5IYDJ 3JRBA 5EG0A 1JT0A 1TWFJ 1ZTRA 1Z0XA 1W0UA 4FISA 1MSFC 3E7LA 3HEFA 1A5JA 5M3FJ 1WH7A 3LOCA 1H88C 3ZQFA 1U9OA 4B1RA 2DA2A 1HCRA 2VKVA 1K61A 1ETWA 1F36A 2MG4A 3S1MJ 2XB5A 1X2MA 4ABZA 4RDUA 4A3IJ 1ZR2A 1DU0A 1HDPA 3CCYA 3G1MA 3Q0UA 5J1RA 4A3GJ 1G2HA 3L1PA 4DW6A 2M9HA 4M3FA 1B72B 1MBGA 2DMPA 3JREA 2NVTJ 4EEFG 3WHCA 4B4CA 1Y1WJ 4M3GA 2XGCA 1BJZA 2CQXA 1RKWA 3NARA 1LE8A 1ETYA 5FKNA 2M0CA 2ECBA 4C3IJ 3GTKJ 2KDZA 2OPTA 2HXOA 1MNMC 2K40A 3S14J 2HOTA 2RAEA 3I4MJ 3BTJA 2YUSA 3O8GA 3TW7A 1MBKA 5J1UA 3GTQJ 1ETOA 3F0CA 3ZOBA 5K7FA 4FE7A 5EGOB 1IG7A 3BR0A 4IHYA 1IGNA 3FIWA 2YU9J 3S16J 2L0KA 3A01B 4C3JJ 1VI0A 5DS9A 5F0HA 1ZKGA 2HOAA 4C3HJ 5F1JA 5FKKA 3M4OJ 3GTGJ 1B8IA 4BXXJ 1TWCJ 3BTLA 1MSEC 2B63J 2LY9A 3WHBA 3RZDJ 4MO7A 1ZK8A 2O8KA 3VPRA 2DA6A 5IP9J 1I6HJ 1GT0C 3A01A 2NVXJ 4CYCB 1P7IA 1GV5A 1JUPA 2CRGA 3GBGA 1IV6A 1NK2P 1PUFB 3RQIA 2Y9ZA 4V2FA 3HOUJ 3SDGA 5M3MJ 5J3LA 4DYCA 3S15J 1YRNA 2NVQJ 2R5YA 2L7ZA 2LD5A 3OIOA 1TWAJ 3JRHA 1JKOC 2E2JJ 1NK3P 5IYBJ 4IEJA 1MBHA 5M5WJ 3K2AA 4AC0A 2TRTA 3JRCA 1UG2A 4A3LJ 1WCMJ 5IP7J 5J1YA 4IHWA 2FD5A 1U9NA 2ID6A 2EZLA 2IAIA 2LP0A 2XGDA 4BY1J 5EG0B 3LSJA 4FCYA 5M5YJ 3GTPJ 1U8BA 4A3DJ 2R0QC 2NS7A 1OCTC 1X58A 4JX5A 2CUFA 2W48A 4XIDA 4I6ZA 1VFCA 2CQQA 1EF4A 3H0GJ 4B3AA 1XG1A 2JJ7A 1NTCA 3A03A 2M8GX 5F04A 5EDNA 3W6VA 3HB9A 2O9LA 1ZGWA 4W97A 5IYCJ 2ID3A 5F0CA 1JKQC 1TWGJ 2AHQA 1MBJA 2EZKA 5E3NA 2JMWA 2DA7A 1LE8B 4A3MJ 1SFOJ 5IOYA 2HI3A 2X6OA 1HOMA 2HDDA 3QPLA 2L9RA 3S17J 3HGYA 4V2GA 1I50J 1VF9A 2HYJA 5E3MA 2CJJA 3FISA 3RZOJ 2WB1N 2CU7A 4QIWN 2HXIA 2VI6A 4FE4A 2LVSA 4QTRA 3NAUA 1CQTA 3FKIJ 2K9NA 4AYBN 2Y0SN 1X2NA 1FTTA 3K7AJ 4A3CJ 3IV5A 1JJ8C 4UUSA 1JTXA 4QSHA 1B8IB 1XC5A 1ENHA 3OSFA 1U78A 2MW8A 2JWTA 3GTLJ 1GVDA 3DCFA 3FK6A 3MVPA 3HOZJ 3HBLA 4X1EA 3JRIA 1BA5A 1GV2A 5FKOA 4DZPA 1HDDC 3DEWA 5E3LA 1E3OC 1TWHJ 1YRNB 2LTPA 1ETQA 2JN6A 4UUTA 2R5YB 1H8AC 3ZQGA 1FIPA 3OOUA 3B6CA 5M5XJ 4L5EA 2LKXA 3HGGA 1BW6A 3O8HA 4DYQA 3CDLA 5F0FA 1A6IA 1RESA 4A3JJ 2Y31A 3GTOJ 3LSPA 3BR6A 1R9TJ 1WGXA 2R5ZA 1ETKA 2K9SA 3BR3A 1FEXA 5JLWA 1AKHA 1S7EA 5EZGA 3MN2A 4RBOA 2XSDC 4M3EA 1RR7A 2EBIA 3BG3A 4MFEA 1ORKA 5C3EJ 2R92J 3S2DJ 1RETA 5IOZA 2Y30A 1QRYA 2O7OA 2COBA 2NOGA 4M3DA 4X6AJ 1FTZA 4G12A 5GPCA 2PMZN 3ZQCA 1HLVA 3BR2A 2ELKA 2ME0A 3BR1A 4BKXA 3A02A 4AUXA 2LFBA 3D1NI 1ZQ3P 2WAQN 2IBDA 4A3KJ 1LFBA 1IDZA 2X9DA 1F43A 1OJLA 2EH3A 4A3BJ 3SFIA 1RPWA 3ZQLA 1K83J 1JKPC 2H1KA 3TP3A 4M3BA 2JA5J 1MBFA 5FLMJ 3HOVJ 1HF0A 3JRFA 3UKGA 5FLVA 3OSGA 2IEKA 2GM4A 3PO3J 2XGEA 3GTJJ 4FTHA 1DU6A 2DTZA 5K7HA 2HQ5A 1POGA 2N8GA 2ME6A 5C44J 3CMYA 1MH4A 3FK7A 3MKLA 1IC8A 2JK3A 2XPUA 2ZB9A 1P7JA 1JUSA 2VKEA 1ZR4A 2VPRA 1WPKA 2HOSA 1TC3C 4J19A 3C2BA 2D5VA 3LNQA 1O4XA 1FJLA 5EEAA 2L7FP 1AU7A 2Y2ZA 1JKRC 3S1NJ 3BQYA 4I76A 1MH3A 2EZIA 5GP9A 2E2HJ 3CQZJ 4UUSB 2AO9A 1OCPA 3JR9A 3IH2A 1GDTA 2L7MP 5IPAA 5EZHA 3RKQA 1ETXA 3BQZA 3ZQHA 1T56A 3ZQIA 1MBEA 4JP0A 5BNGA 4C2MJ 4MFDA
chains in the Genus database with same CATH superfamily
3IRQA 4QWQA 3QOPA 3KZYA 2QQAA 4CCOA 1TL8A 1R7JA 5L3GA 2NYXA 4UVAA 1SAXA 4LOCA 5FFZA 2Q2EA 2K9QA 3JAMZ 3Q0VA 4P96A 4A3EJ 3CCLI 1GXPA 3P7NA 1YO5C 3LA3A 2V9PA 4KIGA 3N05A 3EYIA 1YE9A 3F9KA 3KIOA 3MCZA 4PJ0C 3DKWA 4IHVA 4Y33A 4U87A 3K70D 1B72A 3M3YJ 3FXMA 2KP6A 2YS9A 5LEKA 4RGRA 5CVJA 2DA1A 5ICGA 1V55H 1VNDA 2FX0A 2HVQA 2WA0A 1K79A 2E5NA 1T0FA 3PNTA 4LJZF 2E7WA 1JHHA 2Q1ZB 4BBRJ 1S29A 3TEDA 3BZCA 2JTVA 2FU4A 2LLKA 2HQNA 3V8KA 3BY6A 1A31A 2VJJA 4O3MA 3GTMJ 4CCJA 1LFUP 2NXNB 4A93J 3DXJF 1YI2I 1WJDA 2JSCA 3UR3C 1ZELA 3MZYA 1FY7A 2DT7B 2LY1A 4DJAA 1SD4A 4A0XA 3AG1H 3D0SA 2JPCA 1SD5A 2XRLA 3OR1C 3LSRA 1QHHD 3IH3A 2R7RA 3EQLF 3Q3SA 1SFEA 3FXRA 3Q9VA 4N4OB 2CW8A 2WWYA 4XKCA 4B3XA 4IRIA 4CGZA 4Q4ZF 2FMYA 1ZG1A 1T33A 3ISPA 4Y7NJ 5HODA 1ZRFA 5D5VB 2M4GA 3PSIA 1ITYA 2VT2A 2R7QA 2GLOA 3CZ6A 1IDYA 2OCCH 2Y0SA 4A12A 3WTSC 2XAHA 4Y4RA 1J9IA 2PJRA 2G9WA 2OCEA 4GYGA 5JLXA 1RKTA 2DT6A 3IHUA 5FKLA 1OFCX 3QWLA 2XAUA 3S2HJ 2KZGA 1T8IA 1Y39A 2ZXWH 4AVZA 3I54A 2BEOA 4NC6A 4D5FA 9ANTA 4IZZA 4CYCA 5D4SA 2R7OA 2VBZA 1E0EA 5B1BH 1UHSA 3QQAA 3PFIA 4ZH4F 4F55A 2PJPA 2OQRA 1WWXA 1AA7A 4UV8A 3K70C 2MSYA 3SQNA 1FIAA 3LSIA 4CZZA 2GIVA 1APLC 1GLNA 1DP7P 5KCMA 2HQAA 2M87A 2UV1A 3QRFF 2OJED 1QVTA 5TGTA 5IP6A 1R00A 2IRFG 5GPAA 2P5VA 1QBJA 2UWMA 4IF4A 5BPIA 4XRSG 2QENA 5DTDA 2K27A 2XPVA 2HU9A 1Z05A 1UELB 2FOKA 1X1PA 1GVJA 1QGPA 4P55A 5CVVA 1HXDA 4CDGA 2MD5A 3L9FA 4I09A 3FHNA 1A5JA 4E7JA 1YTYA 1EA3A 3W6JB 3LOCA 2M0MA 4ZYHA 2ZC2A 4CYDA 2Q2EB 3BPVA 1K61A 2BBYA 3P5JA 2AQEA 4XKBA 3VODA 3VYTB 2XB5A 4G6TB 4Y15A 4ABZA 1BI0A 2V79A 4NUBA 3SZTA 3Q0UA 4A3GJ 3R4KA 1G2HA 3L1PA 2FSWA 3PFYA 1B72B 1VQMI 2K85A 1SVLA 1A04A 2BYVE 4EEFG 2A07F 4B4CA 2KRHA 5JR3A 3DBRB 1N77A 1RKWA 3TOBA 3R0JA 2GQQA 2ECBA 2W85A 3GTKJ 1XPXA 2V1NA 1JI8A 3KP7A 1U5TC 3PQKA 4G6DA 3MQ0A 3IWFA 3OMYA 2MH9A 4E7LA 2YUSA 2JA2A 2MLGA 4BQOA 1E3HA 3ZCOA 1U0JA 3EYYA 1HW2A 2OTJI 5H2FC 2IA0A 5KVRA 3JCUC 5BQTA 4XLFA 1IZ1A 2HDCA 2D45A 2GOXB 4F93B 1YQAA 3BR0A 1YYVA 4DBQA 4HNTA 3FIWA 2MYSA 3VFZA 2L0KA 3HSEA 3A01B 5DUKA 1R23A 4BNCA 3I56I 2HOAA 3E6CC 1XCVA 3OYCA 4C3HJ 1F4KA 3GTGJ 2A5YB 2PJRB 1R5HA 3O2PE 2W82A 2EIJH 2V6CA 3FMRA 2GIZA 3ZRGA 3ZMSA 5HS8A 4WWCA 2XC7A 3LL7A 2DA6A 2IP2A 4NQWA 1VQ5I 1I6HJ 2KIUA 4LFUA 1HKSA 1X1CA 3DF8A 4CYCB 3OWTA 3GBGA 4AYBA 4N9IA 5KAIC 5HLIA 3RQIA 5M3MJ 5DM6F 4EM0B 1SVOA 4OMZA 4KDPA 4LB5A 1YRNA 2WBMA 2NVQJ 2BXZA 2LF7A 1YFHA 1YW8A 3F22A 3OIOA 1UJ8A 4L5JA 2LKSA 3GYHX 1EJ9A 3V7CA 2KPMA 1BR1A 3DEEA 3FBNB 1VQPI 3GFLA 2HQRA 3CESA 1TW2A 5IP7J 1LNWA 5DD8A 2FD5A 2EZLA 2MA3A 3HOTA 4B43A 3LSJA 3IL2A 3SZPA 1A35A 3MFKA 4GCVA 4XLPF 4A3DJ 1YW7A 2ACJA 1IRFA 3TKYA 3BC8A 2YPRA 1VQOI 5CYVA 1I39A 2IGMA 4E7KA 4ANJA 3TO7A 1OMIA 1XGNA 5FFXA 2VLAA 2ZMEC 3A03A 1R22A 5J47A 3H9QA 4YIRX 2Z99A 3DBLB 5ED4A 1WFXA 3HTUA 4CA0A 4Y17A 1I1GA 2H94A 1MBJA 4RGSA 2ESNA 3WGHA 2AXTC 4KIBA 5E3NA 3W2AA 2IXSA 3OR2C 4EQQA 2FBKA 3OYKA 3OYLA 1SFUA 3BDDA 3H36A 2PMZA 4OIPF 2HR3A 1UCRA 2HFHA 5IOYA 2HI3A 3REOA 2YU3A 2WADA 2W1OA 2MBFA 3OYDA 3HGYA 1S72I 1D0XA 1VF9A 2EFQA 2BGCA 1O7LA 4HG2A 2ZSHB 3OYMA 3FISA 2MC4A 5LD2C 3MZ8A 4BUPA 3L2RA 3HXLA 1IV8A 1HW5A 3FX3A 3NAUA 1RZ4A 3KP4A 1YITI 4XONA 5DV5A 3FWEA 3HKZA 2NNYA 4M9SA 3M7GA 5DEQA 4AYBN 2KJCA 1X2NA 1FTTA 5D8LB 4ON0A 1JJ8C 3C1DA 2FMLA 4RAYA 4ENJA 2FBHA 5J6XA 4BEHA 3GFIA 4UUVA 1WJAA 2DLLA 3KP6A 1HSJA 1NG7A 4MTEA 2NOJB 4XN3A 4FASD 5FRNA 4XKWA 1GVDA 2JQ7A 3ONQA 2QSHX 4NQWB 1UB9A 3GFJA 4PGHA 2J5PA 1BR4A 1I6XA 2W24A 4X1EA 3WTXC 2DYSH 4NBQA 3EETA 4G94A 4CCMA 1OCOH 2VN2A 3DEWA 5E3LA 3CJQB 1NH3A 1E3OC 4PJLA 1YRNB 2JN6A 3HC7A 4NC8A 2M7BA 3GMEA 4FX0A 3WTUC 4DIQA 4L9VA 4OIOF 4CHUA 4ZYDA 2F5CA 3O8HA 2IA2A 4DYQA 4L9NA 2PX9A 5F0FA 1ZN2A 1X3UA 3L2VA 3MWMA 2DO7A 4A3JJ 5HDGA 5GADJ 4Z6YA 2Y31A 1XDUA 4YFKF 4CZCA 3BR6A 1R9TJ 2XGXA 3BJAA 3RJPA 3K2ZA 3BG6A 1LKXA 1S7EA 2Y75A 4M3EA 3BG3A 2XROA 4ZZLA 5B3SH 3H35A 1K7AA 4PGGA 3OYFA 5IOZA 1KYWA 1TQMA 3RYPA 2Q0OA 2A6HF 5E79C 1KU3A 1ZAOA 1ZG3A 2Y48A 3DPLC 2PMZN 1T98A 4G12A 4H4KC 5HLTA 1HLVA 3O6BB 3SDBA 1K78A 2ELKA 1R49A 1G6NA 3D1NI 1ZQ3P 2CV0A 1TNSA 2IBDA 1YS6A 2DOFA 3KE2A 2X9DA 2OZUA 2VE8A 4DNCA 4Q47A 2F4MB 1OJLA 2EH3A 3LSHA 3M1EA 2XRNA 1MNEA 1U2WA 3ZQLA 1ZRCA 4G7HF 1K83J 2H1KA 4I0BA 2ISZA 2E1MC 3ZMTA 5HVQC 2ISYA 5K1YA 3HRMA 1MBFA 2A61A 1LB2A 4I99C 1PDNC 3HIFA 3UKGA 3OSGA 1O3SA 5FLVA 4A2UA 2PN6A 3HL2A 2QSGX 2BHZA 2XF7A 2LG4A 1DU6A 3RPUA 1ZLJA 1FOWA 5K7HA 4OIQF 4KT5C 2HQ5A 1D1BA 1XCBA 3CMYA 1ON2A 3CJTB 3JSPA 2EA2A 2VQCA 2CG4A 2O0YA 3WU2C 5GTIC 1ULYA 2Z1DA 2VKEA 4PJJA 3V7SA 3TMOA 1D5VA 1R4MB 4J19A 1V4RA 2D5VA 3G2BA 2YSRA 4YG2F 2JSPA 3BJOA 2Y2ZA 1F5TA 3GF2A 3BQYA 2CO5A 4IOAF 4I76A 3F6OA 1N78A 2VASA 2RNJA 1R36A 3JR9A 4BEHB 4S04A 2JRTA 3IH2A 1GDTA 2L7MP 4ZYEA 2GOMA 4BXUA 5IPAA 3HOSA 1J75A 5EZHA 4A0ZA 4WK8F 3J81Z 2LMDA 4E7HA 1R6RA 2BY1A 4UVBA 1X1DA 3CC7I 2KIMA 2DMQA 1P92A 1I3QJ 2CV2A 1RUNA 2KT0A 2L02A 2YX4A 2VC1A 2M34A 2QF7A 2EWNA 2DJNA 3VSKA 4ZYAA 3TGNA 1B9MA 1G59A 1MMDA 1YLFA 4BY7J 3F21A 1BL0A 3HHGA 1ZARA 1X4OA 1SMTA 5E3OA 3J80Z 3HM5A 2FJ1A 3HUGA 5B5EC 2QCOA 3KEQA 4LITA 5AONA 1DP3A 1XMAA 1WZ2A 3WGIA 5C4XJ 1JT6A 2XSJC 1RUOA 2E34A 1XGMA 2DA5A 1FBQA 3IKTA 3TP0A 2CS3A 1LFPA 4U7DA 1OR7C 1Y0UA 2IA1A 2QGUA 2TCTA 4RM3A 5C4JJ 4P9FA 2QEXI 2JA7J 1P2FA 1TQIA 4A6EA 2GXBA 4LIUA 5L3BA 1YHQI 5LBQA 4PJNA 2L4MA 5FJ8J 2Y0MA 1Q1HA 4KT6A 4IRGA 3N4MA 3OS2A 4AD9A 3I0TA 1K78B 2XB0X 1XS9A 2OBPA 1O3QA 2EILH 5CVIA 1Z77A 1FPQA 2B7EA 3G4SI 4RGXA 5FKMA 5EYRA 3DKYA 2DA3A 2E19A 3K4MA 3BT9A 2BE5F 3HTSB 2VOOA 1DDNA 2LNBA 4I7HA 5AIQA 3H5NA 3SJMA 2STTA 5LHHA 3BTCA 3F8MA 4XN0A 3A4CA 1QZEA 2ZNYA 4KJZA 2NVUB 4AIHA 1S9HA 5EEGA 2KRFA 4S0HB 2JVHA 1KONA 1D5YA 3HSFA 2L9SA 3I5UA 2L4AA 3CO6C 4CH7A 3E5QA 1PUFA 1FOXA 3EUHC 2DMNA 2VBWA 1DUXC 3JW4A 1IXRC 2GBYA 3B6AA 2PBIA 1KYZA 2LK2A 5LHIA 1H9TA 3QYBA 1FYLA 1IRZA 5DDGA 2DK8A 5IT3A 4KN7X 2VUMJ 3FXQA 2E71A 2XAJA 5FROA 4M74A 1TNTA 1VQNI 3F8FA 4EV0A 4NDLA 3CCQI 4U7BA 4ENNA 1Z1DA 2R7DA 1Y56A 3QPSA 3FDYA 4TV7A 2XF5A 2H09A 2M2EA 2XVCA 2P7VB 4CICA 2R7FA 4MQ9F 3JRBA 4DQ2A 2MABA 4BACA 4LIVA 3V4GA 3TQNA 3F6VA 2QKMB 1TWFJ 4HLXA 2F4IA 1QPMA 5D5UB 2IPQX 3WTTC 3HEFA 4EM1A 1A36A 1D8KA 5M3FJ 5CKTA 1H88C 3RI4A 3RDIA 1U9OA 3K69A 1S3JA 5LFAA 1R58A 1R1TA 2NNNA 2P5KA 3HUGB 1ETWA 2XKPA 1F36A 3HSRA 2MLKA 3CLQA 1X2MA 4RDUA 4A3IJ 1ZR2A 4JQFA 3CUOA 3MEXA 3CCYA 3G1MA 5J1RA 1IAWA 1J0RA 1CF7A 2M8EA 3D5RC 1Z67A 2ELHA 3JREA 2K7LA 4RS8A 2NVTJ 5J40A 2D1HA 2ZJ2A 3LQQA 5FLXZ 1DQUA 2Z2SB 1O7FA 3E0JB 2L3DA 3MZHA 2QWWA 1ETYA 5FKNA 1IN6A 1ACIA 2M0CA 4C3IJ 3IWZA 4M6YA 1KQ8A 1DGWY 1S7OA 4V19K 2HXOA 3A1YA 2K40A 3AKZA 4KFCA 3BTJA 3K4NA 1H0MA 3VYSB 2VODA 3F3XA 1K4TA 2CMPA 2CH0A 5J1UA 3QU6A 1ETOA 3F0CA 1IG7A 2FF4A 4FE7A 5H20A 1UZCA 3SZGA 2CQ7A 1ON1A 5K7FA 4WX9A 2HKOA 4FX4A 3L2UA 1G4DA 2YU9J 1MJAA 3S16J 1XGSA 1IN7A 1MMGA 1D1AA 3S93A 3BJ6A 4C3JJ 4ENKA 1T95A 2EV5A 5FKKA 3COAC 3M4OJ 1B1BA 1TWCJ 1FX7A 3QYEA 1MSEC 2PI0A 2B63J 2LY9A 1KQ9A 4ASNA 4GDFA 2IVMA 2WB1A 3RZDJ 3J7AO 3RKYA 2RGVA 1R71A 1P4AA 3VPRA 2WTEA 2VXDA 5TISC 3ZMDA 1S5LC 1D8JA 4B47A 5IP9J 1MJBA 4EJOA 3VB2A 3FMSA 3A01A 4HPQA 1GT0C 3DLLF 1GV5A 3OYHA 2CRGA 1WKMA 1PUFB 2L9VA 3SHFA 1RRJA 2Y9ZA 3SDGA 3ROUA 5D5WB 3I55I 5K5RA 2W4SA 1LQ1A 1ODDA 2KL4A 4AIDA 3WG7H 4IQ4A 5GAEJ 3MAJA 2CUJA 3T5XA 1KA8A 5M5WJ 1YX3A 3H9JA 2TRTA 4AC0A 4EJWA 2P6TA 3WODF 2LOOA 4PJMA 3KLNA 5L3EA 1KU2A 2F5DA 1VQ8I 2EV0A 3PQJA 1JGSA 5FD6A 1BBYA 2IGOA 3NEUA 4IHWA 5F64A 3KP2A 1YIJI 2L01A 1U9NA 1FSHA 3K0LA 2IAIA 2P6SA 3EPZA 4HV6A 2Z3YA 4G7OF 1YOVB 2W00A 4IPAA 3S8PA 4B8XA 4D1QA 2I8DA 4ZC3A 1WJEA 1FMVA 2R0QC 2NS7A 1SD7A 2W48A 1FBUA 3OYNA 2HVRA 2DOAA 2KLOA 4LGWA 4XIDA 4KUMA 2QBYA 2VBYA 3EDPA 4B3AA 1DPUA 4XM3A 1NTCA 3ZP5A 3KP3A 1SC7A 5E1XA 2PMHA 3HB9A 4N9HA 3M8FA 4B44A 4IVNA 1ZGWA 5D8KB 1CF7B 4I01A 1YW9A 1VQ4I 2CFXA 1TWGJ 3PIOF 2H27A 2F6CA 3FXLA 4ESBA 3J81K 3CD6I 2DA7A 4ZTFA 3F72A 2ZFWA 4Q48A 2V1DA 4MEYF 4A3MJ 4UV9A 4RMNA 1G3WA 3P9IA 4BXFA 1HSTA 5JVTA 2L7KA 1SFXA 1I50J 2XDVA 3GFMA 3HRSA 2O03A 5E3MA 2QUFA 4I0AA 3ASNH 2WB1N 2CU7A 2HXIA 2XHKA 5A2QZ 3J80K 4KNYA 4IHTA 1IXSB 2FNAA 3DTIA 3TDZC 1WQ2A 3M1CA 3IAM2 2LSOA 4P9UA 4NB5A 3FZVA 3R0AA 1I27A 2Y0SN 4HX8A 1S6LA 3RSNA 2E1MB 3G71I 1G3YA 2DT5A 3K7AJ 4A3CJ 2DQRA 2DI3A 2EPFA 4UUSA 4KICA 2A6EF 4AM3A 4QSHA 5JI6A 1U78A 2HVSA 2HNHA 2MW8A 1R5ID 2JWTA 2WY7Q 4HDVA 2X1CA 3RPQA 3FK6A 3DV8A 3RTRA 4M73A 5HLGA 3BOQA 4U0YA 2VJIA 1R5GA 4JBAA 1A6QA 2F48A 1XN7A 3EUHA 5IY5H 2DU9A 2PLYA 3VEPA 2LY2A 4QPQA 3I59A 2LTPA 1TZLA 1H8AC 1FIPA 3OOUA 2OQGA 3B6CA 4UHTA 1V5EA 3M07A 3OIPA 5F6FA 5HS9A 2EV6A 3GTOJ 1LJ9A 3E5XA 1UHMA 3M8EA 2R5ZA 2O6GE 3BR3A 2X1DA 3DFGA 5D4RA 5EZGA 3MN2A 1IO2A 1RR7A 4Y3OA 3F8CA 5C3EJ 2R92J 1FLIA 1O57A 4XLNF 4RAZA 3WU0A 2DW4A 3QODA 4F3QA 1LDKB 3FM5A 4BHCA 3L7WA 3S3OA 1BC8C 2QBYB 3A02A 2LFBA 3BPXA 1PVEA 1STZA 4ESJA 4A3KJ 1HKTA 2HPMA 1KQ0A 3T8TA 1RPWA 3CLOA 2QQBA 3M8JA 4O6JA 2R7UA 1SD6A 1MNDA 4E7SA 1S8NA 1MD0A 3HOVJ 2XAFA 1DGRM 2IEKA 2LKPA 3GCMA 3TO6A 2R7TA 2HGCA 5E17F 4RB3C 3QOEA 5TJJA 3Q9SA 3FBIB 2RVCA 2DTZA 3AG2H 3OL3A 4MNUA 3HJEA 2N8GA 1N75A 4E6KG 5HNHA 2IGNA 2QQ9A 1GHCA 4PZJA 3DQVC 1Z7UA 4IX7A 1IC8A 4L9JA 3ZMVA 1P7JA 1TTYA 1HBXG 1WPKA 3H1CA 1TC3C 3IUOA 1LEBA 3LNQA 1FJLA 1EV7A 3CUQC 2DFHA 3KPHA 4FHTA 1MGTA 2LYCA 1AU7A 4RGUA 3L2QA 4HW0A 3KCCA 5CLSA 1OQYA 3S1NJ 4HSRA 4BJ5C 2PFBA 3S3MA 2M4KA 1IF1A 3W3CA 3OYJA 5GP9A 2CWEA 3HRTA 4UUSB 3R60A 5FLXK 2LREA 5LGNA 1KGSA 1X19A 2P4WA 3BQZA 5E20A 4BYYA 1T56A 3C3WA 3CDIA 4HEA2 2M1BA 2V26A 4JP0A 5BNGA 1MW7A 3MKZA 1T38A 4EJTA 4ZZDA 4D7NA 2P81A 5CJ9A 3U1DA 4BQNA 4JX4A 2V4JC 1TLHB 1X1AA 4XMYA 1X1BA 4E7ZA 2JA6J 1Y1VJ 4XRMA 1EH8A 4MGRA 3D5SC 1GUUA 1W0TA 3I59B 1JGGA 2R93J 2OU2A 4HQMA 4MLOA 1JE8A 2AXLA 4R79A 1TT0A 4N0BA 3E3VA 2PG4A 5ERIA 2DCEA 3HOYJ 2X6YA 5F08A 5TRDA 3Q0WA 4XKVA 4D5CA 3HOXJ 3CCMI 1YJNI 1OISA 1QPIA 3TW6A 2P0WA 1FP2A 5H6QA 2DMTA 1BI3A 4D0PA 1JJ6C 2DMUA 1U8RA 5FD5A 3H3ZA 3PO2J 3CCEI 1OLTA 2R5ZB 2NVYJ 2VJ5A 4II3A 2EFPA 1IW7F 3KLOA 3OY9A 1WI9A 3DKXA 2X48A 3PUFA 1TW3A 2MFZA 3HZJA 2IS2A 3BWGA 1J09A 3TO9A 2M30A 2CSOA 3JRAA 2A5WA 2DPDA 1AHDP 4XICA 2EK5A 4BS9A 1Q1VA 1WH5A 3JRDA 1G3SA 3FXKA 1MKMA 3S1RJ 2FE3A 5E8GA 1EH6A 4RAFA 4JK1X 5EJCA 5LLQA 4F91B 2VKHA 3H5AA 2RREA 3BP8A 5EGOA 3HDDA 1ETVA 2OA4A 5LGUA 3TL4X 4IHXA 2E60A 2F4OB 3BROA 5ICEA 3DU5A 2EQRA 1YG2A 5ICFA 2I10A 3I4NJ 5F27A 2XAQA 2JUCA 1K6OA 5HDKA 3CF5F 5BPDA 4Z2YA 4RLQA 3HPGA 3ULQB 4QPOA 3QP6A 3VYUB 5JHUA 1SEUA 1QU3A 4W1UA 2BY3A 2HZDA 3M9AA 1U3EM 2HZTA 1R4NB 5K7ZA 3DTKA 1Y0NA 4LMYA 4II2A 2R7WA 1VTNC 3HKZN 2D1VA 4OINF 1Y8RB 4MIMA 3HRUA 4PFPA 2WV0A 4UB8C 2DN0A 4C2UA 2DBBA 2VQGA 4HDUA 1V3FA 3G73A 3OYIA 3ECOA 2HDWA 3CCUI 1W7PB 4NC7A 5JVGF 1U5TA 4M72A 1GXQA 2HPIA 1OYIA 4DYRA 2D2WA 2R7SA 4BJTA 3JSOA 2CQNA 4GO1A 1FT9A 2YX7A 3ABLH 2ZSIB 2WAEA 1TQPA 1IUFA 3HPHA 1JUMA 1VQLI 1P4WA 4KN4X 1IJWC 1MJ9A 2EIKH 2RC4A 5IYDJ 4FT8A 4OAYA 4LG0A 4BJ6C 2ETHA 1FBSA 2XASA 3FXJA 5ILSA 3ZXSA 5EG0A 1ZTRA 1MIJA 3ZQ7A 3PNYA 2FBIA 3E7LA 2RQQA 3MMYB 1WH7A 1X3ZB 5A2QK 3ZQFA 1D1CA 2DOEA 3CP8A 2F2EA 4EVIA 1HCRA 3ZMZA 2MG4A 3CJRB 1IXCA 3JTGA 3W2WA 2WAQA 1DU0A 2P5LC 5DM7F 1RC9A 2A3SA 2COMA 4DW6A 2A68F 2M9HA 4UVCA 3K10A 5FRMA 4OAZA 2QVOA 4XLHA 1Y1WJ 4M3GA 2XGCA 5FGMA 2CQXA 4YFNF 1XMXA 1BI1A 4XL9A 2JVGA 3NARA 1LE8A 1QHGA 2VPLA 4XLEA 1B59A 1V5FA 2J5OA 2K4BA 2NRAC 4KISA 2OPTA 4BQQA 2Z33A 3S14J 2RAEA 3RYRA 3I4MJ 1OKRA 2KHMA 5LRRA 2R7VA 2W7NA 3TW7A 4R8HA 2R7XA 3PSFA 4PSWA 4PCQA 3GTQJ 2VJ4A 4C30A 5L3CA 3CC4I 3H5RA 2OZ6A 1OPCA 3ZOBA 5EGOB 1IGNA 1M1EB 1K6YA 2P8TA 3ECHA 2VC0A 1V5GA 1C0WA 3CP2A 1RR8C 3P9CA 2FEZA 5F0HA 2OAZA 3SEQA 2UUZA 2FNPA 5F1JA 1B8IA 2ZMEA 2QSFX 3ABTA 3BTLA 4ETSA 3CO7C 3WHBA 4AIKA 1NHAA 1ZHFA 3ZN1A 4OU0A 4MO7A 3O3KA 3KETA 2O8KA 2EIMH 4XBFA 4CCKA 1WRJA 3IAS2 4HSTA 4LK1F 1Z7LA 1WJCA 2QKLB 1IV6A 2HYFA 5F1RA 2BY2A 4J01A 3HOUJ 2KMUA 3C2GA 5J3LA 4DYCA 3CUQA 1BIAA 3K4KA 2LD5A 2EA4A 1BM9A 1JKOC 2E2JJ 1U5TB 5IYBJ 5LRSA 4IXAA 3SXYA 3FKJA 1MBHA 1MZBA 1EKEA 3JRCA 3SYTA 4A5MA 2OV7A 4LB6B 3JTHA 3L00A 4DGWB 2RN7A 4A3LJ 1WCMJ 3I64A 5D6EA 1OCCH 2EFOA 2E36A 3GZ5A 4P1WA 1UFMA 2ID6A 1WJBA 3EUKL 2XGDA 4R1HA 1UG0A 3PL8A 4KIFA 5EG0B 3HHHA 4IO9F 4LG0B 3I4PA 5HNFA 4BDYA 3GTPJ 4CCLA 5GAHJ 2X0LA 1U8BA 2BY0A 4RB1A 1T6SA 1D0YA 4BAYA 4QLCU 3OS1A 3CJNA 5J4VA 2CUFA 2ZCWA 4I6ZA 4BHPA 1RI7A 1VQ6I 4YIIA 1EF4A 3K4JA 3H0GJ 1XSDA 4IKFA 2JJ7A 3GEZA 3FXOA 5F04A 3P9KA 2X1EA 5EDNA 4RAGA 4I2OA 3T0YA 2O9LA 5EEHA 1R1VA 4D9JA 5IT9K 5J8FA 3LA2A 2LF8A 2AHQA 2VQLA 2X85A 4LLNA 1W36D 1I5ZA 1BI2A 4XOPA 1WJ5A 2O8XA 5CQEA 3SEZA 2K9MA 3V8LA 2ZBKA 4WF2A 1LE8B 4G9YA 1SFOJ 2ELJA 3ZR8X 1BC7C 3QPLA 2OTLI 4L0ZB 3HYIA 3S17J 4KMUX 3E97A 2LH9A 2L2OA 4V2GA 2HYJA 4L5IA 1Z9CA 3T1BA 1ZGAA 3N97A 3GUDA 2UXXA 3PUBA 4FE4A 2O3FA 2LVSA 4FQGA 3TOAA 2K3FA 4LLLA 3AAFA 4RM2A 3BZ6A 1CQTA 3NQOA 1DPRA 3PIPF 1MMSA 3WG9A 4CCNA 5E1ZB 2LBFA 1RNLA 2FOWA 2RNGA 3QU3A 3IV5A 1JTXA 3K4BA 1Z3XA 4LD5A 4CXFA 2ZXJA 5JFRA 1B8IB 4EM2A 5L3FA 2DTRA 1ENHA 6PAXA 2ZMEB 3VWBA 2GWRA 5B66C 4NHJA 2M3AA 3UNGC 3K1NA 5L3DA 3MVPA 2W57A 1XGOA 3HOZJ 2NS0A 3IRRA 2KKOA 1AOYA 2TDXA 4L9TA 1BA5A 1PYVA 5B1AH 2ZJPF 1ONVA 1JXSA 4DZPA 1HDDC 4BE1A 1TWHJ 3CUQB 4M71A 1ETQA 4WXHA 1SVMA 4UUTA 1B4AA 3T8RA 3BG7A 2AS5F 2GA1A 2GXAA 4EGYA 1W36C 5HS7A 3HGGA 2LKXA 5KHDA 1Z6TA 3A2KA 3I3LA 5DD4A 2I5UA 3DWLE 1LPQA 3ABKH 1RESA 1IRXA 4HX4A 3B73A 3FM3A 4DBRA 4B09A 3GWZA 3DPUA 1EH7A 1WGXA 3U2RA 2K9SA 4AWXB 5JLWA 1AKHA 1J5YA 3VOEA 4HAMA 3NWTA 2IJLA 4MFEA 2C6YA 2HS5A 3S2DJ 1RETA 3VYRB 3QAHA 2Z9OA 2Y30A 3QYFA 1O3TA 2COBA 4XLCA 3GXOA 3S32A 1F9NA 1FMWA 4F92B 4BKXA 1SAUA 5LEJA 4XORA 3SFZA 1BOBA 2ZJRF 3BCBA 3AL0C 1PP7U 1LFBA 3J7YJ 1IDZA 3CCRI 2DYRH 3ELKA 3GLXA 2K5CA 2QA4I 3R61A 3MKWB 4A3BJ 2H1LA 3KZIC 2IS4A 5AIPA 5ILVA 3U9GA 3OV8A 1JKPC 3FXUA 2V9VA 3TP3A 1J59A 2IGKA 4AU7A 2JA5J 3WGGA 4ESFA 4WCGA 5FLMJ 2E35A 3JRFA 3RPUD 3CF2A 3LFKA 2GM4A 3W6KB 3PO3J 2K4JA 3DP7A 3GTJJ 1X4PA 4C9YA 4RLFA 1T08B 1PJRA 3QP5A 5HOOA 1IN5A 5CVUA 5J4YA 1T2KA 5C44J 3LA7A 4RB2C 2BW3A 2PEXA 3FK7A 1HQCA 3QPHA 2M5WA 2ZFUA 4S05A 1OR7A 3OOPA 2VPRA 2OUMA 3LAPA 2HOSA 1X3WB 3C2BA 1FOYA 4EGZA 1KU7A 2CV1A 2MH2A 4P5OA 3F8BA 5KK1A 4RA2A 1FZPB 3ML6A 1JKRC 4O5VA 2LBFB 3D5LA 2VL8A 1B9NA 2EZIA 2E2HJ 3E1SA 4I98B 4PDKA 3CQZJ 2M7AA 2ICWG 2AO9A 1OCPA 3ZPLA 2PMUA 3ESWB 3FHZA 4HYEA 2KQRA 1V54H 1ZREA 2X6XA 3ABUA 3RKQA 1ETXA 3K9TA 2H6BA 3WTVC 4XRFA 1XB4A 4YIFA 2NS8A 1UMQA 4XK4A 1Y8QB 1YX5A 2XV4S 1HKQA 1ZYRF 2GZWA 1I3AA 3IH4A 2VBXA 3BG5A 1FP1D 2EJRA 2V7FA 3FMQA 3I53A 3ZGKA 2WV1A 4DZJA 3WE2A 4XLAA 1REPC 3OYBA 2ECCA 3G1LA 1LVKA 2W84A 2LR8A 2R7ZJ 1H89C 2CYYA 3OIQA 3NRVA 3H3VK 3NWSA 1LDDA 1USTA 2DA4A 4GGGA 4BH9A 2DK5A 1XX5A 2GXGA 4L18B 3C18A 4LLGF 4GFBA 3LSMA 3S1QJ 4XRSA 4UXNA 4Y52J 4BE2A 2HKXA 3G1OA 2OF7A 3CMAI 1WSUA 2DJIA 3DLAA 2XPWA 3JRGA 1AKHB 3RIRA 2VT3A 1WVRA 2HYGD 1WI3A 2BZTA 1QO0D 3V42A 5EF6A 4CO8A 2YR2A 3AG3H 5K5QA 2KIQA 2CW7A 3OL4A 4WXCA 3CDHA 3DBHB 2DODA 3KZZA 2QQ8A 4XSZF 4A69C 4EJUA 2P7CB 1YIOA 2QYOA 2B0LA 2EZHA 1B6AA 4XR6A 2MGQA 2O5RA 2XAGA 3PM1A 4JX6A 4I02A 4HNVA 1RIOH 3EUAA 1JTYA 4ZDOA 4ZTJA 2F5VA 1QVUA 2ESHA 4IL6C 1IRGA 1SANA 2V1XA 3U1KA 4LG3A 2WY8Q 4BBSJ 2H8RA 4L0YB 2XIGA 1G3TA 4D7MA 4RB0A 2E7XA 4HRIA 3BR5A 3IKVA 2CGPA 2E2IJ 4XNFA 2RKHA 2V6EA 1D3YA 2Q8KA 2RDPA 2E1CA 5FB2A 4H0EA 2R3SA 4HF1A 4NNJA 2Z16A 4LK0F 4PSXA 1KU9A 2H8WA 2RQPA 2CQKA 1QZYA 2BW3B 2KDOA 4M6VA 4EMSA 2A05A 4U0WA 1XSXA 3B02A 3G3ZA 2Y9YA 4XSXF 5GTHC 4ZJZA 2JA8J 2L9NA 5DUIA 3LSGA 2B9SA 1WHUA 2FQ4A 4GRIA 3V7RA 2K9LA 1LVAA 3GLLA 3HOWJ 4JYKA 3WE3A 1BW5A 2X6WA 2CUEA 2E1OA 1VQ9I 4PUSA 3L2CA 4BHBA 4U0VA 2DXIA 4A3FJ 1XD7A 1MDMA 2X4HA 1UAAA 2ZNZA 3BG9A 5D5XB 3K1PA 3BTIA 1SMYF 2G0EA 4HNUA 4XOTA 1IUYA 1W7PA 4MEXF 2K02A 1JT0A 3LFUA 1MMNA 1Z0XA 2MD0A 4FISA 1W0UA 5IT9Z 2CUZA 1MSFC 4BQAA 3L09A 3ZN0A 4CUGA 3A0HC 2KZVA 2XUBA 5BOXA 4E7IA 2VOPA 4B1RA 2DA2A 3A0BC 2IS1A 2JT1A 4C2TA 2VKVA 3GO5A 3I58A 1L3LA 3S1MJ 2VKDA 5CQGA 2V9KA 3OYEA 1HDPA 1L0OC 4G8XA 3BCAA 4KMFA 3LSKA 4MHGA 1Z3YA 4HBLA 4M3FA 1PUEE 2HTSA 3H92A 3LQRA 1MBGA 2DMPA 2Z5UA 5E1WA 3K4CA 3ASOH 1HC8A 2LRDA 1PP8F 3WHCA 1D0ZA 2LC2A 3V8JA 3JAMK 1E17A 1BJZA 1YS7A 3X2QH 4Q5SF 1HW1A 2IS6A 3DEUA 4OOIA 3DPTA 2BV6A 1E2XA 2K86A 4M9XA 2DFIA 2G7UA 2QZ8A 2KDZA 1YJWI 4OMYA 1QQIA 4MQVA 1MNMC 1FOKA 2HOTA 1ZH5A 4E70A 5GAGJ 2JUGA 3O8GA 1MBKA 1ZGJA 3H3UA 2XKOA 1LUJB 5D6FA 2CW0F 4BE0A 2FRHA 3CC2I 4IHYA 2RV8A 4EJVA 3RKWA 3QPTA 1VI0A 4F52A 5DS9A 3OYGA 2IT0A 2PQ8A 1ZKGA 1AWCA 5DCMA 2BVLA 4ZYGA 4AVPA 3S3NA 4HA8A 4E4HA 4HLYA 1O3RA 4UY8I 2JRMA 2HTJA 1W5CC 4BXXJ 2UZKA 1LEAA 1U6GA 3ZMUA 2VXZA 2V1UA 5LHGA 1ZK8A 1S7AA 4X0GA 1IN4A 4A5NA 2EFNA 5ILUA 2NVXJ 1P7IA 2UXNA 1T39A 1JUPA 2W25A 1MMAA 1NK2P 1N25A 3L2WA 1E3PA 4V2FA 4F7ZA 3J7AY 4HF2A 3WTWC 3S15J 2LDUA 3C7JA 5BMZA 1BIBA 2R5YA 2AQFA 2L7ZA 1BR2A 1TWAJ 4B48A 3JRHA 2NAZA 1NK3P 2DDBA 2E5ZA 4IEJA 5HLHA 2R4GA 2GA2A 5BS6A 3K2AA 4HV5A 2O61A 4XQFA 1UG2A 5DYMA 1MDMB 3HG9A 3K1MA 3CCSI 3KFWX 4KITB 4UB6C 5J1YA 3Q5FA 1J7KA 3IP4B 4BDZA 1W5SA 2DAOA 1OCZH 3KX2A 2LP0A 1T0FC 4BY1J 2A69F 3H0DA 3K6GA 4FCYA 5M5YJ 4M9ZA 5CVRA 5KAFC 2OC6A 1K4SA 5J8CA 2L54A 3OYAA 2HWVA 3CMEI 1LDJA 3R6SA 2XF6A 1ZRDA 1YJ9I 1OCTC 1X58A 2JPBA 3C2HA 4JX5A 3VDXA 2ZXHA 1VFCA 1J2XA 1NG6A 2CQQA 3GX4X 4UNOA 3WU1B 1XG1A 2M8GX 3G6EI 4PFOA 3W6VA 3KYDB 3AG4H 2KISA 2DFFA 2BXYA 1HA8A 1UHWA 4W97A 5DCFA 1QNTA 2ID3A 5IYCJ 1Y6IA 2DPUA 1BN5A 5F0CA 1JKQC 2ZXIA 2FXAA 3GVAA 3U21A 1OYWA 2HOEA 1KZHA 2H6CA 2EZKA 2F5FA 2F5EA 4ZDPA 2JMWA 2STWA 4EATA 1H9GA 2VE9A 3CMMA 5E8IA 2Y69H 3DU6A 3H9GA 2X6OA 1Z6RA 1HOMA 5CPRB 4FETA 2HDDA 2L9RA 2L5QA 3E6DA 3BZKA 1BJAA 4ENMA 2EINH 4HF0A 2HEOA 2CJJA 2VIXA 3RZOJ 3LSTA 4QIWN 2VI6A 2K3PA 3DTEA 3AL0B 1TBXA 2VQHA 4QTRA 1FNNA 4J00A 2EB7A 3CCJI 3FKIJ 4HOBA 2VONA 5E18F 3OS0A 4IQJA 1QZZA 2K9NA 3TBIA 4Y13A 4OIRF 3K4LA 5DCMB 1W4MA 4HZFA 1XC5A 3OSFA 1P4XA 3ERMA 2A6TA 3GTLJ 4ITVA 3DCFA 2G7HA 4WXDA 3HBLA 3RKXA 3BLYA 1USSA 3JRIA 4JOMA 3GZ6A 1F1ZA 2ADUA 4BGDA 1GV2A 5FKOA 3RQ4A 1QA6A 2WC2A 3PJRA 3E6BA 5LGTA 1VQ7I 2R5YB 2VB6A 3RCOA 3LMMA 3ZQGA 3E6MA 5ICCA 3F23A 2ZKZA 4M6XA 5FO5A 2QM3A 4YEJA 5KNLA 4BU2A 2X51A 5M5XJ 2FA5A 4L5EA 1BW6A 4A6DA 3I9V2 3CDLA 1OCRH 1A6IA 3CTAA 1VZ0A 3KEYA 1JHFA 1FC3A 1P9QC 2CFOA 2KJBA 2DDAA 2EFWA 1I1SA 2E1NA 3LSPA 4G6QA 1XTAA 3FF5A 1ETKA 1FEXA 2KRCA 2OD5A 3VSLA 1FYMA 3PNVA 4RBOA 2XSDC 2EBIA 2MC3A 1ORKA 4N4NB 1WJFA 4DOZA 1QRYA 2O7OA 4YRVA 2NOGA 4M3DA 4X6AJ 3KYLA 1FTZA 5GPCA 3ZQCA 4ZDLA 3J7ZI 3BR2A 3ERED 1SFKA 2QLZA 3TDUC 3CCVI 2ME0A 3KYCB 3BR1A 4AUXA 3MKYB 5HDNA 2ZO4A 2WAQN 2KFDA 4GXOA 4YELA 3WTYC 2BOLA 1FYKA 2JZYA 5K5OA 4K2EA 1F43A 1G8XA 3KEOA 2BVMA 3SFIA 4PK4A 2WAFA 1VQKI 4IRHA 3F8NA 1XSVA 1W1WE 4HX7A 1TT5B 3I71A 3MD2A 4M3BA 4HQEA 2BHYA 2IW5A 3IC7A 4AIJA 3KP5A 1HF0A 2FQ3A 4U88A 2DQLA 3S2WA 4KYWA 1Z21A 2XGEA 3WTZA 5JHFA 3AFHA 4FTHA 1IN8A 1POGA 3GZNB 1R1UA 2ME6A 4CSWA 1Z91A 1MH4A 3MKLA 2ZJQF 4KA4A 2JK3A 2XPUA 2ZB9A 1JUSA 1XMKA 1W7PD 1ZR4A 4IHSA 1BOAA 1FWZA 2FUG2 1O4XA 2M45A 4IJAA 5EEAA 1ZLKA 1W5TA 2DFEA 2L7FP 1CGPA 3LWFA 3E5UA 2GAUA 5H6RA 3GW2A 4GYIA 1MH3A 4IOCF 1ZG5A 1TP4A 4MTDA 1FSEA 3LAJA 1OYYA 2KIFA 4OWRB 3ZQQA 1XDSA 3ZQHA 1P6RA 3ABMH 3ZQIA 4BL0B 4G7ZF 1ERDA 4YFXF 3W2VA 1MBEA 4A0YA 4C2MJ 4MFDA
chains in the Genus database with same CATH topology
2NS8A 1UMQA 4XK4A 2DMQA 4D7NA 2P81A 1I3QJ 2KT0A 4JX4A 3IH4A 3BG5A 2M34A 2QF7A 2JA6J 1Y1VJ 4XRMA 2DJNA 4LOCA 1GUUA 2WV1A 4BY7J 4DZJA 1W0TA 1JGGA 1BL0A 2K9QA 2R93J 2ECCA 3G1LA 3Q0VA 4MLOA 5E3OA 4A3EJ 2LR8A 2FJ1A 3HM5A 2R7ZJ 2QCOA 1H89C 3HOYJ 5F08A 3H3VK 5C4XJ 3Q0WA 1JT6A 2DA4A 4D5CA 4IHVA 3HOXJ 1QPIA 1B72A 3M3YJ 3TW6A 2YS9A 2DA5A 2DMTA 4GFBA 3S1QJ 4Y52J 4XRSA 2DA1A 3TP0A 2DMUA 1JJ6C 3G1OA 2OF7A 3PO2J 2R5ZB 2NVYJ 1VNDA 2FX0A 2XPWA 3JRGA 1AKHB 4BBRJ 2TCTA 2X48A 3TEDA 5C4JJ 1WI3A 2LLKA 2JA7J 3GTMJ 1LFUP 5EF6A 4A93J 3JRAA 5FJ8J 1AHDP 4XICA 1Q1VA 4A69C 2XB0X 1WH5A 3JRDA 1XS9A 2EZHA 3S1RJ 2XRLA 2MGQA 4HNVA 4JX6A 3PM1A 3LSRA 3IH3A 3Q3SA 1JTYA 1Z77A 5FKMA 5EYRA 1QVUA 1T33A 5EGOA 4Y7NJ 3HDDA 1ETVA 5HODA 2DA3A 1ITYA 1SANA 2E19A 4BBSJ 2GLOA 3BT9A 2H8RA 4IHXA 1IDYA 4D7MA 2EQRA 2I10A 3I4NJ 3BR5A 2E2IJ 3SJMA 5F27A 5JLXA 1RKTA 5FKLA 1OFCX 3BTCA 3S2HJ 4S0HB 4D5FA 9ANTA 1D5YA 4CYCA 4W1UA 4M6VA 1PUFA 1UHSA 2DMNA 3QQAA 5K7ZA 2Y9YA 2JA8J 3HKZN 2GBYA 3B6AA 4MIMA 3LSGA 2LK2A 2DN0A 2FQ4A 2MSYA 1FIAA 3HOWJ 1IRZA 1BW5A 4JYKA 2CUEA 2E1OA 1APLC 2VUMJ 4DYRA 4A3FJ 1QVTA 5IP6A 4NDLA 5GPAA 1IUFA 4XRSG 5DTDA 1JUMA 3BG9A 3QPSA 2XPVA 3BTIA 2G0EA 1IJWC 2M2EA 5IYDJ 3JRBA 5EG0A 1JT0A 1TWFJ 1ZTRA 1Z0XA 1W0UA 4FISA 1MSFC 3E7LA 3HEFA 1A5JA 5M3FJ 1WH7A 3LOCA 1H88C 3ZQFA 1U9OA 4B1RA 2DA2A 1HCRA 2VKVA 1K61A 1ETWA 1F36A 2MG4A 3S1MJ 2XB5A 1X2MA 4ABZA 4RDUA 4A3IJ 1ZR2A 1DU0A 1HDPA 3CCYA 3G1MA 3Q0UA 5J1RA 4A3GJ 1G2HA 3L1PA 4DW6A 2M9HA 4M3FA 1B72B 1MBGA 2DMPA 3JREA 2NVTJ 4EEFG 3WHCA 4B4CA 1Y1WJ 4M3GA 2XGCA 1BJZA 2CQXA 1RKWA 3NARA 1LE8A 1ETYA 5FKNA 2M0CA 2ECBA 4C3IJ 3GTKJ 2KDZA 2OPTA 2HXOA 1MNMC 2K40A 3S14J 2HOTA 2RAEA 3I4MJ 3BTJA 2YUSA 3O8GA 3TW7A 1MBKA 5J1UA 3GTQJ 1ETOA 3F0CA 3ZOBA 5K7FA 4FE7A 5EGOB 1IG7A 3BR0A 4IHYA 1IGNA 3FIWA 2YU9J 3S16J 2L0KA 3A01B 4C3JJ 1VI0A 5DS9A 5F0HA 1ZKGA 2HOAA 4C3HJ 5F1JA 5FKKA 3M4OJ 3GTGJ 1B8IA 4BXXJ 1TWCJ 3BTLA 1MSEC 2B63J 2LY9A 3WHBA 3RZDJ 4MO7A 1ZK8A 2O8KA 3VPRA 2DA6A 5IP9J 1I6HJ 1GT0C 3A01A 2NVXJ 4CYCB 1P7IA 1GV5A 1JUPA 2CRGA 3GBGA 1IV6A 1NK2P 1PUFB 3RQIA 2Y9ZA 4V2FA 3HOUJ 3SDGA 5M3MJ 5J3LA 4DYCA 3S15J 1YRNA 2NVQJ 2R5YA 2L7ZA 2LD5A 3OIOA 1TWAJ 3JRHA 1JKOC 2E2JJ 1NK3P 5IYBJ 4IEJA 1MBHA 5M5WJ 3K2AA 4AC0A 2TRTA 3JRCA 1UG2A 4A3LJ 1WCMJ 5IP7J 5J1YA 4IHWA 2FD5A 1U9NA 2ID6A 2EZLA 2IAIA 2LP0A 2XGDA 4BY1J 5EG0B 3LSJA 4FCYA 5M5YJ 3GTPJ 1U8BA 4A3DJ 2R0QC 2NS7A 1OCTC 1X58A 4JX5A 2CUFA 2W48A 4XIDA 4I6ZA 1VFCA 2CQQA 1EF4A 3H0GJ 4B3AA 1XG1A 2JJ7A 1NTCA 3A03A 2M8GX 5F04A 5EDNA 3W6VA 3HB9A 2O9LA 1ZGWA 4W97A 5IYCJ 2ID3A 5F0CA 1JKQC 1TWGJ 2AHQA 1MBJA 2EZKA 5E3NA 2JMWA 2DA7A 1LE8B 4A3MJ 1SFOJ 5IOYA 2HI3A 2X6OA 1HOMA 2HDDA 3QPLA 2L9RA 3S17J 3HGYA 4V2GA 1I50J 1VF9A 2HYJA 5E3MA 2CJJA 3FISA 3RZOJ 2WB1N 2CU7A 4QIWN 2HXIA 2VI6A 4FE4A 2LVSA 4QTRA 3NAUA 1CQTA 3FKIJ 2K9NA 4AYBN 2Y0SN 1X2NA 1FTTA 3K7AJ 4A3CJ 3IV5A 1JJ8C 4UUSA 1JTXA 4QSHA 1B8IB 1XC5A 1ENHA 3OSFA 1U78A 2MW8A 2JWTA 3GTLJ 1GVDA 3DCFA 3FK6A 3MVPA 3HOZJ 3HBLA 4X1EA 3JRIA 1BA5A 1GV2A 5FKOA 4DZPA 1HDDC 3DEWA 5E3LA 1E3OC 1TWHJ 1YRNB 2LTPA 1ETQA 2JN6A 4UUTA 2R5YB 1H8AC 3ZQGA 1FIPA 3OOUA 3B6CA 5M5XJ 4L5EA 2LKXA 3HGGA 1BW6A 3O8HA 4DYQA 3CDLA 5F0FA 1A6IA 1RESA 4A3JJ 2Y31A 3GTOJ 3LSPA 3BR6A 1R9TJ 1WGXA 2R5ZA 1ETKA 2K9SA 3BR3A 1FEXA 5JLWA 1AKHA 1S7EA 5EZGA 3MN2A 4RBOA 2XSDC 4M3EA 1RR7A 2EBIA 3BG3A 4MFEA 1ORKA 5C3EJ 2R92J 3S2DJ 1RETA 5IOZA 2Y30A 1QRYA 2O7OA 2COBA 2NOGA 4M3DA 4X6AJ 1FTZA 4G12A 5GPCA 2PMZN 3ZQCA 1HLVA 3BR2A 2ELKA 2ME0A 3BR1A 4BKXA 3A02A 4AUXA 2LFBA 3D1NI 1ZQ3P 2WAQN 2IBDA 4A3KJ 1LFBA 1IDZA 2X9DA 1F43A 1OJLA 2EH3A 4A3BJ 3SFIA 1RPWA 3ZQLA 1K83J 1JKPC 2H1KA 3TP3A 4M3BA 2JA5J 1MBFA 5FLMJ 3HOVJ 1HF0A 3JRFA 3UKGA 5FLVA 3OSGA 2IEKA 2GM4A 3PO3J 2XGEA 3GTJJ 4FTHA 1DU6A 2DTZA 5K7HA 2HQ5A 1POGA 2N8GA 2ME6A 5C44J 3CMYA 1MH4A 3FK7A 3MKLA 1IC8A 2JK3A 2XPUA 2ZB9A 1P7JA 1JUSA 2VKEA 1ZR4A 2VPRA 1WPKA 2HOSA 1TC3C 4J19A 3C2BA 2D5VA 3LNQA 1O4XA 1FJLA 5EEAA 2L7FP 1AU7A 2Y2ZA 1JKRC 3S1NJ 3BQYA 4I76A 1MH3A 2EZIA 5GP9A 2E2HJ 3CQZJ 4UUSB 2AO9A 1OCPA 3JR9A 3IH2A 1GDTA 2L7MP 5IPAA 5EZHA 3RKQA 1ETXA 3BQZA 3ZQHA 1T56A 3ZQIA 1MBEA 4JP0A 5BNGA 4C2MJ 4MFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS8 A;  1UMQ A;  4XK4 A;  2DMQ A;  4D7N A;  2P81 A;  1I3Q J;  2KT0 A;  4JX4 A;  3IH4 A;  3BG5 A;  2M34 A;  2QF7 A;  2JA6 J;  1Y1V J;  4XRM A;  2DJN A;  4LOC A;  1GUU A;  2WV1 A;  4BY7 J;  4DZJ A;  1W0T A;  1JGG A;  1BL0 A;  2K9Q A;  2R93 J;  2ECC A;  3G1L A;  3Q0V A;  4MLO A;  5E3O A;  4A3E J;  2LR8 A;  2FJ1 A;  3HM5 A;  2R7Z J;  2QCO A;  1H89 C;  3HOY J;  5F08 A;  3H3V K;  5C4X J;  3Q0W A;  1JT6 A;  2DA4 A;  4D5C A;  4IHV A;  3HOX J;  1QPI A;  1B72 A;  3M3Y J;  3TW6 A;  2YS9 A;  2DA5 A;  2DMT A;  4GFB A;  3S1Q J;  4Y52 J;  4XRS A;  2DA1 A;  3TP0 A;  2DMU A;  1JJ6 C;  3G1O A;  2OF7 A;  3PO2 J;  2R5Z B;  2NVY J;  1VND A;  2FX0 A;  2XPW A;  3JRG A;  1AKH B;  4BBR J;  2TCT A;  2X48 A;  3TED A;  5C4J J;  1WI3 A;  2LLK A;  2JA7 J;  3GTM J;  1LFU P;  5EF6 A;  4A93 J;  3JRA A;  5FJ8 J;  1AHD P;  4XIC A;  1Q1V A;  4A69 C;  2XB0 X;  1WH5 A;  3JRD A;  1XS9 A;  2EZH A;  3S1R J;  2XRL A;  2MGQ A;  4HNV A;  4JX6 A;  3PM1 A;  3LSR A;  3IH3 A;  3Q3S A;  1JTY A;  1Z77 A;  5FKM A;  5EYR A;  1QVU A;  1T33 A;  5EGO A;  4Y7N J;  3HDD A;  1ETV A;  5HOD A;  2DA3 A;  1ITY A;  1SAN A;  2E19 A;  4BBS J;  2GLO A;  3BT9 A;  2H8R A;  4IHX A;  1IDY A;  4D7M A;  2EQR A;  2I10 A;  3I4N J;  3BR5 A;  2E2I J;  3SJM A;  5F27 A;  5JLX A;  1RKT A;  5FKL A;  1OFC X;  3BTC A;  3S2H J;  4S0H B;  4D5F A;  9ANT A;  1D5Y A;  4CYC A;  4W1U A;  4M6V A;  1PUF A;  1UHS A;  2DMN A;  3QQA A;  5K7Z A;  2Y9Y A;  2JA8 J;  3HKZ N;  2GBY A;  3B6A A;  4MIM A;  3LSG A;  2LK2 A;  2DN0 A;  2FQ4 A;  2MSY A;  1FIA A;  3HOW J;  1IRZ A;  1BW5 A;  4JYK A;  2CUE A;  2E1O A;  1APL C;  2VUM J;  4DYR A;  4A3F J;  1QVT A;  5IP6 A;  4NDL A;  5GPA A;  1IUF A;  4XRS G;  5DTD A;  1JUM A;  3BG9 A;  3QPS A;  2XPV A;  3BTI A;  2G0E A;  1IJW C;  2M2E A;  5IYD J;  3JRB A;  5EG0 A;  1JT0 A;  1TWF J;  1ZTR A;  1Z0X A;  1W0U A;  4FIS A;  1MSF C;  3E7L A;  3HEF A;  1A5J A;  5M3F J;  1WH7 A;  3LOC A;  1H88 C;  3ZQF A;  1U9O A;  4B1R A;  2DA2 A;  1HCR A;  2VKV A;  1K61 A;  1ETW A;  1F36 A;  2MG4 A;  3S1M J;  2XB5 A;  1X2M A;  4ABZ A;  4RDU A;  4A3I J;  1ZR2 A;  1DU0 A;  1HDP A;  3CCY A;  3G1M A;  3Q0U A;  5J1R A;  4A3G J;  1G2H A;  3L1P A;  4DW6 A;  2M9H A;  4M3F A;  1B72 B;  1MBG A;  2DMP A;  3JRE A;  2NVT J;  4EEF G;  3WHC A;  4B4C A;  1Y1W J;  4M3G A;  2XGC A;  1BJZ A;  2CQX A;  1RKW A;  3NAR A;  1LE8 A;  1ETY A;  5FKN A;  2M0C A;  2ECB A;  4C3I J;  3GTK J;  2KDZ A;  2OPT A;  2HXO A;  1MNM C;  2K40 A;  3S14 J;  2HOT A;  2RAE A;  3I4M J;  3BTJ A;  2YUS A;  3O8G A;  3TW7 A;  1MBK A;  5J1U A;  3GTQ J;  1ETO A;  3F0C A;  3ZOB A;  5K7F A;  4FE7 A;  5EGO B;  1IG7 A;  3BR0 A;  4IHY A;  1IGN A;  3FIW A;  2YU9 J;  3S16 J;  2L0K A;  3A01 B;  4C3J J;  1VI0 A;  5DS9 A;  5F0H A;  1ZKG A;  2HOA A;  4C3H J;  5F1J A;  5FKK A;  3M4O J;  3GTG J;  1B8I A;  4BXX J;  1TWC J;  3BTL A;  1MSE C;  2B63 J;  2LY9 A;  3WHB A;  3RZD J;  4MO7 A;  1ZK8 A;  2O8K A;  3VPR A;  2DA6 A;  5IP9 J;  1I6H J;  1GT0 C;  3A01 A;  2NVX J;  4CYC B;  1P7I A;  1GV5 A;  1JUP A;  2CRG A;  3GBG A;  1IV6 A;  1NK2 P;  1PUF B;  3RQI A;  2Y9Z A;  4V2F A;  3HOU J;  3SDG A;  5M3M J;  5J3L A;  4DYC A;  3S15 J;  1YRN A;  2NVQ J;  2R5Y A;  2L7Z A;  2LD5 A;  3OIO A;  1TWA J;  3JRH A;  1JKO C;  2E2J J;  1NK3 P;  5IYB J;  4IEJ A;  1MBH A;  5M5W J;  3K2A A;  4AC0 A;  2TRT A;  3JRC A;  1UG2 A;  4A3L J;  1WCM J;  5IP7 J;  5J1Y A;  4IHW A;  2FD5 A;  1U9N A;  2ID6 A;  2EZL A;  2IAI A;  2LP0 A;  2XGD A;  4BY1 J;  5EG0 B;  3LSJ A;  4FCY A;  5M5Y J;  3GTP J;  1U8B A;  4A3D J;  2R0Q C;  2NS7 A;  1OCT C;  1X58 A;  4JX5 A;  2CUF A;  2W48 A;  4XID A;  4I6Z A;  1VFC A;  2CQQ A;  1EF4 A;  3H0G J;  4B3A A;  1XG1 A;  2JJ7 A;  1NTC A;  3A03 A;  2M8G X;  5F04 A;  5EDN A;  3W6V A;  3HB9 A;  2O9L A;  1ZGW A;  4W97 A;  5IYC J;  2ID3 A;  5F0C A;  1JKQ C;  1TWG J;  2AHQ A;  1MBJ A;  2EZK A;  5E3N A;  2JMW A;  2DA7 A;  1LE8 B;  4A3M J;  1SFO J;  5IOY A;  2HI3 A;  2X6O A;  1HOM A;  2HDD A;  3QPL A;  2L9R A;  3S17 J;  3HGY A;  4V2G A;  1I50 J;  1VF9 A;  2HYJ A;  5E3M A;  2CJJ A;  3FIS A;  3RZO J;  2WB1 N;  2CU7 A;  4QIW N;  2HXI A;  2VI6 A;  4FE4 A;  2LVS A;  4QTR A;  3NAU A;  1CQT A;  3FKI J;  2K9N A;  4AYB N;  2Y0S N;  1X2N A;  1FTT A;  3K7A J;  4A3C J;  3IV5 A;  1JJ8 C;  4UUS A;  1JTX A;  4QSH A;  1B8I B;  1XC5 A;  1ENH A;  3OSF A;  1U78 A;  2MW8 A;  2JWT A;  3GTL J;  1GVD A;  3DCF A;  3FK6 A;  3MVP A;  3HOZ J;  3HBL A;  4X1E A;  3JRI A;  1BA5 A;  1GV2 A;  5FKO A;  4DZP A;  1HDD C;  3DEW A;  5E3L A;  1E3O C;  1TWH J;  1YRN B;  2LTP A;  1ETQ A;  2JN6 A;  4UUT A;  2R5Y B;  1H8A C;  3ZQG A;  1FIP A;  3OOU A;  3B6C A;  5M5X J;  4L5E A;  2LKX A;  3HGG A;  1BW6 A;  3O8H A;  4DYQ A;  3CDL A;  5F0F A;  1A6I A;  1RES A;  4A3J J;  2Y31 A;  3GTO J;  3LSP A;  3BR6 A;  1R9T J;  1WGX A;  2R5Z A;  1ETK A;  2K9S A;  3BR3 A;  1FEX A;  5JLW A;  1AKH A;  1S7E A;  5EZG A;  3MN2 A;  4RBO A;  2XSD C;  4M3E A;  1RR7 A;  2EBI A;  3BG3 A;  4MFE A;  1ORK A;  5C3E J;  2R92 J;  3S2D J;  1RET A;  5IOZ A;  2Y30 A;  1QRY A;  2O7O A;  2COB A;  2NOG A;  4M3D A;  4X6A J;  1FTZ A;  4G12 A;  5GPC A;  2PMZ N;  3ZQC A;  1HLV A;  3BR2 A;  2ELK A;  2ME0 A;  3BR1 A;  4BKX A;  3A02 A;  4AUX A;  2LFB A;  3D1N I;  1ZQ3 P;  2WAQ N;  2IBD A;  4A3K J;  1LFB A;  1IDZ A;  2X9D A;  1F43 A;  1OJL A;  2EH3 A;  4A3B J;  3SFI A;  1RPW A;  3ZQL A;  1K83 J;  1JKP C;  2H1K A;  3TP3 A;  4M3B A;  2JA5 J;  1MBF A;  5FLM J;  3HOV J;  1HF0 A;  3JRF A;  3UKG A;  5FLV A;  3OSG A;  2IEK A;  2GM4 A;  3PO3 J;  2XGE A;  3GTJ J;  4FTH A;  1DU6 A;  2DTZ A;  5K7H A;  2HQ5 A;  1POG A;  2N8G A;  2ME6 A;  5C44 J;  3CMY A;  1MH4 A;  3FK7 A;  3MKL A;  1IC8 A;  2JK3 A;  2XPU A;  2ZB9 A;  1P7J A;  1JUS A;  2VKE A;  1ZR4 A;  2VPR A;  1WPK A;  2HOS A;  1TC3 C;  4J19 A;  3C2B A;  2D5V A;  3LNQ A;  1O4X A;  1FJL A;  5EEA A;  2L7F P;  1AU7 A;  2Y2Z A;  1JKR C;  3S1N J;  3BQY A;  4I76 A;  1MH3 A;  2EZI A;  5GP9 A;  2E2H J;  3CQZ J;  4UUS B;  2AO9 A;  1OCP A;  3JR9 A;  3IH2 A;  1GDT A;  2L7M P;  5IPA A;  5EZH A;  3RKQ A;  1ETX A;  3BQZ A;  3ZQH A;  1T56 A;  3ZQI A;  1MBE A;  4JP0 A;  5BNG A;  4C2M J;  4MFD A; 
#chains in the Genus database with same CATH topology
 3IRQ A;  4QWQ A;  3QOP A;  3KZY A;  2QQA A;  4CCO A;  1TL8 A;  1R7J A;  5L3G A;  2NYX A;  4UVA A;  1SAX A;  4LOC A;  5FFZ A;  2Q2E A;  2K9Q A;  3JAM Z;  3Q0V A;  4P96 A;  4A3E J;  3CCL I;  1GXP A;  3P7N A;  1YO5 C;  3LA3 A;  2V9P A;  4KIG A;  3N05 A;  3EYI A;  1YE9 A;  3F9K A;  3KIO A;  3MCZ A;  4PJ0 C;  3DKW A;  4IHV A;  4Y33 A;  4U87 A;  3K70 D;  1B72 A;  3M3Y J;  3FXM A;  2KP6 A;  2YS9 A;  5LEK A;  4RGR A;  5CVJ A;  2DA1 A;  5ICG A;  1V55 H;  1VND A;  2FX0 A;  2HVQ A;  2WA0 A;  1K79 A;  2E5N A;  1T0F A;  3PNT A;  4LJZ F;  2E7W A;  1JHH A;  2Q1Z B;  4BBR J;  1S29 A;  3TED A;  3BZC A;  2JTV A;  2FU4 A;  2LLK A;  2HQN A;  3V8K A;  3BY6 A;  1A31 A;  2VJJ A;  4O3M A;  3GTM J;  4CCJ A;  1LFU P;  2NXN B;  4A93 J;  3DXJ F;  1YI2 I;  1WJD A;  2JSC A;  3UR3 C;  1ZEL A;  3MZY A;  1FY7 A;  2DT7 B;  2LY1 A;  4DJA A;  1SD4 A;  4A0X A;  3AG1 H;  3D0S A;  2JPC A;  1SD5 A;  2XRL A;  3OR1 C;  3LSR A;  1QHH D;  3IH3 A;  2R7R A;  3EQL F;  3Q3S A;  1SFE A;  3FXR A;  3Q9V A;  4N4O B;  2CW8 A;  2WWY A;  4XKC A;  4B3X A;  4IRI A;  4CGZ A;  4Q4Z F;  2FMY A;  1ZG1 A;  1T33 A;  3ISP A;  4Y7N J;  5HOD A;  1ZRF A;  5D5V B;  2M4G A;  3PSI A;  1ITY A;  2VT2 A;  2R7Q A;  2GLO A;  3CZ6 A;  1IDY A;  2OCC H;  2Y0S A;  4A12 A;  3WTS C;  2XAH A;  4Y4R A;  1J9I A;  2PJR A;  2G9W A;  2OCE A;  4GYG A;  5JLX A;  1RKT A;  2DT6 A;  3IHU A;  5FKL A;  1OFC X;  3QWL A;  2XAU A;  3S2H J;  2KZG A;  1T8I A;  1Y39 A;  2ZXW H;  4AVZ A;  3I54 A;  2BEO A;  4NC6 A;  4D5F A;  9ANT A;  4IZZ A;  4CYC A;  5D4S A;  2R7O A;  2VBZ A;  1E0E A;  5B1B H;  1UHS A;  3QQA A;  3PFI A;  4ZH4 F;  4F55 A;  2PJP A;  2OQR A;  1WWX A;  1AA7 A;  4UV8 A;  3K70 C;  2MSY A;  3SQN A;  1FIA A;  3LSI A;  4CZZ A;  2GIV A;  1APL C;  1GLN A;  1DP7 P;  5KCM A;  2HQA A;  2M87 A;  2UV1 A;  3QRF F;  2OJE D;  1QVT A;  5TGT A;  5IP6 A;  1R00 A;  2IRF G;  5GPA A;  2P5V A;  1QBJ A;  2UWM A;  4IF4 A;  5BPI A;  4XRS G;  2QEN A;  5DTD A;  2K27 A;  2XPV A;  2HU9 A;  1Z05 A;  1UEL B;  2FOK A;  1X1P A;  1GVJ A;  1QGP A;  4P55 A;  5CVV A;  1HXD A;  4CDG A;  2MD5 A;  3L9F A;  4I09 A;  3FHN A;  1A5J A;  4E7J A;  1YTY A;  1EA3 A;  3W6J B;  3LOC A;  2M0M A;  4ZYH A;  2ZC2 A;  4CYD A;  2Q2E B;  3BPV A;  1K61 A;  2BBY A;  3P5J A;  2AQE A;  4XKB A;  3VOD A;  3VYT B;  2XB5 A;  4G6T B;  4Y15 A;  4ABZ A;  1BI0 A;  2V79 A;  4NUB A;  3SZT A;  3Q0U A;  4A3G J;  3R4K A;  1G2H A;  3L1P A;  2FSW A;  3PFY A;  1B72 B;  1VQM I;  2K85 A;  1SVL A;  1A04 A;  2BYV E;  4EEF G;  2A07 F;  4B4C A;  2KRH A;  5JR3 A;  3DBR B;  1N77 A;  1RKW A;  3TOB A;  3R0J A;  2GQQ A;  2ECB A;  2W85 A;  3GTK J;  1XPX A;  2V1N A;  1JI8 A;  3KP7 A;  1U5T C;  3PQK A;  4G6D A;  3MQ0 A;  3IWF A;  3OMY A;  2MH9 A;  4E7L A;  2YUS A;  2JA2 A;  2MLG A;  4BQO A;  1E3H A;  3ZCO A;  1U0J A;  3EYY A;  1HW2 A;  2OTJ I;  5H2F C;  2IA0 A;  5KVR A;  3JCU C;  5BQT A;  4XLF A;  1IZ1 A;  2HDC A;  2D45 A;  2GOX B;  4F93 B;  1YQA A;  3BR0 A;  1YYV A;  4DBQ A;  4HNT A;  3FIW A;  2MYS A;  3VFZ A;  2L0K A;  3HSE A;  3A01 B;  5DUK A;  1R23 A;  4BNC A;  3I56 I;  2HOA A;  3E6C C;  1XCV A;  3OYC A;  4C3H J;  1F4K A;  3GTG J;  2A5Y B;  2PJR B;  1R5H A;  3O2P E;  2W82 A;  2EIJ H;  2V6C A;  3FMR A;  2GIZ A;  3ZRG A;  3ZMS A;  5HS8 A;  4WWC A;  2XC7 A;  3LL7 A;  2DA6 A;  2IP2 A;  4NQW A;  1VQ5 I;  1I6H J;  2KIU A;  4LFU A;  1HKS A;  1X1C A;  3DF8 A;  4CYC B;  3OWT A;  3GBG A;  4AYB A;  4N9I A;  5KAI C;  5HLI A;  3RQI A;  5M3M J;  5DM6 F;  4EM0 B;  1SVO A;  4OMZ A;  4KDP A;  4LB5 A;  1YRN A;  2WBM A;  2NVQ J;  2BXZ A;  2LF7 A;  1YFH A;  1YW8 A;  3F22 A;  3OIO A;  1UJ8 A;  4L5J A;  2LKS A;  3GYH X;  1EJ9 A;  3V7C A;  2KPM A;  1BR1 A;  3DEE A;  3FBN B;  1VQP I;  3GFL A;  2HQR A;  3CES A;  1TW2 A;  5IP7 J;  1LNW A;  5DD8 A;  2FD5 A;  2EZL A;  2MA3 A;  3HOT A;  4B43 A;  3LSJ A;  3IL2 A;  3SZP A;  1A35 A;  3MFK A;  4GCV A;  4XLP F;  4A3D J;  1YW7 A;  2ACJ A;  1IRF A;  3TKY A;  3BC8 A;  2YPR A;  1VQO I;  5CYV A;  1I39 A;  2IGM A;  4E7K A;  4ANJ A;  3TO7 A;  1OMI A;  1XGN A;  5FFX A;  2VLA A;  2ZME C;  3A03 A;  1R22 A;  5J47 A;  3H9Q A;  4YIR X;  2Z99 A;  3DBL B;  5ED4 A;  1WFX A;  3HTU A;  4CA0 A;  4Y17 A;  1I1G A;  2H94 A;  1MBJ A;  4RGS A;  2ESN A;  3WGH A;  2AXT C;  4KIB A;  5E3N A;  3W2A A;  2IXS A;  3OR2 C;  4EQQ A;  2FBK A;  3OYK A;  3OYL A;  1SFU A;  3BDD A;  3H36 A;  2PMZ A;  4OIP F;  2HR3 A;  1UCR A;  2HFH A;  5IOY A;  2HI3 A;  3REO A;  2YU3 A;  2WAD A;  2W1O A;  2MBF A;  3OYD A;  3HGY A;  1S72 I;  1D0X A;  1VF9 A;  2EFQ A;  2BGC A;  1O7L A;  4HG2 A;  2ZSH B;  3OYM A;  3FIS A;  2MC4 A;  5LD2 C;  3MZ8 A;  4BUP A;  3L2R A;  3HXL A;  1IV8 A;  1HW5 A;  3FX3 A;  3NAU A;  1RZ4 A;  3KP4 A;  1YIT I;  4XON A;  5DV5 A;  3FWE A;  3HKZ A;  2NNY A;  4M9S A;  3M7G A;  5DEQ A;  4AYB N;  2KJC A;  1X2N A;  1FTT A;  5D8L B;  4ON0 A;  1JJ8 C;  3C1D A;  2FML A;  4RAY A;  4ENJ A;  2FBH A;  5J6X A;  4BEH A;  3GFI A;  4UUV A;  1WJA A;  2DLL A;  3KP6 A;  1HSJ A;  1NG7 A;  4MTE A;  2NOJ B;  4XN3 A;  4FAS D;  5FRN A;  4XKW A;  1GVD A;  2JQ7 A;  3ONQ A;  2QSH X;  4NQW B;  1UB9 A;  3GFJ A;  4PGH A;  2J5P A;  1BR4 A;  1I6X A;  2W24 A;  4X1E A;  3WTX C;  2DYS H;  4NBQ A;  3EET A;  4G94 A;  4CCM A;  1OCO H;  2VN2 A;  3DEW A;  5E3L A;  3CJQ B;  1NH3 A;  1E3O C;  4PJL A;  1YRN B;  2JN6 A;  3HC7 A;  4NC8 A;  2M7B A;  3GME A;  4FX0 A;  3WTU C;  4DIQ A;  4L9V A;  4OIO F;  4CHU A;  4ZYD A;  2F5C A;  3O8H A;  2IA2 A;  4DYQ A;  4L9N A;  2PX9 A;  5F0F A;  1ZN2 A;  1X3U A;  3L2V A;  3MWM A;  2DO7 A;  4A3J J;  5HDG A;  5GAD J;  4Z6Y A;  2Y31 A;  1XDU A;  4YFK F;  4CZC A;  3BR6 A;  1R9T J;  2XGX A;  3BJA A;  3RJP A;  3K2Z A;  3BG6 A;  1LKX A;  1S7E A;  2Y75 A;  4M3E A;  3BG3 A;  2XRO A;  4ZZL A;  5B3S H;  3H35 A;  1K7A A;  4PGG A;  3OYF A;  5IOZ A;  1KYW A;  1TQM A;  3RYP A;  2Q0O A;  2A6H F;  5E79 C;  1KU3 A;  1ZAO A;  1ZG3 A;  2Y48 A;  3DPL C;  2PMZ N;  1T98 A;  4G12 A;  4H4K C;  5HLT A;  1HLV A;  3O6B B;  3SDB A;  1K78 A;  2ELK A;  1R49 A;  1G6N A;  3D1N I;  1ZQ3 P;  2CV0 A;  1TNS A;  2IBD A;  1YS6 A;  2DOF A;  3KE2 A;  2X9D A;  2OZU A;  2VE8 A;  4DNC A;  4Q47 A;  2F4M B;  1OJL A;  2EH3 A;  3LSH A;  3M1E A;  2XRN A;  1MNE A;  1U2W A;  3ZQL A;  1ZRC A;  4G7H F;  1K83 J;  2H1K A;  4I0B A;  2ISZ A;  2E1M C;  3ZMT A;  5HVQ C;  2ISY A;  5K1Y A;  3HRM A;  1MBF A;  2A61 A;  1LB2 A;  4I99 C;  1PDN C;  3HIF A;  3UKG A;  3OSG A;  1O3S A;  5FLV A;  4A2U A;  2PN6 A;  3HL2 A;  2QSG X;  2BHZ A;  2XF7 A;  2LG4 A;  1DU6 A;  3RPU A;  1ZLJ A;  1FOW A;  5K7H A;  4OIQ F;  4KT5 C;  2HQ5 A;  1D1B A;  1XCB A;  3CMY A;  1ON2 A;  3CJT B;  3JSP A;  2EA2 A;  2VQC A;  2CG4 A;  2O0Y A;  3WU2 C;  5GTI C;  1ULY A;  2Z1D A;  2VKE A;  4PJJ A;  3V7S A;  3TMO A;  1D5V A;  1R4M B;  4J19 A;  1V4R A;  2D5V A;  3G2B A;  2YSR A;  4YG2 F;  2JSP A;  3BJO A;  2Y2Z A;  1F5T A;  3GF2 A;  3BQY A;  2CO5 A;  4IOA F;  4I76 A;  3F6O A;  1N78 A;  2VAS A;  2RNJ A;  1R36 A;  3JR9 A;  4BEH B;  4S04 A;  2JRT A;  3IH2 A;  1GDT A;  2L7M P;  4ZYE A;  2GOM A;  4BXU A;  5IPA A;  3HOS A;  1J75 A;  5EZH A;  4A0Z A;  4WK8 F;  3J81 Z;  2LMD A;  4E7H A;  1R6R A;  2BY1 A;  4UVB A;  1X1D A;  3CC7 I;  2KIM A;  2DMQ A;  1P92 A;  1I3Q J;  2CV2 A;  1RUN A;  2KT0 A;  2L02 A;  2YX4 A;  2VC1 A;  2M34 A;  2QF7 A;  2EWN A;  2DJN A;  3VSK A;  4ZYA A;  3TGN A;  1B9M A;  1G59 A;  1MMD A;  1YLF A;  4BY7 J;  3F21 A;  1BL0 A;  3HHG A;  1ZAR A;  1X4O A;  1SMT A;  5E3O A;  3J80 Z;  3HM5 A;  2FJ1 A;  3HUG A;  5B5E C;  2QCO A;  3KEQ A;  4LIT A;  5AON A;  1DP3 A;  1XMA A;  1WZ2 A;  3WGI A;  5C4X J;  1JT6 A;  2XSJ C;  1RUO A;  2E34 A;  1XGM A;  2DA5 A;  1FBQ A;  3IKT A;  3TP0 A;  2CS3 A;  1LFP A;  4U7D A;  1OR7 C;  1Y0U A;  2IA1 A;  2QGU A;  2TCT A;  4RM3 A;  5C4J J;  4P9F A;  2QEX I;  2JA7 J;  1P2F A;  1TQI A;  4A6E A;  2GXB A;  4LIU A;  5L3B A;  1YHQ I;  5LBQ A;  4PJN A;  2L4M A;  5FJ8 J;  2Y0M A;  1Q1H A;  4KT6 A;  4IRG A;  3N4M A;  3OS2 A;  4AD9 A;  3I0T A;  1K78 B;  2XB0 X;  1XS9 A;  2OBP A;  1O3Q A;  2EIL H;  5CVI A;  1Z77 A;  1FPQ A;  2B7E A;  3G4S I;  4RGX A;  5FKM A;  5EYR A;  3DKY A;  2DA3 A;  2E19 A;  3K4M A;  3BT9 A;  2BE5 F;  3HTS B;  2VOO A;  1DDN A;  2LNB A;  4I7H A;  5AIQ A;  3H5N A;  3SJM A;  2STT A;  5LHH A;  3BTC A;  3F8M A;  4XN0 A;  3A4C A;  1QZE A;  2ZNY A;  4KJZ A;  2NVU B;  4AIH A;  1S9H A;  5EEG A;  2KRF A;  4S0H B;  2JVH A;  1KON A;  1D5Y A;  3HSF A;  2L9S A;  3I5U A;  2L4A A;  3CO6 C;  4CH7 A;  3E5Q A;  1PUF A;  1FOX A;  3EUH C;  2DMN A;  2VBW A;  1DUX C;  3JW4 A;  1IXR C;  2GBY A;  3B6A A;  2PBI A;  1KYZ A;  2LK2 A;  5LHI A;  1H9T A;  3QYB A;  1FYL A;  1IRZ A;  5DDG A;  2DK8 A;  5IT3 A;  4KN7 X;  2VUM J;  3FXQ A;  2E71 A;  2XAJ A;  5FRO A;  4M74 A;  1TNT A;  1VQN I;  3F8F A;  4EV0 A;  4NDL A;  3CCQ I;  4U7B A;  4ENN A;  1Z1D A;  2R7D A;  1Y56 A;  3QPS A;  3FDY A;  4TV7 A;  2XF5 A;  2H09 A;  2M2E A;  2XVC A;  2P7V B;  4CIC A;  2R7F A;  4MQ9 F;  3JRB A;  4DQ2 A;  2MAB A;  4BAC A;  4LIV A;  3V4G A;  3TQN A;  3F6V A;  2QKM B;  1TWF J;  4HLX A;  2F4I A;  1QPM A;  5D5U B;  2IPQ X;  3WTT C;  3HEF A;  4EM1 A;  1A36 A;  1D8K A;  5M3F J;  5CKT A;  1H88 C;  3RI4 A;  3RDI A;  1U9O A;  3K69 A;  1S3J A;  5LFA A;  1R58 A;  1R1T A;  2NNN A;  2P5K A;  3HUG B;  1ETW A;  2XKP A;  1F36 A;  3HSR A;  2MLK A;  3CLQ A;  1X2M A;  4RDU A;  4A3I J;  1ZR2 A;  4JQF A;  3CUO A;  3MEX A;  3CCY A;  3G1M A;  5J1R A;  1IAW A;  1J0R A;  1CF7 A;  2M8E A;  3D5R C;  1Z67 A;  2ELH A;  3JRE A;  2K7L A;  4RS8 A;  2NVT J;  5J40 A;  2D1H A;  2ZJ2 A;  3LQQ A;  5FLX Z;  1DQU A;  2Z2S B;  1O7F A;  3E0J B;  2L3D A;  3MZH A;  2QWW A;  1ETY A;  5FKN A;  1IN6 A;  1ACI A;  2M0C A;  4C3I J;  3IWZ A;  4M6Y A;  1KQ8 A;  1DGW Y;  1S7O A;  4V19 K;  2HXO A;  3A1Y A;  2K40 A;  3AKZ A;  4KFC A;  3BTJ A;  3K4N A;  1H0M A;  3VYS B;  2VOD A;  3F3X A;  1K4T A;  2CMP A;  2CH0 A;  5J1U A;  3QU6 A;  1ETO A;  3F0C A;  1IG7 A;  2FF4 A;  4FE7 A;  5H20 A;  1UZC A;  3SZG A;  2CQ7 A;  1ON1 A;  5K7F A;  4WX9 A;  2HKO A;  4FX4 A;  3L2U A;  1G4D A;  2YU9 J;  1MJA A;  3S16 J;  1XGS A;  1IN7 A;  1MMG A;  1D1A A;  3S93 A;  3BJ6 A;  4C3J J;  4ENK A;  1T95 A;  2EV5 A;  5FKK A;  3COA C;  3M4O J;  1B1B A;  1TWC J;  1FX7 A;  3QYE A;  1MSE C;  2PI0 A;  2B63 J;  2LY9 A;  1KQ9 A;  4ASN A;  4GDF A;  2IVM A;  2WB1 A;  3RZD J;  3J7A O;  3RKY A;  2RGV A;  1R71 A;  1P4A A;  3VPR A;  2WTE A;  2VXD A;  5TIS C;  3ZMD A;  1S5L C;  1D8J A;  4B47 A;  5IP9 J;  1MJB A;  4EJO A;  3VB2 A;  3FMS A;  3A01 A;  4HPQ A;  1GT0 C;  3DLL F;  1GV5 A;  3OYH A;  2CRG A;  1WKM A;  1PUF B;  2L9V A;  3SHF A;  1RRJ A;  2Y9Z A;  3SDG A;  3ROU A;  5D5W B;  3I55 I;  5K5R A;  2W4S A;  1LQ1 A;  1ODD A;  2KL4 A;  4AID A;  3WG7 H;  4IQ4 A;  5GAE J;  3MAJ A;  2CUJ A;  3T5X A;  1KA8 A;  5M5W J;  1YX3 A;  3H9J A;  2TRT A;  4AC0 A;  4EJW A;  2P6T A;  3WOD F;  2LOO A;  4PJM A;  3KLN A;  5L3E A;  1KU2 A;  2F5D A;  1VQ8 I;  2EV0 A;  3PQJ A;  1JGS A;  5FD6 A;  1BBY A;  2IGO A;  3NEU A;  4IHW A;  5F64 A;  3KP2 A;  1YIJ I;  2L01 A;  1U9N A;  1FSH A;  3K0L A;  2IAI A;  2P6S A;  3EPZ A;  4HV6 A;  2Z3Y A;  4G7O F;  1YOV B;  2W00 A;  4IPA A;  3S8P A;  4B8X A;  4D1Q A;  2I8D A;  4ZC3 A;  1WJE A;  1FMV A;  2R0Q C;  2NS7 A;  1SD7 A;  2W48 A;  1FBU A;  3OYN A;  2HVR A;  2DOA A;  2KLO A;  4LGW A;  4XID A;  4KUM A;  2QBY A;  2VBY A;  3EDP A;  4B3A A;  1DPU A;  4XM3 A;  1NTC A;  3ZP5 A;  3KP3 A;  1SC7 A;  5E1X A;  2PMH A;  3HB9 A;  4N9H A;  3M8F A;  4B44 A;  4IVN A;  1ZGW A;  5D8K B;  1CF7 B;  4I01 A;  1YW9 A;  1VQ4 I;  2CFX A;  1TWG J;  3PIO F;  2H27 A;  2F6C A;  3FXL A;  4ESB A;  3J81 K;  3CD6 I;  2DA7 A;  4ZTF A;  3F72 A;  2ZFW A;  4Q48 A;  2V1D A;  4MEY F;  4A3M J;  4UV9 A;  4RMN A;  1G3W A;  3P9I A;  4BXF A;  1HST A;  5JVT A;  2L7K A;  1SFX A;  1I50 J;  2XDV A;  3GFM A;  3HRS A;  2O03 A;  5E3M A;  2QUF A;  4I0A A;  3ASN H;  2WB1 N;  2CU7 A;  2HXI A;  2XHK A;  5A2Q Z;  3J80 K;  4KNY A;  4IHT A;  1IXS B;  2FNA A;  3DTI A;  3TDZ C;  1WQ2 A;  3M1C A;  3IAM 2;  2LSO A;  4P9U A;  4NB5 A;  3FZV A;  3R0A A;  1I27 A;  2Y0S N;  4HX8 A;  1S6L A;  3RSN A;  2E1M B;  3G71 I;  1G3Y A;  2DT5 A;  3K7A J;  4A3C J;  2DQR A;  2DI3 A;  2EPF A;  4UUS A;  4KIC A;  2A6E F;  4AM3 A;  4QSH A;  5JI6 A;  1U78 A;  2HVS A;  2HNH A;  2MW8 A;  1R5I D;  2JWT A;  2WY7 Q;  4HDV A;  2X1C A;  3RPQ A;  3FK6 A;  3DV8 A;  3RTR A;  4M73 A;  5HLG A;  3BOQ A;  4U0Y A;  2VJI A;  1R5G A;  4JBA A;  1A6Q A;  2F48 A;  1XN7 A;  3EUH A;  5IY5 H;  2DU9 A;  2PLY A;  3VEP A;  2LY2 A;  4QPQ A;  3I59 A;  2LTP A;  1TZL A;  1H8A C;  1FIP A;  3OOU A;  2OQG A;  3B6C A;  4UHT A;  1V5E A;  3M07 A;  3OIP A;  5F6F A;  5HS9 A;  2EV6 A;  3GTO J;  1LJ9 A;  3E5X A;  1UHM A;  3M8E A;  2R5Z A;  2O6G E;  3BR3 A;  2X1D A;  3DFG A;  5D4R A;  5EZG A;  3MN2 A;  1IO2 A;  1RR7 A;  4Y3O A;  3F8C A;  5C3E J;  2R92 J;  1FLI A;  1O57 A;  4XLN F;  4RAZ A;  3WU0 A;  2DW4 A;  3QOD A;  4F3Q A;  1LDK B;  3FM5 A;  4BHC A;  3L7W A;  3S3O A;  1BC8 C;  2QBY B;  3A02 A;  2LFB A;  3BPX A;  1PVE A;  1STZ A;  4ESJ A;  4A3K J;  1HKT A;  2HPM A;  1KQ0 A;  3T8T A;  1RPW A;  3CLO A;  2QQB A;  3M8J A;  4O6J A;  2R7U A;  1SD6 A;  1MND A;  4E7S A;  1S8N A;  1MD0 A;  3HOV J;  2XAF A;  1DGR M;  2IEK A;  2LKP A;  3GCM A;  3TO6 A;  2R7T A;  2HGC A;  5E17 F;  4RB3 C;  3QOE A;  5TJJ A;  3Q9S A;  3FBI B;  2RVC A;  2DTZ A;  3AG2 H;  3OL3 A;  4MNU A;  3HJE A;  2N8G A;  1N75 A;  4E6K G;  5HNH A;  2IGN A;  2QQ9 A;  1GHC A;  4PZJ A;  3DQV C;  1Z7U A;  4IX7 A;  1IC8 A;  4L9J A;  3ZMV A;  1P7J A;  1TTY A;  1HBX G;  1WPK A;  3H1C A;  1TC3 C;  3IUO A;  1LEB A;  3LNQ A;  1FJL A;  1EV7 A;  3CUQ C;  2DFH A;  3KPH A;  4FHT A;  1MGT A;  2LYC A;  1AU7 A;  4RGU A;  3L2Q A;  4HW0 A;  3KCC A;  5CLS A;  1OQY A;  3S1N J;  4HSR A;  4BJ5 C;  2PFB A;  3S3M A;  2M4K A;  1IF1 A;  3W3C A;  3OYJ A;  5GP9 A;  2CWE A;  3HRT A;  4UUS B;  3R60 A;  5FLX K;  2LRE A;  5LGN A;  1KGS A;  1X19 A;  2P4W A;  3BQZ A;  5E20 A;  4BYY A;  1T56 A;  3C3W A;  3CDI A;  4HEA 2;  2M1B A;  2V26 A;  4JP0 A;  5BNG A;  1MW7 A;  3MKZ A;  1T38 A;  4EJT A;  4ZZD A;  4D7N A;  2P81 A;  5CJ9 A;  3U1D A;  4BQN A;  4JX4 A;  2V4J C;  1TLH B;  1X1A A;  4XMY A;  1X1B A;  4E7Z A;  2JA6 J;  1Y1V J;  4XRM A;  1EH8 A;  4MGR A;  3D5S C;  1GUU A;  1W0T A;  3I59 B;  1JGG A;  2R93 J;  2OU2 A;  4HQM A;  4MLO A;  1JE8 A;  2AXL A;  4R79 A;  1TT0 A;  4N0B A;  3E3V A;  2PG4 A;  5ERI A;  2DCE A;  3HOY J;  2X6Y A;  5F08 A;  5TRD A;  3Q0W A;  4XKV A;  4D5C A;  3HOX J;  3CCM I;  1YJN I;  1OIS A;  1QPI A;  3TW6 A;  2P0W A;  1FP2 A;  5H6Q A;  2DMT A;  1BI3 A;  4D0P A;  1JJ6 C;  2DMU A;  1U8R A;  5FD5 A;  3H3Z A;  3PO2 J;  3CCE I;  1OLT A;  2R5Z B;  2NVY J;  2VJ5 A;  4II3 A;  2EFP A;  1IW7 F;  3KLO A;  3OY9 A;  1WI9 A;  3DKX A;  2X48 A;  3PUF A;  1TW3 A;  2MFZ A;  3HZJ A;  2IS2 A;  3BWG A;  1J09 A;  3TO9 A;  2M30 A;  2CSO A;  3JRA A;  2A5W A;  2DPD A;  1AHD P;  4XIC A;  2EK5 A;  4BS9 A;  1Q1V A;  1WH5 A;  3JRD A;  1G3S A;  3FXK A;  1MKM A;  3S1R J;  2FE3 A;  5E8G A;  1EH6 A;  4RAF A;  4JK1 X;  5EJC A;  5LLQ A;  4F91 B;  2VKH A;  3H5A A;  2RRE A;  3BP8 A;  5EGO A;  3HDD A;  1ETV A;  2OA4 A;  5LGU A;  3TL4 X;  4IHX A;  2E60 A;  2F4O B;  3BRO A;  5ICE A;  3DU5 A;  2EQR A;  1YG2 A;  5ICF A;  2I10 A;  3I4N J;  5F27 A;  2XAQ A;  2JUC A;  1K6O A;  5HDK A;  3CF5 F;  5BPD A;  4Z2Y A;  4RLQ A;  3HPG A;  3ULQ B;  4QPO A;  3QP6 A;  3VYU B;  5JHU A;  1SEU A;  1QU3 A;  4W1U A;  2BY3 A;  2HZD A;  3M9A A;  1U3E M;  2HZT A;  1R4N B;  5K7Z A;  3DTK A;  1Y0N A;  4LMY A;  4II2 A;  2R7W A;  1VTN C;  3HKZ N;  2D1V A;  4OIN F;  1Y8R B;  4MIM A;  3HRU A;  4PFP A;  2WV0 A;  4UB8 C;  2DN0 A;  4C2U A;  2DBB A;  2VQG A;  4HDU A;  1V3F A;  3G73 A;  3OYI A;  3ECO A;  2HDW A;  3CCU I;  1W7P B;  4NC7 A;  5JVG F;  1U5T A;  4M72 A;  1GXQ A;  2HPI A;  1OYI A;  4DYR A;  2D2W A;  2R7S A;  4BJT A;  3JSO A;  2CQN A;  4GO1 A;  1FT9 A;  2YX7 A;  3ABL H;  2ZSI B;  2WAE A;  1TQP A;  1IUF A;  3HPH A;  1JUM A;  1VQL I;  1P4W A;  4KN4 X;  1IJW C;  1MJ9 A;  2EIK H;  2RC4 A;  5IYD J;  4FT8 A;  4OAY A;  4LG0 A;  4BJ6 C;  2ETH A;  1FBS A;  2XAS A;  3FXJ A;  5ILS A;  3ZXS A;  5EG0 A;  1ZTR A;  1MIJ A;  3ZQ7 A;  3PNY A;  2FBI A;  3E7L A;  2RQQ A;  3MMY B;  1WH7 A;  1X3Z B;  5A2Q K;  3ZQF A;  1D1C A;  2DOE A;  3CP8 A;  2F2E A;  4EVI A;  1HCR A;  3ZMZ A;  2MG4 A;  3CJR B;  1IXC A;  3JTG A;  3W2W A;  2WAQ A;  1DU0 A;  2P5L C;  5DM7 F;  1RC9 A;  2A3S A;  2COM A;  4DW6 A;  2A68 F;  2M9H A;  4UVC A;  3K10 A;  5FRM A;  4OAZ A;  2QVO A;  4XLH A;  1Y1W J;  4M3G A;  2XGC A;  5FGM A;  2CQX A;  4YFN F;  1XMX A;  1BI1 A;  4XL9 A;  2JVG A;  3NAR A;  1LE8 A;  1QHG A;  2VPL A;  4XLE A;  1B59 A;  1V5F A;  2J5O A;  2K4B A;  2NRA C;  4KIS A;  2OPT A;  4BQQ A;  2Z33 A;  3S14 J;  2RAE A;  3RYR A;  3I4M J;  1OKR A;  2KHM A;  5LRR A;  2R7V A;  2W7N A;  3TW7 A;  4R8H A;  2R7X A;  3PSF A;  4PSW A;  4PCQ A;  3GTQ J;  2VJ4 A;  4C30 A;  5L3C A;  3CC4 I;  3H5R A;  2OZ6 A;  1OPC A;  3ZOB A;  5EGO B;  1IGN A;  1M1E B;  1K6Y A;  2P8T A;  3ECH A;  2VC0 A;  1V5G A;  1C0W A;  3CP2 A;  1RR8 C;  3P9C A;  2FEZ A;  5F0H A;  2OAZ A;  3SEQ A;  2UUZ A;  2FNP A;  5F1J A;  1B8I A;  2ZME A;  2QSF X;  3ABT A;  3BTL A;  4ETS A;  3CO7 C;  3WHB A;  4AIK A;  1NHA A;  1ZHF A;  3ZN1 A;  4OU0 A;  4MO7 A;  3O3K A;  3KET A;  2O8K A;  2EIM H;  4XBF A;  4CCK A;  1WRJ A;  3IAS 2;  4HST A;  4LK1 F;  1Z7L A;  1WJC A;  2QKL B;  1IV6 A;  2HYF A;  5F1R A;  2BY2 A;  4J01 A;  3HOU J;  2KMU A;  3C2G A;  5J3L A;  4DYC A;  3CUQ A;  1BIA A;  3K4K A;  2LD5 A;  2EA4 A;  1BM9 A;  1JKO C;  2E2J J;  1U5T B;  5IYB J;  5LRS A;  4IXA A;  3SXY A;  3FKJ A;  1MBH A;  1MZB A;  1EKE A;  3JRC A;  3SYT A;  4A5M A;  2OV7 A;  4LB6 B;  3JTH A;  3L00 A;  4DGW B;  2RN7 A;  4A3L J;  1WCM J;  3I64 A;  5D6E A;  1OCC H;  2EFO A;  2E36 A;  3GZ5 A;  4P1W A;  1UFM A;  2ID6 A;  1WJB A;  3EUK L;  2XGD A;  4R1H A;  1UG0 A;  3PL8 A;  4KIF A;  5EG0 B;  3HHH A;  4IO9 F;  4LG0 B;  3I4P A;  5HNF A;  4BDY A;  3GTP J;  4CCL A;  5GAH J;  2X0L A;  1U8B A;  2BY0 A;  4RB1 A;  1T6S A;  1D0Y A;  4BAY A;  4QLC U;  3OS1 A;  3CJN A;  5J4V A;  2CUF A;  2ZCW A;  4I6Z A;  4BHP A;  1RI7 A;  1VQ6 I;  4YII A;  1EF4 A;  3K4J A;  3H0G J;  1XSD A;  4IKF A;  2JJ7 A;  3GEZ A;  3FXO A;  5F04 A;  3P9K A;  2X1E A;  5EDN A;  4RAG A;  4I2O A;  3T0Y A;  2O9L A;  5EEH A;  1R1V A;  4D9J A;  5IT9 K;  5J8F A;  3LA2 A;  2LF8 A;  2AHQ A;  2VQL A;  2X85 A;  4LLN A;  1W36 D;  1I5Z A;  1BI2 A;  4XOP A;  1WJ5 A;  2O8X A;  5CQE A;  3SEZ A;  2K9M A;  3V8L A;  2ZBK A;  4WF2 A;  1LE8 B;  4G9Y A;  1SFO J;  2ELJ A;  3ZR8 X;  1BC7 C;  3QPL A;  2OTL I;  4L0Z B;  3HYI A;  3S17 J;  4KMU X;  3E97 A;  2LH9 A;  2L2O A;  4V2G A;  2HYJ A;  4L5I A;  1Z9C A;  3T1B A;  1ZGA A;  3N97 A;  3GUD A;  2UXX A;  3PUB A;  4FE4 A;  2O3F A;  2LVS A;  4FQG A;  3TOA A;  2K3F A;  4LLL A;  3AAF A;  4RM2 A;  3BZ6 A;  1CQT A;  3NQO A;  1DPR A;  3PIP F;  1MMS A;  3WG9 A;  4CCN A;  5E1Z B;  2LBF A;  1RNL A;  2FOW A;  2RNG A;  3QU3 A;  3IV5 A;  1JTX A;  3K4B A;  1Z3X A;  4LD5 A;  4CXF A;  2ZXJ A;  5JFR A;  1B8I B;  4EM2 A;  5L3F A;  2DTR A;  1ENH A;  6PAX A;  2ZME B;  3VWB A;  2GWR A;  5B66 C;  4NHJ A;  2M3A A;  3UNG C;  3K1N A;  5L3D A;  3MVP A;  2W57 A;  1XGO A;  3HOZ J;  2NS0 A;  3IRR A;  2KKO A;  1AOY A;  2TDX A;  4L9T A;  1BA5 A;  1PYV A;  5B1A H;  2ZJP F;  1ONV A;  1JXS A;  4DZP A;  1HDD C;  4BE1 A;  1TWH J;  3CUQ B;  4M71 A;  1ETQ A;  4WXH A;  1SVM A;  4UUT A;  1B4A A;  3T8R A;  3BG7 A;  2AS5 F;  2GA1 A;  2GXA A;  4EGY A;  1W36 C;  5HS7 A;  3HGG A;  2LKX A;  5KHD A;  1Z6T A;  3A2K A;  3I3L A;  5DD4 A;  2I5U A;  3DWL E;  1LPQ A;  3ABK H;  1RES A;  1IRX A;  4HX4 A;  3B73 A;  3FM3 A;  4DBR A;  4B09 A;  3GWZ A;  3DPU A;  1EH7 A;  1WGX A;  3U2R A;  2K9S A;  4AWX B;  5JLW A;  1AKH A;  1J5Y A;  3VOE A;  4HAM A;  3NWT A;  2IJL A;  4MFE A;  2C6Y A;  2HS5 A;  3S2D J;  1RET A;  3VYR B;  3QAH A;  2Z9O A;  2Y30 A;  3QYF A;  1O3T A;  2COB A;  4XLC A;  3GXO A;  3S32 A;  1F9N A;  1FMW A;  4F92 B;  4BKX A;  1SAU A;  5LEJ A;  4XOR A;  3SFZ A;  1BOB A;  2ZJR F;  3BCB A;  3AL0 C;  1PP7 U;  1LFB A;  3J7Y J;  1IDZ A;  3CCR I;  2DYR H;  3ELK A;  3GLX A;  2K5C A;  2QA4 I;  3R61 A;  3MKW B;  4A3B J;  2H1L A;  3KZI C;  2IS4 A;  5AIP A;  5ILV A;  3U9G A;  3OV8 A;  1JKP C;  3FXU A;  2V9V A;  3TP3 A;  1J59 A;  2IGK A;  4AU7 A;  2JA5 J;  3WGG A;  4ESF A;  4WCG A;  5FLM J;  2E35 A;  3JRF A;  3RPU D;  3CF2 A;  3LFK A;  2GM4 A;  3W6K B;  3PO3 J;  2K4J A;  3DP7 A;  3GTJ J;  1X4P A;  4C9Y A;  4RLF A;  1T08 B;  1PJR A;  3QP5 A;  5HOO A;  1IN5 A;  5CVU A;  5J4Y A;  1T2K A;  5C44 J;  3LA7 A;  4RB2 C;  2BW3 A;  2PEX A;  3FK7 A;  1HQC A;  3QPH A;  2M5W A;  2ZFU A;  4S05 A;  1OR7 A;  3OOP A;  2VPR A;  2OUM A;  3LAP A;  2HOS A;  1X3W B;  3C2B A;  1FOY A;  4EGZ A;  1KU7 A;  2CV1 A;  2MH2 A;  4P5O A;  3F8B A;  5KK1 A;  4RA2 A;  1FZP B;  3ML6 A;  1JKR C;  4O5V A;  2LBF B;  3D5L A;  2VL8 A;  1B9N A;  2EZI A;  2E2H J;  3E1S A;  4I98 B;  4PDK A;  3CQZ J;  2M7A A;  2ICW G;  2AO9 A;  1OCP A;  3ZPL A;  2PMU A;  3ESW B;  3FHZ A;  4HYE A;  2KQR A;  1V54 H;  1ZRE A;  2X6X A;  3ABU A;  3RKQ A;  1ETX A;  3K9T A;  2H6B A;  3WTV C;  4XRF A;  1XB4 A;  4YIF A;  2NS8 A;  1UMQ A;  4XK4 A;  1Y8Q B;  1YX5 A;  2XV4 S;  1HKQ A;  1ZYR F;  2GZW A;  1I3A A;  3IH4 A;  2VBX A;  3BG5 A;  1FP1 D;  2EJR A;  2V7F A;  3FMQ A;  3I53 A;  3ZGK A;  2WV1 A;  4DZJ A;  3WE2 A;  4XLA A;  1REP C;  3OYB A;  2ECC A;  3G1L A;  1LVK A;  2W84 A;  2LR8 A;  2R7Z J;  1H89 C;  2CYY A;  3OIQ A;  3NRV A;  3H3V K;  3NWS A;  1LDD A;  1UST A;  2DA4 A;  4GGG A;  4BH9 A;  2DK5 A;  1XX5 A;  2GXG A;  4L18 B;  3C18 A;  4LLG F;  4GFB A;  3LSM A;  3S1Q J;  4XRS A;  4UXN A;  4Y52 J;  4BE2 A;  2HKX A;  3G1O A;  2OF7 A;  3CMA I;  1WSU A;  2DJI A;  3DLA A;  2XPW A;  3JRG A;  1AKH B;  3RIR A;  2VT3 A;  1WVR A;  2HYG D;  1WI3 A;  2BZT A;  1QO0 D;  3V42 A;  5EF6 A;  4CO8 A;  2YR2 A;  3AG3 H;  5K5Q A;  2KIQ A;  2CW7 A;  3OL4 A;  4WXC A;  3CDH A;  3DBH B;  2DOD A;  3KZZ A;  2QQ8 A;  4XSZ F;  4A69 C;  4EJU A;  2P7C B;  1YIO A;  2QYO A;  2B0L A;  2EZH A;  1B6A A;  4XR6 A;  2MGQ A;  2O5R A;  2XAG A;  3PM1 A;  4JX6 A;  4I02 A;  4HNV A;  1RIO H;  3EUA A;  1JTY A;  4ZDO A;  4ZTJ A;  2F5V A;  1QVU A;  2ESH A;  4IL6 C;  1IRG A;  1SAN A;  2V1X A;  3U1K A;  4LG3 A;  2WY8 Q;  4BBS J;  2H8R A;  4L0Y B;  2XIG A;  1G3T A;  4D7M A;  4RB0 A;  2E7X A;  4HRI A;  3BR5 A;  3IKV A;  2CGP A;  2E2I J;  4XNF A;  2RKH A;  2V6E A;  1D3Y A;  2Q8K A;  2RDP A;  2E1C A;  5FB2 A;  4H0E A;  2R3S A;  4HF1 A;  4NNJ A;  2Z16 A;  4LK0 F;  4PSX A;  1KU9 A;  2H8W A;  2RQP A;  2CQK A;  1QZY A;  2BW3 B;  2KDO A;  4M6V A;  4EMS A;  2A05 A;  4U0W A;  1XSX A;  3B02 A;  3G3Z A;  2Y9Y A;  4XSX F;  5GTH C;  4ZJZ A;  2JA8 J;  2L9N A;  5DUI A;  3LSG A;  2B9S A;  1WHU A;  2FQ4 A;  4GRI A;  3V7R A;  2K9L A;  1LVA A;  3GLL A;  3HOW J;  4JYK A;  3WE3 A;  1BW5 A;  2X6W A;  2CUE A;  2E1O A;  1VQ9 I;  4PUS A;  3L2C A;  4BHB A;  4U0V A;  2DXI A;  4A3F J;  1XD7 A;  1MDM A;  2X4H A;  1UAA A;  2ZNZ A;  3BG9 A;  5D5X B;  3K1P A;  3BTI A;  1SMY F;  2G0E A;  4HNU A;  4XOT A;  1IUY A;  1W7P A;  4MEX F;  2K02 A;  1JT0 A;  3LFU A;  1MMN A;  1Z0X A;  2MD0 A;  4FIS A;  1W0U A;  5IT9 Z;  2CUZ A;  1MSF C;  4BQA A;  3L09 A;  3ZN0 A;  4CUG A;  3A0H C;  2KZV A;  2XUB A;  5BOX A;  4E7I A;  2VOP A;  4B1R A;  2DA2 A;  3A0B C;  2IS1 A;  2JT1 A;  4C2T A;  2VKV A;  3GO5 A;  3I58 A;  1L3L A;  3S1M J;  2VKD A;  5CQG A;  2V9K A;  3OYE A;  1HDP A;  1L0O C;  4G8X A;  3BCA A;  4KMF A;  3LSK A;  4MHG A;  1Z3Y A;  4HBL A;  4M3F A;  1PUE E;  2HTS A;  3H92 A;  3LQR A;  1MBG A;  2DMP A;  2Z5U A;  5E1W A;  3K4C A;  3ASO H;  1HC8 A;  2LRD A;  1PP8 F;  3WHC A;  1D0Z A;  2LC2 A;  3V8J A;  3JAM K;  1E17 A;  1BJZ A;  1YS7 A;  3X2Q H;  4Q5S F;  1HW1 A;  2IS6 A;  3DEU A;  4OOI A;  3DPT A;  2BV6 A;  1E2X A;  2K86 A;  4M9X A;  2DFI A;  2G7U A;  2QZ8 A;  2KDZ A;  1YJW I;  4OMY A;  1QQI A;  4MQV A;  1MNM C;  1FOK A;  2HOT A;  1ZH5 A;  4E70 A;  5GAG J;  2JUG A;  3O8G A;  1MBK A;  1ZGJ A;  3H3U A;  2XKO A;  1LUJ B;  5D6F A;  2CW0 F;  4BE0 A;  2FRH A;  3CC2 I;  4IHY A;  2RV8 A;  4EJV A;  3RKW A;  3QPT A;  1VI0 A;  4F52 A;  5DS9 A;  3OYG A;  2IT0 A;  2PQ8 A;  1ZKG A;  1AWC A;  5DCM A;  2BVL A;  4ZYG A;  4AVP A;  3S3N A;  4HA8 A;  4E4H A;  4HLY A;  1O3R A;  4UY8 I;  2JRM A;  2HTJ A;  1W5C C;  4BXX J;  2UZK A;  1LEA A;  1U6G A;  3ZMU A;  2VXZ A;  2V1U A;  5LHG A;  1ZK8 A;  1S7A A;  4X0G A;  1IN4 A;  4A5N A;  2EFN A;  5ILU A;  2NVX J;  1P7I A;  2UXN A;  1T39 A;  1JUP A;  2W25 A;  1MMA A;  1NK2 P;  1N25 A;  3L2W A;  1E3P A;  4V2F A;  4F7Z A;  3J7A Y;  4HF2 A;  3WTW C;  3S15 J;  2LDU A;  3C7J A;  5BMZ A;  1BIB A;  2R5Y A;  2AQF A;  2L7Z A;  1BR2 A;  1TWA J;  4B48 A;  3JRH A;  2NAZ A;  1NK3 P;  2DDB A;  2E5Z A;  4IEJ A;  5HLH A;  2R4G A;  2GA2 A;  5BS6 A;  3K2A A;  4HV5 A;  2O61 A;  4XQF A;  1UG2 A;  5DYM A;  1MDM B;  3HG9 A;  3K1M A;  3CCS I;  3KFW X;  4KIT B;  4UB6 C;  5J1Y A;  3Q5F A;  1J7K A;  3IP4 B;  4BDZ A;  1W5S A;  2DAO A;  1OCZ H;  3KX2 A;  2LP0 A;  1T0F C;  4BY1 J;  2A69 F;  3H0D A;  3K6G A;  4FCY A;  5M5Y J;  4M9Z A;  5CVR A;  5KAF C;  2OC6 A;  1K4S A;  5J8C A;  2L54 A;  3OYA A;  2HWV A;  3CME I;  1LDJ A;  3R6S A;  2XF6 A;  1ZRD A;  1YJ9 I;  1OCT C;  1X58 A;  2JPB A;  3C2H A;  4JX5 A;  3VDX A;  2ZXH A;  1VFC A;  1J2X A;  1NG6 A;  2CQQ A;  3GX4 X;  4UNO A;  3WU1 B;  1XG1 A;  2M8G X;  3G6E I;  4PFO A;  3W6V A;  3KYD B;  3AG4 H;  2KIS A;  2DFF A;  2BXY A;  1HA8 A;  1UHW A;  4W97 A;  5DCF A;  1QNT A;  2ID3 A;  5IYC J;  1Y6I A;  2DPU A;  1BN5 A;  5F0C A;  1JKQ C;  2ZXI A;  2FXA A;  3GVA A;  3U21 A;  1OYW A;  2HOE A;  1KZH A;  2H6C A;  2EZK A;  2F5F A;  2F5E A;  4ZDP A;  2JMW A;  2STW A;  4EAT A;  1H9G A;  2VE9 A;  3CMM A;  5E8I A;  2Y69 H;  3DU6 A;  3H9G A;  2X6O A;  1Z6R A;  1HOM A;  5CPR B;  4FET A;  2HDD A;  2L9R A;  2L5Q A;  3E6D A;  3BZK A;  1BJA A;  4ENM A;  2EIN H;  4HF0 A;  2HEO A;  2CJJ A;  2VIX A;  3RZO J;  3LST A;  4QIW N;  2VI6 A;  2K3P A;  3DTE A;  3AL0 B;  1TBX A;  2VQH A;  4QTR A;  1FNN A;  4J00 A;  2EB7 A;  3CCJ I;  3FKI J;  4HOB A;  2VON A;  5E18 F;  3OS0 A;  4IQJ A;  1QZZ A;  2K9N A;  3TBI A;  4Y13 A;  4OIR F;  3K4L A;  5DCM B;  1W4M A;  4HZF A;  1XC5 A;  3OSF A;  1P4X A;  3ERM A;  2A6T A;  3GTL J;  4ITV A;  3DCF A;  2G7H A;  4WXD A;  3HBL A;  3RKX A;  3BLY A;  1USS A;  3JRI A;  4JOM A;  3GZ6 A;  1F1Z A;  2ADU A;  4BGD A;  1GV2 A;  5FKO A;  3RQ4 A;  1QA6 A;  2WC2 A;  3PJR A;  3E6B A;  5LGT A;  1VQ7 I;  2R5Y B;  2VB6 A;  3RCO A;  3LMM A;  3ZQG A;  3E6M A;  5ICC A;  3F23 A;  2ZKZ A;  4M6X A;  5FO5 A;  2QM3 A;  4YEJ A;  5KNL A;  4BU2 A;  2X51 A;  5M5X J;  2FA5 A;  4L5E A;  1BW6 A;  4A6D A;  3I9V 2;  3CDL A;  1OCR H;  1A6I A;  3CTA A;  1VZ0 A;  3KEY A;  1JHF A;  1FC3 A;  1P9Q C;  2CFO A;  2KJB A;  2DDA A;  2EFW A;  1I1S A;  2E1N A;  3LSP A;  4G6Q A;  1XTA A;  3FF5 A;  1ETK A;  1FEX A;  2KRC A;  2OD5 A;  3VSL A;  1FYM A;  3PNV A;  4RBO A;  2XSD C;  2EBI A;  2MC3 A;  1ORK A;  4N4N B;  1WJF A;  4DOZ A;  1QRY A;  2O7O A;  4YRV A;  2NOG A;  4M3D A;  4X6A J;  3KYL A;  1FTZ A;  5GPC A;  3ZQC A;  4ZDL A;  3J7Z I;  3BR2 A;  3ERE D;  1SFK A;  2QLZ A;  3TDU C;  3CCV I;  2ME0 A;  3KYC B;  3BR1 A;  4AUX A;  3MKY B;  5HDN A;  2ZO4 A;  2WAQ N;  2KFD A;  4GXO A;  4YEL A;  3WTY C;  2BOL A;  1FYK A;  2JZY A;  5K5O A;  4K2E A;  1F43 A;  1G8X A;  3KEO A;  2BVM A;  3SFI A;  4PK4 A;  2WAF A;  1VQK I;  4IRH A;  3F8N A;  1XSV A;  1W1W E;  4HX7 A;  1TT5 B;  3I71 A;  3MD2 A;  4M3B A;  4HQE A;  2BHY A;  2IW5 A;  3IC7 A;  4AIJ A;  3KP5 A;  1HF0 A;  2FQ3 A;  4U88 A;  2DQL A;  3S2W A;  4KYW A;  1Z21 A;  2XGE A;  3WTZ A;  5JHF A;  3AFH A;  4FTH A;  1IN8 A;  1POG A;  3GZN B;  1R1U A;  2ME6 A;  4CSW A;  1Z91 A;  1MH4 A;  3MKL A;  2ZJQ F;  4KA4 A;  2JK3 A;  2XPU A;  2ZB9 A;  1JUS A;  1XMK A;  1W7P D;  1ZR4 A;  4IHS A;  1BOA A;  1FWZ A;  2FUG 2;  1O4X A;  2M45 A;  4IJA A;  5EEA A;  1ZLK A;  1W5T A;  2DFE A;  2L7F P;  1CGP A;  3LWF A;  3E5U A;  2GAU A;  5H6R A;  3GW2 A;  4GYI A;  1MH3 A;  4IOC F;  1ZG5 A;  1TP4 A;  4MTD A;  1FSE A;  3LAJ A;  1OYY A;  2KIF A;  4OWR B;  3ZQQ A;  1XDS A;  3ZQH A;  1P6R A;  3ABM H;  3ZQI A;  4BL0 B;  4G7Z F;  1ERD A;  4YFX F;  3W2V A;  1MBE A;  4A0Y A;  4C2M J;  4MFD A; 
#chains in the Genus database with same CATH homology
 2NS8 A;  1UMQ A;  4XK4 A;  2DMQ A;  4D7N A;  2P81 A;  1I3Q J;  2KT0 A;  4JX4 A;  3IH4 A;  3BG5 A;  2M34 A;  2QF7 A;  2JA6 J;  1Y1V J;  4XRM A;  2DJN A;  4LOC A;  1GUU A;  2WV1 A;  4BY7 J;  4DZJ A;  1W0T A;  1JGG A;  1BL0 A;  2K9Q A;  2R93 J;  2ECC A;  3G1L A;  3Q0V A;  4MLO A;  5E3O A;  4A3E J;  2LR8 A;  2FJ1 A;  3HM5 A;  2R7Z J;  2QCO A;  1H89 C;  3HOY J;  5F08 A;  3H3V K;  5C4X J;  3Q0W A;  1JT6 A;  2DA4 A;  4D5C A;  4IHV A;  3HOX J;  1QPI A;  1B72 A;  3M3Y J;  3TW6 A;  2YS9 A;  2DA5 A;  2DMT A;  4GFB A;  3S1Q J;  4Y52 J;  4XRS A;  2DA1 A;  3TP0 A;  2DMU A;  1JJ6 C;  3G1O A;  2OF7 A;  3PO2 J;  2R5Z B;  2NVY J;  1VND A;  2FX0 A;  2XPW A;  3JRG A;  1AKH B;  4BBR J;  2TCT A;  2X48 A;  3TED A;  5C4J J;  1WI3 A;  2LLK A;  2JA7 J;  3GTM J;  1LFU P;  5EF6 A;  4A93 J;  3JRA A;  5FJ8 J;  1AHD P;  4XIC A;  1Q1V A;  4A69 C;  2XB0 X;  1WH5 A;  3JRD A;  1XS9 A;  2EZH A;  3S1R J;  2XRL A;  2MGQ A;  4HNV A;  4JX6 A;  3PM1 A;  3LSR A;  3IH3 A;  3Q3S A;  1JTY A;  1Z77 A;  5FKM A;  5EYR A;  1QVU A;  1T33 A;  5EGO A;  4Y7N J;  3HDD A;  1ETV A;  5HOD A;  2DA3 A;  1ITY A;  1SAN A;  2E19 A;  4BBS J;  2GLO A;  3BT9 A;  2H8R A;  4IHX A;  1IDY A;  4D7M A;  2EQR A;  2I10 A;  3I4N J;  3BR5 A;  2E2I J;  3SJM A;  5F27 A;  5JLX A;  1RKT A;  5FKL A;  1OFC X;  3BTC A;  3S2H J;  4S0H B;  4D5F A;  9ANT A;  1D5Y A;  4CYC A;  4W1U A;  4M6V A;  1PUF A;  1UHS A;  2DMN A;  3QQA A;  5K7Z A;  2Y9Y A;  2JA8 J;  3HKZ N;  2GBY A;  3B6A A;  4MIM A;  3LSG A;  2LK2 A;  2DN0 A;  2FQ4 A;  2MSY A;  1FIA A;  3HOW J;  1IRZ A;  1BW5 A;  4JYK A;  2CUE A;  2E1O A;  1APL C;  2VUM J;  4DYR A;  4A3F J;  1QVT A;  5IP6 A;  4NDL A;  5GPA A;  1IUF A;  4XRS G;  5DTD A;  1JUM A;  3BG9 A;  3QPS A;  2XPV A;  3BTI A;  2G0E A;  1IJW C;  2M2E A;  5IYD J;  3JRB A;  5EG0 A;  1JT0 A;  1TWF J;  1ZTR A;  1Z0X A;  1W0U A;  4FIS A;  1MSF C;  3E7L A;  3HEF A;  1A5J A;  5M3F J;  1WH7 A;  3LOC A;  1H88 C;  3ZQF A;  1U9O A;  4B1R A;  2DA2 A;  1HCR A;  2VKV A;  1K61 A;  1ETW A;  1F36 A;  2MG4 A;  3S1M J;  2XB5 A;  1X2M A;  4ABZ A;  4RDU A;  4A3I J;  1ZR2 A;  1DU0 A;  1HDP A;  3CCY A;  3G1M A;  3Q0U A;  5J1R A;  4A3G J;  1G2H A;  3L1P A;  4DW6 A;  2M9H A;  4M3F A;  1B72 B;  1MBG A;  2DMP A;  3JRE A;  2NVT J;  4EEF G;  3WHC A;  4B4C A;  1Y1W J;  4M3G A;  2XGC A;  1BJZ A;  2CQX A;  1RKW A;  3NAR A;  1LE8 A;  1ETY A;  5FKN A;  2M0C A;  2ECB A;  4C3I J;  3GTK J;  2KDZ A;  2OPT A;  2HXO A;  1MNM C;  2K40 A;  3S14 J;  2HOT A;  2RAE A;  3I4M J;  3BTJ A;  2YUS A;  3O8G A;  3TW7 A;  1MBK A;  5J1U A;  3GTQ J;  1ETO A;  3F0C A;  3ZOB A;  5K7F A;  4FE7 A;  5EGO B;  1IG7 A;  3BR0 A;  4IHY A;  1IGN A;  3FIW A;  2YU9 J;  3S16 J;  2L0K A;  3A01 B;  4C3J J;  1VI0 A;  5DS9 A;  5F0H A;  1ZKG A;  2HOA A;  4C3H J;  5F1J A;  5FKK A;  3M4O J;  3GTG J;  1B8I A;  4BXX J;  1TWC J;  3BTL A;  1MSE C;  2B63 J;  2LY9 A;  3WHB A;  3RZD J;  4MO7 A;  1ZK8 A;  2O8K A;  3VPR A;  2DA6 A;  5IP9 J;  1I6H J;  1GT0 C;  3A01 A;  2NVX J;  4CYC B;  1P7I A;  1GV5 A;  1JUP A;  2CRG A;  3GBG A;  1IV6 A;  1NK2 P;  1PUF B;  3RQI A;  2Y9Z A;  4V2F A;  3HOU J;  3SDG A;  5M3M J;  5J3L A;  4DYC A;  3S15 J;  1YRN A;  2NVQ J;  2R5Y A;  2L7Z A;  2LD5 A;  3OIO A;  1TWA J;  3JRH A;  1JKO C;  2E2J J;  1NK3 P;  5IYB J;  4IEJ A;  1MBH A;  5M5W J;  3K2A A;  4AC0 A;  2TRT A;  3JRC A;  1UG2 A;  4A3L J;  1WCM J;  5IP7 J;  5J1Y A;  4IHW A;  2FD5 A;  1U9N A;  2ID6 A;  2EZL A;  2IAI A;  2LP0 A;  2XGD A;  4BY1 J;  5EG0 B;  3LSJ A;  4FCY A;  5M5Y J;  3GTP J;  1U8B A;  4A3D J;  2R0Q C;  2NS7 A;  1OCT C;  1X58 A;  4JX5 A;  2CUF A;  2W48 A;  4XID A;  4I6Z A;  1VFC A;  2CQQ A;  1EF4 A;  3H0G J;  4B3A A;  1XG1 A;  2JJ7 A;  1NTC A;  3A03 A;  2M8G X;  5F04 A;  5EDN A;  3W6V A;  3HB9 A;  2O9L A;  1ZGW A;  4W97 A;  5IYC J;  2ID3 A;  5F0C A;  1JKQ C;  1TWG J;  2AHQ A;  1MBJ A;  2EZK A;  5E3N A;  2JMW A;  2DA7 A;  1LE8 B;  4A3M J;  1SFO J;  5IOY A;  2HI3 A;  2X6O A;  1HOM A;  2HDD A;  3QPL A;  2L9R A;  3S17 J;  3HGY A;  4V2G A;  1I50 J;  1VF9 A;  2HYJ A;  5E3M A;  2CJJ A;  3FIS A;  3RZO J;  2WB1 N;  2CU7 A;  4QIW N;  2HXI A;  2VI6 A;  4FE4 A;  2LVS A;  4QTR A;  3NAU A;  1CQT A;  3FKI J;  2K9N A;  4AYB N;  2Y0S N;  1X2N A;  1FTT A;  3K7A J;  4A3C J;  3IV5 A;  1JJ8 C;  4UUS A;  1JTX A;  4QSH A;  1B8I B;  1XC5 A;  1ENH A;  3OSF A;  1U78 A;  2MW8 A;  2JWT A;  3GTL J;  1GVD A;  3DCF A;  3FK6 A;  3MVP A;  3HOZ J;  3HBL A;  4X1E A;  3JRI A;  1BA5 A;  1GV2 A;  5FKO A;  4DZP A;  1HDD C;  3DEW A;  5E3L A;  1E3O C;  1TWH J;  1YRN B;  2LTP A;  1ETQ A;  2JN6 A;  4UUT A;  2R5Y B;  1H8A C;  3ZQG A;  1FIP A;  3OOU A;  3B6C A;  5M5X J;  4L5E A;  2LKX A;  3HGG A;  1BW6 A;  3O8H A;  4DYQ A;  3CDL A;  5F0F A;  1A6I A;  1RES A;  4A3J J;  2Y31 A;  3GTO J;  3LSP A;  3BR6 A;  1R9T J;  1WGX A;  2R5Z A;  1ETK A;  2K9S A;  3BR3 A;  1FEX A;  5JLW A;  1AKH A;  1S7E A;  5EZG A;  3MN2 A;  4RBO A;  2XSD C;  4M3E A;  1RR7 A;  2EBI A;  3BG3 A;  4MFE A;  1ORK A;  5C3E J;  2R92 J;  3S2D J;  1RET A;  5IOZ A;  2Y30 A;  1QRY A;  2O7O A;  2COB A;  2NOG A;  4M3D A;  4X6A J;  1FTZ A;  4G12 A;  5GPC A;  2PMZ N;  3ZQC A;  1HLV A;  3BR2 A;  2ELK A;  2ME0 A;  3BR1 A;  4BKX A;  3A02 A;  4AUX A;  2LFB A;  3D1N I;  1ZQ3 P;  2WAQ N;  2IBD A;  4A3K J;  1LFB A;  1IDZ A;  2X9D A;  1F43 A;  1OJL A;  2EH3 A;  4A3B J;  3SFI A;  1RPW A;  3ZQL A;  1K83 J;  1JKP C;  2H1K A;  3TP3 A;  4M3B A;  2JA5 J;  1MBF A;  5FLM J;  3HOV J;  1HF0 A;  3JRF A;  3UKG A;  5FLV A;  3OSG A;  2IEK A;  2GM4 A;  3PO3 J;  2XGE A;  3GTJ J;  4FTH A;  1DU6 A;  2DTZ A;  5K7H A;  2HQ5 A;  1POG A;  2N8G A;  2ME6 A;  5C44 J;  3CMY A;  1MH4 A;  3FK7 A;  3MKL A;  1IC8 A;  2JK3 A;  2XPU A;  2ZB9 A;  1P7J A;  1JUS A;  2VKE A;  1ZR4 A;  2VPR A;  1WPK A;  2HOS A;  1TC3 C;  4J19 A;  3C2B A;  2D5V A;  3LNQ A;  1O4X A;  1FJL A;  5EEA A;  2L7F P;  1AU7 A;  2Y2Z A;  1JKR C;  3S1N J;  3BQY A;  4I76 A;  1MH3 A;  2EZI A;  5GP9 A;  2E2H J;  3CQZ J;  4UUS B;  2AO9 A;  1OCP A;  3JR9 A;  3IH2 A;  1GDT A;  2L7M P;  5IPA A;  5EZH A;  3RKQ A;  1ETX A;  3BQZ A;  3ZQH A;  1T56 A;  3ZQI A;  1MBE A;  4JP0 A;  5BNG A;  4C2M J;  4MFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...