2E1OA

Solution structure of rsgi ruh-028, a homeobox domain from human cdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
b'GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein PRH
publication title Solution structure of RSGI RUH-028, a homeobox domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e1oA01
1A6IA 2CU7A 4A3LJ 4JYKA 1WCMJ 4NDLA 2VKVA 5IP9J 2CUFA 2AHQA 3BQYA 2DA5A 4C3HJ 4HNVA 2E1OA 4XIDA 2EZLA 3S2DJ 4CYCA 2KT0A 2WV1A 2DMPA 1IDYA 3LSJA 3Q0WA 3ZOBA 1AU7A 3MVPA 5K7FA 2HXIA 1NK3P 2EQRA 3D1NI 3ZQGA 2DA6A 1ZQ3P 2JWTA 3TW6A 4IEJA 4X1EA 2DA2A 2R5ZA 3TEDA 2Y2ZA 4W1UA 3WHBA 2E2JJ 2AO9A 1GV5A 3CCYA 2JK3A 4B3AA 3A01A 4FE7A 2DN0A 5F0HA 1U8BA 1Z0XA 4A93J 1XS9A 1IDZA 1F36A 1VNDA 3ZQIA 2M9HA 5EEAA 2EBIA 1TWAJ 3M3YJ 4MIMA 1IC8A 1MBJA 1B8IA 4B1RA 1BL0A 2HOTA 5IYBJ 1QPIA 3HM5A 1JJ6C 4M3GA 1EF4A 4EEFG 3NARA 2OF7A 2YU9J 2FX0A 1FIAA 1HCRA 1JUPA 3PO2J 2DA7A 1I50J 3HOXJ 4FISA 1TWFJ 2XGEA 2LVSA 4BBRJ 2WB1N 2LP0A 3CDLA 3GBGA 3I4NJ 1B72B 9ANTA 2NS7A 1IGNA 3DEWA 2DMTA 3LSRA 3C2BA 5F08A 3ZQFA 3K2AA 2L9RA 2DTZA 2NVQJ 2LLKA 3Q3SA 4IHXA 2Y0SN 2NS8A 1HDPA 1UMQA 3TP0A 4JX4A 5IOYA 3OIOA 3CMYA 1WH7A 2RAEA 3ZQHA 3K7AJ 2HXOA 2DA3A 5FKMA 3OSGA 3HEFA 2CUEA 4AUXA 2HYJA 1VFCA 3LSPA 5EF6A 2R5ZB 5C4XJ 1WPKA 2LK2A 4RBOA 1XG1A 2CQXA 3FK6A 5EG0A 2XPWA 3A03A 5IOZA 2JJ7A 3A01B 2LD5A 1P7IA 2XRLA 4GFBA 3GTGJ 4IHWA 4XICA 4IHYA 1ETOA 1W0TA 4B4CA 1GUUA 5FJ8J 2I10A 2JA7J 2EZHA 3HOYJ 4M6VA 3BG5A 2O7OA 4DW6A 1MSEC 5FKKA 3FK7A 5F27A 1B8IB 2HDDA 1RKTA 2X6OA 2JA5J 4I6ZA 2EZKA 1H8AC 5C3EJ 4J19A 1MBKA 1MBGA 3S16J 2N8GA 1MBEA 4C2MJ 5EZGA 4V2GA 5GP9A 1JKOC 2M0CA 2JMWA 3PM1A 5EDNA 2L7FP 2VKEA 4BY1J 4A3MJ 1P7JA 2Y9YA 5FLVA 4A3DJ 5DS9A 1VI0A 2ECBA 1BA5A 2LKXA 3HGGA 1IJWC 2L0KA 1SANA 3NAUA 4JP0A 2FJ1A 2E2HJ 1OCPA 1S7EA 3RZOJ 4G12A 5EGOB 2VI6A 3GTMJ 2KDZA 5J3LA 1I6HJ 1JT0A 4A3IJ 2NOGA 5E3OA 3G1LA 4IHVA 3BR2A 4QTRA 2JA6J 1WI3A 3BR5A 3ZQLA 4XRSG 1POGA 1I3QJ 1NTCA 2VPRA 2ME6A 1CQTA 2K9QA 3BG3A 1HLVA 1BW5A 2R7ZJ 3JRBA 2EZIA 2M2EA 4DZPA 4JX5A 5EG0B 2VUMJ 1BJZA 4XRMA 2ID3A 2ELKA 4DYCA 4XRSA 5M5WJ 4A3EJ 1Z77A 2ZB9A 1MH3A 2DMUA 3HOUJ 2COBA 1H88C 2MW8A 1G2HA 4FCYA 1FJLA 1GT0C 5GPAA 1T56A 1ZKGA 5J1UA 3F0CA 2NVYJ 2QCOA 3BR0A 3JRDA 1RPWA 4FTHA 2XB0X 1WH5A 4FE4A 4X6AJ 1IRZA 1MSFC 5C44J 1K61A 2X48A 2L7MP 1ETXA 1RKWA 3BQZA 3GTJJ 2PMZN 1NK2P 3BTLA 1W0UA 2Y31A 1X2NA 5EGOA 4M3BA 2Y9ZA 3G1OA 3B6CA 2TRTA 4D5CA 1ETWA 2XGDA 1T33A 4MFDA 4BY7J 1UHSA 2CRGA 3S1RJ 1ENHA 3G1MA 3MN2A 1QVTA 4DYQA 2LTPA 3HDDA 3BTJA 5EZHA 4A3BJ 2QF7A 3Q0VA 3M4OJ 4JX6A 3S1MJ 1APLC 3JRGA 3A02A 5HODA 3LOCA 1R9TJ 1O4XA 4A3FJ 1LFUP 1JKPC 2MSYA 1E3OC 4C3JJ 3UKGA 2IEKA 1X58A 3Q0UA 2ECCA 3TP3A 1RESA 1DU6A 1QVUA 2XGCA 3S2HJ 1IUFA 3BTCA 3JREA 2O9LA 4MO7A 1MH4A 1JKRC 2DA4A 2H8RA 5K7HA 5IYDJ 1ITYA 3FISA 3BG9A 2XPUA 2HI3A 4XK4A 2EH3A 3S1QJ 3E7LA 1AKHA 1Q1VA 2IAIA 5DTDA 2NVTJ 1D5YA 3IH2A 4RDUA 1FIPA 4BXXJ 1JT6A 3QPSA 3BR6A 1GVDA 1TC3C 1IG7A 2M8GX 5FKOA 4A69C 2B63J 3HOZJ 4BKXA 4AC0A 3HKZN 1QRYA 3S17J 3RKQA 1JTXA 2CQQA 3FKIJ 4QSHA 1MBFA 5M5XJ 3S14J 4M3EA 3O8HA 5J1YA 1ETVA 5IP6A 2P81A 1ETQA 3JRCA 3JRHA 2LFBA 3DCFA 3QPLA 4UUSB 1LFBA 1WGXA 1ZTRA 1FTTA 4A3JJ 3BR1A 3SFIA 3WHCA 5E3NA 1BW6A 2H1KA 2IBDA 3BT9A 1FTZA 5EYRA 1ZR4A 3H3VK 3JR9A 1AHDP 1FEXA 2R5YB 1HF0A 2YS9A 2E2IJ 4A3CJ 2X9DA 2FQ4A 2GBYA 5BNGA 1OCTC 2R93J 1X2MA 1A5JA 4I76A 1JTYA 2M34A 5M3FJ 3S1NJ 2E19A 2ME0A 1PUFA 3BTIA 1JJ8C 1SFOJ 1YRNB 4BBSJ 3OOUA 2DMNA 2TCTA 2W48A 3SJMA 2R0QC 5FLMJ 1ORKA 2OPTA 2XB5A 1UG2A 1VF9A 1GV2A 2LY9A 3TW7A 4S0HB 3LNQA 3LSGA 2K40A 3FIWA 1AKHB 3HOVJ 4C3IJ 3JRIA 2MGQA 5IPAA 3VPRA 5E3LA 3O8GA 3JRAA 5J1RA 5JLXA 1Y1VJ 4UUTA 5GPCA 1K83J 2O8KA 4D7MA 2ID6A 2HQ5A 3MKLA 3GTLJ 5IYCJ 3HOWJ 1H89C 5F04A 4UUSA 1GDTA 1LE8B 3IV5A 1RETA 1RR7A 4QIWN 4D5FA 3QQAA 3S15J 4A3KJ 2DJNA 1U9OA 2G0EA 2R92J 4MFEA 3ZQCA 2HOSA 4DZJA 1OJLA 1TWHJ 2R5YA 3W6VA 3CQZJ 3RQIA 2HOAA 3JRFA 1HOMA 1JKQC 4CYCB 5M3MJ 3OSFA 4MLOA 2K9SA 5F0CA 4DYRA 2DMQA 2YUSA 1YRNA 2XSDC 1HDDC 3H0GJ 3RZDJ 5C4JJ 1MBHA 3L1PA 1ZR2A 2L7ZA 1F43A 1ETYA 4L5EA 2WAQN 1PUFB 3PO3J 4W97A 1JUSA 1ZK8A 3GTKJ 2GLOA 5M5YJ 2XPVA 5K7ZA 3BR3A 4D7NA 1TWGJ 5F1JA 2Y30A 1MNMC 1XC5A 4M3FA 1U9NA 1OFCX 3HGYA 3B6AA 3HB9A 4AYBN 4Y7NJ 1JUMA 2LR8A 5IP7J 1Y1WJ 2K9NA 4LOCA 1IV6A 2FD5A 3SDGA 3IH3A 5E3MA 1U78A 1ZGWA 1ETKA 1DU0A 2D5VA 1TWCJ 2JA8J 5F0FA 2MG4A 5FKLA 2CJJA 3HBLA 3GTPJ 2DA1A 4M3DA 1JGGA 2JN6A 5JLWA 1LE8A 4V2FA 1B72A 5FKNA 4ABZA 2GM4A 3GTQJ 4A3GJ 2NVXJ 3I4MJ 4Y52J 3IH4A 3GTOJ
chains in the Genus database with same CATH superfamily
2GOMA 1G8XA 4A3LJ 3BZKA 4AYBA 5ICCA 2V6EA 2QEXI 4JYKA 2VKVA 1NH3A 3HTSB 2UUZA 4F55A 1MJ9A 2OBPA 4ZZDA 3BZ6A 3GUDA 4CSWA 2EZLA 1IN7A 3VB2A 2KT0A 1SD6A 5LHIA 2WV1A 2DMPA 3LSJA 3JSOA 3ZOBA 4CA0A 3K4MA 4RA2A 3MVPA 3PUFA 1NK3P 2F5VA 4RB0A 5HVQC 3WE2A 1Z3YA 2JWTA 3TW6A 2R5ZA 4X1EA 2DA2A 1S72I 2XIGA 2ZSIB 1Y6IA 2DOFA 1JXSA 6PAXA 3A01A 4ENKA 2DFEA 3LSKA 3PL8A 4MGRA 1U8BA 3H9JA 3PNYA 1QQIA 1EH8A 2FXAA 2UXNA 1XS9A 4OOIA 4QPQA 1IDZA 2ZJPF 4LITA 1XGNA 2M9HA 5E8GA 1TWAJ 1Z91A 3LL7A 1MBJA 2BHYA 2VIXA 4B1RA 3GO5A 4KT5C 1VQNI 4X0GA 3U1DA 4PJMA 4M3GA 1BBYA 1Z6TA 1S6LA 2AXTC 5E20A 1USTA 3TDUC 3CP8A 2OF7A 2TDXA 3EPZA 3NARA 4BJTA 5L3CA 4XOPA 2H1LA 3IWZA 2FX0A 3SEZA 4U88A 2KFDA 3OYMA 4XMYA 2IGNA 1JUPA 2DA7A 4ENMA 1TWFJ 5CYVA 2LVSA 2PX9A 3FXOA 5CQGA 2AXLA 3HOTA 2WB1N 3GEZA 2JSCA 2K7LA 4G7OF 4AVZA 5HOOA 3V8KA 1W7PB 1R5HA 3KETA 3DEWA 1FSEA 3L2CA 2DCEA 3LSRA 1I39A 3C2BA 4Q5SF 2Q0OA 2Z33A 3ZQFA 3K2AA 2L9RA 2HVSA 2DTZA 2NVQJ 3CCLI 3Q3SA 3OYNA 4IHXA 2XV4S 2QZ8A 1XCVA 1UMQA 1JE8A 3IWFA 4DOZA 5IOYA 2KPMA 5JHUA 5IT9Z 3K7AJ 5CQEA 4IF4A 2DA3A 2P6TA 3ZMTA 3OSGA 5L3GA 2HYJA 1BI3A 3OYBA 1VFCA 3CDHA 5EF6A 4EQQA 2CSOA 4HX4A 2LBFB 4A6EA 3FK6A 2PEXA 3HRUA 3CCEI 1J09A 3LWFA 1X3WB 2IPQX 2LD5A 1FPQA 1YI2I 4GFBA 3GTGJ 4G9YA 3P5JA 3HC7A 1YO5C 1SFKA 4OINF 4IHYA 2R7XA 4A0ZA 2CMPA 4A5MA 1WWXA 2OD5A 2DW4A 2XF7A 1F1ZA 2EB7A 3FZVA 3LSTA 2MABA 4M6VA 5FKKA 4DW6A 4R79A 3FK7A 3C1DA 2O3FA 3FHNA 2HDDA 1RKTA 2MC3A 3W6JB 1SAXA 3F8CA 2Z5UA 4LK1F 3S16J 2N8GA 5GP9A 3OWTA 4IPAA 3E6CC 1SD5A 2CW0F 1I1SA 1W7PA 1UCRA 1UELB 3HYIA 2X85A 4BY1J 2ZFWA 5FLVA 5BOXA 1VI0A 3QYEA 1ZYRF 3HGGA 2L0KA 1SD7A 4JP0A 1VTNC 2EA4A 1PP7U 2E2HJ 1S7EA 2Z16A 2E1MB 4BDZA 3FHZA 2LKPA 3ABMH 2WAEA 2QUFA 2FE3A 1ZGAA 4BQQA 3K4CA 1I6HJ 2FF4A 4U0VA 4A3IJ 4YIIA 1FBQA 3ABKH 3OV8A 4AIKA 1DQUA 3BR2A 2Z99A 3BP8A 3M7GA 1U5TA 2M4GA 1I3QJ 2ME6A 2LBFA 2ZXJA 4BHBA 2K9QA 2WAFA 5KCMA 1WSUA 2OTLI 3BWGA 1X4OA 2KQRA 2ZBKA 4OMZA 4LIVA 4R8HA 5ICFA 2ZJQF 1XX5A 3EDPA 4BXUA 2R7TA 2E5NA 3RKWA 2VUMJ 1W4MA 3WU2C 2VQCA 4DYCA 1STZA 4A3EJ 1K6YA 3HOUJ 1MMGA 4NQWB 2MA3A 2MW8A 3LA7A 2HVQA 5FB2A 1FJLA 1XB4A 3C2HA 1S8NA 2Z2SB 1F4KA 5J1UA 2NVYJ 3BR0A 1V5EA 2QCOA 2DYRH 3F0CA 3KE2A 3JRDA 2KHMA 3BLYA 4FE4A 3L7WA 1MSFC 1JHHA 3DU5A 3WG7H 2BW3A 2CFOA 1HXDA 2RDPA 4L5JA 4NC6A 4CYDA 5CVIA 2L9NA 4XOTA 1WJ5A 3BQZA 2W00A 3F3XA 4UXNA 4ZYHA 3KEOA 2AS5F 1WQ2A 3PSIA 3ZP5A 4G6DA 2Y31A 1X2NA 4M3BA 3PQJA 2TRTA 3A1YA 1SVOA 3I58A 1T33A 4MFDA 4BY7J 2V79A 2W4SA 2ZO4A 3AL0C 3QPTA 1TNTA 3MN2A 4XKBA 4ZDPA 1A6QA 3FMRA 3WGIA 4PUSA 2D1HA 2MBFA 3Q0VA 3M4OJ 4JX6A 1SVLA 5F64A 4WWCA 3S1MJ 3A02A 1TQPA 3D5LA 3GMEA 3KZIC 4I0BA 3U2RA 4WF2A 5HODA 1O4XA 1SFXA 4A3FJ 4E7KA 1XCBA 2MSYA 4LK0F 4C3JJ 1E3OC 3A4CA 3UKGA 2IEKA 2PMZA 3H3UA 4E7HA 1L0OC 2JUGA 2PQ8A 3TP3A 3DQVC 4KICA 3DP7A 1QHHD 1FBSA 4NQWA 1QVUA 1IV8A 3AKZA 2QM3A 1O57A 2PFBA 2V6CA 3DEEA 3OL3A 3EETA 2HKOA 2LH9A 1MDMB 2Z3YA 3DPLC 2CS3A 1KU3A 2W85A 5LHHA 4GYIA 4L0ZB 1JKRC 4A12A 2DA4A 5DV5A 5K7HA 2H8RA 4IHTA 3MZYA 3FISA 2XPUA 1R36A 1XSXA 4XK4A 3HL2A 2W1OA 3F8MA 4DBQA 2D1VA 1WVRA 1R00A 3H1CA 2IAIA 4XORA 5DTDA 3ZN1A 4RDUA 3GVAA 1IXCA 4IVNA 4MQ9F 4HSRA 5L3EA 4BXXJ 3O2PE 2KDOA 3BR6A 3ELKA 3BPXA 2CW8A 3KIOA 1R6RA 4BKXA 4M9ZA 1QRYA 1H9GA 3RIRA 1D0XA 2M0MA 4CDGA 2VC1A 3S17J 2XC7A 2DI3A 2KKOA 3F6VA 2VN2A 3FKIJ 1KQ0A 3F8FA 5M5XJ 3BJOA 2BGCA 2VJJA 4AVPA 4E7ZA 4M3EA 4M71A 4BGDA 3MKYB 1KU2A 4S04A 2VOPA 2M5WA 2CQNA 3QOPA 5IP6A 4BQNA 1XTAA 5GTHC 3JRHA 1T8IA 2LFBA 1MW7A 4KA4A 1KA8A 2EK5A 4XN0A 3J7AO 4E7JA 3CUQC 1LJ9A 2HZTA 3H36A 3BR1A 3C7JA 2ZMEC 2QLZA 2EIKH 3K4NA 5FRMA 2BE5F 2HWVA 2D45A 1Z9CA 3H3VK 5DM6F 1QU3A 2WC2A 2CWEA 1IO2A 1ZG3A 3G73A 4HF0A 1R58A 1OCTC 1X2MA 1EKEA 1MDMA 1JTYA 4WXDA 2DFFA 5FLXZ 3I55I 5FFXA 1TTYA 5HLIA 3GFMA 1J7KA 2A6HF 1Z05A 3UR3C 4RB3C 1WKMA 2DFIA 3FXLA 4R1HA 4IO9F 1IZ1A 1IW7F 4KYWA 2QSFX 1HW1A 2AQFA 4F91B 1O3RA 2X6YA 2W48A 2X6WA 3SJMA 1EH6A 3CF5F 1D5VA 3LNQA 2HDCA 1UAAA 1AKHB 5CVUA 1Z6RA 2CV1A 3FMQA 1OYIA 1FBUA 1V4RA 4C3IJ 5IPAA 3LA3A 1YFHA 1T2KA 1UG0A 3ABLH 2XASA 1U3EM 3F9KA 2JZYA 1LFPA 4UUTA 4Z2YA 3ABUA 5E18F 2B0LA 4YG2F 3ISPA 3ZQ7A 4BHCA 2HEOA 1ZG5A 3HOWJ 4HPQA 3HSFA 1TNSA 4GYGA 3QODA 5F04A 3K4JA 1GDTA 1T08B 3OL4A 4QIWN 1G3YA 2PMUA 1USSA 1OCOH 3HRSA 1U2WA 1SMTA 4IOAF 1BIAA 2Q1ZB 1UB9A 4XR6A 2EA2A 3CF2A 3CDIA 2NAZA 2FOWA 4DZJA 4OAYA 3W6VA 1X3UA 2PMHA 3CQZJ 1VQPI 2QBYB 2P5KA 3FM5A 5BS6A 4C2UA 2HOAA 3JRFA 4CYCB 2HR3A 2VKHA 4CCMA 1KQ9A 2F5CA 4QPOA 2K9SA 5F0CA 1AA7A 3QYBA 3OYJA 1YJWI 2CYYA 1R5ID 2R7WA 3RZDJ 4BHPA 3L1PA 1DUXC 1OYYA 2F4MB 2WAQN 3KEQA 5FFZA 1PUFB 3AL0B 1FOYA 1JUSA 3GTKJ 2KIMA 2V1XA 5LLQA 5K7ZA 3I56I 3BR3A 3CCVI 2KP6A 4EVIA 2NNNA 1U9NA 3TO9A 3B6AA 4N4NB 5JHFA 1BR4A 5GAEJ 5L3FA 2VASA 4QLCU 5LGUA 1ZELA 3J81K 1A04A 1DU0A 4U0WA 1TWCJ 5KHDA 1XPXA 1IUYA 5GAGJ 1T39A 3E5UA 1TP4A 3GLXA 1T0FC 3TMOA 1LDDA 2CJJA 3IAM2 5HLTA 3HBLA 4B48A 4ETSA 4ZJZA 1BOBA 2LF8A 4BEHB 1B72A 1Y56A 2GM4A 3GTQJ 3M8EA 4RAZA 3QWLA 4KIBA 1P6RA 1A6IA 5E79C 2LOOA 3CCSI 4NDLA 5BPDA 3C2GA 3U1KA 2CUFA 2H6CA 3BQYA 2DA5A 2E1OA 1Y39A 4ZZLA 1YX3A 3S2DJ 4CYCA 3WODF 5J8CA 5DD8A 3IC7A 1OCCH 2E35A 2M87A 4NBQA 1FYLA 3E5QA 2DFHA 1GVJA 3ULQB 1Z67A 2QQ8A 3ZQGA 5A2QZ 1ZQ3P 2EV5A 2Y2ZA 3WHBA 1NG7A 3CCYA 2OZUA 1O3TA 3H9QA 2JK3A 1KGSA 2CQKA 4B3AA 1K6OA 4Y15A 3RKXA 2GOXB 2IP2A 4FE7A 3LSIA 2DN0A 1P4WA 1J0RA 1Z0XA 2X1EA 3FKJA 1O7FA 2XF6A 3WGHA 4BJ5C 5HNFA 3M1EA 3CJNA 4RB2C 1F36A 5EEAA 3GLLA 2ELJA 3GCMA 1IC8A 1BI2A 4ESBA 2DPUA 4GO1A 4B09A 3DFGA 4LD5A 2G7UA 4IKFA 1JJ6C 4HV5A 2M7BA 2XKOA 1R49A 1T38A 4Z6YA 4I2OA 1HBXG 3FDYA 1IN4A 4BEHA 1R1VA 4HF2A 3ZCOA 1TLHB 3ERMA 5B1BH 3HOXJ 4FISA 2OAZA 4PJ0C 3OYFA 2XGEA 1BN5A 3TBIA 3SDBA 4U7DA 3H35A 1IGNA 2DMTA 3L00A 1D1AA 2K5CA 3RCOA 5KAFC 1FOKA 1ZG1A 3AG3H 3FMSA 3IHUA 1XD7A 1I3AA 4M73A 4YFXF 2Y0SN 2NS8A 4HLYA 1W7PD 3S32A 3TP0A 2R7VA 4HBLA 5DD4A 2QVOA 4LIUA 4XLFA 2LY2A 3X2QH 1QA6A 3RPQA 3KEYA 5FKMA 3COAC 2DTRA 2ZNYA 1MZBA 2WB1A 3LSPA 2R5ZB 2LK2A 4BQOA 2OV7A 5DUIA 1TT0A 1VQ7I 2DBBA 2DT5A 4MNUA 2JJ7A 5IOZA 4FQGA 4CCOA 3A01B 1P7IA 4DIQA 4F3QA 1XGOA 2XRLA 2XROA 2A05A 2EFOA 4IHWA 2ZMEA 2EV0A 4FT8A 3DBHB 4PFPA 4UNOA 2L54A 4B4CA 4E7LA 2I10A 3M07A 3E6DA 2QGUA 2ZXHA 4A6DA 4IQ4A 3C18A 2K4JA 4G8XA 1Q1HA 3K1NA 5B1AH 4M9SA 3FBNB 3GZNB 1OISA 2A61A 2NYXA 2EZKA 3HSEA 5C3EJ 2HKXA 1SVMA 3LA2A 4NB5A 4LG0A 2M30A 4V2GA 1JKOC 2HPMA 3NEUA 3HJEA 3QU3A 3DKWA 3H5RA 3CMMA 2GIZA 2VKEA 1RUOA 1P2FA 4F93B 2Y9YA 5DS9A 1W5TA 2ECBA 4BS9A 3BZCA 1R4NB 2H27A 5DUKA 1K78B 2JTVA 4OIRF 4KIGA 3RZOJ 3AAFA 4G12A 5EGOB 2VI6A 2QQBA 1ZGJA 3R0JA 3VYRB 2DOEA 5LHGA 3PIPF 2P7CB 3GWZA 4XLHA 1YQAA 5J3LA 1VZ0A 3HPHA 4YIFA 1EV7A 1J2XA 3OYIA 2BOLA 3G1LA 2X4HA 5IT9K 1XMXA 2CO5A 2J5OA 5CVRA 3BR5A 5CJ9A 2MYSA 3ZQLA 1POGA 1BC7C 4OIPF 4ZDOA 1L3LA 3BG3A 3A0BC 3KP7A 4DJAA 3O6BB 3J80Z 4YEJA 2KJBA 2WY7Q 1Y8QB 1TW3A 4LLNA 2M2EA 4BE1A 4LJZF 2IS6A 4JX5A 1ZN2A 2ADUA 2BEOA 3F8NA 3JTHA 4XRMA 1QBJA 2EFWA 2G7HA 1Z77A 5D5VB 3T8RA 2DMUA 3BY6A 4BYYA 3V7CA 3W2WA 2L2OA 4CGZA 2DT6A 1W36C 1G2HA 1WJAA 4FCYA 2K9MA 1IXSB 3OYDA 2MC4A 4G94A 1SD4A 1GT0C 2KMUA 1T56A 2VOOA 4XLCA 3K69A 3L2QA 1RPWA 3GXOA 3I59B 3ZMDA 2XB0X 3N05A 2H09A 3OIQA 4PFOA 1G4DA 1Z3XA 4EM0B 1P4XA 1E3PA 4EJUA 5C44J 2VPLA 1P4AA 5TGTA 2L7MP 4PK4A 3LFKA 3U9GA 4PSXA 2ELHA 4S05A 3BG7A 4Y17A 1D1BA 2LY1A 5GAHJ 3GTJJ 3RPUA 3V7SA 1K78A 3BTLA 1NK2P 1W0UA 3CUOA 1HSTA 4I09A 5EGOA 3CO6C 3ZGKA 3B6CA 4D5CA 2HOEA 4PZJA 1WJFA 4M6XA 1TBXA 2B7EA 1X1PA 1UHSA 2CRGA 5BPIA 3S1RJ 1MGTA 3S93A 4G6TB 3KP4A 1BC8C 3BTJA 5EZHA 2ETHA 4A3BJ 1T0FA 3LSHA 3LOCA 2WWYA 1U5TB 2ZKZA 2HVRA 3HOSA 1X58A 1XDSA 2ECCA 1HKQA 4KT6A 3BJ6A 2CUJA 4UVBA 2OTJI 1FZPB 1B1BA 2HQNA 4KITB 3QPHA 4ZTJA 4ZH4F 3S2HJ 5FROA 1IRFA 1VQ6I 3BC8A 3JREA 3DWLE 2XF5A 4YRVA 4WXHA 3I54A 4MO7A 4HQEA 1MH4A 1OQYA 2JSPA 3I59A 3G6EI 5IYDJ 1OCZH 4HOBA 2JQ7A 2ZSHB 1PP8F 2AQEA 2BYVE 3BG6A 2JA2A 3QP5A 4P9UA 2UV1A 3DPUA 4L18B 1O3SA 2Y69H 2XVCA 1QZZA 1Q1VA 5L3BA 3IH2A 1ZRCA 2EWNA 4DNCA 2CH0A 2BW3B 1REPC 3KLNA 3K9TA 1GVDA 1S9HA 1YW7A 2A3SA 2HZDA 3SYTA 2B63J 4A69C 3HOZJ 5HLGA 3O3KA 4AC0A 4B8XA 3FXQA 1W5SA 4L9JA 4AWXB 1JTXA 3RYRA 4U7BA 3TDZC 4Q47A 4CO8A 5J40A 3O8HA 4KJZA 4HZFA 5J1YA 3DBLB 5E1WA 2L01A 3AG1H 4P5OA 3FXJA 2STTA 4GXOA 5HNHA 3JRCA 1RNLA 3OR2C 1YG2A 3QPLA 2W25A 1WGXA 1MJBA 2NXNB 2W57A 3TOBA 3ECOA 1PDNC 5FRNA 5E3NA 1ERDA 2M7AA 1BW6A 3MWMA 2NS0A 3BT9A 3DPTA 1FTZA 2X51A 1RI7A 3OYGA 2IGOA 2O0YA 2W82A 3JR9A 2NNYA 1FEXA 1XMKA 1X1BA 1AHDP 2R5YB 3MFKA 4A3CJ 2K3FA 2VB6A 2X9DA 3TOAA 2FQ4A 3LMMA 5BNGA 2R93J 2FEZA 2G9WA 1A5JA 1J5YA 3IAS2 5K5QA 4HEA2 1ZRDA 1OR7A 4LLLA 3VEPA 3S1NJ 3HHGA 4BACA 2ME0A 1DGWY 3BTIA 1JJ8C 1S5LC 1SFOJ 3J7AY 2YSRA 3KLOA 3E6BA 3CLQA 5E17F 2A07F 5FLMJ 2BXZA 3EYIA 2OPTA 3TGNA 1UG2A 1VF9A 3TW7A 2LY9A 4S0HB 3LSGA 1YW9A 1LEAA 3FIWA 1J75A 1F5TA 3M8JA 5IT3A 3F23A 3T8TA 3K0LA 2MGQA 2MLKA 4KDPA 1CGPA 3O8GA 4MEYF 2BVLA 5JLXA 2K02A 1Y1VJ 3CJQB 1QZYA 2H6BA 2QSGX 2FBHA 1SAUA 2EIMH 1LQ1A 4D7MA 2QA4I 1Z1DA 2ESHA 5DYMA 3MKLA 3GTLJ 1BIBA 1LNWA 2E7WA 2XSJC 1OYWA 4ON0A 2P4WA 1RR7A 3QQAA 2DJNA 2V7FA 2R7FA 1TL8A 2KL4A 5BQTA 2R92J 3TO6A 2P7VB 3WTSC 3WTTC 3DKXA 2EILH 2QYOA 2VBXA 4II3A 1AWCA 4CXFA 2R5YA 2BXYA 3OYLA 4XN3A 2MH2A 1UZCA 3TO7A 3AG4H 4IOCF 1W5CC 2DQRA 2RC4A 4EV0A 5M3MJ 4EATA 2R7QA 4XSZF 4HRIA 4DYRA 4G7HF 2BBYA 3W3CA 2YUSA 5FLXK 1YHQI 3H0GJ 5E8IA 1Z7UA 2L9SA 1O3QA 4EM1A 3GX4X 1ZR2A 1KONA 4RAGA 1IF1A 1UHMA 1WFXA 1X1DA 5M5YJ 5LRSA 2XPVA 4NC7A 4F7ZA 2GLOA 3HHHA 1TWGJ 5DDGA 3AG2H 4RM2A 2KRHA 4M3FA 2FBIA 1FP2A 1N75A 1OKRA 3HTUA 4Y7NJ 1JUMA 2ACJA 2V1UA 1SFEA 3D5RC 2LG4A 3V8LA 3W2AA 2QWWA 2K9NA 3SDGA 3KZYA 1YOVB 4XLPF 2D5VA 5K5OA 2VE9A 2Y75A 5LGTA 1FOXA 1IRGA 1VQ4I 4A2UA 2QKLB 5H2FC 4U0YA 1WJBA 2WADA 5E1ZB 4XKCA 4UUVA 2VONA 1R4MB 4M3DA 2Y48A 2WAQA 1U6GA 1EJ9A 4BQAA 4KISA 4ABZA 2HQRA 1FP1D 3I4MJ 4Y52J 2VE8A 3IH4A 4UB8C 2LREA 3GTOJ 2CU7A 2YX4A 1WCMJ 4Y13A 2AHQA 4HNVA 4XIDA 4H4KC 3GYHX 2ZXWH 3GFIA 4II2A 5B66C 4RM3A 2RGVA 3TQNA 3Q0WA 2E1CA 1DGRM 1KQ8A 2X1DA 4UVAA 2EQRA 2GXGA 3D1NI 3CJRB 2FMLA 2VQGA 2DA6A 2W7NA 3TEDA 1BR2A 3SQNA 5D5WB 4W1UA 4ANJA 2VXZA 1GV5A 4ZTFA 4M6YA 4DGWB 2CW7A 2JPCA 4KUMA 1WJEA 5F0HA 1XN7A 2JT1A 1WZ2A 4A93J 1G59A 1Z21A 3BJAA 3ZQIA 3P9KA 1UHWA 2I8DA 1FYKA 1B8IA 4JOMA 3CTAA 1MIJA 4UV8A 4C9YA 2K9LA 4BU2A 5IYBJ 4M9XA 3FXUA 2F2EA 4IRHA 1QPIA 2HOTA 4PJNA 3MMYB 3R61A 2JUCA 4YFKF 4EEFG 3UNGC 3OMYA 2BY2A 4ESFA 1ODDA 2KZVA 3P7NA 2BVMA 2OC6A 1YS6A 2A5YB 4CCLA 3OYCA 3CC4I 2VKDA 3PO2J 1I50J 1SC7A 1LDKB 2CV0A 2IVMA 4BBRJ 4FHTA 1FT9A 2LP0A 3GBGA 4BAYA 3I4NJ 1B72B 1X3ZB 9ANTA 2NS7A 2XGXA 4EGZA 2IRFG 3K70C 2DLLA 4XKWA 2PN6A 4AU7A 5F08A 4KMUX 3I9V2 1H0MA 2XAGA 3NWSA 3ZMZA 2E1NA 3OOPA 1ULYA 2W24A 2Y0MA 2B9SA 2LLKA 2OZ6A 4IQJA 2GZWA 2K27A 1FWZA 1HDPA 2X1CA 2A69F 3VDXA 2VJ4A 4JX4A 4D1QA 4BDYA 3OIOA 3CMYA 3VYTB 3ZQHA 2E60A 1D8JA 2OJED 2X0LA 5CVVA 5A2QK 3E5XA 2XUBA 3HEFA 1T95A 4CHUA 2Z9OA 1WPKA 4RBOA 1XG1A 4N9IA 5EG0A 2XPWA 2QKMB 3R0AA 4OWRB 4Y4RA 5LGNA 1XDUA 1SEUA 2F5EA 2RKHA 1IAWA 2P5VA 4XICA 3RJPA 1KYWA 2MD5A 1ETOA 2VJ5A 2HTJA 2Y0SA 3KP2A 1GUUA 5FJ8J 3HOYJ 2JA7J 3KYCB 1MSEC 4HV6A 3JW4A 3OYAA 5F27A 2Q8KA 3VFZA 2EFNA 3U21A 1V55H 4I98B 2JA5J 4I6ZA 3BPVA 4LLGF 3VYSB 4J19A 1ZARA 1GLNA 1MBKA 2P6SA 1MBEA 2V4JC 4C2MJ 4ZC3A 1SFUA 2M0CA 2JMWA 3Q5FA 5HDGA 3B02A 3BCBA 3LFUA 1A35A 2A6TA 5EDNA 2L7FP 4OAZA 5CKTA 4A3MJ 3S3MA 3M9AA 2MLGA 4A3DJ 5J4VA 1DDNA 3L9FA 2F5DA 4AIJA 3L2UA 1SANA 3NAUA 1M1EB 2FJ1A 3JAMZ 2PJRA 4LFUA 4BL0B 2FA5A 2CFXA 4M72A 3I53A 3KP3A 3V7RA 4RB1A 2M8EA 3LAPA 2DO7A 2DXIA 1VQ9I 3H3ZA 2CV2A 2VODA 2DPDA 2NOGA 3RSNA 3FXKA 5E3OA 5TRDA 4IHVA 4EM2A 3KYLA 1QPMA 2JA6J 2LRDA 3IKTA 2GXAA 3FXMA 1ON1A 3S3OA 3RPUD 2R7RA 1D8KA 4XRSG 5HS9A 1NTCA 2VPRA 4M74A 2E5ZA 1HLVA 5ILSA 4B47A 2R7ZJ 5F6FA 3DLAA 4ASNA 4RAFA 2M1BA 4KIFA 2CQ7A 4I02A 3K4BA 2KZGA 3CJTB 3H5AA 3VYUB 1KU7A 2ELKA 5M5WJ 3G71I 3CUQB 4HW0A 4I01A 1R22A 2R7DA 2VBWA 3BROA 2ZMEB 1H88C 4BUPA 3MQ0A 3AFHA 3CD6I 2RNGA 3EQLF 2GWRA 5LEKA 3DTIA 3VOEA 2MD0A 3ASNH 5D4SA 2R7OA 3PUBA 4FTHA 1WH5A 4X6AJ 3K1PA 2P8TA 1IRZA 4Y3OA 3OS0A 4KN7X 3HUGA 3PQKA 1K61A 4P96A 4RLFA 3WU1B 4LG0B 2HQAA 1ETXA 2GIVA 1RKWA 2BHZA 3L2RA 1Y8RB 3J81Z 5BMZA 1LUJB 1XGMA 1Y0UA 2QSHX 1FOWA 3G1OA 4OIOF 2A68F 3BDDA 1N77A 2XGDA 1MNDA 5LRRA 1JGSA 5H6RA 4AIDA 2ZJRF 3V42A 1FNNA 1ON2A 3CMEI 1FLIA 3G1MA 4Y33A 1WRJA 2O61A 3HDDA 3M1CA 4KN4X 5IY5H 3SZTA 2DDBA 4RMNA 1MMDA 5CLSA 2V1NA 4FASD 2LMDA 2GQQA 3CCQI 1R9TJ 1LFUP 1I27A 4ZYAA 1RZ4A 1GHCA 3S3NA 3Q0UA 2I5UA 1C0WA 2RVCA 2C6YA 3RTRA 3EUAA 4J01A 1ZH5A 3CUQA 4RAYA 3K2ZA 1K79A 2XGCA 2RQQA 5ED4A 2LF7A 1HW2A 3CO7C 4EMSA 5B5EC 4D0PA 3OR1C 1X1CA 2MH9A 5TJJA 2OQRA 3E0JB 3BG9A 4UB6C 1V5FA 2HI3A 5KAIC 3F21A 4HDUA 2WBMA 1J59A 3E7LA 4AM3A 2E1MC 2X6XA 3QU6A 4P55A 4L0YB 1B9NA 4XLEA 5KK1A 1E0EA 2NVTJ 3ZPLA 1LDJA 1JT6A 1FYMA 1KZHA 1R5GA 3DXJF 3SXYA 2ZNZA 3KX2A 3K4LA 1IG7A 1TC3C 3HKZN 1FMVA 2HNHA 1ZAOA 2PI0A 2NRAC 4QSHA 1QHGA 3HG9A 3M8FA 3CP2A 2L02A 3OYKA 4PDKA 2RV8A 1ETVA 3ONQA 2GAUA 1MJAA 2UZKA 4P1WA 3DF8A 2EPFA 4UUSB 1LFBA 4HLXA 4A3JJ 1JI8A 3SFIA 4GCVA 2IGMA 4ENJA 1EH7A 2H1KA 2IBDA 2IS2A 1BOAA 1G3WA 3OYEA 1G6NA 2FNAA 1FC3A 1HSJA 4A5NA 4WXCA 1LEBA 3HIFA 2JPBA 2VXDA 3ERED 4BE2A 4O6JA 4RGUA 3CCRI 2E2IJ 3RQ4A 3EUKL 3HXLA 4XM3A 4I76A 4IRGA 2M45A 4F92B 3WTWC 4DQ2A 2M34A 5H6QA 5M3FJ 3P9CA 1R1UA 2E19A 2XAFA 2YU3A 2O8XA 2ZXIA 4A0YA 4UV9A 3CMAI 1MD0A 2V9KA 3REOA 2H8WA 1ORKA 2XDVA 2XB5A 3DU6A 1GV2A 4C2TA 2HU9A 1WHUA 5DCMA 2K40A 4ZDLA 3VSKA 2EFQA 1QO0D 2YX7A 3IRQA 1B6AA 3GF2A 4MHGA 1CF7A 2F4OB 2V9PA 4B3XA 4E4HA 3OS1A 1V5GA 2BV6A 2HYGD 5E3LA 3JRAA 4XL9A 3T5XA 3T0YA 1T6SA 1ZREA 4HNUA 5AIPA 3DTEA 3W6KB 4MTDA 1K83J 2O8KA 4I99C 1S7AA 2HQ5A 2ID6A 3NWTA 4XSXF 1XSDA 2XRNA 4UUSA 1VQLI 3W2VA 2F6CA 1LE8B 2R7UA 3IV5A 1RETA 2E34A 2DK5A 1T98A 4EGYA 4A3KJ 5LFAA 4XLAA 5FGMA 4EJTA 1U9OA 2MFZA 4NHJA 2KIQA 4RLQA 4BNCA 4E6KG 4MFEA 3ZQCA 2UXXA 4HAMA 1BI0A 1ONVA 4UY8I 2HYFA 1TWHJ 2VBYA 3PNTA 1W36D 3RQIA 1DP3A 1A36A 1JKQC 4HQMA 1KYZA 2V9VA 1HC8A 3FBIB 1FX7A 2PG4A 5JVGF 2DMQA 4PGGA 3WTZA 1ZLJA 2XSDC 5FO5A 1HDDC 1MBHA 2L7ZA 1F43A 1ETYA 1P9QC 4L5EA 2FQ3A 3PO3J 3WTXC 4W97A 4O3MA 1UJ8A 4D7NA 2A5WA 1D3YA 1MNMC 1XC5A 5D8KB 1OFCX 3H92A 1HA8A 3S8PA 4AYBN 3J7ZI 3G2BA 3RKYA 3R60A 1FSHA 2ZC2A 4B44A 5IP7J 1Y1WJ 3HRMA 1F9NA 4LOCA 1IV6A 2CUZA 5E3MA 1ZGWA 1ETKA 5B3SH 4HDVA 2JA8J 4IHSA 5F0FA 2YPRA 1RR8C 2MG4A 2WY8Q 5D5XB 2IA1A 3I64A 3MZ8A 3JSPA 2DA1A 1RC9A 2JN6A 5JLWA 1JGGA 1LE8A 3ASOH 1YE9A 2O6GE 2ISZA 3F22A 4G7ZF 3I4PA 4XLNF 4P9FA 4NNJA 4A3GJ 2ZCWA 1YJ9I 2RNJA 1B9MA 4ITVA 4XQFA 4BE0A 2NVXJ 4KNYA 1EA3A 4A0XA 4GRIA 1MMNA 1A31A 4HX7A 3DEUA 2DK8A 3PFYA 5IP9J 5J8FA 2R3SA 4G6QA 4C3HJ 3ZN0A 3IRRA 4E70A 1QGPA 1TQIA 1XMAA 2XAUA 4LMYA 4XNFA 1IDYA 3Q9SA 2BY0A 4BXFA 2FUG2 3ZR8X 4MEXF 1AU7A 5K7FA 3GW2A 1TT5B 2HXIA 2XHKA 3K1MA 4JQFA 1SMYF 4IEJA 1YIOA 2E2JJ 2AO9A 1VQ8I 3E3VA 1R7JA 4QWQA 2VC0A 3H0DA 3WTUC 1NHAA 1XSVA 2RN7A 3JTGA 2PJPA 3VWBA 3DV8A 1QZEA 3LQQA 3CCJI 5J4YA 4HF1A 1IRXA 5EEHA 2OQGA 1VNDA 1V54H 4AD9A 2EBIA 3E1SA 2HTSA 3M3YJ 3G4SI 5GADJ 2CG4A 4MIMA 4OMYA 3SFZA 1BL0A 3EYYA 5DM7F 3HM5A 1EF4A 4JBAA 1YYVA 2OUMA 1BM9A 3MCZA 4WCGA 5KNLA 5JR3A 2YU9J 1FIAA 2DOAA 2E7XA 1HCRA 3NQOA 1VQOI 1N78A 2VJIA 2IGKA 2VBZA 3CDLA 4O5VA 5D8LB 4FETA 4IXAA 5D6EA 4WK8F 4RGSA 1MMSA 2KRFA 4WX9A 4ZYEA 5HS7A 2IA0A 1RUNA 3EUHC 1R23A 4XBFA 3R4KA 4Q48A 2IS1A 3SEQA 4PGHA 5HS8A 2HDWA 3C3WA 4HYEA 4F52A 4KFCA 2OA4A 3CC2I 4GDFA 5D4RA 1WH7A 2RAEA 4L9VA 5F1RA 1WJDA 1LVAA 2HXOA 2XAHA 3ZXSA 2Z1DA 2CUEA 2H94A 4AUXA 5C4XJ 3I0TA 1VQMI 2CQXA 4RGRA 3HPGA 4CCNA 2KLOA 1S29A 3A03A 1PYVA 3KPHA 5D5UB 2FRHA 4OU0A 1IN5A 5ICGA 2IJLA 3ZMVA 1W0TA 2EINH 2DJIA 3PNVA 1HQCA 1VQKI 2DU9A 2EZHA 3ESWB 3BG5A 2O7OA 2J5PA 3K4KA 1B8IB 3I3LA 3V8JA 3D5SC 4UHTA 2R7SA 4ZYGA 3GFJA 2X6OA 3OY9A 3HZJA 1H8AC 4XONA 4CH7A 1MBGA 4TV7A 5EZGA 4YELA 2FU4A 3J7YJ 5JI6A 3KYDB 2FMYA 1NG6A 2XKPA 2LYCA 3PM1A 3A2KA 5EEGA 3CCUI 3VSLA 2BY3A 4D9JA 1P7JA 3VODA 2ZJ2A 1R71A 1BA5A 2LKXA 1OMIA 5K5RA 1IJWC 2FBKA 4KMFA 3B73A 1OCPA 2ZFUA 1LPQA 3PJRA 4NC8A 2QQAA 3GTMJ 2KDZA 1YW8A 2JRTA 2ISYA 3CZ6A 1S3JA 1JT0A 2DODA 4L9NA 1QNTA 4QTRA 4IJAA 1GXPA 1WI3A 4NUBA 2QENA 4PCQA 1K7AA 3E97A 2COMA 1CQTA 1BW5A 1HW5A 2E71A 2RQPA 1YITI 1V3FA 1YLFA 1E17A 3JRBA 2EZIA 1GXQA 3KCCA 2LDUA 4DZPA 4HNTA 2KRCA 4HA8A 5EG0B 3CCMI 4B43A 1BJZA 2L4AA 1OPCA 2ID3A 4XRSA 2LC2A 2ZB9A 1MH3A 1I5ZA 5JVTA 2COBA 4IZZA 4C30A 1E3HA 3ZMSA 5GPAA 4PJJA 1ZKGA 2L5QA 3FXRA 2RREA 2A6EF 4CCJA 1HKSA 2JVHA 4OIQF 4ESJA 3MZHA 3WU0A 2PLYA 2KIUA 1E2XA 4IL6C 2HS5A 2Q2EB 2VT3A 1BI1A 2X48A 3L09A 3PSFA 3RI4A 4CZZA 2V26A 1YTYA 2PMZN 2GA2A 4MQVA 5GTIC 1WI9A 1PUEE 3PFIA 2WV0A 3JAMK 2EJRA 1X4PA 2Y9ZA 1ETWA 1TQMA 2FSWA 3WTYC 5LD2C 4RGXA 2PJRB 1I1GA 2DAOA 2JRMA 4LB5A 1ENHA 5AONA 1Z7LA 2OCCH 3CLOA 4FX0A 1QVTA 2KIFA 3MEXA 4DYQA 1D0ZA 1YX5A 1MMAA 2LTPA 3Q9VA 1K4TA 3CC7I 2QF7A 4GGGA 1APLC 3JRGA 1U8RA 3G3ZA 3N97A 1ZRFA 1W1WE 1JHFA 2XAQA 4EJWA 1JKPC 2YR2A 2IA2A 2EIJH 3BCAA 3L2VA 3N4MA 5DEQA 4CUGA 2D2WA 5H20A 1DPRA 3KZZA 1MKMA 1RESA 1TW2A 3OYHA 3F8BA 2LNBA 1DU6A 5AIQA 2O5RA 2F5FA 3E6MA 1IUFA 3BTCA 2NOJB 1P92A 3FWEA 2O9LA 2W84A 3PIOF 4ZYDA 3OS2A 1LVKA 3OIPA 3WG9A 2EFPA 1K4SA 3A0HC 2ICWG 1ITYA 3ZMUA 1B4AA 1ZLKA 1Y0NA 1XGSA 3QOEA 1N25A 2EH3A 3DTKA 2Q2EA 3S1QJ 4XKVA 2DQLA 1AKHA 3K70D 3ZQQA 3S2WA 1LB2A 3TKYA 5ILVA 1D5YA 5FD5A 3HUGB 5CVJA 1FIPA 4LGWA 5EJCA 3QPSA 3KP5A 3I71A 4EJOA 3GZ5A 2VL8A 4BH9A 2VQHA 2M8GX 5FKOA 3LAJA 2F4IA 2F48A 3NRVA 1FMWA 2IXSA 3RKQA 4XRFA 3TL4X 2CQQA 1MBFA 4N0BA 3ML6A 4K2EA 3S14J 1D1CA 4ENNA 3GZ6A 1G3SA 1IN8A 2WA0A 3ROUA 1UFMA 4HX8A 2K4BA 2P81A 1ETQA 4AIHA 4U87A 2WTEA 4I0AA 3MAJA 2L4MA 3DCFA 4HG2A 4UVCA 1ZTRA 1FTTA 3LSMA 5J6XA 3WHCA 3L2WA 4V19K 2L9VA 2QBYA 3WE3A 5EYRA 1ZR4A 2GXBA 1ACIA 1D0YA 3HKZA 2P0WA 1OLTA 4CZCA 2JVGA 3IKVA 1U0JA 5ICEA 1ZHFA 3D0SA 3QYFA 5FD6A 2YS9A 5KVRA 2GA1A 3DKYA 4EJVA 3K6GA 2BZTA 5LEJA 1HF0A 2GBYA 2KISA 1PVEA 2DYSH 2BY1A 3EUHA 3QP6A 1B59A 2OCEA 4JK1X 1PUFA 3ABTA 2FNPA 5TISC 1YRNB 3SHFA 1TZLA 5HLHA 4BBSJ 3FX3A 1G3TA 1I6XA 1X1AA 2DT7B 1KU9A 3QAHA 3ZRGA 3OOUA 2DMNA 2TCTA 2OU2A 2R0QC 2STWA 4MTEA 2IW5A 2LSOA 3FF5A 1RRJA 5DCFA 1FY7A 3JCUC 3V4GA 3HOVJ 3JRIA 1BR1A 2HFHA 4CICA 3T1BA 3VPRA 5HDKA 2VT2A 4FX4A 1H9TA 5J1RA 3F72A 1DPUA 3IL2A 4IX7A 4N4OB 2L7KA 5GPCA 5E1XA 3MD2A 2XAJA 5J47A 2UWMA 1U5TC 1J9IA 2V1DA 5IYCJ 3F6OA 2PBIA 1MNEA 3MKZA 1H89C 1X19A 4YFNF 4J00A 3HRTA 3SZGA 2DDAA 1YS7A 4YIRX 2EV6A 4D5FA 2E36A 2O03A 3DLLF 1AOYA 3S15J 4LG3A 3RDIA 5K1YA 3H5NA 3BOQA 4PSWA 3KFWX 2L3DA 5LBQA 4Q4ZF 2G0EA 2HGCA 4RS8A 1OR7C 2HOSA 3J80K 3ECHA 4L9TA 1RIOH 1OJLA 4CCKA 4HSTA 5CPRB 1DP7P 3HSRA 1HOMA 1WJCA 3OSFA 4MLOA 2IS4A 3WGGA 5L3DA 3QRFF 3H9GA 3LQRA 4LB6B 1S7OA 5ILUA 4IRIA 2QQ9A 3SZPA 1YRNA 5C4JJ 5JFRA 2K85A 2IT0A 3IUOA 3P9IA 2KJCA 4E7SA 3FM3A 4I7HA 2P5LC 1IN6A 4BJ6C 4DBRA 1ZK8A 2K86A 3MKWB 2LKSA 1O7LA 5F1JA 2R4GA 3WTVC 2Y30A 2HPIA 3HB9A 3HGYA 1R1TA 3CESA 3DBRB 2ESNA 3RYPA 1YIJI 1IXRC 5DCMB 3R6SA 3K10A 2FOKA 1YJNI 5D6FA 2LR8A 1CF7B 2K3PA 2M3AA 2FD5A 3IH3A 1PJRA 1U78A 4N9HA 4L5IA 2VLAA 2NVUB 3IP4B 2VQLA 1VQ5I 1LKXA 5HDNA 1HKTA 3GFLA 5FKLA 1OCRH 4H0EA 4E7IA 1BJAA 2M4KA 3GTPJ 2CGPA 3I5UA 4V2FA 5FKNA 5ERIA 3KP6A 4PJLA
chains in the Genus database with same CATH topology
1A6IA 2CU7A 4A3LJ 4JYKA 1WCMJ 4NDLA 2VKVA 5IP9J 2CUFA 2AHQA 3BQYA 2DA5A 4C3HJ 4HNVA 2E1OA 4XIDA 2EZLA 3S2DJ 4CYCA 2KT0A 2WV1A 2DMPA 1IDYA 3LSJA 3Q0WA 3ZOBA 1AU7A 3MVPA 5K7FA 2HXIA 1NK3P 2EQRA 3D1NI 3ZQGA 2DA6A 1ZQ3P 2JWTA 3TW6A 4IEJA 4X1EA 2DA2A 2R5ZA 3TEDA 2Y2ZA 4W1UA 3WHBA 2E2JJ 2AO9A 1GV5A 3CCYA 2JK3A 4B3AA 3A01A 4FE7A 2DN0A 5F0HA 1U8BA 1Z0XA 4A93J 1XS9A 1IDZA 1F36A 1VNDA 3ZQIA 2M9HA 5EEAA 2EBIA 1TWAJ 3M3YJ 4MIMA 1IC8A 1MBJA 1B8IA 4B1RA 1BL0A 2HOTA 5IYBJ 1QPIA 3HM5A 1JJ6C 4M3GA 1EF4A 4EEFG 3NARA 2OF7A 2YU9J 2FX0A 1FIAA 1HCRA 1JUPA 3PO2J 2DA7A 1I50J 3HOXJ 4FISA 1TWFJ 2XGEA 2LVSA 4BBRJ 2WB1N 2LP0A 3CDLA 3GBGA 3I4NJ 1B72B 9ANTA 2NS7A 1IGNA 3DEWA 2DMTA 3LSRA 3C2BA 5F08A 3ZQFA 3K2AA 2L9RA 2DTZA 2NVQJ 2LLKA 3Q3SA 4IHXA 2Y0SN 2NS8A 1HDPA 1UMQA 3TP0A 4JX4A 5IOYA 3OIOA 3CMYA 1WH7A 2RAEA 3ZQHA 3K7AJ 2HXOA 2DA3A 5FKMA 3OSGA 3HEFA 2CUEA 4AUXA 2HYJA 1VFCA 3LSPA 5EF6A 2R5ZB 5C4XJ 1WPKA 2LK2A 4RBOA 1XG1A 2CQXA 3FK6A 5EG0A 2XPWA 3A03A 5IOZA 2JJ7A 3A01B 2LD5A 1P7IA 2XRLA 4GFBA 3GTGJ 4IHWA 4XICA 4IHYA 1ETOA 1W0TA 4B4CA 1GUUA 5FJ8J 2I10A 2JA7J 2EZHA 3HOYJ 4M6VA 3BG5A 2O7OA 4DW6A 1MSEC 5FKKA 3FK7A 5F27A 1B8IB 2HDDA 1RKTA 2X6OA 2JA5J 4I6ZA 2EZKA 1H8AC 5C3EJ 4J19A 1MBKA 1MBGA 3S16J 2N8GA 1MBEA 4C2MJ 5EZGA 4V2GA 5GP9A 1JKOC 2M0CA 2JMWA 3PM1A 5EDNA 2L7FP 2VKEA 4BY1J 4A3MJ 1P7JA 2Y9YA 5FLVA 4A3DJ 5DS9A 1VI0A 2ECBA 1BA5A 2LKXA 3HGGA 1IJWC 2L0KA 1SANA 3NAUA 4JP0A 2FJ1A 2E2HJ 1OCPA 1S7EA 3RZOJ 4G12A 5EGOB 2VI6A 3GTMJ 2KDZA 5J3LA 1I6HJ 1JT0A 4A3IJ 2NOGA 5E3OA 3G1LA 4IHVA 3BR2A 4QTRA 2JA6J 1WI3A 3BR5A 3ZQLA 4XRSG 1POGA 1I3QJ 1NTCA 2VPRA 2ME6A 1CQTA 2K9QA 3BG3A 1HLVA 1BW5A 2R7ZJ 3JRBA 2EZIA 2M2EA 4DZPA 4JX5A 5EG0B 2VUMJ 1BJZA 4XRMA 2ID3A 2ELKA 4DYCA 4XRSA 5M5WJ 4A3EJ 1Z77A 2ZB9A 1MH3A 2DMUA 3HOUJ 2COBA 1H88C 2MW8A 1G2HA 4FCYA 1FJLA 1GT0C 5GPAA 1T56A 1ZKGA 5J1UA 3F0CA 2NVYJ 2QCOA 3BR0A 3JRDA 1RPWA 4FTHA 2XB0X 1WH5A 4FE4A 4X6AJ 1IRZA 1MSFC 5C44J 1K61A 2X48A 2L7MP 1ETXA 1RKWA 3BQZA 3GTJJ 2PMZN 1NK2P 3BTLA 1W0UA 2Y31A 1X2NA 5EGOA 4M3BA 2Y9ZA 3G1OA 3B6CA 2TRTA 4D5CA 1ETWA 2XGDA 1T33A 4MFDA 4BY7J 1UHSA 2CRGA 3S1RJ 1ENHA 3G1MA 3MN2A 1QVTA 4DYQA 2LTPA 3HDDA 3BTJA 5EZHA 4A3BJ 2QF7A 3Q0VA 3M4OJ 4JX6A 3S1MJ 1APLC 3JRGA 3A02A 5HODA 3LOCA 1R9TJ 1O4XA 4A3FJ 1LFUP 1JKPC 2MSYA 1E3OC 4C3JJ 3UKGA 2IEKA 1X58A 3Q0UA 2ECCA 3TP3A 1RESA 1DU6A 1QVUA 2XGCA 3S2HJ 1IUFA 3BTCA 3JREA 2O9LA 4MO7A 1MH4A 1JKRC 2DA4A 2H8RA 5K7HA 5IYDJ 1ITYA 3FISA 3BG9A 2XPUA 2HI3A 4XK4A 2EH3A 3S1QJ 3E7LA 1AKHA 1Q1VA 2IAIA 5DTDA 2NVTJ 1D5YA 3IH2A 4RDUA 1FIPA 4BXXJ 1JT6A 3QPSA 3BR6A 1GVDA 1TC3C 1IG7A 2M8GX 5FKOA 4A69C 2B63J 3HOZJ 4BKXA 4AC0A 3HKZN 1QRYA 3S17J 3RKQA 1JTXA 2CQQA 3FKIJ 4QSHA 1MBFA 5M5XJ 3S14J 4M3EA 3O8HA 5J1YA 1ETVA 5IP6A 2P81A 1ETQA 3JRCA 3JRHA 2LFBA 3DCFA 3QPLA 4UUSB 1LFBA 1WGXA 1ZTRA 1FTTA 4A3JJ 3BR1A 3SFIA 3WHCA 5E3NA 1BW6A 2H1KA 2IBDA 3BT9A 1FTZA 5EYRA 1ZR4A 3H3VK 3JR9A 1AHDP 1FEXA 2R5YB 1HF0A 2YS9A 2E2IJ 4A3CJ 2X9DA 2FQ4A 2GBYA 5BNGA 1OCTC 2R93J 1X2MA 1A5JA 4I76A 1JTYA 2M34A 5M3FJ 3S1NJ 2E19A 2ME0A 1PUFA 3BTIA 1JJ8C 1SFOJ 1YRNB 4BBSJ 3OOUA 2DMNA 2TCTA 2W48A 3SJMA 2R0QC 5FLMJ 1ORKA 2OPTA 2XB5A 1UG2A 1VF9A 1GV2A 2LY9A 3TW7A 4S0HB 3LNQA 3LSGA 2K40A 3FIWA 1AKHB 3HOVJ 4C3IJ 3JRIA 2MGQA 5IPAA 3VPRA 5E3LA 3O8GA 3JRAA 5J1RA 5JLXA 1Y1VJ 4UUTA 5GPCA 1K83J 2O8KA 4D7MA 2ID6A 2HQ5A 3MKLA 3GTLJ 5IYCJ 3HOWJ 1H89C 5F04A 4UUSA 1GDTA 1LE8B 3IV5A 1RETA 1RR7A 4QIWN 4D5FA 3QQAA 3S15J 4A3KJ 2DJNA 1U9OA 2G0EA 2R92J 4MFEA 3ZQCA 2HOSA 4DZJA 1OJLA 1TWHJ 2R5YA 3W6VA 3CQZJ 3RQIA 2HOAA 3JRFA 1HOMA 1JKQC 4CYCB 5M3MJ 3OSFA 4MLOA 2K9SA 5F0CA 4DYRA 2DMQA 2YUSA 1YRNA 2XSDC 1HDDC 3H0GJ 3RZDJ 5C4JJ 1MBHA 3L1PA 1ZR2A 2L7ZA 1F43A 1ETYA 4L5EA 2WAQN 1PUFB 3PO3J 4W97A 1JUSA 1ZK8A 3GTKJ 2GLOA 5M5YJ 2XPVA 5K7ZA 3BR3A 4D7NA 1TWGJ 5F1JA 2Y30A 1MNMC 1XC5A 4M3FA 1U9NA 1OFCX 3HGYA 3B6AA 3HB9A 4AYBN 4Y7NJ 1JUMA 2LR8A 5IP7J 1Y1WJ 2K9NA 4LOCA 1IV6A 2FD5A 3SDGA 3IH3A 5E3MA 1U78A 1ZGWA 1ETKA 1DU0A 2D5VA 1TWCJ 2JA8J 5F0FA 2MG4A 5FKLA 2CJJA 3HBLA 3GTPJ 2DA1A 4M3DA 1JGGA 2JN6A 5JLWA 1LE8A 4V2FA 1B72A 5FKNA 4ABZA 2GM4A 3GTQJ 4A3GJ 2NVXJ 3I4MJ 4Y52J 3IH4A 3GTOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6I A;  2CU7 A;  4A3L J;  4JYK A;  1WCM J;  4NDL A;  2VKV A;  5IP9 J;  2CUF A;  2AHQ A;  3BQY A;  2DA5 A;  4C3H J;  4HNV A;  2E1O A;  4XID A;  2EZL A;  3S2D J;  4CYC A;  2KT0 A;  2WV1 A;  2DMP A;  1IDY A;  3LSJ A;  3Q0W A;  3ZOB A;  1AU7 A;  3MVP A;  5K7F A;  2HXI A;  1NK3 P;  2EQR A;  3D1N I;  3ZQG A;  2DA6 A;  1ZQ3 P;  2JWT A;  3TW6 A;  4IEJ A;  4X1E A;  2DA2 A;  2R5Z A;  3TED A;  2Y2Z A;  4W1U A;  3WHB A;  2E2J J;  2AO9 A;  1GV5 A;  3CCY A;  2JK3 A;  4B3A A;  3A01 A;  4FE7 A;  2DN0 A;  5F0H A;  1U8B A;  1Z0X A;  4A93 J;  1XS9 A;  1IDZ A;  1F36 A;  1VND A;  3ZQI A;  2M9H A;  5EEA A;  2EBI A;  1TWA J;  3M3Y J;  4MIM A;  1IC8 A;  1MBJ A;  1B8I A;  4B1R A;  1BL0 A;  2HOT A;  5IYB J;  1QPI A;  3HM5 A;  1JJ6 C;  4M3G A;  1EF4 A;  4EEF G;  3NAR A;  2OF7 A;  2YU9 J;  2FX0 A;  1FIA A;  1HCR A;  1JUP A;  3PO2 J;  2DA7 A;  1I50 J;  3HOX J;  4FIS A;  1TWF J;  2XGE A;  2LVS A;  4BBR J;  2WB1 N;  2LP0 A;  3CDL A;  3GBG A;  3I4N J;  1B72 B;  9ANT A;  2NS7 A;  1IGN A;  3DEW A;  2DMT A;  3LSR A;  3C2B A;  5F08 A;  3ZQF A;  3K2A A;  2L9R A;  2DTZ A;  2NVQ J;  2LLK A;  3Q3S A;  4IHX A;  2Y0S N;  2NS8 A;  1HDP A;  1UMQ A;  3TP0 A;  4JX4 A;  5IOY A;  3OIO A;  3CMY A;  1WH7 A;  2RAE A;  3ZQH A;  3K7A J;  2HXO A;  2DA3 A;  5FKM A;  3OSG A;  3HEF A;  2CUE A;  4AUX A;  2HYJ A;  1VFC A;  3LSP A;  5EF6 A;  2R5Z B;  5C4X J;  1WPK A;  2LK2 A;  4RBO A;  1XG1 A;  2CQX A;  3FK6 A;  5EG0 A;  2XPW A;  3A03 A;  5IOZ A;  2JJ7 A;  3A01 B;  2LD5 A;  1P7I A;  2XRL A;  4GFB A;  3GTG J;  4IHW A;  4XIC A;  4IHY A;  1ETO A;  1W0T A;  4B4C A;  1GUU A;  5FJ8 J;  2I10 A;  2JA7 J;  2EZH A;  3HOY J;  4M6V A;  3BG5 A;  2O7O A;  4DW6 A;  1MSE C;  5FKK A;  3FK7 A;  5F27 A;  1B8I B;  2HDD A;  1RKT A;  2X6O A;  2JA5 J;  4I6Z A;  2EZK A;  1H8A C;  5C3E J;  4J19 A;  1MBK A;  1MBG A;  3S16 J;  2N8G A;  1MBE A;  4C2M J;  5EZG A;  4V2G A;  5GP9 A;  1JKO C;  2M0C A;  2JMW A;  3PM1 A;  5EDN A;  2L7F P;  2VKE A;  4BY1 J;  4A3M J;  1P7J A;  2Y9Y A;  5FLV A;  4A3D J;  5DS9 A;  1VI0 A;  2ECB A;  1BA5 A;  2LKX A;  3HGG A;  1IJW C;  2L0K A;  1SAN A;  3NAU A;  4JP0 A;  2FJ1 A;  2E2H J;  1OCP A;  1S7E A;  3RZO J;  4G12 A;  5EGO B;  2VI6 A;  3GTM J;  2KDZ A;  5J3L A;  1I6H J;  1JT0 A;  4A3I J;  2NOG A;  5E3O A;  3G1L A;  4IHV A;  3BR2 A;  4QTR A;  2JA6 J;  1WI3 A;  3BR5 A;  3ZQL A;  4XRS G;  1POG A;  1I3Q J;  1NTC A;  2VPR A;  2ME6 A;  1CQT A;  2K9Q A;  3BG3 A;  1HLV A;  1BW5 A;  2R7Z J;  3JRB A;  2EZI A;  2M2E A;  4DZP A;  4JX5 A;  5EG0 B;  2VUM J;  1BJZ A;  4XRM A;  2ID3 A;  2ELK A;  4DYC A;  4XRS A;  5M5W J;  4A3E J;  1Z77 A;  2ZB9 A;  1MH3 A;  2DMU A;  3HOU J;  2COB A;  1H88 C;  2MW8 A;  1G2H A;  4FCY A;  1FJL A;  1GT0 C;  5GPA A;  1T56 A;  1ZKG A;  5J1U A;  3F0C A;  2NVY J;  2QCO A;  3BR0 A;  3JRD A;  1RPW A;  4FTH A;  2XB0 X;  1WH5 A;  4FE4 A;  4X6A J;  1IRZ A;  1MSF C;  5C44 J;  1K61 A;  2X48 A;  2L7M P;  1ETX A;  1RKW A;  3BQZ A;  3GTJ J;  2PMZ N;  1NK2 P;  3BTL A;  1W0U A;  2Y31 A;  1X2N A;  5EGO A;  4M3B A;  2Y9Z A;  3G1O A;  3B6C A;  2TRT A;  4D5C A;  1ETW A;  2XGD A;  1T33 A;  4MFD A;  4BY7 J;  1UHS A;  2CRG A;  3S1R J;  1ENH A;  3G1M A;  3MN2 A;  1QVT A;  4DYQ A;  2LTP A;  3HDD A;  3BTJ A;  5EZH A;  4A3B J;  2QF7 A;  3Q0V A;  3M4O J;  4JX6 A;  3S1M J;  1APL C;  3JRG A;  3A02 A;  5HOD A;  3LOC A;  1R9T J;  1O4X A;  4A3F J;  1LFU P;  1JKP C;  2MSY A;  1E3O C;  4C3J J;  3UKG A;  2IEK A;  1X58 A;  3Q0U A;  2ECC A;  3TP3 A;  1RES A;  1DU6 A;  1QVU A;  2XGC A;  3S2H J;  1IUF A;  3BTC A;  3JRE A;  2O9L A;  4MO7 A;  1MH4 A;  1JKR C;  2DA4 A;  2H8R A;  5K7H A;  5IYD J;  1ITY A;  3FIS A;  3BG9 A;  2XPU A;  2HI3 A;  4XK4 A;  2EH3 A;  3S1Q J;  3E7L A;  1AKH A;  1Q1V A;  2IAI A;  5DTD A;  2NVT J;  1D5Y A;  3IH2 A;  4RDU A;  1FIP A;  4BXX J;  1JT6 A;  3QPS A;  3BR6 A;  1GVD A;  1TC3 C;  1IG7 A;  2M8G X;  5FKO A;  4A69 C;  2B63 J;  3HOZ J;  4BKX A;  4AC0 A;  3HKZ N;  1QRY A;  3S17 J;  3RKQ A;  1JTX A;  2CQQ A;  3FKI J;  4QSH A;  1MBF A;  5M5X J;  3S14 J;  4M3E A;  3O8H A;  5J1Y A;  1ETV A;  5IP6 A;  2P81 A;  1ETQ A;  3JRC A;  3JRH A;  2LFB A;  3DCF A;  3QPL A;  4UUS B;  1LFB A;  1WGX A;  1ZTR A;  1FTT A;  4A3J J;  3BR1 A;  3SFI A;  3WHC A;  5E3N A;  1BW6 A;  2H1K A;  2IBD A;  3BT9 A;  1FTZ A;  5EYR A;  1ZR4 A;  3H3V K;  3JR9 A;  1AHD P;  1FEX A;  2R5Y B;  1HF0 A;  2YS9 A;  2E2I J;  4A3C J;  2X9D A;  2FQ4 A;  2GBY A;  5BNG A;  1OCT C;  2R93 J;  1X2M A;  1A5J A;  4I76 A;  1JTY A;  2M34 A;  5M3F J;  3S1N J;  2E19 A;  2ME0 A;  1PUF A;  3BTI A;  1JJ8 C;  1SFO J;  1YRN B;  4BBS J;  3OOU A;  2DMN A;  2TCT A;  2W48 A;  3SJM A;  2R0Q C;  5FLM J;  1ORK A;  2OPT A;  2XB5 A;  1UG2 A;  1VF9 A;  1GV2 A;  2LY9 A;  3TW7 A;  4S0H B;  3LNQ A;  3LSG A;  2K40 A;  3FIW A;  1AKH B;  3HOV J;  4C3I J;  3JRI A;  2MGQ A;  5IPA A;  3VPR A;  5E3L A;  3O8G A;  3JRA A;  5J1R A;  5JLX A;  1Y1V J;  4UUT A;  5GPC A;  1K83 J;  2O8K A;  4D7M A;  2ID6 A;  2HQ5 A;  3MKL A;  3GTL J;  5IYC J;  3HOW J;  1H89 C;  5F04 A;  4UUS A;  1GDT A;  1LE8 B;  3IV5 A;  1RET A;  1RR7 A;  4QIW N;  4D5F A;  3QQA A;  3S15 J;  4A3K J;  2DJN A;  1U9O A;  2G0E A;  2R92 J;  4MFE A;  3ZQC A;  2HOS A;  4DZJ A;  1OJL A;  1TWH J;  2R5Y A;  3W6V A;  3CQZ J;  3RQI A;  2HOA A;  3JRF A;  1HOM A;  1JKQ C;  4CYC B;  5M3M J;  3OSF A;  4MLO A;  2K9S A;  5F0C A;  4DYR A;  2DMQ A;  2YUS A;  1YRN A;  2XSD C;  1HDD C;  3H0G J;  3RZD J;  5C4J J;  1MBH A;  3L1P A;  1ZR2 A;  2L7Z A;  1F43 A;  1ETY A;  4L5E A;  2WAQ N;  1PUF B;  3PO3 J;  4W97 A;  1JUS A;  1ZK8 A;  3GTK J;  2GLO A;  5M5Y J;  2XPV A;  5K7Z A;  3BR3 A;  4D7N A;  1TWG J;  5F1J A;  2Y30 A;  1MNM C;  1XC5 A;  4M3F A;  1U9N A;  1OFC X;  3HGY A;  3B6A A;  3HB9 A;  4AYB N;  4Y7N J;  1JUM A;  2LR8 A;  5IP7 J;  1Y1W J;  2K9N A;  4LOC A;  1IV6 A;  2FD5 A;  3SDG A;  3IH3 A;  5E3M A;  1U78 A;  1ZGW A;  1ETK A;  1DU0 A;  2D5V A;  1TWC J;  2JA8 J;  5F0F A;  2MG4 A;  5FKL A;  2CJJ A;  3HBL A;  3GTP J;  2DA1 A;  4M3D A;  1JGG A;  2JN6 A;  5JLW A;  1LE8 A;  4V2F A;  1B72 A;  5FKN A;  4ABZ A;  2GM4 A;  3GTQ J;  4A3G J;  2NVX J;  3I4M J;  4Y52 J;  3IH4 A;  3GTO J; 
#chains in the Genus database with same CATH topology
 2GOM A;  1G8X A;  4A3L J;  3BZK A;  4AYB A;  5ICC A;  2V6E A;  2QEX I;  4JYK A;  2VKV A;  1NH3 A;  3HTS B;  2UUZ A;  4F55 A;  1MJ9 A;  2OBP A;  4ZZD A;  3BZ6 A;  3GUD A;  4CSW A;  2EZL A;  1IN7 A;  3VB2 A;  2KT0 A;  1SD6 A;  5LHI A;  2WV1 A;  2DMP A;  3LSJ A;  3JSO A;  3ZOB A;  4CA0 A;  3K4M A;  4RA2 A;  3MVP A;  3PUF A;  1NK3 P;  2F5V A;  4RB0 A;  5HVQ C;  3WE2 A;  1Z3Y A;  2JWT A;  3TW6 A;  2R5Z A;  4X1E A;  2DA2 A;  1S72 I;  2XIG A;  2ZSI B;  1Y6I A;  2DOF A;  1JXS A;  6PAX A;  3A01 A;  4ENK A;  2DFE A;  3LSK A;  3PL8 A;  4MGR A;  1U8B A;  3H9J A;  3PNY A;  1QQI A;  1EH8 A;  2FXA A;  2UXN A;  1XS9 A;  4OOI A;  4QPQ A;  1IDZ A;  2ZJP F;  4LIT A;  1XGN A;  2M9H A;  5E8G A;  1TWA J;  1Z91 A;  3LL7 A;  1MBJ A;  2BHY A;  2VIX A;  4B1R A;  3GO5 A;  4KT5 C;  1VQN I;  4X0G A;  3U1D A;  4PJM A;  4M3G A;  1BBY A;  1Z6T A;  1S6L A;  2AXT C;  5E20 A;  1UST A;  3TDU C;  3CP8 A;  2OF7 A;  2TDX A;  3EPZ A;  3NAR A;  4BJT A;  5L3C A;  4XOP A;  2H1L A;  3IWZ A;  2FX0 A;  3SEZ A;  4U88 A;  2KFD A;  3OYM A;  4XMY A;  2IGN A;  1JUP A;  2DA7 A;  4ENM A;  1TWF J;  5CYV A;  2LVS A;  2PX9 A;  3FXO A;  5CQG A;  2AXL A;  3HOT A;  2WB1 N;  3GEZ A;  2JSC A;  2K7L A;  4G7O F;  4AVZ A;  5HOO A;  3V8K A;  1W7P B;  1R5H A;  3KET A;  3DEW A;  1FSE A;  3L2C A;  2DCE A;  3LSR A;  1I39 A;  3C2B A;  4Q5S F;  2Q0O A;  2Z33 A;  3ZQF A;  3K2A A;  2L9R A;  2HVS A;  2DTZ A;  2NVQ J;  3CCL I;  3Q3S A;  3OYN A;  4IHX A;  2XV4 S;  2QZ8 A;  1XCV A;  1UMQ A;  1JE8 A;  3IWF A;  4DOZ A;  5IOY A;  2KPM A;  5JHU A;  5IT9 Z;  3K7A J;  5CQE A;  4IF4 A;  2DA3 A;  2P6T A;  3ZMT A;  3OSG A;  5L3G A;  2HYJ A;  1BI3 A;  3OYB A;  1VFC A;  3CDH A;  5EF6 A;  4EQQ A;  2CSO A;  4HX4 A;  2LBF B;  4A6E A;  3FK6 A;  2PEX A;  3HRU A;  3CCE I;  1J09 A;  3LWF A;  1X3W B;  2IPQ X;  2LD5 A;  1FPQ A;  1YI2 I;  4GFB A;  3GTG J;  4G9Y A;  3P5J A;  3HC7 A;  1YO5 C;  1SFK A;  4OIN F;  4IHY A;  2R7X A;  4A0Z A;  2CMP A;  4A5M A;  1WWX A;  2OD5 A;  2DW4 A;  2XF7 A;  1F1Z A;  2EB7 A;  3FZV A;  3LST A;  2MAB A;  4M6V A;  5FKK A;  4DW6 A;  4R79 A;  3FK7 A;  3C1D A;  2O3F A;  3FHN A;  2HDD A;  1RKT A;  2MC3 A;  3W6J B;  1SAX A;  3F8C A;  2Z5U A;  4LK1 F;  3S16 J;  2N8G A;  5GP9 A;  3OWT A;  4IPA A;  3E6C C;  1SD5 A;  2CW0 F;  1I1S A;  1W7P A;  1UCR A;  1UEL B;  3HYI A;  2X85 A;  4BY1 J;  2ZFW A;  5FLV A;  5BOX A;  1VI0 A;  3QYE A;  1ZYR F;  3HGG A;  2L0K A;  1SD7 A;  4JP0 A;  1VTN C;  2EA4 A;  1PP7 U;  2E2H J;  1S7E A;  2Z16 A;  2E1M B;  4BDZ A;  3FHZ A;  2LKP A;  3ABM H;  2WAE A;  2QUF A;  2FE3 A;  1ZGA A;  4BQQ A;  3K4C A;  1I6H J;  2FF4 A;  4U0V A;  4A3I J;  4YII A;  1FBQ A;  3ABK H;  3OV8 A;  4AIK A;  1DQU A;  3BR2 A;  2Z99 A;  3BP8 A;  3M7G A;  1U5T A;  2M4G A;  1I3Q J;  2ME6 A;  2LBF A;  2ZXJ A;  4BHB A;  2K9Q A;  2WAF A;  5KCM A;  1WSU A;  2OTL I;  3BWG A;  1X4O A;  2KQR A;  2ZBK A;  4OMZ A;  4LIV A;  4R8H A;  5ICF A;  2ZJQ F;  1XX5 A;  3EDP A;  4BXU A;  2R7T A;  2E5N A;  3RKW A;  2VUM J;  1W4M A;  3WU2 C;  2VQC A;  4DYC A;  1STZ A;  4A3E J;  1K6Y A;  3HOU J;  1MMG A;  4NQW B;  2MA3 A;  2MW8 A;  3LA7 A;  2HVQ A;  5FB2 A;  1FJL A;  1XB4 A;  3C2H A;  1S8N A;  2Z2S B;  1F4K A;  5J1U A;  2NVY J;  3BR0 A;  1V5E A;  2QCO A;  2DYR H;  3F0C A;  3KE2 A;  3JRD A;  2KHM A;  3BLY A;  4FE4 A;  3L7W A;  1MSF C;  1JHH A;  3DU5 A;  3WG7 H;  2BW3 A;  2CFO A;  1HXD A;  2RDP A;  4L5J A;  4NC6 A;  4CYD A;  5CVI A;  2L9N A;  4XOT A;  1WJ5 A;  3BQZ A;  2W00 A;  3F3X A;  4UXN A;  4ZYH A;  3KEO A;  2AS5 F;  1WQ2 A;  3PSI A;  3ZP5 A;  4G6D A;  2Y31 A;  1X2N A;  4M3B A;  3PQJ A;  2TRT A;  3A1Y A;  1SVO A;  3I58 A;  1T33 A;  4MFD A;  4BY7 J;  2V79 A;  2W4S A;  2ZO4 A;  3AL0 C;  3QPT A;  1TNT A;  3MN2 A;  4XKB A;  4ZDP A;  1A6Q A;  3FMR A;  3WGI A;  4PUS A;  2D1H A;  2MBF A;  3Q0V A;  3M4O J;  4JX6 A;  1SVL A;  5F64 A;  4WWC A;  3S1M J;  3A02 A;  1TQP A;  3D5L A;  3GME A;  3KZI C;  4I0B A;  3U2R A;  4WF2 A;  5HOD A;  1O4X A;  1SFX A;  4A3F J;  4E7K A;  1XCB A;  2MSY A;  4LK0 F;  4C3J J;  1E3O C;  3A4C A;  3UKG A;  2IEK A;  2PMZ A;  3H3U A;  4E7H A;  1L0O C;  2JUG A;  2PQ8 A;  3TP3 A;  3DQV C;  4KIC A;  3DP7 A;  1QHH D;  1FBS A;  4NQW A;  1QVU A;  1IV8 A;  3AKZ A;  2QM3 A;  1O57 A;  2PFB A;  2V6C A;  3DEE A;  3OL3 A;  3EET A;  2HKO A;  2LH9 A;  1MDM B;  2Z3Y A;  3DPL C;  2CS3 A;  1KU3 A;  2W85 A;  5LHH A;  4GYI A;  4L0Z B;  1JKR C;  4A12 A;  2DA4 A;  5DV5 A;  5K7H A;  2H8R A;  4IHT A;  3MZY A;  3FIS A;  2XPU A;  1R36 A;  1XSX A;  4XK4 A;  3HL2 A;  2W1O A;  3F8M A;  4DBQ A;  2D1V A;  1WVR A;  1R00 A;  3H1C A;  2IAI A;  4XOR A;  5DTD A;  3ZN1 A;  4RDU A;  3GVA A;  1IXC A;  4IVN A;  4MQ9 F;  4HSR A;  5L3E A;  4BXX J;  3O2P E;  2KDO A;  3BR6 A;  3ELK A;  3BPX A;  2CW8 A;  3KIO A;  1R6R A;  4BKX A;  4M9Z A;  1QRY A;  1H9G A;  3RIR A;  1D0X A;  2M0M A;  4CDG A;  2VC1 A;  3S17 J;  2XC7 A;  2DI3 A;  2KKO A;  3F6V A;  2VN2 A;  3FKI J;  1KQ0 A;  3F8F A;  5M5X J;  3BJO A;  2BGC A;  2VJJ A;  4AVP A;  4E7Z A;  4M3E A;  4M71 A;  4BGD A;  3MKY B;  1KU2 A;  4S04 A;  2VOP A;  2M5W A;  2CQN A;  3QOP A;  5IP6 A;  4BQN A;  1XTA A;  5GTH C;  3JRH A;  1T8I A;  2LFB A;  1MW7 A;  4KA4 A;  1KA8 A;  2EK5 A;  4XN0 A;  3J7A O;  4E7J A;  3CUQ C;  1LJ9 A;  2HZT A;  3H36 A;  3BR1 A;  3C7J A;  2ZME C;  2QLZ A;  2EIK H;  3K4N A;  5FRM A;  2BE5 F;  2HWV A;  2D45 A;  1Z9C A;  3H3V K;  5DM6 F;  1QU3 A;  2WC2 A;  2CWE A;  1IO2 A;  1ZG3 A;  3G73 A;  4HF0 A;  1R58 A;  1OCT C;  1X2M A;  1EKE A;  1MDM A;  1JTY A;  4WXD A;  2DFF A;  5FLX Z;  3I55 I;  5FFX A;  1TTY A;  5HLI A;  3GFM A;  1J7K A;  2A6H F;  1Z05 A;  3UR3 C;  4RB3 C;  1WKM A;  2DFI A;  3FXL A;  4R1H A;  4IO9 F;  1IZ1 A;  1IW7 F;  4KYW A;  2QSF X;  1HW1 A;  2AQF A;  4F91 B;  1O3R A;  2X6Y A;  2W48 A;  2X6W A;  3SJM A;  1EH6 A;  3CF5 F;  1D5V A;  3LNQ A;  2HDC A;  1UAA A;  1AKH B;  5CVU A;  1Z6R A;  2CV1 A;  3FMQ A;  1OYI A;  1FBU A;  1V4R A;  4C3I J;  5IPA A;  3LA3 A;  1YFH A;  1T2K A;  1UG0 A;  3ABL H;  2XAS A;  1U3E M;  3F9K A;  2JZY A;  1LFP A;  4UUT A;  4Z2Y A;  3ABU A;  5E18 F;  2B0L A;  4YG2 F;  3ISP A;  3ZQ7 A;  4BHC A;  2HEO A;  1ZG5 A;  3HOW J;  4HPQ A;  3HSF A;  1TNS A;  4GYG A;  3QOD A;  5F04 A;  3K4J A;  1GDT A;  1T08 B;  3OL4 A;  4QIW N;  1G3Y A;  2PMU A;  1USS A;  1OCO H;  3HRS A;  1U2W A;  1SMT A;  4IOA F;  1BIA A;  2Q1Z B;  1UB9 A;  4XR6 A;  2EA2 A;  3CF2 A;  3CDI A;  2NAZ A;  2FOW A;  4DZJ A;  4OAY A;  3W6V A;  1X3U A;  2PMH A;  3CQZ J;  1VQP I;  2QBY B;  2P5K A;  3FM5 A;  5BS6 A;  4C2U A;  2HOA A;  3JRF A;  4CYC B;  2HR3 A;  2VKH A;  4CCM A;  1KQ9 A;  2F5C A;  4QPO A;  2K9S A;  5F0C A;  1AA7 A;  3QYB A;  3OYJ A;  1YJW I;  2CYY A;  1R5I D;  2R7W A;  3RZD J;  4BHP A;  3L1P A;  1DUX C;  1OYY A;  2F4M B;  2WAQ N;  3KEQ A;  5FFZ A;  1PUF B;  3AL0 B;  1FOY A;  1JUS A;  3GTK J;  2KIM A;  2V1X A;  5LLQ A;  5K7Z A;  3I56 I;  3BR3 A;  3CCV I;  2KP6 A;  4EVI A;  2NNN A;  1U9N A;  3TO9 A;  3B6A A;  4N4N B;  5JHF A;  1BR4 A;  5GAE J;  5L3F A;  2VAS A;  4QLC U;  5LGU A;  1ZEL A;  3J81 K;  1A04 A;  1DU0 A;  4U0W A;  1TWC J;  5KHD A;  1XPX A;  1IUY A;  5GAG J;  1T39 A;  3E5U A;  1TP4 A;  3GLX A;  1T0F C;  3TMO A;  1LDD A;  2CJJ A;  3IAM 2;  5HLT A;  3HBL A;  4B48 A;  4ETS A;  4ZJZ A;  1BOB A;  2LF8 A;  4BEH B;  1B72 A;  1Y56 A;  2GM4 A;  3GTQ J;  3M8E A;  4RAZ A;  3QWL A;  4KIB A;  1P6R A;  1A6I A;  5E79 C;  2LOO A;  3CCS I;  4NDL A;  5BPD A;  3C2G A;  3U1K A;  2CUF A;  2H6C A;  3BQY A;  2DA5 A;  2E1O A;  1Y39 A;  4ZZL A;  1YX3 A;  3S2D J;  4CYC A;  3WOD F;  5J8C A;  5DD8 A;  3IC7 A;  1OCC H;  2E35 A;  2M87 A;  4NBQ A;  1FYL A;  3E5Q A;  2DFH A;  1GVJ A;  3ULQ B;  1Z67 A;  2QQ8 A;  3ZQG A;  5A2Q Z;  1ZQ3 P;  2EV5 A;  2Y2Z A;  3WHB A;  1NG7 A;  3CCY A;  2OZU A;  1O3T A;  3H9Q A;  2JK3 A;  1KGS A;  2CQK A;  4B3A A;  1K6O A;  4Y15 A;  3RKX A;  2GOX B;  2IP2 A;  4FE7 A;  3LSI A;  2DN0 A;  1P4W A;  1J0R A;  1Z0X A;  2X1E A;  3FKJ A;  1O7F A;  2XF6 A;  3WGH A;  4BJ5 C;  5HNF A;  3M1E A;  3CJN A;  4RB2 C;  1F36 A;  5EEA A;  3GLL A;  2ELJ A;  3GCM A;  1IC8 A;  1BI2 A;  4ESB A;  2DPU A;  4GO1 A;  4B09 A;  3DFG A;  4LD5 A;  2G7U A;  4IKF A;  1JJ6 C;  4HV5 A;  2M7B A;  2XKO A;  1R49 A;  1T38 A;  4Z6Y A;  4I2O A;  1HBX G;  3FDY A;  1IN4 A;  4BEH A;  1R1V A;  4HF2 A;  3ZCO A;  1TLH B;  3ERM A;  5B1B H;  3HOX J;  4FIS A;  2OAZ A;  4PJ0 C;  3OYF A;  2XGE A;  1BN5 A;  3TBI A;  3SDB A;  4U7D A;  3H35 A;  1IGN A;  2DMT A;  3L00 A;  1D1A A;  2K5C A;  3RCO A;  5KAF C;  1FOK A;  1ZG1 A;  3AG3 H;  3FMS A;  3IHU A;  1XD7 A;  1I3A A;  4M73 A;  4YFX F;  2Y0S N;  2NS8 A;  4HLY A;  1W7P D;  3S32 A;  3TP0 A;  2R7V A;  4HBL A;  5DD4 A;  2QVO A;  4LIU A;  4XLF A;  2LY2 A;  3X2Q H;  1QA6 A;  3RPQ A;  3KEY A;  5FKM A;  3COA C;  2DTR A;  2ZNY A;  1MZB A;  2WB1 A;  3LSP A;  2R5Z B;  2LK2 A;  4BQO A;  2OV7 A;  5DUI A;  1TT0 A;  1VQ7 I;  2DBB A;  2DT5 A;  4MNU A;  2JJ7 A;  5IOZ A;  4FQG A;  4CCO A;  3A01 B;  1P7I A;  4DIQ A;  4F3Q A;  1XGO A;  2XRL A;  2XRO A;  2A05 A;  2EFO A;  4IHW A;  2ZME A;  2EV0 A;  4FT8 A;  3DBH B;  4PFP A;  4UNO A;  2L54 A;  4B4C A;  4E7L A;  2I10 A;  3M07 A;  3E6D A;  2QGU A;  2ZXH A;  4A6D A;  4IQ4 A;  3C18 A;  2K4J A;  4G8X A;  1Q1H A;  3K1N A;  5B1A H;  4M9S A;  3FBN B;  3GZN B;  1OIS A;  2A61 A;  2NYX A;  2EZK A;  3HSE A;  5C3E J;  2HKX A;  1SVM A;  3LA2 A;  4NB5 A;  4LG0 A;  2M30 A;  4V2G A;  1JKO C;  2HPM A;  3NEU A;  3HJE A;  3QU3 A;  3DKW A;  3H5R A;  3CMM A;  2GIZ A;  2VKE A;  1RUO A;  1P2F A;  4F93 B;  2Y9Y A;  5DS9 A;  1W5T A;  2ECB A;  4BS9 A;  3BZC A;  1R4N B;  2H27 A;  5DUK A;  1K78 B;  2JTV A;  4OIR F;  4KIG A;  3RZO J;  3AAF A;  4G12 A;  5EGO B;  2VI6 A;  2QQB A;  1ZGJ A;  3R0J A;  3VYR B;  2DOE A;  5LHG A;  3PIP F;  2P7C B;  3GWZ A;  4XLH A;  1YQA A;  5J3L A;  1VZ0 A;  3HPH A;  4YIF A;  1EV7 A;  1J2X A;  3OYI A;  2BOL A;  3G1L A;  2X4H A;  5IT9 K;  1XMX A;  2CO5 A;  2J5O A;  5CVR A;  3BR5 A;  5CJ9 A;  2MYS A;  3ZQL A;  1POG A;  1BC7 C;  4OIP F;  4ZDO A;  1L3L A;  3BG3 A;  3A0B C;  3KP7 A;  4DJA A;  3O6B B;  3J80 Z;  4YEJ A;  2KJB A;  2WY7 Q;  1Y8Q B;  1TW3 A;  4LLN A;  2M2E A;  4BE1 A;  4LJZ F;  2IS6 A;  4JX5 A;  1ZN2 A;  2ADU A;  2BEO A;  3F8N A;  3JTH A;  4XRM A;  1QBJ A;  2EFW A;  2G7H A;  1Z77 A;  5D5V B;  3T8R A;  2DMU A;  3BY6 A;  4BYY A;  3V7C A;  3W2W A;  2L2O A;  4CGZ A;  2DT6 A;  1W36 C;  1G2H A;  1WJA A;  4FCY A;  2K9M A;  1IXS B;  3OYD A;  2MC4 A;  4G94 A;  1SD4 A;  1GT0 C;  2KMU A;  1T56 A;  2VOO A;  4XLC A;  3K69 A;  3L2Q A;  1RPW A;  3GXO A;  3I59 B;  3ZMD A;  2XB0 X;  3N05 A;  2H09 A;  3OIQ A;  4PFO A;  1G4D A;  1Z3X A;  4EM0 B;  1P4X A;  1E3P A;  4EJU A;  5C44 J;  2VPL A;  1P4A A;  5TGT A;  2L7M P;  4PK4 A;  3LFK A;  3U9G A;  4PSX A;  2ELH A;  4S05 A;  3BG7 A;  4Y17 A;  1D1B A;  2LY1 A;  5GAH J;  3GTJ J;  3RPU A;  3V7S A;  1K78 A;  3BTL A;  1NK2 P;  1W0U A;  3CUO A;  1HST A;  4I09 A;  5EGO A;  3CO6 C;  3ZGK A;  3B6C A;  4D5C A;  2HOE A;  4PZJ A;  1WJF A;  4M6X A;  1TBX A;  2B7E A;  1X1P A;  1UHS A;  2CRG A;  5BPI A;  3S1R J;  1MGT A;  3S93 A;  4G6T B;  3KP4 A;  1BC8 C;  3BTJ A;  5EZH A;  2ETH A;  4A3B J;  1T0F A;  3LSH A;  3LOC A;  2WWY A;  1U5T B;  2ZKZ A;  2HVR A;  3HOS A;  1X58 A;  1XDS A;  2ECC A;  1HKQ A;  4KT6 A;  3BJ6 A;  2CUJ A;  4UVB A;  2OTJ I;  1FZP B;  1B1B A;  2HQN A;  4KIT B;  3QPH A;  4ZTJ A;  4ZH4 F;  3S2H J;  5FRO A;  1IRF A;  1VQ6 I;  3BC8 A;  3JRE A;  3DWL E;  2XF5 A;  4YRV A;  4WXH A;  3I54 A;  4MO7 A;  4HQE A;  1MH4 A;  1OQY A;  2JSP A;  3I59 A;  3G6E I;  5IYD J;  1OCZ H;  4HOB A;  2JQ7 A;  2ZSH B;  1PP8 F;  2AQE A;  2BYV E;  3BG6 A;  2JA2 A;  3QP5 A;  4P9U A;  2UV1 A;  3DPU A;  4L18 B;  1O3S A;  2Y69 H;  2XVC A;  1QZZ A;  1Q1V A;  5L3B A;  3IH2 A;  1ZRC A;  2EWN A;  4DNC A;  2CH0 A;  2BW3 B;  1REP C;  3KLN A;  3K9T A;  1GVD A;  1S9H A;  1YW7 A;  2A3S A;  2HZD A;  3SYT A;  2B63 J;  4A69 C;  3HOZ J;  5HLG A;  3O3K A;  4AC0 A;  4B8X A;  3FXQ A;  1W5S A;  4L9J A;  4AWX B;  1JTX A;  3RYR A;  4U7B A;  3TDZ C;  4Q47 A;  4CO8 A;  5J40 A;  3O8H A;  4KJZ A;  4HZF A;  5J1Y A;  3DBL B;  5E1W A;  2L01 A;  3AG1 H;  4P5O A;  3FXJ A;  2STT A;  4GXO A;  5HNH A;  3JRC A;  1RNL A;  3OR2 C;  1YG2 A;  3QPL A;  2W25 A;  1WGX A;  1MJB A;  2NXN B;  2W57 A;  3TOB A;  3ECO A;  1PDN C;  5FRN A;  5E3N A;  1ERD A;  2M7A A;  1BW6 A;  3MWM A;  2NS0 A;  3BT9 A;  3DPT A;  1FTZ A;  2X51 A;  1RI7 A;  3OYG A;  2IGO A;  2O0Y A;  2W82 A;  3JR9 A;  2NNY A;  1FEX A;  1XMK A;  1X1B A;  1AHD P;  2R5Y B;  3MFK A;  4A3C J;  2K3F A;  2VB6 A;  2X9D A;  3TOA A;  2FQ4 A;  3LMM A;  5BNG A;  2R93 J;  2FEZ A;  2G9W A;  1A5J A;  1J5Y A;  3IAS 2;  5K5Q A;  4HEA 2;  1ZRD A;  1OR7 A;  4LLL A;  3VEP A;  3S1N J;  3HHG A;  4BAC A;  2ME0 A;  1DGW Y;  3BTI A;  1JJ8 C;  1S5L C;  1SFO J;  3J7A Y;  2YSR A;  3KLO A;  3E6B A;  3CLQ A;  5E17 F;  2A07 F;  5FLM J;  2BXZ A;  3EYI A;  2OPT A;  3TGN A;  1UG2 A;  1VF9 A;  3TW7 A;  2LY9 A;  4S0H B;  3LSG A;  1YW9 A;  1LEA A;  3FIW A;  1J75 A;  1F5T A;  3M8J A;  5IT3 A;  3F23 A;  3T8T A;  3K0L A;  2MGQ A;  2MLK A;  4KDP A;  1CGP A;  3O8G A;  4MEY F;  2BVL A;  5JLX A;  2K02 A;  1Y1V J;  3CJQ B;  1QZY A;  2H6B A;  2QSG X;  2FBH A;  1SAU A;  2EIM H;  1LQ1 A;  4D7M A;  2QA4 I;  1Z1D A;  2ESH A;  5DYM A;  3MKL A;  3GTL J;  1BIB A;  1LNW A;  2E7W A;  2XSJ C;  1OYW A;  4ON0 A;  2P4W A;  1RR7 A;  3QQA A;  2DJN A;  2V7F A;  2R7F A;  1TL8 A;  2KL4 A;  5BQT A;  2R92 J;  3TO6 A;  2P7V B;  3WTS C;  3WTT C;  3DKX A;  2EIL H;  2QYO A;  2VBX A;  4II3 A;  1AWC A;  4CXF A;  2R5Y A;  2BXY A;  3OYL A;  4XN3 A;  2MH2 A;  1UZC A;  3TO7 A;  3AG4 H;  4IOC F;  1W5C C;  2DQR A;  2RC4 A;  4EV0 A;  5M3M J;  4EAT A;  2R7Q A;  4XSZ F;  4HRI A;  4DYR A;  4G7H F;  2BBY A;  3W3C A;  2YUS A;  5FLX K;  1YHQ I;  3H0G J;  5E8I A;  1Z7U A;  2L9S A;  1O3Q A;  4EM1 A;  3GX4 X;  1ZR2 A;  1KON A;  4RAG A;  1IF1 A;  1UHM A;  1WFX A;  1X1D A;  5M5Y J;  5LRS A;  2XPV A;  4NC7 A;  4F7Z A;  2GLO A;  3HHH A;  1TWG J;  5DDG A;  3AG2 H;  4RM2 A;  2KRH A;  4M3F A;  2FBI A;  1FP2 A;  1N75 A;  1OKR A;  3HTU A;  4Y7N J;  1JUM A;  2ACJ A;  2V1U A;  1SFE A;  3D5R C;  2LG4 A;  3V8L A;  3W2A A;  2QWW A;  2K9N A;  3SDG A;  3KZY A;  1YOV B;  4XLP F;  2D5V A;  5K5O A;  2VE9 A;  2Y75 A;  5LGT A;  1FOX A;  1IRG A;  1VQ4 I;  4A2U A;  2QKL B;  5H2F C;  4U0Y A;  1WJB A;  2WAD A;  5E1Z B;  4XKC A;  4UUV A;  2VON A;  1R4M B;  4M3D A;  2Y48 A;  2WAQ A;  1U6G A;  1EJ9 A;  4BQA A;  4KIS A;  4ABZ A;  2HQR A;  1FP1 D;  3I4M J;  4Y52 J;  2VE8 A;  3IH4 A;  4UB8 C;  2LRE A;  3GTO J;  2CU7 A;  2YX4 A;  1WCM J;  4Y13 A;  2AHQ A;  4HNV A;  4XID A;  4H4K C;  3GYH X;  2ZXW H;  3GFI A;  4II2 A;  5B66 C;  4RM3 A;  2RGV A;  3TQN A;  3Q0W A;  2E1C A;  1DGR M;  1KQ8 A;  2X1D A;  4UVA A;  2EQR A;  2GXG A;  3D1N I;  3CJR B;  2FML A;  2VQG A;  2DA6 A;  2W7N A;  3TED A;  1BR2 A;  3SQN A;  5D5W B;  4W1U A;  4ANJ A;  2VXZ A;  1GV5 A;  4ZTF A;  4M6Y A;  4DGW B;  2CW7 A;  2JPC A;  4KUM A;  1WJE A;  5F0H A;  1XN7 A;  2JT1 A;  1WZ2 A;  4A93 J;  1G59 A;  1Z21 A;  3BJA A;  3ZQI A;  3P9K A;  1UHW A;  2I8D A;  1FYK A;  1B8I A;  4JOM A;  3CTA A;  1MIJ A;  4UV8 A;  4C9Y A;  2K9L A;  4BU2 A;  5IYB J;  4M9X A;  3FXU A;  2F2E A;  4IRH A;  1QPI A;  2HOT A;  4PJN A;  3MMY B;  3R61 A;  2JUC A;  4YFK F;  4EEF G;  3UNG C;  3OMY A;  2BY2 A;  4ESF A;  1ODD A;  2KZV A;  3P7N A;  2BVM A;  2OC6 A;  1YS6 A;  2A5Y B;  4CCL A;  3OYC A;  3CC4 I;  2VKD A;  3PO2 J;  1I50 J;  1SC7 A;  1LDK B;  2CV0 A;  2IVM A;  4BBR J;  4FHT A;  1FT9 A;  2LP0 A;  3GBG A;  4BAY A;  3I4N J;  1B72 B;  1X3Z B;  9ANT A;  2NS7 A;  2XGX A;  4EGZ A;  2IRF G;  3K70 C;  2DLL A;  4XKW A;  2PN6 A;  4AU7 A;  5F08 A;  4KMU X;  3I9V 2;  1H0M A;  2XAG A;  3NWS A;  3ZMZ A;  2E1N A;  3OOP A;  1ULY A;  2W24 A;  2Y0M A;  2B9S A;  2LLK A;  2OZ6 A;  4IQJ A;  2GZW A;  2K27 A;  1FWZ A;  1HDP A;  2X1C A;  2A69 F;  3VDX A;  2VJ4 A;  4JX4 A;  4D1Q A;  4BDY A;  3OIO A;  3CMY A;  3VYT B;  3ZQH A;  2E60 A;  1D8J A;  2OJE D;  2X0L A;  5CVV A;  5A2Q K;  3E5X A;  2XUB A;  3HEF A;  1T95 A;  4CHU A;  2Z9O A;  1WPK A;  4RBO A;  1XG1 A;  4N9I A;  5EG0 A;  2XPW A;  2QKM B;  3R0A A;  4OWR B;  4Y4R A;  5LGN A;  1XDU A;  1SEU A;  2F5E A;  2RKH A;  1IAW A;  2P5V A;  4XIC A;  3RJP A;  1KYW A;  2MD5 A;  1ETO A;  2VJ5 A;  2HTJ A;  2Y0S A;  3KP2 A;  1GUU A;  5FJ8 J;  3HOY J;  2JA7 J;  3KYC B;  1MSE C;  4HV6 A;  3JW4 A;  3OYA A;  5F27 A;  2Q8K A;  3VFZ A;  2EFN A;  3U21 A;  1V55 H;  4I98 B;  2JA5 J;  4I6Z A;  3BPV A;  4LLG F;  3VYS B;  4J19 A;  1ZAR A;  1GLN A;  1MBK A;  2P6S A;  1MBE A;  2V4J C;  4C2M J;  4ZC3 A;  1SFU A;  2M0C A;  2JMW A;  3Q5F A;  5HDG A;  3B02 A;  3BCB A;  3LFU A;  1A35 A;  2A6T A;  5EDN A;  2L7F P;  4OAZ A;  5CKT A;  4A3M J;  3S3M A;  3M9A A;  2MLG A;  4A3D J;  5J4V A;  1DDN A;  3L9F A;  2F5D A;  4AIJ A;  3L2U A;  1SAN A;  3NAU A;  1M1E B;  2FJ1 A;  3JAM Z;  2PJR A;  4LFU A;  4BL0 B;  2FA5 A;  2CFX A;  4M72 A;  3I53 A;  3KP3 A;  3V7R A;  4RB1 A;  2M8E A;  3LAP A;  2DO7 A;  2DXI A;  1VQ9 I;  3H3Z A;  2CV2 A;  2VOD A;  2DPD A;  2NOG A;  3RSN A;  3FXK A;  5E3O A;  5TRD A;  4IHV A;  4EM2 A;  3KYL A;  1QPM A;  2JA6 J;  2LRD A;  3IKT A;  2GXA A;  3FXM A;  1ON1 A;  3S3O A;  3RPU D;  2R7R A;  1D8K A;  4XRS G;  5HS9 A;  1NTC A;  2VPR A;  4M74 A;  2E5Z A;  1HLV A;  5ILS A;  4B47 A;  2R7Z J;  5F6F A;  3DLA A;  4ASN A;  4RAF A;  2M1B A;  4KIF A;  2CQ7 A;  4I02 A;  3K4B A;  2KZG A;  3CJT B;  3H5A A;  3VYU B;  1KU7 A;  2ELK A;  5M5W J;  3G71 I;  3CUQ B;  4HW0 A;  4I01 A;  1R22 A;  2R7D A;  2VBW A;  3BRO A;  2ZME B;  1H88 C;  4BUP A;  3MQ0 A;  3AFH A;  3CD6 I;  2RNG A;  3EQL F;  2GWR A;  5LEK A;  3DTI A;  3VOE A;  2MD0 A;  3ASN H;  5D4S A;  2R7O A;  3PUB A;  4FTH A;  1WH5 A;  4X6A J;  3K1P A;  2P8T A;  1IRZ A;  4Y3O A;  3OS0 A;  4KN7 X;  3HUG A;  3PQK A;  1K61 A;  4P96 A;  4RLF A;  3WU1 B;  4LG0 B;  2HQA A;  1ETX A;  2GIV A;  1RKW A;  2BHZ A;  3L2R A;  1Y8R B;  3J81 Z;  5BMZ A;  1LUJ B;  1XGM A;  1Y0U A;  2QSH X;  1FOW A;  3G1O A;  4OIO F;  2A68 F;  3BDD A;  1N77 A;  2XGD A;  1MND A;  5LRR A;  1JGS A;  5H6R A;  4AID A;  2ZJR F;  3V42 A;  1FNN A;  1ON2 A;  3CME I;  1FLI A;  3G1M A;  4Y33 A;  1WRJ A;  2O61 A;  3HDD A;  3M1C A;  4KN4 X;  5IY5 H;  3SZT A;  2DDB A;  4RMN A;  1MMD A;  5CLS A;  2V1N A;  4FAS D;  2LMD A;  2GQQ A;  3CCQ I;  1R9T J;  1LFU P;  1I27 A;  4ZYA A;  1RZ4 A;  1GHC A;  3S3N A;  3Q0U A;  2I5U A;  1C0W A;  2RVC A;  2C6Y A;  3RTR A;  3EUA A;  4J01 A;  1ZH5 A;  3CUQ A;  4RAY A;  3K2Z A;  1K79 A;  2XGC A;  2RQQ A;  5ED4 A;  2LF7 A;  1HW2 A;  3CO7 C;  4EMS A;  5B5E C;  4D0P A;  3OR1 C;  1X1C A;  2MH9 A;  5TJJ A;  2OQR A;  3E0J B;  3BG9 A;  4UB6 C;  1V5F A;  2HI3 A;  5KAI C;  3F21 A;  4HDU A;  2WBM A;  1J59 A;  3E7L A;  4AM3 A;  2E1M C;  2X6X A;  3QU6 A;  4P55 A;  4L0Y B;  1B9N A;  4XLE A;  5KK1 A;  1E0E A;  2NVT J;  3ZPL A;  1LDJ A;  1JT6 A;  1FYM A;  1KZH A;  1R5G A;  3DXJ F;  3SXY A;  2ZNZ A;  3KX2 A;  3K4L A;  1IG7 A;  1TC3 C;  3HKZ N;  1FMV A;  2HNH A;  1ZAO A;  2PI0 A;  2NRA C;  4QSH A;  1QHG A;  3HG9 A;  3M8F A;  3CP2 A;  2L02 A;  3OYK A;  4PDK A;  2RV8 A;  1ETV A;  3ONQ A;  2GAU A;  1MJA A;  2UZK A;  4P1W A;  3DF8 A;  2EPF A;  4UUS B;  1LFB A;  4HLX A;  4A3J J;  1JI8 A;  3SFI A;  4GCV A;  2IGM A;  4ENJ A;  1EH7 A;  2H1K A;  2IBD A;  2IS2 A;  1BOA A;  1G3W A;  3OYE A;  1G6N A;  2FNA A;  1FC3 A;  1HSJ A;  4A5N A;  4WXC A;  1LEB A;  3HIF A;  2JPB A;  2VXD A;  3ERE D;  4BE2 A;  4O6J A;  4RGU A;  3CCR I;  2E2I J;  3RQ4 A;  3EUK L;  3HXL A;  4XM3 A;  4I76 A;  4IRG A;  2M45 A;  4F92 B;  3WTW C;  4DQ2 A;  2M34 A;  5H6Q A;  5M3F J;  3P9C A;  1R1U A;  2E19 A;  2XAF A;  2YU3 A;  2O8X A;  2ZXI A;  4A0Y A;  4UV9 A;  3CMA I;  1MD0 A;  2V9K A;  3REO A;  2H8W A;  1ORK A;  2XDV A;  2XB5 A;  3DU6 A;  1GV2 A;  4C2T A;  2HU9 A;  1WHU A;  5DCM A;  2K40 A;  4ZDL A;  3VSK A;  2EFQ A;  1QO0 D;  2YX7 A;  3IRQ A;  1B6A A;  3GF2 A;  4MHG A;  1CF7 A;  2F4O B;  2V9P A;  4B3X A;  4E4H A;  3OS1 A;  1V5G A;  2BV6 A;  2HYG D;  5E3L A;  3JRA A;  4XL9 A;  3T5X A;  3T0Y A;  1T6S A;  1ZRE A;  4HNU A;  5AIP A;  3DTE A;  3W6K B;  4MTD A;  1K83 J;  2O8K A;  4I99 C;  1S7A A;  2HQ5 A;  2ID6 A;  3NWT A;  4XSX F;  1XSD A;  2XRN A;  4UUS A;  1VQL I;  3W2V A;  2F6C A;  1LE8 B;  2R7U A;  3IV5 A;  1RET A;  2E34 A;  2DK5 A;  1T98 A;  4EGY A;  4A3K J;  5LFA A;  4XLA A;  5FGM A;  4EJT A;  1U9O A;  2MFZ A;  4NHJ A;  2KIQ A;  4RLQ A;  4BNC A;  4E6K G;  4MFE A;  3ZQC A;  2UXX A;  4HAM A;  1BI0 A;  1ONV A;  4UY8 I;  2HYF A;  1TWH J;  2VBY A;  3PNT A;  1W36 D;  3RQI A;  1DP3 A;  1A36 A;  1JKQ C;  4HQM A;  1KYZ A;  2V9V A;  1HC8 A;  3FBI B;  1FX7 A;  2PG4 A;  5JVG F;  2DMQ A;  4PGG A;  3WTZ A;  1ZLJ A;  2XSD C;  5FO5 A;  1HDD C;  1MBH A;  2L7Z A;  1F43 A;  1ETY A;  1P9Q C;  4L5E A;  2FQ3 A;  3PO3 J;  3WTX C;  4W97 A;  4O3M A;  1UJ8 A;  4D7N A;  2A5W A;  1D3Y A;  1MNM C;  1XC5 A;  5D8K B;  1OFC X;  3H92 A;  1HA8 A;  3S8P A;  4AYB N;  3J7Z I;  3G2B A;  3RKY A;  3R60 A;  1FSH A;  2ZC2 A;  4B44 A;  5IP7 J;  1Y1W J;  3HRM A;  1F9N A;  4LOC A;  1IV6 A;  2CUZ A;  5E3M A;  1ZGW A;  1ETK A;  5B3S H;  4HDV A;  2JA8 J;  4IHS A;  5F0F A;  2YPR A;  1RR8 C;  2MG4 A;  2WY8 Q;  5D5X B;  2IA1 A;  3I64 A;  3MZ8 A;  3JSP A;  2DA1 A;  1RC9 A;  2JN6 A;  5JLW A;  1JGG A;  1LE8 A;  3ASO H;  1YE9 A;  2O6G E;  2ISZ A;  3F22 A;  4G7Z F;  3I4P A;  4XLN F;  4P9F A;  4NNJ A;  4A3G J;  2ZCW A;  1YJ9 I;  2RNJ A;  1B9M A;  4ITV A;  4XQF A;  4BE0 A;  2NVX J;  4KNY A;  1EA3 A;  4A0X A;  4GRI A;  1MMN A;  1A31 A;  4HX7 A;  3DEU A;  2DK8 A;  3PFY A;  5IP9 J;  5J8F A;  2R3S A;  4G6Q A;  4C3H J;  3ZN0 A;  3IRR A;  4E70 A;  1QGP A;  1TQI A;  1XMA A;  2XAU A;  4LMY A;  4XNF A;  1IDY A;  3Q9S A;  2BY0 A;  4BXF A;  2FUG 2;  3ZR8 X;  4MEX F;  1AU7 A;  5K7F A;  3GW2 A;  1TT5 B;  2HXI A;  2XHK A;  3K1M A;  4JQF A;  1SMY F;  4IEJ A;  1YIO A;  2E2J J;  2AO9 A;  1VQ8 I;  3E3V A;  1R7J A;  4QWQ A;  2VC0 A;  3H0D A;  3WTU C;  1NHA A;  1XSV A;  2RN7 A;  3JTG A;  2PJP A;  3VWB A;  3DV8 A;  1QZE A;  3LQQ A;  3CCJ I;  5J4Y A;  4HF1 A;  1IRX A;  5EEH A;  2OQG A;  1VND A;  1V54 H;  4AD9 A;  2EBI A;  3E1S A;  2HTS A;  3M3Y J;  3G4S I;  5GAD J;  2CG4 A;  4MIM A;  4OMY A;  3SFZ A;  1BL0 A;  3EYY A;  5DM7 F;  3HM5 A;  1EF4 A;  4JBA A;  1YYV A;  2OUM A;  1BM9 A;  3MCZ A;  4WCG A;  5KNL A;  5JR3 A;  2YU9 J;  1FIA A;  2DOA A;  2E7X A;  1HCR A;  3NQO A;  1VQO I;  1N78 A;  2VJI A;  2IGK A;  2VBZ A;  3CDL A;  4O5V A;  5D8L B;  4FET A;  4IXA A;  5D6E A;  4WK8 F;  4RGS A;  1MMS A;  2KRF A;  4WX9 A;  4ZYE A;  5HS7 A;  2IA0 A;  1RUN A;  3EUH C;  1R23 A;  4XBF A;  3R4K A;  4Q48 A;  2IS1 A;  3SEQ A;  4PGH A;  5HS8 A;  2HDW A;  3C3W A;  4HYE A;  4F52 A;  4KFC A;  2OA4 A;  3CC2 I;  4GDF A;  5D4R A;  1WH7 A;  2RAE A;  4L9V A;  5F1R A;  1WJD A;  1LVA A;  2HXO A;  2XAH A;  3ZXS A;  2Z1D A;  2CUE A;  2H94 A;  4AUX A;  5C4X J;  3I0T A;  1VQM I;  2CQX A;  4RGR A;  3HPG A;  4CCN A;  2KLO A;  1S29 A;  3A03 A;  1PYV A;  3KPH A;  5D5U B;  2FRH A;  4OU0 A;  1IN5 A;  5ICG A;  2IJL A;  3ZMV A;  1W0T A;  2EIN H;  2DJI A;  3PNV A;  1HQC A;  1VQK I;  2DU9 A;  2EZH A;  3ESW B;  3BG5 A;  2O7O A;  2J5P A;  3K4K A;  1B8I B;  3I3L A;  3V8J A;  3D5S C;  4UHT A;  2R7S A;  4ZYG A;  3GFJ A;  2X6O A;  3OY9 A;  3HZJ A;  1H8A C;  4XON A;  4CH7 A;  1MBG A;  4TV7 A;  5EZG A;  4YEL A;  2FU4 A;  3J7Y J;  5JI6 A;  3KYD B;  2FMY A;  1NG6 A;  2XKP A;  2LYC A;  3PM1 A;  3A2K A;  5EEG A;  3CCU I;  3VSL A;  2BY3 A;  4D9J A;  1P7J A;  3VOD A;  2ZJ2 A;  1R71 A;  1BA5 A;  2LKX A;  1OMI A;  5K5R A;  1IJW C;  2FBK A;  4KMF A;  3B73 A;  1OCP A;  2ZFU A;  1LPQ A;  3PJR A;  4NC8 A;  2QQA A;  3GTM J;  2KDZ A;  1YW8 A;  2JRT A;  2ISY A;  3CZ6 A;  1S3J A;  1JT0 A;  2DOD A;  4L9N A;  1QNT A;  4QTR A;  4IJA A;  1GXP A;  1WI3 A;  4NUB A;  2QEN A;  4PCQ A;  1K7A A;  3E97 A;  2COM A;  1CQT A;  1BW5 A;  1HW5 A;  2E71 A;  2RQP A;  1YIT I;  1V3F A;  1YLF A;  1E17 A;  3JRB A;  2EZI A;  1GXQ A;  3KCC A;  2LDU A;  4DZP A;  4HNT A;  2KRC A;  4HA8 A;  5EG0 B;  3CCM I;  4B43 A;  1BJZ A;  2L4A A;  1OPC A;  2ID3 A;  4XRS A;  2LC2 A;  2ZB9 A;  1MH3 A;  1I5Z A;  5JVT A;  2COB A;  4IZZ A;  4C30 A;  1E3H A;  3ZMS A;  5GPA A;  4PJJ A;  1ZKG A;  2L5Q A;  3FXR A;  2RRE A;  2A6E F;  4CCJ A;  1HKS A;  2JVH A;  4OIQ F;  4ESJ A;  3MZH A;  3WU0 A;  2PLY A;  2KIU A;  1E2X A;  4IL6 C;  2HS5 A;  2Q2E B;  2VT3 A;  1BI1 A;  2X48 A;  3L09 A;  3PSF A;  3RI4 A;  4CZZ A;  2V26 A;  1YTY A;  2PMZ N;  2GA2 A;  4MQV A;  5GTI C;  1WI9 A;  1PUE E;  3PFI A;  2WV0 A;  3JAM K;  2EJR A;  1X4P A;  2Y9Z A;  1ETW A;  1TQM A;  2FSW A;  3WTY C;  5LD2 C;  4RGX A;  2PJR B;  1I1G A;  2DAO A;  2JRM A;  4LB5 A;  1ENH A;  5AON A;  1Z7L A;  2OCC H;  3CLO A;  4FX0 A;  1QVT A;  2KIF A;  3MEX A;  4DYQ A;  1D0Z A;  1YX5 A;  1MMA A;  2LTP A;  3Q9V A;  1K4T A;  3CC7 I;  2QF7 A;  4GGG A;  1APL C;  3JRG A;  1U8R A;  3G3Z A;  3N97 A;  1ZRF A;  1W1W E;  1JHF A;  2XAQ A;  4EJW A;  1JKP C;  2YR2 A;  2IA2 A;  2EIJ H;  3BCA A;  3L2V A;  3N4M A;  5DEQ A;  4CUG A;  2D2W A;  5H20 A;  1DPR A;  3KZZ A;  1MKM A;  1RES A;  1TW2 A;  3OYH A;  3F8B A;  2LNB A;  1DU6 A;  5AIQ A;  2O5R A;  2F5F A;  3E6M A;  1IUF A;  3BTC A;  2NOJ B;  1P92 A;  3FWE A;  2O9L A;  2W84 A;  3PIO F;  4ZYD A;  3OS2 A;  1LVK A;  3OIP A;  3WG9 A;  2EFP A;  1K4S A;  3A0H C;  2ICW G;  1ITY A;  3ZMU A;  1B4A A;  1ZLK A;  1Y0N A;  1XGS A;  3QOE A;  1N25 A;  2EH3 A;  3DTK A;  2Q2E A;  3S1Q J;  4XKV A;  2DQL A;  1AKH A;  3K70 D;  3ZQQ A;  3S2W A;  1LB2 A;  3TKY A;  5ILV A;  1D5Y A;  5FD5 A;  3HUG B;  5CVJ A;  1FIP A;  4LGW A;  5EJC A;  3QPS A;  3KP5 A;  3I71 A;  4EJO A;  3GZ5 A;  2VL8 A;  4BH9 A;  2VQH A;  2M8G X;  5FKO A;  3LAJ A;  2F4I A;  2F48 A;  3NRV A;  1FMW A;  2IXS A;  3RKQ A;  4XRF A;  3TL4 X;  2CQQ A;  1MBF A;  4N0B A;  3ML6 A;  4K2E A;  3S14 J;  1D1C A;  4ENN A;  3GZ6 A;  1G3S A;  1IN8 A;  2WA0 A;  3ROU A;  1UFM A;  4HX8 A;  2K4B A;  2P81 A;  1ETQ A;  4AIH A;  4U87 A;  2WTE A;  4I0A A;  3MAJ A;  2L4M A;  3DCF A;  4HG2 A;  4UVC A;  1ZTR A;  1FTT A;  3LSM A;  5J6X A;  3WHC A;  3L2W A;  4V19 K;  2L9V A;  2QBY A;  3WE3 A;  5EYR A;  1ZR4 A;  2GXB A;  1ACI A;  1D0Y A;  3HKZ A;  2P0W A;  1OLT A;  4CZC A;  2JVG A;  3IKV A;  1U0J A;  5ICE A;  1ZHF A;  3D0S A;  3QYF A;  5FD6 A;  2YS9 A;  5KVR A;  2GA1 A;  3DKY A;  4EJV A;  3K6G A;  2BZT A;  5LEJ A;  1HF0 A;  2GBY A;  2KIS A;  1PVE A;  2DYS H;  2BY1 A;  3EUH A;  3QP6 A;  1B59 A;  2OCE A;  4JK1 X;  1PUF A;  3ABT A;  2FNP A;  5TIS C;  1YRN B;  3SHF A;  1TZL A;  5HLH A;  4BBS J;  3FX3 A;  1G3T A;  1I6X A;  1X1A A;  2DT7 B;  1KU9 A;  3QAH A;  3ZRG A;  3OOU A;  2DMN A;  2TCT A;  2OU2 A;  2R0Q C;  2STW A;  4MTE A;  2IW5 A;  2LSO A;  3FF5 A;  1RRJ A;  5DCF A;  1FY7 A;  3JCU C;  3V4G A;  3HOV J;  3JRI A;  1BR1 A;  2HFH A;  4CIC A;  3T1B A;  3VPR A;  5HDK A;  2VT2 A;  4FX4 A;  1H9T A;  5J1R A;  3F72 A;  1DPU A;  3IL2 A;  4IX7 A;  4N4O B;  2L7K A;  5GPC A;  5E1X A;  3MD2 A;  2XAJ A;  5J47 A;  2UWM A;  1U5T C;  1J9I A;  2V1D A;  5IYC J;  3F6O A;  2PBI A;  1MNE A;  3MKZ A;  1H89 C;  1X19 A;  4YFN F;  4J00 A;  3HRT A;  3SZG A;  2DDA A;  1YS7 A;  4YIR X;  2EV6 A;  4D5F A;  2E36 A;  2O03 A;  3DLL F;  1AOY A;  3S15 J;  4LG3 A;  3RDI A;  5K1Y A;  3H5N A;  3BOQ A;  4PSW A;  3KFW X;  2L3D A;  5LBQ A;  4Q4Z F;  2G0E A;  2HGC A;  4RS8 A;  1OR7 C;  2HOS A;  3J80 K;  3ECH A;  4L9T A;  1RIO H;  1OJL A;  4CCK A;  4HST A;  5CPR B;  1DP7 P;  3HSR A;  1HOM A;  1WJC A;  3OSF A;  4MLO A;  2IS4 A;  3WGG A;  5L3D A;  3QRF F;  3H9G A;  3LQR A;  4LB6 B;  1S7O A;  5ILU A;  4IRI A;  2QQ9 A;  3SZP A;  1YRN A;  5C4J J;  5JFR A;  2K85 A;  2IT0 A;  3IUO A;  3P9I A;  2KJC A;  4E7S A;  3FM3 A;  4I7H A;  2P5L C;  1IN6 A;  4BJ6 C;  4DBR A;  1ZK8 A;  2K86 A;  3MKW B;  2LKS A;  1O7L A;  5F1J A;  2R4G A;  3WTV C;  2Y30 A;  2HPI A;  3HB9 A;  3HGY A;  1R1T A;  3CES A;  3DBR B;  2ESN A;  3RYP A;  1YIJ I;  1IXR C;  5DCM B;  3R6S A;  3K10 A;  2FOK A;  1YJN I;  5D6F A;  2LR8 A;  1CF7 B;  2K3P A;  2M3A A;  2FD5 A;  3IH3 A;  1PJR A;  1U78 A;  4N9H A;  4L5I A;  2VLA A;  2NVU B;  3IP4 B;  2VQL A;  1VQ5 I;  1LKX A;  5HDN A;  1HKT A;  3GFL A;  5FKL A;  1OCR H;  4H0E A;  4E7I A;  1BJA A;  2M4K A;  3GTP J;  2CGP A;  3I5U A;  4V2F A;  5FKN A;  5ERI A;  3KP6 A;  4PJL A; 
#chains in the Genus database with same CATH homology
 1A6I A;  2CU7 A;  4A3L J;  4JYK A;  1WCM J;  4NDL A;  2VKV A;  5IP9 J;  2CUF A;  2AHQ A;  3BQY A;  2DA5 A;  4C3H J;  4HNV A;  2E1O A;  4XID A;  2EZL A;  3S2D J;  4CYC A;  2KT0 A;  2WV1 A;  2DMP A;  1IDY A;  3LSJ A;  3Q0W A;  3ZOB A;  1AU7 A;  3MVP A;  5K7F A;  2HXI A;  1NK3 P;  2EQR A;  3D1N I;  3ZQG A;  2DA6 A;  1ZQ3 P;  2JWT A;  3TW6 A;  4IEJ A;  4X1E A;  2DA2 A;  2R5Z A;  3TED A;  2Y2Z A;  4W1U A;  3WHB A;  2E2J J;  2AO9 A;  1GV5 A;  3CCY A;  2JK3 A;  4B3A A;  3A01 A;  4FE7 A;  2DN0 A;  5F0H A;  1U8B A;  1Z0X A;  4A93 J;  1XS9 A;  1IDZ A;  1F36 A;  1VND A;  3ZQI A;  2M9H A;  5EEA A;  2EBI A;  1TWA J;  3M3Y J;  4MIM A;  1IC8 A;  1MBJ A;  1B8I A;  4B1R A;  1BL0 A;  2HOT A;  5IYB J;  1QPI A;  3HM5 A;  1JJ6 C;  4M3G A;  1EF4 A;  4EEF G;  3NAR A;  2OF7 A;  2YU9 J;  2FX0 A;  1FIA A;  1HCR A;  1JUP A;  3PO2 J;  2DA7 A;  1I50 J;  3HOX J;  4FIS A;  1TWF J;  2XGE A;  2LVS A;  4BBR J;  2WB1 N;  2LP0 A;  3CDL A;  3GBG A;  3I4N J;  1B72 B;  9ANT A;  2NS7 A;  1IGN A;  3DEW A;  2DMT A;  3LSR A;  3C2B A;  5F08 A;  3ZQF A;  3K2A A;  2L9R A;  2DTZ A;  2NVQ J;  2LLK A;  3Q3S A;  4IHX A;  2Y0S N;  2NS8 A;  1HDP A;  1UMQ A;  3TP0 A;  4JX4 A;  5IOY A;  3OIO A;  3CMY A;  1WH7 A;  2RAE A;  3ZQH A;  3K7A J;  2HXO A;  2DA3 A;  5FKM A;  3OSG A;  3HEF A;  2CUE A;  4AUX A;  2HYJ A;  1VFC A;  3LSP A;  5EF6 A;  2R5Z B;  5C4X J;  1WPK A;  2LK2 A;  4RBO A;  1XG1 A;  2CQX A;  3FK6 A;  5EG0 A;  2XPW A;  3A03 A;  5IOZ A;  2JJ7 A;  3A01 B;  2LD5 A;  1P7I A;  2XRL A;  4GFB A;  3GTG J;  4IHW A;  4XIC A;  4IHY A;  1ETO A;  1W0T A;  4B4C A;  1GUU A;  5FJ8 J;  2I10 A;  2JA7 J;  2EZH A;  3HOY J;  4M6V A;  3BG5 A;  2O7O A;  4DW6 A;  1MSE C;  5FKK A;  3FK7 A;  5F27 A;  1B8I B;  2HDD A;  1RKT A;  2X6O A;  2JA5 J;  4I6Z A;  2EZK A;  1H8A C;  5C3E J;  4J19 A;  1MBK A;  1MBG A;  3S16 J;  2N8G A;  1MBE A;  4C2M J;  5EZG A;  4V2G A;  5GP9 A;  1JKO C;  2M0C A;  2JMW A;  3PM1 A;  5EDN A;  2L7F P;  2VKE A;  4BY1 J;  4A3M J;  1P7J A;  2Y9Y A;  5FLV A;  4A3D J;  5DS9 A;  1VI0 A;  2ECB A;  1BA5 A;  2LKX A;  3HGG A;  1IJW C;  2L0K A;  1SAN A;  3NAU A;  4JP0 A;  2FJ1 A;  2E2H J;  1OCP A;  1S7E A;  3RZO J;  4G12 A;  5EGO B;  2VI6 A;  3GTM J;  2KDZ A;  5J3L A;  1I6H J;  1JT0 A;  4A3I J;  2NOG A;  5E3O A;  3G1L A;  4IHV A;  3BR2 A;  4QTR A;  2JA6 J;  1WI3 A;  3BR5 A;  3ZQL A;  4XRS G;  1POG A;  1I3Q J;  1NTC A;  2VPR A;  2ME6 A;  1CQT A;  2K9Q A;  3BG3 A;  1HLV A;  1BW5 A;  2R7Z J;  3JRB A;  2EZI A;  2M2E A;  4DZP A;  4JX5 A;  5EG0 B;  2VUM J;  1BJZ A;  4XRM A;  2ID3 A;  2ELK A;  4DYC A;  4XRS A;  5M5W J;  4A3E J;  1Z77 A;  2ZB9 A;  1MH3 A;  2DMU A;  3HOU J;  2COB A;  1H88 C;  2MW8 A;  1G2H A;  4FCY A;  1FJL A;  1GT0 C;  5GPA A;  1T56 A;  1ZKG A;  5J1U A;  3F0C A;  2NVY J;  2QCO A;  3BR0 A;  3JRD A;  1RPW A;  4FTH A;  2XB0 X;  1WH5 A;  4FE4 A;  4X6A J;  1IRZ A;  1MSF C;  5C44 J;  1K61 A;  2X48 A;  2L7M P;  1ETX A;  1RKW A;  3BQZ A;  3GTJ J;  2PMZ N;  1NK2 P;  3BTL A;  1W0U A;  2Y31 A;  1X2N A;  5EGO A;  4M3B A;  2Y9Z A;  3G1O A;  3B6C A;  2TRT A;  4D5C A;  1ETW A;  2XGD A;  1T33 A;  4MFD A;  4BY7 J;  1UHS A;  2CRG A;  3S1R J;  1ENH A;  3G1M A;  3MN2 A;  1QVT A;  4DYQ A;  2LTP A;  3HDD A;  3BTJ A;  5EZH A;  4A3B J;  2QF7 A;  3Q0V A;  3M4O J;  4JX6 A;  3S1M J;  1APL C;  3JRG A;  3A02 A;  5HOD A;  3LOC A;  1R9T J;  1O4X A;  4A3F J;  1LFU P;  1JKP C;  2MSY A;  1E3O C;  4C3J J;  3UKG A;  2IEK A;  1X58 A;  3Q0U A;  2ECC A;  3TP3 A;  1RES A;  1DU6 A;  1QVU A;  2XGC A;  3S2H J;  1IUF A;  3BTC A;  3JRE A;  2O9L A;  4MO7 A;  1MH4 A;  1JKR C;  2DA4 A;  2H8R A;  5K7H A;  5IYD J;  1ITY A;  3FIS A;  3BG9 A;  2XPU A;  2HI3 A;  4XK4 A;  2EH3 A;  3S1Q J;  3E7L A;  1AKH A;  1Q1V A;  2IAI A;  5DTD A;  2NVT J;  1D5Y A;  3IH2 A;  4RDU A;  1FIP A;  4BXX J;  1JT6 A;  3QPS A;  3BR6 A;  1GVD A;  1TC3 C;  1IG7 A;  2M8G X;  5FKO A;  4A69 C;  2B63 J;  3HOZ J;  4BKX A;  4AC0 A;  3HKZ N;  1QRY A;  3S17 J;  3RKQ A;  1JTX A;  2CQQ A;  3FKI J;  4QSH A;  1MBF A;  5M5X J;  3S14 J;  4M3E A;  3O8H A;  5J1Y A;  1ETV A;  5IP6 A;  2P81 A;  1ETQ A;  3JRC A;  3JRH A;  2LFB A;  3DCF A;  3QPL A;  4UUS B;  1LFB A;  1WGX A;  1ZTR A;  1FTT A;  4A3J J;  3BR1 A;  3SFI A;  3WHC A;  5E3N A;  1BW6 A;  2H1K A;  2IBD A;  3BT9 A;  1FTZ A;  5EYR A;  1ZR4 A;  3H3V K;  3JR9 A;  1AHD P;  1FEX A;  2R5Y B;  1HF0 A;  2YS9 A;  2E2I J;  4A3C J;  2X9D A;  2FQ4 A;  2GBY A;  5BNG A;  1OCT C;  2R93 J;  1X2M A;  1A5J A;  4I76 A;  1JTY A;  2M34 A;  5M3F J;  3S1N J;  2E19 A;  2ME0 A;  1PUF A;  3BTI A;  1JJ8 C;  1SFO J;  1YRN B;  4BBS J;  3OOU A;  2DMN A;  2TCT A;  2W48 A;  3SJM A;  2R0Q C;  5FLM J;  1ORK A;  2OPT A;  2XB5 A;  1UG2 A;  1VF9 A;  1GV2 A;  2LY9 A;  3TW7 A;  4S0H B;  3LNQ A;  3LSG A;  2K40 A;  3FIW A;  1AKH B;  3HOV J;  4C3I J;  3JRI A;  2MGQ A;  5IPA A;  3VPR A;  5E3L A;  3O8G A;  3JRA A;  5J1R A;  5JLX A;  1Y1V J;  4UUT A;  5GPC A;  1K83 J;  2O8K A;  4D7M A;  2ID6 A;  2HQ5 A;  3MKL A;  3GTL J;  5IYC J;  3HOW J;  1H89 C;  5F04 A;  4UUS A;  1GDT A;  1LE8 B;  3IV5 A;  1RET A;  1RR7 A;  4QIW N;  4D5F A;  3QQA A;  3S15 J;  4A3K J;  2DJN A;  1U9O A;  2G0E A;  2R92 J;  4MFE A;  3ZQC A;  2HOS A;  4DZJ A;  1OJL A;  1TWH J;  2R5Y A;  3W6V A;  3CQZ J;  3RQI A;  2HOA A;  3JRF A;  1HOM A;  1JKQ C;  4CYC B;  5M3M J;  3OSF A;  4MLO A;  2K9S A;  5F0C A;  4DYR A;  2DMQ A;  2YUS A;  1YRN A;  2XSD C;  1HDD C;  3H0G J;  3RZD J;  5C4J J;  1MBH A;  3L1P A;  1ZR2 A;  2L7Z A;  1F43 A;  1ETY A;  4L5E A;  2WAQ N;  1PUF B;  3PO3 J;  4W97 A;  1JUS A;  1ZK8 A;  3GTK J;  2GLO A;  5M5Y J;  2XPV A;  5K7Z A;  3BR3 A;  4D7N A;  1TWG J;  5F1J A;  2Y30 A;  1MNM C;  1XC5 A;  4M3F A;  1U9N A;  1OFC X;  3HGY A;  3B6A A;  3HB9 A;  4AYB N;  4Y7N J;  1JUM A;  2LR8 A;  5IP7 J;  1Y1W J;  2K9N A;  4LOC A;  1IV6 A;  2FD5 A;  3SDG A;  3IH3 A;  5E3M A;  1U78 A;  1ZGW A;  1ETK A;  1DU0 A;  2D5V A;  1TWC J;  2JA8 J;  5F0F A;  2MG4 A;  5FKL A;  2CJJ A;  3HBL A;  3GTP J;  2DA1 A;  4M3D A;  1JGG A;  2JN6 A;  5JLW A;  1LE8 A;  4V2F A;  1B72 A;  5FKN A;  4ABZ A;  2GM4 A;  3GTQ J;  4A3G J;  2NVX J;  3I4M J;  4Y52 J;  3IH4 A;  3GTO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...