2E1OA

Solution structure of rsgi ruh-028, a homeobox domain from human cdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein PRH
publication title Solution structure of RSGI RUH-028, a homeobox domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e1oA01
3HGYA 3UKGA 2HXOA 2D5VA 3JRFA 2HDDA 5EGOB 1GT0C 3FKIJ 2NVYJ 4IHYA 3O8GA 5GP9A 1WI3A 3O8HA 4AYBN 1ETYA 1VI0A 3QPSA 4C3IJ 2L7MP 4UUTA 1WH7A 2M34A 2LR8A 2E19A 1U9OA 3HBLA 5JLWA 3IH3A 3TP0A 5DTDA 1B72A 2DMTA 2O9LA 3BG3A 4JX4A 1Y1VJ 3S1MJ 5GPCA 4JX6A 2I10A 1QVUA 3MKLA 3HOXJ 5F0FA 4QSHA 5F04A 3S1QJ 2R5ZB 2EZHA 1X2MA 2XPUA 5HODA 1IG7A 3H0GJ 2K40A 3LSPA 1SFOJ 3BR5A 5IP7J 1HF0A 1AHDP 1A6IA 3Q0WA 1DU6A 5EZGA 1ZQ3P 4FISA 1MBGA 1BA5A 4JX5A 2XSDC 1XG1A 3RZOJ 1GUUA 4NDLA 2CRGA 2WV1A 4W97A 3HB9A 3QPLA 1AU7A 4FE7A 1WGXA 3PO2J 4AC0A 1SANA 2K9SA 2MGQA 4B1RA 5K7HA 1B8IA 2LLKA 2NS7A 3L1PA 3TEDA 3SFIA 2NVQJ 1JT0A 2E1OA 2QCOA 2XB5A 1YRNB 1NTCA 4XK4A 4S0HB 4A69C 5EF6A 3S2HJ 2YS9A 3BR3A 2LKXA 4A3LJ 4CYCA 5IPAA 3ZQLA 1H89C 3F0CA 2HOAA 2ID3A 2EZLA 4A3FJ 3HOUJ 1I3QJ 1UMQA 3BTLA 5IYCJ 4C3JJ 2R93J 2ZB9A 2DTZA 1VNDA 3SDGA 2DA4A 4EEFG 1IV6A 2JA6J 1X2NA 4A3BJ 3NARA 3GTPJ 1ZKGA 2HOTA 4DZJA 5F0HA 5M3MJ 5IYBJ 3E7LA 1FIAA 2DMUA 1MSEC 3LSRA 1JTXA 1QPIA 4J19A 2X48A 2EZKA 4M3FA 2G0EA 3WHBA 2B63J 4HNVA 2X6OA 2DA6A 3JRDA 2JMWA 2NOGA 2TCTA 1APLC 3HOZJ 3JRCA 2R7ZJ 1MBHA 3WHCA 3CCYA 1UG2A 5EDNA 1JGGA 2IEKA 2XPWA 3JRBA 1JT6A 3BR0A 1U8BA 1TWGJ 1U9NA 2K9QA 3BTJA 4DYCA 5FKLA 2Y9YA 5C44J 3JRIA 3S17J 3GTKJ 4Y7NJ 1D5YA 2XGDA 1Z0XA 1WCMJ 2FD5A 3I4MJ 3S2DJ 1FEXA 5C3EJ 4D5FA 5M5XJ 1TC3C 4D5CA 3IV5A 2XB0X 3FISA 5K7ZA 3S15J 1R9TJ 2VKEA 3G1OA 4QTRA 4Y52J 3W6VA 1TWHJ 2M2EA 4MFEA 2IAIA 2R5YB 2KT0A 2Y2ZA 1JUMA 5IOZA 1MSFC 2JN6A 2N8GA 1RR7A 1NK2P 5IP6A 3M3YJ 1ZR2A 2XPVA 5FLMJ 5M5YJ 4XIDA 2LY9A 4LOCA 5GPAA 3K7AJ 1ZR4A 1JKPC 2MW8A 1ETQA 1ZTRA 2QF7A 4IEJA 5FKOA 1K83J 5J3LA 3GTGJ 2JA7J 1RPWA 1T33A 2ME0A 1MBEA 3BG9A 1AKHA 1JUPA 3CDLA 4M3DA 3OIOA 4C3HJ 1ETXA 4UUSB 2TRTA 3LSJA 1MNMC 4I76A 2Y30A 1JKOC 4ABZA 1MBFA 2Y0SN 4I6ZA 2DA3A 2LK2A 1HDDC 1MBKA 3BQZA 3JRGA 5FLVA 3BR1A 2HYJA 3RQIA 2DA5A 1OCPA 2L7FP 2X9DA 3RKQA 1MH3A 2AO9A 5M5WJ 1HLVA 4W1UA 2RAEA 3S14J 1P7JA 3HOVJ 3Q3SA 4M3GA 3HGGA 1BW6A 5J1UA 5EGOA 2EBIA 2WAQN 4MO7A 4GFBA 1LE8B 1EF4A 2PMZN 1UHSA 3HOWJ 1JKQC 9ANTA 5F08A 2HQ5A 2ME6A 1RKTA 4QIWN 4IHXA 3MN2A 3VPRA 3BTCA 4G12A 2GBYA 1POGA 5E3LA 3G1LA 2LTPA 2JK3A 5F0CA 1H88C 1JUSA 1IC8A 1GVDA 4RDUA 3BR2A 1IGNA 3BG5A 3M4OJ 2ID6A 2LVSA 3TW7A 3HEFA 4BBSJ 1Q1VA 3BT9A 2R5ZA 1G2HA 1ITYA 3MVPA 3ZOBA 5EG0A 1JJ8C 1GDTA 2EZIA 1W0UA 3PM1A 2H8RA 2OPTA 3C2BA 4A3EJ 2DA2A 4A3DJ 1B72B 1Z77A 1RKWA 3K2AA 1FTZA 4A3KJ 2EH3A 3ZQHA 3FK6A 3SJMA 1W0TA 5EYRA 2O7OA 4A3IJ 3GTLJ 1TWCJ 5E3NA 2P81A 2CQXA 4DW6A 1XS9A 4M6VA 4A3MJ 1OFCX 2L7ZA 2JJ7A 2VI6A 2M9HA 5F27A 2DN0A 2LFBA 3OSGA 4A3JJ 1GV5A 2Y9ZA 3HKZN 2FQ4A 4V2GA 3IH2A 4A93J 3B6AA 1YRNA 2WB1N 2DA7A 3Q0VA 3A01A 4BY7J 3HOYJ 2ELKA 5FJ8J 2LP0A 4JYKA 3B6CA 1VF9A 2FJ1A 5K7FA 1HDPA 2EQRA 1HCRA 4XRSG 2YUSA 1B8IB 2JA8J 3JREA 1Y1WJ 1LFBA 3HDDA 2VUMJ 2CU7A 4BKXA 2DMPA 1FIPA 4B4CA 2W48A 2Y31A 5E3OA 1JJ6C 3FK7A 2GM4A 5E3MA 5BNGA 1I6HJ 4CYCB 3RZDJ 2VKVA 3IH4A 5J1YA 3D1NI 2COBA 2KDZA 5IP9J 4DZPA 2R0QC 2L0KA 1OJLA 1PUFA 1BW5A 2VPRA 3A03A 3JR9A 2NS8A 5FKKA 5IOYA 1U78A 3TP3A 3S16J 4FCYA 1O4XA 1F36A 4D7MA 5FKNA 2HI3A 5FKMA 1IDZA 2XGCA 3I4NJ 2NVXJ 1TWFJ 1RETA 3Q0UA 5M3FJ 4A3GJ 1VFCA 4DYQA 3BQYA 2CQQA 4BXXJ 3CMYA 5EG0B 2MG4A 3ZQIA 1ETOA 1OCTC 3A02A 3DCFA 1DU0A 4XRSA 5JLXA 1GV2A 1ENHA 1I50J 3S1RJ 4MIMA 2L9RA 3OSFA 3GTMJ 3TW6A 4FE4A 4IHWA 4MFDA 2HXIA 1JTYA 2DA1A 2FX0A 2MSYA 4BBRJ 2R5YA 2ECBA 4IHVA 2K9NA 2IBDA 4MLOA 1RESA 1ETVA 1WPKA 2CUFA 3S1NJ 1HOMA 5J1RA 4XRMA 3G1MA 3LNQA 1ZGWA 2M8GX 1FTTA 3QQAA 1QRYA 3A01B 3H3VK 1ORKA 3LOCA 3ZQCA 1IUFA 1S7EA 4M3BA 3LSGA 1P7IA 3FIWA 2LD5A 1BL0A 5IYDJ 1IJWC 1FJLA 5F1JA 2E2HJ 1MBJA 3OOUA 2DJNA 1TWAJ 1T56A 2AHQA 1X58A 5EEAA 2CJJA 1ETWA 1CQTA 1LFUP 4UUSA 1BJZA 4RBOA 4BY1J 1JKRC 2GLOA 4AUXA 4JP0A 2DMNA 5EZHA 1IRZA 2JA5J 3BTIA 2E2JJ 4DYRA 2CUEA 3ZQFA 3GTJJ 1QVTA 3BR6A 3GTOJ 1H8AC 3CQZJ 3HM5A 2JWTA 1A5JA 1ETKA 4C2MJ 1AKHB 1PUFB 3JRAA 1F43A 2NVTJ 2H1KA 4X1EA 1E3OC 2M0CA 3JRHA 2ECCA 4V2FA 2HOSA 2E2IJ 2DMQA 1NK3P 5C4XJ 2R92J 2OF7A 1WH5A 4A3CJ 1LE8A 5DS9A 3NAUA 3ZQGA 1K61A 2O8KA 1MH4A 4FTHA 2XRLA 2YU9J 3DEWA 4XICA 3PO3J 1XC5A 3GTQJ 4B3AA 3GBGA 4X6AJ 2XGEA 1IDYA 5C4JJ 1ZK8A 4D7NA 4L5EA 4M3EA
chains in the Genus database with same CATH superfamily
3HGYA 2VOOA 4BYYA 3JRFA 1YG2A 5JVTA 5EGOB 1GT0C 3FKIJ 1OPCA 1Z3YA 3MD2A 3OYIA 3FBIB 5DCFA 1WI3A 3I55I 2P7CB 1KYZA 2NRAC 1VI0A 1L0OC 4LG0B 4M9ZA 1I39A 4G6TB 4GGGA 2E19A 3OS2A 1XX5A 3TP0A 1VQ8I 3CCJI 1LKXA 2V1DA 2VASA 4K2EA 2DMTA 3WODF 4JX4A 1LJ9A 4YG2F 2MD0A 3BPXA 3CCSI 2CV0A 1QVUA 3HOXJ 4NQWA 1FBQA 5BMZA 3S1QJ 1G3WA 2H6CA 3HOTA 2DT7B 3FWEA 2CH0A 1MMDA 1IG7A 3BCAA 1HA8A 4U0WA 1W5CC 3Q0WA 2KJBA 5EZGA 1XCBA 1MBGA 4FISA 4R1HA 4BHBA 1H9TA 4JX5A 4AM3A 1IW7F 1MW7A 4IL6C 3RZOJ 1GUUA 1BR2A 3ZP5A 2CRGA 2WV1A 3EPZA 1Y56A 1AU7A 2DOEA 3T8RA 4HF1A 3IKTA 1WZ2A 3FMQA 5B1BH 1SANA 5E1XA 2Z3YA 3KYDB 5K7HA 3HIFA 2LF8A 1ZGAA 4ZDOA 2NS7A 3CCRI 4LJZF 1RUNA 2NVQJ 2VXDA 2GAUA 5CQGA 1NTCA 4UV8A 4XK4A 3LA2A 4XONA 1YX5A 3A1YA 3OR2C 1Z9CA 3S2HJ 3HSEA 3E5QA 2LKXA 4LFUA 4RLQA 5E20A 2F5CA 1IRGA 5J40A 2QUFA 2X1DA 3O2PE 4CICA 3F22A 3ZQLA 1D1CA 4Y13A 1WQ2A 2MH9A 3F0CA 1YE9A 2HOAA 1P92A 3BJ6A 2DPUA 5ICCA 2VL8A 2O8XA 1I3QJ 1USSA 3PSIA 4LD5A 1I5ZA 2BOLA 2DTZA 2JA6J 1U6GA 2LSOA 4HLXA 3BWGA 1HC8A 3M8JA 1JHFA 5DYMA 5M3MJ 3G4SI 3COAC 1LVAA 1FIAA 4WCGA 1XGSA 4G7HF 1NHAA 5FD5A 1JTXA 1QPIA 5LFAA 4M74A 3K4CA 2W57A 2LC2A 3FHNA 2EZKA 3AL0B 3IWZA 1N78A 3HUGA 1R7JA 4NB5A 2X6OA 2EB7A 1GXPA 5BS6A 2QSHX 3I56I 5DCMB 3W2VA 2R7ZJ 2BYVE 5H6QA 2LOOA 3CCYA 4WXDA 1IV8A 2R3SA 3ABTA 4CCJA 4PFOA 3JRBA 2KIMA 5LEJA 3BR0A 1Y6IA 2K9QA 4EJWA 2XRNA 3G2BA 3ZMDA 1UZCA 3R0JA 2G9WA 1D5YA 2ZJPF 3DBRB 2QBYB 2XGDA 1YTYA 4BHPA 4II2A 3A0BC 2ZCWA 2C6YA 5EEHA 4LLGF 3RIRA 1IRXA 2DFHA 5D6FA 3GZ6A 2DODA 4XKCA 1TC3C 4D5CA 4EVIA 3FISA 4KYWA 1R9TJ 2FOKA 1BR1A 4Y52J 1TZLA 4C30A 1S29A 1JUMA 2OQRA 5IOZA 2LNBA 3OYMA 4IX7A 2MH2A 3KX2A 3I59B 1RR7A 1NK2P 3SHFA 5IP6A 1Z67A 2EV0A 2DYSH 3MKWB 2OUMA 3S3MA 2BGCA 5FLMJ 5M5YJ 3QPTA 4LOCA 5GPAA 4HPQA 5FROA 2DT5A 3RPQA 1FPQA 4AWXB 1BIBA 3H3ZA 2W00A 5HLGA 1W5TA 1ODDA 2CG4A 3S3NA 5BPDA 2Z16A 3PUFA 2L7KA 3M07A 3VFZA 3K4LA 3K4NA 5FKOA 1K83J 2ZMEA 5J3LA 3GTGJ 2IXSA 4HQMA 1B6AA 3RPUA 3JCUC 2H6BA 2MC3A 3CDLA 3OIOA 2VQLA 4N4NB 3M9AA 4NC7A 1QNTA 3QWLA 4EM2A 3RJPA 2Y0SN 4I6ZA 2XAJA 4U7BA 4LLNA 2DA3A 2OTLI 4O5VA 2HVSA 3DXJF 2AQEA 2LK2A 5FLXZ 1LEAA 4OIRF 1HKQA 1MBKA 4H4KC 3SDBA 3JRGA 3FXKA 3BR1A 5FLVA 4F55A 4DQ2A 4IO9F 2DDAA 3HTSB 4HBLA 2DA5A 3PNTA 3PNVA 3VSKA 2H8WA 4EJVA 4BGDA 2AO9A 2IJLA 1XGMA 3NEUA 5K5RA 1ZRDA 4ZDLA 4B48A 4ENKA 3CZ6A 3OL4A 4J01A 3DU5A 1Z21A 1ERDA 3BLYA 3GUDA 3ECOA 2EBIA 1F4KA 1FY7A 1TQIA 2WC2A 1LE8B 1EF4A 2A3SA 1YJNI 1SD4A 2CS3A 5J4YA 1JKQC 3PJRA 2NOJB 1HBXG 2Y75A 2QKMB 4G12A 3F23A 1ZRFA 1POGA 3CMMA 3G1LA 4HA8A 4LG3A 2LTPA 4PFPA 5DD4A 3HC7A 3MZ8A 3S2WA 2GWRA 1GVDA 1OCRH 2QQ8A 5KAFC 4YFKF 5HOOA 2ESHA 1R00A 2RN7A 1OYWA 3MZYA 3M4OJ 1V54H 5E8GA 4LITA 3HXLA 1NH3A 5D6EA 4BBSJ 2CSOA 2R5ZA 1G2HA 4G94A 3H92A 4LMYA 4CHUA 1JJ8C 3OYKA 3ESWB 5JVGF 1GDTA 3WGGA 1D3YA 2K27A 5ICFA 4N9IA 5LD2C 1YJ9I 2L5QA 2E60A 2VKDA 2GIZA 4F92B 1FTZA 5FLXK 2EH3A 3FM5A 3FK6A 4G9YA 1Y8QB 1R5HA 2CWEA 2OCCH 2BHYA 5EYRA 3GTLJ 2R7VA 2E7WA 1R1TA 3KIOA 5E3NA 2CQXA 2XF5A 5F64A 2XKOA 4M6VA 5D8LB 5GAGJ 1XS9A 1J0RA 2JJ7A 1E3HA 1MNDA 2K5CA 1MGTA 3QAHA 4QLCU 2VQHA 4MEXF 2LBFB 1MMAA 3B6AA 2WB1N 1F5TA 4CXFA 3FF5A 4F52A 4PGGA 4QWQA 2VJ4A 5H6RA 5GTIC 1BI1A 4BEHB 4BACA 1FZPB 3A2KA 1MD0A 3GZNB 4Z2YA 4ESFA 4HSTA 5FJ8J 2J5OA 3ERED 3RKWA 4DBRA 3B6CA 2Z99A 2FJ1A 2XVCA 3JSPA 5D5UB 2RNJA 1HW5A 4R79A 3L09A 2EQRA 2BXZA 1O3RA 4DOZA 2VB6A 1K4TA 2XUBA 1B8IB 2W25A 1LFBA 3NWSA 3HDDA 4BKXA 4ENJA 2DMPA 2W48A 3L2WA 1FBUA 5E3MA 3WG9A 2JPCA 2COBA 2KDZA 3U9GA 1WI9A 1S72I 4XLFA 4UXNA 2FMLA 3LSTA 3IRRA 4A12A 3A03A 2V79A 5FKKA 5IOYA 1WJDA 1R23A 3S16J 5CVIA 1O4XA 2RQPA 4D7MA 5HS8A 2CW7A 1O3SA 3I4NJ 2EA4A 1RETA 5D4SA 3HRTA 2HOEA 5DUIA 2WV0A 3V4GA 1A31A 4DYQA 5D5VB 2F2EA 3DFGA 4UNOA 3GW2A 5BOXA 4Q47A 3WU2C 4DNCA 1ETOA 2RREA 3DU6A 4B44A 1F1ZA 4E7JA 2W7NA 3UR3C 3OYNA 1GV2A 4MQVA 3S1RJ 4C2UA 4UVAA 2XAFA 4GYIA 3GTMJ 2ZO4A 2CUZA 1O57A 3EUHA 4MNUA 4IHWA 2HYFA 4MFDA 2H09A 2DFFA 2R5YA 2JSCA 4BDYA 4IHVA 1G4DA 2ZXWH 1ETVA 1WPKA 2F6CA 5DM6F 1ON1A 1TQPA 1HOMA 3PQKA 2HFHA 3A01B 3BZKA 3H5NA 2BY3A 2O0YA 3CMAI 1BBYA 4HYEA 4NC6A 4HNUA 1P7IA 3FIWA 4BJ6C 3KP3A 1W7PD 1O7FA 1IJWC 2V9VA 1C0WA 4LIVA 3DWLE 5B3SH 3OOUA 3V42A 1TWAJ 4B43A 1CF7A 2IS6A 2EV5A 4KIBA 4IPAA 1SD5A 1X58A 3OYGA 3P5JA 2KPMA 5D4RA 2ZSHB 1ETWA 3N4MA 3A0HC 1IAWA 2A6HF 1W4MA 4RBOA 3DQVC 2KRHA 2GLOA 2KJCA 1IRZA 2JA5J 3FMSA 2E2JJ 2AXTC 1YI2I 3VWBA 4PJMA 4XSZF 4DYRA 2VC1A 1O7LA 3CJTB 1DUXC 3FM3A 4LB5A 3DPLC 2RV8A 3V7RA 5LEKA 3H0DA 3CCLI 3GEZA 1FMVA 4AIJA 4BQNA 4C2MJ 4UY8I 2B7EA 1PUFB 1R49A 5HS9A 2ISZA 3AL0C 1E3OC 3JRHA 1OISA 5H20A 2NVUB 4BS9A 2E2IJ 2HPMA 1WH5A 2L54A 3DKXA 2BXYA 3NAUA 3ZQGA 4I99C 2XRLA 1TW3A 3DKWA 1QGPA 3AG2H 2ELJA 3OIPA 3F9KA 2IVMA 2NS0A 4UVCA 4AIHA 4Q48A 1H0MA 3MQ0A 3G73A 4X6AJ 3I58A 1ZK8A 4KFCA 3ASNH 4L5EA 4ZYAA 1TNSA 4B3XA 4M3EA 4IKFA 1SAXA 3KP7A 4BQAA 1SFKA 2D5VA 4XN3A 4WK8F 2HZTA 3OYEA 5CKTA 2R7QA 1ZG1A 2CV2A 2XKPA 1IN4A 2Q2EB 3ISPA 3T5XA 4I0BA 1SFUA 3L2CA 3QPSA 2L7MP 1WH7A 1PP8F 1MMGA 2IPQX 3SFZA 3Q5FA 2IT0A 3WTWC 1TNTA 4PSXA 4IOCF 3LWFA 3BG3A 3SQNA 2JVHA 3PSFA 1FOXA 4NUBA 5GPCA 4JX6A 2CQKA 2Z2SB 4HX7A 3SXYA 4QSHA 2VBZA 3EDPA 5LGTA 1T6SA 4V19K 5F04A 3V8LA 2L01A 2EZHA 3KE2A 2LH9A 3J7AO 4UB8C 3OL3A 1JHHA 3DV8A 2K40A 1HF0A 2GA2A 2KKOA 2DAOA 3F6OA 1V5GA 3VSLA 3KZZA 2OJED 2DI3A 4MHGA 3DBHB 1D5VA 4NDLA 4WWCA 4W97A 1N77A 3QPLA 1GLNA 1V5EA 2K9SA 4AC0A 4HV6A 1YLFA 2M0MA 2JRTA 4CCLA 4BH9A 3E0JB 4XM3A 3WU0A 1ZREA 2MLGA 2QCOA 1YRNB 4IRIA 3GYHX 2JVGA 1XDUA 2VBWA 2L2OA 4A69C 2WY7Q 1BI2A 3ZCOA 3LSIA 1SFXA 4D1QA 3CF2A 2VT3A 4E7LA 5K1YA 4A3LJ 4CYCA 1MZBA 3V7SA 4ZYGA 2XDVA 1H89C 1BI3A 1R71A 2CYYA 1DGRM 2E71A 2VQCA 2ID3A 2IA0A 2VIXA 3Q9VA 5GAHJ 3WTXC 1A36A 4L9TA 3ABKH 4C3JJ 1WJCA 2R93J 2P4WA 1VQ9I 2DA4A 1IV6A 3NARA 4AYBA 3GTPJ 5KNLA 2D2WA 2F4IA 4ZZDA 3OYHA 2Z33A 1QA6A 1D0ZA 3H35A 5IYBJ 4CA0A 3G6EI 4JK1X 2DMUA 3ZMTA 3RYPA 1MSEC 3LSRA 2FQ3A 4J19A 2X48A 3H36A 1U5TA 2KZGA 4BU2A 2YX4A 4M3FA 4CGZA 2B63J 2LF7A 4HNVA 2LMDA 3JRDA 2BW3B 1FSHA 3WE3A 3GF2A 5JHUA 2JMWA 1CGPA 2TCTA 1APLC 3QP5A 3HOZJ 1X3WB 4EGZA 2IS2A 3AG1H 2ZFWA 1MBHA 3CUQA 3ASOH 1TT5B 2ZNZA 1JGGA 3PFYA 1KQ8A 3CC7I 1U8BA 2KQRA 3IP4B 1U9NA 4IHTA 4NQWB 2L9VA 2Y9YA 3LAJA 4F7ZA 1HSTA 4NC8A 4AIKA 4ENMA 1Z0XA 5E1WA 3ELKA 1MIJA 3S2DJ 1FEXA 3CTAA 4FETA 4ZYDA 2COMA 5DUKA 3TDUC 3TO6A 3IV5A 4RM2A 3R6SA 2WBMA 2MC4A 5K7ZA 5FFXA 3K70D 3D5LA 3JAMZ 1W7PA 4QTRA 3GVAA 2BVMA 3DLAA 5DV5A 3T8TA 2KT0A 2V9PA 4BQQA 1NG7A 4AD9A 4PSWA 2OU2A 3TL4X 4P9FA 2MLKA 4P9UA 5KK1A 1HKTA 3K0LA 4ESJA 2E34A 2XPVA 1GHCA 1QZYA 4XIDA 2LY9A 2CMPA 4BE0A 1U0JA 2XSJC 3N05A 1ZR4A 4EATA 4OOIA 3KPHA 3RKYA 4KMFA 1ETQA 4HW0A 2JSPA 2KZVA 2BV6A 1ZAOA 1T95A 4IEJA 4CDGA 4G8XA 2JA7J 3M8FA 1RPWA 4LK0F 5IY5H 2ME0A 3JSOA 1K4SA 4FX0A 4MTDA 4A0XA 3GFMA 2VE8A 4ZTJA 4U0YA 2R7FA 4I76A 1FT9A 4LB6B 2Y30A 2VJJA 4UB6C 5J8CA 2LRDA 1FWZA 4RS8A 4RGXA 4BUPA 4HRIA 2VONA 3DP7A 3VYRB 4E7IA 4RAFA 2IGNA 4RB2C 2IS4A 4FQGA 3ZR8X 3HUGB 4XKWA 5LGUA 2CGPA 5JI6A 3V7CA 4KDPA 3KZIC 3U1KA 1Y0UA 4W1UA 5LRSA 3DBLB 1JI8A 3JAMK 3WU1B 3HOVJ 1LPQA 3K1PA 1XD7A 2ELHA 2QA4I 3RCOA 5EGOA 4MO7A 1RI7A 3H5RA 3LQQA 2Q8KA 5J4VA 3CP2A 4RB1A 5CVVA 2PMZN 3P9KA 2HEOA 4ETSA 1UHSA 2D1HA 3BP8A 4UUVA 9ANTA 1R5GA 2HQ5A 2OZUA 1RKTA 2EFNA 3DLLF 2Z9OA 2XF7A 5A2QZ 1KU2A 1TTYA 1UAAA 2JQ7A 1WJFA 2EJRA 4PK4A 3MN2A 3TMOA 2GBYA 1VQ4I 5E3LA 2ZBKA 2PI0A 1SD7A 1Z3XA 2M4GA 5F0CA 3RQ4A 1H88C 3V8JA 2HGCA 1IC8A 5D5XB 2QSGX 5ERIA 1DPUA 4G6DA 4PJJA 3D0SA 1MKMA 1SD6A 2LVSA 3TW7A 1X1CA 1Q1VA 2EWNA 5GTHC 5EG0A 2QQ9A 1YS6A 3FXUA 5DDGA 2UWMA 4BQOA 2RQQA 4CUGA 3PM1A 5TRDA 2FBKA 1Q1HA 4A3DJ 3KZYA 4XSXF 1Z77A 5J8FA 3K2AA 1B72B 4IF4A 3ZQHA 3SJMA 2ISYA 4A3IJ 4S04A 2KRFA 2NXNB 3C1DA 3HG9A 2V26A 3K1NA 1GXQA 4KNYA 3F6VA 2VI6A 3LFUA 2M9HA 3SYTA 2DN0A 2HDWA 4XLNF 3OSGA 3MMYB 2FQ4A 4HQEA 1R1UA 3ROUA 4A93J 2Z1DA 4Y4RA 5ED4A 1O3TA 3ZN1A 4HZFA 3HOYJ 3BCBA 2LYCA 3NQOA 4I01A 1KU9A 3I71A 2VBXA 2WWYA 4N9HA 2P8TA 4RGRA 1VF9A 1D0YA 5K7FA 3AAFA 5D8KB 2DDBA 5A2QK 3OR1C 3J7YJ 1HDPA 3H9GA 1HCRA 4YELA 3BDDA 1BC7C 2X6YA 1Y1WJ 3PIOF 3BY6A 2VUMJ 2CU7A 1G8XA 1FIPA 2RNGA 1YIOA 1FOWA 2YU3A 2LY2A 2M5WA 3M1CA 2F5VA 2K02A 2GM4A 5BNGA 1I6HJ 2DTRA 2ZC2A 3M1EA 3L2RA 3HSRA 1Z6TA 4QPOA 2HS5A 1J2XA 3D1NI 1K6OA 1R36A 4M9SA 2HTSA 3FHZA 2FMYA 2XF6A 1T39A 3VEPA 3WTSC 5DCMA 2R0QC 2W24A 1YHQI 1OJLA 2D45A 3GX4X 2VPRA 1WFXA 1MDMA 2ZJ2A 4IZZA 3TP3A 2R7RA 4FCYA 1KGSA 1KU3A 5IT9Z 3BZCA 1HQCA 5FKNA 1IO2A 5FKMA 1IDZA 3H3UA 3P7NA 3MKZA 3BOQA 4L9VA 1S8NA 2I8DA 5LRRA 2F5EA 1R1VA 1TBXA 2V7FA 3BQYA 4BXUA 5KAIC 5L3CA 2IA2A 2KP6A 2MG4A 2PN6A 1SMTA 1OR7C 3LMMA 5TJJA 3R0AA 5D5WB 3A02A 1E3PA 1V3FA 2TDXA 1I50J 4MIMA 3FXMA 1K79A 1LDKB 3FMRA 4FASD 3QPHA 2R7UA 1XCVA 1D8JA 2NAZA 2HXIA 4BBRJ 2DA1A 2MSYA 4LK1F 3IRQA 3TBIA 2ECBA 2IGMA 2K9NA 2M8EA 1RESA 4HG2A 3S1NJ 1SAUA 3I59A 5J1RA 4WXHA 3FXRA 4XRMA 3LNQA 4FX4A 3K1MA 4G6QA 1OCCH 4CCOA 1VQOI 2BY0A 1BR4A 1FTTA 1JXSA 1T2KA 1ORKA 2G7HA 1IUFA 1S7EA 4F3QA 1PDNC 3K10A 1BL0A 3WTUC 4L5JA 2R7DA 5KHDA 1FJLA 2E2HJ 3MFKA 3GCMA 1S7AA 1WHUA 5CVJA 4ZZLA 1OCZH 1T56A 1JE8A 3TOAA 2CJJA 5IT9K 2ZNYA 1CQTA 1TQMA 3NWTA 1LFUP 2BE5F 1BJZA 1M1EB 2CQ7A 3CLOA 4JP0A 2IA1A 2EILH 1G59A 3C18A 4N0BA 2I5UA 5DEQA 3VYSB 1YW7A 2PMUA 3CQZJ 3HM5A 5JFRA 1VQNI 4MEYF 4AU7A 1AKHB 3MCZA 4M6YA 1F43A 4RM3A 2PJRA 3QU6A 2WY8Q 4X1EA 1XTAA 2M0CA 3QOEA 2HOSA 2DQLA 2DMQA 3QU3A 2E1NA 2R92J 2AXLA 2L02A 3K4MA 1LE8A 4NNJA 1BM9A 1YITI 3KLOA 5LHGA 4KA4A 4FTHA 3DEWA 4GXOA 2E36A 3WTYC 3H1CA 2VT2A 3JW4A 4BJTA 3GTQJ 4S05A 2X85A 1ZG3A 5GAEJ 5C4JJ 4D7NA 3CCUI 2GIVA 3PIPF 4OMZA 5L3DA 5DD8A 3CC4I 2X6WA 4QPQA 4B8XA 2WAFA 3OYJA 2HXOA 2HDDA 4G7ZF 1X4OA 3PFIA 5ICGA 2PQ8A 2NVYJ 2ETHA 4P5OA 2XASA 3LSKA 4IHYA 5GP9A 1N75A 2K4JA 2CFOA 1BOBA 4AYBN 3SZPA 4OIOF 3QYFA 2W4SA 4OIQF 2JUCA 2M34A 2LR8A 3ZMSA 1YIJI 3WE2A 5JLWA 3IH3A 4CZCA 2ZXIA 1QPMA 2O9LA 3WGIA 1Y1VJ 1IN5A 2O5RA 1Z6RA 3MKLA 4UV9A 4DBQA 1X4PA 3FXJA 1WKMA 3GXOA 1MJ9A 1WWXA 2DPDA 1LFPA 2XPUA 5HODA 1CF7B 5AIQA 1A35A 1I27A 2RVCA 3LSPA 3O3KA 1XGOA 3BR5A 2LBFA 5IP7J 1SFOJ 1A6IA 2L9NA 2KFDA 3R61A 4BEHA 1DU6A 3IAS2 1BA5A 1RIOH 2XSDC 4IJAA 4PGHA 1XG1A 3SEQA 2DJIA 2ESNA 3RDIA 3HB9A 4E7KA 5KVRA 3PO2J 1A04A 2MA3A 4HDVA 4ENNA 2D1VA 3K4KA 2OTJI 3OS1A 2WADA 1B8IA 1MMSA 1MJBA 2XAQA 3TEDA 1J5YA 1JT0A 2E1OA 2K86A 3U2RA 3FXOA 4XR6A 4XORA 3GFJA 4S0HB 1TT0A 2L4MA 3C7JA 5EF6A 3WG7H 1R4MB 1KA8A 3CDHA 3BR3A 3OYBA 4LIUA 3OMYA 5FD6A 4EJOA 3WTTC 3I9V2 1HSJA 3HSFA 1SVLA 4KN4X 2WA0A 2BVLA 2VOPA 2XAHA 3HOUJ 3QRFF 1UMQA 2QKLB 1XN7A 5LBQA 2ZB9A 2XAGA 1VNDA 2QZ8A 1X2NA 1Z1DA 1ZKGA 3CCVI 2NNNA 2BEOA 2V6EA 3ULQB 3SEZA 1P4XA 2OA4A 4E7HA 1UG0A 2BBYA 4J00A 3DPUA 2BHZA 4II3A 2G0EA 2DXIA 2P5VA 2EV6A 2DA6A 4I0AA 4OU0A 3JRCA 1DP7P 3M8EA 4R8HA 3WHCA 3IKVA 4EJUA 2X0LA 3QP6A 4IHSA 1P9QC 2M7BA 1X1AA 5EDNA 2IEKA 2A69F 2XPWA 1Z91A 3BG6A 2ACJA 1I6XA 4XBFA 3BTJA 1J75A 3KP6A 5FKLA 3S8PA 5C44J 1XMXA 3JRIA 2DOFA 3GTKJ 3F8NA 5HNHA 3OOPA 3TO7A 1WCMJ 2FD5A 3I4MJ 3OV8A 2V1NA 5C3EJ 4D5FA 3F8MA 2HQNA 5M5XJ 2CFXA 2XB0X 4B09A 1QBJA 3VB2A 2ZMEC 3ZMZA 2VKEA 3K4JA 1T0FC 3FDYA 2Y48A 1K78B 1TWHJ 4MFEA 3T0YA 5HDKA 1WRJA 4HX8A 1STZA 3WTVC 1V5FA 4EMSA 1MSFC 2FBIA 3K4BA 3OYAA 2E1MC 2N8GA 2JTVA 2K3PA 4KN7X 3CCEI 1ZR2A 3HPHA 3OY9A 3WTZA 1P6RA 1WJ5A 2WTEA 5CVUA 3K7AJ 1K6YA 3L2UA 2IRFG 1JGSA 1Z05A 3D5RC 4PZJA 1JKPC 5TGTA 2MW8A 4ITVA 4KJZA 1ZTRA 5E1ZB 5L3BA 3OYFA 2DCEA 1T98A 3F72A 4OAZA 3EQLF 3MEXA 4IVNA 1MBEA 3GLLA 3BG9A 4ZTFA 2EIKH 1UJ8A 5B1AH 1VQ5I 1JUPA 4HLYA 4M3DA 2PX9A 3EYYA 4C3HJ 1ETXA 3I5UA 4UUSB 2TRTA 3IC7A 3LSJA 1LVKA 5ILVA 1XSDA 1X3UA 4ABZA 1YX3A 1MBFA 2RDPA 3I64A 2EIMH 2LREA 2FUG2 4IOAF 1U5TB 2M4KA 1FYKA 1OCPA 2L7FP 4RB3C 2YPRA 1IF1A 3C2GA 1P4WA 3B73A 3IUOA 3CUQB 3A4CA 5DM7F 1HLVA 3HL2A 3H9QA 4ZYHA 4IRHA 1ACIA 4HX4A 4I09A 4M73A 2WAEA 3FKJA 3P9CA 4E7SA 3F3XA 2F5DA 3WGHA 5E8IA 4M3GA 3E5UA 2FNPA 4U0VA 3W3CA 2HQAA 4A5NA 4GFBA 2L4AA 4KIFA 4XL9A 4EJTA 2EFPA 2Q2EA 1D1BA 1EH8A 1DQUA 3H9JA 2NNYA 3HOWJ 1E0EA 2R7OA 5F08A 4QIWN 3ZQ7A 3TKYA 1KYWA 1MMNA 4XKBA 4F93B 4KT5C 2R7TA 2V6CA 2JK3A 1FBSA 4JBAA 3CESA 4RDUA 2QENA 3PL8A 4RLFA 1W7PB 4U87A 2ID6A 2DU9A 3BT9A 1IN8A 1WJAA 2V1XA 1D0XA 3L7WA 3MAJA 4KMUX 4GYGA 4CCKA 2EFWA 1YW9A 4AIDA 3TO9A 2LKPA 4O3MA 1W0UA 3UNGC 2AQFA 1LNWA 3S93A 2O6GE 2OPTA 4M72A 4CSWA 2DA2A 4RAGA 3L2QA 4A3KJ 2QGUA 2ZXJA 2XROA 1ZGJA 3E6BA 2HPIA 1TWCJ 2ADUA 2E35A 2P81A 3I3LA 4KIGA 4DW6A 1ZYRF 3E97A 3HRUA 2HZDA 5F27A 2LFBA 2H27A 3S3OA 2Q1ZB 1GV5A 3K69A 4CCMA 2FF4A 2X4HA 3BC8A 2JT1A 3IH2A 4V2GA 1YRNA 4PCQA 3Q0VA 3G71I 3EUKL 4M71A 1HKSA 4BY7J 4HNTA 2MBFA 3LSHA 3L2VA 2G7UA 1OCOH 1RNLA 1W5SA 2K3FA 1VQ6I 2B0LA 2B9SA 3RTRA 2OAZA 2LP0A 4JYKA 2F5FA 1TL8A 3KFWX 4ANJA 3KEQA 3HZJA 3AG3H 1T08B 3PUBA 2WAQA 3U1DA 1S5LC 5FB2A 4XRSG 4CYDA 4XLPF 2YUSA 2PMHA 2W1OA 3BROA 1TP4A 2V9KA 5J6XA 4GDFA 2DK5A 4B4CA 2GZWA 3FBNB 3V8KA 2Y31A 1YQAA 5E3OA 3ML6A 4HAMA 1JJ6C 1I3AA 2XHKA 3FK7A 4A0YA 2IS1A 2Z5UA 1FYLA 2VKVA 3E3VA 5J1YA 1KU7A 1YOVB 4YIRX 2BW3A 1ZLKA 5E18F 4X0GA 3BG7A 4HF0A 2JRMA 4DZPA 2RKHA 4Y17A 4MQ9F 1S6LA 3JR9A 2NS8A 3EUHC 1U78A 4BAYA 3CLQA 3OYCA 1QO0D 2A5WA 2K85A 3HHGA 3KP4A 2HI3A 3ZN0A 3ECHA 1PJRA 2NVXJ 1TWFJ 1YO5C 1YW8A 2XGXA 4U88A 4Y3OA 4A3GJ 1VFCA 1FYMA 3QODA 2P5LC 2CQNA 4BXXJ 1UCRA 1ON2A 3ABMH 2L3DA 5EG0B 3DEEA 5CLSA 3C3WA 1X1PA 3J7ZI 1OCTC 1EV7A 1VQ7I 2VN2A 1ENHA 3HKZA 2L9RA 3W2WA 4C9YA 3FXLA 3CJRB 2DLLA 4EM1A 4XN0A 1BJAA 3TW6A 2A6TA 2IP2A 1JTYA 2FX0A 4EQQA 4NHJA 2IBDA 1IRFA 3I4PA 5H2FC 3ZPLA 2KMUA 2YX7A 2A68F 2CUFA 2M7AA 1Z7LA 4LG0A 2HKXA 2EFOA 5J47A 4UVBA 4LLLA 1ZGWA 1U3EM 3ABLH 1EH6A 1EKEA 2X1CA 3SZTA 3H3VK 3ZQCA 3LOCA 1U8RA 1VQKI 2P6SA 5HDGA 4BDZA 1KQ9A 1X1DA 2RC4A 4OMYA 3PQJA 3LAPA 5E17F 4Q4ZF 1UFMA 3E6CC 2OZ6A 5F1JA 1XDSA 3HOSA 5L3GA 1HW2A 4HSRA 2DJNA 1J9IA 3K2ZA 2KL4A 3IHUA 3ZMUA 2AHQA 4OINF 2R4GA 1RRJA 4WXCA 2KIUA 3CCQI 4RAYA 1O3QA 3DF8A 2A05A 2VJIA 1JKRC 1W1WE 1ZN2A 1S9HA 2Y69H 2DMNA 5EZHA 3BTIA 2E5NA 1V55H 3D5SC 2P0WA 5HLHA 1IZ1A 4RGSA 2R7WA 4P1WA 2CUEA 1XGNA 2W82A 4A0ZA 1EJ9A 2XAUA 2ZMEB 1QVTA 2VLAA 3CD6I 1OLTA 3B02A 4GO1A 1H8AC 2LDUA 2PLYA 2VE9A 1ETKA 1IN7A 1FNNA 3JRAA 4PUSA 1MDMB 3HRSA 2NVTJ 2H1KA 2E1MB 2OV7A 1KZHA 3BJAA 2ECCA 3LQRA 3ONQA 2STTA 4IHXA 1W36C 2OF7A 4A3CJ 2IGKA 1EH7A 4XMYA 4CH7A 1FOKA 1K61A 2QLZA 1RUOA 2O8KA 4XKVA 2QVOA 3F8FA 1KONA 4E70A 3PO3J 3J80Z 3BJOA 3QOPA 4L5IA 3LFKA 4B3AA 3GBGA 1LEBA 2XGEA 2A5YB 1V4RA 2OBPA 1BN5A 4FT8A 3HRMA 3UKGA 3REOA 4AVZA 2VBYA 3J7AY 2V1UA 3FZVA 2EA2A 1IXSB 4H0EA 4EGYA 3O8GA 2M3AA 1FLIA 3CUOA 3O8HA 3AKZA 3GWZA 2AS5F 1ETYA 1J59A 2OD5A 4C3IJ 1BI0A 4UUTA 1IXCA 2X1EA 2FXAA 1U9OA 3HBLA 4ON0A 2CW0F 2UXXA 4E6KG 2HVQA 5DTDA 1B72A 4ZC3A 3KYLA 4L18B 4I02A 3S1MJ 3ZGKA 2R7SA 2I10A 5F0FA 4RAZA 1RC9A 2R5ZB 2F4MB 2QBYA 1X2MA 3QYEA 3KETA 3KYCB 3J81Z 1T0FA 4Q5SF 2EK5A 3H0GJ 2PG4A 1AHDP 1XSVA 2EINH 3JTHA 3CF5F 3TDZC 4PJLA 1ZQ3P 4L9NA 1BIAA 3DTKA 3KLNA 5F6FA 1S7OA 2KLOA 3W6KB 1XB4A 2HU9A 1XMAA 1K7AA 4RMNA 4FE7A 5CQEA 1WGXA 3TOBA 1U2WA 3J80K 4AVPA 2MGQA 4XLCA 2V4JC 4B1RA 3I53A 5L3EA 2KRCA 4HF2A 5K5QA 2LLKA 4HV5A 2KIFA 1L3LA 3L1PA 2VPLA 3SFIA 1YJWI 2W84A 2XB5A 6PAXA 4XLEA 2QEXI 2PJPA 1U5TC 2VKHA 1PYVA 2PJRB 3IWFA 2ICWG 2YS9A 3E1SA 2XIGA 1G6NA 2JUGA 2E1CA 1REPC 3BPVA 5B5EC 5IPAA 4KICA 1ZRCA 1TLHB 3CUQC 3CC2I 2GA1A 1J7KA 2EZLA 3KEYA 4A3FJ 3BTLA 5IYCJ 4LGWA 2MABA 1UHMA 4YEJA 3SDGA 1QHHD 4EEFG 4A3BJ 2J5PA 3MZHA 2EIJH 2FRHA 5AIPA 2HOTA 1RZ4A 1VQPI 3M7GA 4DZJA 5F0HA 1F9NA 2KISA 2EFQA 5CPRB 3E7LA 3FX3A 2GXAA 1ULYA 3J81K 2HQRA 1OMIA 2PFBA 2JPBA 3GFLA 1A6QA 3WHBA 1RR8C 1R22A 1FC3A 3IL2A 1VTNC 3HTUA 2YR2A 5IT3A 2FBHA 2XC7A 1W36D 2NOGA 1ZHFA 1R6RA 4I7HA 3VYUB 1DPRA 3LA3A 2W85A 4RGUA 1UG2A 3DTIA 2A6EF 1YFHA 1JT6A 1TWGJ 1YS7A 1S3JA 2K9LA 4ESBA 4RA2A 4DYCA 1VQMI 4XQFA 1IN6A 1PUEE 2EPFA 3I0TA 4Y7NJ 3S17J 5HNFA 5B66C 4G7OF 1Y8RB 1X3ZB 1XSXA 4D9JA 2UUZA 4M9XA 4EM0B 4XOTA 5AONA 2UXNA 2KDOA 1J09A 3S15J 3G1OA 3MWMA 1FOYA 3MKYB 3W6VA 2M2EA 2IAIA 3LA7A 1FMWA 2R5YB 2Y2ZA 4WX9A 1QQIA 3HJEA 2HR3A 2JN6A 4HEA2 1PVEA 3E6MA 2R7XA 2OCEA 3U21A 3RKXA 2GOMA 2PMZA 3K9TA 3M3YJ 3P9IA 1Y39A 3R4KA 1USTA 3HPGA 1FP2A 4XRFA 4KITB 2PBIA 2STWA 2FU4A 2K9MA 3GFIA 1P4AA 1ONVA 5EEGA 1B9MA 2H1LA 3LSMA 1B4AA 1N25A 2HTJA 2PEXA 5ILSA 1OQYA 2GXGA 2QF7A 5EJCA 4L9JA 1T33A 5TISC 5F1RA 2CUJA 2YSRA 1ZARA 4XOPA 1AKHA 2HVRA 1E17A 4Y33A 4MGRA 2QWWA 2CV1A 1DGWY 3CP8A 1R5ID 1SVMA 2M45A 3AG4H 3TGNA 1LQ1A 1MNMC 3DKYA 1JKOC 2UZKA 1FX7A 4A5MA 1DP3A 1VZ0A 1HDDC 4IQJA 5ICEA 3BQZA 3RI4A 2ZKZA 1D1AA 4BE1A 2HYJA 3RQIA 5CJ9A 5JHFA 2VC0A 2KIQA 2X9DA 3CCMI 2OQGA 1MH3A 3RKQA 5M5WJ 2K7LA 2RAEA 4L0ZB 4D0PA 3S14J 2MYSA 3HHHA 1P7JA 3OIQA 4ZH4F 3QYBA 3Q3SA 1H9GA 4XNFA 3TQNA 2ZJRF 2XV4S 3HGGA 1UHWA 1BW6A 5J1UA 2FE3A 1OYYA 5BQTA 2WAQN 1SC7A 2VXZA 2QM3A 3ZMVA 3DEUA 4L0YB 2QQAA 1R4NB 4YRVA 3L00A 4I98B 1HW1A 1B9NA 4Z6YA 2ME6A 2O03A 1ZELA 2DFIA 4YFXF 3KCCA 3H5AA 1LB2A 3VPRA 3BTCA 3E5XA 5HVQC 1D8KA 1OKRA 3ERMA 4IRGA 3CMEI 3VODA 5GADJ 1ZG5A 2IGOA 1JUSA 2F48A 3BR2A 1IGNA 3BG5A 4N4OB 4YIFA 3CO7C 1IUYA 2Q0OA 3HEFA 3G3ZA 5CVRA 4A6DA 1ITYA 1G3TA 3MVPA 3CJNA 2Y0MA 2X6XA 3EETA 3ZOBA 2DOAA 1T8IA 4C2TA 2EZIA 2P6TA 1SFEA 1YYVA 4OWRB 4EV0A 2H8RA 2DT6A 1LDJA 4A3EJ 3C2BA 1B59A 3RYRA 1RKWA 5LHIA 1W0TA 2GOXB 2O7OA 1QZEA 4HOBA 3IAM2 5KCMA 4DGWB 2DW4A 4A3MJ 1OFCX 2FSWA 2Y0SA 2L7ZA 4M6XA 3RSNA 1ZH5A 4A3JJ 2Y9ZA 3HKZN 1FSEA 2ZSIB 3FXQA 4I2OA 5K5OA 1Y0NA 1KQ0A 2DA7A 3A01A 3VOEA 2QQBA 4DIQA 4BL0B 1AA7A 3GLXA 2A07F 4JQFA 2ELKA 4Y15A 2VJ5A 3E6DA 2BZTA 4O6JA 1WJBA 2P7VB 1EA3A 1P2FA 1LUJB 3VYTB 2UV1A 3EYIA 3GO5A 4BE2A 2OC6A 3C2HA 4WF2A 4A6EA 4PJNA 4ZDPA 2JA8J 4FHTA 3JREA 3W2AA 2JZYA 1WSUA 2LY1A 1XMKA 4F91B 3SZGA 2QSFX 5JR3A 1G3SA 1TW2A 2O3FA 2GQQA 2FEZA 5ILUA 2DO7A 1QZZA 4DJAA 1B1BA 1BOAA 3F8BA 3LL7A 4CYCB 3RZDJ 3IH4A 4XLAA 4P96A 2KHMA 3KP2A 2GXBA 4IQ4A 2HKOA 1NG6A 3X2QH 4PJ0C 1PP7U 5HDNA 5IP9J 2E7XA 4KUMA 2ZJQF 2IW5A 4MTEA 1BC8C 2L0KA 3K70C 5LLQA 1PUFA 1AOYA 2LKSA 1BW5A 2CO5A 1UB9A 4B47A 3OYDA 1IXRC 1F36A 3F8CA 2FA5A 3GMEA 2XGCA 2E5ZA 2RGVA 1QHGA 3Q0UA 3HYIA 3KEOA 3OYLA 5M3FJ 3NRVA 2LG4A 4E4HA 1X19A 4NBQA 2CQQA 2FOWA 1LDDA 4BNCA 4JOMA 2HWVA 3CMYA 2L9SA 3ZQIA 4A2UA 3DTEA 4UHTA 1AWCA 3Q9SA 1WVRA 2MFZA 3DCFA 1DU0A 4XRSA 2M87A 2VODA 5JLXA 4OIPF 3CJQB 1X1BA 3CO6C 2VQGA 2WB1A 3OSFA 5L3FA 1K78A 2F4OB 3I54A 4FE4A 5LGNA 4CCNA 5CYVA 3DPTA 2BY1A 2HNHA 2DK8A 4MLOA 5FFZA 4TV7A 4GRIA 1VQLI 3BZ6A 3OS0A 2CW8A 3F21A 3G1MA 5HS7A 2M8GX 3QQAA 1OYIA 1QRYA 3CDIA 4E7ZA 1MJAA 3GZ5A 4M3BA 1DDNA 1R58A 1OR7A 1WJEA 3LSGA 2LD5A 2ZXHA 2A61A 3O6BB 4OAYA 5LHHA 5IYDJ 4GCVA 2H94A 3ZXSA 1I1SA 2P5KA 2FNAA 1MBJA 2M30A 2MD5A 3KP5A 4CZZA 2HYGD 2X51A 4ZJZA 3N97A 2K4BA 3JTGA 4PDKA 5EEAA 3ABUA 3OWTA 4ZYEA 2O61A 1GVJA 2DYRH 4ASNA 4UUSA 3L9FA 2NYXA 4BY1J 1UELB 1E2XA 3ZRGA 1T38A 5FRMA 4AUXA 3R60A 4BXFA 1XPXA 1G3YA 5HLIA 4XLHA 4RB0A 4P55A 5BPIA 3K6GA 3ZQFA 2DQRA 3GTJJ 4BHCA 4KT6A 5HLTA 3BR6A 3GTOJ 1A5JA 4HDUA 2JWTA 3T1BA 1HXDA 1QU3A 3RPUD 5FRNA 4BJ5C 1SVOA 2DBBA 1FP1D 2ZFUA 3W6JB 3ZQQA 4CO8A 4YIIA 1ZLJA 3S32A 4V2FA 1Z7UA 1NK3P 5C4XJ 2JA2A 5FGMA 2QYOA 5DS9A 1SMYF 2M1BA 2DFEA 3VDXA 3PNYA 4YFNF 4KISA 3EUAA 5FO5A 1MH4A 2YU9J 2HDCA 1MNEA 5E79C 4XICA 4IXAA 1XC5A 1SEUA 1I1GA 4U7DA 1IDYA 2BY2A 3AFHA
chains in the Genus database with same CATH topology
3HGYA 3UKGA 2HXOA 2D5VA 3JRFA 2HDDA 5EGOB 1GT0C 3FKIJ 2NVYJ 4IHYA 3O8GA 5GP9A 1WI3A 3O8HA 4AYBN 1ETYA 1VI0A 3QPSA 4C3IJ 2L7MP 4UUTA 1WH7A 2M34A 2LR8A 2E19A 1U9OA 3HBLA 5JLWA 3IH3A 3TP0A 5DTDA 1B72A 2DMTA 2O9LA 3BG3A 4JX4A 1Y1VJ 3S1MJ 5GPCA 4JX6A 2I10A 1QVUA 3MKLA 3HOXJ 5F0FA 4QSHA 5F04A 3S1QJ 2R5ZB 2EZHA 1X2MA 2XPUA 5HODA 1IG7A 3H0GJ 2K40A 3LSPA 1SFOJ 3BR5A 5IP7J 1HF0A 1AHDP 1A6IA 3Q0WA 1DU6A 5EZGA 1ZQ3P 4FISA 1MBGA 1BA5A 4JX5A 2XSDC 1XG1A 3RZOJ 1GUUA 4NDLA 2CRGA 2WV1A 4W97A 3HB9A 3QPLA 1AU7A 4FE7A 1WGXA 3PO2J 4AC0A 1SANA 2K9SA 2MGQA 4B1RA 5K7HA 1B8IA 2LLKA 2NS7A 3L1PA 3TEDA 3SFIA 2NVQJ 1JT0A 2E1OA 2QCOA 2XB5A 1YRNB 1NTCA 4XK4A 4S0HB 4A69C 5EF6A 3S2HJ 2YS9A 3BR3A 2LKXA 4A3LJ 4CYCA 5IPAA 3ZQLA 1H89C 3F0CA 2HOAA 2ID3A 2EZLA 4A3FJ 3HOUJ 1I3QJ 1UMQA 3BTLA 5IYCJ 4C3JJ 2R93J 2ZB9A 2DTZA 1VNDA 3SDGA 2DA4A 4EEFG 1IV6A 2JA6J 1X2NA 4A3BJ 3NARA 3GTPJ 1ZKGA 2HOTA 4DZJA 5F0HA 5M3MJ 5IYBJ 3E7LA 1FIAA 2DMUA 1MSEC 3LSRA 1JTXA 1QPIA 4J19A 2X48A 2EZKA 4M3FA 2G0EA 3WHBA 2B63J 4HNVA 2X6OA 2DA6A 3JRDA 2JMWA 2NOGA 2TCTA 1APLC 3HOZJ 3JRCA 2R7ZJ 1MBHA 3WHCA 3CCYA 1UG2A 5EDNA 1JGGA 2IEKA 2XPWA 3JRBA 1JT6A 3BR0A 1U8BA 1TWGJ 1U9NA 2K9QA 3BTJA 4DYCA 5FKLA 2Y9YA 5C44J 3JRIA 3S17J 3GTKJ 4Y7NJ 1D5YA 2XGDA 1Z0XA 1WCMJ 2FD5A 3I4MJ 3S2DJ 1FEXA 5C3EJ 4D5FA 5M5XJ 1TC3C 4D5CA 3IV5A 2XB0X 3FISA 5K7ZA 3S15J 1R9TJ 2VKEA 3G1OA 4QTRA 4Y52J 3W6VA 1TWHJ 2M2EA 4MFEA 2IAIA 2R5YB 2KT0A 2Y2ZA 1JUMA 5IOZA 1MSFC 2JN6A 2N8GA 1RR7A 1NK2P 5IP6A 3M3YJ 1ZR2A 2XPVA 5FLMJ 5M5YJ 4XIDA 2LY9A 4LOCA 5GPAA 3K7AJ 1ZR4A 1JKPC 2MW8A 1ETQA 1ZTRA 2QF7A 4IEJA 5FKOA 1K83J 5J3LA 3GTGJ 2JA7J 1RPWA 1T33A 2ME0A 1MBEA 3BG9A 1AKHA 1JUPA 3CDLA 4M3DA 3OIOA 4C3HJ 1ETXA 4UUSB 2TRTA 3LSJA 1MNMC 4I76A 2Y30A 1JKOC 4ABZA 1MBFA 2Y0SN 4I6ZA 2DA3A 2LK2A 1HDDC 1MBKA 3BQZA 3JRGA 5FLVA 3BR1A 2HYJA 3RQIA 2DA5A 1OCPA 2L7FP 2X9DA 3RKQA 1MH3A 2AO9A 5M5WJ 1HLVA 4W1UA 2RAEA 3S14J 1P7JA 3HOVJ 3Q3SA 4M3GA 3HGGA 1BW6A 5J1UA 5EGOA 2EBIA 2WAQN 4MO7A 4GFBA 1LE8B 1EF4A 2PMZN 1UHSA 3HOWJ 1JKQC 9ANTA 5F08A 2HQ5A 2ME6A 1RKTA 4QIWN 4IHXA 3MN2A 3VPRA 3BTCA 4G12A 2GBYA 1POGA 5E3LA 3G1LA 2LTPA 2JK3A 5F0CA 1H88C 1JUSA 1IC8A 1GVDA 4RDUA 3BR2A 1IGNA 3BG5A 3M4OJ 2ID6A 2LVSA 3TW7A 3HEFA 4BBSJ 1Q1VA 3BT9A 2R5ZA 1G2HA 1ITYA 3MVPA 3ZOBA 5EG0A 1JJ8C 1GDTA 2EZIA 1W0UA 3PM1A 2H8RA 2OPTA 3C2BA 4A3EJ 2DA2A 4A3DJ 1B72B 1Z77A 1RKWA 3K2AA 1FTZA 4A3KJ 2EH3A 3ZQHA 3FK6A 3SJMA 1W0TA 5EYRA 2O7OA 4A3IJ 3GTLJ 1TWCJ 5E3NA 2P81A 2CQXA 4DW6A 1XS9A 4M6VA 4A3MJ 1OFCX 2L7ZA 2JJ7A 2VI6A 2M9HA 5F27A 2DN0A 2LFBA 3OSGA 4A3JJ 1GV5A 2Y9ZA 3HKZN 2FQ4A 4V2GA 3IH2A 4A93J 3B6AA 1YRNA 2WB1N 2DA7A 3Q0VA 3A01A 4BY7J 3HOYJ 2ELKA 5FJ8J 2LP0A 4JYKA 3B6CA 1VF9A 2FJ1A 5K7FA 1HDPA 2EQRA 1HCRA 4XRSG 2YUSA 1B8IB 2JA8J 3JREA 1Y1WJ 1LFBA 3HDDA 2VUMJ 2CU7A 4BKXA 2DMPA 1FIPA 4B4CA 2W48A 2Y31A 5E3OA 1JJ6C 3FK7A 2GM4A 5E3MA 5BNGA 1I6HJ 4CYCB 3RZDJ 2VKVA 3IH4A 5J1YA 3D1NI 2COBA 2KDZA 5IP9J 4DZPA 2R0QC 2L0KA 1OJLA 1PUFA 1BW5A 2VPRA 3A03A 3JR9A 2NS8A 5FKKA 5IOYA 1U78A 3TP3A 3S16J 4FCYA 1O4XA 1F36A 4D7MA 5FKNA 2HI3A 5FKMA 1IDZA 2XGCA 3I4NJ 2NVXJ 1TWFJ 1RETA 3Q0UA 5M3FJ 4A3GJ 1VFCA 4DYQA 3BQYA 2CQQA 4BXXJ 3CMYA 5EG0B 2MG4A 3ZQIA 1ETOA 1OCTC 3A02A 3DCFA 1DU0A 4XRSA 5JLXA 1GV2A 1ENHA 1I50J 3S1RJ 4MIMA 2L9RA 3OSFA 3GTMJ 3TW6A 4FE4A 4IHWA 4MFDA 2HXIA 1JTYA 2DA1A 2FX0A 2MSYA 4BBRJ 2R5YA 2ECBA 4IHVA 2K9NA 2IBDA 4MLOA 1RESA 1ETVA 1WPKA 2CUFA 3S1NJ 1HOMA 5J1RA 4XRMA 3G1MA 3LNQA 1ZGWA 2M8GX 1FTTA 3QQAA 1QRYA 3A01B 3H3VK 1ORKA 3LOCA 3ZQCA 1IUFA 1S7EA 4M3BA 3LSGA 1P7IA 3FIWA 2LD5A 1BL0A 5IYDJ 1IJWC 1FJLA 5F1JA 2E2HJ 1MBJA 3OOUA 2DJNA 1TWAJ 1T56A 2AHQA 1X58A 5EEAA 2CJJA 1ETWA 1CQTA 1LFUP 4UUSA 1BJZA 4RBOA 4BY1J 1JKRC 2GLOA 4AUXA 4JP0A 2DMNA 5EZHA 1IRZA 2JA5J 3BTIA 2E2JJ 4DYRA 2CUEA 3ZQFA 3GTJJ 1QVTA 3BR6A 3GTOJ 1H8AC 3CQZJ 3HM5A 2JWTA 1A5JA 1ETKA 4C2MJ 1AKHB 1PUFB 3JRAA 1F43A 2NVTJ 2H1KA 4X1EA 1E3OC 2M0CA 3JRHA 2ECCA 4V2FA 2HOSA 2E2IJ 2DMQA 1NK3P 5C4XJ 2R92J 2OF7A 1WH5A 4A3CJ 1LE8A 5DS9A 3NAUA 3ZQGA 1K61A 2O8KA 1MH4A 4FTHA 2XRLA 2YU9J 3DEWA 4XICA 3PO3J 1XC5A 3GTQJ 4B3AA 3GBGA 4X6AJ 2XGEA 1IDYA 5C4JJ 1ZK8A 4D7NA 4L5EA 4M3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGY A;  3UKG A;  2HXO A;  2D5V A;  3JRF A;  2HDD A;  5EGO B;  1GT0 C;  3FKI J;  2NVY J;  4IHY A;  3O8G A;  5GP9 A;  1WI3 A;  3O8H A;  4AYB N;  1ETY A;  1VI0 A;  3QPS A;  4C3I J;  2L7M P;  4UUT A;  1WH7 A;  2M34 A;  2LR8 A;  2E19 A;  1U9O A;  3HBL A;  5JLW A;  3IH3 A;  3TP0 A;  5DTD A;  1B72 A;  2DMT A;  2O9L A;  3BG3 A;  4JX4 A;  1Y1V J;  3S1M J;  5GPC A;  4JX6 A;  2I10 A;  1QVU A;  3MKL A;  3HOX J;  5F0F A;  4QSH A;  5F04 A;  3S1Q J;  2R5Z B;  2EZH A;  1X2M A;  2XPU A;  5HOD A;  1IG7 A;  3H0G J;  2K40 A;  3LSP A;  1SFO J;  3BR5 A;  5IP7 J;  1HF0 A;  1AHD P;  1A6I A;  3Q0W A;  1DU6 A;  5EZG A;  1ZQ3 P;  4FIS A;  1MBG A;  1BA5 A;  4JX5 A;  2XSD C;  1XG1 A;  3RZO J;  1GUU A;  4NDL A;  2CRG A;  2WV1 A;  4W97 A;  3HB9 A;  3QPL A;  1AU7 A;  4FE7 A;  1WGX A;  3PO2 J;  4AC0 A;  1SAN A;  2K9S A;  2MGQ A;  4B1R A;  5K7H A;  1B8I A;  2LLK A;  2NS7 A;  3L1P A;  3TED A;  3SFI A;  2NVQ J;  1JT0 A;  2E1O A;  2QCO A;  2XB5 A;  1YRN B;  1NTC A;  4XK4 A;  4S0H B;  4A69 C;  5EF6 A;  3S2H J;  2YS9 A;  3BR3 A;  2LKX A;  4A3L J;  4CYC A;  5IPA A;  3ZQL A;  1H89 C;  3F0C A;  2HOA A;  2ID3 A;  2EZL A;  4A3F J;  3HOU J;  1I3Q J;  1UMQ A;  3BTL A;  5IYC J;  4C3J J;  2R93 J;  2ZB9 A;  2DTZ A;  1VND A;  3SDG A;  2DA4 A;  4EEF G;  1IV6 A;  2JA6 J;  1X2N A;  4A3B J;  3NAR A;  3GTP J;  1ZKG A;  2HOT A;  4DZJ A;  5F0H A;  5M3M J;  5IYB J;  3E7L A;  1FIA A;  2DMU A;  1MSE C;  3LSR A;  1JTX A;  1QPI A;  4J19 A;  2X48 A;  2EZK A;  4M3F A;  2G0E A;  3WHB A;  2B63 J;  4HNV A;  2X6O A;  2DA6 A;  3JRD A;  2JMW A;  2NOG A;  2TCT A;  1APL C;  3HOZ J;  3JRC A;  2R7Z J;  1MBH A;  3WHC A;  3CCY A;  1UG2 A;  5EDN A;  1JGG A;  2IEK A;  2XPW A;  3JRB A;  1JT6 A;  3BR0 A;  1U8B A;  1TWG J;  1U9N A;  2K9Q A;  3BTJ A;  4DYC A;  5FKL A;  2Y9Y A;  5C44 J;  3JRI A;  3S17 J;  3GTK J;  4Y7N J;  1D5Y A;  2XGD A;  1Z0X A;  1WCM J;  2FD5 A;  3I4M J;  3S2D J;  1FEX A;  5C3E J;  4D5F A;  5M5X J;  1TC3 C;  4D5C A;  3IV5 A;  2XB0 X;  3FIS A;  5K7Z A;  3S15 J;  1R9T J;  2VKE A;  3G1O A;  4QTR A;  4Y52 J;  3W6V A;  1TWH J;  2M2E A;  4MFE A;  2IAI A;  2R5Y B;  2KT0 A;  2Y2Z A;  1JUM A;  5IOZ A;  1MSF C;  2JN6 A;  2N8G A;  1RR7 A;  1NK2 P;  5IP6 A;  3M3Y J;  1ZR2 A;  2XPV A;  5FLM J;  5M5Y J;  4XID A;  2LY9 A;  4LOC A;  5GPA A;  3K7A J;  1ZR4 A;  1JKP C;  2MW8 A;  1ETQ A;  1ZTR A;  2QF7 A;  4IEJ A;  5FKO A;  1K83 J;  5J3L A;  3GTG J;  2JA7 J;  1RPW A;  1T33 A;  2ME0 A;  1MBE A;  3BG9 A;  1AKH A;  1JUP A;  3CDL A;  4M3D A;  3OIO A;  4C3H J;  1ETX A;  4UUS B;  2TRT A;  3LSJ A;  1MNM C;  4I76 A;  2Y30 A;  1JKO C;  4ABZ A;  1MBF A;  2Y0S N;  4I6Z A;  2DA3 A;  2LK2 A;  1HDD C;  1MBK A;  3BQZ A;  3JRG A;  5FLV A;  3BR1 A;  2HYJ A;  3RQI A;  2DA5 A;  1OCP A;  2L7F P;  2X9D A;  3RKQ A;  1MH3 A;  2AO9 A;  5M5W J;  1HLV A;  4W1U A;  2RAE A;  3S14 J;  1P7J A;  3HOV J;  3Q3S A;  4M3G A;  3HGG A;  1BW6 A;  5J1U A;  5EGO A;  2EBI A;  2WAQ N;  4MO7 A;  4GFB A;  1LE8 B;  1EF4 A;  2PMZ N;  1UHS A;  3HOW J;  1JKQ C;  9ANT A;  5F08 A;  2HQ5 A;  2ME6 A;  1RKT A;  4QIW N;  4IHX A;  3MN2 A;  3VPR A;  3BTC A;  4G12 A;  2GBY A;  1POG A;  5E3L A;  3G1L A;  2LTP A;  2JK3 A;  5F0C A;  1H88 C;  1JUS A;  1IC8 A;  1GVD A;  4RDU A;  3BR2 A;  1IGN A;  3BG5 A;  3M4O J;  2ID6 A;  2LVS A;  3TW7 A;  3HEF A;  4BBS J;  1Q1V A;  3BT9 A;  2R5Z A;  1G2H A;  1ITY A;  3MVP A;  3ZOB A;  5EG0 A;  1JJ8 C;  1GDT A;  2EZI A;  1W0U A;  3PM1 A;  2H8R A;  2OPT A;  3C2B A;  4A3E J;  2DA2 A;  4A3D J;  1B72 B;  1Z77 A;  1RKW A;  3K2A A;  1FTZ A;  4A3K J;  2EH3 A;  3ZQH A;  3FK6 A;  3SJM A;  1W0T A;  5EYR A;  2O7O A;  4A3I J;  3GTL J;  1TWC J;  5E3N A;  2P81 A;  2CQX A;  4DW6 A;  1XS9 A;  4M6V A;  4A3M J;  1OFC X;  2L7Z A;  2JJ7 A;  2VI6 A;  2M9H A;  5F27 A;  2DN0 A;  2LFB A;  3OSG A;  4A3J J;  1GV5 A;  2Y9Z A;  3HKZ N;  2FQ4 A;  4V2G A;  3IH2 A;  4A93 J;  3B6A A;  1YRN A;  2WB1 N;  2DA7 A;  3Q0V A;  3A01 A;  4BY7 J;  3HOY J;  2ELK A;  5FJ8 J;  2LP0 A;  4JYK A;  3B6C A;  1VF9 A;  2FJ1 A;  5K7F A;  1HDP A;  2EQR A;  1HCR A;  4XRS G;  2YUS A;  1B8I B;  2JA8 J;  3JRE A;  1Y1W J;  1LFB A;  3HDD A;  2VUM J;  2CU7 A;  4BKX A;  2DMP A;  1FIP A;  4B4C A;  2W48 A;  2Y31 A;  5E3O A;  1JJ6 C;  3FK7 A;  2GM4 A;  5E3M A;  5BNG A;  1I6H J;  4CYC B;  3RZD J;  2VKV A;  3IH4 A;  5J1Y A;  3D1N I;  2COB A;  2KDZ A;  5IP9 J;  4DZP A;  2R0Q C;  2L0K A;  1OJL A;  1PUF A;  1BW5 A;  2VPR A;  3A03 A;  3JR9 A;  2NS8 A;  5FKK A;  5IOY A;  1U78 A;  3TP3 A;  3S16 J;  4FCY A;  1O4X A;  1F36 A;  4D7M A;  5FKN A;  2HI3 A;  5FKM A;  1IDZ A;  2XGC A;  3I4N J;  2NVX J;  1TWF J;  1RET A;  3Q0U A;  5M3F J;  4A3G J;  1VFC A;  4DYQ A;  3BQY A;  2CQQ A;  4BXX J;  3CMY A;  5EG0 B;  2MG4 A;  3ZQI A;  1ETO A;  1OCT C;  3A02 A;  3DCF A;  1DU0 A;  4XRS A;  5JLX A;  1GV2 A;  1ENH A;  1I50 J;  3S1R J;  4MIM A;  2L9R A;  3OSF A;  3GTM J;  3TW6 A;  4FE4 A;  4IHW A;  4MFD A;  2HXI A;  1JTY A;  2DA1 A;  2FX0 A;  2MSY A;  4BBR J;  2R5Y A;  2ECB A;  4IHV A;  2K9N A;  2IBD A;  4MLO A;  1RES A;  1ETV A;  1WPK A;  2CUF A;  3S1N J;  1HOM A;  5J1R A;  4XRM A;  3G1M A;  3LNQ A;  1ZGW A;  2M8G X;  1FTT A;  3QQA A;  1QRY A;  3A01 B;  3H3V K;  1ORK A;  3LOC A;  3ZQC A;  1IUF A;  1S7E A;  4M3B A;  3LSG A;  1P7I A;  3FIW A;  2LD5 A;  1BL0 A;  5IYD J;  1IJW C;  1FJL A;  5F1J A;  2E2H J;  1MBJ A;  3OOU A;  2DJN A;  1TWA J;  1T56 A;  2AHQ A;  1X58 A;  5EEA A;  2CJJ A;  1ETW A;  1CQT A;  1LFU P;  4UUS A;  1BJZ A;  4RBO A;  4BY1 J;  1JKR C;  2GLO A;  4AUX A;  4JP0 A;  2DMN A;  5EZH A;  1IRZ A;  2JA5 J;  3BTI A;  2E2J J;  4DYR A;  2CUE A;  3ZQF A;  3GTJ J;  1QVT A;  3BR6 A;  3GTO J;  1H8A C;  3CQZ J;  3HM5 A;  2JWT A;  1A5J A;  1ETK A;  4C2M J;  1AKH B;  1PUF B;  3JRA A;  1F43 A;  2NVT J;  2H1K A;  4X1E A;  1E3O C;  2M0C A;  3JRH A;  2ECC A;  4V2F A;  2HOS A;  2E2I J;  2DMQ A;  1NK3 P;  5C4X J;  2R92 J;  2OF7 A;  1WH5 A;  4A3C J;  1LE8 A;  5DS9 A;  3NAU A;  3ZQG A;  1K61 A;  2O8K A;  1MH4 A;  4FTH A;  2XRL A;  2YU9 J;  3DEW A;  4XIC A;  3PO3 J;  1XC5 A;  3GTQ J;  4B3A A;  3GBG A;  4X6A J;  2XGE A;  1IDY A;  5C4J J;  1ZK8 A;  4D7N A;  4L5E A;  4M3E A; 
#chains in the Genus database with same CATH topology
 3HGY A;  2VOO A;  4BYY A;  3JRF A;  1YG2 A;  5JVT A;  5EGO B;  1GT0 C;  3FKI J;  1OPC A;  1Z3Y A;  3MD2 A;  3OYI A;  3FBI B;  5DCF A;  1WI3 A;  3I55 I;  2P7C B;  1KYZ A;  2NRA C;  1VI0 A;  1L0O C;  4LG0 B;  4M9Z A;  1I39 A;  4G6T B;  4GGG A;  2E19 A;  3OS2 A;  1XX5 A;  3TP0 A;  1VQ8 I;  3CCJ I;  1LKX A;  2V1D A;  2VAS A;  4K2E A;  2DMT A;  3WOD F;  4JX4 A;  1LJ9 A;  4YG2 F;  2MD0 A;  3BPX A;  3CCS I;  2CV0 A;  1QVU A;  3HOX J;  4NQW A;  1FBQ A;  5BMZ A;  3S1Q J;  1G3W A;  2H6C A;  3HOT A;  2DT7 B;  3FWE A;  2CH0 A;  1MMD A;  1IG7 A;  3BCA A;  1HA8 A;  4U0W A;  1W5C C;  3Q0W A;  2KJB A;  5EZG A;  1XCB A;  1MBG A;  4FIS A;  4R1H A;  4BHB A;  1H9T A;  4JX5 A;  4AM3 A;  1IW7 F;  1MW7 A;  4IL6 C;  3RZO J;  1GUU A;  1BR2 A;  3ZP5 A;  2CRG A;  2WV1 A;  3EPZ A;  1Y56 A;  1AU7 A;  2DOE A;  3T8R A;  4HF1 A;  3IKT A;  1WZ2 A;  3FMQ A;  5B1B H;  1SAN A;  5E1X A;  2Z3Y A;  3KYD B;  5K7H A;  3HIF A;  2LF8 A;  1ZGA A;  4ZDO A;  2NS7 A;  3CCR I;  4LJZ F;  1RUN A;  2NVQ J;  2VXD A;  2GAU A;  5CQG A;  1NTC A;  4UV8 A;  4XK4 A;  3LA2 A;  4XON A;  1YX5 A;  3A1Y A;  3OR2 C;  1Z9C A;  3S2H J;  3HSE A;  3E5Q A;  2LKX A;  4LFU A;  4RLQ A;  5E20 A;  2F5C A;  1IRG A;  5J40 A;  2QUF A;  2X1D A;  3O2P E;  4CIC A;  3F22 A;  3ZQL A;  1D1C A;  4Y13 A;  1WQ2 A;  2MH9 A;  3F0C A;  1YE9 A;  2HOA A;  1P92 A;  3BJ6 A;  2DPU A;  5ICC A;  2VL8 A;  2O8X A;  1I3Q J;  1USS A;  3PSI A;  4LD5 A;  1I5Z A;  2BOL A;  2DTZ A;  2JA6 J;  1U6G A;  2LSO A;  4HLX A;  3BWG A;  1HC8 A;  3M8J A;  1JHF A;  5DYM A;  5M3M J;  3G4S I;  3COA C;  1LVA A;  1FIA A;  4WCG A;  1XGS A;  4G7H F;  1NHA A;  5FD5 A;  1JTX A;  1QPI A;  5LFA A;  4M74 A;  3K4C A;  2W57 A;  2LC2 A;  3FHN A;  2EZK A;  3AL0 B;  3IWZ A;  1N78 A;  3HUG A;  1R7J A;  4NB5 A;  2X6O A;  2EB7 A;  1GXP A;  5BS6 A;  2QSH X;  3I56 I;  5DCM B;  3W2V A;  2R7Z J;  2BYV E;  5H6Q A;  2LOO A;  3CCY A;  4WXD A;  1IV8 A;  2R3S A;  3ABT A;  4CCJ A;  4PFO A;  3JRB A;  2KIM A;  5LEJ A;  3BR0 A;  1Y6I A;  2K9Q A;  4EJW A;  2XRN A;  3G2B A;  3ZMD A;  1UZC A;  3R0J A;  2G9W A;  1D5Y A;  2ZJP F;  3DBR B;  2QBY B;  2XGD A;  1YTY A;  4BHP A;  4II2 A;  3A0B C;  2ZCW A;  2C6Y A;  5EEH A;  4LLG F;  3RIR A;  1IRX A;  2DFH A;  5D6F A;  3GZ6 A;  2DOD A;  4XKC A;  1TC3 C;  4D5C A;  4EVI A;  3FIS A;  4KYW A;  1R9T J;  2FOK A;  1BR1 A;  4Y52 J;  1TZL A;  4C30 A;  1S29 A;  1JUM A;  2OQR A;  5IOZ A;  2LNB A;  3OYM A;  4IX7 A;  2MH2 A;  3KX2 A;  3I59 B;  1RR7 A;  1NK2 P;  3SHF A;  5IP6 A;  1Z67 A;  2EV0 A;  2DYS H;  3MKW B;  2OUM A;  3S3M A;  2BGC A;  5FLM J;  5M5Y J;  3QPT A;  4LOC A;  5GPA A;  4HPQ A;  5FRO A;  2DT5 A;  3RPQ A;  1FPQ A;  4AWX B;  1BIB A;  3H3Z A;  2W00 A;  5HLG A;  1W5T A;  1ODD A;  2CG4 A;  3S3N A;  5BPD A;  2Z16 A;  3PUF A;  2L7K A;  3M07 A;  3VFZ A;  3K4L A;  3K4N A;  5FKO A;  1K83 J;  2ZME A;  5J3L A;  3GTG J;  2IXS A;  4HQM A;  1B6A A;  3RPU A;  3JCU C;  2H6B A;  2MC3 A;  3CDL A;  3OIO A;  2VQL A;  4N4N B;  3M9A A;  4NC7 A;  1QNT A;  3QWL A;  4EM2 A;  3RJP A;  2Y0S N;  4I6Z A;  2XAJ A;  4U7B A;  4LLN A;  2DA3 A;  2OTL I;  4O5V A;  2HVS A;  3DXJ F;  2AQE A;  2LK2 A;  5FLX Z;  1LEA A;  4OIR F;  1HKQ A;  1MBK A;  4H4K C;  3SDB A;  3JRG A;  3FXK A;  3BR1 A;  5FLV A;  4F55 A;  4DQ2 A;  4IO9 F;  2DDA A;  3HTS B;  4HBL A;  2DA5 A;  3PNT A;  3PNV A;  3VSK A;  2H8W A;  4EJV A;  4BGD A;  2AO9 A;  2IJL A;  1XGM A;  3NEU A;  5K5R A;  1ZRD A;  4ZDL A;  4B48 A;  4ENK A;  3CZ6 A;  3OL4 A;  4J01 A;  3DU5 A;  1Z21 A;  1ERD A;  3BLY A;  3GUD A;  3ECO A;  2EBI A;  1F4K A;  1FY7 A;  1TQI A;  2WC2 A;  1LE8 B;  1EF4 A;  2A3S A;  1YJN I;  1SD4 A;  2CS3 A;  5J4Y A;  1JKQ C;  3PJR A;  2NOJ B;  1HBX G;  2Y75 A;  2QKM B;  4G12 A;  3F23 A;  1ZRF A;  1POG A;  3CMM A;  3G1L A;  4HA8 A;  4LG3 A;  2LTP A;  4PFP A;  5DD4 A;  3HC7 A;  3MZ8 A;  3S2W A;  2GWR A;  1GVD A;  1OCR H;  2QQ8 A;  5KAF C;  4YFK F;  5HOO A;  2ESH A;  1R00 A;  2RN7 A;  1OYW A;  3MZY A;  3M4O J;  1V54 H;  5E8G A;  4LIT A;  3HXL A;  1NH3 A;  5D6E A;  4BBS J;  2CSO A;  2R5Z A;  1G2H A;  4G94 A;  3H92 A;  4LMY A;  4CHU A;  1JJ8 C;  3OYK A;  3ESW B;  5JVG F;  1GDT A;  3WGG A;  1D3Y A;  2K27 A;  5ICF A;  4N9I A;  5LD2 C;  1YJ9 I;  2L5Q A;  2E60 A;  2VKD A;  2GIZ A;  4F92 B;  1FTZ A;  5FLX K;  2EH3 A;  3FM5 A;  3FK6 A;  4G9Y A;  1Y8Q B;  1R5H A;  2CWE A;  2OCC H;  2BHY A;  5EYR A;  3GTL J;  2R7V A;  2E7W A;  1R1T A;  3KIO A;  5E3N A;  2CQX A;  2XF5 A;  5F64 A;  2XKO A;  4M6V A;  5D8L B;  5GAG J;  1XS9 A;  1J0R A;  2JJ7 A;  1E3H A;  1MND A;  2K5C A;  1MGT A;  3QAH A;  4QLC U;  2VQH A;  4MEX F;  2LBF B;  1MMA A;  3B6A A;  2WB1 N;  1F5T A;  4CXF A;  3FF5 A;  4F52 A;  4PGG A;  4QWQ A;  2VJ4 A;  5H6R A;  5GTI C;  1BI1 A;  4BEH B;  4BAC A;  1FZP B;  3A2K A;  1MD0 A;  3GZN B;  4Z2Y A;  4ESF A;  4HST A;  5FJ8 J;  2J5O A;  3ERE D;  3RKW A;  4DBR A;  3B6C A;  2Z99 A;  2FJ1 A;  2XVC A;  3JSP A;  5D5U B;  2RNJ A;  1HW5 A;  4R79 A;  3L09 A;  2EQR A;  2BXZ A;  1O3R A;  4DOZ A;  2VB6 A;  1K4T A;  2XUB A;  1B8I B;  2W25 A;  1LFB A;  3NWS A;  3HDD A;  4BKX A;  4ENJ A;  2DMP A;  2W48 A;  3L2W A;  1FBU A;  5E3M A;  3WG9 A;  2JPC A;  2COB A;  2KDZ A;  3U9G A;  1WI9 A;  1S72 I;  4XLF A;  4UXN A;  2FML A;  3LST A;  3IRR A;  4A12 A;  3A03 A;  2V79 A;  5FKK A;  5IOY A;  1WJD A;  1R23 A;  3S16 J;  5CVI A;  1O4X A;  2RQP A;  4D7M A;  5HS8 A;  2CW7 A;  1O3S A;  3I4N J;  2EA4 A;  1RET A;  5D4S A;  3HRT A;  2HOE A;  5DUI A;  2WV0 A;  3V4G A;  1A31 A;  4DYQ A;  5D5V B;  2F2E A;  3DFG A;  4UNO A;  3GW2 A;  5BOX A;  4Q47 A;  3WU2 C;  4DNC A;  1ETO A;  2RRE A;  3DU6 A;  4B44 A;  1F1Z A;  4E7J A;  2W7N A;  3UR3 C;  3OYN A;  1GV2 A;  4MQV A;  3S1R J;  4C2U A;  4UVA A;  2XAF A;  4GYI A;  3GTM J;  2ZO4 A;  2CUZ A;  1O57 A;  3EUH A;  4MNU A;  4IHW A;  2HYF A;  4MFD A;  2H09 A;  2DFF A;  2R5Y A;  2JSC A;  4BDY A;  4IHV A;  1G4D A;  2ZXW H;  1ETV A;  1WPK A;  2F6C A;  5DM6 F;  1ON1 A;  1TQP A;  1HOM A;  3PQK A;  2HFH A;  3A01 B;  3BZK A;  3H5N A;  2BY3 A;  2O0Y A;  3CMA I;  1BBY A;  4HYE A;  4NC6 A;  4HNU A;  1P7I A;  3FIW A;  4BJ6 C;  3KP3 A;  1W7P D;  1O7F A;  1IJW C;  2V9V A;  1C0W A;  4LIV A;  3DWL E;  5B3S H;  3OOU A;  3V42 A;  1TWA J;  4B43 A;  1CF7 A;  2IS6 A;  2EV5 A;  4KIB A;  4IPA A;  1SD5 A;  1X58 A;  3OYG A;  3P5J A;  2KPM A;  5D4R A;  2ZSH B;  1ETW A;  3N4M A;  3A0H C;  1IAW A;  2A6H F;  1W4M A;  4RBO A;  3DQV C;  2KRH A;  2GLO A;  2KJC A;  1IRZ A;  2JA5 J;  3FMS A;  2E2J J;  2AXT C;  1YI2 I;  3VWB A;  4PJM A;  4XSZ F;  4DYR A;  2VC1 A;  1O7L A;  3CJT B;  1DUX C;  3FM3 A;  4LB5 A;  3DPL C;  2RV8 A;  3V7R A;  5LEK A;  3H0D A;  3CCL I;  3GEZ A;  1FMV A;  4AIJ A;  4BQN A;  4C2M J;  4UY8 I;  2B7E A;  1PUF B;  1R49 A;  5HS9 A;  2ISZ A;  3AL0 C;  1E3O C;  3JRH A;  1OIS A;  5H20 A;  2NVU B;  4BS9 A;  2E2I J;  2HPM A;  1WH5 A;  2L54 A;  3DKX A;  2BXY A;  3NAU A;  3ZQG A;  4I99 C;  2XRL A;  1TW3 A;  3DKW A;  1QGP A;  3AG2 H;  2ELJ A;  3OIP A;  3F9K A;  2IVM A;  2NS0 A;  4UVC A;  4AIH A;  4Q48 A;  1H0M A;  3MQ0 A;  3G73 A;  4X6A J;  3I58 A;  1ZK8 A;  4KFC A;  3ASN H;  4L5E A;  4ZYA A;  1TNS A;  4B3X A;  4M3E A;  4IKF A;  1SAX A;  3KP7 A;  4BQA A;  1SFK A;  2D5V A;  4XN3 A;  4WK8 F;  2HZT A;  3OYE A;  5CKT A;  2R7Q A;  1ZG1 A;  2CV2 A;  2XKP A;  1IN4 A;  2Q2E B;  3ISP A;  3T5X A;  4I0B A;  1SFU A;  3L2C A;  3QPS A;  2L7M P;  1WH7 A;  1PP8 F;  1MMG A;  2IPQ X;  3SFZ A;  3Q5F A;  2IT0 A;  3WTW C;  1TNT A;  4PSX A;  4IOC F;  3LWF A;  3BG3 A;  3SQN A;  2JVH A;  3PSF A;  1FOX A;  4NUB A;  5GPC A;  4JX6 A;  2CQK A;  2Z2S B;  4HX7 A;  3SXY A;  4QSH A;  2VBZ A;  3EDP A;  5LGT A;  1T6S A;  4V19 K;  5F04 A;  3V8L A;  2L01 A;  2EZH A;  3KE2 A;  2LH9 A;  3J7A O;  4UB8 C;  3OL3 A;  1JHH A;  3DV8 A;  2K40 A;  1HF0 A;  2GA2 A;  2KKO A;  2DAO A;  3F6O A;  1V5G A;  3VSL A;  3KZZ A;  2OJE D;  2DI3 A;  4MHG A;  3DBH B;  1D5V A;  4NDL A;  4WWC A;  4W97 A;  1N77 A;  3QPL A;  1GLN A;  1V5E A;  2K9S A;  4AC0 A;  4HV6 A;  1YLF A;  2M0M A;  2JRT A;  4CCL A;  4BH9 A;  3E0J B;  4XM3 A;  3WU0 A;  1ZRE A;  2MLG A;  2QCO A;  1YRN B;  4IRI A;  3GYH X;  2JVG A;  1XDU A;  2VBW A;  2L2O A;  4A69 C;  2WY7 Q;  1BI2 A;  3ZCO A;  3LSI A;  1SFX A;  4D1Q A;  3CF2 A;  2VT3 A;  4E7L A;  5K1Y A;  4A3L J;  4CYC A;  1MZB A;  3V7S A;  4ZYG A;  2XDV A;  1H89 C;  1BI3 A;  1R71 A;  2CYY A;  1DGR M;  2E71 A;  2VQC A;  2ID3 A;  2IA0 A;  2VIX A;  3Q9V A;  5GAH J;  3WTX C;  1A36 A;  4L9T A;  3ABK H;  4C3J J;  1WJC A;  2R93 J;  2P4W A;  1VQ9 I;  2DA4 A;  1IV6 A;  3NAR A;  4AYB A;  3GTP J;  5KNL A;  2D2W A;  2F4I A;  4ZZD A;  3OYH A;  2Z33 A;  1QA6 A;  1D0Z A;  3H35 A;  5IYB J;  4CA0 A;  3G6E I;  4JK1 X;  2DMU A;  3ZMT A;  3RYP A;  1MSE C;  3LSR A;  2FQ3 A;  4J19 A;  2X48 A;  3H36 A;  1U5T A;  2KZG A;  4BU2 A;  2YX4 A;  4M3F A;  4CGZ A;  2B63 J;  2LF7 A;  4HNV A;  2LMD A;  3JRD A;  2BW3 B;  1FSH A;  3WE3 A;  3GF2 A;  5JHU A;  2JMW A;  1CGP A;  2TCT A;  1APL C;  3QP5 A;  3HOZ J;  1X3W B;  4EGZ A;  2IS2 A;  3AG1 H;  2ZFW A;  1MBH A;  3CUQ A;  3ASO H;  1TT5 B;  2ZNZ A;  1JGG A;  3PFY A;  1KQ8 A;  3CC7 I;  1U8B A;  2KQR A;  3IP4 B;  1U9N A;  4IHT A;  4NQW B;  2L9V A;  2Y9Y A;  3LAJ A;  4F7Z A;  1HST A;  4NC8 A;  4AIK A;  4ENM A;  1Z0X A;  5E1W A;  3ELK A;  1MIJ A;  3S2D J;  1FEX A;  3CTA A;  4FET A;  4ZYD A;  2COM A;  5DUK A;  3TDU C;  3TO6 A;  3IV5 A;  4RM2 A;  3R6S A;  2WBM A;  2MC4 A;  5K7Z A;  5FFX A;  3K70 D;  3D5L A;  3JAM Z;  1W7P A;  4QTR A;  3GVA A;  2BVM A;  3DLA A;  5DV5 A;  3T8T A;  2KT0 A;  2V9P A;  4BQQ A;  1NG7 A;  4AD9 A;  4PSW A;  2OU2 A;  3TL4 X;  4P9F A;  2MLK A;  4P9U A;  5KK1 A;  1HKT A;  3K0L A;  4ESJ A;  2E34 A;  2XPV A;  1GHC A;  1QZY A;  4XID A;  2LY9 A;  2CMP A;  4BE0 A;  1U0J A;  2XSJ C;  3N05 A;  1ZR4 A;  4EAT A;  4OOI A;  3KPH A;  3RKY A;  4KMF A;  1ETQ A;  4HW0 A;  2JSP A;  2KZV A;  2BV6 A;  1ZAO A;  1T95 A;  4IEJ A;  4CDG A;  4G8X A;  2JA7 J;  3M8F A;  1RPW A;  4LK0 F;  5IY5 H;  2ME0 A;  3JSO A;  1K4S A;  4FX0 A;  4MTD A;  4A0X A;  3GFM A;  2VE8 A;  4ZTJ A;  4U0Y A;  2R7F A;  4I76 A;  1FT9 A;  4LB6 B;  2Y30 A;  2VJJ A;  4UB6 C;  5J8C A;  2LRD A;  1FWZ A;  4RS8 A;  4RGX A;  4BUP A;  4HRI A;  2VON A;  3DP7 A;  3VYR B;  4E7I A;  4RAF A;  2IGN A;  4RB2 C;  2IS4 A;  4FQG A;  3ZR8 X;  3HUG B;  4XKW A;  5LGU A;  2CGP A;  5JI6 A;  3V7C A;  4KDP A;  3KZI C;  3U1K A;  1Y0U A;  4W1U A;  5LRS A;  3DBL B;  1JI8 A;  3JAM K;  3WU1 B;  3HOV J;  1LPQ A;  3K1P A;  1XD7 A;  2ELH A;  2QA4 I;  3RCO A;  5EGO A;  4MO7 A;  1RI7 A;  3H5R A;  3LQQ A;  2Q8K A;  5J4V A;  3CP2 A;  4RB1 A;  5CVV A;  2PMZ N;  3P9K A;  2HEO A;  4ETS A;  1UHS A;  2D1H A;  3BP8 A;  4UUV A;  9ANT A;  1R5G A;  2HQ5 A;  2OZU A;  1RKT A;  2EFN A;  3DLL F;  2Z9O A;  2XF7 A;  5A2Q Z;  1KU2 A;  1TTY A;  1UAA A;  2JQ7 A;  1WJF A;  2EJR A;  4PK4 A;  3MN2 A;  3TMO A;  2GBY A;  1VQ4 I;  5E3L A;  2ZBK A;  2PI0 A;  1SD7 A;  1Z3X A;  2M4G A;  5F0C A;  3RQ4 A;  1H88 C;  3V8J A;  2HGC A;  1IC8 A;  5D5X B;  2QSG X;  5ERI A;  1DPU A;  4G6D A;  4PJJ A;  3D0S A;  1MKM A;  1SD6 A;  2LVS A;  3TW7 A;  1X1C A;  1Q1V A;  2EWN A;  5GTH C;  5EG0 A;  2QQ9 A;  1YS6 A;  3FXU A;  5DDG A;  2UWM A;  4BQO A;  2RQQ A;  4CUG A;  3PM1 A;  5TRD A;  2FBK A;  1Q1H A;  4A3D J;  3KZY A;  4XSX F;  1Z77 A;  5J8F A;  3K2A A;  1B72 B;  4IF4 A;  3ZQH A;  3SJM A;  2ISY A;  4A3I J;  4S04 A;  2KRF A;  2NXN B;  3C1D A;  3HG9 A;  2V26 A;  3K1N A;  1GXQ A;  4KNY A;  3F6V A;  2VI6 A;  3LFU A;  2M9H A;  3SYT A;  2DN0 A;  2HDW A;  4XLN F;  3OSG A;  3MMY B;  2FQ4 A;  4HQE A;  1R1U A;  3ROU A;  4A93 J;  2Z1D A;  4Y4R A;  5ED4 A;  1O3T A;  3ZN1 A;  4HZF A;  3HOY J;  3BCB A;  2LYC A;  3NQO A;  4I01 A;  1KU9 A;  3I71 A;  2VBX A;  2WWY A;  4N9H A;  2P8T A;  4RGR A;  1VF9 A;  1D0Y A;  5K7F A;  3AAF A;  5D8K B;  2DDB A;  5A2Q K;  3OR1 C;  3J7Y J;  1HDP A;  3H9G A;  1HCR A;  4YEL A;  3BDD A;  1BC7 C;  2X6Y A;  1Y1W J;  3PIO F;  3BY6 A;  2VUM J;  2CU7 A;  1G8X A;  1FIP A;  2RNG A;  1YIO A;  1FOW A;  2YU3 A;  2LY2 A;  2M5W A;  3M1C A;  2F5V A;  2K02 A;  2GM4 A;  5BNG A;  1I6H J;  2DTR A;  2ZC2 A;  3M1E A;  3L2R A;  3HSR A;  1Z6T A;  4QPO A;  2HS5 A;  1J2X A;  3D1N I;  1K6O A;  1R36 A;  4M9S A;  2HTS A;  3FHZ A;  2FMY A;  2XF6 A;  1T39 A;  3VEP A;  3WTS C;  5DCM A;  2R0Q C;  2W24 A;  1YHQ I;  1OJL A;  2D45 A;  3GX4 X;  2VPR A;  1WFX A;  1MDM A;  2ZJ2 A;  4IZZ A;  3TP3 A;  2R7R A;  4FCY A;  1KGS A;  1KU3 A;  5IT9 Z;  3BZC A;  1HQC A;  5FKN A;  1IO2 A;  5FKM A;  1IDZ A;  3H3U A;  3P7N A;  3MKZ A;  3BOQ A;  4L9V A;  1S8N A;  2I8D A;  5LRR A;  2F5E A;  1R1V A;  1TBX A;  2V7F A;  3BQY A;  4BXU A;  5KAI C;  5L3C A;  2IA2 A;  2KP6 A;  2MG4 A;  2PN6 A;  1SMT A;  1OR7 C;  3LMM A;  5TJJ A;  3R0A A;  5D5W B;  3A02 A;  1E3P A;  1V3F A;  2TDX A;  1I50 J;  4MIM A;  3FXM A;  1K79 A;  1LDK B;  3FMR A;  4FAS D;  3QPH A;  2R7U A;  1XCV A;  1D8J A;  2NAZ A;  2HXI A;  4BBR J;  2DA1 A;  2MSY A;  4LK1 F;  3IRQ A;  3TBI A;  2ECB A;  2IGM A;  2K9N A;  2M8E A;  1RES A;  4HG2 A;  3S1N J;  1SAU A;  3I59 A;  5J1R A;  4WXH A;  3FXR A;  4XRM A;  3LNQ A;  4FX4 A;  3K1M A;  4G6Q A;  1OCC H;  4CCO A;  1VQO I;  2BY0 A;  1BR4 A;  1FTT A;  1JXS A;  1T2K A;  1ORK A;  2G7H A;  1IUF A;  1S7E A;  4F3Q A;  1PDN C;  3K10 A;  1BL0 A;  3WTU C;  4L5J A;  2R7D A;  5KHD A;  1FJL A;  2E2H J;  3MFK A;  3GCM A;  1S7A A;  1WHU A;  5CVJ A;  4ZZL A;  1OCZ H;  1T56 A;  1JE8 A;  3TOA A;  2CJJ A;  5IT9 K;  2ZNY A;  1CQT A;  1TQM A;  3NWT A;  1LFU P;  2BE5 F;  1BJZ A;  1M1E B;  2CQ7 A;  3CLO A;  4JP0 A;  2IA1 A;  2EIL H;  1G59 A;  3C18 A;  4N0B A;  2I5U A;  5DEQ A;  3VYS B;  1YW7 A;  2PMU A;  3CQZ J;  3HM5 A;  5JFR A;  1VQN I;  4MEY F;  4AU7 A;  1AKH B;  3MCZ A;  4M6Y A;  1F43 A;  4RM3 A;  2PJR A;  3QU6 A;  2WY8 Q;  4X1E A;  1XTA A;  2M0C A;  3QOE A;  2HOS A;  2DQL A;  2DMQ A;  3QU3 A;  2E1N A;  2R92 J;  2AXL A;  2L02 A;  3K4M A;  1LE8 A;  4NNJ A;  1BM9 A;  1YIT I;  3KLO A;  5LHG A;  4KA4 A;  4FTH A;  3DEW A;  4GXO A;  2E36 A;  3WTY C;  3H1C A;  2VT2 A;  3JW4 A;  4BJT A;  3GTQ J;  4S05 A;  2X85 A;  1ZG3 A;  5GAE J;  5C4J J;  4D7N A;  3CCU I;  2GIV A;  3PIP F;  4OMZ A;  5L3D A;  5DD8 A;  3CC4 I;  2X6W A;  4QPQ A;  4B8X A;  2WAF A;  3OYJ A;  2HXO A;  2HDD A;  4G7Z F;  1X4O A;  3PFI A;  5ICG A;  2PQ8 A;  2NVY J;  2ETH A;  4P5O A;  2XAS A;  3LSK A;  4IHY A;  5GP9 A;  1N75 A;  2K4J A;  2CFO A;  1BOB A;  4AYB N;  3SZP A;  4OIO F;  3QYF A;  2W4S A;  4OIQ F;  2JUC A;  2M34 A;  2LR8 A;  3ZMS A;  1YIJ I;  3WE2 A;  5JLW A;  3IH3 A;  4CZC A;  2ZXI A;  1QPM A;  2O9L A;  3WGI A;  1Y1V J;  1IN5 A;  2O5R A;  1Z6R A;  3MKL A;  4UV9 A;  4DBQ A;  1X4P A;  3FXJ A;  1WKM A;  3GXO A;  1MJ9 A;  1WWX A;  2DPD A;  1LFP A;  2XPU A;  5HOD A;  1CF7 B;  5AIQ A;  1A35 A;  1I27 A;  2RVC A;  3LSP A;  3O3K A;  1XGO A;  3BR5 A;  2LBF A;  5IP7 J;  1SFO J;  1A6I A;  2L9N A;  2KFD A;  3R61 A;  4BEH A;  1DU6 A;  3IAS 2;  1BA5 A;  1RIO H;  2XSD C;  4IJA A;  4PGH A;  1XG1 A;  3SEQ A;  2DJI A;  2ESN A;  3RDI A;  3HB9 A;  4E7K A;  5KVR A;  3PO2 J;  1A04 A;  2MA3 A;  4HDV A;  4ENN A;  2D1V A;  3K4K A;  2OTJ I;  3OS1 A;  2WAD A;  1B8I A;  1MMS A;  1MJB A;  2XAQ A;  3TED A;  1J5Y A;  1JT0 A;  2E1O A;  2K86 A;  3U2R A;  3FXO A;  4XR6 A;  4XOR A;  3GFJ A;  4S0H B;  1TT0 A;  2L4M A;  3C7J A;  5EF6 A;  3WG7 H;  1R4M B;  1KA8 A;  3CDH A;  3BR3 A;  3OYB A;  4LIU A;  3OMY A;  5FD6 A;  4EJO A;  3WTT C;  3I9V 2;  1HSJ A;  3HSF A;  1SVL A;  4KN4 X;  2WA0 A;  2BVL A;  2VOP A;  2XAH A;  3HOU J;  3QRF F;  1UMQ A;  2QKL B;  1XN7 A;  5LBQ A;  2ZB9 A;  2XAG A;  1VND A;  2QZ8 A;  1X2N A;  1Z1D A;  1ZKG A;  3CCV I;  2NNN A;  2BEO A;  2V6E A;  3ULQ B;  3SEZ A;  1P4X A;  2OA4 A;  4E7H A;  1UG0 A;  2BBY A;  4J00 A;  3DPU A;  2BHZ A;  4II3 A;  2G0E A;  2DXI A;  2P5V A;  2EV6 A;  2DA6 A;  4I0A A;  4OU0 A;  3JRC A;  1DP7 P;  3M8E A;  4R8H A;  3WHC A;  3IKV A;  4EJU A;  2X0L A;  3QP6 A;  4IHS A;  1P9Q C;  2M7B A;  1X1A A;  5EDN A;  2IEK A;  2A69 F;  2XPW A;  1Z91 A;  3BG6 A;  2ACJ A;  1I6X A;  4XBF A;  3BTJ A;  1J75 A;  3KP6 A;  5FKL A;  3S8P A;  5C44 J;  1XMX A;  3JRI A;  2DOF A;  3GTK J;  3F8N A;  5HNH A;  3OOP A;  3TO7 A;  1WCM J;  2FD5 A;  3I4M J;  3OV8 A;  2V1N A;  5C3E J;  4D5F A;  3F8M A;  2HQN A;  5M5X J;  2CFX A;  2XB0 X;  4B09 A;  1QBJ A;  3VB2 A;  2ZME C;  3ZMZ A;  2VKE A;  3K4J A;  1T0F C;  3FDY A;  2Y48 A;  1K78 B;  1TWH J;  4MFE A;  3T0Y A;  5HDK A;  1WRJ A;  4HX8 A;  1STZ A;  3WTV C;  1V5F A;  4EMS A;  1MSF C;  2FBI A;  3K4B A;  3OYA A;  2E1M C;  2N8G A;  2JTV A;  2K3P A;  4KN7 X;  3CCE I;  1ZR2 A;  3HPH A;  3OY9 A;  3WTZ A;  1P6R A;  1WJ5 A;  2WTE A;  5CVU A;  3K7A J;  1K6Y A;  3L2U A;  2IRF G;  1JGS A;  1Z05 A;  3D5R C;  4PZJ A;  1JKP C;  5TGT A;  2MW8 A;  4ITV A;  4KJZ A;  1ZTR A;  5E1Z B;  5L3B A;  3OYF A;  2DCE A;  1T98 A;  3F72 A;  4OAZ A;  3EQL F;  3MEX A;  4IVN A;  1MBE A;  3GLL A;  3BG9 A;  4ZTF A;  2EIK H;  1UJ8 A;  5B1A H;  1VQ5 I;  1JUP A;  4HLY A;  4M3D A;  2PX9 A;  3EYY A;  4C3H J;  1ETX A;  3I5U A;  4UUS B;  2TRT A;  3IC7 A;  3LSJ A;  1LVK A;  5ILV A;  1XSD A;  1X3U A;  4ABZ A;  1YX3 A;  1MBF A;  2RDP A;  3I64 A;  2EIM H;  2LRE A;  2FUG 2;  4IOA F;  1U5T B;  2M4K A;  1FYK A;  1OCP A;  2L7F P;  4RB3 C;  2YPR A;  1IF1 A;  3C2G A;  1P4W A;  3B73 A;  3IUO A;  3CUQ B;  3A4C A;  5DM7 F;  1HLV A;  3HL2 A;  3H9Q A;  4ZYH A;  4IRH A;  1ACI A;  4HX4 A;  4I09 A;  4M73 A;  2WAE A;  3FKJ A;  3P9C A;  4E7S A;  3F3X A;  2F5D A;  3WGH A;  5E8I A;  4M3G A;  3E5U A;  2FNP A;  4U0V A;  3W3C A;  2HQA A;  4A5N A;  4GFB A;  2L4A A;  4KIF A;  4XL9 A;  4EJT A;  2EFP A;  2Q2E A;  1D1B A;  1EH8 A;  1DQU A;  3H9J A;  2NNY A;  3HOW J;  1E0E A;  2R7O A;  5F08 A;  4QIW N;  3ZQ7 A;  3TKY A;  1KYW A;  1MMN A;  4XKB A;  4F93 B;  4KT5 C;  2R7T A;  2V6C A;  2JK3 A;  1FBS A;  4JBA A;  3CES A;  4RDU A;  2QEN A;  3PL8 A;  4RLF A;  1W7P B;  4U87 A;  2ID6 A;  2DU9 A;  3BT9 A;  1IN8 A;  1WJA A;  2V1X A;  1D0X A;  3L7W A;  3MAJ A;  4KMU X;  4GYG A;  4CCK A;  2EFW A;  1YW9 A;  4AID A;  3TO9 A;  2LKP A;  4O3M A;  1W0U A;  3UNG C;  2AQF A;  1LNW A;  3S93 A;  2O6G E;  2OPT A;  4M72 A;  4CSW A;  2DA2 A;  4RAG A;  3L2Q A;  4A3K J;  2QGU A;  2ZXJ A;  2XRO A;  1ZGJ A;  3E6B A;  2HPI A;  1TWC J;  2ADU A;  2E35 A;  2P81 A;  3I3L A;  4KIG A;  4DW6 A;  1ZYR F;  3E97 A;  3HRU A;  2HZD A;  5F27 A;  2LFB A;  2H27 A;  3S3O A;  2Q1Z B;  1GV5 A;  3K69 A;  4CCM A;  2FF4 A;  2X4H A;  3BC8 A;  2JT1 A;  3IH2 A;  4V2G A;  1YRN A;  4PCQ A;  3Q0V A;  3G71 I;  3EUK L;  4M71 A;  1HKS A;  4BY7 J;  4HNT A;  2MBF A;  3LSH A;  3L2V A;  2G7U A;  1OCO H;  1RNL A;  1W5S A;  2K3F A;  1VQ6 I;  2B0L A;  2B9S A;  3RTR A;  2OAZ A;  2LP0 A;  4JYK A;  2F5F A;  1TL8 A;  3KFW X;  4ANJ A;  3KEQ A;  3HZJ A;  3AG3 H;  1T08 B;  3PUB A;  2WAQ A;  3U1D A;  1S5L C;  5FB2 A;  4XRS G;  4CYD A;  4XLP F;  2YUS A;  2PMH A;  2W1O A;  3BRO A;  1TP4 A;  2V9K A;  5J6X A;  4GDF A;  2DK5 A;  4B4C A;  2GZW A;  3FBN B;  3V8K A;  2Y31 A;  1YQA A;  5E3O A;  3ML6 A;  4HAM A;  1JJ6 C;  1I3A A;  2XHK A;  3FK7 A;  4A0Y A;  2IS1 A;  2Z5U A;  1FYL A;  2VKV A;  3E3V A;  5J1Y A;  1KU7 A;  1YOV B;  4YIR X;  2BW3 A;  1ZLK A;  5E18 F;  4X0G A;  3BG7 A;  4HF0 A;  2JRM A;  4DZP A;  2RKH A;  4Y17 A;  4MQ9 F;  1S6L A;  3JR9 A;  2NS8 A;  3EUH C;  1U78 A;  4BAY A;  3CLQ A;  3OYC A;  1QO0 D;  2A5W A;  2K85 A;  3HHG A;  3KP4 A;  2HI3 A;  3ZN0 A;  3ECH A;  1PJR A;  2NVX J;  1TWF J;  1YO5 C;  1YW8 A;  2XGX A;  4U88 A;  4Y3O A;  4A3G J;  1VFC A;  1FYM A;  3QOD A;  2P5L C;  2CQN A;  4BXX J;  1UCR A;  1ON2 A;  3ABM H;  2L3D A;  5EG0 B;  3DEE A;  5CLS A;  3C3W A;  1X1P A;  3J7Z I;  1OCT C;  1EV7 A;  1VQ7 I;  2VN2 A;  1ENH A;  3HKZ A;  2L9R A;  3W2W A;  4C9Y A;  3FXL A;  3CJR B;  2DLL A;  4EM1 A;  4XN0 A;  1BJA A;  3TW6 A;  2A6T A;  2IP2 A;  1JTY A;  2FX0 A;  4EQQ A;  4NHJ A;  2IBD A;  1IRF A;  3I4P A;  5H2F C;  3ZPL A;  2KMU A;  2YX7 A;  2A68 F;  2CUF A;  2M7A A;  1Z7L A;  4LG0 A;  2HKX A;  2EFO A;  5J47 A;  4UVB A;  4LLL A;  1ZGW A;  1U3E M;  3ABL H;  1EH6 A;  1EKE A;  2X1C A;  3SZT A;  3H3V K;  3ZQC A;  3LOC A;  1U8R A;  1VQK I;  2P6S A;  5HDG A;  4BDZ A;  1KQ9 A;  1X1D A;  2RC4 A;  4OMY A;  3PQJ A;  3LAP A;  5E17 F;  4Q4Z F;  1UFM A;  3E6C C;  2OZ6 A;  5F1J A;  1XDS A;  3HOS A;  5L3G A;  1HW2 A;  4HSR A;  2DJN A;  1J9I A;  3K2Z A;  2KL4 A;  3IHU A;  3ZMU A;  2AHQ A;  4OIN F;  2R4G A;  1RRJ A;  4WXC A;  2KIU A;  3CCQ I;  4RAY A;  1O3Q A;  3DF8 A;  2A05 A;  2VJI A;  1JKR C;  1W1W E;  1ZN2 A;  1S9H A;  2Y69 H;  2DMN A;  5EZH A;  3BTI A;  2E5N A;  1V55 H;  3D5S C;  2P0W A;  5HLH A;  1IZ1 A;  4RGS A;  2R7W A;  4P1W A;  2CUE A;  1XGN A;  2W82 A;  4A0Z A;  1EJ9 A;  2XAU A;  2ZME B;  1QVT A;  2VLA A;  3CD6 I;  1OLT A;  3B02 A;  4GO1 A;  1H8A C;  2LDU A;  2PLY A;  2VE9 A;  1ETK A;  1IN7 A;  1FNN A;  3JRA A;  4PUS A;  1MDM B;  3HRS A;  2NVT J;  2H1K A;  2E1M B;  2OV7 A;  1KZH A;  3BJA A;  2ECC A;  3LQR A;  3ONQ A;  2STT A;  4IHX A;  1W36 C;  2OF7 A;  4A3C J;  2IGK A;  1EH7 A;  4XMY A;  4CH7 A;  1FOK A;  1K61 A;  2QLZ A;  1RUO A;  2O8K A;  4XKV A;  2QVO A;  3F8F A;  1KON A;  4E70 A;  3PO3 J;  3J80 Z;  3BJO A;  3QOP A;  4L5I A;  3LFK A;  4B3A A;  3GBG A;  1LEB A;  2XGE A;  2A5Y B;  1V4R A;  2OBP A;  1BN5 A;  4FT8 A;  3HRM A;  3UKG A;  3REO A;  4AVZ A;  2VBY A;  3J7A Y;  2V1U A;  3FZV A;  2EA2 A;  1IXS B;  4H0E A;  4EGY A;  3O8G A;  2M3A A;  1FLI A;  3CUO A;  3O8H A;  3AKZ A;  3GWZ A;  2AS5 F;  1ETY A;  1J59 A;  2OD5 A;  4C3I J;  1BI0 A;  4UUT A;  1IXC A;  2X1E A;  2FXA A;  1U9O A;  3HBL A;  4ON0 A;  2CW0 F;  2UXX A;  4E6K G;  2HVQ A;  5DTD A;  1B72 A;  4ZC3 A;  3KYL A;  4L18 B;  4I02 A;  3S1M J;  3ZGK A;  2R7S A;  2I10 A;  5F0F A;  4RAZ A;  1RC9 A;  2R5Z B;  2F4M B;  2QBY A;  1X2M A;  3QYE A;  3KET A;  3KYC B;  3J81 Z;  1T0F A;  4Q5S F;  2EK5 A;  3H0G J;  2PG4 A;  1AHD P;  1XSV A;  2EIN H;  3JTH A;  3CF5 F;  3TDZ C;  4PJL A;  1ZQ3 P;  4L9N A;  1BIA A;  3DTK A;  3KLN A;  5F6F A;  1S7O A;  2KLO A;  3W6K B;  1XB4 A;  2HU9 A;  1XMA A;  1K7A A;  4RMN A;  4FE7 A;  5CQE A;  1WGX A;  3TOB A;  1U2W A;  3J80 K;  4AVP A;  2MGQ A;  4XLC A;  2V4J C;  4B1R A;  3I53 A;  5L3E A;  2KRC A;  4HF2 A;  5K5Q A;  2LLK A;  4HV5 A;  2KIF A;  1L3L A;  3L1P A;  2VPL A;  3SFI A;  1YJW I;  2W84 A;  2XB5 A;  6PAX A;  4XLE A;  2QEX I;  2PJP A;  1U5T C;  2VKH A;  1PYV A;  2PJR B;  3IWF A;  2ICW G;  2YS9 A;  3E1S A;  2XIG A;  1G6N A;  2JUG A;  2E1C A;  1REP C;  3BPV A;  5B5E C;  5IPA A;  4KIC A;  1ZRC A;  1TLH B;  3CUQ C;  3CC2 I;  2GA1 A;  1J7K A;  2EZL A;  3KEY A;  4A3F J;  3BTL A;  5IYC J;  4LGW A;  2MAB A;  1UHM A;  4YEJ A;  3SDG A;  1QHH D;  4EEF G;  4A3B J;  2J5P A;  3MZH A;  2EIJ H;  2FRH A;  5AIP A;  2HOT A;  1RZ4 A;  1VQP I;  3M7G A;  4DZJ A;  5F0H A;  1F9N A;  2KIS A;  2EFQ A;  5CPR B;  3E7L A;  3FX3 A;  2GXA A;  1ULY A;  3J81 K;  2HQR A;  1OMI A;  2PFB A;  2JPB A;  3GFL A;  1A6Q A;  3WHB A;  1RR8 C;  1R22 A;  1FC3 A;  3IL2 A;  1VTN C;  3HTU A;  2YR2 A;  5IT3 A;  2FBH A;  2XC7 A;  1W36 D;  2NOG A;  1ZHF A;  1R6R A;  4I7H A;  3VYU B;  1DPR A;  3LA3 A;  2W85 A;  4RGU A;  1UG2 A;  3DTI A;  2A6E F;  1YFH A;  1JT6 A;  1TWG J;  1YS7 A;  1S3J A;  2K9L A;  4ESB A;  4RA2 A;  4DYC A;  1VQM I;  4XQF A;  1IN6 A;  1PUE E;  2EPF A;  3I0T A;  4Y7N J;  3S17 J;  5HNF A;  5B66 C;  4G7O F;  1Y8R B;  1X3Z B;  1XSX A;  4D9J A;  2UUZ A;  4M9X A;  4EM0 B;  4XOT A;  5AON A;  2UXN A;  2KDO A;  1J09 A;  3S15 J;  3G1O A;  3MWM A;  1FOY A;  3MKY B;  3W6V A;  2M2E A;  2IAI A;  3LA7 A;  1FMW A;  2R5Y B;  2Y2Z A;  4WX9 A;  1QQI A;  3HJE A;  2HR3 A;  2JN6 A;  4HEA 2;  1PVE A;  3E6M A;  2R7X A;  2OCE A;  3U21 A;  3RKX A;  2GOM A;  2PMZ A;  3K9T A;  3M3Y J;  3P9I A;  1Y39 A;  3R4K A;  1UST A;  3HPG A;  1FP2 A;  4XRF A;  4KIT B;  2PBI A;  2STW A;  2FU4 A;  2K9M A;  3GFI A;  1P4A A;  1ONV A;  5EEG A;  1B9M A;  2H1L A;  3LSM A;  1B4A A;  1N25 A;  2HTJ A;  2PEX A;  5ILS A;  1OQY A;  2GXG A;  2QF7 A;  5EJC A;  4L9J A;  1T33 A;  5TIS C;  5F1R A;  2CUJ A;  2YSR A;  1ZAR A;  4XOP A;  1AKH A;  2HVR A;  1E17 A;  4Y33 A;  4MGR A;  2QWW A;  2CV1 A;  1DGW Y;  3CP8 A;  1R5I D;  1SVM A;  2M45 A;  3AG4 H;  3TGN A;  1LQ1 A;  1MNM C;  3DKY A;  1JKO C;  2UZK A;  1FX7 A;  4A5M A;  1DP3 A;  1VZ0 A;  1HDD C;  4IQJ A;  5ICE A;  3BQZ A;  3RI4 A;  2ZKZ A;  1D1A A;  4BE1 A;  2HYJ A;  3RQI A;  5CJ9 A;  5JHF A;  2VC0 A;  2KIQ A;  2X9D A;  3CCM I;  2OQG A;  1MH3 A;  3RKQ A;  5M5W J;  2K7L A;  2RAE A;  4L0Z B;  4D0P A;  3S14 J;  2MYS A;  3HHH A;  1P7J A;  3OIQ A;  4ZH4 F;  3QYB A;  3Q3S A;  1H9G A;  4XNF A;  3TQN A;  2ZJR F;  2XV4 S;  3HGG A;  1UHW A;  1BW6 A;  5J1U A;  2FE3 A;  1OYY A;  5BQT A;  2WAQ N;  1SC7 A;  2VXZ A;  2QM3 A;  3ZMV A;  3DEU A;  4L0Y B;  2QQA A;  1R4N B;  4YRV A;  3L00 A;  4I98 B;  1HW1 A;  1B9N A;  4Z6Y A;  2ME6 A;  2O03 A;  1ZEL A;  2DFI A;  4YFX F;  3KCC A;  3H5A A;  1LB2 A;  3VPR A;  3BTC A;  3E5X A;  5HVQ C;  1D8K A;  1OKR A;  3ERM A;  4IRG A;  3CME I;  3VOD A;  5GAD J;  1ZG5 A;  2IGO A;  1JUS A;  2F48 A;  3BR2 A;  1IGN A;  3BG5 A;  4N4O B;  4YIF A;  3CO7 C;  1IUY A;  2Q0O A;  3HEF A;  3G3Z A;  5CVR A;  4A6D A;  1ITY A;  1G3T A;  3MVP A;  3CJN A;  2Y0M A;  2X6X A;  3EET A;  3ZOB A;  2DOA A;  1T8I A;  4C2T A;  2EZI A;  2P6T A;  1SFE A;  1YYV A;  4OWR B;  4EV0 A;  2H8R A;  2DT6 A;  1LDJ A;  4A3E J;  3C2B A;  1B59 A;  3RYR A;  1RKW A;  5LHI A;  1W0T A;  2GOX B;  2O7O A;  1QZE A;  4HOB A;  3IAM 2;  5KCM A;  4DGW B;  2DW4 A;  4A3M J;  1OFC X;  2FSW A;  2Y0S A;  2L7Z A;  4M6X A;  3RSN A;  1ZH5 A;  4A3J J;  2Y9Z A;  3HKZ N;  1FSE A;  2ZSI B;  3FXQ A;  4I2O A;  5K5O A;  1Y0N A;  1KQ0 A;  2DA7 A;  3A01 A;  3VOE A;  2QQB A;  4DIQ A;  4BL0 B;  1AA7 A;  3GLX A;  2A07 F;  4JQF A;  2ELK A;  4Y15 A;  2VJ5 A;  3E6D A;  2BZT A;  4O6J A;  1WJB A;  2P7V B;  1EA3 A;  1P2F A;  1LUJ B;  3VYT B;  2UV1 A;  3EYI A;  3GO5 A;  4BE2 A;  2OC6 A;  3C2H A;  4WF2 A;  4A6E A;  4PJN A;  4ZDP A;  2JA8 J;  4FHT A;  3JRE A;  3W2A A;  2JZY A;  1WSU A;  2LY1 A;  1XMK A;  4F91 B;  3SZG A;  2QSF X;  5JR3 A;  1G3S A;  1TW2 A;  2O3F A;  2GQQ A;  2FEZ A;  5ILU A;  2DO7 A;  1QZZ A;  4DJA A;  1B1B A;  1BOA A;  3F8B A;  3LL7 A;  4CYC B;  3RZD J;  3IH4 A;  4XLA A;  4P96 A;  2KHM A;  3KP2 A;  2GXB A;  4IQ4 A;  2HKO A;  1NG6 A;  3X2Q H;  4PJ0 C;  1PP7 U;  5HDN A;  5IP9 J;  2E7X A;  4KUM A;  2ZJQ F;  2IW5 A;  4MTE A;  1BC8 C;  2L0K A;  3K70 C;  5LLQ A;  1PUF A;  1AOY A;  2LKS A;  1BW5 A;  2CO5 A;  1UB9 A;  4B47 A;  3OYD A;  1IXR C;  1F36 A;  3F8C A;  2FA5 A;  3GME A;  2XGC A;  2E5Z A;  2RGV A;  1QHG A;  3Q0U A;  3HYI A;  3KEO A;  3OYL A;  5M3F J;  3NRV A;  2LG4 A;  4E4H A;  1X19 A;  4NBQ A;  2CQQ A;  2FOW A;  1LDD A;  4BNC A;  4JOM A;  2HWV A;  3CMY A;  2L9S A;  3ZQI A;  4A2U A;  3DTE A;  4UHT A;  1AWC A;  3Q9S A;  1WVR A;  2MFZ A;  3DCF A;  1DU0 A;  4XRS A;  2M87 A;  2VOD A;  5JLX A;  4OIP F;  3CJQ B;  1X1B A;  3CO6 C;  2VQG A;  2WB1 A;  3OSF A;  5L3F A;  1K78 A;  2F4O B;  3I54 A;  4FE4 A;  5LGN A;  4CCN A;  5CYV A;  3DPT A;  2BY1 A;  2HNH A;  2DK8 A;  4MLO A;  5FFZ A;  4TV7 A;  4GRI A;  1VQL I;  3BZ6 A;  3OS0 A;  2CW8 A;  3F21 A;  3G1M A;  5HS7 A;  2M8G X;  3QQA A;  1OYI A;  1QRY A;  3CDI A;  4E7Z A;  1MJA A;  3GZ5 A;  4M3B A;  1DDN A;  1R58 A;  1OR7 A;  1WJE A;  3LSG A;  2LD5 A;  2ZXH A;  2A61 A;  3O6B B;  4OAY A;  5LHH A;  5IYD J;  4GCV A;  2H94 A;  3ZXS A;  1I1S A;  2P5K A;  2FNA A;  1MBJ A;  2M30 A;  2MD5 A;  3KP5 A;  4CZZ A;  2HYG D;  2X51 A;  4ZJZ A;  3N97 A;  2K4B A;  3JTG A;  4PDK A;  5EEA A;  3ABU A;  3OWT A;  4ZYE A;  2O61 A;  1GVJ A;  2DYR H;  4ASN A;  4UUS A;  3L9F A;  2NYX A;  4BY1 J;  1UEL B;  1E2X A;  3ZRG A;  1T38 A;  5FRM A;  4AUX A;  3R60 A;  4BXF A;  1XPX A;  1G3Y A;  5HLI A;  4XLH A;  4RB0 A;  4P55 A;  5BPI A;  3K6G A;  3ZQF A;  2DQR A;  3GTJ J;  4BHC A;  4KT6 A;  5HLT A;  3BR6 A;  3GTO J;  1A5J A;  4HDU A;  2JWT A;  3T1B A;  1HXD A;  1QU3 A;  3RPU D;  5FRN A;  4BJ5 C;  1SVO A;  2DBB A;  1FP1 D;  2ZFU A;  3W6J B;  3ZQQ A;  4CO8 A;  4YII A;  1ZLJ A;  3S32 A;  4V2F A;  1Z7U A;  1NK3 P;  5C4X J;  2JA2 A;  5FGM A;  2QYO A;  5DS9 A;  1SMY F;  2M1B A;  2DFE A;  3VDX A;  3PNY A;  4YFN F;  4KIS A;  3EUA A;  5FO5 A;  1MH4 A;  2YU9 J;  2HDC A;  1MNE A;  5E79 C;  4XIC A;  4IXA A;  1XC5 A;  1SEU A;  1I1G A;  4U7D A;  1IDY A;  2BY2 A;  3AFH A; 
#chains in the Genus database with same CATH homology
 3HGY A;  3UKG A;  2HXO A;  2D5V A;  3JRF A;  2HDD A;  5EGO B;  1GT0 C;  3FKI J;  2NVY J;  4IHY A;  3O8G A;  5GP9 A;  1WI3 A;  3O8H A;  4AYB N;  1ETY A;  1VI0 A;  3QPS A;  4C3I J;  2L7M P;  4UUT A;  1WH7 A;  2M34 A;  2LR8 A;  2E19 A;  1U9O A;  3HBL A;  5JLW A;  3IH3 A;  3TP0 A;  5DTD A;  1B72 A;  2DMT A;  2O9L A;  3BG3 A;  4JX4 A;  1Y1V J;  3S1M J;  5GPC A;  4JX6 A;  2I10 A;  1QVU A;  3MKL A;  3HOX J;  5F0F A;  4QSH A;  5F04 A;  3S1Q J;  2R5Z B;  2EZH A;  1X2M A;  2XPU A;  5HOD A;  1IG7 A;  3H0G J;  2K40 A;  3LSP A;  1SFO J;  3BR5 A;  5IP7 J;  1HF0 A;  1AHD P;  1A6I A;  3Q0W A;  1DU6 A;  5EZG A;  1ZQ3 P;  4FIS A;  1MBG A;  1BA5 A;  4JX5 A;  2XSD C;  1XG1 A;  3RZO J;  1GUU A;  4NDL A;  2CRG A;  2WV1 A;  4W97 A;  3HB9 A;  3QPL A;  1AU7 A;  4FE7 A;  1WGX A;  3PO2 J;  4AC0 A;  1SAN A;  2K9S A;  2MGQ A;  4B1R A;  5K7H A;  1B8I A;  2LLK A;  2NS7 A;  3L1P A;  3TED A;  3SFI A;  2NVQ J;  1JT0 A;  2E1O A;  2QCO A;  2XB5 A;  1YRN B;  1NTC A;  4XK4 A;  4S0H B;  4A69 C;  5EF6 A;  3S2H J;  2YS9 A;  3BR3 A;  2LKX A;  4A3L J;  4CYC A;  5IPA A;  3ZQL A;  1H89 C;  3F0C A;  2HOA A;  2ID3 A;  2EZL A;  4A3F J;  3HOU J;  1I3Q J;  1UMQ A;  3BTL A;  5IYC J;  4C3J J;  2R93 J;  2ZB9 A;  2DTZ A;  1VND A;  3SDG A;  2DA4 A;  4EEF G;  1IV6 A;  2JA6 J;  1X2N A;  4A3B J;  3NAR A;  3GTP J;  1ZKG A;  2HOT A;  4DZJ A;  5F0H A;  5M3M J;  5IYB J;  3E7L A;  1FIA A;  2DMU A;  1MSE C;  3LSR A;  1JTX A;  1QPI A;  4J19 A;  2X48 A;  2EZK A;  4M3F A;  2G0E A;  3WHB A;  2B63 J;  4HNV A;  2X6O A;  2DA6 A;  3JRD A;  2JMW A;  2NOG A;  2TCT A;  1APL C;  3HOZ J;  3JRC A;  2R7Z J;  1MBH A;  3WHC A;  3CCY A;  1UG2 A;  5EDN A;  1JGG A;  2IEK A;  2XPW A;  3JRB A;  1JT6 A;  3BR0 A;  1U8B A;  1TWG J;  1U9N A;  2K9Q A;  3BTJ A;  4DYC A;  5FKL A;  2Y9Y A;  5C44 J;  3JRI A;  3S17 J;  3GTK J;  4Y7N J;  1D5Y A;  2XGD A;  1Z0X A;  1WCM J;  2FD5 A;  3I4M J;  3S2D J;  1FEX A;  5C3E J;  4D5F A;  5M5X J;  1TC3 C;  4D5C A;  3IV5 A;  2XB0 X;  3FIS A;  5K7Z A;  3S15 J;  1R9T J;  2VKE A;  3G1O A;  4QTR A;  4Y52 J;  3W6V A;  1TWH J;  2M2E A;  4MFE A;  2IAI A;  2R5Y B;  2KT0 A;  2Y2Z A;  1JUM A;  5IOZ A;  1MSF C;  2JN6 A;  2N8G A;  1RR7 A;  1NK2 P;  5IP6 A;  3M3Y J;  1ZR2 A;  2XPV A;  5FLM J;  5M5Y J;  4XID A;  2LY9 A;  4LOC A;  5GPA A;  3K7A J;  1ZR4 A;  1JKP C;  2MW8 A;  1ETQ A;  1ZTR A;  2QF7 A;  4IEJ A;  5FKO A;  1K83 J;  5J3L A;  3GTG J;  2JA7 J;  1RPW A;  1T33 A;  2ME0 A;  1MBE A;  3BG9 A;  1AKH A;  1JUP A;  3CDL A;  4M3D A;  3OIO A;  4C3H J;  1ETX A;  4UUS B;  2TRT A;  3LSJ A;  1MNM C;  4I76 A;  2Y30 A;  1JKO C;  4ABZ A;  1MBF A;  2Y0S N;  4I6Z A;  2DA3 A;  2LK2 A;  1HDD C;  1MBK A;  3BQZ A;  3JRG A;  5FLV A;  3BR1 A;  2HYJ A;  3RQI A;  2DA5 A;  1OCP A;  2L7F P;  2X9D A;  3RKQ A;  1MH3 A;  2AO9 A;  5M5W J;  1HLV A;  4W1U A;  2RAE A;  3S14 J;  1P7J A;  3HOV J;  3Q3S A;  4M3G A;  3HGG A;  1BW6 A;  5J1U A;  5EGO A;  2EBI A;  2WAQ N;  4MO7 A;  4GFB A;  1LE8 B;  1EF4 A;  2PMZ N;  1UHS A;  3HOW J;  1JKQ C;  9ANT A;  5F08 A;  2HQ5 A;  2ME6 A;  1RKT A;  4QIW N;  4IHX A;  3MN2 A;  3VPR A;  3BTC A;  4G12 A;  2GBY A;  1POG A;  5E3L A;  3G1L A;  2LTP A;  2JK3 A;  5F0C A;  1H88 C;  1JUS A;  1IC8 A;  1GVD A;  4RDU A;  3BR2 A;  1IGN A;  3BG5 A;  3M4O J;  2ID6 A;  2LVS A;  3TW7 A;  3HEF A;  4BBS J;  1Q1V A;  3BT9 A;  2R5Z A;  1G2H A;  1ITY A;  3MVP A;  3ZOB A;  5EG0 A;  1JJ8 C;  1GDT A;  2EZI A;  1W0U A;  3PM1 A;  2H8R A;  2OPT A;  3C2B A;  4A3E J;  2DA2 A;  4A3D J;  1B72 B;  1Z77 A;  1RKW A;  3K2A A;  1FTZ A;  4A3K J;  2EH3 A;  3ZQH A;  3FK6 A;  3SJM A;  1W0T A;  5EYR A;  2O7O A;  4A3I J;  3GTL J;  1TWC J;  5E3N A;  2P81 A;  2CQX A;  4DW6 A;  1XS9 A;  4M6V A;  4A3M J;  1OFC X;  2L7Z A;  2JJ7 A;  2VI6 A;  2M9H A;  5F27 A;  2DN0 A;  2LFB A;  3OSG A;  4A3J J;  1GV5 A;  2Y9Z A;  3HKZ N;  2FQ4 A;  4V2G A;  3IH2 A;  4A93 J;  3B6A A;  1YRN A;  2WB1 N;  2DA7 A;  3Q0V A;  3A01 A;  4BY7 J;  3HOY J;  2ELK A;  5FJ8 J;  2LP0 A;  4JYK A;  3B6C A;  1VF9 A;  2FJ1 A;  5K7F A;  1HDP A;  2EQR A;  1HCR A;  4XRS G;  2YUS A;  1B8I B;  2JA8 J;  3JRE A;  1Y1W J;  1LFB A;  3HDD A;  2VUM J;  2CU7 A;  4BKX A;  2DMP A;  1FIP A;  4B4C A;  2W48 A;  2Y31 A;  5E3O A;  1JJ6 C;  3FK7 A;  2GM4 A;  5E3M A;  5BNG A;  1I6H J;  4CYC B;  3RZD J;  2VKV A;  3IH4 A;  5J1Y A;  3D1N I;  2COB A;  2KDZ A;  5IP9 J;  4DZP A;  2R0Q C;  2L0K A;  1OJL A;  1PUF A;  1BW5 A;  2VPR A;  3A03 A;  3JR9 A;  2NS8 A;  5FKK A;  5IOY A;  1U78 A;  3TP3 A;  3S16 J;  4FCY A;  1O4X A;  1F36 A;  4D7M A;  5FKN A;  2HI3 A;  5FKM A;  1IDZ A;  2XGC A;  3I4N J;  2NVX J;  1TWF J;  1RET A;  3Q0U A;  5M3F J;  4A3G J;  1VFC A;  4DYQ A;  3BQY A;  2CQQ A;  4BXX J;  3CMY A;  5EG0 B;  2MG4 A;  3ZQI A;  1ETO A;  1OCT C;  3A02 A;  3DCF A;  1DU0 A;  4XRS A;  5JLX A;  1GV2 A;  1ENH A;  1I50 J;  3S1R J;  4MIM A;  2L9R A;  3OSF A;  3GTM J;  3TW6 A;  4FE4 A;  4IHW A;  4MFD A;  2HXI A;  1JTY A;  2DA1 A;  2FX0 A;  2MSY A;  4BBR J;  2R5Y A;  2ECB A;  4IHV A;  2K9N A;  2IBD A;  4MLO A;  1RES A;  1ETV A;  1WPK A;  2CUF A;  3S1N J;  1HOM A;  5J1R A;  4XRM A;  3G1M A;  3LNQ A;  1ZGW A;  2M8G X;  1FTT A;  3QQA A;  1QRY A;  3A01 B;  3H3V K;  1ORK A;  3LOC A;  3ZQC A;  1IUF A;  1S7E A;  4M3B A;  3LSG A;  1P7I A;  3FIW A;  2LD5 A;  1BL0 A;  5IYD J;  1IJW C;  1FJL A;  5F1J A;  2E2H J;  1MBJ A;  3OOU A;  2DJN A;  1TWA J;  1T56 A;  2AHQ A;  1X58 A;  5EEA A;  2CJJ A;  1ETW A;  1CQT A;  1LFU P;  4UUS A;  1BJZ A;  4RBO A;  4BY1 J;  1JKR C;  2GLO A;  4AUX A;  4JP0 A;  2DMN A;  5EZH A;  1IRZ A;  2JA5 J;  3BTI A;  2E2J J;  4DYR A;  2CUE A;  3ZQF A;  3GTJ J;  1QVT A;  3BR6 A;  3GTO J;  1H8A C;  3CQZ J;  3HM5 A;  2JWT A;  1A5J A;  1ETK A;  4C2M J;  1AKH B;  1PUF B;  3JRA A;  1F43 A;  2NVT J;  2H1K A;  4X1E A;  1E3O C;  2M0C A;  3JRH A;  2ECC A;  4V2F A;  2HOS A;  2E2I J;  2DMQ A;  1NK3 P;  5C4X J;  2R92 J;  2OF7 A;  1WH5 A;  4A3C J;  1LE8 A;  5DS9 A;  3NAU A;  3ZQG A;  1K61 A;  2O8K A;  1MH4 A;  4FTH A;  2XRL A;  2YU9 J;  3DEW A;  4XIC A;  3PO3 J;  1XC5 A;  3GTQ J;  4B3A A;  3GBG A;  4X6A J;  2XGE A;  1IDY A;  5C4J J;  1ZK8 A;  4D7N A;  4L5E A;  4M3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...