2E1OA

Solution structure of rsgi ruh-028, a homeobox domain from human cdna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein PRH
publication title Solution structure of RSGI RUH-028, a homeobox domain from human cDNA
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e1oA01
4RBOA 4J19A 2JA5J 4G12A 1PUFB 5FLVA 1ETWA 2VI6A 3C2BA 5J1UA 2DMQA 5EEAA 1BL0A 1CQTA 5J1RA 2E19A 4Y7NJ 1HDDC 4BBRJ 4XICA 3GTOJ 3F0CA 2H1KA 1XC5A 2XPVA 3G1LA 1GV5A 1IV6A 3BR6A 3SFIA 4V2FA 3BG3A 1B72A 1T33A 2XB0X 3HB9A 3TW6A 2ID3A 5IP7J 2HOTA 5C4JJ 2HQ5A 4DYRA 1WH7A 1ZQ3P 1POGA 3K7AJ 1X2MA 2JN6A 2FQ4A 1ZR4A 1IJWC 3LSRA 4A93J 1XG1A 3BTIA 3TEDA 1ETQA 2R5YA 2EH3A 1VF9A 1NK3P 1MBJA 4MO7A 4DZPA 3LSPA 3BT9A 4DYCA 3RKQA 2R92J 4A3FJ 3Q0VA 2TRTA 1OFCX 1BA5A 1IGNA 4IHXA 4A3DJ 1UMQA 2JJ7A 2CRGA 2GBYA 3GTMJ 5DS9A 1U8BA 1MNMC 2LY9A 3CDLA 3GTLJ 1HDPA 2R0QC 2GLOA 1WCMJ 1ETYA 2GM4A 3GTJJ 1MBHA 2XGEA 3B6AA 1VI0A 2ZB9A 1OJLA 1LE8A 4AC0A 4JX6A 1JKOC 5EG0A 1BJZA 2L7MP 5F0FA 2JK3A 1B72B 4AYBN 5FKNA 2Y31A 5F04A 3GTGJ 2JMWA 2K9QA 1JKQC 1H88C 2R5YB 2CQXA 3PO2J 1K61A 3HOXJ 2JA8J 1JTXA 1U9NA 1FTTA 3JRFA 1RR7A 1WH5A 1LFBA 1DU0A 2LK2A 2OPTA 3HBLA 4MIMA 1JJ8C 1MBEA 2FJ1A 1MSFC 3OIOA 2CUFA 1WI3A 3HDDA 3H3VK 3HM5A 1JT0A 1RPWA 5E3OA 1H8AC 1TC3C 4B3AA 1ENHA 1MH4A 2R7ZJ 3M3YJ 3S17J 2MW8A 3IH3A 3NAUA 5E3MA 4XIDA 1LE8B 3MN2A 5M5XJ 1I6HJ 1E3OC 2YUSA 2KDZA 2R5ZA 5IOYA 3A02A 5IYBJ 5IP9J 2NOGA 1GDTA 4C3HJ 1MBKA 2NS8A 1QRYA 1W0UA 4A3EJ 2O8KA 3GTPJ 1FTZA 2WB1N 3TP0A 2E1OA 1F43A 4AUXA 4D7NA 3JRDA 1TWFJ 3GTKJ 1ETKA 2D5VA 1X2NA 2XGCA 1Q1VA 1NTCA 3LSJA 5C44J 3OSGA 1YRNB 4A3GJ 1WPKA 1AHDP 1JT6A 2XPUA 1JUMA 3S1RJ 3O8GA 1B8IA 2NVYJ 2DA7A 2FX0A 3HOUJ 3S2DJ 3FIWA 5K7FA 2Y9YA 5F08A 1GV2A 4GFBA 3DEWA 2L9RA 5J1YA 2N8GA 2EZIA 5EDNA 3K2AA 1TWCJ 3TW7A 2KT0A 2ECCA 5IOZA 1JKRC 2AHQA 3IV5A 5JLWA 2R5ZB 1MH3A 3GBGA 2DA2A 4A3CJ 4XK4A 3H0GJ 2VUMJ 2X6OA 3WHCA 4D5FA 1IC8A 2IAIA 1VNDA 5M3FJ 1ITYA 4JP0A 1ZK8A 4BKXA 5E3NA 1AU7A 5IYCJ 2DMNA 1B8IB 2K40A 2LKXA 1Y1WJ 5FKOA 3G1OA 2DA6A 2HXIA 4CYCA 2B63J 1TWGJ 2JWTA 2LTPA 3JRAA 2VPRA 4BY1J 5C3EJ 5M5WJ 1QPIA 4UUTA 3DCFA 2QF7A 5K7ZA 2ME6A 2EZHA 2DJNA 1JJ6C 2LLKA 1I50J 2R93J 1IDZA 3S1NJ 3LOCA 4A3BJ 2MSYA 3S15J 4BY7J 1BW5A 5BNGA 1JUSA 3M4OJ 4B1RA 2E2JJ 2NVXJ 4IHWA 5EGOB 2LR8A 3VPRA 2COBA 5FLMJ 1QVTA 2WAQN 1RESA 1YRNA 5M3MJ 2X9DA 3JREA 2RAEA 4I76A 4XRMA 2E2HJ 4CYCB 4IHVA 4Y52J 3HGYA 4M6VA 2XRLA 3JRGA 1MBFA 1GT0C 2O9LA 4C2MJ 2Y2ZA 2XSDC 1FIAA 3JR9A 2AO9A 1UG2A 4I6ZA 4DW6A 2CJJA 5IPAA 4JYKA 3RZDJ 3A03A 1LFUP 3NARA 3HEFA 1ETXA 2G0EA 4IEJA 3JRCA 1U9OA 3PM1A 2YU9J 4RDUA 2ID6A 1APLC 2M2EA 2Y0SN 3L1PA 3BR5A 2K9NA 1P7JA 3MKLA 2XPWA 2XB5A 1RKTA 1MBGA 4MFDA 5C4XJ 4C3IJ 3G1MA 1EF4A 2HOSA 2EBIA 2WV1A 5GPCA 4A3JJ 1D5YA 1JGGA 3RQIA 4EEFG 4JX5A 4QTRA 1H89C 1Y1VJ 4A3LJ 1IRZA 1WGXA 4DYQA 2HXOA 2CQQA 3S14J 1ETOA 4FE7A 2M34A 3FKIJ 3BR1A 3JRHA 2ELKA 4NDLA 5F1JA 4FCYA 1P7IA 3HOVJ 3IH2A 5GPAA 4FISA 4JX4A 3CMYA 2M0CA 1QVUA 2OF7A 5DTDA 4QSHA 1HF0A 1I3QJ 3ZQGA 2TCTA 2DMPA 4A3MJ 2CUEA 2LP0A 3D1NI 4D7MA 1OCTC 2W48A 2O7OA 3HKZN 3MVPA 3WHBA 1TWAJ 3BG5A 3S1QJ 4BBSJ 1IDYA 3QPSA 1A5JA 2E2IJ 2HYJA 3Q0WA 4XRSG 2DA1A 3FK6A 3FISA 1FJLA 1U78A 4A3IJ 2IBDA 4HNVA 3I4NJ 1VFCA 1SANA 5EGOA 4X6AJ 1UHSA 3BR0A 2DN0A 3Q0UA 2EZKA 5F0HA 3OOUA 4B4CA 4C3JJ 1IG7A 3I4MJ 2IEKA 2PMZN 1JUPA 3S16J 1SFOJ 1T56A 2VKVA 3S2HJ 2L7FP 4UUSA 1XS9A 2MGQA 4FE4A 1W0TA 3ZQHA 1O4XA 3RZOJ 4A69C 3OSFA 5F27A 3BTLA 3SJMA 3ZQIA 3UKGA 2XGDA 3BG9A 1MSEC 3LNQA 3A01B 2L0KA 1JKPC 2HI3A 4W1UA 3FK7A 2LFBA 2M9HA 2VKEA 2HDDA 2DA3A 4L5EA 3PO3J 1R9TJ 3ZQCA 4DZJA 5EZHA 2DA4A 1FIPA 2K9SA 4LOCA 4D5CA 1BW6A 3HOZJ 2DMTA 2ME0A 1GVDA 4IHYA 2M8GX 5IP6A 1OCPA 3BQZA 2NVQJ 5IYDJ 5FKLA 1ZR2A 1HCRA 4V2GA 2DA5A 5HODA 2NVTJ 5FJ8J 4UUSB 1RKWA 2MG4A 5E3LA 1GUUA 4M3BA 2JA7J 5JLXA 3HOWJ 3LSGA 3CCYA 5FKMA 1Z77A 3SDGA 1K83J 2Y9ZA 4ABZA 1DU6A 3IH4A 2LD5A 1NK2P 3E7LA 4W97A 1JTYA 2DTZA 2EQRA 3W6VA 1AKHA 2CU7A 4FTHA 4A3KJ 5M5YJ 2HOAA 3JRBA 2QCOA 2YS9A 5K7HA 3ZQFA 3QQAA 1F36A 3BTJA 4M3GA 2JA6J 4MLOA 4BXXJ 2Y30A 3O8HA 5EF6A 1PUFA 5EZGA 3BTCA 5EYRA 3BR3A 5EG0B 3BR2A 1G2HA 3QPLA 4MFEA 1ZGWA 3HGGA 1HOMA 3TP3A 5F0CA 2DMUA 4M3FA 1HLVA 3BQYA 1RETA 2FD5A 4M3DA 3S1MJ 1TWHJ 1ZKGA 2NS7A 1A6IA 1S7EA 2LVSA 1X58A 5FKKA 1Z0XA 2X48A 4M3EA 3ZOBA 3HOYJ 2L7ZA 2H8RA 2EZLA 5J3LA 9ANTA 1IUFA 4S0HB 1AKHB 2P81A 1ETVA 5GP9A 3A01A 4X1EA 1ORKA 3B6CA 4QIWN 1FEXA 1ZTRA 3CQZJ 3JRIA 3GTQJ 4XRSA 3ZQLA 2ECBA 2I10A 3Q3SA
chains in the Genus database with same CATH superfamily
2P6TA 2V4JC 1Y56A 1HKTA 4G12A 1U5TC 2GIZA 4A5NA 3C2BA 4YFKF 5FLXZ 2IGNA 3ASOH 5DV5A 2Y0MA 3CJTB 2KHMA 3MFKA 4BBRJ 1FBUA 4XLCA 2M1BA 1R7JA 4ETSA 3G1LA 1OMIA 1R00A 1R36A 5J47A 1IV6A 4V2FA 1ZRCA 3BG3A 1O3QA 2XB0X 3HB9A 3TW6A 2XUBA 2QZ8A 2ID3A 5IP7J 2HPIA 2QQAA 3KYDB 4DYRA 1ERDA 1ZLJA 4G6TB 4CO8A 1X2MA 1IZ1A 3CP8A 1XGNA 1ZR4A 1YFHA 3ROUA 3LSRA 1MNDA 2R5YA 1BI0A 2MH9A 2EH3A 2IS6A 3CO7C 1T98A 4DZPA 3KEQA 3LWFA 4DYCA 2R92J 5B1BH 2WADA 3K70D 3KZZA 4HG2A 1UMQA 3WGIA 1PP7U 3GTMJ 5DS9A 2ZJQF 1E17A 2HYFA 3R4KA 1U8BA 2G7HA 1Z21A 1E3PA 3CDHA 1ZG5A 3K69A 1WCMJ 1W5SA 4F52A 2MA3A 1LE8A 4AC0A 4MGRA 1JKOC 2IT0A 2VB6A 3PQKA 3VSLA 3K4MA 3DKWA 5F0FA 4BHCA 4XM3A 4CYDA 4EM0B 1P4AA 4WK8F 2XC7A 1W5TA 1MZBA 3WTUC 3OMYA 4HEA2 1ONVA 5F04A 4AIJA 3IKVA 3LQQA 4RAFA 4F55A 2JMWA 1Y6IA 1H88C 4XRFA 1S5LC 2ZFWA 3HOXJ 3F3XA 1ZN2A 5HDKA 3QU3A 5HLHA 2KJCA 2DW4A 3I53A 4DNCA 4G94A 4UUVA 2QSGX 4PGGA 2LK2A 2OPTA 4IZZA 3HBLA 4MIMA 1BOBA 2V26A 1YQAA 1EH8A 3H9JA 3OIOA 3AL0B 3HDDA 1G3TA 4CDGA 4F91B 1IN5A 3EYYA 4LLGF 1H8AC 2HQRA 2JQ7A 2OTJI 1MH4A 3M3YJ 2FRHA 3WE2A 3S17J 3ZMVA 2MW8A 3IH3A 3H3ZA 4PSWA 3H36A 3SZTA 4XIDA 3CMAI 2ZSIB 1WJFA 3ZQQA 2QWWA 4CICA 1UCRA 2X6XA 5IOYA 1VQ8I 1T08B 2RN7A 4C3HJ 3FXJA 1Z6TA 5D8KB 2O5RA 2WAQA 5LHIA 1W0UA 2O8KA 4IX7A 4DJAA 3GTPJ 3V8JA 1FTZA 4BHBA 3TP0A 2E1OA 3NWTA 4A12A 3K4JA 3M7GA 2BVLA 2B0LA 5EJCA 4A2UA 5JFRA 3LSJA 4CCNA 5C44J 5B3SH 4BE1A 3S2WA 3WU2C 3CF5F 3VFZA 3MEXA 1JT6A 4MTDA 4KITB 1FYLA 3IL2A 3SDBA 1BBYA 3CUOA 2M7BA 3NRVA 1Z9CA 4OIQF 5F1RA 2EIMH 4UXNA 4OIOF 1V55H 2OV7A 2V1UA 2V1NA 2UZKA 3QP6A 3ESWB 2GZWA 1IO2A 1G4DA 1A04A 1NG6A 5IOZA 3BY6A 5JLWA 2AQFA 5DCFA 2DA2A 4BDYA 3C3WA 1RIOH 4P9FA 3RPQA 5E20A 3HTUA 4D5FA 1K4SA 2A69F 1VNDA 5M3FJ 1ITYA 2DT6A 5CQGA 2Q2EB 2XIGA 2L02A 1O3RA 3U21A 4IOCF 1MMGA 1ZK8A 4RMNA 2DT7B 1B1BA 1WJ5A 2MYSA 3QAHA 5IYCJ 2ADUA 1TBXA 4FQGA 4UVCA 1Y1WJ 1TL8A 3K0LA 1Z7UA 5KHDA 1WVRA 4KYWA 3FXQA 4U7DA 4RM3A 4IRHA 5HS9A 4CYCA 1JGSA 1FOYA 1X3ZB 3DLLF 2CQ7A 1S8NA 3AG2H 2B63J 2JWTA 5LGUA 4YFNF 4LG3A 4XL9A 1FSHA 5C3EJ 4HOBA 3P9CA 3DCFA 2QF7A 3V4GA 5K7ZA 1D1BA 2EZHA 4KICA 2HVQA 2CSOA 1WJAA 2DO7A 1EJ9A 2LLKA 4E7ZA 4KMFA 5CJ9A 4BGDA 3IWZA 3TGNA 3KYLA 3RPUD 3GW2A 2XHKA 2DAOA 1UJ8A 3LOCA 2I5UA 4RM2A 2MSYA 2VPLA 3HRTA 4BY7J 4F3QA 2PMZA 3G3ZA 2E2JJ 3L2VA 4IHWA 1QVTA 2VOPA 3V7RA 1FY7A 2X9DA 4M9ZA 4U0VA 3HGYA 1IN6A 2KIUA 3I64A 1R5ID 4XORA 3ULQB 3OL3A 4IO9F 1KU3A 4GRIA 1GT0C 1TNTA 3FXOA 4MHGA 1OCRH 4C2MJ 2CV2A 3P9KA 4LIVA 5HLTA 4I6ZA 4DW6A 2KISA 3ZCOA 2M45A 1N25A 2CJJA 1MJBA 2R7RA 4LB6B 4JYKA 1LFUP 4BS9A 1ETXA 3BROA 4MEXF 4EJVA 2KQRA 2L7KA 1APLC 1MMSA 5LRSA 3EUHA 3W2VA 1BI2A 2KL4A 4NQWA 2XB5A 3WTTC 4HZFA 1MBGA 5C4XJ 1B9MA 3KZIC 3HL2A 2JSPA 4QPOA 4U87A 4XNFA 2EBIA 2Z16A 3SZPA 4A0YA 2HYGD 3I0TA 3VYRB 3RQIA 2VQCA 1J5YA 2L2OA 4JX5A 1VQNI 4QTRA 3C18A 3ZRGA 2ZXIA 1VQLI 4UY8I 2DT5A 2PG4A 4KIFA 1X1DA 3PJRA 2VBWA 2JA2A 4XLEA 1BIBA 4FE7A 2JUCA 1O7LA 4L9NA 1VQ6I 3T8TA 5ERIA 2TDXA 4MEYF 2OZUA 3IH2A 5GPAA 3OYGA 4G7HF 4AM3A 1YYVA 4JX4A 4BL0B 1QVUA 4RB2C 3E97A 2MLKA 2I8DA 5KVRA 2V79A 3VEPA 1I3QJ 3ZQGA 2P0WA 3OYIA 1QBJA 3GO5A 3GZ5A 3OY9A 2LP0A 3D1NI 2GA1A 2W48A 2O7OA 3MVPA 3WHBA 2K3FA 3OYBA 1YTYA 2W7NA 2E2IJ 5K5RA 4JBAA 4B09A 1ZH5A 3RCOA 1PP8F 1U78A 4Y13A 2WBMA 1VFCA 2EA4A 1WRJA 3K4LA 5GTHC 4HQEA 1LQ1A 2VE9A 1UHSA 3VODA 4EQQA 2RREA 2EZKA 2V9VA 1KYZA 5F0HA 4C3JJ 1IG7A 2M87A 2L9SA 1W7PD 2V1DA 3FBNB 4I98B 3OYMA 1SFOJ 1T56A 2O03A 5FROA 3S2HJ 1WQ2A 2VBYA 1NHAA 4G9YA 5D4SA 2W1OA 1O4XA 2L4MA 3JTHA 1S9HA 1UHMA 3LA3A 5F27A 1IXSB 1H0MA 3SJMA 5L3DA 2XAJA 5TGTA 3BZCA 2WAEA 4BNCA 2DOAA 2LFBA 2DFFA 4HNTA 5K1YA 1K79A 1U0JA 4C2TA 2V1XA 1OLTA 1UG0A 2L01A 3KP3A 2XAHA 4L5EA 4U0YA 2PX9A 2VODA 1P6RA 2UXXA 3HUGB 1L3LA 1QHGA 4DZJA 2DA4A 1FIPA 1IV8A 4KISA 1GHCA 4NNJA 4MQVA 3HOZJ 2ZMEB 1GVDA 4IJAA 2YR2A 1FMVA 3OYNA 2DFHA 3FM3A 2K02A 2LREA 2VT2A 1HSJA 4OWRB 5AIPA 2RNJA 5EEGA 5FJ8J 4UUSB 1R1UA 1GUUA 4M3BA 1B9NA 3O2PE 5E3LA 6PAXA 1KQ8A 2XF5A 4PCQA 5JLXA 4E4HA 3FMRA 4UV9A 2NVUB 3CCYA 4UB6C 3CDIA 3IHUA 1OKRA 3SDGA 1MMNA 2Y9ZA 3RSNA 4E7SA 2FEZA 2YPRA 1VQOI 1DU6A 3IH4A 4NC7A 2KJBA 2LD5A 3E7LA 4B3XA 4W97A 2EQRA 3SFZA 3W6VA 2R7SA 2CU7A 5LHHA 4EATA 4FTHA 1X3WB 4A3KJ 2QA4I 4EJTA 4Q4ZF 3VSKA 3HPGA 3QQAA 4KT5C 2O6GE 4BE0A 3C2GA 1U5TA 5K5QA 2OTLI 2Y30A 4GYGA 1OQYA 3OV8A 3DLAA 3H5AA 4MQ9F 4BQNA 5EYRA 1SD7A 4E6KG 1K78A 4HX7A 1YS6A 1G2HA 4HA8A 4I02A 4MFEA 4PGHA 3F6VA 2W85A 1JXSA 2EFOA 3TP3A 1RETA 3RYPA 3DWLE 1TWHJ 2NS0A 3G6EI 4BHPA 1S7EA 3KETA 2LVSA 2ZBKA 5FKKA 1HKQA 3CCUI 2X48A 3H92A 3KP6A 3K10A 4AD9A 1TQIA 3HOYJ 1DUXC 4BXFA 2ZNYA 5KK1A 5J3LA 5AONA 3GF2A 1ZLKA 2QENA 1ZGJA 1TT5B 2F48A 4FETA 3DTKA 3B6CA 4EJUA 1BM9A 3CJRB 3KLOA 1FEXA 4HDVA 3CQZJ 3BOQA 2DPDA 1IN7A 1MIJA 3ECOA 2ECBA 3Q3SA 4Y17A 4RBOA 3V7CA 2IA0A 4YIFA 1X19A 2KDOA 1ETWA 4KMUX 2VI6A 1CF7A 2DK8A 4M74A 2VBZA 2JZYA 5EEAA 1BL0A 1CQTA 5J1RA 3GTOJ 4XICA 2DK5A 2HU9A 3F0CA 2H1KA 1XC5A 2XPVA 1GV5A 3SFIA 2BY3A 1G59A 3WE3A 1B72A 4Y33A 1T33A 2LKPA 2VJJA 3L2UA 1UB9A 3RKWA 3WGHA 3EUKL 2E1NA 2MC4A 1WH7A 4UV8A 2GIVA 4R8HA 5AIQA 1R71A 3K7AJ 2R7UA 1SVOA 1BI3A 1IJWC 2STTA 4IQ4A 4OAZA 3EQLF 4I2OA 2Y69H 2E36A 3U1DA 1D5VA 1V5FA 3V8LA 1VF9A 3LSPA 5LD2C 1ZGAA 4A3FJ 3I56I 2TRTA 3KPHA 2E1CA 3W2AA 5HS8A 1IXRC 2ELJA 3I54A 2GBYA 1ODDA 2L54A 3IRQA 3D5LA 3CDLA 2GXAA 3GTLJ 2H09A 2LNBA 3JSOA 3G4SI 2LKSA 1X1PA 2VIXA 4IXAA 3WTVC 2GLOA 2MH2A 3HYIA 5L3CA 2DDBA 5DM7F 4M71A 3Q5FA 3KP2A 3B6AA 5E1WA 1OJLA 3OYJA 5E17F 1LVAA 1G8XA 3ELKA 1T39A 1Y8QB 3CTAA 5KAFC 3D5RC 3L2CA 2JK3A 2CGPA 3A0HC 4AYBN 5FKNA 3CCLI 1RC9A 4BU2A 4HAMA 3FWEA 3GTGJ 3K70C 2Q1ZB 1PYVA 4LD5A 2K9QA 3LQRA 4XOPA 3L00A 2BY0A 1FC3A 2R5YB 4XSZF 3DKXA 3ZMTA 1IN8A 1LEBA 1JTXA 1U9NA 2ZKZA 5D5WB 4IOAF 1HW2A 4Z2YA 1RUNA 4PJ0C 3TKYA 1IUYA 1IAWA 1F9NA 1OR7C 3GWZA 1JJ8C 3EDPA 2QKMB 3GFJA 5LRRA 5DM6F 4CHUA 5IT9Z 3H3VK 2NOJB 3WU0A 1QHHD 2PJRB 3HM5A 3HC7A 1IN4A 3RQ4A 1MJ9A 1DPUA 5J8CA 2M5WA 1HXDA 3ASNH 1MDMB 1UZCA 4IRIA 1V3FA 1YX3A 4HQMA 1LE8B 4GGGA 4C2UA 3MN2A 2IP2A 1MMAA 5M5XJ 2CV0A 3VOEA 3I71A 1WJEA 5JVGF 5FLXK 3A02A 2OCEA 3GFMA 1R23A 2XGXA 4UVBA 1UAAA 2EFNA 1OPCA 4A3EJ 2VASA 3DV8A 1QO0D 1N77A 2WTEA 2EJRA 2WB1N 1JHFA 1ZHFA 2GXBA 3VYUB 4LLNA 2CFOA 2BXYA 3ABLH 4ZDOA 3GTKJ 1ETKA 2D5VA 1X2NA 2QSHX 1Q1VA 3ABMH 3OSGA 2R7QA 3PSFA 2OCCH 3F8CA 1K6YA 4J00A 2XPUA 3HSFA 1JUMA 3E1SA 1R5GA 1J9IA 4K2EA 2FX0A 1KU2A 3HOUJ 3GCMA 3I58A 4I09A 2WAFA 4OIRF 2F4IA 2VKHA 4P1WA 3R6SA 1YO5C 2E1MC 4LIUA 1TNSA 5FRNA 4XLHA 5A2QZ 1AOYA 4FX4A 3WODF 3ZMUA 1W36C 5EDNA 3U9GA 1Z6RA 4GDFA 3GUDA 1TWCJ 1EH7A 4CZZA 3O3KA 1JKRC 1PUFA 2CW0F 1MH3A 3GBGA 2Q8KA 2FU4A 2VUMJ 3WHCA 3I3LA 4D0PA 3L7WA 3JSPA 2KP6A 2K86A 4CXFA 3CO6C 2CWEA 2FMYA 4JP0A 3AKZA 3GZ6A 1K4TA 1VQ9I 4YRVA 3P9IA 2GWRA 3H35A 1DPRA 3ISPA 5E3NA 2NXNB 3R0AA 1IRFA 3QRFF 1U2WA 4E7LA 1H9TA 4PFOA 3ERED 1MGTA 2ZNZA 2J5PA 4PJJA 3N97A 1AA7A 2LTPA 4XSXF 2PJRA 3G73A 1TW3A 2E7XA 2BHZA 3D5SC 1MDMA 5GTIC 1D8KA 2IS1A 1D1CA 3S93A 2ME6A 3DFGA 1A35A 1SMTA 2HVSA 2DJNA 2K9MA 1X4OA 3S3NA 2R7TA 2MD0A 1NH3A 2DPUA 1P2FA 3S1NJ 3I59B 4A3BJ 3CZ6A 3J80Z 2VQLA 3S15J 3PNTA 5BNGA 1JUSA 5HDGA 3M4OJ 2VL8A 1EV7A 4IHTA 3C2HA 3DPLC 1FSEA 2COBA 1YIJI 3R60A 1R5HA 4LGWA 4KN7X 3JREA 2RAEA 2XAQA 4XRMA 2FXAA 4CYCB 5J40A 3DQVC 1D8JA 2P8TA 2XRLA 3JRGA 2H94A 3SEQA 2DQLA 1ZG1A 1D0YA 3BPVA 3K4CA 5ICCA 1MBFA 1LJ9A 1P92A 2BZTA 2O9LA 2VLAA 2XSDC 2DDAA 3JR9A 1FZPB 5B66C 1UG2A 4FT8A 5D4RA 3RTRA 4KFCA 4AVPA 4BACA 1SVMA 3OS1A 4KA4A 1T6SA 1U9OA 3PM1A 3CCVI 3QP5A 5H20A 3H1CA 2VOOA 4UHTA 3MQ0A 1IXCA 3N05A 2EFQA 1P7JA 3IAM2 2DBBA 5GADJ 2XPWA 3CESA 2OBPA 3C7JA 1FX7A 3V7SA 4F7ZA 1QNTA 1RKTA 2L9VA 3KE2A 2H27A 5E1XA 3FBIB 3K4NA 3OYDA 3KEYA 5GPCA 1TZLA 1JGGA 1D5YA 1RR8C 2OQRA 2A07F 1Y1VJ 3OYCA 2AXLA 3PUBA 3F8BA 4KJZA 1IRZA 2EV0A 2F4OB 4HLYA 4YIIA 3KX2A 4BQQA 2HXOA 1P4WA 1YI2I 4NUBA 2HTJA 1VZ0A 4IL6C 2M34A 3R0JA 2X1DA 2Z1DA 1QZEA 1HKSA 3HG9A 1WJBA 4NDLA 2EIKH 2Z3YA 3WG7H 2VBXA 1N78A 3F9KA 4O3MA 3DU5A 3K1PA 3Q9VA 4HV5A 3HOVJ 4H0EA 1YW7A 4FASD 2OF7A 2OQGA 1S72I 4ESFA 4II3A 1WWXA 5HS7A 4N9HA 2TCTA 1I5ZA 2HTSA 3MCZA 3U1KA 4EM1A 3S1QJ 3I59A 4NQWB 3BG5A 3F8FA 5HNFA 4BBSJ 1IDYA 1SFXA 1A5JA 4RGUA 4XOTA 3OYKA 4XRSG 3FK6A 3FISA 4A3IJ 1LPQA 2LF8A 2IBDA 2LY1A 3I4NJ 4ZC3A 1SANA 4X6AJ 3PNVA 3BR0A 4ZYEA 2DN0A 4B4CA 3F6OA 3J7ZI 1JUPA 3S16J 4QWQA 1BOAA 3GYHX 4ZYGA 1W0TA 4ZTFA 3RZOJ 4PZJA 2IXSA 3DPTA 2V9PA 4P9UA 2X1EA 3ABUA 1KGSA 4XLFA 5B5EC 3GX4X 3DXJF 5LEJA 3H5NA 2XGDA 4P55A 3LNQA 3A01B 1YHQI 4G7OF 2L0KA 4W1UA 2BXZA 3FK7A 5GAEJ 3CCSI 2VKEA 4WXCA 1FYKA 2CQNA 3FZVA 3HRMA 3FHZA 3ZQCA 2HR3A 1QPMA 2FOKA 4G6DA 1X1CA 2WC2A 1BW6A 4XKWA 4IHYA 1QU3A 3JW4A 2M8GX 4KDPA 3M8FA 2NVQJ 5IYDJ 2JUGA 1GXPA 1R4NB 1HCRA 1B4AA 4V2GA 3F72A 2DA5A 1RKWA 2W57A 3JTGA 2JA7J 2E60A 3KP4A 1MD0A 4DGWB 1V5GA 4HF2A 3OYEA 1V5EA 1WJDA 1OCCH 5L3GA 1O57A 5FKMA 3ZGKA 2M8EA 4ABZA 5F6FA 4MTEA 4HX8A 1Z91A 1JTYA 4MNUA 2DTZA 3HTSB 2K85A 2DOEA 1D0ZA 4J01A 5BS6A 1G6NA 3CCJI 3KIOA 2HOAA 1S6LA 3JRBA 3VYTB 4BQAA 3LAJA 3KP7A 2IS2A 3N4MA 3AG3H 4D9JA 2YSRA 4C9YA 1KA8A 3BTJA 2JA6J 4M3GA 3E6DA 4MLOA 1O3TA 3O8HA 3CCQI 1C0WA 5EF6A 3IUOA 3BG6A 4AYBA 1A6QA 5B1AH 1PVEA 1P9QC 2GAUA 3ZN1A 4ASNA 3QPTA 1DP7P 1LDJA 3BR3A 3FDYA 5EG0B 2O61A 3BR2A 5JR3A 3P5JA 3QOEA 4CCJA 3QPLA 2JVHA 4L9TA 2Z2SB 1HOMA 2CV1A 3LFUA 2P5KA 2C6YA 3OIQA 2FD5A 3S1MJ 4M3DA 3E6MA 4LG0B 3GFIA 1XTAA 1A6IA 2JT1A 3HSRA 5D6EA 2DYRH 4II2A 3FXUA 4M3EA 2K4JA 1FBSA 2BBYA 2LYCA 2QQ9A 1G3WA 4HLXA 2P7VB 3A01A 4G7ZF 4QPQA 3WTZA 4X1EA 4QIWN 1MNEA 1YITI 3JRIA 3GTQJ 2ZCWA 4YELA 1LUJB 4ZZDA 1HA8A 1U5TB 1FWZA 2JA5J 2ESHA 2KKOA 2Y0SA 1VQKI 4BE2A 1X1BA 3WTSC 4IHSA 2CYYA 1HW1A 4Y7NJ 1K78B 3E5XA 3BJAA 4EV0A 1UELB 2WB1A 1SAUA 2A61A 3HOTA 2VJ4A 2IGMA 5KCMA 2RC4A 1USSA 2BE5F 4A6DA 1BN5A 1OCZH 2HOTA 2HQ5A 1KQ9A 4L5IA 4CH7A 2ACJA 2LMDA 1ZQ3P 1POGA 3W3CA 4RAZA 2FQ4A 2D1VA 1XG1A 3BTIA 4M6XA 1ETQA 3J81Z 2GQQA 3OYFA 1NK3P 4GO1A 4MO7A 1TT0A 1Z05A 3BT9A 3RKQA 3FXKA 3Q0VA 1OR7A 2RVCA 4KN4X 2BHYA 4A3DJ 2JJ7A 1XB4A 2DTRA 5CYVA 4CSWA 2ELHA 2Z33A 2BEOA 4HSRA 1MNMC 4CCLA 2W82A 2QLZA 3IWFA 3I4PA 1CF7B 1HDPA 4NC6A 2F6CA 4OMZA 1U8RA 2HDCA 2GM4A 4BXUA 5LEKA 3HKZA 1VI0A 2ZB9A 1YOVB 2JSCA 5ILUA 5LHGA 1NG7A 2Z5UA 3K1MA 5EG0A 2L7MP 2QUFA 3OS2A 4DOZA 1QZZA 1B72B 2R4GA 3BZKA 1E0EA 2Y31A 1ZREA 4LG0A 5LGNA 5K5OA 4ZJZA 1V4RA 1DDNA 1RNLA 4RA2A 1SFEA 1MW7A 4CGZA 2JA8J 2H6CA 3HOSA 4BJ5C 2FNPA 4GCVA 1J0RA 1FTTA 1RUOA 3JRFA 2HQNA 3WTYC 3OOPA 1RR7A 1WH5A 3O6BB 4WXHA 2MC3A 3M8EA 4S05A 5L3FA 3HIFA 1MBEA 2FJ1A 1MSFC 2MLGA 2CUFA 5D5XB 4KIBA 5HOOA 2VXZA 2EB7A 2FOWA 3AL0C 5E3OA 2O3FA 1O3SA 4B3AA 4WCGA 1ENHA 5CVVA 3CJNA 1YJWI 3TBIA 3RKXA 3KYCB 4EGZA 2R7ZJ 1HQCA 3RIRA 1Z1DA 1BR2A 2A5WA 4WXDA 3NAUA 1FP1D 3DTIA 4N4NB 5ICFA 1ZELA 2QBYA 1YJ9I 2CFXA 1I39A 3KEOA 2YUSA 1A31A 2R5ZA 1LKXA 3T0YA 1GDTA 5IP9J 2G9WA 2AQEA 3AG4H 2NS8A 1ACIA 2M7AA 2R7WA 2MFZA 1FP2A 2R7FA 3RKYA 2F5EA 2COMA 2OA4A 4L9VA 4XQFA 3I5UA 1F43A 4D7NA 3GFLA 2CMPA 4XLNF 1ZG3A 4UVAA 3HZJA 2JRMA 3LL7A 1B8IA 2NVYJ 1OYWA 2PFBA 3J7AO 4IKFA 1DP3A 1R58A 1XD7A 5K7FA 1VQ4I 2KZGA 2X4HA 1XPXA 2VQGA 4GFBA 3A0BC 2QEXI 2EZIA 1H9GA 1YS7A 3QWLA 2NNYA 4XBFA 2BGCA 2AHQA 3IV5A 5DCMA 1UHWA 5CLSA 4OIPF 3ZMZA 4EM2A 4XN3A 4YFXF 3S8PA 4A3CJ 1R6RA 4S04A 4ESBA 3H0GJ 2CS3A 2PMHA 3PSIA 3E0JB 2RKHA 2FBHA 3LSMA 4E7HA 1OYIA 2IAIA 4RS8A 3NWSA 2ZO4A 1SFUA 1IRGA 3SHFA 4RLQA 1X1AA 3MZHA 1P4XA 2VJIA 5GAHJ 4B8XA 1BC7C 3OYLA 2CUJA 3FMQA 1XSVA 1FYMA 1AU7A 3DF8A 5FGMA 2DMNA 4XONA 3G1OA 2UV1A 3QYEA 5FD5A 3OYHA 3L9FA 1XN7A 2HXIA 5L3EA 2K3PA 4R79A 2IPQX 4RGXA 1I1SA 1R1VA 1TWGJ 1PDNC 1SMYF 2W00A 3RPUA 3CD6I 4BY1J 4BUPA 5E18F 3KP5A 4PJLA 5IT9K 1XDUA 2DI3A 4A5MA 3SYTA 1QPIA 2DODA 3FXLA 1HSTA 3MD2A 3L2RA 3ML6A 5CVRA 2D1HA 4EMSA 4O5VA 3EPZA 2O0YA 2XV4S 1I50J 2XKOA 2R93J 4BQOA 3BCBA 1J09A 2EPFA 4LFUA 3F21A 1EH6A 2XF6A 4EJOA 3CLOA 1BW5A 2PI0A 2GA2A 1S3JA 3MKYB 3H9GA 4B1RA 4B48A 2P5LC 4L0YB 3BWGA 1FOWA 3CCRI 2LR8A 3BZ6A 1GVJA 3VPRA 1JE8A 2CH0A 4Z6YA 4LJZF 1KQ0A 2DYSH 3W6JB 5M3MJ 1YIOA 2E2HJ 2XVCA 5DUKA 4X0GA 2D2WA 4Y52J 4M6VA 2L4AA 2LBFB 1VQPI 2KRHA 4WF2A 3HSEA 2P5VA 5LGTA 2Y2ZA 4OU0A 2AO9A 2EWNA 1XDSA 4A0XA 5ICEA 4UB8C 5LBQA 5IPAA 5ILVA 4M6YA 2QYOA 2FBIA 3C1DA 3WG9A 4HX4A 2XROA 2ESNA 1SD6A 2RV8A 4IEJA 5BPDA 1KU9A 5A2QK 4DBQA 2Y0SN 2VQHA 3L1PA 3OR2C 2K9NA 2UUZA 5TISC 4IQJA 1FPQA 4HF0A 4I0AA 3MKLA 3K4KA 1XX5A 2F4MB 2CG4A 4A6EA 4ENKA 4F93B 2R7XA 2ZXJA 3G1MA 3E6CC 2HOSA 5DEQA 4LLLA 5E8GA 2WV1A 1G3SA 4EEFG 2P7CB 4AU7A 1XCVA 2M0MA 4XMYA 1FMWA 1WGXA 3BJ6A 2X6YA 3CLQA 4DYQA 3JAMZ 2CQQA 3S14J 1ETOA 1WHUA 2K27A 2KZVA 4LB5A 2ELKA 3BG7A 4OAYA 4FCYA 1P7IA 1J2XA 1Z7LA 1YE9A 1I27A 2LRDA 3CC2I 2P6SA 4YIRX 3KLNA 3REOA 5DTDA 3LMMA 2ZJRF 2IJLA 2VXDA 1IF1A 1HF0A 3CCMI 2B7EA 2QKLB 2D45A 3F23A 4D7MA 1M1EB 3HKZN 2VC1A 1TWAJ 2Y75A 4LITA 3CMMA 1BR1A 2AS5F 2XDVA 4JK1X 4OINF 3FX3A 3IKTA 3PFIA 2WY8Q 1XMKA 1B59A 2DA1A 3GEZA 1AWCA 1FLIA 4HNVA 3J80K 4L5JA 2M4GA 4HPQA 1MMDA 2EFPA 3Q0UA 5KNLA 3OS0A 3OOUA 5BMZA 2IRFG 5BQTA 3I4MJ 2E35A 1BJAA 3TO6A 1OISA 2L7FP 3ERMA 1XS9A 2LBFA 1YLFA 2MGQA 4FE4A 3CMEI 1RRJA 3AFHA 5J4YA 2YX4A 1Y39A 4A69C 2JPCA 3BTLA 3T8RA 2KMUA 2F5VA 4AIHA 3SXYA 3ZQIA 4ZZLA 2XAFA 1PJRA 4C30A 4Q48A 3SQNA 2XAGA 4I0BA 1O7FA 3KCCA 1JKPC 2HI3A 4RB3C 2HDDA 4NC8A 2OZ6A 2W25A 2DA3A 1R9TJ 1J59A 4AIDA 5L3BA 2GXGA 2V9KA 2XASA 3EYIA 3BLYA 4ESJA 2RQPA 2FSWA 1V54H 3LSHA 2K9SA 4LOCA 4D5CA 4M72A 2YX7A 2BW3A 4JQFA 1SVLA 4BJ6C 3IC7A 4U88A 5IP6A 1OCPA 2Z99A 1F1ZA 2ZMEC 3G2BA 2HZTA 2HGCA 5JI6A 3DU6A 1W5CC 4ENMA 4V19K 2A68F 2DJIA 1ZAOA 3CUQC 4HYEA 4I7HA 4XKVA 3K1NA 3V42A 3DBLB 3LSGA 2FBKA 2X6WA 2LF7A 4ZTJA 2F5DA 4U0WA 3SZGA 1Z77A 2RGVA 3KZYA 3PQJA 4CCKA 3V8KA 3TMOA 1AKHA 2V6CA 3B73A 4UNOA 2QM3A 3TL4X 2QCOA 4L0ZB 4N4OB 2HKXA 3ZQFA 5TJJA 5CQEA 4HRIA 2IA1A 1F36A 1IW7F 3Q9SA 5HDNA 2LG4A 2BV6A 2RQQA 5EZGA 4D1QA 2KRCA 3OL4A 5CKTA 2MBFA 3BTCA 5E79C 3H0DA 1T0FC 2HQAA 1WFXA 2W4SA 4NBQA 4BEHB 1Y0UA 2KRFA 3FXRA 2E7WA 4PJMA 1ZGWA 4ZDPA 4XKCA 3TOBA 3M9AA 4PK4A 3VWBA 1ZKGA 3UR3C 3L2QA 3ECHA 4RAGA 1W36D 4L18B 2EA2A 3MKZA 5DYMA 2QQBA 4DIQA 1ON2A 2FE3A 4U7BA 1Z0XA 1CGPA 3ZOBA 2KPMA 2EZLA 4ENJA 5FB2A 1BC8C 9ANTA 2IGKA 4IPAA 1YW9A 1YG2A 1XSXA 5DDGA 3EETA 3RYRA 3DEUA 1SAXA 2CW7A 4A0ZA 3S3MA 3HRSA 1STZA 3M8JA 4XRSA 1W1WE 3ZQLA 3GVAA 5J1YA 2I10A 2QSFX 5CPRB 4J19A 2DFEA 1R49A 3ZN0A 3QPHA 2OC6A 5FLVA 4GXOA 1PUFB 2E71A 3A1YA 5J1UA 3K6GA 2DMQA 1U3EM 1YX5A 2OAZA 3S32A 2E19A 2O8XA 1HDDC 5CVIA 3GLLA 3VDXA 1K6OA 3FM5A 4P5OA 4PSXA 1LDDA 3BR6A 2ISZA 4CA0A 3K2ZA 2HFHA 2F5CA 5FRMA 5C4JJ 2WV0A 1KZHA 2KIMA 3TQNA 3W2WA 1XMXA 5BOXA 2JN6A 2PBIA 2XSJC 4A93J 3TEDA 4FX0A 5D5VB 3E6BA 1MBJA 1S7OA 3WGGA 2CQKA 1SFKA 1TW2A 2ZXHA 2VT3A 1PUEE 1LDKB 3DTEA 1OFCX 1BA5A 1IGNA 4IHXA 2CRGA 2FMLA 3H5RA 2OD5A 5J6XA 2CUZA 3DBRB 3OYAA 2LY9A 4BYYA 3P7NA 4N9IA 3OWTA 3I9V2 3WU1B 1I3AA 2R0QC 4ENNA 1ETYA 5DUIA 2HPMA 3J7AY 3VYSB 3GTJJ 1MBHA 4ZYAA 2XGEA 5J4VA 2R7VA 4RLFA 3M1CA 3BC8A 5FFZA 4JX6A 4BEHA 3WTWC 1BJZA 1F4KA 3FHNA 1I1GA 3DKYA 1Y8RB 3ABKH 3HHGA 3E3VA 1YJNI 2AXTC 2DLLA 4N0BA 3TDZC 4OMYA 2K7LA 5FFXA 5LLQA 1B6AA 5F64A 2PMUA 4LMYA 4NHJA 2KIFA 1JKQC 1GXQA 1VQ5I 1R4MB 2CQXA 3PO2J 1K61A 5HNHA 3BP8A 2CO5A 2H8WA 2HWVA 3QYFA 1DU0A 1LFBA 1FBQA 2IVMA 2VJ5A 1FOKA 4KUMA 4CCMA 5D8LB 1E3HA 4JOMA 1WI3A 3E5QA 1TP4A 2WY7Q 2X0LA 1JT0A 1RPWA 1TC3C 2ETHA 3K4BA 4ON0A 2BY2A 4EGYA 4YEJA 1OCOH 2P4WA 1DGRM 2ISYA 3BPXA 4XKBA 5ILSA 5E3MA 5D6FA 3MAJA 2BY1A 1WZ2A 1I6HJ 2VE8A 1E3OC 2KDZA 2UXNA 5IYBJ 4CCOA 2NOGA 1MBKA 1N75A 4HW0A 2V7FA 1QRYA 2VC0A 3FF5A 3MKWB 4EVIA 2ICWG 2KFDA 3LAPA 3MWMA 3U2RA 3DBHB 3J7YJ 2HVRA 2ZFUA 4KIGA 2KIQA 4GYIA 4HDUA 2Q2EA 4AUXA 4ZYHA 2CW8A 1TWFJ 3PNYA 3JRDA 3A2KA 2XGCA 1NTCA 3GXOA 3QYBA 4RB0A 2E5ZA 1R22A 3FMSA 1YRNB 4ITVA 4A3GJ 1WPKA 5FO5A 3S1RJ 1AHDP 4PUSA 1A36A 3O8GA 3LA7A 1FNNA 2DA7A 5LFAA 1X3UA 3J81K 1JI8A 2IA2A 3S2DJ 2KLOA 5KAIC 3MZ8A 3H9QA 3FIWA 2E1MB 4Y3OA 2Y9YA 2JVGA 5F08A 4BH9A 3L2WA 1GV2A 1ZARA 3BJOA 4E7KA 3DEWA 2X51A 2L9RA 2VONA 2R3SA 3ZR8X 3MZYA 1D0XA 4AVZA 2N8GA 2QBYB 3K2AA 3TW7A 2KT0A 3X2QH 2ZJ2A 2ECCA 3ONQA 4OOIA 3RDIA 2M4KA 1ZRFA 4Y4RA 3T5XA 2R5ZB 5BPIA 4B43A 2MD5A 2H1LA 5IY5H 2HOEA 3NEUA 2GOXB 3ZMDA 2R7DA 3ZXSA 1WKMA 1QZYA 1Z3XA 1XGSA 4XK4A 3TOAA 2B9SA 2X6OA 1IC8A 1TTYA 3LA2A 3RJPA 1MJAA 1USTA 3CC4I 2FUG2 3MMYB 1LNWA 2LSOA 2WWYA 2HZDA 4BKXA 1ULYA 2RDPA 3CJQB 3G71I 2HDWA 3I55I 1B8IB 2K40A 2OJED 2LKXA 3VB2A 5FKOA 5HLIA 3LFKA 2DA6A 2L3DA 2QGUA 2DFIA 4M9XA 2OU2A 5H2FC 2M30A 1W4MA 1MKMA 1LFPA 2PLYA 3A4CA 3JRAA 2VPRA 3F8MA 4RGSA 2F5FA 4FHTA 3EUAA 1JHHA 1XMAA 2XF7A 4XLAA 1I6XA 5M5WJ 2K9LA 4UUTA 2FA5A 1LEAA 2PJPA 5DCMB 2STWA 1TLHB 4G6QA 3QU6A 4KNYA 1JJ6C 2LOOA 1WSUA 4AIKA 1IDZA 1RZ4A 1ON1A 4LK1F 2EV5A 2PQ8A 5J8FA 2F2EA 1GLNA 1EA3A 4ZDLA 1U6GA 1SEUA 3ZP5A 2NVXJ 4HBLA 3CC7I 2L9NA 5EGOB 2DU9A 5FLMJ 2WAQN 1RESA 1LVKA 2EILH 4PJNA 5EEHA 4BDZA 1VQ7I 3CUQB 2EFWA 1YRNA 4WWCA 3HRUA 5CVJA 4I76A 4IHVA 2NNNA 2EINH 2JRTA 2HS5A 1FIAA 2G7UA 3PL8A 3UNGC 2X85A 4AWXB 1Z67A 2JPBA 3JCUC 3L09A 2A6EF 3A03A 3PFYA 4E7IA 3RZDJ 3NARA 3DP7A 2OUMA 3HEFA 2G0EA 5HVQC 3JRCA 3M1EA 2NAZA 2YU9J 4RDUA 2ID6A 2M2EA 1SC7A 3BR5A 2LY2A 2LH9A 1DGWY 5FD6A 2FNAA 4I99C 1REPC 4PFPA 1BR4A 3KFWX 3LSIA 4HSTA 4MFDA 5CVUA 4C3IJ 1FOXA 1T8IA 1EF4A 4HV6A 1T95A 1ZRDA 4A3JJ 1J75A 1XGOA 1ZYRF 1T2KA 3HXLA 3AG1H 2NYXA 1H89C 2DQRA 3OR1C 4A3LJ 2A05A 4R1HA 5ICGA 3PIPF 3FKIJ 3K9TA 4PDKA 1T38A 3BR1A 1TQPA 3IRRA 4EJWA 4CZCA 3JRHA 4BJTA 5F1JA 5DD4A 1FT9A 4FISA 2IS4A 2LC2A 2FF4A 1BI1A 3CMYA 1S7AA 2M0CA 2BOLA 4Q47A 2Z9OA 4QSHA 2W24A 4KT6A 2A5YB 3BDDA 2DMPA 2YU3A 4A3MJ 2CUEA 2DOFA 3FXMA 3W6KB 3R61A 1OCTC 3EUHC 3GLXA 3NQOA 4ANJA 1S29A 3HJEA 3HUGA 3QPSA 2HYJA 3Q0WA 2K4BA 1IRXA 3HHHA 1FJLA 2VN2A 2E5NA 2ZMEA 2H6BA 5EGOA 2IW5A 4WX9A 2L5QA 1QQIA 2PEXA 3TDUC 3TO7A 3WTXC 2RNGA 2IEKA 2PMZN 3CUQA 4CUGA 3M07A 1HW5A 4QLCU 2VKVA 3ABTA 2ZXWH 3S3OA 4UUSA 3BCAA 3E5UA 3HPHA 1HBXG 2HNHA 3ZQHA 4RB1A 4ZYDA 4B44A 2FQ3A 5JVTA 1G3YA 3H3UA 3OSFA 4L9JA 1Z3YA 4LK0F 4P96A 2LDUA 3DEEA 2A3SA 3UKGA 2Q0OA 2XKPA 3BG9A 1MSEC 4XR6A 3AAFA 2Y48A 4M73A 1K7AA 4O6JA 1RI7A 1VTNC 2BYVE 3IAS2 5ED4A 2M9HA 2UWMA 2HKOA 2NRAC 1W7PB 1XSDA 1Q1HA 1VQMI 1LB2A 3PO3J 4M9SA 3CCEI 2BVMA 2E34A 2M3AA 2R7OA 5EZHA 3COAC 1KONA 2VKDA 1XCBA 1T0FA 4E70A 4DBRA 2DMTA 5D5UB 3RI4A 2ME0A 2ZSHB 4IVNA 4YG2F 3BQZA 2QQ8A 1TQMA 5FKLA 4DQ2A 1SD4A 3SEZA 1ZR2A 1E2XA 1Y0NA 1QGPA 5HODA 2NVTJ 1DQUA 4TV7A 2MG4A 1KU7A 2K5CA 3QODA 4Y15A 4F92B 3HOWJ 3DPUA 4XLPF 4B47A 3B02A 4I01A 5H6RA 3TO9A 1K83J 2X1CA 3F8NA 2PN6A 1X4PA 1OYYA 3JAMK 3OIPA 1NK2P 1SD5A 1R1TA 5JHFA 3GZNB 2MABA 3CP2A 1F5TA 2ZJPF 3LSKA 3QOPA 5M5YJ 2EIJH 3CF2A 5GAGJ 2YS9A 5K7HA 1WJCA 2XAUA 5E8IA 2IGOA 1BIAA 1UFMA 4Q5SF 4BXXJ 2W84A 4E7JA 2BW3B 1D3YA 3LSTA 1XGMA 3PUFA 1KYWA 5JHUA 4IF4A 3F22A 2HEOA 4HNUA 2GOMA 3HGGA 2A6TA 4RAYA 5F0CA 2DMUA 4M3FA 4H4KC 2QVOA 3BQYA 5E1ZB 1HLVA 4NB5A 3ZQ7A 2NS7A 3PIOF 2XRNA 1EKEA 2V6EA 3FKJA 1X58A 3T1BA 4XN0A 3IP4B 2EV6A 2DCEA 2L7ZA 3ZMSA 2H8RA 2DXIA 1L0OC 5DD8A 4BAYA 1YW8A 5HLGA 3ZPLA 4HF1A 2JTVA 5IT3A 5TRDA 1IUFA 3D0SA 4S0HB 2J5OA 1HC8A 1AKHB 1QA6A 4G8XA 2P81A 1ETVA 2WA0A 5GP9A 1ORKA 4RGRA 2A6HF 1ZTRA 1WI9A 1J7KA 2EK5A 4ZH4F 4IRGA 1W7PA 3GMEA 5H6QA 1D1AA 2ZC2A
chains in the Genus database with same CATH topology
4RBOA 4J19A 2JA5J 4G12A 1PUFB 5FLVA 1ETWA 2VI6A 3C2BA 5J1UA 2DMQA 5EEAA 1BL0A 1CQTA 5J1RA 2E19A 4Y7NJ 1HDDC 4BBRJ 4XICA 3GTOJ 3F0CA 2H1KA 1XC5A 2XPVA 3G1LA 1GV5A 1IV6A 3BR6A 3SFIA 4V2FA 3BG3A 1B72A 1T33A 2XB0X 3HB9A 3TW6A 2ID3A 5IP7J 2HOTA 5C4JJ 2HQ5A 4DYRA 1WH7A 1ZQ3P 1POGA 3K7AJ 1X2MA 2JN6A 2FQ4A 1ZR4A 1IJWC 3LSRA 4A93J 1XG1A 3BTIA 3TEDA 1ETQA 2R5YA 2EH3A 1VF9A 1NK3P 1MBJA 4MO7A 4DZPA 3LSPA 3BT9A 4DYCA 3RKQA 2R92J 4A3FJ 3Q0VA 2TRTA 1OFCX 1BA5A 1IGNA 4IHXA 4A3DJ 1UMQA 2JJ7A 2CRGA 2GBYA 3GTMJ 5DS9A 1U8BA 1MNMC 2LY9A 3CDLA 3GTLJ 1HDPA 2R0QC 2GLOA 1WCMJ 1ETYA 2GM4A 3GTJJ 1MBHA 2XGEA 3B6AA 1VI0A 2ZB9A 1OJLA 1LE8A 4AC0A 4JX6A 1JKOC 5EG0A 1BJZA 2L7MP 5F0FA 2JK3A 1B72B 4AYBN 5FKNA 2Y31A 5F04A 3GTGJ 2JMWA 2K9QA 1JKQC 1H88C 2R5YB 2CQXA 3PO2J 1K61A 3HOXJ 2JA8J 1JTXA 1U9NA 1FTTA 3JRFA 1RR7A 1WH5A 1LFBA 1DU0A 2LK2A 2OPTA 3HBLA 4MIMA 1JJ8C 1MBEA 2FJ1A 1MSFC 3OIOA 2CUFA 1WI3A 3HDDA 3H3VK 3HM5A 1JT0A 1RPWA 5E3OA 1H8AC 1TC3C 4B3AA 1ENHA 1MH4A 2R7ZJ 3M3YJ 3S17J 2MW8A 3IH3A 3NAUA 5E3MA 4XIDA 1LE8B 3MN2A 5M5XJ 1I6HJ 1E3OC 2YUSA 2KDZA 2R5ZA 5IOYA 3A02A 5IYBJ 5IP9J 2NOGA 1GDTA 4C3HJ 1MBKA 2NS8A 1QRYA 1W0UA 4A3EJ 2O8KA 3GTPJ 1FTZA 2WB1N 3TP0A 2E1OA 1F43A 4AUXA 4D7NA 3JRDA 1TWFJ 3GTKJ 1ETKA 2D5VA 1X2NA 2XGCA 1Q1VA 1NTCA 3LSJA 5C44J 3OSGA 1YRNB 4A3GJ 1WPKA 1AHDP 1JT6A 2XPUA 1JUMA 3S1RJ 3O8GA 1B8IA 2NVYJ 2DA7A 2FX0A 3HOUJ 3S2DJ 3FIWA 5K7FA 2Y9YA 5F08A 1GV2A 4GFBA 3DEWA 2L9RA 5J1YA 2N8GA 2EZIA 5EDNA 3K2AA 1TWCJ 3TW7A 2KT0A 2ECCA 5IOZA 1JKRC 2AHQA 3IV5A 5JLWA 2R5ZB 1MH3A 3GBGA 2DA2A 4A3CJ 4XK4A 3H0GJ 2VUMJ 2X6OA 3WHCA 4D5FA 1IC8A 2IAIA 1VNDA 5M3FJ 1ITYA 4JP0A 1ZK8A 4BKXA 5E3NA 1AU7A 5IYCJ 2DMNA 1B8IB 2K40A 2LKXA 1Y1WJ 5FKOA 3G1OA 2DA6A 2HXIA 4CYCA 2B63J 1TWGJ 2JWTA 2LTPA 3JRAA 2VPRA 4BY1J 5C3EJ 5M5WJ 1QPIA 4UUTA 3DCFA 2QF7A 5K7ZA 2ME6A 2EZHA 2DJNA 1JJ6C 2LLKA 1I50J 2R93J 1IDZA 3S1NJ 3LOCA 4A3BJ 2MSYA 3S15J 4BY7J 1BW5A 5BNGA 1JUSA 3M4OJ 4B1RA 2E2JJ 2NVXJ 4IHWA 5EGOB 2LR8A 3VPRA 2COBA 5FLMJ 1QVTA 2WAQN 1RESA 1YRNA 5M3MJ 2X9DA 3JREA 2RAEA 4I76A 4XRMA 2E2HJ 4CYCB 4IHVA 4Y52J 3HGYA 4M6VA 2XRLA 3JRGA 1MBFA 1GT0C 2O9LA 4C2MJ 2Y2ZA 2XSDC 1FIAA 3JR9A 2AO9A 1UG2A 4I6ZA 4DW6A 2CJJA 5IPAA 4JYKA 3RZDJ 3A03A 1LFUP 3NARA 3HEFA 1ETXA 2G0EA 4IEJA 3JRCA 1U9OA 3PM1A 2YU9J 4RDUA 2ID6A 1APLC 2M2EA 2Y0SN 3L1PA 3BR5A 2K9NA 1P7JA 3MKLA 2XPWA 2XB5A 1RKTA 1MBGA 4MFDA 5C4XJ 4C3IJ 3G1MA 1EF4A 2HOSA 2EBIA 2WV1A 5GPCA 4A3JJ 1D5YA 1JGGA 3RQIA 4EEFG 4JX5A 4QTRA 1H89C 1Y1VJ 4A3LJ 1IRZA 1WGXA 4DYQA 2HXOA 2CQQA 3S14J 1ETOA 4FE7A 2M34A 3FKIJ 3BR1A 3JRHA 2ELKA 4NDLA 5F1JA 4FCYA 1P7IA 3HOVJ 3IH2A 5GPAA 4FISA 4JX4A 3CMYA 2M0CA 1QVUA 2OF7A 5DTDA 4QSHA 1HF0A 1I3QJ 3ZQGA 2TCTA 2DMPA 4A3MJ 2CUEA 2LP0A 3D1NI 4D7MA 1OCTC 2W48A 2O7OA 3HKZN 3MVPA 3WHBA 1TWAJ 3BG5A 3S1QJ 4BBSJ 1IDYA 3QPSA 1A5JA 2E2IJ 2HYJA 3Q0WA 4XRSG 2DA1A 3FK6A 3FISA 1FJLA 1U78A 4A3IJ 2IBDA 4HNVA 3I4NJ 1VFCA 1SANA 5EGOA 4X6AJ 1UHSA 3BR0A 2DN0A 3Q0UA 2EZKA 5F0HA 3OOUA 4B4CA 4C3JJ 1IG7A 3I4MJ 2IEKA 2PMZN 1JUPA 3S16J 1SFOJ 1T56A 2VKVA 3S2HJ 2L7FP 4UUSA 1XS9A 2MGQA 4FE4A 1W0TA 3ZQHA 1O4XA 3RZOJ 4A69C 3OSFA 5F27A 3BTLA 3SJMA 3ZQIA 3UKGA 2XGDA 3BG9A 1MSEC 3LNQA 3A01B 2L0KA 1JKPC 2HI3A 4W1UA 3FK7A 2LFBA 2M9HA 2VKEA 2HDDA 2DA3A 4L5EA 3PO3J 1R9TJ 3ZQCA 4DZJA 5EZHA 2DA4A 1FIPA 2K9SA 4LOCA 4D5CA 1BW6A 3HOZJ 2DMTA 2ME0A 1GVDA 4IHYA 2M8GX 5IP6A 1OCPA 3BQZA 2NVQJ 5IYDJ 5FKLA 1ZR2A 1HCRA 4V2GA 2DA5A 5HODA 2NVTJ 5FJ8J 4UUSB 1RKWA 2MG4A 5E3LA 1GUUA 4M3BA 2JA7J 5JLXA 3HOWJ 3LSGA 3CCYA 5FKMA 1Z77A 3SDGA 1K83J 2Y9ZA 4ABZA 1DU6A 3IH4A 2LD5A 1NK2P 3E7LA 4W97A 1JTYA 2DTZA 2EQRA 3W6VA 1AKHA 2CU7A 4FTHA 4A3KJ 5M5YJ 2HOAA 3JRBA 2QCOA 2YS9A 5K7HA 3ZQFA 3QQAA 1F36A 3BTJA 4M3GA 2JA6J 4MLOA 4BXXJ 2Y30A 3O8HA 5EF6A 1PUFA 5EZGA 3BTCA 5EYRA 3BR3A 5EG0B 3BR2A 1G2HA 3QPLA 4MFEA 1ZGWA 3HGGA 1HOMA 3TP3A 5F0CA 2DMUA 4M3FA 1HLVA 3BQYA 1RETA 2FD5A 4M3DA 3S1MJ 1TWHJ 1ZKGA 2NS7A 1A6IA 1S7EA 2LVSA 1X58A 5FKKA 1Z0XA 2X48A 4M3EA 3ZOBA 3HOYJ 2L7ZA 2H8RA 2EZLA 5J3LA 9ANTA 1IUFA 4S0HB 1AKHB 2P81A 1ETVA 5GP9A 3A01A 4X1EA 1ORKA 3B6CA 4QIWN 1FEXA 1ZTRA 3CQZJ 3JRIA 3GTQJ 4XRSA 3ZQLA 2ECBA 2I10A 3Q3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RBO A;  4J19 A;  2JA5 J;  4G12 A;  1PUF B;  5FLV A;  1ETW A;  2VI6 A;  3C2B A;  5J1U A;  2DMQ A;  5EEA A;  1BL0 A;  1CQT A;  5J1R A;  2E19 A;  4Y7N J;  1HDD C;  4BBR J;  4XIC A;  3GTO J;  3F0C A;  2H1K A;  1XC5 A;  2XPV A;  3G1L A;  1GV5 A;  1IV6 A;  3BR6 A;  3SFI A;  4V2F A;  3BG3 A;  1B72 A;  1T33 A;  2XB0 X;  3HB9 A;  3TW6 A;  2ID3 A;  5IP7 J;  2HOT A;  5C4J J;  2HQ5 A;  4DYR A;  1WH7 A;  1ZQ3 P;  1POG A;  3K7A J;  1X2M A;  2JN6 A;  2FQ4 A;  1ZR4 A;  1IJW C;  3LSR A;  4A93 J;  1XG1 A;  3BTI A;  3TED A;  1ETQ A;  2R5Y A;  2EH3 A;  1VF9 A;  1NK3 P;  1MBJ A;  4MO7 A;  4DZP A;  3LSP A;  3BT9 A;  4DYC A;  3RKQ A;  2R92 J;  4A3F J;  3Q0V A;  2TRT A;  1OFC X;  1BA5 A;  1IGN A;  4IHX A;  4A3D J;  1UMQ A;  2JJ7 A;  2CRG A;  2GBY A;  3GTM J;  5DS9 A;  1U8B A;  1MNM C;  2LY9 A;  3CDL A;  3GTL J;  1HDP A;  2R0Q C;  2GLO A;  1WCM J;  1ETY A;  2GM4 A;  3GTJ J;  1MBH A;  2XGE A;  3B6A A;  1VI0 A;  2ZB9 A;  1OJL A;  1LE8 A;  4AC0 A;  4JX6 A;  1JKO C;  5EG0 A;  1BJZ A;  2L7M P;  5F0F A;  2JK3 A;  1B72 B;  4AYB N;  5FKN A;  2Y31 A;  5F04 A;  3GTG J;  2JMW A;  2K9Q A;  1JKQ C;  1H88 C;  2R5Y B;  2CQX A;  3PO2 J;  1K61 A;  3HOX J;  2JA8 J;  1JTX A;  1U9N A;  1FTT A;  3JRF A;  1RR7 A;  1WH5 A;  1LFB A;  1DU0 A;  2LK2 A;  2OPT A;  3HBL A;  4MIM A;  1JJ8 C;  1MBE A;  2FJ1 A;  1MSF C;  3OIO A;  2CUF A;  1WI3 A;  3HDD A;  3H3V K;  3HM5 A;  1JT0 A;  1RPW A;  5E3O A;  1H8A C;  1TC3 C;  4B3A A;  1ENH A;  1MH4 A;  2R7Z J;  3M3Y J;  3S17 J;  2MW8 A;  3IH3 A;  3NAU A;  5E3M A;  4XID A;  1LE8 B;  3MN2 A;  5M5X J;  1I6H J;  1E3O C;  2YUS A;  2KDZ A;  2R5Z A;  5IOY A;  3A02 A;  5IYB J;  5IP9 J;  2NOG A;  1GDT A;  4C3H J;  1MBK A;  2NS8 A;  1QRY A;  1W0U A;  4A3E J;  2O8K A;  3GTP J;  1FTZ A;  2WB1 N;  3TP0 A;  2E1O A;  1F43 A;  4AUX A;  4D7N A;  3JRD A;  1TWF J;  3GTK J;  1ETK A;  2D5V A;  1X2N A;  2XGC A;  1Q1V A;  1NTC A;  3LSJ A;  5C44 J;  3OSG A;  1YRN B;  4A3G J;  1WPK A;  1AHD P;  1JT6 A;  2XPU A;  1JUM A;  3S1R J;  3O8G A;  1B8I A;  2NVY J;  2DA7 A;  2FX0 A;  3HOU J;  3S2D J;  3FIW A;  5K7F A;  2Y9Y A;  5F08 A;  1GV2 A;  4GFB A;  3DEW A;  2L9R A;  5J1Y A;  2N8G A;  2EZI A;  5EDN A;  3K2A A;  1TWC J;  3TW7 A;  2KT0 A;  2ECC A;  5IOZ A;  1JKR C;  2AHQ A;  3IV5 A;  5JLW A;  2R5Z B;  1MH3 A;  3GBG A;  2DA2 A;  4A3C J;  4XK4 A;  3H0G J;  2VUM J;  2X6O A;  3WHC A;  4D5F A;  1IC8 A;  2IAI A;  1VND A;  5M3F J;  1ITY A;  4JP0 A;  1ZK8 A;  4BKX A;  5E3N A;  1AU7 A;  5IYC J;  2DMN A;  1B8I B;  2K40 A;  2LKX A;  1Y1W J;  5FKO A;  3G1O A;  2DA6 A;  2HXI A;  4CYC A;  2B63 J;  1TWG J;  2JWT A;  2LTP A;  3JRA A;  2VPR A;  4BY1 J;  5C3E J;  5M5W J;  1QPI A;  4UUT A;  3DCF A;  2QF7 A;  5K7Z A;  2ME6 A;  2EZH A;  2DJN A;  1JJ6 C;  2LLK A;  1I50 J;  2R93 J;  1IDZ A;  3S1N J;  3LOC A;  4A3B J;  2MSY A;  3S15 J;  4BY7 J;  1BW5 A;  5BNG A;  1JUS A;  3M4O J;  4B1R A;  2E2J J;  2NVX J;  4IHW A;  5EGO B;  2LR8 A;  3VPR A;  2COB A;  5FLM J;  1QVT A;  2WAQ N;  1RES A;  1YRN A;  5M3M J;  2X9D A;  3JRE A;  2RAE A;  4I76 A;  4XRM A;  2E2H J;  4CYC B;  4IHV A;  4Y52 J;  3HGY A;  4M6V A;  2XRL A;  3JRG A;  1MBF A;  1GT0 C;  2O9L A;  4C2M J;  2Y2Z A;  2XSD C;  1FIA A;  3JR9 A;  2AO9 A;  1UG2 A;  4I6Z A;  4DW6 A;  2CJJ A;  5IPA A;  4JYK A;  3RZD J;  3A03 A;  1LFU P;  3NAR A;  3HEF A;  1ETX A;  2G0E A;  4IEJ A;  3JRC A;  1U9O A;  3PM1 A;  2YU9 J;  4RDU A;  2ID6 A;  1APL C;  2M2E A;  2Y0S N;  3L1P A;  3BR5 A;  2K9N A;  1P7J A;  3MKL A;  2XPW A;  2XB5 A;  1RKT A;  1MBG A;  4MFD A;  5C4X J;  4C3I J;  3G1M A;  1EF4 A;  2HOS A;  2EBI A;  2WV1 A;  5GPC A;  4A3J J;  1D5Y A;  1JGG A;  3RQI A;  4EEF G;  4JX5 A;  4QTR A;  1H89 C;  1Y1V J;  4A3L J;  1IRZ A;  1WGX A;  4DYQ A;  2HXO A;  2CQQ A;  3S14 J;  1ETO A;  4FE7 A;  2M34 A;  3FKI J;  3BR1 A;  3JRH A;  2ELK A;  4NDL A;  5F1J A;  4FCY A;  1P7I A;  3HOV J;  3IH2 A;  5GPA A;  4FIS A;  4JX4 A;  3CMY A;  2M0C A;  1QVU A;  2OF7 A;  5DTD A;  4QSH A;  1HF0 A;  1I3Q J;  3ZQG A;  2TCT A;  2DMP A;  4A3M J;  2CUE A;  2LP0 A;  3D1N I;  4D7M A;  1OCT C;  2W48 A;  2O7O A;  3HKZ N;  3MVP A;  3WHB A;  1TWA J;  3BG5 A;  3S1Q J;  4BBS J;  1IDY A;  3QPS A;  1A5J A;  2E2I J;  2HYJ A;  3Q0W A;  4XRS G;  2DA1 A;  3FK6 A;  3FIS A;  1FJL A;  1U78 A;  4A3I J;  2IBD A;  4HNV A;  3I4N J;  1VFC A;  1SAN A;  5EGO A;  4X6A J;  1UHS A;  3BR0 A;  2DN0 A;  3Q0U A;  2EZK A;  5F0H A;  3OOU A;  4B4C A;  4C3J J;  1IG7 A;  3I4M J;  2IEK A;  2PMZ N;  1JUP A;  3S16 J;  1SFO J;  1T56 A;  2VKV A;  3S2H J;  2L7F P;  4UUS A;  1XS9 A;  2MGQ A;  4FE4 A;  1W0T A;  3ZQH A;  1O4X A;  3RZO J;  4A69 C;  3OSF A;  5F27 A;  3BTL A;  3SJM A;  3ZQI A;  3UKG A;  2XGD A;  3BG9 A;  1MSE C;  3LNQ A;  3A01 B;  2L0K A;  1JKP C;  2HI3 A;  4W1U A;  3FK7 A;  2LFB A;  2M9H A;  2VKE A;  2HDD A;  2DA3 A;  4L5E A;  3PO3 J;  1R9T J;  3ZQC A;  4DZJ A;  5EZH A;  2DA4 A;  1FIP A;  2K9S A;  4LOC A;  4D5C A;  1BW6 A;  3HOZ J;  2DMT A;  2ME0 A;  1GVD A;  4IHY A;  2M8G X;  5IP6 A;  1OCP A;  3BQZ A;  2NVQ J;  5IYD J;  5FKL A;  1ZR2 A;  1HCR A;  4V2G A;  2DA5 A;  5HOD A;  2NVT J;  5FJ8 J;  4UUS B;  1RKW A;  2MG4 A;  5E3L A;  1GUU A;  4M3B A;  2JA7 J;  5JLX A;  3HOW J;  3LSG A;  3CCY A;  5FKM A;  1Z77 A;  3SDG A;  1K83 J;  2Y9Z A;  4ABZ A;  1DU6 A;  3IH4 A;  2LD5 A;  1NK2 P;  3E7L A;  4W97 A;  1JTY A;  2DTZ A;  2EQR A;  3W6V A;  1AKH A;  2CU7 A;  4FTH A;  4A3K J;  5M5Y J;  2HOA A;  3JRB A;  2QCO A;  2YS9 A;  5K7H A;  3ZQF A;  3QQA A;  1F36 A;  3BTJ A;  4M3G A;  2JA6 J;  4MLO A;  4BXX J;  2Y30 A;  3O8H A;  5EF6 A;  1PUF A;  5EZG A;  3BTC A;  5EYR A;  3BR3 A;  5EG0 B;  3BR2 A;  1G2H A;  3QPL A;  4MFE A;  1ZGW A;  3HGG A;  1HOM A;  3TP3 A;  5F0C A;  2DMU A;  4M3F A;  1HLV A;  3BQY A;  1RET A;  2FD5 A;  4M3D A;  3S1M J;  1TWH J;  1ZKG A;  2NS7 A;  1A6I A;  1S7E A;  2LVS A;  1X58 A;  5FKK A;  1Z0X A;  2X48 A;  4M3E A;  3ZOB A;  3HOY J;  2L7Z A;  2H8R A;  2EZL A;  5J3L A;  9ANT A;  1IUF A;  4S0H B;  1AKH B;  2P81 A;  1ETV A;  5GP9 A;  3A01 A;  4X1E A;  1ORK A;  3B6C A;  4QIW N;  1FEX A;  1ZTR A;  3CQZ J;  3JRI A;  3GTQ J;  4XRS A;  3ZQL A;  2ECB A;  2I10 A;  3Q3S A; 
#chains in the Genus database with same CATH topology
 2P6T A;  2V4J C;  1Y56 A;  1HKT A;  4G12 A;  1U5T C;  2GIZ A;  4A5N A;  3C2B A;  4YFK F;  5FLX Z;  2IGN A;  3ASO H;  5DV5 A;  2Y0M A;  3CJT B;  2KHM A;  3MFK A;  4BBR J;  1FBU A;  4XLC A;  2M1B A;  1R7J A;  4ETS A;  3G1L A;  1OMI A;  1R00 A;  1R36 A;  5J47 A;  1IV6 A;  4V2F A;  1ZRC A;  3BG3 A;  1O3Q A;  2XB0 X;  3HB9 A;  3TW6 A;  2XUB A;  2QZ8 A;  2ID3 A;  5IP7 J;  2HPI A;  2QQA A;  3KYD B;  4DYR A;  1ERD A;  1ZLJ A;  4G6T B;  4CO8 A;  1X2M A;  1IZ1 A;  3CP8 A;  1XGN A;  1ZR4 A;  1YFH A;  3ROU A;  3LSR A;  1MND A;  2R5Y A;  1BI0 A;  2MH9 A;  2EH3 A;  2IS6 A;  3CO7 C;  1T98 A;  4DZP A;  3KEQ A;  3LWF A;  4DYC A;  2R92 J;  5B1B H;  2WAD A;  3K70 D;  3KZZ A;  4HG2 A;  1UMQ A;  3WGI A;  1PP7 U;  3GTM J;  5DS9 A;  2ZJQ F;  1E17 A;  2HYF A;  3R4K A;  1U8B A;  2G7H A;  1Z21 A;  1E3P A;  3CDH A;  1ZG5 A;  3K69 A;  1WCM J;  1W5S A;  4F52 A;  2MA3 A;  1LE8 A;  4AC0 A;  4MGR A;  1JKO C;  2IT0 A;  2VB6 A;  3PQK A;  3VSL A;  3K4M A;  3DKW A;  5F0F A;  4BHC A;  4XM3 A;  4CYD A;  4EM0 B;  1P4A A;  4WK8 F;  2XC7 A;  1W5T A;  1MZB A;  3WTU C;  3OMY A;  4HEA 2;  1ONV A;  5F04 A;  4AIJ A;  3IKV A;  3LQQ A;  4RAF A;  4F55 A;  2JMW A;  1Y6I A;  1H88 C;  4XRF A;  1S5L C;  2ZFW A;  3HOX J;  3F3X A;  1ZN2 A;  5HDK A;  3QU3 A;  5HLH A;  2KJC A;  2DW4 A;  3I53 A;  4DNC A;  4G94 A;  4UUV A;  2QSG X;  4PGG A;  2LK2 A;  2OPT A;  4IZZ A;  3HBL A;  4MIM A;  1BOB A;  2V26 A;  1YQA A;  1EH8 A;  3H9J A;  3OIO A;  3AL0 B;  3HDD A;  1G3T A;  4CDG A;  4F91 B;  1IN5 A;  3EYY A;  4LLG F;  1H8A C;  2HQR A;  2JQ7 A;  2OTJ I;  1MH4 A;  3M3Y J;  2FRH A;  3WE2 A;  3S17 J;  3ZMV A;  2MW8 A;  3IH3 A;  3H3Z A;  4PSW A;  3H36 A;  3SZT A;  4XID A;  3CMA I;  2ZSI B;  1WJF A;  3ZQQ A;  2QWW A;  4CIC A;  1UCR A;  2X6X A;  5IOY A;  1VQ8 I;  1T08 B;  2RN7 A;  4C3H J;  3FXJ A;  1Z6T A;  5D8K B;  2O5R A;  2WAQ A;  5LHI A;  1W0U A;  2O8K A;  4IX7 A;  4DJA A;  3GTP J;  3V8J A;  1FTZ A;  4BHB A;  3TP0 A;  2E1O A;  3NWT A;  4A12 A;  3K4J A;  3M7G A;  2BVL A;  2B0L A;  5EJC A;  4A2U A;  5JFR A;  3LSJ A;  4CCN A;  5C44 J;  5B3S H;  4BE1 A;  3S2W A;  3WU2 C;  3CF5 F;  3VFZ A;  3MEX A;  1JT6 A;  4MTD A;  4KIT B;  1FYL A;  3IL2 A;  3SDB A;  1BBY A;  3CUO A;  2M7B A;  3NRV A;  1Z9C A;  4OIQ F;  5F1R A;  2EIM H;  4UXN A;  4OIO F;  1V55 H;  2OV7 A;  2V1U A;  2V1N A;  2UZK A;  3QP6 A;  3ESW B;  2GZW A;  1IO2 A;  1G4D A;  1A04 A;  1NG6 A;  5IOZ A;  3BY6 A;  5JLW A;  2AQF A;  5DCF A;  2DA2 A;  4BDY A;  3C3W A;  1RIO H;  4P9F A;  3RPQ A;  5E20 A;  3HTU A;  4D5F A;  1K4S A;  2A69 F;  1VND A;  5M3F J;  1ITY A;  2DT6 A;  5CQG A;  2Q2E B;  2XIG A;  2L02 A;  1O3R A;  3U21 A;  4IOC F;  1MMG A;  1ZK8 A;  4RMN A;  2DT7 B;  1B1B A;  1WJ5 A;  2MYS A;  3QAH A;  5IYC J;  2ADU A;  1TBX A;  4FQG A;  4UVC A;  1Y1W J;  1TL8 A;  3K0L A;  1Z7U A;  5KHD A;  1WVR A;  4KYW A;  3FXQ A;  4U7D A;  4RM3 A;  4IRH A;  5HS9 A;  4CYC A;  1JGS A;  1FOY A;  1X3Z B;  3DLL F;  2CQ7 A;  1S8N A;  3AG2 H;  2B63 J;  2JWT A;  5LGU A;  4YFN F;  4LG3 A;  4XL9 A;  1FSH A;  5C3E J;  4HOB A;  3P9C A;  3DCF A;  2QF7 A;  3V4G A;  5K7Z A;  1D1B A;  2EZH A;  4KIC A;  2HVQ A;  2CSO A;  1WJA A;  2DO7 A;  1EJ9 A;  2LLK A;  4E7Z A;  4KMF A;  5CJ9 A;  4BGD A;  3IWZ A;  3TGN A;  3KYL A;  3RPU D;  3GW2 A;  2XHK A;  2DAO A;  1UJ8 A;  3LOC A;  2I5U A;  4RM2 A;  2MSY A;  2VPL A;  3HRT A;  4BY7 J;  4F3Q A;  2PMZ A;  3G3Z A;  2E2J J;  3L2V A;  4IHW A;  1QVT A;  2VOP A;  3V7R A;  1FY7 A;  2X9D A;  4M9Z A;  4U0V A;  3HGY A;  1IN6 A;  2KIU A;  3I64 A;  1R5I D;  4XOR A;  3ULQ B;  3OL3 A;  4IO9 F;  1KU3 A;  4GRI A;  1GT0 C;  1TNT A;  3FXO A;  4MHG A;  1OCR H;  4C2M J;  2CV2 A;  3P9K A;  4LIV A;  5HLT A;  4I6Z A;  4DW6 A;  2KIS A;  3ZCO A;  2M45 A;  1N25 A;  2CJJ A;  1MJB A;  2R7R A;  4LB6 B;  4JYK A;  1LFU P;  4BS9 A;  1ETX A;  3BRO A;  4MEX F;  4EJV A;  2KQR A;  2L7K A;  1APL C;  1MMS A;  5LRS A;  3EUH A;  3W2V A;  1BI2 A;  2KL4 A;  4NQW A;  2XB5 A;  3WTT C;  4HZF A;  1MBG A;  5C4X J;  1B9M A;  3KZI C;  3HL2 A;  2JSP A;  4QPO A;  4U87 A;  4XNF A;  2EBI A;  2Z16 A;  3SZP A;  4A0Y A;  2HYG D;  3I0T A;  3VYR B;  3RQI A;  2VQC A;  1J5Y A;  2L2O A;  4JX5 A;  1VQN I;  4QTR A;  3C18 A;  3ZRG A;  2ZXI A;  1VQL I;  4UY8 I;  2DT5 A;  2PG4 A;  4KIF A;  1X1D A;  3PJR A;  2VBW A;  2JA2 A;  4XLE A;  1BIB A;  4FE7 A;  2JUC A;  1O7L A;  4L9N A;  1VQ6 I;  3T8T A;  5ERI A;  2TDX A;  4MEY F;  2OZU A;  3IH2 A;  5GPA A;  3OYG A;  4G7H F;  4AM3 A;  1YYV A;  4JX4 A;  4BL0 B;  1QVU A;  4RB2 C;  3E97 A;  2MLK A;  2I8D A;  5KVR A;  2V79 A;  3VEP A;  1I3Q J;  3ZQG A;  2P0W A;  3OYI A;  1QBJ A;  3GO5 A;  3GZ5 A;  3OY9 A;  2LP0 A;  3D1N I;  2GA1 A;  2W48 A;  2O7O A;  3MVP A;  3WHB A;  2K3F A;  3OYB A;  1YTY A;  2W7N A;  2E2I J;  5K5R A;  4JBA A;  4B09 A;  1ZH5 A;  3RCO A;  1PP8 F;  1U78 A;  4Y13 A;  2WBM A;  1VFC A;  2EA4 A;  1WRJ A;  3K4L A;  5GTH C;  4HQE A;  1LQ1 A;  2VE9 A;  1UHS A;  3VOD A;  4EQQ A;  2RRE A;  2EZK A;  2V9V A;  1KYZ A;  5F0H A;  4C3J J;  1IG7 A;  2M87 A;  2L9S A;  1W7P D;  2V1D A;  3FBN B;  4I98 B;  3OYM A;  1SFO J;  1T56 A;  2O03 A;  5FRO A;  3S2H J;  1WQ2 A;  2VBY A;  1NHA A;  4G9Y A;  5D4S A;  2W1O A;  1O4X A;  2L4M A;  3JTH A;  1S9H A;  1UHM A;  3LA3 A;  5F27 A;  1IXS B;  1H0M A;  3SJM A;  5L3D A;  2XAJ A;  5TGT A;  3BZC A;  2WAE A;  4BNC A;  2DOA A;  2LFB A;  2DFF A;  4HNT A;  5K1Y A;  1K79 A;  1U0J A;  4C2T A;  2V1X A;  1OLT A;  1UG0 A;  2L01 A;  3KP3 A;  2XAH A;  4L5E A;  4U0Y A;  2PX9 A;  2VOD A;  1P6R A;  2UXX A;  3HUG B;  1L3L A;  1QHG A;  4DZJ A;  2DA4 A;  1FIP A;  1IV8 A;  4KIS A;  1GHC A;  4NNJ A;  4MQV A;  3HOZ J;  2ZME B;  1GVD A;  4IJA A;  2YR2 A;  1FMV A;  3OYN A;  2DFH A;  3FM3 A;  2K02 A;  2LRE A;  2VT2 A;  1HSJ A;  4OWR B;  5AIP A;  2RNJ A;  5EEG A;  5FJ8 J;  4UUS B;  1R1U A;  1GUU A;  4M3B A;  1B9N A;  3O2P E;  5E3L A;  6PAX A;  1KQ8 A;  2XF5 A;  4PCQ A;  5JLX A;  4E4H A;  3FMR A;  4UV9 A;  2NVU B;  3CCY A;  4UB6 C;  3CDI A;  3IHU A;  1OKR A;  3SDG A;  1MMN A;  2Y9Z A;  3RSN A;  4E7S A;  2FEZ A;  2YPR A;  1VQO I;  1DU6 A;  3IH4 A;  4NC7 A;  2KJB A;  2LD5 A;  3E7L A;  4B3X A;  4W97 A;  2EQR A;  3SFZ A;  3W6V A;  2R7S A;  2CU7 A;  5LHH A;  4EAT A;  4FTH A;  1X3W B;  4A3K J;  2QA4 I;  4EJT A;  4Q4Z F;  3VSK A;  3HPG A;  3QQA A;  4KT5 C;  2O6G E;  4BE0 A;  3C2G A;  1U5T A;  5K5Q A;  2OTL I;  2Y30 A;  4GYG A;  1OQY A;  3OV8 A;  3DLA A;  3H5A A;  4MQ9 F;  4BQN A;  5EYR A;  1SD7 A;  4E6K G;  1K78 A;  4HX7 A;  1YS6 A;  1G2H A;  4HA8 A;  4I02 A;  4MFE A;  4PGH A;  3F6V A;  2W85 A;  1JXS A;  2EFO A;  3TP3 A;  1RET A;  3RYP A;  3DWL E;  1TWH J;  2NS0 A;  3G6E I;  4BHP A;  1S7E A;  3KET A;  2LVS A;  2ZBK A;  5FKK A;  1HKQ A;  3CCU I;  2X48 A;  3H92 A;  3KP6 A;  3K10 A;  4AD9 A;  1TQI A;  3HOY J;  1DUX C;  4BXF A;  2ZNY A;  5KK1 A;  5J3L A;  5AON A;  3GF2 A;  1ZLK A;  2QEN A;  1ZGJ A;  1TT5 B;  2F48 A;  4FET A;  3DTK A;  3B6C A;  4EJU A;  1BM9 A;  3CJR B;  3KLO A;  1FEX A;  4HDV A;  3CQZ J;  3BOQ A;  2DPD A;  1IN7 A;  1MIJ A;  3ECO A;  2ECB A;  3Q3S A;  4Y17 A;  4RBO A;  3V7C A;  2IA0 A;  4YIF A;  1X19 A;  2KDO A;  1ETW A;  4KMU X;  2VI6 A;  1CF7 A;  2DK8 A;  4M74 A;  2VBZ A;  2JZY A;  5EEA A;  1BL0 A;  1CQT A;  5J1R A;  3GTO J;  4XIC A;  2DK5 A;  2HU9 A;  3F0C A;  2H1K A;  1XC5 A;  2XPV A;  1GV5 A;  3SFI A;  2BY3 A;  1G59 A;  3WE3 A;  1B72 A;  4Y33 A;  1T33 A;  2LKP A;  2VJJ A;  3L2U A;  1UB9 A;  3RKW A;  3WGH A;  3EUK L;  2E1N A;  2MC4 A;  1WH7 A;  4UV8 A;  2GIV A;  4R8H A;  5AIQ A;  1R71 A;  3K7A J;  2R7U A;  1SVO A;  1BI3 A;  1IJW C;  2STT A;  4IQ4 A;  4OAZ A;  3EQL F;  4I2O A;  2Y69 H;  2E36 A;  3U1D A;  1D5V A;  1V5F A;  3V8L A;  1VF9 A;  3LSP A;  5LD2 C;  1ZGA A;  4A3F J;  3I56 I;  2TRT A;  3KPH A;  2E1C A;  3W2A A;  5HS8 A;  1IXR C;  2ELJ A;  3I54 A;  2GBY A;  1ODD A;  2L54 A;  3IRQ A;  3D5L A;  3CDL A;  2GXA A;  3GTL J;  2H09 A;  2LNB A;  3JSO A;  3G4S I;  2LKS A;  1X1P A;  2VIX A;  4IXA A;  3WTV C;  2GLO A;  2MH2 A;  3HYI A;  5L3C A;  2DDB A;  5DM7 F;  4M71 A;  3Q5F A;  3KP2 A;  3B6A A;  5E1W A;  1OJL A;  3OYJ A;  5E17 F;  1LVA A;  1G8X A;  3ELK A;  1T39 A;  1Y8Q B;  3CTA A;  5KAF C;  3D5R C;  3L2C A;  2JK3 A;  2CGP A;  3A0H C;  4AYB N;  5FKN A;  3CCL I;  1RC9 A;  4BU2 A;  4HAM A;  3FWE A;  3GTG J;  3K70 C;  2Q1Z B;  1PYV A;  4LD5 A;  2K9Q A;  3LQR A;  4XOP A;  3L00 A;  2BY0 A;  1FC3 A;  2R5Y B;  4XSZ F;  3DKX A;  3ZMT A;  1IN8 A;  1LEB A;  1JTX A;  1U9N A;  2ZKZ A;  5D5W B;  4IOA F;  1HW2 A;  4Z2Y A;  1RUN A;  4PJ0 C;  3TKY A;  1IUY A;  1IAW A;  1F9N A;  1OR7 C;  3GWZ A;  1JJ8 C;  3EDP A;  2QKM B;  3GFJ A;  5LRR A;  5DM6 F;  4CHU A;  5IT9 Z;  3H3V K;  2NOJ B;  3WU0 A;  1QHH D;  2PJR B;  3HM5 A;  3HC7 A;  1IN4 A;  3RQ4 A;  1MJ9 A;  1DPU A;  5J8C A;  2M5W A;  1HXD A;  3ASN H;  1MDM B;  1UZC A;  4IRI A;  1V3F A;  1YX3 A;  4HQM A;  1LE8 B;  4GGG A;  4C2U A;  3MN2 A;  2IP2 A;  1MMA A;  5M5X J;  2CV0 A;  3VOE A;  3I71 A;  1WJE A;  5JVG F;  5FLX K;  3A02 A;  2OCE A;  3GFM A;  1R23 A;  2XGX A;  4UVB A;  1UAA A;  2EFN A;  1OPC A;  4A3E J;  2VAS A;  3DV8 A;  1QO0 D;  1N77 A;  2WTE A;  2EJR A;  2WB1 N;  1JHF A;  1ZHF A;  2GXB A;  3VYU B;  4LLN A;  2CFO A;  2BXY A;  3ABL H;  4ZDO A;  3GTK J;  1ETK A;  2D5V A;  1X2N A;  2QSH X;  1Q1V A;  3ABM H;  3OSG A;  2R7Q A;  3PSF A;  2OCC H;  3F8C A;  1K6Y A;  4J00 A;  2XPU A;  3HSF A;  1JUM A;  3E1S A;  1R5G A;  1J9I A;  4K2E A;  2FX0 A;  1KU2 A;  3HOU J;  3GCM A;  3I58 A;  4I09 A;  2WAF A;  4OIR F;  2F4I A;  2VKH A;  4P1W A;  3R6S A;  1YO5 C;  2E1M C;  4LIU A;  1TNS A;  5FRN A;  4XLH A;  5A2Q Z;  1AOY A;  4FX4 A;  3WOD F;  3ZMU A;  1W36 C;  5EDN A;  3U9G A;  1Z6R A;  4GDF A;  3GUD A;  1TWC J;  1EH7 A;  4CZZ A;  3O3K A;  1JKR C;  1PUF A;  2CW0 F;  1MH3 A;  3GBG A;  2Q8K A;  2FU4 A;  2VUM J;  3WHC A;  3I3L A;  4D0P A;  3L7W A;  3JSP A;  2KP6 A;  2K86 A;  4CXF A;  3CO6 C;  2CWE A;  2FMY A;  4JP0 A;  3AKZ A;  3GZ6 A;  1K4T A;  1VQ9 I;  4YRV A;  3P9I A;  2GWR A;  3H35 A;  1DPR A;  3ISP A;  5E3N A;  2NXN B;  3R0A A;  1IRF A;  3QRF F;  1U2W A;  4E7L A;  1H9T A;  4PFO A;  3ERE D;  1MGT A;  2ZNZ A;  2J5P A;  4PJJ A;  3N97 A;  1AA7 A;  2LTP A;  4XSX F;  2PJR A;  3G73 A;  1TW3 A;  2E7X A;  2BHZ A;  3D5S C;  1MDM A;  5GTI C;  1D8K A;  2IS1 A;  1D1C A;  3S93 A;  2ME6 A;  3DFG A;  1A35 A;  1SMT A;  2HVS A;  2DJN A;  2K9M A;  1X4O A;  3S3N A;  2R7T A;  2MD0 A;  1NH3 A;  2DPU A;  1P2F A;  3S1N J;  3I59 B;  4A3B J;  3CZ6 A;  3J80 Z;  2VQL A;  3S15 J;  3PNT A;  5BNG A;  1JUS A;  5HDG A;  3M4O J;  2VL8 A;  1EV7 A;  4IHT A;  3C2H A;  3DPL C;  1FSE A;  2COB A;  1YIJ I;  3R60 A;  1R5H A;  4LGW A;  4KN7 X;  3JRE A;  2RAE A;  2XAQ A;  4XRM A;  2FXA A;  4CYC B;  5J40 A;  3DQV C;  1D8J A;  2P8T A;  2XRL A;  3JRG A;  2H94 A;  3SEQ A;  2DQL A;  1ZG1 A;  1D0Y A;  3BPV A;  3K4C A;  5ICC A;  1MBF A;  1LJ9 A;  1P92 A;  2BZT A;  2O9L A;  2VLA A;  2XSD C;  2DDA A;  3JR9 A;  1FZP B;  5B66 C;  1UG2 A;  4FT8 A;  5D4R A;  3RTR A;  4KFC A;  4AVP A;  4BAC A;  1SVM A;  3OS1 A;  4KA4 A;  1T6S A;  1U9O A;  3PM1 A;  3CCV I;  3QP5 A;  5H20 A;  3H1C A;  2VOO A;  4UHT A;  3MQ0 A;  1IXC A;  3N05 A;  2EFQ A;  1P7J A;  3IAM 2;  2DBB A;  5GAD J;  2XPW A;  3CES A;  2OBP A;  3C7J A;  1FX7 A;  3V7S A;  4F7Z A;  1QNT A;  1RKT A;  2L9V A;  3KE2 A;  2H27 A;  5E1X A;  3FBI B;  3K4N A;  3OYD A;  3KEY A;  5GPC A;  1TZL A;  1JGG A;  1D5Y A;  1RR8 C;  2OQR A;  2A07 F;  1Y1V J;  3OYC A;  2AXL A;  3PUB A;  3F8B A;  4KJZ A;  1IRZ A;  2EV0 A;  2F4O B;  4HLY A;  4YII A;  3KX2 A;  4BQQ A;  2HXO A;  1P4W A;  1YI2 I;  4NUB A;  2HTJ A;  1VZ0 A;  4IL6 C;  2M34 A;  3R0J A;  2X1D A;  2Z1D A;  1QZE A;  1HKS A;  3HG9 A;  1WJB A;  4NDL A;  2EIK H;  2Z3Y A;  3WG7 H;  2VBX A;  1N78 A;  3F9K A;  4O3M A;  3DU5 A;  3K1P A;  3Q9V A;  4HV5 A;  3HOV J;  4H0E A;  1YW7 A;  4FAS D;  2OF7 A;  2OQG A;  1S72 I;  4ESF A;  4II3 A;  1WWX A;  5HS7 A;  4N9H A;  2TCT A;  1I5Z A;  2HTS A;  3MCZ A;  3U1K A;  4EM1 A;  3S1Q J;  3I59 A;  4NQW B;  3BG5 A;  3F8F A;  5HNF A;  4BBS J;  1IDY A;  1SFX A;  1A5J A;  4RGU A;  4XOT A;  3OYK A;  4XRS G;  3FK6 A;  3FIS A;  4A3I J;  1LPQ A;  2LF8 A;  2IBD A;  2LY1 A;  3I4N J;  4ZC3 A;  1SAN A;  4X6A J;  3PNV A;  3BR0 A;  4ZYE A;  2DN0 A;  4B4C A;  3F6O A;  3J7Z I;  1JUP A;  3S16 J;  4QWQ A;  1BOA A;  3GYH X;  4ZYG A;  1W0T A;  4ZTF A;  3RZO J;  4PZJ A;  2IXS A;  3DPT A;  2V9P A;  4P9U A;  2X1E A;  3ABU A;  1KGS A;  4XLF A;  5B5E C;  3GX4 X;  3DXJ F;  5LEJ A;  3H5N A;  2XGD A;  4P55 A;  3LNQ A;  3A01 B;  1YHQ I;  4G7O F;  2L0K A;  4W1U A;  2BXZ A;  3FK7 A;  5GAE J;  3CCS I;  2VKE A;  4WXC A;  1FYK A;  2CQN A;  3FZV A;  3HRM A;  3FHZ A;  3ZQC A;  2HR3 A;  1QPM A;  2FOK A;  4G6D A;  1X1C A;  2WC2 A;  1BW6 A;  4XKW A;  4IHY A;  1QU3 A;  3JW4 A;  2M8G X;  4KDP A;  3M8F A;  2NVQ J;  5IYD J;  2JUG A;  1GXP A;  1R4N B;  1HCR A;  1B4A A;  4V2G A;  3F72 A;  2DA5 A;  1RKW A;  2W57 A;  3JTG A;  2JA7 J;  2E60 A;  3KP4 A;  1MD0 A;  4DGW B;  1V5G A;  4HF2 A;  3OYE A;  1V5E A;  1WJD A;  1OCC H;  5L3G A;  1O57 A;  5FKM A;  3ZGK A;  2M8E A;  4ABZ A;  5F6F A;  4MTE A;  4HX8 A;  1Z91 A;  1JTY A;  4MNU A;  2DTZ A;  3HTS B;  2K85 A;  2DOE A;  1D0Z A;  4J01 A;  5BS6 A;  1G6N A;  3CCJ I;  3KIO A;  2HOA A;  1S6L A;  3JRB A;  3VYT B;  4BQA A;  3LAJ A;  3KP7 A;  2IS2 A;  3N4M A;  3AG3 H;  4D9J A;  2YSR A;  4C9Y A;  1KA8 A;  3BTJ A;  2JA6 J;  4M3G A;  3E6D A;  4MLO A;  1O3T A;  3O8H A;  3CCQ I;  1C0W A;  5EF6 A;  3IUO A;  3BG6 A;  4AYB A;  1A6Q A;  5B1A H;  1PVE A;  1P9Q C;  2GAU A;  3ZN1 A;  4ASN A;  3QPT A;  1DP7 P;  1LDJ A;  3BR3 A;  3FDY A;  5EG0 B;  2O61 A;  3BR2 A;  5JR3 A;  3P5J A;  3QOE A;  4CCJ A;  3QPL A;  2JVH A;  4L9T A;  2Z2S B;  1HOM A;  2CV1 A;  3LFU A;  2P5K A;  2C6Y A;  3OIQ A;  2FD5 A;  3S1M J;  4M3D A;  3E6M A;  4LG0 B;  3GFI A;  1XTA A;  1A6I A;  2JT1 A;  3HSR A;  5D6E A;  2DYR H;  4II2 A;  3FXU A;  4M3E A;  2K4J A;  1FBS A;  2BBY A;  2LYC A;  2QQ9 A;  1G3W A;  4HLX A;  2P7V B;  3A01 A;  4G7Z F;  4QPQ A;  3WTZ A;  4X1E A;  4QIW N;  1MNE A;  1YIT I;  3JRI A;  3GTQ J;  2ZCW A;  4YEL A;  1LUJ B;  4ZZD A;  1HA8 A;  1U5T B;  1FWZ A;  2JA5 J;  2ESH A;  2KKO A;  2Y0S A;  1VQK I;  4BE2 A;  1X1B A;  3WTS C;  4IHS A;  2CYY A;  1HW1 A;  4Y7N J;  1K78 B;  3E5X A;  3BJA A;  4EV0 A;  1UEL B;  2WB1 A;  1SAU A;  2A61 A;  3HOT A;  2VJ4 A;  2IGM A;  5KCM A;  2RC4 A;  1USS A;  2BE5 F;  4A6D A;  1BN5 A;  1OCZ H;  2HOT A;  2HQ5 A;  1KQ9 A;  4L5I A;  4CH7 A;  2ACJ A;  2LMD A;  1ZQ3 P;  1POG A;  3W3C A;  4RAZ A;  2FQ4 A;  2D1V A;  1XG1 A;  3BTI A;  4M6X A;  1ETQ A;  3J81 Z;  2GQQ A;  3OYF A;  1NK3 P;  4GO1 A;  4MO7 A;  1TT0 A;  1Z05 A;  3BT9 A;  3RKQ A;  3FXK A;  3Q0V A;  1OR7 A;  2RVC A;  4KN4 X;  2BHY A;  4A3D J;  2JJ7 A;  1XB4 A;  2DTR A;  5CYV A;  4CSW A;  2ELH A;  2Z33 A;  2BEO A;  4HSR A;  1MNM C;  4CCL A;  2W82 A;  2QLZ A;  3IWF A;  3I4P A;  1CF7 B;  1HDP A;  4NC6 A;  2F6C A;  4OMZ A;  1U8R A;  2HDC A;  2GM4 A;  4BXU A;  5LEK A;  3HKZ A;  1VI0 A;  2ZB9 A;  1YOV B;  2JSC A;  5ILU A;  5LHG A;  1NG7 A;  2Z5U A;  3K1M A;  5EG0 A;  2L7M P;  2QUF A;  3OS2 A;  4DOZ A;  1QZZ A;  1B72 B;  2R4G A;  3BZK A;  1E0E A;  2Y31 A;  1ZRE A;  4LG0 A;  5LGN A;  5K5O A;  4ZJZ A;  1V4R A;  1DDN A;  1RNL A;  4RA2 A;  1SFE A;  1MW7 A;  4CGZ A;  2JA8 J;  2H6C A;  3HOS A;  4BJ5 C;  2FNP A;  4GCV A;  1J0R A;  1FTT A;  1RUO A;  3JRF A;  2HQN A;  3WTY C;  3OOP A;  1RR7 A;  1WH5 A;  3O6B B;  4WXH A;  2MC3 A;  3M8E A;  4S05 A;  5L3F A;  3HIF A;  1MBE A;  2FJ1 A;  1MSF C;  2MLG A;  2CUF A;  5D5X B;  4KIB A;  5HOO A;  2VXZ A;  2EB7 A;  2FOW A;  3AL0 C;  5E3O A;  2O3F A;  1O3S A;  4B3A A;  4WCG A;  1ENH A;  5CVV A;  3CJN A;  1YJW I;  3TBI A;  3RKX A;  3KYC B;  4EGZ A;  2R7Z J;  1HQC A;  3RIR A;  1Z1D A;  1BR2 A;  2A5W A;  4WXD A;  3NAU A;  1FP1 D;  3DTI A;  4N4N B;  5ICF A;  1ZEL A;  2QBY A;  1YJ9 I;  2CFX A;  1I39 A;  3KEO A;  2YUS A;  1A31 A;  2R5Z A;  1LKX A;  3T0Y A;  1GDT A;  5IP9 J;  2G9W A;  2AQE A;  3AG4 H;  2NS8 A;  1ACI A;  2M7A A;  2R7W A;  2MFZ A;  1FP2 A;  2R7F A;  3RKY A;  2F5E A;  2COM A;  2OA4 A;  4L9V A;  4XQF A;  3I5U A;  1F43 A;  4D7N A;  3GFL A;  2CMP A;  4XLN F;  1ZG3 A;  4UVA A;  3HZJ A;  2JRM A;  3LL7 A;  1B8I A;  2NVY J;  1OYW A;  2PFB A;  3J7A O;  4IKF A;  1DP3 A;  1R58 A;  1XD7 A;  5K7F A;  1VQ4 I;  2KZG A;  2X4H A;  1XPX A;  2VQG A;  4GFB A;  3A0B C;  2QEX I;  2EZI A;  1H9G A;  1YS7 A;  3QWL A;  2NNY A;  4XBF A;  2BGC A;  2AHQ A;  3IV5 A;  5DCM A;  1UHW A;  5CLS A;  4OIP F;  3ZMZ A;  4EM2 A;  4XN3 A;  4YFX F;  3S8P A;  4A3C J;  1R6R A;  4S04 A;  4ESB A;  3H0G J;  2CS3 A;  2PMH A;  3PSI A;  3E0J B;  2RKH A;  2FBH A;  3LSM A;  4E7H A;  1OYI A;  2IAI A;  4RS8 A;  3NWS A;  2ZO4 A;  1SFU A;  1IRG A;  3SHF A;  4RLQ A;  1X1A A;  3MZH A;  1P4X A;  2VJI A;  5GAH J;  4B8X A;  1BC7 C;  3OYL A;  2CUJ A;  3FMQ A;  1XSV A;  1FYM A;  1AU7 A;  3DF8 A;  5FGM A;  2DMN A;  4XON A;  3G1O A;  2UV1 A;  3QYE A;  5FD5 A;  3OYH A;  3L9F A;  1XN7 A;  2HXI A;  5L3E A;  2K3P A;  4R79 A;  2IPQ X;  4RGX A;  1I1S A;  1R1V A;  1TWG J;  1PDN C;  1SMY F;  2W00 A;  3RPU A;  3CD6 I;  4BY1 J;  4BUP A;  5E18 F;  3KP5 A;  4PJL A;  5IT9 K;  1XDU A;  2DI3 A;  4A5M A;  3SYT A;  1QPI A;  2DOD A;  3FXL A;  1HST A;  3MD2 A;  3L2R A;  3ML6 A;  5CVR A;  2D1H A;  4EMS A;  4O5V A;  3EPZ A;  2O0Y A;  2XV4 S;  1I50 J;  2XKO A;  2R93 J;  4BQO A;  3BCB A;  1J09 A;  2EPF A;  4LFU A;  3F21 A;  1EH6 A;  2XF6 A;  4EJO A;  3CLO A;  1BW5 A;  2PI0 A;  2GA2 A;  1S3J A;  3MKY B;  3H9G A;  4B1R A;  4B48 A;  2P5L C;  4L0Y B;  3BWG A;  1FOW A;  3CCR I;  2LR8 A;  3BZ6 A;  1GVJ A;  3VPR A;  1JE8 A;  2CH0 A;  4Z6Y A;  4LJZ F;  1KQ0 A;  2DYS H;  3W6J B;  5M3M J;  1YIO A;  2E2H J;  2XVC A;  5DUK A;  4X0G A;  2D2W A;  4Y52 J;  4M6V A;  2L4A A;  2LBF B;  1VQP I;  2KRH A;  4WF2 A;  3HSE A;  2P5V A;  5LGT A;  2Y2Z A;  4OU0 A;  2AO9 A;  2EWN A;  1XDS A;  4A0X A;  5ICE A;  4UB8 C;  5LBQ A;  5IPA A;  5ILV A;  4M6Y A;  2QYO A;  2FBI A;  3C1D A;  3WG9 A;  4HX4 A;  2XRO A;  2ESN A;  1SD6 A;  2RV8 A;  4IEJ A;  5BPD A;  1KU9 A;  5A2Q K;  4DBQ A;  2Y0S N;  2VQH A;  3L1P A;  3OR2 C;  2K9N A;  2UUZ A;  5TIS C;  4IQJ A;  1FPQ A;  4HF0 A;  4I0A A;  3MKL A;  3K4K A;  1XX5 A;  2F4M B;  2CG4 A;  4A6E A;  4ENK A;  4F93 B;  2R7X A;  2ZXJ A;  3G1M A;  3E6C C;  2HOS A;  5DEQ A;  4LLL A;  5E8G A;  2WV1 A;  1G3S A;  4EEF G;  2P7C B;  4AU7 A;  1XCV A;  2M0M A;  4XMY A;  1FMW A;  1WGX A;  3BJ6 A;  2X6Y A;  3CLQ A;  4DYQ A;  3JAM Z;  2CQQ A;  3S14 J;  1ETO A;  1WHU A;  2K27 A;  2KZV A;  4LB5 A;  2ELK A;  3BG7 A;  4OAY A;  4FCY A;  1P7I A;  1J2X A;  1Z7L A;  1YE9 A;  1I27 A;  2LRD A;  3CC2 I;  2P6S A;  4YIR X;  3KLN A;  3REO A;  5DTD A;  3LMM A;  2ZJR F;  2IJL A;  2VXD A;  1IF1 A;  1HF0 A;  3CCM I;  2B7E A;  2QKL B;  2D45 A;  3F23 A;  4D7M A;  1M1E B;  3HKZ N;  2VC1 A;  1TWA J;  2Y75 A;  4LIT A;  3CMM A;  1BR1 A;  2AS5 F;  2XDV A;  4JK1 X;  4OIN F;  3FX3 A;  3IKT A;  3PFI A;  2WY8 Q;  1XMK A;  1B59 A;  2DA1 A;  3GEZ A;  1AWC A;  1FLI A;  4HNV A;  3J80 K;  4L5J A;  2M4G A;  4HPQ A;  1MMD A;  2EFP A;  3Q0U A;  5KNL A;  3OS0 A;  3OOU A;  5BMZ A;  2IRF G;  5BQT A;  3I4M J;  2E35 A;  1BJA A;  3TO6 A;  1OIS A;  2L7F P;  3ERM A;  1XS9 A;  2LBF A;  1YLF A;  2MGQ A;  4FE4 A;  3CME I;  1RRJ A;  3AFH A;  5J4Y A;  2YX4 A;  1Y39 A;  4A69 C;  2JPC A;  3BTL A;  3T8R A;  2KMU A;  2F5V A;  4AIH A;  3SXY A;  3ZQI A;  4ZZL A;  2XAF A;  1PJR A;  4C30 A;  4Q48 A;  3SQN A;  2XAG A;  4I0B A;  1O7F A;  3KCC A;  1JKP C;  2HI3 A;  4RB3 C;  2HDD A;  4NC8 A;  2OZ6 A;  2W25 A;  2DA3 A;  1R9T J;  1J59 A;  4AID A;  5L3B A;  2GXG A;  2V9K A;  2XAS A;  3EYI A;  3BLY A;  4ESJ A;  2RQP A;  2FSW A;  1V54 H;  3LSH A;  2K9S A;  4LOC A;  4D5C A;  4M72 A;  2YX7 A;  2BW3 A;  4JQF A;  1SVL A;  4BJ6 C;  3IC7 A;  4U88 A;  5IP6 A;  1OCP A;  2Z99 A;  1F1Z A;  2ZME C;  3G2B A;  2HZT A;  2HGC A;  5JI6 A;  3DU6 A;  1W5C C;  4ENM A;  4V19 K;  2A68 F;  2DJI A;  1ZAO A;  3CUQ C;  4HYE A;  4I7H A;  4XKV A;  3K1N A;  3V42 A;  3DBL B;  3LSG A;  2FBK A;  2X6W A;  2LF7 A;  4ZTJ A;  2F5D A;  4U0W A;  3SZG A;  1Z77 A;  2RGV A;  3KZY A;  3PQJ A;  4CCK A;  3V8K A;  3TMO A;  1AKH A;  2V6C A;  3B73 A;  4UNO A;  2QM3 A;  3TL4 X;  2QCO A;  4L0Z B;  4N4O B;  2HKX A;  3ZQF A;  5TJJ A;  5CQE A;  4HRI A;  2IA1 A;  1F36 A;  1IW7 F;  3Q9S A;  5HDN A;  2LG4 A;  2BV6 A;  2RQQ A;  5EZG A;  4D1Q A;  2KRC A;  3OL4 A;  5CKT A;  2MBF A;  3BTC A;  5E79 C;  3H0D A;  1T0F C;  2HQA A;  1WFX A;  2W4S A;  4NBQ A;  4BEH B;  1Y0U A;  2KRF A;  3FXR A;  2E7W A;  4PJM A;  1ZGW A;  4ZDP A;  4XKC A;  3TOB A;  3M9A A;  4PK4 A;  3VWB A;  1ZKG A;  3UR3 C;  3L2Q A;  3ECH A;  4RAG A;  1W36 D;  4L18 B;  2EA2 A;  3MKZ A;  5DYM A;  2QQB A;  4DIQ A;  1ON2 A;  2FE3 A;  4U7B A;  1Z0X A;  1CGP A;  3ZOB A;  2KPM A;  2EZL A;  4ENJ A;  5FB2 A;  1BC8 C;  9ANT A;  2IGK A;  4IPA A;  1YW9 A;  1YG2 A;  1XSX A;  5DDG A;  3EET A;  3RYR A;  3DEU A;  1SAX A;  2CW7 A;  4A0Z A;  3S3M A;  3HRS A;  1STZ A;  3M8J A;  4XRS A;  1W1W E;  3ZQL A;  3GVA A;  5J1Y A;  2I10 A;  2QSF X;  5CPR B;  4J19 A;  2DFE A;  1R49 A;  3ZN0 A;  3QPH A;  2OC6 A;  5FLV A;  4GXO A;  1PUF B;  2E71 A;  3A1Y A;  5J1U A;  3K6G A;  2DMQ A;  1U3E M;  1YX5 A;  2OAZ A;  3S32 A;  2E19 A;  2O8X A;  1HDD C;  5CVI A;  3GLL A;  3VDX A;  1K6O A;  3FM5 A;  4P5O A;  4PSX A;  1LDD A;  3BR6 A;  2ISZ A;  4CA0 A;  3K2Z A;  2HFH A;  2F5C A;  5FRM A;  5C4J J;  2WV0 A;  1KZH A;  2KIM A;  3TQN A;  3W2W A;  1XMX A;  5BOX A;  2JN6 A;  2PBI A;  2XSJ C;  4A93 J;  3TED A;  4FX0 A;  5D5V B;  3E6B A;  1MBJ A;  1S7O A;  3WGG A;  2CQK A;  1SFK A;  1TW2 A;  2ZXH A;  2VT3 A;  1PUE E;  1LDK B;  3DTE A;  1OFC X;  1BA5 A;  1IGN A;  4IHX A;  2CRG A;  2FML A;  3H5R A;  2OD5 A;  5J6X A;  2CUZ A;  3DBR B;  3OYA A;  2LY9 A;  4BYY A;  3P7N A;  4N9I A;  3OWT A;  3I9V 2;  3WU1 B;  1I3A A;  2R0Q C;  4ENN A;  1ETY A;  5DUI A;  2HPM A;  3J7A Y;  3VYS B;  3GTJ J;  1MBH A;  4ZYA A;  2XGE A;  5J4V A;  2R7V A;  4RLF A;  3M1C A;  3BC8 A;  5FFZ A;  4JX6 A;  4BEH A;  3WTW C;  1BJZ A;  1F4K A;  3FHN A;  1I1G A;  3DKY A;  1Y8R B;  3ABK H;  3HHG A;  3E3V A;  1YJN I;  2AXT C;  2DLL A;  4N0B A;  3TDZ C;  4OMY A;  2K7L A;  5FFX A;  5LLQ A;  1B6A A;  5F64 A;  2PMU A;  4LMY A;  4NHJ A;  2KIF A;  1JKQ C;  1GXQ A;  1VQ5 I;  1R4M B;  2CQX A;  3PO2 J;  1K61 A;  5HNH A;  3BP8 A;  2CO5 A;  2H8W A;  2HWV A;  3QYF A;  1DU0 A;  1LFB A;  1FBQ A;  2IVM A;  2VJ5 A;  1FOK A;  4KUM A;  4CCM A;  5D8L B;  1E3H A;  4JOM A;  1WI3 A;  3E5Q A;  1TP4 A;  2WY7 Q;  2X0L A;  1JT0 A;  1RPW A;  1TC3 C;  2ETH A;  3K4B A;  4ON0 A;  2BY2 A;  4EGY A;  4YEJ A;  1OCO H;  2P4W A;  1DGR M;  2ISY A;  3BPX A;  4XKB A;  5ILS A;  5E3M A;  5D6F A;  3MAJ A;  2BY1 A;  1WZ2 A;  1I6H J;  2VE8 A;  1E3O C;  2KDZ A;  2UXN A;  5IYB J;  4CCO A;  2NOG A;  1MBK A;  1N75 A;  4HW0 A;  2V7F A;  1QRY A;  2VC0 A;  3FF5 A;  3MKW B;  4EVI A;  2ICW G;  2KFD A;  3LAP A;  3MWM A;  3U2R A;  3DBH B;  3J7Y J;  2HVR A;  2ZFU A;  4KIG A;  2KIQ A;  4GYI A;  4HDU A;  2Q2E A;  4AUX A;  4ZYH A;  2CW8 A;  1TWF J;  3PNY A;  3JRD A;  3A2K A;  2XGC A;  1NTC A;  3GXO A;  3QYB A;  4RB0 A;  2E5Z A;  1R22 A;  3FMS A;  1YRN B;  4ITV A;  4A3G J;  1WPK A;  5FO5 A;  3S1R J;  1AHD P;  4PUS A;  1A36 A;  3O8G A;  3LA7 A;  1FNN A;  2DA7 A;  5LFA A;  1X3U A;  3J81 K;  1JI8 A;  2IA2 A;  3S2D J;  2KLO A;  5KAI C;  3MZ8 A;  3H9Q A;  3FIW A;  2E1M B;  4Y3O A;  2Y9Y A;  2JVG A;  5F08 A;  4BH9 A;  3L2W A;  1GV2 A;  1ZAR A;  3BJO A;  4E7K A;  3DEW A;  2X51 A;  2L9R A;  2VON A;  2R3S A;  3ZR8 X;  3MZY A;  1D0X A;  4AVZ A;  2N8G A;  2QBY B;  3K2A A;  3TW7 A;  2KT0 A;  3X2Q H;  2ZJ2 A;  2ECC A;  3ONQ A;  4OOI A;  3RDI A;  2M4K A;  1ZRF A;  4Y4R A;  3T5X A;  2R5Z B;  5BPI A;  4B43 A;  2MD5 A;  2H1L A;  5IY5 H;  2HOE A;  3NEU A;  2GOX B;  3ZMD A;  2R7D A;  3ZXS A;  1WKM A;  1QZY A;  1Z3X A;  1XGS A;  4XK4 A;  3TOA A;  2B9S A;  2X6O A;  1IC8 A;  1TTY A;  3LA2 A;  3RJP A;  1MJA A;  1UST A;  3CC4 I;  2FUG 2;  3MMY B;  1LNW A;  2LSO A;  2WWY A;  2HZD A;  4BKX A;  1ULY A;  2RDP A;  3CJQ B;  3G71 I;  2HDW A;  3I55 I;  1B8I B;  2K40 A;  2OJE D;  2LKX A;  3VB2 A;  5FKO A;  5HLI A;  3LFK A;  2DA6 A;  2L3D A;  2QGU A;  2DFI A;  4M9X A;  2OU2 A;  5H2F C;  2M30 A;  1W4M A;  1MKM A;  1LFP A;  2PLY A;  3A4C A;  3JRA A;  2VPR A;  3F8M A;  4RGS A;  2F5F A;  4FHT A;  3EUA A;  1JHH A;  1XMA A;  2XF7 A;  4XLA A;  1I6X A;  5M5W J;  2K9L A;  4UUT A;  2FA5 A;  1LEA A;  2PJP A;  5DCM B;  2STW A;  1TLH B;  4G6Q A;  3QU6 A;  4KNY A;  1JJ6 C;  2LOO A;  1WSU A;  4AIK A;  1IDZ A;  1RZ4 A;  1ON1 A;  4LK1 F;  2EV5 A;  2PQ8 A;  5J8F A;  2F2E A;  1GLN A;  1EA3 A;  4ZDL A;  1U6G A;  1SEU A;  3ZP5 A;  2NVX J;  4HBL A;  3CC7 I;  2L9N A;  5EGO B;  2DU9 A;  5FLM J;  2WAQ N;  1RES A;  1LVK A;  2EIL H;  4PJN A;  5EEH A;  4BDZ A;  1VQ7 I;  3CUQ B;  2EFW A;  1YRN A;  4WWC A;  3HRU A;  5CVJ A;  4I76 A;  4IHV A;  2NNN A;  2EIN H;  2JRT A;  2HS5 A;  1FIA A;  2G7U A;  3PL8 A;  3UNG C;  2X85 A;  4AWX B;  1Z67 A;  2JPB A;  3JCU C;  3L09 A;  2A6E F;  3A03 A;  3PFY A;  4E7I A;  3RZD J;  3NAR A;  3DP7 A;  2OUM A;  3HEF A;  2G0E A;  5HVQ C;  3JRC A;  3M1E A;  2NAZ A;  2YU9 J;  4RDU A;  2ID6 A;  2M2E A;  1SC7 A;  3BR5 A;  2LY2 A;  2LH9 A;  1DGW Y;  5FD6 A;  2FNA A;  4I99 C;  1REP C;  4PFP A;  1BR4 A;  3KFW X;  3LSI A;  4HST A;  4MFD A;  5CVU A;  4C3I J;  1FOX A;  1T8I A;  1EF4 A;  4HV6 A;  1T95 A;  1ZRD A;  4A3J J;  1J75 A;  1XGO A;  1ZYR F;  1T2K A;  3HXL A;  3AG1 H;  2NYX A;  1H89 C;  2DQR A;  3OR1 C;  4A3L J;  2A05 A;  4R1H A;  5ICG A;  3PIP F;  3FKI J;  3K9T A;  4PDK A;  1T38 A;  3BR1 A;  1TQP A;  3IRR A;  4EJW A;  4CZC A;  3JRH A;  4BJT A;  5F1J A;  5DD4 A;  1FT9 A;  4FIS A;  2IS4 A;  2LC2 A;  2FF4 A;  1BI1 A;  3CMY A;  1S7A A;  2M0C A;  2BOL A;  4Q47 A;  2Z9O A;  4QSH A;  2W24 A;  4KT6 A;  2A5Y B;  3BDD A;  2DMP A;  2YU3 A;  4A3M J;  2CUE A;  2DOF A;  3FXM A;  3W6K B;  3R61 A;  1OCT C;  3EUH C;  3GLX A;  3NQO A;  4ANJ A;  1S29 A;  3HJE A;  3HUG A;  3QPS A;  2HYJ A;  3Q0W A;  2K4B A;  1IRX A;  3HHH A;  1FJL A;  2VN2 A;  2E5N A;  2ZME A;  2H6B A;  5EGO A;  2IW5 A;  4WX9 A;  2L5Q A;  1QQI A;  2PEX A;  3TDU C;  3TO7 A;  3WTX C;  2RNG A;  2IEK A;  2PMZ N;  3CUQ A;  4CUG A;  3M07 A;  1HW5 A;  4QLC U;  2VKV A;  3ABT A;  2ZXW H;  3S3O A;  4UUS A;  3BCA A;  3E5U A;  3HPH A;  1HBX G;  2HNH A;  3ZQH A;  4RB1 A;  4ZYD A;  4B44 A;  2FQ3 A;  5JVT A;  1G3Y A;  3H3U A;  3OSF A;  4L9J A;  1Z3Y A;  4LK0 F;  4P96 A;  2LDU A;  3DEE A;  2A3S A;  3UKG A;  2Q0O A;  2XKP A;  3BG9 A;  1MSE C;  4XR6 A;  3AAF A;  2Y48 A;  4M73 A;  1K7A A;  4O6J A;  1RI7 A;  1VTN C;  2BYV E;  3IAS 2;  5ED4 A;  2M9H A;  2UWM A;  2HKO A;  2NRA C;  1W7P B;  1XSD A;  1Q1H A;  1VQM I;  1LB2 A;  3PO3 J;  4M9S A;  3CCE I;  2BVM A;  2E34 A;  2M3A A;  2R7O A;  5EZH A;  3COA C;  1KON A;  2VKD A;  1XCB A;  1T0F A;  4E70 A;  4DBR A;  2DMT A;  5D5U B;  3RI4 A;  2ME0 A;  2ZSH B;  4IVN A;  4YG2 F;  3BQZ A;  2QQ8 A;  1TQM A;  5FKL A;  4DQ2 A;  1SD4 A;  3SEZ A;  1ZR2 A;  1E2X A;  1Y0N A;  1QGP A;  5HOD A;  2NVT J;  1DQU A;  4TV7 A;  2MG4 A;  1KU7 A;  2K5C A;  3QOD A;  4Y15 A;  4F92 B;  3HOW J;  3DPU A;  4XLP F;  4B47 A;  3B02 A;  4I01 A;  5H6R A;  3TO9 A;  1K83 J;  2X1C A;  3F8N A;  2PN6 A;  1X4P A;  1OYY A;  3JAM K;  3OIP A;  1NK2 P;  1SD5 A;  1R1T A;  5JHF A;  3GZN B;  2MAB A;  3CP2 A;  1F5T A;  2ZJP F;  3LSK A;  3QOP A;  5M5Y J;  2EIJ H;  3CF2 A;  5GAG J;  2YS9 A;  5K7H A;  1WJC A;  2XAU A;  5E8I A;  2IGO A;  1BIA A;  1UFM A;  4Q5S F;  4BXX J;  2W84 A;  4E7J A;  2BW3 B;  1D3Y A;  3LST A;  1XGM A;  3PUF A;  1KYW A;  5JHU A;  4IF4 A;  3F22 A;  2HEO A;  4HNU A;  2GOM A;  3HGG A;  2A6T A;  4RAY A;  5F0C A;  2DMU A;  4M3F A;  4H4K C;  2QVO A;  3BQY A;  5E1Z B;  1HLV A;  4NB5 A;  3ZQ7 A;  2NS7 A;  3PIO F;  2XRN A;  1EKE A;  2V6E A;  3FKJ A;  1X58 A;  3T1B A;  4XN0 A;  3IP4 B;  2EV6 A;  2DCE A;  2L7Z A;  3ZMS A;  2H8R A;  2DXI A;  1L0O C;  5DD8 A;  4BAY A;  1YW8 A;  5HLG A;  3ZPL A;  4HF1 A;  2JTV A;  5IT3 A;  5TRD A;  1IUF A;  3D0S A;  4S0H B;  2J5O A;  1HC8 A;  1AKH B;  1QA6 A;  4G8X A;  2P81 A;  1ETV A;  2WA0 A;  5GP9 A;  1ORK A;  4RGR A;  2A6H F;  1ZTR A;  1WI9 A;  1J7K A;  2EK5 A;  4ZH4 F;  4IRG A;  1W7P A;  3GME A;  5H6Q A;  1D1A A;  2ZC2 A; 
#chains in the Genus database with same CATH homology
 4RBO A;  4J19 A;  2JA5 J;  4G12 A;  1PUF B;  5FLV A;  1ETW A;  2VI6 A;  3C2B A;  5J1U A;  2DMQ A;  5EEA A;  1BL0 A;  1CQT A;  5J1R A;  2E19 A;  4Y7N J;  1HDD C;  4BBR J;  4XIC A;  3GTO J;  3F0C A;  2H1K A;  1XC5 A;  2XPV A;  3G1L A;  1GV5 A;  1IV6 A;  3BR6 A;  3SFI A;  4V2F A;  3BG3 A;  1B72 A;  1T33 A;  2XB0 X;  3HB9 A;  3TW6 A;  2ID3 A;  5IP7 J;  2HOT A;  5C4J J;  2HQ5 A;  4DYR A;  1WH7 A;  1ZQ3 P;  1POG A;  3K7A J;  1X2M A;  2JN6 A;  2FQ4 A;  1ZR4 A;  1IJW C;  3LSR A;  4A93 J;  1XG1 A;  3BTI A;  3TED A;  1ETQ A;  2R5Y A;  2EH3 A;  1VF9 A;  1NK3 P;  1MBJ A;  4MO7 A;  4DZP A;  3LSP A;  3BT9 A;  4DYC A;  3RKQ A;  2R92 J;  4A3F J;  3Q0V A;  2TRT A;  1OFC X;  1BA5 A;  1IGN A;  4IHX A;  4A3D J;  1UMQ A;  2JJ7 A;  2CRG A;  2GBY A;  3GTM J;  5DS9 A;  1U8B A;  1MNM C;  2LY9 A;  3CDL A;  3GTL J;  1HDP A;  2R0Q C;  2GLO A;  1WCM J;  1ETY A;  2GM4 A;  3GTJ J;  1MBH A;  2XGE A;  3B6A A;  1VI0 A;  2ZB9 A;  1OJL A;  1LE8 A;  4AC0 A;  4JX6 A;  1JKO C;  5EG0 A;  1BJZ A;  2L7M P;  5F0F A;  2JK3 A;  1B72 B;  4AYB N;  5FKN A;  2Y31 A;  5F04 A;  3GTG J;  2JMW A;  2K9Q A;  1JKQ C;  1H88 C;  2R5Y B;  2CQX A;  3PO2 J;  1K61 A;  3HOX J;  2JA8 J;  1JTX A;  1U9N A;  1FTT A;  3JRF A;  1RR7 A;  1WH5 A;  1LFB A;  1DU0 A;  2LK2 A;  2OPT A;  3HBL A;  4MIM A;  1JJ8 C;  1MBE A;  2FJ1 A;  1MSF C;  3OIO A;  2CUF A;  1WI3 A;  3HDD A;  3H3V K;  3HM5 A;  1JT0 A;  1RPW A;  5E3O A;  1H8A C;  1TC3 C;  4B3A A;  1ENH A;  1MH4 A;  2R7Z J;  3M3Y J;  3S17 J;  2MW8 A;  3IH3 A;  3NAU A;  5E3M A;  4XID A;  1LE8 B;  3MN2 A;  5M5X J;  1I6H J;  1E3O C;  2YUS A;  2KDZ A;  2R5Z A;  5IOY A;  3A02 A;  5IYB J;  5IP9 J;  2NOG A;  1GDT A;  4C3H J;  1MBK A;  2NS8 A;  1QRY A;  1W0U A;  4A3E J;  2O8K A;  3GTP J;  1FTZ A;  2WB1 N;  3TP0 A;  2E1O A;  1F43 A;  4AUX A;  4D7N A;  3JRD A;  1TWF J;  3GTK J;  1ETK A;  2D5V A;  1X2N A;  2XGC A;  1Q1V A;  1NTC A;  3LSJ A;  5C44 J;  3OSG A;  1YRN B;  4A3G J;  1WPK A;  1AHD P;  1JT6 A;  2XPU A;  1JUM A;  3S1R J;  3O8G A;  1B8I A;  2NVY J;  2DA7 A;  2FX0 A;  3HOU J;  3S2D J;  3FIW A;  5K7F A;  2Y9Y A;  5F08 A;  1GV2 A;  4GFB A;  3DEW A;  2L9R A;  5J1Y A;  2N8G A;  2EZI A;  5EDN A;  3K2A A;  1TWC J;  3TW7 A;  2KT0 A;  2ECC A;  5IOZ A;  1JKR C;  2AHQ A;  3IV5 A;  5JLW A;  2R5Z B;  1MH3 A;  3GBG A;  2DA2 A;  4A3C J;  4XK4 A;  3H0G J;  2VUM J;  2X6O A;  3WHC A;  4D5F A;  1IC8 A;  2IAI A;  1VND A;  5M3F J;  1ITY A;  4JP0 A;  1ZK8 A;  4BKX A;  5E3N A;  1AU7 A;  5IYC J;  2DMN A;  1B8I B;  2K40 A;  2LKX A;  1Y1W J;  5FKO A;  3G1O A;  2DA6 A;  2HXI A;  4CYC A;  2B63 J;  1TWG J;  2JWT A;  2LTP A;  3JRA A;  2VPR A;  4BY1 J;  5C3E J;  5M5W J;  1QPI A;  4UUT A;  3DCF A;  2QF7 A;  5K7Z A;  2ME6 A;  2EZH A;  2DJN A;  1JJ6 C;  2LLK A;  1I50 J;  2R93 J;  1IDZ A;  3S1N J;  3LOC A;  4A3B J;  2MSY A;  3S15 J;  4BY7 J;  1BW5 A;  5BNG A;  1JUS A;  3M4O J;  4B1R A;  2E2J J;  2NVX J;  4IHW A;  5EGO B;  2LR8 A;  3VPR A;  2COB A;  5FLM J;  1QVT A;  2WAQ N;  1RES A;  1YRN A;  5M3M J;  2X9D A;  3JRE A;  2RAE A;  4I76 A;  4XRM A;  2E2H J;  4CYC B;  4IHV A;  4Y52 J;  3HGY A;  4M6V A;  2XRL A;  3JRG A;  1MBF A;  1GT0 C;  2O9L A;  4C2M J;  2Y2Z A;  2XSD C;  1FIA A;  3JR9 A;  2AO9 A;  1UG2 A;  4I6Z A;  4DW6 A;  2CJJ A;  5IPA A;  4JYK A;  3RZD J;  3A03 A;  1LFU P;  3NAR A;  3HEF A;  1ETX A;  2G0E A;  4IEJ A;  3JRC A;  1U9O A;  3PM1 A;  2YU9 J;  4RDU A;  2ID6 A;  1APL C;  2M2E A;  2Y0S N;  3L1P A;  3BR5 A;  2K9N A;  1P7J A;  3MKL A;  2XPW A;  2XB5 A;  1RKT A;  1MBG A;  4MFD A;  5C4X J;  4C3I J;  3G1M A;  1EF4 A;  2HOS A;  2EBI A;  2WV1 A;  5GPC A;  4A3J J;  1D5Y A;  1JGG A;  3RQI A;  4EEF G;  4JX5 A;  4QTR A;  1H89 C;  1Y1V J;  4A3L J;  1IRZ A;  1WGX A;  4DYQ A;  2HXO A;  2CQQ A;  3S14 J;  1ETO A;  4FE7 A;  2M34 A;  3FKI J;  3BR1 A;  3JRH A;  2ELK A;  4NDL A;  5F1J A;  4FCY A;  1P7I A;  3HOV J;  3IH2 A;  5GPA A;  4FIS A;  4JX4 A;  3CMY A;  2M0C A;  1QVU A;  2OF7 A;  5DTD A;  4QSH A;  1HF0 A;  1I3Q J;  3ZQG A;  2TCT A;  2DMP A;  4A3M J;  2CUE A;  2LP0 A;  3D1N I;  4D7M A;  1OCT C;  2W48 A;  2O7O A;  3HKZ N;  3MVP A;  3WHB A;  1TWA J;  3BG5 A;  3S1Q J;  4BBS J;  1IDY A;  3QPS A;  1A5J A;  2E2I J;  2HYJ A;  3Q0W A;  4XRS G;  2DA1 A;  3FK6 A;  3FIS A;  1FJL A;  1U78 A;  4A3I J;  2IBD A;  4HNV A;  3I4N J;  1VFC A;  1SAN A;  5EGO A;  4X6A J;  1UHS A;  3BR0 A;  2DN0 A;  3Q0U A;  2EZK A;  5F0H A;  3OOU A;  4B4C A;  4C3J J;  1IG7 A;  3I4M J;  2IEK A;  2PMZ N;  1JUP A;  3S16 J;  1SFO J;  1T56 A;  2VKV A;  3S2H J;  2L7F P;  4UUS A;  1XS9 A;  2MGQ A;  4FE4 A;  1W0T A;  3ZQH A;  1O4X A;  3RZO J;  4A69 C;  3OSF A;  5F27 A;  3BTL A;  3SJM A;  3ZQI A;  3UKG A;  2XGD A;  3BG9 A;  1MSE C;  3LNQ A;  3A01 B;  2L0K A;  1JKP C;  2HI3 A;  4W1U A;  3FK7 A;  2LFB A;  2M9H A;  2VKE A;  2HDD A;  2DA3 A;  4L5E A;  3PO3 J;  1R9T J;  3ZQC A;  4DZJ A;  5EZH A;  2DA4 A;  1FIP A;  2K9S A;  4LOC A;  4D5C A;  1BW6 A;  3HOZ J;  2DMT A;  2ME0 A;  1GVD A;  4IHY A;  2M8G X;  5IP6 A;  1OCP A;  3BQZ A;  2NVQ J;  5IYD J;  5FKL A;  1ZR2 A;  1HCR A;  4V2G A;  2DA5 A;  5HOD A;  2NVT J;  5FJ8 J;  4UUS B;  1RKW A;  2MG4 A;  5E3L A;  1GUU A;  4M3B A;  2JA7 J;  5JLX A;  3HOW J;  3LSG A;  3CCY A;  5FKM A;  1Z77 A;  3SDG A;  1K83 J;  2Y9Z A;  4ABZ A;  1DU6 A;  3IH4 A;  2LD5 A;  1NK2 P;  3E7L A;  4W97 A;  1JTY A;  2DTZ A;  2EQR A;  3W6V A;  1AKH A;  2CU7 A;  4FTH A;  4A3K J;  5M5Y J;  2HOA A;  3JRB A;  2QCO A;  2YS9 A;  5K7H A;  3ZQF A;  3QQA A;  1F36 A;  3BTJ A;  4M3G A;  2JA6 J;  4MLO A;  4BXX J;  2Y30 A;  3O8H A;  5EF6 A;  1PUF A;  5EZG A;  3BTC A;  5EYR A;  3BR3 A;  5EG0 B;  3BR2 A;  1G2H A;  3QPL A;  4MFE A;  1ZGW A;  3HGG A;  1HOM A;  3TP3 A;  5F0C A;  2DMU A;  4M3F A;  1HLV A;  3BQY A;  1RET A;  2FD5 A;  4M3D A;  3S1M J;  1TWH J;  1ZKG A;  2NS7 A;  1A6I A;  1S7E A;  2LVS A;  1X58 A;  5FKK A;  1Z0X A;  2X48 A;  4M3E A;  3ZOB A;  3HOY J;  2L7Z A;  2H8R A;  2EZL A;  5J3L A;  9ANT A;  1IUF A;  4S0H B;  1AKH B;  2P81 A;  1ETV A;  5GP9 A;  3A01 A;  4X1E A;  1ORK A;  3B6C A;  4QIW N;  1FEX A;  1ZTR A;  3CQZ J;  3JRI A;  3GTQ J;  4XRS A;  3ZQL A;  2ECB A;  2I10 A;  3Q3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...