4HQEA

The crystal structure of qsrr-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
MMEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords Transcriptional regulator QsrR
total genus 38
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hqeA00
2DK8A 5LHHA 3GWZA 1O57A 2UXXA 5ICGA 5LGUA 2W57A 2HYGD 1S7AA 2MH2A 4HOBA 4G7OF 5K5OA 2FNAA 3ROUA 2HKXA 3HHHA 2DT5A 4GO1A 4HX8A 4KYWA 2X4HA 3ABTA 2VBZA 2JPCA 1R1UA 4UVAA 3TOBA 1B4AA 3MFKA 4L9TA 4AIHA 5L3EA 2PI0A 2QQAA 4LFUA 5BQTA 1W7PD 3NRVA 3CTAA 2FMYA 2IA1A 3HSFA 3CUQC 5K5QA 4O6JA 5E1ZB 1IN6A 2EFPA 4YFNF 1OPCA 1F5TA 5EEGA 2DPUA 1T6SA 4U7DA 2BYVE 5H20A 3DP7A 4GGGA 1B59A 4RB3C 3GZ5A 2GIVA 4RGUA 4EM0B 4MTDA 3T5XA 1KA8A 4AIJA 3I53A 1PDNC 5FGMA 5J8FA 3G73A 3DKWA 3K1MA 5F6FA 1Z91A 3V8JA 3WTVC 1JGSA 5D5WB 2NNNA 2YSRA 2HTJA 4UUVA 3F8MA 1W5TA 4IXAA 2FBKA 2CFXA 2GA2A 2H6CA 2KJBA 4CGZA 1G3TA 2QQBA 3F23A 4RS8A 2PQ8A 2LSOA 4JK1X 3O3KA 1R5HA 4XLNF 5E8IA 4QWQA 4WX9A 5FFZA 3J81K 4KFCA 5CJ9A 4Y15A 2Z5UA 1SAXA 5H6QA 1K79A 1HXDA 3IKTA 2QUFA 2IT0A 5D5VB 5HDNA 1FPQA 2ZMEA 1F9NA 1P4AA 4HX4A 5BOXA 2WTEA 1WRJA 3HIFA 2KJCA 3F22A 3P9IA 2Y0MA 2GWRA 1YQAA 4IRGA 1BI0A 5D6FA 4WK8F 2P7VB 4A2UA 1YS6A 2GZWA 1R1VA 1YLFA 3BPVA 2EK5A 5L3CA 3F8NA 4KIGA 3AAFA 2FXAA 2EFWA 1IRFA 4XRFA 2R7DA 3WE3A 2F5EA 3DPLC 3FXUA 3CUOA 3HHGA 3MZYA 1XD7A 2BGCA 2FEZA 1I5ZA 2KIFA 4RB1A 1FNNA 1ZLKA 2W84A 5IT9K 3L2CA 1SD4A 3NQOA 5D5XB 1ZRDA 4GXOA 2O8XA 3QAHA 1WSUA 4P5OA 4QLCU 2ZFWA 3FMSA 2Z9OA 4HBLA 1STZA 3FX3A 3J81Z 2L54A 3DFGA 4N9IA 1YW8A 2XHKA 3I59B 4HW0A 3KE2A 3ZN0A 2PEXA 1HKQA 2OD5A 3HYIA 2HQNA 3ML6A 2P6SA 2RGVA 2XIGA 3EQLF 1SFXA 2QBYA 5ERIA 4UVCA 2HWVA 2XUBA 5L3FA 1IN7A 5A2QK 1RZ4A 1FBQA 3KP6A 4TV7A 4A12A 4IHSA 2P6TA 1EH7A 2ZBKA 2FA5A 2FE3A 2FF4A 4ETSA 2DI3A 5LBQA 1R58A 1LEBA 2BV6A 5HDGA 4KUMA 5F64A 4EJUA 3T0YA 3GYHX 2V1DA 3M9AA 4F7ZA 3PQKA 4KICA 1FYKA 1QBJA 1HW2A 1XDSA 1ZLJA 2EFQA 2OU2A 1S8NA 1Y0UA 3FM3A 1MJAA 2H94A 2DFIA 1MZBA 3KZYA 2HQRA 4LGWA 4U0VA 3RI4A 1H9TA 1DPUA 5D8KB 1IAWA 5LLQA 4OINF 4NHJA 3O2PE 2OQRA 2VXZA 2EA4A 5AIQA 4LD5A 1LDKB 2BEOA 4HA8A 3PQJA 1TQMA 3LA2A 5DD4A 2O0YA 2PFBA 3GUDA 1S7OA 4UHTA 1SD5A 3HRMA 3BJAA 2A3SA 1LDJA 5AONA 2PMUA 1AWCA 5BPIA 3RYPA 5D4SA 5HLGA 1TLHB 3DEUA 3BPXA 4N9HA 2GXGA 2QQ9A 2K27A 2DW4A 1KU9A 1BJAA 2DQRA 2XAJA 1MJBA 5DYMA 1IZ1A 4YFKF 1RUNA 4M72A 5BS6A 4ENJA 2JT1A 1CGPA 2P8TA 2QLZA 1XSVA 5E8GA 3T8TA 4MNUA 5CLSA 2L4AA 2VBYA 3OV8A 2EFOA 3ZMTA 4P9FA 3R4KA 3WTSC 3KP5A 4BAYA 2DK5A 5BMZA 2W25A 1JXSA 2RDPA 5D8LB 2DLLA 1I27A 4ENNA 3QRFF 1I6XA 3RPUA 2KKOA 4WCGA 5E1WA 2HGCA 4LLNA 2ZNZA 3D0SA 1K78A 1FSEA 2JSCA 2W85A 2EV0A 5ICCA 2STWA 4OMYA 5JR3A 4CO8A 2E1NA 1MD0A 4A0XA 4HDVA 2F5DA 4AVPA 3KP2A 2A69F 1P2FA 1VTNC 1B9MA 3GZ6A 1LVAA 2MLKA 5FLXK 1LNWA 2Q8KA 2V6CA 4JQFA 3RPQA 3ISPA 1MDMB 2GAUA 3SHFA 4MGRA 2LF8A 2RNJA 2RV8A 4AWXB 2DTRA 3ECHA 1XN7A 4XBFA 5E1XA 1MKMA 1WKMA 1Z7UA 4H0EA 3KEQA 3E5QA 2NAZA 3R6SA 2O6GE 3K0LA 2EV5A 1XMKA 5FB2A 2VOOA 2QBYB 2DQLA 3E6DA 1DDNA 1Z9CA 4I02A 1G4DA 4YFXF 1EH8A 1G3YA 3IC7A 2OA4A 1GVJA 1XCVA 2VC0A 3GEZA 4YIFA 3Q9SA 4IRIA 3J7AO 5FLXZ 3J80Z 1FP2A 2IJLA 1ODDA 4XSXF 4M6XA 4LG0B 5D5UB 1Q1HA 3FHZA 1OR7A 2IW5A 1ZGJA 1J5YA 5ED4A 5DD8A 1R22A 1JHFA 1QZZA 3MWMA 2MH9A 4YG2F 1HW1A 1TW3A 2XKOA 4DNCA 4EMSA 4PGHA 3FMQA 1BOAA 1OKRA 2G9WA 3DQVC 4YIIA 4L5IA 2HDCA 3C18A 2MLGA 2ESNA 4O3MA 3SXYA 2PMHA 2NYXA 4I98B 3M7GA 1QO0D 1QZYA 5CVIA 5DCFA 2PLYA 3KLNA 1J75A 2IPQX 2YX7A 1ZG5A 3DPTA 2QWWA 3I64A 1UHMA 4RGSA 5ICFA 3GFIA 3R0AA 1USSA 2YU3A 4G6DA 4G7ZF 1W4MA 2F2EA 2HOEA 2HKOA 3K9TA 2BBYA 1P92A 3P9CA 1MDMA 2RVCA 5JVTA 2Z3YA 4BXUA 1R36A 1GXPA 2O3FA 4LLLA 2OAZA 4HF0A 5EEHA 1KYWA 3P9KA 3WTZA 2EA2A 1XGSA 2HEOA 3F8BA 3VB2A 2F5FA 3LQRA 3RKWA 2OZ6A 4ESJA 2LF7A 3QPTA 2ZXJA 5CVRA 3R60A 1Z6RA 1FYLA 1XDUA 1ZHFA 4IHTA 1ZG3A 1D8JA 2HTSA 3F8CA 4XLPF 5HS9A 3TO6A 3RYRA 5E17F 4HV6A 1K6OA 5K5RA 3FXRA 1S6LA 3B73A 2NNYA 4ZYDA 3ZN1A 1XCBA 1YS7A 1DUXC 4LG0A 1YW7A 2LKPA 1U5TB 5DUIA 4I7HA 2O61A 1Z05A 2H6BA 1KU2A 3MAJA 2P5VA 1F4KA 1R7JA 3C7JA 5E18F 2VBXA 3I0TA 3I59A 4CICA 4WXCA 2V1XA 2H09A 3F3XA 3OOPA 4KN4X 1T98A 4U0YA 3CO6C 5AIPA 2FQ3A 3JAMZ 2XKPA 4A5NA 2XAFA 1MJ9A 4ENKA 4OIQF 3BROA 4DQ2A 2GXBA 3FF5A 5DCMA 1QQIA 2VODA 4ENMA 5KK1A 5L3BA 2Q2EA 3KFWX 1IXRC 2HFHA 1Z1DA 3I4PA 3IL2A 3TDZC 2QVOA 1R1TA 3WTXC 1WWXA 5D4RA 2IVMA 4S05A 3RKXA 3WGHA 2J5OA 4A0ZA 2STTA 1MGTA 1S29A 3CUQA 2FBIA 2R7FA 2Y48A 2GA1A 3ZP5A 3F21A 3N97A 3FXQA 3KZZA 3E6BA 2K4BA 4HX7A 4Y13A 4Q4ZF 3GVAA 4L9VA 2A07F 1OMIA 1E17A 3V7RA 3TKYA 1FC3A 3L09A 4MQVA 2Y75A 3ABUA 3L00A 2CGPA 4KMFA 4I09A 2PJPA 3V8LA 3EYYA 4UV8A 4RGRA 4Q5SF 3SZTA 1QPMA 4R1HA 2WV0A 4KIBA 2UXNA 2IRFG 1FSHA 3FM5A 1GHCA 4MQ9F 1U5TA 1IRGA 2HS5A 3C3WA 4FT8A 2D45A 4AD9A 1F1ZA 5ICEA 4HV5A 2B0LA 3BWGA 3H92A 3GFJA 3PFIA 1UCRA 2X0LA 5K1YA 4WF2A 3ZPLA 2EB7A 3QP5A 2V79A 3CJNA 3M8EA 3ULQB 1BC8C 4M71A 2ISYA 4IVNA 2EFNA 3HTSB 2QENA 4L0YB 2YX4A 1IXCA 2PN6A 2M5WA 4JBAA 5LHGA 1O3TA 4G7HF 5ILSA 3G3ZA 1XGOA 1I1GA 4UV9A 4L5JA 4O5VA 2E7WA 6PAXA 3LAJA 4LK0F 3D5LA 4KT5C 4I0BA 2KIUA 2P4WA 2KIMA 2XGXA 3RDIA 5KVRA 1HQCA 5HLHA 2FOKA 2XASA 2K4JA 2QZ8A 5L3DA 1XMAA 1ZYRF 2D1VA 2CWEA 2M45A 3J80K 4EJTA 1OYIA 2P5LC 2A5YB 3BZ6A 3VOEA 4BNCA 2CQKA 3RTRA 1P4WA 4PDKA 5JFRA 4KNYA 2LNBA 4L18B 1ULYA 3V4GA 1U6GA 5LEJA 5TRDA 2AXLA 3K69A 2G7HA 5LRSA 1U2WA 3I58A 4LB5A 1E2XA 1T2KA 4GCVA 3TQNA 4ZYGA 4EM1A 3E6MA 1D8KA 2W24A 3T1BA 1ZN2A 3CLOA 3HRSA 1TTYA 3WGGA 1SD7A 2XAQA 2L3DA 3BDDA 4RAYA 1OYYA 2A6EF 1RIOH 5DDGA 4A0YA 1FOKA 1B1BA 3HSEA 2RN7A 1CF7B 4LB6B 3ZQ7A 3CUQB 3MEXA 1R23A 1O7LA 2EV6A 2VOPA 1UHWA 3K1PA 2K7LA 3U2RA 4AIKA 5HS8A 3FZVA 4MHGA 1BC7C 1XGNA 3I54A 3WE2A 3JTGA 3K2ZA 4BHPA 4R8HA 3WU1B 5F1RA 1HSTA 2A68F 5HVQC 4EJOA 3F72A 1FT9A 5FFXA 3H3ZA 1XGMA 5A2QZ 1IUYA 3HSRA 1J0RA 4ZZDA 4M6YA 2Z33A 3W6JB 4EV0A 2PG4A 2WWYA 5D6EA 4BYYA 3IWFA 3LA3A 2ZMEB 2DU9A 3VODA 3QOPA 5L3GA 2IA0A 2VN2A 3ZMUA 3IRRA 2XAGA 5J6XA 3JSOA 3L7WA 1IN5A 2E1CA 2HR3A 1BI2A 2BE5F 2F5CA 1BIBA 1HBXG 3WTUC 4CZZA 5CVUA 3SZPA 1BI3A 2ADUA 2TDXA 1KGSA 2QYOA 5JHUA 4EGZA 1TQPA 3GX4X 1J59A 3R61A 1HKSA 4G94A 4HZFA 2ETHA 3QU3A 4G6QA 4UXNA 1W7PB 3KP3A 3E3VA 3RIRA 1T38A 5HOOA 3T8RA 3GO5A 2ELHA 4KDPA 3C1DA 2OZUA 4HAMA 5BPDA 1FY7A 3QU6A 1REPC 4HDUA 2C6YA 3TDUC 1LJ9A 1RUOA 1SFUA 1LB2A 4XSZF 2K86A 4ZH4F 3VFZA 1KYZA 4FHTA 4CXFA 1ZRCA 3M8FA 3EUHA 1WI9A 1ZAOA 4G8XA 1PP7U 4EJWA 3LFKA 1HW5A 4M73A 3DXJF 1L0OC 2FBHA 4S04A 1YG2A 4KIFA 4UVBA 4IPAA 2M1BA 5DEQA 2PBIA 3ELKA 3B02A 1A04A 3F8FA 3H3UA 1G3SA 3BOQA 4IJAA 1IN4A 1SMTA 4KN7X 1ZARA 2RQPA 1UFMA 1AOYA 2V1UA 2XVCA 4LMYA 2HYFA 1LDDA 1PP8F 3GFLA 1TNSA 3U9GA 5H6RA 1P6RA 2JZYA 1L3LA 3IKVA 1KQ8A 3HTUA 3DV8A 2FRHA 5ILVA 4U7BA 3DF8A 4HLYA 2R3SA 1ZGAA 3KP7A 2A61A 2K02A 1BM9A 1U5TC 4ESBA 1K78B 4EGYA 1H0MA 2P7CB 2ZO4A 3N4MA 1QGPA 1HKTA 1RI7A 1GXQA 1XSDA 1P4XA 4OMZA 3SQNA 1W7PA 1KU7A 2JTVA 4Y17A 5E20A 1TQIA 1R00A 1ONVA 1U3EM 5LGTA 1XSXA 3BP8A 3EETA 3V8KA 4B8XA 2EWNA 1JE8A 3I71A 1FZPB 1TBXA 1ZH5A 4M9SA 1IXSB 1G6NA 4A6EA 3GW2A 4Q48A 5HDKA 4U0WA 2NRAC 2D1HA 4L9JA 3TO9A 2QM3A 4BHCA 3KCCA 4B09A 3E6CC 3LAPA 2FU4A 4RB2C 1FYMA 1YIOA 2VONA 5CVVA 1D3YA 4R79A 1FX7A 3VEPA 2UWMA 5HS7A 2DAOA 3WU0A 5FD5A 1B9NA 4ON0A 2G7UA 2J5PA 2FMLA 2ZJ2A 3R0JA 2JRTA 4EJVA 1B6AA 3LQQA 2OQGA 4G9YA 2VC1A 2Z99A 2Q0OA 2XROA 1FLIA 2XAHA 3GLXA 2IA2A 3JAMK 4GYIA 2JPBA 4HQEA 4PZJA 2IP2A 1QNTA 2FNPA 4WXHA 1DP7P 5LRRA 1KU3A 1NHAA 4KMUX 3U1DA 4EM2A 4M9XA 4OU0A 4BH9A 4ZZLA 3QP6A 3RJPA 1FWZA 4NQWA 3K1NA 2FSWA 4A6DA 3MZHA 4GYGA 2A6HF 4OIPF 2YPRA 3HRTA 2DPDA 3LSTA 4EQQA 1BIAA 1FBUA 2RC4A 1H9GA 1ZG1A 4LLGF 3Q9VA 4CDGA 1J7KA 4RAZA 2VT2A 3IRQA 5FD6A 1WQ2A 3REOA 1V3FA 3GFMA 4FX4A 1I1SA 4HQMA 2E7XA 2LDUA 4P9UA 3COAC 1C0WA 2ZKZA 1V4RA 3ERED 4HF2A 3ECOA 3HOTA 1SMYF 4NB5A 4KA4A 4PCQA 2M87A 2GQQA 4A5MA 3WTTC 5LHIA 2XRNA 5DUKA 2ZNYA 5ILUA 1PUEE 5CYVA 3HRUA 1SFEA 1CF7A 3NEUA 4M9ZA 2H27A 1RNLA 1BBYA 2HZTA 2L02A 1ZREA 3SFZA 3M1EA 2KRFA 3ZMZA 4U88A 4P55A 4Q47A 4E70A 2UZKA 1J2XA 3HOSA 1W5SA 3GF2A 4L9NA 4BQAA 2AS5F 2RKHA 3WTWC 4RGXA 2VT3A 3JW4A 2VBWA 3LWFA 4MTEA 3W6KB 3V7SA 3F6OA 5JI6A 1YYVA 4ESFA 2CG4A 4P96A 2CSOA 2YR2A 4Z2YA 5IT9Z 5J8CA 3WTYC 1YFHA 3FWEA 4CYDA 4UNOA 3RKYA 1R5GA 3TOAA 3F6VA 1BN5A 3MQ0A 2COMA 1KQ9A 1TNTA 1T39A 4OIRF 5LEKA 4M74A 4D0PA 3HUGA 1FBSA 3TO7A 2EJRA 3FMRA 5DCMB 1YW9A 4HF1A 1O3RA 5HLIA 2CYYA 1UB9A 1LEAA 4WWCA 2MD5A 2DO7A 1K7AA 2MC3A 4EVIA 3BJ6A 2OBPA 3BJOA 3S2WA 1BI1A 3BY6A 2L01A 1YTYA 1USTA 2ISZA 4L0ZB 1ZRFA 2VE8A 3E5UA 5LGNA 2V9VA 4LJZF 5CVJA 1OYWA 3CO7C 4LK1F 3E5XA 1DPRA 1YO5C 2M8EA 3I5UA 2DBBA 3WODF 2CW0F 4I01A 3TGNA 1KQ0A 1JHHA 3IHUA 3KP4A 3E97A 3EDPA 2ZCWA 2XV4S 3V7CA 2ACJA 1EV7A 2NS0A 1X3UA 4ZYEA 4N0BA 4I2OA 2P5KA 2VE9A 1Z6TA 2M30A 1IF1A 3ZMDA 4ZYHA 1ON1A 5DV5A 4FX0A 1U8RA 1G3WA 4ASNA 1O3QA 3QPHA 5TJJA 4K2EA 3JSPA 1TW2A 3WGIA 4BHBA 1FP1D 5FO5A 4HYEA 1J9IA 3ZMSA 1T0FA 4CHUA 3WG9A 4WXDA 1U78A 3EYIA 3KLOA 1LQ1A 1D5VA 3L9FA 3IWZA 1O7FA 3GXOA 3JTHA 1SD6A 1IW7F 3ZMVA 2O03A 1HSJA 1EH6A 3P7NA 1XB4A 3Q5FA 4MEYF 1IN8A 3LA7A 2MA3A 1O3SA 3KEOA 5IT3A 3O6BB 2L4MA 3MCZA 4IF4A 2MBFA 3KETA 4OIOF 2WC2A 4PGGA 2D2WA 4IRHA 3CDHA 1ON2A 1S3JA 4MEXF 2CO5A 2ESHA 4I0AA 4RB0A 4OOIA 4HLXA
chains in the Genus database with same CATH superfamily
2DK8A 4UB8C 2AQFA 5LHHA 3GWZA 3BTLA 3QOEA 1O57A 1PYVA 2UXXA 5ICGA 5LGUA 2W57A 2HYGD 1S7AA 2MH2A 4BQQA 2KT0A 3PO2J 1VNDA 4HOBA 4MIMA 4G7OF 5K5OA 2FNAA 5F1JA 1A6QA 1MMNA 3ROUA 2WAQN 2DJNA 2HKXA 2VUMJ 5GPCA 3HHHA 4E7HA 1WJFA 2DT5A 4GO1A 4PFPA 4HX8A 1ZQ3P 3OY9A 4KYWA 2X4HA 3IAM2 2HDDA 2HVSA 3ABTA 2VBZA 3A01B 2JPCA 3GTJJ 1R1UA 1YJ9I 4UVAA 3ESWB 3AFHA 3FHNA 3TOBA 1FOWA 1B4AA 3MFKA 4L9TA 3L2QA 2GBYA 4AIHA 5L3EA 2PI0A 2QQAA 5IOYA 2AXTC 1BOBA 1OCCH 4LFUA 5BQTA 2QQ8A 1W7PD 3NRVA 3OYFA 1MBKA 2M3AA 4RLFA 4E7KA 3CTAA 1Y1VJ 2FMYA 2IA1A 2R7RA 1VQ5I 3HSFA 3CUQC 5K5QA 4O6JA 5E1ZB 5F08A 1IN6A 1MH4A 2A6TA 2DMTA 2Q1ZB 4XR6A 2ZC2A 2EFPA 4YFNF 1OPCA 1F5TA 3ZRGA 5EEGA 2DPUA 1T6SA 4U7DA 4HSTA 2BYVE 4HNTA 2Y0SN 5H20A 5IYCJ 3HOWJ 2K5CA 2V9KA 3DWLE 3VYTB 3DP7A 4GGGA 1B59A 3Q3SA 2E35A 4RB3C 2M8GX 3GZ5A 5M5XJ 5IY5H 2GIVA 2DYRH 1N25A 3FDYA 4RGUA 4EM0B 2GLOA 4MTDA 3T5XA 3UNGC 1KA8A 2DFHA 2K9NA 3CP2A 3OYAA 4AIJA 3I53A 3QODA 4XONA 3Q0VA 1PDNC 3CZ6A 5FGMA 4MFDA 4LG3A 5J8FA 2DCEA 3G73A 3ABLH 2WAFA 2VKVA 4YIRX 3DKWA 3K1MA 3TEDA 4LIUA 5F6FA 1Z91A 3V8JA 3B6AA 3WTVC 4YRVA 1JGSA 5D5WB 3S93A 3MZ8A 2DFFA 2NNNA 1U0JA 3IH3A 2YSRA 2MD0A 4MFEA 2HTJA 1IG7A 4UUVA 3DBHB 4ZTFA 3X2QH 3F8MA 3HUGB 3HOZJ 2EZIA 1W5TA 4IXAA 4RBOA 2FBKA 4BEHA 1IUFA 2CFXA 2GA2A 2H6CA 4FETA 2KJBA 4CGZA 1G3TA 4M3FA 1T33A 3ZOBA 2QQBA 2ZXWH 2E34A 1Y8RB 4G6TB 5B1AH 4X0GA 3F23A 3S16J 4RS8A 2PQ8A 1UELB 3J7YJ 2LSOA 4JK1X 3O3KA 1R5HA 4XLNF 5E8IA 2A05A 4QWQA 4AVZA 2F48A 4A3IJ 2CUZA 4WX9A 5FFZA 3E1SA 4XICA 2ELKA 1MW7A 5FROA 4CCKA 2DOEA 2MSYA 3J81K 2K9LA 2VPLA 1WJ5A 3WU2C 4KFCA 3OIPA 4KT6A 3GZNB 5CJ9A 1KZHA 4Y15A 4QPQA 2Z5UA 1SAXA 5H6QA 1K79A 1W36C 1HXDA 3BR3A 3IKTA 2QUFA 3CCJI 3JRIA 1EF4A 2IT0A 3A01A 5D5VB 5HDNA 1FPQA 2ZMEA 1F9NA 1P4AA 1G59A 4HX4A 1ACIA 5BOXA 1JI8A 2JK3A 4CH7A 2WTEA 3S2HJ 1WRJA 3HIFA 4C3JJ 1VF9A 2KJCA 3F22A 3P9IA 2KMUA 2Y0MA 2GWRA 1YQAA 4IRGA 3LL7A 1BI0A 5D6FA 2HNHA 4IKFA 3RZOJ 4WK8F 2P7VB 4A2UA 1YS6A 5KNLA 3TMOA 2GZWA 1W5CC 3PO3J 1R1VA 2XC7A 1YLFA 3FXMA 3BPVA 4FQGA 2KZVA 2H8WA 2EK5A 4FTHA 5L3CA 1OR7C 1K6YA 2DODA 3F8NA 4KIGA 4RLQA 1ZTRA 1AHDP 3AAFA 5JLWA 2FXAA 4BJ6C 3BG6A 2M0MA 5EZHA 5FKMA 3JRHA 1IRFA 4XRFA 2EFWA 2R7DA 2YS9A 3FXKA 3WE3A 3HGYA 3LSKA 2F5EA 2E5NA 3DPLC 3FXUA 1BJZA 3CUOA 1TWGJ 4PJJA 3HHGA 3MZYA 1DQUA 1XD7A 2BGCA 2FEZA 1QRYA 3DBLB 1I5ZA 1X4PA 2K85A 2KIFA 4RB1A 2VJ5A 3QYBA 3O8GA 3OIOA 1FNNA 2W82A 1ZLKA 2W84A 5IPAA 5IT9K 3L2CA 1SD4A 3NQOA 1ORKA 2VL8A 1N75A 3BG3A 5D5XB 1ZRDA 2JA6J 2QCOA 4GXOA 3H3VK 1I39A 2O8XA 3ABKH 3QAHA 3BR2A 1WSUA 4A3CJ 4P5OA 3KPHA 5JVGF 4QLCU 2ZFWA 3FMSA 1Y39A 2EIKH 2Z9OA 2QSHX 4HBLA 1STZA 3JRGA 3CCSI 3FX3A 3J81Z 3BT9A 2XF6A 1XG1A 3BCBA 2L54A 3DFGA 4N9IA 4XK4A 1YJNI 3CC7I 1YW8A 2XHKA 2TCTA 3DKYA 3I59B 4HW0A 3KE2A 3ZN0A 2OTJI 2PEXA 1HKQA 1TC3C 1WH7A 1OCOH 2OD5A 3HYIA 1VQPI 2IS2A 3U1KA 1DP3A 2HQNA 3ML6A 3OOUA 2P6SA 2RGVA 2XIGA 3EQLF 4XKVA 1SFXA 2QBYA 2CFOA 5ERIA 1SC7A 3AG2H 1ZGWA 2WADA 4UVCA 1IO2A 3H9QA 3HG9A 1S72I 3LSGA 2CRGA 1X1BA 2FQ4A 1ETVA 2HWVA 2XUBA 5L3FA 4DYRA 1IN7A 5A2QK 1W1WE 1RZ4A 1I50J 1FBQA 3KP6A 3HBLA 4TV7A 4ZYAA 4A12A 1ZR2A 2EBIA 1PUFA 4IHSA 2P6TA 1EH7A 2ZBKA 2FA5A 2FE3A 2FF4A 2KPMA 5JLXA 4ETSA 2DI3A 1MH3A 5LBQA 5H2FC 2R92J 1R58A 1LEBA 2LR8A 3CMAI 2BV6A 3DTIA 5HDGA 4KUMA 5F64A 2M7BA 3T0YA 4EJUA 3GYHX 2V1DA 3M9AA 4F7ZA 3PQKA 4KICA 2ZFUA 3L2VA 1E3PA 1FYKA 4ZJZA 1QBJA 2XAUA 1HW2A 1XDSA 1ZLJA 2EFQA 2OU2A 1S8NA 5B5EC 2PJRB 1Y0UA 1VQ4I 3FM3A 1MJAA 2H94A 2DFIA 3U21A 1JTXA 3CCRI 1MZBA 3KZYA 5EYRA 2HQRA 1ETOA 4LGWA 5FRNA 1DU0A 5B66C 2YU9J 2OF7A 1D0YA 4U0VA 3RI4A 1H9TA 1DPUA 4XLEA 3DPUA 3G1LA 4CYCB 5D8KB 1IAWA 3F0CA 3H5RA 5LLQA 4OINF 2M0CA 5EGOB 4NHJA 3O2PE 2R7SA 2OQRA 2VXZA 4AIDA 2EA4A 3DTKA 5AIQA 4IX7A 4LD5A 1LDKB 2BEOA 3IP4B 3PM1A 4HA8A 2CW7A 3CDLA 3PQJA 2LRDA 2LFBA 3PSIA 1TQMA 2FOWA 2LLKA 3G71I 3CCEI 3LA2A 2Y9ZA 3A02A 3H5AA 5DD4A 2O0YA 1JGGA 3GUDA 2PFBA 2NS7A 1RKTA 4NC7A 4A3LJ 1S7OA 3MKZA 1FTTA 4UHTA 3NWTA 1SD5A 3HRMA 3BJAA 5J3LA 2A3SA 1LDJA 2ECBA 3HPHA 2R7OA 5AONA 2PMUA 1VI0A 2L7ZA 2PMZA 1AWCA 5BPIA 3A0HC 3RYPA 2XF7A 5D4SA 5HLGA 3GTOJ 1T0FC 1TLHB 2K3PA 3BTJA 3BPXA 3DEUA 2JA2A 2KLOA 4N9HA 5IOZA 1OCPA 4Z6YA 3G2BA 2GXGA 2QQ9A 2K27A 2DW4A 1KU9A 5FJ8J 1Z21A 1BJAA 2CV0A 3OYNA 1VQ9I 2DQRA 2XAJA 3RSNA 1MJBA 3NWSA 5DYMA 2Y69H 1IZ1A 1JJ8C 4YFKF 1RUNA 4M72A 5BS6A 5J1RA 3JRFA 2JT1A 4ENJA 1CGPA 1PVEA 2P8TA 2QLZA 1XSVA 2L9SA 5K7HA 3CC4I 2CQ7A 5E8GA 3T8TA 4MNUA 5CLSA 2L4AA 2HXIA 2BW3A 2VBYA 3OV8A 2EFOA 3LMMA 4F91B 3ZMTA 4P9FA 3OS0A 2QSGX 3R4KA 3WTSC 3KP5A 4BAYA 2DK5A 3ZQCA 5BMZA 2W25A 3OSGA 1R4NB 4B44A 1JXSA 2JVGA 2RDPA 2XGDA 5D8LB 3Q0UA 5KHDA 2X1EA 3FXLA 5C44J 1LPQA 2DLLA 1I27A 4ENNA 3QRFF 1YRNA 1I6XA 3GTMJ 4BJ5C 1X2MA 4Y4RA 3RPUA 1JKRC 2KRHA 2KKOA 1QU3A 4WCGA 2COBA 3CLQA 5E1WA 2HGCA 4LLNA 2XGCA 2LC2A 4FCYA 3ZXSA 2ZNZA 3D0SA 3DKXA 1K78A 1FSEA 2VXDA 2JSCA 2W85A 2EV0A 5ICCA 4CCNA 2STWA 4OMYA 3CD6I 5JR3A 4CCLA 1OCZH 3FKJA 2R7WA 1GDTA 4RDUA 5E79C 3W6VA 4CO8A 2ICWG 3OMYA 2E1NA 1MD0A 4A0XA 1IV6A 3S8PA 3CCQI 4HDVA 2F5DA 1TT0A 1YX3A 4AVPA 3KP2A 1OCTC 2A69F 1X1PA 2E5ZA 2X51A 1P2FA 1BL0A 1VTNC 1B9MA 2X6OA 5EG0A 2DXIA 3LSPA 3CMYA 2HI3A 1LVAA 3GZ6A 2MLKA 5FLXK 1LNWA 5FLVA 2Q8KA 2V6CA 2BY2A 4JQFA 3TW6A 2JSPA 1MBGA 3H0DA 2XF5A 3PUFA 3RPQA 2HDWA 3ISPA 3HOUJ 4CCMA 1MDMB 2LY9A 3DU5A 2GAUA 4II2A 3SHFA 4MGRA 3JRAA 1HCRA 2LF8A 2RNJA 4CZCA 1XTAA 2CUFA 4II3A 2RV8A 4AWXB 1Z3YA 2DMPA 1MSEC 1K61A 1X1AA 2DTRA 3ECHA 4LITA 4E6KG 1WFXA 1XN7A 5E3MA 1ETXA 4XBFA 5E1XA 1MKMA 1WKMA 1Z7UA 1FTZA 4H0EA 1A6IA 3KEQA 3E5QA 4NUBA 2NAZA 3R6SA 2O6GE 3DU6A 3K0LA 2EV5A 2MYSA 1VZ0A 1XMKA 5FB2A 2L7FP 2VOOA 2QBYB 1P7IA 1X3ZB 5GTIC 2WBMA 3VPRA 4B48A 4YEJA 1YIJI 1TWFJ 2DQLA 3E6DA 4A3EJ 1Z9CA 1DDNA 3K2AA 4I02A 1FJLA 1G4DA 4YFXF 1EH8A 1G3YA 3IC7A 4AM3A 2OA4A 1GVJA 1XCVA 3GEZA 2VC0A 2H1KA 3GTLJ 4YIFA 3M8JA 3Q9SA 4XL9A 2IBDA 4IRIA 3J7AO 2G0EA 4I76A 2X6XA 2F4IA 4A3FJ 5FLXZ 3J80Z 3ASOH 2DTZA 1UG0A 1FP2A 3C2GA 2IJLA 2XB0X 2LBFB 2HVQA 3LOCA 1ODDA 2ECCA 1IV8A 3S2DJ 5EDNA 3OL4A 4XLFA 4XSXF 4M6XA 4LG0B 5D5UB 1Q1HA 2X85A 3OL3A 3H5NA 3FHZA 1OR7A 2IW5A 1GV2A 1ZGJA 1AU7A 2HOTA 5TISC 2IEKA 1J5YA 5ED4A 5FLMJ 2VJJA 4KJZA 5DD8A 1R22A 1JHFA 1QZZA 2DMQA 3M07A 3MWMA 3LSJA 2R7QA 2VQHA 4JYKA 2N8GA 2MH9A 4BDYA 4YG2F 1HW1A 5EZGA 1TW3A 2EILH 2XKOA 2W4SA 4B43A 4DNCA 4EMSA 3OYBA 1VQ7I 2NOGA 1QHGA 2IGNA 4PGHA 3FMQA 1BOAA 1OKRA 2G9WA 3DQVC 4FE4A 4BE1A 3A03A 4X6AJ 4YIIA 4L5IA 2HDCA 3C18A 2MLGA 2ESNA 2JQ7A 4NC8A 3SXYA 3JRBA 4O3MA 2PMHA 2NYXA 4I98B 3S1QJ 4BQOA 3M7GA 1QO0D 1Z67A 1QZYA 5CVIA 5DS9A 4G12A 5DCFA 2PLYA 5J1YA 5GPAA 3KLNA 2OUMA 2HPIA 1J75A 4B3AA 1DU6A 2IPQX 2YX7A 1ZG5A 3GTQJ 3DPTA 3I3LA 1Y56A 2QWWA 4W1UA 3I64A 1UHMA 2CUEA 4RGSA 5ICFA 2HQAA 3GFIA 2XDVA 2IGMA 2ID3A 1USSA 3R0AA 2YU3A 4G6DA 4G7ZF 3S32A 3VDXA 1W4MA 1F36A 2IGKA 2F2EA 2HOEA 2HKOA 2YUSA 3K9TA 4FE7A 5BNGA 1HDDC 5B3SH 2BBYA 1P92A 3FXOA 3ERMA 3P9CA 2BHZA 1NG6A 1BR2A 1D0ZA 1MDMA 2RVCA 5JVTA 3PIPF 2Z3YA 3AG4H 4BXUA 2B9SA 1R36A 2PMZN 2I5UA 1GXPA 1ETQA 2O3FA 2EPFA 5EF6A 4LLLA 4P1WA 1K83J 2OAZA 2O8KA 3CESA 3HKZA 4HF0A 5EEHA 4I6ZA 2CH0A 1KYWA 3DBRB 3P9KA 3WTZA 2EA2A 1XGSA 2DDBA 4CUGA 2HEOA 3F8BA 3VB2A 3OYHA 2F5FA 3LQRA 3RKWA 3FBNB 1QVUA 2OZ6A 4ESJA 2LF7A 3QPTA 2ZXJA 3ABMH 5CVRA 3PNTA 2MC4A 3R60A 1ZELA 1Z6RA 3CP8A 3TP3A 2VI6A 5KAFC 2IS6A 1FYLA 1XDUA 3TP0A 1ZHFA 4IHTA 1ZG3A 1D8JA 2HTSA 3HPGA 1Q1VA 3F8CA 4PFOA 4XLPF 2DT6A 5HS9A 5EEAA 1MMDA 3TO6A 1S5LC 3RYRA 2QKMB 5E17F 3SEQA 3MMYB 4HV6A 1K6OA 2Y9YA 3OR1C 2LK2A 5K5RA 3NAUA 3BTCA 4CCOA 1A36A 1JUPA 3FXRA 2ZSHB 1S6LA 2K9MA 3B73A 4QPOA 4UUSB 1JT6A 2NNYA 4ZYDA 1JJ6C 4BDZA 1OLTA 2BY0A 3ZN1A 1XCBA 4QTRA 1YS7A 1DUXC 1XX5A 2ELJA 5M5WJ 1ZKGA 4LG0A 3SDBA 3CF5F 5M3MJ 2E2HJ 2CQNA 3QPSA 2O9LA 1YW7A 1SEUA 2LKPA 1U5TB 2DT7B 3ZQQA 1WJBA 2IS4A 3BQZA 5DUIA 1AKHA 4I7HA 2O61A 1Z05A 4BJTA 2VQCA 3QYFA 5K7FA 2H6BA 1U9NA 1MNEA 1R49A 1KU2A 2IXSA 1Y6IA 2ME6A 3MAJA 2P5VA 1VQNI 3LFUA 3QWLA 2X1DA 1TL8A 1HF0A 1R7JA 3C7JA 1F4KA 3PL8A 5E18F 2VBXA 3GTKJ 3I0TA 1GVDA 3I59A 1VQMI 4HEA2 4CICA 4WXCA 2XRLA 2V1XA 3HXLA 3HZJA 1RPWA 2H09A 3BR6A 3CQZJ 3F3XA 3OOPA 4KN4X 5J40A 3RQIA 1AKHB 1T98A 5IP7J 4U0YA 3I4MJ 3CO6C 5EJCA 4DIQA 3OYEA 5AIPA 4XLAA 2FQ3A 3KIOA 3JAMZ 2XKPA 4A5NA 2XAFA 4UB6C 1DGWY 1MJ9A 2CQQA 2MW8A 4ENKA 1S9HA 4OIQF 3BROA 3D1NI 3J7AY 4DQ2A 4BU2A 2GXBA 3FF5A 3HOVJ 4Y3OA 3CCMI 2FX0A 4IHVA 5DCMA 1YHQI 1QQIA 2XPWA 2VODA 4ENMA 5KK1A 2BHYA 3CMEI 3K4KA 1R6RA 2KL4A 2HVRA 5FRMA 4DYQA 1LVKA 5L3BA 4BE2A 5J47A 4XN0A 2Q2EA 3KFWX 1IXRC 1JUSA 4XMYA 2HFHA 1Z1DA 1SVMA 2IS1A 3I4PA 4OAZA 3IL2A 2VB6A 3TDZC 3C2HA 2QVOA 1R1TA 3WTXC 1WWXA 5D4RA 2JJ7A 2LY1A 1UG2A 1TWCJ 2NVTJ 3HM5A 2X9DA 3GBGA 1VQLI 2IVMA 4S05A 2R7XA 3RKXA 2LBFA 2JRMA 3WGHA 1TT5B 4F55A 2M4KA 2DN0A 2J5OA 2JA7J 1YE9A 3EUHC 4RMNA 4XOTA 2HQ5A 4A0ZA 1WI3A 2STTA 1MGTA 1S29A 4ZDPA 3CUQA 1XS9A 2FBIA 2R7FA 2H8RA 2Y48A 2R7VA 1MBJA 2GA1A 4D5FA 2H1LA 3ZP5A 1B8IA 1IJWC 1N78A 5HLTA 1JKOC 2V26A 3A2KA 3F21A 5KAIC 3BZCA 4C2MJ 2VQLA 1LUJB 3KYDB 5J1UA 3EUAA 3FXQA 1SFKA 3N97A 1WGXA 3EUKL 1W0TA 1O4XA 3KZZA 5FKKA 3E6BA 2K4BA 4HX7A 2HU9A 4Y13A 4Q4ZF 3GVAA 4L9VA 3VWBA 3K4JA 3S17J 2QGUA 2A07F 1OMIA 1E17A 3V7RA 3TKYA 1Z0XA 1FC3A 3DEWA 2BW3B 2R4GA 3I9V2 3L09A 4AUXA 4UUSA 2JVHA 3LSIA 4MQVA 3AKZA 2Y75A 5IYDJ 1QVTA 3ABUA 3L00A 2CGPA 5IYBJ 4KMFA 2CU7A 2CV1A 1MNDA 4I09A 1G8XA 2PJPA 3V8LA 4QIWN 3EYYA 4UV8A 3FK7A 4RGRA 4Q5SF 3SZTA 4J01A 3PNYA 1HDPA 1QPMA 4R1HA 4XN3A 2WV0A 3S1MJ 4KIBA 1A31A 2R0QC 2UXNA 3LSHA 2IRFG 3V42A 4E7SA 4AYBA 2ZMEC 2WAEA 3IAS2 3CJTB 3J7ZI 1FSHA 3FM5A 1GHCA 2K9QA 4MQ9F 3OYMA 5M5YJ 3WHCA 4XRSA 3ZQIA 1U5TA 1IRGA 2E71A 1IRXA 2HS5A 3W2WA 3C3WA 1Z3XA 2AHQA 4C3HJ 2X6YA 4FT8A 2ID6A 1BW5A 2D45A 3GTGJ 4AD9A 1F1ZA 2M34A 2NOJB 5ICEA 4HV5A 2B0LA 3CJRB 5GADJ 1U8BA 1CQTA 4DZJA 1E0EA 2AO9A 3PSFA 4B1RA 3OYKA 1VFCA 3BWGA 2CJJA 3H92A 4XRMA 4C9YA 3GFJA 3PFIA 4A69C 1V55H 1OISA 1UCRA 1ETWA 2X0LA 3VSKA 3FBIB 5K1YA 4WF2A 1XPXA 2EB7A 3QP5A 2VKDA 2V79A 3CJNA 3M8EA 3ZPLA 3ULQB 1BC8C 4M71A 5HNFA 4ZDOA 9ANTA 2EIMH 2ISYA 3QPLA 4IVNA 1MSFC 2EFNA 3LSRA 3F9KA 3HTSB 4C2TA 5M3FJ 3K4NA 2M7AA 3S3OA 4ZTJA 1FOXA 2QENA 2XSDC 4L0YB 2YX4A 3BG7A 1IXCA 4ZC3A 2K3FA 2PN6A 1IGNA 2M5WA 1EA3A 1SAUA 2DYSH 2X1CA 1FEXA 4B47A 4JBAA 5LHGA 1O3TA 1JKQC 2ZB9A 5K7ZA 2DA4A 4G7HF 3I56I 5ILSA 3G3ZA 1XGOA 4V2FA 4C30A 1I1GA 5CQGA 4UV9A 4L5JA 2DA5A 4O5VA 4PJ0C 4DYCA 2GM4A 2E7WA 1MBHA 3HEFA 6PAXA 2O7OA 3LAJA 3BR1A 2BZTA 4GDFA 3HOXJ 4LK0F 4C3IJ 1P9QC 2DMUA 1GUUA 3K4MA 3D5LA 4KT5C 1T56A 4I0BA 3ZQFA 2KIUA 2P4WA 2KRCA 4Y52J 3W2VA 3AL0C 1LKXA 2XGEA 1RRJA 2KIMA 2XGXA 3RDIA 5KVRA 1HQCA 2E1MC 5HLHA 2FOKA 2XASA 2L7KA 4A3JJ 1W0UA 2HOAA 3GTPJ 2K4JA 2K40A 1V54H 3FXJA 2F6CA 2QZ8A 5F04A 5L3DA 1XMAA 1ZYRF 2D1VA 2CWEA 2M45A 2P81A 1QA6A 5CPRB 2R5ZA 2WB1N 3J80K 3HGGA 4EJTA 4LOCA 2NVQJ 5C4JJ 2GIZA 4J00A 1I3AA 1OYIA 4XRSG 2P5LC 2A5YB 3BZ6A 3VOEA 4BNCA 2CQKA 3RTRA 1P4WA 2WV1A 4PDKA 5JFRA 4D5CA 3K4CA 2DA6A 4KNYA 2LNBA 4NQWB 3OYDA 1ULYA 2BXYA 4L18B 1RESA 3MKWB 3DEEA 3V4GA 1U6GA 5FKOA 3IH2A 5F0HA 5LEJA 1FIPA 3BG5A 3SZGA 2I8DA 3K4LA 1QPIA 5TRDA 2AXLA 3K69A 4BEHB 1FIAA 2G7HA 5LRSA 1U2WA 2Z16A 5DM7F 3K70D 3I58A 3MD2A 5GAGJ 4LB5A 1E2XA 3MKLA 2P0WA 1T2KA 2Y2ZA 1H89C 2EZKA 4GCVA 3TQNA 4BUPA 4ZYGA 3OYLA 4EM1A 3E6MA 1D8KA 1NTCA 4RA2A 2M9HA 2W24A 3RZDJ 3T1BA 1ZN2A 2Y31A 1YI2I 5HODA 3CLOA 4IQ4A 3OWTA 3HRSA 1TTYA 3WGGA 1SD7A 2XAQA 2L3DA 3BDDA 4RAYA 4JX6A 4ABZA 3KX2A 1OYYA 2A6EF 2F4OB 1RIOH 4E7IA 1RC9A 3QYEA 2OC6A 4CA0A 5DDGA 3OYJA 4A0YA 2E2JJ 4DJAA 1B1BA 3HSEA 5LD2C 1FOKA 2RN7A 4BS9A 3JR9A 4LB6B 1LE8A 1CF7B 3ZQ7A 3CUQB 3MEXA 4ZDLA 1R23A 1O7LA 2EV6A 3TBIA 2VOPA 2OPTA 1JKPC 2W48A 1UHWA 3K1PA 2K7LA 1X2NA 3U2RA 4AIKA 4NC6A 5HS8A 3FZVA 4IHYA 4MHGA 4AU7A 1BC7C 1XGNA 5DM6F 3I54A 4BBRJ 3WE2A 2HXOA 3S14J 3JTGA 1D1BA 1EJ9A 3CCVI 3K2ZA 2BXZA 4BHPA 4R8HA 2EZHA 4RM3A 2B63J 3ZCOA 3SJMA 3WU1B 4IHWA 3SYTA 5F1RA 1HSTA 2JUCA 4M6VA 2A68F 2E19A 2LKXA 3FKIJ 4EEFG 5HVQC 2PX9A 2X48A 4EJOA 1WZ2A 3F72A 1FT9A 5FFXA 4M3GA 3H3ZA 3KZIC 5E3NA 1XGMA 5A2QZ 4X1EA 4V19K 1IUYA 3HSRA 3ASNH 1J0RA 4ZZDA 4M6YA 2Z33A 3S1RJ 3ZR8X 1YRNB 1UAAA 4Y33A 3W6JB 3BLYA 4EV0A 2PG4A 2WWYA 5D6EA 3N05A 3H1CA 5F0FA 4BYYA 3IWFA 3LA3A 1B72A 2ZMEB 1TWHJ 2DU9A 3VODA 2JMWA 3QOPA 5CKTA 5L3GA 2IA0A 4ANJA 2VN2A 2BVMA 3ZMUA 3IRRA 2XAGA 5J6XA 3BR5A 3JSOA 2LD5A 4YELA 2ZJRF 3L7WA 4PSWA 3S1NJ 2WY8Q 1X3WB 1IN5A 1GLNA 2DA3A 2JN6A 1FMVA 2HR3A 2E1CA 4IZZA 2JWTA 4PJNA 3D5SC 1BI2A 5JHFA 2MGQA 2BE5F 2BY1A 2F5CA 1BIBA 1HBXG 2LH9A 3WTUC 4CZZA 5CVUA 1E3HA 3SZPA 3RKQA 1BI3A 2ADUA 1T8IA 4A3KJ 2TDXA 4M3EA 4N4OB 1JUMA 1KGSA 1W36D 2QA4I 2QYOA 5JHUA 4F3QA 1R4MB 3L2UA 4EGZA 3BCAA 1TQPA 4BXXJ 2KP6A 3GX4X 1J59A 3R61A 1HKSA 2OCCH 3G4SI 4G94A 4HZFA 2ETHA 2JA8J 1I6HJ 3QU3A 4PUSA 1X58A 1WHUA 1J09A 4G6QA 4UXNA 1W7PB 5DTDA 3KP3A 3E3VA 1VQ8I 3L1PA 3RIRA 5TGTA 1T38A 1SVOA 5HOOA 1RR8C 3T8RA 3A1YA 3GO5A 3HC7A 3BZKA 3K4BA 2ELHA 3RCOA 2L2OA 4KDPA 3RQ4A 3C1DA 4JX5A 2OZUA 4IOAF 4HAMA 3AG3H 5BPDA 1VQ6I 1FY7A 3QU6A 1WH5A 2RQQA 1REPC 2W7NA 2DA1A 4HDUA 4UY8I 3SFIA 2C6YA 3TDUC 1LJ9A 1RUOA 1SFUA 1A35A 3A0BC 1LB2A 3FK6A 4XSZF 2K86A 4ZH4F 3I4NJ 1I3QJ 3E0JB 3HB9A 1V5EA 3VFZA 4I99C 1KYZA 4FHTA 4CXFA 2R5YA 4HNVA 1ZRCA 3M8FA 3GMEA 3EUHA 1WI9A 1ZAOA 4G8XA 1PP7U 4EJWA 3LFKA 1HW5A 2ZSIB 4M73A 3DXJF 1L0OC 5F0CA 2FBHA 3CMMA 4S04A 2KDOA 2DA7A 1YG2A 2EQRA 4KIFA 4UVBA 4DGWB 4HG2A 1HOMA 4BACA 4EATA 1GT0C 3Q0WA 4IPAA 2M1BA 2VJ4A 3VSLA 2A5WA 2E1MB 2PBIA 3BG9A 5DEQA 2V1NA 3ELKA 1ZR4A 3B02A 4HRIA 1A04A 3F8FA 1YOVB 2VIXA 2D5VA 3H3UA 1G3SA 3BOQA 4IJAA 3RPUD 1K4SA 1IN4A 1SMTA 2KFDA 4KN7X 1X19A 1ZARA 1MBEA 2RQPA 1D5YA 5EGOA 1UFMA 4S0HB 5LFAA 3O8HA 1AOYA 2V1UA 2XVCA 4LMYA 2HYFA 3CCUI 1LDDA 1PP8F 1Z7LA 3GFLA 4XKCA 1TNSA 3PJRA 3U9GA 5H6RA 2CV2A 2XPUA 1P6RA 2JZYA 1L3LA 2HOSA 1VQKI 1QZEA 3IKVA 1KQ8A 4RM2A 3DLLF 2E60A 3HTUA 3DV8A 3VYSB 2FRHA 5ILVA 5HNHA 2UUZA 2M2EA 3L2RA 4U7BA 2F4MB 3K10A 4CYCA 1ZK8A 1NK3P 3DF8A 3D5RC 2PJRA 1PJRA 1YJWI 4HLYA 1KONA 2HPMA 3VYRB 2R3SA 1ZGAA 1TP4A 2KZGA 3JRDA 3KP7A 4W97A 2A61A 2K02A 1BM9A 1U5TC 4ESBA 4NNJA 1K78B 2RAEA 4EGYA 1H0MA 2P7CB 4A3BJ 2ZO4A 3N4MA 1QGPA 2OCEA 1HKTA 2CMPA 1RI7A 1G2HA 4CSWA 1B72B 1GXQA 1XSDA 4BL0B 2JUGA 5IP9J 2GOXB 1P4XA 2OJED 5GAEJ 5J4YA 3ZQHA 1FMWA 1IC8A 4M3BA 4OMZA 4FISA 2ME0A 3SQNA 3JRCA 1W7PA 5FKNA 1KU7A 2V4JC 2JTVA 4Y17A 4RAFA 5E20A 1TQIA 1IDZA 1R00A 4D1QA 1V5FA 2QSFX 1ONVA 3FISA 1U3EM 5LGTA 1XSXA 2R7ZJ 2VJIA 3BP8A 1OFCX 3OYCA 4M3DA 4BE0A 3EETA 3V8KA 4B8XA 1T08B 2EWNA 1JE8A 3I71A 1TZLA 4JX4A 1FZPB 1QHHD 4BY1J 1TBXA 1ZH5A 4B3XA 2EIJH 4M9SA 1MBFA 1IXSB 4IL6C 1G6NA 4A6EA 3GW2A 3BQYA 2V7FA 2R7TA 1A5JA 4MLOA 4Q48A 2FD5A 3IUOA 5HDKA 3H9JA 5GP9A 3HOYJ 4U0WA 3M1CA 2NRAC 2R7UA 2D1HA 3CJQB 3KYLA 4L9JA 2L9RA 3TO9A 2OTLI 2L9NA 2QM3A 2W1OA 3KCCA 4NDLA 4B09A 4BHCA 3LAPA 3E6CC 2R5YB 2FU4A 2CS3A 4DOZA 1LFPA 1Y8QB 3ZGKA 4F92B 4RB2C 3I55I 3HDDA 4E4HA 1FYMA 1YIOA 2VONA 4BY7J 1HLVA 5CVVA 2DDAA 2I10A 1GV5A 4HNUA 5B1BH 2F5VA 1D3YA 4JP0A 2L7MP 2VPRA 1LFUP 2NVUB 4D9JA 1JT0A 4R79A 1FX7A 3VEPA 2UWMA 5HS7A 2DAOA 3WU0A 5FD5A 1B9NA 4ON0A 2BY3A 1UZCA 2G7UA 2J5PA 2E36A 2FMLA 2ZJ2A 3R0JA 2EZLA 2KIQA 2JRTA 4EJVA 1B6AA 3LQQA 2OQGA 1MMAA 3MN2A 4G9YA 3P5JA 2L0KA 2VC1A 2Z99A 3OS2A 2Q0OA 1POGA 2VASA 3KYCB 2CUJA 4F93B 2XROA 1FLIA 2Z1DA 3H0GJ 2E2IJ 2LYCA 3UKGA 4IHXA 2XAHA 1SVLA 1WPKA 3S3MA 3GLXA 2IA2A 3JAMK 4GYIA 2JPBA 2LREA 4HQEA 4PZJA 2IP2A 1QNTA 2RNGA 2FNPA 4WXHA 4D7NA 3AG1H 5J4VA 2LVSA 4XKWA 2W00A 1DP7P 1OCRH 1YX5A 5LRRA 2GOMA 1KU3A 1NHAA 1Y0NA 4KMUX 3U1DA 4EM2A 5GAHJ 2XPVA 4M9XA 1H8AC 4OU0A 3WG7H 4DBQA 4BH9A 4ZZLA 3QP6A 3TW7A 3RJPA 1SANA 1FWZA 5C3EJ 2X6WA 3B6CA 4NQWA 1RKWA 3K1NA 2FSWA 4B4CA 4A6DA 3MZHA 4GYGA 3OSFA 2A6HF 1UJ8A 1Y1WJ 4OIPF 3QQAA 1FOYA 2YPRA 3HRTA 1JTYA 1NG7A 3LSTA 4HPQA 2DPDA 4EQQA 1BIAA 3OS1A 1SFOJ 2MABA 2ZXHA 1FBUA 3LNQA 2RC4A 1H9GA 1ZG1A 2AQEA 4LLGF 4XLHA 1TWAJ 2Y0SA 4BKXA 3Q9VA 3PIOF 4CDGA 2NVXJ 1J7KA 4HSRA 4H4KC 2VT2A 4RAZA 3IRQA 3HJEA 5FD6A 3KEYA 1WQ2A 3REOA 1OQYA 1V3FA 2DJIA 3PUBA 3GFMA 4E7LA 4PK4A 4FX4A 1I1SA 1T95A 4HQMA 2E7XA 2LDUA 3C2BA 3G1MA 4UUTA 4P9UA 4E7JA 3W2AA 3COAC 1ETKA 2ZKZA 1C0WA 1PUFB 2CQXA 4BBSJ 2LY2A 2JA5J 1V4RA 4PSXA 3ERED 4HF2A 3ECOA 3HOTA 1SMYF 4NB5A 4KA4A 4AC0A 1Z77A 5IP6A 1ERDA 4PCQA 2M87A 2GQQA 3NARA 4A5MA 3WTTC 2KISA 2HZDA 3EPZA 5LHIA 2XRNA 5DUKA 2WB1A 4A3MJ 2FUG2 2DOAA 2ZNYA 5ILUA 3K7AJ 3BR0A 1PUEE 1EKEA 3HRUA 5CYVA 1RR7A 1D1AA 1SFEA 1WCMJ 4QSHA 4BQNA 1LE8B 1CF7A 1R5ID 1WJEA 3NEUA 4M9ZA 3OYIA 1X1CA 2H27A 1RNLA 3DCFA 1BBYA 2HZTA 2L02A 1X1DA 1ZREA 3SFZA 3M1EA 2KRFA 2L5QA 4PJMA 4U88A 4P55A 2LOOA 4Q47A 3ZMZA 4E70A 3OIQA 2CW8A 2UZKA 2IGOA 4D7MA 1NK2P 1J2XA 3HOSA 4OAYA 1W5SA 3IH4A 1HA8A 4BGDA 3K70C 1UHSA 2VQGA 3GF2A 4DBRA 4L9NA 4XORA 3PNVA 2RKHA 3WTWC 4RGXA 2ZJQF 2AS5F 2VT3A 4BQAA 3JW4A 1S7EA 2VBWA 3LWFA 4MTEA 4C2UA 2QF7A 3W6KB 1F43A 5CQEA 3V7SA 4F52A 3F6OA 1BR1A 5JI6A 1YYVA 1OJLA 4ESFA 2CG4A 4P96A 3SEZA 2CSOA 3G1OA 4XM3A 5EG0B 2KHMA 1WVRA 2YR2A 4Z2YA 5KCMA 4XIDA 1H88C 5IT9Z 3OR2C 5J8CA 4BXFA 3CC2I 3WTYC 1YFHA 3S15J 3FWEA 4CYDA 4UNOA 3W3CA 2LP0A 3RKYA 1R5GA 2WAQA 3TOAA 1D1CA 3F6VA 1BN5A 3K6GA 3MQ0A 4GRIA 5E3OA 2COMA 3GCMA 1KQ9A 1R9TJ 1IRZA 4IEJA 1TNTA 1T39A 4OIRF 2QKLB 5LEKA 2Q2EB 2GXAA 3L2WA 4M74A 4D0PA 2OV7A 3HUGA 1FBSA 4XOPA 3H9GA 3MKYB 2K9SA 1XMXA 3TO7A 3GLLA 2EJRA 4A3DJ 2IAIA 3FMRA 5DCMB 1YW9A 4HF1A 1O3RA 2TRTA 3IV5A 5HLIA 2CYYA 1UB9A 2XB5A 1LEAA 2L9VA 3ONQA 4WWCA 3M4OJ 2MD5A 2DO7A 1K7AA 2MC3A 4EVIA 3BJ6A 2Z2SB 1HC8A 1BR4A 3VYUB 2OBPA 2BOLA 2B7EA 2LTPA 3UR3C 2FJ1A 2UV1A 3BJOA 3S2WA 1BI1A 3BY6A 4A93J 1ETYA 2ZJPF 2L01A 4RAGA 1YTYA 1MNMC 4AYBN 1MIJA 1USTA 2ISZA 4L0ZB 1X4OA 2VKHA 2LKSA 1E3OC 1ZRFA 2VE8A 3E5UA 5LGNA 2M4GA 2V9VA 2DMNA 4LJZF 5CVJA 4CCJA 1WJAA 1OYWA 4DZPA 3PFYA 4KITB 3CO7C 4LK1F 4GFBA 2V6EA 2EINH 3E5XA 3TL4X 2R93J 1IDYA 1DPRA 1UMQA 1YO5C 2M8EA 3AL0B 3JCUC 3I5UA 3MVPA 4OWRB 4KISA 2DBBA 3WODF 2WY7Q 4IQJA 2NXNB 4LIVA 4XNFA 2CW0F 4I01A 3TGNA 5GTHC 1KQ0A 1JHHA 3IHUA 1ITYA 3KP4A 2DFEA 1N77A 3EDPA 3E97A 5FKLA 2ZCWA 2XV4S 3V7CA 2ACJA 1ENHA 3BC8A 2R5ZB 4IOCF 2MG4A 1EV7A 2RREA 1M1EB 2NS0A 1X3UA 4ITVA 4DW6A 4N0BA 4ZYEA 4Y7NJ 2P5KA 4J19A 4I2OA 2VE9A 1VQOI 1Z6TA 1NH3A 2M30A 1R71A 2WA0A 3DTEA 1IF1A 4U87A 3ZMDA 4XLCA 1V5GA 4IO9F 2Y30A 4ZYHA 2MFZA 1ON1A 5DV5A 4FX0A 4PJLA 2DOFA 3M3YJ 1U8RA 1G3WA 1XC5A 4ASNA 3LSMA 1O3QA 2HYJA 1BA5A 3QPHA 2LMDA 4N4NB 5E3LA 1K4TA 2XSJC 5TJJA 4K2EA 3JSPA 1TW2A 3WHBA 1YITI 3WGIA 3H36A 1FP1D 4BHBA 5FO5A 3CCYA 4HYEA 2NS8A 3ZQLA 1J9IA 3FIWA 3ZMSA 3G6EI 2BVLA 1T0FA 3DLAA 2LG4A 4CHUA 3WG9A 1WJCA 4WXDA 1U78A 3EYIA 3KLOA 1LQ1A 1D5VA 2V9PA 3L9FA 4FASD 3IWZA 2ZXIA 1BW6A 3E7LA 1O7FA 3GXOA 3JTHA 1SD6A 1MMGA 2DA2A 3H35A 1IW7F 3ZMVA 4XQFA 2O03A 1HSJA 1U9OA 1EH6A 3CF2A 4V2GA 1APLC 3SDGA 1RETA 3P7NA 3CCLI 3HKZN 1XB4A 1WJDA 2QEXI 3Q5FA 4MEYF 1MMSA 1IN8A 1AA7A 3S3NA 4MO7A 3LA7A 2MA3A 3BTIA 3OYGA 1O3SA 3KEOA 1D0XA 3HL2A 5IT3A 3O6BB 2O5RA 4NBQA 2KDZA 2L4MA 3MCZA 1DGRM 4IF4A 1P7JA 4JOMA 2MBFA 3KETA 4OIOF 2WC2A 4PGGA 5C4XJ 4E7ZA 1B8IB 2D2WA 4IRHA 3CDHA 2VLAA 4XKBA 2EH3A 4A3GJ 1ON2A 1S3JA 4MEXF 5F27A 2CO5A 2ESHA 1LFBA 3JREA 3ZQGA 2VKEA 4I0AA 2NVYJ 2KQRA 2E1OA 3A4CA 3CDIA 4RB0A 4L5EA 4OOIA 4HLXA
chains in the Genus database with same CATH topology
2DK8A 5LHHA 3GWZA 1O57A 2UXXA 5ICGA 5LGUA 2W57A 2HYGD 1S7AA 2MH2A 4HOBA 4G7OF 5K5OA 2FNAA 3ROUA 2HKXA 3HHHA 2DT5A 4GO1A 4HX8A 4KYWA 2X4HA 3ABTA 2VBZA 2JPCA 1R1UA 4UVAA 3TOBA 1B4AA 3MFKA 4L9TA 4AIHA 5L3EA 2PI0A 2QQAA 4LFUA 5BQTA 1W7PD 3NRVA 3CTAA 2FMYA 2IA1A 3HSFA 3CUQC 5K5QA 4O6JA 5E1ZB 1IN6A 2EFPA 4YFNF 1OPCA 1F5TA 5EEGA 2DPUA 1T6SA 4U7DA 2BYVE 5H20A 3DP7A 4GGGA 1B59A 4RB3C 3GZ5A 2GIVA 4RGUA 4EM0B 4MTDA 3T5XA 1KA8A 4AIJA 3I53A 1PDNC 5FGMA 5J8FA 3G73A 3DKWA 3K1MA 5F6FA 1Z91A 3V8JA 3WTVC 1JGSA 5D5WB 2NNNA 2YSRA 2HTJA 4UUVA 3F8MA 1W5TA 4IXAA 2FBKA 2CFXA 2GA2A 2H6CA 2KJBA 4CGZA 1G3TA 2QQBA 3F23A 4RS8A 2PQ8A 2LSOA 4JK1X 3O3KA 1R5HA 4XLNF 5E8IA 4QWQA 4WX9A 5FFZA 3J81K 4KFCA 5CJ9A 4Y15A 2Z5UA 1SAXA 5H6QA 1K79A 1HXDA 3IKTA 2QUFA 2IT0A 5D5VB 5HDNA 1FPQA 2ZMEA 1F9NA 1P4AA 4HX4A 5BOXA 2WTEA 1WRJA 3HIFA 2KJCA 3F22A 3P9IA 2Y0MA 2GWRA 1YQAA 4IRGA 1BI0A 5D6FA 4WK8F 2P7VB 4A2UA 1YS6A 2GZWA 1R1VA 1YLFA 3BPVA 2EK5A 5L3CA 3F8NA 4KIGA 3AAFA 2FXAA 2EFWA 1IRFA 4XRFA 2R7DA 3WE3A 2F5EA 3DPLC 3FXUA 3CUOA 3HHGA 3MZYA 1XD7A 2BGCA 2FEZA 1I5ZA 2KIFA 4RB1A 1FNNA 1ZLKA 2W84A 5IT9K 3L2CA 1SD4A 3NQOA 5D5XB 1ZRDA 4GXOA 2O8XA 3QAHA 1WSUA 4P5OA 4QLCU 2ZFWA 3FMSA 2Z9OA 4HBLA 1STZA 3FX3A 3J81Z 2L54A 3DFGA 4N9IA 1YW8A 2XHKA 3I59B 4HW0A 3KE2A 3ZN0A 2PEXA 1HKQA 2OD5A 3HYIA 2HQNA 3ML6A 2P6SA 2RGVA 2XIGA 3EQLF 1SFXA 2QBYA 5ERIA 4UVCA 2HWVA 2XUBA 5L3FA 1IN7A 5A2QK 1RZ4A 1FBQA 3KP6A 4TV7A 4A12A 4IHSA 2P6TA 1EH7A 2ZBKA 2FA5A 2FE3A 2FF4A 4ETSA 2DI3A 5LBQA 1R58A 1LEBA 2BV6A 5HDGA 4KUMA 5F64A 4EJUA 3T0YA 3GYHX 2V1DA 3M9AA 4F7ZA 3PQKA 4KICA 1FYKA 1QBJA 1HW2A 1XDSA 1ZLJA 2EFQA 2OU2A 1S8NA 1Y0UA 3FM3A 1MJAA 2H94A 2DFIA 1MZBA 3KZYA 2HQRA 4LGWA 4U0VA 3RI4A 1H9TA 1DPUA 5D8KB 1IAWA 5LLQA 4OINF 4NHJA 3O2PE 2OQRA 2VXZA 2EA4A 5AIQA 4LD5A 1LDKB 2BEOA 4HA8A 3PQJA 1TQMA 3LA2A 5DD4A 2O0YA 2PFBA 3GUDA 1S7OA 4UHTA 1SD5A 3HRMA 3BJAA 2A3SA 1LDJA 5AONA 2PMUA 1AWCA 5BPIA 3RYPA 5D4SA 5HLGA 1TLHB 3DEUA 3BPXA 4N9HA 2GXGA 2QQ9A 2K27A 2DW4A 1KU9A 1BJAA 2DQRA 2XAJA 1MJBA 5DYMA 1IZ1A 4YFKF 1RUNA 4M72A 5BS6A 4ENJA 2JT1A 1CGPA 2P8TA 2QLZA 1XSVA 5E8GA 3T8TA 4MNUA 5CLSA 2L4AA 2VBYA 3OV8A 2EFOA 3ZMTA 4P9FA 3R4KA 3WTSC 3KP5A 4BAYA 2DK5A 5BMZA 2W25A 1JXSA 2RDPA 5D8LB 2DLLA 1I27A 4ENNA 3QRFF 1I6XA 3RPUA 2KKOA 4WCGA 5E1WA 2HGCA 4LLNA 2ZNZA 3D0SA 1K78A 1FSEA 2JSCA 2W85A 2EV0A 5ICCA 2STWA 4OMYA 5JR3A 4CO8A 2E1NA 1MD0A 4A0XA 4HDVA 2F5DA 4AVPA 3KP2A 2A69F 1P2FA 1VTNC 1B9MA 3GZ6A 1LVAA 2MLKA 5FLXK 1LNWA 2Q8KA 2V6CA 4JQFA 3RPQA 3ISPA 1MDMB 2GAUA 3SHFA 4MGRA 2LF8A 2RNJA 2RV8A 4AWXB 2DTRA 3ECHA 1XN7A 4XBFA 5E1XA 1MKMA 1WKMA 1Z7UA 4H0EA 3KEQA 3E5QA 2NAZA 3R6SA 2O6GE 3K0LA 2EV5A 1XMKA 5FB2A 2VOOA 2QBYB 2DQLA 3E6DA 1DDNA 1Z9CA 4I02A 1G4DA 4YFXF 1EH8A 1G3YA 3IC7A 2OA4A 1GVJA 1XCVA 2VC0A 3GEZA 4YIFA 3Q9SA 4IRIA 3J7AO 5FLXZ 3J80Z 1FP2A 2IJLA 1ODDA 4XSXF 4M6XA 4LG0B 5D5UB 1Q1HA 3FHZA 1OR7A 2IW5A 1ZGJA 1J5YA 5ED4A 5DD8A 1R22A 1JHFA 1QZZA 3MWMA 2MH9A 4YG2F 1HW1A 1TW3A 2XKOA 4DNCA 4EMSA 4PGHA 3FMQA 1BOAA 1OKRA 2G9WA 3DQVC 4YIIA 4L5IA 2HDCA 3C18A 2MLGA 2ESNA 4O3MA 3SXYA 2PMHA 2NYXA 4I98B 3M7GA 1QO0D 1QZYA 5CVIA 5DCFA 2PLYA 3KLNA 1J75A 2IPQX 2YX7A 1ZG5A 3DPTA 2QWWA 3I64A 1UHMA 4RGSA 5ICFA 3GFIA 3R0AA 1USSA 2YU3A 4G6DA 4G7ZF 1W4MA 2F2EA 2HOEA 2HKOA 3K9TA 2BBYA 1P92A 3P9CA 1MDMA 2RVCA 5JVTA 2Z3YA 4BXUA 1R36A 1GXPA 2O3FA 4LLLA 2OAZA 4HF0A 5EEHA 1KYWA 3P9KA 3WTZA 2EA2A 1XGSA 2HEOA 3F8BA 3VB2A 2F5FA 3LQRA 3RKWA 2OZ6A 4ESJA 2LF7A 3QPTA 2ZXJA 5CVRA 3R60A 1Z6RA 1FYLA 1XDUA 1ZHFA 4IHTA 1ZG3A 1D8JA 2HTSA 3F8CA 4XLPF 5HS9A 3TO6A 3RYRA 5E17F 4HV6A 1K6OA 5K5RA 3FXRA 1S6LA 3B73A 2NNYA 4ZYDA 3ZN1A 1XCBA 1YS7A 1DUXC 4LG0A 1YW7A 2LKPA 1U5TB 5DUIA 4I7HA 2O61A 1Z05A 2H6BA 1KU2A 3MAJA 2P5VA 1F4KA 1R7JA 3C7JA 5E18F 2VBXA 3I0TA 3I59A 4CICA 4WXCA 2V1XA 2H09A 3F3XA 3OOPA 4KN4X 1T98A 4U0YA 3CO6C 5AIPA 2FQ3A 3JAMZ 2XKPA 4A5NA 2XAFA 1MJ9A 4ENKA 4OIQF 3BROA 4DQ2A 2GXBA 3FF5A 5DCMA 1QQIA 2VODA 4ENMA 5KK1A 5L3BA 2Q2EA 3KFWX 1IXRC 2HFHA 1Z1DA 3I4PA 3IL2A 3TDZC 2QVOA 1R1TA 3WTXC 1WWXA 5D4RA 2IVMA 4S05A 3RKXA 3WGHA 2J5OA 4A0ZA 2STTA 1MGTA 1S29A 3CUQA 2FBIA 2R7FA 2Y48A 2GA1A 3ZP5A 3F21A 3N97A 3FXQA 3KZZA 3E6BA 2K4BA 4HX7A 4Y13A 4Q4ZF 3GVAA 4L9VA 2A07F 1OMIA 1E17A 3V7RA 3TKYA 1FC3A 3L09A 4MQVA 2Y75A 3ABUA 3L00A 2CGPA 4KMFA 4I09A 2PJPA 3V8LA 3EYYA 4UV8A 4RGRA 4Q5SF 3SZTA 1QPMA 4R1HA 2WV0A 4KIBA 2UXNA 2IRFG 1FSHA 3FM5A 1GHCA 4MQ9F 1U5TA 1IRGA 2HS5A 3C3WA 4FT8A 2D45A 4AD9A 1F1ZA 5ICEA 4HV5A 2B0LA 3BWGA 3H92A 3GFJA 3PFIA 1UCRA 2X0LA 5K1YA 4WF2A 3ZPLA 2EB7A 3QP5A 2V79A 3CJNA 3M8EA 3ULQB 1BC8C 4M71A 2ISYA 4IVNA 2EFNA 3HTSB 2QENA 4L0YB 2YX4A 1IXCA 2PN6A 2M5WA 4JBAA 5LHGA 1O3TA 4G7HF 5ILSA 3G3ZA 1XGOA 1I1GA 4UV9A 4L5JA 4O5VA 2E7WA 6PAXA 3LAJA 4LK0F 3D5LA 4KT5C 4I0BA 2KIUA 2P4WA 2KIMA 2XGXA 3RDIA 5KVRA 1HQCA 5HLHA 2FOKA 2XASA 2K4JA 2QZ8A 5L3DA 1XMAA 1ZYRF 2D1VA 2CWEA 2M45A 3J80K 4EJTA 1OYIA 2P5LC 2A5YB 3BZ6A 3VOEA 4BNCA 2CQKA 3RTRA 1P4WA 4PDKA 5JFRA 4KNYA 2LNBA 4L18B 1ULYA 3V4GA 1U6GA 5LEJA 5TRDA 2AXLA 3K69A 2G7HA 5LRSA 1U2WA 3I58A 4LB5A 1E2XA 1T2KA 4GCVA 3TQNA 4ZYGA 4EM1A 3E6MA 1D8KA 2W24A 3T1BA 1ZN2A 3CLOA 3HRSA 1TTYA 3WGGA 1SD7A 2XAQA 2L3DA 3BDDA 4RAYA 1OYYA 2A6EF 1RIOH 5DDGA 4A0YA 1FOKA 1B1BA 3HSEA 2RN7A 1CF7B 4LB6B 3ZQ7A 3CUQB 3MEXA 1R23A 1O7LA 2EV6A 2VOPA 1UHWA 3K1PA 2K7LA 3U2RA 4AIKA 5HS8A 3FZVA 4MHGA 1BC7C 1XGNA 3I54A 3WE2A 3JTGA 3K2ZA 4BHPA 4R8HA 3WU1B 5F1RA 1HSTA 2A68F 5HVQC 4EJOA 3F72A 1FT9A 5FFXA 3H3ZA 1XGMA 5A2QZ 1IUYA 3HSRA 1J0RA 4ZZDA 4M6YA 2Z33A 3W6JB 4EV0A 2PG4A 2WWYA 5D6EA 4BYYA 3IWFA 3LA3A 2ZMEB 2DU9A 3VODA 3QOPA 5L3GA 2IA0A 2VN2A 3ZMUA 3IRRA 2XAGA 5J6XA 3JSOA 3L7WA 1IN5A 2E1CA 2HR3A 1BI2A 2BE5F 2F5CA 1BIBA 1HBXG 3WTUC 4CZZA 5CVUA 3SZPA 1BI3A 2ADUA 2TDXA 1KGSA 2QYOA 5JHUA 4EGZA 1TQPA 3GX4X 1J59A 3R61A 1HKSA 4G94A 4HZFA 2ETHA 3QU3A 4G6QA 4UXNA 1W7PB 3KP3A 3E3VA 3RIRA 1T38A 5HOOA 3T8RA 3GO5A 2ELHA 4KDPA 3C1DA 2OZUA 4HAMA 5BPDA 1FY7A 3QU6A 1REPC 4HDUA 2C6YA 3TDUC 1LJ9A 1RUOA 1SFUA 1LB2A 4XSZF 2K86A 4ZH4F 3VFZA 1KYZA 4FHTA 4CXFA 1ZRCA 3M8FA 3EUHA 1WI9A 1ZAOA 4G8XA 1PP7U 4EJWA 3LFKA 1HW5A 4M73A 3DXJF 1L0OC 2FBHA 4S04A 1YG2A 4KIFA 4UVBA 4IPAA 2M1BA 5DEQA 2PBIA 3ELKA 3B02A 1A04A 3F8FA 3H3UA 1G3SA 3BOQA 4IJAA 1IN4A 1SMTA 4KN7X 1ZARA 2RQPA 1UFMA 1AOYA 2V1UA 2XVCA 4LMYA 2HYFA 1LDDA 1PP8F 3GFLA 1TNSA 3U9GA 5H6RA 1P6RA 2JZYA 1L3LA 3IKVA 1KQ8A 3HTUA 3DV8A 2FRHA 5ILVA 4U7BA 3DF8A 4HLYA 2R3SA 1ZGAA 3KP7A 2A61A 2K02A 1BM9A 1U5TC 4ESBA 1K78B 4EGYA 1H0MA 2P7CB 2ZO4A 3N4MA 1QGPA 1HKTA 1RI7A 1GXQA 1XSDA 1P4XA 4OMZA 3SQNA 1W7PA 1KU7A 2JTVA 4Y17A 5E20A 1TQIA 1R00A 1ONVA 1U3EM 5LGTA 1XSXA 3BP8A 3EETA 3V8KA 4B8XA 2EWNA 1JE8A 3I71A 1FZPB 1TBXA 1ZH5A 4M9SA 1IXSB 1G6NA 4A6EA 3GW2A 4Q48A 5HDKA 4U0WA 2NRAC 2D1HA 4L9JA 3TO9A 2QM3A 4BHCA 3KCCA 4B09A 3E6CC 3LAPA 2FU4A 4RB2C 1FYMA 1YIOA 2VONA 5CVVA 1D3YA 4R79A 1FX7A 3VEPA 2UWMA 5HS7A 2DAOA 3WU0A 5FD5A 1B9NA 4ON0A 2G7UA 2J5PA 2FMLA 2ZJ2A 3R0JA 2JRTA 4EJVA 1B6AA 3LQQA 2OQGA 4G9YA 2VC1A 2Z99A 2Q0OA 2XROA 1FLIA 2XAHA 3GLXA 2IA2A 3JAMK 4GYIA 2JPBA 4HQEA 4PZJA 2IP2A 1QNTA 2FNPA 4WXHA 1DP7P 5LRRA 1KU3A 1NHAA 4KMUX 3U1DA 4EM2A 4M9XA 4OU0A 4BH9A 4ZZLA 3QP6A 3RJPA 1FWZA 4NQWA 3K1NA 2FSWA 4A6DA 3MZHA 4GYGA 2A6HF 4OIPF 2YPRA 3HRTA 2DPDA 3LSTA 4EQQA 1BIAA 1FBUA 2RC4A 1H9GA 1ZG1A 4LLGF 3Q9VA 4CDGA 1J7KA 4RAZA 2VT2A 3IRQA 5FD6A 1WQ2A 3REOA 1V3FA 3GFMA 4FX4A 1I1SA 4HQMA 2E7XA 2LDUA 4P9UA 3COAC 1C0WA 2ZKZA 1V4RA 3ERED 4HF2A 3ECOA 3HOTA 1SMYF 4NB5A 4KA4A 4PCQA 2M87A 2GQQA 4A5MA 3WTTC 5LHIA 2XRNA 5DUKA 2ZNYA 5ILUA 1PUEE 5CYVA 3HRUA 1SFEA 1CF7A 3NEUA 4M9ZA 2H27A 1RNLA 1BBYA 2HZTA 2L02A 1ZREA 3SFZA 3M1EA 2KRFA 3ZMZA 4U88A 4P55A 4Q47A 4E70A 2UZKA 1J2XA 3HOSA 1W5SA 3GF2A 4L9NA 4BQAA 2AS5F 2RKHA 3WTWC 4RGXA 2VT3A 3JW4A 2VBWA 3LWFA 4MTEA 3W6KB 3V7SA 3F6OA 5JI6A 1YYVA 4ESFA 2CG4A 4P96A 2CSOA 2YR2A 4Z2YA 5IT9Z 5J8CA 3WTYC 1YFHA 3FWEA 4CYDA 4UNOA 3RKYA 1R5GA 3TOAA 3F6VA 1BN5A 3MQ0A 2COMA 1KQ9A 1TNTA 1T39A 4OIRF 5LEKA 4M74A 4D0PA 3HUGA 1FBSA 3TO7A 2EJRA 3FMRA 5DCMB 1YW9A 4HF1A 1O3RA 5HLIA 2CYYA 1UB9A 1LEAA 4WWCA 2MD5A 2DO7A 1K7AA 2MC3A 4EVIA 3BJ6A 2OBPA 3BJOA 3S2WA 1BI1A 3BY6A 2L01A 1YTYA 1USTA 2ISZA 4L0ZB 1ZRFA 2VE8A 3E5UA 5LGNA 2V9VA 4LJZF 5CVJA 1OYWA 3CO7C 4LK1F 3E5XA 1DPRA 1YO5C 2M8EA 3I5UA 2DBBA 3WODF 2CW0F 4I01A 3TGNA 1KQ0A 1JHHA 3IHUA 3KP4A 3E97A 3EDPA 2ZCWA 2XV4S 3V7CA 2ACJA 1EV7A 2NS0A 1X3UA 4ZYEA 4N0BA 4I2OA 2P5KA 2VE9A 1Z6TA 2M30A 1IF1A 3ZMDA 4ZYHA 1ON1A 5DV5A 4FX0A 1U8RA 1G3WA 4ASNA 1O3QA 3QPHA 5TJJA 4K2EA 3JSPA 1TW2A 3WGIA 4BHBA 1FP1D 5FO5A 4HYEA 1J9IA 3ZMSA 1T0FA 4CHUA 3WG9A 4WXDA 1U78A 3EYIA 3KLOA 1LQ1A 1D5VA 3L9FA 3IWZA 1O7FA 3GXOA 3JTHA 1SD6A 1IW7F 3ZMVA 2O03A 1HSJA 1EH6A 3P7NA 1XB4A 3Q5FA 4MEYF 1IN8A 3LA7A 2MA3A 1O3SA 3KEOA 5IT3A 3O6BB 2L4MA 3MCZA 4IF4A 2MBFA 3KETA 4OIOF 2WC2A 4PGGA 2D2WA 4IRHA 3CDHA 1ON2A 1S3JA 4MEXF 2CO5A 2ESHA 4I0AA 4RB0A 4OOIA 4HLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK8 A;  5LHH A;  3GWZ A;  1O57 A;  2UXX A;  5ICG A;  5LGU A;  2W57 A;  2HYG D;  1S7A A;  2MH2 A;  4HOB A;  4G7O F;  5K5O A;  2FNA A;  3ROU A;  2HKX A;  3HHH A;  2DT5 A;  4GO1 A;  4HX8 A;  4KYW A;  2X4H A;  3ABT A;  2VBZ A;  2JPC A;  1R1U A;  4UVA A;  3TOB A;  1B4A A;  3MFK A;  4L9T A;  4AIH A;  5L3E A;  2PI0 A;  2QQA A;  4LFU A;  5BQT A;  1W7P D;  3NRV A;  3CTA A;  2FMY A;  2IA1 A;  3HSF A;  3CUQ C;  5K5Q A;  4O6J A;  5E1Z B;  1IN6 A;  2EFP A;  4YFN F;  1OPC A;  1F5T A;  5EEG A;  2DPU A;  1T6S A;  4U7D A;  2BYV E;  5H20 A;  3DP7 A;  4GGG A;  1B59 A;  4RB3 C;  3GZ5 A;  2GIV A;  4RGU A;  4EM0 B;  4MTD A;  3T5X A;  1KA8 A;  4AIJ A;  3I53 A;  1PDN C;  5FGM A;  5J8F A;  3G73 A;  3DKW A;  3K1M A;  5F6F A;  1Z91 A;  3V8J A;  3WTV C;  1JGS A;  5D5W B;  2NNN A;  2YSR A;  2HTJ A;  4UUV A;  3F8M A;  1W5T A;  4IXA A;  2FBK A;  2CFX A;  2GA2 A;  2H6C A;  2KJB A;  4CGZ A;  1G3T A;  2QQB A;  3F23 A;  4RS8 A;  2PQ8 A;  2LSO A;  4JK1 X;  3O3K A;  1R5H A;  4XLN F;  5E8I A;  4QWQ A;  4WX9 A;  5FFZ A;  3J81 K;  4KFC A;  5CJ9 A;  4Y15 A;  2Z5U A;  1SAX A;  5H6Q A;  1K79 A;  1HXD A;  3IKT A;  2QUF A;  2IT0 A;  5D5V B;  5HDN A;  1FPQ A;  2ZME A;  1F9N A;  1P4A A;  4HX4 A;  5BOX A;  2WTE A;  1WRJ A;  3HIF A;  2KJC A;  3F22 A;  3P9I A;  2Y0M A;  2GWR A;  1YQA A;  4IRG A;  1BI0 A;  5D6F A;  4WK8 F;  2P7V B;  4A2U A;  1YS6 A;  2GZW A;  1R1V A;  1YLF A;  3BPV A;  2EK5 A;  5L3C A;  3F8N A;  4KIG A;  3AAF A;  2FXA A;  2EFW A;  1IRF A;  4XRF A;  2R7D A;  3WE3 A;  2F5E A;  3DPL C;  3FXU A;  3CUO A;  3HHG A;  3MZY A;  1XD7 A;  2BGC A;  2FEZ A;  1I5Z A;  2KIF A;  4RB1 A;  1FNN A;  1ZLK A;  2W84 A;  5IT9 K;  3L2C A;  1SD4 A;  3NQO A;  5D5X B;  1ZRD A;  4GXO A;  2O8X A;  3QAH A;  1WSU A;  4P5O A;  4QLC U;  2ZFW A;  3FMS A;  2Z9O A;  4HBL A;  1STZ A;  3FX3 A;  3J81 Z;  2L54 A;  3DFG A;  4N9I A;  1YW8 A;  2XHK A;  3I59 B;  4HW0 A;  3KE2 A;  3ZN0 A;  2PEX A;  1HKQ A;  2OD5 A;  3HYI A;  2HQN A;  3ML6 A;  2P6S A;  2RGV A;  2XIG A;  3EQL F;  1SFX A;  2QBY A;  5ERI A;  4UVC A;  2HWV A;  2XUB A;  5L3F A;  1IN7 A;  5A2Q K;  1RZ4 A;  1FBQ A;  3KP6 A;  4TV7 A;  4A12 A;  4IHS A;  2P6T A;  1EH7 A;  2ZBK A;  2FA5 A;  2FE3 A;  2FF4 A;  4ETS A;  2DI3 A;  5LBQ A;  1R58 A;  1LEB A;  2BV6 A;  5HDG A;  4KUM A;  5F64 A;  4EJU A;  3T0Y A;  3GYH X;  2V1D A;  3M9A A;  4F7Z A;  3PQK A;  4KIC A;  1FYK A;  1QBJ A;  1HW2 A;  1XDS A;  1ZLJ A;  2EFQ A;  2OU2 A;  1S8N A;  1Y0U A;  3FM3 A;  1MJA A;  2H94 A;  2DFI A;  1MZB A;  3KZY A;  2HQR A;  4LGW A;  4U0V A;  3RI4 A;  1H9T A;  1DPU A;  5D8K B;  1IAW A;  5LLQ A;  4OIN F;  4NHJ A;  3O2P E;  2OQR A;  2VXZ A;  2EA4 A;  5AIQ A;  4LD5 A;  1LDK B;  2BEO A;  4HA8 A;  3PQJ A;  1TQM A;  3LA2 A;  5DD4 A;  2O0Y A;  2PFB A;  3GUD A;  1S7O A;  4UHT A;  1SD5 A;  3HRM A;  3BJA A;  2A3S A;  1LDJ A;  5AON A;  2PMU A;  1AWC A;  5BPI A;  3RYP A;  5D4S A;  5HLG A;  1TLH B;  3DEU A;  3BPX A;  4N9H A;  2GXG A;  2QQ9 A;  2K27 A;  2DW4 A;  1KU9 A;  1BJA A;  2DQR A;  2XAJ A;  1MJB A;  5DYM A;  1IZ1 A;  4YFK F;  1RUN A;  4M72 A;  5BS6 A;  4ENJ A;  2JT1 A;  1CGP A;  2P8T A;  2QLZ A;  1XSV A;  5E8G A;  3T8T A;  4MNU A;  5CLS A;  2L4A A;  2VBY A;  3OV8 A;  2EFO A;  3ZMT A;  4P9F A;  3R4K A;  3WTS C;  3KP5 A;  4BAY A;  2DK5 A;  5BMZ A;  2W25 A;  1JXS A;  2RDP A;  5D8L B;  2DLL A;  1I27 A;  4ENN A;  3QRF F;  1I6X A;  3RPU A;  2KKO A;  4WCG A;  5E1W A;  2HGC A;  4LLN A;  2ZNZ A;  3D0S A;  1K78 A;  1FSE A;  2JSC A;  2W85 A;  2EV0 A;  5ICC A;  2STW A;  4OMY A;  5JR3 A;  4CO8 A;  2E1N A;  1MD0 A;  4A0X A;  4HDV A;  2F5D A;  4AVP A;  3KP2 A;  2A69 F;  1P2F A;  1VTN C;  1B9M A;  3GZ6 A;  1LVA A;  2MLK A;  5FLX K;  1LNW A;  2Q8K A;  2V6C A;  4JQF A;  3RPQ A;  3ISP A;  1MDM B;  2GAU A;  3SHF A;  4MGR A;  2LF8 A;  2RNJ A;  2RV8 A;  4AWX B;  2DTR A;  3ECH A;  1XN7 A;  4XBF A;  5E1X A;  1MKM A;  1WKM A;  1Z7U A;  4H0E A;  3KEQ A;  3E5Q A;  2NAZ A;  3R6S A;  2O6G E;  3K0L A;  2EV5 A;  1XMK A;  5FB2 A;  2VOO A;  2QBY B;  2DQL A;  3E6D A;  1DDN A;  1Z9C A;  4I02 A;  1G4D A;  4YFX F;  1EH8 A;  1G3Y A;  3IC7 A;  2OA4 A;  1GVJ A;  1XCV A;  2VC0 A;  3GEZ A;  4YIF A;  3Q9S A;  4IRI A;  3J7A O;  5FLX Z;  3J80 Z;  1FP2 A;  2IJL A;  1ODD A;  4XSX F;  4M6X A;  4LG0 B;  5D5U B;  1Q1H A;  3FHZ A;  1OR7 A;  2IW5 A;  1ZGJ A;  1J5Y A;  5ED4 A;  5DD8 A;  1R22 A;  1JHF A;  1QZZ A;  3MWM A;  2MH9 A;  4YG2 F;  1HW1 A;  1TW3 A;  2XKO A;  4DNC A;  4EMS A;  4PGH A;  3FMQ A;  1BOA A;  1OKR A;  2G9W A;  3DQV C;  4YII A;  4L5I A;  2HDC A;  3C18 A;  2MLG A;  2ESN A;  4O3M A;  3SXY A;  2PMH A;  2NYX A;  4I98 B;  3M7G A;  1QO0 D;  1QZY A;  5CVI A;  5DCF A;  2PLY A;  3KLN A;  1J75 A;  2IPQ X;  2YX7 A;  1ZG5 A;  3DPT A;  2QWW A;  3I64 A;  1UHM A;  4RGS A;  5ICF A;  3GFI A;  3R0A A;  1USS A;  2YU3 A;  4G6D A;  4G7Z F;  1W4M A;  2F2E A;  2HOE A;  2HKO A;  3K9T A;  2BBY A;  1P92 A;  3P9C A;  1MDM A;  2RVC A;  5JVT A;  2Z3Y A;  4BXU A;  1R36 A;  1GXP A;  2O3F A;  4LLL A;  2OAZ A;  4HF0 A;  5EEH A;  1KYW A;  3P9K A;  3WTZ A;  2EA2 A;  1XGS A;  2HEO A;  3F8B A;  3VB2 A;  2F5F A;  3LQR A;  3RKW A;  2OZ6 A;  4ESJ A;  2LF7 A;  3QPT A;  2ZXJ A;  5CVR A;  3R60 A;  1Z6R A;  1FYL A;  1XDU A;  1ZHF A;  4IHT A;  1ZG3 A;  1D8J A;  2HTS A;  3F8C A;  4XLP F;  5HS9 A;  3TO6 A;  3RYR A;  5E17 F;  4HV6 A;  1K6O A;  5K5R A;  3FXR A;  1S6L A;  3B73 A;  2NNY A;  4ZYD A;  3ZN1 A;  1XCB A;  1YS7 A;  1DUX C;  4LG0 A;  1YW7 A;  2LKP A;  1U5T B;  5DUI A;  4I7H A;  2O61 A;  1Z05 A;  2H6B A;  1KU2 A;  3MAJ A;  2P5V A;  1F4K A;  1R7J A;  3C7J A;  5E18 F;  2VBX A;  3I0T A;  3I59 A;  4CIC A;  4WXC A;  2V1X A;  2H09 A;  3F3X A;  3OOP A;  4KN4 X;  1T98 A;  4U0Y A;  3CO6 C;  5AIP A;  2FQ3 A;  3JAM Z;  2XKP A;  4A5N A;  2XAF A;  1MJ9 A;  4ENK A;  4OIQ F;  3BRO A;  4DQ2 A;  2GXB A;  3FF5 A;  5DCM A;  1QQI A;  2VOD A;  4ENM A;  5KK1 A;  5L3B A;  2Q2E A;  3KFW X;  1IXR C;  2HFH A;  1Z1D A;  3I4P A;  3IL2 A;  3TDZ C;  2QVO A;  1R1T A;  3WTX C;  1WWX A;  5D4R A;  2IVM A;  4S05 A;  3RKX A;  3WGH A;  2J5O A;  4A0Z A;  2STT A;  1MGT A;  1S29 A;  3CUQ A;  2FBI A;  2R7F A;  2Y48 A;  2GA1 A;  3ZP5 A;  3F21 A;  3N97 A;  3FXQ A;  3KZZ A;  3E6B A;  2K4B A;  4HX7 A;  4Y13 A;  4Q4Z F;  3GVA A;  4L9V A;  2A07 F;  1OMI A;  1E17 A;  3V7R A;  3TKY A;  1FC3 A;  3L09 A;  4MQV A;  2Y75 A;  3ABU A;  3L00 A;  2CGP A;  4KMF A;  4I09 A;  2PJP A;  3V8L A;  3EYY A;  4UV8 A;  4RGR A;  4Q5S F;  3SZT A;  1QPM A;  4R1H A;  2WV0 A;  4KIB A;  2UXN A;  2IRF G;  1FSH A;  3FM5 A;  1GHC A;  4MQ9 F;  1U5T A;  1IRG A;  2HS5 A;  3C3W A;  4FT8 A;  2D45 A;  4AD9 A;  1F1Z A;  5ICE A;  4HV5 A;  2B0L A;  3BWG A;  3H92 A;  3GFJ A;  3PFI A;  1UCR A;  2X0L A;  5K1Y A;  4WF2 A;  3ZPL A;  2EB7 A;  3QP5 A;  2V79 A;  3CJN A;  3M8E A;  3ULQ B;  1BC8 C;  4M71 A;  2ISY A;  4IVN A;  2EFN A;  3HTS B;  2QEN A;  4L0Y B;  2YX4 A;  1IXC A;  2PN6 A;  2M5W A;  4JBA A;  5LHG A;  1O3T A;  4G7H F;  5ILS A;  3G3Z A;  1XGO A;  1I1G A;  4UV9 A;  4L5J A;  4O5V A;  2E7W A;  6PAX A;  3LAJ A;  4LK0 F;  3D5L A;  4KT5 C;  4I0B A;  2KIU A;  2P4W A;  2KIM A;  2XGX A;  3RDI A;  5KVR A;  1HQC A;  5HLH A;  2FOK A;  2XAS A;  2K4J A;  2QZ8 A;  5L3D A;  1XMA A;  1ZYR F;  2D1V A;  2CWE A;  2M45 A;  3J80 K;  4EJT A;  1OYI A;  2P5L C;  2A5Y B;  3BZ6 A;  3VOE A;  4BNC A;  2CQK A;  3RTR A;  1P4W A;  4PDK A;  5JFR A;  4KNY A;  2LNB A;  4L18 B;  1ULY A;  3V4G A;  1U6G A;  5LEJ A;  5TRD A;  2AXL A;  3K69 A;  2G7H A;  5LRS A;  1U2W A;  3I58 A;  4LB5 A;  1E2X A;  1T2K A;  4GCV A;  3TQN A;  4ZYG A;  4EM1 A;  3E6M A;  1D8K A;  2W24 A;  3T1B A;  1ZN2 A;  3CLO A;  3HRS A;  1TTY A;  3WGG A;  1SD7 A;  2XAQ A;  2L3D A;  3BDD A;  4RAY A;  1OYY A;  2A6E F;  1RIO H;  5DDG A;  4A0Y A;  1FOK A;  1B1B A;  3HSE A;  2RN7 A;  1CF7 B;  4LB6 B;  3ZQ7 A;  3CUQ B;  3MEX A;  1R23 A;  1O7L A;  2EV6 A;  2VOP A;  1UHW A;  3K1P A;  2K7L A;  3U2R A;  4AIK A;  5HS8 A;  3FZV A;  4MHG A;  1BC7 C;  1XGN A;  3I54 A;  3WE2 A;  3JTG A;  3K2Z A;  4BHP A;  4R8H A;  3WU1 B;  5F1R A;  1HST A;  2A68 F;  5HVQ C;  4EJO A;  3F72 A;  1FT9 A;  5FFX A;  3H3Z A;  1XGM A;  5A2Q Z;  1IUY A;  3HSR A;  1J0R A;  4ZZD A;  4M6Y A;  2Z33 A;  3W6J B;  4EV0 A;  2PG4 A;  2WWY A;  5D6E A;  4BYY A;  3IWF A;  3LA3 A;  2ZME B;  2DU9 A;  3VOD A;  3QOP A;  5L3G A;  2IA0 A;  2VN2 A;  3ZMU A;  3IRR A;  2XAG A;  5J6X A;  3JSO A;  3L7W A;  1IN5 A;  2E1C A;  2HR3 A;  1BI2 A;  2BE5 F;  2F5C A;  1BIB A;  1HBX G;  3WTU C;  4CZZ A;  5CVU A;  3SZP A;  1BI3 A;  2ADU A;  2TDX A;  1KGS A;  2QYO A;  5JHU A;  4EGZ A;  1TQP A;  3GX4 X;  1J59 A;  3R61 A;  1HKS A;  4G94 A;  4HZF A;  2ETH A;  3QU3 A;  4G6Q A;  4UXN A;  1W7P B;  3KP3 A;  3E3V A;  3RIR A;  1T38 A;  5HOO A;  3T8R A;  3GO5 A;  2ELH A;  4KDP A;  3C1D A;  2OZU A;  4HAM A;  5BPD A;  1FY7 A;  3QU6 A;  1REP C;  4HDU A;  2C6Y A;  3TDU C;  1LJ9 A;  1RUO A;  1SFU A;  1LB2 A;  4XSZ F;  2K86 A;  4ZH4 F;  3VFZ A;  1KYZ A;  4FHT A;  4CXF A;  1ZRC A;  3M8F A;  3EUH A;  1WI9 A;  1ZAO A;  4G8X A;  1PP7 U;  4EJW A;  3LFK A;  1HW5 A;  4M73 A;  3DXJ F;  1L0O C;  2FBH A;  4S04 A;  1YG2 A;  4KIF A;  4UVB A;  4IPA A;  2M1B A;  5DEQ A;  2PBI A;  3ELK A;  3B02 A;  1A04 A;  3F8F A;  3H3U A;  1G3S A;  3BOQ A;  4IJA A;  1IN4 A;  1SMT A;  4KN7 X;  1ZAR A;  2RQP A;  1UFM A;  1AOY A;  2V1U A;  2XVC A;  4LMY A;  2HYF A;  1LDD A;  1PP8 F;  3GFL A;  1TNS A;  3U9G A;  5H6R A;  1P6R A;  2JZY A;  1L3L A;  3IKV A;  1KQ8 A;  3HTU A;  3DV8 A;  2FRH A;  5ILV A;  4U7B A;  3DF8 A;  4HLY A;  2R3S A;  1ZGA A;  3KP7 A;  2A61 A;  2K02 A;  1BM9 A;  1U5T C;  4ESB A;  1K78 B;  4EGY A;  1H0M A;  2P7C B;  2ZO4 A;  3N4M A;  1QGP A;  1HKT A;  1RI7 A;  1GXQ A;  1XSD A;  1P4X A;  4OMZ A;  3SQN A;  1W7P A;  1KU7 A;  2JTV A;  4Y17 A;  5E20 A;  1TQI A;  1R00 A;  1ONV A;  1U3E M;  5LGT A;  1XSX A;  3BP8 A;  3EET A;  3V8K A;  4B8X A;  2EWN A;  1JE8 A;  3I71 A;  1FZP B;  1TBX A;  1ZH5 A;  4M9S A;  1IXS B;  1G6N A;  4A6E A;  3GW2 A;  4Q48 A;  5HDK A;  4U0W A;  2NRA C;  2D1H A;  4L9J A;  3TO9 A;  2QM3 A;  4BHC A;  3KCC A;  4B09 A;  3E6C C;  3LAP A;  2FU4 A;  4RB2 C;  1FYM A;  1YIO A;  2VON A;  5CVV A;  1D3Y A;  4R79 A;  1FX7 A;  3VEP A;  2UWM A;  5HS7 A;  2DAO A;  3WU0 A;  5FD5 A;  1B9N A;  4ON0 A;  2G7U A;  2J5P A;  2FML A;  2ZJ2 A;  3R0J A;  2JRT A;  4EJV A;  1B6A A;  3LQQ A;  2OQG A;  4G9Y A;  2VC1 A;  2Z99 A;  2Q0O A;  2XRO A;  1FLI A;  2XAH A;  3GLX A;  2IA2 A;  3JAM K;  4GYI A;  2JPB A;  4HQE A;  4PZJ A;  2IP2 A;  1QNT A;  2FNP A;  4WXH A;  1DP7 P;  5LRR A;  1KU3 A;  1NHA A;  4KMU X;  3U1D A;  4EM2 A;  4M9X A;  4OU0 A;  4BH9 A;  4ZZL A;  3QP6 A;  3RJP A;  1FWZ A;  4NQW A;  3K1N A;  2FSW A;  4A6D A;  3MZH A;  4GYG A;  2A6H F;  4OIP F;  2YPR A;  3HRT A;  2DPD A;  3LST A;  4EQQ A;  1BIA A;  1FBU A;  2RC4 A;  1H9G A;  1ZG1 A;  4LLG F;  3Q9V A;  4CDG A;  1J7K A;  4RAZ A;  2VT2 A;  3IRQ A;  5FD6 A;  1WQ2 A;  3REO A;  1V3F A;  3GFM A;  4FX4 A;  1I1S A;  4HQM A;  2E7X A;  2LDU A;  4P9U A;  3COA C;  1C0W A;  2ZKZ A;  1V4R A;  3ERE D;  4HF2 A;  3ECO A;  3HOT A;  1SMY F;  4NB5 A;  4KA4 A;  4PCQ A;  2M87 A;  2GQQ A;  4A5M A;  3WTT C;  5LHI A;  2XRN A;  5DUK A;  2ZNY A;  5ILU A;  1PUE E;  5CYV A;  3HRU A;  1SFE A;  1CF7 A;  3NEU A;  4M9Z A;  2H27 A;  1RNL A;  1BBY A;  2HZT A;  2L02 A;  1ZRE A;  3SFZ A;  3M1E A;  2KRF A;  3ZMZ A;  4U88 A;  4P55 A;  4Q47 A;  4E70 A;  2UZK A;  1J2X A;  3HOS A;  1W5S A;  3GF2 A;  4L9N A;  4BQA A;  2AS5 F;  2RKH A;  3WTW C;  4RGX A;  2VT3 A;  3JW4 A;  2VBW A;  3LWF A;  4MTE A;  3W6K B;  3V7S A;  3F6O A;  5JI6 A;  1YYV A;  4ESF A;  2CG4 A;  4P96 A;  2CSO A;  2YR2 A;  4Z2Y A;  5IT9 Z;  5J8C A;  3WTY C;  1YFH A;  3FWE A;  4CYD A;  4UNO A;  3RKY A;  1R5G A;  3TOA A;  3F6V A;  1BN5 A;  3MQ0 A;  2COM A;  1KQ9 A;  1TNT A;  1T39 A;  4OIR F;  5LEK A;  4M74 A;  4D0P A;  3HUG A;  1FBS A;  3TO7 A;  2EJR A;  3FMR A;  5DCM B;  1YW9 A;  4HF1 A;  1O3R A;  5HLI A;  2CYY A;  1UB9 A;  1LEA A;  4WWC A;  2MD5 A;  2DO7 A;  1K7A A;  2MC3 A;  4EVI A;  3BJ6 A;  2OBP A;  3BJO A;  3S2W A;  1BI1 A;  3BY6 A;  2L01 A;  1YTY A;  1UST A;  2ISZ A;  4L0Z B;  1ZRF A;  2VE8 A;  3E5U A;  5LGN A;  2V9V A;  4LJZ F;  5CVJ A;  1OYW A;  3CO7 C;  4LK1 F;  3E5X A;  1DPR A;  1YO5 C;  2M8E A;  3I5U A;  2DBB A;  3WOD F;  2CW0 F;  4I01 A;  3TGN A;  1KQ0 A;  1JHH A;  3IHU A;  3KP4 A;  3E97 A;  3EDP A;  2ZCW A;  2XV4 S;  3V7C A;  2ACJ A;  1EV7 A;  2NS0 A;  1X3U A;  4ZYE A;  4N0B A;  4I2O A;  2P5K A;  2VE9 A;  1Z6T A;  2M30 A;  1IF1 A;  3ZMD A;  4ZYH A;  1ON1 A;  5DV5 A;  4FX0 A;  1U8R A;  1G3W A;  4ASN A;  1O3Q A;  3QPH A;  5TJJ A;  4K2E A;  3JSP A;  1TW2 A;  3WGI A;  4BHB A;  1FP1 D;  5FO5 A;  4HYE A;  1J9I A;  3ZMS A;  1T0F A;  4CHU A;  3WG9 A;  4WXD A;  1U78 A;  3EYI A;  3KLO A;  1LQ1 A;  1D5V A;  3L9F A;  3IWZ A;  1O7F A;  3GXO A;  3JTH A;  1SD6 A;  1IW7 F;  3ZMV A;  2O03 A;  1HSJ A;  1EH6 A;  3P7N A;  1XB4 A;  3Q5F A;  4MEY F;  1IN8 A;  3LA7 A;  2MA3 A;  1O3S A;  3KEO A;  5IT3 A;  3O6B B;  2L4M A;  3MCZ A;  4IF4 A;  2MBF A;  3KET A;  4OIO F;  2WC2 A;  4PGG A;  2D2W A;  4IRH A;  3CDH A;  1ON2 A;  1S3J A;  4MEX F;  2CO5 A;  2ESH A;  4I0A A;  4RB0 A;  4OOI A;  4HLX A; 
#chains in the Genus database with same CATH topology
 2DK8 A;  4UB8 C;  2AQF A;  5LHH A;  3GWZ A;  3BTL A;  3QOE A;  1O57 A;  1PYV A;  2UXX A;  5ICG A;  5LGU A;  2W57 A;  2HYG D;  1S7A A;  2MH2 A;  4BQQ A;  2KT0 A;  3PO2 J;  1VND A;  4HOB A;  4MIM A;  4G7O F;  5K5O A;  2FNA A;  5F1J A;  1A6Q A;  1MMN A;  3ROU A;  2WAQ N;  2DJN A;  2HKX A;  2VUM J;  5GPC A;  3HHH A;  4E7H A;  1WJF A;  2DT5 A;  4GO1 A;  4PFP A;  4HX8 A;  1ZQ3 P;  3OY9 A;  4KYW A;  2X4H A;  3IAM 2;  2HDD A;  2HVS A;  3ABT A;  2VBZ A;  3A01 B;  2JPC A;  3GTJ J;  1R1U A;  1YJ9 I;  4UVA A;  3ESW B;  3AFH A;  3FHN A;  3TOB A;  1FOW A;  1B4A A;  3MFK A;  4L9T A;  3L2Q A;  2GBY A;  4AIH A;  5L3E A;  2PI0 A;  2QQA A;  5IOY A;  2AXT C;  1BOB A;  1OCC H;  4LFU A;  5BQT A;  2QQ8 A;  1W7P D;  3NRV A;  3OYF A;  1MBK A;  2M3A A;  4RLF A;  4E7K A;  3CTA A;  1Y1V J;  2FMY A;  2IA1 A;  2R7R A;  1VQ5 I;  3HSF A;  3CUQ C;  5K5Q A;  4O6J A;  5E1Z B;  5F08 A;  1IN6 A;  1MH4 A;  2A6T A;  2DMT A;  2Q1Z B;  4XR6 A;  2ZC2 A;  2EFP A;  4YFN F;  1OPC A;  1F5T A;  3ZRG A;  5EEG A;  2DPU A;  1T6S A;  4U7D A;  4HST A;  2BYV E;  4HNT A;  2Y0S N;  5H20 A;  5IYC J;  3HOW J;  2K5C A;  2V9K A;  3DWL E;  3VYT B;  3DP7 A;  4GGG A;  1B59 A;  3Q3S A;  2E35 A;  4RB3 C;  2M8G X;  3GZ5 A;  5M5X J;  5IY5 H;  2GIV A;  2DYR H;  1N25 A;  3FDY A;  4RGU A;  4EM0 B;  2GLO A;  4MTD A;  3T5X A;  3UNG C;  1KA8 A;  2DFH A;  2K9N A;  3CP2 A;  3OYA A;  4AIJ A;  3I53 A;  3QOD A;  4XON A;  3Q0V A;  1PDN C;  3CZ6 A;  5FGM A;  4MFD A;  4LG3 A;  5J8F A;  2DCE A;  3G73 A;  3ABL H;  2WAF A;  2VKV A;  4YIR X;  3DKW A;  3K1M A;  3TED A;  4LIU A;  5F6F A;  1Z91 A;  3V8J A;  3B6A A;  3WTV C;  4YRV A;  1JGS A;  5D5W B;  3S93 A;  3MZ8 A;  2DFF A;  2NNN A;  1U0J A;  3IH3 A;  2YSR A;  2MD0 A;  4MFE A;  2HTJ A;  1IG7 A;  4UUV A;  3DBH B;  4ZTF A;  3X2Q H;  3F8M A;  3HUG B;  3HOZ J;  2EZI A;  1W5T A;  4IXA A;  4RBO A;  2FBK A;  4BEH A;  1IUF A;  2CFX A;  2GA2 A;  2H6C A;  4FET A;  2KJB A;  4CGZ A;  1G3T A;  4M3F A;  1T33 A;  3ZOB A;  2QQB A;  2ZXW H;  2E34 A;  1Y8R B;  4G6T B;  5B1A H;  4X0G A;  3F23 A;  3S16 J;  4RS8 A;  2PQ8 A;  1UEL B;  3J7Y J;  2LSO A;  4JK1 X;  3O3K A;  1R5H A;  4XLN F;  5E8I A;  2A05 A;  4QWQ A;  4AVZ A;  2F48 A;  4A3I J;  2CUZ A;  4WX9 A;  5FFZ A;  3E1S A;  4XIC A;  2ELK A;  1MW7 A;  5FRO A;  4CCK A;  2DOE A;  2MSY A;  3J81 K;  2K9L A;  2VPL A;  1WJ5 A;  3WU2 C;  4KFC A;  3OIP A;  4KT6 A;  3GZN B;  5CJ9 A;  1KZH A;  4Y15 A;  4QPQ A;  2Z5U A;  1SAX A;  5H6Q A;  1K79 A;  1W36 C;  1HXD A;  3BR3 A;  3IKT A;  2QUF A;  3CCJ I;  3JRI A;  1EF4 A;  2IT0 A;  3A01 A;  5D5V B;  5HDN A;  1FPQ A;  2ZME A;  1F9N A;  1P4A A;  1G59 A;  4HX4 A;  1ACI A;  5BOX A;  1JI8 A;  2JK3 A;  4CH7 A;  2WTE A;  3S2H J;  1WRJ A;  3HIF A;  4C3J J;  1VF9 A;  2KJC A;  3F22 A;  3P9I A;  2KMU A;  2Y0M A;  2GWR A;  1YQA A;  4IRG A;  3LL7 A;  1BI0 A;  5D6F A;  2HNH A;  4IKF A;  3RZO J;  4WK8 F;  2P7V B;  4A2U A;  1YS6 A;  5KNL A;  3TMO A;  2GZW A;  1W5C C;  3PO3 J;  1R1V A;  2XC7 A;  1YLF A;  3FXM A;  3BPV A;  4FQG A;  2KZV A;  2H8W A;  2EK5 A;  4FTH A;  5L3C A;  1OR7 C;  1K6Y A;  2DOD A;  3F8N A;  4KIG A;  4RLQ A;  1ZTR A;  1AHD P;  3AAF A;  5JLW A;  2FXA A;  4BJ6 C;  3BG6 A;  2M0M A;  5EZH A;  5FKM A;  3JRH A;  1IRF A;  4XRF A;  2EFW A;  2R7D A;  2YS9 A;  3FXK A;  3WE3 A;  3HGY A;  3LSK A;  2F5E A;  2E5N A;  3DPL C;  3FXU A;  1BJZ A;  3CUO A;  1TWG J;  4PJJ A;  3HHG A;  3MZY A;  1DQU A;  1XD7 A;  2BGC A;  2FEZ A;  1QRY A;  3DBL B;  1I5Z A;  1X4P A;  2K85 A;  2KIF A;  4RB1 A;  2VJ5 A;  3QYB A;  3O8G A;  3OIO A;  1FNN A;  2W82 A;  1ZLK A;  2W84 A;  5IPA A;  5IT9 K;  3L2C A;  1SD4 A;  3NQO A;  1ORK A;  2VL8 A;  1N75 A;  3BG3 A;  5D5X B;  1ZRD A;  2JA6 J;  2QCO A;  4GXO A;  3H3V K;  1I39 A;  2O8X A;  3ABK H;  3QAH A;  3BR2 A;  1WSU A;  4A3C J;  4P5O A;  3KPH A;  5JVG F;  4QLC U;  2ZFW A;  3FMS A;  1Y39 A;  2EIK H;  2Z9O A;  2QSH X;  4HBL A;  1STZ A;  3JRG A;  3CCS I;  3FX3 A;  3J81 Z;  3BT9 A;  2XF6 A;  1XG1 A;  3BCB A;  2L54 A;  3DFG A;  4N9I A;  4XK4 A;  1YJN I;  3CC7 I;  1YW8 A;  2XHK A;  2TCT A;  3DKY A;  3I59 B;  4HW0 A;  3KE2 A;  3ZN0 A;  2OTJ I;  2PEX A;  1HKQ A;  1TC3 C;  1WH7 A;  1OCO H;  2OD5 A;  3HYI A;  1VQP I;  2IS2 A;  3U1K A;  1DP3 A;  2HQN A;  3ML6 A;  3OOU A;  2P6S A;  2RGV A;  2XIG A;  3EQL F;  4XKV A;  1SFX A;  2QBY A;  2CFO A;  5ERI A;  1SC7 A;  3AG2 H;  1ZGW A;  2WAD A;  4UVC A;  1IO2 A;  3H9Q A;  3HG9 A;  1S72 I;  3LSG A;  2CRG A;  1X1B A;  2FQ4 A;  1ETV A;  2HWV A;  2XUB A;  5L3F A;  4DYR A;  1IN7 A;  5A2Q K;  1W1W E;  1RZ4 A;  1I50 J;  1FBQ A;  3KP6 A;  3HBL A;  4TV7 A;  4ZYA A;  4A12 A;  1ZR2 A;  2EBI A;  1PUF A;  4IHS A;  2P6T A;  1EH7 A;  2ZBK A;  2FA5 A;  2FE3 A;  2FF4 A;  2KPM A;  5JLX A;  4ETS A;  2DI3 A;  1MH3 A;  5LBQ A;  5H2F C;  2R92 J;  1R58 A;  1LEB A;  2LR8 A;  3CMA I;  2BV6 A;  3DTI A;  5HDG A;  4KUM A;  5F64 A;  2M7B A;  3T0Y A;  4EJU A;  3GYH X;  2V1D A;  3M9A A;  4F7Z A;  3PQK A;  4KIC A;  2ZFU A;  3L2V A;  1E3P A;  1FYK A;  4ZJZ A;  1QBJ A;  2XAU A;  1HW2 A;  1XDS A;  1ZLJ A;  2EFQ A;  2OU2 A;  1S8N A;  5B5E C;  2PJR B;  1Y0U A;  1VQ4 I;  3FM3 A;  1MJA A;  2H94 A;  2DFI A;  3U21 A;  1JTX A;  3CCR I;  1MZB A;  3KZY A;  5EYR A;  2HQR A;  1ETO A;  4LGW A;  5FRN A;  1DU0 A;  5B66 C;  2YU9 J;  2OF7 A;  1D0Y A;  4U0V A;  3RI4 A;  1H9T A;  1DPU A;  4XLE A;  3DPU A;  3G1L A;  4CYC B;  5D8K B;  1IAW A;  3F0C A;  3H5R A;  5LLQ A;  4OIN F;  2M0C A;  5EGO B;  4NHJ A;  3O2P E;  2R7S A;  2OQR A;  2VXZ A;  4AID A;  2EA4 A;  3DTK A;  5AIQ A;  4IX7 A;  4LD5 A;  1LDK B;  2BEO A;  3IP4 B;  3PM1 A;  4HA8 A;  2CW7 A;  3CDL A;  3PQJ A;  2LRD A;  2LFB A;  3PSI A;  1TQM A;  2FOW A;  2LLK A;  3G71 I;  3CCE I;  3LA2 A;  2Y9Z A;  3A02 A;  3H5A A;  5DD4 A;  2O0Y A;  1JGG A;  3GUD A;  2PFB A;  2NS7 A;  1RKT A;  4NC7 A;  4A3L J;  1S7O A;  3MKZ A;  1FTT A;  4UHT A;  3NWT A;  1SD5 A;  3HRM A;  3BJA A;  5J3L A;  2A3S A;  1LDJ A;  2ECB A;  3HPH A;  2R7O A;  5AON A;  2PMU A;  1VI0 A;  2L7Z A;  2PMZ A;  1AWC A;  5BPI A;  3A0H C;  3RYP A;  2XF7 A;  5D4S A;  5HLG A;  3GTO J;  1T0F C;  1TLH B;  2K3P A;  3BTJ A;  3BPX A;  3DEU A;  2JA2 A;  2KLO A;  4N9H A;  5IOZ A;  1OCP A;  4Z6Y A;  3G2B A;  2GXG A;  2QQ9 A;  2K27 A;  2DW4 A;  1KU9 A;  5FJ8 J;  1Z21 A;  1BJA A;  2CV0 A;  3OYN A;  1VQ9 I;  2DQR A;  2XAJ A;  3RSN A;  1MJB A;  3NWS A;  5DYM A;  2Y69 H;  1IZ1 A;  1JJ8 C;  4YFK F;  1RUN A;  4M72 A;  5BS6 A;  5J1R A;  3JRF A;  2JT1 A;  4ENJ A;  1CGP A;  1PVE A;  2P8T A;  2QLZ A;  1XSV A;  2L9S A;  5K7H A;  3CC4 I;  2CQ7 A;  5E8G A;  3T8T A;  4MNU A;  5CLS A;  2L4A A;  2HXI A;  2BW3 A;  2VBY A;  3OV8 A;  2EFO A;  3LMM A;  4F91 B;  3ZMT A;  4P9F A;  3OS0 A;  2QSG X;  3R4K A;  3WTS C;  3KP5 A;  4BAY A;  2DK5 A;  3ZQC A;  5BMZ A;  2W25 A;  3OSG A;  1R4N B;  4B44 A;  1JXS A;  2JVG A;  2RDP A;  2XGD A;  5D8L B;  3Q0U A;  5KHD A;  2X1E A;  3FXL A;  5C44 J;  1LPQ A;  2DLL A;  1I27 A;  4ENN A;  3QRF F;  1YRN A;  1I6X A;  3GTM J;  4BJ5 C;  1X2M A;  4Y4R A;  3RPU A;  1JKR C;  2KRH A;  2KKO A;  1QU3 A;  4WCG A;  2COB A;  3CLQ A;  5E1W A;  2HGC A;  4LLN A;  2XGC A;  2LC2 A;  4FCY A;  3ZXS A;  2ZNZ A;  3D0S A;  3DKX A;  1K78 A;  1FSE A;  2VXD A;  2JSC A;  2W85 A;  2EV0 A;  5ICC A;  4CCN A;  2STW A;  4OMY A;  3CD6 I;  5JR3 A;  4CCL A;  1OCZ H;  3FKJ A;  2R7W A;  1GDT A;  4RDU A;  5E79 C;  3W6V A;  4CO8 A;  2ICW G;  3OMY A;  2E1N A;  1MD0 A;  4A0X A;  1IV6 A;  3S8P A;  3CCQ I;  4HDV A;  2F5D A;  1TT0 A;  1YX3 A;  4AVP A;  3KP2 A;  1OCT C;  2A69 F;  1X1P A;  2E5Z A;  2X51 A;  1P2F A;  1BL0 A;  1VTN C;  1B9M A;  2X6O A;  5EG0 A;  2DXI A;  3LSP A;  3CMY A;  2HI3 A;  1LVA A;  3GZ6 A;  2MLK A;  5FLX K;  1LNW A;  5FLV A;  2Q8K A;  2V6C A;  2BY2 A;  4JQF A;  3TW6 A;  2JSP A;  1MBG A;  3H0D A;  2XF5 A;  3PUF A;  3RPQ A;  2HDW A;  3ISP A;  3HOU J;  4CCM A;  1MDM B;  2LY9 A;  3DU5 A;  2GAU A;  4II2 A;  3SHF A;  4MGR A;  3JRA A;  1HCR A;  2LF8 A;  2RNJ A;  4CZC A;  1XTA A;  2CUF A;  4II3 A;  2RV8 A;  4AWX B;  1Z3Y A;  2DMP A;  1MSE C;  1K61 A;  1X1A A;  2DTR A;  3ECH A;  4LIT A;  4E6K G;  1WFX A;  1XN7 A;  5E3M A;  1ETX A;  4XBF A;  5E1X A;  1MKM A;  1WKM A;  1Z7U A;  1FTZ A;  4H0E A;  1A6I A;  3KEQ A;  3E5Q A;  4NUB A;  2NAZ A;  3R6S A;  2O6G E;  3DU6 A;  3K0L A;  2EV5 A;  2MYS A;  1VZ0 A;  1XMK A;  5FB2 A;  2L7F P;  2VOO A;  2QBY B;  1P7I A;  1X3Z B;  5GTI C;  2WBM A;  3VPR A;  4B48 A;  4YEJ A;  1YIJ I;  1TWF J;  2DQL A;  3E6D A;  4A3E J;  1Z9C A;  1DDN A;  3K2A A;  4I02 A;  1FJL A;  1G4D A;  4YFX F;  1EH8 A;  1G3Y A;  3IC7 A;  4AM3 A;  2OA4 A;  1GVJ A;  1XCV A;  3GEZ A;  2VC0 A;  2H1K A;  3GTL J;  4YIF A;  3M8J A;  3Q9S A;  4XL9 A;  2IBD A;  4IRI A;  3J7A O;  2G0E A;  4I76 A;  2X6X A;  2F4I A;  4A3F J;  5FLX Z;  3J80 Z;  3ASO H;  2DTZ A;  1UG0 A;  1FP2 A;  3C2G A;  2IJL A;  2XB0 X;  2LBF B;  2HVQ A;  3LOC A;  1ODD A;  2ECC A;  1IV8 A;  3S2D J;  5EDN A;  3OL4 A;  4XLF A;  4XSX F;  4M6X A;  4LG0 B;  5D5U B;  1Q1H A;  2X85 A;  3OL3 A;  3H5N A;  3FHZ A;  1OR7 A;  2IW5 A;  1GV2 A;  1ZGJ A;  1AU7 A;  2HOT A;  5TIS C;  2IEK A;  1J5Y A;  5ED4 A;  5FLM J;  2VJJ A;  4KJZ A;  5DD8 A;  1R22 A;  1JHF A;  1QZZ A;  2DMQ A;  3M07 A;  3MWM A;  3LSJ A;  2R7Q A;  2VQH A;  4JYK A;  2N8G A;  2MH9 A;  4BDY A;  4YG2 F;  1HW1 A;  5EZG A;  1TW3 A;  2EIL H;  2XKO A;  2W4S A;  4B43 A;  4DNC A;  4EMS A;  3OYB A;  1VQ7 I;  2NOG A;  1QHG A;  2IGN A;  4PGH A;  3FMQ A;  1BOA A;  1OKR A;  2G9W A;  3DQV C;  4FE4 A;  4BE1 A;  3A03 A;  4X6A J;  4YII A;  4L5I A;  2HDC A;  3C18 A;  2MLG A;  2ESN A;  2JQ7 A;  4NC8 A;  3SXY A;  3JRB A;  4O3M A;  2PMH A;  2NYX A;  4I98 B;  3S1Q J;  4BQO A;  3M7G A;  1QO0 D;  1Z67 A;  1QZY A;  5CVI A;  5DS9 A;  4G12 A;  5DCF A;  2PLY A;  5J1Y A;  5GPA A;  3KLN A;  2OUM A;  2HPI A;  1J75 A;  4B3A A;  1DU6 A;  2IPQ X;  2YX7 A;  1ZG5 A;  3GTQ J;  3DPT A;  3I3L A;  1Y56 A;  2QWW A;  4W1U A;  3I64 A;  1UHM A;  2CUE A;  4RGS A;  5ICF A;  2HQA A;  3GFI A;  2XDV A;  2IGM A;  2ID3 A;  1USS A;  3R0A A;  2YU3 A;  4G6D A;  4G7Z F;  3S32 A;  3VDX A;  1W4M A;  1F36 A;  2IGK A;  2F2E A;  2HOE A;  2HKO A;  2YUS A;  3K9T A;  4FE7 A;  5BNG A;  1HDD C;  5B3S H;  2BBY A;  1P92 A;  3FXO A;  3ERM A;  3P9C A;  2BHZ A;  1NG6 A;  1BR2 A;  1D0Z A;  1MDM A;  2RVC A;  5JVT A;  3PIP F;  2Z3Y A;  3AG4 H;  4BXU A;  2B9S A;  1R36 A;  2PMZ N;  2I5U A;  1GXP A;  1ETQ A;  2O3F A;  2EPF A;  5EF6 A;  4LLL A;  4P1W A;  1K83 J;  2OAZ A;  2O8K A;  3CES A;  3HKZ A;  4HF0 A;  5EEH A;  4I6Z A;  2CH0 A;  1KYW A;  3DBR B;  3P9K A;  3WTZ A;  2EA2 A;  1XGS A;  2DDB A;  4CUG A;  2HEO A;  3F8B A;  3VB2 A;  3OYH A;  2F5F A;  3LQR A;  3RKW A;  3FBN B;  1QVU A;  2OZ6 A;  4ESJ A;  2LF7 A;  3QPT A;  2ZXJ A;  3ABM H;  5CVR A;  3PNT A;  2MC4 A;  3R60 A;  1ZEL A;  1Z6R A;  3CP8 A;  3TP3 A;  2VI6 A;  5KAF C;  2IS6 A;  1FYL A;  1XDU A;  3TP0 A;  1ZHF A;  4IHT A;  1ZG3 A;  1D8J A;  2HTS A;  3HPG A;  1Q1V A;  3F8C A;  4PFO A;  4XLP F;  2DT6 A;  5HS9 A;  5EEA A;  1MMD A;  3TO6 A;  1S5L C;  3RYR A;  2QKM B;  5E17 F;  3SEQ A;  3MMY B;  4HV6 A;  1K6O A;  2Y9Y A;  3OR1 C;  2LK2 A;  5K5R A;  3NAU A;  3BTC A;  4CCO A;  1A36 A;  1JUP A;  3FXR A;  2ZSH B;  1S6L A;  2K9M A;  3B73 A;  4QPO A;  4UUS B;  1JT6 A;  2NNY A;  4ZYD A;  1JJ6 C;  4BDZ A;  1OLT A;  2BY0 A;  3ZN1 A;  1XCB A;  4QTR A;  1YS7 A;  1DUX C;  1XX5 A;  2ELJ A;  5M5W J;  1ZKG A;  4LG0 A;  3SDB A;  3CF5 F;  5M3M J;  2E2H J;  2CQN A;  3QPS A;  2O9L A;  1YW7 A;  1SEU A;  2LKP A;  1U5T B;  2DT7 B;  3ZQQ A;  1WJB A;  2IS4 A;  3BQZ A;  5DUI A;  1AKH A;  4I7H A;  2O61 A;  1Z05 A;  4BJT A;  2VQC A;  3QYF A;  5K7F A;  2H6B A;  1U9N A;  1MNE A;  1R49 A;  1KU2 A;  2IXS A;  1Y6I A;  2ME6 A;  3MAJ A;  2P5V A;  1VQN I;  3LFU A;  3QWL A;  2X1D A;  1TL8 A;  1HF0 A;  1R7J A;  3C7J A;  1F4K A;  3PL8 A;  5E18 F;  2VBX A;  3GTK J;  3I0T A;  1GVD A;  3I59 A;  1VQM I;  4HEA 2;  4CIC A;  4WXC A;  2XRL A;  2V1X A;  3HXL A;  3HZJ A;  1RPW A;  2H09 A;  3BR6 A;  3CQZ J;  3F3X A;  3OOP A;  4KN4 X;  5J40 A;  3RQI A;  1AKH B;  1T98 A;  5IP7 J;  4U0Y A;  3I4M J;  3CO6 C;  5EJC A;  4DIQ A;  3OYE A;  5AIP A;  4XLA A;  2FQ3 A;  3KIO A;  3JAM Z;  2XKP A;  4A5N A;  2XAF A;  4UB6 C;  1DGW Y;  1MJ9 A;  2CQQ A;  2MW8 A;  4ENK A;  1S9H A;  4OIQ F;  3BRO A;  3D1N I;  3J7A Y;  4DQ2 A;  4BU2 A;  2GXB A;  3FF5 A;  3HOV J;  4Y3O A;  3CCM I;  2FX0 A;  4IHV A;  5DCM A;  1YHQ I;  1QQI A;  2XPW A;  2VOD A;  4ENM A;  5KK1 A;  2BHY A;  3CME I;  3K4K A;  1R6R A;  2KL4 A;  2HVR A;  5FRM A;  4DYQ A;  1LVK A;  5L3B A;  4BE2 A;  5J47 A;  4XN0 A;  2Q2E A;  3KFW X;  1IXR C;  1JUS A;  4XMY A;  2HFH A;  1Z1D A;  1SVM A;  2IS1 A;  3I4P A;  4OAZ A;  3IL2 A;  2VB6 A;  3TDZ C;  3C2H A;  2QVO A;  1R1T A;  3WTX C;  1WWX A;  5D4R A;  2JJ7 A;  2LY1 A;  1UG2 A;  1TWC J;  2NVT J;  3HM5 A;  2X9D A;  3GBG A;  1VQL I;  2IVM A;  4S05 A;  2R7X A;  3RKX A;  2LBF A;  2JRM A;  3WGH A;  1TT5 B;  4F55 A;  2M4K A;  2DN0 A;  2J5O A;  2JA7 J;  1YE9 A;  3EUH C;  4RMN A;  4XOT A;  2HQ5 A;  4A0Z A;  1WI3 A;  2STT A;  1MGT A;  1S29 A;  4ZDP A;  3CUQ A;  1XS9 A;  2FBI A;  2R7F A;  2H8R A;  2Y48 A;  2R7V A;  1MBJ A;  2GA1 A;  4D5F A;  2H1L A;  3ZP5 A;  1B8I A;  1IJW C;  1N78 A;  5HLT A;  1JKO C;  2V26 A;  3A2K A;  3F21 A;  5KAI C;  3BZC A;  4C2M J;  2VQL A;  1LUJ B;  3KYD B;  5J1U A;  3EUA A;  3FXQ A;  1SFK A;  3N97 A;  1WGX A;  3EUK L;  1W0T A;  1O4X A;  3KZZ A;  5FKK A;  3E6B A;  2K4B A;  4HX7 A;  2HU9 A;  4Y13 A;  4Q4Z F;  3GVA A;  4L9V A;  3VWB A;  3K4J A;  3S17 J;  2QGU A;  2A07 F;  1OMI A;  1E17 A;  3V7R A;  3TKY A;  1Z0X A;  1FC3 A;  3DEW A;  2BW3 B;  2R4G A;  3I9V 2;  3L09 A;  4AUX A;  4UUS A;  2JVH A;  3LSI A;  4MQV A;  3AKZ A;  2Y75 A;  5IYD J;  1QVT A;  3ABU A;  3L00 A;  2CGP A;  5IYB J;  4KMF A;  2CU7 A;  2CV1 A;  1MND A;  4I09 A;  1G8X A;  2PJP A;  3V8L A;  4QIW N;  3EYY A;  4UV8 A;  3FK7 A;  4RGR A;  4Q5S F;  3SZT A;  4J01 A;  3PNY A;  1HDP A;  1QPM A;  4R1H A;  4XN3 A;  2WV0 A;  3S1M J;  4KIB A;  1A31 A;  2R0Q C;  2UXN A;  3LSH A;  2IRF G;  3V42 A;  4E7S A;  4AYB A;  2ZME C;  2WAE A;  3IAS 2;  3CJT B;  3J7Z I;  1FSH A;  3FM5 A;  1GHC A;  2K9Q A;  4MQ9 F;  3OYM A;  5M5Y J;  3WHC A;  4XRS A;  3ZQI A;  1U5T A;  1IRG A;  2E71 A;  1IRX A;  2HS5 A;  3W2W A;  3C3W A;  1Z3X A;  2AHQ A;  4C3H J;  2X6Y A;  4FT8 A;  2ID6 A;  1BW5 A;  2D45 A;  3GTG J;  4AD9 A;  1F1Z A;  2M34 A;  2NOJ B;  5ICE A;  4HV5 A;  2B0L A;  3CJR B;  5GAD J;  1U8B A;  1CQT A;  4DZJ A;  1E0E A;  2AO9 A;  3PSF A;  4B1R A;  3OYK A;  1VFC A;  3BWG A;  2CJJ A;  3H92 A;  4XRM A;  4C9Y A;  3GFJ A;  3PFI A;  4A69 C;  1V55 H;  1OIS A;  1UCR A;  1ETW A;  2X0L A;  3VSK A;  3FBI B;  5K1Y A;  4WF2 A;  1XPX A;  2EB7 A;  3QP5 A;  2VKD A;  2V79 A;  3CJN A;  3M8E A;  3ZPL A;  3ULQ B;  1BC8 C;  4M71 A;  5HNF A;  4ZDO A;  9ANT A;  2EIM H;  2ISY A;  3QPL A;  4IVN A;  1MSF C;  2EFN A;  3LSR A;  3F9K A;  3HTS B;  4C2T A;  5M3F J;  3K4N A;  2M7A A;  3S3O A;  4ZTJ A;  1FOX A;  2QEN A;  2XSD C;  4L0Y B;  2YX4 A;  3BG7 A;  1IXC A;  4ZC3 A;  2K3F A;  2PN6 A;  1IGN A;  2M5W A;  1EA3 A;  1SAU A;  2DYS H;  2X1C A;  1FEX A;  4B47 A;  4JBA A;  5LHG A;  1O3T A;  1JKQ C;  2ZB9 A;  5K7Z A;  2DA4 A;  4G7H F;  3I56 I;  5ILS A;  3G3Z A;  1XGO A;  4V2F A;  4C30 A;  1I1G A;  5CQG A;  4UV9 A;  4L5J A;  2DA5 A;  4O5V A;  4PJ0 C;  4DYC A;  2GM4 A;  2E7W A;  1MBH A;  3HEF A;  6PAX A;  2O7O A;  3LAJ A;  3BR1 A;  2BZT A;  4GDF A;  3HOX J;  4LK0 F;  4C3I J;  1P9Q C;  2DMU A;  1GUU A;  3K4M A;  3D5L A;  4KT5 C;  1T56 A;  4I0B A;  3ZQF A;  2KIU A;  2P4W A;  2KRC A;  4Y52 J;  3W2V A;  3AL0 C;  1LKX A;  2XGE A;  1RRJ A;  2KIM A;  2XGX A;  3RDI A;  5KVR A;  1HQC A;  2E1M C;  5HLH A;  2FOK A;  2XAS A;  2L7K A;  4A3J J;  1W0U A;  2HOA A;  3GTP J;  2K4J A;  2K40 A;  1V54 H;  3FXJ A;  2F6C A;  2QZ8 A;  5F04 A;  5L3D A;  1XMA A;  1ZYR F;  2D1V A;  2CWE A;  2M45 A;  2P81 A;  1QA6 A;  5CPR B;  2R5Z A;  2WB1 N;  3J80 K;  3HGG A;  4EJT A;  4LOC A;  2NVQ J;  5C4J J;  2GIZ A;  4J00 A;  1I3A A;  1OYI A;  4XRS G;  2P5L C;  2A5Y B;  3BZ6 A;  3VOE A;  4BNC A;  2CQK A;  3RTR A;  1P4W A;  2WV1 A;  4PDK A;  5JFR A;  4D5C A;  3K4C A;  2DA6 A;  4KNY A;  2LNB A;  4NQW B;  3OYD A;  1ULY A;  2BXY A;  4L18 B;  1RES A;  3MKW B;  3DEE A;  3V4G A;  1U6G A;  5FKO A;  3IH2 A;  5F0H A;  5LEJ A;  1FIP A;  3BG5 A;  3SZG A;  2I8D A;  3K4L A;  1QPI A;  5TRD A;  2AXL A;  3K69 A;  4BEH B;  1FIA A;  2G7H A;  5LRS A;  1U2W A;  2Z16 A;  5DM7 F;  3K70 D;  3I58 A;  3MD2 A;  5GAG J;  4LB5 A;  1E2X A;  3MKL A;  2P0W A;  1T2K A;  2Y2Z A;  1H89 C;  2EZK A;  4GCV A;  3TQN A;  4BUP A;  4ZYG A;  3OYL A;  4EM1 A;  3E6M A;  1D8K A;  1NTC A;  4RA2 A;  2M9H A;  2W24 A;  3RZD J;  3T1B A;  1ZN2 A;  2Y31 A;  1YI2 I;  5HOD A;  3CLO A;  4IQ4 A;  3OWT A;  3HRS A;  1TTY A;  3WGG A;  1SD7 A;  2XAQ A;  2L3D A;  3BDD A;  4RAY A;  4JX6 A;  4ABZ A;  3KX2 A;  1OYY A;  2A6E F;  2F4O B;  1RIO H;  4E7I A;  1RC9 A;  3QYE A;  2OC6 A;  4CA0 A;  5DDG A;  3OYJ A;  4A0Y A;  2E2J J;  4DJA A;  1B1B A;  3HSE A;  5LD2 C;  1FOK A;  2RN7 A;  4BS9 A;  3JR9 A;  4LB6 B;  1LE8 A;  1CF7 B;  3ZQ7 A;  3CUQ B;  3MEX A;  4ZDL A;  1R23 A;  1O7L A;  2EV6 A;  3TBI A;  2VOP A;  2OPT A;  1JKP C;  2W48 A;  1UHW A;  3K1P A;  2K7L A;  1X2N A;  3U2R A;  4AIK A;  4NC6 A;  5HS8 A;  3FZV A;  4IHY A;  4MHG A;  4AU7 A;  1BC7 C;  1XGN A;  5DM6 F;  3I54 A;  4BBR J;  3WE2 A;  2HXO A;  3S14 J;  3JTG A;  1D1B A;  1EJ9 A;  3CCV I;  3K2Z A;  2BXZ A;  4BHP A;  4R8H A;  2EZH A;  4RM3 A;  2B63 J;  3ZCO A;  3SJM A;  3WU1 B;  4IHW A;  3SYT A;  5F1R A;  1HST A;  2JUC A;  4M6V A;  2A68 F;  2E19 A;  2LKX A;  3FKI J;  4EEF G;  5HVQ C;  2PX9 A;  2X48 A;  4EJO A;  1WZ2 A;  3F72 A;  1FT9 A;  5FFX A;  4M3G A;  3H3Z A;  3KZI C;  5E3N A;  1XGM A;  5A2Q Z;  4X1E A;  4V19 K;  1IUY A;  3HSR A;  3ASN H;  1J0R A;  4ZZD A;  4M6Y A;  2Z33 A;  3S1R J;  3ZR8 X;  1YRN B;  1UAA A;  4Y33 A;  3W6J B;  3BLY A;  4EV0 A;  2PG4 A;  2WWY A;  5D6E A;  3N05 A;  3H1C A;  5F0F A;  4BYY A;  3IWF A;  3LA3 A;  1B72 A;  2ZME B;  1TWH J;  2DU9 A;  3VOD A;  2JMW A;  3QOP A;  5CKT A;  5L3G A;  2IA0 A;  4ANJ A;  2VN2 A;  2BVM A;  3ZMU A;  3IRR A;  2XAG A;  5J6X A;  3BR5 A;  3JSO A;  2LD5 A;  4YEL A;  2ZJR F;  3L7W A;  4PSW A;  3S1N J;  2WY8 Q;  1X3W B;  1IN5 A;  1GLN A;  2DA3 A;  2JN6 A;  1FMV A;  2HR3 A;  2E1C A;  4IZZ A;  2JWT A;  4PJN A;  3D5S C;  1BI2 A;  5JHF A;  2MGQ A;  2BE5 F;  2BY1 A;  2F5C A;  1BIB A;  1HBX G;  2LH9 A;  3WTU C;  4CZZ A;  5CVU A;  1E3H A;  3SZP A;  3RKQ A;  1BI3 A;  2ADU A;  1T8I A;  4A3K J;  2TDX A;  4M3E A;  4N4O B;  1JUM A;  1KGS A;  1W36 D;  2QA4 I;  2QYO A;  5JHU A;  4F3Q A;  1R4M B;  3L2U A;  4EGZ A;  3BCA A;  1TQP A;  4BXX J;  2KP6 A;  3GX4 X;  1J59 A;  3R61 A;  1HKS A;  2OCC H;  3G4S I;  4G94 A;  4HZF A;  2ETH A;  2JA8 J;  1I6H J;  3QU3 A;  4PUS A;  1X58 A;  1WHU A;  1J09 A;  4G6Q A;  4UXN A;  1W7P B;  5DTD A;  3KP3 A;  3E3V A;  1VQ8 I;  3L1P A;  3RIR A;  5TGT A;  1T38 A;  1SVO A;  5HOO A;  1RR8 C;  3T8R A;  3A1Y A;  3GO5 A;  3HC7 A;  3BZK A;  3K4B A;  2ELH A;  3RCO A;  2L2O A;  4KDP A;  3RQ4 A;  3C1D A;  4JX5 A;  2OZU A;  4IOA F;  4HAM A;  3AG3 H;  5BPD A;  1VQ6 I;  1FY7 A;  3QU6 A;  1WH5 A;  2RQQ A;  1REP C;  2W7N A;  2DA1 A;  4HDU A;  4UY8 I;  3SFI A;  2C6Y A;  3TDU C;  1LJ9 A;  1RUO A;  1SFU A;  1A35 A;  3A0B C;  1LB2 A;  3FK6 A;  4XSZ F;  2K86 A;  4ZH4 F;  3I4N J;  1I3Q J;  3E0J B;  3HB9 A;  1V5E A;  3VFZ A;  4I99 C;  1KYZ A;  4FHT A;  4CXF A;  2R5Y A;  4HNV A;  1ZRC A;  3M8F A;  3GME A;  3EUH A;  1WI9 A;  1ZAO A;  4G8X A;  1PP7 U;  4EJW A;  3LFK A;  1HW5 A;  2ZSI B;  4M73 A;  3DXJ F;  1L0O C;  5F0C A;  2FBH A;  3CMM A;  4S04 A;  2KDO A;  2DA7 A;  1YG2 A;  2EQR A;  4KIF A;  4UVB A;  4DGW B;  4HG2 A;  1HOM A;  4BAC A;  4EAT A;  1GT0 C;  3Q0W A;  4IPA A;  2M1B A;  2VJ4 A;  3VSL A;  2A5W A;  2E1M B;  2PBI A;  3BG9 A;  5DEQ A;  2V1N A;  3ELK A;  1ZR4 A;  3B02 A;  4HRI A;  1A04 A;  3F8F A;  1YOV B;  2VIX A;  2D5V A;  3H3U A;  1G3S A;  3BOQ A;  4IJA A;  3RPU D;  1K4S A;  1IN4 A;  1SMT A;  2KFD A;  4KN7 X;  1X19 A;  1ZAR A;  1MBE A;  2RQP A;  1D5Y A;  5EGO A;  1UFM A;  4S0H B;  5LFA A;  3O8H A;  1AOY A;  2V1U A;  2XVC A;  4LMY A;  2HYF A;  3CCU I;  1LDD A;  1PP8 F;  1Z7L A;  3GFL A;  4XKC A;  1TNS A;  3PJR A;  3U9G A;  5H6R A;  2CV2 A;  2XPU A;  1P6R A;  2JZY A;  1L3L A;  2HOS A;  1VQK I;  1QZE A;  3IKV A;  1KQ8 A;  4RM2 A;  3DLL F;  2E60 A;  3HTU A;  3DV8 A;  3VYS B;  2FRH A;  5ILV A;  5HNH A;  2UUZ A;  2M2E A;  3L2R A;  4U7B A;  2F4M B;  3K10 A;  4CYC A;  1ZK8 A;  1NK3 P;  3DF8 A;  3D5R C;  2PJR A;  1PJR A;  1YJW I;  4HLY A;  1KON A;  2HPM A;  3VYR B;  2R3S A;  1ZGA A;  1TP4 A;  2KZG A;  3JRD A;  3KP7 A;  4W97 A;  2A61 A;  2K02 A;  1BM9 A;  1U5T C;  4ESB A;  4NNJ A;  1K78 B;  2RAE A;  4EGY A;  1H0M A;  2P7C B;  4A3B J;  2ZO4 A;  3N4M A;  1QGP A;  2OCE A;  1HKT A;  2CMP A;  1RI7 A;  1G2H A;  4CSW A;  1B72 B;  1GXQ A;  1XSD A;  4BL0 B;  2JUG A;  5IP9 J;  2GOX B;  1P4X A;  2OJE D;  5GAE J;  5J4Y A;  3ZQH A;  1FMW A;  1IC8 A;  4M3B A;  4OMZ A;  4FIS A;  2ME0 A;  3SQN A;  3JRC A;  1W7P A;  5FKN A;  1KU7 A;  2V4J C;  2JTV A;  4Y17 A;  4RAF A;  5E20 A;  1TQI A;  1IDZ A;  1R00 A;  4D1Q A;  1V5F A;  2QSF X;  1ONV A;  3FIS A;  1U3E M;  5LGT A;  1XSX A;  2R7Z J;  2VJI A;  3BP8 A;  1OFC X;  3OYC A;  4M3D A;  4BE0 A;  3EET A;  3V8K A;  4B8X A;  1T08 B;  2EWN A;  1JE8 A;  3I71 A;  1TZL A;  4JX4 A;  1FZP B;  1QHH D;  4BY1 J;  1TBX A;  1ZH5 A;  4B3X A;  2EIJ H;  4M9S A;  1MBF A;  1IXS B;  4IL6 C;  1G6N A;  4A6E A;  3GW2 A;  3BQY A;  2V7F A;  2R7T A;  1A5J A;  4MLO A;  4Q48 A;  2FD5 A;  3IUO A;  5HDK A;  3H9J A;  5GP9 A;  3HOY J;  4U0W A;  3M1C A;  2NRA C;  2R7U A;  2D1H A;  3CJQ B;  3KYL A;  4L9J A;  2L9R A;  3TO9 A;  2OTL I;  2L9N A;  2QM3 A;  2W1O A;  3KCC A;  4NDL A;  4B09 A;  4BHC A;  3LAP A;  3E6C C;  2R5Y B;  2FU4 A;  2CS3 A;  4DOZ A;  1LFP A;  1Y8Q B;  3ZGK A;  4F92 B;  4RB2 C;  3I55 I;  3HDD A;  4E4H A;  1FYM A;  1YIO A;  2VON A;  4BY7 J;  1HLV A;  5CVV A;  2DDA A;  2I10 A;  1GV5 A;  4HNU A;  5B1B H;  2F5V A;  1D3Y A;  4JP0 A;  2L7M P;  2VPR A;  1LFU P;  2NVU B;  4D9J A;  1JT0 A;  4R79 A;  1FX7 A;  3VEP A;  2UWM A;  5HS7 A;  2DAO A;  3WU0 A;  5FD5 A;  1B9N A;  4ON0 A;  2BY3 A;  1UZC A;  2G7U A;  2J5P A;  2E36 A;  2FML A;  2ZJ2 A;  3R0J A;  2EZL A;  2KIQ A;  2JRT A;  4EJV A;  1B6A A;  3LQQ A;  2OQG A;  1MMA A;  3MN2 A;  4G9Y A;  3P5J A;  2L0K A;  2VC1 A;  2Z99 A;  3OS2 A;  2Q0O A;  1POG A;  2VAS A;  3KYC B;  2CUJ A;  4F93 B;  2XRO A;  1FLI A;  2Z1D A;  3H0G J;  2E2I J;  2LYC A;  3UKG A;  4IHX A;  2XAH A;  1SVL A;  1WPK A;  3S3M A;  3GLX A;  2IA2 A;  3JAM K;  4GYI A;  2JPB A;  2LRE A;  4HQE A;  4PZJ A;  2IP2 A;  1QNT A;  2RNG A;  2FNP A;  4WXH A;  4D7N A;  3AG1 H;  5J4V A;  2LVS A;  4XKW A;  2W00 A;  1DP7 P;  1OCR H;  1YX5 A;  5LRR A;  2GOM A;  1KU3 A;  1NHA A;  1Y0N A;  4KMU X;  3U1D A;  4EM2 A;  5GAH J;  2XPV A;  4M9X A;  1H8A C;  4OU0 A;  3WG7 H;  4DBQ A;  4BH9 A;  4ZZL A;  3QP6 A;  3TW7 A;  3RJP A;  1SAN A;  1FWZ A;  5C3E J;  2X6W A;  3B6C A;  4NQW A;  1RKW A;  3K1N A;  2FSW A;  4B4C A;  4A6D A;  3MZH A;  4GYG A;  3OSF A;  2A6H F;  1UJ8 A;  1Y1W J;  4OIP F;  3QQA A;  1FOY A;  2YPR A;  3HRT A;  1JTY A;  1NG7 A;  3LST A;  4HPQ A;  2DPD A;  4EQQ A;  1BIA A;  3OS1 A;  1SFO J;  2MAB A;  2ZXH A;  1FBU A;  3LNQ A;  2RC4 A;  1H9G A;  1ZG1 A;  2AQE A;  4LLG F;  4XLH A;  1TWA J;  2Y0S A;  4BKX A;  3Q9V A;  3PIO F;  4CDG A;  2NVX J;  1J7K A;  4HSR A;  4H4K C;  2VT2 A;  4RAZ A;  3IRQ A;  3HJE A;  5FD6 A;  3KEY A;  1WQ2 A;  3REO A;  1OQY A;  1V3F A;  2DJI A;  3PUB A;  3GFM A;  4E7L A;  4PK4 A;  4FX4 A;  1I1S A;  1T95 A;  4HQM A;  2E7X A;  2LDU A;  3C2B A;  3G1M A;  4UUT A;  4P9U A;  4E7J A;  3W2A A;  3COA C;  1ETK A;  2ZKZ A;  1C0W A;  1PUF B;  2CQX A;  4BBS J;  2LY2 A;  2JA5 J;  1V4R A;  4PSX A;  3ERE D;  4HF2 A;  3ECO A;  3HOT A;  1SMY F;  4NB5 A;  4KA4 A;  4AC0 A;  1Z77 A;  5IP6 A;  1ERD A;  4PCQ A;  2M87 A;  2GQQ A;  3NAR A;  4A5M A;  3WTT C;  2KIS A;  2HZD A;  3EPZ A;  5LHI A;  2XRN A;  5DUK A;  2WB1 A;  4A3M J;  2FUG 2;  2DOA A;  2ZNY A;  5ILU A;  3K7A J;  3BR0 A;  1PUE E;  1EKE A;  3HRU A;  5CYV A;  1RR7 A;  1D1A A;  1SFE A;  1WCM J;  4QSH A;  4BQN A;  1LE8 B;  1CF7 A;  1R5I D;  1WJE A;  3NEU A;  4M9Z A;  3OYI A;  1X1C A;  2H27 A;  1RNL A;  3DCF A;  1BBY A;  2HZT A;  2L02 A;  1X1D A;  1ZRE A;  3SFZ A;  3M1E A;  2KRF A;  2L5Q A;  4PJM A;  4U88 A;  4P55 A;  2LOO A;  4Q47 A;  3ZMZ A;  4E70 A;  3OIQ A;  2CW8 A;  2UZK A;  2IGO A;  4D7M A;  1NK2 P;  1J2X A;  3HOS A;  4OAY A;  1W5S A;  3IH4 A;  1HA8 A;  4BGD A;  3K70 C;  1UHS A;  2VQG A;  3GF2 A;  4DBR A;  4L9N A;  4XOR A;  3PNV A;  2RKH A;  3WTW C;  4RGX A;  2ZJQ F;  2AS5 F;  2VT3 A;  4BQA A;  3JW4 A;  1S7E A;  2VBW A;  3LWF A;  4MTE A;  4C2U A;  2QF7 A;  3W6K B;  1F43 A;  5CQE A;  3V7S A;  4F52 A;  3F6O A;  1BR1 A;  5JI6 A;  1YYV A;  1OJL A;  4ESF A;  2CG4 A;  4P96 A;  3SEZ A;  2CSO A;  3G1O A;  4XM3 A;  5EG0 B;  2KHM A;  1WVR A;  2YR2 A;  4Z2Y A;  5KCM A;  4XID A;  1H88 C;  5IT9 Z;  3OR2 C;  5J8C A;  4BXF A;  3CC2 I;  3WTY C;  1YFH A;  3S15 J;  3FWE A;  4CYD A;  4UNO A;  3W3C A;  2LP0 A;  3RKY A;  1R5G A;  2WAQ A;  3TOA A;  1D1C A;  3F6V A;  1BN5 A;  3K6G A;  3MQ0 A;  4GRI A;  5E3O A;  2COM A;  3GCM A;  1KQ9 A;  1R9T J;  1IRZ A;  4IEJ A;  1TNT A;  1T39 A;  4OIR F;  2QKL B;  5LEK A;  2Q2E B;  2GXA A;  3L2W A;  4M74 A;  4D0P A;  2OV7 A;  3HUG A;  1FBS A;  4XOP A;  3H9G A;  3MKY B;  2K9S A;  1XMX A;  3TO7 A;  3GLL A;  2EJR A;  4A3D J;  2IAI A;  3FMR A;  5DCM B;  1YW9 A;  4HF1 A;  1O3R A;  2TRT A;  3IV5 A;  5HLI A;  2CYY A;  1UB9 A;  2XB5 A;  1LEA A;  2L9V A;  3ONQ A;  4WWC A;  3M4O J;  2MD5 A;  2DO7 A;  1K7A A;  2MC3 A;  4EVI A;  3BJ6 A;  2Z2S B;  1HC8 A;  1BR4 A;  3VYU B;  2OBP A;  2BOL A;  2B7E A;  2LTP A;  3UR3 C;  2FJ1 A;  2UV1 A;  3BJO A;  3S2W A;  1BI1 A;  3BY6 A;  4A93 J;  1ETY A;  2ZJP F;  2L01 A;  4RAG A;  1YTY A;  1MNM C;  4AYB N;  1MIJ A;  1UST A;  2ISZ A;  4L0Z B;  1X4O A;  2VKH A;  2LKS A;  1E3O C;  1ZRF A;  2VE8 A;  3E5U A;  5LGN A;  2M4G A;  2V9V A;  2DMN A;  4LJZ F;  5CVJ A;  4CCJ A;  1WJA A;  1OYW A;  4DZP A;  3PFY A;  4KIT B;  3CO7 C;  4LK1 F;  4GFB A;  2V6E A;  2EIN H;  3E5X A;  3TL4 X;  2R93 J;  1IDY A;  1DPR A;  1UMQ A;  1YO5 C;  2M8E A;  3AL0 B;  3JCU C;  3I5U A;  3MVP A;  4OWR B;  4KIS A;  2DBB A;  3WOD F;  2WY7 Q;  4IQJ A;  2NXN B;  4LIV A;  4XNF A;  2CW0 F;  4I01 A;  3TGN A;  5GTH C;  1KQ0 A;  1JHH A;  3IHU A;  1ITY A;  3KP4 A;  2DFE A;  1N77 A;  3EDP A;  3E97 A;  5FKL A;  2ZCW A;  2XV4 S;  3V7C A;  2ACJ A;  1ENH A;  3BC8 A;  2R5Z B;  4IOC F;  2MG4 A;  1EV7 A;  2RRE A;  1M1E B;  2NS0 A;  1X3U A;  4ITV A;  4DW6 A;  4N0B A;  4ZYE A;  4Y7N J;  2P5K A;  4J19 A;  4I2O A;  2VE9 A;  1VQO I;  1Z6T A;  1NH3 A;  2M30 A;  1R71 A;  2WA0 A;  3DTE A;  1IF1 A;  4U87 A;  3ZMD A;  4XLC A;  1V5G A;  4IO9 F;  2Y30 A;  4ZYH A;  2MFZ A;  1ON1 A;  5DV5 A;  4FX0 A;  4PJL A;  2DOF A;  3M3Y J;  1U8R A;  1G3W A;  1XC5 A;  4ASN A;  3LSM A;  1O3Q A;  2HYJ A;  1BA5 A;  3QPH A;  2LMD A;  4N4N B;  5E3L A;  1K4T A;  2XSJ C;  5TJJ A;  4K2E A;  3JSP A;  1TW2 A;  3WHB A;  1YIT I;  3WGI A;  3H36 A;  1FP1 D;  4BHB A;  5FO5 A;  3CCY A;  4HYE A;  2NS8 A;  3ZQL A;  1J9I A;  3FIW A;  3ZMS A;  3G6E I;  2BVL A;  1T0F A;  3DLA A;  2LG4 A;  4CHU A;  3WG9 A;  1WJC A;  4WXD A;  1U78 A;  3EYI A;  3KLO A;  1LQ1 A;  1D5V A;  2V9P A;  3L9F A;  4FAS D;  3IWZ A;  2ZXI A;  1BW6 A;  3E7L A;  1O7F A;  3GXO A;  3JTH A;  1SD6 A;  1MMG A;  2DA2 A;  3H35 A;  1IW7 F;  3ZMV A;  4XQF A;  2O03 A;  1HSJ A;  1U9O A;  1EH6 A;  3CF2 A;  4V2G A;  1APL C;  3SDG A;  1RET A;  3P7N A;  3CCL I;  3HKZ N;  1XB4 A;  1WJD A;  2QEX I;  3Q5F A;  4MEY F;  1MMS A;  1IN8 A;  1AA7 A;  3S3N A;  4MO7 A;  3LA7 A;  2MA3 A;  3BTI A;  3OYG A;  1O3S A;  3KEO A;  1D0X A;  3HL2 A;  5IT3 A;  3O6B B;  2O5R A;  4NBQ A;  2KDZ A;  2L4M A;  3MCZ A;  1DGR M;  4IF4 A;  1P7J A;  4JOM A;  2MBF A;  3KET A;  4OIO F;  2WC2 A;  4PGG A;  5C4X J;  4E7Z A;  1B8I B;  2D2W A;  4IRH A;  3CDH A;  2VLA A;  4XKB A;  2EH3 A;  4A3G J;  1ON2 A;  1S3J A;  4MEX F;  5F27 A;  2CO5 A;  2ESH A;  1LFB A;  3JRE A;  3ZQG A;  2VKE A;  4I0A A;  2NVY J;  2KQR A;  2E1O A;  3A4C A;  3CDI A;  4RB0 A;  4L5E A;  4OOI A;  4HLX A; 
#chains in the Genus database with same CATH homology
 2DK8 A;  5LHH A;  3GWZ A;  1O57 A;  2UXX A;  5ICG A;  5LGU A;  2W57 A;  2HYG D;  1S7A A;  2MH2 A;  4HOB A;  4G7O F;  5K5O A;  2FNA A;  3ROU A;  2HKX A;  3HHH A;  2DT5 A;  4GO1 A;  4HX8 A;  4KYW A;  2X4H A;  3ABT A;  2VBZ A;  2JPC A;  1R1U A;  4UVA A;  3TOB A;  1B4A A;  3MFK A;  4L9T A;  4AIH A;  5L3E A;  2PI0 A;  2QQA A;  4LFU A;  5BQT A;  1W7P D;  3NRV A;  3CTA A;  2FMY A;  2IA1 A;  3HSF A;  3CUQ C;  5K5Q A;  4O6J A;  5E1Z B;  1IN6 A;  2EFP A;  4YFN F;  1OPC A;  1F5T A;  5EEG A;  2DPU A;  1T6S A;  4U7D A;  2BYV E;  5H20 A;  3DP7 A;  4GGG A;  1B59 A;  4RB3 C;  3GZ5 A;  2GIV A;  4RGU A;  4EM0 B;  4MTD A;  3T5X A;  1KA8 A;  4AIJ A;  3I53 A;  1PDN C;  5FGM A;  5J8F A;  3G73 A;  3DKW A;  3K1M A;  5F6F A;  1Z91 A;  3V8J A;  3WTV C;  1JGS A;  5D5W B;  2NNN A;  2YSR A;  2HTJ A;  4UUV A;  3F8M A;  1W5T A;  4IXA A;  2FBK A;  2CFX A;  2GA2 A;  2H6C A;  2KJB A;  4CGZ A;  1G3T A;  2QQB A;  3F23 A;  4RS8 A;  2PQ8 A;  2LSO A;  4JK1 X;  3O3K A;  1R5H A;  4XLN F;  5E8I A;  4QWQ A;  4WX9 A;  5FFZ A;  3J81 K;  4KFC A;  5CJ9 A;  4Y15 A;  2Z5U A;  1SAX A;  5H6Q A;  1K79 A;  1HXD A;  3IKT A;  2QUF A;  2IT0 A;  5D5V B;  5HDN A;  1FPQ A;  2ZME A;  1F9N A;  1P4A A;  4HX4 A;  5BOX A;  2WTE A;  1WRJ A;  3HIF A;  2KJC A;  3F22 A;  3P9I A;  2Y0M A;  2GWR A;  1YQA A;  4IRG A;  1BI0 A;  5D6F A;  4WK8 F;  2P7V B;  4A2U A;  1YS6 A;  2GZW A;  1R1V A;  1YLF A;  3BPV A;  2EK5 A;  5L3C A;  3F8N A;  4KIG A;  3AAF A;  2FXA A;  2EFW A;  1IRF A;  4XRF A;  2R7D A;  3WE3 A;  2F5E A;  3DPL C;  3FXU A;  3CUO A;  3HHG A;  3MZY A;  1XD7 A;  2BGC A;  2FEZ A;  1I5Z A;  2KIF A;  4RB1 A;  1FNN A;  1ZLK A;  2W84 A;  5IT9 K;  3L2C A;  1SD4 A;  3NQO A;  5D5X B;  1ZRD A;  4GXO A;  2O8X A;  3QAH A;  1WSU A;  4P5O A;  4QLC U;  2ZFW A;  3FMS A;  2Z9O A;  4HBL A;  1STZ A;  3FX3 A;  3J81 Z;  2L54 A;  3DFG A;  4N9I A;  1YW8 A;  2XHK A;  3I59 B;  4HW0 A;  3KE2 A;  3ZN0 A;  2PEX A;  1HKQ A;  2OD5 A;  3HYI A;  2HQN A;  3ML6 A;  2P6S A;  2RGV A;  2XIG A;  3EQL F;  1SFX A;  2QBY A;  5ERI A;  4UVC A;  2HWV A;  2XUB A;  5L3F A;  1IN7 A;  5A2Q K;  1RZ4 A;  1FBQ A;  3KP6 A;  4TV7 A;  4A12 A;  4IHS A;  2P6T A;  1EH7 A;  2ZBK A;  2FA5 A;  2FE3 A;  2FF4 A;  4ETS A;  2DI3 A;  5LBQ A;  1R58 A;  1LEB A;  2BV6 A;  5HDG A;  4KUM A;  5F64 A;  4EJU A;  3T0Y A;  3GYH X;  2V1D A;  3M9A A;  4F7Z A;  3PQK A;  4KIC A;  1FYK A;  1QBJ A;  1HW2 A;  1XDS A;  1ZLJ A;  2EFQ A;  2OU2 A;  1S8N A;  1Y0U A;  3FM3 A;  1MJA A;  2H94 A;  2DFI A;  1MZB A;  3KZY A;  2HQR A;  4LGW A;  4U0V A;  3RI4 A;  1H9T A;  1DPU A;  5D8K B;  1IAW A;  5LLQ A;  4OIN F;  4NHJ A;  3O2P E;  2OQR A;  2VXZ A;  2EA4 A;  5AIQ A;  4LD5 A;  1LDK B;  2BEO A;  4HA8 A;  3PQJ A;  1TQM A;  3LA2 A;  5DD4 A;  2O0Y A;  2PFB A;  3GUD A;  1S7O A;  4UHT A;  1SD5 A;  3HRM A;  3BJA A;  2A3S A;  1LDJ A;  5AON A;  2PMU A;  1AWC A;  5BPI A;  3RYP A;  5D4S A;  5HLG A;  1TLH B;  3DEU A;  3BPX A;  4N9H A;  2GXG A;  2QQ9 A;  2K27 A;  2DW4 A;  1KU9 A;  1BJA A;  2DQR A;  2XAJ A;  1MJB A;  5DYM A;  1IZ1 A;  4YFK F;  1RUN A;  4M72 A;  5BS6 A;  4ENJ A;  2JT1 A;  1CGP A;  2P8T A;  2QLZ A;  1XSV A;  5E8G A;  3T8T A;  4MNU A;  5CLS A;  2L4A A;  2VBY A;  3OV8 A;  2EFO A;  3ZMT A;  4P9F A;  3R4K A;  3WTS C;  3KP5 A;  4BAY A;  2DK5 A;  5BMZ A;  2W25 A;  1JXS A;  2RDP A;  5D8L B;  2DLL A;  1I27 A;  4ENN A;  3QRF F;  1I6X A;  3RPU A;  2KKO A;  4WCG A;  5E1W A;  2HGC A;  4LLN A;  2ZNZ A;  3D0S A;  1K78 A;  1FSE A;  2JSC A;  2W85 A;  2EV0 A;  5ICC A;  2STW A;  4OMY A;  5JR3 A;  4CO8 A;  2E1N A;  1MD0 A;  4A0X A;  4HDV A;  2F5D A;  4AVP A;  3KP2 A;  2A69 F;  1P2F A;  1VTN C;  1B9M A;  3GZ6 A;  1LVA A;  2MLK A;  5FLX K;  1LNW A;  2Q8K A;  2V6C A;  4JQF A;  3RPQ A;  3ISP A;  1MDM B;  2GAU A;  3SHF A;  4MGR A;  2LF8 A;  2RNJ A;  2RV8 A;  4AWX B;  2DTR A;  3ECH A;  1XN7 A;  4XBF A;  5E1X A;  1MKM A;  1WKM A;  1Z7U A;  4H0E A;  3KEQ A;  3E5Q A;  2NAZ A;  3R6S A;  2O6G E;  3K0L A;  2EV5 A;  1XMK A;  5FB2 A;  2VOO A;  2QBY B;  2DQL A;  3E6D A;  1DDN A;  1Z9C A;  4I02 A;  1G4D A;  4YFX F;  1EH8 A;  1G3Y A;  3IC7 A;  2OA4 A;  1GVJ A;  1XCV A;  2VC0 A;  3GEZ A;  4YIF A;  3Q9S A;  4IRI A;  3J7A O;  5FLX Z;  3J80 Z;  1FP2 A;  2IJL A;  1ODD A;  4XSX F;  4M6X A;  4LG0 B;  5D5U B;  1Q1H A;  3FHZ A;  1OR7 A;  2IW5 A;  1ZGJ A;  1J5Y A;  5ED4 A;  5DD8 A;  1R22 A;  1JHF A;  1QZZ A;  3MWM A;  2MH9 A;  4YG2 F;  1HW1 A;  1TW3 A;  2XKO A;  4DNC A;  4EMS A;  4PGH A;  3FMQ A;  1BOA A;  1OKR A;  2G9W A;  3DQV C;  4YII A;  4L5I A;  2HDC A;  3C18 A;  2MLG A;  2ESN A;  4O3M A;  3SXY A;  2PMH A;  2NYX A;  4I98 B;  3M7G A;  1QO0 D;  1QZY A;  5CVI A;  5DCF A;  2PLY A;  3KLN A;  1J75 A;  2IPQ X;  2YX7 A;  1ZG5 A;  3DPT A;  2QWW A;  3I64 A;  1UHM A;  4RGS A;  5ICF A;  3GFI A;  3R0A A;  1USS A;  2YU3 A;  4G6D A;  4G7Z F;  1W4M A;  2F2E A;  2HOE A;  2HKO A;  3K9T A;  2BBY A;  1P92 A;  3P9C A;  1MDM A;  2RVC A;  5JVT A;  2Z3Y A;  4BXU A;  1R36 A;  1GXP A;  2O3F A;  4LLL A;  2OAZ A;  4HF0 A;  5EEH A;  1KYW A;  3P9K A;  3WTZ A;  2EA2 A;  1XGS A;  2HEO A;  3F8B A;  3VB2 A;  2F5F A;  3LQR A;  3RKW A;  2OZ6 A;  4ESJ A;  2LF7 A;  3QPT A;  2ZXJ A;  5CVR A;  3R60 A;  1Z6R A;  1FYL A;  1XDU A;  1ZHF A;  4IHT A;  1ZG3 A;  1D8J A;  2HTS A;  3F8C A;  4XLP F;  5HS9 A;  3TO6 A;  3RYR A;  5E17 F;  4HV6 A;  1K6O A;  5K5R A;  3FXR A;  1S6L A;  3B73 A;  2NNY A;  4ZYD A;  3ZN1 A;  1XCB A;  1YS7 A;  1DUX C;  4LG0 A;  1YW7 A;  2LKP A;  1U5T B;  5DUI A;  4I7H A;  2O61 A;  1Z05 A;  2H6B A;  1KU2 A;  3MAJ A;  2P5V A;  1F4K A;  1R7J A;  3C7J A;  5E18 F;  2VBX A;  3I0T A;  3I59 A;  4CIC A;  4WXC A;  2V1X A;  2H09 A;  3F3X A;  3OOP A;  4KN4 X;  1T98 A;  4U0Y A;  3CO6 C;  5AIP A;  2FQ3 A;  3JAM Z;  2XKP A;  4A5N A;  2XAF A;  1MJ9 A;  4ENK A;  4OIQ F;  3BRO A;  4DQ2 A;  2GXB A;  3FF5 A;  5DCM A;  1QQI A;  2VOD A;  4ENM A;  5KK1 A;  5L3B A;  2Q2E A;  3KFW X;  1IXR C;  2HFH A;  1Z1D A;  3I4P A;  3IL2 A;  3TDZ C;  2QVO A;  1R1T A;  3WTX C;  1WWX A;  5D4R A;  2IVM A;  4S05 A;  3RKX A;  3WGH A;  2J5O A;  4A0Z A;  2STT A;  1MGT A;  1S29 A;  3CUQ A;  2FBI A;  2R7F A;  2Y48 A;  2GA1 A;  3ZP5 A;  3F21 A;  3N97 A;  3FXQ A;  3KZZ A;  3E6B A;  2K4B A;  4HX7 A;  4Y13 A;  4Q4Z F;  3GVA A;  4L9V A;  2A07 F;  1OMI A;  1E17 A;  3V7R A;  3TKY A;  1FC3 A;  3L09 A;  4MQV A;  2Y75 A;  3ABU A;  3L00 A;  2CGP A;  4KMF A;  4I09 A;  2PJP A;  3V8L A;  3EYY A;  4UV8 A;  4RGR A;  4Q5S F;  3SZT A;  1QPM A;  4R1H A;  2WV0 A;  4KIB A;  2UXN A;  2IRF G;  1FSH A;  3FM5 A;  1GHC A;  4MQ9 F;  1U5T A;  1IRG A;  2HS5 A;  3C3W A;  4FT8 A;  2D45 A;  4AD9 A;  1F1Z A;  5ICE A;  4HV5 A;  2B0L A;  3BWG A;  3H92 A;  3GFJ A;  3PFI A;  1UCR A;  2X0L A;  5K1Y A;  4WF2 A;  3ZPL A;  2EB7 A;  3QP5 A;  2V79 A;  3CJN A;  3M8E A;  3ULQ B;  1BC8 C;  4M71 A;  2ISY A;  4IVN A;  2EFN A;  3HTS B;  2QEN A;  4L0Y B;  2YX4 A;  1IXC A;  2PN6 A;  2M5W A;  4JBA A;  5LHG A;  1O3T A;  4G7H F;  5ILS A;  3G3Z A;  1XGO A;  1I1G A;  4UV9 A;  4L5J A;  4O5V A;  2E7W A;  6PAX A;  3LAJ A;  4LK0 F;  3D5L A;  4KT5 C;  4I0B A;  2KIU A;  2P4W A;  2KIM A;  2XGX A;  3RDI A;  5KVR A;  1HQC A;  5HLH A;  2FOK A;  2XAS A;  2K4J A;  2QZ8 A;  5L3D A;  1XMA A;  1ZYR F;  2D1V A;  2CWE A;  2M45 A;  3J80 K;  4EJT A;  1OYI A;  2P5L C;  2A5Y B;  3BZ6 A;  3VOE A;  4BNC A;  2CQK A;  3RTR A;  1P4W A;  4PDK A;  5JFR A;  4KNY A;  2LNB A;  4L18 B;  1ULY A;  3V4G A;  1U6G A;  5LEJ A;  5TRD A;  2AXL A;  3K69 A;  2G7H A;  5LRS A;  1U2W A;  3I58 A;  4LB5 A;  1E2X A;  1T2K A;  4GCV A;  3TQN A;  4ZYG A;  4EM1 A;  3E6M A;  1D8K A;  2W24 A;  3T1B A;  1ZN2 A;  3CLO A;  3HRS A;  1TTY A;  3WGG A;  1SD7 A;  2XAQ A;  2L3D A;  3BDD A;  4RAY A;  1OYY A;  2A6E F;  1RIO H;  5DDG A;  4A0Y A;  1FOK A;  1B1B A;  3HSE A;  2RN7 A;  1CF7 B;  4LB6 B;  3ZQ7 A;  3CUQ B;  3MEX A;  1R23 A;  1O7L A;  2EV6 A;  2VOP A;  1UHW A;  3K1P A;  2K7L A;  3U2R A;  4AIK A;  5HS8 A;  3FZV A;  4MHG A;  1BC7 C;  1XGN A;  3I54 A;  3WE2 A;  3JTG A;  3K2Z A;  4BHP A;  4R8H A;  3WU1 B;  5F1R A;  1HST A;  2A68 F;  5HVQ C;  4EJO A;  3F72 A;  1FT9 A;  5FFX A;  3H3Z A;  1XGM A;  5A2Q Z;  1IUY A;  3HSR A;  1J0R A;  4ZZD A;  4M6Y A;  2Z33 A;  3W6J B;  4EV0 A;  2PG4 A;  2WWY A;  5D6E A;  4BYY A;  3IWF A;  3LA3 A;  2ZME B;  2DU9 A;  3VOD A;  3QOP A;  5L3G A;  2IA0 A;  2VN2 A;  3ZMU A;  3IRR A;  2XAG A;  5J6X A;  3JSO A;  3L7W A;  1IN5 A;  2E1C A;  2HR3 A;  1BI2 A;  2BE5 F;  2F5C A;  1BIB A;  1HBX G;  3WTU C;  4CZZ A;  5CVU A;  3SZP A;  1BI3 A;  2ADU A;  2TDX A;  1KGS A;  2QYO A;  5JHU A;  4EGZ A;  1TQP A;  3GX4 X;  1J59 A;  3R61 A;  1HKS A;  4G94 A;  4HZF A;  2ETH A;  3QU3 A;  4G6Q A;  4UXN A;  1W7P B;  3KP3 A;  3E3V A;  3RIR A;  1T38 A;  5HOO A;  3T8R A;  3GO5 A;  2ELH A;  4KDP A;  3C1D A;  2OZU A;  4HAM A;  5BPD A;  1FY7 A;  3QU6 A;  1REP C;  4HDU A;  2C6Y A;  3TDU C;  1LJ9 A;  1RUO A;  1SFU A;  1LB2 A;  4XSZ F;  2K86 A;  4ZH4 F;  3VFZ A;  1KYZ A;  4FHT A;  4CXF A;  1ZRC A;  3M8F A;  3EUH A;  1WI9 A;  1ZAO A;  4G8X A;  1PP7 U;  4EJW A;  3LFK A;  1HW5 A;  4M73 A;  3DXJ F;  1L0O C;  2FBH A;  4S04 A;  1YG2 A;  4KIF A;  4UVB A;  4IPA A;  2M1B A;  5DEQ A;  2PBI A;  3ELK A;  3B02 A;  1A04 A;  3F8F A;  3H3U A;  1G3S A;  3BOQ A;  4IJA A;  1IN4 A;  1SMT A;  4KN7 X;  1ZAR A;  2RQP A;  1UFM A;  1AOY A;  2V1U A;  2XVC A;  4LMY A;  2HYF A;  1LDD A;  1PP8 F;  3GFL A;  1TNS A;  3U9G A;  5H6R A;  1P6R A;  2JZY A;  1L3L A;  3IKV A;  1KQ8 A;  3HTU A;  3DV8 A;  2FRH A;  5ILV A;  4U7B A;  3DF8 A;  4HLY A;  2R3S A;  1ZGA A;  3KP7 A;  2A61 A;  2K02 A;  1BM9 A;  1U5T C;  4ESB A;  1K78 B;  4EGY A;  1H0M A;  2P7C B;  2ZO4 A;  3N4M A;  1QGP A;  1HKT A;  1RI7 A;  1GXQ A;  1XSD A;  1P4X A;  4OMZ A;  3SQN A;  1W7P A;  1KU7 A;  2JTV A;  4Y17 A;  5E20 A;  1TQI A;  1R00 A;  1ONV A;  1U3E M;  5LGT A;  1XSX A;  3BP8 A;  3EET A;  3V8K A;  4B8X A;  2EWN A;  1JE8 A;  3I71 A;  1FZP B;  1TBX A;  1ZH5 A;  4M9S A;  1IXS B;  1G6N A;  4A6E A;  3GW2 A;  4Q48 A;  5HDK A;  4U0W A;  2NRA C;  2D1H A;  4L9J A;  3TO9 A;  2QM3 A;  4BHC A;  3KCC A;  4B09 A;  3E6C C;  3LAP A;  2FU4 A;  4RB2 C;  1FYM A;  1YIO A;  2VON A;  5CVV A;  1D3Y A;  4R79 A;  1FX7 A;  3VEP A;  2UWM A;  5HS7 A;  2DAO A;  3WU0 A;  5FD5 A;  1B9N A;  4ON0 A;  2G7U A;  2J5P A;  2FML A;  2ZJ2 A;  3R0J A;  2JRT A;  4EJV A;  1B6A A;  3LQQ A;  2OQG A;  4G9Y A;  2VC1 A;  2Z99 A;  2Q0O A;  2XRO A;  1FLI A;  2XAH A;  3GLX A;  2IA2 A;  3JAM K;  4GYI A;  2JPB A;  4HQE A;  4PZJ A;  2IP2 A;  1QNT A;  2FNP A;  4WXH A;  1DP7 P;  5LRR A;  1KU3 A;  1NHA A;  4KMU X;  3U1D A;  4EM2 A;  4M9X A;  4OU0 A;  4BH9 A;  4ZZL A;  3QP6 A;  3RJP A;  1FWZ A;  4NQW A;  3K1N A;  2FSW A;  4A6D A;  3MZH A;  4GYG A;  2A6H F;  4OIP F;  2YPR A;  3HRT A;  2DPD A;  3LST A;  4EQQ A;  1BIA A;  1FBU A;  2RC4 A;  1H9G A;  1ZG1 A;  4LLG F;  3Q9V A;  4CDG A;  1J7K A;  4RAZ A;  2VT2 A;  3IRQ A;  5FD6 A;  1WQ2 A;  3REO A;  1V3F A;  3GFM A;  4FX4 A;  1I1S A;  4HQM A;  2E7X A;  2LDU A;  4P9U A;  3COA C;  1C0W A;  2ZKZ A;  1V4R A;  3ERE D;  4HF2 A;  3ECO A;  3HOT A;  1SMY F;  4NB5 A;  4KA4 A;  4PCQ A;  2M87 A;  2GQQ A;  4A5M A;  3WTT C;  5LHI A;  2XRN A;  5DUK A;  2ZNY A;  5ILU A;  1PUE E;  5CYV A;  3HRU A;  1SFE A;  1CF7 A;  3NEU A;  4M9Z A;  2H27 A;  1RNL A;  1BBY A;  2HZT A;  2L02 A;  1ZRE A;  3SFZ A;  3M1E A;  2KRF A;  3ZMZ A;  4U88 A;  4P55 A;  4Q47 A;  4E70 A;  2UZK A;  1J2X A;  3HOS A;  1W5S A;  3GF2 A;  4L9N A;  4BQA A;  2AS5 F;  2RKH A;  3WTW C;  4RGX A;  2VT3 A;  3JW4 A;  2VBW A;  3LWF A;  4MTE A;  3W6K B;  3V7S A;  3F6O A;  5JI6 A;  1YYV A;  4ESF A;  2CG4 A;  4P96 A;  2CSO A;  2YR2 A;  4Z2Y A;  5IT9 Z;  5J8C A;  3WTY C;  1YFH A;  3FWE A;  4CYD A;  4UNO A;  3RKY A;  1R5G A;  3TOA A;  3F6V A;  1BN5 A;  3MQ0 A;  2COM A;  1KQ9 A;  1TNT A;  1T39 A;  4OIR F;  5LEK A;  4M74 A;  4D0P A;  3HUG A;  1FBS A;  3TO7 A;  2EJR A;  3FMR A;  5DCM B;  1YW9 A;  4HF1 A;  1O3R A;  5HLI A;  2CYY A;  1UB9 A;  1LEA A;  4WWC A;  2MD5 A;  2DO7 A;  1K7A A;  2MC3 A;  4EVI A;  3BJ6 A;  2OBP A;  3BJO A;  3S2W A;  1BI1 A;  3BY6 A;  2L01 A;  1YTY A;  1UST A;  2ISZ A;  4L0Z B;  1ZRF A;  2VE8 A;  3E5U A;  5LGN A;  2V9V A;  4LJZ F;  5CVJ A;  1OYW A;  3CO7 C;  4LK1 F;  3E5X A;  1DPR A;  1YO5 C;  2M8E A;  3I5U A;  2DBB A;  3WOD F;  2CW0 F;  4I01 A;  3TGN A;  1KQ0 A;  1JHH A;  3IHU A;  3KP4 A;  3E97 A;  3EDP A;  2ZCW A;  2XV4 S;  3V7C A;  2ACJ A;  1EV7 A;  2NS0 A;  1X3U A;  4ZYE A;  4N0B A;  4I2O A;  2P5K A;  2VE9 A;  1Z6T A;  2M30 A;  1IF1 A;  3ZMD A;  4ZYH A;  1ON1 A;  5DV5 A;  4FX0 A;  1U8R A;  1G3W A;  4ASN A;  1O3Q A;  3QPH A;  5TJJ A;  4K2E A;  3JSP A;  1TW2 A;  3WGI A;  4BHB A;  1FP1 D;  5FO5 A;  4HYE A;  1J9I A;  3ZMS A;  1T0F A;  4CHU A;  3WG9 A;  4WXD A;  1U78 A;  3EYI A;  3KLO A;  1LQ1 A;  1D5V A;  3L9F A;  3IWZ A;  1O7F A;  3GXO A;  3JTH A;  1SD6 A;  1IW7 F;  3ZMV A;  2O03 A;  1HSJ A;  1EH6 A;  3P7N A;  1XB4 A;  3Q5F A;  4MEY F;  1IN8 A;  3LA7 A;  2MA3 A;  1O3S A;  3KEO A;  5IT3 A;  3O6B B;  2L4M A;  3MCZ A;  4IF4 A;  2MBF A;  3KET A;  4OIO F;  2WC2 A;  4PGG A;  2D2W A;  4IRH A;  3CDH A;  1ON2 A;  1S3J A;  4MEX F;  2CO5 A;  2ESH A;  4I0A A;  4RB0 A;  4OOI A;  4HLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...