4HQEA

The crystal structure of qsrr-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
MMEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Transcriptional regulator QsrR
publication title Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hqeA00
2VXZA 5A2QK 1JXSA 3MFKA 5LRSA 1I1SA 2M30A 2XGXA 2P6TA 1FYKA 3HIFA 2FNAA 2H27A 4P55A 2XAQA 3RYPA 1FBSA 2O03A 3CUQA 3KLNA 5CYVA 4KIGA 3WG9A 3CO7C 2PEXA 3QPTA 5L3FA 1ZGAA 2GXGA 2OZ6A 5DEQA 3JAMK 4OMZA 1IRFA 5LLQA 2BV6A 2V6CA 1SFEA 4RB2C 2FMLA 4KYWA 2ACJA 2Q2EA 2ZFWA 4AIJA 2BE5F 4ENKA 3HSFA 3KEOA 2R7DA 4MQVA 5KK1A 4RB0A 3ULQB 4BAYA 3E97A 5LHGA 1FBQA 3E6MA 1PDNC 5CLSA 1ODDA 4AIKA 4E70A 3AAFA 3HSRA 5FB2A 4YFNF 1OMIA 2CWEA 2PMUA 1T98A 1A04A 1U5TC 4MEYF 1VTNC 2Y48A 5L3EA 1K79A 3Q5FA 4RGUA 4MQ9F 3U1DA 1FPQA 2CG4A 3KP2A 4YG2F 3E5QA 5D5XB 4HQMA 2P8TA 4KIBA 1HKQA 4RB3C 4WX9A 2KJBA 5HVQC 2QYOA 2QQ9A 3VEPA 3E6BA 2CGPA 3JTHA 2EK5A 1FC3A 3OOPA 1P92A 1DP7P 1ZG3A 5D5VB 2IA0A 1CGPA 1FSHA 5E1ZB 5E8IA 2NS0A 1R22A 2J5OA 2ZCWA 4KMUX 4U0VA 3PQJA 2V79A 5D6FA 2A69F 3WODF 2DBBA 2P4WA 4I02A 1QZYA 3RTRA 4QLCU 4KICA 4ENMA 4HW0A 1YO5C 1MGTA 1G4DA 3MWMA 2ISYA 3KZZA 1F9NA 2JTVA 3ECOA 1SFXA 3ROUA 3J80Z 1TNTA 3LA2A 1T6SA 4LG0A 5IT9Z 1I6XA 2YU3A 1IW7F 3T5XA 1J5YA 3B73A 4HDUA 4GYIA 3V8JA 4LB6B 1XB4A 1GVJA 5TRDA 3FM5A 4KT5C 4CZZA 4Q5SF 2HEOA 3GFIA 2LF7A 5D5UB 3BJOA 2P5LC 5FGMA 3QP5A 4FX4A 2XKPA 4ASNA 4JK1X 1B9MA 1ZLJA 1R5GA 2YX7A 3WTSC 2A61A 5K5OA 3KP7A 1BI2A 1TBXA 4EM2A 3TGNA 1KYWA 5JR3A 2P6SA 3V8KA 2QVOA 1IUYA 5BPIA 1V3FA 2VBZA 3D5LA 2VONA 4PCQA 2ELHA 3GW2A 4O3MA 1FP1D 2CO5A 3I64A 4L9VA 3H3ZA 5HS8A 5LHHA 3MCZA 2OQGA 3LAPA 2EV0A 3I71A 3GFMA 2PN6A 3GZ5A 4U7DA 4FHTA 1KQ0A 5HDNA 2HQNA 1STZA 2FEZA 2L4MA 2YPRA 3E5XA 5FO5A 5JFRA 3I59A 1USTA 4HV6A 1IAWA 4EM1A 2ADUA 2DU9A 2MH2A 3PFIA 1OYIA 3V8LA 2DQLA 1FOKA 3I53A 1B4AA 4IXAA 5HS9A 2HTJA 4RAZA 3E6DA 2ZMEB 5HLHA 1ZLKA 3RPUA 3U9GA 3F72A 1O3TA 5L3CA 3TQNA 4P9UA 2F2EA 2PI0A 4G8XA 3VB2A 3W6JB 1U5TB 1R58A 1BC7C 5F64A 2QQAA 3F21A 2IJLA 3KZYA 1GHCA 3KFWX 1GXQA 4G7ZF 2WC2A 4KMFA 1TW2A 3M7GA 4IHTA 1X3UA 1HW1A 3BPVA 1QZZA 1BN5A 4EMSA 3F8CA 3S2WA 1D8JA 2FOKA 4QWQA 3WTZA 3CO6C 4D0PA 3KP3A 1K78A 3LQRA 3NRVA 4CICA 5EEGA 4IJAA 2XKOA 2VBYA 2PQ8A 1L0OC 4A0YA 3BJAA 1W4MA 3J81Z 1QBJA 5L3GA 1G3SA 4N0BA 3GYHX 4F7ZA 5E8GA 1IN5A 2XAHA 3QOPA 5H6QA 5ERIA 1USSA 5DV5A 4ESFA 3CTAA 4L0ZB 4M73A 2UWMA 1IN4A 2TDXA 3GF2A 4BHPA 3KP4A 4A6DA 1L3LA 3HSEA 4UV9A 2ZKZA 4HLXA 1YW9A 4I0AA 4LGWA 4LJZF 1FNNA 2UXNA 4EJWA 3P9CA 1LDDA 1F4KA 3P7NA 3R61A 2K02A 3BOQA 2GIVA 2QBYA 2AS5F 4BHBA 2P5VA 3G3ZA 3JSOA 2UZKA 1BC8C 2LKPA 4I7HA 2FMYA 5DDGA 2M8EA 2F5CA 1XCBA 2JSCA 2WWYA 1LQ1A 2VN2A 2ZO4A 4I2OA 2M5WA 2ESNA 3C3WA 1U3EM 1DPRA 3TKYA 2EFOA 4HX4A 4Y13A 4Q47A 2YX4A 3LSTA 2DO7A 3ZMUA 3MEXA 3O6BB 3CLOA 5K5RA 2DI3A 4LLLA 3C1DA 1RUOA 3HTSB 1WQ2A 3GFLA 2DTRA 3LAJA 2EB7A 1CF7A 4S04A 4GYGA 4U7BA 5BQTA 3RJPA 3SZTA 3ZQ7A 2PG4A 2MC3A 5AIPA 3RKYA 5D4SA 4WK8F 2XAGA 1DUXC 2CYYA 4LMYA 2XAFA 2ZXJA 4ENNA 5KVRA 3V7RA 3WU1B 1TQMA 2MLKA 1XN7A 3VFZA 3ZP5A 1S6LA 4HX7A 4O5VA 1IF1A 1TNSA 3HHGA 2LDUA 4EJTA 4I09A 5L3DA 1G6NA 1PUEE 2HKOA 2EV5A 3EQLF 3KLOA 4U88A 1HSJA 1R5HA 3CUQC 1BI3A 1ZHFA 4RAYA 3PQKA 3ERED 1XMKA 2VC0A 4HYEA 1ZRCA 1HKTA 5ILUA 2V9VA 4BYYA 2DFIA 3H92A 3P9IA 1D5VA 4KN7X 1WI9A 3M8FA 5JI6A 2M87A 2JPBA 2O3FA 3GFJA 2L01A 2QWWA 4NB5A 1MKMA 2KIUA 4GCVA 2J5PA 5D6EA 2OZUA 2IRFG 1ZAOA 1LNWA 3I58A 2RV8A 4L9JA 4OINF 4M72A 5HLIA 5FLXZ 4MTEA 1TQIA 1P4XA 3SXYA 1MDMB 4I98B 4ETSA 5ILVA 4M9XA 5HOOA 4OIRF 2EFNA 2RQPA 5HDKA 1B59A 4AD9A 2GQQA 3DXJF 2Y0MA 2A6HF 2IA1A 1T39A 3F22A 3B02A 3R0AA 2D45A 4PGGA 4UUVA 2A6EF 2K7LA 3WGGA 2K4JA 2KIMA 2P7CB 4CGZA 1R00A 2OQRA 4OOIA 2ZJ2A 1KU2A 4DNCA 3JW4A 1ONVA 1R7JA 5BPDA 2OD5A 3QP6A 2F5FA 2OA4A 2FBKA 2LSOA 1OKRA 2M1BA 1KA8A 1Y0UA 1BM9A 1IXSB 2GA2A 3MZYA 2Z99A 2MD5A 3L09A 1Z1DA 2XV4S 4LK0F 1TLHB 1JGSA 3N97A 2GAUA 4ZZLA 2JZYA 2CSOA 2LNBA 1TW3A 4UVAA 1YS7A 5E1XA 1BI1A 3HRSA 2QLZA 1HW5A 4MEXF 3RKXA 1U5TA 4NHJA 1SMYF 3WE3A 5CVUA 1HW2A 2Z9OA 1RI7A 2XROA 1EH6A 1YQAA 5LRRA 2RVCA 5FD5A 3FHZA 3M1EA 2VE8A 2RNJA 2DT5A 3BJ6A 3F8FA 5FFXA 1TTYA 1UHMA 3RKWA 5DCMB 3J80K 1D8KA 2DPUA 4KNYA 5DD8A 3K1PA 3IKVA 2BGCA 2KKOA 4Q4ZF 1XDUA 3IL2A 4ESJA 1UB9A 4M9ZA 1P4AA 1U6GA 1JHHA 3I4PA 4U0YA 2FF4A 4EJVA 1QPMA 5BMZA 4HF1A 1ULYA 2A68F 3J7AO 2OBPA 2VBXA 3GLXA 3LA3A 3TO7A 2EA2A 2HTSA 3JTGA 3GWZA 1FP2A 1FBUA 1P2FA 1IXCA 5TJJA 1SMTA 3ELKA 1QQIA 3GEZA 3GVAA 3CDHA 3BWGA 1HBXG 2QZ8A 1EH7A 3WTVC 4HOBA 3CUQB 3VODA 4HAMA 1O7FA 1LVAA 1K6OA 2HR3A 1FWZA 2VC1A 1SAXA 3V7CA 3GO5A 1BI0A 1Z05A 3HHHA 1J0RA 4B8XA 5J8CA 5F6FA 4LLGF 2P7VB 4YIIA 3SFZA 4LLNA 1F5TA 2Z5UA 2IA2A 4UVCA 3OV8A 1ZH5A 1E2XA 3EYIA 5AIQA 3V4GA 1B1BA 4KDPA 2FE3A 2KIFA 3TDUC 4XSXF 1LEAA 1KU9A 4GXOA 5E20A 1P4WA 2FXAA 1FYLA 3D0SA 2NAZA 3U2RA 2HGCA 1QGPA 4MHGA 2F5DA 3K69A 4ZH4F 5H6RA 3NQOA 4IRGA 2EA4A 1YIOA 4CXFA 2R3SA 2GXBA 4I0BA 2HQRA 4A6EA 3JSPA 3SZPA 1PP7U 3W6KB 3DQVC 1Z6TA 2RDPA 2XIGA 5LEJA 2W84A 2DQRA 1RIOH 3H3UA 3ABUA 5D5WB 3K0LA 3QRFF 5BOXA 2FQ3A 3R6SA 3RDIA 3MZHA 1YLFA 2FBIA 1JE8A 1H9GA 3L7WA 4IHSA 5J8FA 5CVVA 5ILSA 1MZBA 1J9IA 3DPTA 2QM3A 3RIRA 1V4RA 1S29A 3J81K 1F1ZA 3SHFA 2EFWA 3HOSA 4A5NA 2AXLA 2MLGA 2G7HA 1AOYA 1S8NA 1R23A 4UVBA 1R1VA 4H0EA 1J59A 1LDKB 4UNOA 4HF0A 2BBYA 3O3KA 3WTUC 3E6CC 2ZNYA 1WSUA 4LG0B 2Q0OA 2JT1A 1T0FA 3TOAA 3ZMZA 1BBYA 5HLGA 2W24A 1G3WA 1H9TA 3IWFA 3T8RA 3L2CA 1Z7UA 4G9YA 1KU3A 2FBHA 4IPAA 3IC7A 1MJAA 5AONA 3I54A 5LEKA 4EGZA 1NHAA 2UXXA 2XAJA 2DW4A 4I01A 2KRFA 3F8NA 2L02A 4LFUA 3KETA 5H20A 2R7FA 1ZN2A 4HDVA 3LA7A 1ON1A 1SD6A 2H6CA 5CVJA 2RN7A 2GZWA 5ICGA 2MA3A 4XBFA 1SD5A 3QAHA 1XGOA 2FA5A 1KQ8A 5JVTA 4LD5A 2Q8KA 2FSWA 1MJBA 4M71A 2W57A 2P5KA 3HYIA 3I59B 1DDNA 3FZVA 4HLYA 3KCCA 2X4HA 3DF8A 3Q9VA 1Z9CA 3NEUA 2CFXA 3C7JA 3BP8A 4HZFA 1BJAA 2IPQX 3DKWA 4PDKA 2PFBA 1J7KA 2HZTA 5D8KB 4EJUA 1WKMA 4KIFA 5CVRA 4LB5A 4WXDA 1IRGA 3VOEA 1KQ9A 3WTYC 3RI4A 4G6QA 1ZYRF 2XVCA 3DEUA 4HX8A 2OU2A 4A0ZA 2PMHA 1HKSA 5ICCA 5K1YA 3FX3A 1UCRA 1FSEA 3DV8A 2D1HA 4YFKF 4ZYGA 2YSRA 1OPCA 2JPCA 5HS7A 2O8XA 4XSZF 1BIAA 4A12A 1FY7A 3IRRA 3E5UA 4XLPF 5DYMA 4FT8A 3O2PE 4RB1A 1O7LA 4S05A 2RC4A 4ZYDA 3IKTA 5IT3A 1K78B 3GX4X 3KP5A 3FXQA 1XGMA 2O61A 3TDZC 1FX7A 4WWCA 3GZ6A 3HRMA 5LHIA 1LDJA 4OU0A 3ML6A 2Z3YA 3DPLC 4L0YB 1YTYA 1SD7A 2HFHA 3ZPLA 1FZPB 3DFGA 5FLXK 3F23A 4RGSA 5A2QZ 4BHCA 4IRHA 2IVMA 3RPQA 3ZMVA 2V1UA 5ICEA 4ESBA 2HS5A 4XLNF 3HUGA 1LB2A 3QU3A 4WF2A 4MNUA 5LBQA 3KE2A 2KJCA 3DP7A 4YIFA 5E18F 1XDSA 1YFHA 4HA8A 2RGVA 2IT0A 1UFMA 2ESHA 5EEHA 3QU6A 1XD7A 4HF2A 1PP8F 1YW8A 1XGSA 2HYGD 4EJOA 3WU0A 4P5OA 2LF8A 4CYDA 1REPC 3JAMZ 2QBYB 4XRFA 2E1NA 2XRNA 5J6XA 1T38A 1E17A 2IP2A 3CUOA 3MAJA 4BQAA 2HKXA 1W5SA 4OIPF 3F6VA 4R79A 2PLYA 2E7WA 2HDCA 2L4AA 1HQCA 4L9NA 3WE2A 2H94A 3K1MA 1W7PB 4L9TA 1OYWA 2VT2A 4KA4A 2OAZA 1RUNA 3M8EA 4M74A 3SQNA 1JHFA 4KUMA 2G7UA 4OIQF 3FMRA 4BXUA 2ZMEA 3EYYA 1O57A 2EFQA 2VODA 1IN6A 3T0YA 1OR7A 1CF7B 2GWRA 2NNNA 1XSDA 2EFPA 4L5IA 3RYRA 5D4RA 2L3DA 3BDDA 4G7HF 1ZG5A 2CQKA 3ECHA 4DQ2A 1RNLA 4A2UA 1I27A 1ZARA 1EH8A 3WGIA 4HQEA 1H0MA 2A5YB 3WTWC 3T8TA 5IT9K 3ZMDA 3HTUA 4PZJA 3L9FA 3FWEA 1ON2A 2NRAC 1W5TA 4LK1F 3M9AA 5FD6A 5E1WA 3KP6A 1R1TA 2EWNA 3GXOA 1QO0D 2NYXA 4Z2YA 4M9SA 1XSVA 2H09A 3EDPA 2XASA 2JRTA 4R1HA 4N9IA 3FXUA 1IN8A 4AVPA 1XMAA 2STWA 3LFKA 3R60A 2DLLA 2V1DA 1LJ9A 4U0WA 1WWXA 2COMA 1ZRDA 2PBIA 1WRJA 1D3YA 4ENJA 4UHTA 1Z91A 4IVNA 1I5ZA 4Q48A 3TO9A 4OMYA 3BZ6A 4BH9A 5LGUA 3ABTA 4ZZDA 4EV0A 3MQ0A 1BOAA 3I5UA 2ISZA 2VOOA 2O6GE 2K86A 3C18A 5HDGA 3FF5A 1T2KA 4ZYHA 4GGGA 1U2WA 1EV7A 3K2ZA 3G73A 1XSXA 3R0JA 2M45A 4TV7A 4UV8A 3ZN0A 1QNTA 3F6OA 4RGRA 2IW5A 3HRTA 4IF4A 1BIBA 4Y17A 3FXRA 5L3BA 5CVIA 3COAC 2A3SA 5LGNA 5CJ9A 5K5QA 4EQQA 1W7PD 3LWFA 4JBAA 2D1VA 2V1XA 5ED4A 5FFZA 2ZBKA 4NQWA 5D8LB 1GXPA 4L5JA 3WTXC 1IN7A 3EETA 1ZGJA 1U78A 4EGYA 3I0TA 1J2XA 4UXNA 4CHUA 3KEQA 2VBWA 2NNYA 4Y15A 2VOPA 3WGHA 2RKHA 1FT9A 1O3RA 1S7AA 1HSTA 3K1NA 4ON0A 3ZMTA 3K9TA 4RGXA 3FMQA 4MTDA 2E1CA 2W25A 4PGHA 1J75A 4WCGA 5DUKA 2DK5A 3IRQA 5F1RA 4G7OF 2HOEA 4AWXB 3HOTA 2D2WA 1FYMA 1ZG1A 2L54A 2CW0F 1IXRC 1ZREA 3QPHA 2HYFA 1Z6RA 3ISPA 1RZ4A 1XCVA 1LEBA 2STTA 4GO1A 1XGNA 2BYVE 4KN4X 1B9NA 2MBFA 4G6DA 1DPUA 3GUDA 2G9WA 4M6XA 4R8HA 3TO6A 3BPXA 2DK8A 2QQBA 4K2EA 1Q1HA 2VT3A 1SD4A 1TQPA 1K7AA 2PJPA 5E17F 1I1GA 4KFCA 3IHUA 1AWCA 3REOA 2O0YA 3V7SA 2EV6A 2Y75A 1S3JA 3F3XA 3FM3A 3F8MA 3BY6A 1FLIA 3N4MA 2DPDA 2YR2A 1YYVA 1YG2A 3EUHA 1YW7A 5DCFA 1C0WA 2MH9A 4WXHA 1B6AA 4YFXF 2F5EA 1U8RA 1MDMA 1YS6A 2HWVA 2ETHA 1ZRFA 4B09A 2B0LA 4EM0B 1KYZA 1UHWA 4A0XA 6PAXA 1HXDA 3F8BA 1R1UA 2Z33A 2E7XA 1R36A 3Q9SA 2WTEA 2K4BA 3L00A 5DD4A 1SFUA 4P96A 5BS6A 3ZMSA 1S7OA 2ZNZA 5JHUA 4P9FA 2W85A 4HBLA 4AIHA 1W7PA 3T1BA 4G94A 4M6YA 2C6YA 2FU4A 3HRUA 5DUIA 2VE9A 3R4KA 1O3QA 4A5MA 4EVIA 3WTTC 3FMSA 4ZYEA 1O3SA 2GA1A 4FX0A 1KU7A 2QENA 4RS8A 3E3VA 3BROA 4JQFA 4MGRA 4IRIA 1MD0A 1OYYA 3TOBA 2A07F 4N9HA 2H6BA 4O6JA 4OIOF 4WXCA 3IWZA 2QUFA 2XUBA 2FNPA 2WV0A 2BEOA 2DAOA 2K27A 2FRHA 4BNCA 1G3YA 2X0LA 3CJNA 5DCMA 1IZ1A 1KGSA 3P9KA 1G3TA 3LQQA 5LGTA 1MJ9A 2EJRA 3ZN1A 4CDGA 5ICFA 4L18B 2XHKA 1P6RA 4HV5A 4CO8A
chains in the Genus database with same CATH superfamily
3J7AY 1FOYA 2VXZA 1BW5A 5A2QK 1JXSA 2EBIA 2IS1A 3MFKA 5LRSA 2YU9J 1MSEC 1I1SA 2M30A 4ZTFA 2DOAA 3GTMJ 2XGXA 1D0ZA 2P6TA 5B1AH 1FYKA 3HIFA 1ITYA 1Y1WJ 2FNAA 2H27A 3K4BA 4P55A 1N77A 2XAQA 3RYPA 1APLC 3GTPJ 3OYJA 1FBSA 2O03A 4J00A 2EILH 3CZ6A 2WAQN 3CUQA 1DU0A 2F4OB 3EUAA 3FXKA 3KLNA 5CYVA 4KIGA 4Z6YA 4XKBA 3WG9A 3CO7C 2E36A 2PEXA 3PIOF 2YS9A 2WB1N 2ZFUA 4P1WA 2QSGX 3VSLA 3QPTA 5L3FA 1ZGAA 2GXGA 2OZ6A 3K4CA 5DEQA 4E6KG 3GCMA 3JAMK 4OMZA 1R5ID 3X2QH 1IRFA 5LLQA 3S1QJ 2BV6A 2V6CA 1ETWA 3GMEA 1SFEA 3BR2A 3ASOH 4II2A 4MLOA 4RB2C 2FMLA 3ZQFA 4KYWA 3G1MA 2ACJA 2K85A 2Q2EA 4AVZA 2CW8A 2KZVA 5F04A 2ZFWA 4AIJA 2BE5F 4NNJA 4ENKA 2BXYA 3HSFA 5F0FA 3DWLE 2L7MP 2K5CA 1Z3YA 3KEOA 2R7DA 4MQVA 5DM6F 3FK7A 5KK1A 4RB0A 3ULQB 3LNQA 4F91B 4BAYA 2OTLI 3KYCB 3E97A 3VYUB 4IQ4A 5LHGA 2JWTA 4D1QA 1BOBA 1FBQA 3E6MA 1PUFA 2E71A 1PDNC 3OSGA 5CLSA 1ODDA 4AIKA 4E70A 2DOEA 3AAFA 5H2FC 3HSRA 5FB2A 2GOMA 2IXSA 4YFNF 1OMIA 2CWEA 2PMUA 1T98A 1WCMJ 3PSFA 4II3A 1S9HA 3OWTA 3VYTB 1A04A 1P7IA 4B47A 3BZCA 1U5TC 3H1CA 4MEYF 4BY1J 4OAZA 2DA1A 1VTNC 3BCAA 1WPKA 3OOUA 3PNYA 1LFBA 2Y48A 3RPUD 5L3EA 3BG5A 1K79A 2R7UA 3CCLI 3Q5FA 4RGUA 3DCFA 2XPWA 3B6CA 4A93J 4MQ9F 3MD2A 3SFIA 1Y8RB 3U1DA 4E7ZA 1FPQA 2OCCH 2CG4A 3KP2A 2CQQA 3OYGA 1BA5A 4PSXA 5EG0A 3OYHA 4YG2F 3E5QA 2JVGA 1Y56A 4HQMA 5D5XB 2P8TA 4KIBA 2VKHA 3ONQA 1HKQA 1GVDA 4RB3C 4WX9A 2KJBA 2L0KA 3TW7A 3BTLA 5HVQC 2QYOA 2QQ9A 2IBDA 4HEA2 3E6BA 3VEPA 5C44J 2CGPA 1I6HJ 2MW8A 2Z16A 3JTHA 4HNTA 3L1PA 2XPVA 2EK5A 1FC3A 3OOPA 1P92A 3BR6A 1DP7P 1ZG3A 4A3EJ 5D5VB 2IA0A 1CGPA 2M8GX 1FSHA 1YRNB 5E1ZB 5E8IA 3AG1H 1IV8A 2NS0A 1R22A 1RRJA 2J5OA 2ZCWA 4NUBA 4KMUX 2EPFA 1OLTA 3PQJA 4U0VA 2KISA 2V79A 4FE7A 5D6FA 2DMTA 2K9SA 2A69F 3WODF 4OAYA 2DBBA 2P4WA 3QYEA 4I02A 3I55I 1YOVB 5EEAA 2Y0SN 1QZYA 3RTRA 1WJDA 1NK3P 4QLCU 4KICA 1OCRH 3BR0A 4ENMA 3OYEA 4HW0A 5EYRA 3RZDJ 1YO5C 2X6OA 1MGTA 3S1MJ 1G4DA 3MWMA 3S15J 2ISYA 2QSFX 2KL4A 3KIOA 3OL3A 3KZZA 1F9NA 2JTVA 5CPRB 3ECOA 1U0JA 3N05A 1SFXA 3ROUA 3J80Z 3U21A 1TNTA 3LA2A 5KCMA 1T6SA 4LG0A 4RM2A 3CMAI 3MN2A 5IT9Z 1JKRC 5LD2C 1I6XA 2H1LA 2YU3A 3ZQCA 2P0WA 3Q3SA 3S93A 1IW7F 2X1EA 3T5XA 2W1OA 4QPOA 3B73A 1J5YA 3S3NA 2QSHX 4CSWA 1Z7LA 1IJWC 4HDUA 4GYIA 4ANJA 2M34A 3V8JA 3DLLF 2EH3A 1YJ9I 4LB6B 2ELKA 3MVPA 1XB4A 2FX0A 3OYDA 1GVJA 5TRDA 3FM5A 4KT5C 4CZZA 3A03A 2XSDC 4Q5SF 2HEOA 3GFIA 2LF7A 5D5UB 3CCQI 3BJOA 1A6QA 2P5LC 5FGMA 3QP5A 4FX4A 2DA4A 2O5RA 2XKPA 1N75A 4PSWA 1EKEA 4ASNA 2RNGA 2IS2A 4JK1X 2JJ7A 4AC0A 1B9MA 1R71A 1ZLJA 4AU7A 1R5GA 2YX7A 3ZCOA 3WTSC 3H5AA 2A61A 3HUGB 1VZ0A 3KP7A 5K5OA 1BI2A 2NOGA 1TBXA 2F4MB 4EM2A 3TGNA 4E4HA 1KYWA 2DA3A 5JR3A 3TBIA 2P6SA 1BW6A 3V8KA 4BEHA 2QVOA 1E3PA 1IUYA 2AQFA 4G6TB 2FUG2 5BPIA 1WJFA 2BY2A 4M3BA 1ZR4A 4YIRX 3PJRA 1V3FA 2VBZA 1PJRA 3RZOJ 3O8GA 3D5LA 1F36A 3H5NA 3PNVA 1W0UA 2VONA 4PCQA 2ELHA 3GW2A 4O3MA 4A3DJ 1FP1D 2CO5A 4IZZA 1MH3A 2B9SA 3I64A 4L9VA 3H3ZA 9ANTA 2N8GA 5HS8A 5LHHA 2BHYA 4ABZA 1FTTA 2NVTJ 3MCZA 1IUFA 2OQGA 1UG2A 3RSNA 3LAPA 1POGA 2Y9YA 2EV0A 3I71A 3LL7A 4XONA 3GFMA 2PN6A 3GZ5A 4U7DA 4FHTA 4E7IA 1KQ0A 2M0CA 3DKYA 4JX6A 5HDNA 2HQNA 1STZA 2FEZA 2L4MA 2YPRA 3E5XA 5FO5A 1OCPA 3I59A 1USTA 5JFRA 2HDDA 2HOAA 4HV6A 2VB6A 3ZR8X 2IGKA 1IAWA 4LIVA 4EM1A 3LSJA 2ADUA 3JRHA 4CA0A 5HNHA 2DU9A 1TWFJ 2MH2A 2I10A 3PFIA 1MBGA 1OYIA 4YELA 3V8LA 2DQLA 3W2VA 1JI8A 3QPSA 1FOKA 3D5RC 4IHVA 2HXIA 3I53A 1B4AA 5JLXA 4ZDOA 4IXAA 3S32A 5HS9A 2QQ8A 2HTJA 4RAZA 3E6DA 3CQZJ 1VQLI 2ZMEB 5HLHA 1ZLKA 2TCTA 4RM3A 3RPUA 3U9GA 5CKTA 5JLWA 2K9QA 4A3CJ 2R5ZA 3F72A 1O3TA 3CP2A 3DU5A 5L3CA 3B6AA 3TQNA 4P9UA 1MIJA 2F2EA 3S8PA 3S3OA 4G8XA 2PI0A 4QTRA 4A3GJ 1IDYA 2HZDA 2XSJC 3VB2A 3MKZA 3W6JB 1MMAA 1X2MA 1R58A 1U5TB 1BC7C 4FQGA 4D5FA 2O7OA 5F64A 2Z2SB 4N4NB 2QQAA 2LR8A 1GDTA 3F21A 2DMUA 4DIQA 3GZNB 2IJLA 3KZYA 1GHCA 3SYTA 1BL0A 1D0XA 1BR1A 4BQOA 3KFWX 1GXQA 4MFDA 5E3OA 4G7ZF 2WC2A 4KMFA 2WAQA 1T0FC 1TW2A 4Y33A 3BLYA 4C9YA 1N78A 3M7GA 1RESA 2X48A 4IHTA 2ZB9A 5GTIC 1X3UA 1HW1A 1UAAA 3BPVA 1QZZA 2DMQA 2FQ4A 1ETKA 2LOOA 1WJCA 1BN5A 4EMSA 3F8CA 3S2WA 1D8JA 2FOKA 2HVRA 4QWQA 3WTZA 3CO6C 4IOAF 4D0PA 3KP3A 1K78A 2OV7A 4IHYA 1FEXA 3LQRA 3NRVA 3FKJA 1OCZH 3HG9A 3BCBA 4CICA 5EEGA 1ZTRA 1VQKI 4IJAA 4E7SA 2XKOA 3RKQA 2GLOA 4EEFG 2VBYA 1YJWI 2PQ8A 3BZKA 1L0OC 2HI3A 2LY2A 4A0YA 3BJAA 1R4MB 1W4MA 4ZC3A 3J81Z 3Q0WA 1QBJA 2XGEA 1QZEA 1YJNI 3CDLA 4B44A 5L3GA 5FKOA 4BE2A 1G3SA 4N0BA 3GYHX 4F7ZA 2ME0A 2NS8A 3LSGA 1E3OC 5E8GA 1IN5A 2XAHA 3QOPA 5H6QA 5ERIA 1USSA 5DV5A 1AHDP 2QF7A 3IH4A 3BR5A 4ESFA 3CTAA 1TL8A 4GRIA 4L0ZB 4M73A 3CCRI 2UWMA 1IN4A 3NARA 2TDXA 3J7ZI 3ASNH 2E5ZA 2DDBA 3GF2A 2HQ5A 2VPLA 4BHPA 3KP4A 2ECBA 1S5LC 2EIKH 1HOMA 4A6DA 1L3LA 3HSEA 4UV9A 3CC2I 4XORA 1H88C 2ZKZA 3DLAA 2BVLA 1SFOJ 2JRMA 1YW9A 4HLXA 4I0AA 4XMYA 4QSHA 1I3QJ 4X6AJ 4LGWA 3JRDA 4LJZF 2JVHA 1FNNA 1IV6A 2O9LA 2BXZA 1QVTA 3WHBA 4RBOA 3K4NA 3GTQJ 1R4NB 3MZ8A 2UXNA 1R9TJ 1QU3A 1X2NA 2HOTA 4V19K 1H89C 1X1DA 4N4OB 4EJWA 3J7YJ 4B3AA 2E1OA 3P9CA 1LDDA 2RAEA 3U1KA 3P7NA 1F4KA 2BVMA 3R61A 2X1CA 2K02A 2DFHA 3BOQA 2GIVA 3PM1A 3HB9A 5KAFC 4W1UA 2QBYA 2AS5F 4BHBA 2P5VA 3CLQA 3G3ZA 4RA2A 3JSOA 2UZKA 4ITVA 1BC8C 2LKPA 4I7HA 2FMYA 5DDGA 2M8EA 1IDZA 2F5CA 1XCBA 2JSCA 2WWYA 2L7KA 2VN2A 2ZO4A 1LQ1A 4I2OA 4XK4A 2M5WA 2ESNA 3C3WA 1U3EM 1DPRA 3TKYA 3OYMA 2EFOA 4HX4A 4Y13A 4Q47A 2YX4A 3LSTA 2DO7A 1MMGA 3ZMUA 2JN6A 5EZHA 2H8RA 3MEXA 1HDPA 3O6BB 3CLOA 1FJLA 5K5RA 1U9OA 4NQWB 5JHFA 1Y1VJ 3HM5A 2VQGA 5E3NA 2DI3A 4LLLA 2W82A 3C1DA 3I56I 3A2KA 1RUOA 3HTSB 1WQ2A 3GFLA 1VQPI 2NVXJ 2DODA 2Y0SA 1V54H 2DTRA 3LAJA 2EB7A 3QYBA 2CUZA 5GADJ 3HGGA 1XX5A 2WV1A 2CRGA 1CF7A 4S04A 4GYGA 4XN0A 4U7BA 2HNHA 5JVGF 5BQTA 3RJPA 3SZTA 3ZQ7A 2VKVA 2PG4A 4LOCA 2MC3A 5AIPA 3RKYA 4OWRB 1UJ8A 5D4SA 4WK8F 2XAGA 2HVQA 2X6XA 1DUXC 2CYYA 4CYCB 2DYSH 4LMYA 1GLNA 1O4XA 2XAFA 3Q0VA 2XPUA 2ZXJA 4ENNA 4D5CA 5KVRA 3V7RA 4C3HJ 3ERMA 3WU1B 1TQMA 2MLKA 1XN7A 3D1NI 1ACIA 3BR3A 3VFZA 3WG7H 3HEFA 1Z77A 3ZP5A 1A6IA 2KRHA 1S6LA 2HQAA 2DA6A 1WH7A 1WJ5A 4HX7A 2ZJRF 4O5VA 2HDWA 1IF1A 4DGWB 1TNSA 5M3MJ 3HHGA 2LDUA 4V2FA 4EJTA 4I09A 5L3DA 4AIDA 2HPMA 5IYBJ 3OSFA 1G6NA 2ID6A 1PUEE 2HKOA 4Y52J 1X3WB 2EV5A 4A3BJ 2XF5A 1EA3A 3EQLF 3KLOA 4NC8A 3SEQA 3DTKA 4U88A 1HSJA 5HODA 3A01A 2OPTA 1R5HA 1SFKA 1JUSA 4BBRJ 3JRCA 3CC7I 2R7SA 2KMUA 4XQFA 3CUQC 1BI3A 1TT0A 3CMYA 4A3LJ 1NH3A 2R0QC 1ZHFA 3PUBA 4RAYA 2DT7B 3PQKA 1Z0XA 1T8IA 2QA4I 3ERED 5K7FA 1XMKA 2VC0A 4HYEA 4XLHA 4B4CA 1ZRCA 5FLMJ 1HKTA 2NVUB 2B63J 5ILUA 2V9VA 4JP0A 2P81A 1T56A 4BYYA 2DFIA 3H92A 3P9IA 1D5VA 1IO2A 3ZXSA 3PL8A 4KN7X 1WI9A 3M8FA 5JI6A 5GP9A 1WHUA 1X1BA 1Y0NA 2M87A 2GBYA 2V7FA 2JPBA 2O3FA 3GFJA 2GOXB 2L01A 4C2MJ 1B72B 2QWWA 4NB5A 1MKMA 3I4MJ 3CMEI 2CMPA 2E35A 2KIUA 5J1YA 5F1JA 4FISA 3W2WA 4X0GA 4GCVA 1MBEA 2J5PA 5D6EA 3FISA 2OF7A 2OZUA 4D7NA 1ZAOA 4HNUA 2IRFG 1LNWA 3I58A 3EPZA 2B7EA 3S3MA 2RV8A 2DMPA 4L9JA 1ORKA 2PMZN 2CW7A 4OINF 4M72A 5HLIA 5FLXZ 4IHXA 4MTEA 3UKGA 3HXLA 3P5JA 4XR6A 1TQIA 3CDIA 2LREA 3JRIA 4BJ6C 3H36A 5K7HA 1MH4A 1P4XA 1ETYA 2K3PA 3K4KA 3NWSA 4BGDA 3OYAA 3SXYA 1MDMB 4I98B 4ETSA 1DQUA 5ILVA 1W36C 4UUTA 4M9XA 5HOOA 4OIRF 4FASD 2EFNA 2XRLA 3CESA 2RQPA 5HDKA 5FROA 2R7VA 3FXMA 1B59A 2MABA 3S1NJ 4XLEA 2ZMEC 2DN0A 2UUZA 3IH3A 2VIXA 2VXDA 1X1AA 4NC6A 2GQQA 4AD9A 3DXJF 2Y0MA 2A6HF 3JRFA 2IA1A 1YX3A 1T39A 3F22A 3B02A 3R0AA 5E79C 1OR7C 2D45A 4PGGA 4UUVA 2A5WA 2A6EF 2K7LA 3WGGA 1ERDA 2K4JA 2KIMA 2P7CB 4CGZA 1R00A 3OYFA 2F4IA 3OYCA 2OQRA 1OCOH 4OOIA 2ZJ2A 1KU2A 2V4JC 4DNCA 3BC8A 2VJ5A 3JW4A 1VQ7I 1ONVA 1R7JA 2DA2A 1RC9A 2I8DA 2OD5A 4W97A 3HPHA 5BPDA 2HVSA 3QP6A 2F5FA 2OA4A 1MNEA 4HNVA 2FBKA 3F9KA 2LSOA 1OKRA 2M1BA 1KA8A 3HL2A 2FD5A 3K70C 1OISA 3CJQB 1Y0UA 1BM9A 4PK4A 4RDUA 1IXSB 2GA2A 1VQ4I 1AU7A 2ME6A 2OUMA 3MZYA 2VL8A 2DCEA 2CS3A 2Z99A 4X1EA 2MD5A 5GTHC 4BDYA 3CCUI 3L09A 1Z1DA 2M4KA 2XV4S 4XKVA 4LK0F 5E3LA 1TLHB 1JGSA 3L2RA 3N97A 2ZSIB 4HG2A 2GAUA 4ZZLA 2LK2A 2JZYA 2CSOA 2LNBA 1TW3A 2VI6A 2VQHA 4UVAA 1YS7A 3CCSI 2JA8J 5E1XA 1U8BA 2CV0A 1BI1A 3KPHA 3HRSA 2QLZA 1HW5A 1SVOA 4MEXF 1XG1A 3RKXA 3TP0A 1QVUA 1U5TA 2V9KA 3PNTA 4PFPA 5FKLA 4NHJA 1SMYF 3WE3A 1XS9A 5CVUA 3HBLA 1HW2A 3IH2A 1SAUA 2Z9OA 1RI7A 1PVEA 2XROA 1EH6A 4KITB 5IYCJ 3CC4I 2WAFA 3S14J 1EF4A 1YQAA 1WJBA 3JCUC 5LRRA 2RVCA 2Y31A 3BTIA 5FD5A 3FHZA 3M1EA 2V6EA 2VE8A 2RNJA 2DT5A 4D7MA 2E60A 3BJ6A 3F8FA 5FFXA 1TTYA 4I6ZA 1K83J 1UHMA 3RKWA 5DCMB 3J80K 1D8KA 2DPUA 4KNYA 2MFZA 2L9VA 3K1PA 5DD8A 4DJAA 1GV5A 5KNLA 3IKVA 2BGCA 3OS1A 2KKOA 4Q4ZF 1XDUA 4LIUA 3IL2A 1HCRA 1D1BA 4YEJA 4ESJA 1UB9A 1D0YA 4M9ZA 1P4AA 3CJRB 1U6GA 1JT6A 1JHHA 3HOUJ 3I4PA 4XICA 4U0YA 3IP4B 2FF4A 2KDZA 4EJVA 1QPMA 5BMZA 4HF1A 1ULYA 2A68F 3J7AO 1JKOC 4UY8I 2OBPA 2VBXA 4UUSA 1R6RA 3GLXA 2E2IJ 5IYDJ 3LA3A 2IS6A 3TO7A 2EA2A 2XDVA 2HTSA 3JTGA 3GWZA 4E7KA 3RQ4A 4IHWA 4BJ5C 1NG6A 1FP2A 2L7ZA 4BY7J 1FBUA 1P2FA 3OIOA 1XPXA 1IXCA 5TJJA 1SMTA 1WJAA 1W0TA 2LRDA 5FRNA 3ELKA 1QQIA 3A0HC 1YI2I 2X1DA 3GEZA 3GVAA 3CDHA 5GAEJ 1Q1VA 3BG3A 2QKLB 1D1AA 3BWGA 3VWBA 2X85A 2QZ8A 1HBXG 2HXOA 4XRSA 2KPMA 1EH7A 4RLFA 3WTVC 4HOBA 3CUQB 3VODA 4V2GA 4IX7A 4HAMA 1O7FA 2LC2A 1LVAA 1K6OA 2HR3A 1FWZA 4M3EA 3G1OA 2VC1A 4BQNA 2QCOA 4Y7NJ 1R49A 5F08A 2COBA 3DTIA 1SAXA 1IC8A 3V7CA 3AKZA 2OTJI 4CH7A 3GO5A 5EZGA 4BL0B 2D5VA 4CZCA 2NVQJ 1BI0A 1Z05A 2BHZA 1J0RA 3HHHA 4B8XA 4RAGA 5J8CA 4M6VA 3EUKL 5F6FA 5BNGA 4LLGF 3M3YJ 2P7VB 3HOYJ 5J1RA 4YIIA 2Q2EB 2X6YA 3SFZA 4XL9A 4GDFA 4LLNA 1F5TA 2KRCA 2Z5UA 2CU7A 2IA2A 4UVCA 1V5GA 2GXAA 3IAM2 3OV8A 1ZH5A 1E2XA 2DMNA 3EYIA 5AIQA 1MW7A 5F27A 3V4GA 1B1BA 4KDPA 2FE3A 1QA6A 2KIFA 2LLKA 1RR8C 3TDUC 4XSXF 4JX4A 1LEAA 1KU9A 4GXOA 5E20A 1PUFB 3PSIA 1P4WA 4DYCA 2FXAA 1FIPA 3D0SA 1FYLA 2R7OA 2NAZA 4S0HB 3U2RA 2HGCA 5EDNA 1IRXA 1HF0A 1QGPA 4MO7A 1D5YA 4MHGA 3DBRB 1A5JA 2LY9A 2F5DA 3K69A 4ZH4F 1I50J 5H6RA 3NQOA 2BW3A 4IRGA 2EA4A 2WADA 1YIOA 2G0EA 4CXFA 3OIQA 4IKFA 3QQAA 5DS9A 2R3SA 2JA7J 1LFPA 2F5VA 2GXBA 2R7TA 4H4KC 5C4JJ 4B3XA 3S1RJ 4I0BA 2HQRA 1S72I 1DU6A 4A6EA 2IAIA 3JSPA 2HU9A 3ZQGA 3CCVI 3S2HJ 1QPIA 3SZPA 2JSPA 1PP7U 2R7WA 3W6KB 2L7FP 1BR2A 2ID3A 2KLOA 3DQVC 1Z6TA 5EG0B 1AKHA 2RDPA 2XIGA 1E3HA 4G12A 5LEJA 4XKWA 2AO9A 2W84A 1EJ9A 1S7EA 2DQRA 1RIOH 3H3UA 4CCLA 3LSKA 3ABUA 2LBFA 5FKNA 5D5WB 5EGOA 3L2VA 4F93B 1LPQA 3K0LA 2CQ7A 1X58A 3QRFF 3ZOBA 5BOXA 3FBNB 1A35A 2FQ3A 3R6SA 3RDIA 3MZHA 3F0CA 2R5YB 3H9JA 2JA5J 1YLFA 2FBIA 1JE8A 1VQ6I 1H9GA 3L7WA 5GPCA 4IHSA 5J8FA 1Y39A 2PJRA 5CVVA 1RKWA 5ILSA 2WB1A 1MZBA 1KONA 3DPTA 2QM3A 1J9IA 2R4GA 3RIRA 1V4RA 1S29A 3QWLA 3J81K 1F1ZA 3SHFA 2VQLA 3M1CA 4PUSA 2EFWA 3BQYA 4CCKA 4BUPA 2AXTC 3G1LA 3HOSA 2IS4A 4A5NA 1TWCJ 2AXLA 2MLGA 1TT5B 2G7HA 1AOYA 2PMZA 1S8NA 3H9QA 4Y4RA 1R23A 4UVBA 5J4YA 2VQCA 1R1VA 4H0EA 1J59A 3A4CA 5M3FJ 1SC7A 1LDKB 1VNDA 4UB6C 4UNOA 4HF0A 2BBYA 1RKTA 3O3KA 4RAFA 5TGTA 3WTUC 3E6CC 2ZNYA 3TMOA 1WSUA 2CQXA 3ESWB 3G2BA 3OYLA 4LG0B 2Q0OA 3EUHC 2LFBA 3HOXJ 2JT1A 3CF2A 1T0FA 3TOAA 3GTGJ 3ZMZA 1MSFC 1BBYA 5HLGA 3GBGA 2W24A 1G3WA 2F48A 1H9TA 3IWFA 3RQIA 3T8RA 4UB8C 3L2CA 1Z7UA 4G9YA 2V1NA 1KU3A 2FBHA 4IPAA 3IC7A 1MJAA 1LUJB 2V9PA 5AONA 3I54A 5LEKA 3AG4H 3SDBA 4EGZA 5GAGJ 1NHAA 2EIMH 2UXXA 1JJ8C 2XAJA 1VQMI 1TC3C 2DW4A 2DFFA 4I01A 1LE8B 2LYCA 1IG7A 2KRFA 3F8NA 1IGNA 4ZYAA 2L02A 3SZGA 5M5XJ 4LFUA 3KETA 1JKQC 1UZCA 5H20A 2R7FA 2IGMA 3GLLA 1B8IB 1ZN2A 3ZQHA 4HDVA 4U87A 3VYSB 1XC5A 3LA7A 1ON1A 1SD6A 2H6CA 4L5EA 3M8JA 1MBFA 2M3AA 5C4XJ 4BEHB 3OYIA 5CVJA 2RN7A 5CQGA 5HLTA 2GZWA 3HJEA 3DU6A 5ICGA 2MA3A 4CCOA 4XBFA 4DOZA 1SD5A 3BG9A 1OCTC 3QAHA 3HOVJ 1XGOA 3MKYB 2EZKA 3ZRGA 2L9NA 2FA5A 1ETVA 1KQ8A 5JVTA 4LD5A 3LSHA 3SEZA 2ZC2A 2Q8KA 2FSWA 3ABMH 1MJBA 4KJZA 3K2AA 1YIJI 4M71A 1K6YA 2W57A 1MNMC 2MYSA 5C3EJ 2XGDA 4PJNA 2XB0X 3QOEA 2P5KA 2OJED 3HYIA 3I59B 4B1RA 2ZJQF 1DDNA 3FZVA 4HLYA 3KCCA 2X4HA 3DF8A 3Q9VA 1Z9CA 1ZGWA 3LSIA 3NEUA 2CFXA 4RLQA 2W48A 3C7JA 4E7JA 1W36D 3BP8A 2CV2A 4HZFA 2LKSA 3BTCA 2BY1A 1MBJA 4NDLA 1BJAA 3HDDA 2IPQX 3DKWA 4PDKA 4F3QA 2PFBA 1HLVA 2VLAA 1J7KA 2HZTA 5D8KB 2ELJA 5DM7F 3FIWA 4EJUA 2Y2ZA 4IEJA 3CF5F 1WKMA 4KIFA 1TWHJ 5CVRA 2LVSA 2R5ZB 2CUFA 4LB5A 4WXDA 1IRGA 1LKXA 3VOEA 1KQ9A 5IP7J 3WTYC 3RI4A 2Y9ZA 3L2WA 4G6QA 1ZYRF 1ZELA 2KZGA 3H35A 2XVCA 3DEUA 4HX8A 2OU2A 2ZXHA 3RCOA 2BZTA 3AFHA 4A0ZA 2PMHA 1HKSA 3LMMA 1JKPC 5ICCA 4M3DA 5K1YA 3FX3A 3JRGA 3K70D 1UCRA 3ZQQA 1FSEA 4B48A 3DV8A 2A05A 2DJIA 1Z67A 2D1HA 5B5EC 3Q0UA 1YRNA 2H1KA 2ZSHB 2E1MC 4AM3A 4YFKF 4ZYGA 2R92J 1ZQ3P 2YSRA 3OR1C 4J01A 3M4OJ 1OPCA 2JPCA 5HS7A 2O8XA 4XSZF 1BIAA 3E0JB 4DBQA 4A12A 3K4MA 1FY7A 2MGQA 3H3VK 3IRRA 4E7LA 3E5UA 3K6GA 4XLPF 3PFYA 2Z1DA 3FXLA 5DYMA 2O8KA 2K9MA 4FT8A 2DYRH 4HSRA 3O2PE 4RB1A 2VASA 1O7LA 3CCJI 3AG2H 2KDOA 3C2GA 3HPGA 4S05A 2RC4A 2V26A 5J40A 4ZYDA 4XOPA 5IT3A 3IKTA 1K78B 3GX4X 2JK3A 3KP5A 3HKZN 3FXQA 1WZ2A 1G8XA 2KHMA 1XGMA 2M7BA 4RMNA 2O61A 3TDZC 3D5SC 1FX7A 3CJTB 1F43A 3TP3A 1VFCA 3ZQLA 1ZR2A 5GPAA 4WWCA 3GZ6A 3G6EI 3SDGA 3HRMA 5LHIA 3PO3J 2DT6A 1LDJA 4OU0A 3ML6A 2Z3YA 3DPLC 1ETQA 4GFBA 4L0YB 1MMSA 1YTYA 2KIQA 1SD7A 2HFHA 4AUXA 1K61A 4ZTJA 3ZPLA 1FZPB 3DFGA 1ZK8A 4KISA 2W4SA 5FLXK 3F23A 4RGSA 1QHGA 2LY1A 5A2QZ 3IV5A 2WY8Q 4BHCA 4IO9F 4IRHA 2IVMA 3RPQA 3ZMVA 2MG4A 2V1UA 3GTOJ 2RQQA 4M3FA 5B3SH 5ICEA 4ESBA 2R7ZJ 2HS5A 4YRVA 3LFUA 3CCYA 3HUGA 4XLNF 1LB2A 3M07A 3QU3A 4WF2A 4MNUA 3KE2A 2KJCA 3ZGKA 3DP7A 4EATA 4YIFA 1ETOA 1XDSA 5LBQA 5E18F 1YFHA 1VQ5I 4HA8A 3DTEA 4B43A 2DXIA 1TWAJ 2RGVA 2IT0A 2E19A 2M7AA 1UFMA 2ESHA 4I99C 2E2HJ 2L2OA 3QU6A 5EEHA 3LSRA 2MSYA 4PFOA 2WAEA 1XD7A 4HF2A 1PP8F 4CCJA 1YW8A 1XGSA 2HYGD 2DFEA 3W6VA 4EJOA 3WU0A 3FHNA 2WA0A 1ENHA 3FXJA 4P5OA 1WFXA 2LF8A 2WBMA 2MC4A 4CYDA 3LSPA 1REPC 3JAMZ 2QBYB 4XOTA 4XRFA 2E1NA 2XRNA 5J6XA 1T38A 4KT6A 1E17A 1PYVA 5IPAA 2L9RA 3AL0C 2IP2A 4PJ0C 3CUOA 3MAJA 4BQAA 2HKXA 1W5SA 5IOYA 4OIPF 3KZIC 3W2AA 3C2HA 3F6VA 1T33A 3PIPF 4R79A 2PLYA 1VQ9I 1WI3A 2E7WA 3IUOA 2HDCA 2L4AA 1HQCA 4L9NA 3WE2A 2H94A 3K1MA 1W7PB 2CQNA 1JGGA 4L9TA 2UV1A 3CD6I 2JMWA 1OYWA 2ECCA 2VT2A 4F92B 4KA4A 2OAZA 1RUNA 1SVMA 3M8EA 4M74A 3SQNA 1JHFA 4KUMA 2IGNA 2G7UA 1W5CC 1YE9A 2QGUA 4OIQF 5B66C 4CCNA 2DA5A 3FMRA 1H8AC 1FIAA 4BXUA 3O8HA 3I3LA 2ZMEA 4XLAA 1K4TA 1VQ8I 3H9GA 3I4NJ 3EYYA 5EF6A 1O57A 2LD5A 2JA2A 2EFQA 1QRYA 3LSMA 2VODA 1IN6A 3T0YA 3OR2C 1OR7A 3JR9A 5IY5H 1CF7B 2JQ7A 3CMMA 4XM3A 2K40A 5EJCA 2GWRA 2NNNA 4J19A 1XSDA 2EFPA 4L5IA 3MKLA 1AA7A 2ZJPF 3RYRA 3OMYA 2I5UA 3CP8A 5D4RA 3OY9A 4BQQA 1P7JA 1VF9A 2A6TA 2HYJA 2RREA 3DEWA 2VUMJ 2L3DA 3BDDA 4G7HF 1ZG5A 2CQKA 3ECHA 5FRMA 4DYQA 1ETXA 3E7LA 4DQ2A 1RNLA 4A2UA 1I27A 4ZJZA 5B1BH 3OIPA 1ZARA 1EH8A 3WGIA 2R5YA 4HQEA 1H0MA 4BE1A 2A5YB 4A3JJ 4MIMA 4NBQA 1TP4A 3WTWC 4A3IJ 3T8TA 5IT9K 3ZMDA 3OYKA 2XF6A 3HTUA 4PZJA 2KQRA 1HDDC 1BJZA 1UMQA 2BY3A 3FWEA 1ON2A 1MMNA 3L9FA 4C3JJ 3JRBA 2NRAC 2ICWG 3OYNA 1W5TA 4LK1F 2CUJA 3M9AA 3S2DJ 5FD6A 5E1WA 2R7RA 3KP6A 1R1TA 2EWNA 3GXOA 3PUFA 1QO0D 2NYXA 4Z2YA 4M9SA 3E1SA 3KYLA 3G4SI 3FKIJ 2E1MB 3HGYA 4DZPA 1XSVA 2H09A 3A01B 1MBHA 3EDPA 2M9HA 1P9QC 2XASA 2JRTA 4AYBN 4R1HA 3DBLB 4N9IA 2EIJH 3L2UA 1SVLA 1X3ZB 3NAUA 2DJNA 3ABKH 1RETA 4XLFA 3QODA 3FXUA 1IN8A 4FETA 4AVPA 4BXFA 1V55H 1FOWA 1UELB 2LKXA 1XMAA 2STWA 4C30A 3LFKA 3R60A 4IQJA 2NOJB 1FOXA 1M1EB 2DLLA 1LJ9A 2V1DA 4U0WA 1WWXA 2COMA 1ZRDA 2PBIA 5FKKA 4C2UA 4XLCA 1WRJA 1GUUA 1D3YA 4ENJA 4UHTA 3FXOA 1Z91A 4IVNA 1I5ZA 4M3GA 4CCMA 4Q48A 3TO9A 4OMYA 2W00A 1UG0A 2Q1ZB 2XAUA 3BZ6A 4BH9A 5LGUA 3ABTA 4ZZDA 4EV0A 4PJJA 3MQ0A 5FJ8J 4IOCF 4A3MJ 5FLVA 4FCYA 4DZJA 5FKMA 1BOAA 3I5UA 1FMVA 4D9JA 3H0DA 2ISZA 1LE8A 2CUEA 2YUSA 3OYBA 2VOOA 2O6GE 2K86A 4JX5A 5LFAA 3C18A 4IL6C 3OS2A 4FTHA 5HDGA 3TW6A 4BACA 4BBSJ 1B8IA 4A69C 3FF5A 3VPRA 5GAHJ 1VQOI 1T2KA 4BKXA 4ZYHA 4GGGA 2VKDA 1U2WA 1FTZA 1MNDA 1W1WE 3CCEI 5CQEA 4F55A 2GM4A 5IOZA 4ZDPA 3S16J 1EV7A 1KZHA 3K2ZA 4QPQA 3BR1A 3G73A 1XSXA 3R0JA 3AG3H 1YHQI 2M45A 4TV7A 4UV8A 3ZN0A 3BTJA 1QNTA 3F6OA 4RGRA 4BDZA 2IW5A 4QIWN 4BXXJ 3HRTA 2M4GA 3G71I 4IF4A 1BIBA 2R7QA 4Y17A 2KT0A 3FXRA 1VQNI 5L3BA 1E0EA 5CVIA 5KHDA 4HSTA 4XKCA 3COAC 3TL4X 2A3SA 5LGNA 5CJ9A 5K5QA 1YX5A 4EQQA 1W7PD 3LWFA 3H5RA 4JBAA 2D1VA 3DEEA 5J1UA 2V1XA 4CUGA 5ED4A 1FMWA 5FFZA 2ZBKA 4NQWA 5D8LB 1GXPA 2HOSA 3KEYA 1WGXA 3A1YA 4L5JA 3WTXC 1IN7A 1JJ6C 2CJJA 2GIZA 4BU2A 1JT0A 4FE4A 3KX2A 2E2JJ 2XGCA 3V42A 5M5WJ 3EETA 3AL0B 2JA6J 1ZGJA 3K4JA 1I3AA 1JUPA 1X19A 2IGOA 1V5FA 1U78A 1Y8QB 4MFEA 4EGYA 3I0TA 3HKZA 1J2XA 3DPUA 3HOWJ 2F6CA 4UXNA 2NXNB 2L9SA 4CHUA 3KEQA 2VBWA 2NNYA 4Y15A 2VOPA 3WGHA 2DDAA 2IEKA 3OS0A 2RKHA 1FT9A 5F0HA 4CYCA 2ZXWH 1O3RA 1S7AA 1HSTA 4C2TA 1WH5A 3C2BA 3FK6A 1BR4A 1A36A 3K1NA 4ON0A 3ZMTA 2TRTA 3K9TA 5M5YJ 4RGXA 3FMQA 4MTDA 2E1CA 2QKMB 1NG7A 2W25A 4BJTA 4PJLA 1DGRM 1JTXA 4PGHA 2FJ1A 1J75A 4WCGA 2X6WA 1G2HA 5DUKA 1TWGJ 1X1CA 1X1PA 2DK5A 3IRQA 5F1RA 4G7OF 2HOEA 4AWXB 3JREA 2VPRA 3HOTA 2CH0A 2D2WA 1FYMA 5F0CA 3L2QA 3GTJJ 1ZG1A 3TEDA 2L54A 2LH9A 2CW0F 3JRAA 3DKXA 4NC7A 1IXRC 3WHCA 1ZREA 3QPHA 2HYFA 1Z6RA 2MD0A 3ISPA 1A31A 3VDXA 1RZ4A 1XCVA 1LEBA 1UHSA 2STTA 1NTCA 1X4PA 4GO1A 3IAS2 1XGNA 1I39A 2BYVE 2HPIA 4KN4X 4E7HA 1B9NA 1K4SA 4HPQA 2MBFA 4G6DA 5TISC 1VI0A 1DPUA 2LMDA 4UUSB 3GUDA 2AQEA 2G9WA 2XF7A 2QEXI 4M6XA 3ZQIA 4R8HA 3TO6A 3I9V2 3BPXA 2DK8A 2QQBA 2DTZA 4K2EA 1Q1HA 2VT3A 1SD4A 1TQPA 1K7AA 2PJPA 1U9NA 5E17F 4LG3A 1CQTA 2DA7A 1I1GA 4KFCA 3IHUA 1HC8A 1JUMA 1MMDA 1AWCA 3REOA 2O0YA 3V7SA 2EV6A 2Y75A 1DP3A 1B72A 5IP9J 1S3JA 3F3XA 3FM3A 1SANA 3HZJA 4DBRA 1WVRA 3QYFA 3F8MA 1OFCX 2LG4A 4PJMA 1GT0C 1J09A 3BY6A 1FLIA 2NVYJ 4JYKA 5K7ZA 3WU2C 1Z21A 3N4MA 5KAIC 2DPDA 1GV2A 2YR2A 3A0BC 1YYVA 1YG2A 1T08B 3EUHA 4F52A 1YW7A 1D1CA 2R7XA 4XRMA 5DCFA 3GTKJ 1V5EA 3FDYA 3KYDB 1C0WA 2MH9A 5J47A 2JUCA 2E34A 2KP6A 2LP0A 4WXHA 1MBKA 1B6AA 1QHHD 2F5EA 4I76A 4YFXF 1U8RA 1MDMA 1YS6A 3K7AJ 2HWVA 2ETHA 1ZRFA 3OL4A 4B09A 2B0LA 3BG6A 4EM0B 1KYZA 1UHWA 4A0XA 2OCEA 2VJ4A 5J4VA 3K10A 1X4OA 6PAXA 1TZLA 3S17J 2EQRA 1HXDA 3F8BA 1JTYA 1R1UA 2Z33A 2E7XA 5HNFA 1R36A 3Q9SA 2WTEA 2K4BA 3L00A 5DD4A 1SFUA 3K4LA 4P96A 4JOMA 1OQYA 2K9NA 3QPLA 5BS6A 3ZMSA 1S7OA 3BQZA 3LOCA 2ZNZA 4P9FA 5JHUA 2E5NA 2W85A 2EZHA 3DBHB 4XNFA 2VJIA 4DW6A 4HBLA 3HC7A 2JUGA 4AIHA 2BW3B 1W7PA 2CV1A 2Y30A 2EZLA 2W7NA 2PX9A 3T1BA 2M0MA 1NK2P 4G94A 4M6YA 5DTDA 5IP6A 2C6YA 3FBIB 2FU4A 3HRUA 1LVKA 5DUIA 2M2EA 1RPWA 2VE9A 1N25A 2DOFA 2L5QA 2Y69H 2NS7A 3R4KA 1O3QA 2ZXIA 4A5MA 4EVIA 3WTTC 2XB5A 3FMSA 4ZYEA 1O3SA 1IRZA 2GA1A 4FX0A 1KU7A 2OC6A 3UNGC 1AKHB 2QENA 4RS8A 5E3MA 3E3VA 2EZIA 3PO2J 1HA8A 3BROA 2K3FA 2K9LA 4AYBA 2R93J 4JQFA 4MGRA 4IRIA 1MD0A 1OYYA 1SEUA 2BY0A 4A3FJ 2BOLA 1Z3XA 3BT9A 2FOWA 1XMXA 2LTPA 2LBFB 4BS9A 4A3KJ 3TOBA 5EGOB 2A07F 1RR7A 4N9HA 2H6BA 4O6JA 5J3LA 4HRIA 4OIOF 2VJJA 4WXCA 3IWZA 2QUFA 3H0GJ 2KFDA 1T95A 4ZDLA 2X9DA 3VYRB 2WY7Q 4XN3A 4DYRA 2XUBA 2FNPA 2WV0A 1OJLA 3SJMA 4XIDA 1DGWY 2BEOA 2DAOA 3ABLH 3GTLJ 2K27A 2FRHA 3VSKA 4BNCA 3NWTA 1G3YA 2X0LA 1YITI 1WJEA 2PJRB 3CJNA 5DCMA 1IZ1A 1KGSA 2XC7A 3P9KA 3MKWB 3W3CA 3UR3C 1OCCH 4Y3OA 4BE0A 1G3TA 3A02A 3CCMI 1LFUP 3LQQA 5LGTA 3MMYB 2EINH 4C3IJ 1MJ9A 2VKEA 1G59A 2H8WA 4XRSG 2EJRA 3ZN1A 2AHQA 4CDGA 2X51A 5ICFA 3HOZJ 1XTAA 4L18B 2XHKA 2CFOA 4LITA 1P6RA 4HV5A 1Y6IA 4CO8A 3BG7A 1ZKGA
chains in the Genus database with same CATH topology
2VXZA 5A2QK 1JXSA 3MFKA 5LRSA 1I1SA 2M30A 2XGXA 2P6TA 1FYKA 3HIFA 2FNAA 2H27A 4P55A 2XAQA 3RYPA 1FBSA 2O03A 3CUQA 3KLNA 5CYVA 4KIGA 3WG9A 3CO7C 2PEXA 3QPTA 5L3FA 1ZGAA 2GXGA 2OZ6A 5DEQA 3JAMK 4OMZA 1IRFA 5LLQA 2BV6A 2V6CA 1SFEA 4RB2C 2FMLA 4KYWA 2ACJA 2Q2EA 2ZFWA 4AIJA 2BE5F 4ENKA 3HSFA 3KEOA 2R7DA 4MQVA 5KK1A 4RB0A 3ULQB 4BAYA 3E97A 5LHGA 1FBQA 3E6MA 1PDNC 5CLSA 1ODDA 4AIKA 4E70A 3AAFA 3HSRA 5FB2A 4YFNF 1OMIA 2CWEA 2PMUA 1T98A 1A04A 1U5TC 4MEYF 1VTNC 2Y48A 5L3EA 1K79A 3Q5FA 4RGUA 4MQ9F 3U1DA 1FPQA 2CG4A 3KP2A 4YG2F 3E5QA 5D5XB 4HQMA 2P8TA 4KIBA 1HKQA 4RB3C 4WX9A 2KJBA 5HVQC 2QYOA 2QQ9A 3VEPA 3E6BA 2CGPA 3JTHA 2EK5A 1FC3A 3OOPA 1P92A 1DP7P 1ZG3A 5D5VB 2IA0A 1CGPA 1FSHA 5E1ZB 5E8IA 2NS0A 1R22A 2J5OA 2ZCWA 4KMUX 4U0VA 3PQJA 2V79A 5D6FA 2A69F 3WODF 2DBBA 2P4WA 4I02A 1QZYA 3RTRA 4QLCU 4KICA 4ENMA 4HW0A 1YO5C 1MGTA 1G4DA 3MWMA 2ISYA 3KZZA 1F9NA 2JTVA 3ECOA 1SFXA 3ROUA 3J80Z 1TNTA 3LA2A 1T6SA 4LG0A 5IT9Z 1I6XA 2YU3A 1IW7F 3T5XA 1J5YA 3B73A 4HDUA 4GYIA 3V8JA 4LB6B 1XB4A 1GVJA 5TRDA 3FM5A 4KT5C 4CZZA 4Q5SF 2HEOA 3GFIA 2LF7A 5D5UB 3BJOA 2P5LC 5FGMA 3QP5A 4FX4A 2XKPA 4ASNA 4JK1X 1B9MA 1ZLJA 1R5GA 2YX7A 3WTSC 2A61A 5K5OA 3KP7A 1BI2A 1TBXA 4EM2A 3TGNA 1KYWA 5JR3A 2P6SA 3V8KA 2QVOA 1IUYA 5BPIA 1V3FA 2VBZA 3D5LA 2VONA 4PCQA 2ELHA 3GW2A 4O3MA 1FP1D 2CO5A 3I64A 4L9VA 3H3ZA 5HS8A 5LHHA 3MCZA 2OQGA 3LAPA 2EV0A 3I71A 3GFMA 2PN6A 3GZ5A 4U7DA 4FHTA 1KQ0A 5HDNA 2HQNA 1STZA 2FEZA 2L4MA 2YPRA 3E5XA 5FO5A 5JFRA 3I59A 1USTA 4HV6A 1IAWA 4EM1A 2ADUA 2DU9A 2MH2A 3PFIA 1OYIA 3V8LA 2DQLA 1FOKA 3I53A 1B4AA 4IXAA 5HS9A 2HTJA 4RAZA 3E6DA 2ZMEB 5HLHA 1ZLKA 3RPUA 3U9GA 3F72A 1O3TA 5L3CA 3TQNA 4P9UA 2F2EA 2PI0A 4G8XA 3VB2A 3W6JB 1U5TB 1R58A 1BC7C 5F64A 2QQAA 3F21A 2IJLA 3KZYA 1GHCA 3KFWX 1GXQA 4G7ZF 2WC2A 4KMFA 1TW2A 3M7GA 4IHTA 1X3UA 1HW1A 3BPVA 1QZZA 1BN5A 4EMSA 3F8CA 3S2WA 1D8JA 2FOKA 4QWQA 3WTZA 3CO6C 4D0PA 3KP3A 1K78A 3LQRA 3NRVA 4CICA 5EEGA 4IJAA 2XKOA 2VBYA 2PQ8A 1L0OC 4A0YA 3BJAA 1W4MA 3J81Z 1QBJA 5L3GA 1G3SA 4N0BA 3GYHX 4F7ZA 5E8GA 1IN5A 2XAHA 3QOPA 5H6QA 5ERIA 1USSA 5DV5A 4ESFA 3CTAA 4L0ZB 4M73A 2UWMA 1IN4A 2TDXA 3GF2A 4BHPA 3KP4A 4A6DA 1L3LA 3HSEA 4UV9A 2ZKZA 4HLXA 1YW9A 4I0AA 4LGWA 4LJZF 1FNNA 2UXNA 4EJWA 3P9CA 1LDDA 1F4KA 3P7NA 3R61A 2K02A 3BOQA 2GIVA 2QBYA 2AS5F 4BHBA 2P5VA 3G3ZA 3JSOA 2UZKA 1BC8C 2LKPA 4I7HA 2FMYA 5DDGA 2M8EA 2F5CA 1XCBA 2JSCA 2WWYA 1LQ1A 2VN2A 2ZO4A 4I2OA 2M5WA 2ESNA 3C3WA 1U3EM 1DPRA 3TKYA 2EFOA 4HX4A 4Y13A 4Q47A 2YX4A 3LSTA 2DO7A 3ZMUA 3MEXA 3O6BB 3CLOA 5K5RA 2DI3A 4LLLA 3C1DA 1RUOA 3HTSB 1WQ2A 3GFLA 2DTRA 3LAJA 2EB7A 1CF7A 4S04A 4GYGA 4U7BA 5BQTA 3RJPA 3SZTA 3ZQ7A 2PG4A 2MC3A 5AIPA 3RKYA 5D4SA 4WK8F 2XAGA 1DUXC 2CYYA 4LMYA 2XAFA 2ZXJA 4ENNA 5KVRA 3V7RA 3WU1B 1TQMA 2MLKA 1XN7A 3VFZA 3ZP5A 1S6LA 4HX7A 4O5VA 1IF1A 1TNSA 3HHGA 2LDUA 4EJTA 4I09A 5L3DA 1G6NA 1PUEE 2HKOA 2EV5A 3EQLF 3KLOA 4U88A 1HSJA 1R5HA 3CUQC 1BI3A 1ZHFA 4RAYA 3PQKA 3ERED 1XMKA 2VC0A 4HYEA 1ZRCA 1HKTA 5ILUA 2V9VA 4BYYA 2DFIA 3H92A 3P9IA 1D5VA 4KN7X 1WI9A 3M8FA 5JI6A 2M87A 2JPBA 2O3FA 3GFJA 2L01A 2QWWA 4NB5A 1MKMA 2KIUA 4GCVA 2J5PA 5D6EA 2OZUA 2IRFG 1ZAOA 1LNWA 3I58A 2RV8A 4L9JA 4OINF 4M72A 5HLIA 5FLXZ 4MTEA 1TQIA 1P4XA 3SXYA 1MDMB 4I98B 4ETSA 5ILVA 4M9XA 5HOOA 4OIRF 2EFNA 2RQPA 5HDKA 1B59A 4AD9A 2GQQA 3DXJF 2Y0MA 2A6HF 2IA1A 1T39A 3F22A 3B02A 3R0AA 2D45A 4PGGA 4UUVA 2A6EF 2K7LA 3WGGA 2K4JA 2KIMA 2P7CB 4CGZA 1R00A 2OQRA 4OOIA 2ZJ2A 1KU2A 4DNCA 3JW4A 1ONVA 1R7JA 5BPDA 2OD5A 3QP6A 2F5FA 2OA4A 2FBKA 2LSOA 1OKRA 2M1BA 1KA8A 1Y0UA 1BM9A 1IXSB 2GA2A 3MZYA 2Z99A 2MD5A 3L09A 1Z1DA 2XV4S 4LK0F 1TLHB 1JGSA 3N97A 2GAUA 4ZZLA 2JZYA 2CSOA 2LNBA 1TW3A 4UVAA 1YS7A 5E1XA 1BI1A 3HRSA 2QLZA 1HW5A 4MEXF 3RKXA 1U5TA 4NHJA 1SMYF 3WE3A 5CVUA 1HW2A 2Z9OA 1RI7A 2XROA 1EH6A 1YQAA 5LRRA 2RVCA 5FD5A 3FHZA 3M1EA 2VE8A 2RNJA 2DT5A 3BJ6A 3F8FA 5FFXA 1TTYA 1UHMA 3RKWA 5DCMB 3J80K 1D8KA 2DPUA 4KNYA 5DD8A 3K1PA 3IKVA 2BGCA 2KKOA 4Q4ZF 1XDUA 3IL2A 4ESJA 1UB9A 4M9ZA 1P4AA 1U6GA 1JHHA 3I4PA 4U0YA 2FF4A 4EJVA 1QPMA 5BMZA 4HF1A 1ULYA 2A68F 3J7AO 2OBPA 2VBXA 3GLXA 3LA3A 3TO7A 2EA2A 2HTSA 3JTGA 3GWZA 1FP2A 1FBUA 1P2FA 1IXCA 5TJJA 1SMTA 3ELKA 1QQIA 3GEZA 3GVAA 3CDHA 3BWGA 1HBXG 2QZ8A 1EH7A 3WTVC 4HOBA 3CUQB 3VODA 4HAMA 1O7FA 1LVAA 1K6OA 2HR3A 1FWZA 2VC1A 1SAXA 3V7CA 3GO5A 1BI0A 1Z05A 3HHHA 1J0RA 4B8XA 5J8CA 5F6FA 4LLGF 2P7VB 4YIIA 3SFZA 4LLNA 1F5TA 2Z5UA 2IA2A 4UVCA 3OV8A 1ZH5A 1E2XA 3EYIA 5AIQA 3V4GA 1B1BA 4KDPA 2FE3A 2KIFA 3TDUC 4XSXF 1LEAA 1KU9A 4GXOA 5E20A 1P4WA 2FXAA 1FYLA 3D0SA 2NAZA 3U2RA 2HGCA 1QGPA 4MHGA 2F5DA 3K69A 4ZH4F 5H6RA 3NQOA 4IRGA 2EA4A 1YIOA 4CXFA 2R3SA 2GXBA 4I0BA 2HQRA 4A6EA 3JSPA 3SZPA 1PP7U 3W6KB 3DQVC 1Z6TA 2RDPA 2XIGA 5LEJA 2W84A 2DQRA 1RIOH 3H3UA 3ABUA 5D5WB 3K0LA 3QRFF 5BOXA 2FQ3A 3R6SA 3RDIA 3MZHA 1YLFA 2FBIA 1JE8A 1H9GA 3L7WA 4IHSA 5J8FA 5CVVA 5ILSA 1MZBA 1J9IA 3DPTA 2QM3A 3RIRA 1V4RA 1S29A 3J81K 1F1ZA 3SHFA 2EFWA 3HOSA 4A5NA 2AXLA 2MLGA 2G7HA 1AOYA 1S8NA 1R23A 4UVBA 1R1VA 4H0EA 1J59A 1LDKB 4UNOA 4HF0A 2BBYA 3O3KA 3WTUC 3E6CC 2ZNYA 1WSUA 4LG0B 2Q0OA 2JT1A 1T0FA 3TOAA 3ZMZA 1BBYA 5HLGA 2W24A 1G3WA 1H9TA 3IWFA 3T8RA 3L2CA 1Z7UA 4G9YA 1KU3A 2FBHA 4IPAA 3IC7A 1MJAA 5AONA 3I54A 5LEKA 4EGZA 1NHAA 2UXXA 2XAJA 2DW4A 4I01A 2KRFA 3F8NA 2L02A 4LFUA 3KETA 5H20A 2R7FA 1ZN2A 4HDVA 3LA7A 1ON1A 1SD6A 2H6CA 5CVJA 2RN7A 2GZWA 5ICGA 2MA3A 4XBFA 1SD5A 3QAHA 1XGOA 2FA5A 1KQ8A 5JVTA 4LD5A 2Q8KA 2FSWA 1MJBA 4M71A 2W57A 2P5KA 3HYIA 3I59B 1DDNA 3FZVA 4HLYA 3KCCA 2X4HA 3DF8A 3Q9VA 1Z9CA 3NEUA 2CFXA 3C7JA 3BP8A 4HZFA 1BJAA 2IPQX 3DKWA 4PDKA 2PFBA 1J7KA 2HZTA 5D8KB 4EJUA 1WKMA 4KIFA 5CVRA 4LB5A 4WXDA 1IRGA 3VOEA 1KQ9A 3WTYC 3RI4A 4G6QA 1ZYRF 2XVCA 3DEUA 4HX8A 2OU2A 4A0ZA 2PMHA 1HKSA 5ICCA 5K1YA 3FX3A 1UCRA 1FSEA 3DV8A 2D1HA 4YFKF 4ZYGA 2YSRA 1OPCA 2JPCA 5HS7A 2O8XA 4XSZF 1BIAA 4A12A 1FY7A 3IRRA 3E5UA 4XLPF 5DYMA 4FT8A 3O2PE 4RB1A 1O7LA 4S05A 2RC4A 4ZYDA 3IKTA 5IT3A 1K78B 3GX4X 3KP5A 3FXQA 1XGMA 2O61A 3TDZC 1FX7A 4WWCA 3GZ6A 3HRMA 5LHIA 1LDJA 4OU0A 3ML6A 2Z3YA 3DPLC 4L0YB 1YTYA 1SD7A 2HFHA 3ZPLA 1FZPB 3DFGA 5FLXK 3F23A 4RGSA 5A2QZ 4BHCA 4IRHA 2IVMA 3RPQA 3ZMVA 2V1UA 5ICEA 4ESBA 2HS5A 4XLNF 3HUGA 1LB2A 3QU3A 4WF2A 4MNUA 5LBQA 3KE2A 2KJCA 3DP7A 4YIFA 5E18F 1XDSA 1YFHA 4HA8A 2RGVA 2IT0A 1UFMA 2ESHA 5EEHA 3QU6A 1XD7A 4HF2A 1PP8F 1YW8A 1XGSA 2HYGD 4EJOA 3WU0A 4P5OA 2LF8A 4CYDA 1REPC 3JAMZ 2QBYB 4XRFA 2E1NA 2XRNA 5J6XA 1T38A 1E17A 2IP2A 3CUOA 3MAJA 4BQAA 2HKXA 1W5SA 4OIPF 3F6VA 4R79A 2PLYA 2E7WA 2HDCA 2L4AA 1HQCA 4L9NA 3WE2A 2H94A 3K1MA 1W7PB 4L9TA 1OYWA 2VT2A 4KA4A 2OAZA 1RUNA 3M8EA 4M74A 3SQNA 1JHFA 4KUMA 2G7UA 4OIQF 3FMRA 4BXUA 2ZMEA 3EYYA 1O57A 2EFQA 2VODA 1IN6A 3T0YA 1OR7A 1CF7B 2GWRA 2NNNA 1XSDA 2EFPA 4L5IA 3RYRA 5D4RA 2L3DA 3BDDA 4G7HF 1ZG5A 2CQKA 3ECHA 4DQ2A 1RNLA 4A2UA 1I27A 1ZARA 1EH8A 3WGIA 4HQEA 1H0MA 2A5YB 3WTWC 3T8TA 5IT9K 3ZMDA 3HTUA 4PZJA 3L9FA 3FWEA 1ON2A 2NRAC 1W5TA 4LK1F 3M9AA 5FD6A 5E1WA 3KP6A 1R1TA 2EWNA 3GXOA 1QO0D 2NYXA 4Z2YA 4M9SA 1XSVA 2H09A 3EDPA 2XASA 2JRTA 4R1HA 4N9IA 3FXUA 1IN8A 4AVPA 1XMAA 2STWA 3LFKA 3R60A 2DLLA 2V1DA 1LJ9A 4U0WA 1WWXA 2COMA 1ZRDA 2PBIA 1WRJA 1D3YA 4ENJA 4UHTA 1Z91A 4IVNA 1I5ZA 4Q48A 3TO9A 4OMYA 3BZ6A 4BH9A 5LGUA 3ABTA 4ZZDA 4EV0A 3MQ0A 1BOAA 3I5UA 2ISZA 2VOOA 2O6GE 2K86A 3C18A 5HDGA 3FF5A 1T2KA 4ZYHA 4GGGA 1U2WA 1EV7A 3K2ZA 3G73A 1XSXA 3R0JA 2M45A 4TV7A 4UV8A 3ZN0A 1QNTA 3F6OA 4RGRA 2IW5A 3HRTA 4IF4A 1BIBA 4Y17A 3FXRA 5L3BA 5CVIA 3COAC 2A3SA 5LGNA 5CJ9A 5K5QA 4EQQA 1W7PD 3LWFA 4JBAA 2D1VA 2V1XA 5ED4A 5FFZA 2ZBKA 4NQWA 5D8LB 1GXPA 4L5JA 3WTXC 1IN7A 3EETA 1ZGJA 1U78A 4EGYA 3I0TA 1J2XA 4UXNA 4CHUA 3KEQA 2VBWA 2NNYA 4Y15A 2VOPA 3WGHA 2RKHA 1FT9A 1O3RA 1S7AA 1HSTA 3K1NA 4ON0A 3ZMTA 3K9TA 4RGXA 3FMQA 4MTDA 2E1CA 2W25A 4PGHA 1J75A 4WCGA 5DUKA 2DK5A 3IRQA 5F1RA 4G7OF 2HOEA 4AWXB 3HOTA 2D2WA 1FYMA 1ZG1A 2L54A 2CW0F 1IXRC 1ZREA 3QPHA 2HYFA 1Z6RA 3ISPA 1RZ4A 1XCVA 1LEBA 2STTA 4GO1A 1XGNA 2BYVE 4KN4X 1B9NA 2MBFA 4G6DA 1DPUA 3GUDA 2G9WA 4M6XA 4R8HA 3TO6A 3BPXA 2DK8A 2QQBA 4K2EA 1Q1HA 2VT3A 1SD4A 1TQPA 1K7AA 2PJPA 5E17F 1I1GA 4KFCA 3IHUA 1AWCA 3REOA 2O0YA 3V7SA 2EV6A 2Y75A 1S3JA 3F3XA 3FM3A 3F8MA 3BY6A 1FLIA 3N4MA 2DPDA 2YR2A 1YYVA 1YG2A 3EUHA 1YW7A 5DCFA 1C0WA 2MH9A 4WXHA 1B6AA 4YFXF 2F5EA 1U8RA 1MDMA 1YS6A 2HWVA 2ETHA 1ZRFA 4B09A 2B0LA 4EM0B 1KYZA 1UHWA 4A0XA 6PAXA 1HXDA 3F8BA 1R1UA 2Z33A 2E7XA 1R36A 3Q9SA 2WTEA 2K4BA 3L00A 5DD4A 1SFUA 4P96A 5BS6A 3ZMSA 1S7OA 2ZNZA 5JHUA 4P9FA 2W85A 4HBLA 4AIHA 1W7PA 3T1BA 4G94A 4M6YA 2C6YA 2FU4A 3HRUA 5DUIA 2VE9A 3R4KA 1O3QA 4A5MA 4EVIA 3WTTC 3FMSA 4ZYEA 1O3SA 2GA1A 4FX0A 1KU7A 2QENA 4RS8A 3E3VA 3BROA 4JQFA 4MGRA 4IRIA 1MD0A 1OYYA 3TOBA 2A07F 4N9HA 2H6BA 4O6JA 4OIOF 4WXCA 3IWZA 2QUFA 2XUBA 2FNPA 2WV0A 2BEOA 2DAOA 2K27A 2FRHA 4BNCA 1G3YA 2X0LA 3CJNA 5DCMA 1IZ1A 1KGSA 3P9KA 1G3TA 3LQQA 5LGTA 1MJ9A 2EJRA 3ZN1A 4CDGA 5ICFA 4L18B 2XHKA 1P6RA 4HV5A 4CO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXZ A;  5A2Q K;  1JXS A;  3MFK A;  5LRS A;  1I1S A;  2M30 A;  2XGX A;  2P6T A;  1FYK A;  3HIF A;  2FNA A;  2H27 A;  4P55 A;  2XAQ A;  3RYP A;  1FBS A;  2O03 A;  3CUQ A;  3KLN A;  5CYV A;  4KIG A;  3WG9 A;  3CO7 C;  2PEX A;  3QPT A;  5L3F A;  1ZGA A;  2GXG A;  2OZ6 A;  5DEQ A;  3JAM K;  4OMZ A;  1IRF A;  5LLQ A;  2BV6 A;  2V6C A;  1SFE A;  4RB2 C;  2FML A;  4KYW A;  2ACJ A;  2Q2E A;  2ZFW A;  4AIJ A;  2BE5 F;  4ENK A;  3HSF A;  3KEO A;  2R7D A;  4MQV A;  5KK1 A;  4RB0 A;  3ULQ B;  4BAY A;  3E97 A;  5LHG A;  1FBQ A;  3E6M A;  1PDN C;  5CLS A;  1ODD A;  4AIK A;  4E70 A;  3AAF A;  3HSR A;  5FB2 A;  4YFN F;  1OMI A;  2CWE A;  2PMU A;  1T98 A;  1A04 A;  1U5T C;  4MEY F;  1VTN C;  2Y48 A;  5L3E A;  1K79 A;  3Q5F A;  4RGU A;  4MQ9 F;  3U1D A;  1FPQ A;  2CG4 A;  3KP2 A;  4YG2 F;  3E5Q A;  5D5X B;  4HQM A;  2P8T A;  4KIB A;  1HKQ A;  4RB3 C;  4WX9 A;  2KJB A;  5HVQ C;  2QYO A;  2QQ9 A;  3VEP A;  3E6B A;  2CGP A;  3JTH A;  2EK5 A;  1FC3 A;  3OOP A;  1P92 A;  1DP7 P;  1ZG3 A;  5D5V B;  2IA0 A;  1CGP A;  1FSH A;  5E1Z B;  5E8I A;  2NS0 A;  1R22 A;  2J5O A;  2ZCW A;  4KMU X;  4U0V A;  3PQJ A;  2V79 A;  5D6F A;  2A69 F;  3WOD F;  2DBB A;  2P4W A;  4I02 A;  1QZY A;  3RTR A;  4QLC U;  4KIC A;  4ENM A;  4HW0 A;  1YO5 C;  1MGT A;  1G4D A;  3MWM A;  2ISY A;  3KZZ A;  1F9N A;  2JTV A;  3ECO A;  1SFX A;  3ROU A;  3J80 Z;  1TNT A;  3LA2 A;  1T6S A;  4LG0 A;  5IT9 Z;  1I6X A;  2YU3 A;  1IW7 F;  3T5X A;  1J5Y A;  3B73 A;  4HDU A;  4GYI A;  3V8J A;  4LB6 B;  1XB4 A;  1GVJ A;  5TRD A;  3FM5 A;  4KT5 C;  4CZZ A;  4Q5S F;  2HEO A;  3GFI A;  2LF7 A;  5D5U B;  3BJO A;  2P5L C;  5FGM A;  3QP5 A;  4FX4 A;  2XKP A;  4ASN A;  4JK1 X;  1B9M A;  1ZLJ A;  1R5G A;  2YX7 A;  3WTS C;  2A61 A;  5K5O A;  3KP7 A;  1BI2 A;  1TBX A;  4EM2 A;  3TGN A;  1KYW A;  5JR3 A;  2P6S A;  3V8K A;  2QVO A;  1IUY A;  5BPI A;  1V3F A;  2VBZ A;  3D5L A;  2VON A;  4PCQ A;  2ELH A;  3GW2 A;  4O3M A;  1FP1 D;  2CO5 A;  3I64 A;  4L9V A;  3H3Z A;  5HS8 A;  5LHH A;  3MCZ A;  2OQG A;  3LAP A;  2EV0 A;  3I71 A;  3GFM A;  2PN6 A;  3GZ5 A;  4U7D A;  4FHT A;  1KQ0 A;  5HDN A;  2HQN A;  1STZ A;  2FEZ A;  2L4M A;  2YPR A;  3E5X A;  5FO5 A;  5JFR A;  3I59 A;  1UST A;  4HV6 A;  1IAW A;  4EM1 A;  2ADU A;  2DU9 A;  2MH2 A;  3PFI A;  1OYI A;  3V8L A;  2DQL A;  1FOK A;  3I53 A;  1B4A A;  4IXA A;  5HS9 A;  2HTJ A;  4RAZ A;  3E6D A;  2ZME B;  5HLH A;  1ZLK A;  3RPU A;  3U9G A;  3F72 A;  1O3T A;  5L3C A;  3TQN A;  4P9U A;  2F2E A;  2PI0 A;  4G8X A;  3VB2 A;  3W6J B;  1U5T B;  1R58 A;  1BC7 C;  5F64 A;  2QQA A;  3F21 A;  2IJL A;  3KZY A;  1GHC A;  3KFW X;  1GXQ A;  4G7Z F;  2WC2 A;  4KMF A;  1TW2 A;  3M7G A;  4IHT A;  1X3U A;  1HW1 A;  3BPV A;  1QZZ A;  1BN5 A;  4EMS A;  3F8C A;  3S2W A;  1D8J A;  2FOK A;  4QWQ A;  3WTZ A;  3CO6 C;  4D0P A;  3KP3 A;  1K78 A;  3LQR A;  3NRV A;  4CIC A;  5EEG A;  4IJA A;  2XKO A;  2VBY A;  2PQ8 A;  1L0O C;  4A0Y A;  3BJA A;  1W4M A;  3J81 Z;  1QBJ A;  5L3G A;  1G3S A;  4N0B A;  3GYH X;  4F7Z A;  5E8G A;  1IN5 A;  2XAH A;  3QOP A;  5H6Q A;  5ERI A;  1USS A;  5DV5 A;  4ESF A;  3CTA A;  4L0Z B;  4M73 A;  2UWM A;  1IN4 A;  2TDX A;  3GF2 A;  4BHP A;  3KP4 A;  4A6D A;  1L3L A;  3HSE A;  4UV9 A;  2ZKZ A;  4HLX A;  1YW9 A;  4I0A A;  4LGW A;  4LJZ F;  1FNN A;  2UXN A;  4EJW A;  3P9C A;  1LDD A;  1F4K A;  3P7N A;  3R61 A;  2K02 A;  3BOQ A;  2GIV A;  2QBY A;  2AS5 F;  4BHB A;  2P5V A;  3G3Z A;  3JSO A;  2UZK A;  1BC8 C;  2LKP A;  4I7H A;  2FMY A;  5DDG A;  2M8E A;  2F5C A;  1XCB A;  2JSC A;  2WWY A;  1LQ1 A;  2VN2 A;  2ZO4 A;  4I2O A;  2M5W A;  2ESN A;  3C3W A;  1U3E M;  1DPR A;  3TKY A;  2EFO A;  4HX4 A;  4Y13 A;  4Q47 A;  2YX4 A;  3LST A;  2DO7 A;  3ZMU A;  3MEX A;  3O6B B;  3CLO A;  5K5R A;  2DI3 A;  4LLL A;  3C1D A;  1RUO A;  3HTS B;  1WQ2 A;  3GFL A;  2DTR A;  3LAJ A;  2EB7 A;  1CF7 A;  4S04 A;  4GYG A;  4U7B A;  5BQT A;  3RJP A;  3SZT A;  3ZQ7 A;  2PG4 A;  2MC3 A;  5AIP A;  3RKY A;  5D4S A;  4WK8 F;  2XAG A;  1DUX C;  2CYY A;  4LMY A;  2XAF A;  2ZXJ A;  4ENN A;  5KVR A;  3V7R A;  3WU1 B;  1TQM A;  2MLK A;  1XN7 A;  3VFZ A;  3ZP5 A;  1S6L A;  4HX7 A;  4O5V A;  1IF1 A;  1TNS A;  3HHG A;  2LDU A;  4EJT A;  4I09 A;  5L3D A;  1G6N A;  1PUE E;  2HKO A;  2EV5 A;  3EQL F;  3KLO A;  4U88 A;  1HSJ A;  1R5H A;  3CUQ C;  1BI3 A;  1ZHF A;  4RAY A;  3PQK A;  3ERE D;  1XMK A;  2VC0 A;  4HYE A;  1ZRC A;  1HKT A;  5ILU A;  2V9V A;  4BYY A;  2DFI A;  3H92 A;  3P9I A;  1D5V A;  4KN7 X;  1WI9 A;  3M8F A;  5JI6 A;  2M87 A;  2JPB A;  2O3F A;  3GFJ A;  2L01 A;  2QWW A;  4NB5 A;  1MKM A;  2KIU A;  4GCV A;  2J5P A;  5D6E A;  2OZU A;  2IRF G;  1ZAO A;  1LNW A;  3I58 A;  2RV8 A;  4L9J A;  4OIN F;  4M72 A;  5HLI A;  5FLX Z;  4MTE A;  1TQI A;  1P4X A;  3SXY A;  1MDM B;  4I98 B;  4ETS A;  5ILV A;  4M9X A;  5HOO A;  4OIR F;  2EFN A;  2RQP A;  5HDK A;  1B59 A;  4AD9 A;  2GQQ A;  3DXJ F;  2Y0M A;  2A6H F;  2IA1 A;  1T39 A;  3F22 A;  3B02 A;  3R0A A;  2D45 A;  4PGG A;  4UUV A;  2A6E F;  2K7L A;  3WGG A;  2K4J A;  2KIM A;  2P7C B;  4CGZ A;  1R00 A;  2OQR A;  4OOI A;  2ZJ2 A;  1KU2 A;  4DNC A;  3JW4 A;  1ONV A;  1R7J A;  5BPD A;  2OD5 A;  3QP6 A;  2F5F A;  2OA4 A;  2FBK A;  2LSO A;  1OKR A;  2M1B A;  1KA8 A;  1Y0U A;  1BM9 A;  1IXS B;  2GA2 A;  3MZY A;  2Z99 A;  2MD5 A;  3L09 A;  1Z1D A;  2XV4 S;  4LK0 F;  1TLH B;  1JGS A;  3N97 A;  2GAU A;  4ZZL A;  2JZY A;  2CSO A;  2LNB A;  1TW3 A;  4UVA A;  1YS7 A;  5E1X A;  1BI1 A;  3HRS A;  2QLZ A;  1HW5 A;  4MEX F;  3RKX A;  1U5T A;  4NHJ A;  1SMY F;  3WE3 A;  5CVU A;  1HW2 A;  2Z9O A;  1RI7 A;  2XRO A;  1EH6 A;  1YQA A;  5LRR A;  2RVC A;  5FD5 A;  3FHZ A;  3M1E A;  2VE8 A;  2RNJ A;  2DT5 A;  3BJ6 A;  3F8F A;  5FFX A;  1TTY A;  1UHM A;  3RKW A;  5DCM B;  3J80 K;  1D8K A;  2DPU A;  4KNY A;  5DD8 A;  3K1P A;  3IKV A;  2BGC A;  2KKO A;  4Q4Z F;  1XDU A;  3IL2 A;  4ESJ A;  1UB9 A;  4M9Z A;  1P4A A;  1U6G A;  1JHH A;  3I4P A;  4U0Y A;  2FF4 A;  4EJV A;  1QPM A;  5BMZ A;  4HF1 A;  1ULY A;  2A68 F;  3J7A O;  2OBP A;  2VBX A;  3GLX A;  3LA3 A;  3TO7 A;  2EA2 A;  2HTS A;  3JTG A;  3GWZ A;  1FP2 A;  1FBU A;  1P2F A;  1IXC A;  5TJJ A;  1SMT A;  3ELK A;  1QQI A;  3GEZ A;  3GVA A;  3CDH A;  3BWG A;  1HBX G;  2QZ8 A;  1EH7 A;  3WTV C;  4HOB A;  3CUQ B;  3VOD A;  4HAM A;  1O7F A;  1LVA A;  1K6O A;  2HR3 A;  1FWZ A;  2VC1 A;  1SAX A;  3V7C A;  3GO5 A;  1BI0 A;  1Z05 A;  3HHH A;  1J0R A;  4B8X A;  5J8C A;  5F6F A;  4LLG F;  2P7V B;  4YII A;  3SFZ A;  4LLN A;  1F5T A;  2Z5U A;  2IA2 A;  4UVC A;  3OV8 A;  1ZH5 A;  1E2X A;  3EYI A;  5AIQ A;  3V4G A;  1B1B A;  4KDP A;  2FE3 A;  2KIF A;  3TDU C;  4XSX F;  1LEA A;  1KU9 A;  4GXO A;  5E20 A;  1P4W A;  2FXA A;  1FYL A;  3D0S A;  2NAZ A;  3U2R A;  2HGC A;  1QGP A;  4MHG A;  2F5D A;  3K69 A;  4ZH4 F;  5H6R A;  3NQO A;  4IRG A;  2EA4 A;  1YIO A;  4CXF A;  2R3S A;  2GXB A;  4I0B A;  2HQR A;  4A6E A;  3JSP A;  3SZP A;  1PP7 U;  3W6K B;  3DQV C;  1Z6T A;  2RDP A;  2XIG A;  5LEJ A;  2W84 A;  2DQR A;  1RIO H;  3H3U A;  3ABU A;  5D5W B;  3K0L A;  3QRF F;  5BOX A;  2FQ3 A;  3R6S A;  3RDI A;  3MZH A;  1YLF A;  2FBI A;  1JE8 A;  1H9G A;  3L7W A;  4IHS A;  5J8F A;  5CVV A;  5ILS A;  1MZB A;  1J9I A;  3DPT A;  2QM3 A;  3RIR A;  1V4R A;  1S29 A;  3J81 K;  1F1Z A;  3SHF A;  2EFW A;  3HOS A;  4A5N A;  2AXL A;  2MLG A;  2G7H A;  1AOY A;  1S8N A;  1R23 A;  4UVB A;  1R1V A;  4H0E A;  1J59 A;  1LDK B;  4UNO A;  4HF0 A;  2BBY A;  3O3K A;  3WTU C;  3E6C C;  2ZNY A;  1WSU A;  4LG0 B;  2Q0O A;  2JT1 A;  1T0F A;  3TOA A;  3ZMZ A;  1BBY A;  5HLG A;  2W24 A;  1G3W A;  1H9T A;  3IWF A;  3T8R A;  3L2C A;  1Z7U A;  4G9Y A;  1KU3 A;  2FBH A;  4IPA A;  3IC7 A;  1MJA A;  5AON A;  3I54 A;  5LEK A;  4EGZ A;  1NHA A;  2UXX A;  2XAJ A;  2DW4 A;  4I01 A;  2KRF A;  3F8N A;  2L02 A;  4LFU A;  3KET A;  5H20 A;  2R7F A;  1ZN2 A;  4HDV A;  3LA7 A;  1ON1 A;  1SD6 A;  2H6C A;  5CVJ A;  2RN7 A;  2GZW A;  5ICG A;  2MA3 A;  4XBF A;  1SD5 A;  3QAH A;  1XGO A;  2FA5 A;  1KQ8 A;  5JVT A;  4LD5 A;  2Q8K A;  2FSW A;  1MJB A;  4M71 A;  2W57 A;  2P5K A;  3HYI A;  3I59 B;  1DDN A;  3FZV A;  4HLY A;  3KCC A;  2X4H A;  3DF8 A;  3Q9V A;  1Z9C A;  3NEU A;  2CFX A;  3C7J A;  3BP8 A;  4HZF A;  1BJA A;  2IPQ X;  3DKW A;  4PDK A;  2PFB A;  1J7K A;  2HZT A;  5D8K B;  4EJU A;  1WKM A;  4KIF A;  5CVR A;  4LB5 A;  4WXD A;  1IRG A;  3VOE A;  1KQ9 A;  3WTY C;  3RI4 A;  4G6Q A;  1ZYR F;  2XVC A;  3DEU A;  4HX8 A;  2OU2 A;  4A0Z A;  2PMH A;  1HKS A;  5ICC A;  5K1Y A;  3FX3 A;  1UCR A;  1FSE A;  3DV8 A;  2D1H A;  4YFK F;  4ZYG A;  2YSR A;  1OPC A;  2JPC A;  5HS7 A;  2O8X A;  4XSZ F;  1BIA A;  4A12 A;  1FY7 A;  3IRR A;  3E5U A;  4XLP F;  5DYM A;  4FT8 A;  3O2P E;  4RB1 A;  1O7L A;  4S05 A;  2RC4 A;  4ZYD A;  3IKT A;  5IT3 A;  1K78 B;  3GX4 X;  3KP5 A;  3FXQ A;  1XGM A;  2O61 A;  3TDZ C;  1FX7 A;  4WWC A;  3GZ6 A;  3HRM A;  5LHI A;  1LDJ A;  4OU0 A;  3ML6 A;  2Z3Y A;  3DPL C;  4L0Y B;  1YTY A;  1SD7 A;  2HFH A;  3ZPL A;  1FZP B;  3DFG A;  5FLX K;  3F23 A;  4RGS A;  5A2Q Z;  4BHC A;  4IRH A;  2IVM A;  3RPQ A;  3ZMV A;  2V1U A;  5ICE A;  4ESB A;  2HS5 A;  4XLN F;  3HUG A;  1LB2 A;  3QU3 A;  4WF2 A;  4MNU A;  5LBQ A;  3KE2 A;  2KJC A;  3DP7 A;  4YIF A;  5E18 F;  1XDS A;  1YFH A;  4HA8 A;  2RGV A;  2IT0 A;  1UFM A;  2ESH A;  5EEH A;  3QU6 A;  1XD7 A;  4HF2 A;  1PP8 F;  1YW8 A;  1XGS A;  2HYG D;  4EJO A;  3WU0 A;  4P5O A;  2LF8 A;  4CYD A;  1REP C;  3JAM Z;  2QBY B;  4XRF A;  2E1N A;  2XRN A;  5J6X A;  1T38 A;  1E17 A;  2IP2 A;  3CUO A;  3MAJ A;  4BQA A;  2HKX A;  1W5S A;  4OIP F;  3F6V A;  4R79 A;  2PLY A;  2E7W A;  2HDC A;  2L4A A;  1HQC A;  4L9N A;  3WE2 A;  2H94 A;  3K1M A;  1W7P B;  4L9T A;  1OYW A;  2VT2 A;  4KA4 A;  2OAZ A;  1RUN A;  3M8E A;  4M74 A;  3SQN A;  1JHF A;  4KUM A;  2G7U A;  4OIQ F;  3FMR A;  4BXU A;  2ZME A;  3EYY A;  1O57 A;  2EFQ A;  2VOD A;  1IN6 A;  3T0Y A;  1OR7 A;  1CF7 B;  2GWR A;  2NNN A;  1XSD A;  2EFP A;  4L5I A;  3RYR A;  5D4R A;  2L3D A;  3BDD A;  4G7H F;  1ZG5 A;  2CQK A;  3ECH A;  4DQ2 A;  1RNL A;  4A2U A;  1I27 A;  1ZAR A;  1EH8 A;  3WGI A;  4HQE A;  1H0M A;  2A5Y B;  3WTW C;  3T8T A;  5IT9 K;  3ZMD A;  3HTU A;  4PZJ A;  3L9F A;  3FWE A;  1ON2 A;  2NRA C;  1W5T A;  4LK1 F;  3M9A A;  5FD6 A;  5E1W A;  3KP6 A;  1R1T A;  2EWN A;  3GXO A;  1QO0 D;  2NYX A;  4Z2Y A;  4M9S A;  1XSV A;  2H09 A;  3EDP A;  2XAS A;  2JRT A;  4R1H A;  4N9I A;  3FXU A;  1IN8 A;  4AVP A;  1XMA A;  2STW A;  3LFK A;  3R60 A;  2DLL A;  2V1D A;  1LJ9 A;  4U0W A;  1WWX A;  2COM A;  1ZRD A;  2PBI A;  1WRJ A;  1D3Y A;  4ENJ A;  4UHT A;  1Z91 A;  4IVN A;  1I5Z A;  4Q48 A;  3TO9 A;  4OMY A;  3BZ6 A;  4BH9 A;  5LGU A;  3ABT A;  4ZZD A;  4EV0 A;  3MQ0 A;  1BOA A;  3I5U A;  2ISZ A;  2VOO A;  2O6G E;  2K86 A;  3C18 A;  5HDG A;  3FF5 A;  1T2K A;  4ZYH A;  4GGG A;  1U2W A;  1EV7 A;  3K2Z A;  3G73 A;  1XSX A;  3R0J A;  2M45 A;  4TV7 A;  4UV8 A;  3ZN0 A;  1QNT A;  3F6O A;  4RGR A;  2IW5 A;  3HRT A;  4IF4 A;  1BIB A;  4Y17 A;  3FXR A;  5L3B A;  5CVI A;  3COA C;  2A3S A;  5LGN A;  5CJ9 A;  5K5Q A;  4EQQ A;  1W7P D;  3LWF A;  4JBA A;  2D1V A;  2V1X A;  5ED4 A;  5FFZ A;  2ZBK A;  4NQW A;  5D8L B;  1GXP A;  4L5J A;  3WTX C;  1IN7 A;  3EET A;  1ZGJ A;  1U78 A;  4EGY A;  3I0T A;  1J2X A;  4UXN A;  4CHU A;  3KEQ A;  2VBW A;  2NNY A;  4Y15 A;  2VOP A;  3WGH A;  2RKH A;  1FT9 A;  1O3R A;  1S7A A;  1HST A;  3K1N A;  4ON0 A;  3ZMT A;  3K9T A;  4RGX A;  3FMQ A;  4MTD A;  2E1C A;  2W25 A;  4PGH A;  1J75 A;  4WCG A;  5DUK A;  2DK5 A;  3IRQ A;  5F1R A;  4G7O F;  2HOE A;  4AWX B;  3HOT A;  2D2W A;  1FYM A;  1ZG1 A;  2L54 A;  2CW0 F;  1IXR C;  1ZRE A;  3QPH A;  2HYF A;  1Z6R A;  3ISP A;  1RZ4 A;  1XCV A;  1LEB A;  2STT A;  4GO1 A;  1XGN A;  2BYV E;  4KN4 X;  1B9N A;  2MBF A;  4G6D A;  1DPU A;  3GUD A;  2G9W A;  4M6X A;  4R8H A;  3TO6 A;  3BPX A;  2DK8 A;  2QQB A;  4K2E A;  1Q1H A;  2VT3 A;  1SD4 A;  1TQP A;  1K7A A;  2PJP A;  5E17 F;  1I1G A;  4KFC A;  3IHU A;  1AWC A;  3REO A;  2O0Y A;  3V7S A;  2EV6 A;  2Y75 A;  1S3J A;  3F3X A;  3FM3 A;  3F8M A;  3BY6 A;  1FLI A;  3N4M A;  2DPD A;  2YR2 A;  1YYV A;  1YG2 A;  3EUH A;  1YW7 A;  5DCF A;  1C0W A;  2MH9 A;  4WXH A;  1B6A A;  4YFX F;  2F5E A;  1U8R A;  1MDM A;  1YS6 A;  2HWV A;  2ETH A;  1ZRF A;  4B09 A;  2B0L A;  4EM0 B;  1KYZ A;  1UHW A;  4A0X A;  6PAX A;  1HXD A;  3F8B A;  1R1U A;  2Z33 A;  2E7X A;  1R36 A;  3Q9S A;  2WTE A;  2K4B A;  3L00 A;  5DD4 A;  1SFU A;  4P96 A;  5BS6 A;  3ZMS A;  1S7O A;  2ZNZ A;  5JHU A;  4P9F A;  2W85 A;  4HBL A;  4AIH A;  1W7P A;  3T1B A;  4G94 A;  4M6Y A;  2C6Y A;  2FU4 A;  3HRU A;  5DUI A;  2VE9 A;  3R4K A;  1O3Q A;  4A5M A;  4EVI A;  3WTT C;  3FMS A;  4ZYE A;  1O3S A;  2GA1 A;  4FX0 A;  1KU7 A;  2QEN A;  4RS8 A;  3E3V A;  3BRO A;  4JQF A;  4MGR A;  4IRI A;  1MD0 A;  1OYY A;  3TOB A;  2A07 F;  4N9H A;  2H6B A;  4O6J A;  4OIO F;  4WXC A;  3IWZ A;  2QUF A;  2XUB A;  2FNP A;  2WV0 A;  2BEO A;  2DAO A;  2K27 A;  2FRH A;  4BNC A;  1G3Y A;  2X0L A;  3CJN A;  5DCM A;  1IZ1 A;  1KGS A;  3P9K A;  1G3T A;  3LQQ A;  5LGT A;  1MJ9 A;  2EJR A;  3ZN1 A;  4CDG A;  5ICF A;  4L18 B;  2XHK A;  1P6R A;  4HV5 A;  4CO8 A; 
#chains in the Genus database with same CATH topology
 3J7A Y;  1FOY A;  2VXZ A;  1BW5 A;  5A2Q K;  1JXS A;  2EBI A;  2IS1 A;  3MFK A;  5LRS A;  2YU9 J;  1MSE C;  1I1S A;  2M30 A;  4ZTF A;  2DOA A;  3GTM J;  2XGX A;  1D0Z A;  2P6T A;  5B1A H;  1FYK A;  3HIF A;  1ITY A;  1Y1W J;  2FNA A;  2H27 A;  3K4B A;  4P55 A;  1N77 A;  2XAQ A;  3RYP A;  1APL C;  3GTP J;  3OYJ A;  1FBS A;  2O03 A;  4J00 A;  2EIL H;  3CZ6 A;  2WAQ N;  3CUQ A;  1DU0 A;  2F4O B;  3EUA A;  3FXK A;  3KLN A;  5CYV A;  4KIG A;  4Z6Y A;  4XKB A;  3WG9 A;  3CO7 C;  2E36 A;  2PEX A;  3PIO F;  2YS9 A;  2WB1 N;  2ZFU A;  4P1W A;  2QSG X;  3VSL A;  3QPT A;  5L3F A;  1ZGA A;  2GXG A;  2OZ6 A;  3K4C A;  5DEQ A;  4E6K G;  3GCM A;  3JAM K;  4OMZ A;  1R5I D;  3X2Q H;  1IRF A;  5LLQ A;  3S1Q J;  2BV6 A;  2V6C A;  1ETW A;  3GME A;  1SFE A;  3BR2 A;  3ASO H;  4II2 A;  4MLO A;  4RB2 C;  2FML A;  3ZQF A;  4KYW A;  3G1M A;  2ACJ A;  2K85 A;  2Q2E A;  4AVZ A;  2CW8 A;  2KZV A;  5F04 A;  2ZFW A;  4AIJ A;  2BE5 F;  4NNJ A;  4ENK A;  2BXY A;  3HSF A;  5F0F A;  3DWL E;  2L7M P;  2K5C A;  1Z3Y A;  3KEO A;  2R7D A;  4MQV A;  5DM6 F;  3FK7 A;  5KK1 A;  4RB0 A;  3ULQ B;  3LNQ A;  4F91 B;  4BAY A;  2OTL I;  3KYC B;  3E97 A;  3VYU B;  4IQ4 A;  5LHG A;  2JWT A;  4D1Q A;  1BOB A;  1FBQ A;  3E6M A;  1PUF A;  2E71 A;  1PDN C;  3OSG A;  5CLS A;  1ODD A;  4AIK A;  4E70 A;  2DOE A;  3AAF A;  5H2F C;  3HSR A;  5FB2 A;  2GOM A;  2IXS A;  4YFN F;  1OMI A;  2CWE A;  2PMU A;  1T98 A;  1WCM J;  3PSF A;  4II3 A;  1S9H A;  3OWT A;  3VYT B;  1A04 A;  1P7I A;  4B47 A;  3BZC A;  1U5T C;  3H1C A;  4MEY F;  4BY1 J;  4OAZ A;  2DA1 A;  1VTN C;  3BCA A;  1WPK A;  3OOU A;  3PNY A;  1LFB A;  2Y48 A;  3RPU D;  5L3E A;  3BG5 A;  1K79 A;  2R7U A;  3CCL I;  3Q5F A;  4RGU A;  3DCF A;  2XPW A;  3B6C A;  4A93 J;  4MQ9 F;  3MD2 A;  3SFI A;  1Y8R B;  3U1D A;  4E7Z A;  1FPQ A;  2OCC H;  2CG4 A;  3KP2 A;  2CQQ A;  3OYG A;  1BA5 A;  4PSX A;  5EG0 A;  3OYH A;  4YG2 F;  3E5Q A;  2JVG A;  1Y56 A;  4HQM A;  5D5X B;  2P8T A;  4KIB A;  2VKH A;  3ONQ A;  1HKQ A;  1GVD A;  4RB3 C;  4WX9 A;  2KJB A;  2L0K A;  3TW7 A;  3BTL A;  5HVQ C;  2QYO A;  2QQ9 A;  2IBD A;  4HEA 2;  3E6B A;  3VEP A;  5C44 J;  2CGP A;  1I6H J;  2MW8 A;  2Z16 A;  3JTH A;  4HNT A;  3L1P A;  2XPV A;  2EK5 A;  1FC3 A;  3OOP A;  1P92 A;  3BR6 A;  1DP7 P;  1ZG3 A;  4A3E J;  5D5V B;  2IA0 A;  1CGP A;  2M8G X;  1FSH A;  1YRN B;  5E1Z B;  5E8I A;  3AG1 H;  1IV8 A;  2NS0 A;  1R22 A;  1RRJ A;  2J5O A;  2ZCW A;  4NUB A;  4KMU X;  2EPF A;  1OLT A;  3PQJ A;  4U0V A;  2KIS A;  2V79 A;  4FE7 A;  5D6F A;  2DMT A;  2K9S A;  2A69 F;  3WOD F;  4OAY A;  2DBB A;  2P4W A;  3QYE A;  4I02 A;  3I55 I;  1YOV B;  5EEA A;  2Y0S N;  1QZY A;  3RTR A;  1WJD A;  1NK3 P;  4QLC U;  4KIC A;  1OCR H;  3BR0 A;  4ENM A;  3OYE A;  4HW0 A;  5EYR A;  3RZD J;  1YO5 C;  2X6O A;  1MGT A;  3S1M J;  1G4D A;  3MWM A;  3S15 J;  2ISY A;  2QSF X;  2KL4 A;  3KIO A;  3OL3 A;  3KZZ A;  1F9N A;  2JTV A;  5CPR B;  3ECO A;  1U0J A;  3N05 A;  1SFX A;  3ROU A;  3J80 Z;  3U21 A;  1TNT A;  3LA2 A;  5KCM A;  1T6S A;  4LG0 A;  4RM2 A;  3CMA I;  3MN2 A;  5IT9 Z;  1JKR C;  5LD2 C;  1I6X A;  2H1L A;  2YU3 A;  3ZQC A;  2P0W A;  3Q3S A;  3S93 A;  1IW7 F;  2X1E A;  3T5X A;  2W1O A;  4QPO A;  3B73 A;  1J5Y A;  3S3N A;  2QSH X;  4CSW A;  1Z7L A;  1IJW C;  4HDU A;  4GYI A;  4ANJ A;  2M34 A;  3V8J A;  3DLL F;  2EH3 A;  1YJ9 I;  4LB6 B;  2ELK A;  3MVP A;  1XB4 A;  2FX0 A;  3OYD A;  1GVJ A;  5TRD A;  3FM5 A;  4KT5 C;  4CZZ A;  3A03 A;  2XSD C;  4Q5S F;  2HEO A;  3GFI A;  2LF7 A;  5D5U B;  3CCQ I;  3BJO A;  1A6Q A;  2P5L C;  5FGM A;  3QP5 A;  4FX4 A;  2DA4 A;  2O5R A;  2XKP A;  1N75 A;  4PSW A;  1EKE A;  4ASN A;  2RNG A;  2IS2 A;  4JK1 X;  2JJ7 A;  4AC0 A;  1B9M A;  1R71 A;  1ZLJ A;  4AU7 A;  1R5G A;  2YX7 A;  3ZCO A;  3WTS C;  3H5A A;  2A61 A;  3HUG B;  1VZ0 A;  3KP7 A;  5K5O A;  1BI2 A;  2NOG A;  1TBX A;  2F4M B;  4EM2 A;  3TGN A;  4E4H A;  1KYW A;  2DA3 A;  5JR3 A;  3TBI A;  2P6S A;  1BW6 A;  3V8K A;  4BEH A;  2QVO A;  1E3P A;  1IUY A;  2AQF A;  4G6T B;  2FUG 2;  5BPI A;  1WJF A;  2BY2 A;  4M3B A;  1ZR4 A;  4YIR X;  3PJR A;  1V3F A;  2VBZ A;  1PJR A;  3RZO J;  3O8G A;  3D5L A;  1F36 A;  3H5N A;  3PNV A;  1W0U A;  2VON A;  4PCQ A;  2ELH A;  3GW2 A;  4O3M A;  4A3D J;  1FP1 D;  2CO5 A;  4IZZ A;  1MH3 A;  2B9S A;  3I64 A;  4L9V A;  3H3Z A;  9ANT A;  2N8G A;  5HS8 A;  5LHH A;  2BHY A;  4ABZ A;  1FTT A;  2NVT J;  3MCZ A;  1IUF A;  2OQG A;  1UG2 A;  3RSN A;  3LAP A;  1POG A;  2Y9Y A;  2EV0 A;  3I71 A;  3LL7 A;  4XON A;  3GFM A;  2PN6 A;  3GZ5 A;  4U7D A;  4FHT A;  4E7I A;  1KQ0 A;  2M0C A;  3DKY A;  4JX6 A;  5HDN A;  2HQN A;  1STZ A;  2FEZ A;  2L4M A;  2YPR A;  3E5X A;  5FO5 A;  1OCP A;  3I59 A;  1UST A;  5JFR A;  2HDD A;  2HOA A;  4HV6 A;  2VB6 A;  3ZR8 X;  2IGK A;  1IAW A;  4LIV A;  4EM1 A;  3LSJ A;  2ADU A;  3JRH A;  4CA0 A;  5HNH A;  2DU9 A;  1TWF J;  2MH2 A;  2I10 A;  3PFI A;  1MBG A;  1OYI A;  4YEL A;  3V8L A;  2DQL A;  3W2V A;  1JI8 A;  3QPS A;  1FOK A;  3D5R C;  4IHV A;  2HXI A;  3I53 A;  1B4A A;  5JLX A;  4ZDO A;  4IXA A;  3S32 A;  5HS9 A;  2QQ8 A;  2HTJ A;  4RAZ A;  3E6D A;  3CQZ J;  1VQL I;  2ZME B;  5HLH A;  1ZLK A;  2TCT A;  4RM3 A;  3RPU A;  3U9G A;  5CKT A;  5JLW A;  2K9Q A;  4A3C J;  2R5Z A;  3F72 A;  1O3T A;  3CP2 A;  3DU5 A;  5L3C A;  3B6A A;  3TQN A;  4P9U A;  1MIJ A;  2F2E A;  3S8P A;  3S3O A;  4G8X A;  2PI0 A;  4QTR A;  4A3G J;  1IDY A;  2HZD A;  2XSJ C;  3VB2 A;  3MKZ A;  3W6J B;  1MMA A;  1X2M A;  1R58 A;  1U5T B;  1BC7 C;  4FQG A;  4D5F A;  2O7O A;  5F64 A;  2Z2S B;  4N4N B;  2QQA A;  2LR8 A;  1GDT A;  3F21 A;  2DMU A;  4DIQ A;  3GZN B;  2IJL A;  3KZY A;  1GHC A;  3SYT A;  1BL0 A;  1D0X A;  1BR1 A;  4BQO A;  3KFW X;  1GXQ A;  4MFD A;  5E3O A;  4G7Z F;  2WC2 A;  4KMF A;  2WAQ A;  1T0F C;  1TW2 A;  4Y33 A;  3BLY A;  4C9Y A;  1N78 A;  3M7G A;  1RES A;  2X48 A;  4IHT A;  2ZB9 A;  5GTI C;  1X3U A;  1HW1 A;  1UAA A;  3BPV A;  1QZZ A;  2DMQ A;  2FQ4 A;  1ETK A;  2LOO A;  1WJC A;  1BN5 A;  4EMS A;  3F8C A;  3S2W A;  1D8J A;  2FOK A;  2HVR A;  4QWQ A;  3WTZ A;  3CO6 C;  4IOA F;  4D0P A;  3KP3 A;  1K78 A;  2OV7 A;  4IHY A;  1FEX A;  3LQR A;  3NRV A;  3FKJ A;  1OCZ H;  3HG9 A;  3BCB A;  4CIC A;  5EEG A;  1ZTR A;  1VQK I;  4IJA A;  4E7S A;  2XKO A;  3RKQ A;  2GLO A;  4EEF G;  2VBY A;  1YJW I;  2PQ8 A;  3BZK A;  1L0O C;  2HI3 A;  2LY2 A;  4A0Y A;  3BJA A;  1R4M B;  1W4M A;  4ZC3 A;  3J81 Z;  3Q0W A;  1QBJ A;  2XGE A;  1QZE A;  1YJN I;  3CDL A;  4B44 A;  5L3G A;  5FKO A;  4BE2 A;  1G3S A;  4N0B A;  3GYH X;  4F7Z A;  2ME0 A;  2NS8 A;  3LSG A;  1E3O C;  5E8G A;  1IN5 A;  2XAH A;  3QOP A;  5H6Q A;  5ERI A;  1USS A;  5DV5 A;  1AHD P;  2QF7 A;  3IH4 A;  3BR5 A;  4ESF A;  3CTA A;  1TL8 A;  4GRI A;  4L0Z B;  4M73 A;  3CCR I;  2UWM A;  1IN4 A;  3NAR A;  2TDX A;  3J7Z I;  3ASN H;  2E5Z A;  2DDB A;  3GF2 A;  2HQ5 A;  2VPL A;  4BHP A;  3KP4 A;  2ECB A;  1S5L C;  2EIK H;  1HOM A;  4A6D A;  1L3L A;  3HSE A;  4UV9 A;  3CC2 I;  4XOR A;  1H88 C;  2ZKZ A;  3DLA A;  2BVL A;  1SFO J;  2JRM A;  1YW9 A;  4HLX A;  4I0A A;  4XMY A;  4QSH A;  1I3Q J;  4X6A J;  4LGW A;  3JRD A;  4LJZ F;  2JVH A;  1FNN A;  1IV6 A;  2O9L A;  2BXZ A;  1QVT A;  3WHB A;  4RBO A;  3K4N A;  3GTQ J;  1R4N B;  3MZ8 A;  2UXN A;  1R9T J;  1QU3 A;  1X2N A;  2HOT A;  4V19 K;  1H89 C;  1X1D A;  4N4O B;  4EJW A;  3J7Y J;  4B3A A;  2E1O A;  3P9C A;  1LDD A;  2RAE A;  3U1K A;  3P7N A;  1F4K A;  2BVM A;  3R61 A;  2X1C A;  2K02 A;  2DFH A;  3BOQ A;  2GIV A;  3PM1 A;  3HB9 A;  5KAF C;  4W1U A;  2QBY A;  2AS5 F;  4BHB A;  2P5V A;  3CLQ A;  3G3Z A;  4RA2 A;  3JSO A;  2UZK A;  4ITV A;  1BC8 C;  2LKP A;  4I7H A;  2FMY A;  5DDG A;  2M8E A;  1IDZ A;  2F5C A;  1XCB A;  2JSC A;  2WWY A;  2L7K A;  2VN2 A;  2ZO4 A;  1LQ1 A;  4I2O A;  4XK4 A;  2M5W A;  2ESN A;  3C3W A;  1U3E M;  1DPR A;  3TKY A;  3OYM A;  2EFO A;  4HX4 A;  4Y13 A;  4Q47 A;  2YX4 A;  3LST A;  2DO7 A;  1MMG A;  3ZMU A;  2JN6 A;  5EZH A;  2H8R A;  3MEX A;  1HDP A;  3O6B B;  3CLO A;  1FJL A;  5K5R A;  1U9O A;  4NQW B;  5JHF A;  1Y1V J;  3HM5 A;  2VQG A;  5E3N A;  2DI3 A;  4LLL A;  2W82 A;  3C1D A;  3I56 I;  3A2K A;  1RUO A;  3HTS B;  1WQ2 A;  3GFL A;  1VQP I;  2NVX J;  2DOD A;  2Y0S A;  1V54 H;  2DTR A;  3LAJ A;  2EB7 A;  3QYB A;  2CUZ A;  5GAD J;  3HGG A;  1XX5 A;  2WV1 A;  2CRG A;  1CF7 A;  4S04 A;  4GYG A;  4XN0 A;  4U7B A;  2HNH A;  5JVG F;  5BQT A;  3RJP A;  3SZT A;  3ZQ7 A;  2VKV A;  2PG4 A;  4LOC A;  2MC3 A;  5AIP A;  3RKY A;  4OWR B;  1UJ8 A;  5D4S A;  4WK8 F;  2XAG A;  2HVQ A;  2X6X A;  1DUX C;  2CYY A;  4CYC B;  2DYS H;  4LMY A;  1GLN A;  1O4X A;  2XAF A;  3Q0V A;  2XPU A;  2ZXJ A;  4ENN A;  4D5C A;  5KVR A;  3V7R A;  4C3H J;  3ERM A;  3WU1 B;  1TQM A;  2MLK A;  1XN7 A;  3D1N I;  1ACI A;  3BR3 A;  3VFZ A;  3WG7 H;  3HEF A;  1Z77 A;  3ZP5 A;  1A6I A;  2KRH A;  1S6L A;  2HQA A;  2DA6 A;  1WH7 A;  1WJ5 A;  4HX7 A;  2ZJR F;  4O5V A;  2HDW A;  1IF1 A;  4DGW B;  1TNS A;  5M3M J;  3HHG A;  2LDU A;  4V2F A;  4EJT A;  4I09 A;  5L3D A;  4AID A;  2HPM A;  5IYB J;  3OSF A;  1G6N A;  2ID6 A;  1PUE E;  2HKO A;  4Y52 J;  1X3W B;  2EV5 A;  4A3B J;  2XF5 A;  1EA3 A;  3EQL F;  3KLO A;  4NC8 A;  3SEQ A;  3DTK A;  4U88 A;  1HSJ A;  5HOD A;  3A01 A;  2OPT A;  1R5H A;  1SFK A;  1JUS A;  4BBR J;  3JRC A;  3CC7 I;  2R7S A;  2KMU A;  4XQF A;  3CUQ C;  1BI3 A;  1TT0 A;  3CMY A;  4A3L J;  1NH3 A;  2R0Q C;  1ZHF A;  3PUB A;  4RAY A;  2DT7 B;  3PQK A;  1Z0X A;  1T8I A;  2QA4 I;  3ERE D;  5K7F A;  1XMK A;  2VC0 A;  4HYE A;  4XLH A;  4B4C A;  1ZRC A;  5FLM J;  1HKT A;  2NVU B;  2B63 J;  5ILU A;  2V9V A;  4JP0 A;  2P81 A;  1T56 A;  4BYY A;  2DFI A;  3H92 A;  3P9I A;  1D5V A;  1IO2 A;  3ZXS A;  3PL8 A;  4KN7 X;  1WI9 A;  3M8F A;  5JI6 A;  5GP9 A;  1WHU A;  1X1B A;  1Y0N A;  2M87 A;  2GBY A;  2V7F A;  2JPB A;  2O3F A;  3GFJ A;  2GOX B;  2L01 A;  4C2M J;  1B72 B;  2QWW A;  4NB5 A;  1MKM A;  3I4M J;  3CME I;  2CMP A;  2E35 A;  2KIU A;  5J1Y A;  5F1J A;  4FIS A;  3W2W A;  4X0G A;  4GCV A;  1MBE A;  2J5P A;  5D6E A;  3FIS A;  2OF7 A;  2OZU A;  4D7N A;  1ZAO A;  4HNU A;  2IRF G;  1LNW A;  3I58 A;  3EPZ A;  2B7E A;  3S3M A;  2RV8 A;  2DMP A;  4L9J A;  1ORK A;  2PMZ N;  2CW7 A;  4OIN F;  4M72 A;  5HLI A;  5FLX Z;  4IHX A;  4MTE A;  3UKG A;  3HXL A;  3P5J A;  4XR6 A;  1TQI A;  3CDI A;  2LRE A;  3JRI A;  4BJ6 C;  3H36 A;  5K7H A;  1MH4 A;  1P4X A;  1ETY A;  2K3P A;  3K4K A;  3NWS A;  4BGD A;  3OYA A;  3SXY A;  1MDM B;  4I98 B;  4ETS A;  1DQU A;  5ILV A;  1W36 C;  4UUT A;  4M9X A;  5HOO A;  4OIR F;  4FAS D;  2EFN A;  2XRL A;  3CES A;  2RQP A;  5HDK A;  5FRO A;  2R7V A;  3FXM A;  1B59 A;  2MAB A;  3S1N J;  4XLE A;  2ZME C;  2DN0 A;  2UUZ A;  3IH3 A;  2VIX A;  2VXD A;  1X1A A;  4NC6 A;  2GQQ A;  4AD9 A;  3DXJ F;  2Y0M A;  2A6H F;  3JRF A;  2IA1 A;  1YX3 A;  1T39 A;  3F22 A;  3B02 A;  3R0A A;  5E79 C;  1OR7 C;  2D45 A;  4PGG A;  4UUV A;  2A5W A;  2A6E F;  2K7L A;  3WGG A;  1ERD A;  2K4J A;  2KIM A;  2P7C B;  4CGZ A;  1R00 A;  3OYF A;  2F4I A;  3OYC A;  2OQR A;  1OCO H;  4OOI A;  2ZJ2 A;  1KU2 A;  2V4J C;  4DNC A;  3BC8 A;  2VJ5 A;  3JW4 A;  1VQ7 I;  1ONV A;  1R7J A;  2DA2 A;  1RC9 A;  2I8D A;  2OD5 A;  4W97 A;  3HPH A;  5BPD A;  2HVS A;  3QP6 A;  2F5F A;  2OA4 A;  1MNE A;  4HNV A;  2FBK A;  3F9K A;  2LSO A;  1OKR A;  2M1B A;  1KA8 A;  3HL2 A;  2FD5 A;  3K70 C;  1OIS A;  3CJQ B;  1Y0U A;  1BM9 A;  4PK4 A;  4RDU A;  1IXS B;  2GA2 A;  1VQ4 I;  1AU7 A;  2ME6 A;  2OUM A;  3MZY A;  2VL8 A;  2DCE A;  2CS3 A;  2Z99 A;  4X1E A;  2MD5 A;  5GTH C;  4BDY A;  3CCU I;  3L09 A;  1Z1D A;  2M4K A;  2XV4 S;  4XKV A;  4LK0 F;  5E3L A;  1TLH B;  1JGS A;  3L2R A;  3N97 A;  2ZSI B;  4HG2 A;  2GAU A;  4ZZL A;  2LK2 A;  2JZY A;  2CSO A;  2LNB A;  1TW3 A;  2VI6 A;  2VQH A;  4UVA A;  1YS7 A;  3CCS I;  2JA8 J;  5E1X A;  1U8B A;  2CV0 A;  1BI1 A;  3KPH A;  3HRS A;  2QLZ A;  1HW5 A;  1SVO A;  4MEX F;  1XG1 A;  3RKX A;  3TP0 A;  1QVU A;  1U5T A;  2V9K A;  3PNT A;  4PFP A;  5FKL A;  4NHJ A;  1SMY F;  3WE3 A;  1XS9 A;  5CVU A;  3HBL A;  1HW2 A;  3IH2 A;  1SAU A;  2Z9O A;  1RI7 A;  1PVE A;  2XRO A;  1EH6 A;  4KIT B;  5IYC J;  3CC4 I;  2WAF A;  3S14 J;  1EF4 A;  1YQA A;  1WJB A;  3JCU C;  5LRR A;  2RVC A;  2Y31 A;  3BTI A;  5FD5 A;  3FHZ A;  3M1E A;  2V6E A;  2VE8 A;  2RNJ A;  2DT5 A;  4D7M A;  2E60 A;  3BJ6 A;  3F8F A;  5FFX A;  1TTY A;  4I6Z A;  1K83 J;  1UHM A;  3RKW A;  5DCM B;  3J80 K;  1D8K A;  2DPU A;  4KNY A;  2MFZ A;  2L9V A;  3K1P A;  5DD8 A;  4DJA A;  1GV5 A;  5KNL A;  3IKV A;  2BGC A;  3OS1 A;  2KKO A;  4Q4Z F;  1XDU A;  4LIU A;  3IL2 A;  1HCR A;  1D1B A;  4YEJ A;  4ESJ A;  1UB9 A;  1D0Y A;  4M9Z A;  1P4A A;  3CJR B;  1U6G A;  1JT6 A;  1JHH A;  3HOU J;  3I4P A;  4XIC A;  4U0Y A;  3IP4 B;  2FF4 A;  2KDZ A;  4EJV A;  1QPM A;  5BMZ A;  4HF1 A;  1ULY A;  2A68 F;  3J7A O;  1JKO C;  4UY8 I;  2OBP A;  2VBX A;  4UUS A;  1R6R A;  3GLX A;  2E2I J;  5IYD J;  3LA3 A;  2IS6 A;  3TO7 A;  2EA2 A;  2XDV A;  2HTS A;  3JTG A;  3GWZ A;  4E7K A;  3RQ4 A;  4IHW A;  4BJ5 C;  1NG6 A;  1FP2 A;  2L7Z A;  4BY7 J;  1FBU A;  1P2F A;  3OIO A;  1XPX A;  1IXC A;  5TJJ A;  1SMT A;  1WJA A;  1W0T A;  2LRD A;  5FRN A;  3ELK A;  1QQI A;  3A0H C;  1YI2 I;  2X1D A;  3GEZ A;  3GVA A;  3CDH A;  5GAE J;  1Q1V A;  3BG3 A;  2QKL B;  1D1A A;  3BWG A;  3VWB A;  2X85 A;  2QZ8 A;  1HBX G;  2HXO A;  4XRS A;  2KPM A;  1EH7 A;  4RLF A;  3WTV C;  4HOB A;  3CUQ B;  3VOD A;  4V2G A;  4IX7 A;  4HAM A;  1O7F A;  2LC2 A;  1LVA A;  1K6O A;  2HR3 A;  1FWZ A;  4M3E A;  3G1O A;  2VC1 A;  4BQN A;  2QCO A;  4Y7N J;  1R49 A;  5F08 A;  2COB A;  3DTI A;  1SAX A;  1IC8 A;  3V7C A;  3AKZ A;  2OTJ I;  4CH7 A;  3GO5 A;  5EZG A;  4BL0 B;  2D5V A;  4CZC A;  2NVQ J;  1BI0 A;  1Z05 A;  2BHZ A;  1J0R A;  3HHH A;  4B8X A;  4RAG A;  5J8C A;  4M6V A;  3EUK L;  5F6F A;  5BNG A;  4LLG F;  3M3Y J;  2P7V B;  3HOY J;  5J1R A;  4YII A;  2Q2E B;  2X6Y A;  3SFZ A;  4XL9 A;  4GDF A;  4LLN A;  1F5T A;  2KRC A;  2Z5U A;  2CU7 A;  2IA2 A;  4UVC A;  1V5G A;  2GXA A;  3IAM 2;  3OV8 A;  1ZH5 A;  1E2X A;  2DMN A;  3EYI A;  5AIQ A;  1MW7 A;  5F27 A;  3V4G A;  1B1B A;  4KDP A;  2FE3 A;  1QA6 A;  2KIF A;  2LLK A;  1RR8 C;  3TDU C;  4XSX F;  4JX4 A;  1LEA A;  1KU9 A;  4GXO A;  5E20 A;  1PUF B;  3PSI A;  1P4W A;  4DYC A;  2FXA A;  1FIP A;  3D0S A;  1FYL A;  2R7O A;  2NAZ A;  4S0H B;  3U2R A;  2HGC A;  5EDN A;  1IRX A;  1HF0 A;  1QGP A;  4MO7 A;  1D5Y A;  4MHG A;  3DBR B;  1A5J A;  2LY9 A;  2F5D A;  3K69 A;  4ZH4 F;  1I50 J;  5H6R A;  3NQO A;  2BW3 A;  4IRG A;  2EA4 A;  2WAD A;  1YIO A;  2G0E A;  4CXF A;  3OIQ A;  4IKF A;  3QQA A;  5DS9 A;  2R3S A;  2JA7 J;  1LFP A;  2F5V A;  2GXB A;  2R7T A;  4H4K C;  5C4J J;  4B3X A;  3S1R J;  4I0B A;  2HQR A;  1S72 I;  1DU6 A;  4A6E A;  2IAI A;  3JSP A;  2HU9 A;  3ZQG A;  3CCV I;  3S2H J;  1QPI A;  3SZP A;  2JSP A;  1PP7 U;  2R7W A;  3W6K B;  2L7F P;  1BR2 A;  2ID3 A;  2KLO A;  3DQV C;  1Z6T A;  5EG0 B;  1AKH A;  2RDP A;  2XIG A;  1E3H A;  4G12 A;  5LEJ A;  4XKW A;  2AO9 A;  2W84 A;  1EJ9 A;  1S7E A;  2DQR A;  1RIO H;  3H3U A;  4CCL A;  3LSK A;  3ABU A;  2LBF A;  5FKN A;  5D5W B;  5EGO A;  3L2V A;  4F93 B;  1LPQ A;  3K0L A;  2CQ7 A;  1X58 A;  3QRF F;  3ZOB A;  5BOX A;  3FBN B;  1A35 A;  2FQ3 A;  3R6S A;  3RDI A;  3MZH A;  3F0C A;  2R5Y B;  3H9J A;  2JA5 J;  1YLF A;  2FBI A;  1JE8 A;  1VQ6 I;  1H9G A;  3L7W A;  5GPC A;  4IHS A;  5J8F A;  1Y39 A;  2PJR A;  5CVV A;  1RKW A;  5ILS A;  2WB1 A;  1MZB A;  1KON A;  3DPT A;  2QM3 A;  1J9I A;  2R4G A;  3RIR A;  1V4R A;  1S29 A;  3QWL A;  3J81 K;  1F1Z A;  3SHF A;  2VQL A;  3M1C A;  4PUS A;  2EFW A;  3BQY A;  4CCK A;  4BUP A;  2AXT C;  3G1L A;  3HOS A;  2IS4 A;  4A5N A;  1TWC J;  2AXL A;  2MLG A;  1TT5 B;  2G7H A;  1AOY A;  2PMZ A;  1S8N A;  3H9Q A;  4Y4R A;  1R23 A;  4UVB A;  5J4Y A;  2VQC A;  1R1V A;  4H0E A;  1J59 A;  3A4C A;  5M3F J;  1SC7 A;  1LDK B;  1VND A;  4UB6 C;  4UNO A;  4HF0 A;  2BBY A;  1RKT A;  3O3K A;  4RAF A;  5TGT A;  3WTU C;  3E6C C;  2ZNY A;  3TMO A;  1WSU A;  2CQX A;  3ESW B;  3G2B A;  3OYL A;  4LG0 B;  2Q0O A;  3EUH C;  2LFB A;  3HOX J;  2JT1 A;  3CF2 A;  1T0F A;  3TOA A;  3GTG J;  3ZMZ A;  1MSF C;  1BBY A;  5HLG A;  3GBG A;  2W24 A;  1G3W A;  2F48 A;  1H9T A;  3IWF A;  3RQI A;  3T8R A;  4UB8 C;  3L2C A;  1Z7U A;  4G9Y A;  2V1N A;  1KU3 A;  2FBH A;  4IPA A;  3IC7 A;  1MJA A;  1LUJ B;  2V9P A;  5AON A;  3I54 A;  5LEK A;  3AG4 H;  3SDB A;  4EGZ A;  5GAG J;  1NHA A;  2EIM H;  2UXX A;  1JJ8 C;  2XAJ A;  1VQM I;  1TC3 C;  2DW4 A;  2DFF A;  4I01 A;  1LE8 B;  2LYC A;  1IG7 A;  2KRF A;  3F8N A;  1IGN A;  4ZYA A;  2L02 A;  3SZG A;  5M5X J;  4LFU A;  3KET A;  1JKQ C;  1UZC A;  5H20 A;  2R7F A;  2IGM A;  3GLL A;  1B8I B;  1ZN2 A;  3ZQH A;  4HDV A;  4U87 A;  3VYS B;  1XC5 A;  3LA7 A;  1ON1 A;  1SD6 A;  2H6C A;  4L5E A;  3M8J A;  1MBF A;  2M3A A;  5C4X J;  4BEH B;  3OYI A;  5CVJ A;  2RN7 A;  5CQG A;  5HLT A;  2GZW A;  3HJE A;  3DU6 A;  5ICG A;  2MA3 A;  4CCO A;  4XBF A;  4DOZ A;  1SD5 A;  3BG9 A;  1OCT C;  3QAH A;  3HOV J;  1XGO A;  3MKY B;  2EZK A;  3ZRG A;  2L9N A;  2FA5 A;  1ETV A;  1KQ8 A;  5JVT A;  4LD5 A;  3LSH A;  3SEZ A;  2ZC2 A;  2Q8K A;  2FSW A;  3ABM H;  1MJB A;  4KJZ A;  3K2A A;  1YIJ I;  4M71 A;  1K6Y A;  2W57 A;  1MNM C;  2MYS A;  5C3E J;  2XGD A;  4PJN A;  2XB0 X;  3QOE A;  2P5K A;  2OJE D;  3HYI A;  3I59 B;  4B1R A;  2ZJQ F;  1DDN A;  3FZV A;  4HLY A;  3KCC A;  2X4H A;  3DF8 A;  3Q9V A;  1Z9C A;  1ZGW A;  3LSI A;  3NEU A;  2CFX A;  4RLQ A;  2W48 A;  3C7J A;  4E7J A;  1W36 D;  3BP8 A;  2CV2 A;  4HZF A;  2LKS A;  3BTC A;  2BY1 A;  1MBJ A;  4NDL A;  1BJA A;  3HDD A;  2IPQ X;  3DKW A;  4PDK A;  4F3Q A;  2PFB A;  1HLV A;  2VLA A;  1J7K A;  2HZT A;  5D8K B;  2ELJ A;  5DM7 F;  3FIW A;  4EJU A;  2Y2Z A;  4IEJ A;  3CF5 F;  1WKM A;  4KIF A;  1TWH J;  5CVR A;  2LVS A;  2R5Z B;  2CUF A;  4LB5 A;  4WXD A;  1IRG A;  1LKX A;  3VOE A;  1KQ9 A;  5IP7 J;  3WTY C;  3RI4 A;  2Y9Z A;  3L2W A;  4G6Q A;  1ZYR F;  1ZEL A;  2KZG A;  3H35 A;  2XVC A;  3DEU A;  4HX8 A;  2OU2 A;  2ZXH A;  3RCO A;  2BZT A;  3AFH A;  4A0Z A;  2PMH A;  1HKS A;  3LMM A;  1JKP C;  5ICC A;  4M3D A;  5K1Y A;  3FX3 A;  3JRG A;  3K70 D;  1UCR A;  3ZQQ A;  1FSE A;  4B48 A;  3DV8 A;  2A05 A;  2DJI A;  1Z67 A;  2D1H A;  5B5E C;  3Q0U A;  1YRN A;  2H1K A;  2ZSH B;  2E1M C;  4AM3 A;  4YFK F;  4ZYG A;  2R92 J;  1ZQ3 P;  2YSR A;  3OR1 C;  4J01 A;  3M4O J;  1OPC A;  2JPC A;  5HS7 A;  2O8X A;  4XSZ F;  1BIA A;  3E0J B;  4DBQ A;  4A12 A;  3K4M A;  1FY7 A;  2MGQ A;  3H3V K;  3IRR A;  4E7L A;  3E5U A;  3K6G A;  4XLP F;  3PFY A;  2Z1D A;  3FXL A;  5DYM A;  2O8K A;  2K9M A;  4FT8 A;  2DYR H;  4HSR A;  3O2P E;  4RB1 A;  2VAS A;  1O7L A;  3CCJ I;  3AG2 H;  2KDO A;  3C2G A;  3HPG A;  4S05 A;  2RC4 A;  2V26 A;  5J40 A;  4ZYD A;  4XOP A;  5IT3 A;  3IKT A;  1K78 B;  3GX4 X;  2JK3 A;  3KP5 A;  3HKZ N;  3FXQ A;  1WZ2 A;  1G8X A;  2KHM A;  1XGM A;  2M7B A;  4RMN A;  2O61 A;  3TDZ C;  3D5S C;  1FX7 A;  3CJT B;  1F43 A;  3TP3 A;  1VFC A;  3ZQL A;  1ZR2 A;  5GPA A;  4WWC A;  3GZ6 A;  3G6E I;  3SDG A;  3HRM A;  5LHI A;  3PO3 J;  2DT6 A;  1LDJ A;  4OU0 A;  3ML6 A;  2Z3Y A;  3DPL C;  1ETQ A;  4GFB A;  4L0Y B;  1MMS A;  1YTY A;  2KIQ A;  1SD7 A;  2HFH A;  4AUX A;  1K61 A;  4ZTJ A;  3ZPL A;  1FZP B;  3DFG A;  1ZK8 A;  4KIS A;  2W4S A;  5FLX K;  3F23 A;  4RGS A;  1QHG A;  2LY1 A;  5A2Q Z;  3IV5 A;  2WY8 Q;  4BHC A;  4IO9 F;  4IRH A;  2IVM A;  3RPQ A;  3ZMV A;  2MG4 A;  2V1U A;  3GTO J;  2RQQ A;  4M3F A;  5B3S H;  5ICE A;  4ESB A;  2R7Z J;  2HS5 A;  4YRV A;  3LFU A;  3CCY A;  3HUG A;  4XLN F;  1LB2 A;  3M07 A;  3QU3 A;  4WF2 A;  4MNU A;  3KE2 A;  2KJC A;  3ZGK A;  3DP7 A;  4EAT A;  4YIF A;  1ETO A;  1XDS A;  5LBQ A;  5E18 F;  1YFH A;  1VQ5 I;  4HA8 A;  3DTE A;  4B43 A;  2DXI A;  1TWA J;  2RGV A;  2IT0 A;  2E19 A;  2M7A A;  1UFM A;  2ESH A;  4I99 C;  2E2H J;  2L2O A;  3QU6 A;  5EEH A;  3LSR A;  2MSY A;  4PFO A;  2WAE A;  1XD7 A;  4HF2 A;  1PP8 F;  4CCJ A;  1YW8 A;  1XGS A;  2HYG D;  2DFE A;  3W6V A;  4EJO A;  3WU0 A;  3FHN A;  2WA0 A;  1ENH A;  3FXJ A;  4P5O A;  1WFX A;  2LF8 A;  2WBM A;  2MC4 A;  4CYD A;  3LSP A;  1REP C;  3JAM Z;  2QBY B;  4XOT A;  4XRF A;  2E1N A;  2XRN A;  5J6X A;  1T38 A;  4KT6 A;  1E17 A;  1PYV A;  5IPA A;  2L9R A;  3AL0 C;  2IP2 A;  4PJ0 C;  3CUO A;  3MAJ A;  4BQA A;  2HKX A;  1W5S A;  5IOY A;  4OIP F;  3KZI C;  3W2A A;  3C2H A;  3F6V A;  1T33 A;  3PIP F;  4R79 A;  2PLY A;  1VQ9 I;  1WI3 A;  2E7W A;  3IUO A;  2HDC A;  2L4A A;  1HQC A;  4L9N A;  3WE2 A;  2H94 A;  3K1M A;  1W7P B;  2CQN A;  1JGG A;  4L9T A;  2UV1 A;  3CD6 I;  2JMW A;  1OYW A;  2ECC A;  2VT2 A;  4F92 B;  4KA4 A;  2OAZ A;  1RUN A;  1SVM A;  3M8E A;  4M74 A;  3SQN A;  1JHF A;  4KUM A;  2IGN A;  2G7U A;  1W5C C;  1YE9 A;  2QGU A;  4OIQ F;  5B66 C;  4CCN A;  2DA5 A;  3FMR A;  1H8A C;  1FIA A;  4BXU A;  3O8H A;  3I3L A;  2ZME A;  4XLA A;  1K4T A;  1VQ8 I;  3H9G A;  3I4N J;  3EYY A;  5EF6 A;  1O57 A;  2LD5 A;  2JA2 A;  2EFQ A;  1QRY A;  3LSM A;  2VOD A;  1IN6 A;  3T0Y A;  3OR2 C;  1OR7 A;  3JR9 A;  5IY5 H;  1CF7 B;  2JQ7 A;  3CMM A;  4XM3 A;  2K40 A;  5EJC A;  2GWR A;  2NNN A;  4J19 A;  1XSD A;  2EFP A;  4L5I A;  3MKL A;  1AA7 A;  2ZJP F;  3RYR A;  3OMY A;  2I5U A;  3CP8 A;  5D4R A;  3OY9 A;  4BQQ A;  1P7J A;  1VF9 A;  2A6T A;  2HYJ A;  2RRE A;  3DEW A;  2VUM J;  2L3D A;  3BDD A;  4G7H F;  1ZG5 A;  2CQK A;  3ECH A;  5FRM A;  4DYQ A;  1ETX A;  3E7L A;  4DQ2 A;  1RNL A;  4A2U A;  1I27 A;  4ZJZ A;  5B1B H;  3OIP A;  1ZAR A;  1EH8 A;  3WGI A;  2R5Y A;  4HQE A;  1H0M A;  4BE1 A;  2A5Y B;  4A3J J;  4MIM A;  4NBQ A;  1TP4 A;  3WTW C;  4A3I J;  3T8T A;  5IT9 K;  3ZMD A;  3OYK A;  2XF6 A;  3HTU A;  4PZJ A;  2KQR A;  1HDD C;  1BJZ A;  1UMQ A;  2BY3 A;  3FWE A;  1ON2 A;  1MMN A;  3L9F A;  4C3J J;  3JRB A;  2NRA C;  2ICW G;  3OYN A;  1W5T A;  4LK1 F;  2CUJ A;  3M9A A;  3S2D J;  5FD6 A;  5E1W A;  2R7R A;  3KP6 A;  1R1T A;  2EWN A;  3GXO A;  3PUF A;  1QO0 D;  2NYX A;  4Z2Y A;  4M9S A;  3E1S A;  3KYL A;  3G4S I;  3FKI J;  2E1M B;  3HGY A;  4DZP A;  1XSV A;  2H09 A;  3A01 B;  1MBH A;  3EDP A;  2M9H A;  1P9Q C;  2XAS A;  2JRT A;  4AYB N;  4R1H A;  3DBL B;  4N9I A;  2EIJ H;  3L2U A;  1SVL A;  1X3Z B;  3NAU A;  2DJN A;  3ABK H;  1RET A;  4XLF A;  3QOD A;  3FXU A;  1IN8 A;  4FET A;  4AVP A;  4BXF A;  1V55 H;  1FOW A;  1UEL B;  2LKX A;  1XMA A;  2STW A;  4C30 A;  3LFK A;  3R60 A;  4IQJ A;  2NOJ B;  1FOX A;  1M1E B;  2DLL A;  1LJ9 A;  2V1D A;  4U0W A;  1WWX A;  2COM A;  1ZRD A;  2PBI A;  5FKK A;  4C2U A;  4XLC A;  1WRJ A;  1GUU A;  1D3Y A;  4ENJ A;  4UHT A;  3FXO A;  1Z91 A;  4IVN A;  1I5Z A;  4M3G A;  4CCM A;  4Q48 A;  3TO9 A;  4OMY A;  2W00 A;  1UG0 A;  2Q1Z B;  2XAU A;  3BZ6 A;  4BH9 A;  5LGU A;  3ABT A;  4ZZD A;  4EV0 A;  4PJJ A;  3MQ0 A;  5FJ8 J;  4IOC F;  4A3M J;  5FLV A;  4FCY A;  4DZJ A;  5FKM A;  1BOA A;  3I5U A;  1FMV A;  4D9J A;  3H0D A;  2ISZ A;  1LE8 A;  2CUE A;  2YUS A;  3OYB A;  2VOO A;  2O6G E;  2K86 A;  4JX5 A;  5LFA A;  3C18 A;  4IL6 C;  3OS2 A;  4FTH A;  5HDG A;  3TW6 A;  4BAC A;  4BBS J;  1B8I A;  4A69 C;  3FF5 A;  3VPR A;  5GAH J;  1VQO I;  1T2K A;  4BKX A;  4ZYH A;  4GGG A;  2VKD A;  1U2W A;  1FTZ A;  1MND A;  1W1W E;  3CCE I;  5CQE A;  4F55 A;  2GM4 A;  5IOZ A;  4ZDP A;  3S16 J;  1EV7 A;  1KZH A;  3K2Z A;  4QPQ A;  3BR1 A;  3G73 A;  1XSX A;  3R0J A;  3AG3 H;  1YHQ I;  2M45 A;  4TV7 A;  4UV8 A;  3ZN0 A;  3BTJ A;  1QNT A;  3F6O A;  4RGR A;  4BDZ A;  2IW5 A;  4QIW N;  4BXX J;  3HRT A;  2M4G A;  3G71 I;  4IF4 A;  1BIB A;  2R7Q A;  4Y17 A;  2KT0 A;  3FXR A;  1VQN I;  5L3B A;  1E0E A;  5CVI A;  5KHD A;  4HST A;  4XKC A;  3COA C;  3TL4 X;  2A3S A;  5LGN A;  5CJ9 A;  5K5Q A;  1YX5 A;  4EQQ A;  1W7P D;  3LWF A;  3H5R A;  4JBA A;  2D1V A;  3DEE A;  5J1U A;  2V1X A;  4CUG A;  5ED4 A;  1FMW A;  5FFZ A;  2ZBK A;  4NQW A;  5D8L B;  1GXP A;  2HOS A;  3KEY A;  1WGX A;  3A1Y A;  4L5J A;  3WTX C;  1IN7 A;  1JJ6 C;  2CJJ A;  2GIZ A;  4BU2 A;  1JT0 A;  4FE4 A;  3KX2 A;  2E2J J;  2XGC A;  3V42 A;  5M5W J;  3EET A;  3AL0 B;  2JA6 J;  1ZGJ A;  3K4J A;  1I3A A;  1JUP A;  1X19 A;  2IGO A;  1V5F A;  1U78 A;  1Y8Q B;  4MFE A;  4EGY A;  3I0T A;  3HKZ A;  1J2X A;  3DPU A;  3HOW J;  2F6C A;  4UXN A;  2NXN B;  2L9S A;  4CHU A;  3KEQ A;  2VBW A;  2NNY A;  4Y15 A;  2VOP A;  3WGH A;  2DDA A;  2IEK A;  3OS0 A;  2RKH A;  1FT9 A;  5F0H A;  4CYC A;  2ZXW H;  1O3R A;  1S7A A;  1HST A;  4C2T A;  1WH5 A;  3C2B A;  3FK6 A;  1BR4 A;  1A36 A;  3K1N A;  4ON0 A;  3ZMT A;  2TRT A;  3K9T A;  5M5Y J;  4RGX A;  3FMQ A;  4MTD A;  2E1C A;  2QKM B;  1NG7 A;  2W25 A;  4BJT A;  4PJL A;  1DGR M;  1JTX A;  4PGH A;  2FJ1 A;  1J75 A;  4WCG A;  2X6W A;  1G2H A;  5DUK A;  1TWG J;  1X1C A;  1X1P A;  2DK5 A;  3IRQ A;  5F1R A;  4G7O F;  2HOE A;  4AWX B;  3JRE A;  2VPR A;  3HOT A;  2CH0 A;  2D2W A;  1FYM A;  5F0C A;  3L2Q A;  3GTJ J;  1ZG1 A;  3TED A;  2L54 A;  2LH9 A;  2CW0 F;  3JRA A;  3DKX A;  4NC7 A;  1IXR C;  3WHC A;  1ZRE A;  3QPH A;  2HYF A;  1Z6R A;  2MD0 A;  3ISP A;  1A31 A;  3VDX A;  1RZ4 A;  1XCV A;  1LEB A;  1UHS A;  2STT A;  1NTC A;  1X4P A;  4GO1 A;  3IAS 2;  1XGN A;  1I39 A;  2BYV E;  2HPI A;  4KN4 X;  4E7H A;  1B9N A;  1K4S A;  4HPQ A;  2MBF A;  4G6D A;  5TIS C;  1VI0 A;  1DPU A;  2LMD A;  4UUS B;  3GUD A;  2AQE A;  2G9W A;  2XF7 A;  2QEX I;  4M6X A;  3ZQI A;  4R8H A;  3TO6 A;  3I9V 2;  3BPX A;  2DK8 A;  2QQB A;  2DTZ A;  4K2E A;  1Q1H A;  2VT3 A;  1SD4 A;  1TQP A;  1K7A A;  2PJP A;  1U9N A;  5E17 F;  4LG3 A;  1CQT A;  2DA7 A;  1I1G A;  4KFC A;  3IHU A;  1HC8 A;  1JUM A;  1MMD A;  1AWC A;  3REO A;  2O0Y A;  3V7S A;  2EV6 A;  2Y75 A;  1DP3 A;  1B72 A;  5IP9 J;  1S3J A;  3F3X A;  3FM3 A;  1SAN A;  3HZJ A;  4DBR A;  1WVR A;  3QYF A;  3F8M A;  1OFC X;  2LG4 A;  4PJM A;  1GT0 C;  1J09 A;  3BY6 A;  1FLI A;  2NVY J;  4JYK A;  5K7Z A;  3WU2 C;  1Z21 A;  3N4M A;  5KAI C;  2DPD A;  1GV2 A;  2YR2 A;  3A0B C;  1YYV A;  1YG2 A;  1T08 B;  3EUH A;  4F52 A;  1YW7 A;  1D1C A;  2R7X A;  4XRM A;  5DCF A;  3GTK J;  1V5E A;  3FDY A;  3KYD B;  1C0W A;  2MH9 A;  5J47 A;  2JUC A;  2E34 A;  2KP6 A;  2LP0 A;  4WXH A;  1MBK A;  1B6A A;  1QHH D;  2F5E A;  4I76 A;  4YFX F;  1U8R A;  1MDM A;  1YS6 A;  3K7A J;  2HWV A;  2ETH A;  1ZRF A;  3OL4 A;  4B09 A;  2B0L A;  3BG6 A;  4EM0 B;  1KYZ A;  1UHW A;  4A0X A;  2OCE A;  2VJ4 A;  5J4V A;  3K10 A;  1X4O A;  6PAX A;  1TZL A;  3S17 J;  2EQR A;  1HXD A;  3F8B A;  1JTY A;  1R1U A;  2Z33 A;  2E7X A;  5HNF A;  1R36 A;  3Q9S A;  2WTE A;  2K4B A;  3L00 A;  5DD4 A;  1SFU A;  3K4L A;  4P96 A;  4JOM A;  1OQY A;  2K9N A;  3QPL A;  5BS6 A;  3ZMS A;  1S7O A;  3BQZ A;  3LOC A;  2ZNZ A;  4P9F A;  5JHU A;  2E5N A;  2W85 A;  2EZH A;  3DBH B;  4XNF A;  2VJI A;  4DW6 A;  4HBL A;  3HC7 A;  2JUG A;  4AIH A;  2BW3 B;  1W7P A;  2CV1 A;  2Y30 A;  2EZL A;  2W7N A;  2PX9 A;  3T1B A;  2M0M A;  1NK2 P;  4G94 A;  4M6Y A;  5DTD A;  5IP6 A;  2C6Y A;  3FBI B;  2FU4 A;  3HRU A;  1LVK A;  5DUI A;  2M2E A;  1RPW A;  2VE9 A;  1N25 A;  2DOF A;  2L5Q A;  2Y69 H;  2NS7 A;  3R4K A;  1O3Q A;  2ZXI A;  4A5M A;  4EVI A;  3WTT C;  2XB5 A;  3FMS A;  4ZYE A;  1O3S A;  1IRZ A;  2GA1 A;  4FX0 A;  1KU7 A;  2OC6 A;  3UNG C;  1AKH B;  2QEN A;  4RS8 A;  5E3M A;  3E3V A;  2EZI A;  3PO2 J;  1HA8 A;  3BRO A;  2K3F A;  2K9L A;  4AYB A;  2R93 J;  4JQF A;  4MGR A;  4IRI A;  1MD0 A;  1OYY A;  1SEU A;  2BY0 A;  4A3F J;  2BOL A;  1Z3X A;  3BT9 A;  2FOW A;  1XMX A;  2LTP A;  2LBF B;  4BS9 A;  4A3K J;  3TOB A;  5EGO B;  2A07 F;  1RR7 A;  4N9H A;  2H6B A;  4O6J A;  5J3L A;  4HRI A;  4OIO F;  2VJJ A;  4WXC A;  3IWZ A;  2QUF A;  3H0G J;  2KFD A;  1T95 A;  4ZDL A;  2X9D A;  3VYR B;  2WY7 Q;  4XN3 A;  4DYR A;  2XUB A;  2FNP A;  2WV0 A;  1OJL A;  3SJM A;  4XID A;  1DGW Y;  2BEO A;  2DAO A;  3ABL H;  3GTL J;  2K27 A;  2FRH A;  3VSK A;  4BNC A;  3NWT A;  1G3Y A;  2X0L A;  1YIT I;  1WJE A;  2PJR B;  3CJN A;  5DCM A;  1IZ1 A;  1KGS A;  2XC7 A;  3P9K A;  3MKW B;  3W3C A;  3UR3 C;  1OCC H;  4Y3O A;  4BE0 A;  1G3T A;  3A02 A;  3CCM I;  1LFU P;  3LQQ A;  5LGT A;  3MMY B;  2EIN H;  4C3I J;  1MJ9 A;  2VKE A;  1G59 A;  2H8W A;  4XRS G;  2EJR A;  3ZN1 A;  2AHQ A;  4CDG A;  2X51 A;  5ICF A;  3HOZ J;  1XTA A;  4L18 B;  2XHK A;  2CFO A;  4LIT A;  1P6R A;  4HV5 A;  1Y6I A;  4CO8 A;  3BG7 A;  1ZKG A; 
#chains in the Genus database with same CATH homology
 2VXZ A;  5A2Q K;  1JXS A;  3MFK A;  5LRS A;  1I1S A;  2M30 A;  2XGX A;  2P6T A;  1FYK A;  3HIF A;  2FNA A;  2H27 A;  4P55 A;  2XAQ A;  3RYP A;  1FBS A;  2O03 A;  3CUQ A;  3KLN A;  5CYV A;  4KIG A;  3WG9 A;  3CO7 C;  2PEX A;  3QPT A;  5L3F A;  1ZGA A;  2GXG A;  2OZ6 A;  5DEQ A;  3JAM K;  4OMZ A;  1IRF A;  5LLQ A;  2BV6 A;  2V6C A;  1SFE A;  4RB2 C;  2FML A;  4KYW A;  2ACJ A;  2Q2E A;  2ZFW A;  4AIJ A;  2BE5 F;  4ENK A;  3HSF A;  3KEO A;  2R7D A;  4MQV A;  5KK1 A;  4RB0 A;  3ULQ B;  4BAY A;  3E97 A;  5LHG A;  1FBQ A;  3E6M A;  1PDN C;  5CLS A;  1ODD A;  4AIK A;  4E70 A;  3AAF A;  3HSR A;  5FB2 A;  4YFN F;  1OMI A;  2CWE A;  2PMU A;  1T98 A;  1A04 A;  1U5T C;  4MEY F;  1VTN C;  2Y48 A;  5L3E A;  1K79 A;  3Q5F A;  4RGU A;  4MQ9 F;  3U1D A;  1FPQ A;  2CG4 A;  3KP2 A;  4YG2 F;  3E5Q A;  5D5X B;  4HQM A;  2P8T A;  4KIB A;  1HKQ A;  4RB3 C;  4WX9 A;  2KJB A;  5HVQ C;  2QYO A;  2QQ9 A;  3VEP A;  3E6B A;  2CGP A;  3JTH A;  2EK5 A;  1FC3 A;  3OOP A;  1P92 A;  1DP7 P;  1ZG3 A;  5D5V B;  2IA0 A;  1CGP A;  1FSH A;  5E1Z B;  5E8I A;  2NS0 A;  1R22 A;  2J5O A;  2ZCW A;  4KMU X;  4U0V A;  3PQJ A;  2V79 A;  5D6F A;  2A69 F;  3WOD F;  2DBB A;  2P4W A;  4I02 A;  1QZY A;  3RTR A;  4QLC U;  4KIC A;  4ENM A;  4HW0 A;  1YO5 C;  1MGT A;  1G4D A;  3MWM A;  2ISY A;  3KZZ A;  1F9N A;  2JTV A;  3ECO A;  1SFX A;  3ROU A;  3J80 Z;  1TNT A;  3LA2 A;  1T6S A;  4LG0 A;  5IT9 Z;  1I6X A;  2YU3 A;  1IW7 F;  3T5X A;  1J5Y A;  3B73 A;  4HDU A;  4GYI A;  3V8J A;  4LB6 B;  1XB4 A;  1GVJ A;  5TRD A;  3FM5 A;  4KT5 C;  4CZZ A;  4Q5S F;  2HEO A;  3GFI A;  2LF7 A;  5D5U B;  3BJO A;  2P5L C;  5FGM A;  3QP5 A;  4FX4 A;  2XKP A;  4ASN A;  4JK1 X;  1B9M A;  1ZLJ A;  1R5G A;  2YX7 A;  3WTS C;  2A61 A;  5K5O A;  3KP7 A;  1BI2 A;  1TBX A;  4EM2 A;  3TGN A;  1KYW A;  5JR3 A;  2P6S A;  3V8K A;  2QVO A;  1IUY A;  5BPI A;  1V3F A;  2VBZ A;  3D5L A;  2VON A;  4PCQ A;  2ELH A;  3GW2 A;  4O3M A;  1FP1 D;  2CO5 A;  3I64 A;  4L9V A;  3H3Z A;  5HS8 A;  5LHH A;  3MCZ A;  2OQG A;  3LAP A;  2EV0 A;  3I71 A;  3GFM A;  2PN6 A;  3GZ5 A;  4U7D A;  4FHT A;  1KQ0 A;  5HDN A;  2HQN A;  1STZ A;  2FEZ A;  2L4M A;  2YPR A;  3E5X A;  5FO5 A;  5JFR A;  3I59 A;  1UST A;  4HV6 A;  1IAW A;  4EM1 A;  2ADU A;  2DU9 A;  2MH2 A;  3PFI A;  1OYI A;  3V8L A;  2DQL A;  1FOK A;  3I53 A;  1B4A A;  4IXA A;  5HS9 A;  2HTJ A;  4RAZ A;  3E6D A;  2ZME B;  5HLH A;  1ZLK A;  3RPU A;  3U9G A;  3F72 A;  1O3T A;  5L3C A;  3TQN A;  4P9U A;  2F2E A;  2PI0 A;  4G8X A;  3VB2 A;  3W6J B;  1U5T B;  1R58 A;  1BC7 C;  5F64 A;  2QQA A;  3F21 A;  2IJL A;  3KZY A;  1GHC A;  3KFW X;  1GXQ A;  4G7Z F;  2WC2 A;  4KMF A;  1TW2 A;  3M7G A;  4IHT A;  1X3U A;  1HW1 A;  3BPV A;  1QZZ A;  1BN5 A;  4EMS A;  3F8C A;  3S2W A;  1D8J A;  2FOK A;  4QWQ A;  3WTZ A;  3CO6 C;  4D0P A;  3KP3 A;  1K78 A;  3LQR A;  3NRV A;  4CIC A;  5EEG A;  4IJA A;  2XKO A;  2VBY A;  2PQ8 A;  1L0O C;  4A0Y A;  3BJA A;  1W4M A;  3J81 Z;  1QBJ A;  5L3G A;  1G3S A;  4N0B A;  3GYH X;  4F7Z A;  5E8G A;  1IN5 A;  2XAH A;  3QOP A;  5H6Q A;  5ERI A;  1USS A;  5DV5 A;  4ESF A;  3CTA A;  4L0Z B;  4M73 A;  2UWM A;  1IN4 A;  2TDX A;  3GF2 A;  4BHP A;  3KP4 A;  4A6D A;  1L3L A;  3HSE A;  4UV9 A;  2ZKZ A;  4HLX A;  1YW9 A;  4I0A A;  4LGW A;  4LJZ F;  1FNN A;  2UXN A;  4EJW A;  3P9C A;  1LDD A;  1F4K A;  3P7N A;  3R61 A;  2K02 A;  3BOQ A;  2GIV A;  2QBY A;  2AS5 F;  4BHB A;  2P5V A;  3G3Z A;  3JSO A;  2UZK A;  1BC8 C;  2LKP A;  4I7H A;  2FMY A;  5DDG A;  2M8E A;  2F5C A;  1XCB A;  2JSC A;  2WWY A;  1LQ1 A;  2VN2 A;  2ZO4 A;  4I2O A;  2M5W A;  2ESN A;  3C3W A;  1U3E M;  1DPR A;  3TKY A;  2EFO A;  4HX4 A;  4Y13 A;  4Q47 A;  2YX4 A;  3LST A;  2DO7 A;  3ZMU A;  3MEX A;  3O6B B;  3CLO A;  5K5R A;  2DI3 A;  4LLL A;  3C1D A;  1RUO A;  3HTS B;  1WQ2 A;  3GFL A;  2DTR A;  3LAJ A;  2EB7 A;  1CF7 A;  4S04 A;  4GYG A;  4U7B A;  5BQT A;  3RJP A;  3SZT A;  3ZQ7 A;  2PG4 A;  2MC3 A;  5AIP A;  3RKY A;  5D4S A;  4WK8 F;  2XAG A;  1DUX C;  2CYY A;  4LMY A;  2XAF A;  2ZXJ A;  4ENN A;  5KVR A;  3V7R A;  3WU1 B;  1TQM A;  2MLK A;  1XN7 A;  3VFZ A;  3ZP5 A;  1S6L A;  4HX7 A;  4O5V A;  1IF1 A;  1TNS A;  3HHG A;  2LDU A;  4EJT A;  4I09 A;  5L3D A;  1G6N A;  1PUE E;  2HKO A;  2EV5 A;  3EQL F;  3KLO A;  4U88 A;  1HSJ A;  1R5H A;  3CUQ C;  1BI3 A;  1ZHF A;  4RAY A;  3PQK A;  3ERE D;  1XMK A;  2VC0 A;  4HYE A;  1ZRC A;  1HKT A;  5ILU A;  2V9V A;  4BYY A;  2DFI A;  3H92 A;  3P9I A;  1D5V A;  4KN7 X;  1WI9 A;  3M8F A;  5JI6 A;  2M87 A;  2JPB A;  2O3F A;  3GFJ A;  2L01 A;  2QWW A;  4NB5 A;  1MKM A;  2KIU A;  4GCV A;  2J5P A;  5D6E A;  2OZU A;  2IRF G;  1ZAO A;  1LNW A;  3I58 A;  2RV8 A;  4L9J A;  4OIN F;  4M72 A;  5HLI A;  5FLX Z;  4MTE A;  1TQI A;  1P4X A;  3SXY A;  1MDM B;  4I98 B;  4ETS A;  5ILV A;  4M9X A;  5HOO A;  4OIR F;  2EFN A;  2RQP A;  5HDK A;  1B59 A;  4AD9 A;  2GQQ A;  3DXJ F;  2Y0M A;  2A6H F;  2IA1 A;  1T39 A;  3F22 A;  3B02 A;  3R0A A;  2D45 A;  4PGG A;  4UUV A;  2A6E F;  2K7L A;  3WGG A;  2K4J A;  2KIM A;  2P7C B;  4CGZ A;  1R00 A;  2OQR A;  4OOI A;  2ZJ2 A;  1KU2 A;  4DNC A;  3JW4 A;  1ONV A;  1R7J A;  5BPD A;  2OD5 A;  3QP6 A;  2F5F A;  2OA4 A;  2FBK A;  2LSO A;  1OKR A;  2M1B A;  1KA8 A;  1Y0U A;  1BM9 A;  1IXS B;  2GA2 A;  3MZY A;  2Z99 A;  2MD5 A;  3L09 A;  1Z1D A;  2XV4 S;  4LK0 F;  1TLH B;  1JGS A;  3N97 A;  2GAU A;  4ZZL A;  2JZY A;  2CSO A;  2LNB A;  1TW3 A;  4UVA A;  1YS7 A;  5E1X A;  1BI1 A;  3HRS A;  2QLZ A;  1HW5 A;  4MEX F;  3RKX A;  1U5T A;  4NHJ A;  1SMY F;  3WE3 A;  5CVU A;  1HW2 A;  2Z9O A;  1RI7 A;  2XRO A;  1EH6 A;  1YQA A;  5LRR A;  2RVC A;  5FD5 A;  3FHZ A;  3M1E A;  2VE8 A;  2RNJ A;  2DT5 A;  3BJ6 A;  3F8F A;  5FFX A;  1TTY A;  1UHM A;  3RKW A;  5DCM B;  3J80 K;  1D8K A;  2DPU A;  4KNY A;  5DD8 A;  3K1P A;  3IKV A;  2BGC A;  2KKO A;  4Q4Z F;  1XDU A;  3IL2 A;  4ESJ A;  1UB9 A;  4M9Z A;  1P4A A;  1U6G A;  1JHH A;  3I4P A;  4U0Y A;  2FF4 A;  4EJV A;  1QPM A;  5BMZ A;  4HF1 A;  1ULY A;  2A68 F;  3J7A O;  2OBP A;  2VBX A;  3GLX A;  3LA3 A;  3TO7 A;  2EA2 A;  2HTS A;  3JTG A;  3GWZ A;  1FP2 A;  1FBU A;  1P2F A;  1IXC A;  5TJJ A;  1SMT A;  3ELK A;  1QQI A;  3GEZ A;  3GVA A;  3CDH A;  3BWG A;  1HBX G;  2QZ8 A;  1EH7 A;  3WTV C;  4HOB A;  3CUQ B;  3VOD A;  4HAM A;  1O7F A;  1LVA A;  1K6O A;  2HR3 A;  1FWZ A;  2VC1 A;  1SAX A;  3V7C A;  3GO5 A;  1BI0 A;  1Z05 A;  3HHH A;  1J0R A;  4B8X A;  5J8C A;  5F6F A;  4LLG F;  2P7V B;  4YII A;  3SFZ A;  4LLN A;  1F5T A;  2Z5U A;  2IA2 A;  4UVC A;  3OV8 A;  1ZH5 A;  1E2X A;  3EYI A;  5AIQ A;  3V4G A;  1B1B A;  4KDP A;  2FE3 A;  2KIF A;  3TDU C;  4XSX F;  1LEA A;  1KU9 A;  4GXO A;  5E20 A;  1P4W A;  2FXA A;  1FYL A;  3D0S A;  2NAZ A;  3U2R A;  2HGC A;  1QGP A;  4MHG A;  2F5D A;  3K69 A;  4ZH4 F;  5H6R A;  3NQO A;  4IRG A;  2EA4 A;  1YIO A;  4CXF A;  2R3S A;  2GXB A;  4I0B A;  2HQR A;  4A6E A;  3JSP A;  3SZP A;  1PP7 U;  3W6K B;  3DQV C;  1Z6T A;  2RDP A;  2XIG A;  5LEJ A;  2W84 A;  2DQR A;  1RIO H;  3H3U A;  3ABU A;  5D5W B;  3K0L A;  3QRF F;  5BOX A;  2FQ3 A;  3R6S A;  3RDI A;  3MZH A;  1YLF A;  2FBI A;  1JE8 A;  1H9G A;  3L7W A;  4IHS A;  5J8F A;  5CVV A;  5ILS A;  1MZB A;  1J9I A;  3DPT A;  2QM3 A;  3RIR A;  1V4R A;  1S29 A;  3J81 K;  1F1Z A;  3SHF A;  2EFW A;  3HOS A;  4A5N A;  2AXL A;  2MLG A;  2G7H A;  1AOY A;  1S8N A;  1R23 A;  4UVB A;  1R1V A;  4H0E A;  1J59 A;  1LDK B;  4UNO A;  4HF0 A;  2BBY A;  3O3K A;  3WTU C;  3E6C C;  2ZNY A;  1WSU A;  4LG0 B;  2Q0O A;  2JT1 A;  1T0F A;  3TOA A;  3ZMZ A;  1BBY A;  5HLG A;  2W24 A;  1G3W A;  1H9T A;  3IWF A;  3T8R A;  3L2C A;  1Z7U A;  4G9Y A;  1KU3 A;  2FBH A;  4IPA A;  3IC7 A;  1MJA A;  5AON A;  3I54 A;  5LEK A;  4EGZ A;  1NHA A;  2UXX A;  2XAJ A;  2DW4 A;  4I01 A;  2KRF A;  3F8N A;  2L02 A;  4LFU A;  3KET A;  5H20 A;  2R7F A;  1ZN2 A;  4HDV A;  3LA7 A;  1ON1 A;  1SD6 A;  2H6C A;  5CVJ A;  2RN7 A;  2GZW A;  5ICG A;  2MA3 A;  4XBF A;  1SD5 A;  3QAH A;  1XGO A;  2FA5 A;  1KQ8 A;  5JVT A;  4LD5 A;  2Q8K A;  2FSW A;  1MJB A;  4M71 A;  2W57 A;  2P5K A;  3HYI A;  3I59 B;  1DDN A;  3FZV A;  4HLY A;  3KCC A;  2X4H A;  3DF8 A;  3Q9V A;  1Z9C A;  3NEU A;  2CFX A;  3C7J A;  3BP8 A;  4HZF A;  1BJA A;  2IPQ X;  3DKW A;  4PDK A;  2PFB A;  1J7K A;  2HZT A;  5D8K B;  4EJU A;  1WKM A;  4KIF A;  5CVR A;  4LB5 A;  4WXD A;  1IRG A;  3VOE A;  1KQ9 A;  3WTY C;  3RI4 A;  4G6Q A;  1ZYR F;  2XVC A;  3DEU A;  4HX8 A;  2OU2 A;  4A0Z A;  2PMH A;  1HKS A;  5ICC A;  5K1Y A;  3FX3 A;  1UCR A;  1FSE A;  3DV8 A;  2D1H A;  4YFK F;  4ZYG A;  2YSR A;  1OPC A;  2JPC A;  5HS7 A;  2O8X A;  4XSZ F;  1BIA A;  4A12 A;  1FY7 A;  3IRR A;  3E5U A;  4XLP F;  5DYM A;  4FT8 A;  3O2P E;  4RB1 A;  1O7L A;  4S05 A;  2RC4 A;  4ZYD A;  3IKT A;  5IT3 A;  1K78 B;  3GX4 X;  3KP5 A;  3FXQ A;  1XGM A;  2O61 A;  3TDZ C;  1FX7 A;  4WWC A;  3GZ6 A;  3HRM A;  5LHI A;  1LDJ A;  4OU0 A;  3ML6 A;  2Z3Y A;  3DPL C;  4L0Y B;  1YTY A;  1SD7 A;  2HFH A;  3ZPL A;  1FZP B;  3DFG A;  5FLX K;  3F23 A;  4RGS A;  5A2Q Z;  4BHC A;  4IRH A;  2IVM A;  3RPQ A;  3ZMV A;  2V1U A;  5ICE A;  4ESB A;  2HS5 A;  4XLN F;  3HUG A;  1LB2 A;  3QU3 A;  4WF2 A;  4MNU A;  5LBQ A;  3KE2 A;  2KJC A;  3DP7 A;  4YIF A;  5E18 F;  1XDS A;  1YFH A;  4HA8 A;  2RGV A;  2IT0 A;  1UFM A;  2ESH A;  5EEH A;  3QU6 A;  1XD7 A;  4HF2 A;  1PP8 F;  1YW8 A;  1XGS A;  2HYG D;  4EJO A;  3WU0 A;  4P5O A;  2LF8 A;  4CYD A;  1REP C;  3JAM Z;  2QBY B;  4XRF A;  2E1N A;  2XRN A;  5J6X A;  1T38 A;  1E17 A;  2IP2 A;  3CUO A;  3MAJ A;  4BQA A;  2HKX A;  1W5S A;  4OIP F;  3F6V A;  4R79 A;  2PLY A;  2E7W A;  2HDC A;  2L4A A;  1HQC A;  4L9N A;  3WE2 A;  2H94 A;  3K1M A;  1W7P B;  4L9T A;  1OYW A;  2VT2 A;  4KA4 A;  2OAZ A;  1RUN A;  3M8E A;  4M74 A;  3SQN A;  1JHF A;  4KUM A;  2G7U A;  4OIQ F;  3FMR A;  4BXU A;  2ZME A;  3EYY A;  1O57 A;  2EFQ A;  2VOD A;  1IN6 A;  3T0Y A;  1OR7 A;  1CF7 B;  2GWR A;  2NNN A;  1XSD A;  2EFP A;  4L5I A;  3RYR A;  5D4R A;  2L3D A;  3BDD A;  4G7H F;  1ZG5 A;  2CQK A;  3ECH A;  4DQ2 A;  1RNL A;  4A2U A;  1I27 A;  1ZAR A;  1EH8 A;  3WGI A;  4HQE A;  1H0M A;  2A5Y B;  3WTW C;  3T8T A;  5IT9 K;  3ZMD A;  3HTU A;  4PZJ A;  3L9F A;  3FWE A;  1ON2 A;  2NRA C;  1W5T A;  4LK1 F;  3M9A A;  5FD6 A;  5E1W A;  3KP6 A;  1R1T A;  2EWN A;  3GXO A;  1QO0 D;  2NYX A;  4Z2Y A;  4M9S A;  1XSV A;  2H09 A;  3EDP A;  2XAS A;  2JRT A;  4R1H A;  4N9I A;  3FXU A;  1IN8 A;  4AVP A;  1XMA A;  2STW A;  3LFK A;  3R60 A;  2DLL A;  2V1D A;  1LJ9 A;  4U0W A;  1WWX A;  2COM A;  1ZRD A;  2PBI A;  1WRJ A;  1D3Y A;  4ENJ A;  4UHT A;  1Z91 A;  4IVN A;  1I5Z A;  4Q48 A;  3TO9 A;  4OMY A;  3BZ6 A;  4BH9 A;  5LGU A;  3ABT A;  4ZZD A;  4EV0 A;  3MQ0 A;  1BOA A;  3I5U A;  2ISZ A;  2VOO A;  2O6G E;  2K86 A;  3C18 A;  5HDG A;  3FF5 A;  1T2K A;  4ZYH A;  4GGG A;  1U2W A;  1EV7 A;  3K2Z A;  3G73 A;  1XSX A;  3R0J A;  2M45 A;  4TV7 A;  4UV8 A;  3ZN0 A;  1QNT A;  3F6O A;  4RGR A;  2IW5 A;  3HRT A;  4IF4 A;  1BIB A;  4Y17 A;  3FXR A;  5L3B A;  5CVI A;  3COA C;  2A3S A;  5LGN A;  5CJ9 A;  5K5Q A;  4EQQ A;  1W7P D;  3LWF A;  4JBA A;  2D1V A;  2V1X A;  5ED4 A;  5FFZ A;  2ZBK A;  4NQW A;  5D8L B;  1GXP A;  4L5J A;  3WTX C;  1IN7 A;  3EET A;  1ZGJ A;  1U78 A;  4EGY A;  3I0T A;  1J2X A;  4UXN A;  4CHU A;  3KEQ A;  2VBW A;  2NNY A;  4Y15 A;  2VOP A;  3WGH A;  2RKH A;  1FT9 A;  1O3R A;  1S7A A;  1HST A;  3K1N A;  4ON0 A;  3ZMT A;  3K9T A;  4RGX A;  3FMQ A;  4MTD A;  2E1C A;  2W25 A;  4PGH A;  1J75 A;  4WCG A;  5DUK A;  2DK5 A;  3IRQ A;  5F1R A;  4G7O F;  2HOE A;  4AWX B;  3HOT A;  2D2W A;  1FYM A;  1ZG1 A;  2L54 A;  2CW0 F;  1IXR C;  1ZRE A;  3QPH A;  2HYF A;  1Z6R A;  3ISP A;  1RZ4 A;  1XCV A;  1LEB A;  2STT A;  4GO1 A;  1XGN A;  2BYV E;  4KN4 X;  1B9N A;  2MBF A;  4G6D A;  1DPU A;  3GUD A;  2G9W A;  4M6X A;  4R8H A;  3TO6 A;  3BPX A;  2DK8 A;  2QQB A;  4K2E A;  1Q1H A;  2VT3 A;  1SD4 A;  1TQP A;  1K7A A;  2PJP A;  5E17 F;  1I1G A;  4KFC A;  3IHU A;  1AWC A;  3REO A;  2O0Y A;  3V7S A;  2EV6 A;  2Y75 A;  1S3J A;  3F3X A;  3FM3 A;  3F8M A;  3BY6 A;  1FLI A;  3N4M A;  2DPD A;  2YR2 A;  1YYV A;  1YG2 A;  3EUH A;  1YW7 A;  5DCF A;  1C0W A;  2MH9 A;  4WXH A;  1B6A A;  4YFX F;  2F5E A;  1U8R A;  1MDM A;  1YS6 A;  2HWV A;  2ETH A;  1ZRF A;  4B09 A;  2B0L A;  4EM0 B;  1KYZ A;  1UHW A;  4A0X A;  6PAX A;  1HXD A;  3F8B A;  1R1U A;  2Z33 A;  2E7X A;  1R36 A;  3Q9S A;  2WTE A;  2K4B A;  3L00 A;  5DD4 A;  1SFU A;  4P96 A;  5BS6 A;  3ZMS A;  1S7O A;  2ZNZ A;  5JHU A;  4P9F A;  2W85 A;  4HBL A;  4AIH A;  1W7P A;  3T1B A;  4G94 A;  4M6Y A;  2C6Y A;  2FU4 A;  3HRU A;  5DUI A;  2VE9 A;  3R4K A;  1O3Q A;  4A5M A;  4EVI A;  3WTT C;  3FMS A;  4ZYE A;  1O3S A;  2GA1 A;  4FX0 A;  1KU7 A;  2QEN A;  4RS8 A;  3E3V A;  3BRO A;  4JQF A;  4MGR A;  4IRI A;  1MD0 A;  1OYY A;  3TOB A;  2A07 F;  4N9H A;  2H6B A;  4O6J A;  4OIO F;  4WXC A;  3IWZ A;  2QUF A;  2XUB A;  2FNP A;  2WV0 A;  2BEO A;  2DAO A;  2K27 A;  2FRH A;  4BNC A;  1G3Y A;  2X0L A;  3CJN A;  5DCM A;  1IZ1 A;  1KGS A;  3P9K A;  1G3T A;  3LQQ A;  5LGT A;  1MJ9 A;  2EJR A;  3ZN1 A;  4CDG A;  5ICF A;  4L18 B;  2XHK A;  1P6R A;  4HV5 A;  4CO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...