4HQEA

The crystal structure of qsrr-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
MMEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator QsrR
publication title Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 38
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hqeA00
2OU2A 2Z33A 3D5LA 3VB2A 1K78A 2VC1A 4HZFA 2HYGD 1FWZA 2X4HA 2OA4A 4KT5C 4RB1A 3E6CC 4RAZA 1FBQA 1ZAOA 2PG4A 4PGHA 2FXAA 4LMYA 1JGSA 2G7HA 4FT8A 4LG0A 4F7ZA 4R8HA 1RUOA 1YS7A 2J5OA 2MLGA 5FO5A 2ZMEA 2M8EA 2K4BA 5KK1A 4IRIA 5HS8A 2ESNA 1J2XA 2EFQA 4L5IA 3M9AA 3GFMA 2FE3A 1LEBA 2ZCWA 1D8KA 3GW2A 2W24A 3BY6A 4OU0A 4DQ2A 4Q5SF 2MH2A 3HTUA 2L3DA 4IRHA 1BI1A 3FMSA 3HOSA 3KP4A 4LLLA 2QLZA 2OZ6A 4KMUX 4M9XA 3C3WA 3V4GA 2D2WA 2EV6A 3WTUC 1W7PA 2DTRA 1KU9A 1KQ9A 4EM1A 2E7XA 4L9JA 2HTSA 2FA5A 3HRUA 2ADUA 3ZMDA 1HKTA 2QBYA 1I27A 5E1XA 5L3EA 3P9IA 3M1EA 4EM2A 3KLNA 4LLNA 5E8IA 2CGPA 4G6QA 4EGYA 3FF5A 4GO1A 3AAFA 4DNCA 1P4AA 3W6KB 3SZTA 3ECHA 1P4WA 4I0AA 3CUQA 2HWVA 3TQNA 1HW1A 1TW3A 2QM3A 1LVAA 4BHBA 3VODA 1REPC 1X3UA 4RB2C 3BJ6A 2XAHA 2XHKA 1J0RA 4ESJA 2VC0A 3ML6A 2EK5A 3L00A 1KYWA 2Z99A 2DQRA 3P7NA 1MD0A 5LEKA 1DPUA 2DQLA 5FD5A 1G6NA 2K02A 4ENMA 5LHIA 1MJBA 1ODDA 4N0BA 3TDUC 1HW2A 3DEUA 4IHSA 2DLLA 1UB9A 5LHHA 4OMYA 4GCVA 4RAYA 3ZMTA 2E1NA 2LF8A 1G3TA 1K6OA 2WTEA 5JI6A 4G6DA 1W7PD 5E17F 4A5MA 1HQCA 1K7AA 3IC7A 2A69F 4HA8A 5CVVA 2GQQA 2H6CA 1IF1A 2FRHA 4D0PA 3C1DA 2DAOA 1UHWA 2O03A 2EFOA 1JHFA 2XRNA 3GF2A 5E1WA 4LFUA 1B6AA 5CVRA 3J80Z 3BJAA 5D8KB 3REOA 1BN5A 4XSZF 4K2EA 1DUXC 3I58A 3GFLA 2QQAA 1V3FA 4HX7A 3K1MA 4I7HA 1MZBA 3F6OA 4KFCA 4EMSA 1XD7A 1SMYF 5DCMA 2V1DA 5CVUA 2KJCA 4A6EA 3TOAA 2VBZA 3CO7C 1O57A 5DV5A 3CDHA 2HQRA 3GVAA 2HEOA 2EFWA 5BOXA 1K78B 1FLIA 2VE8A 3H3UA 5D6FA 1IUYA 3COAC 2RV8A 3W6JB 4PGGA 2P6SA 1ZREA 4UVBA 2KIUA 2P4WA 3HIFA 1OYWA 4UVCA 2RN7A 1MKMA 3F3XA 2MC3A 2Q0OA 4KIFA 4LG0B 5E20A 2GXBA 2OZUA 3E5XA 2ZMEB 2LSOA 2XASA 3R4KA 1B4AA 5HLIA 3KE2A 2XVCA 1XSXA 2CFXA 5TJJA 3GEZA 4MQVA 4EJUA 2PLYA 2V9VA 1H9TA 4MGRA 3PQKA 2FBHA 5BQTA 3WTXC 3HSRA 1Z91A 2GIVA 4GYIA 5K5QA 5DUIA 2FBKA 3LA7A 2M5WA 4ZZDA 4M9SA 4KIBA 2E1CA 1BI2A 1W7PB 3MQ0A 4MQ9F 3RJPA 3FMRA 1GXPA 4LLGF 4IPAA 3ULQB 5DYMA 2L54A 1BIBA 3WE2A 4OIQF 2QBYB 3KP2A 2NAZA 4AD9A 3BPXA 3E5QA 5L3FA 1KYZA 5K1YA 3QP6A 4CZZA 1LJ9A 3K1PA 1NHAA 4WXCA 1J9IA 1TQPA 2QQ9A 1XCBA 1H0MA 2Z3YA 3MEXA 1TQIA 2FOKA 3WU1B 2W57A 3B73A 1WSUA 4P55A 3CUQB 3WODF 2XAJA 1OKRA 3PQJA 3RKXA 5D5WB 1Y0UA 2YX7A 2K27A 2IVMA 3LSTA 3U9GA 4Q4ZF 1J59A 4U0VA 3DXJF 2JTVA 1BI3A 1G3WA 4UV9A 1LEAA 3D0SA 4Q47A 3DPLC 1ZARA 1R7JA 1S3JA 4M74A 1MJ9A 4ZYEA 2VOPA 4BH9A 2CW0F 3OV8A 4E70A 4RGSA 3MZYA 1JE8A 1WI9A 5LGNA 2HS5A 3TDZC 1K79A 2EFPA 4O6JA 2EA4A 3ISPA 5A2QZ 2QYOA 5D4SA 4U88A 2PMHA 4Q48A 5HS9A 3MAJA 2YU3A 3NRVA 3GX4X 1O7FA 3M7GA 3RIRA 4IHTA 4NB5A 1YQAA 3C7JA 4KN7X 1DDNA 3TKYA 5IT9K 3ELKA 3JTHA 2R7FA 1XMKA 5F64A 3SXYA 3K0LA 3RTRA 5FFXA 5AIPA 5BS6A 3G3ZA 1KU3A 4HX4A 2A61A 5HS7A 1U3EM 3GLXA 4CXFA 1S6LA 4MTDA 4IF4A 3EQLF 3VOEA 5JHUA 4A0ZA 4M6XA 5DCMB 4A2UA 2FNPA 5JVTA 2GA1A 4KA4A 1XCVA 4OOIA 2FQ3A 4KUMA 4EV0A 1LB2A 1YIOA 4HV5A 4S05A 2HDCA 5ILVA 1R5HA 3Q5FA 2XV4S 1TBXA 4M9ZA 3TO9A 2IRFG 2M1BA 4ENJA 4NHJA 4RS8A 2G7UA 3RPQA 3CJNA 3RI4A 3I64A 1F1ZA 1BM9A 2NNYA 2P8TA 3T5XA 2F5EA 3FHZA 3N4MA 1SD6A 4R1HA 3NQOA 2YX4A 2FMLA 2QUFA 1S29A 4BAYA 3GUDA 1TTYA 1YW8A 3QU6A 4U7BA 3E5UA 1RNLA 4LK0F 5LBQA 3TO7A 3PFIA 1ZG5A 3IHUA 4I09A 1XGOA 3I0TA 3DV8A 2XKPA 4CYDA 1RI7A 2HTJA 5CVJA 2VODA 3HHGA 4MEYF 3DPTA 2L4MA 4UXNA 1ON1A 4G9YA 3RKYA 1F4KA 2QVOA 1FPQA 4G8XA 4LB5A 5DD8A 2IA0A 2P7CB 5L3BA 2M87A 3T1BA 5E8GA 3JAMK 2YSRA 1RZ4A 2RVCA 2OQGA 3E6BA 3L7WA 4JQFA 2NNNA 3BZ6A 4NQWA 3ZN1A 2A6HF 3F72A 2ZNYA 4WWCA 1FSEA 5LEJA 5LRRA 3H92A 2BEOA 3RPUA 1IW7F 2Y48A 3LAPA 4B8XA 1J7KA 1EH6A 2DFIA 3V8KA 4PCQA 1UFMA 3V7SA 1T0FA 4L18B 1Z7UA 1FBUA 2COMA 2P6TA 2RGVA 3EYYA 3GZ5A 3F23A 5F1RA 1KGSA 1STZA 2KIMA 3QP5A 2NRAC 1LNWA 4QLCU 5HDKA 2KIFA 2L01A 2R3SA 1IZ1A 1O3TA 4CGZA 4EM0B 3BOQA 4ESBA 2HZTA 4LK1F 2CSOA 3F8MA 3F8FA 3K69A 4FX4A 3LA3A 1TLHB 2L4AA 3J81K 2GWRA 3I59A 5ERIA 1FYMA 4YIIA 4RGUA 2K86A 2PMUA 2DU9A 1OMIA 4M73A 2B0LA 3ROUA 4RB3C 4A12A 1QQIA 1BJAA 1GVJA 1R1VA 4A6DA 2CYYA 4WF2A 3IWFA 4I02A 1WRJA 3MFKA 4YFXF 2JPBA 2K4JA 4KN4X 2ZO4A 2A5YB 4HOBA 5DDGA 4MNUA 1ZYRF 3R6SA 1FSHA 2W85A 5IT3A 3WTVC 2ISYA 3SZPA 2RNJA 4LD5A 1QBJA 5JFRA 1JXSA 3JW4A 2C6YA 4N9HA 2IT0A 1FP2A 5HOOA 4GYGA 4A5NA 3FXRA 3WTTC 4IVNA 2D1HA 3ABTA 3G73A 1IXCA 3LQQA 4JBAA 4BXUA 1T98A 4HDVA 2JZYA 2FNAA 2DBBA 4QWQA 2MA3A 3SHFA 4BHCA 3FWEA 1P2FA 3JSPA 4O5VA 1TNTA 1D8JA 4ENKA 4Z2YA 4P5OA 5LGTA 4HF2A 1YW9A 2VT2A 2QWWA 2D45A 4CICA 4EJWA 2RQPA 2XKOA 2PEXA 3S2WA 1USSA 4HAMA 1KA8A 2EV5A 3KP6A 3IRQA 2Z9OA 3KEOA 4L0ZB 1BC7C 3DQVC 2DPUA 3LWFA 1O7LA 3R61A 2PI0A 1GHCA 3F6VA 3QOPA 4EJVA 3WG9A 4YIFA 2KKOA 4ZYGA 5FGMA 5D5VB 2PFBA 3QPHA 1IRGA 5D6EA 1R23A 5E1ZB 1FT9A 4XSXF 4IJAA 2ZNZA 2A6EF 2JT1A 1ZRFA 1ONVA 3E6MA 4RGXA 3Q9VA 3TO6A 3T8TA 3BP8A 4YFNF 2JSCA 2WC2A 1YG2A 4HX8A 1BBYA 3L9FA 2ETHA 1J5YA 3DFGA 1XGSA 3HYIA 2DPDA 3FX3A 3WE3A 3GFIA 4L9TA 3OOPA 2EA2A 1SAXA 3DP7A 2HQNA 3MWMA 1F5TA 3CLOA 1QO0D 3KLOA 4Y15A 1SD7A 1U2WA 5HLHA 2VXZA 2Y75A 4FX0A 3Q9SA 4OMZA 2UZKA 3WTSC 2JRTA 1ZN2A 4R79A 2HYFA 1B9NA 3NEUA 5K5RA 4OINF 5J8FA 3F21A 2ZBKA 2OQRA 1SFUA 4XBFA 2XGXA 1KQ0A 3K2ZA 3ZMSA 1FY7A 2O8XA 1A04A 2VE9A 3IRRA 3E6DA 4MEXF 1U5TC 4OIRF 1USTA 2AXLA 2LDUA 2VBYA 5ICEA 1PDNC 3O6BB 2HR3A 3I59B 3P9KA 5AONA 1SD4A 4WXDA 5J8CA 4L5JA 2UWMA 4G7OF 1LQ1A 3EUHA 3I53A 1R36A 3ZN0A 1EH8A 1ZG3A 5FFZA 2V79A 1WKMA 1W4MA 3V8LA 2VBWA 2RC4A 1SMTA 3T8RA 4EJTA 1CF7B 1XSVA 5CLSA 5K5OA 1P92A 1IAWA 3HUGA 2PJPA 5L3GA 4GXOA 1ON2A 4BQAA 2FF4A 4HQMA 3EDPA 4AIKA 2YPRA 3KP5A 2K7LA 4WK8F 2OD5A 1G3SA 4HLYA 1ZH5A 2H94A 5ICGA 3ZQ7A 4OIOF 1ULYA 1SFXA 5FLXK 5FB2A 3SFZA 4CO8A 2QZ8A 1XGNA 1U5TB 1XDUA 1QZYA 3KETA 4CDGA 4U0WA 3HOTA 3KP7A 2WWYA 1DP7P 1YTYA 2XIGA 5H20A 3HRSA 2HOEA 3DKWA 3ZMUA 1HSJA 3GXOA 4H0EA 4MTEA 1PUEE 2W84A 2QQBA 2Q8KA 2HKXA 4L0YB 2FMYA 5DD4A 4P9FA 1Z1DA 5DCFA 1YO5C 3QRFF 4ZYHA 5IT9Z 5D8LB 1T6SA 2MBFA 1BC8C 3LQRA 1Z9CA 1H9GA 1Z6RA 3WTZA 1L3LA 1FX7A 2XAFA 2Y0MA 3JSOA 1WWXA 2LKPA 2MD5A 1V4RA 3CTAA 1PP8F 1G3YA 5DEQA 2STWA 2NS0A 4RB0A 2CWEA 2O6GE 1ZRCA 2A07F 2O61A 4N9IA 3L2CA 1W5TA 2PQ8A 3FMQA 3C18A 5BMZA 3ZMVA 5J6XA 3P9CA 3RKWA 3ERED 1HKQA 1IN7A 4HF1A 1SFEA 3KEQA 1LDKB 1RUNA 4IRGA 5D5XB 2UXNA 2F2EA 2XAQA 2WV0A 1R1UA 1BIAA 1B1BA 1R00A 3ZP5A 1KQ8A 2HGCA 5D4RA 1R5GA 1YYVA 4EVIA 4A0YA 4HQEA 4ZH4F 1HBXG 4FHTA 2BE5F 4HDUA 2A68F 3M8FA 5HLGA 1KU2A 4EQQA 4LB6B 2V6CA 5EEGA 4M72A 3F8NA 3LAJA 1DPRA 4G94A 1BI0A 2UXXA 3V7RA 2E7WA 4P96A 2H09A 1O3RA 3F8BA 3BJOA 3TOBA 2ACJA 2BYVE 1MDMA 1ZGJA 5ICFA 4ZZLA 2DO7A 5LGUA 3B02A 2JPCA 1YLFA 1TW2A 3RYRA 3H3ZA 2BV6A 3BPVA 5BPDA 4ASNA 3JAMZ 2GZWA 1IN8A 1AWCA 2V1XA 1I6XA 1XSDA 2VOOA 2Z5UA 3HSFA 3O3KA 1D3YA 4PZJA 3ZPLA 5HDGA 5E18F 1O3QA 1QGPA 2IW5A 5HVQC 3DF8A 5L3DA 3KP3A 1OPCA 2IA2A 3BWGA 1BOAA 3MCZA 4WXHA 2F5CA 4ESFA 2D1VA 2VBXA 2IA1A 3VEPA 1Z05A 4UV8A 1ZG1A 2OAZA 3FM3A 1U78A 4XLNF 1I1SA 4OIPF 3E3VA 1CF7A 5HDNA 3ZMZA 3WGHA 5CVIA 3GZ6A 1UHMA 1XMAA 2IPQX 4ETSA 3V8JA 1Q1HA 2BGCA 2VT3A 3J81Z 5KVRA 1E2XA 4HBLA 1T2KA 1HKSA 2GA2A 5F6FA 3ABUA 4L9NA 1ZRDA 3BDDA 3LA2A 1MGTA 3J80K 2CO5A 1CGPA 2A3SA 1ZGAA 2LF7A 3QAHA 5ICCA 3WTYC 1R58A 2P5LC 4M6YA 2GAUA 1TQMA 1U5TA 3GYHX 2P5KA 3HSEA 2PN6A 1IRFA 2PBIA 3FXUA 2ZJ2A 1YS6A 5BPIA 5H6QA 4KNYA 4LJZF 2KRFA 3RYPA 3V7CA 4RGRA 4KDPA 4S04A 4MHGA 4WCGA 2F5FA 1FC3A 2ZKZA 4KYWA 5H6RA 2KJBA 1QZZA 1OYIA 1HSTA 4LGWA 1S8NA 3FXQA 3KZYA 1AOYA 5CJ9A 1ZLJA 3T0YA 1ZHFA 3QU3A 2DK5A 2HFHA 3M8EA 2W25A 2AS5F 4I0BA 2XROA 4G7HF 4UUVA 1FZPB 4KIGA 1OR7A 1S7AA 2J5PA 2YR2A 1FBSA 3HRMA 2BBYA 4KMFA 2CQKA 2NYXA 2QENA 4Y13A 5LLQA 4U7DA 3K1NA 1I5ZA 3R0JA 5ED4A 4XRFA 2EWNA 2LNBA 3KZZA 3R60A 1QNTA 1U8RA 3I5UA 3GO5A 5DUKA 1FYKA 1FNNA 1B9MA 4B09A 1W5SA 2R7DA 1IN5A 1R1TA 4HF0A 1HW5A 3IWZA 3WGGA 1EV7A 3IKVA 5LHGA 4HV6A 4BYYA 4PDKA 2CG4A 2G9WA 3GFJA 1XGMA 3CUQC 2MLKA 1XN7A 5AIQA 4WX9A 3EYIA 2DK8A 2M45A 3QPTA 4G7ZF 4UHTA 1D5VA 3HHHA 3WGIA 1PP7U 4AVPA 3R0AA 3WTWC 3HRTA 4I98B 1C0WA 3FM5A 4I01A 1MDMB 2P7VB 1YFHA 5ILUA 2FBIA 4BNCA 1KU7A 3K9TA 5CYVA 2EV0A 1L0OC 4UVAA 2O3FA 3J7AO 2FEZA 2VN2A 1ZLKA 3L09A 1OYYA 2TDXA 3SQNA 4JK1X 1FYLA 3KCCA 4YFKF 1J75A 3N97A 2FSWA 4AIJA 2IP2A 2M30A 3I54A 2HKOA 1TNSA 2EJRA 4U0YA 1XDSA 2DT5A 4CHUA 2RKHA 3IKTA 4TV7A 2VONA 3HTSB 1GXQA 2X0LA 1EH7A 1S7OA 3RDIA 3WU0A 1G4DA 6PAXA 4ON0A 3GWZA 1XB4A 4HYEA 2H6BA 1IN6A 4O3MA 5L3CA 3CUOA 3O2PE 4HLXA 2DI3A 1R22A 2RDPA 3U2RA 3U1DA 1JHHA 5A2QK 1LDJA 5JR3A 2Q2EA 4ZYDA 2FU4A 3KFWX 4L9VA 3IL2A 3F8CA 2ELHA 3VFZA 3I4PA 3MZHA 1IXRC 1I1GA 1T38A 2MH9A 4KICA 2EFNA 5EEHA 2ZFWA 2IJLA 4IXAA 4EGZA 2GXGA 1P6RA 3F22A 1O3SA 4GGGA 1T39A 4Y17A 2STTA 4I2OA 2F5DA 1QPMA 3E97A 1RIOH 4AIHA 1FOKA 5ILSA 3CO6C 2P5VA 2ZXJA 4EJOA 4A0XA 4XLPF 2ISZA 3BROA 2DW4A 3EETA 4HW0A 1UCRA 5TRDA 4UNOA 3JTGA 1B59A 2L02A 4AWXB 3LFKA 2ESHA 5D5UB 1IXSB 3FZVA 5FLXZ 4M71A 3TGNA 1VTNC 1F9NA 5FD6A 1SD5A 2V1UA 1Z6TA 2OBPA 3I71A 1E17A 1P4XA 2XUBA 1MJAA 1IN4A 4P9UA 4YG2F 1HXDA 1YW7A 2EB7A 2XAGA 5LRSA 4ENNA 1WQ2A 4BHPA 3ECOA 2H27A 1U6GA 2O0YA 1FP1D 1LDDA
chains in the Genus database with same CATH superfamily
2LBFB 2OU2A 2IGKA 4ABZA 1FIAA 4P1WA 2Z33A 4AC0A 3D5LA 3PO2J 3VB2A 1K78A 4V2FA 2VC1A 3OR2C 4HZFA 4F93B 2HYGD 1FWZA 2X4HA 3HJEA 2OA4A 4KT5C 3P5JA 1P7IA 4RB1A 3E6CC 4RAZA 1FBQA 3GTJJ 4CCMA 3IAS2 1ZAOA 2PG4A 1X3ZB 2IGOA 4PGHA 2FXAA 2XDVA 4LMYA 1JGSA 2G7HA 4FT8A 3HDDA 4YRVA 1UHSA 1JT6A 2X1CA 2QCOA 1X1AA 2NS7A 4LG0A 4F7ZA 1YJWI 1UAAA 4R8HA 1RUOA 1YS7A 2J5OA 2MLGA 5FO5A 2L7FP 2GIZA 2ZMEA 2M8EA 1JTXA 2K4BA 2Z16A 5KK1A 2LRDA 3BT9A 4IRIA 5HS8A 4D9JA 1BR4A 2ESNA 1ZGWA 1J2XA 2EFQA 4L5IA 3HC7A 3M9AA 2OPTA 3GFMA 4LOCA 2FE3A 4E7IA 4IO9F 1LEBA 2QKLB 2ZCWA 1D8KA 4BJ5C 3GW2A 3NWSA 4QIWN 4AYBA 3SJMA 2TCTA 2W24A 2F6CA 1BJZA 3BY6A 4OU0A 1ZK8A 2M4KA 4DQ2A 4Q5SF 1D1CA 2MH2A 3HTUA 2L3DA 1GVDA 4IRHA 1H8AC 2MYSA 3ZR8X 1BI1A 1HOMA 1RRJA 3UNGC 2V9KA 3FMSA 3HOSA 3KP4A 5C4XJ 4LLLA 2DMNA 3QWLA 2IS1A 2QLZA 2W7NA 4XMYA 3G6EI 1JJ6C 1MMNA 2OZ6A 3HZJA 5F1JA 2DA4A 4KMUX 1OCOH 3C3WA 4M9XA 3V4GA 1JKRC 2D2WA 2EV6A 3WTUC 1W7PA 4I76A 2DTRA 1KU9A 2M4GA 2CS3A 4NDLA 3RSNA 3NAUA 1KQ9A 4HRIA 4EM1A 1I39A 1GLNA 4RBOA 3N05A 1D5YA 4XOPA 2VXDA 2E7XA 3QPSA 2HTSA 4L9JA 3RQIA 2FA5A 2QA4I 3HRUA 5EYRA 2ADUA 3ONQA 3ZMDA 2O9LA 1HKTA 1UELB 1VQLI 2QBYA 2KIQA 1I27A 1ORKA 5E1XA 1MNMC 5L3EA 4M3EA 5EDNA 2CV1A 1RKTA 3P9IA 1RC9A 4HNTA 4KISA 1HCRA 3M1EA 2VL8A 2XSJC 3DWLE 4EM2A 3SDBA 3KLNA 3IV5A 4LLNA 5E8IA 2CGPA 5GPAA 4BDYA 1I50J 2DA1A 3LSHA 4G6QA 1U9NA 4EGYA 1SAUA 3BR5A 1SEUA 3FF5A 3AL0C 1ETOA 3ABKH 2JQ7A 4GO1A 2JWTA 5JLXA 3AAFA 4DNCA 1VQ9I 1P4AA 3W6KB 4DOZA 3FXJA 3SZTA 2MC4A 1T33A 2F4MB 3ECHA 3FK7A 1TC3C 2BY1A 3DKXA 4KT6A 3G1LA 1P4WA 3X2QH 3L2VA 3H5RA 4I0AA 1R9TJ 2XSDC 3CUQA 2HWVA 4EATA 4A69C 3TQNA 1HW1A 1TW3A 2QM3A 3S8PA 1LVAA 4B1RA 3J7AY 4BHBA 3VODA 2HVQA 1MH4A 1REPC 2KDZA 1X3UA 2Q2EB 1NK2P 4RB2C 3BJ6A 3OY9A 2XAHA 2ECBA 2XHKA 1J0RA 4ESJA 2VC0A 2CW8A 5IP9J 3S3MA 3ML6A 1SANA 3KYDB 2W48A 2EK5A 3L00A 2WAFA 4ZC3A 1KYWA 4IX7A 2Z99A 1BOBA 3CDLA 2DQRA 3E7LA 1U0JA 3P7NA 1MD0A 5LEKA 2MD0A 3S14J 1DPUA 2DQLA 4M3BA 1X1DA 1QRYA 5FD5A 4F92B 1G6NA 2K02A 4ENMA 5LHIA 4RAFA 3ZRGA 1MJBA 1ODDA 4BXXJ 4N0BA 3TDUC 1HW2A 3GTOJ 1MBJA 3DEUA 3K4NA 2DLLA 4IHSA 1E0EA 1UB9A 3LSJA 3PUBA 4B48A 5LHHA 4OMYA 4GCVA 4RAYA 3ZMTA 1YJNI 4H4KC 2E1NA 2ZJRF 1Z3YA 2LF8A 1G3TA 1K6OA 2WTEA 5JI6A 3BCBA 2BW3A 1XTAA 4G6DA 1W7PD 5E17F 4A5MA 1HQCA 1K7AA 5IOYA 2E2HJ 3AL0B 1B72B 4CYCB 3DBLB 3IC7A 2A69F 3HKZA 4HA8A 5CVVA 1WI3A 2DA5A 1A6IA 2GQQA 2LC2A 2K3FA 2E19A 2NVYJ 2H6CA 3J7ZI 3I9V2 4BEHB 1IF1A 2FRHA 1GV2A 4D0PA 3C1DA 2XF5A 1FOWA 1WH7A 2DAOA 2CFOA 1UHWA 2O03A 3HL2A 2EFOA 1JHFA 2XRNA 3G71I 3MZ8A 3GF2A 5LD2C 3G1OA 2B63J 2EIKH 4B3XA 2ZMEC 5E1WA 2X9DA 1VZ0A 5K7ZA 4IQ4A 4LFUA 2M2EA 4RA2A 1B6AA 1BW6A 2H1LA 5CVRA 5FRMA 3J80Z 5F0HA 3BJAA 5D8KB 1UJ8A 3REOA 1BN5A 1TWHJ 4XLAA 4XSZF 4AVZA 4K2EA 1JKPC 5IYCJ 1DUXC 3I58A 1Y0NA 3GFLA 2KPMA 2QQAA 2FX0A 2RAEA 3DBRB 1V3FA 5J1RA 4HX7A 3QPLA 2XB5A 3K1MA 4I7HA 4XORA 1MZBA 3F6OA 2ZSHB 4A3MJ 2KRHA 4KFCA 4EMSA 1BW5A 4M3DA 3H9GA 1XD7A 1ZELA 2DFEA 1SMYF 4QPQA 5DCMA 2V1DA 3GCMA 5CVUA 1MIJA 2KJCA 4L5EA 4A6EA 3TOAA 3L2RA 2VBZA 2DOAA 2A5WA 2GOXB 1Z0XA 3CO7C 1O57A 1Y56A 5DV5A 5HLTA 2IBDA 4UUSB 3BQZA 3CDHA 4PFPA 3M07A 2HQRA 3GVAA 2Y31A 3LSKA 2DA6A 3JRBA 2HEOA 3LMMA 2EFWA 3FBNB 5BOXA 1K78B 2CV0A 1FLIA 2VE8A 3H3UA 3CC4I 5FKLA 5D6FA 3OYFA 1IUYA 3COAC 4II3A 1PJRA 2RV8A 4E7SA 1IJWC 3W6JB 4Y3OA 2KMUA 3VYTB 4PGGA 2P6SA 3CLQA 4UVBA 1ZREA 2KIUA 4RDUA 2TRTA 2P4WA 3HIFA 1OYWA 1XC5A 2JA2A 2M34A 4W1UA 2CW7A 2PMZN 4UVCA 2RN7A 1MKMA 3F3XA 1D0YA 1TP4A 1IDZA 1N25A 2HNHA 2MC3A 2Q0OA 4KIFA 5DM7F 4LG0B 4J01A 5E20A 5FLVA 2GXBA 2OZUA 3E5XA 3JR9A 2ZMEB 1RETA 3U1KA 2LSOA 3SEZA 2YU9J 2HYJA 2JUCA 2M3AA 2XASA 3R4KA 1B4AA 5HLIA 3A01A 5FKNA 3KE2A 3OWTA 3ZCOA 1W0TA 5IOZA 2XVCA 1XSXA 2CFXA 3F9KA 1WJDA 3O8HA 5TJJA 3GEZA 1MMGA 1Z77A 1K61A 1POGA 3D1NI 4MQVA 4EJUA 2PLYA 4DZPA 5IP7J 4DBRA 3I4NJ 5DTDA 2V9VA 2I8DA 1H9TA 3LSRA 4RM2A 4MGRA 1V54H 2QEXI 3PQKA 2MW8A 2FBHA 5F04A 5BQTA 1BL0A 3WTXC 1CQTA 3HSRA 5J4YA 2R92J 3DCFA 5B66C 1Z91A 2GIVA 2IS4A 4GYIA 5K5QA 3LSGA 3M4OJ 1VQ8I 5DUIA 3ABMH 1VI0A 2FBKA 3LA7A 3OYEA 1QVUA 2M5WA 4ZDLA 1Z3XA 1TWFJ 4ZZDA 4M9SA 4KIBA 2E1CA 1BI2A 1W7PB 2HQ5A 3MQ0A 4MQ9F 2Y0SA 5GAGJ 4XRMA 2HOSA 3S32A 3RJPA 3FMRA 1FMVA 1GXPA 4LLGF 4IPAA 3BG9A 1MBGA 3ULQB 5DYMA 4BUPA 2L54A 2XGDA 1BIBA 3WE2A 3CCYA 4OIQF 1D1AA 5TGTA 2QBYB 3KP2A 3J7YJ 2AO9A 2EZLA 5K7HA 1OQYA 2NAZA 3PSIA 4AD9A 1JT0A 3BPXA 3E5QA 2IEKA 5L3FA 4IOAF 1KYZA 1TT0A 2VQLA 1LFBA 5K1YA 3QP6A 4CZZA 3A0HC 2BVMA 1LJ9A 4ZDOA 4FTHA 3K1PA 1NHAA 4WXCA 1VNDA 1J9IA 4ZTFA 3OIOA 1TQPA 2QQ9A 1LKXA 3QQAA 1X2NA 1XCBA 1H0MA 3VYRB 2XPVA 2Z3YA 1FJLA 3MEXA 2V6EA 5KNLA 3H5AA 4AYBN 4A3GJ 1TQIA 3K6GA 2FOKA 2VQGA 4F55A 1MNDA 3WU1B 2KHMA 2W57A 3B73A 1WSUA 1VQNI 4OAYA 3CCJI 4P55A 3L2WA 3FXKA 4XLHA 1ACIA 3CUQB 3WODF 4F52A 1Y6IA 2KDOA 2XAJA 1OKRA 3PQJA 3RKXA 5D5WB 1Y0UA 2VKVA 3DU5A 2YX7A 5EZHA 3QYBA 2K27A 1G2HA 3K4MA 2IVMA 3LSTA 3U9GA 4XIDA 4Q4ZF 1J59A 2D5VA 4U0VA 3DXJF 2JTVA 1BI3A 5LFAA 1G3WA 4UV9A 3TP3A 2JVGA 1LEAA 4D7MA 4C2UA 3D0SA 4Q47A 3DU6A 5EGOA 4RLFA 3RKQA 2BHZA 2K40A 3DPLC 1ZARA 3LSMA 1R7JA 2WY8Q 1S3JA 4M74A 2NS8A 1X4OA 1MJ9A 4ZYEA 2JN6A 2VOPA 4BH9A 2JK3A 1QPIA 2CW0F 3OV8A 3ZQQA 4RGSA 4E70A 3MZYA 4CCOA 1JE8A 1Z21A 2IXSA 1WI9A 4DW6A 2R5ZB 5LGNA 2HS5A 3TDZC 2LD5A 1K79A 2EFPA 1VQ5I 2DTZA 4LIVA 4O6JA 2EA4A 3ISPA 3JRDA 5A2QZ 3CCEI 1Y8QB 3OS1A 2BW3B 2QYOA 4I6ZA 4XONA 5JVGF 2JA7J 5K7FA 5D4SA 1SVOA 2ZXWH 3B6CA 4U88A 2PMHA 2OJED 4Q48A 4RMNA 5HS9A 3MAJA 2YU3A 3NRVA 3GX4X 1O7FA 3M7GA 4CYCA 3HPHA 2KZGA 3CCMI 2EH3A 3RIRA 4IHTA 4NB5A 1YQAA 2COBA 4A3DJ 3HGYA 3CD6I 1ZKGA 4M3FA 3C7JA 4KN7X 1DDNA 3TKYA 1ERDA 2WAQA 5IT9K 1RPWA 3LFUA 1FTZA 2F4OB 3ELKA 3JTHA 3AG3H 2R7FA 1XMKA 2PMZA 5F64A 3SXYA 3K0LA 3RTRA 5FFXA 3EUAA 1NTCA 1T95A 5AIPA 3G3ZA 5BS6A 3CCRI 1KU3A 4HX4A 2A61A 3UKGA 3H35A 3CCSI 5HS7A 1EF4A 1U3EM 3GLXA 1X1CA 2ELKA 3ERMA 4LG3A 3GMEA 1S6LA 4CXFA 4MTDA 2L9VA 4IF4A 3EQLF 3VOEA 3CCVI 3W2VA 5JHUA 4A0ZA 1F36A 4M6XA 3OYAA 5DCMB 4A2UA 1R5ID 2FNPA 5JVTA 2MG4A 1MSFC 4NC6A 2GA1A 2Y9YA 1XCVA 4OOIA 4KA4A 3ZQFA 2FQ3A 4KUMA 2R7QA 3HXLA 3WHCA 4A3JJ 1QHHD 4EV0A 3W6VA 1LB2A 1YIOA 4HV5A 4S05A 4C3IJ 5BNGA 2HDCA 1OJLA 1HC8A 5ILVA 1R5HA 3Q5FA 2BHYA 1KONA 5F27A 2XV4S 1TBXA 2LY9A 3HKZN 2KL4A 4M9ZA 2XC7A 3PNVA 3H0GJ 1MMDA 3FXOA 4XN3A 2X51A 3FKJA 3C2HA 1XMXA 2FQ4A 1ZR4A 3Q0VA 3TO9A 3CCUI 4PK4A 4CA0A 1VFCA 3KX2A 2IRFG 2M1BA 3VDXA 2R0QC 3DTIA 5HNFA 4ENJA 4NHJA 2L9SA 4RS8A 2G7UA 3RPQA 3CJNA 4Y4RA 1ETWA 3RI4A 3I64A 1F1ZA 1BM9A 4FE4A 5C3EJ 1NH3A 5J1YA 2NNYA 4BQQA 2P8TA 3T5XA 2F5EA 3FHZA 5TISC 3A01B 3N4MA 4UY8I 1SD6A 2YUSA 3SFIA 4R1HA 2CU7A 3NQOA 2YX4A 2FMLA 2QUFA 1S29A 3HOWJ 4BAYA 4BY7J 3GUDA 1TTYA 1YW8A 2M0CA 3HOXJ 1JI8A 3QU6A 4U7BA 2LOOA 2NVTJ 3E5UA 1RNLA 2E71A 4LK0F 5LBQA 2K5CA 3TO7A 3OYGA 3PFIA 3FHNA 1ZG5A 3IHUA 2MFZA 4I09A 1XGOA 1IV6A 3I0TA 3DV8A 1FOYA 2XKPA 4CYDA 2HVRA 1RI7A 2HTJA 5M3MJ 5CVJA 2VODA 2HVSA 3HHGA 2IAIA 4MEYF 3JRCA 1WJEA 3DPTA 3HPGA 2L4MA 1A31A 4UXNA 1ON1A 4G9YA 2ZC2A 3FXLA 3RKYA 1F4KA 2QVOA 1FPQA 3K70C 5FLMJ 4G8XA 4B44A 4LB5A 5DD8A 2ZXHA 2IA0A 1YOVB 4XK4A 2P7CB 2L7KA 5L3BA 2M87A 3T1BA 4A3BJ 2ZXIA 2LTPA 5E8GA 3JAMK 1AKHB 2YSRA 1RZ4A 2RVCA 1UG0A 2DMQA 2OQGA 1MBFA 3E6BA 3CCQI 3L7WA 4JQFA 3OSGA 2R7UA 2NNNA 3BZ6A 2IGNA 3BZKA 4NQWA 2AQEA 2A6HF 3F72A 3ZN1A 1OLTA 2M7BA 2KP6A 2ZNYA 4WWCA 2KZVA 3K2AA 1FSEA 4AU7A 5LEJA 5LRRA 2NVQJ 3H92A 2BEOA 3RPUA 5IP6A 1IW7F 2DCEA 2Y48A 2E35A 3LAPA 4B8XA 1J7KA 1EH6A 4BE2A 2DFIA 1RR7A 3JCUC 3V8KA 4PCQA 1UFMA 3V7SA 1T0FA 4L18B 1Z7UA 1FBUA 2COMA 1PUFA 1VQOI 2P6TA 2L5QA 4ZJZA 5IPAA 2RGVA 3EYYA 3GZ5A 1V55H 5GP9A 3G4SI 3F23A 5F1RA 1KGSA 1STZA 2EINH 2KIMA 1DGRM 1UZCA 3QP5A 4DBQA 2NRAC 1LNWA 1R4NB 2H8RA 4QLCU 5HDKA 2KIFA 2L01A 3MN2A 2E1OA 1S9HA 2R3SA 2AQFA 1IZ1A 2DJIA 1O3TA 1T08B 4CGZA 4EM0B 4CZCA 3BOQA 1MMSA 2WV1A 4Y7NJ 4ESBA 3ZXSA 2QF7A 2W1OA 1K4SA 1LFUP 2HZTA 4LK1F 1W5CC 2CSOA 3F8MA 3F8FA 3K69A 4FX4A 1UG2A 2Y0SN 3LA3A 1TLHB 2EZIA 2K9QA 2L4AA 3RZDJ 3J81K 4BL0B 5KAFC 2GWRA 3I59A 4JP0A 5ERIA 2CQXA 5E3LA 2K9SA 1HDPA 4RGUA 4YIIA 3TL4X 4CCLA 1FYMA 2K86A 2PMUA 5B1BH 3CP2A 5EGOB 3FBIB 2DU9A 2HQAA 1OMIA 4D5CA 1A35A 4M73A 2B0LA 3ROUA 4RB3C 4M6VA 3S1MJ 2EBIA 2VLAA 4A12A 1QQIA 1BJAA 1GVJA 3S15J 1R1VA 1WH5A 4E4HA 4GDFA 4A6DA 2CYYA 4WF2A 3IWFA 4I02A 1WRJA 4FCYA 3MFKA 3LNQA 4YFXF 3FXMA 2L2OA 2CRGA 2XGCA 5GAEJ 4PJ0C 1YI2I 3TMOA 2JPBA 1YJ9I 2K4JA 4E7KA 4KN4X 2ZO4A 2A5YB 4DIQA 1X3WB 2VQHA 2R5ZA 1UMQA 2LYCA 3H0DA 4HOBA 5DDGA 3AG1H 2BXYA 1D0XA 1V5FA 2FJ1A 5J1UA 4MNUA 1WJCA 1ZYRF 3R6SA 1FSHA 2W85A 2CJJA 3CJQB 3VSLA 4BXFA 5IT3A 3WTVC 4IHVA 2ISYA 3SZPA 2RNJA 4LD5A 4LIUA 1QBJA 5JFRA 1JXSA 3JW4A 2C6YA 4N9HA 1WCMJ 2ECCA 3I56I 3CJRB 2IT0A 1FP2A 5HOOA 4GYGA 1IG7A 3SYTA 2W82A 4A5NA 2JA5J 2BOLA 5EEAA 3A2KA 2XPWA 3FXRA 2CMPA 3WTTC 4IVNA 3FK6A 2D1HA 3IAM2 3ABTA 4C2MJ 3G73A 1IXCA 1IV8A 1JJ8C 3LQQA 3RPUD 4JX6A 3ZOBA 1YHQI 4LITA 4HPQA 1JUPA 4B3AA 1LFPA 3OL4A 3OMYA 4JBAA 4BXUA 2QSHX 1T98A 3OYDA 4HDVA 2B9SA 2VPLA 3GZNB 3K7AJ 2JZYA 2FNAA 2DBBA 4QWQA 1ETVA 3HM5A 2MA3A 3SHFA 4BHCA 4MFEA 3FWEA 1P2FA 3JSPA 4O5VA 1QA6A 1TNTA 2F48A 4ENKA 1D8JA 4Z2YA 4P5OA 2E5NA 2E60A 4OAZA 5LGTA 2GXAA 2DFFA 3CF5F 4HF2A 4AUXA 2CH0A 3OS2A 1YW9A 2ZB9A 2VT2A 3M1CA 2QWWA 2LH9A 2D45A 3PIOF 4YELA 1FEXA 2VQCA 4CICA 3HOVJ 4EJWA 3AKZA 2RQPA 4DJAA 2XKOA 2PEXA 3HOYJ 3S2WA 3ZGKA 1USSA 2HPMA 3OR1C 1ZQ3P 4HAMA 3W2AA 1K83J 5KAIC 1KA8A 2EV5A 2P81A 3KP6A 2E36A 1AU7A 3IRQA 2Z9OA 3KEOA 1YX3A 2KQRA 3QYEA 4L0ZB 1BC7C 2Z1DA 3BR0A 3DQVC 2CUEA 3M3YJ 2DPUA 2WAQN 2JA8J 5KHDA 5HNHA 2EZKA 3LWFA 1O7LA 3AG4H 3R61A 2PI0A 2JA6J 3CMMA 1GHCA 1WGXA 4B4CA 3F6VA 3QOPA 4EJVA 1E3PA 3WG9A 1T0FC 3OYHA 2R7SA 4YIFA 2KKOA 5E79C 3H9JA 4NC7A 5C44J 4ZYGA 3CCLI 5FGMA 4BJTA 5D5VB 3JREA 2PFBA 3QPHA 1IRGA 5D6EA 4A3LJ 1R23A 5E1ZB 3KIOA 5M5XJ 2KRCA 3ABLH 4A3EJ 4YEJA 2FD5A 1FT9A 3UR3C 4C30A 4XSXF 2PJRA 2JRMA 4IJAA 2ZNZA 4BKXA 5J4VA 2A6EF 3A0BC 2JT1A 1DU6A 3CESA 4B47A 1ZRFA 1ONVA 1HDDC 3RZOJ 3BLYA 2EILH 3A4CA 3E6MA 2I10A 4RGXA 3Q9VA 2Y9ZA 3TO6A 1MMAA 3T8TA 3BP8A 4YFNF 2JSCA 1WJFA 2WC2A 3QOEA 4Y52J 1TWGJ 1YG2A 5CKTA 3PNYA 1BBYA 4HX8A 1QU3A 3CF2A 3L9FA 2ETHA 1J5YA 3DFGA 3MVPA 1XGSA 5GPCA 3HYIA 1JKOC 2DPDA 3FX3A 3MKWB 5CQGA 3WE3A 2DA2A 4XICA 3GFIA 4L9TA 4B43A 2BVLA 3OOPA 2EA2A 1SAXA 1WJ5A 3JRFA 3DP7A 2IS6A 2HQNA 2YS9A 3MWMA 3OYJA 5GADJ 1AKHA 3HBLA 1F5TA 3CLOA 1QO0D 3KLOA 4Y15A 1SD7A 4NQWB 4Z6YA 4A3IJ 2XB0X 1LE8A 1U2WA 4XKWA 5HLHA 2VXZA 2R5YA 2XF7A 2LK2A 5HODA 2M0MA 2Y75A 5B3SH 4D1QA 4XOTA 4FX0A 2JUGA 3G2BA 3Q9SA 1OCCH 2BY0A 4OMZA 5FKMA 1N77A 4A93J 2ZSIB 2UZKA 1PUFB 3WTSC 3S2HJ 1OCPA 2JRTA 2ZFUA 5IYBJ 1ZN2A 4R79A 4C3HJ 2DDAA 2HYFA 4CUGA 1B9NA 3NEUA 1EKEA 5K5RA 4HG2A 4OINF 5J8FA 3F21A 5H2FC 2ZBKA 2OQRA 1KZHA 2DA3A 1SFUA 4XBFA 2XGXA 4PSWA 3GTMJ 1YX5A 1V5EA 3MKYB 1X1BA 1KQ0A 2V4JC 3DTKA 3K2ZA 3ZMSA 1FY7A 1A36A 4BQOA 2O8XA 5E3OA 1RESA 1A04A 2WA0A 2VE9A 2VI6A 3IRRA 3E6DA 2PX9A 4E7HA 4MEXF 1U5TC 4OIRF 1USTA 2AXLA 3CC2I 2LDUA 2VBYA 3OIPA 2H1KA 5ICEA 3AG2H 2DOEA 5JHFA 3K4JA 1D0ZA 1PDNC 3O6BB 5B5EC 1WJAA 3OYNA 3VSKA 3MKLA 2HR3A 1DQUA 3I59B 3CP8A 3NWTA 3P9KA 1ETKA 2LP0A 3K4KA 5AONA 1SD4A 2HDDA 3U21A 4MIMA 2VKHA 4WXDA 5J8CA 2DMTA 4L5JA 2UWMA 4XM3A 4G7OF 4G12A 1LQ1A 3EUHA 3PNTA 2MABA 3I53A 1R36A 3K10A 3ZN0A 1EH8A 4DGWB 4JYKA 1ZG3A 5FFZA 3L1PA 1T56A 2V79A 1WKMA 1W4MA 3V8LA 2VBWA 2RC4A 3TW7A 1SMTA 2OUMA 3T8RA 4EJTA 1YITI 3M8JA 1CF7B 4A3FJ 1XSVA 2M7AA 5CLSA 5K5OA 4JX4A 1P92A 4XKCA 1IAWA 3HUGA 1I6HJ 1SVLA 2N8GA 2PJPA 2EPFA 2I5UA 5L3GA 2HXOA 1GDTA 3C2GA 4GXOA 1ON2A 4BQAA 2FF4A 4HQMA 3EDPA 4AIKA 2YPRA 3KP5A 2H8WA 1OR7C 2K7LA 4WK8F 3HOUJ 2OD5A 1G3SA 1VF9A 3I55I 1FTTA 4D7NA 2F4IA 4HLYA 1ZH5A 3FKIJ 2H94A 2CUJA 2EQRA 5ICGA 3ZQ7A 4OIOF 4QTRA 1QHGA 1ULYA 4XLFA 1SFXA 4QSHA 4XRSA 2R93J 1YIJI 3CC7I 4BY1J 3S17J 5FLXK 1W36D 5DM6F 3GTGJ 2LMDA 5FB2A 1R6RA 3SFZA 4CO8A 2QZ8A 1XGNA 1U5TB 3V42A 1XDUA 1DP3A 1QZYA 3KETA 4CDGA 3OSFA 4U0WA 3HOTA 3OL3A 3KP7A 2WWYA 1DP7P 2V1NA 1YTYA 2XIGA 5H20A 3HRSA 3BR3A 3W3CA 1H88C 2HOEA 1GV5A 5DS9A 3FDYA 3TEDA 3DKWA 3ZMUA 2R7WA 1TZLA 2DOFA 1HSJA 3GXOA 5J40A 4H0EA 2ME6A 4MTEA 3H5NA 2CQNA 1PUEE 2W84A 2QQBA 3BTLA 2Q8KA 4CCJA 2HKXA 4IOCF 1IRZA 4MFDA 4L0YB 2ID6A 2FMYA 2CQ7A 5DD4A 2P0WA 4XR6A 3DLAA 3BG7A 1Z1DA 4P9FA 3OYKA 3BR1A 4G6TB 5DCFA 1YO5C 4IHYA 3QRFF 4ZYHA 5IT9Z 1IDYA 5D8LB 1T6SA 2MBFA 1BC8C 2R4GA 3LQRA 1Z9CA 4J19A 1H9GA 4A3KJ 1Z6RA 3WTZA 4BGDA 1L3LA 2XAFA 1FX7A 2F5VA 2Y0MA 3JSOA 3CQZJ 1WWXA 1S72I 2E2IJ 2LKPA 2MD5A 1V4RA 1SFKA 2LREA 1OFCX 1NK3P 3CTAA 4CH7A 1G3YA 5DEQA 1PP8F 2STWA 2BY3A 2NS0A 5E3NA 4RB0A 3K70D 1W0UA 2CWEA 1V5GA 2O6GE 1ZRCA 2QGUA 2A07F 2O61A 4N9IA 1S5LC 3L2CA 1W5TA 1W36C 2PQ8A 4X6AJ 3FMQA 1DU0A 3C18A 3PFYA 5BMZA 3ZMVA 1HLVA 5J6XA 3P9CA 4IKFA 1JKQC 3RKWA 2XGEA 2LFBA 3ERED 2ZJQF 5FKOA 1HKQA 1IN7A 4IHWA 5F0CA 4PJNA 1WFXA 4HF1A 3Q0UA 3ZQGA 1SFEA 2GM4A 3D5SC 3LL7A 3JRIA 2LVSA 1OCRH 3KEQA 1LDKB 1RUNA 2L7MP 4IRGA 5D5XB 2JMWA 1WZ2A 2UXNA 2F2EA 3CMYA 2XAQA 2Y30A 2WV0A 1R1UA 2K9LA 2PJRB 1B1BA 1BIAA 2NVXJ 3OYMA 3K4BA 1R00A 3ZP5A 3S16J 3S1QJ 1TWCJ 1KQ8A 1JUMA 1IUFA 2HGCA 4UB6C 5D4RA 2DYRH 1YRNA 1R5GA 4BBSJ 2BXZA 3L2QA 3PM1A 5EJCA 1ZR2A 2OCCH 1YYVA 3PJRA 2KISA 3FIWA 4EVIA 3K4LA 4A0YA 2X1EA 4HQEA 4ZH4F 1JUSA 1MBHA 1HBXG 5M3FJ 4FHTA 2BE5F 1F43A 2JSPA 2DT7B 3E1SA 2OCEA 3JRGA 1X4PA 1MW7A 4HDUA 2A68F 3DEEA 3M8FA 3NARA 5HLGA 1KU2A 4EQQA 3MD2A 2V6CA 5EEGA 3EUHC 4RAGA 4LB6B 4M72A 1IGNA 3F8NA 4UB8C 2VJ4A 1ENHA 3LAJA 1DPRA 4G94A 2DT6A 3GTQJ 1BI0A 2UXXA 1JGGA 5GTHC 5FJ8J 2DMUA 1LE8B 3V7RA 3DTEA 2R5YB 3B6AA 4C3JJ 2E7WA 4P96A 1RKWA 2H09A 5FKKA 1O3RA 2X6YA 3F8BA 3BJOA 1ZTRA 3F0CA 2VUMJ 5JLWA 1R49A 3TOBA 2AXTC 2VASA 1Z7LA 2W4SA 2RQQA 1QZEA 2ACJA 1HF0A 2BYVE 1MDMA 1ZGJA 2AHQA 4M3GA 2E5ZA 3CZ6A 5ICFA 4ZZLA 1N75A 1MSEC 5C4JJ 2DO7A 1A5JA 4U87A 5LGUA 3B02A 1E3HA 2JPCA 1YLFA 3D5RC 4GRIA 4E6KG 1TW2A 3VWBA 3RYRA 3H3ZA 4RM3A 2BV6A 3BPVA 5BPDA 4ASNA 3S1RJ 3GTKJ 4N4NB 2A05A 3JAMZ 2GZWA 3H9QA 1IN8A 1GUUA 3GBGA 1AWCA 2V1XA 4CCKA 2UV1A 4V19K 3K4CA 3BR6A 1X1PA 1EJ9A 1U8BA 1I6XA 4MO7A 3OIQA 2VJIA 1XSDA 2XAUA 3ASOH 2VOOA 4BQNA 2Z5UA 3IH4A 1FOXA 3HSFA 3O3KA 4HSTA 1D3YA 4PZJA 3ZPLA 4ANJA 3ZQCA 2VJJA 5HDGA 5E18F 3VYUB 3OYLA 1IC8A 1O3QA 1NG6A 4II2A 5J47A 2R7RA 1QGPA 2IW5A 2LKSA 2L7ZA 1IO2A 2Y2ZA 3DF8A 5L3DA 4BU2A 3KP3A 2NVUB 5HVQC 3IP4B 1OPCA 2IA2A 3BWGA 3ZQLA 1BOAA 3A1YA 3MCZA 4WXHA 1OCZH 2RREA 2F5CA 4ESFA 1JTYA 5FRNA 2D1VA 1Y8RB 2VBXA 2Z2SB 2IA1A 3VEPA 5B1AH 4HEA2 4NBQA 1Z05A 1Y1VJ 4UV8A 3TW6A 1ZG1A 3BG3A 2JVHA 4Y33A 2G0EA 2OAZA 3FM3A 1U78A 4XLNF 1I1SA 4OIPF 3IH2A 4FISA 3HUGB 3S93A 2WB1A 3E3VA 4XKVA 3S1NJ 2KFDA 1CF7A 4ZTJA 2O7OA 3ZMZA 3WGHA 5CVIA 5HDNA 3GZ6A 1UHMA 1XMAA 3ASNH 2IPQX 4XRSG 4ETSA 3LSIA 2OC6A 1VQMI 1BR1A 4D5FA 2HOAA 3V8JA 1Q1HA 1MBEA 1NG7A 2BGCA 2VT3A 3H3VK 3J81Z 5KVRA 1E2XA 3WU2C 2V26A 4HBLA 2OV7A 2R7OA 5IY5H 2A6TA 1T2KA 1HKSA 4HNVA 3KEYA 2GA2A 5F6FA 3ABUA 4L9NA 3C2BA 1ZRDA 4DZJA 3BDDA 3LA2A 1MGTA 3J80K 2CO5A 1CGPA 2A3SA 1ZGAA 4X0GA 1APLC 2LF7A 3QAHA 5ICCA 1Y1WJ 3WTYC 3BCAA 3RQ4A 1Z67A 3O8GA 1X19A 1R58A 2P5LC 1R71A 2ICWG 4M6YA 5CPRB 4KITB 2GAUA 3DEWA 1ETQA 1TQMA 1EA3A 1U5TA 1H89C 3GYHX 1I3AA 2P5KA 3LOCA 3CDIA 4DYCA 5GAHJ 3HSEA 5IYDJ 4NUBA 4X1EA 2PN6A 3TBIA 1IRFA 2PBIA 3JRAA 3FXUA 1BA5A 1FMWA 2ZJ2A 4CSWA 1YS6A 4ZDPA 1SC7A 5BPIA 5H6QA 4KNYA 4LJZF 2X6WA 4A3CJ 2KRFA 3RYPA 4HSRA 3V7CA 1BR2A 1IRXA 4RGRA 4KDPA 4S04A 4MHGA 1K6YA 4WCGA 2F5FA 1FC3A 5EF6A 2ZKZA 4XQFA 4KYWA 3S3NA 1RR8C 5H6RA 2KJBA 4JX5A 1D1BA 1QZZA 1OYIA 3SZGA 4XNFA 4IEJA 2OF7A 4PFOA 1K4TA 1OISA 1HSTA 3WHBA 1B8IA 4LGWA 1S8NA 3FXQA 3KZYA 4YIRX 1AOYA 4PJLA 2BZTA 1ZLJA 5CJ9A 3T0YA 3W2WA 2ZJPF 1ZHFA 3Q0WA 1PYVA 3QU3A 3VPRA 2DK5A 2HFHA 2LY1A 3M8EA 3LSPA 1LVKA 2DODA 2W25A 5EG0A 3HGGA 4W97A 2AS5F 3OS0A 4I0BA 2XROA 4G7HF 3PL8A 4UUVA 1FZPB 4KIGA 2EIMH 3BTJA 1OR7A 4BE0A 1S7AA 4J00A 1SVMA 3SEQA 3ZQHA 3DLLF 2L0KA 3OYIA 4JOMA 2J5PA 3HB9A 1HA8A 3CMEI 2YR2A 2E34A 3H36A 5E3MA 1FBSA 2CUZA 1Y39A 3MKZA 4PJMA 3HRMA 4AM3A 2BBYA 1XG1A 4KMFA 3S3OA 3DKYA 2CQKA 2DN0A 4MLOA 2LBFA 2NYXA 2QENA 3E0JB 3Q3SA 2HZDA 4Y13A 1XX5A 2DDBA 4FASD 1DGWY 5LLQA 3ZQIA 4U7DA 3PIPF 4FETA 4BS9A 2ELJA 3K1NA 1I5ZA 3R0JA 5ED4A 3KPHA 4XRFA 3ESWB 2EWNA 2LNBA 2DFHA 2IS2A 3PO3J 1MNEA 3VYSB 1O4XA 3KZZA 3WG7H 3R60A 1MBKA 1QNTA 4BJ6C 2ME0A 1XPXA 1T8IA 1U8RA 2V9PA 2DJNA 3I5UA 3GO5A 3HEFA 3EPZA 1I3QJ 1Q1VA 2V7FA 1YRNB 1VQ7I 5DUKA 2VJ5A 1FYKA 1FNNA 4EEFG 3I3LA 1B9MA 4B09A 1W5SA 2R7DA 1IN5A 1R1TA 4HF0A 3AFHA 1HW5A 2HOTA 4HNUA 2MGQA 2XF6A 2CUFA 3IWZA 2BY2A 2KLOA 3WGGA 1EV7A 3IKVA 5LHGA 4HV6A 4BYYA 4PDKA 1P9QC 2OTJI 2XRLA 2Y69H 2CG4A 2G9WA 3GFJA 1XGMA 3CUQC 2MLKA 1XN7A 3JRHA 1S7EA 5AIQA 4WX9A 5KCMA 2IGMA 3EYIA 1WHUA 2R7XA 2QSGX 2DK8A 2M45A 3DBHB 3QPTA 4G7ZF 4UHTA 4IZZA 3HHHA 3WGIA 1D5VA 1PP7U 4AVPA 2LLKA 2HXIA 4DYRA 3GTPJ 3R0AA 1WVRA 2HDWA 4XKBA 3WTWC 3HRTA 4I98B 1C0WA 1XS9A 4I99C 3FM5A 4I01A 1MDMB 2P7VB 1YFHA 5ILUA 2FBIA 4BNCA 1N78A 1KU7A 4DYQA 4V2GA 1P7JA 3K9TA 4FE7A 1J09A 1YE9A 5CYVA 2EV0A 1L0OC 4UVAA 2LY2A 2O3FA 3J7AO 3HOZJ 4PUSA 4OWRB 3BZCA 2FEZA 2WY7Q 2L9NA 2VN2A 2K9MA 3S2DJ 1ZLKA 3L09A 3BTIA 2KT0A 1OYYA 2TDXA 4BE1A 3IH3A 3SQNA 4JK1X 1FYLA 3IUOA 1U9OA 2M8GX 2DXIA 3KCCA 2LKXA 4NNJA 1AA7A 2GBYA 1VQKI 2VKEA 1X58A 4NC8A 4YFKF 1J75A 2JJ7A 3N97A 3TP0A 2FSWA 2M30A 2IP2A 2LR8A 3I54A 2HKOA 4AIJA 2CV2A 3KYCB 1TNSA 4AIDA 3QYFA 1WJBA 2EJRA 3BQYA 4E7ZA 4IL6C 1XDSA 2DT5A 4U0YA 1E3OC 4CHUA 2RKHA 3IKTA 3FISA 4TV7A 2OTLI 2QSFX 4QPOA 2VONA 3HTSB 1GXQA 2X0LA 1EH7A 2WAEA 4F3QA 2ID3A 1S7OA 2MSYA 4ITVA 3RDIA 2NOGA 3WU0A 1G4DA 6PAXA 1ETYA 2L9RA 4ON0A 2E1MC 3GWZA 1XB4A 3H1CA 4HYEA 4BBRJ 4N4OB 2H6BA 1IN6A 4PSXA 4O3MA 5L3CA 3RCOA 2R7TA 2QKMB 4GFBA 3CUOA 3O2PE 4HLXA 5FROA 2HPIA 2X1DA 2DI3A 1R22A 2RDPA 3U2RA 2R7VA 3U1DA 5M5YJ 1JHHA 2GLOA 5A2QK 1LDJA 5JR3A 2Q2EA 1VQPI 4ZYDA 2FU4A 2K3PA 3CJTB 3KZIC 2FUG2 2NOJB 2M9HA 3KFWX 4L9VA 1QVTA 1OCTC 2X48A 3IL2A 3F8CA 2ELHA 4BACA 3VFZA 2HI3A 3OOUA 3G1MA 3I4PA 3MZHA 3PSFA 1IXRC 1I1GA 4XN0A 2X6XA 5GTIC 1T38A 2MH9A 4XL9A 4KICA 2EFNA 4XLCA 5EEHA 2ZFWA 2IJLA 4IXAA 2E2JJ 3SDGA 4EGZA 1VQ6I 2GXGA 1P6RA 5M5WJ 3QODA 3F22A 1O3SA 4KJZA 3KYLA 3A02A 2DA7A 1VQ4I 4GGGA 1AHDP 1MH3A 2VKDA 1T39A 4Y17A 2STTA 4I2OA 2F5DA 4F91B 4C2TA 1M1EB 1QPMA 2B7EA 2NXNB 4BDZA 3E97A 3PUFA 2O5RA 2CQQA 2EIJH 2Q1ZB 1RIOH 4AIHA 9ANTA 1FOKA 1PVEA 5ILSA 2P5VA 3CO6C 2ZXJA 4EJOA 1B72A 4A0XA 5J3LA 4XLPF 5EZGA 2VPRA 4BEHA 2ISZA 3BROA 2DW4A 3CMAI 1TT5B 2R7ZJ 3EETA 1X2MA 4HW0A 1W1WE 3GLLA 4UUTA 3OYBA 1UCRA 5TRDA 2X6OA 4UNOA 2DYSH 2E1MB 3JTGA 2VIXA 1B59A 3A03A 3I4MJ 2L02A 1ITYA 5F08A 3BTCA 1GT0C 5F0FA 4CCNA 4AWXB 2QQ8A 1LUJB 2FOWA 3LFKA 3HG9A 4PJJA 4XLEA 3BC8A 2ESHA 2WB1N 4IQJA 1B8IB 5D5UB 1G8XA 1WPKA 1IXSB 1A6QA 3FZVA 2XPUA 2UUZA 5FLXZ 4M71A 2K9NA 3TGNA 3EUKL 1VTNC 2EZHA 2HU9A 1F9NA 3MMYB 5EG0B 5FD6A 1SD5A 2W00A 4RLQA 2VB6A 3BR2A 1Z6TA 2OBPA 3I71A 2V1UA 4E7JA 1E17A 1P4XA 2XUBA 3OYCA 1G59A 1MJAA 1IN4A 2O8KA 1R4MB 2DMPA 4C9YA 3BG5A 4P9UA 2WADA 4YG2F 1HXDA 1FIPA 1YW7A 2EB7A 2XAGA 5LRSA 1TL8A 4S0HB 4ENNA 1WQ2A 5CQEA 1LPQA 4BHPA 4IHXA 1SFOJ 4ZYAA 3L2UA 4E7LA 3BG6A 2WBMA 3ECOA 2H27A 1ETXA 1TWAJ 3GTLJ 1U6GA 2GOMA 2O0YA 3DPUA 2LG4A 1FP1D 2RNGA 4UUSA 2X85A 4FQGA 1LDDA 2K85A
chains in the Genus database with same CATH topology
2OU2A 2Z33A 3D5LA 3VB2A 1K78A 2VC1A 4HZFA 2HYGD 1FWZA 2X4HA 2OA4A 4KT5C 4RB1A 3E6CC 4RAZA 1FBQA 1ZAOA 2PG4A 4PGHA 2FXAA 4LMYA 1JGSA 2G7HA 4FT8A 4LG0A 4F7ZA 4R8HA 1RUOA 1YS7A 2J5OA 2MLGA 5FO5A 2ZMEA 2M8EA 2K4BA 5KK1A 4IRIA 5HS8A 2ESNA 1J2XA 2EFQA 4L5IA 3M9AA 3GFMA 2FE3A 1LEBA 2ZCWA 1D8KA 3GW2A 2W24A 3BY6A 4OU0A 4DQ2A 4Q5SF 2MH2A 3HTUA 2L3DA 4IRHA 1BI1A 3FMSA 3HOSA 3KP4A 4LLLA 2QLZA 2OZ6A 4KMUX 4M9XA 3C3WA 3V4GA 2D2WA 2EV6A 3WTUC 1W7PA 2DTRA 1KU9A 1KQ9A 4EM1A 2E7XA 4L9JA 2HTSA 2FA5A 3HRUA 2ADUA 3ZMDA 1HKTA 2QBYA 1I27A 5E1XA 5L3EA 3P9IA 3M1EA 4EM2A 3KLNA 4LLNA 5E8IA 2CGPA 4G6QA 4EGYA 3FF5A 4GO1A 3AAFA 4DNCA 1P4AA 3W6KB 3SZTA 3ECHA 1P4WA 4I0AA 3CUQA 2HWVA 3TQNA 1HW1A 1TW3A 2QM3A 1LVAA 4BHBA 3VODA 1REPC 1X3UA 4RB2C 3BJ6A 2XAHA 2XHKA 1J0RA 4ESJA 2VC0A 3ML6A 2EK5A 3L00A 1KYWA 2Z99A 2DQRA 3P7NA 1MD0A 5LEKA 1DPUA 2DQLA 5FD5A 1G6NA 2K02A 4ENMA 5LHIA 1MJBA 1ODDA 4N0BA 3TDUC 1HW2A 3DEUA 4IHSA 2DLLA 1UB9A 5LHHA 4OMYA 4GCVA 4RAYA 3ZMTA 2E1NA 2LF8A 1G3TA 1K6OA 2WTEA 5JI6A 4G6DA 1W7PD 5E17F 4A5MA 1HQCA 1K7AA 3IC7A 2A69F 4HA8A 5CVVA 2GQQA 2H6CA 1IF1A 2FRHA 4D0PA 3C1DA 2DAOA 1UHWA 2O03A 2EFOA 1JHFA 2XRNA 3GF2A 5E1WA 4LFUA 1B6AA 5CVRA 3J80Z 3BJAA 5D8KB 3REOA 1BN5A 4XSZF 4K2EA 1DUXC 3I58A 3GFLA 2QQAA 1V3FA 4HX7A 3K1MA 4I7HA 1MZBA 3F6OA 4KFCA 4EMSA 1XD7A 1SMYF 5DCMA 2V1DA 5CVUA 2KJCA 4A6EA 3TOAA 2VBZA 3CO7C 1O57A 5DV5A 3CDHA 2HQRA 3GVAA 2HEOA 2EFWA 5BOXA 1K78B 1FLIA 2VE8A 3H3UA 5D6FA 1IUYA 3COAC 2RV8A 3W6JB 4PGGA 2P6SA 1ZREA 4UVBA 2KIUA 2P4WA 3HIFA 1OYWA 4UVCA 2RN7A 1MKMA 3F3XA 2MC3A 2Q0OA 4KIFA 4LG0B 5E20A 2GXBA 2OZUA 3E5XA 2ZMEB 2LSOA 2XASA 3R4KA 1B4AA 5HLIA 3KE2A 2XVCA 1XSXA 2CFXA 5TJJA 3GEZA 4MQVA 4EJUA 2PLYA 2V9VA 1H9TA 4MGRA 3PQKA 2FBHA 5BQTA 3WTXC 3HSRA 1Z91A 2GIVA 4GYIA 5K5QA 5DUIA 2FBKA 3LA7A 2M5WA 4ZZDA 4M9SA 4KIBA 2E1CA 1BI2A 1W7PB 3MQ0A 4MQ9F 3RJPA 3FMRA 1GXPA 4LLGF 4IPAA 3ULQB 5DYMA 2L54A 1BIBA 3WE2A 4OIQF 2QBYB 3KP2A 2NAZA 4AD9A 3BPXA 3E5QA 5L3FA 1KYZA 5K1YA 3QP6A 4CZZA 1LJ9A 3K1PA 1NHAA 4WXCA 1J9IA 1TQPA 2QQ9A 1XCBA 1H0MA 2Z3YA 3MEXA 1TQIA 2FOKA 3WU1B 2W57A 3B73A 1WSUA 4P55A 3CUQB 3WODF 2XAJA 1OKRA 3PQJA 3RKXA 5D5WB 1Y0UA 2YX7A 2K27A 2IVMA 3LSTA 3U9GA 4Q4ZF 1J59A 4U0VA 3DXJF 2JTVA 1BI3A 1G3WA 4UV9A 1LEAA 3D0SA 4Q47A 3DPLC 1ZARA 1R7JA 1S3JA 4M74A 1MJ9A 4ZYEA 2VOPA 4BH9A 2CW0F 3OV8A 4E70A 4RGSA 3MZYA 1JE8A 1WI9A 5LGNA 2HS5A 3TDZC 1K79A 2EFPA 4O6JA 2EA4A 3ISPA 5A2QZ 2QYOA 5D4SA 4U88A 2PMHA 4Q48A 5HS9A 3MAJA 2YU3A 3NRVA 3GX4X 1O7FA 3M7GA 3RIRA 4IHTA 4NB5A 1YQAA 3C7JA 4KN7X 1DDNA 3TKYA 5IT9K 3ELKA 3JTHA 2R7FA 1XMKA 5F64A 3SXYA 3K0LA 3RTRA 5FFXA 5AIPA 5BS6A 3G3ZA 1KU3A 4HX4A 2A61A 5HS7A 1U3EM 3GLXA 4CXFA 1S6LA 4MTDA 4IF4A 3EQLF 3VOEA 5JHUA 4A0ZA 4M6XA 5DCMB 4A2UA 2FNPA 5JVTA 2GA1A 4KA4A 1XCVA 4OOIA 2FQ3A 4KUMA 4EV0A 1LB2A 1YIOA 4HV5A 4S05A 2HDCA 5ILVA 1R5HA 3Q5FA 2XV4S 1TBXA 4M9ZA 3TO9A 2IRFG 2M1BA 4ENJA 4NHJA 4RS8A 2G7UA 3RPQA 3CJNA 3RI4A 3I64A 1F1ZA 1BM9A 2NNYA 2P8TA 3T5XA 2F5EA 3FHZA 3N4MA 1SD6A 4R1HA 3NQOA 2YX4A 2FMLA 2QUFA 1S29A 4BAYA 3GUDA 1TTYA 1YW8A 3QU6A 4U7BA 3E5UA 1RNLA 4LK0F 5LBQA 3TO7A 3PFIA 1ZG5A 3IHUA 4I09A 1XGOA 3I0TA 3DV8A 2XKPA 4CYDA 1RI7A 2HTJA 5CVJA 2VODA 3HHGA 4MEYF 3DPTA 2L4MA 4UXNA 1ON1A 4G9YA 3RKYA 1F4KA 2QVOA 1FPQA 4G8XA 4LB5A 5DD8A 2IA0A 2P7CB 5L3BA 2M87A 3T1BA 5E8GA 3JAMK 2YSRA 1RZ4A 2RVCA 2OQGA 3E6BA 3L7WA 4JQFA 2NNNA 3BZ6A 4NQWA 3ZN1A 2A6HF 3F72A 2ZNYA 4WWCA 1FSEA 5LEJA 5LRRA 3H92A 2BEOA 3RPUA 1IW7F 2Y48A 3LAPA 4B8XA 1J7KA 1EH6A 2DFIA 3V8KA 4PCQA 1UFMA 3V7SA 1T0FA 4L18B 1Z7UA 1FBUA 2COMA 2P6TA 2RGVA 3EYYA 3GZ5A 3F23A 5F1RA 1KGSA 1STZA 2KIMA 3QP5A 2NRAC 1LNWA 4QLCU 5HDKA 2KIFA 2L01A 2R3SA 1IZ1A 1O3TA 4CGZA 4EM0B 3BOQA 4ESBA 2HZTA 4LK1F 2CSOA 3F8MA 3F8FA 3K69A 4FX4A 3LA3A 1TLHB 2L4AA 3J81K 2GWRA 3I59A 5ERIA 1FYMA 4YIIA 4RGUA 2K86A 2PMUA 2DU9A 1OMIA 4M73A 2B0LA 3ROUA 4RB3C 4A12A 1QQIA 1BJAA 1GVJA 1R1VA 4A6DA 2CYYA 4WF2A 3IWFA 4I02A 1WRJA 3MFKA 4YFXF 2JPBA 2K4JA 4KN4X 2ZO4A 2A5YB 4HOBA 5DDGA 4MNUA 1ZYRF 3R6SA 1FSHA 2W85A 5IT3A 3WTVC 2ISYA 3SZPA 2RNJA 4LD5A 1QBJA 5JFRA 1JXSA 3JW4A 2C6YA 4N9HA 2IT0A 1FP2A 5HOOA 4GYGA 4A5NA 3FXRA 3WTTC 4IVNA 2D1HA 3ABTA 3G73A 1IXCA 3LQQA 4JBAA 4BXUA 1T98A 4HDVA 2JZYA 2FNAA 2DBBA 4QWQA 2MA3A 3SHFA 4BHCA 3FWEA 1P2FA 3JSPA 4O5VA 1TNTA 1D8JA 4ENKA 4Z2YA 4P5OA 5LGTA 4HF2A 1YW9A 2VT2A 2QWWA 2D45A 4CICA 4EJWA 2RQPA 2XKOA 2PEXA 3S2WA 1USSA 4HAMA 1KA8A 2EV5A 3KP6A 3IRQA 2Z9OA 3KEOA 4L0ZB 1BC7C 3DQVC 2DPUA 3LWFA 1O7LA 3R61A 2PI0A 1GHCA 3F6VA 3QOPA 4EJVA 3WG9A 4YIFA 2KKOA 4ZYGA 5FGMA 5D5VB 2PFBA 3QPHA 1IRGA 5D6EA 1R23A 5E1ZB 1FT9A 4XSXF 4IJAA 2ZNZA 2A6EF 2JT1A 1ZRFA 1ONVA 3E6MA 4RGXA 3Q9VA 3TO6A 3T8TA 3BP8A 4YFNF 2JSCA 2WC2A 1YG2A 4HX8A 1BBYA 3L9FA 2ETHA 1J5YA 3DFGA 1XGSA 3HYIA 2DPDA 3FX3A 3WE3A 3GFIA 4L9TA 3OOPA 2EA2A 1SAXA 3DP7A 2HQNA 3MWMA 1F5TA 3CLOA 1QO0D 3KLOA 4Y15A 1SD7A 1U2WA 5HLHA 2VXZA 2Y75A 4FX0A 3Q9SA 4OMZA 2UZKA 3WTSC 2JRTA 1ZN2A 4R79A 2HYFA 1B9NA 3NEUA 5K5RA 4OINF 5J8FA 3F21A 2ZBKA 2OQRA 1SFUA 4XBFA 2XGXA 1KQ0A 3K2ZA 3ZMSA 1FY7A 2O8XA 1A04A 2VE9A 3IRRA 3E6DA 4MEXF 1U5TC 4OIRF 1USTA 2AXLA 2LDUA 2VBYA 5ICEA 1PDNC 3O6BB 2HR3A 3I59B 3P9KA 5AONA 1SD4A 4WXDA 5J8CA 4L5JA 2UWMA 4G7OF 1LQ1A 3EUHA 3I53A 1R36A 3ZN0A 1EH8A 1ZG3A 5FFZA 2V79A 1WKMA 1W4MA 3V8LA 2VBWA 2RC4A 1SMTA 3T8RA 4EJTA 1CF7B 1XSVA 5CLSA 5K5OA 1P92A 1IAWA 3HUGA 2PJPA 5L3GA 4GXOA 1ON2A 4BQAA 2FF4A 4HQMA 3EDPA 4AIKA 2YPRA 3KP5A 2K7LA 4WK8F 2OD5A 1G3SA 4HLYA 1ZH5A 2H94A 5ICGA 3ZQ7A 4OIOF 1ULYA 1SFXA 5FLXK 5FB2A 3SFZA 4CO8A 2QZ8A 1XGNA 1U5TB 1XDUA 1QZYA 3KETA 4CDGA 4U0WA 3HOTA 3KP7A 2WWYA 1DP7P 1YTYA 2XIGA 5H20A 3HRSA 2HOEA 3DKWA 3ZMUA 1HSJA 3GXOA 4H0EA 4MTEA 1PUEE 2W84A 2QQBA 2Q8KA 2HKXA 4L0YB 2FMYA 5DD4A 4P9FA 1Z1DA 5DCFA 1YO5C 3QRFF 4ZYHA 5IT9Z 5D8LB 1T6SA 2MBFA 1BC8C 3LQRA 1Z9CA 1H9GA 1Z6RA 3WTZA 1L3LA 1FX7A 2XAFA 2Y0MA 3JSOA 1WWXA 2LKPA 2MD5A 1V4RA 3CTAA 1PP8F 1G3YA 5DEQA 2STWA 2NS0A 4RB0A 2CWEA 2O6GE 1ZRCA 2A07F 2O61A 4N9IA 3L2CA 1W5TA 2PQ8A 3FMQA 3C18A 5BMZA 3ZMVA 5J6XA 3P9CA 3RKWA 3ERED 1HKQA 1IN7A 4HF1A 1SFEA 3KEQA 1LDKB 1RUNA 4IRGA 5D5XB 2UXNA 2F2EA 2XAQA 2WV0A 1R1UA 1BIAA 1B1BA 1R00A 3ZP5A 1KQ8A 2HGCA 5D4RA 1R5GA 1YYVA 4EVIA 4A0YA 4HQEA 4ZH4F 1HBXG 4FHTA 2BE5F 4HDUA 2A68F 3M8FA 5HLGA 1KU2A 4EQQA 4LB6B 2V6CA 5EEGA 4M72A 3F8NA 3LAJA 1DPRA 4G94A 1BI0A 2UXXA 3V7RA 2E7WA 4P96A 2H09A 1O3RA 3F8BA 3BJOA 3TOBA 2ACJA 2BYVE 1MDMA 1ZGJA 5ICFA 4ZZLA 2DO7A 5LGUA 3B02A 2JPCA 1YLFA 1TW2A 3RYRA 3H3ZA 2BV6A 3BPVA 5BPDA 4ASNA 3JAMZ 2GZWA 1IN8A 1AWCA 2V1XA 1I6XA 1XSDA 2VOOA 2Z5UA 3HSFA 3O3KA 1D3YA 4PZJA 3ZPLA 5HDGA 5E18F 1O3QA 1QGPA 2IW5A 5HVQC 3DF8A 5L3DA 3KP3A 1OPCA 2IA2A 3BWGA 1BOAA 3MCZA 4WXHA 2F5CA 4ESFA 2D1VA 2VBXA 2IA1A 3VEPA 1Z05A 4UV8A 1ZG1A 2OAZA 3FM3A 1U78A 4XLNF 1I1SA 4OIPF 3E3VA 1CF7A 5HDNA 3ZMZA 3WGHA 5CVIA 3GZ6A 1UHMA 1XMAA 2IPQX 4ETSA 3V8JA 1Q1HA 2BGCA 2VT3A 3J81Z 5KVRA 1E2XA 4HBLA 1T2KA 1HKSA 2GA2A 5F6FA 3ABUA 4L9NA 1ZRDA 3BDDA 3LA2A 1MGTA 3J80K 2CO5A 1CGPA 2A3SA 1ZGAA 2LF7A 3QAHA 5ICCA 3WTYC 1R58A 2P5LC 4M6YA 2GAUA 1TQMA 1U5TA 3GYHX 2P5KA 3HSEA 2PN6A 1IRFA 2PBIA 3FXUA 2ZJ2A 1YS6A 5BPIA 5H6QA 4KNYA 4LJZF 2KRFA 3RYPA 3V7CA 4RGRA 4KDPA 4S04A 4MHGA 4WCGA 2F5FA 1FC3A 2ZKZA 4KYWA 5H6RA 2KJBA 1QZZA 1OYIA 1HSTA 4LGWA 1S8NA 3FXQA 3KZYA 1AOYA 5CJ9A 1ZLJA 3T0YA 1ZHFA 3QU3A 2DK5A 2HFHA 3M8EA 2W25A 2AS5F 4I0BA 2XROA 4G7HF 4UUVA 1FZPB 4KIGA 1OR7A 1S7AA 2J5PA 2YR2A 1FBSA 3HRMA 2BBYA 4KMFA 2CQKA 2NYXA 2QENA 4Y13A 5LLQA 4U7DA 3K1NA 1I5ZA 3R0JA 5ED4A 4XRFA 2EWNA 2LNBA 3KZZA 3R60A 1QNTA 1U8RA 3I5UA 3GO5A 5DUKA 1FYKA 1FNNA 1B9MA 4B09A 1W5SA 2R7DA 1IN5A 1R1TA 4HF0A 1HW5A 3IWZA 3WGGA 1EV7A 3IKVA 5LHGA 4HV6A 4BYYA 4PDKA 2CG4A 2G9WA 3GFJA 1XGMA 3CUQC 2MLKA 1XN7A 5AIQA 4WX9A 3EYIA 2DK8A 2M45A 3QPTA 4G7ZF 4UHTA 1D5VA 3HHHA 3WGIA 1PP7U 4AVPA 3R0AA 3WTWC 3HRTA 4I98B 1C0WA 3FM5A 4I01A 1MDMB 2P7VB 1YFHA 5ILUA 2FBIA 4BNCA 1KU7A 3K9TA 5CYVA 2EV0A 1L0OC 4UVAA 2O3FA 3J7AO 2FEZA 2VN2A 1ZLKA 3L09A 1OYYA 2TDXA 3SQNA 4JK1X 1FYLA 3KCCA 4YFKF 1J75A 3N97A 2FSWA 4AIJA 2IP2A 2M30A 3I54A 2HKOA 1TNSA 2EJRA 4U0YA 1XDSA 2DT5A 4CHUA 2RKHA 3IKTA 4TV7A 2VONA 3HTSB 1GXQA 2X0LA 1EH7A 1S7OA 3RDIA 3WU0A 1G4DA 6PAXA 4ON0A 3GWZA 1XB4A 4HYEA 2H6BA 1IN6A 4O3MA 5L3CA 3CUOA 3O2PE 4HLXA 2DI3A 1R22A 2RDPA 3U2RA 3U1DA 1JHHA 5A2QK 1LDJA 5JR3A 2Q2EA 4ZYDA 2FU4A 3KFWX 4L9VA 3IL2A 3F8CA 2ELHA 3VFZA 3I4PA 3MZHA 1IXRC 1I1GA 1T38A 2MH9A 4KICA 2EFNA 5EEHA 2ZFWA 2IJLA 4IXAA 4EGZA 2GXGA 1P6RA 3F22A 1O3SA 4GGGA 1T39A 4Y17A 2STTA 4I2OA 2F5DA 1QPMA 3E97A 1RIOH 4AIHA 1FOKA 5ILSA 3CO6C 2P5VA 2ZXJA 4EJOA 4A0XA 4XLPF 2ISZA 3BROA 2DW4A 3EETA 4HW0A 1UCRA 5TRDA 4UNOA 3JTGA 1B59A 2L02A 4AWXB 3LFKA 2ESHA 5D5UB 1IXSB 3FZVA 5FLXZ 4M71A 3TGNA 1VTNC 1F9NA 5FD6A 1SD5A 2V1UA 1Z6TA 2OBPA 3I71A 1E17A 1P4XA 2XUBA 1MJAA 1IN4A 4P9UA 4YG2F 1HXDA 1YW7A 2EB7A 2XAGA 5LRSA 4ENNA 1WQ2A 4BHPA 3ECOA 2H27A 1U6GA 2O0YA 1FP1D 1LDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU2 A;  2Z33 A;  3D5L A;  3VB2 A;  1K78 A;  2VC1 A;  4HZF A;  2HYG D;  1FWZ A;  2X4H A;  2OA4 A;  4KT5 C;  4RB1 A;  3E6C C;  4RAZ A;  1FBQ A;  1ZAO A;  2PG4 A;  4PGH A;  2FXA A;  4LMY A;  1JGS A;  2G7H A;  4FT8 A;  4LG0 A;  4F7Z A;  4R8H A;  1RUO A;  1YS7 A;  2J5O A;  2MLG A;  5FO5 A;  2ZME A;  2M8E A;  2K4B A;  5KK1 A;  4IRI A;  5HS8 A;  2ESN A;  1J2X A;  2EFQ A;  4L5I A;  3M9A A;  3GFM A;  2FE3 A;  1LEB A;  2ZCW A;  1D8K A;  3GW2 A;  2W24 A;  3BY6 A;  4OU0 A;  4DQ2 A;  4Q5S F;  2MH2 A;  3HTU A;  2L3D A;  4IRH A;  1BI1 A;  3FMS A;  3HOS A;  3KP4 A;  4LLL A;  2QLZ A;  2OZ6 A;  4KMU X;  4M9X A;  3C3W A;  3V4G A;  2D2W A;  2EV6 A;  3WTU C;  1W7P A;  2DTR A;  1KU9 A;  1KQ9 A;  4EM1 A;  2E7X A;  4L9J A;  2HTS A;  2FA5 A;  3HRU A;  2ADU A;  3ZMD A;  1HKT A;  2QBY A;  1I27 A;  5E1X A;  5L3E A;  3P9I A;  3M1E A;  4EM2 A;  3KLN A;  4LLN A;  5E8I A;  2CGP A;  4G6Q A;  4EGY A;  3FF5 A;  4GO1 A;  3AAF A;  4DNC A;  1P4A A;  3W6K B;  3SZT A;  3ECH A;  1P4W A;  4I0A A;  3CUQ A;  2HWV A;  3TQN A;  1HW1 A;  1TW3 A;  2QM3 A;  1LVA A;  4BHB A;  3VOD A;  1REP C;  1X3U A;  4RB2 C;  3BJ6 A;  2XAH A;  2XHK A;  1J0R A;  4ESJ A;  2VC0 A;  3ML6 A;  2EK5 A;  3L00 A;  1KYW A;  2Z99 A;  2DQR A;  3P7N A;  1MD0 A;  5LEK A;  1DPU A;  2DQL A;  5FD5 A;  1G6N A;  2K02 A;  4ENM A;  5LHI A;  1MJB A;  1ODD A;  4N0B A;  3TDU C;  1HW2 A;  3DEU A;  4IHS A;  2DLL A;  1UB9 A;  5LHH A;  4OMY A;  4GCV A;  4RAY A;  3ZMT A;  2E1N A;  2LF8 A;  1G3T A;  1K6O A;  2WTE A;  5JI6 A;  4G6D A;  1W7P D;  5E17 F;  4A5M A;  1HQC A;  1K7A A;  3IC7 A;  2A69 F;  4HA8 A;  5CVV A;  2GQQ A;  2H6C A;  1IF1 A;  2FRH A;  4D0P A;  3C1D A;  2DAO A;  1UHW A;  2O03 A;  2EFO A;  1JHF A;  2XRN A;  3GF2 A;  5E1W A;  4LFU A;  1B6A A;  5CVR A;  3J80 Z;  3BJA A;  5D8K B;  3REO A;  1BN5 A;  4XSZ F;  4K2E A;  1DUX C;  3I58 A;  3GFL A;  2QQA A;  1V3F A;  4HX7 A;  3K1M A;  4I7H A;  1MZB A;  3F6O A;  4KFC A;  4EMS A;  1XD7 A;  1SMY F;  5DCM A;  2V1D A;  5CVU A;  2KJC A;  4A6E A;  3TOA A;  2VBZ A;  3CO7 C;  1O57 A;  5DV5 A;  3CDH A;  2HQR A;  3GVA A;  2HEO A;  2EFW A;  5BOX A;  1K78 B;  1FLI A;  2VE8 A;  3H3U A;  5D6F A;  1IUY A;  3COA C;  2RV8 A;  3W6J B;  4PGG A;  2P6S A;  1ZRE A;  4UVB A;  2KIU A;  2P4W A;  3HIF A;  1OYW A;  4UVC A;  2RN7 A;  1MKM A;  3F3X A;  2MC3 A;  2Q0O A;  4KIF A;  4LG0 B;  5E20 A;  2GXB A;  2OZU A;  3E5X A;  2ZME B;  2LSO A;  2XAS A;  3R4K A;  1B4A A;  5HLI A;  3KE2 A;  2XVC A;  1XSX A;  2CFX A;  5TJJ A;  3GEZ A;  4MQV A;  4EJU A;  2PLY A;  2V9V A;  1H9T A;  4MGR A;  3PQK A;  2FBH A;  5BQT A;  3WTX C;  3HSR A;  1Z91 A;  2GIV A;  4GYI A;  5K5Q A;  5DUI A;  2FBK A;  3LA7 A;  2M5W A;  4ZZD A;  4M9S A;  4KIB A;  2E1C A;  1BI2 A;  1W7P B;  3MQ0 A;  4MQ9 F;  3RJP A;  3FMR A;  1GXP A;  4LLG F;  4IPA A;  3ULQ B;  5DYM A;  2L54 A;  1BIB A;  3WE2 A;  4OIQ F;  2QBY B;  3KP2 A;  2NAZ A;  4AD9 A;  3BPX A;  3E5Q A;  5L3F A;  1KYZ A;  5K1Y A;  3QP6 A;  4CZZ A;  1LJ9 A;  3K1P A;  1NHA A;  4WXC A;  1J9I A;  1TQP A;  2QQ9 A;  1XCB A;  1H0M A;  2Z3Y A;  3MEX A;  1TQI A;  2FOK A;  3WU1 B;  2W57 A;  3B73 A;  1WSU A;  4P55 A;  3CUQ B;  3WOD F;  2XAJ A;  1OKR A;  3PQJ A;  3RKX A;  5D5W B;  1Y0U A;  2YX7 A;  2K27 A;  2IVM A;  3LST A;  3U9G A;  4Q4Z F;  1J59 A;  4U0V A;  3DXJ F;  2JTV A;  1BI3 A;  1G3W A;  4UV9 A;  1LEA A;  3D0S A;  4Q47 A;  3DPL C;  1ZAR A;  1R7J A;  1S3J A;  4M74 A;  1MJ9 A;  4ZYE A;  2VOP A;  4BH9 A;  2CW0 F;  3OV8 A;  4E70 A;  4RGS A;  3MZY A;  1JE8 A;  1WI9 A;  5LGN A;  2HS5 A;  3TDZ C;  1K79 A;  2EFP A;  4O6J A;  2EA4 A;  3ISP A;  5A2Q Z;  2QYO A;  5D4S A;  4U88 A;  2PMH A;  4Q48 A;  5HS9 A;  3MAJ A;  2YU3 A;  3NRV A;  3GX4 X;  1O7F A;  3M7G A;  3RIR A;  4IHT A;  4NB5 A;  1YQA A;  3C7J A;  4KN7 X;  1DDN A;  3TKY A;  5IT9 K;  3ELK A;  3JTH A;  2R7F A;  1XMK A;  5F64 A;  3SXY A;  3K0L A;  3RTR A;  5FFX A;  5AIP A;  5BS6 A;  3G3Z A;  1KU3 A;  4HX4 A;  2A61 A;  5HS7 A;  1U3E M;  3GLX A;  4CXF A;  1S6L A;  4MTD A;  4IF4 A;  3EQL F;  3VOE A;  5JHU A;  4A0Z A;  4M6X A;  5DCM B;  4A2U A;  2FNP A;  5JVT A;  2GA1 A;  4KA4 A;  1XCV A;  4OOI A;  2FQ3 A;  4KUM A;  4EV0 A;  1LB2 A;  1YIO A;  4HV5 A;  4S05 A;  2HDC A;  5ILV A;  1R5H A;  3Q5F A;  2XV4 S;  1TBX A;  4M9Z A;  3TO9 A;  2IRF G;  2M1B A;  4ENJ A;  4NHJ A;  4RS8 A;  2G7U A;  3RPQ A;  3CJN A;  3RI4 A;  3I64 A;  1F1Z A;  1BM9 A;  2NNY A;  2P8T A;  3T5X A;  2F5E A;  3FHZ A;  3N4M A;  1SD6 A;  4R1H A;  3NQO A;  2YX4 A;  2FML A;  2QUF A;  1S29 A;  4BAY A;  3GUD A;  1TTY A;  1YW8 A;  3QU6 A;  4U7B A;  3E5U A;  1RNL A;  4LK0 F;  5LBQ A;  3TO7 A;  3PFI A;  1ZG5 A;  3IHU A;  4I09 A;  1XGO A;  3I0T A;  3DV8 A;  2XKP A;  4CYD A;  1RI7 A;  2HTJ A;  5CVJ A;  2VOD A;  3HHG A;  4MEY F;  3DPT A;  2L4M A;  4UXN A;  1ON1 A;  4G9Y A;  3RKY A;  1F4K A;  2QVO A;  1FPQ A;  4G8X A;  4LB5 A;  5DD8 A;  2IA0 A;  2P7C B;  5L3B A;  2M87 A;  3T1B A;  5E8G A;  3JAM K;  2YSR A;  1RZ4 A;  2RVC A;  2OQG A;  3E6B A;  3L7W A;  4JQF A;  2NNN A;  3BZ6 A;  4NQW A;  3ZN1 A;  2A6H F;  3F72 A;  2ZNY A;  4WWC A;  1FSE A;  5LEJ A;  5LRR A;  3H92 A;  2BEO A;  3RPU A;  1IW7 F;  2Y48 A;  3LAP A;  4B8X A;  1J7K A;  1EH6 A;  2DFI A;  3V8K A;  4PCQ A;  1UFM A;  3V7S A;  1T0F A;  4L18 B;  1Z7U A;  1FBU A;  2COM A;  2P6T A;  2RGV A;  3EYY A;  3GZ5 A;  3F23 A;  5F1R A;  1KGS A;  1STZ A;  2KIM A;  3QP5 A;  2NRA C;  1LNW A;  4QLC U;  5HDK A;  2KIF A;  2L01 A;  2R3S A;  1IZ1 A;  1O3T A;  4CGZ A;  4EM0 B;  3BOQ A;  4ESB A;  2HZT A;  4LK1 F;  2CSO A;  3F8M A;  3F8F A;  3K69 A;  4FX4 A;  3LA3 A;  1TLH B;  2L4A A;  3J81 K;  2GWR A;  3I59 A;  5ERI A;  1FYM A;  4YII A;  4RGU A;  2K86 A;  2PMU A;  2DU9 A;  1OMI A;  4M73 A;  2B0L A;  3ROU A;  4RB3 C;  4A12 A;  1QQI A;  1BJA A;  1GVJ A;  1R1V A;  4A6D A;  2CYY A;  4WF2 A;  3IWF A;  4I02 A;  1WRJ A;  3MFK A;  4YFX F;  2JPB A;  2K4J A;  4KN4 X;  2ZO4 A;  2A5Y B;  4HOB A;  5DDG A;  4MNU A;  1ZYR F;  3R6S A;  1FSH A;  2W85 A;  5IT3 A;  3WTV C;  2ISY A;  3SZP A;  2RNJ A;  4LD5 A;  1QBJ A;  5JFR A;  1JXS A;  3JW4 A;  2C6Y A;  4N9H A;  2IT0 A;  1FP2 A;  5HOO A;  4GYG A;  4A5N A;  3FXR A;  3WTT C;  4IVN A;  2D1H A;  3ABT A;  3G73 A;  1IXC A;  3LQQ A;  4JBA A;  4BXU A;  1T98 A;  4HDV A;  2JZY A;  2FNA A;  2DBB A;  4QWQ A;  2MA3 A;  3SHF A;  4BHC A;  3FWE A;  1P2F A;  3JSP A;  4O5V A;  1TNT A;  1D8J A;  4ENK A;  4Z2Y A;  4P5O A;  5LGT A;  4HF2 A;  1YW9 A;  2VT2 A;  2QWW A;  2D45 A;  4CIC A;  4EJW A;  2RQP A;  2XKO A;  2PEX A;  3S2W A;  1USS A;  4HAM A;  1KA8 A;  2EV5 A;  3KP6 A;  3IRQ A;  2Z9O A;  3KEO A;  4L0Z B;  1BC7 C;  3DQV C;  2DPU A;  3LWF A;  1O7L A;  3R61 A;  2PI0 A;  1GHC A;  3F6V A;  3QOP A;  4EJV A;  3WG9 A;  4YIF A;  2KKO A;  4ZYG A;  5FGM A;  5D5V B;  2PFB A;  3QPH A;  1IRG A;  5D6E A;  1R23 A;  5E1Z B;  1FT9 A;  4XSX F;  4IJA A;  2ZNZ A;  2A6E F;  2JT1 A;  1ZRF A;  1ONV A;  3E6M A;  4RGX A;  3Q9V A;  3TO6 A;  3T8T A;  3BP8 A;  4YFN F;  2JSC A;  2WC2 A;  1YG2 A;  4HX8 A;  1BBY A;  3L9F A;  2ETH A;  1J5Y A;  3DFG A;  1XGS A;  3HYI A;  2DPD A;  3FX3 A;  3WE3 A;  3GFI A;  4L9T A;  3OOP A;  2EA2 A;  1SAX A;  3DP7 A;  2HQN A;  3MWM A;  1F5T A;  3CLO A;  1QO0 D;  3KLO A;  4Y15 A;  1SD7 A;  1U2W A;  5HLH A;  2VXZ A;  2Y75 A;  4FX0 A;  3Q9S A;  4OMZ A;  2UZK A;  3WTS C;  2JRT A;  1ZN2 A;  4R79 A;  2HYF A;  1B9N A;  3NEU A;  5K5R A;  4OIN F;  5J8F A;  3F21 A;  2ZBK A;  2OQR A;  1SFU A;  4XBF A;  2XGX A;  1KQ0 A;  3K2Z A;  3ZMS A;  1FY7 A;  2O8X A;  1A04 A;  2VE9 A;  3IRR A;  3E6D A;  4MEX F;  1U5T C;  4OIR F;  1UST A;  2AXL A;  2LDU A;  2VBY A;  5ICE A;  1PDN C;  3O6B B;  2HR3 A;  3I59 B;  3P9K A;  5AON A;  1SD4 A;  4WXD A;  5J8C A;  4L5J A;  2UWM A;  4G7O F;  1LQ1 A;  3EUH A;  3I53 A;  1R36 A;  3ZN0 A;  1EH8 A;  1ZG3 A;  5FFZ A;  2V79 A;  1WKM A;  1W4M A;  3V8L A;  2VBW A;  2RC4 A;  1SMT A;  3T8R A;  4EJT A;  1CF7 B;  1XSV A;  5CLS A;  5K5O A;  1P92 A;  1IAW A;  3HUG A;  2PJP A;  5L3G A;  4GXO A;  1ON2 A;  4BQA A;  2FF4 A;  4HQM A;  3EDP A;  4AIK A;  2YPR A;  3KP5 A;  2K7L A;  4WK8 F;  2OD5 A;  1G3S A;  4HLY A;  1ZH5 A;  2H94 A;  5ICG A;  3ZQ7 A;  4OIO F;  1ULY A;  1SFX A;  5FLX K;  5FB2 A;  3SFZ A;  4CO8 A;  2QZ8 A;  1XGN A;  1U5T B;  1XDU A;  1QZY A;  3KET A;  4CDG A;  4U0W A;  3HOT A;  3KP7 A;  2WWY A;  1DP7 P;  1YTY A;  2XIG A;  5H20 A;  3HRS A;  2HOE A;  3DKW A;  3ZMU A;  1HSJ A;  3GXO A;  4H0E A;  4MTE A;  1PUE E;  2W84 A;  2QQB A;  2Q8K A;  2HKX A;  4L0Y B;  2FMY A;  5DD4 A;  4P9F A;  1Z1D A;  5DCF A;  1YO5 C;  3QRF F;  4ZYH A;  5IT9 Z;  5D8L B;  1T6S A;  2MBF A;  1BC8 C;  3LQR A;  1Z9C A;  1H9G A;  1Z6R A;  3WTZ A;  1L3L A;  1FX7 A;  2XAF A;  2Y0M A;  3JSO A;  1WWX A;  2LKP A;  2MD5 A;  1V4R A;  3CTA A;  1PP8 F;  1G3Y A;  5DEQ A;  2STW A;  2NS0 A;  4RB0 A;  2CWE A;  2O6G E;  1ZRC A;  2A07 F;  2O61 A;  4N9I A;  3L2C A;  1W5T A;  2PQ8 A;  3FMQ A;  3C18 A;  5BMZ A;  3ZMV A;  5J6X A;  3P9C A;  3RKW A;  3ERE D;  1HKQ A;  1IN7 A;  4HF1 A;  1SFE A;  3KEQ A;  1LDK B;  1RUN A;  4IRG A;  5D5X B;  2UXN A;  2F2E A;  2XAQ A;  2WV0 A;  1R1U A;  1BIA A;  1B1B A;  1R00 A;  3ZP5 A;  1KQ8 A;  2HGC A;  5D4R A;  1R5G A;  1YYV A;  4EVI A;  4A0Y A;  4HQE A;  4ZH4 F;  1HBX G;  4FHT A;  2BE5 F;  4HDU A;  2A68 F;  3M8F A;  5HLG A;  1KU2 A;  4EQQ A;  4LB6 B;  2V6C A;  5EEG A;  4M72 A;  3F8N A;  3LAJ A;  1DPR A;  4G94 A;  1BI0 A;  2UXX A;  3V7R A;  2E7W A;  4P96 A;  2H09 A;  1O3R A;  3F8B A;  3BJO A;  3TOB A;  2ACJ A;  2BYV E;  1MDM A;  1ZGJ A;  5ICF A;  4ZZL A;  2DO7 A;  5LGU A;  3B02 A;  2JPC A;  1YLF A;  1TW2 A;  3RYR A;  3H3Z A;  2BV6 A;  3BPV A;  5BPD A;  4ASN A;  3JAM Z;  2GZW A;  1IN8 A;  1AWC A;  2V1X A;  1I6X A;  1XSD A;  2VOO A;  2Z5U A;  3HSF A;  3O3K A;  1D3Y A;  4PZJ A;  3ZPL A;  5HDG A;  5E18 F;  1O3Q A;  1QGP A;  2IW5 A;  5HVQ C;  3DF8 A;  5L3D A;  3KP3 A;  1OPC A;  2IA2 A;  3BWG A;  1BOA A;  3MCZ A;  4WXH A;  2F5C A;  4ESF A;  2D1V A;  2VBX A;  2IA1 A;  3VEP A;  1Z05 A;  4UV8 A;  1ZG1 A;  2OAZ A;  3FM3 A;  1U78 A;  4XLN F;  1I1S A;  4OIP F;  3E3V A;  1CF7 A;  5HDN A;  3ZMZ A;  3WGH A;  5CVI A;  3GZ6 A;  1UHM A;  1XMA A;  2IPQ X;  4ETS A;  3V8J A;  1Q1H A;  2BGC A;  2VT3 A;  3J81 Z;  5KVR A;  1E2X A;  4HBL A;  1T2K A;  1HKS A;  2GA2 A;  5F6F A;  3ABU A;  4L9N A;  1ZRD A;  3BDD A;  3LA2 A;  1MGT A;  3J80 K;  2CO5 A;  1CGP A;  2A3S A;  1ZGA A;  2LF7 A;  3QAH A;  5ICC A;  3WTY C;  1R58 A;  2P5L C;  4M6Y A;  2GAU A;  1TQM A;  1U5T A;  3GYH X;  2P5K A;  3HSE A;  2PN6 A;  1IRF A;  2PBI A;  3FXU A;  2ZJ2 A;  1YS6 A;  5BPI A;  5H6Q A;  4KNY A;  4LJZ F;  2KRF A;  3RYP A;  3V7C A;  4RGR A;  4KDP A;  4S04 A;  4MHG A;  4WCG A;  2F5F A;  1FC3 A;  2ZKZ A;  4KYW A;  5H6R A;  2KJB A;  1QZZ A;  1OYI A;  1HST A;  4LGW A;  1S8N A;  3FXQ A;  3KZY A;  1AOY A;  5CJ9 A;  1ZLJ A;  3T0Y A;  1ZHF A;  3QU3 A;  2DK5 A;  2HFH A;  3M8E A;  2W25 A;  2AS5 F;  4I0B A;  2XRO A;  4G7H F;  4UUV A;  1FZP B;  4KIG A;  1OR7 A;  1S7A A;  2J5P A;  2YR2 A;  1FBS A;  3HRM A;  2BBY A;  4KMF A;  2CQK A;  2NYX A;  2QEN A;  4Y13 A;  5LLQ A;  4U7D A;  3K1N A;  1I5Z A;  3R0J A;  5ED4 A;  4XRF A;  2EWN A;  2LNB A;  3KZZ A;  3R60 A;  1QNT A;  1U8R A;  3I5U A;  3GO5 A;  5DUK A;  1FYK A;  1FNN A;  1B9M A;  4B09 A;  1W5S A;  2R7D A;  1IN5 A;  1R1T A;  4HF0 A;  1HW5 A;  3IWZ A;  3WGG A;  1EV7 A;  3IKV A;  5LHG A;  4HV6 A;  4BYY A;  4PDK A;  2CG4 A;  2G9W A;  3GFJ A;  1XGM A;  3CUQ C;  2MLK A;  1XN7 A;  5AIQ A;  4WX9 A;  3EYI A;  2DK8 A;  2M45 A;  3QPT A;  4G7Z F;  4UHT A;  1D5V A;  3HHH A;  3WGI A;  1PP7 U;  4AVP A;  3R0A A;  3WTW C;  3HRT A;  4I98 B;  1C0W A;  3FM5 A;  4I01 A;  1MDM B;  2P7V B;  1YFH A;  5ILU A;  2FBI A;  4BNC A;  1KU7 A;  3K9T A;  5CYV A;  2EV0 A;  1L0O C;  4UVA A;  2O3F A;  3J7A O;  2FEZ A;  2VN2 A;  1ZLK A;  3L09 A;  1OYY A;  2TDX A;  3SQN A;  4JK1 X;  1FYL A;  3KCC A;  4YFK F;  1J75 A;  3N97 A;  2FSW A;  4AIJ A;  2IP2 A;  2M30 A;  3I54 A;  2HKO A;  1TNS A;  2EJR A;  4U0Y A;  1XDS A;  2DT5 A;  4CHU A;  2RKH A;  3IKT A;  4TV7 A;  2VON A;  3HTS B;  1GXQ A;  2X0L A;  1EH7 A;  1S7O A;  3RDI A;  3WU0 A;  1G4D A;  6PAX A;  4ON0 A;  3GWZ A;  1XB4 A;  4HYE A;  2H6B A;  1IN6 A;  4O3M A;  5L3C A;  3CUO A;  3O2P E;  4HLX A;  2DI3 A;  1R22 A;  2RDP A;  3U2R A;  3U1D A;  1JHH A;  5A2Q K;  1LDJ A;  5JR3 A;  2Q2E A;  4ZYD A;  2FU4 A;  3KFW X;  4L9V A;  3IL2 A;  3F8C A;  2ELH A;  3VFZ A;  3I4P A;  3MZH A;  1IXR C;  1I1G A;  1T38 A;  2MH9 A;  4KIC A;  2EFN A;  5EEH A;  2ZFW A;  2IJL A;  4IXA A;  4EGZ A;  2GXG A;  1P6R A;  3F22 A;  1O3S A;  4GGG A;  1T39 A;  4Y17 A;  2STT A;  4I2O A;  2F5D A;  1QPM A;  3E97 A;  1RIO H;  4AIH A;  1FOK A;  5ILS A;  3CO6 C;  2P5V A;  2ZXJ A;  4EJO A;  4A0X A;  4XLP F;  2ISZ A;  3BRO A;  2DW4 A;  3EET A;  4HW0 A;  1UCR A;  5TRD A;  4UNO A;  3JTG A;  1B59 A;  2L02 A;  4AWX B;  3LFK A;  2ESH A;  5D5U B;  1IXS B;  3FZV A;  5FLX Z;  4M71 A;  3TGN A;  1VTN C;  1F9N A;  5FD6 A;  1SD5 A;  2V1U A;  1Z6T A;  2OBP A;  3I71 A;  1E17 A;  1P4X A;  2XUB A;  1MJA A;  1IN4 A;  4P9U A;  4YG2 F;  1HXD A;  1YW7 A;  2EB7 A;  2XAG A;  5LRS A;  4ENN A;  1WQ2 A;  4BHP A;  3ECO A;  2H27 A;  1U6G A;  2O0Y A;  1FP1 D;  1LDD A; 
#chains in the Genus database with same CATH topology
 2LBF B;  2OU2 A;  2IGK A;  4ABZ A;  1FIA A;  4P1W A;  2Z33 A;  4AC0 A;  3D5L A;  3PO2 J;  3VB2 A;  1K78 A;  4V2F A;  2VC1 A;  3OR2 C;  4HZF A;  4F93 B;  2HYG D;  1FWZ A;  2X4H A;  3HJE A;  2OA4 A;  4KT5 C;  3P5J A;  1P7I A;  4RB1 A;  3E6C C;  4RAZ A;  1FBQ A;  3GTJ J;  4CCM A;  3IAS 2;  1ZAO A;  2PG4 A;  1X3Z B;  2IGO A;  4PGH A;  2FXA A;  2XDV A;  4LMY A;  1JGS A;  2G7H A;  4FT8 A;  3HDD A;  4YRV A;  1UHS A;  1JT6 A;  2X1C A;  2QCO A;  1X1A A;  2NS7 A;  4LG0 A;  4F7Z A;  1YJW I;  1UAA A;  4R8H A;  1RUO A;  1YS7 A;  2J5O A;  2MLG A;  5FO5 A;  2L7F P;  2GIZ A;  2ZME A;  2M8E A;  1JTX A;  2K4B A;  2Z16 A;  5KK1 A;  2LRD A;  3BT9 A;  4IRI A;  5HS8 A;  4D9J A;  1BR4 A;  2ESN A;  1ZGW A;  1J2X A;  2EFQ A;  4L5I A;  3HC7 A;  3M9A A;  2OPT A;  3GFM A;  4LOC A;  2FE3 A;  4E7I A;  4IO9 F;  1LEB A;  2QKL B;  2ZCW A;  1D8K A;  4BJ5 C;  3GW2 A;  3NWS A;  4QIW N;  4AYB A;  3SJM A;  2TCT A;  2W24 A;  2F6C A;  1BJZ A;  3BY6 A;  4OU0 A;  1ZK8 A;  2M4K A;  4DQ2 A;  4Q5S F;  1D1C A;  2MH2 A;  3HTU A;  2L3D A;  1GVD A;  4IRH A;  1H8A C;  2MYS A;  3ZR8 X;  1BI1 A;  1HOM A;  1RRJ A;  3UNG C;  2V9K A;  3FMS A;  3HOS A;  3KP4 A;  5C4X J;  4LLL A;  2DMN A;  3QWL A;  2IS1 A;  2QLZ A;  2W7N A;  4XMY A;  3G6E I;  1JJ6 C;  1MMN A;  2OZ6 A;  3HZJ A;  5F1J A;  2DA4 A;  4KMU X;  1OCO H;  3C3W A;  4M9X A;  3V4G A;  1JKR C;  2D2W A;  2EV6 A;  3WTU C;  1W7P A;  4I76 A;  2DTR A;  1KU9 A;  2M4G A;  2CS3 A;  4NDL A;  3RSN A;  3NAU A;  1KQ9 A;  4HRI A;  4EM1 A;  1I39 A;  1GLN A;  4RBO A;  3N05 A;  1D5Y A;  4XOP A;  2VXD A;  2E7X A;  3QPS A;  2HTS A;  4L9J A;  3RQI A;  2FA5 A;  2QA4 I;  3HRU A;  5EYR A;  2ADU A;  3ONQ A;  3ZMD A;  2O9L A;  1HKT A;  1UEL B;  1VQL I;  2QBY A;  2KIQ A;  1I27 A;  1ORK A;  5E1X A;  1MNM C;  5L3E A;  4M3E A;  5EDN A;  2CV1 A;  1RKT A;  3P9I A;  1RC9 A;  4HNT A;  4KIS A;  1HCR A;  3M1E A;  2VL8 A;  2XSJ C;  3DWL E;  4EM2 A;  3SDB A;  3KLN A;  3IV5 A;  4LLN A;  5E8I A;  2CGP A;  5GPA A;  4BDY A;  1I50 J;  2DA1 A;  3LSH A;  4G6Q A;  1U9N A;  4EGY A;  1SAU A;  3BR5 A;  1SEU A;  3FF5 A;  3AL0 C;  1ETO A;  3ABK H;  2JQ7 A;  4GO1 A;  2JWT A;  5JLX A;  3AAF A;  4DNC A;  1VQ9 I;  1P4A A;  3W6K B;  4DOZ A;  3FXJ A;  3SZT A;  2MC4 A;  1T33 A;  2F4M B;  3ECH A;  3FK7 A;  1TC3 C;  2BY1 A;  3DKX A;  4KT6 A;  3G1L A;  1P4W A;  3X2Q H;  3L2V A;  3H5R A;  4I0A A;  1R9T J;  2XSD C;  3CUQ A;  2HWV A;  4EAT A;  4A69 C;  3TQN A;  1HW1 A;  1TW3 A;  2QM3 A;  3S8P A;  1LVA A;  4B1R A;  3J7A Y;  4BHB A;  3VOD A;  2HVQ A;  1MH4 A;  1REP C;  2KDZ A;  1X3U A;  2Q2E B;  1NK2 P;  4RB2 C;  3BJ6 A;  3OY9 A;  2XAH A;  2ECB A;  2XHK A;  1J0R A;  4ESJ A;  2VC0 A;  2CW8 A;  5IP9 J;  3S3M A;  3ML6 A;  1SAN A;  3KYD B;  2W48 A;  2EK5 A;  3L00 A;  2WAF A;  4ZC3 A;  1KYW A;  4IX7 A;  2Z99 A;  1BOB A;  3CDL A;  2DQR A;  3E7L A;  1U0J A;  3P7N A;  1MD0 A;  5LEK A;  2MD0 A;  3S14 J;  1DPU A;  2DQL A;  4M3B A;  1X1D A;  1QRY A;  5FD5 A;  4F92 B;  1G6N A;  2K02 A;  4ENM A;  5LHI A;  4RAF A;  3ZRG A;  1MJB A;  1ODD A;  4BXX J;  4N0B A;  3TDU C;  1HW2 A;  3GTO J;  1MBJ A;  3DEU A;  3K4N A;  2DLL A;  4IHS A;  1E0E A;  1UB9 A;  3LSJ A;  3PUB A;  4B48 A;  5LHH A;  4OMY A;  4GCV A;  4RAY A;  3ZMT A;  1YJN I;  4H4K C;  2E1N A;  2ZJR F;  1Z3Y A;  2LF8 A;  1G3T A;  1K6O A;  2WTE A;  5JI6 A;  3BCB A;  2BW3 A;  1XTA A;  4G6D A;  1W7P D;  5E17 F;  4A5M A;  1HQC A;  1K7A A;  5IOY A;  2E2H J;  3AL0 B;  1B72 B;  4CYC B;  3DBL B;  3IC7 A;  2A69 F;  3HKZ A;  4HA8 A;  5CVV A;  1WI3 A;  2DA5 A;  1A6I A;  2GQQ A;  2LC2 A;  2K3F A;  2E19 A;  2NVY J;  2H6C A;  3J7Z I;  3I9V 2;  4BEH B;  1IF1 A;  2FRH A;  1GV2 A;  4D0P A;  3C1D A;  2XF5 A;  1FOW A;  1WH7 A;  2DAO A;  2CFO A;  1UHW A;  2O03 A;  3HL2 A;  2EFO A;  1JHF A;  2XRN A;  3G71 I;  3MZ8 A;  3GF2 A;  5LD2 C;  3G1O A;  2B63 J;  2EIK H;  4B3X A;  2ZME C;  5E1W A;  2X9D A;  1VZ0 A;  5K7Z A;  4IQ4 A;  4LFU A;  2M2E A;  4RA2 A;  1B6A A;  1BW6 A;  2H1L A;  5CVR A;  5FRM A;  3J80 Z;  5F0H A;  3BJA A;  5D8K B;  1UJ8 A;  3REO A;  1BN5 A;  1TWH J;  4XLA A;  4XSZ F;  4AVZ A;  4K2E A;  1JKP C;  5IYC J;  1DUX C;  3I58 A;  1Y0N A;  3GFL A;  2KPM A;  2QQA A;  2FX0 A;  2RAE A;  3DBR B;  1V3F A;  5J1R A;  4HX7 A;  3QPL A;  2XB5 A;  3K1M A;  4I7H A;  4XOR A;  1MZB A;  3F6O A;  2ZSH B;  4A3M J;  2KRH A;  4KFC A;  4EMS A;  1BW5 A;  4M3D A;  3H9G A;  1XD7 A;  1ZEL A;  2DFE A;  1SMY F;  4QPQ A;  5DCM A;  2V1D A;  3GCM A;  5CVU A;  1MIJ A;  2KJC A;  4L5E A;  4A6E A;  3TOA A;  3L2R A;  2VBZ A;  2DOA A;  2A5W A;  2GOX B;  1Z0X A;  3CO7 C;  1O57 A;  1Y56 A;  5DV5 A;  5HLT A;  2IBD A;  4UUS B;  3BQZ A;  3CDH A;  4PFP A;  3M07 A;  2HQR A;  3GVA A;  2Y31 A;  3LSK A;  2DA6 A;  3JRB A;  2HEO A;  3LMM A;  2EFW A;  3FBN B;  5BOX A;  1K78 B;  2CV0 A;  1FLI A;  2VE8 A;  3H3U A;  3CC4 I;  5FKL A;  5D6F A;  3OYF A;  1IUY A;  3COA C;  4II3 A;  1PJR A;  2RV8 A;  4E7S A;  1IJW C;  3W6J B;  4Y3O A;  2KMU A;  3VYT B;  4PGG A;  2P6S A;  3CLQ A;  4UVB A;  1ZRE A;  2KIU A;  4RDU A;  2TRT A;  2P4W A;  3HIF A;  1OYW A;  1XC5 A;  2JA2 A;  2M34 A;  4W1U A;  2CW7 A;  2PMZ N;  4UVC A;  2RN7 A;  1MKM A;  3F3X A;  1D0Y A;  1TP4 A;  1IDZ A;  1N25 A;  2HNH A;  2MC3 A;  2Q0O A;  4KIF A;  5DM7 F;  4LG0 B;  4J01 A;  5E20 A;  5FLV A;  2GXB A;  2OZU A;  3E5X A;  3JR9 A;  2ZME B;  1RET A;  3U1K A;  2LSO A;  3SEZ A;  2YU9 J;  2HYJ A;  2JUC A;  2M3A A;  2XAS A;  3R4K A;  1B4A A;  5HLI A;  3A01 A;  5FKN A;  3KE2 A;  3OWT A;  3ZCO A;  1W0T A;  5IOZ A;  2XVC A;  1XSX A;  2CFX A;  3F9K A;  1WJD A;  3O8H A;  5TJJ A;  3GEZ A;  1MMG A;  1Z77 A;  1K61 A;  1POG A;  3D1N I;  4MQV A;  4EJU A;  2PLY A;  4DZP A;  5IP7 J;  4DBR A;  3I4N J;  5DTD A;  2V9V A;  2I8D A;  1H9T A;  3LSR A;  4RM2 A;  4MGR A;  1V54 H;  2QEX I;  3PQK A;  2MW8 A;  2FBH A;  5F04 A;  5BQT A;  1BL0 A;  3WTX C;  1CQT A;  3HSR A;  5J4Y A;  2R92 J;  3DCF A;  5B66 C;  1Z91 A;  2GIV A;  2IS4 A;  4GYI A;  5K5Q A;  3LSG A;  3M4O J;  1VQ8 I;  5DUI A;  3ABM H;  1VI0 A;  2FBK A;  3LA7 A;  3OYE A;  1QVU A;  2M5W A;  4ZDL A;  1Z3X A;  1TWF J;  4ZZD A;  4M9S A;  4KIB A;  2E1C A;  1BI2 A;  1W7P B;  2HQ5 A;  3MQ0 A;  4MQ9 F;  2Y0S A;  5GAG J;  4XRM A;  2HOS A;  3S32 A;  3RJP A;  3FMR A;  1FMV A;  1GXP A;  4LLG F;  4IPA A;  3BG9 A;  1MBG A;  3ULQ B;  5DYM A;  4BUP A;  2L54 A;  2XGD A;  1BIB A;  3WE2 A;  3CCY A;  4OIQ F;  1D1A A;  5TGT A;  2QBY B;  3KP2 A;  3J7Y J;  2AO9 A;  2EZL A;  5K7H A;  1OQY A;  2NAZ A;  3PSI A;  4AD9 A;  1JT0 A;  3BPX A;  3E5Q A;  2IEK A;  5L3F A;  4IOA F;  1KYZ A;  1TT0 A;  2VQL A;  1LFB A;  5K1Y A;  3QP6 A;  4CZZ A;  3A0H C;  2BVM A;  1LJ9 A;  4ZDO A;  4FTH A;  3K1P A;  1NHA A;  4WXC A;  1VND A;  1J9I A;  4ZTF A;  3OIO A;  1TQP A;  2QQ9 A;  1LKX A;  3QQA A;  1X2N A;  1XCB A;  1H0M A;  3VYR B;  2XPV A;  2Z3Y A;  1FJL A;  3MEX A;  2V6E A;  5KNL A;  3H5A A;  4AYB N;  4A3G J;  1TQI A;  3K6G A;  2FOK A;  2VQG A;  4F55 A;  1MND A;  3WU1 B;  2KHM A;  2W57 A;  3B73 A;  1WSU A;  1VQN I;  4OAY A;  3CCJ I;  4P55 A;  3L2W A;  3FXK A;  4XLH A;  1ACI A;  3CUQ B;  3WOD F;  4F52 A;  1Y6I A;  2KDO A;  2XAJ A;  1OKR A;  3PQJ A;  3RKX A;  5D5W B;  1Y0U A;  2VKV A;  3DU5 A;  2YX7 A;  5EZH A;  3QYB A;  2K27 A;  1G2H A;  3K4M A;  2IVM A;  3LST A;  3U9G A;  4XID A;  4Q4Z F;  1J59 A;  2D5V A;  4U0V A;  3DXJ F;  2JTV A;  1BI3 A;  5LFA A;  1G3W A;  4UV9 A;  3TP3 A;  2JVG A;  1LEA A;  4D7M A;  4C2U A;  3D0S A;  4Q47 A;  3DU6 A;  5EGO A;  4RLF A;  3RKQ A;  2BHZ A;  2K40 A;  3DPL C;  1ZAR A;  3LSM A;  1R7J A;  2WY8 Q;  1S3J A;  4M74 A;  2NS8 A;  1X4O A;  1MJ9 A;  4ZYE A;  2JN6 A;  2VOP A;  4BH9 A;  2JK3 A;  1QPI A;  2CW0 F;  3OV8 A;  3ZQQ A;  4RGS A;  4E70 A;  3MZY A;  4CCO A;  1JE8 A;  1Z21 A;  2IXS A;  1WI9 A;  4DW6 A;  2R5Z B;  5LGN A;  2HS5 A;  3TDZ C;  2LD5 A;  1K79 A;  2EFP A;  1VQ5 I;  2DTZ A;  4LIV A;  4O6J A;  2EA4 A;  3ISP A;  3JRD A;  5A2Q Z;  3CCE I;  1Y8Q B;  3OS1 A;  2BW3 B;  2QYO A;  4I6Z A;  4XON A;  5JVG F;  2JA7 J;  5K7F A;  5D4S A;  1SVO A;  2ZXW H;  3B6C A;  4U88 A;  2PMH A;  2OJE D;  4Q48 A;  4RMN A;  5HS9 A;  3MAJ A;  2YU3 A;  3NRV A;  3GX4 X;  1O7F A;  3M7G A;  4CYC A;  3HPH A;  2KZG A;  3CCM I;  2EH3 A;  3RIR A;  4IHT A;  4NB5 A;  1YQA A;  2COB A;  4A3D J;  3HGY A;  3CD6 I;  1ZKG A;  4M3F A;  3C7J A;  4KN7 X;  1DDN A;  3TKY A;  1ERD A;  2WAQ A;  5IT9 K;  1RPW A;  3LFU A;  1FTZ A;  2F4O B;  3ELK A;  3JTH A;  3AG3 H;  2R7F A;  1XMK A;  2PMZ A;  5F64 A;  3SXY A;  3K0L A;  3RTR A;  5FFX A;  3EUA A;  1NTC A;  1T95 A;  5AIP A;  3G3Z A;  5BS6 A;  3CCR I;  1KU3 A;  4HX4 A;  2A61 A;  3UKG A;  3H35 A;  3CCS I;  5HS7 A;  1EF4 A;  1U3E M;  3GLX A;  1X1C A;  2ELK A;  3ERM A;  4LG3 A;  3GME A;  1S6L A;  4CXF A;  4MTD A;  2L9V A;  4IF4 A;  3EQL F;  3VOE A;  3CCV I;  3W2V A;  5JHU A;  4A0Z A;  1F36 A;  4M6X A;  3OYA A;  5DCM B;  4A2U A;  1R5I D;  2FNP A;  5JVT A;  2MG4 A;  1MSF C;  4NC6 A;  2GA1 A;  2Y9Y A;  1XCV A;  4OOI A;  4KA4 A;  3ZQF A;  2FQ3 A;  4KUM A;  2R7Q A;  3HXL A;  3WHC A;  4A3J J;  1QHH D;  4EV0 A;  3W6V A;  1LB2 A;  1YIO A;  4HV5 A;  4S05 A;  4C3I J;  5BNG A;  2HDC A;  1OJL A;  1HC8 A;  5ILV A;  1R5H A;  3Q5F A;  2BHY A;  1KON A;  5F27 A;  2XV4 S;  1TBX A;  2LY9 A;  3HKZ N;  2KL4 A;  4M9Z A;  2XC7 A;  3PNV A;  3H0G J;  1MMD A;  3FXO A;  4XN3 A;  2X51 A;  3FKJ A;  3C2H A;  1XMX A;  2FQ4 A;  1ZR4 A;  3Q0V A;  3TO9 A;  3CCU I;  4PK4 A;  4CA0 A;  1VFC A;  3KX2 A;  2IRF G;  2M1B A;  3VDX A;  2R0Q C;  3DTI A;  5HNF A;  4ENJ A;  4NHJ A;  2L9S A;  4RS8 A;  2G7U A;  3RPQ A;  3CJN A;  4Y4R A;  1ETW A;  3RI4 A;  3I64 A;  1F1Z A;  1BM9 A;  4FE4 A;  5C3E J;  1NH3 A;  5J1Y A;  2NNY A;  4BQQ A;  2P8T A;  3T5X A;  2F5E A;  3FHZ A;  5TIS C;  3A01 B;  3N4M A;  4UY8 I;  1SD6 A;  2YUS A;  3SFI A;  4R1H A;  2CU7 A;  3NQO A;  2YX4 A;  2FML A;  2QUF A;  1S29 A;  3HOW J;  4BAY A;  4BY7 J;  3GUD A;  1TTY A;  1YW8 A;  2M0C A;  3HOX J;  1JI8 A;  3QU6 A;  4U7B A;  2LOO A;  2NVT J;  3E5U A;  1RNL A;  2E71 A;  4LK0 F;  5LBQ A;  2K5C A;  3TO7 A;  3OYG A;  3PFI A;  3FHN A;  1ZG5 A;  3IHU A;  2MFZ A;  4I09 A;  1XGO A;  1IV6 A;  3I0T A;  3DV8 A;  1FOY A;  2XKP A;  4CYD A;  2HVR A;  1RI7 A;  2HTJ A;  5M3M J;  5CVJ A;  2VOD A;  2HVS A;  3HHG A;  2IAI A;  4MEY F;  3JRC A;  1WJE A;  3DPT A;  3HPG A;  2L4M A;  1A31 A;  4UXN A;  1ON1 A;  4G9Y A;  2ZC2 A;  3FXL A;  3RKY A;  1F4K A;  2QVO A;  1FPQ A;  3K70 C;  5FLM J;  4G8X A;  4B44 A;  4LB5 A;  5DD8 A;  2ZXH A;  2IA0 A;  1YOV B;  4XK4 A;  2P7C B;  2L7K A;  5L3B A;  2M87 A;  3T1B A;  4A3B J;  2ZXI A;  2LTP A;  5E8G A;  3JAM K;  1AKH B;  2YSR A;  1RZ4 A;  2RVC A;  1UG0 A;  2DMQ A;  2OQG A;  1MBF A;  3E6B A;  3CCQ I;  3L7W A;  4JQF A;  3OSG A;  2R7U A;  2NNN A;  3BZ6 A;  2IGN A;  3BZK A;  4NQW A;  2AQE A;  2A6H F;  3F72 A;  3ZN1 A;  1OLT A;  2M7B A;  2KP6 A;  2ZNY A;  4WWC A;  2KZV A;  3K2A A;  1FSE A;  4AU7 A;  5LEJ A;  5LRR A;  2NVQ J;  3H92 A;  2BEO A;  3RPU A;  5IP6 A;  1IW7 F;  2DCE A;  2Y48 A;  2E35 A;  3LAP A;  4B8X A;  1J7K A;  1EH6 A;  4BE2 A;  2DFI A;  1RR7 A;  3JCU C;  3V8K A;  4PCQ A;  1UFM A;  3V7S A;  1T0F A;  4L18 B;  1Z7U A;  1FBU A;  2COM A;  1PUF A;  1VQO I;  2P6T A;  2L5Q A;  4ZJZ A;  5IPA A;  2RGV A;  3EYY A;  3GZ5 A;  1V55 H;  5GP9 A;  3G4S I;  3F23 A;  5F1R A;  1KGS A;  1STZ A;  2EIN H;  2KIM A;  1DGR M;  1UZC A;  3QP5 A;  4DBQ A;  2NRA C;  1LNW A;  1R4N B;  2H8R A;  4QLC U;  5HDK A;  2KIF A;  2L01 A;  3MN2 A;  2E1O A;  1S9H A;  2R3S A;  2AQF A;  1IZ1 A;  2DJI A;  1O3T A;  1T08 B;  4CGZ A;  4EM0 B;  4CZC A;  3BOQ A;  1MMS A;  2WV1 A;  4Y7N J;  4ESB A;  3ZXS A;  2QF7 A;  2W1O A;  1K4S A;  1LFU P;  2HZT A;  4LK1 F;  1W5C C;  2CSO A;  3F8M A;  3F8F A;  3K69 A;  4FX4 A;  1UG2 A;  2Y0S N;  3LA3 A;  1TLH B;  2EZI A;  2K9Q A;  2L4A A;  3RZD J;  3J81 K;  4BL0 B;  5KAF C;  2GWR A;  3I59 A;  4JP0 A;  5ERI A;  2CQX A;  5E3L A;  2K9S A;  1HDP A;  4RGU A;  4YII A;  3TL4 X;  4CCL A;  1FYM A;  2K86 A;  2PMU A;  5B1B H;  3CP2 A;  5EGO B;  3FBI B;  2DU9 A;  2HQA A;  1OMI A;  4D5C A;  1A35 A;  4M73 A;  2B0L A;  3ROU A;  4RB3 C;  4M6V A;  3S1M J;  2EBI A;  2VLA A;  4A12 A;  1QQI A;  1BJA A;  1GVJ A;  3S15 J;  1R1V A;  1WH5 A;  4E4H A;  4GDF A;  4A6D A;  2CYY A;  4WF2 A;  3IWF A;  4I02 A;  1WRJ A;  4FCY A;  3MFK A;  3LNQ A;  4YFX F;  3FXM A;  2L2O A;  2CRG A;  2XGC A;  5GAE J;  4PJ0 C;  1YI2 I;  3TMO A;  2JPB A;  1YJ9 I;  2K4J A;  4E7K A;  4KN4 X;  2ZO4 A;  2A5Y B;  4DIQ A;  1X3W B;  2VQH A;  2R5Z A;  1UMQ A;  2LYC A;  3H0D A;  4HOB A;  5DDG A;  3AG1 H;  2BXY A;  1D0X A;  1V5F A;  2FJ1 A;  5J1U A;  4MNU A;  1WJC A;  1ZYR F;  3R6S A;  1FSH A;  2W85 A;  2CJJ A;  3CJQ B;  3VSL A;  4BXF A;  5IT3 A;  3WTV C;  4IHV A;  2ISY A;  3SZP A;  2RNJ A;  4LD5 A;  4LIU A;  1QBJ A;  5JFR A;  1JXS A;  3JW4 A;  2C6Y A;  4N9H A;  1WCM J;  2ECC A;  3I56 I;  3CJR B;  2IT0 A;  1FP2 A;  5HOO A;  4GYG A;  1IG7 A;  3SYT A;  2W82 A;  4A5N A;  2JA5 J;  2BOL A;  5EEA A;  3A2K A;  2XPW A;  3FXR A;  2CMP A;  3WTT C;  4IVN A;  3FK6 A;  2D1H A;  3IAM 2;  3ABT A;  4C2M J;  3G73 A;  1IXC A;  1IV8 A;  1JJ8 C;  3LQQ A;  3RPU D;  4JX6 A;  3ZOB A;  1YHQ I;  4LIT A;  4HPQ A;  1JUP A;  4B3A A;  1LFP A;  3OL4 A;  3OMY A;  4JBA A;  4BXU A;  2QSH X;  1T98 A;  3OYD A;  4HDV A;  2B9S A;  2VPL A;  3GZN B;  3K7A J;  2JZY A;  2FNA A;  2DBB A;  4QWQ A;  1ETV A;  3HM5 A;  2MA3 A;  3SHF A;  4BHC A;  4MFE A;  3FWE A;  1P2F A;  3JSP A;  4O5V A;  1QA6 A;  1TNT A;  2F48 A;  4ENK A;  1D8J A;  4Z2Y A;  4P5O A;  2E5N A;  2E60 A;  4OAZ A;  5LGT A;  2GXA A;  2DFF A;  3CF5 F;  4HF2 A;  4AUX A;  2CH0 A;  3OS2 A;  1YW9 A;  2ZB9 A;  2VT2 A;  3M1C A;  2QWW A;  2LH9 A;  2D45 A;  3PIO F;  4YEL A;  1FEX A;  2VQC A;  4CIC A;  3HOV J;  4EJW A;  3AKZ A;  2RQP A;  4DJA A;  2XKO A;  2PEX A;  3HOY J;  3S2W A;  3ZGK A;  1USS A;  2HPM A;  3OR1 C;  1ZQ3 P;  4HAM A;  3W2A A;  1K83 J;  5KAI C;  1KA8 A;  2EV5 A;  2P81 A;  3KP6 A;  2E36 A;  1AU7 A;  3IRQ A;  2Z9O A;  3KEO A;  1YX3 A;  2KQR A;  3QYE A;  4L0Z B;  1BC7 C;  2Z1D A;  3BR0 A;  3DQV C;  2CUE A;  3M3Y J;  2DPU A;  2WAQ N;  2JA8 J;  5KHD A;  5HNH A;  2EZK A;  3LWF A;  1O7L A;  3AG4 H;  3R61 A;  2PI0 A;  2JA6 J;  3CMM A;  1GHC A;  1WGX A;  4B4C A;  3F6V A;  3QOP A;  4EJV A;  1E3P A;  3WG9 A;  1T0F C;  3OYH A;  2R7S A;  4YIF A;  2KKO A;  5E79 C;  3H9J A;  4NC7 A;  5C44 J;  4ZYG A;  3CCL I;  5FGM A;  4BJT A;  5D5V B;  3JRE A;  2PFB A;  3QPH A;  1IRG A;  5D6E A;  4A3L J;  1R23 A;  5E1Z B;  3KIO A;  5M5X J;  2KRC A;  3ABL H;  4A3E J;  4YEJ A;  2FD5 A;  1FT9 A;  3UR3 C;  4C30 A;  4XSX F;  2PJR A;  2JRM A;  4IJA A;  2ZNZ A;  4BKX A;  5J4V A;  2A6E F;  3A0B C;  2JT1 A;  1DU6 A;  3CES A;  4B47 A;  1ZRF A;  1ONV A;  1HDD C;  3RZO J;  3BLY A;  2EIL H;  3A4C A;  3E6M A;  2I10 A;  4RGX A;  3Q9V A;  2Y9Z A;  3TO6 A;  1MMA A;  3T8T A;  3BP8 A;  4YFN F;  2JSC A;  1WJF A;  2WC2 A;  3QOE A;  4Y52 J;  1TWG J;  1YG2 A;  5CKT A;  3PNY A;  1BBY A;  4HX8 A;  1QU3 A;  3CF2 A;  3L9F A;  2ETH A;  1J5Y A;  3DFG A;  3MVP A;  1XGS A;  5GPC A;  3HYI A;  1JKO C;  2DPD A;  3FX3 A;  3MKW B;  5CQG A;  3WE3 A;  2DA2 A;  4XIC A;  3GFI A;  4L9T A;  4B43 A;  2BVL A;  3OOP A;  2EA2 A;  1SAX A;  1WJ5 A;  3JRF A;  3DP7 A;  2IS6 A;  2HQN A;  2YS9 A;  3MWM A;  3OYJ A;  5GAD J;  1AKH A;  3HBL A;  1F5T A;  3CLO A;  1QO0 D;  3KLO A;  4Y15 A;  1SD7 A;  4NQW B;  4Z6Y A;  4A3I J;  2XB0 X;  1LE8 A;  1U2W A;  4XKW A;  5HLH A;  2VXZ A;  2R5Y A;  2XF7 A;  2LK2 A;  5HOD A;  2M0M A;  2Y75 A;  5B3S H;  4D1Q A;  4XOT A;  4FX0 A;  2JUG A;  3G2B A;  3Q9S A;  1OCC H;  2BY0 A;  4OMZ A;  5FKM A;  1N77 A;  4A93 J;  2ZSI B;  2UZK A;  1PUF B;  3WTS C;  3S2H J;  1OCP A;  2JRT A;  2ZFU A;  5IYB J;  1ZN2 A;  4R79 A;  4C3H J;  2DDA A;  2HYF A;  4CUG A;  1B9N A;  3NEU A;  1EKE A;  5K5R A;  4HG2 A;  4OIN F;  5J8F A;  3F21 A;  5H2F C;  2ZBK A;  2OQR A;  1KZH A;  2DA3 A;  1SFU A;  4XBF A;  2XGX A;  4PSW A;  3GTM J;  1YX5 A;  1V5E A;  3MKY B;  1X1B A;  1KQ0 A;  2V4J C;  3DTK A;  3K2Z A;  3ZMS A;  1FY7 A;  1A36 A;  4BQO A;  2O8X A;  5E3O A;  1RES A;  1A04 A;  2WA0 A;  2VE9 A;  2VI6 A;  3IRR A;  3E6D A;  2PX9 A;  4E7H A;  4MEX F;  1U5T C;  4OIR F;  1UST A;  2AXL A;  3CC2 I;  2LDU A;  2VBY A;  3OIP A;  2H1K A;  5ICE A;  3AG2 H;  2DOE A;  5JHF A;  3K4J A;  1D0Z A;  1PDN C;  3O6B B;  5B5E C;  1WJA A;  3OYN A;  3VSK A;  3MKL A;  2HR3 A;  1DQU A;  3I59 B;  3CP8 A;  3NWT A;  3P9K A;  1ETK A;  2LP0 A;  3K4K A;  5AON A;  1SD4 A;  2HDD A;  3U21 A;  4MIM A;  2VKH A;  4WXD A;  5J8C A;  2DMT A;  4L5J A;  2UWM A;  4XM3 A;  4G7O F;  4G12 A;  1LQ1 A;  3EUH A;  3PNT A;  2MAB A;  3I53 A;  1R36 A;  3K10 A;  3ZN0 A;  1EH8 A;  4DGW B;  4JYK A;  1ZG3 A;  5FFZ A;  3L1P A;  1T56 A;  2V79 A;  1WKM A;  1W4M A;  3V8L A;  2VBW A;  2RC4 A;  3TW7 A;  1SMT A;  2OUM A;  3T8R A;  4EJT A;  1YIT I;  3M8J A;  1CF7 B;  4A3F J;  1XSV A;  2M7A A;  5CLS A;  5K5O A;  4JX4 A;  1P92 A;  4XKC A;  1IAW A;  3HUG A;  1I6H J;  1SVL A;  2N8G A;  2PJP A;  2EPF A;  2I5U A;  5L3G A;  2HXO A;  1GDT A;  3C2G A;  4GXO A;  1ON2 A;  4BQA A;  2FF4 A;  4HQM A;  3EDP A;  4AIK A;  2YPR A;  3KP5 A;  2H8W A;  1OR7 C;  2K7L A;  4WK8 F;  3HOU J;  2OD5 A;  1G3S A;  1VF9 A;  3I55 I;  1FTT A;  4D7N A;  2F4I A;  4HLY A;  1ZH5 A;  3FKI J;  2H94 A;  2CUJ A;  2EQR A;  5ICG A;  3ZQ7 A;  4OIO F;  4QTR A;  1QHG A;  1ULY A;  4XLF A;  1SFX A;  4QSH A;  4XRS A;  2R93 J;  1YIJ I;  3CC7 I;  4BY1 J;  3S17 J;  5FLX K;  1W36 D;  5DM6 F;  3GTG J;  2LMD A;  5FB2 A;  1R6R A;  3SFZ A;  4CO8 A;  2QZ8 A;  1XGN A;  1U5T B;  3V42 A;  1XDU A;  1DP3 A;  1QZY A;  3KET A;  4CDG A;  3OSF A;  4U0W A;  3HOT A;  3OL3 A;  3KP7 A;  2WWY A;  1DP7 P;  2V1N A;  1YTY A;  2XIG A;  5H20 A;  3HRS A;  3BR3 A;  3W3C A;  1H88 C;  2HOE A;  1GV5 A;  5DS9 A;  3FDY A;  3TED A;  3DKW A;  3ZMU A;  2R7W A;  1TZL A;  2DOF A;  1HSJ A;  3GXO A;  5J40 A;  4H0E A;  2ME6 A;  4MTE A;  3H5N A;  2CQN A;  1PUE E;  2W84 A;  2QQB A;  3BTL A;  2Q8K A;  4CCJ A;  2HKX A;  4IOC F;  1IRZ A;  4MFD A;  4L0Y B;  2ID6 A;  2FMY A;  2CQ7 A;  5DD4 A;  2P0W A;  4XR6 A;  3DLA A;  3BG7 A;  1Z1D A;  4P9F A;  3OYK A;  3BR1 A;  4G6T B;  5DCF A;  1YO5 C;  4IHY A;  3QRF F;  4ZYH A;  5IT9 Z;  1IDY A;  5D8L B;  1T6S A;  2MBF A;  1BC8 C;  2R4G A;  3LQR A;  1Z9C A;  4J19 A;  1H9G A;  4A3K J;  1Z6R A;  3WTZ A;  4BGD A;  1L3L A;  2XAF A;  1FX7 A;  2F5V A;  2Y0M A;  3JSO A;  3CQZ J;  1WWX A;  1S72 I;  2E2I J;  2LKP A;  2MD5 A;  1V4R A;  1SFK A;  2LRE A;  1OFC X;  1NK3 P;  3CTA A;  4CH7 A;  1G3Y A;  5DEQ A;  1PP8 F;  2STW A;  2BY3 A;  2NS0 A;  5E3N A;  4RB0 A;  3K70 D;  1W0U A;  2CWE A;  1V5G A;  2O6G E;  1ZRC A;  2QGU A;  2A07 F;  2O61 A;  4N9I A;  1S5L C;  3L2C A;  1W5T A;  1W36 C;  2PQ8 A;  4X6A J;  3FMQ A;  1DU0 A;  3C18 A;  3PFY A;  5BMZ A;  3ZMV A;  1HLV A;  5J6X A;  3P9C A;  4IKF A;  1JKQ C;  3RKW A;  2XGE A;  2LFB A;  3ERE D;  2ZJQ F;  5FKO A;  1HKQ A;  1IN7 A;  4IHW A;  5F0C A;  4PJN A;  1WFX A;  4HF1 A;  3Q0U A;  3ZQG A;  1SFE A;  2GM4 A;  3D5S C;  3LL7 A;  3JRI A;  2LVS A;  1OCR H;  3KEQ A;  1LDK B;  1RUN A;  2L7M P;  4IRG A;  5D5X B;  2JMW A;  1WZ2 A;  2UXN A;  2F2E A;  3CMY A;  2XAQ A;  2Y30 A;  2WV0 A;  1R1U A;  2K9L A;  2PJR B;  1B1B A;  1BIA A;  2NVX J;  3OYM A;  3K4B A;  1R00 A;  3ZP5 A;  3S16 J;  3S1Q J;  1TWC J;  1KQ8 A;  1JUM A;  1IUF A;  2HGC A;  4UB6 C;  5D4R A;  2DYR H;  1YRN A;  1R5G A;  4BBS J;  2BXZ A;  3L2Q A;  3PM1 A;  5EJC A;  1ZR2 A;  2OCC H;  1YYV A;  3PJR A;  2KIS A;  3FIW A;  4EVI A;  3K4L A;  4A0Y A;  2X1E A;  4HQE A;  4ZH4 F;  1JUS A;  1MBH A;  1HBX G;  5M3F J;  4FHT A;  2BE5 F;  1F43 A;  2JSP A;  2DT7 B;  3E1S A;  2OCE A;  3JRG A;  1X4P A;  1MW7 A;  4HDU A;  2A68 F;  3DEE A;  3M8F A;  3NAR A;  5HLG A;  1KU2 A;  4EQQ A;  3MD2 A;  2V6C A;  5EEG A;  3EUH C;  4RAG A;  4LB6 B;  4M72 A;  1IGN A;  3F8N A;  4UB8 C;  2VJ4 A;  1ENH A;  3LAJ A;  1DPR A;  4G94 A;  2DT6 A;  3GTQ J;  1BI0 A;  2UXX A;  1JGG A;  5GTH C;  5FJ8 J;  2DMU A;  1LE8 B;  3V7R A;  3DTE A;  2R5Y B;  3B6A A;  4C3J J;  2E7W A;  4P96 A;  1RKW A;  2H09 A;  5FKK A;  1O3R A;  2X6Y A;  3F8B A;  3BJO A;  1ZTR A;  3F0C A;  2VUM J;  5JLW A;  1R49 A;  3TOB A;  2AXT C;  2VAS A;  1Z7L A;  2W4S A;  2RQQ A;  1QZE A;  2ACJ A;  1HF0 A;  2BYV E;  1MDM A;  1ZGJ A;  2AHQ A;  4M3G A;  2E5Z A;  3CZ6 A;  5ICF A;  4ZZL A;  1N75 A;  1MSE C;  5C4J J;  2DO7 A;  1A5J A;  4U87 A;  5LGU A;  3B02 A;  1E3H A;  2JPC A;  1YLF A;  3D5R C;  4GRI A;  4E6K G;  1TW2 A;  3VWB A;  3RYR A;  3H3Z A;  4RM3 A;  2BV6 A;  3BPV A;  5BPD A;  4ASN A;  3S1R J;  3GTK J;  4N4N B;  2A05 A;  3JAM Z;  2GZW A;  3H9Q A;  1IN8 A;  1GUU A;  3GBG A;  1AWC A;  2V1X A;  4CCK A;  2UV1 A;  4V19 K;  3K4C A;  3BR6 A;  1X1P A;  1EJ9 A;  1U8B A;  1I6X A;  4MO7 A;  3OIQ A;  2VJI A;  1XSD A;  2XAU A;  3ASO H;  2VOO A;  4BQN A;  2Z5U A;  3IH4 A;  1FOX A;  3HSF A;  3O3K A;  4HST A;  1D3Y A;  4PZJ A;  3ZPL A;  4ANJ A;  3ZQC A;  2VJJ A;  5HDG A;  5E18 F;  3VYU B;  3OYL A;  1IC8 A;  1O3Q A;  1NG6 A;  4II2 A;  5J47 A;  2R7R A;  1QGP A;  2IW5 A;  2LKS A;  2L7Z A;  1IO2 A;  2Y2Z A;  3DF8 A;  5L3D A;  4BU2 A;  3KP3 A;  2NVU B;  5HVQ C;  3IP4 B;  1OPC A;  2IA2 A;  3BWG A;  3ZQL A;  1BOA A;  3A1Y A;  3MCZ A;  4WXH A;  1OCZ H;  2RRE A;  2F5C A;  4ESF A;  1JTY A;  5FRN A;  2D1V A;  1Y8R B;  2VBX A;  2Z2S B;  2IA1 A;  3VEP A;  5B1A H;  4HEA 2;  4NBQ A;  1Z05 A;  1Y1V J;  4UV8 A;  3TW6 A;  1ZG1 A;  3BG3 A;  2JVH A;  4Y33 A;  2G0E A;  2OAZ A;  3FM3 A;  1U78 A;  4XLN F;  1I1S A;  4OIP F;  3IH2 A;  4FIS A;  3HUG B;  3S93 A;  2WB1 A;  3E3V A;  4XKV A;  3S1N J;  2KFD A;  1CF7 A;  4ZTJ A;  2O7O A;  3ZMZ A;  3WGH A;  5CVI A;  5HDN A;  3GZ6 A;  1UHM A;  1XMA A;  3ASN H;  2IPQ X;  4XRS G;  4ETS A;  3LSI A;  2OC6 A;  1VQM I;  1BR1 A;  4D5F A;  2HOA A;  3V8J A;  1Q1H A;  1MBE A;  1NG7 A;  2BGC A;  2VT3 A;  3H3V K;  3J81 Z;  5KVR A;  1E2X A;  3WU2 C;  2V26 A;  4HBL A;  2OV7 A;  2R7O A;  5IY5 H;  2A6T A;  1T2K A;  1HKS A;  4HNV A;  3KEY A;  2GA2 A;  5F6F A;  3ABU A;  4L9N A;  3C2B A;  1ZRD A;  4DZJ A;  3BDD A;  3LA2 A;  1MGT A;  3J80 K;  2CO5 A;  1CGP A;  2A3S A;  1ZGA A;  4X0G A;  1APL C;  2LF7 A;  3QAH A;  5ICC A;  1Y1W J;  3WTY C;  3BCA A;  3RQ4 A;  1Z67 A;  3O8G A;  1X19 A;  1R58 A;  2P5L C;  1R71 A;  2ICW G;  4M6Y A;  5CPR B;  4KIT B;  2GAU A;  3DEW A;  1ETQ A;  1TQM A;  1EA3 A;  1U5T A;  1H89 C;  3GYH X;  1I3A A;  2P5K A;  3LOC A;  3CDI A;  4DYC A;  5GAH J;  3HSE A;  5IYD J;  4NUB A;  4X1E A;  2PN6 A;  3TBI A;  1IRF A;  2PBI A;  3JRA A;  3FXU A;  1BA5 A;  1FMW A;  2ZJ2 A;  4CSW A;  1YS6 A;  4ZDP A;  1SC7 A;  5BPI A;  5H6Q A;  4KNY A;  4LJZ F;  2X6W A;  4A3C J;  2KRF A;  3RYP A;  4HSR A;  3V7C A;  1BR2 A;  1IRX A;  4RGR A;  4KDP A;  4S04 A;  4MHG A;  1K6Y A;  4WCG A;  2F5F A;  1FC3 A;  5EF6 A;  2ZKZ A;  4XQF A;  4KYW A;  3S3N A;  1RR8 C;  5H6R A;  2KJB A;  4JX5 A;  1D1B A;  1QZZ A;  1OYI A;  3SZG A;  4XNF A;  4IEJ A;  2OF7 A;  4PFO A;  1K4T A;  1OIS A;  1HST A;  3WHB A;  1B8I A;  4LGW A;  1S8N A;  3FXQ A;  3KZY A;  4YIR X;  1AOY A;  4PJL A;  2BZT A;  1ZLJ A;  5CJ9 A;  3T0Y A;  3W2W A;  2ZJP F;  1ZHF A;  3Q0W A;  1PYV A;  3QU3 A;  3VPR A;  2DK5 A;  2HFH A;  2LY1 A;  3M8E A;  3LSP A;  1LVK A;  2DOD A;  2W25 A;  5EG0 A;  3HGG A;  4W97 A;  2AS5 F;  3OS0 A;  4I0B A;  2XRO A;  4G7H F;  3PL8 A;  4UUV A;  1FZP B;  4KIG A;  2EIM H;  3BTJ A;  1OR7 A;  4BE0 A;  1S7A A;  4J00 A;  1SVM A;  3SEQ A;  3ZQH A;  3DLL F;  2L0K A;  3OYI A;  4JOM A;  2J5P A;  3HB9 A;  1HA8 A;  3CME I;  2YR2 A;  2E34 A;  3H36 A;  5E3M A;  1FBS A;  2CUZ A;  1Y39 A;  3MKZ A;  4PJM A;  3HRM A;  4AM3 A;  2BBY A;  1XG1 A;  4KMF A;  3S3O A;  3DKY A;  2CQK A;  2DN0 A;  4MLO A;  2LBF A;  2NYX A;  2QEN A;  3E0J B;  3Q3S A;  2HZD A;  4Y13 A;  1XX5 A;  2DDB A;  4FAS D;  1DGW Y;  5LLQ A;  3ZQI A;  4U7D A;  3PIP F;  4FET A;  4BS9 A;  2ELJ A;  3K1N A;  1I5Z A;  3R0J A;  5ED4 A;  3KPH A;  4XRF A;  3ESW B;  2EWN A;  2LNB A;  2DFH A;  2IS2 A;  3PO3 J;  1MNE A;  3VYS B;  1O4X A;  3KZZ A;  3WG7 H;  3R60 A;  1MBK A;  1QNT A;  4BJ6 C;  2ME0 A;  1XPX A;  1T8I A;  1U8R A;  2V9P A;  2DJN A;  3I5U A;  3GO5 A;  3HEF A;  3EPZ A;  1I3Q J;  1Q1V A;  2V7F A;  1YRN B;  1VQ7 I;  5DUK A;  2VJ5 A;  1FYK A;  1FNN A;  4EEF G;  3I3L A;  1B9M A;  4B09 A;  1W5S A;  2R7D A;  1IN5 A;  1R1T A;  4HF0 A;  3AFH A;  1HW5 A;  2HOT A;  4HNU A;  2MGQ A;  2XF6 A;  2CUF A;  3IWZ A;  2BY2 A;  2KLO A;  3WGG A;  1EV7 A;  3IKV A;  5LHG A;  4HV6 A;  4BYY A;  4PDK A;  1P9Q C;  2OTJ I;  2XRL A;  2Y69 H;  2CG4 A;  2G9W A;  3GFJ A;  1XGM A;  3CUQ C;  2MLK A;  1XN7 A;  3JRH A;  1S7E A;  5AIQ A;  4WX9 A;  5KCM A;  2IGM A;  3EYI A;  1WHU A;  2R7X A;  2QSG X;  2DK8 A;  2M45 A;  3DBH B;  3QPT A;  4G7Z F;  4UHT A;  4IZZ A;  3HHH A;  3WGI A;  1D5V A;  1PP7 U;  4AVP A;  2LLK A;  2HXI A;  4DYR A;  3GTP J;  3R0A A;  1WVR A;  2HDW A;  4XKB A;  3WTW C;  3HRT A;  4I98 B;  1C0W A;  1XS9 A;  4I99 C;  3FM5 A;  4I01 A;  1MDM B;  2P7V B;  1YFH A;  5ILU A;  2FBI A;  4BNC A;  1N78 A;  1KU7 A;  4DYQ A;  4V2G A;  1P7J A;  3K9T A;  4FE7 A;  1J09 A;  1YE9 A;  5CYV A;  2EV0 A;  1L0O C;  4UVA A;  2LY2 A;  2O3F A;  3J7A O;  3HOZ J;  4PUS A;  4OWR B;  3BZC A;  2FEZ A;  2WY7 Q;  2L9N A;  2VN2 A;  2K9M A;  3S2D J;  1ZLK A;  3L09 A;  3BTI A;  2KT0 A;  1OYY A;  2TDX A;  4BE1 A;  3IH3 A;  3SQN A;  4JK1 X;  1FYL A;  3IUO A;  1U9O A;  2M8G X;  2DXI A;  3KCC A;  2LKX A;  4NNJ A;  1AA7 A;  2GBY A;  1VQK I;  2VKE A;  1X58 A;  4NC8 A;  4YFK F;  1J75 A;  2JJ7 A;  3N97 A;  3TP0 A;  2FSW A;  2M30 A;  2IP2 A;  2LR8 A;  3I54 A;  2HKO A;  4AIJ A;  2CV2 A;  3KYC B;  1TNS A;  4AID A;  3QYF A;  1WJB A;  2EJR A;  3BQY A;  4E7Z A;  4IL6 C;  1XDS A;  2DT5 A;  4U0Y A;  1E3O C;  4CHU A;  2RKH A;  3IKT A;  3FIS A;  4TV7 A;  2OTL I;  2QSF X;  4QPO A;  2VON A;  3HTS B;  1GXQ A;  2X0L A;  1EH7 A;  2WAE A;  4F3Q A;  2ID3 A;  1S7O A;  2MSY A;  4ITV A;  3RDI A;  2NOG A;  3WU0 A;  1G4D A;  6PAX A;  1ETY A;  2L9R A;  4ON0 A;  2E1M C;  3GWZ A;  1XB4 A;  3H1C A;  4HYE A;  4BBR J;  4N4O B;  2H6B A;  1IN6 A;  4PSX A;  4O3M A;  5L3C A;  3RCO A;  2R7T A;  2QKM B;  4GFB A;  3CUO A;  3O2P E;  4HLX A;  5FRO A;  2HPI A;  2X1D A;  2DI3 A;  1R22 A;  2RDP A;  3U2R A;  2R7V A;  3U1D A;  5M5Y J;  1JHH A;  2GLO A;  5A2Q K;  1LDJ A;  5JR3 A;  2Q2E A;  1VQP I;  4ZYD A;  2FU4 A;  2K3P A;  3CJT B;  3KZI C;  2FUG 2;  2NOJ B;  2M9H A;  3KFW X;  4L9V A;  1QVT A;  1OCT C;  2X48 A;  3IL2 A;  3F8C A;  2ELH A;  4BAC A;  3VFZ A;  2HI3 A;  3OOU A;  3G1M A;  3I4P A;  3MZH A;  3PSF A;  1IXR C;  1I1G A;  4XN0 A;  2X6X A;  5GTI C;  1T38 A;  2MH9 A;  4XL9 A;  4KIC A;  2EFN A;  4XLC A;  5EEH A;  2ZFW A;  2IJL A;  4IXA A;  2E2J J;  3SDG A;  4EGZ A;  1VQ6 I;  2GXG A;  1P6R A;  5M5W J;  3QOD A;  3F22 A;  1O3S A;  4KJZ A;  3KYL A;  3A02 A;  2DA7 A;  1VQ4 I;  4GGG A;  1AHD P;  1MH3 A;  2VKD A;  1T39 A;  4Y17 A;  2STT A;  4I2O A;  2F5D A;  4F91 B;  4C2T A;  1M1E B;  1QPM A;  2B7E A;  2NXN B;  4BDZ A;  3E97 A;  3PUF A;  2O5R A;  2CQQ A;  2EIJ H;  2Q1Z B;  1RIO H;  4AIH A;  9ANT A;  1FOK A;  1PVE A;  5ILS A;  2P5V A;  3CO6 C;  2ZXJ A;  4EJO A;  1B72 A;  4A0X A;  5J3L A;  4XLP F;  5EZG A;  2VPR A;  4BEH A;  2ISZ A;  3BRO A;  2DW4 A;  3CMA I;  1TT5 B;  2R7Z J;  3EET A;  1X2M A;  4HW0 A;  1W1W E;  3GLL A;  4UUT A;  3OYB A;  1UCR A;  5TRD A;  2X6O A;  4UNO A;  2DYS H;  2E1M B;  3JTG A;  2VIX A;  1B59 A;  3A03 A;  3I4M J;  2L02 A;  1ITY A;  5F08 A;  3BTC A;  1GT0 C;  5F0F A;  4CCN A;  4AWX B;  2QQ8 A;  1LUJ B;  2FOW A;  3LFK A;  3HG9 A;  4PJJ A;  4XLE A;  3BC8 A;  2ESH A;  2WB1 N;  4IQJ A;  1B8I B;  5D5U B;  1G8X A;  1WPK A;  1IXS B;  1A6Q A;  3FZV A;  2XPU A;  2UUZ A;  5FLX Z;  4M71 A;  2K9N A;  3TGN A;  3EUK L;  1VTN C;  2EZH A;  2HU9 A;  1F9N A;  3MMY B;  5EG0 B;  5FD6 A;  1SD5 A;  2W00 A;  4RLQ A;  2VB6 A;  3BR2 A;  1Z6T A;  2OBP A;  3I71 A;  2V1U A;  4E7J A;  1E17 A;  1P4X A;  2XUB A;  3OYC A;  1G59 A;  1MJA A;  1IN4 A;  2O8K A;  1R4M B;  2DMP A;  4C9Y A;  3BG5 A;  4P9U A;  2WAD A;  4YG2 F;  1HXD A;  1FIP A;  1YW7 A;  2EB7 A;  2XAG A;  5LRS A;  1TL8 A;  4S0H B;  4ENN A;  1WQ2 A;  5CQE A;  1LPQ A;  4BHP A;  4IHX A;  1SFO J;  4ZYA A;  3L2U A;  4E7L A;  3BG6 A;  2WBM A;  3ECO A;  2H27 A;  1ETX A;  1TWA J;  3GTL J;  1U6G A;  2GOM A;  2O0Y A;  3DPU A;  2LG4 A;  1FP1 D;  2RNG A;  4UUS A;  2X85 A;  4FQG A;  1LDD A;  2K85 A; 
#chains in the Genus database with same CATH homology
 2OU2 A;  2Z33 A;  3D5L A;  3VB2 A;  1K78 A;  2VC1 A;  4HZF A;  2HYG D;  1FWZ A;  2X4H A;  2OA4 A;  4KT5 C;  4RB1 A;  3E6C C;  4RAZ A;  1FBQ A;  1ZAO A;  2PG4 A;  4PGH A;  2FXA A;  4LMY A;  1JGS A;  2G7H A;  4FT8 A;  4LG0 A;  4F7Z A;  4R8H A;  1RUO A;  1YS7 A;  2J5O A;  2MLG A;  5FO5 A;  2ZME A;  2M8E A;  2K4B A;  5KK1 A;  4IRI A;  5HS8 A;  2ESN A;  1J2X A;  2EFQ A;  4L5I A;  3M9A A;  3GFM A;  2FE3 A;  1LEB A;  2ZCW A;  1D8K A;  3GW2 A;  2W24 A;  3BY6 A;  4OU0 A;  4DQ2 A;  4Q5S F;  2MH2 A;  3HTU A;  2L3D A;  4IRH A;  1BI1 A;  3FMS A;  3HOS A;  3KP4 A;  4LLL A;  2QLZ A;  2OZ6 A;  4KMU X;  4M9X A;  3C3W A;  3V4G A;  2D2W A;  2EV6 A;  3WTU C;  1W7P A;  2DTR A;  1KU9 A;  1KQ9 A;  4EM1 A;  2E7X A;  4L9J A;  2HTS A;  2FA5 A;  3HRU A;  2ADU A;  3ZMD A;  1HKT A;  2QBY A;  1I27 A;  5E1X A;  5L3E A;  3P9I A;  3M1E A;  4EM2 A;  3KLN A;  4LLN A;  5E8I A;  2CGP A;  4G6Q A;  4EGY A;  3FF5 A;  4GO1 A;  3AAF A;  4DNC A;  1P4A A;  3W6K B;  3SZT A;  3ECH A;  1P4W A;  4I0A A;  3CUQ A;  2HWV A;  3TQN A;  1HW1 A;  1TW3 A;  2QM3 A;  1LVA A;  4BHB A;  3VOD A;  1REP C;  1X3U A;  4RB2 C;  3BJ6 A;  2XAH A;  2XHK A;  1J0R A;  4ESJ A;  2VC0 A;  3ML6 A;  2EK5 A;  3L00 A;  1KYW A;  2Z99 A;  2DQR A;  3P7N A;  1MD0 A;  5LEK A;  1DPU A;  2DQL A;  5FD5 A;  1G6N A;  2K02 A;  4ENM A;  5LHI A;  1MJB A;  1ODD A;  4N0B A;  3TDU C;  1HW2 A;  3DEU A;  4IHS A;  2DLL A;  1UB9 A;  5LHH A;  4OMY A;  4GCV A;  4RAY A;  3ZMT A;  2E1N A;  2LF8 A;  1G3T A;  1K6O A;  2WTE A;  5JI6 A;  4G6D A;  1W7P D;  5E17 F;  4A5M A;  1HQC A;  1K7A A;  3IC7 A;  2A69 F;  4HA8 A;  5CVV A;  2GQQ A;  2H6C A;  1IF1 A;  2FRH A;  4D0P A;  3C1D A;  2DAO A;  1UHW A;  2O03 A;  2EFO A;  1JHF A;  2XRN A;  3GF2 A;  5E1W A;  4LFU A;  1B6A A;  5CVR A;  3J80 Z;  3BJA A;  5D8K B;  3REO A;  1BN5 A;  4XSZ F;  4K2E A;  1DUX C;  3I58 A;  3GFL A;  2QQA A;  1V3F A;  4HX7 A;  3K1M A;  4I7H A;  1MZB A;  3F6O A;  4KFC A;  4EMS A;  1XD7 A;  1SMY F;  5DCM A;  2V1D A;  5CVU A;  2KJC A;  4A6E A;  3TOA A;  2VBZ A;  3CO7 C;  1O57 A;  5DV5 A;  3CDH A;  2HQR A;  3GVA A;  2HEO A;  2EFW A;  5BOX A;  1K78 B;  1FLI A;  2VE8 A;  3H3U A;  5D6F A;  1IUY A;  3COA C;  2RV8 A;  3W6J B;  4PGG A;  2P6S A;  1ZRE A;  4UVB A;  2KIU A;  2P4W A;  3HIF A;  1OYW A;  4UVC A;  2RN7 A;  1MKM A;  3F3X A;  2MC3 A;  2Q0O A;  4KIF A;  4LG0 B;  5E20 A;  2GXB A;  2OZU A;  3E5X A;  2ZME B;  2LSO A;  2XAS A;  3R4K A;  1B4A A;  5HLI A;  3KE2 A;  2XVC A;  1XSX A;  2CFX A;  5TJJ A;  3GEZ A;  4MQV A;  4EJU A;  2PLY A;  2V9V A;  1H9T A;  4MGR A;  3PQK A;  2FBH A;  5BQT A;  3WTX C;  3HSR A;  1Z91 A;  2GIV A;  4GYI A;  5K5Q A;  5DUI A;  2FBK A;  3LA7 A;  2M5W A;  4ZZD A;  4M9S A;  4KIB A;  2E1C A;  1BI2 A;  1W7P B;  3MQ0 A;  4MQ9 F;  3RJP A;  3FMR A;  1GXP A;  4LLG F;  4IPA A;  3ULQ B;  5DYM A;  2L54 A;  1BIB A;  3WE2 A;  4OIQ F;  2QBY B;  3KP2 A;  2NAZ A;  4AD9 A;  3BPX A;  3E5Q A;  5L3F A;  1KYZ A;  5K1Y A;  3QP6 A;  4CZZ A;  1LJ9 A;  3K1P A;  1NHA A;  4WXC A;  1J9I A;  1TQP A;  2QQ9 A;  1XCB A;  1H0M A;  2Z3Y A;  3MEX A;  1TQI A;  2FOK A;  3WU1 B;  2W57 A;  3B73 A;  1WSU A;  4P55 A;  3CUQ B;  3WOD F;  2XAJ A;  1OKR A;  3PQJ A;  3RKX A;  5D5W B;  1Y0U A;  2YX7 A;  2K27 A;  2IVM A;  3LST A;  3U9G A;  4Q4Z F;  1J59 A;  4U0V A;  3DXJ F;  2JTV A;  1BI3 A;  1G3W A;  4UV9 A;  1LEA A;  3D0S A;  4Q47 A;  3DPL C;  1ZAR A;  1R7J A;  1S3J A;  4M74 A;  1MJ9 A;  4ZYE A;  2VOP A;  4BH9 A;  2CW0 F;  3OV8 A;  4E70 A;  4RGS A;  3MZY A;  1JE8 A;  1WI9 A;  5LGN A;  2HS5 A;  3TDZ C;  1K79 A;  2EFP A;  4O6J A;  2EA4 A;  3ISP A;  5A2Q Z;  2QYO A;  5D4S A;  4U88 A;  2PMH A;  4Q48 A;  5HS9 A;  3MAJ A;  2YU3 A;  3NRV A;  3GX4 X;  1O7F A;  3M7G A;  3RIR A;  4IHT A;  4NB5 A;  1YQA A;  3C7J A;  4KN7 X;  1DDN A;  3TKY A;  5IT9 K;  3ELK A;  3JTH A;  2R7F A;  1XMK A;  5F64 A;  3SXY A;  3K0L A;  3RTR A;  5FFX A;  5AIP A;  5BS6 A;  3G3Z A;  1KU3 A;  4HX4 A;  2A61 A;  5HS7 A;  1U3E M;  3GLX A;  4CXF A;  1S6L A;  4MTD A;  4IF4 A;  3EQL F;  3VOE A;  5JHU A;  4A0Z A;  4M6X A;  5DCM B;  4A2U A;  2FNP A;  5JVT A;  2GA1 A;  4KA4 A;  1XCV A;  4OOI A;  2FQ3 A;  4KUM A;  4EV0 A;  1LB2 A;  1YIO A;  4HV5 A;  4S05 A;  2HDC A;  5ILV A;  1R5H A;  3Q5F A;  2XV4 S;  1TBX A;  4M9Z A;  3TO9 A;  2IRF G;  2M1B A;  4ENJ A;  4NHJ A;  4RS8 A;  2G7U A;  3RPQ A;  3CJN A;  3RI4 A;  3I64 A;  1F1Z A;  1BM9 A;  2NNY A;  2P8T A;  3T5X A;  2F5E A;  3FHZ A;  3N4M A;  1SD6 A;  4R1H A;  3NQO A;  2YX4 A;  2FML A;  2QUF A;  1S29 A;  4BAY A;  3GUD A;  1TTY A;  1YW8 A;  3QU6 A;  4U7B A;  3E5U A;  1RNL A;  4LK0 F;  5LBQ A;  3TO7 A;  3PFI A;  1ZG5 A;  3IHU A;  4I09 A;  1XGO A;  3I0T A;  3DV8 A;  2XKP A;  4CYD A;  1RI7 A;  2HTJ A;  5CVJ A;  2VOD A;  3HHG A;  4MEY F;  3DPT A;  2L4M A;  4UXN A;  1ON1 A;  4G9Y A;  3RKY A;  1F4K A;  2QVO A;  1FPQ A;  4G8X A;  4LB5 A;  5DD8 A;  2IA0 A;  2P7C B;  5L3B A;  2M87 A;  3T1B A;  5E8G A;  3JAM K;  2YSR A;  1RZ4 A;  2RVC A;  2OQG A;  3E6B A;  3L7W A;  4JQF A;  2NNN A;  3BZ6 A;  4NQW A;  3ZN1 A;  2A6H F;  3F72 A;  2ZNY A;  4WWC A;  1FSE A;  5LEJ A;  5LRR A;  3H92 A;  2BEO A;  3RPU A;  1IW7 F;  2Y48 A;  3LAP A;  4B8X A;  1J7K A;  1EH6 A;  2DFI A;  3V8K A;  4PCQ A;  1UFM A;  3V7S A;  1T0F A;  4L18 B;  1Z7U A;  1FBU A;  2COM A;  2P6T A;  2RGV A;  3EYY A;  3GZ5 A;  3F23 A;  5F1R A;  1KGS A;  1STZ A;  2KIM A;  3QP5 A;  2NRA C;  1LNW A;  4QLC U;  5HDK A;  2KIF A;  2L01 A;  2R3S A;  1IZ1 A;  1O3T A;  4CGZ A;  4EM0 B;  3BOQ A;  4ESB A;  2HZT A;  4LK1 F;  2CSO A;  3F8M A;  3F8F A;  3K69 A;  4FX4 A;  3LA3 A;  1TLH B;  2L4A A;  3J81 K;  2GWR A;  3I59 A;  5ERI A;  1FYM A;  4YII A;  4RGU A;  2K86 A;  2PMU A;  2DU9 A;  1OMI A;  4M73 A;  2B0L A;  3ROU A;  4RB3 C;  4A12 A;  1QQI A;  1BJA A;  1GVJ A;  1R1V A;  4A6D A;  2CYY A;  4WF2 A;  3IWF A;  4I02 A;  1WRJ A;  3MFK A;  4YFX F;  2JPB A;  2K4J A;  4KN4 X;  2ZO4 A;  2A5Y B;  4HOB A;  5DDG A;  4MNU A;  1ZYR F;  3R6S A;  1FSH A;  2W85 A;  5IT3 A;  3WTV C;  2ISY A;  3SZP A;  2RNJ A;  4LD5 A;  1QBJ A;  5JFR A;  1JXS A;  3JW4 A;  2C6Y A;  4N9H A;  2IT0 A;  1FP2 A;  5HOO A;  4GYG A;  4A5N A;  3FXR A;  3WTT C;  4IVN A;  2D1H A;  3ABT A;  3G73 A;  1IXC A;  3LQQ A;  4JBA A;  4BXU A;  1T98 A;  4HDV A;  2JZY A;  2FNA A;  2DBB A;  4QWQ A;  2MA3 A;  3SHF A;  4BHC A;  3FWE A;  1P2F A;  3JSP A;  4O5V A;  1TNT A;  1D8J A;  4ENK A;  4Z2Y A;  4P5O A;  5LGT A;  4HF2 A;  1YW9 A;  2VT2 A;  2QWW A;  2D45 A;  4CIC A;  4EJW A;  2RQP A;  2XKO A;  2PEX A;  3S2W A;  1USS A;  4HAM A;  1KA8 A;  2EV5 A;  3KP6 A;  3IRQ A;  2Z9O A;  3KEO A;  4L0Z B;  1BC7 C;  3DQV C;  2DPU A;  3LWF A;  1O7L A;  3R61 A;  2PI0 A;  1GHC A;  3F6V A;  3QOP A;  4EJV A;  3WG9 A;  4YIF A;  2KKO A;  4ZYG A;  5FGM A;  5D5V B;  2PFB A;  3QPH A;  1IRG A;  5D6E A;  1R23 A;  5E1Z B;  1FT9 A;  4XSX F;  4IJA A;  2ZNZ A;  2A6E F;  2JT1 A;  1ZRF A;  1ONV A;  3E6M A;  4RGX A;  3Q9V A;  3TO6 A;  3T8T A;  3BP8 A;  4YFN F;  2JSC A;  2WC2 A;  1YG2 A;  4HX8 A;  1BBY A;  3L9F A;  2ETH A;  1J5Y A;  3DFG A;  1XGS A;  3HYI A;  2DPD A;  3FX3 A;  3WE3 A;  3GFI A;  4L9T A;  3OOP A;  2EA2 A;  1SAX A;  3DP7 A;  2HQN A;  3MWM A;  1F5T A;  3CLO A;  1QO0 D;  3KLO A;  4Y15 A;  1SD7 A;  1U2W A;  5HLH A;  2VXZ A;  2Y75 A;  4FX0 A;  3Q9S A;  4OMZ A;  2UZK A;  3WTS C;  2JRT A;  1ZN2 A;  4R79 A;  2HYF A;  1B9N A;  3NEU A;  5K5R A;  4OIN F;  5J8F A;  3F21 A;  2ZBK A;  2OQR A;  1SFU A;  4XBF A;  2XGX A;  1KQ0 A;  3K2Z A;  3ZMS A;  1FY7 A;  2O8X A;  1A04 A;  2VE9 A;  3IRR A;  3E6D A;  4MEX F;  1U5T C;  4OIR F;  1UST A;  2AXL A;  2LDU A;  2VBY A;  5ICE A;  1PDN C;  3O6B B;  2HR3 A;  3I59 B;  3P9K A;  5AON A;  1SD4 A;  4WXD A;  5J8C A;  4L5J A;  2UWM A;  4G7O F;  1LQ1 A;  3EUH A;  3I53 A;  1R36 A;  3ZN0 A;  1EH8 A;  1ZG3 A;  5FFZ A;  2V79 A;  1WKM A;  1W4M A;  3V8L A;  2VBW A;  2RC4 A;  1SMT A;  3T8R A;  4EJT A;  1CF7 B;  1XSV A;  5CLS A;  5K5O A;  1P92 A;  1IAW A;  3HUG A;  2PJP A;  5L3G A;  4GXO A;  1ON2 A;  4BQA A;  2FF4 A;  4HQM A;  3EDP A;  4AIK A;  2YPR A;  3KP5 A;  2K7L A;  4WK8 F;  2OD5 A;  1G3S A;  4HLY A;  1ZH5 A;  2H94 A;  5ICG A;  3ZQ7 A;  4OIO F;  1ULY A;  1SFX A;  5FLX K;  5FB2 A;  3SFZ A;  4CO8 A;  2QZ8 A;  1XGN A;  1U5T B;  1XDU A;  1QZY A;  3KET A;  4CDG A;  4U0W A;  3HOT A;  3KP7 A;  2WWY A;  1DP7 P;  1YTY A;  2XIG A;  5H20 A;  3HRS A;  2HOE A;  3DKW A;  3ZMU A;  1HSJ A;  3GXO A;  4H0E A;  4MTE A;  1PUE E;  2W84 A;  2QQB A;  2Q8K A;  2HKX A;  4L0Y B;  2FMY A;  5DD4 A;  4P9F A;  1Z1D A;  5DCF A;  1YO5 C;  3QRF F;  4ZYH A;  5IT9 Z;  5D8L B;  1T6S A;  2MBF A;  1BC8 C;  3LQR A;  1Z9C A;  1H9G A;  1Z6R A;  3WTZ A;  1L3L A;  1FX7 A;  2XAF A;  2Y0M A;  3JSO A;  1WWX A;  2LKP A;  2MD5 A;  1V4R A;  3CTA A;  1PP8 F;  1G3Y A;  5DEQ A;  2STW A;  2NS0 A;  4RB0 A;  2CWE A;  2O6G E;  1ZRC A;  2A07 F;  2O61 A;  4N9I A;  3L2C A;  1W5T A;  2PQ8 A;  3FMQ A;  3C18 A;  5BMZ A;  3ZMV A;  5J6X A;  3P9C A;  3RKW A;  3ERE D;  1HKQ A;  1IN7 A;  4HF1 A;  1SFE A;  3KEQ A;  1LDK B;  1RUN A;  4IRG A;  5D5X B;  2UXN A;  2F2E A;  2XAQ A;  2WV0 A;  1R1U A;  1BIA A;  1B1B A;  1R00 A;  3ZP5 A;  1KQ8 A;  2HGC A;  5D4R A;  1R5G A;  1YYV A;  4EVI A;  4A0Y A;  4HQE A;  4ZH4 F;  1HBX G;  4FHT A;  2BE5 F;  4HDU A;  2A68 F;  3M8F A;  5HLG A;  1KU2 A;  4EQQ A;  4LB6 B;  2V6C A;  5EEG A;  4M72 A;  3F8N A;  3LAJ A;  1DPR A;  4G94 A;  1BI0 A;  2UXX A;  3V7R A;  2E7W A;  4P96 A;  2H09 A;  1O3R A;  3F8B A;  3BJO A;  3TOB A;  2ACJ A;  2BYV E;  1MDM A;  1ZGJ A;  5ICF A;  4ZZL A;  2DO7 A;  5LGU A;  3B02 A;  2JPC A;  1YLF A;  1TW2 A;  3RYR A;  3H3Z A;  2BV6 A;  3BPV A;  5BPD A;  4ASN A;  3JAM Z;  2GZW A;  1IN8 A;  1AWC A;  2V1X A;  1I6X A;  1XSD A;  2VOO A;  2Z5U A;  3HSF A;  3O3K A;  1D3Y A;  4PZJ A;  3ZPL A;  5HDG A;  5E18 F;  1O3Q A;  1QGP A;  2IW5 A;  5HVQ C;  3DF8 A;  5L3D A;  3KP3 A;  1OPC A;  2IA2 A;  3BWG A;  1BOA A;  3MCZ A;  4WXH A;  2F5C A;  4ESF A;  2D1V A;  2VBX A;  2IA1 A;  3VEP A;  1Z05 A;  4UV8 A;  1ZG1 A;  2OAZ A;  3FM3 A;  1U78 A;  4XLN F;  1I1S A;  4OIP F;  3E3V A;  1CF7 A;  5HDN A;  3ZMZ A;  3WGH A;  5CVI A;  3GZ6 A;  1UHM A;  1XMA A;  2IPQ X;  4ETS A;  3V8J A;  1Q1H A;  2BGC A;  2VT3 A;  3J81 Z;  5KVR A;  1E2X A;  4HBL A;  1T2K A;  1HKS A;  2GA2 A;  5F6F A;  3ABU A;  4L9N A;  1ZRD A;  3BDD A;  3LA2 A;  1MGT A;  3J80 K;  2CO5 A;  1CGP A;  2A3S A;  1ZGA A;  2LF7 A;  3QAH A;  5ICC A;  3WTY C;  1R58 A;  2P5L C;  4M6Y A;  2GAU A;  1TQM A;  1U5T A;  3GYH X;  2P5K A;  3HSE A;  2PN6 A;  1IRF A;  2PBI A;  3FXU A;  2ZJ2 A;  1YS6 A;  5BPI A;  5H6Q A;  4KNY A;  4LJZ F;  2KRF A;  3RYP A;  3V7C A;  4RGR A;  4KDP A;  4S04 A;  4MHG A;  4WCG A;  2F5F A;  1FC3 A;  2ZKZ A;  4KYW A;  5H6R A;  2KJB A;  1QZZ A;  1OYI A;  1HST A;  4LGW A;  1S8N A;  3FXQ A;  3KZY A;  1AOY A;  5CJ9 A;  1ZLJ A;  3T0Y A;  1ZHF A;  3QU3 A;  2DK5 A;  2HFH A;  3M8E A;  2W25 A;  2AS5 F;  4I0B A;  2XRO A;  4G7H F;  4UUV A;  1FZP B;  4KIG A;  1OR7 A;  1S7A A;  2J5P A;  2YR2 A;  1FBS A;  3HRM A;  2BBY A;  4KMF A;  2CQK A;  2NYX A;  2QEN A;  4Y13 A;  5LLQ A;  4U7D A;  3K1N A;  1I5Z A;  3R0J A;  5ED4 A;  4XRF A;  2EWN A;  2LNB A;  3KZZ A;  3R60 A;  1QNT A;  1U8R A;  3I5U A;  3GO5 A;  5DUK A;  1FYK A;  1FNN A;  1B9M A;  4B09 A;  1W5S A;  2R7D A;  1IN5 A;  1R1T A;  4HF0 A;  1HW5 A;  3IWZ A;  3WGG A;  1EV7 A;  3IKV A;  5LHG A;  4HV6 A;  4BYY A;  4PDK A;  2CG4 A;  2G9W A;  3GFJ A;  1XGM A;  3CUQ C;  2MLK A;  1XN7 A;  5AIQ A;  4WX9 A;  3EYI A;  2DK8 A;  2M45 A;  3QPT A;  4G7Z F;  4UHT A;  1D5V A;  3HHH A;  3WGI A;  1PP7 U;  4AVP A;  3R0A A;  3WTW C;  3HRT A;  4I98 B;  1C0W A;  3FM5 A;  4I01 A;  1MDM B;  2P7V B;  1YFH A;  5ILU A;  2FBI A;  4BNC A;  1KU7 A;  3K9T A;  5CYV A;  2EV0 A;  1L0O C;  4UVA A;  2O3F A;  3J7A O;  2FEZ A;  2VN2 A;  1ZLK A;  3L09 A;  1OYY A;  2TDX A;  3SQN A;  4JK1 X;  1FYL A;  3KCC A;  4YFK F;  1J75 A;  3N97 A;  2FSW A;  4AIJ A;  2IP2 A;  2M30 A;  3I54 A;  2HKO A;  1TNS A;  2EJR A;  4U0Y A;  1XDS A;  2DT5 A;  4CHU A;  2RKH A;  3IKT A;  4TV7 A;  2VON A;  3HTS B;  1GXQ A;  2X0L A;  1EH7 A;  1S7O A;  3RDI A;  3WU0 A;  1G4D A;  6PAX A;  4ON0 A;  3GWZ A;  1XB4 A;  4HYE A;  2H6B A;  1IN6 A;  4O3M A;  5L3C A;  3CUO A;  3O2P E;  4HLX A;  2DI3 A;  1R22 A;  2RDP A;  3U2R A;  3U1D A;  1JHH A;  5A2Q K;  1LDJ A;  5JR3 A;  2Q2E A;  4ZYD A;  2FU4 A;  3KFW X;  4L9V A;  3IL2 A;  3F8C A;  2ELH A;  3VFZ A;  3I4P A;  3MZH A;  1IXR C;  1I1G A;  1T38 A;  2MH9 A;  4KIC A;  2EFN A;  5EEH A;  2ZFW A;  2IJL A;  4IXA A;  4EGZ A;  2GXG A;  1P6R A;  3F22 A;  1O3S A;  4GGG A;  1T39 A;  4Y17 A;  2STT A;  4I2O A;  2F5D A;  1QPM A;  3E97 A;  1RIO H;  4AIH A;  1FOK A;  5ILS A;  3CO6 C;  2P5V A;  2ZXJ A;  4EJO A;  4A0X A;  4XLP F;  2ISZ A;  3BRO A;  2DW4 A;  3EET A;  4HW0 A;  1UCR A;  5TRD A;  4UNO A;  3JTG A;  1B59 A;  2L02 A;  4AWX B;  3LFK A;  2ESH A;  5D5U B;  1IXS B;  3FZV A;  5FLX Z;  4M71 A;  3TGN A;  1VTN C;  1F9N A;  5FD6 A;  1SD5 A;  2V1U A;  1Z6T A;  2OBP A;  3I71 A;  1E17 A;  1P4X A;  2XUB A;  1MJA A;  1IN4 A;  4P9U A;  4YG2 F;  1HXD A;  1YW7 A;  2EB7 A;  2XAG A;  5LRS A;  4ENN A;  1WQ2 A;  4BHP A;  3ECO A;  2H27 A;  1U6G A;  2O0Y A;  1FP1 D;  1LDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...