4HQEA

The crystal structure of qsrr-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
b'MMEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator QsrR
molecule tags Transcription/dna
source organism Staphylococcus aureus
publication title Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR.
pubmed doi rcsb
total genus 38
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hqeA00
2QVOA 1TTYA 4M9ZA 2EFOA 4AIKA 1ZRCA 2HTJA 3T5XA 3GFMA 4NHJA 3GFJA 2H09A 1H9TA 3M7GA 2J5OA 1DUXC 2DT5A 5L3FA 1YS6A 3E5XA 5D5UB 1ZG5A 1FWZA 2K4BA 1I27A 2VC0A 1G3TA 2Y0MA 3G73A 3RKYA 3V7RA 1RI7A 2DQRA 4ZYEA 1TQPA 3J81K 2DK5A 1ZGAA 5BOXA 2DAOA 3KP7A 3KP3A 2IW5A 3RKWA 4IRIA 1QO0D 1K6OA 3TKYA 3U9GA 1EH7A 4LG0A 1VTNC 3E97A 5E20A 5FB2A 2FBHA 1R1VA 4Y13A 3QRFF 4YFNF 3ABUA 2RVCA 2O6GE 1JE8A 1XGNA 3D0SA 5AONA 1QPMA 1FBQA 3Q9VA 4LK0F 2FXAA 2V1XA 5HDKA 3DP7A 1YLFA 2ZKZA 2QUFA 4N0BA 1SMYF 1OYYA 1H0MA 4NB5A 4XLPF 1LEBA 1RNLA 2VONA 1YW9A 4RB1A 2NNYA 5DD8A 2MLGA 1G3WA 3OOPA 1FYMA 2BBYA 1P4XA 2HEOA 1SFEA 1QQIA 1V3FA 3ML6A 1R1UA 5AIPA 1LQ1A 1B9MA 2V79A 1S7AA 1E2XA 1BI0A 2D1VA 3F21A 4UVCA 4I2OA 4HZFA 2OQGA 5D6EA 2K86A 1G4DA 2ZMEB 3C7JA 5ICCA 2L02A 3TDUC 2E1CA 2IPQX 4G7HF 4FX0A 4PGGA 1D5VA 4LGWA 2FRHA 4QWQA 3I59A 1IN6A 3IRQA 2O0YA 3SZPA 4HOBA 3HHGA 2Z5UA 2HZTA 3WU1B 4XBFA 3N4MA 4A0YA 3IHUA 2G7HA 2WWYA 2NNNA 4UNOA 5ILVA 4WF2A 2MH9A 2YX7A 5F6FA 4B8XA 3S2WA 4K2EA 1IUYA 4PGHA 4HX4A 2K27A 4UXNA 1KU7A 3JTHA 5DEQA 4KYWA 3WGGA 3V7SA 1TQIA 3I64A 3H3ZA 3N97A 2EWNA 2WV0A 3HRUA 2G7UA 1BI3A 3GYHX 1CF7B 5ICGA 3BOQA 4Q4ZF 2JSCA 2V9VA 3K1MA 3WTSC 5D8KB 4KFCA 1J59A 1FNNA 2PEXA 2MA3A 3WTYC 4LFUA 4GCVA 1ZLJA 3QPHA 1FOKA 4KUMA 1F5TA 2STTA 3F8CA 3GZ5A 2A69F 2XGXA 3ZMVA 2IA2A 4IHSA 3U2RA 5LHGA 2MH2A 5F64A 1FT9A 4HA8A 1SAXA 4HF2A 1KU2A 3IKVA 2IA1A 5K5QA 5K5RA 3WTUC 4OIPF 5FLXZ 2DTRA 1R58A 4WK8F 2F5FA 2ZNZA 2O8XA 2AXLA 4XSXF 3GFLA 1RUNA 4A12A 3V8JA 4HDVA 4M9SA 2FBIA 1XSDA 3QU6A 2EV5A 2O03A 3WTVC 4HLYA 5E17F 2DPDA 1GVJA 1P4WA 4I02A 5L3CA 4L9JA 4OINF 4MTDA 2Y75A 3CUQA 2CO5A 2QQBA 1BIAA 1MDMA 4IJAA 4LB6B 5BQTA 1ZYRF 1Y0UA 5HDGA 1KYWA 4IRGA 3ZP5A 3KP5A 1PP8F 2QM3A 2JPBA 3Q9SA 3IL2A 2Z9OA 4YFKF 2OU2A 3R60A 1SD7A 5FD5A 4ZYHA 4A6EA 3H3UA 2VBZA 2W85A 4EGZA 2WC2A 4Y15A 1XDUA 4Y17A 1JGSA 2EV6A 2NS0A 5ILUA 2B0LA 1TNSA 1LDDA 4P96A 3I5UA 2L3DA 1LEAA 4G8XA 3EYYA 5CVVA 5JFRA 5FO5A 1MJBA 1S6LA 1XMKA 2VOOA 1ZAOA 5DUKA 4CO8A 4G9YA 5BS6A 1BC8C 4OU0A 1U5TA 1RZ4A 3RKXA 1XDSA 1R7JA 3RJPA 2ELHA 5A2QZ 2W57A 2KKOA 1SD6A 4EM0B 2A68F 3DEUA 2EFWA 5HDNA 3JAMZ 2HGCA 1MZBA 1KU3A 5LLQA 2DFIA 4U7DA 3M9AA 1U5TB 2NRAC 4I0AA 4IPAA 3HIFA 2XASA 3TQNA 4LMYA 2CW0F 1F9NA 3FM3A 5EEHA 1UCRA 3L9FA 2F2EA 2LF7A 2A6EF 3IWFA 4RGRA 3BJ6A 4PDKA 4M6XA 3FXRA 3FM5A 4MEXF 1FP1D 3I0TA 1BI1A 4P55A 3M8FA 1KQ9A 1MD0A 3CLOA 3V8LA 1B1BA 1PP7U 2C6YA 4BH9A 2J5PA 3FXQA 3LQQA 4WX9A 1DP7P 4O5VA 2BYVE 4CGZA 4MEYF 4M6YA 3WTTC 1FLIA 3RPQA 1ZGJA 3WGIA 2PI0A 2XROA 1Z6TA 2QENA 3BPVA 2RN7A 3HHHA 3WG9A 4WXCA 5L3BA 2HYFA 4Q47A 1FSEA 2L54A 2LDUA 1LDKB 2XKOA 3CO6C 3VEPA 4G6QA 1SD4A 3E5UA 4FT8A 4RAZA 3ZMZA 5JI6A 2L4MA 4LLGF 2XUBA 2EB7A 2FF4A 2OZUA 1J2XA 4CHUA 2M5WA 1CGPA 2G9WA 3HTUA 1OR7A 5HLHA 1FC3A 4WWCA 3GO5A 5LHIA 2Z99A 3K69A 4EJOA 3EETA 4CDGA 1HXDA 3ZMSA 2EFQA 1XGMA 1AWCA 4ETSA 3R0AA 3TGNA 3KLNA 2P5LC 3T1BA 1A04A 2QBYA 2M8EA 2HS5A 4A5NA 1H9GA 4IXAA 3ZQ7A 2EFNA 1G6NA 3QPTA 2PLYA 2P6SA 4U0VA 4G94A 3DKWA 3JW4A 3I54A 3FX3A 2GAUA 1R00A 1ULYA 4JQFA 1BM9A 3KZZA 1XB4A 4L9NA 2P7CB 4RGXA 2ISZA 5LHHA 1MDMB 3J80K 2FMYA 2H6BA 4L0ZB 2EK5A 4UVAA 2E1NA 4S04A 3MQ0A 1MJ9A 4XRFA 3R6SA 5A2QK 3WTWC 2RQPA 3TO9A 1JXSA 2FNAA 1YO5C 5LGUA 3JAMK 1I5ZA 3O6BB 1T39A 5LGNA 3HSRA 2HTSA 2DI3A 3RDIA 1W5TA 2OA4A 4G7ZF 1S8NA 4IVNA 4P9UA 5BMZA 4M71A 5HS7A 1D3YA 1WWXA 2X0LA 3BY6A 4L18B 3F3XA 2JPCA 2ESHA 5ILSA 4HV6A 3RI4A 2Q2EA 4U0YA 4G6DA 4ON0A 1R36A 2K02A 3CUOA 3FMRA 2IRFG 3I4PA 1HKTA 3KP6A 1W5SA 4OIOF 2CGPA 5J8FA 4EQQA 3IC7A 4KIBA 3I71A 3VOEA 2FOKA 3ZMTA 1QBJA 2V1UA 2GQQA 4BHPA 4KICA 2VT3A 4EVIA 3B02A 1KU9A 3E6DA 2VBXA 4G7OF 1I1SA 1R1TA 3F6OA 2F5DA 5L3EA 4LG0B 1SFUA 1Z7UA 5J8CA 3J7AO 5H20A 3I53A 4UHTA 3KFWX 1E17A 3LA2A 3JSPA 2DLLA 2KRFA 4TV7A 2UXNA 4YIFA 3IRRA 1O57A 1T2KA 1W4MA 4O3MA 2HR3A 2QYOA 3F8BA 4HLXA 4R8HA 3G3ZA 3ZMDA 4AWXB 2VBWA 4NQWA 2EFPA 1SFXA 2OD5A 1FSHA 2CG4A 4DQ2A 2JZYA 2HYGD 2P7VB 1AOYA 3EDPA 4GGGA 3E6MA 1YIOA 3K1PA 4CXFA 2V6CA 2FE3A 3PFIA 4JBAA 4EM1A 3V4GA 4XSZF 1IW7F 4AVPA 2ZXJA 2RV8A 3ZN1A 1K78B 1T38A 1XD7A 4L5IA 2QZ8A 2H94A 2DPUA 1LVAA 1K79A 2IA0A 3L2CA 2KJCA 4UV9A 3RPUA 1V4RA 5HLGA 4ZZLA 2FEZA 4N9IA 1WRJA 3L7WA 4HX7A 5KK1A 3TO6A 2RGVA 1IXCA 2LSOA 3QP5A 3M1EA 1IN5A 2XRNA 1OYWA 2XKPA 1ZHFA 5LRRA 4P5OA 1ZARA 3HUGA 1Z05A 5LBQA 5AIQA 3VB2A 4M73A 4I0BA 1IF1A 1J5YA 1IRFA 3RYPA 2ZBKA 3K9TA 2GA2A 4ZYDA 1Q1HA 5HOOA 4RGSA 4EMSA 1HQCA 2FQ3A 1LNWA 1YW7A 1P2FA 3GVAA 5E18F 1J9IA 4QLCU 2CFXA 1HSJA 3LQRA 1DPUA 3LFKA 1X3UA 3K0LA 2BE5F 1JHHA 5DYMA 3AAFA 3HOSA 5HS8A 3OV8A 3DQVC 2PMUA 5E1WA 3PQKA 2H27A 3LAPA 4L5JA 4WXHA 1ODDA 3QOPA 5FLXK 3NEUA 3CUQB 2ACJA 2XAJA 4EM2A 3R0JA 1WSUA 1FY7A 3CTAA 1GHCA 3R4KA 1IXRC 2VE8A 4M9XA 3SFZA 4EJWA 1W7PD 5HVQC 1BN5A 1YQAA 5DDGA 1IXSB 1ZRDA 3K1NA 4MGRA 3FXUA 3HOTA 3TOBA 4JK1X 2WTEA 5BPIA 2Q0OA 1XCVA 2FA5A 2O61A 2KIMA 4A0ZA 1FBUA 4ENMA 1IN7A 5DUIA 4KT5C 4OOIA 4AD9A 2A5YB 1R5GA 4LJZF 3FMQA 1PDNC 4ENJA 1K7AA 5IT9K 2PJPA 5J6XA 3EUHA 4I98B 4GYIA 2HDCA 1O7FA 1O3TA 2A61A 1BJAA 1R23A 2KIFA 4XLNF 2M1BA 3BJAA 1BBYA 1OPCA 1B9NA 3GW2A 2ZO4A 3MCZA 1O7LA 3RTRA 5D5WB 2XVCA 1HW5A 3F8NA 2HQRA 1EH8A 3BP8A 1TQMA 2VXZA 4GYGA 3QP6A 2A6HF 3HSFA 1BC7C 1USSA 4HYEA 1XGOA 4RB3C 4AIHA 2R3SA 2V1DA 2MLKA 2ESNA 4FHTA 4WXDA 3ZPLA 1OYIA 2VN2A 1F4KA 4YG2F 2EA2A 4GXOA 2R7DA 3TO7A 4WCGA 1JHFA 2HOEA 1QZZA 3DFGA 5L3DA 4EJVA 3WE2A 3T0YA 3KEQA 2VT2A 5DD4A 1CF7A 3GXOA 4KMUX 2QQAA 4I7HA 2GXBA 3W6JB 4OIRF 2ZFWA 2HQNA 2P8TA 4ESBA 2A3SA 5ERIA 1O3RA 3KLOA 4UUVA 4KIGA 2YSRA 2BEOA 3NQOA 2MC3A 3P9KA 1LB2A 3I59B 3J81Z 1B6AA 3Q5FA 2HWVA 3DF8A 1B59A 5F1RA 3KP4A 3DPTA 1XCBA 2OAZA 5DCMB 4ESJA 3WGHA 2MD5A 3REOA 3SHFA 2Y48A 1SD5A 2VE9A 5IT3A 5JR3A 2JTVA 4ASNA 2OZ6A 1U8RA 5E8IA 1XSXA 3V7CA 1BIBA 1XSVA 1J75A 3ROUA 1Z6RA 5CVUA 5LRSA 1UHWA 2KIUA 3SQNA 4MQ9F 3DPLC 2FNPA 2PBIA 1J0RA 4Z2YA 4IRHA 4CYDA 2W24A 4RAYA 3MFKA 1IN8A 1ON1A 4R1HA 2D1HA 4BXUA 3MWMA 2XIGA 4ZZDA 4LLNA 4HBLA 2LNBA 3HYIA 4HF0A 3FZVA 3C18A 5ICEA 4EJTA 2IVMA 2OQRA 2YU3A 5D8LB 3CJNA 5HLIA 2HKXA 2ZMEA 2ZCWA 3FHZA 2MBFA 2Z33A 2CQKA 3L00A 4Q5SF 4RB2C 4Q48A 3ZMUA 1IN4A 3GEZA 4YIIA 1TNTA 3LSTA 1MJAA 3PQJA 1RIOH 2LKPA 1K78A 3F22A 1KQ0A 1I6XA 2XAFA 5IT9Z 5FFXA 2CSOA 2YR2A 2RC4A 1YTYA 1I1GA 4FX4A 2F5EA 4B09A 3F23A 1WI9A 3T8TA 2IJLA 2EA4A 4BNCA 3KCCA 1ZLKA 4N9HA 5CLSA 3U1DA 2COMA 1ZG3A 5D5VB 3HRSA 3E3VA 1DPRA 3KETA 1KQ8A 1EV7A 4U7BA 1LDJA 4LB5A 4PCQA 3MEXA 1S7OA 4M72A 4O6JA 3FWEA 2XAGA 4AIJA 2FSWA 4KN7X 4MQVA 2OBPA 4LLLA 1T0FA 2UZKA 2QQ9A 2NYXA 4HDUA 2QWWA 1KA8A 2FU4A 1HKQA 4EJUA 5D4SA 3HRTA 2EV0A 5JHUA 4EGYA 1IZ1A 4RS8A 2D2WA 1YFHA 4OIQF 1UHMA 3D5LA 2DQLA 2DU9A 1U2WA 3MAJA 3QAHA 3C1DA 3V8KA 2P5VA 1QGPA 4HV5A 3E6CC 1L3LA 3FMSA 1OMIA 1YW8A 2D45A 5K1YA 4IF4A 1FBSA 3CDHA 1ZN2A 1TW2A 3GUDA 4ZYGA 4EV0A 3P7NA 4P9FA 3IWZA 4KMFA 4KA4A 5D6FA 3KP2A 1TLHB 3BJOA 1G3SA 5DV5A 2RNJA 3NRVA 3ELKA 3TOAA 2DBBA 1KGSA 1GXQA 2IP2A 3BZ6A 1B4AA 4L9VA 3T8RA 4U88A 2GWRA 2M87A 1ON2A 4A0XA 3SZTA 1QNTA 2IT0A 2X4HA 4CZZA 2LF8A 1L0OC 1MGTA 1S29A 3HTSB 4OMZA 4RB0A 3VODA 4BAYA 5DCFA 5ED4A 3LAJA 3QU3A 4LD5A 2L4AA 5CVJA 4ZH4F 2R7FA 4BQAA 4MHGA 2VC1A 5LEKA 2A07F 2K7LA 3L09A 1STZA 3ERED 4RGUA 2CWEA 1NHAA 4S05A 5E1ZB 3GZ6A 3GX4X 2W25A 3TDZC 2BV6A 1HKSA 1P4AA 2DW4A 3ISPA 5LEJA 2P5KA 1IRGA 3F6VA 2H6CA 3F72A 4R79A 1USTA 1U5TC 1W7PB 1WQ2A 2STWA 3ULQB 4BHCA 1U78A 4DNCA 3WTZA 3MZHA 3H92A 3RYRA 1SMTA 2M30A 2NAZA 1ZG1A 2VODA 3F8MA 3K2ZA 4MTEA 3WTXC 1Z9CA 2KJBA 2DO7A 3DV8A 3GWZA 2YPRA 5L3GA 5H6QA 3ECHA 3HSEA 2RDPA 1HW2A 3F8FA 4A2UA 2JRTA 1U6GA 2GZWA 4L0YB 1ONVA 1LJ9A 4HQMA 5BPDA 3CO7C 5EEGA 2HFHA 1KYZA 3HRMA 3DXJF 5KVRA 1XGSA 2CYYA 1TBXA 2HKOA 3P9IA 5TJJA 3LWFA 3W6KB 2FMLA 1WKMA 1MKMA 4GO1A 4HAMA 5HS9A 3FF5A 2PMHA 4U0WA 1J7KA 3WU0A 3GF2A 2AS5F 4UVBA 1PUEE 3IKTA 4MNUA 4E70A 4OMYA 4HQEA 3O3KA 1IAWA 2FBKA 1S3JA 5FGMA 3LA3A 5FD6A 3ZN0A 3EQLF 2BGCA 5D5XB 2EJRA 2Q8KA 5CVIA 3E6BA 4ENNA 3KEOA 2XV4S 5D4RA 2PFBA 4IHTA 2VBYA 1QZYA 5TRDA 1O3QA 1RUOA 2XAHA 3ABTA 4F7ZA 1OKRA 3BWGA 3MZYA 4D0PA 2ADUA 1REPC 1Z91A 5K5OA 1XN7A 4ENKA 3WODF 4HF1A 5E8GA 2RKHA 2VOPA 1D8KA 1FPQA 1UB9A 4HX8A 3GFIA 4I01A 1R22A 5LGTA 5FFZA 3JTGA 2XAQA 3CUQC 5CYVA 1FP2A 1C0WA 3E5QA 1G3YA 2GIVA 3VFZA 2P6TA 2XHKA 3R61A 1FYKA 4BYYA 1ZH5A 2E7WA 2JT1A 1FZPB 1D8JA 4H0EA 4CICA 1ZRFA 4ESFA 4YFXF 2GXGA 2W84A 4KN4X 1T98A 4KNYA 1TW3A 3ECOA 2YX4A 4BHBA 1O3SA 3C3WA 3BPXA 1BI2A 5DCMA 4PZJA 2ZNYA 1Z1DA 2ETHA 2QLZA 1HW1A 1BOAA 3RIRA 4A6DA 2K4JA 2QBYB 1F1ZA 2GA1A 3GLXA 3COAC 3KE2A 5JVTA 2ISYA 4M74A 1U3EM 4LK1F 3BDDA 2Z3YA 5H6RA 3P9CA 5E1XA 5ICFA 1P6RA 1UFMA 2ZJ2A 3EYIA 1FX7A 2M45A 2O3FA 3BROA 1HSTA 3M8EA 3WE3A 5CJ9A 1GXPA 1DDNA 3SXYA 2UWMA 3B73A 1XMAA 2UXXA 1EH6A 5CVRA 3JSOA 4L9TA 2F5CA 4UV8A 2P4WA 1HBXG 4I09A 1T6SA 1YS7A 3I58A 4HW0A 4A5MA 3LA7A 1FYLA 2E7XA 3O2PE 3KZYA 6PAXA 1ZREA 1YG2A 2PQ8A 2TDXA 2PG4A 2L01A 4KIFA 2PN6A 1W7PA 4KDPA 1R5HA 3J80Z 2DK8A 1YYVA 1P92A
chains in the Genus database with same CATH superfamily
2QVOA 1TTYA 2CS3A 4M9ZA 2EFOA 1CQTA 1UJ8A 3QQAA 1AA7A 4AIKA 1ZRCA 3HC7A 2HTJA 3O8HA 3ZQCA 3T5XA 2HOSA 2LREA 3GFMA 4Z6YA 4NHJA 3GFJA 2H09A 1BW5A 2E1OA 4B48A 1LPQA 2OPTA 2UUZA 1H9TA 3M7GA 5K7HA 2J5OA 1Z67A 2OV7A 1DUXC 2DT5A 2XPVA 4U87A 1YS6A 3E5XA 5L3FA 5D5UB 3U1KA 2HYJA 1ZG5A 3JCUC 1FWZA 2CJJA 2K4BA 1I27A 2VC0A 1G3TA 2Y0MA 3G73A 2WY7Q 3RKYA 3V7RA 1RI7A 2DQRA 4ZYEA 1TQPA 4XKWA 3J81K 2ELJA 1E3OC 1PUFB 4W97A 2DK5A 3DEEA 3K4MA 2KMUA 1ZGAA 2LRDA 3KZIC 4HG2A 5BOXA 2DAOA 3KP7A 4BEHB 1GDTA 2HQ5A 3KP3A 2IW5A 1IRZA 3SYTA 3RKWA 5CPRB 2KL4A 3BTLA 4IRIA 2WAEA 3BG9A 1QO0D 2Z2SB 1K6OA 1E0EA 1IG7A 3TKYA 5CKTA 3U9GA 4IZZA 1EH7A 1ZTRA 5FKNA 4LG0A 4B44A 1VTNC 2F48A 1VQOI 3E97A 2HVQA 3P5JA 2CW7A 4F52A 4DJAA 5E20A 4NC6A 5FB2A 2FBHA 2CUFA 2XB0X 2VQCA 4LG3A 1QVUA 2E5ZA 2H8RA 1R1VA 4I99C 4Y13A 2KRCA 2HU9A 3QRFF 4YFNF 2E19A 2M3AA 3ABUA 3DLAA 2RVCA 4NQWB 4ZC3A 2O6GE 1JE8A 1XGNA 3D0SA 2W4SA 1QPMA 1FBQA 3Q9VA 5AONA 5JVGF 3WU2C 2XDVA 2B9SA 4LK0F 2FXAA 1I3AA 2V1XA 2OF7A 5HDKA 3DP7A 1YLFA 2ZKZA 2QUFA 1S72I 3DBHB 4N0BA 1SMYF 2EQRA 4PJ0C 1MBHA 1OYYA 1D0ZA 4II2A 1JKQC 1U9OA 1H0MA 4NB5A 4XLPF 3K6GA 1FMWA 1LEBA 2LKXA 3S15J 1WH7A 2L7MP 3QYEA 3OS0A 1RNLA 2VONA 3CDLA 4JYKA 2X6YA 1BR1A 1VQ5I 1YW9A 3H0DA 4RB1A 3RPUD 2NNYA 2WAQN 5DD8A 1R5ID 1E3PA 2MLGA 1G3WA 1HDPA 2LLKA 4F55A 1TP4A 2K9MA 1YIJI 1X4OA 3OOPA 2WY8Q 3CMYA 3S93A 3D1NI 1FYMA 2BBYA 1P4XA 2HEOA 1D1BA 1SFEA 4GDFA 1QQIA 1V3FA 3ML6A 3HOVJ 3K70D 1X4PA 1R1UA 5AIPA 4BQNA 3IH2A 2KISA 1LQ1A 4M3FA 4Y52J 1B9MA 3HPGA 2V79A 1S7AA 1WJCA 1E2XA 2I10A 1BI0A 2D1VA 3F21A 4UVCA 4I2OA 1IUFA 4HZFA 2IEKA 2OQGA 5D6EA 2K86A 5J1UA 1G4DA 2ZMEB 3C7JA 5ICCA 2L02A 3B6CA 2ECCA 3VYRB 3TDUC 2E1CA 3OYEA 2IPQX 1T0FC 2EIKH 2KLOA 4FX0A 4PGGA 5GP9A 4G7HF 1D5VA 1ZQ3P 3EUHC 2ZXHA 4LGWA 2FRHA 1Y0NA 4QWQA 3I59A 2IS1A 3CESA 4XICA 2O7OA 2X1CA 1IN6A 2EIMH 5JLXA 1WJBA 3CP8A 5EG0A 1APLC 3IRQA 2O0YA 3SZPA 4NNJA 4HOBA 3HHGA 2Z5UA 2HZTA 3WU1B 4XBFA 3BR1A 4A0YA 3N4MA 3IHUA 2LR8A 2WA0A 3H9JA 2I8DA 2G7HA 2WWYA 2NNNA 4UNOA 5ILVA 2BY2A 5J47A 1X58A 3H9QA 4XMYA 2X6XA 4WF2A 2JA5J 2MH9A 2YX7A 3K7AJ 5F6FA 4B8XA 1MBEA 2K9LA 3S2WA 4BACA 1VNDA 2KP6A 1J09A 1OCZH 4K2EA 1VQ9I 3BG6A 1IUYA 2XF5A 4PGHA 3GTOJ 4HX4A 1WI3A 2VQGA 4PSXA 2K27A 4JP0A 4UXNA 4RM3A 3WHCA 1KU7A 3JTHA 3N05A 5DEQA 4KYWA 2M0CA 3WGGA 2W82A 4UUSB 1I39A 2M34A 2LP0A 1P9QC 1WVRA 3V7SA 1TQIA 3I64A 3KEYA 3H3ZA 4BQQA 3N97A 2EWNA 2WV0A 2JWTA 4BJ5C 3HRUA 2G7UA 2JA8J 1BI3A 2IAIA 3GYHX 1CF7B 2EIJH 5ICGA 3BOQA 2X6WA 3EUAA 3BG7A 3NARA 3CJTB 3H35A 3RZOJ 4Q4ZF 2CQNA 2JSCA 2V9VA 3VYTB 3K1MA 5J1RA 1POGA 2HXIA 3WTSC 5D8KB 3FDYA 3A0BC 1MMDA 4KFCA 4CA0A 3AG2H 2K40A 1Z3XA 1J59A 1FNNA 2GOMA 5C3EJ 2PEXA 3LMMA 2MA3A 1SVOA 1UHSA 1W5CC 3WTYC 4LFUA 1SVMA 4GCVA 1ZLJA 4X1EA 3QPHA 3TW6A 1FOKA 1SAUA 4KUMA 1B72B 2MGQA 1IJWC 1F5TA 5IP6A 2AO9A 2STTA 1B8IB 4FTHA 4XQFA 1MBGA 3F8CA 3GZ5A 1H88C 1O4XA 2A69F 2X1EA 2XGXA 2D5VA 2LC2A 3I3LA 2ECBA 2OJED 2KDZA 2E71A 2DODA 3GTGJ 3ZMVA 4PJNA 2KZGA 2IA2A 4F3QA 3FK6A 4IHSA 3U2RA 5LHGA 4D5CA 2MH2A 5M5XJ 5F64A 1FT9A 4HA8A 3RQ4A 3CF5F 1SAXA 4HF2A 4RLQA 1KU2A 5FRMA 3DPUA 2GIZA 3IKVA 3A2KA 2IA1A 3A02A 5K5QA 1IDZA 3M07A 4KT6A 5K5RA 1V54H 3WTUC 4OIPF 5FLXZ 3I4NJ 5EF6A 2XC7A 3H36A 2DTRA 3JRIA 1R58A 4WK8F 4C30A 1G2HA 1OISA 2HZDA 2F5FA 2IBDA 2ZNZA 2O8XA 2AXLA 2LYCA 4XSXF 3GFLA 1RUNA 3V42A 4A12A 2R7XA 2A5WA 3CMMA 3V8JA 3ZQIA 4HDVA 2NOGA 4M9SA 2FBIA 1XSDA 3QU6A 2GM4A 3BTJA 2EV5A 2O03A 3WTVC 1NK3P 4HLYA 1XG1A 2VPRA 5E17F 4CCOA 2DPDA 4ZTJA 1GVJA 1P4WA 4I02A 4A3IJ 1G8XA 5L3CA 4L9JA 4OINF 3W3CA 1WJAA 4MTDA 1RESA 3FK7A 3CCUI 2VLAA 2Y75A 3KYLA 3TW7A 3RZDJ 3CUQA 2CO5A 4DGWB 5F27A 2QQBA 1BIAA 9ANTA 1MDMA 4IJAA 3GCMA 1JKPC 4LB6B 5BQTA 3OSGA 1ZYRF 2VI6A 2FD5A 4AUXA 1MNMC 1MMNA 1ZKGA 2L7FP 1GT0C 1Y0UA 5HNHA 3C2HA 5HDGA 1KYWA 4IRGA 3ZP5A 3KP5A 3S17J 1PP8F 2LBFA 2X1DA 2QM3A 2DOEA 3E1SA 2JPBA 3Q9SA 3IL2A 2Z9OA 3DCFA 4IEJA 4YFKF 2OU2A 3R60A 1SD7A 5FD5A 3FBNB 1EKEA 4ZYHA 4KITB 1YHQI 4A6EA 2L7ZA 3S14J 3H3UA 4HPQA 2VBZA 2W85A 4EGZA 3KX2A 2WC2A 4Y15A 3WG7H 1XDUA 4Y17A 1JGSA 2EV6A 2NS0A 5ILUA 2VKDA 2B0LA 2VASA 1DU6A 1TNSA 1LDDA 4FE7A 2F4IA 4P96A 4C3JJ 3I5UA 2L3DA 3K4LA 3HBLA 1LEAA 1OCOH 5HODA 4G8XA 1MMSA 4DBQA 3EYYA 2LY9A 5CVVA 5CQEA 2DYRH 5JFRA 1P7IA 5GAGJ 5FO5A 1X2NA 3L2WA 4F93B 2RQQA 2NVTJ 2JA6J 3FISA 1MJBA 1S6LA 1XMKA 3MVPA 2VOOA 3MKWB 2Y0SA 4Y33A 1ZAOA 5DUKA 4AYBN 4CO8A 1DGWY 4G9YA 5BS6A 4F91B 1YE9A 1BC8C 3CCVI 4IQJA 4OU0A 2BHZA 1IRXA 1U5TA 1RZ4A 1K83J 2RAEA 3RKXA 3PO2J 1XDSA 3FKJA 1R7JA 2E60A 4UB6C 4XKVA 2ELHA 3RJPA 5E3LA 2W57A 5A2QZ 3S3MA 2COBA 2DFHA 2XF6A 2KKOA 4QPQA 5GTIC 1SD6A 5CQGA 1JUMA 4EM0B 4BKXA 2A68F 3DEUA 2EFWA 1IGNA 5HDNA 3JAMZ 2HGCA 1MZBA 1KU3A 2W48A 5LLQA 2DFIA 1WZ2A 2PMZA 3BLYA 1YJWI 4U7DA 5K7ZA 2GBYA 3M9AA 1U5TB 2NRAC 4I0AA 4PSWA 4IPAA 3HIFA 3AG3H 2XASA 2CQQA 3ABKH 3TQNA 4LMYA 2CW0F 4RA2A 4MFEA 4L5EA 1F9NA 1MH3A 4NDLA 1Y39A 3FM3A 5EEHA 1UCRA 2E34A 3ABLH 3OL3A 3L9FA 2ZSHB 3TL4X 4KISA 2F2EA 1PVEA 1WFXA 3K2AA 3OR1C 2CH0A 2R0QC 3OS2A 2LF7A 2A6EF 1TWFJ 1ETXA 3IWFA 3OYDA 4RGRA 2E1MC 4MFDA 3BJ6A 4BQOA 4PDKA 4M6XA 2K9QA 1PUFA 3FXRA 1TL8A 3FM5A 4MEXF 1FP1D 3I0TA 1BI1A 3AG4H 4P55A 1NK2P 3M8FA 2O9LA 1KQ9A 1MD0A 3CLOA 3V8LA 5KAIC 1N25A 1B1BA 3SJMA 2FX0A 1YJNI 1W0TA 1PP7U 2C6YA 1OCPA 4BH9A 2J5PA 3S3NA 2VB6A 4CSWA 3FXQA 1QRYA 2YUSA 3LQQA 5C44J 3CDIA 2IS6A 2ICWG 3CP2A 4WX9A 3S1MJ 4YIRX 2ZC2A 1ACIA 1DP7P 4O5VA 2BYVE 4CGZA 2DXIA 1DGRM 3LSMA 4MEYF 4D7MA 2CFOA 5KNLA 1RKTA 4JX4A 2DJIA 4M6YA 3WTTC 1FLIA 3RPQA 1ZGJA 3WGIA 2PI0A 4C3HJ 1Y56A 2XROA 1Z6TA 2QENA 3BPVA 3CCRI 2RN7A 3HHHA 3WG9A 2PJRB 4WXCA 5L3BA 2HYFA 2EZKA 3RSNA 2LMDA 4IQ4A 4AC0A 4Q47A 2ZFUA 3OYBA 4LOCA 4C2MJ 2AQFA 2MSYA 1FSEA 2R7UA 2MABA 5GPCA 3JRBA 4XK4A 2L54A 2LDUA 1LDKB 2XKOA 3CO6C 3VEPA 4G6QA 1SD4A 2DN0A 2E5NA 2QQ8A 4XONA 3DBLB 2H8WA 3E5UA 1V5GA 4FT8A 4XLHA 1TT5B 2NVXJ 3M1CA 4RAZA 2OUMA 3ZMZA 3CJQB 2FOWA 2OCCH 4XRSG 5JI6A 2L4MA 2IGNA 4LLGF 2XUBA 2EB7A 2DT6A 2FF4A 2OZUA 1J2XA 4XM3A 4CHUA 1LVKA 1W36D 1MBKA 1VQKI 1Y6IA 2VPLA 4IHYA 2M5WA 1SVLA 1CGPA 1WHUA 2G9WA 3MZ8A 1SANA 3HTUA 3KYCB 1OR7A 1Y8QB 5HLHA 1FC3A 4IOCF 4WWCA 3GO5A 5LHIA 2Z99A 2M4KA 3VSLA 3F0CA 3K69A 4EJOA 2VKVA 5DM6F 3HB9A 1T08B 2JUGA 3EETA 1R6RA 4CDGA 1LE8B 5FKOA 4D7NA 1HXDA 2MFZA 3ZMSA 2EFQA 1XGMA 1FEXA 1AWCA 3A4CA 5JLWA 1AHDP 4ETSA 4A3CJ 3R0AA 3JRDA 4UB8C 4ZDPA 3TBIA 4CCJA 3TGNA 3KLNA 3ONQA 2P5LC 3K4BA 3HEFA 3T1BA 1A04A 3VDXA 3QYFA 3JRHA 2QBYA 2M8EA 2RREA 2HS5A 4A5NA 1H9GA 2KT0A 4IXAA 3ZQ7A 2EFNA 2XGEA 5F0HA 1G6NA 2H1KA 3QPTA 2PLYA 2F6CA 1FMVA 2P6SA 3DLLF 2KPMA 3ERMA 2K9SA 1HA8A 2TRTA 4U0VA 4G94A 3DKWA 4BE1A 3JW4A 4G6TB 3I54A 1VF9A 2X9DA 1ETQA 3FX3A 3PNYA 2GAUA 2FJ1A 3NAUA 1R00A 1ULYA 4JQFA 2K9NA 4A3MJ 5GAHJ 2K5CA 3OIPA 4ZTFA 1BM9A 3KZZA 1XB4A 4DBRA 4L9NA 2P7CB 4Y3OA 4RGXA 2ISZA 5LHHA 1MDMB 3J80K 2FMYA 3PUBA 2F4OB 2H6BA 4F92B 4JX5A 4L0ZB 1V5FA 3FXOA 4A3GJ 1LFBA 2XPUA 3BG3A 3QOEA 2EK5A 1VQNI 4UVAA 2E1NA 3ABMH 4S04A 3MQ0A 1MJ9A 4XRFA 1OQYA 3R6SA 5A2QK 3WTWC 3O8GA 2RQPA 3OL4A 2DMTA 2R4GA 3TO9A 2R7ZJ 2EPFA 1D0YA 3TP3A 3JRCA 1E3HA 4FISA 1JXSA 4XORA 2FNAA 3DU5A 1YO5C 5EGOB 5LGUA 5EZHA 5B5EC 3JAMK 2DA7A 2MG4A 4XRSA 1I5ZA 2XGDA 3SDGA 3O6BB 1T39A 5LGNA 1K6YA 3PFYA 1N75A 4YELA 3HSRA 1TZLA 2HTSA 3M8JA 2ZMEC 4E7IA 2DI3A 1ZGWA 2BVLA 4UY8I 3RDIA 3GTLJ 3DTEA 1YRNB 1W5TA 2OA4A 1TT0A 4G7ZF 2X51A 3IH4A 5M3FJ 1S8NA 4IVNA 4P9UA 5BMZA 5KCMA 4M71A 3PNVA 3BQZA 5HS7A 3SEZA 1D3YA 1WWXA 3GTJJ 5IOZA 2X0LA 3SZGA 3BY6A 3DKXA 1BL0A 4L18B 2K3PA 3F3XA 2JJ7A 2JPCA 3AG1H 2ESHA 3HGYA 5ILSA 4HV6A 3RI4A 2BZTA 3A0HC 5FROA 1X1DA 1ETYA 2CUEA 2Q2EA 4U0YA 1BOBA 4G6DA 4ON0A 4EEFG 1R36A 3K4KA 5B66C 2K02A 4BE2A 3H5AA 3CUOA 3A1YA 2DT7B 3FMRA 2IRFG 3I4PA 4AVZA 3GMEA 1HKTA 3FHNA 2F5VA 3KP6A 1W5SA 4OIOF 4D1QA 2CGPA 2V26A 5J8FA 4EQQA 2X48A 3IC7A 3MD2A 4KIBA 3I71A 3VOEA 2FOKA 2LH9A 3ZMTA 1ORKA 1QBJA 4P1WA 2LK2A 1AKHA 2V1UA 2GQQA 2V1NA 4BHPA 4M3GA 2DMPA 4KICA 2VT3A 4EVIA 3B02A 3CCYA 5FLVA 1KU9A 3W2AA 3LSJA 1BA5A 3E6DA 2IXSA 2VBXA 3ZQGA 3CC7I 2A6TA 4G7OF 1I1SA 1R1TA 3F6OA 2F5DA 5L3EA 3GTMJ 5LFAA 2MW8A 1HOMA 3NWTA 1SFKA 4LG0B 1SFUA 1VI0A 4PUSA 4CZCA 1Z7UA 2VJ5A 4B3XA 5J8CA 4RLFA 5KHDA 4XN3A 3VPRA 3J7AO 1QVTA 5C4XJ 4BEHA 3ESWB 3OYHA 5HLTA 3A01A 5H20A 4M3EA 3I53A 4XOPA 1B72A 2XRLA 2QSHX 1ITYA 4UHTA 3CCQI 4QTRA 4CCMA 3KFWX 1E17A 3LA2A 3JSPA 2Y0SN 2VJJA 4AYBA 4Y7NJ 2DLLA 2CU7A 3I4MJ 4IKFA 2KRFA 3QYBA 1VQLI 1K4TA 1MIJA 1WH5A 4TV7A 2UXNA 2M0MA 4YIFA 3H0GJ 1O57A 3IRRA 2M7BA 1T2KA 1W4MA 2Q2EB 1ZELA 4O3MA 2HR3A 3D5SC 1FIPA 4CCLA 1XMXA 4HNTA 2QYOA 3F8BA 4HLXA 4R8HA 3G3ZA 3ZMDA 4AWXB 4J00A 2BW3B 2VBWA 4NQWA 1NTCA 2EFPA 1A5JA 1XC5A 3G2BA 3BZCA 4ZDOA 1SFXA 3OYMA 2OD5A 5EJCA 1SEUA 4NUBA 1WJFA 2MYSA 5IP7J 2QGUA 1FSHA 2CG4A 1VQ7I 2V6EA 2HVRA 4PJMA 4DQ2A 2JZYA 2HYGD 2R5ZB 2XF7A 2P7VB 2BXYA 5IP9J 2NVUB 1AOYA 3EDPA 3U21A 5J40A 1WCMJ 4GGGA 4ABZA 2DA1A 3E6MA 1YIOA 1DP3A 2X6OA 3K1PA 1ZR4A 1UELB 3S32A 1FOWA 4CXFA 2HXOA 2V6CA 2FE3A 3OIQA 3PFIA 1TWHJ 3HKZA 3FXJA 4JBAA 2IS4A 2ID6A 2IS2A 4EM1A 4OAYA 3V4GA 2Q1ZB 2M2EA 4N4NB 4XSZF 2XAUA 3G71I 2XSDC 2LY2A 1IW7F 4AVPA 2ZXJA 2RV8A 1XX5A 1Y1VJ 3ZN1A 1K78B 1ZK8A 1SFOJ 2E2JJ 1T38A 1XD7A 4BXFA 4L5IA 2QZ8A 3IAS2 2H94A 2DPUA 1LVAA 4A3EJ 1MMGA 2LTPA 2EH3A 1K79A 2IA0A 2KIQA 3L2CA 2KJCA 4UV9A 3RPUA 4A3BJ 1H8AC 1V4RA 5HLGA 4ZZLA 3I56I 2FEZA 4N9IA 3S1RJ 1WRJA 3L7WA 1IO2A 4HX7A 4BDYA 2V7FA 4II3A 5KK1A 1MNEA 3HJEA 2EZLA 3TO6A 4XNFA 2RGVA 2YS9A 3OYKA 1IXCA 1UAAA 2LSOA 1NG7A 2NXNB 2JVHA 3QP5A 1S5LC 1IN5A 3M1EA 1MH4A 1LFPA 1Z21A 2AXTC 2XRNA 1WPKA 5GADJ 4DOZA 1OYWA 4PK4A 2XKPA 1ZHFA 4AU7A 5LRRA 3S3OA 4OWRB 2KFDA 4P5OA 1ZARA 3HUGA 1Z05A 4HSRA 2WB1A 4IOAF 5LBQA 5AIQA 3VB2A 4M73A 5J4VA 4H4KC 3PUFA 4I0BA 1IF1A 3PIOF 1QU3A 1J5YA 3CMEI 1IRFA 3RYPA 1JTXA 2ZBKA 3K9TA 1TWCJ 2GA2A 4ZYDA 1Q1HA 4BDZA 5HOOA 2VL8A 2EILH 2V9KA 1W0UA 3AKZA 4RGSA 4EMSA 1HQCA 2FQ3A 4I6ZA 1EJ9A 2E36A 5K7FA 2JVGA 1LNWA 1YW7A 2O5RA 3ZQQA 2UV1A 1P2FA 4AIDA 1KZHA 3HUGB 3GVAA 4XKBA 5E18F 1J9IA 4QLCU 4GFBA 2CFXA 1HSJA 2EINH 3LQRA 1DPUA 1A31A 2DJNA 3LFKA 3K4NA 1RETA 1X3UA 3L1PA 4B43A 3K0LA 3GTPJ 1FTTA 2BE5F 1IV8A 1JHHA 5DYMA 3AAFA 3HOSA 1T95A 1S7EA 2R7VA 3L2VA 5HS8A 3OV8A 3H5RA 3J7YJ 1ZR2A 3DQVC 2LFBA 2LY1A 2PMUA 3MKLA 5E1WA 4M3DA 2VKHA 3PQKA 2R5YA 4BGDA 3ZR8X 3PIPF 2H27A 3LAPA 4L5JA 1R9TJ 1BR2A 4WXHA 1ODDA 3QOPA 4GRIA 5FLXK 3NEUA 2O8KA 1W1WE 4V2FA 4XR6A 2V4JC 3CUQB 3PO3J 3GTQJ 2ACJA 2XAJA 3CF2A 4EM2A 2HQAA 3R0JA 1JJ6C 3JRFA 1F43A 1WSUA 1FY7A 2KRHA 3CTAA 2GXAA 1GHCA 3R4KA 1IXRC 2VE8A 3BG5A 4M9XA 3SFZA 1QPIA 4XLCA 4EJWA 1W7PD 5HVQC 1BN5A 5EDNA 1YQAA 5DDGA 1A35A 1IXSB 2CMPA 3DTKA 3HKZN 4RAFA 1ZRDA 1I6HJ 3K1NA 4MGRA 2P81A 3FXUA 1VQ4I 3HOTA 2WAFA 3TOBA 3S16J 2PJRA 1ENHA 4DZJA 4JK1X 1OCTC 2L0KA 2WTEA 3PSFA 3BC8A 2Q0OA 5BPIA 4RMNA 3G6EI 5E3NA 1XCVA 5J1YA 2L9NA 2FA5A 3D5RC 4FETA 2O61A 4A69C 3G1LA 4B47A 2KIMA 4A0ZA 3LSKA 1FBUA 1V55H 4ENMA 1IN7A 5IYBJ 4KT5C 1A6QA 4OOIA 5DUIA 4AD9A 2R5ZA 1FTZA 1MSEC 2A5YB 3E0JB 1R5GA 2ZJQF 3PNTA 4LJZF 4E7ZA 3BTIA 3FMQA 4HNVA 1PDNC 4ENJA 1K7AA 4IX7A 5IT9K 2PJPA 3DKYA 5J6XA 5EG0B 3HG9A 3EUHA 3ZXSA 4I98B 5FKKA 4GYIA 4BL0B 2HDCA 2R7OA 3G1MA 4D5FA 1O7FA 1O3TA 1U0JA 2A61A 4HEA2 3OYAA 1UZCA 3HXLA 1LUJB 1BJAA 3FKIJ 1R23A 1X1AA 2KIFA 2Y30A 2CW8A 1QZEA 3ASNH 4DYCA 3BQYA 4XLNF 3E7LA 2L5QA 3G1OA 2M1BA 3KPHA 3S1QJ 3AL0C 3BJAA 2VXDA 1BBYA 1OPCA 2VJIA 1B9NA 3GW2A 2ZO4A 3MCZA 1O7LA 3RTRA 5D5WB 2XVCA 1HW5A 3F8NA 2N8GA 1TWGJ 2ZJRF 2HQRA 3BP8A 1EH8A 1TQMA 3G4SI 2VXZA 2R7TA 3A03A 4GYGA 3QP6A 3LOCA 2A6HF 3HSFA 1TC3C 1BC7C 1USSA 4HYEA 3FXKA 1XGOA 4RB3C 5J4YA 3BT9A 4AIHA 1JKRC 1S9HA 3GTKJ 2Y69H 2R3SA 2DYSH 2MLKA 2ESNA 1ETKA 2V1DA 4FHTA 4NBQA 4WXDA 3ZPLA 3VYSB 1OYIA 5IPAA 3GZNB 2VN2A 1JTYA 1F4KA 1HLVA 4E7LA 4YG2F 2EA2A 4GXOA 2R7DA 3TO7A 4WCGA 2E2IJ 4CUGA 2KQRA 1JHFA 2HOEA 1QZZA 5GPAA 2L9VA 3DFGA 3IUOA 5IY5H 5L3DA 2DA4A 4EJVA 3WE2A 5M5YJ 4ZJZA 3T0YA 3KEQA 1RR8C 3HOWJ 2VT2A 1VQ6I 5DD4A 3BR3A 1CF7A 3GXOA 4KMUX 2QQAA 2DFFA 4PFPA 1QHGA 2BY3A 4I7HA 1Z77A 2GXBA 5EGOA 1GV5A 3W6JB 4OIRF 2ZFWA 2HQNA 2P8TA 1IDYA 4ESBA 5C4JJ 4QIWN 3SDBA 2B63J 3ZQLA 2DMQA 2DMUA 2A3SA 5ERIA 1O3RA 3KLOA 3Q3SA 4UUVA 3OYGA 3JR9A 2M9HA 3ZCOA 2R7RA 2QKMB 3I9V2 3RQIA 4KIGA 3QWLA 2YSRA 2BEOA 3NQOA 2MC3A 3P9KA 1LB2A 3I59B 1YJ9I 1R71A 2FUG2 3J81Z 4JOMA 1T8IA 1B6AA 3HOXJ 2HWVA 3Q5FA 1RKWA 3DF8A 1HF0A 3EPZA 3CCEI 1B59A 1IV6A 5F1RA 3KP4A 1HC8A 3DPTA 1XCBA 2OAZA 1N77A 3M4OJ 5DCMB 1VZ0A 3OR2C 4ESJA 4HSTA 3WGHA 2MD5A 2AQEA 4G12A 3REOA 3OYNA 4ZYAA 3SHFA 2Y48A 1JUPA 5E3OA 1SD5A 2VE9A 5IT3A 5JR3A 2JTVA 4ASNA 2JK3A 2WADA 3LSRA 1U8BA 1FJLA 2OZ6A 4J01A 3M3YJ 1U8RA 5E8IA 5E79C 2WB1N 1JI8A 1XSXA 3V7CA 4ANJA 1BIBA 2B7EA 1IC8A 1XSVA 3UNGC 1J75A 3ROUA 1Z6RA 3LL7A 4IL6C 5EYRA 2BHYA 5CVUA 5LRSA 5M5WJ 4IHVA 1UHWA 2L7KA 4BUPA 1RC9A 2KIUA 2EZIA 3MN2A 1BJZA 4XIDA 3CCSI 3SQNA 4A3FJ 1YOVB 3DPLC 4MQ9F 2FNPA 2NS7A 2BXZA 2JUCA 2OC6A 2PBIA 1J0RA 4Z2YA 4LIVA 4IRHA 2MD0A 2DOAA 4CYDA 2W24A 4RAYA 4C9YA 1B8IA 3MFKA 1IN8A 1LKXA 1ON1A 1H89C 4R1HA 2D1HA 4PFOA 4BXUA 3MWMA 4XLFA 2DFEA 2XIGA 2LD5A 4ZZDA 5EEAA 1BR4A 4LLNA 1QHHD 3TEDA 1PYVA 1OCRH 3Q0WA 1AKHB 4HBLA 2GLOA 2LNBA 3HYIA 4HF0A 3IH3A 3FZVA 3C18A 4XRMA 5ICEA 1X1CA 2IVMA 4EJTA 2OQRA 2YU3A 5D8LB 2OTLI 3DEWA 2ME0A 3CJNA 3L2RA 5HLIA 2R5YB 5JHFA 2XPWA 2HKXA 2QKLB 2ZMEA 2ZCWA 3FHZA 4QSHA 1OJLA 5B1AH 2MBFA 3W6VA 2Z33A 2CQKA 3L00A 4CH7A 1X1PA 2Z1DA 1ETWA 4M6VA 3HOYJ 3J7ZI 4Q5SF 4RB2C 4Q48A 3ZMUA 1K61A 1IN4A 4XLAA 3TMOA 3OYLA 1LE8A 1Z7LA 3SEQA 3GEZA 4YIIA 1TNTA 3LSTA 1MJAA 3PQJA 3A01B 1RIOH 2LKPA 2CV2A 1K78A 3F22A 1KQ0A 1I6XA 2XAFA 3IP4B 5IT9Z 5FFXA 2CSOA 2YR2A 4NC7A 4BBRJ 2RC4A 1YTYA 3LNQA 1K4SA 1I1GA 2F5EA 4FX4A 4ITVA 4B09A 3F23A 1WI9A 2DDAA 3T8TA 2IJLA 2HPMA 1N78A 4Y4RA 3H3VK 2EA4A 4BNCA 3MMYB 2DDBA 4PJLA 3KCCA 2JA2A 2EZHA 2W1OA 1ZLKA 4N9HA 5CLSA 3U1DA 3CC4I 2COMA 1ZG3A 3BCAA 2JA7J 4HRIA 5D5VB 3ZQHA 3HRSA 3E3VA 4FCYA 1DPRA 3LSIA 3KETA 1KQ8A 3F9KA 1EV7A 4U7BA 4QPOA 1LDJA 1ERDA 3S2DJ 4LB5A 3CCMI 4PCQA 3MEXA 2R92J 3X2QH 3OWTA 1S7OA 1NH3A 1X19A 4M72A 4O6JA 3CLQA 3FWEA 2XAGA 3W2WA 4AIJA 4CYCA 2FSWA 4KN7X 2WBMA 1D0XA 4MQVA 2E35A 1Y8RB 4XL9A 2OBPA 1T0FA 1UG2A 4LLLA 1Q1VA 2UZKA 2QQ9A 1V5EA 2OCEA 2NYXA 5E3MA 4OAZA 3ZGKA 1OFCX 1BW6A 4HDUA 2DA3A 2QWWA 4DZPA 1KA8A 3WHBA 4RDUA 2FU4A 3DBRB 1HKQA 3UKGA 4EJUA 5D4SA 2QCOA 2QF7A 3HRTA 5TGTA 2EV0A 2L2OA 4BY7J 4W1UA 5JHUA 4EGYA 3LFUA 3TP0A 1IZ1A 4RS8A 2D2WA 1YFHA 2WV1A 1UHMA 3D5LA 2DQLA 2DU9A 1MW7A 4OIQF 1U2WA 3MAJA 2ID3A 3S8PA 3QAHA 3CCLI 3C1DA 3V8KA 5F0FA 4XOTA 2P5VA 1QGPA 3K10A 4HV5A 2NVYJ 3E6CC 1L3LA 5F08A 1P7JA 2JSPA 2QSGX 3FMSA 4C2UA 1OMIA 1YW8A 2VQHA 1VFCA 2D45A 2G0EA 1MSFC 5K1YA 3JRAA 2AHQA 2VQLA 4IF4A 1JUSA 3BR2A 1FBSA 1JJ8C 1F36A 3CDHA 1ZN2A 1TW2A 1D5YA 3PM1A 2PMZN 2IGKA 4B4CA 2EBIA 3GUDA 4NC8A 4A93J 1WJDA 5DS9A 4ZYGA 3HDDA 4EV0A 2BVMA 3LSHA 1OLTA 1SC7A 4HNUA 4A3LJ 3P7NA 4P9FA 3FBIB 3IWZA 2V9PA 4KMFA 3VYUB 2E2HJ 4KA4A 5D6FA 3KP2A 1TLHB 3BJOA 1G3SA 5DV5A 2RNJA 3NRVA 2RNGA 5IYCJ 3ELKA 3TOAA 2DBBA 1KGSA 2QEXI 1X2MA 3K4JA 1GXQA 2ZXWH 3BR0A 1YX5A 2CQ7A 5TISC 1FOYA 2IP2A 1FIAA 3BZ6A 3GBGA 4MIMA 1B4AA 3S2HJ 4UUTA 3MKYB 4L9VA 4MLOA 3T8RA 3HPHA 2GWRA 4JX6A 4U88A 2M87A 3PL8A 3I55I 1ON2A 2ZB9A 1JT6A 3PSIA 3SZTA 1QNTA 4A0XA 4J19A 2IT0A 4BS9A 2X4HA 4CZZA 1JGGA 4YRVA 1ETVA 4E7SA 2LF8A 1L0OC 1S29A 1MGTA 3EUKL 3HTSB 2Y31A 4OMZA 4RB0A 3VODA 1MBFA 3IV5A 4BAYA 5DCFA 5ED4A 2X85A 3C2BA 3LAJA 1EA3A 3QU3A 3OYCA 4LD5A 2L4AA 5CVJA 4ZH4F 2R7FA 2KZVA 5B3SH 4BQAA 2JN6A 3ZOBA 2HVSA 4MHGA 2VC1A 3OOUA 3RCOA 5LEKA 3Q0UA 2A07F 1YI2I 2K7LA 3L09A 1STZA 2HNHA 3ERED 3BZKA 2LVSA 4RGUA 4D9JA 2CWEA 1YITI 1NHAA 3S1NJ 4S05A 3LSPA 5E1ZB 1DQUA 4LITA 5F0CA 1XPXA 4FE4A 5GAEJ 5DM7F 3GZ6A 3GX4X 2W25A 2LKSA 3TDZC 3CZ6A 3CC2I 2BV6A 1HKSA 2IGOA 3RKQA 1P4AA 2P0WA 2DW4A 4XKCA 3ISPA 5LEJA 2NOJB 2P5KA 3QODA 2CV0A 1IRGA 3F6VA 2H6CA 3F72A 1T33A 4R79A 1T56A 2LOOA 4X0GA 3OYFA 1USTA 2HDDA 2CUZA 4YEJA 1U5TC 1W7PB 1WQ2A 2MC4A 2STWA 4IO9F 3ULQB 1PJRA 3BR5A 1X3ZB 4BHCA 1U78A 4DNCA 3WTZA 3C2GA 3MZHA 5B1BH 1MBJA 3PJRA 1W36C 3H92A 3RYRA 1SMTA 2M30A 2NAZA 1ZG1A 2VODA 3HOUJ 3F8MA 3K2ZA 4MTEA 3WTXC 1D1AA 1Z9CA 3HZJA 3HM5A 2KHMA 2KJBA 3VSKA 2DO7A 3DV8A 3GWZA 2QA4I 2A05A 2DA5A 4BJ6C 2YPRA 5L3GA 1U9NA 5H6QA 4N4OB 1RPWA 3UR3C 3ECHA 1GV2A 3HSEA 2RDPA 1HW2A 2BW3A 3F8FA 1VQPI 4A2UA 1R4MB 2JRTA 1X1BA 1RRJA 1U6GA 2GZWA 2Z16A 3H5NA 4L0YB 3GLLA 4X6AJ 4DYQA 1ONVA 1LJ9A 4HQMA 5BPDA 3CO7C 5EEGA 2HFHA 1KYZA 3HRMA 3DXJF 4RM2A 5KVRA 2HOTA 1XGSA 4CCKA 2CYYA 2L9RA 1TBXA 1YX3A 2HKOA 2Y9ZA 3HOZJ 4AM3A 3P9IA 4DYRA 3CJRB 5TJJA 2DA2A 3LWFA 3W6KB 4FASD 2FMLA 2JRMA 2KDOA 2M4GA 1WKMA 1MKMA 2VJ4A 2XGCA 4GO1A 4HAMA 2K85A 1Y1WJ 3HGGA 3Q0VA 2W00A 5HS9A 3FF5A 2M8GX 2PMHA 4U0WA 1J7KA 3WU0A 3GF2A 2AS5F 4IHXA 4UVBA 1A6IA 1PUEE 3IKTA 4MNUA 5F04A 2VIXA 2I5UA 2Y2ZA 2ME6A 4E70A 1HCRA 4B1RA 4OMYA 2W7NA 2R7WA 4HQEA 3JRGA 4A3JJ 3O3KA 1IAWA 2FBKA 3BTCA 2R7SA 5F1JA 2HI3A 1S3JA 5FGMA 3LA3A 5FD6A 3QPLA 3DU6A 3K4CA 3ZN0A 3EQLF 3KYDB 2BGCA 2EJRA 5D5XB 2Q8KA 3OY9A 3OSFA 5CVIA 3E6BA 4ENNA 2GOXB 3KEOA 2XV4S 5D4RA 2PFBA 2CQXA 2LG4A 4IHTA 2VBYA 2E1MB 3FXMA 2DMNA 2QSFX 1GUUA 1QZYA 5TRDA 4S0HB 1VQMI 1O3QA 1RUOA 2XB5A 2XAHA 3MKZA 5LD2C 4KJZA 1OCCH 3ABTA 4F7ZA 1OKRA 3BWGA 3IAM2 3MZYA 5IOYA 3OMYA 5GTHC 3CCJI 4D0PA 4ZDLA 1YRNA 2ADUA 1REPC 1Z91A 5K5OA 1XN7A 4ENKA 3WODF 2CUJA 4HF1A 5E8GA 2XSJC 2RKHA 2WAQA 2VOPA 1D8KA 1FPQA 1UB9A 4HX8A 3K70C 1OR7C 4EATA 4I01A 3GFIA 1R22A 5LGTA 1R4NB 1G59A 5FFZA 3JTGA 2XAQA 3CUQC 5CYVA 5DTDA 4A3KJ 3OS1A 4DW6A 1TWAJ 2OTJI 1ETOA 1FP2A 4DIQA 1C0WA 1LFUP 3E5QA 1MNDA 1G3YA 2GIVA 4RAGA 3VFZA 2P6TA 2XHKA 3FIWA 3R61A 4BYYA 1FYKA 4UUSA 3ZQFA 1ZH5A 2E7WA 1I50J 2JT1A 4FQGA 4MO7A 2BOLA 1GVDA 1FZPB 1VQ8I 5IYDJ 2CV1A 3SFIA 4E7KA 3KIOA 3CD6I 4XLEA 3BR6A 1I3QJ 2L9SA 1D8JA 4H0EA 1GLNA 4RBOA 5FKMA 4CICA 1ZRFA 2CRGA 2H1LA 2PX9A 4ESFA 4YFXF 2GXGA 4BBSJ 2W84A 4KN4X 2HPIA 4A3DJ 5FJ8J 3L2QA 1T98A 3JREA 3L2UA 4KNYA 1TW3A 2M7AA 3ECOA 4B3AA 2YX4A 4BHBA 2ZXIA 1JT0A 2BY0A 1O3SA 2HOAA 5H2FC 5FKLA 2ZSIB 3C3WA 1Z3YA 3BPXA 1BI2A 2K3FA 5DCMA 4BE0A 4PZJA 5HNFA 2VUMJ 3CQZJ 2ZNYA 1Z1DA 4M3BA 2ETHA 4BY1J 2QLZA 5FLMJ 2NVQJ 2TCTA 1D1CA 3B6AA 5KAFC 1HW1A 1BOAA 3RIRA 4A6DA 5EZGA 1EF4A 2K4JA 2IGMA 2QBYB 1F1ZA 2GA1A 1A36A 3GLXA 3COAC 2BY1A 3KE2A 1MMAA 4E6KG 3AL0B 1FOXA 5JVTA 2ISYA 3DWLE 2ELKA 4BJTA 1WGXA 2DA6A 2HDWA 4M74A 1UMQA 2JMWA 2DTZA 4LK1F 3BDDA 1U3EM 1AU7A 4BXXJ 3BCBA 3OYIA 1XS9A 3H1CA 1WJ5A 2Z3YA 4E7HA 5H6RA 4BU2A 1M1EB 3P9CA 3FXLA 4LIUA 1WJEA 5E1XA 1R49A 3QPSA 5ICFA 1P6RA 1UFMA 2ZJ2A 3EYIA 1FX7A 2M45A 2YU9J 5FRNA 2O3FA 3BROA 1HSTA 3M8EA 2JQ7A 4V19K 3WE3A 5CJ9A 1GXPA 1DDNA 3SXYA 2VKEA 3OIOA 4C2TA 2R93J 3B73A 2UWMA 1XMAA 1DU0A 2UXXA 1EH6A 3H9GA 2DOFA 3HL2A 5CVRA 3JSOA 3LSGA 3ASOH 4L9TA 2F5CA 3OYJA 4UV8A 1HDDC 2DCEA 2P4WA 2FQ4A 1HBXG 1X3WB 3J7AY 4I09A 1JKOC 5M3MJ 4E7JA 1T6SA 5J3LA 3NWSA 2LBFB 1YS7A 3I58A 1UG0A 3CMAI 4HW0A 4A5MA 3LA7A 4XN0A 4I76A 1XTAA 4CCNA 3VWBA 2ZJPF 1FYLA 2E7XA 3O2PE 3KZYA 2Y9YA 4C3IJ 6PAXA 3DTIA 1KONA 1ZREA 1YG2A 3AFHA 2F4MB 1Z0XA 2PQ8A 1QA6A 2TDXA 2R7QA 2PG4A 2L01A 3ZRGA 4KIFA 2PN6A 4PJJA 1W7PA 4E4HA 4IHWA 1NG6A 3W2VA 4KDPA 4V2GA 1R5HA 3J80Z 2DK8A 1YYVA 4CYCB 5BNGA 1P92A 2NS8A 1RR7A
chains in the Genus database with same CATH topology
2QVOA 1TTYA 4M9ZA 2EFOA 4AIKA 1ZRCA 2HTJA 3T5XA 3GFMA 4NHJA 3GFJA 2H09A 1H9TA 3M7GA 2J5OA 1DUXC 2DT5A 5L3FA 1YS6A 3E5XA 5D5UB 1ZG5A 1FWZA 2K4BA 1I27A 2VC0A 1G3TA 2Y0MA 3G73A 3RKYA 3V7RA 1RI7A 2DQRA 4ZYEA 1TQPA 3J81K 2DK5A 1ZGAA 5BOXA 2DAOA 3KP7A 3KP3A 2IW5A 3RKWA 4IRIA 1QO0D 1K6OA 3TKYA 3U9GA 1EH7A 4LG0A 1VTNC 3E97A 5E20A 5FB2A 2FBHA 1R1VA 4Y13A 3QRFF 4YFNF 3ABUA 2RVCA 2O6GE 1JE8A 1XGNA 3D0SA 5AONA 1QPMA 1FBQA 3Q9VA 4LK0F 2FXAA 2V1XA 5HDKA 3DP7A 1YLFA 2ZKZA 2QUFA 4N0BA 1SMYF 1OYYA 1H0MA 4NB5A 4XLPF 1LEBA 1RNLA 2VONA 1YW9A 4RB1A 2NNYA 5DD8A 2MLGA 1G3WA 3OOPA 1FYMA 2BBYA 1P4XA 2HEOA 1SFEA 1QQIA 1V3FA 3ML6A 1R1UA 5AIPA 1LQ1A 1B9MA 2V79A 1S7AA 1E2XA 1BI0A 2D1VA 3F21A 4UVCA 4I2OA 4HZFA 2OQGA 5D6EA 2K86A 1G4DA 2ZMEB 3C7JA 5ICCA 2L02A 3TDUC 2E1CA 2IPQX 4G7HF 4FX0A 4PGGA 1D5VA 4LGWA 2FRHA 4QWQA 3I59A 1IN6A 3IRQA 2O0YA 3SZPA 4HOBA 3HHGA 2Z5UA 2HZTA 3WU1B 4XBFA 3N4MA 4A0YA 3IHUA 2G7HA 2WWYA 2NNNA 4UNOA 5ILVA 4WF2A 2MH9A 2YX7A 5F6FA 4B8XA 3S2WA 4K2EA 1IUYA 4PGHA 4HX4A 2K27A 4UXNA 1KU7A 3JTHA 5DEQA 4KYWA 3WGGA 3V7SA 1TQIA 3I64A 3H3ZA 3N97A 2EWNA 2WV0A 3HRUA 2G7UA 1BI3A 3GYHX 1CF7B 5ICGA 3BOQA 4Q4ZF 2JSCA 2V9VA 3K1MA 3WTSC 5D8KB 4KFCA 1J59A 1FNNA 2PEXA 2MA3A 3WTYC 4LFUA 4GCVA 1ZLJA 3QPHA 1FOKA 4KUMA 1F5TA 2STTA 3F8CA 3GZ5A 2A69F 2XGXA 3ZMVA 2IA2A 4IHSA 3U2RA 5LHGA 2MH2A 5F64A 1FT9A 4HA8A 1SAXA 4HF2A 1KU2A 3IKVA 2IA1A 5K5QA 5K5RA 3WTUC 4OIPF 5FLXZ 2DTRA 1R58A 4WK8F 2F5FA 2ZNZA 2O8XA 2AXLA 4XSXF 3GFLA 1RUNA 4A12A 3V8JA 4HDVA 4M9SA 2FBIA 1XSDA 3QU6A 2EV5A 2O03A 3WTVC 4HLYA 5E17F 2DPDA 1GVJA 1P4WA 4I02A 5L3CA 4L9JA 4OINF 4MTDA 2Y75A 3CUQA 2CO5A 2QQBA 1BIAA 1MDMA 4IJAA 4LB6B 5BQTA 1ZYRF 1Y0UA 5HDGA 1KYWA 4IRGA 3ZP5A 3KP5A 1PP8F 2QM3A 2JPBA 3Q9SA 3IL2A 2Z9OA 4YFKF 2OU2A 3R60A 1SD7A 5FD5A 4ZYHA 4A6EA 3H3UA 2VBZA 2W85A 4EGZA 2WC2A 4Y15A 1XDUA 4Y17A 1JGSA 2EV6A 2NS0A 5ILUA 2B0LA 1TNSA 1LDDA 4P96A 3I5UA 2L3DA 1LEAA 4G8XA 3EYYA 5CVVA 5JFRA 5FO5A 1MJBA 1S6LA 1XMKA 2VOOA 1ZAOA 5DUKA 4CO8A 4G9YA 5BS6A 1BC8C 4OU0A 1U5TA 1RZ4A 3RKXA 1XDSA 1R7JA 3RJPA 2ELHA 5A2QZ 2W57A 2KKOA 1SD6A 4EM0B 2A68F 3DEUA 2EFWA 5HDNA 3JAMZ 2HGCA 1MZBA 1KU3A 5LLQA 2DFIA 4U7DA 3M9AA 1U5TB 2NRAC 4I0AA 4IPAA 3HIFA 2XASA 3TQNA 4LMYA 2CW0F 1F9NA 3FM3A 5EEHA 1UCRA 3L9FA 2F2EA 2LF7A 2A6EF 3IWFA 4RGRA 3BJ6A 4PDKA 4M6XA 3FXRA 3FM5A 4MEXF 1FP1D 3I0TA 1BI1A 4P55A 3M8FA 1KQ9A 1MD0A 3CLOA 3V8LA 1B1BA 1PP7U 2C6YA 4BH9A 2J5PA 3FXQA 3LQQA 4WX9A 1DP7P 4O5VA 2BYVE 4CGZA 4MEYF 4M6YA 3WTTC 1FLIA 3RPQA 1ZGJA 3WGIA 2PI0A 2XROA 1Z6TA 2QENA 3BPVA 2RN7A 3HHHA 3WG9A 4WXCA 5L3BA 2HYFA 4Q47A 1FSEA 2L54A 2LDUA 1LDKB 2XKOA 3CO6C 3VEPA 4G6QA 1SD4A 3E5UA 4FT8A 4RAZA 3ZMZA 5JI6A 2L4MA 4LLGF 2XUBA 2EB7A 2FF4A 2OZUA 1J2XA 4CHUA 2M5WA 1CGPA 2G9WA 3HTUA 1OR7A 5HLHA 1FC3A 4WWCA 3GO5A 5LHIA 2Z99A 3K69A 4EJOA 3EETA 4CDGA 1HXDA 3ZMSA 2EFQA 1XGMA 1AWCA 4ETSA 3R0AA 3TGNA 3KLNA 2P5LC 3T1BA 1A04A 2QBYA 2M8EA 2HS5A 4A5NA 1H9GA 4IXAA 3ZQ7A 2EFNA 1G6NA 3QPTA 2PLYA 2P6SA 4U0VA 4G94A 3DKWA 3JW4A 3I54A 3FX3A 2GAUA 1R00A 1ULYA 4JQFA 1BM9A 3KZZA 1XB4A 4L9NA 2P7CB 4RGXA 2ISZA 5LHHA 1MDMB 3J80K 2FMYA 2H6BA 4L0ZB 2EK5A 4UVAA 2E1NA 4S04A 3MQ0A 1MJ9A 4XRFA 3R6SA 5A2QK 3WTWC 2RQPA 3TO9A 1JXSA 2FNAA 1YO5C 5LGUA 3JAMK 1I5ZA 3O6BB 1T39A 5LGNA 3HSRA 2HTSA 2DI3A 3RDIA 1W5TA 2OA4A 4G7ZF 1S8NA 4IVNA 4P9UA 5BMZA 4M71A 5HS7A 1D3YA 1WWXA 2X0LA 3BY6A 4L18B 3F3XA 2JPCA 2ESHA 5ILSA 4HV6A 3RI4A 2Q2EA 4U0YA 4G6DA 4ON0A 1R36A 2K02A 3CUOA 3FMRA 2IRFG 3I4PA 1HKTA 3KP6A 1W5SA 4OIOF 2CGPA 5J8FA 4EQQA 3IC7A 4KIBA 3I71A 3VOEA 2FOKA 3ZMTA 1QBJA 2V1UA 2GQQA 4BHPA 4KICA 2VT3A 4EVIA 3B02A 1KU9A 3E6DA 2VBXA 4G7OF 1I1SA 1R1TA 3F6OA 2F5DA 5L3EA 4LG0B 1SFUA 1Z7UA 5J8CA 3J7AO 5H20A 3I53A 4UHTA 3KFWX 1E17A 3LA2A 3JSPA 2DLLA 2KRFA 4TV7A 2UXNA 4YIFA 3IRRA 1O57A 1T2KA 1W4MA 4O3MA 2HR3A 2QYOA 3F8BA 4HLXA 4R8HA 3G3ZA 3ZMDA 4AWXB 2VBWA 4NQWA 2EFPA 1SFXA 2OD5A 1FSHA 2CG4A 4DQ2A 2JZYA 2HYGD 2P7VB 1AOYA 3EDPA 4GGGA 3E6MA 1YIOA 3K1PA 4CXFA 2V6CA 2FE3A 3PFIA 4JBAA 4EM1A 3V4GA 4XSZF 1IW7F 4AVPA 2ZXJA 2RV8A 3ZN1A 1K78B 1T38A 1XD7A 4L5IA 2QZ8A 2H94A 2DPUA 1LVAA 1K79A 2IA0A 3L2CA 2KJCA 4UV9A 3RPUA 1V4RA 5HLGA 4ZZLA 2FEZA 4N9IA 1WRJA 3L7WA 4HX7A 5KK1A 3TO6A 2RGVA 1IXCA 2LSOA 3QP5A 3M1EA 1IN5A 2XRNA 1OYWA 2XKPA 1ZHFA 5LRRA 4P5OA 1ZARA 3HUGA 1Z05A 5LBQA 5AIQA 3VB2A 4M73A 4I0BA 1IF1A 1J5YA 1IRFA 3RYPA 2ZBKA 3K9TA 2GA2A 4ZYDA 1Q1HA 5HOOA 4RGSA 4EMSA 1HQCA 2FQ3A 1LNWA 1YW7A 1P2FA 3GVAA 5E18F 1J9IA 4QLCU 2CFXA 1HSJA 3LQRA 1DPUA 3LFKA 1X3UA 3K0LA 2BE5F 1JHHA 5DYMA 3AAFA 3HOSA 5HS8A 3OV8A 3DQVC 2PMUA 5E1WA 3PQKA 2H27A 3LAPA 4L5JA 4WXHA 1ODDA 3QOPA 5FLXK 3NEUA 3CUQB 2ACJA 2XAJA 4EM2A 3R0JA 1WSUA 1FY7A 3CTAA 1GHCA 3R4KA 1IXRC 2VE8A 4M9XA 3SFZA 4EJWA 1W7PD 5HVQC 1BN5A 1YQAA 5DDGA 1IXSB 1ZRDA 3K1NA 4MGRA 3FXUA 3HOTA 3TOBA 4JK1X 2WTEA 5BPIA 2Q0OA 1XCVA 2FA5A 2O61A 2KIMA 4A0ZA 1FBUA 4ENMA 1IN7A 5DUIA 4KT5C 4OOIA 4AD9A 2A5YB 1R5GA 4LJZF 3FMQA 1PDNC 4ENJA 1K7AA 5IT9K 2PJPA 5J6XA 3EUHA 4I98B 4GYIA 2HDCA 1O7FA 1O3TA 2A61A 1BJAA 1R23A 2KIFA 4XLNF 2M1BA 3BJAA 1BBYA 1OPCA 1B9NA 3GW2A 2ZO4A 3MCZA 1O7LA 3RTRA 5D5WB 2XVCA 1HW5A 3F8NA 2HQRA 1EH8A 3BP8A 1TQMA 2VXZA 4GYGA 3QP6A 2A6HF 3HSFA 1BC7C 1USSA 4HYEA 1XGOA 4RB3C 4AIHA 2R3SA 2V1DA 2MLKA 2ESNA 4FHTA 4WXDA 3ZPLA 1OYIA 2VN2A 1F4KA 4YG2F 2EA2A 4GXOA 2R7DA 3TO7A 4WCGA 1JHFA 2HOEA 1QZZA 3DFGA 5L3DA 4EJVA 3WE2A 3T0YA 3KEQA 2VT2A 5DD4A 1CF7A 3GXOA 4KMUX 2QQAA 4I7HA 2GXBA 3W6JB 4OIRF 2ZFWA 2HQNA 2P8TA 4ESBA 2A3SA 5ERIA 1O3RA 3KLOA 4UUVA 4KIGA 2YSRA 2BEOA 3NQOA 2MC3A 3P9KA 1LB2A 3I59B 3J81Z 1B6AA 3Q5FA 2HWVA 3DF8A 1B59A 5F1RA 3KP4A 3DPTA 1XCBA 2OAZA 5DCMB 4ESJA 3WGHA 2MD5A 3REOA 3SHFA 2Y48A 1SD5A 2VE9A 5IT3A 5JR3A 2JTVA 4ASNA 2OZ6A 1U8RA 5E8IA 1XSXA 3V7CA 1BIBA 1XSVA 1J75A 3ROUA 1Z6RA 5CVUA 5LRSA 1UHWA 2KIUA 3SQNA 4MQ9F 3DPLC 2FNPA 2PBIA 1J0RA 4Z2YA 4IRHA 4CYDA 2W24A 4RAYA 3MFKA 1IN8A 1ON1A 4R1HA 2D1HA 4BXUA 3MWMA 2XIGA 4ZZDA 4LLNA 4HBLA 2LNBA 3HYIA 4HF0A 3FZVA 3C18A 5ICEA 4EJTA 2IVMA 2OQRA 2YU3A 5D8LB 3CJNA 5HLIA 2HKXA 2ZMEA 2ZCWA 3FHZA 2MBFA 2Z33A 2CQKA 3L00A 4Q5SF 4RB2C 4Q48A 3ZMUA 1IN4A 3GEZA 4YIIA 1TNTA 3LSTA 1MJAA 3PQJA 1RIOH 2LKPA 1K78A 3F22A 1KQ0A 1I6XA 2XAFA 5IT9Z 5FFXA 2CSOA 2YR2A 2RC4A 1YTYA 1I1GA 4FX4A 2F5EA 4B09A 3F23A 1WI9A 3T8TA 2IJLA 2EA4A 4BNCA 3KCCA 1ZLKA 4N9HA 5CLSA 3U1DA 2COMA 1ZG3A 5D5VB 3HRSA 3E3VA 1DPRA 3KETA 1KQ8A 1EV7A 4U7BA 1LDJA 4LB5A 4PCQA 3MEXA 1S7OA 4M72A 4O6JA 3FWEA 2XAGA 4AIJA 2FSWA 4KN7X 4MQVA 2OBPA 4LLLA 1T0FA 2UZKA 2QQ9A 2NYXA 4HDUA 2QWWA 1KA8A 2FU4A 1HKQA 4EJUA 5D4SA 3HRTA 2EV0A 5JHUA 4EGYA 1IZ1A 4RS8A 2D2WA 1YFHA 4OIQF 1UHMA 3D5LA 2DQLA 2DU9A 1U2WA 3MAJA 3QAHA 3C1DA 3V8KA 2P5VA 1QGPA 4HV5A 3E6CC 1L3LA 3FMSA 1OMIA 1YW8A 2D45A 5K1YA 4IF4A 1FBSA 3CDHA 1ZN2A 1TW2A 3GUDA 4ZYGA 4EV0A 3P7NA 4P9FA 3IWZA 4KMFA 4KA4A 5D6FA 3KP2A 1TLHB 3BJOA 1G3SA 5DV5A 2RNJA 3NRVA 3ELKA 3TOAA 2DBBA 1KGSA 1GXQA 2IP2A 3BZ6A 1B4AA 4L9VA 3T8RA 4U88A 2GWRA 2M87A 1ON2A 4A0XA 3SZTA 1QNTA 2IT0A 2X4HA 4CZZA 2LF8A 1L0OC 1MGTA 1S29A 3HTSB 4OMZA 4RB0A 3VODA 4BAYA 5DCFA 5ED4A 3LAJA 3QU3A 4LD5A 2L4AA 5CVJA 4ZH4F 2R7FA 4BQAA 4MHGA 2VC1A 5LEKA 2A07F 2K7LA 3L09A 1STZA 3ERED 4RGUA 2CWEA 1NHAA 4S05A 5E1ZB 3GZ6A 3GX4X 2W25A 3TDZC 2BV6A 1HKSA 1P4AA 2DW4A 3ISPA 5LEJA 2P5KA 1IRGA 3F6VA 2H6CA 3F72A 4R79A 1USTA 1U5TC 1W7PB 1WQ2A 2STWA 3ULQB 4BHCA 1U78A 4DNCA 3WTZA 3MZHA 3H92A 3RYRA 1SMTA 2M30A 2NAZA 1ZG1A 2VODA 3F8MA 3K2ZA 4MTEA 3WTXC 1Z9CA 2KJBA 2DO7A 3DV8A 3GWZA 2YPRA 5L3GA 5H6QA 3ECHA 3HSEA 2RDPA 1HW2A 3F8FA 4A2UA 2JRTA 1U6GA 2GZWA 4L0YB 1ONVA 1LJ9A 4HQMA 5BPDA 3CO7C 5EEGA 2HFHA 1KYZA 3HRMA 3DXJF 5KVRA 1XGSA 2CYYA 1TBXA 2HKOA 3P9IA 5TJJA 3LWFA 3W6KB 2FMLA 1WKMA 1MKMA 4GO1A 4HAMA 5HS9A 3FF5A 2PMHA 4U0WA 1J7KA 3WU0A 3GF2A 2AS5F 4UVBA 1PUEE 3IKTA 4MNUA 4E70A 4OMYA 4HQEA 3O3KA 1IAWA 2FBKA 1S3JA 5FGMA 3LA3A 5FD6A 3ZN0A 3EQLF 2BGCA 5D5XB 2EJRA 2Q8KA 5CVIA 3E6BA 4ENNA 3KEOA 2XV4S 5D4RA 2PFBA 4IHTA 2VBYA 1QZYA 5TRDA 1O3QA 1RUOA 2XAHA 3ABTA 4F7ZA 1OKRA 3BWGA 3MZYA 4D0PA 2ADUA 1REPC 1Z91A 5K5OA 1XN7A 4ENKA 3WODF 4HF1A 5E8GA 2RKHA 2VOPA 1D8KA 1FPQA 1UB9A 4HX8A 3GFIA 4I01A 1R22A 5LGTA 5FFZA 3JTGA 2XAQA 3CUQC 5CYVA 1FP2A 1C0WA 3E5QA 1G3YA 2GIVA 3VFZA 2P6TA 2XHKA 3R61A 1FYKA 4BYYA 1ZH5A 2E7WA 2JT1A 1FZPB 1D8JA 4H0EA 4CICA 1ZRFA 4ESFA 4YFXF 2GXGA 2W84A 4KN4X 1T98A 4KNYA 1TW3A 3ECOA 2YX4A 4BHBA 1O3SA 3C3WA 3BPXA 1BI2A 5DCMA 4PZJA 2ZNYA 1Z1DA 2ETHA 2QLZA 1HW1A 1BOAA 3RIRA 4A6DA 2K4JA 2QBYB 1F1ZA 2GA1A 3GLXA 3COAC 3KE2A 5JVTA 2ISYA 4M74A 1U3EM 4LK1F 3BDDA 2Z3YA 5H6RA 3P9CA 5E1XA 5ICFA 1P6RA 1UFMA 2ZJ2A 3EYIA 1FX7A 2M45A 2O3FA 3BROA 1HSTA 3M8EA 3WE3A 5CJ9A 1GXPA 1DDNA 3SXYA 2UWMA 3B73A 1XMAA 2UXXA 1EH6A 5CVRA 3JSOA 4L9TA 2F5CA 4UV8A 2P4WA 1HBXG 4I09A 1T6SA 1YS7A 3I58A 4HW0A 4A5MA 3LA7A 1FYLA 2E7XA 3O2PE 3KZYA 6PAXA 1ZREA 1YG2A 2PQ8A 2TDXA 2PG4A 2L01A 4KIFA 2PN6A 1W7PA 4KDPA 1R5HA 3J80Z 2DK8A 1YYVA 1P92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVO A;  1TTY A;  4M9Z A;  2EFO A;  4AIK A;  1ZRC A;  2HTJ A;  3T5X A;  3GFM A;  4NHJ A;  3GFJ A;  2H09 A;  1H9T A;  3M7G A;  2J5O A;  1DUX C;  2DT5 A;  5L3F A;  1YS6 A;  3E5X A;  5D5U B;  1ZG5 A;  1FWZ A;  2K4B A;  1I27 A;  2VC0 A;  1G3T A;  2Y0M A;  3G73 A;  3RKY A;  3V7R A;  1RI7 A;  2DQR A;  4ZYE A;  1TQP A;  3J81 K;  2DK5 A;  1ZGA A;  5BOX A;  2DAO A;  3KP7 A;  3KP3 A;  2IW5 A;  3RKW A;  4IRI A;  1QO0 D;  1K6O A;  3TKY A;  3U9G A;  1EH7 A;  4LG0 A;  1VTN C;  3E97 A;  5E20 A;  5FB2 A;  2FBH A;  1R1V A;  4Y13 A;  3QRF F;  4YFN F;  3ABU A;  2RVC A;  2O6G E;  1JE8 A;  1XGN A;  3D0S A;  5AON A;  1QPM A;  1FBQ A;  3Q9V A;  4LK0 F;  2FXA A;  2V1X A;  5HDK A;  3DP7 A;  1YLF A;  2ZKZ A;  2QUF A;  4N0B A;  1SMY F;  1OYY A;  1H0M A;  4NB5 A;  4XLP F;  1LEB A;  1RNL A;  2VON A;  1YW9 A;  4RB1 A;  2NNY A;  5DD8 A;  2MLG A;  1G3W A;  3OOP A;  1FYM A;  2BBY A;  1P4X A;  2HEO A;  1SFE A;  1QQI A;  1V3F A;  3ML6 A;  1R1U A;  5AIP A;  1LQ1 A;  1B9M A;  2V79 A;  1S7A A;  1E2X A;  1BI0 A;  2D1V A;  3F21 A;  4UVC A;  4I2O A;  4HZF A;  2OQG A;  5D6E A;  2K86 A;  1G4D A;  2ZME B;  3C7J A;  5ICC A;  2L02 A;  3TDU C;  2E1C A;  2IPQ X;  4G7H F;  4FX0 A;  4PGG A;  1D5V A;  4LGW A;  2FRH A;  4QWQ A;  3I59 A;  1IN6 A;  3IRQ A;  2O0Y A;  3SZP A;  4HOB A;  3HHG A;  2Z5U A;  2HZT A;  3WU1 B;  4XBF A;  3N4M A;  4A0Y A;  3IHU A;  2G7H A;  2WWY A;  2NNN A;  4UNO A;  5ILV A;  4WF2 A;  2MH9 A;  2YX7 A;  5F6F A;  4B8X A;  3S2W A;  4K2E A;  1IUY A;  4PGH A;  4HX4 A;  2K27 A;  4UXN A;  1KU7 A;  3JTH A;  5DEQ A;  4KYW A;  3WGG A;  3V7S A;  1TQI A;  3I64 A;  3H3Z A;  3N97 A;  2EWN A;  2WV0 A;  3HRU A;  2G7U A;  1BI3 A;  3GYH X;  1CF7 B;  5ICG A;  3BOQ A;  4Q4Z F;  2JSC A;  2V9V A;  3K1M A;  3WTS C;  5D8K B;  4KFC A;  1J59 A;  1FNN A;  2PEX A;  2MA3 A;  3WTY C;  4LFU A;  4GCV A;  1ZLJ A;  3QPH A;  1FOK A;  4KUM A;  1F5T A;  2STT A;  3F8C A;  3GZ5 A;  2A69 F;  2XGX A;  3ZMV A;  2IA2 A;  4IHS A;  3U2R A;  5LHG A;  2MH2 A;  5F64 A;  1FT9 A;  4HA8 A;  1SAX A;  4HF2 A;  1KU2 A;  3IKV A;  2IA1 A;  5K5Q A;  5K5R A;  3WTU C;  4OIP F;  5FLX Z;  2DTR A;  1R58 A;  4WK8 F;  2F5F A;  2ZNZ A;  2O8X A;  2AXL A;  4XSX F;  3GFL A;  1RUN A;  4A12 A;  3V8J A;  4HDV A;  4M9S A;  2FBI A;  1XSD A;  3QU6 A;  2EV5 A;  2O03 A;  3WTV C;  4HLY A;  5E17 F;  2DPD A;  1GVJ A;  1P4W A;  4I02 A;  5L3C A;  4L9J A;  4OIN F;  4MTD A;  2Y75 A;  3CUQ A;  2CO5 A;  2QQB A;  1BIA A;  1MDM A;  4IJA A;  4LB6 B;  5BQT A;  1ZYR F;  1Y0U A;  5HDG A;  1KYW A;  4IRG A;  3ZP5 A;  3KP5 A;  1PP8 F;  2QM3 A;  2JPB A;  3Q9S A;  3IL2 A;  2Z9O A;  4YFK F;  2OU2 A;  3R60 A;  1SD7 A;  5FD5 A;  4ZYH A;  4A6E A;  3H3U A;  2VBZ A;  2W85 A;  4EGZ A;  2WC2 A;  4Y15 A;  1XDU A;  4Y17 A;  1JGS A;  2EV6 A;  2NS0 A;  5ILU A;  2B0L A;  1TNS A;  1LDD A;  4P96 A;  3I5U A;  2L3D A;  1LEA A;  4G8X A;  3EYY A;  5CVV A;  5JFR A;  5FO5 A;  1MJB A;  1S6L A;  1XMK A;  2VOO A;  1ZAO A;  5DUK A;  4CO8 A;  4G9Y A;  5BS6 A;  1BC8 C;  4OU0 A;  1U5T A;  1RZ4 A;  3RKX A;  1XDS A;  1R7J A;  3RJP A;  2ELH A;  5A2Q Z;  2W57 A;  2KKO A;  1SD6 A;  4EM0 B;  2A68 F;  3DEU A;  2EFW A;  5HDN A;  3JAM Z;  2HGC A;  1MZB A;  1KU3 A;  5LLQ A;  2DFI A;  4U7D A;  3M9A A;  1U5T B;  2NRA C;  4I0A A;  4IPA A;  3HIF A;  2XAS A;  3TQN A;  4LMY A;  2CW0 F;  1F9N A;  3FM3 A;  5EEH A;  1UCR A;  3L9F A;  2F2E A;  2LF7 A;  2A6E F;  3IWF A;  4RGR A;  3BJ6 A;  4PDK A;  4M6X A;  3FXR A;  3FM5 A;  4MEX F;  1FP1 D;  3I0T A;  1BI1 A;  4P55 A;  3M8F A;  1KQ9 A;  1MD0 A;  3CLO A;  3V8L A;  1B1B A;  1PP7 U;  2C6Y A;  4BH9 A;  2J5P A;  3FXQ A;  3LQQ A;  4WX9 A;  1DP7 P;  4O5V A;  2BYV E;  4CGZ A;  4MEY F;  4M6Y A;  3WTT C;  1FLI A;  3RPQ A;  1ZGJ A;  3WGI A;  2PI0 A;  2XRO A;  1Z6T A;  2QEN A;  3BPV A;  2RN7 A;  3HHH A;  3WG9 A;  4WXC A;  5L3B A;  2HYF A;  4Q47 A;  1FSE A;  2L54 A;  2LDU A;  1LDK B;  2XKO A;  3CO6 C;  3VEP A;  4G6Q A;  1SD4 A;  3E5U A;  4FT8 A;  4RAZ A;  3ZMZ A;  5JI6 A;  2L4M A;  4LLG F;  2XUB A;  2EB7 A;  2FF4 A;  2OZU A;  1J2X A;  4CHU A;  2M5W A;  1CGP A;  2G9W A;  3HTU A;  1OR7 A;  5HLH A;  1FC3 A;  4WWC A;  3GO5 A;  5LHI A;  2Z99 A;  3K69 A;  4EJO A;  3EET A;  4CDG A;  1HXD A;  3ZMS A;  2EFQ A;  1XGM A;  1AWC A;  4ETS A;  3R0A A;  3TGN A;  3KLN A;  2P5L C;  3T1B A;  1A04 A;  2QBY A;  2M8E A;  2HS5 A;  4A5N A;  1H9G A;  4IXA A;  3ZQ7 A;  2EFN A;  1G6N A;  3QPT A;  2PLY A;  2P6S A;  4U0V A;  4G94 A;  3DKW A;  3JW4 A;  3I54 A;  3FX3 A;  2GAU A;  1R00 A;  1ULY A;  4JQF A;  1BM9 A;  3KZZ A;  1XB4 A;  4L9N A;  2P7C B;  4RGX A;  2ISZ A;  5LHH A;  1MDM B;  3J80 K;  2FMY A;  2H6B A;  4L0Z B;  2EK5 A;  4UVA A;  2E1N A;  4S04 A;  3MQ0 A;  1MJ9 A;  4XRF A;  3R6S A;  5A2Q K;  3WTW C;  2RQP A;  3TO9 A;  1JXS A;  2FNA A;  1YO5 C;  5LGU A;  3JAM K;  1I5Z A;  3O6B B;  1T39 A;  5LGN A;  3HSR A;  2HTS A;  2DI3 A;  3RDI A;  1W5T A;  2OA4 A;  4G7Z F;  1S8N A;  4IVN A;  4P9U A;  5BMZ A;  4M71 A;  5HS7 A;  1D3Y A;  1WWX A;  2X0L A;  3BY6 A;  4L18 B;  3F3X A;  2JPC A;  2ESH A;  5ILS A;  4HV6 A;  3RI4 A;  2Q2E A;  4U0Y A;  4G6D A;  4ON0 A;  1R36 A;  2K02 A;  3CUO A;  3FMR A;  2IRF G;  3I4P A;  1HKT A;  3KP6 A;  1W5S A;  4OIO F;  2CGP A;  5J8F A;  4EQQ A;  3IC7 A;  4KIB A;  3I71 A;  3VOE A;  2FOK A;  3ZMT A;  1QBJ A;  2V1U A;  2GQQ A;  4BHP A;  4KIC A;  2VT3 A;  4EVI A;  3B02 A;  1KU9 A;  3E6D A;  2VBX A;  4G7O F;  1I1S A;  1R1T A;  3F6O A;  2F5D A;  5L3E A;  4LG0 B;  1SFU A;  1Z7U A;  5J8C A;  3J7A O;  5H20 A;  3I53 A;  4UHT A;  3KFW X;  1E17 A;  3LA2 A;  3JSP A;  2DLL A;  2KRF A;  4TV7 A;  2UXN A;  4YIF A;  3IRR A;  1O57 A;  1T2K A;  1W4M A;  4O3M A;  2HR3 A;  2QYO A;  3F8B A;  4HLX A;  4R8H A;  3G3Z A;  3ZMD A;  4AWX B;  2VBW A;  4NQW A;  2EFP A;  1SFX A;  2OD5 A;  1FSH A;  2CG4 A;  4DQ2 A;  2JZY A;  2HYG D;  2P7V B;  1AOY A;  3EDP A;  4GGG A;  3E6M A;  1YIO A;  3K1P A;  4CXF A;  2V6C A;  2FE3 A;  3PFI A;  4JBA A;  4EM1 A;  3V4G A;  4XSZ F;  1IW7 F;  4AVP A;  2ZXJ A;  2RV8 A;  3ZN1 A;  1K78 B;  1T38 A;  1XD7 A;  4L5I A;  2QZ8 A;  2H94 A;  2DPU A;  1LVA A;  1K79 A;  2IA0 A;  3L2C A;  2KJC A;  4UV9 A;  3RPU A;  1V4R A;  5HLG A;  4ZZL A;  2FEZ A;  4N9I A;  1WRJ A;  3L7W A;  4HX7 A;  5KK1 A;  3TO6 A;  2RGV A;  1IXC A;  2LSO A;  3QP5 A;  3M1E A;  1IN5 A;  2XRN A;  1OYW A;  2XKP A;  1ZHF A;  5LRR A;  4P5O A;  1ZAR A;  3HUG A;  1Z05 A;  5LBQ A;  5AIQ A;  3VB2 A;  4M73 A;  4I0B A;  1IF1 A;  1J5Y A;  1IRF A;  3RYP A;  2ZBK A;  3K9T A;  2GA2 A;  4ZYD A;  1Q1H A;  5HOO A;  4RGS A;  4EMS A;  1HQC A;  2FQ3 A;  1LNW A;  1YW7 A;  1P2F A;  3GVA A;  5E18 F;  1J9I A;  4QLC U;  2CFX A;  1HSJ A;  3LQR A;  1DPU A;  3LFK A;  1X3U A;  3K0L A;  2BE5 F;  1JHH A;  5DYM A;  3AAF A;  3HOS A;  5HS8 A;  3OV8 A;  3DQV C;  2PMU A;  5E1W A;  3PQK A;  2H27 A;  3LAP A;  4L5J A;  4WXH A;  1ODD A;  3QOP A;  5FLX K;  3NEU A;  3CUQ B;  2ACJ A;  2XAJ A;  4EM2 A;  3R0J A;  1WSU A;  1FY7 A;  3CTA A;  1GHC A;  3R4K A;  1IXR C;  2VE8 A;  4M9X A;  3SFZ A;  4EJW A;  1W7P D;  5HVQ C;  1BN5 A;  1YQA A;  5DDG A;  1IXS B;  1ZRD A;  3K1N A;  4MGR A;  3FXU A;  3HOT A;  3TOB A;  4JK1 X;  2WTE A;  5BPI A;  2Q0O A;  1XCV A;  2FA5 A;  2O61 A;  2KIM A;  4A0Z A;  1FBU A;  4ENM A;  1IN7 A;  5DUI A;  4KT5 C;  4OOI A;  4AD9 A;  2A5Y B;  1R5G A;  4LJZ F;  3FMQ A;  1PDN C;  4ENJ A;  1K7A A;  5IT9 K;  2PJP A;  5J6X A;  3EUH A;  4I98 B;  4GYI A;  2HDC A;  1O7F A;  1O3T A;  2A61 A;  1BJA A;  1R23 A;  2KIF A;  4XLN F;  2M1B A;  3BJA A;  1BBY A;  1OPC A;  1B9N A;  3GW2 A;  2ZO4 A;  3MCZ A;  1O7L A;  3RTR A;  5D5W B;  2XVC A;  1HW5 A;  3F8N A;  2HQR A;  1EH8 A;  3BP8 A;  1TQM A;  2VXZ A;  4GYG A;  3QP6 A;  2A6H F;  3HSF A;  1BC7 C;  1USS A;  4HYE A;  1XGO A;  4RB3 C;  4AIH A;  2R3S A;  2V1D A;  2MLK A;  2ESN A;  4FHT A;  4WXD A;  3ZPL A;  1OYI A;  2VN2 A;  1F4K A;  4YG2 F;  2EA2 A;  4GXO A;  2R7D A;  3TO7 A;  4WCG A;  1JHF A;  2HOE A;  1QZZ A;  3DFG A;  5L3D A;  4EJV A;  3WE2 A;  3T0Y A;  3KEQ A;  2VT2 A;  5DD4 A;  1CF7 A;  3GXO A;  4KMU X;  2QQA A;  4I7H A;  2GXB A;  3W6J B;  4OIR F;  2ZFW A;  2HQN A;  2P8T A;  4ESB A;  2A3S A;  5ERI A;  1O3R A;  3KLO A;  4UUV A;  4KIG A;  2YSR A;  2BEO A;  3NQO A;  2MC3 A;  3P9K A;  1LB2 A;  3I59 B;  3J81 Z;  1B6A A;  3Q5F A;  2HWV A;  3DF8 A;  1B59 A;  5F1R A;  3KP4 A;  3DPT A;  1XCB A;  2OAZ A;  5DCM B;  4ESJ A;  3WGH A;  2MD5 A;  3REO A;  3SHF A;  2Y48 A;  1SD5 A;  2VE9 A;  5IT3 A;  5JR3 A;  2JTV A;  4ASN A;  2OZ6 A;  1U8R A;  5E8I A;  1XSX A;  3V7C A;  1BIB A;  1XSV A;  1J75 A;  3ROU A;  1Z6R A;  5CVU A;  5LRS A;  1UHW A;  2KIU A;  3SQN A;  4MQ9 F;  3DPL C;  2FNP A;  2PBI A;  1J0R A;  4Z2Y A;  4IRH A;  4CYD A;  2W24 A;  4RAY A;  3MFK A;  1IN8 A;  1ON1 A;  4R1H A;  2D1H A;  4BXU A;  3MWM A;  2XIG A;  4ZZD A;  4LLN A;  4HBL A;  2LNB A;  3HYI A;  4HF0 A;  3FZV A;  3C18 A;  5ICE A;  4EJT A;  2IVM A;  2OQR A;  2YU3 A;  5D8L B;  3CJN A;  5HLI A;  2HKX A;  2ZME A;  2ZCW A;  3FHZ A;  2MBF A;  2Z33 A;  2CQK A;  3L00 A;  4Q5S F;  4RB2 C;  4Q48 A;  3ZMU A;  1IN4 A;  3GEZ A;  4YII A;  1TNT A;  3LST A;  1MJA A;  3PQJ A;  1RIO H;  2LKP A;  1K78 A;  3F22 A;  1KQ0 A;  1I6X A;  2XAF A;  5IT9 Z;  5FFX A;  2CSO A;  2YR2 A;  2RC4 A;  1YTY A;  1I1G A;  4FX4 A;  2F5E A;  4B09 A;  3F23 A;  1WI9 A;  3T8T A;  2IJL A;  2EA4 A;  4BNC A;  3KCC A;  1ZLK A;  4N9H A;  5CLS A;  3U1D A;  2COM A;  1ZG3 A;  5D5V B;  3HRS A;  3E3V A;  1DPR A;  3KET A;  1KQ8 A;  1EV7 A;  4U7B A;  1LDJ A;  4LB5 A;  4PCQ A;  3MEX A;  1S7O A;  4M72 A;  4O6J A;  3FWE A;  2XAG A;  4AIJ A;  2FSW A;  4KN7 X;  4MQV A;  2OBP A;  4LLL A;  1T0F A;  2UZK A;  2QQ9 A;  2NYX A;  4HDU A;  2QWW A;  1KA8 A;  2FU4 A;  1HKQ A;  4EJU A;  5D4S A;  3HRT A;  2EV0 A;  5JHU A;  4EGY A;  1IZ1 A;  4RS8 A;  2D2W A;  1YFH A;  4OIQ F;  1UHM A;  3D5L A;  2DQL A;  2DU9 A;  1U2W A;  3MAJ A;  3QAH A;  3C1D A;  3V8K A;  2P5V A;  1QGP A;  4HV5 A;  3E6C C;  1L3L A;  3FMS A;  1OMI A;  1YW8 A;  2D45 A;  5K1Y A;  4IF4 A;  1FBS A;  3CDH A;  1ZN2 A;  1TW2 A;  3GUD A;  4ZYG A;  4EV0 A;  3P7N A;  4P9F A;  3IWZ A;  4KMF A;  4KA4 A;  5D6F A;  3KP2 A;  1TLH B;  3BJO A;  1G3S A;  5DV5 A;  2RNJ A;  3NRV A;  3ELK A;  3TOA A;  2DBB A;  1KGS A;  1GXQ A;  2IP2 A;  3BZ6 A;  1B4A A;  4L9V A;  3T8R A;  4U88 A;  2GWR A;  2M87 A;  1ON2 A;  4A0X A;  3SZT A;  1QNT A;  2IT0 A;  2X4H A;  4CZZ A;  2LF8 A;  1L0O C;  1MGT A;  1S29 A;  3HTS B;  4OMZ A;  4RB0 A;  3VOD A;  4BAY A;  5DCF A;  5ED4 A;  3LAJ A;  3QU3 A;  4LD5 A;  2L4A A;  5CVJ A;  4ZH4 F;  2R7F A;  4BQA A;  4MHG A;  2VC1 A;  5LEK A;  2A07 F;  2K7L A;  3L09 A;  1STZ A;  3ERE D;  4RGU A;  2CWE A;  1NHA A;  4S05 A;  5E1Z B;  3GZ6 A;  3GX4 X;  2W25 A;  3TDZ C;  2BV6 A;  1HKS A;  1P4A A;  2DW4 A;  3ISP A;  5LEJ A;  2P5K A;  1IRG A;  3F6V A;  2H6C A;  3F72 A;  4R79 A;  1UST A;  1U5T C;  1W7P B;  1WQ2 A;  2STW A;  3ULQ B;  4BHC A;  1U78 A;  4DNC A;  3WTZ A;  3MZH A;  3H92 A;  3RYR A;  1SMT A;  2M30 A;  2NAZ A;  1ZG1 A;  2VOD A;  3F8M A;  3K2Z A;  4MTE A;  3WTX C;  1Z9C A;  2KJB A;  2DO7 A;  3DV8 A;  3GWZ A;  2YPR A;  5L3G A;  5H6Q A;  3ECH A;  3HSE A;  2RDP A;  1HW2 A;  3F8F A;  4A2U A;  2JRT A;  1U6G A;  2GZW A;  4L0Y B;  1ONV A;  1LJ9 A;  4HQM A;  5BPD A;  3CO7 C;  5EEG A;  2HFH A;  1KYZ A;  3HRM A;  3DXJ F;  5KVR A;  1XGS A;  2CYY A;  1TBX A;  2HKO A;  3P9I A;  5TJJ A;  3LWF A;  3W6K B;  2FML A;  1WKM A;  1MKM A;  4GO1 A;  4HAM A;  5HS9 A;  3FF5 A;  2PMH A;  4U0W A;  1J7K A;  3WU0 A;  3GF2 A;  2AS5 F;  4UVB A;  1PUE E;  3IKT A;  4MNU A;  4E70 A;  4OMY A;  4HQE A;  3O3K A;  1IAW A;  2FBK A;  1S3J A;  5FGM A;  3LA3 A;  5FD6 A;  3ZN0 A;  3EQL F;  2BGC A;  5D5X B;  2EJR A;  2Q8K A;  5CVI A;  3E6B A;  4ENN A;  3KEO A;  2XV4 S;  5D4R A;  2PFB A;  4IHT A;  2VBY A;  1QZY A;  5TRD A;  1O3Q A;  1RUO A;  2XAH A;  3ABT A;  4F7Z A;  1OKR A;  3BWG A;  3MZY A;  4D0P A;  2ADU A;  1REP C;  1Z91 A;  5K5O A;  1XN7 A;  4ENK A;  3WOD F;  4HF1 A;  5E8G A;  2RKH A;  2VOP A;  1D8K A;  1FPQ A;  1UB9 A;  4HX8 A;  3GFI A;  4I01 A;  1R22 A;  5LGT A;  5FFZ A;  3JTG A;  2XAQ A;  3CUQ C;  5CYV A;  1FP2 A;  1C0W A;  3E5Q A;  1G3Y A;  2GIV A;  3VFZ A;  2P6T A;  2XHK A;  3R61 A;  1FYK A;  4BYY A;  1ZH5 A;  2E7W A;  2JT1 A;  1FZP B;  1D8J A;  4H0E A;  4CIC A;  1ZRF A;  4ESF A;  4YFX F;  2GXG A;  2W84 A;  4KN4 X;  1T98 A;  4KNY A;  1TW3 A;  3ECO A;  2YX4 A;  4BHB A;  1O3S A;  3C3W A;  3BPX A;  1BI2 A;  5DCM A;  4PZJ A;  2ZNY A;  1Z1D A;  2ETH A;  2QLZ A;  1HW1 A;  1BOA A;  3RIR A;  4A6D A;  2K4J A;  2QBY B;  1F1Z A;  2GA1 A;  3GLX A;  3COA C;  3KE2 A;  5JVT A;  2ISY A;  4M74 A;  1U3E M;  4LK1 F;  3BDD A;  2Z3Y A;  5H6R A;  3P9C A;  5E1X A;  5ICF A;  1P6R A;  1UFM A;  2ZJ2 A;  3EYI A;  1FX7 A;  2M45 A;  2O3F A;  3BRO A;  1HST A;  3M8E A;  3WE3 A;  5CJ9 A;  1GXP A;  1DDN A;  3SXY A;  2UWM A;  3B73 A;  1XMA A;  2UXX A;  1EH6 A;  5CVR A;  3JSO A;  4L9T A;  2F5C A;  4UV8 A;  2P4W A;  1HBX G;  4I09 A;  1T6S A;  1YS7 A;  3I58 A;  4HW0 A;  4A5M A;  3LA7 A;  1FYL A;  2E7X A;  3O2P E;  3KZY A;  6PAX A;  1ZRE A;  1YG2 A;  2PQ8 A;  2TDX A;  2PG4 A;  2L01 A;  4KIF A;  2PN6 A;  1W7P A;  4KDP A;  1R5H A;  3J80 Z;  2DK8 A;  1YYV A;  1P92 A; 
#chains in the Genus database with same CATH topology
 2QVO A;  1TTY A;  2CS3 A;  4M9Z A;  2EFO A;  1CQT A;  1UJ8 A;  3QQA A;  1AA7 A;  4AIK A;  1ZRC A;  3HC7 A;  2HTJ A;  3O8H A;  3ZQC A;  3T5X A;  2HOS A;  2LRE A;  3GFM A;  4Z6Y A;  4NHJ A;  3GFJ A;  2H09 A;  1BW5 A;  2E1O A;  4B48 A;  1LPQ A;  2OPT A;  2UUZ A;  1H9T A;  3M7G A;  5K7H A;  2J5O A;  1Z67 A;  2OV7 A;  1DUX C;  2DT5 A;  2XPV A;  4U87 A;  1YS6 A;  3E5X A;  5L3F A;  5D5U B;  3U1K A;  2HYJ A;  1ZG5 A;  3JCU C;  1FWZ A;  2CJJ A;  2K4B A;  1I27 A;  2VC0 A;  1G3T A;  2Y0M A;  3G73 A;  2WY7 Q;  3RKY A;  3V7R A;  1RI7 A;  2DQR A;  4ZYE A;  1TQP A;  4XKW A;  3J81 K;  2ELJ A;  1E3O C;  1PUF B;  4W97 A;  2DK5 A;  3DEE A;  3K4M A;  2KMU A;  1ZGA A;  2LRD A;  3KZI C;  4HG2 A;  5BOX A;  2DAO A;  3KP7 A;  4BEH B;  1GDT A;  2HQ5 A;  3KP3 A;  2IW5 A;  1IRZ A;  3SYT A;  3RKW A;  5CPR B;  2KL4 A;  3BTL A;  4IRI A;  2WAE A;  3BG9 A;  1QO0 D;  2Z2S B;  1K6O A;  1E0E A;  1IG7 A;  3TKY A;  5CKT A;  3U9G A;  4IZZ A;  1EH7 A;  1ZTR A;  5FKN A;  4LG0 A;  4B44 A;  1VTN C;  2F48 A;  1VQO I;  3E97 A;  2HVQ A;  3P5J A;  2CW7 A;  4F52 A;  4DJA A;  5E20 A;  4NC6 A;  5FB2 A;  2FBH A;  2CUF A;  2XB0 X;  2VQC A;  4LG3 A;  1QVU A;  2E5Z A;  2H8R A;  1R1V A;  4I99 C;  4Y13 A;  2KRC A;  2HU9 A;  3QRF F;  4YFN F;  2E19 A;  2M3A A;  3ABU A;  3DLA A;  2RVC A;  4NQW B;  4ZC3 A;  2O6G E;  1JE8 A;  1XGN A;  3D0S A;  2W4S A;  1QPM A;  1FBQ A;  3Q9V A;  5AON A;  5JVG F;  3WU2 C;  2XDV A;  2B9S A;  4LK0 F;  2FXA A;  1I3A A;  2V1X A;  2OF7 A;  5HDK A;  3DP7 A;  1YLF A;  2ZKZ A;  2QUF A;  1S72 I;  3DBH B;  4N0B A;  1SMY F;  2EQR A;  4PJ0 C;  1MBH A;  1OYY A;  1D0Z A;  4II2 A;  1JKQ C;  1U9O A;  1H0M A;  4NB5 A;  4XLP F;  3K6G A;  1FMW A;  1LEB A;  2LKX A;  3S15 J;  1WH7 A;  2L7M P;  3QYE A;  3OS0 A;  1RNL A;  2VON A;  3CDL A;  4JYK A;  2X6Y A;  1BR1 A;  1VQ5 I;  1YW9 A;  3H0D A;  4RB1 A;  3RPU D;  2NNY A;  2WAQ N;  5DD8 A;  1R5I D;  1E3P A;  2MLG A;  1G3W A;  1HDP A;  2LLK A;  4F55 A;  1TP4 A;  2K9M A;  1YIJ I;  1X4O A;  3OOP A;  2WY8 Q;  3CMY A;  3S93 A;  3D1N I;  1FYM A;  2BBY A;  1P4X A;  2HEO A;  1D1B A;  1SFE A;  4GDF A;  1QQI A;  1V3F A;  3ML6 A;  3HOV J;  3K70 D;  1X4P A;  1R1U A;  5AIP A;  4BQN A;  3IH2 A;  2KIS A;  1LQ1 A;  4M3F A;  4Y52 J;  1B9M A;  3HPG A;  2V79 A;  1S7A A;  1WJC A;  1E2X A;  2I10 A;  1BI0 A;  2D1V A;  3F21 A;  4UVC A;  4I2O A;  1IUF A;  4HZF A;  2IEK A;  2OQG A;  5D6E A;  2K86 A;  5J1U A;  1G4D A;  2ZME B;  3C7J A;  5ICC A;  2L02 A;  3B6C A;  2ECC A;  3VYR B;  3TDU C;  2E1C A;  3OYE A;  2IPQ X;  1T0F C;  2EIK H;  2KLO A;  4FX0 A;  4PGG A;  5GP9 A;  4G7H F;  1D5V A;  1ZQ3 P;  3EUH C;  2ZXH A;  4LGW A;  2FRH A;  1Y0N A;  4QWQ A;  3I59 A;  2IS1 A;  3CES A;  4XIC A;  2O7O A;  2X1C A;  1IN6 A;  2EIM H;  5JLX A;  1WJB A;  3CP8 A;  5EG0 A;  1APL C;  3IRQ A;  2O0Y A;  3SZP A;  4NNJ A;  4HOB A;  3HHG A;  2Z5U A;  2HZT A;  3WU1 B;  4XBF A;  3BR1 A;  4A0Y A;  3N4M A;  3IHU A;  2LR8 A;  2WA0 A;  3H9J A;  2I8D A;  2G7H A;  2WWY A;  2NNN A;  4UNO A;  5ILV A;  2BY2 A;  5J47 A;  1X58 A;  3H9Q A;  4XMY A;  2X6X A;  4WF2 A;  2JA5 J;  2MH9 A;  2YX7 A;  3K7A J;  5F6F A;  4B8X A;  1MBE A;  2K9L A;  3S2W A;  4BAC A;  1VND A;  2KP6 A;  1J09 A;  1OCZ H;  4K2E A;  1VQ9 I;  3BG6 A;  1IUY A;  2XF5 A;  4PGH A;  3GTO J;  4HX4 A;  1WI3 A;  2VQG A;  4PSX A;  2K27 A;  4JP0 A;  4UXN A;  4RM3 A;  3WHC A;  1KU7 A;  3JTH A;  3N05 A;  5DEQ A;  4KYW A;  2M0C A;  3WGG A;  2W82 A;  4UUS B;  1I39 A;  2M34 A;  2LP0 A;  1P9Q C;  1WVR A;  3V7S A;  1TQI A;  3I64 A;  3KEY A;  3H3Z A;  4BQQ A;  3N97 A;  2EWN A;  2WV0 A;  2JWT A;  4BJ5 C;  3HRU A;  2G7U A;  2JA8 J;  1BI3 A;  2IAI A;  3GYH X;  1CF7 B;  2EIJ H;  5ICG A;  3BOQ A;  2X6W A;  3EUA A;  3BG7 A;  3NAR A;  3CJT B;  3H35 A;  3RZO J;  4Q4Z F;  2CQN A;  2JSC A;  2V9V A;  3VYT B;  3K1M A;  5J1R A;  1POG A;  2HXI A;  3WTS C;  5D8K B;  3FDY A;  3A0B C;  1MMD A;  4KFC A;  4CA0 A;  3AG2 H;  2K40 A;  1Z3X A;  1J59 A;  1FNN A;  2GOM A;  5C3E J;  2PEX A;  3LMM A;  2MA3 A;  1SVO A;  1UHS A;  1W5C C;  3WTY C;  4LFU A;  1SVM A;  4GCV A;  1ZLJ A;  4X1E A;  3QPH A;  3TW6 A;  1FOK A;  1SAU A;  4KUM A;  1B72 B;  2MGQ A;  1IJW C;  1F5T A;  5IP6 A;  2AO9 A;  2STT A;  1B8I B;  4FTH A;  4XQF A;  1MBG A;  3F8C A;  3GZ5 A;  1H88 C;  1O4X A;  2A69 F;  2X1E A;  2XGX A;  2D5V A;  2LC2 A;  3I3L A;  2ECB A;  2OJE D;  2KDZ A;  2E71 A;  2DOD A;  3GTG J;  3ZMV A;  4PJN A;  2KZG A;  2IA2 A;  4F3Q A;  3FK6 A;  4IHS A;  3U2R A;  5LHG A;  4D5C A;  2MH2 A;  5M5X J;  5F64 A;  1FT9 A;  4HA8 A;  3RQ4 A;  3CF5 F;  1SAX A;  4HF2 A;  4RLQ A;  1KU2 A;  5FRM A;  3DPU A;  2GIZ A;  3IKV A;  3A2K A;  2IA1 A;  3A02 A;  5K5Q A;  1IDZ A;  3M07 A;  4KT6 A;  5K5R A;  1V54 H;  3WTU C;  4OIP F;  5FLX Z;  3I4N J;  5EF6 A;  2XC7 A;  3H36 A;  2DTR A;  3JRI A;  1R58 A;  4WK8 F;  4C30 A;  1G2H A;  1OIS A;  2HZD A;  2F5F A;  2IBD A;  2ZNZ A;  2O8X A;  2AXL A;  2LYC A;  4XSX F;  3GFL A;  1RUN A;  3V42 A;  4A12 A;  2R7X A;  2A5W A;  3CMM A;  3V8J A;  3ZQI A;  4HDV A;  2NOG A;  4M9S A;  2FBI A;  1XSD A;  3QU6 A;  2GM4 A;  3BTJ A;  2EV5 A;  2O03 A;  3WTV C;  1NK3 P;  4HLY A;  1XG1 A;  2VPR A;  5E17 F;  4CCO A;  2DPD A;  4ZTJ A;  1GVJ A;  1P4W A;  4I02 A;  4A3I J;  1G8X A;  5L3C A;  4L9J A;  4OIN F;  3W3C A;  1WJA A;  4MTD A;  1RES A;  3FK7 A;  3CCU I;  2VLA A;  2Y75 A;  3KYL A;  3TW7 A;  3RZD J;  3CUQ A;  2CO5 A;  4DGW B;  5F27 A;  2QQB A;  1BIA A;  9ANT A;  1MDM A;  4IJA A;  3GCM A;  1JKP C;  4LB6 B;  5BQT A;  3OSG A;  1ZYR F;  2VI6 A;  2FD5 A;  4AUX A;  1MNM C;  1MMN A;  1ZKG A;  2L7F P;  1GT0 C;  1Y0U A;  5HNH A;  3C2H A;  5HDG A;  1KYW A;  4IRG A;  3ZP5 A;  3KP5 A;  3S17 J;  1PP8 F;  2LBF A;  2X1D A;  2QM3 A;  2DOE A;  3E1S A;  2JPB A;  3Q9S A;  3IL2 A;  2Z9O A;  3DCF A;  4IEJ A;  4YFK F;  2OU2 A;  3R60 A;  1SD7 A;  5FD5 A;  3FBN B;  1EKE A;  4ZYH A;  4KIT B;  1YHQ I;  4A6E A;  2L7Z A;  3S14 J;  3H3U A;  4HPQ A;  2VBZ A;  2W85 A;  4EGZ A;  3KX2 A;  2WC2 A;  4Y15 A;  3WG7 H;  1XDU A;  4Y17 A;  1JGS A;  2EV6 A;  2NS0 A;  5ILU A;  2VKD A;  2B0L A;  2VAS A;  1DU6 A;  1TNS A;  1LDD A;  4FE7 A;  2F4I A;  4P96 A;  4C3J J;  3I5U A;  2L3D A;  3K4L A;  3HBL A;  1LEA A;  1OCO H;  5HOD A;  4G8X A;  1MMS A;  4DBQ A;  3EYY A;  2LY9 A;  5CVV A;  5CQE A;  2DYR H;  5JFR A;  1P7I A;  5GAG J;  5FO5 A;  1X2N A;  3L2W A;  4F93 B;  2RQQ A;  2NVT J;  2JA6 J;  3FIS A;  1MJB A;  1S6L A;  1XMK A;  3MVP A;  2VOO A;  3MKW B;  2Y0S A;  4Y33 A;  1ZAO A;  5DUK A;  4AYB N;  4CO8 A;  1DGW Y;  4G9Y A;  5BS6 A;  4F91 B;  1YE9 A;  1BC8 C;  3CCV I;  4IQJ A;  4OU0 A;  2BHZ A;  1IRX A;  1U5T A;  1RZ4 A;  1K83 J;  2RAE A;  3RKX A;  3PO2 J;  1XDS A;  3FKJ A;  1R7J A;  2E60 A;  4UB6 C;  4XKV A;  2ELH A;  3RJP A;  5E3L A;  2W57 A;  5A2Q Z;  3S3M A;  2COB A;  2DFH A;  2XF6 A;  2KKO A;  4QPQ A;  5GTI C;  1SD6 A;  5CQG A;  1JUM A;  4EM0 B;  4BKX A;  2A68 F;  3DEU A;  2EFW A;  1IGN A;  5HDN A;  3JAM Z;  2HGC A;  1MZB A;  1KU3 A;  2W48 A;  5LLQ A;  2DFI A;  1WZ2 A;  2PMZ A;  3BLY A;  1YJW I;  4U7D A;  5K7Z A;  2GBY A;  3M9A A;  1U5T B;  2NRA C;  4I0A A;  4PSW A;  4IPA A;  3HIF A;  3AG3 H;  2XAS A;  2CQQ A;  3ABK H;  3TQN A;  4LMY A;  2CW0 F;  4RA2 A;  4MFE A;  4L5E A;  1F9N A;  1MH3 A;  4NDL A;  1Y39 A;  3FM3 A;  5EEH A;  1UCR A;  2E34 A;  3ABL H;  3OL3 A;  3L9F A;  2ZSH B;  3TL4 X;  4KIS A;  2F2E A;  1PVE A;  1WFX A;  3K2A A;  3OR1 C;  2CH0 A;  2R0Q C;  3OS2 A;  2LF7 A;  2A6E F;  1TWF J;  1ETX A;  3IWF A;  3OYD A;  4RGR A;  2E1M C;  4MFD A;  3BJ6 A;  4BQO A;  4PDK A;  4M6X A;  2K9Q A;  1PUF A;  3FXR A;  1TL8 A;  3FM5 A;  4MEX F;  1FP1 D;  3I0T A;  1BI1 A;  3AG4 H;  4P55 A;  1NK2 P;  3M8F A;  2O9L A;  1KQ9 A;  1MD0 A;  3CLO A;  3V8L A;  5KAI C;  1N25 A;  1B1B A;  3SJM A;  2FX0 A;  1YJN I;  1W0T A;  1PP7 U;  2C6Y A;  1OCP A;  4BH9 A;  2J5P A;  3S3N A;  2VB6 A;  4CSW A;  3FXQ A;  1QRY A;  2YUS A;  3LQQ A;  5C44 J;  3CDI A;  2IS6 A;  2ICW G;  3CP2 A;  4WX9 A;  3S1M J;  4YIR X;  2ZC2 A;  1ACI A;  1DP7 P;  4O5V A;  2BYV E;  4CGZ A;  2DXI A;  1DGR M;  3LSM A;  4MEY F;  4D7M A;  2CFO A;  5KNL A;  1RKT A;  4JX4 A;  2DJI A;  4M6Y A;  3WTT C;  1FLI A;  3RPQ A;  1ZGJ A;  3WGI A;  2PI0 A;  4C3H J;  1Y56 A;  2XRO A;  1Z6T A;  2QEN A;  3BPV A;  3CCR I;  2RN7 A;  3HHH A;  3WG9 A;  2PJR B;  4WXC A;  5L3B A;  2HYF A;  2EZK A;  3RSN A;  2LMD A;  4IQ4 A;  4AC0 A;  4Q47 A;  2ZFU A;  3OYB A;  4LOC A;  4C2M J;  2AQF A;  2MSY A;  1FSE A;  2R7U A;  2MAB A;  5GPC A;  3JRB A;  4XK4 A;  2L54 A;  2LDU A;  1LDK B;  2XKO A;  3CO6 C;  3VEP A;  4G6Q A;  1SD4 A;  2DN0 A;  2E5N A;  2QQ8 A;  4XON A;  3DBL B;  2H8W A;  3E5U A;  1V5G A;  4FT8 A;  4XLH A;  1TT5 B;  2NVX J;  3M1C A;  4RAZ A;  2OUM A;  3ZMZ A;  3CJQ B;  2FOW A;  2OCC H;  4XRS G;  5JI6 A;  2L4M A;  2IGN A;  4LLG F;  2XUB A;  2EB7 A;  2DT6 A;  2FF4 A;  2OZU A;  1J2X A;  4XM3 A;  4CHU A;  1LVK A;  1W36 D;  1MBK A;  1VQK I;  1Y6I A;  2VPL A;  4IHY A;  2M5W A;  1SVL A;  1CGP A;  1WHU A;  2G9W A;  3MZ8 A;  1SAN A;  3HTU A;  3KYC B;  1OR7 A;  1Y8Q B;  5HLH A;  1FC3 A;  4IOC F;  4WWC A;  3GO5 A;  5LHI A;  2Z99 A;  2M4K A;  3VSL A;  3F0C A;  3K69 A;  4EJO A;  2VKV A;  5DM6 F;  3HB9 A;  1T08 B;  2JUG A;  3EET A;  1R6R A;  4CDG A;  1LE8 B;  5FKO A;  4D7N A;  1HXD A;  2MFZ A;  3ZMS A;  2EFQ A;  1XGM A;  1FEX A;  1AWC A;  3A4C A;  5JLW A;  1AHD P;  4ETS A;  4A3C J;  3R0A A;  3JRD A;  4UB8 C;  4ZDP A;  3TBI A;  4CCJ A;  3TGN A;  3KLN A;  3ONQ A;  2P5L C;  3K4B A;  3HEF A;  3T1B A;  1A04 A;  3VDX A;  3QYF A;  3JRH A;  2QBY A;  2M8E A;  2RRE A;  2HS5 A;  4A5N A;  1H9G A;  2KT0 A;  4IXA A;  3ZQ7 A;  2EFN A;  2XGE A;  5F0H A;  1G6N A;  2H1K A;  3QPT A;  2PLY A;  2F6C A;  1FMV A;  2P6S A;  3DLL F;  2KPM A;  3ERM A;  2K9S A;  1HA8 A;  2TRT A;  4U0V A;  4G94 A;  3DKW A;  4BE1 A;  3JW4 A;  4G6T B;  3I54 A;  1VF9 A;  2X9D A;  1ETQ A;  3FX3 A;  3PNY A;  2GAU A;  2FJ1 A;  3NAU A;  1R00 A;  1ULY A;  4JQF A;  2K9N A;  4A3M J;  5GAH J;  2K5C A;  3OIP A;  4ZTF A;  1BM9 A;  3KZZ A;  1XB4 A;  4DBR A;  4L9N A;  2P7C B;  4Y3O A;  4RGX A;  2ISZ A;  5LHH A;  1MDM B;  3J80 K;  2FMY A;  3PUB A;  2F4O B;  2H6B A;  4F92 B;  4JX5 A;  4L0Z B;  1V5F A;  3FXO A;  4A3G J;  1LFB A;  2XPU A;  3BG3 A;  3QOE A;  2EK5 A;  1VQN I;  4UVA A;  2E1N A;  3ABM H;  4S04 A;  3MQ0 A;  1MJ9 A;  4XRF A;  1OQY A;  3R6S A;  5A2Q K;  3WTW C;  3O8G A;  2RQP A;  3OL4 A;  2DMT A;  2R4G A;  3TO9 A;  2R7Z J;  2EPF A;  1D0Y A;  3TP3 A;  3JRC A;  1E3H A;  4FIS A;  1JXS A;  4XOR A;  2FNA A;  3DU5 A;  1YO5 C;  5EGO B;  5LGU A;  5EZH A;  5B5E C;  3JAM K;  2DA7 A;  2MG4 A;  4XRS A;  1I5Z A;  2XGD A;  3SDG A;  3O6B B;  1T39 A;  5LGN A;  1K6Y A;  3PFY A;  1N75 A;  4YEL A;  3HSR A;  1TZL A;  2HTS A;  3M8J A;  2ZME C;  4E7I A;  2DI3 A;  1ZGW A;  2BVL A;  4UY8 I;  3RDI A;  3GTL J;  3DTE A;  1YRN B;  1W5T A;  2OA4 A;  1TT0 A;  4G7Z F;  2X51 A;  3IH4 A;  5M3F J;  1S8N A;  4IVN A;  4P9U A;  5BMZ A;  5KCM A;  4M71 A;  3PNV A;  3BQZ A;  5HS7 A;  3SEZ A;  1D3Y A;  1WWX A;  3GTJ J;  5IOZ A;  2X0L A;  3SZG A;  3BY6 A;  3DKX A;  1BL0 A;  4L18 B;  2K3P A;  3F3X A;  2JJ7 A;  2JPC A;  3AG1 H;  2ESH A;  3HGY A;  5ILS A;  4HV6 A;  3RI4 A;  2BZT A;  3A0H C;  5FRO A;  1X1D A;  1ETY A;  2CUE A;  2Q2E A;  4U0Y A;  1BOB A;  4G6D A;  4ON0 A;  4EEF G;  1R36 A;  3K4K A;  5B66 C;  2K02 A;  4BE2 A;  3H5A A;  3CUO A;  3A1Y A;  2DT7 B;  3FMR A;  2IRF G;  3I4P A;  4AVZ A;  3GME A;  1HKT A;  3FHN A;  2F5V A;  3KP6 A;  1W5S A;  4OIO F;  4D1Q A;  2CGP A;  2V26 A;  5J8F A;  4EQQ A;  2X48 A;  3IC7 A;  3MD2 A;  4KIB A;  3I71 A;  3VOE A;  2FOK A;  2LH9 A;  3ZMT A;  1ORK A;  1QBJ A;  4P1W A;  2LK2 A;  1AKH A;  2V1U A;  2GQQ A;  2V1N A;  4BHP A;  4M3G A;  2DMP A;  4KIC A;  2VT3 A;  4EVI A;  3B02 A;  3CCY A;  5FLV A;  1KU9 A;  3W2A A;  3LSJ A;  1BA5 A;  3E6D A;  2IXS A;  2VBX A;  3ZQG A;  3CC7 I;  2A6T A;  4G7O F;  1I1S A;  1R1T A;  3F6O A;  2F5D A;  5L3E A;  3GTM J;  5LFA A;  2MW8 A;  1HOM A;  3NWT A;  1SFK A;  4LG0 B;  1SFU A;  1VI0 A;  4PUS A;  4CZC A;  1Z7U A;  2VJ5 A;  4B3X A;  5J8C A;  4RLF A;  5KHD A;  4XN3 A;  3VPR A;  3J7A O;  1QVT A;  5C4X J;  4BEH A;  3ESW B;  3OYH A;  5HLT A;  3A01 A;  5H20 A;  4M3E A;  3I53 A;  4XOP A;  1B72 A;  2XRL A;  2QSH X;  1ITY A;  4UHT A;  3CCQ I;  4QTR A;  4CCM A;  3KFW X;  1E17 A;  3LA2 A;  3JSP A;  2Y0S N;  2VJJ A;  4AYB A;  4Y7N J;  2DLL A;  2CU7 A;  3I4M J;  4IKF A;  2KRF A;  3QYB A;  1VQL I;  1K4T A;  1MIJ A;  1WH5 A;  4TV7 A;  2UXN A;  2M0M A;  4YIF A;  3H0G J;  1O57 A;  3IRR A;  2M7B A;  1T2K A;  1W4M A;  2Q2E B;  1ZEL A;  4O3M A;  2HR3 A;  3D5S C;  1FIP A;  4CCL A;  1XMX A;  4HNT A;  2QYO A;  3F8B A;  4HLX A;  4R8H A;  3G3Z A;  3ZMD A;  4AWX B;  4J00 A;  2BW3 B;  2VBW A;  4NQW A;  1NTC A;  2EFP A;  1A5J A;  1XC5 A;  3G2B A;  3BZC A;  4ZDO A;  1SFX A;  3OYM A;  2OD5 A;  5EJC A;  1SEU A;  4NUB A;  1WJF A;  2MYS A;  5IP7 J;  2QGU A;  1FSH A;  2CG4 A;  1VQ7 I;  2V6E A;  2HVR A;  4PJM A;  4DQ2 A;  2JZY A;  2HYG D;  2R5Z B;  2XF7 A;  2P7V B;  2BXY A;  5IP9 J;  2NVU B;  1AOY A;  3EDP A;  3U21 A;  5J40 A;  1WCM J;  4GGG A;  4ABZ A;  2DA1 A;  3E6M A;  1YIO A;  1DP3 A;  2X6O A;  3K1P A;  1ZR4 A;  1UEL B;  3S32 A;  1FOW A;  4CXF A;  2HXO A;  2V6C A;  2FE3 A;  3OIQ A;  3PFI A;  1TWH J;  3HKZ A;  3FXJ A;  4JBA A;  2IS4 A;  2ID6 A;  2IS2 A;  4EM1 A;  4OAY A;  3V4G A;  2Q1Z B;  2M2E A;  4N4N B;  4XSZ F;  2XAU A;  3G71 I;  2XSD C;  2LY2 A;  1IW7 F;  4AVP A;  2ZXJ A;  2RV8 A;  1XX5 A;  1Y1V J;  3ZN1 A;  1K78 B;  1ZK8 A;  1SFO J;  2E2J J;  1T38 A;  1XD7 A;  4BXF A;  4L5I A;  2QZ8 A;  3IAS 2;  2H94 A;  2DPU A;  1LVA A;  4A3E J;  1MMG A;  2LTP A;  2EH3 A;  1K79 A;  2IA0 A;  2KIQ A;  3L2C A;  2KJC A;  4UV9 A;  3RPU A;  4A3B J;  1H8A C;  1V4R A;  5HLG A;  4ZZL A;  3I56 I;  2FEZ A;  4N9I A;  3S1R J;  1WRJ A;  3L7W A;  1IO2 A;  4HX7 A;  4BDY A;  2V7F A;  4II3 A;  5KK1 A;  1MNE A;  3HJE A;  2EZL A;  3TO6 A;  4XNF A;  2RGV A;  2YS9 A;  3OYK A;  1IXC A;  1UAA A;  2LSO A;  1NG7 A;  2NXN B;  2JVH A;  3QP5 A;  1S5L C;  1IN5 A;  3M1E A;  1MH4 A;  1LFP A;  1Z21 A;  2AXT C;  2XRN A;  1WPK A;  5GAD J;  4DOZ A;  1OYW A;  4PK4 A;  2XKP A;  1ZHF A;  4AU7 A;  5LRR A;  3S3O A;  4OWR B;  2KFD A;  4P5O A;  1ZAR A;  3HUG A;  1Z05 A;  4HSR A;  2WB1 A;  4IOA F;  5LBQ A;  5AIQ A;  3VB2 A;  4M73 A;  5J4V A;  4H4K C;  3PUF A;  4I0B A;  1IF1 A;  3PIO F;  1QU3 A;  1J5Y A;  3CME I;  1IRF A;  3RYP A;  1JTX A;  2ZBK A;  3K9T A;  1TWC J;  2GA2 A;  4ZYD A;  1Q1H A;  4BDZ A;  5HOO A;  2VL8 A;  2EIL H;  2V9K A;  1W0U A;  3AKZ A;  4RGS A;  4EMS A;  1HQC A;  2FQ3 A;  4I6Z A;  1EJ9 A;  2E36 A;  5K7F A;  2JVG A;  1LNW A;  1YW7 A;  2O5R A;  3ZQQ A;  2UV1 A;  1P2F A;  4AID A;  1KZH A;  3HUG B;  3GVA A;  4XKB A;  5E18 F;  1J9I A;  4QLC U;  4GFB A;  2CFX A;  1HSJ A;  2EIN H;  3LQR A;  1DPU A;  1A31 A;  2DJN A;  3LFK A;  3K4N A;  1RET A;  1X3U A;  3L1P A;  4B43 A;  3K0L A;  3GTP J;  1FTT A;  2BE5 F;  1IV8 A;  1JHH A;  5DYM A;  3AAF A;  3HOS A;  1T95 A;  1S7E A;  2R7V A;  3L2V A;  5HS8 A;  3OV8 A;  3H5R A;  3J7Y J;  1ZR2 A;  3DQV C;  2LFB A;  2LY1 A;  2PMU A;  3MKL A;  5E1W A;  4M3D A;  2VKH A;  3PQK A;  2R5Y A;  4BGD A;  3ZR8 X;  3PIP F;  2H27 A;  3LAP A;  4L5J A;  1R9T J;  1BR2 A;  4WXH A;  1ODD A;  3QOP A;  4GRI A;  5FLX K;  3NEU A;  2O8K A;  1W1W E;  4V2F A;  4XR6 A;  2V4J C;  3CUQ B;  3PO3 J;  3GTQ J;  2ACJ A;  2XAJ A;  3CF2 A;  4EM2 A;  2HQA A;  3R0J A;  1JJ6 C;  3JRF A;  1F43 A;  1WSU A;  1FY7 A;  2KRH A;  3CTA A;  2GXA A;  1GHC A;  3R4K A;  1IXR C;  2VE8 A;  3BG5 A;  4M9X A;  3SFZ A;  1QPI A;  4XLC A;  4EJW A;  1W7P D;  5HVQ C;  1BN5 A;  5EDN A;  1YQA A;  5DDG A;  1A35 A;  1IXS B;  2CMP A;  3DTK A;  3HKZ N;  4RAF A;  1ZRD A;  1I6H J;  3K1N A;  4MGR A;  2P81 A;  3FXU A;  1VQ4 I;  3HOT A;  2WAF A;  3TOB A;  3S16 J;  2PJR A;  1ENH A;  4DZJ A;  4JK1 X;  1OCT C;  2L0K A;  2WTE A;  3PSF A;  3BC8 A;  2Q0O A;  5BPI A;  4RMN A;  3G6E I;  5E3N A;  1XCV A;  5J1Y A;  2L9N A;  2FA5 A;  3D5R C;  4FET A;  2O61 A;  4A69 C;  3G1L A;  4B47 A;  2KIM A;  4A0Z A;  3LSK A;  1FBU A;  1V55 H;  4ENM A;  1IN7 A;  5IYB J;  4KT5 C;  1A6Q A;  4OOI A;  5DUI A;  4AD9 A;  2R5Z A;  1FTZ A;  1MSE C;  2A5Y B;  3E0J B;  1R5G A;  2ZJQ F;  3PNT A;  4LJZ F;  4E7Z A;  3BTI A;  3FMQ A;  4HNV A;  1PDN C;  4ENJ A;  1K7A A;  4IX7 A;  5IT9 K;  2PJP A;  3DKY A;  5J6X A;  5EG0 B;  3HG9 A;  3EUH A;  3ZXS A;  4I98 B;  5FKK A;  4GYI A;  4BL0 B;  2HDC A;  2R7O A;  3G1M A;  4D5F A;  1O7F A;  1O3T A;  1U0J A;  2A61 A;  4HEA 2;  3OYA A;  1UZC A;  3HXL A;  1LUJ B;  1BJA A;  3FKI J;  1R23 A;  1X1A A;  2KIF A;  2Y30 A;  2CW8 A;  1QZE A;  3ASN H;  4DYC A;  3BQY A;  4XLN F;  3E7L A;  2L5Q A;  3G1O A;  2M1B A;  3KPH A;  3S1Q J;  3AL0 C;  3BJA A;  2VXD A;  1BBY A;  1OPC A;  2VJI A;  1B9N A;  3GW2 A;  2ZO4 A;  3MCZ A;  1O7L A;  3RTR A;  5D5W B;  2XVC A;  1HW5 A;  3F8N A;  2N8G A;  1TWG J;  2ZJR F;  2HQR A;  3BP8 A;  1EH8 A;  1TQM A;  3G4S I;  2VXZ A;  2R7T A;  3A03 A;  4GYG A;  3QP6 A;  3LOC A;  2A6H F;  3HSF A;  1TC3 C;  1BC7 C;  1USS A;  4HYE A;  3FXK A;  1XGO A;  4RB3 C;  5J4Y A;  3BT9 A;  4AIH A;  1JKR C;  1S9H A;  3GTK J;  2Y69 H;  2R3S A;  2DYS H;  2MLK A;  2ESN A;  1ETK A;  2V1D A;  4FHT A;  4NBQ A;  4WXD A;  3ZPL A;  3VYS B;  1OYI A;  5IPA A;  3GZN B;  2VN2 A;  1JTY A;  1F4K A;  1HLV A;  4E7L A;  4YG2 F;  2EA2 A;  4GXO A;  2R7D A;  3TO7 A;  4WCG A;  2E2I J;  4CUG A;  2KQR A;  1JHF A;  2HOE A;  1QZZ A;  5GPA A;  2L9V A;  3DFG A;  3IUO A;  5IY5 H;  5L3D A;  2DA4 A;  4EJV A;  3WE2 A;  5M5Y J;  4ZJZ A;  3T0Y A;  3KEQ A;  1RR8 C;  3HOW J;  2VT2 A;  1VQ6 I;  5DD4 A;  3BR3 A;  1CF7 A;  3GXO A;  4KMU X;  2QQA A;  2DFF A;  4PFP A;  1QHG A;  2BY3 A;  4I7H A;  1Z77 A;  2GXB A;  5EGO A;  1GV5 A;  3W6J B;  4OIR F;  2ZFW A;  2HQN A;  2P8T A;  1IDY A;  4ESB A;  5C4J J;  4QIW N;  3SDB A;  2B63 J;  3ZQL A;  2DMQ A;  2DMU A;  2A3S A;  5ERI A;  1O3R A;  3KLO A;  3Q3S A;  4UUV A;  3OYG A;  3JR9 A;  2M9H A;  3ZCO A;  2R7R A;  2QKM B;  3I9V 2;  3RQI A;  4KIG A;  3QWL A;  2YSR A;  2BEO A;  3NQO A;  2MC3 A;  3P9K A;  1LB2 A;  3I59 B;  1YJ9 I;  1R71 A;  2FUG 2;  3J81 Z;  4JOM A;  1T8I A;  1B6A A;  3HOX J;  2HWV A;  3Q5F A;  1RKW A;  3DF8 A;  1HF0 A;  3EPZ A;  3CCE I;  1B59 A;  1IV6 A;  5F1R A;  3KP4 A;  1HC8 A;  3DPT A;  1XCB A;  2OAZ A;  1N77 A;  3M4O J;  5DCM B;  1VZ0 A;  3OR2 C;  4ESJ A;  4HST A;  3WGH A;  2MD5 A;  2AQE A;  4G12 A;  3REO A;  3OYN A;  4ZYA A;  3SHF A;  2Y48 A;  1JUP A;  5E3O A;  1SD5 A;  2VE9 A;  5IT3 A;  5JR3 A;  2JTV A;  4ASN A;  2JK3 A;  2WAD A;  3LSR A;  1U8B A;  1FJL A;  2OZ6 A;  4J01 A;  3M3Y J;  1U8R A;  5E8I A;  5E79 C;  2WB1 N;  1JI8 A;  1XSX A;  3V7C A;  4ANJ A;  1BIB A;  2B7E A;  1IC8 A;  1XSV A;  3UNG C;  1J75 A;  3ROU A;  1Z6R A;  3LL7 A;  4IL6 C;  5EYR A;  2BHY A;  5CVU A;  5LRS A;  5M5W J;  4IHV A;  1UHW A;  2L7K A;  4BUP A;  1RC9 A;  2KIU A;  2EZI A;  3MN2 A;  1BJZ A;  4XID A;  3CCS I;  3SQN A;  4A3F J;  1YOV B;  3DPL C;  4MQ9 F;  2FNP A;  2NS7 A;  2BXZ A;  2JUC A;  2OC6 A;  2PBI A;  1J0R A;  4Z2Y A;  4LIV A;  4IRH A;  2MD0 A;  2DOA A;  4CYD A;  2W24 A;  4RAY A;  4C9Y A;  1B8I A;  3MFK A;  1IN8 A;  1LKX A;  1ON1 A;  1H89 C;  4R1H A;  2D1H A;  4PFO A;  4BXU A;  3MWM A;  4XLF A;  2DFE A;  2XIG A;  2LD5 A;  4ZZD A;  5EEA A;  1BR4 A;  4LLN A;  1QHH D;  3TED A;  1PYV A;  1OCR H;  3Q0W A;  1AKH B;  4HBL A;  2GLO A;  2LNB A;  3HYI A;  4HF0 A;  3IH3 A;  3FZV A;  3C18 A;  4XRM A;  5ICE A;  1X1C A;  2IVM A;  4EJT A;  2OQR A;  2YU3 A;  5D8L B;  2OTL I;  3DEW A;  2ME0 A;  3CJN A;  3L2R A;  5HLI A;  2R5Y B;  5JHF A;  2XPW A;  2HKX A;  2QKL B;  2ZME A;  2ZCW A;  3FHZ A;  4QSH A;  1OJL A;  5B1A H;  2MBF A;  3W6V A;  2Z33 A;  2CQK A;  3L00 A;  4CH7 A;  1X1P A;  2Z1D A;  1ETW A;  4M6V A;  3HOY J;  3J7Z I;  4Q5S F;  4RB2 C;  4Q48 A;  3ZMU A;  1K61 A;  1IN4 A;  4XLA A;  3TMO A;  3OYL A;  1LE8 A;  1Z7L A;  3SEQ A;  3GEZ A;  4YII A;  1TNT A;  3LST A;  1MJA A;  3PQJ A;  3A01 B;  1RIO H;  2LKP A;  2CV2 A;  1K78 A;  3F22 A;  1KQ0 A;  1I6X A;  2XAF A;  3IP4 B;  5IT9 Z;  5FFX A;  2CSO A;  2YR2 A;  4NC7 A;  4BBR J;  2RC4 A;  1YTY A;  3LNQ A;  1K4S A;  1I1G A;  2F5E A;  4FX4 A;  4ITV A;  4B09 A;  3F23 A;  1WI9 A;  2DDA A;  3T8T A;  2IJL A;  2HPM A;  1N78 A;  4Y4R A;  3H3V K;  2EA4 A;  4BNC A;  3MMY B;  2DDB A;  4PJL A;  3KCC A;  2JA2 A;  2EZH A;  2W1O A;  1ZLK A;  4N9H A;  5CLS A;  3U1D A;  3CC4 I;  2COM A;  1ZG3 A;  3BCA A;  2JA7 J;  4HRI A;  5D5V B;  3ZQH A;  3HRS A;  3E3V A;  4FCY A;  1DPR A;  3LSI A;  3KET A;  1KQ8 A;  3F9K A;  1EV7 A;  4U7B A;  4QPO A;  1LDJ A;  1ERD A;  3S2D J;  4LB5 A;  3CCM I;  4PCQ A;  3MEX A;  2R92 J;  3X2Q H;  3OWT A;  1S7O A;  1NH3 A;  1X19 A;  4M72 A;  4O6J A;  3CLQ A;  3FWE A;  2XAG A;  3W2W A;  4AIJ A;  4CYC A;  2FSW A;  4KN7 X;  2WBM A;  1D0X A;  4MQV A;  2E35 A;  1Y8R B;  4XL9 A;  2OBP A;  1T0F A;  1UG2 A;  4LLL A;  1Q1V A;  2UZK A;  2QQ9 A;  1V5E A;  2OCE A;  2NYX A;  5E3M A;  4OAZ A;  3ZGK A;  1OFC X;  1BW6 A;  4HDU A;  2DA3 A;  2QWW A;  4DZP A;  1KA8 A;  3WHB A;  4RDU A;  2FU4 A;  3DBR B;  1HKQ A;  3UKG A;  4EJU A;  5D4S A;  2QCO A;  2QF7 A;  3HRT A;  5TGT A;  2EV0 A;  2L2O A;  4BY7 J;  4W1U A;  5JHU A;  4EGY A;  3LFU A;  3TP0 A;  1IZ1 A;  4RS8 A;  2D2W A;  1YFH A;  2WV1 A;  1UHM A;  3D5L A;  2DQL A;  2DU9 A;  1MW7 A;  4OIQ F;  1U2W A;  3MAJ A;  2ID3 A;  3S8P A;  3QAH A;  3CCL I;  3C1D A;  3V8K A;  5F0F A;  4XOT A;  2P5V A;  1QGP A;  3K10 A;  4HV5 A;  2NVY J;  3E6C C;  1L3L A;  5F08 A;  1P7J A;  2JSP A;  2QSG X;  3FMS A;  4C2U A;  1OMI A;  1YW8 A;  2VQH A;  1VFC A;  2D45 A;  2G0E A;  1MSF C;  5K1Y A;  3JRA A;  2AHQ A;  2VQL A;  4IF4 A;  1JUS A;  3BR2 A;  1FBS A;  1JJ8 C;  1F36 A;  3CDH A;  1ZN2 A;  1TW2 A;  1D5Y A;  3PM1 A;  2PMZ N;  2IGK A;  4B4C A;  2EBI A;  3GUD A;  4NC8 A;  4A93 J;  1WJD A;  5DS9 A;  4ZYG A;  3HDD A;  4EV0 A;  2BVM A;  3LSH A;  1OLT A;  1SC7 A;  4HNU A;  4A3L J;  3P7N A;  4P9F A;  3FBI B;  3IWZ A;  2V9P A;  4KMF A;  3VYU B;  2E2H J;  4KA4 A;  5D6F A;  3KP2 A;  1TLH B;  3BJO A;  1G3S A;  5DV5 A;  2RNJ A;  3NRV A;  2RNG A;  5IYC J;  3ELK A;  3TOA A;  2DBB A;  1KGS A;  2QEX I;  1X2M A;  3K4J A;  1GXQ A;  2ZXW H;  3BR0 A;  1YX5 A;  2CQ7 A;  5TIS C;  1FOY A;  2IP2 A;  1FIA A;  3BZ6 A;  3GBG A;  4MIM A;  1B4A A;  3S2H J;  4UUT A;  3MKY B;  4L9V A;  4MLO A;  3T8R A;  3HPH A;  2GWR A;  4JX6 A;  4U88 A;  2M87 A;  3PL8 A;  3I55 I;  1ON2 A;  2ZB9 A;  1JT6 A;  3PSI A;  3SZT A;  1QNT A;  4A0X A;  4J19 A;  2IT0 A;  4BS9 A;  2X4H A;  4CZZ A;  1JGG A;  4YRV A;  1ETV A;  4E7S A;  2LF8 A;  1L0O C;  1S29 A;  1MGT A;  3EUK L;  3HTS B;  2Y31 A;  4OMZ A;  4RB0 A;  3VOD A;  1MBF A;  3IV5 A;  4BAY A;  5DCF A;  5ED4 A;  2X85 A;  3C2B A;  3LAJ A;  1EA3 A;  3QU3 A;  3OYC A;  4LD5 A;  2L4A A;  5CVJ A;  4ZH4 F;  2R7F A;  2KZV A;  5B3S H;  4BQA A;  2JN6 A;  3ZOB A;  2HVS A;  4MHG A;  2VC1 A;  3OOU A;  3RCO A;  5LEK A;  3Q0U A;  2A07 F;  1YI2 I;  2K7L A;  3L09 A;  1STZ A;  2HNH A;  3ERE D;  3BZK A;  2LVS A;  4RGU A;  4D9J A;  2CWE A;  1YIT I;  1NHA A;  3S1N J;  4S05 A;  3LSP A;  5E1Z B;  1DQU A;  4LIT A;  5F0C A;  1XPX A;  4FE4 A;  5GAE J;  5DM7 F;  3GZ6 A;  3GX4 X;  2W25 A;  2LKS A;  3TDZ C;  3CZ6 A;  3CC2 I;  2BV6 A;  1HKS A;  2IGO A;  3RKQ A;  1P4A A;  2P0W A;  2DW4 A;  4XKC A;  3ISP A;  5LEJ A;  2NOJ B;  2P5K A;  3QOD A;  2CV0 A;  1IRG A;  3F6V A;  2H6C A;  3F72 A;  1T33 A;  4R79 A;  1T56 A;  2LOO A;  4X0G A;  3OYF A;  1UST A;  2HDD A;  2CUZ A;  4YEJ A;  1U5T C;  1W7P B;  1WQ2 A;  2MC4 A;  2STW A;  4IO9 F;  3ULQ B;  1PJR A;  3BR5 A;  1X3Z B;  4BHC A;  1U78 A;  4DNC A;  3WTZ A;  3C2G A;  3MZH A;  5B1B H;  1MBJ A;  3PJR A;  1W36 C;  3H92 A;  3RYR A;  1SMT A;  2M30 A;  2NAZ A;  1ZG1 A;  2VOD A;  3HOU J;  3F8M A;  3K2Z A;  4MTE A;  3WTX C;  1D1A A;  1Z9C A;  3HZJ A;  3HM5 A;  2KHM A;  2KJB A;  3VSK A;  2DO7 A;  3DV8 A;  3GWZ A;  2QA4 I;  2A05 A;  2DA5 A;  4BJ6 C;  2YPR A;  5L3G A;  1U9N A;  5H6Q A;  4N4O B;  1RPW A;  3UR3 C;  3ECH A;  1GV2 A;  3HSE A;  2RDP A;  1HW2 A;  2BW3 A;  3F8F A;  1VQP I;  4A2U A;  1R4M B;  2JRT A;  1X1B A;  1RRJ A;  1U6G A;  2GZW A;  2Z16 A;  3H5N A;  4L0Y B;  3GLL A;  4X6A J;  4DYQ A;  1ONV A;  1LJ9 A;  4HQM A;  5BPD A;  3CO7 C;  5EEG A;  2HFH A;  1KYZ A;  3HRM A;  3DXJ F;  4RM2 A;  5KVR A;  2HOT A;  1XGS A;  4CCK A;  2CYY A;  2L9R A;  1TBX A;  1YX3 A;  2HKO A;  2Y9Z A;  3HOZ J;  4AM3 A;  3P9I A;  4DYR A;  3CJR B;  5TJJ A;  2DA2 A;  3LWF A;  3W6K B;  4FAS D;  2FML A;  2JRM A;  2KDO A;  2M4G A;  1WKM A;  1MKM A;  2VJ4 A;  2XGC A;  4GO1 A;  4HAM A;  2K85 A;  1Y1W J;  3HGG A;  3Q0V A;  2W00 A;  5HS9 A;  3FF5 A;  2M8G X;  2PMH A;  4U0W A;  1J7K A;  3WU0 A;  3GF2 A;  2AS5 F;  4IHX A;  4UVB A;  1A6I A;  1PUE E;  3IKT A;  4MNU A;  5F04 A;  2VIX A;  2I5U A;  2Y2Z A;  2ME6 A;  4E70 A;  1HCR A;  4B1R A;  4OMY A;  2W7N A;  2R7W A;  4HQE A;  3JRG A;  4A3J J;  3O3K A;  1IAW A;  2FBK A;  3BTC A;  2R7S A;  5F1J A;  2HI3 A;  1S3J A;  5FGM A;  3LA3 A;  5FD6 A;  3QPL A;  3DU6 A;  3K4C A;  3ZN0 A;  3EQL F;  3KYD B;  2BGC A;  2EJR A;  5D5X B;  2Q8K A;  3OY9 A;  3OSF A;  5CVI A;  3E6B A;  4ENN A;  2GOX B;  3KEO A;  2XV4 S;  5D4R A;  2PFB A;  2CQX A;  2LG4 A;  4IHT A;  2VBY A;  2E1M B;  3FXM A;  2DMN A;  2QSF X;  1GUU A;  1QZY A;  5TRD A;  4S0H B;  1VQM I;  1O3Q A;  1RUO A;  2XB5 A;  2XAH A;  3MKZ A;  5LD2 C;  4KJZ A;  1OCC H;  3ABT A;  4F7Z A;  1OKR A;  3BWG A;  3IAM 2;  3MZY A;  5IOY A;  3OMY A;  5GTH C;  3CCJ I;  4D0P A;  4ZDL A;  1YRN A;  2ADU A;  1REP C;  1Z91 A;  5K5O A;  1XN7 A;  4ENK A;  3WOD F;  2CUJ A;  4HF1 A;  5E8G A;  2XSJ C;  2RKH A;  2WAQ A;  2VOP A;  1D8K A;  1FPQ A;  1UB9 A;  4HX8 A;  3K70 C;  1OR7 C;  4EAT A;  4I01 A;  3GFI A;  1R22 A;  5LGT A;  1R4N B;  1G59 A;  5FFZ A;  3JTG A;  2XAQ A;  3CUQ C;  5CYV A;  5DTD A;  4A3K J;  3OS1 A;  4DW6 A;  1TWA J;  2OTJ I;  1ETO A;  1FP2 A;  4DIQ A;  1C0W A;  1LFU P;  3E5Q A;  1MND A;  1G3Y A;  2GIV A;  4RAG A;  3VFZ A;  2P6T A;  2XHK A;  3FIW A;  3R61 A;  4BYY A;  1FYK A;  4UUS A;  3ZQF A;  1ZH5 A;  2E7W A;  1I50 J;  2JT1 A;  4FQG A;  4MO7 A;  2BOL A;  1GVD A;  1FZP B;  1VQ8 I;  5IYD J;  2CV1 A;  3SFI A;  4E7K A;  3KIO A;  3CD6 I;  4XLE A;  3BR6 A;  1I3Q J;  2L9S A;  1D8J A;  4H0E A;  1GLN A;  4RBO A;  5FKM A;  4CIC A;  1ZRF A;  2CRG A;  2H1L A;  2PX9 A;  4ESF A;  4YFX F;  2GXG A;  4BBS J;  2W84 A;  4KN4 X;  2HPI A;  4A3D J;  5FJ8 J;  3L2Q A;  1T98 A;  3JRE A;  3L2U A;  4KNY A;  1TW3 A;  2M7A A;  3ECO A;  4B3A A;  2YX4 A;  4BHB A;  2ZXI A;  1JT0 A;  2BY0 A;  1O3S A;  2HOA A;  5H2F C;  5FKL A;  2ZSI B;  3C3W A;  1Z3Y A;  3BPX A;  1BI2 A;  2K3F A;  5DCM A;  4BE0 A;  4PZJ A;  5HNF A;  2VUM J;  3CQZ J;  2ZNY A;  1Z1D A;  4M3B A;  2ETH A;  4BY1 J;  2QLZ A;  5FLM J;  2NVQ J;  2TCT A;  1D1C A;  3B6A A;  5KAF C;  1HW1 A;  1BOA A;  3RIR A;  4A6D A;  5EZG A;  1EF4 A;  2K4J A;  2IGM A;  2QBY B;  1F1Z A;  2GA1 A;  1A36 A;  3GLX A;  3COA C;  2BY1 A;  3KE2 A;  1MMA A;  4E6K G;  3AL0 B;  1FOX A;  5JVT A;  2ISY A;  3DWL E;  2ELK A;  4BJT A;  1WGX A;  2DA6 A;  2HDW A;  4M74 A;  1UMQ A;  2JMW A;  2DTZ A;  4LK1 F;  3BDD A;  1U3E M;  1AU7 A;  4BXX J;  3BCB A;  3OYI A;  1XS9 A;  3H1C A;  1WJ5 A;  2Z3Y A;  4E7H A;  5H6R A;  4BU2 A;  1M1E B;  3P9C A;  3FXL A;  4LIU A;  1WJE A;  5E1X A;  1R49 A;  3QPS A;  5ICF A;  1P6R A;  1UFM A;  2ZJ2 A;  3EYI A;  1FX7 A;  2M45 A;  2YU9 J;  5FRN A;  2O3F A;  3BRO A;  1HST A;  3M8E A;  2JQ7 A;  4V19 K;  3WE3 A;  5CJ9 A;  1GXP A;  1DDN A;  3SXY A;  2VKE A;  3OIO A;  4C2T A;  2R93 J;  3B73 A;  2UWM A;  1XMA A;  1DU0 A;  2UXX A;  1EH6 A;  3H9G A;  2DOF A;  3HL2 A;  5CVR A;  3JSO A;  3LSG A;  3ASO H;  4L9T A;  2F5C A;  3OYJ A;  4UV8 A;  1HDD C;  2DCE A;  2P4W A;  2FQ4 A;  1HBX G;  1X3W B;  3J7A Y;  4I09 A;  1JKO C;  5M3M J;  4E7J A;  1T6S A;  5J3L A;  3NWS A;  2LBF B;  1YS7 A;  3I58 A;  1UG0 A;  3CMA I;  4HW0 A;  4A5M A;  3LA7 A;  4XN0 A;  4I76 A;  1XTA A;  4CCN A;  3VWB A;  2ZJP F;  1FYL A;  2E7X A;  3O2P E;  3KZY A;  2Y9Y A;  4C3I J;  6PAX A;  3DTI A;  1KON A;  1ZRE A;  1YG2 A;  3AFH A;  2F4M B;  1Z0X A;  2PQ8 A;  1QA6 A;  2TDX A;  2R7Q A;  2PG4 A;  2L01 A;  3ZRG A;  4KIF A;  2PN6 A;  4PJJ A;  1W7P A;  4E4H A;  4IHW A;  1NG6 A;  3W2V A;  4KDP A;  4V2G A;  1R5H A;  3J80 Z;  2DK8 A;  1YYV A;  4CYC B;  5BNG A;  1P92 A;  2NS8 A;  1RR7 A; 
#chains in the Genus database with same CATH homology
 2QVO A;  1TTY A;  4M9Z A;  2EFO A;  4AIK A;  1ZRC A;  2HTJ A;  3T5X A;  3GFM A;  4NHJ A;  3GFJ A;  2H09 A;  1H9T A;  3M7G A;  2J5O A;  1DUX C;  2DT5 A;  5L3F A;  1YS6 A;  3E5X A;  5D5U B;  1ZG5 A;  1FWZ A;  2K4B A;  1I27 A;  2VC0 A;  1G3T A;  2Y0M A;  3G73 A;  3RKY A;  3V7R A;  1RI7 A;  2DQR A;  4ZYE A;  1TQP A;  3J81 K;  2DK5 A;  1ZGA A;  5BOX A;  2DAO A;  3KP7 A;  3KP3 A;  2IW5 A;  3RKW A;  4IRI A;  1QO0 D;  1K6O A;  3TKY A;  3U9G A;  1EH7 A;  4LG0 A;  1VTN C;  3E97 A;  5E20 A;  5FB2 A;  2FBH A;  1R1V A;  4Y13 A;  3QRF F;  4YFN F;  3ABU A;  2RVC A;  2O6G E;  1JE8 A;  1XGN A;  3D0S A;  5AON A;  1QPM A;  1FBQ A;  3Q9V A;  4LK0 F;  2FXA A;  2V1X A;  5HDK A;  3DP7 A;  1YLF A;  2ZKZ A;  2QUF A;  4N0B A;  1SMY F;  1OYY A;  1H0M A;  4NB5 A;  4XLP F;  1LEB A;  1RNL A;  2VON A;  1YW9 A;  4RB1 A;  2NNY A;  5DD8 A;  2MLG A;  1G3W A;  3OOP A;  1FYM A;  2BBY A;  1P4X A;  2HEO A;  1SFE A;  1QQI A;  1V3F A;  3ML6 A;  1R1U A;  5AIP A;  1LQ1 A;  1B9M A;  2V79 A;  1S7A A;  1E2X A;  1BI0 A;  2D1V A;  3F21 A;  4UVC A;  4I2O A;  4HZF A;  2OQG A;  5D6E A;  2K86 A;  1G4D A;  2ZME B;  3C7J A;  5ICC A;  2L02 A;  3TDU C;  2E1C A;  2IPQ X;  4G7H F;  4FX0 A;  4PGG A;  1D5V A;  4LGW A;  2FRH A;  4QWQ A;  3I59 A;  1IN6 A;  3IRQ A;  2O0Y A;  3SZP A;  4HOB A;  3HHG A;  2Z5U A;  2HZT A;  3WU1 B;  4XBF A;  3N4M A;  4A0Y A;  3IHU A;  2G7H A;  2WWY A;  2NNN A;  4UNO A;  5ILV A;  4WF2 A;  2MH9 A;  2YX7 A;  5F6F A;  4B8X A;  3S2W A;  4K2E A;  1IUY A;  4PGH A;  4HX4 A;  2K27 A;  4UXN A;  1KU7 A;  3JTH A;  5DEQ A;  4KYW A;  3WGG A;  3V7S A;  1TQI A;  3I64 A;  3H3Z A;  3N97 A;  2EWN A;  2WV0 A;  3HRU A;  2G7U A;  1BI3 A;  3GYH X;  1CF7 B;  5ICG A;  3BOQ A;  4Q4Z F;  2JSC A;  2V9V A;  3K1M A;  3WTS C;  5D8K B;  4KFC A;  1J59 A;  1FNN A;  2PEX A;  2MA3 A;  3WTY C;  4LFU A;  4GCV A;  1ZLJ A;  3QPH A;  1FOK A;  4KUM A;  1F5T A;  2STT A;  3F8C A;  3GZ5 A;  2A69 F;  2XGX A;  3ZMV A;  2IA2 A;  4IHS A;  3U2R A;  5LHG A;  2MH2 A;  5F64 A;  1FT9 A;  4HA8 A;  1SAX A;  4HF2 A;  1KU2 A;  3IKV A;  2IA1 A;  5K5Q A;  5K5R A;  3WTU C;  4OIP F;  5FLX Z;  2DTR A;  1R58 A;  4WK8 F;  2F5F A;  2ZNZ A;  2O8X A;  2AXL A;  4XSX F;  3GFL A;  1RUN A;  4A12 A;  3V8J A;  4HDV A;  4M9S A;  2FBI A;  1XSD A;  3QU6 A;  2EV5 A;  2O03 A;  3WTV C;  4HLY A;  5E17 F;  2DPD A;  1GVJ A;  1P4W A;  4I02 A;  5L3C A;  4L9J A;  4OIN F;  4MTD A;  2Y75 A;  3CUQ A;  2CO5 A;  2QQB A;  1BIA A;  1MDM A;  4IJA A;  4LB6 B;  5BQT A;  1ZYR F;  1Y0U A;  5HDG A;  1KYW A;  4IRG A;  3ZP5 A;  3KP5 A;  1PP8 F;  2QM3 A;  2JPB A;  3Q9S A;  3IL2 A;  2Z9O A;  4YFK F;  2OU2 A;  3R60 A;  1SD7 A;  5FD5 A;  4ZYH A;  4A6E A;  3H3U A;  2VBZ A;  2W85 A;  4EGZ A;  2WC2 A;  4Y15 A;  1XDU A;  4Y17 A;  1JGS A;  2EV6 A;  2NS0 A;  5ILU A;  2B0L A;  1TNS A;  1LDD A;  4P96 A;  3I5U A;  2L3D A;  1LEA A;  4G8X A;  3EYY A;  5CVV A;  5JFR A;  5FO5 A;  1MJB A;  1S6L A;  1XMK A;  2VOO A;  1ZAO A;  5DUK A;  4CO8 A;  4G9Y A;  5BS6 A;  1BC8 C;  4OU0 A;  1U5T A;  1RZ4 A;  3RKX A;  1XDS A;  1R7J A;  3RJP A;  2ELH A;  5A2Q Z;  2W57 A;  2KKO A;  1SD6 A;  4EM0 B;  2A68 F;  3DEU A;  2EFW A;  5HDN A;  3JAM Z;  2HGC A;  1MZB A;  1KU3 A;  5LLQ A;  2DFI A;  4U7D A;  3M9A A;  1U5T B;  2NRA C;  4I0A A;  4IPA A;  3HIF A;  2XAS A;  3TQN A;  4LMY A;  2CW0 F;  1F9N A;  3FM3 A;  5EEH A;  1UCR A;  3L9F A;  2F2E A;  2LF7 A;  2A6E F;  3IWF A;  4RGR A;  3BJ6 A;  4PDK A;  4M6X A;  3FXR A;  3FM5 A;  4MEX F;  1FP1 D;  3I0T A;  1BI1 A;  4P55 A;  3M8F A;  1KQ9 A;  1MD0 A;  3CLO A;  3V8L A;  1B1B A;  1PP7 U;  2C6Y A;  4BH9 A;  2J5P A;  3FXQ A;  3LQQ A;  4WX9 A;  1DP7 P;  4O5V A;  2BYV E;  4CGZ A;  4MEY F;  4M6Y A;  3WTT C;  1FLI A;  3RPQ A;  1ZGJ A;  3WGI A;  2PI0 A;  2XRO A;  1Z6T A;  2QEN A;  3BPV A;  2RN7 A;  3HHH A;  3WG9 A;  4WXC A;  5L3B A;  2HYF A;  4Q47 A;  1FSE A;  2L54 A;  2LDU A;  1LDK B;  2XKO A;  3CO6 C;  3VEP A;  4G6Q A;  1SD4 A;  3E5U A;  4FT8 A;  4RAZ A;  3ZMZ A;  5JI6 A;  2L4M A;  4LLG F;  2XUB A;  2EB7 A;  2FF4 A;  2OZU A;  1J2X A;  4CHU A;  2M5W A;  1CGP A;  2G9W A;  3HTU A;  1OR7 A;  5HLH A;  1FC3 A;  4WWC A;  3GO5 A;  5LHI A;  2Z99 A;  3K69 A;  4EJO A;  3EET A;  4CDG A;  1HXD A;  3ZMS A;  2EFQ A;  1XGM A;  1AWC A;  4ETS A;  3R0A A;  3TGN A;  3KLN A;  2P5L C;  3T1B A;  1A04 A;  2QBY A;  2M8E A;  2HS5 A;  4A5N A;  1H9G A;  4IXA A;  3ZQ7 A;  2EFN A;  1G6N A;  3QPT A;  2PLY A;  2P6S A;  4U0V A;  4G94 A;  3DKW A;  3JW4 A;  3I54 A;  3FX3 A;  2GAU A;  1R00 A;  1ULY A;  4JQF A;  1BM9 A;  3KZZ A;  1XB4 A;  4L9N A;  2P7C B;  4RGX A;  2ISZ A;  5LHH A;  1MDM B;  3J80 K;  2FMY A;  2H6B A;  4L0Z B;  2EK5 A;  4UVA A;  2E1N A;  4S04 A;  3MQ0 A;  1MJ9 A;  4XRF A;  3R6S A;  5A2Q K;  3WTW C;  2RQP A;  3TO9 A;  1JXS A;  2FNA A;  1YO5 C;  5LGU A;  3JAM K;  1I5Z A;  3O6B B;  1T39 A;  5LGN A;  3HSR A;  2HTS A;  2DI3 A;  3RDI A;  1W5T A;  2OA4 A;  4G7Z F;  1S8N A;  4IVN A;  4P9U A;  5BMZ A;  4M71 A;  5HS7 A;  1D3Y A;  1WWX A;  2X0L A;  3BY6 A;  4L18 B;  3F3X A;  2JPC A;  2ESH A;  5ILS A;  4HV6 A;  3RI4 A;  2Q2E A;  4U0Y A;  4G6D A;  4ON0 A;  1R36 A;  2K02 A;  3CUO A;  3FMR A;  2IRF G;  3I4P A;  1HKT A;  3KP6 A;  1W5S A;  4OIO F;  2CGP A;  5J8F A;  4EQQ A;  3IC7 A;  4KIB A;  3I71 A;  3VOE A;  2FOK A;  3ZMT A;  1QBJ A;  2V1U A;  2GQQ A;  4BHP A;  4KIC A;  2VT3 A;  4EVI A;  3B02 A;  1KU9 A;  3E6D A;  2VBX A;  4G7O F;  1I1S A;  1R1T A;  3F6O A;  2F5D A;  5L3E A;  4LG0 B;  1SFU A;  1Z7U A;  5J8C A;  3J7A O;  5H20 A;  3I53 A;  4UHT A;  3KFW X;  1E17 A;  3LA2 A;  3JSP A;  2DLL A;  2KRF A;  4TV7 A;  2UXN A;  4YIF A;  3IRR A;  1O57 A;  1T2K A;  1W4M A;  4O3M A;  2HR3 A;  2QYO A;  3F8B A;  4HLX A;  4R8H A;  3G3Z A;  3ZMD A;  4AWX B;  2VBW A;  4NQW A;  2EFP A;  1SFX A;  2OD5 A;  1FSH A;  2CG4 A;  4DQ2 A;  2JZY A;  2HYG D;  2P7V B;  1AOY A;  3EDP A;  4GGG A;  3E6M A;  1YIO A;  3K1P A;  4CXF A;  2V6C A;  2FE3 A;  3PFI A;  4JBA A;  4EM1 A;  3V4G A;  4XSZ F;  1IW7 F;  4AVP A;  2ZXJ A;  2RV8 A;  3ZN1 A;  1K78 B;  1T38 A;  1XD7 A;  4L5I A;  2QZ8 A;  2H94 A;  2DPU A;  1LVA A;  1K79 A;  2IA0 A;  3L2C A;  2KJC A;  4UV9 A;  3RPU A;  1V4R A;  5HLG A;  4ZZL A;  2FEZ A;  4N9I A;  1WRJ A;  3L7W A;  4HX7 A;  5KK1 A;  3TO6 A;  2RGV A;  1IXC A;  2LSO A;  3QP5 A;  3M1E A;  1IN5 A;  2XRN A;  1OYW A;  2XKP A;  1ZHF A;  5LRR A;  4P5O A;  1ZAR A;  3HUG A;  1Z05 A;  5LBQ A;  5AIQ A;  3VB2 A;  4M73 A;  4I0B A;  1IF1 A;  1J5Y A;  1IRF A;  3RYP A;  2ZBK A;  3K9T A;  2GA2 A;  4ZYD A;  1Q1H A;  5HOO A;  4RGS A;  4EMS A;  1HQC A;  2FQ3 A;  1LNW A;  1YW7 A;  1P2F A;  3GVA A;  5E18 F;  1J9I A;  4QLC U;  2CFX A;  1HSJ A;  3LQR A;  1DPU A;  3LFK A;  1X3U A;  3K0L A;  2BE5 F;  1JHH A;  5DYM A;  3AAF A;  3HOS A;  5HS8 A;  3OV8 A;  3DQV C;  2PMU A;  5E1W A;  3PQK A;  2H27 A;  3LAP A;  4L5J A;  4WXH A;  1ODD A;  3QOP A;  5FLX K;  3NEU A;  3CUQ B;  2ACJ A;  2XAJ A;  4EM2 A;  3R0J A;  1WSU A;  1FY7 A;  3CTA A;  1GHC A;  3R4K A;  1IXR C;  2VE8 A;  4M9X A;  3SFZ A;  4EJW A;  1W7P D;  5HVQ C;  1BN5 A;  1YQA A;  5DDG A;  1IXS B;  1ZRD A;  3K1N A;  4MGR A;  3FXU A;  3HOT A;  3TOB A;  4JK1 X;  2WTE A;  5BPI A;  2Q0O A;  1XCV A;  2FA5 A;  2O61 A;  2KIM A;  4A0Z A;  1FBU A;  4ENM A;  1IN7 A;  5DUI A;  4KT5 C;  4OOI A;  4AD9 A;  2A5Y B;  1R5G A;  4LJZ F;  3FMQ A;  1PDN C;  4ENJ A;  1K7A A;  5IT9 K;  2PJP A;  5J6X A;  3EUH A;  4I98 B;  4GYI A;  2HDC A;  1O7F A;  1O3T A;  2A61 A;  1BJA A;  1R23 A;  2KIF A;  4XLN F;  2M1B A;  3BJA A;  1BBY A;  1OPC A;  1B9N A;  3GW2 A;  2ZO4 A;  3MCZ A;  1O7L A;  3RTR A;  5D5W B;  2XVC A;  1HW5 A;  3F8N A;  2HQR A;  1EH8 A;  3BP8 A;  1TQM A;  2VXZ A;  4GYG A;  3QP6 A;  2A6H F;  3HSF A;  1BC7 C;  1USS A;  4HYE A;  1XGO A;  4RB3 C;  4AIH A;  2R3S A;  2V1D A;  2MLK A;  2ESN A;  4FHT A;  4WXD A;  3ZPL A;  1OYI A;  2VN2 A;  1F4K A;  4YG2 F;  2EA2 A;  4GXO A;  2R7D A;  3TO7 A;  4WCG A;  1JHF A;  2HOE A;  1QZZ A;  3DFG A;  5L3D A;  4EJV A;  3WE2 A;  3T0Y A;  3KEQ A;  2VT2 A;  5DD4 A;  1CF7 A;  3GXO A;  4KMU X;  2QQA A;  4I7H A;  2GXB A;  3W6J B;  4OIR F;  2ZFW A;  2HQN A;  2P8T A;  4ESB A;  2A3S A;  5ERI A;  1O3R A;  3KLO A;  4UUV A;  4KIG A;  2YSR A;  2BEO A;  3NQO A;  2MC3 A;  3P9K A;  1LB2 A;  3I59 B;  3J81 Z;  1B6A A;  3Q5F A;  2HWV A;  3DF8 A;  1B59 A;  5F1R A;  3KP4 A;  3DPT A;  1XCB A;  2OAZ A;  5DCM B;  4ESJ A;  3WGH A;  2MD5 A;  3REO A;  3SHF A;  2Y48 A;  1SD5 A;  2VE9 A;  5IT3 A;  5JR3 A;  2JTV A;  4ASN A;  2OZ6 A;  1U8R A;  5E8I A;  1XSX A;  3V7C A;  1BIB A;  1XSV A;  1J75 A;  3ROU A;  1Z6R A;  5CVU A;  5LRS A;  1UHW A;  2KIU A;  3SQN A;  4MQ9 F;  3DPL C;  2FNP A;  2PBI A;  1J0R A;  4Z2Y A;  4IRH A;  4CYD A;  2W24 A;  4RAY A;  3MFK A;  1IN8 A;  1ON1 A;  4R1H A;  2D1H A;  4BXU A;  3MWM A;  2XIG A;  4ZZD A;  4LLN A;  4HBL A;  2LNB A;  3HYI A;  4HF0 A;  3FZV A;  3C18 A;  5ICE A;  4EJT A;  2IVM A;  2OQR A;  2YU3 A;  5D8L B;  3CJN A;  5HLI A;  2HKX A;  2ZME A;  2ZCW A;  3FHZ A;  2MBF A;  2Z33 A;  2CQK A;  3L00 A;  4Q5S F;  4RB2 C;  4Q48 A;  3ZMU A;  1IN4 A;  3GEZ A;  4YII A;  1TNT A;  3LST A;  1MJA A;  3PQJ A;  1RIO H;  2LKP A;  1K78 A;  3F22 A;  1KQ0 A;  1I6X A;  2XAF A;  5IT9 Z;  5FFX A;  2CSO A;  2YR2 A;  2RC4 A;  1YTY A;  1I1G A;  4FX4 A;  2F5E A;  4B09 A;  3F23 A;  1WI9 A;  3T8T A;  2IJL A;  2EA4 A;  4BNC A;  3KCC A;  1ZLK A;  4N9H A;  5CLS A;  3U1D A;  2COM A;  1ZG3 A;  5D5V B;  3HRS A;  3E3V A;  1DPR A;  3KET A;  1KQ8 A;  1EV7 A;  4U7B A;  1LDJ A;  4LB5 A;  4PCQ A;  3MEX A;  1S7O A;  4M72 A;  4O6J A;  3FWE A;  2XAG A;  4AIJ A;  2FSW A;  4KN7 X;  4MQV A;  2OBP A;  4LLL A;  1T0F A;  2UZK A;  2QQ9 A;  2NYX A;  4HDU A;  2QWW A;  1KA8 A;  2FU4 A;  1HKQ A;  4EJU A;  5D4S A;  3HRT A;  2EV0 A;  5JHU A;  4EGY A;  1IZ1 A;  4RS8 A;  2D2W A;  1YFH A;  4OIQ F;  1UHM A;  3D5L A;  2DQL A;  2DU9 A;  1U2W A;  3MAJ A;  3QAH A;  3C1D A;  3V8K A;  2P5V A;  1QGP A;  4HV5 A;  3E6C C;  1L3L A;  3FMS A;  1OMI A;  1YW8 A;  2D45 A;  5K1Y A;  4IF4 A;  1FBS A;  3CDH A;  1ZN2 A;  1TW2 A;  3GUD A;  4ZYG A;  4EV0 A;  3P7N A;  4P9F A;  3IWZ A;  4KMF A;  4KA4 A;  5D6F A;  3KP2 A;  1TLH B;  3BJO A;  1G3S A;  5DV5 A;  2RNJ A;  3NRV A;  3ELK A;  3TOA A;  2DBB A;  1KGS A;  1GXQ A;  2IP2 A;  3BZ6 A;  1B4A A;  4L9V A;  3T8R A;  4U88 A;  2GWR A;  2M87 A;  1ON2 A;  4A0X A;  3SZT A;  1QNT A;  2IT0 A;  2X4H A;  4CZZ A;  2LF8 A;  1L0O C;  1MGT A;  1S29 A;  3HTS B;  4OMZ A;  4RB0 A;  3VOD A;  4BAY A;  5DCF A;  5ED4 A;  3LAJ A;  3QU3 A;  4LD5 A;  2L4A A;  5CVJ A;  4ZH4 F;  2R7F A;  4BQA A;  4MHG A;  2VC1 A;  5LEK A;  2A07 F;  2K7L A;  3L09 A;  1STZ A;  3ERE D;  4RGU A;  2CWE A;  1NHA A;  4S05 A;  5E1Z B;  3GZ6 A;  3GX4 X;  2W25 A;  3TDZ C;  2BV6 A;  1HKS A;  1P4A A;  2DW4 A;  3ISP A;  5LEJ A;  2P5K A;  1IRG A;  3F6V A;  2H6C A;  3F72 A;  4R79 A;  1UST A;  1U5T C;  1W7P B;  1WQ2 A;  2STW A;  3ULQ B;  4BHC A;  1U78 A;  4DNC A;  3WTZ A;  3MZH A;  3H92 A;  3RYR A;  1SMT A;  2M30 A;  2NAZ A;  1ZG1 A;  2VOD A;  3F8M A;  3K2Z A;  4MTE A;  3WTX C;  1Z9C A;  2KJB A;  2DO7 A;  3DV8 A;  3GWZ A;  2YPR A;  5L3G A;  5H6Q A;  3ECH A;  3HSE A;  2RDP A;  1HW2 A;  3F8F A;  4A2U A;  2JRT A;  1U6G A;  2GZW A;  4L0Y B;  1ONV A;  1LJ9 A;  4HQM A;  5BPD A;  3CO7 C;  5EEG A;  2HFH A;  1KYZ A;  3HRM A;  3DXJ F;  5KVR A;  1XGS A;  2CYY A;  1TBX A;  2HKO A;  3P9I A;  5TJJ A;  3LWF A;  3W6K B;  2FML A;  1WKM A;  1MKM A;  4GO1 A;  4HAM A;  5HS9 A;  3FF5 A;  2PMH A;  4U0W A;  1J7K A;  3WU0 A;  3GF2 A;  2AS5 F;  4UVB A;  1PUE E;  3IKT A;  4MNU A;  4E70 A;  4OMY A;  4HQE A;  3O3K A;  1IAW A;  2FBK A;  1S3J A;  5FGM A;  3LA3 A;  5FD6 A;  3ZN0 A;  3EQL F;  2BGC A;  5D5X B;  2EJR A;  2Q8K A;  5CVI A;  3E6B A;  4ENN A;  3KEO A;  2XV4 S;  5D4R A;  2PFB A;  4IHT A;  2VBY A;  1QZY A;  5TRD A;  1O3Q A;  1RUO A;  2XAH A;  3ABT A;  4F7Z A;  1OKR A;  3BWG A;  3MZY A;  4D0P A;  2ADU A;  1REP C;  1Z91 A;  5K5O A;  1XN7 A;  4ENK A;  3WOD F;  4HF1 A;  5E8G A;  2RKH A;  2VOP A;  1D8K A;  1FPQ A;  1UB9 A;  4HX8 A;  3GFI A;  4I01 A;  1R22 A;  5LGT A;  5FFZ A;  3JTG A;  2XAQ A;  3CUQ C;  5CYV A;  1FP2 A;  1C0W A;  3E5Q A;  1G3Y A;  2GIV A;  3VFZ A;  2P6T A;  2XHK A;  3R61 A;  1FYK A;  4BYY A;  1ZH5 A;  2E7W A;  2JT1 A;  1FZP B;  1D8J A;  4H0E A;  4CIC A;  1ZRF A;  4ESF A;  4YFX F;  2GXG A;  2W84 A;  4KN4 X;  1T98 A;  4KNY A;  1TW3 A;  3ECO A;  2YX4 A;  4BHB A;  1O3S A;  3C3W A;  3BPX A;  1BI2 A;  5DCM A;  4PZJ A;  2ZNY A;  1Z1D A;  2ETH A;  2QLZ A;  1HW1 A;  1BOA A;  3RIR A;  4A6D A;  2K4J A;  2QBY B;  1F1Z A;  2GA1 A;  3GLX A;  3COA C;  3KE2 A;  5JVT A;  2ISY A;  4M74 A;  1U3E M;  4LK1 F;  3BDD A;  2Z3Y A;  5H6R A;  3P9C A;  5E1X A;  5ICF A;  1P6R A;  1UFM A;  2ZJ2 A;  3EYI A;  1FX7 A;  2M45 A;  2O3F A;  3BRO A;  1HST A;  3M8E A;  3WE3 A;  5CJ9 A;  1GXP A;  1DDN A;  3SXY A;  2UWM A;  3B73 A;  1XMA A;  2UXX A;  1EH6 A;  5CVR A;  3JSO A;  4L9T A;  2F5C A;  4UV8 A;  2P4W A;  1HBX G;  4I09 A;  1T6S A;  1YS7 A;  3I58 A;  4HW0 A;  4A5M A;  3LA7 A;  1FYL A;  2E7X A;  3O2P E;  3KZY A;  6PAX A;  1ZRE A;  1YG2 A;  2PQ8 A;  2TDX A;  2PG4 A;  2L01 A;  4KIF A;  2PN6 A;  1W7P A;  4KDP A;  1R5H A;  3J80 Z;  2DK8 A;  1YYV A;  1P92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...