4HQEA

The crystal structure of qsrr-dna complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
MMEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords Transcriptional regulator QsrR
total genus 38
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hqeA00
5TRDA 4P9UA 4YFNF 1O3TA 2YPRA 2DAOA 3O2PE 2BEOA 4PGGA 3FXRA 1YW8A 3HOTA 1K6OA 1YTYA 4KIGA 3KP7A 2OD5A 1Z6RA 1ZRCA 2M30A 2HKOA 5DYMA 2PMHA 3GW2A 2HYGD 4I02A 1A04A 2LDUA 2MH9A 2A68F 4PZJA 4G9YA 3J80K 2ZMEB 4FX0A 3E5XA 1XSDA 1TNSA 4NB5A 4L9JA 4UVBA 1KU7A 2F2EA 1T98A 1HW2A 2DK8A 5KVRA 4HYEA 1UCRA 2OZUA 4MQ9F 4A0ZA 2ZNYA 4Y17A 2VBWA 3RIRA 1MDMA 3IRQA 1QPMA 1RUOA 1IN6A 1O7FA 1QGPA 3U9GA 4P55A 2XUBA 2OQGA 1XD7A 5BOXA 3ZN1A 1JHFA 1SFUA 2QQBA 4L9VA 2WC2A 2VODA 2QZ8A 4KN4X 1SD7A 4F7ZA 3VB2A 4KYWA 4DNCA 3KP3A 3FWEA 4ETSA 3GZ5A 5HS7A 2KJBA 3Q5FA 2W85A 1CF7A 4LG0A 3T0YA 2NAZA 2UWMA 1J59A 1UFMA 4A0YA 4OIQF 3F3XA 1D8KA 3TKYA 3WTVC 1JGSA 4ZYDA 1UB9A 3LWFA 3FZVA 1D5VA 2CO5A 1MD0A 4KICA 2M1BA 5LHHA 3WTZA 3G73A 1WQ2A 3HUGA 2FU4A 2QLZA 1YS7A 3CLOA 2EFNA 3CUOA 1LNWA 3F8MA 4ESBA 2E7WA 2Z9OA 2IA2A 1O3QA 5DCMA 5FD5A 2RNJA 5ERIA 1BIAA 3K9TA 4G94A 2A3SA 2YR2A 1IRGA 1SAXA 3CO7C 2IT0A 1XN7A 2A07F 2DW4A 2RGVA 2HKXA 5FLXZ 5ILUA 3S2WA 5HDNA 4JBAA 3FMQA 4GXOA 4EJWA 3EQLF 1AOYA 3MQ0A 2EFQA 1GHCA 4B8XA 5DEQA 2YX7A 1BM9A 3GUDA 1G3YA 1ZHFA 3HSRA 1I1GA 4LLGF 1QBJA 4U7DA 1DPUA 3RKWA 1T2KA 1W7PB 5D4RA 4M74A 3MFKA 2HYFA 3CTAA 3V8JA 4LD5A 2M45A 3T5XA 1XGMA 4ENNA 1X3UA 4R1HA 2XIGA 2HQNA 3HTUA 3RTRA 3CUQB 2QUFA 1H9GA 4HW0A 5H20A 2D2WA 3DEUA 2VBZA 4ZZDA 2AS5F 3BPVA 2ZXJA 2H6BA 1R1TA 1Q1HA 4G6QA 2FNAA 1AWCA 4P5OA 2GXBA 4EGYA 2QBYB 2K27A 4AIKA 4MQVA 2RV8A 3H92A 2K7LA 4FT8A 3V8KA 3SXYA 2X4HA 3E3VA 4KDPA 1U2WA 3I58A 2Q0OA 2DLLA 2KIMA 4A5MA 5D4SA 1R23A 2PLYA 4XLNF 2OZ6A 3SZPA 1BBYA 4AD9A 3ZP5A 4ZYGA 3GFIA 1P6RA 2VE8A 4L9TA 4M6YA 4RAZA 2IP2A 1KQ8A 3J81K 1HQCA 3I59A 1OYYA 3FX3A 4MTEA 1DUXC 3HSEA 2UXNA 3QOPA 3F8NA 2HZTA 3GEZA 2RKHA 4EJOA 5LLQA 4YIIA 3IKTA 1ON2A 2F5CA 4ENKA 2XASA 1F4KA 3GF2A 4RGUA 4OOIA 4N0BA 3E6MA 5ILSA 3MZYA 5E17F 4JQFA 2GWRA 4NQWA 3DV8A 3K1NA 2Z3YA 2PI0A 4FHTA 5HLGA 4WK8F 4HV5A 4QWQA 4MHGA 1HKTA 1YS6A 2DO7A 1B9NA 4OIOF 2EA4A 2F5EA 1B6AA 1F9NA 4WX9A 3PQKA 2KJCA 2GAUA 3VEPA 1KQ0A 2GQQA 2FXAA 4I98B 2XHKA 3PQJA 4CHUA 5ILVA 4E70A 3ZMTA 2LKPA 3KP2A 4HF1A 2YX4A 5AONA 3U1DA 2CWEA 1S29A 1YW7A 1CF7B 1BC8C 4KT5C 5E1WA 4NHJA 1ODDA 1C0WA 3HRSA 3P9KA 1ZRFA 1J0RA 5IT9K 5E8GA 4UNOA 2JRTA 4G6DA 5F64A 3QP6A 2ISZA 3RKYA 4BQAA 1E17A 4Y15A 4ZZLA 1GXPA 5E20A 3B02A 3BOQA 1EH8A 2V9VA 1FBUA 3K1MA 5DCFA 4I2OA 2HEOA 2B0LA 2FQ3A 3GXOA 5L3FA 3VODA 3CUQC 3LA7A 3KEQA 2ACJA 2V1UA 4A0XA 2GZWA 3K1PA 2NYXA 3FXUA 2P6SA 2Y75A 1IRFA 5CVIA 3IC7A 2O0YA 4YG2F 1U5TA 4QLCU 3CDHA 2FMLA 2ZCWA 1DDNA 2J5OA 2K86A 2V6CA 5CVUA 5E8IA 4PCQA 3COAC 1IW7F 3KLOA 3KCCA 4GO1A 3KP4A 4U0VA 4Q4ZF 3M1EA 3EYYA 2J5PA 4O5VA 4EGZA 3F22A 3E5QA 4MTDA 2HDCA 4U0WA 1FYKA 1LVAA 3LAJA 5DD4A 5ICGA 4AWXB 1GXQA 1TW3A 4EQQA 3F23A 4I0BA 1FPQA 2DPDA 3RDIA 1BI3A 5D8LB 2WTEA 1ZYRF 5LEJA 3LA2A 1LEBA 3O6BB 2COMA 2BBYA 2XROA 3FM3A 3WGHA 4Z2YA 1TQPA 3L9FA 5LEKA 2P7CB 1XSXA 3E97A 2A5YB 1P92A 3T8TA 1FP2A 4G7OF 2L01A 3KZYA 4IVNA 1F5TA 2ZNZA 1R58A 2IVMA 1O7LA 4I01A 1W4MA 1HXDA 3EUHA 1V4RA 2G9WA 2XAQA 4AIJA 4RS8A 1KQ9A 2MD5A 4I09A 4I0AA 2FA5A 1PP7U 2D1VA 3I59B 3Q9VA 1G3WA 3R0JA 4GCVA 2VOOA 1G3TA 1SD6A 3P9CA 4M9ZA 3GVAA 4HLXA 3E6BA 3RI4A 1HSJA 4XLPF 1U6GA 5F6FA 4K2EA 3BZ6A 2ETHA 2HQRA 5K5QA 4EM2A 2QYOA 5HLHA 1MGTA 3IL2A 4M6XA 1ZGJA 2A6HF 2JSCA 3ZMVA 3M7GA 2DI3A 2NNNA 2XVCA 3ZQ7A 5FFXA 2A6EF 2GA1A 2QQ9A 4RB2C 2QENA 2CW0F 5JVTA 2AXLA 2DPUA 1HW1A 1USSA 1S7AA 3R0AA 1P2FA 2IA1A 4WXDA 3P7NA 3ROUA 3F72A 1FYLA 2HGCA 5BQTA 4HDVA 4XSXF 3R4KA 4OMZA 1B4AA 1VTNC 2IRFG 1SD5A 1ZGAA 4RB3C 5LRSA 6PAXA 2Y48A 2ESNA 2FOKA 3HSFA 1R36A 2V1DA 4HV6A 4UXNA 2PFBA 3HIFA 4UV8A 5J6XA 3WTYC 1R5HA 2R3SA 4AIHA 1BJAA 1IXRC 1EH7A 3C3WA 2QWWA 3MZHA 1U78A 4LB6B 3BWGA 2KRFA 1OYWA 3J81Z 4GYIA 4ZYEA 5L3GA 1U5TC 3E6CC 3KFWX 1XMKA 1KYWA 4U0YA 2MLGA 3L7WA 1IAWA 2IA0A 3V7CA 3RKXA 1PP8F 3CUQA 1IN5A 1H9TA 2M5WA 5DDGA 5H6RA 1FBSA 3MAJA 1R00A 5CJ9A 3KP5A 3JAMK 4HLYA 1HKSA 3VFZA 2XAHA 2A69F 3PFIA 1ZLKA 3I53A 1R22A 2KIUA 3HRMA 2CQKA 5BPDA 1TNTA 2XGXA 3WTWC 2WV0A 3WODF 2VC0A 2MH2A 2R7DA 4LG0B 5D5XB 1UHWA 4RB0A 4CICA 2W84A 1IUYA 2ZBKA 5FD6A 1MJAA 1JE8A 1ZH5A 5DUKA 4A12A 1KU9A 4HX8A 5JI6A 1ZRDA 3GFMA 4HOBA 4KIFA 4LB5A 1SFXA 2EV5A 3HTSB 4HBLA 4LGWA 5CLSA 4I7HA 2RC4A 1H0MA 3TOAA 3TOBA 2GIVA 5FO5A 4EVIA 4BAYA 2HOEA 2VOPA 1Z05A 2GA2A 5JHUA 1SD4A 3GWZA 4WCGA 2A61A 4WF2A 3WTUC 2VN2A 4ZH4F 4CO8A 1J2XA 1T6SA 4HQEA 3BJOA 1K78A 4L9NA 4L5IA 1RI7A 3D5LA 3D0SA 1OMIA 3I4PA 1ULYA 3NEUA 4N9IA 1R7JA 5H6QA 2EV6A 4ZYHA 2H09A 4RB1A 1B9MA 3NQOA 3LQQA 4G7HF 3SZTA 3TDZC 3FXQA 3GZ6A 1LDDA 4PDKA 1UHMA 4UV9A 2LSOA 1P4WA 5CVVA 1R5GA 2FBKA 1XB4A 4P9FA 5BS6A 2WWYA 2ADUA 3HOSA 1R1UA 2BGCA 4RGRA 3JSOA 1FZPB 2JPCA 4KN7X 5HVQC 2DK5A 4IHTA 4M9XA 1L3LA 1PUEE 4U88A 5L3CA 2HWVA 2W24A 1K79A 1DP7P 2TDXA 1T38A 4WXCA 2RN7A 1XDSA 3N97A 2NS0A 3BPXA 3TO9A 1YO5C 3KP6A 4Q48A 2OBPA 2Z33A 3F8FA 2BV6A 4WWCA 1JXSA 3BY6A 4GGGA 2IPQX 2PG4A 1U3EM 1G6NA 3ERED 1Z1DA 1KU2A 2OQRA 2DQRA 2RQPA 3WGIA 1W5SA 2V1XA 3I0TA 2W57A 3EDPA 3J80Z 3ELKA 1T0FA 4BHCA 1G4DA 2FBHA 3MCZA 1LEAA 1IN8A 2CG4A 4LFUA 3RJPA 3DKWA 4MGRA 3M8EA 1USTA 4Q47A 1FC3A 4BHBA 2FNPA 4CXFA 2PJPA 4A6EA 2K4JA 4ASNA 2G7HA 3JTGA 3HYIA 4MEYF 1GVJA 1I1SA 2EFWA 4IF4A 1J9IA 1LB2A 1U8RA 3DP7A 5D5UB 4O3MA 4KMFA 1FY7A 1DPRA 3C18A 1FLIA 4UVCA 5E1XA 2EFOA 4JK1X 3LAPA 3IWZA 5AIQA 3M9AA 1ZG1A 1IN7A 2RDPA 3IWFA 5IT9Z 4B09A 4BH9A 3GLXA 3QP5A 4HX4A 1WSUA 3F21A 3QU3A 3KEOA 4ENJA 1IN4A 2HTJA 2VT3A 4A6DA 3WTSC 2V79A 1J75A 3FM5A 2EFPA 1STZA 3GO5A 1BI2A 2FMYA 2IW5A 1XSVA 4BHPA 5FLXK 5L3DA 4LJZF 3K0LA 5A2QK 2L4MA 2IJLA 1W7PD 4H0EA 5HOOA 3WE2A 2DQLA 2EB7A 1BIBA 4A2UA 5HS8A 2DFIA 2F5DA 2STTA 3MWMA 4LLNA 2EK5A 3JTHA 4N9HA 3L09A 2LF8A 4CGZA 1YIOA 2MLKA 1XGSA 4G7ZF 2CGPA 4LMYA 3HHGA 1ZN2A 1REPC 1O57A 1W5TA 4EJTA 3NRVA 1S3JA 3QRFF 1TQIA 1FSHA 3IRRA 3OV8A 4KIBA 2F5FA 1K7AA 1ZLJA 5KK1A 3T8RA 3L00A 2VE9A 3L2CA 1J7KA 1ZARA 4HZFA 4OU0A 2VC1A 2PQ8A 2UXXA 4FX4A 4UVAA 4S05A 1XCVA 4A5NA 4ON0A 1IF1A 1W7PA 3H3ZA 1Y0UA 4L5JA 2ZKZA 1TLHB 1OKRA 2H94A 5LBQA 2H27A 4IRHA 1O3RA 5L3EA 2P4WA 1IXSB 5HDGA 2MA3A 3DPTA 3QPTA 3FF5A 1LDJA 1MJBA 2DBBA 2L54A 5K5RA 2NNYA 5ICEA 3FHZA 1JHHA 3F6VA 2EWNA 4XBFA 2YSRA 2FBIA 1HKQA 3TO7A 2QBYA 4Y13A 2M87A 3SFZA 4RGXA 3AAFA 5D6FA 1LQ1A 3ZMSA 4RAYA 3KE2A 4KNYA 5IT3A 2P5KA 1L0OC 2FE3A 1S8NA 1WWXA 1NHAA 5D6EA 1Z6TA 4G8XA 1FYMA 2G7UA 3QU6A 1HSTA 1S6LA 1P4XA 5FFZA 1QQIA 1CGPA 4EM0B 4L0YB 2MC3A 2P5LC 5HDKA 1E2XA 2Y0MA 3LSTA 2O6GE 3J7AO 4WXHA 3QAHA 2OU2A 3LFKA 4EM1A 4Q5SF 1SMYF 2DTRA 4HQMA 1ZAOA 5BMZA 1ON1A 3SQNA 4KFCA 5ICFA 3QPHA 2ZMEA 5EEHA 5DCMB 1Z91A 4HF2A 3U2RA 3WE3A 2VBYA 1QNTA 2R7FA 3HHHA 1YFHA 1U5TB 4M73A 4KA4A 3DPLC 4IHSA 3GFJA 3T1BA 2D45A 4IRGA 3ML6A 1LJ9A 1SMTA 4CYDA 5J8FA 1YYVA 1YLFA 3IKVA 1FT9A 3DFGA 4BNCA 1ZREA 3R61A 3G3ZA 1B1BA 5D5VB 2O3FA 4D0PA 1FSEA 1ZG5A 1QZYA 2XRNA 1YQAA 3JW4A 3RYRA 2O61A 2QM3A 5ED4A 4OIRF 1XGNA 2XAGA 5E1ZB 1MZBA 1BC7C 3KLNA 4UUVA 5A2QZ 1J5YA 3ULQB 2HFHA 5F1RA 2RVCA 4IJAA 2VT2A 2MBFA 3BJAA 3WTTC 2P6TA 4TV7A 2QQAA 1O3SA 3WGGA 4LK0F 4IXAA 2GXGA 2LF7A 3CJNA 5LGNA 4M9SA 4P96A 1RNLA 3EETA 5HLIA 3W6KB 2JZYA 1RIOH 4UHTA 5LGTA 3DF8A 4ENMA 2JPBA 2XKOA 1D3YA 2HTSA 1FWZA 3EYIA 4YFXF 4XRFA 1K78B 2ESHA 2FF4A 2W25A 4HX7A 4EV0A 4S04A 1KU3A 3LQRA 3HRUA 2ELHA 3FMSA 2K4BA 2C6YA 1EV7A 3IHUA 2OAZA 3OOPA 3K69A 3B73A 2KKOA 4KUMA 3GFLA 1FBQA 4O6JA 4BXUA 1RUNA 3O3KA 3ECOA 2P5VA 5LHIA 1XDUA 1OPCA 1KGSA 1OR7A 5FGMA 3F8BA 2XAFA 3RYPA 4OINF 4L0ZB 3ZN0A 3WTXC 3I54A 5BPIA 2Z99A 4OIPF 1P4AA 1R1VA 2EJRA 3E5UA 4EMSA 2LNBA 5EEGA 2FRHA 4RGSA 5ICCA 1SFEA 1WI9A 2E1NA 5E18F 2M8EA 2PMUA 3TGNA 1OYIA 2JT1A 2D1HA 2VXZA 1XCBA 3Q9SA 4LLLA 2EA2A 4DQ2A 1WRJA 4MEXF 1F1ZA 4BYYA 4GYGA 1IZ1A 1ZG3A 1Z9CA 3GYHX 2O8XA 2P7VB 4CDGA 4HF0A 2CFXA 2XKPA 3FMRA 2XV4S 3KETA 1MKMA 2P8TA 3TO6A 2DT5A 1MDMB 3ISPA 2EV0A 3P9IA 4YFKF 4HDUA 1TQMA 3RPUA 3N4MA 1HW5A 2XAJA 5DV5A 3WG9A 1BOAA 1D8JA 3JSPA 2PN6A 1KA8A 3HRTA 3VOEA 2ZJ2A 1BN5A 3C7JA 2HR3A 4M71A 2ZO4A 3CO6C 3I5UA 4PGHA 1IXCA 3K2ZA 4HAMA 3RPQA 1Z7UA 2VONA 2VBXA 1I6XA 3F6OA 1RZ4A 3ZMUA 1WKMA 2CSOA 1QZZA 2BE5F 4M72A 4ESFA 4L18B 2L4AA 1QO0D 3WU1B 3V7SA 5JFRA 3C1DA 3GX4X 1TBXA 4R79A 5HS9A 2Q8KA 3W6JB 5LGUA 5D5WB 4EJVA 5LHGA 4MNUA 3KZZA 3WU0A 2PBIA 2E1CA 1LDKB 4XSZF 1PDNC 5DD8A 4EJUA 3M8FA 1B59A 1FX7A 2X0LA 3LA3A 2L3DA 2BYVE 2CYYA 2KIFA 3V8LA 2ISYA 3H3UA 3ZMZA 4ESJA 3DXJF 4AVPA 1FOKA 3REOA 1KYZA 1XGOA 3I71A 3F8CA 1T39A 3ABUA 4LK1F 2NRAC 1FNNA 1XMAA 1TW2A 1S7OA 2FEZA 3I64A 1BI0A 5K5OA 2OA4A 5JR3A 3V7RA 2QVOA 3BDDA 2PEXA 5AIPA 1BI1A 2FSWA 1YW9A 5K1YA 5D8KB 4OMYA 4KMUX 2JTVA 2L02A 5FB2A 2STWA 4R8HA 2Z5UA 3ZMDA 1EH6A 1I5ZA 1ONVA 3ECHA 2DU9A 3V4GA 1MJ9A 3ABTA 3MEXA 5CVRA 1G3SA 1V3FA 2E7XA 1YG2A 5CVJA 4IRIA 1TTYA 4YIFA 5CYVA 3TDUC 2UZKA 2YU3A 3DQVC 4HA8A 2K02A 3JAMZ 5LRRA 2Q2EA 1I27A 3R6SA 4IPAA 2H6CA 5DUIA 2HS5A 3ZPLA 3TQNA 3BJ6A 3BP8A 3BROA 2ZFWA 5L3BA 1FP1D 1HBXG 5J8CA 3E6DA 4CZZA 4U7BA 3R60A 5TJJA 3SHFA 2O03A
chains in the Genus database with same CATH superfamily
1QVUA 5TRDA 2M34A 3A2KA 4P9UA 1NK2P 2DOFA 4YFNF 1O3TA 2IS6A 3AL0B 2YPRA 2LVSA 2FX0A 3OSFA 1F43A 2VQHA 2DAOA 3AG1H 3O2PE 4DYQA 2HNHA 4M3BA 1K83J 3OS1A 4IHXA 2BEOA 1D0XA 1JKQC 2HOSA 2R5ZB 4PGGA 1RETA 3FXRA 1YW8A 2DJIA 2L2OA 2XDVA 1X58A 3HOTA 1T8IA 4A3DJ 1ZQ3P 2VLAA 4BEHA 3OIQA 1H8AC 3MN2A 4C3JJ 1YTYA 1K6OA 2B7EA 4KIGA 4KJZA 3KP7A 3B6AA 4A3IJ 2K9QA 3G1MA 4OAZA 2OD5A 3L1PA 1Z6RA 3H9QA 4Y7NJ 3CMEI 1ZRCA 2M30A 3FBNB 2HKOA 3B6CA 5DYMA 2PMHA 3GW2A 1MNDA 3DTIA 4CCMA 2CFOA 2HYGD 4I02A 1A04A 2LDUA 2ELKA 2MH9A 2H8RA 2A68F 2VQGA 4PZJA 4G9YA 3J80K 1W0TA 2R5YB 3FISA 2ZMEB 3K4BA 4FX0A 3E5XA 1XSDA 3WHBA 1TNSA 1Z3XA 2OC6A 3H5AA 4NB5A 4L9JA 1G2HA 4B3AA 1IO2A 4UVBA 1KU7A 2F2EA 4E7LA 3RZDJ 1T98A 1HW2A 2DK8A 3A1YA 5F04A 1BA5A 3BCAA 1MMDA 5KVRA 4HYEA 2PMZN 1UCRA 2OZUA 4MQ9F 1MMAA 4A0ZA 2ZNYA 4Y17A 4D7NA 4F91B 3PO2J 2VBWA 3RIRA 1S9HA 1MDMA 3CC4I 3IRQA 1YRNB 1FTTA 1QPMA 1RUOA 1HOMA 4IHVA 1IN6A 1MMNA 1O7FA 1QGPA 3U9GA 4P55A 2XUBA 2OQGA 1MW7A 1XD7A 1X1PA 2BW3B 5BOXA 2QKMB 3ZN1A 1JHFA 1SFUA 2QQBA 4L9VA 4A3BJ 2WC2A 2VODA 1TWHJ 2QZ8A 3OYJA 4KN4X 1SD7A 3ZCOA 4F7ZA 2XC7A 3VB2A 4HNUA 4KYWA 3S32A 3M8JA 4DNCA 5J47A 4UUTA 4KT6A 5CPRB 3KP3A 3FWEA 4ETSA 1G59A 4A3JJ 1DU6A 3GZ5A 1BJZA 1X1DA 5HS7A 3PSFA 2KJBA 2M9HA 4LITA 2E2JJ 3DEWA 3FXOA 3Q5FA 2W85A 1CF7A 4LG0A 2JWTA 3T0YA 4Y4RA 2NAZA 3DBRB 5J1YA 1N25A 2I10A 3K6GA 2UWMA 1J59A 3C2BA 1UFMA 2VQLA 2LY1A 4A0YA 2LD5A 4PFOA 4OIQF 3F3XA 1D8KA 3TKYA 3WTVC 1JGSA 4ZYDA 2Y9ZA 1UB9A 3BQYA 3LWFA 1Z7LA 2FOWA 2EILH 4XN0A 3FZVA 3QWLA 2L5QA 1V5GA 2DJNA 2CO5A 1D5VA 1MD0A 1OCPA 3JCUC 2M1BA 4KICA 5LHHA 1ETWA 3WTZA 3G73A 1DGRM 1WQ2A 4XLHA 3E7LA 3HM5A 3HUGA 1A5JA 2FU4A 2QLZA 1YS7A 2BXZA 1E3HA 4DGWB 2R7SA 3A01A 3CLOA 9ANTA 2EFNA 3CUOA 3K7AJ 4MO7A 2LK2A 5M5WJ 1LNWA 1Z3YA 3F8MA 4NC6A 3G71I 4ESBA 3K70C 3BZKA 3IV5A 2E7WA 4PJ0C 2Z9OA 1PUFB 2IA2A 2O7OA 1O3QA 5DCMA 2RNJA 5FD5A 5ERIA 2M3AA 4XONA 1BIAA 3K9TA 4G94A 3J7ZI 2A3SA 2YR2A 1IRGA 1SAXA 3VPRA 3CO7C 2CW7A 1ETKA 4IO9F 1UELB 2IT0A 1XN7A 1O4XA 2XF6A 4D9JA 3BTCA 2A07F 1FIPA 1DP3A 2DW4A 2RGVA 1IJWC 2W4SA 2HKXA 2WV1A 1UMQA 4EATA 5FLXZ 2AQEA 2WADA 5ILUA 1V54H 3S2WA 3HXLA 5HDNA 3DEEA 4JBAA 5IP9J 1ZTRA 2ID6A 3FMQA 1HLVA 4GXOA 4D5CA 4EJWA 3EQLF 1IC8A 1AOYA 4IKFA 3MQ0A 2EFQA 3W2AA 1XC5A 4Y52J 1FTZA 3S1MJ 1GHCA 2JVHA 4B8XA 5DEQA 2YX7A 1R5ID 4PSXA 3NWTA 1BM9A 3GUDA 2HDWA 3ASNH 4DJAA 1LFBA 1G3YA 2L7KA 1ZHFA 4RAGA 2JSPA 1B72A 4XL9A 2BW3A 1I1GA 3HSRA 4LLGF 1QBJA 4U7DA 1DPUA 2QKLB 4CYCB 3OMYA 3RKWA 1T2KA 1W7PB 5D4RA 4M74A 2CV0A 3MFKA 4HNVA 2HYFA 3CTAA 3V8JA 2ZJPF 4LD5A 3HEFA 2M45A 3T5XA 4ZC3A 3DLLF 1VQPI 3OYIA 3HPGA 1XGMA 3S15J 4ENNA 3OYAA 1X3UA 4R1HA 5EJCA 1XTAA 4IHWA 2XIGA 2DMTA 2HQNA 3HTUA 3RTRA 1K4TA 3CUQB 4PJNA 4V19K 1IRZA 4BACA 3OWTA 2QUFA 1H9GA 4HW0A 1ACIA 5H20A 2D2WA 3DEUA 4YEJA 2VBZA 3A0HC 4ZZDA 2AS5F 3IH3A 3BPVA 5FKKA 2JA2A 2ZXJA 1HA8A 2H6BA 1R1TA 5EF6A 4XKCA 1Q1HA 4G6QA 2FNAA 2JUGA 1AWCA 4C2TA 4P5OA 5J1UA 2GXBA 5KAFC 4EGYA 2QBYB 1WJDA 3FBIB 2NXNB 4N4NB 2K27A 4AIKA 4MQVA 2VKDA 2RV8A 3H92A 2K7LA 5J4YA 2NVQJ 2HZDA 2M2EA 2KL4A 4FT8A 1R71A 3NWSA 3V8KA 3SXYA 2OCEA 3PFYA 2X4HA 2DDBA 2CMPA 2W48A 2EBIA 3E3VA 3ONQA 3H35A 5HLTA 4KDPA 1U2WA 3JRIA 2EIJH 2MYSA 2CW8A 2F5VA 3I58A 2Q0OA 2CV2A 5JLXA 2DLLA 2KIMA 4KITB 4A5MA 4PJMA 3H3VK 3DU5A 5B3SH 5D4SA 4XLAA 1R23A 2PLYA 3L2RA 3CP8A 4XLNF 2R7XA 4AYBA 2OZ6A 4YELA 3SZPA 1JKRC 1BBYA 2OCCH 4AD9A 3ZP5A 2R5ZA 5IYDJ 4ZYGA 5BNGA 3JRBA 1DGWY 3GFIA 1P6RA 1ORKA 2HPMA 2VE8A 4L9TA 4M6YA 4RAZA 2IP2A 1KQ8A 3J81K 3GBGA 1XG1A 1VQ6I 1HQCA 1SEUA 3I59A 1ZGWA 2R93J 1OYYA 4J01A 3FX3A 4XRSA 2OPTA 2BOLA 4MTEA 1DUXC 3MKWB 3HSEA 2UXNA 3LSGA 2HQ5A 3QOPA 2F48A 3F8NA 2K85A 2HZTA 3GEZA 2RKHA 5FKLA 4D1QA 4I99C 1IDZA 4EJOA 5LLQA 4HRIA 2GM4A 1IUFA 4YIIA 2Z16A 2QGUA 2JVGA 3IKTA 1TZLA 3TP0A 1ON2A 1PYVA 3QOEA 3JRDA 2F5CA 4ENKA 2XASA 2WB1A 3OYDA 4A93J 1VI0A 4P1WA 1F4KA 3GF2A 4RGUA 4OOIA 3D5RC 1A31A 4N0BA 3E6MA 5ILSA 3OIOA 3MZYA 3ZGKA 2DA5A 5F08A 5M5YJ 3CCQI 3BR0A 5E17F 4JQFA 1T95A 2GWRA 4NQWA 3DV8A 2WAFA 3K1NA 5GPAA 2Z3YA 1YRNA 1MMGA 2PI0A 4FHTA 1MNMC 3VSLA 5C4JJ 3OYHA 5HLGA 4WK8F 3RCOA 4HV5A 3ZQCA 1WJBA 4QWQA 2JMWA 4MHGA 1OCOH 1MH4A 1YS6A 1HKTA 2JN6A 5IP7J 2DO7A 1B9NA 4OIOF 2LC2A 2EA4A 2F5EA 3K4LA 1B6AA 2XF7A 2Z2SB 2M4KA 2AHQA 1F9NA 4WX9A 1MBHA 3PQKA 3HKZN 2KJCA 5HNFA 2GAUA 1VFCA 3FDYA 1KQ0A 3VEPA 2RAEA 2GQQA 2FXAA 4I98B 2XHKA 3PQJA 1YITI 4CHUA 2H1KA 1X2MA 5ILVA 2K40A 4E70A 1U0JA 2G0EA 4NBQA 3ZMTA 5JVGF 2LKPA 3H5NA 4II3A 3KP2A 2M8GX 4M3DA 4XKVA 5TGTA 4HF1A 2YX4A 1VQLI 5AONA 1A36A 3U1DA 3J7AY 2CWEA 1S29A 1YW7A 1CF7B 3DU6A 1BOBA 2GIZA 2H1LA 2Y31A 3CDIA 1GV2A 2OTJI 4C2MJ 3DBHB 1BC8C 4KT5C 2VB6A 5E1WA 1Z77A 4NHJA 1ODDA 1C0WA 4NUBA 4LIUA 3HRSA 4ZDLA 1NK3P 3OS0A 2E1MB 3P9KA 3ZQFA 5CQGA 1ZRFA 3BG7A 1J0RA 3RPUD 3DKXA 5HNHA 5IT9K 4JX6A 5E8GA 3G2BA 4UNOA 2JRTA 3OIPA 1E0EA 2XPWA 4ITVA 4G6DA 1W36C 5F64A 3QP6A 2ISZA 1PJRA 1SANA 3ZQGA 1UG0A 3RKYA 4BQAA 4CCJA 3S8PA 2LFBA 1W36D 4IQJA 2EQRA 3GLLA 1D1AA 1E17A 3QODA 4CCLA 2LMDA 1OCRH 4Y15A 4ZZLA 1GXPA 5E20A 2BVLA 3B02A 3RQ4A 3BOQA 1EH8A 1QZEA 1ZELA 2E35A 2V9VA 5EDNA 3KZIC 1FBUA 2K9NA 2ZMEC 2E2IJ 3K1MA 2HYJA 4FISA 5DCFA 2A6TA 4I2OA 3X2QH 3CCVI 2HEOA 4A3EJ 4IX7A 2B0LA 2VJ5A 1X1AA 2LTPA 2FQ3A 3GXOA 2ELJA 5L3FA 3VODA 4GDFA 2CQ7A 3CUQC 3LA7A 3KIOA 3KEQA 2ACJA 2V1UA 1X4OA 4A0XA 3S3OA 2GZWA 4PJLA 3OYNA 3K1PA 2NYXA 3IUOA 2Q2EB 3FXUA 2P6SA 2Y75A 1IRFA 3LSJA 5CVIA 3PIOF 4F52A 3IC7A 2O0YA 1Y6IA 1QPIA 5F0FA 4YG2F 2HVSA 3TBIA 3CC2I 1U5TA 1T56A 2KZVA 4QLCU 3AG2H 3CDHA 3H9GA 3SJMA 2D5VA 3V42A 2FMLA 2ZCWA 1DDNA 2J5OA 2K86A 2V6CA 3GTMJ 4ZJZA 2K9SA 3EPZA 5CVUA 5E8IA 3ABLH 4PCQA 1DQUA 3COAC 1IW7F 2CS3A 1PVEA 1YOVB 2ZXHA 3KLOA 4YRVA 3KCCA 3RKQA 4GO1A 3KP4A 4U0VA 4Q4ZF 1X2NA 3C2GA 2EINH 4J19A 2R0QC 4B3XA 1JKOC 3M1EA 4UUSB 3EYYA 2J5PA 4O5VA 4EGZA 3F22A 3E5QA 3OYFA 4F55A 4MTDA 2HDCA 1HCRA 3LMMA 4U0WA 4NC8A 1FYKA 1LVAA 3LAJA 5DD4A 5ICGA 4AWXB 3ZR8X 4L5EA 1GXQA 1RC9A 1TW3A 2ZC2A 3FXKA 1JJ8C 2BY3A 1Y1WJ 4BGDA 4EQQA 3W6VA 2Z1DA 3F23A 2CUFA 4I0BA 1FPQA 4RM2A 2DPDA 3RDIA 1BI3A 2CH0A 5IOZA 3L2QA 1AA7A 1E3PA 5D8LB 2WTEA 1ZYRF 3OL4A 3QYBA 5LEJA 1TL8A 3A02A 2EIMH 1RKTA 3LA2A 1LEBA 2CRGA 3K10A 4IZZA 3O6BB 2COMA 2BBYA 3U1KA 2XROA 3FM3A 3WGHA 1RPWA 3KEYA 4Z2YA 1TQPA 3L9FA 5LEKA 2P7CB 1CQTA 4CCKA 1XSXA 1GLNA 3E97A 1KZHA 2A5YB 4FE4A 4AM3A 2X6YA 1P92A 2ZJRF 2BHYA 2PJRA 2WAQA 3T8TA 2OUMA 1FP2A 3MZ8A 4G7OF 2L01A 3JRAA 3KZYA 4IVNA 2OJED 1F5TA 2ZNZA 3K4CA 1R58A 2IVMA 3F9KA 1D0YA 1O7LA 4PJJA 4I01A 1W4MA 2A5WA 1HXDA 2LYCA 3EUHA 4V2GA 1V4RA 2G9WA 2XAQA 4AIJA 4RS8A 4GFBA 1KQ9A 2MD5A 1MH3A 2DCEA 3BG5A 4I09A 1MBEA 1ENHA 1T08B 2XAUA 4I0AA 4V2FA 1X4PA 5GAHJ 2FA5A 2ZJQF 1PP7U 1I6HJ 1WI3A 3SZGA 1WJCA 2D1VA 2X9DA 3I59B 1MIJA 3Q9VA 1G3WA 3R0JA 4GCVA 2VOOA 2R92J 1AHDP 1G3TA 2HOTA 1SD6A 3P9CA 2LLKA 4M9ZA 3GVAA 5FKNA 4ZYAA 4HLXA 3SYTA 3E6BA 4B47A 1LKXA 3RI4A 1HSJA 4XLPF 1U6GA 5F6FA 4K2EA 3ZOBA 3BZ6A 2ETHA 2HQRA 3BZCA 5K5QA 2PMZA 4EM2A 3PIPF 2QYOA 5HLHA 1MGTA 3IL2A 4M6XA 1ZGJA 2QSFX 2A6HF 2XPUA 3CF2A 4FCYA 2JSCA 2W00A 3ZMVA 3M7GA 3GTKJ 2DI3A 2DFFA 2DT7B 2L0KA 4I6ZA 3OYMA 4RA2A 2NNNA 1JGGA 1F36A 3VYSB 3LFUA 2L9VA 1NG7A 2XVCA 3TP3A 3ZQ7A 3LNQA 5FFXA 2A6EF 2GA1A 2VIXA 5M3MJ 2QQ9A 3HKZA 4RB2C 2DFHA 3G1OA 2QENA 2CW0F 3TEDA 5JVTA 2AXLA 2DPUA 1HW1A 1USSA 1S7AA 3CCYA 3R0AA 1LFUP 3GTPJ 5F27A 2JRMA 1P2FA 2IA1A 2V9PA 3SEQA 3UKGA 3E1SA 3P7NA 4WXDA 3ROUA 3F72A 4RM3A 2DOAA 4GRIA 1FYLA 1SFKA 4XORA 2HGCA 3WG7H 5BQTA 3MMYB 4HDVA 3PNTA 4XSXF 3R4KA 3CESA 1VQOI 1FIAA 3JRGA 4BJ6C 1FMVA 2Q1ZB 2R7OA 1P9QC 4OMZA 1AKHA 5GTIC 5K7HA 4E7JA 2B9SA 2WY8Q 1B4AA 1QRYA 1K61A 2WB1N 4HSRA 2Y30A 4DBRA 1VTNC 2IRFG 1SD5A 4UY8I 1ZGAA 4RB3C 3FIWA 4CZCA 2EH3A 3MKLA 5LRSA 2E71A 2E5ZA 3CDLA 2CUJA 6PAXA 2DA3A 4B4CA 3U21A 4F93B 2Y48A 2ESNA 2FOKA 3HSFA 2M0MA 1R36A 1TWGJ 2V1DA 5J4VA 4HV6A 4UXNA 2WAEA 1B8IA 2PFBA 2HU9A 3HIFA 4UV8A 3HJEA 1UJ8A 1JUMA 5J6XA 3WTYC 3H1CA 4B48A 3Q0VA 3G6EI 5EGOB 1R5HA 1WVRA 2R3SA 3KYDB 4M3EA 4AIHA 1BL0A 1EJ9A 3ASOH 1BJAA 1IXRC 4FASD 1EH7A 4E7HA 3S1QJ 2FD5A 4ANJA 3C3WA 2FJ1A 2QWWA 3MZHA 1U78A 5FJ8J 3BTLA 2M7BA 3ERMA 4RAFA 3BWGA 3LSKA 4LB6B 4ZDOA 2KRFA 3I9V2 5GTHC 1OYWA 1E3OC 2W7NA 3J81Z 3OSGA 4GYIA 4ZYEA 2CQXA 5L3GA 1U5TC 2E36A 5B66C 3E6CC 3A03A 3KFWX 1BW6A 1XMKA 5KHDA 5JLWA 1IRXA 1KYWA 4U0YA 2MLGA 4CUGA 3L7WA 1Y8RB 3L2UA 1N77A 1IAWA 3PUBA 2GBYA 3S2HJ 2IA0A 1Z67A 3V7CA 3RKXA 1PP8F 1VQKI 3CUQA 3DPUA 1FEXA 3CCEI 2KRCA 3BC8A 3CCMI 1IN5A 2LY9A 1H9TA 2M5WA 5DDGA 5H6RA 1ETVA 4FTHA 1RR8C 1FBSA 3MAJA 2X48A 3CCRI 1XPXA 1R00A 5CJ9A 3KP5A 2X6XA 3JAMK 2QF7A 4HLYA 3BG3A 4DZPA 1HKSA 3VFZA 2XAHA 2LRDA 3EUKL 2A69F 2QSHX 1P7IA 1V55H 3PFIA 1ZLKA 3I53A 4OAYA 4QIWN 1R22A 2KIUA 4BQOA 2TCTA 5DM6F 3HRMA 2CQKA 1PUFA 5BPDA 5E3LA 1TNTA 2VKVA 3HGGA 1TWFJ 2XGXA 3WTWC 2WV0A 1X1CA 1HDPA 1T33A 3WODF 2VC0A 2KISA 2MH2A 2R7DA 3S93A 4LG0B 5D5XB 1UHWA 4RB0A 2IGMA 2HQAA 4CICA 2W84A 2DODA 1IUYA 2ZBKA 2XF5A 4BQQA 5FD6A 1SVMA 1MJAA 1GV5A 1JE8A 4BUPA 1ZH5A 4CH7A 3HOVJ 3FHNA 5DUKA 2LY2A 4A12A 1KU9A 4HX8A 5JI6A 1ZRDA 2HDDA 2IS4A 1TWAJ 3GFMA 1U9NA 4HOBA 5B1BH 4KIFA 4LB5A 5H2FC 1LE8A 2YS9A 1SVLA 1SFXA 2EV5A 3HTSB 2JA8J 1VQ7I 2ID3A 1Y39A 4A3CJ 4A3KJ 3UR3C 4HBLA 1WFXA 4LGWA 5CLSA 4I7HA 2DFEA 2RC4A 4MLOA 3HL2A 1POGA 1H0MA 3TOAA 3TOBA 2GIVA 4AIDA 2NOJB 5FO5A 4EVIA 2X85A 3ZQHA 4BAYA 2HOEA 2LG4A 1GVDA 2VOPA 1YJNI 1Z05A 2GA2A 5KCMA 1FOYA 5JHUA 5CQEA 1SD4A 3GWZA 4WCGA 2A61A 3S3NA 4I76A 1VQMI 4WF2A 3WTUC 1IG7A 2VN2A 4ZH4F 1OQYA 3A4CA 4CO8A 3A0BC 1J2XA 1YE9A 1T6SA 3ZRGA 4HQEA 4RBOA 3BJOA 5IYCJ 1K78A 4L9NA 2ECBA 4L5IA 1RI7A 5DS9A 2KHMA 4N4OB 3D5LA 5FKOA 2NVYJ 3D0SA 3PSIA 2CU7A 3FK7A 1OMIA 2KLOA 3I4PA 5K7ZA 4CSWA 1ULYA 1X3ZB 4XNFA 1MBKA 3NEUA 4N9IA 3ZQLA 1MSFC 1R7JA 5H6QA 2OV7A 3FXJA 4F3QA 2O8KA 2IS1A 1BR1A 4RDUA 2EV6A 4ZYHA 1QHGA 2H09A 4A3LJ 1SC7A 2R7QA 1A6QA 4RB1A 2EIKH 2E1OA 1B9MA 3DLAA 3NQOA 3LQQA 2K9LA 1VQ8I 4G7HF 3SZTA 3TDZC 3HOUJ 3VSKA 3G4SI 3DKYA 2A05A 1D5YA 2YUSA 3FXQA 3HG9A 1LDDA 3GZ6A 2Y9YA 3IAS2 1UHMA 4PDKA 3D1NI 4UV9A 2LSOA 1P4WA 1OFCX 5CVVA 1JI8A 1R5GA 2FBKA 1XB4A 2XB5A 4P9FA 5BS6A 5E3MA 2WWYA 1ZR2A 2ADUA 3HOSA 2DA6A 1R1UA 1IDYA 2BGCA 2CUEA 3M3YJ 4RGRA 3JSOA 4X1EA 5J3LA 1FZPB 2JPCA 2ZB9A 4KN7X 5HVQC 2DK5A 2QA4I 3Q0UA 4IHTA 4M9XA 1L3LA 2DA2A 1PUEE 2O5RA 4JOMA 1ZR4A 4U88A 3UNGC 1QHHD 5L3CA 2HWVA 2AQFA 3CJRB 3DCFA 2W24A 1OCTC 3M07A 1K79A 2MC4A 3LSRA 5TISC 2VASA 1DP7P 2TDXA 4BDYA 1T38A 4WXCA 2RN7A 5C3EJ 2E5NA 1XDSA 2ME6A 5K7FA 3N97A 4E7IA 1IGNA 2NS0A 3BPXA 3TO9A 1YO5C 4A69C 3KP6A 3BCBA 2VI6A 4Q48A 2LKXA 2OBPA 2Z33A 3F8FA 3WHCA 1JKPC 2BV6A 4WWCA 4ZTJA 1JXSA 4LIVA 3BY6A 4GGGA 5EEAA 3CP2A 2IPQX 2PG4A 1U3EM 1RKWA 1G6NA 4BU2A 3ERED 2X6OA 2VUMJ 3EUAA 2L7ZA 3ABKH 1JT6A 1Z1DA 1ITYA 4NDLA 5C4XJ 1KU2A 4BDZA 1TT0A 2OQRA 2DQRA 3CCUI 2RQPA 3WGIA 2MABA 1W5SA 2W1OA 2M4GA 2V1XA 3K4MA 3I0TA 5DTDA 3MKZA 2MSYA 2W57A 3EDPA 3OYEA 3J80Z 2LKSA 3ELKA 1T0FA 4BHCA 3CMMA 1G4DA 2FBHA 3MCZA 1LEAA 5FROA 1IN8A 2CG4A 4LFUA 4HG2A 3RJPA 3DKWA 4BE0A 4MGRA 4IL6C 3M8EA 1USTA 4PUSA 4X6AJ 2ZSHB 3IAM2 2NVUB 3FK6A 4Q47A 1FC3A 3SFIA 4BHBA 2FNPA 3DTKA 4CXFA 3H36A 3C2HA 4DYRA 4B43A 2PJPA 4A6EA 2K4JA 4XKBA 4ASNA 2G7HA 4IOAF 3JTGA 2QSGX 3LOCA 3HYIA 4MEYF 4ABZA 1GVJA 2KQRA 2R7RA 2DA1A 1I1SA 3GTJJ 2LR8A 2EFWA 4IF4A 1J9IA 1LB2A 1U8RA 3DP7A 2KMUA 3IH2A 5D5UB 4O3MA 4MFEA 4KMFA 5CKTA 4BJ5C 1FY7A 2WY7Q 1DPRA 3C18A 1FLIA 1SVOA 1RESA 3PUFA 3WU2C 1K4SA 3N05A 4BEHB 4UVCA 5E1XA 4UB8C 4BS9A 2EFOA 4JK1X 3LAPA 3CJQB 3IWZA 1TP4A 5AIQA 3BQZA 3M9AA 1ZG1A 1IN7A 2RDPA 1HC8A 1P7JA 3IWFA 5IT9Z 4B09A 2LP0A 1XMXA 1WHUA 1W1WE 1D1CA 4BH9A 3HOYJ 3GLXA 3P5JA 3QP5A 4HX4A 2E19A 1WSUA 1M1EB 1Z0XA 3F21A 3QU3A 3KEOA 3W2VA 1GT0C 4ENJA 1VQ9I 1IN4A 2HTJA 2VT3A 4A6DA 3WTSC 2R5YA 2V79A 1J75A 1WGXA 3FKIJ 3FM5A 1A6IA 2EFPA 1STZA 2IXSA 3GO5A 1BI2A 2FMYA 4Z6YA 3CCSI 2IW5A 4JYKA 1XSVA 1NH3A 4BHPA 2VPRA 4UUSA 4G6TB 2EZHA 5FLXK 5L3DA 4M3FA 4LJZF 3K0LA 5A2QK 2L4MA 3BR2A 2IJLA 1W7PD 2LH9A 4M3GA 2XGCA 4H0EA 5HOOA 2NOGA 3WE2A 2DQLA 1WH7A 2EB7A 4UB6C 1BIBA 3RSNA 4E7KA 3MVPA 1APLC 4A2UA 5HS8A 2DFIA 2F5DA 2KDZA 2STTA 2OF7A 3S1NJ 3MWMA 4LLNA 2PX9A 2EK5A 3JTHA 3NARA 4N9HA 4XMYA 3L09A 2LF8A 4D5FA 3S3MA 4CGZA 1ERDA 3SDBA 3Q0WA 5IY5H 1YIOA 2WAQN 2MLKA 1I3QJ 5DM7F 1XGSA 4G7ZF 2CGPA 3CZ6A 3KYCB 4LMYA 3OY9A 2L9SA 3HHGA 4XRMA 1ZN2A 5FLMJ 2O9LA 1REPC 1O57A 1W5TA 2LOOA 3OYCA 4EJTA 1HDDC 3NRVA 1S3JA 1H88C 1TC3C 3HOXJ 3QRFF 3I4NJ 4AC0A 1TQIA 4FETA 2IGKA 4EEFG 1FSHA 3IRRA 1SFOJ 3OV8A 4KIBA 1N78A 2Y69H 1OCCH 5IYBJ 2F5FA 1JUPA 1K7AA 2AO9A 1Z21A 1S5LC 1ZLJA 5KK1A 3T8RA 2BHZA 3L00A 2VE9A 3TW6A 3L2CA 4B44A 1J7KA 1ZARA 2VJ4A 4HZFA 4NC7A 4A3MJ 4OU0A 2VC1A 1AU7A 3PL8A 2PQ8A 3H9JA 3K2AA 2UXXA 4FX4A 2X1DA 2YU9J 4UVAA 4S05A 2NVTJ 3I4MJ 1XCVA 2ZFUA 4A5NA 2DMPA 4ON0A 2QCOA 4CYCA 2K9MA 1IF1A 1W7PA 3H3ZA 2JA7J 1Y0UA 3K4JA 4Y3OA 1D1BA 4L5JA 2F4MB 2ZKZA 1TLHB 1OKRA 2H94A 5LBQA 4IRHA 5L3EA 4XIDA 1O3RA 2H27A 2E1MC 2HOAA 2P4WA 2AXTC 2R7UA 2EPFA 2K3FA 1Y8QB 1IXSB 5HDGA 4BXFA 2MA3A 3DPTA 3QPTA 1WH5A 3FF5A 1LDJA 1MJBA 4F92B 2MFZA 2DBBA 2L54A 4XLFA 5K5RA 1R4NB 2NNYA 5ICEA 3FHZA 1JHHA 3GCMA 4DBQA 1VQ5I 3F6VA 1QU3A 2EWNA 4XBFA 3NAUA 2YSRA 1WJEA 2FBIA 2HXOA 2V26A 4DIQA 4C9YA 1TWCJ 4H4KC 2OTLI 1YX3A 1HKQA 2DA7A 3AFHA 3TO7A 2QBYA 4Y13A 2M87A 3SFZA 3CLQA 2KRHA 4RGXA 3AAFA 2JK3A 5D6FA 1LQ1A 3ZMSA 4RAYA 1MMSA 3KE2A 4KNYA 1MNEA 2ME0A 5IT3A 1RRJA 1S7EA 2P5KA 1L0OC 5GAGJ 1YHQI 2WA0A 3CQZJ 2FE3A 1S8NA 1WWXA 2V4JC 1NHAA 1MSEC 5D6EA 1Z6TA 4G8XA 1FYMA 2I5UA 2JA6J 2G7UA 3QU6A 2RQQA 1HSTA 1S6LA 3FXLA 1A35A 1WCMJ 2BVMA 4II2A 1VQNI 2KPMA 4FE7A 3M1CA 1B72B 1XX5A 1P4XA 2CQQA 5FFZA 1QQIA 1CGPA 1J09A 2XB0X 4EM0B 4L0YB 2MC3A 2P5LC 4BE1A 3S16J 5HDKA 2GXAA 1E2XA 2Y0MA 2UUZA 4BKXA 5EYRA 4DZJA 3LSTA 3HBLA 3LSPA 2O6GE 5EG0B 3Q3SA 3J7AO 4WXHA 3QAHA 2OU2A 3LFKA 4EM1A 3LL7A 4Q5SF 3OYKA 1SMYF 2DTRA 2DXIA 4HQMA 4A3GJ 1NTCA 2KDOA 1ZAOA 2X1EA 3AG3H 3GZNB 5BMZA 1UHSA 1ON1A 4W97A 2DMQA 3G1LA 2BY1A 1I50J 3SQNA 3HZJA 4KFCA 2JUCA 2R7VA 2UV1A 2MG4A 2ZSIB 5ICFA 3PO3J 3QPHA 3CJTB 3KX2A 2ZMEA 2KT0A 5EEHA 2TRTA 4G12A 5DCMB 1Z91A 1H89C 4IQ4A 4HF2A 3U2RA 3WE3A 2VBYA 2H8WA 2VL8A 1QNTA 2R7FA 3HHHA 3RQIA 1YFHA 1U5TB 4C3HJ 2HI3A 3S1RJ 4M73A 4KA4A 3DPLC 3GFJA 2D45A 3T1BA 4IHSA 4IRGA 3ML6A 2PJRB 2IS2A 1LJ9A 3SDGA 1SMTA 5GADJ 4CYDA 1RR7A 1AKHB 3K4KA 3PNYA 5J8FA 3L2WA 1YYVA 1N75A 1R49A 1YLFA 3IKVA 1VNDA 2M0CA 2F6CA 2BZTA 1FT9A 3DFGA 4BNCA 4XKWA 1ZREA 4JX4A 3R61A 1Y1VJ 2XPVA 3G3ZA 1B1BA 4B1RA 1WPKA 2KIQA 4S0HB 5EZHA 5D5VB 2XRLA 1OJLA 2O3FA 3HUGB 4D0PA 3KYLA 1MBJA 2WBMA 5J40A 2JJ7A 1FSEA 5LFAA 4HPQA 1ZG5A 2RREA 1QZYA 1T0FC 2XRNA 3K4NA 1VQ4I 3A01B 1EF4A 1YQAA 3JW4A 5EZGA 2BY0A 3RYRA 3CMAI 1LPQA 2O61A 4BBRJ 3GTLJ 4AUXA 2QM3A 4FQGA 1UZCA 3OYBA 5J1RA 3DTEA 5ED4A 4YIRX 3MKYB 5B1AH 4OIRF 3QYFA 3VYUB 4CA0A 1XGNA 2M7AA 2XAGA 5E1ZB 1MZBA 5GPCA 2DOEA 3ESWB 3QQAA 3H5RA 1BC7C 3KLNA 4UUVA 2VXDA 2DYSH 3OR2C 4HSTA 5A2QZ 4BY1J 1J5YA 3ULQB 2HFHA 5F1RA 2RVCA 4IJAA 1WZ2A 3K70D 2VT2A 2MBFA 3BJAA 3WTTC 2BY2A 2P6TA 4BL0B 4TV7A 1YX5A 3F0CA 1YIJI 1JJ6C 2QQAA 1O3SA 1QVTA 1MBGA 4AVZA 5B5EC 1OR7C 1MBFA 3WGGA 4LK0F 4IXAA 5E3NA 2GXGA 2LF7A 3FKJA 4BY7J 3CJNA 3MD2A 5LGNA 2E60A 2DTZA 5IOYA 3BTIA 2MGQA 4CCOA 3M4OJ 4M9SA 3PM1A 4P96A 3QPLA 1RNLA 5M3FJ 2E34A 2JQ7A 3W2WA 3I56I 2XSJC 3BR6A 3BLYA 3EETA 1WJAA 5HLIA 2V9KA 3W6KB 2JZYA 1XS9A 2KFDA 1JTXA 1RIOH 4UHTA 2L9RA 1JTYA 5LGTA 4XOTA 3DF8A 4BBSJ 3TW7A 3DBLB 4ENMA 1LVKA 3OR1C 4DW6A 3GTGJ 3ABMH 4E7ZA 5FLVA 4D7MA 2JPBA 2XKOA 1D3YA 3SHFA 2HTSA 3PNVA 4Y33A 3IP4B 1FWZA 1FOWA 3EYIA 4YFXF 3FXMA 4XRFA 3PJRA 1K78B 2ESHA 3HDDA 3HGYA 2VJJA 1UAAA 2FF4A 2W25A 4HX7A 4EV0A 2V6EA 4XM3A 2R4GA 4NQWB 4S04A 1W0UA 2VPLA 5E3OA 1KU3A 3LQRA 1U8BA 5E79C 3HRUA 1B8IB 3CF5F 2ELHA 3FMSA 1X1BA 1ETYA 2K4BA 2C6YA 1ETOA 1EV7A 3CMYA 2FQ4A 4QPQA 3IHUA 3OYLA 2OAZA 3OOPA 3D5SC 3K69A 4BQNA 1R6RA 2N8GA 2KKOA 3B73A 4HNTA 3J7YJ 4KUMA 3GFLA 1FBQA 4O6JA 4BXUA 1RUNA 3O3KA 3ECOA 2P5VA 4C2UA 2DDAA 4OWRB 5LHIA 3BT9A 2QEXI 2CJJA 1XDUA 1OPCA 1KGSA 1X19A 1OR7A 4AYBN 5FGMA 2R7TA 3JRFA 3F8BA 3OYGA 3HOZJ 2R7ZJ 2XAFA 4PSWA 3RYPA 2XGDA 5KAIC 4OINF 4C3IJ 3TL4X 4L0ZB 2LREA 3ZN0A 3WTXC 3I54A 4JP0A 1YJWI 5BPIA 2EZKA 4XR6A 4QTRA 2Z99A 3AKZA 4KISA 4OIPF 1P4AA 1R1VA 2EJRA 1BW5A 3E5UA 4EMSA 2XSDC 1ZK8A 2LNBA 5EEGA 2FRHA 4BE2A 4RGSA 2R7WA 5ICCA 3S2DJ 2DT6A 2F4IA 1SFEA 1WI9A 4XN3A 2E1NA 5E18F 4XLCA 2M8EA 1K6YA 2PMUA 5KNLA 1VZ0A 3AG4H 5F0HA 4RMNA 3TGNA 1OYIA 1R9TJ 2JT1A 2D1HA 3IH4A 4LOCA 4XOPA 2Y0SN 5FKMA 2VXZA 2VQCA 3ZQIA 1XCBA 3Q9SA 4LLLA 2EA2A 2L7MP 3OOUA 4DQ2A 1JUSA 2NS7A 4JX5A 1WRJA 4MEXF 4W1UA 1F1ZA 4BYYA 2RNGA 4GYGA 1LE8B 5EGOA 1IZ1A 1ZG3A 1Z9CA 2LBFB 3GYHX 4IEJA 2O8XA 2P7VB 2QQ8A 3KPHA 4CDGA 4J00A 2VKEA 3CD6I 1EKEA 4HF0A 2HVQA 5GP9A 2CFXA 3BR3A 2XKPA 1IV6A 5GAEJ 3FMRA 3O8HA 1X3WB 2XV4S 2BXYA 2X51A 3E0JB 1MKMA 3KETA 3I55I 2F4OB 4ZTFA 2P8TA 2IAIA 3TO6A 2FUG2 2DT5A 3CC7I 1MDMB 2V1NA 3VWBA 1YJ9I 3ISPA 2EV0A 3P9IA 4YFKF 3DWLE 5EG0A 2W82A 2IBDA 4CCNA 3ZXSA 4HDUA 1TQMA 5LD2C 3H0DA 3RPUA 3N4MA 1HW5A 4A3FJ 2XAJA 5DV5A 1WJFA 3LSMA 1BOAA 3WG9A 1D8JA 3JSPA 3CCLI 2PN6A 1KA8A 2ZXWH 3HRTA 1WJ5A 1LFPA 3RZOJ 3VOEA 2ZJ2A 1BN5A 1OCZH 2HR3A 3C7JA 4M71A 4MFDA 2ZO4A 1NG6A 2EZIA 3CO6C 2HXIA 3I5UA 4PGHA 1IXCA 5JHFA 3K2ZA 4HAMA 4C30A 4M6VA 3RPQA 3LSHA 1Z7UA 2VONA 4IOCF 2VBXA 1I3AA 1I6XA 2K3PA 1RZ4A 3F6OA 5FRNA 1W5CC 1FOXA 3JREA 1GDTA 3O8GA 3ZMUA 4E4HA 3S17J 3ZQQA 2ECCA 3GMEA 2I8DA 1WKMA 2CSOA 4ZDPA 1QZZA 4IHYA 1R4MB 1U9OA 2BE5F 4M72A 4ESFA 3JRCA 4NNJA 4L18B 2L4AA 1JT0A 1QO0D 4RLFA 2K5CA 1VF9A 2XGEA 3WU1B 3V7SA 2B63J 2P81A 5F0CA 5JFRA 3LSIA 5IP6A 3I3LA 4MIMA 4XICA 2CUZA 3C1DA 3GX4X 1TBXA 4R79A 3H0GJ 5M5XJ 5HS9A 2Q8KA 3W6JB 5LGUA 5D5WB 4EJVA 4QPOA 2IGOA 3KZZA 4MNUA 5LHGA 3WU0A 2PBIA 2EZLA 4PK4A 5HODA 3S14J 3BTJA 4XQFA 2HPIA 2E1CA 1LDKB 3JRHA 3CCJI 4XSZF 2P0WA 5DD8A 4EJUA 3QPSA 1PDNC 1S72I 1B59A 1FX7A 2X0LA 3M8FA 3LA3A 2L3DA 2BYVE 2Y0SA 2CYYA 2KIFA 3V8LA 2HVRA 2ISYA 1FMWA 2IGNA 3VYRB 3VDXA 2VKHA 3OL3A 3H3UA 2JA5J 3ZMZA 4ESJA 3DXJF 3BR5A 1V5FA 2LBFA 4AVPA 1FOKA 3REOA 4XRSG 1KYZA 1Q1VA 1XGOA 3I71A 2DA4A 3HPHA 3F8CA 3AL0C 1T39A 3ABUA 3W3CA 2MD0A 4LK1F 5F1JA 1V5EA 2NS8A 4HEA2 2DMNA 3OS2A 2NRAC 2COBA 1ZKGA 3TMOA 1FNNA 1XMAA 1TW2A 1S7OA 1UG2A 2FEZA 4DOZA 3GTQJ 3I64A 1BI0A 5K5OA 2NVXJ 2GLOA 2OA4A 4BJTA 5JR3A 3V7RA 1IV8A 4X0GA 2QVOA 3BDDA 2PEXA 5AIPA 2MW8A 3SEZA 1BI1A 4AU7A 2FSWA 1G8XA 1YW9A 5K1YA 1ETQA 4PFPA 1Y0NA 5D8KB 1DU0A 4KMUX 4OMYA 2E2HJ 3GTOJ 2JTVA 2V7FA 5IPAA 1LUJB 3QYEA 2L02A 5FB2A 2STWA 4R8HA 4E7SA 2Z5UA 2L7FP 3ZMDA 1EH6A 1I5ZA 2KZGA 1SAUA 1I39A 2DYRH 2GOMA 1ONVA 3ECHA 2DU9A 3BR1A 1QA6A 5C44J 3V4GA 4QSHA 1MJ9A 3ABTA 1D0ZA 3MEXA 4XLEA 5CVRA 1G3SA 1FJLA 1V3FA 2E7XA 1YG2A 2X6WA 5CVJA 5FRMA 3HOWJ 1EA3A 2ICWG 1KONA 2VJIA 1BR2A 1GUUA 4IRIA 1HF0A 1TTYA 4YIFA 3L2VA 5CYVA 3TDUC 3HC7A 3HB9A 2UZKA 4BXXJ 1ETXA 2CV1A 1BR4A 2YU3A 2Y2ZA 3DQVC 4HA8A 2K02A 1YI2I 2DN0A 4U87A 1TT5B 4DYCA 3BG9A 1OLTA 5LRRA 3JAMZ 2Q2EA 3JR9A 2GOXB 2L9NA 4RLQA 1I27A 2ZXIA 3R6SA 4IPAA 2H6CA 1OISA 4E6KG 5DUIA 2HS5A 3ZPLA 3BG6A 2KP6A 3TQNA 3BJ6A 3BP8A 2DMUA 3BROA 2ZFWA 5L3BA 1FP1D 2X1CA 3VYTB 1HBXG 4LG3A 5J8CA 3E6DA 4CZZA 4U7BA 1Y56A 3R60A 4XK4A 5TJJA 2IEKA 3EUHC 2CQNA 2O03A
chains in the Genus database with same CATH topology
5TRDA 4P9UA 4YFNF 1O3TA 2YPRA 2DAOA 3O2PE 2BEOA 4PGGA 3FXRA 1YW8A 3HOTA 1K6OA 1YTYA 4KIGA 3KP7A 2OD5A 1Z6RA 1ZRCA 2M30A 2HKOA 5DYMA 2PMHA 3GW2A 2HYGD 4I02A 1A04A 2LDUA 2MH9A 2A68F 4PZJA 4G9YA 3J80K 2ZMEB 4FX0A 3E5XA 1XSDA 1TNSA 4NB5A 4L9JA 4UVBA 1KU7A 2F2EA 1T98A 1HW2A 2DK8A 5KVRA 4HYEA 1UCRA 2OZUA 4MQ9F 4A0ZA 2ZNYA 4Y17A 2VBWA 3RIRA 1MDMA 3IRQA 1QPMA 1RUOA 1IN6A 1O7FA 1QGPA 3U9GA 4P55A 2XUBA 2OQGA 1XD7A 5BOXA 3ZN1A 1JHFA 1SFUA 2QQBA 4L9VA 2WC2A 2VODA 2QZ8A 4KN4X 1SD7A 4F7ZA 3VB2A 4KYWA 4DNCA 3KP3A 3FWEA 4ETSA 3GZ5A 5HS7A 2KJBA 3Q5FA 2W85A 1CF7A 4LG0A 3T0YA 2NAZA 2UWMA 1J59A 1UFMA 4A0YA 4OIQF 3F3XA 1D8KA 3TKYA 3WTVC 1JGSA 4ZYDA 1UB9A 3LWFA 3FZVA 1D5VA 2CO5A 1MD0A 4KICA 2M1BA 5LHHA 3WTZA 3G73A 1WQ2A 3HUGA 2FU4A 2QLZA 1YS7A 3CLOA 2EFNA 3CUOA 1LNWA 3F8MA 4ESBA 2E7WA 2Z9OA 2IA2A 1O3QA 5DCMA 5FD5A 2RNJA 5ERIA 1BIAA 3K9TA 4G94A 2A3SA 2YR2A 1IRGA 1SAXA 3CO7C 2IT0A 1XN7A 2A07F 2DW4A 2RGVA 2HKXA 5FLXZ 5ILUA 3S2WA 5HDNA 4JBAA 3FMQA 4GXOA 4EJWA 3EQLF 1AOYA 3MQ0A 2EFQA 1GHCA 4B8XA 5DEQA 2YX7A 1BM9A 3GUDA 1G3YA 1ZHFA 3HSRA 1I1GA 4LLGF 1QBJA 4U7DA 1DPUA 3RKWA 1T2KA 1W7PB 5D4RA 4M74A 3MFKA 2HYFA 3CTAA 3V8JA 4LD5A 2M45A 3T5XA 1XGMA 4ENNA 1X3UA 4R1HA 2XIGA 2HQNA 3HTUA 3RTRA 3CUQB 2QUFA 1H9GA 4HW0A 5H20A 2D2WA 3DEUA 2VBZA 4ZZDA 2AS5F 3BPVA 2ZXJA 2H6BA 1R1TA 1Q1HA 4G6QA 2FNAA 1AWCA 4P5OA 2GXBA 4EGYA 2QBYB 2K27A 4AIKA 4MQVA 2RV8A 3H92A 2K7LA 4FT8A 3V8KA 3SXYA 2X4HA 3E3VA 4KDPA 1U2WA 3I58A 2Q0OA 2DLLA 2KIMA 4A5MA 5D4SA 1R23A 2PLYA 4XLNF 2OZ6A 3SZPA 1BBYA 4AD9A 3ZP5A 4ZYGA 3GFIA 1P6RA 2VE8A 4L9TA 4M6YA 4RAZA 2IP2A 1KQ8A 3J81K 1HQCA 3I59A 1OYYA 3FX3A 4MTEA 1DUXC 3HSEA 2UXNA 3QOPA 3F8NA 2HZTA 3GEZA 2RKHA 4EJOA 5LLQA 4YIIA 3IKTA 1ON2A 2F5CA 4ENKA 2XASA 1F4KA 3GF2A 4RGUA 4OOIA 4N0BA 3E6MA 5ILSA 3MZYA 5E17F 4JQFA 2GWRA 4NQWA 3DV8A 3K1NA 2Z3YA 2PI0A 4FHTA 5HLGA 4WK8F 4HV5A 4QWQA 4MHGA 1HKTA 1YS6A 2DO7A 1B9NA 4OIOF 2EA4A 2F5EA 1B6AA 1F9NA 4WX9A 3PQKA 2KJCA 2GAUA 3VEPA 1KQ0A 2GQQA 2FXAA 4I98B 2XHKA 3PQJA 4CHUA 5ILVA 4E70A 3ZMTA 2LKPA 3KP2A 4HF1A 2YX4A 5AONA 3U1DA 2CWEA 1S29A 1YW7A 1CF7B 1BC8C 4KT5C 5E1WA 4NHJA 1ODDA 1C0WA 3HRSA 3P9KA 1ZRFA 1J0RA 5IT9K 5E8GA 4UNOA 2JRTA 4G6DA 5F64A 3QP6A 2ISZA 3RKYA 4BQAA 1E17A 4Y15A 4ZZLA 1GXPA 5E20A 3B02A 3BOQA 1EH8A 2V9VA 1FBUA 3K1MA 5DCFA 4I2OA 2HEOA 2B0LA 2FQ3A 3GXOA 5L3FA 3VODA 3CUQC 3LA7A 3KEQA 2ACJA 2V1UA 4A0XA 2GZWA 3K1PA 2NYXA 3FXUA 2P6SA 2Y75A 1IRFA 5CVIA 3IC7A 2O0YA 4YG2F 1U5TA 4QLCU 3CDHA 2FMLA 2ZCWA 1DDNA 2J5OA 2K86A 2V6CA 5CVUA 5E8IA 4PCQA 3COAC 1IW7F 3KLOA 3KCCA 4GO1A 3KP4A 4U0VA 4Q4ZF 3M1EA 3EYYA 2J5PA 4O5VA 4EGZA 3F22A 3E5QA 4MTDA 2HDCA 4U0WA 1FYKA 1LVAA 3LAJA 5DD4A 5ICGA 4AWXB 1GXQA 1TW3A 4EQQA 3F23A 4I0BA 1FPQA 2DPDA 3RDIA 1BI3A 5D8LB 2WTEA 1ZYRF 5LEJA 3LA2A 1LEBA 3O6BB 2COMA 2BBYA 2XROA 3FM3A 3WGHA 4Z2YA 1TQPA 3L9FA 5LEKA 2P7CB 1XSXA 3E97A 2A5YB 1P92A 3T8TA 1FP2A 4G7OF 2L01A 3KZYA 4IVNA 1F5TA 2ZNZA 1R58A 2IVMA 1O7LA 4I01A 1W4MA 1HXDA 3EUHA 1V4RA 2G9WA 2XAQA 4AIJA 4RS8A 1KQ9A 2MD5A 4I09A 4I0AA 2FA5A 1PP7U 2D1VA 3I59B 3Q9VA 1G3WA 3R0JA 4GCVA 2VOOA 1G3TA 1SD6A 3P9CA 4M9ZA 3GVAA 4HLXA 3E6BA 3RI4A 1HSJA 4XLPF 1U6GA 5F6FA 4K2EA 3BZ6A 2ETHA 2HQRA 5K5QA 4EM2A 2QYOA 5HLHA 1MGTA 3IL2A 4M6XA 1ZGJA 2A6HF 2JSCA 3ZMVA 3M7GA 2DI3A 2NNNA 2XVCA 3ZQ7A 5FFXA 2A6EF 2GA1A 2QQ9A 4RB2C 2QENA 2CW0F 5JVTA 2AXLA 2DPUA 1HW1A 1USSA 1S7AA 3R0AA 1P2FA 2IA1A 4WXDA 3P7NA 3ROUA 3F72A 1FYLA 2HGCA 5BQTA 4HDVA 4XSXF 3R4KA 4OMZA 1B4AA 1VTNC 2IRFG 1SD5A 1ZGAA 4RB3C 5LRSA 6PAXA 2Y48A 2ESNA 2FOKA 3HSFA 1R36A 2V1DA 4HV6A 4UXNA 2PFBA 3HIFA 4UV8A 5J6XA 3WTYC 1R5HA 2R3SA 4AIHA 1BJAA 1IXRC 1EH7A 3C3WA 2QWWA 3MZHA 1U78A 4LB6B 3BWGA 2KRFA 1OYWA 3J81Z 4GYIA 4ZYEA 5L3GA 1U5TC 3E6CC 3KFWX 1XMKA 1KYWA 4U0YA 2MLGA 3L7WA 1IAWA 2IA0A 3V7CA 3RKXA 1PP8F 3CUQA 1IN5A 1H9TA 2M5WA 5DDGA 5H6RA 1FBSA 3MAJA 1R00A 5CJ9A 3KP5A 3JAMK 4HLYA 1HKSA 3VFZA 2XAHA 2A69F 3PFIA 1ZLKA 3I53A 1R22A 2KIUA 3HRMA 2CQKA 5BPDA 1TNTA 2XGXA 3WTWC 2WV0A 3WODF 2VC0A 2MH2A 2R7DA 4LG0B 5D5XB 1UHWA 4RB0A 4CICA 2W84A 1IUYA 2ZBKA 5FD6A 1MJAA 1JE8A 1ZH5A 5DUKA 4A12A 1KU9A 4HX8A 5JI6A 1ZRDA 3GFMA 4HOBA 4KIFA 4LB5A 1SFXA 2EV5A 3HTSB 4HBLA 4LGWA 5CLSA 4I7HA 2RC4A 1H0MA 3TOAA 3TOBA 2GIVA 5FO5A 4EVIA 4BAYA 2HOEA 2VOPA 1Z05A 2GA2A 5JHUA 1SD4A 3GWZA 4WCGA 2A61A 4WF2A 3WTUC 2VN2A 4ZH4F 4CO8A 1J2XA 1T6SA 4HQEA 3BJOA 1K78A 4L9NA 4L5IA 1RI7A 3D5LA 3D0SA 1OMIA 3I4PA 1ULYA 3NEUA 4N9IA 1R7JA 5H6QA 2EV6A 4ZYHA 2H09A 4RB1A 1B9MA 3NQOA 3LQQA 4G7HF 3SZTA 3TDZC 3FXQA 3GZ6A 1LDDA 4PDKA 1UHMA 4UV9A 2LSOA 1P4WA 5CVVA 1R5GA 2FBKA 1XB4A 4P9FA 5BS6A 2WWYA 2ADUA 3HOSA 1R1UA 2BGCA 4RGRA 3JSOA 1FZPB 2JPCA 4KN7X 5HVQC 2DK5A 4IHTA 4M9XA 1L3LA 1PUEE 4U88A 5L3CA 2HWVA 2W24A 1K79A 1DP7P 2TDXA 1T38A 4WXCA 2RN7A 1XDSA 3N97A 2NS0A 3BPXA 3TO9A 1YO5C 3KP6A 4Q48A 2OBPA 2Z33A 3F8FA 2BV6A 4WWCA 1JXSA 3BY6A 4GGGA 2IPQX 2PG4A 1U3EM 1G6NA 3ERED 1Z1DA 1KU2A 2OQRA 2DQRA 2RQPA 3WGIA 1W5SA 2V1XA 3I0TA 2W57A 3EDPA 3J80Z 3ELKA 1T0FA 4BHCA 1G4DA 2FBHA 3MCZA 1LEAA 1IN8A 2CG4A 4LFUA 3RJPA 3DKWA 4MGRA 3M8EA 1USTA 4Q47A 1FC3A 4BHBA 2FNPA 4CXFA 2PJPA 4A6EA 2K4JA 4ASNA 2G7HA 3JTGA 3HYIA 4MEYF 1GVJA 1I1SA 2EFWA 4IF4A 1J9IA 1LB2A 1U8RA 3DP7A 5D5UB 4O3MA 4KMFA 1FY7A 1DPRA 3C18A 1FLIA 4UVCA 5E1XA 2EFOA 4JK1X 3LAPA 3IWZA 5AIQA 3M9AA 1ZG1A 1IN7A 2RDPA 3IWFA 5IT9Z 4B09A 4BH9A 3GLXA 3QP5A 4HX4A 1WSUA 3F21A 3QU3A 3KEOA 4ENJA 1IN4A 2HTJA 2VT3A 4A6DA 3WTSC 2V79A 1J75A 3FM5A 2EFPA 1STZA 3GO5A 1BI2A 2FMYA 2IW5A 1XSVA 4BHPA 5FLXK 5L3DA 4LJZF 3K0LA 5A2QK 2L4MA 2IJLA 1W7PD 4H0EA 5HOOA 3WE2A 2DQLA 2EB7A 1BIBA 4A2UA 5HS8A 2DFIA 2F5DA 2STTA 3MWMA 4LLNA 2EK5A 3JTHA 4N9HA 3L09A 2LF8A 4CGZA 1YIOA 2MLKA 1XGSA 4G7ZF 2CGPA 4LMYA 3HHGA 1ZN2A 1REPC 1O57A 1W5TA 4EJTA 3NRVA 1S3JA 3QRFF 1TQIA 1FSHA 3IRRA 3OV8A 4KIBA 2F5FA 1K7AA 1ZLJA 5KK1A 3T8RA 3L00A 2VE9A 3L2CA 1J7KA 1ZARA 4HZFA 4OU0A 2VC1A 2PQ8A 2UXXA 4FX4A 4UVAA 4S05A 1XCVA 4A5NA 4ON0A 1IF1A 1W7PA 3H3ZA 1Y0UA 4L5JA 2ZKZA 1TLHB 1OKRA 2H94A 5LBQA 2H27A 4IRHA 1O3RA 5L3EA 2P4WA 1IXSB 5HDGA 2MA3A 3DPTA 3QPTA 3FF5A 1LDJA 1MJBA 2DBBA 2L54A 5K5RA 2NNYA 5ICEA 3FHZA 1JHHA 3F6VA 2EWNA 4XBFA 2YSRA 2FBIA 1HKQA 3TO7A 2QBYA 4Y13A 2M87A 3SFZA 4RGXA 3AAFA 5D6FA 1LQ1A 3ZMSA 4RAYA 3KE2A 4KNYA 5IT3A 2P5KA 1L0OC 2FE3A 1S8NA 1WWXA 1NHAA 5D6EA 1Z6TA 4G8XA 1FYMA 2G7UA 3QU6A 1HSTA 1S6LA 1P4XA 5FFZA 1QQIA 1CGPA 4EM0B 4L0YB 2MC3A 2P5LC 5HDKA 1E2XA 2Y0MA 3LSTA 2O6GE 3J7AO 4WXHA 3QAHA 2OU2A 3LFKA 4EM1A 4Q5SF 1SMYF 2DTRA 4HQMA 1ZAOA 5BMZA 1ON1A 3SQNA 4KFCA 5ICFA 3QPHA 2ZMEA 5EEHA 5DCMB 1Z91A 4HF2A 3U2RA 3WE3A 2VBYA 1QNTA 2R7FA 3HHHA 1YFHA 1U5TB 4M73A 4KA4A 3DPLC 4IHSA 3GFJA 3T1BA 2D45A 4IRGA 3ML6A 1LJ9A 1SMTA 4CYDA 5J8FA 1YYVA 1YLFA 3IKVA 1FT9A 3DFGA 4BNCA 1ZREA 3R61A 3G3ZA 1B1BA 5D5VB 2O3FA 4D0PA 1FSEA 1ZG5A 1QZYA 2XRNA 1YQAA 3JW4A 3RYRA 2O61A 2QM3A 5ED4A 4OIRF 1XGNA 2XAGA 5E1ZB 1MZBA 1BC7C 3KLNA 4UUVA 5A2QZ 1J5YA 3ULQB 2HFHA 5F1RA 2RVCA 4IJAA 2VT2A 2MBFA 3BJAA 3WTTC 2P6TA 4TV7A 2QQAA 1O3SA 3WGGA 4LK0F 4IXAA 2GXGA 2LF7A 3CJNA 5LGNA 4M9SA 4P96A 1RNLA 3EETA 5HLIA 3W6KB 2JZYA 1RIOH 4UHTA 5LGTA 3DF8A 4ENMA 2JPBA 2XKOA 1D3YA 2HTSA 1FWZA 3EYIA 4YFXF 4XRFA 1K78B 2ESHA 2FF4A 2W25A 4HX7A 4EV0A 4S04A 1KU3A 3LQRA 3HRUA 2ELHA 3FMSA 2K4BA 2C6YA 1EV7A 3IHUA 2OAZA 3OOPA 3K69A 3B73A 2KKOA 4KUMA 3GFLA 1FBQA 4O6JA 4BXUA 1RUNA 3O3KA 3ECOA 2P5VA 5LHIA 1XDUA 1OPCA 1KGSA 1OR7A 5FGMA 3F8BA 2XAFA 3RYPA 4OINF 4L0ZB 3ZN0A 3WTXC 3I54A 5BPIA 2Z99A 4OIPF 1P4AA 1R1VA 2EJRA 3E5UA 4EMSA 2LNBA 5EEGA 2FRHA 4RGSA 5ICCA 1SFEA 1WI9A 2E1NA 5E18F 2M8EA 2PMUA 3TGNA 1OYIA 2JT1A 2D1HA 2VXZA 1XCBA 3Q9SA 4LLLA 2EA2A 4DQ2A 1WRJA 4MEXF 1F1ZA 4BYYA 4GYGA 1IZ1A 1ZG3A 1Z9CA 3GYHX 2O8XA 2P7VB 4CDGA 4HF0A 2CFXA 2XKPA 3FMRA 2XV4S 3KETA 1MKMA 2P8TA 3TO6A 2DT5A 1MDMB 3ISPA 2EV0A 3P9IA 4YFKF 4HDUA 1TQMA 3RPUA 3N4MA 1HW5A 2XAJA 5DV5A 3WG9A 1BOAA 1D8JA 3JSPA 2PN6A 1KA8A 3HRTA 3VOEA 2ZJ2A 1BN5A 3C7JA 2HR3A 4M71A 2ZO4A 3CO6C 3I5UA 4PGHA 1IXCA 3K2ZA 4HAMA 3RPQA 1Z7UA 2VONA 2VBXA 1I6XA 3F6OA 1RZ4A 3ZMUA 1WKMA 2CSOA 1QZZA 2BE5F 4M72A 4ESFA 4L18B 2L4AA 1QO0D 3WU1B 3V7SA 5JFRA 3C1DA 3GX4X 1TBXA 4R79A 5HS9A 2Q8KA 3W6JB 5LGUA 5D5WB 4EJVA 5LHGA 4MNUA 3KZZA 3WU0A 2PBIA 2E1CA 1LDKB 4XSZF 1PDNC 5DD8A 4EJUA 3M8FA 1B59A 1FX7A 2X0LA 3LA3A 2L3DA 2BYVE 2CYYA 2KIFA 3V8LA 2ISYA 3H3UA 3ZMZA 4ESJA 3DXJF 4AVPA 1FOKA 3REOA 1KYZA 1XGOA 3I71A 3F8CA 1T39A 3ABUA 4LK1F 2NRAC 1FNNA 1XMAA 1TW2A 1S7OA 2FEZA 3I64A 1BI0A 5K5OA 2OA4A 5JR3A 3V7RA 2QVOA 3BDDA 2PEXA 5AIPA 1BI1A 2FSWA 1YW9A 5K1YA 5D8KB 4OMYA 4KMUX 2JTVA 2L02A 5FB2A 2STWA 4R8HA 2Z5UA 3ZMDA 1EH6A 1I5ZA 1ONVA 3ECHA 2DU9A 3V4GA 1MJ9A 3ABTA 3MEXA 5CVRA 1G3SA 1V3FA 2E7XA 1YG2A 5CVJA 4IRIA 1TTYA 4YIFA 5CYVA 3TDUC 2UZKA 2YU3A 3DQVC 4HA8A 2K02A 3JAMZ 5LRRA 2Q2EA 1I27A 3R6SA 4IPAA 2H6CA 5DUIA 2HS5A 3ZPLA 3TQNA 3BJ6A 3BP8A 3BROA 2ZFWA 5L3BA 1FP1D 1HBXG 5J8CA 3E6DA 4CZZA 4U7BA 3R60A 5TJJA 3SHFA 2O03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TRD A;  4P9U A;  4YFN F;  1O3T A;  2YPR A;  2DAO A;  3O2P E;  2BEO A;  4PGG A;  3FXR A;  1YW8 A;  3HOT A;  1K6O A;  1YTY A;  4KIG A;  3KP7 A;  2OD5 A;  1Z6R A;  1ZRC A;  2M30 A;  2HKO A;  5DYM A;  2PMH A;  3GW2 A;  2HYG D;  4I02 A;  1A04 A;  2LDU A;  2MH9 A;  2A68 F;  4PZJ A;  4G9Y A;  3J80 K;  2ZME B;  4FX0 A;  3E5X A;  1XSD A;  1TNS A;  4NB5 A;  4L9J A;  4UVB A;  1KU7 A;  2F2E A;  1T98 A;  1HW2 A;  2DK8 A;  5KVR A;  4HYE A;  1UCR A;  2OZU A;  4MQ9 F;  4A0Z A;  2ZNY A;  4Y17 A;  2VBW A;  3RIR A;  1MDM A;  3IRQ A;  1QPM A;  1RUO A;  1IN6 A;  1O7F A;  1QGP A;  3U9G A;  4P55 A;  2XUB A;  2OQG A;  1XD7 A;  5BOX A;  3ZN1 A;  1JHF A;  1SFU A;  2QQB A;  4L9V A;  2WC2 A;  2VOD A;  2QZ8 A;  4KN4 X;  1SD7 A;  4F7Z A;  3VB2 A;  4KYW A;  4DNC A;  3KP3 A;  3FWE A;  4ETS A;  3GZ5 A;  5HS7 A;  2KJB A;  3Q5F A;  2W85 A;  1CF7 A;  4LG0 A;  3T0Y A;  2NAZ A;  2UWM A;  1J59 A;  1UFM A;  4A0Y A;  4OIQ F;  3F3X A;  1D8K A;  3TKY A;  3WTV C;  1JGS A;  4ZYD A;  1UB9 A;  3LWF A;  3FZV A;  1D5V A;  2CO5 A;  1MD0 A;  4KIC A;  2M1B A;  5LHH A;  3WTZ A;  3G73 A;  1WQ2 A;  3HUG A;  2FU4 A;  2QLZ A;  1YS7 A;  3CLO A;  2EFN A;  3CUO A;  1LNW A;  3F8M A;  4ESB A;  2E7W A;  2Z9O A;  2IA2 A;  1O3Q A;  5DCM A;  5FD5 A;  2RNJ A;  5ERI A;  1BIA A;  3K9T A;  4G94 A;  2A3S A;  2YR2 A;  1IRG A;  1SAX A;  3CO7 C;  2IT0 A;  1XN7 A;  2A07 F;  2DW4 A;  2RGV A;  2HKX A;  5FLX Z;  5ILU A;  3S2W A;  5HDN A;  4JBA A;  3FMQ A;  4GXO A;  4EJW A;  3EQL F;  1AOY A;  3MQ0 A;  2EFQ A;  1GHC A;  4B8X A;  5DEQ A;  2YX7 A;  1BM9 A;  3GUD A;  1G3Y A;  1ZHF A;  3HSR A;  1I1G A;  4LLG F;  1QBJ A;  4U7D A;  1DPU A;  3RKW A;  1T2K A;  1W7P B;  5D4R A;  4M74 A;  3MFK A;  2HYF A;  3CTA A;  3V8J A;  4LD5 A;  2M45 A;  3T5X A;  1XGM A;  4ENN A;  1X3U A;  4R1H A;  2XIG A;  2HQN A;  3HTU A;  3RTR A;  3CUQ B;  2QUF A;  1H9G A;  4HW0 A;  5H20 A;  2D2W A;  3DEU A;  2VBZ A;  4ZZD A;  2AS5 F;  3BPV A;  2ZXJ A;  2H6B A;  1R1T A;  1Q1H A;  4G6Q A;  2FNA A;  1AWC A;  4P5O A;  2GXB A;  4EGY A;  2QBY B;  2K27 A;  4AIK A;  4MQV A;  2RV8 A;  3H92 A;  2K7L A;  4FT8 A;  3V8K A;  3SXY A;  2X4H A;  3E3V A;  4KDP A;  1U2W A;  3I58 A;  2Q0O A;  2DLL A;  2KIM A;  4A5M A;  5D4S A;  1R23 A;  2PLY A;  4XLN F;  2OZ6 A;  3SZP A;  1BBY A;  4AD9 A;  3ZP5 A;  4ZYG A;  3GFI A;  1P6R A;  2VE8 A;  4L9T A;  4M6Y A;  4RAZ A;  2IP2 A;  1KQ8 A;  3J81 K;  1HQC A;  3I59 A;  1OYY A;  3FX3 A;  4MTE A;  1DUX C;  3HSE A;  2UXN A;  3QOP A;  3F8N A;  2HZT A;  3GEZ A;  2RKH A;  4EJO A;  5LLQ A;  4YII A;  3IKT A;  1ON2 A;  2F5C A;  4ENK A;  2XAS A;  1F4K A;  3GF2 A;  4RGU A;  4OOI A;  4N0B A;  3E6M A;  5ILS A;  3MZY A;  5E17 F;  4JQF A;  2GWR A;  4NQW A;  3DV8 A;  3K1N A;  2Z3Y A;  2PI0 A;  4FHT A;  5HLG A;  4WK8 F;  4HV5 A;  4QWQ A;  4MHG A;  1HKT A;  1YS6 A;  2DO7 A;  1B9N A;  4OIO F;  2EA4 A;  2F5E A;  1B6A A;  1F9N A;  4WX9 A;  3PQK A;  2KJC A;  2GAU A;  3VEP A;  1KQ0 A;  2GQQ A;  2FXA A;  4I98 B;  2XHK A;  3PQJ A;  4CHU A;  5ILV A;  4E70 A;  3ZMT A;  2LKP A;  3KP2 A;  4HF1 A;  2YX4 A;  5AON A;  3U1D A;  2CWE A;  1S29 A;  1YW7 A;  1CF7 B;  1BC8 C;  4KT5 C;  5E1W A;  4NHJ A;  1ODD A;  1C0W A;  3HRS A;  3P9K A;  1ZRF A;  1J0R A;  5IT9 K;  5E8G A;  4UNO A;  2JRT A;  4G6D A;  5F64 A;  3QP6 A;  2ISZ A;  3RKY A;  4BQA A;  1E17 A;  4Y15 A;  4ZZL A;  1GXP A;  5E20 A;  3B02 A;  3BOQ A;  1EH8 A;  2V9V A;  1FBU A;  3K1M A;  5DCF A;  4I2O A;  2HEO A;  2B0L A;  2FQ3 A;  3GXO A;  5L3F A;  3VOD A;  3CUQ C;  3LA7 A;  3KEQ A;  2ACJ A;  2V1U A;  4A0X A;  2GZW A;  3K1P A;  2NYX A;  3FXU A;  2P6S A;  2Y75 A;  1IRF A;  5CVI A;  3IC7 A;  2O0Y A;  4YG2 F;  1U5T A;  4QLC U;  3CDH A;  2FML A;  2ZCW A;  1DDN A;  2J5O A;  2K86 A;  2V6C A;  5CVU A;  5E8I A;  4PCQ A;  3COA C;  1IW7 F;  3KLO A;  3KCC A;  4GO1 A;  3KP4 A;  4U0V A;  4Q4Z F;  3M1E A;  3EYY A;  2J5P A;  4O5V A;  4EGZ A;  3F22 A;  3E5Q A;  4MTD A;  2HDC A;  4U0W A;  1FYK A;  1LVA A;  3LAJ A;  5DD4 A;  5ICG A;  4AWX B;  1GXQ A;  1TW3 A;  4EQQ A;  3F23 A;  4I0B A;  1FPQ A;  2DPD A;  3RDI A;  1BI3 A;  5D8L B;  2WTE A;  1ZYR F;  5LEJ A;  3LA2 A;  1LEB A;  3O6B B;  2COM A;  2BBY A;  2XRO A;  3FM3 A;  3WGH A;  4Z2Y A;  1TQP A;  3L9F A;  5LEK A;  2P7C B;  1XSX A;  3E97 A;  2A5Y B;  1P92 A;  3T8T A;  1FP2 A;  4G7O F;  2L01 A;  3KZY A;  4IVN A;  1F5T A;  2ZNZ A;  1R58 A;  2IVM A;  1O7L A;  4I01 A;  1W4M A;  1HXD A;  3EUH A;  1V4R A;  2G9W A;  2XAQ A;  4AIJ A;  4RS8 A;  1KQ9 A;  2MD5 A;  4I09 A;  4I0A A;  2FA5 A;  1PP7 U;  2D1V A;  3I59 B;  3Q9V A;  1G3W A;  3R0J A;  4GCV A;  2VOO A;  1G3T A;  1SD6 A;  3P9C A;  4M9Z A;  3GVA A;  4HLX A;  3E6B A;  3RI4 A;  1HSJ A;  4XLP F;  1U6G A;  5F6F A;  4K2E A;  3BZ6 A;  2ETH A;  2HQR A;  5K5Q A;  4EM2 A;  2QYO A;  5HLH A;  1MGT A;  3IL2 A;  4M6X A;  1ZGJ A;  2A6H F;  2JSC A;  3ZMV A;  3M7G A;  2DI3 A;  2NNN A;  2XVC A;  3ZQ7 A;  5FFX A;  2A6E F;  2GA1 A;  2QQ9 A;  4RB2 C;  2QEN A;  2CW0 F;  5JVT A;  2AXL A;  2DPU A;  1HW1 A;  1USS A;  1S7A A;  3R0A A;  1P2F A;  2IA1 A;  4WXD A;  3P7N A;  3ROU A;  3F72 A;  1FYL A;  2HGC A;  5BQT A;  4HDV A;  4XSX F;  3R4K A;  4OMZ A;  1B4A A;  1VTN C;  2IRF G;  1SD5 A;  1ZGA A;  4RB3 C;  5LRS A;  6PAX A;  2Y48 A;  2ESN A;  2FOK A;  3HSF A;  1R36 A;  2V1D A;  4HV6 A;  4UXN A;  2PFB A;  3HIF A;  4UV8 A;  5J6X A;  3WTY C;  1R5H A;  2R3S A;  4AIH A;  1BJA A;  1IXR C;  1EH7 A;  3C3W A;  2QWW A;  3MZH A;  1U78 A;  4LB6 B;  3BWG A;  2KRF A;  1OYW A;  3J81 Z;  4GYI A;  4ZYE A;  5L3G A;  1U5T C;  3E6C C;  3KFW X;  1XMK A;  1KYW A;  4U0Y A;  2MLG A;  3L7W A;  1IAW A;  2IA0 A;  3V7C A;  3RKX A;  1PP8 F;  3CUQ A;  1IN5 A;  1H9T A;  2M5W A;  5DDG A;  5H6R A;  1FBS A;  3MAJ A;  1R00 A;  5CJ9 A;  3KP5 A;  3JAM K;  4HLY A;  1HKS A;  3VFZ A;  2XAH A;  2A69 F;  3PFI A;  1ZLK A;  3I53 A;  1R22 A;  2KIU A;  3HRM A;  2CQK A;  5BPD A;  1TNT A;  2XGX A;  3WTW C;  2WV0 A;  3WOD F;  2VC0 A;  2MH2 A;  2R7D A;  4LG0 B;  5D5X B;  1UHW A;  4RB0 A;  4CIC A;  2W84 A;  1IUY A;  2ZBK A;  5FD6 A;  1MJA A;  1JE8 A;  1ZH5 A;  5DUK A;  4A12 A;  1KU9 A;  4HX8 A;  5JI6 A;  1ZRD A;  3GFM A;  4HOB A;  4KIF A;  4LB5 A;  1SFX A;  2EV5 A;  3HTS B;  4HBL A;  4LGW A;  5CLS A;  4I7H A;  2RC4 A;  1H0M A;  3TOA A;  3TOB A;  2GIV A;  5FO5 A;  4EVI A;  4BAY A;  2HOE A;  2VOP A;  1Z05 A;  2GA2 A;  5JHU A;  1SD4 A;  3GWZ A;  4WCG A;  2A61 A;  4WF2 A;  3WTU C;  2VN2 A;  4ZH4 F;  4CO8 A;  1J2X A;  1T6S A;  4HQE A;  3BJO A;  1K78 A;  4L9N A;  4L5I A;  1RI7 A;  3D5L A;  3D0S A;  1OMI A;  3I4P A;  1ULY A;  3NEU A;  4N9I A;  1R7J A;  5H6Q A;  2EV6 A;  4ZYH A;  2H09 A;  4RB1 A;  1B9M A;  3NQO A;  3LQQ A;  4G7H F;  3SZT A;  3TDZ C;  3FXQ A;  3GZ6 A;  1LDD A;  4PDK A;  1UHM A;  4UV9 A;  2LSO A;  1P4W A;  5CVV A;  1R5G A;  2FBK A;  1XB4 A;  4P9F A;  5BS6 A;  2WWY A;  2ADU A;  3HOS A;  1R1U A;  2BGC A;  4RGR A;  3JSO A;  1FZP B;  2JPC A;  4KN7 X;  5HVQ C;  2DK5 A;  4IHT A;  4M9X A;  1L3L A;  1PUE E;  4U88 A;  5L3C A;  2HWV A;  2W24 A;  1K79 A;  1DP7 P;  2TDX A;  1T38 A;  4WXC A;  2RN7 A;  1XDS A;  3N97 A;  2NS0 A;  3BPX A;  3TO9 A;  1YO5 C;  3KP6 A;  4Q48 A;  2OBP A;  2Z33 A;  3F8F A;  2BV6 A;  4WWC A;  1JXS A;  3BY6 A;  4GGG A;  2IPQ X;  2PG4 A;  1U3E M;  1G6N A;  3ERE D;  1Z1D A;  1KU2 A;  2OQR A;  2DQR A;  2RQP A;  3WGI A;  1W5S A;  2V1X A;  3I0T A;  2W57 A;  3EDP A;  3J80 Z;  3ELK A;  1T0F A;  4BHC A;  1G4D A;  2FBH A;  3MCZ A;  1LEA A;  1IN8 A;  2CG4 A;  4LFU A;  3RJP A;  3DKW A;  4MGR A;  3M8E A;  1UST A;  4Q47 A;  1FC3 A;  4BHB A;  2FNP A;  4CXF A;  2PJP A;  4A6E A;  2K4J A;  4ASN A;  2G7H A;  3JTG A;  3HYI A;  4MEY F;  1GVJ A;  1I1S A;  2EFW A;  4IF4 A;  1J9I A;  1LB2 A;  1U8R A;  3DP7 A;  5D5U B;  4O3M A;  4KMF A;  1FY7 A;  1DPR A;  3C18 A;  1FLI A;  4UVC A;  5E1X A;  2EFO A;  4JK1 X;  3LAP A;  3IWZ A;  5AIQ A;  3M9A A;  1ZG1 A;  1IN7 A;  2RDP A;  3IWF A;  5IT9 Z;  4B09 A;  4BH9 A;  3GLX A;  3QP5 A;  4HX4 A;  1WSU A;  3F21 A;  3QU3 A;  3KEO A;  4ENJ A;  1IN4 A;  2HTJ A;  2VT3 A;  4A6D A;  3WTS C;  2V79 A;  1J75 A;  3FM5 A;  2EFP A;  1STZ A;  3GO5 A;  1BI2 A;  2FMY A;  2IW5 A;  1XSV A;  4BHP A;  5FLX K;  5L3D A;  4LJZ F;  3K0L A;  5A2Q K;  2L4M A;  2IJL A;  1W7P D;  4H0E A;  5HOO A;  3WE2 A;  2DQL A;  2EB7 A;  1BIB A;  4A2U A;  5HS8 A;  2DFI A;  2F5D A;  2STT A;  3MWM A;  4LLN A;  2EK5 A;  3JTH A;  4N9H A;  3L09 A;  2LF8 A;  4CGZ A;  1YIO A;  2MLK A;  1XGS A;  4G7Z F;  2CGP A;  4LMY A;  3HHG A;  1ZN2 A;  1REP C;  1O57 A;  1W5T A;  4EJT A;  3NRV A;  1S3J A;  3QRF F;  1TQI A;  1FSH A;  3IRR A;  3OV8 A;  4KIB A;  2F5F A;  1K7A A;  1ZLJ A;  5KK1 A;  3T8R A;  3L00 A;  2VE9 A;  3L2C A;  1J7K A;  1ZAR A;  4HZF A;  4OU0 A;  2VC1 A;  2PQ8 A;  2UXX A;  4FX4 A;  4UVA A;  4S05 A;  1XCV A;  4A5N A;  4ON0 A;  1IF1 A;  1W7P A;  3H3Z A;  1Y0U A;  4L5J A;  2ZKZ A;  1TLH B;  1OKR A;  2H94 A;  5LBQ A;  2H27 A;  4IRH A;  1O3R A;  5L3E A;  2P4W A;  1IXS B;  5HDG A;  2MA3 A;  3DPT A;  3QPT A;  3FF5 A;  1LDJ A;  1MJB A;  2DBB A;  2L54 A;  5K5R A;  2NNY A;  5ICE A;  3FHZ A;  1JHH A;  3F6V A;  2EWN A;  4XBF A;  2YSR A;  2FBI A;  1HKQ A;  3TO7 A;  2QBY A;  4Y13 A;  2M87 A;  3SFZ A;  4RGX A;  3AAF A;  5D6F A;  1LQ1 A;  3ZMS A;  4RAY A;  3KE2 A;  4KNY A;  5IT3 A;  2P5K A;  1L0O C;  2FE3 A;  1S8N A;  1WWX A;  1NHA A;  5D6E A;  1Z6T A;  4G8X A;  1FYM A;  2G7U A;  3QU6 A;  1HST A;  1S6L A;  1P4X A;  5FFZ A;  1QQI A;  1CGP A;  4EM0 B;  4L0Y B;  2MC3 A;  2P5L C;  5HDK A;  1E2X A;  2Y0M A;  3LST A;  2O6G E;  3J7A O;  4WXH A;  3QAH A;  2OU2 A;  3LFK A;  4EM1 A;  4Q5S F;  1SMY F;  2DTR A;  4HQM A;  1ZAO A;  5BMZ A;  1ON1 A;  3SQN A;  4KFC A;  5ICF A;  3QPH A;  2ZME A;  5EEH A;  5DCM B;  1Z91 A;  4HF2 A;  3U2R A;  3WE3 A;  2VBY A;  1QNT A;  2R7F A;  3HHH A;  1YFH A;  1U5T B;  4M73 A;  4KA4 A;  3DPL C;  4IHS A;  3GFJ A;  3T1B A;  2D45 A;  4IRG A;  3ML6 A;  1LJ9 A;  1SMT A;  4CYD A;  5J8F A;  1YYV A;  1YLF A;  3IKV A;  1FT9 A;  3DFG A;  4BNC A;  1ZRE A;  3R61 A;  3G3Z A;  1B1B A;  5D5V B;  2O3F A;  4D0P A;  1FSE A;  1ZG5 A;  1QZY A;  2XRN A;  1YQA A;  3JW4 A;  3RYR A;  2O61 A;  2QM3 A;  5ED4 A;  4OIR F;  1XGN A;  2XAG A;  5E1Z B;  1MZB A;  1BC7 C;  3KLN A;  4UUV A;  5A2Q Z;  1J5Y A;  3ULQ B;  2HFH A;  5F1R A;  2RVC A;  4IJA A;  2VT2 A;  2MBF A;  3BJA A;  3WTT C;  2P6T A;  4TV7 A;  2QQA A;  1O3S A;  3WGG A;  4LK0 F;  4IXA A;  2GXG A;  2LF7 A;  3CJN A;  5LGN A;  4M9S A;  4P96 A;  1RNL A;  3EET A;  5HLI A;  3W6K B;  2JZY A;  1RIO H;  4UHT A;  5LGT A;  3DF8 A;  4ENM A;  2JPB A;  2XKO A;  1D3Y A;  2HTS A;  1FWZ A;  3EYI A;  4YFX F;  4XRF A;  1K78 B;  2ESH A;  2FF4 A;  2W25 A;  4HX7 A;  4EV0 A;  4S04 A;  1KU3 A;  3LQR A;  3HRU A;  2ELH A;  3FMS A;  2K4B A;  2C6Y A;  1EV7 A;  3IHU A;  2OAZ A;  3OOP A;  3K69 A;  3B73 A;  2KKO A;  4KUM A;  3GFL A;  1FBQ A;  4O6J A;  4BXU A;  1RUN A;  3O3K A;  3ECO A;  2P5V A;  5LHI A;  1XDU A;  1OPC A;  1KGS A;  1OR7 A;  5FGM A;  3F8B A;  2XAF A;  3RYP A;  4OIN F;  4L0Z B;  3ZN0 A;  3WTX C;  3I54 A;  5BPI A;  2Z99 A;  4OIP F;  1P4A A;  1R1V A;  2EJR A;  3E5U A;  4EMS A;  2LNB A;  5EEG A;  2FRH A;  4RGS A;  5ICC A;  1SFE A;  1WI9 A;  2E1N A;  5E18 F;  2M8E A;  2PMU A;  3TGN A;  1OYI A;  2JT1 A;  2D1H A;  2VXZ A;  1XCB A;  3Q9S A;  4LLL A;  2EA2 A;  4DQ2 A;  1WRJ A;  4MEX F;  1F1Z A;  4BYY A;  4GYG A;  1IZ1 A;  1ZG3 A;  1Z9C A;  3GYH X;  2O8X A;  2P7V B;  4CDG A;  4HF0 A;  2CFX A;  2XKP A;  3FMR A;  2XV4 S;  3KET A;  1MKM A;  2P8T A;  3TO6 A;  2DT5 A;  1MDM B;  3ISP A;  2EV0 A;  3P9I A;  4YFK F;  4HDU A;  1TQM A;  3RPU A;  3N4M A;  1HW5 A;  2XAJ A;  5DV5 A;  3WG9 A;  1BOA A;  1D8J A;  3JSP A;  2PN6 A;  1KA8 A;  3HRT A;  3VOE A;  2ZJ2 A;  1BN5 A;  3C7J A;  2HR3 A;  4M71 A;  2ZO4 A;  3CO6 C;  3I5U A;  4PGH A;  1IXC A;  3K2Z A;  4HAM A;  3RPQ A;  1Z7U A;  2VON A;  2VBX A;  1I6X A;  3F6O A;  1RZ4 A;  3ZMU A;  1WKM A;  2CSO A;  1QZZ A;  2BE5 F;  4M72 A;  4ESF A;  4L18 B;  2L4A A;  1QO0 D;  3WU1 B;  3V7S A;  5JFR A;  3C1D A;  3GX4 X;  1TBX A;  4R79 A;  5HS9 A;  2Q8K A;  3W6J B;  5LGU A;  5D5W B;  4EJV A;  5LHG A;  4MNU A;  3KZZ A;  3WU0 A;  2PBI A;  2E1C A;  1LDK B;  4XSZ F;  1PDN C;  5DD8 A;  4EJU A;  3M8F A;  1B59 A;  1FX7 A;  2X0L A;  3LA3 A;  2L3D A;  2BYV E;  2CYY A;  2KIF A;  3V8L A;  2ISY A;  3H3U A;  3ZMZ A;  4ESJ A;  3DXJ F;  4AVP A;  1FOK A;  3REO A;  1KYZ A;  1XGO A;  3I71 A;  3F8C A;  1T39 A;  3ABU A;  4LK1 F;  2NRA C;  1FNN A;  1XMA A;  1TW2 A;  1S7O A;  2FEZ A;  3I64 A;  1BI0 A;  5K5O A;  2OA4 A;  5JR3 A;  3V7R A;  2QVO A;  3BDD A;  2PEX A;  5AIP A;  1BI1 A;  2FSW A;  1YW9 A;  5K1Y A;  5D8K B;  4OMY A;  4KMU X;  2JTV A;  2L02 A;  5FB2 A;  2STW A;  4R8H A;  2Z5U A;  3ZMD A;  1EH6 A;  1I5Z A;  1ONV A;  3ECH A;  2DU9 A;  3V4G A;  1MJ9 A;  3ABT A;  3MEX A;  5CVR A;  1G3S A;  1V3F A;  2E7X A;  1YG2 A;  5CVJ A;  4IRI A;  1TTY A;  4YIF A;  5CYV A;  3TDU C;  2UZK A;  2YU3 A;  3DQV C;  4HA8 A;  2K02 A;  3JAM Z;  5LRR A;  2Q2E A;  1I27 A;  3R6S A;  4IPA A;  2H6C A;  5DUI A;  2HS5 A;  3ZPL A;  3TQN A;  3BJ6 A;  3BP8 A;  3BRO A;  2ZFW A;  5L3B A;  1FP1 D;  1HBX G;  5J8C A;  3E6D A;  4CZZ A;  4U7B A;  3R60 A;  5TJJ A;  3SHF A;  2O03 A; 
#chains in the Genus database with same CATH topology
 1QVU A;  5TRD A;  2M34 A;  3A2K A;  4P9U A;  1NK2 P;  2DOF A;  4YFN F;  1O3T A;  2IS6 A;  3AL0 B;  2YPR A;  2LVS A;  2FX0 A;  3OSF A;  1F43 A;  2VQH A;  2DAO A;  3AG1 H;  3O2P E;  4DYQ A;  2HNH A;  4M3B A;  1K83 J;  3OS1 A;  4IHX A;  2BEO A;  1D0X A;  1JKQ C;  2HOS A;  2R5Z B;  4PGG A;  1RET A;  3FXR A;  1YW8 A;  2DJI A;  2L2O A;  2XDV A;  1X58 A;  3HOT A;  1T8I A;  4A3D J;  1ZQ3 P;  2VLA A;  4BEH A;  3OIQ A;  1H8A C;  3MN2 A;  4C3J J;  1YTY A;  1K6O A;  2B7E A;  4KIG A;  4KJZ A;  3KP7 A;  3B6A A;  4A3I J;  2K9Q A;  3G1M A;  4OAZ A;  2OD5 A;  3L1P A;  1Z6R A;  3H9Q A;  4Y7N J;  3CME I;  1ZRC A;  2M30 A;  3FBN B;  2HKO A;  3B6C A;  5DYM A;  2PMH A;  3GW2 A;  1MND A;  3DTI A;  4CCM A;  2CFO A;  2HYG D;  4I02 A;  1A04 A;  2LDU A;  2ELK A;  2MH9 A;  2H8R A;  2A68 F;  2VQG A;  4PZJ A;  4G9Y A;  3J80 K;  1W0T A;  2R5Y B;  3FIS A;  2ZME B;  3K4B A;  4FX0 A;  3E5X A;  1XSD A;  3WHB A;  1TNS A;  1Z3X A;  2OC6 A;  3H5A A;  4NB5 A;  4L9J A;  1G2H A;  4B3A A;  1IO2 A;  4UVB A;  1KU7 A;  2F2E A;  4E7L A;  3RZD J;  1T98 A;  1HW2 A;  2DK8 A;  3A1Y A;  5F04 A;  1BA5 A;  3BCA A;  1MMD A;  5KVR A;  4HYE A;  2PMZ N;  1UCR A;  2OZU A;  4MQ9 F;  1MMA A;  4A0Z A;  2ZNY A;  4Y17 A;  4D7N A;  4F91 B;  3PO2 J;  2VBW A;  3RIR A;  1S9H A;  1MDM A;  3CC4 I;  3IRQ A;  1YRN B;  1FTT A;  1QPM A;  1RUO A;  1HOM A;  4IHV A;  1IN6 A;  1MMN A;  1O7F A;  1QGP A;  3U9G A;  4P55 A;  2XUB A;  2OQG A;  1MW7 A;  1XD7 A;  1X1P A;  2BW3 B;  5BOX A;  2QKM B;  3ZN1 A;  1JHF A;  1SFU A;  2QQB A;  4L9V A;  4A3B J;  2WC2 A;  2VOD A;  1TWH J;  2QZ8 A;  3OYJ A;  4KN4 X;  1SD7 A;  3ZCO A;  4F7Z A;  2XC7 A;  3VB2 A;  4HNU A;  4KYW A;  3S32 A;  3M8J A;  4DNC A;  5J47 A;  4UUT A;  4KT6 A;  5CPR B;  3KP3 A;  3FWE A;  4ETS A;  1G59 A;  4A3J J;  1DU6 A;  3GZ5 A;  1BJZ A;  1X1D A;  5HS7 A;  3PSF A;  2KJB A;  2M9H A;  4LIT A;  2E2J J;  3DEW A;  3FXO A;  3Q5F A;  2W85 A;  1CF7 A;  4LG0 A;  2JWT A;  3T0Y A;  4Y4R A;  2NAZ A;  3DBR B;  5J1Y A;  1N25 A;  2I10 A;  3K6G A;  2UWM A;  1J59 A;  3C2B A;  1UFM A;  2VQL A;  2LY1 A;  4A0Y A;  2LD5 A;  4PFO A;  4OIQ F;  3F3X A;  1D8K A;  3TKY A;  3WTV C;  1JGS A;  4ZYD A;  2Y9Z A;  1UB9 A;  3BQY A;  3LWF A;  1Z7L A;  2FOW A;  2EIL H;  4XN0 A;  3FZV A;  3QWL A;  2L5Q A;  1V5G A;  2DJN A;  2CO5 A;  1D5V A;  1MD0 A;  1OCP A;  3JCU C;  2M1B A;  4KIC A;  5LHH A;  1ETW A;  3WTZ A;  3G73 A;  1DGR M;  1WQ2 A;  4XLH A;  3E7L A;  3HM5 A;  3HUG A;  1A5J A;  2FU4 A;  2QLZ A;  1YS7 A;  2BXZ A;  1E3H A;  4DGW B;  2R7S A;  3A01 A;  3CLO A;  9ANT A;  2EFN A;  3CUO A;  3K7A J;  4MO7 A;  2LK2 A;  5M5W J;  1LNW A;  1Z3Y A;  3F8M A;  4NC6 A;  3G71 I;  4ESB A;  3K70 C;  3BZK A;  3IV5 A;  2E7W A;  4PJ0 C;  2Z9O A;  1PUF B;  2IA2 A;  2O7O A;  1O3Q A;  5DCM A;  2RNJ A;  5FD5 A;  5ERI A;  2M3A A;  4XON A;  1BIA A;  3K9T A;  4G94 A;  3J7Z I;  2A3S A;  2YR2 A;  1IRG A;  1SAX A;  3VPR A;  3CO7 C;  2CW7 A;  1ETK A;  4IO9 F;  1UEL B;  2IT0 A;  1XN7 A;  1O4X A;  2XF6 A;  4D9J A;  3BTC A;  2A07 F;  1FIP A;  1DP3 A;  2DW4 A;  2RGV A;  1IJW C;  2W4S A;  2HKX A;  2WV1 A;  1UMQ A;  4EAT A;  5FLX Z;  2AQE A;  2WAD A;  5ILU A;  1V54 H;  3S2W A;  3HXL A;  5HDN A;  3DEE A;  4JBA A;  5IP9 J;  1ZTR A;  2ID6 A;  3FMQ A;  1HLV A;  4GXO A;  4D5C A;  4EJW A;  3EQL F;  1IC8 A;  1AOY A;  4IKF A;  3MQ0 A;  2EFQ A;  3W2A A;  1XC5 A;  4Y52 J;  1FTZ A;  3S1M J;  1GHC A;  2JVH A;  4B8X A;  5DEQ A;  2YX7 A;  1R5I D;  4PSX A;  3NWT A;  1BM9 A;  3GUD A;  2HDW A;  3ASN H;  4DJA A;  1LFB A;  1G3Y A;  2L7K A;  1ZHF A;  4RAG A;  2JSP A;  1B72 A;  4XL9 A;  2BW3 A;  1I1G A;  3HSR A;  4LLG F;  1QBJ A;  4U7D A;  1DPU A;  2QKL B;  4CYC B;  3OMY A;  3RKW A;  1T2K A;  1W7P B;  5D4R A;  4M74 A;  2CV0 A;  3MFK A;  4HNV A;  2HYF A;  3CTA A;  3V8J A;  2ZJP F;  4LD5 A;  3HEF A;  2M45 A;  3T5X A;  4ZC3 A;  3DLL F;  1VQP I;  3OYI A;  3HPG A;  1XGM A;  3S15 J;  4ENN A;  3OYA A;  1X3U A;  4R1H A;  5EJC A;  1XTA A;  4IHW A;  2XIG A;  2DMT A;  2HQN A;  3HTU A;  3RTR A;  1K4T A;  3CUQ B;  4PJN A;  4V19 K;  1IRZ A;  4BAC A;  3OWT A;  2QUF A;  1H9G A;  4HW0 A;  1ACI A;  5H20 A;  2D2W A;  3DEU A;  4YEJ A;  2VBZ A;  3A0H C;  4ZZD A;  2AS5 F;  3IH3 A;  3BPV A;  5FKK A;  2JA2 A;  2ZXJ A;  1HA8 A;  2H6B A;  1R1T A;  5EF6 A;  4XKC A;  1Q1H A;  4G6Q A;  2FNA A;  2JUG A;  1AWC A;  4C2T A;  4P5O A;  5J1U A;  2GXB A;  5KAF C;  4EGY A;  2QBY B;  1WJD A;  3FBI B;  2NXN B;  4N4N B;  2K27 A;  4AIK A;  4MQV A;  2VKD A;  2RV8 A;  3H92 A;  2K7L A;  5J4Y A;  2NVQ J;  2HZD A;  2M2E A;  2KL4 A;  4FT8 A;  1R71 A;  3NWS A;  3V8K A;  3SXY A;  2OCE A;  3PFY A;  2X4H A;  2DDB A;  2CMP A;  2W48 A;  2EBI A;  3E3V A;  3ONQ A;  3H35 A;  5HLT A;  4KDP A;  1U2W A;  3JRI A;  2EIJ H;  2MYS A;  2CW8 A;  2F5V A;  3I58 A;  2Q0O A;  2CV2 A;  5JLX A;  2DLL A;  2KIM A;  4KIT B;  4A5M A;  4PJM A;  3H3V K;  3DU5 A;  5B3S H;  5D4S A;  4XLA A;  1R23 A;  2PLY A;  3L2R A;  3CP8 A;  4XLN F;  2R7X A;  4AYB A;  2OZ6 A;  4YEL A;  3SZP A;  1JKR C;  1BBY A;  2OCC H;  4AD9 A;  3ZP5 A;  2R5Z A;  5IYD J;  4ZYG A;  5BNG A;  3JRB A;  1DGW Y;  3GFI A;  1P6R A;  1ORK A;  2HPM A;  2VE8 A;  4L9T A;  4M6Y A;  4RAZ A;  2IP2 A;  1KQ8 A;  3J81 K;  3GBG A;  1XG1 A;  1VQ6 I;  1HQC A;  1SEU A;  3I59 A;  1ZGW A;  2R93 J;  1OYY A;  4J01 A;  3FX3 A;  4XRS A;  2OPT A;  2BOL A;  4MTE A;  1DUX C;  3MKW B;  3HSE A;  2UXN A;  3LSG A;  2HQ5 A;  3QOP A;  2F48 A;  3F8N A;  2K85 A;  2HZT A;  3GEZ A;  2RKH A;  5FKL A;  4D1Q A;  4I99 C;  1IDZ A;  4EJO A;  5LLQ A;  4HRI A;  2GM4 A;  1IUF A;  4YII A;  2Z16 A;  2QGU A;  2JVG A;  3IKT A;  1TZL A;  3TP0 A;  1ON2 A;  1PYV A;  3QOE A;  3JRD A;  2F5C A;  4ENK A;  2XAS A;  2WB1 A;  3OYD A;  4A93 J;  1VI0 A;  4P1W A;  1F4K A;  3GF2 A;  4RGU A;  4OOI A;  3D5R C;  1A31 A;  4N0B A;  3E6M A;  5ILS A;  3OIO A;  3MZY A;  3ZGK A;  2DA5 A;  5F08 A;  5M5Y J;  3CCQ I;  3BR0 A;  5E17 F;  4JQF A;  1T95 A;  2GWR A;  4NQW A;  3DV8 A;  2WAF A;  3K1N A;  5GPA A;  2Z3Y A;  1YRN A;  1MMG A;  2PI0 A;  4FHT A;  1MNM C;  3VSL A;  5C4J J;  3OYH A;  5HLG A;  4WK8 F;  3RCO A;  4HV5 A;  3ZQC A;  1WJB A;  4QWQ A;  2JMW A;  4MHG A;  1OCO H;  1MH4 A;  1YS6 A;  1HKT A;  2JN6 A;  5IP7 J;  2DO7 A;  1B9N A;  4OIO F;  2LC2 A;  2EA4 A;  2F5E A;  3K4L A;  1B6A A;  2XF7 A;  2Z2S B;  2M4K A;  2AHQ A;  1F9N A;  4WX9 A;  1MBH A;  3PQK A;  3HKZ N;  2KJC A;  5HNF A;  2GAU A;  1VFC A;  3FDY A;  1KQ0 A;  3VEP A;  2RAE A;  2GQQ A;  2FXA A;  4I98 B;  2XHK A;  3PQJ A;  1YIT I;  4CHU A;  2H1K A;  1X2M A;  5ILV A;  2K40 A;  4E70 A;  1U0J A;  2G0E A;  4NBQ A;  3ZMT A;  5JVG F;  2LKP A;  3H5N A;  4II3 A;  3KP2 A;  2M8G X;  4M3D A;  4XKV A;  5TGT A;  4HF1 A;  2YX4 A;  1VQL I;  5AON A;  1A36 A;  3U1D A;  3J7A Y;  2CWE A;  1S29 A;  1YW7 A;  1CF7 B;  3DU6 A;  1BOB A;  2GIZ A;  2H1L A;  2Y31 A;  3CDI A;  1GV2 A;  2OTJ I;  4C2M J;  3DBH B;  1BC8 C;  4KT5 C;  2VB6 A;  5E1W A;  1Z77 A;  4NHJ A;  1ODD A;  1C0W A;  4NUB A;  4LIU A;  3HRS A;  4ZDL A;  1NK3 P;  3OS0 A;  2E1M B;  3P9K A;  3ZQF A;  5CQG A;  1ZRF A;  3BG7 A;  1J0R A;  3RPU D;  3DKX A;  5HNH A;  5IT9 K;  4JX6 A;  5E8G A;  3G2B A;  4UNO A;  2JRT A;  3OIP A;  1E0E A;  2XPW A;  4ITV A;  4G6D A;  1W36 C;  5F64 A;  3QP6 A;  2ISZ A;  1PJR A;  1SAN A;  3ZQG A;  1UG0 A;  3RKY A;  4BQA A;  4CCJ A;  3S8P A;  2LFB A;  1W36 D;  4IQJ A;  2EQR A;  3GLL A;  1D1A A;  1E17 A;  3QOD A;  4CCL A;  2LMD A;  1OCR H;  4Y15 A;  4ZZL A;  1GXP A;  5E20 A;  2BVL A;  3B02 A;  3RQ4 A;  3BOQ A;  1EH8 A;  1QZE A;  1ZEL A;  2E35 A;  2V9V A;  5EDN A;  3KZI C;  1FBU A;  2K9N A;  2ZME C;  2E2I J;  3K1M A;  2HYJ A;  4FIS A;  5DCF A;  2A6T A;  4I2O A;  3X2Q H;  3CCV I;  2HEO A;  4A3E J;  4IX7 A;  2B0L A;  2VJ5 A;  1X1A A;  2LTP A;  2FQ3 A;  3GXO A;  2ELJ A;  5L3F A;  3VOD A;  4GDF A;  2CQ7 A;  3CUQ C;  3LA7 A;  3KIO A;  3KEQ A;  2ACJ A;  2V1U A;  1X4O A;  4A0X A;  3S3O A;  2GZW A;  4PJL A;  3OYN A;  3K1P A;  2NYX A;  3IUO A;  2Q2E B;  3FXU A;  2P6S A;  2Y75 A;  1IRF A;  3LSJ A;  5CVI A;  3PIO F;  4F52 A;  3IC7 A;  2O0Y A;  1Y6I A;  1QPI A;  5F0F A;  4YG2 F;  2HVS A;  3TBI A;  3CC2 I;  1U5T A;  1T56 A;  2KZV A;  4QLC U;  3AG2 H;  3CDH A;  3H9G A;  3SJM A;  2D5V A;  3V42 A;  2FML A;  2ZCW A;  1DDN A;  2J5O A;  2K86 A;  2V6C A;  3GTM J;  4ZJZ A;  2K9S A;  3EPZ A;  5CVU A;  5E8I A;  3ABL H;  4PCQ A;  1DQU A;  3COA C;  1IW7 F;  2CS3 A;  1PVE A;  1YOV B;  2ZXH A;  3KLO A;  4YRV A;  3KCC A;  3RKQ A;  4GO1 A;  3KP4 A;  4U0V A;  4Q4Z F;  1X2N A;  3C2G A;  2EIN H;  4J19 A;  2R0Q C;  4B3X A;  1JKO C;  3M1E A;  4UUS B;  3EYY A;  2J5P A;  4O5V A;  4EGZ A;  3F22 A;  3E5Q A;  3OYF A;  4F55 A;  4MTD A;  2HDC A;  1HCR A;  3LMM A;  4U0W A;  4NC8 A;  1FYK A;  1LVA A;  3LAJ A;  5DD4 A;  5ICG A;  4AWX B;  3ZR8 X;  4L5E A;  1GXQ A;  1RC9 A;  1TW3 A;  2ZC2 A;  3FXK A;  1JJ8 C;  2BY3 A;  1Y1W J;  4BGD A;  4EQQ A;  3W6V A;  2Z1D A;  3F23 A;  2CUF A;  4I0B A;  1FPQ A;  4RM2 A;  2DPD A;  3RDI A;  1BI3 A;  2CH0 A;  5IOZ A;  3L2Q A;  1AA7 A;  1E3P A;  5D8L B;  2WTE A;  1ZYR F;  3OL4 A;  3QYB A;  5LEJ A;  1TL8 A;  3A02 A;  2EIM H;  1RKT A;  3LA2 A;  1LEB A;  2CRG A;  3K10 A;  4IZZ A;  3O6B B;  2COM A;  2BBY A;  3U1K A;  2XRO A;  3FM3 A;  3WGH A;  1RPW A;  3KEY A;  4Z2Y A;  1TQP A;  3L9F A;  5LEK A;  2P7C B;  1CQT A;  4CCK A;  1XSX A;  1GLN A;  3E97 A;  1KZH A;  2A5Y B;  4FE4 A;  4AM3 A;  2X6Y A;  1P92 A;  2ZJR F;  2BHY A;  2PJR A;  2WAQ A;  3T8T A;  2OUM A;  1FP2 A;  3MZ8 A;  4G7O F;  2L01 A;  3JRA A;  3KZY A;  4IVN A;  2OJE D;  1F5T A;  2ZNZ A;  3K4C A;  1R58 A;  2IVM A;  3F9K A;  1D0Y A;  1O7L A;  4PJJ A;  4I01 A;  1W4M A;  2A5W A;  1HXD A;  2LYC A;  3EUH A;  4V2G A;  1V4R A;  2G9W A;  2XAQ A;  4AIJ A;  4RS8 A;  4GFB A;  1KQ9 A;  2MD5 A;  1MH3 A;  2DCE A;  3BG5 A;  4I09 A;  1MBE A;  1ENH A;  1T08 B;  2XAU A;  4I0A A;  4V2F A;  1X4P A;  5GAH J;  2FA5 A;  2ZJQ F;  1PP7 U;  1I6H J;  1WI3 A;  3SZG A;  1WJC A;  2D1V A;  2X9D A;  3I59 B;  1MIJ A;  3Q9V A;  1G3W A;  3R0J A;  4GCV A;  2VOO A;  2R92 J;  1AHD P;  1G3T A;  2HOT A;  1SD6 A;  3P9C A;  2LLK A;  4M9Z A;  3GVA A;  5FKN A;  4ZYA A;  4HLX A;  3SYT A;  3E6B A;  4B47 A;  1LKX A;  3RI4 A;  1HSJ A;  4XLP F;  1U6G A;  5F6F A;  4K2E A;  3ZOB A;  3BZ6 A;  2ETH A;  2HQR A;  3BZC A;  5K5Q A;  2PMZ A;  4EM2 A;  3PIP F;  2QYO A;  5HLH A;  1MGT A;  3IL2 A;  4M6X A;  1ZGJ A;  2QSF X;  2A6H F;  2XPU A;  3CF2 A;  4FCY A;  2JSC A;  2W00 A;  3ZMV A;  3M7G A;  3GTK J;  2DI3 A;  2DFF A;  2DT7 B;  2L0K A;  4I6Z A;  3OYM A;  4RA2 A;  2NNN A;  1JGG A;  1F36 A;  3VYS B;  3LFU A;  2L9V A;  1NG7 A;  2XVC A;  3TP3 A;  3ZQ7 A;  3LNQ A;  5FFX A;  2A6E F;  2GA1 A;  2VIX A;  5M3M J;  2QQ9 A;  3HKZ A;  4RB2 C;  2DFH A;  3G1O A;  2QEN A;  2CW0 F;  3TED A;  5JVT A;  2AXL A;  2DPU A;  1HW1 A;  1USS A;  1S7A A;  3CCY A;  3R0A A;  1LFU P;  3GTP J;  5F27 A;  2JRM A;  1P2F A;  2IA1 A;  2V9P A;  3SEQ A;  3UKG A;  3E1S A;  3P7N A;  4WXD A;  3ROU A;  3F72 A;  4RM3 A;  2DOA A;  4GRI A;  1FYL A;  1SFK A;  4XOR A;  2HGC A;  3WG7 H;  5BQT A;  3MMY B;  4HDV A;  3PNT A;  4XSX F;  3R4K A;  3CES A;  1VQO I;  1FIA A;  3JRG A;  4BJ6 C;  1FMV A;  2Q1Z B;  2R7O A;  1P9Q C;  4OMZ A;  1AKH A;  5GTI C;  5K7H A;  4E7J A;  2B9S A;  2WY8 Q;  1B4A A;  1QRY A;  1K61 A;  2WB1 N;  4HSR A;  2Y30 A;  4DBR A;  1VTN C;  2IRF G;  1SD5 A;  4UY8 I;  1ZGA A;  4RB3 C;  3FIW A;  4CZC A;  2EH3 A;  3MKL A;  5LRS A;  2E71 A;  2E5Z A;  3CDL A;  2CUJ A;  6PAX A;  2DA3 A;  4B4C A;  3U21 A;  4F93 B;  2Y48 A;  2ESN A;  2FOK A;  3HSF A;  2M0M A;  1R36 A;  1TWG J;  2V1D A;  5J4V A;  4HV6 A;  4UXN A;  2WAE A;  1B8I A;  2PFB A;  2HU9 A;  3HIF A;  4UV8 A;  3HJE A;  1UJ8 A;  1JUM A;  5J6X A;  3WTY C;  3H1C A;  4B48 A;  3Q0V A;  3G6E I;  5EGO B;  1R5H A;  1WVR A;  2R3S A;  3KYD B;  4M3E A;  4AIH A;  1BL0 A;  1EJ9 A;  3ASO H;  1BJA A;  1IXR C;  4FAS D;  1EH7 A;  4E7H A;  3S1Q J;  2FD5 A;  4ANJ A;  3C3W A;  2FJ1 A;  2QWW A;  3MZH A;  1U78 A;  5FJ8 J;  3BTL A;  2M7B A;  3ERM A;  4RAF A;  3BWG A;  3LSK A;  4LB6 B;  4ZDO A;  2KRF A;  3I9V 2;  5GTH C;  1OYW A;  1E3O C;  2W7N A;  3J81 Z;  3OSG A;  4GYI A;  4ZYE A;  2CQX A;  5L3G A;  1U5T C;  2E36 A;  5B66 C;  3E6C C;  3A03 A;  3KFW X;  1BW6 A;  1XMK A;  5KHD A;  5JLW A;  1IRX A;  1KYW A;  4U0Y A;  2MLG A;  4CUG A;  3L7W A;  1Y8R B;  3L2U A;  1N77 A;  1IAW A;  3PUB A;  2GBY A;  3S2H J;  2IA0 A;  1Z67 A;  3V7C A;  3RKX A;  1PP8 F;  1VQK I;  3CUQ A;  3DPU A;  1FEX A;  3CCE I;  2KRC A;  3BC8 A;  3CCM I;  1IN5 A;  2LY9 A;  1H9T A;  2M5W A;  5DDG A;  5H6R A;  1ETV A;  4FTH A;  1RR8 C;  1FBS A;  3MAJ A;  2X48 A;  3CCR I;  1XPX A;  1R00 A;  5CJ9 A;  3KP5 A;  2X6X A;  3JAM K;  2QF7 A;  4HLY A;  3BG3 A;  4DZP A;  1HKS A;  3VFZ A;  2XAH A;  2LRD A;  3EUK L;  2A69 F;  2QSH X;  1P7I A;  1V55 H;  3PFI A;  1ZLK A;  3I53 A;  4OAY A;  4QIW N;  1R22 A;  2KIU A;  4BQO A;  2TCT A;  5DM6 F;  3HRM A;  2CQK A;  1PUF A;  5BPD A;  5E3L A;  1TNT A;  2VKV A;  3HGG A;  1TWF J;  2XGX A;  3WTW C;  2WV0 A;  1X1C A;  1HDP A;  1T33 A;  3WOD F;  2VC0 A;  2KIS A;  2MH2 A;  2R7D A;  3S93 A;  4LG0 B;  5D5X B;  1UHW A;  4RB0 A;  2IGM A;  2HQA A;  4CIC A;  2W84 A;  2DOD A;  1IUY A;  2ZBK A;  2XF5 A;  4BQQ A;  5FD6 A;  1SVM A;  1MJA A;  1GV5 A;  1JE8 A;  4BUP A;  1ZH5 A;  4CH7 A;  3HOV J;  3FHN A;  5DUK A;  2LY2 A;  4A12 A;  1KU9 A;  4HX8 A;  5JI6 A;  1ZRD A;  2HDD A;  2IS4 A;  1TWA J;  3GFM A;  1U9N A;  4HOB A;  5B1B H;  4KIF A;  4LB5 A;  5H2F C;  1LE8 A;  2YS9 A;  1SVL A;  1SFX A;  2EV5 A;  3HTS B;  2JA8 J;  1VQ7 I;  2ID3 A;  1Y39 A;  4A3C J;  4A3K J;  3UR3 C;  4HBL A;  1WFX A;  4LGW A;  5CLS A;  4I7H A;  2DFE A;  2RC4 A;  4MLO A;  3HL2 A;  1POG A;  1H0M A;  3TOA A;  3TOB A;  2GIV A;  4AID A;  2NOJ B;  5FO5 A;  4EVI A;  2X85 A;  3ZQH A;  4BAY A;  2HOE A;  2LG4 A;  1GVD A;  2VOP A;  1YJN I;  1Z05 A;  2GA2 A;  5KCM A;  1FOY A;  5JHU A;  5CQE A;  1SD4 A;  3GWZ A;  4WCG A;  2A61 A;  3S3N A;  4I76 A;  1VQM I;  4WF2 A;  3WTU C;  1IG7 A;  2VN2 A;  4ZH4 F;  1OQY A;  3A4C A;  4CO8 A;  3A0B C;  1J2X A;  1YE9 A;  1T6S A;  3ZRG A;  4HQE A;  4RBO A;  3BJO A;  5IYC J;  1K78 A;  4L9N A;  2ECB A;  4L5I A;  1RI7 A;  5DS9 A;  2KHM A;  4N4O B;  3D5L A;  5FKO A;  2NVY J;  3D0S A;  3PSI A;  2CU7 A;  3FK7 A;  1OMI A;  2KLO A;  3I4P A;  5K7Z A;  4CSW A;  1ULY A;  1X3Z B;  4XNF A;  1MBK A;  3NEU A;  4N9I A;  3ZQL A;  1MSF C;  1R7J A;  5H6Q A;  2OV7 A;  3FXJ A;  4F3Q A;  2O8K A;  2IS1 A;  1BR1 A;  4RDU A;  2EV6 A;  4ZYH A;  1QHG A;  2H09 A;  4A3L J;  1SC7 A;  2R7Q A;  1A6Q A;  4RB1 A;  2EIK H;  2E1O A;  1B9M A;  3DLA A;  3NQO A;  3LQQ A;  2K9L A;  1VQ8 I;  4G7H F;  3SZT A;  3TDZ C;  3HOU J;  3VSK A;  3G4S I;  3DKY A;  2A05 A;  1D5Y A;  2YUS A;  3FXQ A;  3HG9 A;  1LDD A;  3GZ6 A;  2Y9Y A;  3IAS 2;  1UHM A;  4PDK A;  3D1N I;  4UV9 A;  2LSO A;  1P4W A;  1OFC X;  5CVV A;  1JI8 A;  1R5G A;  2FBK A;  1XB4 A;  2XB5 A;  4P9F A;  5BS6 A;  5E3M A;  2WWY A;  1ZR2 A;  2ADU A;  3HOS A;  2DA6 A;  1R1U A;  1IDY A;  2BGC A;  2CUE A;  3M3Y J;  4RGR A;  3JSO A;  4X1E A;  5J3L A;  1FZP B;  2JPC A;  2ZB9 A;  4KN7 X;  5HVQ C;  2DK5 A;  2QA4 I;  3Q0U A;  4IHT A;  4M9X A;  1L3L A;  2DA2 A;  1PUE E;  2O5R A;  4JOM A;  1ZR4 A;  4U88 A;  3UNG C;  1QHH D;  5L3C A;  2HWV A;  2AQF A;  3CJR B;  3DCF A;  2W24 A;  1OCT C;  3M07 A;  1K79 A;  2MC4 A;  3LSR A;  5TIS C;  2VAS A;  1DP7 P;  2TDX A;  4BDY A;  1T38 A;  4WXC A;  2RN7 A;  5C3E J;  2E5N A;  1XDS A;  2ME6 A;  5K7F A;  3N97 A;  4E7I A;  1IGN A;  2NS0 A;  3BPX A;  3TO9 A;  1YO5 C;  4A69 C;  3KP6 A;  3BCB A;  2VI6 A;  4Q48 A;  2LKX A;  2OBP A;  2Z33 A;  3F8F A;  3WHC A;  1JKP C;  2BV6 A;  4WWC A;  4ZTJ A;  1JXS A;  4LIV A;  3BY6 A;  4GGG A;  5EEA A;  3CP2 A;  2IPQ X;  2PG4 A;  1U3E M;  1RKW A;  1G6N A;  4BU2 A;  3ERE D;  2X6O A;  2VUM J;  3EUA A;  2L7Z A;  3ABK H;  1JT6 A;  1Z1D A;  1ITY A;  4NDL A;  5C4X J;  1KU2 A;  4BDZ A;  1TT0 A;  2OQR A;  2DQR A;  3CCU I;  2RQP A;  3WGI A;  2MAB A;  1W5S A;  2W1O A;  2M4G A;  2V1X A;  3K4M A;  3I0T A;  5DTD A;  3MKZ A;  2MSY A;  2W57 A;  3EDP A;  3OYE A;  3J80 Z;  2LKS A;  3ELK A;  1T0F A;  4BHC A;  3CMM A;  1G4D A;  2FBH A;  3MCZ A;  1LEA A;  5FRO A;  1IN8 A;  2CG4 A;  4LFU A;  4HG2 A;  3RJP A;  3DKW A;  4BE0 A;  4MGR A;  4IL6 C;  3M8E A;  1UST A;  4PUS A;  4X6A J;  2ZSH B;  3IAM 2;  2NVU B;  3FK6 A;  4Q47 A;  1FC3 A;  3SFI A;  4BHB A;  2FNP A;  3DTK A;  4CXF A;  3H36 A;  3C2H A;  4DYR A;  4B43 A;  2PJP A;  4A6E A;  2K4J A;  4XKB A;  4ASN A;  2G7H A;  4IOA F;  3JTG A;  2QSG X;  3LOC A;  3HYI A;  4MEY F;  4ABZ A;  1GVJ A;  2KQR A;  2R7R A;  2DA1 A;  1I1S A;  3GTJ J;  2LR8 A;  2EFW A;  4IF4 A;  1J9I A;  1LB2 A;  1U8R A;  3DP7 A;  2KMU A;  3IH2 A;  5D5U B;  4O3M A;  4MFE A;  4KMF A;  5CKT A;  4BJ5 C;  1FY7 A;  2WY7 Q;  1DPR A;  3C18 A;  1FLI A;  1SVO A;  1RES A;  3PUF A;  3WU2 C;  1K4S A;  3N05 A;  4BEH B;  4UVC A;  5E1X A;  4UB8 C;  4BS9 A;  2EFO A;  4JK1 X;  3LAP A;  3CJQ B;  3IWZ A;  1TP4 A;  5AIQ A;  3BQZ A;  3M9A A;  1ZG1 A;  1IN7 A;  2RDP A;  1HC8 A;  1P7J A;  3IWF A;  5IT9 Z;  4B09 A;  2LP0 A;  1XMX A;  1WHU A;  1W1W E;  1D1C A;  4BH9 A;  3HOY J;  3GLX A;  3P5J A;  3QP5 A;  4HX4 A;  2E19 A;  1WSU A;  1M1E B;  1Z0X A;  3F21 A;  3QU3 A;  3KEO A;  3W2V A;  1GT0 C;  4ENJ A;  1VQ9 I;  1IN4 A;  2HTJ A;  2VT3 A;  4A6D A;  3WTS C;  2R5Y A;  2V79 A;  1J75 A;  1WGX A;  3FKI J;  3FM5 A;  1A6I A;  2EFP A;  1STZ A;  2IXS A;  3GO5 A;  1BI2 A;  2FMY A;  4Z6Y A;  3CCS I;  2IW5 A;  4JYK A;  1XSV A;  1NH3 A;  4BHP A;  2VPR A;  4UUS A;  4G6T B;  2EZH A;  5FLX K;  5L3D A;  4M3F A;  4LJZ F;  3K0L A;  5A2Q K;  2L4M A;  3BR2 A;  2IJL A;  1W7P D;  2LH9 A;  4M3G A;  2XGC A;  4H0E A;  5HOO A;  2NOG A;  3WE2 A;  2DQL A;  1WH7 A;  2EB7 A;  4UB6 C;  1BIB A;  3RSN A;  4E7K A;  3MVP A;  1APL C;  4A2U A;  5HS8 A;  2DFI A;  2F5D A;  2KDZ A;  2STT A;  2OF7 A;  3S1N J;  3MWM A;  4LLN A;  2PX9 A;  2EK5 A;  3JTH A;  3NAR A;  4N9H A;  4XMY A;  3L09 A;  2LF8 A;  4D5F A;  3S3M A;  4CGZ A;  1ERD A;  3SDB A;  3Q0W A;  5IY5 H;  1YIO A;  2WAQ N;  2MLK A;  1I3Q J;  5DM7 F;  1XGS A;  4G7Z F;  2CGP A;  3CZ6 A;  3KYC B;  4LMY A;  3OY9 A;  2L9S A;  3HHG A;  4XRM A;  1ZN2 A;  5FLM J;  2O9L A;  1REP C;  1O57 A;  1W5T A;  2LOO A;  3OYC A;  4EJT A;  1HDD C;  3NRV A;  1S3J A;  1H88 C;  1TC3 C;  3HOX J;  3QRF F;  3I4N J;  4AC0 A;  1TQI A;  4FET A;  2IGK A;  4EEF G;  1FSH A;  3IRR A;  1SFO J;  3OV8 A;  4KIB A;  1N78 A;  2Y69 H;  1OCC H;  5IYB J;  2F5F A;  1JUP A;  1K7A A;  2AO9 A;  1Z21 A;  1S5L C;  1ZLJ A;  5KK1 A;  3T8R A;  2BHZ A;  3L00 A;  2VE9 A;  3TW6 A;  3L2C A;  4B44 A;  1J7K A;  1ZAR A;  2VJ4 A;  4HZF A;  4NC7 A;  4A3M J;  4OU0 A;  2VC1 A;  1AU7 A;  3PL8 A;  2PQ8 A;  3H9J A;  3K2A A;  2UXX A;  4FX4 A;  2X1D A;  2YU9 J;  4UVA A;  4S05 A;  2NVT J;  3I4M J;  1XCV A;  2ZFU A;  4A5N A;  2DMP A;  4ON0 A;  2QCO A;  4CYC A;  2K9M A;  1IF1 A;  1W7P A;  3H3Z A;  2JA7 J;  1Y0U A;  3K4J A;  4Y3O A;  1D1B A;  4L5J A;  2F4M B;  2ZKZ A;  1TLH B;  1OKR A;  2H94 A;  5LBQ A;  4IRH A;  5L3E A;  4XID A;  1O3R A;  2H27 A;  2E1M C;  2HOA A;  2P4W A;  2AXT C;  2R7U A;  2EPF A;  2K3F A;  1Y8Q B;  1IXS B;  5HDG A;  4BXF A;  2MA3 A;  3DPT A;  3QPT A;  1WH5 A;  3FF5 A;  1LDJ A;  1MJB A;  4F92 B;  2MFZ A;  2DBB A;  2L54 A;  4XLF A;  5K5R A;  1R4N B;  2NNY A;  5ICE A;  3FHZ A;  1JHH A;  3GCM A;  4DBQ A;  1VQ5 I;  3F6V A;  1QU3 A;  2EWN A;  4XBF A;  3NAU A;  2YSR A;  1WJE A;  2FBI A;  2HXO A;  2V26 A;  4DIQ A;  4C9Y A;  1TWC J;  4H4K C;  2OTL I;  1YX3 A;  1HKQ A;  2DA7 A;  3AFH A;  3TO7 A;  2QBY A;  4Y13 A;  2M87 A;  3SFZ A;  3CLQ A;  2KRH A;  4RGX A;  3AAF A;  2JK3 A;  5D6F A;  1LQ1 A;  3ZMS A;  4RAY A;  1MMS A;  3KE2 A;  4KNY A;  1MNE A;  2ME0 A;  5IT3 A;  1RRJ A;  1S7E A;  2P5K A;  1L0O C;  5GAG J;  1YHQ I;  2WA0 A;  3CQZ J;  2FE3 A;  1S8N A;  1WWX A;  2V4J C;  1NHA A;  1MSE C;  5D6E A;  1Z6T A;  4G8X A;  1FYM A;  2I5U A;  2JA6 J;  2G7U A;  3QU6 A;  2RQQ A;  1HST A;  1S6L A;  3FXL A;  1A35 A;  1WCM J;  2BVM A;  4II2 A;  1VQN I;  2KPM A;  4FE7 A;  3M1C A;  1B72 B;  1XX5 A;  1P4X A;  2CQQ A;  5FFZ A;  1QQI A;  1CGP A;  1J09 A;  2XB0 X;  4EM0 B;  4L0Y B;  2MC3 A;  2P5L C;  4BE1 A;  3S16 J;  5HDK A;  2GXA A;  1E2X A;  2Y0M A;  2UUZ A;  4BKX A;  5EYR A;  4DZJ A;  3LST A;  3HBL A;  3LSP A;  2O6G E;  5EG0 B;  3Q3S A;  3J7A O;  4WXH A;  3QAH A;  2OU2 A;  3LFK A;  4EM1 A;  3LL7 A;  4Q5S F;  3OYK A;  1SMY F;  2DTR A;  2DXI A;  4HQM A;  4A3G J;  1NTC A;  2KDO A;  1ZAO A;  2X1E A;  3AG3 H;  3GZN B;  5BMZ A;  1UHS A;  1ON1 A;  4W97 A;  2DMQ A;  3G1L A;  2BY1 A;  1I50 J;  3SQN A;  3HZJ A;  4KFC A;  2JUC A;  2R7V A;  2UV1 A;  2MG4 A;  2ZSI B;  5ICF A;  3PO3 J;  3QPH A;  3CJT B;  3KX2 A;  2ZME A;  2KT0 A;  5EEH A;  2TRT A;  4G12 A;  5DCM B;  1Z91 A;  1H89 C;  4IQ4 A;  4HF2 A;  3U2R A;  3WE3 A;  2VBY A;  2H8W A;  2VL8 A;  1QNT A;  2R7F A;  3HHH A;  3RQI A;  1YFH A;  1U5T B;  4C3H J;  2HI3 A;  3S1R J;  4M73 A;  4KA4 A;  3DPL C;  3GFJ A;  2D45 A;  3T1B A;  4IHS A;  4IRG A;  3ML6 A;  2PJR B;  2IS2 A;  1LJ9 A;  3SDG A;  1SMT A;  5GAD J;  4CYD A;  1RR7 A;  1AKH B;  3K4K A;  3PNY A;  5J8F A;  3L2W A;  1YYV A;  1N75 A;  1R49 A;  1YLF A;  3IKV A;  1VND A;  2M0C A;  2F6C A;  2BZT A;  1FT9 A;  3DFG A;  4BNC A;  4XKW A;  1ZRE A;  4JX4 A;  3R61 A;  1Y1V J;  2XPV A;  3G3Z A;  1B1B A;  4B1R A;  1WPK A;  2KIQ A;  4S0H B;  5EZH A;  5D5V B;  2XRL A;  1OJL A;  2O3F A;  3HUG B;  4D0P A;  3KYL A;  1MBJ A;  2WBM A;  5J40 A;  2JJ7 A;  1FSE A;  5LFA A;  4HPQ A;  1ZG5 A;  2RRE A;  1QZY A;  1T0F C;  2XRN A;  3K4N A;  1VQ4 I;  3A01 B;  1EF4 A;  1YQA A;  3JW4 A;  5EZG A;  2BY0 A;  3RYR A;  3CMA I;  1LPQ A;  2O61 A;  4BBR J;  3GTL J;  4AUX A;  2QM3 A;  4FQG A;  1UZC A;  3OYB A;  5J1R A;  3DTE A;  5ED4 A;  4YIR X;  3MKY B;  5B1A H;  4OIR F;  3QYF A;  3VYU B;  4CA0 A;  1XGN A;  2M7A A;  2XAG A;  5E1Z B;  1MZB A;  5GPC A;  2DOE A;  3ESW B;  3QQA A;  3H5R A;  1BC7 C;  3KLN A;  4UUV A;  2VXD A;  2DYS H;  3OR2 C;  4HST A;  5A2Q Z;  4BY1 J;  1J5Y A;  3ULQ B;  2HFH A;  5F1R A;  2RVC A;  4IJA A;  1WZ2 A;  3K70 D;  2VT2 A;  2MBF A;  3BJA A;  3WTT C;  2BY2 A;  2P6T A;  4BL0 B;  4TV7 A;  1YX5 A;  3F0C A;  1YIJ I;  1JJ6 C;  2QQA A;  1O3S A;  1QVT A;  1MBG A;  4AVZ A;  5B5E C;  1OR7 C;  1MBF A;  3WGG A;  4LK0 F;  4IXA A;  5E3N A;  2GXG A;  2LF7 A;  3FKJ A;  4BY7 J;  3CJN A;  3MD2 A;  5LGN A;  2E60 A;  2DTZ A;  5IOY A;  3BTI A;  2MGQ A;  4CCO A;  3M4O J;  4M9S A;  3PM1 A;  4P96 A;  3QPL A;  1RNL A;  5M3F J;  2E34 A;  2JQ7 A;  3W2W A;  3I56 I;  2XSJ C;  3BR6 A;  3BLY A;  3EET A;  1WJA A;  5HLI A;  2V9K A;  3W6K B;  2JZY A;  1XS9 A;  2KFD A;  1JTX A;  1RIO H;  4UHT A;  2L9R A;  1JTY A;  5LGT A;  4XOT A;  3DF8 A;  4BBS J;  3TW7 A;  3DBL B;  4ENM A;  1LVK A;  3OR1 C;  4DW6 A;  3GTG J;  3ABM H;  4E7Z A;  5FLV A;  4D7M A;  2JPB A;  2XKO A;  1D3Y A;  3SHF A;  2HTS A;  3PNV A;  4Y33 A;  3IP4 B;  1FWZ A;  1FOW A;  3EYI A;  4YFX F;  3FXM A;  4XRF A;  3PJR A;  1K78 B;  2ESH A;  3HDD A;  3HGY A;  2VJJ A;  1UAA A;  2FF4 A;  2W25 A;  4HX7 A;  4EV0 A;  2V6E A;  4XM3 A;  2R4G A;  4NQW B;  4S04 A;  1W0U A;  2VPL A;  5E3O A;  1KU3 A;  3LQR A;  1U8B A;  5E79 C;  3HRU A;  1B8I B;  3CF5 F;  2ELH A;  3FMS A;  1X1B A;  1ETY A;  2K4B A;  2C6Y A;  1ETO A;  1EV7 A;  3CMY A;  2FQ4 A;  4QPQ A;  3IHU A;  3OYL A;  2OAZ A;  3OOP A;  3D5S C;  3K69 A;  4BQN A;  1R6R A;  2N8G A;  2KKO A;  3B73 A;  4HNT A;  3J7Y J;  4KUM A;  3GFL A;  1FBQ A;  4O6J A;  4BXU A;  1RUN A;  3O3K A;  3ECO A;  2P5V A;  4C2U A;  2DDA A;  4OWR B;  5LHI A;  3BT9 A;  2QEX I;  2CJJ A;  1XDU A;  1OPC A;  1KGS A;  1X19 A;  1OR7 A;  4AYB N;  5FGM A;  2R7T A;  3JRF A;  3F8B A;  3OYG A;  3HOZ J;  2R7Z J;  2XAF A;  4PSW A;  3RYP A;  2XGD A;  5KAI C;  4OIN F;  4C3I J;  3TL4 X;  4L0Z B;  2LRE A;  3ZN0 A;  3WTX C;  3I54 A;  4JP0 A;  1YJW I;  5BPI A;  2EZK A;  4XR6 A;  4QTR A;  2Z99 A;  3AKZ A;  4KIS A;  4OIP F;  1P4A A;  1R1V A;  2EJR A;  1BW5 A;  3E5U A;  4EMS A;  2XSD C;  1ZK8 A;  2LNB A;  5EEG A;  2FRH A;  4BE2 A;  4RGS A;  2R7W A;  5ICC A;  3S2D J;  2DT6 A;  2F4I A;  1SFE A;  1WI9 A;  4XN3 A;  2E1N A;  5E18 F;  4XLC A;  2M8E A;  1K6Y A;  2PMU A;  5KNL A;  1VZ0 A;  3AG4 H;  5F0H A;  4RMN A;  3TGN A;  1OYI A;  1R9T J;  2JT1 A;  2D1H A;  3IH4 A;  4LOC A;  4XOP A;  2Y0S N;  5FKM A;  2VXZ A;  2VQC A;  3ZQI A;  1XCB A;  3Q9S A;  4LLL A;  2EA2 A;  2L7M P;  3OOU A;  4DQ2 A;  1JUS A;  2NS7 A;  4JX5 A;  1WRJ A;  4MEX F;  4W1U A;  1F1Z A;  4BYY A;  2RNG A;  4GYG A;  1LE8 B;  5EGO A;  1IZ1 A;  1ZG3 A;  1Z9C A;  2LBF B;  3GYH X;  4IEJ A;  2O8X A;  2P7V B;  2QQ8 A;  3KPH A;  4CDG A;  4J00 A;  2VKE A;  3CD6 I;  1EKE A;  4HF0 A;  2HVQ A;  5GP9 A;  2CFX A;  3BR3 A;  2XKP A;  1IV6 A;  5GAE J;  3FMR A;  3O8H A;  1X3W B;  2XV4 S;  2BXY A;  2X51 A;  3E0J B;  1MKM A;  3KET A;  3I55 I;  2F4O B;  4ZTF A;  2P8T A;  2IAI A;  3TO6 A;  2FUG 2;  2DT5 A;  3CC7 I;  1MDM B;  2V1N A;  3VWB A;  1YJ9 I;  3ISP A;  2EV0 A;  3P9I A;  4YFK F;  3DWL E;  5EG0 A;  2W82 A;  2IBD A;  4CCN A;  3ZXS A;  4HDU A;  1TQM A;  5LD2 C;  3H0D A;  3RPU A;  3N4M A;  1HW5 A;  4A3F J;  2XAJ A;  5DV5 A;  1WJF A;  3LSM A;  1BOA A;  3WG9 A;  1D8J A;  3JSP A;  3CCL I;  2PN6 A;  1KA8 A;  2ZXW H;  3HRT A;  1WJ5 A;  1LFP A;  3RZO J;  3VOE A;  2ZJ2 A;  1BN5 A;  1OCZ H;  2HR3 A;  3C7J A;  4M71 A;  4MFD A;  2ZO4 A;  1NG6 A;  2EZI A;  3CO6 C;  2HXI A;  3I5U A;  4PGH A;  1IXC A;  5JHF A;  3K2Z A;  4HAM A;  4C30 A;  4M6V A;  3RPQ A;  3LSH A;  1Z7U A;  2VON A;  4IOC F;  2VBX A;  1I3A A;  1I6X A;  2K3P A;  1RZ4 A;  3F6O A;  5FRN A;  1W5C C;  1FOX A;  3JRE A;  1GDT A;  3O8G A;  3ZMU A;  4E4H A;  3S17 J;  3ZQQ A;  2ECC A;  3GME A;  2I8D A;  1WKM A;  2CSO A;  4ZDP A;  1QZZ A;  4IHY A;  1R4M B;  1U9O A;  2BE5 F;  4M72 A;  4ESF A;  3JRC A;  4NNJ A;  4L18 B;  2L4A A;  1JT0 A;  1QO0 D;  4RLF A;  2K5C A;  1VF9 A;  2XGE A;  3WU1 B;  3V7S A;  2B63 J;  2P81 A;  5F0C A;  5JFR A;  3LSI A;  5IP6 A;  3I3L A;  4MIM A;  4XIC A;  2CUZ A;  3C1D A;  3GX4 X;  1TBX A;  4R79 A;  3H0G J;  5M5X J;  5HS9 A;  2Q8K A;  3W6J B;  5LGU A;  5D5W B;  4EJV A;  4QPO A;  2IGO A;  3KZZ A;  4MNU A;  5LHG A;  3WU0 A;  2PBI A;  2EZL A;  4PK4 A;  5HOD A;  3S14 J;  3BTJ A;  4XQF A;  2HPI A;  2E1C A;  1LDK B;  3JRH A;  3CCJ I;  4XSZ F;  2P0W A;  5DD8 A;  4EJU A;  3QPS A;  1PDN C;  1S72 I;  1B59 A;  1FX7 A;  2X0L A;  3M8F A;  3LA3 A;  2L3D A;  2BYV E;  2Y0S A;  2CYY A;  2KIF A;  3V8L A;  2HVR A;  2ISY A;  1FMW A;  2IGN A;  3VYR B;  3VDX A;  2VKH A;  3OL3 A;  3H3U A;  2JA5 J;  3ZMZ A;  4ESJ A;  3DXJ F;  3BR5 A;  1V5F A;  2LBF A;  4AVP A;  1FOK A;  3REO A;  4XRS G;  1KYZ A;  1Q1V A;  1XGO A;  3I71 A;  2DA4 A;  3HPH A;  3F8C A;  3AL0 C;  1T39 A;  3ABU A;  3W3C A;  2MD0 A;  4LK1 F;  5F1J A;  1V5E A;  2NS8 A;  4HEA 2;  2DMN A;  3OS2 A;  2NRA C;  2COB A;  1ZKG A;  3TMO A;  1FNN A;  1XMA A;  1TW2 A;  1S7O A;  1UG2 A;  2FEZ A;  4DOZ A;  3GTQ J;  3I64 A;  1BI0 A;  5K5O A;  2NVX J;  2GLO A;  2OA4 A;  4BJT A;  5JR3 A;  3V7R A;  1IV8 A;  4X0G A;  2QVO A;  3BDD A;  2PEX A;  5AIP A;  2MW8 A;  3SEZ A;  1BI1 A;  4AU7 A;  2FSW A;  1G8X A;  1YW9 A;  5K1Y A;  1ETQ A;  4PFP A;  1Y0N A;  5D8K B;  1DU0 A;  4KMU X;  4OMY A;  2E2H J;  3GTO J;  2JTV A;  2V7F A;  5IPA A;  1LUJ B;  3QYE A;  2L02 A;  5FB2 A;  2STW A;  4R8H A;  4E7S A;  2Z5U A;  2L7F P;  3ZMD A;  1EH6 A;  1I5Z A;  2KZG A;  1SAU A;  1I39 A;  2DYR H;  2GOM A;  1ONV A;  3ECH A;  2DU9 A;  3BR1 A;  1QA6 A;  5C44 J;  3V4G A;  4QSH A;  1MJ9 A;  3ABT A;  1D0Z A;  3MEX A;  4XLE A;  5CVR A;  1G3S A;  1FJL A;  1V3F A;  2E7X A;  1YG2 A;  2X6W A;  5CVJ A;  5FRM A;  3HOW J;  1EA3 A;  2ICW G;  1KON A;  2VJI A;  1BR2 A;  1GUU A;  4IRI A;  1HF0 A;  1TTY A;  4YIF A;  3L2V A;  5CYV A;  3TDU C;  3HC7 A;  3HB9 A;  2UZK A;  4BXX J;  1ETX A;  2CV1 A;  1BR4 A;  2YU3 A;  2Y2Z A;  3DQV C;  4HA8 A;  2K02 A;  1YI2 I;  2DN0 A;  4U87 A;  1TT5 B;  4DYC A;  3BG9 A;  1OLT A;  5LRR A;  3JAM Z;  2Q2E A;  3JR9 A;  2GOX B;  2L9N A;  4RLQ A;  1I27 A;  2ZXI A;  3R6S A;  4IPA A;  2H6C A;  1OIS A;  4E6K G;  5DUI A;  2HS5 A;  3ZPL A;  3BG6 A;  2KP6 A;  3TQN A;  3BJ6 A;  3BP8 A;  2DMU A;  3BRO A;  2ZFW A;  5L3B A;  1FP1 D;  2X1C A;  3VYT B;  1HBX G;  4LG3 A;  5J8C A;  3E6D A;  4CZZ A;  4U7B A;  1Y56 A;  3R60 A;  4XK4 A;  5TJJ A;  2IEK A;  3EUH C;  2CQN A;  2O03 A; 
#chains in the Genus database with same CATH homology
 5TRD A;  4P9U A;  4YFN F;  1O3T A;  2YPR A;  2DAO A;  3O2P E;  2BEO A;  4PGG A;  3FXR A;  1YW8 A;  3HOT A;  1K6O A;  1YTY A;  4KIG A;  3KP7 A;  2OD5 A;  1Z6R A;  1ZRC A;  2M30 A;  2HKO A;  5DYM A;  2PMH A;  3GW2 A;  2HYG D;  4I02 A;  1A04 A;  2LDU A;  2MH9 A;  2A68 F;  4PZJ A;  4G9Y A;  3J80 K;  2ZME B;  4FX0 A;  3E5X A;  1XSD A;  1TNS A;  4NB5 A;  4L9J A;  4UVB A;  1KU7 A;  2F2E A;  1T98 A;  1HW2 A;  2DK8 A;  5KVR A;  4HYE A;  1UCR A;  2OZU A;  4MQ9 F;  4A0Z A;  2ZNY A;  4Y17 A;  2VBW A;  3RIR A;  1MDM A;  3IRQ A;  1QPM A;  1RUO A;  1IN6 A;  1O7F A;  1QGP A;  3U9G A;  4P55 A;  2XUB A;  2OQG A;  1XD7 A;  5BOX A;  3ZN1 A;  1JHF A;  1SFU A;  2QQB A;  4L9V A;  2WC2 A;  2VOD A;  2QZ8 A;  4KN4 X;  1SD7 A;  4F7Z A;  3VB2 A;  4KYW A;  4DNC A;  3KP3 A;  3FWE A;  4ETS A;  3GZ5 A;  5HS7 A;  2KJB A;  3Q5F A;  2W85 A;  1CF7 A;  4LG0 A;  3T0Y A;  2NAZ A;  2UWM A;  1J59 A;  1UFM A;  4A0Y A;  4OIQ F;  3F3X A;  1D8K A;  3TKY A;  3WTV C;  1JGS A;  4ZYD A;  1UB9 A;  3LWF A;  3FZV A;  1D5V A;  2CO5 A;  1MD0 A;  4KIC A;  2M1B A;  5LHH A;  3WTZ A;  3G73 A;  1WQ2 A;  3HUG A;  2FU4 A;  2QLZ A;  1YS7 A;  3CLO A;  2EFN A;  3CUO A;  1LNW A;  3F8M A;  4ESB A;  2E7W A;  2Z9O A;  2IA2 A;  1O3Q A;  5DCM A;  5FD5 A;  2RNJ A;  5ERI A;  1BIA A;  3K9T A;  4G94 A;  2A3S A;  2YR2 A;  1IRG A;  1SAX A;  3CO7 C;  2IT0 A;  1XN7 A;  2A07 F;  2DW4 A;  2RGV A;  2HKX A;  5FLX Z;  5ILU A;  3S2W A;  5HDN A;  4JBA A;  3FMQ A;  4GXO A;  4EJW A;  3EQL F;  1AOY A;  3MQ0 A;  2EFQ A;  1GHC A;  4B8X A;  5DEQ A;  2YX7 A;  1BM9 A;  3GUD A;  1G3Y A;  1ZHF A;  3HSR A;  1I1G A;  4LLG F;  1QBJ A;  4U7D A;  1DPU A;  3RKW A;  1T2K A;  1W7P B;  5D4R A;  4M74 A;  3MFK A;  2HYF A;  3CTA A;  3V8J A;  4LD5 A;  2M45 A;  3T5X A;  1XGM A;  4ENN A;  1X3U A;  4R1H A;  2XIG A;  2HQN A;  3HTU A;  3RTR A;  3CUQ B;  2QUF A;  1H9G A;  4HW0 A;  5H20 A;  2D2W A;  3DEU A;  2VBZ A;  4ZZD A;  2AS5 F;  3BPV A;  2ZXJ A;  2H6B A;  1R1T A;  1Q1H A;  4G6Q A;  2FNA A;  1AWC A;  4P5O A;  2GXB A;  4EGY A;  2QBY B;  2K27 A;  4AIK A;  4MQV A;  2RV8 A;  3H92 A;  2K7L A;  4FT8 A;  3V8K A;  3SXY A;  2X4H A;  3E3V A;  4KDP A;  1U2W A;  3I58 A;  2Q0O A;  2DLL A;  2KIM A;  4A5M A;  5D4S A;  1R23 A;  2PLY A;  4XLN F;  2OZ6 A;  3SZP A;  1BBY A;  4AD9 A;  3ZP5 A;  4ZYG A;  3GFI A;  1P6R A;  2VE8 A;  4L9T A;  4M6Y A;  4RAZ A;  2IP2 A;  1KQ8 A;  3J81 K;  1HQC A;  3I59 A;  1OYY A;  3FX3 A;  4MTE A;  1DUX C;  3HSE A;  2UXN A;  3QOP A;  3F8N A;  2HZT A;  3GEZ A;  2RKH A;  4EJO A;  5LLQ A;  4YII A;  3IKT A;  1ON2 A;  2F5C A;  4ENK A;  2XAS A;  1F4K A;  3GF2 A;  4RGU A;  4OOI A;  4N0B A;  3E6M A;  5ILS A;  3MZY A;  5E17 F;  4JQF A;  2GWR A;  4NQW A;  3DV8 A;  3K1N A;  2Z3Y A;  2PI0 A;  4FHT A;  5HLG A;  4WK8 F;  4HV5 A;  4QWQ A;  4MHG A;  1HKT A;  1YS6 A;  2DO7 A;  1B9N A;  4OIO F;  2EA4 A;  2F5E A;  1B6A A;  1F9N A;  4WX9 A;  3PQK A;  2KJC A;  2GAU A;  3VEP A;  1KQ0 A;  2GQQ A;  2FXA A;  4I98 B;  2XHK A;  3PQJ A;  4CHU A;  5ILV A;  4E70 A;  3ZMT A;  2LKP A;  3KP2 A;  4HF1 A;  2YX4 A;  5AON A;  3U1D A;  2CWE A;  1S29 A;  1YW7 A;  1CF7 B;  1BC8 C;  4KT5 C;  5E1W A;  4NHJ A;  1ODD A;  1C0W A;  3HRS A;  3P9K A;  1ZRF A;  1J0R A;  5IT9 K;  5E8G A;  4UNO A;  2JRT A;  4G6D A;  5F64 A;  3QP6 A;  2ISZ A;  3RKY A;  4BQA A;  1E17 A;  4Y15 A;  4ZZL A;  1GXP A;  5E20 A;  3B02 A;  3BOQ A;  1EH8 A;  2V9V A;  1FBU A;  3K1M A;  5DCF A;  4I2O A;  2HEO A;  2B0L A;  2FQ3 A;  3GXO A;  5L3F A;  3VOD A;  3CUQ C;  3LA7 A;  3KEQ A;  2ACJ A;  2V1U A;  4A0X A;  2GZW A;  3K1P A;  2NYX A;  3FXU A;  2P6S A;  2Y75 A;  1IRF A;  5CVI A;  3IC7 A;  2O0Y A;  4YG2 F;  1U5T A;  4QLC U;  3CDH A;  2FML A;  2ZCW A;  1DDN A;  2J5O A;  2K86 A;  2V6C A;  5CVU A;  5E8I A;  4PCQ A;  3COA C;  1IW7 F;  3KLO A;  3KCC A;  4GO1 A;  3KP4 A;  4U0V A;  4Q4Z F;  3M1E A;  3EYY A;  2J5P A;  4O5V A;  4EGZ A;  3F22 A;  3E5Q A;  4MTD A;  2HDC A;  4U0W A;  1FYK A;  1LVA A;  3LAJ A;  5DD4 A;  5ICG A;  4AWX B;  1GXQ A;  1TW3 A;  4EQQ A;  3F23 A;  4I0B A;  1FPQ A;  2DPD A;  3RDI A;  1BI3 A;  5D8L B;  2WTE A;  1ZYR F;  5LEJ A;  3LA2 A;  1LEB A;  3O6B B;  2COM A;  2BBY A;  2XRO A;  3FM3 A;  3WGH A;  4Z2Y A;  1TQP A;  3L9F A;  5LEK A;  2P7C B;  1XSX A;  3E97 A;  2A5Y B;  1P92 A;  3T8T A;  1FP2 A;  4G7O F;  2L01 A;  3KZY A;  4IVN A;  1F5T A;  2ZNZ A;  1R58 A;  2IVM A;  1O7L A;  4I01 A;  1W4M A;  1HXD A;  3EUH A;  1V4R A;  2G9W A;  2XAQ A;  4AIJ A;  4RS8 A;  1KQ9 A;  2MD5 A;  4I09 A;  4I0A A;  2FA5 A;  1PP7 U;  2D1V A;  3I59 B;  3Q9V A;  1G3W A;  3R0J A;  4GCV A;  2VOO A;  1G3T A;  1SD6 A;  3P9C A;  4M9Z A;  3GVA A;  4HLX A;  3E6B A;  3RI4 A;  1HSJ A;  4XLP F;  1U6G A;  5F6F A;  4K2E A;  3BZ6 A;  2ETH A;  2HQR A;  5K5Q A;  4EM2 A;  2QYO A;  5HLH A;  1MGT A;  3IL2 A;  4M6X A;  1ZGJ A;  2A6H F;  2JSC A;  3ZMV A;  3M7G A;  2DI3 A;  2NNN A;  2XVC A;  3ZQ7 A;  5FFX A;  2A6E F;  2GA1 A;  2QQ9 A;  4RB2 C;  2QEN A;  2CW0 F;  5JVT A;  2AXL A;  2DPU A;  1HW1 A;  1USS A;  1S7A A;  3R0A A;  1P2F A;  2IA1 A;  4WXD A;  3P7N A;  3ROU A;  3F72 A;  1FYL A;  2HGC A;  5BQT A;  4HDV A;  4XSX F;  3R4K A;  4OMZ A;  1B4A A;  1VTN C;  2IRF G;  1SD5 A;  1ZGA A;  4RB3 C;  5LRS A;  6PAX A;  2Y48 A;  2ESN A;  2FOK A;  3HSF A;  1R36 A;  2V1D A;  4HV6 A;  4UXN A;  2PFB A;  3HIF A;  4UV8 A;  5J6X A;  3WTY C;  1R5H A;  2R3S A;  4AIH A;  1BJA A;  1IXR C;  1EH7 A;  3C3W A;  2QWW A;  3MZH A;  1U78 A;  4LB6 B;  3BWG A;  2KRF A;  1OYW A;  3J81 Z;  4GYI A;  4ZYE A;  5L3G A;  1U5T C;  3E6C C;  3KFW X;  1XMK A;  1KYW A;  4U0Y A;  2MLG A;  3L7W A;  1IAW A;  2IA0 A;  3V7C A;  3RKX A;  1PP8 F;  3CUQ A;  1IN5 A;  1H9T A;  2M5W A;  5DDG A;  5H6R A;  1FBS A;  3MAJ A;  1R00 A;  5CJ9 A;  3KP5 A;  3JAM K;  4HLY A;  1HKS A;  3VFZ A;  2XAH A;  2A69 F;  3PFI A;  1ZLK A;  3I53 A;  1R22 A;  2KIU A;  3HRM A;  2CQK A;  5BPD A;  1TNT A;  2XGX A;  3WTW C;  2WV0 A;  3WOD F;  2VC0 A;  2MH2 A;  2R7D A;  4LG0 B;  5D5X B;  1UHW A;  4RB0 A;  4CIC A;  2W84 A;  1IUY A;  2ZBK A;  5FD6 A;  1MJA A;  1JE8 A;  1ZH5 A;  5DUK A;  4A12 A;  1KU9 A;  4HX8 A;  5JI6 A;  1ZRD A;  3GFM A;  4HOB A;  4KIF A;  4LB5 A;  1SFX A;  2EV5 A;  3HTS B;  4HBL A;  4LGW A;  5CLS A;  4I7H A;  2RC4 A;  1H0M A;  3TOA A;  3TOB A;  2GIV A;  5FO5 A;  4EVI A;  4BAY A;  2HOE A;  2VOP A;  1Z05 A;  2GA2 A;  5JHU A;  1SD4 A;  3GWZ A;  4WCG A;  2A61 A;  4WF2 A;  3WTU C;  2VN2 A;  4ZH4 F;  4CO8 A;  1J2X A;  1T6S A;  4HQE A;  3BJO A;  1K78 A;  4L9N A;  4L5I A;  1RI7 A;  3D5L A;  3D0S A;  1OMI A;  3I4P A;  1ULY A;  3NEU A;  4N9I A;  1R7J A;  5H6Q A;  2EV6 A;  4ZYH A;  2H09 A;  4RB1 A;  1B9M A;  3NQO A;  3LQQ A;  4G7H F;  3SZT A;  3TDZ C;  3FXQ A;  3GZ6 A;  1LDD A;  4PDK A;  1UHM A;  4UV9 A;  2LSO A;  1P4W A;  5CVV A;  1R5G A;  2FBK A;  1XB4 A;  4P9F A;  5BS6 A;  2WWY A;  2ADU A;  3HOS A;  1R1U A;  2BGC A;  4RGR A;  3JSO A;  1FZP B;  2JPC A;  4KN7 X;  5HVQ C;  2DK5 A;  4IHT A;  4M9X A;  1L3L A;  1PUE E;  4U88 A;  5L3C A;  2HWV A;  2W24 A;  1K79 A;  1DP7 P;  2TDX A;  1T38 A;  4WXC A;  2RN7 A;  1XDS A;  3N97 A;  2NS0 A;  3BPX A;  3TO9 A;  1YO5 C;  3KP6 A;  4Q48 A;  2OBP A;  2Z33 A;  3F8F A;  2BV6 A;  4WWC A;  1JXS A;  3BY6 A;  4GGG A;  2IPQ X;  2PG4 A;  1U3E M;  1G6N A;  3ERE D;  1Z1D A;  1KU2 A;  2OQR A;  2DQR A;  2RQP A;  3WGI A;  1W5S A;  2V1X A;  3I0T A;  2W57 A;  3EDP A;  3J80 Z;  3ELK A;  1T0F A;  4BHC A;  1G4D A;  2FBH A;  3MCZ A;  1LEA A;  1IN8 A;  2CG4 A;  4LFU A;  3RJP A;  3DKW A;  4MGR A;  3M8E A;  1UST A;  4Q47 A;  1FC3 A;  4BHB A;  2FNP A;  4CXF A;  2PJP A;  4A6E A;  2K4J A;  4ASN A;  2G7H A;  3JTG A;  3HYI A;  4MEY F;  1GVJ A;  1I1S A;  2EFW A;  4IF4 A;  1J9I A;  1LB2 A;  1U8R A;  3DP7 A;  5D5U B;  4O3M A;  4KMF A;  1FY7 A;  1DPR A;  3C18 A;  1FLI A;  4UVC A;  5E1X A;  2EFO A;  4JK1 X;  3LAP A;  3IWZ A;  5AIQ A;  3M9A A;  1ZG1 A;  1IN7 A;  2RDP A;  3IWF A;  5IT9 Z;  4B09 A;  4BH9 A;  3GLX A;  3QP5 A;  4HX4 A;  1WSU A;  3F21 A;  3QU3 A;  3KEO A;  4ENJ A;  1IN4 A;  2HTJ A;  2VT3 A;  4A6D A;  3WTS C;  2V79 A;  1J75 A;  3FM5 A;  2EFP A;  1STZ A;  3GO5 A;  1BI2 A;  2FMY A;  2IW5 A;  1XSV A;  4BHP A;  5FLX K;  5L3D A;  4LJZ F;  3K0L A;  5A2Q K;  2L4M A;  2IJL A;  1W7P D;  4H0E A;  5HOO A;  3WE2 A;  2DQL A;  2EB7 A;  1BIB A;  4A2U A;  5HS8 A;  2DFI A;  2F5D A;  2STT A;  3MWM A;  4LLN A;  2EK5 A;  3JTH A;  4N9H A;  3L09 A;  2LF8 A;  4CGZ A;  1YIO A;  2MLK A;  1XGS A;  4G7Z F;  2CGP A;  4LMY A;  3HHG A;  1ZN2 A;  1REP C;  1O57 A;  1W5T A;  4EJT A;  3NRV A;  1S3J A;  3QRF F;  1TQI A;  1FSH A;  3IRR A;  3OV8 A;  4KIB A;  2F5F A;  1K7A A;  1ZLJ A;  5KK1 A;  3T8R A;  3L00 A;  2VE9 A;  3L2C A;  1J7K A;  1ZAR A;  4HZF A;  4OU0 A;  2VC1 A;  2PQ8 A;  2UXX A;  4FX4 A;  4UVA A;  4S05 A;  1XCV A;  4A5N A;  4ON0 A;  1IF1 A;  1W7P A;  3H3Z A;  1Y0U A;  4L5J A;  2ZKZ A;  1TLH B;  1OKR A;  2H94 A;  5LBQ A;  2H27 A;  4IRH A;  1O3R A;  5L3E A;  2P4W A;  1IXS B;  5HDG A;  2MA3 A;  3DPT A;  3QPT A;  3FF5 A;  1LDJ A;  1MJB A;  2DBB A;  2L54 A;  5K5R A;  2NNY A;  5ICE A;  3FHZ A;  1JHH A;  3F6V A;  2EWN A;  4XBF A;  2YSR A;  2FBI A;  1HKQ A;  3TO7 A;  2QBY A;  4Y13 A;  2M87 A;  3SFZ A;  4RGX A;  3AAF A;  5D6F A;  1LQ1 A;  3ZMS A;  4RAY A;  3KE2 A;  4KNY A;  5IT3 A;  2P5K A;  1L0O C;  2FE3 A;  1S8N A;  1WWX A;  1NHA A;  5D6E A;  1Z6T A;  4G8X A;  1FYM A;  2G7U A;  3QU6 A;  1HST A;  1S6L A;  1P4X A;  5FFZ A;  1QQI A;  1CGP A;  4EM0 B;  4L0Y B;  2MC3 A;  2P5L C;  5HDK A;  1E2X A;  2Y0M A;  3LST A;  2O6G E;  3J7A O;  4WXH A;  3QAH A;  2OU2 A;  3LFK A;  4EM1 A;  4Q5S F;  1SMY F;  2DTR A;  4HQM A;  1ZAO A;  5BMZ A;  1ON1 A;  3SQN A;  4KFC A;  5ICF A;  3QPH A;  2ZME A;  5EEH A;  5DCM B;  1Z91 A;  4HF2 A;  3U2R A;  3WE3 A;  2VBY A;  1QNT A;  2R7F A;  3HHH A;  1YFH A;  1U5T B;  4M73 A;  4KA4 A;  3DPL C;  4IHS A;  3GFJ A;  3T1B A;  2D45 A;  4IRG A;  3ML6 A;  1LJ9 A;  1SMT A;  4CYD A;  5J8F A;  1YYV A;  1YLF A;  3IKV A;  1FT9 A;  3DFG A;  4BNC A;  1ZRE A;  3R61 A;  3G3Z A;  1B1B A;  5D5V B;  2O3F A;  4D0P A;  1FSE A;  1ZG5 A;  1QZY A;  2XRN A;  1YQA A;  3JW4 A;  3RYR A;  2O61 A;  2QM3 A;  5ED4 A;  4OIR F;  1XGN A;  2XAG A;  5E1Z B;  1MZB A;  1BC7 C;  3KLN A;  4UUV A;  5A2Q Z;  1J5Y A;  3ULQ B;  2HFH A;  5F1R A;  2RVC A;  4IJA A;  2VT2 A;  2MBF A;  3BJA A;  3WTT C;  2P6T A;  4TV7 A;  2QQA A;  1O3S A;  3WGG A;  4LK0 F;  4IXA A;  2GXG A;  2LF7 A;  3CJN A;  5LGN A;  4M9S A;  4P96 A;  1RNL A;  3EET A;  5HLI A;  3W6K B;  2JZY A;  1RIO H;  4UHT A;  5LGT A;  3DF8 A;  4ENM A;  2JPB A;  2XKO A;  1D3Y A;  2HTS A;  1FWZ A;  3EYI A;  4YFX F;  4XRF A;  1K78 B;  2ESH A;  2FF4 A;  2W25 A;  4HX7 A;  4EV0 A;  4S04 A;  1KU3 A;  3LQR A;  3HRU A;  2ELH A;  3FMS A;  2K4B A;  2C6Y A;  1EV7 A;  3IHU A;  2OAZ A;  3OOP A;  3K69 A;  3B73 A;  2KKO A;  4KUM A;  3GFL A;  1FBQ A;  4O6J A;  4BXU A;  1RUN A;  3O3K A;  3ECO A;  2P5V A;  5LHI A;  1XDU A;  1OPC A;  1KGS A;  1OR7 A;  5FGM A;  3F8B A;  2XAF A;  3RYP A;  4OIN F;  4L0Z B;  3ZN0 A;  3WTX C;  3I54 A;  5BPI A;  2Z99 A;  4OIP F;  1P4A A;  1R1V A;  2EJR A;  3E5U A;  4EMS A;  2LNB A;  5EEG A;  2FRH A;  4RGS A;  5ICC A;  1SFE A;  1WI9 A;  2E1N A;  5E18 F;  2M8E A;  2PMU A;  3TGN A;  1OYI A;  2JT1 A;  2D1H A;  2VXZ A;  1XCB A;  3Q9S A;  4LLL A;  2EA2 A;  4DQ2 A;  1WRJ A;  4MEX F;  1F1Z A;  4BYY A;  4GYG A;  1IZ1 A;  1ZG3 A;  1Z9C A;  3GYH X;  2O8X A;  2P7V B;  4CDG A;  4HF0 A;  2CFX A;  2XKP A;  3FMR A;  2XV4 S;  3KET A;  1MKM A;  2P8T A;  3TO6 A;  2DT5 A;  1MDM B;  3ISP A;  2EV0 A;  3P9I A;  4YFK F;  4HDU A;  1TQM A;  3RPU A;  3N4M A;  1HW5 A;  2XAJ A;  5DV5 A;  3WG9 A;  1BOA A;  1D8J A;  3JSP A;  2PN6 A;  1KA8 A;  3HRT A;  3VOE A;  2ZJ2 A;  1BN5 A;  3C7J A;  2HR3 A;  4M71 A;  2ZO4 A;  3CO6 C;  3I5U A;  4PGH A;  1IXC A;  3K2Z A;  4HAM A;  3RPQ A;  1Z7U A;  2VON A;  2VBX A;  1I6X A;  3F6O A;  1RZ4 A;  3ZMU A;  1WKM A;  2CSO A;  1QZZ A;  2BE5 F;  4M72 A;  4ESF A;  4L18 B;  2L4A A;  1QO0 D;  3WU1 B;  3V7S A;  5JFR A;  3C1D A;  3GX4 X;  1TBX A;  4R79 A;  5HS9 A;  2Q8K A;  3W6J B;  5LGU A;  5D5W B;  4EJV A;  5LHG A;  4MNU A;  3KZZ A;  3WU0 A;  2PBI A;  2E1C A;  1LDK B;  4XSZ F;  1PDN C;  5DD8 A;  4EJU A;  3M8F A;  1B59 A;  1FX7 A;  2X0L A;  3LA3 A;  2L3D A;  2BYV E;  2CYY A;  2KIF A;  3V8L A;  2ISY A;  3H3U A;  3ZMZ A;  4ESJ A;  3DXJ F;  4AVP A;  1FOK A;  3REO A;  1KYZ A;  1XGO A;  3I71 A;  3F8C A;  1T39 A;  3ABU A;  4LK1 F;  2NRA C;  1FNN A;  1XMA A;  1TW2 A;  1S7O A;  2FEZ A;  3I64 A;  1BI0 A;  5K5O A;  2OA4 A;  5JR3 A;  3V7R A;  2QVO A;  3BDD A;  2PEX A;  5AIP A;  1BI1 A;  2FSW A;  1YW9 A;  5K1Y A;  5D8K B;  4OMY A;  4KMU X;  2JTV A;  2L02 A;  5FB2 A;  2STW A;  4R8H A;  2Z5U A;  3ZMD A;  1EH6 A;  1I5Z A;  1ONV A;  3ECH A;  2DU9 A;  3V4G A;  1MJ9 A;  3ABT A;  3MEX A;  5CVR A;  1G3S A;  1V3F A;  2E7X A;  1YG2 A;  5CVJ A;  4IRI A;  1TTY A;  4YIF A;  5CYV A;  3TDU C;  2UZK A;  2YU3 A;  3DQV C;  4HA8 A;  2K02 A;  3JAM Z;  5LRR A;  2Q2E A;  1I27 A;  3R6S A;  4IPA A;  2H6C A;  5DUI A;  2HS5 A;  3ZPL A;  3TQN A;  3BJ6 A;  3BP8 A;  3BRO A;  2ZFW A;  5L3B A;  1FP1 D;  1HBX G;  5J8C A;  3E6D A;  4CZZ A;  4U7B A;  3R60 A;  5TJJ A;  3SHF A;  2O03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...