3CUQA

Integrated structural and functional model of the human escrt-ii complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
219
structure length
219
Chain Sequence
AQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA03
2DFIA 5LHIA 1IXRC 3LAPA 2L54A 2Z9OA 3CJNA 4Y15A 1RNLA 4NHJA 1QGPA 3GZ5A 2FMLA 3RPUA 4P9UA 2QVOA 3ZN1A 3DXJF 4BAYA 5D5XB 1JGSA 2FSWA 3ZMUA 2Y0MA 4KIFA 1FPQA 1SD7A 2QQAA 3HSRA 1R58A 1R7JA 1AOYA 5HLIA 1FSHA 4ZYDA 2F5FA 1H0MA 1O57A 2M1BA 1AWCA 2ZJ2A 1L0OC 1CF7B 1S3JA 3HOTA 2ESHA 4YG2F 3KP5A 1GHCA 2WWYA 5ILSA 2DAOA 4IJAA 1LVAA 5K5OA 4HDUA 3FHZA 2HEOA 2EJRA 1SAXA 1EH8A 3ELKA 2D45A 2CWEA 5BS6A 3VB2A 3FX3A 4KNYA 2P5VA 1IRGA 3MWMA 4EM2A 1BIBA 4HX4A 3J81Z 3B02A 4I0BA 3GZ6A 2EFOA 4CHUA 1MJBA 1T98A 2M30A 2QLZA 3R61A 4BHBA 3DP7A 3CUQC 3WTZA 3AAFA 2AXLA 5CVIA 4LFUA 2IJLA 4R79A 1G3YA 2QBYB 3JSOA 3FMRA 2JTVA 4OIPF 5LBQA 2QWWA 1CGPA 3E97A 5JVTA 1VTNC 1ZYRF 1BI1A 2XKOA 5H6QA 3DFGA 5L3EA 3T0YA 4LLLA 5ICCA 1RUOA 1TQPA 1UHWA 3GFMA 2XROA 3RJPA 3KCCA 4ESBA 4XLNF 2L3DA 5BPIA 1MZBA 1J75A 2VC1A 1HKTA 4LG0B 4NB5A 2A07F 5AIPA 3TOBA 4M9ZA 3ZMTA 2QQBA 4QWQA 1HSJA 3OOPA 4UXNA 1KU3A 2JZYA 4L5JA 5BOXA 2OQGA 3L09A 1V3FA 2CYYA 4MEYF 5HS9A 4AIJA 3S2WA 3NEUA 2WTEA 1MKMA 3E5QA 1YIOA 1NHAA 2RVCA 2EV6A 1ZG5A 2RV8A 2DPDA 3ECHA 1D8KA 2EFNA 2PG4A 1XSXA 2RDPA 3FMQA 4KIBA 4HX7A 5J8CA 4MTEA 2FBHA 1XGMA 5DEQA 2ZBKA 1D3YA 5LHGA 3QOPA 2VN2A 1P6RA 3T1BA 4ZZLA 1R00A 2DT5A 2H09A 5J8FA 1ZHFA 5D5WB 3MZHA 3K9TA 2VT2A 1O7LA 1QZYA 2M8EA 4IRHA 1KU7A 1MDMB 4KICA 1S29A 3K2ZA 3HTSB 2WV0A 4PGGA 2DBBA 5FD5A 3KZYA 1TW3A 1WWXA 4HOBA 3ZMSA 1IN4A 1IF1A 2IA1A 4JQFA 4UHTA 1YG2A 1HW2A 3HYIA 4KT5C 2JRTA 1OYYA 5LGNA 3O3KA 4RAZA 4LD5A 2ADUA 5BPDA 2Q8KA 2V79A 3Q5FA 4PGHA 2CQKA 1W5SA 4HLYA 4WF2A 1H9GA 3WU1B 4G6DA 1P92A 3V7SA 1ZGAA 3ZMDA 3WODF 2DQLA 3T8TA 2Z5UA 3FWEA 3TO9A 2GA1A 1Z1DA 1HQCA 4HYEA 1R36A 3F8MA 2ELHA 1F1ZA 2J5PA 5ILVA 3ZN0A 5BMZA 1TNSA 1IZ1A 1V4RA 3MFKA 4GGGA 2KJCA 3MCZA 2P5KA 2LDUA 2V1XA 3C1DA 2XAQA 5H20A 3R6SA 1ZG1A 1FP1D 4U7BA 4M6XA 4AIHA 2HFHA 2F5DA 3KZZA 2Q0OA 5D6EA 2FEZA 3ZMZA 2FXAA 2E1CA 1HSTA 1FX7A 2DQRA 2P4WA 4MGRA 3EUHA 1FYKA 3COAC 1FNNA 4YFKF 3ML6A 3HRUA 4A12A 2XGXA 2DK5A 5JHUA 2L02A 1ZRFA 2KIUA 3I64A 4KYWA 3RKYA 1GXQA 2M5WA 2KKOA 4UV9A 1OPCA 4RGRA 3P9IA 3F6OA 5LGUA 4R8HA 3F22A 3V8LA 4OU0A 1R5GA 4I01A 5CLSA 4EMSA 2EWNA 1RZ4A 5ED4A 1SMTA 2FA5A 3H3ZA 3BJ6A 3MEXA 2L4AA 3WGIA 1ZLJA 3L00A 1ONVA 4HDVA 1BOAA 4OIQF 1F5TA 3HRMA 4L9JA 5DD4A 2XAJA 2QENA 2GXGA 3D0SA 3WU0A 3F8FA 4LK0F 2O03A 2A68F 2AS5F 3ULQB 2Z99A 2ZNYA 1O3QA 1ZARA 3GFIA 3IRQA 5J6XA 1SFEA 3DEUA 1FLIA 4KIGA 3R4KA 4ENJA 4WK8F 3GO5A 2BV6A 4HQEA 2VE8A 2K02A 4B09A 3IWZA 2ISYA 1IRFA 4XBFA 4EGZA 1HBXG 2M87A 4RB2C 4L9TA 4ESJA 2VOOA 3E5UA 2GA2A 4RS8A 1DPRA 1ZN2A 4KFCA 2YU3A 1D8JA 4A6DA 1ULYA 2QYOA 2KJBA 3DF8A 5D4RA 2OBPA 4Y17A 5BQTA 4DQ2A 3ZP5A 1MJAA 1FY7A 3CUOA 1P4XA 4M74A 4GYGA 4HV6A 4YFXF 1FOKA 1ZREA 1KGSA 1PUEE 1TTYA 4IHSA 1JXSA 3CDHA 1U5TA 3W6JB 4U0VA 5LLQA 1W7PA 5K5RA 3BJOA 1XMKA 2YPRA 2YX4A 4RB1A 5IT9K 5K5QA 3RKWA 5HLHA 3O6BB 5E1XA 2W84A 3VOEA 3HHHA 5DD8A 3KEQA 2W85A 4GO1A 1P4AA 3R0AA 1T6SA 3SXYA 5HS8A 3V8KA 3E3VA 2HZTA 1DDNA 3GEZA 3ZQ7A 1QPMA 1I1GA 1XMAA 3FF5A 4GXOA 3K69A 3I4PA 4LLNA 5HDNA 3TO6A 3I5UA 3SZTA 2H27A 2LF7A 1T0FA 2TDXA 1A04A 2HQNA 3RDIA 1O3SA 5DDGA 2HKOA 4RGXA 4RGUA 1MJ9A 3LA7A 1REPC 5FLXK 1S7OA 2LF8A 3FXQA 2UXXA 4G6QA 2CSOA 3GUDA 1UCRA 4IRIA 1HKSA 1XB4A 4N9HA 2ZMEA 2H94A 3KEOA 4M73A 4HQMA 1B9NA 3N4MA 4ZYGA 1Y0UA 2GAUA 3M9AA 4PDKA 1EH7A 4ZZDA 3C18A 1OMIA 5L3DA 3IKVA 2JPCA 3F3XA 5IT9Z 2FU4A 2MH9A 3SFZA 1OYIA 2VODA 2DU9A 1K78A 4IPAA 3DV8A 3V8JA 2RQPA 3VEPA 2X0LA 2V9VA 3T8RA 2DPUA 3I59A 4LJZF 3V7CA 1IXCA 2UZKA 2DTRA 5D8LB 1ZH5A 3GF2A 5IT3A 5FB2A 4EM0B 2VC0A 5LEKA 4PCQA 3F8BA 1T39A 5HVQC 1XGSA 4M71A 5F1RA 2Z3YA 1BIAA 2O3FA 5E1WA 4EJTA 1PP7U 3HOSA 5E20A 2LSOA 2BE5F 4U0WA 3HUGA 4L9NA 5FLXZ 4FHTA 2K4JA 4YIFA 3F8NA 1KA8A 5CVUA 1BI3A 3TKYA 3DPLC 2GXBA 5FGMA 4G7OF 3SZPA 3G3ZA 1R1UA 2UXNA 5F64A 2GIVA 1LQ1A 2HDCA 3PQKA 2STTA 3BY6A 4BH9A 2A6HF 4A2UA 2YSRA 3LQRA 2X4HA 1O3TA 3M8FA 4XLPF 4L0ZB 2K27A 1FBQA 3R60A 1R5HA 4OINF 4OIRF 1PDNC 1LJ9A 2IA2A 4A0ZA 6PAXA 4LK1F 3KE2A 1BI2A 3B73A 1MGTA 3C3WA 4EJVA 2K7LA 4KN7X 5D5VB 2VOPA 4LGWA 4OMYA 5CVRA 1U78A 3CLOA 3KFWX 3LSTA 4JK1X 4G9YA 3WGGA 2XAFA 2HOEA 3H3UA 2PJPA 5JFRA 4Y13A 1LDDA 4WXDA 1HW1A 1KU9A 5ERIA 3ERED 2O0YA 4EJOA 3WTYC 4IRGA 4UUVA 2W57A 4KUMA 4A0XA 1Z6RA 3M7GA 1WQ2A 3DPTA 3HSEA 5DCMA 4MEXF 3TO7A 2FNAA 2W24A 2NAZA 3IC7A 1SD6A 2IPQX 4HF0A 1LDJA 1EH6A 2MH2A 4A5NA 4WXHA 3E6MA 1STZA 3J80K 5L3CA 3E5XA 2QQ9A 1O7FA 3EYIA 1Z91A 2VBXA 1BN5A 1JHFA 2E1NA 1YS6A 2NNNA 2GWRA 4LB5A 5E8GA 5JR3A 3WGHA 4HAMA 2Y75A 1IXSB 1TQMA 4O5VA 5DYMA 3L2CA 4KMFA 1BC8C 1IN8A 2MLKA 4PZJA 2FBKA 5JI6A 4I09A 4LMYA 2XVCA 3FXRA 4P96A 4AVPA 2ZFWA 3QPTA 3DQVC 1B4AA 4LB6B 4Q48A 3WTWC 1I27A 1YFHA 1EV7A 1KQ8A 1UB9A 4I7HA 5DCFA 3GXOA 2NNYA 1R1VA 5CJ9A 2STWA 4N0BA 2YR2A 4Q5SF 4XRFA 2FNPA 5CVJA 4O3MA 5DUIA 1LNWA 1OKRA 2D2WA 4BHCA 1U8RA 1J59A 3P9CA 3I53A 3M8EA 1J5YA 2DW4A 1DUXC 2MC3A 1FP2A 5LRSA 3CUQA 4UNOA 3GFLA 4CDGA 1FSEA 3KP4A 5D8KB 5HS7A 3WTTC 4FT8A 2V1DA 3ZMVA 1J2XA 4NQWA 3SQNA 3TDZC 2MBFA 2R7FA 3J80Z 2D1VA 2CO5A 4KN4X 3E6BA 4ENNA 1BBYA 4JBAA 2XV4S 4KMUX 1XCVA 2OQRA 3OV8A 3FXUA 2MD5A 1WSUA 2F5EA 1S8NA 1XD7A 1YS7A 1XSDA 1BM9A 1BI0A 3I58A 1CF7A 2O61A 5K1YA 1FYLA 3O2PE 4S05A 4U88A 1Z7UA 1RUNA 3NRVA 4EJWA 1G4DA 2XAGA 2OAZA 1FZPB 4QLCU 5TRDA 3HTUA 4N9IA 2XASA 3FM5A 3K1PA 4EQQA 1QBJA 4S04A 2YX7A 4Q4ZF 1XSVA 1UHMA 5DCMB 3EETA 3K0LA 5HOOA 2E7XA 4P9FA 5KK1A 2W25A 3KP3A 1I5ZA 4I0AA 4UVBA 4UV8A 4RB0A 2V6CA 4MHGA 1L3LA 2QBYA 2GQQA 3MZYA 3TQNA 2HYFA 3GVAA 1B1BA 3F6VA 1B9MA 3WTUC 2A3SA 3ROUA 3HIFA 3ECOA 2JSCA 1RI7A 2IA0A 2VT3A 2CG4A 2VBWA 1IN7A 4ZYHA 4FX0A 2ZKZA 4CYDA 2Y48A 4BXUA 2HR3A 1JE8A 4LG0A 2QZ8A 3LFKA 3F21A 2ZNZA 3P7NA 3QPHA 2FMYA 4CGZA 2FOKA 4ENMA 4EV0A 2CW0F 2OA4A 2IRFG 2ZO4A 2PBIA 3ZPLA 4ON0A 1T38A 3L9FA 4RAYA 4WX9A 1R1TA 3RYRA 3JW4A 5D5UB 2ZCWA 3KP7A 2QM3A 4EGYA 3TOAA 1K6OA 2XIGA 4ESFA 3BPVA 2KRFA 1W4MA 2DO7A 2EV0A 4FX4A 3BJAA 2EA4A 2PN6A 3JAMK 2HTJA 3WG9A 3L7WA 1ZAOA 2PMHA 1SMYF 1KYWA 5A2QZ 3CTAA 1J9IA 1R22A 4G7ZF 5LHHA 3BWGA 2P7VB 3EQLF 5FD6A 3IL2A 5TJJA 2RGVA 2WC2A 2HGCA 4CO8A 1MDMA 1U2WA 2XRNA 2OU2A 2HKXA 2DLLA 4CXFA 4Q47A 2F2EA 2ESNA 1TW2A 4ZH4F 1FT9A 4GCVA 1I6XA 1USSA 1YW9A 2XAHA 3K1NA 2LNBA 2COMA 3RTRA 1PP8F 3KLNA 1Z6TA 3FM3A 3WTXC 1KQ9A 4EJUA 4BHPA 3J7AO 1WRJA 2A5YB 4P55A 1WI9A 2OD5A 3WE3A 2VBYA 3I0TA 5EEGA 2EV5A 1YYVA 3RPQA 2EB7A 1IN5A 4Z2YA 3ABUA 1F4KA 1ZLKA 1GXPA 1XN7A 2FBIA 3QU6A 4BNCA 2EK5A 3I71A 2O6GE 2IP2A 2J5OA 1SD5A 4DNCA 4M9XA 4HLXA 1D5VA 1IUYA 3K1MA 2FQ3A 3F8CA 1J7KA 1RIOH 1I1SA 3JAMZ 4H0EA 2PFBA 2MLGA 4BYYA 3JSPA 3DKWA 4G8XA 1U5TB 2A61A 5FFXA 3SHFA 2L4MA 4EM1A 3BP8A 3FMSA 1W7PB 3U1DA 3RIRA 5KVRA 3QP5A 1H9TA 1YTYA 5FFZA 1ODDA 3LA2A 1KQ0A 2P8TA 4MQVA 4CICA 2FRHA 5HDKA 3V7RA 3PFIA 3G73A 3RKXA 4IHTA 1C0WA 4L9VA 1TLHB 2OZ6A 4YIIA 5DUKA 4HW0A 1HKQA 1HW5A 2BEOA 2VBZA 2RNJA 1LB2A 1KYZA 4B8XA 1E2XA 5LRRA 5E18F 1Z9CA 1ZRCA 4I2OA 3QRFF 2CGPA 3QP6A 2VXZA 4MNUA 5LGTA 4E70A 2KIFA 1W5TA 2B0LA 5CYVA 4KDPA 5E8IA 1DPUA 4YFNF 4KA4A 1G6NA 2C6YA 1OR7A 3V4GA 1QNTA 1XGNA 4D0PA 1B6AA 4IXAA 4I02A 3MAJA 4XSZF 2IVMA 5D6FA 2HYGD 3KLOA 1ZGJA 5E17F 5DV5A 5EEHA 3RYPA 4I98B 5D4SA 1B59A 1MD0A 1Q1HA 1IW7F 2HQRA 4CZZA 3Q9SA 3GW2A 1JHHA 3I54A 2PQ8A 4WWCA 3BOQA 1R23A 1YQAA 5FO5A 3GLXA 1O3RA 5F6FA 2ZMEB 3WTSC 1U5TC 5ICFA 2Z33A 5H6RA 3HRTA 5L3BA 2O8XA 1SD4A 3KP6A 3E6CC 1FYMA 3MQ0A 3P9KA 3IHUA 3Q9VA 3F23A 4ASNA 1YO5C 3FZVA 2UWMA 3GFJA 3QU3A 5ICGA 4U0YA 3REOA 3IKTA 4M9SA 1LEAA 4U7DA 4L0YB 4MQ9F 1XDSA 2JT1A 1K78B 1U6GA 2GZWA 3U9GA 2E7WA 4RB3C 4HZFA 2PMUA 4R1HA 2L01A 3LA3A 2PI0A 3I59B 2H6CA 4ETSA 1QQIA 3LAJA 1TNTA 2HWVA 1U3EM 1QZZA 5HDGA 1K79A 1T2KA 2FE3A 3T5XA 3CO6C 2LKPA 2Q2EA 4OIOF 3HSFA 2NRAC 1TQIA 3VFZA 3LWFA 4A6EA 2EFQA 1IAWA 1G3SA 2VE9A 3BPXA 2FF4A 2V1UA 2P5LC 3GYHX 4LLGF 1K7AA 2CFXA 2K4BA 4XSXF 2HS5A 3GX4X 1G3TA 4F7ZA 4G94A 1KU2A 1YW7A 2D1HA 4HBLA 2EA2A 4HV5A 1XGOA 3IRRA 4OOIA 2XKPA 2R7DA 2IW5A 2EFWA 1YW8A 1BJAA 3F72A 4AIKA 1SFXA 4UVAA 1XCBA 2PEXA 4OMZA 4WXCA 3PQJA 3M1EA 1X3UA 5CVVA 2IT0A 1DP7P 1J0RA 3LQQA 2G9WA 1TBXA 2R3SA 4HA8A 1ZG3A 4IF4A 4O6JA 1E17A 3R0JA 2RKHA 4MTDA 3RI4A 2DI3A 3JTHA 1P4WA 1FWZA 3U2RA 2KIMA 5L3GA 3WE2A 4EVIA 1S7AA 5L3FA 2ETHA 2NS0A 3TGNA 1BC7C 3D5LA 1G3WA 5E1ZB 5LEJA 1W7PD 1LEBA 2A69F 4GYIA 2BGCA 1S6LA 3C7JA 4K2EA 4ZYEA 2RN7A 1P2FA 5AIQA 4UVCA 2ACJA 4WCGA 1ON2A 4ENKA 3JTGA 2VONA 4M6YA 4G7HF 2HTSA 3IWFA 5HLGA 2G7HA 1IN6A 1FBUA 3QAHA 5A2QK 2K86A 3GWZA 3BROA 4L5IA 1F9NA 4RGSA 1Z05A 5ICEA 2ISZA 2NYXA 2P6TA 3EDPA 2EFPA 4A0YA 3N97A 1HXDA 2H6BA 2PLYA 3CO7C 2P6SA 1XDUA 3ABTA 1FBSA 5AONA 3BDDA 2P7CB 2F5CA 3KETA 1FC3A 2XHKA 2DK8A 3EYYA 1YLFA 2OZUA 4TV7A 1WKMA 2BYVE 1OYWA 3E6DA 5ILUA 4L18B 3W6KB 2ZXJA 3BZ6A 4HF2A 4M72A 1ON1A 3TDUC 4AWXB 4P5OA 3HRSA 3KP2A 1USTA 3J81K 2JPBA 2A6EF 2XUBA 1UFMA 4AD9A 4BQAA 2MA3A 1GVJA 4IVNA 3VODA 4HF1A 3H92A 1ZRDA 2BBYA 3ISPA 3CUQB 2QUFA 3NQOA 4A5MA 3WTVC 1SFUA 2G7UA 1QO0D 3HHGA 4HX8A 2RC4A 1LDKB 2M45A
chains in the Genus database with same CATH superfamily
1YHQI 2DFIA 5LHIA 1IXRC 2XDVA 3LAPA 4F91B 2JA5J 2JQ7A 2L54A 2Z9OA 3CJNA 4Y15A 1RNLA 4NQWB 4A3KJ 4NHJA 1QGPA 4ZTFA 2L9RA 1WZ2A 3GZ5A 2FMLA 3K4LA 3DTKA 1R4NB 3RPUA 4P9UA 2QVOA 4NBQA 1VQMI 3X2QH 3JRIA 3QQAA 3ZN1A 3DXJF 4BAYA 5D5XB 1JGSA 2FSWA 3OYCA 1GV2A 4S0HB 1LE8B 3ZMUA 1A36A 2CQQA 2JRMA 2Y0MA 1BOBA 4KIFA 2ECCA 4IOCF 1FPQA 1SD7A 2QQAA 3VPRA 5H2FC 3HSRA 1R58A 1R7JA 1AOYA 4UUTA 5HLIA 1FSHA 2WY7Q 4ZYDA 2F5FA 3OIQA 1W0TA 1LKXA 2GIZA 5IYCJ 2DOFA 3DPUA 1H0MA 1O57A 2Y30A 2M1BA 4CYCB 4IQJA 1AWCA 2ZJ2A 1L0OC 2TRTA 3CC2I 3D5RC 1CF7B 1S3JA 3HOTA 2ESHA 4YG2F 3KP5A 1GHCA 2WWYA 4XKVA 5ILSA 2DAOA 5J1UA 4IJAA 1LVAA 5K5OA 4HDUA 3FHZA 1ZTRA 2HEOA 2EJRA 1SAXA 1EH8A 3ELKA 2D45A 3OSFA 1TT5B 2CWEA 2EIJH 5BS6A 3CCLI 2ELKA 2Z1DA 3VB2A 4C2UA 3FX3A 4KNYA 4DZJA 2P5VA 1IRGA 2BY2A 1I6HJ 3MWMA 2CQXA 4EM2A 2NOGA 1BIBA 2NS7A 4HX4A 3J81Z 5DS9A 2WV1A 3B02A 4I0BA 2JUCA 3GZ6A 4XQFA 2FQ4A 3O8HA 3KEYA 2EFOA 5FKNA 4CHUA 4FETA 2LY9A 4A3LJ 4RLFA 5FLMJ 3AKZA 1MJBA 1T98A 2M30A 5LFAA 3K2AA 2Y69H 1DQUA 3C2BA 4AVZA 2BXYA 3CF2A 2QLZA 3R61A 4BHBA 3DP7A 3CUQC 4CCMA 3WTZA 3AAFA 3PNVA 3P5JA 2AXLA 5CVIA 4LFUA 2IJLA 4R79A 1G3YA 2QBYB 3JSOA 3FMRA 2JTVA 2VPRA 4Y4RA 2DFEA 2H8WA 2CUZA 4OIPF 4NC6A 2QWWA 5LBQA 2L7ZA 3E97A 1CGPA 5JVTA 1VTNC 1S72I 3OMYA 1UHSA 1EKEA 1ZYRF 1BI1A 3I4MJ 3OYBA 1YOVB 1X1BA 2XKOA 2MFZA 5H6QA 1E3OC 3ZCOA 1SC7A 3DFGA 5L3EA 3T0YA 3TP3A 3MKWB 4LLLA 3FKJA 5ICCA 1ETYA 5M5YJ 1RUOA 1TQPA 1UHWA 3GFMA 2XROA 3RJPA 3KCCA 3ZQQA 4ESBA 4XLNF 3BTLA 4Y7NJ 2L3DA 4XN0A 5BPIA 1XS9A 5TGTA 1YI2I 4G6TB 1MZBA 1J75A 2VC1A 3VSLA 1HKTA 4LG0B 4NB5A 3HBLA 1G8XA 2QKLB 3TBIA 4F52A 5AIPA 3TOBA 4M9ZA 3ZMTA 1B8IB 2A07F 3ONQA 2QQBA 3S93A 4QWQA 1HSJA 3KYCB 3LSJA 3OOPA 4UXNA 4BDZA 1KU3A 2JZYA 4L5JA 5BOXA 1Z3YA 4I99C 2OQGA 3L09A 4CCOA 1V3FA 5J4VA 1XG1A 2K9NA 2CYYA 2KIQA 4MEYF 5HS9A 2O5RA 2L9SA 3S1MJ 4AIJA 3S2WA 3M1CA 3NEUA 2WTEA 1MKMA 3HKZA 3E5QA 1YIOA 1RR8C 2BZTA 1NHAA 2E1MB 2RVCA 4E7IA 2CUEA 1N78A 2A05A 2EV6A 1ZG5A 4XM3A 3OYGA 2RV8A 1X4PA 2DPDA 3HOXJ 1F36A 3ECHA 4XLEA 1D8KA 5EYRA 5CKTA 2FD5A 1QU3A 2EFNA 2LRDA 2PG4A 3W2VA 1XSXA 3NWSA 2RDPA 5FRNA 3FMQA 4KIBA 4HX7A 2M2EA 1IRXA 2X85A 5J8CA 4MTEA 2JA8J 3C2HA 1MIJA 1MMSA 1WJBA 2FBHA 1G59A 1XGMA 1FIAA 5DEQA 2ZBKA 4B3AA 1Y0NA 2DFHA 3RQ4A 2MW8A 2ME6A 3JRAA 1D3YA 3CCUI 3A03A 1WJ5A 1NK3P 1R6RA 2Y2ZA 2M7BA 4CCLA 5LHGA 5J40A 3QOPA 2VN2A 3HEFA 3GCMA 1P6RA 2IXSA 3T1BA 3F9KA 4ZZLA 1R00A 2DT5A 2H09A 5J8FA 4BEHA 4UB6C 1ZHFA 2H8RA 5D5WB 3MZHA 3K9TA 4BUPA 2VT2A 1FTTA 1O7LA 2KZGA 1QZYA 1OLTA 4AYBA 3CCRI 2M8EA 2E2IJ 1FEXA 4IRHA 3LSRA 1H8AC 1KU7A 2NXNB 5E3MA 1MDMB 2P0WA 4JX4A 4KICA 1S29A 1ZELA 3TW6A 3OYAA 1ZGWA 3K2ZA 4ZDLA 3VWBA 5EZHA 2LBFB 2VQCA 1VZ0A 4XIDA 3HTSB 2WV0A 4PGGA 3OY9A 1U8BA 4IX7A 3CD6I 2DBBA 5FD5A 3TP0A 3KZYA 2XF7A 1TW3A 2X9DA 1WWXA 4HOBA 4II3A 3QOEA 3ZMSA 2GBYA 1IN4A 4F93B 1IF1A 4HEA2 2IA1A 4JQFA 4UHTA 1YG2A 1HW2A 4XRSA 3HYIA 1Z77A 2QCOA 4KT5C 1PUFB 2JRTA 1OYYA 3HOVJ 3GZNB 2JVGA 3O3KA 5LGNA 4RAZA 1JUSA 4LD5A 2ADUA 5BPDA 4AU7A 2ELJA 2H1LA 2Q8KA 4BKXA 2V79A 3LL7A 3I4NJ 2E60A 3Q5FA 1TWFJ 4PGHA 2CQKA 5DM7F 4W1UA 1W5SA 2R7QA 1VQKI 4HLYA 4WF2A 2LTPA 1H9GA 3WU1B 4G6DA 2HDWA 2E19A 1P92A 3V7SA 1ZGAA 1W1WE 3ZMDA 4M3FA 4PFPA 5B1BH 3V42A 3BR1A 3WODF 5E3LA 2DQLA 3T8TA 2Z5UA 3FWEA 3TO9A 2L5QA 3WHBA 2GA1A 3AL0B 1Z1DA 1HQCA 4HYEA 3VDXA 1SANA 1R36A 3FXOA 3F8MA 4LIVA 2ELHA 1F1ZA 2J5PA 5ILVA 3ZN0A 3K70D 2BHZA 5BMZA 1JT6A 1TNSA 3SJMA 2P81A 1IZ1A 1V4RA 4GGGA 2KJCA 3MCZA 1I3AA 1MH3A 2P5KA 4RAFA 3MFKA 1Y8QB 2LDUA 4XKBA 2M34A 3G1MA 2V1XA 3C1DA 3A01A 2XAQA 1CQTA 5H20A 3R6SA 1ZG1A 1FP1D 3S3NA 1Z3XA 1Z7LA 4U7BA 3EUAA 3FBNB 1HCRA 4M6XA 4D7NA 4P1WA 1OCTC 4L5EA 3CMYA 3HPGA 3ZRGA 4AIHA 2DOEA 2HFHA 4Z6YA 2F5DA 4AIDA 3KZZA 2Q0OA 2JJ7A 2RNGA 3SFIA 5HLTA 4DBQA 1QPIA 2M4GA 1IG7A 5D6EA 1D1BA 2FEZA 3ZMZA 2FXAA 1PJRA 2E1CA 3HM5A 3JRDA 1MNEA 3QYBA 5M5XJ 4KJZA 3CJQB 1FX7A 1HSTA 2DQRA 1WJEA 2K9QA 2P4WA 4MGRA 3ZR8X 2CU7A 4MLOA 3OSGA 3EUHA 3GLLA 2R7RA 1FYKA 2CW7A 4XLFA 3COAC 1QA6A 3GTQJ 2X1DA 1FNNA 4YFKF 1YJWI 3SEZA 3ML6A 3OL4A 2R0QC 3HRUA 4A12A 1ETOA 2F5VA 2HVSA 2XGXA 2X1CA 3OWTA 2OV7A 3CESA 4IHXA 2DK5A 2WAEA 5JHUA 2L02A 5EG0A 2ZFUA 4HG2A 1JUPA 4BDYA 1ZRFA 1TZLA 2QEXI 2KIUA 3I64A 2XGCA 3OIPA 3J7ZI 4KYWA 3DEWA 3RKYA 1VFCA 2YU9J 2HVRA 1GXQA 2M5WA 2KKOA 4UV9A 1OPCA 4RGRA 3P9IA 3S14J 3F6OA 5LGUA 2DMUA 4R8HA 3F22A 3IP4B 3V8LA 3ZQIA 2CUJA 1R5GA 4I01A 4OU0A 5E79C 4MFDA 2W4SA 2FJ1A 5CLSA 4X1EA 4EMSA 2EWNA 2ZC2A 2XF6A 1RZ4A 4C30A 5ED4A 3BG3A 1SMTA 2FA5A 3H3ZA 5F04A 3BJ6A 3MEXA 4BQNA 2L4AA 2Y9ZA 1VQ9I 2PJRA 3WGIA 3QPLA 2YUSA 1ZLJA 3L00A 1ONVA 2DYSH 4FQGA 1BOAA 2DA3A 4HDVA 1APLC 2EINH 4OIQF 3UKGA 1F5TA 3K4CA 3HRMA 4L9JA 5DD4A 1TL8A 2XPWA 1T8IA 2XAJA 1SVMA 3GMEA 3RSNA 3OYNA 4PSWA 4E7HA 1QHGA 1SVOA 2GXGA 1WJFA 1OCCH 2KL4A 2QENA 3D0SA 3WU0A 4DGWB 3AL0C 3F8FA 2R7VA 4LK0F 3PO3J 2O03A 3MD2A 2A68F 4ABZA 2AS5F 4GFBA 5EEAA 3ULQB 2Z99A 3DTIA 3H9JA 4JOMA 1IJWC 1WGXA 4FISA 3OS1A 1XC5A 2ZNYA 2AQFA 2B7EA 1TC3C 3VYTB 1O3QA 1ZARA 2L2OA 2HOSA 3PFYA 3GFIA 2Z2SB 3OR1C 5F0CA 3IRQA 1R71A 1I39A 1D1AA 2DMQA 4BBRJ 2VKVA 4MFEA 3QYEA 4CCNA 5J6XA 1SFEA 2LOOA 3DEUA 1FLIA 5B3SH 4XKWA 4KIGA 4H4KC 3R4KA 4XLAA 2QA4I 4ENJA 4WK8F 3GO5A 2BV6A 4HQEA 2VE8A 2K02A 2X6XA 4B09A 3IWZA 2ISYA 1QHHD 1IRFA 2XGEA 4XBFA 4D1QA 4EGZA 1HLVA 2DN0A 1HBXG 3H0DA 2M87A 5IP9J 5J1YA 4RB2C 4L9TA 4ESJA 1RC9A 3E1SA 2VOOA 3E5UA 2GA2A 1ZKGA 4RS8A 4IL6C 1W36C 1DPRA 1RKTA 3DBLB 2NVQJ 3WHCA 1ZN2A 1ZK8A 2YU3A 4KFCA 1D8JA 4A6DA 2B63J 2AHQA 2JUGA 1ULYA 2QYOA 3BR0A 2KJBA 3DF8A 5D4RA 2OBPA 3B6AA 4Y17A 5EF6A 5BQTA 5GAGJ 4DQ2A 3ZP5A 1MJAA 1FY7A 4UUSB 3CCYA 3CUOA 3LSKA 1P4XA 3BR2A 4GYGA 4HSRA 4HV6A 3CZ6A 4M74A 2K3PA 4YFXF 1FOKA 4AUXA 3ASOH 1ZREA 1T56A 1KGSA 1PUEE 2OCEA 1TTYA 4HRIA 4IHSA 1JXSA 3CDHA 3BZKA 1U5TA 2MGQA 2MG4A 3W6JB 5JHFA 4LIUA 4U0VA 1NH3A 3Q0VA 2Q2EB 2R7XA 5LLQA 2HXOA 1W7PA 5K5RA 4BY7J 3BJOA 1XMKA 1B72B 2YPRA 2YX4A 4RB1A 1DGRM 4BBSJ 5IT9K 5K5QA 2EPFA 3RKWA 1Z21A 5HLHA 3O6BB 2WAFA 4DOZA 5E1XA 2W84A 2E34A 4BGDA 2HDDA 3VOEA 3HHHA 3BCBA 1HA8A 5DD8A 3KEQA 2W85A 3PSFA 1QRYA 4GO1A 4OAZA 4IHWA 5J3LA 4A3DJ 1FMWA 1JKOC 1P4AA 1WJAA 2E2HJ 4ZTJA 3HPHA 3BTCA 3R0AA 4BQQA 1T6SA 1YJNI 3SXYA 5HS8A 3V8KA 5IYBJ 3E3VA 3KPHA 2HZTA 1DDNA 3GEZA 3ZQ7A 1VF9A 1QPMA 1I1GA 1XMAA 3JRHA 3FF5A 1N25A 4GXOA 3K69A 2KP6A 3K4KA 3TMOA 1BA5A 3I4PA 4LLNA 1HC8A 3G6EI 5HDNA 1BW5A 1JJ8C 1YRNB 1P7IA 1HDPA 3TO6A 3I5UA 3OL3A 3SZTA 4B3XA 1W5CC 3HGGA 2L0KA 2H27A 2LF7A 1VQ4I 1T0FA 2BY0A 2TDXA 1A04A 1S5LC 2HQNA 1X3WB 3RDIA 1O3SA 2XPUA 1PVEA 5DDGA 3MZ8A 4QPOA 2IS2A 3S8PA 2HKOA 4RGXA 3PNTA 4RGUA 2M9HA 3CDLA 1MJ9A 3LA7A 1REPC 5K7FA 1R4MB 5FLXK 1S7OA 3I55I 3BR5A 2CW8A 3WG7H 4D5CA 1P7JA 3Q0UA 4BJ5C 2LF8A 3FXKA 3FXQA 4BQOA 5LD2C 2UUZA 2UXXA 4G6QA 2CSOA 3GUDA 1GLNA 3LSHA 1UCRA 4IRIA 1RR7A 1V5GA 1HKSA 1XB4A 4NDLA 5JVGF 3OIOA 4CA0A 3S1RJ 1VQOI 2X6WA 4OWRB 2WADA 4ZJZA 1XMXA 4N9HA 2V4JC 3JRFA 2ZMEA 2H94A 2GXAA 1W0UA 3KEOA 4M73A 5CPRB 4HQMA 2KLOA 1HF0A 2XPVA 3ZXSA 1B9NA 3JCUC 1A5JA 1X19A 3N4MA 4CCJA 4ZYGA 1Y0UA 3UNGC 2GAUA 3M9AA 2IGNA 3CCVI 2LFBA 4AC0A 1J09A 1ZQ3P 2R5YA 4PDKA 3HOUJ 3OYEA 3FKIJ 1A31A 5FLVA 1EH7A 1WPKA 4ZZDA 3IAM2 3C18A 1OMIA 3M07A 2DDAA 2HPMA 2DA4A 1FOWA 5L3DA 5HNFA 2ZXIA 3IKVA 1F43A 2JPCA 3F3XA 5IT9Z 3A02A 5IOYA 2FU4A 2DA7A 1DU0A 2MH9A 3SFZA 2FOWA 1OYIA 2VODA 1OCZH 1U9OA 2DU9A 4DBRA 3NARA 3HKZN 3BG5A 5EGOB 3CCMI 1K78A 3CP2A 4IPAA 4GDFA 1MBFA 3DV8A 3V8JA 2RQPA 1IV6A 3ZQLA 3VEPA 5M5WJ 1NTCA 2X0LA 2V9VA 3T8RA 2DPUA 3BTIA 2ZXWH 1A6QA 1SEUA 3I59A 2IAIA 4LJZF 3V7CA 4EATA 2ZXHA 1IXCA 3H36A 3JRCA 5E3OA 3ESWB 2KPMA 2UZKA 2DTRA 3ABKH 2XSDC 1KONA 3EUHC 3OYKA 2F6CA 2W82A 4PFOA 5D8LB 1ZH5A 3GF2A 2ZJRF 1D0YA 1SVLA 5IT3A 5FB2A 4EM0B 4IKFA 2VC0A 5LEKA 4PCQA 2R7ZJ 3F8BA 2I10A 1T39A 5HVQC 1VQ6I 5F1JA 1XGSA 3C2GA 4M71A 1WFXA 3L2WA 4DJAA 2OPTA 5F1RA 2Z3YA 1BIAA 2O3FA 2VLAA 2W1OA 5E1WA 4EJTA 1PP7U 1OFCX 1QVUA 3PIPF 3HOSA 5E20A 2LSOA 2BE5F 2XSJC 4U0WA 1ETXA 2K9SA 3CJRB 3HUGA 4L9NA 3VYRB 5FLXZ 4FHTA 4BL0B 2K4JA 4BJ6C 4AYBN 4YIFA 3F8NA 1KA8A 3PM1A 5CVUA 2R5ZB 2GOMA 4QIWN 1BI3A 1JTXA 3TKYA 3DPLC 1K4SA 3PNYA 3N05A 2GM4A 2GXBA 4XOPA 2CV0A 5FGMA 4G7OF 3SZPA 2K5CA 3G3ZA 1R1UA 3EUKL 3VYSB 4XKCA 2UXNA 5F64A 2GIVA 5FRMA 4RA2A 2IGOA 1T08B 4B1RA 1LQ1A 2XB0X 2HDCA 2OJED 3FXJA 3PQKA 2STTA 3BY6A 2HI3A 1WJDA 4BH9A 2A6HF 2NVTJ 9ANTA 4IHYA 4A2UA 2YSRA 3LQRA 2X4HA 2EIMH 4BY1J 2FX0A 1D5YA 3K10A 1O3TA 3RQIA 3M8FA 4XLPF 1Y1VJ 4II2A 4L0ZB 1Z0XA 2K27A 3TEDA 3PIOF 1FBQA 3HZJA 3R60A 1YITI 1R5HA 1WJCA 4OINF 3SDBA 5M3MJ 2L9VA 4OIRF 4E7JA 1PDNC 1LJ9A 2IA2A 4A0ZA 3QWLA 5K7HA 4XICA 6PAXA 1SFOJ 1VQNI 5EDNA 4RM3A 2OCCH 3U21A 3ZQGA 4LK1F 3KE2A 1BI2A 3ZQFA 3B73A 1BL0A 1MGTA 3C3WA 4E7ZA 4EJVA 4Y33A 2DJNA 1EJ9A 3GTKJ 2K7LA 4FE7A 4KN7X 2E36A 1FOYA 5D5VB 3OS2A 2VOPA 2V1NA 2BXZA 4LGWA 4OMYA 3ZQCA 1TWHJ 5CVRA 1Q1VA 2LKSA 1U78A 3KYLA 3CLOA 3KFWX 3LSTA 4I6ZA 2HPIA 4JK1X 3DEEA 3W2AA 1T33A 4G9YA 3WGGA 2XAFA 1R5ID 1V54H 2HOEA 2FUG2 3H3UA 2PJPA 2KMUA 4C2MJ 5JFRA 3BG9A 2XAUA 4Y13A 2EIKH 1LDDA 4WXDA 4IZZA 1UAAA 1AA7A 1HW1A 3BZCA 1KU9A 5ERIA 3ERED 2O0YA 5GAEJ 1S7EA 3BC8A 4EJOA 2DXIA 3J7YJ 3JRBA 1WI3A 3WTYC 4IRGA 2V7FA 4UUVA 2V6EA 2W57A 4KUMA 4A0XA 4DIQA 1Z6RA 4PJNA 4V2GA 3M7GA 3I9V2 2AO9A 1WQ2A 2Y0SA 3HC7A 3DPTA 3HSEA 1ACIA 2R7SA 5DCMA 4MEXF 1ETQA 1MH4A 1V5FA 3TO7A 2M3AA 2FNAA 5IYDJ 2W24A 1TT0A 3CCEI 2NAZA 3IC7A 4HNVA 1SD6A 2IPQX 4HF0A 1LDJA 1EH6A 2BW3A 1OCOH 2MH2A 4A5NA 2EQRA 2D5VA 4B47A 2DJIA 4WXHA 3E6MA 1OCRH 2LY2A 3A0BC 4BE2A 1STZA 5CQGA 3J80K 5L3CA 3E5XA 2QQ9A 3DLAA 4CH7A 1O7FA 3EYIA 3ERMA 1Z91A 3W2WA 3GTOJ 2VBXA 5FKMA 1BN5A 1MMGA 1JTYA 3CMAI 1JHFA 2E1NA 3OYMA 1LFPA 1YS6A 2NNNA 2GWRA 4LB5A 5E8GA 1RRJA 5JR3A 3WGHA 3HB9A 2Y75A 4HAMA 2HOTA 1YE9A 1MSFC 1IXSB 1TQMA 1D1CA 1WHUA 4O5VA 5DYMA 2CV2A 3L2CA 4KMFA 1BC8C 1AKHA 4F92B 5FKLA 1IN8A 2MLKA 2E35A 4PZJA 4CUGA 2FBKA 2VJIA 5JI6A 4I09A 4XK4A 4LMYA 3IAS2 2XVCA 3FXRA 4P96A 4AVPA 3FBIB 1RPWA 3S15J 2ZFWA 3QPTA 2A6TA 3DQVC 1B4AA 4LB6B 4Q48A 2LY1A 3WTWC 1I27A 1YFHA 1EV7A 1QVTA 4C2TA 4ITVA 1KQ8A 4YELA 2L7KA 1T0FC 1LFBA 1UB9A 3HOYJ 3H9GA 2B9SA 4I7HA 5DCFA 3GXOA 2NNYA 1R1VA 5CJ9A 2STWA 3KZIC 4N0BA 2YR2A 3DLLF 4Q5SF 4XRFA 3VSKA 2FNPA 1OCPA 1UZCA 5CVJA 4O3MA 5DUIA 1LNWA 2CFOA 3K4MA 4M3EA 2DYRH 1OKRA 2D2WA 1SFKA 4HNTA 2Q1ZB 4BHCA 4PJLA 1U8RA 1J59A 4HNUA 1JI8A 3DWLE 3P9CA 5FKKA 3I53A 1X1AA 3M8EA 1J5YA 2DW4A 2R7TA 1DUXC 2EH3A 4J00A 2MC3A 1I50J 1FP2A 5LRSA 4KT6A 3CUQA 2ZMEC 2JA7J 4UNOA 3GFLA 1G2HA 4CDGA 1FSEA 4B43A 1IDYA 3KP4A 1RESA 1X3ZB 4RM2A 5F08A 3QODA 5D8KB 2R4GA 5HS7A 3RZOJ 4KISA 2DMPA 3WTTC 4FT8A 1QZEA 2E71A 2V1DA 3ZMVA 1J2XA 3H9QA 4NQWA 3SQNA 2ZB9A 3TDZC 1FJLA 2MBFA 4J19A 2R7FA 3FISA 2NVYJ 1D0ZA 3J80Z 3VYUB 1ZR2A 1V5EA 2D1VA 2CO5A 4BU2A 2JSPA 4KN4X 3E6BA 4ENNA 4E4HA 4A3BJ 3LSPA 2DTZA 1BBYA 5TISC 3CQZJ 3K4NA 5IP7J 2KDZA 4JBAA 2XV4S 1Z67A 4KMUX 1XCVA 2OQRA 3OV8A 3CCSI 3G4SI 2V9PA 3FXUA 4C9YA 1JKQC 4BXXJ 2MD5A 2LVSA 2OTLI 2PMZA 1WSUA 3H0GJ 1MNMC 1EF4A 2F5EA 1S8NA 1XD7A 1YS7A 3SZGA 1XSDA 1BM9A 4CYCA 2R7WA 1BI0A 2QSFX 1IDZA 3I58A 1CF7A 4BEHB 2O61A 4FASD 1JT0A 1K83J 1LVKA 2HXIA 2K40A 4B44A 5K1YA 3GTJJ 3K6GA 3I3LA 3KIOA 4XRMA 1FYLA 3O2PE 2Y31A 4S05A 4U88A 1Z7UA 1RUNA 2VQHA 3NRVA 1MMDA 4LOCA 4EJWA 2JMWA 3CCJI 4RDUA 1G4DA 2XAGA 3KYDB 2WAQA 2OAZA 2VPLA 1FZPB 4XR6A 4QLCU 4RBOA 5TRDA 3HTUA 4N9IA 2XASA 3FM5A 3K1PA 4EQQA 1BW6A 1QBJA 4S04A 4XN3A 4AM3A 3BG6A 2ME0A 4DYQA 3I56I 2YX7A 5GTHC 4Q4ZF 2VUMJ 1NK2P 1XSVA 2Z16A 1UHMA 5DCMB 3EETA 3K0LA 5HOOA 2E7XA 4P9FA 5KK1A 1FTZA 2W25A 3KP3A 1LPQA 1I5ZA 3L2RA 4I0AA 4UVBA 4UV8A 4RB0A 2V6CA 4LITA 4MHGA 1L3LA 2QBYA 3S2HJ 2GQQA 2OC6A 3MZYA 2CH0A 3GBGA 3MKLA 4BE1A 2HU9A 2WB1A 3TQNA 2HYFA 3GVAA 3QYFA 1B1BA 3F6VA 2A5WA 1N75A 2MSYA 1B9MA 3WTUC 2A3SA 1ETKA 3ROUA 2I5UA 3BTJA 3HIFA 4B48A 5GAHJ 4N4NB 3ECOA 2JSCA 1RI7A 3PJRA 2IA0A 2VT3A 3J7AY 2CG4A 2VBWA 1IN7A 4ZYHA 4FX0A 2LD5A 4EEFG 2ZKZA 2DCEA 2R93J 4CYDA 3A2KA 2Y48A 1ETWA 4BXUA 4XNFA 4X0GA 2HR3A 1GT0C 1JE8A 4IEJA 4LG0A 3A01B 4W97A 2VQGA 1MBJA 2DDBA 2QZ8A 3LFKA 5M3FJ 1B8IA 3F21A 3Q0WA 4RMNA 3DKXA 3M8JA 4A3GJ 2ZNZA 3P7NA 3BR3A 3QPHA 1BJZA 2DODA 3FK6A 3U1KA 2FMYA 4CGZA 2FOKA 4ENMA 1ENHA 4EV0A 5IY5H 2CS3A 2CW0F 2OA4A 1EA3A 2IRFG 4B4CA 2ZO4A 2PBIA 2EZHA 2QQ8A 3ZPLA 1GUUA 3MKZA 4ON0A 1T38A 1VNDA 3L9FA 4RAYA 4WX9A 2LK2A 2BHYA 1R1TA 3RYRA 1RETA 3JW4A 5D5UB 1O4XA 4RLQA 2ZCWA 1WCMJ 3KP7A 2E2JJ 3BQYA 3S2DJ 2QM3A 4EGYA 2X6YA 3TOAA 1K6OA 2XIGA 4ESFA 3TL4X 3OYIA 2VKHA 3BPVA 5EG0B 3CMEI 2KRFA 2ZSIB 1MBEA 1W4MA 3Q3SA 2DO7A 2EV0A 4FX4A 3BJAA 2EA4A 1LUJB 1A6IA 2IS1A 2PN6A 3JAMK 4NNJA 4QTRA 5C44J 2HTJA 3AG3H 3DTEA 3WG9A 3L7WA 1ZAOA 2PMHA 3IH2A 1SMYF 1KYWA 5A2QZ 3CTAA 1J9IA 1PYVA 1R22A 4I76A 4G7ZF 2PJRB 4QSHA 2VJJA 3BWGA 2P7VB 3EQLF 5LHHA 1M1EB 3E0JB 5FD6A 2VQLA 3IL2A 5TJJA 2WA0A 2RGVA 2WC2A 1NG7A 1IGNA 1IUFA 2X6OA 3TW7A 2HGCA 1GVDA 3IV5A 5B1AH 4CO8A 1MDMA 1U2WA 2XRNA 3OYDA 2OU2A 2DT6A 4KITB 2HKXA 2LBFA 2IEKA 2TCTA 2DLLA 4CXFA 4Q47A 3L1PA 2HQAA 2F2EA 2ESNA 1H89C 1TW2A 4JYKA 2KFDA 4ZH4F 1FT9A 4GCVA 1MSEC 3K4BA 1I6XA 2F4MB 3AG2H 1USSA 1YW9A 4PJJA 2XAHA 3H1CA 3G2BA 3K1NA 3OYLA 2LNBA 1RKWA 5EZGA 5KCMA 2L9NA 3WU2C 2COMA 4MO7A 3RTRA 2ECBA 2X1EA 1MBGA 3KLNA 1W36D 1PP8F 3LMMA 1VQPI 3BQZA 5BNGA 2IS6A 1PUFA 5IOZA 2LR8A 1Z6TA 4YIRX 1K61A 2ID3A 3FM3A 3WTXC 2XC7A 1KQ9A 3UR3C 4BHPA 4EJUA 2MABA 3DCFA 3J7AO 3QPSA 4C3HJ 4A3CJ 1WRJA 3DKYA 3RZDJ 2A5YB 4BACA 4LG3A 1WI9A 4P55A 2OD5A 3WE3A 3HL2A 2DA5A 5GPAA 1DU6A 4BXFA 2VBYA 2R7UA 3I0TA 2XRLA 5KNLA 2MYSA 5EEGA 3LSIA 2EV5A 1YYVA 3RPQA 1N77A 4JP0A 2EB7A 1OISA 3BT9A 1IN5A 1UMQA 4FE4A 2LREA 4Z2YA 2M0MA 2HVQA 3ABUA 1F4KA 1ZLKA 2BY3A 1LFUP 1GXPA 1XN7A 1JUMA 2FBIA 3NWTA 3QU6A 2VL8A 5CQEA 1V55H 2NVUB 4BNCA 2EK5A 3I71A 1E3HA 2HQ5A 2IP2A 2O6GE 3CP8A 2J5OA 1SD5A 4DNCA 2MC4A 2ID6A 4HLXA 4M9XA 4XL9A 5IPAA 4DW6A 1D5VA 1IUYA 3FDYA 3K1MA 2FQ3A 3ZQHA 3F8CA 1J7KA 1RIOH 2EZKA 1I1SA 3JAMZ 1X58A 4H0EA 2PFBA 2QSGX 5B66C 2MLGA 4BYYA 3JSPA 3DKWA 4G8XA 1U5TB 4D5FA 3S3MA 3D5SC 4ZDOA 2CMPA 2A61A 3A4CA 5FFXA 3W3CA 2E5NA 3OOUA 3CMMA 3SHFA 2L4MA 3IH3A 2M8GX 4EM1A 2ZSHB 3BP8A 3K70C 3FMSA 3PUFA 5DM6F 4HSTA 1W7PB 3NAUA 3U1DA 3AG4H 3RIRA 5KVRA 3QP5A 1H9TA 3PO2J 1YTYA 2E5ZA 5FFZA 2OUMA 1ODDA 3LA2A 1K4TA 5E3NA 1KQ0A 2P8TA 3AG1H 4MQVA 4U87A 4CICA 2FRHA 2PX9A 2Y0SN 4M3BA 5HDKA 5C3EJ 3V7RA 3S3OA 3PFIA 3G73A 3RKXA 4IHTA 1C0WA 4L9VA 2EZIA 4NC8A 1TLHB 2OZ6A 3ZGKA 3OR2C 4PUSA 4YIIA 1X2NA 1VQLI 3H3VK 2JWTA 3AFHA 4PJMA 5DUKA 4HW0A 2DA2A 2E1OA 3W6VA 1HKQA 1HW5A 4X6AJ 2BEOA 4DZPA 2GLOA 2VBZA 5J1RA 2RQQA 1JKPC 2CV1A 2RNJA 5DTDA 1ERDA 2NOJB 1LB2A 1KYZA 1VI0A 2CJJA 2X48A 4B8XA 3CC4I 1E2XA 2QF7A 5LRRA 5E18F 1U9NA 4D7MA 4E7LA 4PK4A 1Z9CA 1ZRCA 4I2OA 2IGMA 4ZC3A 3QRFF 2CGPA 3QP6A 2VXZA 2W48A 3ABMH 4MNUA 2XGDA 5LGTA 4E70A 2KIFA 1W5TA 2B0LA 5CYVA 4C3JJ 2M0CA 4KDPA 1OJLA 5E8IA 1DPUA 4YFNF 1X1PA 4KA4A 4PSXA 1G6NA 2C6YA 4HPQA 2VXDA 3DBRB 2VJ5A 2EZLA 1OR7A 3V4GA 1QNTA 1XGNA 4D0PA 1B6AA 4IXAA 2NVXJ 4I02A 3MAJA 4XSZF 1KZHA 4IOAF 2F48A 2IVMA 5D6FA 2HYGD 5HNHA 3KLOA 5KAFC 1ZGJA 5IP6A 5J4YA 2ZJQF 3CC7I 2BOLA 5B5EC 3GTMJ 2R7OA 5E17F 5DV5A 5EEHA 3RYPA 4I98B 5D4SA 5GADJ 2N8GA 4D9JA 1XPXA 5GP9A 1B59A 1MD0A 1Q1HA 1IW7F 1X2MA 2AXTC 2RAEA 2JA6J 2IGKA 3CLQA 1X1DA 3K4JA 2HQRA 4GRIA 3LSMA 4CZZA 2VJ4A 3S1QJ 3FK7A 3Q9SA 3GW2A 1JHHA 1T95A 2F4OB 3I54A 1ORKA 2K3FA 2VKDA 1JJ6C 2LKXA 4CZCA 3KX2A 1XX5A 2PQ8A 3FXLA 4WWCA 3BOQA 1R23A 1YQAA 5FO5A 1OQYA 3GLXA 4XLCA 1O3RA 5F6FA 2ZMEB 3WTSC 2R92J 1U5TC 2EBIA 4F55A 5ICFA 2LYCA 5C4JJ 1YJ9I 3L2VA 2Z33A 3O8GA 5H6RA 3HRTA 5L3BA 2KRCA 2O8XA 1SD4A 3KP6A 3D1NI 3E6CC 3CCQI 1FYMA 3HJEA 4M6VA 3MQ0A 2V9KA 3PSIA 2R5YB 4NUBA 1NG6A 3P9KA 2O7OA 3IHUA 3Q9VA 3F23A 4ASNA 1WVRA 1H88C 1YO5C 1TWCJ 3FZVA 5FJ8J 2UWMA 2QGUA 3GFJA 1Y56A 2COBA 3QU3A 5ICGA 4U0YA 3REOA 3SYTA 3LOCA 4M9SA 1LEAA 3IKTA 2M7AA 4U7DA 2VB6A 3OYJA 1HDDC 2XF5A 3PL8A 4MQ9F 4ZDPA 1XDSA 4L0YB 2O8KA 4XLHA 2I8DA 2JT1A 1K78B 1U6GA 1GDTA 4BJTA 2GZWA 5JLXA 3U9GA 1S9HA 2ICWG 4ANJA 2E7WA 3S16J 2L7MP 4UUSA 1FMVA 4RB3C 4A3IJ 4HZFA 2PMUA 3S32A 4R1HA 2L01A 3LA3A 2PI0A 3I59B 2H6CA 1X4OA 2CRGA 2KHMA 1E0EA 4ETSA 1QQIA 3LAJA 2E1MC 3EPZA 5EJCA 1TNTA 2HWVA 1X1CA 1U3EM 1ITYA 2LP0A 1QZZA 5HDGA 1K79A 2DOAA 2K9MA 1T2KA 2KISA 2FE3A 1XTAA 5F27A 3T5XA 4CSWA 3CO6C 1BR2A 1FIPA 2LKPA 2Q2EA 3DU6A 1VQ5I 2LG4A 4OIOF 2BVLA 3CJTB 3HSFA 3HOWJ 1POGA 5F0FA 3OYHA 3MMYB 2PMZN 3IUOA 2VKEA 2YS9A 4QPQA 2LC2A 3GTGJ 1B72A 3IH4A 3SEQA 1ZR4A 2NRAC 4DYCA 3LNQA 1TQIA 4C3IJ 3VFZA 3LWFA 3S1NJ 4JX5A 4A6EA 2EFQA 2G0EA 1IAWA 2HZDA 2CQ7A 2KZVA 1G3SA 3LFUA 4IQ4A 2VE9A 3ASNH 1P9QC 5GTIC 3BPXA 2FF4A 2V1UA 3HUGB 3BLYA 4A69C 2P5LC 3GYHX 4LLGF 1K7AA 2CFXA 2K4BA 1AU7A 4XSXF 2HS5A 2IBDA 3G1LA 5GPCA 3GX4X 1G3TA 4F7ZA 2WAQN 4G94A 1KU2A 1YW7A 2D1HA 4HBLA 1BR4A 1IRZA 3SDGA 2EA2A 4HV5A 1XGOA 4XORA 3IRRA 4J01A 2NS8A 4A93J 1E3PA 3M3YJ 1IO2A 4OOIA 2XKPA 4A3JJ 2DT7B 2HYJA 1YIJI 1DGWY 2R7DA 4MIMA 1YRNA 4Y52J 3OYFA 5K7ZA 2DA1A 4G12A 2JK3A 1TP4A 2ZJPF 3CDIA 4F3QA 2V26A 2IW5A 3FHNA 1YW8A 2EFWA 4CCKA 1BJAA 3F72A 4DYRA 5KHDA 2M4KA 4XONA 4AIKA 1SFXA 4UVAA 1D0XA 2LLKA 2LMDA 4E6KG 5HODA 1XCBA 1I3QJ 2PEXA 4OMZA 4V19K 4WXCA 3PQJA 1UELB 3M1EA 1X3UA 2WB1N 3MN2A 3BR6A 5CVVA 1VQ8I 3DBHB 2K9LA 3PUBA 2IT0A 2RREA 2O9LA 1DP7P 1J0RA 3LQQA 2G9WA 1LE8A 3LSGA 4FTHA 1TBXA 2R3SA 2W7NA 4HA8A 3H5AA 2JA2A 3G71I 1ZG3A 2DA6A 4UY8I 4IF4A 4O6JA 1Y6IA 1E17A 3R0JA 2Y9YA 2H1KA 2RKHA 4MTDA 3RI4A 1SAUA 2DI3A 2VASA 3JTHA 1P4WA 3HXLA 1FWZA 3U2RA 1Y39A 2KIMA 5L3GA 3WE2A 4EVIA 1S7AA 2KRHA 5L3FA 2ETHA 1Y1WJ 2CQNA 1K6YA 2NS0A 3GTPJ 3TGNA 1AHDP 1UG2A 3L2UA 3ABLH 3H5NA 1BC7C 3D5LA 1G3WA 5E1ZB 3HG9A 4M3DA 5LEJA 1MBKA 3H5RA 4IHVA 1W7PD 1LEBA 3HOZJ 3GTLJ 1R49A 2A69F 4GYIA 2BGCA 1DP3A 1S6LA 3C7JA 1VQ7I 4K2EA 4ZYEA 2RN7A 2BY1A 1P2FA 5AIQA 5KAIC 4UVCA 1MNDA 4IO9F 2ACJA 4WCGA 1ON2A 3G1OA 4ENKA 3HDDA 3JTGA 5J47A 5EGOA 2JN6A 2HOAA 2VONA 3E7LA 3RCOA 2MD0A 1JGGA 4M6YA 4G7HF 2UV1A 2HTSA 3MKYB 2F4IA 4A3FJ 3IWFA 2XB5A 5HLGA 2G7HA 1IN6A 1ETVA 1FBUA 2AQEA 2BW3B 3QAHA 3BCAA 5A2QK 2K86A 3GWZA 3BROA 4L5IA 1MBHA 1F9NA 4RGSA 3L2QA 4XRSG 1Z05A 5ICEA 3A1YA 3RKQA 3H35A 2ISZA 2NYXA 2JVHA 2VI6A 1MW7A 5C4XJ 2QKMB 2KQRA 2DMNA 2P6TA 3EDPA 4JX6A 5FROA 1WH5A 5FKOA 3A0HC 1MMAA 3B6CA 1UG0A 2EFPA 3F0CA 4A0YA 4M3GA 3N97A 1HXDA 2H6BA 3DU5A 2PLYA 4YEJA 4BS9A 3CO7C 3M4OJ 2P6SA 1XDUA 4OAYA 2W00A 4ZYAA 3ABTA 2EILH 4RAGA 1FBSA 3ZOBA 2BVMA 3HGYA 5AONA 3FXMA 1TWAJ 3BDDA 2P7CB 2WBMA 2F5CA 1AKHB 3RPUD 4N4OB 4XMYA 4YRVA 1HOMA 3KETA 1R9TJ 2CUFA 4V2FA 2KDOA 1FC3A 2K85A 2XHKA 4XOTA 2DK8A 1FOXA 4E7KA 3EYYA 2R5ZA 2KT0A 1YLFA 4UB8C 2OZUA 4TV7A 1TWGJ 1WKMA 1OYWA 2BYVE 3JRGA 3E6DA 1IV8A 1YX3A 3FIWA 3CF5F 3BG7A 1OR7C 1UJ8A 2VIXA 5ILUA 1BR1A 2OTJI 3K7AJ 3MVPA 1GV5A 5JLWA 4L18B 3W6KB 2ZXJA 3BZ6A 4PJ0C 4HF2A 4M72A 3OS0A 1ON1A 3TDUC 4BE0A 4AWXB 4P5OA 2L7FP 1A35A 3HRSA 4Y3OA 1WH7A 2OF7A 2DFFA 4A3MJ 2HNHA 1USTA 3KP2A 3J81K 2GOXB 2JPBA 5F0HA 4NC7A 2X51A 2A6EF 2XUBA 2DMTA 1UFMA 4AD9A 2LH9A 1MMNA 4BQAA 3S17J 2MA3A 1GVJA 2IS4A 4IVNA 3VODA 4HF1A 3H92A 1JKRC 4E7SA 1IC8A 1ZRDA 2BBYA 4A3EJ 3ISPA 3CUQB 3JR9A 2QUFA 3NQOA 4A5MA 1YX5A 1Y8RB 3WTVC 1SFUA 2WY8Q 2G7UA 1QO0D 1U0JA 4FCYA 3JREA 3HHGA 2QSHX 4HX8A 2RC4A 1LDKB 2M45A
chains in the Genus database with same CATH topology
2DFIA 5LHIA 1IXRC 3LAPA 2L54A 2Z9OA 3CJNA 4Y15A 1RNLA 4NHJA 1QGPA 3GZ5A 2FMLA 3RPUA 4P9UA 2QVOA 3ZN1A 3DXJF 4BAYA 5D5XB 1JGSA 2FSWA 3ZMUA 2Y0MA 4KIFA 1FPQA 1SD7A 2QQAA 3HSRA 1R58A 1R7JA 1AOYA 5HLIA 1FSHA 4ZYDA 2F5FA 1H0MA 1O57A 2M1BA 1AWCA 2ZJ2A 1L0OC 1CF7B 1S3JA 3HOTA 2ESHA 4YG2F 3KP5A 1GHCA 2WWYA 5ILSA 2DAOA 4IJAA 1LVAA 5K5OA 4HDUA 3FHZA 2HEOA 2EJRA 1SAXA 1EH8A 3ELKA 2D45A 2CWEA 5BS6A 3VB2A 3FX3A 4KNYA 2P5VA 1IRGA 3MWMA 4EM2A 1BIBA 4HX4A 3J81Z 3B02A 4I0BA 3GZ6A 2EFOA 4CHUA 1MJBA 1T98A 2M30A 2QLZA 3R61A 4BHBA 3DP7A 3CUQC 3WTZA 3AAFA 2AXLA 5CVIA 4LFUA 2IJLA 4R79A 1G3YA 2QBYB 3JSOA 3FMRA 2JTVA 4OIPF 5LBQA 2QWWA 1CGPA 3E97A 5JVTA 1VTNC 1ZYRF 1BI1A 2XKOA 5H6QA 3DFGA 5L3EA 3T0YA 4LLLA 5ICCA 1RUOA 1TQPA 1UHWA 3GFMA 2XROA 3RJPA 3KCCA 4ESBA 4XLNF 2L3DA 5BPIA 1MZBA 1J75A 2VC1A 1HKTA 4LG0B 4NB5A 2A07F 5AIPA 3TOBA 4M9ZA 3ZMTA 2QQBA 4QWQA 1HSJA 3OOPA 4UXNA 1KU3A 2JZYA 4L5JA 5BOXA 2OQGA 3L09A 1V3FA 2CYYA 4MEYF 5HS9A 4AIJA 3S2WA 3NEUA 2WTEA 1MKMA 3E5QA 1YIOA 1NHAA 2RVCA 2EV6A 1ZG5A 2RV8A 2DPDA 3ECHA 1D8KA 2EFNA 2PG4A 1XSXA 2RDPA 3FMQA 4KIBA 4HX7A 5J8CA 4MTEA 2FBHA 1XGMA 5DEQA 2ZBKA 1D3YA 5LHGA 3QOPA 2VN2A 1P6RA 3T1BA 4ZZLA 1R00A 2DT5A 2H09A 5J8FA 1ZHFA 5D5WB 3MZHA 3K9TA 2VT2A 1O7LA 1QZYA 2M8EA 4IRHA 1KU7A 1MDMB 4KICA 1S29A 3K2ZA 3HTSB 2WV0A 4PGGA 2DBBA 5FD5A 3KZYA 1TW3A 1WWXA 4HOBA 3ZMSA 1IN4A 1IF1A 2IA1A 4JQFA 4UHTA 1YG2A 1HW2A 3HYIA 4KT5C 2JRTA 1OYYA 5LGNA 3O3KA 4RAZA 4LD5A 2ADUA 5BPDA 2Q8KA 2V79A 3Q5FA 4PGHA 2CQKA 1W5SA 4HLYA 4WF2A 1H9GA 3WU1B 4G6DA 1P92A 3V7SA 1ZGAA 3ZMDA 3WODF 2DQLA 3T8TA 2Z5UA 3FWEA 3TO9A 2GA1A 1Z1DA 1HQCA 4HYEA 1R36A 3F8MA 2ELHA 1F1ZA 2J5PA 5ILVA 3ZN0A 5BMZA 1TNSA 1IZ1A 1V4RA 3MFKA 4GGGA 2KJCA 3MCZA 2P5KA 2LDUA 2V1XA 3C1DA 2XAQA 5H20A 3R6SA 1ZG1A 1FP1D 4U7BA 4M6XA 4AIHA 2HFHA 2F5DA 3KZZA 2Q0OA 5D6EA 2FEZA 3ZMZA 2FXAA 2E1CA 1HSTA 1FX7A 2DQRA 2P4WA 4MGRA 3EUHA 1FYKA 3COAC 1FNNA 4YFKF 3ML6A 3HRUA 4A12A 2XGXA 2DK5A 5JHUA 2L02A 1ZRFA 2KIUA 3I64A 4KYWA 3RKYA 1GXQA 2M5WA 2KKOA 4UV9A 1OPCA 4RGRA 3P9IA 3F6OA 5LGUA 4R8HA 3F22A 3V8LA 4OU0A 1R5GA 4I01A 5CLSA 4EMSA 2EWNA 1RZ4A 5ED4A 1SMTA 2FA5A 3H3ZA 3BJ6A 3MEXA 2L4AA 3WGIA 1ZLJA 3L00A 1ONVA 4HDVA 1BOAA 4OIQF 1F5TA 3HRMA 4L9JA 5DD4A 2XAJA 2QENA 2GXGA 3D0SA 3WU0A 3F8FA 4LK0F 2O03A 2A68F 2AS5F 3ULQB 2Z99A 2ZNYA 1O3QA 1ZARA 3GFIA 3IRQA 5J6XA 1SFEA 3DEUA 1FLIA 4KIGA 3R4KA 4ENJA 4WK8F 3GO5A 2BV6A 4HQEA 2VE8A 2K02A 4B09A 3IWZA 2ISYA 1IRFA 4XBFA 4EGZA 1HBXG 2M87A 4RB2C 4L9TA 4ESJA 2VOOA 3E5UA 2GA2A 4RS8A 1DPRA 1ZN2A 4KFCA 2YU3A 1D8JA 4A6DA 1ULYA 2QYOA 2KJBA 3DF8A 5D4RA 2OBPA 4Y17A 5BQTA 4DQ2A 3ZP5A 1MJAA 1FY7A 3CUOA 1P4XA 4M74A 4GYGA 4HV6A 4YFXF 1FOKA 1ZREA 1KGSA 1PUEE 1TTYA 4IHSA 1JXSA 3CDHA 1U5TA 3W6JB 4U0VA 5LLQA 1W7PA 5K5RA 3BJOA 1XMKA 2YPRA 2YX4A 4RB1A 5IT9K 5K5QA 3RKWA 5HLHA 3O6BB 5E1XA 2W84A 3VOEA 3HHHA 5DD8A 3KEQA 2W85A 4GO1A 1P4AA 3R0AA 1T6SA 3SXYA 5HS8A 3V8KA 3E3VA 2HZTA 1DDNA 3GEZA 3ZQ7A 1QPMA 1I1GA 1XMAA 3FF5A 4GXOA 3K69A 3I4PA 4LLNA 5HDNA 3TO6A 3I5UA 3SZTA 2H27A 2LF7A 1T0FA 2TDXA 1A04A 2HQNA 3RDIA 1O3SA 5DDGA 2HKOA 4RGXA 4RGUA 1MJ9A 3LA7A 1REPC 5FLXK 1S7OA 2LF8A 3FXQA 2UXXA 4G6QA 2CSOA 3GUDA 1UCRA 4IRIA 1HKSA 1XB4A 4N9HA 2ZMEA 2H94A 3KEOA 4M73A 4HQMA 1B9NA 3N4MA 4ZYGA 1Y0UA 2GAUA 3M9AA 4PDKA 1EH7A 4ZZDA 3C18A 1OMIA 5L3DA 3IKVA 2JPCA 3F3XA 5IT9Z 2FU4A 2MH9A 3SFZA 1OYIA 2VODA 2DU9A 1K78A 4IPAA 3DV8A 3V8JA 2RQPA 3VEPA 2X0LA 2V9VA 3T8RA 2DPUA 3I59A 4LJZF 3V7CA 1IXCA 2UZKA 2DTRA 5D8LB 1ZH5A 3GF2A 5IT3A 5FB2A 4EM0B 2VC0A 5LEKA 4PCQA 3F8BA 1T39A 5HVQC 1XGSA 4M71A 5F1RA 2Z3YA 1BIAA 2O3FA 5E1WA 4EJTA 1PP7U 3HOSA 5E20A 2LSOA 2BE5F 4U0WA 3HUGA 4L9NA 5FLXZ 4FHTA 2K4JA 4YIFA 3F8NA 1KA8A 5CVUA 1BI3A 3TKYA 3DPLC 2GXBA 5FGMA 4G7OF 3SZPA 3G3ZA 1R1UA 2UXNA 5F64A 2GIVA 1LQ1A 2HDCA 3PQKA 2STTA 3BY6A 4BH9A 2A6HF 4A2UA 2YSRA 3LQRA 2X4HA 1O3TA 3M8FA 4XLPF 4L0ZB 2K27A 1FBQA 3R60A 1R5HA 4OINF 4OIRF 1PDNC 1LJ9A 2IA2A 4A0ZA 6PAXA 4LK1F 3KE2A 1BI2A 3B73A 1MGTA 3C3WA 4EJVA 2K7LA 4KN7X 5D5VB 2VOPA 4LGWA 4OMYA 5CVRA 1U78A 3CLOA 3KFWX 3LSTA 4JK1X 4G9YA 3WGGA 2XAFA 2HOEA 3H3UA 2PJPA 5JFRA 4Y13A 1LDDA 4WXDA 1HW1A 1KU9A 5ERIA 3ERED 2O0YA 4EJOA 3WTYC 4IRGA 4UUVA 2W57A 4KUMA 4A0XA 1Z6RA 3M7GA 1WQ2A 3DPTA 3HSEA 5DCMA 4MEXF 3TO7A 2FNAA 2W24A 2NAZA 3IC7A 1SD6A 2IPQX 4HF0A 1LDJA 1EH6A 2MH2A 4A5NA 4WXHA 3E6MA 1STZA 3J80K 5L3CA 3E5XA 2QQ9A 1O7FA 3EYIA 1Z91A 2VBXA 1BN5A 1JHFA 2E1NA 1YS6A 2NNNA 2GWRA 4LB5A 5E8GA 5JR3A 3WGHA 4HAMA 2Y75A 1IXSB 1TQMA 4O5VA 5DYMA 3L2CA 4KMFA 1BC8C 1IN8A 2MLKA 4PZJA 2FBKA 5JI6A 4I09A 4LMYA 2XVCA 3FXRA 4P96A 4AVPA 2ZFWA 3QPTA 3DQVC 1B4AA 4LB6B 4Q48A 3WTWC 1I27A 1YFHA 1EV7A 1KQ8A 1UB9A 4I7HA 5DCFA 3GXOA 2NNYA 1R1VA 5CJ9A 2STWA 4N0BA 2YR2A 4Q5SF 4XRFA 2FNPA 5CVJA 4O3MA 5DUIA 1LNWA 1OKRA 2D2WA 4BHCA 1U8RA 1J59A 3P9CA 3I53A 3M8EA 1J5YA 2DW4A 1DUXC 2MC3A 1FP2A 5LRSA 3CUQA 4UNOA 3GFLA 4CDGA 1FSEA 3KP4A 5D8KB 5HS7A 3WTTC 4FT8A 2V1DA 3ZMVA 1J2XA 4NQWA 3SQNA 3TDZC 2MBFA 2R7FA 3J80Z 2D1VA 2CO5A 4KN4X 3E6BA 4ENNA 1BBYA 4JBAA 2XV4S 4KMUX 1XCVA 2OQRA 3OV8A 3FXUA 2MD5A 1WSUA 2F5EA 1S8NA 1XD7A 1YS7A 1XSDA 1BM9A 1BI0A 3I58A 1CF7A 2O61A 5K1YA 1FYLA 3O2PE 4S05A 4U88A 1Z7UA 1RUNA 3NRVA 4EJWA 1G4DA 2XAGA 2OAZA 1FZPB 4QLCU 5TRDA 3HTUA 4N9IA 2XASA 3FM5A 3K1PA 4EQQA 1QBJA 4S04A 2YX7A 4Q4ZF 1XSVA 1UHMA 5DCMB 3EETA 3K0LA 5HOOA 2E7XA 4P9FA 5KK1A 2W25A 3KP3A 1I5ZA 4I0AA 4UVBA 4UV8A 4RB0A 2V6CA 4MHGA 1L3LA 2QBYA 2GQQA 3MZYA 3TQNA 2HYFA 3GVAA 1B1BA 3F6VA 1B9MA 3WTUC 2A3SA 3ROUA 3HIFA 3ECOA 2JSCA 1RI7A 2IA0A 2VT3A 2CG4A 2VBWA 1IN7A 4ZYHA 4FX0A 2ZKZA 4CYDA 2Y48A 4BXUA 2HR3A 1JE8A 4LG0A 2QZ8A 3LFKA 3F21A 2ZNZA 3P7NA 3QPHA 2FMYA 4CGZA 2FOKA 4ENMA 4EV0A 2CW0F 2OA4A 2IRFG 2ZO4A 2PBIA 3ZPLA 4ON0A 1T38A 3L9FA 4RAYA 4WX9A 1R1TA 3RYRA 3JW4A 5D5UB 2ZCWA 3KP7A 2QM3A 4EGYA 3TOAA 1K6OA 2XIGA 4ESFA 3BPVA 2KRFA 1W4MA 2DO7A 2EV0A 4FX4A 3BJAA 2EA4A 2PN6A 3JAMK 2HTJA 3WG9A 3L7WA 1ZAOA 2PMHA 1SMYF 1KYWA 5A2QZ 3CTAA 1J9IA 1R22A 4G7ZF 5LHHA 3BWGA 2P7VB 3EQLF 5FD6A 3IL2A 5TJJA 2RGVA 2WC2A 2HGCA 4CO8A 1MDMA 1U2WA 2XRNA 2OU2A 2HKXA 2DLLA 4CXFA 4Q47A 2F2EA 2ESNA 1TW2A 4ZH4F 1FT9A 4GCVA 1I6XA 1USSA 1YW9A 2XAHA 3K1NA 2LNBA 2COMA 3RTRA 1PP8F 3KLNA 1Z6TA 3FM3A 3WTXC 1KQ9A 4EJUA 4BHPA 3J7AO 1WRJA 2A5YB 4P55A 1WI9A 2OD5A 3WE3A 2VBYA 3I0TA 5EEGA 2EV5A 1YYVA 3RPQA 2EB7A 1IN5A 4Z2YA 3ABUA 1F4KA 1ZLKA 1GXPA 1XN7A 2FBIA 3QU6A 4BNCA 2EK5A 3I71A 2O6GE 2IP2A 2J5OA 1SD5A 4DNCA 4M9XA 4HLXA 1D5VA 1IUYA 3K1MA 2FQ3A 3F8CA 1J7KA 1RIOH 1I1SA 3JAMZ 4H0EA 2PFBA 2MLGA 4BYYA 3JSPA 3DKWA 4G8XA 1U5TB 2A61A 5FFXA 3SHFA 2L4MA 4EM1A 3BP8A 3FMSA 1W7PB 3U1DA 3RIRA 5KVRA 3QP5A 1H9TA 1YTYA 5FFZA 1ODDA 3LA2A 1KQ0A 2P8TA 4MQVA 4CICA 2FRHA 5HDKA 3V7RA 3PFIA 3G73A 3RKXA 4IHTA 1C0WA 4L9VA 1TLHB 2OZ6A 4YIIA 5DUKA 4HW0A 1HKQA 1HW5A 2BEOA 2VBZA 2RNJA 1LB2A 1KYZA 4B8XA 1E2XA 5LRRA 5E18F 1Z9CA 1ZRCA 4I2OA 3QRFF 2CGPA 3QP6A 2VXZA 4MNUA 5LGTA 4E70A 2KIFA 1W5TA 2B0LA 5CYVA 4KDPA 5E8IA 1DPUA 4YFNF 4KA4A 1G6NA 2C6YA 1OR7A 3V4GA 1QNTA 1XGNA 4D0PA 1B6AA 4IXAA 4I02A 3MAJA 4XSZF 2IVMA 5D6FA 2HYGD 3KLOA 1ZGJA 5E17F 5DV5A 5EEHA 3RYPA 4I98B 5D4SA 1B59A 1MD0A 1Q1HA 1IW7F 2HQRA 4CZZA 3Q9SA 3GW2A 1JHHA 3I54A 2PQ8A 4WWCA 3BOQA 1R23A 1YQAA 5FO5A 3GLXA 1O3RA 5F6FA 2ZMEB 3WTSC 1U5TC 5ICFA 2Z33A 5H6RA 3HRTA 5L3BA 2O8XA 1SD4A 3KP6A 3E6CC 1FYMA 3MQ0A 3P9KA 3IHUA 3Q9VA 3F23A 4ASNA 1YO5C 3FZVA 2UWMA 3GFJA 3QU3A 5ICGA 4U0YA 3REOA 3IKTA 4M9SA 1LEAA 4U7DA 4L0YB 4MQ9F 1XDSA 2JT1A 1K78B 1U6GA 2GZWA 3U9GA 2E7WA 4RB3C 4HZFA 2PMUA 4R1HA 2L01A 3LA3A 2PI0A 3I59B 2H6CA 4ETSA 1QQIA 3LAJA 1TNTA 2HWVA 1U3EM 1QZZA 5HDGA 1K79A 1T2KA 2FE3A 3T5XA 3CO6C 2LKPA 2Q2EA 4OIOF 3HSFA 2NRAC 1TQIA 3VFZA 3LWFA 4A6EA 2EFQA 1IAWA 1G3SA 2VE9A 3BPXA 2FF4A 2V1UA 2P5LC 3GYHX 4LLGF 1K7AA 2CFXA 2K4BA 4XSXF 2HS5A 3GX4X 1G3TA 4F7ZA 4G94A 1KU2A 1YW7A 2D1HA 4HBLA 2EA2A 4HV5A 1XGOA 3IRRA 4OOIA 2XKPA 2R7DA 2IW5A 2EFWA 1YW8A 1BJAA 3F72A 4AIKA 1SFXA 4UVAA 1XCBA 2PEXA 4OMZA 4WXCA 3PQJA 3M1EA 1X3UA 5CVVA 2IT0A 1DP7P 1J0RA 3LQQA 2G9WA 1TBXA 2R3SA 4HA8A 1ZG3A 4IF4A 4O6JA 1E17A 3R0JA 2RKHA 4MTDA 3RI4A 2DI3A 3JTHA 1P4WA 1FWZA 3U2RA 2KIMA 5L3GA 3WE2A 4EVIA 1S7AA 5L3FA 2ETHA 2NS0A 3TGNA 1BC7C 3D5LA 1G3WA 5E1ZB 5LEJA 1W7PD 1LEBA 2A69F 4GYIA 2BGCA 1S6LA 3C7JA 4K2EA 4ZYEA 2RN7A 1P2FA 5AIQA 4UVCA 2ACJA 4WCGA 1ON2A 4ENKA 3JTGA 2VONA 4M6YA 4G7HF 2HTSA 3IWFA 5HLGA 2G7HA 1IN6A 1FBUA 3QAHA 5A2QK 2K86A 3GWZA 3BROA 4L5IA 1F9NA 4RGSA 1Z05A 5ICEA 2ISZA 2NYXA 2P6TA 3EDPA 2EFPA 4A0YA 3N97A 1HXDA 2H6BA 2PLYA 3CO7C 2P6SA 1XDUA 3ABTA 1FBSA 5AONA 3BDDA 2P7CB 2F5CA 3KETA 1FC3A 2XHKA 2DK8A 3EYYA 1YLFA 2OZUA 4TV7A 1WKMA 2BYVE 1OYWA 3E6DA 5ILUA 4L18B 3W6KB 2ZXJA 3BZ6A 4HF2A 4M72A 1ON1A 3TDUC 4AWXB 4P5OA 3HRSA 3KP2A 1USTA 3J81K 2JPBA 2A6EF 2XUBA 1UFMA 4AD9A 4BQAA 2MA3A 1GVJA 4IVNA 3VODA 4HF1A 3H92A 1ZRDA 2BBYA 3ISPA 3CUQB 2QUFA 3NQOA 4A5MA 3WTVC 1SFUA 2G7UA 1QO0D 3HHGA 4HX8A 2RC4A 1LDKB 2M45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFI A;  5LHI A;  1IXR C;  3LAP A;  2L54 A;  2Z9O A;  3CJN A;  4Y15 A;  1RNL A;  4NHJ A;  1QGP A;  3GZ5 A;  2FML A;  3RPU A;  4P9U A;  2QVO A;  3ZN1 A;  3DXJ F;  4BAY A;  5D5X B;  1JGS A;  2FSW A;  3ZMU A;  2Y0M A;  4KIF A;  1FPQ A;  1SD7 A;  2QQA A;  3HSR A;  1R58 A;  1R7J A;  1AOY A;  5HLI A;  1FSH A;  4ZYD A;  2F5F A;  1H0M A;  1O57 A;  2M1B A;  1AWC A;  2ZJ2 A;  1L0O C;  1CF7 B;  1S3J A;  3HOT A;  2ESH A;  4YG2 F;  3KP5 A;  1GHC A;  2WWY A;  5ILS A;  2DAO A;  4IJA A;  1LVA A;  5K5O A;  4HDU A;  3FHZ A;  2HEO A;  2EJR A;  1SAX A;  1EH8 A;  3ELK A;  2D45 A;  2CWE A;  5BS6 A;  3VB2 A;  3FX3 A;  4KNY A;  2P5V A;  1IRG A;  3MWM A;  4EM2 A;  1BIB A;  4HX4 A;  3J81 Z;  3B02 A;  4I0B A;  3GZ6 A;  2EFO A;  4CHU A;  1MJB A;  1T98 A;  2M30 A;  2QLZ A;  3R61 A;  4BHB A;  3DP7 A;  3CUQ C;  3WTZ A;  3AAF A;  2AXL A;  5CVI A;  4LFU A;  2IJL A;  4R79 A;  1G3Y A;  2QBY B;  3JSO A;  3FMR A;  2JTV A;  4OIP F;  5LBQ A;  2QWW A;  1CGP A;  3E97 A;  5JVT A;  1VTN C;  1ZYR F;  1BI1 A;  2XKO A;  5H6Q A;  3DFG A;  5L3E A;  3T0Y A;  4LLL A;  5ICC A;  1RUO A;  1TQP A;  1UHW A;  3GFM A;  2XRO A;  3RJP A;  3KCC A;  4ESB A;  4XLN F;  2L3D A;  5BPI A;  1MZB A;  1J75 A;  2VC1 A;  1HKT A;  4LG0 B;  4NB5 A;  2A07 F;  5AIP A;  3TOB A;  4M9Z A;  3ZMT A;  2QQB A;  4QWQ A;  1HSJ A;  3OOP A;  4UXN A;  1KU3 A;  2JZY A;  4L5J A;  5BOX A;  2OQG A;  3L09 A;  1V3F A;  2CYY A;  4MEY F;  5HS9 A;  4AIJ A;  3S2W A;  3NEU A;  2WTE A;  1MKM A;  3E5Q A;  1YIO A;  1NHA A;  2RVC A;  2EV6 A;  1ZG5 A;  2RV8 A;  2DPD A;  3ECH A;  1D8K A;  2EFN A;  2PG4 A;  1XSX A;  2RDP A;  3FMQ A;  4KIB A;  4HX7 A;  5J8C A;  4MTE A;  2FBH A;  1XGM A;  5DEQ A;  2ZBK A;  1D3Y A;  5LHG A;  3QOP A;  2VN2 A;  1P6R A;  3T1B A;  4ZZL A;  1R00 A;  2DT5 A;  2H09 A;  5J8F A;  1ZHF A;  5D5W B;  3MZH A;  3K9T A;  2VT2 A;  1O7L A;  1QZY A;  2M8E A;  4IRH A;  1KU7 A;  1MDM B;  4KIC A;  1S29 A;  3K2Z A;  3HTS B;  2WV0 A;  4PGG A;  2DBB A;  5FD5 A;  3KZY A;  1TW3 A;  1WWX A;  4HOB A;  3ZMS A;  1IN4 A;  1IF1 A;  2IA1 A;  4JQF A;  4UHT A;  1YG2 A;  1HW2 A;  3HYI A;  4KT5 C;  2JRT A;  1OYY A;  5LGN A;  3O3K A;  4RAZ A;  4LD5 A;  2ADU A;  5BPD A;  2Q8K A;  2V79 A;  3Q5F A;  4PGH A;  2CQK A;  1W5S A;  4HLY A;  4WF2 A;  1H9G A;  3WU1 B;  4G6D A;  1P92 A;  3V7S A;  1ZGA A;  3ZMD A;  3WOD F;  2DQL A;  3T8T A;  2Z5U A;  3FWE A;  3TO9 A;  2GA1 A;  1Z1D A;  1HQC A;  4HYE A;  1R36 A;  3F8M A;  2ELH A;  1F1Z A;  2J5P A;  5ILV A;  3ZN0 A;  5BMZ A;  1TNS A;  1IZ1 A;  1V4R A;  3MFK A;  4GGG A;  2KJC A;  3MCZ A;  2P5K A;  2LDU A;  2V1X A;  3C1D A;  2XAQ A;  5H20 A;  3R6S A;  1ZG1 A;  1FP1 D;  4U7B A;  4M6X A;  4AIH A;  2HFH A;  2F5D A;  3KZZ A;  2Q0O A;  5D6E A;  2FEZ A;  3ZMZ A;  2FXA A;  2E1C A;  1HST A;  1FX7 A;  2DQR A;  2P4W A;  4MGR A;  3EUH A;  1FYK A;  3COA C;  1FNN A;  4YFK F;  3ML6 A;  3HRU A;  4A12 A;  2XGX A;  2DK5 A;  5JHU A;  2L02 A;  1ZRF A;  2KIU A;  3I64 A;  4KYW A;  3RKY A;  1GXQ A;  2M5W A;  2KKO A;  4UV9 A;  1OPC A;  4RGR A;  3P9I A;  3F6O A;  5LGU A;  4R8H A;  3F22 A;  3V8L A;  4OU0 A;  1R5G A;  4I01 A;  5CLS A;  4EMS A;  2EWN A;  1RZ4 A;  5ED4 A;  1SMT A;  2FA5 A;  3H3Z A;  3BJ6 A;  3MEX A;  2L4A A;  3WGI A;  1ZLJ A;  3L00 A;  1ONV A;  4HDV A;  1BOA A;  4OIQ F;  1F5T A;  3HRM A;  4L9J A;  5DD4 A;  2XAJ A;  2QEN A;  2GXG A;  3D0S A;  3WU0 A;  3F8F A;  4LK0 F;  2O03 A;  2A68 F;  2AS5 F;  3ULQ B;  2Z99 A;  2ZNY A;  1O3Q A;  1ZAR A;  3GFI A;  3IRQ A;  5J6X A;  1SFE A;  3DEU A;  1FLI A;  4KIG A;  3R4K A;  4ENJ A;  4WK8 F;  3GO5 A;  2BV6 A;  4HQE A;  2VE8 A;  2K02 A;  4B09 A;  3IWZ A;  2ISY A;  1IRF A;  4XBF A;  4EGZ A;  1HBX G;  2M87 A;  4RB2 C;  4L9T A;  4ESJ A;  2VOO A;  3E5U A;  2GA2 A;  4RS8 A;  1DPR A;  1ZN2 A;  4KFC A;  2YU3 A;  1D8J A;  4A6D A;  1ULY A;  2QYO A;  2KJB A;  3DF8 A;  5D4R A;  2OBP A;  4Y17 A;  5BQT A;  4DQ2 A;  3ZP5 A;  1MJA A;  1FY7 A;  3CUO A;  1P4X A;  4M74 A;  4GYG A;  4HV6 A;  4YFX F;  1FOK A;  1ZRE A;  1KGS A;  1PUE E;  1TTY A;  4IHS A;  1JXS A;  3CDH A;  1U5T A;  3W6J B;  4U0V A;  5LLQ A;  1W7P A;  5K5R A;  3BJO A;  1XMK A;  2YPR A;  2YX4 A;  4RB1 A;  5IT9 K;  5K5Q A;  3RKW A;  5HLH A;  3O6B B;  5E1X A;  2W84 A;  3VOE A;  3HHH A;  5DD8 A;  3KEQ A;  2W85 A;  4GO1 A;  1P4A A;  3R0A A;  1T6S A;  3SXY A;  5HS8 A;  3V8K A;  3E3V A;  2HZT A;  1DDN A;  3GEZ A;  3ZQ7 A;  1QPM A;  1I1G A;  1XMA A;  3FF5 A;  4GXO A;  3K69 A;  3I4P A;  4LLN A;  5HDN A;  3TO6 A;  3I5U A;  3SZT A;  2H27 A;  2LF7 A;  1T0F A;  2TDX A;  1A04 A;  2HQN A;  3RDI A;  1O3S A;  5DDG A;  2HKO A;  4RGX A;  4RGU A;  1MJ9 A;  3LA7 A;  1REP C;  5FLX K;  1S7O A;  2LF8 A;  3FXQ A;  2UXX A;  4G6Q A;  2CSO A;  3GUD A;  1UCR A;  4IRI A;  1HKS A;  1XB4 A;  4N9H A;  2ZME A;  2H94 A;  3KEO A;  4M73 A;  4HQM A;  1B9N A;  3N4M A;  4ZYG A;  1Y0U A;  2GAU A;  3M9A A;  4PDK A;  1EH7 A;  4ZZD A;  3C18 A;  1OMI A;  5L3D A;  3IKV A;  2JPC A;  3F3X A;  5IT9 Z;  2FU4 A;  2MH9 A;  3SFZ A;  1OYI A;  2VOD A;  2DU9 A;  1K78 A;  4IPA A;  3DV8 A;  3V8J A;  2RQP A;  3VEP A;  2X0L A;  2V9V A;  3T8R A;  2DPU A;  3I59 A;  4LJZ F;  3V7C A;  1IXC A;  2UZK A;  2DTR A;  5D8L B;  1ZH5 A;  3GF2 A;  5IT3 A;  5FB2 A;  4EM0 B;  2VC0 A;  5LEK A;  4PCQ A;  3F8B A;  1T39 A;  5HVQ C;  1XGS A;  4M71 A;  5F1R A;  2Z3Y A;  1BIA A;  2O3F A;  5E1W A;  4EJT A;  1PP7 U;  3HOS A;  5E20 A;  2LSO A;  2BE5 F;  4U0W A;  3HUG A;  4L9N A;  5FLX Z;  4FHT A;  2K4J A;  4YIF A;  3F8N A;  1KA8 A;  5CVU A;  1BI3 A;  3TKY A;  3DPL C;  2GXB A;  5FGM A;  4G7O F;  3SZP A;  3G3Z A;  1R1U A;  2UXN A;  5F64 A;  2GIV A;  1LQ1 A;  2HDC A;  3PQK A;  2STT A;  3BY6 A;  4BH9 A;  2A6H F;  4A2U A;  2YSR A;  3LQR A;  2X4H A;  1O3T A;  3M8F A;  4XLP F;  4L0Z B;  2K27 A;  1FBQ A;  3R60 A;  1R5H A;  4OIN F;  4OIR F;  1PDN C;  1LJ9 A;  2IA2 A;  4A0Z A;  6PAX A;  4LK1 F;  3KE2 A;  1BI2 A;  3B73 A;  1MGT A;  3C3W A;  4EJV A;  2K7L A;  4KN7 X;  5D5V B;  2VOP A;  4LGW A;  4OMY A;  5CVR A;  1U78 A;  3CLO A;  3KFW X;  3LST A;  4JK1 X;  4G9Y A;  3WGG A;  2XAF A;  2HOE A;  3H3U A;  2PJP A;  5JFR A;  4Y13 A;  1LDD A;  4WXD A;  1HW1 A;  1KU9 A;  5ERI A;  3ERE D;  2O0Y A;  4EJO A;  3WTY C;  4IRG A;  4UUV A;  2W57 A;  4KUM A;  4A0X A;  1Z6R A;  3M7G A;  1WQ2 A;  3DPT A;  3HSE A;  5DCM A;  4MEX F;  3TO7 A;  2FNA A;  2W24 A;  2NAZ A;  3IC7 A;  1SD6 A;  2IPQ X;  4HF0 A;  1LDJ A;  1EH6 A;  2MH2 A;  4A5N A;  4WXH A;  3E6M A;  1STZ A;  3J80 K;  5L3C A;  3E5X A;  2QQ9 A;  1O7F A;  3EYI A;  1Z91 A;  2VBX A;  1BN5 A;  1JHF A;  2E1N A;  1YS6 A;  2NNN A;  2GWR A;  4LB5 A;  5E8G A;  5JR3 A;  3WGH A;  4HAM A;  2Y75 A;  1IXS B;  1TQM A;  4O5V A;  5DYM A;  3L2C A;  4KMF A;  1BC8 C;  1IN8 A;  2MLK A;  4PZJ A;  2FBK A;  5JI6 A;  4I09 A;  4LMY A;  2XVC A;  3FXR A;  4P96 A;  4AVP A;  2ZFW A;  3QPT A;  3DQV C;  1B4A A;  4LB6 B;  4Q48 A;  3WTW C;  1I27 A;  1YFH A;  1EV7 A;  1KQ8 A;  1UB9 A;  4I7H A;  5DCF A;  3GXO A;  2NNY A;  1R1V A;  5CJ9 A;  2STW A;  4N0B A;  2YR2 A;  4Q5S F;  4XRF A;  2FNP A;  5CVJ A;  4O3M A;  5DUI A;  1LNW A;  1OKR A;  2D2W A;  4BHC A;  1U8R A;  1J59 A;  3P9C A;  3I53 A;  3M8E A;  1J5Y A;  2DW4 A;  1DUX C;  2MC3 A;  1FP2 A;  5LRS A;  3CUQ A;  4UNO A;  3GFL A;  4CDG A;  1FSE A;  3KP4 A;  5D8K B;  5HS7 A;  3WTT C;  4FT8 A;  2V1D A;  3ZMV A;  1J2X A;  4NQW A;  3SQN A;  3TDZ C;  2MBF A;  2R7F A;  3J80 Z;  2D1V A;  2CO5 A;  4KN4 X;  3E6B A;  4ENN A;  1BBY A;  4JBA A;  2XV4 S;  4KMU X;  1XCV A;  2OQR A;  3OV8 A;  3FXU A;  2MD5 A;  1WSU A;  2F5E A;  1S8N A;  1XD7 A;  1YS7 A;  1XSD A;  1BM9 A;  1BI0 A;  3I58 A;  1CF7 A;  2O61 A;  5K1Y A;  1FYL A;  3O2P E;  4S05 A;  4U88 A;  1Z7U A;  1RUN A;  3NRV A;  4EJW A;  1G4D A;  2XAG A;  2OAZ A;  1FZP B;  4QLC U;  5TRD A;  3HTU A;  4N9I A;  2XAS A;  3FM5 A;  3K1P A;  4EQQ A;  1QBJ A;  4S04 A;  2YX7 A;  4Q4Z F;  1XSV A;  1UHM A;  5DCM B;  3EET A;  3K0L A;  5HOO A;  2E7X A;  4P9F A;  5KK1 A;  2W25 A;  3KP3 A;  1I5Z A;  4I0A A;  4UVB A;  4UV8 A;  4RB0 A;  2V6C A;  4MHG A;  1L3L A;  2QBY A;  2GQQ A;  3MZY A;  3TQN A;  2HYF A;  3GVA A;  1B1B A;  3F6V A;  1B9M A;  3WTU C;  2A3S A;  3ROU A;  3HIF A;  3ECO A;  2JSC A;  1RI7 A;  2IA0 A;  2VT3 A;  2CG4 A;  2VBW A;  1IN7 A;  4ZYH A;  4FX0 A;  2ZKZ A;  4CYD A;  2Y48 A;  4BXU A;  2HR3 A;  1JE8 A;  4LG0 A;  2QZ8 A;  3LFK A;  3F21 A;  2ZNZ A;  3P7N A;  3QPH A;  2FMY A;  4CGZ A;  2FOK A;  4ENM A;  4EV0 A;  2CW0 F;  2OA4 A;  2IRF G;  2ZO4 A;  2PBI A;  3ZPL A;  4ON0 A;  1T38 A;  3L9F A;  4RAY A;  4WX9 A;  1R1T A;  3RYR A;  3JW4 A;  5D5U B;  2ZCW A;  3KP7 A;  2QM3 A;  4EGY A;  3TOA A;  1K6O A;  2XIG A;  4ESF A;  3BPV A;  2KRF A;  1W4M A;  2DO7 A;  2EV0 A;  4FX4 A;  3BJA A;  2EA4 A;  2PN6 A;  3JAM K;  2HTJ A;  3WG9 A;  3L7W A;  1ZAO A;  2PMH A;  1SMY F;  1KYW A;  5A2Q Z;  3CTA A;  1J9I A;  1R22 A;  4G7Z F;  5LHH A;  3BWG A;  2P7V B;  3EQL F;  5FD6 A;  3IL2 A;  5TJJ A;  2RGV A;  2WC2 A;  2HGC A;  4CO8 A;  1MDM A;  1U2W A;  2XRN A;  2OU2 A;  2HKX A;  2DLL A;  4CXF A;  4Q47 A;  2F2E A;  2ESN A;  1TW2 A;  4ZH4 F;  1FT9 A;  4GCV A;  1I6X A;  1USS A;  1YW9 A;  2XAH A;  3K1N A;  2LNB A;  2COM A;  3RTR A;  1PP8 F;  3KLN A;  1Z6T A;  3FM3 A;  3WTX C;  1KQ9 A;  4EJU A;  4BHP A;  3J7A O;  1WRJ A;  2A5Y B;  4P55 A;  1WI9 A;  2OD5 A;  3WE3 A;  2VBY A;  3I0T A;  5EEG A;  2EV5 A;  1YYV A;  3RPQ A;  2EB7 A;  1IN5 A;  4Z2Y A;  3ABU A;  1F4K A;  1ZLK A;  1GXP A;  1XN7 A;  2FBI A;  3QU6 A;  4BNC A;  2EK5 A;  3I71 A;  2O6G E;  2IP2 A;  2J5O A;  1SD5 A;  4DNC A;  4M9X A;  4HLX A;  1D5V A;  1IUY A;  3K1M A;  2FQ3 A;  3F8C A;  1J7K A;  1RIO H;  1I1S A;  3JAM Z;  4H0E A;  2PFB A;  2MLG A;  4BYY A;  3JSP A;  3DKW A;  4G8X A;  1U5T B;  2A61 A;  5FFX A;  3SHF A;  2L4M A;  4EM1 A;  3BP8 A;  3FMS A;  1W7P B;  3U1D A;  3RIR A;  5KVR A;  3QP5 A;  1H9T A;  1YTY A;  5FFZ A;  1ODD A;  3LA2 A;  1KQ0 A;  2P8T A;  4MQV A;  4CIC A;  2FRH A;  5HDK A;  3V7R A;  3PFI A;  3G73 A;  3RKX A;  4IHT A;  1C0W A;  4L9V A;  1TLH B;  2OZ6 A;  4YII A;  5DUK A;  4HW0 A;  1HKQ A;  1HW5 A;  2BEO A;  2VBZ A;  2RNJ A;  1LB2 A;  1KYZ A;  4B8X A;  1E2X A;  5LRR A;  5E18 F;  1Z9C A;  1ZRC A;  4I2O A;  3QRF F;  2CGP A;  3QP6 A;  2VXZ A;  4MNU A;  5LGT A;  4E70 A;  2KIF A;  1W5T A;  2B0L A;  5CYV A;  4KDP A;  5E8I A;  1DPU A;  4YFN F;  4KA4 A;  1G6N A;  2C6Y A;  1OR7 A;  3V4G A;  1QNT A;  1XGN A;  4D0P A;  1B6A A;  4IXA A;  4I02 A;  3MAJ A;  4XSZ F;  2IVM A;  5D6F A;  2HYG D;  3KLO A;  1ZGJ A;  5E17 F;  5DV5 A;  5EEH A;  3RYP A;  4I98 B;  5D4S A;  1B59 A;  1MD0 A;  1Q1H A;  1IW7 F;  2HQR A;  4CZZ A;  3Q9S A;  3GW2 A;  1JHH A;  3I54 A;  2PQ8 A;  4WWC A;  3BOQ A;  1R23 A;  1YQA A;  5FO5 A;  3GLX A;  1O3R A;  5F6F A;  2ZME B;  3WTS C;  1U5T C;  5ICF A;  2Z33 A;  5H6R A;  3HRT A;  5L3B A;  2O8X A;  1SD4 A;  3KP6 A;  3E6C C;  1FYM A;  3MQ0 A;  3P9K A;  3IHU A;  3Q9V A;  3F23 A;  4ASN A;  1YO5 C;  3FZV A;  2UWM A;  3GFJ A;  3QU3 A;  5ICG A;  4U0Y A;  3REO A;  3IKT A;  4M9S A;  1LEA A;  4U7D A;  4L0Y B;  4MQ9 F;  1XDS A;  2JT1 A;  1K78 B;  1U6G A;  2GZW A;  3U9G A;  2E7W A;  4RB3 C;  4HZF A;  2PMU A;  4R1H A;  2L01 A;  3LA3 A;  2PI0 A;  3I59 B;  2H6C A;  4ETS A;  1QQI A;  3LAJ A;  1TNT A;  2HWV A;  1U3E M;  1QZZ A;  5HDG A;  1K79 A;  1T2K A;  2FE3 A;  3T5X A;  3CO6 C;  2LKP A;  2Q2E A;  4OIO F;  3HSF A;  2NRA C;  1TQI A;  3VFZ A;  3LWF A;  4A6E A;  2EFQ A;  1IAW A;  1G3S A;  2VE9 A;  3BPX A;  2FF4 A;  2V1U A;  2P5L C;  3GYH X;  4LLG F;  1K7A A;  2CFX A;  2K4B A;  4XSX F;  2HS5 A;  3GX4 X;  1G3T A;  4F7Z A;  4G94 A;  1KU2 A;  1YW7 A;  2D1H A;  4HBL A;  2EA2 A;  4HV5 A;  1XGO A;  3IRR A;  4OOI A;  2XKP A;  2R7D A;  2IW5 A;  2EFW A;  1YW8 A;  1BJA A;  3F72 A;  4AIK A;  1SFX A;  4UVA A;  1XCB A;  2PEX A;  4OMZ A;  4WXC A;  3PQJ A;  3M1E A;  1X3U A;  5CVV A;  2IT0 A;  1DP7 P;  1J0R A;  3LQQ A;  2G9W A;  1TBX A;  2R3S A;  4HA8 A;  1ZG3 A;  4IF4 A;  4O6J A;  1E17 A;  3R0J A;  2RKH A;  4MTD A;  3RI4 A;  2DI3 A;  3JTH A;  1P4W A;  1FWZ A;  3U2R A;  2KIM A;  5L3G A;  3WE2 A;  4EVI A;  1S7A A;  5L3F A;  2ETH A;  2NS0 A;  3TGN A;  1BC7 C;  3D5L A;  1G3W A;  5E1Z B;  5LEJ A;  1W7P D;  1LEB A;  2A69 F;  4GYI A;  2BGC A;  1S6L A;  3C7J A;  4K2E A;  4ZYE A;  2RN7 A;  1P2F A;  5AIQ A;  4UVC A;  2ACJ A;  4WCG A;  1ON2 A;  4ENK A;  3JTG A;  2VON A;  4M6Y A;  4G7H F;  2HTS A;  3IWF A;  5HLG A;  2G7H A;  1IN6 A;  1FBU A;  3QAH A;  5A2Q K;  2K86 A;  3GWZ A;  3BRO A;  4L5I A;  1F9N A;  4RGS A;  1Z05 A;  5ICE A;  2ISZ A;  2NYX A;  2P6T A;  3EDP A;  2EFP A;  4A0Y A;  3N97 A;  1HXD A;  2H6B A;  2PLY A;  3CO7 C;  2P6S A;  1XDU A;  3ABT A;  1FBS A;  5AON A;  3BDD A;  2P7C B;  2F5C A;  3KET A;  1FC3 A;  2XHK A;  2DK8 A;  3EYY A;  1YLF A;  2OZU A;  4TV7 A;  1WKM A;  2BYV E;  1OYW A;  3E6D A;  5ILU A;  4L18 B;  3W6K B;  2ZXJ A;  3BZ6 A;  4HF2 A;  4M72 A;  1ON1 A;  3TDU C;  4AWX B;  4P5O A;  3HRS A;  3KP2 A;  1UST A;  3J81 K;  2JPB A;  2A6E F;  2XUB A;  1UFM A;  4AD9 A;  4BQA A;  2MA3 A;  1GVJ A;  4IVN A;  3VOD A;  4HF1 A;  3H92 A;  1ZRD A;  2BBY A;  3ISP A;  3CUQ B;  2QUF A;  3NQO A;  4A5M A;  3WTV C;  1SFU A;  2G7U A;  1QO0 D;  3HHG A;  4HX8 A;  2RC4 A;  1LDK B;  2M45 A; 
#chains in the Genus database with same CATH topology
 1YHQ I;  2DFI A;  5LHI A;  1IXR C;  2XDV A;  3LAP A;  4F91 B;  2JA5 J;  2JQ7 A;  2L54 A;  2Z9O A;  3CJN A;  4Y15 A;  1RNL A;  4NQW B;  4A3K J;  4NHJ A;  1QGP A;  4ZTF A;  2L9R A;  1WZ2 A;  3GZ5 A;  2FML A;  3K4L A;  3DTK A;  1R4N B;  3RPU A;  4P9U A;  2QVO A;  4NBQ A;  1VQM I;  3X2Q H;  3JRI A;  3QQA A;  3ZN1 A;  3DXJ F;  4BAY A;  5D5X B;  1JGS A;  2FSW A;  3OYC A;  1GV2 A;  4S0H B;  1LE8 B;  3ZMU A;  1A36 A;  2CQQ A;  2JRM A;  2Y0M A;  1BOB A;  4KIF A;  2ECC A;  4IOC F;  1FPQ A;  1SD7 A;  2QQA A;  3VPR A;  5H2F C;  3HSR A;  1R58 A;  1R7J A;  1AOY A;  4UUT A;  5HLI A;  1FSH A;  2WY7 Q;  4ZYD A;  2F5F A;  3OIQ A;  1W0T A;  1LKX A;  2GIZ A;  5IYC J;  2DOF A;  3DPU A;  1H0M A;  1O57 A;  2Y30 A;  2M1B A;  4CYC B;  4IQJ A;  1AWC A;  2ZJ2 A;  1L0O C;  2TRT A;  3CC2 I;  3D5R C;  1CF7 B;  1S3J A;  3HOT A;  2ESH A;  4YG2 F;  3KP5 A;  1GHC A;  2WWY A;  4XKV A;  5ILS A;  2DAO A;  5J1U A;  4IJA A;  1LVA A;  5K5O A;  4HDU A;  3FHZ A;  1ZTR A;  2HEO A;  2EJR A;  1SAX A;  1EH8 A;  3ELK A;  2D45 A;  3OSF A;  1TT5 B;  2CWE A;  2EIJ H;  5BS6 A;  3CCL I;  2ELK A;  2Z1D A;  3VB2 A;  4C2U A;  3FX3 A;  4KNY A;  4DZJ A;  2P5V A;  1IRG A;  2BY2 A;  1I6H J;  3MWM A;  2CQX A;  4EM2 A;  2NOG A;  1BIB A;  2NS7 A;  4HX4 A;  3J81 Z;  5DS9 A;  2WV1 A;  3B02 A;  4I0B A;  2JUC A;  3GZ6 A;  4XQF A;  2FQ4 A;  3O8H A;  3KEY A;  2EFO A;  5FKN A;  4CHU A;  4FET A;  2LY9 A;  4A3L J;  4RLF A;  5FLM J;  3AKZ A;  1MJB A;  1T98 A;  2M30 A;  5LFA A;  3K2A A;  2Y69 H;  1DQU A;  3C2B A;  4AVZ A;  2BXY A;  3CF2 A;  2QLZ A;  3R61 A;  4BHB A;  3DP7 A;  3CUQ C;  4CCM A;  3WTZ A;  3AAF A;  3PNV A;  3P5J A;  2AXL A;  5CVI A;  4LFU A;  2IJL A;  4R79 A;  1G3Y A;  2QBY B;  3JSO A;  3FMR A;  2JTV A;  2VPR A;  4Y4R A;  2DFE A;  2H8W A;  2CUZ A;  4OIP F;  4NC6 A;  2QWW A;  5LBQ A;  2L7Z A;  3E97 A;  1CGP A;  5JVT A;  1VTN C;  1S72 I;  3OMY A;  1UHS A;  1EKE A;  1ZYR F;  1BI1 A;  3I4M J;  3OYB A;  1YOV B;  1X1B A;  2XKO A;  2MFZ A;  5H6Q A;  1E3O C;  3ZCO A;  1SC7 A;  3DFG A;  5L3E A;  3T0Y A;  3TP3 A;  3MKW B;  4LLL A;  3FKJ A;  5ICC A;  1ETY A;  5M5Y J;  1RUO A;  1TQP A;  1UHW A;  3GFM A;  2XRO A;  3RJP A;  3KCC A;  3ZQQ A;  4ESB A;  4XLN F;  3BTL A;  4Y7N J;  2L3D A;  4XN0 A;  5BPI A;  1XS9 A;  5TGT A;  1YI2 I;  4G6T B;  1MZB A;  1J75 A;  2VC1 A;  3VSL A;  1HKT A;  4LG0 B;  4NB5 A;  3HBL A;  1G8X A;  2QKL B;  3TBI A;  4F52 A;  5AIP A;  3TOB A;  4M9Z A;  3ZMT A;  1B8I B;  2A07 F;  3ONQ A;  2QQB A;  3S93 A;  4QWQ A;  1HSJ A;  3KYC B;  3LSJ A;  3OOP A;  4UXN A;  4BDZ A;  1KU3 A;  2JZY A;  4L5J A;  5BOX A;  1Z3Y A;  4I99 C;  2OQG A;  3L09 A;  4CCO A;  1V3F A;  5J4V A;  1XG1 A;  2K9N A;  2CYY A;  2KIQ A;  4MEY F;  5HS9 A;  2O5R A;  2L9S A;  3S1M J;  4AIJ A;  3S2W A;  3M1C A;  3NEU A;  2WTE A;  1MKM A;  3HKZ A;  3E5Q A;  1YIO A;  1RR8 C;  2BZT A;  1NHA A;  2E1M B;  2RVC A;  4E7I A;  2CUE A;  1N78 A;  2A05 A;  2EV6 A;  1ZG5 A;  4XM3 A;  3OYG A;  2RV8 A;  1X4P A;  2DPD A;  3HOX J;  1F36 A;  3ECH A;  4XLE A;  1D8K A;  5EYR A;  5CKT A;  2FD5 A;  1QU3 A;  2EFN A;  2LRD A;  2PG4 A;  3W2V A;  1XSX A;  3NWS A;  2RDP A;  5FRN A;  3FMQ A;  4KIB A;  4HX7 A;  2M2E A;  1IRX A;  2X85 A;  5J8C A;  4MTE A;  2JA8 J;  3C2H A;  1MIJ A;  1MMS A;  1WJB A;  2FBH A;  1G59 A;  1XGM A;  1FIA A;  5DEQ A;  2ZBK A;  4B3A A;  1Y0N A;  2DFH A;  3RQ4 A;  2MW8 A;  2ME6 A;  3JRA A;  1D3Y A;  3CCU I;  3A03 A;  1WJ5 A;  1NK3 P;  1R6R A;  2Y2Z A;  2M7B A;  4CCL A;  5LHG A;  5J40 A;  3QOP A;  2VN2 A;  3HEF A;  3GCM A;  1P6R A;  2IXS A;  3T1B A;  3F9K A;  4ZZL A;  1R00 A;  2DT5 A;  2H09 A;  5J8F A;  4BEH A;  4UB6 C;  1ZHF A;  2H8R A;  5D5W B;  3MZH A;  3K9T A;  4BUP A;  2VT2 A;  1FTT A;  1O7L A;  2KZG A;  1QZY A;  1OLT A;  4AYB A;  3CCR I;  2M8E A;  2E2I J;  1FEX A;  4IRH A;  3LSR A;  1H8A C;  1KU7 A;  2NXN B;  5E3M A;  1MDM B;  2P0W A;  4JX4 A;  4KIC A;  1S29 A;  1ZEL A;  3TW6 A;  3OYA A;  1ZGW A;  3K2Z A;  4ZDL A;  3VWB A;  5EZH A;  2LBF B;  2VQC A;  1VZ0 A;  4XID A;  3HTS B;  2WV0 A;  4PGG A;  3OY9 A;  1U8B A;  4IX7 A;  3CD6 I;  2DBB A;  5FD5 A;  3TP0 A;  3KZY A;  2XF7 A;  1TW3 A;  2X9D A;  1WWX A;  4HOB A;  4II3 A;  3QOE A;  3ZMS A;  2GBY A;  1IN4 A;  4F93 B;  1IF1 A;  4HEA 2;  2IA1 A;  4JQF A;  4UHT A;  1YG2 A;  1HW2 A;  4XRS A;  3HYI A;  1Z77 A;  2QCO A;  4KT5 C;  1PUF B;  2JRT A;  1OYY A;  3HOV J;  3GZN B;  2JVG A;  3O3K A;  5LGN A;  4RAZ A;  1JUS A;  4LD5 A;  2ADU A;  5BPD A;  4AU7 A;  2ELJ A;  2H1L A;  2Q8K A;  4BKX A;  2V79 A;  3LL7 A;  3I4N J;  2E60 A;  3Q5F A;  1TWF J;  4PGH A;  2CQK A;  5DM7 F;  4W1U A;  1W5S A;  2R7Q A;  1VQK I;  4HLY A;  4WF2 A;  2LTP A;  1H9G A;  3WU1 B;  4G6D A;  2HDW A;  2E19 A;  1P92 A;  3V7S A;  1ZGA A;  1W1W E;  3ZMD A;  4M3F A;  4PFP A;  5B1B H;  3V42 A;  3BR1 A;  3WOD F;  5E3L A;  2DQL A;  3T8T A;  2Z5U A;  3FWE A;  3TO9 A;  2L5Q A;  3WHB A;  2GA1 A;  3AL0 B;  1Z1D A;  1HQC A;  4HYE A;  3VDX A;  1SAN A;  1R36 A;  3FXO A;  3F8M A;  4LIV A;  2ELH A;  1F1Z A;  2J5P A;  5ILV A;  3ZN0 A;  3K70 D;  2BHZ A;  5BMZ A;  1JT6 A;  1TNS A;  3SJM A;  2P81 A;  1IZ1 A;  1V4R A;  4GGG A;  2KJC A;  3MCZ A;  1I3A A;  1MH3 A;  2P5K A;  4RAF A;  3MFK A;  1Y8Q B;  2LDU A;  4XKB A;  2M34 A;  3G1M A;  2V1X A;  3C1D A;  3A01 A;  2XAQ A;  1CQT A;  5H20 A;  3R6S A;  1ZG1 A;  1FP1 D;  3S3N A;  1Z3X A;  1Z7L A;  4U7B A;  3EUA A;  3FBN B;  1HCR A;  4M6X A;  4D7N A;  4P1W A;  1OCT C;  4L5E A;  3CMY A;  3HPG A;  3ZRG A;  4AIH A;  2DOE A;  2HFH A;  4Z6Y A;  2F5D A;  4AID A;  3KZZ A;  2Q0O A;  2JJ7 A;  2RNG A;  3SFI A;  5HLT A;  4DBQ A;  1QPI A;  2M4G A;  1IG7 A;  5D6E A;  1D1B A;  2FEZ A;  3ZMZ A;  2FXA A;  1PJR A;  2E1C A;  3HM5 A;  3JRD A;  1MNE A;  3QYB A;  5M5X J;  4KJZ A;  3CJQ B;  1FX7 A;  1HST A;  2DQR A;  1WJE A;  2K9Q A;  2P4W A;  4MGR A;  3ZR8 X;  2CU7 A;  4MLO A;  3OSG A;  3EUH A;  3GLL A;  2R7R A;  1FYK A;  2CW7 A;  4XLF A;  3COA C;  1QA6 A;  3GTQ J;  2X1D A;  1FNN A;  4YFK F;  1YJW I;  3SEZ A;  3ML6 A;  3OL4 A;  2R0Q C;  3HRU A;  4A12 A;  1ETO A;  2F5V A;  2HVS A;  2XGX A;  2X1C A;  3OWT A;  2OV7 A;  3CES A;  4IHX A;  2DK5 A;  2WAE A;  5JHU A;  2L02 A;  5EG0 A;  2ZFU A;  4HG2 A;  1JUP A;  4BDY A;  1ZRF A;  1TZL A;  2QEX I;  2KIU A;  3I64 A;  2XGC A;  3OIP A;  3J7Z I;  4KYW A;  3DEW A;  3RKY A;  1VFC A;  2YU9 J;  2HVR A;  1GXQ A;  2M5W A;  2KKO A;  4UV9 A;  1OPC A;  4RGR A;  3P9I A;  3S14 J;  3F6O A;  5LGU A;  2DMU A;  4R8H A;  3F22 A;  3IP4 B;  3V8L A;  3ZQI A;  2CUJ A;  1R5G A;  4I01 A;  4OU0 A;  5E79 C;  4MFD A;  2W4S A;  2FJ1 A;  5CLS A;  4X1E A;  4EMS A;  2EWN A;  2ZC2 A;  2XF6 A;  1RZ4 A;  4C30 A;  5ED4 A;  3BG3 A;  1SMT A;  2FA5 A;  3H3Z A;  5F04 A;  3BJ6 A;  3MEX A;  4BQN A;  2L4A A;  2Y9Z A;  1VQ9 I;  2PJR A;  3WGI A;  3QPL A;  2YUS A;  1ZLJ A;  3L00 A;  1ONV A;  2DYS H;  4FQG A;  1BOA A;  2DA3 A;  4HDV A;  1APL C;  2EIN H;  4OIQ F;  3UKG A;  1F5T A;  3K4C A;  3HRM A;  4L9J A;  5DD4 A;  1TL8 A;  2XPW A;  1T8I A;  2XAJ A;  1SVM A;  3GME A;  3RSN A;  3OYN A;  4PSW A;  4E7H A;  1QHG A;  1SVO A;  2GXG A;  1WJF A;  1OCC H;  2KL4 A;  2QEN A;  3D0S A;  3WU0 A;  4DGW B;  3AL0 C;  3F8F A;  2R7V A;  4LK0 F;  3PO3 J;  2O03 A;  3MD2 A;  2A68 F;  4ABZ A;  2AS5 F;  4GFB A;  5EEA A;  3ULQ B;  2Z99 A;  3DTI A;  3H9J A;  4JOM A;  1IJW C;  1WGX A;  4FIS A;  3OS1 A;  1XC5 A;  2ZNY A;  2AQF A;  2B7E A;  1TC3 C;  3VYT B;  1O3Q A;  1ZAR A;  2L2O A;  2HOS A;  3PFY A;  3GFI A;  2Z2S B;  3OR1 C;  5F0C A;  3IRQ A;  1R71 A;  1I39 A;  1D1A A;  2DMQ A;  4BBR J;  2VKV A;  4MFE A;  3QYE A;  4CCN A;  5J6X A;  1SFE A;  2LOO A;  3DEU A;  1FLI A;  5B3S H;  4XKW A;  4KIG A;  4H4K C;  3R4K A;  4XLA A;  2QA4 I;  4ENJ A;  4WK8 F;  3GO5 A;  2BV6 A;  4HQE A;  2VE8 A;  2K02 A;  2X6X A;  4B09 A;  3IWZ A;  2ISY A;  1QHH D;  1IRF A;  2XGE A;  4XBF A;  4D1Q A;  4EGZ A;  1HLV A;  2DN0 A;  1HBX G;  3H0D A;  2M87 A;  5IP9 J;  5J1Y A;  4RB2 C;  4L9T A;  4ESJ A;  1RC9 A;  3E1S A;  2VOO A;  3E5U A;  2GA2 A;  1ZKG A;  4RS8 A;  4IL6 C;  1W36 C;  1DPR A;  1RKT A;  3DBL B;  2NVQ J;  3WHC A;  1ZN2 A;  1ZK8 A;  2YU3 A;  4KFC A;  1D8J A;  4A6D A;  2B63 J;  2AHQ A;  2JUG A;  1ULY A;  2QYO A;  3BR0 A;  2KJB A;  3DF8 A;  5D4R A;  2OBP A;  3B6A A;  4Y17 A;  5EF6 A;  5BQT A;  5GAG J;  4DQ2 A;  3ZP5 A;  1MJA A;  1FY7 A;  4UUS B;  3CCY A;  3CUO A;  3LSK A;  1P4X A;  3BR2 A;  4GYG A;  4HSR A;  4HV6 A;  3CZ6 A;  4M74 A;  2K3P A;  4YFX F;  1FOK A;  4AUX A;  3ASO H;  1ZRE A;  1T56 A;  1KGS A;  1PUE E;  2OCE A;  1TTY A;  4HRI A;  4IHS A;  1JXS A;  3CDH A;  3BZK A;  1U5T A;  2MGQ A;  2MG4 A;  3W6J B;  5JHF A;  4LIU A;  4U0V A;  1NH3 A;  3Q0V A;  2Q2E B;  2R7X A;  5LLQ A;  2HXO A;  1W7P A;  5K5R A;  4BY7 J;  3BJO A;  1XMK A;  1B72 B;  2YPR A;  2YX4 A;  4RB1 A;  1DGR M;  4BBS J;  5IT9 K;  5K5Q A;  2EPF A;  3RKW A;  1Z21 A;  5HLH A;  3O6B B;  2WAF A;  4DOZ A;  5E1X A;  2W84 A;  2E34 A;  4BGD A;  2HDD A;  3VOE A;  3HHH A;  3BCB A;  1HA8 A;  5DD8 A;  3KEQ A;  2W85 A;  3PSF A;  1QRY A;  4GO1 A;  4OAZ A;  4IHW A;  5J3L A;  4A3D J;  1FMW A;  1JKO C;  1P4A A;  1WJA A;  2E2H J;  4ZTJ A;  3HPH A;  3BTC A;  3R0A A;  4BQQ A;  1T6S A;  1YJN I;  3SXY A;  5HS8 A;  3V8K A;  5IYB J;  3E3V A;  3KPH A;  2HZT A;  1DDN A;  3GEZ A;  3ZQ7 A;  1VF9 A;  1QPM A;  1I1G A;  1XMA A;  3JRH A;  3FF5 A;  1N25 A;  4GXO A;  3K69 A;  2KP6 A;  3K4K A;  3TMO A;  1BA5 A;  3I4P A;  4LLN A;  1HC8 A;  3G6E I;  5HDN A;  1BW5 A;  1JJ8 C;  1YRN B;  1P7I A;  1HDP A;  3TO6 A;  3I5U A;  3OL3 A;  3SZT A;  4B3X A;  1W5C C;  3HGG A;  2L0K A;  2H27 A;  2LF7 A;  1VQ4 I;  1T0F A;  2BY0 A;  2TDX A;  1A04 A;  1S5L C;  2HQN A;  1X3W B;  3RDI A;  1O3S A;  2XPU A;  1PVE A;  5DDG A;  3MZ8 A;  4QPO A;  2IS2 A;  3S8P A;  2HKO A;  4RGX A;  3PNT A;  4RGU A;  2M9H A;  3CDL A;  1MJ9 A;  3LA7 A;  1REP C;  5K7F A;  1R4M B;  5FLX K;  1S7O A;  3I55 I;  3BR5 A;  2CW8 A;  3WG7 H;  4D5C A;  1P7J A;  3Q0U A;  4BJ5 C;  2LF8 A;  3FXK A;  3FXQ A;  4BQO A;  5LD2 C;  2UUZ A;  2UXX A;  4G6Q A;  2CSO A;  3GUD A;  1GLN A;  3LSH A;  1UCR A;  4IRI A;  1RR7 A;  1V5G A;  1HKS A;  1XB4 A;  4NDL A;  5JVG F;  3OIO A;  4CA0 A;  3S1R J;  1VQO I;  2X6W A;  4OWR B;  2WAD A;  4ZJZ A;  1XMX A;  4N9H A;  2V4J C;  3JRF A;  2ZME A;  2H94 A;  2GXA A;  1W0U A;  3KEO A;  4M73 A;  5CPR B;  4HQM A;  2KLO A;  1HF0 A;  2XPV A;  3ZXS A;  1B9N A;  3JCU C;  1A5J A;  1X19 A;  3N4M A;  4CCJ A;  4ZYG A;  1Y0U A;  3UNG C;  2GAU A;  3M9A A;  2IGN A;  3CCV I;  2LFB A;  4AC0 A;  1J09 A;  1ZQ3 P;  2R5Y A;  4PDK A;  3HOU J;  3OYE A;  3FKI J;  1A31 A;  5FLV A;  1EH7 A;  1WPK A;  4ZZD A;  3IAM 2;  3C18 A;  1OMI A;  3M07 A;  2DDA A;  2HPM A;  2DA4 A;  1FOW A;  5L3D A;  5HNF A;  2ZXI A;  3IKV A;  1F43 A;  2JPC A;  3F3X A;  5IT9 Z;  3A02 A;  5IOY A;  2FU4 A;  2DA7 A;  1DU0 A;  2MH9 A;  3SFZ A;  2FOW A;  1OYI A;  2VOD A;  1OCZ H;  1U9O A;  2DU9 A;  4DBR A;  3NAR A;  3HKZ N;  3BG5 A;  5EGO B;  3CCM I;  1K78 A;  3CP2 A;  4IPA A;  4GDF A;  1MBF A;  3DV8 A;  3V8J A;  2RQP A;  1IV6 A;  3ZQL A;  3VEP A;  5M5W J;  1NTC A;  2X0L A;  2V9V A;  3T8R A;  2DPU A;  3BTI A;  2ZXW H;  1A6Q A;  1SEU A;  3I59 A;  2IAI A;  4LJZ F;  3V7C A;  4EAT A;  2ZXH A;  1IXC A;  3H36 A;  3JRC A;  5E3O A;  3ESW B;  2KPM A;  2UZK A;  2DTR A;  3ABK H;  2XSD C;  1KON A;  3EUH C;  3OYK A;  2F6C A;  2W82 A;  4PFO A;  5D8L B;  1ZH5 A;  3GF2 A;  2ZJR F;  1D0Y A;  1SVL A;  5IT3 A;  5FB2 A;  4EM0 B;  4IKF A;  2VC0 A;  5LEK A;  4PCQ A;  2R7Z J;  3F8B A;  2I10 A;  1T39 A;  5HVQ C;  1VQ6 I;  5F1J A;  1XGS A;  3C2G A;  4M71 A;  1WFX A;  3L2W A;  4DJA A;  2OPT A;  5F1R A;  2Z3Y A;  1BIA A;  2O3F A;  2VLA A;  2W1O A;  5E1W A;  4EJT A;  1PP7 U;  1OFC X;  1QVU A;  3PIP F;  3HOS A;  5E20 A;  2LSO A;  2BE5 F;  2XSJ C;  4U0W A;  1ETX A;  2K9S A;  3CJR B;  3HUG A;  4L9N A;  3VYR B;  5FLX Z;  4FHT A;  4BL0 B;  2K4J A;  4BJ6 C;  4AYB N;  4YIF A;  3F8N A;  1KA8 A;  3PM1 A;  5CVU A;  2R5Z B;  2GOM A;  4QIW N;  1BI3 A;  1JTX A;  3TKY A;  3DPL C;  1K4S A;  3PNY A;  3N05 A;  2GM4 A;  2GXB A;  4XOP A;  2CV0 A;  5FGM A;  4G7O F;  3SZP A;  2K5C A;  3G3Z A;  1R1U A;  3EUK L;  3VYS B;  4XKC A;  2UXN A;  5F64 A;  2GIV A;  5FRM A;  4RA2 A;  2IGO A;  1T08 B;  4B1R A;  1LQ1 A;  2XB0 X;  2HDC A;  2OJE D;  3FXJ A;  3PQK A;  2STT A;  3BY6 A;  2HI3 A;  1WJD A;  4BH9 A;  2A6H F;  2NVT J;  9ANT A;  4IHY A;  4A2U A;  2YSR A;  3LQR A;  2X4H A;  2EIM H;  4BY1 J;  2FX0 A;  1D5Y A;  3K10 A;  1O3T A;  3RQI A;  3M8F A;  4XLP F;  1Y1V J;  4II2 A;  4L0Z B;  1Z0X A;  2K27 A;  3TED A;  3PIO F;  1FBQ A;  3HZJ A;  3R60 A;  1YIT I;  1R5H A;  1WJC A;  4OIN F;  3SDB A;  5M3M J;  2L9V A;  4OIR F;  4E7J A;  1PDN C;  1LJ9 A;  2IA2 A;  4A0Z A;  3QWL A;  5K7H A;  4XIC A;  6PAX A;  1SFO J;  1VQN I;  5EDN A;  4RM3 A;  2OCC H;  3U21 A;  3ZQG A;  4LK1 F;  3KE2 A;  1BI2 A;  3ZQF A;  3B73 A;  1BL0 A;  1MGT A;  3C3W A;  4E7Z A;  4EJV A;  4Y33 A;  2DJN A;  1EJ9 A;  3GTK J;  2K7L A;  4FE7 A;  4KN7 X;  2E36 A;  1FOY A;  5D5V B;  3OS2 A;  2VOP A;  2V1N A;  2BXZ A;  4LGW A;  4OMY A;  3ZQC A;  1TWH J;  5CVR A;  1Q1V A;  2LKS A;  1U78 A;  3KYL A;  3CLO A;  3KFW X;  3LST A;  4I6Z A;  2HPI A;  4JK1 X;  3DEE A;  3W2A A;  1T33 A;  4G9Y A;  3WGG A;  2XAF A;  1R5I D;  1V54 H;  2HOE A;  2FUG 2;  3H3U A;  2PJP A;  2KMU A;  4C2M J;  5JFR A;  3BG9 A;  2XAU A;  4Y13 A;  2EIK H;  1LDD A;  4WXD A;  4IZZ A;  1UAA A;  1AA7 A;  1HW1 A;  3BZC A;  1KU9 A;  5ERI A;  3ERE D;  2O0Y A;  5GAE J;  1S7E A;  3BC8 A;  4EJO A;  2DXI A;  3J7Y J;  3JRB A;  1WI3 A;  3WTY C;  4IRG A;  2V7F A;  4UUV A;  2V6E A;  2W57 A;  4KUM A;  4A0X A;  4DIQ A;  1Z6R A;  4PJN A;  4V2G A;  3M7G A;  3I9V 2;  2AO9 A;  1WQ2 A;  2Y0S A;  3HC7 A;  3DPT A;  3HSE A;  1ACI A;  2R7S A;  5DCM A;  4MEX F;  1ETQ A;  1MH4 A;  1V5F A;  3TO7 A;  2M3A A;  2FNA A;  5IYD J;  2W24 A;  1TT0 A;  3CCE I;  2NAZ A;  3IC7 A;  4HNV A;  1SD6 A;  2IPQ X;  4HF0 A;  1LDJ A;  1EH6 A;  2BW3 A;  1OCO H;  2MH2 A;  4A5N A;  2EQR A;  2D5V A;  4B47 A;  2DJI A;  4WXH A;  3E6M A;  1OCR H;  2LY2 A;  3A0B C;  4BE2 A;  1STZ A;  5CQG A;  3J80 K;  5L3C A;  3E5X A;  2QQ9 A;  3DLA A;  4CH7 A;  1O7F A;  3EYI A;  3ERM A;  1Z91 A;  3W2W A;  3GTO J;  2VBX A;  5FKM A;  1BN5 A;  1MMG A;  1JTY A;  3CMA I;  1JHF A;  2E1N A;  3OYM A;  1LFP A;  1YS6 A;  2NNN A;  2GWR A;  4LB5 A;  5E8G A;  1RRJ A;  5JR3 A;  3WGH A;  3HB9 A;  2Y75 A;  4HAM A;  2HOT A;  1YE9 A;  1MSF C;  1IXS B;  1TQM A;  1D1C A;  1WHU A;  4O5V A;  5DYM A;  2CV2 A;  3L2C A;  4KMF A;  1BC8 C;  1AKH A;  4F92 B;  5FKL A;  1IN8 A;  2MLK A;  2E35 A;  4PZJ A;  4CUG A;  2FBK A;  2VJI A;  5JI6 A;  4I09 A;  4XK4 A;  4LMY A;  3IAS 2;  2XVC A;  3FXR A;  4P96 A;  4AVP A;  3FBI B;  1RPW A;  3S15 J;  2ZFW A;  3QPT A;  2A6T A;  3DQV C;  1B4A A;  4LB6 B;  4Q48 A;  2LY1 A;  3WTW C;  1I27 A;  1YFH A;  1EV7 A;  1QVT A;  4C2T A;  4ITV A;  1KQ8 A;  4YEL A;  2L7K A;  1T0F C;  1LFB A;  1UB9 A;  3HOY J;  3H9G A;  2B9S A;  4I7H A;  5DCF A;  3GXO A;  2NNY A;  1R1V A;  5CJ9 A;  2STW A;  3KZI C;  4N0B A;  2YR2 A;  3DLL F;  4Q5S F;  4XRF A;  3VSK A;  2FNP A;  1OCP A;  1UZC A;  5CVJ A;  4O3M A;  5DUI A;  1LNW A;  2CFO A;  3K4M A;  4M3E A;  2DYR H;  1OKR A;  2D2W A;  1SFK A;  4HNT A;  2Q1Z B;  4BHC A;  4PJL A;  1U8R A;  1J59 A;  4HNU A;  1JI8 A;  3DWL E;  3P9C A;  5FKK A;  3I53 A;  1X1A A;  3M8E A;  1J5Y A;  2DW4 A;  2R7T A;  1DUX C;  2EH3 A;  4J00 A;  2MC3 A;  1I50 J;  1FP2 A;  5LRS A;  4KT6 A;  3CUQ A;  2ZME C;  2JA7 J;  4UNO A;  3GFL A;  1G2H A;  4CDG A;  1FSE A;  4B43 A;  1IDY A;  3KP4 A;  1RES A;  1X3Z B;  4RM2 A;  5F08 A;  3QOD A;  5D8K B;  2R4G A;  5HS7 A;  3RZO J;  4KIS A;  2DMP A;  3WTT C;  4FT8 A;  1QZE A;  2E71 A;  2V1D A;  3ZMV A;  1J2X A;  3H9Q A;  4NQW A;  3SQN A;  2ZB9 A;  3TDZ C;  1FJL A;  2MBF A;  4J19 A;  2R7F A;  3FIS A;  2NVY J;  1D0Z A;  3J80 Z;  3VYU B;  1ZR2 A;  1V5E A;  2D1V A;  2CO5 A;  4BU2 A;  2JSP A;  4KN4 X;  3E6B A;  4ENN A;  4E4H A;  4A3B J;  3LSP A;  2DTZ A;  1BBY A;  5TIS C;  3CQZ J;  3K4N A;  5IP7 J;  2KDZ A;  4JBA A;  2XV4 S;  1Z67 A;  4KMU X;  1XCV A;  2OQR A;  3OV8 A;  3CCS I;  3G4S I;  2V9P A;  3FXU A;  4C9Y A;  1JKQ C;  4BXX J;  2MD5 A;  2LVS A;  2OTL I;  2PMZ A;  1WSU A;  3H0G J;  1MNM C;  1EF4 A;  2F5E A;  1S8N A;  1XD7 A;  1YS7 A;  3SZG A;  1XSD A;  1BM9 A;  4CYC A;  2R7W A;  1BI0 A;  2QSF X;  1IDZ A;  3I58 A;  1CF7 A;  4BEH B;  2O61 A;  4FAS D;  1JT0 A;  1K83 J;  1LVK A;  2HXI A;  2K40 A;  4B44 A;  5K1Y A;  3GTJ J;  3K6G A;  3I3L A;  3KIO A;  4XRM A;  1FYL A;  3O2P E;  2Y31 A;  4S05 A;  4U88 A;  1Z7U A;  1RUN A;  2VQH A;  3NRV A;  1MMD A;  4LOC A;  4EJW A;  2JMW A;  3CCJ I;  4RDU A;  1G4D A;  2XAG A;  3KYD B;  2WAQ A;  2OAZ A;  2VPL A;  1FZP B;  4XR6 A;  4QLC U;  4RBO A;  5TRD A;  3HTU A;  4N9I A;  2XAS A;  3FM5 A;  3K1P A;  4EQQ A;  1BW6 A;  1QBJ A;  4S04 A;  4XN3 A;  4AM3 A;  3BG6 A;  2ME0 A;  4DYQ A;  3I56 I;  2YX7 A;  5GTH C;  4Q4Z F;  2VUM J;  1NK2 P;  1XSV A;  2Z16 A;  1UHM A;  5DCM B;  3EET A;  3K0L A;  5HOO A;  2E7X A;  4P9F A;  5KK1 A;  1FTZ A;  2W25 A;  3KP3 A;  1LPQ A;  1I5Z A;  3L2R A;  4I0A A;  4UVB A;  4UV8 A;  4RB0 A;  2V6C A;  4LIT A;  4MHG A;  1L3L A;  2QBY A;  3S2H J;  2GQQ A;  2OC6 A;  3MZY A;  2CH0 A;  3GBG A;  3MKL A;  4BE1 A;  2HU9 A;  2WB1 A;  3TQN A;  2HYF A;  3GVA A;  3QYF A;  1B1B A;  3F6V A;  2A5W A;  1N75 A;  2MSY A;  1B9M A;  3WTU C;  2A3S A;  1ETK A;  3ROU A;  2I5U A;  3BTJ A;  3HIF A;  4B48 A;  5GAH J;  4N4N B;  3ECO A;  2JSC A;  1RI7 A;  3PJR A;  2IA0 A;  2VT3 A;  3J7A Y;  2CG4 A;  2VBW A;  1IN7 A;  4ZYH A;  4FX0 A;  2LD5 A;  4EEF G;  2ZKZ A;  2DCE A;  2R93 J;  4CYD A;  3A2K A;  2Y48 A;  1ETW A;  4BXU A;  4XNF A;  4X0G A;  2HR3 A;  1GT0 C;  1JE8 A;  4IEJ A;  4LG0 A;  3A01 B;  4W97 A;  2VQG A;  1MBJ A;  2DDB A;  2QZ8 A;  3LFK A;  5M3F J;  1B8I A;  3F21 A;  3Q0W A;  4RMN A;  3DKX A;  3M8J A;  4A3G J;  2ZNZ A;  3P7N A;  3BR3 A;  3QPH A;  1BJZ A;  2DOD A;  3FK6 A;  3U1K A;  2FMY A;  4CGZ A;  2FOK A;  4ENM A;  1ENH A;  4EV0 A;  5IY5 H;  2CS3 A;  2CW0 F;  2OA4 A;  1EA3 A;  2IRF G;  4B4C A;  2ZO4 A;  2PBI A;  2EZH A;  2QQ8 A;  3ZPL A;  1GUU A;  3MKZ A;  4ON0 A;  1T38 A;  1VND A;  3L9F A;  4RAY A;  4WX9 A;  2LK2 A;  2BHY A;  1R1T A;  3RYR A;  1RET A;  3JW4 A;  5D5U B;  1O4X A;  4RLQ A;  2ZCW A;  1WCM J;  3KP7 A;  2E2J J;  3BQY A;  3S2D J;  2QM3 A;  4EGY A;  2X6Y A;  3TOA A;  1K6O A;  2XIG A;  4ESF A;  3TL4 X;  3OYI A;  2VKH A;  3BPV A;  5EG0 B;  3CME I;  2KRF A;  2ZSI B;  1MBE A;  1W4M A;  3Q3S A;  2DO7 A;  2EV0 A;  4FX4 A;  3BJA A;  2EA4 A;  1LUJ B;  1A6I A;  2IS1 A;  2PN6 A;  3JAM K;  4NNJ A;  4QTR A;  5C44 J;  2HTJ A;  3AG3 H;  3DTE A;  3WG9 A;  3L7W A;  1ZAO A;  2PMH A;  3IH2 A;  1SMY F;  1KYW A;  5A2Q Z;  3CTA A;  1J9I A;  1PYV A;  1R22 A;  4I76 A;  4G7Z F;  2PJR B;  4QSH A;  2VJJ A;  3BWG A;  2P7V B;  3EQL F;  5LHH A;  1M1E B;  3E0J B;  5FD6 A;  2VQL A;  3IL2 A;  5TJJ A;  2WA0 A;  2RGV A;  2WC2 A;  1NG7 A;  1IGN A;  1IUF A;  2X6O A;  3TW7 A;  2HGC A;  1GVD A;  3IV5 A;  5B1A H;  4CO8 A;  1MDM A;  1U2W A;  2XRN A;  3OYD A;  2OU2 A;  2DT6 A;  4KIT B;  2HKX A;  2LBF A;  2IEK A;  2TCT A;  2DLL A;  4CXF A;  4Q47 A;  3L1P A;  2HQA A;  2F2E A;  2ESN A;  1H89 C;  1TW2 A;  4JYK A;  2KFD A;  4ZH4 F;  1FT9 A;  4GCV A;  1MSE C;  3K4B A;  1I6X A;  2F4M B;  3AG2 H;  1USS A;  1YW9 A;  4PJJ A;  2XAH A;  3H1C A;  3G2B A;  3K1N A;  3OYL A;  2LNB A;  1RKW A;  5EZG A;  5KCM A;  2L9N A;  3WU2 C;  2COM A;  4MO7 A;  3RTR A;  2ECB A;  2X1E A;  1MBG A;  3KLN A;  1W36 D;  1PP8 F;  3LMM A;  1VQP I;  3BQZ A;  5BNG A;  2IS6 A;  1PUF A;  5IOZ A;  2LR8 A;  1Z6T A;  4YIR X;  1K61 A;  2ID3 A;  3FM3 A;  3WTX C;  2XC7 A;  1KQ9 A;  3UR3 C;  4BHP A;  4EJU A;  2MAB A;  3DCF A;  3J7A O;  3QPS A;  4C3H J;  4A3C J;  1WRJ A;  3DKY A;  3RZD J;  2A5Y B;  4BAC A;  4LG3 A;  1WI9 A;  4P55 A;  2OD5 A;  3WE3 A;  3HL2 A;  2DA5 A;  5GPA A;  1DU6 A;  4BXF A;  2VBY A;  2R7U A;  3I0T A;  2XRL A;  5KNL A;  2MYS A;  5EEG A;  3LSI A;  2EV5 A;  1YYV A;  3RPQ A;  1N77 A;  4JP0 A;  2EB7 A;  1OIS A;  3BT9 A;  1IN5 A;  1UMQ A;  4FE4 A;  2LRE A;  4Z2Y A;  2M0M A;  2HVQ A;  3ABU A;  1F4K A;  1ZLK A;  2BY3 A;  1LFU P;  1GXP A;  1XN7 A;  1JUM A;  2FBI A;  3NWT A;  3QU6 A;  2VL8 A;  5CQE A;  1V55 H;  2NVU B;  4BNC A;  2EK5 A;  3I71 A;  1E3H A;  2HQ5 A;  2IP2 A;  2O6G E;  3CP8 A;  2J5O A;  1SD5 A;  4DNC A;  2MC4 A;  2ID6 A;  4HLX A;  4M9X A;  4XL9 A;  5IPA A;  4DW6 A;  1D5V A;  1IUY A;  3FDY A;  3K1M A;  2FQ3 A;  3ZQH A;  3F8C A;  1J7K A;  1RIO H;  2EZK A;  1I1S A;  3JAM Z;  1X58 A;  4H0E A;  2PFB A;  2QSG X;  5B66 C;  2MLG A;  4BYY A;  3JSP A;  3DKW A;  4G8X A;  1U5T B;  4D5F A;  3S3M A;  3D5S C;  4ZDO A;  2CMP A;  2A61 A;  3A4C A;  5FFX A;  3W3C A;  2E5N A;  3OOU A;  3CMM A;  3SHF A;  2L4M A;  3IH3 A;  2M8G X;  4EM1 A;  2ZSH B;  3BP8 A;  3K70 C;  3FMS A;  3PUF A;  5DM6 F;  4HST A;  1W7P B;  3NAU A;  3U1D A;  3AG4 H;  3RIR A;  5KVR A;  3QP5 A;  1H9T A;  3PO2 J;  1YTY A;  2E5Z A;  5FFZ A;  2OUM A;  1ODD A;  3LA2 A;  1K4T A;  5E3N A;  1KQ0 A;  2P8T A;  3AG1 H;  4MQV A;  4U87 A;  4CIC A;  2FRH A;  2PX9 A;  2Y0S N;  4M3B A;  5HDK A;  5C3E J;  3V7R A;  3S3O A;  3PFI A;  3G73 A;  3RKX A;  4IHT A;  1C0W A;  4L9V A;  2EZI A;  4NC8 A;  1TLH B;  2OZ6 A;  3ZGK A;  3OR2 C;  4PUS A;  4YII A;  1X2N A;  1VQL I;  3H3V K;  2JWT A;  3AFH A;  4PJM A;  5DUK A;  4HW0 A;  2DA2 A;  2E1O A;  3W6V A;  1HKQ A;  1HW5 A;  4X6A J;  2BEO A;  4DZP A;  2GLO A;  2VBZ A;  5J1R A;  2RQQ A;  1JKP C;  2CV1 A;  2RNJ A;  5DTD A;  1ERD A;  2NOJ B;  1LB2 A;  1KYZ A;  1VI0 A;  2CJJ A;  2X48 A;  4B8X A;  3CC4 I;  1E2X A;  2QF7 A;  5LRR A;  5E18 F;  1U9N A;  4D7M A;  4E7L A;  4PK4 A;  1Z9C A;  1ZRC A;  4I2O A;  2IGM A;  4ZC3 A;  3QRF F;  2CGP A;  3QP6 A;  2VXZ A;  2W48 A;  3ABM H;  4MNU A;  2XGD A;  5LGT A;  4E70 A;  2KIF A;  1W5T A;  2B0L A;  5CYV A;  4C3J J;  2M0C A;  4KDP A;  1OJL A;  5E8I A;  1DPU A;  4YFN F;  1X1P A;  4KA4 A;  4PSX A;  1G6N A;  2C6Y A;  4HPQ A;  2VXD A;  3DBR B;  2VJ5 A;  2EZL A;  1OR7 A;  3V4G A;  1QNT A;  1XGN A;  4D0P A;  1B6A A;  4IXA A;  2NVX J;  4I02 A;  3MAJ A;  4XSZ F;  1KZH A;  4IOA F;  2F48 A;  2IVM A;  5D6F A;  2HYG D;  5HNH A;  3KLO A;  5KAF C;  1ZGJ A;  5IP6 A;  5J4Y A;  2ZJQ F;  3CC7 I;  2BOL A;  5B5E C;  3GTM J;  2R7O A;  5E17 F;  5DV5 A;  5EEH A;  3RYP A;  4I98 B;  5D4S A;  5GAD J;  2N8G A;  4D9J A;  1XPX A;  5GP9 A;  1B59 A;  1MD0 A;  1Q1H A;  1IW7 F;  1X2M A;  2AXT C;  2RAE A;  2JA6 J;  2IGK A;  3CLQ A;  1X1D A;  3K4J A;  2HQR A;  4GRI A;  3LSM A;  4CZZ A;  2VJ4 A;  3S1Q J;  3FK7 A;  3Q9S A;  3GW2 A;  1JHH A;  1T95 A;  2F4O B;  3I54 A;  1ORK A;  2K3F A;  2VKD A;  1JJ6 C;  2LKX A;  4CZC A;  3KX2 A;  1XX5 A;  2PQ8 A;  3FXL A;  4WWC A;  3BOQ A;  1R23 A;  1YQA A;  5FO5 A;  1OQY A;  3GLX A;  4XLC A;  1O3R A;  5F6F A;  2ZME B;  3WTS C;  2R92 J;  1U5T C;  2EBI A;  4F55 A;  5ICF A;  2LYC A;  5C4J J;  1YJ9 I;  3L2V A;  2Z33 A;  3O8G A;  5H6R A;  3HRT A;  5L3B A;  2KRC A;  2O8X A;  1SD4 A;  3KP6 A;  3D1N I;  3E6C C;  3CCQ I;  1FYM A;  3HJE A;  4M6V A;  3MQ0 A;  2V9K A;  3PSI A;  2R5Y B;  4NUB A;  1NG6 A;  3P9K A;  2O7O A;  3IHU A;  3Q9V A;  3F23 A;  4ASN A;  1WVR A;  1H88 C;  1YO5 C;  1TWC J;  3FZV A;  5FJ8 J;  2UWM A;  2QGU A;  3GFJ A;  1Y56 A;  2COB A;  3QU3 A;  5ICG A;  4U0Y A;  3REO A;  3SYT A;  3LOC A;  4M9S A;  1LEA A;  3IKT A;  2M7A A;  4U7D A;  2VB6 A;  3OYJ A;  1HDD C;  2XF5 A;  3PL8 A;  4MQ9 F;  4ZDP A;  1XDS A;  4L0Y B;  2O8K A;  4XLH A;  2I8D A;  2JT1 A;  1K78 B;  1U6G A;  1GDT A;  4BJT A;  2GZW A;  5JLX A;  3U9G A;  1S9H A;  2ICW G;  4ANJ A;  2E7W A;  3S16 J;  2L7M P;  4UUS A;  1FMV A;  4RB3 C;  4A3I J;  4HZF A;  2PMU A;  3S32 A;  4R1H A;  2L01 A;  3LA3 A;  2PI0 A;  3I59 B;  2H6C A;  1X4O A;  2CRG A;  2KHM A;  1E0E A;  4ETS A;  1QQI A;  3LAJ A;  2E1M C;  3EPZ A;  5EJC A;  1TNT A;  2HWV A;  1X1C A;  1U3E M;  1ITY A;  2LP0 A;  1QZZ A;  5HDG A;  1K79 A;  2DOA A;  2K9M A;  1T2K A;  2KIS A;  2FE3 A;  1XTA A;  5F27 A;  3T5X A;  4CSW A;  3CO6 C;  1BR2 A;  1FIP A;  2LKP A;  2Q2E A;  3DU6 A;  1VQ5 I;  2LG4 A;  4OIO F;  2BVL A;  3CJT B;  3HSF A;  3HOW J;  1POG A;  5F0F A;  3OYH A;  3MMY B;  2PMZ N;  3IUO A;  2VKE A;  2YS9 A;  4QPQ A;  2LC2 A;  3GTG J;  1B72 A;  3IH4 A;  3SEQ A;  1ZR4 A;  2NRA C;  4DYC A;  3LNQ A;  1TQI A;  4C3I J;  3VFZ A;  3LWF A;  3S1N J;  4JX5 A;  4A6E A;  2EFQ A;  2G0E A;  1IAW A;  2HZD A;  2CQ7 A;  2KZV A;  1G3S A;  3LFU A;  4IQ4 A;  2VE9 A;  3ASN H;  1P9Q C;  5GTI C;  3BPX A;  2FF4 A;  2V1U A;  3HUG B;  3BLY A;  4A69 C;  2P5L C;  3GYH X;  4LLG F;  1K7A A;  2CFX A;  2K4B A;  1AU7 A;  4XSX F;  2HS5 A;  2IBD A;  3G1L A;  5GPC A;  3GX4 X;  1G3T A;  4F7Z A;  2WAQ N;  4G94 A;  1KU2 A;  1YW7 A;  2D1H A;  4HBL A;  1BR4 A;  1IRZ A;  3SDG A;  2EA2 A;  4HV5 A;  1XGO A;  4XOR A;  3IRR A;  4J01 A;  2NS8 A;  4A93 J;  1E3P A;  3M3Y J;  1IO2 A;  4OOI A;  2XKP A;  4A3J J;  2DT7 B;  2HYJ A;  1YIJ I;  1DGW Y;  2R7D A;  4MIM A;  1YRN A;  4Y52 J;  3OYF A;  5K7Z A;  2DA1 A;  4G12 A;  2JK3 A;  1TP4 A;  2ZJP F;  3CDI A;  4F3Q A;  2V26 A;  2IW5 A;  3FHN A;  1YW8 A;  2EFW A;  4CCK A;  1BJA A;  3F72 A;  4DYR A;  5KHD A;  2M4K A;  4XON A;  4AIK A;  1SFX A;  4UVA A;  1D0X A;  2LLK A;  2LMD A;  4E6K G;  5HOD A;  1XCB A;  1I3Q J;  2PEX A;  4OMZ A;  4V19 K;  4WXC A;  3PQJ A;  1UEL B;  3M1E A;  1X3U A;  2WB1 N;  3MN2 A;  3BR6 A;  5CVV A;  1VQ8 I;  3DBH B;  2K9L A;  3PUB A;  2IT0 A;  2RRE A;  2O9L A;  1DP7 P;  1J0R A;  3LQQ A;  2G9W A;  1LE8 A;  3LSG A;  4FTH A;  1TBX A;  2R3S A;  2W7N A;  4HA8 A;  3H5A A;  2JA2 A;  3G71 I;  1ZG3 A;  2DA6 A;  4UY8 I;  4IF4 A;  4O6J A;  1Y6I A;  1E17 A;  3R0J A;  2Y9Y A;  2H1K A;  2RKH A;  4MTD A;  3RI4 A;  1SAU A;  2DI3 A;  2VAS A;  3JTH A;  1P4W A;  3HXL A;  1FWZ A;  3U2R A;  1Y39 A;  2KIM A;  5L3G A;  3WE2 A;  4EVI A;  1S7A A;  2KRH A;  5L3F A;  2ETH A;  1Y1W J;  2CQN A;  1K6Y A;  2NS0 A;  3GTP J;  3TGN A;  1AHD P;  1UG2 A;  3L2U A;  3ABL H;  3H5N A;  1BC7 C;  3D5L A;  1G3W A;  5E1Z B;  3HG9 A;  4M3D A;  5LEJ A;  1MBK A;  3H5R A;  4IHV A;  1W7P D;  1LEB A;  3HOZ J;  3GTL J;  1R49 A;  2A69 F;  4GYI A;  2BGC A;  1DP3 A;  1S6L A;  3C7J A;  1VQ7 I;  4K2E A;  4ZYE A;  2RN7 A;  2BY1 A;  1P2F A;  5AIQ A;  5KAI C;  4UVC A;  1MND A;  4IO9 F;  2ACJ A;  4WCG A;  1ON2 A;  3G1O A;  4ENK A;  3HDD A;  3JTG A;  5J47 A;  5EGO A;  2JN6 A;  2HOA A;  2VON A;  3E7L A;  3RCO A;  2MD0 A;  1JGG A;  4M6Y A;  4G7H F;  2UV1 A;  2HTS A;  3MKY B;  2F4I A;  4A3F J;  3IWF A;  2XB5 A;  5HLG A;  2G7H A;  1IN6 A;  1ETV A;  1FBU A;  2AQE A;  2BW3 B;  3QAH A;  3BCA A;  5A2Q K;  2K86 A;  3GWZ A;  3BRO A;  4L5I A;  1MBH A;  1F9N A;  4RGS A;  3L2Q A;  4XRS G;  1Z05 A;  5ICE A;  3A1Y A;  3RKQ A;  3H35 A;  2ISZ A;  2NYX A;  2JVH A;  2VI6 A;  1MW7 A;  5C4X J;  2QKM B;  2KQR A;  2DMN A;  2P6T A;  3EDP A;  4JX6 A;  5FRO A;  1WH5 A;  5FKO A;  3A0H C;  1MMA A;  3B6C A;  1UG0 A;  2EFP A;  3F0C A;  4A0Y A;  4M3G A;  3N97 A;  1HXD A;  2H6B A;  3DU5 A;  2PLY A;  4YEJ A;  4BS9 A;  3CO7 C;  3M4O J;  2P6S A;  1XDU A;  4OAY A;  2W00 A;  4ZYA A;  3ABT A;  2EIL H;  4RAG A;  1FBS A;  3ZOB A;  2BVM A;  3HGY A;  5AON A;  3FXM A;  1TWA J;  3BDD A;  2P7C B;  2WBM A;  2F5C A;  1AKH B;  3RPU D;  4N4O B;  4XMY A;  4YRV A;  1HOM A;  3KET A;  1R9T J;  2CUF A;  4V2F A;  2KDO A;  1FC3 A;  2K85 A;  2XHK A;  4XOT A;  2DK8 A;  1FOX A;  4E7K A;  3EYY A;  2R5Z A;  2KT0 A;  1YLF A;  4UB8 C;  2OZU A;  4TV7 A;  1TWG J;  1WKM A;  1OYW A;  2BYV E;  3JRG A;  3E6D A;  1IV8 A;  1YX3 A;  3FIW A;  3CF5 F;  3BG7 A;  1OR7 C;  1UJ8 A;  2VIX A;  5ILU A;  1BR1 A;  2OTJ I;  3K7A J;  3MVP A;  1GV5 A;  5JLW A;  4L18 B;  3W6K B;  2ZXJ A;  3BZ6 A;  4PJ0 C;  4HF2 A;  4M72 A;  3OS0 A;  1ON1 A;  3TDU C;  4BE0 A;  4AWX B;  4P5O A;  2L7F P;  1A35 A;  3HRS A;  4Y3O A;  1WH7 A;  2OF7 A;  2DFF A;  4A3M J;  2HNH A;  1UST A;  3KP2 A;  3J81 K;  2GOX B;  2JPB A;  5F0H A;  4NC7 A;  2X51 A;  2A6E F;  2XUB A;  2DMT A;  1UFM A;  4AD9 A;  2LH9 A;  1MMN A;  4BQA A;  3S17 J;  2MA3 A;  1GVJ A;  2IS4 A;  4IVN A;  3VOD A;  4HF1 A;  3H92 A;  1JKR C;  4E7S A;  1IC8 A;  1ZRD A;  2BBY A;  4A3E J;  3ISP A;  3CUQ B;  3JR9 A;  2QUF A;  3NQO A;  4A5M A;  1YX5 A;  1Y8R B;  3WTV C;  1SFU A;  2WY8 Q;  2G7U A;  1QO0 D;  1U0J A;  4FCY A;  3JRE A;  3HHG A;  2QSH X;  4HX8 A;  2RC4 A;  1LDK B;  2M45 A; 
#chains in the Genus database with same CATH homology
 2DFI A;  5LHI A;  1IXR C;  3LAP A;  2L54 A;  2Z9O A;  3CJN A;  4Y15 A;  1RNL A;  4NHJ A;  1QGP A;  3GZ5 A;  2FML A;  3RPU A;  4P9U A;  2QVO A;  3ZN1 A;  3DXJ F;  4BAY A;  5D5X B;  1JGS A;  2FSW A;  3ZMU A;  2Y0M A;  4KIF A;  1FPQ A;  1SD7 A;  2QQA A;  3HSR A;  1R58 A;  1R7J A;  1AOY A;  5HLI A;  1FSH A;  4ZYD A;  2F5F A;  1H0M A;  1O57 A;  2M1B A;  1AWC A;  2ZJ2 A;  1L0O C;  1CF7 B;  1S3J A;  3HOT A;  2ESH A;  4YG2 F;  3KP5 A;  1GHC A;  2WWY A;  5ILS A;  2DAO A;  4IJA A;  1LVA A;  5K5O A;  4HDU A;  3FHZ A;  2HEO A;  2EJR A;  1SAX A;  1EH8 A;  3ELK A;  2D45 A;  2CWE A;  5BS6 A;  3VB2 A;  3FX3 A;  4KNY A;  2P5V A;  1IRG A;  3MWM A;  4EM2 A;  1BIB A;  4HX4 A;  3J81 Z;  3B02 A;  4I0B A;  3GZ6 A;  2EFO A;  4CHU A;  1MJB A;  1T98 A;  2M30 A;  2QLZ A;  3R61 A;  4BHB A;  3DP7 A;  3CUQ C;  3WTZ A;  3AAF A;  2AXL A;  5CVI A;  4LFU A;  2IJL A;  4R79 A;  1G3Y A;  2QBY B;  3JSO A;  3FMR A;  2JTV A;  4OIP F;  5LBQ A;  2QWW A;  1CGP A;  3E97 A;  5JVT A;  1VTN C;  1ZYR F;  1BI1 A;  2XKO A;  5H6Q A;  3DFG A;  5L3E A;  3T0Y A;  4LLL A;  5ICC A;  1RUO A;  1TQP A;  1UHW A;  3GFM A;  2XRO A;  3RJP A;  3KCC A;  4ESB A;  4XLN F;  2L3D A;  5BPI A;  1MZB A;  1J75 A;  2VC1 A;  1HKT A;  4LG0 B;  4NB5 A;  2A07 F;  5AIP A;  3TOB A;  4M9Z A;  3ZMT A;  2QQB A;  4QWQ A;  1HSJ A;  3OOP A;  4UXN A;  1KU3 A;  2JZY A;  4L5J A;  5BOX A;  2OQG A;  3L09 A;  1V3F A;  2CYY A;  4MEY F;  5HS9 A;  4AIJ A;  3S2W A;  3NEU A;  2WTE A;  1MKM A;  3E5Q A;  1YIO A;  1NHA A;  2RVC A;  2EV6 A;  1ZG5 A;  2RV8 A;  2DPD A;  3ECH A;  1D8K A;  2EFN A;  2PG4 A;  1XSX A;  2RDP A;  3FMQ A;  4KIB A;  4HX7 A;  5J8C A;  4MTE A;  2FBH A;  1XGM A;  5DEQ A;  2ZBK A;  1D3Y A;  5LHG A;  3QOP A;  2VN2 A;  1P6R A;  3T1B A;  4ZZL A;  1R00 A;  2DT5 A;  2H09 A;  5J8F A;  1ZHF A;  5D5W B;  3MZH A;  3K9T A;  2VT2 A;  1O7L A;  1QZY A;  2M8E A;  4IRH A;  1KU7 A;  1MDM B;  4KIC A;  1S29 A;  3K2Z A;  3HTS B;  2WV0 A;  4PGG A;  2DBB A;  5FD5 A;  3KZY A;  1TW3 A;  1WWX A;  4HOB A;  3ZMS A;  1IN4 A;  1IF1 A;  2IA1 A;  4JQF A;  4UHT A;  1YG2 A;  1HW2 A;  3HYI A;  4KT5 C;  2JRT A;  1OYY A;  5LGN A;  3O3K A;  4RAZ A;  4LD5 A;  2ADU A;  5BPD A;  2Q8K A;  2V79 A;  3Q5F A;  4PGH A;  2CQK A;  1W5S A;  4HLY A;  4WF2 A;  1H9G A;  3WU1 B;  4G6D A;  1P92 A;  3V7S A;  1ZGA A;  3ZMD A;  3WOD F;  2DQL A;  3T8T A;  2Z5U A;  3FWE A;  3TO9 A;  2GA1 A;  1Z1D A;  1HQC A;  4HYE A;  1R36 A;  3F8M A;  2ELH A;  1F1Z A;  2J5P A;  5ILV A;  3ZN0 A;  5BMZ A;  1TNS A;  1IZ1 A;  1V4R A;  3MFK A;  4GGG A;  2KJC A;  3MCZ A;  2P5K A;  2LDU A;  2V1X A;  3C1D A;  2XAQ A;  5H20 A;  3R6S A;  1ZG1 A;  1FP1 D;  4U7B A;  4M6X A;  4AIH A;  2HFH A;  2F5D A;  3KZZ A;  2Q0O A;  5D6E A;  2FEZ A;  3ZMZ A;  2FXA A;  2E1C A;  1HST A;  1FX7 A;  2DQR A;  2P4W A;  4MGR A;  3EUH A;  1FYK A;  3COA C;  1FNN A;  4YFK F;  3ML6 A;  3HRU A;  4A12 A;  2XGX A;  2DK5 A;  5JHU A;  2L02 A;  1ZRF A;  2KIU A;  3I64 A;  4KYW A;  3RKY A;  1GXQ A;  2M5W A;  2KKO A;  4UV9 A;  1OPC A;  4RGR A;  3P9I A;  3F6O A;  5LGU A;  4R8H A;  3F22 A;  3V8L A;  4OU0 A;  1R5G A;  4I01 A;  5CLS A;  4EMS A;  2EWN A;  1RZ4 A;  5ED4 A;  1SMT A;  2FA5 A;  3H3Z A;  3BJ6 A;  3MEX A;  2L4A A;  3WGI A;  1ZLJ A;  3L00 A;  1ONV A;  4HDV A;  1BOA A;  4OIQ F;  1F5T A;  3HRM A;  4L9J A;  5DD4 A;  2XAJ A;  2QEN A;  2GXG A;  3D0S A;  3WU0 A;  3F8F A;  4LK0 F;  2O03 A;  2A68 F;  2AS5 F;  3ULQ B;  2Z99 A;  2ZNY A;  1O3Q A;  1ZAR A;  3GFI A;  3IRQ A;  5J6X A;  1SFE A;  3DEU A;  1FLI A;  4KIG A;  3R4K A;  4ENJ A;  4WK8 F;  3GO5 A;  2BV6 A;  4HQE A;  2VE8 A;  2K02 A;  4B09 A;  3IWZ A;  2ISY A;  1IRF A;  4XBF A;  4EGZ A;  1HBX G;  2M87 A;  4RB2 C;  4L9T A;  4ESJ A;  2VOO A;  3E5U A;  2GA2 A;  4RS8 A;  1DPR A;  1ZN2 A;  4KFC A;  2YU3 A;  1D8J A;  4A6D A;  1ULY A;  2QYO A;  2KJB A;  3DF8 A;  5D4R A;  2OBP A;  4Y17 A;  5BQT A;  4DQ2 A;  3ZP5 A;  1MJA A;  1FY7 A;  3CUO A;  1P4X A;  4M74 A;  4GYG A;  4HV6 A;  4YFX F;  1FOK A;  1ZRE A;  1KGS A;  1PUE E;  1TTY A;  4IHS A;  1JXS A;  3CDH A;  1U5T A;  3W6J B;  4U0V A;  5LLQ A;  1W7P A;  5K5R A;  3BJO A;  1XMK A;  2YPR A;  2YX4 A;  4RB1 A;  5IT9 K;  5K5Q A;  3RKW A;  5HLH A;  3O6B B;  5E1X A;  2W84 A;  3VOE A;  3HHH A;  5DD8 A;  3KEQ A;  2W85 A;  4GO1 A;  1P4A A;  3R0A A;  1T6S A;  3SXY A;  5HS8 A;  3V8K A;  3E3V A;  2HZT A;  1DDN A;  3GEZ A;  3ZQ7 A;  1QPM A;  1I1G A;  1XMA A;  3FF5 A;  4GXO A;  3K69 A;  3I4P A;  4LLN A;  5HDN A;  3TO6 A;  3I5U A;  3SZT A;  2H27 A;  2LF7 A;  1T0F A;  2TDX A;  1A04 A;  2HQN A;  3RDI A;  1O3S A;  5DDG A;  2HKO A;  4RGX A;  4RGU A;  1MJ9 A;  3LA7 A;  1REP C;  5FLX K;  1S7O A;  2LF8 A;  3FXQ A;  2UXX A;  4G6Q A;  2CSO A;  3GUD A;  1UCR A;  4IRI A;  1HKS A;  1XB4 A;  4N9H A;  2ZME A;  2H94 A;  3KEO A;  4M73 A;  4HQM A;  1B9N A;  3N4M A;  4ZYG A;  1Y0U A;  2GAU A;  3M9A A;  4PDK A;  1EH7 A;  4ZZD A;  3C18 A;  1OMI A;  5L3D A;  3IKV A;  2JPC A;  3F3X A;  5IT9 Z;  2FU4 A;  2MH9 A;  3SFZ A;  1OYI A;  2VOD A;  2DU9 A;  1K78 A;  4IPA A;  3DV8 A;  3V8J A;  2RQP A;  3VEP A;  2X0L A;  2V9V A;  3T8R A;  2DPU A;  3I59 A;  4LJZ F;  3V7C A;  1IXC A;  2UZK A;  2DTR A;  5D8L B;  1ZH5 A;  3GF2 A;  5IT3 A;  5FB2 A;  4EM0 B;  2VC0 A;  5LEK A;  4PCQ A;  3F8B A;  1T39 A;  5HVQ C;  1XGS A;  4M71 A;  5F1R A;  2Z3Y A;  1BIA A;  2O3F A;  5E1W A;  4EJT A;  1PP7 U;  3HOS A;  5E20 A;  2LSO A;  2BE5 F;  4U0W A;  3HUG A;  4L9N A;  5FLX Z;  4FHT A;  2K4J A;  4YIF A;  3F8N A;  1KA8 A;  5CVU A;  1BI3 A;  3TKY A;  3DPL C;  2GXB A;  5FGM A;  4G7O F;  3SZP A;  3G3Z A;  1R1U A;  2UXN A;  5F64 A;  2GIV A;  1LQ1 A;  2HDC A;  3PQK A;  2STT A;  3BY6 A;  4BH9 A;  2A6H F;  4A2U A;  2YSR A;  3LQR A;  2X4H A;  1O3T A;  3M8F A;  4XLP F;  4L0Z B;  2K27 A;  1FBQ A;  3R60 A;  1R5H A;  4OIN F;  4OIR F;  1PDN C;  1LJ9 A;  2IA2 A;  4A0Z A;  6PAX A;  4LK1 F;  3KE2 A;  1BI2 A;  3B73 A;  1MGT A;  3C3W A;  4EJV A;  2K7L A;  4KN7 X;  5D5V B;  2VOP A;  4LGW A;  4OMY A;  5CVR A;  1U78 A;  3CLO A;  3KFW X;  3LST A;  4JK1 X;  4G9Y A;  3WGG A;  2XAF A;  2HOE A;  3H3U A;  2PJP A;  5JFR A;  4Y13 A;  1LDD A;  4WXD A;  1HW1 A;  1KU9 A;  5ERI A;  3ERE D;  2O0Y A;  4EJO A;  3WTY C;  4IRG A;  4UUV A;  2W57 A;  4KUM A;  4A0X A;  1Z6R A;  3M7G A;  1WQ2 A;  3DPT A;  3HSE A;  5DCM A;  4MEX F;  3TO7 A;  2FNA A;  2W24 A;  2NAZ A;  3IC7 A;  1SD6 A;  2IPQ X;  4HF0 A;  1LDJ A;  1EH6 A;  2MH2 A;  4A5N A;  4WXH A;  3E6M A;  1STZ A;  3J80 K;  5L3C A;  3E5X A;  2QQ9 A;  1O7F A;  3EYI A;  1Z91 A;  2VBX A;  1BN5 A;  1JHF A;  2E1N A;  1YS6 A;  2NNN A;  2GWR A;  4LB5 A;  5E8G A;  5JR3 A;  3WGH A;  4HAM A;  2Y75 A;  1IXS B;  1TQM A;  4O5V A;  5DYM A;  3L2C A;  4KMF A;  1BC8 C;  1IN8 A;  2MLK A;  4PZJ A;  2FBK A;  5JI6 A;  4I09 A;  4LMY A;  2XVC A;  3FXR A;  4P96 A;  4AVP A;  2ZFW A;  3QPT A;  3DQV C;  1B4A A;  4LB6 B;  4Q48 A;  3WTW C;  1I27 A;  1YFH A;  1EV7 A;  1KQ8 A;  1UB9 A;  4I7H A;  5DCF A;  3GXO A;  2NNY A;  1R1V A;  5CJ9 A;  2STW A;  4N0B A;  2YR2 A;  4Q5S F;  4XRF A;  2FNP A;  5CVJ A;  4O3M A;  5DUI A;  1LNW A;  1OKR A;  2D2W A;  4BHC A;  1U8R A;  1J59 A;  3P9C A;  3I53 A;  3M8E A;  1J5Y A;  2DW4 A;  1DUX C;  2MC3 A;  1FP2 A;  5LRS A;  3CUQ A;  4UNO A;  3GFL A;  4CDG A;  1FSE A;  3KP4 A;  5D8K B;  5HS7 A;  3WTT C;  4FT8 A;  2V1D A;  3ZMV A;  1J2X A;  4NQW A;  3SQN A;  3TDZ C;  2MBF A;  2R7F A;  3J80 Z;  2D1V A;  2CO5 A;  4KN4 X;  3E6B A;  4ENN A;  1BBY A;  4JBA A;  2XV4 S;  4KMU X;  1XCV A;  2OQR A;  3OV8 A;  3FXU A;  2MD5 A;  1WSU A;  2F5E A;  1S8N A;  1XD7 A;  1YS7 A;  1XSD A;  1BM9 A;  1BI0 A;  3I58 A;  1CF7 A;  2O61 A;  5K1Y A;  1FYL A;  3O2P E;  4S05 A;  4U88 A;  1Z7U A;  1RUN A;  3NRV A;  4EJW A;  1G4D A;  2XAG A;  2OAZ A;  1FZP B;  4QLC U;  5TRD A;  3HTU A;  4N9I A;  2XAS A;  3FM5 A;  3K1P A;  4EQQ A;  1QBJ A;  4S04 A;  2YX7 A;  4Q4Z F;  1XSV A;  1UHM A;  5DCM B;  3EET A;  3K0L A;  5HOO A;  2E7X A;  4P9F A;  5KK1 A;  2W25 A;  3KP3 A;  1I5Z A;  4I0A A;  4UVB A;  4UV8 A;  4RB0 A;  2V6C A;  4MHG A;  1L3L A;  2QBY A;  2GQQ A;  3MZY A;  3TQN A;  2HYF A;  3GVA A;  1B1B A;  3F6V A;  1B9M A;  3WTU C;  2A3S A;  3ROU A;  3HIF A;  3ECO A;  2JSC A;  1RI7 A;  2IA0 A;  2VT3 A;  2CG4 A;  2VBW A;  1IN7 A;  4ZYH A;  4FX0 A;  2ZKZ A;  4CYD A;  2Y48 A;  4BXU A;  2HR3 A;  1JE8 A;  4LG0 A;  2QZ8 A;  3LFK A;  3F21 A;  2ZNZ A;  3P7N A;  3QPH A;  2FMY A;  4CGZ A;  2FOK A;  4ENM A;  4EV0 A;  2CW0 F;  2OA4 A;  2IRF G;  2ZO4 A;  2PBI A;  3ZPL A;  4ON0 A;  1T38 A;  3L9F A;  4RAY A;  4WX9 A;  1R1T A;  3RYR A;  3JW4 A;  5D5U B;  2ZCW A;  3KP7 A;  2QM3 A;  4EGY A;  3TOA A;  1K6O A;  2XIG A;  4ESF A;  3BPV A;  2KRF A;  1W4M A;  2DO7 A;  2EV0 A;  4FX4 A;  3BJA A;  2EA4 A;  2PN6 A;  3JAM K;  2HTJ A;  3WG9 A;  3L7W A;  1ZAO A;  2PMH A;  1SMY F;  1KYW A;  5A2Q Z;  3CTA A;  1J9I A;  1R22 A;  4G7Z F;  5LHH A;  3BWG A;  2P7V B;  3EQL F;  5FD6 A;  3IL2 A;  5TJJ A;  2RGV A;  2WC2 A;  2HGC A;  4CO8 A;  1MDM A;  1U2W A;  2XRN A;  2OU2 A;  2HKX A;  2DLL A;  4CXF A;  4Q47 A;  2F2E A;  2ESN A;  1TW2 A;  4ZH4 F;  1FT9 A;  4GCV A;  1I6X A;  1USS A;  1YW9 A;  2XAH A;  3K1N A;  2LNB A;  2COM A;  3RTR A;  1PP8 F;  3KLN A;  1Z6T A;  3FM3 A;  3WTX C;  1KQ9 A;  4EJU A;  4BHP A;  3J7A O;  1WRJ A;  2A5Y B;  4P55 A;  1WI9 A;  2OD5 A;  3WE3 A;  2VBY A;  3I0T A;  5EEG A;  2EV5 A;  1YYV A;  3RPQ A;  2EB7 A;  1IN5 A;  4Z2Y A;  3ABU A;  1F4K A;  1ZLK A;  1GXP A;  1XN7 A;  2FBI A;  3QU6 A;  4BNC A;  2EK5 A;  3I71 A;  2O6G E;  2IP2 A;  2J5O A;  1SD5 A;  4DNC A;  4M9X A;  4HLX A;  1D5V A;  1IUY A;  3K1M A;  2FQ3 A;  3F8C A;  1J7K A;  1RIO H;  1I1S A;  3JAM Z;  4H0E A;  2PFB A;  2MLG A;  4BYY A;  3JSP A;  3DKW A;  4G8X A;  1U5T B;  2A61 A;  5FFX A;  3SHF A;  2L4M A;  4EM1 A;  3BP8 A;  3FMS A;  1W7P B;  3U1D A;  3RIR A;  5KVR A;  3QP5 A;  1H9T A;  1YTY A;  5FFZ A;  1ODD A;  3LA2 A;  1KQ0 A;  2P8T A;  4MQV A;  4CIC A;  2FRH A;  5HDK A;  3V7R A;  3PFI A;  3G73 A;  3RKX A;  4IHT A;  1C0W A;  4L9V A;  1TLH B;  2OZ6 A;  4YII A;  5DUK A;  4HW0 A;  1HKQ A;  1HW5 A;  2BEO A;  2VBZ A;  2RNJ A;  1LB2 A;  1KYZ A;  4B8X A;  1E2X A;  5LRR A;  5E18 F;  1Z9C A;  1ZRC A;  4I2O A;  3QRF F;  2CGP A;  3QP6 A;  2VXZ A;  4MNU A;  5LGT A;  4E70 A;  2KIF A;  1W5T A;  2B0L A;  5CYV A;  4KDP A;  5E8I A;  1DPU A;  4YFN F;  4KA4 A;  1G6N A;  2C6Y A;  1OR7 A;  3V4G A;  1QNT A;  1XGN A;  4D0P A;  1B6A A;  4IXA A;  4I02 A;  3MAJ A;  4XSZ F;  2IVM A;  5D6F A;  2HYG D;  3KLO A;  1ZGJ A;  5E17 F;  5DV5 A;  5EEH A;  3RYP A;  4I98 B;  5D4S A;  1B59 A;  1MD0 A;  1Q1H A;  1IW7 F;  2HQR A;  4CZZ A;  3Q9S A;  3GW2 A;  1JHH A;  3I54 A;  2PQ8 A;  4WWC A;  3BOQ A;  1R23 A;  1YQA A;  5FO5 A;  3GLX A;  1O3R A;  5F6F A;  2ZME B;  3WTS C;  1U5T C;  5ICF A;  2Z33 A;  5H6R A;  3HRT A;  5L3B A;  2O8X A;  1SD4 A;  3KP6 A;  3E6C C;  1FYM A;  3MQ0 A;  3P9K A;  3IHU A;  3Q9V A;  3F23 A;  4ASN A;  1YO5 C;  3FZV A;  2UWM A;  3GFJ A;  3QU3 A;  5ICG A;  4U0Y A;  3REO A;  3IKT A;  4M9S A;  1LEA A;  4U7D A;  4L0Y B;  4MQ9 F;  1XDS A;  2JT1 A;  1K78 B;  1U6G A;  2GZW A;  3U9G A;  2E7W A;  4RB3 C;  4HZF A;  2PMU A;  4R1H A;  2L01 A;  3LA3 A;  2PI0 A;  3I59 B;  2H6C A;  4ETS A;  1QQI A;  3LAJ A;  1TNT A;  2HWV A;  1U3E M;  1QZZ A;  5HDG A;  1K79 A;  1T2K A;  2FE3 A;  3T5X A;  3CO6 C;  2LKP A;  2Q2E A;  4OIO F;  3HSF A;  2NRA C;  1TQI A;  3VFZ A;  3LWF A;  4A6E A;  2EFQ A;  1IAW A;  1G3S A;  2VE9 A;  3BPX A;  2FF4 A;  2V1U A;  2P5L C;  3GYH X;  4LLG F;  1K7A A;  2CFX A;  2K4B A;  4XSX F;  2HS5 A;  3GX4 X;  1G3T A;  4F7Z A;  4G94 A;  1KU2 A;  1YW7 A;  2D1H A;  4HBL A;  2EA2 A;  4HV5 A;  1XGO A;  3IRR A;  4OOI A;  2XKP A;  2R7D A;  2IW5 A;  2EFW A;  1YW8 A;  1BJA A;  3F72 A;  4AIK A;  1SFX A;  4UVA A;  1XCB A;  2PEX A;  4OMZ A;  4WXC A;  3PQJ A;  3M1E A;  1X3U A;  5CVV A;  2IT0 A;  1DP7 P;  1J0R A;  3LQQ A;  2G9W A;  1TBX A;  2R3S A;  4HA8 A;  1ZG3 A;  4IF4 A;  4O6J A;  1E17 A;  3R0J A;  2RKH A;  4MTD A;  3RI4 A;  2DI3 A;  3JTH A;  1P4W A;  1FWZ A;  3U2R A;  2KIM A;  5L3G A;  3WE2 A;  4EVI A;  1S7A A;  5L3F A;  2ETH A;  2NS0 A;  3TGN A;  1BC7 C;  3D5L A;  1G3W A;  5E1Z B;  5LEJ A;  1W7P D;  1LEB A;  2A69 F;  4GYI A;  2BGC A;  1S6L A;  3C7J A;  4K2E A;  4ZYE A;  2RN7 A;  1P2F A;  5AIQ A;  4UVC A;  2ACJ A;  4WCG A;  1ON2 A;  4ENK A;  3JTG A;  2VON A;  4M6Y A;  4G7H F;  2HTS A;  3IWF A;  5HLG A;  2G7H A;  1IN6 A;  1FBU A;  3QAH A;  5A2Q K;  2K86 A;  3GWZ A;  3BRO A;  4L5I A;  1F9N A;  4RGS A;  1Z05 A;  5ICE A;  2ISZ A;  2NYX A;  2P6T A;  3EDP A;  2EFP A;  4A0Y A;  3N97 A;  1HXD A;  2H6B A;  2PLY A;  3CO7 C;  2P6S A;  1XDU A;  3ABT A;  1FBS A;  5AON A;  3BDD A;  2P7C B;  2F5C A;  3KET A;  1FC3 A;  2XHK A;  2DK8 A;  3EYY A;  1YLF A;  2OZU A;  4TV7 A;  1WKM A;  2BYV E;  1OYW A;  3E6D A;  5ILU A;  4L18 B;  3W6K B;  2ZXJ A;  3BZ6 A;  4HF2 A;  4M72 A;  1ON1 A;  3TDU C;  4AWX B;  4P5O A;  3HRS A;  3KP2 A;  1UST A;  3J81 K;  2JPB A;  2A6E F;  2XUB A;  1UFM A;  4AD9 A;  4BQA A;  2MA3 A;  1GVJ A;  4IVN A;  3VOD A;  4HF1 A;  3H92 A;  1ZRD A;  2BBY A;  3ISP A;  3CUQ B;  2QUF A;  3NQO A;  4A5M A;  3WTV C;  1SFU A;  2G7U A;  1QO0 D;  3HHG A;  4HX8 A;  2RC4 A;  1LDK B;  2M45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...