3CUQA

Integrated structural and functional model of the human escrt-ii complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
219
structure length
219
Chain Sequence
AQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
total genus 60
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA03
1T39A 2MD5A 2IT0A 3R4KA 4IF4A 3M9AA 1ZG5A 3O2PE 4KDPA 1YIOA 3I53A 3TGNA 3J80Z 4LG0B 3ERED 3DXJF 2D1VA 3I54A 3CTAA 2O6GE 4ETSA 3V8LA 3DP7A 3J80K 2A07F 4EM0B 4UVAA 2XHKA 4R79A 2EA2A 2HWVA 3KCCA 1D8JA 4MGRA 5HLGA 5F64A 2LKPA 2FMLA 3GXOA 1KGSA 5KVRA 3BWGA 1BN5A 1I27A 3HRTA 1TQPA 5DCMB 2CSOA 1BBYA 1OMIA 2FU4A 2YU3A 2FEZA 4BNCA 3SZPA 3ULQB 4OIOF 4B09A 1LDJA 1U2WA 4CZZA 1FNNA 1O7FA 4HLXA 2DQLA 1WKMA 4EJWA 1RNLA 3BJ6A 5ICGA 5DEQA 2XAQA 3ABTA 2CQKA 4OIRF 4ENNA 5L3DA 4O5VA 4ZYEA 3Q9SA 1P4XA 4N9IA 2D2WA 4FX0A 3D0SA 1XCVA 4LD5A 1T98A 3QPHA 1PDNC 4LLGF 2NRAC 2MH9A 2R7FA 2RQPA 1ULYA 2H6BA 2K27A 3GF2A 2KRFA 4MQVA 1D5VA 3BJOA 1S3JA 2FRHA 2HZTA 4EJUA 2GXGA 1ODDA 5AIQA 3KP6A 1B4AA 3K1PA 4ZZLA 2BYVE 1F1ZA 2P5VA 4RS8A 2Q8KA 3E6DA 2G7UA 3BROA 2HKOA 4DNCA 2HTJA 5CYVA 3GFIA 4ZZDA 2BV6A 3LFKA 4LJZF 4OMYA 3NRVA 4WCGA 3I59A 4A6DA 3HYIA 3TDUC 1T2KA 2CWEA 3RKWA 3EETA 1YQAA 3BPVA 3EDPA 1G3YA 1G3TA 4L9VA 5D5WB 3WU0A 3TOAA 4UVCA 3RKYA 5L3EA 4RB1A 2CYYA 1MGTA 2O0YA 3WODF 5BPIA 4Y15A 1JE8A 1J7KA 2FF4A 4FT8A 4BXUA 1NHAA 2FMYA 3RIRA 2XROA 1BC7C 3WU1B 2J5OA 4U7DA 2MH2A 4EV0A 2RVCA 5KK1A 5HDGA 1FBQA 5DD4A 1MKMA 4LFUA 4KN4X 2L02A 3IWZA 2LDUA 4LG0A 1OPCA 5LRSA 4XBFA 1FX7A 2HOEA 4L9TA 4HF2A 2KJCA 4IJAA 2YX4A 1J59A 5BQTA 2PLYA 1P2FA 3KEOA 4LB5A 1P4WA 1EH7A 3G3ZA 1OYIA 1R00A 3COAC 2ELHA 3E6BA 4UV8A 1ZG3A 3KETA 2HEOA 1XDSA 1YW8A 1Z91A 3SZTA 2M87A 4O6JA 3DPTA 3TOBA 1DPUA 2W57A 4HYEA 5AIPA 2LNBA 2HGCA 4I98B 3ROUA 1R7JA 5HLIA 2MLGA 4EGYA 2CO5A 3J81Z 3IKVA 1ZRCA 1EH6A 4G7HF 1K6OA 3JTGA 3J81K 4GYGA 3I58A 4A5NA 3HTSB 4CYDA 1MZBA 3V4GA 3FX3A 2DPDA 1V4RA 3T0YA 2OQRA 1CGPA 4N9HA 2FBHA 3C1DA 3SQNA 3RDIA 1U3EM 2IPQX 3MZHA 4ESJA 3C7JA 4M72A 4A6EA 4KN7X 4IVNA 4G9YA 1FWZA 2IP2A 4GCVA 3K2ZA 2RC4A 2O3FA 1TW3A 4XSZF 1KQ0A 4WXCA 5CLSA 3JSOA 2PG4A 1GHCA 2VT3A 5K5RA 3WTXC 5E18F 4XLNF 1W7PD 2ISZA 3GFLA 4KICA 2BBYA 2P6SA 4XRFA 2DK5A 5E8IA 3HUGA 3RPUA 5ICCA 2K7LA 5FO5A 4IXAA 1UHWA 5D8LB 3F22A 4KNYA 1FOKA 1IN7A 1ZLJA 4M9SA 3QP5A 2NS0A 3JW4A 3TO6A 3BZ6A 3PFIA 2YR2A 2P5LC 4P5OA 1Z6TA 4M6YA 4ENKA 1HW1A 2DQRA 4HX7A 3JSPA 2PFBA 2M1BA 4BHBA 3C18A 3WG9A 5L3GA 2UXNA 2KIFA 1FZPB 5IT9K 1ZHFA 2NNYA 3VB2A 1O3TA 2E1NA 5DD8A 3ZPLA 4HX4A 4NQWA 1SFXA 2DK8A 4R8HA 2CW0F 3GFMA 3HSEA 4IRGA 2FE3A 1U5TB 4PZJA 4I09A 2Z3YA 1TQMA 4PDKA 5LLQA 1R1UA 2NYXA 3M8FA 3HIFA 2STTA 3U9GA 2IVMA 4LMYA 2M30A 2RN7A 3WE3A 3T8TA 2Q0OA 3WTSC 2XV4S 3P9CA 3BOQA 1ZARA 4EQQA 4FX4A 2ADUA 4EM2A 3R0AA 2WC2A 5E1ZB 1IN4A 5D4RA 3R6SA 3CDHA 4EJTA 2VOOA 4ZYHA 2F5DA 1K7AA 1FSEA 2UZKA 1YO5C 3F72A 4QLCU 3CUQA 4BAYA 2PN6A 5LRRA 1D8KA 3K0LA 3C3WA 2LSOA 3TDZC 3AAFA 5CVVA 5E17F 3VEPA 4XSXF 2EK5A 5ICEA 5CVIA 2RDPA 3JTHA 2OQGA 5JR3A 2YPRA 4HV6A 2A69F 3I0TA 3WTZA 1T0FA 2FNAA 4M71A 3DQVC 1TW2A 2ZCWA 2OZ6A 1R36A 5ICFA 5H20A 2DT5A 4AVPA 3IHUA 3GYHX 3L00A 1BIBA 5D4SA 1IAWA 5JI6A 3KLNA 2QVOA 1O3RA 1YG2A 3FHZA 1BI1A 3WTUC 5CVJA 1B9NA 3GEZA 1R1VA 1RZ4A 3B73A 1TNTA 1LEBA 2O61A 2PMUA 3ZN1A 3HRSA 3MCZA 1A04A 3KEQA 3IL2A 3FM5A 2WTEA 3M7GA 4BQAA 3N4MA 2EFQA 1I5ZA 2EFPA 5FFZA 3E3VA 5D6EA 2QBYA 3QPTA 3KZYA 4H0EA 2HR3A 2M5WA 5FD6A 4GGGA 3H92A 2E1CA 1MJ9A 1KU7A 2XKPA 3ECOA 1S29A 1XMAA 1DPRA 2HQNA 1FYMA 4G6QA 1ZREA 4EMSA 4IPAA 3P9IA 2YX7A 2KIMA 1YS7A 3FF5A 4I02A 4JBAA 2GAUA 5CVRA 3QU3A 1MJBA 4LK0F 1HQCA 5ERIA 2JPCA 1ZN2A 2JSCA 4A0YA 3SXYA 3WGGA 1MDMB 4JK1X 3ZMTA 1HW5A 5K1YA 3FMSA 1KYZA 3RKXA 4Q48A 4WWCA 1XSDA 5A2QZ 2O03A 2HTSA 3HSRA 4CGZA 2V1DA 3IWFA 5FFXA 4RAZA 3QU6A 1LDDA 4ZH4F 5ILSA 2QLZA 5E8GA 1QZYA 1O3SA 3RJPA 1FP1D 1Q1HA 3BDDA 3RYPA 5HS7A 3I5UA 5L3CA 1GXPA 3WTVC 2ZKZA 1BM9A 1IW7F 4XLPF 1LNWA 1XB4A 3QP6A 1WQ2A 4QWQA 5K5OA 2VBXA 4ON0A 1RUOA 2VOPA 2FSWA 1IXRC 2K4JA 2RGVA 4EJOA 1W7PA 5HOOA 3FZVA 4KMUX 1R5HA 1CF7B 2F5EA 3F6VA 4HZFA 1O7LA 3NEUA 4D0PA 3WTYC 2P4WA 2ZXJA 4MEXF 3HRUA 4UNOA 1HXDA 4M6XA 4RB2C 5EEGA 3F21A 3KLOA 1XCBA 1ZGJA 1DP7P 1E17A 4WF2A 2IA2A 2ISYA 2ZNZA 3CO6C 4Q4ZF 2L54A 3QOPA 4S05A 1XDUA 2X0LA 3BPXA 4HW0A 1Z9CA 1YFHA 4YFKF 5HDNA 4K2EA 4RGXA 2H94A 3ZMSA 3ZQ7A 3G73A 2CG4A 3HTUA 5D5XB 3ELKA 3FXRA 4KIFA 1UCRA 4A0XA 5JHUA 2ZMEA 1J0RA 1MD0A 3F8NA 2W25A 3OV8A 2P7VB 2P5KA 2QENA 1XN7A 5DDGA 1S7AA 5HLHA 4ESFA 3F23A 5LGNA 4LLNA 4AIJA 4OMZA 4GYIA 1USSA 1ZLKA 2XAGA 2HYGD 3T8RA 3CLOA 3WTWC 4PGHA 3NQOA 4HQMA 2DTRA 3E6MA 4L5JA 1VTNC 5HDKA 1ON2A 1XGOA 1LDKB 3W6JB 4HDVA 4L5IA 4I01A 3LA3A 1ONVA 5LHIA 2KJBA 3F8FA 3HSFA 2PMHA 2R7DA 4YG2F 2Z99A 2EV0A 2QYOA 5ED4A 1AWCA 3EQLF 3MEXA 3FMRA 2HDCA 3T1BA 4EVIA 2V1XA 1JGSA 3ECHA 1U6GA 3ZP5A 4G94A 2K4BA 1I6XA 3O6BB 1ZAOA 2D1HA 1QQIA 5LGUA 1OR7A 3L09A 5IT3A 1F9NA 1HSTA 1ZG1A 2M45A 2OZUA 5F1RA 2G9WA 2PI0A 3JAMZ 3RTRA 1EH8A 2ZFWA 4G7ZF 4CO8A 1CF7A 4HBLA 4UHTA 1UB9A 4GO1A 5LEKA 3I4PA 5DUIA 5EEHA 2DBBA 2FA5A 4CXFA 4LGWA 2B0LA 4PGGA 5BS6A 1P92A 1IRGA 4A5MA 1S6LA 1L3LA 3B02A 3SHFA 5ILVA 2XRNA 3S2WA 1KU2A 1FY7A 2R3SA 3VFZA 3O3KA 2MA3A 3U2RA 4ENJA 4WX9A 1EV7A 5E1XA 4BHCA 2QQAA 2O8XA 2A3SA 1ZRDA 3LAPA 3MWMA 1YTYA 1ZRFA 2QUFA 3V7CA 5DCFA 2W84A 2ESNA 1QPMA 2DU9A 1ZH5A 2VE9A 2IJLA 2Y0MA 2JTVA 3E6CC 2F2EA 1I1SA 1ZYRF 4AIHA 1HKSA 2D45A 1WI9A 4M9ZA 5HS9A 4E70A 4IRIA 2GIVA 2EWNA 1UHMA 1MJAA 3R60A 3QAHA 4RB3C 5LEJA 1SD5A 1MDMA 4OIQF 1WSUA 4OU0A 1K78B 4AD9A 3F8MA 4HQEA 2BE5F 1IF1A 1YLFA 4GXOA 1HW2A 3I64A 4MHGA 4NB5A 1YS6A 2XAHA 3FXUA 1G4DA 1B1BA 2KKOA 2RV8A 1JHHA 5D5UB 1XD7A 1OYWA 2W24A 2QM3A 4MEYF 3HRMA 5H6QA 4MTEA 3K1MA 3ZMUA 2HS5A 1I1GA 5J8FA 5E20A 1SD7A 3TO9A 1O3QA 1YW9A 1DUXC 2F5CA 1U5TA 2YSRA 4HAMA 2PJPA 4EJVA 3N97A 4YIIA 2V1UA 1W7PB 3LWFA 2BGCA 2IW5A 1YYVA 4MTDA 1OKRA 2L4MA 5J8CA 3J7AO 1XSXA 3P9KA 5D5VB 4KIGA 3F8CA 1FC3A 2JZYA 5IT9Z 2ZJ2A 4HV5A 2GWRA 1OYYA 1Z1DA 2K86A 2EV6A 3DKWA 3RYRA 1PUEE 3E97A 3R61A 4EGZA 1WRJA 1JHFA 2NAZA 1XGMA 2P6TA 4YFNF 4A2UA 1LQ1A 4HOBA 3CJNA 1BI3A 3CUQB 3DFGA 3K9TA 2QZ8A 4HF1A 3GLXA 1H0MA 2XASA 1QGPA 4IRHA 5F6FA 1IRFA 2A61A 1RI7A 3T5XA 2EJRA 4RB0A 1HBXG 5FLXZ 3GFJA 4CICA 3FWEA 2ZMEB 1IN6A 2H6CA 3TO7A 3GVAA 5K5QA 2DFIA 2P8TA 1STZA 2VBYA 1RUNA 2MBFA 2A6EF 1G6NA 4RGSA 3GWZA 2CGPA 2JPBA 3L7WA 2GA2A 3RI4A 2ZNYA 3HHHA 2JT1A 2Z5UA 2IRFG 2BEOA 2OD5A 1G3WA 1Z7UA 1D3YA 3W6KB 3REOA 4WXDA 3QRFF 3GUDA 2HFHA 3V8JA 5HVQC 2VBWA 2XAJA 1TBXA 2HYFA 3GZ6A 4U0YA 4ESBA 1K79A 5AONA 4B8XA 5BOXA 1TLHB 2HQRA 2WV0A 1K78A 1W4MA 1KQ8A 2EB7A 3I71A 1R1TA 1J5YA 1Z6RA 2QBYB 4L0YB 1JXSA 3CUOA 1G3SA 1HKQA 4KMFA 4I0AA 3KE2A 5TJJA 1KQ9A 5LHHA 1FSHA 4N0BA 3WE2A 1R23A 4WK8F 1YW7A 4PCQA 2VBZA 3E5XA 5FB2A 1C0WA 2K02A 4ZYGA 3H3UA 5D6FA 4ASNA 2DO7A 2E7XA 1QO0D 1HKTA 2ETHA 4TV7A 3LQQA 1Z05A 4HX8A 4LLLA 4KT5C 3TKYA 4HLYA 2CFXA 1TQIA 2NNNA 2XKOA 1U8RA 3ZMDA 5DUKA 2VE8A 2Y48A 4BH9A 1DDNA 3M8EA 4UXNA 3DPLC 3DF8A 3GX4X 1R22A 2LF8A 3GO5A 4RGRA 2OA4A 1TTYA 4MQ9F 2QQBA 3WTTC 4FHTA 3CO7C 4L18B 2DI3A 2MLKA 3VODA 1V3FA 2PEXA 2VC1A 1XGSA 2EV5A 1LVAA 1U5TC 1ON1A 3BJAA 3K1NA 5HS8A 1BI0A 1IN8A 3KP4A 2RNJA 1IXSB 2X4HA 5D8KB 1B59A 1AOYA 1QNTA 5JFRA 1USTA 5FD5A 3HOTA 3SFZA 3V7RA 4Y13A 1FBUA 2L3DA 1REPC 1S7OA 2V9VA 1E2XA 1SMYF 2G7HA 1IN5A 1SAXA 2XUBA 5L3BA 4LB6B 2J5PA 5CVUA 1H9GA 3H3ZA 1BI2A 4KYWA 2ACJA 3LAJA 1KYWA 2Y75A 4ZYDA 3IRRA 4UUVA 2OBPA 4U0VA 2AS5F 4JQFA 2L4AA 1IZ1A 3FXQA 1BJAA 4AWXB 1XGNA 3L2CA 3F8BA 4R1HA 4L9JA 4Q5SF 2M8EA 2A5YB 3ML6A 1O57A 4G8XA 4M9XA 1J9IA 2GQQA 4Z2YA 3PQKA 2A68F 1GVJA 3ZMZA 3BY6A 3LQRA 4RAYA 3TQNA 2PQ8A 3BP8A 3KP3A 1P4AA 4YIFA 1XMKA 1T6SA 4A12A 4MNUA 3D5LA 3LSTA 3WGIA 4P9UA 4RGUA 3L9FA 2VODA 2AXLA 3LA2A 1FT9A 3Q5FA 5BMZA 1TNSA 1X3UA 1B6AA 4BYYA 2H27A 1SD6A 2IA1A 1R5GA 3U1DA 2EFOA 1LEAA 4A0ZA 1KU9A 3DV8A 4IHSA 2JRTA 4U88A 1Y0UA 3HOSA 2HKXA 2E7WA 1FLIA 2W85A 3HHGA 2Q2EA 2V6CA 2STWA 6PAXA 3PQJA 4AIKA 3ABUA 3FMQA 2H09A 5CJ9A 3KZZA 3R0JA 2ZBKA 3OOPA 2KIUA 3DEUA 4M73A 4OIPF 2FBIA 4L0ZB 3ISPA 1IXCA 2EA4A 4NHJA 2ZO4A 4I0BA 4YFXF 2XAFA 2GXBA 2UXXA 1W5SA 5TRDA 5J6XA 4OOIA 4IHTA 1F4KA 2VT2A 2EFNA 3I59B 2UWMA 4CDGA 5L3FA 4DQ2A 4Y17A 1UFMA 2OU2A 2L01A 2QQ9A 4L9NA 1F5TA 5DYMA 5FGMA 2VC0A 1S8NA 1KA8A 1XSVA 4G7OF 3CUQC 4HF0A 3MQ0A 3ZN0A 2DLLA 4ENMA 2DW4A 1SFUA 2WWYA 1SD4A 1B9MA 4KFCA 1SFEA 2VXZA 4P55A 1R58A 2MC3A 1LJ9A 3KP5A 1U78A 5FLXK 4F7ZA 2Z33A 4UV9A 5DCMA 3ZMVA 2FQ3A 5BPDA 5E1WA 1LB2A 3FM3A 4BHPA 3MAJA 1KU3A 1L0OC 3MFKA 4I7HA 2GZWA 2A6HF 4I2OA 4LK1F 2IA0A 4U0WA 2P7CB 1PP7U 4P96A 4S04A 2DPUA 2DAOA 2V79A 2FNPA 3P7NA 4U7BA 4WXHA 3EYIA 2FXAA 1BIAA 2OAZA 1FYLA 1FYKA 4Q47A 1FBSA 3JAMK 4KUMA 2VN2A 5ILUA 2Z9OA 3E5QA 5LGTA 1SMTA 3K69A 4OINF 1QZZA 2QWWA 4KIBA 4EM1A 5JVTA 1GXQA 3EUHA 2XVCA 3KP2A 5LBQA 1FP2A 5LHGA 4O3MA 4G6DA 2PBIA 3EYYA 3F3XA 1BC8C 3MZYA 3GW2A 2FOKA 1W5TA 2RKHA 1HSJA 2ESHA 3VOEA 2COMA 3IRQA 5A2QK 2FBKA 2TDXA 1J75A 1BOAA 2EFWA 1FPQA 5H6RA 2XIGA 1J2XA 3WGHA 3IKTA 2LF7A 3V7SA 4KA4A 3M1EA 2XGXA 1ZGAA 1IUYA 3V8KA 4UVBA 3F6OA 3KFWX 3KP7A 1PP8F 2F5FA 1QBJA 1P6RA 2GA1A 4P9FA 3LA7A 1RIOH 4M74A 4HDUA 1T38A 5DV5A 1WWXA 3GZ5A 4CHUA 3E5UA 1H9TA 2C6YA 4HA8A 3Q9VA 2VONA 3IC7A 3RPQA
chains in the Genus database with same CATH superfamily
1T39A 2MD5A 1G59A 2IT0A 2LH9A 3R4KA 4IF4A 3M9AA 3E0JB 3H5NA 3O2PE 4W97A 1ZG5A 1JT6A 1YIOA 3A0BC 3I53A 3TGNA 5EDNA 3J80Z 4KDPA 4LG0B 3TEDA 4DOZA 3ERED 3DXJF 3TP0A 1ETYA 2X9DA 2D1VA 3I54A 3CTAA 2O6GE 4ETSA 1HF0A 2L5QA 3I3LA 3V8LA 1T33A 2EIKH 3DP7A 4DW6A 3J80K 2CV2A 5F08A 2A07F 2JVGA 4EM0B 4UVAA 2NVTJ 2CQQA 2XHKA 4IO9F 3HKZA 4R79A 2EA2A 2HWVA 5DM7F 3KCCA 1T8IA 3BTLA 1D8JA 1BR1A 4MGRA 1YJ9I 1EF4A 5HLGA 1SFOJ 5F64A 2LKPA 4GDFA 2FMLA 5FRMA 3LSKA 3GXOA 1KGSA 5KVRA 3BWGA 1BN5A 1I27A 3L2VA 3HRTA 4XN3A 1TQPA 1V5GA 1Z3YA 1TZLA 3RKQA 1GT0C 1YE9A 5DCMB 2CSOA 1BBYA 1H88C 1OMIA 2FU4A 4C2MJ 3S14J 4DYRA 1GDTA 3RSNA 2YU3A 5J47A 2FEZA 4XIDA 5J3LA 4BNCA 3SZPA 3ULQB 4A3DJ 4OIOF 5J1RA 2L9VA 1R49A 4B09A 1LDJA 1U2WA 2H1LA 3FK6A 4II2A 4CZZA 1FNNA 1O7FA 1ZK8A 2KISA 4HLXA 3CCSI 2DQLA 1WKMA 4EJWA 1RNLA 3BJ6A 4BGDA 3ERMA 5ICGA 5DEQA 2XAQA 4RLFA 2Y69H 3ABTA 2CQKA 4OIRF 2K9SA 4Y3OA 4ENNA 3I55I 5L3DA 1X3WB 4O5VA 5K7FA 2EZLA 2XSJC 4ZYEA 2LRDA 1UMQA 3Q9SA 1ERDA 1P4XA 1JJ8C 3PNTA 4A3FJ 4N9IA 1WJCA 2D2WA 3ZOBA 4FX0A 2AQEA 1QU3A 3D0SA 1XCVA 2A5WA 4LD5A 4D9JA 1T98A 3QPHA 1XG1A 1TL8A 2VJIA 1PDNC 2DYRH 4LLGF 1TT5B 2CS3A 2NRAC 2MH9A 2R7FA 2RQPA 1MBHA 1BW6A 1ULYA 1BOBA 4ZJZA 4CCLA 2H6BA 2K27A 3GF2A 1Z3XA 2DXIA 4IOAF 1W0TA 2VI6A 2KRFA 4MQVA 2V4JC 2XF6A 1D5VA 3OL3A 3BJOA 1S3JA 2FRHA 1N75A 2HZTA 4B3AA 3ESWB 4EJUA 1IJWC 2GXGA 1ODDA 5AIQA 3KP6A 3CC4I 2VIXA 4IQJA 4AVZA 1B4AA 3K1PA 1LKXA 4ZZLA 2BYVE 1F1ZA 1OJLA 2P5VA 4RS8A 2Q8KA 3E6DA 2G7UA 3BROA 5GAHJ 3ASOH 2HKOA 4DNCA 3W3CA 3S2DJ 2HTJA 5CYVA 9ANTA 3GFIA 4ZZDA 2BV6A 3LFKA 4LJZF 1GV2A 2M4GA 4PJMA 5B66C 4DBQA 1MBKA 4OMYA 3NRVA 4WCGA 3CCLI 1K4SA 3I59A 4A6DA 1D1CA 3HYIA 3TDUC 1T2KA 3S3OA 4XLCA 2JWTA 2CWEA 3RKWA 3EETA 2IS2A 1YQAA 3MD2A 3BPVA 3EDPA 1JTYA 1G3YA 3W2AA 4J19A 1G3TA 2ELKA 2MGQA 2HQAA 3GBGA 3GLLA 2W1OA 3H35A 4L9VA 3WU0A 1ZTRA 5D5WB 1RKWA 1MMDA 1LVKA 3TOAA 4UVCA 2JA8J 2EZKA 3RKYA 5L3EA 4RB1A 4A3GJ 2CYYA 2JK3A 3A01A 2Y9YA 2E1MC 1MBEA 1MGTA 2HXIA 2O0YA 3WODF 5BPIA 2RREA 4Y15A 4RAGA 3CCVI 4C9YA 1JE8A 1J7KA 2FF4A 1FEXA 4FT8A 4BXUA 1NHAA 2FMYA 3RIRA 4NUBA 2XROA 4PUSA 1BC7C 3WU1B 2CFOA 1JT0A 1VQ7I 2J5OA 4U7DA 2BY2A 2MH2A 4EV0A 2RVCA 5KK1A 5HDGA 1FBQA 5DD4A 1MKMA 4LFUA 3VYUB 3RQIA 2NVQJ 4KN4X 3BCBA 4BU2A 3PO2J 2L02A 3ZRGA 4BJ5C 3IWZA 2LDUA 2OJED 3HB9A 1F43A 4LG0A 1OPCA 3SDBA 5LRSA 1MBFA 2VPRA 4XBFA 3AKZA 1FX7A 1Z21A 2HOEA 4L9TA 1TWGJ 2DMUA 4HF2A 4FASD 2KJCA 2NOJB 4IJAA 4PSWA 1RETA 2YX4A 1J59A 3FHNA 5DM6F 5BQTA 2PLYA 1P2FA 3KEOA 4LB5A 1P4WA 1EH7A 2O5RA 1NH3A 3BG6A 1I3QJ 3G3ZA 1OYIA 1R00A 2CUFA 3SZGA 3COAC 3E6BA 2ELHA 2R7ZJ 4UV8A 3FKIJ 1ZG3A 2NVUB 3KETA 2HEOA 1WI3A 2F4IA 2O7OA 3BR0A 3PUBA 4D7NA 2H8RA 2ZXIA 1XDSA 5EJCA 3BT9A 3M3YJ 1YW8A 3FXLA 1U9OA 1Z91A 3A1YA 2M87A 3SZTA 3B6CA 1YX3A 4O6JA 3DPTA 5FKNA 2VQCA 1R71A 4AYBN 4BE1A 2LTPA 2F6CA 4NC7A 3KIOA 2ZB9A 3TOBA 1DPUA 4BXXJ 2W57A 4HYEA 5AIPA 3IAM2 1G8XA 2LNBA 2HGCA 4I98B 3ROUA 1R7JA 5HLIA 2MLGA 3L2RA 3VYTB 3L2UA 4EGYA 1IG7A 1DGRM 4LG3A 4ZTJA 2CO5A 3J81Z 3JRDA 3IKVA 2CW7A 5HLTA 1ZRCA 1P9QC 3HOZJ 2LK2A 3JRHA 3U1KA 1EH6A 4JX6A 4G7HF 1K6OA 4UB8C 4E7KA 3JTGA 3GZNB 4RM2A 1U0JA 3J81K 4GYGA 3CDIA 4BKXA 4J00A 4RDUA 1X1AA 3P5JA 1P7JA 3I58A 4A5NA 3HTSB 3KYDB 4CYDA 2ZJPF 1MZBA 4JP0A 3V4GA 3FX3A 2DPDA 1K6YA 2ZJRF 1V4RA 4A3IJ 2L9RA 3T0YA 2OQRA 1CGPA 1BL0A 4N9HA 2FBHA 2M3AA 1UZCA 3C1DA 3LMMA 1VZ0A 4E7LA 3SQNA 1SEUA 3RDIA 1U3EM 2W00A 2FUG2 3CQZJ 2IPQX 3MZHA 4ESJA 3C7JA 2CUZA 4M72A 4A6EA 4KN7X 5FKOA 4IVNA 4G9YA 1FWZA 2DOFA 2LY1A 3BZKA 2IP2A 4GCVA 3K2ZA 4Y52J 2RC4A 3VYRB 2O3FA 1TW3A 4XSZF 3TL4X 3S93A 5FLVA 2R7QA 1KQ0A 3CESA 2EILH 4WXCA 5CLSA 3JSOA 2KHMA 2PG4A 1GHCA 2VT3A 2ICWG 5K5RA 1AU7A 1UG2A 4UB6C 4ZYAA 3I9V2 1X2NA 1VQ6I 3WTXC 5E18F 1R4MB 1W7PD 4XLNF 2ISZA 2IS6A 3L2WA 5GADJ 3S2HJ 2WADA 3GFLA 4BACA 5FRNA 2BHZA 1Y8QB 4KICA 4V2FA 1DU0A 2BBYA 4QSHA 2P6SA 4XRFA 2DK5A 5E8IA 2X1CA 3HUGA 3CCEI 2XF5A 1UAAA 3RPUA 5ICCA 2K7LA 5FO5A 3F0CA 4IXAA 1UHWA 4M6VA 3LSJA 5D8LB 3F22A 4KNYA 1FOKA 2FD5A 4C2TA 1FMVA 1IN7A 1ZLJA 2LBFA 2L7MP 2I5UA 2RNGA 4M9SA 4A69C 3QP5A 3OYMA 2ME6A 4AC0A 2QQ8A 1VQLI 2NS0A 3JW4A 3TO6A 3BZ6A 1YX5A 4AUXA 3D5RC 2BW3B 2Y30A 3PFIA 2YR2A 3OWTA 2CQXA 2P5LC 4P5OA 1Z6TA 2CH0A 4M6YA 4ENKA 1HW1A 2DMNA 5JVGF 4IL6C 2DQRA 4HX7A 3JSPA 4B3XA 2PFBA 2M1BA 4BHBA 3C18A 3GMEA 3WG9A 5L3GA 1XC5A 1VI0A 2UXNA 2KIFA 4BQQA 1POGA 3BR6A 1CQTA 1FZPB 3HL2A 5IT9K 1ZHFA 3DTEA 3FK7A 5KHDA 5B1AH 2NNYA 3VB2A 1O3TA 2XPWA 5J4VA 3DPUA 2E1NA 5DD8A 2VKHA 4HX4A 1X2MA 4NQWA 3ZPLA 1SFXA 3RZDJ 3HM5A 4RMNA 4A3JJ 1Y8RB 1TWHJ 2DK8A 1IGNA 4R8HA 1KONA 3CMAI 2CW0F 4NC8A 3GFMA 5F0CA 3HSEA 4IRGA 2FE3A 1U5TB 4XRSA 1ITYA 2H8WA 4PZJA 2EINH 4I09A 2Z3YA 1GUUA 1IRXA 4B1RA 2R7TA 4UY8I 1TQMA 4PDKA 5LLQA 1R1UA 2NYXA 3M8FA 2HOAA 3HIFA 3MKLA 2STTA 3O8GA 3U9GA 2NVXJ 2IVMA 3OIQA 4X1EA 4LMYA 3H0DA 1I39A 2R4GA 2M30A 2RN7A 3WE3A 1PUFA 2VPLA 3T8TA 3PM1A 3AL0B 2Q0OA 3WTSC 1K61A 1APLC 4QIWN 2XV4S 4KT6A 5EG0B 3P9CA 3BOQA 5F04A 1WJEA 1ZARA 3E1SA 3JCUC 2O8KA 1WJDA 4EQQA 1WHUA 4Z6YA 5FKLA 1AA7A 3HPGA 4DIQA 4FX4A 2ADUA 1ENHA 3OL4A 3KZIC 4ZDOA 3H9JA 4EM2A 1W0UA 4HNVA 3R0AA 3OY9A 2WC2A 5E1ZB 1IN4A 3BTIA 5D4RA 1JKPC 3R6SA 3CDHA 4BBRJ 4B44A 4EJTA 1BJZA 2VOOA 4ZYHA 3ZQIA 2F5DA 3CCJI 3JRAA 4A3EJ 1E3OC 3NWTA 1K7AA 1FSEA 4PFPA 1Y56A 4XKVA 2UZKA 5C44J 1YO5C 2LR8A 3F72A 3S3NA 2HDWA 1PYVA 2L2OA 4FETA 4QLCU 2ID6A 3CUQA 4BAYA 2PN6A 3CP2A 2AXTC 5LRRA 1R5ID 1D8KA 3GTKJ 1X3ZB 2JA2A 3K0LA 3HOWJ 3C3WA 3HXLA 3IH2A 1MNMC 2LSOA 3TDZC 3AAFA 5CVVA 1QA6A 5CQEA 3VEPA 4XSXF 4BXFA 1HDDC 4IHWA 2EK5A 5E17F 3WHBA 5ICEA 5CVIA 3I4MJ 2RDPA 2VQHA 2OQGA 3JTHA 2ECBA 4PFOA 5JR3A 2YPRA 2DA1A 4HV6A 1YHQI 2PJRB 3ZR8X 2DT6A 2XPVA 2X6XA 3FDYA 2A69F 3I0TA 3WTZA 1T0FA 2DA7A 2FNAA 3A02A 1HDPA 3GTQJ 2KZVA 4M71A 3DQVC 1TW2A 1B8IB 2ZCWA 2OZ6A 1R36A 4CZCA 5ICFA 1HA8A 5H20A 1ETOA 2DT5A 4NDLA 3MKWB 4AVPA 3IHUA 2CUEA 4PJNA 3GYHX 3L00A 1ORKA 1BIBA 2GOMA 5D4SA 3K10A 3ONQA 1IAWA 2RAEA 5JI6A 3KLNA 4W1UA 3ZQGA 2QVOA 5GAGJ 1O3RA 2VKVA 4BBSJ 3RPUD 4YELA 3K4NA 1YG2A 1WJ5A 3FHZA 1BI1A 3WTUC 1TWCJ 2QA4I 3LOCA 5CVJA 1B9NA 3GEZA 1R1VA 1RZ4A 1NG6A 2HXOA 1A6IA 3B73A 1TNTA 4BEHA 1LEBA 3IH3A 2O61A 1JI8A 3OYNA 2R5YA 2PMUA 1RESA 1WJBA 3ZN1A 3HRSA 3K2AA 3CMYA 1WH7A 5JLXA 3MCZA 1A04A 3NWSA 3KEQA 4DYQA 3IL2A 3FM5A 2WTEA 5GPAA 2EQRA 2V7FA 3M7GA 4BQAA 3MKZA 3N4MA 2EFQA 4RM3A 1I5ZA 2HVRA 2MW8A 3L2QA 2EFPA 1U8BA 5FFZA 1OFCX 1WPKA 3CCYA 3E3VA 5D6EA 3OYFA 2QBYA 1QVTA 2JUGA 1WH5A 4HSTA 3QPTA 4BQOA 3HEFA 3KZYA 4A3BJ 4H0EA 2HR3A 1JUMA 2M5WA 3CJQB 5FD6A 4GGGA 5E3MA 1X1DA 2DA5A 3H92A 2QEXI 2E1CA 1SFKA 1H89C 2M4KA 2EZHA 1MJ9A 2OTLI 4XMYA 1KU7A 2XKPA 4E7HA 3H3VK 3ECOA 1S29A 3IP4B 2CV1A 4JX4A 3LSPA 1XMAA 1DPRA 4C3IJ 4XLFA 2HQNA 1FYMA 4A3LJ 3M1CA 3PNVA 3RCOA 4CCJA 2HQ5A 4G6QA 1ZREA 4EMSA 4IPAA 3BTCA 3P9IA 2YX7A 2XB5A 2KIMA 1YS7A 3FF5A 2R7VA 4I02A 2XSDC 2EZIA 4E7ZA 5IP7J 4JBAA 2ZXHA 1VQ5I 2BY0A 2GAUA 5CVRA 3QU3A 2QF7A 1MJBA 2V6EA 4LK0F 4GRIA 1HQCA 2CU7A 4QTRA 2VJ4A 3M4OJ 5ERIA 1JJ6C 1WVRA 2JPCA 4N4OB 1ZN2A 3H5AA 2JSCA 4A0YA 3SXYA 3G4SI 4PJJA 3WGGA 1MDMB 4RLQA 1EJ9A 4JK1X 3ZMTA 1HW5A 5K1YA 3FMSA 2KT0A 1KYZA 2CUJA 3RKXA 2ME0A 1OQYA 2BY1A 2LP0A 3N05A 4Q48A 4WWCA 5BNGA 1XSDA 4IHXA 2ELJA 5A2QZ 2QSHX 2LC2A 2O03A 2X6WA 2HTSA 4ZC3A 3HSRA 4CGZA 2R7SA 1DP3A 2V1DA 4BUPA 4LIUA 3IWFA 4B43A 5FFXA 1DQUA 4RAZA 3QU6A 1LDDA 4ZH4F 3M8JA 5ILSA 2QLZA 1JUPA 4FCYA 3JRGA 5E8GA 2AQFA 4F91B 1QZYA 2BVMA 1MMSA 2WV1A 2OTJI 1O3SA 2GBYA 3RJPA 3OR2C 2WAFA 1FP1D 1Q1HA 3BDDA 3RYPA 5HS7A 3I5UA 5L3CA 1IRZA 1GXPA 2BVLA 1RRJA 1FJLA 3OYLA 3WTVC 2ZKZA 1BM9A 1IW7F 2LOOA 4NC6A 4XLPF 2F4MB 2GXAA 1LNWA 1XB4A 3VSKA 4QPQA 1TWFJ 3QP6A 1WQ2A 3OOUA 5E3OA 2I10A 4QWQA 5K5OA 2VQGA 2XDVA 2VBXA 4ON0A 1FMWA 1RUOA 3I4NJ 2VOPA 2FSWA 1IXRC 2K4JA 2RGVA 4EJOA 2MFZA 1W7PA 3QQAA 5HOOA 3PIOF 5KCMA 3FZVA 3G1LA 4KMUX 2CJJA 3CD6I 1XTAA 1R5HA 4N4NB 3DBHB 3J7YJ 1CF7B 2IBDA 1YOVB 3HZJA 2F5EA 1HCRA 1FTTA 3F6VA 4HZFA 2ZMEC 1XMXA 1S72I 4F92B 1O7LA 3NEUA 4D0PA 3WTYC 3PSFA 2P4WA 2ZXJA 4XORA 3DKXA 1QZEA 3D1NI 1DU6A 3EUHC 3LSHA 4MEXF 3HRUA 2M2EA 3K4JA 4UNOA 2Z2SB 3QWLA 1HXDA 4M6XA 4RB2C 5EEGA 2E19A 3KYLA 4JOMA 3F21A 3KLOA 3A2KA 1XCBA 3DEWA 2DA2A 2TRTA 2XGEA 1ZGJA 1A6QA 1VQ4I 2VJJA 1DP7P 1E17A 4WF2A 2IA2A 2ISYA 2ZNZA 3CO6C 4Q4ZF 1Z67A 2K5CA 2L54A 3QOPA 4S05A 3G1MA 1UJ8A 4EEFG 4MFDA 1XDUA 2KRHA 4LITA 2X0LA 1E3HA 3BPXA 4HW0A 1V5EA 4CYCB 1Z9CA 1YFHA 4YFKF 4I6ZA 1VQOI 1NK2P 2K9MA 3BCAA 3I56I 2DOEA 4OAYA 3A03A 4K2EA 5HDNA 4RGXA 4M3GA 4P1WA 5F1JA 2H94A 3ZMSA 4C3JJ 3ZQ7A 3G73A 1A35A 2CG4A 3LSMA 3HTUA 4V19K 2XB0X 1IC8A 5D5XB 5CQGA 3ELKA 2X51A 3FXRA 2DMQA 4F3QA 2FX0A 1X1PA 2Z16A 1HLVA 4KIFA 1UCRA 4PJLA 3M07A 3BR5A 2TCTA 4A0XA 1X4OA 4QPOA 5JHUA 2ZMEA 1J0RA 1FIAA 1MD0A 3AG1H 4PJ0C 3F8NA 4NNJA 2W25A 3OV8A 4AYBA 4D1QA 2P7VB 2RQQA 2P5KA 3OYGA 2QENA 1XN7A 5DDGA 1S7AA 2ZFUA 5HLHA 4ESFA 3F23A 5LGNA 1WZ2A 4LLNA 4AIJA 4OMZA 2JRMA 4GYIA 5EG0A 1OCRH 1USSA 2E2IJ 1OCTC 1ZLKA 2A05A 3HC7A 2K3FA 2F5VA 2XAGA 3KPHA 1QPIA 2HYGD 4BDZA 5HNFA 3JRCA 4B47A 2B9SA 3T8RA 2BXYA 2V1NA 5TISC 3CLOA 2ID3A 2K9LA 4U87A 4XKBA 4BE2A 3VPRA 1Y0NA 3WTWC 4PGHA 2DDBA 2DDAA 2ZXWH 2Q1ZB 2IS4A 3S3MA 1HC8A 3NQOA 4HQMA 2HYJA 2DTRA 3E6MA 1ETQA 2M9HA 3CCQI 4L5JA 1VTNC 5HDKA 2QKMB 1ON2A 1XGOA 1LDKB 3LNQA 3PUFA 3W6JB 4HDVA 1N77A 4L5IA 3HG9A 2X48A 2BXZA 3QYFA 2M0CA 4I01A 3LA3A 4OWRB 1ONVA 2VASA 2KJBA 3EPZA 4LIVA 5LHIA 3OYIA 4JX5A 1YIJI 3EUKL 1X1CA 3F8FA 3HSFA 2PMHA 2R7DA 1SVLA 4YG2F 2Z99A 3SDGA 1EKEA 2EV0A 2QYOA 5ED4A 1AWCA 3EQLF 3MEXA 3FMRA 4MLOA 3CZ6A 3DCFA 2HDCA 2GM4A 3T1BA 4EVIA 2V1XA 1JGSA 3ECHA 4E7SA 2PMZA 4C2UA 1U6GA 3ZP5A 2L0KA 4G94A 2K4BA 1H8AC 2WBMA 3PO3J 1I6XA 3O6BB 1FOWA 1Z77A 2R0QC 1SVOA 1JTXA 1ZAOA 2CQNA 1QQIA 2D1HA 5EZGA 4HNUA 4IHVA 5LGUA 1OR7A 1ZGWA 3CMEI 3L09A 3VWBA 2WY8Q 1F9NA 5IT3A 1HSTA 4BY7J 2R7RA 4G12A 1ZG1A 3FBIB 4DGWB 2M45A 2OZUA 2L9SA 5F1RA 4E7IA 4I99C 2G9WA 2PI0A 3FXOA 2Y0SA 4CCMA 3JAMZ 3RTRA 1EH8A 5FROA 4IKFA 3CMMA 1T08B 2ZFWA 4G7ZF 4A93J 2XGCA 4CO8A 5FLMJ 1CF7A 4HBLA 4UHTA 4BEHB 1UB9A 1I50J 3TP3A 3ZCOA 2M7BA 2WB1A 4XR6A 4GO1A 5LEKA 1IDYA 3I4PA 5DUIA 2K85A 5EEHA 2DBBA 2FA5A 4CXFA 4LGWA 2B0LA 4PGGA 5B1BH 2E2JJ 4RAFA 4F52A 5BS6A 1P92A 1IRGA 4A5MA 2AHQA 3LSIA 4BQNA 1S6LA 3V42A 1L3LA 4IHYA 3B02A 3SHFA 4ZDPA 1XX5A 4L5EA 2XC7A 5EF6A 3MVPA 5ILVA 1LFUP 2XRNA 3S2WA 1JGGA 1KU2A 1FY7A 2X1EA 3IH4A 2R3SA 3HBLA 3VFZA 1D1AA 3O3KA 3S1QJ 1ETXA 2MA3A 2E71A 2KFDA 3U2RA 4ENJA 3CLQA 4WX9A 1EV7A 1VF9A 5E1XA 3A01B 4JYKA 3SFIA 4BHCA 1I3AA 2QQAA 3K4BA 2O8XA 1MSFC 5LFAA 3HGYA 2A3SA 3TW6A 1ZRDA 2KLOA 3LAPA 3MWMA 1YTYA 2B7EA 4E7JA 1ZRFA 3ZQQA 2OPTA 2QUFA 3V7CA 4CA0A 5DCFA 2P0WA 2W84A 1QVUA 1RKTA 2YS9A 4J01A 1RR8C 1XPXA 2ESNA 3PL8A 1MNDA 1QPMA 2DU9A 2M7AA 1SC7A 1D0ZA 1ZH5A 2VE9A 2IJLA 2Y0MA 2JTVA 4XONA 3E6CC 2F2EA 2JA6J 1I1SA 1ZYRF 5J1UA 4AIHA 4KITB 4XKWA 1HKSA 5K7ZA 4CCOA 2D45A 1WI9A 1TP4A 4M9ZA 5EGOA 5HS9A 2H1KA 4E70A 3QPLA 4IRIA 2GIVA 2EWNA 1UHSA 1VQKI 1UHMA 1MJAA 3R60A 3QAHA 4IEJA 3OIPA 4NBQA 4RB3C 4M3BA 2B63J 1JKOC 3ZQLA 2GLOA 3DBRB 1LFBA 3QYBA 5LEJA 1SD5A 2L7FP 1MDMA 4OIQF 1WSUA 2VUMJ 4OU0A 3Q0UA 4XLHA 4HRIA 2QKLB 1K78B 2JJ7A 3C2GA 4AD9A 3F8MA 4HQEA 2BE5F 1IF1A 2QGUA 3KX2A 4KJZA 1YLFA 2Y0SN 4GXOA 3GTJJ 1HW2A 3I64A 4MHGA 4NB5A 1YS6A 2MC4A 2XAHA 3FXUA 3CJTB 1G4DA 2HVSA 1B1BA 4XICA 2KKOA 3BQZA 2RV8A 1JHHA 5D5UB 1XD7A 4Y7NJ 3ZXSA 1OYWA 2W24A 5GTHC 2QM3A 4MEYF 3HRMA 2OV7A 5LD2C 5H6QA 4MTEA 3K1MA 3ZMUA 3AG4H 2HS5A 2WAQA 5B5EC 1I1GA 2L7ZA 5J8FA 5E20A 1D1BA 2XF7A 3K4MA 1SD7A 3TO9A 1O3QA 1SAUA 3LFUA 1YW9A 1MNEA 2HZDA 1DUXC 2F5CA 1U5TA 3DTIA 3GTPJ 2YSRA 4HAMA 2PJPA 3MMYB 4EJVA 1LUJB 3BLYA 4XOTA 5IYBJ 3N97A 4HG2A 4FTHA 4YIIA 3SEQA 1ZR4A 2DODA 2V1UA 1W7PB 5M5YJ 2KZGA 3LWFA 2BGCA 2IW5A 3SJMA 4CUGA 1YYVA 4MTDA 1K83J 2MABA 2L7KA 2Y9ZA 2R93J 3PFYA 1PUFB 1OKRA 2R7UA 2L4MA 4A3CJ 2DYSH 5J8CA 4D7MA 3TBIA 3J7AO 4XRMA 1XSXA 3P9KA 5D5VB 4IQ4A 1D0XA 4ITVA 3F8CA 1FC3A 1X4PA 4KIGA 5JLWA 2JZYA 5IT9Z 2ZJ2A 1IUFA 2MG4A 4HV5A 2BOLA 2DA3A 1OYYA 2GWRA 1Z1DA 2X6OA 2IXSA 2K86A 2LFBA 2HDDA 2E34A 2EV6A 3DKWA 3RYRA 3U21A 5C4XJ 2ECCA 1PUEE 3E97A 4XRSG 3R61A 5M5WJ 1WRJA 2HNHA 4EGZA 1JHFA 2NAZA 2YU9J 2MD0A 1D5YA 1XGMA 2P6TA 3H9GA 1IO2A 2M0MA 1OISA 4YFNF 4A2UA 1LQ1A 4MO7A 1LE8B 4HOBA 3ASNH 3CJNA 1NK3P 1BI3A 3CUQB 2BHYA 2VQLA 3DFGA 4BJTA 2EBIA 3K9TA 2QZ8A 1MBJA 4HF1A 3GLXA 4MIMA 3OYBA 1O4XA 2XASA 1H0MA 1QGPA 1AKHA 4IRHA 1LFPA 4CYCA 3H1CA 1IV8A 1PVEA 2IGKA 2V9KA 4XM3A 5F6FA 4IZZA 5DTDA 3OYCA 1IRFA 2A61A 1RI7A 4II3A 3BG3A 3AL0C 1A5JA 1Q1VA 3T5XA 2W7NA 1ZELA 2EJRA 4RB0A 4D5CA 3OYKA 1ETVA 1HBXG 5FLXZ 3GFJA 2FJ1A 2CQ7A 4BL0B 1YRNA 4CICA 2VL8A 5E3LA 3FWEA 2AO9A 1TT0A 2ZMEB 5FKKA 4PK4A 1IN6A 2H6CA 2LBFB 3TO7A 3CCMI 3GVAA 5K5QA 2DFIA 1GV5A 2E36A 2P8TA 2JA5J 3QYEA 4V2GA 1STZA 3OYEA 2VBYA 3BTJA 3HPHA 4XKCA 1RUNA 2MBFA 2IEKA 5IOYA 2A6EF 2LYCA 1G6NA 4EATA 5HODA 2JN6A 2F4OB 1QHGA 4RGSA 3GWZA 4E6KG 3NAUA 2KL4A 4XNFA 2CGPA 2JPBA 3L7WA 1OCCH 2GA2A 3RI4A 2ZNYA 2E1MB 3MZ8A 3HHHA 3CF5F 2JT1A 3S1MJ 2VLAA 4B4CA 3G6EI 2Z5UA 2IRFG 2BEOA 2OD5A 1G3WA 5EGOB 3K7AJ 1Z7UA 4XQFA 1D3YA 3W6KB 1MMGA 3NARA 3REOA 4WXDA 5KAIC 3QRFF 2K9NA 2R7WA 2HU9A 2EIJH 3GUDA 2HFHA 3V8JA 5HVQC 2VBWA 4UUTA 5KAFC 2XAJA 4X6AJ 1TBXA 1NG7A 5IOZA 2XPUA 2HYFA 3GZ6A 4U0YA 4ESBA 2DJNA 2LREA 5AONA 1K79A 4B8XA 3DEEA 4BY1J 5BOXA 3HOVJ 3IV5A 1Z0XA 1TLHB 2HQRA 3WHCA 2WV0A 1K78A 1W4MA 2BZTA 1KQ8A 2EB7A 3I71A 1V54H 1R1TA 2LY2A 1W36D 1J5YA 1Z6RA 1Z7LA 2QBYB 4L0YB 1JXSA 2LD5A 3CUOA 1G3SA 4BS9A 5FJ8J 1HKQA 3CCRI 1S5LC 1ETWA 4KMFA 4I0AA 3KE2A 4CCNA 1XS9A 1ZKGA 2EH3A 2Z1DA 5TJJA 1KQ9A 3WU2C 2OF7A 5LHHA 2L9NA 1FSHA 3S1NJ 4N0BA 2X85A 2MYSA 3WE2A 5IP9J 5M5XJ 5IY5H 1R23A 2CV0A 4WK8F 1YW7A 2LLKA 4PCQA 2VBZA 1VQNI 2GOXB 2JUCA 2MSYA 3E5XA 5FB2A 1MMNA 4E4HA 1Y1VJ 1C0WA 2K02A 4ZYGA 1YI2I 3OR1C 3H3UA 1GVDA 5D6FA 4ASNA 2DO7A 1ZR2A 3FXMA 2E7XA 1KZHA 1QO0D 1IDZA 2DN0A 1HKTA 2ETHA 4TV7A 2PMZN 3LQQA 1Z05A 4HX8A 4LLLA 4KT5C 3W2VA 2V26A 3TKYA 3BG5A 5F0FA 4HLYA 2R5ZB 3S32A 2KDZA 2CFXA 1TQIA 2NNNA 2XKOA 3HUGB 1U8RA 2KDOA 1FOYA 3DU6A 4YEJA 3ZMDA 1R6RA 5DUKA 1MMAA 3DKYA 1TWAJ 2W48A 4UUSB 3KEYA 2VE8A 3PNYA 3H5RA 3FBNB 1LPQA 2Y48A 4BH9A 1DDNA 3M8EA 4UXNA 3DPLC 3OYHA 4M3DA 3DF8A 2BY3A 3RQ4A 4S0HB 1P7IA 3GX4X 1R22A 2LF8A 3LL7A 2JSPA 3GO5A 1VQMI 4RGRA 1W1WE 2DTZA 1W36C 2OA4A 3QOEA 4C30A 2PJRA 1TTYA 4MQ9F 2QQBA 3WTTC 3JR9A 2IS1A 2M34A 1WJFA 4FHTA 3CO7C 1EA3A 4L18B 2DI3A 5K7HA 2MLKA 3VSLA 3VODA 3CC2I 1V3FA 1MH3A 2DFEA 5M3MJ 3Q3SA 3PJRA 1LE8A 4I76A 1B72B 1WJAA 3S15J 2PEXA 2W82A 2VC1A 5F0HA 4AIDA 1XGSA 2EV5A 3PSIA 4D5FA 1K4TA 2R92J 1LVAA 1U5TC 1ON1A 2NS7A 2R7OA 3UR3C 3BJAA 3K1NA 4HSRA 3E7LA 5HS8A 1BI0A 1IN8A 1AKHB 3KP4A 2RNJA 3OS2A 1IXSB 2X4HA 5CPRB 1WGXA 4AM3A 3TMOA 5D8KB 1B59A 4YIRX 1AOYA 2XAUA 1QNTA 1BR2A 3OSFA 5JFRA 1E0EA 1USTA 5C3EJ 5FD5A 3HOTA 1I6HJ 3SFZA 3V7RA 4Y13A 3ZQCA 1FBUA 1OLTA 5IPAA 2L3DA 1X19A 2VKDA 2ZJQF 1REPC 4NQWB 1S7OA 3G2BA 3HOUJ 1YITI 2V9VA 1E2XA 1SMYF 2G7HA 4CCKA 1IN5A 1SAXA 3SEZA 2VB6A 2GIZA 1FTZA 2XUBA 5L3BA 4LB6B 3G71I 1YRNB 2J5PA 5CVUA 1YJWI 2IGOA 3ZQFA 1H9GA 2R5YB 3H3ZA 4AU7A 1BI2A 4KYWA 2ACJA 2K40A 3HKZN 1V55H 3LAJA 3G1OA 2DMTA 1KYWA 2Y75A 4ZYDA 2E35A 2NVYJ 3IRRA 4FE7A 4FE4A 4UUVA 2OBPA 3MN2A 4U0VA 2AS5F 3A0HC 3BR2A 4JQFA 3JRIA 2L4AA 1IZ1A 3FXQA 1TC3C 5J4YA 1BJAA 3OYDA 2CW8A 4AWXB 1XGNA 3L2CA 3F8BA 4R1HA 4L9JA 4XOPA 5GP9A 4Q5SF 2M8EA 2A5YB 5IP6A 3ML6A 4F93B 1O57A 3JREA 1T95A 4G8XA 4M9XA 1J9IA 2GQQA 2VJ5A 2ZSIB 1FOXA 4Z2YA 3PQKA 5TGTA 1VQ9I 2A68F 1GVJA 2OCEA 3ZMZA 2KQRA 3DLAA 3BY6A 3LQRA 4RAYA 3OS0A 3TQNA 5M3FJ 3J7AY 2PQ8A 3BP8A 4YRVA 3LSRA 2DA6A 3KP3A 1P4AA 5J40A 4YIFA 1FIPA 1XMKA 1T6SA 1WCMJ 4A12A 2ZSHB 2WAEA 1E3PA 3D5LA 4MNUA 3FXKA 3LSTA 1S9HA 4X0GA 3DTKA 5FKMA 3WGIA 3HOYJ 4P9UA 2LKSA 4RGUA 1QRYA 1IV6A 3L9FA 5IYCJ 1Y1WJ 3Q0WA 1MBGA 2VODA 2AXLA 1X1BA 1FT9A 1M1EB 3LA2A 1BA5A 2HPMA 4BDYA 3Q5FA 3FIWA 5BMZA 1TNSA 1VFCA 1X3UA 1B6AA 4BYYA 2H27A 1F36A 4DYCA 1R9TJ 1SD6A 2IA1A 1YJNI 2K3PA 4RA2A 1R5GA 1V5FA 2DFFA 2EFOA 3AG2H 3U1DA 1JKQC 4A3MJ 1LEAA 2QCOA 3OYJA 4A0ZA 2FQ4A 3CJRB 1KU9A 3DV8A 4IHSA 3K70C 3FKJA 1PJRA 2JA7J 3IUOA 2KRCA 2JRTA 2VKEA 2Y2ZA 4MFEA 4G6TB 4U88A 1Y0UA 3HOSA 2HKXA 4FQGA 5KNLA 3AG3H 1JUSA 2E7WA 3K4KA 1FLIA 2KIQA 2W85A 3Q0VA 1MSEC 2E1OA 1JKRC 1J09A 3HHGA 1AHDP 2Q2EA 2V6CA 3LSGA 4HNTA 2NS8A 2STWA 4H4KC 2BW3A 6PAXA 5C4JJ 4RBOA 3PQJA 4AIKA 3ABUA 3FMQA 2H09A 5CJ9A 2R5ZA 3HDDA 5B3SH 3KZZA 3C2BA 3R0JA 2P81A 2ZBKA 3L1PA 4B48A 3O8HA 3OOPA 2KIUA 3DEUA 4M73A 4ANJA 4OIPF 1SANA 3K6GA 2FBIA 3GCMA 2WB1N 4L0ZB 3ISPA 1IXCA 4ABZA 3J7ZI 1Y6IA 2DA4A 4UUSA 2UUZA 3ZGKA 2EA4A 4NHJA 2ZO4A 2EIMH 4I0BA 4A3KJ 3PIPF 2IGNA 4YFXF 3ABMH 5H2FC 3GTGJ 3SYTA 2XAFA 2GXBA 2UXXA 5GPCA 1W5SA 2IGMA 1T0FC 5TRDA 2E5ZA 5J6XA 3CP8A 4OOIA 2HI3A 4HPQA 1RR7A 2KPMA 1F4KA 4IHTA 3GTLJ 2VT2A 2HVQA 1A31A 5F27A 2DJIA 2EFNA 2JMWA 2A6TA 2LVSA 2UV1A 3BZCA 3I59B 5HNHA 2UWMA 2X1DA 4CDGA 3CCUI 4C3HJ 2QSFX 5L3FA 4F55A 4DQ2A 1B72A 3GTOJ 3B6AA 1BW5A 1ETKA 4Y17A 1N78A 3DU5A 1UFMA 2OU2A 3OMYA 4DZJA 2L01A 5CKTA 5E3NA 3OSGA 3DBLB 2QQ9A 4L9NA 1RPWA 2DCEA 1OCZH 1F5TA 5DYMA 5FGMA 2VC0A 1S8NA 1D0YA 1KA8A 1XSVA 1R4NB 4G7OF 2W4SA 3CUQC 3DLLF 4HF0A 3HGGA 1MW7A 2LMDA 3MQ0A 3ZN0A 2M8GX 3OS1A 2QSGX 2DLLA 2DMPA 4BJ6C 1N25A 4ENMA 3WG7H 1T56A 2DW4A 1SFUA 2WWYA 4PSXA 1SD4A 2EPFA 1B9MA 4Y4RA 3RZOJ 2E60A 1G2HA 4KFCA 2OUMA 5EYRA 1SFEA 2FOWA 2WY7Q 3ABKH 3S17J 1QHHD 1ACIA 2VXZA 2ZC2A 4P55A 2JVHA 4XL9A 1R58A 2DFHA 2MC3A 3H0GJ 1LJ9A 2E5NA 2KP6A 3OIOA 3KP5A 3K70D 1U78A 3QODA 5J1YA 5FLXK 4F7ZA 4DBRA 1ZQ3P 2Z33A 3C2HA 2OCCH 4UV9A 5DCMA 1HOMA 4IOCF 1W5CC 3AFHA 3EUAA 3ZMVA 3S16J 2FQ3A 3ZQHA 2JQ7A 3A4CA 5BPDA 5E1WA 3BG9A 4XN0A 4KISA 1VQ8I 4DJAA 1VQPI 1LB2A 3FM3A 5E79C 4BHPA 3X2QH 3MAJA 2XGDA 1OR7C 2HOTA 1KU3A 2E2HJ 3CF2A 3K4CA 1L0OC 4HEA2 3MFKA 4I7HA 1MH4A 1U9NA 2GZWA 2A6HF 2I8DA 2CMPA 3D5SC 4I2OA 5GTIC 3IAS2 3BC8A 3UNGC 4LK1F 2IA0A 4U0WA 2P7CB 3DWLE 4DZPA 4LOCA 1VNDA 1PP7U 3JRBA 3W2WA 4P96A 3MKYB 1B8IA 4S04A 2DAOA 2DPUA 4CSWA 1OCPA 2V79A 2FNPA 3P7NA 2N8GA 5IYDJ 3BQYA 4U7BA 3K4LA 2IAIA 3GTMJ 4WXHA 3EYIA 2FXAA 1BIAA 2OAZA 1FYLA 3CC7I 1FYKA 4BE0A 4Q47A 1WFXA 1FBSA 5GAEJ 3JAMK 2VXDA 4KUMA 3OYAA 2VN2A 3W6VA 1OCOH 5ILUA 2Z9OA 3KYCB 3E5QA 5LGTA 1SMTA 3K69A 4M3EA 4OINF 2X6YA 1QZZA 2QWWA 3JRFA 4KIBA 4EM1A 5JVTA 1GXQA 3EUHA 1NTCA 2XVCA 2XRLA 3KP2A 5LBQA 1FP2A 5LHGA 2HPIA 4O3MA 4G6DA 2PBIA 3EYYA 3S1RJ 3F3XA 3MZYA 1BC8C 3GW2A 2FOKA 1W5TA 2KMUA 2D5VA 4Y33A 2RKHA 1HSJA 5EEAA 4GFBA 1S7EA 2ESHA 2Q2EB 2LY9A 2COMA 2Y31A 4XK4A 3VOEA 3IRQA 5A2QK 4ZTFA 3FXJA 5DS9A 2FBKA 2TDXA 2DT7B 1UELB 1J75A 1BOAA 3CDLA 2EFWA 1FPQA 5H6RA 2XIGA 2COBA 1J2XA 3WGHA 3IKTA 2LF7A 2V9PA 4FISA 3V7SA 4KA4A 1GLNA 3M1EA 2XGXA 3ABLH 4OAZA 1ZGAA 2NOGA 1IUYA 3V8KA 2CRGA 4UVBA 2YUSA 5EZHA 4M3FA 4XLAA 4ZDLA 5JHFA 2F48A 3VDXA 3F6OA 4XLEA 3UKGA 3KFWX 2R7XA 3KP7A 1PP8F 2F5FA 4CH7A 1QBJA 1P6RA 2GA1A 4P9FA 3BR3A 2HOSA 3LA7A 3H36A 2O9LA 2G0EA 1RIOH 3H9QA 3S8PA 3F9KA 1BR4A 4M74A 2LG4A 4HDUA 4IX7A 3TW7A 3HOXJ 1RC9A 1T38A 2NXNB 2WA0A 5DV5A 1WWXA 2PX9A 1UG0A 3BG7A 3VYSB 3HJEA 3GZ5A 2K9QA 4CHUA 2DOAA 3E5UA 3FISA 2LKXA 1H9TA 2C6YA 4HA8A 3Q9VA 3QPSA 1Y39A 1MIJA 3BR1A 1X58A 1DGWY 1SVMA 2WAQN 3IC7A 2VONA 2OC6A 1A36A 3RPQA
chains in the Genus database with same CATH topology
1T39A 2MD5A 2IT0A 3R4KA 4IF4A 3M9AA 1ZG5A 3O2PE 4KDPA 1YIOA 3I53A 3TGNA 3J80Z 4LG0B 3ERED 3DXJF 2D1VA 3I54A 3CTAA 2O6GE 4ETSA 3V8LA 3DP7A 3J80K 2A07F 4EM0B 4UVAA 2XHKA 4R79A 2EA2A 2HWVA 3KCCA 1D8JA 4MGRA 5HLGA 5F64A 2LKPA 2FMLA 3GXOA 1KGSA 5KVRA 3BWGA 1BN5A 1I27A 3HRTA 1TQPA 5DCMB 2CSOA 1BBYA 1OMIA 2FU4A 2YU3A 2FEZA 4BNCA 3SZPA 3ULQB 4OIOF 4B09A 1LDJA 1U2WA 4CZZA 1FNNA 1O7FA 4HLXA 2DQLA 1WKMA 4EJWA 1RNLA 3BJ6A 5ICGA 5DEQA 2XAQA 3ABTA 2CQKA 4OIRF 4ENNA 5L3DA 4O5VA 4ZYEA 3Q9SA 1P4XA 4N9IA 2D2WA 4FX0A 3D0SA 1XCVA 4LD5A 1T98A 3QPHA 1PDNC 4LLGF 2NRAC 2MH9A 2R7FA 2RQPA 1ULYA 2H6BA 2K27A 3GF2A 2KRFA 4MQVA 1D5VA 3BJOA 1S3JA 2FRHA 2HZTA 4EJUA 2GXGA 1ODDA 5AIQA 3KP6A 1B4AA 3K1PA 4ZZLA 2BYVE 1F1ZA 2P5VA 4RS8A 2Q8KA 3E6DA 2G7UA 3BROA 2HKOA 4DNCA 2HTJA 5CYVA 3GFIA 4ZZDA 2BV6A 3LFKA 4LJZF 4OMYA 3NRVA 4WCGA 3I59A 4A6DA 3HYIA 3TDUC 1T2KA 2CWEA 3RKWA 3EETA 1YQAA 3BPVA 3EDPA 1G3YA 1G3TA 4L9VA 5D5WB 3WU0A 3TOAA 4UVCA 3RKYA 5L3EA 4RB1A 2CYYA 1MGTA 2O0YA 3WODF 5BPIA 4Y15A 1JE8A 1J7KA 2FF4A 4FT8A 4BXUA 1NHAA 2FMYA 3RIRA 2XROA 1BC7C 3WU1B 2J5OA 4U7DA 2MH2A 4EV0A 2RVCA 5KK1A 5HDGA 1FBQA 5DD4A 1MKMA 4LFUA 4KN4X 2L02A 3IWZA 2LDUA 4LG0A 1OPCA 5LRSA 4XBFA 1FX7A 2HOEA 4L9TA 4HF2A 2KJCA 4IJAA 2YX4A 1J59A 5BQTA 2PLYA 1P2FA 3KEOA 4LB5A 1P4WA 1EH7A 3G3ZA 1OYIA 1R00A 3COAC 2ELHA 3E6BA 4UV8A 1ZG3A 3KETA 2HEOA 1XDSA 1YW8A 1Z91A 3SZTA 2M87A 4O6JA 3DPTA 3TOBA 1DPUA 2W57A 4HYEA 5AIPA 2LNBA 2HGCA 4I98B 3ROUA 1R7JA 5HLIA 2MLGA 4EGYA 2CO5A 3J81Z 3IKVA 1ZRCA 1EH6A 4G7HF 1K6OA 3JTGA 3J81K 4GYGA 3I58A 4A5NA 3HTSB 4CYDA 1MZBA 3V4GA 3FX3A 2DPDA 1V4RA 3T0YA 2OQRA 1CGPA 4N9HA 2FBHA 3C1DA 3SQNA 3RDIA 1U3EM 2IPQX 3MZHA 4ESJA 3C7JA 4M72A 4A6EA 4KN7X 4IVNA 4G9YA 1FWZA 2IP2A 4GCVA 3K2ZA 2RC4A 2O3FA 1TW3A 4XSZF 1KQ0A 4WXCA 5CLSA 3JSOA 2PG4A 1GHCA 2VT3A 5K5RA 3WTXC 5E18F 4XLNF 1W7PD 2ISZA 3GFLA 4KICA 2BBYA 2P6SA 4XRFA 2DK5A 5E8IA 3HUGA 3RPUA 5ICCA 2K7LA 5FO5A 4IXAA 1UHWA 5D8LB 3F22A 4KNYA 1FOKA 1IN7A 1ZLJA 4M9SA 3QP5A 2NS0A 3JW4A 3TO6A 3BZ6A 3PFIA 2YR2A 2P5LC 4P5OA 1Z6TA 4M6YA 4ENKA 1HW1A 2DQRA 4HX7A 3JSPA 2PFBA 2M1BA 4BHBA 3C18A 3WG9A 5L3GA 2UXNA 2KIFA 1FZPB 5IT9K 1ZHFA 2NNYA 3VB2A 1O3TA 2E1NA 5DD8A 3ZPLA 4HX4A 4NQWA 1SFXA 2DK8A 4R8HA 2CW0F 3GFMA 3HSEA 4IRGA 2FE3A 1U5TB 4PZJA 4I09A 2Z3YA 1TQMA 4PDKA 5LLQA 1R1UA 2NYXA 3M8FA 3HIFA 2STTA 3U9GA 2IVMA 4LMYA 2M30A 2RN7A 3WE3A 3T8TA 2Q0OA 3WTSC 2XV4S 3P9CA 3BOQA 1ZARA 4EQQA 4FX4A 2ADUA 4EM2A 3R0AA 2WC2A 5E1ZB 1IN4A 5D4RA 3R6SA 3CDHA 4EJTA 2VOOA 4ZYHA 2F5DA 1K7AA 1FSEA 2UZKA 1YO5C 3F72A 4QLCU 3CUQA 4BAYA 2PN6A 5LRRA 1D8KA 3K0LA 3C3WA 2LSOA 3TDZC 3AAFA 5CVVA 5E17F 3VEPA 4XSXF 2EK5A 5ICEA 5CVIA 2RDPA 3JTHA 2OQGA 5JR3A 2YPRA 4HV6A 2A69F 3I0TA 3WTZA 1T0FA 2FNAA 4M71A 3DQVC 1TW2A 2ZCWA 2OZ6A 1R36A 5ICFA 5H20A 2DT5A 4AVPA 3IHUA 3GYHX 3L00A 1BIBA 5D4SA 1IAWA 5JI6A 3KLNA 2QVOA 1O3RA 1YG2A 3FHZA 1BI1A 3WTUC 5CVJA 1B9NA 3GEZA 1R1VA 1RZ4A 3B73A 1TNTA 1LEBA 2O61A 2PMUA 3ZN1A 3HRSA 3MCZA 1A04A 3KEQA 3IL2A 3FM5A 2WTEA 3M7GA 4BQAA 3N4MA 2EFQA 1I5ZA 2EFPA 5FFZA 3E3VA 5D6EA 2QBYA 3QPTA 3KZYA 4H0EA 2HR3A 2M5WA 5FD6A 4GGGA 3H92A 2E1CA 1MJ9A 1KU7A 2XKPA 3ECOA 1S29A 1XMAA 1DPRA 2HQNA 1FYMA 4G6QA 1ZREA 4EMSA 4IPAA 3P9IA 2YX7A 2KIMA 1YS7A 3FF5A 4I02A 4JBAA 2GAUA 5CVRA 3QU3A 1MJBA 4LK0F 1HQCA 5ERIA 2JPCA 1ZN2A 2JSCA 4A0YA 3SXYA 3WGGA 1MDMB 4JK1X 3ZMTA 1HW5A 5K1YA 3FMSA 1KYZA 3RKXA 4Q48A 4WWCA 1XSDA 5A2QZ 2O03A 2HTSA 3HSRA 4CGZA 2V1DA 3IWFA 5FFXA 4RAZA 3QU6A 1LDDA 4ZH4F 5ILSA 2QLZA 5E8GA 1QZYA 1O3SA 3RJPA 1FP1D 1Q1HA 3BDDA 3RYPA 5HS7A 3I5UA 5L3CA 1GXPA 3WTVC 2ZKZA 1BM9A 1IW7F 4XLPF 1LNWA 1XB4A 3QP6A 1WQ2A 4QWQA 5K5OA 2VBXA 4ON0A 1RUOA 2VOPA 2FSWA 1IXRC 2K4JA 2RGVA 4EJOA 1W7PA 5HOOA 3FZVA 4KMUX 1R5HA 1CF7B 2F5EA 3F6VA 4HZFA 1O7LA 3NEUA 4D0PA 3WTYC 2P4WA 2ZXJA 4MEXF 3HRUA 4UNOA 1HXDA 4M6XA 4RB2C 5EEGA 3F21A 3KLOA 1XCBA 1ZGJA 1DP7P 1E17A 4WF2A 2IA2A 2ISYA 2ZNZA 3CO6C 4Q4ZF 2L54A 3QOPA 4S05A 1XDUA 2X0LA 3BPXA 4HW0A 1Z9CA 1YFHA 4YFKF 5HDNA 4K2EA 4RGXA 2H94A 3ZMSA 3ZQ7A 3G73A 2CG4A 3HTUA 5D5XB 3ELKA 3FXRA 4KIFA 1UCRA 4A0XA 5JHUA 2ZMEA 1J0RA 1MD0A 3F8NA 2W25A 3OV8A 2P7VB 2P5KA 2QENA 1XN7A 5DDGA 1S7AA 5HLHA 4ESFA 3F23A 5LGNA 4LLNA 4AIJA 4OMZA 4GYIA 1USSA 1ZLKA 2XAGA 2HYGD 3T8RA 3CLOA 3WTWC 4PGHA 3NQOA 4HQMA 2DTRA 3E6MA 4L5JA 1VTNC 5HDKA 1ON2A 1XGOA 1LDKB 3W6JB 4HDVA 4L5IA 4I01A 3LA3A 1ONVA 5LHIA 2KJBA 3F8FA 3HSFA 2PMHA 2R7DA 4YG2F 2Z99A 2EV0A 2QYOA 5ED4A 1AWCA 3EQLF 3MEXA 3FMRA 2HDCA 3T1BA 4EVIA 2V1XA 1JGSA 3ECHA 1U6GA 3ZP5A 4G94A 2K4BA 1I6XA 3O6BB 1ZAOA 2D1HA 1QQIA 5LGUA 1OR7A 3L09A 5IT3A 1F9NA 1HSTA 1ZG1A 2M45A 2OZUA 5F1RA 2G9WA 2PI0A 3JAMZ 3RTRA 1EH8A 2ZFWA 4G7ZF 4CO8A 1CF7A 4HBLA 4UHTA 1UB9A 4GO1A 5LEKA 3I4PA 5DUIA 5EEHA 2DBBA 2FA5A 4CXFA 4LGWA 2B0LA 4PGGA 5BS6A 1P92A 1IRGA 4A5MA 1S6LA 1L3LA 3B02A 3SHFA 5ILVA 2XRNA 3S2WA 1KU2A 1FY7A 2R3SA 3VFZA 3O3KA 2MA3A 3U2RA 4ENJA 4WX9A 1EV7A 5E1XA 4BHCA 2QQAA 2O8XA 2A3SA 1ZRDA 3LAPA 3MWMA 1YTYA 1ZRFA 2QUFA 3V7CA 5DCFA 2W84A 2ESNA 1QPMA 2DU9A 1ZH5A 2VE9A 2IJLA 2Y0MA 2JTVA 3E6CC 2F2EA 1I1SA 1ZYRF 4AIHA 1HKSA 2D45A 1WI9A 4M9ZA 5HS9A 4E70A 4IRIA 2GIVA 2EWNA 1UHMA 1MJAA 3R60A 3QAHA 4RB3C 5LEJA 1SD5A 1MDMA 4OIQF 1WSUA 4OU0A 1K78B 4AD9A 3F8MA 4HQEA 2BE5F 1IF1A 1YLFA 4GXOA 1HW2A 3I64A 4MHGA 4NB5A 1YS6A 2XAHA 3FXUA 1G4DA 1B1BA 2KKOA 2RV8A 1JHHA 5D5UB 1XD7A 1OYWA 2W24A 2QM3A 4MEYF 3HRMA 5H6QA 4MTEA 3K1MA 3ZMUA 2HS5A 1I1GA 5J8FA 5E20A 1SD7A 3TO9A 1O3QA 1YW9A 1DUXC 2F5CA 1U5TA 2YSRA 4HAMA 2PJPA 4EJVA 3N97A 4YIIA 2V1UA 1W7PB 3LWFA 2BGCA 2IW5A 1YYVA 4MTDA 1OKRA 2L4MA 5J8CA 3J7AO 1XSXA 3P9KA 5D5VB 4KIGA 3F8CA 1FC3A 2JZYA 5IT9Z 2ZJ2A 4HV5A 2GWRA 1OYYA 1Z1DA 2K86A 2EV6A 3DKWA 3RYRA 1PUEE 3E97A 3R61A 4EGZA 1WRJA 1JHFA 2NAZA 1XGMA 2P6TA 4YFNF 4A2UA 1LQ1A 4HOBA 3CJNA 1BI3A 3CUQB 3DFGA 3K9TA 2QZ8A 4HF1A 3GLXA 1H0MA 2XASA 1QGPA 4IRHA 5F6FA 1IRFA 2A61A 1RI7A 3T5XA 2EJRA 4RB0A 1HBXG 5FLXZ 3GFJA 4CICA 3FWEA 2ZMEB 1IN6A 2H6CA 3TO7A 3GVAA 5K5QA 2DFIA 2P8TA 1STZA 2VBYA 1RUNA 2MBFA 2A6EF 1G6NA 4RGSA 3GWZA 2CGPA 2JPBA 3L7WA 2GA2A 3RI4A 2ZNYA 3HHHA 2JT1A 2Z5UA 2IRFG 2BEOA 2OD5A 1G3WA 1Z7UA 1D3YA 3W6KB 3REOA 4WXDA 3QRFF 3GUDA 2HFHA 3V8JA 5HVQC 2VBWA 2XAJA 1TBXA 2HYFA 3GZ6A 4U0YA 4ESBA 1K79A 5AONA 4B8XA 5BOXA 1TLHB 2HQRA 2WV0A 1K78A 1W4MA 1KQ8A 2EB7A 3I71A 1R1TA 1J5YA 1Z6RA 2QBYB 4L0YB 1JXSA 3CUOA 1G3SA 1HKQA 4KMFA 4I0AA 3KE2A 5TJJA 1KQ9A 5LHHA 1FSHA 4N0BA 3WE2A 1R23A 4WK8F 1YW7A 4PCQA 2VBZA 3E5XA 5FB2A 1C0WA 2K02A 4ZYGA 3H3UA 5D6FA 4ASNA 2DO7A 2E7XA 1QO0D 1HKTA 2ETHA 4TV7A 3LQQA 1Z05A 4HX8A 4LLLA 4KT5C 3TKYA 4HLYA 2CFXA 1TQIA 2NNNA 2XKOA 1U8RA 3ZMDA 5DUKA 2VE8A 2Y48A 4BH9A 1DDNA 3M8EA 4UXNA 3DPLC 3DF8A 3GX4X 1R22A 2LF8A 3GO5A 4RGRA 2OA4A 1TTYA 4MQ9F 2QQBA 3WTTC 4FHTA 3CO7C 4L18B 2DI3A 2MLKA 3VODA 1V3FA 2PEXA 2VC1A 1XGSA 2EV5A 1LVAA 1U5TC 1ON1A 3BJAA 3K1NA 5HS8A 1BI0A 1IN8A 3KP4A 2RNJA 1IXSB 2X4HA 5D8KB 1B59A 1AOYA 1QNTA 5JFRA 1USTA 5FD5A 3HOTA 3SFZA 3V7RA 4Y13A 1FBUA 2L3DA 1REPC 1S7OA 2V9VA 1E2XA 1SMYF 2G7HA 1IN5A 1SAXA 2XUBA 5L3BA 4LB6B 2J5PA 5CVUA 1H9GA 3H3ZA 1BI2A 4KYWA 2ACJA 3LAJA 1KYWA 2Y75A 4ZYDA 3IRRA 4UUVA 2OBPA 4U0VA 2AS5F 4JQFA 2L4AA 1IZ1A 3FXQA 1BJAA 4AWXB 1XGNA 3L2CA 3F8BA 4R1HA 4L9JA 4Q5SF 2M8EA 2A5YB 3ML6A 1O57A 4G8XA 4M9XA 1J9IA 2GQQA 4Z2YA 3PQKA 2A68F 1GVJA 3ZMZA 3BY6A 3LQRA 4RAYA 3TQNA 2PQ8A 3BP8A 3KP3A 1P4AA 4YIFA 1XMKA 1T6SA 4A12A 4MNUA 3D5LA 3LSTA 3WGIA 4P9UA 4RGUA 3L9FA 2VODA 2AXLA 3LA2A 1FT9A 3Q5FA 5BMZA 1TNSA 1X3UA 1B6AA 4BYYA 2H27A 1SD6A 2IA1A 1R5GA 3U1DA 2EFOA 1LEAA 4A0ZA 1KU9A 3DV8A 4IHSA 2JRTA 4U88A 1Y0UA 3HOSA 2HKXA 2E7WA 1FLIA 2W85A 3HHGA 2Q2EA 2V6CA 2STWA 6PAXA 3PQJA 4AIKA 3ABUA 3FMQA 2H09A 5CJ9A 3KZZA 3R0JA 2ZBKA 3OOPA 2KIUA 3DEUA 4M73A 4OIPF 2FBIA 4L0ZB 3ISPA 1IXCA 2EA4A 4NHJA 2ZO4A 4I0BA 4YFXF 2XAFA 2GXBA 2UXXA 1W5SA 5TRDA 5J6XA 4OOIA 4IHTA 1F4KA 2VT2A 2EFNA 3I59B 2UWMA 4CDGA 5L3FA 4DQ2A 4Y17A 1UFMA 2OU2A 2L01A 2QQ9A 4L9NA 1F5TA 5DYMA 5FGMA 2VC0A 1S8NA 1KA8A 1XSVA 4G7OF 3CUQC 4HF0A 3MQ0A 3ZN0A 2DLLA 4ENMA 2DW4A 1SFUA 2WWYA 1SD4A 1B9MA 4KFCA 1SFEA 2VXZA 4P55A 1R58A 2MC3A 1LJ9A 3KP5A 1U78A 5FLXK 4F7ZA 2Z33A 4UV9A 5DCMA 3ZMVA 2FQ3A 5BPDA 5E1WA 1LB2A 3FM3A 4BHPA 3MAJA 1KU3A 1L0OC 3MFKA 4I7HA 2GZWA 2A6HF 4I2OA 4LK1F 2IA0A 4U0WA 2P7CB 1PP7U 4P96A 4S04A 2DPUA 2DAOA 2V79A 2FNPA 3P7NA 4U7BA 4WXHA 3EYIA 2FXAA 1BIAA 2OAZA 1FYLA 1FYKA 4Q47A 1FBSA 3JAMK 4KUMA 2VN2A 5ILUA 2Z9OA 3E5QA 5LGTA 1SMTA 3K69A 4OINF 1QZZA 2QWWA 4KIBA 4EM1A 5JVTA 1GXQA 3EUHA 2XVCA 3KP2A 5LBQA 1FP2A 5LHGA 4O3MA 4G6DA 2PBIA 3EYYA 3F3XA 1BC8C 3MZYA 3GW2A 2FOKA 1W5TA 2RKHA 1HSJA 2ESHA 3VOEA 2COMA 3IRQA 5A2QK 2FBKA 2TDXA 1J75A 1BOAA 2EFWA 1FPQA 5H6RA 2XIGA 1J2XA 3WGHA 3IKTA 2LF7A 3V7SA 4KA4A 3M1EA 2XGXA 1ZGAA 1IUYA 3V8KA 4UVBA 3F6OA 3KFWX 3KP7A 1PP8F 2F5FA 1QBJA 1P6RA 2GA1A 4P9FA 3LA7A 1RIOH 4M74A 4HDUA 1T38A 5DV5A 1WWXA 3GZ5A 4CHUA 3E5UA 1H9TA 2C6YA 4HA8A 3Q9VA 2VONA 3IC7A 3RPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T39 A;  2MD5 A;  2IT0 A;  3R4K A;  4IF4 A;  3M9A A;  1ZG5 A;  3O2P E;  4KDP A;  1YIO A;  3I53 A;  3TGN A;  3J80 Z;  4LG0 B;  3ERE D;  3DXJ F;  2D1V A;  3I54 A;  3CTA A;  2O6G E;  4ETS A;  3V8L A;  3DP7 A;  3J80 K;  2A07 F;  4EM0 B;  4UVA A;  2XHK A;  4R79 A;  2EA2 A;  2HWV A;  3KCC A;  1D8J A;  4MGR A;  5HLG A;  5F64 A;  2LKP A;  2FML A;  3GXO A;  1KGS A;  5KVR A;  3BWG A;  1BN5 A;  1I27 A;  3HRT A;  1TQP A;  5DCM B;  2CSO A;  1BBY A;  1OMI A;  2FU4 A;  2YU3 A;  2FEZ A;  4BNC A;  3SZP A;  3ULQ B;  4OIO F;  4B09 A;  1LDJ A;  1U2W A;  4CZZ A;  1FNN A;  1O7F A;  4HLX A;  2DQL A;  1WKM A;  4EJW A;  1RNL A;  3BJ6 A;  5ICG A;  5DEQ A;  2XAQ A;  3ABT A;  2CQK A;  4OIR F;  4ENN A;  5L3D A;  4O5V A;  4ZYE A;  3Q9S A;  1P4X A;  4N9I A;  2D2W A;  4FX0 A;  3D0S A;  1XCV A;  4LD5 A;  1T98 A;  3QPH A;  1PDN C;  4LLG F;  2NRA C;  2MH9 A;  2R7F A;  2RQP A;  1ULY A;  2H6B A;  2K27 A;  3GF2 A;  2KRF A;  4MQV A;  1D5V A;  3BJO A;  1S3J A;  2FRH A;  2HZT A;  4EJU A;  2GXG A;  1ODD A;  5AIQ A;  3KP6 A;  1B4A A;  3K1P A;  4ZZL A;  2BYV E;  1F1Z A;  2P5V A;  4RS8 A;  2Q8K A;  3E6D A;  2G7U A;  3BRO A;  2HKO A;  4DNC A;  2HTJ A;  5CYV A;  3GFI A;  4ZZD A;  2BV6 A;  3LFK A;  4LJZ F;  4OMY A;  3NRV A;  4WCG A;  3I59 A;  4A6D A;  3HYI A;  3TDU C;  1T2K A;  2CWE A;  3RKW A;  3EET A;  1YQA A;  3BPV A;  3EDP A;  1G3Y A;  1G3T A;  4L9V A;  5D5W B;  3WU0 A;  3TOA A;  4UVC A;  3RKY A;  5L3E A;  4RB1 A;  2CYY A;  1MGT A;  2O0Y A;  3WOD F;  5BPI A;  4Y15 A;  1JE8 A;  1J7K A;  2FF4 A;  4FT8 A;  4BXU A;  1NHA A;  2FMY A;  3RIR A;  2XRO A;  1BC7 C;  3WU1 B;  2J5O A;  4U7D A;  2MH2 A;  4EV0 A;  2RVC A;  5KK1 A;  5HDG A;  1FBQ A;  5DD4 A;  1MKM A;  4LFU A;  4KN4 X;  2L02 A;  3IWZ A;  2LDU A;  4LG0 A;  1OPC A;  5LRS A;  4XBF A;  1FX7 A;  2HOE A;  4L9T A;  4HF2 A;  2KJC A;  4IJA A;  2YX4 A;  1J59 A;  5BQT A;  2PLY A;  1P2F A;  3KEO A;  4LB5 A;  1P4W A;  1EH7 A;  3G3Z A;  1OYI A;  1R00 A;  3COA C;  2ELH A;  3E6B A;  4UV8 A;  1ZG3 A;  3KET A;  2HEO A;  1XDS A;  1YW8 A;  1Z91 A;  3SZT A;  2M87 A;  4O6J A;  3DPT A;  3TOB A;  1DPU A;  2W57 A;  4HYE A;  5AIP A;  2LNB A;  2HGC A;  4I98 B;  3ROU A;  1R7J A;  5HLI A;  2MLG A;  4EGY A;  2CO5 A;  3J81 Z;  3IKV A;  1ZRC A;  1EH6 A;  4G7H F;  1K6O A;  3JTG A;  3J81 K;  4GYG A;  3I58 A;  4A5N A;  3HTS B;  4CYD A;  1MZB A;  3V4G A;  3FX3 A;  2DPD A;  1V4R A;  3T0Y A;  2OQR A;  1CGP A;  4N9H A;  2FBH A;  3C1D A;  3SQN A;  3RDI A;  1U3E M;  2IPQ X;  3MZH A;  4ESJ A;  3C7J A;  4M72 A;  4A6E A;  4KN7 X;  4IVN A;  4G9Y A;  1FWZ A;  2IP2 A;  4GCV A;  3K2Z A;  2RC4 A;  2O3F A;  1TW3 A;  4XSZ F;  1KQ0 A;  4WXC A;  5CLS A;  3JSO A;  2PG4 A;  1GHC A;  2VT3 A;  5K5R A;  3WTX C;  5E18 F;  4XLN F;  1W7P D;  2ISZ A;  3GFL A;  4KIC A;  2BBY A;  2P6S A;  4XRF A;  2DK5 A;  5E8I A;  3HUG A;  3RPU A;  5ICC A;  2K7L A;  5FO5 A;  4IXA A;  1UHW A;  5D8L B;  3F22 A;  4KNY A;  1FOK A;  1IN7 A;  1ZLJ A;  4M9S A;  3QP5 A;  2NS0 A;  3JW4 A;  3TO6 A;  3BZ6 A;  3PFI A;  2YR2 A;  2P5L C;  4P5O A;  1Z6T A;  4M6Y A;  4ENK A;  1HW1 A;  2DQR A;  4HX7 A;  3JSP A;  2PFB A;  2M1B A;  4BHB A;  3C18 A;  3WG9 A;  5L3G A;  2UXN A;  2KIF A;  1FZP B;  5IT9 K;  1ZHF A;  2NNY A;  3VB2 A;  1O3T A;  2E1N A;  5DD8 A;  3ZPL A;  4HX4 A;  4NQW A;  1SFX A;  2DK8 A;  4R8H A;  2CW0 F;  3GFM A;  3HSE A;  4IRG A;  2FE3 A;  1U5T B;  4PZJ A;  4I09 A;  2Z3Y A;  1TQM A;  4PDK A;  5LLQ A;  1R1U A;  2NYX A;  3M8F A;  3HIF A;  2STT A;  3U9G A;  2IVM A;  4LMY A;  2M30 A;  2RN7 A;  3WE3 A;  3T8T A;  2Q0O A;  3WTS C;  2XV4 S;  3P9C A;  3BOQ A;  1ZAR A;  4EQQ A;  4FX4 A;  2ADU A;  4EM2 A;  3R0A A;  2WC2 A;  5E1Z B;  1IN4 A;  5D4R A;  3R6S A;  3CDH A;  4EJT A;  2VOO A;  4ZYH A;  2F5D A;  1K7A A;  1FSE A;  2UZK A;  1YO5 C;  3F72 A;  4QLC U;  3CUQ A;  4BAY A;  2PN6 A;  5LRR A;  1D8K A;  3K0L A;  3C3W A;  2LSO A;  3TDZ C;  3AAF A;  5CVV A;  5E17 F;  3VEP A;  4XSX F;  2EK5 A;  5ICE A;  5CVI A;  2RDP A;  3JTH A;  2OQG A;  5JR3 A;  2YPR A;  4HV6 A;  2A69 F;  3I0T A;  3WTZ A;  1T0F A;  2FNA A;  4M71 A;  3DQV C;  1TW2 A;  2ZCW A;  2OZ6 A;  1R36 A;  5ICF A;  5H20 A;  2DT5 A;  4AVP A;  3IHU A;  3GYH X;  3L00 A;  1BIB A;  5D4S A;  1IAW A;  5JI6 A;  3KLN A;  2QVO A;  1O3R A;  1YG2 A;  3FHZ A;  1BI1 A;  3WTU C;  5CVJ A;  1B9N A;  3GEZ A;  1R1V A;  1RZ4 A;  3B73 A;  1TNT A;  1LEB A;  2O61 A;  2PMU A;  3ZN1 A;  3HRS A;  3MCZ A;  1A04 A;  3KEQ A;  3IL2 A;  3FM5 A;  2WTE A;  3M7G A;  4BQA A;  3N4M A;  2EFQ A;  1I5Z A;  2EFP A;  5FFZ A;  3E3V A;  5D6E A;  2QBY A;  3QPT A;  3KZY A;  4H0E A;  2HR3 A;  2M5W A;  5FD6 A;  4GGG A;  3H92 A;  2E1C A;  1MJ9 A;  1KU7 A;  2XKP A;  3ECO A;  1S29 A;  1XMA A;  1DPR A;  2HQN A;  1FYM A;  4G6Q A;  1ZRE A;  4EMS A;  4IPA A;  3P9I A;  2YX7 A;  2KIM A;  1YS7 A;  3FF5 A;  4I02 A;  4JBA A;  2GAU A;  5CVR A;  3QU3 A;  1MJB A;  4LK0 F;  1HQC A;  5ERI A;  2JPC A;  1ZN2 A;  2JSC A;  4A0Y A;  3SXY A;  3WGG A;  1MDM B;  4JK1 X;  3ZMT A;  1HW5 A;  5K1Y A;  3FMS A;  1KYZ A;  3RKX A;  4Q48 A;  4WWC A;  1XSD A;  5A2Q Z;  2O03 A;  2HTS A;  3HSR A;  4CGZ A;  2V1D A;  3IWF A;  5FFX A;  4RAZ A;  3QU6 A;  1LDD A;  4ZH4 F;  5ILS A;  2QLZ A;  5E8G A;  1QZY A;  1O3S A;  3RJP A;  1FP1 D;  1Q1H A;  3BDD A;  3RYP A;  5HS7 A;  3I5U A;  5L3C A;  1GXP A;  3WTV C;  2ZKZ A;  1BM9 A;  1IW7 F;  4XLP F;  1LNW A;  1XB4 A;  3QP6 A;  1WQ2 A;  4QWQ A;  5K5O A;  2VBX A;  4ON0 A;  1RUO A;  2VOP A;  2FSW A;  1IXR C;  2K4J A;  2RGV A;  4EJO A;  1W7P A;  5HOO A;  3FZV A;  4KMU X;  1R5H A;  1CF7 B;  2F5E A;  3F6V A;  4HZF A;  1O7L A;  3NEU A;  4D0P A;  3WTY C;  2P4W A;  2ZXJ A;  4MEX F;  3HRU A;  4UNO A;  1HXD A;  4M6X A;  4RB2 C;  5EEG A;  3F21 A;  3KLO A;  1XCB A;  1ZGJ A;  1DP7 P;  1E17 A;  4WF2 A;  2IA2 A;  2ISY A;  2ZNZ A;  3CO6 C;  4Q4Z F;  2L54 A;  3QOP A;  4S05 A;  1XDU A;  2X0L A;  3BPX A;  4HW0 A;  1Z9C A;  1YFH A;  4YFK F;  5HDN A;  4K2E A;  4RGX A;  2H94 A;  3ZMS A;  3ZQ7 A;  3G73 A;  2CG4 A;  3HTU A;  5D5X B;  3ELK A;  3FXR A;  4KIF A;  1UCR A;  4A0X A;  5JHU A;  2ZME A;  1J0R A;  1MD0 A;  3F8N A;  2W25 A;  3OV8 A;  2P7V B;  2P5K A;  2QEN A;  1XN7 A;  5DDG A;  1S7A A;  5HLH A;  4ESF A;  3F23 A;  5LGN A;  4LLN A;  4AIJ A;  4OMZ A;  4GYI A;  1USS A;  1ZLK A;  2XAG A;  2HYG D;  3T8R A;  3CLO A;  3WTW C;  4PGH A;  3NQO A;  4HQM A;  2DTR A;  3E6M A;  4L5J A;  1VTN C;  5HDK A;  1ON2 A;  1XGO A;  1LDK B;  3W6J B;  4HDV A;  4L5I A;  4I01 A;  3LA3 A;  1ONV A;  5LHI A;  2KJB A;  3F8F A;  3HSF A;  2PMH A;  2R7D A;  4YG2 F;  2Z99 A;  2EV0 A;  2QYO A;  5ED4 A;  1AWC A;  3EQL F;  3MEX A;  3FMR A;  2HDC A;  3T1B A;  4EVI A;  2V1X A;  1JGS A;  3ECH A;  1U6G A;  3ZP5 A;  4G94 A;  2K4B A;  1I6X A;  3O6B B;  1ZAO A;  2D1H A;  1QQI A;  5LGU A;  1OR7 A;  3L09 A;  5IT3 A;  1F9N A;  1HST A;  1ZG1 A;  2M45 A;  2OZU A;  5F1R A;  2G9W A;  2PI0 A;  3JAM Z;  3RTR A;  1EH8 A;  2ZFW A;  4G7Z F;  4CO8 A;  1CF7 A;  4HBL A;  4UHT A;  1UB9 A;  4GO1 A;  5LEK A;  3I4P A;  5DUI A;  5EEH A;  2DBB A;  2FA5 A;  4CXF A;  4LGW A;  2B0L A;  4PGG A;  5BS6 A;  1P92 A;  1IRG A;  4A5M A;  1S6L A;  1L3L A;  3B02 A;  3SHF A;  5ILV A;  2XRN A;  3S2W A;  1KU2 A;  1FY7 A;  2R3S A;  3VFZ A;  3O3K A;  2MA3 A;  3U2R A;  4ENJ A;  4WX9 A;  1EV7 A;  5E1X A;  4BHC A;  2QQA A;  2O8X A;  2A3S A;  1ZRD A;  3LAP A;  3MWM A;  1YTY A;  1ZRF A;  2QUF A;  3V7C A;  5DCF A;  2W84 A;  2ESN A;  1QPM A;  2DU9 A;  1ZH5 A;  2VE9 A;  2IJL A;  2Y0M A;  2JTV A;  3E6C C;  2F2E A;  1I1S A;  1ZYR F;  4AIH A;  1HKS A;  2D45 A;  1WI9 A;  4M9Z A;  5HS9 A;  4E70 A;  4IRI A;  2GIV A;  2EWN A;  1UHM A;  1MJA A;  3R60 A;  3QAH A;  4RB3 C;  5LEJ A;  1SD5 A;  1MDM A;  4OIQ F;  1WSU A;  4OU0 A;  1K78 B;  4AD9 A;  3F8M A;  4HQE A;  2BE5 F;  1IF1 A;  1YLF A;  4GXO A;  1HW2 A;  3I64 A;  4MHG A;  4NB5 A;  1YS6 A;  2XAH A;  3FXU A;  1G4D A;  1B1B A;  2KKO A;  2RV8 A;  1JHH A;  5D5U B;  1XD7 A;  1OYW A;  2W24 A;  2QM3 A;  4MEY F;  3HRM A;  5H6Q A;  4MTE A;  3K1M A;  3ZMU A;  2HS5 A;  1I1G A;  5J8F A;  5E20 A;  1SD7 A;  3TO9 A;  1O3Q A;  1YW9 A;  1DUX C;  2F5C A;  1U5T A;  2YSR A;  4HAM A;  2PJP A;  4EJV A;  3N97 A;  4YII A;  2V1U A;  1W7P B;  3LWF A;  2BGC A;  2IW5 A;  1YYV A;  4MTD A;  1OKR A;  2L4M A;  5J8C A;  3J7A O;  1XSX A;  3P9K A;  5D5V B;  4KIG A;  3F8C A;  1FC3 A;  2JZY A;  5IT9 Z;  2ZJ2 A;  4HV5 A;  2GWR A;  1OYY A;  1Z1D A;  2K86 A;  2EV6 A;  3DKW A;  3RYR A;  1PUE E;  3E97 A;  3R61 A;  4EGZ A;  1WRJ A;  1JHF A;  2NAZ A;  1XGM A;  2P6T A;  4YFN F;  4A2U A;  1LQ1 A;  4HOB A;  3CJN A;  1BI3 A;  3CUQ B;  3DFG A;  3K9T A;  2QZ8 A;  4HF1 A;  3GLX A;  1H0M A;  2XAS A;  1QGP A;  4IRH A;  5F6F A;  1IRF A;  2A61 A;  1RI7 A;  3T5X A;  2EJR A;  4RB0 A;  1HBX G;  5FLX Z;  3GFJ A;  4CIC A;  3FWE A;  2ZME B;  1IN6 A;  2H6C A;  3TO7 A;  3GVA A;  5K5Q A;  2DFI A;  2P8T A;  1STZ A;  2VBY A;  1RUN A;  2MBF A;  2A6E F;  1G6N A;  4RGS A;  3GWZ A;  2CGP A;  2JPB A;  3L7W A;  2GA2 A;  3RI4 A;  2ZNY A;  3HHH A;  2JT1 A;  2Z5U A;  2IRF G;  2BEO A;  2OD5 A;  1G3W A;  1Z7U A;  1D3Y A;  3W6K B;  3REO A;  4WXD A;  3QRF F;  3GUD A;  2HFH A;  3V8J A;  5HVQ C;  2VBW A;  2XAJ A;  1TBX A;  2HYF A;  3GZ6 A;  4U0Y A;  4ESB A;  1K79 A;  5AON A;  4B8X A;  5BOX A;  1TLH B;  2HQR A;  2WV0 A;  1K78 A;  1W4M A;  1KQ8 A;  2EB7 A;  3I71 A;  1R1T A;  1J5Y A;  1Z6R A;  2QBY B;  4L0Y B;  1JXS A;  3CUO A;  1G3S A;  1HKQ A;  4KMF A;  4I0A A;  3KE2 A;  5TJJ A;  1KQ9 A;  5LHH A;  1FSH A;  4N0B A;  3WE2 A;  1R23 A;  4WK8 F;  1YW7 A;  4PCQ A;  2VBZ A;  3E5X A;  5FB2 A;  1C0W A;  2K02 A;  4ZYG A;  3H3U A;  5D6F A;  4ASN A;  2DO7 A;  2E7X A;  1QO0 D;  1HKT A;  2ETH A;  4TV7 A;  3LQQ A;  1Z05 A;  4HX8 A;  4LLL A;  4KT5 C;  3TKY A;  4HLY A;  2CFX A;  1TQI A;  2NNN A;  2XKO A;  1U8R A;  3ZMD A;  5DUK A;  2VE8 A;  2Y48 A;  4BH9 A;  1DDN A;  3M8E A;  4UXN A;  3DPL C;  3DF8 A;  3GX4 X;  1R22 A;  2LF8 A;  3GO5 A;  4RGR A;  2OA4 A;  1TTY A;  4MQ9 F;  2QQB A;  3WTT C;  4FHT A;  3CO7 C;  4L18 B;  2DI3 A;  2MLK A;  3VOD A;  1V3F A;  2PEX A;  2VC1 A;  1XGS A;  2EV5 A;  1LVA A;  1U5T C;  1ON1 A;  3BJA A;  3K1N A;  5HS8 A;  1BI0 A;  1IN8 A;  3KP4 A;  2RNJ A;  1IXS B;  2X4H A;  5D8K B;  1B59 A;  1AOY A;  1QNT A;  5JFR A;  1UST A;  5FD5 A;  3HOT A;  3SFZ A;  3V7R A;  4Y13 A;  1FBU A;  2L3D A;  1REP C;  1S7O A;  2V9V A;  1E2X A;  1SMY F;  2G7H A;  1IN5 A;  1SAX A;  2XUB A;  5L3B A;  4LB6 B;  2J5P A;  5CVU A;  1H9G A;  3H3Z A;  1BI2 A;  4KYW A;  2ACJ A;  3LAJ A;  1KYW A;  2Y75 A;  4ZYD A;  3IRR A;  4UUV A;  2OBP A;  4U0V A;  2AS5 F;  4JQF A;  2L4A A;  1IZ1 A;  3FXQ A;  1BJA A;  4AWX B;  1XGN A;  3L2C A;  3F8B A;  4R1H A;  4L9J A;  4Q5S F;  2M8E A;  2A5Y B;  3ML6 A;  1O57 A;  4G8X A;  4M9X A;  1J9I A;  2GQQ A;  4Z2Y A;  3PQK A;  2A68 F;  1GVJ A;  3ZMZ A;  3BY6 A;  3LQR A;  4RAY A;  3TQN A;  2PQ8 A;  3BP8 A;  3KP3 A;  1P4A A;  4YIF A;  1XMK A;  1T6S A;  4A12 A;  4MNU A;  3D5L A;  3LST A;  3WGI A;  4P9U A;  4RGU A;  3L9F A;  2VOD A;  2AXL A;  3LA2 A;  1FT9 A;  3Q5F A;  5BMZ A;  1TNS A;  1X3U A;  1B6A A;  4BYY A;  2H27 A;  1SD6 A;  2IA1 A;  1R5G A;  3U1D A;  2EFO A;  1LEA A;  4A0Z A;  1KU9 A;  3DV8 A;  4IHS A;  2JRT A;  4U88 A;  1Y0U A;  3HOS A;  2HKX A;  2E7W A;  1FLI A;  2W85 A;  3HHG A;  2Q2E A;  2V6C A;  2STW A;  6PAX A;  3PQJ A;  4AIK A;  3ABU A;  3FMQ A;  2H09 A;  5CJ9 A;  3KZZ A;  3R0J A;  2ZBK A;  3OOP A;  2KIU A;  3DEU A;  4M73 A;  4OIP F;  2FBI A;  4L0Z B;  3ISP A;  1IXC A;  2EA4 A;  4NHJ A;  2ZO4 A;  4I0B A;  4YFX F;  2XAF A;  2GXB A;  2UXX A;  1W5S A;  5TRD A;  5J6X A;  4OOI A;  4IHT A;  1F4K A;  2VT2 A;  2EFN A;  3I59 B;  2UWM A;  4CDG A;  5L3F A;  4DQ2 A;  4Y17 A;  1UFM A;  2OU2 A;  2L01 A;  2QQ9 A;  4L9N A;  1F5T A;  5DYM A;  5FGM A;  2VC0 A;  1S8N A;  1KA8 A;  1XSV A;  4G7O F;  3CUQ C;  4HF0 A;  3MQ0 A;  3ZN0 A;  2DLL A;  4ENM A;  2DW4 A;  1SFU A;  2WWY A;  1SD4 A;  1B9M A;  4KFC A;  1SFE A;  2VXZ A;  4P55 A;  1R58 A;  2MC3 A;  1LJ9 A;  3KP5 A;  1U78 A;  5FLX K;  4F7Z A;  2Z33 A;  4UV9 A;  5DCM A;  3ZMV A;  2FQ3 A;  5BPD A;  5E1W A;  1LB2 A;  3FM3 A;  4BHP A;  3MAJ A;  1KU3 A;  1L0O C;  3MFK A;  4I7H A;  2GZW A;  2A6H F;  4I2O A;  4LK1 F;  2IA0 A;  4U0W A;  2P7C B;  1PP7 U;  4P96 A;  4S04 A;  2DPU A;  2DAO A;  2V79 A;  2FNP A;  3P7N A;  4U7B A;  4WXH A;  3EYI A;  2FXA A;  1BIA A;  2OAZ A;  1FYL A;  1FYK A;  4Q47 A;  1FBS A;  3JAM K;  4KUM A;  2VN2 A;  5ILU A;  2Z9O A;  3E5Q A;  5LGT A;  1SMT A;  3K69 A;  4OIN F;  1QZZ A;  2QWW A;  4KIB A;  4EM1 A;  5JVT A;  1GXQ A;  3EUH A;  2XVC A;  3KP2 A;  5LBQ A;  1FP2 A;  5LHG A;  4O3M A;  4G6D A;  2PBI A;  3EYY A;  3F3X A;  1BC8 C;  3MZY A;  3GW2 A;  2FOK A;  1W5T A;  2RKH A;  1HSJ A;  2ESH A;  3VOE A;  2COM A;  3IRQ A;  5A2Q K;  2FBK A;  2TDX A;  1J75 A;  1BOA A;  2EFW A;  1FPQ A;  5H6R A;  2XIG A;  1J2X A;  3WGH A;  3IKT A;  2LF7 A;  3V7S A;  4KA4 A;  3M1E A;  2XGX A;  1ZGA A;  1IUY A;  3V8K A;  4UVB A;  3F6O A;  3KFW X;  3KP7 A;  1PP8 F;  2F5F A;  1QBJ A;  1P6R A;  2GA1 A;  4P9F A;  3LA7 A;  1RIO H;  4M74 A;  4HDU A;  1T38 A;  5DV5 A;  1WWX A;  3GZ5 A;  4CHU A;  3E5U A;  1H9T A;  2C6Y A;  4HA8 A;  3Q9V A;  2VON A;  3IC7 A;  3RPQ A; 
#chains in the Genus database with same CATH topology
 1T39 A;  2MD5 A;  1G59 A;  2IT0 A;  2LH9 A;  3R4K A;  4IF4 A;  3M9A A;  3E0J B;  3H5N A;  3O2P E;  4W97 A;  1ZG5 A;  1JT6 A;  1YIO A;  3A0B C;  3I53 A;  3TGN A;  5EDN A;  3J80 Z;  4KDP A;  4LG0 B;  3TED A;  4DOZ A;  3ERE D;  3DXJ F;  3TP0 A;  1ETY A;  2X9D A;  2D1V A;  3I54 A;  3CTA A;  2O6G E;  4ETS A;  1HF0 A;  2L5Q A;  3I3L A;  3V8L A;  1T33 A;  2EIK H;  3DP7 A;  4DW6 A;  3J80 K;  2CV2 A;  5F08 A;  2A07 F;  2JVG A;  4EM0 B;  4UVA A;  2NVT J;  2CQQ A;  2XHK A;  4IO9 F;  3HKZ A;  4R79 A;  2EA2 A;  2HWV A;  5DM7 F;  3KCC A;  1T8I A;  3BTL A;  1D8J A;  1BR1 A;  4MGR A;  1YJ9 I;  1EF4 A;  5HLG A;  1SFO J;  5F64 A;  2LKP A;  4GDF A;  2FML A;  5FRM A;  3LSK A;  3GXO A;  1KGS A;  5KVR A;  3BWG A;  1BN5 A;  1I27 A;  3L2V A;  3HRT A;  4XN3 A;  1TQP A;  1V5G A;  1Z3Y A;  1TZL A;  3RKQ A;  1GT0 C;  1YE9 A;  5DCM B;  2CSO A;  1BBY A;  1H88 C;  1OMI A;  2FU4 A;  4C2M J;  3S14 J;  4DYR A;  1GDT A;  3RSN A;  2YU3 A;  5J47 A;  2FEZ A;  4XID A;  5J3L A;  4BNC A;  3SZP A;  3ULQ B;  4A3D J;  4OIO F;  5J1R A;  2L9V A;  1R49 A;  4B09 A;  1LDJ A;  1U2W A;  2H1L A;  3FK6 A;  4II2 A;  4CZZ A;  1FNN A;  1O7F A;  1ZK8 A;  2KIS A;  4HLX A;  3CCS I;  2DQL A;  1WKM A;  4EJW A;  1RNL A;  3BJ6 A;  4BGD A;  3ERM A;  5ICG A;  5DEQ A;  2XAQ A;  4RLF A;  2Y69 H;  3ABT A;  2CQK A;  4OIR F;  2K9S A;  4Y3O A;  4ENN A;  3I55 I;  5L3D A;  1X3W B;  4O5V A;  5K7F A;  2EZL A;  2XSJ C;  4ZYE A;  2LRD A;  1UMQ A;  3Q9S A;  1ERD A;  1P4X A;  1JJ8 C;  3PNT A;  4A3F J;  4N9I A;  1WJC A;  2D2W A;  3ZOB A;  4FX0 A;  2AQE A;  1QU3 A;  3D0S A;  1XCV A;  2A5W A;  4LD5 A;  4D9J A;  1T98 A;  3QPH A;  1XG1 A;  1TL8 A;  2VJI A;  1PDN C;  2DYR H;  4LLG F;  1TT5 B;  2CS3 A;  2NRA C;  2MH9 A;  2R7F A;  2RQP A;  1MBH A;  1BW6 A;  1ULY A;  1BOB A;  4ZJZ A;  4CCL A;  2H6B A;  2K27 A;  3GF2 A;  1Z3X A;  2DXI A;  4IOA F;  1W0T A;  2VI6 A;  2KRF A;  4MQV A;  2V4J C;  2XF6 A;  1D5V A;  3OL3 A;  3BJO A;  1S3J A;  2FRH A;  1N75 A;  2HZT A;  4B3A A;  3ESW B;  4EJU A;  1IJW C;  2GXG A;  1ODD A;  5AIQ A;  3KP6 A;  3CC4 I;  2VIX A;  4IQJ A;  4AVZ A;  1B4A A;  3K1P A;  1LKX A;  4ZZL A;  2BYV E;  1F1Z A;  1OJL A;  2P5V A;  4RS8 A;  2Q8K A;  3E6D A;  2G7U A;  3BRO A;  5GAH J;  3ASO H;  2HKO A;  4DNC A;  3W3C A;  3S2D J;  2HTJ A;  5CYV A;  9ANT A;  3GFI A;  4ZZD A;  2BV6 A;  3LFK A;  4LJZ F;  1GV2 A;  2M4G A;  4PJM A;  5B66 C;  4DBQ A;  1MBK A;  4OMY A;  3NRV A;  4WCG A;  3CCL I;  1K4S A;  3I59 A;  4A6D A;  1D1C A;  3HYI A;  3TDU C;  1T2K A;  3S3O A;  4XLC A;  2JWT A;  2CWE A;  3RKW A;  3EET A;  2IS2 A;  1YQA A;  3MD2 A;  3BPV A;  3EDP A;  1JTY A;  1G3Y A;  3W2A A;  4J19 A;  1G3T A;  2ELK A;  2MGQ A;  2HQA A;  3GBG A;  3GLL A;  2W1O A;  3H35 A;  4L9V A;  3WU0 A;  1ZTR A;  5D5W B;  1RKW A;  1MMD A;  1LVK A;  3TOA A;  4UVC A;  2JA8 J;  2EZK A;  3RKY A;  5L3E A;  4RB1 A;  4A3G J;  2CYY A;  2JK3 A;  3A01 A;  2Y9Y A;  2E1M C;  1MBE A;  1MGT A;  2HXI A;  2O0Y A;  3WOD F;  5BPI A;  2RRE A;  4Y15 A;  4RAG A;  3CCV I;  4C9Y A;  1JE8 A;  1J7K A;  2FF4 A;  1FEX A;  4FT8 A;  4BXU A;  1NHA A;  2FMY A;  3RIR A;  4NUB A;  2XRO A;  4PUS A;  1BC7 C;  3WU1 B;  2CFO A;  1JT0 A;  1VQ7 I;  2J5O A;  4U7D A;  2BY2 A;  2MH2 A;  4EV0 A;  2RVC A;  5KK1 A;  5HDG A;  1FBQ A;  5DD4 A;  1MKM A;  4LFU A;  3VYU B;  3RQI A;  2NVQ J;  4KN4 X;  3BCB A;  4BU2 A;  3PO2 J;  2L02 A;  3ZRG A;  4BJ5 C;  3IWZ A;  2LDU A;  2OJE D;  3HB9 A;  1F43 A;  4LG0 A;  1OPC A;  3SDB A;  5LRS A;  1MBF A;  2VPR A;  4XBF A;  3AKZ A;  1FX7 A;  1Z21 A;  2HOE A;  4L9T A;  1TWG J;  2DMU A;  4HF2 A;  4FAS D;  2KJC A;  2NOJ B;  4IJA A;  4PSW A;  1RET A;  2YX4 A;  1J59 A;  3FHN A;  5DM6 F;  5BQT A;  2PLY A;  1P2F A;  3KEO A;  4LB5 A;  1P4W A;  1EH7 A;  2O5R A;  1NH3 A;  3BG6 A;  1I3Q J;  3G3Z A;  1OYI A;  1R00 A;  2CUF A;  3SZG A;  3COA C;  3E6B A;  2ELH A;  2R7Z J;  4UV8 A;  3FKI J;  1ZG3 A;  2NVU B;  3KET A;  2HEO A;  1WI3 A;  2F4I A;  2O7O A;  3BR0 A;  3PUB A;  4D7N A;  2H8R A;  2ZXI A;  1XDS A;  5EJC A;  3BT9 A;  3M3Y J;  1YW8 A;  3FXL A;  1U9O A;  1Z91 A;  3A1Y A;  2M87 A;  3SZT A;  3B6C A;  1YX3 A;  4O6J A;  3DPT A;  5FKN A;  2VQC A;  1R71 A;  4AYB N;  4BE1 A;  2LTP A;  2F6C A;  4NC7 A;  3KIO A;  2ZB9 A;  3TOB A;  1DPU A;  4BXX J;  2W57 A;  4HYE A;  5AIP A;  3IAM 2;  1G8X A;  2LNB A;  2HGC A;  4I98 B;  3ROU A;  1R7J A;  5HLI A;  2MLG A;  3L2R A;  3VYT B;  3L2U A;  4EGY A;  1IG7 A;  1DGR M;  4LG3 A;  4ZTJ A;  2CO5 A;  3J81 Z;  3JRD A;  3IKV A;  2CW7 A;  5HLT A;  1ZRC A;  1P9Q C;  3HOZ J;  2LK2 A;  3JRH A;  3U1K A;  1EH6 A;  4JX6 A;  4G7H F;  1K6O A;  4UB8 C;  4E7K A;  3JTG A;  3GZN B;  4RM2 A;  1U0J A;  3J81 K;  4GYG A;  3CDI A;  4BKX A;  4J00 A;  4RDU A;  1X1A A;  3P5J A;  1P7J A;  3I58 A;  4A5N A;  3HTS B;  3KYD B;  4CYD A;  2ZJP F;  1MZB A;  4JP0 A;  3V4G A;  3FX3 A;  2DPD A;  1K6Y A;  2ZJR F;  1V4R A;  4A3I J;  2L9R A;  3T0Y A;  2OQR A;  1CGP A;  1BL0 A;  4N9H A;  2FBH A;  2M3A A;  1UZC A;  3C1D A;  3LMM A;  1VZ0 A;  4E7L A;  3SQN A;  1SEU A;  3RDI A;  1U3E M;  2W00 A;  2FUG 2;  3CQZ J;  2IPQ X;  3MZH A;  4ESJ A;  3C7J A;  2CUZ A;  4M72 A;  4A6E A;  4KN7 X;  5FKO A;  4IVN A;  4G9Y A;  1FWZ A;  2DOF A;  2LY1 A;  3BZK A;  2IP2 A;  4GCV A;  3K2Z A;  4Y52 J;  2RC4 A;  3VYR B;  2O3F A;  1TW3 A;  4XSZ F;  3TL4 X;  3S93 A;  5FLV A;  2R7Q A;  1KQ0 A;  3CES A;  2EIL H;  4WXC A;  5CLS A;  3JSO A;  2KHM A;  2PG4 A;  1GHC A;  2VT3 A;  2ICW G;  5K5R A;  1AU7 A;  1UG2 A;  4UB6 C;  4ZYA A;  3I9V 2;  1X2N A;  1VQ6 I;  3WTX C;  5E18 F;  1R4M B;  1W7P D;  4XLN F;  2ISZ A;  2IS6 A;  3L2W A;  5GAD J;  3S2H J;  2WAD A;  3GFL A;  4BAC A;  5FRN A;  2BHZ A;  1Y8Q B;  4KIC A;  4V2F A;  1DU0 A;  2BBY A;  4QSH A;  2P6S A;  4XRF A;  2DK5 A;  5E8I A;  2X1C A;  3HUG A;  3CCE I;  2XF5 A;  1UAA A;  3RPU A;  5ICC A;  2K7L A;  5FO5 A;  3F0C A;  4IXA A;  1UHW A;  4M6V A;  3LSJ A;  5D8L B;  3F22 A;  4KNY A;  1FOK A;  2FD5 A;  4C2T A;  1FMV A;  1IN7 A;  1ZLJ A;  2LBF A;  2L7M P;  2I5U A;  2RNG A;  4M9S A;  4A69 C;  3QP5 A;  3OYM A;  2ME6 A;  4AC0 A;  2QQ8 A;  1VQL I;  2NS0 A;  3JW4 A;  3TO6 A;  3BZ6 A;  1YX5 A;  4AUX A;  3D5R C;  2BW3 B;  2Y30 A;  3PFI A;  2YR2 A;  3OWT A;  2CQX A;  2P5L C;  4P5O A;  1Z6T A;  2CH0 A;  4M6Y A;  4ENK A;  1HW1 A;  2DMN A;  5JVG F;  4IL6 C;  2DQR A;  4HX7 A;  3JSP A;  4B3X A;  2PFB A;  2M1B A;  4BHB A;  3C18 A;  3GME A;  3WG9 A;  5L3G A;  1XC5 A;  1VI0 A;  2UXN A;  2KIF A;  4BQQ A;  1POG A;  3BR6 A;  1CQT A;  1FZP B;  3HL2 A;  5IT9 K;  1ZHF A;  3DTE A;  3FK7 A;  5KHD A;  5B1A H;  2NNY A;  3VB2 A;  1O3T A;  2XPW A;  5J4V A;  3DPU A;  2E1N A;  5DD8 A;  2VKH A;  4HX4 A;  1X2M A;  4NQW A;  3ZPL A;  1SFX A;  3RZD J;  3HM5 A;  4RMN A;  4A3J J;  1Y8R B;  1TWH J;  2DK8 A;  1IGN A;  4R8H A;  1KON A;  3CMA I;  2CW0 F;  4NC8 A;  3GFM A;  5F0C A;  3HSE A;  4IRG A;  2FE3 A;  1U5T B;  4XRS A;  1ITY A;  2H8W A;  4PZJ A;  2EIN H;  4I09 A;  2Z3Y A;  1GUU A;  1IRX A;  4B1R A;  2R7T A;  4UY8 I;  1TQM A;  4PDK A;  5LLQ A;  1R1U A;  2NYX A;  3M8F A;  2HOA A;  3HIF A;  3MKL A;  2STT A;  3O8G A;  3U9G A;  2NVX J;  2IVM A;  3OIQ A;  4X1E A;  4LMY A;  3H0D A;  1I39 A;  2R4G A;  2M30 A;  2RN7 A;  3WE3 A;  1PUF A;  2VPL A;  3T8T A;  3PM1 A;  3AL0 B;  2Q0O A;  3WTS C;  1K61 A;  1APL C;  4QIW N;  2XV4 S;  4KT6 A;  5EG0 B;  3P9C A;  3BOQ A;  5F04 A;  1WJE A;  1ZAR A;  3E1S A;  3JCU C;  2O8K A;  1WJD A;  4EQQ A;  1WHU A;  4Z6Y A;  5FKL A;  1AA7 A;  3HPG A;  4DIQ A;  4FX4 A;  2ADU A;  1ENH A;  3OL4 A;  3KZI C;  4ZDO A;  3H9J A;  4EM2 A;  1W0U A;  4HNV A;  3R0A A;  3OY9 A;  2WC2 A;  5E1Z B;  1IN4 A;  3BTI A;  5D4R A;  1JKP C;  3R6S A;  3CDH A;  4BBR J;  4B44 A;  4EJT A;  1BJZ A;  2VOO A;  4ZYH A;  3ZQI A;  2F5D A;  3CCJ I;  3JRA A;  4A3E J;  1E3O C;  3NWT A;  1K7A A;  1FSE A;  4PFP A;  1Y56 A;  4XKV A;  2UZK A;  5C44 J;  1YO5 C;  2LR8 A;  3F72 A;  3S3N A;  2HDW A;  1PYV A;  2L2O A;  4FET A;  4QLC U;  2ID6 A;  3CUQ A;  4BAY A;  2PN6 A;  3CP2 A;  2AXT C;  5LRR A;  1R5I D;  1D8K A;  3GTK J;  1X3Z B;  2JA2 A;  3K0L A;  3HOW J;  3C3W A;  3HXL A;  3IH2 A;  1MNM C;  2LSO A;  3TDZ C;  3AAF A;  5CVV A;  1QA6 A;  5CQE A;  3VEP A;  4XSX F;  4BXF A;  1HDD C;  4IHW A;  2EK5 A;  5E17 F;  3WHB A;  5ICE A;  5CVI A;  3I4M J;  2RDP A;  2VQH A;  2OQG A;  3JTH A;  2ECB A;  4PFO A;  5JR3 A;  2YPR A;  2DA1 A;  4HV6 A;  1YHQ I;  2PJR B;  3ZR8 X;  2DT6 A;  2XPV A;  2X6X A;  3FDY A;  2A69 F;  3I0T A;  3WTZ A;  1T0F A;  2DA7 A;  2FNA A;  3A02 A;  1HDP A;  3GTQ J;  2KZV A;  4M71 A;  3DQV C;  1TW2 A;  1B8I B;  2ZCW A;  2OZ6 A;  1R36 A;  4CZC A;  5ICF A;  1HA8 A;  5H20 A;  1ETO A;  2DT5 A;  4NDL A;  3MKW B;  4AVP A;  3IHU A;  2CUE A;  4PJN A;  3GYH X;  3L00 A;  1ORK A;  1BIB A;  2GOM A;  5D4S A;  3K10 A;  3ONQ A;  1IAW A;  2RAE A;  5JI6 A;  3KLN A;  4W1U A;  3ZQG A;  2QVO A;  5GAG J;  1O3R A;  2VKV A;  4BBS J;  3RPU D;  4YEL A;  3K4N A;  1YG2 A;  1WJ5 A;  3FHZ A;  1BI1 A;  3WTU C;  1TWC J;  2QA4 I;  3LOC A;  5CVJ A;  1B9N A;  3GEZ A;  1R1V A;  1RZ4 A;  1NG6 A;  2HXO A;  1A6I A;  3B73 A;  1TNT A;  4BEH A;  1LEB A;  3IH3 A;  2O61 A;  1JI8 A;  3OYN A;  2R5Y A;  2PMU A;  1RES A;  1WJB A;  3ZN1 A;  3HRS A;  3K2A A;  3CMY A;  1WH7 A;  5JLX A;  3MCZ A;  1A04 A;  3NWS A;  3KEQ A;  4DYQ A;  3IL2 A;  3FM5 A;  2WTE A;  5GPA A;  2EQR A;  2V7F A;  3M7G A;  4BQA A;  3MKZ A;  3N4M A;  2EFQ A;  4RM3 A;  1I5Z A;  2HVR A;  2MW8 A;  3L2Q A;  2EFP A;  1U8B A;  5FFZ A;  1OFC X;  1WPK A;  3CCY A;  3E3V A;  5D6E A;  3OYF A;  2QBY A;  1QVT A;  2JUG A;  1WH5 A;  4HST A;  3QPT A;  4BQO A;  3HEF A;  3KZY A;  4A3B J;  4H0E A;  2HR3 A;  1JUM A;  2M5W A;  3CJQ B;  5FD6 A;  4GGG A;  5E3M A;  1X1D A;  2DA5 A;  3H92 A;  2QEX I;  2E1C A;  1SFK A;  1H89 C;  2M4K A;  2EZH A;  1MJ9 A;  2OTL I;  4XMY A;  1KU7 A;  2XKP A;  4E7H A;  3H3V K;  3ECO A;  1S29 A;  3IP4 B;  2CV1 A;  4JX4 A;  3LSP A;  1XMA A;  1DPR A;  4C3I J;  4XLF A;  2HQN A;  1FYM A;  4A3L J;  3M1C A;  3PNV A;  3RCO A;  4CCJ A;  2HQ5 A;  4G6Q A;  1ZRE A;  4EMS A;  4IPA A;  3BTC A;  3P9I A;  2YX7 A;  2XB5 A;  2KIM A;  1YS7 A;  3FF5 A;  2R7V A;  4I02 A;  2XSD C;  2EZI A;  4E7Z A;  5IP7 J;  4JBA A;  2ZXH A;  1VQ5 I;  2BY0 A;  2GAU A;  5CVR A;  3QU3 A;  2QF7 A;  1MJB A;  2V6E A;  4LK0 F;  4GRI A;  1HQC A;  2CU7 A;  4QTR A;  2VJ4 A;  3M4O J;  5ERI A;  1JJ6 C;  1WVR A;  2JPC A;  4N4O B;  1ZN2 A;  3H5A A;  2JSC A;  4A0Y A;  3SXY A;  3G4S I;  4PJJ A;  3WGG A;  1MDM B;  4RLQ A;  1EJ9 A;  4JK1 X;  3ZMT A;  1HW5 A;  5K1Y A;  3FMS A;  2KT0 A;  1KYZ A;  2CUJ A;  3RKX A;  2ME0 A;  1OQY A;  2BY1 A;  2LP0 A;  3N05 A;  4Q48 A;  4WWC A;  5BNG A;  1XSD A;  4IHX A;  2ELJ A;  5A2Q Z;  2QSH X;  2LC2 A;  2O03 A;  2X6W A;  2HTS A;  4ZC3 A;  3HSR A;  4CGZ A;  2R7S A;  1DP3 A;  2V1D A;  4BUP A;  4LIU A;  3IWF A;  4B43 A;  5FFX A;  1DQU A;  4RAZ A;  3QU6 A;  1LDD A;  4ZH4 F;  3M8J A;  5ILS A;  2QLZ A;  1JUP A;  4FCY A;  3JRG A;  5E8G A;  2AQF A;  4F91 B;  1QZY A;  2BVM A;  1MMS A;  2WV1 A;  2OTJ I;  1O3S A;  2GBY A;  3RJP A;  3OR2 C;  2WAF A;  1FP1 D;  1Q1H A;  3BDD A;  3RYP A;  5HS7 A;  3I5U A;  5L3C A;  1IRZ A;  1GXP A;  2BVL A;  1RRJ A;  1FJL A;  3OYL A;  3WTV C;  2ZKZ A;  1BM9 A;  1IW7 F;  2LOO A;  4NC6 A;  4XLP F;  2F4M B;  2GXA A;  1LNW A;  1XB4 A;  3VSK A;  4QPQ A;  1TWF J;  3QP6 A;  1WQ2 A;  3OOU A;  5E3O A;  2I10 A;  4QWQ A;  5K5O A;  2VQG A;  2XDV A;  2VBX A;  4ON0 A;  1FMW A;  1RUO A;  3I4N J;  2VOP A;  2FSW A;  1IXR C;  2K4J A;  2RGV A;  4EJO A;  2MFZ A;  1W7P A;  3QQA A;  5HOO A;  3PIO F;  5KCM A;  3FZV A;  3G1L A;  4KMU X;  2CJJ A;  3CD6 I;  1XTA A;  1R5H A;  4N4N B;  3DBH B;  3J7Y J;  1CF7 B;  2IBD A;  1YOV B;  3HZJ A;  2F5E A;  1HCR A;  1FTT A;  3F6V A;  4HZF A;  2ZME C;  1XMX A;  1S72 I;  4F92 B;  1O7L A;  3NEU A;  4D0P A;  3WTY C;  3PSF A;  2P4W A;  2ZXJ A;  4XOR A;  3DKX A;  1QZE A;  3D1N I;  1DU6 A;  3EUH C;  3LSH A;  4MEX F;  3HRU A;  2M2E A;  3K4J A;  4UNO A;  2Z2S B;  3QWL A;  1HXD A;  4M6X A;  4RB2 C;  5EEG A;  2E19 A;  3KYL A;  4JOM A;  3F21 A;  3KLO A;  3A2K A;  1XCB A;  3DEW A;  2DA2 A;  2TRT A;  2XGE A;  1ZGJ A;  1A6Q A;  1VQ4 I;  2VJJ A;  1DP7 P;  1E17 A;  4WF2 A;  2IA2 A;  2ISY A;  2ZNZ A;  3CO6 C;  4Q4Z F;  1Z67 A;  2K5C A;  2L54 A;  3QOP A;  4S05 A;  3G1M A;  1UJ8 A;  4EEF G;  4MFD A;  1XDU A;  2KRH A;  4LIT A;  2X0L A;  1E3H A;  3BPX A;  4HW0 A;  1V5E A;  4CYC B;  1Z9C A;  1YFH A;  4YFK F;  4I6Z A;  1VQO I;  1NK2 P;  2K9M A;  3BCA A;  3I56 I;  2DOE A;  4OAY A;  3A03 A;  4K2E A;  5HDN A;  4RGX A;  4M3G A;  4P1W A;  5F1J A;  2H94 A;  3ZMS A;  4C3J J;  3ZQ7 A;  3G73 A;  1A35 A;  2CG4 A;  3LSM A;  3HTU A;  4V19 K;  2XB0 X;  1IC8 A;  5D5X B;  5CQG A;  3ELK A;  2X51 A;  3FXR A;  2DMQ A;  4F3Q A;  2FX0 A;  1X1P A;  2Z16 A;  1HLV A;  4KIF A;  1UCR A;  4PJL A;  3M07 A;  3BR5 A;  2TCT A;  4A0X A;  1X4O A;  4QPO A;  5JHU A;  2ZME A;  1J0R A;  1FIA A;  1MD0 A;  3AG1 H;  4PJ0 C;  3F8N A;  4NNJ A;  2W25 A;  3OV8 A;  4AYB A;  4D1Q A;  2P7V B;  2RQQ A;  2P5K A;  3OYG A;  2QEN A;  1XN7 A;  5DDG A;  1S7A A;  2ZFU A;  5HLH A;  4ESF A;  3F23 A;  5LGN A;  1WZ2 A;  4LLN A;  4AIJ A;  4OMZ A;  2JRM A;  4GYI A;  5EG0 A;  1OCR H;  1USS A;  2E2I J;  1OCT C;  1ZLK A;  2A05 A;  3HC7 A;  2K3F A;  2F5V A;  2XAG A;  3KPH A;  1QPI A;  2HYG D;  4BDZ A;  5HNF A;  3JRC A;  4B47 A;  2B9S A;  3T8R A;  2BXY A;  2V1N A;  5TIS C;  3CLO A;  2ID3 A;  2K9L A;  4U87 A;  4XKB A;  4BE2 A;  3VPR A;  1Y0N A;  3WTW C;  4PGH A;  2DDB A;  2DDA A;  2ZXW H;  2Q1Z B;  2IS4 A;  3S3M A;  1HC8 A;  3NQO A;  4HQM A;  2HYJ A;  2DTR A;  3E6M A;  1ETQ A;  2M9H A;  3CCQ I;  4L5J A;  1VTN C;  5HDK A;  2QKM B;  1ON2 A;  1XGO A;  1LDK B;  3LNQ A;  3PUF A;  3W6J B;  4HDV A;  1N77 A;  4L5I A;  3HG9 A;  2X48 A;  2BXZ A;  3QYF A;  2M0C A;  4I01 A;  3LA3 A;  4OWR B;  1ONV A;  2VAS A;  2KJB A;  3EPZ A;  4LIV A;  5LHI A;  3OYI A;  4JX5 A;  1YIJ I;  3EUK L;  1X1C A;  3F8F A;  3HSF A;  2PMH A;  2R7D A;  1SVL A;  4YG2 F;  2Z99 A;  3SDG A;  1EKE A;  2EV0 A;  2QYO A;  5ED4 A;  1AWC A;  3EQL F;  3MEX A;  3FMR A;  4MLO A;  3CZ6 A;  3DCF A;  2HDC A;  2GM4 A;  3T1B A;  4EVI A;  2V1X A;  1JGS A;  3ECH A;  4E7S A;  2PMZ A;  4C2U A;  1U6G A;  3ZP5 A;  2L0K A;  4G94 A;  2K4B A;  1H8A C;  2WBM A;  3PO3 J;  1I6X A;  3O6B B;  1FOW A;  1Z77 A;  2R0Q C;  1SVO A;  1JTX A;  1ZAO A;  2CQN A;  1QQI A;  2D1H A;  5EZG A;  4HNU A;  4IHV A;  5LGU A;  1OR7 A;  1ZGW A;  3CME I;  3L09 A;  3VWB A;  2WY8 Q;  1F9N A;  5IT3 A;  1HST A;  4BY7 J;  2R7R A;  4G12 A;  1ZG1 A;  3FBI B;  4DGW B;  2M45 A;  2OZU A;  2L9S A;  5F1R A;  4E7I A;  4I99 C;  2G9W A;  2PI0 A;  3FXO A;  2Y0S A;  4CCM A;  3JAM Z;  3RTR A;  1EH8 A;  5FRO A;  4IKF A;  3CMM A;  1T08 B;  2ZFW A;  4G7Z F;  4A93 J;  2XGC A;  4CO8 A;  5FLM J;  1CF7 A;  4HBL A;  4UHT A;  4BEH B;  1UB9 A;  1I50 J;  3TP3 A;  3ZCO A;  2M7B A;  2WB1 A;  4XR6 A;  4GO1 A;  5LEK A;  1IDY A;  3I4P A;  5DUI A;  2K85 A;  5EEH A;  2DBB A;  2FA5 A;  4CXF A;  4LGW A;  2B0L A;  4PGG A;  5B1B H;  2E2J J;  4RAF A;  4F52 A;  5BS6 A;  1P92 A;  1IRG A;  4A5M A;  2AHQ A;  3LSI A;  4BQN A;  1S6L A;  3V42 A;  1L3L A;  4IHY A;  3B02 A;  3SHF A;  4ZDP A;  1XX5 A;  4L5E A;  2XC7 A;  5EF6 A;  3MVP A;  5ILV A;  1LFU P;  2XRN A;  3S2W A;  1JGG A;  1KU2 A;  1FY7 A;  2X1E A;  3IH4 A;  2R3S A;  3HBL A;  3VFZ A;  1D1A A;  3O3K A;  3S1Q J;  1ETX A;  2MA3 A;  2E71 A;  2KFD A;  3U2R A;  4ENJ A;  3CLQ A;  4WX9 A;  1EV7 A;  1VF9 A;  5E1X A;  3A01 B;  4JYK A;  3SFI A;  4BHC A;  1I3A A;  2QQA A;  3K4B A;  2O8X A;  1MSF C;  5LFA A;  3HGY A;  2A3S A;  3TW6 A;  1ZRD A;  2KLO A;  3LAP A;  3MWM A;  1YTY A;  2B7E A;  4E7J A;  1ZRF A;  3ZQQ A;  2OPT A;  2QUF A;  3V7C A;  4CA0 A;  5DCF A;  2P0W A;  2W84 A;  1QVU A;  1RKT A;  2YS9 A;  4J01 A;  1RR8 C;  1XPX A;  2ESN A;  3PL8 A;  1MND A;  1QPM A;  2DU9 A;  2M7A A;  1SC7 A;  1D0Z A;  1ZH5 A;  2VE9 A;  2IJL A;  2Y0M A;  2JTV A;  4XON A;  3E6C C;  2F2E A;  2JA6 J;  1I1S A;  1ZYR F;  5J1U A;  4AIH A;  4KIT B;  4XKW A;  1HKS A;  5K7Z A;  4CCO A;  2D45 A;  1WI9 A;  1TP4 A;  4M9Z A;  5EGO A;  5HS9 A;  2H1K A;  4E70 A;  3QPL A;  4IRI A;  2GIV A;  2EWN A;  1UHS A;  1VQK I;  1UHM A;  1MJA A;  3R60 A;  3QAH A;  4IEJ A;  3OIP A;  4NBQ A;  4RB3 C;  4M3B A;  2B63 J;  1JKO C;  3ZQL A;  2GLO A;  3DBR B;  1LFB A;  3QYB A;  5LEJ A;  1SD5 A;  2L7F P;  1MDM A;  4OIQ F;  1WSU A;  2VUM J;  4OU0 A;  3Q0U A;  4XLH A;  4HRI A;  2QKL B;  1K78 B;  2JJ7 A;  3C2G A;  4AD9 A;  3F8M A;  4HQE A;  2BE5 F;  1IF1 A;  2QGU A;  3KX2 A;  4KJZ A;  1YLF A;  2Y0S N;  4GXO A;  3GTJ J;  1HW2 A;  3I64 A;  4MHG A;  4NB5 A;  1YS6 A;  2MC4 A;  2XAH A;  3FXU A;  3CJT B;  1G4D A;  2HVS A;  1B1B A;  4XIC A;  2KKO A;  3BQZ A;  2RV8 A;  1JHH A;  5D5U B;  1XD7 A;  4Y7N J;  3ZXS A;  1OYW A;  2W24 A;  5GTH C;  2QM3 A;  4MEY F;  3HRM A;  2OV7 A;  5LD2 C;  5H6Q A;  4MTE A;  3K1M A;  3ZMU A;  3AG4 H;  2HS5 A;  2WAQ A;  5B5E C;  1I1G A;  2L7Z A;  5J8F A;  5E20 A;  1D1B A;  2XF7 A;  3K4M A;  1SD7 A;  3TO9 A;  1O3Q A;  1SAU A;  3LFU A;  1YW9 A;  1MNE A;  2HZD A;  1DUX C;  2F5C A;  1U5T A;  3DTI A;  3GTP J;  2YSR A;  4HAM A;  2PJP A;  3MMY B;  4EJV A;  1LUJ B;  3BLY A;  4XOT A;  5IYB J;  3N97 A;  4HG2 A;  4FTH A;  4YII A;  3SEQ A;  1ZR4 A;  2DOD A;  2V1U A;  1W7P B;  5M5Y J;  2KZG A;  3LWF A;  2BGC A;  2IW5 A;  3SJM A;  4CUG A;  1YYV A;  4MTD A;  1K83 J;  2MAB A;  2L7K A;  2Y9Z A;  2R93 J;  3PFY A;  1PUF B;  1OKR A;  2R7U A;  2L4M A;  4A3C J;  2DYS H;  5J8C A;  4D7M A;  3TBI A;  3J7A O;  4XRM A;  1XSX A;  3P9K A;  5D5V B;  4IQ4 A;  1D0X A;  4ITV A;  3F8C A;  1FC3 A;  1X4P A;  4KIG A;  5JLW A;  2JZY A;  5IT9 Z;  2ZJ2 A;  1IUF A;  2MG4 A;  4HV5 A;  2BOL A;  2DA3 A;  1OYY A;  2GWR A;  1Z1D A;  2X6O A;  2IXS A;  2K86 A;  2LFB A;  2HDD A;  2E34 A;  2EV6 A;  3DKW A;  3RYR A;  3U21 A;  5C4X J;  2ECC A;  1PUE E;  3E97 A;  4XRS G;  3R61 A;  5M5W J;  1WRJ A;  2HNH A;  4EGZ A;  1JHF A;  2NAZ A;  2YU9 J;  2MD0 A;  1D5Y A;  1XGM A;  2P6T A;  3H9G A;  1IO2 A;  2M0M A;  1OIS A;  4YFN F;  4A2U A;  1LQ1 A;  4MO7 A;  1LE8 B;  4HOB A;  3ASN H;  3CJN A;  1NK3 P;  1BI3 A;  3CUQ B;  2BHY A;  2VQL A;  3DFG A;  4BJT A;  2EBI A;  3K9T A;  2QZ8 A;  1MBJ A;  4HF1 A;  3GLX A;  4MIM A;  3OYB A;  1O4X A;  2XAS A;  1H0M A;  1QGP A;  1AKH A;  4IRH A;  1LFP A;  4CYC A;  3H1C A;  1IV8 A;  1PVE A;  2IGK A;  2V9K A;  4XM3 A;  5F6F A;  4IZZ A;  5DTD A;  3OYC A;  1IRF A;  2A61 A;  1RI7 A;  4II3 A;  3BG3 A;  3AL0 C;  1A5J A;  1Q1V A;  3T5X A;  2W7N A;  1ZEL A;  2EJR A;  4RB0 A;  4D5C A;  3OYK A;  1ETV A;  1HBX G;  5FLX Z;  3GFJ A;  2FJ1 A;  2CQ7 A;  4BL0 B;  1YRN A;  4CIC A;  2VL8 A;  5E3L A;  3FWE A;  2AO9 A;  1TT0 A;  2ZME B;  5FKK A;  4PK4 A;  1IN6 A;  2H6C A;  2LBF B;  3TO7 A;  3CCM I;  3GVA A;  5K5Q A;  2DFI A;  1GV5 A;  2E36 A;  2P8T A;  2JA5 J;  3QYE A;  4V2G A;  1STZ A;  3OYE A;  2VBY A;  3BTJ A;  3HPH A;  4XKC A;  1RUN A;  2MBF A;  2IEK A;  5IOY A;  2A6E F;  2LYC A;  1G6N A;  4EAT A;  5HOD A;  2JN6 A;  2F4O B;  1QHG A;  4RGS A;  3GWZ A;  4E6K G;  3NAU A;  2KL4 A;  4XNF A;  2CGP A;  2JPB A;  3L7W A;  1OCC H;  2GA2 A;  3RI4 A;  2ZNY A;  2E1M B;  3MZ8 A;  3HHH A;  3CF5 F;  2JT1 A;  3S1M J;  2VLA A;  4B4C A;  3G6E I;  2Z5U A;  2IRF G;  2BEO A;  2OD5 A;  1G3W A;  5EGO B;  3K7A J;  1Z7U A;  4XQF A;  1D3Y A;  3W6K B;  1MMG A;  3NAR A;  3REO A;  4WXD A;  5KAI C;  3QRF F;  2K9N A;  2R7W A;  2HU9 A;  2EIJ H;  3GUD A;  2HFH A;  3V8J A;  5HVQ C;  2VBW A;  4UUT A;  5KAF C;  2XAJ A;  4X6A J;  1TBX A;  1NG7 A;  5IOZ A;  2XPU A;  2HYF A;  3GZ6 A;  4U0Y A;  4ESB A;  2DJN A;  2LRE A;  5AON A;  1K79 A;  4B8X A;  3DEE A;  4BY1 J;  5BOX A;  3HOV J;  3IV5 A;  1Z0X A;  1TLH B;  2HQR A;  3WHC A;  2WV0 A;  1K78 A;  1W4M A;  2BZT A;  1KQ8 A;  2EB7 A;  3I71 A;  1V54 H;  1R1T A;  2LY2 A;  1W36 D;  1J5Y A;  1Z6R A;  1Z7L A;  2QBY B;  4L0Y B;  1JXS A;  2LD5 A;  3CUO A;  1G3S A;  4BS9 A;  5FJ8 J;  1HKQ A;  3CCR I;  1S5L C;  1ETW A;  4KMF A;  4I0A A;  3KE2 A;  4CCN A;  1XS9 A;  1ZKG A;  2EH3 A;  2Z1D A;  5TJJ A;  1KQ9 A;  3WU2 C;  2OF7 A;  5LHH A;  2L9N A;  1FSH A;  3S1N J;  4N0B A;  2X85 A;  2MYS A;  3WE2 A;  5IP9 J;  5M5X J;  5IY5 H;  1R23 A;  2CV0 A;  4WK8 F;  1YW7 A;  2LLK A;  4PCQ A;  2VBZ A;  1VQN I;  2GOX B;  2JUC A;  2MSY A;  3E5X A;  5FB2 A;  1MMN A;  4E4H A;  1Y1V J;  1C0W A;  2K02 A;  4ZYG A;  1YI2 I;  3OR1 C;  3H3U A;  1GVD A;  5D6F A;  4ASN A;  2DO7 A;  1ZR2 A;  3FXM A;  2E7X A;  1KZH A;  1QO0 D;  1IDZ A;  2DN0 A;  1HKT A;  2ETH A;  4TV7 A;  2PMZ N;  3LQQ A;  1Z05 A;  4HX8 A;  4LLL A;  4KT5 C;  3W2V A;  2V26 A;  3TKY A;  3BG5 A;  5F0F A;  4HLY A;  2R5Z B;  3S32 A;  2KDZ A;  2CFX A;  1TQI A;  2NNN A;  2XKO A;  3HUG B;  1U8R A;  2KDO A;  1FOY A;  3DU6 A;  4YEJ A;  3ZMD A;  1R6R A;  5DUK A;  1MMA A;  3DKY A;  1TWA J;  2W48 A;  4UUS B;  3KEY A;  2VE8 A;  3PNY A;  3H5R A;  3FBN B;  1LPQ A;  2Y48 A;  4BH9 A;  1DDN A;  3M8E A;  4UXN A;  3DPL C;  3OYH A;  4M3D A;  3DF8 A;  2BY3 A;  3RQ4 A;  4S0H B;  1P7I A;  3GX4 X;  1R22 A;  2LF8 A;  3LL7 A;  2JSP A;  3GO5 A;  1VQM I;  4RGR A;  1W1W E;  2DTZ A;  1W36 C;  2OA4 A;  3QOE A;  4C30 A;  2PJR A;  1TTY A;  4MQ9 F;  2QQB A;  3WTT C;  3JR9 A;  2IS1 A;  2M34 A;  1WJF A;  4FHT A;  3CO7 C;  1EA3 A;  4L18 B;  2DI3 A;  5K7H A;  2MLK A;  3VSL A;  3VOD A;  3CC2 I;  1V3F A;  1MH3 A;  2DFE A;  5M3M J;  3Q3S A;  3PJR A;  1LE8 A;  4I76 A;  1B72 B;  1WJA A;  3S15 J;  2PEX A;  2W82 A;  2VC1 A;  5F0H A;  4AID A;  1XGS A;  2EV5 A;  3PSI A;  4D5F A;  1K4T A;  2R92 J;  1LVA A;  1U5T C;  1ON1 A;  2NS7 A;  2R7O A;  3UR3 C;  3BJA A;  3K1N A;  4HSR A;  3E7L A;  5HS8 A;  1BI0 A;  1IN8 A;  1AKH B;  3KP4 A;  2RNJ A;  3OS2 A;  1IXS B;  2X4H A;  5CPR B;  1WGX A;  4AM3 A;  3TMO A;  5D8K B;  1B59 A;  4YIR X;  1AOY A;  2XAU A;  1QNT A;  1BR2 A;  3OSF A;  5JFR A;  1E0E A;  1UST A;  5C3E J;  5FD5 A;  3HOT A;  1I6H J;  3SFZ A;  3V7R A;  4Y13 A;  3ZQC A;  1FBU A;  1OLT A;  5IPA A;  2L3D A;  1X19 A;  2VKD A;  2ZJQ F;  1REP C;  4NQW B;  1S7O A;  3G2B A;  3HOU J;  1YIT I;  2V9V A;  1E2X A;  1SMY F;  2G7H A;  4CCK A;  1IN5 A;  1SAX A;  3SEZ A;  2VB6 A;  2GIZ A;  1FTZ A;  2XUB A;  5L3B A;  4LB6 B;  3G71 I;  1YRN B;  2J5P A;  5CVU A;  1YJW I;  2IGO A;  3ZQF A;  1H9G A;  2R5Y B;  3H3Z A;  4AU7 A;  1BI2 A;  4KYW A;  2ACJ A;  2K40 A;  3HKZ N;  1V55 H;  3LAJ A;  3G1O A;  2DMT A;  1KYW A;  2Y75 A;  4ZYD A;  2E35 A;  2NVY J;  3IRR A;  4FE7 A;  4FE4 A;  4UUV A;  2OBP A;  3MN2 A;  4U0V A;  2AS5 F;  3A0H C;  3BR2 A;  4JQF A;  3JRI A;  2L4A A;  1IZ1 A;  3FXQ A;  1TC3 C;  5J4Y A;  1BJA A;  3OYD A;  2CW8 A;  4AWX B;  1XGN A;  3L2C A;  3F8B A;  4R1H A;  4L9J A;  4XOP A;  5GP9 A;  4Q5S F;  2M8E A;  2A5Y B;  5IP6 A;  3ML6 A;  4F93 B;  1O57 A;  3JRE A;  1T95 A;  4G8X A;  4M9X A;  1J9I A;  2GQQ A;  2VJ5 A;  2ZSI B;  1FOX A;  4Z2Y A;  3PQK A;  5TGT A;  1VQ9 I;  2A68 F;  1GVJ A;  2OCE A;  3ZMZ A;  2KQR A;  3DLA A;  3BY6 A;  3LQR A;  4RAY A;  3OS0 A;  3TQN A;  5M3F J;  3J7A Y;  2PQ8 A;  3BP8 A;  4YRV A;  3LSR A;  2DA6 A;  3KP3 A;  1P4A A;  5J40 A;  4YIF A;  1FIP A;  1XMK A;  1T6S A;  1WCM J;  4A12 A;  2ZSH B;  2WAE A;  1E3P A;  3D5L A;  4MNU A;  3FXK A;  3LST A;  1S9H A;  4X0G A;  3DTK A;  5FKM A;  3WGI A;  3HOY J;  4P9U A;  2LKS A;  4RGU A;  1QRY A;  1IV6 A;  3L9F A;  5IYC J;  1Y1W J;  3Q0W A;  1MBG A;  2VOD A;  2AXL A;  1X1B A;  1FT9 A;  1M1E B;  3LA2 A;  1BA5 A;  2HPM A;  4BDY A;  3Q5F A;  3FIW A;  5BMZ A;  1TNS A;  1VFC A;  1X3U A;  1B6A A;  4BYY A;  2H27 A;  1F36 A;  4DYC A;  1R9T J;  1SD6 A;  2IA1 A;  1YJN I;  2K3P A;  4RA2 A;  1R5G A;  1V5F A;  2DFF A;  2EFO A;  3AG2 H;  3U1D A;  1JKQ C;  4A3M J;  1LEA A;  2QCO A;  3OYJ A;  4A0Z A;  2FQ4 A;  3CJR B;  1KU9 A;  3DV8 A;  4IHS A;  3K70 C;  3FKJ A;  1PJR A;  2JA7 J;  3IUO A;  2KRC A;  2JRT A;  2VKE A;  2Y2Z A;  4MFE A;  4G6T B;  4U88 A;  1Y0U A;  3HOS A;  2HKX A;  4FQG A;  5KNL A;  3AG3 H;  1JUS A;  2E7W A;  3K4K A;  1FLI A;  2KIQ A;  2W85 A;  3Q0V A;  1MSE C;  2E1O A;  1JKR C;  1J09 A;  3HHG A;  1AHD P;  2Q2E A;  2V6C A;  3LSG A;  4HNT A;  2NS8 A;  2STW A;  4H4K C;  2BW3 A;  6PAX A;  5C4J J;  4RBO A;  3PQJ A;  4AIK A;  3ABU A;  3FMQ A;  2H09 A;  5CJ9 A;  2R5Z A;  3HDD A;  5B3S H;  3KZZ A;  3C2B A;  3R0J A;  2P81 A;  2ZBK A;  3L1P A;  4B48 A;  3O8H A;  3OOP A;  2KIU A;  3DEU A;  4M73 A;  4ANJ A;  4OIP F;  1SAN A;  3K6G A;  2FBI A;  3GCM A;  2WB1 N;  4L0Z B;  3ISP A;  1IXC A;  4ABZ A;  3J7Z I;  1Y6I A;  2DA4 A;  4UUS A;  2UUZ A;  3ZGK A;  2EA4 A;  4NHJ A;  2ZO4 A;  2EIM H;  4I0B A;  4A3K J;  3PIP F;  2IGN A;  4YFX F;  3ABM H;  5H2F C;  3GTG J;  3SYT A;  2XAF A;  2GXB A;  2UXX A;  5GPC A;  1W5S A;  2IGM A;  1T0F C;  5TRD A;  2E5Z A;  5J6X A;  3CP8 A;  4OOI A;  2HI3 A;  4HPQ A;  1RR7 A;  2KPM A;  1F4K A;  4IHT A;  3GTL J;  2VT2 A;  2HVQ A;  1A31 A;  5F27 A;  2DJI A;  2EFN A;  2JMW A;  2A6T A;  2LVS A;  2UV1 A;  3BZC A;  3I59 B;  5HNH A;  2UWM A;  2X1D A;  4CDG A;  3CCU I;  4C3H J;  2QSF X;  5L3F A;  4F55 A;  4DQ2 A;  1B72 A;  3GTO J;  3B6A A;  1BW5 A;  1ETK A;  4Y17 A;  1N78 A;  3DU5 A;  1UFM A;  2OU2 A;  3OMY A;  4DZJ A;  2L01 A;  5CKT A;  5E3N A;  3OSG A;  3DBL B;  2QQ9 A;  4L9N A;  1RPW A;  2DCE A;  1OCZ H;  1F5T A;  5DYM A;  5FGM A;  2VC0 A;  1S8N A;  1D0Y A;  1KA8 A;  1XSV A;  1R4N B;  4G7O F;  2W4S A;  3CUQ C;  3DLL F;  4HF0 A;  3HGG A;  1MW7 A;  2LMD A;  3MQ0 A;  3ZN0 A;  2M8G X;  3OS1 A;  2QSG X;  2DLL A;  2DMP A;  4BJ6 C;  1N25 A;  4ENM A;  3WG7 H;  1T56 A;  2DW4 A;  1SFU A;  2WWY A;  4PSX A;  1SD4 A;  2EPF A;  1B9M A;  4Y4R A;  3RZO J;  2E60 A;  1G2H A;  4KFC A;  2OUM A;  5EYR A;  1SFE A;  2FOW A;  2WY7 Q;  3ABK H;  3S17 J;  1QHH D;  1ACI A;  2VXZ A;  2ZC2 A;  4P55 A;  2JVH A;  4XL9 A;  1R58 A;  2DFH A;  2MC3 A;  3H0G J;  1LJ9 A;  2E5N A;  2KP6 A;  3OIO A;  3KP5 A;  3K70 D;  1U78 A;  3QOD A;  5J1Y A;  5FLX K;  4F7Z A;  4DBR A;  1ZQ3 P;  2Z33 A;  3C2H A;  2OCC H;  4UV9 A;  5DCM A;  1HOM A;  4IOC F;  1W5C C;  3AFH A;  3EUA A;  3ZMV A;  3S16 J;  2FQ3 A;  3ZQH A;  2JQ7 A;  3A4C A;  5BPD A;  5E1W A;  3BG9 A;  4XN0 A;  4KIS A;  1VQ8 I;  4DJA A;  1VQP I;  1LB2 A;  3FM3 A;  5E79 C;  4BHP A;  3X2Q H;  3MAJ A;  2XGD A;  1OR7 C;  2HOT A;  1KU3 A;  2E2H J;  3CF2 A;  3K4C A;  1L0O C;  4HEA 2;  3MFK A;  4I7H A;  1MH4 A;  1U9N A;  2GZW A;  2A6H F;  2I8D A;  2CMP A;  3D5S C;  4I2O A;  5GTI C;  3IAS 2;  3BC8 A;  3UNG C;  4LK1 F;  2IA0 A;  4U0W A;  2P7C B;  3DWL E;  4DZP A;  4LOC A;  1VND A;  1PP7 U;  3JRB A;  3W2W A;  4P96 A;  3MKY B;  1B8I A;  4S04 A;  2DAO A;  2DPU A;  4CSW A;  1OCP A;  2V79 A;  2FNP A;  3P7N A;  2N8G A;  5IYD J;  3BQY A;  4U7B A;  3K4L A;  2IAI A;  3GTM J;  4WXH A;  3EYI A;  2FXA A;  1BIA A;  2OAZ A;  1FYL A;  3CC7 I;  1FYK A;  4BE0 A;  4Q47 A;  1WFX A;  1FBS A;  5GAE J;  3JAM K;  2VXD A;  4KUM A;  3OYA A;  2VN2 A;  3W6V A;  1OCO H;  5ILU A;  2Z9O A;  3KYC B;  3E5Q A;  5LGT A;  1SMT A;  3K69 A;  4M3E A;  4OIN F;  2X6Y A;  1QZZ A;  2QWW A;  3JRF A;  4KIB A;  4EM1 A;  5JVT A;  1GXQ A;  3EUH A;  1NTC A;  2XVC A;  2XRL A;  3KP2 A;  5LBQ A;  1FP2 A;  5LHG A;  2HPI A;  4O3M A;  4G6D A;  2PBI A;  3EYY A;  3S1R J;  3F3X A;  3MZY A;  1BC8 C;  3GW2 A;  2FOK A;  1W5T A;  2KMU A;  2D5V A;  4Y33 A;  2RKH A;  1HSJ A;  5EEA A;  4GFB A;  1S7E A;  2ESH A;  2Q2E B;  2LY9 A;  2COM A;  2Y31 A;  4XK4 A;  3VOE A;  3IRQ A;  5A2Q K;  4ZTF A;  3FXJ A;  5DS9 A;  2FBK A;  2TDX A;  2DT7 B;  1UEL B;  1J75 A;  1BOA A;  3CDL A;  2EFW A;  1FPQ A;  5H6R A;  2XIG A;  2COB A;  1J2X A;  3WGH A;  3IKT A;  2LF7 A;  2V9P A;  4FIS A;  3V7S A;  4KA4 A;  1GLN A;  3M1E A;  2XGX A;  3ABL H;  4OAZ A;  1ZGA A;  2NOG A;  1IUY A;  3V8K A;  2CRG A;  4UVB A;  2YUS A;  5EZH A;  4M3F A;  4XLA A;  4ZDL A;  5JHF A;  2F48 A;  3VDX A;  3F6O A;  4XLE A;  3UKG A;  3KFW X;  2R7X A;  3KP7 A;  1PP8 F;  2F5F A;  4CH7 A;  1QBJ A;  1P6R A;  2GA1 A;  4P9F A;  3BR3 A;  2HOS A;  3LA7 A;  3H36 A;  2O9L A;  2G0E A;  1RIO H;  3H9Q A;  3S8P A;  3F9K A;  1BR4 A;  4M74 A;  2LG4 A;  4HDU A;  4IX7 A;  3TW7 A;  3HOX J;  1RC9 A;  1T38 A;  2NXN B;  2WA0 A;  5DV5 A;  1WWX A;  2PX9 A;  1UG0 A;  3BG7 A;  3VYS B;  3HJE A;  3GZ5 A;  2K9Q A;  4CHU A;  2DOA A;  3E5U A;  3FIS A;  2LKX A;  1H9T A;  2C6Y A;  4HA8 A;  3Q9V A;  3QPS A;  1Y39 A;  1MIJ A;  3BR1 A;  1X58 A;  1DGW Y;  1SVM A;  2WAQ N;  3IC7 A;  2VON A;  2OC6 A;  1A36 A;  3RPQ A; 
#chains in the Genus database with same CATH homology
 1T39 A;  2MD5 A;  2IT0 A;  3R4K A;  4IF4 A;  3M9A A;  1ZG5 A;  3O2P E;  4KDP A;  1YIO A;  3I53 A;  3TGN A;  3J80 Z;  4LG0 B;  3ERE D;  3DXJ F;  2D1V A;  3I54 A;  3CTA A;  2O6G E;  4ETS A;  3V8L A;  3DP7 A;  3J80 K;  2A07 F;  4EM0 B;  4UVA A;  2XHK A;  4R79 A;  2EA2 A;  2HWV A;  3KCC A;  1D8J A;  4MGR A;  5HLG A;  5F64 A;  2LKP A;  2FML A;  3GXO A;  1KGS A;  5KVR A;  3BWG A;  1BN5 A;  1I27 A;  3HRT A;  1TQP A;  5DCM B;  2CSO A;  1BBY A;  1OMI A;  2FU4 A;  2YU3 A;  2FEZ A;  4BNC A;  3SZP A;  3ULQ B;  4OIO F;  4B09 A;  1LDJ A;  1U2W A;  4CZZ A;  1FNN A;  1O7F A;  4HLX A;  2DQL A;  1WKM A;  4EJW A;  1RNL A;  3BJ6 A;  5ICG A;  5DEQ A;  2XAQ A;  3ABT A;  2CQK A;  4OIR F;  4ENN A;  5L3D A;  4O5V A;  4ZYE A;  3Q9S A;  1P4X A;  4N9I A;  2D2W A;  4FX0 A;  3D0S A;  1XCV A;  4LD5 A;  1T98 A;  3QPH A;  1PDN C;  4LLG F;  2NRA C;  2MH9 A;  2R7F A;  2RQP A;  1ULY A;  2H6B A;  2K27 A;  3GF2 A;  2KRF A;  4MQV A;  1D5V A;  3BJO A;  1S3J A;  2FRH A;  2HZT A;  4EJU A;  2GXG A;  1ODD A;  5AIQ A;  3KP6 A;  1B4A A;  3K1P A;  4ZZL A;  2BYV E;  1F1Z A;  2P5V A;  4RS8 A;  2Q8K A;  3E6D A;  2G7U A;  3BRO A;  2HKO A;  4DNC A;  2HTJ A;  5CYV A;  3GFI A;  4ZZD A;  2BV6 A;  3LFK A;  4LJZ F;  4OMY A;  3NRV A;  4WCG A;  3I59 A;  4A6D A;  3HYI A;  3TDU C;  1T2K A;  2CWE A;  3RKW A;  3EET A;  1YQA A;  3BPV A;  3EDP A;  1G3Y A;  1G3T A;  4L9V A;  5D5W B;  3WU0 A;  3TOA A;  4UVC A;  3RKY A;  5L3E A;  4RB1 A;  2CYY A;  1MGT A;  2O0Y A;  3WOD F;  5BPI A;  4Y15 A;  1JE8 A;  1J7K A;  2FF4 A;  4FT8 A;  4BXU A;  1NHA A;  2FMY A;  3RIR A;  2XRO A;  1BC7 C;  3WU1 B;  2J5O A;  4U7D A;  2MH2 A;  4EV0 A;  2RVC A;  5KK1 A;  5HDG A;  1FBQ A;  5DD4 A;  1MKM A;  4LFU A;  4KN4 X;  2L02 A;  3IWZ A;  2LDU A;  4LG0 A;  1OPC A;  5LRS A;  4XBF A;  1FX7 A;  2HOE A;  4L9T A;  4HF2 A;  2KJC A;  4IJA A;  2YX4 A;  1J59 A;  5BQT A;  2PLY A;  1P2F A;  3KEO A;  4LB5 A;  1P4W A;  1EH7 A;  3G3Z A;  1OYI A;  1R00 A;  3COA C;  2ELH A;  3E6B A;  4UV8 A;  1ZG3 A;  3KET A;  2HEO A;  1XDS A;  1YW8 A;  1Z91 A;  3SZT A;  2M87 A;  4O6J A;  3DPT A;  3TOB A;  1DPU A;  2W57 A;  4HYE A;  5AIP A;  2LNB A;  2HGC A;  4I98 B;  3ROU A;  1R7J A;  5HLI A;  2MLG A;  4EGY A;  2CO5 A;  3J81 Z;  3IKV A;  1ZRC A;  1EH6 A;  4G7H F;  1K6O A;  3JTG A;  3J81 K;  4GYG A;  3I58 A;  4A5N A;  3HTS B;  4CYD A;  1MZB A;  3V4G A;  3FX3 A;  2DPD A;  1V4R A;  3T0Y A;  2OQR A;  1CGP A;  4N9H A;  2FBH A;  3C1D A;  3SQN A;  3RDI A;  1U3E M;  2IPQ X;  3MZH A;  4ESJ A;  3C7J A;  4M72 A;  4A6E A;  4KN7 X;  4IVN A;  4G9Y A;  1FWZ A;  2IP2 A;  4GCV A;  3K2Z A;  2RC4 A;  2O3F A;  1TW3 A;  4XSZ F;  1KQ0 A;  4WXC A;  5CLS A;  3JSO A;  2PG4 A;  1GHC A;  2VT3 A;  5K5R A;  3WTX C;  5E18 F;  4XLN F;  1W7P D;  2ISZ A;  3GFL A;  4KIC A;  2BBY A;  2P6S A;  4XRF A;  2DK5 A;  5E8I A;  3HUG A;  3RPU A;  5ICC A;  2K7L A;  5FO5 A;  4IXA A;  1UHW A;  5D8L B;  3F22 A;  4KNY A;  1FOK A;  1IN7 A;  1ZLJ A;  4M9S A;  3QP5 A;  2NS0 A;  3JW4 A;  3TO6 A;  3BZ6 A;  3PFI A;  2YR2 A;  2P5L C;  4P5O A;  1Z6T A;  4M6Y A;  4ENK A;  1HW1 A;  2DQR A;  4HX7 A;  3JSP A;  2PFB A;  2M1B A;  4BHB A;  3C18 A;  3WG9 A;  5L3G A;  2UXN A;  2KIF A;  1FZP B;  5IT9 K;  1ZHF A;  2NNY A;  3VB2 A;  1O3T A;  2E1N A;  5DD8 A;  3ZPL A;  4HX4 A;  4NQW A;  1SFX A;  2DK8 A;  4R8H A;  2CW0 F;  3GFM A;  3HSE A;  4IRG A;  2FE3 A;  1U5T B;  4PZJ A;  4I09 A;  2Z3Y A;  1TQM A;  4PDK A;  5LLQ A;  1R1U A;  2NYX A;  3M8F A;  3HIF A;  2STT A;  3U9G A;  2IVM A;  4LMY A;  2M30 A;  2RN7 A;  3WE3 A;  3T8T A;  2Q0O A;  3WTS C;  2XV4 S;  3P9C A;  3BOQ A;  1ZAR A;  4EQQ A;  4FX4 A;  2ADU A;  4EM2 A;  3R0A A;  2WC2 A;  5E1Z B;  1IN4 A;  5D4R A;  3R6S A;  3CDH A;  4EJT A;  2VOO A;  4ZYH A;  2F5D A;  1K7A A;  1FSE A;  2UZK A;  1YO5 C;  3F72 A;  4QLC U;  3CUQ A;  4BAY A;  2PN6 A;  5LRR A;  1D8K A;  3K0L A;  3C3W A;  2LSO A;  3TDZ C;  3AAF A;  5CVV A;  5E17 F;  3VEP A;  4XSX F;  2EK5 A;  5ICE A;  5CVI A;  2RDP A;  3JTH A;  2OQG A;  5JR3 A;  2YPR A;  4HV6 A;  2A69 F;  3I0T A;  3WTZ A;  1T0F A;  2FNA A;  4M71 A;  3DQV C;  1TW2 A;  2ZCW A;  2OZ6 A;  1R36 A;  5ICF A;  5H20 A;  2DT5 A;  4AVP A;  3IHU A;  3GYH X;  3L00 A;  1BIB A;  5D4S A;  1IAW A;  5JI6 A;  3KLN A;  2QVO A;  1O3R A;  1YG2 A;  3FHZ A;  1BI1 A;  3WTU C;  5CVJ A;  1B9N A;  3GEZ A;  1R1V A;  1RZ4 A;  3B73 A;  1TNT A;  1LEB A;  2O61 A;  2PMU A;  3ZN1 A;  3HRS A;  3MCZ A;  1A04 A;  3KEQ A;  3IL2 A;  3FM5 A;  2WTE A;  3M7G A;  4BQA A;  3N4M A;  2EFQ A;  1I5Z A;  2EFP A;  5FFZ A;  3E3V A;  5D6E A;  2QBY A;  3QPT A;  3KZY A;  4H0E A;  2HR3 A;  2M5W A;  5FD6 A;  4GGG A;  3H92 A;  2E1C A;  1MJ9 A;  1KU7 A;  2XKP A;  3ECO A;  1S29 A;  1XMA A;  1DPR A;  2HQN A;  1FYM A;  4G6Q A;  1ZRE A;  4EMS A;  4IPA A;  3P9I A;  2YX7 A;  2KIM A;  1YS7 A;  3FF5 A;  4I02 A;  4JBA A;  2GAU A;  5CVR A;  3QU3 A;  1MJB A;  4LK0 F;  1HQC A;  5ERI A;  2JPC A;  1ZN2 A;  2JSC A;  4A0Y A;  3SXY A;  3WGG A;  1MDM B;  4JK1 X;  3ZMT A;  1HW5 A;  5K1Y A;  3FMS A;  1KYZ A;  3RKX A;  4Q48 A;  4WWC A;  1XSD A;  5A2Q Z;  2O03 A;  2HTS A;  3HSR A;  4CGZ A;  2V1D A;  3IWF A;  5FFX A;  4RAZ A;  3QU6 A;  1LDD A;  4ZH4 F;  5ILS A;  2QLZ A;  5E8G A;  1QZY A;  1O3S A;  3RJP A;  1FP1 D;  1Q1H A;  3BDD A;  3RYP A;  5HS7 A;  3I5U A;  5L3C A;  1GXP A;  3WTV C;  2ZKZ A;  1BM9 A;  1IW7 F;  4XLP F;  1LNW A;  1XB4 A;  3QP6 A;  1WQ2 A;  4QWQ A;  5K5O A;  2VBX A;  4ON0 A;  1RUO A;  2VOP A;  2FSW A;  1IXR C;  2K4J A;  2RGV A;  4EJO A;  1W7P A;  5HOO A;  3FZV A;  4KMU X;  1R5H A;  1CF7 B;  2F5E A;  3F6V A;  4HZF A;  1O7L A;  3NEU A;  4D0P A;  3WTY C;  2P4W A;  2ZXJ A;  4MEX F;  3HRU A;  4UNO A;  1HXD A;  4M6X A;  4RB2 C;  5EEG A;  3F21 A;  3KLO A;  1XCB A;  1ZGJ A;  1DP7 P;  1E17 A;  4WF2 A;  2IA2 A;  2ISY A;  2ZNZ A;  3CO6 C;  4Q4Z F;  2L54 A;  3QOP A;  4S05 A;  1XDU A;  2X0L A;  3BPX A;  4HW0 A;  1Z9C A;  1YFH A;  4YFK F;  5HDN A;  4K2E A;  4RGX A;  2H94 A;  3ZMS A;  3ZQ7 A;  3G73 A;  2CG4 A;  3HTU A;  5D5X B;  3ELK A;  3FXR A;  4KIF A;  1UCR A;  4A0X A;  5JHU A;  2ZME A;  1J0R A;  1MD0 A;  3F8N A;  2W25 A;  3OV8 A;  2P7V B;  2P5K A;  2QEN A;  1XN7 A;  5DDG A;  1S7A A;  5HLH A;  4ESF A;  3F23 A;  5LGN A;  4LLN A;  4AIJ A;  4OMZ A;  4GYI A;  1USS A;  1ZLK A;  2XAG A;  2HYG D;  3T8R A;  3CLO A;  3WTW C;  4PGH A;  3NQO A;  4HQM A;  2DTR A;  3E6M A;  4L5J A;  1VTN C;  5HDK A;  1ON2 A;  1XGO A;  1LDK B;  3W6J B;  4HDV A;  4L5I A;  4I01 A;  3LA3 A;  1ONV A;  5LHI A;  2KJB A;  3F8F A;  3HSF A;  2PMH A;  2R7D A;  4YG2 F;  2Z99 A;  2EV0 A;  2QYO A;  5ED4 A;  1AWC A;  3EQL F;  3MEX A;  3FMR A;  2HDC A;  3T1B A;  4EVI A;  2V1X A;  1JGS A;  3ECH A;  1U6G A;  3ZP5 A;  4G94 A;  2K4B A;  1I6X A;  3O6B B;  1ZAO A;  2D1H A;  1QQI A;  5LGU A;  1OR7 A;  3L09 A;  5IT3 A;  1F9N A;  1HST A;  1ZG1 A;  2M45 A;  2OZU A;  5F1R A;  2G9W A;  2PI0 A;  3JAM Z;  3RTR A;  1EH8 A;  2ZFW A;  4G7Z F;  4CO8 A;  1CF7 A;  4HBL A;  4UHT A;  1UB9 A;  4GO1 A;  5LEK A;  3I4P A;  5DUI A;  5EEH A;  2DBB A;  2FA5 A;  4CXF A;  4LGW A;  2B0L A;  4PGG A;  5BS6 A;  1P92 A;  1IRG A;  4A5M A;  1S6L A;  1L3L A;  3B02 A;  3SHF A;  5ILV A;  2XRN A;  3S2W A;  1KU2 A;  1FY7 A;  2R3S A;  3VFZ A;  3O3K A;  2MA3 A;  3U2R A;  4ENJ A;  4WX9 A;  1EV7 A;  5E1X A;  4BHC A;  2QQA A;  2O8X A;  2A3S A;  1ZRD A;  3LAP A;  3MWM A;  1YTY A;  1ZRF A;  2QUF A;  3V7C A;  5DCF A;  2W84 A;  2ESN A;  1QPM A;  2DU9 A;  1ZH5 A;  2VE9 A;  2IJL A;  2Y0M A;  2JTV A;  3E6C C;  2F2E A;  1I1S A;  1ZYR F;  4AIH A;  1HKS A;  2D45 A;  1WI9 A;  4M9Z A;  5HS9 A;  4E70 A;  4IRI A;  2GIV A;  2EWN A;  1UHM A;  1MJA A;  3R60 A;  3QAH A;  4RB3 C;  5LEJ A;  1SD5 A;  1MDM A;  4OIQ F;  1WSU A;  4OU0 A;  1K78 B;  4AD9 A;  3F8M A;  4HQE A;  2BE5 F;  1IF1 A;  1YLF A;  4GXO A;  1HW2 A;  3I64 A;  4MHG A;  4NB5 A;  1YS6 A;  2XAH A;  3FXU A;  1G4D A;  1B1B A;  2KKO A;  2RV8 A;  1JHH A;  5D5U B;  1XD7 A;  1OYW A;  2W24 A;  2QM3 A;  4MEY F;  3HRM A;  5H6Q A;  4MTE A;  3K1M A;  3ZMU A;  2HS5 A;  1I1G A;  5J8F A;  5E20 A;  1SD7 A;  3TO9 A;  1O3Q A;  1YW9 A;  1DUX C;  2F5C A;  1U5T A;  2YSR A;  4HAM A;  2PJP A;  4EJV A;  3N97 A;  4YII A;  2V1U A;  1W7P B;  3LWF A;  2BGC A;  2IW5 A;  1YYV A;  4MTD A;  1OKR A;  2L4M A;  5J8C A;  3J7A O;  1XSX A;  3P9K A;  5D5V B;  4KIG A;  3F8C A;  1FC3 A;  2JZY A;  5IT9 Z;  2ZJ2 A;  4HV5 A;  2GWR A;  1OYY A;  1Z1D A;  2K86 A;  2EV6 A;  3DKW A;  3RYR A;  1PUE E;  3E97 A;  3R61 A;  4EGZ A;  1WRJ A;  1JHF A;  2NAZ A;  1XGM A;  2P6T A;  4YFN F;  4A2U A;  1LQ1 A;  4HOB A;  3CJN A;  1BI3 A;  3CUQ B;  3DFG A;  3K9T A;  2QZ8 A;  4HF1 A;  3GLX A;  1H0M A;  2XAS A;  1QGP A;  4IRH A;  5F6F A;  1IRF A;  2A61 A;  1RI7 A;  3T5X A;  2EJR A;  4RB0 A;  1HBX G;  5FLX Z;  3GFJ A;  4CIC A;  3FWE A;  2ZME B;  1IN6 A;  2H6C A;  3TO7 A;  3GVA A;  5K5Q A;  2DFI A;  2P8T A;  1STZ A;  2VBY A;  1RUN A;  2MBF A;  2A6E F;  1G6N A;  4RGS A;  3GWZ A;  2CGP A;  2JPB A;  3L7W A;  2GA2 A;  3RI4 A;  2ZNY A;  3HHH A;  2JT1 A;  2Z5U A;  2IRF G;  2BEO A;  2OD5 A;  1G3W A;  1Z7U A;  1D3Y A;  3W6K B;  3REO A;  4WXD A;  3QRF F;  3GUD A;  2HFH A;  3V8J A;  5HVQ C;  2VBW A;  2XAJ A;  1TBX A;  2HYF A;  3GZ6 A;  4U0Y A;  4ESB A;  1K79 A;  5AON A;  4B8X A;  5BOX A;  1TLH B;  2HQR A;  2WV0 A;  1K78 A;  1W4M A;  1KQ8 A;  2EB7 A;  3I71 A;  1R1T A;  1J5Y A;  1Z6R A;  2QBY B;  4L0Y B;  1JXS A;  3CUO A;  1G3S A;  1HKQ A;  4KMF A;  4I0A A;  3KE2 A;  5TJJ A;  1KQ9 A;  5LHH A;  1FSH A;  4N0B A;  3WE2 A;  1R23 A;  4WK8 F;  1YW7 A;  4PCQ A;  2VBZ A;  3E5X A;  5FB2 A;  1C0W A;  2K02 A;  4ZYG A;  3H3U A;  5D6F A;  4ASN A;  2DO7 A;  2E7X A;  1QO0 D;  1HKT A;  2ETH A;  4TV7 A;  3LQQ A;  1Z05 A;  4HX8 A;  4LLL A;  4KT5 C;  3TKY A;  4HLY A;  2CFX A;  1TQI A;  2NNN A;  2XKO A;  1U8R A;  3ZMD A;  5DUK A;  2VE8 A;  2Y48 A;  4BH9 A;  1DDN A;  3M8E A;  4UXN A;  3DPL C;  3DF8 A;  3GX4 X;  1R22 A;  2LF8 A;  3GO5 A;  4RGR A;  2OA4 A;  1TTY A;  4MQ9 F;  2QQB A;  3WTT C;  4FHT A;  3CO7 C;  4L18 B;  2DI3 A;  2MLK A;  3VOD A;  1V3F A;  2PEX A;  2VC1 A;  1XGS A;  2EV5 A;  1LVA A;  1U5T C;  1ON1 A;  3BJA A;  3K1N A;  5HS8 A;  1BI0 A;  1IN8 A;  3KP4 A;  2RNJ A;  1IXS B;  2X4H A;  5D8K B;  1B59 A;  1AOY A;  1QNT A;  5JFR A;  1UST A;  5FD5 A;  3HOT A;  3SFZ A;  3V7R A;  4Y13 A;  1FBU A;  2L3D A;  1REP C;  1S7O A;  2V9V A;  1E2X A;  1SMY F;  2G7H A;  1IN5 A;  1SAX A;  2XUB A;  5L3B A;  4LB6 B;  2J5P A;  5CVU A;  1H9G A;  3H3Z A;  1BI2 A;  4KYW A;  2ACJ A;  3LAJ A;  1KYW A;  2Y75 A;  4ZYD A;  3IRR A;  4UUV A;  2OBP A;  4U0V A;  2AS5 F;  4JQF A;  2L4A A;  1IZ1 A;  3FXQ A;  1BJA A;  4AWX B;  1XGN A;  3L2C A;  3F8B A;  4R1H A;  4L9J A;  4Q5S F;  2M8E A;  2A5Y B;  3ML6 A;  1O57 A;  4G8X A;  4M9X A;  1J9I A;  2GQQ A;  4Z2Y A;  3PQK A;  2A68 F;  1GVJ A;  3ZMZ A;  3BY6 A;  3LQR A;  4RAY A;  3TQN A;  2PQ8 A;  3BP8 A;  3KP3 A;  1P4A A;  4YIF A;  1XMK A;  1T6S A;  4A12 A;  4MNU A;  3D5L A;  3LST A;  3WGI A;  4P9U A;  4RGU A;  3L9F A;  2VOD A;  2AXL A;  3LA2 A;  1FT9 A;  3Q5F A;  5BMZ A;  1TNS A;  1X3U A;  1B6A A;  4BYY A;  2H27 A;  1SD6 A;  2IA1 A;  1R5G A;  3U1D A;  2EFO A;  1LEA A;  4A0Z A;  1KU9 A;  3DV8 A;  4IHS A;  2JRT A;  4U88 A;  1Y0U A;  3HOS A;  2HKX A;  2E7W A;  1FLI A;  2W85 A;  3HHG A;  2Q2E A;  2V6C A;  2STW A;  6PAX A;  3PQJ A;  4AIK A;  3ABU A;  3FMQ A;  2H09 A;  5CJ9 A;  3KZZ A;  3R0J A;  2ZBK A;  3OOP A;  2KIU A;  3DEU A;  4M73 A;  4OIP F;  2FBI A;  4L0Z B;  3ISP A;  1IXC A;  2EA4 A;  4NHJ A;  2ZO4 A;  4I0B A;  4YFX F;  2XAF A;  2GXB A;  2UXX A;  1W5S A;  5TRD A;  5J6X A;  4OOI A;  4IHT A;  1F4K A;  2VT2 A;  2EFN A;  3I59 B;  2UWM A;  4CDG A;  5L3F A;  4DQ2 A;  4Y17 A;  1UFM A;  2OU2 A;  2L01 A;  2QQ9 A;  4L9N A;  1F5T A;  5DYM A;  5FGM A;  2VC0 A;  1S8N A;  1KA8 A;  1XSV A;  4G7O F;  3CUQ C;  4HF0 A;  3MQ0 A;  3ZN0 A;  2DLL A;  4ENM A;  2DW4 A;  1SFU A;  2WWY A;  1SD4 A;  1B9M A;  4KFC A;  1SFE A;  2VXZ A;  4P55 A;  1R58 A;  2MC3 A;  1LJ9 A;  3KP5 A;  1U78 A;  5FLX K;  4F7Z A;  2Z33 A;  4UV9 A;  5DCM A;  3ZMV A;  2FQ3 A;  5BPD A;  5E1W A;  1LB2 A;  3FM3 A;  4BHP A;  3MAJ A;  1KU3 A;  1L0O C;  3MFK A;  4I7H A;  2GZW A;  2A6H F;  4I2O A;  4LK1 F;  2IA0 A;  4U0W A;  2P7C B;  1PP7 U;  4P96 A;  4S04 A;  2DPU A;  2DAO A;  2V79 A;  2FNP A;  3P7N A;  4U7B A;  4WXH A;  3EYI A;  2FXA A;  1BIA A;  2OAZ A;  1FYL A;  1FYK A;  4Q47 A;  1FBS A;  3JAM K;  4KUM A;  2VN2 A;  5ILU A;  2Z9O A;  3E5Q A;  5LGT A;  1SMT A;  3K69 A;  4OIN F;  1QZZ A;  2QWW A;  4KIB A;  4EM1 A;  5JVT A;  1GXQ A;  3EUH A;  2XVC A;  3KP2 A;  5LBQ A;  1FP2 A;  5LHG A;  4O3M A;  4G6D A;  2PBI A;  3EYY A;  3F3X A;  1BC8 C;  3MZY A;  3GW2 A;  2FOK A;  1W5T A;  2RKH A;  1HSJ A;  2ESH A;  3VOE A;  2COM A;  3IRQ A;  5A2Q K;  2FBK A;  2TDX A;  1J75 A;  1BOA A;  2EFW A;  1FPQ A;  5H6R A;  2XIG A;  1J2X A;  3WGH A;  3IKT A;  2LF7 A;  3V7S A;  4KA4 A;  3M1E A;  2XGX A;  1ZGA A;  1IUY A;  3V8K A;  4UVB A;  3F6O A;  3KFW X;  3KP7 A;  1PP8 F;  2F5F A;  1QBJ A;  1P6R A;  2GA1 A;  4P9F A;  3LA7 A;  1RIO H;  4M74 A;  4HDU A;  1T38 A;  5DV5 A;  1WWX A;  3GZ5 A;  4CHU A;  3E5U A;  1H9T A;  2C6Y A;  4HA8 A;  3Q9V A;  2VON A;  3IC7 A;  3RPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...