3CUQA

Integrated structural and functional model of the human escrt-ii complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
219
structure length
219
Chain Sequence
AQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
total genus 60
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA03
2HFHA 2HQRA 1PP7U 4L9NA 3IHUA 2XIGA 5JHUA 5LGTA 1J5YA 2E7XA 3T1BA 2ESNA 1OMIA 4G7ZF 2J5OA 3MCZA 5JFRA 4PZJA 1LDDA 4BHCA 5D5XB 1LB2A 1X3UA 5CVIA 2VBXA 4MEYF 4CHUA 2HS5A 1SMYF 4GO1A 4A5MA 4MTEA 4A2UA 2A5YB 4UVCA 3ZMDA 1FOKA 4PGHA 2F5EA 3OV8A 4M9XA 3M1EA 2X4HA 3KFWX 5CVJA 1JE8A 1L0OC 5E1WA 1B59A 2FBIA 2B0LA 2LSOA 5ICCA 5K5QA 1S29A 2NS0A 5HVQC 3BJOA 1B9MA 1EH7A 2K4JA 4U0WA 3LA3A 4L9TA 3GW2A 5AONA 1LEBA 2EFWA 2JRTA 2GZWA 2Y75A 1U78A 1R5GA 3KLNA 2BE5F 1R1VA 5ICFA 1JXSA 5CVUA 4HLXA 1OYYA 4HOBA 4N9IA 1IN4A 3L09A 3V8JA 1USTA 1RUOA 2EV6A 3C7JA 3RPUA 4OIOF 2CWEA 3CLOA 2E7WA 1USSA 1KU9A 2O6GE 4AIKA 3HSRA 1E2XA 1DP7P 1I1SA 1MDMA 1FYKA 1GHCA 1B1BA 2EFNA 5D6EA 3KP5A 4RB2C 2HEOA 2XAGA 1YW7A 5L3FA 4LK1F 2R7FA 4I7HA 1BN5A 4WXHA 5H6QA 3BPXA 3WTXC 1OR7A 3P9CA 5CYVA 3TQNA 1BC7C 2OZ6A 2YX7A 3V7SA 1YTYA 3J7AO 1XGOA 3LSTA 2CW0F 4CO8A 2DFIA 3WTWC 5E8GA 3JSOA 3G73A 4OIPF 2YR2A 5BPDA 1Z7UA 1QGPA 3F3XA 4G7HF 3FWEA 1T2KA 1IN5A 1YS7A 4EJVA 2QLZA 4Q4ZF 1MJAA 3CTAA 3VEPA 1U5TA 4UHTA 1T38A 2ESHA 2VONA 1LDKB 1ZRFA 3HHGA 2KRFA 3KZYA 3IL2A 3DFGA 2KKOA 3M9AA 2D1HA 1W5TA 1W7PD 2F5FA 4MNUA 1G3SA 1YLFA 1TQMA 3V7RA 3I53A 1ONVA 2J5PA 4XSXF 2NNNA 1DPRA 3SZPA 2A6EF 3F6OA 5JVTA 1PUEE 1S7AA 1XSXA 2VBZA 4YFXF 5J8CA 5L3CA 1SD7A 1HQCA 5ICEA 4FX4A 2K27A 1XD7A 3E5QA 1BC8C 5HDNA 2P5KA 2IA2A 1IW7F 2PLYA 5CVVA 1O7LA 3QU6A 1HXDA 1ZN2A 5TRDA 5AIPA 4D0PA 2L02A 4KA4A 4LMYA 2D1VA 2ZMEB 4L9VA 3KP3A 1XGSA 2EFQA 2AXLA 2EB7A 1WSUA 5LBQA 3N4MA 4MGRA 4L0YB 4KIBA 5FLXZ 4A12A 5DD8A 3WTTC 4RS8A 3WTSC 1CF7B 3WGIA 2PBIA 5CLSA 3Q9SA 2ZNYA 5IT9K 2EFPA 2GWRA 3BROA 1FX7A 4KIFA 4U7DA 4HX8A 1BM9A 4M71A 5J8FA 3GLXA 2KJBA 2HOEA 3COAC 3GF2A 2OAZA 4NQWA 2W85A 1W4MA 1T39A 4YFNF 1BJAA 1XCVA 2MBFA 3FMQA 3S2WA 5E17F 3KEQA 4KN4X 2VBWA 2A61A 3DP7A 1LJ9A 1JHFA 1XGMA 5LEJA 1MD0A 2O3FA 1R00A 4ENMA 2XAHA 2ISZA 2DLLA 3HUGA 4EJOA 4ZYDA 2QBYB 3ULQB 2M30A 2CYYA 1KYWA 4BHPA 2TDXA 5A2QK 3GFIA 4CZZA 5HS9A 2K4BA 5K1YA 3G3ZA 4KICA 3IC7A 1TW2A 2FOKA 2L3DA 2UXXA 3MQ0A 3LFKA 2ZNZA 2IVMA 4YIIA 4OIQF 3DV8A 4LLNA 1ZGJA 5LLQA 1RNLA 1T0FA 1IXSB 1HW1A 4P96A 3GXOA 1ZG3A 1HKTA 4HQEA 5LHIA 1XN7A 5DCFA 1DUXC 1SD5A 5DUIA 4Z2YA 2MLGA 4LGWA 3HTUA 2DTRA 2W84A 1ZLKA 2FQ3A 2XAFA 3F8BA 3K69A 3MAJA 1TNTA 3WTUC 4LD5A 1UB9A 2PJPA 5KVRA 1Z9CA 1NHAA 2CO5A 1U8RA 3I54A 2V9VA 1BOAA 2DI3A 1WKMA 4ESJA 4EQQA 2RV8A 1TNSA 5L3GA 3LA7A 2EV5A 4M72A 2NAZA 3RDIA 3T0YA 4I98B 1ZAOA 1PP8F 1Q1HA 3LAJA 5L3EA 3E6BA 4Y15A 1Z1DA 1RI7A 2EA4A 4Y17A 1OYIA 2XV4S 1R22A 1ZRCA 2Q2EA 5FFZA 3ABUA 3SQNA 2L4AA 2R3SA 4JBAA 3RKYA 1IUYA 1FBSA 2VT3A 5J6XA 4G6QA 1XB4A 2MLKA 2IA1A 2X0LA 4WF2A 1CF7A 4GYGA 3VOEA 3WU1B 2V6CA 2ISYA 2AS5F 2MH9A 3FM5A 5F1RA 2EWNA 2VOPA 5ERIA 3RYRA 3KP6A 3CUQA 1ZREA 1B9NA 3KP2A 2M1BA 3J80Z 3QPHA 3FMSA 4KFCA 1DDNA 2GAUA 1WWXA 3F22A 4IRIA 5ILUA 4BHBA 3V4GA 4JK1X 1W5SA 3RJPA 2FRHA 2DO7A 4HF1A 4MTDA 4AIHA 2GXGA 2ETHA 4M73A 4E70A 3H92A 4I2OA 4ZYHA 3RKWA 3QPTA 4KMUX 4RGRA 1TTYA 4XLPF 5D5UB 3HSEA 5JI6A 3ELKA 1MJBA 4OOIA 2MC3A 4KIGA 1G6NA 1SFXA 4FT8A 2Y48A 1RZ4A 4N9HA 1R1TA 2VOOA 2BV6A 2DT5A 1R1UA 3SFZA 1BI2A 4ENNA 1HKQA 4YG2F 2QVOA 4BQAA 4Q47A 5LHGA 2RC4A 3ZMZA 5IT9Z 5H20A 1U3EM 2STTA 4P55A 2COMA 2IP2A 3E5XA 4HAMA 4WWCA 3ROUA 1U6GA 3C1DA 5DV5A 5FD5A 2Z33A 3HRSA 4HA8A 1IXCA 2QM3A 5JR3A 4KT5C 5F64A 1T6SA 1SD6A 4KUMA 5E18F 3HOTA 3GEZA 3Q5FA 2W57A 3RYPA 5K5OA 4FX0A 4WK8F 2VBYA 3LQRA 1S8NA 1LEAA 4EGYA 4JQFA 4UNOA 3KLOA 3JAMK 3L00A 1K78B 2WC2A 5E20A 4MEXF 4A5NA 3K2ZA 3EYIA 3WODF 4CICA 1TLHB 4RGUA 1MZBA 1FPQA 2XGXA 1IRGA 3E5UA 2DU9A 4IRHA 2A68F 2Z9OA 3NRVA 3K1NA 1Z05A 2RDPA 2HYGD 3BOQA 4PDKA 3TOBA 4KYWA 1KU3A 2CQKA 2LKPA 5LGNA 5HDGA 4EJUA 2OZUA 3ZMUA 2DW4A 4IXAA 3BWGA 3ML6A 5ILSA 1IRFA 3CO6C 1FSEA 4LFUA 1KQ8A 5FLXK 3RI4A 4AVPA 3KP7A 4RGSA 4EM2A 2IT0A 3F8NA 2VT2A 2BYVE 4GGGA 3P7NA 2HQNA 1FT9A 2G7HA 3HIFA 1TQPA 1KGSA 2JTVA 2XHKA 2IRFG 1D8KA 2O03A 3F8MA 4CDGA 5E8IA 2V1XA 3F8FA 1FBUA 1ZARA 2OA4A 2JPCA 2H6BA 1G3YA 2H09A 3ZN0A 3F21A 4FHTA 1I27A 1YW8A 3QP6A 4CXFA 4HV5A 2OQRA 3SXYA 4N0BA 4R79A 4LG0B 4S04A 3L7WA 1K78A 1S3JA 3BJAA 3KCCA 4HDUA 1MKMA 4CGZA 1D5VA 3SZTA 1PDNC 4ENJA 1I5ZA 5BMZA 2H6CA 2PEXA 4Q48A 2HR3A 2LF7A 1SD4A 3GVAA 5BQTA 4I0AA 4BAYA 3ZMVA 3DPTA 3J81Z 2C6YA 2E1NA 2OBPA 3U9GA 1P4AA 1LDJA 2XAJA 4EM1A 2STWA 3WU0A 3FXRA 2ZJ2A 4TV7A 4ZZDA 4AIJA 2K7LA 1J75A 1HW5A 5HOOA 3N97A 1XMAA 4L5IA 5D5WB 2FNAA 3VB2A 4WXCA 4HF0A 2QQ9A 3BY6A 1ODDA 3RIRA 1O7FA 1T98A 1U5TC 3I59A 3GX4X 4GCVA 1C0WA 2O61A 4A0ZA 3R0JA 3OOPA 1WQ2A 3T8RA 4Q5SF 1KQ9A 1FC3A 5FO5A 3I0TA 5DUKA 3GFLA 1R58A 3DQVC 4HYEA 4HBLA 4BH9A 1SAXA 1YFHA 3IRRA 6PAXA 2VE8A 1UHWA 4NB5A 1GXPA 4OIRF 1FBQA 3KZZA 1YW9A 5KK1A 1IZ1A 2H94A 3DF8A 1K7AA 1H9TA 4A0XA 2HTSA 2FE3A 5F6FA 2NNYA 1HSTA 2PQ8A 2XAQA 5LHHA 4B09A 5FB2A 5HLHA 4EM0B 3HRMA 1BIAA 1D8JA 4L18B 3F8CA 1XDUA 4R8HA 3DKWA 4P9UA 1JGSA 1R36A 3ERED 2QYOA 4ASNA 4EGZA 3B02A 5DEQA 1P92A 5DCMA 3AAFA 1KA8A 1FNNA 3ECHA 5FFXA 2DPUA 1QQIA 2ZCWA 3EETA 1KQ0A 2QQBA 1G4DA 1O3RA 4HX7A 2A6HF 4KNYA 3R6SA 3CUQB 4HX4A 1R7JA 2MH2A 3V7CA 5EEGA 2JSCA 3NQOA 3RTRA 2KIMA 3ZMTA 3I59B 2Q0OA 1DPUA 2WV0A 3DPLC 4M6XA 1U2WA 2NYXA 4Y13A 4AD9A 1J59A 1FWZA 3VODA 4M74A 2V1UA 2EK5A 1YIOA 4I09A 3V8LA 4G6DA 2XROA 1REPC 1BI0A 3BPVA 1BI1A 5AIQA 2RGVA 4L9JA 1BIBA 1YQAA 2W25A 3GUDA 2NRAC 2P4WA 1XMKA 4XRFA 2VC1A 2Z3YA 2QENA 3O3KA 3HOSA 4UUVA 4RAYA 3E6MA 2VE9A 1XCBA 3C3WA 2F5DA 2P8TA 4YFKF 2WWYA 1E17A 5D6FA 2DPDA 3JW4A 3QAHA 1P4XA 2XVCA 1BBYA 3RKXA 3P9KA 2OU2A 3WE3A 3QP5A 4MHGA 3U1DA 5ED4A 2FEZA 3NEUA 2W24A 3I64A 3IKVA 4EJTA 3K9TA 4I0BA 2ZKZA 3PQJA 3ZMSA 1ULYA 3IKTA 1K79A 2K02A 4WXDA 3D5LA 1SMTA 1O57A 3GO5A 4K2EA 1Z6RA 4XSZF 4LB6B 4EVIA 3ZPLA 2DK8A 5EEHA 2VXZA 4LLLA 5BS6A 1ZYRF 1K6OA 2QUFA 4B8XA 1S6LA 2GIVA 5BPIA 4OMZA 5CVRA 3FXUA 3GFMA 4KMFA 4EJWA 2CG4A 2QQAA 4RAZA 5LRSA 1HSJA 3KEOA 1TQIA 5LEKA 3HRUA 2M87A 2EFOA 3DXJF 3I71A 2LF8A 4ZYGA 4BYYA 4HF2A 1UFMA 1H0MA 1ZG1A 1WRJA 3HSFA 4S05A 3ZN1A 4A0YA 3WE2A 3D0SA 3U2RA 4LB5A 1P2FA 4EV0A 2M8EA 2UWMA 3TOAA 4HZFA 1MGTA 2A07F 3C18A 2GA2A 1R23A 3M7GA 3EDPA 2D2WA 3M8FA 1Y0UA 1MJ9A 5HS8A 1J9IA 4LK0F 3KETA 2BGCA 4O6JA 3O2PE 2A3SA 4ZH4F 3BJ6A 1FP2A 5E1XA 3QU3A 2HTJA 5CJ9A 4IRGA 3B73A 5HLIA 1W7PA 2ZBKA 5A2QZ 3KP4A 1LVAA 4RB3C 4NHJA 2IPQX 4HV6A 1TW3A 2DQRA 3I4PA 3GYHX 2XKPA 5ICGA 2P5VA 3F6VA 3MEXA 2RVCA 4LJZF 3E3VA 3L9FA 4UXNA 2OQGA 3LA2A 3MWMA 1F1ZA 4L5JA 3JTGA 4U0YA 4IPAA 3IRQA 5TJJA 4ESBA 1F4KA 2O0YA 3W6KB 2UXNA 4U88A 4U7BA 2KJCA 1AWCA 1ZLJA 4RGXA 3JTHA 5DCMB 1ON1A 3ECOA 1S7OA 1F5TA 2DQLA 3TDZC 1AOYA 1EV7A 1ZH5A 1VTNC 1IN8A 2HYFA 5DD4A 2CSOA 1FP1D 2P5LC 1IN6A 2F2EA 3HRTA 4IVNA 5BOXA 1YS6A 5D8LB 2ZFWA 1J0RA 2QZ8A 2XUBA 4HW0A 2PMHA 1GXQA 3EUHA 1OPCA 4IHSA 3FM3A 1O3QA 2Z5UA 3R61A 4IJAA 2R7DA 1P6RA 1XGNA 2D45A 2H27A 1FZPB 3IWFA 4XLNF 5D4SA 3GZ5A 2E1CA 2HZTA 4G9YA 4UV9A 3M8EA 3WG9A 1IF1A 1ZG5A 3BDDA 1I6XA 1ZGAA 4O3MA 2IW5A 4GXOA 1HW2A 4XBFA 4ZYEA 2FA5A 4A6EA 3FZVA 1KU7A 3CO7C 3ABTA 3E6CC 3E6DA 3O6BB 3WGHA 2V79A 1G3WA 2ZMEA 4ON0A 2HDCA 5L3DA 5DDGA 4OINF 4QWQA 3LAPA 3W6JB 5E1ZB 3REOA 2YSRA 3GZ6A 1B4AA 3CJNA 1STZA 3HYIA 1I1GA 1YO5C 1HKSA 2FXAA 4OU0A 3K0LA 1YYVA 3HHHA 2YX4A 4P9FA 2ZO4A 1QBJA 3H3UA 2OD5A 4HLYA 3FXQA 5HS7A 2GQQA 3ZQ7A 2Q8KA 2A69F 4ZZLA 2O8XA 2JT1A 2PMUA 1J2XA 1XDSA 3GFJA 5HDKA 4O5VA 5FGMA 4GYIA 3F72A 1KU2A 4MQVA 4KDPA 5LRRA 2DK5A 1P4WA 2VC0A 2PFBA 4YIFA 3TKYA 5D4RA 1ON2A 1J7KA 1GVJA 5LGUA 2XKOA 3CUOA 2PI0A 5K5RA 4RB1A 1V3FA 1V4RA 3FF5A 4LG0A 2UZKA 2IA0A 2KIFA 4M6YA 3CDHA 3WGGA 3FX3A 2XRNA 3R60A 1FLIA 2BBYA 1G3TA 2Z99A 3P9IA 3MZYA 2YPRA 4ENKA 2HKXA 5IT3A 1IN7A 3I58A 2ELHA 3E97A 4M9ZA 1L3LA 2V1DA 4L0ZB 3EQLF 1QZYA 5DYMA 4BNCA 1W7PB 3J80K 2JPBA 3CUQC 1UHMA 3R4KA 5HLGA 2ZXJA 2JZYA 1F9NA 4HQMA 4LLGF 4AWXB 2FBKA 2LDUA 1UCRA 4DQ2A 4IF4A 3J81K 1FYLA 2P6TA 3TO6A 2GXBA 2G7UA 4DNCA 2HKOA 4ESFA 5L3BA 3LWFA 5FD6A 3F23A 3I5UA 4R1HA 2EV0A 2K86A 2P6SA 2CGPA 2FF4A 4PGGA 3IWZA 4I02A 1HBXG 2PN6A 2FSWA 1QO0D 2L54A 1TBXA 3VFZA 1IAWA 4MQ9F 4RB0A 2XASA 3TDUC 3L2CA 2FMLA 3WTVC 2Y0MA 3TGNA 1LNWA 2P7VB 4P5OA 1ZHFA 3K1MA 1QZZA 3H3ZA 2DBBA 2ADUA 3TO9A 4A6DA 5H6RA 2ACJA 1RUNA 2QWWA 3KE2A 2L4MA 2FMYA 1WI9A 2WTEA 2LNBA 4ETSA 2RQPA 1FYMA 3WTZA 3JSPA 1Z6TA 2EJRA 4U0VA 1CGPA 2FBHA 4UV8A 4CYDA 3JAMZ 2VN2A 1Z91A 5D5VB 2HWVA 2RNJA 1A04A 2YU3A 3T5XA 4OMYA 2MD5A 2G9WA 1EH6A 1YG2A 4WCGA 2L01A 3TO7A 3BP8A 1OYWA 4EMSA 3FMRA 2GA1A 3QRFF 4IHTA 4M9SA 3MFKA 1RIOH 3K1PA 3RPQA 2KIUA 4BXUA 1H9GA 2QBYA 1XSDA 3PFIA 1O3TA 3HTSB 4F7ZA 1IXRC 2F5CA 3Q9VA 1LQ1A 1EH8A 3DEUA 1FSHA 3FHZA 2FU4A 1QNTA 4UVBA 3PQKA 5ILVA 5D8KB 3ZP5A 1FY7A 3SHFA 4PCQA 4H0EA 2HGCA 1KYZA 4KN7X 1BI3A 2CFXA 3EYYA 2RKHA 1QPMA 2PG4A 1R5HA 2DAOA 3LQQA 2IJLA 4I01A 2MA3A 4WX9A 1B6AA 3QOPA 1U5TB 2FNPA 3V8KA 4HDVA 4QLCU 1SFEA 2M45A 3MZHA 2P7CB 4G7OF 1ZRDA 1O3SA 3WTYC 3BZ6A 1D3YA 1JHHA 1SFUA 3ISPA 2M5WA 2EA2A 3GWZA 3T8TA 4G94A 4UVAA 2VODA 1MDMB 3R0AA 4G8XA 1OKRA 2RN7A 2BEOA 1XSVA
chains in the Genus database with same CATH superfamily
2I5UA 2HFHA 2BVMA 4RLFA 1ETVA 2OJED 2HQRA 2VJIA 3QYBA 2XGCA 1PP7U 2V9KA 4L9NA 4DJAA 3IHUA 1R5ID 3GTKJ 4C3JJ 2XIGA 5JHUA 5LGTA 1J5YA 2E7XA 3T1BA 4E6KG 3H1CA 3J7ZI 1MH3A 2ESNA 1OMIA 2CV0A 3Q0UA 2BXZA 2KDZA 4G7ZF 2J5OA 3MCZA 1OCPA 5JFRA 1RC9A 5J40A 1UAAA 4ZC3A 2HOAA 1AKHA 4PZJA 1LDDA 5D5XB 4BHCA 1LB2A 4GDFA 1X3UA 5CVIA 1Z21A 2K9LA 2VBXA 4MEYF 1IGNA 2CUEA 4CHUA 2HS5A 3TP3A 1SMYF 4GO1A 1Z7LA 2L9RA 3DCFA 2NVYJ 2R92J 4MLOA 4A5MA 3GTJJ 4MTEA 4A2UA 5F08A 3G6EI 3MMYB 2A5YB 4UVCA 4E7JA 4C9YA 3ZMDA 1FOKA 2OUMA 4PGHA 1VQ4I 5EYRA 5GAGJ 2F5EA 2Q1ZB 2KPMA 3OV8A 4M9XA 3M1EA 3SZGA 1ITYA 4CH7A 4XLFA 2X4HA 3KFWX 1GDTA 5CVJA 1JE8A 2ICWG 1L0OC 5E1WA 1B59A 1OCZH 2FBIA 4BEHA 3S1MJ 2B0LA 2LSOA 5ICCA 1U9NA 5K5QA 5H2FC 2RNGA 1S29A 3JRHA 4IQJA 2NS0A 5HVQC 3BJOA 3GMEA 3BG6A 1VFCA 2OCEA 1B9MA 1K61A 2IAIA 4XONA 1OCTC 1EH7A 2K4JA 4U0WA 3LA3A 4L9TA 3FXOA 4S0HB 3GW2A 4JYKA 5AONA 1LEBA 2EFWA 2KDOA 2JRTA 2GZWA 2Y75A 4FQGA 1U78A 1R5GA 3KLNA 2BE5F 4M3FA 1R1VA 5ICFA 1MMAA 1JXSA 2WBMA 3QODA 5CVUA 1ETYA 4HLXA 1OYYA 3EUHC 4HOBA 4N9IA 2IGNA 1IN4A 3L09A 3NARA 3V8JA 2LG4A 1USTA 2DA4A 3RKQA 1RUOA 2EV6A 4PJMA 4E7ZA 3C7JA 4CCKA 3RPUA 3W2VA 4OIOF 3G1MA 3G1OA 1OCCH 1UELB 1E3OC 3H0GJ 3CD6I 2CWEA 3CLOA 4ZYAA 2E7WA 2M34A 1USSA 4CA0A 4F3QA 1KU9A 2O6GE 1R6RA 1POGA 1I6HJ 4AIKA 2IGKA 2DFFA 3HSRA 1SVLA 1E2XA 1X1AA 5DM6F 3CQZJ 2DMPA 3S16J 4BUPA 1DP7P 5C44J 1I1SA 2LKSA 4JP0A 1MDMA 1FYKA 1GHCA 1B1BA 1X1BA 2EFNA 3BCAA 4MIMA 1IO2A 1V5GA 5D6EA 3KP5A 4RB2C 3L2VA 1R4NB 4F91B 2XAGA 2HEOA 2R7XA 1YW7A 5L3FA 4LK1F 2R7FA 4B3AA 4I7HA 1YITI 1BN5A 2HQAA 4WXHA 5H6QA 3BC8A 3BPXA 1D0XA 3WTXC 1BA5A 3CC7I 1OR7A 3P9CA 5CYVA 2DA1A 3TQNA 1Y0NA 1V5EA 1LUJB 2OZ6A 1BC7C 3B6CA 2YX7A 3V7SA 3I9V2 1YTYA 3J7AO 2GLOA 1XGOA 2BW3B 2W1OA 2CMPA 3LSTA 2CW0F 3BQYA 2B9SA 4CO8A 2DFIA 1UG2A 3WTWC 5E8GA 3OYCA 1DGRM 1YRNA 2VQHA 4BGDA 3PO3J 4QPOA 1Y1VJ 3JSOA 3G73A 1I3AA 2YR2A 1BOBA 4XQFA 5JHFA 1V55H 5BPDA 4OIPF 1Z7UA 1QGPA 3F3XA 4X6AJ 3AFHA 4FTHA 2HPIA 5DTDA 4G7HF 3FWEA 2GIZA 1T2KA 1IN5A 2CW8A 1YS7A 5GP9A 3CMEI 4D1QA 3M1CA 2QLZA 2XGDA 4EJVA 2TRTA 2H1KA 4Q4ZF 1MJAA 3CTAA 1X19A 3VEPA 2QEXI 1U5TA 1MBFA 1Z77A 4UHTA 1T38A 4DOZA 1ETQA 4II3A 2ESHA 1APLC 1BR4A 3O8GA 2VONA 5F0HA 1LDKB 1ZRFA 3HHGA 1UZCA 4HPQA 2KRFA 3KZYA 5J47A 2VXDA 2CW7A 3IL2A 3K7AJ 1MBEA 3DFGA 3CCQI 2KKOA 3L2RA 3M9AA 2D1HA 1W5TA 1W7PD 2F5FA 4MNUA 1G3SA 1ETOA 2JA6J 5M5WJ 1YLFA 2M2EA 1TQMA 3V7RA 3I53A 1ONVA 2J5PA 3H36A 4XSXF 2NNNA 1VQ6I 2ZJRF 1DPRA 3SZPA 2A6EF 2DN0A 1Z67A 3F6OA 2DT7B 5JVTA 1JUPA 2OTJI 2KZVA 1S7AA 1PUEE 3UNGC 3HDDA 1XSXA 4BE0A 2ELKA 3KEYA 2VBZA 4YFXF 3FIWA 5J8CA 5L3CA 1SD7A 2XDVA 3S15J 2EZKA 1NG7A 3PL8A 1HQCA 5ICEA 4HRIA 4FX4A 2K27A 2MYSA 2X6YA 3DU6A 2HVSA 1GUUA 3AG1H 1XD7A 3E5QA 5IY5H 4OWRB 1T95A 2L7MP 4RAGA 1BC8C 5HDNA 1MMSA 2P5KA 2IA2A 4IQ4A 3OR2C 4RDUA 3GTPJ 5M5YJ 3S3NA 1IW7F 2PLYA 5CVVA 2RAEA 1O7LA 2BHZA 1HXDA 1ZN2A 3QU6A 5TRDA 1VQ9I 4M3BA 3I3LA 5AIPA 4D0PA 4D7NA 2L0KA 2L02A 4KA4A 3HOVJ 2K3FA 4LMYA 3CCMI 2PJRA 3GTQJ 2E71A 2ZXIA 3I4NJ 2QA4I 2LVSA 2B7EA 2D1VA 3ZQGA 3JRIA 2ZMEB 4L9VA 3KP3A 4YRVA 1XGSA 2EFQA 4RMNA 2AXLA 3CCEI 2EB7A 1WSUA 5LBQA 2XSJC 1BJZA 4V2GA 4F55A 3N4MA 4MGRA 4L0YB 4KIBA 3HEFA 3OYHA 4J00A 4ZDOA 3B6AA 1GT0C 5FLXZ 4A12A 5DD8A 3LSMA 3HC7A 3WTTC 3LNQA 4RS8A 2UV1A 5BNGA 2NOGA 3WTSC 3DWLE 3OY9A 1CF7B 2K85A 3WGIA 4BQOA 1VQ5I 2PBIA 1LKXA 4XLCA 3CMMA 3HOWJ 4CUGA 3A1YA 5CLSA 4BKXA 4E7LA 2F4OB 4B44A 4DZPA 1LPQA 3Q9SA 3JCUC 2ZNYA 5IT9K 2EFPA 1TWHJ 2GWRA 2V1NA 3CCSI 3S3MA 3BROA 1FX7A 4KIFA 2XAUA 1V5FA 4U7DA 4HX8A 1PUFA 1E0EA 1BM9A 4M71A 1WJCA 5FRMA 4HNVA 5CPRB 3GLXA 2KJBA 5J8FA 2HOEA 3COAC 3GF2A 1JKPC 2OAZA 4NQWA 3OYEA 4UB8C 5GPCA 2W85A 1W4MA 1T39A 4GRIA 3TW7A 1Y6IA 2LK2A 4YFNF 1JT6A 1BJAA 5K7ZA 2HI3A 1XCVA 1UG0A 2MBFA 4XRSA 3FMQA 3S2WA 1X1PA 5E17F 3KEQA 5KHDA 4I99C 4KN4X 2VBWA 2A61A 3DP7A 1LJ9A 2JVGA 1JHFA 5J3LA 1XGMA 3JRBA 5IYDJ 5LEJA 3DLLF 3JRAA 1MD0A 3ASNH 2O3FA 3W2AA 3G1LA 1IRZA 5B66C 1K4TA 1R00A 1JUSA 2DFEA 4ENMA 2XAHA 5HNFA 5IP7J 2ISZA 3G71I 1W1WE 2DLLA 3HUGA 4EJOA 4ZYDA 2QBYB 1G2HA 2VB6A 3ULQB 2M30A 2CYYA 1KYWA 2AQEA 2AO9A 4BHPA 3FISA 2TDXA 3JRDA 2D5VA 2A6TA 5A2QK 3GFIA 4CZZA 5HS9A 1SEUA 3C2BA 3OS0A 2DMNA 3AKZA 2K4BA 3P5JA 4C2MJ 5M5XJ 5K1YA 1B8IA 2COBA 3G3ZA 4XK4A 2RQQA 4KICA 2KQRA 3IC7A 3PUFA 1WH5A 5FKKA 1TW2A 2L7FP 2FOKA 2L3DA 1IUFA 4KJZA 3D1NI 3QQAA 2UXXA 1FOYA 3MQ0A 1TWAJ 3LFKA 2ZNZA 2IVMA 4YIIA 1KZHA 4AIDA 3DLAA 1BW5A 2ZSIB 4HSRA 3L2WA 1EJ9A 1ETXA 2Y9YA 2DYSH 2LBFB 4OIQF 2WAEA 3DV8A 2NVQJ 4LLNA 1MBHA 4BJTA 1ZGJA 5LLQA 4G6TB 1RNLA 1T0FA 3PSIA 1IXSB 3HM5A 3A2KA 1HW1A 2PMZN 4P96A 3GXOA 1ZG3A 1HKTA 4MFEA 2X1DA 4IO9F 4HQEA 4XICA 4A3BJ 5LHIA 1XN7A 3MVPA 3L2UA 3N05A 3OYJA 3BG5A 1E3HA 2GOMA 5DCFA 4I6ZA 1ACIA 1DUXC 3QOEA 5JLWA 4A93J 2LRDA 1VQPI 1SD5A 5DUIA 2K5CA 1UHSA 4Z2YA 2MLGA 4LGWA 2WA0A 3HTUA 1TP4A 2DTRA 2W84A 1ZLKA 2FQ3A 4UY8I 2XAFA 3F8BA 3Q0WA 3ZQIA 1Y1WJ 3K69A 3MAJA 1TNTA 1TT0A 3WTUC 4LD5A 1UB9A 2E19A 4A3KJ 2PJPA 4E7KA 1UJ8A 3E7LA 4W1UA 5KVRA 1T08B 1Z9CA 2GM4A 4QSHA 1NHAA 2CO5A 2VKVA 1U8RA 3I54A 2V9VA 2PMZA 3GLLA 1BOAA 2DI3A 1WKMA 4ESJA 4EQQA 2RV8A 1QRYA 5J4VA 2LC2A 2R93J 1BR1A 1TNSA 5L3GA 3L1PA 3HOYJ 3DPUA 3LA7A 3SEZA 1NK2P 2EV5A 4M72A 2NAZA 3RDIA 3T0YA 1VQ7I 2XB5A 2H1LA 2IS6A 2R7ZJ 3AG3H 1VZ0A 4I98B 5FJ8J 4Y3OA 2R7OA 1ZAOA 1Y8QB 1PP8F 1Q1HA 3A0HC 4RBOA 2WY8Q 3LAJA 5L3EA 2R7UA 3HL2A 5IOZA 3GTMJ 3E6BA 4Y15A 2DJIA 1Z1DA 2X6OA 1RI7A 1WPKA 2EA4A 1HLVA 4Y17A 2L9VA 2KZGA 3X2QH 1OYIA 2XV4S 2YUSA 2DA6A 1R22A 3FKIJ 1ZRCA 5F1JA 2Q2EA 4XN3A 5FFZA 3ABUA 1G59A 3BTJA 3HPGA 3SQNA 2L4AA 3A03A 5EZGA 5GTHC 3GTGJ 2XC7A 1FMWA 2R3SA 3MZ8A 3NWSA 4JBAA 3RKYA 1IUYA 1FBSA 2VT3A 5J6XA 4G6QA 1XB4A 2MLKA 4FETA 2DMUA 2IA1A 2X0LA 4WF2A 1CF7A 4GYGA 1LFPA 3VOEA 3WU1B 1TWCJ 2V6CA 2R5YB 2R7SA 2ISYA 2M7AA 3K2AA 2AS5F 2MH9A 1RPWA 2EH3A 1ZR2A 4IHXA 2Z1DA 1FMVA 2EQRA 3FM5A 1FTZA 3IAS2 5B3SH 5F1RA 2HOSA 3J7AY 3VYUB 2EWNA 2VOPA 5ERIA 3RYRA 3L2QA 3ABMH 3KP6A 2K3PA 1GV5A 3CUQA 1ZREA 1U9OA 1B9NA 4C3IJ 2WAQN 3BR0A 4PJLA 2XPUA 3KP2A 2M1BA 3J80Z 1KONA 3QPHA 3K4CA 3LSPA 2F48A 3FMSA 1A5JA 5CQGA 4KFCA 1HDDC 1DDNA 2GAUA 3CCVI 2JMWA 3ZQLA 4NC8A 2F4MB 4J01A 1WWXA 3F22A 2N8GA 3LSKA 3DTIA 4IRIA 1RKWA 3TP0A 3DTKA 2CFOA 2LMDA 4XKBA 1MBJA 5ILUA 4BHBA 4HNTA 3V4GA 4JK1X 4D7MA 2DXIA 1W5SA 3RJPA 1WGXA 2IS1A 1XTAA 3CJRB 2FRHA 2DO7A 4HF1A 1N78A 5HLTA 4MTDA 4AIHA 4RM2A 1ZKGA 3D5SC 2GXGA 2ETHA 3RQ4A 3IAM2 3IV5A 4M73A 2VPRA 4JOMA 1V54H 4E70A 3M07A 4PFOA 3CP2A 3H92A 4I2OA 3CLQA 4ZYHA 3RKWA 4UUTA 2KIQA 3QPTA 3QPSA 4KMUX 4RGRA 1TTYA 3HZJA 4XLPF 5D5UB 3HSEA 5JI6A 3ELKA 1MJBA 4OOIA 2MC3A 4KIGA 1G6NA 1SFXA 4FT8A 1QPIA 3CF2A 2Y48A 1RZ4A 4N9HA 1R1TA 2VOOA 2BV6A 5B1AH 2ECCA 2R7TA 2DT5A 5HODA 3MN2A 5DS9A 1R1UA 3SFZA 1BI2A 2O5RA 4ENNA 1HKQA 3DEEA 4YG2F 2QVOA 4BQAA 1P9QC 4Q47A 4JX6A 3UKGA 5LHGA 2RC4A 2FX0A 3BR6A 3C2GA 3ZMZA 5IT9Z 2LY2A 3OYAA 5H20A 1I39A 2CUJA 1VF9A 4XLEA 1U3EM 5GTIC 3EPZA 2FJ1A 2STTA 4P55A 2COMA 2IP2A 3E5XA 4HAMA 4WWCA 3ROUA 2BZTA 1N77A 1U6GA 1H8AC 3HXLA 2JA8J 3OYBA 3C1DA 5DV5A 5FD5A 2Z33A 3HRSA 1YJWI 1OLTA 2P0WA 4HA8A 1IXCA 2K9MA 1R9TJ 3S2HJ 2VKDA 2QM3A 5JR3A 1QHGA 3DU5A 4BS9A 4UUSA 5EEAA 4KT5C 1A31A 4JX4A 5F64A 2NOJB 1RETA 1T6SA 1SD6A 4KUMA 5E18F 3HOTA 4NQWB 3S1NJ 3GEZA 3Q5FA 2W57A 1W0UA 3RYPA 5K5OA 4V19K 4HEA2 4ABZA 4FX0A 2R0QC 1WVRA 4WK8F 2VBYA 3LQRA 3GTOJ 1S8NA 3F9KA 1LEAA 4EGYA 1NK3P 2MABA 4JQFA 4UNOA 3KLOA 3JAMK 2VIXA 1IDZA 5FKNA 4OAZA 3OR1C 1OCRH 2E35A 3L00A 1K78B 4BJ5C 2WC2A 5E20A 1XPXA 4MEXF 1ETWA 2R7VA 4A5NA 1OISA 3OYKA 2XPWA 3K2ZA 3EYIA 2M4KA 3CJTB 3WODF 4CICA 1TLHB 4RGUA 2BY1A 1MZBA 1FPQA 2HXOA 3OL3A 2XGXA 1IRGA 3E5UA 2DU9A 4IRHA 2A68F 4QIWN 2Z9OA 1J09A 3NRVA 3G4SI 3K1NA 1JKQC 1Z05A 2RDPA 2X48A 3CC4I 2HYGD 3BOQA 4PDKA 1NH3A 3TOBA 4KYWA 4B1RA 2KFDA 3OYLA 1ZQ3P 1KU3A 1IG7A 2CQKA 2LKPA 5LGNA 1AHDP 5HDGA 2OV7A 3GCMA 4LOCA 2WY7Q 4EJUA 1JTXA 2OZUA 2A5WA 2MFZA 2DW4A 3ZMUA 4IXAA 4II2A 3BWGA 3ML6A 2PX9A 4C2TA 2FOWA 3FBNB 1IRFA 5ILSA 4IOCF 3CO6C 1FSEA 5KCMA 4LFUA 1KQ8A 4NNJA 5FLXK 3RI4A 1Y8RB 4AVPA 3KP7A 3RZOJ 2LBFA 2KL4A 2RREA 4RAFA 4RGSA 4EM2A 3HOUJ 2IT0A 1XX5A 3F8NA 2VT2A 3TL4X 2BYVE 2KISA 4GGGA 4ZDPA 2L7ZA 4PFPA 3P7NA 4Y7NJ 2IGOA 2HQNA 1FT9A 1K6YA 2G7HA 3HIFA 1TQPA 4AUXA 4ZDLA 1KGSA 2JTVA 4CYCB 2XHKA 5EZHA 5C3EJ 4IL6C 4NBQA 2IRFG 1D8KA 2O03A 4FE4A 1ZELA 3K4NA 1X2NA 1X3ZB 3CCYA 3F8MA 4CDGA 1VQLI 5E8IA 2GBYA 2V1XA 4CSWA 3F8FA 2EILH 5EJCA 1EA3A 1FBUA 5CQEA 1ZARA 2EINH 3AG4H 2JWTA 2OA4A 2JPCA 2H6BA 4A3IJ 1EKEA 1G3YA 5E3NA 2H09A 3ZN0A 2LYCA 3F21A 2R7QA 1DU0A 2TCTA 5IYBJ 2M8GX 1WJFA 1I27A 1YW8A 3QP6A 4FHTA 4CXFA 1RESA 4FE7A 4HV5A 2MSYA 2OQRA 3SXYA 4N0BA 3FK7A 4BBRJ 4UB6C 4R79A 4LG0B 4S04A 2K9NA 3L7WA 1K78A 1YJNI 4RM3A 1S3JA 3BJAA 3KCCA 4HDUA 1MKMA 4CGZA 1D5VA 3SZTA 3S3OA 3JREA 2CU7A 3VSKA 4AU7A 1PDNC 3BTCA 3UR3C 4ENJA 1LE8B 1I5ZA 3ESWB 2H6CA 5BMZA 2PEXA 4Q48A 2HR3A 2LF7A 1VI0A 1SD4A 3GVAA 5BQTA 1W5CC 4I0AA 2VKEA 3BQZA 4BAYA 3VDXA 3ZMVA 1AKHB 3DPTA 4QTRA 1HOMA 4CCMA 2WADA 3J81Z 2E2HJ 3HOZJ 2C6YA 2E1NA 2OBPA 3U9GA 3LSJA 2EPFA 1TZLA 3OYIA 1P4AA 3ZQHA 3V42A 1LDJA 2QSFX 2O7OA 2B63J 1FJLA 2LY9A 2XAJA 4EM1A 3WG7H 3WU0A 2STWA 3FXRA 2ZJ2A 4TV7A 2E1MC 3PM1A 4ZZDA 2CQXA 3TEDA 2ZB9A 4AIJA 2K7LA 1RR7A 1HW5A 1J75A 5HOOA 4M3DA 3CJQB 3N97A 1XMAA 2EIMH 4L5IA 2QKMB 5D5WB 2FNAA 3VB2A 2IBDA 3IH3A 4ZTJA 3H5RA 3OYFA 3A02A 4WXCA 3LMMA 4HF0A 3BCBA 5J1RA 4GFBA 4Z6YA 2NS7A 2QQ9A 4C2UA 3BY6A 1ODDA 2JVHA 2W00A 3RIRA 1O7FA 5K7HA 2ZJQF 1YE9A 3ZGKA 3WHBA 1YI2I 3EUKL 1T98A 2CRGA 4PJNA 1U5TC 2KHMA 2MW8A 3I59A 1OFCX 3GX4X 1A35A 2X51A 3JR9A 2HQ5A 5HNHA 2DT6A 4GCVA 3MKZA 1C0WA 1PJRA 1WI3A 2O61A 3J7YJ 2ZXWH 2ME6A 4BE1A 4A0ZA 1E3PA 3SJMA 2QCOA 3R0JA 5CKTA 3OOPA 2X1EA 2E1MB 3BG3A 2VJ4A 2M3AA 5J1YA 1WQ2A 3T8RA 2NS8A 3KPHA 4Q5SF 1A6IA 5F27A 4IKFA 1KQ9A 2ID3A 1ZR4A 3OIPA 1FC3A 4DBQA 5FO5A 3I0TA 5DUKA 3S32A 3GFLA 1NTCA 2Y2ZA 3HKZN 1AA7A 1R58A 4BDZA 3DQVC 3KIOA 4HYEA 4HBLA 2K9SA 3EUAA 4BH9A 1SAXA 1YFHA 3IRRA 6PAXA 2VE8A 4B47A 5GPAA 1UHWA 2X6XA 3BG7A 4NB5A 1XS9A 4YELA 1GXPA 4OIRF 1FBQA 4B4CA 5IYCJ 3KZZA 3K6GA 5IP9J 2CJJA 3ZQFA 1YW9A 4CCLA 5KK1A 1IZ1A 2H94A 3GBGA 4MO7A 2XGEA 3DF8A 1DGWY 3OYDA 1K7AA 1H9TA 4A0XA 2HTSA 2FE3A 5F6FA 2H8RA 2NNYA 1WJEA 1HSTA 2PQ8A 3JRCA 2XAQA 4A3LJ 3LFUA 3RPUD 5LHHA 4DBRA 4B09A 2VQLA 5B5EC 5FB2A 5HLHA 1G8XA 4EM0B 1ZK8A 3HRMA 1BIAA 2R7RA 1D8JA 4L18B 3F8CA 5LFAA 1XDUA 2LKXA 4R8HA 3DKWA 4P9UA 1JGSA 2ZJPF 3IP4B 4PJ0C 1JJ6C 2L2OA 1R36A 3ERED 2QYOA 4ASNA 4E4HA 3HGYA 4EGZA 4FASD 1QU3A 3B02A 3PJRA 5DEQA 1P92A 2Z2SB 5DCMA 1OJLA 3H5NA 3TW6A 3AAFA 3FDYA 1KA8A 1FNNA 3OYNA 5C4JJ 3ECHA 5FFXA 2IS2A 3W6VA 2Q2EB 2F4IA 2DPUA 1QQIA 2ZCWA 3EETA 4XNFA 1KQ0A 4ZJZA 2QQBA 2M4GA 3FXJA 1G4DA 3CMAI 2W48A 2KP6A 1O3RA 4HX7A 3PIPF 1ENHA 2A6HF 1Y39A 1MH4A 4KNYA 2UUZA 3R6SA 3CUQB 4HX4A 1R7JA 2MH2A 3V7CA 2XSDC 4XLHA 4CCNA 1R71A 5EEGA 2JSCA 4RLQA 3NQOA 3RTRA 2KIMA 2EZIA 3ZMTA 2HOTA 1LFBA 3I59B 2Q0OA 1DPUA 3CZ6A 2WV0A 3DPLC 3KYCB 4M6XA 3H0DA 1U2WA 2NYXA 3ZQCA 2DMTA 4Y13A 4AD9A 1W0TA 1J59A 4U87A 1FWZA 3OS1A 3GTLJ 1TWGJ 1BW6A 1D0ZA 3RZDJ 2HPMA 2LR8A 3AL0B 3VODA 4M74A 3VWBA 3G2BA 3BZKA 3W2WA 2V1UA 2JSPA 2EK5A 1PVEA 1YIOA 4P1WA 5FKOA 4I09A 3E1SA 2G0EA 3V8LA 4N4OB 4G6DA 3H35A 4BQNA 1WJBA 2LP0A 2XROA 2VJ5A 1BI0A 1REPC 2QGUA 3BPVA 1BI1A 5AIQA 2RGVA 4L9JA 3ZXSA 2XPVA 1BIBA 1YQAA 2W25A 3GUDA 2NRAC 2M9HA 2FD5A 3Q0VA 2P4WA 1XMKA 4DYQA 1WJ5A 2X85A 4XRFA 2VC1A 3OL4A 2Z3YA 2XRLA 2QENA 3H3VK 1D1CA 3DBRB 2W7NA 2FUG2 3O3KA 3HOSA 4UUVA 3HKZA 2NVUB 2IEKA 4A3FJ 1NG6A 3H9JA 4RAYA 3E6MA 1MNEA 2VE9A 1XCBA 2VASA 3ASOH 3C3WA 3IH4A 2M7BA 3ZCOA 2F5DA 1YOVB 2P8TA 3OSFA 3TBIA 4YFKF 2WWYA 1E17A 1MNMC 1HDPA 3S8PA 4XKCA 5D6FA 5M3MJ 2DPDA 4BXXJ 3BT9A 2CV1A 5E3OA 3JW4A 3QAHA 1P4XA 2XVCA 4XRMA 1BBYA 2IXSA 1CQTA 4C3HJ 3PIOF 3LSHA 3RKXA 2R4GA 4NDLA 3P9KA 2OU2A 3S93A 3WE3A 4XR6A 3QP5A 4MHGA 2BHYA 4IX7A 1DP3A 3U1DA 5ED4A 1T33A 2FEZA 1WH7A 4A3JJ 3NEUA 3IUOA 2W24A 3I64A 3IKVA 4EJTA 3K9TA 4I0BA 2ZKZA 1YHQI 3PQJA 3ZMSA 1ULYA 3IKTA 5E79C 3HOXJ 1K79A 2CUFA 2V4JC 1SFOJ 1FOWA 2K02A 3I4MJ 4WXDA 3D5LA 2ZMEC 1SMTA 1O57A 3GO5A 4K2EA 3CP8A 2HU9A 3F0CA 1Z6RA 4XSZF 1I50J 4LB6B 2LH9A 4EVIA 3ZPLA 2DK8A 5EEHA 2VXZA 4LLLA 5BS6A 2X9DA 1ZYRF 4Y4RA 1K6OA 3BR1A 2QUFA 4B8XA 1VQNI 1S6LA 2GIVA 5BPIA 4OMZA 4A69C 5CVRA 3FXUA 2FQ4A 4CZCA 1H89C 2XF5A 1X3WB 3GFMA 4KMFA 2EZLA 2QQ8A 3ONQA 3S14J 4EJWA 2HNHA 2CG4A 2QQAA 3H5AA 4RAZA 2O9LA 5LRSA 1HSJA 1U0JA 2ELJA 2XF7A 3KEOA 3PSFA 2R5YA 1TQIA 5LEKA 4PK4A 3HRUA 2M87A 2EFOA 3DXJF 4Y33A 4XM3A 4BY1J 3VSLA 2ME0A 3I71A 1WJAA 2LF8A 1X58A 4I76A 4ZYGA 4BYYA 5GAEJ 4HF2A 1UFMA 3U1KA 1H0MA 2L7KA 1SC7A 9ANTA 1ZG1A 1WRJA 3HSFA 4S05A 3VYSB 3ZN1A 4A0YA 3WE2A 3D0SA 3U2RA 4LB5A 1BL0A 1P2FA 4LITA 2E60A 4EV0A 2M8EA 1Z3YA 3FXKA 2YS9A 2UWMA 2Y30A 2DA2A 3TOAA 4E7IA 4CCOA 4HZFA 3CCRI 1MGTA 1MMDA 2A07F 3C18A 2DJNA 2GA2A 1R23A 2BY0A 5JLXA 3M7GA 3EDPA 2D2WA 3FK6A 4X0GA 2KMUA 1BR2A 4YIRX 1FOXA 4AYBN 3TMOA 1YJ9I 3M8FA 1Y0UA 4NC6A 1PUFB 1MJ9A 3M8JA 2L5QA 5HS8A 4C30A 1J9IA 2XF6A 2JUCA 2NVXJ 4LK0F 3CDIA 3KETA 3M3YJ 2BGCA 4M3GA 4O6JA 5FKLA 3K4JA 3O2PE 4XL9A 3SEQA 1I3QJ 2A3SA 4ZH4F 5J4YA 1EF4A 3BR5A 3BJ6A 1Y56A 3FXMA 2DOAA 1FP2A 1GVDA 5E1XA 1HC8A 3QU3A 2HTJA 1WJDA 5TISC 5CJ9A 4IRGA 3B73A 2EBIA 3KX2A 5HLIA 1W7PA 2ZBKA 5A2QZ 3KP4A 1LVAA 4RB3C 5FKMA 3PFYA 1PYVA 4NHJA 3D5RC 2IPQX 4HV6A 4BY7J 5GADJ 1TW3A 2DQRA 4L5EA 3I4PA 3FHNA 3GYHX 2XKPA 1T56A 2ID6A 5ICGA 1FIPA 2P5VA 3F6VA 2WV1A 1IDYA 3MEXA 2RVCA 2VPLA 4LJZF 3E3VA 4DIQA 3L9FA 2X1CA 4UXNA 2H8WA 2OQGA 3LA2A 5J1UA 3MWMA 1F1ZA 3HB9A 4L5JA 3JTGA 2E5ZA 4BXFA 4U0YA 1H88C 4IPAA 3OYMA 3IRQA 5TJJA 4D9JA 4ESBA 1F4KA 2O0YA 3W6KB 2UXNA 4U88A 4U7BA 1HA8A 1TWFJ 2KJCA 4H4KC 1AWCA 1ZLJA 4RGXA 3JTHA 4AM3A 5DCMB 2V6EA 5JVGF 1ON1A 3ECOA 1S7OA 1SVMA 2DFHA 4PSWA 1F5TA 2MC4A 3CC2I 2Y31A 2DQLA 3TDZC 4M3EA 4BEHB 1AOYA 1EV7A 1ZH5A 1A36A 4EATA 1VTNC 1IN8A 2HYFA 1R49A 5DD4A 2CSOA 3ZQQA 3LSIA 1FP1D 2P5LC 1IN6A 2JA5J 2F2EA 3HRTA 2WB1A 3JRFA 3FKJA 4IVNA 2L9NA 2DODA 4HG2A 5BOXA 1D5YA 1YS6A 5D8LB 2ZFWA 3HG9A 1J0RA 2QZ8A 2XUBA 4XN0A 5F0FA 3S1QJ 3DBLB 4HW0A 4IEJA 4XOPA 2PMHA 2CQ7A 2JJ7A 3S2DJ 1GXQA 3EUHA 3LL7A 2WAQA 3HGGA 1SAUA 3ZR8X 4IZZA 2GXAA 1M1EB 1OPCA 1D0YA 4IHSA 1X4OA 2JN6A 2O8KA 1IC8A 3FM3A 2JUGA 1O3QA 2ZFUA 2Z5UA 3R61A 4IJAA 2R7DA 1XG1A 3QYEA 1P6RA 1XGNA 2CUZA 2D45A 2H27A 1FZPB 4A3DJ 3IWFA 4XLNF 3OYGA 1WZ2A 3OIOA 5D4SA 2QF7A 3GZ5A 2E1CA 2HZTA 4G9YA 3BZCA 4UV9A 1YX5A 2BY3A 3M8EA 3WG9A 5KAFC 1IF1A 2VQCA 2HDWA 1ZG5A 2XB0X 3BDDA 1I6XA 4E7SA 1ZGAA 4O3MA 2IW5A 3HBLA 4XMYA 4GXOA 1HW2A 1X4PA 4XBFA 4ZYEA 2FA5A 4A6EA 3FZVA 2DDAA 3GZNB 4BU2A 4CYCA 3CO7C 1KU7A 1JKOC 3ABTA 3K70C 3E6CC 2LTPA 3E6DA 3KYLA 1P7JA 3ABKH 3O6BB 4DYRA 2MG4A 3OOUA 2W82A 1MIJA 3WGHA 1QZEA 2V79A 1G3WA 2ZMEA 2GOXB 4ON0A 2ZXHA 1WFXA 2CQNA 2HDCA 5L3DA 3OS2A 3A01B 5DDGA 4OINF 1JJ8C 4QWQA 3LAPA 3W6JB 5E1ZB 1ETKA 1SFKA 3REOA 1T0FC 4BJ6C 2YSRA 4XLAA 3S17J 1ZTRA 2JRMA 3GZ6A 1B4AA 4YEJA 1LE8A 3CJNA 4IHYA 2VQGA 1STZA 3HYIA 1TL8A 3K10A 2NXNB 4BDYA 1I1GA 1VQMI 2A05A 2HVRA 4F93B 2HZDA 1HKSA 2FXAA 1YO5C 3SYTA 5KNLA 2LFBA 3BG9A 3K0LA 4OU0A 1GV2A 1O4XA 2QSHX 4UUSB 1YYVA 1YRNB 4BBSJ 2IS4A 4XORA 3HHHA 2YX4A 4P9FA 1LVKA 2ZO4A 2DCEA 4F52A 2YU9J 1JGGA 1QBJA 3H3UA 3K4BA 2OD5A 5GAHJ 2EZHA 4D5CA 4HLYA 3FXQA 5HS7A 2GQQA 5M3FJ 3ZQ7A 2Q8KA 2A69F 2F5VA 4ZZLA 2O8XA 2LY1A 2JT1A 3RSNA 2PMUA 3PUBA 1JKRC 1J2XA 5IPAA 4LG3A 1XDSA 3OWTA 4E7HA 3GFJA 5HDKA 1K83J 4O5VA 4BQQA 3PNYA 2DA7A 1D1BA 1K4SA 5FGMA 4FISA 4KITB 4GYIA 3SFIA 2JQ7A 3F72A 5IOYA 4AC0A 3VYTB 1MW7A 1KU2A 2HXIA 4MQVA 3AL0C 1RKTA 4KDPA 5FRNA 5LRRA 1QA6A 1LFUP 1D1AA 3O8HA 2DK5A 1P4WA 2VC0A 2PFBA 4YIFA 4PJJA 4B43A 1MNDA 3TKYA 5KAIC 3E0JB 1P7IA 2CS3A 5D4RA 3NWTA 1ON2A 1J7KA 3K4LA 3FBIB 4LIVA 1GVJA 2VL8A 1FIAA 2EIKH 2MD0A 3HJEA 5LGUA 2P81A 2XKOA 3CUOA 1TT5B 1SANA 5K5RA 2PI0A 4RB1A 1V3FA 1V4RA 3BTIA 3FF5A 4LG0A 4NUBA 2UZKA 2HDDA 2IA0A 2KIFA 4M6YA 2K40A 3ABLH 1Z0XA 1ZGWA 3C2HA 4JX5A 2PJRB 2VKHA 3CDHA 2WAFA 4A3GJ 3ZRGA 5DM7F 3M4OJ 3WGGA 3PNTA 3FX3A 3OIQA 4AYBA 1XMXA 2KLOA 2XRNA 3R60A 2V26A 4D5FA 1FLIA 2BBYA 2R5ZB 1G3TA 4A3CJ 3MD2A 1X1DA 2Z99A 4DYCA 1JTYA 4KISA 3P9IA 1AU7A 1VNDA 2JK3A 4MFDA 3MZYA 2YPRA 4ENKA 2HKXA 4B48A 5IT3A 1IN7A 3I58A 3VYRB 2ELHA 3E97A 3PNVA 2DMQA 1GLNA 4M9ZA 3JRGA 2BW3A 1RRJA 1L3LA 2V1DA 5FROA 4L0ZB 4IHWA 2HYJA 3EQLF 4BACA 1QVTA 1F43A 1QZYA 4LIUA 4G12A 3CDLA 5DYMA 1B72A 4BNCA 1W7PB 3J80K 2JPBA 3CUQC 2BOLA 1UHMA 3R4KA 5HLGA 2ZXJA 2JZYA 1F9NA 3RCOA 4Y52J 3MKYB 4HQMA 4LLGF 2LOOA 4AWXB 2FBKA 1QHHD 2LDUA 2K9QA 4DW6A 1UCRA 4V2FA 2ZSHB 4ANJA 4DQ2A 1QVUA 4IF4A 3J81K 1FYLA 2P6TA 3TO6A 2GXBA 2BY2A 4XOTA 2G7UA 3HUGB 2EIJH 4DNCA 3ERMA 2HKOA 3WHCA 4BE2A 4ESFA 1HF0A 4M6VA 5L3BA 3LWFA 2Z16A 5FD6A 2BXYA 3AG2H 2E5NA 3F23A 1SVOA 3I5UA 4R1HA 4EEFG 2E34A 2I10A 2ZC2A 2EV0A 2K86A 2P6SA 2CGPA 4J19A 5EG0A 1DU6A 1B8IB 3Q3SA 2FF4A 4PGGA 2CH0A 3IWZA 4I02A 1U8BA 3DTEA 5IP6A 3H9QA 1HBXG 1A6QA 2WB1N 2M0MA 2PN6A 2FSWA 2KRHA 3BLYA 1QO0D 2L54A 5EGOB 1TBXA 3VFZA 2DOEA 5F04A 1OCOH 2LREA 1IAWA 2NVTJ 3CCLI 4MQ9F 1MMNA 4RB0A 2R7WA 2BVLA 3QPLA 3BR2A 3PO2J 1ORKA 2XASA 1WHUA 3TDUC 5EF6A 4DZJA 3L2CA 2FMLA 3WTVC 3KYDB 2Y0MA 2LD5A 3TGNA 1LNWA 3LSGA 1T8IA 3K70D 3OSGA 2P7VB 2OPTA 1ZHFA 4P5OA 3K1MA 1VQ8I 1QZZA 1ERDA 3H3ZA 3QWLA 2DBBA 2ADUA 3TO9A 2KT0A 5H6RA 4A6DA 3SDBA 1JT0A 2ACJA 1RUNA 2QWWA 3KE2A 2QSGX 2L4MA 1MBGA 2FMYA 1WI9A 2WTEA 2DDBA 2LNBA 2OCCH 4ETSA 3DKYA 3ZOBA 2DYRH 1IV6A 1YIJI 1UMQA 1F36A 2RQPA 1VQOI 3WTZA 1FYMA 3JSPA 1Z6TA 2Y9ZA 4PSXA 5FLVA 2EJRA 3HPHA 4U0VA 3IH2A 2AQFA 3A01A 1VQKI 1X1CA 4F92B 1CGPA 2FBHA 1W36D 4W97A 4UV8A 4CYDA 1XC5A 3JAMZ 4B3XA 2LLKA 1HCRA 1WCMJ 4N4NB 2HVQA 5EGOA 2VN2A 1R4MB 1IRXA 1Z91A 5D5VB 3DKXA 2HWVA 2RNJA 2X6WA 1A04A 2YU3A 2M0CA 3T5XA 4HSTA 5EDNA 4OMYA 2MD5A 2IGMA 3FXLA 3CMYA 2OC6A 1S72I 2G9WA 5TGTA 1EH6A 3U21A 1W36C 2R5ZA 1YG2A 4WCGA 2DA3A 2L01A 1N75A 3TO7A 2VUMJ 4ZTFA 3MKWB 3BP8A 1DQUA 1OYWA 2AHQA 4EMSA 3FMRA 3W3CA 2GA1A 3QRFF 1OR7C 4IHTA 1MBKA 2E36A 4M9SA 2Y69H 3CCJI 3LSRA 3MFKA 1FTTA 1RIOH 3K1PA 1IV8A 2V7FA 3RPQA 3CF5F 2KIUA 3CESA 1IJWC 4X1EA 2E2IJ 4BXUA 1H9GA 2MGQA 4RA2A 3I56I 1XSDA 2QBYA 3PFIA 1O3TA 2QKLB 5E3LA 3HTSB 1TC3C 4FCYA 4QPQA 3RQIA 4F7ZA 1MSFC 1IXRC 5K7FA 2F5CA 3Q9VA 4XRSG 1B72B 1LQ1A 2VI6A 1EH8A 2OF7A 3DEUA 4CCJA 4ITVA 3FHZA 1FSHA 2FU4A 3K4KA 1QNTA 2VJJA 4UVBA 2V9PA 1OQYA 1S9HA 3PQKA 4AVZA 3A0BC 5F0CA 5D8KB 5ILVA 2VLAA 3ZP5A 4IOAF 1FY7A 3SHFA 5B1BH 4PCQA 2DTZA 4H0EA 1Z3XA 2HGCA 1KYZA 1N25A 2L9SA 4KN7X 4XKWA 1S5LC 1BI3A 2CFXA 3EYYA 3DBHB 2RKHA 1QPMA 3LOCA 2PG4A 1R5HA 2DAOA 3LQQA 2IJLA 4I01A 4XKVA 2MA3A 2DA5A 3CCUI 4WX9A 1MMGA 1B6AA 3QOPA 1YX3A 3SDGA 1U5TB 2FNPA 4KT6A 3V8KA 4HDVA 3QYFA 5LD2C 2ECBA 1X2MA 4QLCU 1SFEA 2M45A 3MZHA 2P7CB 4G7OF 2CQQA 4A3MJ 2I8DA 3VPRA 3I55I 1ZRDA 4PUSA 3K4MA 1MSEC 1O3SA 3WTYC 3A4CA 3BZ6A 1D3YA 2DOFA 1JHHA 1SFUA 3ISPA 2M5WA 2CV2A 5E3MA 2E1OA 1S7EA 3GWZA 2EA2A 2W4SA 3T8TA 1FEXA 3S1RJ 4G94A 3NAUA 2AXTC 4UVAA 2VODA 5C4XJ 2F6CA 3DEWA 1MDMB 2OTLI 1JUMA 3R0AA 4DGWB 5FLMJ 4IHVA 1Q1VA 3BTLA 4A3EJ 4G8XA 1OKRA 4NC7A 2JA2A 3BR3A 3OMYA 1JI8A 4HNUA 3H9GA 3WU2C 2JA7J 2Y0SN 2E2JJ 1RR8C 3KZIC 2KRCA 2Y0SA 2RN7A 4BL0B 4XIDA 2BEOA 3MKLA 1XSVA 4OAYA 5EG0B
chains in the Genus database with same CATH topology
2HFHA 2HQRA 1PP7U 4L9NA 3IHUA 2XIGA 5JHUA 5LGTA 1J5YA 2E7XA 3T1BA 2ESNA 1OMIA 4G7ZF 2J5OA 3MCZA 5JFRA 4PZJA 1LDDA 4BHCA 5D5XB 1LB2A 1X3UA 5CVIA 2VBXA 4MEYF 4CHUA 2HS5A 1SMYF 4GO1A 4A5MA 4MTEA 4A2UA 2A5YB 4UVCA 3ZMDA 1FOKA 4PGHA 2F5EA 3OV8A 4M9XA 3M1EA 2X4HA 3KFWX 5CVJA 1JE8A 1L0OC 5E1WA 1B59A 2FBIA 2B0LA 2LSOA 5ICCA 5K5QA 1S29A 2NS0A 5HVQC 3BJOA 1B9MA 1EH7A 2K4JA 4U0WA 3LA3A 4L9TA 3GW2A 5AONA 1LEBA 2EFWA 2JRTA 2GZWA 2Y75A 1U78A 1R5GA 3KLNA 2BE5F 1R1VA 5ICFA 1JXSA 5CVUA 4HLXA 1OYYA 4HOBA 4N9IA 1IN4A 3L09A 3V8JA 1USTA 1RUOA 2EV6A 3C7JA 3RPUA 4OIOF 2CWEA 3CLOA 2E7WA 1USSA 1KU9A 2O6GE 4AIKA 3HSRA 1E2XA 1DP7P 1I1SA 1MDMA 1FYKA 1GHCA 1B1BA 2EFNA 5D6EA 3KP5A 4RB2C 2HEOA 2XAGA 1YW7A 5L3FA 4LK1F 2R7FA 4I7HA 1BN5A 4WXHA 5H6QA 3BPXA 3WTXC 1OR7A 3P9CA 5CYVA 3TQNA 1BC7C 2OZ6A 2YX7A 3V7SA 1YTYA 3J7AO 1XGOA 3LSTA 2CW0F 4CO8A 2DFIA 3WTWC 5E8GA 3JSOA 3G73A 4OIPF 2YR2A 5BPDA 1Z7UA 1QGPA 3F3XA 4G7HF 3FWEA 1T2KA 1IN5A 1YS7A 4EJVA 2QLZA 4Q4ZF 1MJAA 3CTAA 3VEPA 1U5TA 4UHTA 1T38A 2ESHA 2VONA 1LDKB 1ZRFA 3HHGA 2KRFA 3KZYA 3IL2A 3DFGA 2KKOA 3M9AA 2D1HA 1W5TA 1W7PD 2F5FA 4MNUA 1G3SA 1YLFA 1TQMA 3V7RA 3I53A 1ONVA 2J5PA 4XSXF 2NNNA 1DPRA 3SZPA 2A6EF 3F6OA 5JVTA 1PUEE 1S7AA 1XSXA 2VBZA 4YFXF 5J8CA 5L3CA 1SD7A 1HQCA 5ICEA 4FX4A 2K27A 1XD7A 3E5QA 1BC8C 5HDNA 2P5KA 2IA2A 1IW7F 2PLYA 5CVVA 1O7LA 3QU6A 1HXDA 1ZN2A 5TRDA 5AIPA 4D0PA 2L02A 4KA4A 4LMYA 2D1VA 2ZMEB 4L9VA 3KP3A 1XGSA 2EFQA 2AXLA 2EB7A 1WSUA 5LBQA 3N4MA 4MGRA 4L0YB 4KIBA 5FLXZ 4A12A 5DD8A 3WTTC 4RS8A 3WTSC 1CF7B 3WGIA 2PBIA 5CLSA 3Q9SA 2ZNYA 5IT9K 2EFPA 2GWRA 3BROA 1FX7A 4KIFA 4U7DA 4HX8A 1BM9A 4M71A 5J8FA 3GLXA 2KJBA 2HOEA 3COAC 3GF2A 2OAZA 4NQWA 2W85A 1W4MA 1T39A 4YFNF 1BJAA 1XCVA 2MBFA 3FMQA 3S2WA 5E17F 3KEQA 4KN4X 2VBWA 2A61A 3DP7A 1LJ9A 1JHFA 1XGMA 5LEJA 1MD0A 2O3FA 1R00A 4ENMA 2XAHA 2ISZA 2DLLA 3HUGA 4EJOA 4ZYDA 2QBYB 3ULQB 2M30A 2CYYA 1KYWA 4BHPA 2TDXA 5A2QK 3GFIA 4CZZA 5HS9A 2K4BA 5K1YA 3G3ZA 4KICA 3IC7A 1TW2A 2FOKA 2L3DA 2UXXA 3MQ0A 3LFKA 2ZNZA 2IVMA 4YIIA 4OIQF 3DV8A 4LLNA 1ZGJA 5LLQA 1RNLA 1T0FA 1IXSB 1HW1A 4P96A 3GXOA 1ZG3A 1HKTA 4HQEA 5LHIA 1XN7A 5DCFA 1DUXC 1SD5A 5DUIA 4Z2YA 2MLGA 4LGWA 3HTUA 2DTRA 2W84A 1ZLKA 2FQ3A 2XAFA 3F8BA 3K69A 3MAJA 1TNTA 3WTUC 4LD5A 1UB9A 2PJPA 5KVRA 1Z9CA 1NHAA 2CO5A 1U8RA 3I54A 2V9VA 1BOAA 2DI3A 1WKMA 4ESJA 4EQQA 2RV8A 1TNSA 5L3GA 3LA7A 2EV5A 4M72A 2NAZA 3RDIA 3T0YA 4I98B 1ZAOA 1PP8F 1Q1HA 3LAJA 5L3EA 3E6BA 4Y15A 1Z1DA 1RI7A 2EA4A 4Y17A 1OYIA 2XV4S 1R22A 1ZRCA 2Q2EA 5FFZA 3ABUA 3SQNA 2L4AA 2R3SA 4JBAA 3RKYA 1IUYA 1FBSA 2VT3A 5J6XA 4G6QA 1XB4A 2MLKA 2IA1A 2X0LA 4WF2A 1CF7A 4GYGA 3VOEA 3WU1B 2V6CA 2ISYA 2AS5F 2MH9A 3FM5A 5F1RA 2EWNA 2VOPA 5ERIA 3RYRA 3KP6A 3CUQA 1ZREA 1B9NA 3KP2A 2M1BA 3J80Z 3QPHA 3FMSA 4KFCA 1DDNA 2GAUA 1WWXA 3F22A 4IRIA 5ILUA 4BHBA 3V4GA 4JK1X 1W5SA 3RJPA 2FRHA 2DO7A 4HF1A 4MTDA 4AIHA 2GXGA 2ETHA 4M73A 4E70A 3H92A 4I2OA 4ZYHA 3RKWA 3QPTA 4KMUX 4RGRA 1TTYA 4XLPF 5D5UB 3HSEA 5JI6A 3ELKA 1MJBA 4OOIA 2MC3A 4KIGA 1G6NA 1SFXA 4FT8A 2Y48A 1RZ4A 4N9HA 1R1TA 2VOOA 2BV6A 2DT5A 1R1UA 3SFZA 1BI2A 4ENNA 1HKQA 4YG2F 2QVOA 4BQAA 4Q47A 5LHGA 2RC4A 3ZMZA 5IT9Z 5H20A 1U3EM 2STTA 4P55A 2COMA 2IP2A 3E5XA 4HAMA 4WWCA 3ROUA 1U6GA 3C1DA 5DV5A 5FD5A 2Z33A 3HRSA 4HA8A 1IXCA 2QM3A 5JR3A 4KT5C 5F64A 1T6SA 1SD6A 4KUMA 5E18F 3HOTA 3GEZA 3Q5FA 2W57A 3RYPA 5K5OA 4FX0A 4WK8F 2VBYA 3LQRA 1S8NA 1LEAA 4EGYA 4JQFA 4UNOA 3KLOA 3JAMK 3L00A 1K78B 2WC2A 5E20A 4MEXF 4A5NA 3K2ZA 3EYIA 3WODF 4CICA 1TLHB 4RGUA 1MZBA 1FPQA 2XGXA 1IRGA 3E5UA 2DU9A 4IRHA 2A68F 2Z9OA 3NRVA 3K1NA 1Z05A 2RDPA 2HYGD 3BOQA 4PDKA 3TOBA 4KYWA 1KU3A 2CQKA 2LKPA 5LGNA 5HDGA 4EJUA 2OZUA 3ZMUA 2DW4A 4IXAA 3BWGA 3ML6A 5ILSA 1IRFA 3CO6C 1FSEA 4LFUA 1KQ8A 5FLXK 3RI4A 4AVPA 3KP7A 4RGSA 4EM2A 2IT0A 3F8NA 2VT2A 2BYVE 4GGGA 3P7NA 2HQNA 1FT9A 2G7HA 3HIFA 1TQPA 1KGSA 2JTVA 2XHKA 2IRFG 1D8KA 2O03A 3F8MA 4CDGA 5E8IA 2V1XA 3F8FA 1FBUA 1ZARA 2OA4A 2JPCA 2H6BA 1G3YA 2H09A 3ZN0A 3F21A 4FHTA 1I27A 1YW8A 3QP6A 4CXFA 4HV5A 2OQRA 3SXYA 4N0BA 4R79A 4LG0B 4S04A 3L7WA 1K78A 1S3JA 3BJAA 3KCCA 4HDUA 1MKMA 4CGZA 1D5VA 3SZTA 1PDNC 4ENJA 1I5ZA 5BMZA 2H6CA 2PEXA 4Q48A 2HR3A 2LF7A 1SD4A 3GVAA 5BQTA 4I0AA 4BAYA 3ZMVA 3DPTA 3J81Z 2C6YA 2E1NA 2OBPA 3U9GA 1P4AA 1LDJA 2XAJA 4EM1A 2STWA 3WU0A 3FXRA 2ZJ2A 4TV7A 4ZZDA 4AIJA 2K7LA 1J75A 1HW5A 5HOOA 3N97A 1XMAA 4L5IA 5D5WB 2FNAA 3VB2A 4WXCA 4HF0A 2QQ9A 3BY6A 1ODDA 3RIRA 1O7FA 1T98A 1U5TC 3I59A 3GX4X 4GCVA 1C0WA 2O61A 4A0ZA 3R0JA 3OOPA 1WQ2A 3T8RA 4Q5SF 1KQ9A 1FC3A 5FO5A 3I0TA 5DUKA 3GFLA 1R58A 3DQVC 4HYEA 4HBLA 4BH9A 1SAXA 1YFHA 3IRRA 6PAXA 2VE8A 1UHWA 4NB5A 1GXPA 4OIRF 1FBQA 3KZZA 1YW9A 5KK1A 1IZ1A 2H94A 3DF8A 1K7AA 1H9TA 4A0XA 2HTSA 2FE3A 5F6FA 2NNYA 1HSTA 2PQ8A 2XAQA 5LHHA 4B09A 5FB2A 5HLHA 4EM0B 3HRMA 1BIAA 1D8JA 4L18B 3F8CA 1XDUA 4R8HA 3DKWA 4P9UA 1JGSA 1R36A 3ERED 2QYOA 4ASNA 4EGZA 3B02A 5DEQA 1P92A 5DCMA 3AAFA 1KA8A 1FNNA 3ECHA 5FFXA 2DPUA 1QQIA 2ZCWA 3EETA 1KQ0A 2QQBA 1G4DA 1O3RA 4HX7A 2A6HF 4KNYA 3R6SA 3CUQB 4HX4A 1R7JA 2MH2A 3V7CA 5EEGA 2JSCA 3NQOA 3RTRA 2KIMA 3ZMTA 3I59B 2Q0OA 1DPUA 2WV0A 3DPLC 4M6XA 1U2WA 2NYXA 4Y13A 4AD9A 1J59A 1FWZA 3VODA 4M74A 2V1UA 2EK5A 1YIOA 4I09A 3V8LA 4G6DA 2XROA 1REPC 1BI0A 3BPVA 1BI1A 5AIQA 2RGVA 4L9JA 1BIBA 1YQAA 2W25A 3GUDA 2NRAC 2P4WA 1XMKA 4XRFA 2VC1A 2Z3YA 2QENA 3O3KA 3HOSA 4UUVA 4RAYA 3E6MA 2VE9A 1XCBA 3C3WA 2F5DA 2P8TA 4YFKF 2WWYA 1E17A 5D6FA 2DPDA 3JW4A 3QAHA 1P4XA 2XVCA 1BBYA 3RKXA 3P9KA 2OU2A 3WE3A 3QP5A 4MHGA 3U1DA 5ED4A 2FEZA 3NEUA 2W24A 3I64A 3IKVA 4EJTA 3K9TA 4I0BA 2ZKZA 3PQJA 3ZMSA 1ULYA 3IKTA 1K79A 2K02A 4WXDA 3D5LA 1SMTA 1O57A 3GO5A 4K2EA 1Z6RA 4XSZF 4LB6B 4EVIA 3ZPLA 2DK8A 5EEHA 2VXZA 4LLLA 5BS6A 1ZYRF 1K6OA 2QUFA 4B8XA 1S6LA 2GIVA 5BPIA 4OMZA 5CVRA 3FXUA 3GFMA 4KMFA 4EJWA 2CG4A 2QQAA 4RAZA 5LRSA 1HSJA 3KEOA 1TQIA 5LEKA 3HRUA 2M87A 2EFOA 3DXJF 3I71A 2LF8A 4ZYGA 4BYYA 4HF2A 1UFMA 1H0MA 1ZG1A 1WRJA 3HSFA 4S05A 3ZN1A 4A0YA 3WE2A 3D0SA 3U2RA 4LB5A 1P2FA 4EV0A 2M8EA 2UWMA 3TOAA 4HZFA 1MGTA 2A07F 3C18A 2GA2A 1R23A 3M7GA 3EDPA 2D2WA 3M8FA 1Y0UA 1MJ9A 5HS8A 1J9IA 4LK0F 3KETA 2BGCA 4O6JA 3O2PE 2A3SA 4ZH4F 3BJ6A 1FP2A 5E1XA 3QU3A 2HTJA 5CJ9A 4IRGA 3B73A 5HLIA 1W7PA 2ZBKA 5A2QZ 3KP4A 1LVAA 4RB3C 4NHJA 2IPQX 4HV6A 1TW3A 2DQRA 3I4PA 3GYHX 2XKPA 5ICGA 2P5VA 3F6VA 3MEXA 2RVCA 4LJZF 3E3VA 3L9FA 4UXNA 2OQGA 3LA2A 3MWMA 1F1ZA 4L5JA 3JTGA 4U0YA 4IPAA 3IRQA 5TJJA 4ESBA 1F4KA 2O0YA 3W6KB 2UXNA 4U88A 4U7BA 2KJCA 1AWCA 1ZLJA 4RGXA 3JTHA 5DCMB 1ON1A 3ECOA 1S7OA 1F5TA 2DQLA 3TDZC 1AOYA 1EV7A 1ZH5A 1VTNC 1IN8A 2HYFA 5DD4A 2CSOA 1FP1D 2P5LC 1IN6A 2F2EA 3HRTA 4IVNA 5BOXA 1YS6A 5D8LB 2ZFWA 1J0RA 2QZ8A 2XUBA 4HW0A 2PMHA 1GXQA 3EUHA 1OPCA 4IHSA 3FM3A 1O3QA 2Z5UA 3R61A 4IJAA 2R7DA 1P6RA 1XGNA 2D45A 2H27A 1FZPB 3IWFA 4XLNF 5D4SA 3GZ5A 2E1CA 2HZTA 4G9YA 4UV9A 3M8EA 3WG9A 1IF1A 1ZG5A 3BDDA 1I6XA 1ZGAA 4O3MA 2IW5A 4GXOA 1HW2A 4XBFA 4ZYEA 2FA5A 4A6EA 3FZVA 1KU7A 3CO7C 3ABTA 3E6CC 3E6DA 3O6BB 3WGHA 2V79A 1G3WA 2ZMEA 4ON0A 2HDCA 5L3DA 5DDGA 4OINF 4QWQA 3LAPA 3W6JB 5E1ZB 3REOA 2YSRA 3GZ6A 1B4AA 3CJNA 1STZA 3HYIA 1I1GA 1YO5C 1HKSA 2FXAA 4OU0A 3K0LA 1YYVA 3HHHA 2YX4A 4P9FA 2ZO4A 1QBJA 3H3UA 2OD5A 4HLYA 3FXQA 5HS7A 2GQQA 3ZQ7A 2Q8KA 2A69F 4ZZLA 2O8XA 2JT1A 2PMUA 1J2XA 1XDSA 3GFJA 5HDKA 4O5VA 5FGMA 4GYIA 3F72A 1KU2A 4MQVA 4KDPA 5LRRA 2DK5A 1P4WA 2VC0A 2PFBA 4YIFA 3TKYA 5D4RA 1ON2A 1J7KA 1GVJA 5LGUA 2XKOA 3CUOA 2PI0A 5K5RA 4RB1A 1V3FA 1V4RA 3FF5A 4LG0A 2UZKA 2IA0A 2KIFA 4M6YA 3CDHA 3WGGA 3FX3A 2XRNA 3R60A 1FLIA 2BBYA 1G3TA 2Z99A 3P9IA 3MZYA 2YPRA 4ENKA 2HKXA 5IT3A 1IN7A 3I58A 2ELHA 3E97A 4M9ZA 1L3LA 2V1DA 4L0ZB 3EQLF 1QZYA 5DYMA 4BNCA 1W7PB 3J80K 2JPBA 3CUQC 1UHMA 3R4KA 5HLGA 2ZXJA 2JZYA 1F9NA 4HQMA 4LLGF 4AWXB 2FBKA 2LDUA 1UCRA 4DQ2A 4IF4A 3J81K 1FYLA 2P6TA 3TO6A 2GXBA 2G7UA 4DNCA 2HKOA 4ESFA 5L3BA 3LWFA 5FD6A 3F23A 3I5UA 4R1HA 2EV0A 2K86A 2P6SA 2CGPA 2FF4A 4PGGA 3IWZA 4I02A 1HBXG 2PN6A 2FSWA 1QO0D 2L54A 1TBXA 3VFZA 1IAWA 4MQ9F 4RB0A 2XASA 3TDUC 3L2CA 2FMLA 3WTVC 2Y0MA 3TGNA 1LNWA 2P7VB 4P5OA 1ZHFA 3K1MA 1QZZA 3H3ZA 2DBBA 2ADUA 3TO9A 4A6DA 5H6RA 2ACJA 1RUNA 2QWWA 3KE2A 2L4MA 2FMYA 1WI9A 2WTEA 2LNBA 4ETSA 2RQPA 1FYMA 3WTZA 3JSPA 1Z6TA 2EJRA 4U0VA 1CGPA 2FBHA 4UV8A 4CYDA 3JAMZ 2VN2A 1Z91A 5D5VB 2HWVA 2RNJA 1A04A 2YU3A 3T5XA 4OMYA 2MD5A 2G9WA 1EH6A 1YG2A 4WCGA 2L01A 3TO7A 3BP8A 1OYWA 4EMSA 3FMRA 2GA1A 3QRFF 4IHTA 4M9SA 3MFKA 1RIOH 3K1PA 3RPQA 2KIUA 4BXUA 1H9GA 2QBYA 1XSDA 3PFIA 1O3TA 3HTSB 4F7ZA 1IXRC 2F5CA 3Q9VA 1LQ1A 1EH8A 3DEUA 1FSHA 3FHZA 2FU4A 1QNTA 4UVBA 3PQKA 5ILVA 5D8KB 3ZP5A 1FY7A 3SHFA 4PCQA 4H0EA 2HGCA 1KYZA 4KN7X 1BI3A 2CFXA 3EYYA 2RKHA 1QPMA 2PG4A 1R5HA 2DAOA 3LQQA 2IJLA 4I01A 2MA3A 4WX9A 1B6AA 3QOPA 1U5TB 2FNPA 3V8KA 4HDVA 4QLCU 1SFEA 2M45A 3MZHA 2P7CB 4G7OF 1ZRDA 1O3SA 3WTYC 3BZ6A 1D3YA 1JHHA 1SFUA 3ISPA 2M5WA 2EA2A 3GWZA 3T8TA 4G94A 4UVAA 2VODA 1MDMB 3R0AA 4G8XA 1OKRA 2RN7A 2BEOA 1XSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFH A;  2HQR A;  1PP7 U;  4L9N A;  3IHU A;  2XIG A;  5JHU A;  5LGT A;  1J5Y A;  2E7X A;  3T1B A;  2ESN A;  1OMI A;  4G7Z F;  2J5O A;  3MCZ A;  5JFR A;  4PZJ A;  1LDD A;  4BHC A;  5D5X B;  1LB2 A;  1X3U A;  5CVI A;  2VBX A;  4MEY F;  4CHU A;  2HS5 A;  1SMY F;  4GO1 A;  4A5M A;  4MTE A;  4A2U A;  2A5Y B;  4UVC A;  3ZMD A;  1FOK A;  4PGH A;  2F5E A;  3OV8 A;  4M9X A;  3M1E A;  2X4H A;  3KFW X;  5CVJ A;  1JE8 A;  1L0O C;  5E1W A;  1B59 A;  2FBI A;  2B0L A;  2LSO A;  5ICC A;  5K5Q A;  1S29 A;  2NS0 A;  5HVQ C;  3BJO A;  1B9M A;  1EH7 A;  2K4J A;  4U0W A;  3LA3 A;  4L9T A;  3GW2 A;  5AON A;  1LEB A;  2EFW A;  2JRT A;  2GZW A;  2Y75 A;  1U78 A;  1R5G A;  3KLN A;  2BE5 F;  1R1V A;  5ICF A;  1JXS A;  5CVU A;  4HLX A;  1OYY A;  4HOB A;  4N9I A;  1IN4 A;  3L09 A;  3V8J A;  1UST A;  1RUO A;  2EV6 A;  3C7J A;  3RPU A;  4OIO F;  2CWE A;  3CLO A;  2E7W A;  1USS A;  1KU9 A;  2O6G E;  4AIK A;  3HSR A;  1E2X A;  1DP7 P;  1I1S A;  1MDM A;  1FYK A;  1GHC A;  1B1B A;  2EFN A;  5D6E A;  3KP5 A;  4RB2 C;  2HEO A;  2XAG A;  1YW7 A;  5L3F A;  4LK1 F;  2R7F A;  4I7H A;  1BN5 A;  4WXH A;  5H6Q A;  3BPX A;  3WTX C;  1OR7 A;  3P9C A;  5CYV A;  3TQN A;  1BC7 C;  2OZ6 A;  2YX7 A;  3V7S A;  1YTY A;  3J7A O;  1XGO A;  3LST A;  2CW0 F;  4CO8 A;  2DFI A;  3WTW C;  5E8G A;  3JSO A;  3G73 A;  4OIP F;  2YR2 A;  5BPD A;  1Z7U A;  1QGP A;  3F3X A;  4G7H F;  3FWE A;  1T2K A;  1IN5 A;  1YS7 A;  4EJV A;  2QLZ A;  4Q4Z F;  1MJA A;  3CTA A;  3VEP A;  1U5T A;  4UHT A;  1T38 A;  2ESH A;  2VON A;  1LDK B;  1ZRF A;  3HHG A;  2KRF A;  3KZY A;  3IL2 A;  3DFG A;  2KKO A;  3M9A A;  2D1H A;  1W5T A;  1W7P D;  2F5F A;  4MNU A;  1G3S A;  1YLF A;  1TQM A;  3V7R A;  3I53 A;  1ONV A;  2J5P A;  4XSX F;  2NNN A;  1DPR A;  3SZP A;  2A6E F;  3F6O A;  5JVT A;  1PUE E;  1S7A A;  1XSX A;  2VBZ A;  4YFX F;  5J8C A;  5L3C A;  1SD7 A;  1HQC A;  5ICE A;  4FX4 A;  2K27 A;  1XD7 A;  3E5Q A;  1BC8 C;  5HDN A;  2P5K A;  2IA2 A;  1IW7 F;  2PLY A;  5CVV A;  1O7L A;  3QU6 A;  1HXD A;  1ZN2 A;  5TRD A;  5AIP A;  4D0P A;  2L02 A;  4KA4 A;  4LMY A;  2D1V A;  2ZME B;  4L9V A;  3KP3 A;  1XGS A;  2EFQ A;  2AXL A;  2EB7 A;  1WSU A;  5LBQ A;  3N4M A;  4MGR A;  4L0Y B;  4KIB A;  5FLX Z;  4A12 A;  5DD8 A;  3WTT C;  4RS8 A;  3WTS C;  1CF7 B;  3WGI A;  2PBI A;  5CLS A;  3Q9S A;  2ZNY A;  5IT9 K;  2EFP A;  2GWR A;  3BRO A;  1FX7 A;  4KIF A;  4U7D A;  4HX8 A;  1BM9 A;  4M71 A;  5J8F A;  3GLX A;  2KJB A;  2HOE A;  3COA C;  3GF2 A;  2OAZ A;  4NQW A;  2W85 A;  1W4M A;  1T39 A;  4YFN F;  1BJA A;  1XCV A;  2MBF A;  3FMQ A;  3S2W A;  5E17 F;  3KEQ A;  4KN4 X;  2VBW A;  2A61 A;  3DP7 A;  1LJ9 A;  1JHF A;  1XGM A;  5LEJ A;  1MD0 A;  2O3F A;  1R00 A;  4ENM A;  2XAH A;  2ISZ A;  2DLL A;  3HUG A;  4EJO A;  4ZYD A;  2QBY B;  3ULQ B;  2M30 A;  2CYY A;  1KYW A;  4BHP A;  2TDX A;  5A2Q K;  3GFI A;  4CZZ A;  5HS9 A;  2K4B A;  5K1Y A;  3G3Z A;  4KIC A;  3IC7 A;  1TW2 A;  2FOK A;  2L3D A;  2UXX A;  3MQ0 A;  3LFK A;  2ZNZ A;  2IVM A;  4YII A;  4OIQ F;  3DV8 A;  4LLN A;  1ZGJ A;  5LLQ A;  1RNL A;  1T0F A;  1IXS B;  1HW1 A;  4P96 A;  3GXO A;  1ZG3 A;  1HKT A;  4HQE A;  5LHI A;  1XN7 A;  5DCF A;  1DUX C;  1SD5 A;  5DUI A;  4Z2Y A;  2MLG A;  4LGW A;  3HTU A;  2DTR A;  2W84 A;  1ZLK A;  2FQ3 A;  2XAF A;  3F8B A;  3K69 A;  3MAJ A;  1TNT A;  3WTU C;  4LD5 A;  1UB9 A;  2PJP A;  5KVR A;  1Z9C A;  1NHA A;  2CO5 A;  1U8R A;  3I54 A;  2V9V A;  1BOA A;  2DI3 A;  1WKM A;  4ESJ A;  4EQQ A;  2RV8 A;  1TNS A;  5L3G A;  3LA7 A;  2EV5 A;  4M72 A;  2NAZ A;  3RDI A;  3T0Y A;  4I98 B;  1ZAO A;  1PP8 F;  1Q1H A;  3LAJ A;  5L3E A;  3E6B A;  4Y15 A;  1Z1D A;  1RI7 A;  2EA4 A;  4Y17 A;  1OYI A;  2XV4 S;  1R22 A;  1ZRC A;  2Q2E A;  5FFZ A;  3ABU A;  3SQN A;  2L4A A;  2R3S A;  4JBA A;  3RKY A;  1IUY A;  1FBS A;  2VT3 A;  5J6X A;  4G6Q A;  1XB4 A;  2MLK A;  2IA1 A;  2X0L A;  4WF2 A;  1CF7 A;  4GYG A;  3VOE A;  3WU1 B;  2V6C A;  2ISY A;  2AS5 F;  2MH9 A;  3FM5 A;  5F1R A;  2EWN A;  2VOP A;  5ERI A;  3RYR A;  3KP6 A;  3CUQ A;  1ZRE A;  1B9N A;  3KP2 A;  2M1B A;  3J80 Z;  3QPH A;  3FMS A;  4KFC A;  1DDN A;  2GAU A;  1WWX A;  3F22 A;  4IRI A;  5ILU A;  4BHB A;  3V4G A;  4JK1 X;  1W5S A;  3RJP A;  2FRH A;  2DO7 A;  4HF1 A;  4MTD A;  4AIH A;  2GXG A;  2ETH A;  4M73 A;  4E70 A;  3H92 A;  4I2O A;  4ZYH A;  3RKW A;  3QPT A;  4KMU X;  4RGR A;  1TTY A;  4XLP F;  5D5U B;  3HSE A;  5JI6 A;  3ELK A;  1MJB A;  4OOI A;  2MC3 A;  4KIG A;  1G6N A;  1SFX A;  4FT8 A;  2Y48 A;  1RZ4 A;  4N9H A;  1R1T A;  2VOO A;  2BV6 A;  2DT5 A;  1R1U A;  3SFZ A;  1BI2 A;  4ENN A;  1HKQ A;  4YG2 F;  2QVO A;  4BQA A;  4Q47 A;  5LHG A;  2RC4 A;  3ZMZ A;  5IT9 Z;  5H20 A;  1U3E M;  2STT A;  4P55 A;  2COM A;  2IP2 A;  3E5X A;  4HAM A;  4WWC A;  3ROU A;  1U6G A;  3C1D A;  5DV5 A;  5FD5 A;  2Z33 A;  3HRS A;  4HA8 A;  1IXC A;  2QM3 A;  5JR3 A;  4KT5 C;  5F64 A;  1T6S A;  1SD6 A;  4KUM A;  5E18 F;  3HOT A;  3GEZ A;  3Q5F A;  2W57 A;  3RYP A;  5K5O A;  4FX0 A;  4WK8 F;  2VBY A;  3LQR A;  1S8N A;  1LEA A;  4EGY A;  4JQF A;  4UNO A;  3KLO A;  3JAM K;  3L00 A;  1K78 B;  2WC2 A;  5E20 A;  4MEX F;  4A5N A;  3K2Z A;  3EYI A;  3WOD F;  4CIC A;  1TLH B;  4RGU A;  1MZB A;  1FPQ A;  2XGX A;  1IRG A;  3E5U A;  2DU9 A;  4IRH A;  2A68 F;  2Z9O A;  3NRV A;  3K1N A;  1Z05 A;  2RDP A;  2HYG D;  3BOQ A;  4PDK A;  3TOB A;  4KYW A;  1KU3 A;  2CQK A;  2LKP A;  5LGN A;  5HDG A;  4EJU A;  2OZU A;  3ZMU A;  2DW4 A;  4IXA A;  3BWG A;  3ML6 A;  5ILS A;  1IRF A;  3CO6 C;  1FSE A;  4LFU A;  1KQ8 A;  5FLX K;  3RI4 A;  4AVP A;  3KP7 A;  4RGS A;  4EM2 A;  2IT0 A;  3F8N A;  2VT2 A;  2BYV E;  4GGG A;  3P7N A;  2HQN A;  1FT9 A;  2G7H A;  3HIF A;  1TQP A;  1KGS A;  2JTV A;  2XHK A;  2IRF G;  1D8K A;  2O03 A;  3F8M A;  4CDG A;  5E8I A;  2V1X A;  3F8F A;  1FBU A;  1ZAR A;  2OA4 A;  2JPC A;  2H6B A;  1G3Y A;  2H09 A;  3ZN0 A;  3F21 A;  4FHT A;  1I27 A;  1YW8 A;  3QP6 A;  4CXF A;  4HV5 A;  2OQR A;  3SXY A;  4N0B A;  4R79 A;  4LG0 B;  4S04 A;  3L7W A;  1K78 A;  1S3J A;  3BJA A;  3KCC A;  4HDU A;  1MKM A;  4CGZ A;  1D5V A;  3SZT A;  1PDN C;  4ENJ A;  1I5Z A;  5BMZ A;  2H6C A;  2PEX A;  4Q48 A;  2HR3 A;  2LF7 A;  1SD4 A;  3GVA A;  5BQT A;  4I0A A;  4BAY A;  3ZMV A;  3DPT A;  3J81 Z;  2C6Y A;  2E1N A;  2OBP A;  3U9G A;  1P4A A;  1LDJ A;  2XAJ A;  4EM1 A;  2STW A;  3WU0 A;  3FXR A;  2ZJ2 A;  4TV7 A;  4ZZD A;  4AIJ A;  2K7L A;  1J75 A;  1HW5 A;  5HOO A;  3N97 A;  1XMA A;  4L5I A;  5D5W B;  2FNA A;  3VB2 A;  4WXC A;  4HF0 A;  2QQ9 A;  3BY6 A;  1ODD A;  3RIR A;  1O7F A;  1T98 A;  1U5T C;  3I59 A;  3GX4 X;  4GCV A;  1C0W A;  2O61 A;  4A0Z A;  3R0J A;  3OOP A;  1WQ2 A;  3T8R A;  4Q5S F;  1KQ9 A;  1FC3 A;  5FO5 A;  3I0T A;  5DUK A;  3GFL A;  1R58 A;  3DQV C;  4HYE A;  4HBL A;  4BH9 A;  1SAX A;  1YFH A;  3IRR A;  6PAX A;  2VE8 A;  1UHW A;  4NB5 A;  1GXP A;  4OIR F;  1FBQ A;  3KZZ A;  1YW9 A;  5KK1 A;  1IZ1 A;  2H94 A;  3DF8 A;  1K7A A;  1H9T A;  4A0X A;  2HTS A;  2FE3 A;  5F6F A;  2NNY A;  1HST A;  2PQ8 A;  2XAQ A;  5LHH A;  4B09 A;  5FB2 A;  5HLH A;  4EM0 B;  3HRM A;  1BIA A;  1D8J A;  4L18 B;  3F8C A;  1XDU A;  4R8H A;  3DKW A;  4P9U A;  1JGS A;  1R36 A;  3ERE D;  2QYO A;  4ASN A;  4EGZ A;  3B02 A;  5DEQ A;  1P92 A;  5DCM A;  3AAF A;  1KA8 A;  1FNN A;  3ECH A;  5FFX A;  2DPU A;  1QQI A;  2ZCW A;  3EET A;  1KQ0 A;  2QQB A;  1G4D A;  1O3R A;  4HX7 A;  2A6H F;  4KNY A;  3R6S A;  3CUQ B;  4HX4 A;  1R7J A;  2MH2 A;  3V7C A;  5EEG A;  2JSC A;  3NQO A;  3RTR A;  2KIM A;  3ZMT A;  3I59 B;  2Q0O A;  1DPU A;  2WV0 A;  3DPL C;  4M6X A;  1U2W A;  2NYX A;  4Y13 A;  4AD9 A;  1J59 A;  1FWZ A;  3VOD A;  4M74 A;  2V1U A;  2EK5 A;  1YIO A;  4I09 A;  3V8L A;  4G6D A;  2XRO A;  1REP C;  1BI0 A;  3BPV A;  1BI1 A;  5AIQ A;  2RGV A;  4L9J A;  1BIB A;  1YQA A;  2W25 A;  3GUD A;  2NRA C;  2P4W A;  1XMK A;  4XRF A;  2VC1 A;  2Z3Y A;  2QEN A;  3O3K A;  3HOS A;  4UUV A;  4RAY A;  3E6M A;  2VE9 A;  1XCB A;  3C3W A;  2F5D A;  2P8T A;  4YFK F;  2WWY A;  1E17 A;  5D6F A;  2DPD A;  3JW4 A;  3QAH A;  1P4X A;  2XVC A;  1BBY A;  3RKX A;  3P9K A;  2OU2 A;  3WE3 A;  3QP5 A;  4MHG A;  3U1D A;  5ED4 A;  2FEZ A;  3NEU A;  2W24 A;  3I64 A;  3IKV A;  4EJT A;  3K9T A;  4I0B A;  2ZKZ A;  3PQJ A;  3ZMS A;  1ULY A;  3IKT A;  1K79 A;  2K02 A;  4WXD A;  3D5L A;  1SMT A;  1O57 A;  3GO5 A;  4K2E A;  1Z6R A;  4XSZ F;  4LB6 B;  4EVI A;  3ZPL A;  2DK8 A;  5EEH A;  2VXZ A;  4LLL A;  5BS6 A;  1ZYR F;  1K6O A;  2QUF A;  4B8X A;  1S6L A;  2GIV A;  5BPI A;  4OMZ A;  5CVR A;  3FXU A;  3GFM A;  4KMF A;  4EJW A;  2CG4 A;  2QQA A;  4RAZ A;  5LRS A;  1HSJ A;  3KEO A;  1TQI A;  5LEK A;  3HRU A;  2M87 A;  2EFO A;  3DXJ F;  3I71 A;  2LF8 A;  4ZYG A;  4BYY A;  4HF2 A;  1UFM A;  1H0M A;  1ZG1 A;  1WRJ A;  3HSF A;  4S05 A;  3ZN1 A;  4A0Y A;  3WE2 A;  3D0S A;  3U2R A;  4LB5 A;  1P2F A;  4EV0 A;  2M8E A;  2UWM A;  3TOA A;  4HZF A;  1MGT A;  2A07 F;  3C18 A;  2GA2 A;  1R23 A;  3M7G A;  3EDP A;  2D2W A;  3M8F A;  1Y0U A;  1MJ9 A;  5HS8 A;  1J9I A;  4LK0 F;  3KET A;  2BGC A;  4O6J A;  3O2P E;  2A3S A;  4ZH4 F;  3BJ6 A;  1FP2 A;  5E1X A;  3QU3 A;  2HTJ A;  5CJ9 A;  4IRG A;  3B73 A;  5HLI A;  1W7P A;  2ZBK A;  5A2Q Z;  3KP4 A;  1LVA A;  4RB3 C;  4NHJ A;  2IPQ X;  4HV6 A;  1TW3 A;  2DQR A;  3I4P A;  3GYH X;  2XKP A;  5ICG A;  2P5V A;  3F6V A;  3MEX A;  2RVC A;  4LJZ F;  3E3V A;  3L9F A;  4UXN A;  2OQG A;  3LA2 A;  3MWM A;  1F1Z A;  4L5J A;  3JTG A;  4U0Y A;  4IPA A;  3IRQ A;  5TJJ A;  4ESB A;  1F4K A;  2O0Y A;  3W6K B;  2UXN A;  4U88 A;  4U7B A;  2KJC A;  1AWC A;  1ZLJ A;  4RGX A;  3JTH A;  5DCM B;  1ON1 A;  3ECO A;  1S7O A;  1F5T A;  2DQL A;  3TDZ C;  1AOY A;  1EV7 A;  1ZH5 A;  1VTN C;  1IN8 A;  2HYF A;  5DD4 A;  2CSO A;  1FP1 D;  2P5L C;  1IN6 A;  2F2E A;  3HRT A;  4IVN A;  5BOX A;  1YS6 A;  5D8L B;  2ZFW A;  1J0R A;  2QZ8 A;  2XUB A;  4HW0 A;  2PMH A;  1GXQ A;  3EUH A;  1OPC A;  4IHS A;  3FM3 A;  1O3Q A;  2Z5U A;  3R61 A;  4IJA A;  2R7D A;  1P6R A;  1XGN A;  2D45 A;  2H27 A;  1FZP B;  3IWF A;  4XLN F;  5D4S A;  3GZ5 A;  2E1C A;  2HZT A;  4G9Y A;  4UV9 A;  3M8E A;  3WG9 A;  1IF1 A;  1ZG5 A;  3BDD A;  1I6X A;  1ZGA A;  4O3M A;  2IW5 A;  4GXO A;  1HW2 A;  4XBF A;  4ZYE A;  2FA5 A;  4A6E A;  3FZV A;  1KU7 A;  3CO7 C;  3ABT A;  3E6C C;  3E6D A;  3O6B B;  3WGH A;  2V79 A;  1G3W A;  2ZME A;  4ON0 A;  2HDC A;  5L3D A;  5DDG A;  4OIN F;  4QWQ A;  3LAP A;  3W6J B;  5E1Z B;  3REO A;  2YSR A;  3GZ6 A;  1B4A A;  3CJN A;  1STZ A;  3HYI A;  1I1G A;  1YO5 C;  1HKS A;  2FXA A;  4OU0 A;  3K0L A;  1YYV A;  3HHH A;  2YX4 A;  4P9F A;  2ZO4 A;  1QBJ A;  3H3U A;  2OD5 A;  4HLY A;  3FXQ A;  5HS7 A;  2GQQ A;  3ZQ7 A;  2Q8K A;  2A69 F;  4ZZL A;  2O8X A;  2JT1 A;  2PMU A;  1J2X A;  1XDS A;  3GFJ A;  5HDK A;  4O5V A;  5FGM A;  4GYI A;  3F72 A;  1KU2 A;  4MQV A;  4KDP A;  5LRR A;  2DK5 A;  1P4W A;  2VC0 A;  2PFB A;  4YIF A;  3TKY A;  5D4R A;  1ON2 A;  1J7K A;  1GVJ A;  5LGU A;  2XKO A;  3CUO A;  2PI0 A;  5K5R A;  4RB1 A;  1V3F A;  1V4R A;  3FF5 A;  4LG0 A;  2UZK A;  2IA0 A;  2KIF A;  4M6Y A;  3CDH A;  3WGG A;  3FX3 A;  2XRN A;  3R60 A;  1FLI A;  2BBY A;  1G3T A;  2Z99 A;  3P9I A;  3MZY A;  2YPR A;  4ENK A;  2HKX A;  5IT3 A;  1IN7 A;  3I58 A;  2ELH A;  3E97 A;  4M9Z A;  1L3L A;  2V1D A;  4L0Z B;  3EQL F;  1QZY A;  5DYM A;  4BNC A;  1W7P B;  3J80 K;  2JPB A;  3CUQ C;  1UHM A;  3R4K A;  5HLG A;  2ZXJ A;  2JZY A;  1F9N A;  4HQM A;  4LLG F;  4AWX B;  2FBK A;  2LDU A;  1UCR A;  4DQ2 A;  4IF4 A;  3J81 K;  1FYL A;  2P6T A;  3TO6 A;  2GXB A;  2G7U A;  4DNC A;  2HKO A;  4ESF A;  5L3B A;  3LWF A;  5FD6 A;  3F23 A;  3I5U A;  4R1H A;  2EV0 A;  2K86 A;  2P6S A;  2CGP A;  2FF4 A;  4PGG A;  3IWZ A;  4I02 A;  1HBX G;  2PN6 A;  2FSW A;  1QO0 D;  2L54 A;  1TBX A;  3VFZ A;  1IAW A;  4MQ9 F;  4RB0 A;  2XAS A;  3TDU C;  3L2C A;  2FML A;  3WTV C;  2Y0M A;  3TGN A;  1LNW A;  2P7V B;  4P5O A;  1ZHF A;  3K1M A;  1QZZ A;  3H3Z A;  2DBB A;  2ADU A;  3TO9 A;  4A6D A;  5H6R A;  2ACJ A;  1RUN A;  2QWW A;  3KE2 A;  2L4M A;  2FMY A;  1WI9 A;  2WTE A;  2LNB A;  4ETS A;  2RQP A;  1FYM A;  3WTZ A;  3JSP A;  1Z6T A;  2EJR A;  4U0V A;  1CGP A;  2FBH A;  4UV8 A;  4CYD A;  3JAM Z;  2VN2 A;  1Z91 A;  5D5V B;  2HWV A;  2RNJ A;  1A04 A;  2YU3 A;  3T5X A;  4OMY A;  2MD5 A;  2G9W A;  1EH6 A;  1YG2 A;  4WCG A;  2L01 A;  3TO7 A;  3BP8 A;  1OYW A;  4EMS A;  3FMR A;  2GA1 A;  3QRF F;  4IHT A;  4M9S A;  3MFK A;  1RIO H;  3K1P A;  3RPQ A;  2KIU A;  4BXU A;  1H9G A;  2QBY A;  1XSD A;  3PFI A;  1O3T A;  3HTS B;  4F7Z A;  1IXR C;  2F5C A;  3Q9V A;  1LQ1 A;  1EH8 A;  3DEU A;  1FSH A;  3FHZ A;  2FU4 A;  1QNT A;  4UVB A;  3PQK A;  5ILV A;  5D8K B;  3ZP5 A;  1FY7 A;  3SHF A;  4PCQ A;  4H0E A;  2HGC A;  1KYZ A;  4KN7 X;  1BI3 A;  2CFX A;  3EYY A;  2RKH A;  1QPM A;  2PG4 A;  1R5H A;  2DAO A;  3LQQ A;  2IJL A;  4I01 A;  2MA3 A;  4WX9 A;  1B6A A;  3QOP A;  1U5T B;  2FNP A;  3V8K A;  4HDV A;  4QLC U;  1SFE A;  2M45 A;  3MZH A;  2P7C B;  4G7O F;  1ZRD A;  1O3S A;  3WTY C;  3BZ6 A;  1D3Y A;  1JHH A;  1SFU A;  3ISP A;  2M5W A;  2EA2 A;  3GWZ A;  3T8T A;  4G94 A;  4UVA A;  2VOD A;  1MDM B;  3R0A A;  4G8X A;  1OKR A;  2RN7 A;  2BEO A;  1XSV A; 
#chains in the Genus database with same CATH topology
 2I5U A;  2HFH A;  2BVM A;  4RLF A;  1ETV A;  2OJE D;  2HQR A;  2VJI A;  3QYB A;  2XGC A;  1PP7 U;  2V9K A;  4L9N A;  4DJA A;  3IHU A;  1R5I D;  3GTK J;  4C3J J;  2XIG A;  5JHU A;  5LGT A;  1J5Y A;  2E7X A;  3T1B A;  4E6K G;  3H1C A;  3J7Z I;  1MH3 A;  2ESN A;  1OMI A;  2CV0 A;  3Q0U A;  2BXZ A;  2KDZ A;  4G7Z F;  2J5O A;  3MCZ A;  1OCP A;  5JFR A;  1RC9 A;  5J40 A;  1UAA A;  4ZC3 A;  2HOA A;  1AKH A;  4PZJ A;  1LDD A;  5D5X B;  4BHC A;  1LB2 A;  4GDF A;  1X3U A;  5CVI A;  1Z21 A;  2K9L A;  2VBX A;  4MEY F;  1IGN A;  2CUE A;  4CHU A;  2HS5 A;  3TP3 A;  1SMY F;  4GO1 A;  1Z7L A;  2L9R A;  3DCF A;  2NVY J;  2R92 J;  4MLO A;  4A5M A;  3GTJ J;  4MTE A;  4A2U A;  5F08 A;  3G6E I;  3MMY B;  2A5Y B;  4UVC A;  4E7J A;  4C9Y A;  3ZMD A;  1FOK A;  2OUM A;  4PGH A;  1VQ4 I;  5EYR A;  5GAG J;  2F5E A;  2Q1Z B;  2KPM A;  3OV8 A;  4M9X A;  3M1E A;  3SZG A;  1ITY A;  4CH7 A;  4XLF A;  2X4H A;  3KFW X;  1GDT A;  5CVJ A;  1JE8 A;  2ICW G;  1L0O C;  5E1W A;  1B59 A;  1OCZ H;  2FBI A;  4BEH A;  3S1M J;  2B0L A;  2LSO A;  5ICC A;  1U9N A;  5K5Q A;  5H2F C;  2RNG A;  1S29 A;  3JRH A;  4IQJ A;  2NS0 A;  5HVQ C;  3BJO A;  3GME A;  3BG6 A;  1VFC A;  2OCE A;  1B9M A;  1K61 A;  2IAI A;  4XON A;  1OCT C;  1EH7 A;  2K4J A;  4U0W A;  3LA3 A;  4L9T A;  3FXO A;  4S0H B;  3GW2 A;  4JYK A;  5AON A;  1LEB A;  2EFW A;  2KDO A;  2JRT A;  2GZW A;  2Y75 A;  4FQG A;  1U78 A;  1R5G A;  3KLN A;  2BE5 F;  4M3F A;  1R1V A;  5ICF A;  1MMA A;  1JXS A;  2WBM A;  3QOD A;  5CVU A;  1ETY A;  4HLX A;  1OYY A;  3EUH C;  4HOB A;  4N9I A;  2IGN A;  1IN4 A;  3L09 A;  3NAR A;  3V8J A;  2LG4 A;  1UST A;  2DA4 A;  3RKQ A;  1RUO A;  2EV6 A;  4PJM A;  4E7Z A;  3C7J A;  4CCK A;  3RPU A;  3W2V A;  4OIO F;  3G1M A;  3G1O A;  1OCC H;  1UEL B;  1E3O C;  3H0G J;  3CD6 I;  2CWE A;  3CLO A;  4ZYA A;  2E7W A;  2M34 A;  1USS A;  4CA0 A;  4F3Q A;  1KU9 A;  2O6G E;  1R6R A;  1POG A;  1I6H J;  4AIK A;  2IGK A;  2DFF A;  3HSR A;  1SVL A;  1E2X A;  1X1A A;  5DM6 F;  3CQZ J;  2DMP A;  3S16 J;  4BUP A;  1DP7 P;  5C44 J;  1I1S A;  2LKS A;  4JP0 A;  1MDM A;  1FYK A;  1GHC A;  1B1B A;  1X1B A;  2EFN A;  3BCA A;  4MIM A;  1IO2 A;  1V5G A;  5D6E A;  3KP5 A;  4RB2 C;  3L2V A;  1R4N B;  4F91 B;  2XAG A;  2HEO A;  2R7X A;  1YW7 A;  5L3F A;  4LK1 F;  2R7F A;  4B3A A;  4I7H A;  1YIT I;  1BN5 A;  2HQA A;  4WXH A;  5H6Q A;  3BC8 A;  3BPX A;  1D0X A;  3WTX C;  1BA5 A;  3CC7 I;  1OR7 A;  3P9C A;  5CYV A;  2DA1 A;  3TQN A;  1Y0N A;  1V5E A;  1LUJ B;  2OZ6 A;  1BC7 C;  3B6C A;  2YX7 A;  3V7S A;  3I9V 2;  1YTY A;  3J7A O;  2GLO A;  1XGO A;  2BW3 B;  2W1O A;  2CMP A;  3LST A;  2CW0 F;  3BQY A;  2B9S A;  4CO8 A;  2DFI A;  1UG2 A;  3WTW C;  5E8G A;  3OYC A;  1DGR M;  1YRN A;  2VQH A;  4BGD A;  3PO3 J;  4QPO A;  1Y1V J;  3JSO A;  3G73 A;  1I3A A;  2YR2 A;  1BOB A;  4XQF A;  5JHF A;  1V55 H;  5BPD A;  4OIP F;  1Z7U A;  1QGP A;  3F3X A;  4X6A J;  3AFH A;  4FTH A;  2HPI A;  5DTD A;  4G7H F;  3FWE A;  2GIZ A;  1T2K A;  1IN5 A;  2CW8 A;  1YS7 A;  5GP9 A;  3CME I;  4D1Q A;  3M1C A;  2QLZ A;  2XGD A;  4EJV A;  2TRT A;  2H1K A;  4Q4Z F;  1MJA A;  3CTA A;  1X19 A;  3VEP A;  2QEX I;  1U5T A;  1MBF A;  1Z77 A;  4UHT A;  1T38 A;  4DOZ A;  1ETQ A;  4II3 A;  2ESH A;  1APL C;  1BR4 A;  3O8G A;  2VON A;  5F0H A;  1LDK B;  1ZRF A;  3HHG A;  1UZC A;  4HPQ A;  2KRF A;  3KZY A;  5J47 A;  2VXD A;  2CW7 A;  3IL2 A;  3K7A J;  1MBE A;  3DFG A;  3CCQ I;  2KKO A;  3L2R A;  3M9A A;  2D1H A;  1W5T A;  1W7P D;  2F5F A;  4MNU A;  1G3S A;  1ETO A;  2JA6 J;  5M5W J;  1YLF A;  2M2E A;  1TQM A;  3V7R A;  3I53 A;  1ONV A;  2J5P A;  3H36 A;  4XSX F;  2NNN A;  1VQ6 I;  2ZJR F;  1DPR A;  3SZP A;  2A6E F;  2DN0 A;  1Z67 A;  3F6O A;  2DT7 B;  5JVT A;  1JUP A;  2OTJ I;  2KZV A;  1S7A A;  1PUE E;  3UNG C;  3HDD A;  1XSX A;  4BE0 A;  2ELK A;  3KEY A;  2VBZ A;  4YFX F;  3FIW A;  5J8C A;  5L3C A;  1SD7 A;  2XDV A;  3S15 J;  2EZK A;  1NG7 A;  3PL8 A;  1HQC A;  5ICE A;  4HRI A;  4FX4 A;  2K27 A;  2MYS A;  2X6Y A;  3DU6 A;  2HVS A;  1GUU A;  3AG1 H;  1XD7 A;  3E5Q A;  5IY5 H;  4OWR B;  1T95 A;  2L7M P;  4RAG A;  1BC8 C;  5HDN A;  1MMS A;  2P5K A;  2IA2 A;  4IQ4 A;  3OR2 C;  4RDU A;  3GTP J;  5M5Y J;  3S3N A;  1IW7 F;  2PLY A;  5CVV A;  2RAE A;  1O7L A;  2BHZ A;  1HXD A;  1ZN2 A;  3QU6 A;  5TRD A;  1VQ9 I;  4M3B A;  3I3L A;  5AIP A;  4D0P A;  4D7N A;  2L0K A;  2L02 A;  4KA4 A;  3HOV J;  2K3F A;  4LMY A;  3CCM I;  2PJR A;  3GTQ J;  2E71 A;  2ZXI A;  3I4N J;  2QA4 I;  2LVS A;  2B7E A;  2D1V A;  3ZQG A;  3JRI A;  2ZME B;  4L9V A;  3KP3 A;  4YRV A;  1XGS A;  2EFQ A;  4RMN A;  2AXL A;  3CCE I;  2EB7 A;  1WSU A;  5LBQ A;  2XSJ C;  1BJZ A;  4V2G A;  4F55 A;  3N4M A;  4MGR A;  4L0Y B;  4KIB A;  3HEF A;  3OYH A;  4J00 A;  4ZDO A;  3B6A A;  1GT0 C;  5FLX Z;  4A12 A;  5DD8 A;  3LSM A;  3HC7 A;  3WTT C;  3LNQ A;  4RS8 A;  2UV1 A;  5BNG A;  2NOG A;  3WTS C;  3DWL E;  3OY9 A;  1CF7 B;  2K85 A;  3WGI A;  4BQO A;  1VQ5 I;  2PBI A;  1LKX A;  4XLC A;  3CMM A;  3HOW J;  4CUG A;  3A1Y A;  5CLS A;  4BKX A;  4E7L A;  2F4O B;  4B44 A;  4DZP A;  1LPQ A;  3Q9S A;  3JCU C;  2ZNY A;  5IT9 K;  2EFP A;  1TWH J;  2GWR A;  2V1N A;  3CCS I;  3S3M A;  3BRO A;  1FX7 A;  4KIF A;  2XAU A;  1V5F A;  4U7D A;  4HX8 A;  1PUF A;  1E0E A;  1BM9 A;  4M71 A;  1WJC A;  5FRM A;  4HNV A;  5CPR B;  3GLX A;  2KJB A;  5J8F A;  2HOE A;  3COA C;  3GF2 A;  1JKP C;  2OAZ A;  4NQW A;  3OYE A;  4UB8 C;  5GPC A;  2W85 A;  1W4M A;  1T39 A;  4GRI A;  3TW7 A;  1Y6I A;  2LK2 A;  4YFN F;  1JT6 A;  1BJA A;  5K7Z A;  2HI3 A;  1XCV A;  1UG0 A;  2MBF A;  4XRS A;  3FMQ A;  3S2W A;  1X1P A;  5E17 F;  3KEQ A;  5KHD A;  4I99 C;  4KN4 X;  2VBW A;  2A61 A;  3DP7 A;  1LJ9 A;  2JVG A;  1JHF A;  5J3L A;  1XGM A;  3JRB A;  5IYD J;  5LEJ A;  3DLL F;  3JRA A;  1MD0 A;  3ASN H;  2O3F A;  3W2A A;  3G1L A;  1IRZ A;  5B66 C;  1K4T A;  1R00 A;  1JUS A;  2DFE A;  4ENM A;  2XAH A;  5HNF A;  5IP7 J;  2ISZ A;  3G71 I;  1W1W E;  2DLL A;  3HUG A;  4EJO A;  4ZYD A;  2QBY B;  1G2H A;  2VB6 A;  3ULQ B;  2M30 A;  2CYY A;  1KYW A;  2AQE A;  2AO9 A;  4BHP A;  3FIS A;  2TDX A;  3JRD A;  2D5V A;  2A6T A;  5A2Q K;  3GFI A;  4CZZ A;  5HS9 A;  1SEU A;  3C2B A;  3OS0 A;  2DMN A;  3AKZ A;  2K4B A;  3P5J A;  4C2M J;  5M5X J;  5K1Y A;  1B8I A;  2COB A;  3G3Z A;  4XK4 A;  2RQQ A;  4KIC A;  2KQR A;  3IC7 A;  3PUF A;  1WH5 A;  5FKK A;  1TW2 A;  2L7F P;  2FOK A;  2L3D A;  1IUF A;  4KJZ A;  3D1N I;  3QQA A;  2UXX A;  1FOY A;  3MQ0 A;  1TWA J;  3LFK A;  2ZNZ A;  2IVM A;  4YII A;  1KZH A;  4AID A;  3DLA A;  1BW5 A;  2ZSI B;  4HSR A;  3L2W A;  1EJ9 A;  1ETX A;  2Y9Y A;  2DYS H;  2LBF B;  4OIQ F;  2WAE A;  3DV8 A;  2NVQ J;  4LLN A;  1MBH A;  4BJT A;  1ZGJ A;  5LLQ A;  4G6T B;  1RNL A;  1T0F A;  3PSI A;  1IXS B;  3HM5 A;  3A2K A;  1HW1 A;  2PMZ N;  4P96 A;  3GXO A;  1ZG3 A;  1HKT A;  4MFE A;  2X1D A;  4IO9 F;  4HQE A;  4XIC A;  4A3B J;  5LHI A;  1XN7 A;  3MVP A;  3L2U A;  3N05 A;  3OYJ A;  3BG5 A;  1E3H A;  2GOM A;  5DCF A;  4I6Z A;  1ACI A;  1DUX C;  3QOE A;  5JLW A;  4A93 J;  2LRD A;  1VQP I;  1SD5 A;  5DUI A;  2K5C A;  1UHS A;  4Z2Y A;  2MLG A;  4LGW A;  2WA0 A;  3HTU A;  1TP4 A;  2DTR A;  2W84 A;  1ZLK A;  2FQ3 A;  4UY8 I;  2XAF A;  3F8B A;  3Q0W A;  3ZQI A;  1Y1W J;  3K69 A;  3MAJ A;  1TNT A;  1TT0 A;  3WTU C;  4LD5 A;  1UB9 A;  2E19 A;  4A3K J;  2PJP A;  4E7K A;  1UJ8 A;  3E7L A;  4W1U A;  5KVR A;  1T08 B;  1Z9C A;  2GM4 A;  4QSH A;  1NHA A;  2CO5 A;  2VKV A;  1U8R A;  3I54 A;  2V9V A;  2PMZ A;  3GLL A;  1BOA A;  2DI3 A;  1WKM A;  4ESJ A;  4EQQ A;  2RV8 A;  1QRY A;  5J4V A;  2LC2 A;  2R93 J;  1BR1 A;  1TNS A;  5L3G A;  3L1P A;  3HOY J;  3DPU A;  3LA7 A;  3SEZ A;  1NK2 P;  2EV5 A;  4M72 A;  2NAZ A;  3RDI A;  3T0Y A;  1VQ7 I;  2XB5 A;  2H1L A;  2IS6 A;  2R7Z J;  3AG3 H;  1VZ0 A;  4I98 B;  5FJ8 J;  4Y3O A;  2R7O A;  1ZAO A;  1Y8Q B;  1PP8 F;  1Q1H A;  3A0H C;  4RBO A;  2WY8 Q;  3LAJ A;  5L3E A;  2R7U A;  3HL2 A;  5IOZ A;  3GTM J;  3E6B A;  4Y15 A;  2DJI A;  1Z1D A;  2X6O A;  1RI7 A;  1WPK A;  2EA4 A;  1HLV A;  4Y17 A;  2L9V A;  2KZG A;  3X2Q H;  1OYI A;  2XV4 S;  2YUS A;  2DA6 A;  1R22 A;  3FKI J;  1ZRC A;  5F1J A;  2Q2E A;  4XN3 A;  5FFZ A;  3ABU A;  1G59 A;  3BTJ A;  3HPG A;  3SQN A;  2L4A A;  3A03 A;  5EZG A;  5GTH C;  3GTG J;  2XC7 A;  1FMW A;  2R3S A;  3MZ8 A;  3NWS A;  4JBA A;  3RKY A;  1IUY A;  1FBS A;  2VT3 A;  5J6X A;  4G6Q A;  1XB4 A;  2MLK A;  4FET A;  2DMU A;  2IA1 A;  2X0L A;  4WF2 A;  1CF7 A;  4GYG A;  1LFP A;  3VOE A;  3WU1 B;  1TWC J;  2V6C A;  2R5Y B;  2R7S A;  2ISY A;  2M7A A;  3K2A A;  2AS5 F;  2MH9 A;  1RPW A;  2EH3 A;  1ZR2 A;  4IHX A;  2Z1D A;  1FMV A;  2EQR A;  3FM5 A;  1FTZ A;  3IAS 2;  5B3S H;  5F1R A;  2HOS A;  3J7A Y;  3VYU B;  2EWN A;  2VOP A;  5ERI A;  3RYR A;  3L2Q A;  3ABM H;  3KP6 A;  2K3P A;  1GV5 A;  3CUQ A;  1ZRE A;  1U9O A;  1B9N A;  4C3I J;  2WAQ N;  3BR0 A;  4PJL A;  2XPU A;  3KP2 A;  2M1B A;  3J80 Z;  1KON A;  3QPH A;  3K4C A;  3LSP A;  2F48 A;  3FMS A;  1A5J A;  5CQG A;  4KFC A;  1HDD C;  1DDN A;  2GAU A;  3CCV I;  2JMW A;  3ZQL A;  4NC8 A;  2F4M B;  4J01 A;  1WWX A;  3F22 A;  2N8G A;  3LSK A;  3DTI A;  4IRI A;  1RKW A;  3TP0 A;  3DTK A;  2CFO A;  2LMD A;  4XKB A;  1MBJ A;  5ILU A;  4BHB A;  4HNT A;  3V4G A;  4JK1 X;  4D7M A;  2DXI A;  1W5S A;  3RJP A;  1WGX A;  2IS1 A;  1XTA A;  3CJR B;  2FRH A;  2DO7 A;  4HF1 A;  1N78 A;  5HLT A;  4MTD A;  4AIH A;  4RM2 A;  1ZKG A;  3D5S C;  2GXG A;  2ETH A;  3RQ4 A;  3IAM 2;  3IV5 A;  4M73 A;  2VPR A;  4JOM A;  1V54 H;  4E70 A;  3M07 A;  4PFO A;  3CP2 A;  3H92 A;  4I2O A;  3CLQ A;  4ZYH A;  3RKW A;  4UUT A;  2KIQ A;  3QPT A;  3QPS A;  4KMU X;  4RGR A;  1TTY A;  3HZJ A;  4XLP F;  5D5U B;  3HSE A;  5JI6 A;  3ELK A;  1MJB A;  4OOI A;  2MC3 A;  4KIG A;  1G6N A;  1SFX A;  4FT8 A;  1QPI A;  3CF2 A;  2Y48 A;  1RZ4 A;  4N9H A;  1R1T A;  2VOO A;  2BV6 A;  5B1A H;  2ECC A;  2R7T A;  2DT5 A;  5HOD A;  3MN2 A;  5DS9 A;  1R1U A;  3SFZ A;  1BI2 A;  2O5R A;  4ENN A;  1HKQ A;  3DEE A;  4YG2 F;  2QVO A;  4BQA A;  1P9Q C;  4Q47 A;  4JX6 A;  3UKG A;  5LHG A;  2RC4 A;  2FX0 A;  3BR6 A;  3C2G A;  3ZMZ A;  5IT9 Z;  2LY2 A;  3OYA A;  5H20 A;  1I39 A;  2CUJ A;  1VF9 A;  4XLE A;  1U3E M;  5GTI C;  3EPZ A;  2FJ1 A;  2STT A;  4P55 A;  2COM A;  2IP2 A;  3E5X A;  4HAM A;  4WWC A;  3ROU A;  2BZT A;  1N77 A;  1U6G A;  1H8A C;  3HXL A;  2JA8 J;  3OYB A;  3C1D A;  5DV5 A;  5FD5 A;  2Z33 A;  3HRS A;  1YJW I;  1OLT A;  2P0W A;  4HA8 A;  1IXC A;  2K9M A;  1R9T J;  3S2H J;  2VKD A;  2QM3 A;  5JR3 A;  1QHG A;  3DU5 A;  4BS9 A;  4UUS A;  5EEA A;  4KT5 C;  1A31 A;  4JX4 A;  5F64 A;  2NOJ B;  1RET A;  1T6S A;  1SD6 A;  4KUM A;  5E18 F;  3HOT A;  4NQW B;  3S1N J;  3GEZ A;  3Q5F A;  2W57 A;  1W0U A;  3RYP A;  5K5O A;  4V19 K;  4HEA 2;  4ABZ A;  4FX0 A;  2R0Q C;  1WVR A;  4WK8 F;  2VBY A;  3LQR A;  3GTO J;  1S8N A;  3F9K A;  1LEA A;  4EGY A;  1NK3 P;  2MAB A;  4JQF A;  4UNO A;  3KLO A;  3JAM K;  2VIX A;  1IDZ A;  5FKN A;  4OAZ A;  3OR1 C;  1OCR H;  2E35 A;  3L00 A;  1K78 B;  4BJ5 C;  2WC2 A;  5E20 A;  1XPX A;  4MEX F;  1ETW A;  2R7V A;  4A5N A;  1OIS A;  3OYK A;  2XPW A;  3K2Z A;  3EYI A;  2M4K A;  3CJT B;  3WOD F;  4CIC A;  1TLH B;  4RGU A;  2BY1 A;  1MZB A;  1FPQ A;  2HXO A;  3OL3 A;  2XGX A;  1IRG A;  3E5U A;  2DU9 A;  4IRH A;  2A68 F;  4QIW N;  2Z9O A;  1J09 A;  3NRV A;  3G4S I;  3K1N A;  1JKQ C;  1Z05 A;  2RDP A;  2X48 A;  3CC4 I;  2HYG D;  3BOQ A;  4PDK A;  1NH3 A;  3TOB A;  4KYW A;  4B1R A;  2KFD A;  3OYL A;  1ZQ3 P;  1KU3 A;  1IG7 A;  2CQK A;  2LKP A;  5LGN A;  1AHD P;  5HDG A;  2OV7 A;  3GCM A;  4LOC A;  2WY7 Q;  4EJU A;  1JTX A;  2OZU A;  2A5W A;  2MFZ A;  2DW4 A;  3ZMU A;  4IXA A;  4II2 A;  3BWG A;  3ML6 A;  2PX9 A;  4C2T A;  2FOW A;  3FBN B;  1IRF A;  5ILS A;  4IOC F;  3CO6 C;  1FSE A;  5KCM A;  4LFU A;  1KQ8 A;  4NNJ A;  5FLX K;  3RI4 A;  1Y8R B;  4AVP A;  3KP7 A;  3RZO J;  2LBF A;  2KL4 A;  2RRE A;  4RAF A;  4RGS A;  4EM2 A;  3HOU J;  2IT0 A;  1XX5 A;  3F8N A;  2VT2 A;  3TL4 X;  2BYV E;  2KIS A;  4GGG A;  4ZDP A;  2L7Z A;  4PFP A;  3P7N A;  4Y7N J;  2IGO A;  2HQN A;  1FT9 A;  1K6Y A;  2G7H A;  3HIF A;  1TQP A;  4AUX A;  4ZDL A;  1KGS A;  2JTV A;  4CYC B;  2XHK A;  5EZH A;  5C3E J;  4IL6 C;  4NBQ A;  2IRF G;  1D8K A;  2O03 A;  4FE4 A;  1ZEL A;  3K4N A;  1X2N A;  1X3Z B;  3CCY A;  3F8M A;  4CDG A;  1VQL I;  5E8I A;  2GBY A;  2V1X A;  4CSW A;  3F8F A;  2EIL H;  5EJC A;  1EA3 A;  1FBU A;  5CQE A;  1ZAR A;  2EIN H;  3AG4 H;  2JWT A;  2OA4 A;  2JPC A;  2H6B A;  4A3I J;  1EKE A;  1G3Y A;  5E3N A;  2H09 A;  3ZN0 A;  2LYC A;  3F21 A;  2R7Q A;  1DU0 A;  2TCT A;  5IYB J;  2M8G X;  1WJF A;  1I27 A;  1YW8 A;  3QP6 A;  4FHT A;  4CXF A;  1RES A;  4FE7 A;  4HV5 A;  2MSY A;  2OQR A;  3SXY A;  4N0B A;  3FK7 A;  4BBR J;  4UB6 C;  4R79 A;  4LG0 B;  4S04 A;  2K9N A;  3L7W A;  1K78 A;  1YJN I;  4RM3 A;  1S3J A;  3BJA A;  3KCC A;  4HDU A;  1MKM A;  4CGZ A;  1D5V A;  3SZT A;  3S3O A;  3JRE A;  2CU7 A;  3VSK A;  4AU7 A;  1PDN C;  3BTC A;  3UR3 C;  4ENJ A;  1LE8 B;  1I5Z A;  3ESW B;  2H6C A;  5BMZ A;  2PEX A;  4Q48 A;  2HR3 A;  2LF7 A;  1VI0 A;  1SD4 A;  3GVA A;  5BQT A;  1W5C C;  4I0A A;  2VKE A;  3BQZ A;  4BAY A;  3VDX A;  3ZMV A;  1AKH B;  3DPT A;  4QTR A;  1HOM A;  4CCM A;  2WAD A;  3J81 Z;  2E2H J;  3HOZ J;  2C6Y A;  2E1N A;  2OBP A;  3U9G A;  3LSJ A;  2EPF A;  1TZL A;  3OYI A;  1P4A A;  3ZQH A;  3V42 A;  1LDJ A;  2QSF X;  2O7O A;  2B63 J;  1FJL A;  2LY9 A;  2XAJ A;  4EM1 A;  3WG7 H;  3WU0 A;  2STW A;  3FXR A;  2ZJ2 A;  4TV7 A;  2E1M C;  3PM1 A;  4ZZD A;  2CQX A;  3TED A;  2ZB9 A;  4AIJ A;  2K7L A;  1RR7 A;  1HW5 A;  1J75 A;  5HOO A;  4M3D A;  3CJQ B;  3N97 A;  1XMA A;  2EIM H;  4L5I A;  2QKM B;  5D5W B;  2FNA A;  3VB2 A;  2IBD A;  3IH3 A;  4ZTJ A;  3H5R A;  3OYF A;  3A02 A;  4WXC A;  3LMM A;  4HF0 A;  3BCB A;  5J1R A;  4GFB A;  4Z6Y A;  2NS7 A;  2QQ9 A;  4C2U A;  3BY6 A;  1ODD A;  2JVH A;  2W00 A;  3RIR A;  1O7F A;  5K7H A;  2ZJQ F;  1YE9 A;  3ZGK A;  3WHB A;  1YI2 I;  3EUK L;  1T98 A;  2CRG A;  4PJN A;  1U5T C;  2KHM A;  2MW8 A;  3I59 A;  1OFC X;  3GX4 X;  1A35 A;  2X51 A;  3JR9 A;  2HQ5 A;  5HNH A;  2DT6 A;  4GCV A;  3MKZ A;  1C0W A;  1PJR A;  1WI3 A;  2O61 A;  3J7Y J;  2ZXW H;  2ME6 A;  4BE1 A;  4A0Z A;  1E3P A;  3SJM A;  2QCO A;  3R0J A;  5CKT A;  3OOP A;  2X1E A;  2E1M B;  3BG3 A;  2VJ4 A;  2M3A A;  5J1Y A;  1WQ2 A;  3T8R A;  2NS8 A;  3KPH A;  4Q5S F;  1A6I A;  5F27 A;  4IKF A;  1KQ9 A;  2ID3 A;  1ZR4 A;  3OIP A;  1FC3 A;  4DBQ A;  5FO5 A;  3I0T A;  5DUK A;  3S32 A;  3GFL A;  1NTC A;  2Y2Z A;  3HKZ N;  1AA7 A;  1R58 A;  4BDZ A;  3DQV C;  3KIO A;  4HYE A;  4HBL A;  2K9S A;  3EUA A;  4BH9 A;  1SAX A;  1YFH A;  3IRR A;  6PAX A;  2VE8 A;  4B47 A;  5GPA A;  1UHW A;  2X6X A;  3BG7 A;  4NB5 A;  1XS9 A;  4YEL A;  1GXP A;  4OIR F;  1FBQ A;  4B4C A;  5IYC J;  3KZZ A;  3K6G A;  5IP9 J;  2CJJ A;  3ZQF A;  1YW9 A;  4CCL A;  5KK1 A;  1IZ1 A;  2H94 A;  3GBG A;  4MO7 A;  2XGE A;  3DF8 A;  1DGW Y;  3OYD A;  1K7A A;  1H9T A;  4A0X A;  2HTS A;  2FE3 A;  5F6F A;  2H8R A;  2NNY A;  1WJE A;  1HST A;  2PQ8 A;  3JRC A;  2XAQ A;  4A3L J;  3LFU A;  3RPU D;  5LHH A;  4DBR A;  4B09 A;  2VQL A;  5B5E C;  5FB2 A;  5HLH A;  1G8X A;  4EM0 B;  1ZK8 A;  3HRM A;  1BIA A;  2R7R A;  1D8J A;  4L18 B;  3F8C A;  5LFA A;  1XDU A;  2LKX A;  4R8H A;  3DKW A;  4P9U A;  1JGS A;  2ZJP F;  3IP4 B;  4PJ0 C;  1JJ6 C;  2L2O A;  1R36 A;  3ERE D;  2QYO A;  4ASN A;  4E4H A;  3HGY A;  4EGZ A;  4FAS D;  1QU3 A;  3B02 A;  3PJR A;  5DEQ A;  1P92 A;  2Z2S B;  5DCM A;  1OJL A;  3H5N A;  3TW6 A;  3AAF A;  3FDY A;  1KA8 A;  1FNN A;  3OYN A;  5C4J J;  3ECH A;  5FFX A;  2IS2 A;  3W6V A;  2Q2E B;  2F4I A;  2DPU A;  1QQI A;  2ZCW A;  3EET A;  4XNF A;  1KQ0 A;  4ZJZ A;  2QQB A;  2M4G A;  3FXJ A;  1G4D A;  3CMA I;  2W48 A;  2KP6 A;  1O3R A;  4HX7 A;  3PIP F;  1ENH A;  2A6H F;  1Y39 A;  1MH4 A;  4KNY A;  2UUZ A;  3R6S A;  3CUQ B;  4HX4 A;  1R7J A;  2MH2 A;  3V7C A;  2XSD C;  4XLH A;  4CCN A;  1R71 A;  5EEG A;  2JSC A;  4RLQ A;  3NQO A;  3RTR A;  2KIM A;  2EZI A;  3ZMT A;  2HOT A;  1LFB A;  3I59 B;  2Q0O A;  1DPU A;  3CZ6 A;  2WV0 A;  3DPL C;  3KYC B;  4M6X A;  3H0D A;  1U2W A;  2NYX A;  3ZQC A;  2DMT A;  4Y13 A;  4AD9 A;  1W0T A;  1J59 A;  4U87 A;  1FWZ A;  3OS1 A;  3GTL J;  1TWG J;  1BW6 A;  1D0Z A;  3RZD J;  2HPM A;  2LR8 A;  3AL0 B;  3VOD A;  4M74 A;  3VWB A;  3G2B A;  3BZK A;  3W2W A;  2V1U A;  2JSP A;  2EK5 A;  1PVE A;  1YIO A;  4P1W A;  5FKO A;  4I09 A;  3E1S A;  2G0E A;  3V8L A;  4N4O B;  4G6D A;  3H35 A;  4BQN A;  1WJB A;  2LP0 A;  2XRO A;  2VJ5 A;  1BI0 A;  1REP C;  2QGU A;  3BPV A;  1BI1 A;  5AIQ A;  2RGV A;  4L9J A;  3ZXS A;  2XPV A;  1BIB A;  1YQA A;  2W25 A;  3GUD A;  2NRA C;  2M9H A;  2FD5 A;  3Q0V A;  2P4W A;  1XMK A;  4DYQ A;  1WJ5 A;  2X85 A;  4XRF A;  2VC1 A;  3OL4 A;  2Z3Y A;  2XRL A;  2QEN A;  3H3V K;  1D1C A;  3DBR B;  2W7N A;  2FUG 2;  3O3K A;  3HOS A;  4UUV A;  3HKZ A;  2NVU B;  2IEK A;  4A3F J;  1NG6 A;  3H9J A;  4RAY A;  3E6M A;  1MNE A;  2VE9 A;  1XCB A;  2VAS A;  3ASO H;  3C3W A;  3IH4 A;  2M7B A;  3ZCO A;  2F5D A;  1YOV B;  2P8T A;  3OSF A;  3TBI A;  4YFK F;  2WWY A;  1E17 A;  1MNM C;  1HDP A;  3S8P A;  4XKC A;  5D6F A;  5M3M J;  2DPD A;  4BXX J;  3BT9 A;  2CV1 A;  5E3O A;  3JW4 A;  3QAH A;  1P4X A;  2XVC A;  4XRM A;  1BBY A;  2IXS A;  1CQT A;  4C3H J;  3PIO F;  3LSH A;  3RKX A;  2R4G A;  4NDL A;  3P9K A;  2OU2 A;  3S93 A;  3WE3 A;  4XR6 A;  3QP5 A;  4MHG A;  2BHY A;  4IX7 A;  1DP3 A;  3U1D A;  5ED4 A;  1T33 A;  2FEZ A;  1WH7 A;  4A3J J;  3NEU A;  3IUO A;  2W24 A;  3I64 A;  3IKV A;  4EJT A;  3K9T A;  4I0B A;  2ZKZ A;  1YHQ I;  3PQJ A;  3ZMS A;  1ULY A;  3IKT A;  5E79 C;  3HOX J;  1K79 A;  2CUF A;  2V4J C;  1SFO J;  1FOW A;  2K02 A;  3I4M J;  4WXD A;  3D5L A;  2ZME C;  1SMT A;  1O57 A;  3GO5 A;  4K2E A;  3CP8 A;  2HU9 A;  3F0C A;  1Z6R A;  4XSZ F;  1I50 J;  4LB6 B;  2LH9 A;  4EVI A;  3ZPL A;  2DK8 A;  5EEH A;  2VXZ A;  4LLL A;  5BS6 A;  2X9D A;  1ZYR F;  4Y4R A;  1K6O A;  3BR1 A;  2QUF A;  4B8X A;  1VQN I;  1S6L A;  2GIV A;  5BPI A;  4OMZ A;  4A69 C;  5CVR A;  3FXU A;  2FQ4 A;  4CZC A;  1H89 C;  2XF5 A;  1X3W B;  3GFM A;  4KMF A;  2EZL A;  2QQ8 A;  3ONQ A;  3S14 J;  4EJW A;  2HNH A;  2CG4 A;  2QQA A;  3H5A A;  4RAZ A;  2O9L A;  5LRS A;  1HSJ A;  1U0J A;  2ELJ A;  2XF7 A;  3KEO A;  3PSF A;  2R5Y A;  1TQI A;  5LEK A;  4PK4 A;  3HRU A;  2M87 A;  2EFO A;  3DXJ F;  4Y33 A;  4XM3 A;  4BY1 J;  3VSL A;  2ME0 A;  3I71 A;  1WJA A;  2LF8 A;  1X58 A;  4I76 A;  4ZYG A;  4BYY A;  5GAE J;  4HF2 A;  1UFM A;  3U1K A;  1H0M A;  2L7K A;  1SC7 A;  9ANT A;  1ZG1 A;  1WRJ A;  3HSF A;  4S05 A;  3VYS B;  3ZN1 A;  4A0Y A;  3WE2 A;  3D0S A;  3U2R A;  4LB5 A;  1BL0 A;  1P2F A;  4LIT A;  2E60 A;  4EV0 A;  2M8E A;  1Z3Y A;  3FXK A;  2YS9 A;  2UWM A;  2Y30 A;  2DA2 A;  3TOA A;  4E7I A;  4CCO A;  4HZF A;  3CCR I;  1MGT A;  1MMD A;  2A07 F;  3C18 A;  2DJN A;  2GA2 A;  1R23 A;  2BY0 A;  5JLX A;  3M7G A;  3EDP A;  2D2W A;  3FK6 A;  4X0G A;  2KMU A;  1BR2 A;  4YIR X;  1FOX A;  4AYB N;  3TMO A;  1YJ9 I;  3M8F A;  1Y0U A;  4NC6 A;  1PUF B;  1MJ9 A;  3M8J A;  2L5Q A;  5HS8 A;  4C30 A;  1J9I A;  2XF6 A;  2JUC A;  2NVX J;  4LK0 F;  3CDI A;  3KET A;  3M3Y J;  2BGC A;  4M3G A;  4O6J A;  5FKL A;  3K4J A;  3O2P E;  4XL9 A;  3SEQ A;  1I3Q J;  2A3S A;  4ZH4 F;  5J4Y A;  1EF4 A;  3BR5 A;  3BJ6 A;  1Y56 A;  3FXM A;  2DOA A;  1FP2 A;  1GVD A;  5E1X A;  1HC8 A;  3QU3 A;  2HTJ A;  1WJD A;  5TIS C;  5CJ9 A;  4IRG A;  3B73 A;  2EBI A;  3KX2 A;  5HLI A;  1W7P A;  2ZBK A;  5A2Q Z;  3KP4 A;  1LVA A;  4RB3 C;  5FKM A;  3PFY A;  1PYV A;  4NHJ A;  3D5R C;  2IPQ X;  4HV6 A;  4BY7 J;  5GAD J;  1TW3 A;  2DQR A;  4L5E A;  3I4P A;  3FHN A;  3GYH X;  2XKP A;  1T56 A;  2ID6 A;  5ICG A;  1FIP A;  2P5V A;  3F6V A;  2WV1 A;  1IDY A;  3MEX A;  2RVC A;  2VPL A;  4LJZ F;  3E3V A;  4DIQ A;  3L9F A;  2X1C A;  4UXN A;  2H8W A;  2OQG A;  3LA2 A;  5J1U A;  3MWM A;  1F1Z A;  3HB9 A;  4L5J A;  3JTG A;  2E5Z A;  4BXF A;  4U0Y A;  1H88 C;  4IPA A;  3OYM A;  3IRQ A;  5TJJ A;  4D9J A;  4ESB A;  1F4K A;  2O0Y A;  3W6K B;  2UXN A;  4U88 A;  4U7B A;  1HA8 A;  1TWF J;  2KJC A;  4H4K C;  1AWC A;  1ZLJ A;  4RGX A;  3JTH A;  4AM3 A;  5DCM B;  2V6E A;  5JVG F;  1ON1 A;  3ECO A;  1S7O A;  1SVM A;  2DFH A;  4PSW A;  1F5T A;  2MC4 A;  3CC2 I;  2Y31 A;  2DQL A;  3TDZ C;  4M3E A;  4BEH B;  1AOY A;  1EV7 A;  1ZH5 A;  1A36 A;  4EAT A;  1VTN C;  1IN8 A;  2HYF A;  1R49 A;  5DD4 A;  2CSO A;  3ZQQ A;  3LSI A;  1FP1 D;  2P5L C;  1IN6 A;  2JA5 J;  2F2E A;  3HRT A;  2WB1 A;  3JRF A;  3FKJ A;  4IVN A;  2L9N A;  2DOD A;  4HG2 A;  5BOX A;  1D5Y A;  1YS6 A;  5D8L B;  2ZFW A;  3HG9 A;  1J0R A;  2QZ8 A;  2XUB A;  4XN0 A;  5F0F A;  3S1Q J;  3DBL B;  4HW0 A;  4IEJ A;  4XOP A;  2PMH A;  2CQ7 A;  2JJ7 A;  3S2D J;  1GXQ A;  3EUH A;  3LL7 A;  2WAQ A;  3HGG A;  1SAU A;  3ZR8 X;  4IZZ A;  2GXA A;  1M1E B;  1OPC A;  1D0Y A;  4IHS A;  1X4O A;  2JN6 A;  2O8K A;  1IC8 A;  3FM3 A;  2JUG A;  1O3Q A;  2ZFU A;  2Z5U A;  3R61 A;  4IJA A;  2R7D A;  1XG1 A;  3QYE A;  1P6R A;  1XGN A;  2CUZ A;  2D45 A;  2H27 A;  1FZP B;  4A3D J;  3IWF A;  4XLN F;  3OYG A;  1WZ2 A;  3OIO A;  5D4S A;  2QF7 A;  3GZ5 A;  2E1C A;  2HZT A;  4G9Y A;  3BZC A;  4UV9 A;  1YX5 A;  2BY3 A;  3M8E A;  3WG9 A;  5KAF C;  1IF1 A;  2VQC A;  2HDW A;  1ZG5 A;  2XB0 X;  3BDD A;  1I6X A;  4E7S A;  1ZGA A;  4O3M A;  2IW5 A;  3HBL A;  4XMY A;  4GXO A;  1HW2 A;  1X4P A;  4XBF A;  4ZYE A;  2FA5 A;  4A6E A;  3FZV A;  2DDA A;  3GZN B;  4BU2 A;  4CYC A;  3CO7 C;  1KU7 A;  1JKO C;  3ABT A;  3K70 C;  3E6C C;  2LTP A;  3E6D A;  3KYL A;  1P7J A;  3ABK H;  3O6B B;  4DYR A;  2MG4 A;  3OOU A;  2W82 A;  1MIJ A;  3WGH A;  1QZE A;  2V79 A;  1G3W A;  2ZME A;  2GOX B;  4ON0 A;  2ZXH A;  1WFX A;  2CQN A;  2HDC A;  5L3D A;  3OS2 A;  3A01 B;  5DDG A;  4OIN F;  1JJ8 C;  4QWQ A;  3LAP A;  3W6J B;  5E1Z B;  1ETK A;  1SFK A;  3REO A;  1T0F C;  4BJ6 C;  2YSR A;  4XLA A;  3S17 J;  1ZTR A;  2JRM A;  3GZ6 A;  1B4A A;  4YEJ A;  1LE8 A;  3CJN A;  4IHY A;  2VQG A;  1STZ A;  3HYI A;  1TL8 A;  3K10 A;  2NXN B;  4BDY A;  1I1G A;  1VQM I;  2A05 A;  2HVR A;  4F93 B;  2HZD A;  1HKS A;  2FXA A;  1YO5 C;  3SYT A;  5KNL A;  2LFB A;  3BG9 A;  3K0L A;  4OU0 A;  1GV2 A;  1O4X A;  2QSH X;  4UUS B;  1YYV A;  1YRN B;  4BBS J;  2IS4 A;  4XOR A;  3HHH A;  2YX4 A;  4P9F A;  1LVK A;  2ZO4 A;  2DCE A;  4F52 A;  2YU9 J;  1JGG A;  1QBJ A;  3H3U A;  3K4B A;  2OD5 A;  5GAH J;  2EZH A;  4D5C A;  4HLY A;  3FXQ A;  5HS7 A;  2GQQ A;  5M3F J;  3ZQ7 A;  2Q8K A;  2A69 F;  2F5V A;  4ZZL A;  2O8X A;  2LY1 A;  2JT1 A;  3RSN A;  2PMU A;  3PUB A;  1JKR C;  1J2X A;  5IPA A;  4LG3 A;  1XDS A;  3OWT A;  4E7H A;  3GFJ A;  5HDK A;  1K83 J;  4O5V A;  4BQQ A;  3PNY A;  2DA7 A;  1D1B A;  1K4S A;  5FGM A;  4FIS A;  4KIT B;  4GYI A;  3SFI A;  2JQ7 A;  3F72 A;  5IOY A;  4AC0 A;  3VYT B;  1MW7 A;  1KU2 A;  2HXI A;  4MQV A;  3AL0 C;  1RKT A;  4KDP A;  5FRN A;  5LRR A;  1QA6 A;  1LFU P;  1D1A A;  3O8H A;  2DK5 A;  1P4W A;  2VC0 A;  2PFB A;  4YIF A;  4PJJ A;  4B43 A;  1MND A;  3TKY A;  5KAI C;  3E0J B;  1P7I A;  2CS3 A;  5D4R A;  3NWT A;  1ON2 A;  1J7K A;  3K4L A;  3FBI B;  4LIV A;  1GVJ A;  2VL8 A;  1FIA A;  2EIK H;  2MD0 A;  3HJE A;  5LGU A;  2P81 A;  2XKO A;  3CUO A;  1TT5 B;  1SAN A;  5K5R A;  2PI0 A;  4RB1 A;  1V3F A;  1V4R A;  3BTI A;  3FF5 A;  4LG0 A;  4NUB A;  2UZK A;  2HDD A;  2IA0 A;  2KIF A;  4M6Y A;  2K40 A;  3ABL H;  1Z0X A;  1ZGW A;  3C2H A;  4JX5 A;  2PJR B;  2VKH A;  3CDH A;  2WAF A;  4A3G J;  3ZRG A;  5DM7 F;  3M4O J;  3WGG A;  3PNT A;  3FX3 A;  3OIQ A;  4AYB A;  1XMX A;  2KLO A;  2XRN A;  3R60 A;  2V26 A;  4D5F A;  1FLI A;  2BBY A;  2R5Z B;  1G3T A;  4A3C J;  3MD2 A;  1X1D A;  2Z99 A;  4DYC A;  1JTY A;  4KIS A;  3P9I A;  1AU7 A;  1VND A;  2JK3 A;  4MFD A;  3MZY A;  2YPR A;  4ENK A;  2HKX A;  4B48 A;  5IT3 A;  1IN7 A;  3I58 A;  3VYR B;  2ELH A;  3E97 A;  3PNV A;  2DMQ A;  1GLN A;  4M9Z A;  3JRG A;  2BW3 A;  1RRJ A;  1L3L A;  2V1D A;  5FRO A;  4L0Z B;  4IHW A;  2HYJ A;  3EQL F;  4BAC A;  1QVT A;  1F43 A;  1QZY A;  4LIU A;  4G12 A;  3CDL A;  5DYM A;  1B72 A;  4BNC A;  1W7P B;  3J80 K;  2JPB A;  3CUQ C;  2BOL A;  1UHM A;  3R4K A;  5HLG A;  2ZXJ A;  2JZY A;  1F9N A;  3RCO A;  4Y52 J;  3MKY B;  4HQM A;  4LLG F;  2LOO A;  4AWX B;  2FBK A;  1QHH D;  2LDU A;  2K9Q A;  4DW6 A;  1UCR A;  4V2F A;  2ZSH B;  4ANJ A;  4DQ2 A;  1QVU A;  4IF4 A;  3J81 K;  1FYL A;  2P6T A;  3TO6 A;  2GXB A;  2BY2 A;  4XOT A;  2G7U A;  3HUG B;  2EIJ H;  4DNC A;  3ERM A;  2HKO A;  3WHC A;  4BE2 A;  4ESF A;  1HF0 A;  4M6V A;  5L3B A;  3LWF A;  2Z16 A;  5FD6 A;  2BXY A;  3AG2 H;  2E5N A;  3F23 A;  1SVO A;  3I5U A;  4R1H A;  4EEF G;  2E34 A;  2I10 A;  2ZC2 A;  2EV0 A;  2K86 A;  2P6S A;  2CGP A;  4J19 A;  5EG0 A;  1DU6 A;  1B8I B;  3Q3S A;  2FF4 A;  4PGG A;  2CH0 A;  3IWZ A;  4I02 A;  1U8B A;  3DTE A;  5IP6 A;  3H9Q A;  1HBX G;  1A6Q A;  2WB1 N;  2M0M A;  2PN6 A;  2FSW A;  2KRH A;  3BLY A;  1QO0 D;  2L54 A;  5EGO B;  1TBX A;  3VFZ A;  2DOE A;  5F04 A;  1OCO H;  2LRE A;  1IAW A;  2NVT J;  3CCL I;  4MQ9 F;  1MMN A;  4RB0 A;  2R7W A;  2BVL A;  3QPL A;  3BR2 A;  3PO2 J;  1ORK A;  2XAS A;  1WHU A;  3TDU C;  5EF6 A;  4DZJ A;  3L2C A;  2FML A;  3WTV C;  3KYD B;  2Y0M A;  2LD5 A;  3TGN A;  1LNW A;  3LSG A;  1T8I A;  3K70 D;  3OSG A;  2P7V B;  2OPT A;  1ZHF A;  4P5O A;  3K1M A;  1VQ8 I;  1QZZ A;  1ERD A;  3H3Z A;  3QWL A;  2DBB A;  2ADU A;  3TO9 A;  2KT0 A;  5H6R A;  4A6D A;  3SDB A;  1JT0 A;  2ACJ A;  1RUN A;  2QWW A;  3KE2 A;  2QSG X;  2L4M A;  1MBG A;  2FMY A;  1WI9 A;  2WTE A;  2DDB A;  2LNB A;  2OCC H;  4ETS A;  3DKY A;  3ZOB A;  2DYR H;  1IV6 A;  1YIJ I;  1UMQ A;  1F36 A;  2RQP A;  1VQO I;  3WTZ A;  1FYM A;  3JSP A;  1Z6T A;  2Y9Z A;  4PSX A;  5FLV A;  2EJR A;  3HPH A;  4U0V A;  3IH2 A;  2AQF A;  3A01 A;  1VQK I;  1X1C A;  4F92 B;  1CGP A;  2FBH A;  1W36 D;  4W97 A;  4UV8 A;  4CYD A;  1XC5 A;  3JAM Z;  4B3X A;  2LLK A;  1HCR A;  1WCM J;  4N4N B;  2HVQ A;  5EGO A;  2VN2 A;  1R4M B;  1IRX A;  1Z91 A;  5D5V B;  3DKX A;  2HWV A;  2RNJ A;  2X6W A;  1A04 A;  2YU3 A;  2M0C A;  3T5X A;  4HST A;  5EDN A;  4OMY A;  2MD5 A;  2IGM A;  3FXL A;  3CMY A;  2OC6 A;  1S72 I;  2G9W A;  5TGT A;  1EH6 A;  3U21 A;  1W36 C;  2R5Z A;  1YG2 A;  4WCG A;  2DA3 A;  2L01 A;  1N75 A;  3TO7 A;  2VUM J;  4ZTF A;  3MKW B;  3BP8 A;  1DQU A;  1OYW A;  2AHQ A;  4EMS A;  3FMR A;  3W3C A;  2GA1 A;  3QRF F;  1OR7 C;  4IHT A;  1MBK A;  2E36 A;  4M9S A;  2Y69 H;  3CCJ I;  3LSR A;  3MFK A;  1FTT A;  1RIO H;  3K1P A;  1IV8 A;  2V7F A;  3RPQ A;  3CF5 F;  2KIU A;  3CES A;  1IJW C;  4X1E A;  2E2I J;  4BXU A;  1H9G A;  2MGQ A;  4RA2 A;  3I56 I;  1XSD A;  2QBY A;  3PFI A;  1O3T A;  2QKL B;  5E3L A;  3HTS B;  1TC3 C;  4FCY A;  4QPQ A;  3RQI A;  4F7Z A;  1MSF C;  1IXR C;  5K7F A;  2F5C A;  3Q9V A;  4XRS G;  1B72 B;  1LQ1 A;  2VI6 A;  1EH8 A;  2OF7 A;  3DEU A;  4CCJ A;  4ITV A;  3FHZ A;  1FSH A;  2FU4 A;  3K4K A;  1QNT A;  2VJJ A;  4UVB A;  2V9P A;  1OQY A;  1S9H A;  3PQK A;  4AVZ A;  3A0B C;  5F0C A;  5D8K B;  5ILV A;  2VLA A;  3ZP5 A;  4IOA F;  1FY7 A;  3SHF A;  5B1B H;  4PCQ A;  2DTZ A;  4H0E A;  1Z3X A;  2HGC A;  1KYZ A;  1N25 A;  2L9S A;  4KN7 X;  4XKW A;  1S5L C;  1BI3 A;  2CFX A;  3EYY A;  3DBH B;  2RKH A;  1QPM A;  3LOC A;  2PG4 A;  1R5H A;  2DAO A;  3LQQ A;  2IJL A;  4I01 A;  4XKV A;  2MA3 A;  2DA5 A;  3CCU I;  4WX9 A;  1MMG A;  1B6A A;  3QOP A;  1YX3 A;  3SDG A;  1U5T B;  2FNP A;  4KT6 A;  3V8K A;  4HDV A;  3QYF A;  5LD2 C;  2ECB A;  1X2M A;  4QLC U;  1SFE A;  2M45 A;  3MZH A;  2P7C B;  4G7O F;  2CQQ A;  4A3M J;  2I8D A;  3VPR A;  3I55 I;  1ZRD A;  4PUS A;  3K4M A;  1MSE C;  1O3S A;  3WTY C;  3A4C A;  3BZ6 A;  1D3Y A;  2DOF A;  1JHH A;  1SFU A;  3ISP A;  2M5W A;  2CV2 A;  5E3M A;  2E1O A;  1S7E A;  3GWZ A;  2EA2 A;  2W4S A;  3T8T A;  1FEX A;  3S1R J;  4G94 A;  3NAU A;  2AXT C;  4UVA A;  2VOD A;  5C4X J;  2F6C A;  3DEW A;  1MDM B;  2OTL I;  1JUM A;  3R0A A;  4DGW B;  5FLM J;  4IHV A;  1Q1V A;  3BTL A;  4A3E J;  4G8X A;  1OKR A;  4NC7 A;  2JA2 A;  3BR3 A;  3OMY A;  1JI8 A;  4HNU A;  3H9G A;  3WU2 C;  2JA7 J;  2Y0S N;  2E2J J;  1RR8 C;  3KZI C;  2KRC A;  2Y0S A;  2RN7 A;  4BL0 B;  4XID A;  2BEO A;  3MKL A;  1XSV A;  4OAY A;  5EG0 B; 
#chains in the Genus database with same CATH homology
 2HFH A;  2HQR A;  1PP7 U;  4L9N A;  3IHU A;  2XIG A;  5JHU A;  5LGT A;  1J5Y A;  2E7X A;  3T1B A;  2ESN A;  1OMI A;  4G7Z F;  2J5O A;  3MCZ A;  5JFR A;  4PZJ A;  1LDD A;  4BHC A;  5D5X B;  1LB2 A;  1X3U A;  5CVI A;  2VBX A;  4MEY F;  4CHU A;  2HS5 A;  1SMY F;  4GO1 A;  4A5M A;  4MTE A;  4A2U A;  2A5Y B;  4UVC A;  3ZMD A;  1FOK A;  4PGH A;  2F5E A;  3OV8 A;  4M9X A;  3M1E A;  2X4H A;  3KFW X;  5CVJ A;  1JE8 A;  1L0O C;  5E1W A;  1B59 A;  2FBI A;  2B0L A;  2LSO A;  5ICC A;  5K5Q A;  1S29 A;  2NS0 A;  5HVQ C;  3BJO A;  1B9M A;  1EH7 A;  2K4J A;  4U0W A;  3LA3 A;  4L9T A;  3GW2 A;  5AON A;  1LEB A;  2EFW A;  2JRT A;  2GZW A;  2Y75 A;  1U78 A;  1R5G A;  3KLN A;  2BE5 F;  1R1V A;  5ICF A;  1JXS A;  5CVU A;  4HLX A;  1OYY A;  4HOB A;  4N9I A;  1IN4 A;  3L09 A;  3V8J A;  1UST A;  1RUO A;  2EV6 A;  3C7J A;  3RPU A;  4OIO F;  2CWE A;  3CLO A;  2E7W A;  1USS A;  1KU9 A;  2O6G E;  4AIK A;  3HSR A;  1E2X A;  1DP7 P;  1I1S A;  1MDM A;  1FYK A;  1GHC A;  1B1B A;  2EFN A;  5D6E A;  3KP5 A;  4RB2 C;  2HEO A;  2XAG A;  1YW7 A;  5L3F A;  4LK1 F;  2R7F A;  4I7H A;  1BN5 A;  4WXH A;  5H6Q A;  3BPX A;  3WTX C;  1OR7 A;  3P9C A;  5CYV A;  3TQN A;  1BC7 C;  2OZ6 A;  2YX7 A;  3V7S A;  1YTY A;  3J7A O;  1XGO A;  3LST A;  2CW0 F;  4CO8 A;  2DFI A;  3WTW C;  5E8G A;  3JSO A;  3G73 A;  4OIP F;  2YR2 A;  5BPD A;  1Z7U A;  1QGP A;  3F3X A;  4G7H F;  3FWE A;  1T2K A;  1IN5 A;  1YS7 A;  4EJV A;  2QLZ A;  4Q4Z F;  1MJA A;  3CTA A;  3VEP A;  1U5T A;  4UHT A;  1T38 A;  2ESH A;  2VON A;  1LDK B;  1ZRF A;  3HHG A;  2KRF A;  3KZY A;  3IL2 A;  3DFG A;  2KKO A;  3M9A A;  2D1H A;  1W5T A;  1W7P D;  2F5F A;  4MNU A;  1G3S A;  1YLF A;  1TQM A;  3V7R A;  3I53 A;  1ONV A;  2J5P A;  4XSX F;  2NNN A;  1DPR A;  3SZP A;  2A6E F;  3F6O A;  5JVT A;  1PUE E;  1S7A A;  1XSX A;  2VBZ A;  4YFX F;  5J8C A;  5L3C A;  1SD7 A;  1HQC A;  5ICE A;  4FX4 A;  2K27 A;  1XD7 A;  3E5Q A;  1BC8 C;  5HDN A;  2P5K A;  2IA2 A;  1IW7 F;  2PLY A;  5CVV A;  1O7L A;  3QU6 A;  1HXD A;  1ZN2 A;  5TRD A;  5AIP A;  4D0P A;  2L02 A;  4KA4 A;  4LMY A;  2D1V A;  2ZME B;  4L9V A;  3KP3 A;  1XGS A;  2EFQ A;  2AXL A;  2EB7 A;  1WSU A;  5LBQ A;  3N4M A;  4MGR A;  4L0Y B;  4KIB A;  5FLX Z;  4A12 A;  5DD8 A;  3WTT C;  4RS8 A;  3WTS C;  1CF7 B;  3WGI A;  2PBI A;  5CLS A;  3Q9S A;  2ZNY A;  5IT9 K;  2EFP A;  2GWR A;  3BRO A;  1FX7 A;  4KIF A;  4U7D A;  4HX8 A;  1BM9 A;  4M71 A;  5J8F A;  3GLX A;  2KJB A;  2HOE A;  3COA C;  3GF2 A;  2OAZ A;  4NQW A;  2W85 A;  1W4M A;  1T39 A;  4YFN F;  1BJA A;  1XCV A;  2MBF A;  3FMQ A;  3S2W A;  5E17 F;  3KEQ A;  4KN4 X;  2VBW A;  2A61 A;  3DP7 A;  1LJ9 A;  1JHF A;  1XGM A;  5LEJ A;  1MD0 A;  2O3F A;  1R00 A;  4ENM A;  2XAH A;  2ISZ A;  2DLL A;  3HUG A;  4EJO A;  4ZYD A;  2QBY B;  3ULQ B;  2M30 A;  2CYY A;  1KYW A;  4BHP A;  2TDX A;  5A2Q K;  3GFI A;  4CZZ A;  5HS9 A;  2K4B A;  5K1Y A;  3G3Z A;  4KIC A;  3IC7 A;  1TW2 A;  2FOK A;  2L3D A;  2UXX A;  3MQ0 A;  3LFK A;  2ZNZ A;  2IVM A;  4YII A;  4OIQ F;  3DV8 A;  4LLN A;  1ZGJ A;  5LLQ A;  1RNL A;  1T0F A;  1IXS B;  1HW1 A;  4P96 A;  3GXO A;  1ZG3 A;  1HKT A;  4HQE A;  5LHI A;  1XN7 A;  5DCF A;  1DUX C;  1SD5 A;  5DUI A;  4Z2Y A;  2MLG A;  4LGW A;  3HTU A;  2DTR A;  2W84 A;  1ZLK A;  2FQ3 A;  2XAF A;  3F8B A;  3K69 A;  3MAJ A;  1TNT A;  3WTU C;  4LD5 A;  1UB9 A;  2PJP A;  5KVR A;  1Z9C A;  1NHA A;  2CO5 A;  1U8R A;  3I54 A;  2V9V A;  1BOA A;  2DI3 A;  1WKM A;  4ESJ A;  4EQQ A;  2RV8 A;  1TNS A;  5L3G A;  3LA7 A;  2EV5 A;  4M72 A;  2NAZ A;  3RDI A;  3T0Y A;  4I98 B;  1ZAO A;  1PP8 F;  1Q1H A;  3LAJ A;  5L3E A;  3E6B A;  4Y15 A;  1Z1D A;  1RI7 A;  2EA4 A;  4Y17 A;  1OYI A;  2XV4 S;  1R22 A;  1ZRC A;  2Q2E A;  5FFZ A;  3ABU A;  3SQN A;  2L4A A;  2R3S A;  4JBA A;  3RKY A;  1IUY A;  1FBS A;  2VT3 A;  5J6X A;  4G6Q A;  1XB4 A;  2MLK A;  2IA1 A;  2X0L A;  4WF2 A;  1CF7 A;  4GYG A;  3VOE A;  3WU1 B;  2V6C A;  2ISY A;  2AS5 F;  2MH9 A;  3FM5 A;  5F1R A;  2EWN A;  2VOP A;  5ERI A;  3RYR A;  3KP6 A;  3CUQ A;  1ZRE A;  1B9N A;  3KP2 A;  2M1B A;  3J80 Z;  3QPH A;  3FMS A;  4KFC A;  1DDN A;  2GAU A;  1WWX A;  3F22 A;  4IRI A;  5ILU A;  4BHB A;  3V4G A;  4JK1 X;  1W5S A;  3RJP A;  2FRH A;  2DO7 A;  4HF1 A;  4MTD A;  4AIH A;  2GXG A;  2ETH A;  4M73 A;  4E70 A;  3H92 A;  4I2O A;  4ZYH A;  3RKW A;  3QPT A;  4KMU X;  4RGR A;  1TTY A;  4XLP F;  5D5U B;  3HSE A;  5JI6 A;  3ELK A;  1MJB A;  4OOI A;  2MC3 A;  4KIG A;  1G6N A;  1SFX A;  4FT8 A;  2Y48 A;  1RZ4 A;  4N9H A;  1R1T A;  2VOO A;  2BV6 A;  2DT5 A;  1R1U A;  3SFZ A;  1BI2 A;  4ENN A;  1HKQ A;  4YG2 F;  2QVO A;  4BQA A;  4Q47 A;  5LHG A;  2RC4 A;  3ZMZ A;  5IT9 Z;  5H20 A;  1U3E M;  2STT A;  4P55 A;  2COM A;  2IP2 A;  3E5X A;  4HAM A;  4WWC A;  3ROU A;  1U6G A;  3C1D A;  5DV5 A;  5FD5 A;  2Z33 A;  3HRS A;  4HA8 A;  1IXC A;  2QM3 A;  5JR3 A;  4KT5 C;  5F64 A;  1T6S A;  1SD6 A;  4KUM A;  5E18 F;  3HOT A;  3GEZ A;  3Q5F A;  2W57 A;  3RYP A;  5K5O A;  4FX0 A;  4WK8 F;  2VBY A;  3LQR A;  1S8N A;  1LEA A;  4EGY A;  4JQF A;  4UNO A;  3KLO A;  3JAM K;  3L00 A;  1K78 B;  2WC2 A;  5E20 A;  4MEX F;  4A5N A;  3K2Z A;  3EYI A;  3WOD F;  4CIC A;  1TLH B;  4RGU A;  1MZB A;  1FPQ A;  2XGX A;  1IRG A;  3E5U A;  2DU9 A;  4IRH A;  2A68 F;  2Z9O A;  3NRV A;  3K1N A;  1Z05 A;  2RDP A;  2HYG D;  3BOQ A;  4PDK A;  3TOB A;  4KYW A;  1KU3 A;  2CQK A;  2LKP A;  5LGN A;  5HDG A;  4EJU A;  2OZU A;  3ZMU A;  2DW4 A;  4IXA A;  3BWG A;  3ML6 A;  5ILS A;  1IRF A;  3CO6 C;  1FSE A;  4LFU A;  1KQ8 A;  5FLX K;  3RI4 A;  4AVP A;  3KP7 A;  4RGS A;  4EM2 A;  2IT0 A;  3F8N A;  2VT2 A;  2BYV E;  4GGG A;  3P7N A;  2HQN A;  1FT9 A;  2G7H A;  3HIF A;  1TQP A;  1KGS A;  2JTV A;  2XHK A;  2IRF G;  1D8K A;  2O03 A;  3F8M A;  4CDG A;  5E8I A;  2V1X A;  3F8F A;  1FBU A;  1ZAR A;  2OA4 A;  2JPC A;  2H6B A;  1G3Y A;  2H09 A;  3ZN0 A;  3F21 A;  4FHT A;  1I27 A;  1YW8 A;  3QP6 A;  4CXF A;  4HV5 A;  2OQR A;  3SXY A;  4N0B A;  4R79 A;  4LG0 B;  4S04 A;  3L7W A;  1K78 A;  1S3J A;  3BJA A;  3KCC A;  4HDU A;  1MKM A;  4CGZ A;  1D5V A;  3SZT A;  1PDN C;  4ENJ A;  1I5Z A;  5BMZ A;  2H6C A;  2PEX A;  4Q48 A;  2HR3 A;  2LF7 A;  1SD4 A;  3GVA A;  5BQT A;  4I0A A;  4BAY A;  3ZMV A;  3DPT A;  3J81 Z;  2C6Y A;  2E1N A;  2OBP A;  3U9G A;  1P4A A;  1LDJ A;  2XAJ A;  4EM1 A;  2STW A;  3WU0 A;  3FXR A;  2ZJ2 A;  4TV7 A;  4ZZD A;  4AIJ A;  2K7L A;  1J75 A;  1HW5 A;  5HOO A;  3N97 A;  1XMA A;  4L5I A;  5D5W B;  2FNA A;  3VB2 A;  4WXC A;  4HF0 A;  2QQ9 A;  3BY6 A;  1ODD A;  3RIR A;  1O7F A;  1T98 A;  1U5T C;  3I59 A;  3GX4 X;  4GCV A;  1C0W A;  2O61 A;  4A0Z A;  3R0J A;  3OOP A;  1WQ2 A;  3T8R A;  4Q5S F;  1KQ9 A;  1FC3 A;  5FO5 A;  3I0T A;  5DUK A;  3GFL A;  1R58 A;  3DQV C;  4HYE A;  4HBL A;  4BH9 A;  1SAX A;  1YFH A;  3IRR A;  6PAX A;  2VE8 A;  1UHW A;  4NB5 A;  1GXP A;  4OIR F;  1FBQ A;  3KZZ A;  1YW9 A;  5KK1 A;  1IZ1 A;  2H94 A;  3DF8 A;  1K7A A;  1H9T A;  4A0X A;  2HTS A;  2FE3 A;  5F6F A;  2NNY A;  1HST A;  2PQ8 A;  2XAQ A;  5LHH A;  4B09 A;  5FB2 A;  5HLH A;  4EM0 B;  3HRM A;  1BIA A;  1D8J A;  4L18 B;  3F8C A;  1XDU A;  4R8H A;  3DKW A;  4P9U A;  1JGS A;  1R36 A;  3ERE D;  2QYO A;  4ASN A;  4EGZ A;  3B02 A;  5DEQ A;  1P92 A;  5DCM A;  3AAF A;  1KA8 A;  1FNN A;  3ECH A;  5FFX A;  2DPU A;  1QQI A;  2ZCW A;  3EET A;  1KQ0 A;  2QQB A;  1G4D A;  1O3R A;  4HX7 A;  2A6H F;  4KNY A;  3R6S A;  3CUQ B;  4HX4 A;  1R7J A;  2MH2 A;  3V7C A;  5EEG A;  2JSC A;  3NQO A;  3RTR A;  2KIM A;  3ZMT A;  3I59 B;  2Q0O A;  1DPU A;  2WV0 A;  3DPL C;  4M6X A;  1U2W A;  2NYX A;  4Y13 A;  4AD9 A;  1J59 A;  1FWZ A;  3VOD A;  4M74 A;  2V1U A;  2EK5 A;  1YIO A;  4I09 A;  3V8L A;  4G6D A;  2XRO A;  1REP C;  1BI0 A;  3BPV A;  1BI1 A;  5AIQ A;  2RGV A;  4L9J A;  1BIB A;  1YQA A;  2W25 A;  3GUD A;  2NRA C;  2P4W A;  1XMK A;  4XRF A;  2VC1 A;  2Z3Y A;  2QEN A;  3O3K A;  3HOS A;  4UUV A;  4RAY A;  3E6M A;  2VE9 A;  1XCB A;  3C3W A;  2F5D A;  2P8T A;  4YFK F;  2WWY A;  1E17 A;  5D6F A;  2DPD A;  3JW4 A;  3QAH A;  1P4X A;  2XVC A;  1BBY A;  3RKX A;  3P9K A;  2OU2 A;  3WE3 A;  3QP5 A;  4MHG A;  3U1D A;  5ED4 A;  2FEZ A;  3NEU A;  2W24 A;  3I64 A;  3IKV A;  4EJT A;  3K9T A;  4I0B A;  2ZKZ A;  3PQJ A;  3ZMS A;  1ULY A;  3IKT A;  1K79 A;  2K02 A;  4WXD A;  3D5L A;  1SMT A;  1O57 A;  3GO5 A;  4K2E A;  1Z6R A;  4XSZ F;  4LB6 B;  4EVI A;  3ZPL A;  2DK8 A;  5EEH A;  2VXZ A;  4LLL A;  5BS6 A;  1ZYR F;  1K6O A;  2QUF A;  4B8X A;  1S6L A;  2GIV A;  5BPI A;  4OMZ A;  5CVR A;  3FXU A;  3GFM A;  4KMF A;  4EJW A;  2CG4 A;  2QQA A;  4RAZ A;  5LRS A;  1HSJ A;  3KEO A;  1TQI A;  5LEK A;  3HRU A;  2M87 A;  2EFO A;  3DXJ F;  3I71 A;  2LF8 A;  4ZYG A;  4BYY A;  4HF2 A;  1UFM A;  1H0M A;  1ZG1 A;  1WRJ A;  3HSF A;  4S05 A;  3ZN1 A;  4A0Y A;  3WE2 A;  3D0S A;  3U2R A;  4LB5 A;  1P2F A;  4EV0 A;  2M8E A;  2UWM A;  3TOA A;  4HZF A;  1MGT A;  2A07 F;  3C18 A;  2GA2 A;  1R23 A;  3M7G A;  3EDP A;  2D2W A;  3M8F A;  1Y0U A;  1MJ9 A;  5HS8 A;  1J9I A;  4LK0 F;  3KET A;  2BGC A;  4O6J A;  3O2P E;  2A3S A;  4ZH4 F;  3BJ6 A;  1FP2 A;  5E1X A;  3QU3 A;  2HTJ A;  5CJ9 A;  4IRG A;  3B73 A;  5HLI A;  1W7P A;  2ZBK A;  5A2Q Z;  3KP4 A;  1LVA A;  4RB3 C;  4NHJ A;  2IPQ X;  4HV6 A;  1TW3 A;  2DQR A;  3I4P A;  3GYH X;  2XKP A;  5ICG A;  2P5V A;  3F6V A;  3MEX A;  2RVC A;  4LJZ F;  3E3V A;  3L9F A;  4UXN A;  2OQG A;  3LA2 A;  3MWM A;  1F1Z A;  4L5J A;  3JTG A;  4U0Y A;  4IPA A;  3IRQ A;  5TJJ A;  4ESB A;  1F4K A;  2O0Y A;  3W6K B;  2UXN A;  4U88 A;  4U7B A;  2KJC A;  1AWC A;  1ZLJ A;  4RGX A;  3JTH A;  5DCM B;  1ON1 A;  3ECO A;  1S7O A;  1F5T A;  2DQL A;  3TDZ C;  1AOY A;  1EV7 A;  1ZH5 A;  1VTN C;  1IN8 A;  2HYF A;  5DD4 A;  2CSO A;  1FP1 D;  2P5L C;  1IN6 A;  2F2E A;  3HRT A;  4IVN A;  5BOX A;  1YS6 A;  5D8L B;  2ZFW A;  1J0R A;  2QZ8 A;  2XUB A;  4HW0 A;  2PMH A;  1GXQ A;  3EUH A;  1OPC A;  4IHS A;  3FM3 A;  1O3Q A;  2Z5U A;  3R61 A;  4IJA A;  2R7D A;  1P6R A;  1XGN A;  2D45 A;  2H27 A;  1FZP B;  3IWF A;  4XLN F;  5D4S A;  3GZ5 A;  2E1C A;  2HZT A;  4G9Y A;  4UV9 A;  3M8E A;  3WG9 A;  1IF1 A;  1ZG5 A;  3BDD A;  1I6X A;  1ZGA A;  4O3M A;  2IW5 A;  4GXO A;  1HW2 A;  4XBF A;  4ZYE A;  2FA5 A;  4A6E A;  3FZV A;  1KU7 A;  3CO7 C;  3ABT A;  3E6C C;  3E6D A;  3O6B B;  3WGH A;  2V79 A;  1G3W A;  2ZME A;  4ON0 A;  2HDC A;  5L3D A;  5DDG A;  4OIN F;  4QWQ A;  3LAP A;  3W6J B;  5E1Z B;  3REO A;  2YSR A;  3GZ6 A;  1B4A A;  3CJN A;  1STZ A;  3HYI A;  1I1G A;  1YO5 C;  1HKS A;  2FXA A;  4OU0 A;  3K0L A;  1YYV A;  3HHH A;  2YX4 A;  4P9F A;  2ZO4 A;  1QBJ A;  3H3U A;  2OD5 A;  4HLY A;  3FXQ A;  5HS7 A;  2GQQ A;  3ZQ7 A;  2Q8K A;  2A69 F;  4ZZL A;  2O8X A;  2JT1 A;  2PMU A;  1J2X A;  1XDS A;  3GFJ A;  5HDK A;  4O5V A;  5FGM A;  4GYI A;  3F72 A;  1KU2 A;  4MQV A;  4KDP A;  5LRR A;  2DK5 A;  1P4W A;  2VC0 A;  2PFB A;  4YIF A;  3TKY A;  5D4R A;  1ON2 A;  1J7K A;  1GVJ A;  5LGU A;  2XKO A;  3CUO A;  2PI0 A;  5K5R A;  4RB1 A;  1V3F A;  1V4R A;  3FF5 A;  4LG0 A;  2UZK A;  2IA0 A;  2KIF A;  4M6Y A;  3CDH A;  3WGG A;  3FX3 A;  2XRN A;  3R60 A;  1FLI A;  2BBY A;  1G3T A;  2Z99 A;  3P9I A;  3MZY A;  2YPR A;  4ENK A;  2HKX A;  5IT3 A;  1IN7 A;  3I58 A;  2ELH A;  3E97 A;  4M9Z A;  1L3L A;  2V1D A;  4L0Z B;  3EQL F;  1QZY A;  5DYM A;  4BNC A;  1W7P B;  3J80 K;  2JPB A;  3CUQ C;  1UHM A;  3R4K A;  5HLG A;  2ZXJ A;  2JZY A;  1F9N A;  4HQM A;  4LLG F;  4AWX B;  2FBK A;  2LDU A;  1UCR A;  4DQ2 A;  4IF4 A;  3J81 K;  1FYL A;  2P6T A;  3TO6 A;  2GXB A;  2G7U A;  4DNC A;  2HKO A;  4ESF A;  5L3B A;  3LWF A;  5FD6 A;  3F23 A;  3I5U A;  4R1H A;  2EV0 A;  2K86 A;  2P6S A;  2CGP A;  2FF4 A;  4PGG A;  3IWZ A;  4I02 A;  1HBX G;  2PN6 A;  2FSW A;  1QO0 D;  2L54 A;  1TBX A;  3VFZ A;  1IAW A;  4MQ9 F;  4RB0 A;  2XAS A;  3TDU C;  3L2C A;  2FML A;  3WTV C;  2Y0M A;  3TGN A;  1LNW A;  2P7V B;  4P5O A;  1ZHF A;  3K1M A;  1QZZ A;  3H3Z A;  2DBB A;  2ADU A;  3TO9 A;  4A6D A;  5H6R A;  2ACJ A;  1RUN A;  2QWW A;  3KE2 A;  2L4M A;  2FMY A;  1WI9 A;  2WTE A;  2LNB A;  4ETS A;  2RQP A;  1FYM A;  3WTZ A;  3JSP A;  1Z6T A;  2EJR A;  4U0V A;  1CGP A;  2FBH A;  4UV8 A;  4CYD A;  3JAM Z;  2VN2 A;  1Z91 A;  5D5V B;  2HWV A;  2RNJ A;  1A04 A;  2YU3 A;  3T5X A;  4OMY A;  2MD5 A;  2G9W A;  1EH6 A;  1YG2 A;  4WCG A;  2L01 A;  3TO7 A;  3BP8 A;  1OYW A;  4EMS A;  3FMR A;  2GA1 A;  3QRF F;  4IHT A;  4M9S A;  3MFK A;  1RIO H;  3K1P A;  3RPQ A;  2KIU A;  4BXU A;  1H9G A;  2QBY A;  1XSD A;  3PFI A;  1O3T A;  3HTS B;  4F7Z A;  1IXR C;  2F5C A;  3Q9V A;  1LQ1 A;  1EH8 A;  3DEU A;  1FSH A;  3FHZ A;  2FU4 A;  1QNT A;  4UVB A;  3PQK A;  5ILV A;  5D8K B;  3ZP5 A;  1FY7 A;  3SHF A;  4PCQ A;  4H0E A;  2HGC A;  1KYZ A;  4KN7 X;  1BI3 A;  2CFX A;  3EYY A;  2RKH A;  1QPM A;  2PG4 A;  1R5H A;  2DAO A;  3LQQ A;  2IJL A;  4I01 A;  2MA3 A;  4WX9 A;  1B6A A;  3QOP A;  1U5T B;  2FNP A;  3V8K A;  4HDV A;  4QLC U;  1SFE A;  2M45 A;  3MZH A;  2P7C B;  4G7O F;  1ZRD A;  1O3S A;  3WTY C;  3BZ6 A;  1D3Y A;  1JHH A;  1SFU A;  3ISP A;  2M5W A;  2EA2 A;  3GWZ A;  3T8T A;  4G94 A;  4UVA A;  2VOD A;  1MDM B;  3R0A A;  4G8X A;  1OKR A;  2RN7 A;  2BEO A;  1XSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...