3CUQA

Integrated structural and functional model of the human escrt-ii complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
219
structure length
219
Chain Sequence
AQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA03
3LA7A 1TTYA 1TNTA 2HYFA 1QNTA 1BI1A 3HTUA 3F6VA 3SFZA 1L3LA 2DPDA 1BI3A 1WWXA 2XUBA 4UVCA 3R6SA 1SFUA 5LGNA 2EV6A 4GGGA 1ZG5A 4PCQA 4HF1A 3MZYA 2W24A 4I02A 1GVJA 3WGHA 2LNBA 4I7HA 1R1TA 3M8FA 4KNYA 1J2XA 1FBSA 3I64A 5ICGA 4IRIA 2TDXA 4U88A 2NS0A 2Z5UA 5LEJA 1KYZA 2M8EA 2VC0A 3AAFA 2GXGA 1S7OA 2E7XA 3WTSC 2RVCA 1IRGA 1Y0UA 2JRTA 4MTEA 4CO8A 4HF0A 2HQRA 4LLNA 4WK8F 2FU4A 3Q9SA 1P4XA 5L3FA 5FFXA 3D0SA 2OU2A 4ZYEA 2NRAC 5H6RA 2FXAA 5J8CA 2CSOA 4HAMA 2RDPA 1PP8F 1ZN2A 3U2RA 3HUGA 1Q1HA 1J9IA 2XAJA 3CUQC 2W57A 3BPXA 3IKVA 4LMYA 4OIOF 3RKXA 1MJAA 4CXFA 1LQ1A 3O3KA 4OMZA 1BBYA 2YSRA 1X3UA 5L3BA 5AIQA 4MEYF 2ZXJA 2VBZA 2CFXA 3F8CA 5CVUA 1SMYF 5CYVA 2G7UA 3ZMDA 3QPTA 1ZRCA 2Y48A 2EB7A 1D5VA 4EVIA 4HX4A 3V4GA 3CUQB 3FXUA 3WTXC 5CVIA 2FOKA 1XGNA 3C7JA 4IHTA 3EDPA 2DAOA 1ZARA 3ULQB 1ON1A 4ENKA 2P5LC 4YIFA 1E2XA 2L54A 1O7LA 3MWMA 3K1MA 3ZP5A 3HHGA 4FHTA 1KU9A 4RS8A 4ESFA 1RUOA 4IHSA 1ZREA 3C3WA 5DDGA 2OBPA 1Z9CA 3GFIA 2QBYB 4G6DA 5D5UB 4BHPA 3E6MA 2QM3A 1IN4A 2LDUA 3N97A 4N0BA 4A6DA 1BI2A 5FFZA 4D0PA 1V4RA 1U3EM 1GXQA 5E1WA 1TW3A 2E1NA 3CO7C 3E5XA 3DFGA 4EQQA 2VC1A 4RB0A 2Q0OA 3F8FA 1T0FA 4P55A 1ZRFA 3SHFA 1J7KA 3I71A 2KIMA 2CWEA 4OU0A 5DCFA 1R5GA 4QLCU 2DO7A 3LAPA 2YR2A 2CYYA 5E8IA 2JSCA 4KYWA 4WXHA 4XSXF 2Z3YA 1T38A 1LEAA 4A5NA 1S6LA 3J81Z 1HW1A 1EH6A 1YW8A 2V1XA 3VB2A 5HDGA 2ISZA 3REOA 4G9YA 2WC2A 4ESJA 1HSTA 2KJBA 3L7WA 1TQIA 3EYYA 4FT8A 4U7BA 1HKSA 2OZ6A 4A0YA 5TJJA 4A2UA 1AOYA 1D3YA 2HTSA 3CUQA 3WGGA 4OOIA 1FLIA 3PFIA 4B8XA 2VXZA 3M8EA 2JZYA 5DD8A 3Q9VA 1DP7P 5HLIA 1EH8A 1G3TA 4KIBA 1FP2A 3E3VA 1IN8A 3BJOA 4M9ZA 4Y13A 2F5FA 4YFXF 2RKHA 4KT5C 3NRVA 4IPAA 2QBYA 1PDNC 3DV8A 1H9GA 3I0TA 2VONA 2GA2A 2V1DA 1IXRC 4EGYA 3BJ6A 5ED4A 1FWZA 2Z33A 2GXBA 1HQCA 1KQ0A 5LEKA 1XDSA 4HV6A 3BZ6A 4CZZA 1T39A 4EJVA 2OZUA 2HWVA 3ABTA 4HDVA 1EV7A 3K1NA 3MAJA 4HDUA 1QZZA 1IRFA 1Z7UA 4KMUX 5A2QZ 3TOAA 3S2WA 4RB3C 1R7JA 4S05A 2XASA 1VTNC 3QAHA 2VN2A 4N9HA 3O6BB 1K7AA 3HRTA 2RGVA 4M74A 5BPIA 1Z1DA 3KP3A 2D45A 4MEXF 3BJAA 1S8NA 1CGPA 4M72A 4ZZLA 2QUFA 1RZ4A 3ZMSA 1LJ9A 4XLPF 3F22A 2R3SA 2FBIA 1SFXA 2ACJA 3WODF 1STZA 3MCZA 1Z6TA 3WTTC 1MJBA 3P7NA 1T6SA 1GXPA 2KRFA 1BIAA 4KN7X 1WQ2A 1U5TB 1OMIA 1R58A 5BMZA 1P4AA 4BHCA 3ZMTA 3KCCA 5K5RA 4JBAA 1REPC 3R61A 2CG4A 2ETHA 1ZGAA 3KP7A 2XKOA 2MBFA 4WX9A 1G6NA 1K79A 5IT9Z 3GFJA 3K1PA 3KP5A 2K27A 3CO6C 5D8LB 2MH9A 3TDZC 3JTGA 1ZG1A 1HW5A 1KA8A 1R5HA 1KU3A 3ML6A 4U0YA 1PUEE 3CLOA 2EA4A 4A5MA 3WE2A 4LK1F 3ISPA 2O61A 1H9TA 5DYMA 3RDIA 3ZQ7A 1UHWA 2GAUA 1XGMA 5JI6A 4ENMA 4MQ9F 1B1BA 1QQIA 3WU1B 3R0JA 3GWZA 1YYVA 2GZWA 2IA0A 3GFLA 4ZYDA 3W6JB 2BEOA 1P6RA 1XB4A 4LK0F 3E5UA 1R23A 1U2WA 5LBQA 1B9NA 2IVMA 4EM2A 3GXOA 3K69A 1SMTA 2BV6A 2G9WA 3I53A 3R60A 3JW4A 2OQRA 4G8XA 2PJPA 2YX4A 1QZYA 3I5UA 5LGUA 2L4AA 4G7ZF 4U0VA 2PEXA 5D8KB 1KQ9A 2Q2EA 2O3FA 1F5TA 1J5YA 2WTEA 4O3MA 2DLLA 1MKMA 4XSZF 1U5TA 4HOBA 4UXNA 4ETSA 5FGMA 2CW0F 1SD5A 2XAFA 4HA8A 2UXXA 3RKWA 1P2FA 4XRFA 2P7VB 3WTYC 4PZJA 3ZPLA 3SZTA 3M7GA 1BJAA 4YFKF 1F1ZA 3KEOA 5BS6A 4HBLA 1SD7A 2A69F 3BDDA 1IF1A 1O7FA 3TDUC 1MJ9A 2H94A 3IL2A 4XLNF 5D6FA 2GIVA 1B59A 5D4SA 2FMYA 2XRNA 3M1EA 3KP6A 3RIRA 3W6KB 1K6OA 3KFWX 1LDDA 4N9IA 1TQMA 4YIIA 1S7AA 2D1VA 1D8JA 2KIFA 2ZBKA 4WWCA 5IT3A 1QGPA 2DU9A 1XSXA 3DPTA 1ONVA 5HVQC 4NHJA 4UHTA 4FX4A 4RGXA 3TKYA 3K0LA 1IN7A 2H6CA 2O8XA 2W84A 4ENNA 4PGHA 1J75A 3GW2A 1QPMA 3QP5A 3DP7A 2MD5A 2BGCA 1R22A 2K86A 3RKYA 5DEQA 2H09A 2D1HA 4UNOA 4I0AA 3SQNA 5E20A 4ENJA 1FNNA 4EM1A 4EGZA 2JTVA 2E7WA 3T8TA 2HGCA 2EWNA 1B9MA 2XVCA 3BOQA 2DPUA 4BAYA 1IN6A 3ZMZA 1DUXC 3EETA 3T8RA 4KICA 4YG2F 4OIRF 3IWZA 3RI4A 3KEQA 1AWCA 5BQTA 4HQEA 1YW9A 3DKWA 3BPVA 4IJAA 2A6HF 3HSFA 3NEUA 2K02A 1YG2A 1I27A 4BHBA 1R36A 3J80Z 1OYWA 2E1CA 5LRRA 2F5EA 5HOOA 5AIPA 4EV0A 4Y15A 4EJOA 3E97A 2QQAA 2O03A 4KFCA 4I2OA 2PLYA 3CUOA 1KGSA 2AXLA 1DPUA 2W85A 4IF4A 3FHZA 3SXYA 4Z2YA 1F4KA 2Z99A 2ZO4A 2HTJA 3WE3A 2FF4A 2UZKA 3QRFF 4L9VA 4PDKA 5J8FA 1USTA 1UHMA 2COMA 3IRQA 2ZNZA 4G94A 2Y75A 1XDUA 2XHKA 1RNLA 4LFUA 5AONA 1EH7A 3GX4X 2V9VA 4B09A 5CVJA 1USSA 2XGXA 3GUDA 2EV5A 3QP6A 2PMUA 5L3GA 1O3TA 1XGSA 3JAMK 2LF7A 5KVRA 4IRHA 3VEPA 1SAXA 2HKXA 2QVOA 3T1BA 2OA4A 2EV0A 4OIQF 3P9KA 2O6GE 3VFZA 1TQPA 3FF5A 1I6XA 3G73A 2KKOA 2VOOA 2STWA 4L9TA 3FX3A 2XIGA 3ABUA 2EFWA 6PAXA 5K1YA 1F9NA 3QU3A 1FYKA 4RAZA 3KP4A 2YX7A 3WTWC 1O3RA 1CF7B 2HQNA 4HW0A 3NQOA 2ZJ2A 1TNSA 2HDCA 4ON0A 4PGGA 3HSEA 3QPHA 5ICEA 4LB5A 4LJZF 2PBIA 1KU7A 5DCMB 5DUKA 3KZYA 3P9IA 2H6BA 4Q5SF 2QYOA 3EUHA 3PQJA 3RPUA 4DNCA 5LHGA 2GA1A 5DV5A 1RUNA 2BYVE 3P9CA 4G7HF 2QZ8A 2IW5A 3H92A 4OINF 5H6QA 1IN5A 4WCGA 1WRJA 1TBXA 4S04A 1G3WA 4AIJA 3N4MA 2ZCWA 1W7PB 1XGOA 5FLXK 3VOEA 5J6XA 3FMSA 2Y0MA 5FD5A 3IRRA 4A6EA 4JK1X 4GYGA 1ON2A 3ERED 5L3DA 3WG9A 2OQGA 3DF8A 1YLFA 2HOEA 2XAHA 3GFMA 3HRUA 5JHUA 3ELKA 4R1HA 1LEBA 4IRGA 3IHUA 5FD6A 2IP2A 4I01A 3V8JA 3LQQA 5LLQA 1FX7A 1FYMA 2MLKA 2L3DA 2ESHA 4AD9A 4CGZA 4O6JA 4UUVA 4GCVA 4ZYGA 5ILSA 3E6CC 4GXOA 4M9SA 4A12A 1U8RA 2ZNYA 3Q5FA 1O57A 1LVAA 4BXUA 3WTZA 2HR3A 1YTYA 1LB2A 1CF7A 4LG0B 1J59A 2K4JA 5ILVA 3EQLF 1Z05A 1WKMA 4HQMA 1BC7C 5EEHA 1T2KA 2L4MA 1FZPB 4OMYA 3L2CA 4G7OF 3L9FA 1HSJA 5E1ZB 2EK5A 2FSWA 1LNWA 1PP7U 3VODA 4WXCA 3HIFA 5DCMA 3R0AA 5EEGA 3M9AA 2GWRA 4KIGA 4CHUA 1XCVA 1TLHB 2V6CA 1B6AA 5K5OA 5JFRA 3HTSB 3PQKA 4M71A 3ZMVA 1BC8C 1U6GA 1ZRDA 4R79A 1W7PA 1FOKA 3DQVC 1SD4A 5CLSA 3K9TA 4RGUA 1YQAA 4KIFA 4RGRA 5D4RA 1H0MA 1YFHA 3V7SA 2W25A 4EM0B 4HV5A 2HZTA 3V7RA 4EJTA 1W5SA 2FEZA 1XSVA 5TRDA 1YS7A 2PFBA 2IRFG 3JSPA 2A3SA 2L02A 4P96A 1S29A 2Z9OA 2G7HA 4AVPA 3JTHA 2NAZA 1MGTA 4IXAA 1MZBA 5HDKA 1ZHFA 5JVTA 2FA5A 5CVVA 2RC4A 3WTUC 1SD6A 3I54A 3IC7A 4LB6B 2OAZA 1BI0A 3G3ZA 5KK1A 3F21A 3E6DA 4ZYHA 3T5XA 3KETA 5L3EA 1TW2A 4QWQA 1DPRA 4L9NA 5D5VB 3WGIA 4ZZDA 3QOPA 3TQNA 5LRSA 3HOSA 4GYIA 1I5ZA 2P8TA 1K78B 2J5PA 4LG0A 5BOXA 5F6FA 3KP2A 4Q4ZF 3MZHA 5BPDA 3GYHX 4U0WA 2VBXA 1LDKB 5DUIA 3LWFA 3CDHA 3GEZA 2DK8A 2F5CA 4MNUA 1OYIA 2ADUA 2ZMEB 4K2EA 2X4HA 3I59B 4HZFA 2HEOA 5FB2A 1Z91A 2K4BA 4R8HA 4RAYA 1D8KA 2EJRA 3GF2A 2QLZA 2QQBA 1OYYA 2O0YA 1W5TA 1G4DA 3MFKA 2VBYA 3ECHA 2A07F 1OR7A 4RGSA 5LHIA 2BE5F 2RV8A 4Q48A 1O3SA 2XKPA 2FRHA 4LLLA 5L3CA 2FBKA 1I1SA 3B73A 2NYXA 1HKTA 5K5QA 1Z6RA 2EFPA 3FM5A 3DXJF 3FWEA 4EMSA 4EJUA 4CICA 3KE2A 4P9FA 5D5XB 2ISYA 5HLHA 4BH9A 3GZ6A 1C0WA 3F3XA 4BYYA 3FXRA 2FNAA 1OKRA 3HOTA 1ZAOA 2C6YA 1KU2A 2DW4A 2FNPA 4KN4X 2P4WA 5LGTA 1OPCA 3LA3A 1KQ8A 4NB5A 3BP8A 5ICCA 1JHFA 1S3JA 2WV0A 2P5KA 2JPBA 5HS7A 3J81K 3EYIA 1K78A 1JGSA 4L5IA 3LSTA 5JR3A 1DDNA 3HRMA 3ZN1A 2M30A 4Q47A 1T98A 2R7FA 4KDPA 4EJWA 2ZMEA 3MQ0A 3I4PA 2J5OA 3I59A 4F7ZA 3B02A 1FC3A 2VE9A 3TGNA 2V79A 2IA1A 5HDNA 4HYEA 2DI3A 1MD0A 2B0LA 4BNCA 2RQPA 5D5WB 1BM9A 4NQWA 2R7DA 4E70A 1V3FA 1UFMA 4ZH4F 4RB1A 4L9JA 4L0ZB 1L0OC 1O3QA 3F72A 5FO5A 2EFQA 5D6EA 3LQRA 4G6QA 2DFIA 3LFKA 3BY6A 4LLGF 1FPQA 2IPQX 2A68F 2AS5F 4ESBA 2JPCA 3J7AO 2F5DA 3H3UA 3ZMUA 4MTDA 4MQVA 2L01A 3IKTA 4KA4A 2YPRA 3OV8A 1FSEA 1IUYA 1QBJA 1YS6A 1J0RA 5CJ9A 5CVRA 3LAJA 2STTA 3TO7A 3E5QA 3F8MA 1XN7A 2MA3A 4GO1A 3BWGA 4DQ2A 5HS8A 3GO5A 2MLGA 5E8GA 4WF2A 1U78A 4IVNA 1FBUA 5A2QK 4LD5A 1WI9A 4Y17A 1IW7F 1B4AA 2QWWA 2IT0A 3TOBA 2LSOA 2GQQA 1R1UA 3U9GA 2Q8KA 2CQKA 3GVAA 4I09A 3DPLC 1XMAA 5LHHA 5F1RA 2M87A 3K2ZA 2PI0A 2ESNA 4AIHA 4UVBA 1P92A 4AWXB 2X0LA 4LGWA 3RJPA 2IJLA 2MC3A 1UCRA 1IXCA 4L18B 1ZLKA 5E1XA 4YFNF 3CTAA 1ZH5A 4CDGA 1MDMB 2NNNA 3QU6A 2RN7A 2VE8A 2P5VA 1W7PD 1GHCA 2P6TA 2A61A 2PQ8A 5HLGA 5IT9K 2CO5A 4OIPF 1KYWA 4M6XA 3C1DA 2A6EF 1YIOA 3HHHA 3GZ5A 4AIKA 1RIOH 3RYPA 2M45A 2HFHA 3ZN0A 2ZFWA 4H0EA 3FMQA 4ASNA 4I0BA 3FZVA 3LA2A 2HKOA 2VT3A 5F64A 2EFOA 3U1DA 1FT9A 2F2EA 3TO9A 4JQFA 1BIBA 1FYLA 5H20A 4HX8A 1SFEA 3HYIA 1P4WA 1ULYA 2XV4S 3WU0A 3TO6A 2XAGA 4FX0A 3FM3A 3FXQA 1IXSB 4P5OA 2XROA 4U7DA 3RYRA 2P6SA 2KIUA 1ZG3A 1R1VA 2LF8A 2ZKZA 2QQ9A 2IA2A 2VBWA 1UB9A 2NNYA 4A0ZA 2D2WA 2DK5A 1XSDA 2DTRA 3WTVC 3CJNA 3RTRA 3HRSA 3I58A 4TV7A 5DD4A 1BN5A 2DQRA 3ECOA 1MDMA 1IZ1A 2VT2A 4XBFA 2CGPA 3ROUA 2FBHA 3GLXA 3KLNA 2XAQA 1ODDA 1JE8A 1HXDA 4BQAA 1U5TC 3COAC 2P7CB 4L5JA 2JT1A 3JAMZ 4O5VA 3L09A 1BOAA 2PMHA 2EA2A 1G3YA 5HS9A 3DEUA 3OOPA 4WXDA 1R00A 1XMKA 1IAWA 3V7CA 4M73A 4MGRA 3RPQA 5ICFA 4A0XA 2H27A 1FP1D 1HKQA 1ZLJA 4CYDA 4UVAA 4HF2A 5E17F 2HYGD 3HSRA 3D5LA 3T0YA 1WSUA 1ZGJA 2UWMA 1A04A 3SZPA 4HX7A 2KJCA 1HBXG 2RNJA 2FMLA 2ELHA 4M6YA 2MH2A 3FMRA 5ILUA 4UV8A 2BBYA 1FY7A 2LKPA 3V8LA 4P9UA 2DBBA 3F8NA 3JSOA 4KMFA 1FSHA 4KUMA 3MEXA 1XCBA 1FBQA 3V8KA 1HW2A 3E6BA 2FE3A 2EFNA 3F8BA 2K7LA 2DQLA 4RB2C 1YO5C 3IWFA 1XD7A 1E17A 3KZZA 1G3SA 1JHHA 2UXNA 1ZYRF 1W4MA 2VODA 2DT5A 5FLXZ 5ERIA 1YW7A 1NHAA 2A5YB 3H3ZA 5E18F 2YU3A 2FQ3A 2PG4A 2PN6A 3L00A 4L0YB 4MHGA 4I98B 3C18A 2V1UA 3F6OA 2M5WA 3BROA 3J80K 1I1GA 2QENA 3F23A 2M1BA 4M9XA 3O2PE 3R4KA 1RI7A 1LDJA 4HLXA 2WWYA 2HS5A 3KLOA 4HLYA 2OD5A 4UV9A 1JXSA 1QO0D 2VOPA
chains in the Genus database with same CATH superfamily
3LA7A 3OYFA 1TTYA 1TNTA 4A3CJ 2HYFA 3S32A 3PIPF 2JQ7A 1QNTA 1BI1A 3QOEA 1VQMI 2MABA 3HTUA 1ZELA 4CSWA 3F6VA 3SFZA 1L3LA 1ZR4A 4J01A 3W6VA 3HZJA 2NVYJ 2DPDA 1BI3A 1WWXA 4CCMA 2LKSA 2XUBA 4UVCA 1FIAA 4Y7NJ 3R6SA 1SFUA 3JRBA 5LGNA 2EV6A 4GGGA 1ZG5A 3PUBA 4PCQA 4C3HJ 1B8IB 4HF1A 3MZYA 3OSGA 4MFDA 3GLLA 1VQNI 2OCEA 1WJAA 4UB8C 2W24A 1TWCJ 3HOWJ 3BQZA 4I02A 1FMVA 2JVHA 2Y9YA 1YI2I 1NG7A 1GVJA 3KYLA 3WGHA 2KMUA 2LNBA 3GZNB 1TL8A 1ETXA 2WAFA 4II3A 4I7HA 1IV8A 1R1TA 3M8FA 2R5YB 1J2XA 4KNYA 2FD5A 1FBSA 3I64A 5M3FJ 2PMZA 5ICGA 2KRCA 4IRIA 2TDXA 4U88A 2NS0A 2Z5UA 5LEJA 1KYZA 2M8EA 2YU9J 1JT6A 2VC0A 4Y4RA 2XGDA 3AAFA 2GXGA 1T0FC 1S7OA 1TWGJ 1FIPA 2E7XA 2M7AA 1GUUA 3WTSC 2RVCA 1IRGA 4V2GA 1Y0UA 2JRTA 2XGEA 2Y69H 4MTEA 4CO8A 3OYGA 4KT6A 4HF0A 1BR1A 2ECCA 2HQRA 2O5RA 4LLNA 1POGA 4WK8F 1W36D 2FU4A 4LIUA 1DGRM 3Q9SA 1P4XA 5L3FA 5FFXA 2E34A 2VQGA 2E60A 2Z1DA 3D0SA 2P81A 2OU2A 3VYUB 4ZYEA 5C4XJ 2NRAC 3MKYB 5H6RA 2FXAA 5J8CA 2CSOA 2JWTA 2MG4A 4HAMA 5IOYA 1HA8A 4G6TB 3HGGA 3HC7A 1U8BA 4ZDOA 2RDPA 1PP8F 1ZN2A 2QSGX 4V19K 3U2RA 2HQ5A 4HSTA 2XB5A 1S5LC 3HUGA 4C2UA 1Q1HA 1J9IA 2CUFA 2XAJA 3S3NA 1JJ6C 3CUQC 2JK3A 2W57A 3A4CA 2WADA 3BPXA 3IKVA 4LMYA 5J40A 4OIOF 3RKXA 1BW6A 1MJAA 4CXFA 1LQ1A 2K9MA 3V42A 3BR3A 3JRGA 1VQPI 2Y0SA 1SVOA 3ESWB 2XF6A 3O3KA 2F4MB 1Y39A 4OMZA 4C3IJ 2IS4A 1BBYA 2YSRA 4I99C 4BEHB 1X3UA 5L3BA 1WCMJ 5AIQA 1AKHB 1X1AA 4MEYF 3CCJI 4XKWA 1TT0A 2ZXJA 1OCPA 2OC6A 2VBZA 4NC7A 2CFXA 3F8CA 2IGKA 5CVUA 1SMYF 5CYVA 2G7UA 3ZMDA 1LFPA 3QPTA 1B8IA 1ZRCA 4LOCA 2Y48A 3BR6A 2EB7A 1LUJB 1IJWC 2L7MP 4EVIA 1D5VA 3A2KA 4HX4A 3V4GA 1A6IA 3CUQB 3FXUA 3WTXC 1BJZA 1R49A 2HDWA 3G71I 5CVIA 5EF6A 2FOKA 5EDNA 2W00A 1I3AA 1XGNA 3C7JA 4IHTA 3EDPA 3S2DJ 2DAOA 2CQNA 1ZARA 2WV1A 3LSJA 3ULQB 2R5YA 1ON1A 4ENKA 5IP9J 3OYBA 2P5LC 1UG0A 4YIFA 4BE1A 2R7WA 1E2XA 2L54A 3QPSA 1O7LA 1T8IA 3MWMA 3D5RC 3K1MA 3ZP5A 3NARA 3HHGA 3O8HA 3OR1C 4DGWB 4FHTA 2WAQN 1KU9A 3DLLF 4RS8A 1YE9A 4ESFA 1QZEA 3ZQCA 1RUOA 5GTHC 2JN6A 4IHSA 1ZREA 4CCNA 1XTAA 3C3WA 5DDGA 3CCQI 2VPLA 4E7HA 4RLQA 2OBPA 4RBOA 1Z9CA 1LPQA 3GFIA 4F3QA 2DA5A 2QBYB 4G6DA 4JX4A 4IOAF 1ZR2A 5K7HA 5D5UB 4B43A 2FOWA 4BHPA 3E6MA 2QM3A 4BU2A 1IN4A 4GDFA 1WVRA 2LDUA 1UG2A 2BVLA 3N97A 1AHDP 1IC8A 4N0BA 1MMDA 4A6DA 1BI2A 5FFZA 2CUEA 4D0PA 1V4RA 3H0GJ 1U3EM 1GXQA 5E1WA 1TW3A 4FISA 2E1NA 3CO7C 3E5XA 4JP0A 1PYVA 3GTQJ 3DFGA 4EQQA 2A5WA 2VC1A 2GOMA 4RB0A 2Q0OA 3Q3SA 2Z16A 3F8FA 4RLFA 1T0FA 2LR8A 2VKVA 4P55A 1ZRFA 3WHCA 3SHFA 3I9V2 5H2FC 1J7KA 1V54H 2KIMA 2CWEA 3I71A 4OU0A 5DCFA 1VQ8I 3CLQA 4BUPA 2O9LA 1R5GA 4QLCU 4JYKA 1EJ9A 2PX9A 5DM7F 2DO7A 3LAPA 3HJEA 2YR2A 4IOCF 2CYYA 1SVMA 5CKTA 1X4OA 4DYRA 2AO9A 5E8IA 4XRSG 5B5EC 2EZHA 2JSCA 5DS9A 3ASOH 4KYWA 4WXHA 4XSXF 4N4OB 2Z3YA 5K7FA 1T38A 1TWHJ 1LEAA 4A5NA 2DN0A 4FETA 3ZR8X 1S6LA 3J81Z 1HW1A 4BEHA 1EH6A 1AKHA 1YW8A 3D5SC 2V1XA 3VB2A 5F27A 5HDGA 3ZQFA 2ISZA 1G2HA 3REOA 4IKFA 4G9YA 2WC2A 3Q0UA 4ESJA 4BQOA 1HSTA 2GIZA 4D9JA 4XL9A 2KJBA 3L7WA 1TQIA 3EYYA 4FT8A 2X6YA 4U7BA 1Y56A 1HKSA 2OZ6A 4A0YA 5TJJA 3H5AA 4A2UA 1AOYA 1D3YA 2M9HA 1MNMC 1PJRA 2HTSA 3CUQA 1TZLA 4OOIA 3WGGA 1FLIA 2V9PA 2MC4A 2FX0A 2BOLA 3PFIA 5JLXA 1ZQ3P 4B8XA 2GBYA 2VXZA 3WU2C 1WFXA 3M8EA 3BCAA 1JUMA 2JZYA 2X48A 2ZXIA 1X1BA 5DD8A 3Q9VA 3J7ZI 1DP7P 2B63J 1A6QA 4AIDA 2RNGA 3RCOA 5HLIA 2EZKA 1EH8A 3A02A 1VQ9I 3HOZJ 2L0KA 2NS8A 1G3TA 4KIBA 2H1KA 1FP2A 4HRIA 3E3VA 1IN8A 3BJOA 4M9ZA 4Y13A 4GFBA 2F5FA 2ME6A 2BHZA 4YFXF 4IHXA 2RKHA 2PMZN 4KT5C 3NRVA 1T56A 4IPAA 1N25A 3BR0A 4B44A 3C2BA 3AL0C 3J7AY 2NVTJ 2QBYA 2E36A 5LD2C 4XORA 3DV8A 1PDNC 1H9GA 3I0TA 2VONA 2GA2A 2IEKA 3GMEA 2V1DA 2L7FP 1IRXA 2W48A 3IV5A 3KPHA 2JA7J 2XRLA 1IXRC 5GAGJ 3CD6I 2Z33A 3BJ6A 5ED4A 1FWZA 2L9RA 1MBEA 4EGYA 2GXBA 2DMUA 2YUSA 2ZSHB 1H88C 4BJ6C 2X1DA 1HQCA 2L2OA 1SANA 1KQ0A 4DZJA 5LEKA 1XDSA 4XK4A 2VQCA 2D5VA 4HV6A 3AG3H 3BZ6A 3BG3A 4CZZA 1T39A 4PFOA 3AL0B 3ZGKA 4EJVA 2OZUA 2HWVA 2KDOA 3ABTA 4HDVA 1EV7A 3K1NA 2DMQA 3MAJA 3OOUA 4BQNA 4I6ZA 3MKZA 4HDUA 1QZZA 2NVUB 3BTCA 1FTTA 1IRFA 4IQ4A 3ERMA 2KZVA 1Z7UA 4KMUX 5A2QZ 3TOAA 3S2WA 4RB3C 3OL3A 2MYSA 2O8KA 3OS1A 1R7JA 2R7QA 1W5CC 4A3FJ 4I76A 3ABKH 2GXAA 4S05A 2XASA 1IGNA 3TW7A 2E5NA 1VTNC 4CA0A 2DA3A 2Y0SN 3QAHA 4OWRB 4DYCA 4YRVA 2VN2A 4N9HA 3O6BB 4UB6C 3OYDA 1HC8A 1K7AA 3HRTA 1MSFC 3CZ6A 4XLEA 2RGVA 4M74A 5BPIA 3FK7A 1Z1DA 3KP3A 4NBQA 2D45A 4MEXF 2E2IJ 2K3FA 3BJAA 1S8NA 1CGPA 1FTZA 4M72A 4ZZLA 2OUMA 2QUFA 1RZ4A 2VPRA 3ZMSA 1LJ9A 3K6GA 4XLPF 3BCBA 3F22A 3OYKA 2MFZA 2R3SA 2FBIA 3SFIA 1SFXA 2ACJA 1WHUA 3NWSA 3WODF 1A5JA 3NAUA 1STZA 3MCZA 1Z6TA 1HLVA 3WTTC 2IGMA 2Q2EB 1MJBA 3H5NA 1SC7A 3P7NA 3LFUA 1T6SA 2HI3A 5C3EJ 1GXPA 2KRFA 1BIAA 3AFHA 4KN7X 5GADJ 1WQ2A 1U5TB 2V26A 1OMIA 4UUTA 2OTJI 1RETA 3MZ8A 4AYBN 1R58A 3DLAA 5BMZA 1P4AA 4BHCA 2DCEA 3OY9A 3ZMTA 3ZXSA 3KCCA 4ZC3A 5K5RA 3I55I 1H89C 2WAEA 2I10A 4JBAA 2TCTA 1REPC 3R61A 4ANJA 2CG4A 2ETHA 2I5UA 4M3DA 1ZGAA 2LY1A 3KP7A 3HDDA 2JA6J 2XKOA 2BY1A 3S1QJ 4XLHA 3I56I 4F92B 2MBFA 1UELB 4WX9A 1G6NA 2XSJC 1GDTA 1MBKA 1K79A 3S93A 1HDPA 5IT9Z 3GFJA 3K1PA 3KP5A 2K27A 4DJAA 5GAHJ 3CO6C 4BY1J 3PNTA 5D8LB 2MH9A 4XKCA 3TDZC 1KZHA 2DA1A 3JTGA 4C30A 1ZG1A 1WH5A 2I8DA 1HW5A 4XN3A 1KA8A 1R5HA 3K10A 1CQTA 2QF7A 3S1NJ 1KU3A 1RR8C 3FDYA 2WA0A 3ML6A 4U0YA 3GTJJ 1ITYA 1PUEE 1VQLI 5JVGF 4CCJA 3CLOA 2EA4A 4A5MA 3WE2A 2LC2A 4LK1F 2KLOA 3ISPA 4DYQA 3UR3C 4F91B 3J7YJ 4KJZA 1H9TA 3GTOJ 2O61A 5E3MA 2OCCH 5FLVA 2ZMEC 5DYMA 2VASA 3RDIA 2CUZA 3ZQ7A 1UHWA 1D1AA 2GAUA 1XGMA 5JI6A 2XAUA 3K4LA 4ENMA 4ZTFA 2XF7A 2HU9A 2X6WA 4MQ9F 3EUAA 2R7SA 4D5FA 1B1BA 3PL8A 1QQIA 2QCOA 3WU1B 3R0JA 3GWZA 1VQ4I 1YYVA 2GZWA 4A3IJ 2IA0A 2RAEA 3GFLA 4FCYA 4ZYDA 1UZCA 3LSMA 3W6JB 1YIJI 1QA6A 3M4OJ 2BEOA 1P6RA 1XB4A 4LK0F 3E5UA 1R23A 1U2WA 3CDLA 3H36A 1B9NA 5LBQA 2IVMA 4EM2A 3GXOA 4A3DJ 3K69A 1SMTA 1MBHA 2BV6A 2G9WA 1ZGWA 3I53A 3A03A 4DW6A 3R60A 3JW4A 2OQRA 3JRIA 4G8XA 3HG9A 2DA2A 1QU3A 2PJPA 2YX4A 3K4CA 1QZYA 2UUZA 1MBGA 3I5UA 5LGUA 5HLTA 3ZQQA 2L4AA 4G7ZF 1R4MB 4U0VA 2PEXA 1GV5A 1EKEA 5D8KB 1KQ9A 5IY5H 1N77A 2Q2EA 1YJWI 4W1UA 4ZJZA 5K7ZA 2EIKH 2M7BA 2O3FA 1J5YA 3U1KA 1F5TA 2WTEA 4O3MA 1X1PA 2DLLA 2OF7A 1MKMA 1U9NA 2DFFA 4XSZF 1U5TA 4CYCB 4HOBA 4UXNA 4ZDPA 4ETSA 4BBSJ 2DA4A 3RSNA 4B1RA 5E3NA 2DT6A 2CQ7A 3DCFA 2JUGA 5FGMA 2CW0F 1SD5A 3HB9A 2XAFA 4HA8A 2UXXA 5JLWA 3H3VK 3RKWA 1P2FA 4XRFA 2P7VB 3WTYC 4PZJA 4YEJA 2H8RA 4BL0B 2HXIA 3ZPLA 3SZTA 3N05A 3M7GA 1BJAA 4YFKF 1F1ZA 3KEOA 5BS6A 4HBLA 2KP6A 3A0HC 1SD7A 2A69F 4NC6A 4BS9A 2IGNA 1ERDA 2K85A 3BDDA 1IF1A 1O7FA 3CCRI 3OIQA 3QODA 3SEZA 3TDUC 1MJ9A 2DDBA 2H94A 3DKYA 3IL2A 4XLNF 1X1CA 5D6FA 2GIVA 1B59A 5D4SA 2FMYA 3FXMA 2XRNA 2X51A 3M1EA 3PM1A 3L2QA 1JJ8C 1WJBA 3KP6A 3RIRA 4RDUA 3W6KB 1K6OA 3KFWX 5B66C 1D0XA 1OISA 1LDDA 4N9IA 1TQMA 4YIIA 3RKQA 1S7AA 2D1VA 2HVQA 1D8JA 2KIFA 1QHGA 1RC9A 2ZBKA 5C44J 2ID3A 2YS9A 1XX5A 5FKMA 3HKZA 3S8PA 4WWCA 2KDZA 2LG4A 3TP3A 5IT3A 1QGPA 2DU9A 1XSXA 3DPTA 1ONVA 5HVQC 4NHJA 4UHTA 4FX4A 4RGXA 3TKYA 4E7IA 4UY8I 3K0LA 1IN7A 3JRFA 2H6CA 4QPQA 2O8XA 2W84A 3HEFA 5J47A 4FTHA 4ENNA 4PGHA 4F52A 2ZB9A 3RQIA 1J75A 3GW2A 1QPMA 5B3SH 3DEEA 1X2NA 3QP5A 3DP7A 2MD5A 4J00A 2BGCA 4PJJA 1U0JA 1R22A 2K86A 1TT5B 4QTRA 3RKYA 1Y8RB 5DEQA 2HNHA 2H09A 2D1HA 4MLOA 3ONQA 2FJ1A 2F5VA 3K7AJ 3OYMA 2KFDA 4UNOA 2Z2SB 2ZSIB 4I0AA 1KONA 3SQNA 3IAS2 1D1CA 5E20A 4ENJA 1FNNA 4E6KG 3LSKA 3IAM2 4EM1A 3BT9A 4EGZA 1YJNI 2JTVA 2E7WA 3T8TA 2HGCA 2EWNA 4QPOA 3VWBA 2X6OA 3IP4B 3LNQA 3K4KA 1B9MA 2BW3B 2XVCA 3A0BC 3BOQA 2H1LA 2DPUA 4BAYA 1IN6A 4AUXA 3ZMZA 1DUXC 1YX5A 3EETA 1SFOJ 4CYCA 1OFCX 3EUHC 4PSXA 2ZXWH 4Y52J 3T8RA 4KICA 4YG2F 4OIRF 3IWZA 3CCUI 3DU5A 3RI4A 5J1RA 3KEQA 1AWCA 5TGTA 5BQTA 4HQEA 4S0HB 1OQYA 2VKDA 1XS9A 5FJ8J 1YW9A 3DKWA 2GOXB 1J09A 3BPVA 4IJAA 3TMOA 2CW7A 2A6HF 2LRDA 3HSFA 3NEUA 3W2WA 2VQHA 3H35A 2K02A 3FIWA 2JUCA 4XN0A 3M8JA 2EQRA 5CQGA 1YG2A 2DMNA 4RMNA 2XSDC 1I27A 3MD2A 4BHBA 1R36A 3J80Z 1W0TA 1OYWA 2E1CA 4M6VA 1W1WE 5LRRA 2F5EA 3TP0A 5HOOA 5AIPA 2F4IA 1YRNB 4EV0A 1VFCA 4BGDA 4Y15A 4EJOA 3E97A 3H9JA 2QQAA 4E4HA 4RAGA 3SJMA 2O03A 2XC7A 4KFCA 4AYBA 3E7LA 4I2OA 1IO2A 4XONA 2PLYA 2CRGA 3CUOA 1KGSA 2E2HJ 2M0MA 2Y9ZA 3FHNA 2AXLA 1DPUA 2ZJRF 2W85A 2JA5J 4IF4A 3FHZA 3SXYA 2XGCA 4Z2YA 1F4KA 2FUG2 2Z99A 2ZO4A 1Y1WJ 3IUOA 2EH3A 2HTJA 3WE3A 3FK6A 5F0CA 2FF4A 4CUGA 3S3MA 4EATA 3A01B 2UZKA 5EYRA 3G1OA 4L9VA 3QRFF 2N8GA 4PDKA 5J8FA 1USTA 1V5FA 2JA8J 1UHMA 2XB0X 1AU7A 1R4NB 4CCLA 4BQQA 5EZGA 5KCMA 2COMA 1I39A 3IRQA 3AG2H 2ZNZA 4G94A 2Y75A 1XDUA 2XHKA 1I3QJ 5FKNA 4XIDA 1RNLA 1ENHA 2ME0A 2Y31A 4LFUA 5AONA 1ZK8A 1EH7A 3GX4X 3KEYA 2LREA 4BJTA 3QYBA 4B47A 1DU0A 2V9VA 3PSIA 4B09A 2IS1A 5CVJA 1USSA 4V2FA 2Y30A 2VQLA 2XGXA 4QSHA 3GUDA 2BY3A 2EV5A 1X19A 3QP6A 2K9LA 2PMUA 1Y8QB 1RKWA 5L3GA 1O3TA 1XGSA 1NTCA 3JAMK 2LF7A 2JMWA 1DU6A 4AC0A 5KVRA 4ZTJA 4IRHA 3VEPA 1S7EA 3SDBA 5EEAA 2LD5A 1SAXA 3H1CA 4XKBA 2HKXA 2E35A 2QVOA 2KT0A 2M0CA 2LH9A 3T1BA 2OA4A 2EV0A 4OIQF 1WJCA 3P9KA 2O6GE 2BW3A 4A3JJ 4LIVA 3VFZA 1TQPA 3LSPA 3FF5A 1I6XA 3G73A 2ECBA 2KKOA 3KZIC 2DTZA 2VOOA 2STWA 1IG7A 3CC2I 4L9TA 3FKIJ 3FX3A 2XIGA 3ABUA 2M3AA 2EFWA 5FRNA 3HPHA 6PAXA 4HSRA 3L2WA 2CQXA 4ABZA 5K1YA 1F9NA 3QU3A 1GT0C 3M07A 1FYKA 4RAZA 3KP4A 2YX7A 3WTWC 2QSFX 4P1WA 1O3RA 1CF7B 2HQNA 4HW0A 3BG5A 2BXZA 3NQOA 2MW8A 2ZJ2A 1TNSA 2HDCA 1FJLA 3I4MJ 2LY9A 4PK4A 4ON0A 3GTGJ 3ZCOA 4M3BA 3DTKA 4PGGA 3HL2A 2KHMA 3HSEA 3QPHA 4G12A 5CQEA 4AU7A 5ICEA 4LB5A 4LJZF 4PJNA 4E7ZA 3CCSI 1BL0A 2PBIA 1YRNA 1KU7A 4NDLA 5GPAA 5DCMB 5DUKA 5GP9A 2XPVA 3BTIA 3KIOA 3KZYA 2H6BA 3P9IA 2GM4A 2EZLA 2XPUA 4Q5SF 3A1YA 3CC4I 2QYOA 1ETWA 3EUHA 3PQJA 4YIRX 1GVDA 3RPUA 1Z21A 2JJ7A 4DNCA 3S17J 5LHGA 2GA1A 1ZTRA 5DV5A 1OLTA 3CF5F 5CPRB 1RUNA 2BYVE 3P9CA 3K70C 1B72B 1MNDA 3P5JA 4G7HF 2QZ8A 1WJ5A 3LSHA 2IW5A 3U21A 3S2HJ 3H92A 4OINF 4B3AA 5H6QA 1IN5A 2M4KA 4WCGA 4BDYA 5KAFC 3OYCA 2A6TA 2WY8Q 5FRMA 3A01A 1WRJA 3BTLA 1TBXA 4S04A 4IO9F 2Y2ZA 3DBLB 1G3WA 4AIJA 2JSPA 4B4CA 3N4MA 1IV6A 2ZCWA 2W1OA 1W7PB 3VSLA 1XGOA 4XNFA 5FLXK 3VOEA 5J6XA 3FBNB 3FMSA 3G4SI 2HVRA 2Y0MA 5FD5A 1YHQI 1I6HJ 2E71A 3IRRA 4A6EA 4JK1X 2CV0A 3HKZN 2QGUA 4GYGA 3WHBA 1ON2A 3ERED 5L3DA 1DGWY 4C2MJ 2DMTA 2DDAA 3WG9A 1ZKGA 2OQGA 3DF8A 1SVLA 1YLFA 2HOEA 2A05A 2XAHA 1APLC 3GFMA 1Z0XA 3VSKA 3HRUA 4XOPA 5JHUA 4XRMA 3ELKA 4R1HA 1LEBA 4IRGA 1MBJA 3IHUA 1LVKA 2ZC2A 3S1MJ 4PJLA 2DFEA 2CV2A 1WH7A 2JVGA 2KL4A 3G1MA 5FD6A 3MKWB 2IP2A 4I01A 3DPUA 3V8JA 3LQQA 5LLQA 1FX7A 1FYMA 4A3MJ 2MLKA 3BG9A 2L3DA 1ETKA 1JI8A 3Q0WA 3RZDJ 2ESHA 4AD9A 3JRDA 4CGZA 4O6JA 4UUVA 4F55A 1E3PA 4GCVA 2CV1A 3MKLA 4ZYGA 5ILSA 2BHYA 3E6CC 3PJRA 4GXOA 5TISC 4M9SA 2DA7A 1LKXA 4A12A 1U8RA 2ZNYA 3Q5FA 1MIJA 1O57A 3GTMJ 2OJED 1MMAA 2X9DA 1LVAA 4BXUA 3JR9A 2CW8A 1VI0A 3JRCA 3DWLE 3WTZA 2LBFB 3FXOA 2HR3A 1JGGA 3HOUJ 1YTYA 4U87A 1LB2A 1CF7A 4LG0B 2HOSA 1J59A 2VL8A 2ELJA 1DQUA 2K4JA 4BBRJ 4A3KJ 2LOOA 5ILVA 1S9HA 3EQLF 1Z05A 4BE0A 1WKMA 4HQMA 1BC7C 5EEHA 1IRZA 1T2KA 1R71A 2DJNA 2L4MA 1FZPB 4IEJA 4OMYA 3GCMA 3FXKA 3L2CA 4G7OF 3L9FA 3SZGA 3TBIA 1HSJA 3VYTB 1OR7C 2VB6A 5E1ZB 4X6AJ 2EK5A 5HNFA 1K61A 3BG6A 2FSWA 1LNWA 1UJ8A 4A93J 1PP7U 2EPFA 3VODA 4WXCA 3HIFA 5DCMA 3R0AA 5EEGA 2DT7B 5GPCA 4A69C 2ZXHA 3M9AA 1R6RA 2GWRA 4HNUA 2CMPA 4KIGA 4CHUA 1XCVA 4D7NA 3UKGA 1TLHB 3CMMA 2R4GA 1MMNA 2IXSA 2V6CA 2H8WA 1B6AA 4XKVA 1B72A 3AKZA 3S15J 2K9SA 4BE2A 5K5OA 5JFRA 3HTSB 1Y0NA 3HOYJ 3IH3A 5F1JA 3PQKA 4M71A 3ZMVA 1BC8C 3L2VA 3K4JA 1U6GA 5M5WJ 3RQ4A 4BY7J 3OYEA 1OJLA 2DMPA 1ZRDA 2TRTA 4R79A 4RM2A 1W7PA 1H8AC 1FOKA 3DQVC 1SD4A 3OS2A 3VPRA 2DJIA 5CLSA 2HOAA 1QRYA 3K9TA 4RGUA 4JX5A 3ABLH 1YQAA 1MW7A 4KIFA 4RGRA 5D4RA 2EILH 1LE8B 1H0MA 1YFHA 3V7SA 2W25A 4EM0B 4HV5A 3CMYA 1K4TA 4XRSA 3C2GA 3H0DA 1Z77A 1YJ9I 2HZTA 3V7RA 4EJTA 1P7JA 4MO7A 3MMYB 2BZTA 1W5SA 2FEZA 4D7MA 1XSVA 5TRDA 1YS7A 2PFBA 2IRFG 3JSPA 2A3SA 2L02A 4P96A 1S29A 2Z9OA 2G7HA 4AVPA 4AVZA 3JTHA 2NAZA 1QHHD 2K9NA 4D1QA 5E3LA 1MGTA 4IXAA 1MZBA 5HDKA 1ZHFA 5JVTA 2PJRB 3CJTB 2AQEA 4A3BJ 2FA5A 4BXXJ 5CVVA 2RC4A 1HOMA 3WTUC 5GTIC 1SD6A 2VJJA 1VQ7I 2BVMA 3I54A 4FE7A 4XOTA 2EBIA 3IC7A 2L7ZA 1MMSA 3HOXJ 4LB6B 2OAZA 1BI0A 3G3ZA 4XLAA 5KK1A 2HDDA 1NG6A 3WG7H 3F21A 3L2RA 3E6DA 4ZYHA 3T5XA 3KETA 3LSIA 1RKTA 5L3EA 1TW2A 2R7UA 4QWQA 1DPRA 2MSYA 4L9NA 5D5VB 2XPWA 3WGIA 4ZZDA 3QOPA 3TQNA 5LRSA 1MNEA 3HOSA 1OCOH 4GYIA 2LBFA 1I5ZA 5J3LA 2P8TA 1K78B 2J5PA 4LG0A 1F36A 5BOXA 3CMAI 5F6FA 5J4VA 3KP2A 2QEXI 1BW5A 4Q4ZF 4XR6A 5KHDA 4KITB 2KQRA 3MZHA 5BPDA 3GYHX 4U0WA 2VBXA 1LDKB 1SFKA 5DUIA 2R7XA 1YX3A 3S1RJ 3LWFA 3CDHA 3GEZA 2DK8A 2XF5A 2F5CA 4MNUA 1OYIA 2ADUA 2L9SA 4E7LA 3CDIA 2ZMEB 3G6EI 4K2EA 2ZJQF 2QKLB 1RESA 4UUSB 2ICWG 2X1EA 2X4HA 3I59B 4HZFA 5FLMJ 2HZDA 2HEOA 3G1LA 5FB2A 3FXJA 5FKOA 1Z91A 3S16J 2K4BA 3OYNA 2RQQA 4R8HA 1TP4A 2ZFUA 2JRMA 4RAYA 3AG4H 1VQKI 1D8KA 1XMXA 2EJRA 3GF2A 2QLZA 4CH7A 2QQBA 1OYYA 2O0YA 4NQWB 3PNVA 5E79C 1R5ID 5IYCJ 1W5TA 4A3GJ 3IH2A 1G4DA 3CJQB 3GBGA 2DXIA 3MFKA 2VBYA 3ECHA 2A07F 5IYBJ 1X3WB 1OR7A 4RGSA 4Y33A 1BR2A 5LHIA 5M5YJ 2BE5F 1MSEC 2RV8A 4Q48A 4B3XA 1O3SA 2F48A 2EIJH 4MFEA 1LE8A 2XKPA 1BOBA 1FMWA 1WJEA 4EEFG 3LSGA 2FRHA 2EINH 1V55H 4LLLA 1OCRH 5L3CA 1TWFJ 1MH3A 2FBKA 1I1SA 3B73A 1K6YA 2NYXA 1HKTA 1G8XA 1Z6RA 2EFPA 5K5QA 3FM5A 1Z67A 3KYCB 3DXJF 3FWEA 2OV7A 3HPGA 3OL4A 5F04A 4EJUA 4EMSA 2IS2A 4NUBA 4CICA 5HODA 3KE2A 1M1EB 2CH0A 2JA2A 2WB1N 4X1EA 1FOXA 4P9FA 3CCYA 2ISYA 5D5XB 5HLHA 4BH9A 3GZ6A 1C0WA 3W2VA 2HXOA 3F3XA 3JRAA 2PJRA 4BYYA 3FXRA 2ELKA 2FNAA 2R0QC 1OKRA 3HOTA 1ZAOA 3DBHB 3K4BA 1BA5A 2C6YA 1X2MA 2E5ZA 2V9KA 1KU2A 2DW4A 2FNPA 4KN4X 1T33A 2P4WA 5LGTA 2COBA 1OPCA 3LA3A 1KQ8A 1D1BA 3K4MA 3PUFA 1FEXA 2LK2A 1E3HA 3BP8A 4NB5A 5ICCA 1JHFA 1N75A 2VI6A 5JHFA 1S3JA 3ZQGA 2WV0A 2R93J 2P5KA 4RA2A 2JPBA 2W4SA 3W3CA 3DEWA 5HS7A 3J81K 3EYIA 2X1CA 1K78A 1JGSA 3MN2A 4L5IA 3LSTA 3PNYA 2DOEA 4JX6A 5JR3A 2DYSH 3VYRB 1TWAJ 4FQGA 2MGQA 1W36C 3CCLI 2NXNB 4E7KA 2VUMJ 3DKXA 1DDNA 3HRMA 2R5ZB 3ZN1A 3DTIA 2X85A 2M30A 4Q47A 2DYRH 2E1OA 3KYDB 2R7FA 1T98A 4KDPA 4EJWA 2ZMEA 2F6CA 3MQ0A 3OYLA 4IL6C 3I4PA 4DBRA 4UUSA 2J5OA 3I59A 4F7ZA 3B02A 3VYSB 2DODA 1FC3A 3BZKA 2VE9A 3TGNA 2KRHA 2V79A 2EIMH 2IA1A 5HDNA 3PFYA 1N78A 4HYEA 4IHYA 4II2A 2DI3A 2LTPA 1MD0A 5J1UA 2E2JJ 3M1CA 2B0LA 4BNCA 1WZ2A 2RQPA 4DZPA 1BM9A 2K3PA 5D5WB 4NQWA 2R7TA 2CQQA 1PUFB 3RPUD 5KNLA 2R7DA 4E70A 1V3FA 1UFMA 4ZH4F 1JKRC 4RB1A 1LFUP 1VF9A 4L9JA 4L0ZB 3OSFA 5EZHA 2LVSA 2HQAA 2F4OB 2LP0A 1QVTA 4RAFA 2X6XA 1MBFA 3CP2A 2KZGA 4D5CA 3JCUC 4DIQA 2CFOA 1HCRA 9ANTA 1L0OC 1O3QA 4JOMA 3F72A 1EA3A 3PSFA 1AA7A 5FO5A 3CJRB 3GTLJ 5M5XJ 2EFQA 5D6EA 3LQRA 3HGYA 4G6QA 2DFIA 3LFKA 4DBQA 3BY6A 4LLGF 4OAYA 3PO3J 1UHSA 1D0YA 3HXLA 1FPQA 1X4PA 1XG1A 2IPQX 2A68F 2R7VA 3I4NJ 2VJ5A 2AS5F 4ESBA 2JPCA 4HPQA 3J7AO 3ZOBA 4C3JJ 4IX7A 2F5DA 1IDYA 2K9QA 1XC5A 3BLYA 3S14J 3H3UA 3ZMUA 4MIMA 4MTDA 1ETYA 1Q1VA 3BR1A 4MQVA 1OCZH 1DP3A 2L01A 3IKTA 4KA4A 2VKEA 1BR4A 2VLAA 4M3GA 3L2UA 2YPRA 3OV8A 1FSEA 1NK2P 1QBJA 1IUYA 2M8GX 1YS6A 1J0RA 5CJ9A 2R7RA 5CVRA 3LAJA 2STTA 3TO7A 3E5QA 3DU6A 3F8MA 3OMYA 2IAIA 4PJ0C 1XN7A 2MA3A 3H5RA 4GO1A 3BWGA 4B48A 1WPKA 4ZDLA 4DQ2A 2XDVA 5HS8A 3GO5A 2MLGA 1I50J 2VJIA 5E8GA 4WF2A 1U78A 4IVNA 1FBUA 5A2QK 1ACIA 1X1DA 1Z3XA 3MVPA 4LD5A 1WI9A 2AQFA 3QQAA 2Q1ZB 2QSHX 4Y17A 3ZRGA 3QYEA 3JRHA 1IW7F 1LFBA 3E1SA 1B4AA 3LSRA 3BR2A 2QWWA 2IT0A 4IHWA 3TOBA 2LSOA 1TC3C 2GQQA 1WI3A 2R5ZA 3ZQHA 2V6EA 1R1UA 4KISA 3U9GA 1P9QC 1FOYA 4HG2A 2Q8KA 2M34A 2CQKA 3GVAA 3OYJA 4Z6YA 2NOJB 1JT0A 2V4JC 5M3MJ 2VXDA 3O8GA 4I09A 2HYJA 1X3ZB 2GLOA 3DPLC 1JTYA 1XMAA 1F43A 1Z3YA 1D0ZA 5LHHA 5IP7J 3F0CA 3JREA 2R7OA 5F1RA 2M87A 3VDXA 2V1NA 3K2ZA 2W82A 2PI0A 2ESNA 4AIHA 2B7EA 4UVBA 1P92A 1PUFA 4AWXB 2X0LA 4LGWA 3RJPA 2IJLA 4F93B 2MC3A 1UCRA 1IXCA 1JUPA 4L18B 3QPLA 1ZLKA 1YOVB 5E1XA 5F0HA 2LYCA 4YFNF 2MD0A 3CTAA 1OCTC 1ZH5A 5EG0B 4CDGA 2L9VA 5HNHA 1MDMB 4J19A 2QA4I 2NNNA 3QU6A 2RN7A 2QQ8A 4BKXA 2VE8A 2E19A 1VNDA 2P5VA 1A35A 4W97A 5E3OA 2AXTC 1W7PD 4XMYA 4CZCA 1GHCA 3EPZA 4ITVA 5FKLA 3ZQLA 2P6TA 4XM3A 5IOZA 2HPMA 5F08A 3PO2J 2FQ4A 2LY2A 2A61A 5EGOB 2PQ8A 4M3FA 5HLGA 1G59A 5IYDJ 5IT9K 1WJFA 3B6CA 3OR2C 5B1BH 2CO5A 1Y6IA 2HVSA 4OIPF 1KYWA 4OAZA 4E7JA 4M6XA 2R92J 3C1DA 1R9TJ 3K2AA 2A6EF 1YIOA 3HHHA 5IP6A 3GZ5A 3CQZJ 4BDZA 3K70D 2OTLI 1JUSA 4M3EA 3CCVI 4AIKA 1OCCH 1RIOH 1U9OA 4C9YA 4BACA 3RYPA 2M45A 1GV2A 3GTPJ 2HFHA 3ZN0A 1FOWA 2ZFWA 1K4SA 2NVXJ 5IPAA 1RR7A 4H0EA 3FMQA 4ASNA 1ORKA 3BR5A 4LITA 4I0BA 3FZVA 3LA2A 2HKOA 2VIXA 2VT3A 1V5EA 5F64A 3L1PA 2EFOA 5BNGA 3U1DA 3DBRB 2ZJPF 3BC8A 1FT9A 2F2EA 3TO9A 4JQFA 3CMEI 2IGOA 4H4KC 1BIBA 4NC8A 2WB1A 3E0JB 1FYLA 5H20A 4HX8A 1SFEA 2LMDA 1UAAA 3HYIA 1HDDC 1P4WA 1MH4A 3CP8A 1ULYA 2XV4S 3CESA 2LKXA 3WU0A 2EZIA 3HOVJ 3TO6A 2BY2A 2XAGA 4FX0A 3FXLA 3CF2A 3FM3A 3FXQA 3K4NA 4XLFA 5KAIC 2UV1A 2HOTA 1IXSB 4HEA2 4P5OA 3BZCA 4XICA 2XROA 2BY0A 1VQ5I 4U7DA 3RYRA 2P6SA 2KIUA 4LG3A 1S72I 1ZG3A 3CC7I 1R1VA 3LL7A 3F9KA 4A3LJ 4BJ5C 2LF8A 2ZKZA 4N4NB 2QQ9A 3BQYA 5LFAA 2IA2A 2VBWA 1UB9A 3LOCA 2CS3A 2NNYA 3KX2A 4A0ZA 2DOAA 3C2HA 5EJCA 2D2WA 2DK5A 2L9NA 2DTRA 3OIPA 3WTVC 3CJNA 3RTRA 2KISA 1XSDA 1JKOC 3HRSA 3I58A 3OIOA 4ZYAA 3ASNH 3FKJA 4TV7A 3H9GA 1XPXA 5DD4A 5J1YA 1GLNA 1BN5A 2DQRA 3SDGA 5EG0A 3ECOA 2DA6A 1MDMA 4E7SA 1IZ1A 4CCOA 3S3OA 2VT2A 4XBFA 2NOGA 2CGPA 3ROUA 1RRJA 1T08B 1T95A 2FBHA 2O7OA 3GLXA 3KLNA 2XAQA 1ODDA 2L5QA 3OYAA 3PIOF 3AG1H 1JE8A 1HXDA 3OYHA 1JKPC 4PFPA 4BQAA 4A3EJ 1U5TC 1EF4A 3COAC 2P7CB 2CJJA 1Y1VJ 4L5JA 2JT1A 3JAMZ 5EGOA 4O5VA 3L09A 4HNVA 1BOAA 2PMHA 2EA2A 1G3YA 2KIQA 5HS9A 3H9QA 3DEUA 3OOPA 4WXDA 1R00A 2NS7A 1XMKA 1IAWA 3D1NI 4IHVA 3V7CA 3GTKJ 4M73A 3QYFA 4MGRA 3DTEA 3RPQA 3TEDA 5ICFA 4A0XA 3TW6A 2H27A 3SEQA 3ZQIA 3ABMH 2W7NA 1FP1D 1HKQA 1ZLJA 2K40A 4CYDA 4UVAA 1VQOI 4HF2A 5E17F 2P0WA 2HYGD 3HSRA 3NWTA 3D5LA 3T0YA 1WSUA 3M3YJ 1IDZA 4Y3OA 1ZGJA 5C4JJ 4IZZA 1IUFA 3OWTA 1A04A 1A36A 2UWMA 3FBIB 3SZPA 3QWLA 2V7FA 1NK3P 4HX7A 1MMGA 1V5GA 2WY7Q 4NNJA 2G0EA 2KJCA 3FISA 1HBXG 2RNJA 2FMLA 2ELHA 4PUSA 4IQJA 4M6YA 2LLKA 1E3OC 2MH2A 1YITI 2CUJA 1ETVA 4FE4A 1JTXA 3FMRA 5ILUA 4UV8A 1ETQA 4AM3A 3BG7A 2BBYA 1FY7A 2B9SA 2KPMA 2LKPA 2OPTA 3EUKL 3X2QH 3V8LA 4P9UA 2M2EA 1SAUA 2DBBA 3F8NA 3JSOA 3W2AA 4KMFA 1FSHA 4KUMA 4XLCA 2DOFA 3LMMA 1QPIA 1HF0A 1JKQC 3MEXA 1VZ0A 1XCBA 3UNGC 2DFHA 1FBQA 1Z7LA 2NVQJ 2WAQA 3V8KA 2M4GA 1UMQA 5F0FA 2E1MC 2K5CA 1HW2A 3E6BA 3TL4X 3RZOJ 2FE3A 2EFNA 3F8BA 5J4YA 2K7LA 2DQLA 2BXYA 4RB2C 1YO5C 3IWFA 1O4XA 2LFBA 1XD7A 1E17A 1K83J 3KZZA 1G3SA 3OS0A 1W0UA 4DOZA 1JHHA 1WJDA 5GAEJ 2UXNA 1ZYRF 1W4MA 2VODA 3IH4A 1NH3A 4PSWA 5DTDA 1VQ6I 1P7IA 2DT5A 5FLXZ 5ERIA 4C2TA 2IBDA 1YW7A 4PJMA 1NHAA 2VJ4A 2A5YB 3H3ZA 5E18F 2CU7A 3G2BA 1PVEA 3HBLA 2YU3A 2FQ3A 1QVUA 2PG4A 4YELA 2IS6A 1ETOA 1WGXA 2PN6A 3L00A 1E0EA 2VKHA 4L0YB 2WBMA 4MHGA 4I98B 2E1MB 4CCKA 3OYIA 3C18A 2RREA 2V1UA 3F6OA 2HPIA 2M5WA 4QIWN 3BROA 4XQFA 3J80K 1A31A 1I1GA 1SEUA 5B1AH 5DM6F 4FASD 2QENA 3F23A 1X58A 1D5YA 5FKKA 2M1BA 4M9XA 3O2PE 5FROA 3SYTA 2QKMB 3R4KA 4HNTA 1RI7A 1RPWA 1LDJA 4HLXA 3BTJA 2AHQA 4GRIA 2WWYA 2HS5A 3HUGB 2R7ZJ 3KLOA 3CCMI 4HLYA 4RM3A 3Q0VA 4X0GA 3CCEI 3B6AA 2L7KA 4BXFA 2OD5A 2ID6A 4UV9A 3I3LA 1JXSA 3HM5A 1QO0D 4L5EA 2VOPA
chains in the Genus database with same CATH topology
3LA7A 1TTYA 1TNTA 2HYFA 1QNTA 1BI1A 3HTUA 3F6VA 3SFZA 1L3LA 2DPDA 1BI3A 1WWXA 2XUBA 4UVCA 3R6SA 1SFUA 5LGNA 2EV6A 4GGGA 1ZG5A 4PCQA 4HF1A 3MZYA 2W24A 4I02A 1GVJA 3WGHA 2LNBA 4I7HA 1R1TA 3M8FA 4KNYA 1J2XA 1FBSA 3I64A 5ICGA 4IRIA 2TDXA 4U88A 2NS0A 2Z5UA 5LEJA 1KYZA 2M8EA 2VC0A 3AAFA 2GXGA 1S7OA 2E7XA 3WTSC 2RVCA 1IRGA 1Y0UA 2JRTA 4MTEA 4CO8A 4HF0A 2HQRA 4LLNA 4WK8F 2FU4A 3Q9SA 1P4XA 5L3FA 5FFXA 3D0SA 2OU2A 4ZYEA 2NRAC 5H6RA 2FXAA 5J8CA 2CSOA 4HAMA 2RDPA 1PP8F 1ZN2A 3U2RA 3HUGA 1Q1HA 1J9IA 2XAJA 3CUQC 2W57A 3BPXA 3IKVA 4LMYA 4OIOF 3RKXA 1MJAA 4CXFA 1LQ1A 3O3KA 4OMZA 1BBYA 2YSRA 1X3UA 5L3BA 5AIQA 4MEYF 2ZXJA 2VBZA 2CFXA 3F8CA 5CVUA 1SMYF 5CYVA 2G7UA 3ZMDA 3QPTA 1ZRCA 2Y48A 2EB7A 1D5VA 4EVIA 4HX4A 3V4GA 3CUQB 3FXUA 3WTXC 5CVIA 2FOKA 1XGNA 3C7JA 4IHTA 3EDPA 2DAOA 1ZARA 3ULQB 1ON1A 4ENKA 2P5LC 4YIFA 1E2XA 2L54A 1O7LA 3MWMA 3K1MA 3ZP5A 3HHGA 4FHTA 1KU9A 4RS8A 4ESFA 1RUOA 4IHSA 1ZREA 3C3WA 5DDGA 2OBPA 1Z9CA 3GFIA 2QBYB 4G6DA 5D5UB 4BHPA 3E6MA 2QM3A 1IN4A 2LDUA 3N97A 4N0BA 4A6DA 1BI2A 5FFZA 4D0PA 1V4RA 1U3EM 1GXQA 5E1WA 1TW3A 2E1NA 3CO7C 3E5XA 3DFGA 4EQQA 2VC1A 4RB0A 2Q0OA 3F8FA 1T0FA 4P55A 1ZRFA 3SHFA 1J7KA 3I71A 2KIMA 2CWEA 4OU0A 5DCFA 1R5GA 4QLCU 2DO7A 3LAPA 2YR2A 2CYYA 5E8IA 2JSCA 4KYWA 4WXHA 4XSXF 2Z3YA 1T38A 1LEAA 4A5NA 1S6LA 3J81Z 1HW1A 1EH6A 1YW8A 2V1XA 3VB2A 5HDGA 2ISZA 3REOA 4G9YA 2WC2A 4ESJA 1HSTA 2KJBA 3L7WA 1TQIA 3EYYA 4FT8A 4U7BA 1HKSA 2OZ6A 4A0YA 5TJJA 4A2UA 1AOYA 1D3YA 2HTSA 3CUQA 3WGGA 4OOIA 1FLIA 3PFIA 4B8XA 2VXZA 3M8EA 2JZYA 5DD8A 3Q9VA 1DP7P 5HLIA 1EH8A 1G3TA 4KIBA 1FP2A 3E3VA 1IN8A 3BJOA 4M9ZA 4Y13A 2F5FA 4YFXF 2RKHA 4KT5C 3NRVA 4IPAA 2QBYA 1PDNC 3DV8A 1H9GA 3I0TA 2VONA 2GA2A 2V1DA 1IXRC 4EGYA 3BJ6A 5ED4A 1FWZA 2Z33A 2GXBA 1HQCA 1KQ0A 5LEKA 1XDSA 4HV6A 3BZ6A 4CZZA 1T39A 4EJVA 2OZUA 2HWVA 3ABTA 4HDVA 1EV7A 3K1NA 3MAJA 4HDUA 1QZZA 1IRFA 1Z7UA 4KMUX 5A2QZ 3TOAA 3S2WA 4RB3C 1R7JA 4S05A 2XASA 1VTNC 3QAHA 2VN2A 4N9HA 3O6BB 1K7AA 3HRTA 2RGVA 4M74A 5BPIA 1Z1DA 3KP3A 2D45A 4MEXF 3BJAA 1S8NA 1CGPA 4M72A 4ZZLA 2QUFA 1RZ4A 3ZMSA 1LJ9A 4XLPF 3F22A 2R3SA 2FBIA 1SFXA 2ACJA 3WODF 1STZA 3MCZA 1Z6TA 3WTTC 1MJBA 3P7NA 1T6SA 1GXPA 2KRFA 1BIAA 4KN7X 1WQ2A 1U5TB 1OMIA 1R58A 5BMZA 1P4AA 4BHCA 3ZMTA 3KCCA 5K5RA 4JBAA 1REPC 3R61A 2CG4A 2ETHA 1ZGAA 3KP7A 2XKOA 2MBFA 4WX9A 1G6NA 1K79A 5IT9Z 3GFJA 3K1PA 3KP5A 2K27A 3CO6C 5D8LB 2MH9A 3TDZC 3JTGA 1ZG1A 1HW5A 1KA8A 1R5HA 1KU3A 3ML6A 4U0YA 1PUEE 3CLOA 2EA4A 4A5MA 3WE2A 4LK1F 3ISPA 2O61A 1H9TA 5DYMA 3RDIA 3ZQ7A 1UHWA 2GAUA 1XGMA 5JI6A 4ENMA 4MQ9F 1B1BA 1QQIA 3WU1B 3R0JA 3GWZA 1YYVA 2GZWA 2IA0A 3GFLA 4ZYDA 3W6JB 2BEOA 1P6RA 1XB4A 4LK0F 3E5UA 1R23A 1U2WA 5LBQA 1B9NA 2IVMA 4EM2A 3GXOA 3K69A 1SMTA 2BV6A 2G9WA 3I53A 3R60A 3JW4A 2OQRA 4G8XA 2PJPA 2YX4A 1QZYA 3I5UA 5LGUA 2L4AA 4G7ZF 4U0VA 2PEXA 5D8KB 1KQ9A 2Q2EA 2O3FA 1F5TA 1J5YA 2WTEA 4O3MA 2DLLA 1MKMA 4XSZF 1U5TA 4HOBA 4UXNA 4ETSA 5FGMA 2CW0F 1SD5A 2XAFA 4HA8A 2UXXA 3RKWA 1P2FA 4XRFA 2P7VB 3WTYC 4PZJA 3ZPLA 3SZTA 3M7GA 1BJAA 4YFKF 1F1ZA 3KEOA 5BS6A 4HBLA 1SD7A 2A69F 3BDDA 1IF1A 1O7FA 3TDUC 1MJ9A 2H94A 3IL2A 4XLNF 5D6FA 2GIVA 1B59A 5D4SA 2FMYA 2XRNA 3M1EA 3KP6A 3RIRA 3W6KB 1K6OA 3KFWX 1LDDA 4N9IA 1TQMA 4YIIA 1S7AA 2D1VA 1D8JA 2KIFA 2ZBKA 4WWCA 5IT3A 1QGPA 2DU9A 1XSXA 3DPTA 1ONVA 5HVQC 4NHJA 4UHTA 4FX4A 4RGXA 3TKYA 3K0LA 1IN7A 2H6CA 2O8XA 2W84A 4ENNA 4PGHA 1J75A 3GW2A 1QPMA 3QP5A 3DP7A 2MD5A 2BGCA 1R22A 2K86A 3RKYA 5DEQA 2H09A 2D1HA 4UNOA 4I0AA 3SQNA 5E20A 4ENJA 1FNNA 4EM1A 4EGZA 2JTVA 2E7WA 3T8TA 2HGCA 2EWNA 1B9MA 2XVCA 3BOQA 2DPUA 4BAYA 1IN6A 3ZMZA 1DUXC 3EETA 3T8RA 4KICA 4YG2F 4OIRF 3IWZA 3RI4A 3KEQA 1AWCA 5BQTA 4HQEA 1YW9A 3DKWA 3BPVA 4IJAA 2A6HF 3HSFA 3NEUA 2K02A 1YG2A 1I27A 4BHBA 1R36A 3J80Z 1OYWA 2E1CA 5LRRA 2F5EA 5HOOA 5AIPA 4EV0A 4Y15A 4EJOA 3E97A 2QQAA 2O03A 4KFCA 4I2OA 2PLYA 3CUOA 1KGSA 2AXLA 1DPUA 2W85A 4IF4A 3FHZA 3SXYA 4Z2YA 1F4KA 2Z99A 2ZO4A 2HTJA 3WE3A 2FF4A 2UZKA 3QRFF 4L9VA 4PDKA 5J8FA 1USTA 1UHMA 2COMA 3IRQA 2ZNZA 4G94A 2Y75A 1XDUA 2XHKA 1RNLA 4LFUA 5AONA 1EH7A 3GX4X 2V9VA 4B09A 5CVJA 1USSA 2XGXA 3GUDA 2EV5A 3QP6A 2PMUA 5L3GA 1O3TA 1XGSA 3JAMK 2LF7A 5KVRA 4IRHA 3VEPA 1SAXA 2HKXA 2QVOA 3T1BA 2OA4A 2EV0A 4OIQF 3P9KA 2O6GE 3VFZA 1TQPA 3FF5A 1I6XA 3G73A 2KKOA 2VOOA 2STWA 4L9TA 3FX3A 2XIGA 3ABUA 2EFWA 6PAXA 5K1YA 1F9NA 3QU3A 1FYKA 4RAZA 3KP4A 2YX7A 3WTWC 1O3RA 1CF7B 2HQNA 4HW0A 3NQOA 2ZJ2A 1TNSA 2HDCA 4ON0A 4PGGA 3HSEA 3QPHA 5ICEA 4LB5A 4LJZF 2PBIA 1KU7A 5DCMB 5DUKA 3KZYA 3P9IA 2H6BA 4Q5SF 2QYOA 3EUHA 3PQJA 3RPUA 4DNCA 5LHGA 2GA1A 5DV5A 1RUNA 2BYVE 3P9CA 4G7HF 2QZ8A 2IW5A 3H92A 4OINF 5H6QA 1IN5A 4WCGA 1WRJA 1TBXA 4S04A 1G3WA 4AIJA 3N4MA 2ZCWA 1W7PB 1XGOA 5FLXK 3VOEA 5J6XA 3FMSA 2Y0MA 5FD5A 3IRRA 4A6EA 4JK1X 4GYGA 1ON2A 3ERED 5L3DA 3WG9A 2OQGA 3DF8A 1YLFA 2HOEA 2XAHA 3GFMA 3HRUA 5JHUA 3ELKA 4R1HA 1LEBA 4IRGA 3IHUA 5FD6A 2IP2A 4I01A 3V8JA 3LQQA 5LLQA 1FX7A 1FYMA 2MLKA 2L3DA 2ESHA 4AD9A 4CGZA 4O6JA 4UUVA 4GCVA 4ZYGA 5ILSA 3E6CC 4GXOA 4M9SA 4A12A 1U8RA 2ZNYA 3Q5FA 1O57A 1LVAA 4BXUA 3WTZA 2HR3A 1YTYA 1LB2A 1CF7A 4LG0B 1J59A 2K4JA 5ILVA 3EQLF 1Z05A 1WKMA 4HQMA 1BC7C 5EEHA 1T2KA 2L4MA 1FZPB 4OMYA 3L2CA 4G7OF 3L9FA 1HSJA 5E1ZB 2EK5A 2FSWA 1LNWA 1PP7U 3VODA 4WXCA 3HIFA 5DCMA 3R0AA 5EEGA 3M9AA 2GWRA 4KIGA 4CHUA 1XCVA 1TLHB 2V6CA 1B6AA 5K5OA 5JFRA 3HTSB 3PQKA 4M71A 3ZMVA 1BC8C 1U6GA 1ZRDA 4R79A 1W7PA 1FOKA 3DQVC 1SD4A 5CLSA 3K9TA 4RGUA 1YQAA 4KIFA 4RGRA 5D4RA 1H0MA 1YFHA 3V7SA 2W25A 4EM0B 4HV5A 2HZTA 3V7RA 4EJTA 1W5SA 2FEZA 1XSVA 5TRDA 1YS7A 2PFBA 2IRFG 3JSPA 2A3SA 2L02A 4P96A 1S29A 2Z9OA 2G7HA 4AVPA 3JTHA 2NAZA 1MGTA 4IXAA 1MZBA 5HDKA 1ZHFA 5JVTA 2FA5A 5CVVA 2RC4A 3WTUC 1SD6A 3I54A 3IC7A 4LB6B 2OAZA 1BI0A 3G3ZA 5KK1A 3F21A 3E6DA 4ZYHA 3T5XA 3KETA 5L3EA 1TW2A 4QWQA 1DPRA 4L9NA 5D5VB 3WGIA 4ZZDA 3QOPA 3TQNA 5LRSA 3HOSA 4GYIA 1I5ZA 2P8TA 1K78B 2J5PA 4LG0A 5BOXA 5F6FA 3KP2A 4Q4ZF 3MZHA 5BPDA 3GYHX 4U0WA 2VBXA 1LDKB 5DUIA 3LWFA 3CDHA 3GEZA 2DK8A 2F5CA 4MNUA 1OYIA 2ADUA 2ZMEB 4K2EA 2X4HA 3I59B 4HZFA 2HEOA 5FB2A 1Z91A 2K4BA 4R8HA 4RAYA 1D8KA 2EJRA 3GF2A 2QLZA 2QQBA 1OYYA 2O0YA 1W5TA 1G4DA 3MFKA 2VBYA 3ECHA 2A07F 1OR7A 4RGSA 5LHIA 2BE5F 2RV8A 4Q48A 1O3SA 2XKPA 2FRHA 4LLLA 5L3CA 2FBKA 1I1SA 3B73A 2NYXA 1HKTA 5K5QA 1Z6RA 2EFPA 3FM5A 3DXJF 3FWEA 4EMSA 4EJUA 4CICA 3KE2A 4P9FA 5D5XB 2ISYA 5HLHA 4BH9A 3GZ6A 1C0WA 3F3XA 4BYYA 3FXRA 2FNAA 1OKRA 3HOTA 1ZAOA 2C6YA 1KU2A 2DW4A 2FNPA 4KN4X 2P4WA 5LGTA 1OPCA 3LA3A 1KQ8A 4NB5A 3BP8A 5ICCA 1JHFA 1S3JA 2WV0A 2P5KA 2JPBA 5HS7A 3J81K 3EYIA 1K78A 1JGSA 4L5IA 3LSTA 5JR3A 1DDNA 3HRMA 3ZN1A 2M30A 4Q47A 1T98A 2R7FA 4KDPA 4EJWA 2ZMEA 3MQ0A 3I4PA 2J5OA 3I59A 4F7ZA 3B02A 1FC3A 2VE9A 3TGNA 2V79A 2IA1A 5HDNA 4HYEA 2DI3A 1MD0A 2B0LA 4BNCA 2RQPA 5D5WB 1BM9A 4NQWA 2R7DA 4E70A 1V3FA 1UFMA 4ZH4F 4RB1A 4L9JA 4L0ZB 1L0OC 1O3QA 3F72A 5FO5A 2EFQA 5D6EA 3LQRA 4G6QA 2DFIA 3LFKA 3BY6A 4LLGF 1FPQA 2IPQX 2A68F 2AS5F 4ESBA 2JPCA 3J7AO 2F5DA 3H3UA 3ZMUA 4MTDA 4MQVA 2L01A 3IKTA 4KA4A 2YPRA 3OV8A 1FSEA 1IUYA 1QBJA 1YS6A 1J0RA 5CJ9A 5CVRA 3LAJA 2STTA 3TO7A 3E5QA 3F8MA 1XN7A 2MA3A 4GO1A 3BWGA 4DQ2A 5HS8A 3GO5A 2MLGA 5E8GA 4WF2A 1U78A 4IVNA 1FBUA 5A2QK 4LD5A 1WI9A 4Y17A 1IW7F 1B4AA 2QWWA 2IT0A 3TOBA 2LSOA 2GQQA 1R1UA 3U9GA 2Q8KA 2CQKA 3GVAA 4I09A 3DPLC 1XMAA 5LHHA 5F1RA 2M87A 3K2ZA 2PI0A 2ESNA 4AIHA 4UVBA 1P92A 4AWXB 2X0LA 4LGWA 3RJPA 2IJLA 2MC3A 1UCRA 1IXCA 4L18B 1ZLKA 5E1XA 4YFNF 3CTAA 1ZH5A 4CDGA 1MDMB 2NNNA 3QU6A 2RN7A 2VE8A 2P5VA 1W7PD 1GHCA 2P6TA 2A61A 2PQ8A 5HLGA 5IT9K 2CO5A 4OIPF 1KYWA 4M6XA 3C1DA 2A6EF 1YIOA 3HHHA 3GZ5A 4AIKA 1RIOH 3RYPA 2M45A 2HFHA 3ZN0A 2ZFWA 4H0EA 3FMQA 4ASNA 4I0BA 3FZVA 3LA2A 2HKOA 2VT3A 5F64A 2EFOA 3U1DA 1FT9A 2F2EA 3TO9A 4JQFA 1BIBA 1FYLA 5H20A 4HX8A 1SFEA 3HYIA 1P4WA 1ULYA 2XV4S 3WU0A 3TO6A 2XAGA 4FX0A 3FM3A 3FXQA 1IXSB 4P5OA 2XROA 4U7DA 3RYRA 2P6SA 2KIUA 1ZG3A 1R1VA 2LF8A 2ZKZA 2QQ9A 2IA2A 2VBWA 1UB9A 2NNYA 4A0ZA 2D2WA 2DK5A 1XSDA 2DTRA 3WTVC 3CJNA 3RTRA 3HRSA 3I58A 4TV7A 5DD4A 1BN5A 2DQRA 3ECOA 1MDMA 1IZ1A 2VT2A 4XBFA 2CGPA 3ROUA 2FBHA 3GLXA 3KLNA 2XAQA 1ODDA 1JE8A 1HXDA 4BQAA 1U5TC 3COAC 2P7CB 4L5JA 2JT1A 3JAMZ 4O5VA 3L09A 1BOAA 2PMHA 2EA2A 1G3YA 5HS9A 3DEUA 3OOPA 4WXDA 1R00A 1XMKA 1IAWA 3V7CA 4M73A 4MGRA 3RPQA 5ICFA 4A0XA 2H27A 1FP1D 1HKQA 1ZLJA 4CYDA 4UVAA 4HF2A 5E17F 2HYGD 3HSRA 3D5LA 3T0YA 1WSUA 1ZGJA 2UWMA 1A04A 3SZPA 4HX7A 2KJCA 1HBXG 2RNJA 2FMLA 2ELHA 4M6YA 2MH2A 3FMRA 5ILUA 4UV8A 2BBYA 1FY7A 2LKPA 3V8LA 4P9UA 2DBBA 3F8NA 3JSOA 4KMFA 1FSHA 4KUMA 3MEXA 1XCBA 1FBQA 3V8KA 1HW2A 3E6BA 2FE3A 2EFNA 3F8BA 2K7LA 2DQLA 4RB2C 1YO5C 3IWFA 1XD7A 1E17A 3KZZA 1G3SA 1JHHA 2UXNA 1ZYRF 1W4MA 2VODA 2DT5A 5FLXZ 5ERIA 1YW7A 1NHAA 2A5YB 3H3ZA 5E18F 2YU3A 2FQ3A 2PG4A 2PN6A 3L00A 4L0YB 4MHGA 4I98B 3C18A 2V1UA 3F6OA 2M5WA 3BROA 3J80K 1I1GA 2QENA 3F23A 2M1BA 4M9XA 3O2PE 3R4KA 1RI7A 1LDJA 4HLXA 2WWYA 2HS5A 3KLOA 4HLYA 2OD5A 4UV9A 1JXSA 1QO0D 2VOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LA7 A;  1TTY A;  1TNT A;  2HYF A;  1QNT A;  1BI1 A;  3HTU A;  3F6V A;  3SFZ A;  1L3L A;  2DPD A;  1BI3 A;  1WWX A;  2XUB A;  4UVC A;  3R6S A;  1SFU A;  5LGN A;  2EV6 A;  4GGG A;  1ZG5 A;  4PCQ A;  4HF1 A;  3MZY A;  2W24 A;  4I02 A;  1GVJ A;  3WGH A;  2LNB A;  4I7H A;  1R1T A;  3M8F A;  4KNY A;  1J2X A;  1FBS A;  3I64 A;  5ICG A;  4IRI A;  2TDX A;  4U88 A;  2NS0 A;  2Z5U A;  5LEJ A;  1KYZ A;  2M8E A;  2VC0 A;  3AAF A;  2GXG A;  1S7O A;  2E7X A;  3WTS C;  2RVC A;  1IRG A;  1Y0U A;  2JRT A;  4MTE A;  4CO8 A;  4HF0 A;  2HQR A;  4LLN A;  4WK8 F;  2FU4 A;  3Q9S A;  1P4X A;  5L3F A;  5FFX A;  3D0S A;  2OU2 A;  4ZYE A;  2NRA C;  5H6R A;  2FXA A;  5J8C A;  2CSO A;  4HAM A;  2RDP A;  1PP8 F;  1ZN2 A;  3U2R A;  3HUG A;  1Q1H A;  1J9I A;  2XAJ A;  3CUQ C;  2W57 A;  3BPX A;  3IKV A;  4LMY A;  4OIO F;  3RKX A;  1MJA A;  4CXF A;  1LQ1 A;  3O3K A;  4OMZ A;  1BBY A;  2YSR A;  1X3U A;  5L3B A;  5AIQ A;  4MEY F;  2ZXJ A;  2VBZ A;  2CFX A;  3F8C A;  5CVU A;  1SMY F;  5CYV A;  2G7U A;  3ZMD A;  3QPT A;  1ZRC A;  2Y48 A;  2EB7 A;  1D5V A;  4EVI A;  4HX4 A;  3V4G A;  3CUQ B;  3FXU A;  3WTX C;  5CVI A;  2FOK A;  1XGN A;  3C7J A;  4IHT A;  3EDP A;  2DAO A;  1ZAR A;  3ULQ B;  1ON1 A;  4ENK A;  2P5L C;  4YIF A;  1E2X A;  2L54 A;  1O7L A;  3MWM A;  3K1M A;  3ZP5 A;  3HHG A;  4FHT A;  1KU9 A;  4RS8 A;  4ESF A;  1RUO A;  4IHS A;  1ZRE A;  3C3W A;  5DDG A;  2OBP A;  1Z9C A;  3GFI A;  2QBY B;  4G6D A;  5D5U B;  4BHP A;  3E6M A;  2QM3 A;  1IN4 A;  2LDU A;  3N97 A;  4N0B A;  4A6D A;  1BI2 A;  5FFZ A;  4D0P A;  1V4R A;  1U3E M;  1GXQ A;  5E1W A;  1TW3 A;  2E1N A;  3CO7 C;  3E5X A;  3DFG A;  4EQQ A;  2VC1 A;  4RB0 A;  2Q0O A;  3F8F A;  1T0F A;  4P55 A;  1ZRF A;  3SHF A;  1J7K A;  3I71 A;  2KIM A;  2CWE A;  4OU0 A;  5DCF A;  1R5G A;  4QLC U;  2DO7 A;  3LAP A;  2YR2 A;  2CYY A;  5E8I A;  2JSC A;  4KYW A;  4WXH A;  4XSX F;  2Z3Y A;  1T38 A;  1LEA A;  4A5N A;  1S6L A;  3J81 Z;  1HW1 A;  1EH6 A;  1YW8 A;  2V1X A;  3VB2 A;  5HDG A;  2ISZ A;  3REO A;  4G9Y A;  2WC2 A;  4ESJ A;  1HST A;  2KJB A;  3L7W A;  1TQI A;  3EYY A;  4FT8 A;  4U7B A;  1HKS A;  2OZ6 A;  4A0Y A;  5TJJ A;  4A2U A;  1AOY A;  1D3Y A;  2HTS A;  3CUQ A;  3WGG A;  4OOI A;  1FLI A;  3PFI A;  4B8X A;  2VXZ A;  3M8E A;  2JZY A;  5DD8 A;  3Q9V A;  1DP7 P;  5HLI A;  1EH8 A;  1G3T A;  4KIB A;  1FP2 A;  3E3V A;  1IN8 A;  3BJO A;  4M9Z A;  4Y13 A;  2F5F A;  4YFX F;  2RKH A;  4KT5 C;  3NRV A;  4IPA A;  2QBY A;  1PDN C;  3DV8 A;  1H9G A;  3I0T A;  2VON A;  2GA2 A;  2V1D A;  1IXR C;  4EGY A;  3BJ6 A;  5ED4 A;  1FWZ A;  2Z33 A;  2GXB A;  1HQC A;  1KQ0 A;  5LEK A;  1XDS A;  4HV6 A;  3BZ6 A;  4CZZ A;  1T39 A;  4EJV A;  2OZU A;  2HWV A;  3ABT A;  4HDV A;  1EV7 A;  3K1N A;  3MAJ A;  4HDU A;  1QZZ A;  1IRF A;  1Z7U A;  4KMU X;  5A2Q Z;  3TOA A;  3S2W A;  4RB3 C;  1R7J A;  4S05 A;  2XAS A;  1VTN C;  3QAH A;  2VN2 A;  4N9H A;  3O6B B;  1K7A A;  3HRT A;  2RGV A;  4M74 A;  5BPI A;  1Z1D A;  3KP3 A;  2D45 A;  4MEX F;  3BJA A;  1S8N A;  1CGP A;  4M72 A;  4ZZL A;  2QUF A;  1RZ4 A;  3ZMS A;  1LJ9 A;  4XLP F;  3F22 A;  2R3S A;  2FBI A;  1SFX A;  2ACJ A;  3WOD F;  1STZ A;  3MCZ A;  1Z6T A;  3WTT C;  1MJB A;  3P7N A;  1T6S A;  1GXP A;  2KRF A;  1BIA A;  4KN7 X;  1WQ2 A;  1U5T B;  1OMI A;  1R58 A;  5BMZ A;  1P4A A;  4BHC A;  3ZMT A;  3KCC A;  5K5R A;  4JBA A;  1REP C;  3R61 A;  2CG4 A;  2ETH A;  1ZGA A;  3KP7 A;  2XKO A;  2MBF A;  4WX9 A;  1G6N A;  1K79 A;  5IT9 Z;  3GFJ A;  3K1P A;  3KP5 A;  2K27 A;  3CO6 C;  5D8L B;  2MH9 A;  3TDZ C;  3JTG A;  1ZG1 A;  1HW5 A;  1KA8 A;  1R5H A;  1KU3 A;  3ML6 A;  4U0Y A;  1PUE E;  3CLO A;  2EA4 A;  4A5M A;  3WE2 A;  4LK1 F;  3ISP A;  2O61 A;  1H9T A;  5DYM A;  3RDI A;  3ZQ7 A;  1UHW A;  2GAU A;  1XGM A;  5JI6 A;  4ENM A;  4MQ9 F;  1B1B A;  1QQI A;  3WU1 B;  3R0J A;  3GWZ A;  1YYV A;  2GZW A;  2IA0 A;  3GFL A;  4ZYD A;  3W6J B;  2BEO A;  1P6R A;  1XB4 A;  4LK0 F;  3E5U A;  1R23 A;  1U2W A;  5LBQ A;  1B9N A;  2IVM A;  4EM2 A;  3GXO A;  3K69 A;  1SMT A;  2BV6 A;  2G9W A;  3I53 A;  3R60 A;  3JW4 A;  2OQR A;  4G8X A;  2PJP A;  2YX4 A;  1QZY A;  3I5U A;  5LGU A;  2L4A A;  4G7Z F;  4U0V A;  2PEX A;  5D8K B;  1KQ9 A;  2Q2E A;  2O3F A;  1F5T A;  1J5Y A;  2WTE A;  4O3M A;  2DLL A;  1MKM A;  4XSZ F;  1U5T A;  4HOB A;  4UXN A;  4ETS A;  5FGM A;  2CW0 F;  1SD5 A;  2XAF A;  4HA8 A;  2UXX A;  3RKW A;  1P2F A;  4XRF A;  2P7V B;  3WTY C;  4PZJ A;  3ZPL A;  3SZT A;  3M7G A;  1BJA A;  4YFK F;  1F1Z A;  3KEO A;  5BS6 A;  4HBL A;  1SD7 A;  2A69 F;  3BDD A;  1IF1 A;  1O7F A;  3TDU C;  1MJ9 A;  2H94 A;  3IL2 A;  4XLN F;  5D6F A;  2GIV A;  1B59 A;  5D4S A;  2FMY A;  2XRN A;  3M1E A;  3KP6 A;  3RIR A;  3W6K B;  1K6O A;  3KFW X;  1LDD A;  4N9I A;  1TQM A;  4YII A;  1S7A A;  2D1V A;  1D8J A;  2KIF A;  2ZBK A;  4WWC A;  5IT3 A;  1QGP A;  2DU9 A;  1XSX A;  3DPT A;  1ONV A;  5HVQ C;  4NHJ A;  4UHT A;  4FX4 A;  4RGX A;  3TKY A;  3K0L A;  1IN7 A;  2H6C A;  2O8X A;  2W84 A;  4ENN A;  4PGH A;  1J75 A;  3GW2 A;  1QPM A;  3QP5 A;  3DP7 A;  2MD5 A;  2BGC A;  1R22 A;  2K86 A;  3RKY A;  5DEQ A;  2H09 A;  2D1H A;  4UNO A;  4I0A A;  3SQN A;  5E20 A;  4ENJ A;  1FNN A;  4EM1 A;  4EGZ A;  2JTV A;  2E7W A;  3T8T A;  2HGC A;  2EWN A;  1B9M A;  2XVC A;  3BOQ A;  2DPU A;  4BAY A;  1IN6 A;  3ZMZ A;  1DUX C;  3EET A;  3T8R A;  4KIC A;  4YG2 F;  4OIR F;  3IWZ A;  3RI4 A;  3KEQ A;  1AWC A;  5BQT A;  4HQE A;  1YW9 A;  3DKW A;  3BPV A;  4IJA A;  2A6H F;  3HSF A;  3NEU A;  2K02 A;  1YG2 A;  1I27 A;  4BHB A;  1R36 A;  3J80 Z;  1OYW A;  2E1C A;  5LRR A;  2F5E A;  5HOO A;  5AIP A;  4EV0 A;  4Y15 A;  4EJO A;  3E97 A;  2QQA A;  2O03 A;  4KFC A;  4I2O A;  2PLY A;  3CUO A;  1KGS A;  2AXL A;  1DPU A;  2W85 A;  4IF4 A;  3FHZ A;  3SXY A;  4Z2Y A;  1F4K A;  2Z99 A;  2ZO4 A;  2HTJ A;  3WE3 A;  2FF4 A;  2UZK A;  3QRF F;  4L9V A;  4PDK A;  5J8F A;  1UST A;  1UHM A;  2COM A;  3IRQ A;  2ZNZ A;  4G94 A;  2Y75 A;  1XDU A;  2XHK A;  1RNL A;  4LFU A;  5AON A;  1EH7 A;  3GX4 X;  2V9V A;  4B09 A;  5CVJ A;  1USS A;  2XGX A;  3GUD A;  2EV5 A;  3QP6 A;  2PMU A;  5L3G A;  1O3T A;  1XGS A;  3JAM K;  2LF7 A;  5KVR A;  4IRH A;  3VEP A;  1SAX A;  2HKX A;  2QVO A;  3T1B A;  2OA4 A;  2EV0 A;  4OIQ F;  3P9K A;  2O6G E;  3VFZ A;  1TQP A;  3FF5 A;  1I6X A;  3G73 A;  2KKO A;  2VOO A;  2STW A;  4L9T A;  3FX3 A;  2XIG A;  3ABU A;  2EFW A;  6PAX A;  5K1Y A;  1F9N A;  3QU3 A;  1FYK A;  4RAZ A;  3KP4 A;  2YX7 A;  3WTW C;  1O3R A;  1CF7 B;  2HQN A;  4HW0 A;  3NQO A;  2ZJ2 A;  1TNS A;  2HDC A;  4ON0 A;  4PGG A;  3HSE A;  3QPH A;  5ICE A;  4LB5 A;  4LJZ F;  2PBI A;  1KU7 A;  5DCM B;  5DUK A;  3KZY A;  3P9I A;  2H6B A;  4Q5S F;  2QYO A;  3EUH A;  3PQJ A;  3RPU A;  4DNC A;  5LHG A;  2GA1 A;  5DV5 A;  1RUN A;  2BYV E;  3P9C A;  4G7H F;  2QZ8 A;  2IW5 A;  3H92 A;  4OIN F;  5H6Q A;  1IN5 A;  4WCG A;  1WRJ A;  1TBX A;  4S04 A;  1G3W A;  4AIJ A;  3N4M A;  2ZCW A;  1W7P B;  1XGO A;  5FLX K;  3VOE A;  5J6X A;  3FMS A;  2Y0M A;  5FD5 A;  3IRR A;  4A6E A;  4JK1 X;  4GYG A;  1ON2 A;  3ERE D;  5L3D A;  3WG9 A;  2OQG A;  3DF8 A;  1YLF A;  2HOE A;  2XAH A;  3GFM A;  3HRU A;  5JHU A;  3ELK A;  4R1H A;  1LEB A;  4IRG A;  3IHU A;  5FD6 A;  2IP2 A;  4I01 A;  3V8J A;  3LQQ A;  5LLQ A;  1FX7 A;  1FYM A;  2MLK A;  2L3D A;  2ESH A;  4AD9 A;  4CGZ A;  4O6J A;  4UUV A;  4GCV A;  4ZYG A;  5ILS A;  3E6C C;  4GXO A;  4M9S A;  4A12 A;  1U8R A;  2ZNY A;  3Q5F A;  1O57 A;  1LVA A;  4BXU A;  3WTZ A;  2HR3 A;  1YTY A;  1LB2 A;  1CF7 A;  4LG0 B;  1J59 A;  2K4J A;  5ILV A;  3EQL F;  1Z05 A;  1WKM A;  4HQM A;  1BC7 C;  5EEH A;  1T2K A;  2L4M A;  1FZP B;  4OMY A;  3L2C A;  4G7O F;  3L9F A;  1HSJ A;  5E1Z B;  2EK5 A;  2FSW A;  1LNW A;  1PP7 U;  3VOD A;  4WXC A;  3HIF A;  5DCM A;  3R0A A;  5EEG A;  3M9A A;  2GWR A;  4KIG A;  4CHU A;  1XCV A;  1TLH B;  2V6C A;  1B6A A;  5K5O A;  5JFR A;  3HTS B;  3PQK A;  4M71 A;  3ZMV A;  1BC8 C;  1U6G A;  1ZRD A;  4R79 A;  1W7P A;  1FOK A;  3DQV C;  1SD4 A;  5CLS A;  3K9T A;  4RGU A;  1YQA A;  4KIF A;  4RGR A;  5D4R A;  1H0M A;  1YFH A;  3V7S A;  2W25 A;  4EM0 B;  4HV5 A;  2HZT A;  3V7R A;  4EJT A;  1W5S A;  2FEZ A;  1XSV A;  5TRD A;  1YS7 A;  2PFB A;  2IRF G;  3JSP A;  2A3S A;  2L02 A;  4P96 A;  1S29 A;  2Z9O A;  2G7H A;  4AVP A;  3JTH A;  2NAZ A;  1MGT A;  4IXA A;  1MZB A;  5HDK A;  1ZHF A;  5JVT A;  2FA5 A;  5CVV A;  2RC4 A;  3WTU C;  1SD6 A;  3I54 A;  3IC7 A;  4LB6 B;  2OAZ A;  1BI0 A;  3G3Z A;  5KK1 A;  3F21 A;  3E6D A;  4ZYH A;  3T5X A;  3KET A;  5L3E A;  1TW2 A;  4QWQ A;  1DPR A;  4L9N A;  5D5V B;  3WGI A;  4ZZD A;  3QOP A;  3TQN A;  5LRS A;  3HOS A;  4GYI A;  1I5Z A;  2P8T A;  1K78 B;  2J5P A;  4LG0 A;  5BOX A;  5F6F A;  3KP2 A;  4Q4Z F;  3MZH A;  5BPD A;  3GYH X;  4U0W A;  2VBX A;  1LDK B;  5DUI A;  3LWF A;  3CDH A;  3GEZ A;  2DK8 A;  2F5C A;  4MNU A;  1OYI A;  2ADU A;  2ZME B;  4K2E A;  2X4H A;  3I59 B;  4HZF A;  2HEO A;  5FB2 A;  1Z91 A;  2K4B A;  4R8H A;  4RAY A;  1D8K A;  2EJR A;  3GF2 A;  2QLZ A;  2QQB A;  1OYY A;  2O0Y A;  1W5T A;  1G4D A;  3MFK A;  2VBY A;  3ECH A;  2A07 F;  1OR7 A;  4RGS A;  5LHI A;  2BE5 F;  2RV8 A;  4Q48 A;  1O3S A;  2XKP A;  2FRH A;  4LLL A;  5L3C A;  2FBK A;  1I1S A;  3B73 A;  2NYX A;  1HKT A;  5K5Q A;  1Z6R A;  2EFP A;  3FM5 A;  3DXJ F;  3FWE A;  4EMS A;  4EJU A;  4CIC A;  3KE2 A;  4P9F A;  5D5X B;  2ISY A;  5HLH A;  4BH9 A;  3GZ6 A;  1C0W A;  3F3X A;  4BYY A;  3FXR A;  2FNA A;  1OKR A;  3HOT A;  1ZAO A;  2C6Y A;  1KU2 A;  2DW4 A;  2FNP A;  4KN4 X;  2P4W A;  5LGT A;  1OPC A;  3LA3 A;  1KQ8 A;  4NB5 A;  3BP8 A;  5ICC A;  1JHF A;  1S3J A;  2WV0 A;  2P5K A;  2JPB A;  5HS7 A;  3J81 K;  3EYI A;  1K78 A;  1JGS A;  4L5I A;  3LST A;  5JR3 A;  1DDN A;  3HRM A;  3ZN1 A;  2M30 A;  4Q47 A;  1T98 A;  2R7F A;  4KDP A;  4EJW A;  2ZME A;  3MQ0 A;  3I4P A;  2J5O A;  3I59 A;  4F7Z A;  3B02 A;  1FC3 A;  2VE9 A;  3TGN A;  2V79 A;  2IA1 A;  5HDN A;  4HYE A;  2DI3 A;  1MD0 A;  2B0L A;  4BNC A;  2RQP A;  5D5W B;  1BM9 A;  4NQW A;  2R7D A;  4E70 A;  1V3F A;  1UFM A;  4ZH4 F;  4RB1 A;  4L9J A;  4L0Z B;  1L0O C;  1O3Q A;  3F72 A;  5FO5 A;  2EFQ A;  5D6E A;  3LQR A;  4G6Q A;  2DFI A;  3LFK A;  3BY6 A;  4LLG F;  1FPQ A;  2IPQ X;  2A68 F;  2AS5 F;  4ESB A;  2JPC A;  3J7A O;  2F5D A;  3H3U A;  3ZMU A;  4MTD A;  4MQV A;  2L01 A;  3IKT A;  4KA4 A;  2YPR A;  3OV8 A;  1FSE A;  1IUY A;  1QBJ A;  1YS6 A;  1J0R A;  5CJ9 A;  5CVR A;  3LAJ A;  2STT A;  3TO7 A;  3E5Q A;  3F8M A;  1XN7 A;  2MA3 A;  4GO1 A;  3BWG A;  4DQ2 A;  5HS8 A;  3GO5 A;  2MLG A;  5E8G A;  4WF2 A;  1U78 A;  4IVN A;  1FBU A;  5A2Q K;  4LD5 A;  1WI9 A;  4Y17 A;  1IW7 F;  1B4A A;  2QWW A;  2IT0 A;  3TOB A;  2LSO A;  2GQQ A;  1R1U A;  3U9G A;  2Q8K A;  2CQK A;  3GVA A;  4I09 A;  3DPL C;  1XMA A;  5LHH A;  5F1R A;  2M87 A;  3K2Z A;  2PI0 A;  2ESN A;  4AIH A;  4UVB A;  1P92 A;  4AWX B;  2X0L A;  4LGW A;  3RJP A;  2IJL A;  2MC3 A;  1UCR A;  1IXC A;  4L18 B;  1ZLK A;  5E1X A;  4YFN F;  3CTA A;  1ZH5 A;  4CDG A;  1MDM B;  2NNN A;  3QU6 A;  2RN7 A;  2VE8 A;  2P5V A;  1W7P D;  1GHC A;  2P6T A;  2A61 A;  2PQ8 A;  5HLG A;  5IT9 K;  2CO5 A;  4OIP F;  1KYW A;  4M6X A;  3C1D A;  2A6E F;  1YIO A;  3HHH A;  3GZ5 A;  4AIK A;  1RIO H;  3RYP A;  2M45 A;  2HFH A;  3ZN0 A;  2ZFW A;  4H0E A;  3FMQ A;  4ASN A;  4I0B A;  3FZV A;  3LA2 A;  2HKO A;  2VT3 A;  5F64 A;  2EFO A;  3U1D A;  1FT9 A;  2F2E A;  3TO9 A;  4JQF A;  1BIB A;  1FYL A;  5H20 A;  4HX8 A;  1SFE A;  3HYI A;  1P4W A;  1ULY A;  2XV4 S;  3WU0 A;  3TO6 A;  2XAG A;  4FX0 A;  3FM3 A;  3FXQ A;  1IXS B;  4P5O A;  2XRO A;  4U7D A;  3RYR A;  2P6S A;  2KIU A;  1ZG3 A;  1R1V A;  2LF8 A;  2ZKZ A;  2QQ9 A;  2IA2 A;  2VBW A;  1UB9 A;  2NNY A;  4A0Z A;  2D2W A;  2DK5 A;  1XSD A;  2DTR A;  3WTV C;  3CJN A;  3RTR A;  3HRS A;  3I58 A;  4TV7 A;  5DD4 A;  1BN5 A;  2DQR A;  3ECO A;  1MDM A;  1IZ1 A;  2VT2 A;  4XBF A;  2CGP A;  3ROU A;  2FBH A;  3GLX A;  3KLN A;  2XAQ A;  1ODD A;  1JE8 A;  1HXD A;  4BQA A;  1U5T C;  3COA C;  2P7C B;  4L5J A;  2JT1 A;  3JAM Z;  4O5V A;  3L09 A;  1BOA A;  2PMH A;  2EA2 A;  1G3Y A;  5HS9 A;  3DEU A;  3OOP A;  4WXD A;  1R00 A;  1XMK A;  1IAW A;  3V7C A;  4M73 A;  4MGR A;  3RPQ A;  5ICF A;  4A0X A;  2H27 A;  1FP1 D;  1HKQ A;  1ZLJ A;  4CYD A;  4UVA A;  4HF2 A;  5E17 F;  2HYG D;  3HSR A;  3D5L A;  3T0Y A;  1WSU A;  1ZGJ A;  2UWM A;  1A04 A;  3SZP A;  4HX7 A;  2KJC A;  1HBX G;  2RNJ A;  2FML A;  2ELH A;  4M6Y A;  2MH2 A;  3FMR A;  5ILU A;  4UV8 A;  2BBY A;  1FY7 A;  2LKP A;  3V8L A;  4P9U A;  2DBB A;  3F8N A;  3JSO A;  4KMF A;  1FSH A;  4KUM A;  3MEX A;  1XCB A;  1FBQ A;  3V8K A;  1HW2 A;  3E6B A;  2FE3 A;  2EFN A;  3F8B A;  2K7L A;  2DQL A;  4RB2 C;  1YO5 C;  3IWF A;  1XD7 A;  1E17 A;  3KZZ A;  1G3S A;  1JHH A;  2UXN A;  1ZYR F;  1W4M A;  2VOD A;  2DT5 A;  5FLX Z;  5ERI A;  1YW7 A;  1NHA A;  2A5Y B;  3H3Z A;  5E18 F;  2YU3 A;  2FQ3 A;  2PG4 A;  2PN6 A;  3L00 A;  4L0Y B;  4MHG A;  4I98 B;  3C18 A;  2V1U A;  3F6O A;  2M5W A;  3BRO A;  3J80 K;  1I1G A;  2QEN A;  3F23 A;  2M1B A;  4M9X A;  3O2P E;  3R4K A;  1RI7 A;  1LDJ A;  4HLX A;  2WWY A;  2HS5 A;  3KLO A;  4HLY A;  2OD5 A;  4UV9 A;  1JXS A;  1QO0 D;  2VOP A; 
#chains in the Genus database with same CATH topology
 3LA7 A;  3OYF A;  1TTY A;  1TNT A;  4A3C J;  2HYF A;  3S32 A;  3PIP F;  2JQ7 A;  1QNT A;  1BI1 A;  3QOE A;  1VQM I;  2MAB A;  3HTU A;  1ZEL A;  4CSW A;  3F6V A;  3SFZ A;  1L3L A;  1ZR4 A;  4J01 A;  3W6V A;  3HZJ A;  2NVY J;  2DPD A;  1BI3 A;  1WWX A;  4CCM A;  2LKS A;  2XUB A;  4UVC A;  1FIA A;  4Y7N J;  3R6S A;  1SFU A;  3JRB A;  5LGN A;  2EV6 A;  4GGG A;  1ZG5 A;  3PUB A;  4PCQ A;  4C3H J;  1B8I B;  4HF1 A;  3MZY A;  3OSG A;  4MFD A;  3GLL A;  1VQN I;  2OCE A;  1WJA A;  4UB8 C;  2W24 A;  1TWC J;  3HOW J;  3BQZ A;  4I02 A;  1FMV A;  2JVH A;  2Y9Y A;  1YI2 I;  1NG7 A;  1GVJ A;  3KYL A;  3WGH A;  2KMU A;  2LNB A;  3GZN B;  1TL8 A;  1ETX A;  2WAF A;  4II3 A;  4I7H A;  1IV8 A;  1R1T A;  3M8F A;  2R5Y B;  1J2X A;  4KNY A;  2FD5 A;  1FBS A;  3I64 A;  5M3F J;  2PMZ A;  5ICG A;  2KRC A;  4IRI A;  2TDX A;  4U88 A;  2NS0 A;  2Z5U A;  5LEJ A;  1KYZ A;  2M8E A;  2YU9 J;  1JT6 A;  2VC0 A;  4Y4R A;  2XGD A;  3AAF A;  2GXG A;  1T0F C;  1S7O A;  1TWG J;  1FIP A;  2E7X A;  2M7A A;  1GUU A;  3WTS C;  2RVC A;  1IRG A;  4V2G A;  1Y0U A;  2JRT A;  2XGE A;  2Y69 H;  4MTE A;  4CO8 A;  3OYG A;  4KT6 A;  4HF0 A;  1BR1 A;  2ECC A;  2HQR A;  2O5R A;  4LLN A;  1POG A;  4WK8 F;  1W36 D;  2FU4 A;  4LIU A;  1DGR M;  3Q9S A;  1P4X A;  5L3F A;  5FFX A;  2E34 A;  2VQG A;  2E60 A;  2Z1D A;  3D0S A;  2P81 A;  2OU2 A;  3VYU B;  4ZYE A;  5C4X J;  2NRA C;  3MKY B;  5H6R A;  2FXA A;  5J8C A;  2CSO A;  2JWT A;  2MG4 A;  4HAM A;  5IOY A;  1HA8 A;  4G6T B;  3HGG A;  3HC7 A;  1U8B A;  4ZDO A;  2RDP A;  1PP8 F;  1ZN2 A;  2QSG X;  4V19 K;  3U2R A;  2HQ5 A;  4HST A;  2XB5 A;  1S5L C;  3HUG A;  4C2U A;  1Q1H A;  1J9I A;  2CUF A;  2XAJ A;  3S3N A;  1JJ6 C;  3CUQ C;  2JK3 A;  2W57 A;  3A4C A;  2WAD A;  3BPX A;  3IKV A;  4LMY A;  5J40 A;  4OIO F;  3RKX A;  1BW6 A;  1MJA A;  4CXF A;  1LQ1 A;  2K9M A;  3V42 A;  3BR3 A;  3JRG A;  1VQP I;  2Y0S A;  1SVO A;  3ESW B;  2XF6 A;  3O3K A;  2F4M B;  1Y39 A;  4OMZ A;  4C3I J;  2IS4 A;  1BBY A;  2YSR A;  4I99 C;  4BEH B;  1X3U A;  5L3B A;  1WCM J;  5AIQ A;  1AKH B;  1X1A A;  4MEY F;  3CCJ I;  4XKW A;  1TT0 A;  2ZXJ A;  1OCP A;  2OC6 A;  2VBZ A;  4NC7 A;  2CFX A;  3F8C A;  2IGK A;  5CVU A;  1SMY F;  5CYV A;  2G7U A;  3ZMD A;  1LFP A;  3QPT A;  1B8I A;  1ZRC A;  4LOC A;  2Y48 A;  3BR6 A;  2EB7 A;  1LUJ B;  1IJW C;  2L7M P;  4EVI A;  1D5V A;  3A2K A;  4HX4 A;  3V4G A;  1A6I A;  3CUQ B;  3FXU A;  3WTX C;  1BJZ A;  1R49 A;  2HDW A;  3G71 I;  5CVI A;  5EF6 A;  2FOK A;  5EDN A;  2W00 A;  1I3A A;  1XGN A;  3C7J A;  4IHT A;  3EDP A;  3S2D J;  2DAO A;  2CQN A;  1ZAR A;  2WV1 A;  3LSJ A;  3ULQ B;  2R5Y A;  1ON1 A;  4ENK A;  5IP9 J;  3OYB A;  2P5L C;  1UG0 A;  4YIF A;  4BE1 A;  2R7W A;  1E2X A;  2L54 A;  3QPS A;  1O7L A;  1T8I A;  3MWM A;  3D5R C;  3K1M A;  3ZP5 A;  3NAR A;  3HHG A;  3O8H A;  3OR1 C;  4DGW B;  4FHT A;  2WAQ N;  1KU9 A;  3DLL F;  4RS8 A;  1YE9 A;  4ESF A;  1QZE A;  3ZQC A;  1RUO A;  5GTH C;  2JN6 A;  4IHS A;  1ZRE A;  4CCN A;  1XTA A;  3C3W A;  5DDG A;  3CCQ I;  2VPL A;  4E7H A;  4RLQ A;  2OBP A;  4RBO A;  1Z9C A;  1LPQ A;  3GFI A;  4F3Q A;  2DA5 A;  2QBY B;  4G6D A;  4JX4 A;  4IOA F;  1ZR2 A;  5K7H A;  5D5U B;  4B43 A;  2FOW A;  4BHP A;  3E6M A;  2QM3 A;  4BU2 A;  1IN4 A;  4GDF A;  1WVR A;  2LDU A;  1UG2 A;  2BVL A;  3N97 A;  1AHD P;  1IC8 A;  4N0B A;  1MMD A;  4A6D A;  1BI2 A;  5FFZ A;  2CUE A;  4D0P A;  1V4R A;  3H0G J;  1U3E M;  1GXQ A;  5E1W A;  1TW3 A;  4FIS A;  2E1N A;  3CO7 C;  3E5X A;  4JP0 A;  1PYV A;  3GTQ J;  3DFG A;  4EQQ A;  2A5W A;  2VC1 A;  2GOM A;  4RB0 A;  2Q0O A;  3Q3S A;  2Z16 A;  3F8F A;  4RLF A;  1T0F A;  2LR8 A;  2VKV A;  4P55 A;  1ZRF A;  3WHC A;  3SHF A;  3I9V 2;  5H2F C;  1J7K A;  1V54 H;  2KIM A;  2CWE A;  3I71 A;  4OU0 A;  5DCF A;  1VQ8 I;  3CLQ A;  4BUP A;  2O9L A;  1R5G A;  4QLC U;  4JYK A;  1EJ9 A;  2PX9 A;  5DM7 F;  2DO7 A;  3LAP A;  3HJE A;  2YR2 A;  4IOC F;  2CYY A;  1SVM A;  5CKT A;  1X4O A;  4DYR A;  2AO9 A;  5E8I A;  4XRS G;  5B5E C;  2EZH A;  2JSC A;  5DS9 A;  3ASO H;  4KYW A;  4WXH A;  4XSX F;  4N4O B;  2Z3Y A;  5K7F A;  1T38 A;  1TWH J;  1LEA A;  4A5N A;  2DN0 A;  4FET A;  3ZR8 X;  1S6L A;  3J81 Z;  1HW1 A;  4BEH A;  1EH6 A;  1AKH A;  1YW8 A;  3D5S C;  2V1X A;  3VB2 A;  5F27 A;  5HDG A;  3ZQF A;  2ISZ A;  1G2H A;  3REO A;  4IKF A;  4G9Y A;  2WC2 A;  3Q0U A;  4ESJ A;  4BQO A;  1HST A;  2GIZ A;  4D9J A;  4XL9 A;  2KJB A;  3L7W A;  1TQI A;  3EYY A;  4FT8 A;  2X6Y A;  4U7B A;  1Y56 A;  1HKS A;  2OZ6 A;  4A0Y A;  5TJJ A;  3H5A A;  4A2U A;  1AOY A;  1D3Y A;  2M9H A;  1MNM C;  1PJR A;  2HTS A;  3CUQ A;  1TZL A;  4OOI A;  3WGG A;  1FLI A;  2V9P A;  2MC4 A;  2FX0 A;  2BOL A;  3PFI A;  5JLX A;  1ZQ3 P;  4B8X A;  2GBY A;  2VXZ A;  3WU2 C;  1WFX A;  3M8E A;  3BCA A;  1JUM A;  2JZY A;  2X48 A;  2ZXI A;  1X1B A;  5DD8 A;  3Q9V A;  3J7Z I;  1DP7 P;  2B63 J;  1A6Q A;  4AID A;  2RNG A;  3RCO A;  5HLI A;  2EZK A;  1EH8 A;  3A02 A;  1VQ9 I;  3HOZ J;  2L0K A;  2NS8 A;  1G3T A;  4KIB A;  2H1K A;  1FP2 A;  4HRI A;  3E3V A;  1IN8 A;  3BJO A;  4M9Z A;  4Y13 A;  4GFB A;  2F5F A;  2ME6 A;  2BHZ A;  4YFX F;  4IHX A;  2RKH A;  2PMZ N;  4KT5 C;  3NRV A;  1T56 A;  4IPA A;  1N25 A;  3BR0 A;  4B44 A;  3C2B A;  3AL0 C;  3J7A Y;  2NVT J;  2QBY A;  2E36 A;  5LD2 C;  4XOR A;  3DV8 A;  1PDN C;  1H9G A;  3I0T A;  2VON A;  2GA2 A;  2IEK A;  3GME A;  2V1D A;  2L7F P;  1IRX A;  2W48 A;  3IV5 A;  3KPH A;  2JA7 J;  2XRL A;  1IXR C;  5GAG J;  3CD6 I;  2Z33 A;  3BJ6 A;  5ED4 A;  1FWZ A;  2L9R A;  1MBE A;  4EGY A;  2GXB A;  2DMU A;  2YUS A;  2ZSH B;  1H88 C;  4BJ6 C;  2X1D A;  1HQC A;  2L2O A;  1SAN A;  1KQ0 A;  4DZJ A;  5LEK A;  1XDS A;  4XK4 A;  2VQC A;  2D5V A;  4HV6 A;  3AG3 H;  3BZ6 A;  3BG3 A;  4CZZ A;  1T39 A;  4PFO A;  3AL0 B;  3ZGK A;  4EJV A;  2OZU A;  2HWV A;  2KDO A;  3ABT A;  4HDV A;  1EV7 A;  3K1N A;  2DMQ A;  3MAJ A;  3OOU A;  4BQN A;  4I6Z A;  3MKZ A;  4HDU A;  1QZZ A;  2NVU B;  3BTC A;  1FTT A;  1IRF A;  4IQ4 A;  3ERM A;  2KZV A;  1Z7U A;  4KMU X;  5A2Q Z;  3TOA A;  3S2W A;  4RB3 C;  3OL3 A;  2MYS A;  2O8K A;  3OS1 A;  1R7J A;  2R7Q A;  1W5C C;  4A3F J;  4I76 A;  3ABK H;  2GXA A;  4S05 A;  2XAS A;  1IGN A;  3TW7 A;  2E5N A;  1VTN C;  4CA0 A;  2DA3 A;  2Y0S N;  3QAH A;  4OWR B;  4DYC A;  4YRV A;  2VN2 A;  4N9H A;  3O6B B;  4UB6 C;  3OYD A;  1HC8 A;  1K7A A;  3HRT A;  1MSF C;  3CZ6 A;  4XLE A;  2RGV A;  4M74 A;  5BPI A;  3FK7 A;  1Z1D A;  3KP3 A;  4NBQ A;  2D45 A;  4MEX F;  2E2I J;  2K3F A;  3BJA A;  1S8N A;  1CGP A;  1FTZ A;  4M72 A;  4ZZL A;  2OUM A;  2QUF A;  1RZ4 A;  2VPR A;  3ZMS A;  1LJ9 A;  3K6G A;  4XLP F;  3BCB A;  3F22 A;  3OYK A;  2MFZ A;  2R3S A;  2FBI A;  3SFI A;  1SFX A;  2ACJ A;  1WHU A;  3NWS A;  3WOD F;  1A5J A;  3NAU A;  1STZ A;  3MCZ A;  1Z6T A;  1HLV A;  3WTT C;  2IGM A;  2Q2E B;  1MJB A;  3H5N A;  1SC7 A;  3P7N A;  3LFU A;  1T6S A;  2HI3 A;  5C3E J;  1GXP A;  2KRF A;  1BIA A;  3AFH A;  4KN7 X;  5GAD J;  1WQ2 A;  1U5T B;  2V26 A;  1OMI A;  4UUT A;  2OTJ I;  1RET A;  3MZ8 A;  4AYB N;  1R58 A;  3DLA A;  5BMZ A;  1P4A A;  4BHC A;  2DCE A;  3OY9 A;  3ZMT A;  3ZXS A;  3KCC A;  4ZC3 A;  5K5R A;  3I55 I;  1H89 C;  2WAE A;  2I10 A;  4JBA A;  2TCT A;  1REP C;  3R61 A;  4ANJ A;  2CG4 A;  2ETH A;  2I5U A;  4M3D A;  1ZGA A;  2LY1 A;  3KP7 A;  3HDD A;  2JA6 J;  2XKO A;  2BY1 A;  3S1Q J;  4XLH A;  3I56 I;  4F92 B;  2MBF A;  1UEL B;  4WX9 A;  1G6N A;  2XSJ C;  1GDT A;  1MBK A;  1K79 A;  3S93 A;  1HDP A;  5IT9 Z;  3GFJ A;  3K1P A;  3KP5 A;  2K27 A;  4DJA A;  5GAH J;  3CO6 C;  4BY1 J;  3PNT A;  5D8L B;  2MH9 A;  4XKC A;  3TDZ C;  1KZH A;  2DA1 A;  3JTG A;  4C30 A;  1ZG1 A;  1WH5 A;  2I8D A;  1HW5 A;  4XN3 A;  1KA8 A;  1R5H A;  3K10 A;  1CQT A;  2QF7 A;  3S1N J;  1KU3 A;  1RR8 C;  3FDY A;  2WA0 A;  3ML6 A;  4U0Y A;  3GTJ J;  1ITY A;  1PUE E;  1VQL I;  5JVG F;  4CCJ A;  3CLO A;  2EA4 A;  4A5M A;  3WE2 A;  2LC2 A;  4LK1 F;  2KLO A;  3ISP A;  4DYQ A;  3UR3 C;  4F91 B;  3J7Y J;  4KJZ A;  1H9T A;  3GTO J;  2O61 A;  5E3M A;  2OCC H;  5FLV A;  2ZME C;  5DYM A;  2VAS A;  3RDI A;  2CUZ A;  3ZQ7 A;  1UHW A;  1D1A A;  2GAU A;  1XGM A;  5JI6 A;  2XAU A;  3K4L A;  4ENM A;  4ZTF A;  2XF7 A;  2HU9 A;  2X6W A;  4MQ9 F;  3EUA A;  2R7S A;  4D5F A;  1B1B A;  3PL8 A;  1QQI A;  2QCO A;  3WU1 B;  3R0J A;  3GWZ A;  1VQ4 I;  1YYV A;  2GZW A;  4A3I J;  2IA0 A;  2RAE A;  3GFL A;  4FCY A;  4ZYD A;  1UZC A;  3LSM A;  3W6J B;  1YIJ I;  1QA6 A;  3M4O J;  2BEO A;  1P6R A;  1XB4 A;  4LK0 F;  3E5U A;  1R23 A;  1U2W A;  3CDL A;  3H36 A;  1B9N A;  5LBQ A;  2IVM A;  4EM2 A;  3GXO A;  4A3D J;  3K69 A;  1SMT A;  1MBH A;  2BV6 A;  2G9W A;  1ZGW A;  3I53 A;  3A03 A;  4DW6 A;  3R60 A;  3JW4 A;  2OQR A;  3JRI A;  4G8X A;  3HG9 A;  2DA2 A;  1QU3 A;  2PJP A;  2YX4 A;  3K4C A;  1QZY A;  2UUZ A;  1MBG A;  3I5U A;  5LGU A;  5HLT A;  3ZQQ A;  2L4A A;  4G7Z F;  1R4M B;  4U0V A;  2PEX A;  1GV5 A;  1EKE A;  5D8K B;  1KQ9 A;  5IY5 H;  1N77 A;  2Q2E A;  1YJW I;  4W1U A;  4ZJZ A;  5K7Z A;  2EIK H;  2M7B A;  2O3F A;  1J5Y A;  3U1K A;  1F5T A;  2WTE A;  4O3M A;  1X1P A;  2DLL A;  2OF7 A;  1MKM A;  1U9N A;  2DFF A;  4XSZ F;  1U5T A;  4CYC B;  4HOB A;  4UXN A;  4ZDP A;  4ETS A;  4BBS J;  2DA4 A;  3RSN A;  4B1R A;  5E3N A;  2DT6 A;  2CQ7 A;  3DCF A;  2JUG A;  5FGM A;  2CW0 F;  1SD5 A;  3HB9 A;  2XAF A;  4HA8 A;  2UXX A;  5JLW A;  3H3V K;  3RKW A;  1P2F A;  4XRF A;  2P7V B;  3WTY C;  4PZJ A;  4YEJ A;  2H8R A;  4BL0 B;  2HXI A;  3ZPL A;  3SZT A;  3N05 A;  3M7G A;  1BJA A;  4YFK F;  1F1Z A;  3KEO A;  5BS6 A;  4HBL A;  2KP6 A;  3A0H C;  1SD7 A;  2A69 F;  4NC6 A;  4BS9 A;  2IGN A;  1ERD A;  2K85 A;  3BDD A;  1IF1 A;  1O7F A;  3CCR I;  3OIQ A;  3QOD A;  3SEZ A;  3TDU C;  1MJ9 A;  2DDB A;  2H94 A;  3DKY A;  3IL2 A;  4XLN F;  1X1C A;  5D6F A;  2GIV A;  1B59 A;  5D4S A;  2FMY A;  3FXM A;  2XRN A;  2X51 A;  3M1E A;  3PM1 A;  3L2Q A;  1JJ8 C;  1WJB A;  3KP6 A;  3RIR A;  4RDU A;  3W6K B;  1K6O A;  3KFW X;  5B66 C;  1D0X A;  1OIS A;  1LDD A;  4N9I A;  1TQM A;  4YII A;  3RKQ A;  1S7A A;  2D1V A;  2HVQ A;  1D8J A;  2KIF A;  1QHG A;  1RC9 A;  2ZBK A;  5C44 J;  2ID3 A;  2YS9 A;  1XX5 A;  5FKM A;  3HKZ A;  3S8P A;  4WWC A;  2KDZ A;  2LG4 A;  3TP3 A;  5IT3 A;  1QGP A;  2DU9 A;  1XSX A;  3DPT A;  1ONV A;  5HVQ C;  4NHJ A;  4UHT A;  4FX4 A;  4RGX A;  3TKY A;  4E7I A;  4UY8 I;  3K0L A;  1IN7 A;  3JRF A;  2H6C A;  4QPQ A;  2O8X A;  2W84 A;  3HEF A;  5J47 A;  4FTH A;  4ENN A;  4PGH A;  4F52 A;  2ZB9 A;  3RQI A;  1J75 A;  3GW2 A;  1QPM A;  5B3S H;  3DEE A;  1X2N A;  3QP5 A;  3DP7 A;  2MD5 A;  4J00 A;  2BGC A;  4PJJ A;  1U0J A;  1R22 A;  2K86 A;  1TT5 B;  4QTR A;  3RKY A;  1Y8R B;  5DEQ A;  2HNH A;  2H09 A;  2D1H A;  4MLO A;  3ONQ A;  2FJ1 A;  2F5V A;  3K7A J;  3OYM A;  2KFD A;  4UNO A;  2Z2S B;  2ZSI B;  4I0A A;  1KON A;  3SQN A;  3IAS 2;  1D1C A;  5E20 A;  4ENJ A;  1FNN A;  4E6K G;  3LSK A;  3IAM 2;  4EM1 A;  3BT9 A;  4EGZ A;  1YJN I;  2JTV A;  2E7W A;  3T8T A;  2HGC A;  2EWN A;  4QPO A;  3VWB A;  2X6O A;  3IP4 B;  3LNQ A;  3K4K A;  1B9M A;  2BW3 B;  2XVC A;  3A0B C;  3BOQ A;  2H1L A;  2DPU A;  4BAY A;  1IN6 A;  4AUX A;  3ZMZ A;  1DUX C;  1YX5 A;  3EET A;  1SFO J;  4CYC A;  1OFC X;  3EUH C;  4PSX A;  2ZXW H;  4Y52 J;  3T8R A;  4KIC A;  4YG2 F;  4OIR F;  3IWZ A;  3CCU I;  3DU5 A;  3RI4 A;  5J1R A;  3KEQ A;  1AWC A;  5TGT A;  5BQT A;  4HQE A;  4S0H B;  1OQY A;  2VKD A;  1XS9 A;  5FJ8 J;  1YW9 A;  3DKW A;  2GOX B;  1J09 A;  3BPV A;  4IJA A;  3TMO A;  2CW7 A;  2A6H F;  2LRD A;  3HSF A;  3NEU A;  3W2W A;  2VQH A;  3H35 A;  2K02 A;  3FIW A;  2JUC A;  4XN0 A;  3M8J A;  2EQR A;  5CQG A;  1YG2 A;  2DMN A;  4RMN A;  2XSD C;  1I27 A;  3MD2 A;  4BHB A;  1R36 A;  3J80 Z;  1W0T A;  1OYW A;  2E1C A;  4M6V A;  1W1W E;  5LRR A;  2F5E A;  3TP0 A;  5HOO A;  5AIP A;  2F4I A;  1YRN B;  4EV0 A;  1VFC A;  4BGD A;  4Y15 A;  4EJO A;  3E97 A;  3H9J A;  2QQA A;  4E4H A;  4RAG A;  3SJM A;  2O03 A;  2XC7 A;  4KFC A;  4AYB A;  3E7L A;  4I2O A;  1IO2 A;  4XON A;  2PLY A;  2CRG A;  3CUO A;  1KGS A;  2E2H J;  2M0M A;  2Y9Z A;  3FHN A;  2AXL A;  1DPU A;  2ZJR F;  2W85 A;  2JA5 J;  4IF4 A;  3FHZ A;  3SXY A;  2XGC A;  4Z2Y A;  1F4K A;  2FUG 2;  2Z99 A;  2ZO4 A;  1Y1W J;  3IUO A;  2EH3 A;  2HTJ A;  3WE3 A;  3FK6 A;  5F0C A;  2FF4 A;  4CUG A;  3S3M A;  4EAT A;  3A01 B;  2UZK A;  5EYR A;  3G1O A;  4L9V A;  3QRF F;  2N8G A;  4PDK A;  5J8F A;  1UST A;  1V5F A;  2JA8 J;  1UHM A;  2XB0 X;  1AU7 A;  1R4N B;  4CCL A;  4BQQ A;  5EZG A;  5KCM A;  2COM A;  1I39 A;  3IRQ A;  3AG2 H;  2ZNZ A;  4G94 A;  2Y75 A;  1XDU A;  2XHK A;  1I3Q J;  5FKN A;  4XID A;  1RNL A;  1ENH A;  2ME0 A;  2Y31 A;  4LFU A;  5AON A;  1ZK8 A;  1EH7 A;  3GX4 X;  3KEY A;  2LRE A;  4BJT A;  3QYB A;  4B47 A;  1DU0 A;  2V9V A;  3PSI A;  4B09 A;  2IS1 A;  5CVJ A;  1USS A;  4V2F A;  2Y30 A;  2VQL A;  2XGX A;  4QSH A;  3GUD A;  2BY3 A;  2EV5 A;  1X19 A;  3QP6 A;  2K9L A;  2PMU A;  1Y8Q B;  1RKW A;  5L3G A;  1O3T A;  1XGS A;  1NTC A;  3JAM K;  2LF7 A;  2JMW A;  1DU6 A;  4AC0 A;  5KVR A;  4ZTJ A;  4IRH A;  3VEP A;  1S7E A;  3SDB A;  5EEA A;  2LD5 A;  1SAX A;  3H1C A;  4XKB A;  2HKX A;  2E35 A;  2QVO A;  2KT0 A;  2M0C A;  2LH9 A;  3T1B A;  2OA4 A;  2EV0 A;  4OIQ F;  1WJC A;  3P9K A;  2O6G E;  2BW3 A;  4A3J J;  4LIV A;  3VFZ A;  1TQP A;  3LSP A;  3FF5 A;  1I6X A;  3G73 A;  2ECB A;  2KKO A;  3KZI C;  2DTZ A;  2VOO A;  2STW A;  1IG7 A;  3CC2 I;  4L9T A;  3FKI J;  3FX3 A;  2XIG A;  3ABU A;  2M3A A;  2EFW A;  5FRN A;  3HPH A;  6PAX A;  4HSR A;  3L2W A;  2CQX A;  4ABZ A;  5K1Y A;  1F9N A;  3QU3 A;  1GT0 C;  3M07 A;  1FYK A;  4RAZ A;  3KP4 A;  2YX7 A;  3WTW C;  2QSF X;  4P1W A;  1O3R A;  1CF7 B;  2HQN A;  4HW0 A;  3BG5 A;  2BXZ A;  3NQO A;  2MW8 A;  2ZJ2 A;  1TNS A;  2HDC A;  1FJL A;  3I4M J;  2LY9 A;  4PK4 A;  4ON0 A;  3GTG J;  3ZCO A;  4M3B A;  3DTK A;  4PGG A;  3HL2 A;  2KHM A;  3HSE A;  3QPH A;  4G12 A;  5CQE A;  4AU7 A;  5ICE A;  4LB5 A;  4LJZ F;  4PJN A;  4E7Z A;  3CCS I;  1BL0 A;  2PBI A;  1YRN A;  1KU7 A;  4NDL A;  5GPA A;  5DCM B;  5DUK A;  5GP9 A;  2XPV A;  3BTI A;  3KIO A;  3KZY A;  2H6B A;  3P9I A;  2GM4 A;  2EZL A;  2XPU A;  4Q5S F;  3A1Y A;  3CC4 I;  2QYO A;  1ETW A;  3EUH A;  3PQJ A;  4YIR X;  1GVD A;  3RPU A;  1Z21 A;  2JJ7 A;  4DNC A;  3S17 J;  5LHG A;  2GA1 A;  1ZTR A;  5DV5 A;  1OLT A;  3CF5 F;  5CPR B;  1RUN A;  2BYV E;  3P9C A;  3K70 C;  1B72 B;  1MND A;  3P5J A;  4G7H F;  2QZ8 A;  1WJ5 A;  3LSH A;  2IW5 A;  3U21 A;  3S2H J;  3H92 A;  4OIN F;  4B3A A;  5H6Q A;  1IN5 A;  2M4K A;  4WCG A;  4BDY A;  5KAF C;  3OYC A;  2A6T A;  2WY8 Q;  5FRM A;  3A01 A;  1WRJ A;  3BTL A;  1TBX A;  4S04 A;  4IO9 F;  2Y2Z A;  3DBL B;  1G3W A;  4AIJ A;  2JSP A;  4B4C A;  3N4M A;  1IV6 A;  2ZCW A;  2W1O A;  1W7P B;  3VSL A;  1XGO A;  4XNF A;  5FLX K;  3VOE A;  5J6X A;  3FBN B;  3FMS A;  3G4S I;  2HVR A;  2Y0M A;  5FD5 A;  1YHQ I;  1I6H J;  2E71 A;  3IRR A;  4A6E A;  4JK1 X;  2CV0 A;  3HKZ N;  2QGU A;  4GYG A;  3WHB A;  1ON2 A;  3ERE D;  5L3D A;  1DGW Y;  4C2M J;  2DMT A;  2DDA A;  3WG9 A;  1ZKG A;  2OQG A;  3DF8 A;  1SVL A;  1YLF A;  2HOE A;  2A05 A;  2XAH A;  1APL C;  3GFM A;  1Z0X A;  3VSK A;  3HRU A;  4XOP A;  5JHU A;  4XRM A;  3ELK A;  4R1H A;  1LEB A;  4IRG A;  1MBJ A;  3IHU A;  1LVK A;  2ZC2 A;  3S1M J;  4PJL A;  2DFE A;  2CV2 A;  1WH7 A;  2JVG A;  2KL4 A;  3G1M A;  5FD6 A;  3MKW B;  2IP2 A;  4I01 A;  3DPU A;  3V8J A;  3LQQ A;  5LLQ A;  1FX7 A;  1FYM A;  4A3M J;  2MLK A;  3BG9 A;  2L3D A;  1ETK A;  1JI8 A;  3Q0W A;  3RZD J;  2ESH A;  4AD9 A;  3JRD A;  4CGZ A;  4O6J A;  4UUV A;  4F55 A;  1E3P A;  4GCV A;  2CV1 A;  3MKL A;  4ZYG A;  5ILS A;  2BHY A;  3E6C C;  3PJR A;  4GXO A;  5TIS C;  4M9S A;  2DA7 A;  1LKX A;  4A12 A;  1U8R A;  2ZNY A;  3Q5F A;  1MIJ A;  1O57 A;  3GTM J;  2OJE D;  1MMA A;  2X9D A;  1LVA A;  4BXU A;  3JR9 A;  2CW8 A;  1VI0 A;  3JRC A;  3DWL E;  3WTZ A;  2LBF B;  3FXO A;  2HR3 A;  1JGG A;  3HOU J;  1YTY A;  4U87 A;  1LB2 A;  1CF7 A;  4LG0 B;  2HOS A;  1J59 A;  2VL8 A;  2ELJ A;  1DQU A;  2K4J A;  4BBR J;  4A3K J;  2LOO A;  5ILV A;  1S9H A;  3EQL F;  1Z05 A;  4BE0 A;  1WKM A;  4HQM A;  1BC7 C;  5EEH A;  1IRZ A;  1T2K A;  1R71 A;  2DJN A;  2L4M A;  1FZP B;  4IEJ A;  4OMY A;  3GCM A;  3FXK A;  3L2C A;  4G7O F;  3L9F A;  3SZG A;  3TBI A;  1HSJ A;  3VYT B;  1OR7 C;  2VB6 A;  5E1Z B;  4X6A J;  2EK5 A;  5HNF A;  1K61 A;  3BG6 A;  2FSW A;  1LNW A;  1UJ8 A;  4A93 J;  1PP7 U;  2EPF A;  3VOD A;  4WXC A;  3HIF A;  5DCM A;  3R0A A;  5EEG A;  2DT7 B;  5GPC A;  4A69 C;  2ZXH A;  3M9A A;  1R6R A;  2GWR A;  4HNU A;  2CMP A;  4KIG A;  4CHU A;  1XCV A;  4D7N A;  3UKG A;  1TLH B;  3CMM A;  2R4G A;  1MMN A;  2IXS A;  2V6C A;  2H8W A;  1B6A A;  4XKV A;  1B72 A;  3AKZ A;  3S15 J;  2K9S A;  4BE2 A;  5K5O A;  5JFR A;  3HTS B;  1Y0N A;  3HOY J;  3IH3 A;  5F1J A;  3PQK A;  4M71 A;  3ZMV A;  1BC8 C;  3L2V A;  3K4J A;  1U6G A;  5M5W J;  3RQ4 A;  4BY7 J;  3OYE A;  1OJL A;  2DMP A;  1ZRD A;  2TRT A;  4R79 A;  4RM2 A;  1W7P A;  1H8A C;  1FOK A;  3DQV C;  1SD4 A;  3OS2 A;  3VPR A;  2DJI A;  5CLS A;  2HOA A;  1QRY A;  3K9T A;  4RGU A;  4JX5 A;  3ABL H;  1YQA A;  1MW7 A;  4KIF A;  4RGR A;  5D4R A;  2EIL H;  1LE8 B;  1H0M A;  1YFH A;  3V7S A;  2W25 A;  4EM0 B;  4HV5 A;  3CMY A;  1K4T A;  4XRS A;  3C2G A;  3H0D A;  1Z77 A;  1YJ9 I;  2HZT A;  3V7R A;  4EJT A;  1P7J A;  4MO7 A;  3MMY B;  2BZT A;  1W5S A;  2FEZ A;  4D7M A;  1XSV A;  5TRD A;  1YS7 A;  2PFB A;  2IRF G;  3JSP A;  2A3S A;  2L02 A;  4P96 A;  1S29 A;  2Z9O A;  2G7H A;  4AVP A;  4AVZ A;  3JTH A;  2NAZ A;  1QHH D;  2K9N A;  4D1Q A;  5E3L A;  1MGT A;  4IXA A;  1MZB A;  5HDK A;  1ZHF A;  5JVT A;  2PJR B;  3CJT B;  2AQE A;  4A3B J;  2FA5 A;  4BXX J;  5CVV A;  2RC4 A;  1HOM A;  3WTU C;  5GTI C;  1SD6 A;  2VJJ A;  1VQ7 I;  2BVM A;  3I54 A;  4FE7 A;  4XOT A;  2EBI A;  3IC7 A;  2L7Z A;  1MMS A;  3HOX J;  4LB6 B;  2OAZ A;  1BI0 A;  3G3Z A;  4XLA A;  5KK1 A;  2HDD A;  1NG6 A;  3WG7 H;  3F21 A;  3L2R A;  3E6D A;  4ZYH A;  3T5X A;  3KET A;  3LSI A;  1RKT A;  5L3E A;  1TW2 A;  2R7U A;  4QWQ A;  1DPR A;  2MSY A;  4L9N A;  5D5V B;  2XPW A;  3WGI A;  4ZZD A;  3QOP A;  3TQN A;  5LRS A;  1MNE A;  3HOS A;  1OCO H;  4GYI A;  2LBF A;  1I5Z A;  5J3L A;  2P8T A;  1K78 B;  2J5P A;  4LG0 A;  1F36 A;  5BOX A;  3CMA I;  5F6F A;  5J4V A;  3KP2 A;  2QEX I;  1BW5 A;  4Q4Z F;  4XR6 A;  5KHD A;  4KIT B;  2KQR A;  3MZH A;  5BPD A;  3GYH X;  4U0W A;  2VBX A;  1LDK B;  1SFK A;  5DUI A;  2R7X A;  1YX3 A;  3S1R J;  3LWF A;  3CDH A;  3GEZ A;  2DK8 A;  2XF5 A;  2F5C A;  4MNU A;  1OYI A;  2ADU A;  2L9S A;  4E7L A;  3CDI A;  2ZME B;  3G6E I;  4K2E A;  2ZJQ F;  2QKL B;  1RES A;  4UUS B;  2ICW G;  2X1E A;  2X4H A;  3I59 B;  4HZF A;  5FLM J;  2HZD A;  2HEO A;  3G1L A;  5FB2 A;  3FXJ A;  5FKO A;  1Z91 A;  3S16 J;  2K4B A;  3OYN A;  2RQQ A;  4R8H A;  1TP4 A;  2ZFU A;  2JRM A;  4RAY A;  3AG4 H;  1VQK I;  1D8K A;  1XMX A;  2EJR A;  3GF2 A;  2QLZ A;  4CH7 A;  2QQB A;  1OYY A;  2O0Y A;  4NQW B;  3PNV A;  5E79 C;  1R5I D;  5IYC J;  1W5T A;  4A3G J;  3IH2 A;  1G4D A;  3CJQ B;  3GBG A;  2DXI A;  3MFK A;  2VBY A;  3ECH A;  2A07 F;  5IYB J;  1X3W B;  1OR7 A;  4RGS A;  4Y33 A;  1BR2 A;  5LHI A;  5M5Y J;  2BE5 F;  1MSE C;  2RV8 A;  4Q48 A;  4B3X A;  1O3S A;  2F48 A;  2EIJ H;  4MFE A;  1LE8 A;  2XKP A;  1BOB A;  1FMW A;  1WJE A;  4EEF G;  3LSG A;  2FRH A;  2EIN H;  1V55 H;  4LLL A;  1OCR H;  5L3C A;  1TWF J;  1MH3 A;  2FBK A;  1I1S A;  3B73 A;  1K6Y A;  2NYX A;  1HKT A;  1G8X A;  1Z6R A;  2EFP A;  5K5Q A;  3FM5 A;  1Z67 A;  3KYC B;  3DXJ F;  3FWE A;  2OV7 A;  3HPG A;  3OL4 A;  5F04 A;  4EJU A;  4EMS A;  2IS2 A;  4NUB A;  4CIC A;  5HOD A;  3KE2 A;  1M1E B;  2CH0 A;  2JA2 A;  2WB1 N;  4X1E A;  1FOX A;  4P9F A;  3CCY A;  2ISY A;  5D5X B;  5HLH A;  4BH9 A;  3GZ6 A;  1C0W A;  3W2V A;  2HXO A;  3F3X A;  3JRA A;  2PJR A;  4BYY A;  3FXR A;  2ELK A;  2FNA A;  2R0Q C;  1OKR A;  3HOT A;  1ZAO A;  3DBH B;  3K4B A;  1BA5 A;  2C6Y A;  1X2M A;  2E5Z A;  2V9K A;  1KU2 A;  2DW4 A;  2FNP A;  4KN4 X;  1T33 A;  2P4W A;  5LGT A;  2COB A;  1OPC A;  3LA3 A;  1KQ8 A;  1D1B A;  3K4M A;  3PUF A;  1FEX A;  2LK2 A;  1E3H A;  3BP8 A;  4NB5 A;  5ICC A;  1JHF A;  1N75 A;  2VI6 A;  5JHF A;  1S3J A;  3ZQG A;  2WV0 A;  2R93 J;  2P5K A;  4RA2 A;  2JPB A;  2W4S A;  3W3C A;  3DEW A;  5HS7 A;  3J81 K;  3EYI A;  2X1C A;  1K78 A;  1JGS A;  3MN2 A;  4L5I A;  3LST A;  3PNY A;  2DOE A;  4JX6 A;  5JR3 A;  2DYS H;  3VYR B;  1TWA J;  4FQG A;  2MGQ A;  1W36 C;  3CCL I;  2NXN B;  4E7K A;  2VUM J;  3DKX A;  1DDN A;  3HRM A;  2R5Z B;  3ZN1 A;  3DTI A;  2X85 A;  2M30 A;  4Q47 A;  2DYR H;  2E1O A;  3KYD B;  2R7F A;  1T98 A;  4KDP A;  4EJW A;  2ZME A;  2F6C A;  3MQ0 A;  3OYL A;  4IL6 C;  3I4P A;  4DBR A;  4UUS A;  2J5O A;  3I59 A;  4F7Z A;  3B02 A;  3VYS B;  2DOD A;  1FC3 A;  3BZK A;  2VE9 A;  3TGN A;  2KRH A;  2V79 A;  2EIM H;  2IA1 A;  5HDN A;  3PFY A;  1N78 A;  4HYE A;  4IHY A;  4II2 A;  2DI3 A;  2LTP A;  1MD0 A;  5J1U A;  2E2J J;  3M1C A;  2B0L A;  4BNC A;  1WZ2 A;  2RQP A;  4DZP A;  1BM9 A;  2K3P A;  5D5W B;  4NQW A;  2R7T A;  2CQQ A;  1PUF B;  3RPU D;  5KNL A;  2R7D A;  4E70 A;  1V3F A;  1UFM A;  4ZH4 F;  1JKR C;  4RB1 A;  1LFU P;  1VF9 A;  4L9J A;  4L0Z B;  3OSF A;  5EZH A;  2LVS A;  2HQA A;  2F4O B;  2LP0 A;  1QVT A;  4RAF A;  2X6X A;  1MBF A;  3CP2 A;  2KZG A;  4D5C A;  3JCU C;  4DIQ A;  2CFO A;  1HCR A;  9ANT A;  1L0O C;  1O3Q A;  4JOM A;  3F72 A;  1EA3 A;  3PSF A;  1AA7 A;  5FO5 A;  3CJR B;  3GTL J;  5M5X J;  2EFQ A;  5D6E A;  3LQR A;  3HGY A;  4G6Q A;  2DFI A;  3LFK A;  4DBQ A;  3BY6 A;  4LLG F;  4OAY A;  3PO3 J;  1UHS A;  1D0Y A;  3HXL A;  1FPQ A;  1X4P A;  1XG1 A;  2IPQ X;  2A68 F;  2R7V A;  3I4N J;  2VJ5 A;  2AS5 F;  4ESB A;  2JPC A;  4HPQ A;  3J7A O;  3ZOB A;  4C3J J;  4IX7 A;  2F5D A;  1IDY A;  2K9Q A;  1XC5 A;  3BLY A;  3S14 J;  3H3U A;  3ZMU A;  4MIM A;  4MTD A;  1ETY A;  1Q1V A;  3BR1 A;  4MQV A;  1OCZ H;  1DP3 A;  2L01 A;  3IKT A;  4KA4 A;  2VKE A;  1BR4 A;  2VLA A;  4M3G A;  3L2U A;  2YPR A;  3OV8 A;  1FSE A;  1NK2 P;  1QBJ A;  1IUY A;  2M8G X;  1YS6 A;  1J0R A;  5CJ9 A;  2R7R A;  5CVR A;  3LAJ A;  2STT A;  3TO7 A;  3E5Q A;  3DU6 A;  3F8M A;  3OMY A;  2IAI A;  4PJ0 C;  1XN7 A;  2MA3 A;  3H5R A;  4GO1 A;  3BWG A;  4B48 A;  1WPK A;  4ZDL A;  4DQ2 A;  2XDV A;  5HS8 A;  3GO5 A;  2MLG A;  1I50 J;  2VJI A;  5E8G A;  4WF2 A;  1U78 A;  4IVN A;  1FBU A;  5A2Q K;  1ACI A;  1X1D A;  1Z3X A;  3MVP A;  4LD5 A;  1WI9 A;  2AQF A;  3QQA A;  2Q1Z B;  2QSH X;  4Y17 A;  3ZRG A;  3QYE A;  3JRH A;  1IW7 F;  1LFB A;  3E1S A;  1B4A A;  3LSR A;  3BR2 A;  2QWW A;  2IT0 A;  4IHW A;  3TOB A;  2LSO A;  1TC3 C;  2GQQ A;  1WI3 A;  2R5Z A;  3ZQH A;  2V6E A;  1R1U A;  4KIS A;  3U9G A;  1P9Q C;  1FOY A;  4HG2 A;  2Q8K A;  2M34 A;  2CQK A;  3GVA A;  3OYJ A;  4Z6Y A;  2NOJ B;  1JT0 A;  2V4J C;  5M3M J;  2VXD A;  3O8G A;  4I09 A;  2HYJ A;  1X3Z B;  2GLO A;  3DPL C;  1JTY A;  1XMA A;  1F43 A;  1Z3Y A;  1D0Z A;  5LHH A;  5IP7 J;  3F0C A;  3JRE A;  2R7O A;  5F1R A;  2M87 A;  3VDX A;  2V1N A;  3K2Z A;  2W82 A;  2PI0 A;  2ESN A;  4AIH A;  2B7E A;  4UVB A;  1P92 A;  1PUF A;  4AWX B;  2X0L A;  4LGW A;  3RJP A;  2IJL A;  4F93 B;  2MC3 A;  1UCR A;  1IXC A;  1JUP A;  4L18 B;  3QPL A;  1ZLK A;  1YOV B;  5E1X A;  5F0H A;  2LYC A;  4YFN F;  2MD0 A;  3CTA A;  1OCT C;  1ZH5 A;  5EG0 B;  4CDG A;  2L9V A;  5HNH A;  1MDM B;  4J19 A;  2QA4 I;  2NNN A;  3QU6 A;  2RN7 A;  2QQ8 A;  4BKX A;  2VE8 A;  2E19 A;  1VND A;  2P5V A;  1A35 A;  4W97 A;  5E3O A;  2AXT C;  1W7P D;  4XMY A;  4CZC A;  1GHC A;  3EPZ A;  4ITV A;  5FKL A;  3ZQL A;  2P6T A;  4XM3 A;  5IOZ A;  2HPM A;  5F08 A;  3PO2 J;  2FQ4 A;  2LY2 A;  2A61 A;  5EGO B;  2PQ8 A;  4M3F A;  5HLG A;  1G59 A;  5IYD J;  5IT9 K;  1WJF A;  3B6C A;  3OR2 C;  5B1B H;  2CO5 A;  1Y6I A;  2HVS A;  4OIP F;  1KYW A;  4OAZ A;  4E7J A;  4M6X A;  2R92 J;  3C1D A;  1R9T J;  3K2A A;  2A6E F;  1YIO A;  3HHH A;  5IP6 A;  3GZ5 A;  3CQZ J;  4BDZ A;  3K70 D;  2OTL I;  1JUS A;  4M3E A;  3CCV I;  4AIK A;  1OCC H;  1RIO H;  1U9O A;  4C9Y A;  4BAC A;  3RYP A;  2M45 A;  1GV2 A;  3GTP J;  2HFH A;  3ZN0 A;  1FOW A;  2ZFW A;  1K4S A;  2NVX J;  5IPA A;  1RR7 A;  4H0E A;  3FMQ A;  4ASN A;  1ORK A;  3BR5 A;  4LIT A;  4I0B A;  3FZV A;  3LA2 A;  2HKO A;  2VIX A;  2VT3 A;  1V5E A;  5F64 A;  3L1P A;  2EFO A;  5BNG A;  3U1D A;  3DBR B;  2ZJP F;  3BC8 A;  1FT9 A;  2F2E A;  3TO9 A;  4JQF A;  3CME I;  2IGO A;  4H4K C;  1BIB A;  4NC8 A;  2WB1 A;  3E0J B;  1FYL A;  5H20 A;  4HX8 A;  1SFE A;  2LMD A;  1UAA A;  3HYI A;  1HDD C;  1P4W A;  1MH4 A;  3CP8 A;  1ULY A;  2XV4 S;  3CES A;  2LKX A;  3WU0 A;  2EZI A;  3HOV J;  3TO6 A;  2BY2 A;  2XAG A;  4FX0 A;  3FXL A;  3CF2 A;  3FM3 A;  3FXQ A;  3K4N A;  4XLF A;  5KAI C;  2UV1 A;  2HOT A;  1IXS B;  4HEA 2;  4P5O A;  3BZC A;  4XIC A;  2XRO A;  2BY0 A;  1VQ5 I;  4U7D A;  3RYR A;  2P6S A;  2KIU A;  4LG3 A;  1S72 I;  1ZG3 A;  3CC7 I;  1R1V A;  3LL7 A;  3F9K A;  4A3L J;  4BJ5 C;  2LF8 A;  2ZKZ A;  4N4N B;  2QQ9 A;  3BQY A;  5LFA A;  2IA2 A;  2VBW A;  1UB9 A;  3LOC A;  2CS3 A;  2NNY A;  3KX2 A;  4A0Z A;  2DOA A;  3C2H A;  5EJC A;  2D2W A;  2DK5 A;  2L9N A;  2DTR A;  3OIP A;  3WTV C;  3CJN A;  3RTR A;  2KIS A;  1XSD A;  1JKO C;  3HRS A;  3I58 A;  3OIO A;  4ZYA A;  3ASN H;  3FKJ A;  4TV7 A;  3H9G A;  1XPX A;  5DD4 A;  5J1Y A;  1GLN A;  1BN5 A;  2DQR A;  3SDG A;  5EG0 A;  3ECO A;  2DA6 A;  1MDM A;  4E7S A;  1IZ1 A;  4CCO A;  3S3O A;  2VT2 A;  4XBF A;  2NOG A;  2CGP A;  3ROU A;  1RRJ A;  1T08 B;  1T95 A;  2FBH A;  2O7O A;  3GLX A;  3KLN A;  2XAQ A;  1ODD A;  2L5Q A;  3OYA A;  3PIO F;  3AG1 H;  1JE8 A;  1HXD A;  3OYH A;  1JKP C;  4PFP A;  4BQA A;  4A3E J;  1U5T C;  1EF4 A;  3COA C;  2P7C B;  2CJJ A;  1Y1V J;  4L5J A;  2JT1 A;  3JAM Z;  5EGO A;  4O5V A;  3L09 A;  4HNV A;  1BOA A;  2PMH A;  2EA2 A;  1G3Y A;  2KIQ A;  5HS9 A;  3H9Q A;  3DEU A;  3OOP A;  4WXD A;  1R00 A;  2NS7 A;  1XMK A;  1IAW A;  3D1N I;  4IHV A;  3V7C A;  3GTK J;  4M73 A;  3QYF A;  4MGR A;  3DTE A;  3RPQ A;  3TED A;  5ICF A;  4A0X A;  3TW6 A;  2H27 A;  3SEQ A;  3ZQI A;  3ABM H;  2W7N A;  1FP1 D;  1HKQ A;  1ZLJ A;  2K40 A;  4CYD A;  4UVA A;  1VQO I;  4HF2 A;  5E17 F;  2P0W A;  2HYG D;  3HSR A;  3NWT A;  3D5L A;  3T0Y A;  1WSU A;  3M3Y J;  1IDZ A;  4Y3O A;  1ZGJ A;  5C4J J;  4IZZ A;  1IUF A;  3OWT A;  1A04 A;  1A36 A;  2UWM A;  3FBI B;  3SZP A;  3QWL A;  2V7F A;  1NK3 P;  4HX7 A;  1MMG A;  1V5G A;  2WY7 Q;  4NNJ A;  2G0E A;  2KJC A;  3FIS A;  1HBX G;  2RNJ A;  2FML A;  2ELH A;  4PUS A;  4IQJ A;  4M6Y A;  2LLK A;  1E3O C;  2MH2 A;  1YIT I;  2CUJ A;  1ETV A;  4FE4 A;  1JTX A;  3FMR A;  5ILU A;  4UV8 A;  1ETQ A;  4AM3 A;  3BG7 A;  2BBY A;  1FY7 A;  2B9S A;  2KPM A;  2LKP A;  2OPT A;  3EUK L;  3X2Q H;  3V8L A;  4P9U A;  2M2E A;  1SAU A;  2DBB A;  3F8N A;  3JSO A;  3W2A A;  4KMF A;  1FSH A;  4KUM A;  4XLC A;  2DOF A;  3LMM A;  1QPI A;  1HF0 A;  1JKQ C;  3MEX A;  1VZ0 A;  1XCB A;  3UNG C;  2DFH A;  1FBQ A;  1Z7L A;  2NVQ J;  2WAQ A;  3V8K A;  2M4G A;  1UMQ A;  5F0F A;  2E1M C;  2K5C A;  1HW2 A;  3E6B A;  3TL4 X;  3RZO J;  2FE3 A;  2EFN A;  3F8B A;  5J4Y A;  2K7L A;  2DQL A;  2BXY A;  4RB2 C;  1YO5 C;  3IWF A;  1O4X A;  2LFB A;  1XD7 A;  1E17 A;  1K83 J;  3KZZ A;  1G3S A;  3OS0 A;  1W0U A;  4DOZ A;  1JHH A;  1WJD A;  5GAE J;  2UXN A;  1ZYR F;  1W4M A;  2VOD A;  3IH4 A;  1NH3 A;  4PSW A;  5DTD A;  1VQ6 I;  1P7I A;  2DT5 A;  5FLX Z;  5ERI A;  4C2T A;  2IBD A;  1YW7 A;  4PJM A;  1NHA A;  2VJ4 A;  2A5Y B;  3H3Z A;  5E18 F;  2CU7 A;  3G2B A;  1PVE A;  3HBL A;  2YU3 A;  2FQ3 A;  1QVU A;  2PG4 A;  4YEL A;  2IS6 A;  1ETO A;  1WGX A;  2PN6 A;  3L00 A;  1E0E A;  2VKH A;  4L0Y B;  2WBM A;  4MHG A;  4I98 B;  2E1M B;  4CCK A;  3OYI A;  3C18 A;  2RRE A;  2V1U A;  3F6O A;  2HPI A;  2M5W A;  4QIW N;  3BRO A;  4XQF A;  3J80 K;  1A31 A;  1I1G A;  1SEU A;  5B1A H;  5DM6 F;  4FAS D;  2QEN A;  3F23 A;  1X58 A;  1D5Y A;  5FKK A;  2M1B A;  4M9X A;  3O2P E;  5FRO A;  3SYT A;  2QKM B;  3R4K A;  4HNT A;  1RI7 A;  1RPW A;  1LDJ A;  4HLX A;  3BTJ A;  2AHQ A;  4GRI A;  2WWY A;  2HS5 A;  3HUG B;  2R7Z J;  3KLO A;  3CCM I;  4HLY A;  4RM3 A;  3Q0V A;  4X0G A;  3CCE I;  3B6A A;  2L7K A;  4BXF A;  2OD5 A;  2ID6 A;  4UV9 A;  3I3L A;  1JXS A;  3HM5 A;  1QO0 D;  4L5E A;  2VOP A; 
#chains in the Genus database with same CATH homology
 3LA7 A;  1TTY A;  1TNT A;  2HYF A;  1QNT A;  1BI1 A;  3HTU A;  3F6V A;  3SFZ A;  1L3L A;  2DPD A;  1BI3 A;  1WWX A;  2XUB A;  4UVC A;  3R6S A;  1SFU A;  5LGN A;  2EV6 A;  4GGG A;  1ZG5 A;  4PCQ A;  4HF1 A;  3MZY A;  2W24 A;  4I02 A;  1GVJ A;  3WGH A;  2LNB A;  4I7H A;  1R1T A;  3M8F A;  4KNY A;  1J2X A;  1FBS A;  3I64 A;  5ICG A;  4IRI A;  2TDX A;  4U88 A;  2NS0 A;  2Z5U A;  5LEJ A;  1KYZ A;  2M8E A;  2VC0 A;  3AAF A;  2GXG A;  1S7O A;  2E7X A;  3WTS C;  2RVC A;  1IRG A;  1Y0U A;  2JRT A;  4MTE A;  4CO8 A;  4HF0 A;  2HQR A;  4LLN A;  4WK8 F;  2FU4 A;  3Q9S A;  1P4X A;  5L3F A;  5FFX A;  3D0S A;  2OU2 A;  4ZYE A;  2NRA C;  5H6R A;  2FXA A;  5J8C A;  2CSO A;  4HAM A;  2RDP A;  1PP8 F;  1ZN2 A;  3U2R A;  3HUG A;  1Q1H A;  1J9I A;  2XAJ A;  3CUQ C;  2W57 A;  3BPX A;  3IKV A;  4LMY A;  4OIO F;  3RKX A;  1MJA A;  4CXF A;  1LQ1 A;  3O3K A;  4OMZ A;  1BBY A;  2YSR A;  1X3U A;  5L3B A;  5AIQ A;  4MEY F;  2ZXJ A;  2VBZ A;  2CFX A;  3F8C A;  5CVU A;  1SMY F;  5CYV A;  2G7U A;  3ZMD A;  3QPT A;  1ZRC A;  2Y48 A;  2EB7 A;  1D5V A;  4EVI A;  4HX4 A;  3V4G A;  3CUQ B;  3FXU A;  3WTX C;  5CVI A;  2FOK A;  1XGN A;  3C7J A;  4IHT A;  3EDP A;  2DAO A;  1ZAR A;  3ULQ B;  1ON1 A;  4ENK A;  2P5L C;  4YIF A;  1E2X A;  2L54 A;  1O7L A;  3MWM A;  3K1M A;  3ZP5 A;  3HHG A;  4FHT A;  1KU9 A;  4RS8 A;  4ESF A;  1RUO A;  4IHS A;  1ZRE A;  3C3W A;  5DDG A;  2OBP A;  1Z9C A;  3GFI A;  2QBY B;  4G6D A;  5D5U B;  4BHP A;  3E6M A;  2QM3 A;  1IN4 A;  2LDU A;  3N97 A;  4N0B A;  4A6D A;  1BI2 A;  5FFZ A;  4D0P A;  1V4R A;  1U3E M;  1GXQ A;  5E1W A;  1TW3 A;  2E1N A;  3CO7 C;  3E5X A;  3DFG A;  4EQQ A;  2VC1 A;  4RB0 A;  2Q0O A;  3F8F A;  1T0F A;  4P55 A;  1ZRF A;  3SHF A;  1J7K A;  3I71 A;  2KIM A;  2CWE A;  4OU0 A;  5DCF A;  1R5G A;  4QLC U;  2DO7 A;  3LAP A;  2YR2 A;  2CYY A;  5E8I A;  2JSC A;  4KYW A;  4WXH A;  4XSX F;  2Z3Y A;  1T38 A;  1LEA A;  4A5N A;  1S6L A;  3J81 Z;  1HW1 A;  1EH6 A;  1YW8 A;  2V1X A;  3VB2 A;  5HDG A;  2ISZ A;  3REO A;  4G9Y A;  2WC2 A;  4ESJ A;  1HST A;  2KJB A;  3L7W A;  1TQI A;  3EYY A;  4FT8 A;  4U7B A;  1HKS A;  2OZ6 A;  4A0Y A;  5TJJ A;  4A2U A;  1AOY A;  1D3Y A;  2HTS A;  3CUQ A;  3WGG A;  4OOI A;  1FLI A;  3PFI A;  4B8X A;  2VXZ A;  3M8E A;  2JZY A;  5DD8 A;  3Q9V A;  1DP7 P;  5HLI A;  1EH8 A;  1G3T A;  4KIB A;  1FP2 A;  3E3V A;  1IN8 A;  3BJO A;  4M9Z A;  4Y13 A;  2F5F A;  4YFX F;  2RKH A;  4KT5 C;  3NRV A;  4IPA A;  2QBY A;  1PDN C;  3DV8 A;  1H9G A;  3I0T A;  2VON A;  2GA2 A;  2V1D A;  1IXR C;  4EGY A;  3BJ6 A;  5ED4 A;  1FWZ A;  2Z33 A;  2GXB A;  1HQC A;  1KQ0 A;  5LEK A;  1XDS A;  4HV6 A;  3BZ6 A;  4CZZ A;  1T39 A;  4EJV A;  2OZU A;  2HWV A;  3ABT A;  4HDV A;  1EV7 A;  3K1N A;  3MAJ A;  4HDU A;  1QZZ A;  1IRF A;  1Z7U A;  4KMU X;  5A2Q Z;  3TOA A;  3S2W A;  4RB3 C;  1R7J A;  4S05 A;  2XAS A;  1VTN C;  3QAH A;  2VN2 A;  4N9H A;  3O6B B;  1K7A A;  3HRT A;  2RGV A;  4M74 A;  5BPI A;  1Z1D A;  3KP3 A;  2D45 A;  4MEX F;  3BJA A;  1S8N A;  1CGP A;  4M72 A;  4ZZL A;  2QUF A;  1RZ4 A;  3ZMS A;  1LJ9 A;  4XLP F;  3F22 A;  2R3S A;  2FBI A;  1SFX A;  2ACJ A;  3WOD F;  1STZ A;  3MCZ A;  1Z6T A;  3WTT C;  1MJB A;  3P7N A;  1T6S A;  1GXP A;  2KRF A;  1BIA A;  4KN7 X;  1WQ2 A;  1U5T B;  1OMI A;  1R58 A;  5BMZ A;  1P4A A;  4BHC A;  3ZMT A;  3KCC A;  5K5R A;  4JBA A;  1REP C;  3R61 A;  2CG4 A;  2ETH A;  1ZGA A;  3KP7 A;  2XKO A;  2MBF A;  4WX9 A;  1G6N A;  1K79 A;  5IT9 Z;  3GFJ A;  3K1P A;  3KP5 A;  2K27 A;  3CO6 C;  5D8L B;  2MH9 A;  3TDZ C;  3JTG A;  1ZG1 A;  1HW5 A;  1KA8 A;  1R5H A;  1KU3 A;  3ML6 A;  4U0Y A;  1PUE E;  3CLO A;  2EA4 A;  4A5M A;  3WE2 A;  4LK1 F;  3ISP A;  2O61 A;  1H9T A;  5DYM A;  3RDI A;  3ZQ7 A;  1UHW A;  2GAU A;  1XGM A;  5JI6 A;  4ENM A;  4MQ9 F;  1B1B A;  1QQI A;  3WU1 B;  3R0J A;  3GWZ A;  1YYV A;  2GZW A;  2IA0 A;  3GFL A;  4ZYD A;  3W6J B;  2BEO A;  1P6R A;  1XB4 A;  4LK0 F;  3E5U A;  1R23 A;  1U2W A;  5LBQ A;  1B9N A;  2IVM A;  4EM2 A;  3GXO A;  3K69 A;  1SMT A;  2BV6 A;  2G9W A;  3I53 A;  3R60 A;  3JW4 A;  2OQR A;  4G8X A;  2PJP A;  2YX4 A;  1QZY A;  3I5U A;  5LGU A;  2L4A A;  4G7Z F;  4U0V A;  2PEX A;  5D8K B;  1KQ9 A;  2Q2E A;  2O3F A;  1F5T A;  1J5Y A;  2WTE A;  4O3M A;  2DLL A;  1MKM A;  4XSZ F;  1U5T A;  4HOB A;  4UXN A;  4ETS A;  5FGM A;  2CW0 F;  1SD5 A;  2XAF A;  4HA8 A;  2UXX A;  3RKW A;  1P2F A;  4XRF A;  2P7V B;  3WTY C;  4PZJ A;  3ZPL A;  3SZT A;  3M7G A;  1BJA A;  4YFK F;  1F1Z A;  3KEO A;  5BS6 A;  4HBL A;  1SD7 A;  2A69 F;  3BDD A;  1IF1 A;  1O7F A;  3TDU C;  1MJ9 A;  2H94 A;  3IL2 A;  4XLN F;  5D6F A;  2GIV A;  1B59 A;  5D4S A;  2FMY A;  2XRN A;  3M1E A;  3KP6 A;  3RIR A;  3W6K B;  1K6O A;  3KFW X;  1LDD A;  4N9I A;  1TQM A;  4YII A;  1S7A A;  2D1V A;  1D8J A;  2KIF A;  2ZBK A;  4WWC A;  5IT3 A;  1QGP A;  2DU9 A;  1XSX A;  3DPT A;  1ONV A;  5HVQ C;  4NHJ A;  4UHT A;  4FX4 A;  4RGX A;  3TKY A;  3K0L A;  1IN7 A;  2H6C A;  2O8X A;  2W84 A;  4ENN A;  4PGH A;  1J75 A;  3GW2 A;  1QPM A;  3QP5 A;  3DP7 A;  2MD5 A;  2BGC A;  1R22 A;  2K86 A;  3RKY A;  5DEQ A;  2H09 A;  2D1H A;  4UNO A;  4I0A A;  3SQN A;  5E20 A;  4ENJ A;  1FNN A;  4EM1 A;  4EGZ A;  2JTV A;  2E7W A;  3T8T A;  2HGC A;  2EWN A;  1B9M A;  2XVC A;  3BOQ A;  2DPU A;  4BAY A;  1IN6 A;  3ZMZ A;  1DUX C;  3EET A;  3T8R A;  4KIC A;  4YG2 F;  4OIR F;  3IWZ A;  3RI4 A;  3KEQ A;  1AWC A;  5BQT A;  4HQE A;  1YW9 A;  3DKW A;  3BPV A;  4IJA A;  2A6H F;  3HSF A;  3NEU A;  2K02 A;  1YG2 A;  1I27 A;  4BHB A;  1R36 A;  3J80 Z;  1OYW A;  2E1C A;  5LRR A;  2F5E A;  5HOO A;  5AIP A;  4EV0 A;  4Y15 A;  4EJO A;  3E97 A;  2QQA A;  2O03 A;  4KFC A;  4I2O A;  2PLY A;  3CUO A;  1KGS A;  2AXL A;  1DPU A;  2W85 A;  4IF4 A;  3FHZ A;  3SXY A;  4Z2Y A;  1F4K A;  2Z99 A;  2ZO4 A;  2HTJ A;  3WE3 A;  2FF4 A;  2UZK A;  3QRF F;  4L9V A;  4PDK A;  5J8F A;  1UST A;  1UHM A;  2COM A;  3IRQ A;  2ZNZ A;  4G94 A;  2Y75 A;  1XDU A;  2XHK A;  1RNL A;  4LFU A;  5AON A;  1EH7 A;  3GX4 X;  2V9V A;  4B09 A;  5CVJ A;  1USS A;  2XGX A;  3GUD A;  2EV5 A;  3QP6 A;  2PMU A;  5L3G A;  1O3T A;  1XGS A;  3JAM K;  2LF7 A;  5KVR A;  4IRH A;  3VEP A;  1SAX A;  2HKX A;  2QVO A;  3T1B A;  2OA4 A;  2EV0 A;  4OIQ F;  3P9K A;  2O6G E;  3VFZ A;  1TQP A;  3FF5 A;  1I6X A;  3G73 A;  2KKO A;  2VOO A;  2STW A;  4L9T A;  3FX3 A;  2XIG A;  3ABU A;  2EFW A;  6PAX A;  5K1Y A;  1F9N A;  3QU3 A;  1FYK A;  4RAZ A;  3KP4 A;  2YX7 A;  3WTW C;  1O3R A;  1CF7 B;  2HQN A;  4HW0 A;  3NQO A;  2ZJ2 A;  1TNS A;  2HDC A;  4ON0 A;  4PGG A;  3HSE A;  3QPH A;  5ICE A;  4LB5 A;  4LJZ F;  2PBI A;  1KU7 A;  5DCM B;  5DUK A;  3KZY A;  3P9I A;  2H6B A;  4Q5S F;  2QYO A;  3EUH A;  3PQJ A;  3RPU A;  4DNC A;  5LHG A;  2GA1 A;  5DV5 A;  1RUN A;  2BYV E;  3P9C A;  4G7H F;  2QZ8 A;  2IW5 A;  3H92 A;  4OIN F;  5H6Q A;  1IN5 A;  4WCG A;  1WRJ A;  1TBX A;  4S04 A;  1G3W A;  4AIJ A;  3N4M A;  2ZCW A;  1W7P B;  1XGO A;  5FLX K;  3VOE A;  5J6X A;  3FMS A;  2Y0M A;  5FD5 A;  3IRR A;  4A6E A;  4JK1 X;  4GYG A;  1ON2 A;  3ERE D;  5L3D A;  3WG9 A;  2OQG A;  3DF8 A;  1YLF A;  2HOE A;  2XAH A;  3GFM A;  3HRU A;  5JHU A;  3ELK A;  4R1H A;  1LEB A;  4IRG A;  3IHU A;  5FD6 A;  2IP2 A;  4I01 A;  3V8J A;  3LQQ A;  5LLQ A;  1FX7 A;  1FYM A;  2MLK A;  2L3D A;  2ESH A;  4AD9 A;  4CGZ A;  4O6J A;  4UUV A;  4GCV A;  4ZYG A;  5ILS A;  3E6C C;  4GXO A;  4M9S A;  4A12 A;  1U8R A;  2ZNY A;  3Q5F A;  1O57 A;  1LVA A;  4BXU A;  3WTZ A;  2HR3 A;  1YTY A;  1LB2 A;  1CF7 A;  4LG0 B;  1J59 A;  2K4J A;  5ILV A;  3EQL F;  1Z05 A;  1WKM A;  4HQM A;  1BC7 C;  5EEH A;  1T2K A;  2L4M A;  1FZP B;  4OMY A;  3L2C A;  4G7O F;  3L9F A;  1HSJ A;  5E1Z B;  2EK5 A;  2FSW A;  1LNW A;  1PP7 U;  3VOD A;  4WXC A;  3HIF A;  5DCM A;  3R0A A;  5EEG A;  3M9A A;  2GWR A;  4KIG A;  4CHU A;  1XCV A;  1TLH B;  2V6C A;  1B6A A;  5K5O A;  5JFR A;  3HTS B;  3PQK A;  4M71 A;  3ZMV A;  1BC8 C;  1U6G A;  1ZRD A;  4R79 A;  1W7P A;  1FOK A;  3DQV C;  1SD4 A;  5CLS A;  3K9T A;  4RGU A;  1YQA A;  4KIF A;  4RGR A;  5D4R A;  1H0M A;  1YFH A;  3V7S A;  2W25 A;  4EM0 B;  4HV5 A;  2HZT A;  3V7R A;  4EJT A;  1W5S A;  2FEZ A;  1XSV A;  5TRD A;  1YS7 A;  2PFB A;  2IRF G;  3JSP A;  2A3S A;  2L02 A;  4P96 A;  1S29 A;  2Z9O A;  2G7H A;  4AVP A;  3JTH A;  2NAZ A;  1MGT A;  4IXA A;  1MZB A;  5HDK A;  1ZHF A;  5JVT A;  2FA5 A;  5CVV A;  2RC4 A;  3WTU C;  1SD6 A;  3I54 A;  3IC7 A;  4LB6 B;  2OAZ A;  1BI0 A;  3G3Z A;  5KK1 A;  3F21 A;  3E6D A;  4ZYH A;  3T5X A;  3KET A;  5L3E A;  1TW2 A;  4QWQ A;  1DPR A;  4L9N A;  5D5V B;  3WGI A;  4ZZD A;  3QOP A;  3TQN A;  5LRS A;  3HOS A;  4GYI A;  1I5Z A;  2P8T A;  1K78 B;  2J5P A;  4LG0 A;  5BOX A;  5F6F A;  3KP2 A;  4Q4Z F;  3MZH A;  5BPD A;  3GYH X;  4U0W A;  2VBX A;  1LDK B;  5DUI A;  3LWF A;  3CDH A;  3GEZ A;  2DK8 A;  2F5C A;  4MNU A;  1OYI A;  2ADU A;  2ZME B;  4K2E A;  2X4H A;  3I59 B;  4HZF A;  2HEO A;  5FB2 A;  1Z91 A;  2K4B A;  4R8H A;  4RAY A;  1D8K A;  2EJR A;  3GF2 A;  2QLZ A;  2QQB A;  1OYY A;  2O0Y A;  1W5T A;  1G4D A;  3MFK A;  2VBY A;  3ECH A;  2A07 F;  1OR7 A;  4RGS A;  5LHI A;  2BE5 F;  2RV8 A;  4Q48 A;  1O3S A;  2XKP A;  2FRH A;  4LLL A;  5L3C A;  2FBK A;  1I1S A;  3B73 A;  2NYX A;  1HKT A;  5K5Q A;  1Z6R A;  2EFP A;  3FM5 A;  3DXJ F;  3FWE A;  4EMS A;  4EJU A;  4CIC A;  3KE2 A;  4P9F A;  5D5X B;  2ISY A;  5HLH A;  4BH9 A;  3GZ6 A;  1C0W A;  3F3X A;  4BYY A;  3FXR A;  2FNA A;  1OKR A;  3HOT A;  1ZAO A;  2C6Y A;  1KU2 A;  2DW4 A;  2FNP A;  4KN4 X;  2P4W A;  5LGT A;  1OPC A;  3LA3 A;  1KQ8 A;  4NB5 A;  3BP8 A;  5ICC A;  1JHF A;  1S3J A;  2WV0 A;  2P5K A;  2JPB A;  5HS7 A;  3J81 K;  3EYI A;  1K78 A;  1JGS A;  4L5I A;  3LST A;  5JR3 A;  1DDN A;  3HRM A;  3ZN1 A;  2M30 A;  4Q47 A;  1T98 A;  2R7F A;  4KDP A;  4EJW A;  2ZME A;  3MQ0 A;  3I4P A;  2J5O A;  3I59 A;  4F7Z A;  3B02 A;  1FC3 A;  2VE9 A;  3TGN A;  2V79 A;  2IA1 A;  5HDN A;  4HYE A;  2DI3 A;  1MD0 A;  2B0L A;  4BNC A;  2RQP A;  5D5W B;  1BM9 A;  4NQW A;  2R7D A;  4E70 A;  1V3F A;  1UFM A;  4ZH4 F;  4RB1 A;  4L9J A;  4L0Z B;  1L0O C;  1O3Q A;  3F72 A;  5FO5 A;  2EFQ A;  5D6E A;  3LQR A;  4G6Q A;  2DFI A;  3LFK A;  3BY6 A;  4LLG F;  1FPQ A;  2IPQ X;  2A68 F;  2AS5 F;  4ESB A;  2JPC A;  3J7A O;  2F5D A;  3H3U A;  3ZMU A;  4MTD A;  4MQV A;  2L01 A;  3IKT A;  4KA4 A;  2YPR A;  3OV8 A;  1FSE A;  1IUY A;  1QBJ A;  1YS6 A;  1J0R A;  5CJ9 A;  5CVR A;  3LAJ A;  2STT A;  3TO7 A;  3E5Q A;  3F8M A;  1XN7 A;  2MA3 A;  4GO1 A;  3BWG A;  4DQ2 A;  5HS8 A;  3GO5 A;  2MLG A;  5E8G A;  4WF2 A;  1U78 A;  4IVN A;  1FBU A;  5A2Q K;  4LD5 A;  1WI9 A;  4Y17 A;  1IW7 F;  1B4A A;  2QWW A;  2IT0 A;  3TOB A;  2LSO A;  2GQQ A;  1R1U A;  3U9G A;  2Q8K A;  2CQK A;  3GVA A;  4I09 A;  3DPL C;  1XMA A;  5LHH A;  5F1R A;  2M87 A;  3K2Z A;  2PI0 A;  2ESN A;  4AIH A;  4UVB A;  1P92 A;  4AWX B;  2X0L A;  4LGW A;  3RJP A;  2IJL A;  2MC3 A;  1UCR A;  1IXC A;  4L18 B;  1ZLK A;  5E1X A;  4YFN F;  3CTA A;  1ZH5 A;  4CDG A;  1MDM B;  2NNN A;  3QU6 A;  2RN7 A;  2VE8 A;  2P5V A;  1W7P D;  1GHC A;  2P6T A;  2A61 A;  2PQ8 A;  5HLG A;  5IT9 K;  2CO5 A;  4OIP F;  1KYW A;  4M6X A;  3C1D A;  2A6E F;  1YIO A;  3HHH A;  3GZ5 A;  4AIK A;  1RIO H;  3RYP A;  2M45 A;  2HFH A;  3ZN0 A;  2ZFW A;  4H0E A;  3FMQ A;  4ASN A;  4I0B A;  3FZV A;  3LA2 A;  2HKO A;  2VT3 A;  5F64 A;  2EFO A;  3U1D A;  1FT9 A;  2F2E A;  3TO9 A;  4JQF A;  1BIB A;  1FYL A;  5H20 A;  4HX8 A;  1SFE A;  3HYI A;  1P4W A;  1ULY A;  2XV4 S;  3WU0 A;  3TO6 A;  2XAG A;  4FX0 A;  3FM3 A;  3FXQ A;  1IXS B;  4P5O A;  2XRO A;  4U7D A;  3RYR A;  2P6S A;  2KIU A;  1ZG3 A;  1R1V A;  2LF8 A;  2ZKZ A;  2QQ9 A;  2IA2 A;  2VBW A;  1UB9 A;  2NNY A;  4A0Z A;  2D2W A;  2DK5 A;  1XSD A;  2DTR A;  3WTV C;  3CJN A;  3RTR A;  3HRS A;  3I58 A;  4TV7 A;  5DD4 A;  1BN5 A;  2DQR A;  3ECO A;  1MDM A;  1IZ1 A;  2VT2 A;  4XBF A;  2CGP A;  3ROU A;  2FBH A;  3GLX A;  3KLN A;  2XAQ A;  1ODD A;  1JE8 A;  1HXD A;  4BQA A;  1U5T C;  3COA C;  2P7C B;  4L5J A;  2JT1 A;  3JAM Z;  4O5V A;  3L09 A;  1BOA A;  2PMH A;  2EA2 A;  1G3Y A;  5HS9 A;  3DEU A;  3OOP A;  4WXD A;  1R00 A;  1XMK A;  1IAW A;  3V7C A;  4M73 A;  4MGR A;  3RPQ A;  5ICF A;  4A0X A;  2H27 A;  1FP1 D;  1HKQ A;  1ZLJ A;  4CYD A;  4UVA A;  4HF2 A;  5E17 F;  2HYG D;  3HSR A;  3D5L A;  3T0Y A;  1WSU A;  1ZGJ A;  2UWM A;  1A04 A;  3SZP A;  4HX7 A;  2KJC A;  1HBX G;  2RNJ A;  2FML A;  2ELH A;  4M6Y A;  2MH2 A;  3FMR A;  5ILU A;  4UV8 A;  2BBY A;  1FY7 A;  2LKP A;  3V8L A;  4P9U A;  2DBB A;  3F8N A;  3JSO A;  4KMF A;  1FSH A;  4KUM A;  3MEX A;  1XCB A;  1FBQ A;  3V8K A;  1HW2 A;  3E6B A;  2FE3 A;  2EFN A;  3F8B A;  2K7L A;  2DQL A;  4RB2 C;  1YO5 C;  3IWF A;  1XD7 A;  1E17 A;  3KZZ A;  1G3S A;  1JHH A;  2UXN A;  1ZYR F;  1W4M A;  2VOD A;  2DT5 A;  5FLX Z;  5ERI A;  1YW7 A;  1NHA A;  2A5Y B;  3H3Z A;  5E18 F;  2YU3 A;  2FQ3 A;  2PG4 A;  2PN6 A;  3L00 A;  4L0Y B;  4MHG A;  4I98 B;  3C18 A;  2V1U A;  3F6O A;  2M5W A;  3BRO A;  3J80 K;  1I1G A;  2QEN A;  3F23 A;  2M1B A;  4M9X A;  3O2P E;  3R4K A;  1RI7 A;  1LDJ A;  4HLX A;  2WWY A;  2HS5 A;  3KLO A;  4HLY A;  2OD5 A;  4UV9 A;  1JXS A;  1QO0 D;  2VOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...