3CUQA

Integrated structural and functional model of the human escrt-ii complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
219
structure length
219
Chain Sequence
AQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
total genus 60
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA03
1FBSA 2UZKA 3ECHA 1XSXA 1WQ2A 3HTUA 1DPRA 1O3SA 1TTYA 3J80K 3LQQA 4A5MA 2RV8A 3E5QA 4R8HA 5ICEA 1BJAA 4F7ZA 2XKPA 4RS8A 5E18F 4EGZA 2D45A 3PFIA 2IP2A 3J81K 5AIPA 3S2WA 1J7KA 2PG4A 3KZYA 4LB6B 2GIVA 1NHAA 3I54A 1TW3A 3MFKA 4HDUA 1HSJA 1BI3A 4M9XA 1P4WA 4HZFA 3FX3A 1R58A 2AXLA 4ENKA 4KUMA 4XSXF 3LQRA 1SD7A 3ZN1A 1XDSA 4A0ZA 3WTWC 2GXGA 4HW0A 1X3UA 3MZHA 3CLOA 2KJCA 3P7NA 4GCVA 5K5RA 1K78A 4EGYA 1FZPB 2A69F 5JHUA 2EV5A 5D8LB 4IHSA 5EEGA 4XRFA 1ONVA 2A6EF 2CGPA 2DLLA 2VOOA 4MHGA 1QNTA 2B0LA 2RGVA 1VTNC 5D5XB 1W4MA 2VBZA 4M9ZA 4N9IA 2XIGA 2PQ8A 2BV6A 3CUQB 1QZYA 3MEXA 2IA0A 4HX8A 1GHCA 1GVJA 1PUEE 2JT1A 4M6XA 2NS0A 4E70A 4HLXA 3LA3A 1MJBA 1LJ9A 4LK0F 2EFPA 5E17F 4HX4A 4O3MA 1B9NA 4KIFA 2PLYA 4OMZA 3WG9A 5D4RA 5F6FA 1O7FA 2VE9A 2JTVA 1T0FA 3HYIA 1Z91A 4ETSA 2IA1A 4FX0A 2XAFA 1Y0UA 3T8RA 3ZMUA 5BOXA 1FYKA 3VFZA 5BMZA 1R5GA 2H94A 6PAXA 4JQFA 5HS9A 5FD6A 4ZZLA 4A5NA 1XDUA 2DTRA 2RN7A 1QBJA 2NNNA 3K1PA 4Y13A 1K79A 1P2FA 5L3DA 3KETA 2QQAA 1RI7A 3HOTA 3ROUA 2H6BA 1MZBA 4XLNF 4G7ZF 3TQNA 2F5EA 2L01A 1U3EM 3K1NA 1MD0A 1YS6A 2HFHA 5HLHA 4BQAA 3BPXA 1USTA 2DO7A 4L9NA 3KE2A 4KN7X 4OIRF 3Q9VA 1XD7A 3AAFA 2K27A 3V4GA 1LEBA 1WI9A 2VBYA 1YFHA 3WODF 5D5VB 3FMRA 1H0MA 1JHFA 4LG0B 2HS5A 4YFNF 2IVMA 3RKYA 2PJPA 2KIMA 5TRDA 3F3XA 5ERIA 2IW5A 4Q4ZF 4U7BA 1IN5A 3EDPA 2BYVE 1Z1DA 1J5YA 2WC2A 3VEPA 1YQAA 3WTTC 3E6MA 1SMTA 4O6JA 3L7WA 2Q2EA 2Z99A 5E8IA 2HDCA 2L02A 3RYPA 1ZLJA 5JVTA 2HEOA 3J7AO 2FNPA 3CUOA 4EJWA 3RDIA 2R7FA 4IRHA 4G6DA 5K5OA 2W24A 4NHJA 1TBXA 2JSCA 2Z33A 2HZTA 2FA5A 2VC0A 2M87A 2X4HA 4M71A 4IPAA 4CYDA 3COAC 5E1ZB 3KEQA 2RNJA 3E5UA 4UV9A 1KYZA 1IZ1A 3KLOA 2FQ3A 2FBIA 3P9KA 2ISZA 4KT5C 3B73A 3ZQ7A 1J75A 1FX7A 2J5OA 1XN7A 1SAXA 2ELHA 1J9IA 1WRJA 2UXXA 3LA7A 3EYYA 3R6SA 3BDDA 3HRSA 3JSPA 2BBYA 2F5FA 1JHHA 2QVOA 1HKSA 2DQRA 2HQRA 4LJZF 4WCGA 3U2RA 1YLFA 1TW2A 1HXDA 1BIAA 3KCCA 4RB2C 2XAGA 2DQLA 3O6BB 4EV0A 4EM0B 3FXUA 4LLLA 3DXJF 4YFXF 4G6QA 5DUKA 2AS5F 1FC3A 1O3RA 2P4WA 5FGMA 1ZG1A 4KN4X 2P8TA 3MZYA 4RGSA 2OQGA 5LGUA 4RB3C 1ZGJA 1G3TA 5DDGA 2CWEA 2VE8A 5DEQA 1O3TA 1S29A 1T38A 3I64A 1LEAA 1RNLA 1U6GA 2PBIA 1MJ9A 3V7CA 3J80Z 4Q48A 2H09A 5ED4A 4YFKF 4IRGA 4OIPF 4HF2A 3QAHA 4U0YA 5DUIA 4HBLA 1FBUA 3WTZA 2XAJA 4M6YA 3KP5A 2A5YB 4IJAA 3LWFA 3OOPA 1WSUA 1YW7A 4A2UA 1LQ1A 1ZGAA 4RGRA 1F4KA 2IJLA 3I53A 4BAYA 3GWZA 5ILSA 3VODA 1E17A 2P5VA 4OOIA 2FSWA 1P4AA 3Q5FA 2P7VB 3LAPA 3LAJA 2QQ9A 1BC8C 2OD5A 1AOYA 1B59A 1OYYA 3R0AA 4GGGA 2HR3A 3L09A 4L9VA 3DV8A 4HOBA 2V9VA 2VT2A 4RAZA 1S7OA 2OU2A 3W6JB 4CGZA 4IVNA 4HA8A 4WX9A 4KYWA 2P6SA 2NRAC 3MQ0A 1KU9A 1I27A 5LGNA 2IPQX 3WGHA 3GYHX 4BXUA 2HKXA 4MQVA 1E2XA 5A2QZ 2HYFA 2M5WA 4HQEA 2Q0OA 1ZLKA 5CVUA 4LLNA 2FXAA 4LK1F 3D0SA 4LLGF 5DCFA 3RKXA 1G3SA 2QWWA 1K6OA 4WXCA 1Q1HA 1FLIA 2YSRA 5CVJA 3V7RA 1TQIA 2STTA 2XROA 1ZH5A 1OR7A 1Z7UA 1D5VA 4OINF 3RIRA 5E20A 4L0YB 2XKOA 1MDMB 3GXOA 2RVCA 2DBBA 2E1NA 2MBFA 4U0WA 2MC3A 5CLSA 1I6XA 3LSTA 2D2WA 2FMLA 2W25A 4CDGA 3BJAA 1FBQA 1KU7A 3FXQA 1AWCA 4OIOF 1I1SA 2Z9OA 4FT8A 3M8EA 3TOBA 3B02A 1ZYRF 3P9IA 1SD6A 1S7AA 3ZMTA 4ZYGA 3GZ6A 2E1CA 5LHGA 1UHWA 5HOOA 4KDPA 3K0LA 2EFQA 5ILUA 2D1HA 3GW2A 1KU2A 3WTYC 4QLCU 4YIFA 2FF4A 2COMA 4XSZF 1YG2A 4Y15A 3M8FA 2ESNA 5K1YA 3F6VA 5CVRA 2WV0A 4HAMA 3GLXA 1SD5A 3ZPLA 1IRGA 1RUOA 1T98A 4FX4A 3C1DA 4OU0A 2CW0F 3GFMA 1B1BA 4XBFA 1BI1A 1IXCA 3H3UA 2OZ6A 4HX7A 1LB2A 1KU3A 3ABTA 5JI6A 2KRFA 4YG2F 4RGXA 2NAZA 3TDZC 1HKQA 4L18B 4BYYA 1QQIA 4CHUA 3FMSA 4M73A 5ILVA 3TO9A 5FLXZ 3TO6A 4BHBA 2PEXA 3F8BA 1XGNA 3WU0A 4HV5A 3F8MA 4ZYEA 1R7JA 3FMQA 5DCMB 4S04A 3QPHA 3WTSC 2FMYA 1KQ9A 4UVBA 1ZRCA 4EM2A 2VONA 2LSOA 3BY6A 1L3LA 3MCZA 3SZPA 1TQMA 2CQKA 3IRRA 4IRIA 1MKMA 1ZG5A 3GZ5A 2FBHA 2V1XA 3TO7A 1ODDA 1REPC 3ZMDA 3T1BA 1FPQA 3N4MA 5HS7A 4KIGA 3N97A 2E7WA 2GWRA 3M9AA 1JE8A 5HS8A 1ZRDA 4HF1A 3E3VA 2D1VA 4OIQF 3HTSB 5L3GA 2EV0A 1ZREA 4ZH4F 5L3FA 4XLPF 1BC7C 1SD4A 2RC4A 3ECOA 3WE2A 1IN8A 2YX4A 2K7LA 5L3CA 2EWNA 4ESBA 3WTVC 3C7JA 3SQNA 4AWXB 4L5IA 5L3BA 1FYLA 2QBYB 3T0YA 4G94A 5E1XA 4UHTA 4ZYHA 2HKOA 1PDNC 4N0BA 3L2CA 2QZ8A 4RAYA 4IF4A 2ESHA 2XHKA 3BOQA 4I09A 5FD5A 1LNWA 2XRNA 1IXSB 5H6RA 4A0XA 5LHIA 1SFXA 5J8FA 2LKPA 3V8LA 4I0AA 1RIOH 4PGGA 3P9CA 2K86A 3F8FA 2ZMEB 4MEXF 5ICFA 3TKYA 3KP2A 3CO7C 3ULQB 5D8KB 2Z5UA 4HQMA 1S6LA 3M7GA 4KICA 2Y75A 1S3JA 1G6NA 4AVPA 1G3YA 2ZNZA 3K1MA 3GF2A 5HVQC 3VOEA 4FHTA 4P5OA 2WTEA 1O57A 2VBXA 2A07F 2PMUA 1EH8A 2M8EA 2O8XA 2L4MA 1SFEA 4L9JA 1FT9A 3RYRA 3V8JA 2X0LA 4G9YA 1R1TA 5HDNA 1XSDA 3F8CA 3F6OA 2TDXA 3FWEA 1W5SA 4ENNA 4M72A 5KK1A 3IRQA 1J0RA 5L3EA 2O03A 4N9HA 2LF8A 1LDDA 2ETHA 2HTJA 2QM3A 3I59A 2VBWA 4ENMA 2ISYA 2RQPA 1XSVA 2VXZA 3DFGA 5IT9K 1FWZA 2MD5A 2OZUA 1ON2A 3BJ6A 1MDMA 4B09A 1U2WA 2YX7A 4I02A 4EJOA 1I5ZA 2QBYA 2CG4A 3JAMZ 1HW1A 2VT3A 3WTXC 3K2ZA 2PMHA 2YPRA 3MWMA 3R0JA 3IWFA 3GEZA 3EYIA 1V3FA 2PI0A 1FSHA 4EVIA 3E97A 3G73A 1EV7A 1YW8A 3M1EA 3WTUC 2W57A 3JAMK 1OPCA 2Y48A 3F8NA 2Y0MA 4M74A 5AONA 2FEZA 1R00A 2H6CA 2O0YA 2EA2A 3R61A 3RKWA 2WWYA 3IWZA 1K78B 3ML6A 3SFZA 2L4AA 1IAWA 2LNBA 4WWCA 1QGPA 1H9TA 1P6RA 2F2EA 1F9NA 3BP8A 4ESJA 2OAZA 1O3QA 5D6EA 2NNYA 1IN6A 3BJOA 1KGSA 3QU3A 3V8KA 1IN7A 3I4PA 2CSOA 4PZJA 4A6DA 2VODA 1W7PB 1ZARA 2R7DA 4CO8A 2L3DA 1R1UA 1MGTA 2HYGD 3H3ZA 4I0BA 2EB7A 3HHGA 4Z2YA 2V79A 2ZCWA 3ZMSA 1STZA 2QUFA 3O2PE 1TLHB 4UXNA 1BOAA 3EUHA 3QOPA 1FY7A 1Z05A 1HQCA 1GXQA 1W7PD 3K69A 2OBPA 5LRSA 4IXAA 3REOA 2A6HF 5BPIA 4QWQA 2XASA 5LLQA 2QLZA 3FXRA 4I01A 2ZJ2A 2F5CA 3T5XA 2CFXA 3IKVA 4MQ9F 1OMIA 4DQ2A 2P5LC 1SMYF 5FFZA 4OMYA 1U78A 3PQKA 1DUXC 3MAJA 1UB9A 3LA2A 5F64A 4AD9A 1J59A 3K9TA 3ELKA 1CF7B 3HHHA 5JFRA 4HF0A 2LF7A 1OYIA 3F23A 5DD8A 5FO5A 1Z9CA 1D8KA 5D5UB 1XCVA 2HQNA 4A12A 1UCRA 1IRFA 2A68F 3E6BA 2HOEA 2CYYA 1ON1A 3Q9SA 4HYEA 3GX4X 4L5JA 1YIOA 2XGXA 3BZ6A 1XGMA 2XV4S 2M1BA 3CJNA 2ACJA 3I71A 2GA1A 1T6SA 5DCMA 2CO5A 4S05A 4I7HA 3O3KA 4WK8F 3SZTA 1CF7A 2MH9A 3IHUA 4M9SA 2KJBA 1DPUA 3HUGA 4PCQA 1B6AA 1J2XA 3H92A 4ZYDA 1W5TA 4LB5A 1R5HA 2IT0A 1XB4A 5J8CA 3KP6A 1QPMA 3GFLA 5TJJA 2EFOA 1XCBA 4AIKA 2UXNA 2JRTA 1Z6TA 2IRFG 5EEHA 2P7CB 3WE3A 2JZYA 4HDVA 5AIQA 1LDJA 1D3YA 2XAQA 4HV6A 2A61A 3HRTA 2W85A 3HOSA 5CVIA 1FOKA 4AIJA 1G3WA 5DV5A 3QU6A 1A04A 2ZKZA 2DAOA 1YTYA 2G7UA 1ULYA 2O6GE 3HRMA 5FFXA 1HW2A 3QP6A 1DDNA 4UVCA 1W7PA 4RGUA 1FP1D 4GXOA 5KVRA 4GO1A 3JW4A 2PFBA 3QPTA 3GFIA 4ON0A 3CTAA 1R23A 5K5QA 5H20A 3LFKA 2O61A 3DKWA 2GAUA 4NB5A 3HSFA 4KMFA 3C3WA 4Q5SF 3V7SA 3GUDA 1JGSA 5CJ9A 5DYMA 2EJRA 4L9TA 2K4JA 1FNNA 4UV8A 3BPVA 3E6DA 3KEOA 3NRVA 1O7LA 3RPUA 2GQQA 1R22A 2BGCA 1IW7F 2FRHA 5HDGA 5HDKA 5LEJA 3R60A 2W84A 4BNCA 2C6YA 3U1DA 2UWMA 2RDPA 2Q8KA 4KA4A 2EK5A 1KYWA 4HLYA 5ICCA 5IT9Z 2VOPA 2YR2A 1XGSA 2A3SA 2YU3A 1OYWA 2ZBKA 3E5XA 4UNOA 4U88A 4O5VA 1FSEA 4NQWA 4LGWA 3KP4A 1GXPA 2ZNYA 5IT3A 3I59B 2STWA 4H0EA 2DFIA 3KLNA 1KQ8A 1XGOA 3SHFA 4G7OF 2JPBA 1HSTA 1BBYA 3RJPA 3DQVC 2L54A 5CYVA 4MTDA 2QYOA 2LDUA 2EFWA 5HLGA 4I98B 5CVVA 4BHCA 1S8NA 1XMAA 4A6EA 3QP5A 1IF1A 3ABUA 4LMYA 1U5TB 2ZFWA 3F21A 2KIFA 3CUQA 1YS7A 2DU9A 4ZZDA 3TDUC 4GYGA 3WGGA 5BQTA 1U5TA 4JBAA 2V1DA 4IHTA 2HTSA 4MGRA 5A2QK 4P9UA 1ZAOA 1SFUA 4RB1A 3I5UA 4ENJA 4L0ZB 3RTRA 1ZRFA 2HGCA 3DF8A 4MNUA 2BEOA 1ZHFA 1B4AA 2ADUA 2ZXJA 3F72A 3W6KB 4Q47A 2EFNA 4WXDA 1KQ0A 5BPDA 3DEUA 5LRRA 4KFCA 3IKTA 2ZMEA 2MA3A 2QQBA 1RZ4A 4D0PA 4KNYA 1P4XA 3EETA 3FM3A 4UVAA 4LD5A 2RKHA 5D4SA 3FM5A 2E7XA 1DP7P 2P6TA 4I2OA 3I0TA 4PGHA 3RPQA 4G8XA 2OA4A 3ZMVA 1V4RA 1EH6A 4EJUA 4LFUA 2DPDA 1I1GA 2FOKA 4TV7A 3BROA 1YYVA 3L9FA 2XVCA 4CZZA 4WF2A 2NYXA 1QZZA 2BE5F 2EV6A 5H6QA 4EJVA 3CO6C 3E6CC 2FBKA 4PDKA 3ZN0A 5BS6A 2HWVA 1H9GA 1BI2A 2XUBA 3SXYA 2DT5A 5E1WA 3ISPA 1C0WA 5LHHA 3FZVA 3JTHA 5LGTA 3OV8A 3F22A 4EJTA 4WXHA 3HSEA 1IXRC 1TNSA 4CICA 3TOAA 1B9MA 3U9GA 3GFJA 2KIUA 2O3FA 2MLGA 3ZP5A 1PP7U 2JPCA 3NQOA 1RUNA 1D8JA 4P96A 3WGIA 1U5TC 3RI4A 5LEKA 3HIFA 2FE3A 4KIBA 3KZZA 3DPLC 1CGPA 4A0YA 2H27A 3CUQC 3G3ZA 4RB0A 3DP7A 4DNCA 3L00A 4KMUX 3VB2A 1MJAA 2Z3YA 1BN5A 2VC1A 3ZMZA 3BWGA 1R36A 2G7HA 4P9FA 4R79A 1IUYA 3R4KA 4U7DA 2OQRA 3JTGA 1ZG3A 2J5PA 4EQQA 5DD4A 1YO5C 4MEYF 2V1UA 2K02A 4BH9A 1L0OC 1FYMA 3D5LA 3ERED 3HSRA 3DPTA 2DI3A 1TNTA 2P5KA 3C18A 1BI0A 5JR3A 3IL2A 1FP2A 3T8TA 3WU1B 3QRFF 1UHMA 2KKOA 2ZO4A 4Y17A 2K4BA 3EQLF 3I58A 1BM9A 1T2KA 3JSOA 5F1RA 2DPUA 1WWXA 1HW5A 4BHPA 4ASNA 5LBQA 1ZN2A 5ICGA 1XMKA 2GXBA 1Z6RA 3IC7A 4CXFA 4R1HA 4LG0A 1F1ZA 1U8RA 3FF5A 4JK1X 1BIBA 1IN4A 2FU4A 3KP7A 1YW9A 1K7AA 5D6FA 5D5WB 1EH7A 2M30A 3KP3A 2XAHA 3TGNA 4AIHA 4UUVA 5HLIA 2R3SA 5E8GA 1LVAA 2VN2A 1QO0D 2GZWA 1G4DA 2PN6A 1WKMA 4G7HF 2DK8A 2QENA 2V6CA 1KA8A 2MH2A 1F5TA 3KFWX 4B8XA 2EA4A 1T39A 4MTEA 2MLKA 1P92A 3GO5A 5FLXK 1OKRA 2IA2A 4EM1A 2G9WA 1HBXG 3CDHA 1USSA 1HKTA 2DW4A 5J6XA 1R1VA 1JXSA 2M45A 5FB2A 3HRUA 1LDKB 1TQPA 4EMSA 2DK5A 4K2EA 2GA2A 4ESFA 3FHZA 4P55A 1UFMA 3PQJA 3GVAA 1PP8F 4U0VA 3J81Z 2F5DA 4GYIA 4YIIA 2FNAA 3NEUA
chains in the Genus database with same CATH superfamily
1FBSA 2UZKA 2GM4A 3HOUJ 3ECHA 1YIJI 5F04A 5J40A 1XSXA 4YELA 4FCYA 2LFBA 2H1KA 1WQ2A 3HTUA 1D1AA 4F55A 5IYCJ 2IS6A 5EGOB 1DPRA 1O3SA 1TTYA 3J80K 3LQQA 4A5MA 1HCRA 2RV8A 3E5QA 3HJEA 4R8HA 4RMNA 5TISC 5ICEA 3JRHA 3D5SC 1BJAA 5IYBJ 4F7ZA 2XKPA 4RS8A 5M3FJ 5E18F 4EGZA 3HM5A 2D45A 2JA5J 3PFIA 2IP2A 3J81K 1OCOH 4BBRJ 5AIPA 4OAYA 3S2WA 1T0FC 2LP0A 3OMYA 2XGEA 1J7KA 2PG4A 3CDIA 3KZYA 2Y0SA 4LB6B 1YITI 3PM1A 2GIVA 3RKQA 1SVMA 1UZCA 1NHAA 4DBQA 3Q3SA 2EQRA 3SDGA 2EZKA 3I54A 1TW3A 1D0ZA 3MFKA 4DZJA 2E2IJ 4HDUA 1HSJA 3QPLA 3G2BA 1BI3A 2EIKH 4M9XA 1P4WA 4HZFA 3FX3A 1R58A 2AXLA 3KIOA 4ENKA 3K6GA 5C3EJ 1ENHA 4KUMA 4PJNA 3LQRA 4XSXF 1PYVA 1SD7A 1Y56A 5F08A 2X48A 3ZN1A 1XDSA 3A03A 3KPHA 2WAQN 4A0ZA 2VB6A 1SFOJ 1IRZA 4E6KG 3WTWC 4UUTA 2R7OA 2GXGA 4HW0A 1X3UA 3SEQA 2HVQA 3HZJA 4AVZA 3MZHA 3CLOA 1R5ID 3S32A 1JGGA 2KJCA 3BTIA 3G1LA 1X3WB 1MH3A 1VQMI 2DXIA 3P7NA 4GCVA 2JVHA 4NNJA 4CCNA 5K5RA 1K78A 2KRCA 2ZB9A 3CJRB 4DOZA 4EGYA 5IP6A 1FZPB 4UB6C 1Y0NA 2A69F 5JHUA 2EV5A 1B72B 3S1QJ 3NARA 2O7OA 4BXFA 5D8LB 4IHSA 5EEGA 2HVRA 4XRFA 1ONVA 4HSRA 2A6EF 4AC0A 1PVEA 2RNGA 1YRNA 2CGPA 2HNHA 2X6WA 4M6VA 2DLLA 4PUSA 3A0HC 5HLTA 2R0QC 2VOOA 4MHGA 1QNTA 2B0LA 2RGVA 3SDBA 2E1MC 1VTNC 5D5XB 1W4MA 2VBZA 4M9ZA 4N9IA 2XIGA 4IOCF 2PQ8A 3X2QH 2BV6A 3CUQB 1QZYA 3MEXA 4DIQA 2IA0A 4HX8A 3S16J 1GHCA 1GVJA 1PUEE 2HVSA 2JT1A 4M6XA 2NS0A 4NUBA 4E70A 4HLXA 3LA3A 2R93J 1JUSA 1V54H 4XN3A 3MKLA 1MJBA 3DWLE 3E0JB 3G1MA 3RCOA 1LJ9A 3C2BA 4LK0F 2EFPA 3CZ6A 4HX4A 3SEZA 4O3MA 1B9NA 5E17F 3S3MA 4B48A 4KIFA 4FTHA 2PLYA 2LRDA 4OMZA 3QQAA 2WA0A 3LSKA 3WG9A 5D4RA 3OYKA 4BU2A 2YUSA 5F6FA 1O7FA 2VE9A 2UUZA 2JTVA 4M3EA 2L7FP 1T0FA 3HYIA 1Z91A 1FIAA 3AG2H 3HC7A 4ETSA 5J1YA 2IA1A 4FX0A 1AHDP 1EA3A 2XAFA 5CQGA 2QSHX 1Y0UA 3T8RA 3ZMUA 5BOXA 3W2AA 2DMPA 2LREA 1FYKA 3VFZA 1VQ6I 5BMZA 1RC9A 1R5GA 2QF7A 4V2GA 1BW6A 2H94A 6PAXA 4JQFA 3VWBA 5HS9A 5FD6A 1IG7A 4BEHB 4ZZLA 2F4MB 4A5NA 1XDUA 2DTRA 2RN7A 5FLMJ 2M2EA 2DJIA 2X6YA 4CCJA 3K4KA 1QBJA 1WI3A 2NNNA 4C3JJ 5F1JA 1OISA 3K1PA 4DZPA 4Y13A 3FK7A 1K79A 4BJ5C 1P2FA 5L3DA 4IX7A 3KETA 2QQAA 1RI7A 3IAS2 3HOTA 4YEJA 3ROUA 3PFYA 4MLOA 2COBA 2H6BA 1MZBA 2UV1A 4XLNF 4G7ZF 3TQNA 5H2FC 2F5EA 2L01A 1U3EM 3GTPJ 3K1NA 3CCUI 1MD0A 2CUEA 1YS6A 2HFHA 3IP4B 3JRFA 2R7XA 4N4NB 3A1YA 5HLHA 4BQAA 3SYTA 4A3GJ 3BPXA 2GXAA 3D5RC 1LE8B 1XC5A 1USTA 3AKZA 2DO7A 4L9NA 1HOMA 3KE2A 4KN7X 1ETKA 3LMMA 4OIRF 2XF7A 4ZTFA 3CF5F 4ZDOA 3Q9VA 1XD7A 3AAFA 2W4SA 2K27A 3V4GA 2F48A 2LC2A 1RETA 3QOEA 3OYFA 1LEBA 2LK2A 1WI9A 2VBYA 1YFHA 3CCRI 1NH3A 2VQCA 3WODF 2Y9ZA 5D5VB 3FMRA 3VSKA 1JHFA 1H0MA 4LG0B 2HS5A 2IVMA 4YFNF 2P81A 3RKYA 5HNHA 3CCVI 1W5CC 2PJPA 2BY1A 4XMYA 2DMNA 2KIMA 3ASOH 2FX0A 5TRDA 3F3XA 5GPAA 4H4KC 5ERIA 2IW5A 2LOOA 4A69C 4Q4ZF 1IC8A 4U7BA 1KONA 1IN5A 1U0JA 3EDPA 3OYGA 1NG6A 2XB0X 2BYVE 3GTQJ 1Z1DA 1FTZA 2R5ZA 1J5YA 2WC2A 3VEPA 5GAGJ 1MNDA 1YQAA 3WTTC 1BW5A 2K5CA 3E6MA 1FOYA 3NWSA 4GRIA 2HYJA 1SMTA 4O6JA 2VL8A 4CCLA 3KX2A 3AG1H 3K4CA 3CCLI 4FASD 1IV8A 3L7WA 2HPMA 3G4SI 2Q2EA 2Z99A 3BZCA 5E8IA 4XIDA 2HDCA 3PNTA 2L02A 3RYPA 1ZLJA 1JT6A 4Y4RA 2MABA 5JVTA 2LMDA 2HEOA 3J7AO 2FNPA 3CUOA 4EJWA 3RDIA 2BVLA 1XTAA 2NVUB 2R7FA 4DGWB 2KL4A 4LG3A 4IRHA 4G6DA 3FXLA 5K5OA 3BR2A 4PJMA 2W24A 3NAUA 4NHJA 1TBXA 2JSCA 2Z33A 2HZTA 2FA5A 2VC0A 1GDTA 2Q2EB 3ZOBA 2M87A 2X4HA 4ZJZA 3HKZN 3HOYJ 4M71A 4IPAA 4W97A 3ZQHA 4CYDA 3COAC 3DLLF 5E1ZB 4S0HB 3KEQA 2RNJA 1MNEA 5BNGA 3E5UA 4UV9A 2BY3A 4II2A 2WAEA 1K4SA 5LD2C 1KYZA 2WB1A 1IZ1A 3KLOA 1PJRA 2FQ3A 4RM2A 2FBIA 3P9KA 2D5VA 4LIUA 2ISZA 4KT5C 3B73A 3ZQ7A 4B47A 4BE0A 3W2WA 1J75A 2DDBA 3LSHA 2CV0A 1FX7A 2J5OA 1XN7A 1SAXA 3OR1C 2ELHA 3BTLA 1J9IA 2L5QA 1WRJA 2PMZA 2UXXA 1S5LC 3LA7A 4F3QA 3EYYA 3HEFA 3R6SA 3BDDA 3HRSA 2AQFA 3JSPA 2BBYA 4D5CA 2F5FA 1H8AC 1JHHA 2JUCA 3S15J 1T33A 2QVOA 2DCEA 1HKSA 2DQRA 2MC4A 2HQRA 4LJZF 4WCGA 2CUZA 4XRSG 4JOMA 3BQZA 3U2RA 4D5FA 4NBQA 3S1NJ 1VNDA 1YLFA 1TW2A 5B1BH 1HXDA 1MSFC 4A3LJ 4PJJA 3S3NA 2GOMA 1BIAA 3KCCA 1BR4A 3H0DA 5KAIC 4RB2C 4E7LA 2HXIA 2XAGA 1YI2I 2DQLA 3O6BB 2MGQA 1K4TA 4EV0A 1YRNB 2QQ8A 2QSFX 1JKPC 3HXLA 4EM0B 5CQEA 3GZNB 3FXUA 4D7MA 4LLLA 1OLTA 2KDZA 5B66C 3DXJF 4YFXF 2E36A 4G6QA 4B3AA 5DUKA 3A01B 2AS5F 1FC3A 1QVUA 1O3RA 2P4WA 2BHYA 4XONA 5FGMA 1ZG1A 4KN4X 2P8TA 4BBSJ 3MZYA 4RGSA 1V5EA 2OQGA 3CMMA 1TL8A 1MMNA 2EILH 5LGUA 1MNMC 5E3OA 1JI8A 4RB3C 1QHGA 1T08B 2CJJA 3M3YJ 4BQQA 3LSIA 1X4PA 2BXYA 1ZGJA 1G3TA 5DDGA 3PUFA 3HOVJ 2DA5A 5GAHJ 2CWEA 2VE8A 2QEXI 5DEQA 1O3TA 1S29A 4RA2A 3S14J 3JRAA 3OSGA 1Y1WJ 1T38A 3Q0VA 3I64A 1LEAA 2ICWG 2PBIA 1RNLA 1U6GA 1M1EB 3JRCA 1MJ9A 3FDYA 3OL3A 3V7CA 3J80Z 3MKWB 4Q48A 3KYLA 2H09A 2W1OA 3L2WA 2AQEA 5ED4A 4YFKF 4IRGA 4OIPF 4HF2A 3QAHA 4U0YA 3CCSI 5DUIA 4HBLA 1FBUA 2XB5A 2V6EA 3WTZA 2XAJA 1X1DA 3S2HJ 2DODA 2HQ5A 5C44J 3MZ8A 4M6YA 4PK4A 4XKBA 4W1UA 3OYDA 2DFFA 2VQHA 2ZXIA 3KP5A 2JQ7A 5EEAA 2A5YB 4IJAA 3LWFA 2Y30A 5EZGA 3OOPA 1WSUA 1YW7A 4A2UA 1LQ1A 4MO7A 3QYBA 1ZGAA 2BW3B 3ZXSA 4RGRA 3SFIA 4E4HA 1F4KA 2KMUA 2IJLA 3I53A 2WBMA 4BAYA 2DJNA 2LY9A 1SC7A 1S7EA 3GWZA 5ILSA 3VODA 3VSLA 1E17A 2P5VA 5J4VA 1VQOI 4OOIA 1R4NB 2FSWA 1E3HA 1P4AA 3Q5FA 2P7VB 3LAPA 3LAJA 2QQ9A 4HRIA 3PSIA 2HPIA 2OD5A 1BC8C 1AOYA 1Y8QB 2MW8A 1R71A 4IOAF 1B59A 1OYYA 1GT0C 3R0AA 3LSGA 4GGGA 2HR3A 3L09A 5F27A 2JVGA 1BA5A 4B3XA 3DBHB 4L9VA 3DV8A 4HOBA 2V9VA 3CMYA 3MKYB 3PO3J 2VT2A 4RAZA 1S7OA 2OU2A 2YU9J 3IH3A 3W6JB 5JHFA 4CGZA 4D7NA 4IVNA 4HA8A 1D5YA 4WX9A 3DEWA 1VQ8I 4KYWA 2P6SA 2NRAC 3MQ0A 1KU9A 2GIZA 2EINH 1VQPI 3AL0B 1I27A 5IP9J 1TWAJ 5LGNA 2IPQX 2Y9YA 1ZGWA 4XLAA 2OCEA 4HSTA 4JP0A 1IRXA 4CSWA 2PJRA 3WGHA 3UR3C 1RPWA 1ZK8A 2WY8Q 3H5RA 3OYJA 4BXUA 3GYHX 3L2VA 3UKGA 2HKXA 3TP0A 2N8GA 4MQVA 1W1WE 3ZQFA 1E2XA 5A2QZ 2HYFA 2M5WA 2V1NA 1D1BA 4HQEA 2Q0OA 1ZLKA 5CVUA 4LLNA 3BR0A 2FXAA 4LK1F 3D0SA 1Y8RB 5E79C 4A3BJ 4EEFG 4LLGF 5DCFA 3RKXA 1TZLA 4A3CJ 1G3SA 2QWWA 1K6OA 2RREA 2CH0A 1Z21A 4WXCA 2JK3A 5EG0B 1J09A 1Q1HA 4G6TB 1FLIA 2YSRA 3F0CA 2DDAA 5CVJA 4E7IA 3NWTA 4GDFA 2KISA 3BTJA 1ITYA 5DTDA 5B3SH 3V7RA 1TQIA 2STTA 1MBFA 4C30A 2XROA 4XN0A 4NDLA 1ZH5A 1WGXA 1OR7A 5M5YJ 1Z7UA 1D5VA 4OINF 3RIRA 3Q0WA 5E20A 1WPKA 4L0YB 4CH7A 1MMAA 3BR3A 2WV1A 4PSXA 2M4KA 2XKOA 3GTGJ 2KZVA 1MDMB 4ZDPA 3GXOA 2RVCA 2DBBA 2E1NA 2MBFA 5E3LA 4U0WA 5J3LA 2MC3A 5CLSA 4G12A 4GFBA 1I6XA 3LSTA 3CMEI 3HUGB 2D2WA 2FMLA 2W25A 2B63J 2CQXA 4CDGA 3BJAA 3I9V2 3HDDA 1R4MB 1FBQA 4F52A 3LSPA 1KU7A 3FXQA 1AWCA 2NVQJ 3OYBA 2E1OA 1T8IA 3BR6A 4OIOF 1I1SA 4CCOA 4Y3OA 3QYEA 5DS9A 2Z9OA 2V9PA 4FT8A 3M8EA 4CCKA 1Y1VJ 2WAQA 3TOBA 3IV5A 3B02A 1ZYRF 3P9IA 1SD6A 3B6AA 1S7AA 3PIPF 1VQKI 3M1CA 5IOZA 5CPRB 3ZMTA 2X1CA 4ZYGA 3GZ6A 2E1CA 1FOWA 5LHGA 2Z2SB 2Z1DA 1FMVA 3FKIJ 4F92B 1UHWA 5HOOA 4KDPA 2XSDC 4PSWA 4X6AJ 2DOFA 3K0LA 5GAEJ 2EFQA 5ILUA 2D1HA 1ETWA 2XGCA 1UG2A 3GW2A 5FRNA 5IYDJ 2DA7A 3GCMA 3A02A 1KU2A 4XOPA 3WTYC 4QLCU 1WCMJ 4YIFA 2FF4A 4Y7NJ 2COMA 1TT0A 2OF7A 2R7SA 1BR2A 4I76A 3S3OA 4XSZF 2V7FA 1YG2A 2L7MP 3CCEI 3ABLH 1PUFA 2L0KA 2HXOA 4Y15A 1YX3A 3AG4H 3M8FA 3OIOA 1W36C 2ESNA 5K1YA 3F6VA 3S1RJ 5CVRA 2WV0A 2DA6A 1UG0A 2RAEA 4HAMA 2WADA 3GLXA 3FXOA 1SD5A 3ZPLA 1WFXA 3VYUB 4RBOA 1IRGA 3CQZJ 4V2FA 1RUOA 3HGGA 1T98A 2X85A 1GUUA 4FX4A 1XX5A 3W2VA 3C1DA 3PIOF 3K4LA 3CC2I 2R7UA 2CFOA 3E7LA 4NC8A 3IAM2 1HC8A 2ID6A 4OU0A 2CW0F 2HDDA 3GFMA 2H8WA 3HGYA 5M5WJ 1B1BA 4XBFA 1BI1A 3IH4A 3H3UA 1IXCA 2OZ6A 3HBLA 1E0EA 3DTIA 4HX7A 2ZSHB 1WH5A 1LB2A 4RAGA 1KU3A 3ABTA 5JI6A 2KRFA 5C4XJ 4YG2F 4RGXA 2NAZA 3TDZC 1HKQA 3BLYA 4L18B 4BYYA 1QQIA 1SAUA 3KEYA 3PJRA 4CHUA 3FMSA 4M73A 3CCYA 3OIQA 5ILVA 3TO9A 1QHHD 3S93A 5FLXZ 1K61A 4QIWN 3TO6A 3BT9A 4BHBA 2PEXA 3F8BA 2GBYA 3A2KA 1XGNA 3CD6I 3WU0A 4IEJA 4HV5A 4XKWA 3F8MA 2CW8A 4ZYEA 1R7JA 3FMQA 3G6EI 5DCMB 4IO9F 4P1WA 3DTKA 4S04A 3QPHA 1DU6A 3IH2A 3A01A 5JLXA 1IO2A 3WTSC 2FMYA 3OYCA 3ZQCA 1KQ9A 3OS2A 3K10A 2X9DA 3GBGA 4UVBA 1TP4A 2VQGA 1ZRCA 2M3AA 4PFOA 4EM2A 2VONA 1JTYA 2LSOA 2KPMA 3BY6A 3FBNB 4ZC3A 1ZELA 1L3LA 4AM3A 3MCZA 3SZPA 1TQMA 2HDWA 2CQKA 2LYCA 3IRRA 3VYSB 3K70C 1S72I 1H88C 4A3FJ 4IRIA 1MKMA 1P7JA 2VLAA 3VYRB 1ZG5A 2RQQA 2LBFA 3GZ5A 2FBHA 2V1XA 3TO7A 1ODDA 3OYLA 2L9NA 1P7IA 2VKHA 2R7VA 1REPC 2MFZA 3ZMDA 3T1BA 1FPQA 3GLLA 1ETXA 2KDOA 4AYBA 3N4MA 5HS7A 4KIGA 2NOGA 3N97A 2E7WA 2NVYJ 3H9JA 3BC8A 2B7EA 2DOAA 2GWRA 3W3CA 3M9AA 1JE8A 2OPTA 5HS8A 1ZRDA 2E1MB 1WJBA 9ANTA 3U21A 4HF1A 3E3VA 4AIDA 3EUAA 2D1VA 1WJEA 2LKSA 1NK2P 1DU0A 4OIQF 5HNFA 3HTSB 3FXKA 1N77A 2FJ1A 5L3GA 2EV0A 1ZREA 2ELJA 4DYQA 4ZH4F 3CF2A 4B43A 5L3FA 4XLPF 1BC7C 5K7FA 3OSFA 1SD4A 2RC4A 3ECOA 2AHQA 3WE2A 3DLAA 1IN8A 3BQYA 3AFHA 2LBFB 1QA6A 2YX4A 1WJDA 2R92J 2K7LA 5L3CA 2EWNA 4ESBA 3WTVC 2CMPA 3C7JA 3MKZA 3SQNA 4AWXB 4L5IA 5L3BA 2LD5A 1FYLA 2K9LA 2QBYB 3T0YA 4G94A 4AU7A 5E1XA 1A36A 5IP7J 4UHTA 3B6CA 4ZYHA 2HKOA 4KJZA 2O9LA 2QKMB 1PDNC 3GMEA 4MFDA 3GTKJ 2ZXWH 4N0BA 1DQUA 3L2CA 2ZJQF 2EH3A 2QZ8A 2DYSH 3AG3H 4RAYA 4XM3A 4IF4A 2ESHA 2XHKA 3BOQA 2DA2A 4I09A 4BJTA 5FD5A 2ZJRF 3OS0A 1LNWA 1V5FA 3DBRB 2XRNA 1IXSB 3ONQA 3ZR8X 2KLOA 2R5ZB 5H6RA 4DW6A 2Y0SN 4A0XA 5LHIA 1SFXA 1DP3A 4XLFA 1D1CA 5J8FA 1TWCJ 5FROA 2X51A 2LKPA 5FLVA 3FK6A 1QRYA 2X6XA 3V8LA 4I0AA 1RIOH 4PGGA 3TL4X 3P9CA 4ABZA 3FXJA 1JKRC 1DGWY 2K86A 3H9GA 3F8FA 4BGDA 4L5EA 3LNQA 1MBEA 2ZMEB 4MEXF 5ICFA 3TKYA 2ZC2A 2E35A 3KP2A 3S2DJ 4HNUA 2VJ5A 5KHDA 3CO7C 2VUMJ 3ULQB 2QA4I 5D8KB 2Z5UA 2E71A 4BDYA 4HQMA 3GTMJ 4A3MJ 1QVTA 1AU7A 3DU6A 3CCMI 4BUPA 3J7ZI 2R5YB 1S6LA 1Z77A 3M7GA 4KICA 2Y75A 4C9YA 1S3JA 1G6NA 4XICA 1G3YA 1SFKA 4AVPA 1WVRA 2ZNZA 3W6VA 3K1MA 3GF2A 5HVQC 3C2HA 3VOEA 1YJWI 4FHTA 4P5OA 4BKXA 2WTEA 1O57A 1NG7A 1LE8A 2VBXA 1EKEA 1YE9A 3VYTB 2A07F 2PMUA 4CYCA 1EH8A 2M8EA 1B8IB 2O8XA 2VPLA 2XF5A 4AYBN 1X2MA 2X6OA 2L4MA 1SFEA 1VQ4I 2R7TA 1Z67A 1X1PA 2K3PA 1BOBA 4L9JA 1FT9A 3RYRA 1WJCA 2L7KA 3V8JA 2CQ7A 1D0XA 2X0LA 4G9YA 1R1TA 3WG7H 2R7RA 3CP8A 4RLFA 5HDNA 1XSDA 3F8CA 2XPWA 3F6OA 3PUBA 2TDXA 3FWEA 1W5SA 3KZIC 2H8RA 3I55I 1TC3C 4ENNA 2MYSA 4M72A 4BEHA 2FQ4A 5J4YA 3ZQQA 4MFEA 5KK1A 1OQYA 5K7ZA 3GTLJ 1G2HA 3IRQA 4J00A 2LG4A 3A0BC 4BJ6C 1J0RA 1VFCA 5L3EA 2K40A 2O03A 4N9HA 4BXXJ 1FTTA 2LF8A 1LDDA 2ETHA 2HTJA 2QM3A 3I59A 3RQIA 5DM6F 2ACJA 2VBWA 4ENMA 1X2NA 1ZQ3P 2ISYA 2RQPA 1BL0A 2VPRA 1XSVA 2OV7A 1T56A 2VXZA 2KP6A 3JRIA 3DFGA 5IT9K 4PJ0C 1IDZA 1FWZA 2MD5A 2OZUA 4U87A 4V19K 1ON2A 3BJ6A 1MDMA 4B09A 2V4JC 2E2HJ 3J7AY 1U2WA 2YX7A 4I02A 4XLCA 4EJOA 1I5ZA 4F91B 2QBYA 3RQ4A 2CG4A 3JAMZ 3LL7A 1TWGJ 5C4JJ 2JA6J 2X1EA 1UJ8A 1ACIA 1HW1A 4BDZA 2LY1A 3SZGA 2VT3A 3WTXC 3K2ZA 2PMHA 2ECCA 2YPRA 3MWMA 3G71I 5IY5H 3ZQGA 3R0JA 3IWFA 3GEZA 1I3QJ 3EYIA 1V3FA 2ZJPF 3CC7I 2PI0A 1FSHA 4EVIA 1FIPA 3Q0UA 1TT5B 3E97A 2ME0A 3G73A 1EV7A 3FISA 1YW8A 3M1EA 3U1KA 2W48A 3WTUC 2W57A 3JAMK 1OPCA 3QPSA 2Y48A 1NK3P 1OJLA 3F8NA 2WY7Q 3KYDB 2Y0MA 2OTJI 4M74A 4DBRA 2H1LA 2VKVA 5AONA 4B1RA 2FEZA 1OCTC 4JX4A 1R00A 1JJ6C 2H6CA 2O0YA 2EA2A 3R61A 1ZR2A 3RKWA 2K3FA 4D9JA 2WWYA 1QU3A 3IWZA 1K78B 3ML6A 5J1RA 1T95A 2E60A 5FKMA 3SFZA 2L4AA 3EPZA 2LNBA 4WWCA 1IAWA 1QGPA 3WU2C 4CCMA 2DTZA 3JRGA 2LTPA 2VJJA 1H9TA 1P6RA 2F2EA 3BG5A 1F9NA 3BP8A 4ESJA 1FOXA 2ZMEC 3GTOJ 4FISA 2OAZA 1O3QA 5B1AH 1Q1VA 3BG3A 5D6EA 2M7AA 4A3DJ 3S17J 2TCTA 2NNYA 2VIXA 1IN6A 2NS7A 3BJOA 1KGSA 3QU3A 5E3NA 3V8KA 1IN7A 2E5NA 4OWRB 1ETVA 4XKVA 2VQLA 1A5JA 3I4PA 2CSOA 1VQ9I 3CP2A 4PZJA 2IS4A 4BY1J 4A6DA 2VODA 1W7PB 1ZARA 1BJZA 3BR5A 3MD2A 2R7DA 4CO8A 2DT7B 2L3DA 3A4CA 2DOEA 3VDXA 4A3EJ 1R1UA 3BG6A 1MGTA 5KAFC 4C2UA 2HYGD 3H3ZA 2LR8A 3HPHA 1N25A 2EB7A 4I0BA 4CA0A 3HHGA 4Z2YA 2V79A 2ZCWA 5K7HA 3ZMSA 3K70D 1STZA 2QUFA 1XMXA 2QSGX 2L7ZA 3O2PE 5EGOA 1TLHB 4UXNA 1BOAA 3EUHA 3H3VK 3QOPA 1HF0A 4YRVA 1FY7A 3K4NA 1Z05A 1HQCA 1A31A 1UHSA 1GXQA 1W7PD 2XAUA 3K69A 2OBPA 3HG9A 1LUJB 1I6HJ 1SANA 5LRSA 4IXAA 3RZDJ 3D1NI 3REOA 3QYFA 2A6HF 5BPIA 4QWQA 2XASA 5LLQA 2QLZA 3FXRA 2DN0A 4I01A 1FEXA 2ZJ2A 2F5CA 3T5XA 2R4GA 2CFXA 2DA4A 3ERMA 3IKVA 1AA7A 1OMIA 4M3GA 4MQ9F 4KT6A 2HOTA 4DQ2A 2P5LC 1SMYF 5FFZA 4OMYA 1U78A 3PQKA 3ZQIA 4E7JA 2VXDA 1YJ9I 1DUXC 3MAJA 4YIRX 1UB9A 1YJNI 2BXZA 3LA2A 5F64A 2HZDA 4AD9A 2KRHA 1J59A 3K9TA 4XORA 1UMQA 3ELKA 2M4GA 1CF7B 3HHHA 5JFRA 2ELKA 2Y69H 4HF0A 2LF7A 1OYIA 3F23A 3PSFA 3DEEA 3BCAA 5DD8A 4RM3A 1MMSA 1WJFA 5FO5A 2NS8A 3FXMA 4NC7A 3RPUD 2VKDA 1D8KA 1Z9CA 5D5UB 1XCVA 2HQNA 4A12A 1VI0A 1RR7A 4UUSB 1UCRA 2DMQA 3JREA 3ASNH 5EJCA 3FBIB 1IRFA 3ZCOA 2A68F 2K9QA 3E6BA 2HOEA 2IBDA 3OYIA 2CYYA 1ON1A 3Q9SA 2YS9A 4M3FA 4HYEA 3I56I 3GX4X 4L5JA 1YIOA 1IDYA 3EUKL 3OL4A 3F9KA 3TBIA 2BZTA 2XGXA 4FE7A 1OCRH 2BY2A 4C2MJ 3BZ6A 1XGMA 2XV4S 5GTIC 3CESA 4UUSA 3DPUA 3H35A 3TP3A 5LFAA 2M1BA 3IUOA 3CJNA 3I71A 2IGOA 2GA1A 1T6SA 2NOJB 3QWLA 5DCMA 2Y2ZA 5FKNA 3K7AJ 2CO5A 5EYRA 4S05A 2IAIA 4I7HA 2O5RA 3K4MA 2R7WA 1W0TA 4FETA 2KQRA 1POGA 3O3KA 4II3A 2VJ4A 3LSJA 1A6QA 4WK8F 1RR8C 1WZ2A 1KZHA 4NQWB 3SZTA 1CF7A 2MH9A 3CJQB 3IHUA 4M9SA 2KJBA 2PMZN 3WHCA 1MBHA 1DPUA 3HUGA 4PCQA 1B6AA 1J2XA 1MMGA 3H92A 4ZYDA 4BE2A 1RKTA 4ITVA 4D1QA 2OC6A 3CDLA 1XG1A 2L9SA 1W5TA 1X19A 4LB5A 4QPQA 1R5HA 1LFPA 3OYMA 2LKXA 3ABKH 2IT0A 3DTEA 4C2TA 4IQJA 3I4NJ 3G1OA 1XB4A 1AKHB 5J8CA 2IGNA 3KYCB 5F0FA 3M8JA 3KP6A 1QPMA 1QZEA 3O8GA 3GFLA 4JYKA 5TJJA 2EFOA 1XCBA 3DKXA 1X4OA 4AIKA 2W00A 2UXNA 3WHBA 2JRTA 1JUMA 4X0GA 1Z6TA 2MSYA 3HOXJ 3HL2A 2IRFG 2Q1ZB 5EEHA 3C2GA 2IS1A 3WE3A 4QTRA 2P7CB 2JZYA 1WJAA 3OYNA 4HDVA 1VQ7I 5AIQA 1LDJA 1D3YA 2XAQA 4HV6A 1N75A 2A61A 1OCPA 3BZKA 5JVGF 4BE1A 3HRTA 2W85A 2ID3A 3HOSA 4OAZA 5CVIA 1FOKA 3QODA 4IKFA 2JA7J 4LITA 2XPVA 5GTHC 4AIJA 1G3WA 1X3ZB 1GLNA 3GTJJ 1U9OA 2JRMA 3QU6A 2JN6A 2CRGA 3ABMH 5DV5A 2GLOA 1A04A 2FUG2 2ZKZA 2DAOA 1YTYA 1K6YA 4J19A 1F36A 3L2QA 2G7UA 3MN2A 3CMAI 1ULYA 2O6GE 3HRMA 5FFXA 2LVSA 4C3HJ 3QP6A 1HW2A 1DDNA 4UVCA 1W7PA 2ZFUA 2XDVA 4RGUA 1FP1D 5J1UA 3HOWJ 1D0YA 1GV5A 2JA2A 2A05A 2R7ZJ 1Z0XA 4XRMA 4E7ZA 4GXOA 1X1AA 1I50J 2DA3A 5KVRA 4GO1A 3JW4A 4XLEA 2M0MA 2Z16A 1VQ5I 2M8GX 2M0CA 2CQNA 3AL0C 2PFBA 4A3IJ 3QPTA 3GFIA 3M4OJ 2K9SA 2E5ZA 2BVMA 4ON0A 3S8PA 1MIJA 5EF6A 3CTAA 1R23A 5K5QA 5KCMA 5H20A 2E19A 4BQOA 3LFKA 5J47A 3DKWA 2XSJC 1YX5A 2GAUA 4NB5A 1RESA 2O61A 3HSFA 4KMFA 1GVDA 2VJIA 3C3WA 4Q5SF 4BL0B 3V7SA 3H5AA 2XRLA 2I10A 3CJTB 3GUDA 1JGSA 4I6ZA 5CJ9A 4FQGA 1LPQA 5DYMA 2EJRA 1A6IA 4L9TA 2K4JA 4BY7J 1B8IA 1UELB 2IGMA 1FNNA 4UV8A 3BPVA 2WB1N 2CUJA 3E6DA 3KEOA 3NRVA 4E7HA 1APLC 5F0CA 3CCJI 1O7LA 3RPUA 2GQQA 4E7SA 3HPGA 1R22A 2CW7A 3TEDA 5B5EC 2BGCA 1IW7F 2FRHA 5HDGA 1WHUA 2IEKA 5HDKA 4XR6A 4XOTA 2JJ7A 1RKWA 4ZTJA 5LEJA 2F5VA 3R60A 2W84A 5IOYA 1E3OC 4BNCA 2C6YA 3OY9A 5EG0A 3OYHA 4XKCA 3U1DA 4IHYA 4DYCA 2UWMA 1HA8A 1EJ9A 4B4CA 3EUHC 4XL9A 3JRDA 5FKOA 1AKHA 4X1EA 1X1CA 1P9QC 3K4JA 5EZHA 2RDPA 3H5NA 2Q8KA 4C3IJ 4RDUA 4KA4A 2EK5A 1KYWA 2FOWA 1VQLI 4HLYA 5ICCA 5IT9Z 2OUMA 2EPFA 2P0WA 2M7BA 2VOPA 2YR2A 1R9TJ 2DYRH 4LIVA 1JT0A 1XGSA 1K83J 1MW7A 2A3SA 2YU3A 2K9MA 1OYWA 2CS3A 2EZHA 4XLHA 2ZBKA 3E5XA 1G59A 4UNOA 4U88A 4O5VA 1FSEA 4NQWA 2Y31A 2CV2A 3BG7A 2R7QA 4LGWA 5E3MA 2LY2A 3KP4A 1I3AA 3OIPA 1GXPA 2AO9A 2ZNYA 3J7YJ 5IT3A 2EIMH 3I59B 2STWA 4H0EA 2DFIA 3KLNA 3L2UA 1KQ8A 1XGOA 3SHFA 4G7OF 3K2AA 4N4OB 2JPBA 4F93B 1HSTA 1BBYA 4A3JJ 3RZOJ 3RJPA 3DQVC 2L54A 5CYVA 1W36D 4MTDA 2QYOA 1IJWC 2LDUA 1SVLA 2EFWA 5HLGA 1SEUA 3LOCA 4I98B 5CVVA 4BHCA 1S8NA 1XMAA 2CU7A 4A6EA 4UY8I 3QP5A 4DYRA 1IF1A 3ABUA 4IL6C 4LMYA 1U5TB 2W7NA 2ZFWA 3F21A 2KIFA 3MVPA 5EDNA 1YHQI 2PX9A 3CUQA 2M9HA 1YS7A 2QGUA 2DU9A 4ZZDA 3TDUC 2K9NA 4FE4A 2QCOA 4GYGA 4HNVA 2EBIA 1JKOC 1MBJA 4Y52J 3WGGA 1OCZH 5BQTA 1U5TA 1OR7C 1TWFJ 4JBAA 4RAFA 4CYCB 2A5WA 2V1DA 4IHTA 2I5UA 2BW3A 2HTSA 4MGRA 4AUXA 2DA1A 4PJLA 4P9UA 5A2QK 1ZAOA 3OWTA 1JJ8C 3ZRGA 1SFUA 1B72A 1Y39A 3PO2J 3BCBA 1Z3YA 2TRTA 3LSMA 4RB1A 1YOVB 3I5UA 2O8KA 4BQNA 4ENJA 4L0ZB 3RTRA 1ZRFA 3O8HA 2HGCA 3DF8A 4MNUA 2BEOA 2HI3A 1ZHFA 1B4AA 2ADUA 1I39A 1JTXA 3F72A 2ZXJA 4RLQA 4Q47A 3W6KB 2EIJH 4DJAA 2EFNA 4WXDA 1KQ0A 2BY0A 3DEUA 5BPDA 1HLVA 3ZGKA 1MBGA 5LRRA 2NVTJ 3PNYA 4KFCA 3SJMA 1IUFA 3H36A 3IKTA 2ZMEA 3BR1A 2MA3A 1Z3XA 3L2RA 2QQBA 3K4BA 1RZ4A 1G8XA 4D0PA 4KNYA 1P4XA 3EETA 4IHXA 3FM3A 4UVAA 2XC7A 4LD5A 2RKHA 5D4SA 4XRSA 3FM5A 1ETQA 2X1DA 2E7XA 2FD5A 1DP7P 1Z7LA 3OR2C 2P6TA 4BS9A 4I2OA 4ANJA 1Y6IA 3I0TA 4PGHA 3RPQA 4G8XA 1RRJA 2OA4A 3ZMVA 1V4RA 2VASA 4IZZA 1WJ5A 1EH6A 4EJUA 4LFUA 2BOLA 2DPDA 1I1GA 2FOKA 4TV7A 3BROA 2IXSA 2JMWA 1YYVA 2MD0A 1ZKGA 3L9FA 2W82A 4JX5A 2XVCA 4CZZA 4WF2A 2NYXA 1LFUP 1A35A 2LH9A 1QZZA 2BE5F 2G0EA 2EV6A 4KITB 3JCUC 5H6QA 4BACA 4EJVA 3CO6C 1VF9A 4A3KJ 3E6CC 2FBKA 1O4XA 5TGTA 1EF4A 4PDKA 3ZN0A 4HPQA 4JX6A 2KIQA 5BS6A 3CLQA 3OYAA 2HWVA 3HKZA 4I99C 2CV1A 1H9GA 2HU9A 1BI2A 2XUBA 4XK4A 2JSPA 3H0GJ 3SXYA 1LFBA 1E3PA 2DT5A 1ETYA 5E1WA 3DCFA 3ISPA 4IHWA 1C0WA 5LHHA 3HOZJ 3FZVA 3JTHA 5FRMA 5LGTA 5IPAA 3N05A 2E34A 3OV8A 3F22A 1FJLA 4EJTA 4WXHA 4UB8C 3HSEA 1IXRC 4HG2A 1QPIA 1TNSA 4CICA 3TOAA 1B9MA 3CC4I 2A6TA 3U9GA 3GFJA 4HEA2 3JR9A 2KIUA 4B44A 2O3FA 4LOCA 2XPUA 2LLKA 5DM7F 1JKQC 3OYEA 2MLGA 3ZP5A 1H89C 1PP7U 2JPCA 3NQOA 1ZTRA 2DMUA 3ESWB 1RUNA 1D8JA 1PUFB 4P96A 4J01A 4M3DA 1N78A 3WGIA 1U5TC 3TMOA 3RI4A 2OTLI 3ZQLA 5LEKA 3CCQI 1S9HA 2JUGA 3HB9A 3HIFA 2FE3A 4KIBA 3KZZA 2CUFA 3DPLC 3BTCA 1CGPA 2VI6A 4A0YA 2EZIA 1F43A 2AXTC 2JA8J 2H27A 2NVXJ 3CUQC 3G3ZA 4IQ4A 4RB0A 5GP9A 2L2OA 3DP7A 3TW7A 4DNCA 5HODA 3L00A 3NEUA 4KMUX 3VB2A 1V55H 1BR1A 1MJAA 2Z3YA 1V5GA 2KZGA 1BN5A 2VC1A 2XGDA 3ZMZA 1ETOA 5JLWA 3BWGA 1R36A 1XS9A 2G7HA 4P9FA 4R79A 1ZR4A 1IUYA 1ERDA 2OJED 2E2JJ 3R4KA 4XQFA 4U7DA 2OQRA 3JTGA 1ZG3A 2J5PA 4EQQA 5DD4A 4MEYF 1YO5C 2V1UA 4CZCA 2DMTA 2K02A 4BH9A 1DGRM 1L0OC 3OS1A 3LSRA 1VZ0A 2HOSA 3FKJA 1FYMA 3D5LA 4NC6A 1SVOA 3ERED 3HSRA 3DPTA 2DI3A 2HQAA 2KHMA 1TNTA 2P5KA 3C18A 1BI0A 5JR3A 5CKTA 3IL2A 5M3MJ 1MSEC 1FP2A 2WAFA 1MBKA 4ZDLA 2CQQA 2V9KA 3FHNA 2IS2A 3T8TA 4A93J 3WU1B 3QRFF 1ORKA 4QPOA 1UHMA 3RSNA 1U8BA 2KKOA 2ZO4A 5M5XJ 1WH7A 4Y17A 2K4BA 3EQLF 3I58A 1BM9A 2BHZA 1T2KA 3JSOA 5F1RA 2F4OB 2DPUA 1WWXA 3DBLB 2ME6A 2EZLA 1HW5A 5F0HA 5GADJ 4BHPA 4ASNA 5LBQA 1ZN2A 5ICGA 2MG4A 1XMKA 2GXBA 1Z6RA 3H1CA 2F4IA 3IC7A 2I8DA 3DKYA 4R1HA 4CXFA 4LG0A 1F1ZA 1NTCA 1U8RA 3FF5A 3H9QA 1HDPA 3LFUA 4JK1X 5FJ8J 1BIBA 1IN4A 2FU4A 1MMDA 3KP7A 4QSHA 1LKXA 3L1PA 3PL8A 1YW9A 2VKEA 1K7AA 4PFPA 4EATA 5D6FA 5D5WB 1EH7A 2M30A 3KP3A 1XPXA 3FIWA 2XAHA 2NXNB 4M3BA 3TGNA 3OOUA 4AIHA 4UUVA 5HLIA 2R3SA 1X58A 5E8GA 1LVAA 2VN2A 1LVKA 1QO0D 3S1MJ 2HOAA 2GZWA 2GOXB 1JUPA 3I4MJ 1U9NA 2V26A 3DU5A 3I3LA 2K85A 3TW6A 1G4DA 4CUGA 1CQTA 2PN6A 4ZYAA 1WKMA 4G7HF 2DK8A 2QKLB 2XF6A 1OFCX 2OCCH 2R5YA 2QENA 2V6CA 1KA8A 2DFEA 1MH4A 1TWHJ 2MH2A 2PJRB 5FKLA 3M07A 1F5TA 3KFWX 3BG9A 4B8XA 2EA4A 1T39A 1GV2A 4XNFA 2KT0A 3P5JA 4MTEA 2MLKA 1P92A 4Y33A 2DFHA 3GO5A 3JRBA 5FLXK 1IGNA 1OKRA 1VQNI 2IA2A 4KISA 4EM1A 2L9VA 2F6CA 2G9WA 1HBXG 3CDHA 1USSA 1HKTA 2ZSIB 4E7KA 2DW4A 2DT6A 1R6RA 1OCCH 2ECBA 5J6XA 1UAAA 1R1VA 2IGKA 1JXSA 2M45A 5FB2A 5KNLA 3HRUA 5FKKA 4IHVA 3PNVA 1LDKB 3UNGC 1TQPA 4EMSA 2L9RA 1HDDC 2M34A 2DK5A 2JWTA 4K2EA 2GA2A 2KFDA 4ESFA 5GPCA 3FHZA 3V42A 1IV6A 4P55A 3E1SA 1UFMA 4HNTA 1R49A 2ZXHA 3PQJA 3GVAA 1PP8F 3MMYB 1X1BA 4MIMA 4U0VA 3VPRA 4Z6YA 2B9SA 2F5DA 3J81Z 4GYIA 1W0UA 4YIIA 2FNAA 1FMWA
chains in the Genus database with same CATH topology
1FBSA 2UZKA 3ECHA 1XSXA 1WQ2A 3HTUA 1DPRA 1O3SA 1TTYA 3J80K 3LQQA 4A5MA 2RV8A 3E5QA 4R8HA 5ICEA 1BJAA 4F7ZA 2XKPA 4RS8A 5E18F 4EGZA 2D45A 3PFIA 2IP2A 3J81K 5AIPA 3S2WA 1J7KA 2PG4A 3KZYA 4LB6B 2GIVA 1NHAA 3I54A 1TW3A 3MFKA 4HDUA 1HSJA 1BI3A 4M9XA 1P4WA 4HZFA 3FX3A 1R58A 2AXLA 4ENKA 4KUMA 4XSXF 3LQRA 1SD7A 3ZN1A 1XDSA 4A0ZA 3WTWC 2GXGA 4HW0A 1X3UA 3MZHA 3CLOA 2KJCA 3P7NA 4GCVA 5K5RA 1K78A 4EGYA 1FZPB 2A69F 5JHUA 2EV5A 5D8LB 4IHSA 5EEGA 4XRFA 1ONVA 2A6EF 2CGPA 2DLLA 2VOOA 4MHGA 1QNTA 2B0LA 2RGVA 1VTNC 5D5XB 1W4MA 2VBZA 4M9ZA 4N9IA 2XIGA 2PQ8A 2BV6A 3CUQB 1QZYA 3MEXA 2IA0A 4HX8A 1GHCA 1GVJA 1PUEE 2JT1A 4M6XA 2NS0A 4E70A 4HLXA 3LA3A 1MJBA 1LJ9A 4LK0F 2EFPA 5E17F 4HX4A 4O3MA 1B9NA 4KIFA 2PLYA 4OMZA 3WG9A 5D4RA 5F6FA 1O7FA 2VE9A 2JTVA 1T0FA 3HYIA 1Z91A 4ETSA 2IA1A 4FX0A 2XAFA 1Y0UA 3T8RA 3ZMUA 5BOXA 1FYKA 3VFZA 5BMZA 1R5GA 2H94A 6PAXA 4JQFA 5HS9A 5FD6A 4ZZLA 4A5NA 1XDUA 2DTRA 2RN7A 1QBJA 2NNNA 3K1PA 4Y13A 1K79A 1P2FA 5L3DA 3KETA 2QQAA 1RI7A 3HOTA 3ROUA 2H6BA 1MZBA 4XLNF 4G7ZF 3TQNA 2F5EA 2L01A 1U3EM 3K1NA 1MD0A 1YS6A 2HFHA 5HLHA 4BQAA 3BPXA 1USTA 2DO7A 4L9NA 3KE2A 4KN7X 4OIRF 3Q9VA 1XD7A 3AAFA 2K27A 3V4GA 1LEBA 1WI9A 2VBYA 1YFHA 3WODF 5D5VB 3FMRA 1H0MA 1JHFA 4LG0B 2HS5A 4YFNF 2IVMA 3RKYA 2PJPA 2KIMA 5TRDA 3F3XA 5ERIA 2IW5A 4Q4ZF 4U7BA 1IN5A 3EDPA 2BYVE 1Z1DA 1J5YA 2WC2A 3VEPA 1YQAA 3WTTC 3E6MA 1SMTA 4O6JA 3L7WA 2Q2EA 2Z99A 5E8IA 2HDCA 2L02A 3RYPA 1ZLJA 5JVTA 2HEOA 3J7AO 2FNPA 3CUOA 4EJWA 3RDIA 2R7FA 4IRHA 4G6DA 5K5OA 2W24A 4NHJA 1TBXA 2JSCA 2Z33A 2HZTA 2FA5A 2VC0A 2M87A 2X4HA 4M71A 4IPAA 4CYDA 3COAC 5E1ZB 3KEQA 2RNJA 3E5UA 4UV9A 1KYZA 1IZ1A 3KLOA 2FQ3A 2FBIA 3P9KA 2ISZA 4KT5C 3B73A 3ZQ7A 1J75A 1FX7A 2J5OA 1XN7A 1SAXA 2ELHA 1J9IA 1WRJA 2UXXA 3LA7A 3EYYA 3R6SA 3BDDA 3HRSA 3JSPA 2BBYA 2F5FA 1JHHA 2QVOA 1HKSA 2DQRA 2HQRA 4LJZF 4WCGA 3U2RA 1YLFA 1TW2A 1HXDA 1BIAA 3KCCA 4RB2C 2XAGA 2DQLA 3O6BB 4EV0A 4EM0B 3FXUA 4LLLA 3DXJF 4YFXF 4G6QA 5DUKA 2AS5F 1FC3A 1O3RA 2P4WA 5FGMA 1ZG1A 4KN4X 2P8TA 3MZYA 4RGSA 2OQGA 5LGUA 4RB3C 1ZGJA 1G3TA 5DDGA 2CWEA 2VE8A 5DEQA 1O3TA 1S29A 1T38A 3I64A 1LEAA 1RNLA 1U6GA 2PBIA 1MJ9A 3V7CA 3J80Z 4Q48A 2H09A 5ED4A 4YFKF 4IRGA 4OIPF 4HF2A 3QAHA 4U0YA 5DUIA 4HBLA 1FBUA 3WTZA 2XAJA 4M6YA 3KP5A 2A5YB 4IJAA 3LWFA 3OOPA 1WSUA 1YW7A 4A2UA 1LQ1A 1ZGAA 4RGRA 1F4KA 2IJLA 3I53A 4BAYA 3GWZA 5ILSA 3VODA 1E17A 2P5VA 4OOIA 2FSWA 1P4AA 3Q5FA 2P7VB 3LAPA 3LAJA 2QQ9A 1BC8C 2OD5A 1AOYA 1B59A 1OYYA 3R0AA 4GGGA 2HR3A 3L09A 4L9VA 3DV8A 4HOBA 2V9VA 2VT2A 4RAZA 1S7OA 2OU2A 3W6JB 4CGZA 4IVNA 4HA8A 4WX9A 4KYWA 2P6SA 2NRAC 3MQ0A 1KU9A 1I27A 5LGNA 2IPQX 3WGHA 3GYHX 4BXUA 2HKXA 4MQVA 1E2XA 5A2QZ 2HYFA 2M5WA 4HQEA 2Q0OA 1ZLKA 5CVUA 4LLNA 2FXAA 4LK1F 3D0SA 4LLGF 5DCFA 3RKXA 1G3SA 2QWWA 1K6OA 4WXCA 1Q1HA 1FLIA 2YSRA 5CVJA 3V7RA 1TQIA 2STTA 2XROA 1ZH5A 1OR7A 1Z7UA 1D5VA 4OINF 3RIRA 5E20A 4L0YB 2XKOA 1MDMB 3GXOA 2RVCA 2DBBA 2E1NA 2MBFA 4U0WA 2MC3A 5CLSA 1I6XA 3LSTA 2D2WA 2FMLA 2W25A 4CDGA 3BJAA 1FBQA 1KU7A 3FXQA 1AWCA 4OIOF 1I1SA 2Z9OA 4FT8A 3M8EA 3TOBA 3B02A 1ZYRF 3P9IA 1SD6A 1S7AA 3ZMTA 4ZYGA 3GZ6A 2E1CA 5LHGA 1UHWA 5HOOA 4KDPA 3K0LA 2EFQA 5ILUA 2D1HA 3GW2A 1KU2A 3WTYC 4QLCU 4YIFA 2FF4A 2COMA 4XSZF 1YG2A 4Y15A 3M8FA 2ESNA 5K1YA 3F6VA 5CVRA 2WV0A 4HAMA 3GLXA 1SD5A 3ZPLA 1IRGA 1RUOA 1T98A 4FX4A 3C1DA 4OU0A 2CW0F 3GFMA 1B1BA 4XBFA 1BI1A 1IXCA 3H3UA 2OZ6A 4HX7A 1LB2A 1KU3A 3ABTA 5JI6A 2KRFA 4YG2F 4RGXA 2NAZA 3TDZC 1HKQA 4L18B 4BYYA 1QQIA 4CHUA 3FMSA 4M73A 5ILVA 3TO9A 5FLXZ 3TO6A 4BHBA 2PEXA 3F8BA 1XGNA 3WU0A 4HV5A 3F8MA 4ZYEA 1R7JA 3FMQA 5DCMB 4S04A 3QPHA 3WTSC 2FMYA 1KQ9A 4UVBA 1ZRCA 4EM2A 2VONA 2LSOA 3BY6A 1L3LA 3MCZA 3SZPA 1TQMA 2CQKA 3IRRA 4IRIA 1MKMA 1ZG5A 3GZ5A 2FBHA 2V1XA 3TO7A 1ODDA 1REPC 3ZMDA 3T1BA 1FPQA 3N4MA 5HS7A 4KIGA 3N97A 2E7WA 2GWRA 3M9AA 1JE8A 5HS8A 1ZRDA 4HF1A 3E3VA 2D1VA 4OIQF 3HTSB 5L3GA 2EV0A 1ZREA 4ZH4F 5L3FA 4XLPF 1BC7C 1SD4A 2RC4A 3ECOA 3WE2A 1IN8A 2YX4A 2K7LA 5L3CA 2EWNA 4ESBA 3WTVC 3C7JA 3SQNA 4AWXB 4L5IA 5L3BA 1FYLA 2QBYB 3T0YA 4G94A 5E1XA 4UHTA 4ZYHA 2HKOA 1PDNC 4N0BA 3L2CA 2QZ8A 4RAYA 4IF4A 2ESHA 2XHKA 3BOQA 4I09A 5FD5A 1LNWA 2XRNA 1IXSB 5H6RA 4A0XA 5LHIA 1SFXA 5J8FA 2LKPA 3V8LA 4I0AA 1RIOH 4PGGA 3P9CA 2K86A 3F8FA 2ZMEB 4MEXF 5ICFA 3TKYA 3KP2A 3CO7C 3ULQB 5D8KB 2Z5UA 4HQMA 1S6LA 3M7GA 4KICA 2Y75A 1S3JA 1G6NA 4AVPA 1G3YA 2ZNZA 3K1MA 3GF2A 5HVQC 3VOEA 4FHTA 4P5OA 2WTEA 1O57A 2VBXA 2A07F 2PMUA 1EH8A 2M8EA 2O8XA 2L4MA 1SFEA 4L9JA 1FT9A 3RYRA 3V8JA 2X0LA 4G9YA 1R1TA 5HDNA 1XSDA 3F8CA 3F6OA 2TDXA 3FWEA 1W5SA 4ENNA 4M72A 5KK1A 3IRQA 1J0RA 5L3EA 2O03A 4N9HA 2LF8A 1LDDA 2ETHA 2HTJA 2QM3A 3I59A 2VBWA 4ENMA 2ISYA 2RQPA 1XSVA 2VXZA 3DFGA 5IT9K 1FWZA 2MD5A 2OZUA 1ON2A 3BJ6A 1MDMA 4B09A 1U2WA 2YX7A 4I02A 4EJOA 1I5ZA 2QBYA 2CG4A 3JAMZ 1HW1A 2VT3A 3WTXC 3K2ZA 2PMHA 2YPRA 3MWMA 3R0JA 3IWFA 3GEZA 3EYIA 1V3FA 2PI0A 1FSHA 4EVIA 3E97A 3G73A 1EV7A 1YW8A 3M1EA 3WTUC 2W57A 3JAMK 1OPCA 2Y48A 3F8NA 2Y0MA 4M74A 5AONA 2FEZA 1R00A 2H6CA 2O0YA 2EA2A 3R61A 3RKWA 2WWYA 3IWZA 1K78B 3ML6A 3SFZA 2L4AA 1IAWA 2LNBA 4WWCA 1QGPA 1H9TA 1P6RA 2F2EA 1F9NA 3BP8A 4ESJA 2OAZA 1O3QA 5D6EA 2NNYA 1IN6A 3BJOA 1KGSA 3QU3A 3V8KA 1IN7A 3I4PA 2CSOA 4PZJA 4A6DA 2VODA 1W7PB 1ZARA 2R7DA 4CO8A 2L3DA 1R1UA 1MGTA 2HYGD 3H3ZA 4I0BA 2EB7A 3HHGA 4Z2YA 2V79A 2ZCWA 3ZMSA 1STZA 2QUFA 3O2PE 1TLHB 4UXNA 1BOAA 3EUHA 3QOPA 1FY7A 1Z05A 1HQCA 1GXQA 1W7PD 3K69A 2OBPA 5LRSA 4IXAA 3REOA 2A6HF 5BPIA 4QWQA 2XASA 5LLQA 2QLZA 3FXRA 4I01A 2ZJ2A 2F5CA 3T5XA 2CFXA 3IKVA 4MQ9F 1OMIA 4DQ2A 2P5LC 1SMYF 5FFZA 4OMYA 1U78A 3PQKA 1DUXC 3MAJA 1UB9A 3LA2A 5F64A 4AD9A 1J59A 3K9TA 3ELKA 1CF7B 3HHHA 5JFRA 4HF0A 2LF7A 1OYIA 3F23A 5DD8A 5FO5A 1Z9CA 1D8KA 5D5UB 1XCVA 2HQNA 4A12A 1UCRA 1IRFA 2A68F 3E6BA 2HOEA 2CYYA 1ON1A 3Q9SA 4HYEA 3GX4X 4L5JA 1YIOA 2XGXA 3BZ6A 1XGMA 2XV4S 2M1BA 3CJNA 2ACJA 3I71A 2GA1A 1T6SA 5DCMA 2CO5A 4S05A 4I7HA 3O3KA 4WK8F 3SZTA 1CF7A 2MH9A 3IHUA 4M9SA 2KJBA 1DPUA 3HUGA 4PCQA 1B6AA 1J2XA 3H92A 4ZYDA 1W5TA 4LB5A 1R5HA 2IT0A 1XB4A 5J8CA 3KP6A 1QPMA 3GFLA 5TJJA 2EFOA 1XCBA 4AIKA 2UXNA 2JRTA 1Z6TA 2IRFG 5EEHA 2P7CB 3WE3A 2JZYA 4HDVA 5AIQA 1LDJA 1D3YA 2XAQA 4HV6A 2A61A 3HRTA 2W85A 3HOSA 5CVIA 1FOKA 4AIJA 1G3WA 5DV5A 3QU6A 1A04A 2ZKZA 2DAOA 1YTYA 2G7UA 1ULYA 2O6GE 3HRMA 5FFXA 1HW2A 3QP6A 1DDNA 4UVCA 1W7PA 4RGUA 1FP1D 4GXOA 5KVRA 4GO1A 3JW4A 2PFBA 3QPTA 3GFIA 4ON0A 3CTAA 1R23A 5K5QA 5H20A 3LFKA 2O61A 3DKWA 2GAUA 4NB5A 3HSFA 4KMFA 3C3WA 4Q5SF 3V7SA 3GUDA 1JGSA 5CJ9A 5DYMA 2EJRA 4L9TA 2K4JA 1FNNA 4UV8A 3BPVA 3E6DA 3KEOA 3NRVA 1O7LA 3RPUA 2GQQA 1R22A 2BGCA 1IW7F 2FRHA 5HDGA 5HDKA 5LEJA 3R60A 2W84A 4BNCA 2C6YA 3U1DA 2UWMA 2RDPA 2Q8KA 4KA4A 2EK5A 1KYWA 4HLYA 5ICCA 5IT9Z 2VOPA 2YR2A 1XGSA 2A3SA 2YU3A 1OYWA 2ZBKA 3E5XA 4UNOA 4U88A 4O5VA 1FSEA 4NQWA 4LGWA 3KP4A 1GXPA 2ZNYA 5IT3A 3I59B 2STWA 4H0EA 2DFIA 3KLNA 1KQ8A 1XGOA 3SHFA 4G7OF 2JPBA 1HSTA 1BBYA 3RJPA 3DQVC 2L54A 5CYVA 4MTDA 2QYOA 2LDUA 2EFWA 5HLGA 4I98B 5CVVA 4BHCA 1S8NA 1XMAA 4A6EA 3QP5A 1IF1A 3ABUA 4LMYA 1U5TB 2ZFWA 3F21A 2KIFA 3CUQA 1YS7A 2DU9A 4ZZDA 3TDUC 4GYGA 3WGGA 5BQTA 1U5TA 4JBAA 2V1DA 4IHTA 2HTSA 4MGRA 5A2QK 4P9UA 1ZAOA 1SFUA 4RB1A 3I5UA 4ENJA 4L0ZB 3RTRA 1ZRFA 2HGCA 3DF8A 4MNUA 2BEOA 1ZHFA 1B4AA 2ADUA 2ZXJA 3F72A 3W6KB 4Q47A 2EFNA 4WXDA 1KQ0A 5BPDA 3DEUA 5LRRA 4KFCA 3IKTA 2ZMEA 2MA3A 2QQBA 1RZ4A 4D0PA 4KNYA 1P4XA 3EETA 3FM3A 4UVAA 4LD5A 2RKHA 5D4SA 3FM5A 2E7XA 1DP7P 2P6TA 4I2OA 3I0TA 4PGHA 3RPQA 4G8XA 2OA4A 3ZMVA 1V4RA 1EH6A 4EJUA 4LFUA 2DPDA 1I1GA 2FOKA 4TV7A 3BROA 1YYVA 3L9FA 2XVCA 4CZZA 4WF2A 2NYXA 1QZZA 2BE5F 2EV6A 5H6QA 4EJVA 3CO6C 3E6CC 2FBKA 4PDKA 3ZN0A 5BS6A 2HWVA 1H9GA 1BI2A 2XUBA 3SXYA 2DT5A 5E1WA 3ISPA 1C0WA 5LHHA 3FZVA 3JTHA 5LGTA 3OV8A 3F22A 4EJTA 4WXHA 3HSEA 1IXRC 1TNSA 4CICA 3TOAA 1B9MA 3U9GA 3GFJA 2KIUA 2O3FA 2MLGA 3ZP5A 1PP7U 2JPCA 3NQOA 1RUNA 1D8JA 4P96A 3WGIA 1U5TC 3RI4A 5LEKA 3HIFA 2FE3A 4KIBA 3KZZA 3DPLC 1CGPA 4A0YA 2H27A 3CUQC 3G3ZA 4RB0A 3DP7A 4DNCA 3L00A 4KMUX 3VB2A 1MJAA 2Z3YA 1BN5A 2VC1A 3ZMZA 3BWGA 1R36A 2G7HA 4P9FA 4R79A 1IUYA 3R4KA 4U7DA 2OQRA 3JTGA 1ZG3A 2J5PA 4EQQA 5DD4A 1YO5C 4MEYF 2V1UA 2K02A 4BH9A 1L0OC 1FYMA 3D5LA 3ERED 3HSRA 3DPTA 2DI3A 1TNTA 2P5KA 3C18A 1BI0A 5JR3A 3IL2A 1FP2A 3T8TA 3WU1B 3QRFF 1UHMA 2KKOA 2ZO4A 4Y17A 2K4BA 3EQLF 3I58A 1BM9A 1T2KA 3JSOA 5F1RA 2DPUA 1WWXA 1HW5A 4BHPA 4ASNA 5LBQA 1ZN2A 5ICGA 1XMKA 2GXBA 1Z6RA 3IC7A 4CXFA 4R1HA 4LG0A 1F1ZA 1U8RA 3FF5A 4JK1X 1BIBA 1IN4A 2FU4A 3KP7A 1YW9A 1K7AA 5D6FA 5D5WB 1EH7A 2M30A 3KP3A 2XAHA 3TGNA 4AIHA 4UUVA 5HLIA 2R3SA 5E8GA 1LVAA 2VN2A 1QO0D 2GZWA 1G4DA 2PN6A 1WKMA 4G7HF 2DK8A 2QENA 2V6CA 1KA8A 2MH2A 1F5TA 3KFWX 4B8XA 2EA4A 1T39A 4MTEA 2MLKA 1P92A 3GO5A 5FLXK 1OKRA 2IA2A 4EM1A 2G9WA 1HBXG 3CDHA 1USSA 1HKTA 2DW4A 5J6XA 1R1VA 1JXSA 2M45A 5FB2A 3HRUA 1LDKB 1TQPA 4EMSA 2DK5A 4K2EA 2GA2A 4ESFA 3FHZA 4P55A 1UFMA 3PQJA 3GVAA 1PP8F 4U0VA 3J81Z 2F5DA 4GYIA 4YIIA 2FNAA 3NEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBS A;  2UZK A;  3ECH A;  1XSX A;  1WQ2 A;  3HTU A;  1DPR A;  1O3S A;  1TTY A;  3J80 K;  3LQQ A;  4A5M A;  2RV8 A;  3E5Q A;  4R8H A;  5ICE A;  1BJA A;  4F7Z A;  2XKP A;  4RS8 A;  5E18 F;  4EGZ A;  2D45 A;  3PFI A;  2IP2 A;  3J81 K;  5AIP A;  3S2W A;  1J7K A;  2PG4 A;  3KZY A;  4LB6 B;  2GIV A;  1NHA A;  3I54 A;  1TW3 A;  3MFK A;  4HDU A;  1HSJ A;  1BI3 A;  4M9X A;  1P4W A;  4HZF A;  3FX3 A;  1R58 A;  2AXL A;  4ENK A;  4KUM A;  4XSX F;  3LQR A;  1SD7 A;  3ZN1 A;  1XDS A;  4A0Z A;  3WTW C;  2GXG A;  4HW0 A;  1X3U A;  3MZH A;  3CLO A;  2KJC A;  3P7N A;  4GCV A;  5K5R A;  1K78 A;  4EGY A;  1FZP B;  2A69 F;  5JHU A;  2EV5 A;  5D8L B;  4IHS A;  5EEG A;  4XRF A;  1ONV A;  2A6E F;  2CGP A;  2DLL A;  2VOO A;  4MHG A;  1QNT A;  2B0L A;  2RGV A;  1VTN C;  5D5X B;  1W4M A;  2VBZ A;  4M9Z A;  4N9I A;  2XIG A;  2PQ8 A;  2BV6 A;  3CUQ B;  1QZY A;  3MEX A;  2IA0 A;  4HX8 A;  1GHC A;  1GVJ A;  1PUE E;  2JT1 A;  4M6X A;  2NS0 A;  4E70 A;  4HLX A;  3LA3 A;  1MJB A;  1LJ9 A;  4LK0 F;  2EFP A;  5E17 F;  4HX4 A;  4O3M A;  1B9N A;  4KIF A;  2PLY A;  4OMZ A;  3WG9 A;  5D4R A;  5F6F A;  1O7F A;  2VE9 A;  2JTV A;  1T0F A;  3HYI A;  1Z91 A;  4ETS A;  2IA1 A;  4FX0 A;  2XAF A;  1Y0U A;  3T8R A;  3ZMU A;  5BOX A;  1FYK A;  3VFZ A;  5BMZ A;  1R5G A;  2H94 A;  6PAX A;  4JQF A;  5HS9 A;  5FD6 A;  4ZZL A;  4A5N A;  1XDU A;  2DTR A;  2RN7 A;  1QBJ A;  2NNN A;  3K1P A;  4Y13 A;  1K79 A;  1P2F A;  5L3D A;  3KET A;  2QQA A;  1RI7 A;  3HOT A;  3ROU A;  2H6B A;  1MZB A;  4XLN F;  4G7Z F;  3TQN A;  2F5E A;  2L01 A;  1U3E M;  3K1N A;  1MD0 A;  1YS6 A;  2HFH A;  5HLH A;  4BQA A;  3BPX A;  1UST A;  2DO7 A;  4L9N A;  3KE2 A;  4KN7 X;  4OIR F;  3Q9V A;  1XD7 A;  3AAF A;  2K27 A;  3V4G A;  1LEB A;  1WI9 A;  2VBY A;  1YFH A;  3WOD F;  5D5V B;  3FMR A;  1H0M A;  1JHF A;  4LG0 B;  2HS5 A;  4YFN F;  2IVM A;  3RKY A;  2PJP A;  2KIM A;  5TRD A;  3F3X A;  5ERI A;  2IW5 A;  4Q4Z F;  4U7B A;  1IN5 A;  3EDP A;  2BYV E;  1Z1D A;  1J5Y A;  2WC2 A;  3VEP A;  1YQA A;  3WTT C;  3E6M A;  1SMT A;  4O6J A;  3L7W A;  2Q2E A;  2Z99 A;  5E8I A;  2HDC A;  2L02 A;  3RYP A;  1ZLJ A;  5JVT A;  2HEO A;  3J7A O;  2FNP A;  3CUO A;  4EJW A;  3RDI A;  2R7F A;  4IRH A;  4G6D A;  5K5O A;  2W24 A;  4NHJ A;  1TBX A;  2JSC A;  2Z33 A;  2HZT A;  2FA5 A;  2VC0 A;  2M87 A;  2X4H A;  4M71 A;  4IPA A;  4CYD A;  3COA C;  5E1Z B;  3KEQ A;  2RNJ A;  3E5U A;  4UV9 A;  1KYZ A;  1IZ1 A;  3KLO A;  2FQ3 A;  2FBI A;  3P9K A;  2ISZ A;  4KT5 C;  3B73 A;  3ZQ7 A;  1J75 A;  1FX7 A;  2J5O A;  1XN7 A;  1SAX A;  2ELH A;  1J9I A;  1WRJ A;  2UXX A;  3LA7 A;  3EYY A;  3R6S A;  3BDD A;  3HRS A;  3JSP A;  2BBY A;  2F5F A;  1JHH A;  2QVO A;  1HKS A;  2DQR A;  2HQR A;  4LJZ F;  4WCG A;  3U2R A;  1YLF A;  1TW2 A;  1HXD A;  1BIA A;  3KCC A;  4RB2 C;  2XAG A;  2DQL A;  3O6B B;  4EV0 A;  4EM0 B;  3FXU A;  4LLL A;  3DXJ F;  4YFX F;  4G6Q A;  5DUK A;  2AS5 F;  1FC3 A;  1O3R A;  2P4W A;  5FGM A;  1ZG1 A;  4KN4 X;  2P8T A;  3MZY A;  4RGS A;  2OQG A;  5LGU A;  4RB3 C;  1ZGJ A;  1G3T A;  5DDG A;  2CWE A;  2VE8 A;  5DEQ A;  1O3T A;  1S29 A;  1T38 A;  3I64 A;  1LEA A;  1RNL A;  1U6G A;  2PBI A;  1MJ9 A;  3V7C A;  3J80 Z;  4Q48 A;  2H09 A;  5ED4 A;  4YFK F;  4IRG A;  4OIP F;  4HF2 A;  3QAH A;  4U0Y A;  5DUI A;  4HBL A;  1FBU A;  3WTZ A;  2XAJ A;  4M6Y A;  3KP5 A;  2A5Y B;  4IJA A;  3LWF A;  3OOP A;  1WSU A;  1YW7 A;  4A2U A;  1LQ1 A;  1ZGA A;  4RGR A;  1F4K A;  2IJL A;  3I53 A;  4BAY A;  3GWZ A;  5ILS A;  3VOD A;  1E17 A;  2P5V A;  4OOI A;  2FSW A;  1P4A A;  3Q5F A;  2P7V B;  3LAP A;  3LAJ A;  2QQ9 A;  1BC8 C;  2OD5 A;  1AOY A;  1B59 A;  1OYY A;  3R0A A;  4GGG A;  2HR3 A;  3L09 A;  4L9V A;  3DV8 A;  4HOB A;  2V9V A;  2VT2 A;  4RAZ A;  1S7O A;  2OU2 A;  3W6J B;  4CGZ A;  4IVN A;  4HA8 A;  4WX9 A;  4KYW A;  2P6S A;  2NRA C;  3MQ0 A;  1KU9 A;  1I27 A;  5LGN A;  2IPQ X;  3WGH A;  3GYH X;  4BXU A;  2HKX A;  4MQV A;  1E2X A;  5A2Q Z;  2HYF A;  2M5W A;  4HQE A;  2Q0O A;  1ZLK A;  5CVU A;  4LLN A;  2FXA A;  4LK1 F;  3D0S A;  4LLG F;  5DCF A;  3RKX A;  1G3S A;  2QWW A;  1K6O A;  4WXC A;  1Q1H A;  1FLI A;  2YSR A;  5CVJ A;  3V7R A;  1TQI A;  2STT A;  2XRO A;  1ZH5 A;  1OR7 A;  1Z7U A;  1D5V A;  4OIN F;  3RIR A;  5E20 A;  4L0Y B;  2XKO A;  1MDM B;  3GXO A;  2RVC A;  2DBB A;  2E1N A;  2MBF A;  4U0W A;  2MC3 A;  5CLS A;  1I6X A;  3LST A;  2D2W A;  2FML A;  2W25 A;  4CDG A;  3BJA A;  1FBQ A;  1KU7 A;  3FXQ A;  1AWC A;  4OIO F;  1I1S A;  2Z9O A;  4FT8 A;  3M8E A;  3TOB A;  3B02 A;  1ZYR F;  3P9I A;  1SD6 A;  1S7A A;  3ZMT A;  4ZYG A;  3GZ6 A;  2E1C A;  5LHG A;  1UHW A;  5HOO A;  4KDP A;  3K0L A;  2EFQ A;  5ILU A;  2D1H A;  3GW2 A;  1KU2 A;  3WTY C;  4QLC U;  4YIF A;  2FF4 A;  2COM A;  4XSZ F;  1YG2 A;  4Y15 A;  3M8F A;  2ESN A;  5K1Y A;  3F6V A;  5CVR A;  2WV0 A;  4HAM A;  3GLX A;  1SD5 A;  3ZPL A;  1IRG A;  1RUO A;  1T98 A;  4FX4 A;  3C1D A;  4OU0 A;  2CW0 F;  3GFM A;  1B1B A;  4XBF A;  1BI1 A;  1IXC A;  3H3U A;  2OZ6 A;  4HX7 A;  1LB2 A;  1KU3 A;  3ABT A;  5JI6 A;  2KRF A;  4YG2 F;  4RGX A;  2NAZ A;  3TDZ C;  1HKQ A;  4L18 B;  4BYY A;  1QQI A;  4CHU A;  3FMS A;  4M73 A;  5ILV A;  3TO9 A;  5FLX Z;  3TO6 A;  4BHB A;  2PEX A;  3F8B A;  1XGN A;  3WU0 A;  4HV5 A;  3F8M A;  4ZYE A;  1R7J A;  3FMQ A;  5DCM B;  4S04 A;  3QPH A;  3WTS C;  2FMY A;  1KQ9 A;  4UVB A;  1ZRC A;  4EM2 A;  2VON A;  2LSO A;  3BY6 A;  1L3L A;  3MCZ A;  3SZP A;  1TQM A;  2CQK A;  3IRR A;  4IRI A;  1MKM A;  1ZG5 A;  3GZ5 A;  2FBH A;  2V1X A;  3TO7 A;  1ODD A;  1REP C;  3ZMD A;  3T1B A;  1FPQ A;  3N4M A;  5HS7 A;  4KIG A;  3N97 A;  2E7W A;  2GWR A;  3M9A A;  1JE8 A;  5HS8 A;  1ZRD A;  4HF1 A;  3E3V A;  2D1V A;  4OIQ F;  3HTS B;  5L3G A;  2EV0 A;  1ZRE A;  4ZH4 F;  5L3F A;  4XLP F;  1BC7 C;  1SD4 A;  2RC4 A;  3ECO A;  3WE2 A;  1IN8 A;  2YX4 A;  2K7L A;  5L3C A;  2EWN A;  4ESB A;  3WTV C;  3C7J A;  3SQN A;  4AWX B;  4L5I A;  5L3B A;  1FYL A;  2QBY B;  3T0Y A;  4G94 A;  5E1X A;  4UHT A;  4ZYH A;  2HKO A;  1PDN C;  4N0B A;  3L2C A;  2QZ8 A;  4RAY A;  4IF4 A;  2ESH A;  2XHK A;  3BOQ A;  4I09 A;  5FD5 A;  1LNW A;  2XRN A;  1IXS B;  5H6R A;  4A0X A;  5LHI A;  1SFX A;  5J8F A;  2LKP A;  3V8L A;  4I0A A;  1RIO H;  4PGG A;  3P9C A;  2K86 A;  3F8F A;  2ZME B;  4MEX F;  5ICF A;  3TKY A;  3KP2 A;  3CO7 C;  3ULQ B;  5D8K B;  2Z5U A;  4HQM A;  1S6L A;  3M7G A;  4KIC A;  2Y75 A;  1S3J A;  1G6N A;  4AVP A;  1G3Y A;  2ZNZ A;  3K1M A;  3GF2 A;  5HVQ C;  3VOE A;  4FHT A;  4P5O A;  2WTE A;  1O57 A;  2VBX A;  2A07 F;  2PMU A;  1EH8 A;  2M8E A;  2O8X A;  2L4M A;  1SFE A;  4L9J A;  1FT9 A;  3RYR A;  3V8J A;  2X0L A;  4G9Y A;  1R1T A;  5HDN A;  1XSD A;  3F8C A;  3F6O A;  2TDX A;  3FWE A;  1W5S A;  4ENN A;  4M72 A;  5KK1 A;  3IRQ A;  1J0R A;  5L3E A;  2O03 A;  4N9H A;  2LF8 A;  1LDD A;  2ETH A;  2HTJ A;  2QM3 A;  3I59 A;  2VBW A;  4ENM A;  2ISY A;  2RQP A;  1XSV A;  2VXZ A;  3DFG A;  5IT9 K;  1FWZ A;  2MD5 A;  2OZU A;  1ON2 A;  3BJ6 A;  1MDM A;  4B09 A;  1U2W A;  2YX7 A;  4I02 A;  4EJO A;  1I5Z A;  2QBY A;  2CG4 A;  3JAM Z;  1HW1 A;  2VT3 A;  3WTX C;  3K2Z A;  2PMH A;  2YPR A;  3MWM A;  3R0J A;  3IWF A;  3GEZ A;  3EYI A;  1V3F A;  2PI0 A;  1FSH A;  4EVI A;  3E97 A;  3G73 A;  1EV7 A;  1YW8 A;  3M1E A;  3WTU C;  2W57 A;  3JAM K;  1OPC A;  2Y48 A;  3F8N A;  2Y0M A;  4M74 A;  5AON A;  2FEZ A;  1R00 A;  2H6C A;  2O0Y A;  2EA2 A;  3R61 A;  3RKW A;  2WWY A;  3IWZ A;  1K78 B;  3ML6 A;  3SFZ A;  2L4A A;  1IAW A;  2LNB A;  4WWC A;  1QGP A;  1H9T A;  1P6R A;  2F2E A;  1F9N A;  3BP8 A;  4ESJ A;  2OAZ A;  1O3Q A;  5D6E A;  2NNY A;  1IN6 A;  3BJO A;  1KGS A;  3QU3 A;  3V8K A;  1IN7 A;  3I4P A;  2CSO A;  4PZJ A;  4A6D A;  2VOD A;  1W7P B;  1ZAR A;  2R7D A;  4CO8 A;  2L3D A;  1R1U A;  1MGT A;  2HYG D;  3H3Z A;  4I0B A;  2EB7 A;  3HHG A;  4Z2Y A;  2V79 A;  2ZCW A;  3ZMS A;  1STZ A;  2QUF A;  3O2P E;  1TLH B;  4UXN A;  1BOA A;  3EUH A;  3QOP A;  1FY7 A;  1Z05 A;  1HQC A;  1GXQ A;  1W7P D;  3K69 A;  2OBP A;  5LRS A;  4IXA A;  3REO A;  2A6H F;  5BPI A;  4QWQ A;  2XAS A;  5LLQ A;  2QLZ A;  3FXR A;  4I01 A;  2ZJ2 A;  2F5C A;  3T5X A;  2CFX A;  3IKV A;  4MQ9 F;  1OMI A;  4DQ2 A;  2P5L C;  1SMY F;  5FFZ A;  4OMY A;  1U78 A;  3PQK A;  1DUX C;  3MAJ A;  1UB9 A;  3LA2 A;  5F64 A;  4AD9 A;  1J59 A;  3K9T A;  3ELK A;  1CF7 B;  3HHH A;  5JFR A;  4HF0 A;  2LF7 A;  1OYI A;  3F23 A;  5DD8 A;  5FO5 A;  1Z9C A;  1D8K A;  5D5U B;  1XCV A;  2HQN A;  4A12 A;  1UCR A;  1IRF A;  2A68 F;  3E6B A;  2HOE A;  2CYY A;  1ON1 A;  3Q9S A;  4HYE A;  3GX4 X;  4L5J A;  1YIO A;  2XGX A;  3BZ6 A;  1XGM A;  2XV4 S;  2M1B A;  3CJN A;  2ACJ A;  3I71 A;  2GA1 A;  1T6S A;  5DCM A;  2CO5 A;  4S05 A;  4I7H A;  3O3K A;  4WK8 F;  3SZT A;  1CF7 A;  2MH9 A;  3IHU A;  4M9S A;  2KJB A;  1DPU A;  3HUG A;  4PCQ A;  1B6A A;  1J2X A;  3H92 A;  4ZYD A;  1W5T A;  4LB5 A;  1R5H A;  2IT0 A;  1XB4 A;  5J8C A;  3KP6 A;  1QPM A;  3GFL A;  5TJJ A;  2EFO A;  1XCB A;  4AIK A;  2UXN A;  2JRT A;  1Z6T A;  2IRF G;  5EEH A;  2P7C B;  3WE3 A;  2JZY A;  4HDV A;  5AIQ A;  1LDJ A;  1D3Y A;  2XAQ A;  4HV6 A;  2A61 A;  3HRT A;  2W85 A;  3HOS A;  5CVI A;  1FOK A;  4AIJ A;  1G3W A;  5DV5 A;  3QU6 A;  1A04 A;  2ZKZ A;  2DAO A;  1YTY A;  2G7U A;  1ULY A;  2O6G E;  3HRM A;  5FFX A;  1HW2 A;  3QP6 A;  1DDN A;  4UVC A;  1W7P A;  4RGU A;  1FP1 D;  4GXO A;  5KVR A;  4GO1 A;  3JW4 A;  2PFB A;  3QPT A;  3GFI A;  4ON0 A;  3CTA A;  1R23 A;  5K5Q A;  5H20 A;  3LFK A;  2O61 A;  3DKW A;  2GAU A;  4NB5 A;  3HSF A;  4KMF A;  3C3W A;  4Q5S F;  3V7S A;  3GUD A;  1JGS A;  5CJ9 A;  5DYM A;  2EJR A;  4L9T A;  2K4J A;  1FNN A;  4UV8 A;  3BPV A;  3E6D A;  3KEO A;  3NRV A;  1O7L A;  3RPU A;  2GQQ A;  1R22 A;  2BGC A;  1IW7 F;  2FRH A;  5HDG A;  5HDK A;  5LEJ A;  3R60 A;  2W84 A;  4BNC A;  2C6Y A;  3U1D A;  2UWM A;  2RDP A;  2Q8K A;  4KA4 A;  2EK5 A;  1KYW A;  4HLY A;  5ICC A;  5IT9 Z;  2VOP A;  2YR2 A;  1XGS A;  2A3S A;  2YU3 A;  1OYW A;  2ZBK A;  3E5X A;  4UNO A;  4U88 A;  4O5V A;  1FSE A;  4NQW A;  4LGW A;  3KP4 A;  1GXP A;  2ZNY A;  5IT3 A;  3I59 B;  2STW A;  4H0E A;  2DFI A;  3KLN A;  1KQ8 A;  1XGO A;  3SHF A;  4G7O F;  2JPB A;  1HST A;  1BBY A;  3RJP A;  3DQV C;  2L54 A;  5CYV A;  4MTD A;  2QYO A;  2LDU A;  2EFW A;  5HLG A;  4I98 B;  5CVV A;  4BHC A;  1S8N A;  1XMA A;  4A6E A;  3QP5 A;  1IF1 A;  3ABU A;  4LMY A;  1U5T B;  2ZFW A;  3F21 A;  2KIF A;  3CUQ A;  1YS7 A;  2DU9 A;  4ZZD A;  3TDU C;  4GYG A;  3WGG A;  5BQT A;  1U5T A;  4JBA A;  2V1D A;  4IHT A;  2HTS A;  4MGR A;  5A2Q K;  4P9U A;  1ZAO A;  1SFU A;  4RB1 A;  3I5U A;  4ENJ A;  4L0Z B;  3RTR A;  1ZRF A;  2HGC A;  3DF8 A;  4MNU A;  2BEO A;  1ZHF A;  1B4A A;  2ADU A;  2ZXJ A;  3F72 A;  3W6K B;  4Q47 A;  2EFN A;  4WXD A;  1KQ0 A;  5BPD A;  3DEU A;  5LRR A;  4KFC A;  3IKT A;  2ZME A;  2MA3 A;  2QQB A;  1RZ4 A;  4D0P A;  4KNY A;  1P4X A;  3EET A;  3FM3 A;  4UVA A;  4LD5 A;  2RKH A;  5D4S A;  3FM5 A;  2E7X A;  1DP7 P;  2P6T A;  4I2O A;  3I0T A;  4PGH A;  3RPQ A;  4G8X A;  2OA4 A;  3ZMV A;  1V4R A;  1EH6 A;  4EJU A;  4LFU A;  2DPD A;  1I1G A;  2FOK A;  4TV7 A;  3BRO A;  1YYV A;  3L9F A;  2XVC A;  4CZZ A;  4WF2 A;  2NYX A;  1QZZ A;  2BE5 F;  2EV6 A;  5H6Q A;  4EJV A;  3CO6 C;  3E6C C;  2FBK A;  4PDK A;  3ZN0 A;  5BS6 A;  2HWV A;  1H9G A;  1BI2 A;  2XUB A;  3SXY A;  2DT5 A;  5E1W A;  3ISP A;  1C0W A;  5LHH A;  3FZV A;  3JTH A;  5LGT A;  3OV8 A;  3F22 A;  4EJT A;  4WXH A;  3HSE A;  1IXR C;  1TNS A;  4CIC A;  3TOA A;  1B9M A;  3U9G A;  3GFJ A;  2KIU A;  2O3F A;  2MLG A;  3ZP5 A;  1PP7 U;  2JPC A;  3NQO A;  1RUN A;  1D8J A;  4P96 A;  3WGI A;  1U5T C;  3RI4 A;  5LEK A;  3HIF A;  2FE3 A;  4KIB A;  3KZZ A;  3DPL C;  1CGP A;  4A0Y A;  2H27 A;  3CUQ C;  3G3Z A;  4RB0 A;  3DP7 A;  4DNC A;  3L00 A;  4KMU X;  3VB2 A;  1MJA A;  2Z3Y A;  1BN5 A;  2VC1 A;  3ZMZ A;  3BWG A;  1R36 A;  2G7H A;  4P9F A;  4R79 A;  1IUY A;  3R4K A;  4U7D A;  2OQR A;  3JTG A;  1ZG3 A;  2J5P A;  4EQQ A;  5DD4 A;  1YO5 C;  4MEY F;  2V1U A;  2K02 A;  4BH9 A;  1L0O C;  1FYM A;  3D5L A;  3ERE D;  3HSR A;  3DPT A;  2DI3 A;  1TNT A;  2P5K A;  3C18 A;  1BI0 A;  5JR3 A;  3IL2 A;  1FP2 A;  3T8T A;  3WU1 B;  3QRF F;  1UHM A;  2KKO A;  2ZO4 A;  4Y17 A;  2K4B A;  3EQL F;  3I58 A;  1BM9 A;  1T2K A;  3JSO A;  5F1R A;  2DPU A;  1WWX A;  1HW5 A;  4BHP A;  4ASN A;  5LBQ A;  1ZN2 A;  5ICG A;  1XMK A;  2GXB A;  1Z6R A;  3IC7 A;  4CXF A;  4R1H A;  4LG0 A;  1F1Z A;  1U8R A;  3FF5 A;  4JK1 X;  1BIB A;  1IN4 A;  2FU4 A;  3KP7 A;  1YW9 A;  1K7A A;  5D6F A;  5D5W B;  1EH7 A;  2M30 A;  3KP3 A;  2XAH A;  3TGN A;  4AIH A;  4UUV A;  5HLI A;  2R3S A;  5E8G A;  1LVA A;  2VN2 A;  1QO0 D;  2GZW A;  1G4D A;  2PN6 A;  1WKM A;  4G7H F;  2DK8 A;  2QEN A;  2V6C A;  1KA8 A;  2MH2 A;  1F5T A;  3KFW X;  4B8X A;  2EA4 A;  1T39 A;  4MTE A;  2MLK A;  1P92 A;  3GO5 A;  5FLX K;  1OKR A;  2IA2 A;  4EM1 A;  2G9W A;  1HBX G;  3CDH A;  1USS A;  1HKT A;  2DW4 A;  5J6X A;  1R1V A;  1JXS A;  2M45 A;  5FB2 A;  3HRU A;  1LDK B;  1TQP A;  4EMS A;  2DK5 A;  4K2E A;  2GA2 A;  4ESF A;  3FHZ A;  4P55 A;  1UFM A;  3PQJ A;  3GVA A;  1PP8 F;  4U0V A;  3J81 Z;  2F5D A;  4GYI A;  4YII A;  2FNA A;  3NEU A; 
#chains in the Genus database with same CATH topology
 1FBS A;  2UZK A;  2GM4 A;  3HOU J;  3ECH A;  1YIJ I;  5F04 A;  5J40 A;  1XSX A;  4YEL A;  4FCY A;  2LFB A;  2H1K A;  1WQ2 A;  3HTU A;  1D1A A;  4F55 A;  5IYC J;  2IS6 A;  5EGO B;  1DPR A;  1O3S A;  1TTY A;  3J80 K;  3LQQ A;  4A5M A;  1HCR A;  2RV8 A;  3E5Q A;  3HJE A;  4R8H A;  4RMN A;  5TIS C;  5ICE A;  3JRH A;  3D5S C;  1BJA A;  5IYB J;  4F7Z A;  2XKP A;  4RS8 A;  5M3F J;  5E18 F;  4EGZ A;  3HM5 A;  2D45 A;  2JA5 J;  3PFI A;  2IP2 A;  3J81 K;  1OCO H;  4BBR J;  5AIP A;  4OAY A;  3S2W A;  1T0F C;  2LP0 A;  3OMY A;  2XGE A;  1J7K A;  2PG4 A;  3CDI A;  3KZY A;  2Y0S A;  4LB6 B;  1YIT I;  3PM1 A;  2GIV A;  3RKQ A;  1SVM A;  1UZC A;  1NHA A;  4DBQ A;  3Q3S A;  2EQR A;  3SDG A;  2EZK A;  3I54 A;  1TW3 A;  1D0Z A;  3MFK A;  4DZJ A;  2E2I J;  4HDU A;  1HSJ A;  3QPL A;  3G2B A;  1BI3 A;  2EIK H;  4M9X A;  1P4W A;  4HZF A;  3FX3 A;  1R58 A;  2AXL A;  3KIO A;  4ENK A;  3K6G A;  5C3E J;  1ENH A;  4KUM A;  4PJN A;  3LQR A;  4XSX F;  1PYV A;  1SD7 A;  1Y56 A;  5F08 A;  2X48 A;  3ZN1 A;  1XDS A;  3A03 A;  3KPH A;  2WAQ N;  4A0Z A;  2VB6 A;  1SFO J;  1IRZ A;  4E6K G;  3WTW C;  4UUT A;  2R7O A;  2GXG A;  4HW0 A;  1X3U A;  3SEQ A;  2HVQ A;  3HZJ A;  4AVZ A;  3MZH A;  3CLO A;  1R5I D;  3S32 A;  1JGG A;  2KJC A;  3BTI A;  3G1L A;  1X3W B;  1MH3 A;  1VQM I;  2DXI A;  3P7N A;  4GCV A;  2JVH A;  4NNJ A;  4CCN A;  5K5R A;  1K78 A;  2KRC A;  2ZB9 A;  3CJR B;  4DOZ A;  4EGY A;  5IP6 A;  1FZP B;  4UB6 C;  1Y0N A;  2A69 F;  5JHU A;  2EV5 A;  1B72 B;  3S1Q J;  3NAR A;  2O7O A;  4BXF A;  5D8L B;  4IHS A;  5EEG A;  2HVR A;  4XRF A;  1ONV A;  4HSR A;  2A6E F;  4AC0 A;  1PVE A;  2RNG A;  1YRN A;  2CGP A;  2HNH A;  2X6W A;  4M6V A;  2DLL A;  4PUS A;  3A0H C;  5HLT A;  2R0Q C;  2VOO A;  4MHG A;  1QNT A;  2B0L A;  2RGV A;  3SDB A;  2E1M C;  1VTN C;  5D5X B;  1W4M A;  2VBZ A;  4M9Z A;  4N9I A;  2XIG A;  4IOC F;  2PQ8 A;  3X2Q H;  2BV6 A;  3CUQ B;  1QZY A;  3MEX A;  4DIQ A;  2IA0 A;  4HX8 A;  3S16 J;  1GHC A;  1GVJ A;  1PUE E;  2HVS A;  2JT1 A;  4M6X A;  2NS0 A;  4NUB A;  4E70 A;  4HLX A;  3LA3 A;  2R93 J;  1JUS A;  1V54 H;  4XN3 A;  3MKL A;  1MJB A;  3DWL E;  3E0J B;  3G1M A;  3RCO A;  1LJ9 A;  3C2B A;  4LK0 F;  2EFP A;  3CZ6 A;  4HX4 A;  3SEZ A;  4O3M A;  1B9N A;  5E17 F;  3S3M A;  4B48 A;  4KIF A;  4FTH A;  2PLY A;  2LRD A;  4OMZ A;  3QQA A;  2WA0 A;  3LSK A;  3WG9 A;  5D4R A;  3OYK A;  4BU2 A;  2YUS A;  5F6F A;  1O7F A;  2VE9 A;  2UUZ A;  2JTV A;  4M3E A;  2L7F P;  1T0F A;  3HYI A;  1Z91 A;  1FIA A;  3AG2 H;  3HC7 A;  4ETS A;  5J1Y A;  2IA1 A;  4FX0 A;  1AHD P;  1EA3 A;  2XAF A;  5CQG A;  2QSH X;  1Y0U A;  3T8R A;  3ZMU A;  5BOX A;  3W2A A;  2DMP A;  2LRE A;  1FYK A;  3VFZ A;  1VQ6 I;  5BMZ A;  1RC9 A;  1R5G A;  2QF7 A;  4V2G A;  1BW6 A;  2H94 A;  6PAX A;  4JQF A;  3VWB A;  5HS9 A;  5FD6 A;  1IG7 A;  4BEH B;  4ZZL A;  2F4M B;  4A5N A;  1XDU A;  2DTR A;  2RN7 A;  5FLM J;  2M2E A;  2DJI A;  2X6Y A;  4CCJ A;  3K4K A;  1QBJ A;  1WI3 A;  2NNN A;  4C3J J;  5F1J A;  1OIS A;  3K1P A;  4DZP A;  4Y13 A;  3FK7 A;  1K79 A;  4BJ5 C;  1P2F A;  5L3D A;  4IX7 A;  3KET A;  2QQA A;  1RI7 A;  3IAS 2;  3HOT A;  4YEJ A;  3ROU A;  3PFY A;  4MLO A;  2COB A;  2H6B A;  1MZB A;  2UV1 A;  4XLN F;  4G7Z F;  3TQN A;  5H2F C;  2F5E A;  2L01 A;  1U3E M;  3GTP J;  3K1N A;  3CCU I;  1MD0 A;  2CUE A;  1YS6 A;  2HFH A;  3IP4 B;  3JRF A;  2R7X A;  4N4N B;  3A1Y A;  5HLH A;  4BQA A;  3SYT A;  4A3G J;  3BPX A;  2GXA A;  3D5R C;  1LE8 B;  1XC5 A;  1UST A;  3AKZ A;  2DO7 A;  4L9N A;  1HOM A;  3KE2 A;  4KN7 X;  1ETK A;  3LMM A;  4OIR F;  2XF7 A;  4ZTF A;  3CF5 F;  4ZDO A;  3Q9V A;  1XD7 A;  3AAF A;  2W4S A;  2K27 A;  3V4G A;  2F48 A;  2LC2 A;  1RET A;  3QOE A;  3OYF A;  1LEB A;  2LK2 A;  1WI9 A;  2VBY A;  1YFH A;  3CCR I;  1NH3 A;  2VQC A;  3WOD F;  2Y9Z A;  5D5V B;  3FMR A;  3VSK A;  1JHF A;  1H0M A;  4LG0 B;  2HS5 A;  2IVM A;  4YFN F;  2P81 A;  3RKY A;  5HNH A;  3CCV I;  1W5C C;  2PJP A;  2BY1 A;  4XMY A;  2DMN A;  2KIM A;  3ASO H;  2FX0 A;  5TRD A;  3F3X A;  5GPA A;  4H4K C;  5ERI A;  2IW5 A;  2LOO A;  4A69 C;  4Q4Z F;  1IC8 A;  4U7B A;  1KON A;  1IN5 A;  1U0J A;  3EDP A;  3OYG A;  1NG6 A;  2XB0 X;  2BYV E;  3GTQ J;  1Z1D A;  1FTZ A;  2R5Z A;  1J5Y A;  2WC2 A;  3VEP A;  5GAG J;  1MND A;  1YQA A;  3WTT C;  1BW5 A;  2K5C A;  3E6M A;  1FOY A;  3NWS A;  4GRI A;  2HYJ A;  1SMT A;  4O6J A;  2VL8 A;  4CCL A;  3KX2 A;  3AG1 H;  3K4C A;  3CCL I;  4FAS D;  1IV8 A;  3L7W A;  2HPM A;  3G4S I;  2Q2E A;  2Z99 A;  3BZC A;  5E8I A;  4XID A;  2HDC A;  3PNT A;  2L02 A;  3RYP A;  1ZLJ A;  1JT6 A;  4Y4R A;  2MAB A;  5JVT A;  2LMD A;  2HEO A;  3J7A O;  2FNP A;  3CUO A;  4EJW A;  3RDI A;  2BVL A;  1XTA A;  2NVU B;  2R7F A;  4DGW B;  2KL4 A;  4LG3 A;  4IRH A;  4G6D A;  3FXL A;  5K5O A;  3BR2 A;  4PJM A;  2W24 A;  3NAU A;  4NHJ A;  1TBX A;  2JSC A;  2Z33 A;  2HZT A;  2FA5 A;  2VC0 A;  1GDT A;  2Q2E B;  3ZOB A;  2M87 A;  2X4H A;  4ZJZ A;  3HKZ N;  3HOY J;  4M71 A;  4IPA A;  4W97 A;  3ZQH A;  4CYD A;  3COA C;  3DLL F;  5E1Z B;  4S0H B;  3KEQ A;  2RNJ A;  1MNE A;  5BNG A;  3E5U A;  4UV9 A;  2BY3 A;  4II2 A;  2WAE A;  1K4S A;  5LD2 C;  1KYZ A;  2WB1 A;  1IZ1 A;  3KLO A;  1PJR A;  2FQ3 A;  4RM2 A;  2FBI A;  3P9K A;  2D5V A;  4LIU A;  2ISZ A;  4KT5 C;  3B73 A;  3ZQ7 A;  4B47 A;  4BE0 A;  3W2W A;  1J75 A;  2DDB A;  3LSH A;  2CV0 A;  1FX7 A;  2J5O A;  1XN7 A;  1SAX A;  3OR1 C;  2ELH A;  3BTL A;  1J9I A;  2L5Q A;  1WRJ A;  2PMZ A;  2UXX A;  1S5L C;  3LA7 A;  4F3Q A;  3EYY A;  3HEF A;  3R6S A;  3BDD A;  3HRS A;  2AQF A;  3JSP A;  2BBY A;  4D5C A;  2F5F A;  1H8A C;  1JHH A;  2JUC A;  3S15 J;  1T33 A;  2QVO A;  2DCE A;  1HKS A;  2DQR A;  2MC4 A;  2HQR A;  4LJZ F;  4WCG A;  2CUZ A;  4XRS G;  4JOM A;  3BQZ A;  3U2R A;  4D5F A;  4NBQ A;  3S1N J;  1VND A;  1YLF A;  1TW2 A;  5B1B H;  1HXD A;  1MSF C;  4A3L J;  4PJJ A;  3S3N A;  2GOM A;  1BIA A;  3KCC A;  1BR4 A;  3H0D A;  5KAI C;  4RB2 C;  4E7L A;  2HXI A;  2XAG A;  1YI2 I;  2DQL A;  3O6B B;  2MGQ A;  1K4T A;  4EV0 A;  1YRN B;  2QQ8 A;  2QSF X;  1JKP C;  3HXL A;  4EM0 B;  5CQE A;  3GZN B;  3FXU A;  4D7M A;  4LLL A;  1OLT A;  2KDZ A;  5B66 C;  3DXJ F;  4YFX F;  2E36 A;  4G6Q A;  4B3A A;  5DUK A;  3A01 B;  2AS5 F;  1FC3 A;  1QVU A;  1O3R A;  2P4W A;  2BHY A;  4XON A;  5FGM A;  1ZG1 A;  4KN4 X;  2P8T A;  4BBS J;  3MZY A;  4RGS A;  1V5E A;  2OQG A;  3CMM A;  1TL8 A;  1MMN A;  2EIL H;  5LGU A;  1MNM C;  5E3O A;  1JI8 A;  4RB3 C;  1QHG A;  1T08 B;  2CJJ A;  3M3Y J;  4BQQ A;  3LSI A;  1X4P A;  2BXY A;  1ZGJ A;  1G3T A;  5DDG A;  3PUF A;  3HOV J;  2DA5 A;  5GAH J;  2CWE A;  2VE8 A;  2QEX I;  5DEQ A;  1O3T A;  1S29 A;  4RA2 A;  3S14 J;  3JRA A;  3OSG A;  1Y1W J;  1T38 A;  3Q0V A;  3I64 A;  1LEA A;  2ICW G;  2PBI A;  1RNL A;  1U6G A;  1M1E B;  3JRC A;  1MJ9 A;  3FDY A;  3OL3 A;  3V7C A;  3J80 Z;  3MKW B;  4Q48 A;  3KYL A;  2H09 A;  2W1O A;  3L2W A;  2AQE A;  5ED4 A;  4YFK F;  4IRG A;  4OIP F;  4HF2 A;  3QAH A;  4U0Y A;  3CCS I;  5DUI A;  4HBL A;  1FBU A;  2XB5 A;  2V6E A;  3WTZ A;  2XAJ A;  1X1D A;  3S2H J;  2DOD A;  2HQ5 A;  5C44 J;  3MZ8 A;  4M6Y A;  4PK4 A;  4XKB A;  4W1U A;  3OYD A;  2DFF A;  2VQH A;  2ZXI A;  3KP5 A;  2JQ7 A;  5EEA A;  2A5Y B;  4IJA A;  3LWF A;  2Y30 A;  5EZG A;  3OOP A;  1WSU A;  1YW7 A;  4A2U A;  1LQ1 A;  4MO7 A;  3QYB A;  1ZGA A;  2BW3 B;  3ZXS A;  4RGR A;  3SFI A;  4E4H A;  1F4K A;  2KMU A;  2IJL A;  3I53 A;  2WBM A;  4BAY A;  2DJN A;  2LY9 A;  1SC7 A;  1S7E A;  3GWZ A;  5ILS A;  3VOD A;  3VSL A;  1E17 A;  2P5V A;  5J4V A;  1VQO I;  4OOI A;  1R4N B;  2FSW A;  1E3H A;  1P4A A;  3Q5F A;  2P7V B;  3LAP A;  3LAJ A;  2QQ9 A;  4HRI A;  3PSI A;  2HPI A;  2OD5 A;  1BC8 C;  1AOY A;  1Y8Q B;  2MW8 A;  1R71 A;  4IOA F;  1B59 A;  1OYY A;  1GT0 C;  3R0A A;  3LSG A;  4GGG A;  2HR3 A;  3L09 A;  5F27 A;  2JVG A;  1BA5 A;  4B3X A;  3DBH B;  4L9V A;  3DV8 A;  4HOB A;  2V9V A;  3CMY A;  3MKY B;  3PO3 J;  2VT2 A;  4RAZ A;  1S7O A;  2OU2 A;  2YU9 J;  3IH3 A;  3W6J B;  5JHF A;  4CGZ A;  4D7N A;  4IVN A;  4HA8 A;  1D5Y A;  4WX9 A;  3DEW A;  1VQ8 I;  4KYW A;  2P6S A;  2NRA C;  3MQ0 A;  1KU9 A;  2GIZ A;  2EIN H;  1VQP I;  3AL0 B;  1I27 A;  5IP9 J;  1TWA J;  5LGN A;  2IPQ X;  2Y9Y A;  1ZGW A;  4XLA A;  2OCE A;  4HST A;  4JP0 A;  1IRX A;  4CSW A;  2PJR A;  3WGH A;  3UR3 C;  1RPW A;  1ZK8 A;  2WY8 Q;  3H5R A;  3OYJ A;  4BXU A;  3GYH X;  3L2V A;  3UKG A;  2HKX A;  3TP0 A;  2N8G A;  4MQV A;  1W1W E;  3ZQF A;  1E2X A;  5A2Q Z;  2HYF A;  2M5W A;  2V1N A;  1D1B A;  4HQE A;  2Q0O A;  1ZLK A;  5CVU A;  4LLN A;  3BR0 A;  2FXA A;  4LK1 F;  3D0S A;  1Y8R B;  5E79 C;  4A3B J;  4EEF G;  4LLG F;  5DCF A;  3RKX A;  1TZL A;  4A3C J;  1G3S A;  2QWW A;  1K6O A;  2RRE A;  2CH0 A;  1Z21 A;  4WXC A;  2JK3 A;  5EG0 B;  1J09 A;  1Q1H A;  4G6T B;  1FLI A;  2YSR A;  3F0C A;  2DDA A;  5CVJ A;  4E7I A;  3NWT A;  4GDF A;  2KIS A;  3BTJ A;  1ITY A;  5DTD A;  5B3S H;  3V7R A;  1TQI A;  2STT A;  1MBF A;  4C30 A;  2XRO A;  4XN0 A;  4NDL A;  1ZH5 A;  1WGX A;  1OR7 A;  5M5Y J;  1Z7U A;  1D5V A;  4OIN F;  3RIR A;  3Q0W A;  5E20 A;  1WPK A;  4L0Y B;  4CH7 A;  1MMA A;  3BR3 A;  2WV1 A;  4PSX A;  2M4K A;  2XKO A;  3GTG J;  2KZV A;  1MDM B;  4ZDP A;  3GXO A;  2RVC A;  2DBB A;  2E1N A;  2MBF A;  5E3L A;  4U0W A;  5J3L A;  2MC3 A;  5CLS A;  4G12 A;  4GFB A;  1I6X A;  3LST A;  3CME I;  3HUG B;  2D2W A;  2FML A;  2W25 A;  2B63 J;  2CQX A;  4CDG A;  3BJA A;  3I9V 2;  3HDD A;  1R4M B;  1FBQ A;  4F52 A;  3LSP A;  1KU7 A;  3FXQ A;  1AWC A;  2NVQ J;  3OYB A;  2E1O A;  1T8I A;  3BR6 A;  4OIO F;  1I1S A;  4CCO A;  4Y3O A;  3QYE A;  5DS9 A;  2Z9O A;  2V9P A;  4FT8 A;  3M8E A;  4CCK A;  1Y1V J;  2WAQ A;  3TOB A;  3IV5 A;  3B02 A;  1ZYR F;  3P9I A;  1SD6 A;  3B6A A;  1S7A A;  3PIP F;  1VQK I;  3M1C A;  5IOZ A;  5CPR B;  3ZMT A;  2X1C A;  4ZYG A;  3GZ6 A;  2E1C A;  1FOW A;  5LHG A;  2Z2S B;  2Z1D A;  1FMV A;  3FKI J;  4F92 B;  1UHW A;  5HOO A;  4KDP A;  2XSD C;  4PSW A;  4X6A J;  2DOF A;  3K0L A;  5GAE J;  2EFQ A;  5ILU A;  2D1H A;  1ETW A;  2XGC A;  1UG2 A;  3GW2 A;  5FRN A;  5IYD J;  2DA7 A;  3GCM A;  3A02 A;  1KU2 A;  4XOP A;  3WTY C;  4QLC U;  1WCM J;  4YIF A;  2FF4 A;  4Y7N J;  2COM A;  1TT0 A;  2OF7 A;  2R7S A;  1BR2 A;  4I76 A;  3S3O A;  4XSZ F;  2V7F A;  1YG2 A;  2L7M P;  3CCE I;  3ABL H;  1PUF A;  2L0K A;  2HXO A;  4Y15 A;  1YX3 A;  3AG4 H;  3M8F A;  3OIO A;  1W36 C;  2ESN A;  5K1Y A;  3F6V A;  3S1R J;  5CVR A;  2WV0 A;  2DA6 A;  1UG0 A;  2RAE A;  4HAM A;  2WAD A;  3GLX A;  3FXO A;  1SD5 A;  3ZPL A;  1WFX A;  3VYU B;  4RBO A;  1IRG A;  3CQZ J;  4V2F A;  1RUO A;  3HGG A;  1T98 A;  2X85 A;  1GUU A;  4FX4 A;  1XX5 A;  3W2V A;  3C1D A;  3PIO F;  3K4L A;  3CC2 I;  2R7U A;  2CFO A;  3E7L A;  4NC8 A;  3IAM 2;  1HC8 A;  2ID6 A;  4OU0 A;  2CW0 F;  2HDD A;  3GFM A;  2H8W A;  3HGY A;  5M5W J;  1B1B A;  4XBF A;  1BI1 A;  3IH4 A;  3H3U A;  1IXC A;  2OZ6 A;  3HBL A;  1E0E A;  3DTI A;  4HX7 A;  2ZSH B;  1WH5 A;  1LB2 A;  4RAG A;  1KU3 A;  3ABT A;  5JI6 A;  2KRF A;  5C4X J;  4YG2 F;  4RGX A;  2NAZ A;  3TDZ C;  1HKQ A;  3BLY A;  4L18 B;  4BYY A;  1QQI A;  1SAU A;  3KEY A;  3PJR A;  4CHU A;  3FMS A;  4M73 A;  3CCY A;  3OIQ A;  5ILV A;  3TO9 A;  1QHH D;  3S93 A;  5FLX Z;  1K61 A;  4QIW N;  3TO6 A;  3BT9 A;  4BHB A;  2PEX A;  3F8B A;  2GBY A;  3A2K A;  1XGN A;  3CD6 I;  3WU0 A;  4IEJ A;  4HV5 A;  4XKW A;  3F8M A;  2CW8 A;  4ZYE A;  1R7J A;  3FMQ A;  3G6E I;  5DCM B;  4IO9 F;  4P1W A;  3DTK A;  4S04 A;  3QPH A;  1DU6 A;  3IH2 A;  3A01 A;  5JLX A;  1IO2 A;  3WTS C;  2FMY A;  3OYC A;  3ZQC A;  1KQ9 A;  3OS2 A;  3K10 A;  2X9D A;  3GBG A;  4UVB A;  1TP4 A;  2VQG A;  1ZRC A;  2M3A A;  4PFO A;  4EM2 A;  2VON A;  1JTY A;  2LSO A;  2KPM A;  3BY6 A;  3FBN B;  4ZC3 A;  1ZEL A;  1L3L A;  4AM3 A;  3MCZ A;  3SZP A;  1TQM A;  2HDW A;  2CQK A;  2LYC A;  3IRR A;  3VYS B;  3K70 C;  1S72 I;  1H88 C;  4A3F J;  4IRI A;  1MKM A;  1P7J A;  2VLA A;  3VYR B;  1ZG5 A;  2RQQ A;  2LBF A;  3GZ5 A;  2FBH A;  2V1X A;  3TO7 A;  1ODD A;  3OYL A;  2L9N A;  1P7I A;  2VKH A;  2R7V A;  1REP C;  2MFZ A;  3ZMD A;  3T1B A;  1FPQ A;  3GLL A;  1ETX A;  2KDO A;  4AYB A;  3N4M A;  5HS7 A;  4KIG A;  2NOG A;  3N97 A;  2E7W A;  2NVY J;  3H9J A;  3BC8 A;  2B7E A;  2DOA A;  2GWR A;  3W3C A;  3M9A A;  1JE8 A;  2OPT A;  5HS8 A;  1ZRD A;  2E1M B;  1WJB A;  9ANT A;  3U21 A;  4HF1 A;  3E3V A;  4AID A;  3EUA A;  2D1V A;  1WJE A;  2LKS A;  1NK2 P;  1DU0 A;  4OIQ F;  5HNF A;  3HTS B;  3FXK A;  1N77 A;  2FJ1 A;  5L3G A;  2EV0 A;  1ZRE A;  2ELJ A;  4DYQ A;  4ZH4 F;  3CF2 A;  4B43 A;  5L3F A;  4XLP F;  1BC7 C;  5K7F A;  3OSF A;  1SD4 A;  2RC4 A;  3ECO A;  2AHQ A;  3WE2 A;  3DLA A;  1IN8 A;  3BQY A;  3AFH A;  2LBF B;  1QA6 A;  2YX4 A;  1WJD A;  2R92 J;  2K7L A;  5L3C A;  2EWN A;  4ESB A;  3WTV C;  2CMP A;  3C7J A;  3MKZ A;  3SQN A;  4AWX B;  4L5I A;  5L3B A;  2LD5 A;  1FYL A;  2K9L A;  2QBY B;  3T0Y A;  4G94 A;  4AU7 A;  5E1X A;  1A36 A;  5IP7 J;  4UHT A;  3B6C A;  4ZYH A;  2HKO A;  4KJZ A;  2O9L A;  2QKM B;  1PDN C;  3GME A;  4MFD A;  3GTK J;  2ZXW H;  4N0B A;  1DQU A;  3L2C A;  2ZJQ F;  2EH3 A;  2QZ8 A;  2DYS H;  3AG3 H;  4RAY A;  4XM3 A;  4IF4 A;  2ESH A;  2XHK A;  3BOQ A;  2DA2 A;  4I09 A;  4BJT A;  5FD5 A;  2ZJR F;  3OS0 A;  1LNW A;  1V5F A;  3DBR B;  2XRN A;  1IXS B;  3ONQ A;  3ZR8 X;  2KLO A;  2R5Z B;  5H6R A;  4DW6 A;  2Y0S N;  4A0X A;  5LHI A;  1SFX A;  1DP3 A;  4XLF A;  1D1C A;  5J8F A;  1TWC J;  5FRO A;  2X51 A;  2LKP A;  5FLV A;  3FK6 A;  1QRY A;  2X6X A;  3V8L A;  4I0A A;  1RIO H;  4PGG A;  3TL4 X;  3P9C A;  4ABZ A;  3FXJ A;  1JKR C;  1DGW Y;  2K86 A;  3H9G A;  3F8F A;  4BGD A;  4L5E A;  3LNQ A;  1MBE A;  2ZME B;  4MEX F;  5ICF A;  3TKY A;  2ZC2 A;  2E35 A;  3KP2 A;  3S2D J;  4HNU A;  2VJ5 A;  5KHD A;  3CO7 C;  2VUM J;  3ULQ B;  2QA4 I;  5D8K B;  2Z5U A;  2E71 A;  4BDY A;  4HQM A;  3GTM J;  4A3M J;  1QVT A;  1AU7 A;  3DU6 A;  3CCM I;  4BUP A;  3J7Z I;  2R5Y B;  1S6L A;  1Z77 A;  3M7G A;  4KIC A;  2Y75 A;  4C9Y A;  1S3J A;  1G6N A;  4XIC A;  1G3Y A;  1SFK A;  4AVP A;  1WVR A;  2ZNZ A;  3W6V A;  3K1M A;  3GF2 A;  5HVQ C;  3C2H A;  3VOE A;  1YJW I;  4FHT A;  4P5O A;  4BKX A;  2WTE A;  1O57 A;  1NG7 A;  1LE8 A;  2VBX A;  1EKE A;  1YE9 A;  3VYT B;  2A07 F;  2PMU A;  4CYC A;  1EH8 A;  2M8E A;  1B8I B;  2O8X A;  2VPL A;  2XF5 A;  4AYB N;  1X2M A;  2X6O A;  2L4M A;  1SFE A;  1VQ4 I;  2R7T A;  1Z67 A;  1X1P A;  2K3P A;  1BOB A;  4L9J A;  1FT9 A;  3RYR A;  1WJC A;  2L7K A;  3V8J A;  2CQ7 A;  1D0X A;  2X0L A;  4G9Y A;  1R1T A;  3WG7 H;  2R7R A;  3CP8 A;  4RLF A;  5HDN A;  1XSD A;  3F8C A;  2XPW A;  3F6O A;  3PUB A;  2TDX A;  3FWE A;  1W5S A;  3KZI C;  2H8R A;  3I55 I;  1TC3 C;  4ENN A;  2MYS A;  4M72 A;  4BEH A;  2FQ4 A;  5J4Y A;  3ZQQ A;  4MFE A;  5KK1 A;  1OQY A;  5K7Z A;  3GTL J;  1G2H A;  3IRQ A;  4J00 A;  2LG4 A;  3A0B C;  4BJ6 C;  1J0R A;  1VFC A;  5L3E A;  2K40 A;  2O03 A;  4N9H A;  4BXX J;  1FTT A;  2LF8 A;  1LDD A;  2ETH A;  2HTJ A;  2QM3 A;  3I59 A;  3RQI A;  5DM6 F;  2ACJ A;  2VBW A;  4ENM A;  1X2N A;  1ZQ3 P;  2ISY A;  2RQP A;  1BL0 A;  2VPR A;  1XSV A;  2OV7 A;  1T56 A;  2VXZ A;  2KP6 A;  3JRI A;  3DFG A;  5IT9 K;  4PJ0 C;  1IDZ A;  1FWZ A;  2MD5 A;  2OZU A;  4U87 A;  4V19 K;  1ON2 A;  3BJ6 A;  1MDM A;  4B09 A;  2V4J C;  2E2H J;  3J7A Y;  1U2W A;  2YX7 A;  4I02 A;  4XLC A;  4EJO A;  1I5Z A;  4F91 B;  2QBY A;  3RQ4 A;  2CG4 A;  3JAM Z;  3LL7 A;  1TWG J;  5C4J J;  2JA6 J;  2X1E A;  1UJ8 A;  1ACI A;  1HW1 A;  4BDZ A;  2LY1 A;  3SZG A;  2VT3 A;  3WTX C;  3K2Z A;  2PMH A;  2ECC A;  2YPR A;  3MWM A;  3G71 I;  5IY5 H;  3ZQG A;  3R0J A;  3IWF A;  3GEZ A;  1I3Q J;  3EYI A;  1V3F A;  2ZJP F;  3CC7 I;  2PI0 A;  1FSH A;  4EVI A;  1FIP A;  3Q0U A;  1TT5 B;  3E97 A;  2ME0 A;  3G73 A;  1EV7 A;  3FIS A;  1YW8 A;  3M1E A;  3U1K A;  2W48 A;  3WTU C;  2W57 A;  3JAM K;  1OPC A;  3QPS A;  2Y48 A;  1NK3 P;  1OJL A;  3F8N A;  2WY7 Q;  3KYD B;  2Y0M A;  2OTJ I;  4M74 A;  4DBR A;  2H1L A;  2VKV A;  5AON A;  4B1R A;  2FEZ A;  1OCT C;  4JX4 A;  1R00 A;  1JJ6 C;  2H6C A;  2O0Y A;  2EA2 A;  3R61 A;  1ZR2 A;  3RKW A;  2K3F A;  4D9J A;  2WWY A;  1QU3 A;  3IWZ A;  1K78 B;  3ML6 A;  5J1R A;  1T95 A;  2E60 A;  5FKM A;  3SFZ A;  2L4A A;  3EPZ A;  2LNB A;  4WWC A;  1IAW A;  1QGP A;  3WU2 C;  4CCM A;  2DTZ A;  3JRG A;  2LTP A;  2VJJ A;  1H9T A;  1P6R A;  2F2E A;  3BG5 A;  1F9N A;  3BP8 A;  4ESJ A;  1FOX A;  2ZME C;  3GTO J;  4FIS A;  2OAZ A;  1O3Q A;  5B1A H;  1Q1V A;  3BG3 A;  5D6E A;  2M7A A;  4A3D J;  3S17 J;  2TCT A;  2NNY A;  2VIX A;  1IN6 A;  2NS7 A;  3BJO A;  1KGS A;  3QU3 A;  5E3N A;  3V8K A;  1IN7 A;  2E5N A;  4OWR B;  1ETV A;  4XKV A;  2VQL A;  1A5J A;  3I4P A;  2CSO A;  1VQ9 I;  3CP2 A;  4PZJ A;  2IS4 A;  4BY1 J;  4A6D A;  2VOD A;  1W7P B;  1ZAR A;  1BJZ A;  3BR5 A;  3MD2 A;  2R7D A;  4CO8 A;  2DT7 B;  2L3D A;  3A4C A;  2DOE A;  3VDX A;  4A3E J;  1R1U A;  3BG6 A;  1MGT A;  5KAF C;  4C2U A;  2HYG D;  3H3Z A;  2LR8 A;  3HPH A;  1N25 A;  2EB7 A;  4I0B A;  4CA0 A;  3HHG A;  4Z2Y A;  2V79 A;  2ZCW A;  5K7H A;  3ZMS A;  3K70 D;  1STZ A;  2QUF A;  1XMX A;  2QSG X;  2L7Z A;  3O2P E;  5EGO A;  1TLH B;  4UXN A;  1BOA A;  3EUH A;  3H3V K;  3QOP A;  1HF0 A;  4YRV A;  1FY7 A;  3K4N A;  1Z05 A;  1HQC A;  1A31 A;  1UHS A;  1GXQ A;  1W7P D;  2XAU A;  3K69 A;  2OBP A;  3HG9 A;  1LUJ B;  1I6H J;  1SAN A;  5LRS A;  4IXA A;  3RZD J;  3D1N I;  3REO A;  3QYF A;  2A6H F;  5BPI A;  4QWQ A;  2XAS A;  5LLQ A;  2QLZ A;  3FXR A;  2DN0 A;  4I01 A;  1FEX A;  2ZJ2 A;  2F5C A;  3T5X A;  2R4G A;  2CFX A;  2DA4 A;  3ERM A;  3IKV A;  1AA7 A;  1OMI A;  4M3G A;  4MQ9 F;  4KT6 A;  2HOT A;  4DQ2 A;  2P5L C;  1SMY F;  5FFZ A;  4OMY A;  1U78 A;  3PQK A;  3ZQI A;  4E7J A;  2VXD A;  1YJ9 I;  1DUX C;  3MAJ A;  4YIR X;  1UB9 A;  1YJN I;  2BXZ A;  3LA2 A;  5F64 A;  2HZD A;  4AD9 A;  2KRH A;  1J59 A;  3K9T A;  4XOR A;  1UMQ A;  3ELK A;  2M4G A;  1CF7 B;  3HHH A;  5JFR A;  2ELK A;  2Y69 H;  4HF0 A;  2LF7 A;  1OYI A;  3F23 A;  3PSF A;  3DEE A;  3BCA A;  5DD8 A;  4RM3 A;  1MMS A;  1WJF A;  5FO5 A;  2NS8 A;  3FXM A;  4NC7 A;  3RPU D;  2VKD A;  1D8K A;  1Z9C A;  5D5U B;  1XCV A;  2HQN A;  4A12 A;  1VI0 A;  1RR7 A;  4UUS B;  1UCR A;  2DMQ A;  3JRE A;  3ASN H;  5EJC A;  3FBI B;  1IRF A;  3ZCO A;  2A68 F;  2K9Q A;  3E6B A;  2HOE A;  2IBD A;  3OYI A;  2CYY A;  1ON1 A;  3Q9S A;  2YS9 A;  4M3F A;  4HYE A;  3I56 I;  3GX4 X;  4L5J A;  1YIO A;  1IDY A;  3EUK L;  3OL4 A;  3F9K A;  3TBI A;  2BZT A;  2XGX A;  4FE7 A;  1OCR H;  2BY2 A;  4C2M J;  3BZ6 A;  1XGM A;  2XV4 S;  5GTI C;  3CES A;  4UUS A;  3DPU A;  3H35 A;  3TP3 A;  5LFA A;  2M1B A;  3IUO A;  3CJN A;  3I71 A;  2IGO A;  2GA1 A;  1T6S A;  2NOJ B;  3QWL A;  5DCM A;  2Y2Z A;  5FKN A;  3K7A J;  2CO5 A;  5EYR A;  4S05 A;  2IAI A;  4I7H A;  2O5R A;  3K4M A;  2R7W A;  1W0T A;  4FET A;  2KQR A;  1POG A;  3O3K A;  4II3 A;  2VJ4 A;  3LSJ A;  1A6Q A;  4WK8 F;  1RR8 C;  1WZ2 A;  1KZH A;  4NQW B;  3SZT A;  1CF7 A;  2MH9 A;  3CJQ B;  3IHU A;  4M9S A;  2KJB A;  2PMZ N;  3WHC A;  1MBH A;  1DPU A;  3HUG A;  4PCQ A;  1B6A A;  1J2X A;  1MMG A;  3H92 A;  4ZYD A;  4BE2 A;  1RKT A;  4ITV A;  4D1Q A;  2OC6 A;  3CDL A;  1XG1 A;  2L9S A;  1W5T A;  1X19 A;  4LB5 A;  4QPQ A;  1R5H A;  1LFP A;  3OYM A;  2LKX A;  3ABK H;  2IT0 A;  3DTE A;  4C2T A;  4IQJ A;  3I4N J;  3G1O A;  1XB4 A;  1AKH B;  5J8C A;  2IGN A;  3KYC B;  5F0F A;  3M8J A;  3KP6 A;  1QPM A;  1QZE A;  3O8G A;  3GFL A;  4JYK A;  5TJJ A;  2EFO A;  1XCB A;  3DKX A;  1X4O A;  4AIK A;  2W00 A;  2UXN A;  3WHB A;  2JRT A;  1JUM A;  4X0G A;  1Z6T A;  2MSY A;  3HOX J;  3HL2 A;  2IRF G;  2Q1Z B;  5EEH A;  3C2G A;  2IS1 A;  3WE3 A;  4QTR A;  2P7C B;  2JZY A;  1WJA A;  3OYN A;  4HDV A;  1VQ7 I;  5AIQ A;  1LDJ A;  1D3Y A;  2XAQ A;  4HV6 A;  1N75 A;  2A61 A;  1OCP A;  3BZK A;  5JVG F;  4BE1 A;  3HRT A;  2W85 A;  2ID3 A;  3HOS A;  4OAZ A;  5CVI A;  1FOK A;  3QOD A;  4IKF A;  2JA7 J;  4LIT A;  2XPV A;  5GTH C;  4AIJ A;  1G3W A;  1X3Z B;  1GLN A;  3GTJ J;  1U9O A;  2JRM A;  3QU6 A;  2JN6 A;  2CRG A;  3ABM H;  5DV5 A;  2GLO A;  1A04 A;  2FUG 2;  2ZKZ A;  2DAO A;  1YTY A;  1K6Y A;  4J19 A;  1F36 A;  3L2Q A;  2G7U A;  3MN2 A;  3CMA I;  1ULY A;  2O6G E;  3HRM A;  5FFX A;  2LVS A;  4C3H J;  3QP6 A;  1HW2 A;  1DDN A;  4UVC A;  1W7P A;  2ZFU A;  2XDV A;  4RGU A;  1FP1 D;  5J1U A;  3HOW J;  1D0Y A;  1GV5 A;  2JA2 A;  2A05 A;  2R7Z J;  1Z0X A;  4XRM A;  4E7Z A;  4GXO A;  1X1A A;  1I50 J;  2DA3 A;  5KVR A;  4GO1 A;  3JW4 A;  4XLE A;  2M0M A;  2Z16 A;  1VQ5 I;  2M8G X;  2M0C A;  2CQN A;  3AL0 C;  2PFB A;  4A3I J;  3QPT A;  3GFI A;  3M4O J;  2K9S A;  2E5Z A;  2BVM A;  4ON0 A;  3S8P A;  1MIJ A;  5EF6 A;  3CTA A;  1R23 A;  5K5Q A;  5KCM A;  5H20 A;  2E19 A;  4BQO A;  3LFK A;  5J47 A;  3DKW A;  2XSJ C;  1YX5 A;  2GAU A;  4NB5 A;  1RES A;  2O61 A;  3HSF A;  4KMF A;  1GVD A;  2VJI A;  3C3W A;  4Q5S F;  4BL0 B;  3V7S A;  3H5A A;  2XRL A;  2I10 A;  3CJT B;  3GUD A;  1JGS A;  4I6Z A;  5CJ9 A;  4FQG A;  1LPQ A;  5DYM A;  2EJR A;  1A6I A;  4L9T A;  2K4J A;  4BY7 J;  1B8I A;  1UEL B;  2IGM A;  1FNN A;  4UV8 A;  3BPV A;  2WB1 N;  2CUJ A;  3E6D A;  3KEO A;  3NRV A;  4E7H A;  1APL C;  5F0C A;  3CCJ I;  1O7L A;  3RPU A;  2GQQ A;  4E7S A;  3HPG A;  1R22 A;  2CW7 A;  3TED A;  5B5E C;  2BGC A;  1IW7 F;  2FRH A;  5HDG A;  1WHU A;  2IEK A;  5HDK A;  4XR6 A;  4XOT A;  2JJ7 A;  1RKW A;  4ZTJ A;  5LEJ A;  2F5V A;  3R60 A;  2W84 A;  5IOY A;  1E3O C;  4BNC A;  2C6Y A;  3OY9 A;  5EG0 A;  3OYH A;  4XKC A;  3U1D A;  4IHY A;  4DYC A;  2UWM A;  1HA8 A;  1EJ9 A;  4B4C A;  3EUH C;  4XL9 A;  3JRD A;  5FKO A;  1AKH A;  4X1E A;  1X1C A;  1P9Q C;  3K4J A;  5EZH A;  2RDP A;  3H5N A;  2Q8K A;  4C3I J;  4RDU A;  4KA4 A;  2EK5 A;  1KYW A;  2FOW A;  1VQL I;  4HLY A;  5ICC A;  5IT9 Z;  2OUM A;  2EPF A;  2P0W A;  2M7B A;  2VOP A;  2YR2 A;  1R9T J;  2DYR H;  4LIV A;  1JT0 A;  1XGS A;  1K83 J;  1MW7 A;  2A3S A;  2YU3 A;  2K9M A;  1OYW A;  2CS3 A;  2EZH A;  4XLH A;  2ZBK A;  3E5X A;  1G59 A;  4UNO A;  4U88 A;  4O5V A;  1FSE A;  4NQW A;  2Y31 A;  2CV2 A;  3BG7 A;  2R7Q A;  4LGW A;  5E3M A;  2LY2 A;  3KP4 A;  1I3A A;  3OIP A;  1GXP A;  2AO9 A;  2ZNY A;  3J7Y J;  5IT3 A;  2EIM H;  3I59 B;  2STW A;  4H0E A;  2DFI A;  3KLN A;  3L2U A;  1KQ8 A;  1XGO A;  3SHF A;  4G7O F;  3K2A A;  4N4O B;  2JPB A;  4F93 B;  1HST A;  1BBY A;  4A3J J;  3RZO J;  3RJP A;  3DQV C;  2L54 A;  5CYV A;  1W36 D;  4MTD A;  2QYO A;  1IJW C;  2LDU A;  1SVL A;  2EFW A;  5HLG A;  1SEU A;  3LOC A;  4I98 B;  5CVV A;  4BHC A;  1S8N A;  1XMA A;  2CU7 A;  4A6E A;  4UY8 I;  3QP5 A;  4DYR A;  1IF1 A;  3ABU A;  4IL6 C;  4LMY A;  1U5T B;  2W7N A;  2ZFW A;  3F21 A;  2KIF A;  3MVP A;  5EDN A;  1YHQ I;  2PX9 A;  3CUQ A;  2M9H A;  1YS7 A;  2QGU A;  2DU9 A;  4ZZD A;  3TDU C;  2K9N A;  4FE4 A;  2QCO A;  4GYG A;  4HNV A;  2EBI A;  1JKO C;  1MBJ A;  4Y52 J;  3WGG A;  1OCZ H;  5BQT A;  1U5T A;  1OR7 C;  1TWF J;  4JBA A;  4RAF A;  4CYC B;  2A5W A;  2V1D A;  4IHT A;  2I5U A;  2BW3 A;  2HTS A;  4MGR A;  4AUX A;  2DA1 A;  4PJL A;  4P9U A;  5A2Q K;  1ZAO A;  3OWT A;  1JJ8 C;  3ZRG A;  1SFU A;  1B72 A;  1Y39 A;  3PO2 J;  3BCB A;  1Z3Y A;  2TRT A;  3LSM A;  4RB1 A;  1YOV B;  3I5U A;  2O8K A;  4BQN A;  4ENJ A;  4L0Z B;  3RTR A;  1ZRF A;  3O8H A;  2HGC A;  3DF8 A;  4MNU A;  2BEO A;  2HI3 A;  1ZHF A;  1B4A A;  2ADU A;  1I39 A;  1JTX A;  3F72 A;  2ZXJ A;  4RLQ A;  4Q47 A;  3W6K B;  2EIJ H;  4DJA A;  2EFN A;  4WXD A;  1KQ0 A;  2BY0 A;  3DEU A;  5BPD A;  1HLV A;  3ZGK A;  1MBG A;  5LRR A;  2NVT J;  3PNY A;  4KFC A;  3SJM A;  1IUF A;  3H36 A;  3IKT A;  2ZME A;  3BR1 A;  2MA3 A;  1Z3X A;  3L2R A;  2QQB A;  3K4B A;  1RZ4 A;  1G8X A;  4D0P A;  4KNY A;  1P4X A;  3EET A;  4IHX A;  3FM3 A;  4UVA A;  2XC7 A;  4LD5 A;  2RKH A;  5D4S A;  4XRS A;  3FM5 A;  1ETQ A;  2X1D A;  2E7X A;  2FD5 A;  1DP7 P;  1Z7L A;  3OR2 C;  2P6T A;  4BS9 A;  4I2O A;  4ANJ A;  1Y6I A;  3I0T A;  4PGH A;  3RPQ A;  4G8X A;  1RRJ A;  2OA4 A;  3ZMV A;  1V4R A;  2VAS A;  4IZZ A;  1WJ5 A;  1EH6 A;  4EJU A;  4LFU A;  2BOL A;  2DPD A;  1I1G A;  2FOK A;  4TV7 A;  3BRO A;  2IXS A;  2JMW A;  1YYV A;  2MD0 A;  1ZKG A;  3L9F A;  2W82 A;  4JX5 A;  2XVC A;  4CZZ A;  4WF2 A;  2NYX A;  1LFU P;  1A35 A;  2LH9 A;  1QZZ A;  2BE5 F;  2G0E A;  2EV6 A;  4KIT B;  3JCU C;  5H6Q A;  4BAC A;  4EJV A;  3CO6 C;  1VF9 A;  4A3K J;  3E6C C;  2FBK A;  1O4X A;  5TGT A;  1EF4 A;  4PDK A;  3ZN0 A;  4HPQ A;  4JX6 A;  2KIQ A;  5BS6 A;  3CLQ A;  3OYA A;  2HWV A;  3HKZ A;  4I99 C;  2CV1 A;  1H9G A;  2HU9 A;  1BI2 A;  2XUB A;  4XK4 A;  2JSP A;  3H0G J;  3SXY A;  1LFB A;  1E3P A;  2DT5 A;  1ETY A;  5E1W A;  3DCF A;  3ISP A;  4IHW A;  1C0W A;  5LHH A;  3HOZ J;  3FZV A;  3JTH A;  5FRM A;  5LGT A;  5IPA A;  3N05 A;  2E34 A;  3OV8 A;  3F22 A;  1FJL A;  4EJT A;  4WXH A;  4UB8 C;  3HSE A;  1IXR C;  4HG2 A;  1QPI A;  1TNS A;  4CIC A;  3TOA A;  1B9M A;  3CC4 I;  2A6T A;  3U9G A;  3GFJ A;  4HEA 2;  3JR9 A;  2KIU A;  4B44 A;  2O3F A;  4LOC A;  2XPU A;  2LLK A;  5DM7 F;  1JKQ C;  3OYE A;  2MLG A;  3ZP5 A;  1H89 C;  1PP7 U;  2JPC A;  3NQO A;  1ZTR A;  2DMU A;  3ESW B;  1RUN A;  1D8J A;  1PUF B;  4P96 A;  4J01 A;  4M3D A;  1N78 A;  3WGI A;  1U5T C;  3TMO A;  3RI4 A;  2OTL I;  3ZQL A;  5LEK A;  3CCQ I;  1S9H A;  2JUG A;  3HB9 A;  3HIF A;  2FE3 A;  4KIB A;  3KZZ A;  2CUF A;  3DPL C;  3BTC A;  1CGP A;  2VI6 A;  4A0Y A;  2EZI A;  1F43 A;  2AXT C;  2JA8 J;  2H27 A;  2NVX J;  3CUQ C;  3G3Z A;  4IQ4 A;  4RB0 A;  5GP9 A;  2L2O A;  3DP7 A;  3TW7 A;  4DNC A;  5HOD A;  3L00 A;  3NEU A;  4KMU X;  3VB2 A;  1V55 H;  1BR1 A;  1MJA A;  2Z3Y A;  1V5G A;  2KZG A;  1BN5 A;  2VC1 A;  2XGD A;  3ZMZ A;  1ETO A;  5JLW A;  3BWG A;  1R36 A;  1XS9 A;  2G7H A;  4P9F A;  4R79 A;  1ZR4 A;  1IUY A;  1ERD A;  2OJE D;  2E2J J;  3R4K A;  4XQF A;  4U7D A;  2OQR A;  3JTG A;  1ZG3 A;  2J5P A;  4EQQ A;  5DD4 A;  4MEY F;  1YO5 C;  2V1U A;  4CZC A;  2DMT A;  2K02 A;  4BH9 A;  1DGR M;  1L0O C;  3OS1 A;  3LSR A;  1VZ0 A;  2HOS A;  3FKJ A;  1FYM A;  3D5L A;  4NC6 A;  1SVO A;  3ERE D;  3HSR A;  3DPT A;  2DI3 A;  2HQA A;  2KHM A;  1TNT A;  2P5K A;  3C18 A;  1BI0 A;  5JR3 A;  5CKT A;  3IL2 A;  5M3M J;  1MSE C;  1FP2 A;  2WAF A;  1MBK A;  4ZDL A;  2CQQ A;  2V9K A;  3FHN A;  2IS2 A;  3T8T A;  4A93 J;  3WU1 B;  3QRF F;  1ORK A;  4QPO A;  1UHM A;  3RSN A;  1U8B A;  2KKO A;  2ZO4 A;  5M5X J;  1WH7 A;  4Y17 A;  2K4B A;  3EQL F;  3I58 A;  1BM9 A;  2BHZ A;  1T2K A;  3JSO A;  5F1R A;  2F4O B;  2DPU A;  1WWX A;  3DBL B;  2ME6 A;  2EZL A;  1HW5 A;  5F0H A;  5GAD J;  4BHP A;  4ASN A;  5LBQ A;  1ZN2 A;  5ICG A;  2MG4 A;  1XMK A;  2GXB A;  1Z6R A;  3H1C A;  2F4I A;  3IC7 A;  2I8D A;  3DKY A;  4R1H A;  4CXF A;  4LG0 A;  1F1Z A;  1NTC A;  1U8R A;  3FF5 A;  3H9Q A;  1HDP A;  3LFU A;  4JK1 X;  5FJ8 J;  1BIB A;  1IN4 A;  2FU4 A;  1MMD A;  3KP7 A;  4QSH A;  1LKX A;  3L1P A;  3PL8 A;  1YW9 A;  2VKE A;  1K7A A;  4PFP A;  4EAT A;  5D6F A;  5D5W B;  1EH7 A;  2M30 A;  3KP3 A;  1XPX A;  3FIW A;  2XAH A;  2NXN B;  4M3B A;  3TGN A;  3OOU A;  4AIH A;  4UUV A;  5HLI A;  2R3S A;  1X58 A;  5E8G A;  1LVA A;  2VN2 A;  1LVK A;  1QO0 D;  3S1M J;  2HOA A;  2GZW A;  2GOX B;  1JUP A;  3I4M J;  1U9N A;  2V26 A;  3DU5 A;  3I3L A;  2K85 A;  3TW6 A;  1G4D A;  4CUG A;  1CQT A;  2PN6 A;  4ZYA A;  1WKM A;  4G7H F;  2DK8 A;  2QKL B;  2XF6 A;  1OFC X;  2OCC H;  2R5Y A;  2QEN A;  2V6C A;  1KA8 A;  2DFE A;  1MH4 A;  1TWH J;  2MH2 A;  2PJR B;  5FKL A;  3M07 A;  1F5T A;  3KFW X;  3BG9 A;  4B8X A;  2EA4 A;  1T39 A;  1GV2 A;  4XNF A;  2KT0 A;  3P5J A;  4MTE A;  2MLK A;  1P92 A;  4Y33 A;  2DFH A;  3GO5 A;  3JRB A;  5FLX K;  1IGN A;  1OKR A;  1VQN I;  2IA2 A;  4KIS A;  4EM1 A;  2L9V A;  2F6C A;  2G9W A;  1HBX G;  3CDH A;  1USS A;  1HKT A;  2ZSI B;  4E7K A;  2DW4 A;  2DT6 A;  1R6R A;  1OCC H;  2ECB A;  5J6X A;  1UAA A;  1R1V A;  2IGK A;  1JXS A;  2M45 A;  5FB2 A;  5KNL A;  3HRU A;  5FKK A;  4IHV A;  3PNV A;  1LDK B;  3UNG C;  1TQP A;  4EMS A;  2L9R A;  1HDD C;  2M34 A;  2DK5 A;  2JWT A;  4K2E A;  2GA2 A;  2KFD A;  4ESF A;  5GPC A;  3FHZ A;  3V42 A;  1IV6 A;  4P55 A;  3E1S A;  1UFM A;  4HNT A;  1R49 A;  2ZXH A;  3PQJ A;  3GVA A;  1PP8 F;  3MMY B;  1X1B A;  4MIM A;  4U0V A;  3VPR A;  4Z6Y A;  2B9S A;  2F5D A;  3J81 Z;  4GYI A;  1W0U A;  4YII A;  2FNA A;  1FMW A; 
#chains in the Genus database with same CATH homology
 1FBS A;  2UZK A;  3ECH A;  1XSX A;  1WQ2 A;  3HTU A;  1DPR A;  1O3S A;  1TTY A;  3J80 K;  3LQQ A;  4A5M A;  2RV8 A;  3E5Q A;  4R8H A;  5ICE A;  1BJA A;  4F7Z A;  2XKP A;  4RS8 A;  5E18 F;  4EGZ A;  2D45 A;  3PFI A;  2IP2 A;  3J81 K;  5AIP A;  3S2W A;  1J7K A;  2PG4 A;  3KZY A;  4LB6 B;  2GIV A;  1NHA A;  3I54 A;  1TW3 A;  3MFK A;  4HDU A;  1HSJ A;  1BI3 A;  4M9X A;  1P4W A;  4HZF A;  3FX3 A;  1R58 A;  2AXL A;  4ENK A;  4KUM A;  4XSX F;  3LQR A;  1SD7 A;  3ZN1 A;  1XDS A;  4A0Z A;  3WTW C;  2GXG A;  4HW0 A;  1X3U A;  3MZH A;  3CLO A;  2KJC A;  3P7N A;  4GCV A;  5K5R A;  1K78 A;  4EGY A;  1FZP B;  2A69 F;  5JHU A;  2EV5 A;  5D8L B;  4IHS A;  5EEG A;  4XRF A;  1ONV A;  2A6E F;  2CGP A;  2DLL A;  2VOO A;  4MHG A;  1QNT A;  2B0L A;  2RGV A;  1VTN C;  5D5X B;  1W4M A;  2VBZ A;  4M9Z A;  4N9I A;  2XIG A;  2PQ8 A;  2BV6 A;  3CUQ B;  1QZY A;  3MEX A;  2IA0 A;  4HX8 A;  1GHC A;  1GVJ A;  1PUE E;  2JT1 A;  4M6X A;  2NS0 A;  4E70 A;  4HLX A;  3LA3 A;  1MJB A;  1LJ9 A;  4LK0 F;  2EFP A;  5E17 F;  4HX4 A;  4O3M A;  1B9N A;  4KIF A;  2PLY A;  4OMZ A;  3WG9 A;  5D4R A;  5F6F A;  1O7F A;  2VE9 A;  2JTV A;  1T0F A;  3HYI A;  1Z91 A;  4ETS A;  2IA1 A;  4FX0 A;  2XAF A;  1Y0U A;  3T8R A;  3ZMU A;  5BOX A;  1FYK A;  3VFZ A;  5BMZ A;  1R5G A;  2H94 A;  6PAX A;  4JQF A;  5HS9 A;  5FD6 A;  4ZZL A;  4A5N A;  1XDU A;  2DTR A;  2RN7 A;  1QBJ A;  2NNN A;  3K1P A;  4Y13 A;  1K79 A;  1P2F A;  5L3D A;  3KET A;  2QQA A;  1RI7 A;  3HOT A;  3ROU A;  2H6B A;  1MZB A;  4XLN F;  4G7Z F;  3TQN A;  2F5E A;  2L01 A;  1U3E M;  3K1N A;  1MD0 A;  1YS6 A;  2HFH A;  5HLH A;  4BQA A;  3BPX A;  1UST A;  2DO7 A;  4L9N A;  3KE2 A;  4KN7 X;  4OIR F;  3Q9V A;  1XD7 A;  3AAF A;  2K27 A;  3V4G A;  1LEB A;  1WI9 A;  2VBY A;  1YFH A;  3WOD F;  5D5V B;  3FMR A;  1H0M A;  1JHF A;  4LG0 B;  2HS5 A;  4YFN F;  2IVM A;  3RKY A;  2PJP A;  2KIM A;  5TRD A;  3F3X A;  5ERI A;  2IW5 A;  4Q4Z F;  4U7B A;  1IN5 A;  3EDP A;  2BYV E;  1Z1D A;  1J5Y A;  2WC2 A;  3VEP A;  1YQA A;  3WTT C;  3E6M A;  1SMT A;  4O6J A;  3L7W A;  2Q2E A;  2Z99 A;  5E8I A;  2HDC A;  2L02 A;  3RYP A;  1ZLJ A;  5JVT A;  2HEO A;  3J7A O;  2FNP A;  3CUO A;  4EJW A;  3RDI A;  2R7F A;  4IRH A;  4G6D A;  5K5O A;  2W24 A;  4NHJ A;  1TBX A;  2JSC A;  2Z33 A;  2HZT A;  2FA5 A;  2VC0 A;  2M87 A;  2X4H A;  4M71 A;  4IPA A;  4CYD A;  3COA C;  5E1Z B;  3KEQ A;  2RNJ A;  3E5U A;  4UV9 A;  1KYZ A;  1IZ1 A;  3KLO A;  2FQ3 A;  2FBI A;  3P9K A;  2ISZ A;  4KT5 C;  3B73 A;  3ZQ7 A;  1J75 A;  1FX7 A;  2J5O A;  1XN7 A;  1SAX A;  2ELH A;  1J9I A;  1WRJ A;  2UXX A;  3LA7 A;  3EYY A;  3R6S A;  3BDD A;  3HRS A;  3JSP A;  2BBY A;  2F5F A;  1JHH A;  2QVO A;  1HKS A;  2DQR A;  2HQR A;  4LJZ F;  4WCG A;  3U2R A;  1YLF A;  1TW2 A;  1HXD A;  1BIA A;  3KCC A;  4RB2 C;  2XAG A;  2DQL A;  3O6B B;  4EV0 A;  4EM0 B;  3FXU A;  4LLL A;  3DXJ F;  4YFX F;  4G6Q A;  5DUK A;  2AS5 F;  1FC3 A;  1O3R A;  2P4W A;  5FGM A;  1ZG1 A;  4KN4 X;  2P8T A;  3MZY A;  4RGS A;  2OQG A;  5LGU A;  4RB3 C;  1ZGJ A;  1G3T A;  5DDG A;  2CWE A;  2VE8 A;  5DEQ A;  1O3T A;  1S29 A;  1T38 A;  3I64 A;  1LEA A;  1RNL A;  1U6G A;  2PBI A;  1MJ9 A;  3V7C A;  3J80 Z;  4Q48 A;  2H09 A;  5ED4 A;  4YFK F;  4IRG A;  4OIP F;  4HF2 A;  3QAH A;  4U0Y A;  5DUI A;  4HBL A;  1FBU A;  3WTZ A;  2XAJ A;  4M6Y A;  3KP5 A;  2A5Y B;  4IJA A;  3LWF A;  3OOP A;  1WSU A;  1YW7 A;  4A2U A;  1LQ1 A;  1ZGA A;  4RGR A;  1F4K A;  2IJL A;  3I53 A;  4BAY A;  3GWZ A;  5ILS A;  3VOD A;  1E17 A;  2P5V A;  4OOI A;  2FSW A;  1P4A A;  3Q5F A;  2P7V B;  3LAP A;  3LAJ A;  2QQ9 A;  1BC8 C;  2OD5 A;  1AOY A;  1B59 A;  1OYY A;  3R0A A;  4GGG A;  2HR3 A;  3L09 A;  4L9V A;  3DV8 A;  4HOB A;  2V9V A;  2VT2 A;  4RAZ A;  1S7O A;  2OU2 A;  3W6J B;  4CGZ A;  4IVN A;  4HA8 A;  4WX9 A;  4KYW A;  2P6S A;  2NRA C;  3MQ0 A;  1KU9 A;  1I27 A;  5LGN A;  2IPQ X;  3WGH A;  3GYH X;  4BXU A;  2HKX A;  4MQV A;  1E2X A;  5A2Q Z;  2HYF A;  2M5W A;  4HQE A;  2Q0O A;  1ZLK A;  5CVU A;  4LLN A;  2FXA A;  4LK1 F;  3D0S A;  4LLG F;  5DCF A;  3RKX A;  1G3S A;  2QWW A;  1K6O A;  4WXC A;  1Q1H A;  1FLI A;  2YSR A;  5CVJ A;  3V7R A;  1TQI A;  2STT A;  2XRO A;  1ZH5 A;  1OR7 A;  1Z7U A;  1D5V A;  4OIN F;  3RIR A;  5E20 A;  4L0Y B;  2XKO A;  1MDM B;  3GXO A;  2RVC A;  2DBB A;  2E1N A;  2MBF A;  4U0W A;  2MC3 A;  5CLS A;  1I6X A;  3LST A;  2D2W A;  2FML A;  2W25 A;  4CDG A;  3BJA A;  1FBQ A;  1KU7 A;  3FXQ A;  1AWC A;  4OIO F;  1I1S A;  2Z9O A;  4FT8 A;  3M8E A;  3TOB A;  3B02 A;  1ZYR F;  3P9I A;  1SD6 A;  1S7A A;  3ZMT A;  4ZYG A;  3GZ6 A;  2E1C A;  5LHG A;  1UHW A;  5HOO A;  4KDP A;  3K0L A;  2EFQ A;  5ILU A;  2D1H A;  3GW2 A;  1KU2 A;  3WTY C;  4QLC U;  4YIF A;  2FF4 A;  2COM A;  4XSZ F;  1YG2 A;  4Y15 A;  3M8F A;  2ESN A;  5K1Y A;  3F6V A;  5CVR A;  2WV0 A;  4HAM A;  3GLX A;  1SD5 A;  3ZPL A;  1IRG A;  1RUO A;  1T98 A;  4FX4 A;  3C1D A;  4OU0 A;  2CW0 F;  3GFM A;  1B1B A;  4XBF A;  1BI1 A;  1IXC A;  3H3U A;  2OZ6 A;  4HX7 A;  1LB2 A;  1KU3 A;  3ABT A;  5JI6 A;  2KRF A;  4YG2 F;  4RGX A;  2NAZ A;  3TDZ C;  1HKQ A;  4L18 B;  4BYY A;  1QQI A;  4CHU A;  3FMS A;  4M73 A;  5ILV A;  3TO9 A;  5FLX Z;  3TO6 A;  4BHB A;  2PEX A;  3F8B A;  1XGN A;  3WU0 A;  4HV5 A;  3F8M A;  4ZYE A;  1R7J A;  3FMQ A;  5DCM B;  4S04 A;  3QPH A;  3WTS C;  2FMY A;  1KQ9 A;  4UVB A;  1ZRC A;  4EM2 A;  2VON A;  2LSO A;  3BY6 A;  1L3L A;  3MCZ A;  3SZP A;  1TQM A;  2CQK A;  3IRR A;  4IRI A;  1MKM A;  1ZG5 A;  3GZ5 A;  2FBH A;  2V1X A;  3TO7 A;  1ODD A;  1REP C;  3ZMD A;  3T1B A;  1FPQ A;  3N4M A;  5HS7 A;  4KIG A;  3N97 A;  2E7W A;  2GWR A;  3M9A A;  1JE8 A;  5HS8 A;  1ZRD A;  4HF1 A;  3E3V A;  2D1V A;  4OIQ F;  3HTS B;  5L3G A;  2EV0 A;  1ZRE A;  4ZH4 F;  5L3F A;  4XLP F;  1BC7 C;  1SD4 A;  2RC4 A;  3ECO A;  3WE2 A;  1IN8 A;  2YX4 A;  2K7L A;  5L3C A;  2EWN A;  4ESB A;  3WTV C;  3C7J A;  3SQN A;  4AWX B;  4L5I A;  5L3B A;  1FYL A;  2QBY B;  3T0Y A;  4G94 A;  5E1X A;  4UHT A;  4ZYH A;  2HKO A;  1PDN C;  4N0B A;  3L2C A;  2QZ8 A;  4RAY A;  4IF4 A;  2ESH A;  2XHK A;  3BOQ A;  4I09 A;  5FD5 A;  1LNW A;  2XRN A;  1IXS B;  5H6R A;  4A0X A;  5LHI A;  1SFX A;  5J8F A;  2LKP A;  3V8L A;  4I0A A;  1RIO H;  4PGG A;  3P9C A;  2K86 A;  3F8F A;  2ZME B;  4MEX F;  5ICF A;  3TKY A;  3KP2 A;  3CO7 C;  3ULQ B;  5D8K B;  2Z5U A;  4HQM A;  1S6L A;  3M7G A;  4KIC A;  2Y75 A;  1S3J A;  1G6N A;  4AVP A;  1G3Y A;  2ZNZ A;  3K1M A;  3GF2 A;  5HVQ C;  3VOE A;  4FHT A;  4P5O A;  2WTE A;  1O57 A;  2VBX A;  2A07 F;  2PMU A;  1EH8 A;  2M8E A;  2O8X A;  2L4M A;  1SFE A;  4L9J A;  1FT9 A;  3RYR A;  3V8J A;  2X0L A;  4G9Y A;  1R1T A;  5HDN A;  1XSD A;  3F8C A;  3F6O A;  2TDX A;  3FWE A;  1W5S A;  4ENN A;  4M72 A;  5KK1 A;  3IRQ A;  1J0R A;  5L3E A;  2O03 A;  4N9H A;  2LF8 A;  1LDD A;  2ETH A;  2HTJ A;  2QM3 A;  3I59 A;  2VBW A;  4ENM A;  2ISY A;  2RQP A;  1XSV A;  2VXZ A;  3DFG A;  5IT9 K;  1FWZ A;  2MD5 A;  2OZU A;  1ON2 A;  3BJ6 A;  1MDM A;  4B09 A;  1U2W A;  2YX7 A;  4I02 A;  4EJO A;  1I5Z A;  2QBY A;  2CG4 A;  3JAM Z;  1HW1 A;  2VT3 A;  3WTX C;  3K2Z A;  2PMH A;  2YPR A;  3MWM A;  3R0J A;  3IWF A;  3GEZ A;  3EYI A;  1V3F A;  2PI0 A;  1FSH A;  4EVI A;  3E97 A;  3G73 A;  1EV7 A;  1YW8 A;  3M1E A;  3WTU C;  2W57 A;  3JAM K;  1OPC A;  2Y48 A;  3F8N A;  2Y0M A;  4M74 A;  5AON A;  2FEZ A;  1R00 A;  2H6C A;  2O0Y A;  2EA2 A;  3R61 A;  3RKW A;  2WWY A;  3IWZ A;  1K78 B;  3ML6 A;  3SFZ A;  2L4A A;  1IAW A;  2LNB A;  4WWC A;  1QGP A;  1H9T A;  1P6R A;  2F2E A;  1F9N A;  3BP8 A;  4ESJ A;  2OAZ A;  1O3Q A;  5D6E A;  2NNY A;  1IN6 A;  3BJO A;  1KGS A;  3QU3 A;  3V8K A;  1IN7 A;  3I4P A;  2CSO A;  4PZJ A;  4A6D A;  2VOD A;  1W7P B;  1ZAR A;  2R7D A;  4CO8 A;  2L3D A;  1R1U A;  1MGT A;  2HYG D;  3H3Z A;  4I0B A;  2EB7 A;  3HHG A;  4Z2Y A;  2V79 A;  2ZCW A;  3ZMS A;  1STZ A;  2QUF A;  3O2P E;  1TLH B;  4UXN A;  1BOA A;  3EUH A;  3QOP A;  1FY7 A;  1Z05 A;  1HQC A;  1GXQ A;  1W7P D;  3K69 A;  2OBP A;  5LRS A;  4IXA A;  3REO A;  2A6H F;  5BPI A;  4QWQ A;  2XAS A;  5LLQ A;  2QLZ A;  3FXR A;  4I01 A;  2ZJ2 A;  2F5C A;  3T5X A;  2CFX A;  3IKV A;  4MQ9 F;  1OMI A;  4DQ2 A;  2P5L C;  1SMY F;  5FFZ A;  4OMY A;  1U78 A;  3PQK A;  1DUX C;  3MAJ A;  1UB9 A;  3LA2 A;  5F64 A;  4AD9 A;  1J59 A;  3K9T A;  3ELK A;  1CF7 B;  3HHH A;  5JFR A;  4HF0 A;  2LF7 A;  1OYI A;  3F23 A;  5DD8 A;  5FO5 A;  1Z9C A;  1D8K A;  5D5U B;  1XCV A;  2HQN A;  4A12 A;  1UCR A;  1IRF A;  2A68 F;  3E6B A;  2HOE A;  2CYY A;  1ON1 A;  3Q9S A;  4HYE A;  3GX4 X;  4L5J A;  1YIO A;  2XGX A;  3BZ6 A;  1XGM A;  2XV4 S;  2M1B A;  3CJN A;  2ACJ A;  3I71 A;  2GA1 A;  1T6S A;  5DCM A;  2CO5 A;  4S05 A;  4I7H A;  3O3K A;  4WK8 F;  3SZT A;  1CF7 A;  2MH9 A;  3IHU A;  4M9S A;  2KJB A;  1DPU A;  3HUG A;  4PCQ A;  1B6A A;  1J2X A;  3H92 A;  4ZYD A;  1W5T A;  4LB5 A;  1R5H A;  2IT0 A;  1XB4 A;  5J8C A;  3KP6 A;  1QPM A;  3GFL A;  5TJJ A;  2EFO A;  1XCB A;  4AIK A;  2UXN A;  2JRT A;  1Z6T A;  2IRF G;  5EEH A;  2P7C B;  3WE3 A;  2JZY A;  4HDV A;  5AIQ A;  1LDJ A;  1D3Y A;  2XAQ A;  4HV6 A;  2A61 A;  3HRT A;  2W85 A;  3HOS A;  5CVI A;  1FOK A;  4AIJ A;  1G3W A;  5DV5 A;  3QU6 A;  1A04 A;  2ZKZ A;  2DAO A;  1YTY A;  2G7U A;  1ULY A;  2O6G E;  3HRM A;  5FFX A;  1HW2 A;  3QP6 A;  1DDN A;  4UVC A;  1W7P A;  4RGU A;  1FP1 D;  4GXO A;  5KVR A;  4GO1 A;  3JW4 A;  2PFB A;  3QPT A;  3GFI A;  4ON0 A;  3CTA A;  1R23 A;  5K5Q A;  5H20 A;  3LFK A;  2O61 A;  3DKW A;  2GAU A;  4NB5 A;  3HSF A;  4KMF A;  3C3W A;  4Q5S F;  3V7S A;  3GUD A;  1JGS A;  5CJ9 A;  5DYM A;  2EJR A;  4L9T A;  2K4J A;  1FNN A;  4UV8 A;  3BPV A;  3E6D A;  3KEO A;  3NRV A;  1O7L A;  3RPU A;  2GQQ A;  1R22 A;  2BGC A;  1IW7 F;  2FRH A;  5HDG A;  5HDK A;  5LEJ A;  3R60 A;  2W84 A;  4BNC A;  2C6Y A;  3U1D A;  2UWM A;  2RDP A;  2Q8K A;  4KA4 A;  2EK5 A;  1KYW A;  4HLY A;  5ICC A;  5IT9 Z;  2VOP A;  2YR2 A;  1XGS A;  2A3S A;  2YU3 A;  1OYW A;  2ZBK A;  3E5X A;  4UNO A;  4U88 A;  4O5V A;  1FSE A;  4NQW A;  4LGW A;  3KP4 A;  1GXP A;  2ZNY A;  5IT3 A;  3I59 B;  2STW A;  4H0E A;  2DFI A;  3KLN A;  1KQ8 A;  1XGO A;  3SHF A;  4G7O F;  2JPB A;  1HST A;  1BBY A;  3RJP A;  3DQV C;  2L54 A;  5CYV A;  4MTD A;  2QYO A;  2LDU A;  2EFW A;  5HLG A;  4I98 B;  5CVV A;  4BHC A;  1S8N A;  1XMA A;  4A6E A;  3QP5 A;  1IF1 A;  3ABU A;  4LMY A;  1U5T B;  2ZFW A;  3F21 A;  2KIF A;  3CUQ A;  1YS7 A;  2DU9 A;  4ZZD A;  3TDU C;  4GYG A;  3WGG A;  5BQT A;  1U5T A;  4JBA A;  2V1D A;  4IHT A;  2HTS A;  4MGR A;  5A2Q K;  4P9U A;  1ZAO A;  1SFU A;  4RB1 A;  3I5U A;  4ENJ A;  4L0Z B;  3RTR A;  1ZRF A;  2HGC A;  3DF8 A;  4MNU A;  2BEO A;  1ZHF A;  1B4A A;  2ADU A;  2ZXJ A;  3F72 A;  3W6K B;  4Q47 A;  2EFN A;  4WXD A;  1KQ0 A;  5BPD A;  3DEU A;  5LRR A;  4KFC A;  3IKT A;  2ZME A;  2MA3 A;  2QQB A;  1RZ4 A;  4D0P A;  4KNY A;  1P4X A;  3EET A;  3FM3 A;  4UVA A;  4LD5 A;  2RKH A;  5D4S A;  3FM5 A;  2E7X A;  1DP7 P;  2P6T A;  4I2O A;  3I0T A;  4PGH A;  3RPQ A;  4G8X A;  2OA4 A;  3ZMV A;  1V4R A;  1EH6 A;  4EJU A;  4LFU A;  2DPD A;  1I1G A;  2FOK A;  4TV7 A;  3BRO A;  1YYV A;  3L9F A;  2XVC A;  4CZZ A;  4WF2 A;  2NYX A;  1QZZ A;  2BE5 F;  2EV6 A;  5H6Q A;  4EJV A;  3CO6 C;  3E6C C;  2FBK A;  4PDK A;  3ZN0 A;  5BS6 A;  2HWV A;  1H9G A;  1BI2 A;  2XUB A;  3SXY A;  2DT5 A;  5E1W A;  3ISP A;  1C0W A;  5LHH A;  3FZV A;  3JTH A;  5LGT A;  3OV8 A;  3F22 A;  4EJT A;  4WXH A;  3HSE A;  1IXR C;  1TNS A;  4CIC A;  3TOA A;  1B9M A;  3U9G A;  3GFJ A;  2KIU A;  2O3F A;  2MLG A;  3ZP5 A;  1PP7 U;  2JPC A;  3NQO A;  1RUN A;  1D8J A;  4P96 A;  3WGI A;  1U5T C;  3RI4 A;  5LEK A;  3HIF A;  2FE3 A;  4KIB A;  3KZZ A;  3DPL C;  1CGP A;  4A0Y A;  2H27 A;  3CUQ C;  3G3Z A;  4RB0 A;  3DP7 A;  4DNC A;  3L00 A;  4KMU X;  3VB2 A;  1MJA A;  2Z3Y A;  1BN5 A;  2VC1 A;  3ZMZ A;  3BWG A;  1R36 A;  2G7H A;  4P9F A;  4R79 A;  1IUY A;  3R4K A;  4U7D A;  2OQR A;  3JTG A;  1ZG3 A;  2J5P A;  4EQQ A;  5DD4 A;  1YO5 C;  4MEY F;  2V1U A;  2K02 A;  4BH9 A;  1L0O C;  1FYM A;  3D5L A;  3ERE D;  3HSR A;  3DPT A;  2DI3 A;  1TNT A;  2P5K A;  3C18 A;  1BI0 A;  5JR3 A;  3IL2 A;  1FP2 A;  3T8T A;  3WU1 B;  3QRF F;  1UHM A;  2KKO A;  2ZO4 A;  4Y17 A;  2K4B A;  3EQL F;  3I58 A;  1BM9 A;  1T2K A;  3JSO A;  5F1R A;  2DPU A;  1WWX A;  1HW5 A;  4BHP A;  4ASN A;  5LBQ A;  1ZN2 A;  5ICG A;  1XMK A;  2GXB A;  1Z6R A;  3IC7 A;  4CXF A;  4R1H A;  4LG0 A;  1F1Z A;  1U8R A;  3FF5 A;  4JK1 X;  1BIB A;  1IN4 A;  2FU4 A;  3KP7 A;  1YW9 A;  1K7A A;  5D6F A;  5D5W B;  1EH7 A;  2M30 A;  3KP3 A;  2XAH A;  3TGN A;  4AIH A;  4UUV A;  5HLI A;  2R3S A;  5E8G A;  1LVA A;  2VN2 A;  1QO0 D;  2GZW A;  1G4D A;  2PN6 A;  1WKM A;  4G7H F;  2DK8 A;  2QEN A;  2V6C A;  1KA8 A;  2MH2 A;  1F5T A;  3KFW X;  4B8X A;  2EA4 A;  1T39 A;  4MTE A;  2MLK A;  1P92 A;  3GO5 A;  5FLX K;  1OKR A;  2IA2 A;  4EM1 A;  2G9W A;  1HBX G;  3CDH A;  1USS A;  1HKT A;  2DW4 A;  5J6X A;  1R1V A;  1JXS A;  2M45 A;  5FB2 A;  3HRU A;  1LDK B;  1TQP A;  4EMS A;  2DK5 A;  4K2E A;  2GA2 A;  4ESF A;  3FHZ A;  4P55 A;  1UFM A;  3PQJ A;  3GVA A;  1PP8 F;  4U0V A;  3J81 Z;  2F5D A;  4GYI A;  4YII A;  2FNA A;  3NEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...