3CUQA

Integrated structural and functional model of the human escrt-ii complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
219
structure length
219
Chain Sequence
b'AQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cuqA03
1ZRDA 1XDSA 3E3VA 5HDNA 2MH9A 5D4RA 3HRMA 2P5LC 5J8FA 1YFHA 2PLYA 4EGZA 1OMIA 2QWWA 3LQRA 2MD5A 3KEQA 3IKVA 5KVRA 3KE2A 2EB7A 5A2QZ 4MTDA 1ULYA 3U2RA 3GUDA 3GX4X 1U5TA 3C18A 5E17F 3E6BA 2VC0A 3DEUA 4EVIA 3NQOA 2HGCA 4HV5A 4MQVA 2LSOA 3TO6A 1FPQA 2Y0MA 1FYMA 1W4MA 1W7PA 3RIRA 4N9HA 3FMSA 3O6BB 2L01A 1SD4A 1QQIA 4CICA 2JRTA 5FLXZ 4JBAA 4HW0A 2W84A 4YIIA 4KFCA 2R3SA 2O3FA 2E7XA 3F6VA 4LG0B 1KGSA 2EFNA 1IUYA 2VBXA 4G7ZF 2B0LA 5IT3A 1OKRA 4CXFA 2XASA 1E2XA 1ZG3A 2RV8A 2F5FA 3ZN1A 1HW2A 4XLNF 4YFKF 5LGNA 4L9TA 1FP1D 2A6EF 2HZTA 5CVUA 2G9WA 4O5VA 1MDMA 2KJCA 4P55A 3GW2A 4IVNA 2JTVA 1YO5C 5TJJA 2FSWA 1KA8A 1GXQA 2M30A 3FM3A 1SD5A 2STTA 2FQ3A 5DDGA 2RVCA 4LLLA 3PQKA 2Z33A 4WXCA 1XD7A 3OOPA 4E70A 4HAMA 4M9SA 2JSCA 4UNOA 3BJOA 3M8FA 4IRIA 5CVJA 5FGMA 2QBYA 2X0LA 1FLIA 2A5YB 5D5WB 1CF7B 3BY6A 2MH2A 4AVPA 3ZN0A 4ZYHA 1OPCA 3FXRA 5F1RA 1XMAA 1Z91A 2O61A 3MAJA 1H0MA 1XCVA 1USSA 1P4AA 3GXOA 1DUXC 3SQNA 2PN6A 3WTXC 5E1WA 2DPDA 1TNSA 1K78B 4A0YA 5D6FA 3RYPA 3Q9SA 4KMUX 5F6FA 3ECHA 2Q2EA 2FA5A 3ABUA 5K5RA 2ZKZA 1SD7A 4ESJA 3P7NA 4XRFA 2PJPA 3BOQA 5ERIA 1OYWA 4HF0A 1YLFA 3KLOA 3LA7A 3KETA 5AIQA 1Y0UA 1XGNA 3D0SA 3ELKA 2YX7A 2CW0F 1IRGA 5LRRA 3VFZA 5HDKA 1KYWA 4L5JA 1ZGAA 1FYLA 3CLOA 3KP4A 3M9AA 2BE5F 1BI2A 2XUBA 2X4HA 1KU7A 2ISYA 3GFLA 5E8IA 3ZMUA 3J81K 2O8XA 3H3UA 5HDGA 2TDXA 1OR7A 3HSFA 1Z6TA 5ILUA 5JR3A 1XB4A 1PP7U 1W5SA 3FWEA 5BPDA 2NYXA 1USTA 2UXXA 3WGHA 1HKTA 2VC1A 1R5HA 2QENA 4A12A 4B8XA 1JXSA 4IPAA 2VOPA 1UHWA 2HTJA 2H94A 5ILVA 5CJ9A 2FBIA 1G3SA 4EJUA 2E7WA 4ON0A 1LVAA 1E17A 5HS7A 2GWRA 2HFHA 1LQ1A 2COMA 1REPC 3BDDA 3QAHA 4UVBA 3ZMSA 3DQVC 4MHGA 5KK1A 3WTZA 3F22A 2YX4A 2HWVA 4R79A 2OQGA 4HF1A 3KFWX 2MLGA 2VBWA 4EJOA 1IN8A 4P9UA 1U5TB 3SXYA 4BNCA 1TQPA 1Z7UA 3WTWC 2MBFA 3LWFA 3Q9VA 1K79A 5ICGA 4BHBA 3G3ZA 4OINF 2QVOA 2HR3A 1FSEA 1W7PB 4L9NA 2ZNZA 2ZFWA 2F5DA 4O6JA 2J5OA 3M1EA 2BYVE 2EK5A 4UUVA 2M87A 1ZG1A 1XGMA 3BWGA 3QP6A 3IHUA 4MNUA 5ICEA 2Z9OA 2ZO4A 5LGTA 2DTRA 2DPUA 4I0AA 3I64A 1GXPA 3I53A 3C3WA 2O03A 1IN5A 4L18B 5LHHA 2RDPA 2V6CA 3ZMDA 1F1ZA 2Z3YA 4YFNF 1LEAA 1ODDA 1B9MA 1MDMB 2Q8KA 2XAJA 4BAYA 4FHTA 2GXGA 3K0LA 2BBYA 1FBQA 5ICCA 2P5VA 2A68F 1BC8C 3GWZA 1Z6RA 4XBFA 2QLZA 4IJAA 5D5XB 2XV4S 3GVAA 4UXNA 2EWNA 3DKWA 5FO5A 4G6DA 1ON2A 2A3SA 3GYHX 5LHIA 4IHTA 4LK1F 4FX0A 3R60A 2QBYB 2CGPA 5IT9K 2BGCA 3HSEA 1XSXA 5HS9A 3F8CA 1HW1A 4KIFA 4RGUA 4BYYA 4LFUA 1R23A 3F3XA 4EJVA 2WC2A 2FE3A 3F72A 5L3CA 4OIPF 4RB3C 4EJTA 2G7HA 4BQAA 1LNWA 3JSPA 3ULQB 1NHAA 2DQRA 2IA2A 1IN6A 3C7JA 1WKMA 2L02A 4Q48A 3FF5A 4PCQA 4D0PA 1HSJA 5H20A 1LDKB 1T98A 2L4AA 5D6EA 4TV7A 5DD8A 2XAGA 3FHZA 1I6XA 2H27A 3HOSA 5EEGA 3JAMK 5HS8A 2IJLA 5E20A 3CO7C 1WQ2A 2ISZA 1IN4A 4GYIA 3MQ0A 3T0YA 2PEXA 3U9GA 2H6BA 4WK8F 2HKOA 5CLSA 1MKMA 2FBHA 3CUQA 3ZPLA 1JHHA 1BI3A 1ZRFA 4N0BA 2GZWA 4LLNA 4EM0B 1J2XA 4H0EA 5DUKA 4U7DA 1FBSA 3ZMZA 3RKWA 3ERED 3RYRA 1IW7F 1LDJA 3T1BA 1ZREA 3U1DA 3S2WA 2CG4A 2L54A 5DEQA 3RKXA 3N4MA 3HHHA 1CGPA 1BIAA 4LMYA 4RB1A 1BI0A 4IXAA 1DDNA 1HXDA 1XCBA 1IZ1A 1UFMA 2O0YA 1PUEE 2VN2A 2MC3A 3IRQA 4ZZDA 3G73A 1T38A 3R0JA 4I09A 1SFXA 1QNTA 2QYOA 5CYVA 2FXAA 3LFKA 2XRNA 3LAJA 3J7AO 1TBXA 2IVMA 3F8NA 2AS5F 2HDCA 4EJWA 2K02A 1OYIA 4NQWA 1XGOA 2DAOA 4L0ZB 4AIJA 1BJAA 2GAUA 1ONVA 3DFGA 2CSOA 2ZMEA 3QP5A 4Y13A 1WWXA 4I98B 2A6HF 3LQQA 5L3DA 3TO7A 4A5NA 4OIOF 2CYYA 4ENMA 2VE9A 3I71A 4GYGA 2O6GE 3QRFF 1J0RA 2WV0A 2HYGD 4M6YA 4ETSA 2C6YA 1R5GA 3KP3A 3CDHA 5HLIA 3H92A 1YS6A 3V8JA 4KIBA 1QGPA 5E8GA 1RUOA 3I0TA 3EETA 3LAPA 5L3GA 1IRFA 1TW3A 3IC7A 5H6RA 4IRHA 2K27A 3QOPA 3IKTA 2EFOA 1BI1A 1J7KA 3MEXA 3ML6A 3PFIA 2D45A 1S7OA 1S8NA 5A2QK 1ZN2A 3RDIA 3KEOA 1O3SA 1YW7A 4ESBA 1KU2A 2ZJ2A 1BIBA 1U6GA 4G6QA 1S29A 2LKPA 4RB2C 1HW5A 1R7JA 1RUNA 1ZGJA 4UVCA 4JQFA 1FX7A 3GEZA 3NEUA 2PI0A 1R22A 2UZKA 4ZYEA 3EYIA 1UB9A 2BEOA 3GFIA 2XIGA 2YR2A 4U0YA 3RJPA 3AAFA 2NAZA 3HUGA 5FLXK 3W6JB 4Q4ZF 3WTVC 4KA4A 2V1DA 1SFUA 3WG9A 4KN7X 2GIVA 3K1MA 1P2FA 4CO8A 4A0XA 2LF7A 2OQRA 3QU3A 1G3TA 1MZBA 1KQ9A 4ENKA 3JW4A 4Q47A 4QLCU 3CUQB 4LK0F 3JSOA 1I27A 4O3MA 3O3KA 2EV6A 3DV8A 2V9VA 1FZPB 1P4WA 2VBYA 3P9IA 2KRFA 4OIRF 3VEPA 1RNLA 2F2EA 2K4BA 3RTRA 4U0VA 1ZG5A 2A07F 2P7VB 4ENJA 1R1UA 2ZNYA 5H6QA 5LGUA 4HBLA 1QO0D 3TDUC 2IT0A 3BPXA 2DLLA 4I02A 3V8KA 3COAC 3TOBA 1EH7A 2RNJA 4EV0A 4U0WA 4AIHA 4P9FA 5E1XA 5BQTA 4M72A 4IRGA 2DW4A 1SD6A 1XSDA 1FNNA 2YPRA 3B02A 2FBKA 2XAHA 1I1GA 1AOYA 2V79A 1DP7P 5LHGA 3EDPA 3WE3A 4I7HA 4L5IA 3I5UA 3MZYA 2XAFA 4GCVA 1IAWA 2XVCA 1S7AA 1ZRCA 2RC4A 3RKYA 2JPCA 2ZMEB 3ROUA 3I58A 4KIGA 1DPUA 4XSXF 2D1HA 3ZQ7A 3EUHA 3CJNA 4I01A 4KICA 2VONA 2NNYA 2DI3A 1ZARA 4QWQA 2Y75A 5L3FA 1MJBA 4EQQA 2XAQA 3DPLC 2YU3A 3JTHA 1G6NA 4HZFA 3TKYA 3KP5A 1KYZA 1LDDA 6PAXA 2RKHA 2HQRA 2ESHA 2M45A 4AD9A 2LF8A 4UHTA 2DU9A 1KU3A 3HTUA 3GZ6A 1L3LA 3KZZA 2D1VA 4ZYGA 1S6LA 4HDVA 5HLGA 1HKQA 1XSVA 3K69A 2QUFA 4G7HF 1MD0A 4BH9A 1R1VA 2P6SA 2DO7A 4S04A 3BROA 3J80Z 1YW8A 1BOAA 2VXZA 5L3EA 1J5YA 4HX7A 4G7OF 2M1BA 1I1SA 3WODF 4OU0A 4KUMA 2KIUA 3PQJA 2Z5UA 1U78A 1O7FA 5BPIA 3JTGA 1G3YA 3WTTC 2XKPA 1EV7A 5K5OA 2H6CA 4F7ZA 2JT1A 3IL2A 2M5WA 3HSRA 2CQKA 4L9JA 2ADUA 4WXDA 1TNTA 5J6XA 2BV6A 4FX4A 4P96A 4LG0A 3WTSC 1XGSA 1R00A 4KT5C 1Z9CA 1I5ZA 5DV5A 4LD5A 5D8LB 1YW9A 4Y15A 3WGIA 1R58A 4G8XA 2MLKA 3WGGA 2FMYA 1PDNC 4A0ZA 3QU6A 2XGXA 3K9TA 2A69F 3E6CC 5JVTA 5CVVA 4EGYA 1LB2A 3L7WA 1YYVA 4RB0A 2EA4A 2HOEA 2OA4A 5DCFA 2ZCWA 3F8MA 1U8RA 2FRHA 4CGZA 2EFQA 1D8KA 3C1DA 4ASNA 3E97A 2NNNA 4BXUA 1KQ0A 5LEJA 5FFZA 1U2WA 2RQPA 2MA3A 3I4PA 5FB2A 1SFEA 2CWEA 1W7PD 4BHPA 2KKOA 5TRDA 2OZ6A 4OIQF 4K2EA 1K78A 2KIMA 3L00A 1HQCA 1C0WA 3WU1B 3M8EA 4G94A 3E5QA 2OD5A 1ZLKA 4RGXA 3V7RA 1UCRA 1JE8A 5FD6A 3T8RA 1ZHFA 2XHKA 3TDZC 1UHMA 1IXSB 2QQAA 4LB6B 1H9TA 4GXOA 3HTSB 2E1CA 2W25A 4LGWA 3RI4A 1VTNC 3MWMA 1D5VA 4KDPA 1OYYA 5FFXA 1G3WA 1KQ8A 1RIOH 4N9IA 4R8HA 2Q0OA 4I2OA 3DXJF 2W85A 1AWCA 5HLHA 4YG2F 1ZLJA 2VT2A 4Z2YA 3D5LA 1WRJA 4R1HA 2KJBA 5ICFA 4M73A 5AIPA 3MZHA 4M6XA 2L3DA 3Q5FA 3CTAA 5HOOA 2ETHA 4HQMA 1EH6A 2OZUA 3DPTA 3R0AA 2DT5A 3WTYC 4HQEA 4MTEA 3IRRA 2CO5A 5DD4A 3L9FA 1HBXG 1R1TA 2V1XA 4OMZA 3KP6A 3TOAA 2PG4A 1RI7A 2F5EA 3E5XA 4PDKA 2HQNA 4XLPF 1ZYRF 1U5TC 2IRFG 2GA1A 2P4WA 3ZMTA 4GO1A 1IN7A 5J8CA 2HTSA 2VE8A 3R4KA 1F4KA 3FX3A 1BC7C 1FC3A 3VOEA 2A61A 2FF4A 3ZMVA 1O7LA 1HSTA 3VODA 2JPBA 1O3TA 1TW2A 1O3RA 3IWFA 1O3QA 3OV8A 2VT3A 3HRSA 5D5VB 1TTYA 1V4RA 3F6OA 2G7UA 5JHUA 5AONA 3GZ5A 3SHFA 2FU4A 4BHCA 2QM3A 4PGGA 5DCMA 3BZ6A 5CVIA 4RAZA 3EQLF 1STZA 3FMQA 2GA2A 1QZYA 1L0OC 3HRTA 5K1YA 5D4SA 4WCGA 4WX9A 4CYDA 1YG2A 4M9XA 1YQAA 2ELHA 2QQ9A 4Q5SF 1U3EM 4CDGA 1DPRA 4RGRA 1J9IA 4OOIA 2HS5A 3FZVA 4FT8A 2FNPA 2K86A 2PFBA 1R36A 3O2PE 1FWZA 2YSRA 3J81Z 3N97A 1PP8F 1F5TA 3BJAA 3RPUA 3V8LA 4XSZF 5ED4A 1IF1A 2PBIA 1FBUA 3BP8A 1S3JA 3ECOA 3FXUA 3I54A 4IHSA 2R7FA 4RGSA 5LRSA 2XROA 2ZXJA 3K1NA 4G9YA 2DK5A 3EYYA 4AWXB 3HYIA 4PZJA 4HYEA 3I59A 5D5UB 4HX8A 1B1BA 2EJRA 2CFXA 1B9NA 1FT9A 5JFRA 3BPVA 1K6OA 5EEHA 4UV8A 2HYFA 3V7SA 4JK1X 2F5CA 3KZYA 1EH8A 2GQQA 1SMYF 2ZBKA 1Q1HA 4HLYA 2HKXA 4EMSA 2EFWA 4EM1A 4U88A 1W5TA 2DQLA 1QPMA 1T0FA 4WWCA 3CUOA 2FMLA 4HF2A 2NS0A 1D3YA 3K2ZA 1BBYA 4RAYA 3T8TA 4ZH4F 1QBJA 3R61A 3HRUA 1JGSA 4CZZA 3TO9A 4U7BA 4ZZLA 3QPHA 2VBZA 5L3BA 4IF4A 2ESNA 2EFPA 1TQMA 3E6DA 1B4AA 5HVQC 3P9CA 2W57A 1FY7A 1GHCA 4AIKA 1Z05A 1LEBA 1YS7A 2V1UA 4A5MA 5FD5A 4M71A 3FXQA 2P7CB 2D2WA 1K7AA 4MQ9F 1B59A 4GGGA 3R6SA 3QPTA 1G4DA 1MGTA 4RS8A 1P92A 3DF8A 3V7CA 4I0BA 3P9KA 2GXBA 2WTEA 1IXCA 5BS6A 3NRVA 3E5UA 4KNYA 2M8EA 4KN4X 4UVAA 4Y17A 3T5XA 5IT9Z 2OAZA 1HKSA 3FMRA 1ON1A 4YFXF 4CHUA 3VB2A 3HOTA 2OU2A 3F21A 4OMYA 4KMFA 3KLNA 5CVRA 2LDUA 5E18F 3L09A 3V4GA 4LLGF 5K5QA 2QZ8A 2IP2A 2PMHA 4EM2A 1FP2A 1BN5A 4ESFA 5BOXA 3SZPA 2R7DA 5DCMB 1FOKA 3FM5A 1T6SA 1FYKA 3TGNA 4M74A 2ACJA 3ZP5A 2RGVA 5ILSA 4HOBA 3MCZA 3JAMZ 2UWMA 3CO6C 1FSHA 2STWA 2XKOA 4A2UA 1ZH5A 1XMKA 1LJ9A 1SMTA 2W24A 5D8KB 4YIFA 2OBPA 1T39A 3K1PA 3ABTA 4LJZF 3J80K 1XN7A 1A04A 4ZYDA 3DP7A 4MEYF 1RZ4A 5F64A 5LLQA 5E1ZB 4HA8A 2LNBA 2L4MA 3WTUC 2IW5A 2P6TA 1JHFA 2P8TA 3L2CA 3WU0A 2VOOA 1WSUA 3BJ6A 3LSTA 2EV5A 3IWZA 3HHGA 1T2KA 3SZTA 4ENNA 3ISPA 4P5OA 2E1NA 3LA3A 1H9GA 1TQIA 2IA0A 4DQ2A 5LBQA 3MFKA 1MJAA 2P5KA 3WE2A 1CF7A 1KU9A 2HEOA 2EV0A 3I59B 4HLXA 3KP2A 2QQBA 4KYWA 3RPQA 2DFIA 3KCCA 1GVJA 1TLHB 3GF2A 2K4JA 5DUIA 3F23A 2DBBA 4S05A 2IA1A 4A6DA 2UXNA 5LEKA 2Y48A 3F8BA 4PGHA 1X3UA 4HV6A 4DNCA 2K7LA 4LB5A 2KIFA 4WF2A 3M7GA 3HIFA 1O57A 3CUQC 2IPQX 4M9ZA 4L0YB 3H3ZA 3W6KB 3GLXA 2VODA 1Z1DA 5DYMA 1J75A 1B6AA 4A6EA 3SFZA 3GFJA 4B09A 1J59A 4NHJA 1YIOA 1QZZA 3GO5A 1D8JA 3TQNA 4HDUA 1P6RA 1V3FA 1SAXA 2Z99A 1BM9A 5BMZA 1MJ9A 4WXHA 2AXLA 4NB5A 3F8FA 2EA2A 2J5PA 4MEXF 1YTYA 2RN7A 2NRAC 2FNAA 1F9NA 2FEZA 4UV9A 2FOKA 4MGRA 1ZAOA 3GFMA 2H09A 5JI6A 3LA2A 2DK8A 1XDUA 1WI9A 3REOA 4L9VA 1P4XA 3KP7A 2JZYA 2PMUA 1IXRC 2PQ8A 4HX4A 3B73A 2WWYA 3E6MA
chains in the Genus database with same CATH superfamily
4IQJA 2L0KA 1BR1A 1ZRDA 2UUZA 1XDSA 3E3VA 1YOVB 4CH7A 5HDNA 5LFAA 2MH9A 1WJAA 5D4RA 3I55I 2E34A 3HRMA 2P5LC 1U9OA 2DA2A 1DU0A 2CUFA 2LMDA 4W97A 5J8FA 1YFHA 2PLYA 3J7AY 3W2VA 1T56A 4EGZA 1OMIA 2MYSA 3DTEA 2QWWA 3LQRA 2MD5A 3KEQA 4F52A 1HF0A 2K3FA 3S93A 5GAHJ 1K83J 2WAQN 3IKVA 5KVRA 3KE2A 2EB7A 5A2QZ 4MTDA 2ZMEC 4E7HA 4CSWA 2RAEA 3S2DJ 1ULYA 2OV7A 3HBLA 3U2RA 3GUDA 3S1NJ 2BHYA 4NC6A 3PSIA 3GX4X 1U5TA 3O8HA 3C18A 4CA0A 3FK6A 4M3BA 2B9SA 5E17F 3E6BA 2VC0A 3DEUA 2JA8J 4EVIA 1TWHJ 2HGCA 3NQOA 3OIPA 1FJLA 4HV5A 5GAGJ 4FCYA 4MQVA 2LSOA 4JOMA 2HU9A 2LR8A 1BR4A 3TO6A 1FPQA 2Y0MA 2DFEA 2NS7A 1FYMA 2E60A 1W4MA 1W7PA 3RIRA 4BACA 4N9HA 2COBA 3FMSA 3O6BB 2L01A 4E7ZA 3HM5A 3CMMA 1SD4A 1QQIA 1XC5A 4CICA 2JRTA 3SDBA 3CCMI 5FLXZ 4JBAA 3FKJA 2E2HJ 2X1EA 2W84A 4HW0A 4YIIA 4KFCA 1JKRC 4EATA 2O8KA 2A5WA 2R3SA 2O3FA 1D1AA 2DTZA 3X2QH 1H89C 2E7XA 3F6VA 4LG0B 1KGSA 2EFNA 1HCRA 2HPIA 2X85A 1R6RA 2IXSA 1IUYA 2VBXA 4G7ZF 2O9LA 2BY3A 1RR7A 2B0LA 5IT3A 2WAEA 1OKRA 4CXFA 4UB8C 2XASA 1E2XA 1ZG3A 2RV8A 2F5FA 3ZN1A 1OCCH 1HW2A 4LITA 4XLNF 4YFKF 5LGNA 1LFUP 3B6AA 4L9TA 1FP1D 2A6EF 1UJ8A 2HZTA 5CVUA 1VQKI 2G9WA 4O5VA 1MDMA 2KJCA 4P55A 3GW2A 1Z77A 2RREA 4IVNA 2JTVA 1YO5C 3OYCA 4C2TA 3F9KA 5TJJA 4A3JJ 3ONQA 2FSWA 3FXKA 2NVUB 3BLYA 2R7XA 1KA8A 1SVOA 2QA4I 4MFEA 1GXQA 3OSFA 1FOXA 2M30A 3ZQLA 3M8JA 4IKFA 2VKDA 3FM3A 3FXJA 5IOYA 1UAAA 5IYDJ 1SD5A 3CCJI 2STTA 1FOWA 2FQ3A 5DDGA 5M5XJ 2RVCA 4LLLA 4AC0A 3PQKA 2Z33A 1YE9A 3DCFA 4WXCA 1T8IA 1XD7A 2E5ZA 3IP4B 3OOPA 4E70A 2EQRA 4HAMA 4M9SA 2JSPA 2JSCA 2GOMA 3PUFA 4HEA2 4JP0A 4UNOA 3BJOA 1MBFA 3M8FA 4IRIA 1ZR2A 5CVJA 1SANA 5FGMA 2QBYA 1HA8A 2X0LA 1FLIA 2A5YB 1MH4A 3D5RC 4NC7A 5HODA 5D5WB 1CF7B 3BY6A 2MH2A 4AVPA 3ZN0A 4ZYHA 1OPCA 1BOBA 1W1WE 3OIOA 3FXRA 4C2UA 3GTKJ 5F1RA 3AG2H 1XMAA 1Z91A 2O61A 3PNVA 3MAJA 2Y2ZA 1H0MA 1XCVA 3BG5A 1USSA 1WJBA 3FXMA 3WU2C 1P4AA 2V1NA 3GXOA 1DUXC 4XN0A 3SQNA 4KT6A 2PN6A 4XLCA 3CJRB 4DZPA 5E1WA 3WTXC 2DPDA 5FLVA 1WHUA 1TNSA 4XNFA 2R5ZA 2DDBA 1PUFB 3DBLB 3PFYA 4A0YA 1K78B 5D6FA 3RYPA 3Q9SA 4KMUX 1HC8A 5F6FA 3ECHA 2Q2EA 2R7OA 2DT6A 2X6YA 2CUEA 2FA5A 3ABUA 5K5RA 1TWGJ 3NWTA 2ZKZA 2M8GX 1SD7A 2X6XA 4ESJA 1OCTC 1X3ZB 3P7NA 2DMQA 2EINH 4XRFA 2ZXIA 2PJPA 3BOQA 2AO9A 4DIQA 5ERIA 5K7HA 1OYWA 4BJTA 2F5VA 2XRLA 4C30A 4HF0A 2CUJA 2L2OA 3CC7I 1YLFA 3KLOA 1E3HA 2I8DA 3HKZN 3LA7A 3KETA 4MIMA 3H0DA 1ITYA 3A01B 2DN0A 5AIQA 1Y0UA 2F4IA 2FD5A 3V42A 1XGNA 4CCOA 3EUAA 3D0SA 5FKLA 4MO7A 3BZKA 2XF7A 3ELKA 2YX7A 2CW0F 1IRGA 5LRRA 3VFZA 5HDKA 1KYWA 4FISA 4E7JA 4L5JA 2IS1A 4IOCF 1ZGAA 1FYLA 3CLOA 3KP4A 3M9AA 5E3NA 4BXXJ 4RAFA 3HOUJ 1WI3A 2BE5F 1BI2A 2XUBA 2W00A 2X4HA 1CQTA 3BTLA 3VPRA 1KU7A 2ISYA 3GFLA 3DBRB 4Y4RA 5E8IA 2VUMJ 3OYAA 3OYLA 3ZMUA 3J81K 1MMGA 2O8XA 2JJ7A 3H3UA 5HDGA 2TDXA 3A0BC 2K5CA 5IY5H 1OR7A 1WJ5A 3HSFA 2NOJB 5DM6F 1Z6TA 5ILUA 4LIVA 5JR3A 1XB4A 4H4KC 1PP7U 5FRMA 1W5SA 3FWEA 4U87A 3H3VK 5BPDA 2NYXA 1USTA 2UXXA 4XKCA 3HPGA 3WGHA 1HKTA 1NTCA 4XR6A 1QHHD 4RLQA 2K9MA 2VC1A 4M3DA 1R5HA 2L9NA 2QENA 4A12A 1GV5A 4B8XA 3K4LA 5EYRA 1JXSA 4IPAA 5FKNA 1HDPA 2WB1N 3FISA 2VOPA 1UHWA 2A6TA 2HTJA 2H94A 5ILVA 5CJ9A 2ME0A 2FBIA 3LSMA 1G3SA 2BVMA 3M07A 4EJUA 2E7WA 4ON0A 3I4NJ 2F6CA 1LVAA 1E17A 2LKSA 5HS7A 2GWRA 3JRAA 4HG2A 2WA0A 2HFHA 4D7NA 1LKXA 1LQ1A 5GPAA 2COMA 2EIJH 1REPC 3BDDA 3QAHA 4UVBA 3ZMSA 3DQVC 4MHGA 5KK1A 3WTZA 5IOZA 3F22A 2YX4A 4QSHA 1SC7A 2HWVA 4R79A 2IS6A 3DU5A 2OQGA 3DTKA 4HF1A 2RNGA 3KFWX 2MLGA 2VBWA 3SEZA 4EJOA 2WY7Q 3EUHC 1IUFA 1IN8A 3H35A 5E79C 4P9UA 1U5TB 3SXYA 4BNCA 1TQPA 4UUSA 1Z7UA 3WTWC 2MBFA 3K4KA 4AYBA 4ANJA 1JTYA 3LWFA 3L2RA 3CDLA 3Q9VA 1K79A 3DLAA 1OLTA 2DA5A 5ICGA 3OS2A 1DU6A 4BHBA 3KYLA 3G3ZA 4OINF 2QVOA 2QSHX 3RQIA 1W0TA 4JYKA 2ID6A 2HR3A 1FSEA 4F3QA 1W7PB 4L9NA 2CRGA 2ZNZA 2ZFWA 4D5CA 3CLQA 2F5DA 3LMMA 4QPQA 3PNTA 4O6JA 2J5OA 3M1EA 1E3OC 4BJ5C 2BYVE 2EK5A 4UUVA 2M87A 1ZG1A 3K70C 1XGMA 1AHDP 2DA6A 3BWGA 2BVLA 3QP6A 3IHUA 4MNUA 5ICEA 2Z9OA 1FEXA 2ZO4A 3JRCA 1JT0A 1WJCA 5LGTA 2DTRA 2DPUA 4I0AA 2V26A 3I64A 5TISC 2L9RA 1GXPA 1GV2A 3I53A 3VYTB 3C3WA 4OAYA 1I50J 2O03A 4GRIA 3KPHA 1IN5A 3N05A 3ZR8X 4L18B 3PM1A 5LHHA 2RDPA 1S9HA 2V6CA 3ZMDA 1F1ZA 2Z3YA 3C2GA 4YFNF 4X1EA 1JT6A 4PJ0C 1BJZA 1LEAA 1ODDA 1B9MA 1FOYA 2JVHA 4NUBA 1MDMB 4Y33A 2Q8KA 4QTRA 2XAJA 4BAYA 1QVTA 4FHTA 2E71A 3FBIB 2BHZA 2GXGA 5KNLA 3Q0WA 2ME6A 3CJTB 1XTAA 3K0LA 2BBYA 1W0UA 1FBQA 1YJNI 5ICCA 3OYGA 2P5VA 4RMNA 4D1QA 2EPFA 3BR5A 2A68F 3JREA 3GTLJ 1BC8C 3GWZA 1Z6RA 4XBFA 2QLZA 4IJAA 5D5XB 2XV4S 3GVAA 2CFOA 4UXNA 2EWNA 2Z16A 3DKWA 1Q1VA 5FO5A 4G6DA 5B3SH 1ON2A 3QPSA 5FRNA 2A3SA 3GYHX 2KRCA 3FDYA 5M3MJ 5LHIA 5EDNA 4IHTA 2BXZA 3H0GJ 2VQLA 2AHQA 4LK1F 1MBGA 4FX0A 3R60A 1LPQA 2Y69H 2ELKA 3CCRI 3GTJJ 5H2FC 2QBYB 4E7LA 4E7KA 2CGPA 5IT9K 2BGCA 3HSEA 1XSXA 2BZTA 2E36A 2OUMA 1JUMA 5HS9A 1MBHA 3F8CA 1HW1A 1VQ6I 4XOPA 4KIFA 3BG6A 2LK2A 4RGUA 1S72I 1WVRA 4BYYA 4ITVA 4LFUA 5F0CA 1R23A 3F3XA 4EJVA 4YELA 1SFKA 2WC2A 2L9SA 3K2AA 2FE3A 2VJJA 3F72A 5L3CA 4OIPF 4RB3C 4EJTA 2G7HA 2I10A 2YU9J 4BU2A 1LNWA 5DTDA 2R5ZB 4BQAA 1Z21A 2KMUA 2M0CA 4BE2A 3FXOA 3JSPA 3ULQB 2E2IJ 1NHAA 1RC9A 2DQRA 2JUGA 3ZQFA 4HNUA 2Q2EB 2IA2A 1IN6A 1X2NA 3C7JA 1WKMA 2L02A 1G8XA 2IGOA 4Q48A 3FF5A 4XMYA 4PCQA 4D0PA 1HSJA 5H20A 1LDKB 1T98A 2L4AA 3U21A 5D6EA 4TV7A 2K9SA 2JA7J 3A1YA 4W1UA 1ACIA 3CP2A 5DD8A 2XAGA 4D5FA 3FHZA 1I6XA 2H27A 3VDXA 3HOSA 5EEGA 2O7OA 3JAMK 5HS8A 2KDZA 2IJLA 2GBYA 5E20A 1MMAA 2DMPA 3CO7C 1ZQ3P 2VJIA 1Y8RB 5E3LA 2IGKA 3OMYA 4EEFG 2R0QC 1X1PA 2XGCA 1UG2A 1RETA 3AKZA 3QPLA 1WQ2A 2ISZA 1TT5B 1IN4A 3NAUA 4GYIA 4Y3OA 2HOSA 4KISA 4OWRB 1S5LC 3MQ0A 1BA5A 3T0YA 2PEXA 4DJAA 3U9GA 4RA2A 2XSDC 2H6BA 3CCUI 2GM4A 4JX5A 4WK8F 3BR1A 2PJRA 2HKOA 1HOMA 4DYQA 2X48A 5CLSA 2L9VA 1MKMA 2W82A 2FBHA 3CUQA 2CMPA 3ZPLA 2VLAA 1JHHA 1MW7A 2VKVA 2EBIA 1BI3A 4I6ZA 1ZRFA 2V9KA 4CYCA 4N0BA 2GZWA 1RESA 4RAGA 4LLNA 4EM0B 1J2XA 4H0EA 3L2QA 5DUKA 4U7DA 1FBSA 3ZMZA 3RKWA 3ERED 3RYRA 1IW7F 1LDJA 2KZGA 3MKLA 3T1BA 4FASD 2YUSA 3DEEA 1ZREA 3U1DA 3PSFA 3Q0VA 4FQGA 2VKHA 3S2WA 3CMEI 3MVPA 4C9YA 1APLC 1N77A 2CG4A 2L54A 3JRHA 4A3FJ 5DEQA 3RKXA 3CMAI 3AG4H 3N4MA 3HHHA 1CGPA 1X4PA 2WY8Q 1BIAA 3MKYB 4LMYA 4RB1A 1BI0A 1GDTA 4ZYAA 2Z2SB 4IXAA 1DDNA 1HXDA 1XCBA 1IZ1A 1T95A 1UFMA 2O0YA 4NNJA 1I3QJ 1PUEE 2A05A 3HJEA 2VN2A 2MC3A 3IRQA 4ZZDA 4B3XA 3G73A 2KDOA 1T38A 3AL0C 1QVUA 3R0JA 3A03A 4I09A 1B8IA 1SFXA 1XS9A 1QNTA 2QYOA 5CYVA 2FXAA 3LFKA 1NK3P 1R9TJ 2XRNA 4PK4A 2KL4A 4BEHB 3LAJA 2QCOA 3J7AO 4UUSB 1TBXA 2IVMA 2L5QA 2Y30A 4IOAF 3SDGA 4MFDA 3CF5F 2E1OA 3F8NA 3SYTA 2AS5F 1ZR4A 2K9QA 2H1KA 2HDCA 5J47A 4EJWA 2K02A 2OCEA 3W2WA 1OYIA 1WJDA 4NQWA 4MLOA 3RPUD 3PIPF 4XL9A 4B47A 1XGOA 2DAOA 4II3A 5IYCJ 2QEXI 4L0ZB 4AIJA 4A3MJ 2CW8A 3K6GA 2VPLA 1BJAA 2GAUA 1ONVA 2DFHA 3DFGA 2OC6A 2CSOA 2L7MP 2ZMEA 3QP5A 4ABZA 4Y13A 2MD0A 1WWXA 2IBDA 4I98B 1K4SA 3GTOJ 3VWBA 2DOAA 2A6HF 3LQQA 3TP3A 4XLAA 5L3DA 3RCOA 3TO7A 4A5NA 1BW6A 1WCMJ 4OIOF 1ZGWA 2NOGA 2CYYA 2CQNA 4F92B 4ENMA 2CQ7A 2VKEA 2PX9A 2VE9A 4PFOA 1LFPA 4A3IJ 4HSTA 1RRJA 3I71A 1EJ9A 3S17J 4GYGA 2O6GE 3L2VA 3QRFF 1J0RA 2WV0A 2HYGD 4M6YA 2NXNB 4ETSA 2PMZA 1OQYA 2C6YA 2QKLB 4DGWB 1R5GA 3KP3A 4F93B 1I39A 2XPVA 3CDHA 5HLIA 3H92A 1YS6A 4XM3A 3Q3SA 4AU7A 2X6OA 3V8JA 2LRDA 2ZSIB 1W36D 4Y52J 2GIZA 4KIBA 1QGPA 4NDLA 5E8GA 1RUOA 3JR9A 3OR2C 4B3AA 1GUUA 3I0TA 2LFBA 4IEJA 4PSWA 3EETA 3LAPA 3GBGA 5L3GA 3DU6A 4C3HJ 1IRFA 1TW3A 3IC7A 3WHBA 5H6RA 4IRHA 2K27A 4BXFA 5K7ZA 2Y9YA 3HOWJ 3I4MJ 4Z6YA 1O4XA 3CCQI 3QOPA 2W7NA 3IKTA 2BY2A 2EFOA 2KPMA 1XX5A 1BI1A 1J7KA 2WADA 3BZCA 3MEXA 3ML6A 3PFIA 2D45A 5IP9J 3HDDA 1S7OA 3BC8A 1QHGA 3K7AJ 2DXIA 1UELB 1S8NA 5A2QK 1ZN2A 3RDIA 1ZKGA 3KEOA 1O3SA 1V55H 1YW7A 4ESBA 2K9NA 1V5FA 1KU2A 2M7AA 2X51A 2ZJ2A 3BTIA 1BIBA 3A2KA 1U6GA 4BJ6C 4G6QA 3MMYB 1S29A 2LKPA 4RB2C 1HW5A 3S8PA 4DBRA 1R7JA 1RUNA 3GTPJ 3CCYA 1JJ8C 3E6MA 1A5JA 4V19K 1ZGJA 4UVCA 4JQFA 2H8RA 2HQAA 5F1JA 1FX7A 3GEZA 3NEUA 1JTXA 1KZHA 2PI0A 1OFCX 1R22A 2UZKA 4ZYEA 3OS0A 3EYIA 1UB9A 2BEOA 3GFIA 2XIGA 2YR2A 4U0YA 4A3GJ 3RZOJ 1LE8B 3EPZA 3RJPA 3GTMJ 3OYEA 4XIDA 4RLFA 3AAFA 2NAZA 2K85A 2XSJC 2WBMA 3HUGA 5FLXK 3BG3A 3W6JB 1X2MA 2QSFX 4V2FA 4Q4ZF 3KIOA 1PJRA 2UV1A 3WTVC 2KLOA 1AKHA 4KA4A 2V1DA 4C2MJ 1SFUA 3WG9A 1IO2A 3CQZJ 3IAM2 4KN7X 2GIVA 2XPWA 2Y0SN 3K1MA 1P2FA 4CO8A 4A0XA 1IDYA 3CZ6A 3F0CA 2DMTA 2LF7A 2OQRA 3QU3A 1G3TA 1MZBA 2ECBA 4A69C 4BGDA 1KQ9A 5E3OA 2JWTA 2PJRB 4ENKA 5M5WJ 3A02A 4CCLA 3JW4A 4BKXA 3M3YJ 4Q47A 4QLCU 1I3AA 3CUQB 3ESWB 4LK0F 3JSOA 1I27A 1OCZH 4XLHA 1VQOI 2IS2A 4O3MA 1MBJA 3OYNA 2V6EA 4CYCB 4XRSA 3BTCA 3O3KA 2EV6A 3BR2A 4D7MA 3TL4X 1GT0C 2ZSHB 1A35A 3RQ4A 3DV8A 5FKKA 2EZLA 2V9VA 4A3EJ 2V7FA 1RKWA 1FZPB 2NVQJ 1P4WA 2VBYA 1FIPA 3P9IA 2KRFA 4OIRF 3VSLA 2VQHA 3VEPA 4RDUA 3MZ8A 1RNLA 3VYSB 2F2EA 2HVQA 2IS4A 2K4BA 5J40A 3RTRA 4U0VA 2R7SA 3O8GA 1ZG5A 2A07F 2P7VB 3IUOA 3S32A 1U0JA 2XDVA 4ENJA 1W36C 2F4MB 1R1UA 1ETXA 2ZNYA 5H6QA 5LGUA 4HBLA 4BDZA 1T08B 3TW6A 2JVGA 1QO0D 3TDUC 2HVSA 2IT0A 3BPXA 3L2UA 2DLLA 4I02A 3V8KA 2LG4A 3COAC 3TOBA 1EH7A 2RNJA 3IH4A 4U0WA 4EV0A 2CV1A 4AIHA 1P7JA 4P9FA 1B8IB 2L7KA 5E1XA 5BQTA 3OS1A 4M72A 4Y7NJ 4IRGA 5F27A 1SEUA 2DW4A 1SD6A 1TWFJ 4IX7A 1XSDA 1FNNA 3CP8A 2YPRA 3B02A 2QSGX 2FBKA 5EG0A 4YRVA 2KHMA 2WAQA 4P1WA 2XAHA 4FTHA 1I1GA 5IPAA 1AOYA 2V79A 3JRIA 1DP7P 2M4GA 5LHGA 3S14J 3EDPA 3WE3A 1YHQI 2EILH 2E1MC 4I99C 1YJWI 4I7HA 4L5IA 3LSGA 3G71I 3CF2A 3I5UA 1ETQA 3MZYA 4NQWB 2XAFA 4GCVA 1MMNA 5CKTA 2CU7A 1IAWA 4XN3A 2XVCA 1D1CA 3LSJA 4YEJA 3DKXA 2KFDA 1W5CC 1S7AA 3OSGA 2RC4A 3GCMA 1ZRCA 3RKYA 2JPCA 2ZMEB 2O5RA 3ROUA 3I58A 4KIGA 5FKMA 1DPUA 4YIRX 2D1HA 4XSXF 1MNEA 3ZQ7A 3EUHA 3CJNA 4I01A 4KICA 2HQ5A 2VONA 2NNYA 1X4OA 3UR3C 1D1BA 2DI3A 4PFPA 1ZARA 4QWQA 2Y75A 4XKVA 5L3FA 1IRXA 1MJBA 4EQQA 2CV0A 1SVMA 2XAQA 3DPLC 2R93J 2YU3A 3JTHA 1G6NA 3D1NI 1RKTA 4HZFA 2HDDA 3E0JB 3TKYA 3K4BA 2DT7B 2JA2A 3KP5A 3UKGA 1KYZA 1D5YA 1LDDA 3SZGA 6PAXA 3CC4I 2RKHA 2HQRA 4BE1A 2ESHA 2M45A 4AD9A 3CMYA 4IO9F 2LF8A 1JUSA 4UHTA 2VPRA 2DU9A 1KU3A 4E7SA 3HTUA 3P5JA 3GZ6A 2TRTA 1L3LA 3KZZA 2IGNA 4NC8A 2D1VA 4ZYGA 1S6LA 4HDVA 5HLGA 1HKQA 1XSVA 3OYHA 3K69A 2LREA 1ETOA 2QUFA 4G7HF 1MD0A 4BH9A 1R1VA 2P6SA 2DO7A 1NH3A 4S04A 1M1EB 3BROA 3E7LA 1YW8A 3J80Z 2R92J 1FIAA 4LG3A 1BOAA 2VXZA 3BR3A 2ZB9A 3ZQCA 2FX0A 4XQFA 3JRFA 5L3EA 1J5YA 1DGWY 4HX7A 1LVKA 5F08A 1VQ8I 4FE7A 4IQ4A 2I5UA 4G7OF 2FOWA 2M1BA 3HEFA 1U8BA 1I1SA 5F0HA 3WODF 4OU0A 3IH3A 4KUMA 4IZZA 5FJ8J 2KIUA 3PQJA 1WPKA 2Z5UA 1U78A 1O7FA 5BPIA 2R7VA 3JTGA 1G3YA 1SVLA 3IAS2 3WTTC 4I76A 2R7WA 2EH3A 2XKPA 3UNGC 3DEWA 1EV7A 3BCBA 5M5YJ 3E1SA 5K5OA 2H6CA 4B4CA 4F7ZA 2JT1A 3IL2A 2OCCH 1OCOH 3ABLH 2M5WA 4PUSA 5IP6A 1E3PA 3ZRGA 1JKOC 3HSRA 1NG7A 2MC4A 1VQ5I 2CQKA 4L9JA 2OF7A 1SAUA 2ADUA 4WXDA 1TNTA 3TP0A 4DOZA 3LSHA 5J6XA 2BV6A 4ZJZA 4FX4A 2PMZN 2MSYA 4P96A 4LG0A 2WAFA 3WTSC 1D0ZA 3RKQA 1XGSA 1R00A 4KT5C 4PJMA 5KAIC 3CCSI 4RM2A 5EGOA 5J1RA 1Z9CA 3LSPA 3VYUB 1I5ZA 2DJIA 5CQGA 3VSKA 5DV5A 4LD5A 3B6CA 5D8LB 4XONA 1AKHB 1YW9A 3G1MA 4ZDLA 2HDWA 4Y15A 3WGIA 1R58A 1WFXA 3PL8A 1TL8A 1WH7A 4G8XA 5JHFA 1G2HA 2MLKA 3MKWB 1K6YA 2FMYA 2P0WA 3WGGA 4A0ZA 1PDNC 2HPMA 5BNGA 3QU6A 2XGXA 3K9TA 2A69F 3S3NA 3E6CC 2Y9ZA 2GXAA 5C3EJ 2CQQA 3HKZA 5JVTA 4BBRJ 1Y8QB 5CVVA 3OYJA 4BUPA 4UB6C 4AVZA 4EGYA 3ABKH 2LD5A 4M3GA 1LB2A 2XAUA 3L7WA 1YYVA 1YI2I 3ASOH 4RB0A 5GAEJ 2EA4A 2HOEA 2HZDA 2OA4A 5DCFA 4E6KG 3CCVI 2ZCWA 1RR8C 3JRGA 4ZTFA 3A4CA 3F8MA 1U8RA 2FRHA 2XGDA 4CGZA 3ABMH 9ANTA 1IC8A 3H5RA 1J09A 2EFQA 1D8KA 3C1DA 1VNDA 2AXTC 4XLFA 4ASNA 4GDFA 3E97A 4RBOA 2NNNA 4BXUA 2QKMB 4C3IJ 1KQ0A 5LEJA 1XPXA 5FFZA 1R5ID 4DZJA 1U2WA 2RQPA 2MA3A 3I4PA 5FB2A 2NVYJ 3HGYA 1YITI 4BBSJ 2V4JC 1SFEA 2L7FP 2CWEA 1W7PD 3DLLF 4BHPA 3KEYA 2KKOA 5TRDA 2OZ6A 4CCJA 3ZOBA 4OIQF 4K2EA 4J01A 3K4MA 1TC3C 5B1AH 4C3JJ 4XLEA 1K78A 2KIMA 3OYFA 3S3OA 3L00A 3H5NA 1HQCA 3DBHB 4HSRA 3WU1B 1C0WA 1MH3A 3M8EA 3E5QA 4G94A 1N78A 4A3KJ 4GFBA 2OD5A 1ZLKA 4BQQA 2LLKA 4N4NB 4RGXA 3H9QA 3V7RA 1UCRA 1JE8A 4DYRA 3LOCA 5FD6A 3T8RA 3HOXJ 1ZHFA 2XHKA 3TDZC 1UHMA 3G6EI 2ID3A 5B66C 1IXSB 3RZDJ 3ERMA 2LYCA 1Y39A 2H1LA 3HOVJ 2QQAA 4LB6B 1H9TA 3J7YJ 4GXOA 3HTSB 3S1MJ 2DYSH 3IV5A 2E1CA 1A31A 2W25A 3AG1H 4LGWA 1A6QA 4KJZA 1YX5A 1ENHA 3RI4A 1VTNC 1R4MB 3MWMA 1X1AA 1D5VA 2HXIA 5IYBJ 2B63J 4KDPA 2VJ4A 1OYYA 5FFXA 3SJMA 1X19A 2N8GA 1HLVA 1G3WA 1KQ8A 2CQXA 1RIOH 1Y1WJ 1PVEA 1VZ0A 1JKQC 4N9IA 3CDIA 4R8HA 2Q0OA 4I2OA 3DXJF 4G12A 2W85A 1AWCA 5HLHA 1VF9A 2KP6A 1H8AC 3DKYA 3K4JA 4YG2F 1UHSA 2JMWA 2OJED 3FK7A 1ZLJA 2VT2A 4Z2YA 1JUPA 2V9PA 3D5LA 1WRJA 3OWTA 4R1HA 2KJBA 5ICFA 2D5VA 4M73A 5AIPA 3MZHA 1KONA 4M6XA 3PNYA 2NVTJ 2L3DA 2R7UA 3G1LA 3Q5FA 3CTAA 3HG9A 3QWLA 5HOOA 2ETHA 2R5YA 4HQMA 2CV2A 2M34A 1EH6A 3OYBA 2OZUA 2DJNA 1NG6A 3DPTA 3R0AA 2JA6J 3S15J 2DT5A 3BR0A 3WTYC 4HQEA 4MTEA 1TWAJ 2Z1DA 2HYJA 4XKBA 3IRRA 2CO5A 1EA3A 5DD4A 4ZC3A 3OYKA 1BR2A 3QODA 1ETVA 3L9FA 4A3DJ 2H8WA 3I3LA 1HBXG 1R1TA 3FXLA 3KYDB 2JQ7A 2V1XA 2XF5A 4OMZA 3GTGJ 4HRIA 2DYRH 3KP6A 3TOAA 2PG4A 3ZXSA 4HPQA 1RI7A 1XMXA 2F5EA 1Y0NA 3E5XA 4PDKA 1IV8A 1X58A 3HOZJ 3OYMA 3M1CA 5KHDA 3GZNB 2HQNA 4XLPF 1ZYRF 1U5TC 2BY1A 2QF7A 2IRFG 2GA1A 2P4WA 3ZMTA 1IG7A 1VQMI 5KCMA 2R7TA 4GO1A 1IN7A 5J8CA 2HTSA 2CH0A 2VE8A 3R4KA 1F4KA 1Y1VJ 1DP3A 2ECCA 1JKPC 2L7ZA 3FX3A 3OY9A 3ZQQA 1BC7C 1VI0A 3H5AA 1FC3A 1VQ7I 2MGQA 1OISA 3VOEA 3MD2A 2A61A 2FF4A 3ZMVA 1O7LA 2LTPA 1HSTA 3IH2A 3VODA 4BL0B 4AYBN 2M9HA 2R4GA 3HC7A 2F4OB 2JPBA 1O3TA 2MABA 4CCMA 5GADJ 1TW2A 3ZGKA 3NWSA 3LL7A 1O3RA 2IGMA 3IWFA 1O3QA 1JGGA 1QU3A 2M7BA 3OV8A 4RM3A 3S2HJ 2VT3A 2HNHA 1UZCA 3HRSA 5CPRB 2ZXWH 2DMNA 3S1QJ 2LH9A 3KX2A 5D5VB 1TTYA 4CCKA 1ORKA 5EGOB 1V4RA 3F6OA 1EKEA 2G7UA 5JHUA 4ZTJA 4HNVA 5AONA 4S0HB 3BT9A 1WJEA 3GZ5A 3SHFA 4B1RA 5J1YA 2FU4A 4BHCA 2QM3A 4PGGA 2JA5J 1P7IA 1T33A 3CJQB 2QQ8A 5DCMA 1D0YA 3BZ6A 5CVIA 2NS8A 4RAZA 4X6AJ 3EQLF 3FBNB 1STZA 2EZIA 3FMQA 5TGTA 2GA2A 4IHVA 1QZYA 1L0OC 3HRTA 3W6VA 5K1YA 2JUCA 1TZLA 5D4SA 4WCGA 2VQCA 4WX9A 3OL3A 1YG2A 4CYDA 1Z7LA 4M9XA 2X1CA 3H9JA 1YQAA 2YS9A 2ELHA 3G2BA 1PYVA 1VQ9I 3CCLI 2F48A 1YX3A 4QIWN 5J3LA 2QQ9A 2FUG2 1U3EM 4Q5SF 4CDGA 4HNTA 1DPRA 4RGRA 1X1CA 2FQ4A 3ZQIA 4BQOA 1J9IA 2IAIA 2HS5A 4OOIA 3FZVA 4FT8A 2CW7A 2FNPA 1K4TA 4ZDOA 1JI8A 2K86A 1POGA 2PFBA 5F0FA 2MFZA 1R36A 4DW6A 3O2PE 4BE0A 4XICA 5B5EC 1FWZA 2DOFA 2KIQA 1WGXA 2YSRA 1K61A 2OTJI 5C44J 3J81Z 3N97A 4D9JA 1PP8F 4CCNA 1F5TA 4CUGA 2DA4A 4L5EA 1ETWA 3BJAA 3RPUA 3V8LA 4XSZF 1AA7A 1IV6A 2R7QA 5ED4A 1IF1A 2PBIA 5DS9A 3BR6A 4G6TB 1UMQA 1FBUA 2VL8A 3BP8A 1QPIA 2LKXA 1S3JA 3ECOA 3FXUA 4B43A 3I54A 3K70D 3ZQHA 3JCUC 4IHSA 2R7FA 2OTLI 4RGSA 4N4OB 4F91B 1YRNA 5LRSA 2XROA 3FIWA 2ZXJA 3H1CA 1ETKA 3QYFA 5HLTA 1VQ4I 5EZHA 2LBFA 3K1NA 4G9YA 2DK5A 3Q0UA 2OPTA 3EYYA 4V2GA 4AWXB 2DMUA 4XRMA 3HYIA 1DQUA 2DA7A 2XF6A 4PZJA 4HYEA 1FTZA 3I59A 5J4VA 5D5UB 4E7IA 5GTHC 2LP0A 4HX8A 1B1BA 2EJRA 2VI6A 2BXYA 3ZQGA 5E3MA 2CFXA 3H9GA 1B9NA 3G4SI 3ZCOA 1OJLA 1FT9A 2LOOA 5JFRA 4IHXA 3BPVA 1K6OA 1GVDA 5EEHA 4UV8A 2HYFA 3V7SA 4JK1X 3QQAA 2F5CA 4PJNA 4FETA 3KZYA 2BW3A 1EH8A 2GQQA 2BOLA 1SMYF 2ZBKA 3HZJA 3GTQJ 2VIXA 3MN2A 1Q1HA 4HLYA 2HKXA 2BY0A 4EMSA 2EZKA 3AL0B 3GLLA 5J1UA 1S7EA 1QA6A 1MSFC 3WG7H 3HXLA 2EFWA 4EM1A 4U88A 1MBEA 3WHCA 1W5TA 2DQLA 2KRHA 1T0FC 1QPMA 1T0FA 5K7FA 1OR7C 3OOUA 4WWCA 3CUOA 3DTIA 2XGEA 4J00A 2FMLA 3OIQA 4HF2A 2NS0A 5J4YA 1D3YA 2EIMH 3JRDA 1G59A 3K2ZA 5EEAA 1BBYA 1TP4A 1ZK8A 4RAYA 3T8TA 4ZH4F 1QBJA 1VQPI 3R61A 3JRBA 1SFOJ 3HRUA 1JGSA 4XOTA 4CZZA 3TO9A 3S1RJ 1F36A 5HNHA 1X3WB 4U7BA 2ZJQF 2R5YB 1FMWA 3HOYJ 4AIDA 3OYDA 3BQYA 4ZZLA 2GLOA 4XRSG 3QPHA 2VBZA 2LY1A 5L3BA 3J7ZI 3KZIC 4IF4A 2P81A 4IHYA 2CJJA 2KT0A 4CZCA 2ESNA 1ZTRA 2EFPA 1TQMA 3E6DA 3L2WA 2W1OA 1B4AA 5HVQC 3P9CA 4XKWA 1N25A 2W57A 4B44A 1FY7A 5LD2C 1WZ2A 1GHCA 2DDAA 4AIKA 1Z05A 4A3BJ 1MIJA 1LEBA 5HNFA 2B7EA 1YS7A 3L1PA 2V1UA 1Z0XA 4A5MA 5FD5A 4M71A 3FXQA 5M3FJ 3OL4A 2P7CB 2D2WA 1K7AA 2M4KA 4MQ9F 4A93J 1B59A 4BEHA 1X1BA 1JJ6C 4GGGA 1B72A 3I9V2 3R6SA 3LSKA 3QPTA 5EZGA 1BL0A 2GOXB 1OCPA 1G4DA 3K4NA 1MGTA 4RS8A 1P92A 3DF8A 3V7CA 4I0BA 2XB5A 4BY1J 4NBQA 3P9KA 2GXBA 2WTEA 1IXCA 2Q1ZB 5BS6A 1VFCA 3PO2J 4IL6C 3NRVA 3E5UA 4ZDPA 1V54H 5C4JJ 2K9LA 3FHNA 1MMSA 2QGUA 4KNYA 3KYCB 4DYCA 3W3CA 3H36A 1FTTA 2M8EA 5GTIC 2CUZA 1Z3XA 4KN4X 2E35A 4OAZA 2X9DA 4UVAA 4Y17A 2DA1A 3C2BA 3T5XA 5IT9Z 4QPOA 2ZC2A 3ASNH 2OAZA 1MSEC 2XPUA 4AM3A 1HKSA 1Y6IA 3HPHA 1Y56A 3FMRA 1ON1A 4YFXF 4CHUA 3VB2A 5FKOA 3HOTA 5DM7F 2OU2A 3F21A 1YJ9I 4OMYA 4KMFA 2JN6A 3KLNA 5CVRA 2LDUA 5E18F 3D5SC 3L09A 3HGGA 3PUBA 4LLGF 3RSNA 3V4GA 2XB0X 1WH5A 2IEKA 2QZ8A 1V5EA 5K5QA 3LSRA 2M3AA 2IP2A 2PMHA 1A36A 1TT0A 1VQLI 4XK4A 4BY7J 4EM2A 1FP2A 1EF4A 1BN5A 4PJJA 4ESFA 1VQNI 5BOXA 3SZPA 2VB6A 2R7DA 5DCMB 2DCEA 3QYBA 1U9NA 1FOKA 2KQRA 3FM5A 1T6SA 2VASA 3LNQA 1N75A 1IGNA 3A0HC 2DFFA 1FYKA 2E2JJ 2K3PA 3TGNA 3OYIA 4II2A 2ELJA 3G1OA 2R7ZJ 4M74A 2ACJA 3ZP5A 1A6IA 2RGVA 2JK3A 5ILSA 5FLMJ 3BCAA 1R71A 2LY2A 2KISA 5KAFC 4HOBA 3MCZA 3JAMZ 2UWMA 3CO6C 2NVXJ 1XG1A 1FSHA 3HB9A 3BG7A 3HUGB 2STWA 2Y0SA 4E4HA 2XKOA 1P9QC 4A2UA 1ZH5A 1XMKA 1LJ9A 4M3FA 1ETYA 1SMTA 4BQNA 2G0EA 2W24A 2RQQA 5D8KB 4YIFA 2OBPA 3FKIJ 2HXOA 3K1PA 1T39A 1IDZA 3ABTA 2X6WA 4LJZF 3J80K 1XN7A 1A04A 4FE4A 1QRYA 3LFUA 4ZYDA 3PJRA 3DP7A 2ICWG 5GP9A 4MEYF 1R49A 1RZ4A 5F64A 1Z67A 5LLQA 2VXDA 4J19A 5E1ZB 4HA8A 2LNBA 2JRMA 1LUJB 2L4MA 2DOEA 1D0XA 3WTUC 2IW5A 3CCEI 2P6TA 1JHFA 2P8TA 3L2CA 3QOEA 4JX6A 4PSXA 3VYRB 3WU0A 5EF6A 1WSUA 2VOOA 1MBKA 3BJ6A 2TCTA 3HL2A 3LSTA 2M2EA 3SEQA 2E19A 2AQFA 2EV5A 1YIJI 3IWZA 3HHGA 4UY8I 3W2AA 3OR1C 3QYEA 1T2KA 4XORA 1H88C 1YRNB 2XC7A 5GPCA 4F55A 3SZTA 4ENNA 3DPUA 3ISPA 1I6HJ 4P5OA 2DA3A 2E1NA 4BS9A 3LA3A 5JLXA 2X1DA 2LBFB 1H9GA 2DODA 2KZVA 1TQIA 2IA0A 2M0MA 3BQZA 4DQ2A 3PO3J 2EIKH 1LE8A 5LBQA 1E0EA 3MFKA 1MNDA 1MJAA 1AU7A 2P5KA 3WE2A 4KITB 1CF7A 1KU9A 2HEOA 2EV0A 3I59B 4HLXA 1F43A 1Z3YA 3KP2A 2QQBA 4KYWA 3RPQA 5CQEA 2DFIA 4UUTA 3KCCA 1QZEA 1GVJA 3DWLE 1TLHB 3GF2A 3AFHA 3MKZA 2K4JA 2CS3A 2W4SA 2LC2A 5DUIA 3U1KA 3F23A 2DBBA 4S05A 2IA1A 1PUFA 2HOAA 4A6DA 3K10A 1IRZA 2UXNA 2BW3B 2WB1A 2Y48A 5LEKA 3F8BA 3BG9A 4PGHA 4DBQA 2VJ5A 1LFBA 1X3UA 4HV6A 4DNCA 2K7LA 5JVGF 4LB5A 5EJCA 2HVRA 2KIFA 1ZELA 4WF2A 3M7GA 3TEDA 3HIFA 2VQGA 1O57A 3CUQC 1RPWA 2IPQX 4JX4A 1MNMC 4M9ZA 2ZJRF 3BTJA 1NK2P 4L0YB 3CC2I 5EG0B 3H3ZA 1IJWC 2MW8A 3W6KB 3GLXA 2VODA 1Z1DA 5DYMA 3A01A 1J75A 1B6AA 4A3LJ 1X1DA 5B1BH 3AG3H 4A6EA 3SFZA 5C4XJ 3GFJA 4B09A 1J59A 2AQEA 4NHJA 1YIOA 2E1MB 2EZHA 1OCRH 3TMOA 1QZZA 5FROA 3S3MA 3EUKL 1HDDC 3GO5A 3NARA 3S16J 1BW5A 2HI3A 1D8JA 4LIUA 3TQNA 4M3EA 2W48A 3GMEA 1ERDA 4HDUA 1P6RA 1TWCJ 3TBIA 3M4OJ 1V3FA 1SAXA 5F04A 2Z99A 1BM9A 3I56I 4M6VA 4BDYA 1MJ9A 5BMZA 2WV1A 2FJ1A 4WXHA 4PJLA 2AXLA 4NB5A 3F8FA 2EA2A 4A3CJ 2J5PA 3PIOF 2R7RA 4MEXF 1YTYA 2RN7A 2ZFUA 2NRAC 2FNAA 1F9NA 2FEZA 4UV9A 1FMVA 2E5NA 2FOKA 4LOCA 4MGRA 1ZAOA 1UG0A 2LY9A 3GFMA 1WJFA 2H09A 3CD6I 5JI6A 3LA2A 2DK8A 1XDUA 4IHWA 1DGRM 1WI9A 3REOA 3K4CA 4L9VA 1P4XA 2HOTA 2Y31A 1GLNA 2LVSA 3KP7A 2JZYA 2MG4A 2K40A 2PMUA 4AUXA 1IXRC 2PQ8A 3CESA 3LSIA 4HX4A 3TW7A 4B48A 2ZJPF 3C2HA 5JLWA 2ZXHA 1B72B 3SFIA 1R4NB 3B73A 2WWYA 1V5GA 1MMDA 5IP7J 4X0GA
chains in the Genus database with same CATH topology
1ZRDA 1XDSA 3E3VA 5HDNA 2MH9A 5D4RA 3HRMA 2P5LC 5J8FA 1YFHA 2PLYA 4EGZA 1OMIA 2QWWA 3LQRA 2MD5A 3KEQA 3IKVA 5KVRA 3KE2A 2EB7A 5A2QZ 4MTDA 1ULYA 3U2RA 3GUDA 3GX4X 1U5TA 3C18A 5E17F 3E6BA 2VC0A 3DEUA 4EVIA 3NQOA 2HGCA 4HV5A 4MQVA 2LSOA 3TO6A 1FPQA 2Y0MA 1FYMA 1W4MA 1W7PA 3RIRA 4N9HA 3FMSA 3O6BB 2L01A 1SD4A 1QQIA 4CICA 2JRTA 5FLXZ 4JBAA 4HW0A 2W84A 4YIIA 4KFCA 2R3SA 2O3FA 2E7XA 3F6VA 4LG0B 1KGSA 2EFNA 1IUYA 2VBXA 4G7ZF 2B0LA 5IT3A 1OKRA 4CXFA 2XASA 1E2XA 1ZG3A 2RV8A 2F5FA 3ZN1A 1HW2A 4XLNF 4YFKF 5LGNA 4L9TA 1FP1D 2A6EF 2HZTA 5CVUA 2G9WA 4O5VA 1MDMA 2KJCA 4P55A 3GW2A 4IVNA 2JTVA 1YO5C 5TJJA 2FSWA 1KA8A 1GXQA 2M30A 3FM3A 1SD5A 2STTA 2FQ3A 5DDGA 2RVCA 4LLLA 3PQKA 2Z33A 4WXCA 1XD7A 3OOPA 4E70A 4HAMA 4M9SA 2JSCA 4UNOA 3BJOA 3M8FA 4IRIA 5CVJA 5FGMA 2QBYA 2X0LA 1FLIA 2A5YB 5D5WB 1CF7B 3BY6A 2MH2A 4AVPA 3ZN0A 4ZYHA 1OPCA 3FXRA 5F1RA 1XMAA 1Z91A 2O61A 3MAJA 1H0MA 1XCVA 1USSA 1P4AA 3GXOA 1DUXC 3SQNA 2PN6A 3WTXC 5E1WA 2DPDA 1TNSA 1K78B 4A0YA 5D6FA 3RYPA 3Q9SA 4KMUX 5F6FA 3ECHA 2Q2EA 2FA5A 3ABUA 5K5RA 2ZKZA 1SD7A 4ESJA 3P7NA 4XRFA 2PJPA 3BOQA 5ERIA 1OYWA 4HF0A 1YLFA 3KLOA 3LA7A 3KETA 5AIQA 1Y0UA 1XGNA 3D0SA 3ELKA 2YX7A 2CW0F 1IRGA 5LRRA 3VFZA 5HDKA 1KYWA 4L5JA 1ZGAA 1FYLA 3CLOA 3KP4A 3M9AA 2BE5F 1BI2A 2XUBA 2X4HA 1KU7A 2ISYA 3GFLA 5E8IA 3ZMUA 3J81K 2O8XA 3H3UA 5HDGA 2TDXA 1OR7A 3HSFA 1Z6TA 5ILUA 5JR3A 1XB4A 1PP7U 1W5SA 3FWEA 5BPDA 2NYXA 1USTA 2UXXA 3WGHA 1HKTA 2VC1A 1R5HA 2QENA 4A12A 4B8XA 1JXSA 4IPAA 2VOPA 1UHWA 2HTJA 2H94A 5ILVA 5CJ9A 2FBIA 1G3SA 4EJUA 2E7WA 4ON0A 1LVAA 1E17A 5HS7A 2GWRA 2HFHA 1LQ1A 2COMA 1REPC 3BDDA 3QAHA 4UVBA 3ZMSA 3DQVC 4MHGA 5KK1A 3WTZA 3F22A 2YX4A 2HWVA 4R79A 2OQGA 4HF1A 3KFWX 2MLGA 2VBWA 4EJOA 1IN8A 4P9UA 1U5TB 3SXYA 4BNCA 1TQPA 1Z7UA 3WTWC 2MBFA 3LWFA 3Q9VA 1K79A 5ICGA 4BHBA 3G3ZA 4OINF 2QVOA 2HR3A 1FSEA 1W7PB 4L9NA 2ZNZA 2ZFWA 2F5DA 4O6JA 2J5OA 3M1EA 2BYVE 2EK5A 4UUVA 2M87A 1ZG1A 1XGMA 3BWGA 3QP6A 3IHUA 4MNUA 5ICEA 2Z9OA 2ZO4A 5LGTA 2DTRA 2DPUA 4I0AA 3I64A 1GXPA 3I53A 3C3WA 2O03A 1IN5A 4L18B 5LHHA 2RDPA 2V6CA 3ZMDA 1F1ZA 2Z3YA 4YFNF 1LEAA 1ODDA 1B9MA 1MDMB 2Q8KA 2XAJA 4BAYA 4FHTA 2GXGA 3K0LA 2BBYA 1FBQA 5ICCA 2P5VA 2A68F 1BC8C 3GWZA 1Z6RA 4XBFA 2QLZA 4IJAA 5D5XB 2XV4S 3GVAA 4UXNA 2EWNA 3DKWA 5FO5A 4G6DA 1ON2A 2A3SA 3GYHX 5LHIA 4IHTA 4LK1F 4FX0A 3R60A 2QBYB 2CGPA 5IT9K 2BGCA 3HSEA 1XSXA 5HS9A 3F8CA 1HW1A 4KIFA 4RGUA 4BYYA 4LFUA 1R23A 3F3XA 4EJVA 2WC2A 2FE3A 3F72A 5L3CA 4OIPF 4RB3C 4EJTA 2G7HA 4BQAA 1LNWA 3JSPA 3ULQB 1NHAA 2DQRA 2IA2A 1IN6A 3C7JA 1WKMA 2L02A 4Q48A 3FF5A 4PCQA 4D0PA 1HSJA 5H20A 1LDKB 1T98A 2L4AA 5D6EA 4TV7A 5DD8A 2XAGA 3FHZA 1I6XA 2H27A 3HOSA 5EEGA 3JAMK 5HS8A 2IJLA 5E20A 3CO7C 1WQ2A 2ISZA 1IN4A 4GYIA 3MQ0A 3T0YA 2PEXA 3U9GA 2H6BA 4WK8F 2HKOA 5CLSA 1MKMA 2FBHA 3CUQA 3ZPLA 1JHHA 1BI3A 1ZRFA 4N0BA 2GZWA 4LLNA 4EM0B 1J2XA 4H0EA 5DUKA 4U7DA 1FBSA 3ZMZA 3RKWA 3ERED 3RYRA 1IW7F 1LDJA 3T1BA 1ZREA 3U1DA 3S2WA 2CG4A 2L54A 5DEQA 3RKXA 3N4MA 3HHHA 1CGPA 1BIAA 4LMYA 4RB1A 1BI0A 4IXAA 1DDNA 1HXDA 1XCBA 1IZ1A 1UFMA 2O0YA 1PUEE 2VN2A 2MC3A 3IRQA 4ZZDA 3G73A 1T38A 3R0JA 4I09A 1SFXA 1QNTA 2QYOA 5CYVA 2FXAA 3LFKA 2XRNA 3LAJA 3J7AO 1TBXA 2IVMA 3F8NA 2AS5F 2HDCA 4EJWA 2K02A 1OYIA 4NQWA 1XGOA 2DAOA 4L0ZB 4AIJA 1BJAA 2GAUA 1ONVA 3DFGA 2CSOA 2ZMEA 3QP5A 4Y13A 1WWXA 4I98B 2A6HF 3LQQA 5L3DA 3TO7A 4A5NA 4OIOF 2CYYA 4ENMA 2VE9A 3I71A 4GYGA 2O6GE 3QRFF 1J0RA 2WV0A 2HYGD 4M6YA 4ETSA 2C6YA 1R5GA 3KP3A 3CDHA 5HLIA 3H92A 1YS6A 3V8JA 4KIBA 1QGPA 5E8GA 1RUOA 3I0TA 3EETA 3LAPA 5L3GA 1IRFA 1TW3A 3IC7A 5H6RA 4IRHA 2K27A 3QOPA 3IKTA 2EFOA 1BI1A 1J7KA 3MEXA 3ML6A 3PFIA 2D45A 1S7OA 1S8NA 5A2QK 1ZN2A 3RDIA 3KEOA 1O3SA 1YW7A 4ESBA 1KU2A 2ZJ2A 1BIBA 1U6GA 4G6QA 1S29A 2LKPA 4RB2C 1HW5A 1R7JA 1RUNA 1ZGJA 4UVCA 4JQFA 1FX7A 3GEZA 3NEUA 2PI0A 1R22A 2UZKA 4ZYEA 3EYIA 1UB9A 2BEOA 3GFIA 2XIGA 2YR2A 4U0YA 3RJPA 3AAFA 2NAZA 3HUGA 5FLXK 3W6JB 4Q4ZF 3WTVC 4KA4A 2V1DA 1SFUA 3WG9A 4KN7X 2GIVA 3K1MA 1P2FA 4CO8A 4A0XA 2LF7A 2OQRA 3QU3A 1G3TA 1MZBA 1KQ9A 4ENKA 3JW4A 4Q47A 4QLCU 3CUQB 4LK0F 3JSOA 1I27A 4O3MA 3O3KA 2EV6A 3DV8A 2V9VA 1FZPB 1P4WA 2VBYA 3P9IA 2KRFA 4OIRF 3VEPA 1RNLA 2F2EA 2K4BA 3RTRA 4U0VA 1ZG5A 2A07F 2P7VB 4ENJA 1R1UA 2ZNYA 5H6QA 5LGUA 4HBLA 1QO0D 3TDUC 2IT0A 3BPXA 2DLLA 4I02A 3V8KA 3COAC 3TOBA 1EH7A 2RNJA 4EV0A 4U0WA 4AIHA 4P9FA 5E1XA 5BQTA 4M72A 4IRGA 2DW4A 1SD6A 1XSDA 1FNNA 2YPRA 3B02A 2FBKA 2XAHA 1I1GA 1AOYA 2V79A 1DP7P 5LHGA 3EDPA 3WE3A 4I7HA 4L5IA 3I5UA 3MZYA 2XAFA 4GCVA 1IAWA 2XVCA 1S7AA 1ZRCA 2RC4A 3RKYA 2JPCA 2ZMEB 3ROUA 3I58A 4KIGA 1DPUA 4XSXF 2D1HA 3ZQ7A 3EUHA 3CJNA 4I01A 4KICA 2VONA 2NNYA 2DI3A 1ZARA 4QWQA 2Y75A 5L3FA 1MJBA 4EQQA 2XAQA 3DPLC 2YU3A 3JTHA 1G6NA 4HZFA 3TKYA 3KP5A 1KYZA 1LDDA 6PAXA 2RKHA 2HQRA 2ESHA 2M45A 4AD9A 2LF8A 4UHTA 2DU9A 1KU3A 3HTUA 3GZ6A 1L3LA 3KZZA 2D1VA 4ZYGA 1S6LA 4HDVA 5HLGA 1HKQA 1XSVA 3K69A 2QUFA 4G7HF 1MD0A 4BH9A 1R1VA 2P6SA 2DO7A 4S04A 3BROA 3J80Z 1YW8A 1BOAA 2VXZA 5L3EA 1J5YA 4HX7A 4G7OF 2M1BA 1I1SA 3WODF 4OU0A 4KUMA 2KIUA 3PQJA 2Z5UA 1U78A 1O7FA 5BPIA 3JTGA 1G3YA 3WTTC 2XKPA 1EV7A 5K5OA 2H6CA 4F7ZA 2JT1A 3IL2A 2M5WA 3HSRA 2CQKA 4L9JA 2ADUA 4WXDA 1TNTA 5J6XA 2BV6A 4FX4A 4P96A 4LG0A 3WTSC 1XGSA 1R00A 4KT5C 1Z9CA 1I5ZA 5DV5A 4LD5A 5D8LB 1YW9A 4Y15A 3WGIA 1R58A 4G8XA 2MLKA 3WGGA 2FMYA 1PDNC 4A0ZA 3QU6A 2XGXA 3K9TA 2A69F 3E6CC 5JVTA 5CVVA 4EGYA 1LB2A 3L7WA 1YYVA 4RB0A 2EA4A 2HOEA 2OA4A 5DCFA 2ZCWA 3F8MA 1U8RA 2FRHA 4CGZA 2EFQA 1D8KA 3C1DA 4ASNA 3E97A 2NNNA 4BXUA 1KQ0A 5LEJA 5FFZA 1U2WA 2RQPA 2MA3A 3I4PA 5FB2A 1SFEA 2CWEA 1W7PD 4BHPA 2KKOA 5TRDA 2OZ6A 4OIQF 4K2EA 1K78A 2KIMA 3L00A 1HQCA 1C0WA 3WU1B 3M8EA 4G94A 3E5QA 2OD5A 1ZLKA 4RGXA 3V7RA 1UCRA 1JE8A 5FD6A 3T8RA 1ZHFA 2XHKA 3TDZC 1UHMA 1IXSB 2QQAA 4LB6B 1H9TA 4GXOA 3HTSB 2E1CA 2W25A 4LGWA 3RI4A 1VTNC 3MWMA 1D5VA 4KDPA 1OYYA 5FFXA 1G3WA 1KQ8A 1RIOH 4N9IA 4R8HA 2Q0OA 4I2OA 3DXJF 2W85A 1AWCA 5HLHA 4YG2F 1ZLJA 2VT2A 4Z2YA 3D5LA 1WRJA 4R1HA 2KJBA 5ICFA 4M73A 5AIPA 3MZHA 4M6XA 2L3DA 3Q5FA 3CTAA 5HOOA 2ETHA 4HQMA 1EH6A 2OZUA 3DPTA 3R0AA 2DT5A 3WTYC 4HQEA 4MTEA 3IRRA 2CO5A 5DD4A 3L9FA 1HBXG 1R1TA 2V1XA 4OMZA 3KP6A 3TOAA 2PG4A 1RI7A 2F5EA 3E5XA 4PDKA 2HQNA 4XLPF 1ZYRF 1U5TC 2IRFG 2GA1A 2P4WA 3ZMTA 4GO1A 1IN7A 5J8CA 2HTSA 2VE8A 3R4KA 1F4KA 3FX3A 1BC7C 1FC3A 3VOEA 2A61A 2FF4A 3ZMVA 1O7LA 1HSTA 3VODA 2JPBA 1O3TA 1TW2A 1O3RA 3IWFA 1O3QA 3OV8A 2VT3A 3HRSA 5D5VB 1TTYA 1V4RA 3F6OA 2G7UA 5JHUA 5AONA 3GZ5A 3SHFA 2FU4A 4BHCA 2QM3A 4PGGA 5DCMA 3BZ6A 5CVIA 4RAZA 3EQLF 1STZA 3FMQA 2GA2A 1QZYA 1L0OC 3HRTA 5K1YA 5D4SA 4WCGA 4WX9A 4CYDA 1YG2A 4M9XA 1YQAA 2ELHA 2QQ9A 4Q5SF 1U3EM 4CDGA 1DPRA 4RGRA 1J9IA 4OOIA 2HS5A 3FZVA 4FT8A 2FNPA 2K86A 2PFBA 1R36A 3O2PE 1FWZA 2YSRA 3J81Z 3N97A 1PP8F 1F5TA 3BJAA 3RPUA 3V8LA 4XSZF 5ED4A 1IF1A 2PBIA 1FBUA 3BP8A 1S3JA 3ECOA 3FXUA 3I54A 4IHSA 2R7FA 4RGSA 5LRSA 2XROA 2ZXJA 3K1NA 4G9YA 2DK5A 3EYYA 4AWXB 3HYIA 4PZJA 4HYEA 3I59A 5D5UB 4HX8A 1B1BA 2EJRA 2CFXA 1B9NA 1FT9A 5JFRA 3BPVA 1K6OA 5EEHA 4UV8A 2HYFA 3V7SA 4JK1X 2F5CA 3KZYA 1EH8A 2GQQA 1SMYF 2ZBKA 1Q1HA 4HLYA 2HKXA 4EMSA 2EFWA 4EM1A 4U88A 1W5TA 2DQLA 1QPMA 1T0FA 4WWCA 3CUOA 2FMLA 4HF2A 2NS0A 1D3YA 3K2ZA 1BBYA 4RAYA 3T8TA 4ZH4F 1QBJA 3R61A 3HRUA 1JGSA 4CZZA 3TO9A 4U7BA 4ZZLA 3QPHA 2VBZA 5L3BA 4IF4A 2ESNA 2EFPA 1TQMA 3E6DA 1B4AA 5HVQC 3P9CA 2W57A 1FY7A 1GHCA 4AIKA 1Z05A 1LEBA 1YS7A 2V1UA 4A5MA 5FD5A 4M71A 3FXQA 2P7CB 2D2WA 1K7AA 4MQ9F 1B59A 4GGGA 3R6SA 3QPTA 1G4DA 1MGTA 4RS8A 1P92A 3DF8A 3V7CA 4I0BA 3P9KA 2GXBA 2WTEA 1IXCA 5BS6A 3NRVA 3E5UA 4KNYA 2M8EA 4KN4X 4UVAA 4Y17A 3T5XA 5IT9Z 2OAZA 1HKSA 3FMRA 1ON1A 4YFXF 4CHUA 3VB2A 3HOTA 2OU2A 3F21A 4OMYA 4KMFA 3KLNA 5CVRA 2LDUA 5E18F 3L09A 3V4GA 4LLGF 5K5QA 2QZ8A 2IP2A 2PMHA 4EM2A 1FP2A 1BN5A 4ESFA 5BOXA 3SZPA 2R7DA 5DCMB 1FOKA 3FM5A 1T6SA 1FYKA 3TGNA 4M74A 2ACJA 3ZP5A 2RGVA 5ILSA 4HOBA 3MCZA 3JAMZ 2UWMA 3CO6C 1FSHA 2STWA 2XKOA 4A2UA 1ZH5A 1XMKA 1LJ9A 1SMTA 2W24A 5D8KB 4YIFA 2OBPA 1T39A 3K1PA 3ABTA 4LJZF 3J80K 1XN7A 1A04A 4ZYDA 3DP7A 4MEYF 1RZ4A 5F64A 5LLQA 5E1ZB 4HA8A 2LNBA 2L4MA 3WTUC 2IW5A 2P6TA 1JHFA 2P8TA 3L2CA 3WU0A 2VOOA 1WSUA 3BJ6A 3LSTA 2EV5A 3IWZA 3HHGA 1T2KA 3SZTA 4ENNA 3ISPA 4P5OA 2E1NA 3LA3A 1H9GA 1TQIA 2IA0A 4DQ2A 5LBQA 3MFKA 1MJAA 2P5KA 3WE2A 1CF7A 1KU9A 2HEOA 2EV0A 3I59B 4HLXA 3KP2A 2QQBA 4KYWA 3RPQA 2DFIA 3KCCA 1GVJA 1TLHB 3GF2A 2K4JA 5DUIA 3F23A 2DBBA 4S05A 2IA1A 4A6DA 2UXNA 5LEKA 2Y48A 3F8BA 4PGHA 1X3UA 4HV6A 4DNCA 2K7LA 4LB5A 2KIFA 4WF2A 3M7GA 3HIFA 1O57A 3CUQC 2IPQX 4M9ZA 4L0YB 3H3ZA 3W6KB 3GLXA 2VODA 1Z1DA 5DYMA 1J75A 1B6AA 4A6EA 3SFZA 3GFJA 4B09A 1J59A 4NHJA 1YIOA 1QZZA 3GO5A 1D8JA 3TQNA 4HDUA 1P6RA 1V3FA 1SAXA 2Z99A 1BM9A 5BMZA 1MJ9A 4WXHA 2AXLA 4NB5A 3F8FA 2EA2A 2J5PA 4MEXF 1YTYA 2RN7A 2NRAC 2FNAA 1F9NA 2FEZA 4UV9A 2FOKA 4MGRA 1ZAOA 3GFMA 2H09A 5JI6A 3LA2A 2DK8A 1XDUA 1WI9A 3REOA 4L9VA 1P4XA 3KP7A 2JZYA 2PMUA 1IXRC 2PQ8A 4HX4A 3B73A 2WWYA 3E6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRD A;  1XDS A;  3E3V A;  5HDN A;  2MH9 A;  5D4R A;  3HRM A;  2P5L C;  5J8F A;  1YFH A;  2PLY A;  4EGZ A;  1OMI A;  2QWW A;  3LQR A;  2MD5 A;  3KEQ A;  3IKV A;  5KVR A;  3KE2 A;  2EB7 A;  5A2Q Z;  4MTD A;  1ULY A;  3U2R A;  3GUD A;  3GX4 X;  1U5T A;  3C18 A;  5E17 F;  3E6B A;  2VC0 A;  3DEU A;  4EVI A;  3NQO A;  2HGC A;  4HV5 A;  4MQV A;  2LSO A;  3TO6 A;  1FPQ A;  2Y0M A;  1FYM A;  1W4M A;  1W7P A;  3RIR A;  4N9H A;  3FMS A;  3O6B B;  2L01 A;  1SD4 A;  1QQI A;  4CIC A;  2JRT A;  5FLX Z;  4JBA A;  4HW0 A;  2W84 A;  4YII A;  4KFC A;  2R3S A;  2O3F A;  2E7X A;  3F6V A;  4LG0 B;  1KGS A;  2EFN A;  1IUY A;  2VBX A;  4G7Z F;  2B0L A;  5IT3 A;  1OKR A;  4CXF A;  2XAS A;  1E2X A;  1ZG3 A;  2RV8 A;  2F5F A;  3ZN1 A;  1HW2 A;  4XLN F;  4YFK F;  5LGN A;  4L9T A;  1FP1 D;  2A6E F;  2HZT A;  5CVU A;  2G9W A;  4O5V A;  1MDM A;  2KJC A;  4P55 A;  3GW2 A;  4IVN A;  2JTV A;  1YO5 C;  5TJJ A;  2FSW A;  1KA8 A;  1GXQ A;  2M30 A;  3FM3 A;  1SD5 A;  2STT A;  2FQ3 A;  5DDG A;  2RVC A;  4LLL A;  3PQK A;  2Z33 A;  4WXC A;  1XD7 A;  3OOP A;  4E70 A;  4HAM A;  4M9S A;  2JSC A;  4UNO A;  3BJO A;  3M8F A;  4IRI A;  5CVJ A;  5FGM A;  2QBY A;  2X0L A;  1FLI A;  2A5Y B;  5D5W B;  1CF7 B;  3BY6 A;  2MH2 A;  4AVP A;  3ZN0 A;  4ZYH A;  1OPC A;  3FXR A;  5F1R A;  1XMA A;  1Z91 A;  2O61 A;  3MAJ A;  1H0M A;  1XCV A;  1USS A;  1P4A A;  3GXO A;  1DUX C;  3SQN A;  2PN6 A;  3WTX C;  5E1W A;  2DPD A;  1TNS A;  1K78 B;  4A0Y A;  5D6F A;  3RYP A;  3Q9S A;  4KMU X;  5F6F A;  3ECH A;  2Q2E A;  2FA5 A;  3ABU A;  5K5R A;  2ZKZ A;  1SD7 A;  4ESJ A;  3P7N A;  4XRF A;  2PJP A;  3BOQ A;  5ERI A;  1OYW A;  4HF0 A;  1YLF A;  3KLO A;  3LA7 A;  3KET A;  5AIQ A;  1Y0U A;  1XGN A;  3D0S A;  3ELK A;  2YX7 A;  2CW0 F;  1IRG A;  5LRR A;  3VFZ A;  5HDK A;  1KYW A;  4L5J A;  1ZGA A;  1FYL A;  3CLO A;  3KP4 A;  3M9A A;  2BE5 F;  1BI2 A;  2XUB A;  2X4H A;  1KU7 A;  2ISY A;  3GFL A;  5E8I A;  3ZMU A;  3J81 K;  2O8X A;  3H3U A;  5HDG A;  2TDX A;  1OR7 A;  3HSF A;  1Z6T A;  5ILU A;  5JR3 A;  1XB4 A;  1PP7 U;  1W5S A;  3FWE A;  5BPD A;  2NYX A;  1UST A;  2UXX A;  3WGH A;  1HKT A;  2VC1 A;  1R5H A;  2QEN A;  4A12 A;  4B8X A;  1JXS A;  4IPA A;  2VOP A;  1UHW A;  2HTJ A;  2H94 A;  5ILV A;  5CJ9 A;  2FBI A;  1G3S A;  4EJU A;  2E7W A;  4ON0 A;  1LVA A;  1E17 A;  5HS7 A;  2GWR A;  2HFH A;  1LQ1 A;  2COM A;  1REP C;  3BDD A;  3QAH A;  4UVB A;  3ZMS A;  3DQV C;  4MHG A;  5KK1 A;  3WTZ A;  3F22 A;  2YX4 A;  2HWV A;  4R79 A;  2OQG A;  4HF1 A;  3KFW X;  2MLG A;  2VBW A;  4EJO A;  1IN8 A;  4P9U A;  1U5T B;  3SXY A;  4BNC A;  1TQP A;  1Z7U A;  3WTW C;  2MBF A;  3LWF A;  3Q9V A;  1K79 A;  5ICG A;  4BHB A;  3G3Z A;  4OIN F;  2QVO A;  2HR3 A;  1FSE A;  1W7P B;  4L9N A;  2ZNZ A;  2ZFW A;  2F5D A;  4O6J A;  2J5O A;  3M1E A;  2BYV E;  2EK5 A;  4UUV A;  2M87 A;  1ZG1 A;  1XGM A;  3BWG A;  3QP6 A;  3IHU A;  4MNU A;  5ICE A;  2Z9O A;  2ZO4 A;  5LGT A;  2DTR A;  2DPU A;  4I0A A;  3I64 A;  1GXP A;  3I53 A;  3C3W A;  2O03 A;  1IN5 A;  4L18 B;  5LHH A;  2RDP A;  2V6C A;  3ZMD A;  1F1Z A;  2Z3Y A;  4YFN F;  1LEA A;  1ODD A;  1B9M A;  1MDM B;  2Q8K A;  2XAJ A;  4BAY A;  4FHT A;  2GXG A;  3K0L A;  2BBY A;  1FBQ A;  5ICC A;  2P5V A;  2A68 F;  1BC8 C;  3GWZ A;  1Z6R A;  4XBF A;  2QLZ A;  4IJA A;  5D5X B;  2XV4 S;  3GVA A;  4UXN A;  2EWN A;  3DKW A;  5FO5 A;  4G6D A;  1ON2 A;  2A3S A;  3GYH X;  5LHI A;  4IHT A;  4LK1 F;  4FX0 A;  3R60 A;  2QBY B;  2CGP A;  5IT9 K;  2BGC A;  3HSE A;  1XSX A;  5HS9 A;  3F8C A;  1HW1 A;  4KIF A;  4RGU A;  4BYY A;  4LFU A;  1R23 A;  3F3X A;  4EJV A;  2WC2 A;  2FE3 A;  3F72 A;  5L3C A;  4OIP F;  4RB3 C;  4EJT A;  2G7H A;  4BQA A;  1LNW A;  3JSP A;  3ULQ B;  1NHA A;  2DQR A;  2IA2 A;  1IN6 A;  3C7J A;  1WKM A;  2L02 A;  4Q48 A;  3FF5 A;  4PCQ A;  4D0P A;  1HSJ A;  5H20 A;  1LDK B;  1T98 A;  2L4A A;  5D6E A;  4TV7 A;  5DD8 A;  2XAG A;  3FHZ A;  1I6X A;  2H27 A;  3HOS A;  5EEG A;  3JAM K;  5HS8 A;  2IJL A;  5E20 A;  3CO7 C;  1WQ2 A;  2ISZ A;  1IN4 A;  4GYI A;  3MQ0 A;  3T0Y A;  2PEX A;  3U9G A;  2H6B A;  4WK8 F;  2HKO A;  5CLS A;  1MKM A;  2FBH A;  3CUQ A;  3ZPL A;  1JHH A;  1BI3 A;  1ZRF A;  4N0B A;  2GZW A;  4LLN A;  4EM0 B;  1J2X A;  4H0E A;  5DUK A;  4U7D A;  1FBS A;  3ZMZ A;  3RKW A;  3ERE D;  3RYR A;  1IW7 F;  1LDJ A;  3T1B A;  1ZRE A;  3U1D A;  3S2W A;  2CG4 A;  2L54 A;  5DEQ A;  3RKX A;  3N4M A;  3HHH A;  1CGP A;  1BIA A;  4LMY A;  4RB1 A;  1BI0 A;  4IXA A;  1DDN A;  1HXD A;  1XCB A;  1IZ1 A;  1UFM A;  2O0Y A;  1PUE E;  2VN2 A;  2MC3 A;  3IRQ A;  4ZZD A;  3G73 A;  1T38 A;  3R0J A;  4I09 A;  1SFX A;  1QNT A;  2QYO A;  5CYV A;  2FXA A;  3LFK A;  2XRN A;  3LAJ A;  3J7A O;  1TBX A;  2IVM A;  3F8N A;  2AS5 F;  2HDC A;  4EJW A;  2K02 A;  1OYI A;  4NQW A;  1XGO A;  2DAO A;  4L0Z B;  4AIJ A;  1BJA A;  2GAU A;  1ONV A;  3DFG A;  2CSO A;  2ZME A;  3QP5 A;  4Y13 A;  1WWX A;  4I98 B;  2A6H F;  3LQQ A;  5L3D A;  3TO7 A;  4A5N A;  4OIO F;  2CYY A;  4ENM A;  2VE9 A;  3I71 A;  4GYG A;  2O6G E;  3QRF F;  1J0R A;  2WV0 A;  2HYG D;  4M6Y A;  4ETS A;  2C6Y A;  1R5G A;  3KP3 A;  3CDH A;  5HLI A;  3H92 A;  1YS6 A;  3V8J A;  4KIB A;  1QGP A;  5E8G A;  1RUO A;  3I0T A;  3EET A;  3LAP A;  5L3G A;  1IRF A;  1TW3 A;  3IC7 A;  5H6R A;  4IRH A;  2K27 A;  3QOP A;  3IKT A;  2EFO A;  1BI1 A;  1J7K A;  3MEX A;  3ML6 A;  3PFI A;  2D45 A;  1S7O A;  1S8N A;  5A2Q K;  1ZN2 A;  3RDI A;  3KEO A;  1O3S A;  1YW7 A;  4ESB A;  1KU2 A;  2ZJ2 A;  1BIB A;  1U6G A;  4G6Q A;  1S29 A;  2LKP A;  4RB2 C;  1HW5 A;  1R7J A;  1RUN A;  1ZGJ A;  4UVC A;  4JQF A;  1FX7 A;  3GEZ A;  3NEU A;  2PI0 A;  1R22 A;  2UZK A;  4ZYE A;  3EYI A;  1UB9 A;  2BEO A;  3GFI A;  2XIG A;  2YR2 A;  4U0Y A;  3RJP A;  3AAF A;  2NAZ A;  3HUG A;  5FLX K;  3W6J B;  4Q4Z F;  3WTV C;  4KA4 A;  2V1D A;  1SFU A;  3WG9 A;  4KN7 X;  2GIV A;  3K1M A;  1P2F A;  4CO8 A;  4A0X A;  2LF7 A;  2OQR A;  3QU3 A;  1G3T A;  1MZB A;  1KQ9 A;  4ENK A;  3JW4 A;  4Q47 A;  4QLC U;  3CUQ B;  4LK0 F;  3JSO A;  1I27 A;  4O3M A;  3O3K A;  2EV6 A;  3DV8 A;  2V9V A;  1FZP B;  1P4W A;  2VBY A;  3P9I A;  2KRF A;  4OIR F;  3VEP A;  1RNL A;  2F2E A;  2K4B A;  3RTR A;  4U0V A;  1ZG5 A;  2A07 F;  2P7V B;  4ENJ A;  1R1U A;  2ZNY A;  5H6Q A;  5LGU A;  4HBL A;  1QO0 D;  3TDU C;  2IT0 A;  3BPX A;  2DLL A;  4I02 A;  3V8K A;  3COA C;  3TOB A;  1EH7 A;  2RNJ A;  4EV0 A;  4U0W A;  4AIH A;  4P9F A;  5E1X A;  5BQT A;  4M72 A;  4IRG A;  2DW4 A;  1SD6 A;  1XSD A;  1FNN A;  2YPR A;  3B02 A;  2FBK A;  2XAH A;  1I1G A;  1AOY A;  2V79 A;  1DP7 P;  5LHG A;  3EDP A;  3WE3 A;  4I7H A;  4L5I A;  3I5U A;  3MZY A;  2XAF A;  4GCV A;  1IAW A;  2XVC A;  1S7A A;  1ZRC A;  2RC4 A;  3RKY A;  2JPC A;  2ZME B;  3ROU A;  3I58 A;  4KIG A;  1DPU A;  4XSX F;  2D1H A;  3ZQ7 A;  3EUH A;  3CJN A;  4I01 A;  4KIC A;  2VON A;  2NNY A;  2DI3 A;  1ZAR A;  4QWQ A;  2Y75 A;  5L3F A;  1MJB A;  4EQQ A;  2XAQ A;  3DPL C;  2YU3 A;  3JTH A;  1G6N A;  4HZF A;  3TKY A;  3KP5 A;  1KYZ A;  1LDD A;  6PAX A;  2RKH A;  2HQR A;  2ESH A;  2M45 A;  4AD9 A;  2LF8 A;  4UHT A;  2DU9 A;  1KU3 A;  3HTU A;  3GZ6 A;  1L3L A;  3KZZ A;  2D1V A;  4ZYG A;  1S6L A;  4HDV A;  5HLG A;  1HKQ A;  1XSV A;  3K69 A;  2QUF A;  4G7H F;  1MD0 A;  4BH9 A;  1R1V A;  2P6S A;  2DO7 A;  4S04 A;  3BRO A;  3J80 Z;  1YW8 A;  1BOA A;  2VXZ A;  5L3E A;  1J5Y A;  4HX7 A;  4G7O F;  2M1B A;  1I1S A;  3WOD F;  4OU0 A;  4KUM A;  2KIU A;  3PQJ A;  2Z5U A;  1U78 A;  1O7F A;  5BPI A;  3JTG A;  1G3Y A;  3WTT C;  2XKP A;  1EV7 A;  5K5O A;  2H6C A;  4F7Z A;  2JT1 A;  3IL2 A;  2M5W A;  3HSR A;  2CQK A;  4L9J A;  2ADU A;  4WXD A;  1TNT A;  5J6X A;  2BV6 A;  4FX4 A;  4P96 A;  4LG0 A;  3WTS C;  1XGS A;  1R00 A;  4KT5 C;  1Z9C A;  1I5Z A;  5DV5 A;  4LD5 A;  5D8L B;  1YW9 A;  4Y15 A;  3WGI A;  1R58 A;  4G8X A;  2MLK A;  3WGG A;  2FMY A;  1PDN C;  4A0Z A;  3QU6 A;  2XGX A;  3K9T A;  2A69 F;  3E6C C;  5JVT A;  5CVV A;  4EGY A;  1LB2 A;  3L7W A;  1YYV A;  4RB0 A;  2EA4 A;  2HOE A;  2OA4 A;  5DCF A;  2ZCW A;  3F8M A;  1U8R A;  2FRH A;  4CGZ A;  2EFQ A;  1D8K A;  3C1D A;  4ASN A;  3E97 A;  2NNN A;  4BXU A;  1KQ0 A;  5LEJ A;  5FFZ A;  1U2W A;  2RQP A;  2MA3 A;  3I4P A;  5FB2 A;  1SFE A;  2CWE A;  1W7P D;  4BHP A;  2KKO A;  5TRD A;  2OZ6 A;  4OIQ F;  4K2E A;  1K78 A;  2KIM A;  3L00 A;  1HQC A;  1C0W A;  3WU1 B;  3M8E A;  4G94 A;  3E5Q A;  2OD5 A;  1ZLK A;  4RGX A;  3V7R A;  1UCR A;  1JE8 A;  5FD6 A;  3T8R A;  1ZHF A;  2XHK A;  3TDZ C;  1UHM A;  1IXS B;  2QQA A;  4LB6 B;  1H9T A;  4GXO A;  3HTS B;  2E1C A;  2W25 A;  4LGW A;  3RI4 A;  1VTN C;  3MWM A;  1D5V A;  4KDP A;  1OYY A;  5FFX A;  1G3W A;  1KQ8 A;  1RIO H;  4N9I A;  4R8H A;  2Q0O A;  4I2O A;  3DXJ F;  2W85 A;  1AWC A;  5HLH A;  4YG2 F;  1ZLJ A;  2VT2 A;  4Z2Y A;  3D5L A;  1WRJ A;  4R1H A;  2KJB A;  5ICF A;  4M73 A;  5AIP A;  3MZH A;  4M6X A;  2L3D A;  3Q5F A;  3CTA A;  5HOO A;  2ETH A;  4HQM A;  1EH6 A;  2OZU A;  3DPT A;  3R0A A;  2DT5 A;  3WTY C;  4HQE A;  4MTE A;  3IRR A;  2CO5 A;  5DD4 A;  3L9F A;  1HBX G;  1R1T A;  2V1X A;  4OMZ A;  3KP6 A;  3TOA A;  2PG4 A;  1RI7 A;  2F5E A;  3E5X A;  4PDK A;  2HQN A;  4XLP F;  1ZYR F;  1U5T C;  2IRF G;  2GA1 A;  2P4W A;  3ZMT A;  4GO1 A;  1IN7 A;  5J8C A;  2HTS A;  2VE8 A;  3R4K A;  1F4K A;  3FX3 A;  1BC7 C;  1FC3 A;  3VOE A;  2A61 A;  2FF4 A;  3ZMV A;  1O7L A;  1HST A;  3VOD A;  2JPB A;  1O3T A;  1TW2 A;  1O3R A;  3IWF A;  1O3Q A;  3OV8 A;  2VT3 A;  3HRS A;  5D5V B;  1TTY A;  1V4R A;  3F6O A;  2G7U A;  5JHU A;  5AON A;  3GZ5 A;  3SHF A;  2FU4 A;  4BHC A;  2QM3 A;  4PGG A;  5DCM A;  3BZ6 A;  5CVI A;  4RAZ A;  3EQL F;  1STZ A;  3FMQ A;  2GA2 A;  1QZY A;  1L0O C;  3HRT A;  5K1Y A;  5D4S A;  4WCG A;  4WX9 A;  4CYD A;  1YG2 A;  4M9X A;  1YQA A;  2ELH A;  2QQ9 A;  4Q5S F;  1U3E M;  4CDG A;  1DPR A;  4RGR A;  1J9I A;  4OOI A;  2HS5 A;  3FZV A;  4FT8 A;  2FNP A;  2K86 A;  2PFB A;  1R36 A;  3O2P E;  1FWZ A;  2YSR A;  3J81 Z;  3N97 A;  1PP8 F;  1F5T A;  3BJA A;  3RPU A;  3V8L A;  4XSZ F;  5ED4 A;  1IF1 A;  2PBI A;  1FBU A;  3BP8 A;  1S3J A;  3ECO A;  3FXU A;  3I54 A;  4IHS A;  2R7F A;  4RGS A;  5LRS A;  2XRO A;  2ZXJ A;  3K1N A;  4G9Y A;  2DK5 A;  3EYY A;  4AWX B;  3HYI A;  4PZJ A;  4HYE A;  3I59 A;  5D5U B;  4HX8 A;  1B1B A;  2EJR A;  2CFX A;  1B9N A;  1FT9 A;  5JFR A;  3BPV A;  1K6O A;  5EEH A;  4UV8 A;  2HYF A;  3V7S A;  4JK1 X;  2F5C A;  3KZY A;  1EH8 A;  2GQQ A;  1SMY F;  2ZBK A;  1Q1H A;  4HLY A;  2HKX A;  4EMS A;  2EFW A;  4EM1 A;  4U88 A;  1W5T A;  2DQL A;  1QPM A;  1T0F A;  4WWC A;  3CUO A;  2FML A;  4HF2 A;  2NS0 A;  1D3Y A;  3K2Z A;  1BBY A;  4RAY A;  3T8T A;  4ZH4 F;  1QBJ A;  3R61 A;  3HRU A;  1JGS A;  4CZZ A;  3TO9 A;  4U7B A;  4ZZL A;  3QPH A;  2VBZ A;  5L3B A;  4IF4 A;  2ESN A;  2EFP A;  1TQM A;  3E6D A;  1B4A A;  5HVQ C;  3P9C A;  2W57 A;  1FY7 A;  1GHC A;  4AIK A;  1Z05 A;  1LEB A;  1YS7 A;  2V1U A;  4A5M A;  5FD5 A;  4M71 A;  3FXQ A;  2P7C B;  2D2W A;  1K7A A;  4MQ9 F;  1B59 A;  4GGG A;  3R6S A;  3QPT A;  1G4D A;  1MGT A;  4RS8 A;  1P92 A;  3DF8 A;  3V7C A;  4I0B A;  3P9K A;  2GXB A;  2WTE A;  1IXC A;  5BS6 A;  3NRV A;  3E5U A;  4KNY A;  2M8E A;  4KN4 X;  4UVA A;  4Y17 A;  3T5X A;  5IT9 Z;  2OAZ A;  1HKS A;  3FMR A;  1ON1 A;  4YFX F;  4CHU A;  3VB2 A;  3HOT A;  2OU2 A;  3F21 A;  4OMY A;  4KMF A;  3KLN A;  5CVR A;  2LDU A;  5E18 F;  3L09 A;  3V4G A;  4LLG F;  5K5Q A;  2QZ8 A;  2IP2 A;  2PMH A;  4EM2 A;  1FP2 A;  1BN5 A;  4ESF A;  5BOX A;  3SZP A;  2R7D A;  5DCM B;  1FOK A;  3FM5 A;  1T6S A;  1FYK A;  3TGN A;  4M74 A;  2ACJ A;  3ZP5 A;  2RGV A;  5ILS A;  4HOB A;  3MCZ A;  3JAM Z;  2UWM A;  3CO6 C;  1FSH A;  2STW A;  2XKO A;  4A2U A;  1ZH5 A;  1XMK A;  1LJ9 A;  1SMT A;  2W24 A;  5D8K B;  4YIF A;  2OBP A;  1T39 A;  3K1P A;  3ABT A;  4LJZ F;  3J80 K;  1XN7 A;  1A04 A;  4ZYD A;  3DP7 A;  4MEY F;  1RZ4 A;  5F64 A;  5LLQ A;  5E1Z B;  4HA8 A;  2LNB A;  2L4M A;  3WTU C;  2IW5 A;  2P6T A;  1JHF A;  2P8T A;  3L2C A;  3WU0 A;  2VOO A;  1WSU A;  3BJ6 A;  3LST A;  2EV5 A;  3IWZ A;  3HHG A;  1T2K A;  3SZT A;  4ENN A;  3ISP A;  4P5O A;  2E1N A;  3LA3 A;  1H9G A;  1TQI A;  2IA0 A;  4DQ2 A;  5LBQ A;  3MFK A;  1MJA A;  2P5K A;  3WE2 A;  1CF7 A;  1KU9 A;  2HEO A;  2EV0 A;  3I59 B;  4HLX A;  3KP2 A;  2QQB A;  4KYW A;  3RPQ A;  2DFI A;  3KCC A;  1GVJ A;  1TLH B;  3GF2 A;  2K4J A;  5DUI A;  3F23 A;  2DBB A;  4S05 A;  2IA1 A;  4A6D A;  2UXN A;  5LEK A;  2Y48 A;  3F8B A;  4PGH A;  1X3U A;  4HV6 A;  4DNC A;  2K7L A;  4LB5 A;  2KIF A;  4WF2 A;  3M7G A;  3HIF A;  1O57 A;  3CUQ C;  2IPQ X;  4M9Z A;  4L0Y B;  3H3Z A;  3W6K B;  3GLX A;  2VOD A;  1Z1D A;  5DYM A;  1J75 A;  1B6A A;  4A6E A;  3SFZ A;  3GFJ A;  4B09 A;  1J59 A;  4NHJ A;  1YIO A;  1QZZ A;  3GO5 A;  1D8J A;  3TQN A;  4HDU A;  1P6R A;  1V3F A;  1SAX A;  2Z99 A;  1BM9 A;  5BMZ A;  1MJ9 A;  4WXH A;  2AXL A;  4NB5 A;  3F8F A;  2EA2 A;  2J5P A;  4MEX F;  1YTY A;  2RN7 A;  2NRA C;  2FNA A;  1F9N A;  2FEZ A;  4UV9 A;  2FOK A;  4MGR A;  1ZAO A;  3GFM A;  2H09 A;  5JI6 A;  3LA2 A;  2DK8 A;  1XDU A;  1WI9 A;  3REO A;  4L9V A;  1P4X A;  3KP7 A;  2JZY A;  2PMU A;  1IXR C;  2PQ8 A;  4HX4 A;  3B73 A;  2WWY A;  3E6M A; 
#chains in the Genus database with same CATH topology
 4IQJ A;  2L0K A;  1BR1 A;  1ZRD A;  2UUZ A;  1XDS A;  3E3V A;  1YOV B;  4CH7 A;  5HDN A;  5LFA A;  2MH9 A;  1WJA A;  5D4R A;  3I55 I;  2E34 A;  3HRM A;  2P5L C;  1U9O A;  2DA2 A;  1DU0 A;  2CUF A;  2LMD A;  4W97 A;  5J8F A;  1YFH A;  2PLY A;  3J7A Y;  3W2V A;  1T56 A;  4EGZ A;  1OMI A;  2MYS A;  3DTE A;  2QWW A;  3LQR A;  2MD5 A;  3KEQ A;  4F52 A;  1HF0 A;  2K3F A;  3S93 A;  5GAH J;  1K83 J;  2WAQ N;  3IKV A;  5KVR A;  3KE2 A;  2EB7 A;  5A2Q Z;  4MTD A;  2ZME C;  4E7H A;  4CSW A;  2RAE A;  3S2D J;  1ULY A;  2OV7 A;  3HBL A;  3U2R A;  3GUD A;  3S1N J;  2BHY A;  4NC6 A;  3PSI A;  3GX4 X;  1U5T A;  3O8H A;  3C18 A;  4CA0 A;  3FK6 A;  4M3B A;  2B9S A;  5E17 F;  3E6B A;  2VC0 A;  3DEU A;  2JA8 J;  4EVI A;  1TWH J;  2HGC A;  3NQO A;  3OIP A;  1FJL A;  4HV5 A;  5GAG J;  4FCY A;  4MQV A;  2LSO A;  4JOM A;  2HU9 A;  2LR8 A;  1BR4 A;  3TO6 A;  1FPQ A;  2Y0M A;  2DFE A;  2NS7 A;  1FYM A;  2E60 A;  1W4M A;  1W7P A;  3RIR A;  4BAC A;  4N9H A;  2COB A;  3FMS A;  3O6B B;  2L01 A;  4E7Z A;  3HM5 A;  3CMM A;  1SD4 A;  1QQI A;  1XC5 A;  4CIC A;  2JRT A;  3SDB A;  3CCM I;  5FLX Z;  4JBA A;  3FKJ A;  2E2H J;  2X1E A;  2W84 A;  4HW0 A;  4YII A;  4KFC A;  1JKR C;  4EAT A;  2O8K A;  2A5W A;  2R3S A;  2O3F A;  1D1A A;  2DTZ A;  3X2Q H;  1H89 C;  2E7X A;  3F6V A;  4LG0 B;  1KGS A;  2EFN A;  1HCR A;  2HPI A;  2X85 A;  1R6R A;  2IXS A;  1IUY A;  2VBX A;  4G7Z F;  2O9L A;  2BY3 A;  1RR7 A;  2B0L A;  5IT3 A;  2WAE A;  1OKR A;  4CXF A;  4UB8 C;  2XAS A;  1E2X A;  1ZG3 A;  2RV8 A;  2F5F A;  3ZN1 A;  1OCC H;  1HW2 A;  4LIT A;  4XLN F;  4YFK F;  5LGN A;  1LFU P;  3B6A A;  4L9T A;  1FP1 D;  2A6E F;  1UJ8 A;  2HZT A;  5CVU A;  1VQK I;  2G9W A;  4O5V A;  1MDM A;  2KJC A;  4P55 A;  3GW2 A;  1Z77 A;  2RRE A;  4IVN A;  2JTV A;  1YO5 C;  3OYC A;  4C2T A;  3F9K A;  5TJJ A;  4A3J J;  3ONQ A;  2FSW A;  3FXK A;  2NVU B;  3BLY A;  2R7X A;  1KA8 A;  1SVO A;  2QA4 I;  4MFE A;  1GXQ A;  3OSF A;  1FOX A;  2M30 A;  3ZQL A;  3M8J A;  4IKF A;  2VKD A;  3FM3 A;  3FXJ A;  5IOY A;  1UAA A;  5IYD J;  1SD5 A;  3CCJ I;  2STT A;  1FOW A;  2FQ3 A;  5DDG A;  5M5X J;  2RVC A;  4LLL A;  4AC0 A;  3PQK A;  2Z33 A;  1YE9 A;  3DCF A;  4WXC A;  1T8I A;  1XD7 A;  2E5Z A;  3IP4 B;  3OOP A;  4E70 A;  2EQR A;  4HAM A;  4M9S A;  2JSP A;  2JSC A;  2GOM A;  3PUF A;  4HEA 2;  4JP0 A;  4UNO A;  3BJO A;  1MBF A;  3M8F A;  4IRI A;  1ZR2 A;  5CVJ A;  1SAN A;  5FGM A;  2QBY A;  1HA8 A;  2X0L A;  1FLI A;  2A5Y B;  1MH4 A;  3D5R C;  4NC7 A;  5HOD A;  5D5W B;  1CF7 B;  3BY6 A;  2MH2 A;  4AVP A;  3ZN0 A;  4ZYH A;  1OPC A;  1BOB A;  1W1W E;  3OIO A;  3FXR A;  4C2U A;  3GTK J;  5F1R A;  3AG2 H;  1XMA A;  1Z91 A;  2O61 A;  3PNV A;  3MAJ A;  2Y2Z A;  1H0M A;  1XCV A;  3BG5 A;  1USS A;  1WJB A;  3FXM A;  3WU2 C;  1P4A A;  2V1N A;  3GXO A;  1DUX C;  4XN0 A;  3SQN A;  4KT6 A;  2PN6 A;  4XLC A;  3CJR B;  4DZP A;  5E1W A;  3WTX C;  2DPD A;  5FLV A;  1WHU A;  1TNS A;  4XNF A;  2R5Z A;  2DDB A;  1PUF B;  3DBL B;  3PFY A;  4A0Y A;  1K78 B;  5D6F A;  3RYP A;  3Q9S A;  4KMU X;  1HC8 A;  5F6F A;  3ECH A;  2Q2E A;  2R7O A;  2DT6 A;  2X6Y A;  2CUE A;  2FA5 A;  3ABU A;  5K5R A;  1TWG J;  3NWT A;  2ZKZ A;  2M8G X;  1SD7 A;  2X6X A;  4ESJ A;  1OCT C;  1X3Z B;  3P7N A;  2DMQ A;  2EIN H;  4XRF A;  2ZXI A;  2PJP A;  3BOQ A;  2AO9 A;  4DIQ A;  5ERI A;  5K7H A;  1OYW A;  4BJT A;  2F5V A;  2XRL A;  4C30 A;  4HF0 A;  2CUJ A;  2L2O A;  3CC7 I;  1YLF A;  3KLO A;  1E3H A;  2I8D A;  3HKZ N;  3LA7 A;  3KET A;  4MIM A;  3H0D A;  1ITY A;  3A01 B;  2DN0 A;  5AIQ A;  1Y0U A;  2F4I A;  2FD5 A;  3V42 A;  1XGN A;  4CCO A;  3EUA A;  3D0S A;  5FKL A;  4MO7 A;  3BZK A;  2XF7 A;  3ELK A;  2YX7 A;  2CW0 F;  1IRG A;  5LRR A;  3VFZ A;  5HDK A;  1KYW A;  4FIS A;  4E7J A;  4L5J A;  2IS1 A;  4IOC F;  1ZGA A;  1FYL A;  3CLO A;  3KP4 A;  3M9A A;  5E3N A;  4BXX J;  4RAF A;  3HOU J;  1WI3 A;  2BE5 F;  1BI2 A;  2XUB A;  2W00 A;  2X4H A;  1CQT A;  3BTL A;  3VPR A;  1KU7 A;  2ISY A;  3GFL A;  3DBR B;  4Y4R A;  5E8I A;  2VUM J;  3OYA A;  3OYL A;  3ZMU A;  3J81 K;  1MMG A;  2O8X A;  2JJ7 A;  3H3U A;  5HDG A;  2TDX A;  3A0B C;  2K5C A;  5IY5 H;  1OR7 A;  1WJ5 A;  3HSF A;  2NOJ B;  5DM6 F;  1Z6T A;  5ILU A;  4LIV A;  5JR3 A;  1XB4 A;  4H4K C;  1PP7 U;  5FRM A;  1W5S A;  3FWE A;  4U87 A;  3H3V K;  5BPD A;  2NYX A;  1UST A;  2UXX A;  4XKC A;  3HPG A;  3WGH A;  1HKT A;  1NTC A;  4XR6 A;  1QHH D;  4RLQ A;  2K9M A;  2VC1 A;  4M3D A;  1R5H A;  2L9N A;  2QEN A;  4A12 A;  1GV5 A;  4B8X A;  3K4L A;  5EYR A;  1JXS A;  4IPA A;  5FKN A;  1HDP A;  2WB1 N;  3FIS A;  2VOP A;  1UHW A;  2A6T A;  2HTJ A;  2H94 A;  5ILV A;  5CJ9 A;  2ME0 A;  2FBI A;  3LSM A;  1G3S A;  2BVM A;  3M07 A;  4EJU A;  2E7W A;  4ON0 A;  3I4N J;  2F6C A;  1LVA A;  1E17 A;  2LKS A;  5HS7 A;  2GWR A;  3JRA A;  4HG2 A;  2WA0 A;  2HFH A;  4D7N A;  1LKX A;  1LQ1 A;  5GPA A;  2COM A;  2EIJ H;  1REP C;  3BDD A;  3QAH A;  4UVB A;  3ZMS A;  3DQV C;  4MHG A;  5KK1 A;  3WTZ A;  5IOZ A;  3F22 A;  2YX4 A;  4QSH A;  1SC7 A;  2HWV A;  4R79 A;  2IS6 A;  3DU5 A;  2OQG A;  3DTK A;  4HF1 A;  2RNG A;  3KFW X;  2MLG A;  2VBW A;  3SEZ A;  4EJO A;  2WY7 Q;  3EUH C;  1IUF A;  1IN8 A;  3H35 A;  5E79 C;  4P9U A;  1U5T B;  3SXY A;  4BNC A;  1TQP A;  4UUS A;  1Z7U A;  3WTW C;  2MBF A;  3K4K A;  4AYB A;  4ANJ A;  1JTY A;  3LWF A;  3L2R A;  3CDL A;  3Q9V A;  1K79 A;  3DLA A;  1OLT A;  2DA5 A;  5ICG A;  3OS2 A;  1DU6 A;  4BHB A;  3KYL A;  3G3Z A;  4OIN F;  2QVO A;  2QSH X;  3RQI A;  1W0T A;  4JYK A;  2ID6 A;  2HR3 A;  1FSE A;  4F3Q A;  1W7P B;  4L9N A;  2CRG A;  2ZNZ A;  2ZFW A;  4D5C A;  3CLQ A;  2F5D A;  3LMM A;  4QPQ A;  3PNT A;  4O6J A;  2J5O A;  3M1E A;  1E3O C;  4BJ5 C;  2BYV E;  2EK5 A;  4UUV A;  2M87 A;  1ZG1 A;  3K70 C;  1XGM A;  1AHD P;  2DA6 A;  3BWG A;  2BVL A;  3QP6 A;  3IHU A;  4MNU A;  5ICE A;  2Z9O A;  1FEX A;  2ZO4 A;  3JRC A;  1JT0 A;  1WJC A;  5LGT A;  2DTR A;  2DPU A;  4I0A A;  2V26 A;  3I64 A;  5TIS C;  2L9R A;  1GXP A;  1GV2 A;  3I53 A;  3VYT B;  3C3W A;  4OAY A;  1I50 J;  2O03 A;  4GRI A;  3KPH A;  1IN5 A;  3N05 A;  3ZR8 X;  4L18 B;  3PM1 A;  5LHH A;  2RDP A;  1S9H A;  2V6C A;  3ZMD A;  1F1Z A;  2Z3Y A;  3C2G A;  4YFN F;  4X1E A;  1JT6 A;  4PJ0 C;  1BJZ A;  1LEA A;  1ODD A;  1B9M A;  1FOY A;  2JVH A;  4NUB A;  1MDM B;  4Y33 A;  2Q8K A;  4QTR A;  2XAJ A;  4BAY A;  1QVT A;  4FHT A;  2E71 A;  3FBI B;  2BHZ A;  2GXG A;  5KNL A;  3Q0W A;  2ME6 A;  3CJT B;  1XTA A;  3K0L A;  2BBY A;  1W0U A;  1FBQ A;  1YJN I;  5ICC A;  3OYG A;  2P5V A;  4RMN A;  4D1Q A;  2EPF A;  3BR5 A;  2A68 F;  3JRE A;  3GTL J;  1BC8 C;  3GWZ A;  1Z6R A;  4XBF A;  2QLZ A;  4IJA A;  5D5X B;  2XV4 S;  3GVA A;  2CFO A;  4UXN A;  2EWN A;  2Z16 A;  3DKW A;  1Q1V A;  5FO5 A;  4G6D A;  5B3S H;  1ON2 A;  3QPS A;  5FRN A;  2A3S A;  3GYH X;  2KRC A;  3FDY A;  5M3M J;  5LHI A;  5EDN A;  4IHT A;  2BXZ A;  3H0G J;  2VQL A;  2AHQ A;  4LK1 F;  1MBG A;  4FX0 A;  3R60 A;  1LPQ A;  2Y69 H;  2ELK A;  3CCR I;  3GTJ J;  5H2F C;  2QBY B;  4E7L A;  4E7K A;  2CGP A;  5IT9 K;  2BGC A;  3HSE A;  1XSX A;  2BZT A;  2E36 A;  2OUM A;  1JUM A;  5HS9 A;  1MBH A;  3F8C A;  1HW1 A;  1VQ6 I;  4XOP A;  4KIF A;  3BG6 A;  2LK2 A;  4RGU A;  1S72 I;  1WVR A;  4BYY A;  4ITV A;  4LFU A;  5F0C A;  1R23 A;  3F3X A;  4EJV A;  4YEL A;  1SFK A;  2WC2 A;  2L9S A;  3K2A A;  2FE3 A;  2VJJ A;  3F72 A;  5L3C A;  4OIP F;  4RB3 C;  4EJT A;  2G7H A;  2I10 A;  2YU9 J;  4BU2 A;  1LNW A;  5DTD A;  2R5Z B;  4BQA A;  1Z21 A;  2KMU A;  2M0C A;  4BE2 A;  3FXO A;  3JSP A;  3ULQ B;  2E2I J;  1NHA A;  1RC9 A;  2DQR A;  2JUG A;  3ZQF A;  4HNU A;  2Q2E B;  2IA2 A;  1IN6 A;  1X2N A;  3C7J A;  1WKM A;  2L02 A;  1G8X A;  2IGO A;  4Q48 A;  3FF5 A;  4XMY A;  4PCQ A;  4D0P A;  1HSJ A;  5H20 A;  1LDK B;  1T98 A;  2L4A A;  3U21 A;  5D6E A;  4TV7 A;  2K9S A;  2JA7 J;  3A1Y A;  4W1U A;  1ACI A;  3CP2 A;  5DD8 A;  2XAG A;  4D5F A;  3FHZ A;  1I6X A;  2H27 A;  3VDX A;  3HOS A;  5EEG A;  2O7O A;  3JAM K;  5HS8 A;  2KDZ A;  2IJL A;  2GBY A;  5E20 A;  1MMA A;  2DMP A;  3CO7 C;  1ZQ3 P;  2VJI A;  1Y8R B;  5E3L A;  2IGK A;  3OMY A;  4EEF G;  2R0Q C;  1X1P A;  2XGC A;  1UG2 A;  1RET A;  3AKZ A;  3QPL A;  1WQ2 A;  2ISZ A;  1TT5 B;  1IN4 A;  3NAU A;  4GYI A;  4Y3O A;  2HOS A;  4KIS A;  4OWR B;  1S5L C;  3MQ0 A;  1BA5 A;  3T0Y A;  2PEX A;  4DJA A;  3U9G A;  4RA2 A;  2XSD C;  2H6B A;  3CCU I;  2GM4 A;  4JX5 A;  4WK8 F;  3BR1 A;  2PJR A;  2HKO A;  1HOM A;  4DYQ A;  2X48 A;  5CLS A;  2L9V A;  1MKM A;  2W82 A;  2FBH A;  3CUQ A;  2CMP A;  3ZPL A;  2VLA A;  1JHH A;  1MW7 A;  2VKV A;  2EBI A;  1BI3 A;  4I6Z A;  1ZRF A;  2V9K A;  4CYC A;  4N0B A;  2GZW A;  1RES A;  4RAG A;  4LLN A;  4EM0 B;  1J2X A;  4H0E A;  3L2Q A;  5DUK A;  4U7D A;  1FBS A;  3ZMZ A;  3RKW A;  3ERE D;  3RYR A;  1IW7 F;  1LDJ A;  2KZG A;  3MKL A;  3T1B A;  4FAS D;  2YUS A;  3DEE A;  1ZRE A;  3U1D A;  3PSF A;  3Q0V A;  4FQG A;  2VKH A;  3S2W A;  3CME I;  3MVP A;  4C9Y A;  1APL C;  1N77 A;  2CG4 A;  2L54 A;  3JRH A;  4A3F J;  5DEQ A;  3RKX A;  3CMA I;  3AG4 H;  3N4M A;  3HHH A;  1CGP A;  1X4P A;  2WY8 Q;  1BIA A;  3MKY B;  4LMY A;  4RB1 A;  1BI0 A;  1GDT A;  4ZYA A;  2Z2S B;  4IXA A;  1DDN A;  1HXD A;  1XCB A;  1IZ1 A;  1T95 A;  1UFM A;  2O0Y A;  4NNJ A;  1I3Q J;  1PUE E;  2A05 A;  3HJE A;  2VN2 A;  2MC3 A;  3IRQ A;  4ZZD A;  4B3X A;  3G73 A;  2KDO A;  1T38 A;  3AL0 C;  1QVU A;  3R0J A;  3A03 A;  4I09 A;  1B8I A;  1SFX A;  1XS9 A;  1QNT A;  2QYO A;  5CYV A;  2FXA A;  3LFK A;  1NK3 P;  1R9T J;  2XRN A;  4PK4 A;  2KL4 A;  4BEH B;  3LAJ A;  2QCO A;  3J7A O;  4UUS B;  1TBX A;  2IVM A;  2L5Q A;  2Y30 A;  4IOA F;  3SDG A;  4MFD A;  3CF5 F;  2E1O A;  3F8N A;  3SYT A;  2AS5 F;  1ZR4 A;  2K9Q A;  2H1K A;  2HDC A;  5J47 A;  4EJW A;  2K02 A;  2OCE A;  3W2W A;  1OYI A;  1WJD A;  4NQW A;  4MLO A;  3RPU D;  3PIP F;  4XL9 A;  4B47 A;  1XGO A;  2DAO A;  4II3 A;  5IYC J;  2QEX I;  4L0Z B;  4AIJ A;  4A3M J;  2CW8 A;  3K6G A;  2VPL A;  1BJA A;  2GAU A;  1ONV A;  2DFH A;  3DFG A;  2OC6 A;  2CSO A;  2L7M P;  2ZME A;  3QP5 A;  4ABZ A;  4Y13 A;  2MD0 A;  1WWX A;  2IBD A;  4I98 B;  1K4S A;  3GTO J;  3VWB A;  2DOA A;  2A6H F;  3LQQ A;  3TP3 A;  4XLA A;  5L3D A;  3RCO A;  3TO7 A;  4A5N A;  1BW6 A;  1WCM J;  4OIO F;  1ZGW A;  2NOG A;  2CYY A;  2CQN A;  4F92 B;  4ENM A;  2CQ7 A;  2VKE A;  2PX9 A;  2VE9 A;  4PFO A;  1LFP A;  4A3I J;  4HST A;  1RRJ A;  3I71 A;  1EJ9 A;  3S17 J;  4GYG A;  2O6G E;  3L2V A;  3QRF F;  1J0R A;  2WV0 A;  2HYG D;  4M6Y A;  2NXN B;  4ETS A;  2PMZ A;  1OQY A;  2C6Y A;  2QKL B;  4DGW B;  1R5G A;  3KP3 A;  4F93 B;  1I39 A;  2XPV A;  3CDH A;  5HLI A;  3H92 A;  1YS6 A;  4XM3 A;  3Q3S A;  4AU7 A;  2X6O A;  3V8J A;  2LRD A;  2ZSI B;  1W36 D;  4Y52 J;  2GIZ A;  4KIB A;  1QGP A;  4NDL A;  5E8G A;  1RUO A;  3JR9 A;  3OR2 C;  4B3A A;  1GUU A;  3I0T A;  2LFB A;  4IEJ A;  4PSW A;  3EET A;  3LAP A;  3GBG A;  5L3G A;  3DU6 A;  4C3H J;  1IRF A;  1TW3 A;  3IC7 A;  3WHB A;  5H6R A;  4IRH A;  2K27 A;  4BXF A;  5K7Z A;  2Y9Y A;  3HOW J;  3I4M J;  4Z6Y A;  1O4X A;  3CCQ I;  3QOP A;  2W7N A;  3IKT A;  2BY2 A;  2EFO A;  2KPM A;  1XX5 A;  1BI1 A;  1J7K A;  2WAD A;  3BZC A;  3MEX A;  3ML6 A;  3PFI A;  2D45 A;  5IP9 J;  3HDD A;  1S7O A;  3BC8 A;  1QHG A;  3K7A J;  2DXI A;  1UEL B;  1S8N A;  5A2Q K;  1ZN2 A;  3RDI A;  1ZKG A;  3KEO A;  1O3S A;  1V55 H;  1YW7 A;  4ESB A;  2K9N A;  1V5F A;  1KU2 A;  2M7A A;  2X51 A;  2ZJ2 A;  3BTI A;  1BIB A;  3A2K A;  1U6G A;  4BJ6 C;  4G6Q A;  3MMY B;  1S29 A;  2LKP A;  4RB2 C;  1HW5 A;  3S8P A;  4DBR A;  1R7J A;  1RUN A;  3GTP J;  3CCY A;  1JJ8 C;  3E6M A;  1A5J A;  4V19 K;  1ZGJ A;  4UVC A;  4JQF A;  2H8R A;  2HQA A;  5F1J A;  1FX7 A;  3GEZ A;  3NEU A;  1JTX A;  1KZH A;  2PI0 A;  1OFC X;  1R22 A;  2UZK A;  4ZYE A;  3OS0 A;  3EYI A;  1UB9 A;  2BEO A;  3GFI A;  2XIG A;  2YR2 A;  4U0Y A;  4A3G J;  3RZO J;  1LE8 B;  3EPZ A;  3RJP A;  3GTM J;  3OYE A;  4XID A;  4RLF A;  3AAF A;  2NAZ A;  2K85 A;  2XSJ C;  2WBM A;  3HUG A;  5FLX K;  3BG3 A;  3W6J B;  1X2M A;  2QSF X;  4V2F A;  4Q4Z F;  3KIO A;  1PJR A;  2UV1 A;  3WTV C;  2KLO A;  1AKH A;  4KA4 A;  2V1D A;  4C2M J;  1SFU A;  3WG9 A;  1IO2 A;  3CQZ J;  3IAM 2;  4KN7 X;  2GIV A;  2XPW A;  2Y0S N;  3K1M A;  1P2F A;  4CO8 A;  4A0X A;  1IDY A;  3CZ6 A;  3F0C A;  2DMT A;  2LF7 A;  2OQR A;  3QU3 A;  1G3T A;  1MZB A;  2ECB A;  4A69 C;  4BGD A;  1KQ9 A;  5E3O A;  2JWT A;  2PJR B;  4ENK A;  5M5W J;  3A02 A;  4CCL A;  3JW4 A;  4BKX A;  3M3Y J;  4Q47 A;  4QLC U;  1I3A A;  3CUQ B;  3ESW B;  4LK0 F;  3JSO A;  1I27 A;  1OCZ H;  4XLH A;  1VQO I;  2IS2 A;  4O3M A;  1MBJ A;  3OYN A;  2V6E A;  4CYC B;  4XRS A;  3BTC A;  3O3K A;  2EV6 A;  3BR2 A;  4D7M A;  3TL4 X;  1GT0 C;  2ZSH B;  1A35 A;  3RQ4 A;  3DV8 A;  5FKK A;  2EZL A;  2V9V A;  4A3E J;  2V7F A;  1RKW A;  1FZP B;  2NVQ J;  1P4W A;  2VBY A;  1FIP A;  3P9I A;  2KRF A;  4OIR F;  3VSL A;  2VQH A;  3VEP A;  4RDU A;  3MZ8 A;  1RNL A;  3VYS B;  2F2E A;  2HVQ A;  2IS4 A;  2K4B A;  5J40 A;  3RTR A;  4U0V A;  2R7S A;  3O8G A;  1ZG5 A;  2A07 F;  2P7V B;  3IUO A;  3S32 A;  1U0J A;  2XDV A;  4ENJ A;  1W36 C;  2F4M B;  1R1U A;  1ETX A;  2ZNY A;  5H6Q A;  5LGU A;  4HBL A;  4BDZ A;  1T08 B;  3TW6 A;  2JVG A;  1QO0 D;  3TDU C;  2HVS A;  2IT0 A;  3BPX A;  3L2U A;  2DLL A;  4I02 A;  3V8K A;  2LG4 A;  3COA C;  3TOB A;  1EH7 A;  2RNJ A;  3IH4 A;  4U0W A;  4EV0 A;  2CV1 A;  4AIH A;  1P7J A;  4P9F A;  1B8I B;  2L7K A;  5E1X A;  5BQT A;  3OS1 A;  4M72 A;  4Y7N J;  4IRG A;  5F27 A;  1SEU A;  2DW4 A;  1SD6 A;  1TWF J;  4IX7 A;  1XSD A;  1FNN A;  3CP8 A;  2YPR A;  3B02 A;  2QSG X;  2FBK A;  5EG0 A;  4YRV A;  2KHM A;  2WAQ A;  4P1W A;  2XAH A;  4FTH A;  1I1G A;  5IPA A;  1AOY A;  2V79 A;  3JRI A;  1DP7 P;  2M4G A;  5LHG A;  3S14 J;  3EDP A;  3WE3 A;  1YHQ I;  2EIL H;  2E1M C;  4I99 C;  1YJW I;  4I7H A;  4L5I A;  3LSG A;  3G71 I;  3CF2 A;  3I5U A;  1ETQ A;  3MZY A;  4NQW B;  2XAF A;  4GCV A;  1MMN A;  5CKT A;  2CU7 A;  1IAW A;  4XN3 A;  2XVC A;  1D1C A;  3LSJ A;  4YEJ A;  3DKX A;  2KFD A;  1W5C C;  1S7A A;  3OSG A;  2RC4 A;  3GCM A;  1ZRC A;  3RKY A;  2JPC A;  2ZME B;  2O5R A;  3ROU A;  3I58 A;  4KIG A;  5FKM A;  1DPU A;  4YIR X;  2D1H A;  4XSX F;  1MNE A;  3ZQ7 A;  3EUH A;  3CJN A;  4I01 A;  4KIC A;  2HQ5 A;  2VON A;  2NNY A;  1X4O A;  3UR3 C;  1D1B A;  2DI3 A;  4PFP A;  1ZAR A;  4QWQ A;  2Y75 A;  4XKV A;  5L3F A;  1IRX A;  1MJB A;  4EQQ A;  2CV0 A;  1SVM A;  2XAQ A;  3DPL C;  2R93 J;  2YU3 A;  3JTH A;  1G6N A;  3D1N I;  1RKT A;  4HZF A;  2HDD A;  3E0J B;  3TKY A;  3K4B A;  2DT7 B;  2JA2 A;  3KP5 A;  3UKG A;  1KYZ A;  1D5Y A;  1LDD A;  3SZG A;  6PAX A;  3CC4 I;  2RKH A;  2HQR A;  4BE1 A;  2ESH A;  2M45 A;  4AD9 A;  3CMY A;  4IO9 F;  2LF8 A;  1JUS A;  4UHT A;  2VPR A;  2DU9 A;  1KU3 A;  4E7S A;  3HTU A;  3P5J A;  3GZ6 A;  2TRT A;  1L3L A;  3KZZ A;  2IGN A;  4NC8 A;  2D1V A;  4ZYG A;  1S6L A;  4HDV A;  5HLG A;  1HKQ A;  1XSV A;  3OYH A;  3K69 A;  2LRE A;  1ETO A;  2QUF A;  4G7H F;  1MD0 A;  4BH9 A;  1R1V A;  2P6S A;  2DO7 A;  1NH3 A;  4S04 A;  1M1E B;  3BRO A;  3E7L A;  1YW8 A;  3J80 Z;  2R92 J;  1FIA A;  4LG3 A;  1BOA A;  2VXZ A;  3BR3 A;  2ZB9 A;  3ZQC A;  2FX0 A;  4XQF A;  3JRF A;  5L3E A;  1J5Y A;  1DGW Y;  4HX7 A;  1LVK A;  5F08 A;  1VQ8 I;  4FE7 A;  4IQ4 A;  2I5U A;  4G7O F;  2FOW A;  2M1B A;  3HEF A;  1U8B A;  1I1S A;  5F0H A;  3WOD F;  4OU0 A;  3IH3 A;  4KUM A;  4IZZ A;  5FJ8 J;  2KIU A;  3PQJ A;  1WPK A;  2Z5U A;  1U78 A;  1O7F A;  5BPI A;  2R7V A;  3JTG A;  1G3Y A;  1SVL A;  3IAS 2;  3WTT C;  4I76 A;  2R7W A;  2EH3 A;  2XKP A;  3UNG C;  3DEW A;  1EV7 A;  3BCB A;  5M5Y J;  3E1S A;  5K5O A;  2H6C A;  4B4C A;  4F7Z A;  2JT1 A;  3IL2 A;  2OCC H;  1OCO H;  3ABL H;  2M5W A;  4PUS A;  5IP6 A;  1E3P A;  3ZRG A;  1JKO C;  3HSR A;  1NG7 A;  2MC4 A;  1VQ5 I;  2CQK A;  4L9J A;  2OF7 A;  1SAU A;  2ADU A;  4WXD A;  1TNT A;  3TP0 A;  4DOZ A;  3LSH A;  5J6X A;  2BV6 A;  4ZJZ A;  4FX4 A;  2PMZ N;  2MSY A;  4P96 A;  4LG0 A;  2WAF A;  3WTS C;  1D0Z A;  3RKQ A;  1XGS A;  1R00 A;  4KT5 C;  4PJM A;  5KAI C;  3CCS I;  4RM2 A;  5EGO A;  5J1R A;  1Z9C A;  3LSP A;  3VYU B;  1I5Z A;  2DJI A;  5CQG A;  3VSK A;  5DV5 A;  4LD5 A;  3B6C A;  5D8L B;  4XON A;  1AKH B;  1YW9 A;  3G1M A;  4ZDL A;  2HDW A;  4Y15 A;  3WGI A;  1R58 A;  1WFX A;  3PL8 A;  1TL8 A;  1WH7 A;  4G8X A;  5JHF A;  1G2H A;  2MLK A;  3MKW B;  1K6Y A;  2FMY A;  2P0W A;  3WGG A;  4A0Z A;  1PDN C;  2HPM A;  5BNG A;  3QU6 A;  2XGX A;  3K9T A;  2A69 F;  3S3N A;  3E6C C;  2Y9Z A;  2GXA A;  5C3E J;  2CQQ A;  3HKZ A;  5JVT A;  4BBR J;  1Y8Q B;  5CVV A;  3OYJ A;  4BUP A;  4UB6 C;  4AVZ A;  4EGY A;  3ABK H;  2LD5 A;  4M3G A;  1LB2 A;  2XAU A;  3L7W A;  1YYV A;  1YI2 I;  3ASO H;  4RB0 A;  5GAE J;  2EA4 A;  2HOE A;  2HZD A;  2OA4 A;  5DCF A;  4E6K G;  3CCV I;  2ZCW A;  1RR8 C;  3JRG A;  4ZTF A;  3A4C A;  3F8M A;  1U8R A;  2FRH A;  2XGD A;  4CGZ A;  3ABM H;  9ANT A;  1IC8 A;  3H5R A;  1J09 A;  2EFQ A;  1D8K A;  3C1D A;  1VND A;  2AXT C;  4XLF A;  4ASN A;  4GDF A;  3E97 A;  4RBO A;  2NNN A;  4BXU A;  2QKM B;  4C3I J;  1KQ0 A;  5LEJ A;  1XPX A;  5FFZ A;  1R5I D;  4DZJ A;  1U2W A;  2RQP A;  2MA3 A;  3I4P A;  5FB2 A;  2NVY J;  3HGY A;  1YIT I;  4BBS J;  2V4J C;  1SFE A;  2L7F P;  2CWE A;  1W7P D;  3DLL F;  4BHP A;  3KEY A;  2KKO A;  5TRD A;  2OZ6 A;  4CCJ A;  3ZOB A;  4OIQ F;  4K2E A;  4J01 A;  3K4M A;  1TC3 C;  5B1A H;  4C3J J;  4XLE A;  1K78 A;  2KIM A;  3OYF A;  3S3O A;  3L00 A;  3H5N A;  1HQC A;  3DBH B;  4HSR A;  3WU1 B;  1C0W A;  1MH3 A;  3M8E A;  3E5Q A;  4G94 A;  1N78 A;  4A3K J;  4GFB A;  2OD5 A;  1ZLK A;  4BQQ A;  2LLK A;  4N4N B;  4RGX A;  3H9Q A;  3V7R A;  1UCR A;  1JE8 A;  4DYR A;  3LOC A;  5FD6 A;  3T8R A;  3HOX J;  1ZHF A;  2XHK A;  3TDZ C;  1UHM A;  3G6E I;  2ID3 A;  5B66 C;  1IXS B;  3RZD J;  3ERM A;  2LYC A;  1Y39 A;  2H1L A;  3HOV J;  2QQA A;  4LB6 B;  1H9T A;  3J7Y J;  4GXO A;  3HTS B;  3S1M J;  2DYS H;  3IV5 A;  2E1C A;  1A31 A;  2W25 A;  3AG1 H;  4LGW A;  1A6Q A;  4KJZ A;  1YX5 A;  1ENH A;  3RI4 A;  1VTN C;  1R4M B;  3MWM A;  1X1A A;  1D5V A;  2HXI A;  5IYB J;  2B63 J;  4KDP A;  2VJ4 A;  1OYY A;  5FFX A;  3SJM A;  1X19 A;  2N8G A;  1HLV A;  1G3W A;  1KQ8 A;  2CQX A;  1RIO H;  1Y1W J;  1PVE A;  1VZ0 A;  1JKQ C;  4N9I A;  3CDI A;  4R8H A;  2Q0O A;  4I2O A;  3DXJ F;  4G12 A;  2W85 A;  1AWC A;  5HLH A;  1VF9 A;  2KP6 A;  1H8A C;  3DKY A;  3K4J A;  4YG2 F;  1UHS A;  2JMW A;  2OJE D;  3FK7 A;  1ZLJ A;  2VT2 A;  4Z2Y A;  1JUP A;  2V9P A;  3D5L A;  1WRJ A;  3OWT A;  4R1H A;  2KJB A;  5ICF A;  2D5V A;  4M73 A;  5AIP A;  3MZH A;  1KON A;  4M6X A;  3PNY A;  2NVT J;  2L3D A;  2R7U A;  3G1L A;  3Q5F A;  3CTA A;  3HG9 A;  3QWL A;  5HOO A;  2ETH A;  2R5Y A;  4HQM A;  2CV2 A;  2M34 A;  1EH6 A;  3OYB A;  2OZU A;  2DJN A;  1NG6 A;  3DPT A;  3R0A A;  2JA6 J;  3S15 J;  2DT5 A;  3BR0 A;  3WTY C;  4HQE A;  4MTE A;  1TWA J;  2Z1D A;  2HYJ A;  4XKB A;  3IRR A;  2CO5 A;  1EA3 A;  5DD4 A;  4ZC3 A;  3OYK A;  1BR2 A;  3QOD A;  1ETV A;  3L9F A;  4A3D J;  2H8W A;  3I3L A;  1HBX G;  1R1T A;  3FXL A;  3KYD B;  2JQ7 A;  2V1X A;  2XF5 A;  4OMZ A;  3GTG J;  4HRI A;  2DYR H;  3KP6 A;  3TOA A;  2PG4 A;  3ZXS A;  4HPQ A;  1RI7 A;  1XMX A;  2F5E A;  1Y0N A;  3E5X A;  4PDK A;  1IV8 A;  1X58 A;  3HOZ J;  3OYM A;  3M1C A;  5KHD A;  3GZN B;  2HQN A;  4XLP F;  1ZYR F;  1U5T C;  2BY1 A;  2QF7 A;  2IRF G;  2GA1 A;  2P4W A;  3ZMT A;  1IG7 A;  1VQM I;  5KCM A;  2R7T A;  4GO1 A;  1IN7 A;  5J8C A;  2HTS A;  2CH0 A;  2VE8 A;  3R4K A;  1F4K A;  1Y1V J;  1DP3 A;  2ECC A;  1JKP C;  2L7Z A;  3FX3 A;  3OY9 A;  3ZQQ A;  1BC7 C;  1VI0 A;  3H5A A;  1FC3 A;  1VQ7 I;  2MGQ A;  1OIS A;  3VOE A;  3MD2 A;  2A61 A;  2FF4 A;  3ZMV A;  1O7L A;  2LTP A;  1HST A;  3IH2 A;  3VOD A;  4BL0 B;  4AYB N;  2M9H A;  2R4G A;  3HC7 A;  2F4O B;  2JPB A;  1O3T A;  2MAB A;  4CCM A;  5GAD J;  1TW2 A;  3ZGK A;  3NWS A;  3LL7 A;  1O3R A;  2IGM A;  3IWF A;  1O3Q A;  1JGG A;  1QU3 A;  2M7B A;  3OV8 A;  4RM3 A;  3S2H J;  2VT3 A;  2HNH A;  1UZC A;  3HRS A;  5CPR B;  2ZXW H;  2DMN A;  3S1Q J;  2LH9 A;  3KX2 A;  5D5V B;  1TTY A;  4CCK A;  1ORK A;  5EGO B;  1V4R A;  3F6O A;  1EKE A;  2G7U A;  5JHU A;  4ZTJ A;  4HNV A;  5AON A;  4S0H B;  3BT9 A;  1WJE A;  3GZ5 A;  3SHF A;  4B1R A;  5J1Y A;  2FU4 A;  4BHC A;  2QM3 A;  4PGG A;  2JA5 J;  1P7I A;  1T33 A;  3CJQ B;  2QQ8 A;  5DCM A;  1D0Y A;  3BZ6 A;  5CVI A;  2NS8 A;  4RAZ A;  4X6A J;  3EQL F;  3FBN B;  1STZ A;  2EZI A;  3FMQ A;  5TGT A;  2GA2 A;  4IHV A;  1QZY A;  1L0O C;  3HRT A;  3W6V A;  5K1Y A;  2JUC A;  1TZL A;  5D4S A;  4WCG A;  2VQC A;  4WX9 A;  3OL3 A;  1YG2 A;  4CYD A;  1Z7L A;  4M9X A;  2X1C A;  3H9J A;  1YQA A;  2YS9 A;  2ELH A;  3G2B A;  1PYV A;  1VQ9 I;  3CCL I;  2F48 A;  1YX3 A;  4QIW N;  5J3L A;  2QQ9 A;  2FUG 2;  1U3E M;  4Q5S F;  4CDG A;  4HNT A;  1DPR A;  4RGR A;  1X1C A;  2FQ4 A;  3ZQI A;  4BQO A;  1J9I A;  2IAI A;  2HS5 A;  4OOI A;  3FZV A;  4FT8 A;  2CW7 A;  2FNP A;  1K4T A;  4ZDO A;  1JI8 A;  2K86 A;  1POG A;  2PFB A;  5F0F A;  2MFZ A;  1R36 A;  4DW6 A;  3O2P E;  4BE0 A;  4XIC A;  5B5E C;  1FWZ A;  2DOF A;  2KIQ A;  1WGX A;  2YSR A;  1K61 A;  2OTJ I;  5C44 J;  3J81 Z;  3N97 A;  4D9J A;  1PP8 F;  4CCN A;  1F5T A;  4CUG A;  2DA4 A;  4L5E A;  1ETW A;  3BJA A;  3RPU A;  3V8L A;  4XSZ F;  1AA7 A;  1IV6 A;  2R7Q A;  5ED4 A;  1IF1 A;  2PBI A;  5DS9 A;  3BR6 A;  4G6T B;  1UMQ A;  1FBU A;  2VL8 A;  3BP8 A;  1QPI A;  2LKX A;  1S3J A;  3ECO A;  3FXU A;  4B43 A;  3I54 A;  3K70 D;  3ZQH A;  3JCU C;  4IHS A;  2R7F A;  2OTL I;  4RGS A;  4N4O B;  4F91 B;  1YRN A;  5LRS A;  2XRO A;  3FIW A;  2ZXJ A;  3H1C A;  1ETK A;  3QYF A;  5HLT A;  1VQ4 I;  5EZH A;  2LBF A;  3K1N A;  4G9Y A;  2DK5 A;  3Q0U A;  2OPT A;  3EYY A;  4V2G A;  4AWX B;  2DMU A;  4XRM A;  3HYI A;  1DQU A;  2DA7 A;  2XF6 A;  4PZJ A;  4HYE A;  1FTZ A;  3I59 A;  5J4V A;  5D5U B;  4E7I A;  5GTH C;  2LP0 A;  4HX8 A;  1B1B A;  2EJR A;  2VI6 A;  2BXY A;  3ZQG A;  5E3M A;  2CFX A;  3H9G A;  1B9N A;  3G4S I;  3ZCO A;  1OJL A;  1FT9 A;  2LOO A;  5JFR A;  4IHX A;  3BPV A;  1K6O A;  1GVD A;  5EEH A;  4UV8 A;  2HYF A;  3V7S A;  4JK1 X;  3QQA A;  2F5C A;  4PJN A;  4FET A;  3KZY A;  2BW3 A;  1EH8 A;  2GQQ A;  2BOL A;  1SMY F;  2ZBK A;  3HZJ A;  3GTQ J;  2VIX A;  3MN2 A;  1Q1H A;  4HLY A;  2HKX A;  2BY0 A;  4EMS A;  2EZK A;  3AL0 B;  3GLL A;  5J1U A;  1S7E A;  1QA6 A;  1MSF C;  3WG7 H;  3HXL A;  2EFW A;  4EM1 A;  4U88 A;  1MBE A;  3WHC A;  1W5T A;  2DQL A;  2KRH A;  1T0F C;  1QPM A;  1T0F A;  5K7F A;  1OR7 C;  3OOU A;  4WWC A;  3CUO A;  3DTI A;  2XGE A;  4J00 A;  2FML A;  3OIQ A;  4HF2 A;  2NS0 A;  5J4Y A;  1D3Y A;  2EIM H;  3JRD A;  1G59 A;  3K2Z A;  5EEA A;  1BBY A;  1TP4 A;  1ZK8 A;  4RAY A;  3T8T A;  4ZH4 F;  1QBJ A;  1VQP I;  3R61 A;  3JRB A;  1SFO J;  3HRU A;  1JGS A;  4XOT A;  4CZZ A;  3TO9 A;  3S1R J;  1F36 A;  5HNH A;  1X3W B;  4U7B A;  2ZJQ F;  2R5Y B;  1FMW A;  3HOY J;  4AID A;  3OYD A;  3BQY A;  4ZZL A;  2GLO A;  4XRS G;  3QPH A;  2VBZ A;  2LY1 A;  5L3B A;  3J7Z I;  3KZI C;  4IF4 A;  2P81 A;  4IHY A;  2CJJ A;  2KT0 A;  4CZC A;  2ESN A;  1ZTR A;  2EFP A;  1TQM A;  3E6D A;  3L2W A;  2W1O A;  1B4A A;  5HVQ C;  3P9C A;  4XKW A;  1N25 A;  2W57 A;  4B44 A;  1FY7 A;  5LD2 C;  1WZ2 A;  1GHC A;  2DDA A;  4AIK A;  1Z05 A;  4A3B J;  1MIJ A;  1LEB A;  5HNF A;  2B7E A;  1YS7 A;  3L1P A;  2V1U A;  1Z0X A;  4A5M A;  5FD5 A;  4M71 A;  3FXQ A;  5M3F J;  3OL4 A;  2P7C B;  2D2W A;  1K7A A;  2M4K A;  4MQ9 F;  4A93 J;  1B59 A;  4BEH A;  1X1B A;  1JJ6 C;  4GGG A;  1B72 A;  3I9V 2;  3R6S A;  3LSK A;  3QPT A;  5EZG A;  1BL0 A;  2GOX B;  1OCP A;  1G4D A;  3K4N A;  1MGT A;  4RS8 A;  1P92 A;  3DF8 A;  3V7C A;  4I0B A;  2XB5 A;  4BY1 J;  4NBQ A;  3P9K A;  2GXB A;  2WTE A;  1IXC A;  2Q1Z B;  5BS6 A;  1VFC A;  3PO2 J;  4IL6 C;  3NRV A;  3E5U A;  4ZDP A;  1V54 H;  5C4J J;  2K9L A;  3FHN A;  1MMS A;  2QGU A;  4KNY A;  3KYC B;  4DYC A;  3W3C A;  3H36 A;  1FTT A;  2M8E A;  5GTI C;  2CUZ A;  1Z3X A;  4KN4 X;  2E35 A;  4OAZ A;  2X9D A;  4UVA A;  4Y17 A;  2DA1 A;  3C2B A;  3T5X A;  5IT9 Z;  4QPO A;  2ZC2 A;  3ASN H;  2OAZ A;  1MSE C;  2XPU A;  4AM3 A;  1HKS A;  1Y6I A;  3HPH A;  1Y56 A;  3FMR A;  1ON1 A;  4YFX F;  4CHU A;  3VB2 A;  5FKO A;  3HOT A;  5DM7 F;  2OU2 A;  3F21 A;  1YJ9 I;  4OMY A;  4KMF A;  2JN6 A;  3KLN A;  5CVR A;  2LDU A;  5E18 F;  3D5S C;  3L09 A;  3HGG A;  3PUB A;  4LLG F;  3RSN A;  3V4G A;  2XB0 X;  1WH5 A;  2IEK A;  2QZ8 A;  1V5E A;  5K5Q A;  3LSR A;  2M3A A;  2IP2 A;  2PMH A;  1A36 A;  1TT0 A;  1VQL I;  4XK4 A;  4BY7 J;  4EM2 A;  1FP2 A;  1EF4 A;  1BN5 A;  4PJJ A;  4ESF A;  1VQN I;  5BOX A;  3SZP A;  2VB6 A;  2R7D A;  5DCM B;  2DCE A;  3QYB A;  1U9N A;  1FOK A;  2KQR A;  3FM5 A;  1T6S A;  2VAS A;  3LNQ A;  1N75 A;  1IGN A;  3A0H C;  2DFF A;  1FYK A;  2E2J J;  2K3P A;  3TGN A;  3OYI A;  4II2 A;  2ELJ A;  3G1O A;  2R7Z J;  4M74 A;  2ACJ A;  3ZP5 A;  1A6I A;  2RGV A;  2JK3 A;  5ILS A;  5FLM J;  3BCA A;  1R71 A;  2LY2 A;  2KIS A;  5KAF C;  4HOB A;  3MCZ A;  3JAM Z;  2UWM A;  3CO6 C;  2NVX J;  1XG1 A;  1FSH A;  3HB9 A;  3BG7 A;  3HUG B;  2STW A;  2Y0S A;  4E4H A;  2XKO A;  1P9Q C;  4A2U A;  1ZH5 A;  1XMK A;  1LJ9 A;  4M3F A;  1ETY A;  1SMT A;  4BQN A;  2G0E A;  2W24 A;  2RQQ A;  5D8K B;  4YIF A;  2OBP A;  3FKI J;  2HXO A;  3K1P A;  1T39 A;  1IDZ A;  3ABT A;  2X6W A;  4LJZ F;  3J80 K;  1XN7 A;  1A04 A;  4FE4 A;  1QRY A;  3LFU A;  4ZYD A;  3PJR A;  3DP7 A;  2ICW G;  5GP9 A;  4MEY F;  1R49 A;  1RZ4 A;  5F64 A;  1Z67 A;  5LLQ A;  2VXD A;  4J19 A;  5E1Z B;  4HA8 A;  2LNB A;  2JRM A;  1LUJ B;  2L4M A;  2DOE A;  1D0X A;  3WTU C;  2IW5 A;  3CCE I;  2P6T A;  1JHF A;  2P8T A;  3L2C A;  3QOE A;  4JX6 A;  4PSX A;  3VYR B;  3WU0 A;  5EF6 A;  1WSU A;  2VOO A;  1MBK A;  3BJ6 A;  2TCT A;  3HL2 A;  3LST A;  2M2E A;  3SEQ A;  2E19 A;  2AQF A;  2EV5 A;  1YIJ I;  3IWZ A;  3HHG A;  4UY8 I;  3W2A A;  3OR1 C;  3QYE A;  1T2K A;  4XOR A;  1H88 C;  1YRN B;  2XC7 A;  5GPC A;  4F55 A;  3SZT A;  4ENN A;  3DPU A;  3ISP A;  1I6H J;  4P5O A;  2DA3 A;  2E1N A;  4BS9 A;  3LA3 A;  5JLX A;  2X1D A;  2LBF B;  1H9G A;  2DOD A;  2KZV A;  1TQI A;  2IA0 A;  2M0M A;  3BQZ A;  4DQ2 A;  3PO3 J;  2EIK H;  1LE8 A;  5LBQ A;  1E0E A;  3MFK A;  1MND A;  1MJA A;  1AU7 A;  2P5K A;  3WE2 A;  4KIT B;  1CF7 A;  1KU9 A;  2HEO A;  2EV0 A;  3I59 B;  4HLX A;  1F43 A;  1Z3Y A;  3KP2 A;  2QQB A;  4KYW A;  3RPQ A;  5CQE A;  2DFI A;  4UUT A;  3KCC A;  1QZE A;  1GVJ A;  3DWL E;  1TLH B;  3GF2 A;  3AFH A;  3MKZ A;  2K4J A;  2CS3 A;  2W4S A;  2LC2 A;  5DUI A;  3U1K A;  3F23 A;  2DBB A;  4S05 A;  2IA1 A;  1PUF A;  2HOA A;  4A6D A;  3K10 A;  1IRZ A;  2UXN A;  2BW3 B;  2WB1 A;  2Y48 A;  5LEK A;  3F8B A;  3BG9 A;  4PGH A;  4DBQ A;  2VJ5 A;  1LFB A;  1X3U A;  4HV6 A;  4DNC A;  2K7L A;  5JVG F;  4LB5 A;  5EJC A;  2HVR A;  2KIF A;  1ZEL A;  4WF2 A;  3M7G A;  3TED A;  3HIF A;  2VQG A;  1O57 A;  3CUQ C;  1RPW A;  2IPQ X;  4JX4 A;  1MNM C;  4M9Z A;  2ZJR F;  3BTJ A;  1NK2 P;  4L0Y B;  3CC2 I;  5EG0 B;  3H3Z A;  1IJW C;  2MW8 A;  3W6K B;  3GLX A;  2VOD A;  1Z1D A;  5DYM A;  3A01 A;  1J75 A;  1B6A A;  4A3L J;  1X1D A;  5B1B H;  3AG3 H;  4A6E A;  3SFZ A;  5C4X J;  3GFJ A;  4B09 A;  1J59 A;  2AQE A;  4NHJ A;  1YIO A;  2E1M B;  2EZH A;  1OCR H;  3TMO A;  1QZZ A;  5FRO A;  3S3M A;  3EUK L;  1HDD C;  3GO5 A;  3NAR A;  3S16 J;  1BW5 A;  2HI3 A;  1D8J A;  4LIU A;  3TQN A;  4M3E A;  2W48 A;  3GME A;  1ERD A;  4HDU A;  1P6R A;  1TWC J;  3TBI A;  3M4O J;  1V3F A;  1SAX A;  5F04 A;  2Z99 A;  1BM9 A;  3I56 I;  4M6V A;  4BDY A;  1MJ9 A;  5BMZ A;  2WV1 A;  2FJ1 A;  4WXH A;  4PJL A;  2AXL A;  4NB5 A;  3F8F A;  2EA2 A;  4A3C J;  2J5P A;  3PIO F;  2R7R A;  4MEX F;  1YTY A;  2RN7 A;  2ZFU A;  2NRA C;  2FNA A;  1F9N A;  2FEZ A;  4UV9 A;  1FMV A;  2E5N A;  2FOK A;  4LOC A;  4MGR A;  1ZAO A;  1UG0 A;  2LY9 A;  3GFM A;  1WJF A;  2H09 A;  3CD6 I;  5JI6 A;  3LA2 A;  2DK8 A;  1XDU A;  4IHW A;  1DGR M;  1WI9 A;  3REO A;  3K4C A;  4L9V A;  1P4X A;  2HOT A;  2Y31 A;  1GLN A;  2LVS A;  3KP7 A;  2JZY A;  2MG4 A;  2K40 A;  2PMU A;  4AUX A;  1IXR C;  2PQ8 A;  3CES A;  3LSI A;  4HX4 A;  3TW7 A;  4B48 A;  2ZJP F;  3C2H A;  5JLW A;  2ZXH A;  1B72 B;  3SFI A;  1R4N B;  3B73 A;  2WWY A;  1V5G A;  1MMD A;  5IP7 J;  4X0G A; 
#chains in the Genus database with same CATH homology
 1ZRD A;  1XDS A;  3E3V A;  5HDN A;  2MH9 A;  5D4R A;  3HRM A;  2P5L C;  5J8F A;  1YFH A;  2PLY A;  4EGZ A;  1OMI A;  2QWW A;  3LQR A;  2MD5 A;  3KEQ A;  3IKV A;  5KVR A;  3KE2 A;  2EB7 A;  5A2Q Z;  4MTD A;  1ULY A;  3U2R A;  3GUD A;  3GX4 X;  1U5T A;  3C18 A;  5E17 F;  3E6B A;  2VC0 A;  3DEU A;  4EVI A;  3NQO A;  2HGC A;  4HV5 A;  4MQV A;  2LSO A;  3TO6 A;  1FPQ A;  2Y0M A;  1FYM A;  1W4M A;  1W7P A;  3RIR A;  4N9H A;  3FMS A;  3O6B B;  2L01 A;  1SD4 A;  1QQI A;  4CIC A;  2JRT A;  5FLX Z;  4JBA A;  4HW0 A;  2W84 A;  4YII A;  4KFC A;  2R3S A;  2O3F A;  2E7X A;  3F6V A;  4LG0 B;  1KGS A;  2EFN A;  1IUY A;  2VBX A;  4G7Z F;  2B0L A;  5IT3 A;  1OKR A;  4CXF A;  2XAS A;  1E2X A;  1ZG3 A;  2RV8 A;  2F5F A;  3ZN1 A;  1HW2 A;  4XLN F;  4YFK F;  5LGN A;  4L9T A;  1FP1 D;  2A6E F;  2HZT A;  5CVU A;  2G9W A;  4O5V A;  1MDM A;  2KJC A;  4P55 A;  3GW2 A;  4IVN A;  2JTV A;  1YO5 C;  5TJJ A;  2FSW A;  1KA8 A;  1GXQ A;  2M30 A;  3FM3 A;  1SD5 A;  2STT A;  2FQ3 A;  5DDG A;  2RVC A;  4LLL A;  3PQK A;  2Z33 A;  4WXC A;  1XD7 A;  3OOP A;  4E70 A;  4HAM A;  4M9S A;  2JSC A;  4UNO A;  3BJO A;  3M8F A;  4IRI A;  5CVJ A;  5FGM A;  2QBY A;  2X0L A;  1FLI A;  2A5Y B;  5D5W B;  1CF7 B;  3BY6 A;  2MH2 A;  4AVP A;  3ZN0 A;  4ZYH A;  1OPC A;  3FXR A;  5F1R A;  1XMA A;  1Z91 A;  2O61 A;  3MAJ A;  1H0M A;  1XCV A;  1USS A;  1P4A A;  3GXO A;  1DUX C;  3SQN A;  2PN6 A;  3WTX C;  5E1W A;  2DPD A;  1TNS A;  1K78 B;  4A0Y A;  5D6F A;  3RYP A;  3Q9S A;  4KMU X;  5F6F A;  3ECH A;  2Q2E A;  2FA5 A;  3ABU A;  5K5R A;  2ZKZ A;  1SD7 A;  4ESJ A;  3P7N A;  4XRF A;  2PJP A;  3BOQ A;  5ERI A;  1OYW A;  4HF0 A;  1YLF A;  3KLO A;  3LA7 A;  3KET A;  5AIQ A;  1Y0U A;  1XGN A;  3D0S A;  3ELK A;  2YX7 A;  2CW0 F;  1IRG A;  5LRR A;  3VFZ A;  5HDK A;  1KYW A;  4L5J A;  1ZGA A;  1FYL A;  3CLO A;  3KP4 A;  3M9A A;  2BE5 F;  1BI2 A;  2XUB A;  2X4H A;  1KU7 A;  2ISY A;  3GFL A;  5E8I A;  3ZMU A;  3J81 K;  2O8X A;  3H3U A;  5HDG A;  2TDX A;  1OR7 A;  3HSF A;  1Z6T A;  5ILU A;  5JR3 A;  1XB4 A;  1PP7 U;  1W5S A;  3FWE A;  5BPD A;  2NYX A;  1UST A;  2UXX A;  3WGH A;  1HKT A;  2VC1 A;  1R5H A;  2QEN A;  4A12 A;  4B8X A;  1JXS A;  4IPA A;  2VOP A;  1UHW A;  2HTJ A;  2H94 A;  5ILV A;  5CJ9 A;  2FBI A;  1G3S A;  4EJU A;  2E7W A;  4ON0 A;  1LVA A;  1E17 A;  5HS7 A;  2GWR A;  2HFH A;  1LQ1 A;  2COM A;  1REP C;  3BDD A;  3QAH A;  4UVB A;  3ZMS A;  3DQV C;  4MHG A;  5KK1 A;  3WTZ A;  3F22 A;  2YX4 A;  2HWV A;  4R79 A;  2OQG A;  4HF1 A;  3KFW X;  2MLG A;  2VBW A;  4EJO A;  1IN8 A;  4P9U A;  1U5T B;  3SXY A;  4BNC A;  1TQP A;  1Z7U A;  3WTW C;  2MBF A;  3LWF A;  3Q9V A;  1K79 A;  5ICG A;  4BHB A;  3G3Z A;  4OIN F;  2QVO A;  2HR3 A;  1FSE A;  1W7P B;  4L9N A;  2ZNZ A;  2ZFW A;  2F5D A;  4O6J A;  2J5O A;  3M1E A;  2BYV E;  2EK5 A;  4UUV A;  2M87 A;  1ZG1 A;  1XGM A;  3BWG A;  3QP6 A;  3IHU A;  4MNU A;  5ICE A;  2Z9O A;  2ZO4 A;  5LGT A;  2DTR A;  2DPU A;  4I0A A;  3I64 A;  1GXP A;  3I53 A;  3C3W A;  2O03 A;  1IN5 A;  4L18 B;  5LHH A;  2RDP A;  2V6C A;  3ZMD A;  1F1Z A;  2Z3Y A;  4YFN F;  1LEA A;  1ODD A;  1B9M A;  1MDM B;  2Q8K A;  2XAJ A;  4BAY A;  4FHT A;  2GXG A;  3K0L A;  2BBY A;  1FBQ A;  5ICC A;  2P5V A;  2A68 F;  1BC8 C;  3GWZ A;  1Z6R A;  4XBF A;  2QLZ A;  4IJA A;  5D5X B;  2XV4 S;  3GVA A;  4UXN A;  2EWN A;  3DKW A;  5FO5 A;  4G6D A;  1ON2 A;  2A3S A;  3GYH X;  5LHI A;  4IHT A;  4LK1 F;  4FX0 A;  3R60 A;  2QBY B;  2CGP A;  5IT9 K;  2BGC A;  3HSE A;  1XSX A;  5HS9 A;  3F8C A;  1HW1 A;  4KIF A;  4RGU A;  4BYY A;  4LFU A;  1R23 A;  3F3X A;  4EJV A;  2WC2 A;  2FE3 A;  3F72 A;  5L3C A;  4OIP F;  4RB3 C;  4EJT A;  2G7H A;  4BQA A;  1LNW A;  3JSP A;  3ULQ B;  1NHA A;  2DQR A;  2IA2 A;  1IN6 A;  3C7J A;  1WKM A;  2L02 A;  4Q48 A;  3FF5 A;  4PCQ A;  4D0P A;  1HSJ A;  5H20 A;  1LDK B;  1T98 A;  2L4A A;  5D6E A;  4TV7 A;  5DD8 A;  2XAG A;  3FHZ A;  1I6X A;  2H27 A;  3HOS A;  5EEG A;  3JAM K;  5HS8 A;  2IJL A;  5E20 A;  3CO7 C;  1WQ2 A;  2ISZ A;  1IN4 A;  4GYI A;  3MQ0 A;  3T0Y A;  2PEX A;  3U9G A;  2H6B A;  4WK8 F;  2HKO A;  5CLS A;  1MKM A;  2FBH A;  3CUQ A;  3ZPL A;  1JHH A;  1BI3 A;  1ZRF A;  4N0B A;  2GZW A;  4LLN A;  4EM0 B;  1J2X A;  4H0E A;  5DUK A;  4U7D A;  1FBS A;  3ZMZ A;  3RKW A;  3ERE D;  3RYR A;  1IW7 F;  1LDJ A;  3T1B A;  1ZRE A;  3U1D A;  3S2W A;  2CG4 A;  2L54 A;  5DEQ A;  3RKX A;  3N4M A;  3HHH A;  1CGP A;  1BIA A;  4LMY A;  4RB1 A;  1BI0 A;  4IXA A;  1DDN A;  1HXD A;  1XCB A;  1IZ1 A;  1UFM A;  2O0Y A;  1PUE E;  2VN2 A;  2MC3 A;  3IRQ A;  4ZZD A;  3G73 A;  1T38 A;  3R0J A;  4I09 A;  1SFX A;  1QNT A;  2QYO A;  5CYV A;  2FXA A;  3LFK A;  2XRN A;  3LAJ A;  3J7A O;  1TBX A;  2IVM A;  3F8N A;  2AS5 F;  2HDC A;  4EJW A;  2K02 A;  1OYI A;  4NQW A;  1XGO A;  2DAO A;  4L0Z B;  4AIJ A;  1BJA A;  2GAU A;  1ONV A;  3DFG A;  2CSO A;  2ZME A;  3QP5 A;  4Y13 A;  1WWX A;  4I98 B;  2A6H F;  3LQQ A;  5L3D A;  3TO7 A;  4A5N A;  4OIO F;  2CYY A;  4ENM A;  2VE9 A;  3I71 A;  4GYG A;  2O6G E;  3QRF F;  1J0R A;  2WV0 A;  2HYG D;  4M6Y A;  4ETS A;  2C6Y A;  1R5G A;  3KP3 A;  3CDH A;  5HLI A;  3H92 A;  1YS6 A;  3V8J A;  4KIB A;  1QGP A;  5E8G A;  1RUO A;  3I0T A;  3EET A;  3LAP A;  5L3G A;  1IRF A;  1TW3 A;  3IC7 A;  5H6R A;  4IRH A;  2K27 A;  3QOP A;  3IKT A;  2EFO A;  1BI1 A;  1J7K A;  3MEX A;  3ML6 A;  3PFI A;  2D45 A;  1S7O A;  1S8N A;  5A2Q K;  1ZN2 A;  3RDI A;  3KEO A;  1O3S A;  1YW7 A;  4ESB A;  1KU2 A;  2ZJ2 A;  1BIB A;  1U6G A;  4G6Q A;  1S29 A;  2LKP A;  4RB2 C;  1HW5 A;  1R7J A;  1RUN A;  1ZGJ A;  4UVC A;  4JQF A;  1FX7 A;  3GEZ A;  3NEU A;  2PI0 A;  1R22 A;  2UZK A;  4ZYE A;  3EYI A;  1UB9 A;  2BEO A;  3GFI A;  2XIG A;  2YR2 A;  4U0Y A;  3RJP A;  3AAF A;  2NAZ A;  3HUG A;  5FLX K;  3W6J B;  4Q4Z F;  3WTV C;  4KA4 A;  2V1D A;  1SFU A;  3WG9 A;  4KN7 X;  2GIV A;  3K1M A;  1P2F A;  4CO8 A;  4A0X A;  2LF7 A;  2OQR A;  3QU3 A;  1G3T A;  1MZB A;  1KQ9 A;  4ENK A;  3JW4 A;  4Q47 A;  4QLC U;  3CUQ B;  4LK0 F;  3JSO A;  1I27 A;  4O3M A;  3O3K A;  2EV6 A;  3DV8 A;  2V9V A;  1FZP B;  1P4W A;  2VBY A;  3P9I A;  2KRF A;  4OIR F;  3VEP A;  1RNL A;  2F2E A;  2K4B A;  3RTR A;  4U0V A;  1ZG5 A;  2A07 F;  2P7V B;  4ENJ A;  1R1U A;  2ZNY A;  5H6Q A;  5LGU A;  4HBL A;  1QO0 D;  3TDU C;  2IT0 A;  3BPX A;  2DLL A;  4I02 A;  3V8K A;  3COA C;  3TOB A;  1EH7 A;  2RNJ A;  4EV0 A;  4U0W A;  4AIH A;  4P9F A;  5E1X A;  5BQT A;  4M72 A;  4IRG A;  2DW4 A;  1SD6 A;  1XSD A;  1FNN A;  2YPR A;  3B02 A;  2FBK A;  2XAH A;  1I1G A;  1AOY A;  2V79 A;  1DP7 P;  5LHG A;  3EDP A;  3WE3 A;  4I7H A;  4L5I A;  3I5U A;  3MZY A;  2XAF A;  4GCV A;  1IAW A;  2XVC A;  1S7A A;  1ZRC A;  2RC4 A;  3RKY A;  2JPC A;  2ZME B;  3ROU A;  3I58 A;  4KIG A;  1DPU A;  4XSX F;  2D1H A;  3ZQ7 A;  3EUH A;  3CJN A;  4I01 A;  4KIC A;  2VON A;  2NNY A;  2DI3 A;  1ZAR A;  4QWQ A;  2Y75 A;  5L3F A;  1MJB A;  4EQQ A;  2XAQ A;  3DPL C;  2YU3 A;  3JTH A;  1G6N A;  4HZF A;  3TKY A;  3KP5 A;  1KYZ A;  1LDD A;  6PAX A;  2RKH A;  2HQR A;  2ESH A;  2M45 A;  4AD9 A;  2LF8 A;  4UHT A;  2DU9 A;  1KU3 A;  3HTU A;  3GZ6 A;  1L3L A;  3KZZ A;  2D1V A;  4ZYG A;  1S6L A;  4HDV A;  5HLG A;  1HKQ A;  1XSV A;  3K69 A;  2QUF A;  4G7H F;  1MD0 A;  4BH9 A;  1R1V A;  2P6S A;  2DO7 A;  4S04 A;  3BRO A;  3J80 Z;  1YW8 A;  1BOA A;  2VXZ A;  5L3E A;  1J5Y A;  4HX7 A;  4G7O F;  2M1B A;  1I1S A;  3WOD F;  4OU0 A;  4KUM A;  2KIU A;  3PQJ A;  2Z5U A;  1U78 A;  1O7F A;  5BPI A;  3JTG A;  1G3Y A;  3WTT C;  2XKP A;  1EV7 A;  5K5O A;  2H6C A;  4F7Z A;  2JT1 A;  3IL2 A;  2M5W A;  3HSR A;  2CQK A;  4L9J A;  2ADU A;  4WXD A;  1TNT A;  5J6X A;  2BV6 A;  4FX4 A;  4P96 A;  4LG0 A;  3WTS C;  1XGS A;  1R00 A;  4KT5 C;  1Z9C A;  1I5Z A;  5DV5 A;  4LD5 A;  5D8L B;  1YW9 A;  4Y15 A;  3WGI A;  1R58 A;  4G8X A;  2MLK A;  3WGG A;  2FMY A;  1PDN C;  4A0Z A;  3QU6 A;  2XGX A;  3K9T A;  2A69 F;  3E6C C;  5JVT A;  5CVV A;  4EGY A;  1LB2 A;  3L7W A;  1YYV A;  4RB0 A;  2EA4 A;  2HOE A;  2OA4 A;  5DCF A;  2ZCW A;  3F8M A;  1U8R A;  2FRH A;  4CGZ A;  2EFQ A;  1D8K A;  3C1D A;  4ASN A;  3E97 A;  2NNN A;  4BXU A;  1KQ0 A;  5LEJ A;  5FFZ A;  1U2W A;  2RQP A;  2MA3 A;  3I4P A;  5FB2 A;  1SFE A;  2CWE A;  1W7P D;  4BHP A;  2KKO A;  5TRD A;  2OZ6 A;  4OIQ F;  4K2E A;  1K78 A;  2KIM A;  3L00 A;  1HQC A;  1C0W A;  3WU1 B;  3M8E A;  4G94 A;  3E5Q A;  2OD5 A;  1ZLK A;  4RGX A;  3V7R A;  1UCR A;  1JE8 A;  5FD6 A;  3T8R A;  1ZHF A;  2XHK A;  3TDZ C;  1UHM A;  1IXS B;  2QQA A;  4LB6 B;  1H9T A;  4GXO A;  3HTS B;  2E1C A;  2W25 A;  4LGW A;  3RI4 A;  1VTN C;  3MWM A;  1D5V A;  4KDP A;  1OYY A;  5FFX A;  1G3W A;  1KQ8 A;  1RIO H;  4N9I A;  4R8H A;  2Q0O A;  4I2O A;  3DXJ F;  2W85 A;  1AWC A;  5HLH A;  4YG2 F;  1ZLJ A;  2VT2 A;  4Z2Y A;  3D5L A;  1WRJ A;  4R1H A;  2KJB A;  5ICF A;  4M73 A;  5AIP A;  3MZH A;  4M6X A;  2L3D A;  3Q5F A;  3CTA A;  5HOO A;  2ETH A;  4HQM A;  1EH6 A;  2OZU A;  3DPT A;  3R0A A;  2DT5 A;  3WTY C;  4HQE A;  4MTE A;  3IRR A;  2CO5 A;  5DD4 A;  3L9F A;  1HBX G;  1R1T A;  2V1X A;  4OMZ A;  3KP6 A;  3TOA A;  2PG4 A;  1RI7 A;  2F5E A;  3E5X A;  4PDK A;  2HQN A;  4XLP F;  1ZYR F;  1U5T C;  2IRF G;  2GA1 A;  2P4W A;  3ZMT A;  4GO1 A;  1IN7 A;  5J8C A;  2HTS A;  2VE8 A;  3R4K A;  1F4K A;  3FX3 A;  1BC7 C;  1FC3 A;  3VOE A;  2A61 A;  2FF4 A;  3ZMV A;  1O7L A;  1HST A;  3VOD A;  2JPB A;  1O3T A;  1TW2 A;  1O3R A;  3IWF A;  1O3Q A;  3OV8 A;  2VT3 A;  3HRS A;  5D5V B;  1TTY A;  1V4R A;  3F6O A;  2G7U A;  5JHU A;  5AON A;  3GZ5 A;  3SHF A;  2FU4 A;  4BHC A;  2QM3 A;  4PGG A;  5DCM A;  3BZ6 A;  5CVI A;  4RAZ A;  3EQL F;  1STZ A;  3FMQ A;  2GA2 A;  1QZY A;  1L0O C;  3HRT A;  5K1Y A;  5D4S A;  4WCG A;  4WX9 A;  4CYD A;  1YG2 A;  4M9X A;  1YQA A;  2ELH A;  2QQ9 A;  4Q5S F;  1U3E M;  4CDG A;  1DPR A;  4RGR A;  1J9I A;  4OOI A;  2HS5 A;  3FZV A;  4FT8 A;  2FNP A;  2K86 A;  2PFB A;  1R36 A;  3O2P E;  1FWZ A;  2YSR A;  3J81 Z;  3N97 A;  1PP8 F;  1F5T A;  3BJA A;  3RPU A;  3V8L A;  4XSZ F;  5ED4 A;  1IF1 A;  2PBI A;  1FBU A;  3BP8 A;  1S3J A;  3ECO A;  3FXU A;  3I54 A;  4IHS A;  2R7F A;  4RGS A;  5LRS A;  2XRO A;  2ZXJ A;  3K1N A;  4G9Y A;  2DK5 A;  3EYY A;  4AWX B;  3HYI A;  4PZJ A;  4HYE A;  3I59 A;  5D5U B;  4HX8 A;  1B1B A;  2EJR A;  2CFX A;  1B9N A;  1FT9 A;  5JFR A;  3BPV A;  1K6O A;  5EEH A;  4UV8 A;  2HYF A;  3V7S A;  4JK1 X;  2F5C A;  3KZY A;  1EH8 A;  2GQQ A;  1SMY F;  2ZBK A;  1Q1H A;  4HLY A;  2HKX A;  4EMS A;  2EFW A;  4EM1 A;  4U88 A;  1W5T A;  2DQL A;  1QPM A;  1T0F A;  4WWC A;  3CUO A;  2FML A;  4HF2 A;  2NS0 A;  1D3Y A;  3K2Z A;  1BBY A;  4RAY A;  3T8T A;  4ZH4 F;  1QBJ A;  3R61 A;  3HRU A;  1JGS A;  4CZZ A;  3TO9 A;  4U7B A;  4ZZL A;  3QPH A;  2VBZ A;  5L3B A;  4IF4 A;  2ESN A;  2EFP A;  1TQM A;  3E6D A;  1B4A A;  5HVQ C;  3P9C A;  2W57 A;  1FY7 A;  1GHC A;  4AIK A;  1Z05 A;  1LEB A;  1YS7 A;  2V1U A;  4A5M A;  5FD5 A;  4M71 A;  3FXQ A;  2P7C B;  2D2W A;  1K7A A;  4MQ9 F;  1B59 A;  4GGG A;  3R6S A;  3QPT A;  1G4D A;  1MGT A;  4RS8 A;  1P92 A;  3DF8 A;  3V7C A;  4I0B A;  3P9K A;  2GXB A;  2WTE A;  1IXC A;  5BS6 A;  3NRV A;  3E5U A;  4KNY A;  2M8E A;  4KN4 X;  4UVA A;  4Y17 A;  3T5X A;  5IT9 Z;  2OAZ A;  1HKS A;  3FMR A;  1ON1 A;  4YFX F;  4CHU A;  3VB2 A;  3HOT A;  2OU2 A;  3F21 A;  4OMY A;  4KMF A;  3KLN A;  5CVR A;  2LDU A;  5E18 F;  3L09 A;  3V4G A;  4LLG F;  5K5Q A;  2QZ8 A;  2IP2 A;  2PMH A;  4EM2 A;  1FP2 A;  1BN5 A;  4ESF A;  5BOX A;  3SZP A;  2R7D A;  5DCM B;  1FOK A;  3FM5 A;  1T6S A;  1FYK A;  3TGN A;  4M74 A;  2ACJ A;  3ZP5 A;  2RGV A;  5ILS A;  4HOB A;  3MCZ A;  3JAM Z;  2UWM A;  3CO6 C;  1FSH A;  2STW A;  2XKO A;  4A2U A;  1ZH5 A;  1XMK A;  1LJ9 A;  1SMT A;  2W24 A;  5D8K B;  4YIF A;  2OBP A;  1T39 A;  3K1P A;  3ABT A;  4LJZ F;  3J80 K;  1XN7 A;  1A04 A;  4ZYD A;  3DP7 A;  4MEY F;  1RZ4 A;  5F64 A;  5LLQ A;  5E1Z B;  4HA8 A;  2LNB A;  2L4M A;  3WTU C;  2IW5 A;  2P6T A;  1JHF A;  2P8T A;  3L2C A;  3WU0 A;  2VOO A;  1WSU A;  3BJ6 A;  3LST A;  2EV5 A;  3IWZ A;  3HHG A;  1T2K A;  3SZT A;  4ENN A;  3ISP A;  4P5O A;  2E1N A;  3LA3 A;  1H9G A;  1TQI A;  2IA0 A;  4DQ2 A;  5LBQ A;  3MFK A;  1MJA A;  2P5K A;  3WE2 A;  1CF7 A;  1KU9 A;  2HEO A;  2EV0 A;  3I59 B;  4HLX A;  3KP2 A;  2QQB A;  4KYW A;  3RPQ A;  2DFI A;  3KCC A;  1GVJ A;  1TLH B;  3GF2 A;  2K4J A;  5DUI A;  3F23 A;  2DBB A;  4S05 A;  2IA1 A;  4A6D A;  2UXN A;  5LEK A;  2Y48 A;  3F8B A;  4PGH A;  1X3U A;  4HV6 A;  4DNC A;  2K7L A;  4LB5 A;  2KIF A;  4WF2 A;  3M7G A;  3HIF A;  1O57 A;  3CUQ C;  2IPQ X;  4M9Z A;  4L0Y B;  3H3Z A;  3W6K B;  3GLX A;  2VOD A;  1Z1D A;  5DYM A;  1J75 A;  1B6A A;  4A6E A;  3SFZ A;  3GFJ A;  4B09 A;  1J59 A;  4NHJ A;  1YIO A;  1QZZ A;  3GO5 A;  1D8J A;  3TQN A;  4HDU A;  1P6R A;  1V3F A;  1SAX A;  2Z99 A;  1BM9 A;  5BMZ A;  1MJ9 A;  4WXH A;  2AXL A;  4NB5 A;  3F8F A;  2EA2 A;  2J5P A;  4MEX F;  1YTY A;  2RN7 A;  2NRA C;  2FNA A;  1F9N A;  2FEZ A;  4UV9 A;  2FOK A;  4MGR A;  1ZAO A;  3GFM A;  2H09 A;  5JI6 A;  3LA2 A;  2DK8 A;  1XDU A;  1WI9 A;  3REO A;  4L9V A;  1P4X A;  3KP7 A;  2JZY A;  2PMU A;  1IXR C;  2PQ8 A;  4HX4 A;  3B73 A;  2WWY A;  3E6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...