3DEUA

Crystal structure of transcription regulatory protein slya from salmonella typhimurium in complex with salicylate ligands
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
132
Chain Sequence
LESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator slyA
publication title Crystal structure of transcription regulatory protein slyA from Salmonella typhimurium in complex with salicylate ligands.
rcsb
source organism Salmonella typhimurium
total genus 52
structure length 132
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3deuA00
3JTGA 1LDKB 4ZZLA 5H20A 4EQQA 1H9GA 3CO7C 1J59A 1F5TA 1R5HA 1C0WA 5FO5A 1K78A 1MJAA 1FBSA 1TTYA 1BI0A 1YS6A 1HSJA 2DO7A 5LEKA 1LNWA 4RGSA 1J7KA 3V7RA 1FT9A 2OQRA 2DQRA 1IZ1A 5E18F 4S05A 3DKWA 1B6AA 1AWCA 3FWEA 4KIFA 4M71A 1R36A 4LK1F 5EEHA 3V7CA 3HRTA 2PMHA 1UHMA 1PDNC 1IN4A 1J9IA 5L3EA 4EM1A 5HS7A 3K1MA 4YG2F 5F1RA 3WTWC 2AS5F 5A2QK 4OIQF 1MDMB 1HSTA 1ZN2A 2IJLA 2BV6A 1KGSA 1LDDA 4UHTA 1IW7F 3RPUA 3O6BB 2A61A 3ULQB 4LK0F 4U88A 3F8FA 5E8IA 2G9WA 4AVPA 4JK1X 3EQLF 1MDMA 2NYXA 3KLOA 3FMRA 3CUQC 4U7DA 2BE5F 4I09A 5LRSA 3V4GA 4L9JA 4LJZF 1KYWA 2E1NA 4P9FA 2HGCA 4CO8A 2D45A 3E6CC 5LGTA 1LEAA 2JTVA 4HF0A 3VB2A 1V4RA 5D6EA 5IT3A 5DYMA 2YX7A 3BPXA 2VBWA 3ZMTA 2P4WA 5DCMB 3GUDA 4XLPF 1KU2A 1FX7A 4PGHA 2P5VA 1FPQA 4XRFA 2FXAA 4FX4A 4IHTA 4FHTA 4L9NA 2WC2A 3H3UA 5J8CA 2VE8A 5FFZA 4RB3C 2FMLA 3FM5A 3R60A 1U2WA 2LKPA 1Z91A 3KFWX 1FYMA 3NRVA 2FE3A 2HEOA 3QU6A 2OZ6A 5L3DA 1OR7A 1FNNA 2CFXA 5AIQA 3ELKA 1ZG5A 1P4AA 4A0XA 1VTNC 1YFHA 5D5VB 4L5JA 1TQPA 2HQRA 3WGIA 3KETA 3RYRA 5JR3A 2XKOA 3TGNA 5LBQA 5ERIA 3BDDA 3QPHA 1B59A 4PGGA 3HYIA 3GEZA 3GFJA 1UB9A 5DDGA 1Z05A 4ENMA 4UUVA 5FD6A 1ZLJA 1O3TA 2MC3A 1DP7P 5HDGA 4PDKA 5LGNA 4B09A 4RGRA 1U78A 1J0RA 2QQBA 3J81Z 1MJ9A 4I0BA 1Q1HA 2QLZA 3M7GA 3IC7A 3C7JA 1RNLA 2PMUA 4ESJA 3GVAA 3HRMA 4ETSA 4HDUA 3ROUA 2DW4A 1G6NA 4YIIA 1BIAA 4G94A 2W25A 5J6XA 1SD6A 1O57A 4ESBA 3WTTC 1SFEA 5D5XB 3WE3A 1UFMA 5ILSA 3RJPA 1IUYA 3LSTA 3S2WA 1XB4A 3LQQA 4N9HA 4UV9A 4FT8A 1FBUA 3SZPA 4ENNA 2HYFA 3KP2A 2FEZA 2QYOA 4CZZA 4B8XA 1S3JA 5JI6A 2MH2A 2L02A 3HSEA 3QOPA 4BYYA 2PBIA 2JZYA 4CHUA 2GA2A 2M45A 4L0YB 1HBXG 2OD5A 3RKYA 2KJBA 5F64A 1KQ8A 1O3QA 4RAZA 4N0BA 4HX8A 3GFLA 3GO5A 5AIPA 3WU0A 2X0LA 1K7AA 1O7LA 5DD4A 3JSPA 2MLGA 4LG0B 2A07F 2VC0A 1MKMA 2P7VB 1ZARA 2GA1A 1F9NA 3EYYA 3SHFA 2K4JA 5HLGA 4KICA 4IVNA 3O3KA 3DEUA 2WTEA 3VOEA 3SXYA 3IRQA 4R8HA 5KVRA 2O61A 3FM3A 1B9MA 3ZP5A 4ESFA 3TQNA 4LG0A 2UXXA 3LAPA 2L01A 3ZQ7A 3LA7A 2HOEA 1SMTA 1SD5A 2F2EA 2IA0A 4WCGA 2DLLA 3DPTA 4LLGF 4A6DA 5CVRA 2D1HA 4P9UA 4RGUA 4M9SA 2TDXA 1XCVA 2BGCA 2DI3A 3L09A 3TDZC 4BNCA 2UZKA 3K0LA 5ICCA 3ECHA 3L9FA 1T0FA 2XRNA 3J81K 1NHAA 3GYHX 4DQ2A 2JPCA 4DNCA 2ADUA 4UV8A 1XMKA 4ZYGA 2XGXA 2DK8A 2EK5A 3QP6A 4HX4A 4MNUA 1KQ9A 4MEYF 5L3FA 2B0LA 1IN6A 1V3FA 2VBZA 5A2QZ 1XSXA 3ML6A 2DPUA 1PP7U 1W5SA 3GXOA 4RGXA 3L00A 5BQTA 3RKXA 1BOAA 1RI7A 3EUHA 4GXOA 3ZPLA 1R7JA 3MQ0A 5CJ9A 2IW5A 5ILVA 1ON2A 3QRFF 2DQLA 4OIOF 3QPTA 4G6QA 2O0YA 1FYLA 3DPLC 3V8LA 2XAJA 2QBYB 3FF5A 1KQ0A 2Y75A 1L3LA 3LA3A 2L4MA 3F23A 4RAYA 3C3WA 4KMUX 4RB2C 4U0VA 2IA2A 4A5MA 3E6DA 2FMYA 3E3VA 2COMA 3IWFA 2XAHA 1JXSA 4Q47A 1B1BA 1QQIA 1H0MA 1RUOA 2QBYA 1HKTA 4M72A 5H6RA 1I27A 4LFUA 4Y17A 1R1VA 3T8RA 3ZMSA 1TW3A 4OIPF 3B02A 1IN8A 3EYIA 4F7ZA 2LF7A 2GXBA 2R3SA 1G3YA 3Q5FA 2D1VA 5HDNA 4Y13A 2VBXA 3WG9A 4KUMA 2EJRA 4EMSA 3N4MA 2CGPA 3IRRA 1ZRDA 2Z33A 3WTUC 1I6XA 4IRIA 2EB7A 4AIKA 4LB6B 2XHKA 6PAXA 3F8NA 3I59B 2QQ9A 3BROA 3GZ5A 4G6DA 4G8XA 1DDNA 5JHUA 4KDPA 4BHCA 2Z99A 2XV4S 1XN7A 2FOKA 4A0YA 3G73A 1R00A 4D0PA 2M30A 1MD0A 1WWXA 1KU7A 1FBQA 1KU9A 3HHHA 3CUQB 2RV8A 3HHGA 3I59A 2R7FA 4KFCA 1IRFA 5IT9K 5FB2A 2GAUA 3P9KA 4LB5A 1EH6A 1U5TC 5J8FA 3WGHA 1J5YA 3DP7A 1BC8C 1I1SA 3K1NA 4ON0A 2RN7A 4CXFA 3M1EA 2Z5UA 5D5WB 2P5LC 1CGPA 4EM2A 3CUQA 1OYIA 4U0YA 2MBFA 1YW7A 3IWZA 1IN7A 1BI1A 1Z9CA 1R1UA 1SMYF 1WKMA 1W7PD 2RC4A 3TOAA 3P9CA 4MQ9F 4XBFA 2F5CA 4KIBA 2ELHA 4LD5A 1LB2A 1A04A 3KP4A 4UVCA 4IRGA 2XAQA 1ODDA 2E7XA 1YYVA 2K02A 4EJUA 1QZYA 1XDUA 3ZN1A 3GF2A 1RZ4A 3I5UA 4MQVA 1P4XA 4QLCU 1SFXA 3FZVA 4P55A 3T1BA 2FSWA 3FX3A 1J75A 1R1TA 5FD5A 2QZ8A 2EV6A 1LJ9A 1EH7A 2P5KA 2JSCA 1TNTA 5BMZA 2RGVA 4HLXA 3QAHA 2PFBA 2A3SA 1FWZA 2W24A 4L0ZB 1HKSA 4N9IA 1W5TA 4L5IA 3TO6A 5D4SA 2V1DA 4KN4X 2DT5A 3E5UA 1DPRA 3HTSB 1O7FA 1XGNA 3OV8A 4HLYA 3KP3A 2E1CA 1YO5C 2A6EF 2NAZA 4I01A 1YG2A 5LEJA 3WTYC 2ZBKA 2VE9A 1X3UA 3ZN0A 4JQFA 4HV6A 1L0OC 2YR2A 2EFQA 3VEPA 3KZZA 2A68F 3V8KA 1BIBA 2UWMA 4PCQA 2W85A 1ZAOA 3I71A 1XDSA 4UNOA 2YSRA 3TDUC 5CYVA 3H92A 2Z3YA 3IL2A 3T0YA 4HF1A 1LDJA 2GWRA 2VN2A 4XLNF 2PQ8A 4KN7X 4AIHA 5K5RA 1LEBA 4HA8A 2ZFWA 1U6GA 1XSVA 5DEQA 2IT0A 4A5NA 1KA8A 3HIFA 4RB1A 2GZWA 2MA3A 4HQMA 4HF2A 2H6CA 5DV5A 4MTDA 1ZRCA 2MH9A 3F3XA 4NHJA 4O6JA 1J2XA 2ZMEA 5JFRA 2KKOA 2HKXA 1ZRFA 2PJPA 2OAZA 2KRFA 2QVOA 3FMSA 1YW8A 3B73A 2M1BA 2XUBA 1QZZA 1I1GA 5K5OA 2YPRA 1R5GA 1R23A 4HOBA 1R22A 2Y0MA 2QENA 1ZG1A 2CWEA 2R7DA 4K2EA 2L54A 1Z1DA 5K1YA 4WK8F 2M5WA 1TBXA 2JRTA 2HS5A 2M87A 4LMYA 2ESHA 3F8MA 2MD5A 4EGZA 4CDGA 2EFPA 4U7BA 3WTZA 2IP2A 2ZNYA 1XCBA 3T5XA 1Y0UA 3RIRA 4LGWA 1FLIA 2IPQX 5E17F 3D0SA 2L3DA 5LHIA 2WWYA 3R0JA 5D5UB 1TQMA 3GFMA 2BEOA 3DV8A 3HSFA 1BJAA 4HZFA 1DPUA 1IXSB 4XSXF 2XVCA 3ISPA 2HTSA 1D8JA 4M6XA 3I54A 4RB0A 4ASNA 1HXDA 2FNPA 4EGYA 2V9VA 3OOPA 1BI2A 2CYYA 2RVCA 1S7OA 4PZJA 1S29A 2HDCA 4L9TA 4UVAA 4EJVA 1U8RA 3KE2A 1F4KA 4HQEA 2QUFA 3JAMZ 5BOXA 2V79A 1ON1A 3I0TA 5ICEA 1EV7A 1ZYRF 3CTAA 3LA2A 1D3YA 2DFIA 1IXCA 2E7WA 2P7CB 4HBLA 2H27A 4EJWA 2BYVE 4L18B 2VONA 4Y15A 3FXQA 2J5PA 1PP8F 2V1UA 5IT9Z 3QP5A 2HYGD 5TJJA 4P96A 3H3ZA 1TLHB 2JPBA 3LAJA 1F1ZA 4CYDA 4S04A 2C6YA 3VFZA 5BS6A 1LQ1A 5LRRA 3HOTA 4ZYDA 5F6FA 3MZYA 4G7OF 3W6KB 5CVJA 3BWGA 4M74A 3RTRA 4OOIA 3BPVA 3J80Z 2EFWA 4NQWA 1YQAA 2EFOA 3V8JA 1G3WA 3HOSA 3BZ6A 3JW4A 1IF1A 1YS7A 4BAYA 1BBYA 1D5VA 4A2UA 4P5OA 4L9VA 2NNNA 5CVIA 3K9TA 2OZUA 5BPIA 1T39A 3SFZA 3HRSA 1BN5A 3LWFA 3CJNA 2Z9OA 2V6CA 5CVUA 3L2CA 4QWQA 2ZKZA 3G3ZA 5D8LB 1T98A 1FC3A 1ZG3A 1JHHA 4HV5A 3GLXA 4ENJA 3GZ6A 1YLFA 2QQAA 1U5TB 4WF2A 2CW0F 4EV0A 4M73A 1FSEA 3Q9VA 4ENKA 1KU3A 3MEXA 4O3MA 5LGUA 2A6HF 1SFUA 2EA4A 5HDKA 4HDVA 3F6OA 4A6EA 1OMIA 1U5TA 2AXLA 5DUKA 3R4KA 4Q4ZF 3KCCA 1QO0D 3FXUA 4GCVA 2VC1A 4ZZDA 5DUIA 4EVIA 3JAMK 1MZBA 2HZTA 3FXRA 3KP5A 3NEUA 1ZREA 5CLSA 4BHBA 3ZMDA 3DXJF 2P6SA 2CO5A 3C1DA 3M9AA 3HSRA 2IVMA 3EETA 4E70A 2ISZA 1OYYA 5LHGA 3K2ZA 2Q2EA 4ZYHA 4CGZA 2F5DA 1XGOA 4KYWA 1W4MA 3K1PA 2XROA 1FOKA 3RYPA 3DFGA 1ZHFA 2W57A 2PG4A 1REPC 1USTA 3PQJA 1B9NA 2XAFA 4M9XA 3RPQA 1QPMA 1P2FA 3F21A 3J80K 3P9IA 2FF4A 3BP8A 4R1HA 4AWXB 1UCRA 2K4BA 3WU1B 5D6FA 4LLNA 2G7UA 2O8XA 3C18A 3F8CA 2YU3A 5KK1A 1D8KA 1WI9A 2RDPA 3KEOA 2ZCWA 3P7NA 2VXZA 3CLOA 4YIFA 1G3SA 5E1WA 2FRHA 2XKPA 2DAOA 3MFKA 3TOBA 1FP1D 3KEQA 2STTA 2XAGA 1AOYA 4FX0A 3TO9A 4G7ZF 4XSZF 3R61A 1FP2A 4UXNA 1YW9A 1E2XA 3E6MA 5HLHA 3I64A 3REOA 1PUEE 2H09A 5JVTA 1ZH5A 3FHZA 2OA4A 4LLLA 1YIOA 1BM9A 5AONA 3DF8A 5TRDA 1Z7UA 1P4WA 3GWZA 3E6BA 1XD7A 1ZLKA 5L3BA 3ZMZA 1OPCA 3COAC 2FBIA 2FA5A 2Q8KA 5HVQC 1E17A 2K86A 3WE2A 3SZTA 3V7SA 2P8TA 3HRUA 3BOQA 4MTEA 4A12A 4IXAA 3U9GA 1IXRC 2VODA 2FBKA 3K69A 5EEGA 3F6VA 1T6SA 2K27A 4Z2YA 3E97A 2VT2A 2OU2A 1LVAA 4CICA 2HKOA 5HLIA 2FU4A 4HW0A 2ACJA 3BY6A 2HTJA 4I2OA 5DCMA 3ABTA 1B4AA 4OMZA 2WV0A 2DK5A 1S6LA 2F5EA 1UHWA 3JSOA 3U2RA 3WODF 3F22A 2RNJA 2HWVA 3ECOA 3F8BA 2G7HA 2LNBA 2ZMEB 2RKHA 2EA2A 1FY7A 2H94A 1WQ2A 1QBJA 3GX4X 2A69F 4KA4A 3NQOA 3R0AA 4YFXF 1H9TA 4GYIA 4IRHA 1S7AA 4I02A 1IN5A 4HX7A 1I5ZA 2F5FA 1O3RA 1SD7A 3D5LA 4AD9A 2LDUA 2KIMA 2DU9A 4OIRF 1K79A 2Q0OA 1SD4A 2OQGA 4Q5SF 3M8FA 2KJCA 5H6QA 3WTSC 3MAJA 5ED4A 1ZGJA 3I53A 3WGGA 3AAFA 5E20A 4EM0B 2DTRA 5ILUA 2VOPA 5E8GA 4GO1A 2J5OA 2ZO4A 1XSDA 3BJOA 1HW5A 4KNYA 4ZH4F 2JT1A 2O3FA 1OYWA 4R79A 1FYKA 3N97A 2K7LA 2X4HA 5BPDA 1MJBA 4YFKF 3WTVC 4G7HF 2DPDA 4YFNF 4O5VA 4OMYA 5FLXZ 4WXDA 5D8KB 4KIGA 5E1ZB 2D2WA 2HR3A 3KP7A 5CVVA 2QWWA 2Y48A 2NRAC 4HAMA 3EDPA 1ONVA 1WRJA 3U1DA 4WWCA 3VODA 4BHPA 4ZYEA 2W84A 1IAWA 1JGSA 3RI4A 2PEXA 2HFHA 4UVBA 2PLYA 5L3GA 1HQCA 3ABUA 3ERED 2CQKA 4RS8A 2P6TA 1HW2A 1TQIA 1TW2A 4KT5C 3M8EA 3CUOA 5ICFA 2VOOA 5FGMA 2ESNA 4WXCA 1CF7B 3JTHA 5DD8A 3MCZA 4BH9A 1T38A 1TNSA 2IRFG 1WSUA 4KMFA 4MEXF 1DUXC 3TO7A 2MLKA 1XMAA 2ZXJA 3MZHA 1W7PB 2QM3A 1T2KA 4U0WA 5D4RA 2CSOA 3IKTA 2OBPA 3KLNA 1CF7A 3GFIA 3ZMUA 2STWA 1OKRA 1P92A 3KZYA 2UXNA 1QNTA 1GVJA 2ZNZA 3HUGA 2NNYA 3LFKA 2IA1A 1W7PA 1RIOH 1KYZA 1BC7C 3TKYA 3DQVC 2VBYA 1ULYA 3SQNA 4JBAA 1GHCA 5LLQA 3BJAA 5HS9A 4EJTA 1O3SA 2XIGA 2CG4A 3I58A 4M9ZA 5L3CA 3MWMA 4IHSA 4BQAA 2ZJ2A 4MGRA 2GQQA 2YX4A 3IKVA 4OINF 2VT3A 2ETHA 3CDHA 5HS8A 4BXUA 4M6YA 4NB5A 3FMQA 1XGMA 2EV0A 2FBHA 5LHHA 1USSA 4I0AA 1SAXA 1GXQA 1QGPA 3BJ6A 3HTUA 2BBYA 2LF8A 3PFIA 1Z6TA 4AIJA 4EJOA 5FFXA 3W6JB 2FNAA 3QU3A 3E5QA 2H6BA 2M8EA 3O2PE 2PI0A 3J7AO 1R58A 3L7WA 5K5QA 2A5YB 5FLXK 1JE8A 1P6RA 2NS0A 4G9YA 2EV5A 1IRGA 3LQRA 2KIUA 3E5XA 5ICGA 3F72A 3IHUA 4IJAA 3RKWA 1S8NA 1G3TA 1GXPA 3R6SA 3T8TA 4H0EA 4TV7A 4A0ZA 4WX9A 4IF4A 3WTXC 5HOOA 2FQ3A 1YTYA 2RQPA 3KP6A 2DBBA 4WXHA 1BI3A 3GW2A 4OU0A 2EWNA 1RUNA 1Z6RA 1EH8A 2O03A 3Q9SA 2L4AA 2LSOA 2HQNA 4GGGA 2EFNA 2V1XA 3ZMVA 1U3EM 5E1XA 1FZPB 2KIFA 3I4PA 1ZGAA 5DCFA 2XASA 3PQKA 1STZA 4Q48A 1XGSA 1K6OA 4GYGA 2ISYA 4I7HA 4IPAA 2PN6A 4I98B 1JHFA 3CO6C 1K78B 1FSHA 1G4DA 4HYEA 2GIVA 4MHGA 3RDIA 2GXGA 2O6GE 1HW1A 1MGTA 1HKQA
chains in the Genus database with same CATH superfamily
3JTGA 3MVPA 1LDKB 4ZZLA 1WJFA 5H20A 3FXJA 2OC6A 4EQQA 1H9GA 4D5FA 3CO7C 4XOPA 2B63J 1Y39A 4XLFA 4RAFA 5B66C 4W97A 1J59A 1F5TA 1R5HA 1C0WA 5FO5A 1K78A 1MJAA 1PJRA 1FBSA 1XC5A 2XPUA 3HXLA 1TTYA 1BI0A 1YS6A 1HSJA 2LY2A 1BL0A 1ZK8A 2DO7A 3D5RC 3L2VA 5LEKA 2M9HA 1LNWA 2CQ7A 4RGSA 2VKDA 2VL8A 1J7KA 3V7RA 1FT9A 3GTMJ 3DKYA 5EZHA 1JUPA 2OQRA 5F08A 3W2VA 2DQRA 1IZ1A 5E18F 2ZXHA 4FETA 1JTXA 4S05A 3DKWA 2LC2A 1B6AA 2K9LA 1AWCA 3E1SA 1VQ9I 3BLYA 3BQZA 3BCBA 3FWEA 3BC8A 4KIFA 4M3EA 4M71A 4FTHA 1R36A 4LK1F 4CYCB 2O7OA 1P9QC 3K4LA 2HDDA 5EEHA 4GDFA 3V7CA 5GTIC 4XQFA 2R7SA 3HRTA 1YX5A 2EIKH 2PMHA 1UHMA 4XN3A 1PDNC 4BBRJ 1IN4A 1HF0A 1J9IA 1MBFA 2KP6A 5L3EA 4EM1A 5HS7A 3K1MA 4YG2F 5F1RA 5FJ8J 2K9MA 3WTWC 2AS5F 3DTKA 5A2QK 4OIQF 1MDMB 1HSTA 3P5JA 1Z67A 1ZN2A 2IJLA 2BV6A 2E71A 1QPIA 3MKYB 1N78A 5FKMA 3MD2A 1IRXA 1KGSA 2DA3A 4CYCA 1LDDA 4UHTA 1IW7F 3RPUA 3O6BB 2A61A 3ULQB 4LK0F 4U88A 3F8FA 3PM1A 5GP9A 4U87A 5E8IA 4QTRA 1JKRC 2G9WA 4AVPA 3JREA 2KPMA 5IP7J 2KISA 4JK1X 1HDDC 3CCEI 3EQLF 5K7HA 1MDMA 3CMMA 1DQUA 2NYXA 3KLOA 2DA5A 3FMRA 2VKHA 3CUQC 4IQ4A 1WH5A 4U7DA 2BE5F 1SAUA 1K6YA 5GAEJ 4I09A 3IP4B 5LRSA 3V4GA 4L9JA 4LJZF 4RMNA 4XKWA 1KYWA 2ME6A 2E1NA 3GZNB 1ORKA 1MW7A 4P9FA 1I3QJ 2HGCA 4CO8A 2JMWA 1MNMC 2GLOA 4XL9A 1WVRA 2DFFA 3PSIA 2D45A 2HPMA 2M7BA 3LOCA 3E6CC 3CESA 5LGTA 3ABLH 1LEAA 2JTVA 4HF0A 3VB2A 1V4RA 2X9DA 2WAEA 2MD0A 5D6EA 5IT3A 1E0EA 2V9PA 5DYMA 2YX7A 3BPXA 2VBWA 3ZMTA 2P4WA 5DCMB 3GUDA 4XLPF 4LIUA 2R93J 3CZ6A 2FX0A 1KU2A 1VQ6I 1FX7A 1RR7A 3RQIA 4XIDA 4PGHA 2P5VA 3W2WA 1FPQA 2LTPA 1K61A 2L7KA 2EH3A 4FCYA 4XRFA 4BY7J 2FXAA 1ZQ3P 4FX4A 1WHUA 2HQAA 2WB1A 4IHTA 4FHTA 4L9NA 3IH2A 2WC2A 3H3UA 3H36A 5J8CA 2VE8A 3H5NA 5FFZA 4RB3C 3ZGKA 5J47A 2FMLA 3FM5A 3GTJJ 3R60A 1U2WA 5M5YJ 2LKPA 3ASOH 1Z91A 3BR2A 3KFWX 5M5WJ 3NRVA 1FYMA 1V5FA 2FE3A 1PUFB 4DYRA 2HEOA 3QU6A 2OZ6A 5L3DA 4E7SA 1OR7A 1FNNA 2CFXA 1GT0C 5AIQA 2UUZA 3ELKA 3CCVI 1ZG5A 1P4AA 4RLQA 4A0XA 4DBQA 1VTNC 4IO9F 1YFHA 5D5VB 5DM6F 4L5JA 1TQPA 2HQRA 3WGIA 4QPOA 3KETA 3RYRA 5JR3A 2XKOA 1DGWY 4AM3A 2HU9A 3TGNA 5LBQA 5ERIA 3BDDA 2CQNA 4XLHA 1PUFA 1X19A 4BDYA 4BUPA 3QPHA 4E4HA 3ZQFA 1B59A 4UUTA 4DIQA 4PGGA 1MSEC 2IS4A 2IGOA 1VNDA 3HYIA 4Y52J 3GEZA 2QGUA 3GFJA 1UB9A 5DDGA 1Z05A 4ENMA 4UUVA 5FD6A 2EZKA 1ZLJA 1UELB 3S3NA 1O3TA 2MC3A 2ZC2A 2CUZA 4A3BJ 4D7NA 5GAHJ 3PSFA 2EBIA 3TL4X 1Y8RB 5J4VA 1DP7P 1VQOI 5HDGA 5E3OA 1TC3C 3K10A 4PDKA 5LGNA 4B09A 1RKTA 2JSPA 5J1RA 4XONA 4PJ0C 3W2AA 4RGRA 3SFIA 3OS1A 2LRDA 5EDNA 2I5UA 5FROA 1U78A 1J0RA 2KZVA 2QQBA 3J81Z 1MJ9A 3I55I 2Y69H 3FHNA 3CCSI 4I0BA 3NWSA 1Q1HA 1FEXA 1X3WB 3EUKL 1QRYA 4BU2A 5GPAA 2QLZA 1Q1VA 4CCJA 3DKXA 3K2AA 3RZDJ 3AL0C 3M7GA 2M0CA 3QYBA 3IC7A 3C7JA 3H9QA 2BY2A 1RNLA 4C30A 2PMUA 4UB8C 1FIAA 4KITB 1A36A 4ESJA 3G6EI 3GVAA 1RRJA 3HRMA 4ETSA 4QPQA 4HDUA 3ROUA 2DW4A 1G6NA 2PMZN 2X6OA 2CV0A 5FRMA 4YIIA 1BIAA 1X1CA 4G94A 1XPXA 2W25A 5J6XA 4LIVA 1SD6A 1O57A 4ESBA 3WTTC 1SFEA 5D5XB 2K9NA 2QF7A 4IOAF 3UNGC 3WE3A 2LY1A 1UFMA 1TWFJ 4Y3OA 5ILSA 4CH7A 4IOCF 3S15J 1IUFA 3RJPA 1IUYA 3LSTA 3S2WA 3U1KA 3DPUA 1SANA 1XB4A 2K9QA 2OCEA 3LQQA 2PMZA 1YIJI 2DTZA 4N9HA 4UV9A 2DDAA 2VQHA 2QSFX 4FT8A 5KNLA 1FBUA 3SZPA 4A3EJ 4ENNA 2HVQA 1VQ4I 5FKOA 1MNDA 2HYFA 3S17J 3D5SC 2ZMEC 3S1RJ 2MG4A 3KP2A 4XM3A 3CC2I 2FEZA 1LFPA 2DA2A 3GTOJ 3BG7A 5B1BH 2QYOA 1WI3A 2L9RA 4CZZA 5F0HA 4G6TB 1S3JA 4B8XA 5JI6A 1WJ5A 2MH2A 2EIMH 3JRIA 3A1YA 2L02A 3HSEA 3QOPA 3CLQA 4BYYA 1ETKA 2PBIA 2FJ1A 1Z0XA 3S1MJ 2JZYA 3ZCOA 4CHUA 2GA2A 3SEQA 2M45A 1W36C 2OF7A 3VSLA 3LNQA 3RPUD 4L0YB 1HBXG 2OD5A 3QOEA 4FE4A 1A5JA 3DWLE 3OSFA 3QPLA 3G1MA 2WBMA 3RKYA 2KJBA 2E2IJ 5F64A 1KQ8A 4A93J 2LFBA 2P81A 1O3QA 4RAZA 4N0BA 1LUJB 3S14J 4HX8A 3GFLA 3GO5A 5AIPA 3GCMA 2KQRA 2H1LA 3WU0A 2X0LA 3OL4A 2R7UA 1K7AA 4XLAA 5HODA 1O7LA 5DD4A 2IS6A 1MIJA 2MLGA 2IXSA 3JSPA 4LG0B 2A07F 4JOMA 2VC0A 1MKMA 2P7VB 2Y9YA 1ZARA 2GA1A 3OYGA 3S2DJ 1YHQI 1F9NA 3EYYA 3SHFA 2K4JA 1JJ8C 5HLGA 4KICA 3SDGA 3HBLA 2R0QC 4ZYAA 2UV1A 4IVNA 4EATA 1MBHA 3O3KA 3DEUA 2WTEA 3VOEA 1DU0A 3LFUA 3SXYA 4R8HA 3IRQA 2LMDA 4F3QA 5KVRA 2O61A 1FMWA 3FM3A 1B9MA 3ZP5A 4ESFA 3TQNA 1X1DA 3CP2A 1OQYA 3PNYA 1X1AA 4C9YA 4LG0A 2UXXA 4IEJA 3VYSB 3LAPA 2L01A 3ZQ7A 1N77A 3LA7A 1OFCX 2VJ4A 2ELJA 1VQMI 2V26A 2HOEA 3CCUI 1SMTA 1SD5A 1SVOA 1R49A 2F2EA 2IA0A 2XDVA 4B44A 4WCGA 2DLLA 1IDYA 3DPTA 3BG6A 4LLGF 2LBFB 4QIWN 1QU3A 2BHZA 4A6DA 5CVRA 2D1HA 1X2MA 2Y2ZA 4P9UA 3SJMA 2GBYA 4RGUA 3HOYJ 1MH3A 2VQGA 4M9SA 2TDXA 1XCVA 2BGCA 2DI3A 3L09A 3TDZC 2FD5A 4A3LJ 3JR9A 4BNCA 2UZKA 2VQLA 3K0LA 5ICCA 3ECHA 4A3CJ 3Q0UA 3QYFA 1GUUA 3L9FA 3TW6A 2JWTA 5BNGA 1T0FA 2LVSA 2XRNA 3J81K 1JKPC 2W4SA 1NHAA 3GYHX 1IO2A 4DQ2A 1POGA 4HG2A 3HOUJ 1BW6A 3OMYA 2DMTA 4V2GA 2FOWA 1MMAA 1FTTA 2JPCA 4DNCA 3TP3A 2ADUA 1JGGA 4UV8A 1VZ0A 1XMKA 2NVQJ 3PO2J 4M3BA 5CKTA 2RREA 4ZYGA 2XGXA 1BOBA 1WFXA 2NS8A 2DK8A 2EK5A 3MKLA 1K4TA 1U9OA 3QP6A 4HX4A 1R4NB 3FKJA 4B4CA 2BHYA 1YRNB 4MNUA 2HDWA 3RKQA 1KQ9A 4MEYF 5L3FA 1H89C 1SVMA 2B0LA 3GTKJ 1IN6A 5TISC 1V3FA 2VLAA 3GTPJ 2VBZA 5A2QZ 2H8RA 1TWHJ 1XSXA 2LG4A 3ML6A 5HNHA 2ECCA 2DPUA 1PP7U 1W5SA 3GXOA 4RGXA 3L00A 3OYAA 3CC7I 4BXXJ 5BQTA 3RKXA 2VJ5A 1BOAA 1RI7A 3CJTB 3EUHA 2M0MA 4GXOA 4PUSA 3ZPLA 1AA7A 4ZDOA 3OYHA 1R7JA 2BZTA 2B7EA 1TWCJ 2AQFA 3MQ0A 4XKVA 5CJ9A 4YRVA 5K7ZA 1GV5A 2IW5A 5ILVA 1JT6A 1ON2A 1YX3A 2L9VA 4RBOA 4HNUA 3QRFF 2DQLA 4IHWA 2BVMA 1VQNI 2OUMA 2BXYA 1YRNA 4OIOF 3QPTA 4G6QA 2O0YA 1FYLA 2JUCA 3DPLC 3V8LA 2XAJA 4B48A 2QBYB 3FF5A 2CV2A 2MW8A 1WZ2A 1KQ0A 2Y75A 2NVYJ 1L3LA 3LA3A 1W5CC 2L4MA 4PJLA 3F23A 4RAYA 2HQ5A 2ICWG 3C3WA 5GPCA 2XB0X 2EZHA 3A0BC 3FISA 4KMUX 1LFUP 4RB2C 2EINH 2IA2A 2X85A 3E6DA 4I76A 1S9HA 4U0VA 4A5MA 1YJ9I 2FMYA 3E3VA 2EIJH 4CCKA 3FKIJ 2COMA 2Y9ZA 3IWFA 3VPRA 3S8PA 2XAHA 1JXSA 3H0DA 4Q47A 1TWGJ 2E60A 1B1BA 5B5EC 1QQIA 1H0MA 1RUOA 2QBYA 1HKTA 4M72A 4AVZA 3ASNH 5H6RA 1I27A 4LFUA 4Y17A 1R1VA 3AG4H 3T8RA 3ZMSA 1TW3A 3FXMA 4N4OB 3B02A 4OIPF 4RM3A 3WU2C 1IN8A 3EYIA 2KLOA 3GBGA 3HDDA 5TGTA 1OCRH 4F7ZA 2LF7A 2GXBA 2R3SA 1G3YA 3Q5FA 2D1VA 5HDNA 5LD2C 4Y13A 2VBXA 3WG9A 4KUMA 2EJRA 2E5ZA 3RSNA 1T95A 2QSHX 2E1MC 2M8GX 4EMSA 3IRRA 3N4MA 1ZRDA 2CGPA 2L0KA 1XX5A 3ONQA 2Z33A 3WTUC 4GFBA 1I6XA 4V19K 4NDLA 4IRIA 2EB7A 2VJJA 4AIKA 1Y1VJ 2NOGA 4LB6B 3CMAI 4BY1J 2XHKA 1FTZA 3HB9A 3IH3A 6PAXA 1G2HA 3MKWB 4ZJZA 3F8NA 2O8KA 3S93A 3I59B 2QQ9A 3BROA 3GZ5A 1S72I 4G6DA 3BTLA 2V6EA 4G8XA 1DDNA 3QPSA 5JHUA 2YUSA 2MSYA 4BHCA 3UR3C 4KDPA 2QCOA 1D0YA 2Z99A 2XV4S 1XN7A 1P7IA 2FOKA 4A0YA 4PJNA 5C3EJ 1S5LC 2K5CA 4DZJA 4XK4A 3G73A 1R00A 4D0PA 1R6RA 2M30A 1MD0A 1WWXA 2LR8A 1KU7A 1FBQA 1KU9A 3HHHA 3CUQB 5F27A 2RV8A 3HHGA 3I59A 2XF7A 5B1AH 2L7MP 2R7FA 4MO7A 2P0WA 4KFCA 3DU5A 1UZCA 1IRFA 3M4OJ 2NVUB 5IT9K 5FB2A 2GAUA 2BOLA 3P9KA 4LB5A 1EH6A 3OYKA 2CMPA 1U5TC 4OAYA 5J8FA 3CD6I 2CFOA 3WGHA 3HEFA 1J5YA 5E3MA 3DP7A 1BC8C 1I1SA 3K1NA 4ON0A 2RN7A 4CXFA 3M1EA 1MBGA 2Z5UA 5D5WB 2P5LC 1CGPA 4EM2A 4C2UA 1R4MB 3CUQA 1OYIA 4PFOA 4U0YA 2MBFA 3JRBA 1YW7A 5FRNA 3IWZA 1IN7A 1BI1A 1Z9CA 1R1UA 1JKQC 1Y6IA 1SMYF 1WKMA 2DT7B 1W7PD 2RC4A 3ZQHA 2XF6A 3TOAA 2DOFA 3CDLA 1T08B 3P9CA 4MQ9F 4BQOA 3JRCA 4XBFA 2F5CA 4KIBA 2ELHA 4LD5A 1LB2A 5EG0B 1A04A 1MMNA 4D9JA 4ZC3A 3KX2A 3KP4A 3I4MJ 1WJDA 2XB5A 1OLTA 4UVCA 3A01B 4IRGA 5IPAA 2XAQA 1ODDA 2E7XA 1U9NA 2KL4A 4ZTJA 1HC8A 1YYVA 2K02A 4EJUA 2QA4I 1UJ8A 1QZYA 1ERDA 5CQGA 3OYJA 1XDUA 3AG1H 3ZN1A 3GF2A 1RZ4A 3I5UA 4ITVA 4MQVA 3LSRA 1P4XA 4QLCU 1SFXA 3FZVA 4P55A 3T1BA 2FSWA 5EG0A 2VXDA 2X51A 3FX3A 3FXLA 1J75A 2R92J 2F48A 1W0UA 2YU9J 5FLMJ 1R1TA 1K83J 2K40A 2V9KA 5FD5A 2Z2SB 2DJNA 1R71A 4QSHA 2QZ8A 3A01A 2EV6A 2RNGA 1LJ9A 4E7KA 1T8IA 1EH7A 3A4CA 4DYQA 2P5KA 2JSCA 3CMEI 3DTEA 2WADA 1SC7A 3OOUA 4ZTFA 1TNTA 5BMZA 5HLTA 2RGVA 1R9TJ 2DFEA 4HLXA 5FKNA 1BR1A 1YI2I 3QAHA 3EPZA 2PFBA 5H2FC 2R4GA 2A3SA 2PX9A 1FWZA 3TP0A 2WB1N 2W24A 2E35A 1OCTC 4L0ZB 2MYSA 1M1EB 2Q1ZB 2M4GA 1HKSA 4N9IA 4D7MA 2DJIA 1W5TA 2WY7Q 4L5IA 3TO6A 1YJWI 1XTAA 2BY3A 2E5NA 2Z16A 5D4SA 2V1DA 1JUSA 4KN4X 2DT5A 3VYTB 3LMMA 4B47A 3E5UA 1DPRA 3HTSB 2FQ4A 1O7FA 1XGNA 3HC7A 3OV8A 4HLYA 3CF5F 3KP3A 3AL0B 5FLVA 2E1CA 4DYCA 2CRGA 3H3VK 4RM2A 5FKLA 3LL7A 3OYCA 1TT0A 3ZQCA 1YO5C 4V2FA 2X1CA 4F52A 2M7AA 2A6EF 2NAZA 4I01A 1YG2A 3WHCA 4D5CA 5LEJA 3WTYC 1APLC 2ZBKA 2VE9A 1X3UA 3ZN0A 4JQFA 2WY8Q 4F91B 3BR0A 3Q0WA 4HV6A 1XG1A 2JRMA 1L0OC 2YR2A 3GTQJ 2EFQA 3FIWA 3VEPA 4A69C 2CV1A 2LH9A 3KZZA 1FOWA 2A68F 3ERMA 3G1OA 3V8KA 4NC7A 3ZR8X 4BXFA 1BIBA 2UWMA 4ZDLA 4PCQA 2W85A 1ZAOA 3I71A 1XDSA 2HOTA 4UNOA 3H5RA 1J09A 2YSRA 3TDUC 3J7YJ 5CYVA 3H92A 2Z3YA 3IL2A 4XICA 3BCAA 3T0YA 2BVLA 4HF1A 1LDJA 3OYIA 3RZOJ 1A35A 2GWRA 2VN2A 1UAAA 5C44J 4HRIA 4CCOA 3BR5A 5JLXA 4EEFG 3E0JB 4XLNF 2PQ8A 5GAGJ 1AU7A 4KN7X 4AIHA 5K5RA 2CUFA 1LEBA 3PNVA 4HA8A 2ZFWA 1NG7A 1U6GA 1XSVA 1ZELA 5DEQA 2IT0A 4A5NA 2R7RA 1KA8A 1KONA 2XPWA 3HIFA 4RB1A 2GZWA 1FJLA 2MA3A 1S7EA 4HQMA 4HF2A 2H6CA 3DTIA 5DV5A 3L1PA 1VQ5I 1DGRM 4MTDA 2AO9A 3AG2H 1ZRCA 2O9LA 2MH9A 3F3XA 2PJRB 4NHJA 4O6JA 2Y0SA 4ABZA 2GOMA 1J2XA 3HOZJ 2ZMEA 5JHFA 5JFRA 2KKOA 2HKXA 1ZRFA 2JA7J 2PJPA 2OAZA 3A02A 2WAQA 4PK4A 2KRFA 3OYBA 2ID3A 2QVOA 1MMSA 3FMSA 4FASD 4RDUA 1YW8A 4HSTA 3JRHA 4XLEA 3B73A 2BXZA 5CPRB 2M1BA 2DXIA 2PJRA 2XUBA 1QZZA 1I1GA 5EJCA 5K5OA 2YPRA 2VB6A 1R5GA 1R23A 2R7QA 4HOBA 4PSWA 4MIMA 3HM5A 5GTHC 1X1BA 1B72B 1R22A 3B6CA 1EKEA 2Y0MA 2QENA 1ETVA 1ZG1A 4C3JJ 4HNTA 2CWEA 2R7DA 4K2EA 3K4BA 5B3SH 4Y4RA 2L54A 1Z1DA 3GTLJ 5K1YA 3HGGA 4BJ6C 1ZGWA 4WK8F 2M5WA 1TBXA 2JRTA 4A3DJ 1VFCA 2HS5A 2M87A 4LMYA 3I9V2 3RCOA 2ESHA 3F8MA 3OY9A 2MD5A 4EGZA 4CDGA 2EFPA 4U7BA 4XORA 2E2JJ 3WTZA 1B72A 2IP2A 2ZNYA 5J1UA 1XCBA 3OIPA 3T5XA 5KAFC 3BTCA 1Y0UA 2IGNA 3BT9A 3DBRB 3RIRA 2L9SA 4LGWA 1FLIA 2IPQX 5E17F 3OYDA 3TBIA 3D0SA 3PUFA 2L3DA 2H8WA 3HOVJ 5LHIA 2WWYA 3K4NA 3R0JA 5D5UB 4FE7A 1TQMA 1O4XA 2R7TA 2WV1A 2KIQA 4W1UA 3GFMA 4XOTA 4BEHB 2BEOA 4DGWB 3DV8A 4BACA 1VI0A 2ZJRF 3HSFA 1BJAA 3PFYA 4HZFA 4RA2A 1DPUA 4XMYA 1IXSB 5K7FA 2VUMJ 4BE1A 3IV5A 2HOAA 4XSXF 3BG5A 1X3ZB 2XVCA 2HTSA 3ISPA 1D8JA 2A05A 3FK6A 2DA7A 4M6XA 1ETWA 1Z77A 3U21A 3I54A 2E34A 4RB0A 4ASNA 1MSFC 1HXDA 2FNPA 5GADJ 4EGYA 1MBEA 2V9VA 1N25A 4DJAA 3OOPA 1BI2A 2CYYA 1IG7A 4F92B 2RVCA 4BEHA 1S7OA 2ZB9A 4PZJA 1S29A 2M2EA 2HDCA 4L9TA 3FBNB 4UVAA 3FBIB 4F93B 4EJVA 3DU6A 4F55A 3M1CA 1U8RA 2R7OA 3KE2A 1F4KA 2ZJQF 4HQEA 3ABKH 2ID6A 2QUFA 3JAMZ 5BOXA 2V79A 1ON1A 3I0TA 5ICEA 1EV7A 4XRSG 3K4CA 1VQ8I 4J00A 4L5EA 1ZYRF 3CTAA 3LSPA 3G4SI 3FK7A 3LA2A 3S3OA 2ZSIB 1D3YA 3E7LA 2DFIA 3NARA 1IXCA 1RETA 2V4JC 3HG9A 2E7WA 1UG2A 2P7CB 3HKZA 4HBLA 2H27A 2ECBA 4EJWA 2DMUA 1I50J 2BYVE 1QHHD 4L18B 2XF5A 3OS2A 4Y15A 2VONA 3KIOA 3RQ4A 1YOVB 3KPHA 2L9NA 3DBLB 3FXQA 2J5PA 3CJQB 1PP8F 5F0FA 2V1UA 4PFPA 5IT9Z 3QP5A 2KHMA 2HXOA 2HYGD 4E7IA 3OYEA 3LSGA 1D1AA 5TJJA 4P96A 3H3ZA 1FIPA 1TLHB 2JPBA 3SZGA 3LAJA 2OTJI 4MFEA 1F1ZA 1Y1WJ 3L2WA 3M8JA 4NQWB 4CYDA 4S04A 2C6YA 3VFZA 5BS6A 3VYRB 1LQ1A 5LRRA 2GIZA 3H35A 4X1EA 4ZDPA 4XN0A 4AUXA 3HOTA 4ZYDA 5F6FA 3MZYA 1AKHB 3W6KB 3BTIA 4G7OF 1A6IA 1Y8QB 5CVJA 3BWGA 2ME0A 4YEJA 3CQZJ 4MFDA 4C2TA 4DBRA 2H1KA 2NXNB 3PJRA 3IAM2 4M74A 3RTRA 1WJBA 4OOIA 3BPVA 1B8IB 9ANTA 2JVHA 3J80Z 1BJZA 3ZQQA 1XMXA 2EFWA 4JX6A 2CH0A 4NQWA 4PJMA 1YQAA 4FISA 1QA6A 4M3DA 3VWBA 3GTGJ 2EFOA 2VJIA 3V8JA 3CMYA 3VDXA 1G3WA 4BQNA 1NK2P 3A0HC 2E1MB 1AKHA 3HOSA 3BZ6A 3JW4A 2M3AA 1IF1A 1YS7A 1NTCA 4BAYA 1SFKA 1BBYA 3C2BA 3ZQLA 1D5VA 2TCTA 3K4MA 4A2UA 4P5OA 4L9VA 1B8IA 2NNNA 3HJEA 5CVIA 3A03A 2B9SA 1IGNA 3K9TA 2VKVA 2DFHA 2JA2A 2OZUA 4CCNA 4A3FJ 5BPIA 1T39A 2CS3A 4BQQA 2RQQA 1R5ID 3SFZA 2XPVA 2DDBA 3HRSA 3G2BA 3PNTA 1MH4A 4DZPA 1BN5A 3LWFA 3CJNA 2IS2A 2Z9OA 2V6CA 5CVUA 3L2CA 4QWQA 4A3MJ 2ZKZA 3BR1A 3G3ZA 5D8LB 2F6CA 3L2RA 1T98A 2IEKA 3BG9A 4BS9A 3WG7H 3KYDB 1TWAJ 3L2QA 1OISA 4LITA 1FC3A 1ZTRA 3BZKA 1ZG3A 1JHHA 4HV5A 1WJCA 3GLXA 4ENJA 3GZ6A 5F0CA 1I3AA 1YLFA 2HXIA 2QQAA 1U5TB 4WF2A 4Z6YA 3H9GA 1WJEA 2CW0F 1HDPA 4EV0A 4M73A 1FSEA 3Q9VA 4ENKA 1X4OA 2IBDA 1EF4A 2I10A 4RLFA 1KU3A 3MEXA 3CC4I 4NC6A 4O3MA 5LGUA 2A6HF 3KZIC 1SFUA 5IY5H 2R7VA 1HA8A 4XR6A 3I3LA 2EA4A 1D1BA 5HDKA 4HDVA 3F6OA 3PUBA 4E7JA 5EZGA 1ZR4A 4A6EA 1OMIA 1U5TA 1RKWA 5CQEA 2KRCA 3VSKA 4JX4A 2W7NA 1TT5B 2DMQA 3K70D 3BG3A 2VPRA 3I4NJ 5JLWA 2AXLA 4M3GA 3X2QH 2COBA 5DUKA 1XS9A 3R4KA 2Y30A 4Q4ZF 1V54H 2XSJC 3KCCA 1QO0D 3FXUA 2R7ZJ 4GCVA 2Q2EB 2VC1A 3K4KA 4ZZDA 2LREA 5DUIA 4EVIA 3JAMK 3JRAA 1MZBA 2HZTA 3FXRA 3KP5A 4JP0A 2HNHA 3NEUA 1V5GA 3H5AA 1ZREA 5CLSA 4BHBA 2JUGA 4M3FA 5IYDJ 3ZMDA 3DXJF 2P6SA 2CO5A 3C1DA 3M9AA 2CQXA 3HSRA 3TMOA 5C4XJ 1QZEA 2IVMA 2XGCA 4BJTA 3EETA 4Y7NJ 1ENHA 3JCUC 2E1OA 2HI3A 2IGMA 4E70A 2ISZA 2KFDA 2RAEA 1OYYA 1Z3XA 5LHGA 3K2ZA 2HVRA 4XKBA 1GVDA 2Q2EA 2JA6J 4XRSA 5F1JA 1WJAA 1MNEA 4ZYHA 4CGZA 3K4JA 5EYRA 5DTDA 4NNJA 1OCOH 2F5DA 4IKFA 3G71I 2W1OA 1XGOA 4KYWA 1W4MA 3K1PA 3ZQIA 2Z1DA 1Z3YA 2XROA 1FOKA 2HZDA 3RYPA 3CCMI 3L2UA 2W00A 3DFGA 1ZHFA 1DP3A 4YELA 3LSKA 1OCCH 1IDZA 3K7AJ 2W57A 2PG4A 3CCYA 2JA8J 1U8BA 2E2HJ 4H4KC 1REPC 1X1PA 4N4NB 4UY8I 1USTA 3PQJA 1B9NA 2XAFA 4M9XA 3FXKA 2WAFA 3RPQA 2DCEA 1QPMA 4BKXA 3AKZA 3CCRI 1E3HA 1G8XA 5KAIC 2OV7A 1P2FA 3F21A 5IOZA 1ETXA 3J80K 2BW3B 1RR8C 2LP0A 2DOAA 3O8HA 3DBHB 3DEWA 3P9IA 2XSDC 1GV2A 2FF4A 4S0HB 3BP8A 3M3YJ 4R1HA 2LK2A 4AWXB 1FOXA 1UCRA 4PJJA 1LVKA 2JK3A 2K4BA 4DW6A 3WU1B 1IC8A 4B3XA 2VQCA 3H1CA 2DN0A 5D6FA 4E7LA 2LY9A 4LLNA 1JUMA 1UMQA 1NH3A 2G7UA 2K9SA 4HSRA 2HYJA 3Q0VA 2JJ7A 2O8XA 1ITYA 3C18A 1Y56A 3F8CA 3OYNA 2G0EA 2BW3A 2YU3A 1W0TA 5KK1A 3J7AY 1F43A 1D8KA 4J19A 1WI9A 2RDPA 3KEOA 2ZCWA 3LSIA 3P7NA 4PSXA 2VXZA 1HOMA 3CLOA 3LSJA 4YIFA 1G3SA 1D5YA 5E1WA 5EGOB 2CW8A 2FRHA 2XKPA 1P7JA 2DAOA 3MFKA 3TOBA 4AC0A 1FP1D 3F9KA 3KEQA 2NVTJ 2STTA 2XAGA 1AOYA 4NUBA 4FX0A 3TO9A 4B43A 3NAUA 5HNFA 4G7ZF 3UKGA 1VQ7I 4XSZF 3S3MA 4A3IJ 3R61A 1FP2A 2EPFA 4UXNA 2AHQA 1YW9A 1I39A 4X0GA 5EGOA 1E2XA 3E6MA 2K3FA 1MMDA 5HLHA 1YITI 1AHDP 1CQTA 3I64A 3REOA 1ZKGA 2OJED 3HPGA 2H09A 1PUEE 5JVTA 4A3KJ 4UUSB 1ZH5A 3FHZA 2DMNA 3MMYB 1OJLA 4JX5A 1W1WE 2OA4A 2CU7A 4LLLA 1YIOA 2NS7A 1BM9A 5AONA 1VQPI 3DF8A 2D5VA 1ZR2A 5TRDA 1Z7UA 3JRDA 2A6TA 1P4WA 3GWZA 3BR6A 3E6BA 3K6GA 1UHSA 1K4SA 1XD7A 3D1NI 2QSGX 5KHDA 2R7XA 1YJNI 2V7FA 1ZLKA 5L3BA 3ZMZA 1OPCA 1WCMJ 2R5YB 1BW5A 3COAC 2FBIA 1RESA 2FA5A 2JVGA 3ESWB 3HZJA 2Q8KA 4BGDA 5IP6A 1ACIA 5HVQC 1E17A 1ETOA 5EF6A 2LLKA 1BR4A 2K86A 3SZTA 3WE2A 4UUSA 3V7SA 2P8TA 2L7ZA 1X58A 3HRUA 3BOQA 3A2KA 3TW7A 4MTEA 4HEA2 4A12A 2CUEA 2MFZA 4MLOA 4IXAA 3U9GA 1IXRC 2A5WA 2VODA 2K3PA 2FBKA 3K69A 3BZCA 5EEGA 3F6VA 2ZXWH 5DM7F 2QQ8A 2LD5A 3ZQGA 1MBJA 3JRFA 1T6SA 2K27A 4Z2YA 3E97A 2R5YA 2VT2A 1RPWA 1LVAA 2OU2A 4CICA 2HKOA 5HLIA 2FU4A 3CCJI 4HW0A 3ABMH 2ACJA 3BY6A 3M07A 2VASA 3ZXSA 4C2MJ 1D0ZA 2HOSA 1WPKA 2XGDA 2HTJA 4II3A 4I2OA 5DCMA 1UG0A 3ABTA 1GLNA 1B4AA 5IP9J 4OMZA 4HPQA 2WV0A 1H8AC 2DK5A 1KZHA 1S6LA 2F5EA 3QODA 1TL8A 1UHWA 3JSOA 2CQQA 3U2RA 2E36A 2CW7A 3WODF 2RNJA 3F22A 1E3OC 2HWVA 3ECOA 2Y0SN 3F8BA 2G7HA 1RC9A 2LNBA 4B1RA 2ZMEB 2RKHA 3JRGA 2EA2A 3F0CA 1A31A 1FY7A 2ZXIA 2H94A 1WQ2A 2WA0A 1QBJA 3GX4X 2A69F 4KA4A 4II2A 2WAQN 4OAZA 3W6VA 3C2HA 2QEXI 4AYBN 3NQOA 3QQAA 3OS0A 2JQ7A 3R0AA 4YFXF 4LG3A 1H9TA 1E3PA 2BY1A 3OYLA 5KCMA 4CCMA 2X6WA 3GLLA 2HPIA 1LKXA 2I8DA 2X1DA 2XGEA 2N8GA 4GYIA 2GXAA 2DA6A 4IRHA 4KT6A 3S1QJ 1TP4A 1S7AA 3CCLI 4I02A 1IN5A 2OTLI 1F36A 4HX7A 1I5ZA 3CCQI 2F5FA 4KJZA 3NWTA 4OWRB 1V5EA 1O3RA 4J01A 1SD7A 5DS9A 2KRHA 4AYBA 3D5LA 4AD9A 2LDUA 2IAIA 5E3NA 1IJWC 2KIMA 2AQEA 2DU9A 2ZFUA 4OIRF 1K79A 2Q0OA 1SD4A 2OQGA 4Q5SF 2EZIA 3M8FA 2KJCA 5H6QA 2X48A 3IAS2 3WTSC 3MAJA 5ED4A 2CUJA 3GMEA 1ZGJA 1OR7C 3I53A 3WGGA 3AAFA 5E20A 4EM0B 2DTRA 5ILUA 4B3AA 2VOPA 1D0XA 4M6VA 2XAUA 5E8GA 4GO1A 1MBKA 2J5OA 2ZO4A 1XSDA 3BJOA 3MN2A 1IV8A 5JVGF 3VYUB 2TRTA 2EILH 5J1YA 1HW5A 4KNYA 4ZH4F 2E19A 2JT1A 2O3FA 2XRLA 1OYWA 4XLCA 4R79A 3H9JA 1FYKA 3N97A 2ZSHB 2ELKA 2L5QA 5M5XJ 2K7LA 2X4HA 5BPDA 2F4OB 1MJBA 1Y0NA 4E7HA 3PIOF 1SFOJ 3W3CA 1OCPA 4YFKF 2CJJA 3IUOA 3KYLA 1LPQA 3C2GA 3WTVC 4G7HF 2DPDA 4RAGA 1JI8A 2GM4A 1WGXA 2LKSA 2QKMB 3FXOA 4YFNF 4O5VA 4FQGA 2K85A 5IYBJ 5FLXZ 4OMYA 4WXDA 5D8KB 1FOYA 4KIGA 5E1ZB 2D2WA 3HOWJ 1ETQA 1EA3A 2HR3A 2HVSA 3HGYA 3OR2C 3PIPF 3KP7A 5CVVA 2R7WA 4GRIA 3B6AA 4C3IJ 5IOYA 3OL3A 2QWWA 2Y48A 1WH7A 2NRAC 4XKCA 2F4MB 3DLAA 2OPTA 4HAMA 3EDPA 1ONVA 1WRJA 3U1DA 3VODA 4WWCA 1VQLI 4BHPA 3J7ZI 4ZYEA 2W84A 1IAWA 3OR1C 1JGSA 2JN6A 3QWLA 2MGQA 1SEUA 3RI4A 2PEXA 2HFHA 3DEEA 4UVBA 2PLYA 5L3GA 2JA5J 1HQCA 3ABUA 4LOCA 3ERED 2CQKA 4NBQA 4RS8A 2P6TA 4AIDA 4HNVA 1HW2A 3G1LA 2MC4A 1TQIA 1TW2A 4KT5C 4G12A 3M8EA 2IGKA 3QYEA 2OCCH 3MKZA 3CUOA 5ICFA 3ZOBA 1D1CA 3HKZN 2M4KA 2VOOA 5FGMA 4P1WA 2ESNA 4WXCA 2XC7A 1CF7B 2DYRH 3JTHA 3EUAA 3MZ8A 5DD8A 3V42A 3MCZA 4BH9A 1T38A 1TNSA 2IRFG 1WSUA 3WHBA 4KMFA 4BDZA 4MEXF 1DUXC 3HPHA 3HUGB 3KEYA 4I6ZA 4KISA 3TO7A 2MLKA 1XMAA 3CJRB 1YE9A 2ZXJA 3LSHA 3MZHA 1W7PB 2EZLA 2QM3A 3O8GA 2LKXA 1T2KA 4XRMA 4U0WA 5D4RA 3CDIA 4CSWA 3K70C 2VKEA 2CSOA 3IKTA 3BR3A 2OBPA 3S1NJ 3PL8A 3KLNA 1CF7A 3GFIA 3ZMUA 1HLVA 4CCLA 2KMUA 2STWA 1LFBA 1OKRA 1P92A 3KZYA 4A3JJ 5E79C 1Z21A 3Q3SA 2UXNA 1QNTA 1GVJA 2ZNZA 2KT0A 3HUGA 2NNYA 1EJ9A 3LFKA 1IRZA 2IA1A 5E3LA 1T56A 1W7PA 1RIOH 5J40A 1KYZA 1BC7C 3TKYA 3DQVC 2VBYA 1ULYA 3SQNA 3LSMA 4JBAA 1GHCA 5J3LA 3OYFA 5LLQA 3BJAA 1TZLA 2DT6A 5HS9A 4EJTA 1NK3P 2IS1A 1O3SA 1X2NA 2XIGA 5IYCJ 3AFHA 2CG4A 2VPLA 3I58A 4M9ZA 3H0GJ 1LE8B 5L3CA 3MWMA 1H88C 5EEAA 4Y33A 4IHSA 1MMGA 3S2HJ 4BQAA 2DA1A 2ZJ2A 4MGRA 2GQQA 1A6QA 2YX4A 4BL0B 4YIRX 3IKVA 4OINF 3OIQA 2VT3A 2ETHA 3CDHA 4E6KG 5HS8A 4CZCA 2LBFA 2F5VA 4BXUA 1JKOC 4M6YA 4NB5A 1BR2A 4E7ZA 3FMQA 2LYCA 1LE8A 1XGMA 2EV0A 2FBHA 5LHHA 1USSA 4I0AA 1SAXA 2FUG2 1G59A 4X6AJ 4BJ5C 1GXQA 3PO3J 1QGPA 3BJ6A 3SDBA 3HTUA 3HL2A 1VQKI 1V55H 2BBYA 5C4JJ 2DMPA 2KDZA 2LF8A 3PFIA 4I99C 1Z6TA 5FKKA 2O5RA 4AIJA 3OSGA 5F04A 2MABA 4AU7A 4IHVA 1QHGA 4EJOA 5FFXA 3W6JB 2DYSH 2FNAA 3QU3A 3E5QA 4BE0A 2H6BA 2M8EA 3O2PE 1JJ6C 2PI0A 1DU6A 2V1NA 3J7AO 2L2OA 1R58A 3L7WA 5M3FJ 5K5QA 2A5YB 5FLXK 1FMVA 2F4IA 1HCRA 1JE8A 1P6RA 2NS0A 4IL6C 4G9YA 2EV5A 3HOXJ 2NVXJ 1IRGA 1W36D 3OWTA 3BTJA 1T0FC 2KIUA 3LQRA 3OYMA 3E5XA 5ICGA 3F72A 3IHUA 1U0JA 3ZRGA 2GOXB 1BA5A 3S32A 4IJAA 3RKWA 1S8NA 1G3TA 1GXPA 3R6SA 3T8TA 4H0EA 4IX7A 1JT0A 2DOEA 5J4YA 4IQJA 1X4PA 3AG3H 4TV7A 2YS9A 4A0ZA 4C3HJ 4IF4A 4WX9A 3CP8A 2VI6A 3WTXC 5HOOA 2FQ3A 3CF2A 1YTYA 2DODA 4CUGA 2RQPA 3KP6A 2X6YA 2DBBA 4WXHA 1BI3A 4IZZA 2W48A 2AXTC 3FDYA 4D1QA 3DLLF 3GW2A 2R5ZB 4BE2A 4IHXA 4BBSJ 4OU0A 3S16J 3DCFA 2NOJB 4XNFA 2EWNA 2EQRA 1JTYA 1PVEA 4DOZA 4CA0A 2Y31A 3IH4A 1RUNA 3EUHC 2X1EA 2M34A 1PYVA 5LFAA 1Z6RA 2L7FP 1IV6A 1EH8A 2O03A 4IHYA 2VIXA 3Q9SA 1NG6A 3SEZA 2L4AA 2LSOA 2QKLB 2HQNA 4GGGA 2EFNA 2V1XA 3ZMVA 1U3EM 1SVLA 1T33A 5E1XA 2KZGA 2ZJPF 1FZPB 2KIFA 3I4PA 3N05A 1ZGAA 2R5ZA 5DCFA 2XASA 4UB6C 3PQKA 4A3GJ 1STZA 1ETYA 1GDTA 1QVTA 3SYTA 4Q48A 1XGSA 1K6OA 3KYCB 1I6HJ 2DA4A 1VF9A 4GYGA 2KDOA 2ISYA 4ANJA 4I7HA 1QVUA 4IPAA 3I56I 4NC8A 1OCZH 4JYKA 2BY0A 2PN6A 4I98B 1JHFA 3CO6C 1K78B 1FSHA 1G4DA 1Z7LA 4HYEA 3TEDA 2GIVA 4MHGA 3RDIA 1N75A 2X6XA 2GXGA 3OIOA 5M3MJ 2O6GE 1HW1A 3BQYA 2W82A 2LOOA 1MGTA 1HKQA
chains in the Genus database with same CATH topology
3JTGA 1LDKB 4ZZLA 5H20A 4EQQA 1H9GA 3CO7C 1J59A 1F5TA 1R5HA 1C0WA 5FO5A 1K78A 1MJAA 1FBSA 1TTYA 1BI0A 1YS6A 1HSJA 2DO7A 5LEKA 1LNWA 4RGSA 1J7KA 3V7RA 1FT9A 2OQRA 2DQRA 1IZ1A 5E18F 4S05A 3DKWA 1B6AA 1AWCA 3FWEA 4KIFA 4M71A 1R36A 4LK1F 5EEHA 3V7CA 3HRTA 2PMHA 1UHMA 1PDNC 1IN4A 1J9IA 5L3EA 4EM1A 5HS7A 3K1MA 4YG2F 5F1RA 3WTWC 2AS5F 5A2QK 4OIQF 1MDMB 1HSTA 1ZN2A 2IJLA 2BV6A 1KGSA 1LDDA 4UHTA 1IW7F 3RPUA 3O6BB 2A61A 3ULQB 4LK0F 4U88A 3F8FA 5E8IA 2G9WA 4AVPA 4JK1X 3EQLF 1MDMA 2NYXA 3KLOA 3FMRA 3CUQC 4U7DA 2BE5F 4I09A 5LRSA 3V4GA 4L9JA 4LJZF 1KYWA 2E1NA 4P9FA 2HGCA 4CO8A 2D45A 3E6CC 5LGTA 1LEAA 2JTVA 4HF0A 3VB2A 1V4RA 5D6EA 5IT3A 5DYMA 2YX7A 3BPXA 2VBWA 3ZMTA 2P4WA 5DCMB 3GUDA 4XLPF 1KU2A 1FX7A 4PGHA 2P5VA 1FPQA 4XRFA 2FXAA 4FX4A 4IHTA 4FHTA 4L9NA 2WC2A 3H3UA 5J8CA 2VE8A 5FFZA 4RB3C 2FMLA 3FM5A 3R60A 1U2WA 2LKPA 1Z91A 3KFWX 1FYMA 3NRVA 2FE3A 2HEOA 3QU6A 2OZ6A 5L3DA 1OR7A 1FNNA 2CFXA 5AIQA 3ELKA 1ZG5A 1P4AA 4A0XA 1VTNC 1YFHA 5D5VB 4L5JA 1TQPA 2HQRA 3WGIA 3KETA 3RYRA 5JR3A 2XKOA 3TGNA 5LBQA 5ERIA 3BDDA 3QPHA 1B59A 4PGGA 3HYIA 3GEZA 3GFJA 1UB9A 5DDGA 1Z05A 4ENMA 4UUVA 5FD6A 1ZLJA 1O3TA 2MC3A 1DP7P 5HDGA 4PDKA 5LGNA 4B09A 4RGRA 1U78A 1J0RA 2QQBA 3J81Z 1MJ9A 4I0BA 1Q1HA 2QLZA 3M7GA 3IC7A 3C7JA 1RNLA 2PMUA 4ESJA 3GVAA 3HRMA 4ETSA 4HDUA 3ROUA 2DW4A 1G6NA 4YIIA 1BIAA 4G94A 2W25A 5J6XA 1SD6A 1O57A 4ESBA 3WTTC 1SFEA 5D5XB 3WE3A 1UFMA 5ILSA 3RJPA 1IUYA 3LSTA 3S2WA 1XB4A 3LQQA 4N9HA 4UV9A 4FT8A 1FBUA 3SZPA 4ENNA 2HYFA 3KP2A 2FEZA 2QYOA 4CZZA 4B8XA 1S3JA 5JI6A 2MH2A 2L02A 3HSEA 3QOPA 4BYYA 2PBIA 2JZYA 4CHUA 2GA2A 2M45A 4L0YB 1HBXG 2OD5A 3RKYA 2KJBA 5F64A 1KQ8A 1O3QA 4RAZA 4N0BA 4HX8A 3GFLA 3GO5A 5AIPA 3WU0A 2X0LA 1K7AA 1O7LA 5DD4A 3JSPA 2MLGA 4LG0B 2A07F 2VC0A 1MKMA 2P7VB 1ZARA 2GA1A 1F9NA 3EYYA 3SHFA 2K4JA 5HLGA 4KICA 4IVNA 3O3KA 3DEUA 2WTEA 3VOEA 3SXYA 3IRQA 4R8HA 5KVRA 2O61A 3FM3A 1B9MA 3ZP5A 4ESFA 3TQNA 4LG0A 2UXXA 3LAPA 2L01A 3ZQ7A 3LA7A 2HOEA 1SMTA 1SD5A 2F2EA 2IA0A 4WCGA 2DLLA 3DPTA 4LLGF 4A6DA 5CVRA 2D1HA 4P9UA 4RGUA 4M9SA 2TDXA 1XCVA 2BGCA 2DI3A 3L09A 3TDZC 4BNCA 2UZKA 3K0LA 5ICCA 3ECHA 3L9FA 1T0FA 2XRNA 3J81K 1NHAA 3GYHX 4DQ2A 2JPCA 4DNCA 2ADUA 4UV8A 1XMKA 4ZYGA 2XGXA 2DK8A 2EK5A 3QP6A 4HX4A 4MNUA 1KQ9A 4MEYF 5L3FA 2B0LA 1IN6A 1V3FA 2VBZA 5A2QZ 1XSXA 3ML6A 2DPUA 1PP7U 1W5SA 3GXOA 4RGXA 3L00A 5BQTA 3RKXA 1BOAA 1RI7A 3EUHA 4GXOA 3ZPLA 1R7JA 3MQ0A 5CJ9A 2IW5A 5ILVA 1ON2A 3QRFF 2DQLA 4OIOF 3QPTA 4G6QA 2O0YA 1FYLA 3DPLC 3V8LA 2XAJA 2QBYB 3FF5A 1KQ0A 2Y75A 1L3LA 3LA3A 2L4MA 3F23A 4RAYA 3C3WA 4KMUX 4RB2C 4U0VA 2IA2A 4A5MA 3E6DA 2FMYA 3E3VA 2COMA 3IWFA 2XAHA 1JXSA 4Q47A 1B1BA 1QQIA 1H0MA 1RUOA 2QBYA 1HKTA 4M72A 5H6RA 1I27A 4LFUA 4Y17A 1R1VA 3T8RA 3ZMSA 1TW3A 4OIPF 3B02A 1IN8A 3EYIA 4F7ZA 2LF7A 2GXBA 2R3SA 1G3YA 3Q5FA 2D1VA 5HDNA 4Y13A 2VBXA 3WG9A 4KUMA 2EJRA 4EMSA 3N4MA 2CGPA 3IRRA 1ZRDA 2Z33A 3WTUC 1I6XA 4IRIA 2EB7A 4AIKA 4LB6B 2XHKA 6PAXA 3F8NA 3I59B 2QQ9A 3BROA 3GZ5A 4G6DA 4G8XA 1DDNA 5JHUA 4KDPA 4BHCA 2Z99A 2XV4S 1XN7A 2FOKA 4A0YA 3G73A 1R00A 4D0PA 2M30A 1MD0A 1WWXA 1KU7A 1FBQA 1KU9A 3HHHA 3CUQB 2RV8A 3HHGA 3I59A 2R7FA 4KFCA 1IRFA 5IT9K 5FB2A 2GAUA 3P9KA 4LB5A 1EH6A 1U5TC 5J8FA 3WGHA 1J5YA 3DP7A 1BC8C 1I1SA 3K1NA 4ON0A 2RN7A 4CXFA 3M1EA 2Z5UA 5D5WB 2P5LC 1CGPA 4EM2A 3CUQA 1OYIA 4U0YA 2MBFA 1YW7A 3IWZA 1IN7A 1BI1A 1Z9CA 1R1UA 1SMYF 1WKMA 1W7PD 2RC4A 3TOAA 3P9CA 4MQ9F 4XBFA 2F5CA 4KIBA 2ELHA 4LD5A 1LB2A 1A04A 3KP4A 4UVCA 4IRGA 2XAQA 1ODDA 2E7XA 1YYVA 2K02A 4EJUA 1QZYA 1XDUA 3ZN1A 3GF2A 1RZ4A 3I5UA 4MQVA 1P4XA 4QLCU 1SFXA 3FZVA 4P55A 3T1BA 2FSWA 3FX3A 1J75A 1R1TA 5FD5A 2QZ8A 2EV6A 1LJ9A 1EH7A 2P5KA 2JSCA 1TNTA 5BMZA 2RGVA 4HLXA 3QAHA 2PFBA 2A3SA 1FWZA 2W24A 4L0ZB 1HKSA 4N9IA 1W5TA 4L5IA 3TO6A 5D4SA 2V1DA 4KN4X 2DT5A 3E5UA 1DPRA 3HTSB 1O7FA 1XGNA 3OV8A 4HLYA 3KP3A 2E1CA 1YO5C 2A6EF 2NAZA 4I01A 1YG2A 5LEJA 3WTYC 2ZBKA 2VE9A 1X3UA 3ZN0A 4JQFA 4HV6A 1L0OC 2YR2A 2EFQA 3VEPA 3KZZA 2A68F 3V8KA 1BIBA 2UWMA 4PCQA 2W85A 1ZAOA 3I71A 1XDSA 4UNOA 2YSRA 3TDUC 5CYVA 3H92A 2Z3YA 3IL2A 3T0YA 4HF1A 1LDJA 2GWRA 2VN2A 4XLNF 2PQ8A 4KN7X 4AIHA 5K5RA 1LEBA 4HA8A 2ZFWA 1U6GA 1XSVA 5DEQA 2IT0A 4A5NA 1KA8A 3HIFA 4RB1A 2GZWA 2MA3A 4HQMA 4HF2A 2H6CA 5DV5A 4MTDA 1ZRCA 2MH9A 3F3XA 4NHJA 4O6JA 1J2XA 2ZMEA 5JFRA 2KKOA 2HKXA 1ZRFA 2PJPA 2OAZA 2KRFA 2QVOA 3FMSA 1YW8A 3B73A 2M1BA 2XUBA 1QZZA 1I1GA 5K5OA 2YPRA 1R5GA 1R23A 4HOBA 1R22A 2Y0MA 2QENA 1ZG1A 2CWEA 2R7DA 4K2EA 2L54A 1Z1DA 5K1YA 4WK8F 2M5WA 1TBXA 2JRTA 2HS5A 2M87A 4LMYA 2ESHA 3F8MA 2MD5A 4EGZA 4CDGA 2EFPA 4U7BA 3WTZA 2IP2A 2ZNYA 1XCBA 3T5XA 1Y0UA 3RIRA 4LGWA 1FLIA 2IPQX 5E17F 3D0SA 2L3DA 5LHIA 2WWYA 3R0JA 5D5UB 1TQMA 3GFMA 2BEOA 3DV8A 3HSFA 1BJAA 4HZFA 1DPUA 1IXSB 4XSXF 2XVCA 3ISPA 2HTSA 1D8JA 4M6XA 3I54A 4RB0A 4ASNA 1HXDA 2FNPA 4EGYA 2V9VA 3OOPA 1BI2A 2CYYA 2RVCA 1S7OA 4PZJA 1S29A 2HDCA 4L9TA 4UVAA 4EJVA 1U8RA 3KE2A 1F4KA 4HQEA 2QUFA 3JAMZ 5BOXA 2V79A 1ON1A 3I0TA 5ICEA 1EV7A 1ZYRF 3CTAA 3LA2A 1D3YA 2DFIA 1IXCA 2E7WA 2P7CB 4HBLA 2H27A 4EJWA 2BYVE 4L18B 2VONA 4Y15A 3FXQA 2J5PA 1PP8F 2V1UA 5IT9Z 3QP5A 2HYGD 5TJJA 4P96A 3H3ZA 1TLHB 2JPBA 3LAJA 1F1ZA 4CYDA 4S04A 2C6YA 3VFZA 5BS6A 1LQ1A 5LRRA 3HOTA 4ZYDA 5F6FA 3MZYA 4G7OF 3W6KB 5CVJA 3BWGA 4M74A 3RTRA 4OOIA 3BPVA 3J80Z 2EFWA 4NQWA 1YQAA 2EFOA 3V8JA 1G3WA 3HOSA 3BZ6A 3JW4A 1IF1A 1YS7A 4BAYA 1BBYA 1D5VA 4A2UA 4P5OA 4L9VA 2NNNA 5CVIA 3K9TA 2OZUA 5BPIA 1T39A 3SFZA 3HRSA 1BN5A 3LWFA 3CJNA 2Z9OA 2V6CA 5CVUA 3L2CA 4QWQA 2ZKZA 3G3ZA 5D8LB 1T98A 1FC3A 1ZG3A 1JHHA 4HV5A 3GLXA 4ENJA 3GZ6A 1YLFA 2QQAA 1U5TB 4WF2A 2CW0F 4EV0A 4M73A 1FSEA 3Q9VA 4ENKA 1KU3A 3MEXA 4O3MA 5LGUA 2A6HF 1SFUA 2EA4A 5HDKA 4HDVA 3F6OA 4A6EA 1OMIA 1U5TA 2AXLA 5DUKA 3R4KA 4Q4ZF 3KCCA 1QO0D 3FXUA 4GCVA 2VC1A 4ZZDA 5DUIA 4EVIA 3JAMK 1MZBA 2HZTA 3FXRA 3KP5A 3NEUA 1ZREA 5CLSA 4BHBA 3ZMDA 3DXJF 2P6SA 2CO5A 3C1DA 3M9AA 3HSRA 2IVMA 3EETA 4E70A 2ISZA 1OYYA 5LHGA 3K2ZA 2Q2EA 4ZYHA 4CGZA 2F5DA 1XGOA 4KYWA 1W4MA 3K1PA 2XROA 1FOKA 3RYPA 3DFGA 1ZHFA 2W57A 2PG4A 1REPC 1USTA 3PQJA 1B9NA 2XAFA 4M9XA 3RPQA 1QPMA 1P2FA 3F21A 3J80K 3P9IA 2FF4A 3BP8A 4R1HA 4AWXB 1UCRA 2K4BA 3WU1B 5D6FA 4LLNA 2G7UA 2O8XA 3C18A 3F8CA 2YU3A 5KK1A 1D8KA 1WI9A 2RDPA 3KEOA 2ZCWA 3P7NA 2VXZA 3CLOA 4YIFA 1G3SA 5E1WA 2FRHA 2XKPA 2DAOA 3MFKA 3TOBA 1FP1D 3KEQA 2STTA 2XAGA 1AOYA 4FX0A 3TO9A 4G7ZF 4XSZF 3R61A 1FP2A 4UXNA 1YW9A 1E2XA 3E6MA 5HLHA 3I64A 3REOA 1PUEE 2H09A 5JVTA 1ZH5A 3FHZA 2OA4A 4LLLA 1YIOA 1BM9A 5AONA 3DF8A 5TRDA 1Z7UA 1P4WA 3GWZA 3E6BA 1XD7A 1ZLKA 5L3BA 3ZMZA 1OPCA 3COAC 2FBIA 2FA5A 2Q8KA 5HVQC 1E17A 2K86A 3WE2A 3SZTA 3V7SA 2P8TA 3HRUA 3BOQA 4MTEA 4A12A 4IXAA 3U9GA 1IXRC 2VODA 2FBKA 3K69A 5EEGA 3F6VA 1T6SA 2K27A 4Z2YA 3E97A 2VT2A 2OU2A 1LVAA 4CICA 2HKOA 5HLIA 2FU4A 4HW0A 2ACJA 3BY6A 2HTJA 4I2OA 5DCMA 3ABTA 1B4AA 4OMZA 2WV0A 2DK5A 1S6LA 2F5EA 1UHWA 3JSOA 3U2RA 3WODF 3F22A 2RNJA 2HWVA 3ECOA 3F8BA 2G7HA 2LNBA 2ZMEB 2RKHA 2EA2A 1FY7A 2H94A 1WQ2A 1QBJA 3GX4X 2A69F 4KA4A 3NQOA 3R0AA 4YFXF 1H9TA 4GYIA 4IRHA 1S7AA 4I02A 1IN5A 4HX7A 1I5ZA 2F5FA 1O3RA 1SD7A 3D5LA 4AD9A 2LDUA 2KIMA 2DU9A 4OIRF 1K79A 2Q0OA 1SD4A 2OQGA 4Q5SF 3M8FA 2KJCA 5H6QA 3WTSC 3MAJA 5ED4A 1ZGJA 3I53A 3WGGA 3AAFA 5E20A 4EM0B 2DTRA 5ILUA 2VOPA 5E8GA 4GO1A 2J5OA 2ZO4A 1XSDA 3BJOA 1HW5A 4KNYA 4ZH4F 2JT1A 2O3FA 1OYWA 4R79A 1FYKA 3N97A 2K7LA 2X4HA 5BPDA 1MJBA 4YFKF 3WTVC 4G7HF 2DPDA 4YFNF 4O5VA 4OMYA 5FLXZ 4WXDA 5D8KB 4KIGA 5E1ZB 2D2WA 2HR3A 3KP7A 5CVVA 2QWWA 2Y48A 2NRAC 4HAMA 3EDPA 1ONVA 1WRJA 3U1DA 4WWCA 3VODA 4BHPA 4ZYEA 2W84A 1IAWA 1JGSA 3RI4A 2PEXA 2HFHA 4UVBA 2PLYA 5L3GA 1HQCA 3ABUA 3ERED 2CQKA 4RS8A 2P6TA 1HW2A 1TQIA 1TW2A 4KT5C 3M8EA 3CUOA 5ICFA 2VOOA 5FGMA 2ESNA 4WXCA 1CF7B 3JTHA 5DD8A 3MCZA 4BH9A 1T38A 1TNSA 2IRFG 1WSUA 4KMFA 4MEXF 1DUXC 3TO7A 2MLKA 1XMAA 2ZXJA 3MZHA 1W7PB 2QM3A 1T2KA 4U0WA 5D4RA 2CSOA 3IKTA 2OBPA 3KLNA 1CF7A 3GFIA 3ZMUA 2STWA 1OKRA 1P92A 3KZYA 2UXNA 1QNTA 1GVJA 2ZNZA 3HUGA 2NNYA 3LFKA 2IA1A 1W7PA 1RIOH 1KYZA 1BC7C 3TKYA 3DQVC 2VBYA 1ULYA 3SQNA 4JBAA 1GHCA 5LLQA 3BJAA 5HS9A 4EJTA 1O3SA 2XIGA 2CG4A 3I58A 4M9ZA 5L3CA 3MWMA 4IHSA 4BQAA 2ZJ2A 4MGRA 2GQQA 2YX4A 3IKVA 4OINF 2VT3A 2ETHA 3CDHA 5HS8A 4BXUA 4M6YA 4NB5A 3FMQA 1XGMA 2EV0A 2FBHA 5LHHA 1USSA 4I0AA 1SAXA 1GXQA 1QGPA 3BJ6A 3HTUA 2BBYA 2LF8A 3PFIA 1Z6TA 4AIJA 4EJOA 5FFXA 3W6JB 2FNAA 3QU3A 3E5QA 2H6BA 2M8EA 3O2PE 2PI0A 3J7AO 1R58A 3L7WA 5K5QA 2A5YB 5FLXK 1JE8A 1P6RA 2NS0A 4G9YA 2EV5A 1IRGA 3LQRA 2KIUA 3E5XA 5ICGA 3F72A 3IHUA 4IJAA 3RKWA 1S8NA 1G3TA 1GXPA 3R6SA 3T8TA 4H0EA 4TV7A 4A0ZA 4WX9A 4IF4A 3WTXC 5HOOA 2FQ3A 1YTYA 2RQPA 3KP6A 2DBBA 4WXHA 1BI3A 3GW2A 4OU0A 2EWNA 1RUNA 1Z6RA 1EH8A 2O03A 3Q9SA 2L4AA 2LSOA 2HQNA 4GGGA 2EFNA 2V1XA 3ZMVA 1U3EM 5E1XA 1FZPB 2KIFA 3I4PA 1ZGAA 5DCFA 2XASA 3PQKA 1STZA 4Q48A 1XGSA 1K6OA 4GYGA 2ISYA 4I7HA 4IPAA 2PN6A 4I98B 1JHFA 3CO6C 1K78B 1FSHA 1G4DA 4HYEA 2GIVA 4MHGA 3RDIA 2GXGA 2O6GE 1HW1A 1MGTA 1HKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTG A;  1LDK B;  4ZZL A;  5H20 A;  4EQQ A;  1H9G A;  3CO7 C;  1J59 A;  1F5T A;  1R5H A;  1C0W A;  5FO5 A;  1K78 A;  1MJA A;  1FBS A;  1TTY A;  1BI0 A;  1YS6 A;  1HSJ A;  2DO7 A;  5LEK A;  1LNW A;  4RGS A;  1J7K A;  3V7R A;  1FT9 A;  2OQR A;  2DQR A;  1IZ1 A;  5E18 F;  4S05 A;  3DKW A;  1B6A A;  1AWC A;  3FWE A;  4KIF A;  4M71 A;  1R36 A;  4LK1 F;  5EEH A;  3V7C A;  3HRT A;  2PMH A;  1UHM A;  1PDN C;  1IN4 A;  1J9I A;  5L3E A;  4EM1 A;  5HS7 A;  3K1M A;  4YG2 F;  5F1R A;  3WTW C;  2AS5 F;  5A2Q K;  4OIQ F;  1MDM B;  1HST A;  1ZN2 A;  2IJL A;  2BV6 A;  1KGS A;  1LDD A;  4UHT A;  1IW7 F;  3RPU A;  3O6B B;  2A61 A;  3ULQ B;  4LK0 F;  4U88 A;  3F8F A;  5E8I A;  2G9W A;  4AVP A;  4JK1 X;  3EQL F;  1MDM A;  2NYX A;  3KLO A;  3FMR A;  3CUQ C;  4U7D A;  2BE5 F;  4I09 A;  5LRS A;  3V4G A;  4L9J A;  4LJZ F;  1KYW A;  2E1N A;  4P9F A;  2HGC A;  4CO8 A;  2D45 A;  3E6C C;  5LGT A;  1LEA A;  2JTV A;  4HF0 A;  3VB2 A;  1V4R A;  5D6E A;  5IT3 A;  5DYM A;  2YX7 A;  3BPX A;  2VBW A;  3ZMT A;  2P4W A;  5DCM B;  3GUD A;  4XLP F;  1KU2 A;  1FX7 A;  4PGH A;  2P5V A;  1FPQ A;  4XRF A;  2FXA A;  4FX4 A;  4IHT A;  4FHT A;  4L9N A;  2WC2 A;  3H3U A;  5J8C A;  2VE8 A;  5FFZ A;  4RB3 C;  2FML A;  3FM5 A;  3R60 A;  1U2W A;  2LKP A;  1Z91 A;  3KFW X;  1FYM A;  3NRV A;  2FE3 A;  2HEO A;  3QU6 A;  2OZ6 A;  5L3D A;  1OR7 A;  1FNN A;  2CFX A;  5AIQ A;  3ELK A;  1ZG5 A;  1P4A A;  4A0X A;  1VTN C;  1YFH A;  5D5V B;  4L5J A;  1TQP A;  2HQR A;  3WGI A;  3KET A;  3RYR A;  5JR3 A;  2XKO A;  3TGN A;  5LBQ A;  5ERI A;  3BDD A;  3QPH A;  1B59 A;  4PGG A;  3HYI A;  3GEZ A;  3GFJ A;  1UB9 A;  5DDG A;  1Z05 A;  4ENM A;  4UUV A;  5FD6 A;  1ZLJ A;  1O3T A;  2MC3 A;  1DP7 P;  5HDG A;  4PDK A;  5LGN A;  4B09 A;  4RGR A;  1U78 A;  1J0R A;  2QQB A;  3J81 Z;  1MJ9 A;  4I0B A;  1Q1H A;  2QLZ A;  3M7G A;  3IC7 A;  3C7J A;  1RNL A;  2PMU A;  4ESJ A;  3GVA A;  3HRM A;  4ETS A;  4HDU A;  3ROU A;  2DW4 A;  1G6N A;  4YII A;  1BIA A;  4G94 A;  2W25 A;  5J6X A;  1SD6 A;  1O57 A;  4ESB A;  3WTT C;  1SFE A;  5D5X B;  3WE3 A;  1UFM A;  5ILS A;  3RJP A;  1IUY A;  3LST A;  3S2W A;  1XB4 A;  3LQQ A;  4N9H A;  4UV9 A;  4FT8 A;  1FBU A;  3SZP A;  4ENN A;  2HYF A;  3KP2 A;  2FEZ A;  2QYO A;  4CZZ A;  4B8X A;  1S3J A;  5JI6 A;  2MH2 A;  2L02 A;  3HSE A;  3QOP A;  4BYY A;  2PBI A;  2JZY A;  4CHU A;  2GA2 A;  2M45 A;  4L0Y B;  1HBX G;  2OD5 A;  3RKY A;  2KJB A;  5F64 A;  1KQ8 A;  1O3Q A;  4RAZ A;  4N0B A;  4HX8 A;  3GFL A;  3GO5 A;  5AIP A;  3WU0 A;  2X0L A;  1K7A A;  1O7L A;  5DD4 A;  3JSP A;  2MLG A;  4LG0 B;  2A07 F;  2VC0 A;  1MKM A;  2P7V B;  1ZAR A;  2GA1 A;  1F9N A;  3EYY A;  3SHF A;  2K4J A;  5HLG A;  4KIC A;  4IVN A;  3O3K A;  3DEU A;  2WTE A;  3VOE A;  3SXY A;  3IRQ A;  4R8H A;  5KVR A;  2O61 A;  3FM3 A;  1B9M A;  3ZP5 A;  4ESF A;  3TQN A;  4LG0 A;  2UXX A;  3LAP A;  2L01 A;  3ZQ7 A;  3LA7 A;  2HOE A;  1SMT A;  1SD5 A;  2F2E A;  2IA0 A;  4WCG A;  2DLL A;  3DPT A;  4LLG F;  4A6D A;  5CVR A;  2D1H A;  4P9U A;  4RGU A;  4M9S A;  2TDX A;  1XCV A;  2BGC A;  2DI3 A;  3L09 A;  3TDZ C;  4BNC A;  2UZK A;  3K0L A;  5ICC A;  3ECH A;  3L9F A;  1T0F A;  2XRN A;  3J81 K;  1NHA A;  3GYH X;  4DQ2 A;  2JPC A;  4DNC A;  2ADU A;  4UV8 A;  1XMK A;  4ZYG A;  2XGX A;  2DK8 A;  2EK5 A;  3QP6 A;  4HX4 A;  4MNU A;  1KQ9 A;  4MEY F;  5L3F A;  2B0L A;  1IN6 A;  1V3F A;  2VBZ A;  5A2Q Z;  1XSX A;  3ML6 A;  2DPU A;  1PP7 U;  1W5S A;  3GXO A;  4RGX A;  3L00 A;  5BQT A;  3RKX A;  1BOA A;  1RI7 A;  3EUH A;  4GXO A;  3ZPL A;  1R7J A;  3MQ0 A;  5CJ9 A;  2IW5 A;  5ILV A;  1ON2 A;  3QRF F;  2DQL A;  4OIO F;  3QPT A;  4G6Q A;  2O0Y A;  1FYL A;  3DPL C;  3V8L A;  2XAJ A;  2QBY B;  3FF5 A;  1KQ0 A;  2Y75 A;  1L3L A;  3LA3 A;  2L4M A;  3F23 A;  4RAY A;  3C3W A;  4KMU X;  4RB2 C;  4U0V A;  2IA2 A;  4A5M A;  3E6D A;  2FMY A;  3E3V A;  2COM A;  3IWF A;  2XAH A;  1JXS A;  4Q47 A;  1B1B A;  1QQI A;  1H0M A;  1RUO A;  2QBY A;  1HKT A;  4M72 A;  5H6R A;  1I27 A;  4LFU A;  4Y17 A;  1R1V A;  3T8R A;  3ZMS A;  1TW3 A;  4OIP F;  3B02 A;  1IN8 A;  3EYI A;  4F7Z A;  2LF7 A;  2GXB A;  2R3S A;  1G3Y A;  3Q5F A;  2D1V A;  5HDN A;  4Y13 A;  2VBX A;  3WG9 A;  4KUM A;  2EJR A;  4EMS A;  3N4M A;  2CGP A;  3IRR A;  1ZRD A;  2Z33 A;  3WTU C;  1I6X A;  4IRI A;  2EB7 A;  4AIK A;  4LB6 B;  2XHK A;  6PAX A;  3F8N A;  3I59 B;  2QQ9 A;  3BRO A;  3GZ5 A;  4G6D A;  4G8X A;  1DDN A;  5JHU A;  4KDP A;  4BHC A;  2Z99 A;  2XV4 S;  1XN7 A;  2FOK A;  4A0Y A;  3G73 A;  1R00 A;  4D0P A;  2M30 A;  1MD0 A;  1WWX A;  1KU7 A;  1FBQ A;  1KU9 A;  3HHH A;  3CUQ B;  2RV8 A;  3HHG A;  3I59 A;  2R7F A;  4KFC A;  1IRF A;  5IT9 K;  5FB2 A;  2GAU A;  3P9K A;  4LB5 A;  1EH6 A;  1U5T C;  5J8F A;  3WGH A;  1J5Y A;  3DP7 A;  1BC8 C;  1I1S A;  3K1N A;  4ON0 A;  2RN7 A;  4CXF A;  3M1E A;  2Z5U A;  5D5W B;  2P5L C;  1CGP A;  4EM2 A;  3CUQ A;  1OYI A;  4U0Y A;  2MBF A;  1YW7 A;  3IWZ A;  1IN7 A;  1BI1 A;  1Z9C A;  1R1U A;  1SMY F;  1WKM A;  1W7P D;  2RC4 A;  3TOA A;  3P9C A;  4MQ9 F;  4XBF A;  2F5C A;  4KIB A;  2ELH A;  4LD5 A;  1LB2 A;  1A04 A;  3KP4 A;  4UVC A;  4IRG A;  2XAQ A;  1ODD A;  2E7X A;  1YYV A;  2K02 A;  4EJU A;  1QZY A;  1XDU A;  3ZN1 A;  3GF2 A;  1RZ4 A;  3I5U A;  4MQV A;  1P4X A;  4QLC U;  1SFX A;  3FZV A;  4P55 A;  3T1B A;  2FSW A;  3FX3 A;  1J75 A;  1R1T A;  5FD5 A;  2QZ8 A;  2EV6 A;  1LJ9 A;  1EH7 A;  2P5K A;  2JSC A;  1TNT A;  5BMZ A;  2RGV A;  4HLX A;  3QAH A;  2PFB A;  2A3S A;  1FWZ A;  2W24 A;  4L0Z B;  1HKS A;  4N9I A;  1W5T A;  4L5I A;  3TO6 A;  5D4S A;  2V1D A;  4KN4 X;  2DT5 A;  3E5U A;  1DPR A;  3HTS B;  1O7F A;  1XGN A;  3OV8 A;  4HLY A;  3KP3 A;  2E1C A;  1YO5 C;  2A6E F;  2NAZ A;  4I01 A;  1YG2 A;  5LEJ A;  3WTY C;  2ZBK A;  2VE9 A;  1X3U A;  3ZN0 A;  4JQF A;  4HV6 A;  1L0O C;  2YR2 A;  2EFQ A;  3VEP A;  3KZZ A;  2A68 F;  3V8K A;  1BIB A;  2UWM A;  4PCQ A;  2W85 A;  1ZAO A;  3I71 A;  1XDS A;  4UNO A;  2YSR A;  3TDU C;  5CYV A;  3H92 A;  2Z3Y A;  3IL2 A;  3T0Y A;  4HF1 A;  1LDJ A;  2GWR A;  2VN2 A;  4XLN F;  2PQ8 A;  4KN7 X;  4AIH A;  5K5R A;  1LEB A;  4HA8 A;  2ZFW A;  1U6G A;  1XSV A;  5DEQ A;  2IT0 A;  4A5N A;  1KA8 A;  3HIF A;  4RB1 A;  2GZW A;  2MA3 A;  4HQM A;  4HF2 A;  2H6C A;  5DV5 A;  4MTD A;  1ZRC A;  2MH9 A;  3F3X A;  4NHJ A;  4O6J A;  1J2X A;  2ZME A;  5JFR A;  2KKO A;  2HKX A;  1ZRF A;  2PJP A;  2OAZ A;  2KRF A;  2QVO A;  3FMS A;  1YW8 A;  3B73 A;  2M1B A;  2XUB A;  1QZZ A;  1I1G A;  5K5O A;  2YPR A;  1R5G A;  1R23 A;  4HOB A;  1R22 A;  2Y0M A;  2QEN A;  1ZG1 A;  2CWE A;  2R7D A;  4K2E A;  2L54 A;  1Z1D A;  5K1Y A;  4WK8 F;  2M5W A;  1TBX A;  2JRT A;  2HS5 A;  2M87 A;  4LMY A;  2ESH A;  3F8M A;  2MD5 A;  4EGZ A;  4CDG A;  2EFP A;  4U7B A;  3WTZ A;  2IP2 A;  2ZNY A;  1XCB A;  3T5X A;  1Y0U A;  3RIR A;  4LGW A;  1FLI A;  2IPQ X;  5E17 F;  3D0S A;  2L3D A;  5LHI A;  2WWY A;  3R0J A;  5D5U B;  1TQM A;  3GFM A;  2BEO A;  3DV8 A;  3HSF A;  1BJA A;  4HZF A;  1DPU A;  1IXS B;  4XSX F;  2XVC A;  3ISP A;  2HTS A;  1D8J A;  4M6X A;  3I54 A;  4RB0 A;  4ASN A;  1HXD A;  2FNP A;  4EGY A;  2V9V A;  3OOP A;  1BI2 A;  2CYY A;  2RVC A;  1S7O A;  4PZJ A;  1S29 A;  2HDC A;  4L9T A;  4UVA A;  4EJV A;  1U8R A;  3KE2 A;  1F4K A;  4HQE A;  2QUF A;  3JAM Z;  5BOX A;  2V79 A;  1ON1 A;  3I0T A;  5ICE A;  1EV7 A;  1ZYR F;  3CTA A;  3LA2 A;  1D3Y A;  2DFI A;  1IXC A;  2E7W A;  2P7C B;  4HBL A;  2H27 A;  4EJW A;  2BYV E;  4L18 B;  2VON A;  4Y15 A;  3FXQ A;  2J5P A;  1PP8 F;  2V1U A;  5IT9 Z;  3QP5 A;  2HYG D;  5TJJ A;  4P96 A;  3H3Z A;  1TLH B;  2JPB A;  3LAJ A;  1F1Z A;  4CYD A;  4S04 A;  2C6Y A;  3VFZ A;  5BS6 A;  1LQ1 A;  5LRR A;  3HOT A;  4ZYD A;  5F6F A;  3MZY A;  4G7O F;  3W6K B;  5CVJ A;  3BWG A;  4M74 A;  3RTR A;  4OOI A;  3BPV A;  3J80 Z;  2EFW A;  4NQW A;  1YQA A;  2EFO A;  3V8J A;  1G3W A;  3HOS A;  3BZ6 A;  3JW4 A;  1IF1 A;  1YS7 A;  4BAY A;  1BBY A;  1D5V A;  4A2U A;  4P5O A;  4L9V A;  2NNN A;  5CVI A;  3K9T A;  2OZU A;  5BPI A;  1T39 A;  3SFZ A;  3HRS A;  1BN5 A;  3LWF A;  3CJN A;  2Z9O A;  2V6C A;  5CVU A;  3L2C A;  4QWQ A;  2ZKZ A;  3G3Z A;  5D8L B;  1T98 A;  1FC3 A;  1ZG3 A;  1JHH A;  4HV5 A;  3GLX A;  4ENJ A;  3GZ6 A;  1YLF A;  2QQA A;  1U5T B;  4WF2 A;  2CW0 F;  4EV0 A;  4M73 A;  1FSE A;  3Q9V A;  4ENK A;  1KU3 A;  3MEX A;  4O3M A;  5LGU A;  2A6H F;  1SFU A;  2EA4 A;  5HDK A;  4HDV A;  3F6O A;  4A6E A;  1OMI A;  1U5T A;  2AXL A;  5DUK A;  3R4K A;  4Q4Z F;  3KCC A;  1QO0 D;  3FXU A;  4GCV A;  2VC1 A;  4ZZD A;  5DUI A;  4EVI A;  3JAM K;  1MZB A;  2HZT A;  3FXR A;  3KP5 A;  3NEU A;  1ZRE A;  5CLS A;  4BHB A;  3ZMD A;  3DXJ F;  2P6S A;  2CO5 A;  3C1D A;  3M9A A;  3HSR A;  2IVM A;  3EET A;  4E70 A;  2ISZ A;  1OYY A;  5LHG A;  3K2Z A;  2Q2E A;  4ZYH A;  4CGZ A;  2F5D A;  1XGO A;  4KYW A;  1W4M A;  3K1P A;  2XRO A;  1FOK A;  3RYP A;  3DFG A;  1ZHF A;  2W57 A;  2PG4 A;  1REP C;  1UST A;  3PQJ A;  1B9N A;  2XAF A;  4M9X A;  3RPQ A;  1QPM A;  1P2F A;  3F21 A;  3J80 K;  3P9I A;  2FF4 A;  3BP8 A;  4R1H A;  4AWX B;  1UCR A;  2K4B A;  3WU1 B;  5D6F A;  4LLN A;  2G7U A;  2O8X A;  3C18 A;  3F8C A;  2YU3 A;  5KK1 A;  1D8K A;  1WI9 A;  2RDP A;  3KEO A;  2ZCW A;  3P7N A;  2VXZ A;  3CLO A;  4YIF A;  1G3S A;  5E1W A;  2FRH A;  2XKP A;  2DAO A;  3MFK A;  3TOB A;  1FP1 D;  3KEQ A;  2STT A;  2XAG A;  1AOY A;  4FX0 A;  3TO9 A;  4G7Z F;  4XSZ F;  3R61 A;  1FP2 A;  4UXN A;  1YW9 A;  1E2X A;  3E6M A;  5HLH A;  3I64 A;  3REO A;  1PUE E;  2H09 A;  5JVT A;  1ZH5 A;  3FHZ A;  2OA4 A;  4LLL A;  1YIO A;  1BM9 A;  5AON A;  3DF8 A;  5TRD A;  1Z7U A;  1P4W A;  3GWZ A;  3E6B A;  1XD7 A;  1ZLK A;  5L3B A;  3ZMZ A;  1OPC A;  3COA C;  2FBI A;  2FA5 A;  2Q8K A;  5HVQ C;  1E17 A;  2K86 A;  3WE2 A;  3SZT A;  3V7S A;  2P8T A;  3HRU A;  3BOQ A;  4MTE A;  4A12 A;  4IXA A;  3U9G A;  1IXR C;  2VOD A;  2FBK A;  3K69 A;  5EEG A;  3F6V A;  1T6S A;  2K27 A;  4Z2Y A;  3E97 A;  2VT2 A;  2OU2 A;  1LVA A;  4CIC A;  2HKO A;  5HLI A;  2FU4 A;  4HW0 A;  2ACJ A;  3BY6 A;  2HTJ A;  4I2O A;  5DCM A;  3ABT A;  1B4A A;  4OMZ A;  2WV0 A;  2DK5 A;  1S6L A;  2F5E A;  1UHW A;  3JSO A;  3U2R A;  3WOD F;  3F22 A;  2RNJ A;  2HWV A;  3ECO A;  3F8B A;  2G7H A;  2LNB A;  2ZME B;  2RKH A;  2EA2 A;  1FY7 A;  2H94 A;  1WQ2 A;  1QBJ A;  3GX4 X;  2A69 F;  4KA4 A;  3NQO A;  3R0A A;  4YFX F;  1H9T A;  4GYI A;  4IRH A;  1S7A A;  4I02 A;  1IN5 A;  4HX7 A;  1I5Z A;  2F5F A;  1O3R A;  1SD7 A;  3D5L A;  4AD9 A;  2LDU A;  2KIM A;  2DU9 A;  4OIR F;  1K79 A;  2Q0O A;  1SD4 A;  2OQG A;  4Q5S F;  3M8F A;  2KJC A;  5H6Q A;  3WTS C;  3MAJ A;  5ED4 A;  1ZGJ A;  3I53 A;  3WGG A;  3AAF A;  5E20 A;  4EM0 B;  2DTR A;  5ILU A;  2VOP A;  5E8G A;  4GO1 A;  2J5O A;  2ZO4 A;  1XSD A;  3BJO A;  1HW5 A;  4KNY A;  4ZH4 F;  2JT1 A;  2O3F A;  1OYW A;  4R79 A;  1FYK A;  3N97 A;  2K7L A;  2X4H A;  5BPD A;  1MJB A;  4YFK F;  3WTV C;  4G7H F;  2DPD A;  4YFN F;  4O5V A;  4OMY A;  5FLX Z;  4WXD A;  5D8K B;  4KIG A;  5E1Z B;  2D2W A;  2HR3 A;  3KP7 A;  5CVV A;  2QWW A;  2Y48 A;  2NRA C;  4HAM A;  3EDP A;  1ONV A;  1WRJ A;  3U1D A;  4WWC A;  3VOD A;  4BHP A;  4ZYE A;  2W84 A;  1IAW A;  1JGS A;  3RI4 A;  2PEX A;  2HFH A;  4UVB A;  2PLY A;  5L3G A;  1HQC A;  3ABU A;  3ERE D;  2CQK A;  4RS8 A;  2P6T A;  1HW2 A;  1TQI A;  1TW2 A;  4KT5 C;  3M8E A;  3CUO A;  5ICF A;  2VOO A;  5FGM A;  2ESN A;  4WXC A;  1CF7 B;  3JTH A;  5DD8 A;  3MCZ A;  4BH9 A;  1T38 A;  1TNS A;  2IRF G;  1WSU A;  4KMF A;  4MEX F;  1DUX C;  3TO7 A;  2MLK A;  1XMA A;  2ZXJ A;  3MZH A;  1W7P B;  2QM3 A;  1T2K A;  4U0W A;  5D4R A;  2CSO A;  3IKT A;  2OBP A;  3KLN A;  1CF7 A;  3GFI A;  3ZMU A;  2STW A;  1OKR A;  1P92 A;  3KZY A;  2UXN A;  1QNT A;  1GVJ A;  2ZNZ A;  3HUG A;  2NNY A;  3LFK A;  2IA1 A;  1W7P A;  1RIO H;  1KYZ A;  1BC7 C;  3TKY A;  3DQV C;  2VBY A;  1ULY A;  3SQN A;  4JBA A;  1GHC A;  5LLQ A;  3BJA A;  5HS9 A;  4EJT A;  1O3S A;  2XIG A;  2CG4 A;  3I58 A;  4M9Z A;  5L3C A;  3MWM A;  4IHS A;  4BQA A;  2ZJ2 A;  4MGR A;  2GQQ A;  2YX4 A;  3IKV A;  4OIN F;  2VT3 A;  2ETH A;  3CDH A;  5HS8 A;  4BXU A;  4M6Y A;  4NB5 A;  3FMQ A;  1XGM A;  2EV0 A;  2FBH A;  5LHH A;  1USS A;  4I0A A;  1SAX A;  1GXQ A;  1QGP A;  3BJ6 A;  3HTU A;  2BBY A;  2LF8 A;  3PFI A;  1Z6T A;  4AIJ A;  4EJO A;  5FFX A;  3W6J B;  2FNA A;  3QU3 A;  3E5Q A;  2H6B A;  2M8E A;  3O2P E;  2PI0 A;  3J7A O;  1R58 A;  3L7W A;  5K5Q A;  2A5Y B;  5FLX K;  1JE8 A;  1P6R A;  2NS0 A;  4G9Y A;  2EV5 A;  1IRG A;  3LQR A;  2KIU A;  3E5X A;  5ICG A;  3F72 A;  3IHU A;  4IJA A;  3RKW A;  1S8N A;  1G3T A;  1GXP A;  3R6S A;  3T8T A;  4H0E A;  4TV7 A;  4A0Z A;  4WX9 A;  4IF4 A;  3WTX C;  5HOO A;  2FQ3 A;  1YTY A;  2RQP A;  3KP6 A;  2DBB A;  4WXH A;  1BI3 A;  3GW2 A;  4OU0 A;  2EWN A;  1RUN A;  1Z6R A;  1EH8 A;  2O03 A;  3Q9S A;  2L4A A;  2LSO A;  2HQN A;  4GGG A;  2EFN A;  2V1X A;  3ZMV A;  1U3E M;  5E1X A;  1FZP B;  2KIF A;  3I4P A;  1ZGA A;  5DCF A;  2XAS A;  3PQK A;  1STZ A;  4Q48 A;  1XGS A;  1K6O A;  4GYG A;  2ISY A;  4I7H A;  4IPA A;  2PN6 A;  4I98 B;  1JHF A;  3CO6 C;  1K78 B;  1FSH A;  1G4D A;  4HYE A;  2GIV A;  4MHG A;  3RDI A;  2GXG A;  2O6G E;  1HW1 A;  1MGT A;  1HKQ A; 
#chains in the Genus database with same CATH topology
 3JTG A;  3MVP A;  1LDK B;  4ZZL A;  1WJF A;  5H20 A;  3FXJ A;  2OC6 A;  4EQQ A;  1H9G A;  4D5F A;  3CO7 C;  4XOP A;  2B63 J;  1Y39 A;  4XLF A;  4RAF A;  5B66 C;  4W97 A;  1J59 A;  1F5T A;  1R5H A;  1C0W A;  5FO5 A;  1K78 A;  1MJA A;  1PJR A;  1FBS A;  1XC5 A;  2XPU A;  3HXL A;  1TTY A;  1BI0 A;  1YS6 A;  1HSJ A;  2LY2 A;  1BL0 A;  1ZK8 A;  2DO7 A;  3D5R C;  3L2V A;  5LEK A;  2M9H A;  1LNW A;  2CQ7 A;  4RGS A;  2VKD A;  2VL8 A;  1J7K A;  3V7R A;  1FT9 A;  3GTM J;  3DKY A;  5EZH A;  1JUP A;  2OQR A;  5F08 A;  3W2V A;  2DQR A;  1IZ1 A;  5E18 F;  2ZXH A;  4FET A;  1JTX A;  4S05 A;  3DKW A;  2LC2 A;  1B6A A;  2K9L A;  1AWC A;  3E1S A;  1VQ9 I;  3BLY A;  3BQZ A;  3BCB A;  3FWE A;  3BC8 A;  4KIF A;  4M3E A;  4M71 A;  4FTH A;  1R36 A;  4LK1 F;  4CYC B;  2O7O A;  1P9Q C;  3K4L A;  2HDD A;  5EEH A;  4GDF A;  3V7C A;  5GTI C;  4XQF A;  2R7S A;  3HRT A;  1YX5 A;  2EIK H;  2PMH A;  1UHM A;  4XN3 A;  1PDN C;  4BBR J;  1IN4 A;  1HF0 A;  1J9I A;  1MBF A;  2KP6 A;  5L3E A;  4EM1 A;  5HS7 A;  3K1M A;  4YG2 F;  5F1R A;  5FJ8 J;  2K9M A;  3WTW C;  2AS5 F;  3DTK A;  5A2Q K;  4OIQ F;  1MDM B;  1HST A;  3P5J A;  1Z67 A;  1ZN2 A;  2IJL A;  2BV6 A;  2E71 A;  1QPI A;  3MKY B;  1N78 A;  5FKM A;  3MD2 A;  1IRX A;  1KGS A;  2DA3 A;  4CYC A;  1LDD A;  4UHT A;  1IW7 F;  3RPU A;  3O6B B;  2A61 A;  3ULQ B;  4LK0 F;  4U88 A;  3F8F A;  3PM1 A;  5GP9 A;  4U87 A;  5E8I A;  4QTR A;  1JKR C;  2G9W A;  4AVP A;  3JRE A;  2KPM A;  5IP7 J;  2KIS A;  4JK1 X;  1HDD C;  3CCE I;  3EQL F;  5K7H A;  1MDM A;  3CMM A;  1DQU A;  2NYX A;  3KLO A;  2DA5 A;  3FMR A;  2VKH A;  3CUQ C;  4IQ4 A;  1WH5 A;  4U7D A;  2BE5 F;  1SAU A;  1K6Y A;  5GAE J;  4I09 A;  3IP4 B;  5LRS A;  3V4G A;  4L9J A;  4LJZ F;  4RMN A;  4XKW A;  1KYW A;  2ME6 A;  2E1N A;  3GZN B;  1ORK A;  1MW7 A;  4P9F A;  1I3Q J;  2HGC A;  4CO8 A;  2JMW A;  1MNM C;  2GLO A;  4XL9 A;  1WVR A;  2DFF A;  3PSI A;  2D45 A;  2HPM A;  2M7B A;  3LOC A;  3E6C C;  3CES A;  5LGT A;  3ABL H;  1LEA A;  2JTV A;  4HF0 A;  3VB2 A;  1V4R A;  2X9D A;  2WAE A;  2MD0 A;  5D6E A;  5IT3 A;  1E0E A;  2V9P A;  5DYM A;  2YX7 A;  3BPX A;  2VBW A;  3ZMT A;  2P4W A;  5DCM B;  3GUD A;  4XLP F;  4LIU A;  2R93 J;  3CZ6 A;  2FX0 A;  1KU2 A;  1VQ6 I;  1FX7 A;  1RR7 A;  3RQI A;  4XID A;  4PGH A;  2P5V A;  3W2W A;  1FPQ A;  2LTP A;  1K61 A;  2L7K A;  2EH3 A;  4FCY A;  4XRF A;  4BY7 J;  2FXA A;  1ZQ3 P;  4FX4 A;  1WHU A;  2HQA A;  2WB1 A;  4IHT A;  4FHT A;  4L9N A;  3IH2 A;  2WC2 A;  3H3U A;  3H36 A;  5J8C A;  2VE8 A;  3H5N A;  5FFZ A;  4RB3 C;  3ZGK A;  5J47 A;  2FML A;  3FM5 A;  3GTJ J;  3R60 A;  1U2W A;  5M5Y J;  2LKP A;  3ASO H;  1Z91 A;  3BR2 A;  3KFW X;  5M5W J;  3NRV A;  1FYM A;  1V5F A;  2FE3 A;  1PUF B;  4DYR A;  2HEO A;  3QU6 A;  2OZ6 A;  5L3D A;  4E7S A;  1OR7 A;  1FNN A;  2CFX A;  1GT0 C;  5AIQ A;  2UUZ A;  3ELK A;  3CCV I;  1ZG5 A;  1P4A A;  4RLQ A;  4A0X A;  4DBQ A;  1VTN C;  4IO9 F;  1YFH A;  5D5V B;  5DM6 F;  4L5J A;  1TQP A;  2HQR A;  3WGI A;  4QPO A;  3KET A;  3RYR A;  5JR3 A;  2XKO A;  1DGW Y;  4AM3 A;  2HU9 A;  3TGN A;  5LBQ A;  5ERI A;  3BDD A;  2CQN A;  4XLH A;  1PUF A;  1X19 A;  4BDY A;  4BUP A;  3QPH A;  4E4H A;  3ZQF A;  1B59 A;  4UUT A;  4DIQ A;  4PGG A;  1MSE C;  2IS4 A;  2IGO A;  1VND A;  3HYI A;  4Y52 J;  3GEZ A;  2QGU A;  3GFJ A;  1UB9 A;  5DDG A;  1Z05 A;  4ENM A;  4UUV A;  5FD6 A;  2EZK A;  1ZLJ A;  1UEL B;  3S3N A;  1O3T A;  2MC3 A;  2ZC2 A;  2CUZ A;  4A3B J;  4D7N A;  5GAH J;  3PSF A;  2EBI A;  3TL4 X;  1Y8R B;  5J4V A;  1DP7 P;  1VQO I;  5HDG A;  5E3O A;  1TC3 C;  3K10 A;  4PDK A;  5LGN A;  4B09 A;  1RKT A;  2JSP A;  5J1R A;  4XON A;  4PJ0 C;  3W2A A;  4RGR A;  3SFI A;  3OS1 A;  2LRD A;  5EDN A;  2I5U A;  5FRO A;  1U78 A;  1J0R A;  2KZV A;  2QQB A;  3J81 Z;  1MJ9 A;  3I55 I;  2Y69 H;  3FHN A;  3CCS I;  4I0B A;  3NWS A;  1Q1H A;  1FEX A;  1X3W B;  3EUK L;  1QRY A;  4BU2 A;  5GPA A;  2QLZ A;  1Q1V A;  4CCJ A;  3DKX A;  3K2A A;  3RZD J;  3AL0 C;  3M7G A;  2M0C A;  3QYB A;  3IC7 A;  3C7J A;  3H9Q A;  2BY2 A;  1RNL A;  4C30 A;  2PMU A;  4UB8 C;  1FIA A;  4KIT B;  1A36 A;  4ESJ A;  3G6E I;  3GVA A;  1RRJ A;  3HRM A;  4ETS A;  4QPQ A;  4HDU A;  3ROU A;  2DW4 A;  1G6N A;  2PMZ N;  2X6O A;  2CV0 A;  5FRM A;  4YII A;  1BIA A;  1X1C A;  4G94 A;  1XPX A;  2W25 A;  5J6X A;  4LIV A;  1SD6 A;  1O57 A;  4ESB A;  3WTT C;  1SFE A;  5D5X B;  2K9N A;  2QF7 A;  4IOA F;  3UNG C;  3WE3 A;  2LY1 A;  1UFM A;  1TWF J;  4Y3O A;  5ILS A;  4CH7 A;  4IOC F;  3S15 J;  1IUF A;  3RJP A;  1IUY A;  3LST A;  3S2W A;  3U1K A;  3DPU A;  1SAN A;  1XB4 A;  2K9Q A;  2OCE A;  3LQQ A;  2PMZ A;  1YIJ I;  2DTZ A;  4N9H A;  4UV9 A;  2DDA A;  2VQH A;  2QSF X;  4FT8 A;  5KNL A;  1FBU A;  3SZP A;  4A3E J;  4ENN A;  2HVQ A;  1VQ4 I;  5FKO A;  1MND A;  2HYF A;  3S17 J;  3D5S C;  2ZME C;  3S1R J;  2MG4 A;  3KP2 A;  4XM3 A;  3CC2 I;  2FEZ A;  1LFP A;  2DA2 A;  3GTO J;  3BG7 A;  5B1B H;  2QYO A;  1WI3 A;  2L9R A;  4CZZ A;  5F0H A;  4G6T B;  1S3J A;  4B8X A;  5JI6 A;  1WJ5 A;  2MH2 A;  2EIM H;  3JRI A;  3A1Y A;  2L02 A;  3HSE A;  3QOP A;  3CLQ A;  4BYY A;  1ETK A;  2PBI A;  2FJ1 A;  1Z0X A;  3S1M J;  2JZY A;  3ZCO A;  4CHU A;  2GA2 A;  3SEQ A;  2M45 A;  1W36 C;  2OF7 A;  3VSL A;  3LNQ A;  3RPU D;  4L0Y B;  1HBX G;  2OD5 A;  3QOE A;  4FE4 A;  1A5J A;  3DWL E;  3OSF A;  3QPL A;  3G1M A;  2WBM A;  3RKY A;  2KJB A;  2E2I J;  5F64 A;  1KQ8 A;  4A93 J;  2LFB A;  2P81 A;  1O3Q A;  4RAZ A;  4N0B A;  1LUJ B;  3S14 J;  4HX8 A;  3GFL A;  3GO5 A;  5AIP A;  3GCM A;  2KQR A;  2H1L A;  3WU0 A;  2X0L A;  3OL4 A;  2R7U A;  1K7A A;  4XLA A;  5HOD A;  1O7L A;  5DD4 A;  2IS6 A;  1MIJ A;  2MLG A;  2IXS A;  3JSP A;  4LG0 B;  2A07 F;  4JOM A;  2VC0 A;  1MKM A;  2P7V B;  2Y9Y A;  1ZAR A;  2GA1 A;  3OYG A;  3S2D J;  1YHQ I;  1F9N A;  3EYY A;  3SHF A;  2K4J A;  1JJ8 C;  5HLG A;  4KIC A;  3SDG A;  3HBL A;  2R0Q C;  4ZYA A;  2UV1 A;  4IVN A;  4EAT A;  1MBH A;  3O3K A;  3DEU A;  2WTE A;  3VOE A;  1DU0 A;  3LFU A;  3SXY A;  4R8H A;  3IRQ A;  2LMD A;  4F3Q A;  5KVR A;  2O61 A;  1FMW A;  3FM3 A;  1B9M A;  3ZP5 A;  4ESF A;  3TQN A;  1X1D A;  3CP2 A;  1OQY A;  3PNY A;  1X1A A;  4C9Y A;  4LG0 A;  2UXX A;  4IEJ A;  3VYS B;  3LAP A;  2L01 A;  3ZQ7 A;  1N77 A;  3LA7 A;  1OFC X;  2VJ4 A;  2ELJ A;  1VQM I;  2V26 A;  2HOE A;  3CCU I;  1SMT A;  1SD5 A;  1SVO A;  1R49 A;  2F2E A;  2IA0 A;  2XDV A;  4B44 A;  4WCG A;  2DLL A;  1IDY A;  3DPT A;  3BG6 A;  4LLG F;  2LBF B;  4QIW N;  1QU3 A;  2BHZ A;  4A6D A;  5CVR A;  2D1H A;  1X2M A;  2Y2Z A;  4P9U A;  3SJM A;  2GBY A;  4RGU A;  3HOY J;  1MH3 A;  2VQG A;  4M9S A;  2TDX A;  1XCV A;  2BGC A;  2DI3 A;  3L09 A;  3TDZ C;  2FD5 A;  4A3L J;  3JR9 A;  4BNC A;  2UZK A;  2VQL A;  3K0L A;  5ICC A;  3ECH A;  4A3C J;  3Q0U A;  3QYF A;  1GUU A;  3L9F A;  3TW6 A;  2JWT A;  5BNG A;  1T0F A;  2LVS A;  2XRN A;  3J81 K;  1JKP C;  2W4S A;  1NHA A;  3GYH X;  1IO2 A;  4DQ2 A;  1POG A;  4HG2 A;  3HOU J;  1BW6 A;  3OMY A;  2DMT A;  4V2G A;  2FOW A;  1MMA A;  1FTT A;  2JPC A;  4DNC A;  3TP3 A;  2ADU A;  1JGG A;  4UV8 A;  1VZ0 A;  1XMK A;  2NVQ J;  3PO2 J;  4M3B A;  5CKT A;  2RRE A;  4ZYG A;  2XGX A;  1BOB A;  1WFX A;  2NS8 A;  2DK8 A;  2EK5 A;  3MKL A;  1K4T A;  1U9O A;  3QP6 A;  4HX4 A;  1R4N B;  3FKJ A;  4B4C A;  2BHY A;  1YRN B;  4MNU A;  2HDW A;  3RKQ A;  1KQ9 A;  4MEY F;  5L3F A;  1H89 C;  1SVM A;  2B0L A;  3GTK J;  1IN6 A;  5TIS C;  1V3F A;  2VLA A;  3GTP J;  2VBZ A;  5A2Q Z;  2H8R A;  1TWH J;  1XSX A;  2LG4 A;  3ML6 A;  5HNH A;  2ECC A;  2DPU A;  1PP7 U;  1W5S A;  3GXO A;  4RGX A;  3L00 A;  3OYA A;  3CC7 I;  4BXX J;  5BQT A;  3RKX A;  2VJ5 A;  1BOA A;  1RI7 A;  3CJT B;  3EUH A;  2M0M A;  4GXO A;  4PUS A;  3ZPL A;  1AA7 A;  4ZDO A;  3OYH A;  1R7J A;  2BZT A;  2B7E A;  1TWC J;  2AQF A;  3MQ0 A;  4XKV A;  5CJ9 A;  4YRV A;  5K7Z A;  1GV5 A;  2IW5 A;  5ILV A;  1JT6 A;  1ON2 A;  1YX3 A;  2L9V A;  4RBO A;  4HNU A;  3QRF F;  2DQL A;  4IHW A;  2BVM A;  1VQN I;  2OUM A;  2BXY A;  1YRN A;  4OIO F;  3QPT A;  4G6Q A;  2O0Y A;  1FYL A;  2JUC A;  3DPL C;  3V8L A;  2XAJ A;  4B48 A;  2QBY B;  3FF5 A;  2CV2 A;  2MW8 A;  1WZ2 A;  1KQ0 A;  2Y75 A;  2NVY J;  1L3L A;  3LA3 A;  1W5C C;  2L4M A;  4PJL A;  3F23 A;  4RAY A;  2HQ5 A;  2ICW G;  3C3W A;  5GPC A;  2XB0 X;  2EZH A;  3A0B C;  3FIS A;  4KMU X;  1LFU P;  4RB2 C;  2EIN H;  2IA2 A;  2X85 A;  3E6D A;  4I76 A;  1S9H A;  4U0V A;  4A5M A;  1YJ9 I;  2FMY A;  3E3V A;  2EIJ H;  4CCK A;  3FKI J;  2COM A;  2Y9Z A;  3IWF A;  3VPR A;  3S8P A;  2XAH A;  1JXS A;  3H0D A;  4Q47 A;  1TWG J;  2E60 A;  1B1B A;  5B5E C;  1QQI A;  1H0M A;  1RUO A;  2QBY A;  1HKT A;  4M72 A;  4AVZ A;  3ASN H;  5H6R A;  1I27 A;  4LFU A;  4Y17 A;  1R1V A;  3AG4 H;  3T8R A;  3ZMS A;  1TW3 A;  3FXM A;  4N4O B;  3B02 A;  4OIP F;  4RM3 A;  3WU2 C;  1IN8 A;  3EYI A;  2KLO A;  3GBG A;  3HDD A;  5TGT A;  1OCR H;  4F7Z A;  2LF7 A;  2GXB A;  2R3S A;  1G3Y A;  3Q5F A;  2D1V A;  5HDN A;  5LD2 C;  4Y13 A;  2VBX A;  3WG9 A;  4KUM A;  2EJR A;  2E5Z A;  3RSN A;  1T95 A;  2QSH X;  2E1M C;  2M8G X;  4EMS A;  3IRR A;  3N4M A;  1ZRD A;  2CGP A;  2L0K A;  1XX5 A;  3ONQ A;  2Z33 A;  3WTU C;  4GFB A;  1I6X A;  4V19 K;  4NDL A;  4IRI A;  2EB7 A;  2VJJ A;  4AIK A;  1Y1V J;  2NOG A;  4LB6 B;  3CMA I;  4BY1 J;  2XHK A;  1FTZ A;  3HB9 A;  3IH3 A;  6PAX A;  1G2H A;  3MKW B;  4ZJZ A;  3F8N A;  2O8K A;  3S93 A;  3I59 B;  2QQ9 A;  3BRO A;  3GZ5 A;  1S72 I;  4G6D A;  3BTL A;  2V6E A;  4G8X A;  1DDN A;  3QPS A;  5JHU A;  2YUS A;  2MSY A;  4BHC A;  3UR3 C;  4KDP A;  2QCO A;  1D0Y A;  2Z99 A;  2XV4 S;  1XN7 A;  1P7I A;  2FOK A;  4A0Y A;  4PJN A;  5C3E J;  1S5L C;  2K5C A;  4DZJ A;  4XK4 A;  3G73 A;  1R00 A;  4D0P A;  1R6R A;  2M30 A;  1MD0 A;  1WWX A;  2LR8 A;  1KU7 A;  1FBQ A;  1KU9 A;  3HHH A;  3CUQ B;  5F27 A;  2RV8 A;  3HHG A;  3I59 A;  2XF7 A;  5B1A H;  2L7M P;  2R7F A;  4MO7 A;  2P0W A;  4KFC A;  3DU5 A;  1UZC A;  1IRF A;  3M4O J;  2NVU B;  5IT9 K;  5FB2 A;  2GAU A;  2BOL A;  3P9K A;  4LB5 A;  1EH6 A;  3OYK A;  2CMP A;  1U5T C;  4OAY A;  5J8F A;  3CD6 I;  2CFO A;  3WGH A;  3HEF A;  1J5Y A;  5E3M A;  3DP7 A;  1BC8 C;  1I1S A;  3K1N A;  4ON0 A;  2RN7 A;  4CXF A;  3M1E A;  1MBG A;  2Z5U A;  5D5W B;  2P5L C;  1CGP A;  4EM2 A;  4C2U A;  1R4M B;  3CUQ A;  1OYI A;  4PFO A;  4U0Y A;  2MBF A;  3JRB A;  1YW7 A;  5FRN A;  3IWZ A;  1IN7 A;  1BI1 A;  1Z9C A;  1R1U A;  1JKQ C;  1Y6I A;  1SMY F;  1WKM A;  2DT7 B;  1W7P D;  2RC4 A;  3ZQH A;  2XF6 A;  3TOA A;  2DOF A;  3CDL A;  1T08 B;  3P9C A;  4MQ9 F;  4BQO A;  3JRC A;  4XBF A;  2F5C A;  4KIB A;  2ELH A;  4LD5 A;  1LB2 A;  5EG0 B;  1A04 A;  1MMN A;  4D9J A;  4ZC3 A;  3KX2 A;  3KP4 A;  3I4M J;  1WJD A;  2XB5 A;  1OLT A;  4UVC A;  3A01 B;  4IRG A;  5IPA A;  2XAQ A;  1ODD A;  2E7X A;  1U9N A;  2KL4 A;  4ZTJ A;  1HC8 A;  1YYV A;  2K02 A;  4EJU A;  2QA4 I;  1UJ8 A;  1QZY A;  1ERD A;  5CQG A;  3OYJ A;  1XDU A;  3AG1 H;  3ZN1 A;  3GF2 A;  1RZ4 A;  3I5U A;  4ITV A;  4MQV A;  3LSR A;  1P4X A;  4QLC U;  1SFX A;  3FZV A;  4P55 A;  3T1B A;  2FSW A;  5EG0 A;  2VXD A;  2X51 A;  3FX3 A;  3FXL A;  1J75 A;  2R92 J;  2F48 A;  1W0U A;  2YU9 J;  5FLM J;  1R1T A;  1K83 J;  2K40 A;  2V9K A;  5FD5 A;  2Z2S B;  2DJN A;  1R71 A;  4QSH A;  2QZ8 A;  3A01 A;  2EV6 A;  2RNG A;  1LJ9 A;  4E7K A;  1T8I A;  1EH7 A;  3A4C A;  4DYQ A;  2P5K A;  2JSC A;  3CME I;  3DTE A;  2WAD A;  1SC7 A;  3OOU A;  4ZTF A;  1TNT A;  5BMZ A;  5HLT A;  2RGV A;  1R9T J;  2DFE A;  4HLX A;  5FKN A;  1BR1 A;  1YI2 I;  3QAH A;  3EPZ A;  2PFB A;  5H2F C;  2R4G A;  2A3S A;  2PX9 A;  1FWZ A;  3TP0 A;  2WB1 N;  2W24 A;  2E35 A;  1OCT C;  4L0Z B;  2MYS A;  1M1E B;  2Q1Z B;  2M4G A;  1HKS A;  4N9I A;  4D7M A;  2DJI A;  1W5T A;  2WY7 Q;  4L5I A;  3TO6 A;  1YJW I;  1XTA A;  2BY3 A;  2E5N A;  2Z16 A;  5D4S A;  2V1D A;  1JUS A;  4KN4 X;  2DT5 A;  3VYT B;  3LMM A;  4B47 A;  3E5U A;  1DPR A;  3HTS B;  2FQ4 A;  1O7F A;  1XGN A;  3HC7 A;  3OV8 A;  4HLY A;  3CF5 F;  3KP3 A;  3AL0 B;  5FLV A;  2E1C A;  4DYC A;  2CRG A;  3H3V K;  4RM2 A;  5FKL A;  3LL7 A;  3OYC A;  1TT0 A;  3ZQC A;  1YO5 C;  4V2F A;  2X1C A;  4F52 A;  2M7A A;  2A6E F;  2NAZ A;  4I01 A;  1YG2 A;  3WHC A;  4D5C A;  5LEJ A;  3WTY C;  1APL C;  2ZBK A;  2VE9 A;  1X3U A;  3ZN0 A;  4JQF A;  2WY8 Q;  4F91 B;  3BR0 A;  3Q0W A;  4HV6 A;  1XG1 A;  2JRM A;  1L0O C;  2YR2 A;  3GTQ J;  2EFQ A;  3FIW A;  3VEP A;  4A69 C;  2CV1 A;  2LH9 A;  3KZZ A;  1FOW A;  2A68 F;  3ERM A;  3G1O A;  3V8K A;  4NC7 A;  3ZR8 X;  4BXF A;  1BIB A;  2UWM A;  4ZDL A;  4PCQ A;  2W85 A;  1ZAO A;  3I71 A;  1XDS A;  2HOT A;  4UNO A;  3H5R A;  1J09 A;  2YSR A;  3TDU C;  3J7Y J;  5CYV A;  3H92 A;  2Z3Y A;  3IL2 A;  4XIC A;  3BCA A;  3T0Y A;  2BVL A;  4HF1 A;  1LDJ A;  3OYI A;  3RZO J;  1A35 A;  2GWR A;  2VN2 A;  1UAA A;  5C44 J;  4HRI A;  4CCO A;  3BR5 A;  5JLX A;  4EEF G;  3E0J B;  4XLN F;  2PQ8 A;  5GAG J;  1AU7 A;  4KN7 X;  4AIH A;  5K5R A;  2CUF A;  1LEB A;  3PNV A;  4HA8 A;  2ZFW A;  1NG7 A;  1U6G A;  1XSV A;  1ZEL A;  5DEQ A;  2IT0 A;  4A5N A;  2R7R A;  1KA8 A;  1KON A;  2XPW A;  3HIF A;  4RB1 A;  2GZW A;  1FJL A;  2MA3 A;  1S7E A;  4HQM A;  4HF2 A;  2H6C A;  3DTI A;  5DV5 A;  3L1P A;  1VQ5 I;  1DGR M;  4MTD A;  2AO9 A;  3AG2 H;  1ZRC A;  2O9L A;  2MH9 A;  3F3X A;  2PJR B;  4NHJ A;  4O6J A;  2Y0S A;  4ABZ A;  2GOM A;  1J2X A;  3HOZ J;  2ZME A;  5JHF A;  5JFR A;  2KKO A;  2HKX A;  1ZRF A;  2JA7 J;  2PJP A;  2OAZ A;  3A02 A;  2WAQ A;  4PK4 A;  2KRF A;  3OYB A;  2ID3 A;  2QVO A;  1MMS A;  3FMS A;  4FAS D;  4RDU A;  1YW8 A;  4HST A;  3JRH A;  4XLE A;  3B73 A;  2BXZ A;  5CPR B;  2M1B A;  2DXI A;  2PJR A;  2XUB A;  1QZZ A;  1I1G A;  5EJC A;  5K5O A;  2YPR A;  2VB6 A;  1R5G A;  1R23 A;  2R7Q A;  4HOB A;  4PSW A;  4MIM A;  3HM5 A;  5GTH C;  1X1B A;  1B72 B;  1R22 A;  3B6C A;  1EKE A;  2Y0M A;  2QEN A;  1ETV A;  1ZG1 A;  4C3J J;  4HNT A;  2CWE A;  2R7D A;  4K2E A;  3K4B A;  5B3S H;  4Y4R A;  2L54 A;  1Z1D A;  3GTL J;  5K1Y A;  3HGG A;  4BJ6 C;  1ZGW A;  4WK8 F;  2M5W A;  1TBX A;  2JRT A;  4A3D J;  1VFC A;  2HS5 A;  2M87 A;  4LMY A;  3I9V 2;  3RCO A;  2ESH A;  3F8M A;  3OY9 A;  2MD5 A;  4EGZ A;  4CDG A;  2EFP A;  4U7B A;  4XOR A;  2E2J J;  3WTZ A;  1B72 A;  2IP2 A;  2ZNY A;  5J1U A;  1XCB A;  3OIP A;  3T5X A;  5KAF C;  3BTC A;  1Y0U A;  2IGN A;  3BT9 A;  3DBR B;  3RIR A;  2L9S A;  4LGW A;  1FLI A;  2IPQ X;  5E17 F;  3OYD A;  3TBI A;  3D0S A;  3PUF A;  2L3D A;  2H8W A;  3HOV J;  5LHI A;  2WWY A;  3K4N A;  3R0J A;  5D5U B;  4FE7 A;  1TQM A;  1O4X A;  2R7T A;  2WV1 A;  2KIQ A;  4W1U A;  3GFM A;  4XOT A;  4BEH B;  2BEO A;  4DGW B;  3DV8 A;  4BAC A;  1VI0 A;  2ZJR F;  3HSF A;  1BJA A;  3PFY A;  4HZF A;  4RA2 A;  1DPU A;  4XMY A;  1IXS B;  5K7F A;  2VUM J;  4BE1 A;  3IV5 A;  2HOA A;  4XSX F;  3BG5 A;  1X3Z B;  2XVC A;  2HTS A;  3ISP A;  1D8J A;  2A05 A;  3FK6 A;  2DA7 A;  4M6X A;  1ETW A;  1Z77 A;  3U21 A;  3I54 A;  2E34 A;  4RB0 A;  4ASN A;  1MSF C;  1HXD A;  2FNP A;  5GAD J;  4EGY A;  1MBE A;  2V9V A;  1N25 A;  4DJA A;  3OOP A;  1BI2 A;  2CYY A;  1IG7 A;  4F92 B;  2RVC A;  4BEH A;  1S7O A;  2ZB9 A;  4PZJ A;  1S29 A;  2M2E A;  2HDC A;  4L9T A;  3FBN B;  4UVA A;  3FBI B;  4F93 B;  4EJV A;  3DU6 A;  4F55 A;  3M1C A;  1U8R A;  2R7O A;  3KE2 A;  1F4K A;  2ZJQ F;  4HQE A;  3ABK H;  2ID6 A;  2QUF A;  3JAM Z;  5BOX A;  2V79 A;  1ON1 A;  3I0T A;  5ICE A;  1EV7 A;  4XRS G;  3K4C A;  1VQ8 I;  4J00 A;  4L5E A;  1ZYR F;  3CTA A;  3LSP A;  3G4S I;  3FK7 A;  3LA2 A;  3S3O A;  2ZSI B;  1D3Y A;  3E7L A;  2DFI A;  3NAR A;  1IXC A;  1RET A;  2V4J C;  3HG9 A;  2E7W A;  1UG2 A;  2P7C B;  3HKZ A;  4HBL A;  2H27 A;  2ECB A;  4EJW A;  2DMU A;  1I50 J;  2BYV E;  1QHH D;  4L18 B;  2XF5 A;  3OS2 A;  4Y15 A;  2VON A;  3KIO A;  3RQ4 A;  1YOV B;  3KPH A;  2L9N A;  3DBL B;  3FXQ A;  2J5P A;  3CJQ B;  1PP8 F;  5F0F A;  2V1U A;  4PFP A;  5IT9 Z;  3QP5 A;  2KHM A;  2HXO A;  2HYG D;  4E7I A;  3OYE A;  3LSG A;  1D1A A;  5TJJ A;  4P96 A;  3H3Z A;  1FIP A;  1TLH B;  2JPB A;  3SZG A;  3LAJ A;  2OTJ I;  4MFE A;  1F1Z A;  1Y1W J;  3L2W A;  3M8J A;  4NQW B;  4CYD A;  4S04 A;  2C6Y A;  3VFZ A;  5BS6 A;  3VYR B;  1LQ1 A;  5LRR A;  2GIZ A;  3H35 A;  4X1E A;  4ZDP A;  4XN0 A;  4AUX A;  3HOT A;  4ZYD A;  5F6F A;  3MZY A;  1AKH B;  3W6K B;  3BTI A;  4G7O F;  1A6I A;  1Y8Q B;  5CVJ A;  3BWG A;  2ME0 A;  4YEJ A;  3CQZ J;  4MFD A;  4C2T A;  4DBR A;  2H1K A;  2NXN B;  3PJR A;  3IAM 2;  4M74 A;  3RTR A;  1WJB A;  4OOI A;  3BPV A;  1B8I B;  9ANT A;  2JVH A;  3J80 Z;  1BJZ A;  3ZQQ A;  1XMX A;  2EFW A;  4JX6 A;  2CH0 A;  4NQW A;  4PJM A;  1YQA A;  4FIS A;  1QA6 A;  4M3D A;  3VWB A;  3GTG J;  2EFO A;  2VJI A;  3V8J A;  3CMY A;  3VDX A;  1G3W A;  4BQN A;  1NK2 P;  3A0H C;  2E1M B;  1AKH A;  3HOS A;  3BZ6 A;  3JW4 A;  2M3A A;  1IF1 A;  1YS7 A;  1NTC A;  4BAY A;  1SFK A;  1BBY A;  3C2B A;  3ZQL A;  1D5V A;  2TCT A;  3K4M A;  4A2U A;  4P5O A;  4L9V A;  1B8I A;  2NNN A;  3HJE A;  5CVI A;  3A03 A;  2B9S A;  1IGN A;  3K9T A;  2VKV A;  2DFH A;  2JA2 A;  2OZU A;  4CCN A;  4A3F J;  5BPI A;  1T39 A;  2CS3 A;  4BQQ A;  2RQQ A;  1R5I D;  3SFZ A;  2XPV A;  2DDB A;  3HRS A;  3G2B A;  3PNT A;  1MH4 A;  4DZP A;  1BN5 A;  3LWF A;  3CJN A;  2IS2 A;  2Z9O A;  2V6C A;  5CVU A;  3L2C A;  4QWQ A;  4A3M J;  2ZKZ A;  3BR1 A;  3G3Z A;  5D8L B;  2F6C A;  3L2R A;  1T98 A;  2IEK A;  3BG9 A;  4BS9 A;  3WG7 H;  3KYD B;  1TWA J;  3L2Q A;  1OIS A;  4LIT A;  1FC3 A;  1ZTR A;  3BZK A;  1ZG3 A;  1JHH A;  4HV5 A;  1WJC A;  3GLX A;  4ENJ A;  3GZ6 A;  5F0C A;  1I3A A;  1YLF A;  2HXI A;  2QQA A;  1U5T B;  4WF2 A;  4Z6Y A;  3H9G A;  1WJE A;  2CW0 F;  1HDP A;  4EV0 A;  4M73 A;  1FSE A;  3Q9V A;  4ENK A;  1X4O A;  2IBD A;  1EF4 A;  2I10 A;  4RLF A;  1KU3 A;  3MEX A;  3CC4 I;  4NC6 A;  4O3M A;  5LGU A;  2A6H F;  3KZI C;  1SFU A;  5IY5 H;  2R7V A;  1HA8 A;  4XR6 A;  3I3L A;  2EA4 A;  1D1B A;  5HDK A;  4HDV A;  3F6O A;  3PUB A;  4E7J A;  5EZG A;  1ZR4 A;  4A6E A;  1OMI A;  1U5T A;  1RKW A;  5CQE A;  2KRC A;  3VSK A;  4JX4 A;  2W7N A;  1TT5 B;  2DMQ A;  3K70 D;  3BG3 A;  2VPR A;  3I4N J;  5JLW A;  2AXL A;  4M3G A;  3X2Q H;  2COB A;  5DUK A;  1XS9 A;  3R4K A;  2Y30 A;  4Q4Z F;  1V54 H;  2XSJ C;  3KCC A;  1QO0 D;  3FXU A;  2R7Z J;  4GCV A;  2Q2E B;  2VC1 A;  3K4K A;  4ZZD A;  2LRE A;  5DUI A;  4EVI A;  3JAM K;  3JRA A;  1MZB A;  2HZT A;  3FXR A;  3KP5 A;  4JP0 A;  2HNH A;  3NEU A;  1V5G A;  3H5A A;  1ZRE A;  5CLS A;  4BHB A;  2JUG A;  4M3F A;  5IYD J;  3ZMD A;  3DXJ F;  2P6S A;  2CO5 A;  3C1D A;  3M9A A;  2CQX A;  3HSR A;  3TMO A;  5C4X J;  1QZE A;  2IVM A;  2XGC A;  4BJT A;  3EET A;  4Y7N J;  1ENH A;  3JCU C;  2E1O A;  2HI3 A;  2IGM A;  4E70 A;  2ISZ A;  2KFD A;  2RAE A;  1OYY A;  1Z3X A;  5LHG A;  3K2Z A;  2HVR A;  4XKB A;  1GVD A;  2Q2E A;  2JA6 J;  4XRS A;  5F1J A;  1WJA A;  1MNE A;  4ZYH A;  4CGZ A;  3K4J A;  5EYR A;  5DTD A;  4NNJ A;  1OCO H;  2F5D A;  4IKF A;  3G71 I;  2W1O A;  1XGO A;  4KYW A;  1W4M A;  3K1P A;  3ZQI A;  2Z1D A;  1Z3Y A;  2XRO A;  1FOK A;  2HZD A;  3RYP A;  3CCM I;  3L2U A;  2W00 A;  3DFG A;  1ZHF A;  1DP3 A;  4YEL A;  3LSK A;  1OCC H;  1IDZ A;  3K7A J;  2W57 A;  2PG4 A;  3CCY A;  2JA8 J;  1U8B A;  2E2H J;  4H4K C;  1REP C;  1X1P A;  4N4N B;  4UY8 I;  1UST A;  3PQJ A;  1B9N A;  2XAF A;  4M9X A;  3FXK A;  2WAF A;  3RPQ A;  2DCE A;  1QPM A;  4BKX A;  3AKZ A;  3CCR I;  1E3H A;  1G8X A;  5KAI C;  2OV7 A;  1P2F A;  3F21 A;  5IOZ A;  1ETX A;  3J80 K;  2BW3 B;  1RR8 C;  2LP0 A;  2DOA A;  3O8H A;  3DBH B;  3DEW A;  3P9I A;  2XSD C;  1GV2 A;  2FF4 A;  4S0H B;  3BP8 A;  3M3Y J;  4R1H A;  2LK2 A;  4AWX B;  1FOX A;  1UCR A;  4PJJ A;  1LVK A;  2JK3 A;  2K4B A;  4DW6 A;  3WU1 B;  1IC8 A;  4B3X A;  2VQC A;  3H1C A;  2DN0 A;  5D6F A;  4E7L A;  2LY9 A;  4LLN A;  1JUM A;  1UMQ A;  1NH3 A;  2G7U A;  2K9S A;  4HSR A;  2HYJ A;  3Q0V A;  2JJ7 A;  2O8X A;  1ITY A;  3C18 A;  1Y56 A;  3F8C A;  3OYN A;  2G0E A;  2BW3 A;  2YU3 A;  1W0T A;  5KK1 A;  3J7A Y;  1F43 A;  1D8K A;  4J19 A;  1WI9 A;  2RDP A;  3KEO A;  2ZCW A;  3LSI A;  3P7N A;  4PSX A;  2VXZ A;  1HOM A;  3CLO A;  3LSJ A;  4YIF A;  1G3S A;  1D5Y A;  5E1W A;  5EGO B;  2CW8 A;  2FRH A;  2XKP A;  1P7J A;  2DAO A;  3MFK A;  3TOB A;  4AC0 A;  1FP1 D;  3F9K A;  3KEQ A;  2NVT J;  2STT A;  2XAG A;  1AOY A;  4NUB A;  4FX0 A;  3TO9 A;  4B43 A;  3NAU A;  5HNF A;  4G7Z F;  3UKG A;  1VQ7 I;  4XSZ F;  3S3M A;  4A3I J;  3R61 A;  1FP2 A;  2EPF A;  4UXN A;  2AHQ A;  1YW9 A;  1I39 A;  4X0G A;  5EGO A;  1E2X A;  3E6M A;  2K3F A;  1MMD A;  5HLH A;  1YIT I;  1AHD P;  1CQT A;  3I64 A;  3REO A;  1ZKG A;  2OJE D;  3HPG A;  2H09 A;  1PUE E;  5JVT A;  4A3K J;  4UUS B;  1ZH5 A;  3FHZ A;  2DMN A;  3MMY B;  1OJL A;  4JX5 A;  1W1W E;  2OA4 A;  2CU7 A;  4LLL A;  1YIO A;  2NS7 A;  1BM9 A;  5AON A;  1VQP I;  3DF8 A;  2D5V A;  1ZR2 A;  5TRD A;  1Z7U A;  3JRD A;  2A6T A;  1P4W A;  3GWZ A;  3BR6 A;  3E6B A;  3K6G A;  1UHS A;  1K4S A;  1XD7 A;  3D1N I;  2QSG X;  5KHD A;  2R7X A;  1YJN I;  2V7F A;  1ZLK A;  5L3B A;  3ZMZ A;  1OPC A;  1WCM J;  2R5Y B;  1BW5 A;  3COA C;  2FBI A;  1RES A;  2FA5 A;  2JVG A;  3ESW B;  3HZJ A;  2Q8K A;  4BGD A;  5IP6 A;  1ACI A;  5HVQ C;  1E17 A;  1ETO A;  5EF6 A;  2LLK A;  1BR4 A;  2K86 A;  3SZT A;  3WE2 A;  4UUS A;  3V7S A;  2P8T A;  2L7Z A;  1X58 A;  3HRU A;  3BOQ A;  3A2K A;  3TW7 A;  4MTE A;  4HEA 2;  4A12 A;  2CUE A;  2MFZ A;  4MLO A;  4IXA A;  3U9G A;  1IXR C;  2A5W A;  2VOD A;  2K3P A;  2FBK A;  3K69 A;  3BZC A;  5EEG A;  3F6V A;  2ZXW H;  5DM7 F;  2QQ8 A;  2LD5 A;  3ZQG A;  1MBJ A;  3JRF A;  1T6S A;  2K27 A;  4Z2Y A;  3E97 A;  2R5Y A;  2VT2 A;  1RPW A;  1LVA A;  2OU2 A;  4CIC A;  2HKO A;  5HLI A;  2FU4 A;  3CCJ I;  4HW0 A;  3ABM H;  2ACJ A;  3BY6 A;  3M07 A;  2VAS A;  3ZXS A;  4C2M J;  1D0Z A;  2HOS A;  1WPK A;  2XGD A;  2HTJ A;  4II3 A;  4I2O A;  5DCM A;  1UG0 A;  3ABT A;  1GLN A;  1B4A A;  5IP9 J;  4OMZ A;  4HPQ A;  2WV0 A;  1H8A C;  2DK5 A;  1KZH A;  1S6L A;  2F5E A;  3QOD A;  1TL8 A;  1UHW A;  3JSO A;  2CQQ A;  3U2R A;  2E36 A;  2CW7 A;  3WOD F;  2RNJ A;  3F22 A;  1E3O C;  2HWV A;  3ECO A;  2Y0S N;  3F8B A;  2G7H A;  1RC9 A;  2LNB A;  4B1R A;  2ZME B;  2RKH A;  3JRG A;  2EA2 A;  3F0C A;  1A31 A;  1FY7 A;  2ZXI A;  2H94 A;  1WQ2 A;  2WA0 A;  1QBJ A;  3GX4 X;  2A69 F;  4KA4 A;  4II2 A;  2WAQ N;  4OAZ A;  3W6V A;  3C2H A;  2QEX I;  4AYB N;  3NQO A;  3QQA A;  3OS0 A;  2JQ7 A;  3R0A A;  4YFX F;  4LG3 A;  1H9T A;  1E3P A;  2BY1 A;  3OYL A;  5KCM A;  4CCM A;  2X6W A;  3GLL A;  2HPI A;  1LKX A;  2I8D A;  2X1D A;  2XGE A;  2N8G A;  4GYI A;  2GXA A;  2DA6 A;  4IRH A;  4KT6 A;  3S1Q J;  1TP4 A;  1S7A A;  3CCL I;  4I02 A;  1IN5 A;  2OTL I;  1F36 A;  4HX7 A;  1I5Z A;  3CCQ I;  2F5F A;  4KJZ A;  3NWT A;  4OWR B;  1V5E A;  1O3R A;  4J01 A;  1SD7 A;  5DS9 A;  2KRH A;  4AYB A;  3D5L A;  4AD9 A;  2LDU A;  2IAI A;  5E3N A;  1IJW C;  2KIM A;  2AQE A;  2DU9 A;  2ZFU A;  4OIR F;  1K79 A;  2Q0O A;  1SD4 A;  2OQG A;  4Q5S F;  2EZI A;  3M8F A;  2KJC A;  5H6Q A;  2X48 A;  3IAS 2;  3WTS C;  3MAJ A;  5ED4 A;  2CUJ A;  3GME A;  1ZGJ A;  1OR7 C;  3I53 A;  3WGG A;  3AAF A;  5E20 A;  4EM0 B;  2DTR A;  5ILU A;  4B3A A;  2VOP A;  1D0X A;  4M6V A;  2XAU A;  5E8G A;  4GO1 A;  1MBK A;  2J5O A;  2ZO4 A;  1XSD A;  3BJO A;  3MN2 A;  1IV8 A;  5JVG F;  3VYU B;  2TRT A;  2EIL H;  5J1Y A;  1HW5 A;  4KNY A;  4ZH4 F;  2E19 A;  2JT1 A;  2O3F A;  2XRL A;  1OYW A;  4XLC A;  4R79 A;  3H9J A;  1FYK A;  3N97 A;  2ZSH B;  2ELK A;  2L5Q A;  5M5X J;  2K7L A;  2X4H A;  5BPD A;  2F4O B;  1MJB A;  1Y0N A;  4E7H A;  3PIO F;  1SFO J;  3W3C A;  1OCP A;  4YFK F;  2CJJ A;  3IUO A;  3KYL A;  1LPQ A;  3C2G A;  3WTV C;  4G7H F;  2DPD A;  4RAG A;  1JI8 A;  2GM4 A;  1WGX A;  2LKS A;  2QKM B;  3FXO A;  4YFN F;  4O5V A;  4FQG A;  2K85 A;  5IYB J;  5FLX Z;  4OMY A;  4WXD A;  5D8K B;  1FOY A;  4KIG A;  5E1Z B;  2D2W A;  3HOW J;  1ETQ A;  1EA3 A;  2HR3 A;  2HVS A;  3HGY A;  3OR2 C;  3PIP F;  3KP7 A;  5CVV A;  2R7W A;  4GRI A;  3B6A A;  4C3I J;  5IOY A;  3OL3 A;  2QWW A;  2Y48 A;  1WH7 A;  2NRA C;  4XKC A;  2F4M B;  3DLA A;  2OPT A;  4HAM A;  3EDP A;  1ONV A;  1WRJ A;  3U1D A;  3VOD A;  4WWC A;  1VQL I;  4BHP A;  3J7Z I;  4ZYE A;  2W84 A;  1IAW A;  3OR1 C;  1JGS A;  2JN6 A;  3QWL A;  2MGQ A;  1SEU A;  3RI4 A;  2PEX A;  2HFH A;  3DEE A;  4UVB A;  2PLY A;  5L3G A;  2JA5 J;  1HQC A;  3ABU A;  4LOC A;  3ERE D;  2CQK A;  4NBQ A;  4RS8 A;  2P6T A;  4AID A;  4HNV A;  1HW2 A;  3G1L A;  2MC4 A;  1TQI A;  1TW2 A;  4KT5 C;  4G12 A;  3M8E A;  2IGK A;  3QYE A;  2OCC H;  3MKZ A;  3CUO A;  5ICF A;  3ZOB A;  1D1C A;  3HKZ N;  2M4K A;  2VOO A;  5FGM A;  4P1W A;  2ESN A;  4WXC A;  2XC7 A;  1CF7 B;  2DYR H;  3JTH A;  3EUA A;  3MZ8 A;  5DD8 A;  3V42 A;  3MCZ A;  4BH9 A;  1T38 A;  1TNS A;  2IRF G;  1WSU A;  3WHB A;  4KMF A;  4BDZ A;  4MEX F;  1DUX C;  3HPH A;  3HUG B;  3KEY A;  4I6Z A;  4KIS A;  3TO7 A;  2MLK A;  1XMA A;  3CJR B;  1YE9 A;  2ZXJ A;  3LSH A;  3MZH A;  1W7P B;  2EZL A;  2QM3 A;  3O8G A;  2LKX A;  1T2K A;  4XRM A;  4U0W A;  5D4R A;  3CDI A;  4CSW A;  3K70 C;  2VKE A;  2CSO A;  3IKT A;  3BR3 A;  2OBP A;  3S1N J;  3PL8 A;  3KLN A;  1CF7 A;  3GFI A;  3ZMU A;  1HLV A;  4CCL A;  2KMU A;  2STW A;  1LFB A;  1OKR A;  1P92 A;  3KZY A;  4A3J J;  5E79 C;  1Z21 A;  3Q3S A;  2UXN A;  1QNT A;  1GVJ A;  2ZNZ A;  2KT0 A;  3HUG A;  2NNY A;  1EJ9 A;  3LFK A;  1IRZ A;  2IA1 A;  5E3L A;  1T56 A;  1W7P A;  1RIO H;  5J40 A;  1KYZ A;  1BC7 C;  3TKY A;  3DQV C;  2VBY A;  1ULY A;  3SQN A;  3LSM A;  4JBA A;  1GHC A;  5J3L A;  3OYF A;  5LLQ A;  3BJA A;  1TZL A;  2DT6 A;  5HS9 A;  4EJT A;  1NK3 P;  2IS1 A;  1O3S A;  1X2N A;  2XIG A;  5IYC J;  3AFH A;  2CG4 A;  2VPL A;  3I58 A;  4M9Z A;  3H0G J;  1LE8 B;  5L3C A;  3MWM A;  1H88 C;  5EEA A;  4Y33 A;  4IHS A;  1MMG A;  3S2H J;  4BQA A;  2DA1 A;  2ZJ2 A;  4MGR A;  2GQQ A;  1A6Q A;  2YX4 A;  4BL0 B;  4YIR X;  3IKV A;  4OIN F;  3OIQ A;  2VT3 A;  2ETH A;  3CDH A;  4E6K G;  5HS8 A;  4CZC A;  2LBF A;  2F5V A;  4BXU A;  1JKO C;  4M6Y A;  4NB5 A;  1BR2 A;  4E7Z A;  3FMQ A;  2LYC A;  1LE8 A;  1XGM A;  2EV0 A;  2FBH A;  5LHH A;  1USS A;  4I0A A;  1SAX A;  2FUG 2;  1G59 A;  4X6A J;  4BJ5 C;  1GXQ A;  3PO3 J;  1QGP A;  3BJ6 A;  3SDB A;  3HTU A;  3HL2 A;  1VQK I;  1V55 H;  2BBY A;  5C4J J;  2DMP A;  2KDZ A;  2LF8 A;  3PFI A;  4I99 C;  1Z6T A;  5FKK A;  2O5R A;  4AIJ A;  3OSG A;  5F04 A;  2MAB A;  4AU7 A;  4IHV A;  1QHG A;  4EJO A;  5FFX A;  3W6J B;  2DYS H;  2FNA A;  3QU3 A;  3E5Q A;  4BE0 A;  2H6B A;  2M8E A;  3O2P E;  1JJ6 C;  2PI0 A;  1DU6 A;  2V1N A;  3J7A O;  2L2O A;  1R58 A;  3L7W A;  5M3F J;  5K5Q A;  2A5Y B;  5FLX K;  1FMV A;  2F4I A;  1HCR A;  1JE8 A;  1P6R A;  2NS0 A;  4IL6 C;  4G9Y A;  2EV5 A;  3HOX J;  2NVX J;  1IRG A;  1W36 D;  3OWT A;  3BTJ A;  1T0F C;  2KIU A;  3LQR A;  3OYM A;  3E5X A;  5ICG A;  3F72 A;  3IHU A;  1U0J A;  3ZRG A;  2GOX B;  1BA5 A;  3S32 A;  4IJA A;  3RKW A;  1S8N A;  1G3T A;  1GXP A;  3R6S A;  3T8T A;  4H0E A;  4IX7 A;  1JT0 A;  2DOE A;  5J4Y A;  4IQJ A;  1X4P A;  3AG3 H;  4TV7 A;  2YS9 A;  4A0Z A;  4C3H J;  4IF4 A;  4WX9 A;  3CP8 A;  2VI6 A;  3WTX C;  5HOO A;  2FQ3 A;  3CF2 A;  1YTY A;  2DOD A;  4CUG A;  2RQP A;  3KP6 A;  2X6Y A;  2DBB A;  4WXH A;  1BI3 A;  4IZZ A;  2W48 A;  2AXT C;  3FDY A;  4D1Q A;  3DLL F;  3GW2 A;  2R5Z B;  4BE2 A;  4IHX A;  4BBS J;  4OU0 A;  3S16 J;  3DCF A;  2NOJ B;  4XNF A;  2EWN A;  2EQR A;  1JTY A;  1PVE A;  4DOZ A;  4CA0 A;  2Y31 A;  3IH4 A;  1RUN A;  3EUH C;  2X1E A;  2M34 A;  1PYV A;  5LFA A;  1Z6R A;  2L7F P;  1IV6 A;  1EH8 A;  2O03 A;  4IHY A;  2VIX A;  3Q9S A;  1NG6 A;  3SEZ A;  2L4A A;  2LSO A;  2QKL B;  2HQN A;  4GGG A;  2EFN A;  2V1X A;  3ZMV A;  1U3E M;  1SVL A;  1T33 A;  5E1X A;  2KZG A;  2ZJP F;  1FZP B;  2KIF A;  3I4P A;  3N05 A;  1ZGA A;  2R5Z A;  5DCF A;  2XAS A;  4UB6 C;  3PQK A;  4A3G J;  1STZ A;  1ETY A;  1GDT A;  1QVT A;  3SYT A;  4Q48 A;  1XGS A;  1K6O A;  3KYC B;  1I6H J;  2DA4 A;  1VF9 A;  4GYG A;  2KDO A;  2ISY A;  4ANJ A;  4I7H A;  1QVU A;  4IPA A;  3I56 I;  4NC8 A;  1OCZ H;  4JYK A;  2BY0 A;  2PN6 A;  4I98 B;  1JHF A;  3CO6 C;  1K78 B;  1FSH A;  1G4D A;  1Z7L A;  4HYE A;  3TED A;  2GIV A;  4MHG A;  3RDI A;  1N75 A;  2X6X A;  2GXG A;  3OIO A;  5M3M J;  2O6G E;  1HW1 A;  3BQY A;  2W82 A;  2LOO A;  1MGT A;  1HKQ A; 
#chains in the Genus database with same CATH homology
 3JTG A;  1LDK B;  4ZZL A;  5H20 A;  4EQQ A;  1H9G A;  3CO7 C;  1J59 A;  1F5T A;  1R5H A;  1C0W A;  5FO5 A;  1K78 A;  1MJA A;  1FBS A;  1TTY A;  1BI0 A;  1YS6 A;  1HSJ A;  2DO7 A;  5LEK A;  1LNW A;  4RGS A;  1J7K A;  3V7R A;  1FT9 A;  2OQR A;  2DQR A;  1IZ1 A;  5E18 F;  4S05 A;  3DKW A;  1B6A A;  1AWC A;  3FWE A;  4KIF A;  4M71 A;  1R36 A;  4LK1 F;  5EEH A;  3V7C A;  3HRT A;  2PMH A;  1UHM A;  1PDN C;  1IN4 A;  1J9I A;  5L3E A;  4EM1 A;  5HS7 A;  3K1M A;  4YG2 F;  5F1R A;  3WTW C;  2AS5 F;  5A2Q K;  4OIQ F;  1MDM B;  1HST A;  1ZN2 A;  2IJL A;  2BV6 A;  1KGS A;  1LDD A;  4UHT A;  1IW7 F;  3RPU A;  3O6B B;  2A61 A;  3ULQ B;  4LK0 F;  4U88 A;  3F8F A;  5E8I A;  2G9W A;  4AVP A;  4JK1 X;  3EQL F;  1MDM A;  2NYX A;  3KLO A;  3FMR A;  3CUQ C;  4U7D A;  2BE5 F;  4I09 A;  5LRS A;  3V4G A;  4L9J A;  4LJZ F;  1KYW A;  2E1N A;  4P9F A;  2HGC A;  4CO8 A;  2D45 A;  3E6C C;  5LGT A;  1LEA A;  2JTV A;  4HF0 A;  3VB2 A;  1V4R A;  5D6E A;  5IT3 A;  5DYM A;  2YX7 A;  3BPX A;  2VBW A;  3ZMT A;  2P4W A;  5DCM B;  3GUD A;  4XLP F;  1KU2 A;  1FX7 A;  4PGH A;  2P5V A;  1FPQ A;  4XRF A;  2FXA A;  4FX4 A;  4IHT A;  4FHT A;  4L9N A;  2WC2 A;  3H3U A;  5J8C A;  2VE8 A;  5FFZ A;  4RB3 C;  2FML A;  3FM5 A;  3R60 A;  1U2W A;  2LKP A;  1Z91 A;  3KFW X;  1FYM A;  3NRV A;  2FE3 A;  2HEO A;  3QU6 A;  2OZ6 A;  5L3D A;  1OR7 A;  1FNN A;  2CFX A;  5AIQ A;  3ELK A;  1ZG5 A;  1P4A A;  4A0X A;  1VTN C;  1YFH A;  5D5V B;  4L5J A;  1TQP A;  2HQR A;  3WGI A;  3KET A;  3RYR A;  5JR3 A;  2XKO A;  3TGN A;  5LBQ A;  5ERI A;  3BDD A;  3QPH A;  1B59 A;  4PGG A;  3HYI A;  3GEZ A;  3GFJ A;  1UB9 A;  5DDG A;  1Z05 A;  4ENM A;  4UUV A;  5FD6 A;  1ZLJ A;  1O3T A;  2MC3 A;  1DP7 P;  5HDG A;  4PDK A;  5LGN A;  4B09 A;  4RGR A;  1U78 A;  1J0R A;  2QQB A;  3J81 Z;  1MJ9 A;  4I0B A;  1Q1H A;  2QLZ A;  3M7G A;  3IC7 A;  3C7J A;  1RNL A;  2PMU A;  4ESJ A;  3GVA A;  3HRM A;  4ETS A;  4HDU A;  3ROU A;  2DW4 A;  1G6N A;  4YII A;  1BIA A;  4G94 A;  2W25 A;  5J6X A;  1SD6 A;  1O57 A;  4ESB A;  3WTT C;  1SFE A;  5D5X B;  3WE3 A;  1UFM A;  5ILS A;  3RJP A;  1IUY A;  3LST A;  3S2W A;  1XB4 A;  3LQQ A;  4N9H A;  4UV9 A;  4FT8 A;  1FBU A;  3SZP A;  4ENN A;  2HYF A;  3KP2 A;  2FEZ A;  2QYO A;  4CZZ A;  4B8X A;  1S3J A;  5JI6 A;  2MH2 A;  2L02 A;  3HSE A;  3QOP A;  4BYY A;  2PBI A;  2JZY A;  4CHU A;  2GA2 A;  2M45 A;  4L0Y B;  1HBX G;  2OD5 A;  3RKY A;  2KJB A;  5F64 A;  1KQ8 A;  1O3Q A;  4RAZ A;  4N0B A;  4HX8 A;  3GFL A;  3GO5 A;  5AIP A;  3WU0 A;  2X0L A;  1K7A A;  1O7L A;  5DD4 A;  3JSP A;  2MLG A;  4LG0 B;  2A07 F;  2VC0 A;  1MKM A;  2P7V B;  1ZAR A;  2GA1 A;  1F9N A;  3EYY A;  3SHF A;  2K4J A;  5HLG A;  4KIC A;  4IVN A;  3O3K A;  3DEU A;  2WTE A;  3VOE A;  3SXY A;  3IRQ A;  4R8H A;  5KVR A;  2O61 A;  3FM3 A;  1B9M A;  3ZP5 A;  4ESF A;  3TQN A;  4LG0 A;  2UXX A;  3LAP A;  2L01 A;  3ZQ7 A;  3LA7 A;  2HOE A;  1SMT A;  1SD5 A;  2F2E A;  2IA0 A;  4WCG A;  2DLL A;  3DPT A;  4LLG F;  4A6D A;  5CVR A;  2D1H A;  4P9U A;  4RGU A;  4M9S A;  2TDX A;  1XCV A;  2BGC A;  2DI3 A;  3L09 A;  3TDZ C;  4BNC A;  2UZK A;  3K0L A;  5ICC A;  3ECH A;  3L9F A;  1T0F A;  2XRN A;  3J81 K;  1NHA A;  3GYH X;  4DQ2 A;  2JPC A;  4DNC A;  2ADU A;  4UV8 A;  1XMK A;  4ZYG A;  2XGX A;  2DK8 A;  2EK5 A;  3QP6 A;  4HX4 A;  4MNU A;  1KQ9 A;  4MEY F;  5L3F A;  2B0L A;  1IN6 A;  1V3F A;  2VBZ A;  5A2Q Z;  1XSX A;  3ML6 A;  2DPU A;  1PP7 U;  1W5S A;  3GXO A;  4RGX A;  3L00 A;  5BQT A;  3RKX A;  1BOA A;  1RI7 A;  3EUH A;  4GXO A;  3ZPL A;  1R7J A;  3MQ0 A;  5CJ9 A;  2IW5 A;  5ILV A;  1ON2 A;  3QRF F;  2DQL A;  4OIO F;  3QPT A;  4G6Q A;  2O0Y A;  1FYL A;  3DPL C;  3V8L A;  2XAJ A;  2QBY B;  3FF5 A;  1KQ0 A;  2Y75 A;  1L3L A;  3LA3 A;  2L4M A;  3F23 A;  4RAY A;  3C3W A;  4KMU X;  4RB2 C;  4U0V A;  2IA2 A;  4A5M A;  3E6D A;  2FMY A;  3E3V A;  2COM A;  3IWF A;  2XAH A;  1JXS A;  4Q47 A;  1B1B A;  1QQI A;  1H0M A;  1RUO A;  2QBY A;  1HKT A;  4M72 A;  5H6R A;  1I27 A;  4LFU A;  4Y17 A;  1R1V A;  3T8R A;  3ZMS A;  1TW3 A;  4OIP F;  3B02 A;  1IN8 A;  3EYI A;  4F7Z A;  2LF7 A;  2GXB A;  2R3S A;  1G3Y A;  3Q5F A;  2D1V A;  5HDN A;  4Y13 A;  2VBX A;  3WG9 A;  4KUM A;  2EJR A;  4EMS A;  3N4M A;  2CGP A;  3IRR A;  1ZRD A;  2Z33 A;  3WTU C;  1I6X A;  4IRI A;  2EB7 A;  4AIK A;  4LB6 B;  2XHK A;  6PAX A;  3F8N A;  3I59 B;  2QQ9 A;  3BRO A;  3GZ5 A;  4G6D A;  4G8X A;  1DDN A;  5JHU A;  4KDP A;  4BHC A;  2Z99 A;  2XV4 S;  1XN7 A;  2FOK A;  4A0Y A;  3G73 A;  1R00 A;  4D0P A;  2M30 A;  1MD0 A;  1WWX A;  1KU7 A;  1FBQ A;  1KU9 A;  3HHH A;  3CUQ B;  2RV8 A;  3HHG A;  3I59 A;  2R7F A;  4KFC A;  1IRF A;  5IT9 K;  5FB2 A;  2GAU A;  3P9K A;  4LB5 A;  1EH6 A;  1U5T C;  5J8F A;  3WGH A;  1J5Y A;  3DP7 A;  1BC8 C;  1I1S A;  3K1N A;  4ON0 A;  2RN7 A;  4CXF A;  3M1E A;  2Z5U A;  5D5W B;  2P5L C;  1CGP A;  4EM2 A;  3CUQ A;  1OYI A;  4U0Y A;  2MBF A;  1YW7 A;  3IWZ A;  1IN7 A;  1BI1 A;  1Z9C A;  1R1U A;  1SMY F;  1WKM A;  1W7P D;  2RC4 A;  3TOA A;  3P9C A;  4MQ9 F;  4XBF A;  2F5C A;  4KIB A;  2ELH A;  4LD5 A;  1LB2 A;  1A04 A;  3KP4 A;  4UVC A;  4IRG A;  2XAQ A;  1ODD A;  2E7X A;  1YYV A;  2K02 A;  4EJU A;  1QZY A;  1XDU A;  3ZN1 A;  3GF2 A;  1RZ4 A;  3I5U A;  4MQV A;  1P4X A;  4QLC U;  1SFX A;  3FZV A;  4P55 A;  3T1B A;  2FSW A;  3FX3 A;  1J75 A;  1R1T A;  5FD5 A;  2QZ8 A;  2EV6 A;  1LJ9 A;  1EH7 A;  2P5K A;  2JSC A;  1TNT A;  5BMZ A;  2RGV A;  4HLX A;  3QAH A;  2PFB A;  2A3S A;  1FWZ A;  2W24 A;  4L0Z B;  1HKS A;  4N9I A;  1W5T A;  4L5I A;  3TO6 A;  5D4S A;  2V1D A;  4KN4 X;  2DT5 A;  3E5U A;  1DPR A;  3HTS B;  1O7F A;  1XGN A;  3OV8 A;  4HLY A;  3KP3 A;  2E1C A;  1YO5 C;  2A6E F;  2NAZ A;  4I01 A;  1YG2 A;  5LEJ A;  3WTY C;  2ZBK A;  2VE9 A;  1X3U A;  3ZN0 A;  4JQF A;  4HV6 A;  1L0O C;  2YR2 A;  2EFQ A;  3VEP A;  3KZZ A;  2A68 F;  3V8K A;  1BIB A;  2UWM A;  4PCQ A;  2W85 A;  1ZAO A;  3I71 A;  1XDS A;  4UNO A;  2YSR A;  3TDU C;  5CYV A;  3H92 A;  2Z3Y A;  3IL2 A;  3T0Y A;  4HF1 A;  1LDJ A;  2GWR A;  2VN2 A;  4XLN F;  2PQ8 A;  4KN7 X;  4AIH A;  5K5R A;  1LEB A;  4HA8 A;  2ZFW A;  1U6G A;  1XSV A;  5DEQ A;  2IT0 A;  4A5N A;  1KA8 A;  3HIF A;  4RB1 A;  2GZW A;  2MA3 A;  4HQM A;  4HF2 A;  2H6C A;  5DV5 A;  4MTD A;  1ZRC A;  2MH9 A;  3F3X A;  4NHJ A;  4O6J A;  1J2X A;  2ZME A;  5JFR A;  2KKO A;  2HKX A;  1ZRF A;  2PJP A;  2OAZ A;  2KRF A;  2QVO A;  3FMS A;  1YW8 A;  3B73 A;  2M1B A;  2XUB A;  1QZZ A;  1I1G A;  5K5O A;  2YPR A;  1R5G A;  1R23 A;  4HOB A;  1R22 A;  2Y0M A;  2QEN A;  1ZG1 A;  2CWE A;  2R7D A;  4K2E A;  2L54 A;  1Z1D A;  5K1Y A;  4WK8 F;  2M5W A;  1TBX A;  2JRT A;  2HS5 A;  2M87 A;  4LMY A;  2ESH A;  3F8M A;  2MD5 A;  4EGZ A;  4CDG A;  2EFP A;  4U7B A;  3WTZ A;  2IP2 A;  2ZNY A;  1XCB A;  3T5X A;  1Y0U A;  3RIR A;  4LGW A;  1FLI A;  2IPQ X;  5E17 F;  3D0S A;  2L3D A;  5LHI A;  2WWY A;  3R0J A;  5D5U B;  1TQM A;  3GFM A;  2BEO A;  3DV8 A;  3HSF A;  1BJA A;  4HZF A;  1DPU A;  1IXS B;  4XSX F;  2XVC A;  3ISP A;  2HTS A;  1D8J A;  4M6X A;  3I54 A;  4RB0 A;  4ASN A;  1HXD A;  2FNP A;  4EGY A;  2V9V A;  3OOP A;  1BI2 A;  2CYY A;  2RVC A;  1S7O A;  4PZJ A;  1S29 A;  2HDC A;  4L9T A;  4UVA A;  4EJV A;  1U8R A;  3KE2 A;  1F4K A;  4HQE A;  2QUF A;  3JAM Z;  5BOX A;  2V79 A;  1ON1 A;  3I0T A;  5ICE A;  1EV7 A;  1ZYR F;  3CTA A;  3LA2 A;  1D3Y A;  2DFI A;  1IXC A;  2E7W A;  2P7C B;  4HBL A;  2H27 A;  4EJW A;  2BYV E;  4L18 B;  2VON A;  4Y15 A;  3FXQ A;  2J5P A;  1PP8 F;  2V1U A;  5IT9 Z;  3QP5 A;  2HYG D;  5TJJ A;  4P96 A;  3H3Z A;  1TLH B;  2JPB A;  3LAJ A;  1F1Z A;  4CYD A;  4S04 A;  2C6Y A;  3VFZ A;  5BS6 A;  1LQ1 A;  5LRR A;  3HOT A;  4ZYD A;  5F6F A;  3MZY A;  4G7O F;  3W6K B;  5CVJ A;  3BWG A;  4M74 A;  3RTR A;  4OOI A;  3BPV A;  3J80 Z;  2EFW A;  4NQW A;  1YQA A;  2EFO A;  3V8J A;  1G3W A;  3HOS A;  3BZ6 A;  3JW4 A;  1IF1 A;  1YS7 A;  4BAY A;  1BBY A;  1D5V A;  4A2U A;  4P5O A;  4L9V A;  2NNN A;  5CVI A;  3K9T A;  2OZU A;  5BPI A;  1T39 A;  3SFZ A;  3HRS A;  1BN5 A;  3LWF A;  3CJN A;  2Z9O A;  2V6C A;  5CVU A;  3L2C A;  4QWQ A;  2ZKZ A;  3G3Z A;  5D8L B;  1T98 A;  1FC3 A;  1ZG3 A;  1JHH A;  4HV5 A;  3GLX A;  4ENJ A;  3GZ6 A;  1YLF A;  2QQA A;  1U5T B;  4WF2 A;  2CW0 F;  4EV0 A;  4M73 A;  1FSE A;  3Q9V A;  4ENK A;  1KU3 A;  3MEX A;  4O3M A;  5LGU A;  2A6H F;  1SFU A;  2EA4 A;  5HDK A;  4HDV A;  3F6O A;  4A6E A;  1OMI A;  1U5T A;  2AXL A;  5DUK A;  3R4K A;  4Q4Z F;  3KCC A;  1QO0 D;  3FXU A;  4GCV A;  2VC1 A;  4ZZD A;  5DUI A;  4EVI A;  3JAM K;  1MZB A;  2HZT A;  3FXR A;  3KP5 A;  3NEU A;  1ZRE A;  5CLS A;  4BHB A;  3ZMD A;  3DXJ F;  2P6S A;  2CO5 A;  3C1D A;  3M9A A;  3HSR A;  2IVM A;  3EET A;  4E70 A;  2ISZ A;  1OYY A;  5LHG A;  3K2Z A;  2Q2E A;  4ZYH A;  4CGZ A;  2F5D A;  1XGO A;  4KYW A;  1W4M A;  3K1P A;  2XRO A;  1FOK A;  3RYP A;  3DFG A;  1ZHF A;  2W57 A;  2PG4 A;  1REP C;  1UST A;  3PQJ A;  1B9N A;  2XAF A;  4M9X A;  3RPQ A;  1QPM A;  1P2F A;  3F21 A;  3J80 K;  3P9I A;  2FF4 A;  3BP8 A;  4R1H A;  4AWX B;  1UCR A;  2K4B A;  3WU1 B;  5D6F A;  4LLN A;  2G7U A;  2O8X A;  3C18 A;  3F8C A;  2YU3 A;  5KK1 A;  1D8K A;  1WI9 A;  2RDP A;  3KEO A;  2ZCW A;  3P7N A;  2VXZ A;  3CLO A;  4YIF A;  1G3S A;  5E1W A;  2FRH A;  2XKP A;  2DAO A;  3MFK A;  3TOB A;  1FP1 D;  3KEQ A;  2STT A;  2XAG A;  1AOY A;  4FX0 A;  3TO9 A;  4G7Z F;  4XSZ F;  3R61 A;  1FP2 A;  4UXN A;  1YW9 A;  1E2X A;  3E6M A;  5HLH A;  3I64 A;  3REO A;  1PUE E;  2H09 A;  5JVT A;  1ZH5 A;  3FHZ A;  2OA4 A;  4LLL A;  1YIO A;  1BM9 A;  5AON A;  3DF8 A;  5TRD A;  1Z7U A;  1P4W A;  3GWZ A;  3E6B A;  1XD7 A;  1ZLK A;  5L3B A;  3ZMZ A;  1OPC A;  3COA C;  2FBI A;  2FA5 A;  2Q8K A;  5HVQ C;  1E17 A;  2K86 A;  3WE2 A;  3SZT A;  3V7S A;  2P8T A;  3HRU A;  3BOQ A;  4MTE A;  4A12 A;  4IXA A;  3U9G A;  1IXR C;  2VOD A;  2FBK A;  3K69 A;  5EEG A;  3F6V A;  1T6S A;  2K27 A;  4Z2Y A;  3E97 A;  2VT2 A;  2OU2 A;  1LVA A;  4CIC A;  2HKO A;  5HLI A;  2FU4 A;  4HW0 A;  2ACJ A;  3BY6 A;  2HTJ A;  4I2O A;  5DCM A;  3ABT A;  1B4A A;  4OMZ A;  2WV0 A;  2DK5 A;  1S6L A;  2F5E A;  1UHW A;  3JSO A;  3U2R A;  3WOD F;  3F22 A;  2RNJ A;  2HWV A;  3ECO A;  3F8B A;  2G7H A;  2LNB A;  2ZME B;  2RKH A;  2EA2 A;  1FY7 A;  2H94 A;  1WQ2 A;  1QBJ A;  3GX4 X;  2A69 F;  4KA4 A;  3NQO A;  3R0A A;  4YFX F;  1H9T A;  4GYI A;  4IRH A;  1S7A A;  4I02 A;  1IN5 A;  4HX7 A;  1I5Z A;  2F5F A;  1O3R A;  1SD7 A;  3D5L A;  4AD9 A;  2LDU A;  2KIM A;  2DU9 A;  4OIR F;  1K79 A;  2Q0O A;  1SD4 A;  2OQG A;  4Q5S F;  3M8F A;  2KJC A;  5H6Q A;  3WTS C;  3MAJ A;  5ED4 A;  1ZGJ A;  3I53 A;  3WGG A;  3AAF A;  5E20 A;  4EM0 B;  2DTR A;  5ILU A;  2VOP A;  5E8G A;  4GO1 A;  2J5O A;  2ZO4 A;  1XSD A;  3BJO A;  1HW5 A;  4KNY A;  4ZH4 F;  2JT1 A;  2O3F A;  1OYW A;  4R79 A;  1FYK A;  3N97 A;  2K7L A;  2X4H A;  5BPD A;  1MJB A;  4YFK F;  3WTV C;  4G7H F;  2DPD A;  4YFN F;  4O5V A;  4OMY A;  5FLX Z;  4WXD A;  5D8K B;  4KIG A;  5E1Z B;  2D2W A;  2HR3 A;  3KP7 A;  5CVV A;  2QWW A;  2Y48 A;  2NRA C;  4HAM A;  3EDP A;  1ONV A;  1WRJ A;  3U1D A;  4WWC A;  3VOD A;  4BHP A;  4ZYE A;  2W84 A;  1IAW A;  1JGS A;  3RI4 A;  2PEX A;  2HFH A;  4UVB A;  2PLY A;  5L3G A;  1HQC A;  3ABU A;  3ERE D;  2CQK A;  4RS8 A;  2P6T A;  1HW2 A;  1TQI A;  1TW2 A;  4KT5 C;  3M8E A;  3CUO A;  5ICF A;  2VOO A;  5FGM A;  2ESN A;  4WXC A;  1CF7 B;  3JTH A;  5DD8 A;  3MCZ A;  4BH9 A;  1T38 A;  1TNS A;  2IRF G;  1WSU A;  4KMF A;  4MEX F;  1DUX C;  3TO7 A;  2MLK A;  1XMA A;  2ZXJ A;  3MZH A;  1W7P B;  2QM3 A;  1T2K A;  4U0W A;  5D4R A;  2CSO A;  3IKT A;  2OBP A;  3KLN A;  1CF7 A;  3GFI A;  3ZMU A;  2STW A;  1OKR A;  1P92 A;  3KZY A;  2UXN A;  1QNT A;  1GVJ A;  2ZNZ A;  3HUG A;  2NNY A;  3LFK A;  2IA1 A;  1W7P A;  1RIO H;  1KYZ A;  1BC7 C;  3TKY A;  3DQV C;  2VBY A;  1ULY A;  3SQN A;  4JBA A;  1GHC A;  5LLQ A;  3BJA A;  5HS9 A;  4EJT A;  1O3S A;  2XIG A;  2CG4 A;  3I58 A;  4M9Z A;  5L3C A;  3MWM A;  4IHS A;  4BQA A;  2ZJ2 A;  4MGR A;  2GQQ A;  2YX4 A;  3IKV A;  4OIN F;  2VT3 A;  2ETH A;  3CDH A;  5HS8 A;  4BXU A;  4M6Y A;  4NB5 A;  3FMQ A;  1XGM A;  2EV0 A;  2FBH A;  5LHH A;  1USS A;  4I0A A;  1SAX A;  1GXQ A;  1QGP A;  3BJ6 A;  3HTU A;  2BBY A;  2LF8 A;  3PFI A;  1Z6T A;  4AIJ A;  4EJO A;  5FFX A;  3W6J B;  2FNA A;  3QU3 A;  3E5Q A;  2H6B A;  2M8E A;  3O2P E;  2PI0 A;  3J7A O;  1R58 A;  3L7W A;  5K5Q A;  2A5Y B;  5FLX K;  1JE8 A;  1P6R A;  2NS0 A;  4G9Y A;  2EV5 A;  1IRG A;  3LQR A;  2KIU A;  3E5X A;  5ICG A;  3F72 A;  3IHU A;  4IJA A;  3RKW A;  1S8N A;  1G3T A;  1GXP A;  3R6S A;  3T8T A;  4H0E A;  4TV7 A;  4A0Z A;  4WX9 A;  4IF4 A;  3WTX C;  5HOO A;  2FQ3 A;  1YTY A;  2RQP A;  3KP6 A;  2DBB A;  4WXH A;  1BI3 A;  3GW2 A;  4OU0 A;  2EWN A;  1RUN A;  1Z6R A;  1EH8 A;  2O03 A;  3Q9S A;  2L4A A;  2LSO A;  2HQN A;  4GGG A;  2EFN A;  2V1X A;  3ZMV A;  1U3E M;  5E1X A;  1FZP B;  2KIF A;  3I4P A;  1ZGA A;  5DCF A;  2XAS A;  3PQK A;  1STZ A;  4Q48 A;  1XGS A;  1K6O A;  4GYG A;  2ISY A;  4I7H A;  4IPA A;  2PN6 A;  4I98 B;  1JHF A;  3CO6 C;  1K78 B;  1FSH A;  1G4D A;  4HYE A;  2GIV A;  4MHG A;  3RDI A;  2GXG A;  2O6G E;  1HW1 A;  1MGT A;  1HKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...