3DEUA

Crystal structure of transcription regulatory protein slya from salmonella typhimurium in complex with salicylate ligands
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
140
structure length
132
Chain Sequence
LESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator slyA
publication title Crystal structure of transcription regulatory protein slyA from Salmonella typhimurium in complex with salicylate ligands.
rcsb
source organism Salmonella typhimurium
molecule tags Transcription regulator
total genus 52
structure length 132
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3deuA00
4BHCA 3E5UA 5JVTA 2IW5A 4MQ9F 2EJRA 3RKWA 4Y17A 1EH6A 3NEUA 5D5UB 1SD5A 2LF8A 1YW9A 2XAHA 2RN7A 1U6GA 1FPQA 3TQNA 3WGHA 3TOAA 4L9TA 1EV7A 2YX4A 4RGRA 2HQRA 4RS8A 3WTUC 2L01A 1IAWA 3TOBA 4KNYA 1D3YA 2W85A 1STZA 2GZWA 2HS5A 4IHSA 3WTTC 3KP5A 4GO1A 1WSUA 4I2OA 1SFEA 1J2XA 4KN4X 2DBBA 3KP3A 3N4MA 1G3SA 1XGNA 3QP6A 3M8EA 4EVIA 2Z5UA 5AIPA 4QWQA 2K4JA 4BHPA 2HQNA 4M71A 2FQ3A 1O3SA 6PAXA 1ZARA 4HLYA 3DQVC 2H27A 5D4RA 3HRUA 1TTYA 2GXGA 2QQBA 4FX0A 1FOKA 2ELHA 1ZRDA 2FNPA 4CO8A 2DU9A 2ESNA 2GIVA 4LGWA 4HF1A 2OBPA 5F64A 4A0YA 1IRFA 1XDSA 5ICGA 4Q48A 1XGMA 2V1DA 2FNAA 4EGYA 3U9GA 3F6VA 1H9GA 1K7AA 1RZ4A 1FNNA 1CGPA 4Y15A 1FP1D 4EMSA 3GUDA 4IRHA 2W24A 1S3JA 1HBXG 2RGVA 1HSJA 4U0YA 5DV5A 1BI2A 1ZH5A 4XRFA 1E17A 2OZ6A 4HAMA 4LB6B 2MLKA 4P9UA 1Y0UA 4U7DA 3V8KA 1REPC 1O3QA 3Q9VA 4R8HA 3MZHA 4WXDA 4YFKF 2EFNA 3DV8A 5FB2A 1KYZA 2GXBA 1JHHA 1FC3A 1XMAA 1YW7A 2VE9A 4KMUX 1BJAA 3I5UA 4AIJA 3F8NA 2YPRA 1SFUA 4ENJA 4FT8A 1W4MA 4UV9A 5H20A 3CUOA 2OAZA 2XAJA 2PN6A 3Q9SA 4RAZA 3KFWX 5E8GA 1Z6TA 1F5TA 1ZGAA 2R3SA 1IXRC 1ODDA 3D5LA 1P4WA 3F8MA 3JTGA 4UVCA 4LLNA 1J75A 3T8TA 1SD6A 4LK0F 4EJTA 4CGZA 1HW5A 5LEKA 4M9ZA 1QGPA 3RPUA 1RUOA 1LEBA 4HF2A 3LQQA 1Z7UA 1G3WA 3VB2A 3HOTA 3LFKA 2RV8A 2Q8KA 4WXCA 1XB4A 1FT9A 2R7DA 4OOIA 5HDNA 2VBXA 2P6SA 1I27A 2JTVA 4A6DA 2H6CA 1RUNA 1BIAA 4OMZA 1BI1A 2WWYA 3SXYA 3ECHA 3SHFA 2ESHA 5A2QZ 4HQEA 3L2CA 2FF4A 1FX7A 1T6SA 1MJAA 5D4SA 5FD6A 4G9YA 4EM0B 2K86A 4M6XA 2B0LA 4L0ZB 1YQAA 3ROUA 2A5YB 3IL2A 4I01A 1YW8A 1PDNC 2IA0A 4LK1F 4IVNA 4HYEA 1HW1A 4Q4ZF 3QU3A 3E5QA 3GZ5A 3LA3A 4KMFA 1V4RA 2VOOA 3JAMZ 4N0BA 3HSEA 2QM3A 5H6QA 4LG0B 5K1YA 3K1PA 1Q1HA 1K6OA 1PP8F 1TLHB 2F2EA 4A6EA 1XDUA 1TQPA 2XUBA 3DXJF 3H3ZA 1WI9A 2COMA 2G9WA 3HHHA 4XLPF 1BOAA 3SZPA 5HLHA 2H09A 1YS7A 2KJCA 4ZH4F 4ZYHA 2HKOA 4L0YB 2UWMA 2F5CA 1Z1DA 1R7JA 5FLXK 1IN4A 1LEAA 2Z99A 3C3WA 3MAJA 2CO5A 5LRSA 3E3VA 5BMZA 1BIBA 4HX8A 5CVRA 1ZG3A 1SD7A 1FLIA 1QZYA 4ZYDA 2CW0F 3IKTA 1ZREA 3GEZA 4L9VA 3FF5A 3I0TA 4P5OA 2QUFA 4A0XA 5F1RA 2IA2A 2IA1A 4AIHA 4A12A 2FXAA 1KU7A 1K78B 4HA8A 3ERED 1I1GA 2PLYA 1AWCA 1FBQA 2DAOA 4GXOA 2GA1A 5CVIA 1FYMA 3I58A 1IZ1A 1QPMA 4ESFA 1MGTA 2EWNA 2XAQA 3WU1B 2NNYA 1F1ZA 3HSRA 2V79A 2HTJA 1B4AA 1LDDA 3NQOA 4IXAA 1RI7A 4M73A 2MC3A 1MJBA 3P9IA 3WTWC 2VC1A 2CFXA 4XBFA 3KZYA 3P9KA 2FBKA 3KP7A 4Q5SF 2M87A 3E6DA 4CZZA 1KGSA 1DPRA 2IVMA 4RGXA 2HTSA 2FOKA 4WF2A 2QVOA 5HLGA 1XSVA 3KP2A 4LG0A 2HYFA 5BPDA 4ON0A 3F8CA 5CVJA 3ZMSA 4K2EA 5LGUA 2AXLA 2PFBA 1FYLA 4OIOF 1FSHA 2F5EA 2FSWA 1USSA 5ICEA 3MZYA 1I5ZA 1S29A 2ZNZA 5DUKA 3RYPA 2EA4A 4Z2YA 4KIGA 2LSOA 2QBYB 3JTHA 1YG2A 4G6DA 3SQNA 3FXQA 4R1HA 2DPUA 3IRRA 4I0BA 5HDKA 1IN5A 2D45A 2IPQX 4TV7A 3CO7C 2XV4S 1W7PD 2PEXA 2RNJA 1K78A 4P96A 2ZXJA 4EQQA 3FX3A 1TNTA 1QZZA 2FU4A 1XSXA 2BGCA 2C6YA 2JSCA 2UZKA 3J80Z 3SFZA 2G7UA 4E70A 1YLFA 4HDVA 4P9FA 4MQVA 1BC8C 1LDKB 4I98B 4BXUA 1R00A 4U88A 3V8JA 1X3UA 2P5KA 1UFMA 1DPUA 1WQ2A 2OZUA 4RB2C 1HQCA 3DFGA 2PBIA 1OPCA 3HHGA 1OKRA 3CLOA 2HYGD 2MA3A 2VN2A 4QLCU 5LGNA 2CWEA 3R0JA 3WTZA 4UVAA 4B09A 2QENA 2LF7A 2P7VB 4OIRF 2XKPA 2HGCA 1CF7B 2ZMEB 1V3FA 1XGSA 1IW7F 2FBHA 4BHBA 4F7ZA 2AS5F 4IHTA 3V4GA 2ISZA 4KN7X 2H6BA 4ETSA 5D6FA 3EYYA 4S04A 4WWCA 4BQAA 3B73A 5ICFA 3TDZC 4A5NA 4BAYA 1DDNA 4NB5A 2L4MA 3R0AA 2VT2A 1JE8A 3RTRA 3V7SA 1T0FA 2DQLA 3I59B 4S05A 4ZYEA 3WTSC 5JFRA 3RIRA 1HXDA 4NHJA 1U3EM 3QOPA 5E8IA 1QQIA 3KZZA 1B9MA 4KUMA 1IRGA 3E6MA 1O7LA 1WKMA 2Y75A 5F6FA 1FSEA 2QBYA 1RIOH 4PZJA 2ZCWA 1A04A 2WTEA 2M1BA 5E18F 2NYXA 4FHTA 1FZPB 1TBXA 2VT3A 3DPLC 4HOBA 1IN6A 2EK5A 2VONA 3H92A 4BNCA 2CSOA 2YR2A 2K27A 1T98A 1IUYA 2HEOA 4ZYGA 5EEHA 2FMYA 5FFXA 2PG4A 3GX4X 3HYIA 2FEZA 3R61A 1S6LA 2V1XA 2KIUA 4MHGA 5AIQA 1D8KA 1P6RA 2GWRA 4JK1X 4EJOA 1I1SA 4MGRA 3KETA 5IT9K 3DEUA 1HSTA 1YYVA 2O61A 3HOSA 2G7HA 3MQ0A 4L5JA 3TDUC 3ZQ7A 3KEQA 2CGPA 1BM9A 4AD9A 3W6KB 4BH9A 5A2QK 4I0AA 2HR3A 2ISYA 4XLNF 4WK8F 4A0ZA 5D8LB 4O5VA 5LLQA 2QYOA 3ZN1A 1J0RA 5K5QA 3TO6A 1P4XA 2CQKA 3BZ6A 3ELKA 3E5XA 5ILSA 4FX4A 3BOQA 1CF7A 2DI3A 2FBIA 2ZMEA 5D5VB 3T5XA 1GXPA 4YIFA 3LA7A 3L7WA 5DDGA 2P6TA 2O03A 4UNOA 1U78A 2VBZA 2X4HA 4ASNA 1LJ9A 3QPTA 4EJVA 4D0PA 5D5XB 1XMKA 2GAUA 4HX7A 3ZMDA 2Q2EA 3I71A 2Y48A 5HS9A 3WTYC 2M5WA 4GYGA 3JAMK 4LLGF 5L3GA 1TW3A 3LSTA 1R58A 2KIMA 3ISPA 3I59A 5DUIA 1MJ9A 3BJ6A 3GFLA 3BP8A 3KCCA 3IC7A 4OINF 3K1MA 2MBFA 1KU2A 4AIKA 1XGOA 3CO6C 2L54A 3FXUA 1R5HA 1FP2A 5EEGA 3CUQB 3I64A 3GVAA 5E1XA 3PQKA 1TQMA 5AONA 3RDIA 3I4PA 2DLLA 2K7LA 1HW2A 2RKHA 1BBYA 2RVCA 3KP4A 3I54A 1B6AA 1EH7A 3FXRA 1Z05A 2QZ8A 3J7AO 4RB0A 1KU3A 1TW2A 4M9XA 4I7HA 2IP2A 4G7ZF 2TDXA 2VBYA 4WX9A 3EETA 1KYWA 1O57A 3HRMA 3MFKA 1UB9A 3IKVA 1LB2A 4JQFA 3FMSA 4YIIA 4M72A 3W6JB 3EDPA 2MD5A 1IN7A 1W7PB 3FZVA 1SAXA 4LFUA 1G6NA 1HKSA 1B59A 3COAC 3E6CC 3ABTA 3F3XA 4YFNF 3IHUA 4CICA 2EV6A 1F4KA 4I09A 3QP5A 2QQAA 2IRFG 1ZG1A 4UUVA 4EJWA 2Z33A 1RNLA 4ESJA 4HW0A 5D8KB 3IWZA 2F5DA 1ZN2A 5ICCA 5IT3A 1NHAA 1Z91A 4GGGA 3BPXA 2UXXA 3HRSA 3F72A 5LBQA 4PCQA 3KEOA 4UVBA 3F22A 2LNBA 4ENNA 2DTRA 2M30A 1BI3A 4LJZF 3QU6A 4HDUA 3CUQC 3WGIA 2MH9A 5HS8A 3GYHX 1H0MA 4AVPA 2A6EF 4G8XA 2QQ9A 2XROA 2HDCA 1ZLJA 4UXNA 5HS7A 3O2PE 4MEXF 2STWA 1DP7P 3E97A 1HKTA 3F8BA 1O3TA 2LKPA 2O3FA 3CUQA 2V1UA 2XKOA 3QRFF 2O0YA 5DCFA 4IPAA 2DK5A 3CDHA 2GQQA 1B9NA 5E1WA 1K79A 5K5RA 5ILVA 1TQIA 1UHMA 4EM1A 3CTAA 2XIGA 3V8LA 2HWVA 2VC0A 3L09A 3D0SA 4BYYA 1W5SA 1EH8A 1QNTA 1XSDA 4U7BA 2WC2A 5LHHA 4PGHA 3ULQB 2W57A 4JBAA 3GF2A 2DT5A 2XGXA 4P55A 2DW4A 2XRNA 4M74A 4IJAA 3J81K 1ZYRF 3AAFA 1BC7C 3EYIA 4MTEA 1GHCA 4HX4A 3WGGA 1MDMB 1FBSA 4MTDA 1W7PA 5LHGA 2NRAC 1OYIA 1ZHFA 2A61A 5E20A 4U0WA 5L3DA 5BQTA 2ACJA 4RAYA 1XCBA 3IWFA 5DEQA 4M6YA 1R23A 4DQ2A 3TGNA 5DCMB 3FMQA 3I53A 4A5MA 3ZMUA 2O6GE 2OQGA 5CYVA 3JSPA 4AWXB 3WTVC 4OU0A 1WRJA 2LDUA 4YG2F 1KA8A 1R5GA 4YFXF 3M7GA 3BJAA 4G94A 4R79A 1ZRFA 3HSFA 4L9NA 3T0YA 2VODA 4HQMA 2KJBA 3GFJA 1FBUA 3GO5A 5BS6A 1B1BA 1SMTA 3WODF 1H9TA 2JT1A 4ZZDA 3KP6A 4HF0A 1D8JA 5J8FA 5HLIA 1GVJA 2DQRA 4IRGA 3PQJA 4CYDA 4KFCA 2D1HA 4L9JA 3ZPLA 4ZZLA 2ZNYA 3F6OA 3L9FA 2RDPA 3G73A 1T2KA 4G7OF 1S7AA 3QAHA 1U8RA 1F9NA 1ZLKA 2YSRA 1S8NA 3LA2A 3V7CA 1O7FA 3CJNA 1R1TA 2A69F 4EJUA 1XD7A 3TKYA 5L3BA 1SFXA 1MKMA 2M45A 4OIPF 1MDMA 2QWWA 1S7OA 2PI0A 3DF8A 4U0VA 1FY7A 2A3SA 1SMYF 4Q47A 1L0OC 3RYRA 2K02A 3HTUA 5DYMA 3OOPA 3B02A 2RC4A 2RQPA 5L3EA 4ESBA 4GCVA 1ON2A 3ZMZA 3HIFA 1YS6A 3Q5FA 3R6SA 3S2WA 2Z9OA 2OU2A 5DCMA 4OMYA 2NAZA 2EB7A 2NS0A 3O3KA 5CLSA 4DNCA 5FGMA 2PQ8A 2V6CA 2BBYA 1KQ9A 5LGTA 4LB5A 3ABUA 3P9CA 1TNSA 3BDDA 5BPIA 3SZTA 2FA5A 4PDKA 2EFPA 1Z6RA 2OD5A 3ECOA 1P4AA 4HBLA 3ZP5A 2DO7A 2EV0A 3GFIA 3HRTA 5LHIA 3HUGA 3BROA 4XSXF 2OQRA 2ZJ2A 2XAGA 2XVCA 2J5OA 2L4AA 1W5TA 4KIBA 3OV8A 4L5IA 2IT0A 2DPDA 3KE2A 3K69A 1J59A 3RKYA 3K1NA 2BE5F 1IF1A 5LRRA 3VODA 2M8EA 4RB3C 4MNUA 3BY6A 1R1UA 2PMHA 2E7XA 3K0LA 2UXNA 5CJ9A 3HTSB 2JZYA 1U5TB 3ZMTA 3RJPA 1DUXC 4OIQF 1PP7U 1BN5A 4CDGA 2A68F 3M8FA 1IXSB 1P2FA 3F23A 5ED4A 2BV6A 2PMUA 2ETHA 5FD5A 4EGZA 3N97A 3WE3A 4O6JA 5CVUA 3BWGA 3WU0A 2HFHA 3V7RA 4LLLA 2FE3A 5TRDA 2Q0OA 2HKXA 5L3CA 5HVQC 3ML6A 3GFMA 4PGGA 1ON1A 1USTA 2KRFA 1JGSA 2VOPA 2F5FA 4IRIA 3LWFA 3M9AA 1ULYA 1Z9CA 1AOYA 2HZTA 4H0EA 2W25A 3LAPA 2EFWA 1G3TA 2ZKZA 1MD0A 5IT9Z 2NNNA 4KDPA 4XSZF 2VBWA 2L02A 3WG9A 4LD5A 3KLNA 3MWMA 4UV8A 4HV6A 2YU3A 2GA2A 4KICA 1IXCA 3EUHA 4I02A 5LEJA 3WE2A 2PJPA 3O6BB 3VEPA 5E1ZB 1G3YA 1YIOA 4KYWA 3C7JA 5J8CA 1LQ1A 2YX7A 5FFZA 3NRVA 3DKWA 3BPVA 2EFQA 1XN7A 2EA2A 3ZMVA 2FRHA 2MH2A 2STTA 4N9IA 5H6RA 1U5TC 3FWEA 4M9SA 5JR3A 1JHFA 1J5YA 4CHUA 1FWZA 2CG4A 4RB1A 4B8XA 1UCRA 2ZBKA 3RKXA 2Z3YA 3U2RA 1D5VA 1U5TA 5KK1A 4HLXA 5E17F 4N9HA 1SD4A 4MEYF 3PFIA 2ADUA 3QPHA 5HOOA 3LAJA 4LMYA 1OR7A 1C0WA 1QO0D 4ENKA 2ZO4A 3VOEA 5D5WB 1L3LA 4RGSA 2A6HF 5ERIA 1ONVA 1YFHA 2XASA 3GLXA 2P8TA 1ZGJA 2P5VA 5HDGA 2JPCA 3GWZA 3T8RA 1UHWA 3K2ZA 2R7FA 2J5PA 5K5OA 1U2WA 3C1DA 3FMRA 2DK8A 1IN8A 1KU9A 1T39A 1KQ0A 2D2WA 3TO9A 2MLGA 3REOA 3R60A 5ILUA 3JW4A 4KIFA 3ZN0A 5D6EA 4WXHA 3GZ6A 5L3FA 5JHUA 2H94A 1PUEE 2QLZA 2KKOA 1P92A 1WWXA 1LVAA 3H3UA 3FM5A 2OA4A 1T38A 1ZG5A 4NQWA 4KA4A 4L18B 4A2UA 2P4WA 1O3RA 1BI0A 4O3MA 2BYVE 4HZFA 3RPQA 5DD4A 2Y0MA 2E1CA 1MZBA 2CYYA 1VTNC 1E2XA 1I6XA 3KLOA 4CXFA 1R22A 5BOXA 3R4KA 1G4DA 3FHZA 3C18A 3E6BA 2D1VA 2P7CB 2K4BA 5FLXZ 1KQ8A 3GXOA 1LNWA 5CVVA 1GXQA 3G3ZA 1ZRCA 3LQRA 2E7WA 3BJOA 3MCZA 3L00A 2L3DA 3M1EA 2KIFA 5TJJA 1YTYA 5DD8A 2JRTA 3J80K 3K9TA 1HKQA 2EV5A 2JPBA 5FO5A 3T1BA 3TO7A 3VFZA 1OYYA 3IRQA 3WTXC 4WCGA 1OMIA 1J7KA 5J6XA 1J9IA 1XCVA 2WV0A 1QBJA 3MEXA 3P7NA 4ENMA 2E1NA 3F21A 3F8FA 2P5LC 2V9VA 1ZAOA 1YO5C 2XAFA 2IJLA 4Y13A 3DP7A 4IF4A 2BEOA 2FMLA 4G7HF 3DPTA 4KT5C 1R1VA 2HOEA 2X0LA 4GYIA 3JSOA 2W84A 3FM3A 1OYWA 2VXZA 2VE8A 2O8XA 3RI4A 1JXSA 2DFIA 4HV5A 3U1DA 5JI6A 2A07F 2ZFWA 4EV0A 4EM2A 3J81Z 3EQLF 4RGUA 1R36A 2XHKA 3GW2A 1FYKA 4G6QA 2EFOA 1LDJA 4UHTA 5KVRA
chains in the Genus database with same CATH superfamily
4HEA2 4BHCA 1GVDA 1WH5A 2R5YA 4GDFA 5C4JJ 3E5UA 5JVTA 2Y69H 2IXSA 2IW5A 4MQ9F 3DKYA 5E3NA 4A3GJ 2EJRA 3RKWA 5KNLA 4Y17A 4F93B 1EH6A 4EATA 3D1NI 4E7LA 3HDDA 2A05A 3NEUA 5D5UB 1SD5A 2V9PA 3S32A 3IP4B 2ECCA 2LF8A 1YW9A 2XAHA 2RN7A 1U6GA 1FPQA 2ZSIB 3TQNA 1N75A 3WGHA 1XX5A 3TOAA 4RDUA 4PJJA 4L9TA 1XMXA 2JWTA 1R4NB 4M3GA 4M3FA 1EV7A 2X6YA 1FMVA 2NVUB 2YX4A 4HPQA 2HQRA 4RGRA 3ZQIA 4DJAA 1K4SA 4IHXA 4RS8A 3DPUA 3CC4I 3WTUC 2L01A 1G2HA 5HNFA 1VZ0A 3HBLA 4QPOA 3VPRA 1IAWA 3H0GJ 3TOBA 4E7IA 4KNYA 1D3YA 2X6OA 3BR1A 2W85A 1STZA 2GZWA 2HS5A 2EH3A 4IHSA 3CMAI 1ETKA 2QCOA 3WTTC 3KP5A 4GO1A 1WSUA 5M3MJ 4I2OA 1NTCA 2WAQN 3DEEA 3MD2A 5M3FJ 1SFEA 1J2XA 1RR8C 4KN4X 3BR5A 3OYBA 2DBBA 3KP3A 1MMSA 2MYSA 2JSPA 3N4MA 2TRTA 2E1MB 1G3SA 1XGNA 2LTPA 3QP6A 1B8IB 2MABA 3M8EA 4EVIA 2Z5UA 3DBLB 4C3IJ 3FKIJ 5AIPA 3FXKA 1MMNA 4QWQA 2K4JA 4BHPA 1KZHA 2HQNA 1JKRC 2IS6A 3DTKA 1UJ8A 2XGCA 4M71A 3DLLF 1MBKA 2FQ3A 2ID6A 3A02A 1O3SA 6PAXA 1JUPA 1V5GA 2JN6A 1ZARA 3AG2H 4HLYA 2VPLA 1V55H 1AHDP 3DQVC 2O7OA 2H27A 5D4RA 3HRUA 1TTYA 2GXGA 2QQBA 4FX0A 1FOKA 2ELHA 1D1AA 1HDPA 1ZRDA 2FNPA 1WJAA 2BXZA 4CO8A 2DU9A 3RZDJ 2ESNA 2GIVA 1Y6IA 1FIAA 2GLOA 4LGWA 1H8AC 4HF1A 2OBPA 4BDYA 2VKEA 5F64A 4A0YA 1IRFA 1XDSA 4RM2A 5ICGA 3CC7I 4Q48A 1XGMA 1TP4A 2V1DA 2FNAA 4EGYA 2LFBA 3U9GA 2PJRB 3VWBA 3F6VA 1H9GA 2DMUA 1K7AA 3CP8A 1RZ4A 3CMYA 1FNNA 1CGPA 3P5JA 2BZTA 4Y15A 2QSFX 1FP1D 3Q0WA 4EMSA 3LSHA 3GUDA 1QZEA 3N05A 4IRHA 3JRGA 1A35A 2Z2SB 2W24A 1UHSA 2CQNA 1S3JA 1HBXG 2RGVA 1HSJA 4U0YA 1X1BA 5DV5A 3A4CA 4HNVA 5C3EJ 1PJRA 2R7RA 2JA5J 1BI2A 1ZH5A 4XRFA 1E17A 2OZ6A 2E1OA 4HAMA 4LB6B 1JUSA 2HOAA 2FOWA 2E36A 2MLKA 1S72I 3W2VA 1MNMC 1FMWA 4P9UA 1YIJI 1Y0UA 5F08A 2QKMB 2VJ5A 4U7DA 4XKCA 3OYDA 2F6CA 3UR3C 2EZLA 1G59A 3V8KA 1REPC 1O3QA 3Q9VA 3OL3A 4R8HA 4HSTA 3MZHA 4WXDA 5GAEJ 4YFKF 2EFNA 2COBA 3DV8A 5FB2A 1KYZA 2GXBA 1JHHA 1FC3A 2M2EA 1OCRH 1XMAA 2LVSA 1W0TA 1TWCJ 1YW7A 2VE9A 2JUCA 2HNHA 4KMUX 1XPXA 3K4MA 1BJAA 3I5UA 2KIQA 4AIJA 3F8NA 1A36A 2YPRA 3ZQFA 1SFUA 4CUGA 4ENJA 4FT8A 3HKZN 1SEUA 2HDWA 3FBNB 1W4MA 3HJEA 2K9LA 4UV9A 1BA5A 3MMYB 5H20A 4UB8C 3CUOA 5HNHA 2OAZA 2XAJA 2LRDA 1RR7A 2PN6A 2E1MC 3Q9SA 4RAZA 1X1PA 2ZC2A 5IY5H 3KFWX 4IO9F 5E8GA 2R93J 1N78A 1Z6TA 1F5TA 1ZGAA 2R3SA 1IXRC 3NARA 3KIOA 3HGGA 1ODDA 1PVEA 3D5LA 1P4WA 3F8MA 3JTGA 4UVCA 4FE7A 4LLNA 1J75A 3T8TA 3TEDA 5FKOA 5IP7J 2MG4A 1SD6A 4J01A 5B3SH 4LK0F 4J00A 1FOYA 4S0HB 4YEJA 2EIMH 2R7OA 4AM3A 2A5WA 4EJTA 2EINH 1B8IA 4CGZA 1HW5A 3U21A 3HXLA 3L2UA 4IOAF 5GADJ 5LEKA 4E7HA 3M8JA 4LG3A 4M9ZA 4NNJA 1ZR2A 1QGPA 2R7QA 4KJZA 5HODA 2KFDA 1JUMA 1H89C 3JR9A 2CV1A 2W7NA 2M7AA 3RPUA 3ZCOA 3ZQCA 1U9NA 1RUOA 1LEBA 3JRAA 4RAFA 4HF2A 3M1CA 2IBDA 2CV2A 2KISA 3LQQA 4H4KC 2EIKH 1Z7UA 1G3WA 2DA1A 3VB2A 1S9HA 5DM6F 3LFKA 3HOTA 4HG2A 2RV8A 2Q8KA 2MD0A 4WXCA 4B43A 1XB4A 1FT9A 2R7DA 4OOIA 2LC2A 5HDNA 2VBXA 2P6SA 1I27A 3M07A 2JTVA 4IHYA 2DDBA 3H5RA 4A6DA 2H6CA 1RUNA 1BIAA 2X6WA 2K9SA 4ABZA 4OMZA 3S1QJ 2VKHA 3LFUA 1BI1A 2WWYA 3SXYA 3ECHA 1X1DA 3SHFA 1XC5A 2ESHA 2NOGA 4Y7NJ 5A2QZ 4XKBA 4HQEA 3ZGKA 3L2CA 1AA7A 4B3XA 1DGWY 2FF4A 2PJRA 2E2JJ 3H36A 1FX7A 1GT0C 1T6SA 1MJAA 2F4OB 2OC6A 3CMMA 5F04A 2YS9A 3BR0A 4CZCA 5D4SA 5FD6A 4G9YA 4EM0B 2JRMA 3QYEA 1OCTC 4DBRA 4XQFA 5IOYA 2K86A 4M6XA 2B0LA 4BACA 4G12A 2WB1A 3RPUD 2OPTA 3BR3A 4L0ZB 1G8XA 1JKOC 1YQAA 3ROUA 5IPAA 1XS9A 1R71A 1FTZA 4ZDPA 2A5YB 4PJNA 2L7MP 2ZB9A 1XG1A 5C4XJ 1GLNA 2R7TA 1LE8B 3IL2A 4I01A 2ZXIA 1YW8A 1D5YA 1PDNC 2IA0A 3BC8A 2DFFA 4LK1F 4IVNA 4HYEA 1HW1A 4Q4ZF 2JVHA 4BJ5C 3QU3A 3E5QA 3BLYA 2XB0X 1HC8A 1JTYA 5EGOB 3GZ5A 1VQPI 2XF5A 3LA3A 2E5NA 3DTIA 2JA7J 5IOZA 4KMFA 1V4RA 5IYBJ 2QF7A 2VOOA 3JAMZ 3SYTA 4N0BA 4DIQA 3HSEA 4MO7A 1XTAA 1X4PA 4LITA 2QM3A 3SFIA 5H6QA 5FKKA 4LG0B 5K1YA 1E3OC 3K1PA 3BCAA 3S93A 1ETXA 4IEJA 2HOSA 1Q1HA 3FHNA 1NK3P 3BZCA 4DYQA 2W1OA 4UUTA 1K6OA 4IHVA 2KQRA 1PP8F 2BY2A 1TLHB 2F2EA 2OUMA 4A6EA 1XDUA 5J40A 1TQPA 2XUBA 3EUAA 4D5CA 4A3MJ 3TMOA 3GTQJ 3DXJF 3H3ZA 1V5EA 1WI9A 2COMA 2G9WA 3QWLA 4MIMA 3HHHA 1VI0A 3VYRB 4DBQA 4XLPF 1BOAA 3SZPA 5HLHA 2H09A 4AYBA 2R7WA 2OF7A 3TBIA 1YS7A 2KJCA 4JX6A 4ZH4F 1GV5A 2Y0SA 4ZYHA 2HKOA 4IKFA 4L0YB 2UWMA 2DA5A 2BHZA 2F5CA 4RBOA 1Z1DA 1Y8RB 1W1WE 1R7JA 5FLXK 1IN4A 1LEAA 2Z99A 3C3WA 1YOVB 2CW7A 4A3KJ 3MAJA 2CO5A 5IYCJ 3KPHA 4JYKA 5LRSA 2N8GA 1YJ9I 3RSNA 3E3VA 1ZGWA 5BMZA 1BIBA 4HX8A 3OYGA 5CVRA 2F5VA 1RPWA 1ZG3A 1IV6A 1YE9A 1A6QA 1SD7A 1FLIA 2QSGX 3CP2A 1QZYA 4XIDA 4ZYDA 2CW0F 3IKTA 1ZREA 4N4NB 5IP9J 3HC7A 3GEZA 3HGYA 4L9VA 3IV5A 3VYUB 3FF5A 3I0TA 4P5OA 2QUFA 4A0XA 3LOCA 5F1RA 2IA2A 2R4GA 1R6RA 2IA1A 2KHMA 4AIHA 4A12A 2FXAA 1KU7A 3KEYA 1AU7A 1RKTA 1K78B 3A0HC 4FQGA 2R92J 4HA8A 3S2DJ 3ERED 2VQGA 1I1GA 4RM3A 2PLYA 1AWCA 2XGDA 3CCQI 1JGGA 4DYRA 3FK6A 1FBQA 2DAOA 1DU6A 3BQZA 2IGMA 4GXOA 2BHYA 2GA1A 5CVIA 2UV1A 1FYMA 3I58A 3I3LA 1IZ1A 1YX3A 2FJ1A 1QPMA 2KLOA 1MGTA 4ESFA 1I39A 2EWNA 2L7ZA 2XAQA 3SEQA 3WU1B 4XOTA 1WGXA 1O4XA 3CLQA 2I8DA 2NNYA 1F1ZA 1POGA 3G1MA 4XRSG 4OWRB 1VQ9I 3HSRA 2V79A 2HTJA 3QPSA 5GAGJ 1B4AA 1LDDA 3NQOA 4DW6A 1ITYA 4IXAA 1RI7A 4M73A 4CYCB 4II3A 2MC3A 2KZGA 2DOAA 1MJBA 3P9IA 3FK7A 3WTWC 2VC1A 2DMTA 2CFXA 4C9YA 3OYKA 4XBFA 1LE8A 2JK3A 3KZYA 2AQEA 3P9KA 2GM4A 2FBKA 3KP7A 4Q5SF 2MW8A 4BQQA 5EGOA 2L2OA 1R5ID 3S14J 1OISA 2M87A 3E6DA 4CZZA 1KGSA 1DPRA 4FCYA 3S2HJ 2IVMA 2VLAA 4RGXA 1TWGJ 2HTSA 1WZ2A 2FOKA 3IH4A 4WF2A 4AC0A 2UUZA 2QVOA 3TP3A 5HLGA 1XSVA 2DA2A 4BE1A 1T33A 3KP2A 4LG0A 2HYFA 5M5YJ 3PIOF 1QVTA 2AQFA 5BPDA 1JTXA 2CH0A 3BT9A 4ON0A 3F8CA 5CVJA 3ZMSA 3BG6A 4K2EA 5LGUA 1BR2A 2AXLA 2PFBA 2R7UA 2O9LA 1HCRA 3S15J 1FYLA 4OIOF 4XNFA 2HVRA 2WAQA 2CQXA 1FSHA 3G2BA 4BY7J 1X19A 2F5EA 2FSWA 5IP6A 2JVGA 3PM1A 2P81A 1USSA 1YJWI 5J1RA 5ICEA 1ZK8A 3MZYA 4FTHA 1I5ZA 1S29A 1HOMA 2OV7A 2VKDA 2XGEA 1YRNB 2ELKA 2ZNZA 4XLCA 5DUKA 3RYPA 2EA4A 4Z2YA 3W2WA 4KIGA 4PJMA 3HOVJ 2LSOA 2QBYB 3JTHA 1YG2A 1Z21A 3UKGA 4G6DA 3SQNA 3FXQA 3L2VA 4BXFA 2ZXHA 2K3FA 1MH3A 4R1HA 4MFDA 3OR1C 1RESA 2GOXB 2DPUA 3IRRA 4I0BA 5JHFA 2BY1A 1SANA 1IN5A 5HDKA 1BOBA 2DFHA 2D45A 3DLAA 2IPQX 1A6IA 4TV7A 4XKVA 3CO7C 2L9NA 2XV4S 3I4MJ 1W7PD 3HOYJ 4C2MJ 5JVGF 5B1BH 2L5QA 1OCCH 4DZJA 2DT6A 2LR8A 2PEXA 4B3AA 2M34A 2RNJA 3W3CA 1K78A 3K4CA 4P96A 2ZXJA 1QPIA 4EQQA 3FX3A 1TNTA 4HNTA 1QZZA 2FU4A 3SJMA 1JKPC 1XSXA 2BGCA 3I56I 1W36C 2C6YA 2JSCA 1X58A 2UZKA 3J80Z 2KDZA 3SFZA 2G7UA 4M3DA 4E70A 2DA7A 3VSLA 4XRMA 4G6TB 1YLFA 5JLWA 4HDVA 2RAEA 3ESWB 1F36A 1AKHB 4P9FA 3CF5F 4MQVA 2WADA 5EEAA 4V19K 1BC8C 1LDKB 4ZTFA 4I98B 4BXUA 3PNVA 2LYCA 1R00A 2CU7A 4U88A 5JLXA 5J1YA 3V8JA 1X3UA 3H9JA 2P5KA 2CJJA 2VJIA 1UFMA 1DPUA 1T08B 1TT0A 1WQ2A 2LH9A 2OZUA 4LOCA 2DJNA 4RB2C 2X48A 3DBHB 1HQCA 3DFGA 1WCMJ 2PBIA 3G6EI 4CYCA 3C2BA 1OPCA 1ZR4A 3HHGA 1OKRA 3CLOA 4XMYA 3MKLA 2HYGD 2MA3A 2VN2A 4QLCU 2CWEA 3R0JA 5LGNA 2MSYA 3WTZA 4UVAA 4B09A 4PUSA 3GZNB 2QENA 2LF7A 2P7VB 4OIRF 2XKPA 2LBFB 2R7ZJ 2ZJRF 2HGCA 2PMZN 1CF7B 4BKXA 2ZMEB 3DWLE 1V3FA 3JREA 1XGSA 4M3EA 1IW7F 2I10A 3OYIA 3K4NA 1T0FC 5K7FA 3AG4H 2FBHA 4B48A 2EBIA 4BHBA 4AIDA 2X6XA 3AL0B 3VDXA 4F7ZA 1I50J 3CCLI 3S8PA 2AS5F 2M4KA 4IHTA 3V4GA 2ISZA 4KN7X 2DOEA 2H6BA 4ETSA 2E60A 4IX7A 4IZZA 5D6FA 3EYYA 4S04A 3M3YJ 4WWCA 4BQAA 2CQQA 4BE0A 4II2A 3B73A 5ICFA 3TDZC 1K61A 1NH3A 3TW7A 2MC4A 1ORKA 4A5NA 4BAYA 1DDNA 4NB5A 2L4MA 3R0AA 2DFEA 1W36D 2VT2A 1JE8A 3RTRA 1MH4A 2KP6A 1Y56A 1T0FA 2DQLA 3K4JA 3V7SA 4RLFA 3A2KA 3I59B 3KYCB 4S05A 2LOOA 4ZYEA 1TL8A 3WTSC 3CQZJ 3U1KA 5JFRA 5F27A 1R49A 3A1YA 3RIRA 4NBQA 1HXDA 4NHJA 1ACIA 1U3EM 3BQYA 3QOPA 5E8IA 3OS0A 1QQIA 2VPRA 3KZZA 4BBRJ 1B9MA 4KUMA 1VQLI 1IRGA 3E6MA 1O7LA 4X1EA 1WKMA 2XRLA 2VXDA 2Y75A 1R9TJ 1HA8A 2IGKA 3BG5A 3S1NJ 1YRNA 2F4IA 4BGDA 3G1LA 3OL4A 2W4SA 5F6FA 3A03A 1FOXA 2L7KA 1FSEA 2QBYA 1RIOH 4PZJA 2FD5A 2ZCWA 3RCOA 1A04A 2WTEA 2M1BA 5E18F 2NYXA 3HOXJ 2PX9A 2LK2A 1UAAA 4FHTA 1FZPB 1TBXA 1Z0XA 2VT3A 4Y33A 3DPLC 3X2QH 1TZLA 3CC2I 1D0ZA 1X3WB 4HOBA 3LSPA 3OYNA 1IN6A 2EK5A 2VONA 3H92A 4BNCA 4GFBA 3L2RA 2BVMA 1QHGA 2CSOA 2K27A 2YR2A 4RLQA 1T98A 4PSXA 2WY8Q 1F43A 1TT5B 1IUYA 2HEOA 4ZYGA 5FLMJ 5EEHA 4FETA 3CCVI 2IAIA 2FMYA 5FFXA 2XAUA 2PG4A 3GX4X 3HYIA 2NVTJ 3D5RC 2FEZA 3OS2A 4PFOA 3R61A 4XLFA 2CW8A 2NOJB 1S6LA 2V1XA 2KIUA 2VL8A 5DS9A 4D7MA 2HDDA 4W1UA 3K4BA 1M1EB 4MHGA 5AIQA 2K9QA 2YU9J 4IHWA 3PO3J 1D8KA 1P6RA 2GWRA 4JK1X 4EJOA 1I1SA 2XPVA 2IS1A 4MGRA 4M6VA 3KETA 5IT9K 2MFZA 3DEUA 1AKHA 2M8GX 2VB6A 1HSTA 3SZGA 1H88C 3PUBA 1YYVA 2O61A 1LFBA 2ZJPF 3HOSA 2G7HA 3MQ0A 2E71A 4L5JA 3JRHA 3TDUC 3OIOA 3OIQA 3ABMH 3ZQ7A 3FXLA 3KEQA 2CGPA 3ERMA 2ZMEC 1JJ6C 1BM9A 4AD9A 4A69C 2CMPA 3W6KB 4BH9A 2VUMJ 5A2QK 4I0AA 5GPAA 1ETWA 2HR3A 3HPHA 3E1SA 2ISYA 3LMMA 4XLNF 3K6GA 4WK8F 3OMYA 4A0ZA 5D8LB 4O5VA 5LLQA 1E3HA 2QYOA 3AL0C 3NWSA 3ZN1A 1J0RA 5K5QA 2ID3A 3TO6A 1P4XA 2CQKA 3OIPA 3BZ6A 1NK2P 2G0EA 4P1WA 2LLKA 1Y8QB 3ELKA 2LMDA 2LBFA 3JRBA 3E5XA 3EPZA 4CCJA 3G1OA 5ILSA 1U0JA 3BOQA 4FX4A 2DI3A 2FBIA 2ZMEA 3H0DA 1CF7A 1A31A 2Y9ZA 3GLLA 4BXXJ 4CCMA 5D5VB 5KCMA 3T5XA 3G4SI 3JCUC 1ETYA 4YIFA 1GXPA 3LA7A 3L7WA 5DDGA 2P6TA 2O03A 4UNOA 1Z77A 2LD5A 2VBZA 1U78A 2V4JC 2X4HA 3O8HA 4ZYAA 2H8RA 2Z16A 2B7EA 1SC7A 2DDAA 2EQRA 5F0CA 1LJ9A 4ASNA 5J4YA 3A0BC 2DA4A 3QPTA 1V5FA 4EJVA 2QQ8A 4D0PA 5D5XB 1XMKA 2LY9A 4BEHB 2GAUA 4HX7A 1WJCA 3ZMDA 2Q2EA 3I71A 2Y48A 3GTGJ 3IUOA 2YUSA 5HS9A 3WTYC 2M5WA 1IDYA 4GYGA 3KZIC 4LLGF 4XLAA 3JAMK 4FE4A 5L3GA 1TW3A 3LSTA 1R58A 2KIMA 3ISPA 3I59A 2NS7A 5B1AH 1MJ9A 3BJ6A 5DUIA 1TC3C 2GXAA 1KONA 3GFLA 3BP8A 3J7ZI 3PJRA 3KCCA 3IC7A 4OINF 3K1MA 1ENHA 2MBFA 1KU2A 4AIKA 1W0UA 4BU2A 1XGOA 3CO6C 2ME0A 2L54A 3QYFA 3FXUA 1R5HA 1FP2A 2VQCA 4QSHA 5EEGA 4HRIA 2Y2ZA 3PNTA 3CUQB 3I64A 4XM3A 3GVAA 2AHQA 3ASOH 5J3LA 4FISA 4QPQA 5E1XA 3PQKA 1TQMA 5FKNA 5AONA 2E2HJ 2OTJI 3RDIA 2K9MA 3FDYA 4XN0A 4UY8I 1Y0NA 1FOWA 3F9KA 3I4PA 4B4CA 2DLLA 2K7LA 1RC9A 1HW2A 2RKHA 1BBYA 2RVCA 3KP4A 4W97A 2R7SA 3I54A 1B6AA 1QHHD 1EH7A 4NC6A 3FXRA 3QOEA 1Z05A 5CQGA 5F1JA 2QZ8A 3J7AO 2XSJC 4RB0A 4ZDLA 3EUKL 1KU3A 1TW2A 3BTIA 4C2UA 4M9XA 1FJLA 1YI2I 4I7HA 2VIXA 2IP2A 3BTLA 4G7ZF 2TDXA 2VBYA 2WBMA 2XB5A 2QA4I 4WX9A 3HM5A 3EETA 1KYWA 1O57A 3HRMA 2BOLA 3MFKA 4CH7A 1UB9A 3IKVA 1ERDA 1LB2A 4NC8A 4JQFA 2FX0A 3FMSA 4YIIA 4M72A 3W6JB 2KRHA 2EZHA 1K4TA 3EDPA 3S16J 1ZKGA 2MD5A 2HQ5A 1IN7A 1W7PB 3FZVA 1SAXA 4LFUA 5K7HA 1G6NA 1HKSA 1OJLA 4CA0A 5E3LA 1B59A 1S7EA 3FBIB 3KX2A 3COAC 3E6CC 3ABTA 4IQ4A 2GBYA 2KZVA 3F3XA 4YFNF 3IHUA 3ZXSA 1W5CC 4CICA 5KAIC 2EV6A 1F4KA 2M0CA 3DU6A 4I09A 4XONA 2L9VA 3QP5A 2QQAA 1VNDA 4BQNA 2IRFG 3MKWB 1ZG1A 3CCSI 4UUVA 1E3PA 4EJWA 2Z33A 1RNLA 3CJQB 4ESJA 3OS1A 1EF4A 4HW0A 5D8KB 3IWZA 3C2GA 2F5DA 2IGNA 3CDIA 5CPRB 2B9SA 4RAGA 1ZN2A 3HEFA 2GIZA 5ICCA 5IT3A 1NHAA 1X2MA 1Z91A 3UNGC 3CF2A 1WJFA 4GGGA 4AU7A 1X1AA 3BPXA 2M4GA 2UXXA 2EILH 3CCRI 3HRSA 3F72A 5LBQA 4CCKA 3K10A 4PCQA 2DCEA 2HVQA 3BTJA 3KEOA 1N25A 4UVBA 2XC7A 1OCPA 3F22A 4DYCA 2LNBA 4ENNA 4BEHA 2DTRA 5B66C 1JI8A 2M30A 1BI3A 5FROA 3D5SC 4LJZF 4V2GA 1WJEA 2M0MA 3QU6A 2X1CA 4HDUA 3CUQC 3CCEI 3WGIA 1RETA 3QQAA 2CUFA 2MH9A 5C44J 4DGWB 2DN0A 5HS8A 3GYHX 1H0MA 1TWFJ 2ZSHB 4AVPA 2A6EF 4LIUA 1LPQA 4G8XA 3WU2C 2QQ9A 3FXOA 3K2AA 2XROA 2HDCA 1ZLJA 4UXNA 1CQTA 5HS7A 3O2PE 4UUSB 4MEXF 2STWA 1DP7P 3E97A 3Q0UA 2GOMA 1HKTA 1PUFB 3I4NJ 3F8BA 3L2QA 1O3TA 2LKPA 2O3FA 3RQ4A 3CUQA 2V1UA 2XKOA 3QRFF 5M5XJ 2O0YA 5DCFA 3DBRB 1SVMA 2E34A 4CSWA 4A3CJ 4BUPA 3GTMJ 4IPAA 2DK5A 2WB1N 2M7BA 1Q1VA 1TWHJ 2DTZA 3CDHA 2GQQA 1B9NA 1FEXA 5E1WA 1K79A 3Q0VA 5K5RA 3DKXA 5ILVA 1TQIA 4KT6A 5LD2C 1UHMA 4EM1A 3BTCA 1T95A 3CTAA 2XIGA 3V8LA 3OYEA 2O5RA 2HWVA 2VC0A 3L09A 3D0SA 4BYYA 1W5SA 1YITI 5EG0B 1EH8A 4I76A 1QNTA 3SDBA 3CCUI 1VQ5I 1XSDA 4U7BA 1MMAA 2CUEA 2WC2A 5LHHA 1I6HJ 4PGHA 3PSIA 3ULQB 1PYVA 1WJBA 1OFCX 3CJTB 2QKLB 4DOZA 1D1BA 5EZHA 2W57A 4JBAA 4JX5A 3GF2A 2DT5A 2XGXA 4P55A 3OWTA 1DP3A 4DZPA 2DW4A 2XRNA 3Q3SA 4M74A 1HLVA 4IJAA 3J81K 2CV0A 1ZYRF 3AAFA 2OCEA 1BC7C 3S1RJ 3EYIA 3HOZJ 4MTEA 1GHCA 4IL6C 3F0CA 2P0WA 4HX4A 3WGGA 4F91B 2DMQA 1MDMB 1Y1WJ 1FBSA 5J47A 4MTDA 1W7PA 2VQHA 4XN3A 1LVKA 5LHGA 2NRAC 1OYIA 3NWTA 1ZHFA 4B47A 2A61A 5E20A 4ZTJA 1RKWA 4U0WA 5L3DA 3JRDA 1X4OA 4IQJA 2Y0SN 5BQTA 2ACJA 4RAYA 1XCBA 3IWFA 5DEQA 4HSRA 4M6YA 1K6YA 1FIPA 1R23A 2VI6A 1TWAJ 3GBGA 4DQ2A 3TGNA 5DCMB 3V42A 3FMQA 2V7FA 3I53A 4A5MA 2DYRH 2CQ7A 1VQOI 3ZMUA 2O6GE 3WG7H 2OQGA 5CYVA 3JSPA 3HOUJ 4AWXB 1VFCA 3WTVC 4XKWA 4OU0A 2H1KA 1WRJA 3HL2A 4CCLA 2VQLA 2LDUA 4YG2F 1KA8A 1R5GA 4YFXF 4RA2A 1R4MB 2K9NA 1I3AA 2E2IJ 3M7GA 4E6KG 3BJAA 4CCOA 4G94A 4R79A 1ZRFA 3HSFA 4L9NA 3T0YA 2VODA 2CS3A 4XICA 1ETOA 4HQMA 1I3QJ 5IYDJ 2KJBA 4JOMA 3GFJA 1FBUA 3GO5A 4B1RA 2WY7Q 3VSKA 3GMEA 3GTJJ 3PIPF 5BS6A 3GTLJ 1B1BA 3BR6A 1SMTA 3WODF 1H9TA 2BXYA 4C3HJ 1QU3A 2JT1A 4ZZDA 2NXNB 3HZJA 3NAUA 1S5LC 3KP6A 4NUBA 3OYHA 3HUGB 4HF0A 1D8JA 5E79C 5J8FA 1D1CA 2WV1A 5HLIA 4BL0B 1J09A 5FLVA 1GVJA 3OYAA 4UUSA 4M3BA 2DQRA 4X0GA 1Y39A 5EDNA 3H1CA 4IRGA 1PUFA 5EJCA 3PQJA 4ANJA 5M5WJ 2FQ4A 4CYDA 1OQYA 4KFCA 2KRCA 2D1HA 4L9JA 3ZPLA 1WVRA 2HQAA 4ZZLA 4A3BJ 2E19A 2ZNYA 3F6OA 1E0EA 3L9FA 1RRJA 4PK4A 2RDPA 3LL7A 3E7LA 4QTRA 3G73A 1T2KA 4G7OF 1S7AA 3QAHA 1U8RA 2F4MB 1F9NA 1ZLKA 1UELB 2L7FP 2YSRA 4ITVA 1S8NA 3LA2A 5EG0A 3V7CA 4XRSA 3DTEA 3MKZA 2FUG2 1O7FA 3CJNA 1GDTA 1R1TA 4BY1J 2IEKA 2A69F 4EJUA 2H8WA 4U87A 1YHQI 5GAHJ 4D5FA 4E7SA 3S3OA 3S1MJ 3OYFA 1XD7A 4V2FA 3DCFA 4PJ0C 3TKYA 5L3BA 1VQNI 1SFXA 2XSDC 1MKMA 3HKZA 2M45A 4OIPF 1MDMA 2QWWA 1S7OA 2PI0A 3DF8A 4U0VA 2ZJQF 1FY7A 2A3SA 1SMYF 2H1LA 2Q2EB 4Q47A 4LIVA 1L0OC 5LFAA 2DT7B 3ABKH 2WAFA 3RYRA 2K02A 2E35A 3HTUA 5DYMA 3OOPA 3CD6I 2KL4A 3B02A 3GTOJ 2RC4A 2RQPA 5L3EA 4ESBA 1JJ8C 4GCVA 1ON2A 3ZMZA 3M4OJ 3HIFA 3AFHA 2RQQA 2W00A 3ABLH 1IJWC 3J7YJ 4Z6YA 1YS6A 3Q5FA 3R6SA 5F0FA 2DA3A 3S2WA 2HU9A 1VQ4I 1MMDA 2Z9OA 3A01B 2OU2A 3PUFA 3O8GA 5DCMA 4OMYA 4X6AJ 2NAZA 4MLOA 2EB7A 2NS0A 3O3KA 2EZIA 1NG6A 5CLSA 3OSGA 2WAEA 4E7KA 2V9KA 2EZKA 5FGMA 4DNCA 1U9OA 2PQ8A 4JP0A 1JT6A 2V6CA 1IRZA 2BBYA 1P9QC 1KQ9A 1IUFA 4OAZA 5LGTA 4LB5A 2VKVA 3ABUA 3WHCA 4B44A 4ZDOA 3P9CA 3ZQQA 1TNSA 5KHDA 1B72B 3CCYA 2CUJA 3S17J 3BDDA 5BPIA 4C30A 1D0YA 3SDGA 3SZTA 2FA5A 4PDKA 2EFPA 1Z6RA 1A5JA 4I99C 9ANTA 2OD5A 3ECOA 1P4AA 1MBHA 2XF6A 4HBLA 2JA8J 1WH7A 3ZP5A 2DO7A 2NVQJ 3K4KA 2EV0A 3GFIA 3HRTA 5LHIA 3HUGA 1OLTA 3BROA 4XSXF 2OQRA 1EKEA 4HNUA 2K85A 2ZJ2A 2XAGA 2XVCA 5HLTA 2JA6J 5J1UA 1LKXA 2CUZA 1ETVA 2J5OA 2L4AA 4AUXA 1W5TA 4KIBA 2LP0A 3OV8A 4L5IA 2HVSA 2IT0A 2DPDA 2R7VA 5GTIC 3KE2A 1MIJA 3K69A 3DU5A 4A3FJ 1Z67A 2OJED 2QGUA 1J59A 3IAS2 3RKYA 3K1NA 4EEFG 3CCJI 2BE5F 1N77A 3LSJA 5GP9A 1IF1A 2VJ4A 5LRRA 1P7IA 3VODA 2M8EA 4KITB 3K70C 4RB3C 4MNUA 3BY6A 1R1UA 2PMHA 2L0KA 2E7XA 2M3AA 5K7ZA 4D1QA 3K0LA 2UXNA 5CJ9A 3HTSB 3HPGA 3QODA 3ZQHA 1K83J 1DQUA 2JZYA 3FXJA 1U5TB 4NC7A 1X2NA 3ZMTA 2R7XA 3BG3A 2MGQA 3MKYB 3RJPA 1DUXC 4OIQF 1PP7U 1MBFA 3QYBA 2RNGA 1BN5A 1WFXA 4CDGA 3GCMA 2A68F 2X85A 3OYCA 3M8FA 1IXSB 1P2FA 4YIRX 2ZFUA 3G71I 3W6VA 3F23A 5ED4A 3OYMA 2BV6A 4CCNA 2PMUA 2ETHA 2DA6A 2DYSH 5FD5A 4EGZA 3RKQA 5J4VA 1Z7LA 3N97A 4YELA 4GRIA 3WE3A 2VJJA 2OCCH 4O6JA 4Y3OA 5CVUA 3BWGA 3WU0A 2HFHA 3V7RA 1WJDA 3IH3A 1VQ7I 4LLLA 2FE3A 3H5NA 5TRDA 4PFPA 4F52A 1UG0A 4XR6A 5TISC 4F3QA 1MNEA 2Q0OA 2HKXA 1U8BA 5L3CA 5FKLA 5HVQC 3ML6A 3GFMA 4BQOA 4PGGA 3DEWA 1ON1A 1USTA 1GV2A 2KRFA 2Y31A 1QA6A 1JGSA 2V6EA 2QSHX 4NDLA 2VOPA 2F5FA 3MN2A 4IRIA 1BW5A 3LWFA 2DODA 3ZRGA 3A01A 3M9AA 4D7NA 1MW7A 4C3JJ 1JT0A 1ULYA 3EUHC 1VQ8I 1Z9CA 5DTDA 1AOYA 3HOWJ 2HZTA 3H9GA 2AO9A 4H0EA 3K70D 2JQ7A 1UG2A 4BS9A 2W25A 1MNDA 3LAPA 2EFWA 3AG1H 1G3TA 3PL8A 4XLEA 2ZKZA 2HXOA 1MD0A 5IT9Z 2NNNA 4KDPA 2LY2A 2WA0A 2Q1ZB 4XSZF 2VBWA 1IC8A 2CRGA 2L02A 3WG9A 4LD5A 4NQWB 1WHUA 3KLNA 3MWMA 4UV8A 1B72A 3CDLA 4HV6A 2LREA 2YU3A 4XK4A 1NG7A 2GA2A 4KICA 4AVZA 1IXCA 2IGOA 3EUHA 4I02A 5LEJA 4KISA 2CFOA 2M9HA 1Y1VJ 4A3EJ 2Z1DA 3JRIA 3WE2A 5F0HA 5GTHC 3BCBA 2PJPA 1X3ZB 3O6BB 3VEPA 4BDZA 1X1CA 2BY0A 5E1ZB 1G3YA 1YIOA 1MBEA 4KYWA 2E5ZA 3C7JA 3BZKA 5J8CA 2DMNA 1LQ1A 2YX7A 2BVLA 3BG9A 3NRVA 5FFZA 3DKWA 3BPVA 2EFQA 2NS8A 2X1EA 1XN7A 1HDDC 2EA2A 2LY1A 5H2FC 1ZTRA 2X51A 3SEZA 3ZMVA 2FRHA 2L9RA 4QIWN 4N4OB 3W2AA 2MH2A 2STTA 2JUGA 4YRVA 1BJZA 4N9IA 5H6RA 1EA3A 1U5TC 3FWEA 2ECBA 3ZOBA 3CJRB 4M9SA 5JR3A 3OR2C 1DGRM 1ETQA 1JHFA 4A3JJ 1J5YA 2O8KA 4CHUA 3TL4X 1OR7C 2V26A 1FWZA 1IG7A 4A3DJ 1SVOA 2CG4A 4RB1A 4B8XA 1UCRA 3BR2A 2ZBKA 3RKXA 2A6TA 5FKMA 2L9SA 2Z3YA 2ELJA 2LKSA 3U2RA 3KYLA 1D5VA 3PSFA 1UMQA 1U5TA 5KK1A 4HLXA 5E17F 4N9HA 1SD4A 4MEYF 3PFIA 2XF7A 1Z3YA 2ADUA 2AXTC 3QPHA 2W82A 4F92B 3S3MA 5HOOA 3MZ8A 3LAJA 4LMYA 1JKQC 2HOTA 1OR7A 3WHBA 1C0WA 4BBSJ 1QO0D 4XOPA 3BG7A 2R5ZB 4ENKA 1UZCA 4C2TA 1MBJA 2ZO4A 1BR1A 3H3VK 1MBGA 3IAM2 2RREA 3VOEA 1LUJB 1IDZA 2BW3B 5D5WB 1L3LA 4RGSA 3OYLA 2A6HF 2NVXJ 5ERIA 1ONVA 1YFHA 2XASA 3FKJA 3GLXA 2P8TA 3ASNH 5CKTA 1OCOH 1ZGJA 1VQ6I 3H5AA 2D5VA 1QVUA 2P5VA 2DMPA 1DU0A 5HDGA 2JPCA 3TW6A 2ME6A 4BJ6C 3GWZA 1P7JA 3T8RA 1UHWA 2TCTA 3K2ZA 5FRNA 3GTPJ 2R7FA 2ICWG 5EF6A 3IH2A 3CMEI 2EIJH 2J5PA 2XPUA 5K5OA 1U2WA 3B6CA 3C1DA 2LG4A 4FASD 2Y9YA 3VYSB 3FMRA 2DK8A 1T8IA 3FISA 1IN8A 5KAFC 3ONQA 1KU9A 1T39A 1KQ0A 2D2WA 3TO9A 4A3IJ 4XORA 2MLGA 3REOA 3R60A 3B6AA 3H35A 2DOFA 5ILUA 3L2WA 3JW4A 3K4LA 2K40A 4KIFA 1IRXA 3ZN0A 5D6EA 4WXHA 5EYRA 3GZ6A 1V54H 3QPLA 5JHUA 2H94A 3TP0A 2QLZA 5L3FA 2KKOA 1PUEE 1P92A 5BNGA 5FRMA 1WWXA 3PFYA 1LVAA 4E4HA 3OYJA 3H3UA 3FM5A 1T56A 2OA4A 1T38A 3RZOJ 2XDVA 1ZELA 1ZG5A 4NQWA 2F48A 4KA4A 5EZGA 2QEXI 1SFKA 2X9DA 3OOUA 2R5YB 5DM7F 3LSGA 4L18B 2HXIA 4A2UA 2JJ7A 2B63J 1GUUA 2P4WA 1O3RA 1BI0A 4O3MA 2KT0A 3H9QA 2XPWA 2BYVE 2HZDA 1D0XA 2KDOA 4HZFA 5DD4A 3RPQA 2I5UA 2Y0MA 2E1CA 2DJIA 1MZBA 2HYJA 3LSIA 2KPMA 2CYYA 1VTNC 1E2XA 3C2HA 3OY9A 3E0JB 1I6XA 3KLOA 1Z3XA 1APLC 4CXFA 1R22A 5BOXA 3R4KA 1G4DA 3FHZA 3RQIA 1SVLA 3C18A 1SAUA 3E6BA 1IO2A 2D1VA 2P7CB 1BL0A 3CESA 2K4BA 5FLXZ 4XLHA 1LFUP 5E3MA 4ZC3A 1KQ8A 3GXOA 1LNWA 5CVVA 4OAYA 2IS4A 3S3NA 1OCZH 1GXQA 1YX5A 3ZR8X 4J19A 3G3ZA 3GTKJ 3JRCA 1SFOJ 1ZRCA 1FTTA 3LQRA 3HB9A 3L1PA 5B5EC 2E7WA 5FJ8J 3K7AJ 3BJOA 3LNQA 2Y30A 3MCZA 3L00A 2JA2A 2L3DA 3M1EA 4D9JA 3MVPA 2KIFA 5TJJA 2W48A 1YTYA 5DD8A 2JRTA 3J80K 3K9TA 4IOCF 1VQKI 1HKQA 2EV5A 2JPBA 3FIWA 4F55A 1WJ5A 1VF9A 3LSKA 5FO5A 4AYBN 1LFPA 3T1BA 3TO7A 3VFZA 2LKXA 4PJLA 1OYYA 3IRQA 3WTXC 1QRYA 2PMZA 3FXMA 4WCGA 4E7JA 3KYDB 2VASA 4E7ZA 1OMIA 1J7KA 3PO2J 1HF0A 4JX4A 5J6XA 1J9IA 1XCVA 2EPFA 2WV0A 4UB6C 2HI3A 3VYTB 1MSEC 4XL9A 2HPMA 1QBJA 3MEXA 3P7NA 2R5ZA 3HG9A 3ZQLA 3LSMA 4L5EA 4ENMA 2E1NA 3F8FA 3F21A 2P5LC 2V9VA 4BE2A 1ZAOA 1YO5C 2XAFA 4A93J 2IJLA 1WI3A 2BW3A 2JMWA 3DP7A 4IF4A 2BEOA 2FMLA 4Y13A 2V1NA 4G7HF 2DXIA 3CZ6A 4Y52J 3AG3H 3DPTA 3LSRA 4KT5C 3CCMI 1R1VA 1BR4A 2X1DA 2BY3A 2HOEA 4PSWA 2X0LA 4GYIA 5GPCA 3JSOA 2IS2A 3JRFA 1EJ9A 2R0QC 1ZQ3P 2W84A 3FM3A 5E3OA 1OYWA 2VXZA 1WPKA 2VE8A 2O8XA 3RI4A 3ZQGA 4I6ZA 1JXSA 1MMGA 2DFIA 4HV5A 2K5CA 5CQEA 3U1DA 3I55I 1BW6A 4RMNA 5JI6A 2A07F 2NVYJ 4BJTA 2ZFWA 4MFEA 4EV0A 2K3PA 4EM2A 3OSFA 4Y4RA 2ZXWH 3J81Z 2HPIA 2OTLI 4A3LJ 1IGNA 3EQLF 3J7AY 1IV8A 1YJNI 2KMUA 1VQMI 4RGUA 1R36A 2XHKA 5TGTA 4ZJZA 3GW2A 1FYKA 1MSFC 3AKZA 4G6QA 2EFOA 3PNYA 1LDJA 3I9V2 4UHTA 5KVRA
chains in the Genus database with same CATH topology
4BHCA 3E5UA 5JVTA 2IW5A 4MQ9F 2EJRA 3RKWA 4Y17A 1EH6A 3NEUA 5D5UB 1SD5A 2LF8A 1YW9A 2XAHA 2RN7A 1U6GA 1FPQA 3TQNA 3WGHA 3TOAA 4L9TA 1EV7A 2YX4A 4RGRA 2HQRA 4RS8A 3WTUC 2L01A 1IAWA 3TOBA 4KNYA 1D3YA 2W85A 1STZA 2GZWA 2HS5A 4IHSA 3WTTC 3KP5A 4GO1A 1WSUA 4I2OA 1SFEA 1J2XA 4KN4X 2DBBA 3KP3A 3N4MA 1G3SA 1XGNA 3QP6A 3M8EA 4EVIA 2Z5UA 5AIPA 4QWQA 2K4JA 4BHPA 2HQNA 4M71A 2FQ3A 1O3SA 6PAXA 1ZARA 4HLYA 3DQVC 2H27A 5D4RA 3HRUA 1TTYA 2GXGA 2QQBA 4FX0A 1FOKA 2ELHA 1ZRDA 2FNPA 4CO8A 2DU9A 2ESNA 2GIVA 4LGWA 4HF1A 2OBPA 5F64A 4A0YA 1IRFA 1XDSA 5ICGA 4Q48A 1XGMA 2V1DA 2FNAA 4EGYA 3U9GA 3F6VA 1H9GA 1K7AA 1RZ4A 1FNNA 1CGPA 4Y15A 1FP1D 4EMSA 3GUDA 4IRHA 2W24A 1S3JA 1HBXG 2RGVA 1HSJA 4U0YA 5DV5A 1BI2A 1ZH5A 4XRFA 1E17A 2OZ6A 4HAMA 4LB6B 2MLKA 4P9UA 1Y0UA 4U7DA 3V8KA 1REPC 1O3QA 3Q9VA 4R8HA 3MZHA 4WXDA 4YFKF 2EFNA 3DV8A 5FB2A 1KYZA 2GXBA 1JHHA 1FC3A 1XMAA 1YW7A 2VE9A 4KMUX 1BJAA 3I5UA 4AIJA 3F8NA 2YPRA 1SFUA 4ENJA 4FT8A 1W4MA 4UV9A 5H20A 3CUOA 2OAZA 2XAJA 2PN6A 3Q9SA 4RAZA 3KFWX 5E8GA 1Z6TA 1F5TA 1ZGAA 2R3SA 1IXRC 1ODDA 3D5LA 1P4WA 3F8MA 3JTGA 4UVCA 4LLNA 1J75A 3T8TA 1SD6A 4LK0F 4EJTA 4CGZA 1HW5A 5LEKA 4M9ZA 1QGPA 3RPUA 1RUOA 1LEBA 4HF2A 3LQQA 1Z7UA 1G3WA 3VB2A 3HOTA 3LFKA 2RV8A 2Q8KA 4WXCA 1XB4A 1FT9A 2R7DA 4OOIA 5HDNA 2VBXA 2P6SA 1I27A 2JTVA 4A6DA 2H6CA 1RUNA 1BIAA 4OMZA 1BI1A 2WWYA 3SXYA 3ECHA 3SHFA 2ESHA 5A2QZ 4HQEA 3L2CA 2FF4A 1FX7A 1T6SA 1MJAA 5D4SA 5FD6A 4G9YA 4EM0B 2K86A 4M6XA 2B0LA 4L0ZB 1YQAA 3ROUA 2A5YB 3IL2A 4I01A 1YW8A 1PDNC 2IA0A 4LK1F 4IVNA 4HYEA 1HW1A 4Q4ZF 3QU3A 3E5QA 3GZ5A 3LA3A 4KMFA 1V4RA 2VOOA 3JAMZ 4N0BA 3HSEA 2QM3A 5H6QA 4LG0B 5K1YA 3K1PA 1Q1HA 1K6OA 1PP8F 1TLHB 2F2EA 4A6EA 1XDUA 1TQPA 2XUBA 3DXJF 3H3ZA 1WI9A 2COMA 2G9WA 3HHHA 4XLPF 1BOAA 3SZPA 5HLHA 2H09A 1YS7A 2KJCA 4ZH4F 4ZYHA 2HKOA 4L0YB 2UWMA 2F5CA 1Z1DA 1R7JA 5FLXK 1IN4A 1LEAA 2Z99A 3C3WA 3MAJA 2CO5A 5LRSA 3E3VA 5BMZA 1BIBA 4HX8A 5CVRA 1ZG3A 1SD7A 1FLIA 1QZYA 4ZYDA 2CW0F 3IKTA 1ZREA 3GEZA 4L9VA 3FF5A 3I0TA 4P5OA 2QUFA 4A0XA 5F1RA 2IA2A 2IA1A 4AIHA 4A12A 2FXAA 1KU7A 1K78B 4HA8A 3ERED 1I1GA 2PLYA 1AWCA 1FBQA 2DAOA 4GXOA 2GA1A 5CVIA 1FYMA 3I58A 1IZ1A 1QPMA 4ESFA 1MGTA 2EWNA 2XAQA 3WU1B 2NNYA 1F1ZA 3HSRA 2V79A 2HTJA 1B4AA 1LDDA 3NQOA 4IXAA 1RI7A 4M73A 2MC3A 1MJBA 3P9IA 3WTWC 2VC1A 2CFXA 4XBFA 3KZYA 3P9KA 2FBKA 3KP7A 4Q5SF 2M87A 3E6DA 4CZZA 1KGSA 1DPRA 2IVMA 4RGXA 2HTSA 2FOKA 4WF2A 2QVOA 5HLGA 1XSVA 3KP2A 4LG0A 2HYFA 5BPDA 4ON0A 3F8CA 5CVJA 3ZMSA 4K2EA 5LGUA 2AXLA 2PFBA 1FYLA 4OIOF 1FSHA 2F5EA 2FSWA 1USSA 5ICEA 3MZYA 1I5ZA 1S29A 2ZNZA 5DUKA 3RYPA 2EA4A 4Z2YA 4KIGA 2LSOA 2QBYB 3JTHA 1YG2A 4G6DA 3SQNA 3FXQA 4R1HA 2DPUA 3IRRA 4I0BA 5HDKA 1IN5A 2D45A 2IPQX 4TV7A 3CO7C 2XV4S 1W7PD 2PEXA 2RNJA 1K78A 4P96A 2ZXJA 4EQQA 3FX3A 1TNTA 1QZZA 2FU4A 1XSXA 2BGCA 2C6YA 2JSCA 2UZKA 3J80Z 3SFZA 2G7UA 4E70A 1YLFA 4HDVA 4P9FA 4MQVA 1BC8C 1LDKB 4I98B 4BXUA 1R00A 4U88A 3V8JA 1X3UA 2P5KA 1UFMA 1DPUA 1WQ2A 2OZUA 4RB2C 1HQCA 3DFGA 2PBIA 1OPCA 3HHGA 1OKRA 3CLOA 2HYGD 2MA3A 2VN2A 4QLCU 5LGNA 2CWEA 3R0JA 3WTZA 4UVAA 4B09A 2QENA 2LF7A 2P7VB 4OIRF 2XKPA 2HGCA 1CF7B 2ZMEB 1V3FA 1XGSA 1IW7F 2FBHA 4BHBA 4F7ZA 2AS5F 4IHTA 3V4GA 2ISZA 4KN7X 2H6BA 4ETSA 5D6FA 3EYYA 4S04A 4WWCA 4BQAA 3B73A 5ICFA 3TDZC 4A5NA 4BAYA 1DDNA 4NB5A 2L4MA 3R0AA 2VT2A 1JE8A 3RTRA 3V7SA 1T0FA 2DQLA 3I59B 4S05A 4ZYEA 3WTSC 5JFRA 3RIRA 1HXDA 4NHJA 1U3EM 3QOPA 5E8IA 1QQIA 3KZZA 1B9MA 4KUMA 1IRGA 3E6MA 1O7LA 1WKMA 2Y75A 5F6FA 1FSEA 2QBYA 1RIOH 4PZJA 2ZCWA 1A04A 2WTEA 2M1BA 5E18F 2NYXA 4FHTA 1FZPB 1TBXA 2VT3A 3DPLC 4HOBA 1IN6A 2EK5A 2VONA 3H92A 4BNCA 2CSOA 2YR2A 2K27A 1T98A 1IUYA 2HEOA 4ZYGA 5EEHA 2FMYA 5FFXA 2PG4A 3GX4X 3HYIA 2FEZA 3R61A 1S6LA 2V1XA 2KIUA 4MHGA 5AIQA 1D8KA 1P6RA 2GWRA 4JK1X 4EJOA 1I1SA 4MGRA 3KETA 5IT9K 3DEUA 1HSTA 1YYVA 2O61A 3HOSA 2G7HA 3MQ0A 4L5JA 3TDUC 3ZQ7A 3KEQA 2CGPA 1BM9A 4AD9A 3W6KB 4BH9A 5A2QK 4I0AA 2HR3A 2ISYA 4XLNF 4WK8F 4A0ZA 5D8LB 4O5VA 5LLQA 2QYOA 3ZN1A 1J0RA 5K5QA 3TO6A 1P4XA 2CQKA 3BZ6A 3ELKA 3E5XA 5ILSA 4FX4A 3BOQA 1CF7A 2DI3A 2FBIA 2ZMEA 5D5VB 3T5XA 1GXPA 4YIFA 3LA7A 3L7WA 5DDGA 2P6TA 2O03A 4UNOA 1U78A 2VBZA 2X4HA 4ASNA 1LJ9A 3QPTA 4EJVA 4D0PA 5D5XB 1XMKA 2GAUA 4HX7A 3ZMDA 2Q2EA 3I71A 2Y48A 5HS9A 3WTYC 2M5WA 4GYGA 3JAMK 4LLGF 5L3GA 1TW3A 3LSTA 1R58A 2KIMA 3ISPA 3I59A 5DUIA 1MJ9A 3BJ6A 3GFLA 3BP8A 3KCCA 3IC7A 4OINF 3K1MA 2MBFA 1KU2A 4AIKA 1XGOA 3CO6C 2L54A 3FXUA 1R5HA 1FP2A 5EEGA 3CUQB 3I64A 3GVAA 5E1XA 3PQKA 1TQMA 5AONA 3RDIA 3I4PA 2DLLA 2K7LA 1HW2A 2RKHA 1BBYA 2RVCA 3KP4A 3I54A 1B6AA 1EH7A 3FXRA 1Z05A 2QZ8A 3J7AO 4RB0A 1KU3A 1TW2A 4M9XA 4I7HA 2IP2A 4G7ZF 2TDXA 2VBYA 4WX9A 3EETA 1KYWA 1O57A 3HRMA 3MFKA 1UB9A 3IKVA 1LB2A 4JQFA 3FMSA 4YIIA 4M72A 3W6JB 3EDPA 2MD5A 1IN7A 1W7PB 3FZVA 1SAXA 4LFUA 1G6NA 1HKSA 1B59A 3COAC 3E6CC 3ABTA 3F3XA 4YFNF 3IHUA 4CICA 2EV6A 1F4KA 4I09A 3QP5A 2QQAA 2IRFG 1ZG1A 4UUVA 4EJWA 2Z33A 1RNLA 4ESJA 4HW0A 5D8KB 3IWZA 2F5DA 1ZN2A 5ICCA 5IT3A 1NHAA 1Z91A 4GGGA 3BPXA 2UXXA 3HRSA 3F72A 5LBQA 4PCQA 3KEOA 4UVBA 3F22A 2LNBA 4ENNA 2DTRA 2M30A 1BI3A 4LJZF 3QU6A 4HDUA 3CUQC 3WGIA 2MH9A 5HS8A 3GYHX 1H0MA 4AVPA 2A6EF 4G8XA 2QQ9A 2XROA 2HDCA 1ZLJA 4UXNA 5HS7A 3O2PE 4MEXF 2STWA 1DP7P 3E97A 1HKTA 3F8BA 1O3TA 2LKPA 2O3FA 3CUQA 2V1UA 2XKOA 3QRFF 2O0YA 5DCFA 4IPAA 2DK5A 3CDHA 2GQQA 1B9NA 5E1WA 1K79A 5K5RA 5ILVA 1TQIA 1UHMA 4EM1A 3CTAA 2XIGA 3V8LA 2HWVA 2VC0A 3L09A 3D0SA 4BYYA 1W5SA 1EH8A 1QNTA 1XSDA 4U7BA 2WC2A 5LHHA 4PGHA 3ULQB 2W57A 4JBAA 3GF2A 2DT5A 2XGXA 4P55A 2DW4A 2XRNA 4M74A 4IJAA 3J81K 1ZYRF 3AAFA 1BC7C 3EYIA 4MTEA 1GHCA 4HX4A 3WGGA 1MDMB 1FBSA 4MTDA 1W7PA 5LHGA 2NRAC 1OYIA 1ZHFA 2A61A 5E20A 4U0WA 5L3DA 5BQTA 2ACJA 4RAYA 1XCBA 3IWFA 5DEQA 4M6YA 1R23A 4DQ2A 3TGNA 5DCMB 3FMQA 3I53A 4A5MA 3ZMUA 2O6GE 2OQGA 5CYVA 3JSPA 4AWXB 3WTVC 4OU0A 1WRJA 2LDUA 4YG2F 1KA8A 1R5GA 4YFXF 3M7GA 3BJAA 4G94A 4R79A 1ZRFA 3HSFA 4L9NA 3T0YA 2VODA 4HQMA 2KJBA 3GFJA 1FBUA 3GO5A 5BS6A 1B1BA 1SMTA 3WODF 1H9TA 2JT1A 4ZZDA 3KP6A 4HF0A 1D8JA 5J8FA 5HLIA 1GVJA 2DQRA 4IRGA 3PQJA 4CYDA 4KFCA 2D1HA 4L9JA 3ZPLA 4ZZLA 2ZNYA 3F6OA 3L9FA 2RDPA 3G73A 1T2KA 4G7OF 1S7AA 3QAHA 1U8RA 1F9NA 1ZLKA 2YSRA 1S8NA 3LA2A 3V7CA 1O7FA 3CJNA 1R1TA 2A69F 4EJUA 1XD7A 3TKYA 5L3BA 1SFXA 1MKMA 2M45A 4OIPF 1MDMA 2QWWA 1S7OA 2PI0A 3DF8A 4U0VA 1FY7A 2A3SA 1SMYF 4Q47A 1L0OC 3RYRA 2K02A 3HTUA 5DYMA 3OOPA 3B02A 2RC4A 2RQPA 5L3EA 4ESBA 4GCVA 1ON2A 3ZMZA 3HIFA 1YS6A 3Q5FA 3R6SA 3S2WA 2Z9OA 2OU2A 5DCMA 4OMYA 2NAZA 2EB7A 2NS0A 3O3KA 5CLSA 4DNCA 5FGMA 2PQ8A 2V6CA 2BBYA 1KQ9A 5LGTA 4LB5A 3ABUA 3P9CA 1TNSA 3BDDA 5BPIA 3SZTA 2FA5A 4PDKA 2EFPA 1Z6RA 2OD5A 3ECOA 1P4AA 4HBLA 3ZP5A 2DO7A 2EV0A 3GFIA 3HRTA 5LHIA 3HUGA 3BROA 4XSXF 2OQRA 2ZJ2A 2XAGA 2XVCA 2J5OA 2L4AA 1W5TA 4KIBA 3OV8A 4L5IA 2IT0A 2DPDA 3KE2A 3K69A 1J59A 3RKYA 3K1NA 2BE5F 1IF1A 5LRRA 3VODA 2M8EA 4RB3C 4MNUA 3BY6A 1R1UA 2PMHA 2E7XA 3K0LA 2UXNA 5CJ9A 3HTSB 2JZYA 1U5TB 3ZMTA 3RJPA 1DUXC 4OIQF 1PP7U 1BN5A 4CDGA 2A68F 3M8FA 1IXSB 1P2FA 3F23A 5ED4A 2BV6A 2PMUA 2ETHA 5FD5A 4EGZA 3N97A 3WE3A 4O6JA 5CVUA 3BWGA 3WU0A 2HFHA 3V7RA 4LLLA 2FE3A 5TRDA 2Q0OA 2HKXA 5L3CA 5HVQC 3ML6A 3GFMA 4PGGA 1ON1A 1USTA 2KRFA 1JGSA 2VOPA 2F5FA 4IRIA 3LWFA 3M9AA 1ULYA 1Z9CA 1AOYA 2HZTA 4H0EA 2W25A 3LAPA 2EFWA 1G3TA 2ZKZA 1MD0A 5IT9Z 2NNNA 4KDPA 4XSZF 2VBWA 2L02A 3WG9A 4LD5A 3KLNA 3MWMA 4UV8A 4HV6A 2YU3A 2GA2A 4KICA 1IXCA 3EUHA 4I02A 5LEJA 3WE2A 2PJPA 3O6BB 3VEPA 5E1ZB 1G3YA 1YIOA 4KYWA 3C7JA 5J8CA 1LQ1A 2YX7A 5FFZA 3NRVA 3DKWA 3BPVA 2EFQA 1XN7A 2EA2A 3ZMVA 2FRHA 2MH2A 2STTA 4N9IA 5H6RA 1U5TC 3FWEA 4M9SA 5JR3A 1JHFA 1J5YA 4CHUA 1FWZA 2CG4A 4RB1A 4B8XA 1UCRA 2ZBKA 3RKXA 2Z3YA 3U2RA 1D5VA 1U5TA 5KK1A 4HLXA 5E17F 4N9HA 1SD4A 4MEYF 3PFIA 2ADUA 3QPHA 5HOOA 3LAJA 4LMYA 1OR7A 1C0WA 1QO0D 4ENKA 2ZO4A 3VOEA 5D5WB 1L3LA 4RGSA 2A6HF 5ERIA 1ONVA 1YFHA 2XASA 3GLXA 2P8TA 1ZGJA 2P5VA 5HDGA 2JPCA 3GWZA 3T8RA 1UHWA 3K2ZA 2R7FA 2J5PA 5K5OA 1U2WA 3C1DA 3FMRA 2DK8A 1IN8A 1KU9A 1T39A 1KQ0A 2D2WA 3TO9A 2MLGA 3REOA 3R60A 5ILUA 3JW4A 4KIFA 3ZN0A 5D6EA 4WXHA 3GZ6A 5L3FA 5JHUA 2H94A 1PUEE 2QLZA 2KKOA 1P92A 1WWXA 1LVAA 3H3UA 3FM5A 2OA4A 1T38A 1ZG5A 4NQWA 4KA4A 4L18B 4A2UA 2P4WA 1O3RA 1BI0A 4O3MA 2BYVE 4HZFA 3RPQA 5DD4A 2Y0MA 2E1CA 1MZBA 2CYYA 1VTNC 1E2XA 1I6XA 3KLOA 4CXFA 1R22A 5BOXA 3R4KA 1G4DA 3FHZA 3C18A 3E6BA 2D1VA 2P7CB 2K4BA 5FLXZ 1KQ8A 3GXOA 1LNWA 5CVVA 1GXQA 3G3ZA 1ZRCA 3LQRA 2E7WA 3BJOA 3MCZA 3L00A 2L3DA 3M1EA 2KIFA 5TJJA 1YTYA 5DD8A 2JRTA 3J80K 3K9TA 1HKQA 2EV5A 2JPBA 5FO5A 3T1BA 3TO7A 3VFZA 1OYYA 3IRQA 3WTXC 4WCGA 1OMIA 1J7KA 5J6XA 1J9IA 1XCVA 2WV0A 1QBJA 3MEXA 3P7NA 4ENMA 2E1NA 3F21A 3F8FA 2P5LC 2V9VA 1ZAOA 1YO5C 2XAFA 2IJLA 4Y13A 3DP7A 4IF4A 2BEOA 2FMLA 4G7HF 3DPTA 4KT5C 1R1VA 2HOEA 2X0LA 4GYIA 3JSOA 2W84A 3FM3A 1OYWA 2VXZA 2VE8A 2O8XA 3RI4A 1JXSA 2DFIA 4HV5A 3U1DA 5JI6A 2A07F 2ZFWA 4EV0A 4EM2A 3J81Z 3EQLF 4RGUA 1R36A 2XHKA 3GW2A 1FYKA 4G6QA 2EFOA 1LDJA 4UHTA 5KVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHC A;  3E5U A;  5JVT A;  2IW5 A;  4MQ9 F;  2EJR A;  3RKW A;  4Y17 A;  1EH6 A;  3NEU A;  5D5U B;  1SD5 A;  2LF8 A;  1YW9 A;  2XAH A;  2RN7 A;  1U6G A;  1FPQ A;  3TQN A;  3WGH A;  3TOA A;  4L9T A;  1EV7 A;  2YX4 A;  4RGR A;  2HQR A;  4RS8 A;  3WTU C;  2L01 A;  1IAW A;  3TOB A;  4KNY A;  1D3Y A;  2W85 A;  1STZ A;  2GZW A;  2HS5 A;  4IHS A;  3WTT C;  3KP5 A;  4GO1 A;  1WSU A;  4I2O A;  1SFE A;  1J2X A;  4KN4 X;  2DBB A;  3KP3 A;  3N4M A;  1G3S A;  1XGN A;  3QP6 A;  3M8E A;  4EVI A;  2Z5U A;  5AIP A;  4QWQ A;  2K4J A;  4BHP A;  2HQN A;  4M71 A;  2FQ3 A;  1O3S A;  6PAX A;  1ZAR A;  4HLY A;  3DQV C;  2H27 A;  5D4R A;  3HRU A;  1TTY A;  2GXG A;  2QQB A;  4FX0 A;  1FOK A;  2ELH A;  1ZRD A;  2FNP A;  4CO8 A;  2DU9 A;  2ESN A;  2GIV A;  4LGW A;  4HF1 A;  2OBP A;  5F64 A;  4A0Y A;  1IRF A;  1XDS A;  5ICG A;  4Q48 A;  1XGM A;  2V1D A;  2FNA A;  4EGY A;  3U9G A;  3F6V A;  1H9G A;  1K7A A;  1RZ4 A;  1FNN A;  1CGP A;  4Y15 A;  1FP1 D;  4EMS A;  3GUD A;  4IRH A;  2W24 A;  1S3J A;  1HBX G;  2RGV A;  1HSJ A;  4U0Y A;  5DV5 A;  1BI2 A;  1ZH5 A;  4XRF A;  1E17 A;  2OZ6 A;  4HAM A;  4LB6 B;  2MLK A;  4P9U A;  1Y0U A;  4U7D A;  3V8K A;  1REP C;  1O3Q A;  3Q9V A;  4R8H A;  3MZH A;  4WXD A;  4YFK F;  2EFN A;  3DV8 A;  5FB2 A;  1KYZ A;  2GXB A;  1JHH A;  1FC3 A;  1XMA A;  1YW7 A;  2VE9 A;  4KMU X;  1BJA A;  3I5U A;  4AIJ A;  3F8N A;  2YPR A;  1SFU A;  4ENJ A;  4FT8 A;  1W4M A;  4UV9 A;  5H20 A;  3CUO A;  2OAZ A;  2XAJ A;  2PN6 A;  3Q9S A;  4RAZ A;  3KFW X;  5E8G A;  1Z6T A;  1F5T A;  1ZGA A;  2R3S A;  1IXR C;  1ODD A;  3D5L A;  1P4W A;  3F8M A;  3JTG A;  4UVC A;  4LLN A;  1J75 A;  3T8T A;  1SD6 A;  4LK0 F;  4EJT A;  4CGZ A;  1HW5 A;  5LEK A;  4M9Z A;  1QGP A;  3RPU A;  1RUO A;  1LEB A;  4HF2 A;  3LQQ A;  1Z7U A;  1G3W A;  3VB2 A;  3HOT A;  3LFK A;  2RV8 A;  2Q8K A;  4WXC A;  1XB4 A;  1FT9 A;  2R7D A;  4OOI A;  5HDN A;  2VBX A;  2P6S A;  1I27 A;  2JTV A;  4A6D A;  2H6C A;  1RUN A;  1BIA A;  4OMZ A;  1BI1 A;  2WWY A;  3SXY A;  3ECH A;  3SHF A;  2ESH A;  5A2Q Z;  4HQE A;  3L2C A;  2FF4 A;  1FX7 A;  1T6S A;  1MJA A;  5D4S A;  5FD6 A;  4G9Y A;  4EM0 B;  2K86 A;  4M6X A;  2B0L A;  4L0Z B;  1YQA A;  3ROU A;  2A5Y B;  3IL2 A;  4I01 A;  1YW8 A;  1PDN C;  2IA0 A;  4LK1 F;  4IVN A;  4HYE A;  1HW1 A;  4Q4Z F;  3QU3 A;  3E5Q A;  3GZ5 A;  3LA3 A;  4KMF A;  1V4R A;  2VOO A;  3JAM Z;  4N0B A;  3HSE A;  2QM3 A;  5H6Q A;  4LG0 B;  5K1Y A;  3K1P A;  1Q1H A;  1K6O A;  1PP8 F;  1TLH B;  2F2E A;  4A6E A;  1XDU A;  1TQP A;  2XUB A;  3DXJ F;  3H3Z A;  1WI9 A;  2COM A;  2G9W A;  3HHH A;  4XLP F;  1BOA A;  3SZP A;  5HLH A;  2H09 A;  1YS7 A;  2KJC A;  4ZH4 F;  4ZYH A;  2HKO A;  4L0Y B;  2UWM A;  2F5C A;  1Z1D A;  1R7J A;  5FLX K;  1IN4 A;  1LEA A;  2Z99 A;  3C3W A;  3MAJ A;  2CO5 A;  5LRS A;  3E3V A;  5BMZ A;  1BIB A;  4HX8 A;  5CVR A;  1ZG3 A;  1SD7 A;  1FLI A;  1QZY A;  4ZYD A;  2CW0 F;  3IKT A;  1ZRE A;  3GEZ A;  4L9V A;  3FF5 A;  3I0T A;  4P5O A;  2QUF A;  4A0X A;  5F1R A;  2IA2 A;  2IA1 A;  4AIH A;  4A12 A;  2FXA A;  1KU7 A;  1K78 B;  4HA8 A;  3ERE D;  1I1G A;  2PLY A;  1AWC A;  1FBQ A;  2DAO A;  4GXO A;  2GA1 A;  5CVI A;  1FYM A;  3I58 A;  1IZ1 A;  1QPM A;  4ESF A;  1MGT A;  2EWN A;  2XAQ A;  3WU1 B;  2NNY A;  1F1Z A;  3HSR A;  2V79 A;  2HTJ A;  1B4A A;  1LDD A;  3NQO A;  4IXA A;  1RI7 A;  4M73 A;  2MC3 A;  1MJB A;  3P9I A;  3WTW C;  2VC1 A;  2CFX A;  4XBF A;  3KZY A;  3P9K A;  2FBK A;  3KP7 A;  4Q5S F;  2M87 A;  3E6D A;  4CZZ A;  1KGS A;  1DPR A;  2IVM A;  4RGX A;  2HTS A;  2FOK A;  4WF2 A;  2QVO A;  5HLG A;  1XSV A;  3KP2 A;  4LG0 A;  2HYF A;  5BPD A;  4ON0 A;  3F8C A;  5CVJ A;  3ZMS A;  4K2E A;  5LGU A;  2AXL A;  2PFB A;  1FYL A;  4OIO F;  1FSH A;  2F5E A;  2FSW A;  1USS A;  5ICE A;  3MZY A;  1I5Z A;  1S29 A;  2ZNZ A;  5DUK A;  3RYP A;  2EA4 A;  4Z2Y A;  4KIG A;  2LSO A;  2QBY B;  3JTH A;  1YG2 A;  4G6D A;  3SQN A;  3FXQ A;  4R1H A;  2DPU A;  3IRR A;  4I0B A;  5HDK A;  1IN5 A;  2D45 A;  2IPQ X;  4TV7 A;  3CO7 C;  2XV4 S;  1W7P D;  2PEX A;  2RNJ A;  1K78 A;  4P96 A;  2ZXJ A;  4EQQ A;  3FX3 A;  1TNT A;  1QZZ A;  2FU4 A;  1XSX A;  2BGC A;  2C6Y A;  2JSC A;  2UZK A;  3J80 Z;  3SFZ A;  2G7U A;  4E70 A;  1YLF A;  4HDV A;  4P9F A;  4MQV A;  1BC8 C;  1LDK B;  4I98 B;  4BXU A;  1R00 A;  4U88 A;  3V8J A;  1X3U A;  2P5K A;  1UFM A;  1DPU A;  1WQ2 A;  2OZU A;  4RB2 C;  1HQC A;  3DFG A;  2PBI A;  1OPC A;  3HHG A;  1OKR A;  3CLO A;  2HYG D;  2MA3 A;  2VN2 A;  4QLC U;  5LGN A;  2CWE A;  3R0J A;  3WTZ A;  4UVA A;  4B09 A;  2QEN A;  2LF7 A;  2P7V B;  4OIR F;  2XKP A;  2HGC A;  1CF7 B;  2ZME B;  1V3F A;  1XGS A;  1IW7 F;  2FBH A;  4BHB A;  4F7Z A;  2AS5 F;  4IHT A;  3V4G A;  2ISZ A;  4KN7 X;  2H6B A;  4ETS A;  5D6F A;  3EYY A;  4S04 A;  4WWC A;  4BQA A;  3B73 A;  5ICF A;  3TDZ C;  4A5N A;  4BAY A;  1DDN A;  4NB5 A;  2L4M A;  3R0A A;  2VT2 A;  1JE8 A;  3RTR A;  3V7S A;  1T0F A;  2DQL A;  3I59 B;  4S05 A;  4ZYE A;  3WTS C;  5JFR A;  3RIR A;  1HXD A;  4NHJ A;  1U3E M;  3QOP A;  5E8I A;  1QQI A;  3KZZ A;  1B9M A;  4KUM A;  1IRG A;  3E6M A;  1O7L A;  1WKM A;  2Y75 A;  5F6F A;  1FSE A;  2QBY A;  1RIO H;  4PZJ A;  2ZCW A;  1A04 A;  2WTE A;  2M1B A;  5E18 F;  2NYX A;  4FHT A;  1FZP B;  1TBX A;  2VT3 A;  3DPL C;  4HOB A;  1IN6 A;  2EK5 A;  2VON A;  3H92 A;  4BNC A;  2CSO A;  2YR2 A;  2K27 A;  1T98 A;  1IUY A;  2HEO A;  4ZYG A;  5EEH A;  2FMY A;  5FFX A;  2PG4 A;  3GX4 X;  3HYI A;  2FEZ A;  3R61 A;  1S6L A;  2V1X A;  2KIU A;  4MHG A;  5AIQ A;  1D8K A;  1P6R A;  2GWR A;  4JK1 X;  4EJO A;  1I1S A;  4MGR A;  3KET A;  5IT9 K;  3DEU A;  1HST A;  1YYV A;  2O61 A;  3HOS A;  2G7H A;  3MQ0 A;  4L5J A;  3TDU C;  3ZQ7 A;  3KEQ A;  2CGP A;  1BM9 A;  4AD9 A;  3W6K B;  4BH9 A;  5A2Q K;  4I0A A;  2HR3 A;  2ISY A;  4XLN F;  4WK8 F;  4A0Z A;  5D8L B;  4O5V A;  5LLQ A;  2QYO A;  3ZN1 A;  1J0R A;  5K5Q A;  3TO6 A;  1P4X A;  2CQK A;  3BZ6 A;  3ELK A;  3E5X A;  5ILS A;  4FX4 A;  3BOQ A;  1CF7 A;  2DI3 A;  2FBI A;  2ZME A;  5D5V B;  3T5X A;  1GXP A;  4YIF A;  3LA7 A;  3L7W A;  5DDG A;  2P6T A;  2O03 A;  4UNO A;  1U78 A;  2VBZ A;  2X4H A;  4ASN A;  1LJ9 A;  3QPT A;  4EJV A;  4D0P A;  5D5X B;  1XMK A;  2GAU A;  4HX7 A;  3ZMD A;  2Q2E A;  3I71 A;  2Y48 A;  5HS9 A;  3WTY C;  2M5W A;  4GYG A;  3JAM K;  4LLG F;  5L3G A;  1TW3 A;  3LST A;  1R58 A;  2KIM A;  3ISP A;  3I59 A;  5DUI A;  1MJ9 A;  3BJ6 A;  3GFL A;  3BP8 A;  3KCC A;  3IC7 A;  4OIN F;  3K1M A;  2MBF A;  1KU2 A;  4AIK A;  1XGO A;  3CO6 C;  2L54 A;  3FXU A;  1R5H A;  1FP2 A;  5EEG A;  3CUQ B;  3I64 A;  3GVA A;  5E1X A;  3PQK A;  1TQM A;  5AON A;  3RDI A;  3I4P A;  2DLL A;  2K7L A;  1HW2 A;  2RKH A;  1BBY A;  2RVC A;  3KP4 A;  3I54 A;  1B6A A;  1EH7 A;  3FXR A;  1Z05 A;  2QZ8 A;  3J7A O;  4RB0 A;  1KU3 A;  1TW2 A;  4M9X A;  4I7H A;  2IP2 A;  4G7Z F;  2TDX A;  2VBY A;  4WX9 A;  3EET A;  1KYW A;  1O57 A;  3HRM A;  3MFK A;  1UB9 A;  3IKV A;  1LB2 A;  4JQF A;  3FMS A;  4YII A;  4M72 A;  3W6J B;  3EDP A;  2MD5 A;  1IN7 A;  1W7P B;  3FZV A;  1SAX A;  4LFU A;  1G6N A;  1HKS A;  1B59 A;  3COA C;  3E6C C;  3ABT A;  3F3X A;  4YFN F;  3IHU A;  4CIC A;  2EV6 A;  1F4K A;  4I09 A;  3QP5 A;  2QQA A;  2IRF G;  1ZG1 A;  4UUV A;  4EJW A;  2Z33 A;  1RNL A;  4ESJ A;  4HW0 A;  5D8K B;  3IWZ A;  2F5D A;  1ZN2 A;  5ICC A;  5IT3 A;  1NHA A;  1Z91 A;  4GGG A;  3BPX A;  2UXX A;  3HRS A;  3F72 A;  5LBQ A;  4PCQ A;  3KEO A;  4UVB A;  3F22 A;  2LNB A;  4ENN A;  2DTR A;  2M30 A;  1BI3 A;  4LJZ F;  3QU6 A;  4HDU A;  3CUQ C;  3WGI A;  2MH9 A;  5HS8 A;  3GYH X;  1H0M A;  4AVP A;  2A6E F;  4G8X A;  2QQ9 A;  2XRO A;  2HDC A;  1ZLJ A;  4UXN A;  5HS7 A;  3O2P E;  4MEX F;  2STW A;  1DP7 P;  3E97 A;  1HKT A;  3F8B A;  1O3T A;  2LKP A;  2O3F A;  3CUQ A;  2V1U A;  2XKO A;  3QRF F;  2O0Y A;  5DCF A;  4IPA A;  2DK5 A;  3CDH A;  2GQQ A;  1B9N A;  5E1W A;  1K79 A;  5K5R A;  5ILV A;  1TQI A;  1UHM A;  4EM1 A;  3CTA A;  2XIG A;  3V8L A;  2HWV A;  2VC0 A;  3L09 A;  3D0S A;  4BYY A;  1W5S A;  1EH8 A;  1QNT A;  1XSD A;  4U7B A;  2WC2 A;  5LHH A;  4PGH A;  3ULQ B;  2W57 A;  4JBA A;  3GF2 A;  2DT5 A;  2XGX A;  4P55 A;  2DW4 A;  2XRN A;  4M74 A;  4IJA A;  3J81 K;  1ZYR F;  3AAF A;  1BC7 C;  3EYI A;  4MTE A;  1GHC A;  4HX4 A;  3WGG A;  1MDM B;  1FBS A;  4MTD A;  1W7P A;  5LHG A;  2NRA C;  1OYI A;  1ZHF A;  2A61 A;  5E20 A;  4U0W A;  5L3D A;  5BQT A;  2ACJ A;  4RAY A;  1XCB A;  3IWF A;  5DEQ A;  4M6Y A;  1R23 A;  4DQ2 A;  3TGN A;  5DCM B;  3FMQ A;  3I53 A;  4A5M A;  3ZMU A;  2O6G E;  2OQG A;  5CYV A;  3JSP A;  4AWX B;  3WTV C;  4OU0 A;  1WRJ A;  2LDU A;  4YG2 F;  1KA8 A;  1R5G A;  4YFX F;  3M7G A;  3BJA A;  4G94 A;  4R79 A;  1ZRF A;  3HSF A;  4L9N A;  3T0Y A;  2VOD A;  4HQM A;  2KJB A;  3GFJ A;  1FBU A;  3GO5 A;  5BS6 A;  1B1B A;  1SMT A;  3WOD F;  1H9T A;  2JT1 A;  4ZZD A;  3KP6 A;  4HF0 A;  1D8J A;  5J8F A;  5HLI A;  1GVJ A;  2DQR A;  4IRG A;  3PQJ A;  4CYD A;  4KFC A;  2D1H A;  4L9J A;  3ZPL A;  4ZZL A;  2ZNY A;  3F6O A;  3L9F A;  2RDP A;  3G73 A;  1T2K A;  4G7O F;  1S7A A;  3QAH A;  1U8R A;  1F9N A;  1ZLK A;  2YSR A;  1S8N A;  3LA2 A;  3V7C A;  1O7F A;  3CJN A;  1R1T A;  2A69 F;  4EJU A;  1XD7 A;  3TKY A;  5L3B A;  1SFX A;  1MKM A;  2M45 A;  4OIP F;  1MDM A;  2QWW A;  1S7O A;  2PI0 A;  3DF8 A;  4U0V A;  1FY7 A;  2A3S A;  1SMY F;  4Q47 A;  1L0O C;  3RYR A;  2K02 A;  3HTU A;  5DYM A;  3OOP A;  3B02 A;  2RC4 A;  2RQP A;  5L3E A;  4ESB A;  4GCV A;  1ON2 A;  3ZMZ A;  3HIF A;  1YS6 A;  3Q5F A;  3R6S A;  3S2W A;  2Z9O A;  2OU2 A;  5DCM A;  4OMY A;  2NAZ A;  2EB7 A;  2NS0 A;  3O3K A;  5CLS A;  4DNC A;  5FGM A;  2PQ8 A;  2V6C A;  2BBY A;  1KQ9 A;  5LGT A;  4LB5 A;  3ABU A;  3P9C A;  1TNS A;  3BDD A;  5BPI A;  3SZT A;  2FA5 A;  4PDK A;  2EFP A;  1Z6R A;  2OD5 A;  3ECO A;  1P4A A;  4HBL A;  3ZP5 A;  2DO7 A;  2EV0 A;  3GFI A;  3HRT A;  5LHI A;  3HUG A;  3BRO A;  4XSX F;  2OQR A;  2ZJ2 A;  2XAG A;  2XVC A;  2J5O A;  2L4A A;  1W5T A;  4KIB A;  3OV8 A;  4L5I A;  2IT0 A;  2DPD A;  3KE2 A;  3K69 A;  1J59 A;  3RKY A;  3K1N A;  2BE5 F;  1IF1 A;  5LRR A;  3VOD A;  2M8E A;  4RB3 C;  4MNU A;  3BY6 A;  1R1U A;  2PMH A;  2E7X A;  3K0L A;  2UXN A;  5CJ9 A;  3HTS B;  2JZY A;  1U5T B;  3ZMT A;  3RJP A;  1DUX C;  4OIQ F;  1PP7 U;  1BN5 A;  4CDG A;  2A68 F;  3M8F A;  1IXS B;  1P2F A;  3F23 A;  5ED4 A;  2BV6 A;  2PMU A;  2ETH A;  5FD5 A;  4EGZ A;  3N97 A;  3WE3 A;  4O6J A;  5CVU A;  3BWG A;  3WU0 A;  2HFH A;  3V7R A;  4LLL A;  2FE3 A;  5TRD A;  2Q0O A;  2HKX A;  5L3C A;  5HVQ C;  3ML6 A;  3GFM A;  4PGG A;  1ON1 A;  1UST A;  2KRF A;  1JGS A;  2VOP A;  2F5F A;  4IRI A;  3LWF A;  3M9A A;  1ULY A;  1Z9C A;  1AOY A;  2HZT A;  4H0E A;  2W25 A;  3LAP A;  2EFW A;  1G3T A;  2ZKZ A;  1MD0 A;  5IT9 Z;  2NNN A;  4KDP A;  4XSZ F;  2VBW A;  2L02 A;  3WG9 A;  4LD5 A;  3KLN A;  3MWM A;  4UV8 A;  4HV6 A;  2YU3 A;  2GA2 A;  4KIC A;  1IXC A;  3EUH A;  4I02 A;  5LEJ A;  3WE2 A;  2PJP A;  3O6B B;  3VEP A;  5E1Z B;  1G3Y A;  1YIO A;  4KYW A;  3C7J A;  5J8C A;  1LQ1 A;  2YX7 A;  5FFZ A;  3NRV A;  3DKW A;  3BPV A;  2EFQ A;  1XN7 A;  2EA2 A;  3ZMV A;  2FRH A;  2MH2 A;  2STT A;  4N9I A;  5H6R A;  1U5T C;  3FWE A;  4M9S A;  5JR3 A;  1JHF A;  1J5Y A;  4CHU A;  1FWZ A;  2CG4 A;  4RB1 A;  4B8X A;  1UCR A;  2ZBK A;  3RKX A;  2Z3Y A;  3U2R A;  1D5V A;  1U5T A;  5KK1 A;  4HLX A;  5E17 F;  4N9H A;  1SD4 A;  4MEY F;  3PFI A;  2ADU A;  3QPH A;  5HOO A;  3LAJ A;  4LMY A;  1OR7 A;  1C0W A;  1QO0 D;  4ENK A;  2ZO4 A;  3VOE A;  5D5W B;  1L3L A;  4RGS A;  2A6H F;  5ERI A;  1ONV A;  1YFH A;  2XAS A;  3GLX A;  2P8T A;  1ZGJ A;  2P5V A;  5HDG A;  2JPC A;  3GWZ A;  3T8R A;  1UHW A;  3K2Z A;  2R7F A;  2J5P A;  5K5O A;  1U2W A;  3C1D A;  3FMR A;  2DK8 A;  1IN8 A;  1KU9 A;  1T39 A;  1KQ0 A;  2D2W A;  3TO9 A;  2MLG A;  3REO A;  3R60 A;  5ILU A;  3JW4 A;  4KIF A;  3ZN0 A;  5D6E A;  4WXH A;  3GZ6 A;  5L3F A;  5JHU A;  2H94 A;  1PUE E;  2QLZ A;  2KKO A;  1P92 A;  1WWX A;  1LVA A;  3H3U A;  3FM5 A;  2OA4 A;  1T38 A;  1ZG5 A;  4NQW A;  4KA4 A;  4L18 B;  4A2U A;  2P4W A;  1O3R A;  1BI0 A;  4O3M A;  2BYV E;  4HZF A;  3RPQ A;  5DD4 A;  2Y0M A;  2E1C A;  1MZB A;  2CYY A;  1VTN C;  1E2X A;  1I6X A;  3KLO A;  4CXF A;  1R22 A;  5BOX A;  3R4K A;  1G4D A;  3FHZ A;  3C18 A;  3E6B A;  2D1V A;  2P7C B;  2K4B A;  5FLX Z;  1KQ8 A;  3GXO A;  1LNW A;  5CVV A;  1GXQ A;  3G3Z A;  1ZRC A;  3LQR A;  2E7W A;  3BJO A;  3MCZ A;  3L00 A;  2L3D A;  3M1E A;  2KIF A;  5TJJ A;  1YTY A;  5DD8 A;  2JRT A;  3J80 K;  3K9T A;  1HKQ A;  2EV5 A;  2JPB A;  5FO5 A;  3T1B A;  3TO7 A;  3VFZ A;  1OYY A;  3IRQ A;  3WTX C;  4WCG A;  1OMI A;  1J7K A;  5J6X A;  1J9I A;  1XCV A;  2WV0 A;  1QBJ A;  3MEX A;  3P7N A;  4ENM A;  2E1N A;  3F21 A;  3F8F A;  2P5L C;  2V9V A;  1ZAO A;  1YO5 C;  2XAF A;  2IJL A;  4Y13 A;  3DP7 A;  4IF4 A;  2BEO A;  2FML A;  4G7H F;  3DPT A;  4KT5 C;  1R1V A;  2HOE A;  2X0L A;  4GYI A;  3JSO A;  2W84 A;  3FM3 A;  1OYW A;  2VXZ A;  2VE8 A;  2O8X A;  3RI4 A;  1JXS A;  2DFI A;  4HV5 A;  3U1D A;  5JI6 A;  2A07 F;  2ZFW A;  4EV0 A;  4EM2 A;  3J81 Z;  3EQL F;  4RGU A;  1R36 A;  2XHK A;  3GW2 A;  1FYK A;  4G6Q A;  2EFO A;  1LDJ A;  4UHT A;  5KVR A; 
#chains in the Genus database with same CATH topology
 4HEA 2;  4BHC A;  1GVD A;  1WH5 A;  2R5Y A;  4GDF A;  5C4J J;  3E5U A;  5JVT A;  2Y69 H;  2IXS A;  2IW5 A;  4MQ9 F;  3DKY A;  5E3N A;  4A3G J;  2EJR A;  3RKW A;  5KNL A;  4Y17 A;  4F93 B;  1EH6 A;  4EAT A;  3D1N I;  4E7L A;  3HDD A;  2A05 A;  3NEU A;  5D5U B;  1SD5 A;  2V9P A;  3S32 A;  3IP4 B;  2ECC A;  2LF8 A;  1YW9 A;  2XAH A;  2RN7 A;  1U6G A;  1FPQ A;  2ZSI B;  3TQN A;  1N75 A;  3WGH A;  1XX5 A;  3TOA A;  4RDU A;  4PJJ A;  4L9T A;  1XMX A;  2JWT A;  1R4N B;  4M3G A;  4M3F A;  1EV7 A;  2X6Y A;  1FMV A;  2NVU B;  2YX4 A;  4HPQ A;  2HQR A;  4RGR A;  3ZQI A;  4DJA A;  1K4S A;  4IHX A;  4RS8 A;  3DPU A;  3CC4 I;  3WTU C;  2L01 A;  1G2H A;  5HNF A;  1VZ0 A;  3HBL A;  4QPO A;  3VPR A;  1IAW A;  3H0G J;  3TOB A;  4E7I A;  4KNY A;  1D3Y A;  2X6O A;  3BR1 A;  2W85 A;  1STZ A;  2GZW A;  2HS5 A;  2EH3 A;  4IHS A;  3CMA I;  1ETK A;  2QCO A;  3WTT C;  3KP5 A;  4GO1 A;  1WSU A;  5M3M J;  4I2O A;  1NTC A;  2WAQ N;  3DEE A;  3MD2 A;  5M3F J;  1SFE A;  1J2X A;  1RR8 C;  4KN4 X;  3BR5 A;  3OYB A;  2DBB A;  3KP3 A;  1MMS A;  2MYS A;  2JSP A;  3N4M A;  2TRT A;  2E1M B;  1G3S A;  1XGN A;  2LTP A;  3QP6 A;  1B8I B;  2MAB A;  3M8E A;  4EVI A;  2Z5U A;  3DBL B;  4C3I J;  3FKI J;  5AIP A;  3FXK A;  1MMN A;  4QWQ A;  2K4J A;  4BHP A;  1KZH A;  2HQN A;  1JKR C;  2IS6 A;  3DTK A;  1UJ8 A;  2XGC A;  4M71 A;  3DLL F;  1MBK A;  2FQ3 A;  2ID6 A;  3A02 A;  1O3S A;  6PAX A;  1JUP A;  1V5G A;  2JN6 A;  1ZAR A;  3AG2 H;  4HLY A;  2VPL A;  1V55 H;  1AHD P;  3DQV C;  2O7O A;  2H27 A;  5D4R A;  3HRU A;  1TTY A;  2GXG A;  2QQB A;  4FX0 A;  1FOK A;  2ELH A;  1D1A A;  1HDP A;  1ZRD A;  2FNP A;  1WJA A;  2BXZ A;  4CO8 A;  2DU9 A;  3RZD J;  2ESN A;  2GIV A;  1Y6I A;  1FIA A;  2GLO A;  4LGW A;  1H8A C;  4HF1 A;  2OBP A;  4BDY A;  2VKE A;  5F64 A;  4A0Y A;  1IRF A;  1XDS A;  4RM2 A;  5ICG A;  3CC7 I;  4Q48 A;  1XGM A;  1TP4 A;  2V1D A;  2FNA A;  4EGY A;  2LFB A;  3U9G A;  2PJR B;  3VWB A;  3F6V A;  1H9G A;  2DMU A;  1K7A A;  3CP8 A;  1RZ4 A;  3CMY A;  1FNN A;  1CGP A;  3P5J A;  2BZT A;  4Y15 A;  2QSF X;  1FP1 D;  3Q0W A;  4EMS A;  3LSH A;  3GUD A;  1QZE A;  3N05 A;  4IRH A;  3JRG A;  1A35 A;  2Z2S B;  2W24 A;  1UHS A;  2CQN A;  1S3J A;  1HBX G;  2RGV A;  1HSJ A;  4U0Y A;  1X1B A;  5DV5 A;  3A4C A;  4HNV A;  5C3E J;  1PJR A;  2R7R A;  2JA5 J;  1BI2 A;  1ZH5 A;  4XRF A;  1E17 A;  2OZ6 A;  2E1O A;  4HAM A;  4LB6 B;  1JUS A;  2HOA A;  2FOW A;  2E36 A;  2MLK A;  1S72 I;  3W2V A;  1MNM C;  1FMW A;  4P9U A;  1YIJ I;  1Y0U A;  5F08 A;  2QKM B;  2VJ5 A;  4U7D A;  4XKC A;  3OYD A;  2F6C A;  3UR3 C;  2EZL A;  1G59 A;  3V8K A;  1REP C;  1O3Q A;  3Q9V A;  3OL3 A;  4R8H A;  4HST A;  3MZH A;  4WXD A;  5GAE J;  4YFK F;  2EFN A;  2COB A;  3DV8 A;  5FB2 A;  1KYZ A;  2GXB A;  1JHH A;  1FC3 A;  2M2E A;  1OCR H;  1XMA A;  2LVS A;  1W0T A;  1TWC J;  1YW7 A;  2VE9 A;  2JUC A;  2HNH A;  4KMU X;  1XPX A;  3K4M A;  1BJA A;  3I5U A;  2KIQ A;  4AIJ A;  3F8N A;  1A36 A;  2YPR A;  3ZQF A;  1SFU A;  4CUG A;  4ENJ A;  4FT8 A;  3HKZ N;  1SEU A;  2HDW A;  3FBN B;  1W4M A;  3HJE A;  2K9L A;  4UV9 A;  1BA5 A;  3MMY B;  5H20 A;  4UB8 C;  3CUO A;  5HNH A;  2OAZ A;  2XAJ A;  2LRD A;  1RR7 A;  2PN6 A;  2E1M C;  3Q9S A;  4RAZ A;  1X1P A;  2ZC2 A;  5IY5 H;  3KFW X;  4IO9 F;  5E8G A;  2R93 J;  1N78 A;  1Z6T A;  1F5T A;  1ZGA A;  2R3S A;  1IXR C;  3NAR A;  3KIO A;  3HGG A;  1ODD A;  1PVE A;  3D5L A;  1P4W A;  3F8M A;  3JTG A;  4UVC A;  4FE7 A;  4LLN A;  1J75 A;  3T8T A;  3TED A;  5FKO A;  5IP7 J;  2MG4 A;  1SD6 A;  4J01 A;  5B3S H;  4LK0 F;  4J00 A;  1FOY A;  4S0H B;  4YEJ A;  2EIM H;  2R7O A;  4AM3 A;  2A5W A;  4EJT A;  2EIN H;  1B8I A;  4CGZ A;  1HW5 A;  3U21 A;  3HXL A;  3L2U A;  4IOA F;  5GAD J;  5LEK A;  4E7H A;  3M8J A;  4LG3 A;  4M9Z A;  4NNJ A;  1ZR2 A;  1QGP A;  2R7Q A;  4KJZ A;  5HOD A;  2KFD A;  1JUM A;  1H89 C;  3JR9 A;  2CV1 A;  2W7N A;  2M7A A;  3RPU A;  3ZCO A;  3ZQC A;  1U9N A;  1RUO A;  1LEB A;  3JRA A;  4RAF A;  4HF2 A;  3M1C A;  2IBD A;  2CV2 A;  2KIS A;  3LQQ A;  4H4K C;  2EIK H;  1Z7U A;  1G3W A;  2DA1 A;  3VB2 A;  1S9H A;  5DM6 F;  3LFK A;  3HOT A;  4HG2 A;  2RV8 A;  2Q8K A;  2MD0 A;  4WXC A;  4B43 A;  1XB4 A;  1FT9 A;  2R7D A;  4OOI A;  2LC2 A;  5HDN A;  2VBX A;  2P6S A;  1I27 A;  3M07 A;  2JTV A;  4IHY A;  2DDB A;  3H5R A;  4A6D A;  2H6C A;  1RUN A;  1BIA A;  2X6W A;  2K9S A;  4ABZ A;  4OMZ A;  3S1Q J;  2VKH A;  3LFU A;  1BI1 A;  2WWY A;  3SXY A;  3ECH A;  1X1D A;  3SHF A;  1XC5 A;  2ESH A;  2NOG A;  4Y7N J;  5A2Q Z;  4XKB A;  4HQE A;  3ZGK A;  3L2C A;  1AA7 A;  4B3X A;  1DGW Y;  2FF4 A;  2PJR A;  2E2J J;  3H36 A;  1FX7 A;  1GT0 C;  1T6S A;  1MJA A;  2F4O B;  2OC6 A;  3CMM A;  5F04 A;  2YS9 A;  3BR0 A;  4CZC A;  5D4S A;  5FD6 A;  4G9Y A;  4EM0 B;  2JRM A;  3QYE A;  1OCT C;  4DBR A;  4XQF A;  5IOY A;  2K86 A;  4M6X A;  2B0L A;  4BAC A;  4G12 A;  2WB1 A;  3RPU D;  2OPT A;  3BR3 A;  4L0Z B;  1G8X A;  1JKO C;  1YQA A;  3ROU A;  5IPA A;  1XS9 A;  1R71 A;  1FTZ A;  4ZDP A;  2A5Y B;  4PJN A;  2L7M P;  2ZB9 A;  1XG1 A;  5C4X J;  1GLN A;  2R7T A;  1LE8 B;  3IL2 A;  4I01 A;  2ZXI A;  1YW8 A;  1D5Y A;  1PDN C;  2IA0 A;  3BC8 A;  2DFF A;  4LK1 F;  4IVN A;  4HYE A;  1HW1 A;  4Q4Z F;  2JVH A;  4BJ5 C;  3QU3 A;  3E5Q A;  3BLY A;  2XB0 X;  1HC8 A;  1JTY A;  5EGO B;  3GZ5 A;  1VQP I;  2XF5 A;  3LA3 A;  2E5N A;  3DTI A;  2JA7 J;  5IOZ A;  4KMF A;  1V4R A;  5IYB J;  2QF7 A;  2VOO A;  3JAM Z;  3SYT A;  4N0B A;  4DIQ A;  3HSE A;  4MO7 A;  1XTA A;  1X4P A;  4LIT A;  2QM3 A;  3SFI A;  5H6Q A;  5FKK A;  4LG0 B;  5K1Y A;  1E3O C;  3K1P A;  3BCA A;  3S93 A;  1ETX A;  4IEJ A;  2HOS A;  1Q1H A;  3FHN A;  1NK3 P;  3BZC A;  4DYQ A;  2W1O A;  4UUT A;  1K6O A;  4IHV A;  2KQR A;  1PP8 F;  2BY2 A;  1TLH B;  2F2E A;  2OUM A;  4A6E A;  1XDU A;  5J40 A;  1TQP A;  2XUB A;  3EUA A;  4D5C A;  4A3M J;  3TMO A;  3GTQ J;  3DXJ F;  3H3Z A;  1V5E A;  1WI9 A;  2COM A;  2G9W A;  3QWL A;  4MIM A;  3HHH A;  1VI0 A;  3VYR B;  4DBQ A;  4XLP F;  1BOA A;  3SZP A;  5HLH A;  2H09 A;  4AYB A;  2R7W A;  2OF7 A;  3TBI A;  1YS7 A;  2KJC A;  4JX6 A;  4ZH4 F;  1GV5 A;  2Y0S A;  4ZYH A;  2HKO A;  4IKF A;  4L0Y B;  2UWM A;  2DA5 A;  2BHZ A;  2F5C A;  4RBO A;  1Z1D A;  1Y8R B;  1W1W E;  1R7J A;  5FLX K;  1IN4 A;  1LEA A;  2Z99 A;  3C3W A;  1YOV B;  2CW7 A;  4A3K J;  3MAJ A;  2CO5 A;  5IYC J;  3KPH A;  4JYK A;  5LRS A;  2N8G A;  1YJ9 I;  3RSN A;  3E3V A;  1ZGW A;  5BMZ A;  1BIB A;  4HX8 A;  3OYG A;  5CVR A;  2F5V A;  1RPW A;  1ZG3 A;  1IV6 A;  1YE9 A;  1A6Q A;  1SD7 A;  1FLI A;  2QSG X;  3CP2 A;  1QZY A;  4XID A;  4ZYD A;  2CW0 F;  3IKT A;  1ZRE A;  4N4N B;  5IP9 J;  3HC7 A;  3GEZ A;  3HGY A;  4L9V A;  3IV5 A;  3VYU B;  3FF5 A;  3I0T A;  4P5O A;  2QUF A;  4A0X A;  3LOC A;  5F1R A;  2IA2 A;  2R4G A;  1R6R A;  2IA1 A;  2KHM A;  4AIH A;  4A12 A;  2FXA A;  1KU7 A;  3KEY A;  1AU7 A;  1RKT A;  1K78 B;  3A0H C;  4FQG A;  2R92 J;  4HA8 A;  3S2D J;  3ERE D;  2VQG A;  1I1G A;  4RM3 A;  2PLY A;  1AWC A;  2XGD A;  3CCQ I;  1JGG A;  4DYR A;  3FK6 A;  1FBQ A;  2DAO A;  1DU6 A;  3BQZ A;  2IGM A;  4GXO A;  2BHY A;  2GA1 A;  5CVI A;  2UV1 A;  1FYM A;  3I58 A;  3I3L A;  1IZ1 A;  1YX3 A;  2FJ1 A;  1QPM A;  2KLO A;  1MGT A;  4ESF A;  1I39 A;  2EWN A;  2L7Z A;  2XAQ A;  3SEQ A;  3WU1 B;  4XOT A;  1WGX A;  1O4X A;  3CLQ A;  2I8D A;  2NNY A;  1F1Z A;  1POG A;  3G1M A;  4XRS G;  4OWR B;  1VQ9 I;  3HSR A;  2V79 A;  2HTJ A;  3QPS A;  5GAG J;  1B4A A;  1LDD A;  3NQO A;  4DW6 A;  1ITY A;  4IXA A;  1RI7 A;  4M73 A;  4CYC B;  4II3 A;  2MC3 A;  2KZG A;  2DOA A;  1MJB A;  3P9I A;  3FK7 A;  3WTW C;  2VC1 A;  2DMT A;  2CFX A;  4C9Y A;  3OYK A;  4XBF A;  1LE8 A;  2JK3 A;  3KZY A;  2AQE A;  3P9K A;  2GM4 A;  2FBK A;  3KP7 A;  4Q5S F;  2MW8 A;  4BQQ A;  5EGO A;  2L2O A;  1R5I D;  3S14 J;  1OIS A;  2M87 A;  3E6D A;  4CZZ A;  1KGS A;  1DPR A;  4FCY A;  3S2H J;  2IVM A;  2VLA A;  4RGX A;  1TWG J;  2HTS A;  1WZ2 A;  2FOK A;  3IH4 A;  4WF2 A;  4AC0 A;  2UUZ A;  2QVO A;  3TP3 A;  5HLG A;  1XSV A;  2DA2 A;  4BE1 A;  1T33 A;  3KP2 A;  4LG0 A;  2HYF A;  5M5Y J;  3PIO F;  1QVT A;  2AQF A;  5BPD A;  1JTX A;  2CH0 A;  3BT9 A;  4ON0 A;  3F8C A;  5CVJ A;  3ZMS A;  3BG6 A;  4K2E A;  5LGU A;  1BR2 A;  2AXL A;  2PFB A;  2R7U A;  2O9L A;  1HCR A;  3S15 J;  1FYL A;  4OIO F;  4XNF A;  2HVR A;  2WAQ A;  2CQX A;  1FSH A;  3G2B A;  4BY7 J;  1X19 A;  2F5E A;  2FSW A;  5IP6 A;  2JVG A;  3PM1 A;  2P81 A;  1USS A;  1YJW I;  5J1R A;  5ICE A;  1ZK8 A;  3MZY A;  4FTH A;  1I5Z A;  1S29 A;  1HOM A;  2OV7 A;  2VKD A;  2XGE A;  1YRN B;  2ELK A;  2ZNZ A;  4XLC A;  5DUK A;  3RYP A;  2EA4 A;  4Z2Y A;  3W2W A;  4KIG A;  4PJM A;  3HOV J;  2LSO A;  2QBY B;  3JTH A;  1YG2 A;  1Z21 A;  3UKG A;  4G6D A;  3SQN A;  3FXQ A;  3L2V A;  4BXF A;  2ZXH A;  2K3F A;  1MH3 A;  4R1H A;  4MFD A;  3OR1 C;  1RES A;  2GOX B;  2DPU A;  3IRR A;  4I0B A;  5JHF A;  2BY1 A;  1SAN A;  1IN5 A;  5HDK A;  1BOB A;  2DFH A;  2D45 A;  3DLA A;  2IPQ X;  1A6I A;  4TV7 A;  4XKV A;  3CO7 C;  2L9N A;  2XV4 S;  3I4M J;  1W7P D;  3HOY J;  4C2M J;  5JVG F;  5B1B H;  2L5Q A;  1OCC H;  4DZJ A;  2DT6 A;  2LR8 A;  2PEX A;  4B3A A;  2M34 A;  2RNJ A;  3W3C A;  1K78 A;  3K4C A;  4P96 A;  2ZXJ A;  1QPI A;  4EQQ A;  3FX3 A;  1TNT A;  4HNT A;  1QZZ A;  2FU4 A;  3SJM A;  1JKP C;  1XSX A;  2BGC A;  3I56 I;  1W36 C;  2C6Y A;  2JSC A;  1X58 A;  2UZK A;  3J80 Z;  2KDZ A;  3SFZ A;  2G7U A;  4M3D A;  4E70 A;  2DA7 A;  3VSL A;  4XRM A;  4G6T B;  1YLF A;  5JLW A;  4HDV A;  2RAE A;  3ESW B;  1F36 A;  1AKH B;  4P9F A;  3CF5 F;  4MQV A;  2WAD A;  5EEA A;  4V19 K;  1BC8 C;  1LDK B;  4ZTF A;  4I98 B;  4BXU A;  3PNV A;  2LYC A;  1R00 A;  2CU7 A;  4U88 A;  5JLX A;  5J1Y A;  3V8J A;  1X3U A;  3H9J A;  2P5K A;  2CJJ A;  2VJI A;  1UFM A;  1DPU A;  1T08 B;  1TT0 A;  1WQ2 A;  2LH9 A;  2OZU A;  4LOC A;  2DJN A;  4RB2 C;  2X48 A;  3DBH B;  1HQC A;  3DFG A;  1WCM J;  2PBI A;  3G6E I;  4CYC A;  3C2B A;  1OPC A;  1ZR4 A;  3HHG A;  1OKR A;  3CLO A;  4XMY A;  3MKL A;  2HYG D;  2MA3 A;  2VN2 A;  4QLC U;  2CWE A;  3R0J A;  5LGN A;  2MSY A;  3WTZ A;  4UVA A;  4B09 A;  4PUS A;  3GZN B;  2QEN A;  2LF7 A;  2P7V B;  4OIR F;  2XKP A;  2LBF B;  2R7Z J;  2ZJR F;  2HGC A;  2PMZ N;  1CF7 B;  4BKX A;  2ZME B;  3DWL E;  1V3F A;  3JRE A;  1XGS A;  4M3E A;  1IW7 F;  2I10 A;  3OYI A;  3K4N A;  1T0F C;  5K7F A;  3AG4 H;  2FBH A;  4B48 A;  2EBI A;  4BHB A;  4AID A;  2X6X A;  3AL0 B;  3VDX A;  4F7Z A;  1I50 J;  3CCL I;  3S8P A;  2AS5 F;  2M4K A;  4IHT A;  3V4G A;  2ISZ A;  4KN7 X;  2DOE A;  2H6B A;  4ETS A;  2E60 A;  4IX7 A;  4IZZ A;  5D6F A;  3EYY A;  4S04 A;  3M3Y J;  4WWC A;  4BQA A;  2CQQ A;  4BE0 A;  4II2 A;  3B73 A;  5ICF A;  3TDZ C;  1K61 A;  1NH3 A;  3TW7 A;  2MC4 A;  1ORK A;  4A5N A;  4BAY A;  1DDN A;  4NB5 A;  2L4M A;  3R0A A;  2DFE A;  1W36 D;  2VT2 A;  1JE8 A;  3RTR A;  1MH4 A;  2KP6 A;  1Y56 A;  1T0F A;  2DQL A;  3K4J A;  3V7S A;  4RLF A;  3A2K A;  3I59 B;  3KYC B;  4S05 A;  2LOO A;  4ZYE A;  1TL8 A;  3WTS C;  3CQZ J;  3U1K A;  5JFR A;  5F27 A;  1R49 A;  3A1Y A;  3RIR A;  4NBQ A;  1HXD A;  4NHJ A;  1ACI A;  1U3E M;  3BQY A;  3QOP A;  5E8I A;  3OS0 A;  1QQI A;  2VPR A;  3KZZ A;  4BBR J;  1B9M A;  4KUM A;  1VQL I;  1IRG A;  3E6M A;  1O7L A;  4X1E A;  1WKM A;  2XRL A;  2VXD A;  2Y75 A;  1R9T J;  1HA8 A;  2IGK A;  3BG5 A;  3S1N J;  1YRN A;  2F4I A;  4BGD A;  3G1L A;  3OL4 A;  2W4S A;  5F6F A;  3A03 A;  1FOX A;  2L7K A;  1FSE A;  2QBY A;  1RIO H;  4PZJ A;  2FD5 A;  2ZCW A;  3RCO A;  1A04 A;  2WTE A;  2M1B A;  5E18 F;  2NYX A;  3HOX J;  2PX9 A;  2LK2 A;  1UAA A;  4FHT A;  1FZP B;  1TBX A;  1Z0X A;  2VT3 A;  4Y33 A;  3DPL C;  3X2Q H;  1TZL A;  3CC2 I;  1D0Z A;  1X3W B;  4HOB A;  3LSP A;  3OYN A;  1IN6 A;  2EK5 A;  2VON A;  3H92 A;  4BNC A;  4GFB A;  3L2R A;  2BVM A;  1QHG A;  2CSO A;  2K27 A;  2YR2 A;  4RLQ A;  1T98 A;  4PSX A;  2WY8 Q;  1F43 A;  1TT5 B;  1IUY A;  2HEO A;  4ZYG A;  5FLM J;  5EEH A;  4FET A;  3CCV I;  2IAI A;  2FMY A;  5FFX A;  2XAU A;  2PG4 A;  3GX4 X;  3HYI A;  2NVT J;  3D5R C;  2FEZ A;  3OS2 A;  4PFO A;  3R61 A;  4XLF A;  2CW8 A;  2NOJ B;  1S6L A;  2V1X A;  2KIU A;  2VL8 A;  5DS9 A;  4D7M A;  2HDD A;  4W1U A;  3K4B A;  1M1E B;  4MHG A;  5AIQ A;  2K9Q A;  2YU9 J;  4IHW A;  3PO3 J;  1D8K A;  1P6R A;  2GWR A;  4JK1 X;  4EJO A;  1I1S A;  2XPV A;  2IS1 A;  4MGR A;  4M6V A;  3KET A;  5IT9 K;  2MFZ A;  3DEU A;  1AKH A;  2M8G X;  2VB6 A;  1HST A;  3SZG A;  1H88 C;  3PUB A;  1YYV A;  2O61 A;  1LFB A;  2ZJP F;  3HOS A;  2G7H A;  3MQ0 A;  2E71 A;  4L5J A;  3JRH A;  3TDU C;  3OIO A;  3OIQ A;  3ABM H;  3ZQ7 A;  3FXL A;  3KEQ A;  2CGP A;  3ERM A;  2ZME C;  1JJ6 C;  1BM9 A;  4AD9 A;  4A69 C;  2CMP A;  3W6K B;  4BH9 A;  2VUM J;  5A2Q K;  4I0A A;  5GPA A;  1ETW A;  2HR3 A;  3HPH A;  3E1S A;  2ISY A;  3LMM A;  4XLN F;  3K6G A;  4WK8 F;  3OMY A;  4A0Z A;  5D8L B;  4O5V A;  5LLQ A;  1E3H A;  2QYO A;  3AL0 C;  3NWS A;  3ZN1 A;  1J0R A;  5K5Q A;  2ID3 A;  3TO6 A;  1P4X A;  2CQK A;  3OIP A;  3BZ6 A;  1NK2 P;  2G0E A;  4P1W A;  2LLK A;  1Y8Q B;  3ELK A;  2LMD A;  2LBF A;  3JRB A;  3E5X A;  3EPZ A;  4CCJ A;  3G1O A;  5ILS A;  1U0J A;  3BOQ A;  4FX4 A;  2DI3 A;  2FBI A;  2ZME A;  3H0D A;  1CF7 A;  1A31 A;  2Y9Z A;  3GLL A;  4BXX J;  4CCM A;  5D5V B;  5KCM A;  3T5X A;  3G4S I;  3JCU C;  1ETY A;  4YIF A;  1GXP A;  3LA7 A;  3L7W A;  5DDG A;  2P6T A;  2O03 A;  4UNO A;  1Z77 A;  2LD5 A;  2VBZ A;  1U78 A;  2V4J C;  2X4H A;  3O8H A;  4ZYA A;  2H8R A;  2Z16 A;  2B7E A;  1SC7 A;  2DDA A;  2EQR A;  5F0C A;  1LJ9 A;  4ASN A;  5J4Y A;  3A0B C;  2DA4 A;  3QPT A;  1V5F A;  4EJV A;  2QQ8 A;  4D0P A;  5D5X B;  1XMK A;  2LY9 A;  4BEH B;  2GAU A;  4HX7 A;  1WJC A;  3ZMD A;  2Q2E A;  3I71 A;  2Y48 A;  3GTG J;  3IUO A;  2YUS A;  5HS9 A;  3WTY C;  2M5W A;  1IDY A;  4GYG A;  3KZI C;  4LLG F;  4XLA A;  3JAM K;  4FE4 A;  5L3G A;  1TW3 A;  3LST A;  1R58 A;  2KIM A;  3ISP A;  3I59 A;  2NS7 A;  5B1A H;  1MJ9 A;  3BJ6 A;  5DUI A;  1TC3 C;  2GXA A;  1KON A;  3GFL A;  3BP8 A;  3J7Z I;  3PJR A;  3KCC A;  3IC7 A;  4OIN F;  3K1M A;  1ENH A;  2MBF A;  1KU2 A;  4AIK A;  1W0U A;  4BU2 A;  1XGO A;  3CO6 C;  2ME0 A;  2L54 A;  3QYF A;  3FXU A;  1R5H A;  1FP2 A;  2VQC A;  4QSH A;  5EEG A;  4HRI A;  2Y2Z A;  3PNT A;  3CUQ B;  3I64 A;  4XM3 A;  3GVA A;  2AHQ A;  3ASO H;  5J3L A;  4FIS A;  4QPQ A;  5E1X A;  3PQK A;  1TQM A;  5FKN A;  5AON A;  2E2H J;  2OTJ I;  3RDI A;  2K9M A;  3FDY A;  4XN0 A;  4UY8 I;  1Y0N A;  1FOW A;  3F9K A;  3I4P A;  4B4C A;  2DLL A;  2K7L A;  1RC9 A;  1HW2 A;  2RKH A;  1BBY A;  2RVC A;  3KP4 A;  4W97 A;  2R7S A;  3I54 A;  1B6A A;  1QHH D;  1EH7 A;  4NC6 A;  3FXR A;  3QOE A;  1Z05 A;  5CQG A;  5F1J A;  2QZ8 A;  3J7A O;  2XSJ C;  4RB0 A;  4ZDL A;  3EUK L;  1KU3 A;  1TW2 A;  3BTI A;  4C2U A;  4M9X A;  1FJL A;  1YI2 I;  4I7H A;  2VIX A;  2IP2 A;  3BTL A;  4G7Z F;  2TDX A;  2VBY A;  2WBM A;  2XB5 A;  2QA4 I;  4WX9 A;  3HM5 A;  3EET A;  1KYW A;  1O57 A;  3HRM A;  2BOL A;  3MFK A;  4CH7 A;  1UB9 A;  3IKV A;  1ERD A;  1LB2 A;  4NC8 A;  4JQF A;  2FX0 A;  3FMS A;  4YII A;  4M72 A;  3W6J B;  2KRH A;  2EZH A;  1K4T A;  3EDP A;  3S16 J;  1ZKG A;  2MD5 A;  2HQ5 A;  1IN7 A;  1W7P B;  3FZV A;  1SAX A;  4LFU A;  5K7H A;  1G6N A;  1HKS A;  1OJL A;  4CA0 A;  5E3L A;  1B59 A;  1S7E A;  3FBI B;  3KX2 A;  3COA C;  3E6C C;  3ABT A;  4IQ4 A;  2GBY A;  2KZV A;  3F3X A;  4YFN F;  3IHU A;  3ZXS A;  1W5C C;  4CIC A;  5KAI C;  2EV6 A;  1F4K A;  2M0C A;  3DU6 A;  4I09 A;  4XON A;  2L9V A;  3QP5 A;  2QQA A;  1VND A;  4BQN A;  2IRF G;  3MKW B;  1ZG1 A;  3CCS I;  4UUV A;  1E3P A;  4EJW A;  2Z33 A;  1RNL A;  3CJQ B;  4ESJ A;  3OS1 A;  1EF4 A;  4HW0 A;  5D8K B;  3IWZ A;  3C2G A;  2F5D A;  2IGN A;  3CDI A;  5CPR B;  2B9S A;  4RAG A;  1ZN2 A;  3HEF A;  2GIZ A;  5ICC A;  5IT3 A;  1NHA A;  1X2M A;  1Z91 A;  3UNG C;  3CF2 A;  1WJF A;  4GGG A;  4AU7 A;  1X1A A;  3BPX A;  2M4G A;  2UXX A;  2EIL H;  3CCR I;  3HRS A;  3F72 A;  5LBQ A;  4CCK A;  3K10 A;  4PCQ A;  2DCE A;  2HVQ A;  3BTJ A;  3KEO A;  1N25 A;  4UVB A;  2XC7 A;  1OCP A;  3F22 A;  4DYC A;  2LNB A;  4ENN A;  4BEH A;  2DTR A;  5B66 C;  1JI8 A;  2M30 A;  1BI3 A;  5FRO A;  3D5S C;  4LJZ F;  4V2G A;  1WJE A;  2M0M A;  3QU6 A;  2X1C A;  4HDU A;  3CUQ C;  3CCE I;  3WGI A;  1RET A;  3QQA A;  2CUF A;  2MH9 A;  5C44 J;  4DGW B;  2DN0 A;  5HS8 A;  3GYH X;  1H0M A;  1TWF J;  2ZSH B;  4AVP A;  2A6E F;  4LIU A;  1LPQ A;  4G8X A;  3WU2 C;  2QQ9 A;  3FXO A;  3K2A A;  2XRO A;  2HDC A;  1ZLJ A;  4UXN A;  1CQT A;  5HS7 A;  3O2P E;  4UUS B;  4MEX F;  2STW A;  1DP7 P;  3E97 A;  3Q0U A;  2GOM A;  1HKT A;  1PUF B;  3I4N J;  3F8B A;  3L2Q A;  1O3T A;  2LKP A;  2O3F A;  3RQ4 A;  3CUQ A;  2V1U A;  2XKO A;  3QRF F;  5M5X J;  2O0Y A;  5DCF A;  3DBR B;  1SVM A;  2E34 A;  4CSW A;  4A3C J;  4BUP A;  3GTM J;  4IPA A;  2DK5 A;  2WB1 N;  2M7B A;  1Q1V A;  1TWH J;  2DTZ A;  3CDH A;  2GQQ A;  1B9N A;  1FEX A;  5E1W A;  1K79 A;  3Q0V A;  5K5R A;  3DKX A;  5ILV A;  1TQI A;  4KT6 A;  5LD2 C;  1UHM A;  4EM1 A;  3BTC A;  1T95 A;  3CTA A;  2XIG A;  3V8L A;  3OYE A;  2O5R A;  2HWV A;  2VC0 A;  3L09 A;  3D0S A;  4BYY A;  1W5S A;  1YIT I;  5EG0 B;  1EH8 A;  4I76 A;  1QNT A;  3SDB A;  3CCU I;  1VQ5 I;  1XSD A;  4U7B A;  1MMA A;  2CUE A;  2WC2 A;  5LHH A;  1I6H J;  4PGH A;  3PSI A;  3ULQ B;  1PYV A;  1WJB A;  1OFC X;  3CJT B;  2QKL B;  4DOZ A;  1D1B A;  5EZH A;  2W57 A;  4JBA A;  4JX5 A;  3GF2 A;  2DT5 A;  2XGX A;  4P55 A;  3OWT A;  1DP3 A;  4DZP A;  2DW4 A;  2XRN A;  3Q3S A;  4M74 A;  1HLV A;  4IJA A;  3J81 K;  2CV0 A;  1ZYR F;  3AAF A;  2OCE A;  1BC7 C;  3S1R J;  3EYI A;  3HOZ J;  4MTE A;  1GHC A;  4IL6 C;  3F0C A;  2P0W A;  4HX4 A;  3WGG A;  4F91 B;  2DMQ A;  1MDM B;  1Y1W J;  1FBS A;  5J47 A;  4MTD A;  1W7P A;  2VQH A;  4XN3 A;  1LVK A;  5LHG A;  2NRA C;  1OYI A;  3NWT A;  1ZHF A;  4B47 A;  2A61 A;  5E20 A;  4ZTJ A;  1RKW A;  4U0W A;  5L3D A;  3JRD A;  1X4O A;  4IQJ A;  2Y0S N;  5BQT A;  2ACJ A;  4RAY A;  1XCB A;  3IWF A;  5DEQ A;  4HSR A;  4M6Y A;  1K6Y A;  1FIP A;  1R23 A;  2VI6 A;  1TWA J;  3GBG A;  4DQ2 A;  3TGN A;  5DCM B;  3V42 A;  3FMQ A;  2V7F A;  3I53 A;  4A5M A;  2DYR H;  2CQ7 A;  1VQO I;  3ZMU A;  2O6G E;  3WG7 H;  2OQG A;  5CYV A;  3JSP A;  3HOU J;  4AWX B;  1VFC A;  3WTV C;  4XKW A;  4OU0 A;  2H1K A;  1WRJ A;  3HL2 A;  4CCL A;  2VQL A;  2LDU A;  4YG2 F;  1KA8 A;  1R5G A;  4YFX F;  4RA2 A;  1R4M B;  2K9N A;  1I3A A;  2E2I J;  3M7G A;  4E6K G;  3BJA A;  4CCO A;  4G94 A;  4R79 A;  1ZRF A;  3HSF A;  4L9N A;  3T0Y A;  2VOD A;  2CS3 A;  4XIC A;  1ETO A;  4HQM A;  1I3Q J;  5IYD J;  2KJB A;  4JOM A;  3GFJ A;  1FBU A;  3GO5 A;  4B1R A;  2WY7 Q;  3VSK A;  3GME A;  3GTJ J;  3PIP F;  5BS6 A;  3GTL J;  1B1B A;  3BR6 A;  1SMT A;  3WOD F;  1H9T A;  2BXY A;  4C3H J;  1QU3 A;  2JT1 A;  4ZZD A;  2NXN B;  3HZJ A;  3NAU A;  1S5L C;  3KP6 A;  4NUB A;  3OYH A;  3HUG B;  4HF0 A;  1D8J A;  5E79 C;  5J8F A;  1D1C A;  2WV1 A;  5HLI A;  4BL0 B;  1J09 A;  5FLV A;  1GVJ A;  3OYA A;  4UUS A;  4M3B A;  2DQR A;  4X0G A;  1Y39 A;  5EDN A;  3H1C A;  4IRG A;  1PUF A;  5EJC A;  3PQJ A;  4ANJ A;  5M5W J;  2FQ4 A;  4CYD A;  1OQY A;  4KFC A;  2KRC A;  2D1H A;  4L9J A;  3ZPL A;  1WVR A;  2HQA A;  4ZZL A;  4A3B J;  2E19 A;  2ZNY A;  3F6O A;  1E0E A;  3L9F A;  1RRJ A;  4PK4 A;  2RDP A;  3LL7 A;  3E7L A;  4QTR A;  3G73 A;  1T2K A;  4G7O F;  1S7A A;  3QAH A;  1U8R A;  2F4M B;  1F9N A;  1ZLK A;  1UEL B;  2L7F P;  2YSR A;  4ITV A;  1S8N A;  3LA2 A;  5EG0 A;  3V7C A;  4XRS A;  3DTE A;  3MKZ A;  2FUG 2;  1O7F A;  3CJN A;  1GDT A;  1R1T A;  4BY1 J;  2IEK A;  2A69 F;  4EJU A;  2H8W A;  4U87 A;  1YHQ I;  5GAH J;  4D5F A;  4E7S A;  3S3O A;  3S1M J;  3OYF A;  1XD7 A;  4V2F A;  3DCF A;  4PJ0 C;  3TKY A;  5L3B A;  1VQN I;  1SFX A;  2XSD C;  1MKM A;  3HKZ A;  2M45 A;  4OIP F;  1MDM A;  2QWW A;  1S7O A;  2PI0 A;  3DF8 A;  4U0V A;  2ZJQ F;  1FY7 A;  2A3S A;  1SMY F;  2H1L A;  2Q2E B;  4Q47 A;  4LIV A;  1L0O C;  5LFA A;  2DT7 B;  3ABK H;  2WAF A;  3RYR A;  2K02 A;  2E35 A;  3HTU A;  5DYM A;  3OOP A;  3CD6 I;  2KL4 A;  3B02 A;  3GTO J;  2RC4 A;  2RQP A;  5L3E A;  4ESB A;  1JJ8 C;  4GCV A;  1ON2 A;  3ZMZ A;  3M4O J;  3HIF A;  3AFH A;  2RQQ A;  2W00 A;  3ABL H;  1IJW C;  3J7Y J;  4Z6Y A;  1YS6 A;  3Q5F A;  3R6S A;  5F0F A;  2DA3 A;  3S2W A;  2HU9 A;  1VQ4 I;  1MMD A;  2Z9O A;  3A01 B;  2OU2 A;  3PUF A;  3O8G A;  5DCM A;  4OMY A;  4X6A J;  2NAZ A;  4MLO A;  2EB7 A;  2NS0 A;  3O3K A;  2EZI A;  1NG6 A;  5CLS A;  3OSG A;  2WAE A;  4E7K A;  2V9K A;  2EZK A;  5FGM A;  4DNC A;  1U9O A;  2PQ8 A;  4JP0 A;  1JT6 A;  2V6C A;  1IRZ A;  2BBY A;  1P9Q C;  1KQ9 A;  1IUF A;  4OAZ A;  5LGT A;  4LB5 A;  2VKV A;  3ABU A;  3WHC A;  4B44 A;  4ZDO A;  3P9C A;  3ZQQ A;  1TNS A;  5KHD A;  1B72 B;  3CCY A;  2CUJ A;  3S17 J;  3BDD A;  5BPI A;  4C30 A;  1D0Y A;  3SDG A;  3SZT A;  2FA5 A;  4PDK A;  2EFP A;  1Z6R A;  1A5J A;  4I99 C;  9ANT A;  2OD5 A;  3ECO A;  1P4A A;  1MBH A;  2XF6 A;  4HBL A;  2JA8 J;  1WH7 A;  3ZP5 A;  2DO7 A;  2NVQ J;  3K4K A;  2EV0 A;  3GFI A;  3HRT A;  5LHI A;  3HUG A;  1OLT A;  3BRO A;  4XSX F;  2OQR A;  1EKE A;  4HNU A;  2K85 A;  2ZJ2 A;  2XAG A;  2XVC A;  5HLT A;  2JA6 J;  5J1U A;  1LKX A;  2CUZ A;  1ETV A;  2J5O A;  2L4A A;  4AUX A;  1W5T A;  4KIB A;  2LP0 A;  3OV8 A;  4L5I A;  2HVS A;  2IT0 A;  2DPD A;  2R7V A;  5GTI C;  3KE2 A;  1MIJ A;  3K69 A;  3DU5 A;  4A3F J;  1Z67 A;  2OJE D;  2QGU A;  1J59 A;  3IAS 2;  3RKY A;  3K1N A;  4EEF G;  3CCJ I;  2BE5 F;  1N77 A;  3LSJ A;  5GP9 A;  1IF1 A;  2VJ4 A;  5LRR A;  1P7I A;  3VOD A;  2M8E A;  4KIT B;  3K70 C;  4RB3 C;  4MNU A;  3BY6 A;  1R1U A;  2PMH A;  2L0K A;  2E7X A;  2M3A A;  5K7Z A;  4D1Q A;  3K0L A;  2UXN A;  5CJ9 A;  3HTS B;  3HPG A;  3QOD A;  3ZQH A;  1K83 J;  1DQU A;  2JZY A;  3FXJ A;  1U5T B;  4NC7 A;  1X2N A;  3ZMT A;  2R7X A;  3BG3 A;  2MGQ A;  3MKY B;  3RJP A;  1DUX C;  4OIQ F;  1PP7 U;  1MBF A;  3QYB A;  2RNG A;  1BN5 A;  1WFX A;  4CDG A;  3GCM A;  2A68 F;  2X85 A;  3OYC A;  3M8F A;  1IXS B;  1P2F A;  4YIR X;  2ZFU A;  3G71 I;  3W6V A;  3F23 A;  5ED4 A;  3OYM A;  2BV6 A;  4CCN A;  2PMU A;  2ETH A;  2DA6 A;  2DYS H;  5FD5 A;  4EGZ A;  3RKQ A;  5J4V A;  1Z7L A;  3N97 A;  4YEL A;  4GRI A;  3WE3 A;  2VJJ A;  2OCC H;  4O6J A;  4Y3O A;  5CVU A;  3BWG A;  3WU0 A;  2HFH A;  3V7R A;  1WJD A;  3IH3 A;  1VQ7 I;  4LLL A;  2FE3 A;  3H5N A;  5TRD A;  4PFP A;  4F52 A;  1UG0 A;  4XR6 A;  5TIS C;  4F3Q A;  1MNE A;  2Q0O A;  2HKX A;  1U8B A;  5L3C A;  5FKL A;  5HVQ C;  3ML6 A;  3GFM A;  4BQO A;  4PGG A;  3DEW A;  1ON1 A;  1UST A;  1GV2 A;  2KRF A;  2Y31 A;  1QA6 A;  1JGS A;  2V6E A;  2QSH X;  4NDL A;  2VOP A;  2F5F A;  3MN2 A;  4IRI A;  1BW5 A;  3LWF A;  2DOD A;  3ZRG A;  3A01 A;  3M9A A;  4D7N A;  1MW7 A;  4C3J J;  1JT0 A;  1ULY A;  3EUH C;  1VQ8 I;  1Z9C A;  5DTD A;  1AOY A;  3HOW J;  2HZT A;  3H9G A;  2AO9 A;  4H0E A;  3K70 D;  2JQ7 A;  1UG2 A;  4BS9 A;  2W25 A;  1MND A;  3LAP A;  2EFW A;  3AG1 H;  1G3T A;  3PL8 A;  4XLE A;  2ZKZ A;  2HXO A;  1MD0 A;  5IT9 Z;  2NNN A;  4KDP A;  2LY2 A;  2WA0 A;  2Q1Z B;  4XSZ F;  2VBW A;  1IC8 A;  2CRG A;  2L02 A;  3WG9 A;  4LD5 A;  4NQW B;  1WHU A;  3KLN A;  3MWM A;  4UV8 A;  1B72 A;  3CDL A;  4HV6 A;  2LRE A;  2YU3 A;  4XK4 A;  1NG7 A;  2GA2 A;  4KIC A;  4AVZ A;  1IXC A;  2IGO A;  3EUH A;  4I02 A;  5LEJ A;  4KIS A;  2CFO A;  2M9H A;  1Y1V J;  4A3E J;  2Z1D A;  3JRI A;  3WE2 A;  5F0H A;  5GTH C;  3BCB A;  2PJP A;  1X3Z B;  3O6B B;  3VEP A;  4BDZ A;  1X1C A;  2BY0 A;  5E1Z B;  1G3Y A;  1YIO A;  1MBE A;  4KYW A;  2E5Z A;  3C7J A;  3BZK A;  5J8C A;  2DMN A;  1LQ1 A;  2YX7 A;  2BVL A;  3BG9 A;  3NRV A;  5FFZ A;  3DKW A;  3BPV A;  2EFQ A;  2NS8 A;  2X1E A;  1XN7 A;  1HDD C;  2EA2 A;  2LY1 A;  5H2F C;  1ZTR A;  2X51 A;  3SEZ A;  3ZMV A;  2FRH A;  2L9R A;  4QIW N;  4N4O B;  3W2A A;  2MH2 A;  2STT A;  2JUG A;  4YRV A;  1BJZ A;  4N9I A;  5H6R A;  1EA3 A;  1U5T C;  3FWE A;  2ECB A;  3ZOB A;  3CJR B;  4M9S A;  5JR3 A;  3OR2 C;  1DGR M;  1ETQ A;  1JHF A;  4A3J J;  1J5Y A;  2O8K A;  4CHU A;  3TL4 X;  1OR7 C;  2V26 A;  1FWZ A;  1IG7 A;  4A3D J;  1SVO A;  2CG4 A;  4RB1 A;  4B8X A;  1UCR A;  3BR2 A;  2ZBK A;  3RKX A;  2A6T A;  5FKM A;  2L9S A;  2Z3Y A;  2ELJ A;  2LKS A;  3U2R A;  3KYL A;  1D5V A;  3PSF A;  1UMQ A;  1U5T A;  5KK1 A;  4HLX A;  5E17 F;  4N9H A;  1SD4 A;  4MEY F;  3PFI A;  2XF7 A;  1Z3Y A;  2ADU A;  2AXT C;  3QPH A;  2W82 A;  4F92 B;  3S3M A;  5HOO A;  3MZ8 A;  3LAJ A;  4LMY A;  1JKQ C;  2HOT A;  1OR7 A;  3WHB A;  1C0W A;  4BBS J;  1QO0 D;  4XOP A;  3BG7 A;  2R5Z B;  4ENK A;  1UZC A;  4C2T A;  1MBJ A;  2ZO4 A;  1BR1 A;  3H3V K;  1MBG A;  3IAM 2;  2RRE A;  3VOE A;  1LUJ B;  1IDZ A;  2BW3 B;  5D5W B;  1L3L A;  4RGS A;  3OYL A;  2A6H F;  2NVX J;  5ERI A;  1ONV A;  1YFH A;  2XAS A;  3FKJ A;  3GLX A;  2P8T A;  3ASN H;  5CKT A;  1OCO H;  1ZGJ A;  1VQ6 I;  3H5A A;  2D5V A;  1QVU A;  2P5V A;  2DMP A;  1DU0 A;  5HDG A;  2JPC A;  3TW6 A;  2ME6 A;  4BJ6 C;  3GWZ A;  1P7J A;  3T8R A;  1UHW A;  2TCT A;  3K2Z A;  5FRN A;  3GTP J;  2R7F A;  2ICW G;  5EF6 A;  3IH2 A;  3CME I;  2EIJ H;  2J5P A;  2XPU A;  5K5O A;  1U2W A;  3B6C A;  3C1D A;  2LG4 A;  4FAS D;  2Y9Y A;  3VYS B;  3FMR A;  2DK8 A;  1T8I A;  3FIS A;  1IN8 A;  5KAF C;  3ONQ A;  1KU9 A;  1T39 A;  1KQ0 A;  2D2W A;  3TO9 A;  4A3I J;  4XOR A;  2MLG A;  3REO A;  3R60 A;  3B6A A;  3H35 A;  2DOF A;  5ILU A;  3L2W A;  3JW4 A;  3K4L A;  2K40 A;  4KIF A;  1IRX A;  3ZN0 A;  5D6E A;  4WXH A;  5EYR A;  3GZ6 A;  1V54 H;  3QPL A;  5JHU A;  2H94 A;  3TP0 A;  2QLZ A;  5L3F A;  2KKO A;  1PUE E;  1P92 A;  5BNG A;  5FRM A;  1WWX A;  3PFY A;  1LVA A;  4E4H A;  3OYJ A;  3H3U A;  3FM5 A;  1T56 A;  2OA4 A;  1T38 A;  3RZO J;  2XDV A;  1ZEL A;  1ZG5 A;  4NQW A;  2F48 A;  4KA4 A;  5EZG A;  2QEX I;  1SFK A;  2X9D A;  3OOU A;  2R5Y B;  5DM7 F;  3LSG A;  4L18 B;  2HXI A;  4A2U A;  2JJ7 A;  2B63 J;  1GUU A;  2P4W A;  1O3R A;  1BI0 A;  4O3M A;  2KT0 A;  3H9Q A;  2XPW A;  2BYV E;  2HZD A;  1D0X A;  2KDO A;  4HZF A;  5DD4 A;  3RPQ A;  2I5U A;  2Y0M A;  2E1C A;  2DJI A;  1MZB A;  2HYJ A;  3LSI A;  2KPM A;  2CYY A;  1VTN C;  1E2X A;  3C2H A;  3OY9 A;  3E0J B;  1I6X A;  3KLO A;  1Z3X A;  1APL C;  4CXF A;  1R22 A;  5BOX A;  3R4K A;  1G4D A;  3FHZ A;  3RQI A;  1SVL A;  3C18 A;  1SAU A;  3E6B A;  1IO2 A;  2D1V A;  2P7C B;  1BL0 A;  3CES A;  2K4B A;  5FLX Z;  4XLH A;  1LFU P;  5E3M A;  4ZC3 A;  1KQ8 A;  3GXO A;  1LNW A;  5CVV A;  4OAY A;  2IS4 A;  3S3N A;  1OCZ H;  1GXQ A;  1YX5 A;  3ZR8 X;  4J19 A;  3G3Z A;  3GTK J;  3JRC A;  1SFO J;  1ZRC A;  1FTT A;  3LQR A;  3HB9 A;  3L1P A;  5B5E C;  2E7W A;  5FJ8 J;  3K7A J;  3BJO A;  3LNQ A;  2Y30 A;  3MCZ A;  3L00 A;  2JA2 A;  2L3D A;  3M1E A;  4D9J A;  3MVP A;  2KIF A;  5TJJ A;  2W48 A;  1YTY A;  5DD8 A;  2JRT A;  3J80 K;  3K9T A;  4IOC F;  1VQK I;  1HKQ A;  2EV5 A;  2JPB A;  3FIW A;  4F55 A;  1WJ5 A;  1VF9 A;  3LSK A;  5FO5 A;  4AYB N;  1LFP A;  3T1B A;  3TO7 A;  3VFZ A;  2LKX A;  4PJL A;  1OYY A;  3IRQ A;  3WTX C;  1QRY A;  2PMZ A;  3FXM A;  4WCG A;  4E7J A;  3KYD B;  2VAS A;  4E7Z A;  1OMI A;  1J7K A;  3PO2 J;  1HF0 A;  4JX4 A;  5J6X A;  1J9I A;  1XCV A;  2EPF A;  2WV0 A;  4UB6 C;  2HI3 A;  3VYT B;  1MSE C;  4XL9 A;  2HPM A;  1QBJ A;  3MEX A;  3P7N A;  2R5Z A;  3HG9 A;  3ZQL A;  3LSM A;  4L5E A;  4ENM A;  2E1N A;  3F8F A;  3F21 A;  2P5L C;  2V9V A;  4BE2 A;  1ZAO A;  1YO5 C;  2XAF A;  4A93 J;  2IJL A;  1WI3 A;  2BW3 A;  2JMW A;  3DP7 A;  4IF4 A;  2BEO A;  2FML A;  4Y13 A;  2V1N A;  4G7H F;  2DXI A;  3CZ6 A;  4Y52 J;  3AG3 H;  3DPT A;  3LSR A;  4KT5 C;  3CCM I;  1R1V A;  1BR4 A;  2X1D A;  2BY3 A;  2HOE A;  4PSW A;  2X0L A;  4GYI A;  5GPC A;  3JSO A;  2IS2 A;  3JRF A;  1EJ9 A;  2R0Q C;  1ZQ3 P;  2W84 A;  3FM3 A;  5E3O A;  1OYW A;  2VXZ A;  1WPK A;  2VE8 A;  2O8X A;  3RI4 A;  3ZQG A;  4I6Z A;  1JXS A;  1MMG A;  2DFI A;  4HV5 A;  2K5C A;  5CQE A;  3U1D A;  3I55 I;  1BW6 A;  4RMN A;  5JI6 A;  2A07 F;  2NVY J;  4BJT A;  2ZFW A;  4MFE A;  4EV0 A;  2K3P A;  4EM2 A;  3OSF A;  4Y4R A;  2ZXW H;  3J81 Z;  2HPI A;  2OTL I;  4A3L J;  1IGN A;  3EQL F;  3J7A Y;  1IV8 A;  1YJN I;  2KMU A;  1VQM I;  4RGU A;  1R36 A;  2XHK A;  5TGT A;  4ZJZ A;  3GW2 A;  1FYK A;  1MSF C;  3AKZ A;  4G6Q A;  2EFO A;  3PNY A;  1LDJ A;  3I9V 2;  4UHT A;  5KVR A; 
#chains in the Genus database with same CATH homology
 4BHC A;  3E5U A;  5JVT A;  2IW5 A;  4MQ9 F;  2EJR A;  3RKW A;  4Y17 A;  1EH6 A;  3NEU A;  5D5U B;  1SD5 A;  2LF8 A;  1YW9 A;  2XAH A;  2RN7 A;  1U6G A;  1FPQ A;  3TQN A;  3WGH A;  3TOA A;  4L9T A;  1EV7 A;  2YX4 A;  4RGR A;  2HQR A;  4RS8 A;  3WTU C;  2L01 A;  1IAW A;  3TOB A;  4KNY A;  1D3Y A;  2W85 A;  1STZ A;  2GZW A;  2HS5 A;  4IHS A;  3WTT C;  3KP5 A;  4GO1 A;  1WSU A;  4I2O A;  1SFE A;  1J2X A;  4KN4 X;  2DBB A;  3KP3 A;  3N4M A;  1G3S A;  1XGN A;  3QP6 A;  3M8E A;  4EVI A;  2Z5U A;  5AIP A;  4QWQ A;  2K4J A;  4BHP A;  2HQN A;  4M71 A;  2FQ3 A;  1O3S A;  6PAX A;  1ZAR A;  4HLY A;  3DQV C;  2H27 A;  5D4R A;  3HRU A;  1TTY A;  2GXG A;  2QQB A;  4FX0 A;  1FOK A;  2ELH A;  1ZRD A;  2FNP A;  4CO8 A;  2DU9 A;  2ESN A;  2GIV A;  4LGW A;  4HF1 A;  2OBP A;  5F64 A;  4A0Y A;  1IRF A;  1XDS A;  5ICG A;  4Q48 A;  1XGM A;  2V1D A;  2FNA A;  4EGY A;  3U9G A;  3F6V A;  1H9G A;  1K7A A;  1RZ4 A;  1FNN A;  1CGP A;  4Y15 A;  1FP1 D;  4EMS A;  3GUD A;  4IRH A;  2W24 A;  1S3J A;  1HBX G;  2RGV A;  1HSJ A;  4U0Y A;  5DV5 A;  1BI2 A;  1ZH5 A;  4XRF A;  1E17 A;  2OZ6 A;  4HAM A;  4LB6 B;  2MLK A;  4P9U A;  1Y0U A;  4U7D A;  3V8K A;  1REP C;  1O3Q A;  3Q9V A;  4R8H A;  3MZH A;  4WXD A;  4YFK F;  2EFN A;  3DV8 A;  5FB2 A;  1KYZ A;  2GXB A;  1JHH A;  1FC3 A;  1XMA A;  1YW7 A;  2VE9 A;  4KMU X;  1BJA A;  3I5U A;  4AIJ A;  3F8N A;  2YPR A;  1SFU A;  4ENJ A;  4FT8 A;  1W4M A;  4UV9 A;  5H20 A;  3CUO A;  2OAZ A;  2XAJ A;  2PN6 A;  3Q9S A;  4RAZ A;  3KFW X;  5E8G A;  1Z6T A;  1F5T A;  1ZGA A;  2R3S A;  1IXR C;  1ODD A;  3D5L A;  1P4W A;  3F8M A;  3JTG A;  4UVC A;  4LLN A;  1J75 A;  3T8T A;  1SD6 A;  4LK0 F;  4EJT A;  4CGZ A;  1HW5 A;  5LEK A;  4M9Z A;  1QGP A;  3RPU A;  1RUO A;  1LEB A;  4HF2 A;  3LQQ A;  1Z7U A;  1G3W A;  3VB2 A;  3HOT A;  3LFK A;  2RV8 A;  2Q8K A;  4WXC A;  1XB4 A;  1FT9 A;  2R7D A;  4OOI A;  5HDN A;  2VBX A;  2P6S A;  1I27 A;  2JTV A;  4A6D A;  2H6C A;  1RUN A;  1BIA A;  4OMZ A;  1BI1 A;  2WWY A;  3SXY A;  3ECH A;  3SHF A;  2ESH A;  5A2Q Z;  4HQE A;  3L2C A;  2FF4 A;  1FX7 A;  1T6S A;  1MJA A;  5D4S A;  5FD6 A;  4G9Y A;  4EM0 B;  2K86 A;  4M6X A;  2B0L A;  4L0Z B;  1YQA A;  3ROU A;  2A5Y B;  3IL2 A;  4I01 A;  1YW8 A;  1PDN C;  2IA0 A;  4LK1 F;  4IVN A;  4HYE A;  1HW1 A;  4Q4Z F;  3QU3 A;  3E5Q A;  3GZ5 A;  3LA3 A;  4KMF A;  1V4R A;  2VOO A;  3JAM Z;  4N0B A;  3HSE A;  2QM3 A;  5H6Q A;  4LG0 B;  5K1Y A;  3K1P A;  1Q1H A;  1K6O A;  1PP8 F;  1TLH B;  2F2E A;  4A6E A;  1XDU A;  1TQP A;  2XUB A;  3DXJ F;  3H3Z A;  1WI9 A;  2COM A;  2G9W A;  3HHH A;  4XLP F;  1BOA A;  3SZP A;  5HLH A;  2H09 A;  1YS7 A;  2KJC A;  4ZH4 F;  4ZYH A;  2HKO A;  4L0Y B;  2UWM A;  2F5C A;  1Z1D A;  1R7J A;  5FLX K;  1IN4 A;  1LEA A;  2Z99 A;  3C3W A;  3MAJ A;  2CO5 A;  5LRS A;  3E3V A;  5BMZ A;  1BIB A;  4HX8 A;  5CVR A;  1ZG3 A;  1SD7 A;  1FLI A;  1QZY A;  4ZYD A;  2CW0 F;  3IKT A;  1ZRE A;  3GEZ A;  4L9V A;  3FF5 A;  3I0T A;  4P5O A;  2QUF A;  4A0X A;  5F1R A;  2IA2 A;  2IA1 A;  4AIH A;  4A12 A;  2FXA A;  1KU7 A;  1K78 B;  4HA8 A;  3ERE D;  1I1G A;  2PLY A;  1AWC A;  1FBQ A;  2DAO A;  4GXO A;  2GA1 A;  5CVI A;  1FYM A;  3I58 A;  1IZ1 A;  1QPM A;  4ESF A;  1MGT A;  2EWN A;  2XAQ A;  3WU1 B;  2NNY A;  1F1Z A;  3HSR A;  2V79 A;  2HTJ A;  1B4A A;  1LDD A;  3NQO A;  4IXA A;  1RI7 A;  4M73 A;  2MC3 A;  1MJB A;  3P9I A;  3WTW C;  2VC1 A;  2CFX A;  4XBF A;  3KZY A;  3P9K A;  2FBK A;  3KP7 A;  4Q5S F;  2M87 A;  3E6D A;  4CZZ A;  1KGS A;  1DPR A;  2IVM A;  4RGX A;  2HTS A;  2FOK A;  4WF2 A;  2QVO A;  5HLG A;  1XSV A;  3KP2 A;  4LG0 A;  2HYF A;  5BPD A;  4ON0 A;  3F8C A;  5CVJ A;  3ZMS A;  4K2E A;  5LGU A;  2AXL A;  2PFB A;  1FYL A;  4OIO F;  1FSH A;  2F5E A;  2FSW A;  1USS A;  5ICE A;  3MZY A;  1I5Z A;  1S29 A;  2ZNZ A;  5DUK A;  3RYP A;  2EA4 A;  4Z2Y A;  4KIG A;  2LSO A;  2QBY B;  3JTH A;  1YG2 A;  4G6D A;  3SQN A;  3FXQ A;  4R1H A;  2DPU A;  3IRR A;  4I0B A;  5HDK A;  1IN5 A;  2D45 A;  2IPQ X;  4TV7 A;  3CO7 C;  2XV4 S;  1W7P D;  2PEX A;  2RNJ A;  1K78 A;  4P96 A;  2ZXJ A;  4EQQ A;  3FX3 A;  1TNT A;  1QZZ A;  2FU4 A;  1XSX A;  2BGC A;  2C6Y A;  2JSC A;  2UZK A;  3J80 Z;  3SFZ A;  2G7U A;  4E70 A;  1YLF A;  4HDV A;  4P9F A;  4MQV A;  1BC8 C;  1LDK B;  4I98 B;  4BXU A;  1R00 A;  4U88 A;  3V8J A;  1X3U A;  2P5K A;  1UFM A;  1DPU A;  1WQ2 A;  2OZU A;  4RB2 C;  1HQC A;  3DFG A;  2PBI A;  1OPC A;  3HHG A;  1OKR A;  3CLO A;  2HYG D;  2MA3 A;  2VN2 A;  4QLC U;  5LGN A;  2CWE A;  3R0J A;  3WTZ A;  4UVA A;  4B09 A;  2QEN A;  2LF7 A;  2P7V B;  4OIR F;  2XKP A;  2HGC A;  1CF7 B;  2ZME B;  1V3F A;  1XGS A;  1IW7 F;  2FBH A;  4BHB A;  4F7Z A;  2AS5 F;  4IHT A;  3V4G A;  2ISZ A;  4KN7 X;  2H6B A;  4ETS A;  5D6F A;  3EYY A;  4S04 A;  4WWC A;  4BQA A;  3B73 A;  5ICF A;  3TDZ C;  4A5N A;  4BAY A;  1DDN A;  4NB5 A;  2L4M A;  3R0A A;  2VT2 A;  1JE8 A;  3RTR A;  3V7S A;  1T0F A;  2DQL A;  3I59 B;  4S05 A;  4ZYE A;  3WTS C;  5JFR A;  3RIR A;  1HXD A;  4NHJ A;  1U3E M;  3QOP A;  5E8I A;  1QQI A;  3KZZ A;  1B9M A;  4KUM A;  1IRG A;  3E6M A;  1O7L A;  1WKM A;  2Y75 A;  5F6F A;  1FSE A;  2QBY A;  1RIO H;  4PZJ A;  2ZCW A;  1A04 A;  2WTE A;  2M1B A;  5E18 F;  2NYX A;  4FHT A;  1FZP B;  1TBX A;  2VT3 A;  3DPL C;  4HOB A;  1IN6 A;  2EK5 A;  2VON A;  3H92 A;  4BNC A;  2CSO A;  2YR2 A;  2K27 A;  1T98 A;  1IUY A;  2HEO A;  4ZYG A;  5EEH A;  2FMY A;  5FFX A;  2PG4 A;  3GX4 X;  3HYI A;  2FEZ A;  3R61 A;  1S6L A;  2V1X A;  2KIU A;  4MHG A;  5AIQ A;  1D8K A;  1P6R A;  2GWR A;  4JK1 X;  4EJO A;  1I1S A;  4MGR A;  3KET A;  5IT9 K;  3DEU A;  1HST A;  1YYV A;  2O61 A;  3HOS A;  2G7H A;  3MQ0 A;  4L5J A;  3TDU C;  3ZQ7 A;  3KEQ A;  2CGP A;  1BM9 A;  4AD9 A;  3W6K B;  4BH9 A;  5A2Q K;  4I0A A;  2HR3 A;  2ISY A;  4XLN F;  4WK8 F;  4A0Z A;  5D8L B;  4O5V A;  5LLQ A;  2QYO A;  3ZN1 A;  1J0R A;  5K5Q A;  3TO6 A;  1P4X A;  2CQK A;  3BZ6 A;  3ELK A;  3E5X A;  5ILS A;  4FX4 A;  3BOQ A;  1CF7 A;  2DI3 A;  2FBI A;  2ZME A;  5D5V B;  3T5X A;  1GXP A;  4YIF A;  3LA7 A;  3L7W A;  5DDG A;  2P6T A;  2O03 A;  4UNO A;  1U78 A;  2VBZ A;  2X4H A;  4ASN A;  1LJ9 A;  3QPT A;  4EJV A;  4D0P A;  5D5X B;  1XMK A;  2GAU A;  4HX7 A;  3ZMD A;  2Q2E A;  3I71 A;  2Y48 A;  5HS9 A;  3WTY C;  2M5W A;  4GYG A;  3JAM K;  4LLG F;  5L3G A;  1TW3 A;  3LST A;  1R58 A;  2KIM A;  3ISP A;  3I59 A;  5DUI A;  1MJ9 A;  3BJ6 A;  3GFL A;  3BP8 A;  3KCC A;  3IC7 A;  4OIN F;  3K1M A;  2MBF A;  1KU2 A;  4AIK A;  1XGO A;  3CO6 C;  2L54 A;  3FXU A;  1R5H A;  1FP2 A;  5EEG A;  3CUQ B;  3I64 A;  3GVA A;  5E1X A;  3PQK A;  1TQM A;  5AON A;  3RDI A;  3I4P A;  2DLL A;  2K7L A;  1HW2 A;  2RKH A;  1BBY A;  2RVC A;  3KP4 A;  3I54 A;  1B6A A;  1EH7 A;  3FXR A;  1Z05 A;  2QZ8 A;  3J7A O;  4RB0 A;  1KU3 A;  1TW2 A;  4M9X A;  4I7H A;  2IP2 A;  4G7Z F;  2TDX A;  2VBY A;  4WX9 A;  3EET A;  1KYW A;  1O57 A;  3HRM A;  3MFK A;  1UB9 A;  3IKV A;  1LB2 A;  4JQF A;  3FMS A;  4YII A;  4M72 A;  3W6J B;  3EDP A;  2MD5 A;  1IN7 A;  1W7P B;  3FZV A;  1SAX A;  4LFU A;  1G6N A;  1HKS A;  1B59 A;  3COA C;  3E6C C;  3ABT A;  3F3X A;  4YFN F;  3IHU A;  4CIC A;  2EV6 A;  1F4K A;  4I09 A;  3QP5 A;  2QQA A;  2IRF G;  1ZG1 A;  4UUV A;  4EJW A;  2Z33 A;  1RNL A;  4ESJ A;  4HW0 A;  5D8K B;  3IWZ A;  2F5D A;  1ZN2 A;  5ICC A;  5IT3 A;  1NHA A;  1Z91 A;  4GGG A;  3BPX A;  2UXX A;  3HRS A;  3F72 A;  5LBQ A;  4PCQ A;  3KEO A;  4UVB A;  3F22 A;  2LNB A;  4ENN A;  2DTR A;  2M30 A;  1BI3 A;  4LJZ F;  3QU6 A;  4HDU A;  3CUQ C;  3WGI A;  2MH9 A;  5HS8 A;  3GYH X;  1H0M A;  4AVP A;  2A6E F;  4G8X A;  2QQ9 A;  2XRO A;  2HDC A;  1ZLJ A;  4UXN A;  5HS7 A;  3O2P E;  4MEX F;  2STW A;  1DP7 P;  3E97 A;  1HKT A;  3F8B A;  1O3T A;  2LKP A;  2O3F A;  3CUQ A;  2V1U A;  2XKO A;  3QRF F;  2O0Y A;  5DCF A;  4IPA A;  2DK5 A;  3CDH A;  2GQQ A;  1B9N A;  5E1W A;  1K79 A;  5K5R A;  5ILV A;  1TQI A;  1UHM A;  4EM1 A;  3CTA A;  2XIG A;  3V8L A;  2HWV A;  2VC0 A;  3L09 A;  3D0S A;  4BYY A;  1W5S A;  1EH8 A;  1QNT A;  1XSD A;  4U7B A;  2WC2 A;  5LHH A;  4PGH A;  3ULQ B;  2W57 A;  4JBA A;  3GF2 A;  2DT5 A;  2XGX A;  4P55 A;  2DW4 A;  2XRN A;  4M74 A;  4IJA A;  3J81 K;  1ZYR F;  3AAF A;  1BC7 C;  3EYI A;  4MTE A;  1GHC A;  4HX4 A;  3WGG A;  1MDM B;  1FBS A;  4MTD A;  1W7P A;  5LHG A;  2NRA C;  1OYI A;  1ZHF A;  2A61 A;  5E20 A;  4U0W A;  5L3D A;  5BQT A;  2ACJ A;  4RAY A;  1XCB A;  3IWF A;  5DEQ A;  4M6Y A;  1R23 A;  4DQ2 A;  3TGN A;  5DCM B;  3FMQ A;  3I53 A;  4A5M A;  3ZMU A;  2O6G E;  2OQG A;  5CYV A;  3JSP A;  4AWX B;  3WTV C;  4OU0 A;  1WRJ A;  2LDU A;  4YG2 F;  1KA8 A;  1R5G A;  4YFX F;  3M7G A;  3BJA A;  4G94 A;  4R79 A;  1ZRF A;  3HSF A;  4L9N A;  3T0Y A;  2VOD A;  4HQM A;  2KJB A;  3GFJ A;  1FBU A;  3GO5 A;  5BS6 A;  1B1B A;  1SMT A;  3WOD F;  1H9T A;  2JT1 A;  4ZZD A;  3KP6 A;  4HF0 A;  1D8J A;  5J8F A;  5HLI A;  1GVJ A;  2DQR A;  4IRG A;  3PQJ A;  4CYD A;  4KFC A;  2D1H A;  4L9J A;  3ZPL A;  4ZZL A;  2ZNY A;  3F6O A;  3L9F A;  2RDP A;  3G73 A;  1T2K A;  4G7O F;  1S7A A;  3QAH A;  1U8R A;  1F9N A;  1ZLK A;  2YSR A;  1S8N A;  3LA2 A;  3V7C A;  1O7F A;  3CJN A;  1R1T A;  2A69 F;  4EJU A;  1XD7 A;  3TKY A;  5L3B A;  1SFX A;  1MKM A;  2M45 A;  4OIP F;  1MDM A;  2QWW A;  1S7O A;  2PI0 A;  3DF8 A;  4U0V A;  1FY7 A;  2A3S A;  1SMY F;  4Q47 A;  1L0O C;  3RYR A;  2K02 A;  3HTU A;  5DYM A;  3OOP A;  3B02 A;  2RC4 A;  2RQP A;  5L3E A;  4ESB A;  4GCV A;  1ON2 A;  3ZMZ A;  3HIF A;  1YS6 A;  3Q5F A;  3R6S A;  3S2W A;  2Z9O A;  2OU2 A;  5DCM A;  4OMY A;  2NAZ A;  2EB7 A;  2NS0 A;  3O3K A;  5CLS A;  4DNC A;  5FGM A;  2PQ8 A;  2V6C A;  2BBY A;  1KQ9 A;  5LGT A;  4LB5 A;  3ABU A;  3P9C A;  1TNS A;  3BDD A;  5BPI A;  3SZT A;  2FA5 A;  4PDK A;  2EFP A;  1Z6R A;  2OD5 A;  3ECO A;  1P4A A;  4HBL A;  3ZP5 A;  2DO7 A;  2EV0 A;  3GFI A;  3HRT A;  5LHI A;  3HUG A;  3BRO A;  4XSX F;  2OQR A;  2ZJ2 A;  2XAG A;  2XVC A;  2J5O A;  2L4A A;  1W5T A;  4KIB A;  3OV8 A;  4L5I A;  2IT0 A;  2DPD A;  3KE2 A;  3K69 A;  1J59 A;  3RKY A;  3K1N A;  2BE5 F;  1IF1 A;  5LRR A;  3VOD A;  2M8E A;  4RB3 C;  4MNU A;  3BY6 A;  1R1U A;  2PMH A;  2E7X A;  3K0L A;  2UXN A;  5CJ9 A;  3HTS B;  2JZY A;  1U5T B;  3ZMT A;  3RJP A;  1DUX C;  4OIQ F;  1PP7 U;  1BN5 A;  4CDG A;  2A68 F;  3M8F A;  1IXS B;  1P2F A;  3F23 A;  5ED4 A;  2BV6 A;  2PMU A;  2ETH A;  5FD5 A;  4EGZ A;  3N97 A;  3WE3 A;  4O6J A;  5CVU A;  3BWG A;  3WU0 A;  2HFH A;  3V7R A;  4LLL A;  2FE3 A;  5TRD A;  2Q0O A;  2HKX A;  5L3C A;  5HVQ C;  3ML6 A;  3GFM A;  4PGG A;  1ON1 A;  1UST A;  2KRF A;  1JGS A;  2VOP A;  2F5F A;  4IRI A;  3LWF A;  3M9A A;  1ULY A;  1Z9C A;  1AOY A;  2HZT A;  4H0E A;  2W25 A;  3LAP A;  2EFW A;  1G3T A;  2ZKZ A;  1MD0 A;  5IT9 Z;  2NNN A;  4KDP A;  4XSZ F;  2VBW A;  2L02 A;  3WG9 A;  4LD5 A;  3KLN A;  3MWM A;  4UV8 A;  4HV6 A;  2YU3 A;  2GA2 A;  4KIC A;  1IXC A;  3EUH A;  4I02 A;  5LEJ A;  3WE2 A;  2PJP A;  3O6B B;  3VEP A;  5E1Z B;  1G3Y A;  1YIO A;  4KYW A;  3C7J A;  5J8C A;  1LQ1 A;  2YX7 A;  5FFZ A;  3NRV A;  3DKW A;  3BPV A;  2EFQ A;  1XN7 A;  2EA2 A;  3ZMV A;  2FRH A;  2MH2 A;  2STT A;  4N9I A;  5H6R A;  1U5T C;  3FWE A;  4M9S A;  5JR3 A;  1JHF A;  1J5Y A;  4CHU A;  1FWZ A;  2CG4 A;  4RB1 A;  4B8X A;  1UCR A;  2ZBK A;  3RKX A;  2Z3Y A;  3U2R A;  1D5V A;  1U5T A;  5KK1 A;  4HLX A;  5E17 F;  4N9H A;  1SD4 A;  4MEY F;  3PFI A;  2ADU A;  3QPH A;  5HOO A;  3LAJ A;  4LMY A;  1OR7 A;  1C0W A;  1QO0 D;  4ENK A;  2ZO4 A;  3VOE A;  5D5W B;  1L3L A;  4RGS A;  2A6H F;  5ERI A;  1ONV A;  1YFH A;  2XAS A;  3GLX A;  2P8T A;  1ZGJ A;  2P5V A;  5HDG A;  2JPC A;  3GWZ A;  3T8R A;  1UHW A;  3K2Z A;  2R7F A;  2J5P A;  5K5O A;  1U2W A;  3C1D A;  3FMR A;  2DK8 A;  1IN8 A;  1KU9 A;  1T39 A;  1KQ0 A;  2D2W A;  3TO9 A;  2MLG A;  3REO A;  3R60 A;  5ILU A;  3JW4 A;  4KIF A;  3ZN0 A;  5D6E A;  4WXH A;  3GZ6 A;  5L3F A;  5JHU A;  2H94 A;  1PUE E;  2QLZ A;  2KKO A;  1P92 A;  1WWX A;  1LVA A;  3H3U A;  3FM5 A;  2OA4 A;  1T38 A;  1ZG5 A;  4NQW A;  4KA4 A;  4L18 B;  4A2U A;  2P4W A;  1O3R A;  1BI0 A;  4O3M A;  2BYV E;  4HZF A;  3RPQ A;  5DD4 A;  2Y0M A;  2E1C A;  1MZB A;  2CYY A;  1VTN C;  1E2X A;  1I6X A;  3KLO A;  4CXF A;  1R22 A;  5BOX A;  3R4K A;  1G4D A;  3FHZ A;  3C18 A;  3E6B A;  2D1V A;  2P7C B;  2K4B A;  5FLX Z;  1KQ8 A;  3GXO A;  1LNW A;  5CVV A;  1GXQ A;  3G3Z A;  1ZRC A;  3LQR A;  2E7W A;  3BJO A;  3MCZ A;  3L00 A;  2L3D A;  3M1E A;  2KIF A;  5TJJ A;  1YTY A;  5DD8 A;  2JRT A;  3J80 K;  3K9T A;  1HKQ A;  2EV5 A;  2JPB A;  5FO5 A;  3T1B A;  3TO7 A;  3VFZ A;  1OYY A;  3IRQ A;  3WTX C;  4WCG A;  1OMI A;  1J7K A;  5J6X A;  1J9I A;  1XCV A;  2WV0 A;  1QBJ A;  3MEX A;  3P7N A;  4ENM A;  2E1N A;  3F21 A;  3F8F A;  2P5L C;  2V9V A;  1ZAO A;  1YO5 C;  2XAF A;  2IJL A;  4Y13 A;  3DP7 A;  4IF4 A;  2BEO A;  2FML A;  4G7H F;  3DPT A;  4KT5 C;  1R1V A;  2HOE A;  2X0L A;  4GYI A;  3JSO A;  2W84 A;  3FM3 A;  1OYW A;  2VXZ A;  2VE8 A;  2O8X A;  3RI4 A;  1JXS A;  2DFI A;  4HV5 A;  3U1D A;  5JI6 A;  2A07 F;  2ZFW A;  4EV0 A;  4EM2 A;  3J81 Z;  3EQL F;  4RGU A;  1R36 A;  2XHK A;  3GW2 A;  1FYK A;  4G6Q A;  2EFO A;  1LDJ A;  4UHT A;  5KVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...