3WTVC

Crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtvC00
3E6BA 1KGSA 2NAZA 4MQVA 1I6XA 4M74A 4Q47A 4KN4X 1USSA 2MH2A 4N9HA 1UFMA 2CSOA 2P7CB 4Y13A 5JI6A 5FLXZ 5EEHA 1F4KA 2CYYA 2VN2A 5LEJA 1ULYA 1DPUA 4PDKA 2D1HA 3VB2A 1S7AA 5J8FA 4ZYDA 1T2KA 2ETHA 3KZZA 3F8NA 4EJWA 4HOBA 2Q2EA 2PMHA 2E7WA 3DPTA 2VE9A 3HRUA 3L00A 5DCFA 3L09A 3RPUA 3BROA 3DQVC 4I0AA 4RB2C 1ZG5A 3E6CC 1BN5A 1A04A 5CYVA 3DKWA 2STTA 4A0YA 4CXFA 1IN4A 3ZQ7A 1TW3A 1ZLKA 3ELKA 4HLXA 3RJPA 4MEYF 1BI3A 1F1ZA 1Z6RA 2QYOA 4E70A 1LNWA 2LF7A 4H0EA 1RI7A 2A5YB 3NQOA 2DLLA 2IA2A 3WTSC 3K1PA 1BI0A 1KQ9A 2F5FA 2GIVA 2XAQA 3LA3A 2HQRA 1KYWA 3I59B 3HOSA 1D8KA 2YX7A 4I98B 1W7PB 5HS7A 3K1MA 1QQIA 3IL2A 5ICEA 2IT0A 4Q48A 2P6SA 3L2CA 2RN7A 4CGZA 1B1BA 3FMRA 2FE3A 2ESNA 3ML6A 4OOIA 2MBFA 2VT2A 5D5WB 4XLPF 4KA4A 3TOBA 1J7KA 3BDDA 4ENNA 2VE8A 1SFEA 2UZKA 1YS7A 2Z9OA 2UXNA 3FHZA 2DFIA 3V8LA 3WTTC 2W84A 3TGNA 2ZFWA 1REPC 1XCVA 1FY7A 5A2QZ 2CGPA 3CUQA 2WTEA 1J9IA 4MTEA 1G3WA 3R0AA 4A6EA 3G73A 3EDPA 3HSEA 3M1EA 2QUFA 4LLGF 2DK5A 2XROA 1HSTA 1CF7B 2DT5A 1BI1A 1FZPB 4ZYHA 4L9JA 4FX4A 5H6QA 2OQRA 1GXPA 3OOPA 4RB3C 4OINF 2HKXA 4MGRA 4IRHA 3GW2A 4IHSA 3F21A 5D5UB 1O3QA 2MD5A 1R7JA 2HOEA 3Q9SA 2MA3A 2Z33A 3ZMTA 3RYRA 3TO6A 2NNNA 4JBAA 4YIFA 1H9GA 4L5JA 3P7NA 4EV0A 5HOOA 3HHHA 4HA8A 4HX8A 3C3WA 4RAYA 4RGXA 2HTSA 2LDUA 1S7OA 1D5VA 2JRTA 4XBFA 1W5TA 2ZCWA 2YSRA 4KT5C 4RGUA 1O3SA 2ZKZA 4R8HA 3GXOA 1F9NA 3M7GA 3LQQA 2EV0A 2KRFA 3JSPA 1FBSA 2OBPA 2ZO4A 5LHHA 1G3TA 3WU1B 1MDMB 1SAXA 1P4XA 4EJUA 3ZN1A 2MLGA 2QBYA 4ESFA 5FO5A 1ZGJA 1U5TC 5D6EA 1G3SA 1HQCA 2F5EA 3P9CA 6PAXA 1WQ2A 2QQAA 1T6SA 4ZZLA 2VOOA 5HLHA 1FLIA 2RC4A 3QPTA 1SFXA 3BJ6A 2IPQX 4M9XA 3IHUA 3BPXA 1HKSA 1Z6TA 4KNYA 3DPLC 2Q8KA 4WWCA 5LLQA 1R00A 3HTSB 4HAMA 2VC1A 5LBQA 4I02A 1LJ9A 3DEUA 4UVAA 2DU9A 1RNLA 2XHKA 3TO9A 2YPRA 5DUIA 3LSTA 5HDGA 2Z99A 1FYKA 1PP8F 5CVJA 1IF1A 3ZMUA 3HSFA 2M45A 2A61A 4UV9A 4IVNA 1HKTA 2K4BA 4AVPA 3T8TA 2HEOA 3CUQB 1SMYF 4KDPA 3ZN0A 3U2RA 1W5SA 3F8MA 3KFWX 2OZ6A 5E1ZB 3V7SA 2L4MA 5BQTA 3ZMDA 1OMIA 4B09A 4XRFA 2JPBA 4D0PA 2E1NA 3RTRA 2DTRA 3BJOA 2K02A 5JHUA 2PJPA 1Q1HA 3K9TA 3F6VA 1MD0A 2LNBA 3RPQA 5DCMA 1IXCA 1EV7A 3J80Z 4CO8A 2DBBA 4RAZA 2UWMA 1YW7A 5BMZA 3GF2A 3GYHX 1RZ4A 4UVCA 4R79A 4BH9A 2RDPA 5LRRA 5ILVA 5LHGA 2FQ3A 2QZ8A 4WXDA 2VBXA 1FX7A 4P9UA 5DEQA 3I5UA 3BPVA 2K27A 3KP3A 3V8KA 2DAOA 2QENA 2W85A 4CDGA 4KFCA 3IWFA 1D3YA 2A07F 3DFGA 4HQMA 2VC0A 4I7HA 1SD7A 3KLOA 1K79A 4M72A 1XCBA 2COMA 2M1BA 1ZLJA 2QQ9A 1WSUA 4CZZA 5CJ9A 3TDZC 5HDKA 5L3BA 4ESJA 2FOKA 3O3KA 1YW8A 2VBZA 1S8NA 1XMKA 1P4WA 3FF5A 1IXRC 2RNJA 4GCVA 1TLHB 2FXAA 1R58A 4ASNA 1Z05A 4HYEA 3KCCA 2GA1A 5H6RA 1XN7A 4ENKA 4XLNF 1LEAA 3FXQA 2D1VA 2K7LA 1YIOA 2WC2A 2B0LA 1P6RA 2GAUA 4HF1A 4ENMA 3N4MA 4IRIA 3D0SA 1XSXA 2W24A 4RB0A 4ESBA 4EGZA 1XMAA 2OQGA 1ZGAA 3LQRA 3GFLA 5IT3A 3CLOA 2OD5A 1NHAA 1QPMA 5DV5A 4IF4A 3JSOA 3B02A 5L3CA 5ERIA 3BP8A 4AIJA 1BM9A 1JXSA 4A0ZA 2QLZA 3IRQA 2M8EA 2BE5F 2EFPA 4GYGA 2FEZA 3GZ6A 3MAJA 1U5TB 1WI9A 1STZA 3IWZA 3QPHA 4A0XA 5HLIA 4LLNA 2FNPA 3GZ5A 2VXZA 3DF8A 5HLGA 2F2EA 5BPIA 5LHIA 1WWXA 5DYMA 2HGCA 2VT3A 2V6CA 2XAJA 1XDSA 3FM3A 4LK0F 3QU6A 3JTGA 3C1DA 5LRSA 1SD5A 3H3UA 5DCMB 1LDDA 1IXSB 3KEOA 3WE3A 2E1CA 2ZJ2A 1FBUA 1R5GA 4L0YB 4ZH4F 3BWGA 4YFKF 4L9TA 1T38A 4UXNA 2OU2A 2RKHA 2J5PA 5D5XB 3CUQC 1W7PD 3U9GA 4WX9A 2FF4A 3MZYA 2ZMEA 3V4GA 1KA8A 4UUVA 4O3MA 5FD5A 3BZ6A 4LGWA 1PUEE 2YX4A 2FBIA 1B4AA 4BQAA 2K86A 2H09A 3F72A 4DQ2A 5E8IA 2HTJA 1XGOA 3P9KA 3M8EA 5L3DA 2HDCA 1P4AA 2VOPA 4A2UA 4YFXF 2JTVA 2MLKA 2ZBKA 1KQ0A 2D45A 3WTUC 4I09A 2HS5A 2FA5A 3T5XA 2VBWA 5JVTA 3WGHA 2QQBA 1XGSA 3ZMVA 3WU0A 1K78B 2RVCA 5HDNA 2MC3A 4EJTA 1Y0UA 1TQPA 2IP2A 5E8GA 2FMLA 2XVCA 3F23A 2BYVE 5FD6A 2EK5A 4L5IA 4UVBA 2L54A 2R7DA 5K5RA 3CUOA 1TQMA 3U1DA 4L9NA 2P5VA 3NRVA 1KU3A 2LF8A 3RI4A 3Q5FA 2FSWA 4EQQA 5KVRA 4G8XA 3W6KB 3HSRA 2W57A 2RV8A 2Z3YA 5E20A 3LAJA 3FMQA 5CVVA 4M71A 2ISZA 3TO7A 1HW5A 4EM2A 2ELHA 5ICCA 1OYWA 4NQWA 2ESHA 2GXBA 4S04A 3E5QA 4KIGA 2BEOA 2L3DA 3DP7A 1BJAA 2M5WA 3L9FA 4EM0B 1TNSA 2PBIA 3F8CA 1BI2A 4RGSA 2M87A 1P2FA 1IUYA 2A6EF 1U2WA 1UCRA 5HS9A 2P5LC 5TJJA 3K2ZA 3G3ZA 5BPDA 3I53A 2HR3A 3WTYC 3HHGA 4OU0A 4OMZA 1KU2A 4CICA 1G6NA 2PMUA 2XV4S 2DW4A 2H6BA 4LJZF 4CYDA 2FU4A 2AXLA 3WE2A 4HQEA 4HX7A 2KIUA 4EMSA 1UB9A 3AAFA 3ZMSA 5BOXA 2J5OA 1ZG3A 1EH8A 3R60A 2XAGA 3KP6A 2KJCA 1C0WA 3P9IA 2A69F 3GWZA 1TW2A 3LWFA 1RIOH 1ZRDA 4HDUA 4BNCA 3F22A 4G6QA 2F5DA 3J81K 1XGNA 1CGPA 1ZG1A 1O3TA 1B9NA 1YLFA 1L3LA 4QLCU 3E97A 1J75A 1T98A 3JW4A 1YS6A 2FNAA 1BC8C 4MHGA 5K5QA 3W6JB 2NYXA 2OA4A 3I58A 3R0JA 5DD8A 1BC7C 1ON1A 2CQKA 3R6SA 2KJBA 3HRTA 3E5UA 3SXYA 3TOAA 3D5LA 3T8RA 1S3JA 4KIBA 3ECHA 1FNNA 1R36A 4K2EA 1IN6A 4HDVA 1FBQA 2KIFA 2XIGA 4LLLA 3K0LA 5FGMA 1FC3A 3RYPA 1U6GA 2IJLA 1OYIA 5L3EA 1U3EM 3HUGA 3PFIA 3OV8A 2CW0F 2BBYA 2HQNA 4LK1F 2XUBA 3KP7A 1OPCA 1HKQA 2HWVA 1TBXA 3TQNA 4G94A 1V4RA 3NEUA 1SFUA 4A12A 3HOTA 1OR7A 4OIQF 5IT9K 1D8JA 4U7DA 2VONA 2PLYA 1IW7F 2QWWA 2CG4A 2P6TA 4OMYA 5ICFA 3C18A 4WXCA 2A6HF 5EEGA 2JSCA 4L0ZB 1ZAOA 5K1YA 4WK8F 1DPRA 2O61A 1OKRA 3LA2A 4MNUA 4EM1A 3WTWC 1MZBA 1W4MA 5AIPA 1J5YA 1ZARA 2IA0A 3ISPA 3HIFA 3VEPA 2PEXA 1YTYA 3H3ZA 1LDKB 4CHUA 1I1GA 2XKOA 1JGSA 2X4HA 3I4PA 5LGNA 2IA1A 3QAHA 1MJBA 3B73A 5ILUA 3FZVA 3V8JA 3IRRA 4AIHA 1Z7UA 2XRNA 1PP7U 5J6XA 4M9SA 1ZREA 3FXRA 2EFNA 3R61A 3GUDA 3I54A 3KP4A 5TRDA 3MWMA 4HV6A 1IZ1A 2K4JA 1TTYA 2O6GE 3R4KA 2A3SA 4I0BA 2PQ8A 1FP1D 3WGGA 1I1SA 3DV8A 2P4WA 2KKOA 3I59A 1H0MA 5F64A 1VTNC 2Y48A 3EETA 4UV8A 2R7FA 3FWEA 1W7PA 4KN7X 3O2PE 2E7XA 1KQ8A 3ERED 2LKPA 1ZRFA 2Z5UA 2DQRA 3GO5A 3QOPA 2QBYB 2YR2A 3WG9A 1UHWA 4GGGA 5AIQA 2GA2A 2L01A 3RKWA 3IKVA 3KZYA 2DPDA 1XGMA 4Q4ZF 5DDGA 1FWZA 4ETSA 4YG2F 3FM5A 4L9VA 3ZPLA 1ZRCA 1R5HA 4N0BA 2V1DA 2ZNYA 1QBJA 4YIIA 2A68F 4BHCA 4WF2A 1DDNA 2PI0A 5F6FA 2C6YA 1UHMA 2V9VA 1CF7A 5DUKA 4BYYA 4KMUX 4TV7A 2EA4A 1FPQA 2EFWA 1DUXC 3E6MA 1MJAA 2YU3A 2RGVA 2EFQA 1O7FA 4FX0A 1MGTA 1K7AA 2X0LA 2ZXJA 4HLYA 4NHJA 3QRFF 1O3RA 3M9AA 1JE8A 4U7BA 4U0YA 3GLXA 4KIFA 3C7JA 3S2WA 1IN7A 1T39A 2ACJA 4LMYA 3IKTA 1FP2A 3MCZA 2L4AA 2HZTA 5FLXK 3ULQB 4LG0A 2V1UA 3I71A 1BOAA 1IN8A 4I01A 1SD6A 3ABUA 4ENJA 4G7ZF 1U78A 2DO7A 2EJRA 1YFHA 2G9WA 1IRGA 1GXQA 4GXOA 4IHTA 1S29A 3DXJF 3QU3A 3GVAA 1H9TA 1XSVA 3K1NA 1R22A 4BXUA 2RQPA 1MDMA 1O57A 2OZUA 1USTA 2ISYA 5D8LB 1R1VA 1ZH5A 1BIBA 5CLSA 2FBHA 2NRAC 4BHPA 5D8KB 1IN5A 1HXDA 4U0VA 2CWEA 5D4RA 3EUHA 2EB7A 1ZHFA 4B8XA 1EH7A 2MH9A 2CFXA 4IJAA 5F1RA 3KP2A 3KLNA 1E17A 1Z1DA 1IRFA 3WODF 5E1WA 1KYZA 3T0YA 3N97A 3H92A 3WTXC 5LGUA 4NB5A 5E1XA 3V7RA 2FMYA 2GZWA 1Z9CA 1I5ZA 3JTHA 5CVUA 1LDJA 3JAMK 1MKMA 3JAMZ 4YFNF 2FRHA 2JZYA 4GYIA 5BS6A 1FYMA 4EJVA 4G7OF 1LEBA 3GFIA 5E17F 3HRSA 2ADUA 4JK1X 3TKYA 4O6JA 1YYVA 4M6YA 2DQLA 2NNYA 2QM3A 1G3YA 2O8XA 4A5NA 3KE2A 5FFZA 5A2QK 1FSHA 2BGCA 1ODDA 1KU7A 4WCGA 1T0FA 1WKMA 1BBYA 4PCQA 3HRMA 2WV0A 1HW2A 4S05A 5K5OA 4UNOA 2XGXA 5D4SA 3ECOA 2O0YA 1JHHA 3COAC 4M6XA 1TNTA 2DI3A 2P5KA 2W25A 4RB1A 3HTUA 1RUNA 4RGRA 1FOKA 3FMSA 2PFBA 1B6AA 1YG2A 1R1TA 1BIAA 3VFZA 2EA2A 1TQIA 3LFKA 3BY6A 3QP6A 5HVQC 5LEKA 1E2XA 3L7WA 4P55A 1HBXG 2IVMA 4WXHA 1F5TA 4P9FA 4U0WA 5D6FA 1AOYA 1ON2A 4M9ZA 1DP7P 1RUOA 3RKYA 4MEXF 2BV6A 1B9MA 2TDXA 1GVJA 4IPAA 4LG0B 5LGTA 3RKXA 4FT8A 3GFMA 2Y0MA 4ZYGA 2GQQA 3J7AO 1YO5C 2P8TA 5D5VB 2EFOA 1R23A 3E3VA 4XSZF 5ICGA 2O3FA 4EVIA 4N9IA 4MTDA 3CJNA 1J59A 2JPCA 1P92A 4U88A 3J81Z 4A5MA 1FYLA 4EJOA 3ZMZA 3CTAA 4HF2A 3IC7A 3Q9VA 3I0TA 2HYFA 2PG4A 2ZMEB 1I27A 1IAWA 4AIKA 3WTZA 4OIOF 2H94A 3VODA 1ZYRF 3SHFA 1HW1A 3V7CA 1S6LA 2XAHA 3F8BA 3CDHA 4LB5A 2FBKA 3RDIA 4O5VA 4QWQA 2VBYA 4A6DA 2G7UA 2OAZA 1AWCA 5FB2A 3ZP5A 1GHCA 3MEXA 3M8FA 2LSOA 4FHTA 3I64A 1QNTA 2VODA 4DNCA 2JT1A 2KIMA 5L3GA 1U8RA 5JR3A 2WWYA 4EGYA 2EWNA 4PZJA 3KEQA 2Y75A 3HYIA 3MFKA 2GWRA 3GEZA 4XSXF 1R1UA 4R1HA 4RS8A 4JQFA 3KP5A 4HZFA 5IT9Z 3K69A 3QP5A 4I2OA 2CO5A 2DPUA 2H6CA 2HYGD 4HW0A 3EYIA 4KYWA 4HBLA 4IXAA 4P5OA 1QO0D 3LA7A 1OYYA 3FX3A 2AS5F 3E6DA 4KUMA 2V79A 3GFJA 2IRFG 1G4DA 1XDUA 1U5TA 3SZPA 5L3FA 2NS0A 3ABTA 4F7ZA 3CO7C 2V1XA 2UXXA 2XKPA 4ZZDA 4LB6B 1ZN2A 3SQNA 3CO6C 4P96A 1YQAA 1JHFA 2P7VB 2Q0OA 1L0OC 2PN6A 2R3SA 4KMFA 4G7HF 1HSJA 3ROUA 3J80K 4BHBA 1XSDA 2HKOA 1B59A 5AONA 3SZTA 3SFZA 4OIRF 1MJ9A 3LAPA 1SD4A 3PQKA 2STWA 4KICA 4PGGA 2F5CA 1J0RA 3EYYA 5JFRA 1ONVA 2HFHA 1QZZA 5ILSA 3T1BA 4Z2YA 4G9YA 3O6BB 3VOEA 4UHTA 4PGHA 1WRJA 2GXGA 2QVOA 4MQ9F 2H27A 3RIRA 3WTVC 3TDUC 5CVRA 1YW9A 3BJAA 3KETA 1SMTA 1QGPA 4LFUA 4GO1A 1O7LA 4G6DA 3PQJA 5H20A 3F6OA 4AD9A 2XAFA 3F8FA 4LD5A 5DD4A 1XD7A 3REOA 1Z91A 2EV5A 1K78A 4Q5SF 2IW5A 2D2WA 4M73A 5CVIA 2L02A 3WGIA 1FT9A 2M30A 1KU9A 5ED4A 2XASA 3EQLF 4AWXB 4Y17A 1LQ1A 3GX4X 5FFXA 4L18B 4IRGA 5KK1A 1LB2A 2ZNZA 4OIPF 3BOQA 3F3XA 5J8CA 5E18F 2EV6A 1J2XA 2DK8A 1LVAA 3E5XA 4Y15A 4HV5A 4HF0A 1QZYA 1K6OA 2O03A 1FSEA 1EH6A 1V3FA 1PDNC 4BAYA 5HS8A 4ZYEA 3MZHA 4ON0A 2G7HA 3FXUA 4HX4A 1XB4A 1X3UA 3MQ0A
chains in the Genus database with same CATH superfamily
3PSFA 3E6BA 1KGSA 2NAZA 2XGCA 1TWCJ 4MQVA 1I6XA 2ZSHB 4ABZA 4M74A 4Q47A 3LSPA 4KN4X 1USSA 2MH2A 4IHYA 2XGEA 3O8GA 4N9HA 2WBMA 1UFMA 1U9OA 2CSOA 2HOSA 2P7CB 2XC7A 2WB1N 2GM4A 4Y13A 2BXYA 5JI6A 4BDYA 2OJED 1POGA 5FLXZ 1WJ5A 5EEHA 3OR1C 1F4KA 3H9QA 1TWHJ 2CYYA 2VN2A 5LEJA 2OTJI 1ULYA 1DPUA 3WG7H 4PDKA 2D1HA 1FJLA 4II2A 3M4OJ 1X3WB 3VB2A 1S7AA 5J8FA 4ZYDA 1T2KA 2ETHA 3HBLA 2Y31A 3KZZA 1WJDA 4ZDOA 2FX0A 3F8NA 4EJWA 4HOBA 4QSHA 2Q2EA 1SANA 4XKCA 3QPLA 3H5AA 5CKTA 1IV6A 2H8WA 3HG9A 2PMHA 2JK3A 2E7WA 2VIXA 3DPTA 4FTHA 1WH5A 3OYKA 4UY8I 2VE9A 1DP3A 3HRUA 3L00A 5DCFA 4E4HA 3L09A 2VJ4A 1LPQA 2IEKA 1VF9A 2X85A 2Y2ZA 1IG7A 1ZR2A 5FJ8J 3GTKJ 1X1PA 1D0YA 4N4NB 3RPUA 2O9LA 4JYKA 1WJBA 4CCLA 1JTYA 4RMNA 3BROA 3DQVC 4I0AA 4RB2C 2OCEA 1ZG5A 4ZYAA 3E6CC 1Z77A 3DWLE 2NVYJ 1BN5A 1A04A 1WPKA 5CYVA 4IX7A 3DKWA 3CCSI 2STTA 4IQ4A 4A0YA 4CXFA 1IN4A 3GBGA 2BY0A 1I3QJ 3ZQ7A 3OYFA 1TW3A 1ZLKA 2OV7A 4ZTJA 3ELKA 4HLXA 3RJPA 5DS9A 2V4JC 4MEYF 1BI3A 1F1ZA 1Z6RA 1T0FC 2HU9A 2QYOA 4E70A 1LNWA 3AFHA 3FKJA 3HKZA 2LF7A 4B1RA 5EZGA 4H0EA 4E7SA 1D0XA 3CMMA 1RI7A 4I76A 2FQ4A 3HPHA 3O8HA 3MZ8A 5DM6F 2A5YB 4M6VA 3NQOA 2DLLA 2IA2A 3WTSC 3K1PA 2Z16A 1LE8A 1BI0A 1PUFB 1H89C 1KQ9A 2HPMA 3A2KA 2F5FA 4AYBN 3JRDA 2OTLI 2GIVA 1Z21A 1ETWA 3TMOA 3OL4A 2XAQA 3LA3A 2HQRA 1XTAA 1KYWA 3I59B 3HOSA 2DYSH 2X6YA 1D8KA 2YX7A 3CP8A 4G6TB 4I98B 1W7PB 5IPAA 5HS7A 3K1MA 1WHUA 1QQIA 3IL2A 5ICEA 4XRSG 2HI3A 4A69C 2ID6A 1R49A 2IT0A 2CV2A 4Q48A 3NAUA 1FIAA 2P6SA 3OS1A 4QPQA 1QPIA 3L2CA 2RN7A 4BEHA 3H1CA 2QEXI 4CGZA 1B1BA 3FMRA 2F48A 2FE3A 2ESNA 3ML6A 4OOIA 2MBFA 1VZ0A 3S16J 2HOTA 5F27A 1W36C 2EINH 2LY2A 1ZQ3P 3S1RJ 2L9NA 2VT2A 1HDPA 4HPQA 1W1WE 3ZQLA 5D5WB 1K83J 4XLPF 4KA4A 3TOBA 1J7KA 2M0CA 3BDDA 3IH3A 1S9HA 4ENNA 2VE8A 1SFEA 2UZKA 1YS7A 4CCOA 2Z9OA 3OOUA 1X1CA 2Y0SA 3FXMA 2UXNA 2O7OA 2K9LA 3FHZA 2DFIA 3V8LA 3WTTC 1RR8C 2W84A 4B43A 3TGNA 1A5JA 2ZFWA 1BR2A 1APLC 5FLMJ 1REPC 1XCVA 1FY7A 5A2QZ 2CGPA 3BTIA 3BR1A 3CUQA 3BTJA 2WTEA 1J9IA 3G1LA 4MTEA 1VQOI 2VQCA 3OYGA 2VI6A 1G3WA 3R0AA 4A6EA 1BR4A 3G73A 3EDPA 3K4BA 3A01B 2KISA 3HSEA 3M1EA 2QUFA 4LLGF 2DK5A 2XROA 1HSTA 2R93J 1CF7B 2DT5A 1BI1A 2TRTA 1Y1VJ 1FZPB 4ZYHA 4L9JA 2Y9ZA 4FX4A 5H6QA 2OQRA 3OIQA 1GXPA 3ZCOA 1LFUP 1A36A 1X4OA 3J7YJ 3DLLF 3OOPA 3LFUA 4RB3C 4OINF 2HKXA 4MGRA 4AC0A 2EZHA 4IRHA 3GW2A 4IHSA 3PL8A 2LY1A 3F21A 5D5UB 1O3QA 2MD5A 1R7JA 2EIKH 1JKOC 2HOEA 2LKSA 3Q9SA 2MA3A 3KYDB 4P1WA 2Z33A 3ZMTA 3RYRA 2MSYA 1FEXA 3TO6A 2DA7A 2NNNA 3BQZA 1P7JA 4JBAA 4XLHA 4YIFA 1R4NB 2M7AA 2KDOA 1E3HA 3H0DA 3RQIA 9ANTA 1MMSA 1MBGA 2IS2A 1H9GA 4L5JA 4V2FA 4BQQA 2JJ7A 3P7NA 4AU7A 4EV0A 5HOOA 3HHHA 2QGUA 3CDIA 3K10A 4HA8A 5FKLA 1VQ9I 4FASD 4HX8A 3C3WA 2R5YB 4RAYA 4RGXA 2HTSA 2LDUA 3IH4A 1S7OA 1D5VA 1BW6A 3ZR8X 3CMYA 3HL2A 1WCMJ 2JRTA 4CCJA 4XBFA 1W5TA 2DFHA 1OLTA 2DOEA 2ZCWA 4BXFA 2YSRA 3B6CA 4XONA 4KT5C 4RGUA 1O3SA 2Q2EB 3DBHB 2ZKZA 3SZGA 4R8HA 3CJTB 4DGWB 2QF7A 3FISA 1JKPC 3GXOA 1F9NA 2V9KA 1S72I 1ZTRA 2DMTA 3L2RA 4XLFA 3CF2A 3SEQA 2N8GA 3M7GA 1X1DA 4FQGA 3LQQA 2EV0A 2KRFA 4EEFG 3JSPA 1IGNA 3HOZJ 1FBSA 3PIOF 2OBPA 5HLTA 3CMEI 5B66C 2ZO4A 1TWGJ 5LHHA 1G3TA 1SAUA 2VKHA 3KYCB 3WU1B 1MDMB 1SAXA 2EPFA 2JA5J 2KHMA 1P4XA 4EJUA 3TW7A 3ZN1A 3H36A 2YU9J 3A02A 2KPMA 2MLGA 3BTLA 1FMWA 2QBYA 4ESFA 5FO5A 2W7NA 1ZGJA 4XK4A 1U5TC 3ZQGA 5D6EA 1OISA 5EDNA 1G3SA 3CC7I 1X2NA 1HQCA 1VI0A 2MYSA 2F5EA 1MW7A 3P9CA 3CCVI 6PAXA 1WQ2A 2QQAA 1T6SA 4ZZLA 4PJ0C 2VOOA 3OWTA 3FBIB 4PJNA 3VYUB 5HLHA 4BE2A 2EILH 3U21A 3KYLA 1FLIA 2Y0SN 2E1MC 2RC4A 3QPTA 2BOLA 2LVSA 1VFCA 1SFXA 3BJ6A 2IPQX 1Z67A 2ZB9A 4M9XA 3IHUA 3ABMH 3HOWJ 3BPXA 1HKSA 1SVMA 4HNVA 1Z6TA 2W1OA 4KNYA 1FOXA 3DPLC 4XRSA 1QU3A 1ENHA 1M1EB 2PX9A 1ZELA 2Q8KA 3GTJJ 3CCJI 4WWCA 5LLQA 1R00A 3OYLA 2LTPA 3HTSB 4HNTA 2GIZA 2JVHA 2KZVA 4HAMA 4A3EJ 2CUEA 3CJRB 2VC1A 5LBQA 2NXNB 4I02A 1LJ9A 1GV2A 2B9SA 3DEUA 3ABLH 3D5RC 1UHSA 3OR2C 4UVAA 2DU9A 1RNLA 5IY5H 2XHKA 3TO9A 1SVOA 2JUGA 3AG4H 2VPRA 2YPRA 4YEJA 5DUIA 3LSTA 5HDGA 2Z99A 2JQ7A 2CMPA 2YS9A 3HOVJ 1FYKA 1PP8F 5CVJA 2P81A 3VSLA 3HDDA 3N05A 1VQPI 3TP3A 1IF1A 2E5ZA 2YUSA 3ZMUA 3CF5F 1UJ8A 3HSFA 2QA4I 2M45A 2A61A 4UV9A 3QQAA 5C4JJ 2RREA 4IVNA 1HKTA 3MKWB 2NVQJ 2K4BA 4AVPA 2AHQA 1YHQI 2M2EA 3T8TA 4F93B 2HEOA 5LD2C 3CUQB 5M5YJ 4A3CJ 1SMYF 4KDPA 4IO9F 3ZN0A 3U2RA 3OIPA 1W5SA 3F8MA 3KFWX 3IUOA 5IP7J 3S3NA 2OZ6A 5E1ZB 1KONA 3V7SA 3BR2A 3Q0UA 3K70C 2L4MA 3OY9A 2HPIA 1F36A 5J47A 5BQTA 3ZMDA 1OMIA 1V5EA 4CYCB 3CCEI 4B09A 4XRFA 2JPBA 3W2WA 1AKHB 4BE0A 4D0PA 2E1NA 1H8AC 3LL7A 2DTRA 3RTRA 3GCMA 3LSHA 1R4MB 2K02A 3BJOA 3BQYA 5JHUA 2PJPA 3S93A 1Q1HA 3K9TA 2K5CA 3F6VA 3SDBA 1MD0A 2MABA 2LNBA 3RPQA 5DCMA 1IXCA 2R7OA 1MBHA 1EV7A 3J80Z 5EGOA 4CO8A 5EG0B 3Q3SA 4C2TA 3FXOA 2LRDA 2DBBA 4RAZA 2UWMA 1YW7A 5BMZA 1UAAA 3A03A 1LUJB 3BG3A 5IYCJ 2KIQA 3GF2A 3GYHX 5J1UA 4KITB 3OYJA 4Y3OA 1RZ4A 4UVCA 2B63J 4R79A 5B3SH 3M07A 4BH9A 4RAGA 2RDPA 3D1NI 1BA5A 5LRRA 5ILVA 2LOOA 1WJAA 4Y4RA 5LHGA 4F55A 3M8JA 1JT6A 2W00A 4ZC3A 2FQ3A 5GAEJ 2QZ8A 4WXDA 2VBXA 1FX7A 4P9UA 4BGDA 1OFCX 5DEQA 3I5UA 3BPVA 2K27A 3KP3A 4A3KJ 1VQMI 3S2DJ 3V8KA 2DAOA 2Q1ZB 4DYCA 5KAFC 3PJRA 2QENA 2DN0A 2W85A 4CDGA 5HNHA 4C3JJ 4KFCA 3DKXA 3IWFA 4MFEA 3PM1A 1DGRM 1D3YA 3EUAA 1YE9A 2XF6A 1MH3A 2DDAA 2A07F 2IS4A 3DFGA 4HQMA 3AKZA 2VC0A 3GTMJ 4I7HA 1SD7A 2IBDA 3KLOA 4LIUA 2LYCA 4XLCA 1K79A 4M72A 3VPRA 2M4KA 1XCBA 2X1EA 2COMA 4G12A 2M1BA 1ZLJA 1PJRA 2QQ9A 3I3LA 1WSUA 4CZZA 2EIMH 5CJ9A 5B1BH 3TDZC 5HDKA 3VYSB 5L3BA 1YJ9I 4ESJA 1UG2A 2FOKA 3O3KA 3CCRI 1YW8A 2EZIA 2VBZA 5J1YA 1S8NA 1XMKA 1P4WA 5M5WJ 1VQ5I 3FF5A 4DOZA 5M3MJ 1E3OC 1IXRC 3CCUI 2RNJA 3MN2A 1TLHB 4GCVA 2FXAA 4RLFA 2Y69H 2R7TA 4CCMA 1BW5A 2IGOA 1JUSA 1WZ2A 4BY1J 1R58A 4ASNA 1Z05A 2VKEA 3K6GA 2PJRB 4HYEA 1DU0A 3KCCA 2GA1A 3CZ6A 3FXLA 1XN7A 5H6RA 3PSIA 4ENKA 4XLNF 4ZJZA 2JUCA 1TC3C 2WAQN 1LEAA 3FXQA 3OYHA 2D1VA 1YRNB 2K7LA 1YIOA 2WC2A 2B0LA 1A6QA 1P6RA 1AHDP 2GAUA 3KPHA 2R7WA 4HF1A 4ENMA 3N4MA 2DJIA 1ZR4A 4J19A 4RM3A 3S14J 2KP6A 2VQGA 4HNUA 4IRIA 2LFBA 2CFOA 4IQJA 2VPLA 1IO2A 4W1UA 2BHYA 3D0SA 1XSXA 2I10A 2W24A 4RB0A 4ESBA 4EGZA 2PMZA 4M3EA 3HGGA 4CA0A 1XMAA 2OQGA 1ZGAA 3LQRA 3GFLA 5IT3A 1GLNA 3CLOA 3TL4X 2E35A 5EYRA 4M3FA 4XM3A 4PJMA 4B44A 2OD5A 1NHAA 3JRFA 1QPMA 1PYVA 5DV5A 1MSFC 4IF4A 3JSOA 1JT0A 3B02A 3S1MJ 1K6YA 3A0BC 3HPGA 5L3CA 5ERIA 3KX2A 2VUMJ 3OYCA 3BP8A 4AIJA 1BM9A 5E3NA 3G71I 1JXSA 2XAUA 4A0ZA 2QLZA 3HXLA 3IRQA 2M8EA 2BE5F 2EFPA 4GYGA 3PUBA 1FMVA 1U0JA 2FEZA 4BDZA 3JRGA 4BQOA 3LSJA 1YX5A 5GTIC 2X48A 3GZ6A 3VDXA 2HYJA 3MAJA 3PUFA 1VQ4I 2JSPA 4XL9A 2IGKA 3CMAI 2NVTJ 1OJLA 2WA0A 1U5TB 1WI9A 1STZA 3BG6A 3IWZA 3QPHA 4A0XA 5HLIA 2W48A 4LLNA 2FNPA 3GZ5A 1WVRA 2VXZA 5CPRB 5GP9A 3DF8A 5HLGA 2F2EA 5BPIA 4AM3A 3S8PA 1YJNI 3UKGA 5FRMA 5LHIA 4L5EA 2ZXHA 1WWXA 5DYMA 4BACA 1DGWY 2VB6A 3S15J 2HGCA 3HOUJ 3ZRGA 3JRHA 2VJIA 2E1MB 2L7KA 2V6CA 2VT3A 2ZXWH 4BQNA 1ERDA 2XAJA 1XS9A 1XDSA 3FM3A 2L9VA 3OYNA 4LK0F 2LH9A 2BHZA 3QU6A 3JTGA 4E7JA 4D5CA 1Z3XA 4AUXA 3C1DA 1BOBA 5LRSA 1SD5A 3H3UA 5DCMB 1RPWA 4F3QA 1LDDA 1IXSB 1FOWA 3KEOA 3F9KA 3MKLA 3WE3A 4CZCA 2E1CA 2ZJ2A 2Z1DA 5E3OA 1FBUA 1R5GA 4L0YB 2O5RA 4ZH4F 3BWGA 1E3PA 5M5XJ 4YFKF 1YITI 4L9TA 1RETA 1T38A 4UXNA 1R71A 2UV1A 2OU2A 2DMUA 2RKHA 2J5PA 5D5XB 3OYMA 1MIJA 2MC4A 3CUQC 3DEWA 1W7PD 3U9GA 4WX9A 2FF4A 3MZYA 2ZMEA 3V4GA 4BKXA 2QSHX 1KA8A 4UUVA 3ONQA 4O3MA 5FD5A 1EJ9A 3BZ6A 4LGWA 3CESA 1PUEE 1OCRH 2YX4A 2FBIA 1B4AA 5J40A 4BQAA 1U9NA 2K86A 2H09A 3F72A 2HDDA 4DQ2A 2HXIA 5GADJ 4A3IJ 1VQ6I 2A05A 4CCNA 5E8IA 3S1NJ 3GZNB 2HTJA 4KISA 1XGOA 4HSRA 4BBSJ 1Y39A 1JUMA 2V9PA 1N78A 3HC7A 3P9KA 3M8EA 4D7NA 1ETXA 5L3DA 2HXOA 2HDCA 1P4AA 4F91B 2VOPA 5KHDA 4A2UA 4YFXF 2JTVA 2MLKA 4FE4A 1JGGA 2K3FA 2CRGA 2ZBKA 4JX6A 1KQ0A 5B1AH 2D45A 1D1BA 3WTUC 2FOWA 4I09A 2HS5A 2UUZA 2FA5A 2K9MA 1B72B 3W2AA 3T5XA 3MKYB 5GAGJ 2ZJPF 2DFEA 2VBWA 5JVTA 3WGHA 2X9DA 2QQBA 1XGSA 1Y0NA 3ZMVA 3WU0A 3WHBA 2PMZN 5J4VA 1K78B 4QPOA 2RVCA 5HDNA 1WFXA 2MC3A 3OYAA 4EJTA 5IOZA 1Y0UA 1TQPA 4UUSA 3CCLI 3K4KA 2IP2A 5E8GA 2FMLA 2XVCA 3F23A 2BYVE 5FD6A 3AL0C 3V42A 1OCOH 3JRBA 3DCFA 2EK5A 4MO7A 2K9NA 4L5IA 4GRIA 4UVBA 1MMNA 3JR9A 3CP2A 2L54A 3WHCA 3L1PA 2R7DA 4IKFA 5K5RA 3CUOA 2MFZA 2RNGA 1TQMA 3U1DA 1V5GA 4L9NA 2P5VA 3NRVA 1KU3A 2LF8A 1VQNI 3RI4A 3Q5FA 2FSWA 4EQQA 5KVRA 4G8XA 3W6KB 3HSRA 2W57A 1D1AA 1I50J 1RR7A 2OF7A 2RV8A 4CUGA 2Z3YA 2LC2A 5E20A 3LAJA 3FMQA 2XSJC 5CVVA 3OIOA 1R5ID 4M71A 3HOXJ 1EA3A 1ETYA 2ISZA 3TO7A 1HW5A 1Q1VA 4EM2A 2LR8A 4NDLA 2IS6A 2ELHA 5ICCA 1OYWA 3ASNH 4NQWA 2BY1A 2ESHA 4PFPA 2GXBA 4S04A 3E5QA 3SDGA 1LKXA 1XG1A 1ETQA 4KIGA 5KCMA 2BEOA 2L3DA 3DP7A 1BJAA 3QYEA 1V54H 1T56A 2M5WA 3A0HC 3L9FA 4EM0B 1TNSA 2PBIA 3F8CA 4YELA 1BI2A 4RGSA 2M87A 4HSTA 4YRVA 1P2FA 3RKQA 3SJMA 1IUYA 3FXJA 3AG2H 2E71A 2A6EF 3I55I 1U2WA 1UCRA 5HS9A 2P5LC 4XKBA 5TJJA 2DA6A 2F6CA 2ZSIB 3K2ZA 3OYBA 3GTQJ 1QHGA 3G3ZA 3QOEA 3I53A 3S32A 2HR3A 5BPDA 3VWBA 2DYRH 2WY8Q 3WTYC 3HHGA 4OU0A 4OMZA 1KU2A 5B5EC 3E0JB 4IOAF 3IH2A 4CICA 1G6NA 1JTXA 2PMUA 2XV4S 2DW4A 4E7LA 2H1LA 2H6BA 2XDVA 4XN0A 3DBLB 5DTDA 2HZDA 4LJZF 4CYDA 2FU4A 4NBQA 2AXLA 4IEJA 3WE2A 2M0MA 4B47A 4HQEA 4HX7A 1IUFA 2KIUA 4W97A 4EMSA 1UB9A 3AAFA 3DU6A 3ZMSA 1JJ6C 5BOXA 2CV1A 1RC9A 5GTHC 2ZC2A 1YJWI 2J5OA 3QPSA 2R7XA 1ZG3A 1EH8A 3R60A 2XAGA 3KP6A 2DT7B 2EIJH 4BBRJ 2KJCA 1YIJI 1C0WA 1TT5B 2MD0A 2LK2A 3BCBA 1NK2P 3P9IA 2A69F 3DTEA 3GWZA 2R5ZA 1GDTA 1TW2A 1G2HA 3LWFA 2L7ZA 1VQ8I 1RIOH 5EF6A 1ZRDA 4HDUA 4DBRA 4BNCA 3F22A 2VQLA 4G6QA 2F5DA 1N77A 2MG4A 3J81K 1XGNA 1CGPA 3CCYA 1ZG1A 3HOYJ 1O3TA 1QA6A 1B9NA 1YLFA 4B3XA 1L3LA 4QLCU 3E97A 1J75A 1T98A 3JW4A 1YS6A 2FNAA 2JMWA 1BC8C 4MHGA 5K5QA 3JRIA 1BL0A 1MMDA 3W6JB 2NYXA 2OA4A 2R7QA 3I58A 3R0JA 3DBRB 4XR6A 3RCOA 1LVKA 5DD8A 1RRJA 1BC7C 3G1MA 5FRNA 1ON1A 2CQKA 2ICWG 5EEAA 2OUMA 1JKQC 1AA7A 3R6SA 2DCEA 1LE8B 5M3FJ 2KJBA 3HRTA 3LSIA 3X2QH 3QYFA 3E5UA 3SXYA 3TOAA 3TW6A 3D5LA 1NK3P 3T8RA 2DA1A 4HRIA 2KFDA 3ZOBA 1S3JA 4KIBA 3ECHA 1FNNA 1R36A 4K2EA 1IN6A 4HDVA 5FROA 1DU6A 1FBQA 2KIFA 2XIGA 5E3LA 3J7AY 4X1EA 4LLLA 3K0LA 4XKWA 2KQRA 5FGMA 2CJJA 1FC3A 3RYPA 1U6GA 2IJLA 4D5FA 1OYIA 5L3EA 2CH0A 4BEHB 3OSFA 2H8RA 4PUSA 1U3EM 3HUGA 4NUBA 3PFIA 1IRXA 3OV8A 1I3AA 2CW0F 2BBYA 3FK7A 4XICA 2HQNA 3C2BA 2WAQA 3FKIJ 4LK1F 2XUBA 5HODA 3KP7A 1OPCA 3HM5A 2W82A 1HKQA 3CJQB 2HWVA 1TBXA 3IAS2 2LD5A 1W5CC 3TQNA 4G94A 1V4RA 3DTKA 4LG3A 3CD6I 3NEUA 3LSMA 2L9RA 1SFUA 4A12A 3HOTA 1OR7A 1S5LC 4AIDA 3S2HJ 4OIQF 5IT9K 5J4YA 1MBFA 3CC4I 3I4MJ 1D8JA 3H35A 2KL4A 4U7DA 2VONA 3BR3A 2PLYA 5TISC 1IW7F 2QWWA 2KDZA 2CG4A 2WADA 2P6TA 2LBFA 4OMYA 5J3LA 2ME6A 1VNDA 1RKWA 1X1BA 5ICFA 2Y30A 3C18A 3QODA 4WXCA 2A6HF 5EEGA 2JSCA 4X0GA 2ZJQF 1ZAOA 5K1YA 4BS9A 1W36D 4L0ZB 4WK8F 2E2IJ 1ITYA 5FLVA 1DPRA 1J09A 2L9SA 2O61A 1OKRA 3LA2A 4MNUA 3HZJA 4EM1A 4XLEA 3ZQCA 3WTWC 1MZBA 1W4MA 5AIPA 1J5YA 2VKVA 4DW6A 4LIVA 1ZARA 3TEDA 1WH7A 3MKZA 2IA0A 3ISPA 3HIFA 1MBJA 4PSWA 3TP0A 3VEPA 3LMMA 3VYTB 4C3HJ 5F1JA 2R92J 2I8DA 2PEXA 1YTYA 3H3ZA 2G0EA 1SC7A 1LDKB 4CHUA 1I1GA 2XKOA 1JGSA 2NVUB 2L7FP 2X4HA 3I4PA 5LGNA 2IA1A 3QAHA 1MJBA 1FOYA 3B73A 5ILUA 2X6WA 3FZVA 1EF4A 2E5NA 3V8JA 3IRRA 2NVXJ 4AIHA 1Z7UA 3EPZA 3ESWB 2XRNA 4I99C 1P7IA 1PP7U 1S7EA 4BJTA 4C30A 3UR3C 3BCAA 2GBYA 1MSEC 5J6XA 2CUFA 4M9SA 1ZREA 3FXRA 2EFNA 2L7MP 3R61A 1TL8A 1VQLI 3Q0WA 3AL0B 2CS3A 2DTZA 4BXXJ 5LFAA 2D5VA 3GUDA 3I54A 3KP4A 1D0ZA 5TRDA 3MWMA 4HV6A 1IZ1A 2K4JA 1V55H 1ZGWA 1UMQA 1LFBA 1TTYA 3K7AJ 4IL6C 2O6GE 3R4KA 2F4OB 1NG6A 2A3SA 2QCOA 5GPAA 4I0BA 4BY7J 2PQ8A 1FP1D 3RZDJ 3EUKL 1Z0XA 1PUFA 2K3PA 3M3YJ 3WGGA 2BZTA 1Y6IA 1I1SA 3DV8A 3E1SA 2P4WA 2KKOA 3I59A 1H0MA 5F64A 1VTNC 2Y48A 3EETA 3IAM2 4UV8A 2R7FA 3A4CA 3FWEA 1W7PA 1ZK8A 2RQQA 4KN7X 2HDWA 4D9JA 3O2PE 4BUPA 2E7XA 3BZKA 1NTCA 1CQTA 1KQ8A 2IXSA 4PJLA 3ERED 3KEYA 1KZHA 2LKPA 1ZRFA 2Z5UA 1X19A 2DQRA 3GO5A 3QOPA 2QBYB 2YR2A 3PNVA 3BTCA 3WG9A 1UHWA 4GDFA 2ME0A 4A3FJ 2L0KA 3BG5A 2BW3A 4RLQA 4GGGA 5AIQA 5K7FA 2GA2A 2L01A 3RKWA 1TWFJ 3IKVA 3TBIA 3JRCA 3KZYA 3S3MA 2X6XA 2DPDA 4A3JJ 1XGMA 1MMAA 4Q4ZF 2CW7A 1TT0A 5DDGA 2ELJA 2XPUA 1FWZA 1T95A 2DMQA 2JA2A 2DA3A 4ETSA 4YG2F 3H5NA 3FM5A 4A93J 4L9VA 4CCKA 3ZPLA 2M8GX 1ZRCA 1X4PA 1R5HA 4N0BA 4U87A 2V1DA 5FKMA 2ZNYA 2BXZA 1QBJA 1X58A 4JOMA 4YIIA 2A68F 4OAZA 4BHCA 4WF2A 1DDNA 2PI0A 3LOCA 2R0QC 3JREA 3A1YA 5F6FA 1WJEA 1F43A 4B4CA 4BJ5C 1R9TJ 2X1DA 2C6YA 3I56I 3A01A 2XSDC 1UHMA 2HVQA 3S1QJ 4YIRX 4M3GA 2E19A 2HOAA 2V9VA 1CF7A 2O8KA 5DUKA 4BYYA 4X6AJ 2ID3A 2DXIA 4KMUX 4TV7A 3GTGJ 1XX5A 2EA4A 1FPQA 2EFWA 5GPCA 2GOXB 1DUXC 2Z2SB 1YX3A 3E6MA 3MVPA 5E79C 2ZMEC 1MJAA 2BVLA 2DT6A 2YU3A 3HUGB 3FIWA 2X51A 2RGVA 2EFQA 1O7FA 4UB8C 2KLOA 4FX0A 1PVEA 1U8BA 1MGTA 2HVSA 2JWTA 1O4XA 1K7AA 3DEEA 4FISA 3VYRB 4B48A 3BLYA 2X0LA 2ZXJA 4HLYA 2E2HJ 4NHJA 2ZXIA 3QRFF 4DYRA 1O3RA 2V6EA 3M9AA 3OMYA 2DA5A 1JE8A 4U7BA 4U0YA 3GLXA 2ZJRF 4KIFA 3C7JA 3S2WA 1IN7A 2ELKA 2ACJA 1T39A 2CQNA 4EATA 4CSWA 4LMYA 4XQFA 3IKTA 1FP2A 2DMPA 1FIPA 3MCZA 2L4AA 2VQHA 2LBFB 1TP4A 2HZTA 5FLXK 3ULQB 3FHNA 4LG0A 2R5YA 3CC2I 1ETOA 2V1UA 3I71A 1BOAA 4GFBA 3ZQIA 1IN8A 3B6AA 4I01A 1SD6A 3ABUA 4ENJA 4G7ZF 2AQEA 1MBKA 5IYDJ 4KT6A 2JRMA 2Y9YA 1U78A 1HCRA 2DO7A 2EJRA 3KZIC 4JX4A 4DYQA 1YFHA 2G9WA 1IRGA 4XOPA 3PFYA 4PFOA 1GXQA 4GXOA 2LKXA 5EGOB 5F0FA 2KRCA 3NWTA 4IHTA 1A6IA 1B8IA 1S29A 3DXJF 3QU3A 3GVAA 3BR6A 4II3A 4BL0B 1H9TA 2GOMA 5IP6A 5FKNA 1XSVA 2P0WA 4E7KA 3K1NA 1R22A 4V2GA 2V7FA 4BXUA 3LNQA 1UELB 2RQPA 3K70D 1MDMA 3PNYA 1O57A 2VXDA 2XPVA 2OZUA 3OL3A 2JVGA 4UB6C 4IHVA 1USTA 2ISYA 5D8LB 1R1VA 1ZH5A 1BIBA 5CLSA 3HGYA 2FBHA 2NRAC 1IDYA 1FTZA 2M9HA 4BHPA 5D8KB 1IN5A 1HXDA 4U0VA 2CWEA 4XNFA 5D4RA 3EUHA 2EB7A 4H4KC 2CUZA 3OYEA 1ZHFA 1G8XA 4B8XA 1EH7A 2MH9A 3MD2A 2V1NA 1QHHD 2BY3A 2CFXA 2K85A 4IJAA 4OWRB 5F1RA 3KP2A 3KLNA 5K7ZA 3QYBA 1E17A 2AXTC 1Z1DA 4FETA 3GTLJ 1IRFA 3WODF 5E1WA 1KYZA 2NOGA 3T0YA 5IP9J 3N97A 3H92A 2HNHA 2VL8A 3K4JA 4CH7A 3WTXC 4XIDA 2BVMA 5LGUA 1JKRC 1WI3A 1OQYA 4NB5A 5F08A 1WJCA 4S0HB 4RDUA 2OPTA 5E1XA 3UNGC 3V7RA 2FMYA 2GZWA 3OYDA 1Z9CA 1I5ZA 2LMDA 3JTHA 2IS1A 1A31A 4F92B 5CVUA 2EZKA 5DM7F 3GTOJ 1LDJA 3K4NA 4E7HA 2QKLB 3P5JA 3GLLA 2CU7A 4FE7A 4MLOA 4J00A 3JAMK 1MKMA 5JLXA 3JAMZ 4YFNF 2QKMB 2FRHA 1VQ7I 2ECCA 4D1QA 2X6OA 2NS8A 2XB5A 2E1OA 3K2AA 1T08B 5F0CA 2MW8A 2JZYA 4E7ZA 4GYIA 2BW3B 4C2MJ 5BS6A 1FYMA 3DTIA 4PK4A 4EJVA 4ZTFA 4G7OF 1LEBA 3ZQFA 3GFIA 5E17F 3IV5A 2AQFA 3BG9A 3HRSA 2E36A 2ADUA 2QSFX 5EJCA 2H1KA 4JK1X 3TKYA 4NC8A 4O6JA 2LP0A 3G4SI 1YYVA 3K4CA 4M6YA 4QIWN 2DQLA 2NNYA 2QM3A 1UZCA 1G3YA 4BU2A 2O8XA 4A5NA 2EH3A 2A5WA 4N4OB 3KE2A 5FFZA 5A2QK 1MMGA 1FSHA 5HNFA 4C9YA 2AO9A 2BGCA 4AVZA 1DQUA 4RAFA 1ODDA 1V5FA 1KU7A 4WCGA 1T0FA 3RQ4A 1I6HJ 1WKMA 5J1RA 3BG7A 1BBYA 4PCQA 3HRMA 2WV0A 3GMEA 4IHXA 1MNMC 1Y56A 2JA6J 1HW2A 1W0TA 4S05A 5K5OA 3ZQQA 4CYCA 1MH4A 4UNOA 2XGXA 4A3MJ 1AKHA 5D4SA 3ECOA 2O0YA 3BC8A 3I9V2 1ETVA 1JHHA 2WAEA 1XMXA 5C4XJ 3COAC 4M6XA 3FXKA 4RBOA 3J7ZI 1TNTA 2DI3A 2P5KA 2W25A 1T8IA 1HOMA 4RB1A 3HTUA 1K4TA 1RUNA 4RGRA 4IZZA 1FOKA 3FMSA 4Y52J 2PFBA 1B6AA 1YG2A 1R1TA 1Z3YA 1JJ8C 1NH3A 1BIAA 5EG0A 2IGMA 3VFZA 2EA2A 3BR5A 4XOTA 4E6KG 1TQIA 2R7VA 3BZCA 1TZLA 3BY6A 3LFKA 3QP6A 5HVQC 1E2XA 3L7WA 4P55A 5LEKA 3ZXSA 1HBXG 2MGQA 2IVMA 4WXHA 5C3EJ 3LSKA 3JRAA 1F5TA 2GXAA 4P9FA 3ZGKA 1IC8A 2LLKA 2DJNA 4U0WA 4MIMA 5D6FA 5FKKA 3GTPJ 1AOYA 3RPUD 2CV0A 1ON2A 4M9ZA 1WGXA 3C2HA 2CQ7A 1K4SA 3H5RA 4ITVA 4E7IA 1YI2I 4XRMA 1DP7P 4RM2A 1RUOA 3CCMI 2K40A 3RKYA 4RA2A 4MEXF 2BV6A 1B9MA 2TDXA 2CUJA 3OSGA 1HDDC 2R7SA 1GVJA 4IPAA 4LITA 4LG0B 1OCPA 5LGTA 1ETKA 2DA2A 1MNEA 3RKXA 4FT8A 1H88C 3GFMA 2Y0MA 4ZYGA 4BE1A 2GQQA 3J7AO 1YO5C 2P8TA 5CQGA 5D5VB 3D5SC 1IDZA 2F5VA 2EFOA 3H9GA 3HKZN 1R23A 1R6RA 3E3VA 4XSZF 3WU2C 5ICGA 2O3FA 1A35A 3I4NJ 1E0EA 4EVIA 5IOYA 1B8IB 4N9IA 3H0GJ 4MTDA 1X1AA 2HQAA 3CJNA 3L2WA 2JA7J 1SVLA 2JPCA 1J59A 2DODA 1P92A 4U88A 3J81Z 4A5MA 3CLQA 1FYLA 1OR7C 3G1OA 2RAEA 1TWAJ 2BY2A 1MBEA 4EJOA 2OCCH 3E7LA 5KNLA 3ZMZA 3CTAA 4UUTA 1XC5A 1Y1WJ 4HF2A 3IC7A 3Q9VA 3I0TA 2HYFA 2PG4A 2ZMEB 3H3VK 1SFKA 1I27A 2DMNA 1IAWA 1AU7A 2DA4A 4AIKA 1HC8A 1IRZA 3WTZA 4OIOF 2H94A 5TGTA 3LSGA 3VODA 1ZYRF 3K4LA 3SHFA 1HW1A 3V7CA 1S6LA 2XAHA 5BNGA 2EBIA 1MNDA 3F8BA 2XGDA 3NARA 3CDHA 2PJRA 2NOJB 4Z6YA 4A3GJ 2XRLA 4LB5A 2XB0X 2ECBA 2FBKA 2F4MB 3RDIA 4O5VA 4QWQA 2VBYA 2HVRA 4A6DA 2G7UA 1NG7A 1YRNA 2R7ZJ 2DOFA 2OAZA 2LREA 1AWCA 5FB2A 3ZP5A 1GHCA 2K9QA 3MEXA 4XMYA 3DKYA 3M8FA 2LSOA 2COBA 2IGNA 4Y7NJ 4FHTA 3I64A 1QVTA 4B3AA 1QNTA 2VODA 2R4GA 4DNCA 2JT1A 4A3LJ 2KIMA 5L3GA 2JN6A 3W6VA 1U8RA 5JR3A 2WWYA 3HJEA 4EGYA 3C2GA 1SEUA 2EWNA 2XF7A 4PZJA 3SFIA 2L5QA 4UUSB 4OAYA 3KEQA 3F0CA 2M4GA 2QQ8A 2Y75A 3HYIA 2CQQA 2WY7Q 3CDLA 3MFKA 3PIPF 2DOAA 1D5YA 2GWRA 3ABKH 3FBNB 4NC7A 5KAIC 3ASOH 3GEZA 4XSXF 1R1UA 2K9SA 2LG4A 4R1HA 4RS8A 5JLWA 4JQFA 3KP5A 4JP0A 4HZFA 2V26A 1IV8A 5IT9Z 3K69A 3QP5A 1X2MA 4I2OA 1JI8A 4IOCF 2CO5A 3DLAA 2VJ5A 1GT0C 2DPUA 1N25A 2H6CA 3RZOJ 2HYGD 4C2UA 1OCCH 4HW0A 3ERMA 3EYIA 4KYWA 4HBLA 4IXAA 4P5OA 2E60A 4KJZA 4ZDPA 1W0UA 2XF5A 3FK6A 3W3CA 1QO0D 3LA7A 2E2JJ 1OYYA 3FX3A 2AS5F 3E6DA 3L2VA 4KUMA 2R7UA 3AG1H 2V79A 3GFJA 2IRFG 1G4DA 1XDUA 1U5TA 3SZPA 5L3FA 3ABTA 2NS0A 2OC6A 4F7ZA 3CO7C 2V1XA 2UXXA 3PNTA 2XKPA 4ZZDA 4LB6B 5JHFA 1ZN2A 1N75A 3SQNA 3CO6C 4P96A 4NQWB 5F04A 1YQAA 4PSXA 3ZQHA 5GAHJ 1JHFA 3BR0A 2P7VB 2X1CA 2ZFUA 2Q0OA 3DU5A 3S17J 1G59A 1L0OC 2PN6A 2IAIA 2R3SA 4KMFA 2I5UA 2FJ1A 2LY9A 4QTRA 4G7HF 4DZPA 3HB9A 3SYTA 2FD5A 4A3DJ 1HSJA 3ROUA 3J80K 4BHBA 1OCZH 4LOCA 1XSDA 2HKOA 2EZLA 4HEA2 3FDYA 1B59A 1ZKGA 2WB1A 3L2UA 5AONA 2R7RA 3SZTA 1EKEA 1GUUA 4C3IJ 5C44J 3SFZA 1Y8RB 1GV5A 4OIRF 1MJ9A 1HA8A 4DIQA 3LAPA 1RKTA 3W2VA 1SD4A 3PQKA 2STWA 1IJWC 4KICA 4PGGA 2F5CA 3IP4B 4M3BA 3VSKA 1J0RA 2KZGA 2VJJA 3EYYA 3CCQI 5JFRA 2M7BA 1ONVA 2HFHA 1QZZA 3HEFA 5ILSA 3T1BA 2TCTA 4Z2YA 4G9YA 3L2QA 3O6BB 2FUG2 1FTTA 3VOEA 4UHTA 4PGHA 3PO2J 1WRJA 2GXGA 2QVOA 4MQ9F 1Z7LA 5FKOA 3LSRA 3K4MA 3G6EI 2W4SA 1UG0A 2H27A 2CW8A 2KMUA 1QZEA 1LFPA 3RIRA 3WTVC 1JUPA 1RESA 3TDUC 5CVRA 5JVGF 1YW9A 3SEZA 3BJAA 3KETA 2EQRA 5K7HA 4IHWA 1SMTA 1K61A 4M3DA 1QGPA 3DPUA 4LFUA 2NS7A 4GO1A 1O7LA 4G6DA 3PQJA 3OYIA 1YOVB 2R5ZB 3NWSA 4PJJA 2CQXA 5H20A 3F6OA 4AD9A 1B72A 1ACIA 2WV1A 4XKVA 2XAFA 4BJ6C 4XLAA 3F8FA 1HLVA 3JCUC 2DDBA 4LD5A 5DD4A 1QVUA 2VKDA 2KT0A 1XD7A 3REOA 1VQKI 1Z91A 2L2OA 2EV5A 1K78A 4Q5SF 2IW5A 2D2WA 1ORKA 4M73A 1X3ZB 5CVIA 2L02A 3WGIA 1FT9A 2KRHA 2M30A 1XPXA 1I39A 1KU9A 5ED4A 4DJAA 2XASA 5F0HA 3EQLF 1Y8QB 4MFDA 4AWXB 4I6ZA 4NNJA 3S3OA 1OCTC 4Y17A 1LQ1A 3GX4X 5FFXA 1T33A 4F52A 4A3BJ 4L18B 4IRGA 4AYBA 3G2BA 5KK1A 3PO3J 5H2FC 2GLOA 4NC6A 5CQEA 2ZNZA 1LB2A 4OIPF 3BOQA 3M1CA 4Y33A 3F3XA 3H9JA 2DFFA 3MMYB 4DBQA 5EZHA 3U1KA 5J8CA 5E18F 2EV6A 1GVDA 3AG3H 2M3AA 1J2XA 4DZJA 2VLAA 2DK8A 2E34A 1LVAA 3KIOA 3OS0A 1BR1A 3E5XA 1HF0A 4Y15A 4HV5A 5E3MA 1QRYA 4HF0A 1QZYA 1K6OA 2JA8J 2F4IA 2WAFA 2O03A 3QWLA 2VASA 3BT9A 4D7MA 4FCYA 1D1CA 1FSEA 3Q0VA 1EH6A 1V3FA 2XPWA 4XN3A 1PDNC 4BAYA 4ZDLA 4ANJA 4HG2A 5HS8A 4ZYEA 4J01A 3CQZJ 4V19K 3MZHA 2A6TA 3RSNA 4ON0A 2G7HA 3OS2A 2M34A 3FXUA 1XB4A 4HX4A 1WJFA 1BJZA 2HQ5A 4XORA 1X3UA 5IYBJ 1SFOJ 3MQ0A 3EUHC 4JX5A 1P9QC 2B7EA 2QSGX
chains in the Genus database with same CATH topology
3E6BA 1KGSA 2NAZA 4MQVA 1I6XA 4M74A 4Q47A 4KN4X 1USSA 2MH2A 4N9HA 1UFMA 2CSOA 2P7CB 4Y13A 5JI6A 5FLXZ 5EEHA 1F4KA 2CYYA 2VN2A 5LEJA 1ULYA 1DPUA 4PDKA 2D1HA 3VB2A 1S7AA 5J8FA 4ZYDA 1T2KA 2ETHA 3KZZA 3F8NA 4EJWA 4HOBA 2Q2EA 2PMHA 2E7WA 3DPTA 2VE9A 3HRUA 3L00A 5DCFA 3L09A 3RPUA 3BROA 3DQVC 4I0AA 4RB2C 1ZG5A 3E6CC 1BN5A 1A04A 5CYVA 3DKWA 2STTA 4A0YA 4CXFA 1IN4A 3ZQ7A 1TW3A 1ZLKA 3ELKA 4HLXA 3RJPA 4MEYF 1BI3A 1F1ZA 1Z6RA 2QYOA 4E70A 1LNWA 2LF7A 4H0EA 1RI7A 2A5YB 3NQOA 2DLLA 2IA2A 3WTSC 3K1PA 1BI0A 1KQ9A 2F5FA 2GIVA 2XAQA 3LA3A 2HQRA 1KYWA 3I59B 3HOSA 1D8KA 2YX7A 4I98B 1W7PB 5HS7A 3K1MA 1QQIA 3IL2A 5ICEA 2IT0A 4Q48A 2P6SA 3L2CA 2RN7A 4CGZA 1B1BA 3FMRA 2FE3A 2ESNA 3ML6A 4OOIA 2MBFA 2VT2A 5D5WB 4XLPF 4KA4A 3TOBA 1J7KA 3BDDA 4ENNA 2VE8A 1SFEA 2UZKA 1YS7A 2Z9OA 2UXNA 3FHZA 2DFIA 3V8LA 3WTTC 2W84A 3TGNA 2ZFWA 1REPC 1XCVA 1FY7A 5A2QZ 2CGPA 3CUQA 2WTEA 1J9IA 4MTEA 1G3WA 3R0AA 4A6EA 3G73A 3EDPA 3HSEA 3M1EA 2QUFA 4LLGF 2DK5A 2XROA 1HSTA 1CF7B 2DT5A 1BI1A 1FZPB 4ZYHA 4L9JA 4FX4A 5H6QA 2OQRA 1GXPA 3OOPA 4RB3C 4OINF 2HKXA 4MGRA 4IRHA 3GW2A 4IHSA 3F21A 5D5UB 1O3QA 2MD5A 1R7JA 2HOEA 3Q9SA 2MA3A 2Z33A 3ZMTA 3RYRA 3TO6A 2NNNA 4JBAA 4YIFA 1H9GA 4L5JA 3P7NA 4EV0A 5HOOA 3HHHA 4HA8A 4HX8A 3C3WA 4RAYA 4RGXA 2HTSA 2LDUA 1S7OA 1D5VA 2JRTA 4XBFA 1W5TA 2ZCWA 2YSRA 4KT5C 4RGUA 1O3SA 2ZKZA 4R8HA 3GXOA 1F9NA 3M7GA 3LQQA 2EV0A 2KRFA 3JSPA 1FBSA 2OBPA 2ZO4A 5LHHA 1G3TA 3WU1B 1MDMB 1SAXA 1P4XA 4EJUA 3ZN1A 2MLGA 2QBYA 4ESFA 5FO5A 1ZGJA 1U5TC 5D6EA 1G3SA 1HQCA 2F5EA 3P9CA 6PAXA 1WQ2A 2QQAA 1T6SA 4ZZLA 2VOOA 5HLHA 1FLIA 2RC4A 3QPTA 1SFXA 3BJ6A 2IPQX 4M9XA 3IHUA 3BPXA 1HKSA 1Z6TA 4KNYA 3DPLC 2Q8KA 4WWCA 5LLQA 1R00A 3HTSB 4HAMA 2VC1A 5LBQA 4I02A 1LJ9A 3DEUA 4UVAA 2DU9A 1RNLA 2XHKA 3TO9A 2YPRA 5DUIA 3LSTA 5HDGA 2Z99A 1FYKA 1PP8F 5CVJA 1IF1A 3ZMUA 3HSFA 2M45A 2A61A 4UV9A 4IVNA 1HKTA 2K4BA 4AVPA 3T8TA 2HEOA 3CUQB 1SMYF 4KDPA 3ZN0A 3U2RA 1W5SA 3F8MA 3KFWX 2OZ6A 5E1ZB 3V7SA 2L4MA 5BQTA 3ZMDA 1OMIA 4B09A 4XRFA 2JPBA 4D0PA 2E1NA 3RTRA 2DTRA 3BJOA 2K02A 5JHUA 2PJPA 1Q1HA 3K9TA 3F6VA 1MD0A 2LNBA 3RPQA 5DCMA 1IXCA 1EV7A 3J80Z 4CO8A 2DBBA 4RAZA 2UWMA 1YW7A 5BMZA 3GF2A 3GYHX 1RZ4A 4UVCA 4R79A 4BH9A 2RDPA 5LRRA 5ILVA 5LHGA 2FQ3A 2QZ8A 4WXDA 2VBXA 1FX7A 4P9UA 5DEQA 3I5UA 3BPVA 2K27A 3KP3A 3V8KA 2DAOA 2QENA 2W85A 4CDGA 4KFCA 3IWFA 1D3YA 2A07F 3DFGA 4HQMA 2VC0A 4I7HA 1SD7A 3KLOA 1K79A 4M72A 1XCBA 2COMA 2M1BA 1ZLJA 2QQ9A 1WSUA 4CZZA 5CJ9A 3TDZC 5HDKA 5L3BA 4ESJA 2FOKA 3O3KA 1YW8A 2VBZA 1S8NA 1XMKA 1P4WA 3FF5A 1IXRC 2RNJA 4GCVA 1TLHB 2FXAA 1R58A 4ASNA 1Z05A 4HYEA 3KCCA 2GA1A 5H6RA 1XN7A 4ENKA 4XLNF 1LEAA 3FXQA 2D1VA 2K7LA 1YIOA 2WC2A 2B0LA 1P6RA 2GAUA 4HF1A 4ENMA 3N4MA 4IRIA 3D0SA 1XSXA 2W24A 4RB0A 4ESBA 4EGZA 1XMAA 2OQGA 1ZGAA 3LQRA 3GFLA 5IT3A 3CLOA 2OD5A 1NHAA 1QPMA 5DV5A 4IF4A 3JSOA 3B02A 5L3CA 5ERIA 3BP8A 4AIJA 1BM9A 1JXSA 4A0ZA 2QLZA 3IRQA 2M8EA 2BE5F 2EFPA 4GYGA 2FEZA 3GZ6A 3MAJA 1U5TB 1WI9A 1STZA 3IWZA 3QPHA 4A0XA 5HLIA 4LLNA 2FNPA 3GZ5A 2VXZA 3DF8A 5HLGA 2F2EA 5BPIA 5LHIA 1WWXA 5DYMA 2HGCA 2VT3A 2V6CA 2XAJA 1XDSA 3FM3A 4LK0F 3QU6A 3JTGA 3C1DA 5LRSA 1SD5A 3H3UA 5DCMB 1LDDA 1IXSB 3KEOA 3WE3A 2E1CA 2ZJ2A 1FBUA 1R5GA 4L0YB 4ZH4F 3BWGA 4YFKF 4L9TA 1T38A 4UXNA 2OU2A 2RKHA 2J5PA 5D5XB 3CUQC 1W7PD 3U9GA 4WX9A 2FF4A 3MZYA 2ZMEA 3V4GA 1KA8A 4UUVA 4O3MA 5FD5A 3BZ6A 4LGWA 1PUEE 2YX4A 2FBIA 1B4AA 4BQAA 2K86A 2H09A 3F72A 4DQ2A 5E8IA 2HTJA 1XGOA 3P9KA 3M8EA 5L3DA 2HDCA 1P4AA 2VOPA 4A2UA 4YFXF 2JTVA 2MLKA 2ZBKA 1KQ0A 2D45A 3WTUC 4I09A 2HS5A 2FA5A 3T5XA 2VBWA 5JVTA 3WGHA 2QQBA 1XGSA 3ZMVA 3WU0A 1K78B 2RVCA 5HDNA 2MC3A 4EJTA 1Y0UA 1TQPA 2IP2A 5E8GA 2FMLA 2XVCA 3F23A 2BYVE 5FD6A 2EK5A 4L5IA 4UVBA 2L54A 2R7DA 5K5RA 3CUOA 1TQMA 3U1DA 4L9NA 2P5VA 3NRVA 1KU3A 2LF8A 3RI4A 3Q5FA 2FSWA 4EQQA 5KVRA 4G8XA 3W6KB 3HSRA 2W57A 2RV8A 2Z3YA 5E20A 3LAJA 3FMQA 5CVVA 4M71A 2ISZA 3TO7A 1HW5A 4EM2A 2ELHA 5ICCA 1OYWA 4NQWA 2ESHA 2GXBA 4S04A 3E5QA 4KIGA 2BEOA 2L3DA 3DP7A 1BJAA 2M5WA 3L9FA 4EM0B 1TNSA 2PBIA 3F8CA 1BI2A 4RGSA 2M87A 1P2FA 1IUYA 2A6EF 1U2WA 1UCRA 5HS9A 2P5LC 5TJJA 3K2ZA 3G3ZA 5BPDA 3I53A 2HR3A 3WTYC 3HHGA 4OU0A 4OMZA 1KU2A 4CICA 1G6NA 2PMUA 2XV4S 2DW4A 2H6BA 4LJZF 4CYDA 2FU4A 2AXLA 3WE2A 4HQEA 4HX7A 2KIUA 4EMSA 1UB9A 3AAFA 3ZMSA 5BOXA 2J5OA 1ZG3A 1EH8A 3R60A 2XAGA 3KP6A 2KJCA 1C0WA 3P9IA 2A69F 3GWZA 1TW2A 3LWFA 1RIOH 1ZRDA 4HDUA 4BNCA 3F22A 4G6QA 2F5DA 3J81K 1XGNA 1CGPA 1ZG1A 1O3TA 1B9NA 1YLFA 1L3LA 4QLCU 3E97A 1J75A 1T98A 3JW4A 1YS6A 2FNAA 1BC8C 4MHGA 5K5QA 3W6JB 2NYXA 2OA4A 3I58A 3R0JA 5DD8A 1BC7C 1ON1A 2CQKA 3R6SA 2KJBA 3HRTA 3E5UA 3SXYA 3TOAA 3D5LA 3T8RA 1S3JA 4KIBA 3ECHA 1FNNA 1R36A 4K2EA 1IN6A 4HDVA 1FBQA 2KIFA 2XIGA 4LLLA 3K0LA 5FGMA 1FC3A 3RYPA 1U6GA 2IJLA 1OYIA 5L3EA 1U3EM 3HUGA 3PFIA 3OV8A 2CW0F 2BBYA 2HQNA 4LK1F 2XUBA 3KP7A 1OPCA 1HKQA 2HWVA 1TBXA 3TQNA 4G94A 1V4RA 3NEUA 1SFUA 4A12A 3HOTA 1OR7A 4OIQF 5IT9K 1D8JA 4U7DA 2VONA 2PLYA 1IW7F 2QWWA 2CG4A 2P6TA 4OMYA 5ICFA 3C18A 4WXCA 2A6HF 5EEGA 2JSCA 4L0ZB 1ZAOA 5K1YA 4WK8F 1DPRA 2O61A 1OKRA 3LA2A 4MNUA 4EM1A 3WTWC 1MZBA 1W4MA 5AIPA 1J5YA 1ZARA 2IA0A 3ISPA 3HIFA 3VEPA 2PEXA 1YTYA 3H3ZA 1LDKB 4CHUA 1I1GA 2XKOA 1JGSA 2X4HA 3I4PA 5LGNA 2IA1A 3QAHA 1MJBA 3B73A 5ILUA 3FZVA 3V8JA 3IRRA 4AIHA 1Z7UA 2XRNA 1PP7U 5J6XA 4M9SA 1ZREA 3FXRA 2EFNA 3R61A 3GUDA 3I54A 3KP4A 5TRDA 3MWMA 4HV6A 1IZ1A 2K4JA 1TTYA 2O6GE 3R4KA 2A3SA 4I0BA 2PQ8A 1FP1D 3WGGA 1I1SA 3DV8A 2P4WA 2KKOA 3I59A 1H0MA 5F64A 1VTNC 2Y48A 3EETA 4UV8A 2R7FA 3FWEA 1W7PA 4KN7X 3O2PE 2E7XA 1KQ8A 3ERED 2LKPA 1ZRFA 2Z5UA 2DQRA 3GO5A 3QOPA 2QBYB 2YR2A 3WG9A 1UHWA 4GGGA 5AIQA 2GA2A 2L01A 3RKWA 3IKVA 3KZYA 2DPDA 1XGMA 4Q4ZF 5DDGA 1FWZA 4ETSA 4YG2F 3FM5A 4L9VA 3ZPLA 1ZRCA 1R5HA 4N0BA 2V1DA 2ZNYA 1QBJA 4YIIA 2A68F 4BHCA 4WF2A 1DDNA 2PI0A 5F6FA 2C6YA 1UHMA 2V9VA 1CF7A 5DUKA 4BYYA 4KMUX 4TV7A 2EA4A 1FPQA 2EFWA 1DUXC 3E6MA 1MJAA 2YU3A 2RGVA 2EFQA 1O7FA 4FX0A 1MGTA 1K7AA 2X0LA 2ZXJA 4HLYA 4NHJA 3QRFF 1O3RA 3M9AA 1JE8A 4U7BA 4U0YA 3GLXA 4KIFA 3C7JA 3S2WA 1IN7A 1T39A 2ACJA 4LMYA 3IKTA 1FP2A 3MCZA 2L4AA 2HZTA 5FLXK 3ULQB 4LG0A 2V1UA 3I71A 1BOAA 1IN8A 4I01A 1SD6A 3ABUA 4ENJA 4G7ZF 1U78A 2DO7A 2EJRA 1YFHA 2G9WA 1IRGA 1GXQA 4GXOA 4IHTA 1S29A 3DXJF 3QU3A 3GVAA 1H9TA 1XSVA 3K1NA 1R22A 4BXUA 2RQPA 1MDMA 1O57A 2OZUA 1USTA 2ISYA 5D8LB 1R1VA 1ZH5A 1BIBA 5CLSA 2FBHA 2NRAC 4BHPA 5D8KB 1IN5A 1HXDA 4U0VA 2CWEA 5D4RA 3EUHA 2EB7A 1ZHFA 4B8XA 1EH7A 2MH9A 2CFXA 4IJAA 5F1RA 3KP2A 3KLNA 1E17A 1Z1DA 1IRFA 3WODF 5E1WA 1KYZA 3T0YA 3N97A 3H92A 3WTXC 5LGUA 4NB5A 5E1XA 3V7RA 2FMYA 2GZWA 1Z9CA 1I5ZA 3JTHA 5CVUA 1LDJA 3JAMK 1MKMA 3JAMZ 4YFNF 2FRHA 2JZYA 4GYIA 5BS6A 1FYMA 4EJVA 4G7OF 1LEBA 3GFIA 5E17F 3HRSA 2ADUA 4JK1X 3TKYA 4O6JA 1YYVA 4M6YA 2DQLA 2NNYA 2QM3A 1G3YA 2O8XA 4A5NA 3KE2A 5FFZA 5A2QK 1FSHA 2BGCA 1ODDA 1KU7A 4WCGA 1T0FA 1WKMA 1BBYA 4PCQA 3HRMA 2WV0A 1HW2A 4S05A 5K5OA 4UNOA 2XGXA 5D4SA 3ECOA 2O0YA 1JHHA 3COAC 4M6XA 1TNTA 2DI3A 2P5KA 2W25A 4RB1A 3HTUA 1RUNA 4RGRA 1FOKA 3FMSA 2PFBA 1B6AA 1YG2A 1R1TA 1BIAA 3VFZA 2EA2A 1TQIA 3LFKA 3BY6A 3QP6A 5HVQC 5LEKA 1E2XA 3L7WA 4P55A 1HBXG 2IVMA 4WXHA 1F5TA 4P9FA 4U0WA 5D6FA 1AOYA 1ON2A 4M9ZA 1DP7P 1RUOA 3RKYA 4MEXF 2BV6A 1B9MA 2TDXA 1GVJA 4IPAA 4LG0B 5LGTA 3RKXA 4FT8A 3GFMA 2Y0MA 4ZYGA 2GQQA 3J7AO 1YO5C 2P8TA 5D5VB 2EFOA 1R23A 3E3VA 4XSZF 5ICGA 2O3FA 4EVIA 4N9IA 4MTDA 3CJNA 1J59A 2JPCA 1P92A 4U88A 3J81Z 4A5MA 1FYLA 4EJOA 3ZMZA 3CTAA 4HF2A 3IC7A 3Q9VA 3I0TA 2HYFA 2PG4A 2ZMEB 1I27A 1IAWA 4AIKA 3WTZA 4OIOF 2H94A 3VODA 1ZYRF 3SHFA 1HW1A 3V7CA 1S6LA 2XAHA 3F8BA 3CDHA 4LB5A 2FBKA 3RDIA 4O5VA 4QWQA 2VBYA 4A6DA 2G7UA 2OAZA 1AWCA 5FB2A 3ZP5A 1GHCA 3MEXA 3M8FA 2LSOA 4FHTA 3I64A 1QNTA 2VODA 4DNCA 2JT1A 2KIMA 5L3GA 1U8RA 5JR3A 2WWYA 4EGYA 2EWNA 4PZJA 3KEQA 2Y75A 3HYIA 3MFKA 2GWRA 3GEZA 4XSXF 1R1UA 4R1HA 4RS8A 4JQFA 3KP5A 4HZFA 5IT9Z 3K69A 3QP5A 4I2OA 2CO5A 2DPUA 2H6CA 2HYGD 4HW0A 3EYIA 4KYWA 4HBLA 4IXAA 4P5OA 1QO0D 3LA7A 1OYYA 3FX3A 2AS5F 3E6DA 4KUMA 2V79A 3GFJA 2IRFG 1G4DA 1XDUA 1U5TA 3SZPA 5L3FA 2NS0A 3ABTA 4F7ZA 3CO7C 2V1XA 2UXXA 2XKPA 4ZZDA 4LB6B 1ZN2A 3SQNA 3CO6C 4P96A 1YQAA 1JHFA 2P7VB 2Q0OA 1L0OC 2PN6A 2R3SA 4KMFA 4G7HF 1HSJA 3ROUA 3J80K 4BHBA 1XSDA 2HKOA 1B59A 5AONA 3SZTA 3SFZA 4OIRF 1MJ9A 3LAPA 1SD4A 3PQKA 2STWA 4KICA 4PGGA 2F5CA 1J0RA 3EYYA 5JFRA 1ONVA 2HFHA 1QZZA 5ILSA 3T1BA 4Z2YA 4G9YA 3O6BB 3VOEA 4UHTA 4PGHA 1WRJA 2GXGA 2QVOA 4MQ9F 2H27A 3RIRA 3WTVC 3TDUC 5CVRA 1YW9A 3BJAA 3KETA 1SMTA 1QGPA 4LFUA 4GO1A 1O7LA 4G6DA 3PQJA 5H20A 3F6OA 4AD9A 2XAFA 3F8FA 4LD5A 5DD4A 1XD7A 3REOA 1Z91A 2EV5A 1K78A 4Q5SF 2IW5A 2D2WA 4M73A 5CVIA 2L02A 3WGIA 1FT9A 2M30A 1KU9A 5ED4A 2XASA 3EQLF 4AWXB 4Y17A 1LQ1A 3GX4X 5FFXA 4L18B 4IRGA 5KK1A 1LB2A 2ZNZA 4OIPF 3BOQA 3F3XA 5J8CA 5E18F 2EV6A 1J2XA 2DK8A 1LVAA 3E5XA 4Y15A 4HV5A 4HF0A 1QZYA 1K6OA 2O03A 1FSEA 1EH6A 1V3FA 1PDNC 4BAYA 5HS8A 4ZYEA 3MZHA 4ON0A 2G7HA 3FXUA 4HX4A 1XB4A 1X3UA 3MQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6B A;  1KGS A;  2NAZ A;  4MQV A;  1I6X A;  4M74 A;  4Q47 A;  4KN4 X;  1USS A;  2MH2 A;  4N9H A;  1UFM A;  2CSO A;  2P7C B;  4Y13 A;  5JI6 A;  5FLX Z;  5EEH A;  1F4K A;  2CYY A;  2VN2 A;  5LEJ A;  1ULY A;  1DPU A;  4PDK A;  2D1H A;  3VB2 A;  1S7A A;  5J8F A;  4ZYD A;  1T2K A;  2ETH A;  3KZZ A;  3F8N A;  4EJW A;  4HOB A;  2Q2E A;  2PMH A;  2E7W A;  3DPT A;  2VE9 A;  3HRU A;  3L00 A;  5DCF A;  3L09 A;  3RPU A;  3BRO A;  3DQV C;  4I0A A;  4RB2 C;  1ZG5 A;  3E6C C;  1BN5 A;  1A04 A;  5CYV A;  3DKW A;  2STT A;  4A0Y A;  4CXF A;  1IN4 A;  3ZQ7 A;  1TW3 A;  1ZLK A;  3ELK A;  4HLX A;  3RJP A;  4MEY F;  1BI3 A;  1F1Z A;  1Z6R A;  2QYO A;  4E70 A;  1LNW A;  2LF7 A;  4H0E A;  1RI7 A;  2A5Y B;  3NQO A;  2DLL A;  2IA2 A;  3WTS C;  3K1P A;  1BI0 A;  1KQ9 A;  2F5F A;  2GIV A;  2XAQ A;  3LA3 A;  2HQR A;  1KYW A;  3I59 B;  3HOS A;  1D8K A;  2YX7 A;  4I98 B;  1W7P B;  5HS7 A;  3K1M A;  1QQI A;  3IL2 A;  5ICE A;  2IT0 A;  4Q48 A;  2P6S A;  3L2C A;  2RN7 A;  4CGZ A;  1B1B A;  3FMR A;  2FE3 A;  2ESN A;  3ML6 A;  4OOI A;  2MBF A;  2VT2 A;  5D5W B;  4XLP F;  4KA4 A;  3TOB A;  1J7K A;  3BDD A;  4ENN A;  2VE8 A;  1SFE A;  2UZK A;  1YS7 A;  2Z9O A;  2UXN A;  3FHZ A;  2DFI A;  3V8L A;  3WTT C;  2W84 A;  3TGN A;  2ZFW A;  1REP C;  1XCV A;  1FY7 A;  5A2Q Z;  2CGP A;  3CUQ A;  2WTE A;  1J9I A;  4MTE A;  1G3W A;  3R0A A;  4A6E A;  3G73 A;  3EDP A;  3HSE A;  3M1E A;  2QUF A;  4LLG F;  2DK5 A;  2XRO A;  1HST A;  1CF7 B;  2DT5 A;  1BI1 A;  1FZP B;  4ZYH A;  4L9J A;  4FX4 A;  5H6Q A;  2OQR A;  1GXP A;  3OOP A;  4RB3 C;  4OIN F;  2HKX A;  4MGR A;  4IRH A;  3GW2 A;  4IHS A;  3F21 A;  5D5U B;  1O3Q A;  2MD5 A;  1R7J A;  2HOE A;  3Q9S A;  2MA3 A;  2Z33 A;  3ZMT A;  3RYR A;  3TO6 A;  2NNN A;  4JBA A;  4YIF A;  1H9G A;  4L5J A;  3P7N A;  4EV0 A;  5HOO A;  3HHH A;  4HA8 A;  4HX8 A;  3C3W A;  4RAY A;  4RGX A;  2HTS A;  2LDU A;  1S7O A;  1D5V A;  2JRT A;  4XBF A;  1W5T A;  2ZCW A;  2YSR A;  4KT5 C;  4RGU A;  1O3S A;  2ZKZ A;  4R8H A;  3GXO A;  1F9N A;  3M7G A;  3LQQ A;  2EV0 A;  2KRF A;  3JSP A;  1FBS A;  2OBP A;  2ZO4 A;  5LHH A;  1G3T A;  3WU1 B;  1MDM B;  1SAX A;  1P4X A;  4EJU A;  3ZN1 A;  2MLG A;  2QBY A;  4ESF A;  5FO5 A;  1ZGJ A;  1U5T C;  5D6E A;  1G3S A;  1HQC A;  2F5E A;  3P9C A;  6PAX A;  1WQ2 A;  2QQA A;  1T6S A;  4ZZL A;  2VOO A;  5HLH A;  1FLI A;  2RC4 A;  3QPT A;  1SFX A;  3BJ6 A;  2IPQ X;  4M9X A;  3IHU A;  3BPX A;  1HKS A;  1Z6T A;  4KNY A;  3DPL C;  2Q8K A;  4WWC A;  5LLQ A;  1R00 A;  3HTS B;  4HAM A;  2VC1 A;  5LBQ A;  4I02 A;  1LJ9 A;  3DEU A;  4UVA A;  2DU9 A;  1RNL A;  2XHK A;  3TO9 A;  2YPR A;  5DUI A;  3LST A;  5HDG A;  2Z99 A;  1FYK A;  1PP8 F;  5CVJ A;  1IF1 A;  3ZMU A;  3HSF A;  2M45 A;  2A61 A;  4UV9 A;  4IVN A;  1HKT A;  2K4B A;  4AVP A;  3T8T A;  2HEO A;  3CUQ B;  1SMY F;  4KDP A;  3ZN0 A;  3U2R A;  1W5S A;  3F8M A;  3KFW X;  2OZ6 A;  5E1Z B;  3V7S A;  2L4M A;  5BQT A;  3ZMD A;  1OMI A;  4B09 A;  4XRF A;  2JPB A;  4D0P A;  2E1N A;  3RTR A;  2DTR A;  3BJO A;  2K02 A;  5JHU A;  2PJP A;  1Q1H A;  3K9T A;  3F6V A;  1MD0 A;  2LNB A;  3RPQ A;  5DCM A;  1IXC A;  1EV7 A;  3J80 Z;  4CO8 A;  2DBB A;  4RAZ A;  2UWM A;  1YW7 A;  5BMZ A;  3GF2 A;  3GYH X;  1RZ4 A;  4UVC A;  4R79 A;  4BH9 A;  2RDP A;  5LRR A;  5ILV A;  5LHG A;  2FQ3 A;  2QZ8 A;  4WXD A;  2VBX A;  1FX7 A;  4P9U A;  5DEQ A;  3I5U A;  3BPV A;  2K27 A;  3KP3 A;  3V8K A;  2DAO A;  2QEN A;  2W85 A;  4CDG A;  4KFC A;  3IWF A;  1D3Y A;  2A07 F;  3DFG A;  4HQM A;  2VC0 A;  4I7H A;  1SD7 A;  3KLO A;  1K79 A;  4M72 A;  1XCB A;  2COM A;  2M1B A;  1ZLJ A;  2QQ9 A;  1WSU A;  4CZZ A;  5CJ9 A;  3TDZ C;  5HDK A;  5L3B A;  4ESJ A;  2FOK A;  3O3K A;  1YW8 A;  2VBZ A;  1S8N A;  1XMK A;  1P4W A;  3FF5 A;  1IXR C;  2RNJ A;  4GCV A;  1TLH B;  2FXA A;  1R58 A;  4ASN A;  1Z05 A;  4HYE A;  3KCC A;  2GA1 A;  5H6R A;  1XN7 A;  4ENK A;  4XLN F;  1LEA A;  3FXQ A;  2D1V A;  2K7L A;  1YIO A;  2WC2 A;  2B0L A;  1P6R A;  2GAU A;  4HF1 A;  4ENM A;  3N4M A;  4IRI A;  3D0S A;  1XSX A;  2W24 A;  4RB0 A;  4ESB A;  4EGZ A;  1XMA A;  2OQG A;  1ZGA A;  3LQR A;  3GFL A;  5IT3 A;  3CLO A;  2OD5 A;  1NHA A;  1QPM A;  5DV5 A;  4IF4 A;  3JSO A;  3B02 A;  5L3C A;  5ERI A;  3BP8 A;  4AIJ A;  1BM9 A;  1JXS A;  4A0Z A;  2QLZ A;  3IRQ A;  2M8E A;  2BE5 F;  2EFP A;  4GYG A;  2FEZ A;  3GZ6 A;  3MAJ A;  1U5T B;  1WI9 A;  1STZ A;  3IWZ A;  3QPH A;  4A0X A;  5HLI A;  4LLN A;  2FNP A;  3GZ5 A;  2VXZ A;  3DF8 A;  5HLG A;  2F2E A;  5BPI A;  5LHI A;  1WWX A;  5DYM A;  2HGC A;  2VT3 A;  2V6C A;  2XAJ A;  1XDS A;  3FM3 A;  4LK0 F;  3QU6 A;  3JTG A;  3C1D A;  5LRS A;  1SD5 A;  3H3U A;  5DCM B;  1LDD A;  1IXS B;  3KEO A;  3WE3 A;  2E1C A;  2ZJ2 A;  1FBU A;  1R5G A;  4L0Y B;  4ZH4 F;  3BWG A;  4YFK F;  4L9T A;  1T38 A;  4UXN A;  2OU2 A;  2RKH A;  2J5P A;  5D5X B;  3CUQ C;  1W7P D;  3U9G A;  4WX9 A;  2FF4 A;  3MZY A;  2ZME A;  3V4G A;  1KA8 A;  4UUV A;  4O3M A;  5FD5 A;  3BZ6 A;  4LGW A;  1PUE E;  2YX4 A;  2FBI A;  1B4A A;  4BQA A;  2K86 A;  2H09 A;  3F72 A;  4DQ2 A;  5E8I A;  2HTJ A;  1XGO A;  3P9K A;  3M8E A;  5L3D A;  2HDC A;  1P4A A;  2VOP A;  4A2U A;  4YFX F;  2JTV A;  2MLK A;  2ZBK A;  1KQ0 A;  2D45 A;  3WTU C;  4I09 A;  2HS5 A;  2FA5 A;  3T5X A;  2VBW A;  5JVT A;  3WGH A;  2QQB A;  1XGS A;  3ZMV A;  3WU0 A;  1K78 B;  2RVC A;  5HDN A;  2MC3 A;  4EJT A;  1Y0U A;  1TQP A;  2IP2 A;  5E8G A;  2FML A;  2XVC A;  3F23 A;  2BYV E;  5FD6 A;  2EK5 A;  4L5I A;  4UVB A;  2L54 A;  2R7D A;  5K5R A;  3CUO A;  1TQM A;  3U1D A;  4L9N A;  2P5V A;  3NRV A;  1KU3 A;  2LF8 A;  3RI4 A;  3Q5F A;  2FSW A;  4EQQ A;  5KVR A;  4G8X A;  3W6K B;  3HSR A;  2W57 A;  2RV8 A;  2Z3Y A;  5E20 A;  3LAJ A;  3FMQ A;  5CVV A;  4M71 A;  2ISZ A;  3TO7 A;  1HW5 A;  4EM2 A;  2ELH A;  5ICC A;  1OYW A;  4NQW A;  2ESH A;  2GXB A;  4S04 A;  3E5Q A;  4KIG A;  2BEO A;  2L3D A;  3DP7 A;  1BJA A;  2M5W A;  3L9F A;  4EM0 B;  1TNS A;  2PBI A;  3F8C A;  1BI2 A;  4RGS A;  2M87 A;  1P2F A;  1IUY A;  2A6E F;  1U2W A;  1UCR A;  5HS9 A;  2P5L C;  5TJJ A;  3K2Z A;  3G3Z A;  5BPD A;  3I53 A;  2HR3 A;  3WTY C;  3HHG A;  4OU0 A;  4OMZ A;  1KU2 A;  4CIC A;  1G6N A;  2PMU A;  2XV4 S;  2DW4 A;  2H6B A;  4LJZ F;  4CYD A;  2FU4 A;  2AXL A;  3WE2 A;  4HQE A;  4HX7 A;  2KIU A;  4EMS A;  1UB9 A;  3AAF A;  3ZMS A;  5BOX A;  2J5O A;  1ZG3 A;  1EH8 A;  3R60 A;  2XAG A;  3KP6 A;  2KJC A;  1C0W A;  3P9I A;  2A69 F;  3GWZ A;  1TW2 A;  3LWF A;  1RIO H;  1ZRD A;  4HDU A;  4BNC A;  3F22 A;  4G6Q A;  2F5D A;  3J81 K;  1XGN A;  1CGP A;  1ZG1 A;  1O3T A;  1B9N A;  1YLF A;  1L3L A;  4QLC U;  3E97 A;  1J75 A;  1T98 A;  3JW4 A;  1YS6 A;  2FNA A;  1BC8 C;  4MHG A;  5K5Q A;  3W6J B;  2NYX A;  2OA4 A;  3I58 A;  3R0J A;  5DD8 A;  1BC7 C;  1ON1 A;  2CQK A;  3R6S A;  2KJB A;  3HRT A;  3E5U A;  3SXY A;  3TOA A;  3D5L A;  3T8R A;  1S3J A;  4KIB A;  3ECH A;  1FNN A;  1R36 A;  4K2E A;  1IN6 A;  4HDV A;  1FBQ A;  2KIF A;  2XIG A;  4LLL A;  3K0L A;  5FGM A;  1FC3 A;  3RYP A;  1U6G A;  2IJL A;  1OYI A;  5L3E A;  1U3E M;  3HUG A;  3PFI A;  3OV8 A;  2CW0 F;  2BBY A;  2HQN A;  4LK1 F;  2XUB A;  3KP7 A;  1OPC A;  1HKQ A;  2HWV A;  1TBX A;  3TQN A;  4G94 A;  1V4R A;  3NEU A;  1SFU A;  4A12 A;  3HOT A;  1OR7 A;  4OIQ F;  5IT9 K;  1D8J A;  4U7D A;  2VON A;  2PLY A;  1IW7 F;  2QWW A;  2CG4 A;  2P6T A;  4OMY A;  5ICF A;  3C18 A;  4WXC A;  2A6H F;  5EEG A;  2JSC A;  4L0Z B;  1ZAO A;  5K1Y A;  4WK8 F;  1DPR A;  2O61 A;  1OKR A;  3LA2 A;  4MNU A;  4EM1 A;  3WTW C;  1MZB A;  1W4M A;  5AIP A;  1J5Y A;  1ZAR A;  2IA0 A;  3ISP A;  3HIF A;  3VEP A;  2PEX A;  1YTY A;  3H3Z A;  1LDK B;  4CHU A;  1I1G A;  2XKO A;  1JGS A;  2X4H A;  3I4P A;  5LGN A;  2IA1 A;  3QAH A;  1MJB A;  3B73 A;  5ILU A;  3FZV A;  3V8J A;  3IRR A;  4AIH A;  1Z7U A;  2XRN A;  1PP7 U;  5J6X A;  4M9S A;  1ZRE A;  3FXR A;  2EFN A;  3R61 A;  3GUD A;  3I54 A;  3KP4 A;  5TRD A;  3MWM A;  4HV6 A;  1IZ1 A;  2K4J A;  1TTY A;  2O6G E;  3R4K A;  2A3S A;  4I0B A;  2PQ8 A;  1FP1 D;  3WGG A;  1I1S A;  3DV8 A;  2P4W A;  2KKO A;  3I59 A;  1H0M A;  5F64 A;  1VTN C;  2Y48 A;  3EET A;  4UV8 A;  2R7F A;  3FWE A;  1W7P A;  4KN7 X;  3O2P E;  2E7X A;  1KQ8 A;  3ERE D;  2LKP A;  1ZRF A;  2Z5U A;  2DQR A;  3GO5 A;  3QOP A;  2QBY B;  2YR2 A;  3WG9 A;  1UHW A;  4GGG A;  5AIQ A;  2GA2 A;  2L01 A;  3RKW A;  3IKV A;  3KZY A;  2DPD A;  1XGM A;  4Q4Z F;  5DDG A;  1FWZ A;  4ETS A;  4YG2 F;  3FM5 A;  4L9V A;  3ZPL A;  1ZRC A;  1R5H A;  4N0B A;  2V1D A;  2ZNY A;  1QBJ A;  4YII A;  2A68 F;  4BHC A;  4WF2 A;  1DDN A;  2PI0 A;  5F6F A;  2C6Y A;  1UHM A;  2V9V A;  1CF7 A;  5DUK A;  4BYY A;  4KMU X;  4TV7 A;  2EA4 A;  1FPQ A;  2EFW A;  1DUX C;  3E6M A;  1MJA A;  2YU3 A;  2RGV A;  2EFQ A;  1O7F A;  4FX0 A;  1MGT A;  1K7A A;  2X0L A;  2ZXJ A;  4HLY A;  4NHJ A;  3QRF F;  1O3R A;  3M9A A;  1JE8 A;  4U7B A;  4U0Y A;  3GLX A;  4KIF A;  3C7J A;  3S2W A;  1IN7 A;  1T39 A;  2ACJ A;  4LMY A;  3IKT A;  1FP2 A;  3MCZ A;  2L4A A;  2HZT A;  5FLX K;  3ULQ B;  4LG0 A;  2V1U A;  3I71 A;  1BOA A;  1IN8 A;  4I01 A;  1SD6 A;  3ABU A;  4ENJ A;  4G7Z F;  1U78 A;  2DO7 A;  2EJR A;  1YFH A;  2G9W A;  1IRG A;  1GXQ A;  4GXO A;  4IHT A;  1S29 A;  3DXJ F;  3QU3 A;  3GVA A;  1H9T A;  1XSV A;  3K1N A;  1R22 A;  4BXU A;  2RQP A;  1MDM A;  1O57 A;  2OZU A;  1UST A;  2ISY A;  5D8L B;  1R1V A;  1ZH5 A;  1BIB A;  5CLS A;  2FBH A;  2NRA C;  4BHP A;  5D8K B;  1IN5 A;  1HXD A;  4U0V A;  2CWE A;  5D4R A;  3EUH A;  2EB7 A;  1ZHF A;  4B8X A;  1EH7 A;  2MH9 A;  2CFX A;  4IJA A;  5F1R A;  3KP2 A;  3KLN A;  1E17 A;  1Z1D A;  1IRF A;  3WOD F;  5E1W A;  1KYZ A;  3T0Y A;  3N97 A;  3H92 A;  3WTX C;  5LGU A;  4NB5 A;  5E1X A;  3V7R A;  2FMY A;  2GZW A;  1Z9C A;  1I5Z A;  3JTH A;  5CVU A;  1LDJ A;  3JAM K;  1MKM A;  3JAM Z;  4YFN F;  2FRH A;  2JZY A;  4GYI A;  5BS6 A;  1FYM A;  4EJV A;  4G7O F;  1LEB A;  3GFI A;  5E17 F;  3HRS A;  2ADU A;  4JK1 X;  3TKY A;  4O6J A;  1YYV A;  4M6Y A;  2DQL A;  2NNY A;  2QM3 A;  1G3Y A;  2O8X A;  4A5N A;  3KE2 A;  5FFZ A;  5A2Q K;  1FSH A;  2BGC A;  1ODD A;  1KU7 A;  4WCG A;  1T0F A;  1WKM A;  1BBY A;  4PCQ A;  3HRM A;  2WV0 A;  1HW2 A;  4S05 A;  5K5O A;  4UNO A;  2XGX A;  5D4S A;  3ECO A;  2O0Y A;  1JHH A;  3COA C;  4M6X A;  1TNT A;  2DI3 A;  2P5K A;  2W25 A;  4RB1 A;  3HTU A;  1RUN A;  4RGR A;  1FOK A;  3FMS A;  2PFB A;  1B6A A;  1YG2 A;  1R1T A;  1BIA A;  3VFZ A;  2EA2 A;  1TQI A;  3LFK A;  3BY6 A;  3QP6 A;  5HVQ C;  5LEK A;  1E2X A;  3L7W A;  4P55 A;  1HBX G;  2IVM A;  4WXH A;  1F5T A;  4P9F A;  4U0W A;  5D6F A;  1AOY A;  1ON2 A;  4M9Z A;  1DP7 P;  1RUO A;  3RKY A;  4MEX F;  2BV6 A;  1B9M A;  2TDX A;  1GVJ A;  4IPA A;  4LG0 B;  5LGT A;  3RKX A;  4FT8 A;  3GFM A;  2Y0M A;  4ZYG A;  2GQQ A;  3J7A O;  1YO5 C;  2P8T A;  5D5V B;  2EFO A;  1R23 A;  3E3V A;  4XSZ F;  5ICG A;  2O3F A;  4EVI A;  4N9I A;  4MTD A;  3CJN A;  1J59 A;  2JPC A;  1P92 A;  4U88 A;  3J81 Z;  4A5M A;  1FYL A;  4EJO A;  3ZMZ A;  3CTA A;  4HF2 A;  3IC7 A;  3Q9V A;  3I0T A;  2HYF A;  2PG4 A;  2ZME B;  1I27 A;  1IAW A;  4AIK A;  3WTZ A;  4OIO F;  2H94 A;  3VOD A;  1ZYR F;  3SHF A;  1HW1 A;  3V7C A;  1S6L A;  2XAH A;  3F8B A;  3CDH A;  4LB5 A;  2FBK A;  3RDI A;  4O5V A;  4QWQ A;  2VBY A;  4A6D A;  2G7U A;  2OAZ A;  1AWC A;  5FB2 A;  3ZP5 A;  1GHC A;  3MEX A;  3M8F A;  2LSO A;  4FHT A;  3I64 A;  1QNT A;  2VOD A;  4DNC A;  2JT1 A;  2KIM A;  5L3G A;  1U8R A;  5JR3 A;  2WWY A;  4EGY A;  2EWN A;  4PZJ A;  3KEQ A;  2Y75 A;  3HYI A;  3MFK A;  2GWR A;  3GEZ A;  4XSX F;  1R1U A;  4R1H A;  4RS8 A;  4JQF A;  3KP5 A;  4HZF A;  5IT9 Z;  3K69 A;  3QP5 A;  4I2O A;  2CO5 A;  2DPU A;  2H6C A;  2HYG D;  4HW0 A;  3EYI A;  4KYW A;  4HBL A;  4IXA A;  4P5O A;  1QO0 D;  3LA7 A;  1OYY A;  3FX3 A;  2AS5 F;  3E6D A;  4KUM A;  2V79 A;  3GFJ A;  2IRF G;  1G4D A;  1XDU A;  1U5T A;  3SZP A;  5L3F A;  2NS0 A;  3ABT A;  4F7Z A;  3CO7 C;  2V1X A;  2UXX A;  2XKP A;  4ZZD A;  4LB6 B;  1ZN2 A;  3SQN A;  3CO6 C;  4P96 A;  1YQA A;  1JHF A;  2P7V B;  2Q0O A;  1L0O C;  2PN6 A;  2R3S A;  4KMF A;  4G7H F;  1HSJ A;  3ROU A;  3J80 K;  4BHB A;  1XSD A;  2HKO A;  1B59 A;  5AON A;  3SZT A;  3SFZ A;  4OIR F;  1MJ9 A;  3LAP A;  1SD4 A;  3PQK A;  2STW A;  4KIC A;  4PGG A;  2F5C A;  1J0R A;  3EYY A;  5JFR A;  1ONV A;  2HFH A;  1QZZ A;  5ILS A;  3T1B A;  4Z2Y A;  4G9Y A;  3O6B B;  3VOE A;  4UHT A;  4PGH A;  1WRJ A;  2GXG A;  2QVO A;  4MQ9 F;  2H27 A;  3RIR A;  3WTV C;  3TDU C;  5CVR A;  1YW9 A;  3BJA A;  3KET A;  1SMT A;  1QGP A;  4LFU A;  4GO1 A;  1O7L A;  4G6D A;  3PQJ A;  5H20 A;  3F6O A;  4AD9 A;  2XAF A;  3F8F A;  4LD5 A;  5DD4 A;  1XD7 A;  3REO A;  1Z91 A;  2EV5 A;  1K78 A;  4Q5S F;  2IW5 A;  2D2W A;  4M73 A;  5CVI A;  2L02 A;  3WGI A;  1FT9 A;  2M30 A;  1KU9 A;  5ED4 A;  2XAS A;  3EQL F;  4AWX B;  4Y17 A;  1LQ1 A;  3GX4 X;  5FFX A;  4L18 B;  4IRG A;  5KK1 A;  1LB2 A;  2ZNZ A;  4OIP F;  3BOQ A;  3F3X A;  5J8C A;  5E18 F;  2EV6 A;  1J2X A;  2DK8 A;  1LVA A;  3E5X A;  4Y15 A;  4HV5 A;  4HF0 A;  1QZY A;  1K6O A;  2O03 A;  1FSE A;  1EH6 A;  1V3F A;  1PDN C;  4BAY A;  5HS8 A;  4ZYE A;  3MZH A;  4ON0 A;  2G7H A;  3FXU A;  4HX4 A;  1XB4 A;  1X3U A;  3MQ0 A; 
#chains in the Genus database with same CATH topology
 3PSF A;  3E6B A;  1KGS A;  2NAZ A;  2XGC A;  1TWC J;  4MQV A;  1I6X A;  2ZSH B;  4ABZ A;  4M74 A;  4Q47 A;  3LSP A;  4KN4 X;  1USS A;  2MH2 A;  4IHY A;  2XGE A;  3O8G A;  4N9H A;  2WBM A;  1UFM A;  1U9O A;  2CSO A;  2HOS A;  2P7C B;  2XC7 A;  2WB1 N;  2GM4 A;  4Y13 A;  2BXY A;  5JI6 A;  4BDY A;  2OJE D;  1POG A;  5FLX Z;  1WJ5 A;  5EEH A;  3OR1 C;  1F4K A;  3H9Q A;  1TWH J;  2CYY A;  2VN2 A;  5LEJ A;  2OTJ I;  1ULY A;  1DPU A;  3WG7 H;  4PDK A;  2D1H A;  1FJL A;  4II2 A;  3M4O J;  1X3W B;  3VB2 A;  1S7A A;  5J8F A;  4ZYD A;  1T2K A;  2ETH A;  3HBL A;  2Y31 A;  3KZZ A;  1WJD A;  4ZDO A;  2FX0 A;  3F8N A;  4EJW A;  4HOB A;  4QSH A;  2Q2E A;  1SAN A;  4XKC A;  3QPL A;  3H5A A;  5CKT A;  1IV6 A;  2H8W A;  3HG9 A;  2PMH A;  2JK3 A;  2E7W A;  2VIX A;  3DPT A;  4FTH A;  1WH5 A;  3OYK A;  4UY8 I;  2VE9 A;  1DP3 A;  3HRU A;  3L00 A;  5DCF A;  4E4H A;  3L09 A;  2VJ4 A;  1LPQ A;  2IEK A;  1VF9 A;  2X85 A;  2Y2Z A;  1IG7 A;  1ZR2 A;  5FJ8 J;  3GTK J;  1X1P A;  1D0Y A;  4N4N B;  3RPU A;  2O9L A;  4JYK A;  1WJB A;  4CCL A;  1JTY A;  4RMN A;  3BRO A;  3DQV C;  4I0A A;  4RB2 C;  2OCE A;  1ZG5 A;  4ZYA A;  3E6C C;  1Z77 A;  3DWL E;  2NVY J;  1BN5 A;  1A04 A;  1WPK A;  5CYV A;  4IX7 A;  3DKW A;  3CCS I;  2STT A;  4IQ4 A;  4A0Y A;  4CXF A;  1IN4 A;  3GBG A;  2BY0 A;  1I3Q J;  3ZQ7 A;  3OYF A;  1TW3 A;  1ZLK A;  2OV7 A;  4ZTJ A;  3ELK A;  4HLX A;  3RJP A;  5DS9 A;  2V4J C;  4MEY F;  1BI3 A;  1F1Z A;  1Z6R A;  1T0F C;  2HU9 A;  2QYO A;  4E70 A;  1LNW A;  3AFH A;  3FKJ A;  3HKZ A;  2LF7 A;  4B1R A;  5EZG A;  4H0E A;  4E7S A;  1D0X A;  3CMM A;  1RI7 A;  4I76 A;  2FQ4 A;  3HPH A;  3O8H A;  3MZ8 A;  5DM6 F;  2A5Y B;  4M6V A;  3NQO A;  2DLL A;  2IA2 A;  3WTS C;  3K1P A;  2Z16 A;  1LE8 A;  1BI0 A;  1PUF B;  1H89 C;  1KQ9 A;  2HPM A;  3A2K A;  2F5F A;  4AYB N;  3JRD A;  2OTL I;  2GIV A;  1Z21 A;  1ETW A;  3TMO A;  3OL4 A;  2XAQ A;  3LA3 A;  2HQR A;  1XTA A;  1KYW A;  3I59 B;  3HOS A;  2DYS H;  2X6Y A;  1D8K A;  2YX7 A;  3CP8 A;  4G6T B;  4I98 B;  1W7P B;  5IPA A;  5HS7 A;  3K1M A;  1WHU A;  1QQI A;  3IL2 A;  5ICE A;  4XRS G;  2HI3 A;  4A69 C;  2ID6 A;  1R49 A;  2IT0 A;  2CV2 A;  4Q48 A;  3NAU A;  1FIA A;  2P6S A;  3OS1 A;  4QPQ A;  1QPI A;  3L2C A;  2RN7 A;  4BEH A;  3H1C A;  2QEX I;  4CGZ A;  1B1B A;  3FMR A;  2F48 A;  2FE3 A;  2ESN A;  3ML6 A;  4OOI A;  2MBF A;  1VZ0 A;  3S16 J;  2HOT A;  5F27 A;  1W36 C;  2EIN H;  2LY2 A;  1ZQ3 P;  3S1R J;  2L9N A;  2VT2 A;  1HDP A;  4HPQ A;  1W1W E;  3ZQL A;  5D5W B;  1K83 J;  4XLP F;  4KA4 A;  3TOB A;  1J7K A;  2M0C A;  3BDD A;  3IH3 A;  1S9H A;  4ENN A;  2VE8 A;  1SFE A;  2UZK A;  1YS7 A;  4CCO A;  2Z9O A;  3OOU A;  1X1C A;  2Y0S A;  3FXM A;  2UXN A;  2O7O A;  2K9L A;  3FHZ A;  2DFI A;  3V8L A;  3WTT C;  1RR8 C;  2W84 A;  4B43 A;  3TGN A;  1A5J A;  2ZFW A;  1BR2 A;  1APL C;  5FLM J;  1REP C;  1XCV A;  1FY7 A;  5A2Q Z;  2CGP A;  3BTI A;  3BR1 A;  3CUQ A;  3BTJ A;  2WTE A;  1J9I A;  3G1L A;  4MTE A;  1VQO I;  2VQC A;  3OYG A;  2VI6 A;  1G3W A;  3R0A A;  4A6E A;  1BR4 A;  3G73 A;  3EDP A;  3K4B A;  3A01 B;  2KIS A;  3HSE A;  3M1E A;  2QUF A;  4LLG F;  2DK5 A;  2XRO A;  1HST A;  2R93 J;  1CF7 B;  2DT5 A;  1BI1 A;  2TRT A;  1Y1V J;  1FZP B;  4ZYH A;  4L9J A;  2Y9Z A;  4FX4 A;  5H6Q A;  2OQR A;  3OIQ A;  1GXP A;  3ZCO A;  1LFU P;  1A36 A;  1X4O A;  3J7Y J;  3DLL F;  3OOP A;  3LFU A;  4RB3 C;  4OIN F;  2HKX A;  4MGR A;  4AC0 A;  2EZH A;  4IRH A;  3GW2 A;  4IHS A;  3PL8 A;  2LY1 A;  3F21 A;  5D5U B;  1O3Q A;  2MD5 A;  1R7J A;  2EIK H;  1JKO C;  2HOE A;  2LKS A;  3Q9S A;  2MA3 A;  3KYD B;  4P1W A;  2Z33 A;  3ZMT A;  3RYR A;  2MSY A;  1FEX A;  3TO6 A;  2DA7 A;  2NNN A;  3BQZ A;  1P7J A;  4JBA A;  4XLH A;  4YIF A;  1R4N B;  2M7A A;  2KDO A;  1E3H A;  3H0D A;  3RQI A;  9ANT A;  1MMS A;  1MBG A;  2IS2 A;  1H9G A;  4L5J A;  4V2F A;  4BQQ A;  2JJ7 A;  3P7N A;  4AU7 A;  4EV0 A;  5HOO A;  3HHH A;  2QGU A;  3CDI A;  3K10 A;  4HA8 A;  5FKL A;  1VQ9 I;  4FAS D;  4HX8 A;  3C3W A;  2R5Y B;  4RAY A;  4RGX A;  2HTS A;  2LDU A;  3IH4 A;  1S7O A;  1D5V A;  1BW6 A;  3ZR8 X;  3CMY A;  3HL2 A;  1WCM J;  2JRT A;  4CCJ A;  4XBF A;  1W5T A;  2DFH A;  1OLT A;  2DOE A;  2ZCW A;  4BXF A;  2YSR A;  3B6C A;  4XON A;  4KT5 C;  4RGU A;  1O3S A;  2Q2E B;  3DBH B;  2ZKZ A;  3SZG A;  4R8H A;  3CJT B;  4DGW B;  2QF7 A;  3FIS A;  1JKP C;  3GXO A;  1F9N A;  2V9K A;  1S72 I;  1ZTR A;  2DMT A;  3L2R A;  4XLF A;  3CF2 A;  3SEQ A;  2N8G A;  3M7G A;  1X1D A;  4FQG A;  3LQQ A;  2EV0 A;  2KRF A;  4EEF G;  3JSP A;  1IGN A;  3HOZ J;  1FBS A;  3PIO F;  2OBP A;  5HLT A;  3CME I;  5B66 C;  2ZO4 A;  1TWG J;  5LHH A;  1G3T A;  1SAU A;  2VKH A;  3KYC B;  3WU1 B;  1MDM B;  1SAX A;  2EPF A;  2JA5 J;  2KHM A;  1P4X A;  4EJU A;  3TW7 A;  3ZN1 A;  3H36 A;  2YU9 J;  3A02 A;  2KPM A;  2MLG A;  3BTL A;  1FMW A;  2QBY A;  4ESF A;  5FO5 A;  2W7N A;  1ZGJ A;  4XK4 A;  1U5T C;  3ZQG A;  5D6E A;  1OIS A;  5EDN A;  1G3S A;  3CC7 I;  1X2N A;  1HQC A;  1VI0 A;  2MYS A;  2F5E A;  1MW7 A;  3P9C A;  3CCV I;  6PAX A;  1WQ2 A;  2QQA A;  1T6S A;  4ZZL A;  4PJ0 C;  2VOO A;  3OWT A;  3FBI B;  4PJN A;  3VYU B;  5HLH A;  4BE2 A;  2EIL H;  3U21 A;  3KYL A;  1FLI A;  2Y0S N;  2E1M C;  2RC4 A;  3QPT A;  2BOL A;  2LVS A;  1VFC A;  1SFX A;  3BJ6 A;  2IPQ X;  1Z67 A;  2ZB9 A;  4M9X A;  3IHU A;  3ABM H;  3HOW J;  3BPX A;  1HKS A;  1SVM A;  4HNV A;  1Z6T A;  2W1O A;  4KNY A;  1FOX A;  3DPL C;  4XRS A;  1QU3 A;  1ENH A;  1M1E B;  2PX9 A;  1ZEL A;  2Q8K A;  3GTJ J;  3CCJ I;  4WWC A;  5LLQ A;  1R00 A;  3OYL A;  2LTP A;  3HTS B;  4HNT A;  2GIZ A;  2JVH A;  2KZV A;  4HAM A;  4A3E J;  2CUE A;  3CJR B;  2VC1 A;  5LBQ A;  2NXN B;  4I02 A;  1LJ9 A;  1GV2 A;  2B9S A;  3DEU A;  3ABL H;  3D5R C;  1UHS A;  3OR2 C;  4UVA A;  2DU9 A;  1RNL A;  5IY5 H;  2XHK A;  3TO9 A;  1SVO A;  2JUG A;  3AG4 H;  2VPR A;  2YPR A;  4YEJ A;  5DUI A;  3LST A;  5HDG A;  2Z99 A;  2JQ7 A;  2CMP A;  2YS9 A;  3HOV J;  1FYK A;  1PP8 F;  5CVJ A;  2P81 A;  3VSL A;  3HDD A;  3N05 A;  1VQP I;  3TP3 A;  1IF1 A;  2E5Z A;  2YUS A;  3ZMU A;  3CF5 F;  1UJ8 A;  3HSF A;  2QA4 I;  2M45 A;  2A61 A;  4UV9 A;  3QQA A;  5C4J J;  2RRE A;  4IVN A;  1HKT A;  3MKW B;  2NVQ J;  2K4B A;  4AVP A;  2AHQ A;  1YHQ I;  2M2E A;  3T8T A;  4F93 B;  2HEO A;  5LD2 C;  3CUQ B;  5M5Y J;  4A3C J;  1SMY F;  4KDP A;  4IO9 F;  3ZN0 A;  3U2R A;  3OIP A;  1W5S A;  3F8M A;  3KFW X;  3IUO A;  5IP7 J;  3S3N A;  2OZ6 A;  5E1Z B;  1KON A;  3V7S A;  3BR2 A;  3Q0U A;  3K70 C;  2L4M A;  3OY9 A;  2HPI A;  1F36 A;  5J47 A;  5BQT A;  3ZMD A;  1OMI A;  1V5E A;  4CYC B;  3CCE I;  4B09 A;  4XRF A;  2JPB A;  3W2W A;  1AKH B;  4BE0 A;  4D0P A;  2E1N A;  1H8A C;  3LL7 A;  2DTR A;  3RTR A;  3GCM A;  3LSH A;  1R4M B;  2K02 A;  3BJO A;  3BQY A;  5JHU A;  2PJP A;  3S93 A;  1Q1H A;  3K9T A;  2K5C A;  3F6V A;  3SDB A;  1MD0 A;  2MAB A;  2LNB A;  3RPQ A;  5DCM A;  1IXC A;  2R7O A;  1MBH A;  1EV7 A;  3J80 Z;  5EGO A;  4CO8 A;  5EG0 B;  3Q3S A;  4C2T A;  3FXO A;  2LRD A;  2DBB A;  4RAZ A;  2UWM A;  1YW7 A;  5BMZ A;  1UAA A;  3A03 A;  1LUJ B;  3BG3 A;  5IYC J;  2KIQ A;  3GF2 A;  3GYH X;  5J1U A;  4KIT B;  3OYJ A;  4Y3O A;  1RZ4 A;  4UVC A;  2B63 J;  4R79 A;  5B3S H;  3M07 A;  4BH9 A;  4RAG A;  2RDP A;  3D1N I;  1BA5 A;  5LRR A;  5ILV A;  2LOO A;  1WJA A;  4Y4R A;  5LHG A;  4F55 A;  3M8J A;  1JT6 A;  2W00 A;  4ZC3 A;  2FQ3 A;  5GAE J;  2QZ8 A;  4WXD A;  2VBX A;  1FX7 A;  4P9U A;  4BGD A;  1OFC X;  5DEQ A;  3I5U A;  3BPV A;  2K27 A;  3KP3 A;  4A3K J;  1VQM I;  3S2D J;  3V8K A;  2DAO A;  2Q1Z B;  4DYC A;  5KAF C;  3PJR A;  2QEN A;  2DN0 A;  2W85 A;  4CDG A;  5HNH A;  4C3J J;  4KFC A;  3DKX A;  3IWF A;  4MFE A;  3PM1 A;  1DGR M;  1D3Y A;  3EUA A;  1YE9 A;  2XF6 A;  1MH3 A;  2DDA A;  2A07 F;  2IS4 A;  3DFG A;  4HQM A;  3AKZ A;  2VC0 A;  3GTM J;  4I7H A;  1SD7 A;  2IBD A;  3KLO A;  4LIU A;  2LYC A;  4XLC A;  1K79 A;  4M72 A;  3VPR A;  2M4K A;  1XCB A;  2X1E A;  2COM A;  4G12 A;  2M1B A;  1ZLJ A;  1PJR A;  2QQ9 A;  3I3L A;  1WSU A;  4CZZ A;  2EIM H;  5CJ9 A;  5B1B H;  3TDZ C;  5HDK A;  3VYS B;  5L3B A;  1YJ9 I;  4ESJ A;  1UG2 A;  2FOK A;  3O3K A;  3CCR I;  1YW8 A;  2EZI A;  2VBZ A;  5J1Y A;  1S8N A;  1XMK A;  1P4W A;  5M5W J;  1VQ5 I;  3FF5 A;  4DOZ A;  5M3M J;  1E3O C;  1IXR C;  3CCU I;  2RNJ A;  3MN2 A;  1TLH B;  4GCV A;  2FXA A;  4RLF A;  2Y69 H;  2R7T A;  4CCM A;  1BW5 A;  2IGO A;  1JUS A;  1WZ2 A;  4BY1 J;  1R58 A;  4ASN A;  1Z05 A;  2VKE A;  3K6G A;  2PJR B;  4HYE A;  1DU0 A;  3KCC A;  2GA1 A;  3CZ6 A;  3FXL A;  1XN7 A;  5H6R A;  3PSI A;  4ENK A;  4XLN F;  4ZJZ A;  2JUC A;  1TC3 C;  2WAQ N;  1LEA A;  3FXQ A;  3OYH A;  2D1V A;  1YRN B;  2K7L A;  1YIO A;  2WC2 A;  2B0L A;  1A6Q A;  1P6R A;  1AHD P;  2GAU A;  3KPH A;  2R7W A;  4HF1 A;  4ENM A;  3N4M A;  2DJI A;  1ZR4 A;  4J19 A;  4RM3 A;  3S14 J;  2KP6 A;  2VQG A;  4HNU A;  4IRI A;  2LFB A;  2CFO A;  4IQJ A;  2VPL A;  1IO2 A;  4W1U A;  2BHY A;  3D0S A;  1XSX A;  2I10 A;  2W24 A;  4RB0 A;  4ESB A;  4EGZ A;  2PMZ A;  4M3E A;  3HGG A;  4CA0 A;  1XMA A;  2OQG A;  1ZGA A;  3LQR A;  3GFL A;  5IT3 A;  1GLN A;  3CLO A;  3TL4 X;  2E35 A;  5EYR A;  4M3F A;  4XM3 A;  4PJM A;  4B44 A;  2OD5 A;  1NHA A;  3JRF A;  1QPM A;  1PYV A;  5DV5 A;  1MSF C;  4IF4 A;  3JSO A;  1JT0 A;  3B02 A;  3S1M J;  1K6Y A;  3A0B C;  3HPG A;  5L3C A;  5ERI A;  3KX2 A;  2VUM J;  3OYC A;  3BP8 A;  4AIJ A;  1BM9 A;  5E3N A;  3G71 I;  1JXS A;  2XAU A;  4A0Z A;  2QLZ A;  3HXL A;  3IRQ A;  2M8E A;  2BE5 F;  2EFP A;  4GYG A;  3PUB A;  1FMV A;  1U0J A;  2FEZ A;  4BDZ A;  3JRG A;  4BQO A;  3LSJ A;  1YX5 A;  5GTI C;  2X48 A;  3GZ6 A;  3VDX A;  2HYJ A;  3MAJ A;  3PUF A;  1VQ4 I;  2JSP A;  4XL9 A;  2IGK A;  3CMA I;  2NVT J;  1OJL A;  2WA0 A;  1U5T B;  1WI9 A;  1STZ A;  3BG6 A;  3IWZ A;  3QPH A;  4A0X A;  5HLI A;  2W48 A;  4LLN A;  2FNP A;  3GZ5 A;  1WVR A;  2VXZ A;  5CPR B;  5GP9 A;  3DF8 A;  5HLG A;  2F2E A;  5BPI A;  4AM3 A;  3S8P A;  1YJN I;  3UKG A;  5FRM A;  5LHI A;  4L5E A;  2ZXH A;  1WWX A;  5DYM A;  4BAC A;  1DGW Y;  2VB6 A;  3S15 J;  2HGC A;  3HOU J;  3ZRG A;  3JRH A;  2VJI A;  2E1M B;  2L7K A;  2V6C A;  2VT3 A;  2ZXW H;  4BQN A;  1ERD A;  2XAJ A;  1XS9 A;  1XDS A;  3FM3 A;  2L9V A;  3OYN A;  4LK0 F;  2LH9 A;  2BHZ A;  3QU6 A;  3JTG A;  4E7J A;  4D5C A;  1Z3X A;  4AUX A;  3C1D A;  1BOB A;  5LRS A;  1SD5 A;  3H3U A;  5DCM B;  1RPW A;  4F3Q A;  1LDD A;  1IXS B;  1FOW A;  3KEO A;  3F9K A;  3MKL A;  3WE3 A;  4CZC A;  2E1C A;  2ZJ2 A;  2Z1D A;  5E3O A;  1FBU A;  1R5G A;  4L0Y B;  2O5R A;  4ZH4 F;  3BWG A;  1E3P A;  5M5X J;  4YFK F;  1YIT I;  4L9T A;  1RET A;  1T38 A;  4UXN A;  1R71 A;  2UV1 A;  2OU2 A;  2DMU A;  2RKH A;  2J5P A;  5D5X B;  3OYM A;  1MIJ A;  2MC4 A;  3CUQ C;  3DEW A;  1W7P D;  3U9G A;  4WX9 A;  2FF4 A;  3MZY A;  2ZME A;  3V4G A;  4BKX A;  2QSH X;  1KA8 A;  4UUV A;  3ONQ A;  4O3M A;  5FD5 A;  1EJ9 A;  3BZ6 A;  4LGW A;  3CES A;  1PUE E;  1OCR H;  2YX4 A;  2FBI A;  1B4A A;  5J40 A;  4BQA A;  1U9N A;  2K86 A;  2H09 A;  3F72 A;  2HDD A;  4DQ2 A;  2HXI A;  5GAD J;  4A3I J;  1VQ6 I;  2A05 A;  4CCN A;  5E8I A;  3S1N J;  3GZN B;  2HTJ A;  4KIS A;  1XGO A;  4HSR A;  4BBS J;  1Y39 A;  1JUM A;  2V9P A;  1N78 A;  3HC7 A;  3P9K A;  3M8E A;  4D7N A;  1ETX A;  5L3D A;  2HXO A;  2HDC A;  1P4A A;  4F91 B;  2VOP A;  5KHD A;  4A2U A;  4YFX F;  2JTV A;  2MLK A;  4FE4 A;  1JGG A;  2K3F A;  2CRG A;  2ZBK A;  4JX6 A;  1KQ0 A;  5B1A H;  2D45 A;  1D1B A;  3WTU C;  2FOW A;  4I09 A;  2HS5 A;  2UUZ A;  2FA5 A;  2K9M A;  1B72 B;  3W2A A;  3T5X A;  3MKY B;  5GAG J;  2ZJP F;  2DFE A;  2VBW A;  5JVT A;  3WGH A;  2X9D A;  2QQB A;  1XGS A;  1Y0N A;  3ZMV A;  3WU0 A;  3WHB A;  2PMZ N;  5J4V A;  1K78 B;  4QPO A;  2RVC A;  5HDN A;  1WFX A;  2MC3 A;  3OYA A;  4EJT A;  5IOZ A;  1Y0U A;  1TQP A;  4UUS A;  3CCL I;  3K4K A;  2IP2 A;  5E8G A;  2FML A;  2XVC A;  3F23 A;  2BYV E;  5FD6 A;  3AL0 C;  3V42 A;  1OCO H;  3JRB A;  3DCF A;  2EK5 A;  4MO7 A;  2K9N A;  4L5I A;  4GRI A;  4UVB A;  1MMN A;  3JR9 A;  3CP2 A;  2L54 A;  3WHC A;  3L1P A;  2R7D A;  4IKF A;  5K5R A;  3CUO A;  2MFZ A;  2RNG A;  1TQM A;  3U1D A;  1V5G A;  4L9N A;  2P5V A;  3NRV A;  1KU3 A;  2LF8 A;  1VQN I;  3RI4 A;  3Q5F A;  2FSW A;  4EQQ A;  5KVR A;  4G8X A;  3W6K B;  3HSR A;  2W57 A;  1D1A A;  1I50 J;  1RR7 A;  2OF7 A;  2RV8 A;  4CUG A;  2Z3Y A;  2LC2 A;  5E20 A;  3LAJ A;  3FMQ A;  2XSJ C;  5CVV A;  3OIO A;  1R5I D;  4M71 A;  3HOX J;  1EA3 A;  1ETY A;  2ISZ A;  3TO7 A;  1HW5 A;  1Q1V A;  4EM2 A;  2LR8 A;  4NDL A;  2IS6 A;  2ELH A;  5ICC A;  1OYW A;  3ASN H;  4NQW A;  2BY1 A;  2ESH A;  4PFP A;  2GXB A;  4S04 A;  3E5Q A;  3SDG A;  1LKX A;  1XG1 A;  1ETQ A;  4KIG A;  5KCM A;  2BEO A;  2L3D A;  3DP7 A;  1BJA A;  3QYE A;  1V54 H;  1T56 A;  2M5W A;  3A0H C;  3L9F A;  4EM0 B;  1TNS A;  2PBI A;  3F8C A;  4YEL A;  1BI2 A;  4RGS A;  2M87 A;  4HST A;  4YRV A;  1P2F A;  3RKQ A;  3SJM A;  1IUY A;  3FXJ A;  3AG2 H;  2E71 A;  2A6E F;  3I55 I;  1U2W A;  1UCR A;  5HS9 A;  2P5L C;  4XKB A;  5TJJ A;  2DA6 A;  2F6C A;  2ZSI B;  3K2Z A;  3OYB A;  3GTQ J;  1QHG A;  3G3Z A;  3QOE A;  3I53 A;  3S32 A;  2HR3 A;  5BPD A;  3VWB A;  2DYR H;  2WY8 Q;  3WTY C;  3HHG A;  4OU0 A;  4OMZ A;  1KU2 A;  5B5E C;  3E0J B;  4IOA F;  3IH2 A;  4CIC A;  1G6N A;  1JTX A;  2PMU A;  2XV4 S;  2DW4 A;  4E7L A;  2H1L A;  2H6B A;  2XDV A;  4XN0 A;  3DBL B;  5DTD A;  2HZD A;  4LJZ F;  4CYD A;  2FU4 A;  4NBQ A;  2AXL A;  4IEJ A;  3WE2 A;  2M0M A;  4B47 A;  4HQE A;  4HX7 A;  1IUF A;  2KIU A;  4W97 A;  4EMS A;  1UB9 A;  3AAF A;  3DU6 A;  3ZMS A;  1JJ6 C;  5BOX A;  2CV1 A;  1RC9 A;  5GTH C;  2ZC2 A;  1YJW I;  2J5O A;  3QPS A;  2R7X A;  1ZG3 A;  1EH8 A;  3R60 A;  2XAG A;  3KP6 A;  2DT7 B;  2EIJ H;  4BBR J;  2KJC A;  1YIJ I;  1C0W A;  1TT5 B;  2MD0 A;  2LK2 A;  3BCB A;  1NK2 P;  3P9I A;  2A69 F;  3DTE A;  3GWZ A;  2R5Z A;  1GDT A;  1TW2 A;  1G2H A;  3LWF A;  2L7Z A;  1VQ8 I;  1RIO H;  5EF6 A;  1ZRD A;  4HDU A;  4DBR A;  4BNC A;  3F22 A;  2VQL A;  4G6Q A;  2F5D A;  1N77 A;  2MG4 A;  3J81 K;  1XGN A;  1CGP A;  3CCY A;  1ZG1 A;  3HOY J;  1O3T A;  1QA6 A;  1B9N A;  1YLF A;  4B3X A;  1L3L A;  4QLC U;  3E97 A;  1J75 A;  1T98 A;  3JW4 A;  1YS6 A;  2FNA A;  2JMW A;  1BC8 C;  4MHG A;  5K5Q A;  3JRI A;  1BL0 A;  1MMD A;  3W6J B;  2NYX A;  2OA4 A;  2R7Q A;  3I58 A;  3R0J A;  3DBR B;  4XR6 A;  3RCO A;  1LVK A;  5DD8 A;  1RRJ A;  1BC7 C;  3G1M A;  5FRN A;  1ON1 A;  2CQK A;  2ICW G;  5EEA A;  2OUM A;  1JKQ C;  1AA7 A;  3R6S A;  2DCE A;  1LE8 B;  5M3F J;  2KJB A;  3HRT A;  3LSI A;  3X2Q H;  3QYF A;  3E5U A;  3SXY A;  3TOA A;  3TW6 A;  3D5L A;  1NK3 P;  3T8R A;  2DA1 A;  4HRI A;  2KFD A;  3ZOB A;  1S3J A;  4KIB A;  3ECH A;  1FNN A;  1R36 A;  4K2E A;  1IN6 A;  4HDV A;  5FRO A;  1DU6 A;  1FBQ A;  2KIF A;  2XIG A;  5E3L A;  3J7A Y;  4X1E A;  4LLL A;  3K0L A;  4XKW A;  2KQR A;  5FGM A;  2CJJ A;  1FC3 A;  3RYP A;  1U6G A;  2IJL A;  4D5F A;  1OYI A;  5L3E A;  2CH0 A;  4BEH B;  3OSF A;  2H8R A;  4PUS A;  1U3E M;  3HUG A;  4NUB A;  3PFI A;  1IRX A;  3OV8 A;  1I3A A;  2CW0 F;  2BBY A;  3FK7 A;  4XIC A;  2HQN A;  3C2B A;  2WAQ A;  3FKI J;  4LK1 F;  2XUB A;  5HOD A;  3KP7 A;  1OPC A;  3HM5 A;  2W82 A;  1HKQ A;  3CJQ B;  2HWV A;  1TBX A;  3IAS 2;  2LD5 A;  1W5C C;  3TQN A;  4G94 A;  1V4R A;  3DTK A;  4LG3 A;  3CD6 I;  3NEU A;  3LSM A;  2L9R A;  1SFU A;  4A12 A;  3HOT A;  1OR7 A;  1S5L C;  4AID A;  3S2H J;  4OIQ F;  5IT9 K;  5J4Y A;  1MBF A;  3CC4 I;  3I4M J;  1D8J A;  3H35 A;  2KL4 A;  4U7D A;  2VON A;  3BR3 A;  2PLY A;  5TIS C;  1IW7 F;  2QWW A;  2KDZ A;  2CG4 A;  2WAD A;  2P6T A;  2LBF A;  4OMY A;  5J3L A;  2ME6 A;  1VND A;  1RKW A;  1X1B A;  5ICF A;  2Y30 A;  3C18 A;  3QOD A;  4WXC A;  2A6H F;  5EEG A;  2JSC A;  4X0G A;  2ZJQ F;  1ZAO A;  5K1Y A;  4BS9 A;  1W36 D;  4L0Z B;  4WK8 F;  2E2I J;  1ITY A;  5FLV A;  1DPR A;  1J09 A;  2L9S A;  2O61 A;  1OKR A;  3LA2 A;  4MNU A;  3HZJ A;  4EM1 A;  4XLE A;  3ZQC A;  3WTW C;  1MZB A;  1W4M A;  5AIP A;  1J5Y A;  2VKV A;  4DW6 A;  4LIV A;  1ZAR A;  3TED A;  1WH7 A;  3MKZ A;  2IA0 A;  3ISP A;  3HIF A;  1MBJ A;  4PSW A;  3TP0 A;  3VEP A;  3LMM A;  3VYT B;  4C3H J;  5F1J A;  2R92 J;  2I8D A;  2PEX A;  1YTY A;  3H3Z A;  2G0E A;  1SC7 A;  1LDK B;  4CHU A;  1I1G A;  2XKO A;  1JGS A;  2NVU B;  2L7F P;  2X4H A;  3I4P A;  5LGN A;  2IA1 A;  3QAH A;  1MJB A;  1FOY A;  3B73 A;  5ILU A;  2X6W A;  3FZV A;  1EF4 A;  2E5N A;  3V8J A;  3IRR A;  2NVX J;  4AIH A;  1Z7U A;  3EPZ A;  3ESW B;  2XRN A;  4I99 C;  1P7I A;  1PP7 U;  1S7E A;  4BJT A;  4C30 A;  3UR3 C;  3BCA A;  2GBY A;  1MSE C;  5J6X A;  2CUF A;  4M9S A;  1ZRE A;  3FXR A;  2EFN A;  2L7M P;  3R61 A;  1TL8 A;  1VQL I;  3Q0W A;  3AL0 B;  2CS3 A;  2DTZ A;  4BXX J;  5LFA A;  2D5V A;  3GUD A;  3I54 A;  3KP4 A;  1D0Z A;  5TRD A;  3MWM A;  4HV6 A;  1IZ1 A;  2K4J A;  1V55 H;  1ZGW A;  1UMQ A;  1LFB A;  1TTY A;  3K7A J;  4IL6 C;  2O6G E;  3R4K A;  2F4O B;  1NG6 A;  2A3S A;  2QCO A;  5GPA A;  4I0B A;  4BY7 J;  2PQ8 A;  1FP1 D;  3RZD J;  3EUK L;  1Z0X A;  1PUF A;  2K3P A;  3M3Y J;  3WGG A;  2BZT A;  1Y6I A;  1I1S A;  3DV8 A;  3E1S A;  2P4W A;  2KKO A;  3I59 A;  1H0M A;  5F64 A;  1VTN C;  2Y48 A;  3EET A;  3IAM 2;  4UV8 A;  2R7F A;  3A4C A;  3FWE A;  1W7P A;  1ZK8 A;  2RQQ A;  4KN7 X;  2HDW A;  4D9J A;  3O2P E;  4BUP A;  2E7X A;  3BZK A;  1NTC A;  1CQT A;  1KQ8 A;  2IXS A;  4PJL A;  3ERE D;  3KEY A;  1KZH A;  2LKP A;  1ZRF A;  2Z5U A;  1X19 A;  2DQR A;  3GO5 A;  3QOP A;  2QBY B;  2YR2 A;  3PNV A;  3BTC A;  3WG9 A;  1UHW A;  4GDF A;  2ME0 A;  4A3F J;  2L0K A;  3BG5 A;  2BW3 A;  4RLQ A;  4GGG A;  5AIQ A;  5K7F A;  2GA2 A;  2L01 A;  3RKW A;  1TWF J;  3IKV A;  3TBI A;  3JRC A;  3KZY A;  3S3M A;  2X6X A;  2DPD A;  4A3J J;  1XGM A;  1MMA A;  4Q4Z F;  2CW7 A;  1TT0 A;  5DDG A;  2ELJ A;  2XPU A;  1FWZ A;  1T95 A;  2DMQ A;  2JA2 A;  2DA3 A;  4ETS A;  4YG2 F;  3H5N A;  3FM5 A;  4A93 J;  4L9V A;  4CCK A;  3ZPL A;  2M8G X;  1ZRC A;  1X4P A;  1R5H A;  4N0B A;  4U87 A;  2V1D A;  5FKM A;  2ZNY A;  2BXZ A;  1QBJ A;  1X58 A;  4JOM A;  4YII A;  2A68 F;  4OAZ A;  4BHC A;  4WF2 A;  1DDN A;  2PI0 A;  3LOC A;  2R0Q C;  3JRE A;  3A1Y A;  5F6F A;  1WJE A;  1F43 A;  4B4C A;  4BJ5 C;  1R9T J;  2X1D A;  2C6Y A;  3I56 I;  3A01 A;  2XSD C;  1UHM A;  2HVQ A;  3S1Q J;  4YIR X;  4M3G A;  2E19 A;  2HOA A;  2V9V A;  1CF7 A;  2O8K A;  5DUK A;  4BYY A;  4X6A J;  2ID3 A;  2DXI A;  4KMU X;  4TV7 A;  3GTG J;  1XX5 A;  2EA4 A;  1FPQ A;  2EFW A;  5GPC A;  2GOX B;  1DUX C;  2Z2S B;  1YX3 A;  3E6M A;  3MVP A;  5E79 C;  2ZME C;  1MJA A;  2BVL A;  2DT6 A;  2YU3 A;  3HUG B;  3FIW A;  2X51 A;  2RGV A;  2EFQ A;  1O7F A;  4UB8 C;  2KLO A;  4FX0 A;  1PVE A;  1U8B A;  1MGT A;  2HVS A;  2JWT A;  1O4X A;  1K7A A;  3DEE A;  4FIS A;  3VYR B;  4B48 A;  3BLY A;  2X0L A;  2ZXJ A;  4HLY A;  2E2H J;  4NHJ A;  2ZXI A;  3QRF F;  4DYR A;  1O3R A;  2V6E A;  3M9A A;  3OMY A;  2DA5 A;  1JE8 A;  4U7B A;  4U0Y A;  3GLX A;  2ZJR F;  4KIF A;  3C7J A;  3S2W A;  1IN7 A;  2ELK A;  2ACJ A;  1T39 A;  2CQN A;  4EAT A;  4CSW A;  4LMY A;  4XQF A;  3IKT A;  1FP2 A;  2DMP A;  1FIP A;  3MCZ A;  2L4A A;  2VQH A;  2LBF B;  1TP4 A;  2HZT A;  5FLX K;  3ULQ B;  3FHN A;  4LG0 A;  2R5Y A;  3CC2 I;  1ETO A;  2V1U A;  3I71 A;  1BOA A;  4GFB A;  3ZQI A;  1IN8 A;  3B6A A;  4I01 A;  1SD6 A;  3ABU A;  4ENJ A;  4G7Z F;  2AQE A;  1MBK A;  5IYD J;  4KT6 A;  2JRM A;  2Y9Y A;  1U78 A;  1HCR A;  2DO7 A;  2EJR A;  3KZI C;  4JX4 A;  4DYQ A;  1YFH A;  2G9W A;  1IRG A;  4XOP A;  3PFY A;  4PFO A;  1GXQ A;  4GXO A;  2LKX A;  5EGO B;  5F0F A;  2KRC A;  3NWT A;  4IHT A;  1A6I A;  1B8I A;  1S29 A;  3DXJ F;  3QU3 A;  3GVA A;  3BR6 A;  4II3 A;  4BL0 B;  1H9T A;  2GOM A;  5IP6 A;  5FKN A;  1XSV A;  2P0W A;  4E7K A;  3K1N A;  1R22 A;  4V2G A;  2V7F A;  4BXU A;  3LNQ A;  1UEL B;  2RQP A;  3K70 D;  1MDM A;  3PNY A;  1O57 A;  2VXD A;  2XPV A;  2OZU A;  3OL3 A;  2JVG A;  4UB6 C;  4IHV A;  1UST A;  2ISY A;  5D8L B;  1R1V A;  1ZH5 A;  1BIB A;  5CLS A;  3HGY A;  2FBH A;  2NRA C;  1IDY A;  1FTZ A;  2M9H A;  4BHP A;  5D8K B;  1IN5 A;  1HXD A;  4U0V A;  2CWE A;  4XNF A;  5D4R A;  3EUH A;  2EB7 A;  4H4K C;  2CUZ A;  3OYE A;  1ZHF A;  1G8X A;  4B8X A;  1EH7 A;  2MH9 A;  3MD2 A;  2V1N A;  1QHH D;  2BY3 A;  2CFX A;  2K85 A;  4IJA A;  4OWR B;  5F1R A;  3KP2 A;  3KLN A;  5K7Z A;  3QYB A;  1E17 A;  2AXT C;  1Z1D A;  4FET A;  3GTL J;  1IRF A;  3WOD F;  5E1W A;  1KYZ A;  2NOG A;  3T0Y A;  5IP9 J;  3N97 A;  3H92 A;  2HNH A;  2VL8 A;  3K4J A;  4CH7 A;  3WTX C;  4XID A;  2BVM A;  5LGU A;  1JKR C;  1WI3 A;  1OQY A;  4NB5 A;  5F08 A;  1WJC A;  4S0H B;  4RDU A;  2OPT A;  5E1X A;  3UNG C;  3V7R A;  2FMY A;  2GZW A;  3OYD A;  1Z9C A;  1I5Z A;  2LMD A;  3JTH A;  2IS1 A;  1A31 A;  4F92 B;  5CVU A;  2EZK A;  5DM7 F;  3GTO J;  1LDJ A;  3K4N A;  4E7H A;  2QKL B;  3P5J A;  3GLL A;  2CU7 A;  4FE7 A;  4MLO A;  4J00 A;  3JAM K;  1MKM A;  5JLX A;  3JAM Z;  4YFN F;  2QKM B;  2FRH A;  1VQ7 I;  2ECC A;  4D1Q A;  2X6O A;  2NS8 A;  2XB5 A;  2E1O A;  3K2A A;  1T08 B;  5F0C A;  2MW8 A;  2JZY A;  4E7Z A;  4GYI A;  2BW3 B;  4C2M J;  5BS6 A;  1FYM A;  3DTI A;  4PK4 A;  4EJV A;  4ZTF A;  4G7O F;  1LEB A;  3ZQF A;  3GFI A;  5E17 F;  3IV5 A;  2AQF A;  3BG9 A;  3HRS A;  2E36 A;  2ADU A;  2QSF X;  5EJC A;  2H1K A;  4JK1 X;  3TKY A;  4NC8 A;  4O6J A;  2LP0 A;  3G4S I;  1YYV A;  3K4C A;  4M6Y A;  4QIW N;  2DQL A;  2NNY A;  2QM3 A;  1UZC A;  1G3Y A;  4BU2 A;  2O8X A;  4A5N A;  2EH3 A;  2A5W A;  4N4O B;  3KE2 A;  5FFZ A;  5A2Q K;  1MMG A;  1FSH A;  5HNF A;  4C9Y A;  2AO9 A;  2BGC A;  4AVZ A;  1DQU A;  4RAF A;  1ODD A;  1V5F A;  1KU7 A;  4WCG A;  1T0F A;  3RQ4 A;  1I6H J;  1WKM A;  5J1R A;  3BG7 A;  1BBY A;  4PCQ A;  3HRM A;  2WV0 A;  3GME A;  4IHX A;  1MNM C;  1Y56 A;  2JA6 J;  1HW2 A;  1W0T A;  4S05 A;  5K5O A;  3ZQQ A;  4CYC A;  1MH4 A;  4UNO A;  2XGX A;  4A3M J;  1AKH A;  5D4S A;  3ECO A;  2O0Y A;  3BC8 A;  3I9V 2;  1ETV A;  1JHH A;  2WAE A;  1XMX A;  5C4X J;  3COA C;  4M6X A;  3FXK A;  4RBO A;  3J7Z I;  1TNT A;  2DI3 A;  2P5K A;  2W25 A;  1T8I A;  1HOM A;  4RB1 A;  3HTU A;  1K4T A;  1RUN A;  4RGR A;  4IZZ A;  1FOK A;  3FMS A;  4Y52 J;  2PFB A;  1B6A A;  1YG2 A;  1R1T A;  1Z3Y A;  1JJ8 C;  1NH3 A;  1BIA A;  5EG0 A;  2IGM A;  3VFZ A;  2EA2 A;  3BR5 A;  4XOT A;  4E6K G;  1TQI A;  2R7V A;  3BZC A;  1TZL A;  3BY6 A;  3LFK A;  3QP6 A;  5HVQ C;  1E2X A;  3L7W A;  4P55 A;  5LEK A;  3ZXS A;  1HBX G;  2MGQ A;  2IVM A;  4WXH A;  5C3E J;  3LSK A;  3JRA A;  1F5T A;  2GXA A;  4P9F A;  3ZGK A;  1IC8 A;  2LLK A;  2DJN A;  4U0W A;  4MIM A;  5D6F A;  5FKK A;  3GTP J;  1AOY A;  3RPU D;  2CV0 A;  1ON2 A;  4M9Z A;  1WGX A;  3C2H A;  2CQ7 A;  1K4S A;  3H5R A;  4ITV A;  4E7I A;  1YI2 I;  4XRM A;  1DP7 P;  4RM2 A;  1RUO A;  3CCM I;  2K40 A;  3RKY A;  4RA2 A;  4MEX F;  2BV6 A;  1B9M A;  2TDX A;  2CUJ A;  3OSG A;  1HDD C;  2R7S A;  1GVJ A;  4IPA A;  4LIT A;  4LG0 B;  1OCP A;  5LGT A;  1ETK A;  2DA2 A;  1MNE A;  3RKX A;  4FT8 A;  1H88 C;  3GFM A;  2Y0M A;  4ZYG A;  4BE1 A;  2GQQ A;  3J7A O;  1YO5 C;  2P8T A;  5CQG A;  5D5V B;  3D5S C;  1IDZ A;  2F5V A;  2EFO A;  3H9G A;  3HKZ N;  1R23 A;  1R6R A;  3E3V A;  4XSZ F;  3WU2 C;  5ICG A;  2O3F A;  1A35 A;  3I4N J;  1E0E A;  4EVI A;  5IOY A;  1B8I B;  4N9I A;  3H0G J;  4MTD A;  1X1A A;  2HQA A;  3CJN A;  3L2W A;  2JA7 J;  1SVL A;  2JPC A;  1J59 A;  2DOD A;  1P92 A;  4U88 A;  3J81 Z;  4A5M A;  3CLQ A;  1FYL A;  1OR7 C;  3G1O A;  2RAE A;  1TWA J;  2BY2 A;  1MBE A;  4EJO A;  2OCC H;  3E7L A;  5KNL A;  3ZMZ A;  3CTA A;  4UUT A;  1XC5 A;  1Y1W J;  4HF2 A;  3IC7 A;  3Q9V A;  3I0T A;  2HYF A;  2PG4 A;  2ZME B;  3H3V K;  1SFK A;  1I27 A;  2DMN A;  1IAW A;  1AU7 A;  2DA4 A;  4AIK A;  1HC8 A;  1IRZ A;  3WTZ A;  4OIO F;  2H94 A;  5TGT A;  3LSG A;  3VOD A;  1ZYR F;  3K4L A;  3SHF A;  1HW1 A;  3V7C A;  1S6L A;  2XAH A;  5BNG A;  2EBI A;  1MND A;  3F8B A;  2XGD A;  3NAR A;  3CDH A;  2PJR A;  2NOJ B;  4Z6Y A;  4A3G J;  2XRL A;  4LB5 A;  2XB0 X;  2ECB A;  2FBK A;  2F4M B;  3RDI A;  4O5V A;  4QWQ A;  2VBY A;  2HVR A;  4A6D A;  2G7U A;  1NG7 A;  1YRN A;  2R7Z J;  2DOF A;  2OAZ A;  2LRE A;  1AWC A;  5FB2 A;  3ZP5 A;  1GHC A;  2K9Q A;  3MEX A;  4XMY A;  3DKY A;  3M8F A;  2LSO A;  2COB A;  2IGN A;  4Y7N J;  4FHT A;  3I64 A;  1QVT A;  4B3A A;  1QNT A;  2VOD A;  2R4G A;  4DNC A;  2JT1 A;  4A3L J;  2KIM A;  5L3G A;  2JN6 A;  3W6V A;  1U8R A;  5JR3 A;  2WWY A;  3HJE A;  4EGY A;  3C2G A;  1SEU A;  2EWN A;  2XF7 A;  4PZJ A;  3SFI A;  2L5Q A;  4UUS B;  4OAY A;  3KEQ A;  3F0C A;  2M4G A;  2QQ8 A;  2Y75 A;  3HYI A;  2CQQ A;  2WY7 Q;  3CDL A;  3MFK A;  3PIP F;  2DOA A;  1D5Y A;  2GWR A;  3ABK H;  3FBN B;  4NC7 A;  5KAI C;  3ASO H;  3GEZ A;  4XSX F;  1R1U A;  2K9S A;  2LG4 A;  4R1H A;  4RS8 A;  5JLW A;  4JQF A;  3KP5 A;  4JP0 A;  4HZF A;  2V26 A;  1IV8 A;  5IT9 Z;  3K69 A;  3QP5 A;  1X2M A;  4I2O A;  1JI8 A;  4IOC F;  2CO5 A;  3DLA A;  2VJ5 A;  1GT0 C;  2DPU A;  1N25 A;  2H6C A;  3RZO J;  2HYG D;  4C2U A;  1OCC H;  4HW0 A;  3ERM A;  3EYI A;  4KYW A;  4HBL A;  4IXA A;  4P5O A;  2E60 A;  4KJZ A;  4ZDP A;  1W0U A;  2XF5 A;  3FK6 A;  3W3C A;  1QO0 D;  3LA7 A;  2E2J J;  1OYY A;  3FX3 A;  2AS5 F;  3E6D A;  3L2V A;  4KUM A;  2R7U A;  3AG1 H;  2V79 A;  3GFJ A;  2IRF G;  1G4D A;  1XDU A;  1U5T A;  3SZP A;  5L3F A;  3ABT A;  2NS0 A;  2OC6 A;  4F7Z A;  3CO7 C;  2V1X A;  2UXX A;  3PNT A;  2XKP A;  4ZZD A;  4LB6 B;  5JHF A;  1ZN2 A;  1N75 A;  3SQN A;  3CO6 C;  4P96 A;  4NQW B;  5F04 A;  1YQA A;  4PSX A;  3ZQH A;  5GAH J;  1JHF A;  3BR0 A;  2P7V B;  2X1C A;  2ZFU A;  2Q0O A;  3DU5 A;  3S17 J;  1G59 A;  1L0O C;  2PN6 A;  2IAI A;  2R3S A;  4KMF A;  2I5U A;  2FJ1 A;  2LY9 A;  4QTR A;  4G7H F;  4DZP A;  3HB9 A;  3SYT A;  2FD5 A;  4A3D J;  1HSJ A;  3ROU A;  3J80 K;  4BHB A;  1OCZ H;  4LOC A;  1XSD A;  2HKO A;  2EZL A;  4HEA 2;  3FDY A;  1B59 A;  1ZKG A;  2WB1 A;  3L2U A;  5AON A;  2R7R A;  3SZT A;  1EKE A;  1GUU A;  4C3I J;  5C44 J;  3SFZ A;  1Y8R B;  1GV5 A;  4OIR F;  1MJ9 A;  1HA8 A;  4DIQ A;  3LAP A;  1RKT A;  3W2V A;  1SD4 A;  3PQK A;  2STW A;  1IJW C;  4KIC A;  4PGG A;  2F5C A;  3IP4 B;  4M3B A;  3VSK A;  1J0R A;  2KZG A;  2VJJ A;  3EYY A;  3CCQ I;  5JFR A;  2M7B A;  1ONV A;  2HFH A;  1QZZ A;  3HEF A;  5ILS A;  3T1B A;  2TCT A;  4Z2Y A;  4G9Y A;  3L2Q A;  3O6B B;  2FUG 2;  1FTT A;  3VOE A;  4UHT A;  4PGH A;  3PO2 J;  1WRJ A;  2GXG A;  2QVO A;  4MQ9 F;  1Z7L A;  5FKO A;  3LSR A;  3K4M A;  3G6E I;  2W4S A;  1UG0 A;  2H27 A;  2CW8 A;  2KMU A;  1QZE A;  1LFP A;  3RIR A;  3WTV C;  1JUP A;  1RES A;  3TDU C;  5CVR A;  5JVG F;  1YW9 A;  3SEZ A;  3BJA A;  3KET A;  2EQR A;  5K7H A;  4IHW A;  1SMT A;  1K61 A;  4M3D A;  1QGP A;  3DPU A;  4LFU A;  2NS7 A;  4GO1 A;  1O7L A;  4G6D A;  3PQJ A;  3OYI A;  1YOV B;  2R5Z B;  3NWS A;  4PJJ A;  2CQX A;  5H20 A;  3F6O A;  4AD9 A;  1B72 A;  1ACI A;  2WV1 A;  4XKV A;  2XAF A;  4BJ6 C;  4XLA A;  3F8F A;  1HLV A;  3JCU C;  2DDB A;  4LD5 A;  5DD4 A;  1QVU A;  2VKD A;  2KT0 A;  1XD7 A;  3REO A;  1VQK I;  1Z91 A;  2L2O A;  2EV5 A;  1K78 A;  4Q5S F;  2IW5 A;  2D2W A;  1ORK A;  4M73 A;  1X3Z B;  5CVI A;  2L02 A;  3WGI A;  1FT9 A;  2KRH A;  2M30 A;  1XPX A;  1I39 A;  1KU9 A;  5ED4 A;  4DJA A;  2XAS A;  5F0H A;  3EQL F;  1Y8Q B;  4MFD A;  4AWX B;  4I6Z A;  4NNJ A;  3S3O A;  1OCT C;  4Y17 A;  1LQ1 A;  3GX4 X;  5FFX A;  1T33 A;  4F52 A;  4A3B J;  4L18 B;  4IRG A;  4AYB A;  3G2B A;  5KK1 A;  3PO3 J;  5H2F C;  2GLO A;  4NC6 A;  5CQE A;  2ZNZ A;  1LB2 A;  4OIP F;  3BOQ A;  3M1C A;  4Y33 A;  3F3X A;  3H9J A;  2DFF A;  3MMY B;  4DBQ A;  5EZH A;  3U1K A;  5J8C A;  5E18 F;  2EV6 A;  1GVD A;  3AG3 H;  2M3A A;  1J2X A;  4DZJ A;  2VLA A;  2DK8 A;  2E34 A;  1LVA A;  3KIO A;  3OS0 A;  1BR1 A;  3E5X A;  1HF0 A;  4Y15 A;  4HV5 A;  5E3M A;  1QRY A;  4HF0 A;  1QZY A;  1K6O A;  2JA8 J;  2F4I A;  2WAF A;  2O03 A;  3QWL A;  2VAS A;  3BT9 A;  4D7M A;  4FCY A;  1D1C A;  1FSE A;  3Q0V A;  1EH6 A;  1V3F A;  2XPW A;  4XN3 A;  1PDN C;  4BAY A;  4ZDL A;  4ANJ A;  4HG2 A;  5HS8 A;  4ZYE A;  4J01 A;  3CQZ J;  4V19 K;  3MZH A;  2A6T A;  3RSN A;  4ON0 A;  2G7H A;  3OS2 A;  2M34 A;  3FXU A;  1XB4 A;  4HX4 A;  1WJF A;  1BJZ A;  2HQ5 A;  4XOR A;  1X3U A;  5IYB J;  1SFO J;  3MQ0 A;  3EUH C;  4JX5 A;  1P9Q C;  2B7E A;  2QSG X; 
#chains in the Genus database with same CATH homology
 3E6B A;  1KGS A;  2NAZ A;  4MQV A;  1I6X A;  4M74 A;  4Q47 A;  4KN4 X;  1USS A;  2MH2 A;  4N9H A;  1UFM A;  2CSO A;  2P7C B;  4Y13 A;  5JI6 A;  5FLX Z;  5EEH A;  1F4K A;  2CYY A;  2VN2 A;  5LEJ A;  1ULY A;  1DPU A;  4PDK A;  2D1H A;  3VB2 A;  1S7A A;  5J8F A;  4ZYD A;  1T2K A;  2ETH A;  3KZZ A;  3F8N A;  4EJW A;  4HOB A;  2Q2E A;  2PMH A;  2E7W A;  3DPT A;  2VE9 A;  3HRU A;  3L00 A;  5DCF A;  3L09 A;  3RPU A;  3BRO A;  3DQV C;  4I0A A;  4RB2 C;  1ZG5 A;  3E6C C;  1BN5 A;  1A04 A;  5CYV A;  3DKW A;  2STT A;  4A0Y A;  4CXF A;  1IN4 A;  3ZQ7 A;  1TW3 A;  1ZLK A;  3ELK A;  4HLX A;  3RJP A;  4MEY F;  1BI3 A;  1F1Z A;  1Z6R A;  2QYO A;  4E70 A;  1LNW A;  2LF7 A;  4H0E A;  1RI7 A;  2A5Y B;  3NQO A;  2DLL A;  2IA2 A;  3WTS C;  3K1P A;  1BI0 A;  1KQ9 A;  2F5F A;  2GIV A;  2XAQ A;  3LA3 A;  2HQR A;  1KYW A;  3I59 B;  3HOS A;  1D8K A;  2YX7 A;  4I98 B;  1W7P B;  5HS7 A;  3K1M A;  1QQI A;  3IL2 A;  5ICE A;  2IT0 A;  4Q48 A;  2P6S A;  3L2C A;  2RN7 A;  4CGZ A;  1B1B A;  3FMR A;  2FE3 A;  2ESN A;  3ML6 A;  4OOI A;  2MBF A;  2VT2 A;  5D5W B;  4XLP F;  4KA4 A;  3TOB A;  1J7K A;  3BDD A;  4ENN A;  2VE8 A;  1SFE A;  2UZK A;  1YS7 A;  2Z9O A;  2UXN A;  3FHZ A;  2DFI A;  3V8L A;  3WTT C;  2W84 A;  3TGN A;  2ZFW A;  1REP C;  1XCV A;  1FY7 A;  5A2Q Z;  2CGP A;  3CUQ A;  2WTE A;  1J9I A;  4MTE A;  1G3W A;  3R0A A;  4A6E A;  3G73 A;  3EDP A;  3HSE A;  3M1E A;  2QUF A;  4LLG F;  2DK5 A;  2XRO A;  1HST A;  1CF7 B;  2DT5 A;  1BI1 A;  1FZP B;  4ZYH A;  4L9J A;  4FX4 A;  5H6Q A;  2OQR A;  1GXP A;  3OOP A;  4RB3 C;  4OIN F;  2HKX A;  4MGR A;  4IRH A;  3GW2 A;  4IHS A;  3F21 A;  5D5U B;  1O3Q A;  2MD5 A;  1R7J A;  2HOE A;  3Q9S A;  2MA3 A;  2Z33 A;  3ZMT A;  3RYR A;  3TO6 A;  2NNN A;  4JBA A;  4YIF A;  1H9G A;  4L5J A;  3P7N A;  4EV0 A;  5HOO A;  3HHH A;  4HA8 A;  4HX8 A;  3C3W A;  4RAY A;  4RGX A;  2HTS A;  2LDU A;  1S7O A;  1D5V A;  2JRT A;  4XBF A;  1W5T A;  2ZCW A;  2YSR A;  4KT5 C;  4RGU A;  1O3S A;  2ZKZ A;  4R8H A;  3GXO A;  1F9N A;  3M7G A;  3LQQ A;  2EV0 A;  2KRF A;  3JSP A;  1FBS A;  2OBP A;  2ZO4 A;  5LHH A;  1G3T A;  3WU1 B;  1MDM B;  1SAX A;  1P4X A;  4EJU A;  3ZN1 A;  2MLG A;  2QBY A;  4ESF A;  5FO5 A;  1ZGJ A;  1U5T C;  5D6E A;  1G3S A;  1HQC A;  2F5E A;  3P9C A;  6PAX A;  1WQ2 A;  2QQA A;  1T6S A;  4ZZL A;  2VOO A;  5HLH A;  1FLI A;  2RC4 A;  3QPT A;  1SFX A;  3BJ6 A;  2IPQ X;  4M9X A;  3IHU A;  3BPX A;  1HKS A;  1Z6T A;  4KNY A;  3DPL C;  2Q8K A;  4WWC A;  5LLQ A;  1R00 A;  3HTS B;  4HAM A;  2VC1 A;  5LBQ A;  4I02 A;  1LJ9 A;  3DEU A;  4UVA A;  2DU9 A;  1RNL A;  2XHK A;  3TO9 A;  2YPR A;  5DUI A;  3LST A;  5HDG A;  2Z99 A;  1FYK A;  1PP8 F;  5CVJ A;  1IF1 A;  3ZMU A;  3HSF A;  2M45 A;  2A61 A;  4UV9 A;  4IVN A;  1HKT A;  2K4B A;  4AVP A;  3T8T A;  2HEO A;  3CUQ B;  1SMY F;  4KDP A;  3ZN0 A;  3U2R A;  1W5S A;  3F8M A;  3KFW X;  2OZ6 A;  5E1Z B;  3V7S A;  2L4M A;  5BQT A;  3ZMD A;  1OMI A;  4B09 A;  4XRF A;  2JPB A;  4D0P A;  2E1N A;  3RTR A;  2DTR A;  3BJO A;  2K02 A;  5JHU A;  2PJP A;  1Q1H A;  3K9T A;  3F6V A;  1MD0 A;  2LNB A;  3RPQ A;  5DCM A;  1IXC A;  1EV7 A;  3J80 Z;  4CO8 A;  2DBB A;  4RAZ A;  2UWM A;  1YW7 A;  5BMZ A;  3GF2 A;  3GYH X;  1RZ4 A;  4UVC A;  4R79 A;  4BH9 A;  2RDP A;  5LRR A;  5ILV A;  5LHG A;  2FQ3 A;  2QZ8 A;  4WXD A;  2VBX A;  1FX7 A;  4P9U A;  5DEQ A;  3I5U A;  3BPV A;  2K27 A;  3KP3 A;  3V8K A;  2DAO A;  2QEN A;  2W85 A;  4CDG A;  4KFC A;  3IWF A;  1D3Y A;  2A07 F;  3DFG A;  4HQM A;  2VC0 A;  4I7H A;  1SD7 A;  3KLO A;  1K79 A;  4M72 A;  1XCB A;  2COM A;  2M1B A;  1ZLJ A;  2QQ9 A;  1WSU A;  4CZZ A;  5CJ9 A;  3TDZ C;  5HDK A;  5L3B A;  4ESJ A;  2FOK A;  3O3K A;  1YW8 A;  2VBZ A;  1S8N A;  1XMK A;  1P4W A;  3FF5 A;  1IXR C;  2RNJ A;  4GCV A;  1TLH B;  2FXA A;  1R58 A;  4ASN A;  1Z05 A;  4HYE A;  3KCC A;  2GA1 A;  5H6R A;  1XN7 A;  4ENK A;  4XLN F;  1LEA A;  3FXQ A;  2D1V A;  2K7L A;  1YIO A;  2WC2 A;  2B0L A;  1P6R A;  2GAU A;  4HF1 A;  4ENM A;  3N4M A;  4IRI A;  3D0S A;  1XSX A;  2W24 A;  4RB0 A;  4ESB A;  4EGZ A;  1XMA A;  2OQG A;  1ZGA A;  3LQR A;  3GFL A;  5IT3 A;  3CLO A;  2OD5 A;  1NHA A;  1QPM A;  5DV5 A;  4IF4 A;  3JSO A;  3B02 A;  5L3C A;  5ERI A;  3BP8 A;  4AIJ A;  1BM9 A;  1JXS A;  4A0Z A;  2QLZ A;  3IRQ A;  2M8E A;  2BE5 F;  2EFP A;  4GYG A;  2FEZ A;  3GZ6 A;  3MAJ A;  1U5T B;  1WI9 A;  1STZ A;  3IWZ A;  3QPH A;  4A0X A;  5HLI A;  4LLN A;  2FNP A;  3GZ5 A;  2VXZ A;  3DF8 A;  5HLG A;  2F2E A;  5BPI A;  5LHI A;  1WWX A;  5DYM A;  2HGC A;  2VT3 A;  2V6C A;  2XAJ A;  1XDS A;  3FM3 A;  4LK0 F;  3QU6 A;  3JTG A;  3C1D A;  5LRS A;  1SD5 A;  3H3U A;  5DCM B;  1LDD A;  1IXS B;  3KEO A;  3WE3 A;  2E1C A;  2ZJ2 A;  1FBU A;  1R5G A;  4L0Y B;  4ZH4 F;  3BWG A;  4YFK F;  4L9T A;  1T38 A;  4UXN A;  2OU2 A;  2RKH A;  2J5P A;  5D5X B;  3CUQ C;  1W7P D;  3U9G A;  4WX9 A;  2FF4 A;  3MZY A;  2ZME A;  3V4G A;  1KA8 A;  4UUV A;  4O3M A;  5FD5 A;  3BZ6 A;  4LGW A;  1PUE E;  2YX4 A;  2FBI A;  1B4A A;  4BQA A;  2K86 A;  2H09 A;  3F72 A;  4DQ2 A;  5E8I A;  2HTJ A;  1XGO A;  3P9K A;  3M8E A;  5L3D A;  2HDC A;  1P4A A;  2VOP A;  4A2U A;  4YFX F;  2JTV A;  2MLK A;  2ZBK A;  1KQ0 A;  2D45 A;  3WTU C;  4I09 A;  2HS5 A;  2FA5 A;  3T5X A;  2VBW A;  5JVT A;  3WGH A;  2QQB A;  1XGS A;  3ZMV A;  3WU0 A;  1K78 B;  2RVC A;  5HDN A;  2MC3 A;  4EJT A;  1Y0U A;  1TQP A;  2IP2 A;  5E8G A;  2FML A;  2XVC A;  3F23 A;  2BYV E;  5FD6 A;  2EK5 A;  4L5I A;  4UVB A;  2L54 A;  2R7D A;  5K5R A;  3CUO A;  1TQM A;  3U1D A;  4L9N A;  2P5V A;  3NRV A;  1KU3 A;  2LF8 A;  3RI4 A;  3Q5F A;  2FSW A;  4EQQ A;  5KVR A;  4G8X A;  3W6K B;  3HSR A;  2W57 A;  2RV8 A;  2Z3Y A;  5E20 A;  3LAJ A;  3FMQ A;  5CVV A;  4M71 A;  2ISZ A;  3TO7 A;  1HW5 A;  4EM2 A;  2ELH A;  5ICC A;  1OYW A;  4NQW A;  2ESH A;  2GXB A;  4S04 A;  3E5Q A;  4KIG A;  2BEO A;  2L3D A;  3DP7 A;  1BJA A;  2M5W A;  3L9F A;  4EM0 B;  1TNS A;  2PBI A;  3F8C A;  1BI2 A;  4RGS A;  2M87 A;  1P2F A;  1IUY A;  2A6E F;  1U2W A;  1UCR A;  5HS9 A;  2P5L C;  5TJJ A;  3K2Z A;  3G3Z A;  5BPD A;  3I53 A;  2HR3 A;  3WTY C;  3HHG A;  4OU0 A;  4OMZ A;  1KU2 A;  4CIC A;  1G6N A;  2PMU A;  2XV4 S;  2DW4 A;  2H6B A;  4LJZ F;  4CYD A;  2FU4 A;  2AXL A;  3WE2 A;  4HQE A;  4HX7 A;  2KIU A;  4EMS A;  1UB9 A;  3AAF A;  3ZMS A;  5BOX A;  2J5O A;  1ZG3 A;  1EH8 A;  3R60 A;  2XAG A;  3KP6 A;  2KJC A;  1C0W A;  3P9I A;  2A69 F;  3GWZ A;  1TW2 A;  3LWF A;  1RIO H;  1ZRD A;  4HDU A;  4BNC A;  3F22 A;  4G6Q A;  2F5D A;  3J81 K;  1XGN A;  1CGP A;  1ZG1 A;  1O3T A;  1B9N A;  1YLF A;  1L3L A;  4QLC U;  3E97 A;  1J75 A;  1T98 A;  3JW4 A;  1YS6 A;  2FNA A;  1BC8 C;  4MHG A;  5K5Q A;  3W6J B;  2NYX A;  2OA4 A;  3I58 A;  3R0J A;  5DD8 A;  1BC7 C;  1ON1 A;  2CQK A;  3R6S A;  2KJB A;  3HRT A;  3E5U A;  3SXY A;  3TOA A;  3D5L A;  3T8R A;  1S3J A;  4KIB A;  3ECH A;  1FNN A;  1R36 A;  4K2E A;  1IN6 A;  4HDV A;  1FBQ A;  2KIF A;  2XIG A;  4LLL A;  3K0L A;  5FGM A;  1FC3 A;  3RYP A;  1U6G A;  2IJL A;  1OYI A;  5L3E A;  1U3E M;  3HUG A;  3PFI A;  3OV8 A;  2CW0 F;  2BBY A;  2HQN A;  4LK1 F;  2XUB A;  3KP7 A;  1OPC A;  1HKQ A;  2HWV A;  1TBX A;  3TQN A;  4G94 A;  1V4R A;  3NEU A;  1SFU A;  4A12 A;  3HOT A;  1OR7 A;  4OIQ F;  5IT9 K;  1D8J A;  4U7D A;  2VON A;  2PLY A;  1IW7 F;  2QWW A;  2CG4 A;  2P6T A;  4OMY A;  5ICF A;  3C18 A;  4WXC A;  2A6H F;  5EEG A;  2JSC A;  4L0Z B;  1ZAO A;  5K1Y A;  4WK8 F;  1DPR A;  2O61 A;  1OKR A;  3LA2 A;  4MNU A;  4EM1 A;  3WTW C;  1MZB A;  1W4M A;  5AIP A;  1J5Y A;  1ZAR A;  2IA0 A;  3ISP A;  3HIF A;  3VEP A;  2PEX A;  1YTY A;  3H3Z A;  1LDK B;  4CHU A;  1I1G A;  2XKO A;  1JGS A;  2X4H A;  3I4P A;  5LGN A;  2IA1 A;  3QAH A;  1MJB A;  3B73 A;  5ILU A;  3FZV A;  3V8J A;  3IRR A;  4AIH A;  1Z7U A;  2XRN A;  1PP7 U;  5J6X A;  4M9S A;  1ZRE A;  3FXR A;  2EFN A;  3R61 A;  3GUD A;  3I54 A;  3KP4 A;  5TRD A;  3MWM A;  4HV6 A;  1IZ1 A;  2K4J A;  1TTY A;  2O6G E;  3R4K A;  2A3S A;  4I0B A;  2PQ8 A;  1FP1 D;  3WGG A;  1I1S A;  3DV8 A;  2P4W A;  2KKO A;  3I59 A;  1H0M A;  5F64 A;  1VTN C;  2Y48 A;  3EET A;  4UV8 A;  2R7F A;  3FWE A;  1W7P A;  4KN7 X;  3O2P E;  2E7X A;  1KQ8 A;  3ERE D;  2LKP A;  1ZRF A;  2Z5U A;  2DQR A;  3GO5 A;  3QOP A;  2QBY B;  2YR2 A;  3WG9 A;  1UHW A;  4GGG A;  5AIQ A;  2GA2 A;  2L01 A;  3RKW A;  3IKV A;  3KZY A;  2DPD A;  1XGM A;  4Q4Z F;  5DDG A;  1FWZ A;  4ETS A;  4YG2 F;  3FM5 A;  4L9V A;  3ZPL A;  1ZRC A;  1R5H A;  4N0B A;  2V1D A;  2ZNY A;  1QBJ A;  4YII A;  2A68 F;  4BHC A;  4WF2 A;  1DDN A;  2PI0 A;  5F6F A;  2C6Y A;  1UHM A;  2V9V A;  1CF7 A;  5DUK A;  4BYY A;  4KMU X;  4TV7 A;  2EA4 A;  1FPQ A;  2EFW A;  1DUX C;  3E6M A;  1MJA A;  2YU3 A;  2RGV A;  2EFQ A;  1O7F A;  4FX0 A;  1MGT A;  1K7A A;  2X0L A;  2ZXJ A;  4HLY A;  4NHJ A;  3QRF F;  1O3R A;  3M9A A;  1JE8 A;  4U7B A;  4U0Y A;  3GLX A;  4KIF A;  3C7J A;  3S2W A;  1IN7 A;  1T39 A;  2ACJ A;  4LMY A;  3IKT A;  1FP2 A;  3MCZ A;  2L4A A;  2HZT A;  5FLX K;  3ULQ B;  4LG0 A;  2V1U A;  3I71 A;  1BOA A;  1IN8 A;  4I01 A;  1SD6 A;  3ABU A;  4ENJ A;  4G7Z F;  1U78 A;  2DO7 A;  2EJR A;  1YFH A;  2G9W A;  1IRG A;  1GXQ A;  4GXO A;  4IHT A;  1S29 A;  3DXJ F;  3QU3 A;  3GVA A;  1H9T A;  1XSV A;  3K1N A;  1R22 A;  4BXU A;  2RQP A;  1MDM A;  1O57 A;  2OZU A;  1UST A;  2ISY A;  5D8L B;  1R1V A;  1ZH5 A;  1BIB A;  5CLS A;  2FBH A;  2NRA C;  4BHP A;  5D8K B;  1IN5 A;  1HXD A;  4U0V A;  2CWE A;  5D4R A;  3EUH A;  2EB7 A;  1ZHF A;  4B8X A;  1EH7 A;  2MH9 A;  2CFX A;  4IJA A;  5F1R A;  3KP2 A;  3KLN A;  1E17 A;  1Z1D A;  1IRF A;  3WOD F;  5E1W A;  1KYZ A;  3T0Y A;  3N97 A;  3H92 A;  3WTX C;  5LGU A;  4NB5 A;  5E1X A;  3V7R A;  2FMY A;  2GZW A;  1Z9C A;  1I5Z A;  3JTH A;  5CVU A;  1LDJ A;  3JAM K;  1MKM A;  3JAM Z;  4YFN F;  2FRH A;  2JZY A;  4GYI A;  5BS6 A;  1FYM A;  4EJV A;  4G7O F;  1LEB A;  3GFI A;  5E17 F;  3HRS A;  2ADU A;  4JK1 X;  3TKY A;  4O6J A;  1YYV A;  4M6Y A;  2DQL A;  2NNY A;  2QM3 A;  1G3Y A;  2O8X A;  4A5N A;  3KE2 A;  5FFZ A;  5A2Q K;  1FSH A;  2BGC A;  1ODD A;  1KU7 A;  4WCG A;  1T0F A;  1WKM A;  1BBY A;  4PCQ A;  3HRM A;  2WV0 A;  1HW2 A;  4S05 A;  5K5O A;  4UNO A;  2XGX A;  5D4S A;  3ECO A;  2O0Y A;  1JHH A;  3COA C;  4M6X A;  1TNT A;  2DI3 A;  2P5K A;  2W25 A;  4RB1 A;  3HTU A;  1RUN A;  4RGR A;  1FOK A;  3FMS A;  2PFB A;  1B6A A;  1YG2 A;  1R1T A;  1BIA A;  3VFZ A;  2EA2 A;  1TQI A;  3LFK A;  3BY6 A;  3QP6 A;  5HVQ C;  5LEK A;  1E2X A;  3L7W A;  4P55 A;  1HBX G;  2IVM A;  4WXH A;  1F5T A;  4P9F A;  4U0W A;  5D6F A;  1AOY A;  1ON2 A;  4M9Z A;  1DP7 P;  1RUO A;  3RKY A;  4MEX F;  2BV6 A;  1B9M A;  2TDX A;  1GVJ A;  4IPA A;  4LG0 B;  5LGT A;  3RKX A;  4FT8 A;  3GFM A;  2Y0M A;  4ZYG A;  2GQQ A;  3J7A O;  1YO5 C;  2P8T A;  5D5V B;  2EFO A;  1R23 A;  3E3V A;  4XSZ F;  5ICG A;  2O3F A;  4EVI A;  4N9I A;  4MTD A;  3CJN A;  1J59 A;  2JPC A;  1P92 A;  4U88 A;  3J81 Z;  4A5M A;  1FYL A;  4EJO A;  3ZMZ A;  3CTA A;  4HF2 A;  3IC7 A;  3Q9V A;  3I0T A;  2HYF A;  2PG4 A;  2ZME B;  1I27 A;  1IAW A;  4AIK A;  3WTZ A;  4OIO F;  2H94 A;  3VOD A;  1ZYR F;  3SHF A;  1HW1 A;  3V7C A;  1S6L A;  2XAH A;  3F8B A;  3CDH A;  4LB5 A;  2FBK A;  3RDI A;  4O5V A;  4QWQ A;  2VBY A;  4A6D A;  2G7U A;  2OAZ A;  1AWC A;  5FB2 A;  3ZP5 A;  1GHC A;  3MEX A;  3M8F A;  2LSO A;  4FHT A;  3I64 A;  1QNT A;  2VOD A;  4DNC A;  2JT1 A;  2KIM A;  5L3G A;  1U8R A;  5JR3 A;  2WWY A;  4EGY A;  2EWN A;  4PZJ A;  3KEQ A;  2Y75 A;  3HYI A;  3MFK A;  2GWR A;  3GEZ A;  4XSX F;  1R1U A;  4R1H A;  4RS8 A;  4JQF A;  3KP5 A;  4HZF A;  5IT9 Z;  3K69 A;  3QP5 A;  4I2O A;  2CO5 A;  2DPU A;  2H6C A;  2HYG D;  4HW0 A;  3EYI A;  4KYW A;  4HBL A;  4IXA A;  4P5O A;  1QO0 D;  3LA7 A;  1OYY A;  3FX3 A;  2AS5 F;  3E6D A;  4KUM A;  2V79 A;  3GFJ A;  2IRF G;  1G4D A;  1XDU A;  1U5T A;  3SZP A;  5L3F A;  2NS0 A;  3ABT A;  4F7Z A;  3CO7 C;  2V1X A;  2UXX A;  2XKP A;  4ZZD A;  4LB6 B;  1ZN2 A;  3SQN A;  3CO6 C;  4P96 A;  1YQA A;  1JHF A;  2P7V B;  2Q0O A;  1L0O C;  2PN6 A;  2R3S A;  4KMF A;  4G7H F;  1HSJ A;  3ROU A;  3J80 K;  4BHB A;  1XSD A;  2HKO A;  1B59 A;  5AON A;  3SZT A;  3SFZ A;  4OIR F;  1MJ9 A;  3LAP A;  1SD4 A;  3PQK A;  2STW A;  4KIC A;  4PGG A;  2F5C A;  1J0R A;  3EYY A;  5JFR A;  1ONV A;  2HFH A;  1QZZ A;  5ILS A;  3T1B A;  4Z2Y A;  4G9Y A;  3O6B B;  3VOE A;  4UHT A;  4PGH A;  1WRJ A;  2GXG A;  2QVO A;  4MQ9 F;  2H27 A;  3RIR A;  3WTV C;  3TDU C;  5CVR A;  1YW9 A;  3BJA A;  3KET A;  1SMT A;  1QGP A;  4LFU A;  4GO1 A;  1O7L A;  4G6D A;  3PQJ A;  5H20 A;  3F6O A;  4AD9 A;  2XAF A;  3F8F A;  4LD5 A;  5DD4 A;  1XD7 A;  3REO A;  1Z91 A;  2EV5 A;  1K78 A;  4Q5S F;  2IW5 A;  2D2W A;  4M73 A;  5CVI A;  2L02 A;  3WGI A;  1FT9 A;  2M30 A;  1KU9 A;  5ED4 A;  2XAS A;  3EQL F;  4AWX B;  4Y17 A;  1LQ1 A;  3GX4 X;  5FFX A;  4L18 B;  4IRG A;  5KK1 A;  1LB2 A;  2ZNZ A;  4OIP F;  3BOQ A;  3F3X A;  5J8C A;  5E18 F;  2EV6 A;  1J2X A;  2DK8 A;  1LVA A;  3E5X A;  4Y15 A;  4HV5 A;  4HF0 A;  1QZY A;  1K6O A;  2O03 A;  1FSE A;  1EH6 A;  1V3F A;  1PDN C;  4BAY A;  5HS8 A;  4ZYE A;  3MZH A;  4ON0 A;  2G7H A;  3FXU A;  4HX4 A;  1XB4 A;  1X3U A;  3MQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...