3WTVC

Crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 37
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtvC00
1JHFA 4WK8F 5E17F 3V8JA 2EFPA 4HF0A 3ZMDA 4U7DA 3LQQA 2OQGA 1FNNA 1O7LA 2C6YA 4AIHA 3KE2A 2QLZA 5LBQA 1I6XA 3GFJA 2XAFA 2P7CB 5HS7A 5HVQC 1MJ9A 3C18A 1YW8A 4EM0B 4BHBA 5L3EA 4Y17A 2DTRA 1MD0A 3FM5A 2Q8KA 2DK5A 2KIUA 2WTEA 1R5HA 3W6KB 4LLLA 1P4XA 2IA2A 2EV6A 3BJAA 4A6DA 2BV6A 1BN5A 2DK8A 2HGCA 3MWMA 3IKVA 1KYWA 3NQOA 2Z5UA 3ROUA 3HRMA 3CUOA 4M74A 5D4RA 3RTRA 3FX3A 3O3KA 3V7SA 1XGSA 1LQ1A 2R7DA 2RNJA 2DT5A 2V1UA 2QBYA 1IXRC 4O6JA 1KU7A 2GA1A 1XMAA 2DBBA 2VOPA 4CGZA 1YLFA 3KP2A 4CYDA 1QNTA 2A6HF 1I1SA 4DNCA 3CUQB 5F1RA 2QUFA 3DEUA 3TKYA 2HTJA 1YO5C 5E8GA 2MH2A 3DKWA 1MJBA 3CUQC 4G6DA 3F6OA 5LRRA 1O3SA 4GYGA 2FU4A 4Q47A 1SMYF 1FPQA 4A0XA 5LEKA 1BC8C 3M1EA 3KFWX 1XCBA 3HIFA 4PCQA 3DPTA 2DI3A 1G3SA 3N4MA 5ILVA 3T5XA 3F8BA 2O8XA 2UXXA 2PI0A 1FY7A 3KP5A 3Q5FA 2V6CA 3VB2A 2NNYA 4RGUA 3L9FA 1GXQA 2ZJ2A 2Q0OA 4ON0A 5JR3A 2RN7A 2XUBA 3HTUA 4AD9A 1YIOA 1O57A 4RAZA 3LAJA 3DV8A 2HEOA 5HOOA 3R0AA 4KFCA 5J8FA 1HW5A 2L4AA 3GZ5A 2OQRA 3LWFA 1W7PB 4YIFA 2F5EA 2GZWA 2XVCA 5L3DA 2COMA 3VODA 2R7FA 4RB2C 3O6BB 1TNSA 1XGNA 5L3CA 1RNLA 4Y15A 1MGTA 3PQKA 4YIIA 2DU9A 2L02A 5LGNA 4UVCA 5JVTA 3E97A 3NEUA 5FGMA 4YFNF 2ZMEB 3BJ6A 4HQEA 1PP8F 3CO6C 2M1BA 3COAC 3BOQA 2JRTA 4K2EA 2K4BA 2PBIA 3M8EA 3M7GA 5EEGA 1D8JA 3I59B 3HYIA 1KQ0A 2HFHA 4MQ9F 1JGSA 2HQNA 2BE5F 4R1HA 3F23A 2ADUA 2YPRA 4OU0A 2OZUA 1U5TB 3ZMSA 3L2CA 3F22A 1Z9CA 2STWA 1VTNC 3QU6A 4PGHA 1T0FA 2HKXA 3KP3A 5HS8A 1MZBA 2BEOA 2KKOA 2LF8A 4M71A 5HS9A 2ACJA 2A6EF 3GZ6A 4S04A 4BNCA 2R3SA 1S6LA 3I64A 5BMZA 4U7BA 2OD5A 2P5KA 1IN5A 3RKXA 1LDJA 4F7ZA 3B73A 1B9MA 1IUYA 1Z6RA 4A5NA 2WV0A 2NAZA 3GX4X 1RUOA 4WF2A 2F2EA 2EFWA 1UCRA 1O3QA 3I0TA 5K1YA 2PEXA 2X0LA 3TGNA 4KA4A 1HKQA 4RGRA 2Y48A 2VC1A 4ZH4F 4MTDA 3CJNA 4U0WA 4WX9A 4UV9A 4RGSA 2M45A 3W6JB 2VOOA 1BC7C 1P4AA 3I5UA 1L0OC 1R22A 3P9IA 1D5VA 2HTSA 3GFMA 1Z91A 3FXQA 3SZPA 4L18B 2VODA 1KA8A 3WG9A 4WWCA 2E7XA 1K78A 2E7WA 2XIGA 2ZNZA 3GFLA 4I0AA 2GWRA 3Q9SA 1U78A 3SHFA 2JSCA 4XBFA 2TDXA 3L09A 5FFZA 2LKPA 3VOEA 4D0PA 3EETA 2PMHA 2V9VA 3MEXA 2A68F 1YW7A 2Z9OA 3WTWC 4Q48A 5CVUA 4EGZA 1I1GA 4HQMA 2VN2A 3HSRA 4OOIA 2Z33A 4R8HA 1RI7A 1ZG1A 4EMSA 5LHGA 3EQLF 4NHJA 4CXFA 5J6XA 1XSVA 1SFUA 3MCZA 4EQQA 4HDVA 3F8NA 5HLIA 3U1DA 4HW0A 3IRQA 4TV7A 3F21A 1ZRDA 1UFMA 2M8EA 1XMKA 1S7AA 4HA8A 1BBYA 1XD7A 1FZPB 2QQ9A 2QZ8A 2NYXA 2IRFG 4M72A 3RPQA 4B09A 3BROA 2QVOA 1E17A 5ERIA 5H6RA 3TOAA 4ZZLA 1HSTA 2CO5A 2XHKA 3OV8A 4FT8A 2O0YA 5DD8A 4M9SA 4KDPA 1CF7B 1WKMA 2ISYA 4AIJA 4ZZDA 1B4AA 1IAWA 3WTXC 5E20A 4HV6A 2QQBA 3WU0A 1PP7U 3V4GA 1SFXA 4EM1A 1H0MA 2CYYA 1FT9A 2ETHA 5HDGA 3S2WA 2DPDA 2JPBA 4IHTA 4LD5A 5D8LB 1V4RA 2VE8A 2CGPA 3R0JA 4N9IA 1USSA 2FMYA 4XLNF 1IRFA 1AOYA 1BOAA 4LGWA 4YFKF 3G3ZA 3ECHA 4M9ZA 2GA2A 3LSTA 2HYFA 5JI6A 1OYYA 3WGHA 2J5PA 3E6MA 2ESNA 4BHPA 2IA0A 3RYRA 3HTSB 4NB5A 4G7OF 2FQ3A 2FMLA 3K0LA 1QGPA 5LHIA 3EYYA 3BZ6A 2PLYA 3MZHA 4HLYA 1SFEA 2W85A 4P9UA 3WU1B 1HKTA 4A0ZA 1BI3A 4HLXA 1JXSA 1ON2A 1HW2A 2VT3A 5CYVA 5AONA 4WXHA 2W25A 1XSXA 1WWXA 1FBQA 5FLXK 3R60A 1FSHA 2QWWA 3JTGA 1BIAA 1F1ZA 2CWEA 3SZTA 4MEYF 5D5UB 4HX4A 4S05A 4O3MA 2RGVA 3WTVC 1ZHFA 1ZARA 2QM3A 1QBJA 3IHUA 3GWZA 5K5QA 3LAPA 3G73A 4KMUX 2KIFA 2Z3YA 1ULYA 3V8KA 1W7PA 3SQNA 4G7ZF 1BIBA 1QPMA 2P5VA 5DV5A 4OINF 1DDNA 3HSFA 3TOBA 3HOSA 1L3LA 3BDDA 3FF5A 1IF1A 3GYHX 4Z2YA 1U2WA 1W7PD 5TRDA 3HRSA 4BAYA 2ZMEA 4UUVA 2HYGD 2VC0A 2XV4S 4M6XA 1CGPA 2DW4A 4IJAA 2D2WA 4ENNA 3F3XA 1T39A 2AXLA 1HKSA 2DFIA 4JBAA 3I59A 4KT5C 2YU3A 1XB4A 2F5DA 3ERED 4MTEA 1JHHA 2BYVE 2XKOA 2QQAA 3L00A 2FBHA 5DCMB 3VFZA 1U5TA 5LHHA 5D8KB 3KETA 4BYYA 1IRGA 5FO5A 4RGXA 2HWVA 3O2PE 1PDNC 2FF4A 2FBIA 1I5ZA 2KRFA 2VBZA 4ZYDA 3N97A 4L9VA 3E6DA 2QYOA 2Y75A 4BHCA 3QAHA 2D1HA 2DLLA 4OMZA 1S29A 2IA1A 3IWFA 4GYIA 4UV8A 4CHUA 3K1NA 1FC3A 4AIKA 2VBYA 4G6QA 3BJOA 4GXOA 1EH8A 5E18F 1PUEE 2K27A 4KIFA 3FXUA 3QRFF 5LLQA 1R5GA 3GXOA 2IJLA 3RYPA 1S8NA 1MDMB 2BGCA 1OYIA 5FB2A 2QBYB 3KLNA 2K7LA 4P55A 3SXYA 1UHWA 3C3WA 3RKWA 1BJAA 3HRTA 1LEBA 4LG0B 4L9JA 5DUIA 1XSDA 4G94A 1R7JA 1ZG5A 2DO7A 4A5MA 2M87A 4XSZF 1YQAA 2UXNA 5LEJA 3KP6A 5DDGA 1FWZA 4LJZF 3K9TA 1ZGJA 4KYWA 2CSOA 5TJJA 1U8RA 1YFHA 3EDPA 3JSPA 1KU9A 1J75A 4LLNA 5H20A 1HXDA 3E6CC 5BPDA 2OAZA 3F6VA 1XDSA 3WTSC 4IRIA 4EV0A 4MNUA 4RB0A 2LDUA 5JHUA 1F9NA 2A69F 4L5IA 4GCVA 3WTZA 1D8KA 4KIBA 1EH6A 1T2KA 1W5SA 1K79A 4M6YA 2W84A 1BI0A 1XGOA 1BM9A 4HDUA 1WRJA 2MC3A 1J2XA 3K2ZA 2XKPA 2ZO4A 2IPQX 2P8TA 2MLGA 2JT1A 4UNOA 3Q9VA 5AIPA 5D4SA 3QOPA 1AWCA 3IL2A 1O3TA 4CO8A 3F8CA 3WE3A 2ZKZA 5E1XA 1KU3A 1K6OA 5EEHA 2K86A 1GXPA 1DPUA 3U2RA 2NS0A 4LK1F 3OOPA 4AWXB 1TQMA 4BQAA 1U6GA 2VT2A 4I0BA 3GFIA 4GGGA 5L3GA 2HDCA 4QLCU 2O61A 5F64A 2OZ6A 5CVVA 1P2FA 3IC7A 4CICA 5ICEA 1FSEA 2EFNA 5J8CA 5BQTA 1ZLJA 3E3VA 2H09A 4WXCA 3LA3A 1FX7A 1F4KA 2UZKA 3KLOA 1FOKA 2IP2A 2XAJA 1RIOH 2O6GE 3KZZA 3DP7A 3TQNA 1Q1HA 3BWGA 4ESBA 3DQVC 2F5FA 3ZP5A 3ECOA 3ULQB 2EFOA 3V8LA 5BOXA 4EJWA 2RKHA 5KVRA 1CF7A 1DPRA 1SD5A 2E1CA 2B0LA 2V1DA 3CLOA 3F8MA 2M5WA 2CQKA 3IWZA 1J5YA 2LSOA 2FBKA 4EVIA 3ML6A 1R1VA 3P9CA 5HDKA 3ABTA 3FHZA 5F6FA 1G6NA 4L5JA 1S7OA 2XASA 5L3BA 4IPAA 3BPVA 3F8FA 4CZZA 2ZFWA 2EV0A 2XGXA 1J0RA 3RIRA 3EUHA 1TQIA 1TBXA 4YG2F 1ONVA 5IT9Z 3ABUA 1Z1DA 3ZN0A 2P6TA 4UVBA 1QZYA 4LFUA 3I58A 1OYWA 2BBYA 2L3DA 3E6BA 4XRFA 3RKYA 2ZCWA 3EYIA 2FSWA 3ZN1A 4HF1A 4IRHA 4OIOF 2EA2A 2ZXJA 4HAMA 1BI1A 4OIQF 1XN7A 1LVAA 1G3YA 1R58A 4E70A 3P9KA 5CLSA 2MD5A 3I4PA 1IN7A 3RJPA 3FWEA 2J5OA 2RDPA 1P92A 3PFIA 2AS5F 5D5WB 3TO9A 3DXJF 1QQIA 4KNYA 1LDKB 3LQRA 4PZJA 4ENKA 2GQQA 3BY6A 3HRUA 1IN6A 5ED4A 3T1BA 5ILSA 1K78B 3ZMUA 2XAQA 4KIGA 1HSJA 3JAMZ 4WCGA 1LNWA 2XROA 1FP2A 2M30A 2XRNA 3HHGA 1ZRFA 4P5OA 5HLGA 4HZFA 3T8TA 2WWYA 3ZMZA 2CG4A 2MA3A 3BPXA 5HLHA 3GO5A 1J7KA 3RI4A 5DD4A 5D6EA 1B9NA 3TO7A 2FA5A 3E5QA 1P4WA 3IKTA 3FZVA 4P9FA 3CUQA 4I09A 4ETSA 3REOA 5ICGA 1UB9A 5IT9K 4L9TA 4CDGA 2EK5A 3K1PA 2QENA 2RV8A 4Q4ZF 4A0YA 2JPCA 4RAYA 1ON1A 4ENJA 1HQCA 1SD7A 4EJVA 3R61A 1R23A 3H3ZA 4XSXF 5JFRA 1Z6TA 4LB6B 4YFXF 1RUNA 5DCMA 2Y0MA 3ZMTA 1ZAOA 2KIMA 2KJBA 4IXAA 4XLPF 1G4DA 2H27A 1B1BA 1H9TA 1XDUA 3ZMVA 3GEZA 4HV5A 2ISZA 4FX4A 1IXSB 1ZRCA 1OPCA 3AAFA 4RS8A 4L0YB 2OU2A 3FMQA 2EB7A 2MLKA 4HOBA 4IF4A 3JAMK 2FXAA 4RB3C 2G7HA 3C7JA 3KP4A 4HX7A 2A61A 4Q5SF 1OR7A 3E5UA 1W4MA 3WTYC 4P96A 2PG4A 4A12A 3KCCA 4RB1A 1KYZA 1QO0D 2MBFA 4HX8A 1MDMA 4FHTA 1ZREA 2YX4A 2G9WA 3J7AO 4UXNA 4KICA 4G8XA 1TNTA 2CFXA 2X4HA 4IRGA 4LG0A 3GF2A 5E1WA 2V1XA 3MFKA 1IXCA 2D1VA 1P6RA 3KZYA 2VBXA 1KGSA 1SD4A 3I71A 5ICCA 4U0YA 5CVRA 3D5LA 2FNAA 3U9GA 3I53A 1KU2A 4ENMA 1X3UA 1B6AA 4L9NA 3E5XA 2HKOA 3R4KA 2ESHA 2V79A 3LFKA 4I2OA 4ZYGA 3V7RA 2VE9A 2RVCA 5LRSA 1YS7A 1IN4A 1WQ2A 1DP7P 2EV5A 5ICFA 3V7CA 3HSEA 1MKMA 4BH9A 3FXRA 1B59A 2HS5A 3RDIA 3JW4A 3MZYA 1SMTA 5CJ9A 4EM2A 3K1MA 2LNBA 3H92A 1LDDA 5BS6A 1Z7UA 3WTUC 4HBLA 2L01A 3FMRA 5CVIA 1J9IA 1D3YA 3LA2A 1GVJA 3T8RA 3FMSA 2PMUA 3TO6A 1V3FA 3WGGA 4IVNA 5DUKA 1R1UA 2A5YB 2GXGA 2VONA 2DQRA 5K5RA 1WI9A 2EA4A 4KMFA 2H94A 5AIQA 5D5VB 2FOKA 4PGGA 3FM3A 1OKRA 3WGIA 5K5OA 2YSRA 3GW2A 1WSUA 2XAHA 1LB2A 5D5XB 4B8XA 2GIVA 2HZTA 2W57A 1MJAA 5H6QA 4M9XA 3NRVA 4LLGF 4G9YA 4ZYHA 4JQFA 1EH7A 1T98A 2A07F 3QU3A 1ZG3A 1S3JA 3I54A 1TLHB 2WC2A 2FRHA 1A04A 2PN6A 3F72A 1G3TA 2P5LC 1G3WA 3CO7C 3RPUA 1Z05A 1OMIA 4MGRA 1T38A 2EFQA 1FP1D 2XAGA 1O7FA 2DPUA 1YS6A 2FE3A 5E1ZB 1HBXG 2YR2A 3J81Z 2H6BA 4L0ZB 1R00A 1U5TC 3PQJA 3R6SA 3M9AA 1YYVA 1QZZA 1YG2A 4OIPF 3TDZC 3DFGA 1ZLKA 1I27A 4U88A 3ZQ7A 4I02A 1SAXA 1E2XA 2FNPA 2O3FA 3IRRA 2ZNYA 2OA4A 3T0YA 3QPTA 3JTHA 2P4WA 4I7HA 3J80Z 2K02A 3GVAA 3JSOA 2D45A 1R1TA 4MQVA 4AVPA 3KEOA 2L54A 4JK1X 1FLIA 3GLXA 2EJRA 2HR3A 2K4JA 1RZ4A 3ZPLA 1W5TA 2ZBKA 3QPHA 1UHMA 2DQLA 2JZYA 2JTVA 4MEXF 1TTYA 5LGTA 3DPLC 2Q2EA 1REPC 1XCVA 4KN4X 6PAXA 1H9GA 4HYEA 1YW9A 2L4MA 5A2QZ 3MAJA 4EJUA 4LB5A 1C0WA 4LMYA 1Y0UA 2HOEA 5E8IA 4M73A 3K69A 2H6CA 4Y13A 3HOTA 2RQPA 4DQ2A 4N9HA 4IHSA 2ELHA 2GAUA 3BP8A 1FBUA 1TW3A 4NQWA 2PJPA 3LA7A 4UHTA 3KP7A 5BPIA 4N0BA 1IZ1A 2GXBA 4OMYA 3J81K 2PQ8A 3SFZA 1KQ9A 5L3FA 2O03A 5D6FA 4O5VA 5IT3A 3KEQA 2VXZA 1NHAA 1DUXC 1K7AA 1IW7F 2DAOA 2Z99A 4ASNA 4ESJA 3ISPA 3H3UA 1FYMA 4QWQA 5LGUA 3B02A 1FYKA 1ODDA 3WTTC 1FBSA 3P7NA 2UWMA 3C1DA 3WODF 1IN8A 5HDNA 1ZN2A 2FEZA 1USTA 1HW1A 3M8FA 4U0VA 4HF2A 3L7WA 3TDUC 4A2UA 3J80K 1T6SA 4LK0F 4OIRF 4BXUA 1J59A 5FD5A 4EGYA 5KK1A 3CTAA 1ZGAA 3HUGA 4KN7X 2LF7A 2HQRA 5DCFA 2IT0A 1R36A 1LEAA 1ZYRF 2STTA 2CW0F 2OBPA 2PFBA 3GUDA 4ESFA 4EJTA 3D0SA 4I01A 1GHCA 2NRAC 4UVAA 4MHGA 5A2QK 1XGMA 5FLXZ 2KJCA 3DF8A 1BI2A 3QP6A 3WE2A 4PDKA 2A3SA 1JE8A 3QP5A 2IW5A 4H0EA 4G7HF 1YTYA 2F5CA 5CVJA 1U3EM 2MH9A 5DYMA 4KUMA 2YX7A 1STZA 2NNNA 3HHHA 4R79A 5FFXA 2EWNA 3ELKA 1KQ8A 2P6SA 1ZH5A 4FX0A 4A6EA 2E1NA 2G7UA 4EJOA 2IVMA 2RC4A 4GO1A 2P7VB 1LJ9A 2W24A 5DEQA 4ZYEA 1TQPA 1F5TA 5FD6A 3MQ0A 1TW2A 1FYLA 3CDHA 4I98B 1SD6A 2VBWA 4WXDA 3VEPA 1EV7A 1O3RA 5ILUA
chains in the Genus database with same CATH superfamily
1JHFA 4WK8F 5E17F 3QPLA 3V8JA 2EFPA 4HF0A 3GTOJ 3ZMDA 2ZXIA 4U7DA 3LQQA 2ZJPF 2OQGA 1FNNA 1O7LA 1MBJA 2HVRA 2C6YA 4RDUA 4AIHA 4IOAF 2AHQA 3KE2A 1J09A 2QLZA 2CMPA 4G6TB 2ELJA 5LBQA 1FTTA 1I6XA 3GFJA 2XAFA 4F55A 1LPQA 2P7CB 2BOLA 3ZQQA 5JHFA 5B66C 5HS7A 1B8IB 5HVQC 1MJ9A 3C18A 1YW8A 4M3DA 4EM0B 4HRIA 1IDZA 4BHBA 1XMXA 1Z3XA 2QEXI 5EGOA 5L3EA 4Y17A 4ANJA 2DTRA 2NS7A 1MD0A 3FM5A 2Q8KA 4M6VA 4HNVA 2DK5A 2EIKH 3BG3A 2KIUA 4IL6C 2WTEA 1R5HA 2OF7A 1AKHA 3W6KB 4LLLA 1P4XA 4JX6A 2IA2A 2EV6A 3BJAA 4A6DA 2BV6A 2LVSA 3A02A 1BN5A 2DK8A 2O8KA 2HGCA 3MWMA 3IKVA 2Y9ZA 1KYWA 2B63J 3NQOA 2E2IJ 2Z5UA 3ROUA 4AUXA 1X58A 3HRMA 3CUOA 4M74A 5D4RA 3RTRA 3FX3A 2XAUA 2DMUA 1RR8C 3O3KA 2NVTJ 3OY9A 3V7SA 4CCMA 1XGSA 3BCBA 1LQ1A 4NC8A 2DOFA 2NOGA 2R7DA 1LE8B 2RNJA 2DT5A 2V1UA 2QBYA 4UY8I 1IXRC 4O6JA 4CUGA 2LD5A 4XR6A 5IP6A 3LNQA 1KU7A 2GA1A 2BVLA 4BBSJ 1XMAA 4Y4RA 2DBBA 2VOPA 4CGZA 1XTAA 2ZSHB 1YLFA 3KP2A 4CYDA 1QNTA 2A6HF 3CMYA 1I1SA 3G2BA 4DNCA 3CUQB 5F1RA 2RAEA 2QUFA 4XORA 1SVMA 3DEUA 2V9KA 3LSMA 2PMZN 3TKYA 1MW7A 2HTJA 2YS9A 1YO5C 3OL3A 5E8GA 4UUSB 2MH2A 2HOSA 4DOZA 3DKWA 4MFEA 1MJBA 3CUQC 1QZEA 4G6DA 3M07A 3F6OA 5LRRA 4XLFA 1O3SA 4GYGA 2FU4A 4JX5A 2QSHX 4Q47A 2EZHA 1SMYF 4ZC3A 1TWGJ 1FPQA 4A0XA 2HI3A 5LEKA 3BR6A 1BC8C 1ETYA 3M1EA 1I3QJ 3KFWX 4A3LJ 3NWSA 1XCBA 3H5NA 3S2DJ 3O8GA 3GLLA 2NOJB 3HIFA 3K70D 4PCQA 3DPTA 1DGWY 4JX4A 4AYBA 3BZCA 1BOBA 2MFZA 3S3OA 4W97A 2NVUB 4AU7A 2DI3A 1G3SA 3N4MA 5ILVA 3T5XA 4FE7A 5IP7J 5KCMA 3F8BA 2O8XA 2UXXA 2PI0A 1FY7A 3KP5A 2HVQA 3IH4A 3Q5FA 3AL0C 2V6CA 3VB2A 4A3KJ 2NNYA 4RGUA 3L9FA 1GXQA 2ZJ2A 2Q0OA 4ON0A 2M2EA 4XKWA 2XSJC 3FXMA 5JR3A 2RN7A 2Z2SB 2XUBA 3HTUA 4AD9A 4M3BA 1YIOA 1IV6A 2RNGA 5KAIC 2Y9YA 4ZTJA 2TRTA 2CUFA 3BR1A 1O57A 4RAZA 3LAJA 3ZQIA 4I76A 3DV8A 2HEOA 5HOOA 5K7ZA 3R0AA 4KFCA 3K4MA 5J8FA 1HW5A 3CJRB 2L4AA 2GOXB 3GZ5A 2OQRA 1WJEA 5F0FA 3F9KA 3LWFA 1R4MB 3GMEA 4LIVA 1HCRA 1W7PB 2O9LA 2QSFX 4YIFA 2F5EA 2GZWA 2XVCA 5L3DA 2WBMA 2COMA 1X1AA 3VODA 2R7FA 5CKTA 4RB2C 3CCJI 3S93A 3O6BB 2KMUA 3CDIA 1TNSA 1XGNA 4F92B 1RNLA 5L3CA 2Z16A 3GTQJ 1PVEA 3RQIA 4Y15A 1MGTA 3PQKA 3AG1H 3LSGA 3PNVA 4YIIA 3VWBA 2DU9A 2F4MB 1OR7C 2R0QC 2L02A 5LGNA 4UVCA 5JVTA 3JREA 1UHSA 3E97A 3NEUA 4D9JA 5FGMA 4YFNF 2ZMEB 3BJ6A 3ABMH 3OR1C 4HQEA 3IV5A 3CO6C 1PP8F 2M1BA 2LFBA 3NARA 1RETA 3COAC 2I5UA 2JRTA 3BOQA 2XC7A 5K7FA 4K2EA 2K4BA 1FTZA 2PBIA 3M8EA 3N05A 2BY1A 4IEJA 1TT5B 3M7GA 5EEGA 1D8JA 1XX5A 4NC7A 3I59B 3HYIA 1KQ0A 2HFHA 2QCOA 4MQ9F 1JGSA 2HQNA 2BE5F 1IUFA 4PSXA 3H35A 4RMNA 2HQAA 4BGDA 4R1HA 5J4YA 2IGMA 4RA2A 2ELKA 2IS1A 4C3JJ 3F23A 2ADUA 4ZJZA 2YPRA 3BLYA 4OU0A 2OZUA 1U5TB 3E1SA 2X6OA 4U87A 1WZ2A 3ZMSA 3L2CA 3F22A 1NG7A 1Z9CA 1JKQC 1B72A 2STWA 1VTNC 1JKPC 4XNFA 1K4TA 3QU6A 1GV5A 4PGHA 1T0FA 1EF4A 2HKXA 3KP3A 5HS8A 2HQ5A 1YJWI 1MZBA 4BQOA 3A03A 2BEOA 2KKOA 2CQQA 2UV1A 1ZGWA 5GPAA 2LF8A 4M71A 2JUCA 5HS9A 2JVHA 2ACJA 1UMQA 3K4KA 5J4VA 4RLQA 2A6EF 3GZ6A 4S04A 2JUGA 4BNCA 3DEWA 2R3SA 5GAEJ 4HSRA 1S6LA 3I64A 5BMZA 2VPLA 2X1EA 4DBRA 4U7BA 3ABLH 2OD5A 2ZSIB 2P5KA 1TT0A 1WJFA 1IN5A 4NC6A 2DJNA 1V5EA 3RKXA 1LDJA 1U8BA 2XPUA 5LFAA 3CESA 4F7ZA 1DQUA 3B73A 3W3CA 3W2AA 4Y52J 1AU7A 2Y2ZA 4GRIA 1B9MA 1IUYA 3D5SC 3DLLF 1Z6RA 4A5NA 2WV0A 2NAZA 3GX4X 1RUOA 1IRZA 4WF2A 1W1WE 3CJQB 2F2EA 1T56A 5JVGF 4IOCF 2EH3A 1GDTA 2EFWA 1UCRA 3BR3A 1O3QA 2CFOA 3I0TA 5K1YA 1NG6A 2IS2A 2M34A 2PEXA 2X0LA 3TGNA 3OYNA 4KA4A 1S7EA 5JLXA 3DLAA 2V1NA 1HKQA 4RGRA 2Y48A 2VC1A 4A3BJ 4ZH4F 5HODA 3ZXSA 4MTDA 3CJNA 4U0WA 1YE9A 2HPMA 1Z21A 4WX9A 4KJZA 1JUPA 2BHZA 1N75A 1QU3A 4UV9A 4RGSA 2W82A 1KZHA 2M45A 3H0DA 1IDYA 1Y0NA 3OYCA 5F04A 3W6JB 2VOOA 2NVYJ 1BC7C 1P4AA 3I5UA 3SJMA 3CCLI 2DT6A 1L0OC 5GAGJ 1VFCA 1R22A 3P9IA 1D5VA 3S1RJ 2HTSA 2BY3A 1MNMC 3KX2A 1R71A 1XS9A 4RM3A 1QPIA 3GCMA 3HKZN 2K9MA 2R92J 3GFMA 1Z91A 1UG2A 3FXQA 2CV1A 4A3GJ 3SZPA 4L18B 2VODA 1R9TJ 1KA8A 1KONA 4ZDPA 3WG9A 1VQ8I 2W7NA 4WWCA 1YOVB 1OJLA 2E7XA 3SDBA 1D0YA 1K78A 2E7WA 2XIGA 2GXAA 1RKTA 2ZNZA 3GFLA 4I0AA 2GWRA 2XDVA 4M3EA 3Q9SA 1U78A 3SHFA 1VF9A 2JSCA 4XBFA 1RRJA 3H5AA 2R5YA 2Y0SN 1WJCA 2TDXA 5DS9A 3L09A 1W5CC 3FXLA 5FFZA 3BC8A 1X4PA 2LKPA 3GBGA 2HPIA 4KT6A 2X6XA 2CH0A 3VOEA 3FDYA 3EETA 4D0PA 2KPMA 2PMHA 2V9VA 3MEXA 2M3AA 2A68F 3HC7A 1YW7A 5EYRA 2BHYA 2Z9OA 1X2MA 3PO2J 3AG3H 4E7HA 3WU2C 3WTWC 2WAEA 4ZYAA 4Q48A 5CVUA 4EGZA 2DA2A 1I1GA 2LR8A 4HQMA 1MIJA 3GZNB 4BDYA 3C2GA 1VQMI 2HU9A 2VN2A 3I3LA 3HSRA 1ENHA 4OOIA 1OCPA 2Z33A 4R8HA 2VL8A 3W6VA 3HBLA 1RI7A 1ZG1A 4X0GA 4F91B 4EMSA 5LHGA 3EQLF 3C2HA 1N77A 1WJAA 3FKIJ 4UB6C 2DDAA 4NHJA 2RREA 4CXFA 3OIPA 5J6XA 1XSVA 2ID3A 1SFUA 1NH3A 3MCZA 4EQQA 4HDVA 1YJNI 4I99C 2HNHA 3F8NA 1OCZH 1JJ8C 5HLIA 3FKJA 3J7AY 2DMQA 3CCMI 3E0JB 2VI6A 3U1DA 4HW0A 2BXYA 4TV7A 4HPQA 3IRQA 3F21A 1ZRDA 2DOEA 1UFMA 2M8EA 1MBKA 1S7AA 1XMKA 4BS9A 2DMPA 3MVPA 2CUZA 1X2NA 1D1AA 4JOMA 5C4XJ 1K4SA 3HM5A 1BBYA 4HA8A 4E6KG 1XD7A 1FZPB 2ZXHA 2O7OA 2R7QA 4PSWA 2IXSA 2QQ9A 3S15J 2QZ8A 1SANA 2JA2A 2NYXA 5FKKA 5M3FJ 4J19A 1QHGA 1IG7A 2IRFG 3BQZA 4ITVA 3L2VA 4M72A 3RPQA 4AM3A 3A01B 4B09A 1T33A 4UB8C 2VKHA 1ZTRA 4HG2A 4Y33A 2QSGX 1A31A 1YX5A 3BROA 3W2WA 2LY1A 2QVOA 2KRHA 1E17A 3SYTA 3I55I 5ERIA 5H6RA 3TOAA 2QA4I 2EZLA 4ZZLA 3JRDA 2VQCA 5GAHJ 1HSTA 2CO5A 2XHKA 3OV8A 4FT8A 4I6ZA 3CMMA 2O0YA 5DD8A 1Z67A 2EIJH 2X6WA 4M9SA 4KDPA 1MMDA 3H0GJ 2IGOA 1CF7B 4KISA 1WH5A 1WKMA 2ISYA 2K9QA 4ZDOA 4AIJA 4ZZDA 5M5YJ 2KLOA 2E1MC 1B4AA 2NXNB 2Z1DA 3VPRA 1IAWA 2IS4A 2HOTA 3WTXC 5E20A 2R7OA 4HV6A 2AXTC 2QQBA 3I56I 3WU0A 3CD6I 1PP7U 2XPWA 2L0KA 1W0UA 3V4GA 2E60A 1SFXA 4EM1A 1H0MA 2CYYA 1FT9A 4PJJA 4IHYA 2ETHA 1LE8A 3HOZJ 2K3PA 1O4XA 5HDGA 2IGKA 3W2VA 3S2WA 2DPDA 2A5WA 1U0JA 3K4CA 2JPBA 4IHTA 4LD5A 5D8LB 2DCEA 1V4RA 3HG9A 2VE8A 1XC5A 2CGPA 1I6HJ 3BTIA 3R0JA 4N9IA 1I3AA 3SZGA 1USSA 1VQLI 4FCYA 1P9QC 2FMYA 3OYDA 3O8HA 1YJ9I 4BBRJ 4XLNF 1IRFA 4DIQA 1AOYA 4P1WA 1BOAA 4FQGA 4LGWA 4YFKF 5GPCA 2ICWG 3G3ZA 1POGA 3OS2A 3ZQCA 3A0HC 3ECHA 2VQGA 4M9ZA 2GA2A 2R5ZA 3H9GA 3LSTA 2HYFA 4UUSA 2DMNA 3DKYA 5GTIC 5JI6A 1OYYA 3WGHA 3QYBA 2J5PA 3E6MA 2ESNA 5FKOA 4BHPA 2IA0A 3RYRA 5FLMJ 4QTRA 1K61A 1LFUP 2BZTA 3HTSB 1OLTA 4NB5A 4G7OF 4QIWN 2OCCH 3OYHA 4LITA 2FQ3A 2L7KA 4XN0A 2FMLA 3K0LA 3K4BA 2ZFUA 3ABKH 4PJNA 1QGPA 5LHIA 2V4JC 3EYYA 3BZ6A 4B48A 2PLYA 3OYIA 2HXIA 3MZHA 4HLYA 1SFEA 2W85A 4P9UA 2HVSA 3FK6A 2RQQA 1NK3P 3WU1B 2JN6A 1BJZA 1HKTA 3DU6A 4A0ZA 4A93J 1BI3A 4HLXA 1JXSA 3EUAA 1ON2A 1HW2A 2VT3A 2DJIA 5CYVA 5AONA 4H4KC 4WXHA 2W25A 4C30A 1XSXA 2HDWA 1WWXA 1BA5A 1FBQA 5FLXK 3RSNA 4B43A 4CCOA 2NVXJ 3R60A 1FSHA 2QWWA 4FE4A 4YRVA 1BIAA 1F1ZA 3JTGA 2CWEA 3NAUA 3SZTA 4MEYF 1BR1A 4HX4A 5D5UB 1D1CA 2OC6A 4E7SA 3CF5F 4S05A 4ABZA 1OCRH 4O3MA 2FD5A 2DA5A 2RGVA 2L7MP 3WTVC 1IC8A 2JA8J 1ZHFA 2VUMJ 1ZARA 2QM3A 4XKVA 1QBJA 5EG0A 3IHUA 3GWZA 1X1BA 5K5QA 2JWTA 2TCTA 3LAPA 4S0HB 4CZCA 1FIAA 4C3HJ 3G73A 4KMUX 3VYSB 3FISA 2F5VA 2KIFA 2Z3YA 1ULYA 1Y6IA 3V8KA 1SFOJ 2YUSA 5J47A 1W7PA 2F6CA 5EEAA 2LH9A 1SEUA 3SQNA 1HDPA 4G7ZF 2L9NA 1BIBA 2IEKA 2R7ZJ 1QPMA 4A3IJ 5KAFC 2P5VA 2XF6A 5DV5A 4OINF 1DDNA 1H88C 3HSFA 4A3EJ 3TOBA 3HOSA 2MYSA 2L9RA 2OV7A 1Z7LA 2ME6A 1L3LA 2V26A 3BDDA 3FF5A 1IF1A 3GYHX 2GIZA 4Z2YA 3K4JA 1GUUA 1U2WA 3TP0A 1VQ4I 1W7PD 4D5CA 1RC9A 5TRDA 3BT9A 3HRSA 1A6IA 4BAYA 2ZMEA 2OCEA 4UUVA 2X48A 2HYGD 3LL7A 1EJ9A 2VC0A 2XV4S 3BTLA 2LTPA 1VQ6I 2DA7A 4M6XA 3DU5A 1CGPA 2DW4A 4IJAA 4FETA 2D2WA 1MH3A 4ENNA 3F3XA 1FOYA 1T39A 2AXLA 1BR4A 3AL0B 4HSTA 1LFPA 4BEHB 1HKSA 2DFIA 4JBAA 4BY7J 3I59A 3OYEA 2FJ1A 4KT5C 2MC4A 1MBEA 2HDDA 2YU3A 2DXIA 1XB4A 2F5DA 4CSWA 3PUBA 5J3LA 4MTEA 3ERED 3IAS2 1WCMJ 4D7MA 1JHHA 2BYVE 2XKOA 4Y3OA 5E79C 1SVLA 2QQAA 3L00A 2FBHA 5DCMB 3VFZA 1U5TA 5LHHA 2CRGA 5D8KB 3KETA 4BYYA 4V19K 2M9HA 1IRGA 3P5JA 5FO5A 3ZR8X 4BJ5C 4RGXA 2HWVA 3O2PE 1V5GA 2KIQA 5M5WJ 1PDNC 2FF4A 2FBIA 1I5ZA 3DTEA 2BW3B 2KRFA 5EGOB 4MIMA 2VBZA 4YIRX 2R7RA 1F43A 4ZYDA 3A1YA 4L9VA 3N97A 3E6DA 2QYOA 3S32A 2Y75A 4BHCA 3QAHA 2D1HA 2DLLA 4XK4A 4OMZA 3RKQA 1S29A 2IA1A 2CS3A 3E7LA 3IWFA 2KZGA 3SFIA 4GYIA 4UV8A 5KHDA 4CHUA 3K1NA 1FC3A 1AKHB 4XL9A 4AIKA 3GTLJ 4A3DJ 2VBYA 3PSIA 4G6QA 1ETKA 3HEFA 3HDDA 3S3NA 3BJOA 2CJJA 5C44J 2CUEA 1FOWA 3ZRGA 1ZKGA 4GXOA 1EH8A 2QF7A 3L2RA 3CC4I 5E18F 2PJRB 4YELA 1PUEE 1YI2I 1JT6A 2DFFA 2K27A 4KIFA 2LC2A 3FXUA 3QRFF 4A3CJ 1R5GA 5LLQA 4DW6A 3GXOA 2IJLA 2JRMA 2QQ8A 3VYTB 2X1CA 5IP9J 3RYPA 1VQNI 1S8NA 2R7XA 4E4HA 1MDMB 3U1KA 2BGCA 1A6QA 3PJRA 3HB9A 1UAAA 1OYIA 5FB2A 2QBYB 2L7ZA 3ZGKA 3KLNA 2K7LA 4P55A 3SXYA 1UHWA 4YEJA 3C3WA 3RKWA 4BE1A 1BJAA 2Q1ZB 1D1BA 4B44A 3HRTA 1LEBA 4LG0B 4L9JA 5DUIA 4E7JA 1XSDA 2Y31A 4G94A 1R7JA 1ZG5A 2DO7A 4A5MA 1K6YA 3TEDA 1X1CA 3HOVJ 2M87A 2E5NA 4XSZF 3I9V2 3CQZJ 2A05A 1YQAA 4EEFG 2UXNA 2Y30A 5LEJA 3KP6A 5DDGA 1FWZA 4LJZF 3K9TA 1ZGJA 4KYWA 2CSOA 5TJJA 1U8RA 1R5ID 1YFHA 3EDPA 3JSPA 1KU9A 5EDNA 1J75A 1U9OA 5H20A 4LLNA 1HXDA 2XB5A 4F52A 1E3OC 3E6CC 4PFPA 5BPDA 4CYCB 1QVTA 2OAZA 3F6VA 1D0XA 1XDSA 3WTSC 4HNTA 3D5RC 4IRIA 1S5LC 4EV0A 5IYDJ 4MNUA 4RB0A 3CMAI 2D5VA 2LDUA 5JHUA 3MKZA 1MBGA 1F9NA 2NS8A 3K70C 4XLHA 5FKLA 1OISA 2VJIA 1HOMA 2A69F 4L5IA 4BACA 4GCVA 4OAYA 3ONQA 2XGDA 3HGGA 3WTZA 2K40A 4J01A 3J7ZI 1GT0C 1OQYA 3U21A 1D8KA 2LOOA 4KIBA 2ZXWH 2M7BA 1EH6A 1MH4A 2KL4A 4A3FJ 1YIJI 1WJDA 1T2KA 2K5CA 1W5SA 1K79A 1X3WB 1BW5A 4M6YA 2W84A 1VZ0A 4XLEA 1BI0A 1XGOA 1BM9A 4HDUA 5LD2C 4B1RA 2I8DA 1WRJA 2MC3A 4LOCA 2LP0A 1J2XA 1X19A 2IS6A 3K2ZA 2XKPA 3JRCA 4B3AA 2ZO4A 2IPQX 2P8TA 2KHMA 1Y1WJ 4XKBA 5EZHA 3QQAA 4IHXA 2MLGA 3FBNB 2JT1A 5IOZA 4UNOA 3Q9VA 5AIPA 2X85A 3HXLA 5D4SA 3QOPA 1Y56A 1AWCA 3FXKA 3IL2A 1O3TA 4CO8A 5K7HA 3F8CA 3WE3A 2ZKZA 5E1XA 3RPUD 1KU3A 1K6OA 5EEHA 2MSYA 2K86A 1GXPA 1TWFJ 1DPUA 2OJED 4AVZA 5B3SH 3U2RA 4PFOA 2JA5J 2NS0A 4LK1F 3OOPA 4AWXB 1TQMA 2WY7Q 4RLFA 4BQAA 1U6GA 1IO2A 2VT2A 4I0BA 3GFIA 4GGGA 1QA6A 4BL0B 5L3GA 3PSFA 3A4CA 4G12A 2KDZA 2HDCA 3ASOH 1MBFA 2K9SA 4QLCU 1M1EB 2ZJQF 2O61A 1RESA 5F64A 3K4LA 1TWAJ 2OZ6A 3IAM2 1AHDP 5CVVA 3SDGA 1P2FA 3GTGJ 3IC7A 4CICA 1WJ5A 2GBYA 1S9HA 5ICEA 3F0CA 1FSEA 1RKWA 3A2KA 2EFNA 5J8CA 3KYCB 3D1NI 3CCQI 1N78A 3JR9A 1PUFA 1QVUA 1ZLJA 5BQTA 3CCVI 3E3VA 2UUZA 3QPSA 2H09A 4WXCA 4E7KA 3CDLA 2E5ZA 1WI3A 3OOUA 3LA3A 1FX7A 3VYRB 2M7AA 1JKOC 1F4KA 2UZKA 2ID6A 1JKRC 3KLOA 2EBIA 1FOKA 1WJBA 2IP2A 2XAJA 3CP8A 1RIOH 2O6GE 2KDOA 4BXXJ 3KZZA 3DP7A 2E71A 2VQLA 3TQNA 3L2QA 1Q1HA 3VSKA 4IX7A 3HKZA 1SFKA 3HJEA 3IH2A 3JRGA 3BWGA 1WVRA 1R4NB 2DN0A 4ESBA 3VDXA 3DQVC 4CH7A 4ZDLA 2F5FA 3ZP5A 3ECOA 3ULQB 2EFOA 3V8LA 5BOXA 2OTLI 4EJWA 3ESWB 2RKHA 2XF7A 4CA0A 4M3GA 5KVRA 2E2JJ 1CF7A 1DPRA 1ETWA 2DFEA 3DBLB 3OYGA 4QPOA 1SD5A 1E0EA 2E1CA 2B0LA 2V1DA 3M3YJ 2X51A 3CLOA 3F8MA 3BG9A 2M5WA 5FLVA 3UKGA 4PUSA 2CQKA 3IWZA 4DJAA 2P0WA 1J5YA 1T08B 2LSOA 3CMEI 2FBKA 4EVIA 2XB0X 3ML6A 1R1VA 3P9CA 4E7IA 4NNJA 5HDKA 3RQ4A 1T95A 2K85A 3ABTA 3BG6A 1I39A 2Y0SA 3DTIA 3FHZA 2KRCA 4W1UA 4QSHA 5F6FA 4BXFA 3NWTA 1G6NA 4L5JA 1S7OA 2VPRA 3K10A 2XASA 5L3BA 4IPAA 1V54H 1HF0A 3BPVA 2H1KA 3F8FA 3LFUA 3CCEI 4II2A 4CZZA 2E34A 2ZFWA 4D1QA 4B47A 2EV0A 1ERDA 3LSKA 1LUJB 2XGXA 4N4NB 1T0FC 1BL0A 1FMWA 3OIOA 1J0RA 3RIRA 5E3OA 3EUHA 5HLTA 4XRSG 1IGNA 1Y8RB 1TQIA 3CLQA 1JTYA 2CV2A 1TBXA 4YG2F 1ONVA 1G8XA 1UJ8A 5IT9Z 3ABUA 1Z1DA 3ZN0A 1Y39A 3H36A 2P6TA 3DTKA 3JRHA 2PX9A 4UVBA 3HOYJ 1V5FA 1EA3A 1QZYA 4LFUA 3LSRA 3I58A 1OYWA 2BBYA 2L3DA 3E6BA 4XRFA 5C4JJ 2W00A 3RKYA 3A0BC 2ZCWA 4J00A 2FSWA 3EYIA 3ZN1A 4HF1A 4IRHA 4OIOF 1ORKA 2EA2A 2ZXJA 4HEA2 4HAMA 1BI1A 4OIQF 1XG1A 1T8IA 1MSFC 2F4OB 3LOCA 4LG3A 1XN7A 1LVAA 3M4OJ 3HOWJ 2W1OA 3FXOA 1G3YA 1N25A 2JQ7A 5J1YA 1R58A 2L2OA 4E70A 3P9KA 5CLSA 2ZJRF 1W0TA 3C2BA 5DM6F 4IZZA 2W4SA 3OSGA 2MD5A 2Q2EB 3I4PA 1ETQA 1IN7A 3ZQHA 3RJPA 2LBFB 3FWEA 2J5OA 5TGTA 2RDPA 2R7UA 1YRNB 1P92A 3MZ8A 3PFIA 1B8IA 2AS5F 3HGYA 3TP3A 5D5WB 2E1MB 3TO9A 3GTJJ 3DXJF 4PJ0C 3S16J 1QQIA 3IP4B 4KNYA 3WG7H 1LDKB 3LQRA 4DZJA 4E7LA 2DA3A 4PZJA 4XOPA 2VJ5A 5E3NA 4ENKA 1FEXA 1RR7A 4X1EA 1FMVA 2WAQN 3BY6A 2GQQA 3HRUA 3JRIA 1IN6A 1K83J 3FBIB 2R93J 3PIOF 5ED4A 1UELB 3VYUB 3T1BA 5ILSA 4BE2A 1K78B 5CQGA 3ZMUA 2MW8A 2XAQA 3OMYA 4KIGA 2M4KA 3HPGA 3OIQA 3RZDJ 2KQRA 1HSJA 3CC7I 2FUG2 3JAMZ 3HL2A 1UG0A 2KZVA 2AQEA 4WCGA 2WB1A 4NQWB 1LNWA 2XROA 2R5YB 1FP2A 2M30A 2XRNA 3HHGA 5GTHC 1ZR2A 1ZRFA 4E7ZA 2BVMA 4A69C 2HZDA 3HOUJ 3JRBA 3DWLE 2FX0A 4P5OA 3SEQA 5HLGA 2R7SA 4HZFA 3T8TA 2WWYA 3ZMZA 5IY5H 1R49A 2CG4A 2MA3A 3FK7A 3BPXA 5HLHA 1SAUA 3GO5A 1J7KA 3RI4A 5DTDA 5DD4A 3KYDB 3GTPJ 5D6EA 2DT7B 4KITB 1B9NA 3TO7A 2FA5A 4F93B 3E5QA 1P4WA 4CCKA 2MD0A 2ZC2A 3IKTA 1NK2P 3FZVA 1TP4A 2Y69H 4P9FA 3TL4X 3CUQA 3KPHA 1OCOH 1CQTA 4I09A 4ETSA 1YX3A 3REOA 1V55H 3OYMA 1PJRA 1A35A 3DBRB 4RAGA 5ICGA 1UB9A 2GM4A 4V2FA 5IT9K 4L9TA 4BUPA 4CDGA 2EK5A 4IKFA 3K1PA 5JLWA 2QENA 2RV8A 4NUBA 3PIPF 2EZKA 4Q4ZF 3I4MJ 4FISA 4NBQA 4A0YA 4M3FA 1VQ9I 5IOYA 2JPCA 4RAYA 2P81A 1ON1A 2E2HJ 2CQ7A 2EZIA 4ENJA 1HQCA 1YHQI 2I10A 3HUGB 1X1PA 4BEHA 4RM2A 1SD7A 4EJVA 3R61A 1R23A 2KISA 2EINH 3H3ZA 4XSXF 4C2TA 4II3A 5M5XJ 2FQ4A 2R7VA 5JFRA 1Y1VJ 1Z6TA 3I4NJ 4LB6B 4YFXF 2VASA 3BTJA 1RUNA 5GADJ 3OS1A 1APLC 3UR3C 5DCMA 1MMNA 4BJTA 2XPVA 4Z6YA 2Y0MA 2X9DA 1W36C 3ZMTA 4DYQA 1ZAOA 3UNGC 3L1PA 3G71I 2KIMA 2KJBA 2A6TA 2ME0A 4IXAA 2H8WA 4XLPF 4C9YA 4DBQA 1G4DA 4XN3A 2H27A 1B1BA 2BW3A 2GOMA 2DA6A 1H8AC 1H9TA 3DEEA 1XDUA 1Z3YA 5F0CA 1JUMA 3ZMVA 3H9QA 3GEZA 4HV5A 2ISZA 4FX4A 1IXSB 3G4SI 1XPXA 1ZRCA 2B7EA 1OPCA 5TISC 3AAFA 4RS8A 4XRSA 3SEZA 4L0YB 2OU2A 3OL4A 3FMQA 3ZQLA 4A3JJ 2EB7A 1ZELA 2WA0A 2MLKA 4HOBA 4Y7NJ 3Q0WA 4PJMA 4IF4A 4C2UA 3JAMK 4MFDA 2FXAA 4RB3C 2JJ7A 1ZQ3P 2G7HA 3C7JA 3ZQGA 2PJRA 1FIPA 3KP4A 4HX7A 2A61A 3GTMJ 1WH7A 4Q5SF 1OR7A 3E5UA 3JRFA 1W4MA 2V9PA 5CQEA 5IPAA 3WTYC 2OTJI 1WFXA 3FXJA 4MLOA 2PG4A 2LYCA 4P96A 3KCCA 4A12A 4RB1A 1KYZA 1TC3C 1QO0D 2MBFA 3EUKL 4HX8A 1ZR4A 1MDMA 2CQNA 3BQYA 1A5JA 3MD2A 4FHTA 5HNHA 3JRAA 3DBHB 1P7IA 2LRDA 5FJ8J 1ZREA 2YX4A 2G9WA 3J7AO 2VLAA 4UXNA 4PJLA 4C3IJ 4KICA 4G8XA 3OYKA 1TNTA 2CFXA 5C3EJ 2LG4A 2X4HA 4IRGA 2BY0A 4B3XA 4LG0A 3GF2A 5E1WA 2V1XA 3MFKA 1IXCA 2D1VA 1P6RA 5B1BH 3KZYA 4OAZA 3DPUA 2VBXA 3QODA 2GLOA 1KGSA 1SD4A 2EILH 3I71A 5ICCA 4U0YA 5CVRA 3CCRI 3M1CA 3D5LA 2FNAA 5J1RA 1DP3A 2PMZA 3U9GA 2XRLA 1KU2A 3I53A 5B1AH 4ENMA 1X3UA 2LLKA 3OS0A 4AC0A 1GV2A 2HOAA 4XRMA 1QHHD 3G1OA 1B6AA 3AKZA 2R5ZB 4L9NA 3E5XA 2HKOA 3R4KA 2ESHA 2LMDA 4AYBN 2V79A 2XGCA 3S14J 4CYCA 3BTCA 2X6YA 3LFKA 3OYBA 4I2OA 3AG2H 2VJ4A 3ERMA 4ZYGA 3V7RA 2VE9A 3PNTA 3Q3SA 3S2HJ 2RVCA 4FASD 3K4NA 4CCJA 2ECCA 5LRSA 1YS7A 2WV1A 1IN4A 1WQ2A 1DP7P 2EV5A 5ICFA 3MKYB 1X3ZB 2E1OA 5B5EC 2VQHA 3V7CA 3CCUI 3HSEA 4C2MJ 1MKMA 3HZJA 4BH9A 3FXRA 1B59A 2HS5A 3RDIA 3JW4A 3MZYA 3DKXA 1SMTA 4BKXA 5CJ9A 4EM2A 3IUOA 2E36A 2CUJA 3K1MA 2YU9J 2LNBA 1VNDA 3H92A 3S8PA 1LDDA 3BR5A 4CCNA 1VI0A 2E19A 3PNYA 5F1JA 5BS6A 1Z7UA 3WTUC 1SC7A 4HBLA 4GDFA 3TBIA 2IAIA 2IBDA 2L01A 3FMRA 1JT0A 3H9JA 5CVIA 1J9IA 4IO9F 1D3YA 2XGEA 3LA2A 4N4OB 1GVJA 5EG0B 1S72I 2BXZA 1JTXA 4IHVA 2R7TA 3BZKA 1WGXA 3T8RA 1LKXA 1U9NA 3GTKJ 3CCYA 5FRMA 3FMSA 2PMUA 3AG4H 3ZQFA 4BQNA 1SVOA 3TO6A 1V3FA 3H3VK 1G59A 1P7JA 4NDLA 3WGGA 4IVNA 5DUKA 3CZ6A 1TL8A 2JVGA 1R1UA 3MKLA 2L9VA 2A5YB 2GXGA 2VONA 2DQRA 4XOTA 5K5RA 3FHNA 1WI9A 2EA4A 4CCLA 2VKDA 2R7WA 3BR0A 5IYCJ 1ETOA 2H94A 3Q0VA 4KMFA 2H8RA 5AIQA 1MMGA 4MO7A 4RAFA 5D5VB 1IJWC 2FOKA 4D7NA 1X1DA 4PGGA 1Y8QB 2COBA 2AO9A 3FM3A 2FOWA 1OKRA 1MNEA 3WGIA 5K5OA 2ECBA 1ETXA 3B6CA 2YSRA 4F3QA 3GW2A 1WSUA 2LY2A 2XAHA 4BE0A 1LB2A 5D5XB 4B8XA 1DGRM 2GIVA 2HZTA 1HC8A 4JYKA 4BU2A 2W57A 4L5EA 2F48A 1MJAA 2DFHA 5H6QA 1VQ5I 4M9XA 1TWCJ 2LREA 3NRVA 1E3PA 4LLGF 2L9SA 2QKLB 2DA4A 4G9YA 4ZYHA 2ZMEC 4JQFA 3L2WA 1HLVA 1EH7A 1T98A 2VKEA 3M8JA 1ZG3A 1S3JA 3QU3A 3LSPA 1HDDC 2A07F 3I54A 3OYJA 1TLHB 2M4GA 2WC2A 2FRHA 2EIMH 1A04A 2OPTA 3K7AJ 2PN6A 3QOEA 3QYEA 1VQPI 3F72A 4B4CA 1G3TA 2P5LC 2F4IA 1G3WA 3CO7C 3RPUA 1E3HA 1Z05A 2K9LA 1OMIA 2X1DA 5F27A 3S1MJ 4MGRA 1T38A 2EFQA 5J1UA 1FP1D 2XAGA 1O7FA 2CW8A 3KIOA 2DPUA 3VSLA 1YS6A 2FE3A 5E1ZB 2MABA 1FJLA 2BY2A 3S1NJ 1HBXG 3QWLA 2YR2A 3J81Z 2K3FA 2AQFA 1IRXA 3S3MA 2H6BA 2M8GX 4L0ZB 1R00A 1U5TC 5DM7F 3PQJA 3R6SA 3M9AA 3HPHA 1MMAA 1MBHA 1YYVA 5E3LA 1QZZA 3TW6A 3PO3J 1YG2A 4OIPF 3TDZC 5FKMA 3DFGA 4XLAA 1ZLKA 1DU0A 1ACIA 1QRYA 3WHCA 2B9SA 1I27A 4U88A 3H1CA 3ZQ7A 1BW6A 4I02A 1SAXA 3H5RA 1E2XA 2JMWA 2FNPA 2O3FA 3IRRA 5GP9A 2ZNYA 2OA4A 3T0YA 1Q1VA 3QPTA 5FROA 3JTHA 2P4WA 1LFBA 3RCOA 2WAFA 1FOXA 4I7HA 5CPRB 3J80Z 2K02A 3GVAA 3JSOA 2D45A 1R1TA 4BDZA 4MQVA 4AVPA 3KEOA 2L54A 4JK1X 1FLIA 3LMMA 3GLXA 1H89C 3HOXJ 1R6RA 2EJRA 3S17J 1JUSA 2HR3A 1X4OA 2K4JA 1RZ4A 1JI8A 4QPQA 1OFCX 1RPWA 3ZPLA 3OYFA 2DYRH 1W5TA 3CCSI 2ZBKA 3QPHA 4ZTFA 1UHMA 2DQLA 2W48A 4OWRB 4XQFA 2JZYA 2JTVA 2WADA 4RBOA 4MEXF 3PFYA 1TTYA 5LGTA 3DPLC 3KYLA 2E35A 2IGNA 3G1MA 2Q2EA 4LIUA 1XCVA 3A01A 1REPC 4KN4X 4IHWA 2LBFA 5FKNA 1GLNA 6PAXA 2N8GA 4JP0A 5M3MJ 1H9GA 4HYEA 1YRNA 1YW9A 2L4MA 2H1LA 5A2QZ 5EZGA 3MAJA 4XKCA 3ASNH 2M0MA 4EJUA 4LB5A 2DTZA 2DOAA 4XIDA 1UZCA 1C0WA 2V6EA 4LMYA 3CJTB 1Y0UA 4UUTA 2HOEA 5E8IA 4X6AJ 3AFHA 4M73A 3K69A 2H6CA 4Y13A 2EPFA 2VKVA 3DCFA 3HOTA 2JK3A 2RQPA 2VJJA 3WHBA 4DQ2A 1B72B 4N9HA 2L7FP 4A3MJ 4XLCA 4IHSA 2ELHA 2EQRA 2GAUA 3BP8A 1FBUA 1TW3A 4NQWA 1ITYA 3OR2C 2PJPA 2L5QA 1NTCA 2JSPA 3LA7A 4UHTA 5F0HA 4DZPA 2KFDA 2KT0A 2DMTA 3KP7A 1DU6A 5BPIA 3G1LA 4N0BA 4DGWB 1ETVA 5FRNA 4D5FA 1IZ1A 1AA7A 2GXBA 5KNLA 1F36A 4AIDA 4OMYA 2XF5A 3J81K 5BNGA 2PQ8A 3SFZA 1KQ9A 2R4GA 5L3FA 2O03A 5D6FA 4PK4A 1D0ZA 4O5VA 5IT3A 3QYFA 4HNUA 9ANTA 3KEQA 2VXZA 1NHAA 1DUXC 2ZB9A 3MKWB 1K7AA 1IW7F 2DAOA 2Z99A 5IYBJ 4ASNA 4GFBA 3BCAA 3EPZA 4ESJA 5F08A 3ISPA 3H3UA 2LKSA 1FYMA 4QWQA 3CC2I 5LGUA 2QGUA 3B02A 1FYKA 1ODDA 3WTTC 1FBSA 3P7NA 4DYRA 2UWMA 3C1DA 3WODF 1IN8A 5HDNA 3OSFA 1ZN2A 2FEZA 1USTA 4EATA 2XSDC 1Z0XA 1HW1A 3M8FA 4U0VA 3KZIC 4HF2A 2DA1A 3L7WA 3TDUC 4A2UA 3J80K 1T6SA 1ZK8A 4LK0F 4OIRF 4BXUA 5H2FC 3PL8A 4BY1J 1J59A 1MNDA 5FD5A 1VQ7I 1D5YA 4EGYA 2LKXA 5KK1A 3CTAA 1ZGAA 1IV8A 2DODA 3Q0UA 2DDBA 3HUGA 3OYLA 1OCCH 4KN7X 2LF7A 3JCUC 2HQRA 5DCFA 2IT0A 1R36A 1PUFB 1Z77A 1LEAA 1ZYRF 1HA8A 2STTA 1VQKI 4IQJA 2CW0F 3PUFA 2OBPA 2PFBA 3LSHA 3GUDA 3OWTA 2CV0A 4ESFA 4EJTA 1BR2A 3K2AA 3D0SA 3CF2A 3IH3A 2VIXA 4I01A 2CQXA 2JA6J 1GHCA 1PYVA 2NRAC 1I50J 4UVAA 4MHGA 5A2QK 1W36D 1XGMA 1GVDA 5FLXZ 2KJCA 3DF8A 3TMOA 3OYAA 3ZCOA 1BI2A 2G0EA 3B6AA 1LVKA 3BG5A 3QP6A 3WE2A 1MMSA 2VXDA 4PDKA 2MGQA 1A36A 2A3SA 1JE8A 3QP5A 3KEYA 1MSEC 2IW5A 3X2QH 3FIWA 4H0EA 4G7HF 2WB1N 1YTYA 2F5CA 2WAQA 5CVJA 1U3EM 2MH9A 4XONA 5EF6A 5DYMA 3LSJA 1YITI 3BR2A 3L2UA 1EKEA 4XICA 4FTHA 4KUMA 2YX7A 3ZOBA 3TW7A 5E3MA 1STZA 2NNNA 3HHHA 4R79A 2KP6A 2LY9A 5FFXA 2JA7J 2EWNA 3K6GA 1G2HA 3ELKA 2OUMA 3S1QJ 2HXOA 2V7FA 3CP2A 4DYCA 2DYSH 1WPKA 5J40A 4BJ6C 1OCTC 1KQ8A 3RZOJ 2P6SA 1ZH5A 2VB6A 4FX0A 4A6EA 4XMYA 2E1NA 3G6EI 5EJCA 2LK2A 2G7UA 3MN2A 5HNFA 4EJOA 4BQQA 2IVMA 2K9NA 2RC4A 1JJ6C 4GO1A 4IQ4A 1JGGA 2P7VB 1LJ9A 2W24A 5DEQA 4ZYEA 2HYJA 2MG4A 2CU7A 2NVQJ 1TQPA 1F5TA 5FD6A 4XM3A 1TWHJ 3J7YJ 3MQ0A 1TW2A 3LSIA 1FYLA 3CDHA 4I98B 1SD6A 1WHUA 2WY8Q 2VBWA 4WXDA 3V42A 3BG7A 4V2GA 3VEPA 1EV7A 2M0CA 3MMYB 2CW7A 3PM1A 2O5RA 3EUHC 1O3RA 5ILUA 1VQOI 2QKMB 1TZLA
chains in the Genus database with same CATH topology
1JHFA 4WK8F 5E17F 3V8JA 2EFPA 4HF0A 3ZMDA 4U7DA 3LQQA 2OQGA 1FNNA 1O7LA 2C6YA 4AIHA 3KE2A 2QLZA 5LBQA 1I6XA 3GFJA 2XAFA 2P7CB 5HS7A 5HVQC 1MJ9A 3C18A 1YW8A 4EM0B 4BHBA 5L3EA 4Y17A 2DTRA 1MD0A 3FM5A 2Q8KA 2DK5A 2KIUA 2WTEA 1R5HA 3W6KB 4LLLA 1P4XA 2IA2A 2EV6A 3BJAA 4A6DA 2BV6A 1BN5A 2DK8A 2HGCA 3MWMA 3IKVA 1KYWA 3NQOA 2Z5UA 3ROUA 3HRMA 3CUOA 4M74A 5D4RA 3RTRA 3FX3A 3O3KA 3V7SA 1XGSA 1LQ1A 2R7DA 2RNJA 2DT5A 2V1UA 2QBYA 1IXRC 4O6JA 1KU7A 2GA1A 1XMAA 2DBBA 2VOPA 4CGZA 1YLFA 3KP2A 4CYDA 1QNTA 2A6HF 1I1SA 4DNCA 3CUQB 5F1RA 2QUFA 3DEUA 3TKYA 2HTJA 1YO5C 5E8GA 2MH2A 3DKWA 1MJBA 3CUQC 4G6DA 3F6OA 5LRRA 1O3SA 4GYGA 2FU4A 4Q47A 1SMYF 1FPQA 4A0XA 5LEKA 1BC8C 3M1EA 3KFWX 1XCBA 3HIFA 4PCQA 3DPTA 2DI3A 1G3SA 3N4MA 5ILVA 3T5XA 3F8BA 2O8XA 2UXXA 2PI0A 1FY7A 3KP5A 3Q5FA 2V6CA 3VB2A 2NNYA 4RGUA 3L9FA 1GXQA 2ZJ2A 2Q0OA 4ON0A 5JR3A 2RN7A 2XUBA 3HTUA 4AD9A 1YIOA 1O57A 4RAZA 3LAJA 3DV8A 2HEOA 5HOOA 3R0AA 4KFCA 5J8FA 1HW5A 2L4AA 3GZ5A 2OQRA 3LWFA 1W7PB 4YIFA 2F5EA 2GZWA 2XVCA 5L3DA 2COMA 3VODA 2R7FA 4RB2C 3O6BB 1TNSA 1XGNA 5L3CA 1RNLA 4Y15A 1MGTA 3PQKA 4YIIA 2DU9A 2L02A 5LGNA 4UVCA 5JVTA 3E97A 3NEUA 5FGMA 4YFNF 2ZMEB 3BJ6A 4HQEA 1PP8F 3CO6C 2M1BA 3COAC 3BOQA 2JRTA 4K2EA 2K4BA 2PBIA 3M8EA 3M7GA 5EEGA 1D8JA 3I59B 3HYIA 1KQ0A 2HFHA 4MQ9F 1JGSA 2HQNA 2BE5F 4R1HA 3F23A 2ADUA 2YPRA 4OU0A 2OZUA 1U5TB 3ZMSA 3L2CA 3F22A 1Z9CA 2STWA 1VTNC 3QU6A 4PGHA 1T0FA 2HKXA 3KP3A 5HS8A 1MZBA 2BEOA 2KKOA 2LF8A 4M71A 5HS9A 2ACJA 2A6EF 3GZ6A 4S04A 4BNCA 2R3SA 1S6LA 3I64A 5BMZA 4U7BA 2OD5A 2P5KA 1IN5A 3RKXA 1LDJA 4F7ZA 3B73A 1B9MA 1IUYA 1Z6RA 4A5NA 2WV0A 2NAZA 3GX4X 1RUOA 4WF2A 2F2EA 2EFWA 1UCRA 1O3QA 3I0TA 5K1YA 2PEXA 2X0LA 3TGNA 4KA4A 1HKQA 4RGRA 2Y48A 2VC1A 4ZH4F 4MTDA 3CJNA 4U0WA 4WX9A 4UV9A 4RGSA 2M45A 3W6JB 2VOOA 1BC7C 1P4AA 3I5UA 1L0OC 1R22A 3P9IA 1D5VA 2HTSA 3GFMA 1Z91A 3FXQA 3SZPA 4L18B 2VODA 1KA8A 3WG9A 4WWCA 2E7XA 1K78A 2E7WA 2XIGA 2ZNZA 3GFLA 4I0AA 2GWRA 3Q9SA 1U78A 3SHFA 2JSCA 4XBFA 2TDXA 3L09A 5FFZA 2LKPA 3VOEA 4D0PA 3EETA 2PMHA 2V9VA 3MEXA 2A68F 1YW7A 2Z9OA 3WTWC 4Q48A 5CVUA 4EGZA 1I1GA 4HQMA 2VN2A 3HSRA 4OOIA 2Z33A 4R8HA 1RI7A 1ZG1A 4EMSA 5LHGA 3EQLF 4NHJA 4CXFA 5J6XA 1XSVA 1SFUA 3MCZA 4EQQA 4HDVA 3F8NA 5HLIA 3U1DA 4HW0A 3IRQA 4TV7A 3F21A 1ZRDA 1UFMA 2M8EA 1XMKA 1S7AA 4HA8A 1BBYA 1XD7A 1FZPB 2QQ9A 2QZ8A 2NYXA 2IRFG 4M72A 3RPQA 4B09A 3BROA 2QVOA 1E17A 5ERIA 5H6RA 3TOAA 4ZZLA 1HSTA 2CO5A 2XHKA 3OV8A 4FT8A 2O0YA 5DD8A 4M9SA 4KDPA 1CF7B 1WKMA 2ISYA 4AIJA 4ZZDA 1B4AA 1IAWA 3WTXC 5E20A 4HV6A 2QQBA 3WU0A 1PP7U 3V4GA 1SFXA 4EM1A 1H0MA 2CYYA 1FT9A 2ETHA 5HDGA 3S2WA 2DPDA 2JPBA 4IHTA 4LD5A 5D8LB 1V4RA 2VE8A 2CGPA 3R0JA 4N9IA 1USSA 2FMYA 4XLNF 1IRFA 1AOYA 1BOAA 4LGWA 4YFKF 3G3ZA 3ECHA 4M9ZA 2GA2A 3LSTA 2HYFA 5JI6A 1OYYA 3WGHA 2J5PA 3E6MA 2ESNA 4BHPA 2IA0A 3RYRA 3HTSB 4NB5A 4G7OF 2FQ3A 2FMLA 3K0LA 1QGPA 5LHIA 3EYYA 3BZ6A 2PLYA 3MZHA 4HLYA 1SFEA 2W85A 4P9UA 3WU1B 1HKTA 4A0ZA 1BI3A 4HLXA 1JXSA 1ON2A 1HW2A 2VT3A 5CYVA 5AONA 4WXHA 2W25A 1XSXA 1WWXA 1FBQA 5FLXK 3R60A 1FSHA 2QWWA 3JTGA 1BIAA 1F1ZA 2CWEA 3SZTA 4MEYF 5D5UB 4HX4A 4S05A 4O3MA 2RGVA 3WTVC 1ZHFA 1ZARA 2QM3A 1QBJA 3IHUA 3GWZA 5K5QA 3LAPA 3G73A 4KMUX 2KIFA 2Z3YA 1ULYA 3V8KA 1W7PA 3SQNA 4G7ZF 1BIBA 1QPMA 2P5VA 5DV5A 4OINF 1DDNA 3HSFA 3TOBA 3HOSA 1L3LA 3BDDA 3FF5A 1IF1A 3GYHX 4Z2YA 1U2WA 1W7PD 5TRDA 3HRSA 4BAYA 2ZMEA 4UUVA 2HYGD 2VC0A 2XV4S 4M6XA 1CGPA 2DW4A 4IJAA 2D2WA 4ENNA 3F3XA 1T39A 2AXLA 1HKSA 2DFIA 4JBAA 3I59A 4KT5C 2YU3A 1XB4A 2F5DA 3ERED 4MTEA 1JHHA 2BYVE 2XKOA 2QQAA 3L00A 2FBHA 5DCMB 3VFZA 1U5TA 5LHHA 5D8KB 3KETA 4BYYA 1IRGA 5FO5A 4RGXA 2HWVA 3O2PE 1PDNC 2FF4A 2FBIA 1I5ZA 2KRFA 2VBZA 4ZYDA 3N97A 4L9VA 3E6DA 2QYOA 2Y75A 4BHCA 3QAHA 2D1HA 2DLLA 4OMZA 1S29A 2IA1A 3IWFA 4GYIA 4UV8A 4CHUA 3K1NA 1FC3A 4AIKA 2VBYA 4G6QA 3BJOA 4GXOA 1EH8A 5E18F 1PUEE 2K27A 4KIFA 3FXUA 3QRFF 5LLQA 1R5GA 3GXOA 2IJLA 3RYPA 1S8NA 1MDMB 2BGCA 1OYIA 5FB2A 2QBYB 3KLNA 2K7LA 4P55A 3SXYA 1UHWA 3C3WA 3RKWA 1BJAA 3HRTA 1LEBA 4LG0B 4L9JA 5DUIA 1XSDA 4G94A 1R7JA 1ZG5A 2DO7A 4A5MA 2M87A 4XSZF 1YQAA 2UXNA 5LEJA 3KP6A 5DDGA 1FWZA 4LJZF 3K9TA 1ZGJA 4KYWA 2CSOA 5TJJA 1U8RA 1YFHA 3EDPA 3JSPA 1KU9A 1J75A 4LLNA 5H20A 1HXDA 3E6CC 5BPDA 2OAZA 3F6VA 1XDSA 3WTSC 4IRIA 4EV0A 4MNUA 4RB0A 2LDUA 5JHUA 1F9NA 2A69F 4L5IA 4GCVA 3WTZA 1D8KA 4KIBA 1EH6A 1T2KA 1W5SA 1K79A 4M6YA 2W84A 1BI0A 1XGOA 1BM9A 4HDUA 1WRJA 2MC3A 1J2XA 3K2ZA 2XKPA 2ZO4A 2IPQX 2P8TA 2MLGA 2JT1A 4UNOA 3Q9VA 5AIPA 5D4SA 3QOPA 1AWCA 3IL2A 1O3TA 4CO8A 3F8CA 3WE3A 2ZKZA 5E1XA 1KU3A 1K6OA 5EEHA 2K86A 1GXPA 1DPUA 3U2RA 2NS0A 4LK1F 3OOPA 4AWXB 1TQMA 4BQAA 1U6GA 2VT2A 4I0BA 3GFIA 4GGGA 5L3GA 2HDCA 4QLCU 2O61A 5F64A 2OZ6A 5CVVA 1P2FA 3IC7A 4CICA 5ICEA 1FSEA 2EFNA 5J8CA 5BQTA 1ZLJA 3E3VA 2H09A 4WXCA 3LA3A 1FX7A 1F4KA 2UZKA 3KLOA 1FOKA 2IP2A 2XAJA 1RIOH 2O6GE 3KZZA 3DP7A 3TQNA 1Q1HA 3BWGA 4ESBA 3DQVC 2F5FA 3ZP5A 3ECOA 3ULQB 2EFOA 3V8LA 5BOXA 4EJWA 2RKHA 5KVRA 1CF7A 1DPRA 1SD5A 2E1CA 2B0LA 2V1DA 3CLOA 3F8MA 2M5WA 2CQKA 3IWZA 1J5YA 2LSOA 2FBKA 4EVIA 3ML6A 1R1VA 3P9CA 5HDKA 3ABTA 3FHZA 5F6FA 1G6NA 4L5JA 1S7OA 2XASA 5L3BA 4IPAA 3BPVA 3F8FA 4CZZA 2ZFWA 2EV0A 2XGXA 1J0RA 3RIRA 3EUHA 1TQIA 1TBXA 4YG2F 1ONVA 5IT9Z 3ABUA 1Z1DA 3ZN0A 2P6TA 4UVBA 1QZYA 4LFUA 3I58A 1OYWA 2BBYA 2L3DA 3E6BA 4XRFA 3RKYA 2ZCWA 3EYIA 2FSWA 3ZN1A 4HF1A 4IRHA 4OIOF 2EA2A 2ZXJA 4HAMA 1BI1A 4OIQF 1XN7A 1LVAA 1G3YA 1R58A 4E70A 3P9KA 5CLSA 2MD5A 3I4PA 1IN7A 3RJPA 3FWEA 2J5OA 2RDPA 1P92A 3PFIA 2AS5F 5D5WB 3TO9A 3DXJF 1QQIA 4KNYA 1LDKB 3LQRA 4PZJA 4ENKA 2GQQA 3BY6A 3HRUA 1IN6A 5ED4A 3T1BA 5ILSA 1K78B 3ZMUA 2XAQA 4KIGA 1HSJA 3JAMZ 4WCGA 1LNWA 2XROA 1FP2A 2M30A 2XRNA 3HHGA 1ZRFA 4P5OA 5HLGA 4HZFA 3T8TA 2WWYA 3ZMZA 2CG4A 2MA3A 3BPXA 5HLHA 3GO5A 1J7KA 3RI4A 5DD4A 5D6EA 1B9NA 3TO7A 2FA5A 3E5QA 1P4WA 3IKTA 3FZVA 4P9FA 3CUQA 4I09A 4ETSA 3REOA 5ICGA 1UB9A 5IT9K 4L9TA 4CDGA 2EK5A 3K1PA 2QENA 2RV8A 4Q4ZF 4A0YA 2JPCA 4RAYA 1ON1A 4ENJA 1HQCA 1SD7A 4EJVA 3R61A 1R23A 3H3ZA 4XSXF 5JFRA 1Z6TA 4LB6B 4YFXF 1RUNA 5DCMA 2Y0MA 3ZMTA 1ZAOA 2KIMA 2KJBA 4IXAA 4XLPF 1G4DA 2H27A 1B1BA 1H9TA 1XDUA 3ZMVA 3GEZA 4HV5A 2ISZA 4FX4A 1IXSB 1ZRCA 1OPCA 3AAFA 4RS8A 4L0YB 2OU2A 3FMQA 2EB7A 2MLKA 4HOBA 4IF4A 3JAMK 2FXAA 4RB3C 2G7HA 3C7JA 3KP4A 4HX7A 2A61A 4Q5SF 1OR7A 3E5UA 1W4MA 3WTYC 4P96A 2PG4A 4A12A 3KCCA 4RB1A 1KYZA 1QO0D 2MBFA 4HX8A 1MDMA 4FHTA 1ZREA 2YX4A 2G9WA 3J7AO 4UXNA 4KICA 4G8XA 1TNTA 2CFXA 2X4HA 4IRGA 4LG0A 3GF2A 5E1WA 2V1XA 3MFKA 1IXCA 2D1VA 1P6RA 3KZYA 2VBXA 1KGSA 1SD4A 3I71A 5ICCA 4U0YA 5CVRA 3D5LA 2FNAA 3U9GA 3I53A 1KU2A 4ENMA 1X3UA 1B6AA 4L9NA 3E5XA 2HKOA 3R4KA 2ESHA 2V79A 3LFKA 4I2OA 4ZYGA 3V7RA 2VE9A 2RVCA 5LRSA 1YS7A 1IN4A 1WQ2A 1DP7P 2EV5A 5ICFA 3V7CA 3HSEA 1MKMA 4BH9A 3FXRA 1B59A 2HS5A 3RDIA 3JW4A 3MZYA 1SMTA 5CJ9A 4EM2A 3K1MA 2LNBA 3H92A 1LDDA 5BS6A 1Z7UA 3WTUC 4HBLA 2L01A 3FMRA 5CVIA 1J9IA 1D3YA 3LA2A 1GVJA 3T8RA 3FMSA 2PMUA 3TO6A 1V3FA 3WGGA 4IVNA 5DUKA 1R1UA 2A5YB 2GXGA 2VONA 2DQRA 5K5RA 1WI9A 2EA4A 4KMFA 2H94A 5AIQA 5D5VB 2FOKA 4PGGA 3FM3A 1OKRA 3WGIA 5K5OA 2YSRA 3GW2A 1WSUA 2XAHA 1LB2A 5D5XB 4B8XA 2GIVA 2HZTA 2W57A 1MJAA 5H6QA 4M9XA 3NRVA 4LLGF 4G9YA 4ZYHA 4JQFA 1EH7A 1T98A 2A07F 3QU3A 1ZG3A 1S3JA 3I54A 1TLHB 2WC2A 2FRHA 1A04A 2PN6A 3F72A 1G3TA 2P5LC 1G3WA 3CO7C 3RPUA 1Z05A 1OMIA 4MGRA 1T38A 2EFQA 1FP1D 2XAGA 1O7FA 2DPUA 1YS6A 2FE3A 5E1ZB 1HBXG 2YR2A 3J81Z 2H6BA 4L0ZB 1R00A 1U5TC 3PQJA 3R6SA 3M9AA 1YYVA 1QZZA 1YG2A 4OIPF 3TDZC 3DFGA 1ZLKA 1I27A 4U88A 3ZQ7A 4I02A 1SAXA 1E2XA 2FNPA 2O3FA 3IRRA 2ZNYA 2OA4A 3T0YA 3QPTA 3JTHA 2P4WA 4I7HA 3J80Z 2K02A 3GVAA 3JSOA 2D45A 1R1TA 4MQVA 4AVPA 3KEOA 2L54A 4JK1X 1FLIA 3GLXA 2EJRA 2HR3A 2K4JA 1RZ4A 3ZPLA 1W5TA 2ZBKA 3QPHA 1UHMA 2DQLA 2JZYA 2JTVA 4MEXF 1TTYA 5LGTA 3DPLC 2Q2EA 1REPC 1XCVA 4KN4X 6PAXA 1H9GA 4HYEA 1YW9A 2L4MA 5A2QZ 3MAJA 4EJUA 4LB5A 1C0WA 4LMYA 1Y0UA 2HOEA 5E8IA 4M73A 3K69A 2H6CA 4Y13A 3HOTA 2RQPA 4DQ2A 4N9HA 4IHSA 2ELHA 2GAUA 3BP8A 1FBUA 1TW3A 4NQWA 2PJPA 3LA7A 4UHTA 3KP7A 5BPIA 4N0BA 1IZ1A 2GXBA 4OMYA 3J81K 2PQ8A 3SFZA 1KQ9A 5L3FA 2O03A 5D6FA 4O5VA 5IT3A 3KEQA 2VXZA 1NHAA 1DUXC 1K7AA 1IW7F 2DAOA 2Z99A 4ASNA 4ESJA 3ISPA 3H3UA 1FYMA 4QWQA 5LGUA 3B02A 1FYKA 1ODDA 3WTTC 1FBSA 3P7NA 2UWMA 3C1DA 3WODF 1IN8A 5HDNA 1ZN2A 2FEZA 1USTA 1HW1A 3M8FA 4U0VA 4HF2A 3L7WA 3TDUC 4A2UA 3J80K 1T6SA 4LK0F 4OIRF 4BXUA 1J59A 5FD5A 4EGYA 5KK1A 3CTAA 1ZGAA 3HUGA 4KN7X 2LF7A 2HQRA 5DCFA 2IT0A 1R36A 1LEAA 1ZYRF 2STTA 2CW0F 2OBPA 2PFBA 3GUDA 4ESFA 4EJTA 3D0SA 4I01A 1GHCA 2NRAC 4UVAA 4MHGA 5A2QK 1XGMA 5FLXZ 2KJCA 3DF8A 1BI2A 3QP6A 3WE2A 4PDKA 2A3SA 1JE8A 3QP5A 2IW5A 4H0EA 4G7HF 1YTYA 2F5CA 5CVJA 1U3EM 2MH9A 5DYMA 4KUMA 2YX7A 1STZA 2NNNA 3HHHA 4R79A 5FFXA 2EWNA 3ELKA 1KQ8A 2P6SA 1ZH5A 4FX0A 4A6EA 2E1NA 2G7UA 4EJOA 2IVMA 2RC4A 4GO1A 2P7VB 1LJ9A 2W24A 5DEQA 4ZYEA 1TQPA 1F5TA 5FD6A 3MQ0A 1TW2A 1FYLA 3CDHA 4I98B 1SD6A 2VBWA 4WXDA 3VEPA 1EV7A 1O3RA 5ILUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHF A;  4WK8 F;  5E17 F;  3V8J A;  2EFP A;  4HF0 A;  3ZMD A;  4U7D A;  3LQQ A;  2OQG A;  1FNN A;  1O7L A;  2C6Y A;  4AIH A;  3KE2 A;  2QLZ A;  5LBQ A;  1I6X A;  3GFJ A;  2XAF A;  2P7C B;  5HS7 A;  5HVQ C;  1MJ9 A;  3C18 A;  1YW8 A;  4EM0 B;  4BHB A;  5L3E A;  4Y17 A;  2DTR A;  1MD0 A;  3FM5 A;  2Q8K A;  2DK5 A;  2KIU A;  2WTE A;  1R5H A;  3W6K B;  4LLL A;  1P4X A;  2IA2 A;  2EV6 A;  3BJA A;  4A6D A;  2BV6 A;  1BN5 A;  2DK8 A;  2HGC A;  3MWM A;  3IKV A;  1KYW A;  3NQO A;  2Z5U A;  3ROU A;  3HRM A;  3CUO A;  4M74 A;  5D4R A;  3RTR A;  3FX3 A;  3O3K A;  3V7S A;  1XGS A;  1LQ1 A;  2R7D A;  2RNJ A;  2DT5 A;  2V1U A;  2QBY A;  1IXR C;  4O6J A;  1KU7 A;  2GA1 A;  1XMA A;  2DBB A;  2VOP A;  4CGZ A;  1YLF A;  3KP2 A;  4CYD A;  1QNT A;  2A6H F;  1I1S A;  4DNC A;  3CUQ B;  5F1R A;  2QUF A;  3DEU A;  3TKY A;  2HTJ A;  1YO5 C;  5E8G A;  2MH2 A;  3DKW A;  1MJB A;  3CUQ C;  4G6D A;  3F6O A;  5LRR A;  1O3S A;  4GYG A;  2FU4 A;  4Q47 A;  1SMY F;  1FPQ A;  4A0X A;  5LEK A;  1BC8 C;  3M1E A;  3KFW X;  1XCB A;  3HIF A;  4PCQ A;  3DPT A;  2DI3 A;  1G3S A;  3N4M A;  5ILV A;  3T5X A;  3F8B A;  2O8X A;  2UXX A;  2PI0 A;  1FY7 A;  3KP5 A;  3Q5F A;  2V6C A;  3VB2 A;  2NNY A;  4RGU A;  3L9F A;  1GXQ A;  2ZJ2 A;  2Q0O A;  4ON0 A;  5JR3 A;  2RN7 A;  2XUB A;  3HTU A;  4AD9 A;  1YIO A;  1O57 A;  4RAZ A;  3LAJ A;  3DV8 A;  2HEO A;  5HOO A;  3R0A A;  4KFC A;  5J8F A;  1HW5 A;  2L4A A;  3GZ5 A;  2OQR A;  3LWF A;  1W7P B;  4YIF A;  2F5E A;  2GZW A;  2XVC A;  5L3D A;  2COM A;  3VOD A;  2R7F A;  4RB2 C;  3O6B B;  1TNS A;  1XGN A;  5L3C A;  1RNL A;  4Y15 A;  1MGT A;  3PQK A;  4YII A;  2DU9 A;  2L02 A;  5LGN A;  4UVC A;  5JVT A;  3E97 A;  3NEU A;  5FGM A;  4YFN F;  2ZME B;  3BJ6 A;  4HQE A;  1PP8 F;  3CO6 C;  2M1B A;  3COA C;  3BOQ A;  2JRT A;  4K2E A;  2K4B A;  2PBI A;  3M8E A;  3M7G A;  5EEG A;  1D8J A;  3I59 B;  3HYI A;  1KQ0 A;  2HFH A;  4MQ9 F;  1JGS A;  2HQN A;  2BE5 F;  4R1H A;  3F23 A;  2ADU A;  2YPR A;  4OU0 A;  2OZU A;  1U5T B;  3ZMS A;  3L2C A;  3F22 A;  1Z9C A;  2STW A;  1VTN C;  3QU6 A;  4PGH A;  1T0F A;  2HKX A;  3KP3 A;  5HS8 A;  1MZB A;  2BEO A;  2KKO A;  2LF8 A;  4M71 A;  5HS9 A;  2ACJ A;  2A6E F;  3GZ6 A;  4S04 A;  4BNC A;  2R3S A;  1S6L A;  3I64 A;  5BMZ A;  4U7B A;  2OD5 A;  2P5K A;  1IN5 A;  3RKX A;  1LDJ A;  4F7Z A;  3B73 A;  1B9M A;  1IUY A;  1Z6R A;  4A5N A;  2WV0 A;  2NAZ A;  3GX4 X;  1RUO A;  4WF2 A;  2F2E A;  2EFW A;  1UCR A;  1O3Q A;  3I0T A;  5K1Y A;  2PEX A;  2X0L A;  3TGN A;  4KA4 A;  1HKQ A;  4RGR A;  2Y48 A;  2VC1 A;  4ZH4 F;  4MTD A;  3CJN A;  4U0W A;  4WX9 A;  4UV9 A;  4RGS A;  2M45 A;  3W6J B;  2VOO A;  1BC7 C;  1P4A A;  3I5U A;  1L0O C;  1R22 A;  3P9I A;  1D5V A;  2HTS A;  3GFM A;  1Z91 A;  3FXQ A;  3SZP A;  4L18 B;  2VOD A;  1KA8 A;  3WG9 A;  4WWC A;  2E7X A;  1K78 A;  2E7W A;  2XIG A;  2ZNZ A;  3GFL A;  4I0A A;  2GWR A;  3Q9S A;  1U78 A;  3SHF A;  2JSC A;  4XBF A;  2TDX A;  3L09 A;  5FFZ A;  2LKP A;  3VOE A;  4D0P A;  3EET A;  2PMH A;  2V9V A;  3MEX A;  2A68 F;  1YW7 A;  2Z9O A;  3WTW C;  4Q48 A;  5CVU A;  4EGZ A;  1I1G A;  4HQM A;  2VN2 A;  3HSR A;  4OOI A;  2Z33 A;  4R8H A;  1RI7 A;  1ZG1 A;  4EMS A;  5LHG A;  3EQL F;  4NHJ A;  4CXF A;  5J6X A;  1XSV A;  1SFU A;  3MCZ A;  4EQQ A;  4HDV A;  3F8N A;  5HLI A;  3U1D A;  4HW0 A;  3IRQ A;  4TV7 A;  3F21 A;  1ZRD A;  1UFM A;  2M8E A;  1XMK A;  1S7A A;  4HA8 A;  1BBY A;  1XD7 A;  1FZP B;  2QQ9 A;  2QZ8 A;  2NYX A;  2IRF G;  4M72 A;  3RPQ A;  4B09 A;  3BRO A;  2QVO A;  1E17 A;  5ERI A;  5H6R A;  3TOA A;  4ZZL A;  1HST A;  2CO5 A;  2XHK A;  3OV8 A;  4FT8 A;  2O0Y A;  5DD8 A;  4M9S A;  4KDP A;  1CF7 B;  1WKM A;  2ISY A;  4AIJ A;  4ZZD A;  1B4A A;  1IAW A;  3WTX C;  5E20 A;  4HV6 A;  2QQB A;  3WU0 A;  1PP7 U;  3V4G A;  1SFX A;  4EM1 A;  1H0M A;  2CYY A;  1FT9 A;  2ETH A;  5HDG A;  3S2W A;  2DPD A;  2JPB A;  4IHT A;  4LD5 A;  5D8L B;  1V4R A;  2VE8 A;  2CGP A;  3R0J A;  4N9I A;  1USS A;  2FMY A;  4XLN F;  1IRF A;  1AOY A;  1BOA A;  4LGW A;  4YFK F;  3G3Z A;  3ECH A;  4M9Z A;  2GA2 A;  3LST A;  2HYF A;  5JI6 A;  1OYY A;  3WGH A;  2J5P A;  3E6M A;  2ESN A;  4BHP A;  2IA0 A;  3RYR A;  3HTS B;  4NB5 A;  4G7O F;  2FQ3 A;  2FML A;  3K0L A;  1QGP A;  5LHI A;  3EYY A;  3BZ6 A;  2PLY A;  3MZH A;  4HLY A;  1SFE A;  2W85 A;  4P9U A;  3WU1 B;  1HKT A;  4A0Z A;  1BI3 A;  4HLX A;  1JXS A;  1ON2 A;  1HW2 A;  2VT3 A;  5CYV A;  5AON A;  4WXH A;  2W25 A;  1XSX A;  1WWX A;  1FBQ A;  5FLX K;  3R60 A;  1FSH A;  2QWW A;  3JTG A;  1BIA A;  1F1Z A;  2CWE A;  3SZT A;  4MEY F;  5D5U B;  4HX4 A;  4S05 A;  4O3M A;  2RGV A;  3WTV C;  1ZHF A;  1ZAR A;  2QM3 A;  1QBJ A;  3IHU A;  3GWZ A;  5K5Q A;  3LAP A;  3G73 A;  4KMU X;  2KIF A;  2Z3Y A;  1ULY A;  3V8K A;  1W7P A;  3SQN A;  4G7Z F;  1BIB A;  1QPM A;  2P5V A;  5DV5 A;  4OIN F;  1DDN A;  3HSF A;  3TOB A;  3HOS A;  1L3L A;  3BDD A;  3FF5 A;  1IF1 A;  3GYH X;  4Z2Y A;  1U2W A;  1W7P D;  5TRD A;  3HRS A;  4BAY A;  2ZME A;  4UUV A;  2HYG D;  2VC0 A;  2XV4 S;  4M6X A;  1CGP A;  2DW4 A;  4IJA A;  2D2W A;  4ENN A;  3F3X A;  1T39 A;  2AXL A;  1HKS A;  2DFI A;  4JBA A;  3I59 A;  4KT5 C;  2YU3 A;  1XB4 A;  2F5D A;  3ERE D;  4MTE A;  1JHH A;  2BYV E;  2XKO A;  2QQA A;  3L00 A;  2FBH A;  5DCM B;  3VFZ A;  1U5T A;  5LHH A;  5D8K B;  3KET A;  4BYY A;  1IRG A;  5FO5 A;  4RGX A;  2HWV A;  3O2P E;  1PDN C;  2FF4 A;  2FBI A;  1I5Z A;  2KRF A;  2VBZ A;  4ZYD A;  3N97 A;  4L9V A;  3E6D A;  2QYO A;  2Y75 A;  4BHC A;  3QAH A;  2D1H A;  2DLL A;  4OMZ A;  1S29 A;  2IA1 A;  3IWF A;  4GYI A;  4UV8 A;  4CHU A;  3K1N A;  1FC3 A;  4AIK A;  2VBY A;  4G6Q A;  3BJO A;  4GXO A;  1EH8 A;  5E18 F;  1PUE E;  2K27 A;  4KIF A;  3FXU A;  3QRF F;  5LLQ A;  1R5G A;  3GXO A;  2IJL A;  3RYP A;  1S8N A;  1MDM B;  2BGC A;  1OYI A;  5FB2 A;  2QBY B;  3KLN A;  2K7L A;  4P55 A;  3SXY A;  1UHW A;  3C3W A;  3RKW A;  1BJA A;  3HRT A;  1LEB A;  4LG0 B;  4L9J A;  5DUI A;  1XSD A;  4G94 A;  1R7J A;  1ZG5 A;  2DO7 A;  4A5M A;  2M87 A;  4XSZ F;  1YQA A;  2UXN A;  5LEJ A;  3KP6 A;  5DDG A;  1FWZ A;  4LJZ F;  3K9T A;  1ZGJ A;  4KYW A;  2CSO A;  5TJJ A;  1U8R A;  1YFH A;  3EDP A;  3JSP A;  1KU9 A;  1J75 A;  4LLN A;  5H20 A;  1HXD A;  3E6C C;  5BPD A;  2OAZ A;  3F6V A;  1XDS A;  3WTS C;  4IRI A;  4EV0 A;  4MNU A;  4RB0 A;  2LDU A;  5JHU A;  1F9N A;  2A69 F;  4L5I A;  4GCV A;  3WTZ A;  1D8K A;  4KIB A;  1EH6 A;  1T2K A;  1W5S A;  1K79 A;  4M6Y A;  2W84 A;  1BI0 A;  1XGO A;  1BM9 A;  4HDU A;  1WRJ A;  2MC3 A;  1J2X A;  3K2Z A;  2XKP A;  2ZO4 A;  2IPQ X;  2P8T A;  2MLG A;  2JT1 A;  4UNO A;  3Q9V A;  5AIP A;  5D4S A;  3QOP A;  1AWC A;  3IL2 A;  1O3T A;  4CO8 A;  3F8C A;  3WE3 A;  2ZKZ A;  5E1X A;  1KU3 A;  1K6O A;  5EEH A;  2K86 A;  1GXP A;  1DPU A;  3U2R A;  2NS0 A;  4LK1 F;  3OOP A;  4AWX B;  1TQM A;  4BQA A;  1U6G A;  2VT2 A;  4I0B A;  3GFI A;  4GGG A;  5L3G A;  2HDC A;  4QLC U;  2O61 A;  5F64 A;  2OZ6 A;  5CVV A;  1P2F A;  3IC7 A;  4CIC A;  5ICE A;  1FSE A;  2EFN A;  5J8C A;  5BQT A;  1ZLJ A;  3E3V A;  2H09 A;  4WXC A;  3LA3 A;  1FX7 A;  1F4K A;  2UZK A;  3KLO A;  1FOK A;  2IP2 A;  2XAJ A;  1RIO H;  2O6G E;  3KZZ A;  3DP7 A;  3TQN A;  1Q1H A;  3BWG A;  4ESB A;  3DQV C;  2F5F A;  3ZP5 A;  3ECO A;  3ULQ B;  2EFO A;  3V8L A;  5BOX A;  4EJW A;  2RKH A;  5KVR A;  1CF7 A;  1DPR A;  1SD5 A;  2E1C A;  2B0L A;  2V1D A;  3CLO A;  3F8M A;  2M5W A;  2CQK A;  3IWZ A;  1J5Y A;  2LSO A;  2FBK A;  4EVI A;  3ML6 A;  1R1V A;  3P9C A;  5HDK A;  3ABT A;  3FHZ A;  5F6F A;  1G6N A;  4L5J A;  1S7O A;  2XAS A;  5L3B A;  4IPA A;  3BPV A;  3F8F A;  4CZZ A;  2ZFW A;  2EV0 A;  2XGX A;  1J0R A;  3RIR A;  3EUH A;  1TQI A;  1TBX A;  4YG2 F;  1ONV A;  5IT9 Z;  3ABU A;  1Z1D A;  3ZN0 A;  2P6T A;  4UVB A;  1QZY A;  4LFU A;  3I58 A;  1OYW A;  2BBY A;  2L3D A;  3E6B A;  4XRF A;  3RKY A;  2ZCW A;  3EYI A;  2FSW A;  3ZN1 A;  4HF1 A;  4IRH A;  4OIO F;  2EA2 A;  2ZXJ A;  4HAM A;  1BI1 A;  4OIQ F;  1XN7 A;  1LVA A;  1G3Y A;  1R58 A;  4E70 A;  3P9K A;  5CLS A;  2MD5 A;  3I4P A;  1IN7 A;  3RJP A;  3FWE A;  2J5O A;  2RDP A;  1P92 A;  3PFI A;  2AS5 F;  5D5W B;  3TO9 A;  3DXJ F;  1QQI A;  4KNY A;  1LDK B;  3LQR A;  4PZJ A;  4ENK A;  2GQQ A;  3BY6 A;  3HRU A;  1IN6 A;  5ED4 A;  3T1B A;  5ILS A;  1K78 B;  3ZMU A;  2XAQ A;  4KIG A;  1HSJ A;  3JAM Z;  4WCG A;  1LNW A;  2XRO A;  1FP2 A;  2M30 A;  2XRN A;  3HHG A;  1ZRF A;  4P5O A;  5HLG A;  4HZF A;  3T8T A;  2WWY A;  3ZMZ A;  2CG4 A;  2MA3 A;  3BPX A;  5HLH A;  3GO5 A;  1J7K A;  3RI4 A;  5DD4 A;  5D6E A;  1B9N A;  3TO7 A;  2FA5 A;  3E5Q A;  1P4W A;  3IKT A;  3FZV A;  4P9F A;  3CUQ A;  4I09 A;  4ETS A;  3REO A;  5ICG A;  1UB9 A;  5IT9 K;  4L9T A;  4CDG A;  2EK5 A;  3K1P A;  2QEN A;  2RV8 A;  4Q4Z F;  4A0Y A;  2JPC A;  4RAY A;  1ON1 A;  4ENJ A;  1HQC A;  1SD7 A;  4EJV A;  3R61 A;  1R23 A;  3H3Z A;  4XSX F;  5JFR A;  1Z6T A;  4LB6 B;  4YFX F;  1RUN A;  5DCM A;  2Y0M A;  3ZMT A;  1ZAO A;  2KIM A;  2KJB A;  4IXA A;  4XLP F;  1G4D A;  2H27 A;  1B1B A;  1H9T A;  1XDU A;  3ZMV A;  3GEZ A;  4HV5 A;  2ISZ A;  4FX4 A;  1IXS B;  1ZRC A;  1OPC A;  3AAF A;  4RS8 A;  4L0Y B;  2OU2 A;  3FMQ A;  2EB7 A;  2MLK A;  4HOB A;  4IF4 A;  3JAM K;  2FXA A;  4RB3 C;  2G7H A;  3C7J A;  3KP4 A;  4HX7 A;  2A61 A;  4Q5S F;  1OR7 A;  3E5U A;  1W4M A;  3WTY C;  4P96 A;  2PG4 A;  4A12 A;  3KCC A;  4RB1 A;  1KYZ A;  1QO0 D;  2MBF A;  4HX8 A;  1MDM A;  4FHT A;  1ZRE A;  2YX4 A;  2G9W A;  3J7A O;  4UXN A;  4KIC A;  4G8X A;  1TNT A;  2CFX A;  2X4H A;  4IRG A;  4LG0 A;  3GF2 A;  5E1W A;  2V1X A;  3MFK A;  1IXC A;  2D1V A;  1P6R A;  3KZY A;  2VBX A;  1KGS A;  1SD4 A;  3I71 A;  5ICC A;  4U0Y A;  5CVR A;  3D5L A;  2FNA A;  3U9G A;  3I53 A;  1KU2 A;  4ENM A;  1X3U A;  1B6A A;  4L9N A;  3E5X A;  2HKO A;  3R4K A;  2ESH A;  2V79 A;  3LFK A;  4I2O A;  4ZYG A;  3V7R A;  2VE9 A;  2RVC A;  5LRS A;  1YS7 A;  1IN4 A;  1WQ2 A;  1DP7 P;  2EV5 A;  5ICF A;  3V7C A;  3HSE A;  1MKM A;  4BH9 A;  3FXR A;  1B59 A;  2HS5 A;  3RDI A;  3JW4 A;  3MZY A;  1SMT A;  5CJ9 A;  4EM2 A;  3K1M A;  2LNB A;  3H92 A;  1LDD A;  5BS6 A;  1Z7U A;  3WTU C;  4HBL A;  2L01 A;  3FMR A;  5CVI A;  1J9I A;  1D3Y A;  3LA2 A;  1GVJ A;  3T8R A;  3FMS A;  2PMU A;  3TO6 A;  1V3F A;  3WGG A;  4IVN A;  5DUK A;  1R1U A;  2A5Y B;  2GXG A;  2VON A;  2DQR A;  5K5R A;  1WI9 A;  2EA4 A;  4KMF A;  2H94 A;  5AIQ A;  5D5V B;  2FOK A;  4PGG A;  3FM3 A;  1OKR A;  3WGI A;  5K5O A;  2YSR A;  3GW2 A;  1WSU A;  2XAH A;  1LB2 A;  5D5X B;  4B8X A;  2GIV A;  2HZT A;  2W57 A;  1MJA A;  5H6Q A;  4M9X A;  3NRV A;  4LLG F;  4G9Y A;  4ZYH A;  4JQF A;  1EH7 A;  1T98 A;  2A07 F;  3QU3 A;  1ZG3 A;  1S3J A;  3I54 A;  1TLH B;  2WC2 A;  2FRH A;  1A04 A;  2PN6 A;  3F72 A;  1G3T A;  2P5L C;  1G3W A;  3CO7 C;  3RPU A;  1Z05 A;  1OMI A;  4MGR A;  1T38 A;  2EFQ A;  1FP1 D;  2XAG A;  1O7F A;  2DPU A;  1YS6 A;  2FE3 A;  5E1Z B;  1HBX G;  2YR2 A;  3J81 Z;  2H6B A;  4L0Z B;  1R00 A;  1U5T C;  3PQJ A;  3R6S A;  3M9A A;  1YYV A;  1QZZ A;  1YG2 A;  4OIP F;  3TDZ C;  3DFG A;  1ZLK A;  1I27 A;  4U88 A;  3ZQ7 A;  4I02 A;  1SAX A;  1E2X A;  2FNP A;  2O3F A;  3IRR A;  2ZNY A;  2OA4 A;  3T0Y A;  3QPT A;  3JTH A;  2P4W A;  4I7H A;  3J80 Z;  2K02 A;  3GVA A;  3JSO A;  2D45 A;  1R1T A;  4MQV A;  4AVP A;  3KEO A;  2L54 A;  4JK1 X;  1FLI A;  3GLX A;  2EJR A;  2HR3 A;  2K4J A;  1RZ4 A;  3ZPL A;  1W5T A;  2ZBK A;  3QPH A;  1UHM A;  2DQL A;  2JZY A;  2JTV A;  4MEX F;  1TTY A;  5LGT A;  3DPL C;  2Q2E A;  1REP C;  1XCV A;  4KN4 X;  6PAX A;  1H9G A;  4HYE A;  1YW9 A;  2L4M A;  5A2Q Z;  3MAJ A;  4EJU A;  4LB5 A;  1C0W A;  4LMY A;  1Y0U A;  2HOE A;  5E8I A;  4M73 A;  3K69 A;  2H6C A;  4Y13 A;  3HOT A;  2RQP A;  4DQ2 A;  4N9H A;  4IHS A;  2ELH A;  2GAU A;  3BP8 A;  1FBU A;  1TW3 A;  4NQW A;  2PJP A;  3LA7 A;  4UHT A;  3KP7 A;  5BPI A;  4N0B A;  1IZ1 A;  2GXB A;  4OMY A;  3J81 K;  2PQ8 A;  3SFZ A;  1KQ9 A;  5L3F A;  2O03 A;  5D6F A;  4O5V A;  5IT3 A;  3KEQ A;  2VXZ A;  1NHA A;  1DUX C;  1K7A A;  1IW7 F;  2DAO A;  2Z99 A;  4ASN A;  4ESJ A;  3ISP A;  3H3U A;  1FYM A;  4QWQ A;  5LGU A;  3B02 A;  1FYK A;  1ODD A;  3WTT C;  1FBS A;  3P7N A;  2UWM A;  3C1D A;  3WOD F;  1IN8 A;  5HDN A;  1ZN2 A;  2FEZ A;  1UST A;  1HW1 A;  3M8F A;  4U0V A;  4HF2 A;  3L7W A;  3TDU C;  4A2U A;  3J80 K;  1T6S A;  4LK0 F;  4OIR F;  4BXU A;  1J59 A;  5FD5 A;  4EGY A;  5KK1 A;  3CTA A;  1ZGA A;  3HUG A;  4KN7 X;  2LF7 A;  2HQR A;  5DCF A;  2IT0 A;  1R36 A;  1LEA A;  1ZYR F;  2STT A;  2CW0 F;  2OBP A;  2PFB A;  3GUD A;  4ESF A;  4EJT A;  3D0S A;  4I01 A;  1GHC A;  2NRA C;  4UVA A;  4MHG A;  5A2Q K;  1XGM A;  5FLX Z;  2KJC A;  3DF8 A;  1BI2 A;  3QP6 A;  3WE2 A;  4PDK A;  2A3S A;  1JE8 A;  3QP5 A;  2IW5 A;  4H0E A;  4G7H F;  1YTY A;  2F5C A;  5CVJ A;  1U3E M;  2MH9 A;  5DYM A;  4KUM A;  2YX7 A;  1STZ A;  2NNN A;  3HHH A;  4R79 A;  5FFX A;  2EWN A;  3ELK A;  1KQ8 A;  2P6S A;  1ZH5 A;  4FX0 A;  4A6E A;  2E1N A;  2G7U A;  4EJO A;  2IVM A;  2RC4 A;  4GO1 A;  2P7V B;  1LJ9 A;  2W24 A;  5DEQ A;  4ZYE A;  1TQP A;  1F5T A;  5FD6 A;  3MQ0 A;  1TW2 A;  1FYL A;  3CDH A;  4I98 B;  1SD6 A;  2VBW A;  4WXD A;  3VEP A;  1EV7 A;  1O3R A;  5ILU A; 
#chains in the Genus database with same CATH topology
 1JHF A;  4WK8 F;  5E17 F;  3QPL A;  3V8J A;  2EFP A;  4HF0 A;  3GTO J;  3ZMD A;  2ZXI A;  4U7D A;  3LQQ A;  2ZJP F;  2OQG A;  1FNN A;  1O7L A;  1MBJ A;  2HVR A;  2C6Y A;  4RDU A;  4AIH A;  4IOA F;  2AHQ A;  3KE2 A;  1J09 A;  2QLZ A;  2CMP A;  4G6T B;  2ELJ A;  5LBQ A;  1FTT A;  1I6X A;  3GFJ A;  2XAF A;  4F55 A;  1LPQ A;  2P7C B;  2BOL A;  3ZQQ A;  5JHF A;  5B66 C;  5HS7 A;  1B8I B;  5HVQ C;  1MJ9 A;  3C18 A;  1YW8 A;  4M3D A;  4EM0 B;  4HRI A;  1IDZ A;  4BHB A;  1XMX A;  1Z3X A;  2QEX I;  5EGO A;  5L3E A;  4Y17 A;  4ANJ A;  2DTR A;  2NS7 A;  1MD0 A;  3FM5 A;  2Q8K A;  4M6V A;  4HNV A;  2DK5 A;  2EIK H;  3BG3 A;  2KIU A;  4IL6 C;  2WTE A;  1R5H A;  2OF7 A;  1AKH A;  3W6K B;  4LLL A;  1P4X A;  4JX6 A;  2IA2 A;  2EV6 A;  3BJA A;  4A6D A;  2BV6 A;  2LVS A;  3A02 A;  1BN5 A;  2DK8 A;  2O8K A;  2HGC A;  3MWM A;  3IKV A;  2Y9Z A;  1KYW A;  2B63 J;  3NQO A;  2E2I J;  2Z5U A;  3ROU A;  4AUX A;  1X58 A;  3HRM A;  3CUO A;  4M74 A;  5D4R A;  3RTR A;  3FX3 A;  2XAU A;  2DMU A;  1RR8 C;  3O3K A;  2NVT J;  3OY9 A;  3V7S A;  4CCM A;  1XGS A;  3BCB A;  1LQ1 A;  4NC8 A;  2DOF A;  2NOG A;  2R7D A;  1LE8 B;  2RNJ A;  2DT5 A;  2V1U A;  2QBY A;  4UY8 I;  1IXR C;  4O6J A;  4CUG A;  2LD5 A;  4XR6 A;  5IP6 A;  3LNQ A;  1KU7 A;  2GA1 A;  2BVL A;  4BBS J;  1XMA A;  4Y4R A;  2DBB A;  2VOP A;  4CGZ A;  1XTA A;  2ZSH B;  1YLF A;  3KP2 A;  4CYD A;  1QNT A;  2A6H F;  3CMY A;  1I1S A;  3G2B A;  4DNC A;  3CUQ B;  5F1R A;  2RAE A;  2QUF A;  4XOR A;  1SVM A;  3DEU A;  2V9K A;  3LSM A;  2PMZ N;  3TKY A;  1MW7 A;  2HTJ A;  2YS9 A;  1YO5 C;  3OL3 A;  5E8G A;  4UUS B;  2MH2 A;  2HOS A;  4DOZ A;  3DKW A;  4MFE A;  1MJB A;  3CUQ C;  1QZE A;  4G6D A;  3M07 A;  3F6O A;  5LRR A;  4XLF A;  1O3S A;  4GYG A;  2FU4 A;  4JX5 A;  2QSH X;  4Q47 A;  2EZH A;  1SMY F;  4ZC3 A;  1TWG J;  1FPQ A;  4A0X A;  2HI3 A;  5LEK A;  3BR6 A;  1BC8 C;  1ETY A;  3M1E A;  1I3Q J;  3KFW X;  4A3L J;  3NWS A;  1XCB A;  3H5N A;  3S2D J;  3O8G A;  3GLL A;  2NOJ B;  3HIF A;  3K70 D;  4PCQ A;  3DPT A;  1DGW Y;  4JX4 A;  4AYB A;  3BZC A;  1BOB A;  2MFZ A;  3S3O A;  4W97 A;  2NVU B;  4AU7 A;  2DI3 A;  1G3S A;  3N4M A;  5ILV A;  3T5X A;  4FE7 A;  5IP7 J;  5KCM A;  3F8B A;  2O8X A;  2UXX A;  2PI0 A;  1FY7 A;  3KP5 A;  2HVQ A;  3IH4 A;  3Q5F A;  3AL0 C;  2V6C A;  3VB2 A;  4A3K J;  2NNY A;  4RGU A;  3L9F A;  1GXQ A;  2ZJ2 A;  2Q0O A;  4ON0 A;  2M2E A;  4XKW A;  2XSJ C;  3FXM A;  5JR3 A;  2RN7 A;  2Z2S B;  2XUB A;  3HTU A;  4AD9 A;  4M3B A;  1YIO A;  1IV6 A;  2RNG A;  5KAI C;  2Y9Y A;  4ZTJ A;  2TRT A;  2CUF A;  3BR1 A;  1O57 A;  4RAZ A;  3LAJ A;  3ZQI A;  4I76 A;  3DV8 A;  2HEO A;  5HOO A;  5K7Z A;  3R0A A;  4KFC A;  3K4M A;  5J8F A;  1HW5 A;  3CJR B;  2L4A A;  2GOX B;  3GZ5 A;  2OQR A;  1WJE A;  5F0F A;  3F9K A;  3LWF A;  1R4M B;  3GME A;  4LIV A;  1HCR A;  1W7P B;  2O9L A;  2QSF X;  4YIF A;  2F5E A;  2GZW A;  2XVC A;  5L3D A;  2WBM A;  2COM A;  1X1A A;  3VOD A;  2R7F A;  5CKT A;  4RB2 C;  3CCJ I;  3S93 A;  3O6B B;  2KMU A;  3CDI A;  1TNS A;  1XGN A;  4F92 B;  1RNL A;  5L3C A;  2Z16 A;  3GTQ J;  1PVE A;  3RQI A;  4Y15 A;  1MGT A;  3PQK A;  3AG1 H;  3LSG A;  3PNV A;  4YII A;  3VWB A;  2DU9 A;  2F4M B;  1OR7 C;  2R0Q C;  2L02 A;  5LGN A;  4UVC A;  5JVT A;  3JRE A;  1UHS A;  3E97 A;  3NEU A;  4D9J A;  5FGM A;  4YFN F;  2ZME B;  3BJ6 A;  3ABM H;  3OR1 C;  4HQE A;  3IV5 A;  3CO6 C;  1PP8 F;  2M1B A;  2LFB A;  3NAR A;  1RET A;  3COA C;  2I5U A;  2JRT A;  3BOQ A;  2XC7 A;  5K7F A;  4K2E A;  2K4B A;  1FTZ A;  2PBI A;  3M8E A;  3N05 A;  2BY1 A;  4IEJ A;  1TT5 B;  3M7G A;  5EEG A;  1D8J A;  1XX5 A;  4NC7 A;  3I59 B;  3HYI A;  1KQ0 A;  2HFH A;  2QCO A;  4MQ9 F;  1JGS A;  2HQN A;  2BE5 F;  1IUF A;  4PSX A;  3H35 A;  4RMN A;  2HQA A;  4BGD A;  4R1H A;  5J4Y A;  2IGM A;  4RA2 A;  2ELK A;  2IS1 A;  4C3J J;  3F23 A;  2ADU A;  4ZJZ A;  2YPR A;  3BLY A;  4OU0 A;  2OZU A;  1U5T B;  3E1S A;  2X6O A;  4U87 A;  1WZ2 A;  3ZMS A;  3L2C A;  3F22 A;  1NG7 A;  1Z9C A;  1JKQ C;  1B72 A;  2STW A;  1VTN C;  1JKP C;  4XNF A;  1K4T A;  3QU6 A;  1GV5 A;  4PGH A;  1T0F A;  1EF4 A;  2HKX A;  3KP3 A;  5HS8 A;  2HQ5 A;  1YJW I;  1MZB A;  4BQO A;  3A03 A;  2BEO A;  2KKO A;  2CQQ A;  2UV1 A;  1ZGW A;  5GPA A;  2LF8 A;  4M71 A;  2JUC A;  5HS9 A;  2JVH A;  2ACJ A;  1UMQ A;  3K4K A;  5J4V A;  4RLQ A;  2A6E F;  3GZ6 A;  4S04 A;  2JUG A;  4BNC A;  3DEW A;  2R3S A;  5GAE J;  4HSR A;  1S6L A;  3I64 A;  5BMZ A;  2VPL A;  2X1E A;  4DBR A;  4U7B A;  3ABL H;  2OD5 A;  2ZSI B;  2P5K A;  1TT0 A;  1WJF A;  1IN5 A;  4NC6 A;  2DJN A;  1V5E A;  3RKX A;  1LDJ A;  1U8B A;  2XPU A;  5LFA A;  3CES A;  4F7Z A;  1DQU A;  3B73 A;  3W3C A;  3W2A A;  4Y52 J;  1AU7 A;  2Y2Z A;  4GRI A;  1B9M A;  1IUY A;  3D5S C;  3DLL F;  1Z6R A;  4A5N A;  2WV0 A;  2NAZ A;  3GX4 X;  1RUO A;  1IRZ A;  4WF2 A;  1W1W E;  3CJQ B;  2F2E A;  1T56 A;  5JVG F;  4IOC F;  2EH3 A;  1GDT A;  2EFW A;  1UCR A;  3BR3 A;  1O3Q A;  2CFO A;  3I0T A;  5K1Y A;  1NG6 A;  2IS2 A;  2M34 A;  2PEX A;  2X0L A;  3TGN A;  3OYN A;  4KA4 A;  1S7E A;  5JLX A;  3DLA A;  2V1N A;  1HKQ A;  4RGR A;  2Y48 A;  2VC1 A;  4A3B J;  4ZH4 F;  5HOD A;  3ZXS A;  4MTD A;  3CJN A;  4U0W A;  1YE9 A;  2HPM A;  1Z21 A;  4WX9 A;  4KJZ A;  1JUP A;  2BHZ A;  1N75 A;  1QU3 A;  4UV9 A;  4RGS A;  2W82 A;  1KZH A;  2M45 A;  3H0D A;  1IDY A;  1Y0N A;  3OYC A;  5F04 A;  3W6J B;  2VOO A;  2NVY J;  1BC7 C;  1P4A A;  3I5U A;  3SJM A;  3CCL I;  2DT6 A;  1L0O C;  5GAG J;  1VFC A;  1R22 A;  3P9I A;  1D5V A;  3S1R J;  2HTS A;  2BY3 A;  1MNM C;  3KX2 A;  1R71 A;  1XS9 A;  4RM3 A;  1QPI A;  3GCM A;  3HKZ N;  2K9M A;  2R92 J;  3GFM A;  1Z91 A;  1UG2 A;  3FXQ A;  2CV1 A;  4A3G J;  3SZP A;  4L18 B;  2VOD A;  1R9T J;  1KA8 A;  1KON A;  4ZDP A;  3WG9 A;  1VQ8 I;  2W7N A;  4WWC A;  1YOV B;  1OJL A;  2E7X A;  3SDB A;  1D0Y A;  1K78 A;  2E7W A;  2XIG A;  2GXA A;  1RKT A;  2ZNZ A;  3GFL A;  4I0A A;  2GWR A;  2XDV A;  4M3E A;  3Q9S A;  1U78 A;  3SHF A;  1VF9 A;  2JSC A;  4XBF A;  1RRJ A;  3H5A A;  2R5Y A;  2Y0S N;  1WJC A;  2TDX A;  5DS9 A;  3L09 A;  1W5C C;  3FXL A;  5FFZ A;  3BC8 A;  1X4P A;  2LKP A;  3GBG A;  2HPI A;  4KT6 A;  2X6X A;  2CH0 A;  3VOE A;  3FDY A;  3EET A;  4D0P A;  2KPM A;  2PMH A;  2V9V A;  3MEX A;  2M3A A;  2A68 F;  3HC7 A;  1YW7 A;  5EYR A;  2BHY A;  2Z9O A;  1X2M A;  3PO2 J;  3AG3 H;  4E7H A;  3WU2 C;  3WTW C;  2WAE A;  4ZYA A;  4Q48 A;  5CVU A;  4EGZ A;  2DA2 A;  1I1G A;  2LR8 A;  4HQM A;  1MIJ A;  3GZN B;  4BDY A;  3C2G A;  1VQM I;  2HU9 A;  2VN2 A;  3I3L A;  3HSR A;  1ENH A;  4OOI A;  1OCP A;  2Z33 A;  4R8H A;  2VL8 A;  3W6V A;  3HBL A;  1RI7 A;  1ZG1 A;  4X0G A;  4F91 B;  4EMS A;  5LHG A;  3EQL F;  3C2H A;  1N77 A;  1WJA A;  3FKI J;  4UB6 C;  2DDA A;  4NHJ A;  2RRE A;  4CXF A;  3OIP A;  5J6X A;  1XSV A;  2ID3 A;  1SFU A;  1NH3 A;  3MCZ A;  4EQQ A;  4HDV A;  1YJN I;  4I99 C;  2HNH A;  3F8N A;  1OCZ H;  1JJ8 C;  5HLI A;  3FKJ A;  3J7A Y;  2DMQ A;  3CCM I;  3E0J B;  2VI6 A;  3U1D A;  4HW0 A;  2BXY A;  4TV7 A;  4HPQ A;  3IRQ A;  3F21 A;  1ZRD A;  2DOE A;  1UFM A;  2M8E A;  1MBK A;  1S7A A;  1XMK A;  4BS9 A;  2DMP A;  3MVP A;  2CUZ A;  1X2N A;  1D1A A;  4JOM A;  5C4X J;  1K4S A;  3HM5 A;  1BBY A;  4HA8 A;  4E6K G;  1XD7 A;  1FZP B;  2ZXH A;  2O7O A;  2R7Q A;  4PSW A;  2IXS A;  2QQ9 A;  3S15 J;  2QZ8 A;  1SAN A;  2JA2 A;  2NYX A;  5FKK A;  5M3F J;  4J19 A;  1QHG A;  1IG7 A;  2IRF G;  3BQZ A;  4ITV A;  3L2V A;  4M72 A;  3RPQ A;  4AM3 A;  3A01 B;  4B09 A;  1T33 A;  4UB8 C;  2VKH A;  1ZTR A;  4HG2 A;  4Y33 A;  2QSG X;  1A31 A;  1YX5 A;  3BRO A;  3W2W A;  2LY1 A;  2QVO A;  2KRH A;  1E17 A;  3SYT A;  3I55 I;  5ERI A;  5H6R A;  3TOA A;  2QA4 I;  2EZL A;  4ZZL A;  3JRD A;  2VQC A;  5GAH J;  1HST A;  2CO5 A;  2XHK A;  3OV8 A;  4FT8 A;  4I6Z A;  3CMM A;  2O0Y A;  5DD8 A;  1Z67 A;  2EIJ H;  2X6W A;  4M9S A;  4KDP A;  1MMD A;  3H0G J;  2IGO A;  1CF7 B;  4KIS A;  1WH5 A;  1WKM A;  2ISY A;  2K9Q A;  4ZDO A;  4AIJ A;  4ZZD A;  5M5Y J;  2KLO A;  2E1M C;  1B4A A;  2NXN B;  2Z1D A;  3VPR A;  1IAW A;  2IS4 A;  2HOT A;  3WTX C;  5E20 A;  2R7O A;  4HV6 A;  2AXT C;  2QQB A;  3I56 I;  3WU0 A;  3CD6 I;  1PP7 U;  2XPW A;  2L0K A;  1W0U A;  3V4G A;  2E60 A;  1SFX A;  4EM1 A;  1H0M A;  2CYY A;  1FT9 A;  4PJJ A;  4IHY A;  2ETH A;  1LE8 A;  3HOZ J;  2K3P A;  1O4X A;  5HDG A;  2IGK A;  3W2V A;  3S2W A;  2DPD A;  2A5W A;  1U0J A;  3K4C A;  2JPB A;  4IHT A;  4LD5 A;  5D8L B;  2DCE A;  1V4R A;  3HG9 A;  2VE8 A;  1XC5 A;  2CGP A;  1I6H J;  3BTI A;  3R0J A;  4N9I A;  1I3A A;  3SZG A;  1USS A;  1VQL I;  4FCY A;  1P9Q C;  2FMY A;  3OYD A;  3O8H A;  1YJ9 I;  4BBR J;  4XLN F;  1IRF A;  4DIQ A;  1AOY A;  4P1W A;  1BOA A;  4FQG A;  4LGW A;  4YFK F;  5GPC A;  2ICW G;  3G3Z A;  1POG A;  3OS2 A;  3ZQC A;  3A0H C;  3ECH A;  2VQG A;  4M9Z A;  2GA2 A;  2R5Z A;  3H9G A;  3LST A;  2HYF A;  4UUS A;  2DMN A;  3DKY A;  5GTI C;  5JI6 A;  1OYY A;  3WGH A;  3QYB A;  2J5P A;  3E6M A;  2ESN A;  5FKO A;  4BHP A;  2IA0 A;  3RYR A;  5FLM J;  4QTR A;  1K61 A;  1LFU P;  2BZT A;  3HTS B;  1OLT A;  4NB5 A;  4G7O F;  4QIW N;  2OCC H;  3OYH A;  4LIT A;  2FQ3 A;  2L7K A;  4XN0 A;  2FML A;  3K0L A;  3K4B A;  2ZFU A;  3ABK H;  4PJN A;  1QGP A;  5LHI A;  2V4J C;  3EYY A;  3BZ6 A;  4B48 A;  2PLY A;  3OYI A;  2HXI A;  3MZH A;  4HLY A;  1SFE A;  2W85 A;  4P9U A;  2HVS A;  3FK6 A;  2RQQ A;  1NK3 P;  3WU1 B;  2JN6 A;  1BJZ A;  1HKT A;  3DU6 A;  4A0Z A;  4A93 J;  1BI3 A;  4HLX A;  1JXS A;  3EUA A;  1ON2 A;  1HW2 A;  2VT3 A;  2DJI A;  5CYV A;  5AON A;  4H4K C;  4WXH A;  2W25 A;  4C30 A;  1XSX A;  2HDW A;  1WWX A;  1BA5 A;  1FBQ A;  5FLX K;  3RSN A;  4B43 A;  4CCO A;  2NVX J;  3R60 A;  1FSH A;  2QWW A;  4FE4 A;  4YRV A;  1BIA A;  1F1Z A;  3JTG A;  2CWE A;  3NAU A;  3SZT A;  4MEY F;  1BR1 A;  4HX4 A;  5D5U B;  1D1C A;  2OC6 A;  4E7S A;  3CF5 F;  4S05 A;  4ABZ A;  1OCR H;  4O3M A;  2FD5 A;  2DA5 A;  2RGV A;  2L7M P;  3WTV C;  1IC8 A;  2JA8 J;  1ZHF A;  2VUM J;  1ZAR A;  2QM3 A;  4XKV A;  1QBJ A;  5EG0 A;  3IHU A;  3GWZ A;  1X1B A;  5K5Q A;  2JWT A;  2TCT A;  3LAP A;  4S0H B;  4CZC A;  1FIA A;  4C3H J;  3G73 A;  4KMU X;  3VYS B;  3FIS A;  2F5V A;  2KIF A;  2Z3Y A;  1ULY A;  1Y6I A;  3V8K A;  1SFO J;  2YUS A;  5J47 A;  1W7P A;  2F6C A;  5EEA A;  2LH9 A;  1SEU A;  3SQN A;  1HDP A;  4G7Z F;  2L9N A;  1BIB A;  2IEK A;  2R7Z J;  1QPM A;  4A3I J;  5KAF C;  2P5V A;  2XF6 A;  5DV5 A;  4OIN F;  1DDN A;  1H88 C;  3HSF A;  4A3E J;  3TOB A;  3HOS A;  2MYS A;  2L9R A;  2OV7 A;  1Z7L A;  2ME6 A;  1L3L A;  2V26 A;  3BDD A;  3FF5 A;  1IF1 A;  3GYH X;  2GIZ A;  4Z2Y A;  3K4J A;  1GUU A;  1U2W A;  3TP0 A;  1VQ4 I;  1W7P D;  4D5C A;  1RC9 A;  5TRD A;  3BT9 A;  3HRS A;  1A6I A;  4BAY A;  2ZME A;  2OCE A;  4UUV A;  2X48 A;  2HYG D;  3LL7 A;  1EJ9 A;  2VC0 A;  2XV4 S;  3BTL A;  2LTP A;  1VQ6 I;  2DA7 A;  4M6X A;  3DU5 A;  1CGP A;  2DW4 A;  4IJA A;  4FET A;  2D2W A;  1MH3 A;  4ENN A;  3F3X A;  1FOY A;  1T39 A;  2AXL A;  1BR4 A;  3AL0 B;  4HST A;  1LFP A;  4BEH B;  1HKS A;  2DFI A;  4JBA A;  4BY7 J;  3I59 A;  3OYE A;  2FJ1 A;  4KT5 C;  2MC4 A;  1MBE A;  2HDD A;  2YU3 A;  2DXI A;  1XB4 A;  2F5D A;  4CSW A;  3PUB A;  5J3L A;  4MTE A;  3ERE D;  3IAS 2;  1WCM J;  4D7M A;  1JHH A;  2BYV E;  2XKO A;  4Y3O A;  5E79 C;  1SVL A;  2QQA A;  3L00 A;  2FBH A;  5DCM B;  3VFZ A;  1U5T A;  5LHH A;  2CRG A;  5D8K B;  3KET A;  4BYY A;  4V19 K;  2M9H A;  1IRG A;  3P5J A;  5FO5 A;  3ZR8 X;  4BJ5 C;  4RGX A;  2HWV A;  3O2P E;  1V5G A;  2KIQ A;  5M5W J;  1PDN C;  2FF4 A;  2FBI A;  1I5Z A;  3DTE A;  2BW3 B;  2KRF A;  5EGO B;  4MIM A;  2VBZ A;  4YIR X;  2R7R A;  1F43 A;  4ZYD A;  3A1Y A;  4L9V A;  3N97 A;  3E6D A;  2QYO A;  3S32 A;  2Y75 A;  4BHC A;  3QAH A;  2D1H A;  2DLL A;  4XK4 A;  4OMZ A;  3RKQ A;  1S29 A;  2IA1 A;  2CS3 A;  3E7L A;  3IWF A;  2KZG A;  3SFI A;  4GYI A;  4UV8 A;  5KHD A;  4CHU A;  3K1N A;  1FC3 A;  1AKH B;  4XL9 A;  4AIK A;  3GTL J;  4A3D J;  2VBY A;  3PSI A;  4G6Q A;  1ETK A;  3HEF A;  3HDD A;  3S3N A;  3BJO A;  2CJJ A;  5C44 J;  2CUE A;  1FOW A;  3ZRG A;  1ZKG A;  4GXO A;  1EH8 A;  2QF7 A;  3L2R A;  3CC4 I;  5E18 F;  2PJR B;  4YEL A;  1PUE E;  1YI2 I;  1JT6 A;  2DFF A;  2K27 A;  4KIF A;  2LC2 A;  3FXU A;  3QRF F;  4A3C J;  1R5G A;  5LLQ A;  4DW6 A;  3GXO A;  2IJL A;  2JRM A;  2QQ8 A;  3VYT B;  2X1C A;  5IP9 J;  3RYP A;  1VQN I;  1S8N A;  2R7X A;  4E4H A;  1MDM B;  3U1K A;  2BGC A;  1A6Q A;  3PJR A;  3HB9 A;  1UAA A;  1OYI A;  5FB2 A;  2QBY B;  2L7Z A;  3ZGK A;  3KLN A;  2K7L A;  4P55 A;  3SXY A;  1UHW A;  4YEJ A;  3C3W A;  3RKW A;  4BE1 A;  1BJA A;  2Q1Z B;  1D1B A;  4B44 A;  3HRT A;  1LEB A;  4LG0 B;  4L9J A;  5DUI A;  4E7J A;  1XSD A;  2Y31 A;  4G94 A;  1R7J A;  1ZG5 A;  2DO7 A;  4A5M A;  1K6Y A;  3TED A;  1X1C A;  3HOV J;  2M87 A;  2E5N A;  4XSZ F;  3I9V 2;  3CQZ J;  2A05 A;  1YQA A;  4EEF G;  2UXN A;  2Y30 A;  5LEJ A;  3KP6 A;  5DDG A;  1FWZ A;  4LJZ F;  3K9T A;  1ZGJ A;  4KYW A;  2CSO A;  5TJJ A;  1U8R A;  1R5I D;  1YFH A;  3EDP A;  3JSP A;  1KU9 A;  5EDN A;  1J75 A;  1U9O A;  5H20 A;  4LLN A;  1HXD A;  2XB5 A;  4F52 A;  1E3O C;  3E6C C;  4PFP A;  5BPD A;  4CYC B;  1QVT A;  2OAZ A;  3F6V A;  1D0X A;  1XDS A;  3WTS C;  4HNT A;  3D5R C;  4IRI A;  1S5L C;  4EV0 A;  5IYD J;  4MNU A;  4RB0 A;  3CMA I;  2D5V A;  2LDU A;  5JHU A;  3MKZ A;  1MBG A;  1F9N A;  2NS8 A;  3K70 C;  4XLH A;  5FKL A;  1OIS A;  2VJI A;  1HOM A;  2A69 F;  4L5I A;  4BAC A;  4GCV A;  4OAY A;  3ONQ A;  2XGD A;  3HGG A;  3WTZ A;  2K40 A;  4J01 A;  3J7Z I;  1GT0 C;  1OQY A;  3U21 A;  1D8K A;  2LOO A;  4KIB A;  2ZXW H;  2M7B A;  1EH6 A;  1MH4 A;  2KL4 A;  4A3F J;  1YIJ I;  1WJD A;  1T2K A;  2K5C A;  1W5S A;  1K79 A;  1X3W B;  1BW5 A;  4M6Y A;  2W84 A;  1VZ0 A;  4XLE A;  1BI0 A;  1XGO A;  1BM9 A;  4HDU A;  5LD2 C;  4B1R A;  2I8D A;  1WRJ A;  2MC3 A;  4LOC A;  2LP0 A;  1J2X A;  1X19 A;  2IS6 A;  3K2Z A;  2XKP A;  3JRC A;  4B3A A;  2ZO4 A;  2IPQ X;  2P8T A;  2KHM A;  1Y1W J;  4XKB A;  5EZH A;  3QQA A;  4IHX A;  2MLG A;  3FBN B;  2JT1 A;  5IOZ A;  4UNO A;  3Q9V A;  5AIP A;  2X85 A;  3HXL A;  5D4S A;  3QOP A;  1Y56 A;  1AWC A;  3FXK A;  3IL2 A;  1O3T A;  4CO8 A;  5K7H A;  3F8C A;  3WE3 A;  2ZKZ A;  5E1X A;  3RPU D;  1KU3 A;  1K6O A;  5EEH A;  2MSY A;  2K86 A;  1GXP A;  1TWF J;  1DPU A;  2OJE D;  4AVZ A;  5B3S H;  3U2R A;  4PFO A;  2JA5 J;  2NS0 A;  4LK1 F;  3OOP A;  4AWX B;  1TQM A;  2WY7 Q;  4RLF A;  4BQA A;  1U6G A;  1IO2 A;  2VT2 A;  4I0B A;  3GFI A;  4GGG A;  1QA6 A;  4BL0 B;  5L3G A;  3PSF A;  3A4C A;  4G12 A;  2KDZ A;  2HDC A;  3ASO H;  1MBF A;  2K9S A;  4QLC U;  1M1E B;  2ZJQ F;  2O61 A;  1RES A;  5F64 A;  3K4L A;  1TWA J;  2OZ6 A;  3IAM 2;  1AHD P;  5CVV A;  3SDG A;  1P2F A;  3GTG J;  3IC7 A;  4CIC A;  1WJ5 A;  2GBY A;  1S9H A;  5ICE A;  3F0C A;  1FSE A;  1RKW A;  3A2K A;  2EFN A;  5J8C A;  3KYC B;  3D1N I;  3CCQ I;  1N78 A;  3JR9 A;  1PUF A;  1QVU A;  1ZLJ A;  5BQT A;  3CCV I;  3E3V A;  2UUZ A;  3QPS A;  2H09 A;  4WXC A;  4E7K A;  3CDL A;  2E5Z A;  1WI3 A;  3OOU A;  3LA3 A;  1FX7 A;  3VYR B;  2M7A A;  1JKO C;  1F4K A;  2UZK A;  2ID6 A;  1JKR C;  3KLO A;  2EBI A;  1FOK A;  1WJB A;  2IP2 A;  2XAJ A;  3CP8 A;  1RIO H;  2O6G E;  2KDO A;  4BXX J;  3KZZ A;  3DP7 A;  2E71 A;  2VQL A;  3TQN A;  3L2Q A;  1Q1H A;  3VSK A;  4IX7 A;  3HKZ A;  1SFK A;  3HJE A;  3IH2 A;  3JRG A;  3BWG A;  1WVR A;  1R4N B;  2DN0 A;  4ESB A;  3VDX A;  3DQV C;  4CH7 A;  4ZDL A;  2F5F A;  3ZP5 A;  3ECO A;  3ULQ B;  2EFO A;  3V8L A;  5BOX A;  2OTL I;  4EJW A;  3ESW B;  2RKH A;  2XF7 A;  4CA0 A;  4M3G A;  5KVR A;  2E2J J;  1CF7 A;  1DPR A;  1ETW A;  2DFE A;  3DBL B;  3OYG A;  4QPO A;  1SD5 A;  1E0E A;  2E1C A;  2B0L A;  2V1D A;  3M3Y J;  2X51 A;  3CLO A;  3F8M A;  3BG9 A;  2M5W A;  5FLV A;  3UKG A;  4PUS A;  2CQK A;  3IWZ A;  4DJA A;  2P0W A;  1J5Y A;  1T08 B;  2LSO A;  3CME I;  2FBK A;  4EVI A;  2XB0 X;  3ML6 A;  1R1V A;  3P9C A;  4E7I A;  4NNJ A;  5HDK A;  3RQ4 A;  1T95 A;  2K85 A;  3ABT A;  3BG6 A;  1I39 A;  2Y0S A;  3DTI A;  3FHZ A;  2KRC A;  4W1U A;  4QSH A;  5F6F A;  4BXF A;  3NWT A;  1G6N A;  4L5J A;  1S7O A;  2VPR A;  3K10 A;  2XAS A;  5L3B A;  4IPA A;  1V54 H;  1HF0 A;  3BPV A;  2H1K A;  3F8F A;  3LFU A;  3CCE I;  4II2 A;  4CZZ A;  2E34 A;  2ZFW A;  4D1Q A;  4B47 A;  2EV0 A;  1ERD A;  3LSK A;  1LUJ B;  2XGX A;  4N4N B;  1T0F C;  1BL0 A;  1FMW A;  3OIO A;  1J0R A;  3RIR A;  5E3O A;  3EUH A;  5HLT A;  4XRS G;  1IGN A;  1Y8R B;  1TQI A;  3CLQ A;  1JTY A;  2CV2 A;  1TBX A;  4YG2 F;  1ONV A;  1G8X A;  1UJ8 A;  5IT9 Z;  3ABU A;  1Z1D A;  3ZN0 A;  1Y39 A;  3H36 A;  2P6T A;  3DTK A;  3JRH A;  2PX9 A;  4UVB A;  3HOY J;  1V5F A;  1EA3 A;  1QZY A;  4LFU A;  3LSR A;  3I58 A;  1OYW A;  2BBY A;  2L3D A;  3E6B A;  4XRF A;  5C4J J;  2W00 A;  3RKY A;  3A0B C;  2ZCW A;  4J00 A;  2FSW A;  3EYI A;  3ZN1 A;  4HF1 A;  4IRH A;  4OIO F;  1ORK A;  2EA2 A;  2ZXJ A;  4HEA 2;  4HAM A;  1BI1 A;  4OIQ F;  1XG1 A;  1T8I A;  1MSF C;  2F4O B;  3LOC A;  4LG3 A;  1XN7 A;  1LVA A;  3M4O J;  3HOW J;  2W1O A;  3FXO A;  1G3Y A;  1N25 A;  2JQ7 A;  5J1Y A;  1R58 A;  2L2O A;  4E70 A;  3P9K A;  5CLS A;  2ZJR F;  1W0T A;  3C2B A;  5DM6 F;  4IZZ A;  2W4S A;  3OSG A;  2MD5 A;  2Q2E B;  3I4P A;  1ETQ A;  1IN7 A;  3ZQH A;  3RJP A;  2LBF B;  3FWE A;  2J5O A;  5TGT A;  2RDP A;  2R7U A;  1YRN B;  1P92 A;  3MZ8 A;  3PFI A;  1B8I A;  2AS5 F;  3HGY A;  3TP3 A;  5D5W B;  2E1M B;  3TO9 A;  3GTJ J;  3DXJ F;  4PJ0 C;  3S16 J;  1QQI A;  3IP4 B;  4KNY A;  3WG7 H;  1LDK B;  3LQR A;  4DZJ A;  4E7L A;  2DA3 A;  4PZJ A;  4XOP A;  2VJ5 A;  5E3N A;  4ENK A;  1FEX A;  1RR7 A;  4X1E A;  1FMV A;  2WAQ N;  3BY6 A;  2GQQ A;  3HRU A;  3JRI A;  1IN6 A;  1K83 J;  3FBI B;  2R93 J;  3PIO F;  5ED4 A;  1UEL B;  3VYU B;  3T1B A;  5ILS A;  4BE2 A;  1K78 B;  5CQG A;  3ZMU A;  2MW8 A;  2XAQ A;  3OMY A;  4KIG A;  2M4K A;  3HPG A;  3OIQ A;  3RZD J;  2KQR A;  1HSJ A;  3CC7 I;  2FUG 2;  3JAM Z;  3HL2 A;  1UG0 A;  2KZV A;  2AQE A;  4WCG A;  2WB1 A;  4NQW B;  1LNW A;  2XRO A;  2R5Y B;  1FP2 A;  2M30 A;  2XRN A;  3HHG A;  5GTH C;  1ZR2 A;  1ZRF A;  4E7Z A;  2BVM A;  4A69 C;  2HZD A;  3HOU J;  3JRB A;  3DWL E;  2FX0 A;  4P5O A;  3SEQ A;  5HLG A;  2R7S A;  4HZF A;  3T8T A;  2WWY A;  3ZMZ A;  5IY5 H;  1R49 A;  2CG4 A;  2MA3 A;  3FK7 A;  3BPX A;  5HLH A;  1SAU A;  3GO5 A;  1J7K A;  3RI4 A;  5DTD A;  5DD4 A;  3KYD B;  3GTP J;  5D6E A;  2DT7 B;  4KIT B;  1B9N A;  3TO7 A;  2FA5 A;  4F93 B;  3E5Q A;  1P4W A;  4CCK A;  2MD0 A;  2ZC2 A;  3IKT A;  1NK2 P;  3FZV A;  1TP4 A;  2Y69 H;  4P9F A;  3TL4 X;  3CUQ A;  3KPH A;  1OCO H;  1CQT A;  4I09 A;  4ETS A;  1YX3 A;  3REO A;  1V55 H;  3OYM A;  1PJR A;  1A35 A;  3DBR B;  4RAG A;  5ICG A;  1UB9 A;  2GM4 A;  4V2F A;  5IT9 K;  4L9T A;  4BUP A;  4CDG A;  2EK5 A;  4IKF A;  3K1P A;  5JLW A;  2QEN A;  2RV8 A;  4NUB A;  3PIP F;  2EZK A;  4Q4Z F;  3I4M J;  4FIS A;  4NBQ A;  4A0Y A;  4M3F A;  1VQ9 I;  5IOY A;  2JPC A;  4RAY A;  2P81 A;  1ON1 A;  2E2H J;  2CQ7 A;  2EZI A;  4ENJ A;  1HQC A;  1YHQ I;  2I10 A;  3HUG B;  1X1P A;  4BEH A;  4RM2 A;  1SD7 A;  4EJV A;  3R61 A;  1R23 A;  2KIS A;  2EIN H;  3H3Z A;  4XSX F;  4C2T A;  4II3 A;  5M5X J;  2FQ4 A;  2R7V A;  5JFR A;  1Y1V J;  1Z6T A;  3I4N J;  4LB6 B;  4YFX F;  2VAS A;  3BTJ A;  1RUN A;  5GAD J;  3OS1 A;  1APL C;  3UR3 C;  5DCM A;  1MMN A;  4BJT A;  2XPV A;  4Z6Y A;  2Y0M A;  2X9D A;  1W36 C;  3ZMT A;  4DYQ A;  1ZAO A;  3UNG C;  3L1P A;  3G71 I;  2KIM A;  2KJB A;  2A6T A;  2ME0 A;  4IXA A;  2H8W A;  4XLP F;  4C9Y A;  4DBQ A;  1G4D A;  4XN3 A;  2H27 A;  1B1B A;  2BW3 A;  2GOM A;  2DA6 A;  1H8A C;  1H9T A;  3DEE A;  1XDU A;  1Z3Y A;  5F0C A;  1JUM A;  3ZMV A;  3H9Q A;  3GEZ A;  4HV5 A;  2ISZ A;  4FX4 A;  1IXS B;  3G4S I;  1XPX A;  1ZRC A;  2B7E A;  1OPC A;  5TIS C;  3AAF A;  4RS8 A;  4XRS A;  3SEZ A;  4L0Y B;  2OU2 A;  3OL4 A;  3FMQ A;  3ZQL A;  4A3J J;  2EB7 A;  1ZEL A;  2WA0 A;  2MLK A;  4HOB A;  4Y7N J;  3Q0W A;  4PJM A;  4IF4 A;  4C2U A;  3JAM K;  4MFD A;  2FXA A;  4RB3 C;  2JJ7 A;  1ZQ3 P;  2G7H A;  3C7J A;  3ZQG A;  2PJR A;  1FIP A;  3KP4 A;  4HX7 A;  2A61 A;  3GTM J;  1WH7 A;  4Q5S F;  1OR7 A;  3E5U A;  3JRF A;  1W4M A;  2V9P A;  5CQE A;  5IPA A;  3WTY C;  2OTJ I;  1WFX A;  3FXJ A;  4MLO A;  2PG4 A;  2LYC A;  4P96 A;  3KCC A;  4A12 A;  4RB1 A;  1KYZ A;  1TC3 C;  1QO0 D;  2MBF A;  3EUK L;  4HX8 A;  1ZR4 A;  1MDM A;  2CQN A;  3BQY A;  1A5J A;  3MD2 A;  4FHT A;  5HNH A;  3JRA A;  3DBH B;  1P7I A;  2LRD A;  5FJ8 J;  1ZRE A;  2YX4 A;  2G9W A;  3J7A O;  2VLA A;  4UXN A;  4PJL A;  4C3I J;  4KIC A;  4G8X A;  3OYK A;  1TNT A;  2CFX A;  5C3E J;  2LG4 A;  2X4H A;  4IRG A;  2BY0 A;  4B3X A;  4LG0 A;  3GF2 A;  5E1W A;  2V1X A;  3MFK A;  1IXC A;  2D1V A;  1P6R A;  5B1B H;  3KZY A;  4OAZ A;  3DPU A;  2VBX A;  3QOD A;  2GLO A;  1KGS A;  1SD4 A;  2EIL H;  3I71 A;  5ICC A;  4U0Y A;  5CVR A;  3CCR I;  3M1C A;  3D5L A;  2FNA A;  5J1R A;  1DP3 A;  2PMZ A;  3U9G A;  2XRL A;  1KU2 A;  3I53 A;  5B1A H;  4ENM A;  1X3U A;  2LLK A;  3OS0 A;  4AC0 A;  1GV2 A;  2HOA A;  4XRM A;  1QHH D;  3G1O A;  1B6A A;  3AKZ A;  2R5Z B;  4L9N A;  3E5X A;  2HKO A;  3R4K A;  2ESH A;  2LMD A;  4AYB N;  2V79 A;  2XGC A;  3S14 J;  4CYC A;  3BTC A;  2X6Y A;  3LFK A;  3OYB A;  4I2O A;  3AG2 H;  2VJ4 A;  3ERM A;  4ZYG A;  3V7R A;  2VE9 A;  3PNT A;  3Q3S A;  3S2H J;  2RVC A;  4FAS D;  3K4N A;  4CCJ A;  2ECC A;  5LRS A;  1YS7 A;  2WV1 A;  1IN4 A;  1WQ2 A;  1DP7 P;  2EV5 A;  5ICF A;  3MKY B;  1X3Z B;  2E1O A;  5B5E C;  2VQH A;  3V7C A;  3CCU I;  3HSE A;  4C2M J;  1MKM A;  3HZJ A;  4BH9 A;  3FXR A;  1B59 A;  2HS5 A;  3RDI A;  3JW4 A;  3MZY A;  3DKX A;  1SMT A;  4BKX A;  5CJ9 A;  4EM2 A;  3IUO A;  2E36 A;  2CUJ A;  3K1M A;  2YU9 J;  2LNB A;  1VND A;  3H92 A;  3S8P A;  1LDD A;  3BR5 A;  4CCN A;  1VI0 A;  2E19 A;  3PNY A;  5F1J A;  5BS6 A;  1Z7U A;  3WTU C;  1SC7 A;  4HBL A;  4GDF A;  3TBI A;  2IAI A;  2IBD A;  2L01 A;  3FMR A;  1JT0 A;  3H9J A;  5CVI A;  1J9I A;  4IO9 F;  1D3Y A;  2XGE A;  3LA2 A;  4N4O B;  1GVJ A;  5EG0 B;  1S72 I;  2BXZ A;  1JTX A;  4IHV A;  2R7T A;  3BZK A;  1WGX A;  3T8R A;  1LKX A;  1U9N A;  3GTK J;  3CCY A;  5FRM A;  3FMS A;  2PMU A;  3AG4 H;  3ZQF A;  4BQN A;  1SVO A;  3TO6 A;  1V3F A;  3H3V K;  1G59 A;  1P7J A;  4NDL A;  3WGG A;  4IVN A;  5DUK A;  3CZ6 A;  1TL8 A;  2JVG A;  1R1U A;  3MKL A;  2L9V A;  2A5Y B;  2GXG A;  2VON A;  2DQR A;  4XOT A;  5K5R A;  3FHN A;  1WI9 A;  2EA4 A;  4CCL A;  2VKD A;  2R7W A;  3BR0 A;  5IYC J;  1ETO A;  2H94 A;  3Q0V A;  4KMF A;  2H8R A;  5AIQ A;  1MMG A;  4MO7 A;  4RAF A;  5D5V B;  1IJW C;  2FOK A;  4D7N A;  1X1D A;  4PGG A;  1Y8Q B;  2COB A;  2AO9 A;  3FM3 A;  2FOW A;  1OKR A;  1MNE A;  3WGI A;  5K5O A;  2ECB A;  1ETX A;  3B6C A;  2YSR A;  4F3Q A;  3GW2 A;  1WSU A;  2LY2 A;  2XAH A;  4BE0 A;  1LB2 A;  5D5X B;  4B8X A;  1DGR M;  2GIV A;  2HZT A;  1HC8 A;  4JYK A;  4BU2 A;  2W57 A;  4L5E A;  2F48 A;  1MJA A;  2DFH A;  5H6Q A;  1VQ5 I;  4M9X A;  1TWC J;  2LRE A;  3NRV A;  1E3P A;  4LLG F;  2L9S A;  2QKL B;  2DA4 A;  4G9Y A;  4ZYH A;  2ZME C;  4JQF A;  3L2W A;  1HLV A;  1EH7 A;  1T98 A;  2VKE A;  3M8J A;  1ZG3 A;  1S3J A;  3QU3 A;  3LSP A;  1HDD C;  2A07 F;  3I54 A;  3OYJ A;  1TLH B;  2M4G A;  2WC2 A;  2FRH A;  2EIM H;  1A04 A;  2OPT A;  3K7A J;  2PN6 A;  3QOE A;  3QYE A;  1VQP I;  3F72 A;  4B4C A;  1G3T A;  2P5L C;  2F4I A;  1G3W A;  3CO7 C;  3RPU A;  1E3H A;  1Z05 A;  2K9L A;  1OMI A;  2X1D A;  5F27 A;  3S1M J;  4MGR A;  1T38 A;  2EFQ A;  5J1U A;  1FP1 D;  2XAG A;  1O7F A;  2CW8 A;  3KIO A;  2DPU A;  3VSL A;  1YS6 A;  2FE3 A;  5E1Z B;  2MAB A;  1FJL A;  2BY2 A;  3S1N J;  1HBX G;  3QWL A;  2YR2 A;  3J81 Z;  2K3F A;  2AQF A;  1IRX A;  3S3M A;  2H6B A;  2M8G X;  4L0Z B;  1R00 A;  1U5T C;  5DM7 F;  3PQJ A;  3R6S A;  3M9A A;  3HPH A;  1MMA A;  1MBH A;  1YYV A;  5E3L A;  1QZZ A;  3TW6 A;  3PO3 J;  1YG2 A;  4OIP F;  3TDZ C;  5FKM A;  3DFG A;  4XLA A;  1ZLK A;  1DU0 A;  1ACI A;  1QRY A;  3WHC A;  2B9S A;  1I27 A;  4U88 A;  3H1C A;  3ZQ7 A;  1BW6 A;  4I02 A;  1SAX A;  3H5R A;  1E2X A;  2JMW A;  2FNP A;  2O3F A;  3IRR A;  5GP9 A;  2ZNY A;  2OA4 A;  3T0Y A;  1Q1V A;  3QPT A;  5FRO A;  3JTH A;  2P4W A;  1LFB A;  3RCO A;  2WAF A;  1FOX A;  4I7H A;  5CPR B;  3J80 Z;  2K02 A;  3GVA A;  3JSO A;  2D45 A;  1R1T A;  4BDZ A;  4MQV A;  4AVP A;  3KEO A;  2L54 A;  4JK1 X;  1FLI A;  3LMM A;  3GLX A;  1H89 C;  3HOX J;  1R6R A;  2EJR A;  3S17 J;  1JUS A;  2HR3 A;  1X4O A;  2K4J A;  1RZ4 A;  1JI8 A;  4QPQ A;  1OFC X;  1RPW A;  3ZPL A;  3OYF A;  2DYR H;  1W5T A;  3CCS I;  2ZBK A;  3QPH A;  4ZTF A;  1UHM A;  2DQL A;  2W48 A;  4OWR B;  4XQF A;  2JZY A;  2JTV A;  2WAD A;  4RBO A;  4MEX F;  3PFY A;  1TTY A;  5LGT A;  3DPL C;  3KYL A;  2E35 A;  2IGN A;  3G1M A;  2Q2E A;  4LIU A;  1XCV A;  3A01 A;  1REP C;  4KN4 X;  4IHW A;  2LBF A;  5FKN A;  1GLN A;  6PAX A;  2N8G A;  4JP0 A;  5M3M J;  1H9G A;  4HYE A;  1YRN A;  1YW9 A;  2L4M A;  2H1L A;  5A2Q Z;  5EZG A;  3MAJ A;  4XKC A;  3ASN H;  2M0M A;  4EJU A;  4LB5 A;  2DTZ A;  2DOA A;  4XID A;  1UZC A;  1C0W A;  2V6E A;  4LMY A;  3CJT B;  1Y0U A;  4UUT A;  2HOE A;  5E8I A;  4X6A J;  3AFH A;  4M73 A;  3K69 A;  2H6C A;  4Y13 A;  2EPF A;  2VKV A;  3DCF A;  3HOT A;  2JK3 A;  2RQP A;  2VJJ A;  3WHB A;  4DQ2 A;  1B72 B;  4N9H A;  2L7F P;  4A3M J;  4XLC A;  4IHS A;  2ELH A;  2EQR A;  2GAU A;  3BP8 A;  1FBU A;  1TW3 A;  4NQW A;  1ITY A;  3OR2 C;  2PJP A;  2L5Q A;  1NTC A;  2JSP A;  3LA7 A;  4UHT A;  5F0H A;  4DZP A;  2KFD A;  2KT0 A;  2DMT A;  3KP7 A;  1DU6 A;  5BPI A;  3G1L A;  4N0B A;  4DGW B;  1ETV A;  5FRN A;  4D5F A;  1IZ1 A;  1AA7 A;  2GXB A;  5KNL A;  1F36 A;  4AID A;  4OMY A;  2XF5 A;  3J81 K;  5BNG A;  2PQ8 A;  3SFZ A;  1KQ9 A;  2R4G A;  5L3F A;  2O03 A;  5D6F A;  4PK4 A;  1D0Z A;  4O5V A;  5IT3 A;  3QYF A;  4HNU A;  9ANT A;  3KEQ A;  2VXZ A;  1NHA A;  1DUX C;  2ZB9 A;  3MKW B;  1K7A A;  1IW7 F;  2DAO A;  2Z99 A;  5IYB J;  4ASN A;  4GFB A;  3BCA A;  3EPZ A;  4ESJ A;  5F08 A;  3ISP A;  3H3U A;  2LKS A;  1FYM A;  4QWQ A;  3CC2 I;  5LGU A;  2QGU A;  3B02 A;  1FYK A;  1ODD A;  3WTT C;  1FBS A;  3P7N A;  4DYR A;  2UWM A;  3C1D A;  3WOD F;  1IN8 A;  5HDN A;  3OSF A;  1ZN2 A;  2FEZ A;  1UST A;  4EAT A;  2XSD C;  1Z0X A;  1HW1 A;  3M8F A;  4U0V A;  3KZI C;  4HF2 A;  2DA1 A;  3L7W A;  3TDU C;  4A2U A;  3J80 K;  1T6S A;  1ZK8 A;  4LK0 F;  4OIR F;  4BXU A;  5H2F C;  3PL8 A;  4BY1 J;  1J59 A;  1MND A;  5FD5 A;  1VQ7 I;  1D5Y A;  4EGY A;  2LKX A;  5KK1 A;  3CTA A;  1ZGA A;  1IV8 A;  2DOD A;  3Q0U A;  2DDB A;  3HUG A;  3OYL A;  1OCC H;  4KN7 X;  2LF7 A;  3JCU C;  2HQR A;  5DCF A;  2IT0 A;  1R36 A;  1PUF B;  1Z77 A;  1LEA A;  1ZYR F;  1HA8 A;  2STT A;  1VQK I;  4IQJ A;  2CW0 F;  3PUF A;  2OBP A;  2PFB A;  3LSH A;  3GUD A;  3OWT A;  2CV0 A;  4ESF A;  4EJT A;  1BR2 A;  3K2A A;  3D0S A;  3CF2 A;  3IH3 A;  2VIX A;  4I01 A;  2CQX A;  2JA6 J;  1GHC A;  1PYV A;  2NRA C;  1I50 J;  4UVA A;  4MHG A;  5A2Q K;  1W36 D;  1XGM A;  1GVD A;  5FLX Z;  2KJC A;  3DF8 A;  3TMO A;  3OYA A;  3ZCO A;  1BI2 A;  2G0E A;  3B6A A;  1LVK A;  3BG5 A;  3QP6 A;  3WE2 A;  1MMS A;  2VXD A;  4PDK A;  2MGQ A;  1A36 A;  2A3S A;  1JE8 A;  3QP5 A;  3KEY A;  1MSE C;  2IW5 A;  3X2Q H;  3FIW A;  4H0E A;  4G7H F;  2WB1 N;  1YTY A;  2F5C A;  2WAQ A;  5CVJ A;  1U3E M;  2MH9 A;  4XON A;  5EF6 A;  5DYM A;  3LSJ A;  1YIT I;  3BR2 A;  3L2U A;  1EKE A;  4XIC A;  4FTH A;  4KUM A;  2YX7 A;  3ZOB A;  3TW7 A;  5E3M A;  1STZ A;  2NNN A;  3HHH A;  4R79 A;  2KP6 A;  2LY9 A;  5FFX A;  2JA7 J;  2EWN A;  3K6G A;  1G2H A;  3ELK A;  2OUM A;  3S1Q J;  2HXO A;  2V7F A;  3CP2 A;  4DYC A;  2DYS H;  1WPK A;  5J40 A;  4BJ6 C;  1OCT C;  1KQ8 A;  3RZO J;  2P6S A;  1ZH5 A;  2VB6 A;  4FX0 A;  4A6E A;  4XMY A;  2E1N A;  3G6E I;  5EJC A;  2LK2 A;  2G7U A;  3MN2 A;  5HNF A;  4EJO A;  4BQQ A;  2IVM A;  2K9N A;  2RC4 A;  1JJ6 C;  4GO1 A;  4IQ4 A;  1JGG A;  2P7V B;  1LJ9 A;  2W24 A;  5DEQ A;  4ZYE A;  2HYJ A;  2MG4 A;  2CU7 A;  2NVQ J;  1TQP A;  1F5T A;  5FD6 A;  4XM3 A;  1TWH J;  3J7Y J;  3MQ0 A;  1TW2 A;  3LSI A;  1FYL A;  3CDH A;  4I98 B;  1SD6 A;  1WHU A;  2WY8 Q;  2VBW A;  4WXD A;  3V42 A;  3BG7 A;  4V2G A;  3VEP A;  1EV7 A;  2M0C A;  3MMY B;  2CW7 A;  3PM1 A;  2O5R A;  3EUH C;  1O3R A;  5ILU A;  1VQO I;  2QKM B;  1TZL A; 
#chains in the Genus database with same CATH homology
 1JHF A;  4WK8 F;  5E17 F;  3V8J A;  2EFP A;  4HF0 A;  3ZMD A;  4U7D A;  3LQQ A;  2OQG A;  1FNN A;  1O7L A;  2C6Y A;  4AIH A;  3KE2 A;  2QLZ A;  5LBQ A;  1I6X A;  3GFJ A;  2XAF A;  2P7C B;  5HS7 A;  5HVQ C;  1MJ9 A;  3C18 A;  1YW8 A;  4EM0 B;  4BHB A;  5L3E A;  4Y17 A;  2DTR A;  1MD0 A;  3FM5 A;  2Q8K A;  2DK5 A;  2KIU A;  2WTE A;  1R5H A;  3W6K B;  4LLL A;  1P4X A;  2IA2 A;  2EV6 A;  3BJA A;  4A6D A;  2BV6 A;  1BN5 A;  2DK8 A;  2HGC A;  3MWM A;  3IKV A;  1KYW A;  3NQO A;  2Z5U A;  3ROU A;  3HRM A;  3CUO A;  4M74 A;  5D4R A;  3RTR A;  3FX3 A;  3O3K A;  3V7S A;  1XGS A;  1LQ1 A;  2R7D A;  2RNJ A;  2DT5 A;  2V1U A;  2QBY A;  1IXR C;  4O6J A;  1KU7 A;  2GA1 A;  1XMA A;  2DBB A;  2VOP A;  4CGZ A;  1YLF A;  3KP2 A;  4CYD A;  1QNT A;  2A6H F;  1I1S A;  4DNC A;  3CUQ B;  5F1R A;  2QUF A;  3DEU A;  3TKY A;  2HTJ A;  1YO5 C;  5E8G A;  2MH2 A;  3DKW A;  1MJB A;  3CUQ C;  4G6D A;  3F6O A;  5LRR A;  1O3S A;  4GYG A;  2FU4 A;  4Q47 A;  1SMY F;  1FPQ A;  4A0X A;  5LEK A;  1BC8 C;  3M1E A;  3KFW X;  1XCB A;  3HIF A;  4PCQ A;  3DPT A;  2DI3 A;  1G3S A;  3N4M A;  5ILV A;  3T5X A;  3F8B A;  2O8X A;  2UXX A;  2PI0 A;  1FY7 A;  3KP5 A;  3Q5F A;  2V6C A;  3VB2 A;  2NNY A;  4RGU A;  3L9F A;  1GXQ A;  2ZJ2 A;  2Q0O A;  4ON0 A;  5JR3 A;  2RN7 A;  2XUB A;  3HTU A;  4AD9 A;  1YIO A;  1O57 A;  4RAZ A;  3LAJ A;  3DV8 A;  2HEO A;  5HOO A;  3R0A A;  4KFC A;  5J8F A;  1HW5 A;  2L4A A;  3GZ5 A;  2OQR A;  3LWF A;  1W7P B;  4YIF A;  2F5E A;  2GZW A;  2XVC A;  5L3D A;  2COM A;  3VOD A;  2R7F A;  4RB2 C;  3O6B B;  1TNS A;  1XGN A;  5L3C A;  1RNL A;  4Y15 A;  1MGT A;  3PQK A;  4YII A;  2DU9 A;  2L02 A;  5LGN A;  4UVC A;  5JVT A;  3E97 A;  3NEU A;  5FGM A;  4YFN F;  2ZME B;  3BJ6 A;  4HQE A;  1PP8 F;  3CO6 C;  2M1B A;  3COA C;  3BOQ A;  2JRT A;  4K2E A;  2K4B A;  2PBI A;  3M8E A;  3M7G A;  5EEG A;  1D8J A;  3I59 B;  3HYI A;  1KQ0 A;  2HFH A;  4MQ9 F;  1JGS A;  2HQN A;  2BE5 F;  4R1H A;  3F23 A;  2ADU A;  2YPR A;  4OU0 A;  2OZU A;  1U5T B;  3ZMS A;  3L2C A;  3F22 A;  1Z9C A;  2STW A;  1VTN C;  3QU6 A;  4PGH A;  1T0F A;  2HKX A;  3KP3 A;  5HS8 A;  1MZB A;  2BEO A;  2KKO A;  2LF8 A;  4M71 A;  5HS9 A;  2ACJ A;  2A6E F;  3GZ6 A;  4S04 A;  4BNC A;  2R3S A;  1S6L A;  3I64 A;  5BMZ A;  4U7B A;  2OD5 A;  2P5K A;  1IN5 A;  3RKX A;  1LDJ A;  4F7Z A;  3B73 A;  1B9M A;  1IUY A;  1Z6R A;  4A5N A;  2WV0 A;  2NAZ A;  3GX4 X;  1RUO A;  4WF2 A;  2F2E A;  2EFW A;  1UCR A;  1O3Q A;  3I0T A;  5K1Y A;  2PEX A;  2X0L A;  3TGN A;  4KA4 A;  1HKQ A;  4RGR A;  2Y48 A;  2VC1 A;  4ZH4 F;  4MTD A;  3CJN A;  4U0W A;  4WX9 A;  4UV9 A;  4RGS A;  2M45 A;  3W6J B;  2VOO A;  1BC7 C;  1P4A A;  3I5U A;  1L0O C;  1R22 A;  3P9I A;  1D5V A;  2HTS A;  3GFM A;  1Z91 A;  3FXQ A;  3SZP A;  4L18 B;  2VOD A;  1KA8 A;  3WG9 A;  4WWC A;  2E7X A;  1K78 A;  2E7W A;  2XIG A;  2ZNZ A;  3GFL A;  4I0A A;  2GWR A;  3Q9S A;  1U78 A;  3SHF A;  2JSC A;  4XBF A;  2TDX A;  3L09 A;  5FFZ A;  2LKP A;  3VOE A;  4D0P A;  3EET A;  2PMH A;  2V9V A;  3MEX A;  2A68 F;  1YW7 A;  2Z9O A;  3WTW C;  4Q48 A;  5CVU A;  4EGZ A;  1I1G A;  4HQM A;  2VN2 A;  3HSR A;  4OOI A;  2Z33 A;  4R8H A;  1RI7 A;  1ZG1 A;  4EMS A;  5LHG A;  3EQL F;  4NHJ A;  4CXF A;  5J6X A;  1XSV A;  1SFU A;  3MCZ A;  4EQQ A;  4HDV A;  3F8N A;  5HLI A;  3U1D A;  4HW0 A;  3IRQ A;  4TV7 A;  3F21 A;  1ZRD A;  1UFM A;  2M8E A;  1XMK A;  1S7A A;  4HA8 A;  1BBY A;  1XD7 A;  1FZP B;  2QQ9 A;  2QZ8 A;  2NYX A;  2IRF G;  4M72 A;  3RPQ A;  4B09 A;  3BRO A;  2QVO A;  1E17 A;  5ERI A;  5H6R A;  3TOA A;  4ZZL A;  1HST A;  2CO5 A;  2XHK A;  3OV8 A;  4FT8 A;  2O0Y A;  5DD8 A;  4M9S A;  4KDP A;  1CF7 B;  1WKM A;  2ISY A;  4AIJ A;  4ZZD A;  1B4A A;  1IAW A;  3WTX C;  5E20 A;  4HV6 A;  2QQB A;  3WU0 A;  1PP7 U;  3V4G A;  1SFX A;  4EM1 A;  1H0M A;  2CYY A;  1FT9 A;  2ETH A;  5HDG A;  3S2W A;  2DPD A;  2JPB A;  4IHT A;  4LD5 A;  5D8L B;  1V4R A;  2VE8 A;  2CGP A;  3R0J A;  4N9I A;  1USS A;  2FMY A;  4XLN F;  1IRF A;  1AOY A;  1BOA A;  4LGW A;  4YFK F;  3G3Z A;  3ECH A;  4M9Z A;  2GA2 A;  3LST A;  2HYF A;  5JI6 A;  1OYY A;  3WGH A;  2J5P A;  3E6M A;  2ESN A;  4BHP A;  2IA0 A;  3RYR A;  3HTS B;  4NB5 A;  4G7O F;  2FQ3 A;  2FML A;  3K0L A;  1QGP A;  5LHI A;  3EYY A;  3BZ6 A;  2PLY A;  3MZH A;  4HLY A;  1SFE A;  2W85 A;  4P9U A;  3WU1 B;  1HKT A;  4A0Z A;  1BI3 A;  4HLX A;  1JXS A;  1ON2 A;  1HW2 A;  2VT3 A;  5CYV A;  5AON A;  4WXH A;  2W25 A;  1XSX A;  1WWX A;  1FBQ A;  5FLX K;  3R60 A;  1FSH A;  2QWW A;  3JTG A;  1BIA A;  1F1Z A;  2CWE A;  3SZT A;  4MEY F;  5D5U B;  4HX4 A;  4S05 A;  4O3M A;  2RGV A;  3WTV C;  1ZHF A;  1ZAR A;  2QM3 A;  1QBJ A;  3IHU A;  3GWZ A;  5K5Q A;  3LAP A;  3G73 A;  4KMU X;  2KIF A;  2Z3Y A;  1ULY A;  3V8K A;  1W7P A;  3SQN A;  4G7Z F;  1BIB A;  1QPM A;  2P5V A;  5DV5 A;  4OIN F;  1DDN A;  3HSF A;  3TOB A;  3HOS A;  1L3L A;  3BDD A;  3FF5 A;  1IF1 A;  3GYH X;  4Z2Y A;  1U2W A;  1W7P D;  5TRD A;  3HRS A;  4BAY A;  2ZME A;  4UUV A;  2HYG D;  2VC0 A;  2XV4 S;  4M6X A;  1CGP A;  2DW4 A;  4IJA A;  2D2W A;  4ENN A;  3F3X A;  1T39 A;  2AXL A;  1HKS A;  2DFI A;  4JBA A;  3I59 A;  4KT5 C;  2YU3 A;  1XB4 A;  2F5D A;  3ERE D;  4MTE A;  1JHH A;  2BYV E;  2XKO A;  2QQA A;  3L00 A;  2FBH A;  5DCM B;  3VFZ A;  1U5T A;  5LHH A;  5D8K B;  3KET A;  4BYY A;  1IRG A;  5FO5 A;  4RGX A;  2HWV A;  3O2P E;  1PDN C;  2FF4 A;  2FBI A;  1I5Z A;  2KRF A;  2VBZ A;  4ZYD A;  3N97 A;  4L9V A;  3E6D A;  2QYO A;  2Y75 A;  4BHC A;  3QAH A;  2D1H A;  2DLL A;  4OMZ A;  1S29 A;  2IA1 A;  3IWF A;  4GYI A;  4UV8 A;  4CHU A;  3K1N A;  1FC3 A;  4AIK A;  2VBY A;  4G6Q A;  3BJO A;  4GXO A;  1EH8 A;  5E18 F;  1PUE E;  2K27 A;  4KIF A;  3FXU A;  3QRF F;  5LLQ A;  1R5G A;  3GXO A;  2IJL A;  3RYP A;  1S8N A;  1MDM B;  2BGC A;  1OYI A;  5FB2 A;  2QBY B;  3KLN A;  2K7L A;  4P55 A;  3SXY A;  1UHW A;  3C3W A;  3RKW A;  1BJA A;  3HRT A;  1LEB A;  4LG0 B;  4L9J A;  5DUI A;  1XSD A;  4G94 A;  1R7J A;  1ZG5 A;  2DO7 A;  4A5M A;  2M87 A;  4XSZ F;  1YQA A;  2UXN A;  5LEJ A;  3KP6 A;  5DDG A;  1FWZ A;  4LJZ F;  3K9T A;  1ZGJ A;  4KYW A;  2CSO A;  5TJJ A;  1U8R A;  1YFH A;  3EDP A;  3JSP A;  1KU9 A;  1J75 A;  4LLN A;  5H20 A;  1HXD A;  3E6C C;  5BPD A;  2OAZ A;  3F6V A;  1XDS A;  3WTS C;  4IRI A;  4EV0 A;  4MNU A;  4RB0 A;  2LDU A;  5JHU A;  1F9N A;  2A69 F;  4L5I A;  4GCV A;  3WTZ A;  1D8K A;  4KIB A;  1EH6 A;  1T2K A;  1W5S A;  1K79 A;  4M6Y A;  2W84 A;  1BI0 A;  1XGO A;  1BM9 A;  4HDU A;  1WRJ A;  2MC3 A;  1J2X A;  3K2Z A;  2XKP A;  2ZO4 A;  2IPQ X;  2P8T A;  2MLG A;  2JT1 A;  4UNO A;  3Q9V A;  5AIP A;  5D4S A;  3QOP A;  1AWC A;  3IL2 A;  1O3T A;  4CO8 A;  3F8C A;  3WE3 A;  2ZKZ A;  5E1X A;  1KU3 A;  1K6O A;  5EEH A;  2K86 A;  1GXP A;  1DPU A;  3U2R A;  2NS0 A;  4LK1 F;  3OOP A;  4AWX B;  1TQM A;  4BQA A;  1U6G A;  2VT2 A;  4I0B A;  3GFI A;  4GGG A;  5L3G A;  2HDC A;  4QLC U;  2O61 A;  5F64 A;  2OZ6 A;  5CVV A;  1P2F A;  3IC7 A;  4CIC A;  5ICE A;  1FSE A;  2EFN A;  5J8C A;  5BQT A;  1ZLJ A;  3E3V A;  2H09 A;  4WXC A;  3LA3 A;  1FX7 A;  1F4K A;  2UZK A;  3KLO A;  1FOK A;  2IP2 A;  2XAJ A;  1RIO H;  2O6G E;  3KZZ A;  3DP7 A;  3TQN A;  1Q1H A;  3BWG A;  4ESB A;  3DQV C;  2F5F A;  3ZP5 A;  3ECO A;  3ULQ B;  2EFO A;  3V8L A;  5BOX A;  4EJW A;  2RKH A;  5KVR A;  1CF7 A;  1DPR A;  1SD5 A;  2E1C A;  2B0L A;  2V1D A;  3CLO A;  3F8M A;  2M5W A;  2CQK A;  3IWZ A;  1J5Y A;  2LSO A;  2FBK A;  4EVI A;  3ML6 A;  1R1V A;  3P9C A;  5HDK A;  3ABT A;  3FHZ A;  5F6F A;  1G6N A;  4L5J A;  1S7O A;  2XAS A;  5L3B A;  4IPA A;  3BPV A;  3F8F A;  4CZZ A;  2ZFW A;  2EV0 A;  2XGX A;  1J0R A;  3RIR A;  3EUH A;  1TQI A;  1TBX A;  4YG2 F;  1ONV A;  5IT9 Z;  3ABU A;  1Z1D A;  3ZN0 A;  2P6T A;  4UVB A;  1QZY A;  4LFU A;  3I58 A;  1OYW A;  2BBY A;  2L3D A;  3E6B A;  4XRF A;  3RKY A;  2ZCW A;  3EYI A;  2FSW A;  3ZN1 A;  4HF1 A;  4IRH A;  4OIO F;  2EA2 A;  2ZXJ A;  4HAM A;  1BI1 A;  4OIQ F;  1XN7 A;  1LVA A;  1G3Y A;  1R58 A;  4E70 A;  3P9K A;  5CLS A;  2MD5 A;  3I4P A;  1IN7 A;  3RJP A;  3FWE A;  2J5O A;  2RDP A;  1P92 A;  3PFI A;  2AS5 F;  5D5W B;  3TO9 A;  3DXJ F;  1QQI A;  4KNY A;  1LDK B;  3LQR A;  4PZJ A;  4ENK A;  2GQQ A;  3BY6 A;  3HRU A;  1IN6 A;  5ED4 A;  3T1B A;  5ILS A;  1K78 B;  3ZMU A;  2XAQ A;  4KIG A;  1HSJ A;  3JAM Z;  4WCG A;  1LNW A;  2XRO A;  1FP2 A;  2M30 A;  2XRN A;  3HHG A;  1ZRF A;  4P5O A;  5HLG A;  4HZF A;  3T8T A;  2WWY A;  3ZMZ A;  2CG4 A;  2MA3 A;  3BPX A;  5HLH A;  3GO5 A;  1J7K A;  3RI4 A;  5DD4 A;  5D6E A;  1B9N A;  3TO7 A;  2FA5 A;  3E5Q A;  1P4W A;  3IKT A;  3FZV A;  4P9F A;  3CUQ A;  4I09 A;  4ETS A;  3REO A;  5ICG A;  1UB9 A;  5IT9 K;  4L9T A;  4CDG A;  2EK5 A;  3K1P A;  2QEN A;  2RV8 A;  4Q4Z F;  4A0Y A;  2JPC A;  4RAY A;  1ON1 A;  4ENJ A;  1HQC A;  1SD7 A;  4EJV A;  3R61 A;  1R23 A;  3H3Z A;  4XSX F;  5JFR A;  1Z6T A;  4LB6 B;  4YFX F;  1RUN A;  5DCM A;  2Y0M A;  3ZMT A;  1ZAO A;  2KIM A;  2KJB A;  4IXA A;  4XLP F;  1G4D A;  2H27 A;  1B1B A;  1H9T A;  1XDU A;  3ZMV A;  3GEZ A;  4HV5 A;  2ISZ A;  4FX4 A;  1IXS B;  1ZRC A;  1OPC A;  3AAF A;  4RS8 A;  4L0Y B;  2OU2 A;  3FMQ A;  2EB7 A;  2MLK A;  4HOB A;  4IF4 A;  3JAM K;  2FXA A;  4RB3 C;  2G7H A;  3C7J A;  3KP4 A;  4HX7 A;  2A61 A;  4Q5S F;  1OR7 A;  3E5U A;  1W4M A;  3WTY C;  4P96 A;  2PG4 A;  4A12 A;  3KCC A;  4RB1 A;  1KYZ A;  1QO0 D;  2MBF A;  4HX8 A;  1MDM A;  4FHT A;  1ZRE A;  2YX4 A;  2G9W A;  3J7A O;  4UXN A;  4KIC A;  4G8X A;  1TNT A;  2CFX A;  2X4H A;  4IRG A;  4LG0 A;  3GF2 A;  5E1W A;  2V1X A;  3MFK A;  1IXC A;  2D1V A;  1P6R A;  3KZY A;  2VBX A;  1KGS A;  1SD4 A;  3I71 A;  5ICC A;  4U0Y A;  5CVR A;  3D5L A;  2FNA A;  3U9G A;  3I53 A;  1KU2 A;  4ENM A;  1X3U A;  1B6A A;  4L9N A;  3E5X A;  2HKO A;  3R4K A;  2ESH A;  2V79 A;  3LFK A;  4I2O A;  4ZYG A;  3V7R A;  2VE9 A;  2RVC A;  5LRS A;  1YS7 A;  1IN4 A;  1WQ2 A;  1DP7 P;  2EV5 A;  5ICF A;  3V7C A;  3HSE A;  1MKM A;  4BH9 A;  3FXR A;  1B59 A;  2HS5 A;  3RDI A;  3JW4 A;  3MZY A;  1SMT A;  5CJ9 A;  4EM2 A;  3K1M A;  2LNB A;  3H92 A;  1LDD A;  5BS6 A;  1Z7U A;  3WTU C;  4HBL A;  2L01 A;  3FMR A;  5CVI A;  1J9I A;  1D3Y A;  3LA2 A;  1GVJ A;  3T8R A;  3FMS A;  2PMU A;  3TO6 A;  1V3F A;  3WGG A;  4IVN A;  5DUK A;  1R1U A;  2A5Y B;  2GXG A;  2VON A;  2DQR A;  5K5R A;  1WI9 A;  2EA4 A;  4KMF A;  2H94 A;  5AIQ A;  5D5V B;  2FOK A;  4PGG A;  3FM3 A;  1OKR A;  3WGI A;  5K5O A;  2YSR A;  3GW2 A;  1WSU A;  2XAH A;  1LB2 A;  5D5X B;  4B8X A;  2GIV A;  2HZT A;  2W57 A;  1MJA A;  5H6Q A;  4M9X A;  3NRV A;  4LLG F;  4G9Y A;  4ZYH A;  4JQF A;  1EH7 A;  1T98 A;  2A07 F;  3QU3 A;  1ZG3 A;  1S3J A;  3I54 A;  1TLH B;  2WC2 A;  2FRH A;  1A04 A;  2PN6 A;  3F72 A;  1G3T A;  2P5L C;  1G3W A;  3CO7 C;  3RPU A;  1Z05 A;  1OMI A;  4MGR A;  1T38 A;  2EFQ A;  1FP1 D;  2XAG A;  1O7F A;  2DPU A;  1YS6 A;  2FE3 A;  5E1Z B;  1HBX G;  2YR2 A;  3J81 Z;  2H6B A;  4L0Z B;  1R00 A;  1U5T C;  3PQJ A;  3R6S A;  3M9A A;  1YYV A;  1QZZ A;  1YG2 A;  4OIP F;  3TDZ C;  3DFG A;  1ZLK A;  1I27 A;  4U88 A;  3ZQ7 A;  4I02 A;  1SAX A;  1E2X A;  2FNP A;  2O3F A;  3IRR A;  2ZNY A;  2OA4 A;  3T0Y A;  3QPT A;  3JTH A;  2P4W A;  4I7H A;  3J80 Z;  2K02 A;  3GVA A;  3JSO A;  2D45 A;  1R1T A;  4MQV A;  4AVP A;  3KEO A;  2L54 A;  4JK1 X;  1FLI A;  3GLX A;  2EJR A;  2HR3 A;  2K4J A;  1RZ4 A;  3ZPL A;  1W5T A;  2ZBK A;  3QPH A;  1UHM A;  2DQL A;  2JZY A;  2JTV A;  4MEX F;  1TTY A;  5LGT A;  3DPL C;  2Q2E A;  1REP C;  1XCV A;  4KN4 X;  6PAX A;  1H9G A;  4HYE A;  1YW9 A;  2L4M A;  5A2Q Z;  3MAJ A;  4EJU A;  4LB5 A;  1C0W A;  4LMY A;  1Y0U A;  2HOE A;  5E8I A;  4M73 A;  3K69 A;  2H6C A;  4Y13 A;  3HOT A;  2RQP A;  4DQ2 A;  4N9H A;  4IHS A;  2ELH A;  2GAU A;  3BP8 A;  1FBU A;  1TW3 A;  4NQW A;  2PJP A;  3LA7 A;  4UHT A;  3KP7 A;  5BPI A;  4N0B A;  1IZ1 A;  2GXB A;  4OMY A;  3J81 K;  2PQ8 A;  3SFZ A;  1KQ9 A;  5L3F A;  2O03 A;  5D6F A;  4O5V A;  5IT3 A;  3KEQ A;  2VXZ A;  1NHA A;  1DUX C;  1K7A A;  1IW7 F;  2DAO A;  2Z99 A;  4ASN A;  4ESJ A;  3ISP A;  3H3U A;  1FYM A;  4QWQ A;  5LGU A;  3B02 A;  1FYK A;  1ODD A;  3WTT C;  1FBS A;  3P7N A;  2UWM A;  3C1D A;  3WOD F;  1IN8 A;  5HDN A;  1ZN2 A;  2FEZ A;  1UST A;  1HW1 A;  3M8F A;  4U0V A;  4HF2 A;  3L7W A;  3TDU C;  4A2U A;  3J80 K;  1T6S A;  4LK0 F;  4OIR F;  4BXU A;  1J59 A;  5FD5 A;  4EGY A;  5KK1 A;  3CTA A;  1ZGA A;  3HUG A;  4KN7 X;  2LF7 A;  2HQR A;  5DCF A;  2IT0 A;  1R36 A;  1LEA A;  1ZYR F;  2STT A;  2CW0 F;  2OBP A;  2PFB A;  3GUD A;  4ESF A;  4EJT A;  3D0S A;  4I01 A;  1GHC A;  2NRA C;  4UVA A;  4MHG A;  5A2Q K;  1XGM A;  5FLX Z;  2KJC A;  3DF8 A;  1BI2 A;  3QP6 A;  3WE2 A;  4PDK A;  2A3S A;  1JE8 A;  3QP5 A;  2IW5 A;  4H0E A;  4G7H F;  1YTY A;  2F5C A;  5CVJ A;  1U3E M;  2MH9 A;  5DYM A;  4KUM A;  2YX7 A;  1STZ A;  2NNN A;  3HHH A;  4R79 A;  5FFX A;  2EWN A;  3ELK A;  1KQ8 A;  2P6S A;  1ZH5 A;  4FX0 A;  4A6E A;  2E1N A;  2G7U A;  4EJO A;  2IVM A;  2RC4 A;  4GO1 A;  2P7V B;  1LJ9 A;  2W24 A;  5DEQ A;  4ZYE A;  1TQP A;  1F5T A;  5FD6 A;  3MQ0 A;  1TW2 A;  1FYL A;  3CDH A;  4I98 B;  1SD6 A;  2VBW A;  4WXD A;  3VEP A;  1EV7 A;  1O3R A;  5ILU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...