4GFBA

Rap1/dna complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
238
structure length
218
Chain Sequence
HNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPRPGVPTPGNYNSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RAP1
publication title Effect of Rap1 binding on DNA distortion and potassium permanganate hypersensitivity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 56
structure length 218
sequence length 238
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF09197 Rap1-DNA-bind Rap1, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4gfbA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4gfbA02
4A3GJ 3FKIJ 1GUUA 3ZOBA 3JRHA 1X58A 2HOTA 3HGYA 5J1YA 1MBHA 3GTJJ 3Q0VA 5IP9J 3HOWJ 4RBOA 4XICA 3JREA 3BTJA 5C4JJ 5DS9A 2E2IJ 9ANTA 1ENHA 5EZHA 3TEDA 2ZB9A 3S16J 2MW8A 2R5YB 1AHDP 3QPLA 3JRAA 1GV2A 2XPWA 1XC5A 3B6CA 1MBEA 1RETA 1IDYA 2NOGA 3RQIA 2ID3A 1JKRC 1W0TA 2XB5A 1OCPA 1ETOA 1ZGWA 3S14J 1JKPC 1WGXA 5F0CA 3LSGA 1OJLA 1EF4A 1QRYA 4M3DA 1WH5A 2EZKA 1IC8A 4FISA 3D1NI 1E3OC 2VI6A 1P7JA 3G1OA 4W97A 2LKXA 2KDZA 1T33A 2Y9YA 3NARA 5FKLA 2LTPA 1LFUP 2HYJA 5C3EJ 1H88C 2VKVA 1IG7A 4C3HJ 1XS9A 1UG2A 2CQQA 1RKTA 3M4OJ 2R93J 4FE4A 2K9NA 1NK2P 2NVQJ 4AYBN 2EZLA 4MFDA 2NVXJ 3JRDA 2L0KA 3K7AJ 1WH7A 2K40A 3IV5A 3BR6A 4J19A 3OSFA 3GTQJ 1ZR2A 2D5VA 2GLOA 1MBFA 2LP0A 1JT6A 4UUSB 3SJMA 1GVDA 1POGA 2M34A 1DU6A 1W0UA 3E7LA 2KT0A 2R5ZB 3ZQLA 1FIPA 2NS7A 2FD5A 2X6OA 3HBLA 3WHCA 3HOZJ 2EZHA 1F43A 5EDNA 3CCYA 2GM4A 3OOUA 1H8AC 3BR2A 5K7ZA 4JX4A 5EG0B 2DA6A 1ORKA 2MSYA 5GPAA 2LY9A 4IEJA 3BT9A 2WB1N 3G1MA 4A3EJ 1Y1VJ 2AO9A 1ZKGA 4M3EA 1O4XA 1JT0A 3ZQIA 1FTTA 2IAIA 5DTDA 4DYQA 1FJLA 1MNMC 4MO7A 4D5FA 4A3CJ 3BR1A 3QQAA 2EBIA 2K9SA 4A3JJ 1MSEC 3GTOJ 3W6VA 1U9NA 2JK3A 2VKEA 2R7ZJ 1LFBA 1MBGA 3B6AA 2HI3A 2DMTA 3A02A 3PM1A 1PUFA 4S0HB 5F0FA 5FKKA 3HOUJ 1IDZA 5HODA 2CUEA 3GTMJ 2XGCA 3K2AA 5FKOA 2E1OA 5K7FA 1JGGA 1TWHJ 5EEAA 1Q1VA 3ZQCA 2R5YA 1I6HJ 1HLVA 2YUSA 4ABZA 3BQYA 4HNVA 4XIDA 2JA5J 5M5YJ 4A3LJ 2MG4A 4DZJA 1UMQA 1WCMJ 4BBSJ 2CJJA 5M5XJ 1HOMA 4MIMA 3MN2A 2DA3A 2L7ZA 4BBRJ 4M3FA 1WI3A 1K83J 1B72B 1H89C 2LVSA 1YRNB 3IH2A 2EQRA 3HDDA 4D7NA 3GTKJ 3VPRA 4IHWA 1JUMA 4FCYA 2I10A 5J3LA 4C3IJ 1OCTC 5IP7J 2QCOA 1LE8B 4XRSG 1MBJA 4XRSA 1F36A 3HOVJ 4D5CA 5FKMA 1QPIA 1I50J 2L7FP 2MGQA 5J1UA 1GV5A 3LSRA 2P81A 2Y0SN 5IYBJ 2O9LA 5GP9A 2N8GA 3OSGA 1BW6A 3PO3J 1XG1A 3TP3A 1X2NA 4NDLA 3UKGA 1BJZA 5E3NA 1SFOJ 5IYDJ 2LFBA 2TCTA 2H1KA 4A3FJ 4M3GA 2R5ZA 1BW5A 2M0CA 1NK3P 1D5YA 3H0GJ 5F0HA 1HCRA 3BTIA 2YU9J 1ETQA 2YS9A 4B1RA 5EG0A 3GTGJ 2CU7A 4C3JJ 4D7MA 3LNQA 5E3LA 1AKHA 4M6VA 3GBGA 2DA4A 4UUTA 3L1PA 3JRIA 3I4MJ 2XRLA 2DA1A 4LOCA 3A01A 2R0QC 3S1NJ 2DN0A 1U8BA 2VPRA 1ETXA 4AUXA 3F0CA 2JMWA 2CRGA 4A3DJ 2FX0A 3ZQGA 2PMZN 4BY1J 2E19A 2JA6J 3BR3A 4CYCB 1ETVA 2ID6A 3TW6A 4B4CA 4Y7NJ 2H8RA 4IHYA 3I4NJ 3JR9A 3O8GA 2AHQA 5EGOA 2LD5A 5JLXA 3Q0UA 1MH3A 1IGNA 3FISA 4L5EA 4BY7J 3TW7A 2M2EA 1B8IB 2QF7A 4IHVA 2LLKA 2JJ7A 1IV6A 1QVTA 3MVPA 2DMPA 1JKOC 1VF9A 2XB0X 2X48A 2ECBA 1RKWA 1TWCJ 2JA7J 2Y31A 3SFIA 1VI0A 3NAUA 1ETWA 1ZK8A 4QSHA 3S15J 3JRGA 1B72A 2ME0A 1IRZA 3BG9A 5F1JA 3S1QJ 3LOCA 5IOYA 3BG5A 3JRCA 1R9TJ 4I76A 1RPWA 5C44J 2JWTA 2RAEA 1K61A 3BTCA 1ZQ3P 5M3FJ 1LE8A 5EYRA 2HOSA 1Z77A 3H3VK 4BKXA 3RKQA 2E2JJ 2HDDA 2L7MP 4RDUA 1ZR4A 5GPCA 4W1UA 4V2GA 1TWFJ 2IBDA 5FKNA 3HEFA 1U78A 2DMNA 4MFEA 4A3BJ 4A3MJ 1GT0C 3WHBA 2L9RA 2ME6A 4A93J 1RESA 5EZGA 4A3IJ 1MH4A 5K7HA 2XPUA 1FEXA 1JUPA 3BQZA 1PUFB 4JX6A 5M3MJ 4QTRA 5FLMJ 1BL0A 2ELKA 4DW6A 3S2DJ 1IUFA 2Y30A 1FTZA 2DMUA 1CQTA 4DYRA 3HB9A 5E3MA 2EZIA 1U9OA 1JTYA 4V2FA 3DEWA 4UUSA 3FIWA 3FK6A 1Y1WJ 1A5JA 2G0EA 3Q3SA 1G2HA 3IH4A 1HDPA 3CMYA 1VFCA 2DTZA 1A6IA 1FIAA 3ZQHA 1APLC 1MSFC 2XGEA 4CYCA 2HXOA 4EEFG 1HDDC 2TRTA 2Y9ZA 1TWAJ 1TC3C 3BTLA 2O7OA 4C2MJ 1T56A 2XGDA 5F08A 2NVTJ 3C2BA 3BR5A 4FTHA 2Y2ZA 1JKQC 1B8IA 5J1RA 3DCFA 3S1MJ 2OF7A 2XPVA 3JRBA 2JN6A 4DZPA 2B63J 4M3BA 3O8HA 3JRFA 2XSDC 1SANA 2ECCA 3PO2J 2COBA 2CQXA 3TP0A 1JTXA 5IP6A 4A69C 5JLWA 4X1EA 3CQZJ 3GTLJ 3HKZN 2OPTA 5C4XJ 3FK7A 3Q0WA 4XK4A 4Y52J 2HOAA 3G1LA 4JP0A 4JYKA 2EH3A 3LSPA 2NS8A 2HQ5A 3HOXJ 2FJ1A 3A03A 4A3KJ 2HXIA 4XRMA 5F27A 5M5WJ 3HGGA 3CDLA 3IH3A 1ETYA 1I3QJ 2IEKA 2DA5A 4DYCA 2R92J 5IOZA 2LK2A 2X9DA 4X6AJ 1AU7A 3M3YJ 4G12A 2JA8J 4IHXA 1UHSA 1DU0A 1OFCX 1GDTA 3S2HJ 3LSJA 1ETKA 1IJWC 3S1RJ 1ITYA 2CUFA 3BR0A 1AKHB 4MLOA 1X2MA 5E3OA 2O8KA 1S7EA 4I6ZA 4QIWN 1YRNA 3HOYJ 1JUSA 5F04A 3QPSA 4JX5A 3BG3A 3A01B 3ZQFA 3RZOJ 1MBKA 2DA2A 2M9HA 5IPAA 1BA5A 2DMQA 2GBYA 2LR8A 2FQ4A 3HM5A 2E2HJ 2DA7A 1TWGJ 1JJ8C 3RZDJ 4B3AA 5FLVA 1Z0XA 2K9QA 2M8GX 3OIOA 5FJ8J 5BNGA 4GFBA 1HF0A 1NTCA 1WPKA 4FE7A 1ZTRA 2DJNA 5EGOB 1P7IA 1VNDA 2WV1A 2VUMJ 1JJ6C 3MKLA 4AC0A 2NVYJ 5EF6A 1QVUA 3S17J 3GTPJ 4BXXJ 2W48A 1RR7A 3SDGA 2WAQN 5IYCJ
chains in the Genus database with same CATH superfamily
1LUJB 3DU6A 2RQPA 3FKIJ 3ZOBA 4DBQA 2L5QA 2GZWA 1T0FC 3CF5F 4BU2A 2ZXWH 2LC2A 3Q0VA 1M1EB 4KMFA 2W85A 4R8HA 5IP9J 5K1YA 1Z7UA 3N05A 2RVCA 2WTEA 4BJTA 3HPGA 2P6TA 1SFXA 4XICA 3JREA 1WFXA 2QM3A 1UG0A 3OR2C 2Y0MA 2E2IJ 4CYDA 2DI3A 1ENHA 5EZHA 2IA1A 3TEDA 1LEBA 3K0LA 3KZYA 2ACJA 3RPQA 4A6DA 3CCSI 2EA2A 1GV2A 2XPWA 3BP8A 1RETA 1X3ZB 4YFXF 2QVOA 2HVRA 2NOGA 3OYKA 4BDYA 1OCPA 2G9WA 1FP2A 4EATA 3CC2I 2Z5UA 1JKPC 1WRJA 4RM2A 3CJTB 4Z6YA 1OJLA 1FOXA 2EZKA 2WWYA 2ELJA 1E3OC 1BJAA 3U1DA 2AQEA 1P7JA 2BY2A 2X1EA 1XGNA 4J00A 1D8KA 4RLFA 3PNTA 3QOEA 1IG7A 1SD5A 2OBPA 4BHBA 1F9NA 2PFBA 4ANJA 4II3A 2KMUA 1U5TC 1R1UA 1R7JA 2L9NA 2DT6A 1NK2P 3DKYA 2D1VA 1KQ0A 1VZ0A 3CESA 5HOOA 1WH7A 3GLXA 2DFIA 1T39A 2WA0A 1HQCA 1TZLA 1Z3YA 5HDGA 1J75A 2ZFUA 2OD5A 3GZ5A 4OIQF 2NNYA 4J19A 3OSFA 1YIOA 2FOWA 4KA4A 2D5VA 1MBFA 5E79C 4EM1A 2QQBA 3ABTA 2LP0A 4UUSB 4I2OA 2ZSIB 2WBMA 3KYLA 1FYMA 1VQ6I 1YOVB 3BWGA 3FZVA 2F4OB 2X6WA 1TBXA 3DLAA 4L9JA 4BHPA 4KITB 4H4KC 3QPHA 1P6RA 1W36C 1TQPA 3GZNB 2NS7A 3HBLA 4A5MA 2EZHA 4UUVA 5EDNA 3T8TA 4LMYA 2PMHA 1U5TB 2W82A 2Y69H 2DA6A 5GPAA 4HSTA 3TOAA 1XN7A 2LDUA 3BT9A 4B3XA 5B3SH 1CGPA 1YYVA 4A3EJ 2E1NA 3FXUA 3OYIA 4BE0A 5E20A 4M6XA 1JT0A 1X1BA 4DYQA 2IVMA 3RKXA 3H3ZA 4A3CJ 4LLLA 4PJJA 3TGNA 4A3JJ 2GIVA 1I1GA 3GTOJ 1U9NA 4RAYA 2VKEA 5DCMB 1K4TA 2R7ZJ 3VWBA 1PJRA 2EILH 2EK5A 1UHMA 3IRRA 4S0HB 1LKXA 5F0FA 2ESHA 1IDZA 2CUEA 3KP2A 3OWTA 2L01A 2OCCH 3AG2H 3K2AA 4DGWB 2CW7A 2A6HF 1QZZA 1O3TA 1T08B 5H6QA 1O3RA 4HV5A 4U0WA 2AXTC 5D5WB 2QLZA 1UFMA 3PIPF 4WF2A 3ECHA 4HNVA 4XIDA 3K10A 4ZDPA 5M5YJ 2JQ7A 4DZJA 2NRAC 1WCMJ 1K7AA 3DF8A 2DPDA 4IHTA 3MN2A 2LG4A 2WC2A 5FO5A 4EJVA 2YR2A 2LVSA 4U0YA 3LL7A 5ICGA 4I98B 2E1CA 3CCJI 2JT1A 1KONA 1R00A 4M71A 3ZQ7A 3GTKJ 1QO0D 4XBFA 2P8TA 1IN5A 4FCYA 1MMGA 1BR4A 4C3IJ 3SFZA 3BJ6A 4L5IA 4I01A 4P96A 5J8FA 2D1HA 3S3NA 2Z99A 4HX4A 3G71I 1LE8B 1XGMA 3HG9A 1MNDA 4XRSG 4XRSA 4D5CA 1DQUA 5FKMA 4D9JA 4MHGA 1VTNC 2KLOA 2MGQA 5J1UA 1GV5A 2EJRA 3WU1B 2HEOA 1JGSA 1ZELA 2VBWA 2Y0SN 3DTEA 1R4NB 3MAJA 5IYBJ 5DDGA 2PG4A 1CF7A 2XAUA 5B5EC 1BOBA 3ZXSA 3OYBA 1N25A 3DXJF 3CUOA 4XKVA 3IC7A 4ZZLA 2ZFWA 4R79A 3HL2A 5DD8A 3FBIB 1W1WE 4E7HA 3QU3A 2O61A 4EGZA 1QA6A 1SVOA 4CCJA 1GVJA 5F6FA 3DBHB 1MDMA 2DT5A 2FMLA 2YU9J 4IQJA 5JHFA 2CV2A 5HS9A 2JSCA 4EJWA 3DPLC 4M6VA 3TO7A 2PN6A 3GBGA 3Q5FA 2K9MA 3SZGA 3L1PA 2HKOA 3I4MJ 4B09A 3K4KA 5FGMA 3A01A 3S1NJ 3K70C 1D8JA 3ONQA 2P5LC 4YIRX 1BR2A 4P9UA 4AWXB 4WCGA 2KQRA 4XR6A 1J7KA 2PJPA 3VEPA 5LHIA 1OMIA 3BR3A 4CO8A 3HRSA 1BI3A 4O5VA 1B6AA 4B4CA 4Y7NJ 4RB1A 3DLLF 2HVSA 4N9IA 3JR9A 3O8GA 1F5TA 1ZGAA 3P9CA 5CQGA 5EGOA 4XNFA 3FXRA 1IGNA 3AL0C 5AIPA 1EJ9A 4I0BA 3OYEA 2UZKA 2JJ7A 3QRFF 1QVTA 3MVPA 2X48A 3CUQB 2VOOA 1RKWA 5DD4A 2K86A 4LB6B 1TWCJ 3MFKA 3GFJA 1SD4A 4HV6A 3HTSB 1QHGA 5HNFA 3HPHA 2F5CA 3JSPA 3OYLA 5DUKA 3BPXA 2E60A 1B59A 2DW4A 2IGOA 2UXXA 3BG9A 5F1JA 1FOKA 3H5AA 2L2OA 3RPUD 5IY5H 4F93B 2VBZA 3LQQA 2KRHA 5BPIA 4G6TB 4M73A 1KU2A 1RPWA 4OMYA 2L4MA 4G9YA 2JWTA 1E17A 2XAJA 3BTCA 4JQFA 4XLAA 2NVUB 5M3FJ 2HYFA 2HOSA 3FF5A 4ZYDA 1A36A 3H3VK 1BOAA 2AQFA 1HW1A 3K69A 3BPVA 4WWCA 2XC7A 3FBNB 1ZR4A 5L3BA 5GPCA 3ERED 3RYPA 4W1UA 4IHSA 2R7TA 2IBDA 3FXOA 3HEFA 5DM6F 3GEZA 5E1WA 3COAC 3KP4A 2M87A 2XGXA 4ZDLA 5D4RA 2ZMEB 4DIQA 2DK8A 5J6XA 1X3UA 4CCOA 3ECOA 1GT0C 3EPZA 2JUCA 1XCBA 2HFHA 2QSGX 2H6CA 2CFXA 3F8FA 3OIQA 3HRTA 2ME6A 3EYIA 3GXOA 1B4AA 3BDDA 2OJED 1MH4A 2HZDA 4L9NA 2XPUA 3KYCB 2XVCA 4A12A 1ULYA 4KDPA 1XDUA 3KP6A 3BQZA 3WTXC 3IAS2 4RB0A 2DTRA 4PJ0C 4JX6A 5E17F 5FLMJ 4XOTA 1R22A 2A5WA 1WKMA 3ZR8X 3S2DJ 3IKVA 2Y30A 5F1RA 1CQTA 1UZCA 3FHZA 2J5OA 3DTIA 5LGUA 2VQCA 2TDXA 4ENKA 1Y1WJ 3I5UA 1IF1A 2MD0A 3F22A 4HLYA 1ZG1A 4D0PA 4EM0B 4G7ZF 4MQVA 1D3YA 4M9XA 2HQRA 2XGEA 2V7FA 2RV8A 2I8DA 2ZKZA 3DBLB 4CYCA 5F64A 1KZHA 1HDDC 3MZ8A 2Y9ZA 1O57A 3NQOA 1HSTA 2V1UA 5L3CA 2IS6A 4NBQA 2CG4A 1G3SA 1T56A 1UCRA 2JSPA 3EYYA 5F08A 3MEXA 4Q4ZF 5BPDA 3BR5A 3TQNA 1JKQC 2NXNB 1B8IA 4MTDA 3DCFA 4M72A 3S1MJ 2XPVA 3JRBA 1I6XA 1MGTA 3F23A 1PP7U 3JRFA 2XAGA 3QODA 3AKZA 4I0AA 3PO2J 2ESNA 2XF5A 5HLIA 4KYWA 5JLWA 1K78B 2V9PA 3CQZJ 2HGCA 3E3VA 4PCQA 5ICCA 3HKZN 5FD5A 4XK4A 1LEAA 3N97A 1B9NA 4JYKA 1W5CC 1LDKB 4OWRB 4G6QA 2E36A 1J59A 2V1NA 3D5SC 4B47A 1SFEA 4XRMA 1BI1A 1YQAA 3HGGA 4XLPF 4BE1A 1Z9CA 1E2XA 2Y75A 1NG6A 3K9TA 1IRFA 1Y56A 2R92J 3R0JA 1ONVA 4RGUA 1MDMB 1BBYA 5HLGA 4MEXF 3ROUA 4IHXA 1OFCX 3S2HJ 1ETKA 2XROA 1IJWC 1W7PD 2UV1A 4YELA 1ITYA 2P0WA 1X2MA 5E3OA 2O8KA 3FHNA 1YRNA 2WAFA 1LJ9A 2W57A 3A01B 2O6GE 2XRNA 4PZJA 2HQNA 2STTA 1H9GA 3TMOA 2CV0A 3LAJA 2BW3B 3IP4B 1VQ8I 3RI4A 5FRMA 4BQQA 4E7SA 2A5YB 1GXQA 4XL9A 3RZDJ 1TT5B 4B3AA 5FLVA 3VFZA 3A0BC 4ENJA 3DTKA 3K6GA 3IL2A 4FE7A 1WPKA 4HEA2 1SVMA 1TT0A 2M5WA 4RAGA 3C2HA 5EGOB 4IJAA 1P7IA 1VQ7I 3F21A 4MGRA 1TNSA 3C7JA 4HOBA 3CDHA 3RDIA 3Q9SA 3MKLA 1JJ6C 2NVYJ 3OL3A 4MNUA 1QVUA 4IF4A 3NEUA 4BXXJ 5ICFA 3M07A 3AFHA 1SFUA 2WAQN 2DBBA 1USSA 2BEOA 3A4CA 4GGGA 3HXLA 2LF8A 3ZGKA 2V6CA 3JRHA 2BE5F 1X58A 4N4OB 2HOTA 4B8XA 2XAQA 2MYSA 5J1YA 3GTJJ 2DXIA 4L0YB 4V19K 3H35A 3WGIA 2CQNA 2XASA 3AG4H 3KIOA 4LD5A 3WODF 1R4MB 4HF2A 1EH6A 3BTJA 5C4JJ 4KMUX 5DS9A 1WSUA 9ANTA 3GFMA 1J5YA 2FXAA 3CDIA 1S29A 4G6DA 2R5YB 4PFOA 2VJIA 4DOZA 5JVTA 1AHDP 4KISA 3JRAA 1XC5A 3K4NA 2MC3A 1EH8A 4BJ5C 5LEKA 2E71A 3OYGA 3S14J 3R60A 1RZ4A 3HSRA 1ZGWA 2Q1ZB 5GAGJ 4S05A 4CHUA 2UWMA 1WGXA 5F0CA 2B9SA 1Y8RB 4M3DA 2R7VA 1O3SA 2F48A 5L3GA 2W00A 4FISA 5D8KB 2KRCA 3D1NI 2VI6A 3QWLA 4RLQA 3SXYA 3KLOA 2LKXA 1BI2A 2P5VA 4JOMA 1T33A 4GYGA 4Q47A 2Y9YA 3DV8A 1MNEA 2L54A 3KP5A 2MA3A 2VKVA 4NNJA 4FETA 1ZYRF 3WE2A 3ULQB 3QYFA 1UG2A 1RKTA 1KA8A 1E3PA 4XKWA 3B02A 4FE4A 2NVQJ 2W25A 4L18B 5KCMA 2IA2A 3K7AJ 1P92A 4OIRF 3GUDA 3M7GA 3B73A 1FOYA 2DPUA 2ZNYA 3SZPA 2ZNZA 1FBQA 1JT6A 1PYVA 5ERIA 3SJMA 2FA5A 3H5RA 1LDJA 3HIFA 5DEQA 2QQAA 2G7HA 4KT6A 4PJLA 4PSWA 1MJ9A 4CCNA 3K4MA 5EEHA 3E7LA 3LSMA 1OKRA 2R5ZB 3ZQLA 1F43A 3HOZJ 1FSEA 4Y4RA 3CCEI 3W2VA 4BQOA 1L3LA 2RC4A 1X19A 1S3JA 2ZSHB 1BI0A 4ZC3A 5K7ZA 4XRFA 4U88A 4CCMA 4HDUA 1W36D 1J0RA 1NG7A 3T5XA 2XDVA 1Y1VJ 2R7XA 2IPQX 2PX9A 3OYDA 1U6GA 5CPRB 3ZQIA 2MABA 2IAIA 2CWEA 3WTUC 1MNMC 3PQKA 4F55A 2EIKH 3BR1A 4OINF 1XPXA 1JHFA 4OAZA 2R7WA 3W6VA 1ZH5A 2HR3A 2IXSA 3EDPA 2P5KA 3B6AA 3E97A 3PM1A 3HOSA 5FKKA 4LLGF 1FYLA 4OU0A 3GTMJ 1E3HA 2OUMA 3E5QA 1SFKA 2XGCA 5FKOA 3OYJA 4Y33A 4YFNF 3F8NA 1WWXA 1TWHJ 1OCCH 1G4DA 2LKPA 4E7JA 3Q9VA 3WE3A 3ZMZA 1R36A 3BC8A 1ZHFA 4N9HA 2JA5J 4TV7A 2H09A 3M1EA 1FZPB 2MC4A 2MG4A 4E7IA 2EV0A 3MCZA 5FRNA 1UMQA 4BBSJ 5M5XJ 3EUAA 1HOMA 3ISPA 1K4SA 2MD5A 1RR8C 2L7ZA 4BBRJ 3C1DA 3QYEA 1K83J 2KDOA 3ERMA 3GLLA 3PFIA 1YRNB 2CO5A 2LBFA 2EQRA 1SMTA 2WAEA 2P6SA 2QKMB 4D7NA 1QHHD 2CUZA 4CCLA 2DT7B 1A04A 4EMSA 1IAWA 1G3TA 3P7NA 4N4NB 2VJ4A 3KCCA 3HHGA 1OCTC 2QCOA 3H92A 1FWZA 2JZYA 5LRRA 3H9GA 1F36A 2OZ6A 5FLXK 3BZCA 3GFLA 1IW7F 4B43A 4NC7A 1RC9A 3L09A 3BLYA 3I0TA 4L9TA 1BN5A 2P81A 5J4VA 3SHFA 5E8IA 2N8GA 1VQ9I 1OCOH 1XG1A 1WQ2A 3HJEA 1RI7A 4U7BA 4E70A 2WADA 1P9QC 3O6BB 2OQGA 1SFOJ 1MJAA 2TCTA 3F8MA 1U0JA 5D5XB 3SEQA 4II2A 1BW5A 4Q48A 2JUGA 4XLEA 3G73A 4EQQA 4L9VA 1D5YA 3HYIA 5F0HA 1YG2A 1HCRA 3J80Z 3BTIA 1ETQA 3L2CA 1YTYA 1VQNI 2IW5A 1YE9A 2F6CA 2YS9A 4B1RA 5EG0A 3GTGJ 2CU7A 3T0YA 4C3JJ 4YIFA 4D7MA 1DPRA 1LVKA 2E7XA 3JTHA 3BCAA 2KL4A 3LNQA 5GAEJ 2L9VA 1AKHA 4M74A 4F91B 2QKLB 1D1AA 2ZXIA 4WXDA 1Y8QB 2DN0A 1U8BA 2VPRA 3CZ6A 4AUXA 3E5UA 3G3ZA 2CRGA 2BY3A 1FNNA 2FX0A 3ZQGA 1QNTA 1XTAA 2QGUA 2AS5F 2KZVA 2JPCA 2IS4A 3GO5A 4HSRA 4RGXA 2DK5A 1V55H 3K70D 3RKWA 1TP4A 4IVNA 1AWCA 4IHYA 3I4NJ 2A61A 1K6YA 1XMAA 2DCEA 4CDGA 5H6RA 5HS8A 5JLXA 2H8WA 1KU9A 4A0ZA 1DP7P 2D2WA 4L5EA 3TW7A 5LD2C 2VONA 5J8CA 1OYYA 2KHMA 2QF7A 3LFKA 3J7YJ 1SD7A 5DCFA 1IV6A 2GIZA 3L2RA 3WTTC 3ASOH 4IL6C 4ESFA 2JA7J 2NOJB 3ZMTA 3SFIA 4HZFA 1VI0A 1QZYA 2E1MC 5LLQA 2FE3A 1ETWA 1ZK8A 1WZ2A 2FBHA 3KYDB 2CYYA 4UB6C 2B0LA 1R5GA 2ZJ2A 3TDUC 1B72A 1IRZA 3F3XA 3S1QJ 1YW7A 3FWEA 2VC1A 2R3SA 3G6EI 1IV8A 5GADJ 2KIUA 3FMSA 2E5ZA 1LVAA 2JA2A 1T6SA 1T8IA 2IS1A 2KFDA 4C9YA 2P7CB 2ZJRF 2EPFA 1Z77A 1U8RA 4S04A 3RKQA 3W6KB 2LYCA 2HDDA 2L7MP 4DJAA 3C18A 4RDUA 2H27A 3I56I 5KAIC 3HOTA 2VBYA 4FX0A 5FKNA 1KGSA 4AYBA 2OTLI 2DMNA 1USTA 3ZMUA 3I59A 3T1BA 1R1VA 1DGWY 1D0ZA 2VKHA 4HX7A 4OAYA 1RESA 2AXLA 4A93J 1BIAA 5BMZA 2R7OA 3K1MA 3GMEA 5KK1A 2O03A 3LMMA 3M8JA 4RM3A 1RUNA 1TW3A 4PDKA 5JI6A 1E0EA 5M3MJ 4C2UA 3WU2C 1XB4A 2JTVA 4CZZA 3S3MA 1FTZA 3OMYA 5CQEA 4XLFA 5B1BH 4LG0A 5E3MA 1N77A 3RIRA 1P2FA 4V2FA 4YIIA 3CLOA 3FIWA 1YJWI 1EA3A 4XKCA 2NS0A 2G0EA 4LGWA 3CCQI 2IRFG 4G8XA 3IH4A 2QENA 3CMYA 1ZN2A 1SEUA 2WB1A 2DTZA 1A6IA 1FIAA 3ZQHA 1Y0NA 1MSFC 2EFWA 1J09A 2HXOA 4ON0A 1X4OA 2TRTA 1TWAJ 2FU4A 1YX5A 2LSOA 2O7OA 3OL4A 1FBSA 3J81Z 3J7AY 3OS0A 4LJZF 2BHYA 2MBFA 3C2BA 3W3CA 2LBFB 2Y2ZA 4UVBA 2P7VB 1PP8F 3ELKA 1TQMA 2FUG2 2OF7A 4PK4A 2B63J 4A0XA 2W1OA 2K9LA 5CLSA 1SC7A 3W2WA 3RJPA 2COBA 2CQXA 2DFFA 3ZMDA 3TP0A 1JTXA 3BG7A 3F8CA 3I64A 3QP6A 1XGOA 1VQLI 4U7DA 4Q5SF 3CO6C 4Z2YA 2FBKA 3Q0WA 2FNAA 5HLHA 3G1LA 2Q8KA 2Z9OA 1W4MA 2STWA 1MMNA 2HQ5A 2R7SA 3CD6I 1S7OA 3A03A 1LNWA 4EV0A 1AOYA 2XAHA 3J7AO 5M5WJ 3IWFA 3JTGA 1ZAOA 3H1CA 1I3QJ 1EV7A 4ITVA 5L3FA 2CUJA 2DA5A 4HYEA 5IOZA 5IT9Z 3D5RC 4X6AJ 3M3YJ 3W2AA 5FFXA 3G2BA 2JA8J 1DU0A 3CP2A 5LGTA 3R61A 3QPTA 4A2UA 3BR0A 1Z21A 1AKHB 4RAZA 3LQRA 1UELB 2RNGA 4QIWN 3SEZA 1Z7LA 4JX5A 3BG3A 2FEZA 1WJAA 2B7EA 5D6FA 2JPBA 3RZOJ 2RN7A 3O3KA 2DA2A 4G7HF 2V4JC 2FBIA 1ZG5A 3DQVC 3EQLF 2HWVA 4GRIA 3AL0B 3LWFA 2V1DA 1KU3A 1GLNA 2KZGA 5KAFC 1Z0XA 3OIOA 4UV8A 3H5NA 2X1DA 2FOKA 1NTCA 2LY2A 1H0MA 2CQKA 2NNNA 3RKYA 4BJ6C 4IRGA 2DJNA 5TRDA 2HU9A 3PIOF 3L2QA 1ZRFA 5EF6A 1YHQI 3U1KA 3S17J 1I1SA 1Z6RA 2KJCA 1R5HA 2W48A 2FNPA 1RR7A 1SVLA 2JVHA 4CSWA 3SDGA 4HG2A 3N4MA 2VBXA 4YG2F 5DV5A 2EA4A 2W4SA 2DQRA 2M4GA 3HZJA 1GUUA 4ZH4F 1IRXA 4KT5C 3V7RA 4I02A 3HGYA 2L02A 3AAFA 1VQ4I 1LQ1A 2BVMA 1S8NA 1QZEA 4RMNA 3E5XA 2H94A 5ILUA 3F6OA 3WTVC 1RUOA 5E8GA 4RBOA 2DFEA 3WG9A 2A07F 2PMZA 1X1PA 3LSTA 2EFQA 2IT0A 3S16J 3ZRGA 4Y13A 2HNHA 2Z16A 5GAHJ 3B6CA 4HPQA 1MBEA 4LFUA 4LK0F 5FLXZ 4BYYA 2H6BA 1MD0A 2OQRA 2K02A 3OV8A 2QZ8A 3RQIA 1IUYA 2X85A 1JKRC 2XB5A 1ZGJA 1ACIA 3LA7A 1HA8A 1XX5A 1T38A 3OS1A 1XSVA 2GOMA 1WH5A 1IC8A 3K4LA 2RKHA 2QQ9A 3G1OA 1ZG3A 2HTJA 2RNJA 1DPUA 5FKLA 2LTPA 4KN7X 3I59B 5FB2A 5K5QA 2DFHA 5C3EJ 1LFUP 3A1YA 3CTAA 2Y48A 2HS5A 2CQQA 5HDNA 2GA2A 3BJAA 3M4OJ 3AG1H 1S6LA 1YFHA 1OCZH 3KP7A 4I7HA 4YRVA 4ZTFA 3IV5A 3GZ6A 2PMUA 1Z67A 2KIQA 3ABKH 2LF7A 3GTQJ 1ZR2A 1G59A 1CF7B 2GLOA 1PVEA 3QP5A 1XCVA 2L3DA 3BG6A 4HNUA 3MKYB 1W5SA 1HKTA 4E7LA 3MKWB 2HDCA 3DKXA 3A0HC 3K4BA 2FMYA 3V4GA 4BXFA 1DGRM 1HSJA 3H0DA 2QEXI 3S93A 2KPMA 2ZXJA 4ZJZA 2OTJI 1WI9A 2KT0A 1FIPA 2M3AA 2FD5A 2BBYA 4F52A 1N75A 1HW5A 1R23A 4XLCA 3CCYA 1W7PA 2GM4A 5LEJA 2W24A 1H8AC 3LA2A 3BR2A 3PNVA 4UXNA 3CP8A 4AD9A 4JX4A 1MW7A 3PUBA 1ORKA 5LHHA 2LY9A 4IEJA 3G1MA 5CVIA 3FM5A 2AO9A 3ZCOA 1ZKGA 4M3EA 3OYNA 1VQOI 3BZKA 3JSOA 4C30A 3HC7A 5DTDA 4CUGA 2GA1A 2ISZA 2OC6A 2ADUA 2RDPA 4BAYA 4D5FA 1T2KA 3DKWA 2K9SA 1MSEC 2E5NA 2K85A 2K4JA 3I54A 2LRDA 3CJQB 1OLTA 4AU7A 1LFBA 1MBGA 1IXRC 2HI3A 1WJDA 1PUFA 1NH3A 1ZREA 4M9SA 3HOUJ 3L9FA 5HODA 2C6YA 1T98A 3DWLE 4EJTA 2XSJC 3BROA 3OYHA 2E1OA 1JGGA 1EKEA 1YS6A 3SDBA 1A31A 5EEAA 2PLYA 1Q1VA 2L4AA 4A6EA 1I6HJ 1HLVA 2YUSA 4CA0A 4ABZA 3CJNA 1L0OC 1S7AA 1Y0UA 3H3UA 3VSLA 3J80K 1HKQA 1WJCA 4CCKA 1Q1HA 2IA0A 1Z1DA 1O3QA 5CVUA 3OOPA 5TISC 1V54H 4HRIA 1X1CA 2OCEA 2ZC2A 4ENNA 4MIMA 4U87A 2DA3A 4E7ZA 1B9MA 4M3FA 1WI3A 3K1PA 1H89C 3K4CA 1G6NA 1S9HA 4M9ZA 3I53A 4EJUA 1D5VA 1BC7C 2VXZA 4KICA 1PUEE 4G7OF 3VPRA 1O7LA 2EFNA 3GW2A 1JUMA 2I10A 5J3LA 1D0XA 4GDFA 2R4GA 2ZBKA 4UNOA 2HZTA 1XGSA 5IP7J 4Y15A 5TGTA 1DDNA 3K1NA 4BGDA 3DFGA 3HOVJ 4UV9A 4XORA 2K4BA 2R7QA 5K5RA 1I50J 2DJIA 2L7FP 1IN4A 1TLHB 4WXCA 2LREA 3LSRA 1VQKI 1S72I 4UVAA 3O2PE 2OAZA 3KLNA 2HTSA 1BW6A 3IKTA 3PO3J 2PI0A 1FMWA 1X2NA 4ESBA 2L7KA 2WY7Q 1YJ9I 3UKGA 4JBAA 4CXFA 3F9KA 3FKJA 2VT2A 5E3NA 3ASNH 2LFBA 1VQMI 4F92B 2H1KA 3MMYB 4A3FJ 4M3GA 4BNCA 1ZLKA 2XIGA 3H36A 2M0CA 3H9QA 6PAXA 2CS3A 2M7BA 1NK3P 2EIJH 2VIXA 1QQIA 2EFOA 3VDXA 4M6YA 3ZN1A 5HS7A 2BHZA 5E3LA 5J40A 4UUTA 3JRIA 5B66C 2XRLA 2DA1A 3MWMA 4LOCA 1Y39A 4O3MA 4ZYEA 1B1BA 2R0QC 1ON1A 1ETXA 1YO5C 1RNLA 2JMWA 3F0CA 3JCUC 4KNYA 3QYBA 2X0LA 1SD6A 4BY1J 2E19A 2JA6J 2BY0A 4CYCB 1ETVA 2ID6A 3TW6A 5JHUA 4ZDOA 3MQ0A 2G7UA 5HLTA 1BC8C 1G3YA 4BUPA 2YX4A 2AHQA 3Q0UA 3FISA 3HRUA 4L0ZB 1B8IB 3REOA 4IHVA 2LLKA 5K5OA 4P55A 5BQTA 3IAM2 3IWZA 1ON2A 2DMPA 2XKOA 1VF9A 1JKOC 2ECBA 3HTUA 5B1AH 1VQPI 2GWRA 2Y31A 2R7UA 4BS9A 3NAUA 5H2FC 3EUKL 1MJBA 2M4KA 4PJNA 3MKZA 3ABUA 4QSHA 3S15J 1YIJI 4N0BA 1YI2I 1NHAA 3JRGA 1R71A 4LIUA 1MZBA 2MH2A 5KVRA 2VKDA 3LOCA 2LKSA 4EVIA 3DU5A 3FMRA 4X0GA 5IOYA 3BG5A 3JRCA 1OQYA 4BH9A 2BY1A 4J01A 1QU3A 2UXNA 5C44J 1HXDA 1K61A 4RB2C 1ZQ3P 1LE8A 5EYRA 3J81K 1VQ5I 2CMPA 3FXJA 1LDDA 1KQ9A 3IRQA 3L00A 1XD7A 4NB5A 1OISA 4IO9F 2F4IA 1STZA 4PUSA 4Y3OA 1ZLJA 1A35A 1TWFJ 5CVJA 4G94A 3CCMI 1V5EA 2V9VA 3OYCA 1U78A 2ICWG 2VLAA 4MFEA 4IKFA 4A3BJ 4LITA 3PJRA 1BM9A 3WHBA 1V3FA 2V1XA 2FRHA 2L9RA 3GX4X 2IGMA 4A3IJ 4HF1A 3OYMA 3C3WA 3BJOA 5K7HA 2PQ8A 1TW2A 1JUPA 4U0VA 2VODA 2DDAA 5ILSA 1I39A 2DDBA 2VL8A 3FMQA 4BEHA 5KNLA 1PUFB 1QBJA 2Z3YA 5J47A 1BL0A 2XAFA 1SMYF 4DW6A 2QSFX 4P9FA 1FY7A 2VXDA 2M1BA 4IXAA 4DYRA 1W5TA 5D4SA 2EZIA 4PJMA 1U9OA 3CMMA 1X4PA 2DLLA 2VJ5A 2RGVA 2M0MA 5IT9K 2MH9A 2RREA 2DOAA 1A5JA 3Q3SA 1G2HA 3E6BA 1XSDA 4P1WA 2ZXHA 2M7AA 4OOIA 2A69F 3AG3H 3JAMZ 4EEFG 1R1TA 2E34A 4BHCA 1TC3C 2KKOA 3ESWB 2BOLA 4XMYA 2XGDA 2NVTJ 1FP1D 3V8KA 3H9JA 4FTHA 5A2QZ 1K79A 1V5GA 3I9V2 3SQNA 3ABLH 1BR1A 4DZPA 5FFZA 4M3BA 3CUQA 3IHUA 1MMDA 3O8HA 4AIHA 1HBXG 3F6VA 3C2GA 2VE9A 2BXZA 1SANA 2ECCA 3VSKA 3R6SA 3OR1C 4RGRA 4XQFA 2P4WA 1K6OA 4B44A 4KUMA 1HC8A 4X1EA 3SZTA 2R7DA 3FXQA 3U9GA 2W84A 3GF2A 2LNBA 3CMAI 2OPTA 2DOFA 3QAHA 4JP0A 2EH3A 5DYMA 5ILVA 1IO2A 3LSPA 3HOXJ 2FJ1A 3KP3A 4A3KJ 4ZYGA 3U21A 2HXIA 1YITI 4BQNA 1XSXA 5LFAA 2FF4A 4WK8F 3CDLA 1ETYA 4RB3C 2CFOA 3GWZA 3TKYA 4FT8A 4ETSA 3D5LA 5D5UB 2BYVE 2LK2A 2BVLA 1AU7A 5L3EA 2VQLA 3LSJA 2CUFA 3UNGC 2X6YA 2F2EA 3ZQQA 3PSIA 4MLOA 3KFWX 3FXLA 1YS7A 1S7EA 3PUFA 4I6ZA 2A68F 1H9TA 1ZRCA 3HOYJ 3QPSA 4HAMA 3ZQFA 2ZMEA 2KISA 2EINH 3CCUI 1MBKA 3L2WA 2PJRA 5TJJA 4LB5A 4AVZA 2M9HA 1BA5A 2Y0SA 2DMQA 3KEYA 2GBYA 4F7ZA 5EEGA 2WV0A 4L5JA 2OV7A 3HM5A 4NHJA 3WGHA 2F5DA 1XDSA 3V8JA 2HVQA 1JJ8C 4AIJA 2R7RA 5CVRA 3ZPLA 4GFBA 1HF0A 1ZTRA 1IXCA 2VUMJ 2E1MB 3I71A 4MTEA 3OYAA 2XF6A 3DPUA 5CJ9A 5LRSA 4CGZA 1SAUA 4BACA 3BOQA 1IN8A 3GVAA 2A05A 4ZZDA 3L7WA 3P9IA 2CW0F 5IYCJ 4GCVA 2K7LA 4A3GJ 4ZTJA 2HQAA 2BZTA 1MBHA 2QA4I 3E6CC 2HDWA 2DQLA 3HOWJ 2BGCA 2F5FA 1YLFA 2KIMA 4BE2A 2LOOA 2VC0A 5FROA 2ZB9A 2MW8A 4A0YA 1WJFA 3QPLA 4HNTA 4F3QA 3PSFA 1IDYA 2IP2A 1R6RA 3PFYA 2V79A 4RA2A 2LH9A 2ID3A 1K78A 2O0YA 1W0TA 1ETOA 2QBYA 5BOXA 5E18F 2Z33A 3V8LA 3LSGA 2ISYA 1EF4A 1R49A 1QRYA 3I4PA 1ZRDA 4W97A 5JFRA 2KDZA 3NWSA 4YEJA 2CW8A 3NARA 3RTRA 2KIFA 2HYJA 2ZO4A 4XKBA 3OS2A 1H88C 1IN7A 2CSOA 1IRGA 3MZHA 2GXAA 1U3EM 1DP3A 4C3HJ 1XS9A 1Z05A 2R93J 1WHUA 2K9NA 4LIVA 2XV4S 4AYBN 2EZLA 4MFDA 5L3DA 4BEHB 3KX2A 3JRDA 1TL8A 2NVXJ 2L0KA 4LG3A 2XF7A 2VB6A 2K40A 1HKSA 3BR6A 3CUQC 2GAUA 1RIOH 2HOEA 4CICA 1GVDA 5BS6A 4IOCF 4WX9A 1POGA 1IXSB 2BW3A 2M34A 2WY8Q 4BDZA 1DU6A 3W6JB 3KEOA 4FQGA 1W0UA 3VYSB 2OZUA 3PL8A 3WTZA 1FX7A 1F1ZA 5JR3A 2X6OA 4KIFA 4FHTA 3WHCA 3ZP5A 2NYXA 3OOUA 4QWQA 1JE8A 2YU3A 3CLQA 4AIKA 1D0YA 1FLIA 2I5UA 3PNYA 5EG0B 2MSYA 2VJJA 5CVVA 2WB1N 1OR7A 3VYTB 3M8EA 3RPUA 1IN6A 1MIJA 2EIMH 2QYOA 4XONA 4KIBA 3WTYC 1O4XA 3SYTA 1FTTA 3FDYA 3CCLI 1FJLA 3HHHA 2GQQA 4MO7A 2A3SA 2DOEA 3QQAA 1Z3XA 2EBIA 3S3OA 5D6EA 4GYIA 3CF2A 3EETA 3CMEI 1XMXA 4PFPA 4ESJA 1ERDA 3V7CA 4IOAF 4MQ9F 4UVCA 2JK3A 2MLGA 3TO6A 2DMTA 2ZMEC 2L9SA 3A02A 1S5LC 3I3LA 4YFKF 2W7NA 5HNHA 3HSEA 1FT9A 1D1CA 2IGKA 3BZ6A 5K7FA 4H0EA 3JW4A 3LAPA 3ZQCA 2VE8A 2R5YA 3TOBA 4NUBA 2OA4A 4EGYA 2Q0OA 4E6KG 3BQYA 4XSZF 1Y6IA 4HW0A 2J5PA 2PBIA 1U2WA 4A3LJ 1FBUA 2A6EF 2V6EA 2CJJA 4FASD 2IJLA 3P9KA 2HYGD 2E35A 2KJBA 2M30A 1B72B 3CCRI 2DYRH 2EV6A 2DYSH 2KP6A 3IH2A 2VOPA 2DU9A 2EFPA 4E4HA 2M45A 3HDDA 1I5ZA 2PJRB 2HPIA 5D5VB 3HKZA 3TO9A 4IHWA 1P4WA 2V9KA 3PQJA 4GO1A 2COMA 2EV5A 5GTIC 3BY6A 3L2VA 2Q2EA 3VYUB 1MBJA 4NQWA 5AONA 3VB2A 2IS2A 4Y17A 1QPIA 1GXPA 3I55I 2VASA 4EJOA 3CJRB 2CGPA 1YW8A 4OMZA 3WTWC 2O9LA 5GP9A 3OSGA 1MMAA 4HX8A 4IZZA 3TP3A 1TQIA 3RYRA 1JHHA 4NDLA 2M8EA 3HSFA 1BJZA 2H1LA 5IYDJ 3TBIA 3QU6A 5H20A 2CH0A 2R5ZA 4IRHA 3LA3A 3VYRB 4A5NA 4IX7A 1SAXA 1LB2A 3NRVA 4PSXA 5HDKA 3H0GJ 1UAAA 4KIGA 1ZARA 2R7FA 1R58A 2O3FA 2DA4A 2K3FA 4LG0B 3MD2A 4HBLA 3E6DA 5DM7F 2Z2SB 4BXUA 4ENMA 1P4XA 4XLHA 2K3PA 1FYKA 3GFIA 4DNCA 2VQGA 4ASNA 4A3DJ 2ZJPF 2EWNA 1X1AA 2PMZN 2QBYB 1YX3A 3M8FA 3RSNA 1T95A 4UHTA 2DAOA 3VOEA 2H8RA 2WAQA 3MZYA 4NC8A 3S8PA 5FD6A 1MKMA 3LSKA 2LD5A 1WJ5A 1MH3A 4BY7J 2M2EA 1QGPA 2VT3A 5D8LB 1OYIA 2LY1A 4HLXA 3CC4I 3HUGA 2XB0X 4MEYF 2GXBA 4HDVA 2GXGA 3EUHA 4DBRA 1G8XA 1OR7C 4P5OA 2UUZA 1F4KA 4CH7A 2X6XA 5ICEA 3CO7C 1UJ8A 3WU0A 4R1HA 1J9IA 2ZCWA 5AIQA 3GYHX 4O6JA 2ME0A 1O7FA 3OY9A 2FSWA 2MLKA 5GTHC 2ELHA 3WG7H 2O5RA 2QQ8A 1D1BA 1X1DA 3WGGA 4IPAA 2K27A 1WVRA 4UY8I 3JAMK 1R9TJ 3KZZA 3TL4X 3UR3C 3X2QH 1X3WB 4I76A 1FOWA 2V26A 2RAEA 3F8BA 5CYVA 3S32A 5HVQC 3J7ZI 4XLNF 3M1CA 4FX4A 4BKXA 4XN3A 3ZN0A 4E7KA 5A2QK 4BQAA 2E2JJ 3LSIA 2HPMA 4UB8C 1OCRH 3NWTA 3G4SI 2F5EA 3V7SA 3KPHA 4AM3A 2EB7A 1GHCA 3DBRB 4V2GA 2CV1A 4I09A 2X4HA 4QLCU 1UHWA 1T0FA 2FQ3A 4OIPF 4A3MJ 5CKTA 5LHGA 4BL0B 2K5CA 3FX3A 1RRJA 2YPRA 3DEEA 5EZGA 5J4YA 3KETA 2GOXB 1QPMA 3D0SA 2MFZA 5JVGF 3LSHA 1FEXA 2IGNA 1WJEA 4D1QA 1R5ID 2LMDA 5LBQA 5KHDA 2BV6A 2VN2A 4QTRA 1REPC 3S2WA 1Z6TA 3FXKA 4XM3A 4I99C 2ELKA 1IUFA 3E1SA 3CCVI 3DPTA 1EH7A 3KEQA 3QOPA 2DMUA 3HB9A 3I58A 1JTYA 4XSXF 3DEWA 4UUSA 3VODA 3FK6A 2ZJQF 3K2ZA 2XUBA 1HDPA 1WJBA 1VFCA 1V5FA 2Z1DA 4GXOA 4PGHA 1APLC 2VPLA 3F72A 4B48A 4JK1X 5IT3A 5EJCA 1KQ8A 2PEXA 1YJNI 1PDNC 1UB9A 3BTLA 3ML6A 1N78A 2CQ7A 4LLNA 1U5TA 1LFPA 4RAFA 3RCOA 1BIBA 1IZ1A 2JRTA 4C2MJ 3R0AA 1I27A 2ETHA 4XOPA 1TNTA 2F4MB 5J1RA 3OIPA 1P4AA 4IRIA 2JN6A 1JXSA 3WTSC 1FC3A 4LK1F 4KFCA 3ZMSA 5E1XA 3V42A 5E1ZB 4XN0A 2XSDC 3LFUA 2VQHA 3ABMH 3FM3A 2Q2EB 4NC6A 5IP6A 4HQMA 3E6MA 2QUFA 4A69C 4EM2A 3E0JB 4NQWB 2X1CA 2XHKA 2DO7A 5DCMA 4RS8A 3GTLJ 1J2XA 2JVGA 5C4XJ 4ZYHA 2O8XA 2BXYA 3FK7A 2D45A 1Z91A 4Y52J 2HOAA 2A6TA 2JRMA 1MMSA 4PGGA 3U2RA 1KYWA 2NS8A 4AVPA 3GCMA 2RQQA 5F27A 1LPQA 3IH3A 3RQ4A 1I3AA 2IEKA 1KU7A 3KZIC 4QPOA 4KJZA 4DYCA 3DP7A 2X9DA 4ZYAA 4HF0A 4G12A 1G3WA 1UHSA 3M9AA 1GDTA 5DUIA 1V4RA 3S1RJ 4HQEA 5LGNA 3OYFA 1DUXC 2OU2A 1HW2A 1AA7A 5ED4A 1OPCA 3CC7I 2YSRA 1JUSA 1OYWA 5F04A 3EUHC 4DQ2A 4RGSA 3BCBA 3P5JA 3HRMA 3IUOA 1A6QA 1FPQA 4C2TA 2DODA 2NAZA 4KN4X 4AIDA 5IPAA 1YW9A 2LR8A 2FQ4A 3DEUA 4WXHA 2E2HJ 4HA8A 2DA7A 1TWGJ 2F5VA 3TDZC 3A2KA 1TTYA 1FMVA 2K9QA 2M8GX 2QSHX 1W7PB 4IQ4A 5BNGA 5FJ8J 4QPQA 3FXMA 3T8RA 2YX7A 4K2EA 2E7WA 1KYZA 1VNDA 2WV1A 2XKPA 4AC0A 1JI8A 4OIOF 3R4KA 3L2UA 1FSHA 3HUGB 3ZMVA 2QWWA 3GTPJ 2KRFA 3KE2A 1XMKA 4CZCA 2HKXA 3K4JA 1C0WA 2X51A 1ODDA
chains in the Genus database with same CATH topology
4A3GJ 3FKIJ 1GUUA 3ZOBA 3JRHA 1X58A 2HOTA 3HGYA 5J1YA 1MBHA 3GTJJ 3Q0VA 5IP9J 3HOWJ 4RBOA 4XICA 3JREA 3BTJA 5C4JJ 5DS9A 2E2IJ 9ANTA 1ENHA 5EZHA 3TEDA 2ZB9A 3S16J 2MW8A 2R5YB 1AHDP 3QPLA 3JRAA 1GV2A 2XPWA 1XC5A 3B6CA 1MBEA 1RETA 1IDYA 2NOGA 3RQIA 2ID3A 1JKRC 1W0TA 2XB5A 1OCPA 1ETOA 1ZGWA 3S14J 1JKPC 1WGXA 5F0CA 3LSGA 1OJLA 1EF4A 1QRYA 4M3DA 1WH5A 2EZKA 1IC8A 4FISA 3D1NI 1E3OC 2VI6A 1P7JA 3G1OA 4W97A 2LKXA 2KDZA 1T33A 2Y9YA 3NARA 5FKLA 2LTPA 1LFUP 2HYJA 5C3EJ 1H88C 2VKVA 1IG7A 4C3HJ 1XS9A 1UG2A 2CQQA 1RKTA 3M4OJ 2R93J 4FE4A 2K9NA 1NK2P 2NVQJ 4AYBN 2EZLA 4MFDA 2NVXJ 3JRDA 2L0KA 3K7AJ 1WH7A 2K40A 3IV5A 3BR6A 4J19A 3OSFA 3GTQJ 1ZR2A 2D5VA 2GLOA 1MBFA 2LP0A 1JT6A 4UUSB 3SJMA 1GVDA 1POGA 2M34A 1DU6A 1W0UA 3E7LA 2KT0A 2R5ZB 3ZQLA 1FIPA 2NS7A 2FD5A 2X6OA 3HBLA 3WHCA 3HOZJ 2EZHA 1F43A 5EDNA 3CCYA 2GM4A 3OOUA 1H8AC 3BR2A 5K7ZA 4JX4A 5EG0B 2DA6A 1ORKA 2MSYA 5GPAA 2LY9A 4IEJA 3BT9A 2WB1N 3G1MA 4A3EJ 1Y1VJ 2AO9A 1ZKGA 4M3EA 1O4XA 1JT0A 3ZQIA 1FTTA 2IAIA 5DTDA 4DYQA 1FJLA 1MNMC 4MO7A 4D5FA 4A3CJ 3BR1A 3QQAA 2EBIA 2K9SA 4A3JJ 1MSEC 3GTOJ 3W6VA 1U9NA 2JK3A 2VKEA 2R7ZJ 1LFBA 1MBGA 3B6AA 2HI3A 2DMTA 3A02A 3PM1A 1PUFA 4S0HB 5F0FA 5FKKA 3HOUJ 1IDZA 5HODA 2CUEA 3GTMJ 2XGCA 3K2AA 5FKOA 2E1OA 5K7FA 1JGGA 1TWHJ 5EEAA 1Q1VA 3ZQCA 2R5YA 1I6HJ 1HLVA 2YUSA 4ABZA 3BQYA 4HNVA 4XIDA 2JA5J 5M5YJ 4A3LJ 2MG4A 4DZJA 1UMQA 1WCMJ 4BBSJ 2CJJA 5M5XJ 1HOMA 4MIMA 3MN2A 2DA3A 2L7ZA 4BBRJ 4M3FA 1WI3A 1K83J 1B72B 1H89C 2LVSA 1YRNB 3IH2A 2EQRA 3HDDA 4D7NA 3GTKJ 3VPRA 4IHWA 1JUMA 4FCYA 2I10A 5J3LA 4C3IJ 1OCTC 5IP7J 2QCOA 1LE8B 4XRSG 1MBJA 4XRSA 1F36A 3HOVJ 4D5CA 5FKMA 1QPIA 1I50J 2L7FP 2MGQA 5J1UA 1GV5A 3LSRA 2P81A 2Y0SN 5IYBJ 2O9LA 5GP9A 2N8GA 3OSGA 1BW6A 3PO3J 1XG1A 3TP3A 1X2NA 4NDLA 3UKGA 1BJZA 5E3NA 1SFOJ 5IYDJ 2LFBA 2TCTA 2H1KA 4A3FJ 4M3GA 2R5ZA 1BW5A 2M0CA 1NK3P 1D5YA 3H0GJ 5F0HA 1HCRA 3BTIA 2YU9J 1ETQA 2YS9A 4B1RA 5EG0A 3GTGJ 2CU7A 4C3JJ 4D7MA 3LNQA 5E3LA 1AKHA 4M6VA 3GBGA 2DA4A 4UUTA 3L1PA 3JRIA 3I4MJ 2XRLA 2DA1A 4LOCA 3A01A 2R0QC 3S1NJ 2DN0A 1U8BA 2VPRA 1ETXA 4AUXA 3F0CA 2JMWA 2CRGA 4A3DJ 2FX0A 3ZQGA 2PMZN 4BY1J 2E19A 2JA6J 3BR3A 4CYCB 1ETVA 2ID6A 3TW6A 4B4CA 4Y7NJ 2H8RA 4IHYA 3I4NJ 3JR9A 3O8GA 2AHQA 5EGOA 2LD5A 5JLXA 3Q0UA 1MH3A 1IGNA 3FISA 4L5EA 4BY7J 3TW7A 2M2EA 1B8IB 2QF7A 4IHVA 2LLKA 2JJ7A 1IV6A 1QVTA 3MVPA 2DMPA 1JKOC 1VF9A 2XB0X 2X48A 2ECBA 1RKWA 1TWCJ 2JA7J 2Y31A 3SFIA 1VI0A 3NAUA 1ETWA 1ZK8A 4QSHA 3S15J 3JRGA 1B72A 2ME0A 1IRZA 3BG9A 5F1JA 3S1QJ 3LOCA 5IOYA 3BG5A 3JRCA 1R9TJ 4I76A 1RPWA 5C44J 2JWTA 2RAEA 1K61A 3BTCA 1ZQ3P 5M3FJ 1LE8A 5EYRA 2HOSA 1Z77A 3H3VK 4BKXA 3RKQA 2E2JJ 2HDDA 2L7MP 4RDUA 1ZR4A 5GPCA 4W1UA 4V2GA 1TWFJ 2IBDA 5FKNA 3HEFA 1U78A 2DMNA 4MFEA 4A3BJ 4A3MJ 1GT0C 3WHBA 2L9RA 2ME6A 4A93J 1RESA 5EZGA 4A3IJ 1MH4A 5K7HA 2XPUA 1FEXA 1JUPA 3BQZA 1PUFB 4JX6A 5M3MJ 4QTRA 5FLMJ 1BL0A 2ELKA 4DW6A 3S2DJ 1IUFA 2Y30A 1FTZA 2DMUA 1CQTA 4DYRA 3HB9A 5E3MA 2EZIA 1U9OA 1JTYA 4V2FA 3DEWA 4UUSA 3FIWA 3FK6A 1Y1WJ 1A5JA 2G0EA 3Q3SA 1G2HA 3IH4A 1HDPA 3CMYA 1VFCA 2DTZA 1A6IA 1FIAA 3ZQHA 1APLC 1MSFC 2XGEA 4CYCA 2HXOA 4EEFG 1HDDC 2TRTA 2Y9ZA 1TWAJ 1TC3C 3BTLA 2O7OA 4C2MJ 1T56A 2XGDA 5F08A 2NVTJ 3C2BA 3BR5A 4FTHA 2Y2ZA 1JKQC 1B8IA 5J1RA 3DCFA 3S1MJ 2OF7A 2XPVA 3JRBA 2JN6A 4DZPA 2B63J 4M3BA 3O8HA 3JRFA 2XSDC 1SANA 2ECCA 3PO2J 2COBA 2CQXA 3TP0A 1JTXA 5IP6A 4A69C 5JLWA 4X1EA 3CQZJ 3GTLJ 3HKZN 2OPTA 5C4XJ 3FK7A 3Q0WA 4XK4A 4Y52J 2HOAA 3G1LA 4JP0A 4JYKA 2EH3A 3LSPA 2NS8A 2HQ5A 3HOXJ 2FJ1A 3A03A 4A3KJ 2HXIA 4XRMA 5F27A 5M5WJ 3HGGA 3CDLA 3IH3A 1ETYA 1I3QJ 2IEKA 2DA5A 4DYCA 2R92J 5IOZA 2LK2A 2X9DA 4X6AJ 1AU7A 3M3YJ 4G12A 2JA8J 4IHXA 1UHSA 1DU0A 1OFCX 1GDTA 3S2HJ 3LSJA 1ETKA 1IJWC 3S1RJ 1ITYA 2CUFA 3BR0A 1AKHB 4MLOA 1X2MA 5E3OA 2O8KA 1S7EA 4I6ZA 4QIWN 1YRNA 3HOYJ 1JUSA 5F04A 3QPSA 4JX5A 3BG3A 3A01B 3ZQFA 3RZOJ 1MBKA 2DA2A 2M9HA 5IPAA 1BA5A 2DMQA 2GBYA 2LR8A 2FQ4A 3HM5A 2E2HJ 2DA7A 1TWGJ 1JJ8C 3RZDJ 4B3AA 5FLVA 1Z0XA 2K9QA 2M8GX 3OIOA 5FJ8J 5BNGA 4GFBA 1HF0A 1NTCA 1WPKA 4FE7A 1ZTRA 2DJNA 5EGOB 1P7IA 1VNDA 2WV1A 2VUMJ 1JJ6C 3MKLA 4AC0A 2NVYJ 5EF6A 1QVUA 3S17J 3GTPJ 4BXXJ 2W48A 1RR7A 3SDGA 2WAQN 5IYCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G J;  3FKI J;  1GUU A;  3ZOB A;  3JRH A;  1X58 A;  2HOT A;  3HGY A;  5J1Y A;  1MBH A;  3GTJ J;  3Q0V A;  5IP9 J;  3HOW J;  4RBO A;  4XIC A;  3JRE A;  3BTJ A;  5C4J J;  5DS9 A;  2E2I J;  9ANT A;  1ENH A;  5EZH A;  3TED A;  2ZB9 A;  3S16 J;  2MW8 A;  2R5Y B;  1AHD P;  3QPL A;  3JRA A;  1GV2 A;  2XPW A;  1XC5 A;  3B6C A;  1MBE A;  1RET A;  1IDY A;  2NOG A;  3RQI A;  2ID3 A;  1JKR C;  1W0T A;  2XB5 A;  1OCP A;  1ETO A;  1ZGW A;  3S14 J;  1JKP C;  1WGX A;  5F0C A;  3LSG A;  1OJL A;  1EF4 A;  1QRY A;  4M3D A;  1WH5 A;  2EZK A;  1IC8 A;  4FIS A;  3D1N I;  1E3O C;  2VI6 A;  1P7J A;  3G1O A;  4W97 A;  2LKX A;  2KDZ A;  1T33 A;  2Y9Y A;  3NAR A;  5FKL A;  2LTP A;  1LFU P;  2HYJ A;  5C3E J;  1H88 C;  2VKV A;  1IG7 A;  4C3H J;  1XS9 A;  1UG2 A;  2CQQ A;  1RKT A;  3M4O J;  2R93 J;  4FE4 A;  2K9N A;  1NK2 P;  2NVQ J;  4AYB N;  2EZL A;  4MFD A;  2NVX J;  3JRD A;  2L0K A;  3K7A J;  1WH7 A;  2K40 A;  3IV5 A;  3BR6 A;  4J19 A;  3OSF A;  3GTQ J;  1ZR2 A;  2D5V A;  2GLO A;  1MBF A;  2LP0 A;  1JT6 A;  4UUS B;  3SJM A;  1GVD A;  1POG A;  2M34 A;  1DU6 A;  1W0U A;  3E7L A;  2KT0 A;  2R5Z B;  3ZQL A;  1FIP A;  2NS7 A;  2FD5 A;  2X6O A;  3HBL A;  3WHC A;  3HOZ J;  2EZH A;  1F43 A;  5EDN A;  3CCY A;  2GM4 A;  3OOU A;  1H8A C;  3BR2 A;  5K7Z A;  4JX4 A;  5EG0 B;  2DA6 A;  1ORK A;  2MSY A;  5GPA A;  2LY9 A;  4IEJ A;  3BT9 A;  2WB1 N;  3G1M A;  4A3E J;  1Y1V J;  2AO9 A;  1ZKG A;  4M3E A;  1O4X A;  1JT0 A;  3ZQI A;  1FTT A;  2IAI A;  5DTD A;  4DYQ A;  1FJL A;  1MNM C;  4MO7 A;  4D5F A;  4A3C J;  3BR1 A;  3QQA A;  2EBI A;  2K9S A;  4A3J J;  1MSE C;  3GTO J;  3W6V A;  1U9N A;  2JK3 A;  2VKE A;  2R7Z J;  1LFB A;  1MBG A;  3B6A A;  2HI3 A;  2DMT A;  3A02 A;  3PM1 A;  1PUF A;  4S0H B;  5F0F A;  5FKK A;  3HOU J;  1IDZ A;  5HOD A;  2CUE A;  3GTM J;  2XGC A;  3K2A A;  5FKO A;  2E1O A;  5K7F A;  1JGG A;  1TWH J;  5EEA A;  1Q1V A;  3ZQC A;  2R5Y A;  1I6H J;  1HLV A;  2YUS A;  4ABZ A;  3BQY A;  4HNV A;  4XID A;  2JA5 J;  5M5Y J;  4A3L J;  2MG4 A;  4DZJ A;  1UMQ A;  1WCM J;  4BBS J;  2CJJ A;  5M5X J;  1HOM A;  4MIM A;  3MN2 A;  2DA3 A;  2L7Z A;  4BBR J;  4M3F A;  1WI3 A;  1K83 J;  1B72 B;  1H89 C;  2LVS A;  1YRN B;  3IH2 A;  2EQR A;  3HDD A;  4D7N A;  3GTK J;  3VPR A;  4IHW A;  1JUM A;  4FCY A;  2I10 A;  5J3L A;  4C3I J;  1OCT C;  5IP7 J;  2QCO A;  1LE8 B;  4XRS G;  1MBJ A;  4XRS A;  1F36 A;  3HOV J;  4D5C A;  5FKM A;  1QPI A;  1I50 J;  2L7F P;  2MGQ A;  5J1U A;  1GV5 A;  3LSR A;  2P81 A;  2Y0S N;  5IYB J;  2O9L A;  5GP9 A;  2N8G A;  3OSG A;  1BW6 A;  3PO3 J;  1XG1 A;  3TP3 A;  1X2N A;  4NDL A;  3UKG A;  1BJZ A;  5E3N A;  1SFO J;  5IYD J;  2LFB A;  2TCT A;  2H1K A;  4A3F J;  4M3G A;  2R5Z A;  1BW5 A;  2M0C A;  1NK3 P;  1D5Y A;  3H0G J;  5F0H A;  1HCR A;  3BTI A;  2YU9 J;  1ETQ A;  2YS9 A;  4B1R A;  5EG0 A;  3GTG J;  2CU7 A;  4C3J J;  4D7M A;  3LNQ A;  5E3L A;  1AKH A;  4M6V A;  3GBG A;  2DA4 A;  4UUT A;  3L1P A;  3JRI A;  3I4M J;  2XRL A;  2DA1 A;  4LOC A;  3A01 A;  2R0Q C;  3S1N J;  2DN0 A;  1U8B A;  2VPR A;  1ETX A;  4AUX A;  3F0C A;  2JMW A;  2CRG A;  4A3D J;  2FX0 A;  3ZQG A;  2PMZ N;  4BY1 J;  2E19 A;  2JA6 J;  3BR3 A;  4CYC B;  1ETV A;  2ID6 A;  3TW6 A;  4B4C A;  4Y7N J;  2H8R A;  4IHY A;  3I4N J;  3JR9 A;  3O8G A;  2AHQ A;  5EGO A;  2LD5 A;  5JLX A;  3Q0U A;  1MH3 A;  1IGN A;  3FIS A;  4L5E A;  4BY7 J;  3TW7 A;  2M2E A;  1B8I B;  2QF7 A;  4IHV A;  2LLK A;  2JJ7 A;  1IV6 A;  1QVT A;  3MVP A;  2DMP A;  1JKO C;  1VF9 A;  2XB0 X;  2X48 A;  2ECB A;  1RKW A;  1TWC J;  2JA7 J;  2Y31 A;  3SFI A;  1VI0 A;  3NAU A;  1ETW A;  1ZK8 A;  4QSH A;  3S15 J;  3JRG A;  1B72 A;  2ME0 A;  1IRZ A;  3BG9 A;  5F1J A;  3S1Q J;  3LOC A;  5IOY A;  3BG5 A;  3JRC A;  1R9T J;  4I76 A;  1RPW A;  5C44 J;  2JWT A;  2RAE A;  1K61 A;  3BTC A;  1ZQ3 P;  5M3F J;  1LE8 A;  5EYR A;  2HOS A;  1Z77 A;  3H3V K;  4BKX A;  3RKQ A;  2E2J J;  2HDD A;  2L7M P;  4RDU A;  1ZR4 A;  5GPC A;  4W1U A;  4V2G A;  1TWF J;  2IBD A;  5FKN A;  3HEF A;  1U78 A;  2DMN A;  4MFE A;  4A3B J;  4A3M J;  1GT0 C;  3WHB A;  2L9R A;  2ME6 A;  4A93 J;  1RES A;  5EZG A;  4A3I J;  1MH4 A;  5K7H A;  2XPU A;  1FEX A;  1JUP A;  3BQZ A;  1PUF B;  4JX6 A;  5M3M J;  4QTR A;  5FLM J;  1BL0 A;  2ELK A;  4DW6 A;  3S2D J;  1IUF A;  2Y30 A;  1FTZ A;  2DMU A;  1CQT A;  4DYR A;  3HB9 A;  5E3M A;  2EZI A;  1U9O A;  1JTY A;  4V2F A;  3DEW A;  4UUS A;  3FIW A;  3FK6 A;  1Y1W J;  1A5J A;  2G0E A;  3Q3S A;  1G2H A;  3IH4 A;  1HDP A;  3CMY A;  1VFC A;  2DTZ A;  1A6I A;  1FIA A;  3ZQH A;  1APL C;  1MSF C;  2XGE A;  4CYC A;  2HXO A;  4EEF G;  1HDD C;  2TRT A;  2Y9Z A;  1TWA J;  1TC3 C;  3BTL A;  2O7O A;  4C2M J;  1T56 A;  2XGD A;  5F08 A;  2NVT J;  3C2B A;  3BR5 A;  4FTH A;  2Y2Z A;  1JKQ C;  1B8I A;  5J1R A;  3DCF A;  3S1M J;  2OF7 A;  2XPV A;  3JRB A;  2JN6 A;  4DZP A;  2B63 J;  4M3B A;  3O8H A;  3JRF A;  2XSD C;  1SAN A;  2ECC A;  3PO2 J;  2COB A;  2CQX A;  3TP0 A;  1JTX A;  5IP6 A;  4A69 C;  5JLW A;  4X1E A;  3CQZ J;  3GTL J;  3HKZ N;  2OPT A;  5C4X J;  3FK7 A;  3Q0W A;  4XK4 A;  4Y52 J;  2HOA A;  3G1L A;  4JP0 A;  4JYK A;  2EH3 A;  3LSP A;  2NS8 A;  2HQ5 A;  3HOX J;  2FJ1 A;  3A03 A;  4A3K J;  2HXI A;  4XRM A;  5F27 A;  5M5W J;  3HGG A;  3CDL A;  3IH3 A;  1ETY A;  1I3Q J;  2IEK A;  2DA5 A;  4DYC A;  2R92 J;  5IOZ A;  2LK2 A;  2X9D A;  4X6A J;  1AU7 A;  3M3Y J;  4G12 A;  2JA8 J;  4IHX A;  1UHS A;  1DU0 A;  1OFC X;  1GDT A;  3S2H J;  3LSJ A;  1ETK A;  1IJW C;  3S1R J;  1ITY A;  2CUF A;  3BR0 A;  1AKH B;  4MLO A;  1X2M A;  5E3O A;  2O8K A;  1S7E A;  4I6Z A;  4QIW N;  1YRN A;  3HOY J;  1JUS A;  5F04 A;  3QPS A;  4JX5 A;  3BG3 A;  3A01 B;  3ZQF A;  3RZO J;  1MBK A;  2DA2 A;  2M9H A;  5IPA A;  1BA5 A;  2DMQ A;  2GBY A;  2LR8 A;  2FQ4 A;  3HM5 A;  2E2H J;  2DA7 A;  1TWG J;  1JJ8 C;  3RZD J;  4B3A A;  5FLV A;  1Z0X A;  2K9Q A;  2M8G X;  3OIO A;  5FJ8 J;  5BNG A;  4GFB A;  1HF0 A;  1NTC A;  1WPK A;  4FE7 A;  1ZTR A;  2DJN A;  5EGO B;  1P7I A;  1VND A;  2WV1 A;  2VUM J;  1JJ6 C;  3MKL A;  4AC0 A;  2NVY J;  5EF6 A;  1QVU A;  3S17 J;  3GTP J;  4BXX J;  2W48 A;  1RR7 A;  3SDG A;  2WAQ N;  5IYC J; 
#chains in the Genus database with same CATH topology
 1LUJ B;  3DU6 A;  2RQP A;  3FKI J;  3ZOB A;  4DBQ A;  2L5Q A;  2GZW A;  1T0F C;  3CF5 F;  4BU2 A;  2ZXW H;  2LC2 A;  3Q0V A;  1M1E B;  4KMF A;  2W85 A;  4R8H A;  5IP9 J;  5K1Y A;  1Z7U A;  3N05 A;  2RVC A;  2WTE A;  4BJT A;  3HPG A;  2P6T A;  1SFX A;  4XIC A;  3JRE A;  1WFX A;  2QM3 A;  1UG0 A;  3OR2 C;  2Y0M A;  2E2I J;  4CYD A;  2DI3 A;  1ENH A;  5EZH A;  2IA1 A;  3TED A;  1LEB A;  3K0L A;  3KZY A;  2ACJ A;  3RPQ A;  4A6D A;  3CCS I;  2EA2 A;  1GV2 A;  2XPW A;  3BP8 A;  1RET A;  1X3Z B;  4YFX F;  2QVO A;  2HVR A;  2NOG A;  3OYK A;  4BDY A;  1OCP A;  2G9W A;  1FP2 A;  4EAT A;  3CC2 I;  2Z5U A;  1JKP C;  1WRJ A;  4RM2 A;  3CJT B;  4Z6Y A;  1OJL A;  1FOX A;  2EZK A;  2WWY A;  2ELJ A;  1E3O C;  1BJA A;  3U1D A;  2AQE A;  1P7J A;  2BY2 A;  2X1E A;  1XGN A;  4J00 A;  1D8K A;  4RLF A;  3PNT A;  3QOE A;  1IG7 A;  1SD5 A;  2OBP A;  4BHB A;  1F9N A;  2PFB A;  4ANJ A;  4II3 A;  2KMU A;  1U5T C;  1R1U A;  1R7J A;  2L9N A;  2DT6 A;  1NK2 P;  3DKY A;  2D1V A;  1KQ0 A;  1VZ0 A;  3CES A;  5HOO A;  1WH7 A;  3GLX A;  2DFI A;  1T39 A;  2WA0 A;  1HQC A;  1TZL A;  1Z3Y A;  5HDG A;  1J75 A;  2ZFU A;  2OD5 A;  3GZ5 A;  4OIQ F;  2NNY A;  4J19 A;  3OSF A;  1YIO A;  2FOW A;  4KA4 A;  2D5V A;  1MBF A;  5E79 C;  4EM1 A;  2QQB A;  3ABT A;  2LP0 A;  4UUS B;  4I2O A;  2ZSI B;  2WBM A;  3KYL A;  1FYM A;  1VQ6 I;  1YOV B;  3BWG A;  3FZV A;  2F4O B;  2X6W A;  1TBX A;  3DLA A;  4L9J A;  4BHP A;  4KIT B;  4H4K C;  3QPH A;  1P6R A;  1W36 C;  1TQP A;  3GZN B;  2NS7 A;  3HBL A;  4A5M A;  2EZH A;  4UUV A;  5EDN A;  3T8T A;  4LMY A;  2PMH A;  1U5T B;  2W82 A;  2Y69 H;  2DA6 A;  5GPA A;  4HST A;  3TOA A;  1XN7 A;  2LDU A;  3BT9 A;  4B3X A;  5B3S H;  1CGP A;  1YYV A;  4A3E J;  2E1N A;  3FXU A;  3OYI A;  4BE0 A;  5E20 A;  4M6X A;  1JT0 A;  1X1B A;  4DYQ A;  2IVM A;  3RKX A;  3H3Z A;  4A3C J;  4LLL A;  4PJJ A;  3TGN A;  4A3J J;  2GIV A;  1I1G A;  3GTO J;  1U9N A;  4RAY A;  2VKE A;  5DCM B;  1K4T A;  2R7Z J;  3VWB A;  1PJR A;  2EIL H;  2EK5 A;  1UHM A;  3IRR A;  4S0H B;  1LKX A;  5F0F A;  2ESH A;  1IDZ A;  2CUE A;  3KP2 A;  3OWT A;  2L01 A;  2OCC H;  3AG2 H;  3K2A A;  4DGW B;  2CW7 A;  2A6H F;  1QZZ A;  1O3T A;  1T08 B;  5H6Q A;  1O3R A;  4HV5 A;  4U0W A;  2AXT C;  5D5W B;  2QLZ A;  1UFM A;  3PIP F;  4WF2 A;  3ECH A;  4HNV A;  4XID A;  3K10 A;  4ZDP A;  5M5Y J;  2JQ7 A;  4DZJ A;  2NRA C;  1WCM J;  1K7A A;  3DF8 A;  2DPD A;  4IHT A;  3MN2 A;  2LG4 A;  2WC2 A;  5FO5 A;  4EJV A;  2YR2 A;  2LVS A;  4U0Y A;  3LL7 A;  5ICG A;  4I98 B;  2E1C A;  3CCJ I;  2JT1 A;  1KON A;  1R00 A;  4M71 A;  3ZQ7 A;  3GTK J;  1QO0 D;  4XBF A;  2P8T A;  1IN5 A;  4FCY A;  1MMG A;  1BR4 A;  4C3I J;  3SFZ A;  3BJ6 A;  4L5I A;  4I01 A;  4P96 A;  5J8F A;  2D1H A;  3S3N A;  2Z99 A;  4HX4 A;  3G71 I;  1LE8 B;  1XGM A;  3HG9 A;  1MND A;  4XRS G;  4XRS A;  4D5C A;  1DQU A;  5FKM A;  4D9J A;  4MHG A;  1VTN C;  2KLO A;  2MGQ A;  5J1U A;  1GV5 A;  2EJR A;  3WU1 B;  2HEO A;  1JGS A;  1ZEL A;  2VBW A;  2Y0S N;  3DTE A;  1R4N B;  3MAJ A;  5IYB J;  5DDG A;  2PG4 A;  1CF7 A;  2XAU A;  5B5E C;  1BOB A;  3ZXS A;  3OYB A;  1N25 A;  3DXJ F;  3CUO A;  4XKV A;  3IC7 A;  4ZZL A;  2ZFW A;  4R79 A;  3HL2 A;  5DD8 A;  3FBI B;  1W1W E;  4E7H A;  3QU3 A;  2O61 A;  4EGZ A;  1QA6 A;  1SVO A;  4CCJ A;  1GVJ A;  5F6F A;  3DBH B;  1MDM A;  2DT5 A;  2FML A;  2YU9 J;  4IQJ A;  5JHF A;  2CV2 A;  5HS9 A;  2JSC A;  4EJW A;  3DPL C;  4M6V A;  3TO7 A;  2PN6 A;  3GBG A;  3Q5F A;  2K9M A;  3SZG A;  3L1P A;  2HKO A;  3I4M J;  4B09 A;  3K4K A;  5FGM A;  3A01 A;  3S1N J;  3K70 C;  1D8J A;  3ONQ A;  2P5L C;  4YIR X;  1BR2 A;  4P9U A;  4AWX B;  4WCG A;  2KQR A;  4XR6 A;  1J7K A;  2PJP A;  3VEP A;  5LHI A;  1OMI A;  3BR3 A;  4CO8 A;  3HRS A;  1BI3 A;  4O5V A;  1B6A A;  4B4C A;  4Y7N J;  4RB1 A;  3DLL F;  2HVS A;  4N9I A;  3JR9 A;  3O8G A;  1F5T A;  1ZGA A;  3P9C A;  5CQG A;  5EGO A;  4XNF A;  3FXR A;  1IGN A;  3AL0 C;  5AIP A;  1EJ9 A;  4I0B A;  3OYE A;  2UZK A;  2JJ7 A;  3QRF F;  1QVT A;  3MVP A;  2X48 A;  3CUQ B;  2VOO A;  1RKW A;  5DD4 A;  2K86 A;  4LB6 B;  1TWC J;  3MFK A;  3GFJ A;  1SD4 A;  4HV6 A;  3HTS B;  1QHG A;  5HNF A;  3HPH A;  2F5C A;  3JSP A;  3OYL A;  5DUK A;  3BPX A;  2E60 A;  1B59 A;  2DW4 A;  2IGO A;  2UXX A;  3BG9 A;  5F1J A;  1FOK A;  3H5A A;  2L2O A;  3RPU D;  5IY5 H;  4F93 B;  2VBZ A;  3LQQ A;  2KRH A;  5BPI A;  4G6T B;  4M73 A;  1KU2 A;  1RPW A;  4OMY A;  2L4M A;  4G9Y A;  2JWT A;  1E17 A;  2XAJ A;  3BTC A;  4JQF A;  4XLA A;  2NVU B;  5M3F J;  2HYF A;  2HOS A;  3FF5 A;  4ZYD A;  1A36 A;  3H3V K;  1BOA A;  2AQF A;  1HW1 A;  3K69 A;  3BPV A;  4WWC A;  2XC7 A;  3FBN B;  1ZR4 A;  5L3B A;  5GPC A;  3ERE D;  3RYP A;  4W1U A;  4IHS A;  2R7T A;  2IBD A;  3FXO A;  3HEF A;  5DM6 F;  3GEZ A;  5E1W A;  3COA C;  3KP4 A;  2M87 A;  2XGX A;  4ZDL A;  5D4R A;  2ZME B;  4DIQ A;  2DK8 A;  5J6X A;  1X3U A;  4CCO A;  3ECO A;  1GT0 C;  3EPZ A;  2JUC A;  1XCB A;  2HFH A;  2QSG X;  2H6C A;  2CFX A;  3F8F A;  3OIQ A;  3HRT A;  2ME6 A;  3EYI A;  3GXO A;  1B4A A;  3BDD A;  2OJE D;  1MH4 A;  2HZD A;  4L9N A;  2XPU A;  3KYC B;  2XVC A;  4A12 A;  1ULY A;  4KDP A;  1XDU A;  3KP6 A;  3BQZ A;  3WTX C;  3IAS 2;  4RB0 A;  2DTR A;  4PJ0 C;  4JX6 A;  5E17 F;  5FLM J;  4XOT A;  1R22 A;  2A5W A;  1WKM A;  3ZR8 X;  3S2D J;  3IKV A;  2Y30 A;  5F1R A;  1CQT A;  1UZC A;  3FHZ A;  2J5O A;  3DTI A;  5LGU A;  2VQC A;  2TDX A;  4ENK A;  1Y1W J;  3I5U A;  1IF1 A;  2MD0 A;  3F22 A;  4HLY A;  1ZG1 A;  4D0P A;  4EM0 B;  4G7Z F;  4MQV A;  1D3Y A;  4M9X A;  2HQR A;  2XGE A;  2V7F A;  2RV8 A;  2I8D A;  2ZKZ A;  3DBL B;  4CYC A;  5F64 A;  1KZH A;  1HDD C;  3MZ8 A;  2Y9Z A;  1O57 A;  3NQO A;  1HST A;  2V1U A;  5L3C A;  2IS6 A;  4NBQ A;  2CG4 A;  1G3S A;  1T56 A;  1UCR A;  2JSP A;  3EYY A;  5F08 A;  3MEX A;  4Q4Z F;  5BPD A;  3BR5 A;  3TQN A;  1JKQ C;  2NXN B;  1B8I A;  4MTD A;  3DCF A;  4M72 A;  3S1M J;  2XPV A;  3JRB A;  1I6X A;  1MGT A;  3F23 A;  1PP7 U;  3JRF A;  2XAG A;  3QOD A;  3AKZ A;  4I0A A;  3PO2 J;  2ESN A;  2XF5 A;  5HLI A;  4KYW A;  5JLW A;  1K78 B;  2V9P A;  3CQZ J;  2HGC A;  3E3V A;  4PCQ A;  5ICC A;  3HKZ N;  5FD5 A;  4XK4 A;  1LEA A;  3N97 A;  1B9N A;  4JYK A;  1W5C C;  1LDK B;  4OWR B;  4G6Q A;  2E36 A;  1J59 A;  2V1N A;  3D5S C;  4B47 A;  1SFE A;  4XRM A;  1BI1 A;  1YQA A;  3HGG A;  4XLP F;  4BE1 A;  1Z9C A;  1E2X A;  2Y75 A;  1NG6 A;  3K9T A;  1IRF A;  1Y56 A;  2R92 J;  3R0J A;  1ONV A;  4RGU A;  1MDM B;  1BBY A;  5HLG A;  4MEX F;  3ROU A;  4IHX A;  1OFC X;  3S2H J;  1ETK A;  2XRO A;  1IJW C;  1W7P D;  2UV1 A;  4YEL A;  1ITY A;  2P0W A;  1X2M A;  5E3O A;  2O8K A;  3FHN A;  1YRN A;  2WAF A;  1LJ9 A;  2W57 A;  3A01 B;  2O6G E;  2XRN A;  4PZJ A;  2HQN A;  2STT A;  1H9G A;  3TMO A;  2CV0 A;  3LAJ A;  2BW3 B;  3IP4 B;  1VQ8 I;  3RI4 A;  5FRM A;  4BQQ A;  4E7S A;  2A5Y B;  1GXQ A;  4XL9 A;  3RZD J;  1TT5 B;  4B3A A;  5FLV A;  3VFZ A;  3A0B C;  4ENJ A;  3DTK A;  3K6G A;  3IL2 A;  4FE7 A;  1WPK A;  4HEA 2;  1SVM A;  1TT0 A;  2M5W A;  4RAG A;  3C2H A;  5EGO B;  4IJA A;  1P7I A;  1VQ7 I;  3F21 A;  4MGR A;  1TNS A;  3C7J A;  4HOB A;  3CDH A;  3RDI A;  3Q9S A;  3MKL A;  1JJ6 C;  2NVY J;  3OL3 A;  4MNU A;  1QVU A;  4IF4 A;  3NEU A;  4BXX J;  5ICF A;  3M07 A;  3AFH A;  1SFU A;  2WAQ N;  2DBB A;  1USS A;  2BEO A;  3A4C A;  4GGG A;  3HXL A;  2LF8 A;  3ZGK A;  2V6C A;  3JRH A;  2BE5 F;  1X58 A;  4N4O B;  2HOT A;  4B8X A;  2XAQ A;  2MYS A;  5J1Y A;  3GTJ J;  2DXI A;  4L0Y B;  4V19 K;  3H35 A;  3WGI A;  2CQN A;  2XAS A;  3AG4 H;  3KIO A;  4LD5 A;  3WOD F;  1R4M B;  4HF2 A;  1EH6 A;  3BTJ A;  5C4J J;  4KMU X;  5DS9 A;  1WSU A;  9ANT A;  3GFM A;  1J5Y A;  2FXA A;  3CDI A;  1S29 A;  4G6D A;  2R5Y B;  4PFO A;  2VJI A;  4DOZ A;  5JVT A;  1AHD P;  4KIS A;  3JRA A;  1XC5 A;  3K4N A;  2MC3 A;  1EH8 A;  4BJ5 C;  5LEK A;  2E71 A;  3OYG A;  3S14 J;  3R60 A;  1RZ4 A;  3HSR A;  1ZGW A;  2Q1Z B;  5GAG J;  4S05 A;  4CHU A;  2UWM A;  1WGX A;  5F0C A;  2B9S A;  1Y8R B;  4M3D A;  2R7V A;  1O3S A;  2F48 A;  5L3G A;  2W00 A;  4FIS A;  5D8K B;  2KRC A;  3D1N I;  2VI6 A;  3QWL A;  4RLQ A;  3SXY A;  3KLO A;  2LKX A;  1BI2 A;  2P5V A;  4JOM A;  1T33 A;  4GYG A;  4Q47 A;  2Y9Y A;  3DV8 A;  1MNE A;  2L54 A;  3KP5 A;  2MA3 A;  2VKV A;  4NNJ A;  4FET A;  1ZYR F;  3WE2 A;  3ULQ B;  3QYF A;  1UG2 A;  1RKT A;  1KA8 A;  1E3P A;  4XKW A;  3B02 A;  4FE4 A;  2NVQ J;  2W25 A;  4L18 B;  5KCM A;  2IA2 A;  3K7A J;  1P92 A;  4OIR F;  3GUD A;  3M7G A;  3B73 A;  1FOY A;  2DPU A;  2ZNY A;  3SZP A;  2ZNZ A;  1FBQ A;  1JT6 A;  1PYV A;  5ERI A;  3SJM A;  2FA5 A;  3H5R A;  1LDJ A;  3HIF A;  5DEQ A;  2QQA A;  2G7H A;  4KT6 A;  4PJL A;  4PSW A;  1MJ9 A;  4CCN A;  3K4M A;  5EEH A;  3E7L A;  3LSM A;  1OKR A;  2R5Z B;  3ZQL A;  1F43 A;  3HOZ J;  1FSE A;  4Y4R A;  3CCE I;  3W2V A;  4BQO A;  1L3L A;  2RC4 A;  1X19 A;  1S3J A;  2ZSH B;  1BI0 A;  4ZC3 A;  5K7Z A;  4XRF A;  4U88 A;  4CCM A;  4HDU A;  1W36 D;  1J0R A;  1NG7 A;  3T5X A;  2XDV A;  1Y1V J;  2R7X A;  2IPQ X;  2PX9 A;  3OYD A;  1U6G A;  5CPR B;  3ZQI A;  2MAB A;  2IAI A;  2CWE A;  3WTU C;  1MNM C;  3PQK A;  4F55 A;  2EIK H;  3BR1 A;  4OIN F;  1XPX A;  1JHF A;  4OAZ A;  2R7W A;  3W6V A;  1ZH5 A;  2HR3 A;  2IXS A;  3EDP A;  2P5K A;  3B6A A;  3E97 A;  3PM1 A;  3HOS A;  5FKK A;  4LLG F;  1FYL A;  4OU0 A;  3GTM J;  1E3H A;  2OUM A;  3E5Q A;  1SFK A;  2XGC A;  5FKO A;  3OYJ A;  4Y33 A;  4YFN F;  3F8N A;  1WWX A;  1TWH J;  1OCC H;  1G4D A;  2LKP A;  4E7J A;  3Q9V A;  3WE3 A;  3ZMZ A;  1R36 A;  3BC8 A;  1ZHF A;  4N9H A;  2JA5 J;  4TV7 A;  2H09 A;  3M1E A;  1FZP B;  2MC4 A;  2MG4 A;  4E7I A;  2EV0 A;  3MCZ A;  5FRN A;  1UMQ A;  4BBS J;  5M5X J;  3EUA A;  1HOM A;  3ISP A;  1K4S A;  2MD5 A;  1RR8 C;  2L7Z A;  4BBR J;  3C1D A;  3QYE A;  1K83 J;  2KDO A;  3ERM A;  3GLL A;  3PFI A;  1YRN B;  2CO5 A;  2LBF A;  2EQR A;  1SMT A;  2WAE A;  2P6S A;  2QKM B;  4D7N A;  1QHH D;  2CUZ A;  4CCL A;  2DT7 B;  1A04 A;  4EMS A;  1IAW A;  1G3T A;  3P7N A;  4N4N B;  2VJ4 A;  3KCC A;  3HHG A;  1OCT C;  2QCO A;  3H92 A;  1FWZ A;  2JZY A;  5LRR A;  3H9G A;  1F36 A;  2OZ6 A;  5FLX K;  3BZC A;  3GFL A;  1IW7 F;  4B43 A;  4NC7 A;  1RC9 A;  3L09 A;  3BLY A;  3I0T A;  4L9T A;  1BN5 A;  2P81 A;  5J4V A;  3SHF A;  5E8I A;  2N8G A;  1VQ9 I;  1OCO H;  1XG1 A;  1WQ2 A;  3HJE A;  1RI7 A;  4U7B A;  4E70 A;  2WAD A;  1P9Q C;  3O6B B;  2OQG A;  1SFO J;  1MJA A;  2TCT A;  3F8M A;  1U0J A;  5D5X B;  3SEQ A;  4II2 A;  1BW5 A;  4Q48 A;  2JUG A;  4XLE A;  3G73 A;  4EQQ A;  4L9V A;  1D5Y A;  3HYI A;  5F0H A;  1YG2 A;  1HCR A;  3J80 Z;  3BTI A;  1ETQ A;  3L2C A;  1YTY A;  1VQN I;  2IW5 A;  1YE9 A;  2F6C A;  2YS9 A;  4B1R A;  5EG0 A;  3GTG J;  2CU7 A;  3T0Y A;  4C3J J;  4YIF A;  4D7M A;  1DPR A;  1LVK A;  2E7X A;  3JTH A;  3BCA A;  2KL4 A;  3LNQ A;  5GAE J;  2L9V A;  1AKH A;  4M74 A;  4F91 B;  2QKL B;  1D1A A;  2ZXI A;  4WXD A;  1Y8Q B;  2DN0 A;  1U8B A;  2VPR A;  3CZ6 A;  4AUX A;  3E5U A;  3G3Z A;  2CRG A;  2BY3 A;  1FNN A;  2FX0 A;  3ZQG A;  1QNT A;  1XTA A;  2QGU A;  2AS5 F;  2KZV A;  2JPC A;  2IS4 A;  3GO5 A;  4HSR A;  4RGX A;  2DK5 A;  1V55 H;  3K70 D;  3RKW A;  1TP4 A;  4IVN A;  1AWC A;  4IHY A;  3I4N J;  2A61 A;  1K6Y A;  1XMA A;  2DCE A;  4CDG A;  5H6R A;  5HS8 A;  5JLX A;  2H8W A;  1KU9 A;  4A0Z A;  1DP7 P;  2D2W A;  4L5E A;  3TW7 A;  5LD2 C;  2VON A;  5J8C A;  1OYY A;  2KHM A;  2QF7 A;  3LFK A;  3J7Y J;  1SD7 A;  5DCF A;  1IV6 A;  2GIZ A;  3L2R A;  3WTT C;  3ASO H;  4IL6 C;  4ESF A;  2JA7 J;  2NOJ B;  3ZMT A;  3SFI A;  4HZF A;  1VI0 A;  1QZY A;  2E1M C;  5LLQ A;  2FE3 A;  1ETW A;  1ZK8 A;  1WZ2 A;  2FBH A;  3KYD B;  2CYY A;  4UB6 C;  2B0L A;  1R5G A;  2ZJ2 A;  3TDU C;  1B72 A;  1IRZ A;  3F3X A;  3S1Q J;  1YW7 A;  3FWE A;  2VC1 A;  2R3S A;  3G6E I;  1IV8 A;  5GAD J;  2KIU A;  3FMS A;  2E5Z A;  1LVA A;  2JA2 A;  1T6S A;  1T8I A;  2IS1 A;  2KFD A;  4C9Y A;  2P7C B;  2ZJR F;  2EPF A;  1Z77 A;  1U8R A;  4S04 A;  3RKQ A;  3W6K B;  2LYC A;  2HDD A;  2L7M P;  4DJA A;  3C18 A;  4RDU A;  2H27 A;  3I56 I;  5KAI C;  3HOT A;  2VBY A;  4FX0 A;  5FKN A;  1KGS A;  4AYB A;  2OTL I;  2DMN A;  1UST A;  3ZMU A;  3I59 A;  3T1B A;  1R1V A;  1DGW Y;  1D0Z A;  2VKH A;  4HX7 A;  4OAY A;  1RES A;  2AXL A;  4A93 J;  1BIA A;  5BMZ A;  2R7O A;  3K1M A;  3GME A;  5KK1 A;  2O03 A;  3LMM A;  3M8J A;  4RM3 A;  1RUN A;  1TW3 A;  4PDK A;  5JI6 A;  1E0E A;  5M3M J;  4C2U A;  3WU2 C;  1XB4 A;  2JTV A;  4CZZ A;  3S3M A;  1FTZ A;  3OMY A;  5CQE A;  4XLF A;  5B1B H;  4LG0 A;  5E3M A;  1N77 A;  3RIR A;  1P2F A;  4V2F A;  4YII A;  3CLO A;  3FIW A;  1YJW I;  1EA3 A;  4XKC A;  2NS0 A;  2G0E A;  4LGW A;  3CCQ I;  2IRF G;  4G8X A;  3IH4 A;  2QEN A;  3CMY A;  1ZN2 A;  1SEU A;  2WB1 A;  2DTZ A;  1A6I A;  1FIA A;  3ZQH A;  1Y0N A;  1MSF C;  2EFW A;  1J09 A;  2HXO A;  4ON0 A;  1X4O A;  2TRT A;  1TWA J;  2FU4 A;  1YX5 A;  2LSO A;  2O7O A;  3OL4 A;  1FBS A;  3J81 Z;  3J7A Y;  3OS0 A;  4LJZ F;  2BHY A;  2MBF A;  3C2B A;  3W3C A;  2LBF B;  2Y2Z A;  4UVB A;  2P7V B;  1PP8 F;  3ELK A;  1TQM A;  2FUG 2;  2OF7 A;  4PK4 A;  2B63 J;  4A0X A;  2W1O A;  2K9L A;  5CLS A;  1SC7 A;  3W2W A;  3RJP A;  2COB A;  2CQX A;  2DFF A;  3ZMD A;  3TP0 A;  1JTX A;  3BG7 A;  3F8C A;  3I64 A;  3QP6 A;  1XGO A;  1VQL I;  4U7D A;  4Q5S F;  3CO6 C;  4Z2Y A;  2FBK A;  3Q0W A;  2FNA A;  5HLH A;  3G1L A;  2Q8K A;  2Z9O A;  1W4M A;  2STW A;  1MMN A;  2HQ5 A;  2R7S A;  3CD6 I;  1S7O A;  3A03 A;  1LNW A;  4EV0 A;  1AOY A;  2XAH A;  3J7A O;  5M5W J;  3IWF A;  3JTG A;  1ZAO A;  3H1C A;  1I3Q J;  1EV7 A;  4ITV A;  5L3F A;  2CUJ A;  2DA5 A;  4HYE A;  5IOZ A;  5IT9 Z;  3D5R C;  4X6A J;  3M3Y J;  3W2A A;  5FFX A;  3G2B A;  2JA8 J;  1DU0 A;  3CP2 A;  5LGT A;  3R61 A;  3QPT A;  4A2U A;  3BR0 A;  1Z21 A;  1AKH B;  4RAZ A;  3LQR A;  1UEL B;  2RNG A;  4QIW N;  3SEZ A;  1Z7L A;  4JX5 A;  3BG3 A;  2FEZ A;  1WJA A;  2B7E A;  5D6F A;  2JPB A;  3RZO J;  2RN7 A;  3O3K A;  2DA2 A;  4G7H F;  2V4J C;  2FBI A;  1ZG5 A;  3DQV C;  3EQL F;  2HWV A;  4GRI A;  3AL0 B;  3LWF A;  2V1D A;  1KU3 A;  1GLN A;  2KZG A;  5KAF C;  1Z0X A;  3OIO A;  4UV8 A;  3H5N A;  2X1D A;  2FOK A;  1NTC A;  2LY2 A;  1H0M A;  2CQK A;  2NNN A;  3RKY A;  4BJ6 C;  4IRG A;  2DJN A;  5TRD A;  2HU9 A;  3PIO F;  3L2Q A;  1ZRF A;  5EF6 A;  1YHQ I;  3U1K A;  3S17 J;  1I1S A;  1Z6R A;  2KJC A;  1R5H A;  2W48 A;  2FNP A;  1RR7 A;  1SVL A;  2JVH A;  4CSW A;  3SDG A;  4HG2 A;  3N4M A;  2VBX A;  4YG2 F;  5DV5 A;  2EA4 A;  2W4S A;  2DQR A;  2M4G A;  3HZJ A;  1GUU A;  4ZH4 F;  1IRX A;  4KT5 C;  3V7R A;  4I02 A;  3HGY A;  2L02 A;  3AAF A;  1VQ4 I;  1LQ1 A;  2BVM A;  1S8N A;  1QZE A;  4RMN A;  3E5X A;  2H94 A;  5ILU A;  3F6O A;  3WTV C;  1RUO A;  5E8G A;  4RBO A;  2DFE A;  3WG9 A;  2A07 F;  2PMZ A;  1X1P A;  3LST A;  2EFQ A;  2IT0 A;  3S16 J;  3ZRG A;  4Y13 A;  2HNH A;  2Z16 A;  5GAH J;  3B6C A;  4HPQ A;  1MBE A;  4LFU A;  4LK0 F;  5FLX Z;  4BYY A;  2H6B A;  1MD0 A;  2OQR A;  2K02 A;  3OV8 A;  2QZ8 A;  3RQI A;  1IUY A;  2X85 A;  1JKR C;  2XB5 A;  1ZGJ A;  1ACI A;  3LA7 A;  1HA8 A;  1XX5 A;  1T38 A;  3OS1 A;  1XSV A;  2GOM A;  1WH5 A;  1IC8 A;  3K4L A;  2RKH A;  2QQ9 A;  3G1O A;  1ZG3 A;  2HTJ A;  2RNJ A;  1DPU A;  5FKL A;  2LTP A;  4KN7 X;  3I59 B;  5FB2 A;  5K5Q A;  2DFH A;  5C3E J;  1LFU P;  3A1Y A;  3CTA A;  2Y48 A;  2HS5 A;  2CQQ A;  5HDN A;  2GA2 A;  3BJA A;  3M4O J;  3AG1 H;  1S6L A;  1YFH A;  1OCZ H;  3KP7 A;  4I7H A;  4YRV A;  4ZTF A;  3IV5 A;  3GZ6 A;  2PMU A;  1Z67 A;  2KIQ A;  3ABK H;  2LF7 A;  3GTQ J;  1ZR2 A;  1G59 A;  1CF7 B;  2GLO A;  1PVE A;  3QP5 A;  1XCV A;  2L3D A;  3BG6 A;  4HNU A;  3MKY B;  1W5S A;  1HKT A;  4E7L A;  3MKW B;  2HDC A;  3DKX A;  3A0H C;  3K4B A;  2FMY A;  3V4G A;  4BXF A;  1DGR M;  1HSJ A;  3H0D A;  2QEX I;  3S93 A;  2KPM A;  2ZXJ A;  4ZJZ A;  2OTJ I;  1WI9 A;  2KT0 A;  1FIP A;  2M3A A;  2FD5 A;  2BBY A;  4F52 A;  1N75 A;  1HW5 A;  1R23 A;  4XLC A;  3CCY A;  1W7P A;  2GM4 A;  5LEJ A;  2W24 A;  1H8A C;  3LA2 A;  3BR2 A;  3PNV A;  4UXN A;  3CP8 A;  4AD9 A;  4JX4 A;  1MW7 A;  3PUB A;  1ORK A;  5LHH A;  2LY9 A;  4IEJ A;  3G1M A;  5CVI A;  3FM5 A;  2AO9 A;  3ZCO A;  1ZKG A;  4M3E A;  3OYN A;  1VQO I;  3BZK A;  3JSO A;  4C30 A;  3HC7 A;  5DTD A;  4CUG A;  2GA1 A;  2ISZ A;  2OC6 A;  2ADU A;  2RDP A;  4BAY A;  4D5F A;  1T2K A;  3DKW A;  2K9S A;  1MSE C;  2E5N A;  2K85 A;  2K4J A;  3I54 A;  2LRD A;  3CJQ B;  1OLT A;  4AU7 A;  1LFB A;  1MBG A;  1IXR C;  2HI3 A;  1WJD A;  1PUF A;  1NH3 A;  1ZRE A;  4M9S A;  3HOU J;  3L9F A;  5HOD A;  2C6Y A;  1T98 A;  3DWL E;  4EJT A;  2XSJ C;  3BRO A;  3OYH A;  2E1O A;  1JGG A;  1EKE A;  1YS6 A;  3SDB A;  1A31 A;  5EEA A;  2PLY A;  1Q1V A;  2L4A A;  4A6E A;  1I6H J;  1HLV A;  2YUS A;  4CA0 A;  4ABZ A;  3CJN A;  1L0O C;  1S7A A;  1Y0U A;  3H3U A;  3VSL A;  3J80 K;  1HKQ A;  1WJC A;  4CCK A;  1Q1H A;  2IA0 A;  1Z1D A;  1O3Q A;  5CVU A;  3OOP A;  5TIS C;  1V54 H;  4HRI A;  1X1C A;  2OCE A;  2ZC2 A;  4ENN A;  4MIM A;  4U87 A;  2DA3 A;  4E7Z A;  1B9M A;  4M3F A;  1WI3 A;  3K1P A;  1H89 C;  3K4C A;  1G6N A;  1S9H A;  4M9Z A;  3I53 A;  4EJU A;  1D5V A;  1BC7 C;  2VXZ A;  4KIC A;  1PUE E;  4G7O F;  3VPR A;  1O7L A;  2EFN A;  3GW2 A;  1JUM A;  2I10 A;  5J3L A;  1D0X A;  4GDF A;  2R4G A;  2ZBK A;  4UNO A;  2HZT A;  1XGS A;  5IP7 J;  4Y15 A;  5TGT A;  1DDN A;  3K1N A;  4BGD A;  3DFG A;  3HOV J;  4UV9 A;  4XOR A;  2K4B A;  2R7Q A;  5K5R A;  1I50 J;  2DJI A;  2L7F P;  1IN4 A;  1TLH B;  4WXC A;  2LRE A;  3LSR A;  1VQK I;  1S72 I;  4UVA A;  3O2P E;  2OAZ A;  3KLN A;  2HTS A;  1BW6 A;  3IKT A;  3PO3 J;  2PI0 A;  1FMW A;  1X2N A;  4ESB A;  2L7K A;  2WY7 Q;  1YJ9 I;  3UKG A;  4JBA A;  4CXF A;  3F9K A;  3FKJ A;  2VT2 A;  5E3N A;  3ASN H;  2LFB A;  1VQM I;  4F92 B;  2H1K A;  3MMY B;  4A3F J;  4M3G A;  4BNC A;  1ZLK A;  2XIG A;  3H36 A;  2M0C A;  3H9Q A;  6PAX A;  2CS3 A;  2M7B A;  1NK3 P;  2EIJ H;  2VIX A;  1QQI A;  2EFO A;  3VDX A;  4M6Y A;  3ZN1 A;  5HS7 A;  2BHZ A;  5E3L A;  5J40 A;  4UUT A;  3JRI A;  5B66 C;  2XRL A;  2DA1 A;  3MWM A;  4LOC A;  1Y39 A;  4O3M A;  4ZYE A;  1B1B A;  2R0Q C;  1ON1 A;  1ETX A;  1YO5 C;  1RNL A;  2JMW A;  3F0C A;  3JCU C;  4KNY A;  3QYB A;  2X0L A;  1SD6 A;  4BY1 J;  2E19 A;  2JA6 J;  2BY0 A;  4CYC B;  1ETV A;  2ID6 A;  3TW6 A;  5JHU A;  4ZDO A;  3MQ0 A;  2G7U A;  5HLT A;  1BC8 C;  1G3Y A;  4BUP A;  2YX4 A;  2AHQ A;  3Q0U A;  3FIS A;  3HRU A;  4L0Z B;  1B8I B;  3REO A;  4IHV A;  2LLK A;  5K5O A;  4P55 A;  5BQT A;  3IAM 2;  3IWZ A;  1ON2 A;  2DMP A;  2XKO A;  1VF9 A;  1JKO C;  2ECB A;  3HTU A;  5B1A H;  1VQP I;  2GWR A;  2Y31 A;  2R7U A;  4BS9 A;  3NAU A;  5H2F C;  3EUK L;  1MJB A;  2M4K A;  4PJN A;  3MKZ A;  3ABU A;  4QSH A;  3S15 J;  1YIJ I;  4N0B A;  1YI2 I;  1NHA A;  3JRG A;  1R71 A;  4LIU A;  1MZB A;  2MH2 A;  5KVR A;  2VKD A;  3LOC A;  2LKS A;  4EVI A;  3DU5 A;  3FMR A;  4X0G A;  5IOY A;  3BG5 A;  3JRC A;  1OQY A;  4BH9 A;  2BY1 A;  4J01 A;  1QU3 A;  2UXN A;  5C44 J;  1HXD A;  1K61 A;  4RB2 C;  1ZQ3 P;  1LE8 A;  5EYR A;  3J81 K;  1VQ5 I;  2CMP A;  3FXJ A;  1LDD A;  1KQ9 A;  3IRQ A;  3L00 A;  1XD7 A;  4NB5 A;  1OIS A;  4IO9 F;  2F4I A;  1STZ A;  4PUS A;  4Y3O A;  1ZLJ A;  1A35 A;  1TWF J;  5CVJ A;  4G94 A;  3CCM I;  1V5E A;  2V9V A;  3OYC A;  1U78 A;  2ICW G;  2VLA A;  4MFE A;  4IKF A;  4A3B J;  4LIT A;  3PJR A;  1BM9 A;  3WHB A;  1V3F A;  2V1X A;  2FRH A;  2L9R A;  3GX4 X;  2IGM A;  4A3I J;  4HF1 A;  3OYM A;  3C3W A;  3BJO A;  5K7H A;  2PQ8 A;  1TW2 A;  1JUP A;  4U0V A;  2VOD A;  2DDA A;  5ILS A;  1I39 A;  2DDB A;  2VL8 A;  3FMQ A;  4BEH A;  5KNL A;  1PUF B;  1QBJ A;  2Z3Y A;  5J47 A;  1BL0 A;  2XAF A;  1SMY F;  4DW6 A;  2QSF X;  4P9F A;  1FY7 A;  2VXD A;  2M1B A;  4IXA A;  4DYR A;  1W5T A;  5D4S A;  2EZI A;  4PJM A;  1U9O A;  3CMM A;  1X4P A;  2DLL A;  2VJ5 A;  2RGV A;  2M0M A;  5IT9 K;  2MH9 A;  2RRE A;  2DOA A;  1A5J A;  3Q3S A;  1G2H A;  3E6B A;  1XSD A;  4P1W A;  2ZXH A;  2M7A A;  4OOI A;  2A69 F;  3AG3 H;  3JAM Z;  4EEF G;  1R1T A;  2E34 A;  4BHC A;  1TC3 C;  2KKO A;  3ESW B;  2BOL A;  4XMY A;  2XGD A;  2NVT J;  1FP1 D;  3V8K A;  3H9J A;  4FTH A;  5A2Q Z;  1K79 A;  1V5G A;  3I9V 2;  3SQN A;  3ABL H;  1BR1 A;  4DZP A;  5FFZ A;  4M3B A;  3CUQ A;  3IHU A;  1MMD A;  3O8H A;  4AIH A;  1HBX G;  3F6V A;  3C2G A;  2VE9 A;  2BXZ A;  1SAN A;  2ECC A;  3VSK A;  3R6S A;  3OR1 C;  4RGR A;  4XQF A;  2P4W A;  1K6O A;  4B44 A;  4KUM A;  1HC8 A;  4X1E A;  3SZT A;  2R7D A;  3FXQ A;  3U9G A;  2W84 A;  3GF2 A;  2LNB A;  3CMA I;  2OPT A;  2DOF A;  3QAH A;  4JP0 A;  2EH3 A;  5DYM A;  5ILV A;  1IO2 A;  3LSP A;  3HOX J;  2FJ1 A;  3KP3 A;  4A3K J;  4ZYG A;  3U21 A;  2HXI A;  1YIT I;  4BQN A;  1XSX A;  5LFA A;  2FF4 A;  4WK8 F;  3CDL A;  1ETY A;  4RB3 C;  2CFO A;  3GWZ A;  3TKY A;  4FT8 A;  4ETS A;  3D5L A;  5D5U B;  2BYV E;  2LK2 A;  2BVL A;  1AU7 A;  5L3E A;  2VQL A;  3LSJ A;  2CUF A;  3UNG C;  2X6Y A;  2F2E A;  3ZQQ A;  3PSI A;  4MLO A;  3KFW X;  3FXL A;  1YS7 A;  1S7E A;  3PUF A;  4I6Z A;  2A68 F;  1H9T A;  1ZRC A;  3HOY J;  3QPS A;  4HAM A;  3ZQF A;  2ZME A;  2KIS A;  2EIN H;  3CCU I;  1MBK A;  3L2W A;  2PJR A;  5TJJ A;  4LB5 A;  4AVZ A;  2M9H A;  1BA5 A;  2Y0S A;  2DMQ A;  3KEY A;  2GBY A;  4F7Z A;  5EEG A;  2WV0 A;  4L5J A;  2OV7 A;  3HM5 A;  4NHJ A;  3WGH A;  2F5D A;  1XDS A;  3V8J A;  2HVQ A;  1JJ8 C;  4AIJ A;  2R7R A;  5CVR A;  3ZPL A;  4GFB A;  1HF0 A;  1ZTR A;  1IXC A;  2VUM J;  2E1M B;  3I71 A;  4MTE A;  3OYA A;  2XF6 A;  3DPU A;  5CJ9 A;  5LRS A;  4CGZ A;  1SAU A;  4BAC A;  3BOQ A;  1IN8 A;  3GVA A;  2A05 A;  4ZZD A;  3L7W A;  3P9I A;  2CW0 F;  5IYC J;  4GCV A;  2K7L A;  4A3G J;  4ZTJ A;  2HQA A;  2BZT A;  1MBH A;  2QA4 I;  3E6C C;  2HDW A;  2DQL A;  3HOW J;  2BGC A;  2F5F A;  1YLF A;  2KIM A;  4BE2 A;  2LOO A;  2VC0 A;  5FRO A;  2ZB9 A;  2MW8 A;  4A0Y A;  1WJF A;  3QPL A;  4HNT A;  4F3Q A;  3PSF A;  1IDY A;  2IP2 A;  1R6R A;  3PFY A;  2V79 A;  4RA2 A;  2LH9 A;  2ID3 A;  1K78 A;  2O0Y A;  1W0T A;  1ETO A;  2QBY A;  5BOX A;  5E18 F;  2Z33 A;  3V8L A;  3LSG A;  2ISY A;  1EF4 A;  1R49 A;  1QRY A;  3I4P A;  1ZRD A;  4W97 A;  5JFR A;  2KDZ A;  3NWS A;  4YEJ A;  2CW8 A;  3NAR A;  3RTR A;  2KIF A;  2HYJ A;  2ZO4 A;  4XKB A;  3OS2 A;  1H88 C;  1IN7 A;  2CSO A;  1IRG A;  3MZH A;  2GXA A;  1U3E M;  1DP3 A;  4C3H J;  1XS9 A;  1Z05 A;  2R93 J;  1WHU A;  2K9N A;  4LIV A;  2XV4 S;  4AYB N;  2EZL A;  4MFD A;  5L3D A;  4BEH B;  3KX2 A;  3JRD A;  1TL8 A;  2NVX J;  2L0K A;  4LG3 A;  2XF7 A;  2VB6 A;  2K40 A;  1HKS A;  3BR6 A;  3CUQ C;  2GAU A;  1RIO H;  2HOE A;  4CIC A;  1GVD A;  5BS6 A;  4IOC F;  4WX9 A;  1POG A;  1IXS B;  2BW3 A;  2M34 A;  2WY8 Q;  4BDZ A;  1DU6 A;  3W6J B;  3KEO A;  4FQG A;  1W0U A;  3VYS B;  2OZU A;  3PL8 A;  3WTZ A;  1FX7 A;  1F1Z A;  5JR3 A;  2X6O A;  4KIF A;  4FHT A;  3WHC A;  3ZP5 A;  2NYX A;  3OOU A;  4QWQ A;  1JE8 A;  2YU3 A;  3CLQ A;  4AIK A;  1D0Y A;  1FLI A;  2I5U A;  3PNY A;  5EG0 B;  2MSY A;  2VJJ A;  5CVV A;  2WB1 N;  1OR7 A;  3VYT B;  3M8E A;  3RPU A;  1IN6 A;  1MIJ A;  2EIM H;  2QYO A;  4XON A;  4KIB A;  3WTY C;  1O4X A;  3SYT A;  1FTT A;  3FDY A;  3CCL I;  1FJL A;  3HHH A;  2GQQ A;  4MO7 A;  2A3S A;  2DOE A;  3QQA A;  1Z3X A;  2EBI A;  3S3O A;  5D6E A;  4GYI A;  3CF2 A;  3EET A;  3CME I;  1XMX A;  4PFP A;  4ESJ A;  1ERD A;  3V7C A;  4IOA F;  4MQ9 F;  4UVC A;  2JK3 A;  2MLG A;  3TO6 A;  2DMT A;  2ZME C;  2L9S A;  3A02 A;  1S5L C;  3I3L A;  4YFK F;  2W7N A;  5HNH A;  3HSE A;  1FT9 A;  1D1C A;  2IGK A;  3BZ6 A;  5K7F A;  4H0E A;  3JW4 A;  3LAP A;  3ZQC A;  2VE8 A;  2R5Y A;  3TOB A;  4NUB A;  2OA4 A;  4EGY A;  2Q0O A;  4E6K G;  3BQY A;  4XSZ F;  1Y6I A;  4HW0 A;  2J5P A;  2PBI A;  1U2W A;  4A3L J;  1FBU A;  2A6E F;  2V6E A;  2CJJ A;  4FAS D;  2IJL A;  3P9K A;  2HYG D;  2E35 A;  2KJB A;  2M30 A;  1B72 B;  3CCR I;  2DYR H;  2EV6 A;  2DYS H;  2KP6 A;  3IH2 A;  2VOP A;  2DU9 A;  2EFP A;  4E4H A;  2M45 A;  3HDD A;  1I5Z A;  2PJR B;  2HPI A;  5D5V B;  3HKZ A;  3TO9 A;  4IHW A;  1P4W A;  2V9K A;  3PQJ A;  4GO1 A;  2COM A;  2EV5 A;  5GTI C;  3BY6 A;  3L2V A;  2Q2E A;  3VYU B;  1MBJ A;  4NQW A;  5AON A;  3VB2 A;  2IS2 A;  4Y17 A;  1QPI A;  1GXP A;  3I55 I;  2VAS A;  4EJO A;  3CJR B;  2CGP A;  1YW8 A;  4OMZ A;  3WTW C;  2O9L A;  5GP9 A;  3OSG A;  1MMA A;  4HX8 A;  4IZZ A;  3TP3 A;  1TQI A;  3RYR A;  1JHH A;  4NDL A;  2M8E A;  3HSF A;  1BJZ A;  2H1L A;  5IYD J;  3TBI A;  3QU6 A;  5H20 A;  2CH0 A;  2R5Z A;  4IRH A;  3LA3 A;  3VYR B;  4A5N A;  4IX7 A;  1SAX A;  1LB2 A;  3NRV A;  4PSX A;  5HDK A;  3H0G J;  1UAA A;  4KIG A;  1ZAR A;  2R7F A;  1R58 A;  2O3F A;  2DA4 A;  2K3F A;  4LG0 B;  3MD2 A;  4HBL A;  3E6D A;  5DM7 F;  2Z2S B;  4BXU A;  4ENM A;  1P4X A;  4XLH A;  2K3P A;  1FYK A;  3GFI A;  4DNC A;  2VQG A;  4ASN A;  4A3D J;  2ZJP F;  2EWN A;  1X1A A;  2PMZ N;  2QBY B;  1YX3 A;  3M8F A;  3RSN A;  1T95 A;  4UHT A;  2DAO A;  3VOE A;  2H8R A;  2WAQ A;  3MZY A;  4NC8 A;  3S8P A;  5FD6 A;  1MKM A;  3LSK A;  2LD5 A;  1WJ5 A;  1MH3 A;  4BY7 J;  2M2E A;  1QGP A;  2VT3 A;  5D8L B;  1OYI A;  2LY1 A;  4HLX A;  3CC4 I;  3HUG A;  2XB0 X;  4MEY F;  2GXB A;  4HDV A;  2GXG A;  3EUH A;  4DBR A;  1G8X A;  1OR7 C;  4P5O A;  2UUZ A;  1F4K A;  4CH7 A;  2X6X A;  5ICE A;  3CO7 C;  1UJ8 A;  3WU0 A;  4R1H A;  1J9I A;  2ZCW A;  5AIQ A;  3GYH X;  4O6J A;  2ME0 A;  1O7F A;  3OY9 A;  2FSW A;  2MLK A;  5GTH C;  2ELH A;  3WG7 H;  2O5R A;  2QQ8 A;  1D1B A;  1X1D A;  3WGG A;  4IPA A;  2K27 A;  1WVR A;  4UY8 I;  3JAM K;  1R9T J;  3KZZ A;  3TL4 X;  3UR3 C;  3X2Q H;  1X3W B;  4I76 A;  1FOW A;  2V26 A;  2RAE A;  3F8B A;  5CYV A;  3S32 A;  5HVQ C;  3J7Z I;  4XLN F;  3M1C A;  4FX4 A;  4BKX A;  4XN3 A;  3ZN0 A;  4E7K A;  5A2Q K;  4BQA A;  2E2J J;  3LSI A;  2HPM A;  4UB8 C;  1OCR H;  3NWT A;  3G4S I;  2F5E A;  3V7S A;  3KPH A;  4AM3 A;  2EB7 A;  1GHC A;  3DBR B;  4V2G A;  2CV1 A;  4I09 A;  2X4H A;  4QLC U;  1UHW A;  1T0F A;  2FQ3 A;  4OIP F;  4A3M J;  5CKT A;  5LHG A;  4BL0 B;  2K5C A;  3FX3 A;  1RRJ A;  2YPR A;  3DEE A;  5EZG A;  5J4Y A;  3KET A;  2GOX B;  1QPM A;  3D0S A;  2MFZ A;  5JVG F;  3LSH A;  1FEX A;  2IGN A;  1WJE A;  4D1Q A;  1R5I D;  2LMD A;  5LBQ A;  5KHD A;  2BV6 A;  2VN2 A;  4QTR A;  1REP C;  3S2W A;  1Z6T A;  3FXK A;  4XM3 A;  4I99 C;  2ELK A;  1IUF A;  3E1S A;  3CCV I;  3DPT A;  1EH7 A;  3KEQ A;  3QOP A;  2DMU A;  3HB9 A;  3I58 A;  1JTY A;  4XSX F;  3DEW A;  4UUS A;  3VOD A;  3FK6 A;  2ZJQ F;  3K2Z A;  2XUB A;  1HDP A;  1WJB A;  1VFC A;  1V5F A;  2Z1D A;  4GXO A;  4PGH A;  1APL C;  2VPL A;  3F72 A;  4B48 A;  4JK1 X;  5IT3 A;  5EJC A;  1KQ8 A;  2PEX A;  1YJN I;  1PDN C;  1UB9 A;  3BTL A;  3ML6 A;  1N78 A;  2CQ7 A;  4LLN A;  1U5T A;  1LFP A;  4RAF A;  3RCO A;  1BIB A;  1IZ1 A;  2JRT A;  4C2M J;  3R0A A;  1I27 A;  2ETH A;  4XOP A;  1TNT A;  2F4M B;  5J1R A;  3OIP A;  1P4A A;  4IRI A;  2JN6 A;  1JXS A;  3WTS C;  1FC3 A;  4LK1 F;  4KFC A;  3ZMS A;  5E1X A;  3V42 A;  5E1Z B;  4XN0 A;  2XSD C;  3LFU A;  2VQH A;  3ABM H;  3FM3 A;  2Q2E B;  4NC6 A;  5IP6 A;  4HQM A;  3E6M A;  2QUF A;  4A69 C;  4EM2 A;  3E0J B;  4NQW B;  2X1C A;  2XHK A;  2DO7 A;  5DCM A;  4RS8 A;  3GTL J;  1J2X A;  2JVG A;  5C4X J;  4ZYH A;  2O8X A;  2BXY A;  3FK7 A;  2D45 A;  1Z91 A;  4Y52 J;  2HOA A;  2A6T A;  2JRM A;  1MMS A;  4PGG A;  3U2R A;  1KYW A;  2NS8 A;  4AVP A;  3GCM A;  2RQQ A;  5F27 A;  1LPQ A;  3IH3 A;  3RQ4 A;  1I3A A;  2IEK A;  1KU7 A;  3KZI C;  4QPO A;  4KJZ A;  4DYC A;  3DP7 A;  2X9D A;  4ZYA A;  4HF0 A;  4G12 A;  1G3W A;  1UHS A;  3M9A A;  1GDT A;  5DUI A;  1V4R A;  3S1R J;  4HQE A;  5LGN A;  3OYF A;  1DUX C;  2OU2 A;  1HW2 A;  1AA7 A;  5ED4 A;  1OPC A;  3CC7 I;  2YSR A;  1JUS A;  1OYW A;  5F04 A;  3EUH C;  4DQ2 A;  4RGS A;  3BCB A;  3P5J A;  3HRM A;  3IUO A;  1A6Q A;  1FPQ A;  4C2T A;  2DOD A;  2NAZ A;  4KN4 X;  4AID A;  5IPA A;  1YW9 A;  2LR8 A;  2FQ4 A;  3DEU A;  4WXH A;  2E2H J;  4HA8 A;  2DA7 A;  1TWG J;  2F5V A;  3TDZ C;  3A2K A;  1TTY A;  1FMV A;  2K9Q A;  2M8G X;  2QSH X;  1W7P B;  4IQ4 A;  5BNG A;  5FJ8 J;  4QPQ A;  3FXM A;  3T8R A;  2YX7 A;  4K2E A;  2E7W A;  1KYZ A;  1VND A;  2WV1 A;  2XKP A;  4AC0 A;  1JI8 A;  4OIO F;  3R4K A;  3L2U A;  1FSH A;  3HUG B;  3ZMV A;  2QWW A;  3GTP J;  2KRF A;  3KE2 A;  1XMK A;  4CZC A;  2HKX A;  3K4J A;  1C0W A;  2X51 A;  1ODD A; 
#chains in the Genus database with same CATH homology
 4A3G J;  3FKI J;  1GUU A;  3ZOB A;  3JRH A;  1X58 A;  2HOT A;  3HGY A;  5J1Y A;  1MBH A;  3GTJ J;  3Q0V A;  5IP9 J;  3HOW J;  4RBO A;  4XIC A;  3JRE A;  3BTJ A;  5C4J J;  5DS9 A;  2E2I J;  9ANT A;  1ENH A;  5EZH A;  3TED A;  2ZB9 A;  3S16 J;  2MW8 A;  2R5Y B;  1AHD P;  3QPL A;  3JRA A;  1GV2 A;  2XPW A;  1XC5 A;  3B6C A;  1MBE A;  1RET A;  1IDY A;  2NOG A;  3RQI A;  2ID3 A;  1JKR C;  1W0T A;  2XB5 A;  1OCP A;  1ETO A;  1ZGW A;  3S14 J;  1JKP C;  1WGX A;  5F0C A;  3LSG A;  1OJL A;  1EF4 A;  1QRY A;  4M3D A;  1WH5 A;  2EZK A;  1IC8 A;  4FIS A;  3D1N I;  1E3O C;  2VI6 A;  1P7J A;  3G1O A;  4W97 A;  2LKX A;  2KDZ A;  1T33 A;  2Y9Y A;  3NAR A;  5FKL A;  2LTP A;  1LFU P;  2HYJ A;  5C3E J;  1H88 C;  2VKV A;  1IG7 A;  4C3H J;  1XS9 A;  1UG2 A;  2CQQ A;  1RKT A;  3M4O J;  2R93 J;  4FE4 A;  2K9N A;  1NK2 P;  2NVQ J;  4AYB N;  2EZL A;  4MFD A;  2NVX J;  3JRD A;  2L0K A;  3K7A J;  1WH7 A;  2K40 A;  3IV5 A;  3BR6 A;  4J19 A;  3OSF A;  3GTQ J;  1ZR2 A;  2D5V A;  2GLO A;  1MBF A;  2LP0 A;  1JT6 A;  4UUS B;  3SJM A;  1GVD A;  1POG A;  2M34 A;  1DU6 A;  1W0U A;  3E7L A;  2KT0 A;  2R5Z B;  3ZQL A;  1FIP A;  2NS7 A;  2FD5 A;  2X6O A;  3HBL A;  3WHC A;  3HOZ J;  2EZH A;  1F43 A;  5EDN A;  3CCY A;  2GM4 A;  3OOU A;  1H8A C;  3BR2 A;  5K7Z A;  4JX4 A;  5EG0 B;  2DA6 A;  1ORK A;  2MSY A;  5GPA A;  2LY9 A;  4IEJ A;  3BT9 A;  2WB1 N;  3G1M A;  4A3E J;  1Y1V J;  2AO9 A;  1ZKG A;  4M3E A;  1O4X A;  1JT0 A;  3ZQI A;  1FTT A;  2IAI A;  5DTD A;  4DYQ A;  1FJL A;  1MNM C;  4MO7 A;  4D5F A;  4A3C J;  3BR1 A;  3QQA A;  2EBI A;  2K9S A;  4A3J J;  1MSE C;  3GTO J;  3W6V A;  1U9N A;  2JK3 A;  2VKE A;  2R7Z J;  1LFB A;  1MBG A;  3B6A A;  2HI3 A;  2DMT A;  3A02 A;  3PM1 A;  1PUF A;  4S0H B;  5F0F A;  5FKK A;  3HOU J;  1IDZ A;  5HOD A;  2CUE A;  3GTM J;  2XGC A;  3K2A A;  5FKO A;  2E1O A;  5K7F A;  1JGG A;  1TWH J;  5EEA A;  1Q1V A;  3ZQC A;  2R5Y A;  1I6H J;  1HLV A;  2YUS A;  4ABZ A;  3BQY A;  4HNV A;  4XID A;  2JA5 J;  5M5Y J;  4A3L J;  2MG4 A;  4DZJ A;  1UMQ A;  1WCM J;  4BBS J;  2CJJ A;  5M5X J;  1HOM A;  4MIM A;  3MN2 A;  2DA3 A;  2L7Z A;  4BBR J;  4M3F A;  1WI3 A;  1K83 J;  1B72 B;  1H89 C;  2LVS A;  1YRN B;  3IH2 A;  2EQR A;  3HDD A;  4D7N A;  3GTK J;  3VPR A;  4IHW A;  1JUM A;  4FCY A;  2I10 A;  5J3L A;  4C3I J;  1OCT C;  5IP7 J;  2QCO A;  1LE8 B;  4XRS G;  1MBJ A;  4XRS A;  1F36 A;  3HOV J;  4D5C A;  5FKM A;  1QPI A;  1I50 J;  2L7F P;  2MGQ A;  5J1U A;  1GV5 A;  3LSR A;  2P81 A;  2Y0S N;  5IYB J;  2O9L A;  5GP9 A;  2N8G A;  3OSG A;  1BW6 A;  3PO3 J;  1XG1 A;  3TP3 A;  1X2N A;  4NDL A;  3UKG A;  1BJZ A;  5E3N A;  1SFO J;  5IYD J;  2LFB A;  2TCT A;  2H1K A;  4A3F J;  4M3G A;  2R5Z A;  1BW5 A;  2M0C A;  1NK3 P;  1D5Y A;  3H0G J;  5F0H A;  1HCR A;  3BTI A;  2YU9 J;  1ETQ A;  2YS9 A;  4B1R A;  5EG0 A;  3GTG J;  2CU7 A;  4C3J J;  4D7M A;  3LNQ A;  5E3L A;  1AKH A;  4M6V A;  3GBG A;  2DA4 A;  4UUT A;  3L1P A;  3JRI A;  3I4M J;  2XRL A;  2DA1 A;  4LOC A;  3A01 A;  2R0Q C;  3S1N J;  2DN0 A;  1U8B A;  2VPR A;  1ETX A;  4AUX A;  3F0C A;  2JMW A;  2CRG A;  4A3D J;  2FX0 A;  3ZQG A;  2PMZ N;  4BY1 J;  2E19 A;  2JA6 J;  3BR3 A;  4CYC B;  1ETV A;  2ID6 A;  3TW6 A;  4B4C A;  4Y7N J;  2H8R A;  4IHY A;  3I4N J;  3JR9 A;  3O8G A;  2AHQ A;  5EGO A;  2LD5 A;  5JLX A;  3Q0U A;  1MH3 A;  1IGN A;  3FIS A;  4L5E A;  4BY7 J;  3TW7 A;  2M2E A;  1B8I B;  2QF7 A;  4IHV A;  2LLK A;  2JJ7 A;  1IV6 A;  1QVT A;  3MVP A;  2DMP A;  1JKO C;  1VF9 A;  2XB0 X;  2X48 A;  2ECB A;  1RKW A;  1TWC J;  2JA7 J;  2Y31 A;  3SFI A;  1VI0 A;  3NAU A;  1ETW A;  1ZK8 A;  4QSH A;  3S15 J;  3JRG A;  1B72 A;  2ME0 A;  1IRZ A;  3BG9 A;  5F1J A;  3S1Q J;  3LOC A;  5IOY A;  3BG5 A;  3JRC A;  1R9T J;  4I76 A;  1RPW A;  5C44 J;  2JWT A;  2RAE A;  1K61 A;  3BTC A;  1ZQ3 P;  5M3F J;  1LE8 A;  5EYR A;  2HOS A;  1Z77 A;  3H3V K;  4BKX A;  3RKQ A;  2E2J J;  2HDD A;  2L7M P;  4RDU A;  1ZR4 A;  5GPC A;  4W1U A;  4V2G A;  1TWF J;  2IBD A;  5FKN A;  3HEF A;  1U78 A;  2DMN A;  4MFE A;  4A3B J;  4A3M J;  1GT0 C;  3WHB A;  2L9R A;  2ME6 A;  4A93 J;  1RES A;  5EZG A;  4A3I J;  1MH4 A;  5K7H A;  2XPU A;  1FEX A;  1JUP A;  3BQZ A;  1PUF B;  4JX6 A;  5M3M J;  4QTR A;  5FLM J;  1BL0 A;  2ELK A;  4DW6 A;  3S2D J;  1IUF A;  2Y30 A;  1FTZ A;  2DMU A;  1CQT A;  4DYR A;  3HB9 A;  5E3M A;  2EZI A;  1U9O A;  1JTY A;  4V2F A;  3DEW A;  4UUS A;  3FIW A;  3FK6 A;  1Y1W J;  1A5J A;  2G0E A;  3Q3S A;  1G2H A;  3IH4 A;  1HDP A;  3CMY A;  1VFC A;  2DTZ A;  1A6I A;  1FIA A;  3ZQH A;  1APL C;  1MSF C;  2XGE A;  4CYC A;  2HXO A;  4EEF G;  1HDD C;  2TRT A;  2Y9Z A;  1TWA J;  1TC3 C;  3BTL A;  2O7O A;  4C2M J;  1T56 A;  2XGD A;  5F08 A;  2NVT J;  3C2B A;  3BR5 A;  4FTH A;  2Y2Z A;  1JKQ C;  1B8I A;  5J1R A;  3DCF A;  3S1M J;  2OF7 A;  2XPV A;  3JRB A;  2JN6 A;  4DZP A;  2B63 J;  4M3B A;  3O8H A;  3JRF A;  2XSD C;  1SAN A;  2ECC A;  3PO2 J;  2COB A;  2CQX A;  3TP0 A;  1JTX A;  5IP6 A;  4A69 C;  5JLW A;  4X1E A;  3CQZ J;  3GTL J;  3HKZ N;  2OPT A;  5C4X J;  3FK7 A;  3Q0W A;  4XK4 A;  4Y52 J;  2HOA A;  3G1L A;  4JP0 A;  4JYK A;  2EH3 A;  3LSP A;  2NS8 A;  2HQ5 A;  3HOX J;  2FJ1 A;  3A03 A;  4A3K J;  2HXI A;  4XRM A;  5F27 A;  5M5W J;  3HGG A;  3CDL A;  3IH3 A;  1ETY A;  1I3Q J;  2IEK A;  2DA5 A;  4DYC A;  2R92 J;  5IOZ A;  2LK2 A;  2X9D A;  4X6A J;  1AU7 A;  3M3Y J;  4G12 A;  2JA8 J;  4IHX A;  1UHS A;  1DU0 A;  1OFC X;  1GDT A;  3S2H J;  3LSJ A;  1ETK A;  1IJW C;  3S1R J;  1ITY A;  2CUF A;  3BR0 A;  1AKH B;  4MLO A;  1X2M A;  5E3O A;  2O8K A;  1S7E A;  4I6Z A;  4QIW N;  1YRN A;  3HOY J;  1JUS A;  5F04 A;  3QPS A;  4JX5 A;  3BG3 A;  3A01 B;  3ZQF A;  3RZO J;  1MBK A;  2DA2 A;  2M9H A;  5IPA A;  1BA5 A;  2DMQ A;  2GBY A;  2LR8 A;  2FQ4 A;  3HM5 A;  2E2H J;  2DA7 A;  1TWG J;  1JJ8 C;  3RZD J;  4B3A A;  5FLV A;  1Z0X A;  2K9Q A;  2M8G X;  3OIO A;  5FJ8 J;  5BNG A;  4GFB A;  1HF0 A;  1NTC A;  1WPK A;  4FE7 A;  1ZTR A;  2DJN A;  5EGO B;  1P7I A;  1VND A;  2WV1 A;  2VUM J;  1JJ6 C;  3MKL A;  4AC0 A;  2NVY J;  5EF6 A;  1QVU A;  3S17 J;  3GTP J;  4BXX J;  2W48 A;  1RR7 A;  3SDG A;  2WAQ N;  5IYC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...