4GFBA

Rap1/dna complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
238
structure length
218
Chain Sequence
HNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPRPGVPTPGNYNSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA-binding protein RAP1
publication title Effect of Rap1 binding on DNA distortion and potassium permanganate hypersensitivity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 56
structure length 218
sequence length 238
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF09197 Rap1-DNA-bind Rap1, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4gfbA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4gfbA02
1W0TA 1MBEA 3HGGA 2AO9A 1AU7A 4HNVA 1WPKA 4XRMA 4IHWA 3G1OA 5C3EJ 2H8RA 3S2HJ 3H3VK 2NOGA 3HOVJ 2L7ZA 2JA5J 1NK3P 3S2DJ 1A5JA 2K9SA 1IUFA 2YU9J 1JKQC 1IRZA 4B1RA 4FISA 1QVTA 2Y9YA 2L0KA 3MKLA 3SFIA 2XPWA 1B72A 3IH3A 5M5XJ 1JKRC 1MH4A 4M3EA 5IP7J 2DMPA 3HOWJ 4A3BJ 4JX4A 5GPAA 1JUSA 3HKZN 2EQRA 2TCTA 1MSFC 3OOUA 1A6IA 3A01A 1BA5A 2W48A 2GLOA 3S16J 1JUPA 5FKOA 3RKQA 2QCOA 1FEXA 1TWCJ 4M3BA 3E7LA 1JT0A 2LK2A 9ANTA 2M9HA 3BR0A 1IV6A 2LLKA 1FTZA 4MLOA 1Z0XA 2H1KA 1YRNB 2DA1A 1H88C 2JK3A 1ETYA 3BR6A 4A3FJ 1JJ6C 1X2NA 2E19A 2JA7J 3JRFA 1Z77A 1Y1WJ 5F0FA 5EF6A 3GTPJ 3BQYA 3JRDA 1GV5A 4C2MJ 1OCTC 3W6VA 2K40A 1G2HA 1VNDA 2HOTA 1U9NA 4I76A 2XSDC 4MFEA 3HB9A 4FE7A 2DA4A 3I4MJ 1VF9A 5EZHA 3IV5A 1RETA 1WH7A 2P81A 5EZGA 4D5FA 3JREA 3HGYA 3PM1A 5IYDJ 1GDTA 1HDPA 3DEWA 1XG1A 3OSGA 3HM5A 2HOAA 3H0GJ 3FISA 3FIWA 4M3DA 4G12A 2MSYA 4A3GJ 2VKEA 4FCYA 1NK2P 2NVYJ 4JYKA 2Y30A 1EF4A 2IAIA 5J1UA 3RQIA 3OIOA 4DYCA 1FIAA 4A3KJ 3C2BA 2GBYA 1LE8A 1BW6A 4V2GA 1JKOC 2CRGA 4C3IJ 1UHSA 3LOCA 4X6AJ 4LOCA 4W1UA 2XB5A 4B3AA 1ETXA 1ZTRA 3JR9A 2CUFA 5EG0A 1TWAJ 1LFUP 3S1QJ 2VI6A 1I50J 2Y9ZA 1PUFA 1POGA 3UKGA 2R93J 3BQZA 1TWGJ 1RR7A 3A03A 2ECBA 5F27A 1JJ8C 3A02A 4CYCB 3JRBA 2LTPA 3QPLA 5HODA 3GTKJ 2I10A 3S14J 1AKHA 4BKXA 5F0CA 2R5YB 2ELKA 3HDDA 4UUSB 3RZDJ 1TWFJ 3S1RJ 2R7ZJ 5FKKA 2FD5A 5EYRA 4XICA 1T56A 4DZJA 1HLVA 5FKLA 1RKWA 4DYQA 4Y7NJ 2CUEA 4A3JJ 5GPCA 3O8HA 5FLMJ 5IOZA 3BTLA 1ZK8A 1ORKA 5J3LA 2DTZA 1AHDP 2ZB9A 3OSFA 4A69C 1CQTA 3JRIA 1D5YA 1HCRA 2IEKA 4J19A 4AC0A 2RAEA 3ZQCA 1ITYA 2NVTJ 2M2EA 3PO2J 3S15J 3CQZJ 1B8IA 2E2IJ 4D5CA 1I6HJ 1QRYA 1OFCX 4XIDA 5DS9A 1B72B 2FX0A 4D7MA 5EGOA 2HQ5A 5FJ8J 3I4NJ 2JA8J 1SANA 3GBGA 3CMYA 1MBGA 2DA2A 4BBSJ 2DA7A 1OCPA 2FQ4A 5J1RA 3M4OJ 3BG3A 1MH3A 5FKNA 1JT6A 2KDZA 3NARA 1RKTA 3A01B 1SFOJ 4JX5A 4A3MJ 2VKVA 2M8GX 3L1PA 4D7NA 2HYJA 5IOYA 1OJLA 1VFCA 3HOYJ 2MG4A 2JN6A 2LR8A 3Q0VA 5IP6A 4BXXJ 1W0UA 2K9NA 5IP9J 1QPIA 2R5ZA 3TEDA 1TC3C 4V2FA 2QF7A 1ENHA 4W97A 2LY9A 3LNQA 2PMZN 2K9QA 2DMTA 3FK7A 1XC5A 2EZKA 2OPTA 5E3LA 4RBOA 1FTTA 2E2HJ 2ME6A 1Q1VA 1Y1VJ 2ME0A 2M34A 4QSHA 2LKXA 2X9DA 1WGXA 3LSPA 4DYRA 1GVDA 5IPAA 4FTHA 3HBLA 1U8BA 2YUSA 4I6ZA 2YS9A 2JWTA 4QIWN 1H89C 1ETKA 5EDNA 3BTJA 5C4JJ 2HOSA 1K83J 2NS8A 5DTDA 1LE8B 2E1OA 2HI3A 2X48A 3F0CA 3B6CA 3SDGA 3CDLA 1WCMJ 2XGDA 1S7EA 3G1MA 4A3DJ 1ETWA 1R9TJ 5EG0B 1MBHA 5K7HA 4GFBA 2HXIA 3O8GA 1JTYA 5JLWA 1JKPC 4A3LJ 1X58A 4AYBN 1I3QJ 1ZQ3P 2WV1A 4BY1J 1XS9A 1PUFB 5E3MA 3S1MJ 1MBFA 2L9RA 2IBDA 3CCYA 1U9OA 5F04A 3ZOBA 2VUMJ 2XPUA 1GV2A 1IGNA 3JRGA 1BJZA 1VI0A 2E2JJ 3BR1A 3BT9A 2EBIA 5E3OA 1HOMA 4XK4A 2L7FP 3IH2A 4M3GA 1AKHB 2AHQA 3WHBA 1MBJA 1WH5A 3LSRA 4DW6A 1BW5A 3BG9A 3GTQJ 1LFBA 2DA3A 1QVUA 3HOZJ 1JUMA 2OF7A 2X6OA 2LD5A 2Y2ZA 3D1NI 1F43A 2DN0A 2XB0X 1FIPA 2O8KA 4IHYA 2JA6J 4NDLA 3FK6A 3HOXJ 1WI3A 3ZQLA 1ZR2A 3Q0WA 4X1EA 1APLC 5JLXA 2LVSA 2N8GA 1B8IB 3NAUA 1MBKA 1JGGA 4S0HB 3FKIJ 3ZQGA 1TWHJ 5M5YJ 2CQQA 1ZKGA 3M3YJ 5EGOB 3GTOJ 5GP9A 2D5VA 1F36A 5K7FA 5FKMA 2WAQN 2XPVA 4UUTA 3ZQHA 1E3OC 4JX6A 3Q0UA 3TW6A 5J1YA 2HXOA 3JRCA 1DU0A 4ABZA 1IG7A 4A93J 5E3NA 4DZPA 3TP0A 1IDZA 4A3EJ 2L7MP 1H8AC 2KT0A 5M3MJ 1T33A 4MO7A 3MN2A 3G1LA 1NTCA 4JP0A 1FJLA 1P7JA 5F08A 5FLVA 4BBRJ 3JRHA 2DMQA 4M3FA 5M5WJ 2ID6A 1IJWC 2NVQJ 3BTCA 2DA5A 3GTMJ 3JRAA 1RPWA 2R5ZB 2DA6A 3IH4A 4XRSG 2HDDA 5BNGA 3HEFA 2MGQA 1ZGWA 4C3HJ 4IHXA 1IC8A 2LFBA 4A3IJ 1U78A 3SJMA 3S17J 3LSJA 3Q3SA 1GUUA 3QPSA 2R0QC 5F1JA 1MSEC 4IEJA 1O4XA 5M3FJ 4IHVA 2LP0A 3TW7A 2DJNA 1ZR4A 1YRNA 4RDUA 3B6AA 3RZOJ 2FJ1A 2EZHA 1ETVA 4B4CA 3K2AA 1DU6A 3GTLJ 4QTRA 2GM4A 4AUXA 1ETOA 3WHCA 2MW8A 4Y52J 2NVXJ 2Y31A 4MFDA 4L5EA 3HOUJ 2XRLA 2XGCA 3MVPA 3DCFA 1BL0A 4A3CJ 2B63J 5IYBJ 3ZQIA 1IDYA 2EZIA 2EZLA 3BTIA 2TRTA 1K61A 2M0CA 3BR3A 1ETQA 2DMUA 2CJJA 3ZQFA 3BG5A 2COBA 5K7ZA 1HDDC 2Y0SN 2R92J 2NS7A 3LSGA 2O9LA 5C4XJ 4BY7J 3VPRA 2JMWA 1GT0C 1HF0A 1MNMC 2XGEA 3BR5A 2WB1N 3TP3A 4EEFG 3GTGJ 3BR2A 2ID3A 4M6VA 2O7OA 5IYCJ 3QQAA 1X2MA 4MIMA 2JJ7A 3S1NJ 1UG2A 3PO3J 5C44J 4CYCA 1RESA 1JTXA 3K7AJ 2ECCA 4XRSA 2CU7A 4FE4A 2G0EA 3GTJJ 2CQXA 4C3JJ 2R5YA 1UMQA 2DMNA 5F0HA 2VPRA 1P7IA 4UUSA 2EH3A 5EEAA
chains in the Genus database with same CATH superfamily
2MH2A 3JSPA 3HOTA 1FNNA 1WJDA 4LB6B 2FNPA 2R7DA 3VOEA 1MD0A 1WPKA 2FF4A 3F6VA 5C3EJ 3ZPLA 3TL4X 2IVMA 2ZC2A 1EH8A 2QYOA 3OYLA 2R7XA 4EJOA 5CVRA 1K7AA 3TOAA 4HAMA 4ZYDA 2L7ZA 1RC9A 3KP3A 1RRJA 4ESBA 1YI2I 1GXPA 1BBYA 2IP2A 4K2EA 2L0KA 3MKLA 2HGCA 1KQ9A 2XPWA 2DT6A 4BS9A 2VQCA 3H92A 5M5XJ 1JKRC 3WG7H 4IHTA 1WJ5A 3I9V2 3I55I 5IT3A 1TL8A 4WXDA 4ZYGA 4I0BA 5ICEA 3GZ6A 2ADUA 2XAQA 1YS6A 3HKZN 1KYZA 2EQRA 2HFHA 2IXSA 4E7IA 3OOUA 4F91B 2W48A 2VBZA 4C2TA 3J80K 5FKOA 3C2HA 3ZMVA 2LKPA 2KZGA 2UWMA 1FOWA 3E7LA 2LK2A 1DP3A 2LLKA 1IXCA 1XSDA 3KEOA 3L9FA 2DDAA 4CCKA 3S3OA 2M8EA 1XCBA 4X0GA 3I5UA 2DA1A 2LH9A 1ETYA 4B09A 3I54A 4CZCA 1Z77A 3HZJA 4XMYA 4XLNF 2IS4A 3BQYA 1E17A 5BMZA 1HW1A 3W6VA 2K40A 3HSFA 1G2HA 2X1DA 2XSJC 2HOTA 2KJBA 2XSDC 2G7HA 2H94A 3LFKA 2VL8A 4R79A 3W2AA 2PJPA 1XGNA 2P81A 3E5QA 1R22A 3KX2A 3PM1A 3HM5A 3FIWA 2O5RA 4RGSA 3T5XA 2AQEA 1X4PA 3BZKA 1GLNA 3ABMH 2ZMEA 5J1UA 5LEKA 1VQ7I 2QBYB 1FIAA 3C2BA 3PL8A 1LE8A 2X85A 2Z2SB 1ZG3A 3FZVA 1JKOC 4C9YA 5DCFA 5ICFA 2NS0A 3ECOA 2ZXWH 5J4VA 1ETXA 4P55A 4PSWA 3JR9A 2M7AA 4OU0A 4PGGA 2DBBA 4LLNA 2GIVA 2CSOA 1FYKA 2VI6A 2F2EA 3DTKA 3LFUA 5DD4A 2Y9ZA 2E60A 3SEQA 1IN5A 3UKGA 2DODA 1R71A 4PFPA 2ECBA 1S7AA 1MJ9A 4CYCB 4XOPA 1W5TA 1W7PD 2X6YA 2Z99A 3JW4A 4DOZA 5F0CA 2HVRA 4UHTA 4OAYA 3HDDA 1ON1A 3GFLA 2DW4A 3IC7A 4CGZA 1MDMA 1V55H 1D5VA 4DZJA 3GXOA 1R1TA 1M1EB 1XGOA 4DQ2A 2V9VA 2FA5A 2P8TA 3O8HA 3PNYA 2BZTA 3PUBA 1E0EA 5ED4A 1H9TA 3BTLA 1ORKA 1TT0A 2DTZA 4ZZLA 5DYMA 1HCRA 3JRIA 1D5YA 2X4HA 1CF7A 2IEKA 5DD8A 2RAEA 3ZQCA 2NVTJ 2M2EA 3PO2J 3S15J 2VJJA 1MNEA 3CQZJ 3M8FA 4IJAA 3EQLF 3HHHA 5FB2A 1PP7U 1OFCX 1JI8A 3FF5A 5J40A 4A0YA 1ACIA 3QWLA 4CSWA 5BS6A 2VJ5A 3M8EA 4P96A 3GBGA 3CMYA 1MBGA 3HTUA 2DA2A 2JVHA 2A68F 2DA7A 3BJAA 5E17F 3U21A 4KMFA 3GF2A 3J80Z 2KDZA 2L02A 4NUBA 4JX5A 5EEGA 4EGYA 1REPC 3EUKL 3E6DA 4II2A 3WTUC 3V7CA 4MHGA 1OJLA 3BLYA 3HOYJ 2VBXA 3F8MA 3K4BA 2V6CA 3IRQA 3QAHA 2W1OA 4MEYF 4G9YA 1S5LC 3CO7C 4E7KA 4U0YA 4BQAA 4HF1A 5AIQA 2OD5A 2ZXIA 3PSIA 4G6DA 4M9SA 5JFRA 1TC3C 2QF7A 1AWCA 2LY9A 2M87A 4P5OA 3SZPA 2DFHA 3LNQA 3QPHA 2ZJRF 2DMTA 4Z2YA 3CMMA 3H36A 2EZKA 2OPTA 2KDOA 2OQRA 4U0WA 5E3LA 1BC7C 1SEUA 1I1GA 4C2UA 3ABLH 2IRFG 3FM3A 3CLOA 1OYWA 2XF7A 2VOPA 4FX0A 1TBXA 3LSPA 1WGXA 1USTA 2KQRA 4FTHA 2ZKZA 3HSEA 3HBLA 2V1DA 3Q9SA 1J2XA 5CJ9A 2IA1A 5CPRB 3FX3A 5EDNA 2DYRH 2ZMEB 2W7NA 2GWRA 5C4JJ 2C6YA 5LHIA 3WG9A 2BBYA 2NS8A 4CCLA 1LE8B 2IJLA 2EFPA 2X48A 3TKYA 1LPQA 1PUEE 1EH7A 3SDGA 3TDUC 1WJBA 2IA0A 1YIOA 1ZGJA 4DBRA 5K7HA 4RLQA 3LSKA 5FFXA 4GFBA 2VXDA 2PJRA 1JTYA 4Z6YA 4PJLA 1ZREA 2VASA 3IAM2 4A3LJ 3S3MA 5GADJ 3KLOA 5E3MA 3S1MJ 3CCYA 2HWVA 5J4YA 1W5CC 1IGNA 2FBIA 1HW2A 4BE0A 5HOOA 1ZARA 2E2JJ 2VQGA 3BT9A 2DOEA 1E3PA 1HOMA 1A6QA 4TV7A 1YLFA 1RI7A 2K27A 3K4KA 4AVZA 5BPDA 2RN7A 1B6AA 3DLLF 1B59A 2LY1A 3ZN1A 4AVPA 4ZC3A 5HLHA 4AU7A 1SFEA 2CW7A 2DA3A 5BOXA 1QVUA 1MDMB 3HOZJ 4IVNA 4IXAA 4BU2A 1YYVA 3DBHB 1IV8A 3VODA 2ZJ2A 2DAOA 1Q1HA 1DGRM 3F9KA 2XB0X 3HRMA 4BACA 4CHUA 5CQGA 2E34A 1I27A 3F6OA 3FK6A 1XMXA 1ZR2A 1CF7B 2F4OB 3J7ZI 3OS2A 2WAFA 5JLXA 1I3AA 1RZ4A 4ESJA 2LVSA 1T6SA 3IUOA 3GO5A 2ISYA 2L2OA 1TQPA 1UHWA 2CQQA 3L09A 4BE2A 1OCCH 4BAYA 2X6XA 3CMEI 3V8KA 5GP9A 2D5VA 3KCCA 3PJRA 4WF2A 1B9MA 2B0LA 2WAQN 2ZMEC 1E3OC 2H8WA 1DU0A 4RM2A 2HXOA 1KQ8A 2BGCA 4ABZA 1FT9A 1Z91A 4HQEA 3TP0A 2DQLA 1SAXA 2R7SA 2L7MP 5ICGA 1H8AC 1IDZA 2RNGA 1P4AA 2ZXHA 1ZH5A 3MN2A 3G1LA 1WI9A 4HNTA 2IT0A 2NRAC 4HA8A 1D1BA 1TZLA 3D5LA 3BTCA 3BZCA 4ON0A 3AKZA 4UV9A 3GTMJ 1X3WB 4BJTA 1RPWA 5HS7A 2CV0A 2D1HA 2DA6A 3A0BC 3ERMA 3IH4A 1H9GA 1R5ID 4D1QA 2LFBA 1W7PA 5FRNA 4A3IJ 4WK8F 4LITA 3VWBA 1I6XA 5GTIC 1D0YA 1R23A 1AOYA 2CW8A 4G7HF 2PN6A 3Q3SA 3CF5F 3QPSA 4CCOA 4L9TA 1WJCA 4KT6A 1BOAA 1YTYA 2D1VA 1G4DA 2O6GE 5TGTA 1TW2A 5J8FA 3TW7A 4ZDPA 4XSXF 4N4OB 4RDUA 4KIBA 3SQNA 2EZHA 2F5FA 3AG3H 1T0FA 3MMYB 1OKRA 4Y17A 4B4CA 3WU1B 3H9GA 2WBMA 2A3SA 1RNLA 2EV6A 4QTRA 1HA8A 1WZ2A 1PYVA 4OMYA 4DJAA 2MW8A 3W6JB 1R6RA 1TLHB 2KHMA 1WWXA 2XKPA 3HSRA 5LGUA 5D5VB 2Y31A 1LQ1A 3M1CA 1T95A 1QHHD 2IA2A 4E6KG 2JZYA 1BL0A 4KNYA 1SD4A 2PJRB 3F23A 1WJAA 4I98B 4S04A 2Z9OA 5HS8A 1K6YA 5A2QZ 4G7ZF 2DMUA 2VIXA 3ZQFA 2CW0F 3BG5A 3WTWC 1YJWI 5CVIA 3G2BA 1LKXA 1BIBA 4BY7J 4CCMA 1UB9A 1FZPB 2XAFA 2B9SA 3OIPA 3VYSB 1HF0A 4M71A 1ZAOA 1FYLA 1O7FA 5DUIA 5E79C 4EEFG 4GXOA 2OUMA 1E2XA 2ID3A 4V19K 4EV0A 2PI0A 1U5TC 4E7ZA 4KISA 3FXLA 1J75A 1RESA 1MNDA 2M0MA 3LA7A 4EJWA 3P9IA 2QA4I 3W6KB 3C18A 1D0ZA 2R5YA 3PUFA 1UMQA 2DMNA 4PFOA 1VQNI 2VPRA 3KP2A 4LGWA 4UUSA 3OMYA 1R58A 3MEXA 5EEAA 3FMQA 2O03A 2XASA 4F52A 3HXLA 5JI6A 4IX7A 3HGGA 4HF0A 3VEPA 1LVKA 4XRMA 1PP8F 4ZDOA 3BC8A 4ENKA 3RKXA 5L3CA 2H8RA 3S2HJ 2NOGA 2KIQA 1LEAA 2JA5J 1BN5A 2K9SA 1YIJI 3L7WA 1JKQC 1WQ2A 4B1RA 4FISA 4LD5A 3QP5A 2CV2A 1IRGA 1OLTA 3FWEA 3FDYA 3MQ0A 4PDKA 4KITB 3F21A 2K9LA 4UVAA 2XRNA 5KK1A 4F93B 4M3EA 1ZHFA 1KA8A 3E0JB 3HOWJ 3CUOA 3J7YJ 3HHGA 4A3BJ 3N05A 5GPAA 2QUFA 1JUSA 3IKVA 3WU0A 4HX7A 1PJRA 3M9AA 2LNBA 3FBIB 1OR7A 1JHHA 1ZGAA 1BA5A 1JUPA 2EINH 5D5UB 1VQ5I 1W7PB 3WTYC 5LFAA 5L3FA 4IKFA 4CUGA 2M3AA 2JSPA 3BR0A 2F5DA 2RGVA 5K5OA 3RYRA 2STTA 2JK3A 1YFHA 3WGIA 4A3FJ 3VYTB 3ERED 2E19A 3NWTA 2JA7J 3JRFA 2K3PA 4YRVA 1ZRFA 2E5ZA 1O57A 3DKXA 3EETA 2E7WA 5F0FA 5EF6A 2TDXA 3ZCOA 1QU3A 4LK1F 3DWLE 4C2MJ 1RUOA 2KIFA 2ESNA 2KMUA 3I4PA 4I76A 1J7KA 3SHFA 2QQBA 4FE7A 3KEYA 1S72I 4E7SA 3RDIA 3A0HC 3DPTA 1P4XA 1RETA 4WXHA 4U87A 4D5FA 5L3BA 3JREA 2DTRA 2LRDA 3HGYA 5HDNA 1GDTA 3TQNA 2QKLB 1FWZA 1OYIA 3ZMUA 3OYGA 1FPQA 3FISA 2IPQX 3K1MA 3WE2A 3QOPA 3CP8A 1N75A 2QQAA 2V1NA 4DIQA 5LRSA 2LY2A 4JYKA 2Y30A 3ZQ7A 3FMSA 2KRCA 2EIJH 4ESFA 3OYAA 2KLOA 2XKOA 3JTHA 1MJAA 3GYHX 4ZTFA 4M6XA 2DCEA 1MKMA 2OCCH 2QBYA 4H0EA 5FLXK 3LSHA 1BW6A 2K7LA 2LF7A 4V2GA 2ZSIB 5E1WA 1QBJA 3H9QA 4X6AJ 4WCGA 1DDNA 1IN8A 4RA2A 2CUFA 4XR6A 2VE8A 1TWAJ 2L4AA 2DOAA 2DFFA 2JPCA 1LFUP 2E36A 3FXUA 2EK5A 3DV8A 1TP4A 2M7BA 1POGA 3PIOF 1P92A 3GMEA 2O61A 1T98A 4JOMA 3MAJA 2M1BA 3A03A 3P7NA 4ZYHA 2WY7Q 4AIKA 4BNCA 2FOKA 2W00A 3JRBA 3QYFA 2Z16A 4AIDA 3RJPA 2VC0A 1Z7UA 4EVIA 1JHFA 2JPBA 2J5PA 1XTAA 3KLNA 1AKHA 3R6SA 1EJ9A 4RM3A 4BKXA 2R5YB 2JQ7A 1T38A 2X1CA 2XF6A 4OIRF 3LSIA 5D8LB 4UUSB 3RZDJ 1FOKA 4QPQA 4IQJA 4UVCA 5EYRA 1T56A 3GVAA 5LGTA 5E20A 5FKLA 4DYQA 4Y7NJ 2Z33A 4HOBA 4IPAA 2FXAA 4Q5SF 3WGGA 3OYFA 1MMSA 3BROA 3ZXSA 1UFMA 2XHKA 4ZTJA 2WB1A 1QO0D 1ZK8A 2HDCA 2H6CA 1CQTA 1XB4A 2K02A 2VQHA 1WKMA 3WTVC 3ZMTA 4L0YB 4F3QA 3F72A 2E2IJ 4D5CA 2ZJQF 2ACJA 2W82A 1QRYA 1FLIA 1Z3YA 2QLZA 2FX0A 3S2WA 2OU2A 2V4JC 2HQ5A 5EGOA 2QKMB 1IF1A 4KA4A 3IP4B 3I4NJ 3X2QH 3HG9A 5E1XA 4YIIA 1RUNA 4BBSJ 5J1RA 1OCPA 2KFDA 2E5NA 1MH3A 4NHJA 5GAEJ 1JT6A 2GA1A 4J01A 3RYPA 4A3MJ 1KZHA 2VKVA 2M8GX 4D7NA 2HYJA 1VFCA 3LA2A 3WTZA 3DU5A 2MG4A 2COMA 2EV0A 2MD5A 1QZYA 2DK5A 4CZZA 3D0SA 2WY8Q 4M74A 3DQVC 4HBLA 5FRMA 3W2VA 3BWGA 5IP6A 4BXXJ 1W0UA 2K9NA 3L2CA 1Z67A 1QPIA 2DQRA 3NRVA 3GLLA 2K85A 2GZWA 1HC8A 2OZ6A 4MQ9F 4YFNF 4BUPA 2HYGD 4XKWA 1MMGA 3KYDB 4RB1A 4XONA 2PLYA 3K69A 3OYMA 5L3GA 3HKZA 4ZDLA 2E2HJ 1B1BA 2BEOA 4G94A 1Q1VA 4I0AA 5LEJA 1R5HA 1Y1VJ 1G59A 3ZR8X 1R4NB 1R4MB 3HPGA 4QSHA 4WWCA 3P5JA 1DUXC 3HC7A 2VB6A 3B02A 5KAIC 2CQ7A 2L9SA 1X1AA 1HSJA 1H89C 2VC1A 2BY3A 2BY2A 4WXCA 5FLXZ 1MW7A 2Y69H 2CYYA 1J59A 1ZRCA 1XMAA 1IN7A 1KU3A 2ZSHB 2E1NA 2HI3A 5DCMA 2E35A 4BXUA 2X6WA 3A1YA 2MABA 3OR1C 3CDLA 3I71A 1FY7A 1WCMJ 2O3FA 3CF2A 3J81Z 1SFUA 2W84A 2F5CA 1IRXA 2H1LA 1MBHA 2K4JA 1QZEA 3FXMA 3O8GA 2EFNA 1FOYA 1X58A 4AYBN 2V6EA 3SXYA 4BL0B 1L3LA 4L5IA 3K1NA 1MBFA 3H3ZA 4OMZA 2IBDA 4RAFA 1SFXA 5F04A 3ZOBA 1UAAA 4KDPA 3J7AY 5IT9K 2EFQA 1OR7C 4G7OF 2XUBA 3BJOA 1BJZA 3JRGA 2B7EA 4BHBA 3BR1A 2WADA 2VKHA 2NXNB 1IUYA 1AKHB 4IHSA 2FNAA 5LBQA 2XC7A 1J0RA 3HJEA 4CYDA 1S6LA 3WHBA 5JHFA 3LSRA 1P9QC 1O3SA 3CESA 3BDDA 3J7AO 3R60A 2X6OA 3I58A 3HL2A 3CJQB 1W1WE 3DXJF 3I59A 3VFZA 4E7LA 4I2OA 4HSRA 4NBQA 4KICA 1MMDA 5TRDA 1VQPI 1Z1DA 3BG6A 1FIPA 3HRTA 4IHYA 2JA6J 4BEHA 1VQ9I 3HOXJ 3Q0WA 3VYRB 4E7HA 2K9MA 1APLC 2W24A 2OCEA 4N9IA 3MKZA 2N8GA 5E1ZB 4B3XA 4AIJA 1S8NA 1QZZA 1T2KA 3RKWA 5HNHA 1JGGA 3ZQGA 1IO2A 2MC4A 1TWHJ 4Y15A 2FBKA 5EGOB 2HTSA 3MKWB 3K4LA 1F36A 2OQGA 4LLLA 2F5VA 3ZQHA 3Q0UA 3TW6A 1YW8A 3OIQA 3FXJA 3Q9VA 1D1CA 4A93J 5E3NA 4BGDA 3CDHA 1KONA 2HS5A 4A3EJ 2F4MB 3E3VA 4G8XA 5M3MJ 1T33A 2VKDA 3WTSC 4KIFA 2VOOA 2XGXA 4KT5C 1QQIA 3OOPA 4JP0A 1VZ0A 1X3ZB 3LAPA 3AG2H 2DMQA 4M3FA 3DPLC 3ZQQA 2ID6A 3KFWX 3KZYA 5AONA 4B48A 1W36C 2NYXA 3M8JA 3KYCB 1X4OA 4B43A 3H0DA 5KHDA 2QQ8A 3PFYA 1ON2A 4XRSG 1Z9CA 2R7VA 4PJ0C 5BNGA 3QOEA 1USSA 1I5ZA 1QHGA 3ISPA 3TBIA 3C2GA 4NC8A 4ENMA 1U78A 3R4KA 1EA3A 2KRFA 4Q48A 3S17J 1ULYA 3LSJA 1BR4A 2RQPA 2A6HF 3D5SC 4Y13A 2QSFX 4IHVA 4ETSA 1FMVA 2LP0A 2ELHA 4AWXB 4HDUA 2DJNA 5HLGA 3B6AA 2FJ1A 2VBYA 1YOVB 4KJZA 2XAJA 3QP6A 1ETVA 5TJJA 3CCLI 2L01A 2QWWA 1KYWA 1V4RA 2GM4A 2EA4A 4AUXA 3ZMDA 2Z1DA 5DCMB 3K70D 2NVXJ 3HYIA 5J6XA 4L5EA 3F8BA 2GXGA 2DPUA 3DP7A 4ITVA 4LLGF 1LUJB 2FEZA 3DCFA 1YJ9I 2B63J 5IYBJ 3ZQIA 2O8XA 5CYVA 1EH6A 4II3A 5H6RA 2P5LC 1FBUA 3RIRA 3TMOA 3H5RA 2LF8A 1K61A 1R1UA 3DPUA 2M0CA 5IT9Z 1HW5A 5A2QK 4OIPF 1LVAA 2E1MB 3HPHA 3ZRGA 3ABUA 3PSFA 5K7ZA 2H6BA 1U8RA 2Y0SN 5KCMA 4J00A 3VPRA 3E6CC 4FETA 3CO6C 3KP7A 4XN3A 2XGEA 3BR5A 2M4KA 4RB0A 2PEXA 4BQQA 3GTGJ 2GXAA 5D4RA 4M9XA 4ENJA 4M6VA 4KN4X 5IYCJ 3I59B 4MIMA 1X2MA 1KQ0A 3DEEA 4RGXA 4N4NB 1XGMA 5HDKA 1IRFA 3N4MA 4HX8A 3SFZA 5C44J 1QNTA 3MWMA 4BEHB 4FE4A 2G0EA 3I56I 3GTJJ 2CQXA 1Z3XA 2IGKA 4QLCU 1JE8A 4O3MA 4AM3A 2M45A 1VQ6I 2DJIA 1U2WA 1WVRA 3GX4X 1FSHA 4XM3A 2UUZA 3GW2A 5K1YA 2A07F 2RC4A 3F8CA 2AO9A 4XLHA 3BJ6A 1AU7A 5D5XB 1DPUA 4IHWA 1Y6IA 3K0LA 3G1OA 1U3EM 4UB6C 1GHCA 3O2PE 1QGPA 2A6TA 3H3VK 2CUZA 2AQFA 5D5WB 1NK3P 1OMIA 3S2DJ 2A05A 1DPRA 1RR8C 2KZVA 3PNVA 5GAGJ 3DKYA 3ASNH 2Y48A 3T8RA 3EUAA 2Y9YA 3QODA 5HS9A 2W4SA 1X3UA 1SMTA 2EJRA 4F92B 4A0XA 2XIGA 2UXNA 3KEQA 3KE2A 1WJEA 3IH3A 4M72A 2ESHA 2PBIA 3M7GA 4FX4A 2X1EA 1LDDA 1KU9A 4JX4A 2RDPA 4A5MA 1MSFC 3K10A 3OYNA 3DFGA 1MJBA 3GUDA 1G3TA 2DXIA 1A6IA 2EILH 1IXRC 2GLOA 2Y75A 4JK1X 3RKQA 2MC3A 2WAQA 2EIMH 1ZLJA 3CZ6A 2L7KA 5B3SH 3CD6I 9ANTA 3FXKA 2M9HA 2L9VA 4G6TB 5B5EC 3JCUC 4HV5A 3AL0B 2W85A 2RV8A 4MNUA 2GOXB 4MLOA 1Z0XA 4RAGA 2H1KA 5KNLA 2FQ3A 3BR6A 1JJ6C 1MZBA 2IW5A 1Y1WJ 2EV5A 1R1VA 2K4BA 3GTPJ 3JRDA 1GV5A 1OCTC 2YU3A 4A5NA 1G3SA 5D6FA 5CVJA 2VBWA 1XMKA 3HB9A 3SZGA 3I4MJ 3IV5A 3PNTA 4GRIA 1WH7A 1XCVA 1R7JA 2HOEA 3DEWA 2FSWA 4BJ6C 3GFJA 3H0GJ 3MFKA 2V26A 4QWQA 4M3DA 4OWRB 4G12A 1EV7A 2MSYA 2DLLA 4FCYA 4IRIA 2HYFA 3HIFA 4ZZDA 1EF4A 2IAIA 2KRHA 1B4AA 4PJMA 3KYLA 2D45A 3RQIA 2HEOA 5L3DA 1SVOA 2JRMA 5AIPA 4DYCA 1JGSA 4O6JA 2GBYA 5LHGA 3CCQI 5CVUA 3P9CA 2LC2A 2CRGA 2MA3A 1DGWY 4HPQA 4LOCA 1Z05A 4NQWA 3V42A 4B3AA 2VJIA 3GCMA 5LGNA 1KU2A 1ZTRA 2XAUA 5EG0A 3H1CA 2P4WA 1SFKA 2AXLA 1ZG1A 5E18F 3S1QJ 1Y0NA 2VT2A 5GTHC 5H6QA 2BHZA 1LDJA 3CDIA 1SC7A 2X0LA 1WRJA 2R93J 4JQFA 1G3YA 5KAFC 1TWGJ 1RR7A 4N0BA 3DTEA 2K3FA 1JJ8C 3A02A 5HODA 2HQAA 2F6CA 2A5YB 4B8XA 5FD5A 2MLGA 5EJCA 3IHUA 3RQ4A 2I10A 3GWZA 4GO1A 1FP2A 5LD2C 5FROA 5DUKA 4CCNA 4LMYA 3OWTA 1HKQA 3S3NA 2MD0A 3LQRA 3AL0C 2FD5A 2K5CA 4L0ZB 4RS8A 1HLVA 1OCOH 3HRSA 3CC7I 2CUEA 4A3JJ 5FLMJ 1LNWA 2KP6A 2M30A 3DTIA 3FXQA 5IOZA 4RMNA 1R36A 3LWFA 3O3KA 4Y4RA 2ZB9A 3EUHA 3OSFA 2PFBA 2HDWA 1Y0UA 4AC0A 3T8TA 5DV5A 1D8KA 4L9VA 2BXYA 5H20A 5L3EA 5ERIA 5BPIA 4XIDA 1OISA 3FXRA 3S32A 2DT5A 1UCRA 2Q8KA 5FJ8J 2JA8J 2QSGX 2QSHX 2RQQA 4PSXA 3OV8A 1TT5B 2OA4A 3OS0A 2FQ4A 2MBFA 3WTXC 3BG3A 2ISZA 1RKTA 1SFOJ 4DNCA 1O3TA 3JAMK 4KMUX 2IGOA 4NC6A 3VB2A 1R49A 5D4SA 2XROA 2IS6A 2JN6A 3KETA 3MZYA 2A69F 3U9GA 3KZZA 2FMYA 1K4SA 2HTJA 1C0WA 2DI3A 4OIQF 1LDKB 4EMSA 4S05A 1R5GA 3BOQA 3L00A 3TEDA 3BZ6A 3VDXA 1CGPA 3K1PA 2AS5F 1A35A 2PMZN 2QEXI 4HF2A 3E1SA 2K9QA 5HLTA 2CH0A 4BHCA 1NG6A 1N77A 3KP5A 3MD2A 5FD6A 1GXQA 4GYIA 3UNGC 4LIUA 2EFWA 2JVGA 2ME6A 4HG2A 2YX7A 3AG1H 2ME0A 1K78A 3K4NA 5DDGA 3C1DA 3OYDA 2X9DA 2STWA 1GVDA 3VYUB 4CICA 3PIPF 1S9HA 5FFZA 2I5UA 2YUSA 2OBPA 2YS9A 3L2QA 3IRRA 4XLAA 4QIWN 2BE5F 1ETKA 2NNNA 3BTJA 3MZHA 1VQ8I 2R3SA 3QYEA 2HOSA 4GYGA 3ABKH 4R8HA 4HLYA 3RCOA 4XN0A 4B47A 3VSLA 3F0CA 2RREA 4XKVA 3M1EA 4RAZA 3G1MA 4NQWB 4A3DJ 3J81K 1R9TJ 4KIGA 5EG0B 2HXIA 1QA6A 1JKPC 1ZQ3P 1I3QJ 3HTSB 2EB7A 2G7UA 3ZMZA 1XD7A 1MMNA 3QRFF 2L9RA 1NHAA 4YG2F 4IRGA 3M07A 3TO7A 1U9OA 5B1AH 4RGUA 1GV2A 1ZLKA 5JHUA 1SD6A 1D8JA 4HLXA 1IXSB 1T08B 4GGGA 2BY1A 5E3OA 1YX5A 4Q47A 4BXFA 2XAHA 2L7FP 2ICWG 4JBAA 3ZGKA 2AHQA 1MBJA 1WH5A 3E6MA 4Y33A 4RB2C 1VQMI 1BR2A 4HSTA 3BG9A 1BW5A 3CCJI 2XVCA 2IS2A 3EDPA 3RKYA 1YJNI 1FX7A 2CV1A 2Y2ZA 3GZNB 3BPVA 4OOIA 2LYCA 5JR3A 2DN0A 5GAHJ 3WTTC 2IS1A 2VXZA 1T0FC 3FXOA 2ZNYA 4G6QA 4XSZF 2O8KA 1G8XA 4NDLA 3L2WA 4NB5A 3FHNA 4FQGA 3ZQLA 2JA2A 4FT8A 3B73A 1G6NA 3A4CA 2WTEA 4LFUA 1YX3A 3TOBA 4S0HB 4UY8I 5TISC 5M5YJ 1V5EA 3G3ZA 3FMRA 1F9NA 3CTAA 1ZKGA 4EJUA 4MTDA 3I0TA 3GTOJ 3M3YJ 4UVBA 3T1BA 1SD5A 2MLKA 5K7FA 5FKMA 4A6DA 4UUTA 4JX6A 3JRCA 1WJFA 1R00A 3CJTB 5HDGA 3JAMZ 3ULQB 4DZPA 1XSXA 4P9FA 3OYBA 1X1PA 3BPXA 2CFXA 4ENNA 2Z3YA 2H27A 2LSOA 4MO7A 2EFOA 2LBFB 2CQNA 2EWNA 3OYHA 3IAS2 5F08A 3FKJA 1F5TA 5FLVA 4CCJA 5M5WJ 2MFZA 1IJWC 2R7QA 3BG7A 2DA5A 1MGTA 1FBSA 3BP8A 2ZCWA 4ZYAA 3JRAA 1SMYF 4PJJA 3FHZA 3E6BA 2MGQA 1I1SA 3L2VA 2A6EF 2LREA 2HPIA 4XOTA 4B44A 4L9NA 2BXZA 1IC8A 4WX9A 4A2UA 1SAUA 1TW3A 2GXBA 2W57A 1GUUA 1Y56A 3G4SI 1P2FA 2V1UA 1YQAA 1D0XA 2VODA 4HX4A 5J47A 4XLEA 4IEJA 1O4XA 2D2WA 1K78B 1ZR4A 1YRNA 2OZUA 2ZFWA 1ODDA 1XPXA 2EIKH 4YELA 2YSRA 2JTVA 3K2AA 2G9WA 2A61A 1MMAA 1ZELA 2YX4A 2OV7A 3IWFA 3OL3A 3GTLJ 1ZG5A 3LSTA 3WE3A 4UUVA 1OQYA 2WC2A 1V5GA 4E70A 1ETOA 3EUHC 2KPMA 3IKTA 3ASOH 2RKHA 1V3FA 3K70C 3G6EI 2QM3A 3CJNA 3L2RA 4MFDA 3HOUJ 2XRLA 2L5QA 2X51A 4A3CJ 4PUSA 3OYEA 2HZTA 5DEQA 3ZP5A 3UR3C 2JT1A 1FP1D 2QGUA 4LG0A 1TTYA 2L3DA 2HR3A 3H35A 5CVVA 1N78A 3ELKA 1D3YA 3BR3A 1ONVA 1ETQA 2E71A 2W25A 2CJJA 4YIFA 4IF4A 2COBA 1HDDC 2NS7A 2R7RA 4CO8A 1XSVA 3HOSA 1OPCA 2O0YA 5C4XJ 4FHTA 1STZA 3C7JA 3DF8A 2H09A 1HKSA 1GT0C 4XLFA 3ZMSA 1SVLA 2HZDA 1ERDA 3ML6A 1O3QA 5J8CA 2PMHA 2O7OA 4U0VA 3QQAA 1A36A 4XQFA 2LOOA 4HQMA 2EPFA 1YO5C 2M4GA 3V7RA 1GVJA 3K7AJ 4AYBA 1J5YA 2BW3A 4OIOF 2CU7A 4EATA 2ZNZA 5F64A 1K4TA 1P7IA 2HQNA 3BCBA 1EKEA 4EM0B 4IQ4A 3RTRA 2CS3A 1W0TA 1MBEA 2KJCA 1AA7A 4EQQA 3RPUD 2PG4A 3KP4A 3PQJA 4HNVA 1VQKI 1TNSA 3R0JA 3H5NA 3K4JA 2R4GA 1BI3A 1XDSA 2P6TA 3HOVJ 1FSEA 3MZ8A 2JUCA 4YFKF 1A5JA 1IUFA 4I09A 5KVRA 2YU9J 3F3XA 2P7CB 1IRZA 3MCZA 2I8DA 2VONA 1QVTA 2DDBA 5HVQC 1UHMA 2FUG2 3SFIA 3OYIA 1B72A 4R1HA 1W5SA 4XNFA 4BH9A 1KGSA 1MH4A 1FBQA 4CH7A 3HRUA 5IP7J 2DMPA 2XF5A 3CCUI 4DBQA 2EA2A 2P6SA 5E8IA 4I7HA 4PJNA 2TCTA 1O3RA 3LSMA 2NNYA 1BIAA 3A01A 2HKXA 3S16J 1A04A 2E7XA 4ZYEA 3V8JA 1UZCA 1DQUA 3H9JA 2A5WA 5H2FC 2QCOA 1BM9A 2M5WA 1FEXA 1TWCJ 3I64A 4M3BA 4PK4A 1JT0A 3RI4A 1IV6A 4EM1A 3CUQA 2HQRA 1FTZA 3DKWA 4Y3OA 4EGZA 5DM7F 2QQ9A 1YRNB 5ILSA 2CG4A 1U5TA 1H88C 1U0JA 2K86A 1X2NA 2CFOA 2QZ8A 3G73A 2DFEA 2UZKA 5CKTA 4C30A 1YG2A 2RNJA 3GZ5A 3L2UA 4F7ZA 1VNDA 1X1BA 4Q4ZF 4HV6A 2HPMA 1U9NA 4MFEA 1YS7A 1HBXG 3PFIA 4F55A 1OCZH 2DA4A 1VF9A 2R7OA 5EZHA 2ZO4A 4YEJA 4M9ZA 5EZGA 2F5EA 2PQ8A 5IYDJ 1HDPA 3WGHA 1XG1A 2VLAA 4NC7A 2HOAA 3OSGA 1T39A 2AXTC 3HUGA 1RIOH 6PAXA 4A3GJ 3DU6A 2VKEA 2ZJPF 1NK2P 2QENA 2NVYJ 3CCSI 4IZZA 1JXSA 3OYJA 2FOWA 3OY9A 4LG0B 2WAEA 3OIOA 3E97A 4FASD 1FOXA 4A3KJ 1Z6RA 3SEZA 5LLQA 2R7UA 2HVQA 2KIMA 3KIOA 2QVOA 4C3IJ 2NVUB 5D6EA 1HXDA 1UHSA 3LOCA 1WFXA 4ZH4F 2P7VB 4W1UA 2XB5A 3LL7A 1U6GA 2OAZA 2V79A 1P6RA 1OCRH 3IL2A 4O5VA 1I50J 3W2WA 1PUFA 1P4WA 3R61A 3K9TA 4BJ5C 3QU6A 4HYEA 1J9IA 3F8FA 3BQZA 3FM5A 1PVEA 2CUJA 5F27A 5F1RA 2LTPA 3QPLA 3OYCA 1D1AA 3GTKJ 4I99C 5LHHA 1S7OA 1Z7LA 2BW3B 4BDYA 3S14J 1L0OC 2HNHA 2Q2EA 2R7FA 5B66C 1VQ4I 2ELKA 1LFPA 4BQNA 3DBRB 1TWFJ 1IZ1A 2ELJA 2IGMA 2V1XA 2Y0SA 3S1RJ 2R7ZJ 5FKKA 1IN4A 3D5RC 3NWSA 4XICA 1RKWA 3LAJA 5FO5A 4KFCA 5BQTA 5GPCA 1H0MA 1I39A 2GQQA 4BHPA 4QPOA 5J3LA 3VSKA 3KPHA 3Q5FA 1AHDP 3K4MA 4A69C 2CGPA 2R7TA 2PMUA 1KU7A 1TQIA 4J19A 2FRHA 2LDUA 2XDVA 4EM2A 4KN7X 1ITYA 2BY0A 2UXXA 1V5FA 1YITI 1B8IA 1I6HJ 4HRIA 4KYWA 1XN7A 5DS9A 1B72B 4D7MA 3TGNA 1UJ8A 1BJAA 2P0WA 3LA3A 1SANA 2L4MA 4RAYA 2HVSA 3AFHA 2BHYA 2BYVE 3S8PA 3M4OJ 5FKNA 2E1CA 1VQOI 3G71I 3NARA 3A01B 3DEUA 2E1MC 4MTEA 4XKCA 2GA2A 3QYBA 2V9PA 5EEHA 1W4MA 4H4KC 4RB3C 2DT7B 5IOYA 3L1PA 1N25A 2FMLA 1FMWA 2LR8A 3K6GA 3Q0VA 3C3WA 1W36D 3CUQB 3E5UA 3CCMI 1BR1A 2LMDA 5IP9J 3I53A 5DM6F 5JVGF 2R5ZA 1U5TB 5LRRA 2ZFUA 4V2FA 3W3CA 1ENHA 2P5KA 4W97A 3AAFA 4XRFA 1S3JA 1HSTA 3TDZC 3U1DA 3JSOA 3GFIA 1ZYRF 4E7JA 1X1DA 2CMPA 3JTGA 3FK7A 1XC5A 2VE9A 1V54H 1XDUA 2DK8A 4M6YA 4RBOA 5CLSA 1FYMA 2HU9A 5HLIA 1FTTA 4OINF 4L5JA 4AIHA 2F48A 2M34A 3RPUA 2LKXA 1VTNC 1LEBA 4YIRX 3ONQA 2Q0OA 4DYRA 5IPAA 3HUGB 2WWYA 1U8BA 3WU2C 2JRTA 4I6ZA 1O7LA 1F4KA 2JWTA 4P9UA 5JVTA 2LKSA 2J5OA 1FC3A 2OTLI 1TNTA 1Y8QB 2MYSA 4OAZA 3QU3A 4DGWB 2DPDA 1X19A 3CCRI 1K83J 5E8GA 4XL9A 5DTDA 4GCVA 3V7SA 2CQKA 2E1OA 1WHUA 4LJZF 4I01A 3B6CA 2XGDA 4IOCF 3CJRB 3S93A 1S7EA 2LG4A 3REOA 1ETWA 5CQEA 4L18B 4NNJA 4XORA 2L9NA 4EJVA 3IWZA 4UB8C 5JLWA 4BY1J 2WV1A 1BC8C 1XS9A 4LK0F 5ICCA 4D0PA 1PUFB 4HW0A 1F1ZA 3ECHA 2WA0A 1IW7F 4RGRA 2VUMJ 1UELB 2XPUA 2UV1A 4PGHA 2F4IA 4EJTA 2GAUA 5ILVA 1BI2A 4GDFA 1VI0A 3CMAI 3T0YA 1Z21A 2EBIA 1UG0A 4KUMA 4XK4A 3IH2A 1QPMA 4M3GA 2Q2EB 3DLAA 1LJ9A 1J09A 4DW6A 3K4CA 2KISA 3H3UA 1XX5A 2JUGA 3GTQJ 1LFBA 2ZXJA 3CUQC 3U2RA 4L9JA 1JUMA 2OF7A 4BQOA 4LG3A 2LD5A 4YFXF 3D1NI 2VJ4A 2WV0A 2GIZA 3CC4I 2V9KA 1F43A 2GOMA 5ILUA 1S29A 1DP7P 1TQMA 3SYTA 4IL6C 1HQCA 1ZRDA 1WSUA 2OTJI 3OR2C 1BI0A 1WI3A 3RSNA 4X1EA 3KP6A 1NG7A 3BY6A 2BV6A 2DU9A 1Y8RB 4HEA2 2VT3A 3FBNB 1A31A 2Q1ZB 1B8IB 3NAUA 1MBKA 4BE1A 3CC2I 3MKYB 2XV4S 2Y0MA 1SD7A 3FKIJ 2DOFA 4CXFA 4XLPF 4ASNA 1Y39A 4D9JA 1NH3A 2VN2A 2XPVA 1E3HA 3N97A 4LIVA 5J1YA 4I02A 3COAC 1IG7A 4HZFA 3CLQA 2CWEA 3TO9A 3EYIA 3NQOA 4IRHA 1SVMA 1Z6TA 2KT0A 3AG4H 3ZN0A 3DBLB 2YR2A 1NTCA 1YW9A 2LBFA 1FJLA 2OC6A 1P7JA 5F6FA 4BBRJ 5IY5H 2JSCA 3JRHA 4U7BA 2VQLA 5K5RA 2NVQJ 2P5VA 4P1WA 4XKBA 1YHQI 2NAZA 2R5ZB 4BYYA 4MQVA 4BDZA 2HDDA 2VPLA 3HEFA 3A2KA 4MGRA 1ZGWA 4CDGA 3V8LA 4C3HJ 3O6BB 1YE9A 3RPQA 3OYKA 4IHXA 1K6OA 5HNFA 3EPZA 3SJMA 1K79A 1X1CA 1ZN2A 2XAGA 2R0QC 5F1JA 2OJED 1OYYA 2L54A 2R7WA 1MSEC 3P9KA 5M3FJ 1B9NA 4A0ZA 4U88A 3RZOJ 1VQLI 3GEZA 2ETHA 2KL4A 3CCEI 2MH9A 3SDBA 1IAWA 1DU6A 3ROUA 3NEUA 4PZJA 4CA0A 3GFMA 3CCVI 1MIJA 3H5AA 3EYYA 4IOAF 4E4HA 3WHCA 4Y52J 4MEXF 3OL4A 2FU4A 2ZBKA 2BVMA 2PMZA 4ZJZA 2BOLA 3E5XA 3BCAA 3R0AA 4PCQA 2XGCA 3MVPA 4M73A 2YPRA 1HKTA 3CP2A 4A12A 3F22A 3LMMA 4XLCA 2CO5A 1IDYA 2EZIA 2EZLA 3BTIA 2TRTA 3LQQA 2PX9A 3U1KA 3I3LA 3F8NA 5K5QA 4HDVA 1PDNC 4AD9A 2KIUA 1BOBA 1YW7A 4RLFA 2DFIA 4ANJA 5B1BH 4UXNA 1XGSA 2DO7A 2R92J 4LB5A 1G3WA 3LSGA 4UNOA 5D8KB 2O9LA 2Z5UA 2FE3A 3ABTA 4IO9F 4XBFA 2FBHA 3V4GA 3GLXA 2JMWA 4UV8A 1MNMC 2IGNA 1LB2A 2WB1N 4HNUA 3TP3A 2HKOA 3BR2A 2BVLA 4U7DA 1BI1A 2DYSH 3SZTA 3WODF 2JJ7A 3S1NJ 3TO6A 1T8IA 1UG2A 3PO3J 3K2ZA 4CYCA 1JTXA 2ECCA 2RVCA 4XRSA 4A6EA 3OS1A 4N9HA 3QPTA 2NOJB 3PQKA 4C3JJ 5F0HA 3KZIC 2KKOA 3ESWB 5FGMA 2EH3A 2V7FA 1IN6A
chains in the Genus database with same CATH topology
1W0TA 1MBEA 3HGGA 2AO9A 1AU7A 4HNVA 1WPKA 4XRMA 4IHWA 3G1OA 5C3EJ 2H8RA 3S2HJ 3H3VK 2NOGA 3HOVJ 2L7ZA 2JA5J 1NK3P 3S2DJ 1A5JA 2K9SA 1IUFA 2YU9J 1JKQC 1IRZA 4B1RA 4FISA 1QVTA 2Y9YA 2L0KA 3MKLA 3SFIA 2XPWA 1B72A 3IH3A 5M5XJ 1JKRC 1MH4A 4M3EA 5IP7J 2DMPA 3HOWJ 4A3BJ 4JX4A 5GPAA 1JUSA 3HKZN 2EQRA 2TCTA 1MSFC 3OOUA 1A6IA 3A01A 1BA5A 2W48A 2GLOA 3S16J 1JUPA 5FKOA 3RKQA 2QCOA 1FEXA 1TWCJ 4M3BA 3E7LA 1JT0A 2LK2A 9ANTA 2M9HA 3BR0A 1IV6A 2LLKA 1FTZA 4MLOA 1Z0XA 2H1KA 1YRNB 2DA1A 1H88C 2JK3A 1ETYA 3BR6A 4A3FJ 1JJ6C 1X2NA 2E19A 2JA7J 3JRFA 1Z77A 1Y1WJ 5F0FA 5EF6A 3GTPJ 3BQYA 3JRDA 1GV5A 4C2MJ 1OCTC 3W6VA 2K40A 1G2HA 1VNDA 2HOTA 1U9NA 4I76A 2XSDC 4MFEA 3HB9A 4FE7A 2DA4A 3I4MJ 1VF9A 5EZHA 3IV5A 1RETA 1WH7A 2P81A 5EZGA 4D5FA 3JREA 3HGYA 3PM1A 5IYDJ 1GDTA 1HDPA 3DEWA 1XG1A 3OSGA 3HM5A 2HOAA 3H0GJ 3FISA 3FIWA 4M3DA 4G12A 2MSYA 4A3GJ 2VKEA 4FCYA 1NK2P 2NVYJ 4JYKA 2Y30A 1EF4A 2IAIA 5J1UA 3RQIA 3OIOA 4DYCA 1FIAA 4A3KJ 3C2BA 2GBYA 1LE8A 1BW6A 4V2GA 1JKOC 2CRGA 4C3IJ 1UHSA 3LOCA 4X6AJ 4LOCA 4W1UA 2XB5A 4B3AA 1ETXA 1ZTRA 3JR9A 2CUFA 5EG0A 1TWAJ 1LFUP 3S1QJ 2VI6A 1I50J 2Y9ZA 1PUFA 1POGA 3UKGA 2R93J 3BQZA 1TWGJ 1RR7A 3A03A 2ECBA 5F27A 1JJ8C 3A02A 4CYCB 3JRBA 2LTPA 3QPLA 5HODA 3GTKJ 2I10A 3S14J 1AKHA 4BKXA 5F0CA 2R5YB 2ELKA 3HDDA 4UUSB 3RZDJ 1TWFJ 3S1RJ 2R7ZJ 5FKKA 2FD5A 5EYRA 4XICA 1T56A 4DZJA 1HLVA 5FKLA 1RKWA 4DYQA 4Y7NJ 2CUEA 4A3JJ 5GPCA 3O8HA 5FLMJ 5IOZA 3BTLA 1ZK8A 1ORKA 5J3LA 2DTZA 1AHDP 2ZB9A 3OSFA 4A69C 1CQTA 3JRIA 1D5YA 1HCRA 2IEKA 4J19A 4AC0A 2RAEA 3ZQCA 1ITYA 2NVTJ 2M2EA 3PO2J 3S15J 3CQZJ 1B8IA 2E2IJ 4D5CA 1I6HJ 1QRYA 1OFCX 4XIDA 5DS9A 1B72B 2FX0A 4D7MA 5EGOA 2HQ5A 5FJ8J 3I4NJ 2JA8J 1SANA 3GBGA 3CMYA 1MBGA 2DA2A 4BBSJ 2DA7A 1OCPA 2FQ4A 5J1RA 3M4OJ 3BG3A 1MH3A 5FKNA 1JT6A 2KDZA 3NARA 1RKTA 3A01B 1SFOJ 4JX5A 4A3MJ 2VKVA 2M8GX 3L1PA 4D7NA 2HYJA 5IOYA 1OJLA 1VFCA 3HOYJ 2MG4A 2JN6A 2LR8A 3Q0VA 5IP6A 4BXXJ 1W0UA 2K9NA 5IP9J 1QPIA 2R5ZA 3TEDA 1TC3C 4V2FA 2QF7A 1ENHA 4W97A 2LY9A 3LNQA 2PMZN 2K9QA 2DMTA 3FK7A 1XC5A 2EZKA 2OPTA 5E3LA 4RBOA 1FTTA 2E2HJ 2ME6A 1Q1VA 1Y1VJ 2ME0A 2M34A 4QSHA 2LKXA 2X9DA 1WGXA 3LSPA 4DYRA 1GVDA 5IPAA 4FTHA 3HBLA 1U8BA 2YUSA 4I6ZA 2YS9A 2JWTA 4QIWN 1H89C 1ETKA 5EDNA 3BTJA 5C4JJ 2HOSA 1K83J 2NS8A 5DTDA 1LE8B 2E1OA 2HI3A 2X48A 3F0CA 3B6CA 3SDGA 3CDLA 1WCMJ 2XGDA 1S7EA 3G1MA 4A3DJ 1ETWA 1R9TJ 5EG0B 1MBHA 5K7HA 4GFBA 2HXIA 3O8GA 1JTYA 5JLWA 1JKPC 4A3LJ 1X58A 4AYBN 1I3QJ 1ZQ3P 2WV1A 4BY1J 1XS9A 1PUFB 5E3MA 3S1MJ 1MBFA 2L9RA 2IBDA 3CCYA 1U9OA 5F04A 3ZOBA 2VUMJ 2XPUA 1GV2A 1IGNA 3JRGA 1BJZA 1VI0A 2E2JJ 3BR1A 3BT9A 2EBIA 5E3OA 1HOMA 4XK4A 2L7FP 3IH2A 4M3GA 1AKHB 2AHQA 3WHBA 1MBJA 1WH5A 3LSRA 4DW6A 1BW5A 3BG9A 3GTQJ 1LFBA 2DA3A 1QVUA 3HOZJ 1JUMA 2OF7A 2X6OA 2LD5A 2Y2ZA 3D1NI 1F43A 2DN0A 2XB0X 1FIPA 2O8KA 4IHYA 2JA6J 4NDLA 3FK6A 3HOXJ 1WI3A 3ZQLA 1ZR2A 3Q0WA 4X1EA 1APLC 5JLXA 2LVSA 2N8GA 1B8IB 3NAUA 1MBKA 1JGGA 4S0HB 3FKIJ 3ZQGA 1TWHJ 5M5YJ 2CQQA 1ZKGA 3M3YJ 5EGOB 3GTOJ 5GP9A 2D5VA 1F36A 5K7FA 5FKMA 2WAQN 2XPVA 4UUTA 3ZQHA 1E3OC 4JX6A 3Q0UA 3TW6A 5J1YA 2HXOA 3JRCA 1DU0A 4ABZA 1IG7A 4A93J 5E3NA 4DZPA 3TP0A 1IDZA 4A3EJ 2L7MP 1H8AC 2KT0A 5M3MJ 1T33A 4MO7A 3MN2A 3G1LA 1NTCA 4JP0A 1FJLA 1P7JA 5F08A 5FLVA 4BBRJ 3JRHA 2DMQA 4M3FA 5M5WJ 2ID6A 1IJWC 2NVQJ 3BTCA 2DA5A 3GTMJ 3JRAA 1RPWA 2R5ZB 2DA6A 3IH4A 4XRSG 2HDDA 5BNGA 3HEFA 2MGQA 1ZGWA 4C3HJ 4IHXA 1IC8A 2LFBA 4A3IJ 1U78A 3SJMA 3S17J 3LSJA 3Q3SA 1GUUA 3QPSA 2R0QC 5F1JA 1MSEC 4IEJA 1O4XA 5M3FJ 4IHVA 2LP0A 3TW7A 2DJNA 1ZR4A 1YRNA 4RDUA 3B6AA 3RZOJ 2FJ1A 2EZHA 1ETVA 4B4CA 3K2AA 1DU6A 3GTLJ 4QTRA 2GM4A 4AUXA 1ETOA 3WHCA 2MW8A 4Y52J 2NVXJ 2Y31A 4MFDA 4L5EA 3HOUJ 2XRLA 2XGCA 3MVPA 3DCFA 1BL0A 4A3CJ 2B63J 5IYBJ 3ZQIA 1IDYA 2EZIA 2EZLA 3BTIA 2TRTA 1K61A 2M0CA 3BR3A 1ETQA 2DMUA 2CJJA 3ZQFA 3BG5A 2COBA 5K7ZA 1HDDC 2Y0SN 2R92J 2NS7A 3LSGA 2O9LA 5C4XJ 4BY7J 3VPRA 2JMWA 1GT0C 1HF0A 1MNMC 2XGEA 3BR5A 2WB1N 3TP3A 4EEFG 3GTGJ 3BR2A 2ID3A 4M6VA 2O7OA 5IYCJ 3QQAA 1X2MA 4MIMA 2JJ7A 3S1NJ 1UG2A 3PO3J 5C44J 4CYCA 1RESA 1JTXA 3K7AJ 2ECCA 4XRSA 2CU7A 4FE4A 2G0EA 3GTJJ 2CQXA 4C3JJ 2R5YA 1UMQA 2DMNA 5F0HA 2VPRA 1P7IA 4UUSA 2EH3A 5EEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0T A;  1MBE A;  3HGG A;  2AO9 A;  1AU7 A;  4HNV A;  1WPK A;  4XRM A;  4IHW A;  3G1O A;  5C3E J;  2H8R A;  3S2H J;  3H3V K;  2NOG A;  3HOV J;  2L7Z A;  2JA5 J;  1NK3 P;  3S2D J;  1A5J A;  2K9S A;  1IUF A;  2YU9 J;  1JKQ C;  1IRZ A;  4B1R A;  4FIS A;  1QVT A;  2Y9Y A;  2L0K A;  3MKL A;  3SFI A;  2XPW A;  1B72 A;  3IH3 A;  5M5X J;  1JKR C;  1MH4 A;  4M3E A;  5IP7 J;  2DMP A;  3HOW J;  4A3B J;  4JX4 A;  5GPA A;  1JUS A;  3HKZ N;  2EQR A;  2TCT A;  1MSF C;  3OOU A;  1A6I A;  3A01 A;  1BA5 A;  2W48 A;  2GLO A;  3S16 J;  1JUP A;  5FKO A;  3RKQ A;  2QCO A;  1FEX A;  1TWC J;  4M3B A;  3E7L A;  1JT0 A;  2LK2 A;  9ANT A;  2M9H A;  3BR0 A;  1IV6 A;  2LLK A;  1FTZ A;  4MLO A;  1Z0X A;  2H1K A;  1YRN B;  2DA1 A;  1H88 C;  2JK3 A;  1ETY A;  3BR6 A;  4A3F J;  1JJ6 C;  1X2N A;  2E19 A;  2JA7 J;  3JRF A;  1Z77 A;  1Y1W J;  5F0F A;  5EF6 A;  3GTP J;  3BQY A;  3JRD A;  1GV5 A;  4C2M J;  1OCT C;  3W6V A;  2K40 A;  1G2H A;  1VND A;  2HOT A;  1U9N A;  4I76 A;  2XSD C;  4MFE A;  3HB9 A;  4FE7 A;  2DA4 A;  3I4M J;  1VF9 A;  5EZH A;  3IV5 A;  1RET A;  1WH7 A;  2P81 A;  5EZG A;  4D5F A;  3JRE A;  3HGY A;  3PM1 A;  5IYD J;  1GDT A;  1HDP A;  3DEW A;  1XG1 A;  3OSG A;  3HM5 A;  2HOA A;  3H0G J;  3FIS A;  3FIW A;  4M3D A;  4G12 A;  2MSY A;  4A3G J;  2VKE A;  4FCY A;  1NK2 P;  2NVY J;  4JYK A;  2Y30 A;  1EF4 A;  2IAI A;  5J1U A;  3RQI A;  3OIO A;  4DYC A;  1FIA A;  4A3K J;  3C2B A;  2GBY A;  1LE8 A;  1BW6 A;  4V2G A;  1JKO C;  2CRG A;  4C3I J;  1UHS A;  3LOC A;  4X6A J;  4LOC A;  4W1U A;  2XB5 A;  4B3A A;  1ETX A;  1ZTR A;  3JR9 A;  2CUF A;  5EG0 A;  1TWA J;  1LFU P;  3S1Q J;  2VI6 A;  1I50 J;  2Y9Z A;  1PUF A;  1POG A;  3UKG A;  2R93 J;  3BQZ A;  1TWG J;  1RR7 A;  3A03 A;  2ECB A;  5F27 A;  1JJ8 C;  3A02 A;  4CYC B;  3JRB A;  2LTP A;  3QPL A;  5HOD A;  3GTK J;  2I10 A;  3S14 J;  1AKH A;  4BKX A;  5F0C A;  2R5Y B;  2ELK A;  3HDD A;  4UUS B;  3RZD J;  1TWF J;  3S1R J;  2R7Z J;  5FKK A;  2FD5 A;  5EYR A;  4XIC A;  1T56 A;  4DZJ A;  1HLV A;  5FKL A;  1RKW A;  4DYQ A;  4Y7N J;  2CUE A;  4A3J J;  5GPC A;  3O8H A;  5FLM J;  5IOZ A;  3BTL A;  1ZK8 A;  1ORK A;  5J3L A;  2DTZ A;  1AHD P;  2ZB9 A;  3OSF A;  4A69 C;  1CQT A;  3JRI A;  1D5Y A;  1HCR A;  2IEK A;  4J19 A;  4AC0 A;  2RAE A;  3ZQC A;  1ITY A;  2NVT J;  2M2E A;  3PO2 J;  3S15 J;  3CQZ J;  1B8I A;  2E2I J;  4D5C A;  1I6H J;  1QRY A;  1OFC X;  4XID A;  5DS9 A;  1B72 B;  2FX0 A;  4D7M A;  5EGO A;  2HQ5 A;  5FJ8 J;  3I4N J;  2JA8 J;  1SAN A;  3GBG A;  3CMY A;  1MBG A;  2DA2 A;  4BBS J;  2DA7 A;  1OCP A;  2FQ4 A;  5J1R A;  3M4O J;  3BG3 A;  1MH3 A;  5FKN A;  1JT6 A;  2KDZ A;  3NAR A;  1RKT A;  3A01 B;  1SFO J;  4JX5 A;  4A3M J;  2VKV A;  2M8G X;  3L1P A;  4D7N A;  2HYJ A;  5IOY A;  1OJL A;  1VFC A;  3HOY J;  2MG4 A;  2JN6 A;  2LR8 A;  3Q0V A;  5IP6 A;  4BXX J;  1W0U A;  2K9N A;  5IP9 J;  1QPI A;  2R5Z A;  3TED A;  1TC3 C;  4V2F A;  2QF7 A;  1ENH A;  4W97 A;  2LY9 A;  3LNQ A;  2PMZ N;  2K9Q A;  2DMT A;  3FK7 A;  1XC5 A;  2EZK A;  2OPT A;  5E3L A;  4RBO A;  1FTT A;  2E2H J;  2ME6 A;  1Q1V A;  1Y1V J;  2ME0 A;  2M34 A;  4QSH A;  2LKX A;  2X9D A;  1WGX A;  3LSP A;  4DYR A;  1GVD A;  5IPA A;  4FTH A;  3HBL A;  1U8B A;  2YUS A;  4I6Z A;  2YS9 A;  2JWT A;  4QIW N;  1H89 C;  1ETK A;  5EDN A;  3BTJ A;  5C4J J;  2HOS A;  1K83 J;  2NS8 A;  5DTD A;  1LE8 B;  2E1O A;  2HI3 A;  2X48 A;  3F0C A;  3B6C A;  3SDG A;  3CDL A;  1WCM J;  2XGD A;  1S7E A;  3G1M A;  4A3D J;  1ETW A;  1R9T J;  5EG0 B;  1MBH A;  5K7H A;  4GFB A;  2HXI A;  3O8G A;  1JTY A;  5JLW A;  1JKP C;  4A3L J;  1X58 A;  4AYB N;  1I3Q J;  1ZQ3 P;  2WV1 A;  4BY1 J;  1XS9 A;  1PUF B;  5E3M A;  3S1M J;  1MBF A;  2L9R A;  2IBD A;  3CCY A;  1U9O A;  5F04 A;  3ZOB A;  2VUM J;  2XPU A;  1GV2 A;  1IGN A;  3JRG A;  1BJZ A;  1VI0 A;  2E2J J;  3BR1 A;  3BT9 A;  2EBI A;  5E3O A;  1HOM A;  4XK4 A;  2L7F P;  3IH2 A;  4M3G A;  1AKH B;  2AHQ A;  3WHB A;  1MBJ A;  1WH5 A;  3LSR A;  4DW6 A;  1BW5 A;  3BG9 A;  3GTQ J;  1LFB A;  2DA3 A;  1QVU A;  3HOZ J;  1JUM A;  2OF7 A;  2X6O A;  2LD5 A;  2Y2Z A;  3D1N I;  1F43 A;  2DN0 A;  2XB0 X;  1FIP A;  2O8K A;  4IHY A;  2JA6 J;  4NDL A;  3FK6 A;  3HOX J;  1WI3 A;  3ZQL A;  1ZR2 A;  3Q0W A;  4X1E A;  1APL C;  5JLX A;  2LVS A;  2N8G A;  1B8I B;  3NAU A;  1MBK A;  1JGG A;  4S0H B;  3FKI J;  3ZQG A;  1TWH J;  5M5Y J;  2CQQ A;  1ZKG A;  3M3Y J;  5EGO B;  3GTO J;  5GP9 A;  2D5V A;  1F36 A;  5K7F A;  5FKM A;  2WAQ N;  2XPV A;  4UUT A;  3ZQH A;  1E3O C;  4JX6 A;  3Q0U A;  3TW6 A;  5J1Y A;  2HXO A;  3JRC A;  1DU0 A;  4ABZ A;  1IG7 A;  4A93 J;  5E3N A;  4DZP A;  3TP0 A;  1IDZ A;  4A3E J;  2L7M P;  1H8A C;  2KT0 A;  5M3M J;  1T33 A;  4MO7 A;  3MN2 A;  3G1L A;  1NTC A;  4JP0 A;  1FJL A;  1P7J A;  5F08 A;  5FLV A;  4BBR J;  3JRH A;  2DMQ A;  4M3F A;  5M5W J;  2ID6 A;  1IJW C;  2NVQ J;  3BTC A;  2DA5 A;  3GTM J;  3JRA A;  1RPW A;  2R5Z B;  2DA6 A;  3IH4 A;  4XRS G;  2HDD A;  5BNG A;  3HEF A;  2MGQ A;  1ZGW A;  4C3H J;  4IHX A;  1IC8 A;  2LFB A;  4A3I J;  1U78 A;  3SJM A;  3S17 J;  3LSJ A;  3Q3S A;  1GUU A;  3QPS A;  2R0Q C;  5F1J A;  1MSE C;  4IEJ A;  1O4X A;  5M3F J;  4IHV A;  2LP0 A;  3TW7 A;  2DJN A;  1ZR4 A;  1YRN A;  4RDU A;  3B6A A;  3RZO J;  2FJ1 A;  2EZH A;  1ETV A;  4B4C A;  3K2A A;  1DU6 A;  3GTL J;  4QTR A;  2GM4 A;  4AUX A;  1ETO A;  3WHC A;  2MW8 A;  4Y52 J;  2NVX J;  2Y31 A;  4MFD A;  4L5E A;  3HOU J;  2XRL A;  2XGC A;  3MVP A;  3DCF A;  1BL0 A;  4A3C J;  2B63 J;  5IYB J;  3ZQI A;  1IDY A;  2EZI A;  2EZL A;  3BTI A;  2TRT A;  1K61 A;  2M0C A;  3BR3 A;  1ETQ A;  2DMU A;  2CJJ A;  3ZQF A;  3BG5 A;  2COB A;  5K7Z A;  1HDD C;  2Y0S N;  2R92 J;  2NS7 A;  3LSG A;  2O9L A;  5C4X J;  4BY7 J;  3VPR A;  2JMW A;  1GT0 C;  1HF0 A;  1MNM C;  2XGE A;  3BR5 A;  2WB1 N;  3TP3 A;  4EEF G;  3GTG J;  3BR2 A;  2ID3 A;  4M6V A;  2O7O A;  5IYC J;  3QQA A;  1X2M A;  4MIM A;  2JJ7 A;  3S1N J;  1UG2 A;  3PO3 J;  5C44 J;  4CYC A;  1RES A;  1JTX A;  3K7A J;  2ECC A;  4XRS A;  2CU7 A;  4FE4 A;  2G0E A;  3GTJ J;  2CQX A;  4C3J J;  2R5Y A;  1UMQ A;  2DMN A;  5F0H A;  2VPR A;  1P7I A;  4UUS A;  2EH3 A;  5EEA A; 
#chains in the Genus database with same CATH topology
 2MH2 A;  3JSP A;  3HOT A;  1FNN A;  1WJD A;  4LB6 B;  2FNP A;  2R7D A;  3VOE A;  1MD0 A;  1WPK A;  2FF4 A;  3F6V A;  5C3E J;  3ZPL A;  3TL4 X;  2IVM A;  2ZC2 A;  1EH8 A;  2QYO A;  3OYL A;  2R7X A;  4EJO A;  5CVR A;  1K7A A;  3TOA A;  4HAM A;  4ZYD A;  2L7Z A;  1RC9 A;  3KP3 A;  1RRJ A;  4ESB A;  1YI2 I;  1GXP A;  1BBY A;  2IP2 A;  4K2E A;  2L0K A;  3MKL A;  2HGC A;  1KQ9 A;  2XPW A;  2DT6 A;  4BS9 A;  2VQC A;  3H92 A;  5M5X J;  1JKR C;  3WG7 H;  4IHT A;  1WJ5 A;  3I9V 2;  3I55 I;  5IT3 A;  1TL8 A;  4WXD A;  4ZYG A;  4I0B A;  5ICE A;  3GZ6 A;  2ADU A;  2XAQ A;  1YS6 A;  3HKZ N;  1KYZ A;  2EQR A;  2HFH A;  2IXS A;  4E7I A;  3OOU A;  4F91 B;  2W48 A;  2VBZ A;  4C2T A;  3J80 K;  5FKO A;  3C2H A;  3ZMV A;  2LKP A;  2KZG A;  2UWM A;  1FOW A;  3E7L A;  2LK2 A;  1DP3 A;  2LLK A;  1IXC A;  1XSD A;  3KEO A;  3L9F A;  2DDA A;  4CCK A;  3S3O A;  2M8E A;  1XCB A;  4X0G A;  3I5U A;  2DA1 A;  2LH9 A;  1ETY A;  4B09 A;  3I54 A;  4CZC A;  1Z77 A;  3HZJ A;  4XMY A;  4XLN F;  2IS4 A;  3BQY A;  1E17 A;  5BMZ A;  1HW1 A;  3W6V A;  2K40 A;  3HSF A;  1G2H A;  2X1D A;  2XSJ C;  2HOT A;  2KJB A;  2XSD C;  2G7H A;  2H94 A;  3LFK A;  2VL8 A;  4R79 A;  3W2A A;  2PJP A;  1XGN A;  2P81 A;  3E5Q A;  1R22 A;  3KX2 A;  3PM1 A;  3HM5 A;  3FIW A;  2O5R A;  4RGS A;  3T5X A;  2AQE A;  1X4P A;  3BZK A;  1GLN A;  3ABM H;  2ZME A;  5J1U A;  5LEK A;  1VQ7 I;  2QBY B;  1FIA A;  3C2B A;  3PL8 A;  1LE8 A;  2X85 A;  2Z2S B;  1ZG3 A;  3FZV A;  1JKO C;  4C9Y A;  5DCF A;  5ICF A;  2NS0 A;  3ECO A;  2ZXW H;  5J4V A;  1ETX A;  4P55 A;  4PSW A;  3JR9 A;  2M7A A;  4OU0 A;  4PGG A;  2DBB A;  4LLN A;  2GIV A;  2CSO A;  1FYK A;  2VI6 A;  2F2E A;  3DTK A;  3LFU A;  5DD4 A;  2Y9Z A;  2E60 A;  3SEQ A;  1IN5 A;  3UKG A;  2DOD A;  1R71 A;  4PFP A;  2ECB A;  1S7A A;  1MJ9 A;  4CYC B;  4XOP A;  1W5T A;  1W7P D;  2X6Y A;  2Z99 A;  3JW4 A;  4DOZ A;  5F0C A;  2HVR A;  4UHT A;  4OAY A;  3HDD A;  1ON1 A;  3GFL A;  2DW4 A;  3IC7 A;  4CGZ A;  1MDM A;  1V55 H;  1D5V A;  4DZJ A;  3GXO A;  1R1T A;  1M1E B;  1XGO A;  4DQ2 A;  2V9V A;  2FA5 A;  2P8T A;  3O8H A;  3PNY A;  2BZT A;  3PUB A;  1E0E A;  5ED4 A;  1H9T A;  3BTL A;  1ORK A;  1TT0 A;  2DTZ A;  4ZZL A;  5DYM A;  1HCR A;  3JRI A;  1D5Y A;  2X4H A;  1CF7 A;  2IEK A;  5DD8 A;  2RAE A;  3ZQC A;  2NVT J;  2M2E A;  3PO2 J;  3S15 J;  2VJJ A;  1MNE A;  3CQZ J;  3M8F A;  4IJA A;  3EQL F;  3HHH A;  5FB2 A;  1PP7 U;  1OFC X;  1JI8 A;  3FF5 A;  5J40 A;  4A0Y A;  1ACI A;  3QWL A;  4CSW A;  5BS6 A;  2VJ5 A;  3M8E A;  4P96 A;  3GBG A;  3CMY A;  1MBG A;  3HTU A;  2DA2 A;  2JVH A;  2A68 F;  2DA7 A;  3BJA A;  5E17 F;  3U21 A;  4KMF A;  3GF2 A;  3J80 Z;  2KDZ A;  2L02 A;  4NUB A;  4JX5 A;  5EEG A;  4EGY A;  1REP C;  3EUK L;  3E6D A;  4II2 A;  3WTU C;  3V7C A;  4MHG A;  1OJL A;  3BLY A;  3HOY J;  2VBX A;  3F8M A;  3K4B A;  2V6C A;  3IRQ A;  3QAH A;  2W1O A;  4MEY F;  4G9Y A;  1S5L C;  3CO7 C;  4E7K A;  4U0Y A;  4BQA A;  4HF1 A;  5AIQ A;  2OD5 A;  2ZXI A;  3PSI A;  4G6D A;  4M9S A;  5JFR A;  1TC3 C;  2QF7 A;  1AWC A;  2LY9 A;  2M87 A;  4P5O A;  3SZP A;  2DFH A;  3LNQ A;  3QPH A;  2ZJR F;  2DMT A;  4Z2Y A;  3CMM A;  3H36 A;  2EZK A;  2OPT A;  2KDO A;  2OQR A;  4U0W A;  5E3L A;  1BC7 C;  1SEU A;  1I1G A;  4C2U A;  3ABL H;  2IRF G;  3FM3 A;  3CLO A;  1OYW A;  2XF7 A;  2VOP A;  4FX0 A;  1TBX A;  3LSP A;  1WGX A;  1UST A;  2KQR A;  4FTH A;  2ZKZ A;  3HSE A;  3HBL A;  2V1D A;  3Q9S A;  1J2X A;  5CJ9 A;  2IA1 A;  5CPR B;  3FX3 A;  5EDN A;  2DYR H;  2ZME B;  2W7N A;  2GWR A;  5C4J J;  2C6Y A;  5LHI A;  3WG9 A;  2BBY A;  2NS8 A;  4CCL A;  1LE8 B;  2IJL A;  2EFP A;  2X48 A;  3TKY A;  1LPQ A;  1PUE E;  1EH7 A;  3SDG A;  3TDU C;  1WJB A;  2IA0 A;  1YIO A;  1ZGJ A;  4DBR A;  5K7H A;  4RLQ A;  3LSK A;  5FFX A;  4GFB A;  2VXD A;  2PJR A;  1JTY A;  4Z6Y A;  4PJL A;  1ZRE A;  2VAS A;  3IAM 2;  4A3L J;  3S3M A;  5GAD J;  3KLO A;  5E3M A;  3S1M J;  3CCY A;  2HWV A;  5J4Y A;  1W5C C;  1IGN A;  2FBI A;  1HW2 A;  4BE0 A;  5HOO A;  1ZAR A;  2E2J J;  2VQG A;  3BT9 A;  2DOE A;  1E3P A;  1HOM A;  1A6Q A;  4TV7 A;  1YLF A;  1RI7 A;  2K27 A;  3K4K A;  4AVZ A;  5BPD A;  2RN7 A;  1B6A A;  3DLL F;  1B59 A;  2LY1 A;  3ZN1 A;  4AVP A;  4ZC3 A;  5HLH A;  4AU7 A;  1SFE A;  2CW7 A;  2DA3 A;  5BOX A;  1QVU A;  1MDM B;  3HOZ J;  4IVN A;  4IXA A;  4BU2 A;  1YYV A;  3DBH B;  1IV8 A;  3VOD A;  2ZJ2 A;  2DAO A;  1Q1H A;  1DGR M;  3F9K A;  2XB0 X;  3HRM A;  4BAC A;  4CHU A;  5CQG A;  2E34 A;  1I27 A;  3F6O A;  3FK6 A;  1XMX A;  1ZR2 A;  1CF7 B;  2F4O B;  3J7Z I;  3OS2 A;  2WAF A;  5JLX A;  1I3A A;  1RZ4 A;  4ESJ A;  2LVS A;  1T6S A;  3IUO A;  3GO5 A;  2ISY A;  2L2O A;  1TQP A;  1UHW A;  2CQQ A;  3L09 A;  4BE2 A;  1OCC H;  4BAY A;  2X6X A;  3CME I;  3V8K A;  5GP9 A;  2D5V A;  3KCC A;  3PJR A;  4WF2 A;  1B9M A;  2B0L A;  2WAQ N;  2ZME C;  1E3O C;  2H8W A;  1DU0 A;  4RM2 A;  2HXO A;  1KQ8 A;  2BGC A;  4ABZ A;  1FT9 A;  1Z91 A;  4HQE A;  3TP0 A;  2DQL A;  1SAX A;  2R7S A;  2L7M P;  5ICG A;  1H8A C;  1IDZ A;  2RNG A;  1P4A A;  2ZXH A;  1ZH5 A;  3MN2 A;  3G1L A;  1WI9 A;  4HNT A;  2IT0 A;  2NRA C;  4HA8 A;  1D1B A;  1TZL A;  3D5L A;  3BTC A;  3BZC A;  4ON0 A;  3AKZ A;  4UV9 A;  3GTM J;  1X3W B;  4BJT A;  1RPW A;  5HS7 A;  2CV0 A;  2D1H A;  2DA6 A;  3A0B C;  3ERM A;  3IH4 A;  1H9G A;  1R5I D;  4D1Q A;  2LFB A;  1W7P A;  5FRN A;  4A3I J;  4WK8 F;  4LIT A;  3VWB A;  1I6X A;  5GTI C;  1D0Y A;  1R23 A;  1AOY A;  2CW8 A;  4G7H F;  2PN6 A;  3Q3S A;  3CF5 F;  3QPS A;  4CCO A;  4L9T A;  1WJC A;  4KT6 A;  1BOA A;  1YTY A;  2D1V A;  1G4D A;  2O6G E;  5TGT A;  1TW2 A;  5J8F A;  3TW7 A;  4ZDP A;  4XSX F;  4N4O B;  4RDU A;  4KIB A;  3SQN A;  2EZH A;  2F5F A;  3AG3 H;  1T0F A;  3MMY B;  1OKR A;  4Y17 A;  4B4C A;  3WU1 B;  3H9G A;  2WBM A;  2A3S A;  1RNL A;  2EV6 A;  4QTR A;  1HA8 A;  1WZ2 A;  1PYV A;  4OMY A;  4DJA A;  2MW8 A;  3W6J B;  1R6R A;  1TLH B;  2KHM A;  1WWX A;  2XKP A;  3HSR A;  5LGU A;  5D5V B;  2Y31 A;  1LQ1 A;  3M1C A;  1T95 A;  1QHH D;  2IA2 A;  4E6K G;  2JZY A;  1BL0 A;  4KNY A;  1SD4 A;  2PJR B;  3F23 A;  1WJA A;  4I98 B;  4S04 A;  2Z9O A;  5HS8 A;  1K6Y A;  5A2Q Z;  4G7Z F;  2DMU A;  2VIX A;  3ZQF A;  2CW0 F;  3BG5 A;  3WTW C;  1YJW I;  5CVI A;  3G2B A;  1LKX A;  1BIB A;  4BY7 J;  4CCM A;  1UB9 A;  1FZP B;  2XAF A;  2B9S A;  3OIP A;  3VYS B;  1HF0 A;  4M71 A;  1ZAO A;  1FYL A;  1O7F A;  5DUI A;  5E79 C;  4EEF G;  4GXO A;  2OUM A;  1E2X A;  2ID3 A;  4V19 K;  4EV0 A;  2PI0 A;  1U5T C;  4E7Z A;  4KIS A;  3FXL A;  1J75 A;  1RES A;  1MND A;  2M0M A;  3LA7 A;  4EJW A;  3P9I A;  2QA4 I;  3W6K B;  3C18 A;  1D0Z A;  2R5Y A;  3PUF A;  1UMQ A;  2DMN A;  4PFO A;  1VQN I;  2VPR A;  3KP2 A;  4LGW A;  4UUS A;  3OMY A;  1R58 A;  3MEX A;  5EEA A;  3FMQ A;  2O03 A;  2XAS A;  4F52 A;  3HXL A;  5JI6 A;  4IX7 A;  3HGG A;  4HF0 A;  3VEP A;  1LVK A;  4XRM A;  1PP8 F;  4ZDO A;  3BC8 A;  4ENK A;  3RKX A;  5L3C A;  2H8R A;  3S2H J;  2NOG A;  2KIQ A;  1LEA A;  2JA5 J;  1BN5 A;  2K9S A;  1YIJ I;  3L7W A;  1JKQ C;  1WQ2 A;  4B1R A;  4FIS A;  4LD5 A;  3QP5 A;  2CV2 A;  1IRG A;  1OLT A;  3FWE A;  3FDY A;  3MQ0 A;  4PDK A;  4KIT B;  3F21 A;  2K9L A;  4UVA A;  2XRN A;  5KK1 A;  4F93 B;  4M3E A;  1ZHF A;  1KA8 A;  3E0J B;  3HOW J;  3CUO A;  3J7Y J;  3HHG A;  4A3B J;  3N05 A;  5GPA A;  2QUF A;  1JUS A;  3IKV A;  3WU0 A;  4HX7 A;  1PJR A;  3M9A A;  2LNB A;  3FBI B;  1OR7 A;  1JHH A;  1ZGA A;  1BA5 A;  1JUP A;  2EIN H;  5D5U B;  1VQ5 I;  1W7P B;  3WTY C;  5LFA A;  5L3F A;  4IKF A;  4CUG A;  2M3A A;  2JSP A;  3BR0 A;  2F5D A;  2RGV A;  5K5O A;  3RYR A;  2STT A;  2JK3 A;  1YFH A;  3WGI A;  4A3F J;  3VYT B;  3ERE D;  2E19 A;  3NWT A;  2JA7 J;  3JRF A;  2K3P A;  4YRV A;  1ZRF A;  2E5Z A;  1O57 A;  3DKX A;  3EET A;  2E7W A;  5F0F A;  5EF6 A;  2TDX A;  3ZCO A;  1QU3 A;  4LK1 F;  3DWL E;  4C2M J;  1RUO A;  2KIF A;  2ESN A;  2KMU A;  3I4P A;  4I76 A;  1J7K A;  3SHF A;  2QQB A;  4FE7 A;  3KEY A;  1S72 I;  4E7S A;  3RDI A;  3A0H C;  3DPT A;  1P4X A;  1RET A;  4WXH A;  4U87 A;  4D5F A;  5L3B A;  3JRE A;  2DTR A;  2LRD A;  3HGY A;  5HDN A;  1GDT A;  3TQN A;  2QKL B;  1FWZ A;  1OYI A;  3ZMU A;  3OYG A;  1FPQ A;  3FIS A;  2IPQ X;  3K1M A;  3WE2 A;  3QOP A;  3CP8 A;  1N75 A;  2QQA A;  2V1N A;  4DIQ A;  5LRS A;  2LY2 A;  4JYK A;  2Y30 A;  3ZQ7 A;  3FMS A;  2KRC A;  2EIJ H;  4ESF A;  3OYA A;  2KLO A;  2XKO A;  3JTH A;  1MJA A;  3GYH X;  4ZTF A;  4M6X A;  2DCE A;  1MKM A;  2OCC H;  2QBY A;  4H0E A;  5FLX K;  3LSH A;  1BW6 A;  2K7L A;  2LF7 A;  4V2G A;  2ZSI B;  5E1W A;  1QBJ A;  3H9Q A;  4X6A J;  4WCG A;  1DDN A;  1IN8 A;  4RA2 A;  2CUF A;  4XR6 A;  2VE8 A;  1TWA J;  2L4A A;  2DOA A;  2DFF A;  2JPC A;  1LFU P;  2E36 A;  3FXU A;  2EK5 A;  3DV8 A;  1TP4 A;  2M7B A;  1POG A;  3PIO F;  1P92 A;  3GME A;  2O61 A;  1T98 A;  4JOM A;  3MAJ A;  2M1B A;  3A03 A;  3P7N A;  4ZYH A;  2WY7 Q;  4AIK A;  4BNC A;  2FOK A;  2W00 A;  3JRB A;  3QYF A;  2Z16 A;  4AID A;  3RJP A;  2VC0 A;  1Z7U A;  4EVI A;  1JHF A;  2JPB A;  2J5P A;  1XTA A;  3KLN A;  1AKH A;  3R6S A;  1EJ9 A;  4RM3 A;  4BKX A;  2R5Y B;  2JQ7 A;  1T38 A;  2X1C A;  2XF6 A;  4OIR F;  3LSI A;  5D8L B;  4UUS B;  3RZD J;  1FOK A;  4QPQ A;  4IQJ A;  4UVC A;  5EYR A;  1T56 A;  3GVA A;  5LGT A;  5E20 A;  5FKL A;  4DYQ A;  4Y7N J;  2Z33 A;  4HOB A;  4IPA A;  2FXA A;  4Q5S F;  3WGG A;  3OYF A;  1MMS A;  3BRO A;  3ZXS A;  1UFM A;  2XHK A;  4ZTJ A;  2WB1 A;  1QO0 D;  1ZK8 A;  2HDC A;  2H6C A;  1CQT A;  1XB4 A;  2K02 A;  2VQH A;  1WKM A;  3WTV C;  3ZMT A;  4L0Y B;  4F3Q A;  3F72 A;  2E2I J;  4D5C A;  2ZJQ F;  2ACJ A;  2W82 A;  1QRY A;  1FLI A;  1Z3Y A;  2QLZ A;  2FX0 A;  3S2W A;  2OU2 A;  2V4J C;  2HQ5 A;  5EGO A;  2QKM B;  1IF1 A;  4KA4 A;  3IP4 B;  3I4N J;  3X2Q H;  3HG9 A;  5E1X A;  4YII A;  1RUN A;  4BBS J;  5J1R A;  1OCP A;  2KFD A;  2E5N A;  1MH3 A;  4NHJ A;  5GAE J;  1JT6 A;  2GA1 A;  4J01 A;  3RYP A;  4A3M J;  1KZH A;  2VKV A;  2M8G X;  4D7N A;  2HYJ A;  1VFC A;  3LA2 A;  3WTZ A;  3DU5 A;  2MG4 A;  2COM A;  2EV0 A;  2MD5 A;  1QZY A;  2DK5 A;  4CZZ A;  3D0S A;  2WY8 Q;  4M74 A;  3DQV C;  4HBL A;  5FRM A;  3W2V A;  3BWG A;  5IP6 A;  4BXX J;  1W0U A;  2K9N A;  3L2C A;  1Z67 A;  1QPI A;  2DQR A;  3NRV A;  3GLL A;  2K85 A;  2GZW A;  1HC8 A;  2OZ6 A;  4MQ9 F;  4YFN F;  4BUP A;  2HYG D;  4XKW A;  1MMG A;  3KYD B;  4RB1 A;  4XON A;  2PLY A;  3K69 A;  3OYM A;  5L3G A;  3HKZ A;  4ZDL A;  2E2H J;  1B1B A;  2BEO A;  4G94 A;  1Q1V A;  4I0A A;  5LEJ A;  1R5H A;  1Y1V J;  1G59 A;  3ZR8 X;  1R4N B;  1R4M B;  3HPG A;  4QSH A;  4WWC A;  3P5J A;  1DUX C;  3HC7 A;  2VB6 A;  3B02 A;  5KAI C;  2CQ7 A;  2L9S A;  1X1A A;  1HSJ A;  1H89 C;  2VC1 A;  2BY3 A;  2BY2 A;  4WXC A;  5FLX Z;  1MW7 A;  2Y69 H;  2CYY A;  1J59 A;  1ZRC A;  1XMA A;  1IN7 A;  1KU3 A;  2ZSH B;  2E1N A;  2HI3 A;  5DCM A;  2E35 A;  4BXU A;  2X6W A;  3A1Y A;  2MAB A;  3OR1 C;  3CDL A;  3I71 A;  1FY7 A;  1WCM J;  2O3F A;  3CF2 A;  3J81 Z;  1SFU A;  2W84 A;  2F5C A;  1IRX A;  2H1L A;  1MBH A;  2K4J A;  1QZE A;  3FXM A;  3O8G A;  2EFN A;  1FOY A;  1X58 A;  4AYB N;  2V6E A;  3SXY A;  4BL0 B;  1L3L A;  4L5I A;  3K1N A;  1MBF A;  3H3Z A;  4OMZ A;  2IBD A;  4RAF A;  1SFX A;  5F04 A;  3ZOB A;  1UAA A;  4KDP A;  3J7A Y;  5IT9 K;  2EFQ A;  1OR7 C;  4G7O F;  2XUB A;  3BJO A;  1BJZ A;  3JRG A;  2B7E A;  4BHB A;  3BR1 A;  2WAD A;  2VKH A;  2NXN B;  1IUY A;  1AKH B;  4IHS A;  2FNA A;  5LBQ A;  2XC7 A;  1J0R A;  3HJE A;  4CYD A;  1S6L A;  3WHB A;  5JHF A;  3LSR A;  1P9Q C;  1O3S A;  3CES A;  3BDD A;  3J7A O;  3R60 A;  2X6O A;  3I58 A;  3HL2 A;  3CJQ B;  1W1W E;  3DXJ F;  3I59 A;  3VFZ A;  4E7L A;  4I2O A;  4HSR A;  4NBQ A;  4KIC A;  1MMD A;  5TRD A;  1VQP I;  1Z1D A;  3BG6 A;  1FIP A;  3HRT A;  4IHY A;  2JA6 J;  4BEH A;  1VQ9 I;  3HOX J;  3Q0W A;  3VYR B;  4E7H A;  2K9M A;  1APL C;  2W24 A;  2OCE A;  4N9I A;  3MKZ A;  2N8G A;  5E1Z B;  4B3X A;  4AIJ A;  1S8N A;  1QZZ A;  1T2K A;  3RKW A;  5HNH A;  1JGG A;  3ZQG A;  1IO2 A;  2MC4 A;  1TWH J;  4Y15 A;  2FBK A;  5EGO B;  2HTS A;  3MKW B;  3K4L A;  1F36 A;  2OQG A;  4LLL A;  2F5V A;  3ZQH A;  3Q0U A;  3TW6 A;  1YW8 A;  3OIQ A;  3FXJ A;  3Q9V A;  1D1C A;  4A93 J;  5E3N A;  4BGD A;  3CDH A;  1KON A;  2HS5 A;  4A3E J;  2F4M B;  3E3V A;  4G8X A;  5M3M J;  1T33 A;  2VKD A;  3WTS C;  4KIF A;  2VOO A;  2XGX A;  4KT5 C;  1QQI A;  3OOP A;  4JP0 A;  1VZ0 A;  1X3Z B;  3LAP A;  3AG2 H;  2DMQ A;  4M3F A;  3DPL C;  3ZQQ A;  2ID6 A;  3KFW X;  3KZY A;  5AON A;  4B48 A;  1W36 C;  2NYX A;  3M8J A;  3KYC B;  1X4O A;  4B43 A;  3H0D A;  5KHD A;  2QQ8 A;  3PFY A;  1ON2 A;  4XRS G;  1Z9C A;  2R7V A;  4PJ0 C;  5BNG A;  3QOE A;  1USS A;  1I5Z A;  1QHG A;  3ISP A;  3TBI A;  3C2G A;  4NC8 A;  4ENM A;  1U78 A;  3R4K A;  1EA3 A;  2KRF A;  4Q48 A;  3S17 J;  1ULY A;  3LSJ A;  1BR4 A;  2RQP A;  2A6H F;  3D5S C;  4Y13 A;  2QSF X;  4IHV A;  4ETS A;  1FMV A;  2LP0 A;  2ELH A;  4AWX B;  4HDU A;  2DJN A;  5HLG A;  3B6A A;  2FJ1 A;  2VBY A;  1YOV B;  4KJZ A;  2XAJ A;  3QP6 A;  1ETV A;  5TJJ A;  3CCL I;  2L01 A;  2QWW A;  1KYW A;  1V4R A;  2GM4 A;  2EA4 A;  4AUX A;  3ZMD A;  2Z1D A;  5DCM B;  3K70 D;  2NVX J;  3HYI A;  5J6X A;  4L5E A;  3F8B A;  2GXG A;  2DPU A;  3DP7 A;  4ITV A;  4LLG F;  1LUJ B;  2FEZ A;  3DCF A;  1YJ9 I;  2B63 J;  5IYB J;  3ZQI A;  2O8X A;  5CYV A;  1EH6 A;  4II3 A;  5H6R A;  2P5L C;  1FBU A;  3RIR A;  3TMO A;  3H5R A;  2LF8 A;  1K61 A;  1R1U A;  3DPU A;  2M0C A;  5IT9 Z;  1HW5 A;  5A2Q K;  4OIP F;  1LVA A;  2E1M B;  3HPH A;  3ZRG A;  3ABU A;  3PSF A;  5K7Z A;  2H6B A;  1U8R A;  2Y0S N;  5KCM A;  4J00 A;  3VPR A;  3E6C C;  4FET A;  3CO6 C;  3KP7 A;  4XN3 A;  2XGE A;  3BR5 A;  2M4K A;  4RB0 A;  2PEX A;  4BQQ A;  3GTG J;  2GXA A;  5D4R A;  4M9X A;  4ENJ A;  4M6V A;  4KN4 X;  5IYC J;  3I59 B;  4MIM A;  1X2M A;  1KQ0 A;  3DEE A;  4RGX A;  4N4N B;  1XGM A;  5HDK A;  1IRF A;  3N4M A;  4HX8 A;  3SFZ A;  5C44 J;  1QNT A;  3MWM A;  4BEH B;  4FE4 A;  2G0E A;  3I56 I;  3GTJ J;  2CQX A;  1Z3X A;  2IGK A;  4QLC U;  1JE8 A;  4O3M A;  4AM3 A;  2M45 A;  1VQ6 I;  2DJI A;  1U2W A;  1WVR A;  3GX4 X;  1FSH A;  4XM3 A;  2UUZ A;  3GW2 A;  5K1Y A;  2A07 F;  2RC4 A;  3F8C A;  2AO9 A;  4XLH A;  3BJ6 A;  1AU7 A;  5D5X B;  1DPU A;  4IHW A;  1Y6I A;  3K0L A;  3G1O A;  1U3E M;  4UB6 C;  1GHC A;  3O2P E;  1QGP A;  2A6T A;  3H3V K;  2CUZ A;  2AQF A;  5D5W B;  1NK3 P;  1OMI A;  3S2D J;  2A05 A;  1DPR A;  1RR8 C;  2KZV A;  3PNV A;  5GAG J;  3DKY A;  3ASN H;  2Y48 A;  3T8R A;  3EUA A;  2Y9Y A;  3QOD A;  5HS9 A;  2W4S A;  1X3U A;  1SMT A;  2EJR A;  4F92 B;  4A0X A;  2XIG A;  2UXN A;  3KEQ A;  3KE2 A;  1WJE A;  3IH3 A;  4M72 A;  2ESH A;  2PBI A;  3M7G A;  4FX4 A;  2X1E A;  1LDD A;  1KU9 A;  4JX4 A;  2RDP A;  4A5M A;  1MSF C;  3K10 A;  3OYN A;  3DFG A;  1MJB A;  3GUD A;  1G3T A;  2DXI A;  1A6I A;  2EIL H;  1IXR C;  2GLO A;  2Y75 A;  4JK1 X;  3RKQ A;  2MC3 A;  2WAQ A;  2EIM H;  1ZLJ A;  3CZ6 A;  2L7K A;  5B3S H;  3CD6 I;  9ANT A;  3FXK A;  2M9H A;  2L9V A;  4G6T B;  5B5E C;  3JCU C;  4HV5 A;  3AL0 B;  2W85 A;  2RV8 A;  4MNU A;  2GOX B;  4MLO A;  1Z0X A;  4RAG A;  2H1K A;  5KNL A;  2FQ3 A;  3BR6 A;  1JJ6 C;  1MZB A;  2IW5 A;  1Y1W J;  2EV5 A;  1R1V A;  2K4B A;  3GTP J;  3JRD A;  1GV5 A;  1OCT C;  2YU3 A;  4A5N A;  1G3S A;  5D6F A;  5CVJ A;  2VBW A;  1XMK A;  3HB9 A;  3SZG A;  3I4M J;  3IV5 A;  3PNT A;  4GRI A;  1WH7 A;  1XCV A;  1R7J A;  2HOE A;  3DEW A;  2FSW A;  4BJ6 C;  3GFJ A;  3H0G J;  3MFK A;  2V26 A;  4QWQ A;  4M3D A;  4OWR B;  4G12 A;  1EV7 A;  2MSY A;  2DLL A;  4FCY A;  4IRI A;  2HYF A;  3HIF A;  4ZZD A;  1EF4 A;  2IAI A;  2KRH A;  1B4A A;  4PJM A;  3KYL A;  2D45 A;  3RQI A;  2HEO A;  5L3D A;  1SVO A;  2JRM A;  5AIP A;  4DYC A;  1JGS A;  4O6J A;  2GBY A;  5LHG A;  3CCQ I;  5CVU A;  3P9C A;  2LC2 A;  2CRG A;  2MA3 A;  1DGW Y;  4HPQ A;  4LOC A;  1Z05 A;  4NQW A;  3V42 A;  4B3A A;  2VJI A;  3GCM A;  5LGN A;  1KU2 A;  1ZTR A;  2XAU A;  5EG0 A;  3H1C A;  2P4W A;  1SFK A;  2AXL A;  1ZG1 A;  5E18 F;  3S1Q J;  1Y0N A;  2VT2 A;  5GTH C;  5H6Q A;  2BHZ A;  1LDJ A;  3CDI A;  1SC7 A;  2X0L A;  1WRJ A;  2R93 J;  4JQF A;  1G3Y A;  5KAF C;  1TWG J;  1RR7 A;  4N0B A;  3DTE A;  2K3F A;  1JJ8 C;  3A02 A;  5HOD A;  2HQA A;  2F6C A;  2A5Y B;  4B8X A;  5FD5 A;  2MLG A;  5EJC A;  3IHU A;  3RQ4 A;  2I10 A;  3GWZ A;  4GO1 A;  1FP2 A;  5LD2 C;  5FRO A;  5DUK A;  4CCN A;  4LMY A;  3OWT A;  1HKQ A;  3S3N A;  2MD0 A;  3LQR A;  3AL0 C;  2FD5 A;  2K5C A;  4L0Z B;  4RS8 A;  1HLV A;  1OCO H;  3HRS A;  3CC7 I;  2CUE A;  4A3J J;  5FLM J;  1LNW A;  2KP6 A;  2M30 A;  3DTI A;  3FXQ A;  5IOZ A;  4RMN A;  1R36 A;  3LWF A;  3O3K A;  4Y4R A;  2ZB9 A;  3EUH A;  3OSF A;  2PFB A;  2HDW A;  1Y0U A;  4AC0 A;  3T8T A;  5DV5 A;  1D8K A;  4L9V A;  2BXY A;  5H20 A;  5L3E A;  5ERI A;  5BPI A;  4XID A;  1OIS A;  3FXR A;  3S32 A;  2DT5 A;  1UCR A;  2Q8K A;  5FJ8 J;  2JA8 J;  2QSG X;  2QSH X;  2RQQ A;  4PSX A;  3OV8 A;  1TT5 B;  2OA4 A;  3OS0 A;  2FQ4 A;  2MBF A;  3WTX C;  3BG3 A;  2ISZ A;  1RKT A;  1SFO J;  4DNC A;  1O3T A;  3JAM K;  4KMU X;  2IGO A;  4NC6 A;  3VB2 A;  1R49 A;  5D4S A;  2XRO A;  2IS6 A;  2JN6 A;  3KET A;  3MZY A;  2A69 F;  3U9G A;  3KZZ A;  2FMY A;  1K4S A;  2HTJ A;  1C0W A;  2DI3 A;  4OIQ F;  1LDK B;  4EMS A;  4S05 A;  1R5G A;  3BOQ A;  3L00 A;  3TED A;  3BZ6 A;  3VDX A;  1CGP A;  3K1P A;  2AS5 F;  1A35 A;  2PMZ N;  2QEX I;  4HF2 A;  3E1S A;  2K9Q A;  5HLT A;  2CH0 A;  4BHC A;  1NG6 A;  1N77 A;  3KP5 A;  3MD2 A;  5FD6 A;  1GXQ A;  4GYI A;  3UNG C;  4LIU A;  2EFW A;  2JVG A;  2ME6 A;  4HG2 A;  2YX7 A;  3AG1 H;  2ME0 A;  1K78 A;  3K4N A;  5DDG A;  3C1D A;  3OYD A;  2X9D A;  2STW A;  1GVD A;  3VYU B;  4CIC A;  3PIP F;  1S9H A;  5FFZ A;  2I5U A;  2YUS A;  2OBP A;  2YS9 A;  3L2Q A;  3IRR A;  4XLA A;  4QIW N;  2BE5 F;  1ETK A;  2NNN A;  3BTJ A;  3MZH A;  1VQ8 I;  2R3S A;  3QYE A;  2HOS A;  4GYG A;  3ABK H;  4R8H A;  4HLY A;  3RCO A;  4XN0 A;  4B47 A;  3VSL A;  3F0C A;  2RRE A;  4XKV A;  3M1E A;  4RAZ A;  3G1M A;  4NQW B;  4A3D J;  3J81 K;  1R9T J;  4KIG A;  5EG0 B;  2HXI A;  1QA6 A;  1JKP C;  1ZQ3 P;  1I3Q J;  3HTS B;  2EB7 A;  2G7U A;  3ZMZ A;  1XD7 A;  1MMN A;  3QRF F;  2L9R A;  1NHA A;  4YG2 F;  4IRG A;  3M07 A;  3TO7 A;  1U9O A;  5B1A H;  4RGU A;  1GV2 A;  1ZLK A;  5JHU A;  1SD6 A;  1D8J A;  4HLX A;  1IXS B;  1T08 B;  4GGG A;  2BY1 A;  5E3O A;  1YX5 A;  4Q47 A;  4BXF A;  2XAH A;  2L7F P;  2ICW G;  4JBA A;  3ZGK A;  2AHQ A;  1MBJ A;  1WH5 A;  3E6M A;  4Y33 A;  4RB2 C;  1VQM I;  1BR2 A;  4HST A;  3BG9 A;  1BW5 A;  3CCJ I;  2XVC A;  2IS2 A;  3EDP A;  3RKY A;  1YJN I;  1FX7 A;  2CV1 A;  2Y2Z A;  3GZN B;  3BPV A;  4OOI A;  2LYC A;  5JR3 A;  2DN0 A;  5GAH J;  3WTT C;  2IS1 A;  2VXZ A;  1T0F C;  3FXO A;  2ZNY A;  4G6Q A;  4XSZ F;  2O8K A;  1G8X A;  4NDL A;  3L2W A;  4NB5 A;  3FHN A;  4FQG A;  3ZQL A;  2JA2 A;  4FT8 A;  3B73 A;  1G6N A;  3A4C A;  2WTE A;  4LFU A;  1YX3 A;  3TOB A;  4S0H B;  4UY8 I;  5TIS C;  5M5Y J;  1V5E A;  3G3Z A;  3FMR A;  1F9N A;  3CTA A;  1ZKG A;  4EJU A;  4MTD A;  3I0T A;  3GTO J;  3M3Y J;  4UVB A;  3T1B A;  1SD5 A;  2MLK A;  5K7F A;  5FKM A;  4A6D A;  4UUT A;  4JX6 A;  3JRC A;  1WJF A;  1R00 A;  3CJT B;  5HDG A;  3JAM Z;  3ULQ B;  4DZP A;  1XSX A;  4P9F A;  3OYB A;  1X1P A;  3BPX A;  2CFX A;  4ENN A;  2Z3Y A;  2H27 A;  2LSO A;  4MO7 A;  2EFO A;  2LBF B;  2CQN A;  2EWN A;  3OYH A;  3IAS 2;  5F08 A;  3FKJ A;  1F5T A;  5FLV A;  4CCJ A;  5M5W J;  2MFZ A;  1IJW C;  2R7Q A;  3BG7 A;  2DA5 A;  1MGT A;  1FBS A;  3BP8 A;  2ZCW A;  4ZYA A;  3JRA A;  1SMY F;  4PJJ A;  3FHZ A;  3E6B A;  2MGQ A;  1I1S A;  3L2V A;  2A6E F;  2LRE A;  2HPI A;  4XOT A;  4B44 A;  4L9N A;  2BXZ A;  1IC8 A;  4WX9 A;  4A2U A;  1SAU A;  1TW3 A;  2GXB A;  2W57 A;  1GUU A;  1Y56 A;  3G4S I;  1P2F A;  2V1U A;  1YQA A;  1D0X A;  2VOD A;  4HX4 A;  5J47 A;  4XLE A;  4IEJ A;  1O4X A;  2D2W A;  1K78 B;  1ZR4 A;  1YRN A;  2OZU A;  2ZFW A;  1ODD A;  1XPX A;  2EIK H;  4YEL A;  2YSR A;  2JTV A;  3K2A A;  2G9W A;  2A61 A;  1MMA A;  1ZEL A;  2YX4 A;  2OV7 A;  3IWF A;  3OL3 A;  3GTL J;  1ZG5 A;  3LST A;  3WE3 A;  4UUV A;  1OQY A;  2WC2 A;  1V5G A;  4E70 A;  1ETO A;  3EUH C;  2KPM A;  3IKT A;  3ASO H;  2RKH A;  1V3F A;  3K70 C;  3G6E I;  2QM3 A;  3CJN A;  3L2R A;  4MFD A;  3HOU J;  2XRL A;  2L5Q A;  2X51 A;  4A3C J;  4PUS A;  3OYE A;  2HZT A;  5DEQ A;  3ZP5 A;  3UR3 C;  2JT1 A;  1FP1 D;  2QGU A;  4LG0 A;  1TTY A;  2L3D A;  2HR3 A;  3H35 A;  5CVV A;  1N78 A;  3ELK A;  1D3Y A;  3BR3 A;  1ONV A;  1ETQ A;  2E71 A;  2W25 A;  2CJJ A;  4YIF A;  4IF4 A;  2COB A;  1HDD C;  2NS7 A;  2R7R A;  4CO8 A;  1XSV A;  3HOS A;  1OPC A;  2O0Y A;  5C4X J;  4FHT A;  1STZ A;  3C7J A;  3DF8 A;  2H09 A;  1HKS A;  1GT0 C;  4XLF A;  3ZMS A;  1SVL A;  2HZD A;  1ERD A;  3ML6 A;  1O3Q A;  5J8C A;  2PMH A;  2O7O A;  4U0V A;  3QQA A;  1A36 A;  4XQF A;  2LOO A;  4HQM A;  2EPF A;  1YO5 C;  2M4G A;  3V7R A;  1GVJ A;  3K7A J;  4AYB A;  1J5Y A;  2BW3 A;  4OIO F;  2CU7 A;  4EAT A;  2ZNZ A;  5F64 A;  1K4T A;  1P7I A;  2HQN A;  3BCB A;  1EKE A;  4EM0 B;  4IQ4 A;  3RTR A;  2CS3 A;  1W0T A;  1MBE A;  2KJC A;  1AA7 A;  4EQQ A;  3RPU D;  2PG4 A;  3KP4 A;  3PQJ A;  4HNV A;  1VQK I;  1TNS A;  3R0J A;  3H5N A;  3K4J A;  2R4G A;  1BI3 A;  1XDS A;  2P6T A;  3HOV J;  1FSE A;  3MZ8 A;  2JUC A;  4YFK F;  1A5J A;  1IUF A;  4I09 A;  5KVR A;  2YU9 J;  3F3X A;  2P7C B;  1IRZ A;  3MCZ A;  2I8D A;  2VON A;  1QVT A;  2DDB A;  5HVQ C;  1UHM A;  2FUG 2;  3SFI A;  3OYI A;  1B72 A;  4R1H A;  1W5S A;  4XNF A;  4BH9 A;  1KGS A;  1MH4 A;  1FBQ A;  4CH7 A;  3HRU A;  5IP7 J;  2DMP A;  2XF5 A;  3CCU I;  4DBQ A;  2EA2 A;  2P6S A;  5E8I A;  4I7H A;  4PJN A;  2TCT A;  1O3R A;  3LSM A;  2NNY A;  1BIA A;  3A01 A;  2HKX A;  3S16 J;  1A04 A;  2E7X A;  4ZYE A;  3V8J A;  1UZC A;  1DQU A;  3H9J A;  2A5W A;  5H2F C;  2QCO A;  1BM9 A;  2M5W A;  1FEX A;  1TWC J;  3I64 A;  4M3B A;  4PK4 A;  1JT0 A;  3RI4 A;  1IV6 A;  4EM1 A;  3CUQ A;  2HQR A;  1FTZ A;  3DKW A;  4Y3O A;  4EGZ A;  5DM7 F;  2QQ9 A;  1YRN B;  5ILS A;  2CG4 A;  1U5T A;  1H88 C;  1U0J A;  2K86 A;  1X2N A;  2CFO A;  2QZ8 A;  3G73 A;  2DFE A;  2UZK A;  5CKT A;  4C30 A;  1YG2 A;  2RNJ A;  3GZ5 A;  3L2U A;  4F7Z A;  1VND A;  1X1B A;  4Q4Z F;  4HV6 A;  2HPM A;  1U9N A;  4MFE A;  1YS7 A;  1HBX G;  3PFI A;  4F55 A;  1OCZ H;  2DA4 A;  1VF9 A;  2R7O A;  5EZH A;  2ZO4 A;  4YEJ A;  4M9Z A;  5EZG A;  2F5E A;  2PQ8 A;  5IYD J;  1HDP A;  3WGH A;  1XG1 A;  2VLA A;  4NC7 A;  2HOA A;  3OSG A;  1T39 A;  2AXT C;  3HUG A;  1RIO H;  6PAX A;  4A3G J;  3DU6 A;  2VKE A;  2ZJP F;  1NK2 P;  2QEN A;  2NVY J;  3CCS I;  4IZZ A;  1JXS A;  3OYJ A;  2FOW A;  3OY9 A;  4LG0 B;  2WAE A;  3OIO A;  3E97 A;  4FAS D;  1FOX A;  4A3K J;  1Z6R A;  3SEZ A;  5LLQ A;  2R7U A;  2HVQ A;  2KIM A;  3KIO A;  2QVO A;  4C3I J;  2NVU B;  5D6E A;  1HXD A;  1UHS A;  3LOC A;  1WFX A;  4ZH4 F;  2P7V B;  4W1U A;  2XB5 A;  3LL7 A;  1U6G A;  2OAZ A;  2V79 A;  1P6R A;  1OCR H;  3IL2 A;  4O5V A;  1I50 J;  3W2W A;  1PUF A;  1P4W A;  3R61 A;  3K9T A;  4BJ5 C;  3QU6 A;  4HYE A;  1J9I A;  3F8F A;  3BQZ A;  3FM5 A;  1PVE A;  2CUJ A;  5F27 A;  5F1R A;  2LTP A;  3QPL A;  3OYC A;  1D1A A;  3GTK J;  4I99 C;  5LHH A;  1S7O A;  1Z7L A;  2BW3 B;  4BDY A;  3S14 J;  1L0O C;  2HNH A;  2Q2E A;  2R7F A;  5B66 C;  1VQ4 I;  2ELK A;  1LFP A;  4BQN A;  3DBR B;  1TWF J;  1IZ1 A;  2ELJ A;  2IGM A;  2V1X A;  2Y0S A;  3S1R J;  2R7Z J;  5FKK A;  1IN4 A;  3D5R C;  3NWS A;  4XIC A;  1RKW A;  3LAJ A;  5FO5 A;  4KFC A;  5BQT A;  5GPC A;  1H0M A;  1I39 A;  2GQQ A;  4BHP A;  4QPO A;  5J3L A;  3VSK A;  3KPH A;  3Q5F A;  1AHD P;  3K4M A;  4A69 C;  2CGP A;  2R7T A;  2PMU A;  1KU7 A;  1TQI A;  4J19 A;  2FRH A;  2LDU A;  2XDV A;  4EM2 A;  4KN7 X;  1ITY A;  2BY0 A;  2UXX A;  1V5F A;  1YIT I;  1B8I A;  1I6H J;  4HRI A;  4KYW A;  1XN7 A;  5DS9 A;  1B72 B;  4D7M A;  3TGN A;  1UJ8 A;  1BJA A;  2P0W A;  3LA3 A;  1SAN A;  2L4M A;  4RAY A;  2HVS A;  3AFH A;  2BHY A;  2BYV E;  3S8P A;  3M4O J;  5FKN A;  2E1C A;  1VQO I;  3G71 I;  3NAR A;  3A01 B;  3DEU A;  2E1M C;  4MTE A;  4XKC A;  2GA2 A;  3QYB A;  2V9P A;  5EEH A;  1W4M A;  4H4K C;  4RB3 C;  2DT7 B;  5IOY A;  3L1P A;  1N25 A;  2FML A;  1FMW A;  2LR8 A;  3K6G A;  3Q0V A;  3C3W A;  1W36 D;  3CUQ B;  3E5U A;  3CCM I;  1BR1 A;  2LMD A;  5IP9 J;  3I53 A;  5DM6 F;  5JVG F;  2R5Z A;  1U5T B;  5LRR A;  2ZFU A;  4V2F A;  3W3C A;  1ENH A;  2P5K A;  4W97 A;  3AAF A;  4XRF A;  1S3J A;  1HST A;  3TDZ C;  3U1D A;  3JSO A;  3GFI A;  1ZYR F;  4E7J A;  1X1D A;  2CMP A;  3JTG A;  3FK7 A;  1XC5 A;  2VE9 A;  1V54 H;  1XDU A;  2DK8 A;  4M6Y A;  4RBO A;  5CLS A;  1FYM A;  2HU9 A;  5HLI A;  1FTT A;  4OIN F;  4L5J A;  4AIH A;  2F48 A;  2M34 A;  3RPU A;  2LKX A;  1VTN C;  1LEB A;  4YIR X;  3ONQ A;  2Q0O A;  4DYR A;  5IPA A;  3HUG B;  2WWY A;  1U8B A;  3WU2 C;  2JRT A;  4I6Z A;  1O7L A;  1F4K A;  2JWT A;  4P9U A;  5JVT A;  2LKS A;  2J5O A;  1FC3 A;  2OTL I;  1TNT A;  1Y8Q B;  2MYS A;  4OAZ A;  3QU3 A;  4DGW B;  2DPD A;  1X19 A;  3CCR I;  1K83 J;  5E8G A;  4XL9 A;  5DTD A;  4GCV A;  3V7S A;  2CQK A;  2E1O A;  1WHU A;  4LJZ F;  4I01 A;  3B6C A;  2XGD A;  4IOC F;  3CJR B;  3S93 A;  1S7E A;  2LG4 A;  3REO A;  1ETW A;  5CQE A;  4L18 B;  4NNJ A;  4XOR A;  2L9N A;  4EJV A;  3IWZ A;  4UB8 C;  5JLW A;  4BY1 J;  2WV1 A;  1BC8 C;  1XS9 A;  4LK0 F;  5ICC A;  4D0P A;  1PUF B;  4HW0 A;  1F1Z A;  3ECH A;  2WA0 A;  1IW7 F;  4RGR A;  2VUM J;  1UEL B;  2XPU A;  2UV1 A;  4PGH A;  2F4I A;  4EJT A;  2GAU A;  5ILV A;  1BI2 A;  4GDF A;  1VI0 A;  3CMA I;  3T0Y A;  1Z21 A;  2EBI A;  1UG0 A;  4KUM A;  4XK4 A;  3IH2 A;  1QPM A;  4M3G A;  2Q2E B;  3DLA A;  1LJ9 A;  1J09 A;  4DW6 A;  3K4C A;  2KIS A;  3H3U A;  1XX5 A;  2JUG A;  3GTQ J;  1LFB A;  2ZXJ A;  3CUQ C;  3U2R A;  4L9J A;  1JUM A;  2OF7 A;  4BQO A;  4LG3 A;  2LD5 A;  4YFX F;  3D1N I;  2VJ4 A;  2WV0 A;  2GIZ A;  3CC4 I;  2V9K A;  1F43 A;  2GOM A;  5ILU A;  1S29 A;  1DP7 P;  1TQM A;  3SYT A;  4IL6 C;  1HQC A;  1ZRD A;  1WSU A;  2OTJ I;  3OR2 C;  1BI0 A;  1WI3 A;  3RSN A;  4X1E A;  3KP6 A;  1NG7 A;  3BY6 A;  2BV6 A;  2DU9 A;  1Y8R B;  4HEA 2;  2VT3 A;  3FBN B;  1A31 A;  2Q1Z B;  1B8I B;  3NAU A;  1MBK A;  4BE1 A;  3CC2 I;  3MKY B;  2XV4 S;  2Y0M A;  1SD7 A;  3FKI J;  2DOF A;  4CXF A;  4XLP F;  4ASN A;  1Y39 A;  4D9J A;  1NH3 A;  2VN2 A;  2XPV A;  1E3H A;  3N97 A;  4LIV A;  5J1Y A;  4I02 A;  3COA C;  1IG7 A;  4HZF A;  3CLQ A;  2CWE A;  3TO9 A;  3EYI A;  3NQO A;  4IRH A;  1SVM A;  1Z6T A;  2KT0 A;  3AG4 H;  3ZN0 A;  3DBL B;  2YR2 A;  1NTC A;  1YW9 A;  2LBF A;  1FJL A;  2OC6 A;  1P7J A;  5F6F A;  4BBR J;  5IY5 H;  2JSC A;  3JRH A;  4U7B A;  2VQL A;  5K5R A;  2NVQ J;  2P5V A;  4P1W A;  4XKB A;  1YHQ I;  2NAZ A;  2R5Z B;  4BYY A;  4MQV A;  4BDZ A;  2HDD A;  2VPL A;  3HEF A;  3A2K A;  4MGR A;  1ZGW A;  4CDG A;  3V8L A;  4C3H J;  3O6B B;  1YE9 A;  3RPQ A;  3OYK A;  4IHX A;  1K6O A;  5HNF A;  3EPZ A;  3SJM A;  1K79 A;  1X1C A;  1ZN2 A;  2XAG A;  2R0Q C;  5F1J A;  2OJE D;  1OYY A;  2L54 A;  2R7W A;  1MSE C;  3P9K A;  5M3F J;  1B9N A;  4A0Z A;  4U88 A;  3RZO J;  1VQL I;  3GEZ A;  2ETH A;  2KL4 A;  3CCE I;  2MH9 A;  3SDB A;  1IAW A;  1DU6 A;  3ROU A;  3NEU A;  4PZJ A;  4CA0 A;  3GFM A;  3CCV I;  1MIJ A;  3H5A A;  3EYY A;  4IOA F;  4E4H A;  3WHC A;  4Y52 J;  4MEX F;  3OL4 A;  2FU4 A;  2ZBK A;  2BVM A;  2PMZ A;  4ZJZ A;  2BOL A;  3E5X A;  3BCA A;  3R0A A;  4PCQ A;  2XGC A;  3MVP A;  4M73 A;  2YPR A;  1HKT A;  3CP2 A;  4A12 A;  3F22 A;  3LMM A;  4XLC A;  2CO5 A;  1IDY A;  2EZI A;  2EZL A;  3BTI A;  2TRT A;  3LQQ A;  2PX9 A;  3U1K A;  3I3L A;  3F8N A;  5K5Q A;  4HDV A;  1PDN C;  4AD9 A;  2KIU A;  1BOB A;  1YW7 A;  4RLF A;  2DFI A;  4ANJ A;  5B1B H;  4UXN A;  1XGS A;  2DO7 A;  2R92 J;  4LB5 A;  1G3W A;  3LSG A;  4UNO A;  5D8K B;  2O9L A;  2Z5U A;  2FE3 A;  3ABT A;  4IO9 F;  4XBF A;  2FBH A;  3V4G A;  3GLX A;  2JMW A;  4UV8 A;  1MNM C;  2IGN A;  1LB2 A;  2WB1 N;  4HNU A;  3TP3 A;  2HKO A;  3BR2 A;  2BVL A;  4U7D A;  1BI1 A;  2DYS H;  3SZT A;  3WOD F;  2JJ7 A;  3S1N J;  3TO6 A;  1T8I A;  1UG2 A;  3PO3 J;  3K2Z A;  4CYC A;  1JTX A;  2ECC A;  2RVC A;  4XRS A;  4A6E A;  3OS1 A;  4N9H A;  3QPT A;  2NOJ B;  3PQK A;  4C3J J;  5F0H A;  3KZI C;  2KKO A;  3ESW B;  5FGM A;  2EH3 A;  2V7F A;  1IN6 A; 
#chains in the Genus database with same CATH homology
 1W0T A;  1MBE A;  3HGG A;  2AO9 A;  1AU7 A;  4HNV A;  1WPK A;  4XRM A;  4IHW A;  3G1O A;  5C3E J;  2H8R A;  3S2H J;  3H3V K;  2NOG A;  3HOV J;  2L7Z A;  2JA5 J;  1NK3 P;  3S2D J;  1A5J A;  2K9S A;  1IUF A;  2YU9 J;  1JKQ C;  1IRZ A;  4B1R A;  4FIS A;  1QVT A;  2Y9Y A;  2L0K A;  3MKL A;  3SFI A;  2XPW A;  1B72 A;  3IH3 A;  5M5X J;  1JKR C;  1MH4 A;  4M3E A;  5IP7 J;  2DMP A;  3HOW J;  4A3B J;  4JX4 A;  5GPA A;  1JUS A;  3HKZ N;  2EQR A;  2TCT A;  1MSF C;  3OOU A;  1A6I A;  3A01 A;  1BA5 A;  2W48 A;  2GLO A;  3S16 J;  1JUP A;  5FKO A;  3RKQ A;  2QCO A;  1FEX A;  1TWC J;  4M3B A;  3E7L A;  1JT0 A;  2LK2 A;  9ANT A;  2M9H A;  3BR0 A;  1IV6 A;  2LLK A;  1FTZ A;  4MLO A;  1Z0X A;  2H1K A;  1YRN B;  2DA1 A;  1H88 C;  2JK3 A;  1ETY A;  3BR6 A;  4A3F J;  1JJ6 C;  1X2N A;  2E19 A;  2JA7 J;  3JRF A;  1Z77 A;  1Y1W J;  5F0F A;  5EF6 A;  3GTP J;  3BQY A;  3JRD A;  1GV5 A;  4C2M J;  1OCT C;  3W6V A;  2K40 A;  1G2H A;  1VND A;  2HOT A;  1U9N A;  4I76 A;  2XSD C;  4MFE A;  3HB9 A;  4FE7 A;  2DA4 A;  3I4M J;  1VF9 A;  5EZH A;  3IV5 A;  1RET A;  1WH7 A;  2P81 A;  5EZG A;  4D5F A;  3JRE A;  3HGY A;  3PM1 A;  5IYD J;  1GDT A;  1HDP A;  3DEW A;  1XG1 A;  3OSG A;  3HM5 A;  2HOA A;  3H0G J;  3FIS A;  3FIW A;  4M3D A;  4G12 A;  2MSY A;  4A3G J;  2VKE A;  4FCY A;  1NK2 P;  2NVY J;  4JYK A;  2Y30 A;  1EF4 A;  2IAI A;  5J1U A;  3RQI A;  3OIO A;  4DYC A;  1FIA A;  4A3K J;  3C2B A;  2GBY A;  1LE8 A;  1BW6 A;  4V2G A;  1JKO C;  2CRG A;  4C3I J;  1UHS A;  3LOC A;  4X6A J;  4LOC A;  4W1U A;  2XB5 A;  4B3A A;  1ETX A;  1ZTR A;  3JR9 A;  2CUF A;  5EG0 A;  1TWA J;  1LFU P;  3S1Q J;  2VI6 A;  1I50 J;  2Y9Z A;  1PUF A;  1POG A;  3UKG A;  2R93 J;  3BQZ A;  1TWG J;  1RR7 A;  3A03 A;  2ECB A;  5F27 A;  1JJ8 C;  3A02 A;  4CYC B;  3JRB A;  2LTP A;  3QPL A;  5HOD A;  3GTK J;  2I10 A;  3S14 J;  1AKH A;  4BKX A;  5F0C A;  2R5Y B;  2ELK A;  3HDD A;  4UUS B;  3RZD J;  1TWF J;  3S1R J;  2R7Z J;  5FKK A;  2FD5 A;  5EYR A;  4XIC A;  1T56 A;  4DZJ A;  1HLV A;  5FKL A;  1RKW A;  4DYQ A;  4Y7N J;  2CUE A;  4A3J J;  5GPC A;  3O8H A;  5FLM J;  5IOZ A;  3BTL A;  1ZK8 A;  1ORK A;  5J3L A;  2DTZ A;  1AHD P;  2ZB9 A;  3OSF A;  4A69 C;  1CQT A;  3JRI A;  1D5Y A;  1HCR A;  2IEK A;  4J19 A;  4AC0 A;  2RAE A;  3ZQC A;  1ITY A;  2NVT J;  2M2E A;  3PO2 J;  3S15 J;  3CQZ J;  1B8I A;  2E2I J;  4D5C A;  1I6H J;  1QRY A;  1OFC X;  4XID A;  5DS9 A;  1B72 B;  2FX0 A;  4D7M A;  5EGO A;  2HQ5 A;  5FJ8 J;  3I4N J;  2JA8 J;  1SAN A;  3GBG A;  3CMY A;  1MBG A;  2DA2 A;  4BBS J;  2DA7 A;  1OCP A;  2FQ4 A;  5J1R A;  3M4O J;  3BG3 A;  1MH3 A;  5FKN A;  1JT6 A;  2KDZ A;  3NAR A;  1RKT A;  3A01 B;  1SFO J;  4JX5 A;  4A3M J;  2VKV A;  2M8G X;  3L1P A;  4D7N A;  2HYJ A;  5IOY A;  1OJL A;  1VFC A;  3HOY J;  2MG4 A;  2JN6 A;  2LR8 A;  3Q0V A;  5IP6 A;  4BXX J;  1W0U A;  2K9N A;  5IP9 J;  1QPI A;  2R5Z A;  3TED A;  1TC3 C;  4V2F A;  2QF7 A;  1ENH A;  4W97 A;  2LY9 A;  3LNQ A;  2PMZ N;  2K9Q A;  2DMT A;  3FK7 A;  1XC5 A;  2EZK A;  2OPT A;  5E3L A;  4RBO A;  1FTT A;  2E2H J;  2ME6 A;  1Q1V A;  1Y1V J;  2ME0 A;  2M34 A;  4QSH A;  2LKX A;  2X9D A;  1WGX A;  3LSP A;  4DYR A;  1GVD A;  5IPA A;  4FTH A;  3HBL A;  1U8B A;  2YUS A;  4I6Z A;  2YS9 A;  2JWT A;  4QIW N;  1H89 C;  1ETK A;  5EDN A;  3BTJ A;  5C4J J;  2HOS A;  1K83 J;  2NS8 A;  5DTD A;  1LE8 B;  2E1O A;  2HI3 A;  2X48 A;  3F0C A;  3B6C A;  3SDG A;  3CDL A;  1WCM J;  2XGD A;  1S7E A;  3G1M A;  4A3D J;  1ETW A;  1R9T J;  5EG0 B;  1MBH A;  5K7H A;  4GFB A;  2HXI A;  3O8G A;  1JTY A;  5JLW A;  1JKP C;  4A3L J;  1X58 A;  4AYB N;  1I3Q J;  1ZQ3 P;  2WV1 A;  4BY1 J;  1XS9 A;  1PUF B;  5E3M A;  3S1M J;  1MBF A;  2L9R A;  2IBD A;  3CCY A;  1U9O A;  5F04 A;  3ZOB A;  2VUM J;  2XPU A;  1GV2 A;  1IGN A;  3JRG A;  1BJZ A;  1VI0 A;  2E2J J;  3BR1 A;  3BT9 A;  2EBI A;  5E3O A;  1HOM A;  4XK4 A;  2L7F P;  3IH2 A;  4M3G A;  1AKH B;  2AHQ A;  3WHB A;  1MBJ A;  1WH5 A;  3LSR A;  4DW6 A;  1BW5 A;  3BG9 A;  3GTQ J;  1LFB A;  2DA3 A;  1QVU A;  3HOZ J;  1JUM A;  2OF7 A;  2X6O A;  2LD5 A;  2Y2Z A;  3D1N I;  1F43 A;  2DN0 A;  2XB0 X;  1FIP A;  2O8K A;  4IHY A;  2JA6 J;  4NDL A;  3FK6 A;  3HOX J;  1WI3 A;  3ZQL A;  1ZR2 A;  3Q0W A;  4X1E A;  1APL C;  5JLX A;  2LVS A;  2N8G A;  1B8I B;  3NAU A;  1MBK A;  1JGG A;  4S0H B;  3FKI J;  3ZQG A;  1TWH J;  5M5Y J;  2CQQ A;  1ZKG A;  3M3Y J;  5EGO B;  3GTO J;  5GP9 A;  2D5V A;  1F36 A;  5K7F A;  5FKM A;  2WAQ N;  2XPV A;  4UUT A;  3ZQH A;  1E3O C;  4JX6 A;  3Q0U A;  3TW6 A;  5J1Y A;  2HXO A;  3JRC A;  1DU0 A;  4ABZ A;  1IG7 A;  4A93 J;  5E3N A;  4DZP A;  3TP0 A;  1IDZ A;  4A3E J;  2L7M P;  1H8A C;  2KT0 A;  5M3M J;  1T33 A;  4MO7 A;  3MN2 A;  3G1L A;  1NTC A;  4JP0 A;  1FJL A;  1P7J A;  5F08 A;  5FLV A;  4BBR J;  3JRH A;  2DMQ A;  4M3F A;  5M5W J;  2ID6 A;  1IJW C;  2NVQ J;  3BTC A;  2DA5 A;  3GTM J;  3JRA A;  1RPW A;  2R5Z B;  2DA6 A;  3IH4 A;  4XRS G;  2HDD A;  5BNG A;  3HEF A;  2MGQ A;  1ZGW A;  4C3H J;  4IHX A;  1IC8 A;  2LFB A;  4A3I J;  1U78 A;  3SJM A;  3S17 J;  3LSJ A;  3Q3S A;  1GUU A;  3QPS A;  2R0Q C;  5F1J A;  1MSE C;  4IEJ A;  1O4X A;  5M3F J;  4IHV A;  2LP0 A;  3TW7 A;  2DJN A;  1ZR4 A;  1YRN A;  4RDU A;  3B6A A;  3RZO J;  2FJ1 A;  2EZH A;  1ETV A;  4B4C A;  3K2A A;  1DU6 A;  3GTL J;  4QTR A;  2GM4 A;  4AUX A;  1ETO A;  3WHC A;  2MW8 A;  4Y52 J;  2NVX J;  2Y31 A;  4MFD A;  4L5E A;  3HOU J;  2XRL A;  2XGC A;  3MVP A;  3DCF A;  1BL0 A;  4A3C J;  2B63 J;  5IYB J;  3ZQI A;  1IDY A;  2EZI A;  2EZL A;  3BTI A;  2TRT A;  1K61 A;  2M0C A;  3BR3 A;  1ETQ A;  2DMU A;  2CJJ A;  3ZQF A;  3BG5 A;  2COB A;  5K7Z A;  1HDD C;  2Y0S N;  2R92 J;  2NS7 A;  3LSG A;  2O9L A;  5C4X J;  4BY7 J;  3VPR A;  2JMW A;  1GT0 C;  1HF0 A;  1MNM C;  2XGE A;  3BR5 A;  2WB1 N;  3TP3 A;  4EEF G;  3GTG J;  3BR2 A;  2ID3 A;  4M6V A;  2O7O A;  5IYC J;  3QQA A;  1X2M A;  4MIM A;  2JJ7 A;  3S1N J;  1UG2 A;  3PO3 J;  5C44 J;  4CYC A;  1RES A;  1JTX A;  3K7A J;  2ECC A;  4XRS A;  2CU7 A;  4FE4 A;  2G0E A;  3GTJ J;  2CQX A;  4C3J J;  2R5Y A;  1UMQ A;  2DMN A;  5F0H A;  2VPR A;  1P7I A;  4UUS A;  2EH3 A;  5EEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...