1ZG5A

Narl complexed to narg-89 promoter palindromic tail-to-tail dna site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
66
structure length
66
Chain Sequence
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*GP*TP*AP*CP*CP*CP*CP*TP*AP*TP*AP*GP*GP*GP*GP*TP*AP*
publication title Primary and Secondary Modes of DNA Recognition by the NarL Two-Component Response Regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 22
structure length 66
sequence length 66
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zg5A00
3PFIA 1QZYA 4BHCA 5CVVA 5DUKA 1LEAA 1XSVA 2KIMA 4LGWA 3R60A 4BXUA 1P92A 4RGXA 4EJWA 5HS8A 1HKQA 4A6DA 2WC2A 2RKHA 5LGNA 1O3SA 3CTAA 2MD5A 2G9WA 3HIFA 2VODA 4CXFA 3JAMZ 1DUXC 1Z1DA 1BIAA 3M7GA 4RB2C 2Q0OA 3N4MA 5JR3A 1FNNA 4UXNA 1Z6RA 4LFUA 3GZ6A 4LB6B 4HBLA 1PUEE 5AIQA 4Z2YA 2ESHA 2ETHA 1U2WA 1JHHA 4LMYA 4OU0A 3GFJA 3L2CA 2HOEA 4TV7A 5LRRA 1RNLA 3WGIA 4ENJA 3DEUA 2R3SA 4HQMA 2MH2A 1BBYA 5EEHA 1ODDA 3IRQA 3C1DA 5ILVA 1D5VA 3CDHA 1F5TA 4BQAA 4BHPA 2NNNA 4O5VA 2DTRA 4PCQA 3WG9A 3TO6A 5BMZA 3PQKA 4EM2A 2ZNZA 1QNTA 3QU3A 3ROUA 1HQCA 1IN6A 4B09A 2EV0A 4Q47A 4I7HA 3V7CA 4HDVA 1IRFA 2CO5A 3KFWX 2Z5UA 3FXQA 3KEQA 5BQTA 1ZG5A 2YR2A 1BC8C 3LA2A 1I27A 1ZYRF 2IA1A 4XBFA 2QLZA 1S29A 1F9NA 3KP3A 2M87A 3KLOA 2FBIA 1GHCA 1R1UA 2LSOA 2EFWA 3CUQA 4O6JA 1LB2A 3F23A 3SHFA 1G3TA 3W6KB 5KK1A 1SD6A 1Z9CA 2GXBA 5CJ9A 3J80K 4JQFA 4Q5SF 2M45A 5L3EA 3FM3A 1IRGA 2PJPA 1QPMA 3TQNA 1HSTA 5H6RA 3BZ6A 4IJAA 1B4AA 2XAQA 1TNSA 5DCMA 4FT8A 3KP4A 4A5MA 2BV6A 1FYKA 1W4MA 1IN5A 1JXSA 1CF7A 3HHGA 3T1BA 5HDKA 5IT9Z 1E2XA 1I1SA 2COMA 4YFKF 3O2PE 1V4RA 3HSFA 1FC3A 2QYOA 2RQPA 2GQQA 3EYYA 1S8NA 1BI0A 1ZRDA 4ZH4F 4OMYA 1WRJA 1E17A 2KIFA 5E20A 5F64A 2OZUA 2F5FA 3MFKA 4A6EA 1D8KA 1IW7F 2HTJA 1UHMA 4R79A 3SZPA 5DYMA 2O8XA 1R5GA 3RYPA 2KKOA 1LNWA 4MEYF 3VB2A 4HYEA 5JI6A 4GYGA 1MJ9A 4EJUA 4KIFA 4E70A 3HRUA 1OPCA 1LEBA 2JPCA 2XROA 4ESJA 3G3ZA 1MJAA 2OQGA 1HXDA 1USSA 2W24A 3K1MA 5K5RA 2K4BA 3C7JA 2EJRA 4L0ZB 2H94A 4H0EA 1XCVA 2QZ8A 4LLNA 2A61A 1U3EM 4U0YA 4AD9A 1UHWA 2DLLA 2QBYB 1IN7A 3F6VA 2EA4A 2EFQA 2P7VB 2MLKA 4HQEA 4I2OA 5K5OA 2EV6A 3TOAA 2L01A 1R00A 3H3ZA 1G4DA 4UV9A 3S2WA 1FBSA 1B9MA 4UVCA 5HDGA 4OOIA 3NRVA 3J81K 2EK5A 2JPBA 1CGPA 1D3YA 1RUOA 3GW2A 4MEXF 3BOQA 4EV0A 1TW2A 2CW0F 2LNBA 4ZYHA 1KQ0A 5E18F 4L9NA 2Z3YA 1C0WA 2L4MA 2RN7A 5L3DA 3I54A 4EGZA 2LF7A 4UNOA 5HLGA 1EV7A 2K7LA 1G3WA 3ZPLA 2WV0A 1OR7A 1FLIA 1EH7A 5FLXZ 2HTSA 2CYYA 1YW9A 3IKVA 1GXQA 3EUHA 1HBXG 1QQIA 2HR3A 2DFIA 5BPDA 1X3UA 2EFOA 5AIPA 3ZMZA 2O61A 1GVJA 1AOYA 4HX4A 4PDKA 3CJNA 3LAPA 3KCCA 5BS6A 2CWEA 5ICFA 1XDUA 2YX4A 4LD5A 3BP8A 3SFZA 2EA2A 1TQPA 3HYIA 3DPTA 1LDKB 2V1DA 4U0WA 4KDPA 2RNJA 2HDCA 4AIJA 4KN4X 3F8CA 3WGHA 2VC0A 4KA4A 4AVPA 1BM9A 2DK5A 3ZQ7A 2WWYA 1XGSA 1HW1A 5AONA 2GXGA 3HTSB 1IXSB 2F5DA 5E17F 1BI3A 1J59A 2P6TA 1HKSA 4OIOF 3U2RA 2GAUA 4RAYA 1V3FA 3OOPA 5ERIA 3RTRA 3KE2A 1QO0D 4BAYA 2XAGA 4MNUA 5D4SA 3BPVA 2HFHA 1ON1A 5FB2A 4UHTA 1HSJA 2JSCA 3F8BA 3F21A 2IP2A 5L3CA 3WE2A 1R36A 4ENMA 4KUMA 1ZREA 5LHIA 4L5JA 2M1BA 2O6GE 2DU9A 2QWWA 2IW5A 5DUIA 2FSWA 3REOA 1R1VA 4U0VA 5ICGA 5L3FA 3TGNA 3FF5A 2VE8A 4ENKA 1W7PD 2EFPA 1S3JA 2XIGA 4MGRA 1PP7U 2DK8A 3I4PA 4LLLA 1WI9A 3FMSA 4M71A 4EGYA 3I64A 5D8KB 1T0FA 2W85A 5H6QA 5HVQC 1ULYA 2D45A 5LRSA 3BY6A 3K1PA 4IXAA 2P5LC 1YYVA 4S04A 5TJJA 4HV6A 1KGSA 4LK0F 3L00A 4ASNA 2FE3A 2W25A 1FYLA 3CO6C 1XDSA 4IF4A 4I98B 1OYWA 2D2WA 2VXZA 1ZRCA 2HKXA 2HYGD 3R4KA 5HLIA 2PBIA 2ZO4A 3I53A 3GVAA 2XUBA 3N97A 4KNYA 1ZH5A 3GLXA 4O3MA 2FQ3A 2P4WA 2P8TA 1JE8A 2XAFA 1I5ZA 2OBPA 1J7KA 2FBHA 1RI7A 2E1CA 4PGHA 2DO7A 3QP6A 3DV8A 1SMYF 5HDNA 2FU4A 3F3XA 2IPQX 3WODF 4IHTA 3HSRA 3PQJA 4IPAA 2CFXA 5L3BA 1J9IA 3AAFA 2OQRA 2P5VA 4U7DA 2PI0A 4WCGA 2RGVA 4ON0A 3IL2A 2V1XA 4G6DA 2FMLA 4RB1A 4UUVA 1J75A 2HKOA 1K79A 2M8EA 4ZZLA 1UB9A 4I02A 3IKTA 3RIRA 4WWCA 1YLFA 1K78B 4JBAA 3FMQA 2RDPA 3GO5A 5LLQA 2YU3A 3NEUA 1REPC 4I09A 4M73A 2VC1A 3OV8A 4IVNA 3GXOA 2DQLA 3RPUA 2A68F 4PGGA 2ISYA 4KIBA 2JRTA 3GFIA 3GF2A 2BBYA 2DQRA 4R1HA 4PZJA 1SAXA 5JHUA 1USTA 2OA4A 1OMIA 2AXLA 4EM0B 5ILSA 3CUOA 3QAHA 2QBYA 1J2XA 2GWRA 4G7ZF 3F22A 2VE9A 3MCZA 3MZHA 3GFLA 5CLSA 5D5XB 2ZMEA 1KYWA 1EH6A 1YW7A 1ZG3A 2K86A 1LDJA 1DPUA 4EM1A 1WSUA 2ZNYA 1T98A 1QZZA 2G7UA 1OYYA 1TQMA 3E6BA 1H9TA 1ZLKA 2L3DA 2BEOA 3WTXC 2HEOA 1G3YA 3JSOA 3LA7A 2PMHA 4ESBA 2YSRA 5TRDA 2MBFA 3ECOA 2C6YA 2HQRA 3VEPA 1KYZA 2XAHA 1YO5C 3JW4A 1FYMA 4HOBA 2QQBA 5HLHA 1STZA 1I6XA 4XLNF 2A07F 3VFZA 1AWCA 2NNYA 2A6EF 3W6JB 2EV5A 3T0YA 1YTYA 3QU6A 2FEZA 2QENA 2Y0MA 2XVCA 1Z05A 3E5XA 3DXJF 3KZYA 3T8RA 1DP7P 3V8JA 1MD0A 2XKOA 5KVRA 3Q9VA 1G3SA 5ILUA 4HLXA 2DPDA 2VT2A 4KYWA 2OU2A 1SFEA 1SD7A 5FO5A 2W57A 1ZHFA 2KIUA 5J8FA 2QVOA 1ONVA 3J80Z 4YFNF 3F8FA 3ECHA 4UVBA 2HWVA 5E8IA 5LEKA 4FX4A 5DDGA 3U1DA 3F8NA 4YIIA 4MTDA 3SQNA 2HS5A 2EFNA 4HLYA 3KP5A 3L7WA 4ETSA 1MJBA 4HW0A 1W5SA 2J5OA 3E5QA 2Z99A 4P9FA 5A2QK 5BOXA 4NB5A 3HHHA 5L3GA 3I59B 2XKPA 4HV5A 1G6NA 1SD5A 3GYHX 1D8JA 1YQAA 2NRAC 1S6LA 4XRFA 1IUYA 4D0PA 1W5TA 4KMFA 2A69F 1WQ2A 4R8HA 2ZMEB 1NHAA 3ZMVA 4EMSA 4OIRF 2YX7A 4KFCA 4NQWA 2CGPA 3TOBA 1KQ9A 4G9YA 3E6MA 4M9XA 1MKMA 4N9IA 2PEXA 1XD7A 4GO1A 4A0YA 2TDXA 3O3KA 1T39A 4UVAA 5FD5A 3R0JA 2XASA 2YPRA 3ZP5A 1L3LA 3MWMA 3KP7A 2MLGA 2XGXA 3D5LA 4BYYA 2QM3A 4IHSA 5DCFA 4WXHA 5D4RA 2ZCWA 3U9GA 5IT3A 1SFUA 3ABTA 3LWFA 3MAJA 1BC7C 3RDIA 2VBZA 3FX3A 1ZGAA 2IRFG 2QQAA 2QQ9A 2VOOA 1XGNA 3WU0A 3GFMA 3CO7C 1T38A 2JT1A 4MQVA 4L5IA 3K69A 1HW5A 3V7RA 1KU7A 3DQVC 4KMUX 3FZVA 3J81Z 4ESFA 5LBQA 5D5VB 1RUNA 1YG2A 2OD5A 2Z9OA 2UXNA 2LKPA 5CVIA 5LEJA 1L0OC 3TO9A 1U78A 1K7AA 4EJTA 5K5QA 4WXCA 2DBBA 3VOEA 3QPTA 1F4KA 4EVIA 3R0AA 5D5UB 1O3RA 2BE5F 2DI3A 2NYXA 1B6AA 1BJAA 5HOOA 1BIBA 4DQ2A 1KA8A 2FBKA 3K1NA 1FY7A 3EDPA 2Z33A 1QBJA 2PN6A 2OZ6A 4WK8F 2CQKA 3LAJA 3E5UA 2XV4S 2O03A 3L9FA 3KETA 3Q5FA 3D0SA 4JK1X 3ML6A 1BN5A 4BHBA 1K78A 4I0AA 1FOKA 4ZYGA 3JTHA 1GXPA 2P6SA 3HRMA 4BH9A 4HX8A 2EWNA 1XGMA 1VTNC 5D6FA 1BI2A 1RZ4A 4ZYEA 3BJAA 3IWZA 3K0LA 3M8FA 4KIGA 1FSHA 2VBXA 3ZMDA 1H0MA 4K2EA 4EJVA 2FOKA 4A0XA 2D1VA 3G73A 3H3UA 3JSPA 2VN2A 2FF4A 1ZGJA 3HSEA 5J8CA 3ZN0A 2X0LA 1MDMB 1B1BA 3ZMSA 2NS0A 1A04A 3WTYC 3WTVC 3QPHA 4BNCA 4LLGF 3P9CA 1DDNA 2RVCA 4LK1F 4CDGA 2H6BA 4HDUA 1Q1HA 1YW8A 4I01A 1ZN2A 3GZ5A 5CVJA 3JAMK 3WTTC 2QUFA 5F1RA 3DFGA 3R61A 2PLYA 1IXRC 4M72A 4L0YB 2R7FA 1IN4A 1BI1A 4IRGA 5DD8A 2G7HA 4G8XA 3LA3A 3M8EA 1EH8A 3CLOA 2F5CA 3HOTA 3I5UA 2A5YB 2GA2A 1W7PA 2ISZA 4HAMA 2V79A 3KP2A 5HS7A 4QLCU 2KJBA 1JHFA 4IRIA 2VOPA 2O3FA 2BYVE 4LJZF 1O7FA 3ZMUA 1K6OA 3FXUA 3J7AO 3DF8A 5E1XA 3BPXA 3MQ0A 1U5TC 3TDZC 1LVAA 4GYIA 2ZJ2A 2VONA 4CYDA 3I71A 3HTUA 4N0BA 3RKWA 4Y15A 4G6QA 2KJCA 1YIOA 3GUDA 2DAOA 1ZLJA 1B59A 5ICCA 2FNPA 3IWFA 4I0BA 3T5XA 3WTUC 4XSZF 1J0RA 2WTEA 4P9UA 3E6CC 1DPRA 2RC4A 3GEZA 2JZYA 1XSXA 6PAXA 2HYFA 2MA3A 2GZWA 1U6GA 3ABUA 1FSEA 2IJLA 4G7OF 1FP1D 5H20A 1FT9A 2K27A 2O0YA 3RI4A 4MQ9F 1Z7UA 3HOSA 3K2ZA 5CYVA 4Y17A 3BROA 5ICEA 4U7BA 1XGOA 2VBWA 1T2KA 3M1EA 2XAJA 3BJOA 5CVUA 3I59A 4AIHA 1TTYA 2GA1A 2V6CA 2H09A 2K4JA 4L9TA 4P55A 3R6SA 1IZ1A 1KQ8A 4M9ZA 2A6HF 4KN7X 4QWQA 2JTVA 4RGRA 1P2FA 2ACJA 2Q8KA 1MZBA 1RIOH 3BWGA 4Q48A 5FFZA 3FWEA 5IT9K 5E8GA 3KZZA 1U8RA 1T6SA 5K1YA 4FHTA 1R23A 3H92A 1PDNC 3E97A 3IRRA 3MEXA 5D8LB 3T8TA 2FXAA 3SXYA 1XMAA 4L9VA 2ZBKA 4CICA 5FFXA 5DD4A 3WTSC 1JGSA 5D6EA 3EYIA 1LDDA 4XSXF 3Q9SA 1MGTA 3B73A 4P96A 5DV5A 3P9KA 1LJ9A 3HRTA 1W7PB 5LHHA 4GCVA 3GWZA 4MTEA 4HA8A 3DP7A 2STTA 4B8XA 1YS6A 4YG2F 1HKTA 3DPLC 3RPQA 4Q4ZF 4A2UA 5FGMA 3WTZA 3LQRA 1UCRA 1KU3A 3V8KA 4UV8A 1Z91A 3M9AA 4FX0A 1TNTA 3EQLF 5DEQA 4AWXB 3IC7A 2E7XA 1O57A 2M5WA 1LQ1A 3K9TA 1ZRFA 5HS9A 1ZAOA 1O3TA 5JFRA 1R58A 1PP8F 2V9VA 1IF1A 3QOPA 3TKYA 1XB4A 4HF0A 2XHKA 1R7JA 2PMUA 2A3SA 4RGSA 2BGCA 2P5KA 2M30A 3E3VA 1S7AA 3WE3A 5EEGA 2ELHA 1R5HA 3HUGA 4L9JA 4GGGA 2UZKA 2P7CB 3KEOA 1BOAA 4G7HF 1WWXA 1XSDA 2E7WA 1FX7A 3MZYA 2IVMA 2IA0A 4RS8A 3LFKA 4LB5A 4GXOA 5E1WA 1FBUA 2F2EA 3F72A 1R1TA 1TBXA 4MHGA 2FRHA 2W84A 1ZARA 1KU9A 3QRFF 4RAZA 2RV8A 3COAC 2VBYA 3EETA 3I0TA 1FZPB 1FBQA 2R7DA 5FLXK 2J5PA 4KICA 4IRHA 1SFXA 2DPUA 3LSTA 3V8LA 4LG0A 4YFXF 3BDDA 3ERED 2GIVA 2CSOA 1Z6TA 2IA2A 3GX4X 1WKMA 3RYRA 1MDMA 2H27A 4OIPF 3ZN1A 1I1GA 3TO7A 5FD6A 2HGCA 3IHUA 3FHZA 1P4WA 1O7LA 2FA5A 3CUQB 4HZFA 1J5YA 5D5WB 1S7OA 1YS7A 1U5TA 3KP6A 1SMTA 5A2QZ 1H9GA 1KU2A 2DW4A 4N9HA 3ZMTA 1F1ZA 3O6BB 3F6OA 1XMKA 5DCMB 2VT3A 3V7SA 2HQNA 4RGUA 3FM5A 2ESNA 1CF7B 4RB3C 4YIFA 3P9IA 3FXRA 4OINF 2AS5F 5J6XA 4CHUA 5E1ZB 2KRFA 4CO8A 3CUQC 3SZTA 4HX7A 2FNAA 5CVRA 1ON2A 3C18A 3WTWC 2B0LA 2LDUA 4EJOA 1IXCA 1IAWA 5LGUA 3KLNA 4CGZA 4L18B 2STWA 1IN8A 4ZYDA 1QGPA 4M9SA 2HZTA 1TQIA 2UWMA 4P5OA 2Y75A 1SD4A 3VODA 1XCBA 4DNCA 4M74A 2PG4A 2H6CA 4ZZDA 2Q2EA 2E1NA 1TW3A 4M6YA 2D1HA 1R22A 1OYIA 1TLHB 4U88A 4A12A 2MC3A 1P4XA 2MH9A 2PQ8A 4M6XA 2LF8A 3B02A 4AIKA 3QP5A 4WXDA 1O3QA 2NAZA 3F8MA 3RKYA 3ULQB 4HF1A 1YFHA 5ED4A 3P7NA 4LG0B 4OMZA 3RJPA 5LHGA 5BPIA 3L09A 4A0ZA 2PFBA 1XN7A 3DKWA 2L4AA 4WF2A 1B9NA 1OKRA 3JTGA 3ISPA 2K02A 3V4GA 1HW2A 3C3WA 3NQOA 4A5NA 2V1UA 4WX9A 4EQQA 2ZXJA 1FPQA 4F7ZA 5F6FA 3FMRA 2ZFWA 3ELKA 5JVTA 4CZZA 5LGTA 1FWZA 2ADUA 4RB0A 2X4HA 3RKXA 2F5EA 1FP2A 3LQQA 1P4AA 1U5TB 2L54A 1Y0UA 2EB7A 4OIQF 2XRNA 2OAZA 3BJ6A 2ZKZA 1UFMA 3E6DA 4ENNA 4XLPF 4S05A 3TDUC 4Y13A 2CG4A 3WU1B 2L02A 2DT5A 4KT5C 4HF2A 3HRSA 4G94A 2Y48A 1P6RA 2IT0A 3I58A 4NHJA 2FMYA 1ZG1A 3WGGA 2UXXA
chains in the Genus database with same CATH superfamily
1MH4A 3PFIA 3HM5A 1YJ9I 1MBGA 1QZYA 4BHCA 5CVVA 1UG0A 2GOXB 5DUKA 1LEAA 1XSVA 2KIMA 4LGWA 3R60A 5J3LA 1W0TA 4BXUA 1P92A 3A0HC 2EZKA 3SDBA 3HL2A 4RGXA 4IHYA 2DJNA 3HOXJ 2WAQN 4EJWA 3RPUD 4A3DJ 5HS8A 3K70D 1HKQA 3FBIB 4A6DA 2LFBA 2WC2A 1SVOA 3IP4B 1GDTA 2RKHA 5LGNA 3BTJA 1PUFA 1O3SA 2O5RA 4XIDA 3CTAA 2MD5A 2QEXI 2PJRA 2G9WA 3HIFA 1A5JA 1OR7C 1P7IA 4CXFA 2VODA 3JAMZ 2OTJI 2XB5A 1Z1DA 3BLYA 3TL4X 1BIAA 4E7SA 1DUXC 3S1MJ 1SEUA 3VSKA 5E3MA 2R7VA 3M7GA 4RB2C 2Q0OA 3N4MA 2LMDA 5JR3A 3EUHC 3BZKA 1FNNA 3BQYA 4UXNA 1HF0A 1Z6RA 4LFUA 2YU9J 3GZ6A 4LB6B 4HBLA 1PUEE 5AIQA 4Z2YA 1EA3A 2PX9A 2R7RA 2CUJA 2ESHA 3S3NA 2ETHA 4M3DA 1U2WA 1JHHA 3NWTA 4LMYA 4U87A 4OU0A 3GFJA 3L2CA 2HOEA 1Q1VA 1MSEC 2TCTA 4RLFA 4TV7A 1MMNA 5LRRA 1RNLA 2Y0SA 3WGIA 3BCBA 2XGCA 4ZJZA 3CC7I 4ENJA 1FMWA 3DEUA 2R3SA 5LFAA 3F0CA 4HQMA 5IYBJ 3EPZA 5EJCA 3CC2I 2R7XA 1P9QC 1KZHA 2MH2A 1BBYA 1ACIA 5EEHA 1ODDA 3IRQA 1BOBA 1R4NB 3C1DA 1X4OA 2IS4A 4PJMA 4XOTA 1R5ID 5EZHA 5ILVA 2ZXIA 2VJ4A 3OYLA 1D5VA 3SYTA 3QQAA 1MMGA 3CDHA 1F5TA 4MFDA 1MBEA 3PUBA 3G71I 4BQAA 4BHPA 3LSHA 2NNNA 4O5VA 2DTRA 5IOZA 3ZQLA 2X6WA 4PCQA 1BR4A 3WG9A 4P1WA 3PSFA 3TO6A 3PIPF 3PQKA 4EM2A 5BMZA 2ZNZA 1QNTA 3QU3A 3ROUA 1HQCA 4BE0A 1IN6A 1PYVA 4B09A 2DMPA 2XF7A 3OYKA 1ZQ3P 2EV0A 4Q47A 1S7EA 4I7HA 5F08A 3V7CA 4HDVA 3CMEI 1OISA 1IRFA 1NG7A 2CO5A 3KFWX 2V6EA 2Z5UA 5EGOA 3M3YJ 3FXQA 4RMNA 3KEQA 2ME0A 5BQTA 1ZG5A 4E7HA 2RNGA 4XRSG 3ZQQA 2JA5J 2YUSA 2YR2A 1BC8C 3KZIC 4W97A 2VL8A 3LA2A 3QOEA 1I27A 2QKMB 1ZYRF 2IA1A 4PFOA 1S72I 5FRNA 3FK6A 1LE8B 2JMWA 3N05A 3OOUA 2QLZA 4PFPA 4XBFA 1S29A 1F9NA 2LKSA 1W1WE 2M87A 3KP3A 3KLOA 2FBIA 4BQOA 2XB0X 1YRNB 2BY2A 4G6TB 2BW3B 1GHCA 1R1UA 1A36A 2LSOA 2K9NA 2EFWA 3CUQA 2CQ7A 3ZQGA 4O6JA 2E35A 1LB2A 3OYEA 1XG1A 5IP6A 3F23A 2WB1A 3SHFA 1G3TA 3W6KB 5KK1A 1SD6A 1Z9CA 5K7HA 2GXBA 5CJ9A 2W48A 1B72B 1W5CC 3J80K 4JQFA 4Q5SF 2M45A 4XLHA 4BGDA 5L3EA 2GIZA 5C4XJ 3OR2C 3FM3A 1IRGA 1WJFA 2PJPA 1QPMA 3TQNA 1HSTA 2KLOA 3RKQA 5H6RA 2KHMA 3BZ6A 4BJ6C 2DA2A 4IJAA 2VQHA 2LLKA 1B4AA 2XAQA 4GRIA 1TNSA 1UELB 2CUFA 3Q3SA 1IRXA 1ETVA 5DCMA 4GDFA 5EYRA 2W82A 2KRCA 3I3LA 4FT8A 3KP4A 4V2FA 4A5MA 3QWLA 2BV6A 4JP0A 1W4MA 1FYKA 1IN5A 5GAHJ 1JXSA 1CF7A 4QIWN 3HHGA 3MKWB 3T1BA 5HDKA 2R7ZJ 4QPQA 5IT9Z 1T0FC 3OYMA 2CV2A 1E2XA 1I1SA 2V26A 2KDOA 5JHFA 2B63J 2COMA 4XLFA 3RCOA 3DTEA 1T33A 4YFKF 2R7OA 2Y9ZA 3CP8A 3O2PE 4DGWB 1V4RA 2BXZA 3HSFA 1FC3A 2QYOA 2WA0A 3CJTB 4Y3OA 2RQPA 2GQQA 3CDIA 3WU2C 2O7OA 1FOYA 3EYYA 4FQGA 4BBSJ 1IV6A 2ZJRF 1S8NA 1BI0A 3ZGKA 2R7SA 1ETKA 2KDZA 1ZRDA 1X1AA 4M3EA 2XSDC 1LFUP 4ZH4F 4F91B 4OMYA 3AG2H 1U9OA 1WRJA 1E17A 2KIFA 3CLQA 5E20A 4A3LJ 5F64A 2OZUA 2F5FA 2E36A 3MFKA 3CCQI 3S1QJ 4A6EA 1D8KA 2JVGA 4YEJA 3DBLB 1IW7F 2DMUA 3E1SA 2NVQJ 2KRHA 2HTJA 4CZCA 4B3AA 1UHMA 4R79A 3SZPA 3LSKA 2O8XA 2CFOA 5DYMA 1R5GA 3RYPA 3FKJA 2KKOA 4B1RA 3OIQA 5GPCA 2QKLB 3DTIA 1LNWA 3AFHA 4MEYF 3VB2A 5CQEA 1BW5A 3AG4H 3E7LA 4RBOA 3PM1A 2Y9YA 4HYEA 5JI6A 4C2TA 4OWRB 4GYGA 2E71A 1MJ9A 3IAS2 4EJUA 4KIFA 4E70A 2DYRH 1X2NA 2N8GA 3K4NA 5HNFA 3HRUA 1OPCA 2EH3A 1LEBA 3BR3A 3CCJI 1WH5A 2JPCA 2XROA 4ESJA 3G3ZA 1MJAA 4QSHA 2OQGA 1HXDA 1USSA 2W24A 2QQ8A 3K1MA 5K5RA 4CYCB 4RM2A 2K4BA 3C7JA 2EJRA 2OF7A 4L0ZB 2QA4I 2EPFA 2H94A 4H0EA 2VUMJ 1XCVA 2QZ8A 4LLNA 2A61A 5CKTA 2ECCA 3J7YJ 1U3EM 4U0YA 5J4YA 4AD9A 2JQ7A 2Y30A 1JT6A 4NC7A 1UHWA 2DLLA 2OV7A 2R5YB 1IN7A 2H8WA 2OCEA 3F6VA 2QBYB 1DU6A 2BY1A 2XGEA 2EA4A 2EFQA 2P7VB 2JA6J 4LOCA 3QPLA 2MLKA 4HQEA 3TEDA 5HNHA 4I2OA 5K5OA 2EV6A 3TOAA 2L01A 1R00A 3H3ZA 1G4DA 4UV9A 3S2DJ 4DZJA 4OAZA 3SDGA 3S2WA 1FBSA 1B9MA 2DOEA 4UVCA 5HDGA 4OOIA 3NRVA 3J81K 2EK5A 1MNDA 1VQ4I 2MYSA 3ESWB 5J1YA 2AQEA 3EUAA 4YIRX 2JPBA 1CGPA 3S15J 3SFIA 3WG7H 3ZOBA 3K70C 1D3YA 1RUOA 4A69C 2CQQA 3GW2A 4MEXF 2EZIA 2OPTA 4A93J 2A6TA 3BOQA 4EV0A 1TW2A 5J1RA 2CW0F 4E6KG 3HKZA 2LNBA 1FJLA 1V5EA 4ZYHA 1IG7A 1KQ0A 2QSFX 5E18F 4L9NA 2Z3YA 1C0WA 3HOYJ 2L4MA 2RN7A 5L3DA 3I54A 4HEA2 2X48A 4EGZA 1N78A 2LF7A 4UNOA 5HLGA 1EV7A 2K7LA 1G3WA 4EEFG 1G2HA 2HXIA 1NH3A 1TWCJ 3ZPLA 2WV0A 2Y0SN 4DJAA 1MMDA 3KYCB 1OR7A 1FLIA 1EH7A 2EIMH 1LPQA 1LFPA 1X19A 2ZMEC 5GP9A 2JSPA 5FLXZ 5GTIC 2ZJQF 5JVGF 3GMEA 2HTSA 2CYYA 4E7JA 3G6EI 1YW9A 3IKVA 2VQGA 1GXQA 3EUHA 1HBXG 2O8KA 1QQIA 3DEWA 3GTKJ 1WJEA 2HR3A 3RZOJ 2DFIA 3NWSA 1YOVB 2K9SA 1AKHA 5BPDA 1X3UA 2JRMA 2EFOA 5AIPA 3ZMZA 1IO2A 3CF2A 2CUZA 4BE2A 5KNLA 2O61A 1GVJA 1AOYA 4HX4A 3FIWA 3B6CA 2DMQA 4PDKA 1YIJI 3VYTB 3CJNA 3DU5A 1N25A 2V7FA 2DXIA 3LAPA 4BKXA 1W36D 3KCCA 5BS6A 2CWEA 5ICFA 4N4OB 1DGWY 1XDUA 3GCMA 2YX4A 4LD5A 2IGNA 3BP8A 3DBRB 3SFZA 2E60A 2MC4A 2EA2A 2L9VA 1H88C 1TQPA 2JUGA 3HYIA 3DPTA 1LDKB 2V1DA 3KEYA 4YRVA 4U0WA 4KDPA 5FRMA 2WY7Q 3TW7A 1X1CA 2RNJA 2HDCA 4AIJA 4S0HB 4KN4X 4ITVA 1GT0C 5TISC 3F8CA 3WGHA 2VC0A 4KA4A 1X58A 4AVPA 1BM9A 2DK5A 2GM4A 2WV1A 1X1DA 2KT0A 3PSIA 3ZQ7A 1MBFA 2WWYA 4XICA 1D5YA 4PJ0C 1YHQI 1XGSA 1HW1A 2M3AA 1ETXA 5AONA 3M1CA 3LNQA 2GXGA 1A31A 4ZDPA 2COBA 3OYCA 1Z3XA 2EZLA 2WB1N 1TC3C 2P81A 1YX3A 3HTSB 3HPHA 1IXSB 2F5DA 4AYBA 5E17F 1BI3A 1J59A 2P6TA 1HKSA 4OIOF 3U2RA 2DDBA 3GTGJ 4ZDOA 4B3XA 3ONQA 2GAUA 4RAYA 1V3FA 3OOPA 5ERIA 1XTAA 1YJWI 3RTRA 3BC8A 3KE2A 1MIJA 1QO0D 2XAGA 4BAYA 5E3NA 4MNUA 5D4SA 3BPVA 2CV1A 2HFHA 4NC6A 3K4LA 1ON1A 5FB2A 4UHTA 2CS3A 2F48A 4KITB 1HSJA 2MGQA 3TMOA 5IY5H 2JWTA 2JSCA 1QRYA 2DN0A 3F8BA 4E7KA 3F21A 5DTDA 4C2UA 2IP2A 5L3CA 3WE2A 1R36A 4ENMA 4AVZA 4KUMA 3KIOA 4BXFA 1ZREA 4XLEA 5LHIA 4L5JA 2M1BA 2O6GE 3VSLA 2DU9A 4JX5A 1HOMA 2QWWA 2HVQA 2IW5A 5DUIA 2FSWA 3REOA 1R1VA 4U0VA 3HZJA 5ICGA 2NVUB 2EBIA 5L3FA 3FDYA 3DU6A 5FKOA 3OYGA 2VASA 3TGNA 3FF5A 2VE8A 4ENKA 3VYSB 1SAUA 3OYJA 4RM3A 2HPMA 1W7PD 2EFPA 1S3JA 5J4VA 1AA7A 2XIGA 4MGRA 1PP7U 1TWFJ 2DK8A 3I4PA 1U0JA 2R5ZB 2KZVA 4LLLA 4ZDLA 4F52A 1Y1WJ 1ETOA 1WI9A 5EF6A 2MABA 3FMSA 4M71A 1ENHA 2E1MB 4EGYA 3I64A 4HSRA 3H9JA 1R6RA 1RKTA 5D8KB 1T0FA 2W85A 2BW3A 2P0WA 5H6QA 1X1BA 2LC2A 4DYQA 5HVQC 1ULYA 4PJJA 2BXYA 2D45A 1SVMA 2F4IA 2VKVA 5LRSA 3BY6A 3K1PA 2HOSA 3S14J 3PO2J 2VLAA 4IXAA 2P5LC 3OR1C 1ZKGA 3CD6I 1YYVA 4X0GA 4S04A 3QYEA 2LY9A 3D5RC 5TJJA 4HV6A 3UR3C 1QU3A 1B72A 1KGSA 5C3EJ 5K7FA 4LK0F 5IP7J 2L9NA 3L00A 4ASNA 4D7NA 2ID6A 3I9V2 2FE3A 2W25A 3JREA 1FYLA 3OS2A 3CO6C 1XDSA 2DA1A 4I98B 4IF4A 1OYWA 2D2WA 2VXZA 1ZRCA 1ITYA 2HKXA 1JUPA 2HYGD 3R4KA 5F04A 5HLIA 2PBIA 2ZO4A 2E2IJ 3I53A 3GVAA 2XUBA 1Y1VJ 3N97A 2RAEA 4KNYA 1ZH5A 3BR0A 3V42A 5M3FJ 3GLXA 1PJRA 4O3MA 2FQ3A 2P4WA 4CH7A 5B66C 2P8TA 4M3GA 1JE8A 4KT6A 1JKRC 2E1MC 1BL0A 2XAFA 1I5ZA 2OBPA 3H36A 1J7KA 4IX7A 2FBHA 1RI7A 3H5RA 3MMYB 1WHUA 4NUBA 2E1CA 1R9TJ 2DA5A 4PGHA 1VQNI 2DO7A 3QP6A 4Y7NJ 1FTTA 1Z67A 3DV8A 1SMYF 2DYSH 5HDNA 2H8RA 2FU4A 1ERDA 3F3XA 2IPQX 4NNJA 1E3OC 3WODF 4IHTA 3HSRA 3PQJA 4IPAA 2CFXA 5L3BA 1J9IA 4JOMA 4B44A 3AAFA 2OQRA 2P5VA 4U7DA 2R0QC 2PI0A 4WCGA 2CV0A 2V4JC 1ZTRA 2RGVA 1YI2I 9ANTA 2XGDA 4ON0A 3IL2A 4IEJA 5KHDA 2V1XA 4G6DA 2FMLA 3BG5A 3ZCOA 4RB1A 4UUVA 2ZC2A 3KX2A 2HPIA 1J75A 3RQ4A 2HKOA 2HZDA 1K79A 2M8EA 3K2AA 1ZR2A 4BU2A 4UB8C 4ZZLA 1UB9A 2VKDA 2I10A 4I02A 3IKTA 3HOZJ 4L5EA 1WCMJ 3RIRA 4WWCA 4M3BA 2W4SA 3H5NA 1YLFA 1K61A 1K78B 4XKVA 4JBAA 2HOTA 3FMQA 2RDPA 3GO5A 5LLQA 2CW7A 2YU3A 3NEUA 2R4GA 4DIQA 1LVKA 1HC8A 1REPC 3ZQFA 4I09A 4M73A 3S16J 2VC1A 3JRHA 3OV8A 4IVNA 5EG0B 3GXOA 4PSWA 2DQLA 1OFCX 3K10A 2EIJH 3RPUA 1FIPA 2E1OA 2BVMA 1JI8A 3OS1A 3DPUA 5BNGA 2A68F 4PGGA 2ISYA 5CQGA 4KIBA 2M7BA 1UAAA 2JRTA 1ETWA 3GFIA 3GF2A 2BBYA 2DQRA 4R1HA 2LP0A 4CYCA 4BEHB 4PZJA 4J19A 2E2HJ 4XKBA 3SZGA 2KFDA 1SAXA 3GLLA 1X3ZB 1USTA 2OA4A 1OMIA 5JHUA 2XPUA 2AXLA 1YJNI 2WBMA 4EM0B 5ILSA 3CUOA 3QAHA 2R5YA 2QBYA 2F5VA 1UZCA 1J2XA 1PVEA 1XS9A 2GWRA 2CMPA 4NDLA 4G7ZF 4GFBA 3TP3A 3F22A 2VE9A 3MCZA 4FETA 5FKMA 5EDNA 4LITA 3GFLA 5CLSA 5D5XB 4DW6A 3CCUI 3CF5F 1JTYA 3G4SI 2ZMEA 1KYWA 2HOAA 1W36C 1EH6A 1YW7A 1ZG3A 2Y2ZA 4E7LA 2G0EA 2KP6A 4ZTFA 2K86A 3CMAI 1LDJA 4XORA 1MNEA 5GADJ 1K4TA 2Z1DA 1DPUA 4EM1A 2VPRA 2L9SA 4FE7A 3JRDA 1WSUA 2LOOA 2ZNYA 1T98A 1QZZA 2G7UA 1V55H 1OYYA 1VFCA 1TQMA 2AO9A 3E6BA 3HGYA 1H9TA 4AU7A 1DU0A 2NS8A 4QPOA 1ZLKA 2L3DA 2BEOA 3WTXC 3FXJA 2HEOA 1G3YA 3JSOA 3BTLA 3DBHB 4F92B 3LA7A 2PMHA 2M4KA 1NK3P 4ESBA 2YSRA 5TRDA 2MBFA 1RKWA 3ECOA 2C6YA 2HQRA 4AYBN 4C9YA 1BW6A 2DDAA 3VEPA 3PNYA 3MD2A 3A02A 1LFBA 3F9KA 2JJ7A 1KYZA 2XAHA 1YO5C 2GLOA 2M0MA 3JW4A 4A3MJ 1FYMA 1QVTA 1RPWA 1RC9A 2QQBA 4HOBA 5HLHA 4ZYAA 1MW7A 3MVPA 2W1OA 1STZA 1I6XA 4FE4A 4XLNF 2A07F 3GTOJ 4Z6YA 4CA0A 2AXTC 3VFZA 1AWCA 3KPHA 5J47A 2NNYA 3OSFA 1VZ0A 2A6EF 3ABLH 3W6JB 2VJ5A 2EV5A 3ERMA 5CPRB 3T0YA 1XMXA 4MIMA 1YTYA 4A3JJ 3QU6A 3B6AA 2QENA 2FEZA 2LRDA 1XX5A 3OIOA 2DJIA 1FOXA 2Y0MA 2LH9A 2XVCA 3D1NI 3SJMA 4BY1J 2MD0A 1Z05A 3E5XA 3U1KA 5FJ8J 3DXJF 1ETQA 2VI6A 3KZYA 3T8RA 4BDZA 1DP7P 3BR6A 3V8JA 3D5SC 3RSNA 1MD0A 1MMSA 2XKOA 4BY7J 5KVRA 3Q9VA 2HXOA 4A3IJ 1G3SA 5ILUA 3HOUJ 3OYBA 4HLXA 1T08B 2DPDA 2VT2A 1K83J 4KYWA 2OU2A 3FBNB 3VYRB 1GUUA 1SFEA 2R93J 3HB9A 4JX4A 2XF6A 2D5VA 1SD7A 5FO5A 3I4MJ 2W57A 1ZHFA 2KIUA 5J8FA 1IRZA 2QVOA 1ONVA 2DTZA 2DOFA 3J80Z 3J7ZI 5F1JA 4YFNF 3F8FA 3ECHA 4UVBA 2HWVA 5E8IA 5LEKA 4FX4A 4D9JA 2FX0A 3LSJA 3U1DA 5DDGA 3F8NA 5B1BH 2V1NA 4YIIA 4MTDA 3SQNA 2HS5A 3HOVJ 2EFNA 4HLYA 2NVTJ 3KP5A 3L7WA 4ETSA 3H9QA 1MJBA 1JUMA 5FKLA 3CCEI 3PL8A 4HW0A 1W5SA 2J5OA 3E5QA 1JT0A 2Z99A 1VQLI 4P9FA 4EATA 5A2QK 3H0DA 5BOXA 2ZXWH 4BL0B 4NB5A 2L0KA 2UUZA 3HHHA 1MH3A 3LMMA 5L3GA 3I59B 2XKPA 4HV5A 1G6NA 1SD5A 2ID3A 3GYHX 1H89C 2EINH 1OCPA 2BY0A 1D8JA 1IUFA 2NOGA 1YQAA 2NRAC 3OMYA 2DA4A 5KAIC 1S6LA 4A3KJ 4XRFA 1IUYA 4D0PA 1MNMC 1W5TA 2X85A 3OL3A 3GTJJ 2A69F 1K4SA 4KMFA 4AC0A 1WQ2A 2NOJB 3H9GA 5IYDJ 2DMNA 4R8HA 1I3QJ 1NHAA 2ZMEB 3A4CA 3ZMVA 2ZSIB 4EMSA 2E19A 1Z77A 4OIRF 2YX7A 1N75A 3LOCA 4NQWA 4KFCA 5F27A 3OYFA 1SFOJ 1B8IB 2CGPA 3CCMI 3GTLJ 3TOBA 1KQ9A 4G9YA 2W7NA 4JX6A 2KMUA 3E6MA 4UB6C 3I56I 4M9XA 5JLXA 3ZQCA 1MKMA 4N9IA 2PEXA 2FUG2 1U9NA 1V54H 1XD7A 2BVLA 1VQPI 2DFHA 4GO1A 4NC8A 4A0YA 2TDXA 1D1AA 1VI0A 3CJQB 3O3KA 2R5ZA 1T39A 1VQMI 2X51A 5EEAA 1IC8A 4UVAA 5FD5A 3R0JA 2XASA 2YPRA 3ZP5A 3PJRA 3TW6A 3MWMA 1L3LA 2PMZA 3KP7A 1JGGA 4XL9A 3BT9A 2MLGA 2XGXA 5K7ZA 3D5LA 2XPWA 4BYYA 2QM3A 3KYLA 3PO3J 3DLAA 4IHSA 1QHHD 1X4PA 4Y4RA 5DCFA 4WXHA 5D4RA 1EF4A 1VQ5I 2ZCWA 3U9GA 5IT3A 1JJ8C 5M5YJ 1SFUA 3G1MA 4D7MA 3ABTA 3H3VK 3LWFA 3MAJA 5F0FA 3RDIA 1BC7C 2VBZA 3FX3A 3S93A 1ZGAA 3OWTA 2IRFG 2QQAA 2ZFUA 2QQ9A 2VOOA 1LUJB 1XGNA 3UNGC 1WI3A 3S3OA 3WU0A 3GFMA 3CO7C 2EQRA 1T38A 4IHVA 2JK3A 2JT1A 2X6OA 5GTHC 3EUKL 4IHXA 4MQVA 2QSHX 4L5IA 1TWAJ 3K69A 4B48A 1HW5A 3AG1H 3V7RA 1KU7A 3DQVC 4KMUX 2AHQA 1OCRH 3FZVA 3C2GA 3J81Z 4ESFA 3K7AJ 5LBQA 5D5VB 2X1DA 1RUNA 1YG2A 2OD5A 5H2FC 3JRBA 1VQ8I 2Z9OA 5C44J 2UXNA 2LKPA 3W3CA 5CVIA 5LEJA 1L0OC 4DYRA 3MKLA 3TO9A 5FROA 4FCYA 2TRTA 1OJLA 3LFUA 1I6HJ 1U78A 1K7AA 3BQZA 1M1EB 4EJTA 5K5QA 2K9LA 4WXCA 4CCNA 5HODA 2DBBA 3K4BA 3VOEA 3QPTA 1F4KA 4EVIA 4I6ZA 2DOAA 3O8GA 3R0AA 5D5UB 1O3RA 1A6IA 3I4NJ 3HUGB 3IH3A 2BE5F 2DI3A 2NYXA 3K4JA 1B6AA 2K3FA 1BJAA 2DFFA 5HOOA 1BIBA 4DQ2A 1KA8A 2FBKA 3K1NA 1Y0NA 1FY7A 1D1BA 2V9PA 4E4HA 3EDPA 2Z33A 1QBJA 3S2HJ 2JA2A 2PN6A 2OZ6A 4RA2A 4WK8F 4B4CA 2CQKA 3LAJA 3E5UA 2XV4S 2O03A 3L9FA 3KETA 3OS0A 3Q5FA 3BZCA 3D0SA 4JK1X 4RLQA 3BTCA 3ML6A 1BN5A 4BHBA 1K78A 2CU7A 2LTPA 4I0AA 1FOKA 4ZYGA 3JTHA 4DBQA 1GXPA 2E2JJ 2P6SA 4C30A 1TT0A 2XSJC 3HRMA 3CDLA 4X6AJ 3PIOF 4BH9A 4HX8A 2EWNA 1XGMA 2LYCA 5EG0A 1VTNC 5D6FA 1BI2A 2WADA 1RZ4A 4ZYEA 3BJAA 1Y8RB 3IWZA 3K0LA 1SANA 2VPLA 3TBIA 1IDZA 3M8FA 4KIGA 4W1UA 1FSHA 2VBXA 3ZMDA 2M8GX 3MKZA 1QA6A 4HRIA 1H0MA 3S3MA 3GTPJ 1D0XA 2B9SA 4K2EA 4NQWB 4EJVA 2FOKA 1FIAA 3CCRI 4BEHA 4A0XA 2D1VA 3FXLA 4F3QA 4FTHA 2OTLI 1E3PA 1MBKA 3H3UA 3G73A 2XAUA 3JSPA 2L5QA 2VN2A 3CCLI 2A05A 4I99C 2FF4A 1E0EA 4CCJA 1ZGJA 3HSEA 5J8CA 2CRGA 4LIVA 2L7ZA 4V19K 2JVHA 3ZN0A 2X0LA 1MDMB 1B1BA 2F4OB 2X6XA 3ZMSA 5IYCJ 3OYIA 3K4CA 2NS0A 2LK2A 1A04A 1ZK8A 3WTVC 3WTYC 3OSGA 3GBGA 1D1CA 2NXNB 3QPHA 4BNCA 3CZ6A 2FJ1A 4LLGF 3P9CA 1DDNA 3JRAA 4MFEA 4A3BJ 4XLCA 4ZC3A 2E34A 2RVCA 1ETYA 4LK1F 4CDGA 1XC5A 2H6BA 4HDUA 3LL7A 2HNHA 3SEQA 1Q1HA 1T95A 2ZB9A 2HYJA 1YW8A 2Z16A 2JUCA 4PSXA 2CQXA 4I01A 1ZN2A 3GZ5A 3ZRGA 2QGUA 5CVJA 3OY9A 2K3PA 1I50J 3JAMK 1Z3YA 3WTTC 4D5FA 4XNFA 2QUFA 3IAM2 5F1RA 1UMQA 3X2QH 1CQTA 3DFGA 3R61A 4J00A 2PLYA 3M07A 3G1OA 3O8HA 1IXRC 4M72A 2DCEA 4L0YB 1WFXA 3HGGA 4UUSA 1HLVA 2R7FA 1IN4A 1BI1A 4IRGA 2BY3A 5DD8A 1EJ9A 2HQ5A 2G7HA 4G8XA 4F93B 2IXSA 3LA3A 3M8EA 1EH8A 1MBHA 2LREA 3CLOA 2F5CA 3HOTA 3CC4I 3I5UA 3P5JA 4XN3A 1AHDP 2EILH 2A5YB 2DT7B 2GA2A 1W7PA 4XM3A 5B1AH 3DEEA 5DM7F 4M6VA 1ZR4A 2IS6A 3OIPA 2ISZA 2IGKA 3QYBA 4HAMA 3JRCA 3S17J 2V79A 5F0CA 1IV8A 3KP2A 2ELJA 1SFKA 5HS7A 2IS2A 4QLCU 2BZTA 2KJBA 2V9KA 1JHFA 4IRIA 2K85A 3LSIA 2VOPA 2O3FA 2I8DA 4XN0A 3ASOH 2BYVE 4LJZF 1VQ6I 1O7FA 2UV1A 3ZMUA 1OCZH 1K6OA 3FXUA 2M2EA 3HXLA 2CQNA 3VPRA 3WHCA 3J7AO 3DF8A 5E1XA 2VQCA 3BPXA 3MQ0A 5IOYA 1U5TC 4XR6A 1GV5A 1LVAA 1P7JA 1WJ5A 4GYIA 3TDZC 2ZJ2A 4IZZA 2NVXJ 2VONA 1MMAA 4CYDA 3I71A 3HTUA 4N0BA 4CCLA 4IKFA 3RKWA 4Y15A 4G6QA 2QSGX 1S5LC 2KJCA 4XLAA 1YIOA 3GUDA 2DAOA 2HVSA 1ZLJA 4IHWA 1B59A 5ICCA 1R71A 1RESA 2FNPA 3IWFA 2WAFA 4RAFA 1WZ2A 4I0BA 3T5XA 3WTUC 4XSZF 4B43A 3RZDJ 1J0RA 2HQAA 3BCAA 3DKXA 2WTEA 2LBFB 4P9UA 3E6CC 3UKGA 2VKHA 3OYAA 3AL0B 1DPRA 2RC4A 3HKZN 3GEZA 3A01B 2LG4A 4ABZA 2DODA 2JZYA 1XSXA 2VXDA 3DLLF 4HNTA 1NTCA 6PAXA 2HYFA 1OQYA 2YS9A 2MA3A 2Q2EB 1GV2A 1Z21A 2GZWA 1JUSA 1U6GA 3ABUA 3W6VA 1FSEA 2IJLA 1QPIA 4G7OF 2PMZN 1IDYA 2Y31A 1FP1D 1FMVA 4MO7A 5H20A 3CCSI 1FT9A 1VF9A 2K27A 3M4OJ 1T56A 2O0YA 2R7WA 3BG3A 3RI4A 1NK2P 4UY8I 1TZLA 4MQ9F 5HLTA 2H1LA 1Z7UA 2KIQA 3OYHA 3HOSA 1RR7A 3K2ZA 1T8IA 5CYVA 4Y17A 4MLOA 3BROA 1G59A 3OYNA 5ICEA 1VQ7I 2M4GA 3A0BC 4U7BA 1XGOA 2VBWA 1T2KA 3M1EA 3L2WA 3PNTA 2XAJA 3BJOA 5CVUA 2QCOA 4XOPA 3I59A 4AIHA 5F0HA 1TTYA 2GA1A 4IQ4A 4HNVA 2V6CA 2H09A 4A3CJ 1H8AC 4E7ZA 2AQFA 2K4JA 3FHNA 4L9TA 4P55A 1F36A 3R6SA 1IZ1A 1KQ8A 2I5UA 4M9ZA 2A6HF 4KN7X 3AL0C 4QWQA 2JTVA 4RGRA 1P2FA 2ACJA 2L7FP 4BS9A 3QPSA 4AIDA 2Q8KA 1Y6IA 3IH4A 5B3SH 3DCFA 1MZBA 1RIOH 3BWGA 1TWHJ 4Q48A 4IO9F 5FFZA 3CCYA 3FWEA 5B5EC 4BUPA 3LSGA 1WVRA 5IT9K 1A35A 2OCCH 5E8GA 4Y33A 3KZZA 1U8RA 4CCKA 1AU7A 1T6SA 5K1YA 1X2MA 1RR8C 4FHTA 1B8IA 1R23A 3H92A 4CCOA 2W00A 1PDNC 4D1QA 3E97A 1E3HA 3MEXA 3LSPA 3IRRA 3FK7A 3NAUA 4OAYA 5D8LB 3T8TA 2FXAA 3SXYA 1XMAA 5FLMJ 4L9VA 3TP0A 2ZBKA 4CICA 2O9LA 5FFXA 3BG7A 5DD4A 3WTSC 1JGSA 5D6EA 3EYIA 3PFYA 4AUXA 1YE9A 2CH0A 3VDXA 1LDDA 2LVSA 4UUSB 3ZQHA 4XSXF 3K4KA 3Q9SA 4XONA 1A6QA 1MGTA 3B73A 4P96A 3ZXSA 1I3AA 5DV5A 1TL8A 3P9KA 1LJ9A 1U8BA 3HRTA 2EZHA 1LKXA 1W7PB 1YITI 5LHHA 4GCVA 3GWZA 4MTEA 4HA8A 3K6GA 1OCCH 4HPQA 4YELA 3MN2A 3DP7A 5FKKA 3HBLA 2EIKH 2STTA 4B8XA 4RAGA 3BR2A 1YS6A 3PUFA 4YG2F 1HKTA 3DPLC 3RPQA 4Q4ZF 2F4MB 4A2UA 2XRLA 4CCMA 2F6CA 5FGMA 3WTZA 5M5WJ 2LY2A 4CSWA 1HA8A 3LQRA 4C3IJ 1BR1A 1UCRA 2K9QA 2L7MP 1KU3A 2K5CA 4AM3A 2IGOA 2DT6A 4UV8A 3V8KA 1Z91A 1JJ6C 3FXOA 3M9AA 4FX0A 3MKYB 1JKOC 1TNTA 2KL4A 2FQ4A 3EQLF 2WY8Q 1TT5B 5DEQA 4Y52J 3JRFA 3Q0UA 4AWXB 3H5AA 1G8XA 2LY1A 3IC7A 4XQFA 4X1EA 4NBQA 2E7XA 1O57A 2M5WA 1LQ1A 3BG6A 3K9TA 1ZRFA 5HS9A 1ZAOA 1O3TA 5JFRA 5J40A 1R58A 1PP8F 2V9VA 1IF1A 3QOPA 1Y39A 4IOAF 3S8PA 2KZGA 3TKYA 2QF7A 1XB4A 2E5ZA 4HF0A 3ZR8X 2XF5A 2XHKA 1R7JA 1PUFB 2PMUA 3J7AY 2PJRB 3GTMJ 1HDPA 2A3SA 4RGSA 3AG3H 2Z2SB 1D0YA 4M3FA 2R92J 3AKZA 2BGCA 2P5KA 2M30A 3E3VA 1S7AA 3WE3A 2BHZA 2M9HA 5EEGA 2JA7J 1BR2A 2ELHA 2OJED 1R5HA 1VQKI 3QYFA 3HUGA 1YX5A 4L9JA 1DGRM 4GGGA 2UZKA 2P7CB 3CMYA 4PJNA 3KEOA 2B7EA 2X1EA 3KYDB 3W2VA 2HDDA 1BOAA 2GXAA 2JA8J 1JKQC 3BTIA 2JN6A 4G7HF 1WWXA 2Q1ZB 5E3LA 1XSDA 2E7WA 1FX7A 1GVDA 3MZYA 2IVMA 2IA0A 1KONA 4RS8A 3LFKA 4LB5A 4GXOA 5E1WA 1FBUA 2F2EA 3F72A 4H4KC 1R1TA 1R4MB 1TBXA 4MHGA 3HPGA 3MZ8A 1IGNA 1HDDC 4HSTA 2FRHA 2W84A 3QODA 4C2MJ 1ZARA 3VWBA 1Z7LA 3ASNH 1KU9A 3QRFF 1WH7A 1FOWA 4RAZA 1J09A 1DQUA 3C2HA 4XKWA 3HOWJ 3BR5A 5IP9J 2RV8A 4XMYA 3COAC 2VBYA 3EETA 3JR9A 3CQZJ 5J1UA 3I0TA 1D0ZA 3W2WA 4D5CA 2K40A 5FKNA 1FZPB 2RQQA 1FBQA 2R7DA 2XPVA 5FLXK 2J5PA 2M34A 1WJCA 4KICA 4IRHA 1SFXA 2KISA 2DPUA 3LSTA 3V8LA 3G1LA 3BG9A 2MSYA 4E7IA 3CP2A 4LG0A 4YFXF 5DM6F 2WAEA 1N77A 3BDDA 4B47A 4IQJA 2WAQA 5EGOB 3ERED 4A3GJ 1QHGA 2R7UA 3L2UA 1ZGWA 2GIVA 2ZJPF 2GBYA 2CSOA 1MSFC 4PK4A 1Z6TA 3S1NJ 2IA2A 4I76A 3GX4X 2M7AA 5FLVA 1ORKA 1WKMA 4DYCA 3E0JB 4KJZA 3RYRA 1MDMA 5M5XJ 4BQQA 1WJDA 2H27A 2VJIA 2DMTA 3FXMA 5DS9A 3JRGA 3ZN1A 3L2RA 4OIPF 1I1GA 3TO7A 4FISA 5M3MJ 4BDYA 4BACA 1SVLA 5FD6A 2HGCA 2IGMA 2X6YA 3U21A 1X3WB 3IHUA 3FHZA 1P4WA 3CESA 3ZQIA 1O7LA 2FA5A 3CUQB 3MZHA 4BBRJ 3LSRA 2DA3A 1OCOH 4HZFA 3H0GJ 2X1CA 5IPAA 4PUSA 1J5YA 2ZXHA 2OC6A 5D5WB 1S7OA 4FASD 1YS7A 1U5TA 3KP6A 1SMTA 5A2QZ 3OL4A 3Q0WA 3HC7A 1RRJA 1H9GA 1KU2A 2DW4A 2VIXA 4N9HA 3S1RJ 5LD2C 2IAIA 2BHYA 3HEFA 4UUTA 3L1PA 3S32A 3ZMTA 3K4MA 2K9MA 5E3OA 3VYUB 1F1ZA 2E5NA 4XRSA 3O6BB 3I55I 3BR1A 3F6OA 3IUOA 1XMKA 3CJRB 5DCMB 2VT3A 1OCTC 2LD5A 3SEZA 3DWLE 3V7SA 2HQNA 4RGUA 1O4XA 4BQNA 3CMMA 4CUGA 2ECBA 3FM5A 1RETA 2ESNA 2BOLA 2R7QA 1CF7B 2MFZA 4HG2A 4DOZA 4RB3C 4YIFA 3P9IA 5KCMA 3FXRA 3CCVI 4OINF 2AS5F 1X1PA 4C3HJ 1K6YA 5J6XA 3L2VA 4CHUA 5E1ZB 2HU9A 2MG4A 4DBRA 2KRFA 4CO8A 1R49A 3CUQC 3SZTA 4HX7A 2FNAA 3A2KA 5CVRA 1ON2A 3C18A 1UJ8A 1V5FA 2B0LA 2CW8A 2LDUA 4BJTA 3WTWC 3A03A 1VNDA 3G2BA 4IL6C 3A1YA 4EJOA 3H35A 3DTKA 1IXCA 3IV5A 1IAWA 4LG3A 5LGUA 1WJAA 2DFEA 2ZSHB 2L2OA 3KLNA 1OLTA 4BE1A 4CGZA 4HNUA 4L18B 5GAEJ 2HDWA 2STWA 1IN8A 4ZYDA 1QGPA 2VB6A 3Q0VA 4M9SA 2HZTA 4PJLA 3LSMA 1BA5A 2RREA 4II3A 1TQIA 1V5GA 5GPAA 1Y56A 2FOWA 2CJJA 2UWMA 2LBFA 4P5OA 2KPMA 2Y75A 1SD4A 1VQOI 3VODA 2CUEA 2ME6A 1XCBA 3JCUC 1F43A 3C2BA 3A01A 1HCRA 4DNCA 4M74A 1WGXA 2PG4A 2H6CA 2VQLA 4ZZDA 2Q2EA 2E1NA 1TW3A 1JTXA 4M6YA 4II2A 2D1HA 1R22A 1OYIA 1TLHB 4U88A 4A12A 2MC3A 1P4XA 2MH9A 2PQ8A 1I39A 4M6XA 4XRMA 2LF8A 1WJBA 3B02A 1XPXA 4AIKA 3QP5A 4WXDA 1O3QA 2NAZA 3F8MA 2XC7A 3RKYA 3ULQB 2IBDA 5C4JJ 4BJ5C 4ZTJA 2NS7A 4HF1A 2A5WA 1UHSA 1W0UA 3L2QA 1YFHA 5ED4A 1MBJA 3P7NA 4QTRA 4LG0B 3M8JA 4OMZA 3RJPA 5LHGA 5BPIA 1FEXA 2X9DA 4F55A 3HDDA 3L09A 4A0ZA 4IOCF 1APLC 4G12A 2PFBA 1XN7A 2GOMA 1IJWC 3DKWA 2L4AA 4WF2A 1B9NA 2HVRA 1Y8QB 1OKRA 5GAGJ 3HJEA 4JYKA 2IEKA 3ISPA 4RDUA 3JTGA 2ICWG 2K02A 3FISA 3IH2A 3V4GA 2VJJA 1Z0XA 1EKEA 4A3EJ 5KAFC 1HW2A 3C3WA 3H1CA 3NQOA 4A5NA 4WX9A 2V1UA 4EQQA 2ZXJA 1FPQA 4F7ZA 5F6FA 3DKYA 2LR8A 3FMRA 2ZFWA 3ELKA 5JVTA 1BJZA 4C3JJ 3NARA 1DP3A 1QVUA 4CZZA 5LGTA 1FWZA 2HI3A 2ADUA 4RB0A 3GTQJ 2X4HA 3RKXA 2F5EA 2L9RA 1FP2A 3LQQA 1POGA 3PNVA 3ABMH 1P4AA 1U5TB 2L54A 4KISA 1GLNA 1Y0UA 2EB7A 2ELKA 4OIQF 2Y69H 4DZPA 5EZGA 5E79C 1JKPC 1TWGJ 2OAZA 2XRNA 3BJ6A 2ZKZA 1UFMA 3OYDA 4XK4A 2L7KA 1LE8A 3ABKH 3E6DA 3FXKA 4J01A 2DA7A 3RQIA 4ENNA 1FTZA 4XLPF 1YRNA 4S05A 3TDUC 4XKCA 4Y13A 1NG6A 4BXXJ 2CG4A 2DA6A 2FD5A 3WHBA 2KQRA 2M0CA 3WU1B 1UG2A 1S9HA 1TP4A 2L02A 3FKIJ 1QZEA 1VQ9I 2DT5A 4V2GA 4KT5C 2H1KA 2NVYJ 1SC7A 3JRIA 2OUMA 1ZELA 4HF2A 3HRSA 2R7TA 4G94A 4LIUA 2MW8A 5JLWA 2Y48A 1P6RA 2IT0A 3I58A 4ANJA 4NHJA 1AKHB 2FMYA 4A3FJ 1WPKA 2VKEA 2IS1A 4N4NB 3W2AA 2XDVA 1ZG1A 3WGGA 2LKXA 5TGTA 2UXXA 3GZNB 3HG9A
chains in the Genus database with same CATH topology
3PFIA 1QZYA 4BHCA 5CVVA 5DUKA 1LEAA 1XSVA 2KIMA 4LGWA 3R60A 4BXUA 1P92A 4RGXA 4EJWA 5HS8A 1HKQA 4A6DA 2WC2A 2RKHA 5LGNA 1O3SA 3CTAA 2MD5A 2G9WA 3HIFA 2VODA 4CXFA 3JAMZ 1DUXC 1Z1DA 1BIAA 3M7GA 4RB2C 2Q0OA 3N4MA 5JR3A 1FNNA 4UXNA 1Z6RA 4LFUA 3GZ6A 4LB6B 4HBLA 1PUEE 5AIQA 4Z2YA 2ESHA 2ETHA 1U2WA 1JHHA 4LMYA 4OU0A 3GFJA 3L2CA 2HOEA 4TV7A 5LRRA 1RNLA 3WGIA 4ENJA 3DEUA 2R3SA 4HQMA 2MH2A 1BBYA 5EEHA 1ODDA 3IRQA 3C1DA 5ILVA 1D5VA 3CDHA 1F5TA 4BQAA 4BHPA 2NNNA 4O5VA 2DTRA 4PCQA 3WG9A 3TO6A 5BMZA 3PQKA 4EM2A 2ZNZA 1QNTA 3QU3A 3ROUA 1HQCA 1IN6A 4B09A 2EV0A 4Q47A 4I7HA 3V7CA 4HDVA 1IRFA 2CO5A 3KFWX 2Z5UA 3FXQA 3KEQA 5BQTA 1ZG5A 2YR2A 1BC8C 3LA2A 1I27A 1ZYRF 2IA1A 4XBFA 2QLZA 1S29A 1F9NA 3KP3A 2M87A 3KLOA 2FBIA 1GHCA 1R1UA 2LSOA 2EFWA 3CUQA 4O6JA 1LB2A 3F23A 3SHFA 1G3TA 3W6KB 5KK1A 1SD6A 1Z9CA 2GXBA 5CJ9A 3J80K 4JQFA 4Q5SF 2M45A 5L3EA 3FM3A 1IRGA 2PJPA 1QPMA 3TQNA 1HSTA 5H6RA 3BZ6A 4IJAA 1B4AA 2XAQA 1TNSA 5DCMA 4FT8A 3KP4A 4A5MA 2BV6A 1FYKA 1W4MA 1IN5A 1JXSA 1CF7A 3HHGA 3T1BA 5HDKA 5IT9Z 1E2XA 1I1SA 2COMA 4YFKF 3O2PE 1V4RA 3HSFA 1FC3A 2QYOA 2RQPA 2GQQA 3EYYA 1S8NA 1BI0A 1ZRDA 4ZH4F 4OMYA 1WRJA 1E17A 2KIFA 5E20A 5F64A 2OZUA 2F5FA 3MFKA 4A6EA 1D8KA 1IW7F 2HTJA 1UHMA 4R79A 3SZPA 5DYMA 2O8XA 1R5GA 3RYPA 2KKOA 1LNWA 4MEYF 3VB2A 4HYEA 5JI6A 4GYGA 1MJ9A 4EJUA 4KIFA 4E70A 3HRUA 1OPCA 1LEBA 2JPCA 2XROA 4ESJA 3G3ZA 1MJAA 2OQGA 1HXDA 1USSA 2W24A 3K1MA 5K5RA 2K4BA 3C7JA 2EJRA 4L0ZB 2H94A 4H0EA 1XCVA 2QZ8A 4LLNA 2A61A 1U3EM 4U0YA 4AD9A 1UHWA 2DLLA 2QBYB 1IN7A 3F6VA 2EA4A 2EFQA 2P7VB 2MLKA 4HQEA 4I2OA 5K5OA 2EV6A 3TOAA 2L01A 1R00A 3H3ZA 1G4DA 4UV9A 3S2WA 1FBSA 1B9MA 4UVCA 5HDGA 4OOIA 3NRVA 3J81K 2EK5A 2JPBA 1CGPA 1D3YA 1RUOA 3GW2A 4MEXF 3BOQA 4EV0A 1TW2A 2CW0F 2LNBA 4ZYHA 1KQ0A 5E18F 4L9NA 2Z3YA 1C0WA 2L4MA 2RN7A 5L3DA 3I54A 4EGZA 2LF7A 4UNOA 5HLGA 1EV7A 2K7LA 1G3WA 3ZPLA 2WV0A 1OR7A 1FLIA 1EH7A 5FLXZ 2HTSA 2CYYA 1YW9A 3IKVA 1GXQA 3EUHA 1HBXG 1QQIA 2HR3A 2DFIA 5BPDA 1X3UA 2EFOA 5AIPA 3ZMZA 2O61A 1GVJA 1AOYA 4HX4A 4PDKA 3CJNA 3LAPA 3KCCA 5BS6A 2CWEA 5ICFA 1XDUA 2YX4A 4LD5A 3BP8A 3SFZA 2EA2A 1TQPA 3HYIA 3DPTA 1LDKB 2V1DA 4U0WA 4KDPA 2RNJA 2HDCA 4AIJA 4KN4X 3F8CA 3WGHA 2VC0A 4KA4A 4AVPA 1BM9A 2DK5A 3ZQ7A 2WWYA 1XGSA 1HW1A 5AONA 2GXGA 3HTSB 1IXSB 2F5DA 5E17F 1BI3A 1J59A 2P6TA 1HKSA 4OIOF 3U2RA 2GAUA 4RAYA 1V3FA 3OOPA 5ERIA 3RTRA 3KE2A 1QO0D 4BAYA 2XAGA 4MNUA 5D4SA 3BPVA 2HFHA 1ON1A 5FB2A 4UHTA 1HSJA 2JSCA 3F8BA 3F21A 2IP2A 5L3CA 3WE2A 1R36A 4ENMA 4KUMA 1ZREA 5LHIA 4L5JA 2M1BA 2O6GE 2DU9A 2QWWA 2IW5A 5DUIA 2FSWA 3REOA 1R1VA 4U0VA 5ICGA 5L3FA 3TGNA 3FF5A 2VE8A 4ENKA 1W7PD 2EFPA 1S3JA 2XIGA 4MGRA 1PP7U 2DK8A 3I4PA 4LLLA 1WI9A 3FMSA 4M71A 4EGYA 3I64A 5D8KB 1T0FA 2W85A 5H6QA 5HVQC 1ULYA 2D45A 5LRSA 3BY6A 3K1PA 4IXAA 2P5LC 1YYVA 4S04A 5TJJA 4HV6A 1KGSA 4LK0F 3L00A 4ASNA 2FE3A 2W25A 1FYLA 3CO6C 1XDSA 4IF4A 4I98B 1OYWA 2D2WA 2VXZA 1ZRCA 2HKXA 2HYGD 3R4KA 5HLIA 2PBIA 2ZO4A 3I53A 3GVAA 2XUBA 3N97A 4KNYA 1ZH5A 3GLXA 4O3MA 2FQ3A 2P4WA 2P8TA 1JE8A 2XAFA 1I5ZA 2OBPA 1J7KA 2FBHA 1RI7A 2E1CA 4PGHA 2DO7A 3QP6A 3DV8A 1SMYF 5HDNA 2FU4A 3F3XA 2IPQX 3WODF 4IHTA 3HSRA 3PQJA 4IPAA 2CFXA 5L3BA 1J9IA 3AAFA 2OQRA 2P5VA 4U7DA 2PI0A 4WCGA 2RGVA 4ON0A 3IL2A 2V1XA 4G6DA 2FMLA 4RB1A 4UUVA 1J75A 2HKOA 1K79A 2M8EA 4ZZLA 1UB9A 4I02A 3IKTA 3RIRA 4WWCA 1YLFA 1K78B 4JBAA 3FMQA 2RDPA 3GO5A 5LLQA 2YU3A 3NEUA 1REPC 4I09A 4M73A 2VC1A 3OV8A 4IVNA 3GXOA 2DQLA 3RPUA 2A68F 4PGGA 2ISYA 4KIBA 2JRTA 3GFIA 3GF2A 2BBYA 2DQRA 4R1HA 4PZJA 1SAXA 5JHUA 1USTA 2OA4A 1OMIA 2AXLA 4EM0B 5ILSA 3CUOA 3QAHA 2QBYA 1J2XA 2GWRA 4G7ZF 3F22A 2VE9A 3MCZA 3MZHA 3GFLA 5CLSA 5D5XB 2ZMEA 1KYWA 1EH6A 1YW7A 1ZG3A 2K86A 1LDJA 1DPUA 4EM1A 1WSUA 2ZNYA 1T98A 1QZZA 2G7UA 1OYYA 1TQMA 3E6BA 1H9TA 1ZLKA 2L3DA 2BEOA 3WTXC 2HEOA 1G3YA 3JSOA 3LA7A 2PMHA 4ESBA 2YSRA 5TRDA 2MBFA 3ECOA 2C6YA 2HQRA 3VEPA 1KYZA 2XAHA 1YO5C 3JW4A 1FYMA 4HOBA 2QQBA 5HLHA 1STZA 1I6XA 4XLNF 2A07F 3VFZA 1AWCA 2NNYA 2A6EF 3W6JB 2EV5A 3T0YA 1YTYA 3QU6A 2FEZA 2QENA 2Y0MA 2XVCA 1Z05A 3E5XA 3DXJF 3KZYA 3T8RA 1DP7P 3V8JA 1MD0A 2XKOA 5KVRA 3Q9VA 1G3SA 5ILUA 4HLXA 2DPDA 2VT2A 4KYWA 2OU2A 1SFEA 1SD7A 5FO5A 2W57A 1ZHFA 2KIUA 5J8FA 2QVOA 1ONVA 3J80Z 4YFNF 3F8FA 3ECHA 4UVBA 2HWVA 5E8IA 5LEKA 4FX4A 5DDGA 3U1DA 3F8NA 4YIIA 4MTDA 3SQNA 2HS5A 2EFNA 4HLYA 3KP5A 3L7WA 4ETSA 1MJBA 4HW0A 1W5SA 2J5OA 3E5QA 2Z99A 4P9FA 5A2QK 5BOXA 4NB5A 3HHHA 5L3GA 3I59B 2XKPA 4HV5A 1G6NA 1SD5A 3GYHX 1D8JA 1YQAA 2NRAC 1S6LA 4XRFA 1IUYA 4D0PA 1W5TA 4KMFA 2A69F 1WQ2A 4R8HA 2ZMEB 1NHAA 3ZMVA 4EMSA 4OIRF 2YX7A 4KFCA 4NQWA 2CGPA 3TOBA 1KQ9A 4G9YA 3E6MA 4M9XA 1MKMA 4N9IA 2PEXA 1XD7A 4GO1A 4A0YA 2TDXA 3O3KA 1T39A 4UVAA 5FD5A 3R0JA 2XASA 2YPRA 3ZP5A 1L3LA 3MWMA 3KP7A 2MLGA 2XGXA 3D5LA 4BYYA 2QM3A 4IHSA 5DCFA 4WXHA 5D4RA 2ZCWA 3U9GA 5IT3A 1SFUA 3ABTA 3LWFA 3MAJA 1BC7C 3RDIA 2VBZA 3FX3A 1ZGAA 2IRFG 2QQAA 2QQ9A 2VOOA 1XGNA 3WU0A 3GFMA 3CO7C 1T38A 2JT1A 4MQVA 4L5IA 3K69A 1HW5A 3V7RA 1KU7A 3DQVC 4KMUX 3FZVA 3J81Z 4ESFA 5LBQA 5D5VB 1RUNA 1YG2A 2OD5A 2Z9OA 2UXNA 2LKPA 5CVIA 5LEJA 1L0OC 3TO9A 1U78A 1K7AA 4EJTA 5K5QA 4WXCA 2DBBA 3VOEA 3QPTA 1F4KA 4EVIA 3R0AA 5D5UB 1O3RA 2BE5F 2DI3A 2NYXA 1B6AA 1BJAA 5HOOA 1BIBA 4DQ2A 1KA8A 2FBKA 3K1NA 1FY7A 3EDPA 2Z33A 1QBJA 2PN6A 2OZ6A 4WK8F 2CQKA 3LAJA 3E5UA 2XV4S 2O03A 3L9FA 3KETA 3Q5FA 3D0SA 4JK1X 3ML6A 1BN5A 4BHBA 1K78A 4I0AA 1FOKA 4ZYGA 3JTHA 1GXPA 2P6SA 3HRMA 4BH9A 4HX8A 2EWNA 1XGMA 1VTNC 5D6FA 1BI2A 1RZ4A 4ZYEA 3BJAA 3IWZA 3K0LA 3M8FA 4KIGA 1FSHA 2VBXA 3ZMDA 1H0MA 4K2EA 4EJVA 2FOKA 4A0XA 2D1VA 3G73A 3H3UA 3JSPA 2VN2A 2FF4A 1ZGJA 3HSEA 5J8CA 3ZN0A 2X0LA 1MDMB 1B1BA 3ZMSA 2NS0A 1A04A 3WTYC 3WTVC 3QPHA 4BNCA 4LLGF 3P9CA 1DDNA 2RVCA 4LK1F 4CDGA 2H6BA 4HDUA 1Q1HA 1YW8A 4I01A 1ZN2A 3GZ5A 5CVJA 3JAMK 3WTTC 2QUFA 5F1RA 3DFGA 3R61A 2PLYA 1IXRC 4M72A 4L0YB 2R7FA 1IN4A 1BI1A 4IRGA 5DD8A 2G7HA 4G8XA 3LA3A 3M8EA 1EH8A 3CLOA 2F5CA 3HOTA 3I5UA 2A5YB 2GA2A 1W7PA 2ISZA 4HAMA 2V79A 3KP2A 5HS7A 4QLCU 2KJBA 1JHFA 4IRIA 2VOPA 2O3FA 2BYVE 4LJZF 1O7FA 3ZMUA 1K6OA 3FXUA 3J7AO 3DF8A 5E1XA 3BPXA 3MQ0A 1U5TC 3TDZC 1LVAA 4GYIA 2ZJ2A 2VONA 4CYDA 3I71A 3HTUA 4N0BA 3RKWA 4Y15A 4G6QA 2KJCA 1YIOA 3GUDA 2DAOA 1ZLJA 1B59A 5ICCA 2FNPA 3IWFA 4I0BA 3T5XA 3WTUC 4XSZF 1J0RA 2WTEA 4P9UA 3E6CC 1DPRA 2RC4A 3GEZA 2JZYA 1XSXA 6PAXA 2HYFA 2MA3A 2GZWA 1U6GA 3ABUA 1FSEA 2IJLA 4G7OF 1FP1D 5H20A 1FT9A 2K27A 2O0YA 3RI4A 4MQ9F 1Z7UA 3HOSA 3K2ZA 5CYVA 4Y17A 3BROA 5ICEA 4U7BA 1XGOA 2VBWA 1T2KA 3M1EA 2XAJA 3BJOA 5CVUA 3I59A 4AIHA 1TTYA 2GA1A 2V6CA 2H09A 2K4JA 4L9TA 4P55A 3R6SA 1IZ1A 1KQ8A 4M9ZA 2A6HF 4KN7X 4QWQA 2JTVA 4RGRA 1P2FA 2ACJA 2Q8KA 1MZBA 1RIOH 3BWGA 4Q48A 5FFZA 3FWEA 5IT9K 5E8GA 3KZZA 1U8RA 1T6SA 5K1YA 4FHTA 1R23A 3H92A 1PDNC 3E97A 3IRRA 3MEXA 5D8LB 3T8TA 2FXAA 3SXYA 1XMAA 4L9VA 2ZBKA 4CICA 5FFXA 5DD4A 3WTSC 1JGSA 5D6EA 3EYIA 1LDDA 4XSXF 3Q9SA 1MGTA 3B73A 4P96A 5DV5A 3P9KA 1LJ9A 3HRTA 1W7PB 5LHHA 4GCVA 3GWZA 4MTEA 4HA8A 3DP7A 2STTA 4B8XA 1YS6A 4YG2F 1HKTA 3DPLC 3RPQA 4Q4ZF 4A2UA 5FGMA 3WTZA 3LQRA 1UCRA 1KU3A 3V8KA 4UV8A 1Z91A 3M9AA 4FX0A 1TNTA 3EQLF 5DEQA 4AWXB 3IC7A 2E7XA 1O57A 2M5WA 1LQ1A 3K9TA 1ZRFA 5HS9A 1ZAOA 1O3TA 5JFRA 1R58A 1PP8F 2V9VA 1IF1A 3QOPA 3TKYA 1XB4A 4HF0A 2XHKA 1R7JA 2PMUA 2A3SA 4RGSA 2BGCA 2P5KA 2M30A 3E3VA 1S7AA 3WE3A 5EEGA 2ELHA 1R5HA 3HUGA 4L9JA 4GGGA 2UZKA 2P7CB 3KEOA 1BOAA 4G7HF 1WWXA 1XSDA 2E7WA 1FX7A 3MZYA 2IVMA 2IA0A 4RS8A 3LFKA 4LB5A 4GXOA 5E1WA 1FBUA 2F2EA 3F72A 1R1TA 1TBXA 4MHGA 2FRHA 2W84A 1ZARA 1KU9A 3QRFF 4RAZA 2RV8A 3COAC 2VBYA 3EETA 3I0TA 1FZPB 1FBQA 2R7DA 5FLXK 2J5PA 4KICA 4IRHA 1SFXA 2DPUA 3LSTA 3V8LA 4LG0A 4YFXF 3BDDA 3ERED 2GIVA 2CSOA 1Z6TA 2IA2A 3GX4X 1WKMA 3RYRA 1MDMA 2H27A 4OIPF 3ZN1A 1I1GA 3TO7A 5FD6A 2HGCA 3IHUA 3FHZA 1P4WA 1O7LA 2FA5A 3CUQB 4HZFA 1J5YA 5D5WB 1S7OA 1YS7A 1U5TA 3KP6A 1SMTA 5A2QZ 1H9GA 1KU2A 2DW4A 4N9HA 3ZMTA 1F1ZA 3O6BB 3F6OA 1XMKA 5DCMB 2VT3A 3V7SA 2HQNA 4RGUA 3FM5A 2ESNA 1CF7B 4RB3C 4YIFA 3P9IA 3FXRA 4OINF 2AS5F 5J6XA 4CHUA 5E1ZB 2KRFA 4CO8A 3CUQC 3SZTA 4HX7A 2FNAA 5CVRA 1ON2A 3C18A 3WTWC 2B0LA 2LDUA 4EJOA 1IXCA 1IAWA 5LGUA 3KLNA 4CGZA 4L18B 2STWA 1IN8A 4ZYDA 1QGPA 4M9SA 2HZTA 1TQIA 2UWMA 4P5OA 2Y75A 1SD4A 3VODA 1XCBA 4DNCA 4M74A 2PG4A 2H6CA 4ZZDA 2Q2EA 2E1NA 1TW3A 4M6YA 2D1HA 1R22A 1OYIA 1TLHB 4U88A 4A12A 2MC3A 1P4XA 2MH9A 2PQ8A 4M6XA 2LF8A 3B02A 4AIKA 3QP5A 4WXDA 1O3QA 2NAZA 3F8MA 3RKYA 3ULQB 4HF1A 1YFHA 5ED4A 3P7NA 4LG0B 4OMZA 3RJPA 5LHGA 5BPIA 3L09A 4A0ZA 2PFBA 1XN7A 3DKWA 2L4AA 4WF2A 1B9NA 1OKRA 3JTGA 3ISPA 2K02A 3V4GA 1HW2A 3C3WA 3NQOA 4A5NA 2V1UA 4WX9A 4EQQA 2ZXJA 1FPQA 4F7ZA 5F6FA 3FMRA 2ZFWA 3ELKA 5JVTA 4CZZA 5LGTA 1FWZA 2ADUA 4RB0A 2X4HA 3RKXA 2F5EA 1FP2A 3LQQA 1P4AA 1U5TB 2L54A 1Y0UA 2EB7A 4OIQF 2XRNA 2OAZA 3BJ6A 2ZKZA 1UFMA 3E6DA 4ENNA 4XLPF 4S05A 3TDUC 4Y13A 2CG4A 3WU1B 2L02A 2DT5A 4KT5C 4HF2A 3HRSA 4G94A 2Y48A 1P6RA 2IT0A 3I58A 4NHJA 2FMYA 1ZG1A 3WGGA 2UXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFI A;  1QZY A;  4BHC A;  5CVV A;  5DUK A;  1LEA A;  1XSV A;  2KIM A;  4LGW A;  3R60 A;  4BXU A;  1P92 A;  4RGX A;  4EJW A;  5HS8 A;  1HKQ A;  4A6D A;  2WC2 A;  2RKH A;  5LGN A;  1O3S A;  3CTA A;  2MD5 A;  2G9W A;  3HIF A;  2VOD A;  4CXF A;  3JAM Z;  1DUX C;  1Z1D A;  1BIA A;  3M7G A;  4RB2 C;  2Q0O A;  3N4M A;  5JR3 A;  1FNN A;  4UXN A;  1Z6R A;  4LFU A;  3GZ6 A;  4LB6 B;  4HBL A;  1PUE E;  5AIQ A;  4Z2Y A;  2ESH A;  2ETH A;  1U2W A;  1JHH A;  4LMY A;  4OU0 A;  3GFJ A;  3L2C A;  2HOE A;  4TV7 A;  5LRR A;  1RNL A;  3WGI A;  4ENJ A;  3DEU A;  2R3S A;  4HQM A;  2MH2 A;  1BBY A;  5EEH A;  1ODD A;  3IRQ A;  3C1D A;  5ILV A;  1D5V A;  3CDH A;  1F5T A;  4BQA A;  4BHP A;  2NNN A;  4O5V A;  2DTR A;  4PCQ A;  3WG9 A;  3TO6 A;  5BMZ A;  3PQK A;  4EM2 A;  2ZNZ A;  1QNT A;  3QU3 A;  3ROU A;  1HQC A;  1IN6 A;  4B09 A;  2EV0 A;  4Q47 A;  4I7H A;  3V7C A;  4HDV A;  1IRF A;  2CO5 A;  3KFW X;  2Z5U A;  3FXQ A;  3KEQ A;  5BQT A;  1ZG5 A;  2YR2 A;  1BC8 C;  3LA2 A;  1I27 A;  1ZYR F;  2IA1 A;  4XBF A;  2QLZ A;  1S29 A;  1F9N A;  3KP3 A;  2M87 A;  3KLO A;  2FBI A;  1GHC A;  1R1U A;  2LSO A;  2EFW A;  3CUQ A;  4O6J A;  1LB2 A;  3F23 A;  3SHF A;  1G3T A;  3W6K B;  5KK1 A;  1SD6 A;  1Z9C A;  2GXB A;  5CJ9 A;  3J80 K;  4JQF A;  4Q5S F;  2M45 A;  5L3E A;  3FM3 A;  1IRG A;  2PJP A;  1QPM A;  3TQN A;  1HST A;  5H6R A;  3BZ6 A;  4IJA A;  1B4A A;  2XAQ A;  1TNS A;  5DCM A;  4FT8 A;  3KP4 A;  4A5M A;  2BV6 A;  1FYK A;  1W4M A;  1IN5 A;  1JXS A;  1CF7 A;  3HHG A;  3T1B A;  5HDK A;  5IT9 Z;  1E2X A;  1I1S A;  2COM A;  4YFK F;  3O2P E;  1V4R A;  3HSF A;  1FC3 A;  2QYO A;  2RQP A;  2GQQ A;  3EYY A;  1S8N A;  1BI0 A;  1ZRD A;  4ZH4 F;  4OMY A;  1WRJ A;  1E17 A;  2KIF A;  5E20 A;  5F64 A;  2OZU A;  2F5F A;  3MFK A;  4A6E A;  1D8K A;  1IW7 F;  2HTJ A;  1UHM A;  4R79 A;  3SZP A;  5DYM A;  2O8X A;  1R5G A;  3RYP A;  2KKO A;  1LNW A;  4MEY F;  3VB2 A;  4HYE A;  5JI6 A;  4GYG A;  1MJ9 A;  4EJU A;  4KIF A;  4E70 A;  3HRU A;  1OPC A;  1LEB A;  2JPC A;  2XRO A;  4ESJ A;  3G3Z A;  1MJA A;  2OQG A;  1HXD A;  1USS A;  2W24 A;  3K1M A;  5K5R A;  2K4B A;  3C7J A;  2EJR A;  4L0Z B;  2H94 A;  4H0E A;  1XCV A;  2QZ8 A;  4LLN A;  2A61 A;  1U3E M;  4U0Y A;  4AD9 A;  1UHW A;  2DLL A;  2QBY B;  1IN7 A;  3F6V A;  2EA4 A;  2EFQ A;  2P7V B;  2MLK A;  4HQE A;  4I2O A;  5K5O A;  2EV6 A;  3TOA A;  2L01 A;  1R00 A;  3H3Z A;  1G4D A;  4UV9 A;  3S2W A;  1FBS A;  1B9M A;  4UVC A;  5HDG A;  4OOI A;  3NRV A;  3J81 K;  2EK5 A;  2JPB A;  1CGP A;  1D3Y A;  1RUO A;  3GW2 A;  4MEX F;  3BOQ A;  4EV0 A;  1TW2 A;  2CW0 F;  2LNB A;  4ZYH A;  1KQ0 A;  5E18 F;  4L9N A;  2Z3Y A;  1C0W A;  2L4M A;  2RN7 A;  5L3D A;  3I54 A;  4EGZ A;  2LF7 A;  4UNO A;  5HLG A;  1EV7 A;  2K7L A;  1G3W A;  3ZPL A;  2WV0 A;  1OR7 A;  1FLI A;  1EH7 A;  5FLX Z;  2HTS A;  2CYY A;  1YW9 A;  3IKV A;  1GXQ A;  3EUH A;  1HBX G;  1QQI A;  2HR3 A;  2DFI A;  5BPD A;  1X3U A;  2EFO A;  5AIP A;  3ZMZ A;  2O61 A;  1GVJ A;  1AOY A;  4HX4 A;  4PDK A;  3CJN A;  3LAP A;  3KCC A;  5BS6 A;  2CWE A;  5ICF A;  1XDU A;  2YX4 A;  4LD5 A;  3BP8 A;  3SFZ A;  2EA2 A;  1TQP A;  3HYI A;  3DPT A;  1LDK B;  2V1D A;  4U0W A;  4KDP A;  2RNJ A;  2HDC A;  4AIJ A;  4KN4 X;  3F8C A;  3WGH A;  2VC0 A;  4KA4 A;  4AVP A;  1BM9 A;  2DK5 A;  3ZQ7 A;  2WWY A;  1XGS A;  1HW1 A;  5AON A;  2GXG A;  3HTS B;  1IXS B;  2F5D A;  5E17 F;  1BI3 A;  1J59 A;  2P6T A;  1HKS A;  4OIO F;  3U2R A;  2GAU A;  4RAY A;  1V3F A;  3OOP A;  5ERI A;  3RTR A;  3KE2 A;  1QO0 D;  4BAY A;  2XAG A;  4MNU A;  5D4S A;  3BPV A;  2HFH A;  1ON1 A;  5FB2 A;  4UHT A;  1HSJ A;  2JSC A;  3F8B A;  3F21 A;  2IP2 A;  5L3C A;  3WE2 A;  1R36 A;  4ENM A;  4KUM A;  1ZRE A;  5LHI A;  4L5J A;  2M1B A;  2O6G E;  2DU9 A;  2QWW A;  2IW5 A;  5DUI A;  2FSW A;  3REO A;  1R1V A;  4U0V A;  5ICG A;  5L3F A;  3TGN A;  3FF5 A;  2VE8 A;  4ENK A;  1W7P D;  2EFP A;  1S3J A;  2XIG A;  4MGR A;  1PP7 U;  2DK8 A;  3I4P A;  4LLL A;  1WI9 A;  3FMS A;  4M71 A;  4EGY A;  3I64 A;  5D8K B;  1T0F A;  2W85 A;  5H6Q A;  5HVQ C;  1ULY A;  2D45 A;  5LRS A;  3BY6 A;  3K1P A;  4IXA A;  2P5L C;  1YYV A;  4S04 A;  5TJJ A;  4HV6 A;  1KGS A;  4LK0 F;  3L00 A;  4ASN A;  2FE3 A;  2W25 A;  1FYL A;  3CO6 C;  1XDS A;  4IF4 A;  4I98 B;  1OYW A;  2D2W A;  2VXZ A;  1ZRC A;  2HKX A;  2HYG D;  3R4K A;  5HLI A;  2PBI A;  2ZO4 A;  3I53 A;  3GVA A;  2XUB A;  3N97 A;  4KNY A;  1ZH5 A;  3GLX A;  4O3M A;  2FQ3 A;  2P4W A;  2P8T A;  1JE8 A;  2XAF A;  1I5Z A;  2OBP A;  1J7K A;  2FBH A;  1RI7 A;  2E1C A;  4PGH A;  2DO7 A;  3QP6 A;  3DV8 A;  1SMY F;  5HDN A;  2FU4 A;  3F3X A;  2IPQ X;  3WOD F;  4IHT A;  3HSR A;  3PQJ A;  4IPA A;  2CFX A;  5L3B A;  1J9I A;  3AAF A;  2OQR A;  2P5V A;  4U7D A;  2PI0 A;  4WCG A;  2RGV A;  4ON0 A;  3IL2 A;  2V1X A;  4G6D A;  2FML A;  4RB1 A;  4UUV A;  1J75 A;  2HKO A;  1K79 A;  2M8E A;  4ZZL A;  1UB9 A;  4I02 A;  3IKT A;  3RIR A;  4WWC A;  1YLF A;  1K78 B;  4JBA A;  3FMQ A;  2RDP A;  3GO5 A;  5LLQ A;  2YU3 A;  3NEU A;  1REP C;  4I09 A;  4M73 A;  2VC1 A;  3OV8 A;  4IVN A;  3GXO A;  2DQL A;  3RPU A;  2A68 F;  4PGG A;  2ISY A;  4KIB A;  2JRT A;  3GFI A;  3GF2 A;  2BBY A;  2DQR A;  4R1H A;  4PZJ A;  1SAX A;  5JHU A;  1UST A;  2OA4 A;  1OMI A;  2AXL A;  4EM0 B;  5ILS A;  3CUO A;  3QAH A;  2QBY A;  1J2X A;  2GWR A;  4G7Z F;  3F22 A;  2VE9 A;  3MCZ A;  3MZH A;  3GFL A;  5CLS A;  5D5X B;  2ZME A;  1KYW A;  1EH6 A;  1YW7 A;  1ZG3 A;  2K86 A;  1LDJ A;  1DPU A;  4EM1 A;  1WSU A;  2ZNY A;  1T98 A;  1QZZ A;  2G7U A;  1OYY A;  1TQM A;  3E6B A;  1H9T A;  1ZLK A;  2L3D A;  2BEO A;  3WTX C;  2HEO A;  1G3Y A;  3JSO A;  3LA7 A;  2PMH A;  4ESB A;  2YSR A;  5TRD A;  2MBF A;  3ECO A;  2C6Y A;  2HQR A;  3VEP A;  1KYZ A;  2XAH A;  1YO5 C;  3JW4 A;  1FYM A;  4HOB A;  2QQB A;  5HLH A;  1STZ A;  1I6X A;  4XLN F;  2A07 F;  3VFZ A;  1AWC A;  2NNY A;  2A6E F;  3W6J B;  2EV5 A;  3T0Y A;  1YTY A;  3QU6 A;  2FEZ A;  2QEN A;  2Y0M A;  2XVC A;  1Z05 A;  3E5X A;  3DXJ F;  3KZY A;  3T8R A;  1DP7 P;  3V8J A;  1MD0 A;  2XKO A;  5KVR A;  3Q9V A;  1G3S A;  5ILU A;  4HLX A;  2DPD A;  2VT2 A;  4KYW A;  2OU2 A;  1SFE A;  1SD7 A;  5FO5 A;  2W57 A;  1ZHF A;  2KIU A;  5J8F A;  2QVO A;  1ONV A;  3J80 Z;  4YFN F;  3F8F A;  3ECH A;  4UVB A;  2HWV A;  5E8I A;  5LEK A;  4FX4 A;  5DDG A;  3U1D A;  3F8N A;  4YII A;  4MTD A;  3SQN A;  2HS5 A;  2EFN A;  4HLY A;  3KP5 A;  3L7W A;  4ETS A;  1MJB A;  4HW0 A;  1W5S A;  2J5O A;  3E5Q A;  2Z99 A;  4P9F A;  5A2Q K;  5BOX A;  4NB5 A;  3HHH A;  5L3G A;  3I59 B;  2XKP A;  4HV5 A;  1G6N A;  1SD5 A;  3GYH X;  1D8J A;  1YQA A;  2NRA C;  1S6L A;  4XRF A;  1IUY A;  4D0P A;  1W5T A;  4KMF A;  2A69 F;  1WQ2 A;  4R8H A;  2ZME B;  1NHA A;  3ZMV A;  4EMS A;  4OIR F;  2YX7 A;  4KFC A;  4NQW A;  2CGP A;  3TOB A;  1KQ9 A;  4G9Y A;  3E6M A;  4M9X A;  1MKM A;  4N9I A;  2PEX A;  1XD7 A;  4GO1 A;  4A0Y A;  2TDX A;  3O3K A;  1T39 A;  4UVA A;  5FD5 A;  3R0J A;  2XAS A;  2YPR A;  3ZP5 A;  1L3L A;  3MWM A;  3KP7 A;  2MLG A;  2XGX A;  3D5L A;  4BYY A;  2QM3 A;  4IHS A;  5DCF A;  4WXH A;  5D4R A;  2ZCW A;  3U9G A;  5IT3 A;  1SFU A;  3ABT A;  3LWF A;  3MAJ A;  1BC7 C;  3RDI A;  2VBZ A;  3FX3 A;  1ZGA A;  2IRF G;  2QQA A;  2QQ9 A;  2VOO A;  1XGN A;  3WU0 A;  3GFM A;  3CO7 C;  1T38 A;  2JT1 A;  4MQV A;  4L5I A;  3K69 A;  1HW5 A;  3V7R A;  1KU7 A;  3DQV C;  4KMU X;  3FZV A;  3J81 Z;  4ESF A;  5LBQ A;  5D5V B;  1RUN A;  1YG2 A;  2OD5 A;  2Z9O A;  2UXN A;  2LKP A;  5CVI A;  5LEJ A;  1L0O C;  3TO9 A;  1U78 A;  1K7A A;  4EJT A;  5K5Q A;  4WXC A;  2DBB A;  3VOE A;  3QPT A;  1F4K A;  4EVI A;  3R0A A;  5D5U B;  1O3R A;  2BE5 F;  2DI3 A;  2NYX A;  1B6A A;  1BJA A;  5HOO A;  1BIB A;  4DQ2 A;  1KA8 A;  2FBK A;  3K1N A;  1FY7 A;  3EDP A;  2Z33 A;  1QBJ A;  2PN6 A;  2OZ6 A;  4WK8 F;  2CQK A;  3LAJ A;  3E5U A;  2XV4 S;  2O03 A;  3L9F A;  3KET A;  3Q5F A;  3D0S A;  4JK1 X;  3ML6 A;  1BN5 A;  4BHB A;  1K78 A;  4I0A A;  1FOK A;  4ZYG A;  3JTH A;  1GXP A;  2P6S A;  3HRM A;  4BH9 A;  4HX8 A;  2EWN A;  1XGM A;  1VTN C;  5D6F A;  1BI2 A;  1RZ4 A;  4ZYE A;  3BJA A;  3IWZ A;  3K0L A;  3M8F A;  4KIG A;  1FSH A;  2VBX A;  3ZMD A;  1H0M A;  4K2E A;  4EJV A;  2FOK A;  4A0X A;  2D1V A;  3G73 A;  3H3U A;  3JSP A;  2VN2 A;  2FF4 A;  1ZGJ A;  3HSE A;  5J8C A;  3ZN0 A;  2X0L A;  1MDM B;  1B1B A;  3ZMS A;  2NS0 A;  1A04 A;  3WTY C;  3WTV C;  3QPH A;  4BNC A;  4LLG F;  3P9C A;  1DDN A;  2RVC A;  4LK1 F;  4CDG A;  2H6B A;  4HDU A;  1Q1H A;  1YW8 A;  4I01 A;  1ZN2 A;  3GZ5 A;  5CVJ A;  3JAM K;  3WTT C;  2QUF A;  5F1R A;  3DFG A;  3R61 A;  2PLY A;  1IXR C;  4M72 A;  4L0Y B;  2R7F A;  1IN4 A;  1BI1 A;  4IRG A;  5DD8 A;  2G7H A;  4G8X A;  3LA3 A;  3M8E A;  1EH8 A;  3CLO A;  2F5C A;  3HOT A;  3I5U A;  2A5Y B;  2GA2 A;  1W7P A;  2ISZ A;  4HAM A;  2V79 A;  3KP2 A;  5HS7 A;  4QLC U;  2KJB A;  1JHF A;  4IRI A;  2VOP A;  2O3F A;  2BYV E;  4LJZ F;  1O7F A;  3ZMU A;  1K6O A;  3FXU A;  3J7A O;  3DF8 A;  5E1X A;  3BPX A;  3MQ0 A;  1U5T C;  3TDZ C;  1LVA A;  4GYI A;  2ZJ2 A;  2VON A;  4CYD A;  3I71 A;  3HTU A;  4N0B A;  3RKW A;  4Y15 A;  4G6Q A;  2KJC A;  1YIO A;  3GUD A;  2DAO A;  1ZLJ A;  1B59 A;  5ICC A;  2FNP A;  3IWF A;  4I0B A;  3T5X A;  3WTU C;  4XSZ F;  1J0R A;  2WTE A;  4P9U A;  3E6C C;  1DPR A;  2RC4 A;  3GEZ A;  2JZY A;  1XSX A;  6PAX A;  2HYF A;  2MA3 A;  2GZW A;  1U6G A;  3ABU A;  1FSE A;  2IJL A;  4G7O F;  1FP1 D;  5H20 A;  1FT9 A;  2K27 A;  2O0Y A;  3RI4 A;  4MQ9 F;  1Z7U A;  3HOS A;  3K2Z A;  5CYV A;  4Y17 A;  3BRO A;  5ICE A;  4U7B A;  1XGO A;  2VBW A;  1T2K A;  3M1E A;  2XAJ A;  3BJO A;  5CVU A;  3I59 A;  4AIH A;  1TTY A;  2GA1 A;  2V6C A;  2H09 A;  2K4J A;  4L9T A;  4P55 A;  3R6S A;  1IZ1 A;  1KQ8 A;  4M9Z A;  2A6H F;  4KN7 X;  4QWQ A;  2JTV A;  4RGR A;  1P2F A;  2ACJ A;  2Q8K A;  1MZB A;  1RIO H;  3BWG A;  4Q48 A;  5FFZ A;  3FWE A;  5IT9 K;  5E8G A;  3KZZ A;  1U8R A;  1T6S A;  5K1Y A;  4FHT A;  1R23 A;  3H92 A;  1PDN C;  3E97 A;  3IRR A;  3MEX A;  5D8L B;  3T8T A;  2FXA A;  3SXY A;  1XMA A;  4L9V A;  2ZBK A;  4CIC A;  5FFX A;  5DD4 A;  3WTS C;  1JGS A;  5D6E A;  3EYI A;  1LDD A;  4XSX F;  3Q9S A;  1MGT A;  3B73 A;  4P96 A;  5DV5 A;  3P9K A;  1LJ9 A;  3HRT A;  1W7P B;  5LHH A;  4GCV A;  3GWZ A;  4MTE A;  4HA8 A;  3DP7 A;  2STT A;  4B8X A;  1YS6 A;  4YG2 F;  1HKT A;  3DPL C;  3RPQ A;  4Q4Z F;  4A2U A;  5FGM A;  3WTZ A;  3LQR A;  1UCR A;  1KU3 A;  3V8K A;  4UV8 A;  1Z91 A;  3M9A A;  4FX0 A;  1TNT A;  3EQL F;  5DEQ A;  4AWX B;  3IC7 A;  2E7X A;  1O57 A;  2M5W A;  1LQ1 A;  3K9T A;  1ZRF A;  5HS9 A;  1ZAO A;  1O3T A;  5JFR A;  1R58 A;  1PP8 F;  2V9V A;  1IF1 A;  3QOP A;  3TKY A;  1XB4 A;  4HF0 A;  2XHK A;  1R7J A;  2PMU A;  2A3S A;  4RGS A;  2BGC A;  2P5K A;  2M30 A;  3E3V A;  1S7A A;  3WE3 A;  5EEG A;  2ELH A;  1R5H A;  3HUG A;  4L9J A;  4GGG A;  2UZK A;  2P7C B;  3KEO A;  1BOA A;  4G7H F;  1WWX A;  1XSD A;  2E7W A;  1FX7 A;  3MZY A;  2IVM A;  2IA0 A;  4RS8 A;  3LFK A;  4LB5 A;  4GXO A;  5E1W A;  1FBU A;  2F2E A;  3F72 A;  1R1T A;  1TBX A;  4MHG A;  2FRH A;  2W84 A;  1ZAR A;  1KU9 A;  3QRF F;  4RAZ A;  2RV8 A;  3COA C;  2VBY A;  3EET A;  3I0T A;  1FZP B;  1FBQ A;  2R7D A;  5FLX K;  2J5P A;  4KIC A;  4IRH A;  1SFX A;  2DPU A;  3LST A;  3V8L A;  4LG0 A;  4YFX F;  3BDD A;  3ERE D;  2GIV A;  2CSO A;  1Z6T A;  2IA2 A;  3GX4 X;  1WKM A;  3RYR A;  1MDM A;  2H27 A;  4OIP F;  3ZN1 A;  1I1G A;  3TO7 A;  5FD6 A;  2HGC A;  3IHU A;  3FHZ A;  1P4W A;  1O7L A;  2FA5 A;  3CUQ B;  4HZF A;  1J5Y A;  5D5W B;  1S7O A;  1YS7 A;  1U5T A;  3KP6 A;  1SMT A;  5A2Q Z;  1H9G A;  1KU2 A;  2DW4 A;  4N9H A;  3ZMT A;  1F1Z A;  3O6B B;  3F6O A;  1XMK A;  5DCM B;  2VT3 A;  3V7S A;  2HQN A;  4RGU A;  3FM5 A;  2ESN A;  1CF7 B;  4RB3 C;  4YIF A;  3P9I A;  3FXR A;  4OIN F;  2AS5 F;  5J6X A;  4CHU A;  5E1Z B;  2KRF A;  4CO8 A;  3CUQ C;  3SZT A;  4HX7 A;  2FNA A;  5CVR A;  1ON2 A;  3C18 A;  3WTW C;  2B0L A;  2LDU A;  4EJO A;  1IXC A;  1IAW A;  5LGU A;  3KLN A;  4CGZ A;  4L18 B;  2STW A;  1IN8 A;  4ZYD A;  1QGP A;  4M9S A;  2HZT A;  1TQI A;  2UWM A;  4P5O A;  2Y75 A;  1SD4 A;  3VOD A;  1XCB A;  4DNC A;  4M74 A;  2PG4 A;  2H6C A;  4ZZD A;  2Q2E A;  2E1N A;  1TW3 A;  4M6Y A;  2D1H A;  1R22 A;  1OYI A;  1TLH B;  4U88 A;  4A12 A;  2MC3 A;  1P4X A;  2MH9 A;  2PQ8 A;  4M6X A;  2LF8 A;  3B02 A;  4AIK A;  3QP5 A;  4WXD A;  1O3Q A;  2NAZ A;  3F8M A;  3RKY A;  3ULQ B;  4HF1 A;  1YFH A;  5ED4 A;  3P7N A;  4LG0 B;  4OMZ A;  3RJP A;  5LHG A;  5BPI A;  3L09 A;  4A0Z A;  2PFB A;  1XN7 A;  3DKW A;  2L4A A;  4WF2 A;  1B9N A;  1OKR A;  3JTG A;  3ISP A;  2K02 A;  3V4G A;  1HW2 A;  3C3W A;  3NQO A;  4A5N A;  2V1U A;  4WX9 A;  4EQQ A;  2ZXJ A;  1FPQ A;  4F7Z A;  5F6F A;  3FMR A;  2ZFW A;  3ELK A;  5JVT A;  4CZZ A;  5LGT A;  1FWZ A;  2ADU A;  4RB0 A;  2X4H A;  3RKX A;  2F5E A;  1FP2 A;  3LQQ A;  1P4A A;  1U5T B;  2L54 A;  1Y0U A;  2EB7 A;  4OIQ F;  2XRN A;  2OAZ A;  3BJ6 A;  2ZKZ A;  1UFM A;  3E6D A;  4ENN A;  4XLP F;  4S05 A;  3TDU C;  4Y13 A;  2CG4 A;  3WU1 B;  2L02 A;  2DT5 A;  4KT5 C;  4HF2 A;  3HRS A;  4G94 A;  2Y48 A;  1P6R A;  2IT0 A;  3I58 A;  4NHJ A;  2FMY A;  1ZG1 A;  3WGG A;  2UXX A; 
#chains in the Genus database with same CATH topology
 1MH4 A;  3PFI A;  3HM5 A;  1YJ9 I;  1MBG A;  1QZY A;  4BHC A;  5CVV A;  1UG0 A;  2GOX B;  5DUK A;  1LEA A;  1XSV A;  2KIM A;  4LGW A;  3R60 A;  5J3L A;  1W0T A;  4BXU A;  1P92 A;  3A0H C;  2EZK A;  3SDB A;  3HL2 A;  4RGX A;  4IHY A;  2DJN A;  3HOX J;  2WAQ N;  4EJW A;  3RPU D;  4A3D J;  5HS8 A;  3K70 D;  1HKQ A;  3FBI B;  4A6D A;  2LFB A;  2WC2 A;  1SVO A;  3IP4 B;  1GDT A;  2RKH A;  5LGN A;  3BTJ A;  1PUF A;  1O3S A;  2O5R A;  4XID A;  3CTA A;  2MD5 A;  2QEX I;  2PJR A;  2G9W A;  3HIF A;  1A5J A;  1OR7 C;  1P7I A;  4CXF A;  2VOD A;  3JAM Z;  2OTJ I;  2XB5 A;  1Z1D A;  3BLY A;  3TL4 X;  1BIA A;  4E7S A;  1DUX C;  3S1M J;  1SEU A;  3VSK A;  5E3M A;  2R7V A;  3M7G A;  4RB2 C;  2Q0O A;  3N4M A;  2LMD A;  5JR3 A;  3EUH C;  3BZK A;  1FNN A;  3BQY A;  4UXN A;  1HF0 A;  1Z6R A;  4LFU A;  2YU9 J;  3GZ6 A;  4LB6 B;  4HBL A;  1PUE E;  5AIQ A;  4Z2Y A;  1EA3 A;  2PX9 A;  2R7R A;  2CUJ A;  2ESH A;  3S3N A;  2ETH A;  4M3D A;  1U2W A;  1JHH A;  3NWT A;  4LMY A;  4U87 A;  4OU0 A;  3GFJ A;  3L2C A;  2HOE A;  1Q1V A;  1MSE C;  2TCT A;  4RLF A;  4TV7 A;  1MMN A;  5LRR A;  1RNL A;  2Y0S A;  3WGI A;  3BCB A;  2XGC A;  4ZJZ A;  3CC7 I;  4ENJ A;  1FMW A;  3DEU A;  2R3S A;  5LFA A;  3F0C A;  4HQM A;  5IYB J;  3EPZ A;  5EJC A;  3CC2 I;  2R7X A;  1P9Q C;  1KZH A;  2MH2 A;  1BBY A;  1ACI A;  5EEH A;  1ODD A;  3IRQ A;  1BOB A;  1R4N B;  3C1D A;  1X4O A;  2IS4 A;  4PJM A;  4XOT A;  1R5I D;  5EZH A;  5ILV A;  2ZXI A;  2VJ4 A;  3OYL A;  1D5V A;  3SYT A;  3QQA A;  1MMG A;  3CDH A;  1F5T A;  4MFD A;  1MBE A;  3PUB A;  3G71 I;  4BQA A;  4BHP A;  3LSH A;  2NNN A;  4O5V A;  2DTR A;  5IOZ A;  3ZQL A;  2X6W A;  4PCQ A;  1BR4 A;  3WG9 A;  4P1W A;  3PSF A;  3TO6 A;  3PIP F;  3PQK A;  4EM2 A;  5BMZ A;  2ZNZ A;  1QNT A;  3QU3 A;  3ROU A;  1HQC A;  4BE0 A;  1IN6 A;  1PYV A;  4B09 A;  2DMP A;  2XF7 A;  3OYK A;  1ZQ3 P;  2EV0 A;  4Q47 A;  1S7E A;  4I7H A;  5F08 A;  3V7C A;  4HDV A;  3CME I;  1OIS A;  1IRF A;  1NG7 A;  2CO5 A;  3KFW X;  2V6E A;  2Z5U A;  5EGO A;  3M3Y J;  3FXQ A;  4RMN A;  3KEQ A;  2ME0 A;  5BQT A;  1ZG5 A;  4E7H A;  2RNG A;  4XRS G;  3ZQQ A;  2JA5 J;  2YUS A;  2YR2 A;  1BC8 C;  3KZI C;  4W97 A;  2VL8 A;  3LA2 A;  3QOE A;  1I27 A;  2QKM B;  1ZYR F;  2IA1 A;  4PFO A;  1S72 I;  5FRN A;  3FK6 A;  1LE8 B;  2JMW A;  3N05 A;  3OOU A;  2QLZ A;  4PFP A;  4XBF A;  1S29 A;  1F9N A;  2LKS A;  1W1W E;  2M87 A;  3KP3 A;  3KLO A;  2FBI A;  4BQO A;  2XB0 X;  1YRN B;  2BY2 A;  4G6T B;  2BW3 B;  1GHC A;  1R1U A;  1A36 A;  2LSO A;  2K9N A;  2EFW A;  3CUQ A;  2CQ7 A;  3ZQG A;  4O6J A;  2E35 A;  1LB2 A;  3OYE A;  1XG1 A;  5IP6 A;  3F23 A;  2WB1 A;  3SHF A;  1G3T A;  3W6K B;  5KK1 A;  1SD6 A;  1Z9C A;  5K7H A;  2GXB A;  5CJ9 A;  2W48 A;  1B72 B;  1W5C C;  3J80 K;  4JQF A;  4Q5S F;  2M45 A;  4XLH A;  4BGD A;  5L3E A;  2GIZ A;  5C4X J;  3OR2 C;  3FM3 A;  1IRG A;  1WJF A;  2PJP A;  1QPM A;  3TQN A;  1HST A;  2KLO A;  3RKQ A;  5H6R A;  2KHM A;  3BZ6 A;  4BJ6 C;  2DA2 A;  4IJA A;  2VQH A;  2LLK A;  1B4A A;  2XAQ A;  4GRI A;  1TNS A;  1UEL B;  2CUF A;  3Q3S A;  1IRX A;  1ETV A;  5DCM A;  4GDF A;  5EYR A;  2W82 A;  2KRC A;  3I3L A;  4FT8 A;  3KP4 A;  4V2F A;  4A5M A;  3QWL A;  2BV6 A;  4JP0 A;  1W4M A;  1FYK A;  1IN5 A;  5GAH J;  1JXS A;  1CF7 A;  4QIW N;  3HHG A;  3MKW B;  3T1B A;  5HDK A;  2R7Z J;  4QPQ A;  5IT9 Z;  1T0F C;  3OYM A;  2CV2 A;  1E2X A;  1I1S A;  2V26 A;  2KDO A;  5JHF A;  2B63 J;  2COM A;  4XLF A;  3RCO A;  3DTE A;  1T33 A;  4YFK F;  2R7O A;  2Y9Z A;  3CP8 A;  3O2P E;  4DGW B;  1V4R A;  2BXZ A;  3HSF A;  1FC3 A;  2QYO A;  2WA0 A;  3CJT B;  4Y3O A;  2RQP A;  2GQQ A;  3CDI A;  3WU2 C;  2O7O A;  1FOY A;  3EYY A;  4FQG A;  4BBS J;  1IV6 A;  2ZJR F;  1S8N A;  1BI0 A;  3ZGK A;  2R7S A;  1ETK A;  2KDZ A;  1ZRD A;  1X1A A;  4M3E A;  2XSD C;  1LFU P;  4ZH4 F;  4F91 B;  4OMY A;  3AG2 H;  1U9O A;  1WRJ A;  1E17 A;  2KIF A;  3CLQ A;  5E20 A;  4A3L J;  5F64 A;  2OZU A;  2F5F A;  2E36 A;  3MFK A;  3CCQ I;  3S1Q J;  4A6E A;  1D8K A;  2JVG A;  4YEJ A;  3DBL B;  1IW7 F;  2DMU A;  3E1S A;  2NVQ J;  2KRH A;  2HTJ A;  4CZC A;  4B3A A;  1UHM A;  4R79 A;  3SZP A;  3LSK A;  2O8X A;  2CFO A;  5DYM A;  1R5G A;  3RYP A;  3FKJ A;  2KKO A;  4B1R A;  3OIQ A;  5GPC A;  2QKL B;  3DTI A;  1LNW A;  3AFH A;  4MEY F;  3VB2 A;  5CQE A;  1BW5 A;  3AG4 H;  3E7L A;  4RBO A;  3PM1 A;  2Y9Y A;  4HYE A;  5JI6 A;  4C2T A;  4OWR B;  4GYG A;  2E71 A;  1MJ9 A;  3IAS 2;  4EJU A;  4KIF A;  4E70 A;  2DYR H;  1X2N A;  2N8G A;  3K4N A;  5HNF A;  3HRU A;  1OPC A;  2EH3 A;  1LEB A;  3BR3 A;  3CCJ I;  1WH5 A;  2JPC A;  2XRO A;  4ESJ A;  3G3Z A;  1MJA A;  4QSH A;  2OQG A;  1HXD A;  1USS A;  2W24 A;  2QQ8 A;  3K1M A;  5K5R A;  4CYC B;  4RM2 A;  2K4B A;  3C7J A;  2EJR A;  2OF7 A;  4L0Z B;  2QA4 I;  2EPF A;  2H94 A;  4H0E A;  2VUM J;  1XCV A;  2QZ8 A;  4LLN A;  2A61 A;  5CKT A;  2ECC A;  3J7Y J;  1U3E M;  4U0Y A;  5J4Y A;  4AD9 A;  2JQ7 A;  2Y30 A;  1JT6 A;  4NC7 A;  1UHW A;  2DLL A;  2OV7 A;  2R5Y B;  1IN7 A;  2H8W A;  2OCE A;  3F6V A;  2QBY B;  1DU6 A;  2BY1 A;  2XGE A;  2EA4 A;  2EFQ A;  2P7V B;  2JA6 J;  4LOC A;  3QPL A;  2MLK A;  4HQE A;  3TED A;  5HNH A;  4I2O A;  5K5O A;  2EV6 A;  3TOA A;  2L01 A;  1R00 A;  3H3Z A;  1G4D A;  4UV9 A;  3S2D J;  4DZJ A;  4OAZ A;  3SDG A;  3S2W A;  1FBS A;  1B9M A;  2DOE A;  4UVC A;  5HDG A;  4OOI A;  3NRV A;  3J81 K;  2EK5 A;  1MND A;  1VQ4 I;  2MYS A;  3ESW B;  5J1Y A;  2AQE A;  3EUA A;  4YIR X;  2JPB A;  1CGP A;  3S15 J;  3SFI A;  3WG7 H;  3ZOB A;  3K70 C;  1D3Y A;  1RUO A;  4A69 C;  2CQQ A;  3GW2 A;  4MEX F;  2EZI A;  2OPT A;  4A93 J;  2A6T A;  3BOQ A;  4EV0 A;  1TW2 A;  5J1R A;  2CW0 F;  4E6K G;  3HKZ A;  2LNB A;  1FJL A;  1V5E A;  4ZYH A;  1IG7 A;  1KQ0 A;  2QSF X;  5E18 F;  4L9N A;  2Z3Y A;  1C0W A;  3HOY J;  2L4M A;  2RN7 A;  5L3D A;  3I54 A;  4HEA 2;  2X48 A;  4EGZ A;  1N78 A;  2LF7 A;  4UNO A;  5HLG A;  1EV7 A;  2K7L A;  1G3W A;  4EEF G;  1G2H A;  2HXI A;  1NH3 A;  1TWC J;  3ZPL A;  2WV0 A;  2Y0S N;  4DJA A;  1MMD A;  3KYC B;  1OR7 A;  1FLI A;  1EH7 A;  2EIM H;  1LPQ A;  1LFP A;  1X19 A;  2ZME C;  5GP9 A;  2JSP A;  5FLX Z;  5GTI C;  2ZJQ F;  5JVG F;  3GME A;  2HTS A;  2CYY A;  4E7J A;  3G6E I;  1YW9 A;  3IKV A;  2VQG A;  1GXQ A;  3EUH A;  1HBX G;  2O8K A;  1QQI A;  3DEW A;  3GTK J;  1WJE A;  2HR3 A;  3RZO J;  2DFI A;  3NWS A;  1YOV B;  2K9S A;  1AKH A;  5BPD A;  1X3U A;  2JRM A;  2EFO A;  5AIP A;  3ZMZ A;  1IO2 A;  3CF2 A;  2CUZ A;  4BE2 A;  5KNL A;  2O61 A;  1GVJ A;  1AOY A;  4HX4 A;  3FIW A;  3B6C A;  2DMQ A;  4PDK A;  1YIJ I;  3VYT B;  3CJN A;  3DU5 A;  1N25 A;  2V7F A;  2DXI A;  3LAP A;  4BKX A;  1W36 D;  3KCC A;  5BS6 A;  2CWE A;  5ICF A;  4N4O B;  1DGW Y;  1XDU A;  3GCM A;  2YX4 A;  4LD5 A;  2IGN A;  3BP8 A;  3DBR B;  3SFZ A;  2E60 A;  2MC4 A;  2EA2 A;  2L9V A;  1H88 C;  1TQP A;  2JUG A;  3HYI A;  3DPT A;  1LDK B;  2V1D A;  3KEY A;  4YRV A;  4U0W A;  4KDP A;  5FRM A;  2WY7 Q;  3TW7 A;  1X1C A;  2RNJ A;  2HDC A;  4AIJ A;  4S0H B;  4KN4 X;  4ITV A;  1GT0 C;  5TIS C;  3F8C A;  3WGH A;  2VC0 A;  4KA4 A;  1X58 A;  4AVP A;  1BM9 A;  2DK5 A;  2GM4 A;  2WV1 A;  1X1D A;  2KT0 A;  3PSI A;  3ZQ7 A;  1MBF A;  2WWY A;  4XIC A;  1D5Y A;  4PJ0 C;  1YHQ I;  1XGS A;  1HW1 A;  2M3A A;  1ETX A;  5AON A;  3M1C A;  3LNQ A;  2GXG A;  1A31 A;  4ZDP A;  2COB A;  3OYC A;  1Z3X A;  2EZL A;  2WB1 N;  1TC3 C;  2P81 A;  1YX3 A;  3HTS B;  3HPH A;  1IXS B;  2F5D A;  4AYB A;  5E17 F;  1BI3 A;  1J59 A;  2P6T A;  1HKS A;  4OIO F;  3U2R A;  2DDB A;  3GTG J;  4ZDO A;  4B3X A;  3ONQ A;  2GAU A;  4RAY A;  1V3F A;  3OOP A;  5ERI A;  1XTA A;  1YJW I;  3RTR A;  3BC8 A;  3KE2 A;  1MIJ A;  1QO0 D;  2XAG A;  4BAY A;  5E3N A;  4MNU A;  5D4S A;  3BPV A;  2CV1 A;  2HFH A;  4NC6 A;  3K4L A;  1ON1 A;  5FB2 A;  4UHT A;  2CS3 A;  2F48 A;  4KIT B;  1HSJ A;  2MGQ A;  3TMO A;  5IY5 H;  2JWT A;  2JSC A;  1QRY A;  2DN0 A;  3F8B A;  4E7K A;  3F21 A;  5DTD A;  4C2U A;  2IP2 A;  5L3C A;  3WE2 A;  1R36 A;  4ENM A;  4AVZ A;  4KUM A;  3KIO A;  4BXF A;  1ZRE A;  4XLE A;  5LHI A;  4L5J A;  2M1B A;  2O6G E;  3VSL A;  2DU9 A;  4JX5 A;  1HOM A;  2QWW A;  2HVQ A;  2IW5 A;  5DUI A;  2FSW A;  3REO A;  1R1V A;  4U0V A;  3HZJ A;  5ICG A;  2NVU B;  2EBI A;  5L3F A;  3FDY A;  3DU6 A;  5FKO A;  3OYG A;  2VAS A;  3TGN A;  3FF5 A;  2VE8 A;  4ENK A;  3VYS B;  1SAU A;  3OYJ A;  4RM3 A;  2HPM A;  1W7P D;  2EFP A;  1S3J A;  5J4V A;  1AA7 A;  2XIG A;  4MGR A;  1PP7 U;  1TWF J;  2DK8 A;  3I4P A;  1U0J A;  2R5Z B;  2KZV A;  4LLL A;  4ZDL A;  4F52 A;  1Y1W J;  1ETO A;  1WI9 A;  5EF6 A;  2MAB A;  3FMS A;  4M71 A;  1ENH A;  2E1M B;  4EGY A;  3I64 A;  4HSR A;  3H9J A;  1R6R A;  1RKT A;  5D8K B;  1T0F A;  2W85 A;  2BW3 A;  2P0W A;  5H6Q A;  1X1B A;  2LC2 A;  4DYQ A;  5HVQ C;  1ULY A;  4PJJ A;  2BXY A;  2D45 A;  1SVM A;  2F4I A;  2VKV A;  5LRS A;  3BY6 A;  3K1P A;  2HOS A;  3S14 J;  3PO2 J;  2VLA A;  4IXA A;  2P5L C;  3OR1 C;  1ZKG A;  3CD6 I;  1YYV A;  4X0G A;  4S04 A;  3QYE A;  2LY9 A;  3D5R C;  5TJJ A;  4HV6 A;  3UR3 C;  1QU3 A;  1B72 A;  1KGS A;  5C3E J;  5K7F A;  4LK0 F;  5IP7 J;  2L9N A;  3L00 A;  4ASN A;  4D7N A;  2ID6 A;  3I9V 2;  2FE3 A;  2W25 A;  3JRE A;  1FYL A;  3OS2 A;  3CO6 C;  1XDS A;  2DA1 A;  4I98 B;  4IF4 A;  1OYW A;  2D2W A;  2VXZ A;  1ZRC A;  1ITY A;  2HKX A;  1JUP A;  2HYG D;  3R4K A;  5F04 A;  5HLI A;  2PBI A;  2ZO4 A;  2E2I J;  3I53 A;  3GVA A;  2XUB A;  1Y1V J;  3N97 A;  2RAE A;  4KNY A;  1ZH5 A;  3BR0 A;  3V42 A;  5M3F J;  3GLX A;  1PJR A;  4O3M A;  2FQ3 A;  2P4W A;  4CH7 A;  5B66 C;  2P8T A;  4M3G A;  1JE8 A;  4KT6 A;  1JKR C;  2E1M C;  1BL0 A;  2XAF A;  1I5Z A;  2OBP A;  3H36 A;  1J7K A;  4IX7 A;  2FBH A;  1RI7 A;  3H5R A;  3MMY B;  1WHU A;  4NUB A;  2E1C A;  1R9T J;  2DA5 A;  4PGH A;  1VQN I;  2DO7 A;  3QP6 A;  4Y7N J;  1FTT A;  1Z67 A;  3DV8 A;  1SMY F;  2DYS H;  5HDN A;  2H8R A;  2FU4 A;  1ERD A;  3F3X A;  2IPQ X;  4NNJ A;  1E3O C;  3WOD F;  4IHT A;  3HSR A;  3PQJ A;  4IPA A;  2CFX A;  5L3B A;  1J9I A;  4JOM A;  4B44 A;  3AAF A;  2OQR A;  2P5V A;  4U7D A;  2R0Q C;  2PI0 A;  4WCG A;  2CV0 A;  2V4J C;  1ZTR A;  2RGV A;  1YI2 I;  9ANT A;  2XGD A;  4ON0 A;  3IL2 A;  4IEJ A;  5KHD A;  2V1X A;  4G6D A;  2FML A;  3BG5 A;  3ZCO A;  4RB1 A;  4UUV A;  2ZC2 A;  3KX2 A;  2HPI A;  1J75 A;  3RQ4 A;  2HKO A;  2HZD A;  1K79 A;  2M8E A;  3K2A A;  1ZR2 A;  4BU2 A;  4UB8 C;  4ZZL A;  1UB9 A;  2VKD A;  2I10 A;  4I02 A;  3IKT A;  3HOZ J;  4L5E A;  1WCM J;  3RIR A;  4WWC A;  4M3B A;  2W4S A;  3H5N A;  1YLF A;  1K61 A;  1K78 B;  4XKV A;  4JBA A;  2HOT A;  3FMQ A;  2RDP A;  3GO5 A;  5LLQ A;  2CW7 A;  2YU3 A;  3NEU A;  2R4G A;  4DIQ A;  1LVK A;  1HC8 A;  1REP C;  3ZQF A;  4I09 A;  4M73 A;  3S16 J;  2VC1 A;  3JRH A;  3OV8 A;  4IVN A;  5EG0 B;  3GXO A;  4PSW A;  2DQL A;  1OFC X;  3K10 A;  2EIJ H;  3RPU A;  1FIP A;  2E1O A;  2BVM A;  1JI8 A;  3OS1 A;  3DPU A;  5BNG A;  2A68 F;  4PGG A;  2ISY A;  5CQG A;  4KIB A;  2M7B A;  1UAA A;  2JRT A;  1ETW A;  3GFI A;  3GF2 A;  2BBY A;  2DQR A;  4R1H A;  2LP0 A;  4CYC A;  4BEH B;  4PZJ A;  4J19 A;  2E2H J;  4XKB A;  3SZG A;  2KFD A;  1SAX A;  3GLL A;  1X3Z B;  1UST A;  2OA4 A;  1OMI A;  5JHU A;  2XPU A;  2AXL A;  1YJN I;  2WBM A;  4EM0 B;  5ILS A;  3CUO A;  3QAH A;  2R5Y A;  2QBY A;  2F5V A;  1UZC A;  1J2X A;  1PVE A;  1XS9 A;  2GWR A;  2CMP A;  4NDL A;  4G7Z F;  4GFB A;  3TP3 A;  3F22 A;  2VE9 A;  3MCZ A;  4FET A;  5FKM A;  5EDN A;  4LIT A;  3GFL A;  5CLS A;  5D5X B;  4DW6 A;  3CCU I;  3CF5 F;  1JTY A;  3G4S I;  2ZME A;  1KYW A;  2HOA A;  1W36 C;  1EH6 A;  1YW7 A;  1ZG3 A;  2Y2Z A;  4E7L A;  2G0E A;  2KP6 A;  4ZTF A;  2K86 A;  3CMA I;  1LDJ A;  4XOR A;  1MNE A;  5GAD J;  1K4T A;  2Z1D A;  1DPU A;  4EM1 A;  2VPR A;  2L9S A;  4FE7 A;  3JRD A;  1WSU A;  2LOO A;  2ZNY A;  1T98 A;  1QZZ A;  2G7U A;  1V55 H;  1OYY A;  1VFC A;  1TQM A;  2AO9 A;  3E6B A;  3HGY A;  1H9T A;  4AU7 A;  1DU0 A;  2NS8 A;  4QPO A;  1ZLK A;  2L3D A;  2BEO A;  3WTX C;  3FXJ A;  2HEO A;  1G3Y A;  3JSO A;  3BTL A;  3DBH B;  4F92 B;  3LA7 A;  2PMH A;  2M4K A;  1NK3 P;  4ESB A;  2YSR A;  5TRD A;  2MBF A;  1RKW A;  3ECO A;  2C6Y A;  2HQR A;  4AYB N;  4C9Y A;  1BW6 A;  2DDA A;  3VEP A;  3PNY A;  3MD2 A;  3A02 A;  1LFB A;  3F9K A;  2JJ7 A;  1KYZ A;  2XAH A;  1YO5 C;  2GLO A;  2M0M A;  3JW4 A;  4A3M J;  1FYM A;  1QVT A;  1RPW A;  1RC9 A;  2QQB A;  4HOB A;  5HLH A;  4ZYA A;  1MW7 A;  3MVP A;  2W1O A;  1STZ A;  1I6X A;  4FE4 A;  4XLN F;  2A07 F;  3GTO J;  4Z6Y A;  4CA0 A;  2AXT C;  3VFZ A;  1AWC A;  3KPH A;  5J47 A;  2NNY A;  3OSF A;  1VZ0 A;  2A6E F;  3ABL H;  3W6J B;  2VJ5 A;  2EV5 A;  3ERM A;  5CPR B;  3T0Y A;  1XMX A;  4MIM A;  1YTY A;  4A3J J;  3QU6 A;  3B6A A;  2QEN A;  2FEZ A;  2LRD A;  1XX5 A;  3OIO A;  2DJI A;  1FOX A;  2Y0M A;  2LH9 A;  2XVC A;  3D1N I;  3SJM A;  4BY1 J;  2MD0 A;  1Z05 A;  3E5X A;  3U1K A;  5FJ8 J;  3DXJ F;  1ETQ A;  2VI6 A;  3KZY A;  3T8R A;  4BDZ A;  1DP7 P;  3BR6 A;  3V8J A;  3D5S C;  3RSN A;  1MD0 A;  1MMS A;  2XKO A;  4BY7 J;  5KVR A;  3Q9V A;  2HXO A;  4A3I J;  1G3S A;  5ILU A;  3HOU J;  3OYB A;  4HLX A;  1T08 B;  2DPD A;  2VT2 A;  1K83 J;  4KYW A;  2OU2 A;  3FBN B;  3VYR B;  1GUU A;  1SFE A;  2R93 J;  3HB9 A;  4JX4 A;  2XF6 A;  2D5V A;  1SD7 A;  5FO5 A;  3I4M J;  2W57 A;  1ZHF A;  2KIU A;  5J8F A;  1IRZ A;  2QVO A;  1ONV A;  2DTZ A;  2DOF A;  3J80 Z;  3J7Z I;  5F1J A;  4YFN F;  3F8F A;  3ECH A;  4UVB A;  2HWV A;  5E8I A;  5LEK A;  4FX4 A;  4D9J A;  2FX0 A;  3LSJ A;  3U1D A;  5DDG A;  3F8N A;  5B1B H;  2V1N A;  4YII A;  4MTD A;  3SQN A;  2HS5 A;  3HOV J;  2EFN A;  4HLY A;  2NVT J;  3KP5 A;  3L7W A;  4ETS A;  3H9Q A;  1MJB A;  1JUM A;  5FKL A;  3CCE I;  3PL8 A;  4HW0 A;  1W5S A;  2J5O A;  3E5Q A;  1JT0 A;  2Z99 A;  1VQL I;  4P9F A;  4EAT A;  5A2Q K;  3H0D A;  5BOX A;  2ZXW H;  4BL0 B;  4NB5 A;  2L0K A;  2UUZ A;  3HHH A;  1MH3 A;  3LMM A;  5L3G A;  3I59 B;  2XKP A;  4HV5 A;  1G6N A;  1SD5 A;  2ID3 A;  3GYH X;  1H89 C;  2EIN H;  1OCP A;  2BY0 A;  1D8J A;  1IUF A;  2NOG A;  1YQA A;  2NRA C;  3OMY A;  2DA4 A;  5KAI C;  1S6L A;  4A3K J;  4XRF A;  1IUY A;  4D0P A;  1MNM C;  1W5T A;  2X85 A;  3OL3 A;  3GTJ J;  2A69 F;  1K4S A;  4KMF A;  4AC0 A;  1WQ2 A;  2NOJ B;  3H9G A;  5IYD J;  2DMN A;  4R8H A;  1I3Q J;  1NHA A;  2ZME B;  3A4C A;  3ZMV A;  2ZSI B;  4EMS A;  2E19 A;  1Z77 A;  4OIR F;  2YX7 A;  1N75 A;  3LOC A;  4NQW A;  4KFC A;  5F27 A;  3OYF A;  1SFO J;  1B8I B;  2CGP A;  3CCM I;  3GTL J;  3TOB A;  1KQ9 A;  4G9Y A;  2W7N A;  4JX6 A;  2KMU A;  3E6M A;  4UB6 C;  3I56 I;  4M9X A;  5JLX A;  3ZQC A;  1MKM A;  4N9I A;  2PEX A;  2FUG 2;  1U9N A;  1V54 H;  1XD7 A;  2BVL A;  1VQP I;  2DFH A;  4GO1 A;  4NC8 A;  4A0Y A;  2TDX A;  1D1A A;  1VI0 A;  3CJQ B;  3O3K A;  2R5Z A;  1T39 A;  1VQM I;  2X51 A;  5EEA A;  1IC8 A;  4UVA A;  5FD5 A;  3R0J A;  2XAS A;  2YPR A;  3ZP5 A;  3PJR A;  3TW6 A;  3MWM A;  1L3L A;  2PMZ A;  3KP7 A;  1JGG A;  4XL9 A;  3BT9 A;  2MLG A;  2XGX A;  5K7Z A;  3D5L A;  2XPW A;  4BYY A;  2QM3 A;  3KYL A;  3PO3 J;  3DLA A;  4IHS A;  1QHH D;  1X4P A;  4Y4R A;  5DCF A;  4WXH A;  5D4R A;  1EF4 A;  1VQ5 I;  2ZCW A;  3U9G A;  5IT3 A;  1JJ8 C;  5M5Y J;  1SFU A;  3G1M A;  4D7M A;  3ABT A;  3H3V K;  3LWF A;  3MAJ A;  5F0F A;  3RDI A;  1BC7 C;  2VBZ A;  3FX3 A;  3S93 A;  1ZGA A;  3OWT A;  2IRF G;  2QQA A;  2ZFU A;  2QQ9 A;  2VOO A;  1LUJ B;  1XGN A;  3UNG C;  1WI3 A;  3S3O A;  3WU0 A;  3GFM A;  3CO7 C;  2EQR A;  1T38 A;  4IHV A;  2JK3 A;  2JT1 A;  2X6O A;  5GTH C;  3EUK L;  4IHX A;  4MQV A;  2QSH X;  4L5I A;  1TWA J;  3K69 A;  4B48 A;  1HW5 A;  3AG1 H;  3V7R A;  1KU7 A;  3DQV C;  4KMU X;  2AHQ A;  1OCR H;  3FZV A;  3C2G A;  3J81 Z;  4ESF A;  3K7A J;  5LBQ A;  5D5V B;  2X1D A;  1RUN A;  1YG2 A;  2OD5 A;  5H2F C;  3JRB A;  1VQ8 I;  2Z9O A;  5C44 J;  2UXN A;  2LKP A;  3W3C A;  5CVI A;  5LEJ A;  1L0O C;  4DYR A;  3MKL A;  3TO9 A;  5FRO A;  4FCY A;  2TRT A;  1OJL A;  3LFU A;  1I6H J;  1U78 A;  1K7A A;  3BQZ A;  1M1E B;  4EJT A;  5K5Q A;  2K9L A;  4WXC A;  4CCN A;  5HOD A;  2DBB A;  3K4B A;  3VOE A;  3QPT A;  1F4K A;  4EVI A;  4I6Z A;  2DOA A;  3O8G A;  3R0A A;  5D5U B;  1O3R A;  1A6I A;  3I4N J;  3HUG B;  3IH3 A;  2BE5 F;  2DI3 A;  2NYX A;  3K4J A;  1B6A A;  2K3F A;  1BJA A;  2DFF A;  5HOO A;  1BIB A;  4DQ2 A;  1KA8 A;  2FBK A;  3K1N A;  1Y0N A;  1FY7 A;  1D1B A;  2V9P A;  4E4H A;  3EDP A;  2Z33 A;  1QBJ A;  3S2H J;  2JA2 A;  2PN6 A;  2OZ6 A;  4RA2 A;  4WK8 F;  4B4C A;  2CQK A;  3LAJ A;  3E5U A;  2XV4 S;  2O03 A;  3L9F A;  3KET A;  3OS0 A;  3Q5F A;  3BZC A;  3D0S A;  4JK1 X;  4RLQ A;  3BTC A;  3ML6 A;  1BN5 A;  4BHB A;  1K78 A;  2CU7 A;  2LTP A;  4I0A A;  1FOK A;  4ZYG A;  3JTH A;  4DBQ A;  1GXP A;  2E2J J;  2P6S A;  4C30 A;  1TT0 A;  2XSJ C;  3HRM A;  3CDL A;  4X6A J;  3PIO F;  4BH9 A;  4HX8 A;  2EWN A;  1XGM A;  2LYC A;  5EG0 A;  1VTN C;  5D6F A;  1BI2 A;  2WAD A;  1RZ4 A;  4ZYE A;  3BJA A;  1Y8R B;  3IWZ A;  3K0L A;  1SAN A;  2VPL A;  3TBI A;  1IDZ A;  3M8F A;  4KIG A;  4W1U A;  1FSH A;  2VBX A;  3ZMD A;  2M8G X;  3MKZ A;  1QA6 A;  4HRI A;  1H0M A;  3S3M A;  3GTP J;  1D0X A;  2B9S A;  4K2E A;  4NQW B;  4EJV A;  2FOK A;  1FIA A;  3CCR I;  4BEH A;  4A0X A;  2D1V A;  3FXL A;  4F3Q A;  4FTH A;  2OTL I;  1E3P A;  1MBK A;  3H3U A;  3G73 A;  2XAU A;  3JSP A;  2L5Q A;  2VN2 A;  3CCL I;  2A05 A;  4I99 C;  2FF4 A;  1E0E A;  4CCJ A;  1ZGJ A;  3HSE A;  5J8C A;  2CRG A;  4LIV A;  2L7Z A;  4V19 K;  2JVH A;  3ZN0 A;  2X0L A;  1MDM B;  1B1B A;  2F4O B;  2X6X A;  3ZMS A;  5IYC J;  3OYI A;  3K4C A;  2NS0 A;  2LK2 A;  1A04 A;  1ZK8 A;  3WTV C;  3WTY C;  3OSG A;  3GBG A;  1D1C A;  2NXN B;  3QPH A;  4BNC A;  3CZ6 A;  2FJ1 A;  4LLG F;  3P9C A;  1DDN A;  3JRA A;  4MFE A;  4A3B J;  4XLC A;  4ZC3 A;  2E34 A;  2RVC A;  1ETY A;  4LK1 F;  4CDG A;  1XC5 A;  2H6B A;  4HDU A;  3LL7 A;  2HNH A;  3SEQ A;  1Q1H A;  1T95 A;  2ZB9 A;  2HYJ A;  1YW8 A;  2Z16 A;  2JUC A;  4PSX A;  2CQX A;  4I01 A;  1ZN2 A;  3GZ5 A;  3ZRG A;  2QGU A;  5CVJ A;  3OY9 A;  2K3P A;  1I50 J;  3JAM K;  1Z3Y A;  3WTT C;  4D5F A;  4XNF A;  2QUF A;  3IAM 2;  5F1R A;  1UMQ A;  3X2Q H;  1CQT A;  3DFG A;  3R61 A;  4J00 A;  2PLY A;  3M07 A;  3G1O A;  3O8H A;  1IXR C;  4M72 A;  2DCE A;  4L0Y B;  1WFX A;  3HGG A;  4UUS A;  1HLV A;  2R7F A;  1IN4 A;  1BI1 A;  4IRG A;  2BY3 A;  5DD8 A;  1EJ9 A;  2HQ5 A;  2G7H A;  4G8X A;  4F93 B;  2IXS A;  3LA3 A;  3M8E A;  1EH8 A;  1MBH A;  2LRE A;  3CLO A;  2F5C A;  3HOT A;  3CC4 I;  3I5U A;  3P5J A;  4XN3 A;  1AHD P;  2EIL H;  2A5Y B;  2DT7 B;  2GA2 A;  1W7P A;  4XM3 A;  5B1A H;  3DEE A;  5DM7 F;  4M6V A;  1ZR4 A;  2IS6 A;  3OIP A;  2ISZ A;  2IGK A;  3QYB A;  4HAM A;  3JRC A;  3S17 J;  2V79 A;  5F0C A;  1IV8 A;  3KP2 A;  2ELJ A;  1SFK A;  5HS7 A;  2IS2 A;  4QLC U;  2BZT A;  2KJB A;  2V9K A;  1JHF A;  4IRI A;  2K85 A;  3LSI A;  2VOP A;  2O3F A;  2I8D A;  4XN0 A;  3ASO H;  2BYV E;  4LJZ F;  1VQ6 I;  1O7F A;  2UV1 A;  3ZMU A;  1OCZ H;  1K6O A;  3FXU A;  2M2E A;  3HXL A;  2CQN A;  3VPR A;  3WHC A;  3J7A O;  3DF8 A;  5E1X A;  2VQC A;  3BPX A;  3MQ0 A;  5IOY A;  1U5T C;  4XR6 A;  1GV5 A;  1LVA A;  1P7J A;  1WJ5 A;  4GYI A;  3TDZ C;  2ZJ2 A;  4IZZ A;  2NVX J;  2VON A;  1MMA A;  4CYD A;  3I71 A;  3HTU A;  4N0B A;  4CCL A;  4IKF A;  3RKW A;  4Y15 A;  4G6Q A;  2QSG X;  1S5L C;  2KJC A;  4XLA A;  1YIO A;  3GUD A;  2DAO A;  2HVS A;  1ZLJ A;  4IHW A;  1B59 A;  5ICC A;  1R71 A;  1RES A;  2FNP A;  3IWF A;  2WAF A;  4RAF A;  1WZ2 A;  4I0B A;  3T5X A;  3WTU C;  4XSZ F;  4B43 A;  3RZD J;  1J0R A;  2HQA A;  3BCA A;  3DKX A;  2WTE A;  2LBF B;  4P9U A;  3E6C C;  3UKG A;  2VKH A;  3OYA A;  3AL0 B;  1DPR A;  2RC4 A;  3HKZ N;  3GEZ A;  3A01 B;  2LG4 A;  4ABZ A;  2DOD A;  2JZY A;  1XSX A;  2VXD A;  3DLL F;  4HNT A;  1NTC A;  6PAX A;  2HYF A;  1OQY A;  2YS9 A;  2MA3 A;  2Q2E B;  1GV2 A;  1Z21 A;  2GZW A;  1JUS A;  1U6G A;  3ABU A;  3W6V A;  1FSE A;  2IJL A;  1QPI A;  4G7O F;  2PMZ N;  1IDY A;  2Y31 A;  1FP1 D;  1FMV A;  4MO7 A;  5H20 A;  3CCS I;  1FT9 A;  1VF9 A;  2K27 A;  3M4O J;  1T56 A;  2O0Y A;  2R7W A;  3BG3 A;  3RI4 A;  1NK2 P;  4UY8 I;  1TZL A;  4MQ9 F;  5HLT A;  2H1L A;  1Z7U A;  2KIQ A;  3OYH A;  3HOS A;  1RR7 A;  3K2Z A;  1T8I A;  5CYV A;  4Y17 A;  4MLO A;  3BRO A;  1G59 A;  3OYN A;  5ICE A;  1VQ7 I;  2M4G A;  3A0B C;  4U7B A;  1XGO A;  2VBW A;  1T2K A;  3M1E A;  3L2W A;  3PNT A;  2XAJ A;  3BJO A;  5CVU A;  2QCO A;  4XOP A;  3I59 A;  4AIH A;  5F0H A;  1TTY A;  2GA1 A;  4IQ4 A;  4HNV A;  2V6C A;  2H09 A;  4A3C J;  1H8A C;  4E7Z A;  2AQF A;  2K4J A;  3FHN A;  4L9T A;  4P55 A;  1F36 A;  3R6S A;  1IZ1 A;  1KQ8 A;  2I5U A;  4M9Z A;  2A6H F;  4KN7 X;  3AL0 C;  4QWQ A;  2JTV A;  4RGR A;  1P2F A;  2ACJ A;  2L7F P;  4BS9 A;  3QPS A;  4AID A;  2Q8K A;  1Y6I A;  3IH4 A;  5B3S H;  3DCF A;  1MZB A;  1RIO H;  3BWG A;  1TWH J;  4Q48 A;  4IO9 F;  5FFZ A;  3CCY A;  3FWE A;  5B5E C;  4BUP A;  3LSG A;  1WVR A;  5IT9 K;  1A35 A;  2OCC H;  5E8G A;  4Y33 A;  3KZZ A;  1U8R A;  4CCK A;  1AU7 A;  1T6S A;  5K1Y A;  1X2M A;  1RR8 C;  4FHT A;  1B8I A;  1R23 A;  3H92 A;  4CCO A;  2W00 A;  1PDN C;  4D1Q A;  3E97 A;  1E3H A;  3MEX A;  3LSP A;  3IRR A;  3FK7 A;  3NAU A;  4OAY A;  5D8L B;  3T8T A;  2FXA A;  3SXY A;  1XMA A;  5FLM J;  4L9V A;  3TP0 A;  2ZBK A;  4CIC A;  2O9L A;  5FFX A;  3BG7 A;  5DD4 A;  3WTS C;  1JGS A;  5D6E A;  3EYI A;  3PFY A;  4AUX A;  1YE9 A;  2CH0 A;  3VDX A;  1LDD A;  2LVS A;  4UUS B;  3ZQH A;  4XSX F;  3K4K A;  3Q9S A;  4XON A;  1A6Q A;  1MGT A;  3B73 A;  4P96 A;  3ZXS A;  1I3A A;  5DV5 A;  1TL8 A;  3P9K A;  1LJ9 A;  1U8B A;  3HRT A;  2EZH A;  1LKX A;  1W7P B;  1YIT I;  5LHH A;  4GCV A;  3GWZ A;  4MTE A;  4HA8 A;  3K6G A;  1OCC H;  4HPQ A;  4YEL A;  3MN2 A;  3DP7 A;  5FKK A;  3HBL A;  2EIK H;  2STT A;  4B8X A;  4RAG A;  3BR2 A;  1YS6 A;  3PUF A;  4YG2 F;  1HKT A;  3DPL C;  3RPQ A;  4Q4Z F;  2F4M B;  4A2U A;  2XRL A;  4CCM A;  2F6C A;  5FGM A;  3WTZ A;  5M5W J;  2LY2 A;  4CSW A;  1HA8 A;  3LQR A;  4C3I J;  1BR1 A;  1UCR A;  2K9Q A;  2L7M P;  1KU3 A;  2K5C A;  4AM3 A;  2IGO A;  2DT6 A;  4UV8 A;  3V8K A;  1Z91 A;  1JJ6 C;  3FXO A;  3M9A A;  4FX0 A;  3MKY B;  1JKO C;  1TNT A;  2KL4 A;  2FQ4 A;  3EQL F;  2WY8 Q;  1TT5 B;  5DEQ A;  4Y52 J;  3JRF A;  3Q0U A;  4AWX B;  3H5A A;  1G8X A;  2LY1 A;  3IC7 A;  4XQF A;  4X1E A;  4NBQ A;  2E7X A;  1O57 A;  2M5W A;  1LQ1 A;  3BG6 A;  3K9T A;  1ZRF A;  5HS9 A;  1ZAO A;  1O3T A;  5JFR A;  5J40 A;  1R58 A;  1PP8 F;  2V9V A;  1IF1 A;  3QOP A;  1Y39 A;  4IOA F;  3S8P A;  2KZG A;  3TKY A;  2QF7 A;  1XB4 A;  2E5Z A;  4HF0 A;  3ZR8 X;  2XF5 A;  2XHK A;  1R7J A;  1PUF B;  2PMU A;  3J7A Y;  2PJR B;  3GTM J;  1HDP A;  2A3S A;  4RGS A;  3AG3 H;  2Z2S B;  1D0Y A;  4M3F A;  2R92 J;  3AKZ A;  2BGC A;  2P5K A;  2M30 A;  3E3V A;  1S7A A;  3WE3 A;  2BHZ A;  2M9H A;  5EEG A;  2JA7 J;  1BR2 A;  2ELH A;  2OJE D;  1R5H A;  1VQK I;  3QYF A;  3HUG A;  1YX5 A;  4L9J A;  1DGR M;  4GGG A;  2UZK A;  2P7C B;  3CMY A;  4PJN A;  3KEO A;  2B7E A;  2X1E A;  3KYD B;  3W2V A;  2HDD A;  1BOA A;  2GXA A;  2JA8 J;  1JKQ C;  3BTI A;  2JN6 A;  4G7H F;  1WWX A;  2Q1Z B;  5E3L A;  1XSD A;  2E7W A;  1FX7 A;  1GVD A;  3MZY A;  2IVM A;  2IA0 A;  1KON A;  4RS8 A;  3LFK A;  4LB5 A;  4GXO A;  5E1W A;  1FBU A;  2F2E A;  3F72 A;  4H4K C;  1R1T A;  1R4M B;  1TBX A;  4MHG A;  3HPG A;  3MZ8 A;  1IGN A;  1HDD C;  4HST A;  2FRH A;  2W84 A;  3QOD A;  4C2M J;  1ZAR A;  3VWB A;  1Z7L A;  3ASN H;  1KU9 A;  3QRF F;  1WH7 A;  1FOW A;  4RAZ A;  1J09 A;  1DQU A;  3C2H A;  4XKW A;  3HOW J;  3BR5 A;  5IP9 J;  2RV8 A;  4XMY A;  3COA C;  2VBY A;  3EET A;  3JR9 A;  3CQZ J;  5J1U A;  3I0T A;  1D0Z A;  3W2W A;  4D5C A;  2K40 A;  5FKN A;  1FZP B;  2RQQ A;  1FBQ A;  2R7D A;  2XPV A;  5FLX K;  2J5P A;  2M34 A;  1WJC A;  4KIC A;  4IRH A;  1SFX A;  2KIS A;  2DPU A;  3LST A;  3V8L A;  3G1L A;  3BG9 A;  2MSY A;  4E7I A;  3CP2 A;  4LG0 A;  4YFX F;  5DM6 F;  2WAE A;  1N77 A;  3BDD A;  4B47 A;  4IQJ A;  2WAQ A;  5EGO B;  3ERE D;  4A3G J;  1QHG A;  2R7U A;  3L2U A;  1ZGW A;  2GIV A;  2ZJP F;  2GBY A;  2CSO A;  1MSF C;  4PK4 A;  1Z6T A;  3S1N J;  2IA2 A;  4I76 A;  3GX4 X;  2M7A A;  5FLV A;  1ORK A;  1WKM A;  4DYC A;  3E0J B;  4KJZ A;  3RYR A;  1MDM A;  5M5X J;  4BQQ A;  1WJD A;  2H27 A;  2VJI A;  2DMT A;  3FXM A;  5DS9 A;  3JRG A;  3ZN1 A;  3L2R A;  4OIP F;  1I1G A;  3TO7 A;  4FIS A;  5M3M J;  4BDY A;  4BAC A;  1SVL A;  5FD6 A;  2HGC A;  2IGM A;  2X6Y A;  3U21 A;  1X3W B;  3IHU A;  3FHZ A;  1P4W A;  3CES A;  3ZQI A;  1O7L A;  2FA5 A;  3CUQ B;  3MZH A;  4BBR J;  3LSR A;  2DA3 A;  1OCO H;  4HZF A;  3H0G J;  2X1C A;  5IPA A;  4PUS A;  1J5Y A;  2ZXH A;  2OC6 A;  5D5W B;  1S7O A;  4FAS D;  1YS7 A;  1U5T A;  3KP6 A;  1SMT A;  5A2Q Z;  3OL4 A;  3Q0W A;  3HC7 A;  1RRJ A;  1H9G A;  1KU2 A;  2DW4 A;  2VIX A;  4N9H A;  3S1R J;  5LD2 C;  2IAI A;  2BHY A;  3HEF A;  4UUT A;  3L1P A;  3S32 A;  3ZMT A;  3K4M A;  2K9M A;  5E3O A;  3VYU B;  1F1Z A;  2E5N A;  4XRS A;  3O6B B;  3I55 I;  3BR1 A;  3F6O A;  3IUO A;  1XMK A;  3CJR B;  5DCM B;  2VT3 A;  1OCT C;  2LD5 A;  3SEZ A;  3DWL E;  3V7S A;  2HQN A;  4RGU A;  1O4X A;  4BQN A;  3CMM A;  4CUG A;  2ECB A;  3FM5 A;  1RET A;  2ESN A;  2BOL A;  2R7Q A;  1CF7 B;  2MFZ A;  4HG2 A;  4DOZ A;  4RB3 C;  4YIF A;  3P9I A;  5KCM A;  3FXR A;  3CCV I;  4OIN F;  2AS5 F;  1X1P A;  4C3H J;  1K6Y A;  5J6X A;  3L2V A;  4CHU A;  5E1Z B;  2HU9 A;  2MG4 A;  4DBR A;  2KRF A;  4CO8 A;  1R49 A;  3CUQ C;  3SZT A;  4HX7 A;  2FNA A;  3A2K A;  5CVR A;  1ON2 A;  3C18 A;  1UJ8 A;  1V5F A;  2B0L A;  2CW8 A;  2LDU A;  4BJT A;  3WTW C;  3A03 A;  1VND A;  3G2B A;  4IL6 C;  3A1Y A;  4EJO A;  3H35 A;  3DTK A;  1IXC A;  3IV5 A;  1IAW A;  4LG3 A;  5LGU A;  1WJA A;  2DFE A;  2ZSH B;  2L2O A;  3KLN A;  1OLT A;  4BE1 A;  4CGZ A;  4HNU A;  4L18 B;  5GAE J;  2HDW A;  2STW A;  1IN8 A;  4ZYD A;  1QGP A;  2VB6 A;  3Q0V A;  4M9S A;  2HZT A;  4PJL A;  3LSM A;  1BA5 A;  2RRE A;  4II3 A;  1TQI A;  1V5G A;  5GPA A;  1Y56 A;  2FOW A;  2CJJ A;  2UWM A;  2LBF A;  4P5O A;  2KPM A;  2Y75 A;  1SD4 A;  1VQO I;  3VOD A;  2CUE A;  2ME6 A;  1XCB A;  3JCU C;  1F43 A;  3C2B A;  3A01 A;  1HCR A;  4DNC A;  4M74 A;  1WGX A;  2PG4 A;  2H6C A;  2VQL A;  4ZZD A;  2Q2E A;  2E1N A;  1TW3 A;  1JTX A;  4M6Y A;  4II2 A;  2D1H A;  1R22 A;  1OYI A;  1TLH B;  4U88 A;  4A12 A;  2MC3 A;  1P4X A;  2MH9 A;  2PQ8 A;  1I39 A;  4M6X A;  4XRM A;  2LF8 A;  1WJB A;  3B02 A;  1XPX A;  4AIK A;  3QP5 A;  4WXD A;  1O3Q A;  2NAZ A;  3F8M A;  2XC7 A;  3RKY A;  3ULQ B;  2IBD A;  5C4J J;  4BJ5 C;  4ZTJ A;  2NS7 A;  4HF1 A;  2A5W A;  1UHS A;  1W0U A;  3L2Q A;  1YFH A;  5ED4 A;  1MBJ A;  3P7N A;  4QTR A;  4LG0 B;  3M8J A;  4OMZ A;  3RJP A;  5LHG A;  5BPI A;  1FEX A;  2X9D A;  4F55 A;  3HDD A;  3L09 A;  4A0Z A;  4IOC F;  1APL C;  4G12 A;  2PFB A;  1XN7 A;  2GOM A;  1IJW C;  3DKW A;  2L4A A;  4WF2 A;  1B9N A;  2HVR A;  1Y8Q B;  1OKR A;  5GAG J;  3HJE A;  4JYK A;  2IEK A;  3ISP A;  4RDU A;  3JTG A;  2ICW G;  2K02 A;  3FIS A;  3IH2 A;  3V4G A;  2VJJ A;  1Z0X A;  1EKE A;  4A3E J;  5KAF C;  1HW2 A;  3C3W A;  3H1C A;  3NQO A;  4A5N A;  4WX9 A;  2V1U A;  4EQQ A;  2ZXJ A;  1FPQ A;  4F7Z A;  5F6F A;  3DKY A;  2LR8 A;  3FMR A;  2ZFW A;  3ELK A;  5JVT A;  1BJZ A;  4C3J J;  3NAR A;  1DP3 A;  1QVU A;  4CZZ A;  5LGT A;  1FWZ A;  2HI3 A;  2ADU A;  4RB0 A;  3GTQ J;  2X4H A;  3RKX A;  2F5E A;  2L9R A;  1FP2 A;  3LQQ A;  1POG A;  3PNV A;  3ABM H;  1P4A A;  1U5T B;  2L54 A;  4KIS A;  1GLN A;  1Y0U A;  2EB7 A;  2ELK A;  4OIQ F;  2Y69 H;  4DZP A;  5EZG A;  5E79 C;  1JKP C;  1TWG J;  2OAZ A;  2XRN A;  3BJ6 A;  2ZKZ A;  1UFM A;  3OYD A;  4XK4 A;  2L7K A;  1LE8 A;  3ABK H;  3E6D A;  3FXK A;  4J01 A;  2DA7 A;  3RQI A;  4ENN A;  1FTZ A;  4XLP F;  1YRN A;  4S05 A;  3TDU C;  4XKC A;  4Y13 A;  1NG6 A;  4BXX J;  2CG4 A;  2DA6 A;  2FD5 A;  3WHB A;  2KQR A;  2M0C A;  3WU1 B;  1UG2 A;  1S9H A;  1TP4 A;  2L02 A;  3FKI J;  1QZE A;  1VQ9 I;  2DT5 A;  4V2G A;  4KT5 C;  2H1K A;  2NVY J;  1SC7 A;  3JRI A;  2OUM A;  1ZEL A;  4HF2 A;  3HRS A;  2R7T A;  4G94 A;  4LIU A;  2MW8 A;  5JLW A;  2Y48 A;  1P6R A;  2IT0 A;  3I58 A;  4ANJ A;  4NHJ A;  1AKH B;  2FMY A;  4A3F J;  1WPK A;  2VKE A;  2IS1 A;  4N4N B;  3W2A A;  2XDV A;  1ZG1 A;  3WGG A;  2LKX A;  5TGT A;  2UXX A;  3GZN B;  3HG9 A; 
#chains in the Genus database with same CATH homology
 3PFI A;  1QZY A;  4BHC A;  5CVV A;  5DUK A;  1LEA A;  1XSV A;  2KIM A;  4LGW A;  3R60 A;  4BXU A;  1P92 A;  4RGX A;  4EJW A;  5HS8 A;  1HKQ A;  4A6D A;  2WC2 A;  2RKH A;  5LGN A;  1O3S A;  3CTA A;  2MD5 A;  2G9W A;  3HIF A;  2VOD A;  4CXF A;  3JAM Z;  1DUX C;  1Z1D A;  1BIA A;  3M7G A;  4RB2 C;  2Q0O A;  3N4M A;  5JR3 A;  1FNN A;  4UXN A;  1Z6R A;  4LFU A;  3GZ6 A;  4LB6 B;  4HBL A;  1PUE E;  5AIQ A;  4Z2Y A;  2ESH A;  2ETH A;  1U2W A;  1JHH A;  4LMY A;  4OU0 A;  3GFJ A;  3L2C A;  2HOE A;  4TV7 A;  5LRR A;  1RNL A;  3WGI A;  4ENJ A;  3DEU A;  2R3S A;  4HQM A;  2MH2 A;  1BBY A;  5EEH A;  1ODD A;  3IRQ A;  3C1D A;  5ILV A;  1D5V A;  3CDH A;  1F5T A;  4BQA A;  4BHP A;  2NNN A;  4O5V A;  2DTR A;  4PCQ A;  3WG9 A;  3TO6 A;  5BMZ A;  3PQK A;  4EM2 A;  2ZNZ A;  1QNT A;  3QU3 A;  3ROU A;  1HQC A;  1IN6 A;  4B09 A;  2EV0 A;  4Q47 A;  4I7H A;  3V7C A;  4HDV A;  1IRF A;  2CO5 A;  3KFW X;  2Z5U A;  3FXQ A;  3KEQ A;  5BQT A;  1ZG5 A;  2YR2 A;  1BC8 C;  3LA2 A;  1I27 A;  1ZYR F;  2IA1 A;  4XBF A;  2QLZ A;  1S29 A;  1F9N A;  3KP3 A;  2M87 A;  3KLO A;  2FBI A;  1GHC A;  1R1U A;  2LSO A;  2EFW A;  3CUQ A;  4O6J A;  1LB2 A;  3F23 A;  3SHF A;  1G3T A;  3W6K B;  5KK1 A;  1SD6 A;  1Z9C A;  2GXB A;  5CJ9 A;  3J80 K;  4JQF A;  4Q5S F;  2M45 A;  5L3E A;  3FM3 A;  1IRG A;  2PJP A;  1QPM A;  3TQN A;  1HST A;  5H6R A;  3BZ6 A;  4IJA A;  1B4A A;  2XAQ A;  1TNS A;  5DCM A;  4FT8 A;  3KP4 A;  4A5M A;  2BV6 A;  1FYK A;  1W4M A;  1IN5 A;  1JXS A;  1CF7 A;  3HHG A;  3T1B A;  5HDK A;  5IT9 Z;  1E2X A;  1I1S A;  2COM A;  4YFK F;  3O2P E;  1V4R A;  3HSF A;  1FC3 A;  2QYO A;  2RQP A;  2GQQ A;  3EYY A;  1S8N A;  1BI0 A;  1ZRD A;  4ZH4 F;  4OMY A;  1WRJ A;  1E17 A;  2KIF A;  5E20 A;  5F64 A;  2OZU A;  2F5F A;  3MFK A;  4A6E A;  1D8K A;  1IW7 F;  2HTJ A;  1UHM A;  4R79 A;  3SZP A;  5DYM A;  2O8X A;  1R5G A;  3RYP A;  2KKO A;  1LNW A;  4MEY F;  3VB2 A;  4HYE A;  5JI6 A;  4GYG A;  1MJ9 A;  4EJU A;  4KIF A;  4E70 A;  3HRU A;  1OPC A;  1LEB A;  2JPC A;  2XRO A;  4ESJ A;  3G3Z A;  1MJA A;  2OQG A;  1HXD A;  1USS A;  2W24 A;  3K1M A;  5K5R A;  2K4B A;  3C7J A;  2EJR A;  4L0Z B;  2H94 A;  4H0E A;  1XCV A;  2QZ8 A;  4LLN A;  2A61 A;  1U3E M;  4U0Y A;  4AD9 A;  1UHW A;  2DLL A;  2QBY B;  1IN7 A;  3F6V A;  2EA4 A;  2EFQ A;  2P7V B;  2MLK A;  4HQE A;  4I2O A;  5K5O A;  2EV6 A;  3TOA A;  2L01 A;  1R00 A;  3H3Z A;  1G4D A;  4UV9 A;  3S2W A;  1FBS A;  1B9M A;  4UVC A;  5HDG A;  4OOI A;  3NRV A;  3J81 K;  2EK5 A;  2JPB A;  1CGP A;  1D3Y A;  1RUO A;  3GW2 A;  4MEX F;  3BOQ A;  4EV0 A;  1TW2 A;  2CW0 F;  2LNB A;  4ZYH A;  1KQ0 A;  5E18 F;  4L9N A;  2Z3Y A;  1C0W A;  2L4M A;  2RN7 A;  5L3D A;  3I54 A;  4EGZ A;  2LF7 A;  4UNO A;  5HLG A;  1EV7 A;  2K7L A;  1G3W A;  3ZPL A;  2WV0 A;  1OR7 A;  1FLI A;  1EH7 A;  5FLX Z;  2HTS A;  2CYY A;  1YW9 A;  3IKV A;  1GXQ A;  3EUH A;  1HBX G;  1QQI A;  2HR3 A;  2DFI A;  5BPD A;  1X3U A;  2EFO A;  5AIP A;  3ZMZ A;  2O61 A;  1GVJ A;  1AOY A;  4HX4 A;  4PDK A;  3CJN A;  3LAP A;  3KCC A;  5BS6 A;  2CWE A;  5ICF A;  1XDU A;  2YX4 A;  4LD5 A;  3BP8 A;  3SFZ A;  2EA2 A;  1TQP A;  3HYI A;  3DPT A;  1LDK B;  2V1D A;  4U0W A;  4KDP A;  2RNJ A;  2HDC A;  4AIJ A;  4KN4 X;  3F8C A;  3WGH A;  2VC0 A;  4KA4 A;  4AVP A;  1BM9 A;  2DK5 A;  3ZQ7 A;  2WWY A;  1XGS A;  1HW1 A;  5AON A;  2GXG A;  3HTS B;  1IXS B;  2F5D A;  5E17 F;  1BI3 A;  1J59 A;  2P6T A;  1HKS A;  4OIO F;  3U2R A;  2GAU A;  4RAY A;  1V3F A;  3OOP A;  5ERI A;  3RTR A;  3KE2 A;  1QO0 D;  4BAY A;  2XAG A;  4MNU A;  5D4S A;  3BPV A;  2HFH A;  1ON1 A;  5FB2 A;  4UHT A;  1HSJ A;  2JSC A;  3F8B A;  3F21 A;  2IP2 A;  5L3C A;  3WE2 A;  1R36 A;  4ENM A;  4KUM A;  1ZRE A;  5LHI A;  4L5J A;  2M1B A;  2O6G E;  2DU9 A;  2QWW A;  2IW5 A;  5DUI A;  2FSW A;  3REO A;  1R1V A;  4U0V A;  5ICG A;  5L3F A;  3TGN A;  3FF5 A;  2VE8 A;  4ENK A;  1W7P D;  2EFP A;  1S3J A;  2XIG A;  4MGR A;  1PP7 U;  2DK8 A;  3I4P A;  4LLL A;  1WI9 A;  3FMS A;  4M71 A;  4EGY A;  3I64 A;  5D8K B;  1T0F A;  2W85 A;  5H6Q A;  5HVQ C;  1ULY A;  2D45 A;  5LRS A;  3BY6 A;  3K1P A;  4IXA A;  2P5L C;  1YYV A;  4S04 A;  5TJJ A;  4HV6 A;  1KGS A;  4LK0 F;  3L00 A;  4ASN A;  2FE3 A;  2W25 A;  1FYL A;  3CO6 C;  1XDS A;  4IF4 A;  4I98 B;  1OYW A;  2D2W A;  2VXZ A;  1ZRC A;  2HKX A;  2HYG D;  3R4K A;  5HLI A;  2PBI A;  2ZO4 A;  3I53 A;  3GVA A;  2XUB A;  3N97 A;  4KNY A;  1ZH5 A;  3GLX A;  4O3M A;  2FQ3 A;  2P4W A;  2P8T A;  1JE8 A;  2XAF A;  1I5Z A;  2OBP A;  1J7K A;  2FBH A;  1RI7 A;  2E1C A;  4PGH A;  2DO7 A;  3QP6 A;  3DV8 A;  1SMY F;  5HDN A;  2FU4 A;  3F3X A;  2IPQ X;  3WOD F;  4IHT A;  3HSR A;  3PQJ A;  4IPA A;  2CFX A;  5L3B A;  1J9I A;  3AAF A;  2OQR A;  2P5V A;  4U7D A;  2PI0 A;  4WCG A;  2RGV A;  4ON0 A;  3IL2 A;  2V1X A;  4G6D A;  2FML A;  4RB1 A;  4UUV A;  1J75 A;  2HKO A;  1K79 A;  2M8E A;  4ZZL A;  1UB9 A;  4I02 A;  3IKT A;  3RIR A;  4WWC A;  1YLF A;  1K78 B;  4JBA A;  3FMQ A;  2RDP A;  3GO5 A;  5LLQ A;  2YU3 A;  3NEU A;  1REP C;  4I09 A;  4M73 A;  2VC1 A;  3OV8 A;  4IVN A;  3GXO A;  2DQL A;  3RPU A;  2A68 F;  4PGG A;  2ISY A;  4KIB A;  2JRT A;  3GFI A;  3GF2 A;  2BBY A;  2DQR A;  4R1H A;  4PZJ A;  1SAX A;  5JHU A;  1UST A;  2OA4 A;  1OMI A;  2AXL A;  4EM0 B;  5ILS A;  3CUO A;  3QAH A;  2QBY A;  1J2X A;  2GWR A;  4G7Z F;  3F22 A;  2VE9 A;  3MCZ A;  3MZH A;  3GFL A;  5CLS A;  5D5X B;  2ZME A;  1KYW A;  1EH6 A;  1YW7 A;  1ZG3 A;  2K86 A;  1LDJ A;  1DPU A;  4EM1 A;  1WSU A;  2ZNY A;  1T98 A;  1QZZ A;  2G7U A;  1OYY A;  1TQM A;  3E6B A;  1H9T A;  1ZLK A;  2L3D A;  2BEO A;  3WTX C;  2HEO A;  1G3Y A;  3JSO A;  3LA7 A;  2PMH A;  4ESB A;  2YSR A;  5TRD A;  2MBF A;  3ECO A;  2C6Y A;  2HQR A;  3VEP A;  1KYZ A;  2XAH A;  1YO5 C;  3JW4 A;  1FYM A;  4HOB A;  2QQB A;  5HLH A;  1STZ A;  1I6X A;  4XLN F;  2A07 F;  3VFZ A;  1AWC A;  2NNY A;  2A6E F;  3W6J B;  2EV5 A;  3T0Y A;  1YTY A;  3QU6 A;  2FEZ A;  2QEN A;  2Y0M A;  2XVC A;  1Z05 A;  3E5X A;  3DXJ F;  3KZY A;  3T8R A;  1DP7 P;  3V8J A;  1MD0 A;  2XKO A;  5KVR A;  3Q9V A;  1G3S A;  5ILU A;  4HLX A;  2DPD A;  2VT2 A;  4KYW A;  2OU2 A;  1SFE A;  1SD7 A;  5FO5 A;  2W57 A;  1ZHF A;  2KIU A;  5J8F A;  2QVO A;  1ONV A;  3J80 Z;  4YFN F;  3F8F A;  3ECH A;  4UVB A;  2HWV A;  5E8I A;  5LEK A;  4FX4 A;  5DDG A;  3U1D A;  3F8N A;  4YII A;  4MTD A;  3SQN A;  2HS5 A;  2EFN A;  4HLY A;  3KP5 A;  3L7W A;  4ETS A;  1MJB A;  4HW0 A;  1W5S A;  2J5O A;  3E5Q A;  2Z99 A;  4P9F A;  5A2Q K;  5BOX A;  4NB5 A;  3HHH A;  5L3G A;  3I59 B;  2XKP A;  4HV5 A;  1G6N A;  1SD5 A;  3GYH X;  1D8J A;  1YQA A;  2NRA C;  1S6L A;  4XRF A;  1IUY A;  4D0P A;  1W5T A;  4KMF A;  2A69 F;  1WQ2 A;  4R8H A;  2ZME B;  1NHA A;  3ZMV A;  4EMS A;  4OIR F;  2YX7 A;  4KFC A;  4NQW A;  2CGP A;  3TOB A;  1KQ9 A;  4G9Y A;  3E6M A;  4M9X A;  1MKM A;  4N9I A;  2PEX A;  1XD7 A;  4GO1 A;  4A0Y A;  2TDX A;  3O3K A;  1T39 A;  4UVA A;  5FD5 A;  3R0J A;  2XAS A;  2YPR A;  3ZP5 A;  1L3L A;  3MWM A;  3KP7 A;  2MLG A;  2XGX A;  3D5L A;  4BYY A;  2QM3 A;  4IHS A;  5DCF A;  4WXH A;  5D4R A;  2ZCW A;  3U9G A;  5IT3 A;  1SFU A;  3ABT A;  3LWF A;  3MAJ A;  1BC7 C;  3RDI A;  2VBZ A;  3FX3 A;  1ZGA A;  2IRF G;  2QQA A;  2QQ9 A;  2VOO A;  1XGN A;  3WU0 A;  3GFM A;  3CO7 C;  1T38 A;  2JT1 A;  4MQV A;  4L5I A;  3K69 A;  1HW5 A;  3V7R A;  1KU7 A;  3DQV C;  4KMU X;  3FZV A;  3J81 Z;  4ESF A;  5LBQ A;  5D5V B;  1RUN A;  1YG2 A;  2OD5 A;  2Z9O A;  2UXN A;  2LKP A;  5CVI A;  5LEJ A;  1L0O C;  3TO9 A;  1U78 A;  1K7A A;  4EJT A;  5K5Q A;  4WXC A;  2DBB A;  3VOE A;  3QPT A;  1F4K A;  4EVI A;  3R0A A;  5D5U B;  1O3R A;  2BE5 F;  2DI3 A;  2NYX A;  1B6A A;  1BJA A;  5HOO A;  1BIB A;  4DQ2 A;  1KA8 A;  2FBK A;  3K1N A;  1FY7 A;  3EDP A;  2Z33 A;  1QBJ A;  2PN6 A;  2OZ6 A;  4WK8 F;  2CQK A;  3LAJ A;  3E5U A;  2XV4 S;  2O03 A;  3L9F A;  3KET A;  3Q5F A;  3D0S A;  4JK1 X;  3ML6 A;  1BN5 A;  4BHB A;  1K78 A;  4I0A A;  1FOK A;  4ZYG A;  3JTH A;  1GXP A;  2P6S A;  3HRM A;  4BH9 A;  4HX8 A;  2EWN A;  1XGM A;  1VTN C;  5D6F A;  1BI2 A;  1RZ4 A;  4ZYE A;  3BJA A;  3IWZ A;  3K0L A;  3M8F A;  4KIG A;  1FSH A;  2VBX A;  3ZMD A;  1H0M A;  4K2E A;  4EJV A;  2FOK A;  4A0X A;  2D1V A;  3G73 A;  3H3U A;  3JSP A;  2VN2 A;  2FF4 A;  1ZGJ A;  3HSE A;  5J8C A;  3ZN0 A;  2X0L A;  1MDM B;  1B1B A;  3ZMS A;  2NS0 A;  1A04 A;  3WTY C;  3WTV C;  3QPH A;  4BNC A;  4LLG F;  3P9C A;  1DDN A;  2RVC A;  4LK1 F;  4CDG A;  2H6B A;  4HDU A;  1Q1H A;  1YW8 A;  4I01 A;  1ZN2 A;  3GZ5 A;  5CVJ A;  3JAM K;  3WTT C;  2QUF A;  5F1R A;  3DFG A;  3R61 A;  2PLY A;  1IXR C;  4M72 A;  4L0Y B;  2R7F A;  1IN4 A;  1BI1 A;  4IRG A;  5DD8 A;  2G7H A;  4G8X A;  3LA3 A;  3M8E A;  1EH8 A;  3CLO A;  2F5C A;  3HOT A;  3I5U A;  2A5Y B;  2GA2 A;  1W7P A;  2ISZ A;  4HAM A;  2V79 A;  3KP2 A;  5HS7 A;  4QLC U;  2KJB A;  1JHF A;  4IRI A;  2VOP A;  2O3F A;  2BYV E;  4LJZ F;  1O7F A;  3ZMU A;  1K6O A;  3FXU A;  3J7A O;  3DF8 A;  5E1X A;  3BPX A;  3MQ0 A;  1U5T C;  3TDZ C;  1LVA A;  4GYI A;  2ZJ2 A;  2VON A;  4CYD A;  3I71 A;  3HTU A;  4N0B A;  3RKW A;  4Y15 A;  4G6Q A;  2KJC A;  1YIO A;  3GUD A;  2DAO A;  1ZLJ A;  1B59 A;  5ICC A;  2FNP A;  3IWF A;  4I0B A;  3T5X A;  3WTU C;  4XSZ F;  1J0R A;  2WTE A;  4P9U A;  3E6C C;  1DPR A;  2RC4 A;  3GEZ A;  2JZY A;  1XSX A;  6PAX A;  2HYF A;  2MA3 A;  2GZW A;  1U6G A;  3ABU A;  1FSE A;  2IJL A;  4G7O F;  1FP1 D;  5H20 A;  1FT9 A;  2K27 A;  2O0Y A;  3RI4 A;  4MQ9 F;  1Z7U A;  3HOS A;  3K2Z A;  5CYV A;  4Y17 A;  3BRO A;  5ICE A;  4U7B A;  1XGO A;  2VBW A;  1T2K A;  3M1E A;  2XAJ A;  3BJO A;  5CVU A;  3I59 A;  4AIH A;  1TTY A;  2GA1 A;  2V6C A;  2H09 A;  2K4J A;  4L9T A;  4P55 A;  3R6S A;  1IZ1 A;  1KQ8 A;  4M9Z A;  2A6H F;  4KN7 X;  4QWQ A;  2JTV A;  4RGR A;  1P2F A;  2ACJ A;  2Q8K A;  1MZB A;  1RIO H;  3BWG A;  4Q48 A;  5FFZ A;  3FWE A;  5IT9 K;  5E8G A;  3KZZ A;  1U8R A;  1T6S A;  5K1Y A;  4FHT A;  1R23 A;  3H92 A;  1PDN C;  3E97 A;  3IRR A;  3MEX A;  5D8L B;  3T8T A;  2FXA A;  3SXY A;  1XMA A;  4L9V A;  2ZBK A;  4CIC A;  5FFX A;  5DD4 A;  3WTS C;  1JGS A;  5D6E A;  3EYI A;  1LDD A;  4XSX F;  3Q9S A;  1MGT A;  3B73 A;  4P96 A;  5DV5 A;  3P9K A;  1LJ9 A;  3HRT A;  1W7P B;  5LHH A;  4GCV A;  3GWZ A;  4MTE A;  4HA8 A;  3DP7 A;  2STT A;  4B8X A;  1YS6 A;  4YG2 F;  1HKT A;  3DPL C;  3RPQ A;  4Q4Z F;  4A2U A;  5FGM A;  3WTZ A;  3LQR A;  1UCR A;  1KU3 A;  3V8K A;  4UV8 A;  1Z91 A;  3M9A A;  4FX0 A;  1TNT A;  3EQL F;  5DEQ A;  4AWX B;  3IC7 A;  2E7X A;  1O57 A;  2M5W A;  1LQ1 A;  3K9T A;  1ZRF A;  5HS9 A;  1ZAO A;  1O3T A;  5JFR A;  1R58 A;  1PP8 F;  2V9V A;  1IF1 A;  3QOP A;  3TKY A;  1XB4 A;  4HF0 A;  2XHK A;  1R7J A;  2PMU A;  2A3S A;  4RGS A;  2BGC A;  2P5K A;  2M30 A;  3E3V A;  1S7A A;  3WE3 A;  5EEG A;  2ELH A;  1R5H A;  3HUG A;  4L9J A;  4GGG A;  2UZK A;  2P7C B;  3KEO A;  1BOA A;  4G7H F;  1WWX A;  1XSD A;  2E7W A;  1FX7 A;  3MZY A;  2IVM A;  2IA0 A;  4RS8 A;  3LFK A;  4LB5 A;  4GXO A;  5E1W A;  1FBU A;  2F2E A;  3F72 A;  1R1T A;  1TBX A;  4MHG A;  2FRH A;  2W84 A;  1ZAR A;  1KU9 A;  3QRF F;  4RAZ A;  2RV8 A;  3COA C;  2VBY A;  3EET A;  3I0T A;  1FZP B;  1FBQ A;  2R7D A;  5FLX K;  2J5P A;  4KIC A;  4IRH A;  1SFX A;  2DPU A;  3LST A;  3V8L A;  4LG0 A;  4YFX F;  3BDD A;  3ERE D;  2GIV A;  2CSO A;  1Z6T A;  2IA2 A;  3GX4 X;  1WKM A;  3RYR A;  1MDM A;  2H27 A;  4OIP F;  3ZN1 A;  1I1G A;  3TO7 A;  5FD6 A;  2HGC A;  3IHU A;  3FHZ A;  1P4W A;  1O7L A;  2FA5 A;  3CUQ B;  4HZF A;  1J5Y A;  5D5W B;  1S7O A;  1YS7 A;  1U5T A;  3KP6 A;  1SMT A;  5A2Q Z;  1H9G A;  1KU2 A;  2DW4 A;  4N9H A;  3ZMT A;  1F1Z A;  3O6B B;  3F6O A;  1XMK A;  5DCM B;  2VT3 A;  3V7S A;  2HQN A;  4RGU A;  3FM5 A;  2ESN A;  1CF7 B;  4RB3 C;  4YIF A;  3P9I A;  3FXR A;  4OIN F;  2AS5 F;  5J6X A;  4CHU A;  5E1Z B;  2KRF A;  4CO8 A;  3CUQ C;  3SZT A;  4HX7 A;  2FNA A;  5CVR A;  1ON2 A;  3C18 A;  3WTW C;  2B0L A;  2LDU A;  4EJO A;  1IXC A;  1IAW A;  5LGU A;  3KLN A;  4CGZ A;  4L18 B;  2STW A;  1IN8 A;  4ZYD A;  1QGP A;  4M9S A;  2HZT A;  1TQI A;  2UWM A;  4P5O A;  2Y75 A;  1SD4 A;  3VOD A;  1XCB A;  4DNC A;  4M74 A;  2PG4 A;  2H6C A;  4ZZD A;  2Q2E A;  2E1N A;  1TW3 A;  4M6Y A;  2D1H A;  1R22 A;  1OYI A;  1TLH B;  4U88 A;  4A12 A;  2MC3 A;  1P4X A;  2MH9 A;  2PQ8 A;  4M6X A;  2LF8 A;  3B02 A;  4AIK A;  3QP5 A;  4WXD A;  1O3Q A;  2NAZ A;  3F8M A;  3RKY A;  3ULQ B;  4HF1 A;  1YFH A;  5ED4 A;  3P7N A;  4LG0 B;  4OMZ A;  3RJP A;  5LHG A;  5BPI A;  3L09 A;  4A0Z A;  2PFB A;  1XN7 A;  3DKW A;  2L4A A;  4WF2 A;  1B9N A;  1OKR A;  3JTG A;  3ISP A;  2K02 A;  3V4G A;  1HW2 A;  3C3W A;  3NQO A;  4A5N A;  2V1U A;  4WX9 A;  4EQQ A;  2ZXJ A;  1FPQ A;  4F7Z A;  5F6F A;  3FMR A;  2ZFW A;  3ELK A;  5JVT A;  4CZZ A;  5LGT A;  1FWZ A;  2ADU A;  4RB0 A;  2X4H A;  3RKX A;  2F5E A;  1FP2 A;  3LQQ A;  1P4A A;  1U5T B;  2L54 A;  1Y0U A;  2EB7 A;  4OIQ F;  2XRN A;  2OAZ A;  3BJ6 A;  2ZKZ A;  1UFM A;  3E6D A;  4ENN A;  4XLP F;  4S05 A;  3TDU C;  4Y13 A;  2CG4 A;  3WU1 B;  2L02 A;  2DT5 A;  4KT5 C;  4HF2 A;  3HRS A;  4G94 A;  2Y48 A;  1P6R A;  2IT0 A;  3I58 A;  4NHJ A;  2FMY A;  1ZG1 A;  3WGG A;  2UXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...