1ZG5A

Narl complexed to narg-89 promoter palindromic tail-to-tail dna site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
66
structure length
66
Chain Sequence
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Primary and Secondary Modes of DNA Recognition by the NarL Two-Component Response Regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*GP*TP*AP*CP*CP*CP*CP*TP*AP*TP*AP*GP*GP*GP*GP*TP*AP*
total genus 22
structure length 66
sequence length 66
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zg5A00
3NQOA 1QBJA 3RPUA 3V4GA 2E7WA 2W24A 3GVAA 2JPBA 4L5JA 2RN7A 1OR7A 2B0LA 3RIRA 5L3CA 3W6JB 4HQMA 4L5IA 2FMYA 1IUYA 2R7DA 4N0BA 4GCVA 2UZKA 5HS8A 4LLNA 2VT3A 4R79A 3KP7A 3WTXC 3I53A 2P5VA 4UV9A 5K5OA 4P9UA 3H3ZA 2L02A 5HLGA 5LHGA 2PQ8A 1V3FA 1E17A 3DKWA 4GGGA 3SXYA 4JBAA 4HLXA 2MD5A 1V4RA 3V7SA 4EJOA 1HBXG 2DAOA 1G3YA 4ETSA 2LNBA 3F8NA 1K78A 3OOPA 2PEXA 2XRNA 3MZYA 5K1YA 2EWNA 2UXXA 4YG2F 3RYPA 4MHGA 3JTGA 4RAYA 4ESFA 2XROA 2WV0A 1BM9A 4WF2A 4LB6B 2O61A 2RVCA 2FNAA 1Z9CA 1HKTA 2P5LC 5D5UB 1FNNA 3ZMVA 3HRSA 1WQ2A 1F4KA 4XSZF 2LSOA 2FXAA 3HSFA 4RGRA 2CGPA 1QZYA 3MWMA 4DNCA 2FOKA 2HTJA 4RAZA 1UCRA 5D8KB 5LGTA 3VFZA 4BHPA 2L4MA 3F21A 3HUGA 2P7VB 5ILVA 3RJPA 5L3FA 2ISYA 1Z6RA 2XAJA 4ZYDA 3VEPA 2VXZA 3J81K 2F5DA 4L9TA 2CW0F 2VOPA 3JAMK 2A61A 1YTYA 4AD9A 2G7UA 2DI3A 3F8FA 2DT5A 3E3VA 2EFPA 1U8RA 2JPCA 4ENMA 2EJRA 4MNUA 2W57A 2EB7A 2XV4S 4M71A 1W5SA 1TNSA 4UVAA 4UV8A 3E5QA 3WE3A 2P7CB 2PMHA 4A6EA 1ZYRF 5BQTA 1ZG1A 1T6SA 3EUHA 2RDPA 4RB0A 3GLXA 2FE3A 2KIMA 4EV0A 2X4HA 4M9ZA 3ABTA 2K4BA 2ZBKA 3IKTA 1DDNA 1LEAA 4LJZF 3CDHA 1J59A 4TV7A 1PUEE 1OYWA 1BI1A 4GYGA 4G7HF 4Y13A 5E20A 2QLZA 1K7AA 2FBIA 2M5WA 4LLGF 2XKPA 4E70A 2O6GE 4R8HA 4P5OA 4ESBA 1TQPA 1FPQA 2HYFA 1QPMA 1ZGJA 3L2CA 3GFMA 3GZ6A 3TOBA 1R23A 3JSOA 1HQCA 4ENJA 2FQ3A 2ZJ2A 4L9VA 3L9FA 3HTUA 5ICCA 3R6SA 4IRHA 1LQ1A 2L01A 2ZO4A 3JW4A 1XGMA 5LBQA 4EJVA 1I1GA 4IHSA 4CZZA 4EJWA 2O03A 3TDUC 3FZVA 2E7XA 5DUKA 4ZYGA 5LRSA 2K27A 4NQWA 4HA8A 1SFUA 3KP4A 4OU0A 2A5YB 2KKOA 4WXCA 5HLHA 1FBQA 1OYYA 2Z99A 4LMYA 5AONA 1FYLA 2OQGA 3F72A 3OV8A 4XSXF 1ZGAA 1QNTA 5CVVA 3EDPA 3ULQB 5LHIA 3TO6A 2VBYA 2Y75A 2GQQA 4BAYA 4CO8A 5L3DA 1JE8A 1B6AA 4KA4A 5HS9A 1O7LA 5LGNA 3W6KB 4OIRF 1XB4A 2V79A 1P92A 1DUXC 2DFIA 2G9WA 4UUVA 1ON1A 2Q2EA 1SMYF 4FT8A 4UNOA 1ZH5A 1O57A 2DK5A 3C1DA 3KZYA 1J2XA 4A5NA 1AWCA 2DPUA 2HFHA 1S8NA 2CFXA 5TRDA 5ED4A 3B02A 3JTHA 1OPCA 3S2WA 4A0ZA 2BEOA 3CO7C 1HW1A 2OU2A 2PI0A 3LAPA 5BS6A 4G7ZF 1J5YA 4RB3C 3QOPA 3E5XA 5F1RA 3FM5A 4HX4A 3HRMA 4I0AA 3COAC 3GXOA 4LD5A 3O2PE 3D5LA 3ZN0A 1MJBA 3BJ6A 5D6FA 2VBXA 3WGGA 4IHTA 4RB2C 4MTDA 3I64A 2D1HA 4ENKA 3TKYA 1O3TA 4OMYA 2DU9A 4L18B 3RI4A 1KA8A 1QGPA 2HYGD 3C7JA 1XGOA 3O3KA 1FT9A 4XLPF 3LQRA 3E6MA 4I0BA 5D6EA 3DPLC 1HW5A 1MJ9A 2XHKA 2E1NA 3GWZA 3V8KA 3K9TA 3ZMSA 2ESHA 2XVCA 3SZPA 1FC3A 4ZZLA 2DW4A 1STZA 4NB5A 4YIFA 5J6XA 2QQBA 2R3SA 4KICA 4JK1X 4I98B 2R7FA 4MTEA 2LKPA 4HQEA 1DPUA 4IXAA 3U1DA 3DP7A 4HF0A 1D8KA 2D2WA 1MD0A 5TJJA 3HOSA 4HF1A 3CUOA 4KMUX 2QZ8A 4A2UA 1FLIA 2MC3A 3ZQ7A 3AAFA 1O3QA 1B9NA 2RGVA 4HYEA 2JTVA 1U3EM 5FFXA 1BI2A 4AVPA 4RGXA 5JR3A 5E1WA 1IRGA 1FYMA 3F8BA 5JI6A 3ROUA 4LK1F 1S6LA 4N9IA 3JSPA 2QENA 3R61A 4YFXF 4QLCU 3TO9A 1ZN2A 4KIGA 1IW7F 2ZMEB 2VC1A 1XSDA 4HDVA 3BOQA 4CXFA 4M9SA 1XMAA 2UWMA 1PDNC 3IRQA 3M9AA 2XAQA 3DXJF 4A0YA 5D8LB 3JAMZ 1W7PA 3IC7A 4RGSA 3ECOA 4EVIA 1FP2A 3I54A 2CO5A 4D0PA 2PLYA 1PP7U 4M9XA 3HIFA 2ZCWA 5IT9K 1RIOH 5F6FA 1D8JA 3PQKA 2ZMEA 2LF8A 4G6DA 1AOYA 1BBYA 5DCFA 2OD5A 2VT2A 2M45A 5ICFA 2FU4A 4BH9A 2KJCA 1FP1D 1YW8A 2W85A 3J80K 4I7HA 3M7GA 4IRIA 4XBFA 4BXUA 1MDMA 1TQMA 5DV5A 1GXPA 4MGRA 2A68F 3HRUA 2TDXA 2L54A 2IJLA 4MEYF 5HDNA 5E17F 1TQIA 4HF2A 1R1VA 1Y0UA 2A69F 1HKQA 4JQFA 3QAHA 5KK1A 4U7BA 2H94A 1K78B 2Q8KA 3HHHA 3T1BA 1ZREA 1U5TB 1XDUA 3DQVC 2FMLA 1YS6A 1FBSA 3L09A 1NHAA 1J75A 5D5XB 2EA2A 4LLLA 1KQ8A 1BIBA 3BROA 4L0YB 3O6BB 3TGNA 1TW3A 4KUMA 4FHTA 2GXBA 2VONA 4HV5A 3GO5A 1RNLA 2HZTA 5FFZA 3BWGA 3U9GA 5FD5A 3SFZA 3WU1B 3KETA 3WTZA 3FMSA 1T38A 3M1EA 3ZPLA 4O5VA 2EK5A 3HHGA 1MDMB 1XMKA 2K4JA 2X0LA 1W4MA 1GVJA 3DF8A 4Y17A 1FOKA 3K69A 2YX4A 2V9VA 4LG0B 3M8FA 3R0AA 2MLKA 2MH9A 2IA1A 3Q9SA 2IA0A 4Z2YA 1HXDA 1K79A 3BZ6A 4U7DA 1T2KA 4AIJA 1IRFA 2F5FA 1R00A 2DPDA 1HKSA 4PGGA 2KIUA 1RZ4A 4K2EA 3N97A 1TLHB 5FGMA 5CVIA 1LDKB 2D1VA 2JT1A 2PN6A 4EQQA 4Q5SF 5DDGA 1LB2A 1J0RA 3G3ZA 2IRFG 1FX7A 2QYOA 4YIIA 1ZRDA 2FEZA 2XIGA 2QBYA 2A07F 2Z9OA 2O0YA 1WSUA 1XGNA 2NYXA 4IPAA 2HWVA 2V1XA 2QM3A 3HTSB 3LA2A 2WWYA 3LQQA 3Q9VA 5DCMA 3KZZA 1I1SA 3MEXA 1H0MA 1LJ9A 3BPXA 1EH6A 2G7HA 1MKMA 5CVRA 5CVJA 3IHUA 5E1XA 4EGZA 3T8RA 5DYMA 3F3XA 4I2OA 2D45A 2YSRA 4Q47A 1H9TA 5H20A 3LA3A 4MQVA 2YU3A 4U0YA 2NRAC 4I02A 3U2RA 4OIPF 1YIOA 1B1BA 2WC2A 2OZ6A 1W7PD 2VBZA 4WX9A 4H0EA 1VTNC 2FF4A 1X3UA 5DD4A 2P5KA 2FA5A 4CYDA 3IRRA 2VE9A 3T0YA 2OZUA 1W7PB 3QPHA 4CGZA 4A6DA 4BNCA 1O3SA 2EFNA 2AXLA 2AS5F 3ZMUA 1SAXA 3I0TA 2F5CA 2RC4A 2P4WA 3QPTA 5A2QZ 2ADUA 3E6BA 1BOAA 2BE5F 2HR3A 2BBYA 5D5WB 5BPIA 3C3WA 4OINF 5D4RA 1FYKA 4M74A 1F5TA 2YPRA 1P4XA 1UHWA 4MQ9F 3R4KA 3H3UA 4G7OF 1LDJA 3RKXA 1QQIA 3V8JA 2YX7A 1R5HA 2ZXJA 3V7CA 2ZFWA 3FF5A 2HEOA 3GX4X 3V8LA 2DQRA 5E8IA 3CTAA 2XKOA 2GIVA 2KJBA 3DPTA 2KIFA 1JGSA 4CHUA 2ZNZA 4R1HA 1SMTA 2DK8A 1O3RA 5FLXK 3FWEA 1UB9A 4G6QA 3E5UA 4HW0A 3RDIA 3NRVA 2UXNA 2JSCA 5AIQA 3IWFA 4P55A 1EH8A 2YR2A 4KDPA 1YYVA 2HKOA 2EA4A 3LFKA 4UVCA 5K5RA 3K1PA 3QU3A 4Q4ZF 5DEQA 4YFNF 2IP2A 3TQNA 5LHHA 3FXRA 2Z33A 1J9IA 2A6HF 4AIKA 3I5UA 4WXHA 1IN7A 4L9NA 1PP8F 1R5GA 2NS0A 1BN5A 4HZFA 4ZH4F 3GFLA 3IWZA 2EV6A 5BMZA 1HSJA 1P2FA 3P9KA 2OQRA 1BC8C 2VC0A 2GA1A 5J8FA 3I58A 1L0OC 1YG2A 2IW5A 1S7AA 2FSWA 2P6TA 3J81Z 1TNTA 1WI9A 4EGYA 2QQ9A 3KCCA 1S7OA 2VOOA 3FMQA 2PMUA 5CVUA 1ZLJA 1IXRC 4UXNA 3M8EA 3KEQA 1P4AA 1YLFA 1CF7B 1UFMA 2RKHA 4BYYA 2A3SA 2EV5A 3CLOA 2ACJA 5LLQA 2J5PA 2STTA 1U2WA 4HX7A 1EH7A 3IKVA 3TO7A 1XSXA 1R58A 1Z7UA 3EYIA 1GHCA 3T8TA 1YS7A 2DQLA 1JHFA 5CJ9A 1IF1A 2OA4A 1XCVA 4CICA 5A2QK 2CWEA 1WWXA 5E1ZB 4KIFA 1YQAA 2OAZA 3EQLF 1J7KA 4IJAA 4HLYA 1S3JA 4EJUA 4OMZA 2QVOA 2GA2A 3BJOA 1BIAA 5IT3A 1F9NA 1YO5C 2IA2A 3K0LA 3F23A 5CLSA 1P6RA 1RUNA 4HV6A 3P7NA 3IL2A 3FM3A 2IVMA 4CDGA 5HS7A 3EETA 3LSTA 4AWXB 3SQNA 5H6RA 3WGIA 4U88A 3GUDA 5EEGA 1IN8A 1USTA 5L3GA 4XRFA 4FX4A 3QP5A 4U0VA 1SD7A 3K1MA 1ODDA 4M6YA 5LRRA 4YFKF 2Y48A 4RGUA 1ULYA 3C18A 4LGWA 2CG4A 5AIPA 1IZ1A 4EM1A 3VB2A 1YW9A 1KQ9A 3KP2A 2MA3A 2HTSA 3WTYC 5D4SA 1ON2A 4OIOF 3FXUA 4A0XA 1R1TA 1G3SA 3CUQB 1KYZA 4IF4A 1IAWA 1LNWA 3RTRA 1TBXA 5ICGA 3I59B 1I27A 3ABUA 2ELHA 2NNNA 2M8EA 5ICEA 2CSOA 3BP8A 3E6CC 4MEXF 1YFHA 1I6XA 3SHFA 3F6OA 3F6VA 4O3MA 2F5EA 3E6DA 4PZJA 5JHUA 2GWRA 4A12A 4N9HA 4Q48A 4LG0A 4KMFA 2XAFA 4LK0F 5LGUA 4RS8A 1ZAOA 1MGTA 1R22A 1MJAA 3F8CA 1EV7A 4GXOA 3ERED 4PCQA 5DUIA 2ZKZA 2PFBA 5J8CA 3LAJA 1W5TA 3QU6A 3CO6C 1FSEA 4ON0A 1IXSB 2FNPA 2DBBA 3R60A 5FLXZ 3KP5A 5LEKA 3WTUC 4ZZDA 4EM0B 1U6GA 4BHCA 2HOEA 2EFWA 4UVBA 2STWA 1BI3A 3V7RA 3H92A 2J5OA 4ENNA 5BOXA 1KYWA 1BI0A 2FBHA 5D5VB 2EV0A 2LF7A 4B09A 1XCBA 1IN4A 4EM2A 2DLLA 1G4DA 2VN2A 3ZMTA 2HGCA 1SFEA 2MBFA 5EEHA 4KYWA 1K6OA 3WGHA 4S05A 1ZG3A 5DD8A 5ILUA 1D5VA 3FX3A 1YW7A 3GFJA 5KVRA 1ZARA 3WTSC 1DP7P 1FY7A 4BQAA 3D0SA 3WTWC 1XDSA 4KN4X 4P9FA 2K86A 1GXQA 2W84A 2V6CA 2WTEA 6PAXA 2H09A 3J80Z 4M73A 3GW2A 2P8TA 4A5MA 1HW2A 3FHZA 1XGSA 1LDDA 3ZP5A 1QZZA 1A04A 3GZ5A 4HAMA 3T5XA 3F22A 1FWZA 4DQ2A 1D3YA 2V1UA 3ML6A 2EFOA 1B59A 4Y15A 4ESJA 1SFXA 2EFQA 2GZWA 2VODA 1G6NA 2ESNA 1JHHA 4GYIA 3K1NA 3REOA 5K5QA 4IRGA 2RNJA 5L3EA 2DO7A 2JZYA 4G94A 3WTTC 2PG4A 3QP6A 2XAGA 4XLNF 2M30A 3B73A 1TTYA 4WCGA 1Z91A 5BPDA 1KU3A 3L00A 4S04A 3I4PA 1ZHFA 1E2XA 3RPQA 2HQNA 3I71A 2A6EF 1IN6A 2K7LA 2VE8A 2MLGA 1U78A 3DFGA 4PGHA 5CYVA 3MCZA 4O6JA 1O7FA 2XUBA 1KGSA 1QO0D 1R1UA 4WK8F 1U5TA 5H6QA 1KU2A 2OBPA 3PQJA 1Z6TA 5HDGA 1CF7A 1B9MA 3KP6A 4L0ZB 4M72A 2XASA 3HRTA 3RYRA 3KFWX 3KP3A 5E8GA 3VODA 1F1ZA 2QQAA 4ZYHA 3ECHA 1ZG5A 1SD4A 1ZLKA 2F2EA 4LFUA 3P9CA 5F64A 3ZMDA 3P9IA 4KT5C 2NNYA 4UHTA 4FX0A 4WXDA 3ELKA 1B4AA 4NHJA 2W25A 3LA7A 1XSVA 3WU0A 1S29A 4KNYA 2JRTA 3EYYA 3MAJA 3MFKA 1FZPB 4KFCA 1WKMA 2QUFA 3Q5FA 1T39A 3FXQA 3GF2A 4AIHA 1SD5A 1DPRA 2LDUA 3ZMZA 1LEBA 2Y0MA 2FBKA 3G73A 5HVQC 2BGCA 3GYHX 3WE2A 1UHMA 3GFIA 2V1DA 4IVNA 4GO1A 2PBIA 4HBLA 3BY6A 1ONVA 5E18F 4HOBA 2H6BA 4QWQA 1KU9A 2HS5A 3WG9A 2BYVE 3DEUA 1RUOA 3BDDA 3FMRA 2QWWA 4KN7X 1BJAA 1FBUA 2GXGA 2KRFA 1LVAA 1T98A 3HSRA 4EJTA 2COMA 3K2ZA 2IT0A 1XN7A 1Z1DA 2RQPA 2CQKA 2H6CA 4HDUA 1JXSA 3RKWA 5HLIA 4G8XA 3R0JA 3LWFA 4P96A 2C6YA 4I01A 1I5ZA 2IPQX 3MQ0A 2BV6A 3N4MA 1OKRA 3CUQA 2ETHA 1Q1HA 2HQRA 2L3DA 2O8XA 1R7JA 4I09A 5JVTA 4F7ZA 2NAZA 4WWCA 4LB5A 1HSTA 3GEZA 4HX8A 3BPVA 5HOOA 2ISZA 2Z5UA 2E1CA 4BHBA 3F8MA 3E97A 5ERIA 2Q0OA 3SZTA 3I59A 1XD7A 2FRHA 2XGXA 4U0WA 1IN5A 1RI7A 1KU7A 3VOEA 2O3FA 5ILSA 1G3WA 4EMSA 3CUQC 4ZYEA 3HOTA 1OMIA 2L4AA 2M1BA 5L3BA 3DV8A 2ZNYA 4OIQF 1G3TA 5JFRA 3KLNA 1MZBA 1Z05A 1OYIA 3WTVC 3MZHA 1C0WA 4OOIA 3WODF 4B8XA 5IT9Z 1USSA 4L9JA 1SD6A 5DCMB 1R36A 3KE2A 2P6SA 4M6XA 3RKYA 1L3LA 1BC7C 2DTRA 2HKXA 2K02A 1T0FA 5FD6A 4PDKA 3KEOA 1H9GA 1P4WA 1ZRCA 3ISPA 1WRJA 1TW2A 1KQ0A 3PFIA 3KLOA 1IXCA 3HYIA 2Z3YA 1CGPA 2M87A 1REPC 3BJAA 3ZN1A 2QBYB 3J7AO 2VBWA 1ZRFA 3TDZC 5HDKA 2CYYA 5FO5A 2GAUA 1U5TC 3QRFF 3L7WA 3CJNA 4RB1A 1FSHA 5LEJA 3NEUA 2MH2A 3TOAA 4ASNA 4KIBA 2HDCA 4G9YA 2PJPA 2RV8A 2H27A 2XAHA 3HSEA 5FB2A
chains in the Genus database with same CATH superfamily
4BL0B 3NQOA 1RETA 1SFKA 1QBJA 1IDZA 4XKCA 2KDOA 2CFOA 2WA0A 2LY1A 3RPUA 3V4GA 2E7WA 3MKZA 1ETWA 2KRCA 2X6WA 2VPLA 2W24A 3GVAA 2JPBA 4L5JA 3W2VA 2RN7A 1JKOC 3DTKA 4DIQA 1OR7A 2B0LA 1QHGA 3RIRA 5L3CA 2EH3A 3L2QA 3S8PA 4RMNA 3W6JB 4HQMA 4L5IA 2FMYA 1IUYA 4BE0A 2R7DA 4N0BA 4GCVA 2UZKA 5HS8A 3HBLA 1F36A 4B1RA 4LLNA 3S15J 4Z6YA 1PUFB 1X4OA 2VT3A 4R79A 1UMQA 3KP7A 3JCUC 3W2WA 3WTXC 5F0CA 3D1NI 1MNEA 2K9NA 3I53A 4BQQA 2P5VA 1HLVA 2K85A 3J7AY 3K4BA 3S3MA 4BEHA 1BA5A 4BQNA 5LD2C 4UV9A 5K5OA 3I3LA 4P9UA 4A3IJ 3H3ZA 2OF7A 4KT6A 3CMAI 1B72B 3HB9A 5KCMA 3TMOA 3OS1A 1SAUA 2L02A 5HLGA 5LHGA 4PK4A 2PQ8A 1V3FA 1E17A 3DKWA 4GGGA 3E1SA 3SXYA 2ZSIB 4HLXA 2MD5A 1V4RA 4JBAA 3S93A 1X1CA 3V7SA 4EJOA 3E0JB 2DAOA 1HBXG 1G3YA 4ETSA 2LNBA 3F8NA 1K78A 3OOPA 2PEXA 2XRNA 2E35A 3MZYA 5K1YA 2EWNA 3MMYB 2M34A 2UXXA 4YG2F 3RYPA 3FHNA 1VQ4I 3GTOJ 4MHGA 4NBQA 1T95A 2VKDA 4E7JA 3JTGA 2CQ7A 1D1BA 4A3DJ 4RAYA 2I5UA 4ESFA 2XROA 1ETQA 5EF6A 2WV0A 4EATA 1IRZA 2D5VA 4C2MJ 1P7IA 1BM9A 4WF2A 4FTHA 4LB6B 2O61A 2RVCA 2FNAA 1A35A 1Z9CA 4ZTJA 1HKTA 2P5LC 5D5UB 1FNNA 3CQZJ 1MMNA 3ZMVA 3HRSA 1WQ2A 1F4KA 1SVOA 4XSZF 3K4LA 5IP7J 4DBRA 4JOMA 4BY7J 4CCNA 1MSEC 2LSOA 3OYIA 1W0TA 2FXAA 2E34A 2HQ5A 3DLLF 3HSFA 4RGRA 3HZJA 5TGTA 2CGPA 3L2UA 3DU5A 4RBOA 1QZYA 5F1JA 3MWMA 1QRYA 4BQOA 4DNCA 3CJRB 1G59A 1S72I 5EDNA 2DJIA 2FOKA 1X1BA 3PSIA 4CCOA 5EGOA 4A3EJ 2K3FA 2HTJA 2LY9A 5B66C 3CLQA 4RAZA 1UCRA 5D8KB 5LGTA 5HNFA 2HPMA 3VFZA 1X3ZB 4BHPA 2L4MA 3F21A 2TCTA 4PJNA 3I4MJ 4NC6A 3HUGA 2DOEA 5FKLA 2P7VB 5ILVA 1EJ9A 3RJPA 5L3FA 1TWCJ 5FKOA 2ISYA 1Z6RA 2NVTJ 2XAJA 4ZYDA 5FRNA 3VEPA 3VYUB 4X0GA 2VXZA 3J81K 1N78A 2F5DA 4L9TA 2CW0F 3BZKA 2VOPA 3JAMK 2M4GA 2A61A 1JKPC 1YTYA 3HOXJ 5GP9A 1SVLA 4A3KJ 2OTJI 2OCCH 1HCRA 4AD9A 2G7UA 3PFYA 2DI3A 3KPHA 4G12A 3H9JA 3F8FA 2DT5A 1R5ID 5HNHA 2KQRA 3E3VA 4B43A 3AL0C 2EFPA 1ETKA 1RESA 1YJWI 5DM7F 2XC7A 1U8RA 2KLOA 5FLMJ 2JPCA 4ENMA 2EJRA 4UUSA 4NNJA 3OY9A 4MNUA 1K61A 2VJIA 2W57A 4YELA 2EB7A 2XV4S 1Q1VA 4M71A 1W5SA 3KYDB 1TNSA 4UVAA 2ID6A 2DA4A 4UV8A 3E5QA 3AG3H 3WE3A 2P7CB 4A3GJ 1RR8C 1UELB 2PMHA 2XGCA 1FJLA 3CP2A 4E7ZA 4A6EA 1ZYRF 5BQTA 1ZG1A 4ABZA 1T6SA 3EUHA 1ZGWA 2RDPA 4RB0A 4E7LA 3GLXA 3J7YJ 2FE3A 1FTTA 2KIMA 1A31A 2GIZA 4EV0A 1IG7A 2VKVA 4A69C 2X4HA 4M9ZA 3LSHA 2IEKA 1LFPA 3ZXSA 3ABTA 2K4BA 2ZBKA 2JRMA 3IKTA 1NG6A 1DDNA 1LEAA 2ELJA 4DW6A 3PM1A 4LJZF 1WH7A 3CDHA 1J59A 4TV7A 1E3HA 2AXTC 2B7EA 2NVYJ 4DYQA 4FCYA 1PUEE 1OYWA 1BI1A 4FETA 4GYGA 4G7HF 1RR7A 1ERDA 1WH5A 4Y13A 1POGA 3BR3A 4OAYA 5E20A 3K4NA 2QLZA 3QODA 1K7AA 2FBIA 4BJTA 2M5WA 4LLGF 4A3JJ 2XKPA 4E70A 1ITYA 2O6GE 3CP8A 1HDPA 4D7NA 4R8HA 2K40A 4P5OA 3A4CA 4ESBA 1TQPA 1WJEA 3M3YJ 1FPQA 1A5JA 2HYFA 1FEXA 3OYHA 1QPMA 1ZGJA 3L2CA 3GFMA 3H5NA 1Z3YA 3GZ6A 3TOBA 2QQ8A 4M3FA 1R23A 3E7LA 3JSOA 1HQCA 3M07A 3ZQFA 4ENJA 3BTJA 2MSYA 4QTRA 1R6RA 2FQ3A 2ZJ2A 4W1UA 3PO3J 4L9VA 3L9FA 3HTUA 4XOPA 2EZKA 4ZJZA 5ICCA 2N8GA 3R6SA 2R5ZB 4IRHA 1LQ1A 2L01A 2ZO4A 3JW4A 3OYBA 4UUSB 1XGMA 2E2IJ 5LBQA 4XOTA 5C3EJ 1OFCX 4EJVA 3DBHB 1I1GA 2HI3A 4IHSA 2DDAA 5BNGA 1IV8A 4CZZA 5TISC 4IZZA 2XRLA 4EJWA 1BR2A 2O03A 4HG2A 3TDUC 4NQWB 4PJJA 3FZVA 2E7XA 5DUKA 4ZYGA 1VQ7I 1FOWA 5LRSA 4IQJA 3J7ZI 2K27A 5M5WJ 4NQWA 4QPQA 4HA8A 1BR1A 3LSJA 1SFUA 2CS3A 1MBFA 3KP4A 1UHSA 4OU0A 2A5YB 2KKOA 4FASD 1LFUP 1LFBA 4WXCA 2GLOA 5HLHA 5KAFC 1FBQA 1DQUA 3OR2C 1OYYA 3IUOA 2Z99A 4LMYA 5AONA 1W0UA 3CCLI 2OQGA 3F72A 3OV8A 4LIUA 4C9YA 4XSXF 1FYLA 4IHXA 1ZGAA 1QNTA 5CVVA 3L2VA 3DU6A 3EDPA 3ULQB 5LHIA 3TO6A 4JYKA 3HDDA 2VBYA 2Y75A 5CKTA 2GQQA 4BAYA 4CO8A 2COBA 1EF4A 3FXLA 5L3DA 1JE8A 5EGOB 1B6AA 1MBJA 3LSMA 4KA4A 9ANTA 1IUFA 1V5FA 2LYCA 1VQ5I 5HS9A 1O7LA 5LGNA 3OSFA 3W6KB 4CUGA 2R7TA 4OIRF 1XB4A 2V79A 1P92A 5JHFA 1DUXC 2DFIA 2KHMA 2G9WA 4UUVA 2CV2A 4KITB 5E3LA 1KZHA 3M4OJ 2X48A 1ON1A 3QOEA 5EG0B 2Q2EA 1SMYF 2ME6A 4FT8A 4GDFA 4UNOA 2H8WA 4XL9A 1ZH5A 3LSGA 1O57A 3VWBA 2DK5A 2XDVA 3C1DA 3KZYA 1U9NA 3AKZA 1J2XA 4A5NA 4M3BA 1V54H 1U9OA 1AWCA 5B3SH 2MG4A 3ABLH 4BXXJ 4ZC3A 2DPUA 2VL8A 2L7MP 2IGOA 2PJRA 2HFHA 1S8NA 3F9KA 2X85A 2CFXA 4BS9A 5TRDA 2DFHA 2DMUA 2BY1A 3CCUI 1WI3A 5ED4A 3B02A 3JTHA 1OPCA 3S2WA 1LUJB 4A0ZA 2BEOA 3CO7C 1HW1A 2PX9A 3B6CA 2DA2A 4CYCB 3F0CA 2OU2A 2ZB9A 2PI0A 3LAPA 5BS6A 5CQGA 3GBGA 4G7ZF 3A01A 1V55H 1J5YA 5CPRB 4RB3C 2IS4A 3HKZA 3QOPA 3E5XA 3ZQLA 5F1RA 2CUEA 2W1OA 3RZOJ 4DBQA 2KZVA 3FM5A 4HX4A 3HRMA 3G1MA 4I0AA 3RCOA 2DMTA 2HVQA 3GXOA 3COAC 4ZTFA 4LD5A 2HVRA 3O2PE 2X6OA 3D5LA 3ZN0A 1AA7A 3OSGA 1MJBA 3BJ6A 1R71A 5D6FA 2VBXA 1YIJI 3Q3SA 2E1MB 3WGGA 1UG2A 4PJMA 4IHTA 4UB8C 4RB2C 1H8AC 4MTDA 2VQGA 2E1MC 2DA1A 3I64A 4HRIA 4A3MJ 2D1HA 4ENKA 3TKYA 1IV6A 2JA2A 1O3TA 4OMYA 2DU9A 2R5ZA 3SZGA 1K83J 2K9LA 4L18B 3CCVI 3RI4A 1N25A 1OLTA 4EEFG 1KA8A 3C2HA 2JN6A 1QGPA 2OV7A 2HYGD 3LSIA 3C7JA 1XGOA 3O3KA 2M9HA 1FT9A 1FIPA 4XLPF 5JLWA 2DA5A 3LQRA 2IGMA 3E6MA 5FKKA 2DA3A 2DN0A 2JVGA 4I0BA 4PJ0C 2RREA 2WAFA 3JRIA 1V5GA 2VJ5A 2GM4A 5D6EA 2HXIA 3DPLC 1HW5A 1MJ9A 2DXIA 3H0GJ 2XHKA 4UY8I 1OJLA 3SYTA 2E1NA 3GWZA 1JKQC 3V8KA 3K9TA 1VQ9I 3ASOH 3ZMSA 2ESHA 2E1OA 2KL4A 2XVCA 3CC7I 4XLHA 3S16J 3SZPA 3DKYA 1FC3A 4ZZLA 1MH4A 2DW4A 1STZA 4NB5A 4XN3A 4YIFA 5J6XA 2QQBA 3PNYA 2R3SA 4KICA 1T0FC 3KYCB 4JK1X 4I98B 4XLCA 2LKSA 4IQ4A 3BG6A 2R7FA 4MTEA 2LKPA 4HQEA 1DPUA 2R7XA 2LR8A 2BVMA 4ZDOA 4IXAA 4Y4RA 2JA5J 2DODA 3U1DA 2KISA 3DP7A 4ITVA 4HF0A 3RZDJ 1D8KA 2D2WA 3OL3A 1MD0A 4M6VA 5TJJA 3HOSA 2X6YA 3HOWJ 4HF1A 1DGRM 3CUOA 4KMUX 4CA0A 2QZ8A 3FXKA 5F08A 3LL7A 2QCOA 3OYDA 3K4CA 3S2DJ 1ZKGA 4PUSA 4A2UA 1FLIA 2MC3A 3ZQ7A 3AAFA 2ECBA 1DU0A 1O3QA 1B9NA 2XSDC 2RGVA 4HYEA 2NS7A 2JTVA 2R7ZJ 1VQOI 1U3EM 5FFXA 2A6TA 2OPTA 1BI2A 2X1EA 4CCMA 4AVPA 1D1AA 4RGXA 5JR3A 4J19A 5E1WA 1IRGA 3K70C 4XIDA 1FYMA 3OR1C 1WJBA 3F8BA 2LLKA 1S7EA 5JI6A 3ROUA 2Q1ZB 4LK1F 1OCZH 1S6LA 1E3OC 4N9IA 1ETOA 3JSPA 2QENA 3R61A 3U1KA 4YFXF 2VXDA 2HDDA 4QLCU 3VYTB 4XLAA 4C3JJ 1SFOJ 3TO9A 1ZN2A 4KIGA 1IW7F 2ZMEB 4B4CA 2VC1A 1XSDA 4HDVA 3BOQA 1S9HA 4CXFA 3UR3C 3BR1A 4LG3A 3IH4A 3OMYA 1NH3A 4D7MA 2VJ4A 1OCTC 4M9SA 1XMAA 2UWMA 2E5NA 2Y0SN 5J3LA 3OYKA 3CMYA 2H1KA 3JRFA 1PDNC 3IRQA 2HOSA 3M9AA 2XAQA 3DXJF 4A0YA 5D8LB 3JAMZ 2M0MA 1W7PA 2K3PA 3IC7A 2GXAA 5H2FC 2DMNA 3DTIA 4RGSA 3W2AA 3DTEA 3ECOA 4EVIA 3WHBA 1ETYA 1FP2A 1JTYA 3C2BA 1QU3A 1X1AA 3I54A 2CO5A 4D0PA 2PLYA 1PP7U 4M9XA 2A05A 3HIFA 4IO9F 5KAIC 2BXYA 3H36A 2ZCWA 2R93J 3DBRB 2DFFA 3PNTA 4B47A 1I39A 3D5SC 5IT9K 1RIOH 5F6FA 3BCAA 4C3HJ 2Y0SA 1D8JA 3PQKA 2VUMJ 2ZMEA 2RAEA 4XN0A 3ONQA 2LF8A 4G6DA 3A02A 1AOYA 1BBYA 5DCFA 2OD5A 2R0QC 3FK7A 2VT2A 1VFCA 4J01A 2M45A 2K9QA 2EIKH 3W6VA 5ICFA 3WU2C 2FU4A 4BH9A 2KJCA 4X6AJ 1FP1D 3BCBA 1YW8A 2W85A 3J80K 4I7HA 1VF9A 3M7GA 5FROA 2QF7A 4IRIA 4XBFA 5JLXA 4BXUA 1MDMA 4OAZA 2Z1DA 2JUGA 1TQMA 1HA8A 5DV5A 1GXPA 4MGRA 2A68F 3HRUA 2TDXA 4NC7A 1I3QJ 2L54A 3D5RC 4E6KG 2IJLA 1IO2A 1Z67A 4MEYF 5HDNA 3ZGKA 1SC7A 5E17F 1TQIA 4HF2A 1X1PA 1R1VA 1Y0UA 2A69F 2OTLI 5FRMA 1ZELA 1MBEA 2UUZA 2ZFUA 1HKQA 2WV1A 4QPOA 4BJ6C 2DCEA 1S5LC 4JQFA 5E3MA 3QAHA 1LPQA 5KK1A 5JVGF 1WCMJ 4MFDA 4U7BA 2H94A 5J40A 1K78B 3H9GA 2Q8KA 3HHHA 5E3NA 3T1BA 4V2FA 1ZREA 1JI8A 1U5TB 1XDUA 3DQVC 4JX4A 4DYRA 1KONA 2FMLA 3UNGC 2DJNA 1YS6A 2BW3A 1FBSA 3L09A 3RKQA 3CMMA 1NHAA 1J75A 2E36A 5GTIC 5D5XB 3JRCA 2EA2A 2JWTA 4LLLA 1KQ8A 1BIBA 3BROA 4L0YB 3O6BB 1X19A 3TGNA 1TW3A 5M3FJ 3FBIB 4XKBA 4KUMA 4FHTA 2X1CA 1G2HA 2GXBA 5IP6A 2VONA 3K4MA 1PJRA 3GTKJ 1WFXA 2LK2A 4HV5A 3GO5A 3L2WA 1RNLA 3H35A 4BEHB 2HZTA 5FFZA 3BWGA 5FJ8J 3I4NJ 4M3EA 2LFBA 3U9GA 4A3LJ 2VB6A 3KZIC 5FD5A 3SFZA 4XKVA 3WU1B 3KETA 1APLC 3WTZA 1VNDA 3FMSA 1T38A 3M1EA 3ZPLA 4O5VA 3W3CA 2V1NA 5J4YA 2EK5A 3HJEA 3HHGA 2DFEA 4ZDLA 5EEAA 1MDMB 4G6TB 4IHVA 3QYEA 3SDGA 1XMKA 1SVMA 3LSKA 2K4JA 2K9MA 2X0LA 1N75A 1W4MA 1GVJA 3DF8A 3M8JA 3GLLA 1YOVB 3OS0A 1A6QA 4Y17A 2LH9A 3A03A 3IAM2 1FOKA 3K69A 2YX4A 3I9V2 2V9VA 4LG0B 3M8FA 3CF5F 1OCPA 3R0AA 2KIQA 5DTDA 2NVQJ 2MLKA 2MH9A 1DU6A 1LE8A 3ESWB 3SJMA 1ACIA 2IA1A 2LVSA 2F5VA 4FE4A 2EIMH 3H9QA 4XICA 3LSRA 3Q9SA 1HC8A 1BR4A 2E2JJ 2QSHX 2IA0A 5M5YJ 4Z2YA 1HXDA 1K79A 3BZ6A 1YRNA 5GAGJ 4U7DA 1T2KA 2R7UA 5E3OA 2WB1N 1MBHA 4AIJA 1IRFA 2F5FA 1R00A 3HEFA 2DPDA 1HKSA 4QSHA 4PGGA 2KIUA 2JUCA 1RZ4A 2EIJH 4K2EA 3N97A 3LMMA 5DS9A 1FIAA 1TLHB 5FGMA 4D5CA 3G4SI 1R4NB 5CVIA 1LDKB 2D1VA 2JT1A 2PN6A 5FKNA 4EQQA 5DDGA 4Q5SF 4IL6C 2MGQA 1LB2A 1J0RA 3G3ZA 4U87A 2IRFG 1D0XA 2F4OB 3VDXA 4I6ZA 1FX7A 2QYOA 4YIIA 2HXOA 1SANA 2LC2A 2M7AA 2FEZA 2VI6A 1ZRDA 2XIGA 4IOAF 4II3A 4CYCA 2QBYA 2A07F 2Z9OA 2O0YA 1IJWC 2HZDA 1WSUA 1XGNA 2NYXA 3U21A 1XPXA 1YJNI 1HF0A 4XQFA 4AVZA 2CW7A 1UAAA 4IPAA 2HWVA 2V1XA 3TW6A 2QM3A 2Y2ZA 3JRDA 3HTSB 2V7FA 3LA2A 2WWYA 4MO7A 1UJ8A 4PFOA 2FQ4A 3LQQA 3Q9VA 4HSRA 5F27A 5DCMA 3KZZA 1I1SA 5F0FA 1JUSA 2VQLA 3MEXA 1MBKA 1VQLI 1TWAJ 2CUJA 1H0MA 1LJ9A 3BPXA 1R9TJ 4BACA 4M3DA 3ERMA 3G1OA 1EH6A 2I8DA 5EG0A 2G7HA 3QPSA 1MKMA 5KHDA 3GZNB 2MABA 4NDLA 5CVRA 5J1YA 3PIOF 5CVJA 3IHUA 4LITA 5E1XA 4EGZA 3T8RA 5DYMA 3F3XA 5F04A 4I2OA 5IP9J 2D45A 2VKEA 1EKEA 2YSRA 2GBYA 4Q47A 1H9TA 2EZHA 3BR2A 3H1CA 5H20A 3RQ4A 3LA3A 2M0CA 1MIJA 4AM3A 3IP4B 4MQVA 2YU3A 4U0YA 2NRAC 4RM3A 4I02A 3U2RA 4OIPF 1YIOA 3BG3A 5IPAA 3S17J 1B1BA 2WC2A 3PUBA 2OZ6A 1W7PD 2OC6A 2VBZA 3QPLA 4WX9A 4H0EA 1VTNC 2FF4A 3NWTA 2F4IA 1X3UA 5DD4A 2M7BA 2P5KA 2FA5A 3OYFA 3OYAA 2L9VA 4CYDA 3IRRA 2VE9A 3QYFA 2OZUA 3T0YA 1W7PB 3QPHA 3AL0B 4Y52J 4CGZA 4XM3A 4A6DA 1SEUA 3HPGA 4MIMA 1BOBA 1WJAA 4E7SA 4BNCA 1O3SA 2EFNA 2AXLA 3FBNB 2AS5F 4A3BJ 1TWFJ 4AU7A 3ZMUA 1SAXA 3HC7A 3I0TA 4N4OB 2F5CA 2RC4A 1R4MB 4XLEA 2CU7A 2P4WA 3QPTA 3SDBA 5A2QZ 1YJ9I 2ADUA 4BUPA 4GFBA 3E6BA 3TP0A 1W36C 2WADA 1BOAA 2BE5F 2HR3A 3BLYA 4BDYA 1X2NA 2W7NA 2DYRH 1ZR2A 3HGGA 5KNLA 2BBYA 2NS8A 5D5WB 4YRVA 1ORKA 5BPIA 3C3WA 4OINF 5D4RA 1FYKA 4M74A 1F5TA 2YPRA 1P4XA 1UHWA 4MQ9F 3R4KA 2R4GA 3H3UA 3OOUA 4G7OF 1BW5A 1LDJA 3RKXA 1QQIA 3V8JA 2YX7A 1R5HA 2M2EA 4Y7NJ 2ZXJA 3V7CA 2ZFWA 3FF5A 2HEOA 3BTIA 3GX4X 3V8LA 2DQRA 5E8IA 2NOJB 3CTAA 4P1WA 2XKOA 1GLNA 2GIVA 2KJBA 2DDBA 3ABMH 2DA6A 5IYDJ 2DOAA 3DPTA 2KIFA 1JGSA 4D9JA 3TP3A 4CHUA 2ZNZA 4R1HA 1SMTA 2BZTA 2DK8A 1O3RA 3ZRGA 5FLXK 3FWEA 3O8HA 1UB9A 3CESA 4G6QA 2XAUA 4ZYAA 3Q0WA 2CV1A 3E5UA 4HW0A 3RDIA 3NRVA 2UXNA 3OS2A 3A2KA 1H89C 2JSCA 3VYRB 3CCJI 1MMSA 1OCCH 5AIQA 4AC0A 3IWFA 3S1RJ 2EILH 4P55A 1EH8A 2YR2A 4KDPA 1YYVA 2HKOA 2HOTA 2EA4A 3LFKA 1VQNI 4UVCA 5M5XJ 5K5RA 3OIOA 3K1PA 2DYSH 3QU3A 4Q4ZF 3KX2A 1JGGA 1FMVA 3CC4I 4C2UA 5DEQA 2W4SA 3PNVA 4YFNF 2IP2A 3TQNA 3IH3A 5LHHA 3CJQB 2XPVA 4F92B 1WVRA 3FXRA 1ZQ3P 2KZGA 2Z33A 3BG9A 1J9IA 2A6HF 4AIKA 3I5UA 4WXHA 2ZXIA 3KIOA 1IN7A 3HXLA 4L9NA 1PP8F 1R5GA 2NS0A 1YHQI 1BN5A 4HZFA 3LFUA 4ZH4F 2WAQA 5J47A 4JX5A 1JUMA 2UV1A 2AQFA 3GFLA 4XRMA 3IWZA 1BJZA 2EV6A 5BMZA 1HSJA 3GTQJ 1P2FA 2M8GX 3FXOA 3DBLB 3P9KA 4H4KC 2KFDA 3OYGA 2OQRA 3PIPF 1FOXA 3DEWA 1BC8C 2VC0A 3HL2A 4HNTA 2GA1A 3BTCA 5J8FA 2E19A 1HOMA 3I58A 2L9NA 1L0OC 1YG2A 3CCYA 2GOXB 2NOGA 1JT6A 2IW5A 1S7AA 2FSWA 1PVEA 2P6TA 3J81Z 1GT0C 1TNTA 2ICWG 4V19K 1WI9A 1YX5A 3IV5A 4EGYA 2WAQN 4XRSA 2QQ9A 3KCCA 1S7OA 2Y69H 1TT0A 2VOOA 1AHDP 2XGEA 3FMQA 2PMUA 1BL0A 5CVUA 2V26A 1ZLJA 1IXRC 3HM5A 4UXNA 5LFAA 1A6IA 3M8EA 3KEQA 1P4AA 3NWSA 3N05A 1XX5A 1YLFA 3SEQA 1I50J 1AKHA 2CUFA 1CF7B 5IOZA 3KYLA 1UFMA 2RKHA 2QEXI 4BYYA 2A3SA 2EV5A 3A0HC 3CLOA 2ACJA 5LLQA 2J5PA 5DM6F 4D1QA 2STTA 1XMXA 1U2WA 1YRNB 4HX7A 3MKLA 1EH7A 3M1CA 3IKVA 4A93J 2X9DA 3TO7A 1XSXA 1R58A 3K7AJ 1IRXA 1Z7UA 3EYIA 1GHCA 2QSFX 1YS7A 3T8TA 2BXZA 1X2MA 2BHYA 2DQLA 3CCMI 1JHFA 5CJ9A 3RPUD 3OWTA 1IF1A 1GVDA 2OA4A 2VQCA 1XCVA 1D1CA 4I99C 2MW8A 4CICA 5A2QK 2CWEA 1WWXA 4LOCA 4KIFA 1YQAA 5E1ZB 3ZCOA 5IY5H 1B8IB 2OAZA 2KRHA 3EQLF 1J7KA 1T33A 2LOOA 2AQEA 4IJAA 4HLYA 1RC9A 1S3JA 1WJDA 1NG7A 1G8XA 2W82A 1OCRH 2B9SA 2R7QA 4EJUA 3OL4A 4OMZA 2QVOA 3MD2A 2GA2A 2W00A 3BJOA 2Z16A 1BIAA 5IT3A 1F9NA 1YO5C 2IA2A 3K0LA 3F23A 1U8BA 5CLSA 3L2RA 1QVUA 1P6RA 2KPMA 4HV6A 3P7NA 1JKRC 3IL2A 1RUNA 1VZ0A 1FMWA 2JMWA 2XSJC 4J00A 2R7RA 3HPHA 2E71A 3JRBA 2E60A 3FM3A 2IVMA 2EBIA 4CDGA 1JUPA 2L2OA 1JJ6C 5HS7A 1Y56A 1FOYA 3EETA 2HDWA 4PSWA 3LSTA 4AWXB 2DMQA 3SQNA 5H6RA 1MBGA 3WGIA 3JR9A 2JK3A 4U88A 1QZEA 4IEJA 1ENHA 1V5EA 3GUDA 1OR7C 5EEGA 4E7HA 1IN8A 1USTA 1Z21A 5GAEJ 5L3GA 1MW7A 4XRFA 2IAIA 3MN2A 1Y1VJ 4FX4A 2L9RA 3QP5A 2ZJQF 2V4JC 4U0VA 3Q0UA 1WGXA 2JJ7A 2IS2A 1SD7A 4CCLA 1QA6A 2LREA 3CDIA 3K1MA 2YUSA 2LMDA 4UUTA 3CMEI 1ODDA 3S2HJ 5EYRA 2R5YA 4M6YA 5LRRA 4YFKF 2Y48A 4Y33A 4BY1J 2X6XA 3GCMA 1ULYA 3K6GA 4RGUA 1LE8B 3C18A 4LGWA 2CG4A 4IX7A 5AIPA 3K70D 1PUFA 3BT9A 3IH2A 1IZ1A 4EM1A 3VB2A 2ZMEC 1YW9A 1KQ9A 2QKLB 3KP2A 1B72A 1W1WE 3OYCA 2MA3A 1Z3XA 2HTSA 3WTYC 5D4SA 1ON2A 2DTZA 3OYMA 4OIOF 3FXUA 2BY0A 2CMPA 3PSFA 3SFIA 4A0XA 2XPUA 1R1TA 2CUZA 1G3SA 2L0KA 2VKHA 3CUQB 3RSNA 2ME0A 1KYZA 4IF4A 1IAWA 1LNWA 4DZPA 3RTRA 1TBXA 2V9KA 3LOCA 4B3AA 3G2BA 5ICGA 3I59B 1JTXA 1I27A 2PMZA 1X3WB 3BTLA 3ABUA 4HSTA 3DEEA 2ELHA 2NNNA 2M8EA 1WJCA 5ICEA 2CQXA 2BY3A 2CSOA 3BP8A 3E6CC 2R5YB 4MEXF 1YFHA 4Y3OA 1I6XA 4CH7A 3CCEI 4A3FJ 3SHFA 1ZK8A 3F6OA 3F6VA 4O3MA 2F5EA 2MFZA 1YITI 3E6DA 4PZJA 5JHUA 2GWRA 4A12A 4N9HA 4Q48A 4LG0A 4KMFA 1LVKA 3EUHC 2KT0A 2XAFA 4LK0F 5LGUA 3EUAA 1EA3A 4RS8A 1ZAOA 1MGTA 1R22A 1MJAA 3F8CA 4BGDA 1EV7A 4GXOA 3ERED 2KMUA 3CJTB 4MFEA 1Y0NA 4PCQA 4RDUA 5DUIA 2ZKZA 1BW6A 3OIQA 3S1NJ 2R7WA 2PFBA 4PSXA 3ZQQA 5J8CA 2VIXA 3LAJA 1W5TA 3QU6A 2WAEA 3CO6C 1FSEA 3GTGJ 4ON0A 5IYCJ 3BR0A 4LIVA 1IXSB 2FNPA 2DBBA 1TC3C 3R60A 1QHHD 1VI0A 3L1PA 5FLXZ 3KP5A 5LEKA 3WTUC 3TBIA 4ZZDA 1GDTA 4EM0B 2LBFB 4NUBA 2V9PA 3MKYB 2CQNA 3A1YA 3QYBA 1U6GA 3I56I 4BHCA 2CJJA 2HOEA 2EFWA 2LD5A 2VJJA 5K7FA 1N77A 1WJ5A 2EQRA 3FKIJ 4AYBN 4UVBA 2STWA 1D0ZA 2LKXA 3CCQI 5CQEA 3KEYA 5B1AH 1D5YA 2AO9A 1BI3A 3FDYA 3V7RA 3H92A 2J5OA 4ENNA 4MLOA 3S14J 5BOXA 1KYWA 3H3VK 2QA4I 1BI0A 4AIDA 1X1DA 2FBHA 2EZLA 1ETVA 2IS6A 5GPCA 5D5VB 2EV0A 1NTCA 2LF7A 2CRGA 4B09A 1XCBA 3I55I 3QWLA 1IN4A 2RQQA 3C2GA 4FISA 1TL8A 1VQKI 4EM2A 2DLLA 2Y31A 2VN2A 2HGCA 1SFEA 4JP0A 3ZMTA 1T8IA 3ZR8X 2MBFA 1G4DA 5EEHA 4KYWA 1K6OA 2BHZA 2ECCA 4RAGA 2X1DA 3WGHA 4S05A 1VQMI 1ZG3A 3CCSI 5DD8A 2P81A 3ZQHA 3H5AA 5ILUA 1OQYA 3RQIA 1D5VA 3FX3A 1YW7A 2YU9J 3GFJA 5KVRA 1ZARA 3WTSC 1DP7P 1FY7A 1WZ2A 4BQAA 4BXFA 3D0SA 3WTWC 4DGWB 1XDSA 4KN4X 2IXSA 3ZQGA 1TWHJ 1QVTA 3ZQCA 4P9FA 2K86A 1GXQA 2W84A 4CCKA 4F52A 2V6CA 3PUFA 2WTEA 5EZHA 5B1BH 6PAXA 2H09A 1ZR4A 5J1RA 5FLVA 3J80Z 4M73A 3GW2A 2P8TA 3WG7H 4A5MA 3SEZA 4A3CJ 1HW2A 3FHZA 3AFHA 1XGSA 3H0DA 3CDLA 3BQYA 1LDDA 4JX6A 3ZP5A 1QZZA 1A04A 2E5ZA 4RLQA 3GZ5A 2ZSHB 1Y6IA 3CZ6A 4HAMA 3G6EI 3T5XA 3F22A 1FWZA 1AKHB 2BY2A 1D3YA 4DQ2A 2V1UA 3ML6A 2F6CA 2EFOA 1B59A 1Z77A 1MNMC 4Y15A 1X58A 1U0JA 1O4XA 4ESJA 1SFXA 2HVSA 2WBMA 3DPUA 2EFQA 3ASNH 2O9LA 2GZWA 2VODA 1G6NA 2ESNA 4L5EA 3PO2J 1MSFC 1JHHA 1DGWY 2PJRB 4GYIA 4IKFA 3K1NA 3REOA 2QKMB 5K5QA 4IHWA 4IRGA 2RNJA 2HNHA 5L3EA 4BBRJ 2DO7A 2JZYA 4G94A 3WTTC 2PG4A 2R7OA 2V6EA 3QP6A 3DCFA 2XAGA 4XLNF 2M30A 2KDZA 4II2A 3B73A 2IGKA 1TTYA 3NARA 4PFPA 3OYNA 5GADJ 4WCGA 1Z91A 5BPDA 2LG4A 1KU3A 4IHYA 3L00A 4S04A 2LP0A 3I4PA 1ZHFA 1E2XA 3VSKA 5C44J 3RPQA 2HQNA 3I71A 4DJAA 2L5QA 2A6EF 2BW3B 1IN6A 2K7LA 4BE1A 2VE8A 2MLGA 1M1EB 2IS1A 1U78A 1E0EA 1YX3A 4XK4A 3FIWA 2LTPA 3DFGA 2XGDA 2DT7B 3EPZA 3K10A 3ZOBA 1MMAA 4PGHA 3DKXA 5C4JJ 5CYVA 5K7HA 3JRAA 4RM2A 1MMDA 4S0HB 3S1QJ 1FTZA 3GTMJ 2L9SA 3VYSB 4YIRX 3K4KA 3MCZA 1UG0A 4O6JA 1O7FA 2XUBA 1MH3A 1KGSA 3UKGA 4KJZA 3G71I 2O7OA 1R1UA 1QO0D 1W5CC 1XTAA 1A36A 2MYSA 2JA8J 3TL4X 4WK8F 1U5TA 3S3NA 5H6QA 1KU2A 2K5CA 2LRDA 2OBPA 4B3XA 4HNVA 4FE7A 3PQJA 3JRGA 1Z6TA 3LSPA 2L7FP 5IYBJ 5HDGA 1CF7A 1YE9A 1B9MA 3H5RA 3KP6A 5GTHC 4M72A 4L0ZB 3FXMA 2XASA 3HRTA 4YEJA 3RYRA 3KFWX 3KP3A 5E8GA 3GTPJ 1RKTA 3VODA 1RRJA 1F1ZA 3AG2H 2QQAA 4XORA 4ZYHA 3ECHA 1ZG5A 1TP4A 2OCEA 1SD4A 4BE2A 1ZLKA 4BU2A 3FISA 2F2EA 1HDDC 4LFUA 3P9CA 1R49A 5F64A 3ZMDA 1RPWA 3P9IA 3S32A 3BC8A 4KT5C 4UHTA 2NNYA 4FX0A 4WXDA 3ELKA 1K4SA 4XRSG 1B4AA 3OYEA 4NHJA 2W25A 4OWRB 3A01B 3LA7A 3BG5A 2DOFA 3HUGB 1XSVA 2X51A 2OJED 3WU0A 1S29A 4KNYA 2H8RA 4XMYA 2JRTA 3EYYA 3MAJA 1X4PA 2HOAA 3WHCA 2M4KA 3MFKA 1FZPB 4KFCA 3MVPA 1TT5B 2FOWA 3O8GA 1WKMA 3HOYJ 2E2HJ 2QUFA 4D5FA 1DP3A 1UZCA 3FKJA 2TRTA 3Q5FA 3Q0VA 1T39A 3FXQA 2ZXHA 2QSGX 3GF2A 4UB6C 2CH0A 2F4MB 2G0EA 3MKWB 1GV5A 4V2GA 4C3IJ 2KP6A 3VPRA 4RAFA 4AYBA 3PL8A 1CQTA 3GTLJ 4XLFA 3K4JA 4AIHA 1OCOH 1SD5A 3S1MJ 1JJ8C 3CD6I 2XF5A 1DPRA 2LDUA 3ZMZA 2MD0A 2R7SA 1LEBA 2Y0MA 2FBKA 2DMPA 3VSLA 3G73A 1T56A 3JREA 2LBFA 2VASA 3FXJA 1NK2P 1I6HJ 5HVQC 5IOYA 2BGCA 5B5EC 3GYHX 3WE2A 1UHMA 3GFIA 2V1DA 1Y8QB 4IVNA 2RNGA 3A0BC 4XKWA 2GOMA 3TW7A 4GO1A 4QIWN 1GV2A 2PBIA 4HBLA 4CCJA 3BY6A 2JVHA 1ONVA 5E18F 3OIPA 4C2TA 4HOBA 1W36D 2H6BA 3MZ8A 4QWQA 3HOVJ 1KU9A 2HS5A 3WG9A 5J4VA 2BYVE 1PYVA 3DEUA 5F0HA 1RUOA 2CW8A 4F93B 2ID3A 3BDDA 1AU7A 4HPQA 2LY2A 2QWWA 3FMRA 4KN7X 1BJAA 4E4HA 4HNUA 3HOZJ 2W48A 4N4NB 1Y1WJ 1JT0A 2MC4A 4RLFA 3ZQIA 2BVLA 2VQHA 4C30A 1FBUA 1RKWA 2GXGA 1LVAA 1T98A 2KRFA 3HSRA 4EJTA 2FD5A 2COMA 3K2ZA 2IT0A 2O5RA 3AG1H 1XN7A 1Z1DA 3HGYA 2RQPA 2CQKA 2BOLA 2H6CA 3TEDA 4FQGA 4HDUA 3CC2I 1WPKA 1JXSA 2I10A 3RKWA 2JSPA 5HLIA 4G8XA 4ZDPA 3R0JA 4I76A 4XONA 3G1LA 3LWFA 4P96A 2XB0X 2C6YA 2Y9YA 4I01A 3OYJA 4BKXA 1I5ZA 2IPQX 2M3AA 1VQPI 3MQ0A 3CCRI 5FKMA 2O8KA 2BV6A 2L7ZA 3N4MA 1OKRA 2HU9A 3V42A 3OYLA 1D0YA 2DT6A 3CUQA 2ETHA 1Y8RB 1TWGJ 1Q1HA 2HQRA 1IGNA 1XS9A 2WB1A 3QQAA 2L3DA 2ZXWH 5HODA 2QGUA 5M3MJ 2O8XA 1R7JA 4I09A 2IGNA 5EZGA 5JVTA 4F7ZA 2NVUB 2NAZA 3PJRA 4WWCA 1VQ8I 1I3AA 4LB5A 2AHQA 4ANJA 1HSTA 3GEZA 1IDYA 2WY7Q 3BPVA 4HX8A 5HOOA 3NAUA 4HEA2 2FUG2 2ZC2A 4F91B 1E3PA 1MMGA 4W97A 2ISZA 2Z5UA 1OISA 2E1CA 4BHBA 3F8MA 2P0WA 3E97A 5ERIA 1WHUA 2Q0OA 3SZTA 2ELKA 3I59A 3HKZN 1XD7A 2FRHA 2XGXA 3BR5A 1Y39A 4U0WA 4E7IA 1IN5A 1RI7A 4DOZA 3FK6A 2H1LA 1KU7A 3VOEA 2O3FA 4F3QA 3AG4H 1MNDA 3EUKL 5ILSA 4DZJA 3S3OA 1G3WA 4EMSA 1K4TA 2CQQA 1Z7LA 3CUQC 3BQZA 4ZYEA 3GMEA 3BG7A 3HOTA 1OMIA 2L4AA 2CV0A 2M1BA 3DLAA 5L3BA 3DV8A 2XF6A 2XPWA 2ZNYA 4OIQF 1K6YA 2JA7J 1G3TA 3B6AA 1J09A 5JFRA 3BR6A 3KLNA 1WJFA 1MZBA 2NXNB 2K9SA 4CSWA 2VLAA 4DYCA 1Z05A 1OYIA 3WTVC 2IBDA 3IAS2 2NVXJ 3MZHA 4BDZA 1C0WA 4KISA 4OOIA 3WODF 4CZCA 1H88C 1YI2I 4B8XA 4XNFA 1F43A 2HPIA 4AUXA 2FJ1A 5IT9Z 1USSA 2ZJPF 2B63J 4L9JA 1SD6A 5DCMB 1R36A 2A5WA 3KE2A 2P6SA 4RA2A 4M6XA 5J1UA 3RKYA 3X2QH 1L3LA 4M3GA 2XB5A 1BC7C 2OUMA 3CF2A 1XC5A 3K2AA 2DTRA 2HKXA 2JA6J 1NK3P 2K02A 1T0FA 5FD6A 5C4XJ 1QPIA 4PDKA 1TZLA 2ZJRF 3KEOA 3DWLE 2F48A 1H9GA 2DA7A 1Z0XA 1P4WA 1ZRCA 1P7JA 3ISPA 3LNQA 1WRJA 3BZCA 1TW2A 1KQ0A 3PFIA 3KLOA 4BBSJ 1IXCA 3HYIA 2R92J 2XF7A 2Z3YA 1CGPA 2M87A 1REPC 5GAHJ 3BJAA 3ZN1A 2QBYB 1GUUA 3J7AO 4BJ5C 2PMZN 2VBWA 4F55A 4E7KA 1ZRFA 4IOCF 2Q2EB 3TDZC 5HDKA 2CYYA 5HLTA 5FO5A 2FX0A 2GAUA 4PJLA 1T08B 2Z2SB 1U5TC 1ZTRA 3QRFF 3L7WA 3CJNA 4RB1A 4XR6A 2HYJA 2VPRA 4X1EA 1FSHA 5LEJA 3GTJJ 3HOUJ 3JRHA 5GPAA 1LKXA 3NEUA 2MH2A 3TOAA 4ASNA 4B44A 1B8IA 4KIBA 3HG9A 5E79C 5EJCA 1IC8A 2HDCA 4G9YA 3P5JA 2PJPA 2Y9ZA 2HQAA 2RV8A 4NC8A 1VQ6I 1ETXA 2EZIA 2WY8Q 2H27A 4B48A 2Y30A 2R7VA 2XAHA 3HSEA 2EPFA 5K7ZA 2EINH 3ABKH 1XG1A 4GRIA 5FB2A 2L7KA 2JQ7A 1P9QC 2YS9A
chains in the Genus database with same CATH topology
3NQOA 1QBJA 3RPUA 3V4GA 2E7WA 2W24A 3GVAA 2JPBA 4L5JA 2RN7A 1OR7A 2B0LA 3RIRA 5L3CA 3W6JB 4HQMA 4L5IA 2FMYA 1IUYA 2R7DA 4N0BA 4GCVA 2UZKA 5HS8A 4LLNA 2VT3A 4R79A 3KP7A 3WTXC 3I53A 2P5VA 4UV9A 5K5OA 4P9UA 3H3ZA 2L02A 5HLGA 5LHGA 2PQ8A 1V3FA 1E17A 3DKWA 4GGGA 3SXYA 4JBAA 4HLXA 2MD5A 1V4RA 3V7SA 4EJOA 1HBXG 2DAOA 1G3YA 4ETSA 2LNBA 3F8NA 1K78A 3OOPA 2PEXA 2XRNA 3MZYA 5K1YA 2EWNA 2UXXA 4YG2F 3RYPA 4MHGA 3JTGA 4RAYA 4ESFA 2XROA 2WV0A 1BM9A 4WF2A 4LB6B 2O61A 2RVCA 2FNAA 1Z9CA 1HKTA 2P5LC 5D5UB 1FNNA 3ZMVA 3HRSA 1WQ2A 1F4KA 4XSZF 2LSOA 2FXAA 3HSFA 4RGRA 2CGPA 1QZYA 3MWMA 4DNCA 2FOKA 2HTJA 4RAZA 1UCRA 5D8KB 5LGTA 3VFZA 4BHPA 2L4MA 3F21A 3HUGA 2P7VB 5ILVA 3RJPA 5L3FA 2ISYA 1Z6RA 2XAJA 4ZYDA 3VEPA 2VXZA 3J81K 2F5DA 4L9TA 2CW0F 2VOPA 3JAMK 2A61A 1YTYA 4AD9A 2G7UA 2DI3A 3F8FA 2DT5A 3E3VA 2EFPA 1U8RA 2JPCA 4ENMA 2EJRA 4MNUA 2W57A 2EB7A 2XV4S 4M71A 1W5SA 1TNSA 4UVAA 4UV8A 3E5QA 3WE3A 2P7CB 2PMHA 4A6EA 1ZYRF 5BQTA 1ZG1A 1T6SA 3EUHA 2RDPA 4RB0A 3GLXA 2FE3A 2KIMA 4EV0A 2X4HA 4M9ZA 3ABTA 2K4BA 2ZBKA 3IKTA 1DDNA 1LEAA 4LJZF 3CDHA 1J59A 4TV7A 1PUEE 1OYWA 1BI1A 4GYGA 4G7HF 4Y13A 5E20A 2QLZA 1K7AA 2FBIA 2M5WA 4LLGF 2XKPA 4E70A 2O6GE 4R8HA 4P5OA 4ESBA 1TQPA 1FPQA 2HYFA 1QPMA 1ZGJA 3L2CA 3GFMA 3GZ6A 3TOBA 1R23A 3JSOA 1HQCA 4ENJA 2FQ3A 2ZJ2A 4L9VA 3L9FA 3HTUA 5ICCA 3R6SA 4IRHA 1LQ1A 2L01A 2ZO4A 3JW4A 1XGMA 5LBQA 4EJVA 1I1GA 4IHSA 4CZZA 4EJWA 2O03A 3TDUC 3FZVA 2E7XA 5DUKA 4ZYGA 5LRSA 2K27A 4NQWA 4HA8A 1SFUA 3KP4A 4OU0A 2A5YB 2KKOA 4WXCA 5HLHA 1FBQA 1OYYA 2Z99A 4LMYA 5AONA 1FYLA 2OQGA 3F72A 3OV8A 4XSXF 1ZGAA 1QNTA 5CVVA 3EDPA 3ULQB 5LHIA 3TO6A 2VBYA 2Y75A 2GQQA 4BAYA 4CO8A 5L3DA 1JE8A 1B6AA 4KA4A 5HS9A 1O7LA 5LGNA 3W6KB 4OIRF 1XB4A 2V79A 1P92A 1DUXC 2DFIA 2G9WA 4UUVA 1ON1A 2Q2EA 1SMYF 4FT8A 4UNOA 1ZH5A 1O57A 2DK5A 3C1DA 3KZYA 1J2XA 4A5NA 1AWCA 2DPUA 2HFHA 1S8NA 2CFXA 5TRDA 5ED4A 3B02A 3JTHA 1OPCA 3S2WA 4A0ZA 2BEOA 3CO7C 1HW1A 2OU2A 2PI0A 3LAPA 5BS6A 4G7ZF 1J5YA 4RB3C 3QOPA 3E5XA 5F1RA 3FM5A 4HX4A 3HRMA 4I0AA 3COAC 3GXOA 4LD5A 3O2PE 3D5LA 3ZN0A 1MJBA 3BJ6A 5D6FA 2VBXA 3WGGA 4IHTA 4RB2C 4MTDA 3I64A 2D1HA 4ENKA 3TKYA 1O3TA 4OMYA 2DU9A 4L18B 3RI4A 1KA8A 1QGPA 2HYGD 3C7JA 1XGOA 3O3KA 1FT9A 4XLPF 3LQRA 3E6MA 4I0BA 5D6EA 3DPLC 1HW5A 1MJ9A 2XHKA 2E1NA 3GWZA 3V8KA 3K9TA 3ZMSA 2ESHA 2XVCA 3SZPA 1FC3A 4ZZLA 2DW4A 1STZA 4NB5A 4YIFA 5J6XA 2QQBA 2R3SA 4KICA 4JK1X 4I98B 2R7FA 4MTEA 2LKPA 4HQEA 1DPUA 4IXAA 3U1DA 3DP7A 4HF0A 1D8KA 2D2WA 1MD0A 5TJJA 3HOSA 4HF1A 3CUOA 4KMUX 2QZ8A 4A2UA 1FLIA 2MC3A 3ZQ7A 3AAFA 1O3QA 1B9NA 2RGVA 4HYEA 2JTVA 1U3EM 5FFXA 1BI2A 4AVPA 4RGXA 5JR3A 5E1WA 1IRGA 1FYMA 3F8BA 5JI6A 3ROUA 4LK1F 1S6LA 4N9IA 3JSPA 2QENA 3R61A 4YFXF 4QLCU 3TO9A 1ZN2A 4KIGA 1IW7F 2ZMEB 2VC1A 1XSDA 4HDVA 3BOQA 4CXFA 4M9SA 1XMAA 2UWMA 1PDNC 3IRQA 3M9AA 2XAQA 3DXJF 4A0YA 5D8LB 3JAMZ 1W7PA 3IC7A 4RGSA 3ECOA 4EVIA 1FP2A 3I54A 2CO5A 4D0PA 2PLYA 1PP7U 4M9XA 3HIFA 2ZCWA 5IT9K 1RIOH 5F6FA 1D8JA 3PQKA 2ZMEA 2LF8A 4G6DA 1AOYA 1BBYA 5DCFA 2OD5A 2VT2A 2M45A 5ICFA 2FU4A 4BH9A 2KJCA 1FP1D 1YW8A 2W85A 3J80K 4I7HA 3M7GA 4IRIA 4XBFA 4BXUA 1MDMA 1TQMA 5DV5A 1GXPA 4MGRA 2A68F 3HRUA 2TDXA 2L54A 2IJLA 4MEYF 5HDNA 5E17F 1TQIA 4HF2A 1R1VA 1Y0UA 2A69F 1HKQA 4JQFA 3QAHA 5KK1A 4U7BA 2H94A 1K78B 2Q8KA 3HHHA 3T1BA 1ZREA 1U5TB 1XDUA 3DQVC 2FMLA 1YS6A 1FBSA 3L09A 1NHAA 1J75A 5D5XB 2EA2A 4LLLA 1KQ8A 1BIBA 3BROA 4L0YB 3O6BB 3TGNA 1TW3A 4KUMA 4FHTA 2GXBA 2VONA 4HV5A 3GO5A 1RNLA 2HZTA 5FFZA 3BWGA 3U9GA 5FD5A 3SFZA 3WU1B 3KETA 3WTZA 3FMSA 1T38A 3M1EA 3ZPLA 4O5VA 2EK5A 3HHGA 1MDMB 1XMKA 2K4JA 2X0LA 1W4MA 1GVJA 3DF8A 4Y17A 1FOKA 3K69A 2YX4A 2V9VA 4LG0B 3M8FA 3R0AA 2MLKA 2MH9A 2IA1A 3Q9SA 2IA0A 4Z2YA 1HXDA 1K79A 3BZ6A 4U7DA 1T2KA 4AIJA 1IRFA 2F5FA 1R00A 2DPDA 1HKSA 4PGGA 2KIUA 1RZ4A 4K2EA 3N97A 1TLHB 5FGMA 5CVIA 1LDKB 2D1VA 2JT1A 2PN6A 4EQQA 4Q5SF 5DDGA 1LB2A 1J0RA 3G3ZA 2IRFG 1FX7A 2QYOA 4YIIA 1ZRDA 2FEZA 2XIGA 2QBYA 2A07F 2Z9OA 2O0YA 1WSUA 1XGNA 2NYXA 4IPAA 2HWVA 2V1XA 2QM3A 3HTSB 3LA2A 2WWYA 3LQQA 3Q9VA 5DCMA 3KZZA 1I1SA 3MEXA 1H0MA 1LJ9A 3BPXA 1EH6A 2G7HA 1MKMA 5CVRA 5CVJA 3IHUA 5E1XA 4EGZA 3T8RA 5DYMA 3F3XA 4I2OA 2D45A 2YSRA 4Q47A 1H9TA 5H20A 3LA3A 4MQVA 2YU3A 4U0YA 2NRAC 4I02A 3U2RA 4OIPF 1YIOA 1B1BA 2WC2A 2OZ6A 1W7PD 2VBZA 4WX9A 4H0EA 1VTNC 2FF4A 1X3UA 5DD4A 2P5KA 2FA5A 4CYDA 3IRRA 2VE9A 3T0YA 2OZUA 1W7PB 3QPHA 4CGZA 4A6DA 4BNCA 1O3SA 2EFNA 2AXLA 2AS5F 3ZMUA 1SAXA 3I0TA 2F5CA 2RC4A 2P4WA 3QPTA 5A2QZ 2ADUA 3E6BA 1BOAA 2BE5F 2HR3A 2BBYA 5D5WB 5BPIA 3C3WA 4OINF 5D4RA 1FYKA 4M74A 1F5TA 2YPRA 1P4XA 1UHWA 4MQ9F 3R4KA 3H3UA 4G7OF 1LDJA 3RKXA 1QQIA 3V8JA 2YX7A 1R5HA 2ZXJA 3V7CA 2ZFWA 3FF5A 2HEOA 3GX4X 3V8LA 2DQRA 5E8IA 3CTAA 2XKOA 2GIVA 2KJBA 3DPTA 2KIFA 1JGSA 4CHUA 2ZNZA 4R1HA 1SMTA 2DK8A 1O3RA 5FLXK 3FWEA 1UB9A 4G6QA 3E5UA 4HW0A 3RDIA 3NRVA 2UXNA 2JSCA 5AIQA 3IWFA 4P55A 1EH8A 2YR2A 4KDPA 1YYVA 2HKOA 2EA4A 3LFKA 4UVCA 5K5RA 3K1PA 3QU3A 4Q4ZF 5DEQA 4YFNF 2IP2A 3TQNA 5LHHA 3FXRA 2Z33A 1J9IA 2A6HF 4AIKA 3I5UA 4WXHA 1IN7A 4L9NA 1PP8F 1R5GA 2NS0A 1BN5A 4HZFA 4ZH4F 3GFLA 3IWZA 2EV6A 5BMZA 1HSJA 1P2FA 3P9KA 2OQRA 1BC8C 2VC0A 2GA1A 5J8FA 3I58A 1L0OC 1YG2A 2IW5A 1S7AA 2FSWA 2P6TA 3J81Z 1TNTA 1WI9A 4EGYA 2QQ9A 3KCCA 1S7OA 2VOOA 3FMQA 2PMUA 5CVUA 1ZLJA 1IXRC 4UXNA 3M8EA 3KEQA 1P4AA 1YLFA 1CF7B 1UFMA 2RKHA 4BYYA 2A3SA 2EV5A 3CLOA 2ACJA 5LLQA 2J5PA 2STTA 1U2WA 4HX7A 1EH7A 3IKVA 3TO7A 1XSXA 1R58A 1Z7UA 3EYIA 1GHCA 3T8TA 1YS7A 2DQLA 1JHFA 5CJ9A 1IF1A 2OA4A 1XCVA 4CICA 5A2QK 2CWEA 1WWXA 5E1ZB 4KIFA 1YQAA 2OAZA 3EQLF 1J7KA 4IJAA 4HLYA 1S3JA 4EJUA 4OMZA 2QVOA 2GA2A 3BJOA 1BIAA 5IT3A 1F9NA 1YO5C 2IA2A 3K0LA 3F23A 5CLSA 1P6RA 1RUNA 4HV6A 3P7NA 3IL2A 3FM3A 2IVMA 4CDGA 5HS7A 3EETA 3LSTA 4AWXB 3SQNA 5H6RA 3WGIA 4U88A 3GUDA 5EEGA 1IN8A 1USTA 5L3GA 4XRFA 4FX4A 3QP5A 4U0VA 1SD7A 3K1MA 1ODDA 4M6YA 5LRRA 4YFKF 2Y48A 4RGUA 1ULYA 3C18A 4LGWA 2CG4A 5AIPA 1IZ1A 4EM1A 3VB2A 1YW9A 1KQ9A 3KP2A 2MA3A 2HTSA 3WTYC 5D4SA 1ON2A 4OIOF 3FXUA 4A0XA 1R1TA 1G3SA 3CUQB 1KYZA 4IF4A 1IAWA 1LNWA 3RTRA 1TBXA 5ICGA 3I59B 1I27A 3ABUA 2ELHA 2NNNA 2M8EA 5ICEA 2CSOA 3BP8A 3E6CC 4MEXF 1YFHA 1I6XA 3SHFA 3F6OA 3F6VA 4O3MA 2F5EA 3E6DA 4PZJA 5JHUA 2GWRA 4A12A 4N9HA 4Q48A 4LG0A 4KMFA 2XAFA 4LK0F 5LGUA 4RS8A 1ZAOA 1MGTA 1R22A 1MJAA 3F8CA 1EV7A 4GXOA 3ERED 4PCQA 5DUIA 2ZKZA 2PFBA 5J8CA 3LAJA 1W5TA 3QU6A 3CO6C 1FSEA 4ON0A 1IXSB 2FNPA 2DBBA 3R60A 5FLXZ 3KP5A 5LEKA 3WTUC 4ZZDA 4EM0B 1U6GA 4BHCA 2HOEA 2EFWA 4UVBA 2STWA 1BI3A 3V7RA 3H92A 2J5OA 4ENNA 5BOXA 1KYWA 1BI0A 2FBHA 5D5VB 2EV0A 2LF7A 4B09A 1XCBA 1IN4A 4EM2A 2DLLA 1G4DA 2VN2A 3ZMTA 2HGCA 1SFEA 2MBFA 5EEHA 4KYWA 1K6OA 3WGHA 4S05A 1ZG3A 5DD8A 5ILUA 1D5VA 3FX3A 1YW7A 3GFJA 5KVRA 1ZARA 3WTSC 1DP7P 1FY7A 4BQAA 3D0SA 3WTWC 1XDSA 4KN4X 4P9FA 2K86A 1GXQA 2W84A 2V6CA 2WTEA 6PAXA 2H09A 3J80Z 4M73A 3GW2A 2P8TA 4A5MA 1HW2A 3FHZA 1XGSA 1LDDA 3ZP5A 1QZZA 1A04A 3GZ5A 4HAMA 3T5XA 3F22A 1FWZA 4DQ2A 1D3YA 2V1UA 3ML6A 2EFOA 1B59A 4Y15A 4ESJA 1SFXA 2EFQA 2GZWA 2VODA 1G6NA 2ESNA 1JHHA 4GYIA 3K1NA 3REOA 5K5QA 4IRGA 2RNJA 5L3EA 2DO7A 2JZYA 4G94A 3WTTC 2PG4A 3QP6A 2XAGA 4XLNF 2M30A 3B73A 1TTYA 4WCGA 1Z91A 5BPDA 1KU3A 3L00A 4S04A 3I4PA 1ZHFA 1E2XA 3RPQA 2HQNA 3I71A 2A6EF 1IN6A 2K7LA 2VE8A 2MLGA 1U78A 3DFGA 4PGHA 5CYVA 3MCZA 4O6JA 1O7FA 2XUBA 1KGSA 1QO0D 1R1UA 4WK8F 1U5TA 5H6QA 1KU2A 2OBPA 3PQJA 1Z6TA 5HDGA 1CF7A 1B9MA 3KP6A 4L0ZB 4M72A 2XASA 3HRTA 3RYRA 3KFWX 3KP3A 5E8GA 3VODA 1F1ZA 2QQAA 4ZYHA 3ECHA 1ZG5A 1SD4A 1ZLKA 2F2EA 4LFUA 3P9CA 5F64A 3ZMDA 3P9IA 4KT5C 2NNYA 4UHTA 4FX0A 4WXDA 3ELKA 1B4AA 4NHJA 2W25A 3LA7A 1XSVA 3WU0A 1S29A 4KNYA 2JRTA 3EYYA 3MAJA 3MFKA 1FZPB 4KFCA 1WKMA 2QUFA 3Q5FA 1T39A 3FXQA 3GF2A 4AIHA 1SD5A 1DPRA 2LDUA 3ZMZA 1LEBA 2Y0MA 2FBKA 3G73A 5HVQC 2BGCA 3GYHX 3WE2A 1UHMA 3GFIA 2V1DA 4IVNA 4GO1A 2PBIA 4HBLA 3BY6A 1ONVA 5E18F 4HOBA 2H6BA 4QWQA 1KU9A 2HS5A 3WG9A 2BYVE 3DEUA 1RUOA 3BDDA 3FMRA 2QWWA 4KN7X 1BJAA 1FBUA 2GXGA 2KRFA 1LVAA 1T98A 3HSRA 4EJTA 2COMA 3K2ZA 2IT0A 1XN7A 1Z1DA 2RQPA 2CQKA 2H6CA 4HDUA 1JXSA 3RKWA 5HLIA 4G8XA 3R0JA 3LWFA 4P96A 2C6YA 4I01A 1I5ZA 2IPQX 3MQ0A 2BV6A 3N4MA 1OKRA 3CUQA 2ETHA 1Q1HA 2HQRA 2L3DA 2O8XA 1R7JA 4I09A 5JVTA 4F7ZA 2NAZA 4WWCA 4LB5A 1HSTA 3GEZA 4HX8A 3BPVA 5HOOA 2ISZA 2Z5UA 2E1CA 4BHBA 3F8MA 3E97A 5ERIA 2Q0OA 3SZTA 3I59A 1XD7A 2FRHA 2XGXA 4U0WA 1IN5A 1RI7A 1KU7A 3VOEA 2O3FA 5ILSA 1G3WA 4EMSA 3CUQC 4ZYEA 3HOTA 1OMIA 2L4AA 2M1BA 5L3BA 3DV8A 2ZNYA 4OIQF 1G3TA 5JFRA 3KLNA 1MZBA 1Z05A 1OYIA 3WTVC 3MZHA 1C0WA 4OOIA 3WODF 4B8XA 5IT9Z 1USSA 4L9JA 1SD6A 5DCMB 1R36A 3KE2A 2P6SA 4M6XA 3RKYA 1L3LA 1BC7C 2DTRA 2HKXA 2K02A 1T0FA 5FD6A 4PDKA 3KEOA 1H9GA 1P4WA 1ZRCA 3ISPA 1WRJA 1TW2A 1KQ0A 3PFIA 3KLOA 1IXCA 3HYIA 2Z3YA 1CGPA 2M87A 1REPC 3BJAA 3ZN1A 2QBYB 3J7AO 2VBWA 1ZRFA 3TDZC 5HDKA 2CYYA 5FO5A 2GAUA 1U5TC 3QRFF 3L7WA 3CJNA 4RB1A 1FSHA 5LEJA 3NEUA 2MH2A 3TOAA 4ASNA 4KIBA 2HDCA 4G9YA 2PJPA 2RV8A 2H27A 2XAHA 3HSEA 5FB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQO A;  1QBJ A;  3RPU A;  3V4G A;  2E7W A;  2W24 A;  3GVA A;  2JPB A;  4L5J A;  2RN7 A;  1OR7 A;  2B0L A;  3RIR A;  5L3C A;  3W6J B;  4HQM A;  4L5I A;  2FMY A;  1IUY A;  2R7D A;  4N0B A;  4GCV A;  2UZK A;  5HS8 A;  4LLN A;  2VT3 A;  4R79 A;  3KP7 A;  3WTX C;  3I53 A;  2P5V A;  4UV9 A;  5K5O A;  4P9U A;  3H3Z A;  2L02 A;  5HLG A;  5LHG A;  2PQ8 A;  1V3F A;  1E17 A;  3DKW A;  4GGG A;  3SXY A;  4JBA A;  4HLX A;  2MD5 A;  1V4R A;  3V7S A;  4EJO A;  1HBX G;  2DAO A;  1G3Y A;  4ETS A;  2LNB A;  3F8N A;  1K78 A;  3OOP A;  2PEX A;  2XRN A;  3MZY A;  5K1Y A;  2EWN A;  2UXX A;  4YG2 F;  3RYP A;  4MHG A;  3JTG A;  4RAY A;  4ESF A;  2XRO A;  2WV0 A;  1BM9 A;  4WF2 A;  4LB6 B;  2O61 A;  2RVC A;  2FNA A;  1Z9C A;  1HKT A;  2P5L C;  5D5U B;  1FNN A;  3ZMV A;  3HRS A;  1WQ2 A;  1F4K A;  4XSZ F;  2LSO A;  2FXA A;  3HSF A;  4RGR A;  2CGP A;  1QZY A;  3MWM A;  4DNC A;  2FOK A;  2HTJ A;  4RAZ A;  1UCR A;  5D8K B;  5LGT A;  3VFZ A;  4BHP A;  2L4M A;  3F21 A;  3HUG A;  2P7V B;  5ILV A;  3RJP A;  5L3F A;  2ISY A;  1Z6R A;  2XAJ A;  4ZYD A;  3VEP A;  2VXZ A;  3J81 K;  2F5D A;  4L9T A;  2CW0 F;  2VOP A;  3JAM K;  2A61 A;  1YTY A;  4AD9 A;  2G7U A;  2DI3 A;  3F8F A;  2DT5 A;  3E3V A;  2EFP A;  1U8R A;  2JPC A;  4ENM A;  2EJR A;  4MNU A;  2W57 A;  2EB7 A;  2XV4 S;  4M71 A;  1W5S A;  1TNS A;  4UVA A;  4UV8 A;  3E5Q A;  3WE3 A;  2P7C B;  2PMH A;  4A6E A;  1ZYR F;  5BQT A;  1ZG1 A;  1T6S A;  3EUH A;  2RDP A;  4RB0 A;  3GLX A;  2FE3 A;  2KIM A;  4EV0 A;  2X4H A;  4M9Z A;  3ABT A;  2K4B A;  2ZBK A;  3IKT A;  1DDN A;  1LEA A;  4LJZ F;  3CDH A;  1J59 A;  4TV7 A;  1PUE E;  1OYW A;  1BI1 A;  4GYG A;  4G7H F;  4Y13 A;  5E20 A;  2QLZ A;  1K7A A;  2FBI A;  2M5W A;  4LLG F;  2XKP A;  4E70 A;  2O6G E;  4R8H A;  4P5O A;  4ESB A;  1TQP A;  1FPQ A;  2HYF A;  1QPM A;  1ZGJ A;  3L2C A;  3GFM A;  3GZ6 A;  3TOB A;  1R23 A;  3JSO A;  1HQC A;  4ENJ A;  2FQ3 A;  2ZJ2 A;  4L9V A;  3L9F A;  3HTU A;  5ICC A;  3R6S A;  4IRH A;  1LQ1 A;  2L01 A;  2ZO4 A;  3JW4 A;  1XGM A;  5LBQ A;  4EJV A;  1I1G A;  4IHS A;  4CZZ A;  4EJW A;  2O03 A;  3TDU C;  3FZV A;  2E7X A;  5DUK A;  4ZYG A;  5LRS A;  2K27 A;  4NQW A;  4HA8 A;  1SFU A;  3KP4 A;  4OU0 A;  2A5Y B;  2KKO A;  4WXC A;  5HLH A;  1FBQ A;  1OYY A;  2Z99 A;  4LMY A;  5AON A;  1FYL A;  2OQG A;  3F72 A;  3OV8 A;  4XSX F;  1ZGA A;  1QNT A;  5CVV A;  3EDP A;  3ULQ B;  5LHI A;  3TO6 A;  2VBY A;  2Y75 A;  2GQQ A;  4BAY A;  4CO8 A;  5L3D A;  1JE8 A;  1B6A A;  4KA4 A;  5HS9 A;  1O7L A;  5LGN A;  3W6K B;  4OIR F;  1XB4 A;  2V79 A;  1P92 A;  1DUX C;  2DFI A;  2G9W A;  4UUV A;  1ON1 A;  2Q2E A;  1SMY F;  4FT8 A;  4UNO A;  1ZH5 A;  1O57 A;  2DK5 A;  3C1D A;  3KZY A;  1J2X A;  4A5N A;  1AWC A;  2DPU A;  2HFH A;  1S8N A;  2CFX A;  5TRD A;  5ED4 A;  3B02 A;  3JTH A;  1OPC A;  3S2W A;  4A0Z A;  2BEO A;  3CO7 C;  1HW1 A;  2OU2 A;  2PI0 A;  3LAP A;  5BS6 A;  4G7Z F;  1J5Y A;  4RB3 C;  3QOP A;  3E5X A;  5F1R A;  3FM5 A;  4HX4 A;  3HRM A;  4I0A A;  3COA C;  3GXO A;  4LD5 A;  3O2P E;  3D5L A;  3ZN0 A;  1MJB A;  3BJ6 A;  5D6F A;  2VBX A;  3WGG A;  4IHT A;  4RB2 C;  4MTD A;  3I64 A;  2D1H A;  4ENK A;  3TKY A;  1O3T A;  4OMY A;  2DU9 A;  4L18 B;  3RI4 A;  1KA8 A;  1QGP A;  2HYG D;  3C7J A;  1XGO A;  3O3K A;  1FT9 A;  4XLP F;  3LQR A;  3E6M A;  4I0B A;  5D6E A;  3DPL C;  1HW5 A;  1MJ9 A;  2XHK A;  2E1N A;  3GWZ A;  3V8K A;  3K9T A;  3ZMS A;  2ESH A;  2XVC A;  3SZP A;  1FC3 A;  4ZZL A;  2DW4 A;  1STZ A;  4NB5 A;  4YIF A;  5J6X A;  2QQB A;  2R3S A;  4KIC A;  4JK1 X;  4I98 B;  2R7F A;  4MTE A;  2LKP A;  4HQE A;  1DPU A;  4IXA A;  3U1D A;  3DP7 A;  4HF0 A;  1D8K A;  2D2W A;  1MD0 A;  5TJJ A;  3HOS A;  4HF1 A;  3CUO A;  4KMU X;  2QZ8 A;  4A2U A;  1FLI A;  2MC3 A;  3ZQ7 A;  3AAF A;  1O3Q A;  1B9N A;  2RGV A;  4HYE A;  2JTV A;  1U3E M;  5FFX A;  1BI2 A;  4AVP A;  4RGX A;  5JR3 A;  5E1W A;  1IRG A;  1FYM A;  3F8B A;  5JI6 A;  3ROU A;  4LK1 F;  1S6L A;  4N9I A;  3JSP A;  2QEN A;  3R61 A;  4YFX F;  4QLC U;  3TO9 A;  1ZN2 A;  4KIG A;  1IW7 F;  2ZME B;  2VC1 A;  1XSD A;  4HDV A;  3BOQ A;  4CXF A;  4M9S A;  1XMA A;  2UWM A;  1PDN C;  3IRQ A;  3M9A A;  2XAQ A;  3DXJ F;  4A0Y A;  5D8L B;  3JAM Z;  1W7P A;  3IC7 A;  4RGS A;  3ECO A;  4EVI A;  1FP2 A;  3I54 A;  2CO5 A;  4D0P A;  2PLY A;  1PP7 U;  4M9X A;  3HIF A;  2ZCW A;  5IT9 K;  1RIO H;  5F6F A;  1D8J A;  3PQK A;  2ZME A;  2LF8 A;  4G6D A;  1AOY A;  1BBY A;  5DCF A;  2OD5 A;  2VT2 A;  2M45 A;  5ICF A;  2FU4 A;  4BH9 A;  2KJC A;  1FP1 D;  1YW8 A;  2W85 A;  3J80 K;  4I7H A;  3M7G A;  4IRI A;  4XBF A;  4BXU A;  1MDM A;  1TQM A;  5DV5 A;  1GXP A;  4MGR A;  2A68 F;  3HRU A;  2TDX A;  2L54 A;  2IJL A;  4MEY F;  5HDN A;  5E17 F;  1TQI A;  4HF2 A;  1R1V A;  1Y0U A;  2A69 F;  1HKQ A;  4JQF A;  3QAH A;  5KK1 A;  4U7B A;  2H94 A;  1K78 B;  2Q8K A;  3HHH A;  3T1B A;  1ZRE A;  1U5T B;  1XDU A;  3DQV C;  2FML A;  1YS6 A;  1FBS A;  3L09 A;  1NHA A;  1J75 A;  5D5X B;  2EA2 A;  4LLL A;  1KQ8 A;  1BIB A;  3BRO A;  4L0Y B;  3O6B B;  3TGN A;  1TW3 A;  4KUM A;  4FHT A;  2GXB A;  2VON A;  4HV5 A;  3GO5 A;  1RNL A;  2HZT A;  5FFZ A;  3BWG A;  3U9G A;  5FD5 A;  3SFZ A;  3WU1 B;  3KET A;  3WTZ A;  3FMS A;  1T38 A;  3M1E A;  3ZPL A;  4O5V A;  2EK5 A;  3HHG A;  1MDM B;  1XMK A;  2K4J A;  2X0L A;  1W4M A;  1GVJ A;  3DF8 A;  4Y17 A;  1FOK A;  3K69 A;  2YX4 A;  2V9V A;  4LG0 B;  3M8F A;  3R0A A;  2MLK A;  2MH9 A;  2IA1 A;  3Q9S A;  2IA0 A;  4Z2Y A;  1HXD A;  1K79 A;  3BZ6 A;  4U7D A;  1T2K A;  4AIJ A;  1IRF A;  2F5F A;  1R00 A;  2DPD A;  1HKS A;  4PGG A;  2KIU A;  1RZ4 A;  4K2E A;  3N97 A;  1TLH B;  5FGM A;  5CVI A;  1LDK B;  2D1V A;  2JT1 A;  2PN6 A;  4EQQ A;  4Q5S F;  5DDG A;  1LB2 A;  1J0R A;  3G3Z A;  2IRF G;  1FX7 A;  2QYO A;  4YII A;  1ZRD A;  2FEZ A;  2XIG A;  2QBY A;  2A07 F;  2Z9O A;  2O0Y A;  1WSU A;  1XGN A;  2NYX A;  4IPA A;  2HWV A;  2V1X A;  2QM3 A;  3HTS B;  3LA2 A;  2WWY A;  3LQQ A;  3Q9V A;  5DCM A;  3KZZ A;  1I1S A;  3MEX A;  1H0M A;  1LJ9 A;  3BPX A;  1EH6 A;  2G7H A;  1MKM A;  5CVR A;  5CVJ A;  3IHU A;  5E1X A;  4EGZ A;  3T8R A;  5DYM A;  3F3X A;  4I2O A;  2D45 A;  2YSR A;  4Q47 A;  1H9T A;  5H20 A;  3LA3 A;  4MQV A;  2YU3 A;  4U0Y A;  2NRA C;  4I02 A;  3U2R A;  4OIP F;  1YIO A;  1B1B A;  2WC2 A;  2OZ6 A;  1W7P D;  2VBZ A;  4WX9 A;  4H0E A;  1VTN C;  2FF4 A;  1X3U A;  5DD4 A;  2P5K A;  2FA5 A;  4CYD A;  3IRR A;  2VE9 A;  3T0Y A;  2OZU A;  1W7P B;  3QPH A;  4CGZ A;  4A6D A;  4BNC A;  1O3S A;  2EFN A;  2AXL A;  2AS5 F;  3ZMU A;  1SAX A;  3I0T A;  2F5C A;  2RC4 A;  2P4W A;  3QPT A;  5A2Q Z;  2ADU A;  3E6B A;  1BOA A;  2BE5 F;  2HR3 A;  2BBY A;  5D5W B;  5BPI A;  3C3W A;  4OIN F;  5D4R A;  1FYK A;  4M74 A;  1F5T A;  2YPR A;  1P4X A;  1UHW A;  4MQ9 F;  3R4K A;  3H3U A;  4G7O F;  1LDJ A;  3RKX A;  1QQI A;  3V8J A;  2YX7 A;  1R5H A;  2ZXJ A;  3V7C A;  2ZFW A;  3FF5 A;  2HEO A;  3GX4 X;  3V8L A;  2DQR A;  5E8I A;  3CTA A;  2XKO A;  2GIV A;  2KJB A;  3DPT A;  2KIF A;  1JGS A;  4CHU A;  2ZNZ A;  4R1H A;  1SMT A;  2DK8 A;  1O3R A;  5FLX K;  3FWE A;  1UB9 A;  4G6Q A;  3E5U A;  4HW0 A;  3RDI A;  3NRV A;  2UXN A;  2JSC A;  5AIQ A;  3IWF A;  4P55 A;  1EH8 A;  2YR2 A;  4KDP A;  1YYV A;  2HKO A;  2EA4 A;  3LFK A;  4UVC A;  5K5R A;  3K1P A;  3QU3 A;  4Q4Z F;  5DEQ A;  4YFN F;  2IP2 A;  3TQN A;  5LHH A;  3FXR A;  2Z33 A;  1J9I A;  2A6H F;  4AIK A;  3I5U A;  4WXH A;  1IN7 A;  4L9N A;  1PP8 F;  1R5G A;  2NS0 A;  1BN5 A;  4HZF A;  4ZH4 F;  3GFL A;  3IWZ A;  2EV6 A;  5BMZ A;  1HSJ A;  1P2F A;  3P9K A;  2OQR A;  1BC8 C;  2VC0 A;  2GA1 A;  5J8F A;  3I58 A;  1L0O C;  1YG2 A;  2IW5 A;  1S7A A;  2FSW A;  2P6T A;  3J81 Z;  1TNT A;  1WI9 A;  4EGY A;  2QQ9 A;  3KCC A;  1S7O A;  2VOO A;  3FMQ A;  2PMU A;  5CVU A;  1ZLJ A;  1IXR C;  4UXN A;  3M8E A;  3KEQ A;  1P4A A;  1YLF A;  1CF7 B;  1UFM A;  2RKH A;  4BYY A;  2A3S A;  2EV5 A;  3CLO A;  2ACJ A;  5LLQ A;  2J5P A;  2STT A;  1U2W A;  4HX7 A;  1EH7 A;  3IKV A;  3TO7 A;  1XSX A;  1R58 A;  1Z7U A;  3EYI A;  1GHC A;  3T8T A;  1YS7 A;  2DQL A;  1JHF A;  5CJ9 A;  1IF1 A;  2OA4 A;  1XCV A;  4CIC A;  5A2Q K;  2CWE A;  1WWX A;  5E1Z B;  4KIF A;  1YQA A;  2OAZ A;  3EQL F;  1J7K A;  4IJA A;  4HLY A;  1S3J A;  4EJU A;  4OMZ A;  2QVO A;  2GA2 A;  3BJO A;  1BIA A;  5IT3 A;  1F9N A;  1YO5 C;  2IA2 A;  3K0L A;  3F23 A;  5CLS A;  1P6R A;  1RUN A;  4HV6 A;  3P7N A;  3IL2 A;  3FM3 A;  2IVM A;  4CDG A;  5HS7 A;  3EET A;  3LST A;  4AWX B;  3SQN A;  5H6R A;  3WGI A;  4U88 A;  3GUD A;  5EEG A;  1IN8 A;  1UST A;  5L3G A;  4XRF A;  4FX4 A;  3QP5 A;  4U0V A;  1SD7 A;  3K1M A;  1ODD A;  4M6Y A;  5LRR A;  4YFK F;  2Y48 A;  4RGU A;  1ULY A;  3C18 A;  4LGW A;  2CG4 A;  5AIP A;  1IZ1 A;  4EM1 A;  3VB2 A;  1YW9 A;  1KQ9 A;  3KP2 A;  2MA3 A;  2HTS A;  3WTY C;  5D4S A;  1ON2 A;  4OIO F;  3FXU A;  4A0X A;  1R1T A;  1G3S A;  3CUQ B;  1KYZ A;  4IF4 A;  1IAW A;  1LNW A;  3RTR A;  1TBX A;  5ICG A;  3I59 B;  1I27 A;  3ABU A;  2ELH A;  2NNN A;  2M8E A;  5ICE A;  2CSO A;  3BP8 A;  3E6C C;  4MEX F;  1YFH A;  1I6X A;  3SHF A;  3F6O A;  3F6V A;  4O3M A;  2F5E A;  3E6D A;  4PZJ A;  5JHU A;  2GWR A;  4A12 A;  4N9H A;  4Q48 A;  4LG0 A;  4KMF A;  2XAF A;  4LK0 F;  5LGU A;  4RS8 A;  1ZAO A;  1MGT A;  1R22 A;  1MJA A;  3F8C A;  1EV7 A;  4GXO A;  3ERE D;  4PCQ A;  5DUI A;  2ZKZ A;  2PFB A;  5J8C A;  3LAJ A;  1W5T A;  3QU6 A;  3CO6 C;  1FSE A;  4ON0 A;  1IXS B;  2FNP A;  2DBB A;  3R60 A;  5FLX Z;  3KP5 A;  5LEK A;  3WTU C;  4ZZD A;  4EM0 B;  1U6G A;  4BHC A;  2HOE A;  2EFW A;  4UVB A;  2STW A;  1BI3 A;  3V7R A;  3H92 A;  2J5O A;  4ENN A;  5BOX A;  1KYW A;  1BI0 A;  2FBH A;  5D5V B;  2EV0 A;  2LF7 A;  4B09 A;  1XCB A;  1IN4 A;  4EM2 A;  2DLL A;  1G4D A;  2VN2 A;  3ZMT A;  2HGC A;  1SFE A;  2MBF A;  5EEH A;  4KYW A;  1K6O A;  3WGH A;  4S05 A;  1ZG3 A;  5DD8 A;  5ILU A;  1D5V A;  3FX3 A;  1YW7 A;  3GFJ A;  5KVR A;  1ZAR A;  3WTS C;  1DP7 P;  1FY7 A;  4BQA A;  3D0S A;  3WTW C;  1XDS A;  4KN4 X;  4P9F A;  2K86 A;  1GXQ A;  2W84 A;  2V6C A;  2WTE A;  6PAX A;  2H09 A;  3J80 Z;  4M73 A;  3GW2 A;  2P8T A;  4A5M A;  1HW2 A;  3FHZ A;  1XGS A;  1LDD A;  3ZP5 A;  1QZZ A;  1A04 A;  3GZ5 A;  4HAM A;  3T5X A;  3F22 A;  1FWZ A;  4DQ2 A;  1D3Y A;  2V1U A;  3ML6 A;  2EFO A;  1B59 A;  4Y15 A;  4ESJ A;  1SFX A;  2EFQ A;  2GZW A;  2VOD A;  1G6N A;  2ESN A;  1JHH A;  4GYI A;  3K1N A;  3REO A;  5K5Q A;  4IRG A;  2RNJ A;  5L3E A;  2DO7 A;  2JZY A;  4G94 A;  3WTT C;  2PG4 A;  3QP6 A;  2XAG A;  4XLN F;  2M30 A;  3B73 A;  1TTY A;  4WCG A;  1Z91 A;  5BPD A;  1KU3 A;  3L00 A;  4S04 A;  3I4P A;  1ZHF A;  1E2X A;  3RPQ A;  2HQN A;  3I71 A;  2A6E F;  1IN6 A;  2K7L A;  2VE8 A;  2MLG A;  1U78 A;  3DFG A;  4PGH A;  5CYV A;  3MCZ A;  4O6J A;  1O7F A;  2XUB A;  1KGS A;  1QO0 D;  1R1U A;  4WK8 F;  1U5T A;  5H6Q A;  1KU2 A;  2OBP A;  3PQJ A;  1Z6T A;  5HDG A;  1CF7 A;  1B9M A;  3KP6 A;  4L0Z B;  4M72 A;  2XAS A;  3HRT A;  3RYR A;  3KFW X;  3KP3 A;  5E8G A;  3VOD A;  1F1Z A;  2QQA A;  4ZYH A;  3ECH A;  1ZG5 A;  1SD4 A;  1ZLK A;  2F2E A;  4LFU A;  3P9C A;  5F64 A;  3ZMD A;  3P9I A;  4KT5 C;  2NNY A;  4UHT A;  4FX0 A;  4WXD A;  3ELK A;  1B4A A;  4NHJ A;  2W25 A;  3LA7 A;  1XSV A;  3WU0 A;  1S29 A;  4KNY A;  2JRT A;  3EYY A;  3MAJ A;  3MFK A;  1FZP B;  4KFC A;  1WKM A;  2QUF A;  3Q5F A;  1T39 A;  3FXQ A;  3GF2 A;  4AIH A;  1SD5 A;  1DPR A;  2LDU A;  3ZMZ A;  1LEB A;  2Y0M A;  2FBK A;  3G73 A;  5HVQ C;  2BGC A;  3GYH X;  3WE2 A;  1UHM A;  3GFI A;  2V1D A;  4IVN A;  4GO1 A;  2PBI A;  4HBL A;  3BY6 A;  1ONV A;  5E18 F;  4HOB A;  2H6B A;  4QWQ A;  1KU9 A;  2HS5 A;  3WG9 A;  2BYV E;  3DEU A;  1RUO A;  3BDD A;  3FMR A;  2QWW A;  4KN7 X;  1BJA A;  1FBU A;  2GXG A;  2KRF A;  1LVA A;  1T98 A;  3HSR A;  4EJT A;  2COM A;  3K2Z A;  2IT0 A;  1XN7 A;  1Z1D A;  2RQP A;  2CQK A;  2H6C A;  4HDU A;  1JXS A;  3RKW A;  5HLI A;  4G8X A;  3R0J A;  3LWF A;  4P96 A;  2C6Y A;  4I01 A;  1I5Z A;  2IPQ X;  3MQ0 A;  2BV6 A;  3N4M A;  1OKR A;  3CUQ A;  2ETH A;  1Q1H A;  2HQR A;  2L3D A;  2O8X A;  1R7J A;  4I09 A;  5JVT A;  4F7Z A;  2NAZ A;  4WWC A;  4LB5 A;  1HST A;  3GEZ A;  4HX8 A;  3BPV A;  5HOO A;  2ISZ A;  2Z5U A;  2E1C A;  4BHB A;  3F8M A;  3E97 A;  5ERI A;  2Q0O A;  3SZT A;  3I59 A;  1XD7 A;  2FRH A;  2XGX A;  4U0W A;  1IN5 A;  1RI7 A;  1KU7 A;  3VOE A;  2O3F A;  5ILS A;  1G3W A;  4EMS A;  3CUQ C;  4ZYE A;  3HOT A;  1OMI A;  2L4A A;  2M1B A;  5L3B A;  3DV8 A;  2ZNY A;  4OIQ F;  1G3T A;  5JFR A;  3KLN A;  1MZB A;  1Z05 A;  1OYI A;  3WTV C;  3MZH A;  1C0W A;  4OOI A;  3WOD F;  4B8X A;  5IT9 Z;  1USS A;  4L9J A;  1SD6 A;  5DCM B;  1R36 A;  3KE2 A;  2P6S A;  4M6X A;  3RKY A;  1L3L A;  1BC7 C;  2DTR A;  2HKX A;  2K02 A;  1T0F A;  5FD6 A;  4PDK A;  3KEO A;  1H9G A;  1P4W A;  1ZRC A;  3ISP A;  1WRJ A;  1TW2 A;  1KQ0 A;  3PFI A;  3KLO A;  1IXC A;  3HYI A;  2Z3Y A;  1CGP A;  2M87 A;  1REP C;  3BJA A;  3ZN1 A;  2QBY B;  3J7A O;  2VBW A;  1ZRF A;  3TDZ C;  5HDK A;  2CYY A;  5FO5 A;  2GAU A;  1U5T C;  3QRF F;  3L7W A;  3CJN A;  4RB1 A;  1FSH A;  5LEJ A;  3NEU A;  2MH2 A;  3TOA A;  4ASN A;  4KIB A;  2HDC A;  4G9Y A;  2PJP A;  2RV8 A;  2H27 A;  2XAH A;  3HSE A;  5FB2 A; 
#chains in the Genus database with same CATH topology
 4BL0 B;  3NQO A;  1RET A;  1SFK A;  1QBJ A;  1IDZ A;  4XKC A;  2KDO A;  2CFO A;  2WA0 A;  2LY1 A;  3RPU A;  3V4G A;  2E7W A;  3MKZ A;  1ETW A;  2KRC A;  2X6W A;  2VPL A;  2W24 A;  3GVA A;  2JPB A;  4L5J A;  3W2V A;  2RN7 A;  1JKO C;  3DTK A;  4DIQ A;  1OR7 A;  2B0L A;  1QHG A;  3RIR A;  5L3C A;  2EH3 A;  3L2Q A;  3S8P A;  4RMN A;  3W6J B;  4HQM A;  4L5I A;  2FMY A;  1IUY A;  4BE0 A;  2R7D A;  4N0B A;  4GCV A;  2UZK A;  5HS8 A;  3HBL A;  1F36 A;  4B1R A;  4LLN A;  3S15 J;  4Z6Y A;  1PUF B;  1X4O A;  2VT3 A;  4R79 A;  1UMQ A;  3KP7 A;  3JCU C;  3W2W A;  3WTX C;  5F0C A;  3D1N I;  1MNE A;  2K9N A;  3I53 A;  4BQQ A;  2P5V A;  1HLV A;  2K85 A;  3J7A Y;  3K4B A;  3S3M A;  4BEH A;  1BA5 A;  4BQN A;  5LD2 C;  4UV9 A;  5K5O A;  3I3L A;  4P9U A;  4A3I J;  3H3Z A;  2OF7 A;  4KT6 A;  3CMA I;  1B72 B;  3HB9 A;  5KCM A;  3TMO A;  3OS1 A;  1SAU A;  2L02 A;  5HLG A;  5LHG A;  4PK4 A;  2PQ8 A;  1V3F A;  1E17 A;  3DKW A;  4GGG A;  3E1S A;  3SXY A;  2ZSI B;  4HLX A;  2MD5 A;  1V4R A;  4JBA A;  3S93 A;  1X1C A;  3V7S A;  4EJO A;  3E0J B;  2DAO A;  1HBX G;  1G3Y A;  4ETS A;  2LNB A;  3F8N A;  1K78 A;  3OOP A;  2PEX A;  2XRN A;  2E35 A;  3MZY A;  5K1Y A;  2EWN A;  3MMY B;  2M34 A;  2UXX A;  4YG2 F;  3RYP A;  3FHN A;  1VQ4 I;  3GTO J;  4MHG A;  4NBQ A;  1T95 A;  2VKD A;  4E7J A;  3JTG A;  2CQ7 A;  1D1B A;  4A3D J;  4RAY A;  2I5U A;  4ESF A;  2XRO A;  1ETQ A;  5EF6 A;  2WV0 A;  4EAT A;  1IRZ A;  2D5V A;  4C2M J;  1P7I A;  1BM9 A;  4WF2 A;  4FTH A;  4LB6 B;  2O61 A;  2RVC A;  2FNA A;  1A35 A;  1Z9C A;  4ZTJ A;  1HKT A;  2P5L C;  5D5U B;  1FNN A;  3CQZ J;  1MMN A;  3ZMV A;  3HRS A;  1WQ2 A;  1F4K A;  1SVO A;  4XSZ F;  3K4L A;  5IP7 J;  4DBR A;  4JOM A;  4BY7 J;  4CCN A;  1MSE C;  2LSO A;  3OYI A;  1W0T A;  2FXA A;  2E34 A;  2HQ5 A;  3DLL F;  3HSF A;  4RGR A;  3HZJ A;  5TGT A;  2CGP A;  3L2U A;  3DU5 A;  4RBO A;  1QZY A;  5F1J A;  3MWM A;  1QRY A;  4BQO A;  4DNC A;  3CJR B;  1G59 A;  1S72 I;  5EDN A;  2DJI A;  2FOK A;  1X1B A;  3PSI A;  4CCO A;  5EGO A;  4A3E J;  2K3F A;  2HTJ A;  2LY9 A;  5B66 C;  3CLQ A;  4RAZ A;  1UCR A;  5D8K B;  5LGT A;  5HNF A;  2HPM A;  3VFZ A;  1X3Z B;  4BHP A;  2L4M A;  3F21 A;  2TCT A;  4PJN A;  3I4M J;  4NC6 A;  3HUG A;  2DOE A;  5FKL A;  2P7V B;  5ILV A;  1EJ9 A;  3RJP A;  5L3F A;  1TWC J;  5FKO A;  2ISY A;  1Z6R A;  2NVT J;  2XAJ A;  4ZYD A;  5FRN A;  3VEP A;  3VYU B;  4X0G A;  2VXZ A;  3J81 K;  1N78 A;  2F5D A;  4L9T A;  2CW0 F;  3BZK A;  2VOP A;  3JAM K;  2M4G A;  2A61 A;  1JKP C;  1YTY A;  3HOX J;  5GP9 A;  1SVL A;  4A3K J;  2OTJ I;  2OCC H;  1HCR A;  4AD9 A;  2G7U A;  3PFY A;  2DI3 A;  3KPH A;  4G12 A;  3H9J A;  3F8F A;  2DT5 A;  1R5I D;  5HNH A;  2KQR A;  3E3V A;  4B43 A;  3AL0 C;  2EFP A;  1ETK A;  1RES A;  1YJW I;  5DM7 F;  2XC7 A;  1U8R A;  2KLO A;  5FLM J;  2JPC A;  4ENM A;  2EJR A;  4UUS A;  4NNJ A;  3OY9 A;  4MNU A;  1K61 A;  2VJI A;  2W57 A;  4YEL A;  2EB7 A;  2XV4 S;  1Q1V A;  4M71 A;  1W5S A;  3KYD B;  1TNS A;  4UVA A;  2ID6 A;  2DA4 A;  4UV8 A;  3E5Q A;  3AG3 H;  3WE3 A;  2P7C B;  4A3G J;  1RR8 C;  1UEL B;  2PMH A;  2XGC A;  1FJL A;  3CP2 A;  4E7Z A;  4A6E A;  1ZYR F;  5BQT A;  1ZG1 A;  4ABZ A;  1T6S A;  3EUH A;  1ZGW A;  2RDP A;  4RB0 A;  4E7L A;  3GLX A;  3J7Y J;  2FE3 A;  1FTT A;  2KIM A;  1A31 A;  2GIZ A;  4EV0 A;  1IG7 A;  2VKV A;  4A69 C;  2X4H A;  4M9Z A;  3LSH A;  2IEK A;  1LFP A;  3ZXS A;  3ABT A;  2K4B A;  2ZBK A;  2JRM A;  3IKT A;  1NG6 A;  1DDN A;  1LEA A;  2ELJ A;  4DW6 A;  3PM1 A;  4LJZ F;  1WH7 A;  3CDH A;  1J59 A;  4TV7 A;  1E3H A;  2AXT C;  2B7E A;  2NVY J;  4DYQ A;  4FCY A;  1PUE E;  1OYW A;  1BI1 A;  4FET A;  4GYG A;  4G7H F;  1RR7 A;  1ERD A;  1WH5 A;  4Y13 A;  1POG A;  3BR3 A;  4OAY A;  5E20 A;  3K4N A;  2QLZ A;  3QOD A;  1K7A A;  2FBI A;  4BJT A;  2M5W A;  4LLG F;  4A3J J;  2XKP A;  4E70 A;  1ITY A;  2O6G E;  3CP8 A;  1HDP A;  4D7N A;  4R8H A;  2K40 A;  4P5O A;  3A4C A;  4ESB A;  1TQP A;  1WJE A;  3M3Y J;  1FPQ A;  1A5J A;  2HYF A;  1FEX A;  3OYH A;  1QPM A;  1ZGJ A;  3L2C A;  3GFM A;  3H5N A;  1Z3Y A;  3GZ6 A;  3TOB A;  2QQ8 A;  4M3F A;  1R23 A;  3E7L A;  3JSO A;  1HQC A;  3M07 A;  3ZQF A;  4ENJ A;  3BTJ A;  2MSY A;  4QTR A;  1R6R A;  2FQ3 A;  2ZJ2 A;  4W1U A;  3PO3 J;  4L9V A;  3L9F A;  3HTU A;  4XOP A;  2EZK A;  4ZJZ A;  5ICC A;  2N8G A;  3R6S A;  2R5Z B;  4IRH A;  1LQ1 A;  2L01 A;  2ZO4 A;  3JW4 A;  3OYB A;  4UUS B;  1XGM A;  2E2I J;  5LBQ A;  4XOT A;  5C3E J;  1OFC X;  4EJV A;  3DBH B;  1I1G A;  2HI3 A;  4IHS A;  2DDA A;  5BNG A;  1IV8 A;  4CZZ A;  5TIS C;  4IZZ A;  2XRL A;  4EJW A;  1BR2 A;  2O03 A;  4HG2 A;  3TDU C;  4NQW B;  4PJJ A;  3FZV A;  2E7X A;  5DUK A;  4ZYG A;  1VQ7 I;  1FOW A;  5LRS A;  4IQJ A;  3J7Z I;  2K27 A;  5M5W J;  4NQW A;  4QPQ A;  4HA8 A;  1BR1 A;  3LSJ A;  1SFU A;  2CS3 A;  1MBF A;  3KP4 A;  1UHS A;  4OU0 A;  2A5Y B;  2KKO A;  4FAS D;  1LFU P;  1LFB A;  4WXC A;  2GLO A;  5HLH A;  5KAF C;  1FBQ A;  1DQU A;  3OR2 C;  1OYY A;  3IUO A;  2Z99 A;  4LMY A;  5AON A;  1W0U A;  3CCL I;  2OQG A;  3F72 A;  3OV8 A;  4LIU A;  4C9Y A;  4XSX F;  1FYL A;  4IHX A;  1ZGA A;  1QNT A;  5CVV A;  3L2V A;  3DU6 A;  3EDP A;  3ULQ B;  5LHI A;  3TO6 A;  4JYK A;  3HDD A;  2VBY A;  2Y75 A;  5CKT A;  2GQQ A;  4BAY A;  4CO8 A;  2COB A;  1EF4 A;  3FXL A;  5L3D A;  1JE8 A;  5EGO B;  1B6A A;  1MBJ A;  3LSM A;  4KA4 A;  9ANT A;  1IUF A;  1V5F A;  2LYC A;  1VQ5 I;  5HS9 A;  1O7L A;  5LGN A;  3OSF A;  3W6K B;  4CUG A;  2R7T A;  4OIR F;  1XB4 A;  2V79 A;  1P92 A;  5JHF A;  1DUX C;  2DFI A;  2KHM A;  2G9W A;  4UUV A;  2CV2 A;  4KIT B;  5E3L A;  1KZH A;  3M4O J;  2X48 A;  1ON1 A;  3QOE A;  5EG0 B;  2Q2E A;  1SMY F;  2ME6 A;  4FT8 A;  4GDF A;  4UNO A;  2H8W A;  4XL9 A;  1ZH5 A;  3LSG A;  1O57 A;  3VWB A;  2DK5 A;  2XDV A;  3C1D A;  3KZY A;  1U9N A;  3AKZ A;  1J2X A;  4A5N A;  4M3B A;  1V54 H;  1U9O A;  1AWC A;  5B3S H;  2MG4 A;  3ABL H;  4BXX J;  4ZC3 A;  2DPU A;  2VL8 A;  2L7M P;  2IGO A;  2PJR A;  2HFH A;  1S8N A;  3F9K A;  2X85 A;  2CFX A;  4BS9 A;  5TRD A;  2DFH A;  2DMU A;  2BY1 A;  3CCU I;  1WI3 A;  5ED4 A;  3B02 A;  3JTH A;  1OPC A;  3S2W A;  1LUJ B;  4A0Z A;  2BEO A;  3CO7 C;  1HW1 A;  2PX9 A;  3B6C A;  2DA2 A;  4CYC B;  3F0C A;  2OU2 A;  2ZB9 A;  2PI0 A;  3LAP A;  5BS6 A;  5CQG A;  3GBG A;  4G7Z F;  3A01 A;  1V55 H;  1J5Y A;  5CPR B;  4RB3 C;  2IS4 A;  3HKZ A;  3QOP A;  3E5X A;  3ZQL A;  5F1R A;  2CUE A;  2W1O A;  3RZO J;  4DBQ A;  2KZV A;  3FM5 A;  4HX4 A;  3HRM A;  3G1M A;  4I0A A;  3RCO A;  2DMT A;  2HVQ A;  3GXO A;  3COA C;  4ZTF A;  4LD5 A;  2HVR A;  3O2P E;  2X6O A;  3D5L A;  3ZN0 A;  1AA7 A;  3OSG A;  1MJB A;  3BJ6 A;  1R71 A;  5D6F A;  2VBX A;  1YIJ I;  3Q3S A;  2E1M B;  3WGG A;  1UG2 A;  4PJM A;  4IHT A;  4UB8 C;  4RB2 C;  1H8A C;  4MTD A;  2VQG A;  2E1M C;  2DA1 A;  3I64 A;  4HRI A;  4A3M J;  2D1H A;  4ENK A;  3TKY A;  1IV6 A;  2JA2 A;  1O3T A;  4OMY A;  2DU9 A;  2R5Z A;  3SZG A;  1K83 J;  2K9L A;  4L18 B;  3CCV I;  3RI4 A;  1N25 A;  1OLT A;  4EEF G;  1KA8 A;  3C2H A;  2JN6 A;  1QGP A;  2OV7 A;  2HYG D;  3LSI A;  3C7J A;  1XGO A;  3O3K A;  2M9H A;  1FT9 A;  1FIP A;  4XLP F;  5JLW A;  2DA5 A;  3LQR A;  2IGM A;  3E6M A;  5FKK A;  2DA3 A;  2DN0 A;  2JVG A;  4I0B A;  4PJ0 C;  2RRE A;  2WAF A;  3JRI A;  1V5G A;  2VJ5 A;  2GM4 A;  5D6E A;  2HXI A;  3DPL C;  1HW5 A;  1MJ9 A;  2DXI A;  3H0G J;  2XHK A;  4UY8 I;  1OJL A;  3SYT A;  2E1N A;  3GWZ A;  1JKQ C;  3V8K A;  3K9T A;  1VQ9 I;  3ASO H;  3ZMS A;  2ESH A;  2E1O A;  2KL4 A;  2XVC A;  3CC7 I;  4XLH A;  3S16 J;  3SZP A;  3DKY A;  1FC3 A;  4ZZL A;  1MH4 A;  2DW4 A;  1STZ A;  4NB5 A;  4XN3 A;  4YIF A;  5J6X A;  2QQB A;  3PNY A;  2R3S A;  4KIC A;  1T0F C;  3KYC B;  4JK1 X;  4I98 B;  4XLC A;  2LKS A;  4IQ4 A;  3BG6 A;  2R7F A;  4MTE A;  2LKP A;  4HQE A;  1DPU A;  2R7X A;  2LR8 A;  2BVM A;  4ZDO A;  4IXA A;  4Y4R A;  2JA5 J;  2DOD A;  3U1D A;  2KIS A;  3DP7 A;  4ITV A;  4HF0 A;  3RZD J;  1D8K A;  2D2W A;  3OL3 A;  1MD0 A;  4M6V A;  5TJJ A;  3HOS A;  2X6Y A;  3HOW J;  4HF1 A;  1DGR M;  3CUO A;  4KMU X;  4CA0 A;  2QZ8 A;  3FXK A;  5F08 A;  3LL7 A;  2QCO A;  3OYD A;  3K4C A;  3S2D J;  1ZKG A;  4PUS A;  4A2U A;  1FLI A;  2MC3 A;  3ZQ7 A;  3AAF A;  2ECB A;  1DU0 A;  1O3Q A;  1B9N A;  2XSD C;  2RGV A;  4HYE A;  2NS7 A;  2JTV A;  2R7Z J;  1VQO I;  1U3E M;  5FFX A;  2A6T A;  2OPT A;  1BI2 A;  2X1E A;  4CCM A;  4AVP A;  1D1A A;  4RGX A;  5JR3 A;  4J19 A;  5E1W A;  1IRG A;  3K70 C;  4XID A;  1FYM A;  3OR1 C;  1WJB A;  3F8B A;  2LLK A;  1S7E A;  5JI6 A;  3ROU A;  2Q1Z B;  4LK1 F;  1OCZ H;  1S6L A;  1E3O C;  4N9I A;  1ETO A;  3JSP A;  2QEN A;  3R61 A;  3U1K A;  4YFX F;  2VXD A;  2HDD A;  4QLC U;  3VYT B;  4XLA A;  4C3J J;  1SFO J;  3TO9 A;  1ZN2 A;  4KIG A;  1IW7 F;  2ZME B;  4B4C A;  2VC1 A;  1XSD A;  4HDV A;  3BOQ A;  1S9H A;  4CXF A;  3UR3 C;  3BR1 A;  4LG3 A;  3IH4 A;  3OMY A;  1NH3 A;  4D7M A;  2VJ4 A;  1OCT C;  4M9S A;  1XMA A;  2UWM A;  2E5N A;  2Y0S N;  5J3L A;  3OYK A;  3CMY A;  2H1K A;  3JRF A;  1PDN C;  3IRQ A;  2HOS A;  3M9A A;  2XAQ A;  3DXJ F;  4A0Y A;  5D8L B;  3JAM Z;  2M0M A;  1W7P A;  2K3P A;  3IC7 A;  2GXA A;  5H2F C;  2DMN A;  3DTI A;  4RGS A;  3W2A A;  3DTE A;  3ECO A;  4EVI A;  3WHB A;  1ETY A;  1FP2 A;  1JTY A;  3C2B A;  1QU3 A;  1X1A A;  3I54 A;  2CO5 A;  4D0P A;  2PLY A;  1PP7 U;  4M9X A;  2A05 A;  3HIF A;  4IO9 F;  5KAI C;  2BXY A;  3H36 A;  2ZCW A;  2R93 J;  3DBR B;  2DFF A;  3PNT A;  4B47 A;  1I39 A;  3D5S C;  5IT9 K;  1RIO H;  5F6F A;  3BCA A;  4C3H J;  2Y0S A;  1D8J A;  3PQK A;  2VUM J;  2ZME A;  2RAE A;  4XN0 A;  3ONQ A;  2LF8 A;  4G6D A;  3A02 A;  1AOY A;  1BBY A;  5DCF A;  2OD5 A;  2R0Q C;  3FK7 A;  2VT2 A;  1VFC A;  4J01 A;  2M45 A;  2K9Q A;  2EIK H;  3W6V A;  5ICF A;  3WU2 C;  2FU4 A;  4BH9 A;  2KJC A;  4X6A J;  1FP1 D;  3BCB A;  1YW8 A;  2W85 A;  3J80 K;  4I7H A;  1VF9 A;  3M7G A;  5FRO A;  2QF7 A;  4IRI A;  4XBF A;  5JLX A;  4BXU A;  1MDM A;  4OAZ A;  2Z1D A;  2JUG A;  1TQM A;  1HA8 A;  5DV5 A;  1GXP A;  4MGR A;  2A68 F;  3HRU A;  2TDX A;  4NC7 A;  1I3Q J;  2L54 A;  3D5R C;  4E6K G;  2IJL A;  1IO2 A;  1Z67 A;  4MEY F;  5HDN A;  3ZGK A;  1SC7 A;  5E17 F;  1TQI A;  4HF2 A;  1X1P A;  1R1V A;  1Y0U A;  2A69 F;  2OTL I;  5FRM A;  1ZEL A;  1MBE A;  2UUZ A;  2ZFU A;  1HKQ A;  2WV1 A;  4QPO A;  4BJ6 C;  2DCE A;  1S5L C;  4JQF A;  5E3M A;  3QAH A;  1LPQ A;  5KK1 A;  5JVG F;  1WCM J;  4MFD A;  4U7B A;  2H94 A;  5J40 A;  1K78 B;  3H9G A;  2Q8K A;  3HHH A;  5E3N A;  3T1B A;  4V2F A;  1ZRE A;  1JI8 A;  1U5T B;  1XDU A;  3DQV C;  4JX4 A;  4DYR A;  1KON A;  2FML A;  3UNG C;  2DJN A;  1YS6 A;  2BW3 A;  1FBS A;  3L09 A;  3RKQ A;  3CMM A;  1NHA A;  1J75 A;  2E36 A;  5GTI C;  5D5X B;  3JRC A;  2EA2 A;  2JWT A;  4LLL A;  1KQ8 A;  1BIB A;  3BRO A;  4L0Y B;  3O6B B;  1X19 A;  3TGN A;  1TW3 A;  5M3F J;  3FBI B;  4XKB A;  4KUM A;  4FHT A;  2X1C A;  1G2H A;  2GXB A;  5IP6 A;  2VON A;  3K4M A;  1PJR A;  3GTK J;  1WFX A;  2LK2 A;  4HV5 A;  3GO5 A;  3L2W A;  1RNL A;  3H35 A;  4BEH B;  2HZT A;  5FFZ A;  3BWG A;  5FJ8 J;  3I4N J;  4M3E A;  2LFB A;  3U9G A;  4A3L J;  2VB6 A;  3KZI C;  5FD5 A;  3SFZ A;  4XKV A;  3WU1 B;  3KET A;  1APL C;  3WTZ A;  1VND A;  3FMS A;  1T38 A;  3M1E A;  3ZPL A;  4O5V A;  3W3C A;  2V1N A;  5J4Y A;  2EK5 A;  3HJE A;  3HHG A;  2DFE A;  4ZDL A;  5EEA A;  1MDM B;  4G6T B;  4IHV A;  3QYE A;  3SDG A;  1XMK A;  1SVM A;  3LSK A;  2K4J A;  2K9M A;  2X0L A;  1N75 A;  1W4M A;  1GVJ A;  3DF8 A;  3M8J A;  3GLL A;  1YOV B;  3OS0 A;  1A6Q A;  4Y17 A;  2LH9 A;  3A03 A;  3IAM 2;  1FOK A;  3K69 A;  2YX4 A;  3I9V 2;  2V9V A;  4LG0 B;  3M8F A;  3CF5 F;  1OCP A;  3R0A A;  2KIQ A;  5DTD A;  2NVQ J;  2MLK A;  2MH9 A;  1DU6 A;  1LE8 A;  3ESW B;  3SJM A;  1ACI A;  2IA1 A;  2LVS A;  2F5V A;  4FE4 A;  2EIM H;  3H9Q A;  4XIC A;  3LSR A;  3Q9S A;  1HC8 A;  1BR4 A;  2E2J J;  2QSH X;  2IA0 A;  5M5Y J;  4Z2Y A;  1HXD A;  1K79 A;  3BZ6 A;  1YRN A;  5GAG J;  4U7D A;  1T2K A;  2R7U A;  5E3O A;  2WB1 N;  1MBH A;  4AIJ A;  1IRF A;  2F5F A;  1R00 A;  3HEF A;  2DPD A;  1HKS A;  4QSH A;  4PGG A;  2KIU A;  2JUC A;  1RZ4 A;  2EIJ H;  4K2E A;  3N97 A;  3LMM A;  5DS9 A;  1FIA A;  1TLH B;  5FGM A;  4D5C A;  3G4S I;  1R4N B;  5CVI A;  1LDK B;  2D1V A;  2JT1 A;  2PN6 A;  5FKN A;  4EQQ A;  5DDG A;  4Q5S F;  4IL6 C;  2MGQ A;  1LB2 A;  1J0R A;  3G3Z A;  4U87 A;  2IRF G;  1D0X A;  2F4O B;  3VDX A;  4I6Z A;  1FX7 A;  2QYO A;  4YII A;  2HXO A;  1SAN A;  2LC2 A;  2M7A A;  2FEZ A;  2VI6 A;  1ZRD A;  2XIG A;  4IOA F;  4II3 A;  4CYC A;  2QBY A;  2A07 F;  2Z9O A;  2O0Y A;  1IJW C;  2HZD A;  1WSU A;  1XGN A;  2NYX A;  3U21 A;  1XPX A;  1YJN I;  1HF0 A;  4XQF A;  4AVZ A;  2CW7 A;  1UAA A;  4IPA A;  2HWV A;  2V1X A;  3TW6 A;  2QM3 A;  2Y2Z A;  3JRD A;  3HTS B;  2V7F A;  3LA2 A;  2WWY A;  4MO7 A;  1UJ8 A;  4PFO A;  2FQ4 A;  3LQQ A;  3Q9V A;  4HSR A;  5F27 A;  5DCM A;  3KZZ A;  1I1S A;  5F0F A;  1JUS A;  2VQL A;  3MEX A;  1MBK A;  1VQL I;  1TWA J;  2CUJ A;  1H0M A;  1LJ9 A;  3BPX A;  1R9T J;  4BAC A;  4M3D A;  3ERM A;  3G1O A;  1EH6 A;  2I8D A;  5EG0 A;  2G7H A;  3QPS A;  1MKM A;  5KHD A;  3GZN B;  2MAB A;  4NDL A;  5CVR A;  5J1Y A;  3PIO F;  5CVJ A;  3IHU A;  4LIT A;  5E1X A;  4EGZ A;  3T8R A;  5DYM A;  3F3X A;  5F04 A;  4I2O A;  5IP9 J;  2D45 A;  2VKE A;  1EKE A;  2YSR A;  2GBY A;  4Q47 A;  1H9T A;  2EZH A;  3BR2 A;  3H1C A;  5H20 A;  3RQ4 A;  3LA3 A;  2M0C A;  1MIJ A;  4AM3 A;  3IP4 B;  4MQV A;  2YU3 A;  4U0Y A;  2NRA C;  4RM3 A;  4I02 A;  3U2R A;  4OIP F;  1YIO A;  3BG3 A;  5IPA A;  3S17 J;  1B1B A;  2WC2 A;  3PUB A;  2OZ6 A;  1W7P D;  2OC6 A;  2VBZ A;  3QPL A;  4WX9 A;  4H0E A;  1VTN C;  2FF4 A;  3NWT A;  2F4I A;  1X3U A;  5DD4 A;  2M7B A;  2P5K A;  2FA5 A;  3OYF A;  3OYA A;  2L9V A;  4CYD A;  3IRR A;  2VE9 A;  3QYF A;  2OZU A;  3T0Y A;  1W7P B;  3QPH A;  3AL0 B;  4Y52 J;  4CGZ A;  4XM3 A;  4A6D A;  1SEU A;  3HPG A;  4MIM A;  1BOB A;  1WJA A;  4E7S A;  4BNC A;  1O3S A;  2EFN A;  2AXL A;  3FBN B;  2AS5 F;  4A3B J;  1TWF J;  4AU7 A;  3ZMU A;  1SAX A;  3HC7 A;  3I0T A;  4N4O B;  2F5C A;  2RC4 A;  1R4M B;  4XLE A;  2CU7 A;  2P4W A;  3QPT A;  3SDB A;  5A2Q Z;  1YJ9 I;  2ADU A;  4BUP A;  4GFB A;  3E6B A;  3TP0 A;  1W36 C;  2WAD A;  1BOA A;  2BE5 F;  2HR3 A;  3BLY A;  4BDY A;  1X2N A;  2W7N A;  2DYR H;  1ZR2 A;  3HGG A;  5KNL A;  2BBY A;  2NS8 A;  5D5W B;  4YRV A;  1ORK A;  5BPI A;  3C3W A;  4OIN F;  5D4R A;  1FYK A;  4M74 A;  1F5T A;  2YPR A;  1P4X A;  1UHW A;  4MQ9 F;  3R4K A;  2R4G A;  3H3U A;  3OOU A;  4G7O F;  1BW5 A;  1LDJ A;  3RKX A;  1QQI A;  3V8J A;  2YX7 A;  1R5H A;  2M2E A;  4Y7N J;  2ZXJ A;  3V7C A;  2ZFW A;  3FF5 A;  2HEO A;  3BTI A;  3GX4 X;  3V8L A;  2DQR A;  5E8I A;  2NOJ B;  3CTA A;  4P1W A;  2XKO A;  1GLN A;  2GIV A;  2KJB A;  2DDB A;  3ABM H;  2DA6 A;  5IYD J;  2DOA A;  3DPT A;  2KIF A;  1JGS A;  4D9J A;  3TP3 A;  4CHU A;  2ZNZ A;  4R1H A;  1SMT A;  2BZT A;  2DK8 A;  1O3R A;  3ZRG A;  5FLX K;  3FWE A;  3O8H A;  1UB9 A;  3CES A;  4G6Q A;  2XAU A;  4ZYA A;  3Q0W A;  2CV1 A;  3E5U A;  4HW0 A;  3RDI A;  3NRV A;  2UXN A;  3OS2 A;  3A2K A;  1H89 C;  2JSC A;  3VYR B;  3CCJ I;  1MMS A;  1OCC H;  5AIQ A;  4AC0 A;  3IWF A;  3S1R J;  2EIL H;  4P55 A;  1EH8 A;  2YR2 A;  4KDP A;  1YYV A;  2HKO A;  2HOT A;  2EA4 A;  3LFK A;  1VQN I;  4UVC A;  5M5X J;  5K5R A;  3OIO A;  3K1P A;  2DYS H;  3QU3 A;  4Q4Z F;  3KX2 A;  1JGG A;  1FMV A;  3CC4 I;  4C2U A;  5DEQ A;  2W4S A;  3PNV A;  4YFN F;  2IP2 A;  3TQN A;  3IH3 A;  5LHH A;  3CJQ B;  2XPV A;  4F92 B;  1WVR A;  3FXR A;  1ZQ3 P;  2KZG A;  2Z33 A;  3BG9 A;  1J9I A;  2A6H F;  4AIK A;  3I5U A;  4WXH A;  2ZXI A;  3KIO A;  1IN7 A;  3HXL A;  4L9N A;  1PP8 F;  1R5G A;  2NS0 A;  1YHQ I;  1BN5 A;  4HZF A;  3LFU A;  4ZH4 F;  2WAQ A;  5J47 A;  4JX5 A;  1JUM A;  2UV1 A;  2AQF A;  3GFL A;  4XRM A;  3IWZ A;  1BJZ A;  2EV6 A;  5BMZ A;  1HSJ A;  3GTQ J;  1P2F A;  2M8G X;  3FXO A;  3DBL B;  3P9K A;  4H4K C;  2KFD A;  3OYG A;  2OQR A;  3PIP F;  1FOX A;  3DEW A;  1BC8 C;  2VC0 A;  3HL2 A;  4HNT A;  2GA1 A;  3BTC A;  5J8F A;  2E19 A;  1HOM A;  3I58 A;  2L9N A;  1L0O C;  1YG2 A;  3CCY A;  2GOX B;  2NOG A;  1JT6 A;  2IW5 A;  1S7A A;  2FSW A;  1PVE A;  2P6T A;  3J81 Z;  1GT0 C;  1TNT A;  2ICW G;  4V19 K;  1WI9 A;  1YX5 A;  3IV5 A;  4EGY A;  2WAQ N;  4XRS A;  2QQ9 A;  3KCC A;  1S7O A;  2Y69 H;  1TT0 A;  2VOO A;  1AHD P;  2XGE A;  3FMQ A;  2PMU A;  1BL0 A;  5CVU A;  2V26 A;  1ZLJ A;  1IXR C;  3HM5 A;  4UXN A;  5LFA A;  1A6I A;  3M8E A;  3KEQ A;  1P4A A;  3NWS A;  3N05 A;  1XX5 A;  1YLF A;  3SEQ A;  1I50 J;  1AKH A;  2CUF A;  1CF7 B;  5IOZ A;  3KYL A;  1UFM A;  2RKH A;  2QEX I;  4BYY A;  2A3S A;  2EV5 A;  3A0H C;  3CLO A;  2ACJ A;  5LLQ A;  2J5P A;  5DM6 F;  4D1Q A;  2STT A;  1XMX A;  1U2W A;  1YRN B;  4HX7 A;  3MKL A;  1EH7 A;  3M1C A;  3IKV A;  4A93 J;  2X9D A;  3TO7 A;  1XSX A;  1R58 A;  3K7A J;  1IRX A;  1Z7U A;  3EYI A;  1GHC A;  2QSF X;  1YS7 A;  3T8T A;  2BXZ A;  1X2M A;  2BHY A;  2DQL A;  3CCM I;  1JHF A;  5CJ9 A;  3RPU D;  3OWT A;  1IF1 A;  1GVD A;  2OA4 A;  2VQC A;  1XCV A;  1D1C A;  4I99 C;  2MW8 A;  4CIC A;  5A2Q K;  2CWE A;  1WWX A;  4LOC A;  4KIF A;  1YQA A;  5E1Z B;  3ZCO A;  5IY5 H;  1B8I B;  2OAZ A;  2KRH A;  3EQL F;  1J7K A;  1T33 A;  2LOO A;  2AQE A;  4IJA A;  4HLY A;  1RC9 A;  1S3J A;  1WJD A;  1NG7 A;  1G8X A;  2W82 A;  1OCR H;  2B9S A;  2R7Q A;  4EJU A;  3OL4 A;  4OMZ A;  2QVO A;  3MD2 A;  2GA2 A;  2W00 A;  3BJO A;  2Z16 A;  1BIA A;  5IT3 A;  1F9N A;  1YO5 C;  2IA2 A;  3K0L A;  3F23 A;  1U8B A;  5CLS A;  3L2R A;  1QVU A;  1P6R A;  2KPM A;  4HV6 A;  3P7N A;  1JKR C;  3IL2 A;  1RUN A;  1VZ0 A;  1FMW A;  2JMW A;  2XSJ C;  4J00 A;  2R7R A;  3HPH A;  2E71 A;  3JRB A;  2E60 A;  3FM3 A;  2IVM A;  2EBI A;  4CDG A;  1JUP A;  2L2O A;  1JJ6 C;  5HS7 A;  1Y56 A;  1FOY A;  3EET A;  2HDW A;  4PSW A;  3LST A;  4AWX B;  2DMQ A;  3SQN A;  5H6R A;  1MBG A;  3WGI A;  3JR9 A;  2JK3 A;  4U88 A;  1QZE A;  4IEJ A;  1ENH A;  1V5E A;  3GUD A;  1OR7 C;  5EEG A;  4E7H A;  1IN8 A;  1UST A;  1Z21 A;  5GAE J;  5L3G A;  1MW7 A;  4XRF A;  2IAI A;  3MN2 A;  1Y1V J;  4FX4 A;  2L9R A;  3QP5 A;  2ZJQ F;  2V4J C;  4U0V A;  3Q0U A;  1WGX A;  2JJ7 A;  2IS2 A;  1SD7 A;  4CCL A;  1QA6 A;  2LRE A;  3CDI A;  3K1M A;  2YUS A;  2LMD A;  4UUT A;  3CME I;  1ODD A;  3S2H J;  5EYR A;  2R5Y A;  4M6Y A;  5LRR A;  4YFK F;  2Y48 A;  4Y33 A;  4BY1 J;  2X6X A;  3GCM A;  1ULY A;  3K6G A;  4RGU A;  1LE8 B;  3C18 A;  4LGW A;  2CG4 A;  4IX7 A;  5AIP A;  3K70 D;  1PUF A;  3BT9 A;  3IH2 A;  1IZ1 A;  4EM1 A;  3VB2 A;  2ZME C;  1YW9 A;  1KQ9 A;  2QKL B;  3KP2 A;  1B72 A;  1W1W E;  3OYC A;  2MA3 A;  1Z3X A;  2HTS A;  3WTY C;  5D4S A;  1ON2 A;  2DTZ A;  3OYM A;  4OIO F;  3FXU A;  2BY0 A;  2CMP A;  3PSF A;  3SFI A;  4A0X A;  2XPU A;  1R1T A;  2CUZ A;  1G3S A;  2L0K A;  2VKH A;  3CUQ B;  3RSN A;  2ME0 A;  1KYZ A;  4IF4 A;  1IAW A;  1LNW A;  4DZP A;  3RTR A;  1TBX A;  2V9K A;  3LOC A;  4B3A A;  3G2B A;  5ICG A;  3I59 B;  1JTX A;  1I27 A;  2PMZ A;  1X3W B;  3BTL A;  3ABU A;  4HST A;  3DEE A;  2ELH A;  2NNN A;  2M8E A;  1WJC A;  5ICE A;  2CQX A;  2BY3 A;  2CSO A;  3BP8 A;  3E6C C;  2R5Y B;  4MEX F;  1YFH A;  4Y3O A;  1I6X A;  4CH7 A;  3CCE I;  4A3F J;  3SHF A;  1ZK8 A;  3F6O A;  3F6V A;  4O3M A;  2F5E A;  2MFZ A;  1YIT I;  3E6D A;  4PZJ A;  5JHU A;  2GWR A;  4A12 A;  4N9H A;  4Q48 A;  4LG0 A;  4KMF A;  1LVK A;  3EUH C;  2KT0 A;  2XAF A;  4LK0 F;  5LGU A;  3EUA A;  1EA3 A;  4RS8 A;  1ZAO A;  1MGT A;  1R22 A;  1MJA A;  3F8C A;  4BGD A;  1EV7 A;  4GXO A;  3ERE D;  2KMU A;  3CJT B;  4MFE A;  1Y0N A;  4PCQ A;  4RDU A;  5DUI A;  2ZKZ A;  1BW6 A;  3OIQ A;  3S1N J;  2R7W A;  2PFB A;  4PSX A;  3ZQQ A;  5J8C A;  2VIX A;  3LAJ A;  1W5T A;  3QU6 A;  2WAE A;  3CO6 C;  1FSE A;  3GTG J;  4ON0 A;  5IYC J;  3BR0 A;  4LIV A;  1IXS B;  2FNP A;  2DBB A;  1TC3 C;  3R60 A;  1QHH D;  1VI0 A;  3L1P A;  5FLX Z;  3KP5 A;  5LEK A;  3WTU C;  3TBI A;  4ZZD A;  1GDT A;  4EM0 B;  2LBF B;  4NUB A;  2V9P A;  3MKY B;  2CQN A;  3A1Y A;  3QYB A;  1U6G A;  3I56 I;  4BHC A;  2CJJ A;  2HOE A;  2EFW A;  2LD5 A;  2VJJ A;  5K7F A;  1N77 A;  1WJ5 A;  2EQR A;  3FKI J;  4AYB N;  4UVB A;  2STW A;  1D0Z A;  2LKX A;  3CCQ I;  5CQE A;  3KEY A;  5B1A H;  1D5Y A;  2AO9 A;  1BI3 A;  3FDY A;  3V7R A;  3H92 A;  2J5O A;  4ENN A;  4MLO A;  3S14 J;  5BOX A;  1KYW A;  3H3V K;  2QA4 I;  1BI0 A;  4AID A;  1X1D A;  2FBH A;  2EZL A;  1ETV A;  2IS6 A;  5GPC A;  5D5V B;  2EV0 A;  1NTC A;  2LF7 A;  2CRG A;  4B09 A;  1XCB A;  3I55 I;  3QWL A;  1IN4 A;  2RQQ A;  3C2G A;  4FIS A;  1TL8 A;  1VQK I;  4EM2 A;  2DLL A;  2Y31 A;  2VN2 A;  2HGC A;  1SFE A;  4JP0 A;  3ZMT A;  1T8I A;  3ZR8 X;  2MBF A;  1G4D A;  5EEH A;  4KYW A;  1K6O A;  2BHZ A;  2ECC A;  4RAG A;  2X1D A;  3WGH A;  4S05 A;  1VQM I;  1ZG3 A;  3CCS I;  5DD8 A;  2P81 A;  3ZQH A;  3H5A A;  5ILU A;  1OQY A;  3RQI A;  1D5V A;  3FX3 A;  1YW7 A;  2YU9 J;  3GFJ A;  5KVR A;  1ZAR A;  3WTS C;  1DP7 P;  1FY7 A;  1WZ2 A;  4BQA A;  4BXF A;  3D0S A;  3WTW C;  4DGW B;  1XDS A;  4KN4 X;  2IXS A;  3ZQG A;  1TWH J;  1QVT A;  3ZQC A;  4P9F A;  2K86 A;  1GXQ A;  2W84 A;  4CCK A;  4F52 A;  2V6C A;  3PUF A;  2WTE A;  5EZH A;  5B1B H;  6PAX A;  2H09 A;  1ZR4 A;  5J1R A;  5FLV A;  3J80 Z;  4M73 A;  3GW2 A;  2P8T A;  3WG7 H;  4A5M A;  3SEZ A;  4A3C J;  1HW2 A;  3FHZ A;  3AFH A;  1XGS A;  3H0D A;  3CDL A;  3BQY A;  1LDD A;  4JX6 A;  3ZP5 A;  1QZZ A;  1A04 A;  2E5Z A;  4RLQ A;  3GZ5 A;  2ZSH B;  1Y6I A;  3CZ6 A;  4HAM A;  3G6E I;  3T5X A;  3F22 A;  1FWZ A;  1AKH B;  2BY2 A;  1D3Y A;  4DQ2 A;  2V1U A;  3ML6 A;  2F6C A;  2EFO A;  1B59 A;  1Z77 A;  1MNM C;  4Y15 A;  1X58 A;  1U0J A;  1O4X A;  4ESJ A;  1SFX A;  2HVS A;  2WBM A;  3DPU A;  2EFQ A;  3ASN H;  2O9L A;  2GZW A;  2VOD A;  1G6N A;  2ESN A;  4L5E A;  3PO2 J;  1MSF C;  1JHH A;  1DGW Y;  2PJR B;  4GYI A;  4IKF A;  3K1N A;  3REO A;  2QKM B;  5K5Q A;  4IHW A;  4IRG A;  2RNJ A;  2HNH A;  5L3E A;  4BBR J;  2DO7 A;  2JZY A;  4G94 A;  3WTT C;  2PG4 A;  2R7O A;  2V6E A;  3QP6 A;  3DCF A;  2XAG A;  4XLN F;  2M30 A;  2KDZ A;  4II2 A;  3B73 A;  2IGK A;  1TTY A;  3NAR A;  4PFP A;  3OYN A;  5GAD J;  4WCG A;  1Z91 A;  5BPD A;  2LG4 A;  1KU3 A;  4IHY A;  3L00 A;  4S04 A;  2LP0 A;  3I4P A;  1ZHF A;  1E2X A;  3VSK A;  5C44 J;  3RPQ A;  2HQN A;  3I71 A;  4DJA A;  2L5Q A;  2A6E F;  2BW3 B;  1IN6 A;  2K7L A;  4BE1 A;  2VE8 A;  2MLG A;  1M1E B;  2IS1 A;  1U78 A;  1E0E A;  1YX3 A;  4XK4 A;  3FIW A;  2LTP A;  3DFG A;  2XGD A;  2DT7 B;  3EPZ A;  3K10 A;  3ZOB A;  1MMA A;  4PGH A;  3DKX A;  5C4J J;  5CYV A;  5K7H A;  3JRA A;  4RM2 A;  1MMD A;  4S0H B;  3S1Q J;  1FTZ A;  3GTM J;  2L9S A;  3VYS B;  4YIR X;  3K4K A;  3MCZ A;  1UG0 A;  4O6J A;  1O7F A;  2XUB A;  1MH3 A;  1KGS A;  3UKG A;  4KJZ A;  3G71 I;  2O7O A;  1R1U A;  1QO0 D;  1W5C C;  1XTA A;  1A36 A;  2MYS A;  2JA8 J;  3TL4 X;  4WK8 F;  1U5T A;  3S3N A;  5H6Q A;  1KU2 A;  2K5C A;  2LRD A;  2OBP A;  4B3X A;  4HNV A;  4FE7 A;  3PQJ A;  3JRG A;  1Z6T A;  3LSP A;  2L7F P;  5IYB J;  5HDG A;  1CF7 A;  1YE9 A;  1B9M A;  3H5R A;  3KP6 A;  5GTH C;  4M72 A;  4L0Z B;  3FXM A;  2XAS A;  3HRT A;  4YEJ A;  3RYR A;  3KFW X;  3KP3 A;  5E8G A;  3GTP J;  1RKT A;  3VOD A;  1RRJ A;  1F1Z A;  3AG2 H;  2QQA A;  4XOR A;  4ZYH A;  3ECH A;  1ZG5 A;  1TP4 A;  2OCE A;  1SD4 A;  4BE2 A;  1ZLK A;  4BU2 A;  3FIS A;  2F2E A;  1HDD C;  4LFU A;  3P9C A;  1R49 A;  5F64 A;  3ZMD A;  1RPW A;  3P9I A;  3S32 A;  3BC8 A;  4KT5 C;  4UHT A;  2NNY A;  4FX0 A;  4WXD A;  3ELK A;  1K4S A;  4XRS G;  1B4A A;  3OYE A;  4NHJ A;  2W25 A;  4OWR B;  3A01 B;  3LA7 A;  3BG5 A;  2DOF A;  3HUG B;  1XSV A;  2X51 A;  2OJE D;  3WU0 A;  1S29 A;  4KNY A;  2H8R A;  4XMY A;  2JRT A;  3EYY A;  3MAJ A;  1X4P A;  2HOA A;  3WHC A;  2M4K A;  3MFK A;  1FZP B;  4KFC A;  3MVP A;  1TT5 B;  2FOW A;  3O8G A;  1WKM A;  3HOY J;  2E2H J;  2QUF A;  4D5F A;  1DP3 A;  1UZC A;  3FKJ A;  2TRT A;  3Q5F A;  3Q0V A;  1T39 A;  3FXQ A;  2ZXH A;  2QSG X;  3GF2 A;  4UB6 C;  2CH0 A;  2F4M B;  2G0E A;  3MKW B;  1GV5 A;  4V2G A;  4C3I J;  2KP6 A;  3VPR A;  4RAF A;  4AYB A;  3PL8 A;  1CQT A;  3GTL J;  4XLF A;  3K4J A;  4AIH A;  1OCO H;  1SD5 A;  3S1M J;  1JJ8 C;  3CD6 I;  2XF5 A;  1DPR A;  2LDU A;  3ZMZ A;  2MD0 A;  2R7S A;  1LEB A;  2Y0M A;  2FBK A;  2DMP A;  3VSL A;  3G73 A;  1T56 A;  3JRE A;  2LBF A;  2VAS A;  3FXJ A;  1NK2 P;  1I6H J;  5HVQ C;  5IOY A;  2BGC A;  5B5E C;  3GYH X;  3WE2 A;  1UHM A;  3GFI A;  2V1D A;  1Y8Q B;  4IVN A;  2RNG A;  3A0B C;  4XKW A;  2GOM A;  3TW7 A;  4GO1 A;  4QIW N;  1GV2 A;  2PBI A;  4HBL A;  4CCJ A;  3BY6 A;  2JVH A;  1ONV A;  5E18 F;  3OIP A;  4C2T A;  4HOB A;  1W36 D;  2H6B A;  3MZ8 A;  4QWQ A;  3HOV J;  1KU9 A;  2HS5 A;  3WG9 A;  5J4V A;  2BYV E;  1PYV A;  3DEU A;  5F0H A;  1RUO A;  2CW8 A;  4F93 B;  2ID3 A;  3BDD A;  1AU7 A;  4HPQ A;  2LY2 A;  2QWW A;  3FMR A;  4KN7 X;  1BJA A;  4E4H A;  4HNU A;  3HOZ J;  2W48 A;  4N4N B;  1Y1W J;  1JT0 A;  2MC4 A;  4RLF A;  3ZQI A;  2BVL A;  2VQH A;  4C30 A;  1FBU A;  1RKW A;  2GXG A;  1LVA A;  1T98 A;  2KRF A;  3HSR A;  4EJT A;  2FD5 A;  2COM A;  3K2Z A;  2IT0 A;  2O5R A;  3AG1 H;  1XN7 A;  1Z1D A;  3HGY A;  2RQP A;  2CQK A;  2BOL A;  2H6C A;  3TED A;  4FQG A;  4HDU A;  3CC2 I;  1WPK A;  1JXS A;  2I10 A;  3RKW A;  2JSP A;  5HLI A;  4G8X A;  4ZDP A;  3R0J A;  4I76 A;  4XON A;  3G1L A;  3LWF A;  4P96 A;  2XB0 X;  2C6Y A;  2Y9Y A;  4I01 A;  3OYJ A;  4BKX A;  1I5Z A;  2IPQ X;  2M3A A;  1VQP I;  3MQ0 A;  3CCR I;  5FKM A;  2O8K A;  2BV6 A;  2L7Z A;  3N4M A;  1OKR A;  2HU9 A;  3V42 A;  3OYL A;  1D0Y A;  2DT6 A;  3CUQ A;  2ETH A;  1Y8R B;  1TWG J;  1Q1H A;  2HQR A;  1IGN A;  1XS9 A;  2WB1 A;  3QQA A;  2L3D A;  2ZXW H;  5HOD A;  2QGU A;  5M3M J;  2O8X A;  1R7J A;  4I09 A;  2IGN A;  5EZG A;  5JVT A;  4F7Z A;  2NVU B;  2NAZ A;  3PJR A;  4WWC A;  1VQ8 I;  1I3A A;  4LB5 A;  2AHQ A;  4ANJ A;  1HST A;  3GEZ A;  1IDY A;  2WY7 Q;  3BPV A;  4HX8 A;  5HOO A;  3NAU A;  4HEA 2;  2FUG 2;  2ZC2 A;  4F91 B;  1E3P A;  1MMG A;  4W97 A;  2ISZ A;  2Z5U A;  1OIS A;  2E1C A;  4BHB A;  3F8M A;  2P0W A;  3E97 A;  5ERI A;  1WHU A;  2Q0O A;  3SZT A;  2ELK A;  3I59 A;  3HKZ N;  1XD7 A;  2FRH A;  2XGX A;  3BR5 A;  1Y39 A;  4U0W A;  4E7I A;  1IN5 A;  1RI7 A;  4DOZ A;  3FK6 A;  2H1L A;  1KU7 A;  3VOE A;  2O3F A;  4F3Q A;  3AG4 H;  1MND A;  3EUK L;  5ILS A;  4DZJ A;  3S3O A;  1G3W A;  4EMS A;  1K4T A;  2CQQ A;  1Z7L A;  3CUQ C;  3BQZ A;  4ZYE A;  3GME A;  3BG7 A;  3HOT A;  1OMI A;  2L4A A;  2CV0 A;  2M1B A;  3DLA A;  5L3B A;  3DV8 A;  2XF6 A;  2XPW A;  2ZNY A;  4OIQ F;  1K6Y A;  2JA7 J;  1G3T A;  3B6A A;  1J09 A;  5JFR A;  3BR6 A;  3KLN A;  1WJF A;  1MZB A;  2NXN B;  2K9S A;  4CSW A;  2VLA A;  4DYC A;  1Z05 A;  1OYI A;  3WTV C;  2IBD A;  3IAS 2;  2NVX J;  3MZH A;  4BDZ A;  1C0W A;  4KIS A;  4OOI A;  3WOD F;  4CZC A;  1H88 C;  1YI2 I;  4B8X A;  4XNF A;  1F43 A;  2HPI A;  4AUX A;  2FJ1 A;  5IT9 Z;  1USS A;  2ZJP F;  2B63 J;  4L9J A;  1SD6 A;  5DCM B;  1R36 A;  2A5W A;  3KE2 A;  2P6S A;  4RA2 A;  4M6X A;  5J1U A;  3RKY A;  3X2Q H;  1L3L A;  4M3G A;  2XB5 A;  1BC7 C;  2OUM A;  3CF2 A;  1XC5 A;  3K2A A;  2DTR A;  2HKX A;  2JA6 J;  1NK3 P;  2K02 A;  1T0F A;  5FD6 A;  5C4X J;  1QPI A;  4PDK A;  1TZL A;  2ZJR F;  3KEO A;  3DWL E;  2F48 A;  1H9G A;  2DA7 A;  1Z0X A;  1P4W A;  1ZRC A;  1P7J A;  3ISP A;  3LNQ A;  1WRJ A;  3BZC A;  1TW2 A;  1KQ0 A;  3PFI A;  3KLO A;  4BBS J;  1IXC A;  3HYI A;  2R92 J;  2XF7 A;  2Z3Y A;  1CGP A;  2M87 A;  1REP C;  5GAH J;  3BJA A;  3ZN1 A;  2QBY B;  1GUU A;  3J7A O;  4BJ5 C;  2PMZ N;  2VBW A;  4F55 A;  4E7K A;  1ZRF A;  4IOC F;  2Q2E B;  3TDZ C;  5HDK A;  2CYY A;  5HLT A;  5FO5 A;  2FX0 A;  2GAU A;  4PJL A;  1T08 B;  2Z2S B;  1U5T C;  1ZTR A;  3QRF F;  3L7W A;  3CJN A;  4RB1 A;  4XR6 A;  2HYJ A;  2VPR A;  4X1E A;  1FSH A;  5LEJ A;  3GTJ J;  3HOU J;  3JRH A;  5GPA A;  1LKX A;  3NEU A;  2MH2 A;  3TOA A;  4ASN A;  4B44 A;  1B8I A;  4KIB A;  3HG9 A;  5E79 C;  5EJC A;  1IC8 A;  2HDC A;  4G9Y A;  3P5J A;  2PJP A;  2Y9Z A;  2HQA A;  2RV8 A;  4NC8 A;  1VQ6 I;  1ETX A;  2EZI A;  2WY8 Q;  2H27 A;  4B48 A;  2Y30 A;  2R7V A;  2XAH A;  3HSE A;  2EPF A;  5K7Z A;  2EIN H;  3ABK H;  1XG1 A;  4GRI A;  5FB2 A;  2L7K A;  2JQ7 A;  1P9Q C;  2YS9 A; 
#chains in the Genus database with same CATH homology
 3NQO A;  1QBJ A;  3RPU A;  3V4G A;  2E7W A;  2W24 A;  3GVA A;  2JPB A;  4L5J A;  2RN7 A;  1OR7 A;  2B0L A;  3RIR A;  5L3C A;  3W6J B;  4HQM A;  4L5I A;  2FMY A;  1IUY A;  2R7D A;  4N0B A;  4GCV A;  2UZK A;  5HS8 A;  4LLN A;  2VT3 A;  4R79 A;  3KP7 A;  3WTX C;  3I53 A;  2P5V A;  4UV9 A;  5K5O A;  4P9U A;  3H3Z A;  2L02 A;  5HLG A;  5LHG A;  2PQ8 A;  1V3F A;  1E17 A;  3DKW A;  4GGG A;  3SXY A;  4JBA A;  4HLX A;  2MD5 A;  1V4R A;  3V7S A;  4EJO A;  1HBX G;  2DAO A;  1G3Y A;  4ETS A;  2LNB A;  3F8N A;  1K78 A;  3OOP A;  2PEX A;  2XRN A;  3MZY A;  5K1Y A;  2EWN A;  2UXX A;  4YG2 F;  3RYP A;  4MHG A;  3JTG A;  4RAY A;  4ESF A;  2XRO A;  2WV0 A;  1BM9 A;  4WF2 A;  4LB6 B;  2O61 A;  2RVC A;  2FNA A;  1Z9C A;  1HKT A;  2P5L C;  5D5U B;  1FNN A;  3ZMV A;  3HRS A;  1WQ2 A;  1F4K A;  4XSZ F;  2LSO A;  2FXA A;  3HSF A;  4RGR A;  2CGP A;  1QZY A;  3MWM A;  4DNC A;  2FOK A;  2HTJ A;  4RAZ A;  1UCR A;  5D8K B;  5LGT A;  3VFZ A;  4BHP A;  2L4M A;  3F21 A;  3HUG A;  2P7V B;  5ILV A;  3RJP A;  5L3F A;  2ISY A;  1Z6R A;  2XAJ A;  4ZYD A;  3VEP A;  2VXZ A;  3J81 K;  2F5D A;  4L9T A;  2CW0 F;  2VOP A;  3JAM K;  2A61 A;  1YTY A;  4AD9 A;  2G7U A;  2DI3 A;  3F8F A;  2DT5 A;  3E3V A;  2EFP A;  1U8R A;  2JPC A;  4ENM A;  2EJR A;  4MNU A;  2W57 A;  2EB7 A;  2XV4 S;  4M71 A;  1W5S A;  1TNS A;  4UVA A;  4UV8 A;  3E5Q A;  3WE3 A;  2P7C B;  2PMH A;  4A6E A;  1ZYR F;  5BQT A;  1ZG1 A;  1T6S A;  3EUH A;  2RDP A;  4RB0 A;  3GLX A;  2FE3 A;  2KIM A;  4EV0 A;  2X4H A;  4M9Z A;  3ABT A;  2K4B A;  2ZBK A;  3IKT A;  1DDN A;  1LEA A;  4LJZ F;  3CDH A;  1J59 A;  4TV7 A;  1PUE E;  1OYW A;  1BI1 A;  4GYG A;  4G7H F;  4Y13 A;  5E20 A;  2QLZ A;  1K7A A;  2FBI A;  2M5W A;  4LLG F;  2XKP A;  4E70 A;  2O6G E;  4R8H A;  4P5O A;  4ESB A;  1TQP A;  1FPQ A;  2HYF A;  1QPM A;  1ZGJ A;  3L2C A;  3GFM A;  3GZ6 A;  3TOB A;  1R23 A;  3JSO A;  1HQC A;  4ENJ A;  2FQ3 A;  2ZJ2 A;  4L9V A;  3L9F A;  3HTU A;  5ICC A;  3R6S A;  4IRH A;  1LQ1 A;  2L01 A;  2ZO4 A;  3JW4 A;  1XGM A;  5LBQ A;  4EJV A;  1I1G A;  4IHS A;  4CZZ A;  4EJW A;  2O03 A;  3TDU C;  3FZV A;  2E7X A;  5DUK A;  4ZYG A;  5LRS A;  2K27 A;  4NQW A;  4HA8 A;  1SFU A;  3KP4 A;  4OU0 A;  2A5Y B;  2KKO A;  4WXC A;  5HLH A;  1FBQ A;  1OYY A;  2Z99 A;  4LMY A;  5AON A;  1FYL A;  2OQG A;  3F72 A;  3OV8 A;  4XSX F;  1ZGA A;  1QNT A;  5CVV A;  3EDP A;  3ULQ B;  5LHI A;  3TO6 A;  2VBY A;  2Y75 A;  2GQQ A;  4BAY A;  4CO8 A;  5L3D A;  1JE8 A;  1B6A A;  4KA4 A;  5HS9 A;  1O7L A;  5LGN A;  3W6K B;  4OIR F;  1XB4 A;  2V79 A;  1P92 A;  1DUX C;  2DFI A;  2G9W A;  4UUV A;  1ON1 A;  2Q2E A;  1SMY F;  4FT8 A;  4UNO A;  1ZH5 A;  1O57 A;  2DK5 A;  3C1D A;  3KZY A;  1J2X A;  4A5N A;  1AWC A;  2DPU A;  2HFH A;  1S8N A;  2CFX A;  5TRD A;  5ED4 A;  3B02 A;  3JTH A;  1OPC A;  3S2W A;  4A0Z A;  2BEO A;  3CO7 C;  1HW1 A;  2OU2 A;  2PI0 A;  3LAP A;  5BS6 A;  4G7Z F;  1J5Y A;  4RB3 C;  3QOP A;  3E5X A;  5F1R A;  3FM5 A;  4HX4 A;  3HRM A;  4I0A A;  3COA C;  3GXO A;  4LD5 A;  3O2P E;  3D5L A;  3ZN0 A;  1MJB A;  3BJ6 A;  5D6F A;  2VBX A;  3WGG A;  4IHT A;  4RB2 C;  4MTD A;  3I64 A;  2D1H A;  4ENK A;  3TKY A;  1O3T A;  4OMY A;  2DU9 A;  4L18 B;  3RI4 A;  1KA8 A;  1QGP A;  2HYG D;  3C7J A;  1XGO A;  3O3K A;  1FT9 A;  4XLP F;  3LQR A;  3E6M A;  4I0B A;  5D6E A;  3DPL C;  1HW5 A;  1MJ9 A;  2XHK A;  2E1N A;  3GWZ A;  3V8K A;  3K9T A;  3ZMS A;  2ESH A;  2XVC A;  3SZP A;  1FC3 A;  4ZZL A;  2DW4 A;  1STZ A;  4NB5 A;  4YIF A;  5J6X A;  2QQB A;  2R3S A;  4KIC A;  4JK1 X;  4I98 B;  2R7F A;  4MTE A;  2LKP A;  4HQE A;  1DPU A;  4IXA A;  3U1D A;  3DP7 A;  4HF0 A;  1D8K A;  2D2W A;  1MD0 A;  5TJJ A;  3HOS A;  4HF1 A;  3CUO A;  4KMU X;  2QZ8 A;  4A2U A;  1FLI A;  2MC3 A;  3ZQ7 A;  3AAF A;  1O3Q A;  1B9N A;  2RGV A;  4HYE A;  2JTV A;  1U3E M;  5FFX A;  1BI2 A;  4AVP A;  4RGX A;  5JR3 A;  5E1W A;  1IRG A;  1FYM A;  3F8B A;  5JI6 A;  3ROU A;  4LK1 F;  1S6L A;  4N9I A;  3JSP A;  2QEN A;  3R61 A;  4YFX F;  4QLC U;  3TO9 A;  1ZN2 A;  4KIG A;  1IW7 F;  2ZME B;  2VC1 A;  1XSD A;  4HDV A;  3BOQ A;  4CXF A;  4M9S A;  1XMA A;  2UWM A;  1PDN C;  3IRQ A;  3M9A A;  2XAQ A;  3DXJ F;  4A0Y A;  5D8L B;  3JAM Z;  1W7P A;  3IC7 A;  4RGS A;  3ECO A;  4EVI A;  1FP2 A;  3I54 A;  2CO5 A;  4D0P A;  2PLY A;  1PP7 U;  4M9X A;  3HIF A;  2ZCW A;  5IT9 K;  1RIO H;  5F6F A;  1D8J A;  3PQK A;  2ZME A;  2LF8 A;  4G6D A;  1AOY A;  1BBY A;  5DCF A;  2OD5 A;  2VT2 A;  2M45 A;  5ICF A;  2FU4 A;  4BH9 A;  2KJC A;  1FP1 D;  1YW8 A;  2W85 A;  3J80 K;  4I7H A;  3M7G A;  4IRI A;  4XBF A;  4BXU A;  1MDM A;  1TQM A;  5DV5 A;  1GXP A;  4MGR A;  2A68 F;  3HRU A;  2TDX A;  2L54 A;  2IJL A;  4MEY F;  5HDN A;  5E17 F;  1TQI A;  4HF2 A;  1R1V A;  1Y0U A;  2A69 F;  1HKQ A;  4JQF A;  3QAH A;  5KK1 A;  4U7B A;  2H94 A;  1K78 B;  2Q8K A;  3HHH A;  3T1B A;  1ZRE A;  1U5T B;  1XDU A;  3DQV C;  2FML A;  1YS6 A;  1FBS A;  3L09 A;  1NHA A;  1J75 A;  5D5X B;  2EA2 A;  4LLL A;  1KQ8 A;  1BIB A;  3BRO A;  4L0Y B;  3O6B B;  3TGN A;  1TW3 A;  4KUM A;  4FHT A;  2GXB A;  2VON A;  4HV5 A;  3GO5 A;  1RNL A;  2HZT A;  5FFZ A;  3BWG A;  3U9G A;  5FD5 A;  3SFZ A;  3WU1 B;  3KET A;  3WTZ A;  3FMS A;  1T38 A;  3M1E A;  3ZPL A;  4O5V A;  2EK5 A;  3HHG A;  1MDM B;  1XMK A;  2K4J A;  2X0L A;  1W4M A;  1GVJ A;  3DF8 A;  4Y17 A;  1FOK A;  3K69 A;  2YX4 A;  2V9V A;  4LG0 B;  3M8F A;  3R0A A;  2MLK A;  2MH9 A;  2IA1 A;  3Q9S A;  2IA0 A;  4Z2Y A;  1HXD A;  1K79 A;  3BZ6 A;  4U7D A;  1T2K A;  4AIJ A;  1IRF A;  2F5F A;  1R00 A;  2DPD A;  1HKS A;  4PGG A;  2KIU A;  1RZ4 A;  4K2E A;  3N97 A;  1TLH B;  5FGM A;  5CVI A;  1LDK B;  2D1V A;  2JT1 A;  2PN6 A;  4EQQ A;  4Q5S F;  5DDG A;  1LB2 A;  1J0R A;  3G3Z A;  2IRF G;  1FX7 A;  2QYO A;  4YII A;  1ZRD A;  2FEZ A;  2XIG A;  2QBY A;  2A07 F;  2Z9O A;  2O0Y A;  1WSU A;  1XGN A;  2NYX A;  4IPA A;  2HWV A;  2V1X A;  2QM3 A;  3HTS B;  3LA2 A;  2WWY A;  3LQQ A;  3Q9V A;  5DCM A;  3KZZ A;  1I1S A;  3MEX A;  1H0M A;  1LJ9 A;  3BPX A;  1EH6 A;  2G7H A;  1MKM A;  5CVR A;  5CVJ A;  3IHU A;  5E1X A;  4EGZ A;  3T8R A;  5DYM A;  3F3X A;  4I2O A;  2D45 A;  2YSR A;  4Q47 A;  1H9T A;  5H20 A;  3LA3 A;  4MQV A;  2YU3 A;  4U0Y A;  2NRA C;  4I02 A;  3U2R A;  4OIP F;  1YIO A;  1B1B A;  2WC2 A;  2OZ6 A;  1W7P D;  2VBZ A;  4WX9 A;  4H0E A;  1VTN C;  2FF4 A;  1X3U A;  5DD4 A;  2P5K A;  2FA5 A;  4CYD A;  3IRR A;  2VE9 A;  3T0Y A;  2OZU A;  1W7P B;  3QPH A;  4CGZ A;  4A6D A;  4BNC A;  1O3S A;  2EFN A;  2AXL A;  2AS5 F;  3ZMU A;  1SAX A;  3I0T A;  2F5C A;  2RC4 A;  2P4W A;  3QPT A;  5A2Q Z;  2ADU A;  3E6B A;  1BOA A;  2BE5 F;  2HR3 A;  2BBY A;  5D5W B;  5BPI A;  3C3W A;  4OIN F;  5D4R A;  1FYK A;  4M74 A;  1F5T A;  2YPR A;  1P4X A;  1UHW A;  4MQ9 F;  3R4K A;  3H3U A;  4G7O F;  1LDJ A;  3RKX A;  1QQI A;  3V8J A;  2YX7 A;  1R5H A;  2ZXJ A;  3V7C A;  2ZFW A;  3FF5 A;  2HEO A;  3GX4 X;  3V8L A;  2DQR A;  5E8I A;  3CTA A;  2XKO A;  2GIV A;  2KJB A;  3DPT A;  2KIF A;  1JGS A;  4CHU A;  2ZNZ A;  4R1H A;  1SMT A;  2DK8 A;  1O3R A;  5FLX K;  3FWE A;  1UB9 A;  4G6Q A;  3E5U A;  4HW0 A;  3RDI A;  3NRV A;  2UXN A;  2JSC A;  5AIQ A;  3IWF A;  4P55 A;  1EH8 A;  2YR2 A;  4KDP A;  1YYV A;  2HKO A;  2EA4 A;  3LFK A;  4UVC A;  5K5R A;  3K1P A;  3QU3 A;  4Q4Z F;  5DEQ A;  4YFN F;  2IP2 A;  3TQN A;  5LHH A;  3FXR A;  2Z33 A;  1J9I A;  2A6H F;  4AIK A;  3I5U A;  4WXH A;  1IN7 A;  4L9N A;  1PP8 F;  1R5G A;  2NS0 A;  1BN5 A;  4HZF A;  4ZH4 F;  3GFL A;  3IWZ A;  2EV6 A;  5BMZ A;  1HSJ A;  1P2F A;  3P9K A;  2OQR A;  1BC8 C;  2VC0 A;  2GA1 A;  5J8F A;  3I58 A;  1L0O C;  1YG2 A;  2IW5 A;  1S7A A;  2FSW A;  2P6T A;  3J81 Z;  1TNT A;  1WI9 A;  4EGY A;  2QQ9 A;  3KCC A;  1S7O A;  2VOO A;  3FMQ A;  2PMU A;  5CVU A;  1ZLJ A;  1IXR C;  4UXN A;  3M8E A;  3KEQ A;  1P4A A;  1YLF A;  1CF7 B;  1UFM A;  2RKH A;  4BYY A;  2A3S A;  2EV5 A;  3CLO A;  2ACJ A;  5LLQ A;  2J5P A;  2STT A;  1U2W A;  4HX7 A;  1EH7 A;  3IKV A;  3TO7 A;  1XSX A;  1R58 A;  1Z7U A;  3EYI A;  1GHC A;  3T8T A;  1YS7 A;  2DQL A;  1JHF A;  5CJ9 A;  1IF1 A;  2OA4 A;  1XCV A;  4CIC A;  5A2Q K;  2CWE A;  1WWX A;  5E1Z B;  4KIF A;  1YQA A;  2OAZ A;  3EQL F;  1J7K A;  4IJA A;  4HLY A;  1S3J A;  4EJU A;  4OMZ A;  2QVO A;  2GA2 A;  3BJO A;  1BIA A;  5IT3 A;  1F9N A;  1YO5 C;  2IA2 A;  3K0L A;  3F23 A;  5CLS A;  1P6R A;  1RUN A;  4HV6 A;  3P7N A;  3IL2 A;  3FM3 A;  2IVM A;  4CDG A;  5HS7 A;  3EET A;  3LST A;  4AWX B;  3SQN A;  5H6R A;  3WGI A;  4U88 A;  3GUD A;  5EEG A;  1IN8 A;  1UST A;  5L3G A;  4XRF A;  4FX4 A;  3QP5 A;  4U0V A;  1SD7 A;  3K1M A;  1ODD A;  4M6Y A;  5LRR A;  4YFK F;  2Y48 A;  4RGU A;  1ULY A;  3C18 A;  4LGW A;  2CG4 A;  5AIP A;  1IZ1 A;  4EM1 A;  3VB2 A;  1YW9 A;  1KQ9 A;  3KP2 A;  2MA3 A;  2HTS A;  3WTY C;  5D4S A;  1ON2 A;  4OIO F;  3FXU A;  4A0X A;  1R1T A;  1G3S A;  3CUQ B;  1KYZ A;  4IF4 A;  1IAW A;  1LNW A;  3RTR A;  1TBX A;  5ICG A;  3I59 B;  1I27 A;  3ABU A;  2ELH A;  2NNN A;  2M8E A;  5ICE A;  2CSO A;  3BP8 A;  3E6C C;  4MEX F;  1YFH A;  1I6X A;  3SHF A;  3F6O A;  3F6V A;  4O3M A;  2F5E A;  3E6D A;  4PZJ A;  5JHU A;  2GWR A;  4A12 A;  4N9H A;  4Q48 A;  4LG0 A;  4KMF A;  2XAF A;  4LK0 F;  5LGU A;  4RS8 A;  1ZAO A;  1MGT A;  1R22 A;  1MJA A;  3F8C A;  1EV7 A;  4GXO A;  3ERE D;  4PCQ A;  5DUI A;  2ZKZ A;  2PFB A;  5J8C A;  3LAJ A;  1W5T A;  3QU6 A;  3CO6 C;  1FSE A;  4ON0 A;  1IXS B;  2FNP A;  2DBB A;  3R60 A;  5FLX Z;  3KP5 A;  5LEK A;  3WTU C;  4ZZD A;  4EM0 B;  1U6G A;  4BHC A;  2HOE A;  2EFW A;  4UVB A;  2STW A;  1BI3 A;  3V7R A;  3H92 A;  2J5O A;  4ENN A;  5BOX A;  1KYW A;  1BI0 A;  2FBH A;  5D5V B;  2EV0 A;  2LF7 A;  4B09 A;  1XCB A;  1IN4 A;  4EM2 A;  2DLL A;  1G4D A;  2VN2 A;  3ZMT A;  2HGC A;  1SFE A;  2MBF A;  5EEH A;  4KYW A;  1K6O A;  3WGH A;  4S05 A;  1ZG3 A;  5DD8 A;  5ILU A;  1D5V A;  3FX3 A;  1YW7 A;  3GFJ A;  5KVR A;  1ZAR A;  3WTS C;  1DP7 P;  1FY7 A;  4BQA A;  3D0S A;  3WTW C;  1XDS A;  4KN4 X;  4P9F A;  2K86 A;  1GXQ A;  2W84 A;  2V6C A;  2WTE A;  6PAX A;  2H09 A;  3J80 Z;  4M73 A;  3GW2 A;  2P8T A;  4A5M A;  1HW2 A;  3FHZ A;  1XGS A;  1LDD A;  3ZP5 A;  1QZZ A;  1A04 A;  3GZ5 A;  4HAM A;  3T5X A;  3F22 A;  1FWZ A;  4DQ2 A;  1D3Y A;  2V1U A;  3ML6 A;  2EFO A;  1B59 A;  4Y15 A;  4ESJ A;  1SFX A;  2EFQ A;  2GZW A;  2VOD A;  1G6N A;  2ESN A;  1JHH A;  4GYI A;  3K1N A;  3REO A;  5K5Q A;  4IRG A;  2RNJ A;  5L3E A;  2DO7 A;  2JZY A;  4G94 A;  3WTT C;  2PG4 A;  3QP6 A;  2XAG A;  4XLN F;  2M30 A;  3B73 A;  1TTY A;  4WCG A;  1Z91 A;  5BPD A;  1KU3 A;  3L00 A;  4S04 A;  3I4P A;  1ZHF A;  1E2X A;  3RPQ A;  2HQN A;  3I71 A;  2A6E F;  1IN6 A;  2K7L A;  2VE8 A;  2MLG A;  1U78 A;  3DFG A;  4PGH A;  5CYV A;  3MCZ A;  4O6J A;  1O7F A;  2XUB A;  1KGS A;  1QO0 D;  1R1U A;  4WK8 F;  1U5T A;  5H6Q A;  1KU2 A;  2OBP A;  3PQJ A;  1Z6T A;  5HDG A;  1CF7 A;  1B9M A;  3KP6 A;  4L0Z B;  4M72 A;  2XAS A;  3HRT A;  3RYR A;  3KFW X;  3KP3 A;  5E8G A;  3VOD A;  1F1Z A;  2QQA A;  4ZYH A;  3ECH A;  1ZG5 A;  1SD4 A;  1ZLK A;  2F2E A;  4LFU A;  3P9C A;  5F64 A;  3ZMD A;  3P9I A;  4KT5 C;  2NNY A;  4UHT A;  4FX0 A;  4WXD A;  3ELK A;  1B4A A;  4NHJ A;  2W25 A;  3LA7 A;  1XSV A;  3WU0 A;  1S29 A;  4KNY A;  2JRT A;  3EYY A;  3MAJ A;  3MFK A;  1FZP B;  4KFC A;  1WKM A;  2QUF A;  3Q5F A;  1T39 A;  3FXQ A;  3GF2 A;  4AIH A;  1SD5 A;  1DPR A;  2LDU A;  3ZMZ A;  1LEB A;  2Y0M A;  2FBK A;  3G73 A;  5HVQ C;  2BGC A;  3GYH X;  3WE2 A;  1UHM A;  3GFI A;  2V1D A;  4IVN A;  4GO1 A;  2PBI A;  4HBL A;  3BY6 A;  1ONV A;  5E18 F;  4HOB A;  2H6B A;  4QWQ A;  1KU9 A;  2HS5 A;  3WG9 A;  2BYV E;  3DEU A;  1RUO A;  3BDD A;  3FMR A;  2QWW A;  4KN7 X;  1BJA A;  1FBU A;  2GXG A;  2KRF A;  1LVA A;  1T98 A;  3HSR A;  4EJT A;  2COM A;  3K2Z A;  2IT0 A;  1XN7 A;  1Z1D A;  2RQP A;  2CQK A;  2H6C A;  4HDU A;  1JXS A;  3RKW A;  5HLI A;  4G8X A;  3R0J A;  3LWF A;  4P96 A;  2C6Y A;  4I01 A;  1I5Z A;  2IPQ X;  3MQ0 A;  2BV6 A;  3N4M A;  1OKR A;  3CUQ A;  2ETH A;  1Q1H A;  2HQR A;  2L3D A;  2O8X A;  1R7J A;  4I09 A;  5JVT A;  4F7Z A;  2NAZ A;  4WWC A;  4LB5 A;  1HST A;  3GEZ A;  4HX8 A;  3BPV A;  5HOO A;  2ISZ A;  2Z5U A;  2E1C A;  4BHB A;  3F8M A;  3E97 A;  5ERI A;  2Q0O A;  3SZT A;  3I59 A;  1XD7 A;  2FRH A;  2XGX A;  4U0W A;  1IN5 A;  1RI7 A;  1KU7 A;  3VOE A;  2O3F A;  5ILS A;  1G3W A;  4EMS A;  3CUQ C;  4ZYE A;  3HOT A;  1OMI A;  2L4A A;  2M1B A;  5L3B A;  3DV8 A;  2ZNY A;  4OIQ F;  1G3T A;  5JFR A;  3KLN A;  1MZB A;  1Z05 A;  1OYI A;  3WTV C;  3MZH A;  1C0W A;  4OOI A;  3WOD F;  4B8X A;  5IT9 Z;  1USS A;  4L9J A;  1SD6 A;  5DCM B;  1R36 A;  3KE2 A;  2P6S A;  4M6X A;  3RKY A;  1L3L A;  1BC7 C;  2DTR A;  2HKX A;  2K02 A;  1T0F A;  5FD6 A;  4PDK A;  3KEO A;  1H9G A;  1P4W A;  1ZRC A;  3ISP A;  1WRJ A;  1TW2 A;  1KQ0 A;  3PFI A;  3KLO A;  1IXC A;  3HYI A;  2Z3Y A;  1CGP A;  2M87 A;  1REP C;  3BJA A;  3ZN1 A;  2QBY B;  3J7A O;  2VBW A;  1ZRF A;  3TDZ C;  5HDK A;  2CYY A;  5FO5 A;  2GAU A;  1U5T C;  3QRF F;  3L7W A;  3CJN A;  4RB1 A;  1FSH A;  5LEJ A;  3NEU A;  2MH2 A;  3TOA A;  4ASN A;  4KIB A;  2HDC A;  4G9Y A;  2PJP A;  2RV8 A;  2H27 A;  2XAH A;  3HSE A;  5FB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...