1ZG5A

Narl complexed to narg-89 promoter palindromic tail-to-tail dna site
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
66
structure length
66
Chain Sequence
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*CP*GP*TP*AP*CP*CP*CP*CP*TP*AP*TP*AP*GP*GP*GP*GP*TP*AP*
publication title Primary and Secondary Modes of DNA Recognition by the NarL Two-Component Response Regulator.
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 66
sequence length 66
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zg5A00
3F3XA 4BH9A 2HQRA 2QQ9A 4JQFA 4MQVA 5ILVA 1L3LA 5LHGA 4XBFA 3LA7A 1MKMA 2G7UA 1GXQA 2YR2A 2GXGA 3GO5A 1OMIA 3KEOA 1YW8A 4I01A 4LB5A 1X3UA 3HTUA 4N0BA 3F23A 5ILUA 1KYWA 1F9NA 1KU3A 2M5WA 1ODDA 4LK0F 2NRAC 1JHHA 1R22A 1ZH5A 3ZP5A 3WE3A 2E7WA 2D2WA 3V4GA 1IN7A 3ECHA 2K27A 4HF0A 1ZREA 2V1XA 2XROA 3EDPA 4HLYA 3TO9A 1I1SA 4I0AA 2EWNA 1HXDA 3O3KA 5D5VB 3DP7A 4LGWA 5DUKA 4UVBA 3EYIA 4K2EA 3RIRA 3J80Z 3I64A 1TW3A 1FOKA 3O6BB 1P2FA 5H6QA 2RC4A 3EQLF 5DEQA 1U5TA 5J6XA 3C1DA 4HX8A 4KIBA 1YW7A 3DF8A 1K78B 4G7HF 1XCBA 1XSXA 3KP2A 4XSXF 4N9HA 1OYWA 3CJNA 1P4AA 1TQMA 2P5LC 4FX0A 2VOPA 2DFIA 2DI3A 2M30A 1QQIA 3V8KA 4D0PA 1O3RA 2UWMA 4AWXB 4F7ZA 4AVPA 5JVTA 1S3JA 1I5ZA 4YIFA 1WRJA 3FXRA 1KA8A 1VTNC 1O7LA 3QRFF 2YPRA 2M87A 1KQ8A 2UXXA 3CUQA 5A2QZ 4M73A 3JSPA 2X4HA 4ZYEA 4PGHA 2XKOA 3VFZA 3AAFA 4TV7A 4XLNF 4IXAA 4P96A 4ENMA 1BN5A 1Q1HA 2XKPA 3ZMSA 3MZYA 4ZZDA 3HHHA 2GA1A 4O6JA 4O3MA 2FF4A 2H27A 1YS6A 4OINF 3M8FA 4G94A 5HDKA 2FSWA 4M9ZA 4P5OA 4ZYHA 1KQ9A 5L3BA 3ELKA 2IA0A 1QNTA 1XGNA 1YG2A 3RDIA 5ILSA 2M45A 1XDUA 4WCGA 3T1BA 4WXCA 4RGXA 3LWFA 3OV8A 3GWZA 1Y0UA 1O3TA 2FEZA 4ESFA 3KFWX 1YW9A 4EGZA 4ZYGA 1DPUA 4WF2A 3T0YA 3IRQA 5E8IA 4FX4A 4ASNA 1SD6A 2KIUA 3LA2A 3WTSC 2UZKA 4BHPA 2OAZA 1U6GA 4HF1A 2DK5A 3JTGA 1Z9CA 4UHTA 3WTTC 4RAYA 5BPIA 1OPCA 3JSOA 1JXSA 1ZHFA 1BJAA 4R1HA 1TQPA 4KN4X 4CZZA 2L54A 3PFIA 4A0YA 3DQVC 5H6RA 3HUGA 3JW4A 1PUEE 1ZAOA 3QPHA 1G6NA 5F1RA 5FFXA 5D5XB 2F2EA 1ZRDA 3GVAA 2MLKA 2VOOA 4Y17A 1W7PB 1ZYRF 2D1VA 1K79A 2H6BA 4BHBA 2A3SA 3ECOA 2ZMEA 1MJBA 2QWWA 4IRGA 4KMUX 2P7VB 4KYWA 5E20A 3RKWA 2L4MA 1S7OA 2FMLA 2XIGA 5L3CA 4ETSA 1J59A 1HW5A 2FNAA 3P7NA 2YU3A 3BJAA 1KU9A 4GO1A 3BOQA 4YFXF 2A6HF 4MEXF 4Q48A 3QP6A 2B0LA 3GLXA 3I59A 4IF4A 2VODA 2EFNA 3M1EA 2IT0A 3W6KB 2A69F 3N4MA 3MZHA 3SQNA 5DCMB 5D8LB 4IHSA 1UCRA 1FYKA 2AS5F 2P4WA 5K5RA 4U7DA 1J75A 1IN8A 1FSEA 2HFHA 2DK8A 4HOBA 3ULQB 2XVCA 2HKOA 3FHZA 1RUNA 2IW5A 3NRVA 2STWA 4MGRA 2F5FA 1HKTA 4OMYA 5E1ZB 1ZG3A 4RS8A 1TQIA 1W7PD 1F4KA 3GZ6A 4MTDA 4U0YA 2FXAA 3KP4A 2OD5A 1IF1A 2FBKA 4WWCA 2QM3A 2EK5A 4UVCA 1RIOH 2W24A 2ZNZA 2RQPA 5K1YA 1MD0A 1FX7A 1T98A 1T38A 2IA1A 5L3GA 1SFXA 5HS7A 2NNYA 2OBPA 2DPDA 3BPVA 4M9XA 2HDCA 3C7JA 2CSOA 3E6BA 5L3FA 2OQRA 1RNLA 3JAMK 2P6SA 1S29A 2IP2A 1AWCA 5E17F 3OOPA 1XGMA 3QOPA 2Y48A 3VOEA 1LEBA 1IRFA 3Q9SA 3FWEA 2YSRA 1YTYA 2PBIA 1STZA 4PGGA 4KN7X 4BNCA 4HQEA 1K6OA 3RI4A 1WQ2A 2EFOA 2VBXA 4KIFA 4KIGA 2HGCA 1V3FA 3GEZA 1ON2A 4RB1A 1BOAA 2QBYB 4AIKA 1SMTA 2DTRA 3HRSA 2K4BA 4EJTA 3J81K 2XAGA 4M6YA 2NYXA 2UXNA 3TDZC 5K5QA 2J5OA 2XHKA 1QPMA 4MTEA 2VE8A 3D5LA 2VBWA 4WX9A 1T6SA 2HTJA 2OZUA 4U0VA 2XUBA 4S05A 3DPTA 4OU0A 4HA8A 3FM5A 2EFQA 1WKMA 3W6JB 2P8TA 1DUXC 2AXLA 2EA4A 5EEHA 2NNNA 4CHUA 4WXDA 3HTSB 3PQKA 1R36A 2QZ8A 1K78A 2HYFA 4Y13A 5HS8A 4ZYDA 5DUIA 2V79A 2CWEA 3NEUA 3I0TA 2Z9OA 1R1VA 3QU3A 4U0WA 4ESJA 4U7BA 3KLOA 1J9IA 1IXSB 1I1GA 2R7FA 3P9CA 4IVNA 2FNPA 3REOA 1JGSA 5JFRA 2Y0MA 1GXPA 3TOAA 4B09A 4A6DA 4R79A 4R8HA 3E6DA 5E18F 1HKSA 5IT3A 4YIIA 3QU6A 2LDUA 1USTA 2K02A 2XV4S 2KJBA 1FYMA 4H0EA 4ON0A 1MJAA 1G3WA 3FXQA 3IWFA 4P9UA 1ZRCA 2FA5A 5BPDA 4HAMA 3MCZA 3HYIA 3CDHA 1FP1D 2K86A 1BI0A 5DYMA 4WXHA 3ZPLA 1EH8A 5LHHA 1QZYA 4GCVA 3IL2A 4G6DA 3R6SA 1XGOA 3V8LA 2ELHA 5AONA 1B9MA 2W84A 5FLXK 3QP5A 2BGCA 3WGGA 2DLLA 2OQGA 2ZO4A 1G4DA 2D45A 1OR7A 1J0RA 2HYGD 2EA2A 4U88A 2HTSA 3N97A 3L00A 2GXBA 2A68F 2KIMA 3TOBA 3M7GA 2X0LA 5L3EA 3HOSA 2MLGA 3ZMVA 4MHGA 2NAZA 4CXFA 3DEUA 2FQ3A 1FNNA 2V1DA 3HSEA 3I71A 4CICA 4L5JA 1P4XA 5D4SA 3TGNA 1B1BA 2M1BA 2XRNA 3F8MA 2LF8A 3GUDA 1S8NA 2RNJA 3WTVC 3GX4X 3F8FA 4JK1X 1BIBA 5ICFA 1B6AA 1MDMB 1FP2A 4HV5A 4YG2F 3EETA 3H92A 1C0WA 1R58A 5CVJA 4L9VA 5TJJA 4A5NA 1OYYA 1YFHA 3FX3A 1ULYA 2DQRA 3IRRA 1XCVA 1UFMA 4L9NA 3SFZA 4GGGA 3VEPA 2XAFA 4ESBA 5BMZA 2HQNA 2A61A 1XMKA 4AIJA 1ZLJA 2CYYA 4HBLA 3WU1B 2TDXA 4RB3C 1IXRC 3WGHA 4LG0B 3WTZA 1FZPB 4QWQA 1XSVA 2O3FA 4HLXA 1ZLKA 2F5DA 3GFMA 2Q0OA 1IW7F 1ZARA 2XAHA 1IXCA 3WODF 3C18A 1GHCA 3K1MA 1LJ9A 2DO7A 1KYZA 5CYVA 3V7RA 3E3VA 2BBYA 1FPQA 3GFIA 2H09A 4DQ2A 3T8RA 4KMFA 4M9SA 2H94A 1O3QA 2IVMA 2MC3A 3Q5FA 1IAWA 5HOOA 1XN7A 4BHCA 3J7AO 4ZH4F 4RGUA 2KJCA 2LKPA 2CQKA 2QVOA 2RN7A 3U9GA 2DAOA 4LB6B 5D4RA 4CGZA 1W4MA 2C6YA 2VC1A 2RDPA 4M74A 2K7LA 2YX4A 1R1TA 2MBFA 4LJZF 2MA3A 1U5TC 2RKHA 2FOKA 3HRMA 2ISYA 3L09A 5D6EA 2ZBKA 2DPUA 5F6FA 1XGSA 2GZWA 2V9VA 5H20A 2VC0A 3U1DA 3FMQA 1YS7A 5CVRA 3ZQ7A 2QUFA 3TKYA 2KRFA 5LEJA 3KP7A 1HSJA 2R3SA 4LMYA 4QLCU 3DPLC 1YIOA 1GVJA 4RGSA 1H9TA 2HZTA 2EJRA 1KQ0A 2MD5A 2EV0A 1SD7A 3BJ6A 4G6QA 2V1UA 2F5EA 3Q9VA 4OIOF 4N9IA 2Z33A 5LLQA 4M6XA 3HSRA 1B4AA 4HF2A 2VN2A 4ENNA 3O2PE 3DKWA 3V7CA 4HW0A 3HHGA 1E2XA 5E8GA 3K2ZA 4HYEA 2L01A 3CUQC 1P92A 2A5YB 4ENKA 2ACJA 2GA2A 1G3YA 3EYYA 2O8XA 2V6CA 5CVUA 4I0BA 1IZ1A 1H9GA 1BI3A 4P55A 3GW2A 4LLLA 3M8EA 4Q5SF 1YYVA 1NHAA 2JPCA 1D8JA 2FE3A 2CG4A 3FXUA 1LVAA 1V4RA 1S7AA 2L4AA 3GYHX 3GF2A 2D1HA 1IN5A 5IT9K 1Z1DA 1P4WA 2QBYA 3GFJA 3BJOA 4HX4A 2GIVA 5HDGA 2VONA 4L0YB 5LRRA 3RYRA 1HKQA 3ABTA 1LQ1A 5AIPA 4UV9A 2PJPA 4LLGF 5LEKA 5IT9Z 3R60A 2L02A 2ISZA 3FMRA 2HEOA 4IPAA 1QZZA 4PZJA 1U78A 4RGRA 3RPQA 4L9JA 2Z3YA 1HQCA 5DDGA 2A6EF 3CUOA 1TBXA 2QENA 3KZYA 5D8KB 5ICCA 3COAC 5FD6A 3NQOA 2FRHA 3F8BA 5D5UB 2DBBA 3QAHA 3JAMZ 1WI9A 1SFEA 3R0JA 3G73A 4HX7A 1REPC 2K4JA 2PQ8A 2P5VA 4YFKF 2J5PA 3B73A 3WG9A 1DDNA 1FLIA 4MEYF 3BP8A 4Z2YA 2WWYA 3WE2A 2HWVA 4EJUA 1ZG5A 3MAJA 2Y75A 3FZVA 2EV6A 1IUYA 3KE2A 4G7ZF 4AD9A 1R5HA 3J81Z 2O03A 1ZGJA 1HBXG 5JR3A 3ML6A 4A0ZA 5KK1A 2R7DA 3V8JA 1FY7A 2W25A 2Q8KA 4B8XA 2FU4A 1FBSA 3I5UA 5LRSA 4JBAA 5FO5A 1IRGA 3LA3A 3HOTA 1O57A 3SZTA 3EUHA 4OMZA 1G3SA 3E5XA 3BWGA 4GYGA 1LDDA 3BPXA 4UVAA 4ENJA 3KETA 3MFKA 2ZNYA 3KP5A 2QQBA 4A6EA 3ZMTA 3GXOA 1B59A 1OKRA 3B02A 5CLSA 3P9IA 1T2KA 5ICEA 3E97A 4MQ9F 2LNBA 5LHIA 4PCQA 5KVRA 1ONVA 1MJ9A 2OA4A 1Z6TA 4P9FA 4HDVA 1IN6A 1J2XA 1K7AA 1MZBA 1D3YA 3L9FA 1W5SA 4EMSA 4E70A 5HDNA 3D0SA 2PMHA 3CLOA 3HIFA 2CW0F 1WSUA 1LEAA 5ERIA 5HS9A 2PN6A 3RJPA 1R23A 3LFKA 1WWXA 2PG4A 2PFBA 3J80K 1FT9A 2EFWA 3BROA 3ZN0A 3L7WA 3ROUA 4KUMA 1R5GA 1MDMA 1XSDA 2FBHA 3FMSA 4CO8A 3IC7A 1CF7B 2G9WA 1LDKB 3F8CA 4A0XA 3SZPA 5HLIA 1BC8C 2BV6A 3BZ6A 2JZYA 1EH6A 3E5QA 3QPTA 2A07F 3K1PA 1PP8F 1USSA 1TNSA 3ZMZA 3F8NA 5DCFA 2F5CA 4ZZLA 3KZZA 3LAJA 3VODA 2VT2A 1XB4A 2IPQX 2IRFG 3WGIA 3LQRA 2G7HA 2Z5UA 4UV8A 1EV7A 4UXNA 1BI1A 1ZG1A 3WU0A 4AIHA 4IRHA 4BQAA 2GQQA 3HRUA 2P5KA 2DW4A 1D8KA 5FLXZ 4LG0A 5HLHA 1ZN2A 5JHUA 3TO7A 4L0ZB 3ERED 3RYPA 3IHUA 1AOYA 3R61A 2CGPA 2STTA 4UNOA 1MGTA 2WTEA 1TNTA 2P6TA 3GZ5A 1YQAA 2HKXA 3BDDA 5ED4A 1J7KA 1JE8A 1EH7A 2E1CA 2ZJ2A 3V7SA 2W85A 2ZCWA 4HDUA 1O7FA 4XSZF 4RAZA 1YO5C 3SHFA 5A2QK 3I53A 4L9TA 1BI2A 2DU9A 1F5TA 3MQ0A 1Z05A 3C3WA 1RZ4A 3WTUC 5AIQA 2GWRA 5E1WA 3KP6A 1PP7U 3TQNA 1TTYA 3JTHA 2XAJA 1U5TB 5J8FA 1TLHB 3K9TA 4KT5C 3IKVA 3KP3A 2JTVA 4LFUA 1SD5A 2DT5A 4Y15A 4IJAA 4EV0A 5K5OA 2HOEA 5FGMA 3MWMA 1B9NA 1SFUA 1SAXA 5FD5A 1HSTA 1Z6RA 4HV6A 5CJ9A 5BOXA 1DP7P 5LBQA 2MH2A 4CDGA 1W7PA 1UHMA 1XDSA 5HVQC 3E6MA 1BC7C 1U3EM 3TDUC 2XGXA 4G7OF 3RPUA 5ICGA 5D6FA 5D5WB 2O61A 3M9AA 5E1XA 3K0LA 1YLFA 3KCCA 4EJWA 4I09A 2VBYA 3DXJF 4L5IA 1OYIA 1P6RA 2JRTA 4O5VA 3FF5A 1A04A 1R1UA 3ISPA 5F64A 2O6GE 5DD4A 2ESNA 2ZKZA 5CVIA 1KGSA 4I2OA 4IRIA 3F72A 2LSOA 3I4PA 1T39A 3L2CA 4I02A 1I27A 5DV5A 2EB7A 4S04A 2FBIA 3CO6C 3CUQB 5BS6A 6PAXA 3F21A 3WTYC 3T8TA 4UUVA 1U2WA 5DCMA 1R7JA 1W5TA 4HZFA 4BAYA 3I58A 1XMAA 1TW2A 3S2WA 3ABUA 2VBZA 4M71A 4A2UA 1LDJA 1UHWA 1G3TA 5J8CA 2PI0A 1S6LA 4G9YA 4Q47A 3F22A 3RTRA 2OZ6A 1QGPA 1JHFA 2Z99A 4RB2C 4KNYA 4EJVA 5CVVA 1FYLA 2ETHA 3IKTA 3PQJA 1ON1A 3MEXA 2KKOA 1IN4A 5JI6A 3H3ZA 3ZN1A 3I54A 4EVIA 1E17A 4XRFA 2VE9A 5HLGA 4EM1A 2ESHA 3HSFA 2JPBA 4OIQF 4EGYA 4BYYA 5BQTA 3DFGA 2JSCA 4GYIA 2QQAA 4A5MA 3E6CC 2P7CB 1Z91A 4EM0B 2PMUA 3IWZA 1CGPA 4IHTA 3RKYA 2ZXJA 1FBQA 1H0MA 4KFCA 2XAQA 2BEOA 4YFNF 4WK8F 4OOIA 1RI7A 3LSTA 4RB0A 5TRDA 1BIAA 2ADUA 2WV0A 5FFZA 2VT3A 1SD4A 1R00A 1FC3A 4XLPF 5FB2A 2Q2EA 1O3SA 2VXZA 2NS0A 2XASA 2BE5F 2KIFA 1ZGAA 2COMA 1KU2A 4LD5A 2HS5A 2CFXA 4KDPA 1KU7A 3K1NA 4OIRF 2GAUA 1RUOA 3P9KA 3R4KA 3K69A 2IA2A 3H3UA 2IJLA 2MH9A 4L18B 4NB5A 1T0FA 3U2RA 2WC2A 2ZMEB 2H6CA 2HR3A 2EV5A 4PDKA 3GFLA 3SXYA 4M72A 2FMYA 1PDNC 2PEXA 3LAPA 3FM3A 4GXOA 3RKXA 2E7XA 3BY6A 1HW1A 4NHJA 4BXUA 4A12A 1F1ZA 3G3ZA 1XD7A 5EEGA 2EFPA 2QYOA 1L0OC 3I59B 4I98B 4FHTA 1HW2A 3HRTA 3F6VA 4LK1F 5DD8A 1QO0D 5L3DA 1SMYF 1LNWA 3LQQA 4EQQA 1FBUA 4LLNA 1DPRA 2L3DA 4HQMA 4OIPF 3VB2A 1BM9A 2CO5A 5LGUA 3T5XA 1D5VA 1Z7UA 4EJOA 4I7HA 2YX7A 2QLZA 3DV8A 1UB9A 2E1NA 2ZFWA 4Q4ZF 4G8XA 2O0YA 3KLNA 2RV8A 5LGNA 3F6OA 4MNUA 3R0AA 2BYVE 1BBYA 3ZMUA 1FSHA 2DQLA 1I6XA 4NQWA 4EM2A 4KA4A 1J5YA 2M8EA 1QBJA 3CTAA 2OU2A 3CO7C 1U8RA 4DNCA 2RGVA 2JT1A 2W57A 4FT8A 5LGTA 1CF7A 4KICA 3KEQA 3ZMDA 3WTXC 1LB2A 3TO6A 2LF7A 2RVCA 1ZRFA 2PLYA 1FWZA 3E5UA 4CYDA 3WTWC
chains in the Genus database with same CATH superfamily
3F3XA 4BH9A 2E1MC 2HQRA 2QQ9A 4JQFA 4MQVA 1GUUA 5B3SH 2ECBA 5ILVA 2YUSA 4DJAA 3I4MJ 1L3LA 4F93B 5LHGA 1JKOC 4EEFG 4XBFA 3LA7A 2CS3A 1MKMA 2G7UA 1MSFC 1GXQA 2YR2A 1F36A 2GXGA 3GO5A 1XX5A 2LOOA 3S1QJ 1OMIA 4XL9A 3KEOA 5CPRB 1WJAA 2E60A 1YW8A 1YX3A 4I01A 4LB5A 1X3UA 3HTUA 1I3AA 1RKWA 3K4KA 4XR6A 4N0BA 3F23A 4AC0A 1AKHA 5ILUA 1KYWA 1F9NA 1KZHA 1D1CA 1KU3A 2M5WA 3AG4H 3OY9A 1YRNB 1B72A 1ODDA 4LK0F 2NRAC 1UAAA 1JHHA 1R22A 2X6YA 1ZH5A 1T0FC 5LFAA 3ZP5A 5FKLA 3WE3A 2E7WA 4E7IA 2RQQA 2D2WA 3CLQA 3V4GA 5K7ZA 3LSRA 1IN7A 5M5WJ 1DU6A 3ECHA 2K27A 4HF0A 4IL6C 2EQRA 1R9TJ 2ZJPF 1ZREA 2V1XA 2XROA 2RAEA 4IHWA 3G71I 4ZJZA 3EDPA 5EZGA 1NG7A 4HLYA 3TO9A 3PO3J 2GXAA 4NC6A 4I0AA 1I1SA 2EWNA 2K5CA 4PFOA 3MZ8A 1HXDA 1TZLA 3O3KA 5D5VB 3BQZA 3DP7A 1MH3A 1XMXA 3I56I 4LGWA 5DUKA 4UVBA 4XIDA 3E7LA 3EYIA 2OCEA 2VKHA 3ERMA 2IBDA 1YIJI 4K2EA 3RIRA 3J80Z 4OWRB 3I64A 2JMWA 1TW3A 1FOKA 4JP0A 3O6BB 4IEJA 3D5RC 1P2FA 5H6QA 3S8PA 2RC4A 3CMYA 3EQLF 4AU7A 5DEQA 1U5TA 5J6XA 1R49A 3HBLA 4ZDPA 3C1DA 4HX8A 2R7SA 3CDLA 4KIBA 1YW7A 2JA2A 3DF8A 1K78B 4G7HF 1XCBA 1XSXA 3KP2A 4XSXF 2KMUA 3ZRGA 2O9LA 5F0FA 4C2UA 4BXXJ 4E7HA 4N9HA 4BXFA 2FX0A 3FKIJ 1OYWA 3CJNA 3AFHA 1P4AA 1TQMA 4AYBN 3IH4A 2DN0A 3JRDA 2P5LC 4GDFA 5IOYA 4FX0A 2VOPA 3O8GA 1IO2A 2DFIA 3SEQA 3DTEA 4C2TA 1ETVA 2JK3A 2EILH 2DI3A 1LFPA 2M30A 2XGDA 1QQIA 3VWBA 3V8KA 4XICA 1W36C 5TGTA 4XKWA 4D0PA 3J7YJ 3OYIA 2DODA 1O3RA 2BY0A 4CCLA 4XKVA 4J19A 2UWMA 3KYLA 4AWXB 4F7ZA 1VQNI 4U87A 2JSPA 3HJEA 3H9JA 2E71A 1X2NA 2FOWA 1DP3A 2KHMA 4YEJA 4XMYA 4AVPA 5JVTA 2MABA 1NK2P 1WH5A 1S3JA 1IUFA 3GTOJ 1I5ZA 4YIFA 1WRJA 4F55A 1VQMI 3FXRA 1KA8A 1B8IB 1VTNC 2MW8A 1O7LA 3GTGJ 1PVEA 2F4OB 3QRFF 4BDYA 2YPRA 2M87A 5EG0B 4BJTA 2CFOA 1KQ8A 1QVUA 2UXXA 3BR1A 3CUQA 2UUZA 4CCOA 1ZGWA 1MBGA 1LE8A 5A2QZ 4M73A 3JSPA 5KNLA 2X4HA 4ZYEA 4PGHA 4BS9A 2K9QA 3LSMA 1MMNA 3UKGA 2XKOA 3F0CA 2HVQA 5JLXA 3EUHC 3VFZA 3PIOF 1K4TA 3AL0C 3AAFA 3TP0A 3ZXSA 4TV7A 4CSWA 3LFUA 3LSKA 1K4SA 4XLNF 1RPWA 4IXAA 4P96A 1BN5A 1Q1HA 1UG2A 2XKPA 3ZMSA 4ENMA 2K40A 3GMEA 3MZYA 4ZZDA 1RKTA 3HHHA 2NVQJ 4C3IJ 4S0HB 2GA1A 3VYUB 3OYLA 2X1DA 4O6JA 2KPMA 4O3MA 2FF4A 2H27A 1YS6A 4OINF 3M8FA 3S3NA 1OISA 4G94A 5HDKA 2FSWA 2LTPA 1HOMA 5CKTA 4M9ZA 4P5OA 4Y4RA 4ZYHA 3DEEA 1KQ9A 5L3BA 3ELKA 3HG9A 2IA0A 3ZQCA 1QNTA 5CQGA 1XGNA 4RMNA 1YG2A 3RDIA 5ILSA 2M45A 1SC7A 1XDUA 2TRTA 1WJBA 4WCGA 3AG3H 2L9SA 1HDDC 2M4KA 3T1BA 4WXCA 1V54H 2NOGA 4RGXA 3LWFA 4RA2A 3FXMA 3OV8A 3E1SA 3GWZA 1Y0UA 4W1UA 4OAYA 5F0CA 1O3TA 1UELB 2FEZA 4A3BJ 2JN6A 1POGA 4BE0A 2E35A 4ESFA 3KFWX 3CJQB 1YW9A 4EGZA 2DXIA 4ZYGA 1DPUA 4C3HJ 2M7AA 3JRIA 2EZLA 1VQ6I 4WF2A 3T0YA 1JT0A 1Z3YA 3IRQA 4UUSA 3BG7A 4BBSJ 2JVGA 5E8IA 2E2HJ 3K4CA 2M9HA 1RRJA 4FX4A 4DBRA 4A3IJ 4II3A 2R5YB 4ASNA 4D1QA 1TWGJ 3OYJA 2CUEA 1SD6A 3OR1C 1QPIA 2KIUA 3PSFA 3LA2A 3WTSC 1F43A 2UZKA 4BHPA 2EINH 2OAZA 1U6GA 4HF1A 1MNDA 2DK5A 3OS1A 2L7FP 3JTGA 1Z9CA 1TC3C 4UHTA 3WTTC 5CQEA 4RAYA 1QU3A 5BPIA 1OPCA 2ECCA 5J1RA 3CCEI 4X6AJ 3JSOA 1M1EB 4XKCA 1JXSA 2A05A 3BCBA 3CCRI 1ZHFA 3KPHA 2LRDA 1BJAA 4R1HA 1TQPA 2EZKA 4KN4X 2MSYA 2CUZA 5IYDJ 2WB1A 3Q0VA 2L54A 3HGYA 3G1LA 4CZZA 3PFIA 3JCUC 4A0YA 1WJDA 3DQVC 5H6RA 3HUGA 3PNTA 5KAIC 3JW4A 1SVLA 1PUEE 1ZAOA 3W2WA 3QPHA 2VPLA 1G6NA 5F1RA 1P7JA 4Z6YA 1UJ8A 5FFXA 5D5XB 2H8RA 2F2EA 3RSNA 2L2OA 2DA2A 2VKEA 1ZRDA 4XLHA 3GVAA 2MLKA 2VOOA 3WHBA 4Y17A 5F27A 1W0TA 4IKFA 1W7PB 1ZYRF 2E2IJ 2OF7A 2DTZA 2D1VA 4E7SA 1K79A 1TP4A 1MMGA 3L2RA 3CP8A 2W82A 2X85A 3G4SI 2O8KA 2H6BA 4HNTA 1VQ7I 4BHBA 2F48A 2PMZA 2A3SA 3ECOA 2ZMEA 1MJBA 2QWWA 2CQNA 3FBIB 3DCFA 4ZDOA 3BT9A 2WAEA 4BQQA 1OCPA 4X0GA 3K10A 3H35A 4IRGA 4KMUX 2NOJB 2P7VB 4KYWA 5E20A 3RKWA 2L4MA 2CJJA 1S7OA 2FMLA 2XIGA 4M6VA 4PJLA 5L3CA 4ETSA 2COBA 1J59A 1HW5A 2W7NA 2FNAA 2W48A 3A1YA 1SFKA 3P7NA 3ZR8X 2YU3A 3BJAA 3M4OJ 2M4GA 1WJFA 4HSRA 1RETA 5FROA 1KU9A 4GO1A 1ZELA 3BOQA 3D5SC 2A6HF 4YFXF 4MEXF 2LVSA 4Q48A 3CCLI 2EBIA 2IGMA 3QP6A 3HKZN 4ABZA 2B0LA 2R0QC 1QHGA 1OCTC 4II2A 1X1CA 2DDBA 2DFHA 3GLXA 3I59A 4IF4A 3S3MA 2VODA 4NC8A 2CRGA 2EFNA 3M1EA 1VQOI 1A5JA 2IT0A 3K2AA 3W6KB 2A69F 3MKYB 3N4MA 2LC2A 3OL4A 5C3EJ 3MZHA 2QA4I 3SQNA 5DCMB 5D8LB 4IHSA 1UCRA 4DYQA 1TT5B 1FYKA 2AS5F 2P4WA 2E1OA 5K5RA 1MMSA 1WHUA 4U7DA 1J75A 2WAQN 1IN8A 2KL4A 1FSEA 2HFHA 2GBYA 2DK8A 2R7VA 2VKVA 4HOBA 3ULQB 2K9SA 2XVCA 2XSDC 2HKOA 2XAUA 5J3LA 1SANA 2EH3A 3FHZA 3CCSI 1RUNA 2F4IA 2IW5A 3NRVA 2CV0A 2STWA 4MGRA 4KT6A 2HVRA 3L2WA 4E7JA 3M8JA 2F5FA 3DBLB 2KP6A 1HKTA 2VPRA 3S32A 4OMYA 5E1ZB 3K7AJ 1EKEA 1ZG3A 3MD2A 3VSLA 1HLVA 4RS8A 1TQIA 1W7PD 2XGEA 4YRVA 1F4KA 2VQLA 5IP6A 3TW7A 2R7WA 2LREA 3GZ6A 2LH9A 2V9PA 4UY8I 4MTDA 2EIKH 4U0YA 1FOWA 2FXAA 3KP4A 2OD5A 4KJZA 3J7AY 1IF1A 2MC4A 2FBKA 3PJRA 4E7ZA 4WWCA 1HDPA 1D1BA 2QM3A 2EK5A 4UVCA 1RIOH 1OFCX 3LNQA 1V5EA 3D1NI 1X1BA 3DU6A 2W24A 2BW3A 3OIQA 4RAFA 2AXTC 2ZNZA 3ONQA 2CH0A 2RQPA 2HPIA 5K1YA 1MD0A 3KEYA 1FX7A 4V19K 1T98A 3LSPA 1T38A 2IA1A 3RCOA 3AKZA 1RR8C 5L3GA 1SFXA 4RLFA 5C4JJ 3PNVA 1ERDA 5HS7A 3A0BC 2NNYA 1G2HA 2OBPA 2DPDA 3JREA 2H1KA 3BPVA 3FDYA 4M9XA 2HDCA 3C7JA 2ZB9A 2CSOA 3E6BA 5LD2C 4RBOA 5L3FA 3FIWA 2OQRA 4HNVA 1OQYA 3HB9A 1S72I 2E1MB 3A4CA 3FXJA 1RNLA 4M3EA 3JAMK 3M3YJ 3S17J 2P6SA 2R7QA 1S29A 3ZQGA 3JRHA 2IP2A 4FISA 2K9MA 1AWCA 1U8BA 1RESA 2IGNA 5E17F 2VQHA 1Y8QB 3OOPA 4DIQA 4BE2A 1XGMA 3QOPA 2Y48A 3VOEA 4HRIA 1LEBA 1IRFA 3Q9SA 3FWEA 5IOZA 3SEZA 2YSRA 1J09A 1A31A 1X3ZB 1YTYA 2PBIA 2VKDA 1STZA 4A3DJ 4PGGA 4KN7X 2AO9A 4BNCA 1IG7A 4HQEA 1ZTRA 3RI4A 1K6OA 1W0UA 4B3XA 1WQ2A 1EA3A 1UHSA 2EFOA 2VBXA 4KIFA 4KIGA 2HGCA 1V3FA 3GEZA 3SJMA 1ON2A 4RB1A 5GPAA 1BOAA 4JX4A 2JA8J 4F92B 2M8GX 4AIKA 2QBYB 3A2KA 4BY7J 1SMTA 2DTRA 3FK6A 2OCCH 1GV2A 4AVZA 3GTQJ 4A3LJ 3HRSA 2K4BA 4EJTA 2P0WA 3J81K 1ZR2A 3VYSB 2XAGA 2B63J 4M6YA 2NYXA 1BR2A 2UXNA 2LBFB 3TDZC 5K5QA 2J5OA 1G59A 3CMMA 1MH4A 3GZNB 2XHKA 1QPMA 4MTEA 2VE8A 2XRLA 3D5LA 4Y33A 2VBWA 4XOPA 3BTLA 4WX9A 1T6SA 1MSEC 3S1RJ 3OYDA 1IC8A 5FKNA 2HTJA 1YJNI 2I8DA 3A01B 2HXIA 2OZUA 1N75A 2DYSH 4U0VA 3CF5F 4HEA2 4ZTJA 2XUBA 4Y7NJ 3TMOA 4S05A 3DPTA 4OU0A 1VI0A 4HA8A 4BKXA 3FM5A 4JX5A 2EFQA 5J47A 1WKMA 3IAM2 3W6JB 2P8TA 1DUXC 2AXLA 2EA4A 2Y31A 4CCNA 3BR0A 3OYEA 5EEHA 2NNNA 2QKMB 4CHUA 2K9LA 1EJ9A 4WXDA 3HTSB 1BJZA 2X1CA 3PQKA 4DYCA 4JOMA 1R36A 3HGGA 5B1BH 1MMAA 1IV6A 2QZ8A 4BL0B 3NWTA 4XNFA 1K78A 1DQUA 2HYFA 4Y13A 3TEDA 5HS8A 2IGKA 4ZYDA 5DUIA 2V79A 2CWEA 2GLOA 3G1MA 1BOBA 3NEUA 4IOAF 2QSHX 3I0TA 5GAEJ 3CD6I 1X1AA 2Z9OA 2DMNA 1R1VA 3QU3A 4N4NB 4U0WA 4ESJA 3BG3A 4U7BA 3KLOA 1J9IA 1JUSA 1IXSB 2HOAA 3L2UA 3HC7A 1I1GA 2R7FA 2V7FA 3P9CA 2FNPA 4IVNA 3REOA 1JGSA 1LKXA 2HDWA 3ZQHA 5FRNA 3GTKJ 5JFRA 2Y0MA 1GXPA 3TOAA 4B09A 4A6DA 1ACIA 4R79A 4R8HA 3E6DA 1JJ8C 5E18F 1HKSA 5IT3A 4YIIA 3QU6A 3GTJJ 3Q0WA 5F0HA 3BG5A 2HXOA 2LDUA 1USTA 2K02A 2XV4S 3C2HA 2KJBA 1FYMA 1B8IA 3C2BA 1WGXA 4ON0A 4H0EA 2Q1ZB 3HOUJ 2JA5J 1HC8A 1MJAA 1G3WA 1FTZA 3FXQA 3IWFA 5B5EC 4P9UA 1ZRCA 4M3FA 1VF9A 5EGOA 2FA5A 2K9NA 5BPDA 4HAMA 3MCZA 2L5QA 3HYIA 1PUFB 3VYRB 3CDHA 1FP1D 2K86A 1BI0A 5DYMA 1X4PA 3AL0B 4WXHA 3ZPLA 1EH8A 4CH7A 3W3CA 5LHHA 1QZYA 4GCVA 1VQPI 3IL2A 3OYFA 4G6DA 3R6SA 1ENHA 1G8XA 3S1NJ 1XGOA 3V8LA 2ELHA 3OR2C 5AONA 4CCJA 1B9MA 4XLFA 2W84A 3NWSA 5FLXK 3QP5A 3K4NA 4UB6C 1JJ6C 2Y9YA 2ICWG 1MNMC 2B9SA 2BGCA 3WGGA 2DLLA 4UB8C 2OQGA 3KIOA 5F08A 2ZO4A 4HG2A 5EF6A 1G4DA 2D45A 1OR7A 1J0RA 2HYGD 2RREA 2IS6A 2EA2A 4RM2A 2CW7A 4CCMA 4U88A 2HTSA 3CQZJ 1TWCJ 2GIZA 2HYJA 4KISA 3N97A 2VJJA 3L00A 1W5CC 2GXBA 2R7RA 3PNYA 2A68F 2KIMA 3HM5A 3TOBA 3H3VK 3M7GA 2X0LA 5L3EA 2HDDA 2DA4A 5EZHA 2AHQA 2MLGA 3HOSA 2GM4A 3ZMVA 4MHGA 2NAZA 4CXFA 3DEUA 1JKQC 3OYGA 3I4NJ 2FQ3A 2Z16A 4CA0A 1FNNA 2V1DA 3HSEA 5J1YA 4RDUA 2VQCA 4YELA 3G6EI 3PM1A 4F91B 1U0JA 3I71A 4CICA 4L5JA 4XM3A 1W36D 1P4XA 5D4SA 3S15J 2NS7A 1OCCH 1B1BA 2M1BA 3TGNA 2XRNA 3F8MA 3W2AA 2LF8A 4IOCF 3CF2A 3GUDA 1XG1A 1S8NA 2RNJA 3WTVC 3GX4X 3F8FA 4JK1X 1BIBA 5ICFA 4HSTA 4QPOA 1QHHD 1B6AA 1MDMB 1FP2A 4HV5A 1S5LC 4YG2F 2M0CA 3EETA 3H92A 3BQYA 1C0WA 1R58A 2ZJRF 2W4SA 3GTPJ 3RKQA 4F3QA 3A03A 5CVJA 4L9VA 5TJJA 1JKRC 4A5NA 1X19A 2BVLA 1JUPA 2DT6A 1OYYA 2IXSA 2VI6A 1YFHA 3FX3A 1D5YA 1ULYA 2DQRA 3IRRA 1V5GA 1XCVA 2JVHA 1VZ0A 1UFMA 4L9NA 3SFZA 2LK2A 4GGGA 2FJ1A 2XAFA 3VEPA 1ORKA 1A35A 3QYEA 4ESBA 5BMZA 1IDZA 3K70C 2HQNA 1I39A 2A61A 3HDDA 1XMKA 2DA1A 3DKXA 2V1NA 2XB0X 3CDIA 1T56A 4AIJA 4FE7A 1ZLJA 5F1JA 1D0XA 2NVYJ 2JRMA 2CYYA 4HBLA 3WU1B 2TDXA 2RNGA 1OLTA 1NK3P 2OTJI 4RB3C 1IXRC 2VJ5A 3WGHA 4LG0B 4HPQA 4IQJA 3TW6A 3WTZA 1X58A 5IPAA 1VQLI 3BLYA 4BE1A 1SEUA 1FZPB 5C44J 4QWQA 1XSVA 2O3FA 4HLXA 1ZLKA 1BW6A 2F5DA 2Z1DA 4M3DA 2JJ7A 2CMPA 1IW7F 1ZARA 2Q0OA 3GFMA 3Q3SA 1FEXA 1IJWC 2XAHA 1R5ID 3SDGA 4AYBA 4L5EA 1IXCA 2MFZA 3C18A 3WODF 2R92J 1GHCA 3K1MA 1LJ9A 2DO7A 5DM7F 1KYZA 5CYVA 3V7RA 3E3VA 1E0EA 2BBYA 1FPQA 3GFIA 2H09A 2CQXA 3AG2H 4LIVA 4DQ2A 3WU2C 3T8RA 4KMFA 4M9SA 2H94A 4RM3A 1O3QA 2IVMA 2HU9A 2MC3A 3Q5FA 1IAWA 5HOOA 1XN7A 4BHCA 3J7AO 4ZH4F 2KT0A 4RGUA 2KJCA 2LKPA 2CQKA 2Z2SB 2QVOA 3B6CA 1N77A 4MIMA 2HZDA 2LP0A 2P81A 1H8AC 2RN7A 3I55I 1BW5A 3U9GA 2DAOA 4LB6B 5D4RA 4CGZA 3H5AA 1D1AA 1GDTA 5GTHC 3OMYA 1W4MA 1V5FA 2C6YA 2VC1A 2RDPA 4DOZA 4M74A 1ZQ3P 5FLMJ 2K7LA 2YX4A 3CCVI 1YITI 3H0GJ 1R1TA 1FMVA 2MBFA 4LJZF 3PUFA 5KAFC 2MA3A 1Z67A 1U5TC 2DOEA 2RKHA 4A3KJ 2BHYA 4MFEA 2FOKA 1ITYA 3HRMA 2ISYA 3L09A 4XN3A 5D6EA 2ZBKA 4B47A 2DPUA 3HEFA 2ZXIA 5F6FA 1MBHA 3JRGA 1R4NB 1XGSA 2L7KA 2GZWA 2V9VA 5H20A 2VC0A 3HOXJ 3DTIA 3U1DA 5M5YJ 3FMQA 2OJED 1YS7A 5CVRA 3ZQ7A 2V9KA 2QUFA 3DEWA 3TKYA 2OTLI 2KRFA 5LEJA 3KP7A 1MBEA 1FOYA 3ABLH 1MNEA 2QSGX 2WY8Q 1HSJA 2R3SA 4LMYA 4QLCU 1IRXA 3DPLC 3H9GA 1YIOA 1GVJA 2PJRB 3S16J 4RGSA 3OYHA 1H9TA 3I3LA 2HZTA 2QF7A 3CCYA 2EJRA 1KQ0A 1Z77A 3OYAA 2MD5A 4QPQA 1NTCA 2EV0A 1S7EA 1SD7A 4A3FJ 1Y39A 2R7OA 3BJ6A 1KONA 2HPMA 4G6QA 2E2JJ 2V1UA 1H89C 2F5EA 4PUSA 3Q9VA 2M34A 2K85A 5E79C 4OIOF 4DZJA 1Y6IA 1QA6A 2YU9J 3BR2A 4N9IA 3WHCA 2L9RA 3U1KA 2ZSHB 1QRYA 2ZXHA 4LIUA 4V2GA 2Z33A 3QOEA 2DFFA 2A5WA 1IGNA 2CQQA 5LLQA 4M6XA 3HSRA 1B4AA 4HF2A 1GLNA 2VN2A 4ENNA 5HNHA 1VQ4I 3O2PE 3DKWA 3V7CA 2KLOA 2A6TA 2OPTA 3PFYA 4HW0A 3HHGA 1E2XA 5E8GA 3K2ZA 3FXLA 3BC8A 2VIXA 3FISA 4HYEA 2L01A 2F4MB 3CUQC 3CC4I 1P92A 4UUTA 2A5YB 2JWTA 1O4XA 5KCMA 3K4BA 4ENKA 2QCOA 3BG9A 3RQIA 2ACJA 3N05A 2GA2A 2R5ZB 1G3YA 3EYYA 3A0HC 3BG6A 5E3NA 2O8XA 5M3FJ 1T8IA 4ITVA 1K83J 2V6CA 3CCQI 5CVUA 3SYTA 4I0BA 5IP7J 1IZ1A 1MBKA 1H9GA 3KYDB 1BI3A 3G1OA 3UNGC 2KDZA 4P55A 5EYRA 3GW2A 2QQ8A 3CJTB 2E19A 4LLLA 3M8EA 5JHFA 1Y0NA 4Q5SF 2G0EA 2M2EA 1YYVA 1NHAA 2N8GA 2JPCA 2QKLB 1D8JA 5GPCA 2FE3A 2CG4A 1FOXA 3FXUA 2CUJA 1LVAA 5TISC 1FIAA 1S7AA 1LVKA 1V4RA 2DT7B 2L4AA 3GYHX 3GF2A 2HOTA 2D1HA 1IN5A 5IT9K 1Z1DA 1P4WA 3RPUD 2QBYA 3BR3A 3GFJA 3BJOA 4HX4A 3S14J 2GIVA 3AG1H 1X4OA 2HI3A 3ESWB 5HDGA 2YS9A 2W1OA 2VONA 4XLAA 4L0YB 5LRRA 3RYRA 1T08B 1HKQA 3G2BA 3GTLJ 4BQNA 1Q1VA 3ABTA 3FXKA 1LQ1A 1YJ9I 5AIPA 4UV9A 2PJPA 4NNJA 2DOFA 4CZCA 4LLGF 5LEKA 5IT9Z 3ASNH 2BZTA 3R60A 1GV5A 3A01A 2JQ7A 2L02A 2ISZA 1JKPC 3OS2A 2QGUA 2L7MP 2Y0SN 4IHYA 3FMRA 2KZGA 2QEXI 2HEOA 4IPAA 2AQEA 1QZZA 4BEHB 4PZJA 3QQAA 4J00A 2Q2EB 1U78A 4RGRA 3RPQA 1WJCA 4MO7A 3HKZA 4L9JA 2Z3YA 5FKKA 2LD5A 1HQCA 5DDGA 2A6EF 2R4GA 3C2GA 3JRAA 1AU7A 2MYSA 2JUCA 1Z0XA 3CUOA 1R6RA 1TBXA 2E34A 2QENA 1I6HJ 3FK7A 3H9QA 4LITA 3KZYA 4A93J 1OCOH 4KITB 1YHQI 5D8KB 4W97A 3TBIA 1I3QJ 5ICCA 4PFPA 3COAC 4I99C 5FD6A 3NQOA 2FRHA 1JGGA 4GRIA 3HOVJ 4IHVA 1LPQA 2WAQA 3F8BA 3HXLA 4PSXA 1YX5A 2CQ7A 5D5UB 2DBBA 3QAHA 3JAMZ 2VLAA 4AIDA 1WI9A 1SFOJ 2V26A 1SFEA 4BGDA 3R0JA 3ZQFA 1YRNA 3G73A 4OAZA 3BZKA 2XGCA 4HX7A 1REPC 2K4JA 2PQ8A 5FKMA 2P5VA 4YFKF 3EPZA 1S9HA 2J5PA 3FKJA 3B73A 2IS4A 3WG9A 1DDNA 1FLIA 2ZMEC 4MEYF 1D0YA 4NUBA 3BP8A 1BA5A 4Z2YA 1SAUA 2M0MA 2WWYA 3WE2A 2HWVA 4EJUA 1ZG5A 1AA7A 3MKWB 3PO2J 3HZJA 3A02A 3M1CA 1YI2I 4B4CA 1T95A 3U21A 4D7NA 1X3WB 3MAJA 2Y75A 3FZVA 2EV6A 1OJLA 1E3HA 3KE2A 1IUYA 1HA8A 2HQ5A 3DPUA 2KFDA 4G7ZF 4AD9A 1R5HA 3J81Z 5GAGJ 2ID3A 2O03A 4C30A 3IH3A 1ZGJA 2K3PA 3ABMH 1HBXG 5JR3A 3ML6A 4A0ZA 5GTIC 5KK1A 1X1PA 2R7DA 3ABKH 3K4LA 3V8JA 1FY7A 4DZPA 2W25A 2XC7A 2IGOA 2Q8KA 2F5VA 4B8XA 4CYCB 1CQTA 2FU4A 1QZEA 2KISA 1FBSA 2L9NA 3I5UA 2MGQA 5LRSA 4JBAA 5FO5A 1IRGA 2XF6A 2CU7A 3LA3A 4BQOA 1PUFA 4ZDLA 3HOTA 4Y52J 1O57A 1P9QC 3SZTA 3EUHA 4OMZA 1G3SA 3FBNB 2LYCA 2I10A 3E5XA 4XLEA 1DGRM 3BWGA 1VNDA 4GYGA 4XONA 3H0DA 2ZJQF 1LDDA 2MD0A 3CJRB 4HNUA 3BPXA 4UVAA 3L2QA 4ENJA 3KETA 2R7XA 1Z21A 2LLKA 1JT6A 3CC7I 3MFKA 3JRCA 2ZNYA 1U9OA 3GBGA 4P1WA 4EATA 3KX2A 3KP5A 3OL3A 4LOCA 2FD5A 2QQBA 4J01A 4A6EA 3ZMTA 2FQ4A 3GXOA 1OCRH 1B59A 1OKRA 2AQFA 2DJNA 1X1DA 3B02A 5CLSA 3P9IA 4B44A 4A3JJ 2VUMJ 1T2KA 4RAGA 5ICEA 3E97A 3P5JA 4MQ9F 2DDAA 2LNBA 2R93J 4PCQA 5KVRA 5LHIA 1ONVA 1K61A 1MJ9A 2OA4A 1Z6TA 3NAUA 4P9FA 4HDVA 2ELJA 3W2VA 1IN6A 1J2XA 1K7AA 1MZBA 4E7KA 1D3YA 3L9FA 1W5SA 3MMYB 2UV1A 4EMSA 4NQWB 5K7FA 5M3MJ 3JR9A 1XS9A 4E70A 1TT0A 3TL4X 4B3AA 5HDNA 3D0SA 2PMHA 3CLOA 3HIFA 1VQ9I 2CW0F 1WSUA 1LEAA 5ERIA 5HS9A 1XTAA 2PN6A 3ZQQA 2DOAA 3OIOA 1R23A 2JUGA 3LFKA 3RJPA 4C9YA 4B48A 1WWXA 2X9DA 3LSHA 2PG4A 2PFBA 1IV8A 3J80K 3CCUI 1FT9A 3ZCOA 4E6KG 4ZTFA 3M07A 4NBQA 2EFWA 2XPUA 3CP2A 3BROA 3L7WA 3ROUA 3ZN0A 4KUMA 1R5GA 2WA0A 1MDMA 1XSDA 5EG0A 2FBHA 3FMSA 4CO8A 3IC7A 4I6ZA 2M3AA 5EDNA 2BY1A 1CF7B 2G9WA 2L9VA 1LDKB 3F8CA 4XQFA 3GCMA 4A0XA 3SZPA 5HLIA 1BC8C 3J7ZI 2BXYA 2CV2A 2BV6A 3BZ6A 2JZYA 1EH6A 3E5QA 3QPTA 2A07F 3EUKL 3K1PA 1PP8F 1USSA 3KZIC 1TNSA 3ZMZA 3F8NA 5DCFA 3CCMI 1R4MB 2F5CA 4ZZLA 3KZZA 2O7OA 3LAJA 3O8HA 1X2MA 3MN2A 4XKBA 3VODA 2NS8A 2DCEA 2VT2A 1XB4A 2IPQX 3DU5A 2IRFG 3WGIA 3LQRA 1MMDA 2G7HA 4X1EA 4XRSG 3S2HJ 2Z5UA 4UV8A 1EV7A 3BTIA 4ZYAA 4UXNA 3S93A 1BI1A 4MLOA 1ZG1A 3WU0A 2LKXA 2V4JC 4AIHA 4IRHA 4BQAA 2GQQA 3HRUA 3EUAA 2P5KA 1UMQA 2DW4A 1D8KA 5FLXZ 1AKHB 2X48A 4LG0A 5HLHA 1ZN2A 5JHUA 3TO7A 1MBJA 2VJIA 3ERED 4L0ZB 1B72B 3RYPA 2KDOA 1WJ5A 3IHUA 1TWAJ 2L0KA 3UR3C 1AOYA 3R61A 3OYMA 3HOYJ 4PJMA 2CGPA 1JUMA 2STTA 4UNOA 1N25A 1MGTA 2WADA 2WTEA 1MBFA 3ZOBA 3QODA 1TNTA 2OC6A 2P6TA 3GZ5A 3MKZA 1YQAA 2WY7Q 2HKXA 3BDDA 1ETWA 1J7KA 4C3JJ 5ED4A 4QTRA 1JE8A 1EH7A 3LL7A 2DYRH 2E1CA 2ZJ2A 3V7SA 4QIWN 1A6QA 3QWLA 5IP9J 2W85A 2Y69H 2XF7A 1ZR4A 1V55H 2R7ZJ 2ZCWA 4NDLA 2VJ4A 4HDUA 1O7FA 2X6WA 4XSZF 4RAZA 1YO5C 3SHFA 5A2QK 3PIPF 2R5YA 3I53A 4I76A 4L9TA 1BI2A 2D5VA 2DU9A 3CC2I 2DA7A 3FXOA 1FIPA 5FJ8J 3OYNA 3DBRB 1F5TA 3MQ0A 1Z05A 3C3WA 1VQ8I 1RZ4A 3DKYA 3WTUC 3CMEI 5AIQA 2F6CA 2GWRA 5E1WA 3W6VA 4PJ0C 3KP6A 1PP7U 4BY1J 4D9JA 2VXDA 3TQNA 2NXNB 1BR1A 1HF0A 1EF4A 5EGOB 2LMDA 1TTYA 4Y3OA 3JTHA 3K4MA 5KHDA 3OYKA 4V2FA 4PK4A 2XAJA 5GP9A 1WJEA 1U5TB 5J8FA 1TLHB 2WB1N 1E3OC 2KQRA 3K9TA 1ETXA 4KT5C 3K70D 5C4XJ 3IKVA 5FRMA 3KP3A 5DS9A 2JTVA 4B43A 1AHDP 4LFUA 1SD5A 2DT5A 4FTHA 2W00A 2XSJC 4Y15A 5HNFA 4IJAA 4EV0A 3BR6A 5K5OA 1ETKA 3SDBA 2HOEA 2LY9A 5FGMA 3MWMA 3OIPA 1B9NA 3BTCA 3F9KA 1SFUA 2VASA 1SAXA 5FD5A 3HL2A 3RQ4A 1HSTA 2NVTJ 2R7UA 4D5FA 1Z6RA 1Z3XA 4HV6A 5CJ9A 5BOXA 1DP7P 2JA6J 5LBQA 2MH2A 2PMZN 4CDGA 2IEKA 1W7PA 1UHMA 3DWLE 1XDSA 2QSFX 5HVQC 3E6MA 1BC7C 1U3EM 2VL8A 1IRZA 3TDUC 3PUBA 2PJRA 2LR8A 2XGXA 4G7OF 5E3OA 3RPUA 5ICGA 5D6FA 3LSGA 5D5WB 2O61A 3H5RA 3M9AA 5E1XA 3K0LA 1YLFA 3KCCA 4EJWA 3H36A 2VBYA 4I09A 5EJCA 3VSKA 3DXJF 2DFEA 1OYIA 3B6AA 1A6IA 4L5IA 1P6RA 2JRTA 4O5VA 3RZOJ 2XPVA 3FF5A 5HLTA 1A04A 5DM6F 5IY5H 1R1UA 3ISPA 2NVUB 1VQKI 5F64A 2O6GE 5GADJ 4IQ4A 5DD4A 2HNHA 4FETA 2ESNA 2ZKZA 5CVIA 1KGSA 2NVXJ 1DGWY 2ZC2A 3IAS2 4IRIA 4I2OA 3F72A 2LSOA 3I4PA 3V42A 5FLVA 1T39A 1TWFJ 2CW8A 3L2CA 4I02A 1I27A 1JTXA 5DV5A 2EB7A 4GFBA 1FTTA 1Y8RB 2LG4A 4S04A 2LY1A 2FBIA 2ZSIB 3CO6C 1WFXA 1N78A 2XB5A 1BR4A 1MIJA 3CUQB 5BS6A 6PAXA 2H1LA 1LE8B 3F21A 3WTYC 3T8TA 4UUVA 3ZGKA 1W1WE 1U2WA 5DCMA 1R7JA 2EZIA 3LMMA 3QYFA 1FMWA 1WZ2A 2WBMA 1W5TA 5H2FC 5E3LA 3DLAA 4HZFA 2R5ZA 4BAYA 3I58A 1XMAA 1TW2A 3S2WA 4E7LA 3ABUA 2VBZA 4M71A 4A2UA 4BBRJ 1LDJA 3HOZJ 1UHWA 1G3TA 3GTMJ 5J8CA 5K7HA 2ID6A 2PI0A 1S6LA 4G9YA 4Q47A 3CCJI 3F22A 3I9V2 4IX7A 3JRFA 3BR5A 3RTRA 2OZ6A 1QGPA 1JHFA 2Z99A 4RB2C 4KNYA 2DA6A 4EJVA 5CVVA 2R7TA 1WVRA 1OR7C 3WG7H 1IDYA 3DTKA 4DYRA 3BTJA 2EIMH 1FYLA 1ZK8A 2ETHA 1WI3A 3IKTA 3PQJA 1ON1A 2XF5A 3MEXA 3K6GA 2KKOA 2ZXWH 4M3BA 4PJNA 1IN4A 3S2DJ 5JI6A 2XPWA 1ZKGA 3H3ZA 3ZN1A 3I54A 4D5CA 4EVIA 1E17A 4DW6A 3NARA 4F52A 3ASOH 4XRFA 2VE9A 5BNGA 5HLGA 2BOLA 4EM1A 4XK4A 2ESHA 2LFBA 3HSFA 2JPBA 1BL0A 5B66C 1UZCA 4CCKA 4XRSA 4OIQF 3OOUA 4EGYA 4DBQA 4PSWA 4BYYA 3ZQIA 5JLWA 2X6XA 2E36A 5BQTA 3DFGA 2JSCA 1Y56A 4GYIA 2QQAA 4A5MA 1OCZH 5F04A 3E6CC 2P7CB 1Z91A 4EM0B 2MG4A 3FHNA 4XLCA 1APLC 2PMUA 1A36A 3IWZA 4RLQA 1CGPA 3OWTA 3RKYA 2ZXJA 4IHTA 1FBQA 1H0MA 4KFCA 4UUSB 2Y2ZA 3IP4B 2XAQA 5M5XJ 1JI8A 2BEOA 2CUFA 4YFNF 4WK8F 3Q0UA 4OOIA 1RI7A 3LSTA 4RB0A 3H5NA 5TRDA 1BIAA 2ADUA 2WV0A 3IH2A 3HPGA 5FFZA 2KIQA 1QVTA 2X51A 2VT3A 1SD4A 2WV1A 4XORA 1R00A 2E5ZA 3OS0A 1FC3A 2DMTA 4XLPF 4BEHA 2K3FA 5FB2A 2HVSA 2Q2EA 4IZZA 5FKOA 1YJWI 1RR7A 1O3SA 2OV7A 2VXZA 4D7MA 4E4HA 2NS0A 2HQAA 3QPLA 2XASA 1PYVA 2BE5F 2KIFA 1P7IA 3KYCB 4YIRX 3K4JA 2IS2A 9ANTA 2OUMA 1ZGAA 2ME6A 2EZHA 2IS1A 4BDZA 2COMA 1KU2A 3S1MJ 3HOWJ 2XDVA 4LD5A 3LSIA 2DMUA 2H8WA 2HS5A 2WAFA 1ETYA 3DBHB 2CFXA 1E3PA 4KDPA 1KU7A 1VFCA 3HUGB 3ZQLA 3K1NA 1GVDA 2ZFUA 4OIRF 2BXZA 4C2MJ 2BY3A 1LFBA 3TP3A 5IYCJ 2GAUA 4NC7A 1RUOA 1TL8A 2LKSA 2TCTA 3P9KA 3R4KA 3H1CA 1Y1VJ 1MW7A 3K69A 2IA2A 3H3UA 1TWHJ 2IJLA 3OYCA 2MH9A 3GLLA 4DGWB 2X6OA 3IUOA 4L18B 3MKLA 1RC9A 4NB5A 2GOMA 1T0FA 1YE9A 3QPSA 3U2RA 1ETOA 2WC2A 2ZMEB 4AM3A 2CV1A 2H6CA 2HR3A 4JYKA 4FE4A 2EV5A 4G6TB 4PDKA 1K6YA 3GFLA 2IAIA 2LBFA 3LSJA 3SXYA 4M72A 1NH3A 1JTYA 2FMYA 1PDNC 4A3CJ 3PL8A 2PEXA 3VYTB 4BU2A 3LAPA 3FM3A 2KRHA 4GXOA 4XOTA 3OSFA 3RKXA 2EPFA 2BHZA 3VPRA 1U9NA 1XPXA 2E7XA 3BY6A 1HW1A 1Y1WJ 2PX9A 4NHJA 4BXUA 5J4VA 4A12A 2DJIA 1F1ZA 3G3ZA 1XD7A 3BCAA 5IYBJ 5EEGA 2DA3A 2EFPA 2QYOA 4BACA 1LFUP 1L0OC 3I59B 4I98B 5E3MA 4FHTA 3L2VA 3BZCA 4A3GJ 4CYCA 1HW2A 3HRTA 3F6VA 2BVMA 4CUGA 1D0ZA 2LY2A 1GT0C 1T33A 5J4YA 4FQGA 4FCYA 4LK1F 5DD8A 1QO0D 2I5UA 5L3DA 1SMYF 1LNWA 3LQQA 4EQQA 1FBUA 4LLNA 1DPRA 2X1EA 5HODA 2L3DA 4HQMA 1WCMJ 4LG3A 2V6EA 4OIPF 3VB2A 3L1PA 4N4OB 1HCRA 1BM9A 3CESA 4PJJA 3DLLF 2CO5A 5LGUA 5GAHJ 3OSGA 4A3MJ 4BUPA 3T5XA 4AUXA 3CZ6A 4A3EJ 1D5VA 1LUJB 1WH7A 1Z7UA 3SZGA 4IO9F 4EJOA 4I7HA 2YX7A 2QLZA 2Y9ZA 3DV8A 1UB9A 1XC5A 1YOVB 2M7BA 2E1NA 5EEAA 2Y30A 2L7ZA 2ZFWA 2DMQA 2ME0A 4BJ5C 2JA7J 4Q4ZF 3X2QH 4G8XA 3SFIA 2GOXB 2KZVA 3E0JB 3CMAI 2O0YA 2HOSA 3KLNA 2RV8A 2ELKA 5LGNA 2EIJH 3IV5A 2DMPA 3F6OA 4MNUA 3R0AA 3RZDJ 4BJ6C 2BYVE 4QSHA 1DU0A 2KRCA 1BBYA 1PJRA 3VDXA 4ZC3A 3ZMUA 2BY2A 5J1UA 1FSHA 1SVOA 2DQLA 1I6XA 4NQWA 4EM2A 4KA4A 4M3GA 4ANJA 1J5YA 2M8EA 4A69C 3JRBA 1SVMA 1QBJA 3HPHA 3CTAA 1WPKA 4XRMA 2OU2A 3CO7C 1NG6A 1U8RA 4IHXA 4DNCA 1I50J 2BW3B 3LOCA 1H88C 4B1RA 2VQGA 2RGVA 4XN0A 5B1AH 2JT1A 3S3OA 5J40A 3QYBA 2O5RA 1UG0A 2W57A 4FT8A 1Z7LA 5LGTA 4FASD 2DA5A 3PSIA 1FJLA 1CF7A 4KICA 3KEQA 3ZMDA 1VQ5I 5JVGF 5DTDA 4MFDA 1ETQA 3WTXC 3MVPA 1LB2A 3TO6A 2B7EA 2LF7A 2RVCA 1ZRFA 2PLYA 2Y0SA 1R71A 2E5NA 2FUG2 1FWZA 4G12A 2VB6A 3E5UA 4CYDA 4JX6A 3WTWC 4H4KC 3OYBA
chains in the Genus database with same CATH topology
3F3XA 4BH9A 2HQRA 2QQ9A 4JQFA 4MQVA 5ILVA 1L3LA 5LHGA 4XBFA 3LA7A 1MKMA 2G7UA 1GXQA 2YR2A 2GXGA 3GO5A 1OMIA 3KEOA 1YW8A 4I01A 4LB5A 1X3UA 3HTUA 4N0BA 3F23A 5ILUA 1KYWA 1F9NA 1KU3A 2M5WA 1ODDA 4LK0F 2NRAC 1JHHA 1R22A 1ZH5A 3ZP5A 3WE3A 2E7WA 2D2WA 3V4GA 1IN7A 3ECHA 2K27A 4HF0A 1ZREA 2V1XA 2XROA 3EDPA 4HLYA 3TO9A 1I1SA 4I0AA 2EWNA 1HXDA 3O3KA 5D5VB 3DP7A 4LGWA 5DUKA 4UVBA 3EYIA 4K2EA 3RIRA 3J80Z 3I64A 1TW3A 1FOKA 3O6BB 1P2FA 5H6QA 2RC4A 3EQLF 5DEQA 1U5TA 5J6XA 3C1DA 4HX8A 4KIBA 1YW7A 3DF8A 1K78B 4G7HF 1XCBA 1XSXA 3KP2A 4XSXF 4N9HA 1OYWA 3CJNA 1P4AA 1TQMA 2P5LC 4FX0A 2VOPA 2DFIA 2DI3A 2M30A 1QQIA 3V8KA 4D0PA 1O3RA 2UWMA 4AWXB 4F7ZA 4AVPA 5JVTA 1S3JA 1I5ZA 4YIFA 1WRJA 3FXRA 1KA8A 1VTNC 1O7LA 3QRFF 2YPRA 2M87A 1KQ8A 2UXXA 3CUQA 5A2QZ 4M73A 3JSPA 2X4HA 4ZYEA 4PGHA 2XKOA 3VFZA 3AAFA 4TV7A 4XLNF 4IXAA 4P96A 4ENMA 1BN5A 1Q1HA 2XKPA 3ZMSA 3MZYA 4ZZDA 3HHHA 2GA1A 4O6JA 4O3MA 2FF4A 2H27A 1YS6A 4OINF 3M8FA 4G94A 5HDKA 2FSWA 4M9ZA 4P5OA 4ZYHA 1KQ9A 5L3BA 3ELKA 2IA0A 1QNTA 1XGNA 1YG2A 3RDIA 5ILSA 2M45A 1XDUA 4WCGA 3T1BA 4WXCA 4RGXA 3LWFA 3OV8A 3GWZA 1Y0UA 1O3TA 2FEZA 4ESFA 3KFWX 1YW9A 4EGZA 4ZYGA 1DPUA 4WF2A 3T0YA 3IRQA 5E8IA 4FX4A 4ASNA 1SD6A 2KIUA 3LA2A 3WTSC 2UZKA 4BHPA 2OAZA 1U6GA 4HF1A 2DK5A 3JTGA 1Z9CA 4UHTA 3WTTC 4RAYA 5BPIA 1OPCA 3JSOA 1JXSA 1ZHFA 1BJAA 4R1HA 1TQPA 4KN4X 4CZZA 2L54A 3PFIA 4A0YA 3DQVC 5H6RA 3HUGA 3JW4A 1PUEE 1ZAOA 3QPHA 1G6NA 5F1RA 5FFXA 5D5XB 2F2EA 1ZRDA 3GVAA 2MLKA 2VOOA 4Y17A 1W7PB 1ZYRF 2D1VA 1K79A 2H6BA 4BHBA 2A3SA 3ECOA 2ZMEA 1MJBA 2QWWA 4IRGA 4KMUX 2P7VB 4KYWA 5E20A 3RKWA 2L4MA 1S7OA 2FMLA 2XIGA 5L3CA 4ETSA 1J59A 1HW5A 2FNAA 3P7NA 2YU3A 3BJAA 1KU9A 4GO1A 3BOQA 4YFXF 2A6HF 4MEXF 4Q48A 3QP6A 2B0LA 3GLXA 3I59A 4IF4A 2VODA 2EFNA 3M1EA 2IT0A 3W6KB 2A69F 3N4MA 3MZHA 3SQNA 5DCMB 5D8LB 4IHSA 1UCRA 1FYKA 2AS5F 2P4WA 5K5RA 4U7DA 1J75A 1IN8A 1FSEA 2HFHA 2DK8A 4HOBA 3ULQB 2XVCA 2HKOA 3FHZA 1RUNA 2IW5A 3NRVA 2STWA 4MGRA 2F5FA 1HKTA 4OMYA 5E1ZB 1ZG3A 4RS8A 1TQIA 1W7PD 1F4KA 3GZ6A 4MTDA 4U0YA 2FXAA 3KP4A 2OD5A 1IF1A 2FBKA 4WWCA 2QM3A 2EK5A 4UVCA 1RIOH 2W24A 2ZNZA 2RQPA 5K1YA 1MD0A 1FX7A 1T98A 1T38A 2IA1A 5L3GA 1SFXA 5HS7A 2NNYA 2OBPA 2DPDA 3BPVA 4M9XA 2HDCA 3C7JA 2CSOA 3E6BA 5L3FA 2OQRA 1RNLA 3JAMK 2P6SA 1S29A 2IP2A 1AWCA 5E17F 3OOPA 1XGMA 3QOPA 2Y48A 3VOEA 1LEBA 1IRFA 3Q9SA 3FWEA 2YSRA 1YTYA 2PBIA 1STZA 4PGGA 4KN7X 4BNCA 4HQEA 1K6OA 3RI4A 1WQ2A 2EFOA 2VBXA 4KIFA 4KIGA 2HGCA 1V3FA 3GEZA 1ON2A 4RB1A 1BOAA 2QBYB 4AIKA 1SMTA 2DTRA 3HRSA 2K4BA 4EJTA 3J81K 2XAGA 4M6YA 2NYXA 2UXNA 3TDZC 5K5QA 2J5OA 2XHKA 1QPMA 4MTEA 2VE8A 3D5LA 2VBWA 4WX9A 1T6SA 2HTJA 2OZUA 4U0VA 2XUBA 4S05A 3DPTA 4OU0A 4HA8A 3FM5A 2EFQA 1WKMA 3W6JB 2P8TA 1DUXC 2AXLA 2EA4A 5EEHA 2NNNA 4CHUA 4WXDA 3HTSB 3PQKA 1R36A 2QZ8A 1K78A 2HYFA 4Y13A 5HS8A 4ZYDA 5DUIA 2V79A 2CWEA 3NEUA 3I0TA 2Z9OA 1R1VA 3QU3A 4U0WA 4ESJA 4U7BA 3KLOA 1J9IA 1IXSB 1I1GA 2R7FA 3P9CA 4IVNA 2FNPA 3REOA 1JGSA 5JFRA 2Y0MA 1GXPA 3TOAA 4B09A 4A6DA 4R79A 4R8HA 3E6DA 5E18F 1HKSA 5IT3A 4YIIA 3QU6A 2LDUA 1USTA 2K02A 2XV4S 2KJBA 1FYMA 4H0EA 4ON0A 1MJAA 1G3WA 3FXQA 3IWFA 4P9UA 1ZRCA 2FA5A 5BPDA 4HAMA 3MCZA 3HYIA 3CDHA 1FP1D 2K86A 1BI0A 5DYMA 4WXHA 3ZPLA 1EH8A 5LHHA 1QZYA 4GCVA 3IL2A 4G6DA 3R6SA 1XGOA 3V8LA 2ELHA 5AONA 1B9MA 2W84A 5FLXK 3QP5A 2BGCA 3WGGA 2DLLA 2OQGA 2ZO4A 1G4DA 2D45A 1OR7A 1J0RA 2HYGD 2EA2A 4U88A 2HTSA 3N97A 3L00A 2GXBA 2A68F 2KIMA 3TOBA 3M7GA 2X0LA 5L3EA 3HOSA 2MLGA 3ZMVA 4MHGA 2NAZA 4CXFA 3DEUA 2FQ3A 1FNNA 2V1DA 3HSEA 3I71A 4CICA 4L5JA 1P4XA 5D4SA 3TGNA 1B1BA 2M1BA 2XRNA 3F8MA 2LF8A 3GUDA 1S8NA 2RNJA 3WTVC 3GX4X 3F8FA 4JK1X 1BIBA 5ICFA 1B6AA 1MDMB 1FP2A 4HV5A 4YG2F 3EETA 3H92A 1C0WA 1R58A 5CVJA 4L9VA 5TJJA 4A5NA 1OYYA 1YFHA 3FX3A 1ULYA 2DQRA 3IRRA 1XCVA 1UFMA 4L9NA 3SFZA 4GGGA 3VEPA 2XAFA 4ESBA 5BMZA 2HQNA 2A61A 1XMKA 4AIJA 1ZLJA 2CYYA 4HBLA 3WU1B 2TDXA 4RB3C 1IXRC 3WGHA 4LG0B 3WTZA 1FZPB 4QWQA 1XSVA 2O3FA 4HLXA 1ZLKA 2F5DA 3GFMA 2Q0OA 1IW7F 1ZARA 2XAHA 1IXCA 3WODF 3C18A 1GHCA 3K1MA 1LJ9A 2DO7A 1KYZA 5CYVA 3V7RA 3E3VA 2BBYA 1FPQA 3GFIA 2H09A 4DQ2A 3T8RA 4KMFA 4M9SA 2H94A 1O3QA 2IVMA 2MC3A 3Q5FA 1IAWA 5HOOA 1XN7A 4BHCA 3J7AO 4ZH4F 4RGUA 2KJCA 2LKPA 2CQKA 2QVOA 2RN7A 3U9GA 2DAOA 4LB6B 5D4RA 4CGZA 1W4MA 2C6YA 2VC1A 2RDPA 4M74A 2K7LA 2YX4A 1R1TA 2MBFA 4LJZF 2MA3A 1U5TC 2RKHA 2FOKA 3HRMA 2ISYA 3L09A 5D6EA 2ZBKA 2DPUA 5F6FA 1XGSA 2GZWA 2V9VA 5H20A 2VC0A 3U1DA 3FMQA 1YS7A 5CVRA 3ZQ7A 2QUFA 3TKYA 2KRFA 5LEJA 3KP7A 1HSJA 2R3SA 4LMYA 4QLCU 3DPLC 1YIOA 1GVJA 4RGSA 1H9TA 2HZTA 2EJRA 1KQ0A 2MD5A 2EV0A 1SD7A 3BJ6A 4G6QA 2V1UA 2F5EA 3Q9VA 4OIOF 4N9IA 2Z33A 5LLQA 4M6XA 3HSRA 1B4AA 4HF2A 2VN2A 4ENNA 3O2PE 3DKWA 3V7CA 4HW0A 3HHGA 1E2XA 5E8GA 3K2ZA 4HYEA 2L01A 3CUQC 1P92A 2A5YB 4ENKA 2ACJA 2GA2A 1G3YA 3EYYA 2O8XA 2V6CA 5CVUA 4I0BA 1IZ1A 1H9GA 1BI3A 4P55A 3GW2A 4LLLA 3M8EA 4Q5SF 1YYVA 1NHAA 2JPCA 1D8JA 2FE3A 2CG4A 3FXUA 1LVAA 1V4RA 1S7AA 2L4AA 3GYHX 3GF2A 2D1HA 1IN5A 5IT9K 1Z1DA 1P4WA 2QBYA 3GFJA 3BJOA 4HX4A 2GIVA 5HDGA 2VONA 4L0YB 5LRRA 3RYRA 1HKQA 3ABTA 1LQ1A 5AIPA 4UV9A 2PJPA 4LLGF 5LEKA 5IT9Z 3R60A 2L02A 2ISZA 3FMRA 2HEOA 4IPAA 1QZZA 4PZJA 1U78A 4RGRA 3RPQA 4L9JA 2Z3YA 1HQCA 5DDGA 2A6EF 3CUOA 1TBXA 2QENA 3KZYA 5D8KB 5ICCA 3COAC 5FD6A 3NQOA 2FRHA 3F8BA 5D5UB 2DBBA 3QAHA 3JAMZ 1WI9A 1SFEA 3R0JA 3G73A 4HX7A 1REPC 2K4JA 2PQ8A 2P5VA 4YFKF 2J5PA 3B73A 3WG9A 1DDNA 1FLIA 4MEYF 3BP8A 4Z2YA 2WWYA 3WE2A 2HWVA 4EJUA 1ZG5A 3MAJA 2Y75A 3FZVA 2EV6A 1IUYA 3KE2A 4G7ZF 4AD9A 1R5HA 3J81Z 2O03A 1ZGJA 1HBXG 5JR3A 3ML6A 4A0ZA 5KK1A 2R7DA 3V8JA 1FY7A 2W25A 2Q8KA 4B8XA 2FU4A 1FBSA 3I5UA 5LRSA 4JBAA 5FO5A 1IRGA 3LA3A 3HOTA 1O57A 3SZTA 3EUHA 4OMZA 1G3SA 3E5XA 3BWGA 4GYGA 1LDDA 3BPXA 4UVAA 4ENJA 3KETA 3MFKA 2ZNYA 3KP5A 2QQBA 4A6EA 3ZMTA 3GXOA 1B59A 1OKRA 3B02A 5CLSA 3P9IA 1T2KA 5ICEA 3E97A 4MQ9F 2LNBA 5LHIA 4PCQA 5KVRA 1ONVA 1MJ9A 2OA4A 1Z6TA 4P9FA 4HDVA 1IN6A 1J2XA 1K7AA 1MZBA 1D3YA 3L9FA 1W5SA 4EMSA 4E70A 5HDNA 3D0SA 2PMHA 3CLOA 3HIFA 2CW0F 1WSUA 1LEAA 5ERIA 5HS9A 2PN6A 3RJPA 1R23A 3LFKA 1WWXA 2PG4A 2PFBA 3J80K 1FT9A 2EFWA 3BROA 3ZN0A 3L7WA 3ROUA 4KUMA 1R5GA 1MDMA 1XSDA 2FBHA 3FMSA 4CO8A 3IC7A 1CF7B 2G9WA 1LDKB 3F8CA 4A0XA 3SZPA 5HLIA 1BC8C 2BV6A 3BZ6A 2JZYA 1EH6A 3E5QA 3QPTA 2A07F 3K1PA 1PP8F 1USSA 1TNSA 3ZMZA 3F8NA 5DCFA 2F5CA 4ZZLA 3KZZA 3LAJA 3VODA 2VT2A 1XB4A 2IPQX 2IRFG 3WGIA 3LQRA 2G7HA 2Z5UA 4UV8A 1EV7A 4UXNA 1BI1A 1ZG1A 3WU0A 4AIHA 4IRHA 4BQAA 2GQQA 3HRUA 2P5KA 2DW4A 1D8KA 5FLXZ 4LG0A 5HLHA 1ZN2A 5JHUA 3TO7A 4L0ZB 3ERED 3RYPA 3IHUA 1AOYA 3R61A 2CGPA 2STTA 4UNOA 1MGTA 2WTEA 1TNTA 2P6TA 3GZ5A 1YQAA 2HKXA 3BDDA 5ED4A 1J7KA 1JE8A 1EH7A 2E1CA 2ZJ2A 3V7SA 2W85A 2ZCWA 4HDUA 1O7FA 4XSZF 4RAZA 1YO5C 3SHFA 5A2QK 3I53A 4L9TA 1BI2A 2DU9A 1F5TA 3MQ0A 1Z05A 3C3WA 1RZ4A 3WTUC 5AIQA 2GWRA 5E1WA 3KP6A 1PP7U 3TQNA 1TTYA 3JTHA 2XAJA 1U5TB 5J8FA 1TLHB 3K9TA 4KT5C 3IKVA 3KP3A 2JTVA 4LFUA 1SD5A 2DT5A 4Y15A 4IJAA 4EV0A 5K5OA 2HOEA 5FGMA 3MWMA 1B9NA 1SFUA 1SAXA 5FD5A 1HSTA 1Z6RA 4HV6A 5CJ9A 5BOXA 1DP7P 5LBQA 2MH2A 4CDGA 1W7PA 1UHMA 1XDSA 5HVQC 3E6MA 1BC7C 1U3EM 3TDUC 2XGXA 4G7OF 3RPUA 5ICGA 5D6FA 5D5WB 2O61A 3M9AA 5E1XA 3K0LA 1YLFA 3KCCA 4EJWA 4I09A 2VBYA 3DXJF 4L5IA 1OYIA 1P6RA 2JRTA 4O5VA 3FF5A 1A04A 1R1UA 3ISPA 5F64A 2O6GE 5DD4A 2ESNA 2ZKZA 5CVIA 1KGSA 4I2OA 4IRIA 3F72A 2LSOA 3I4PA 1T39A 3L2CA 4I02A 1I27A 5DV5A 2EB7A 4S04A 2FBIA 3CO6C 3CUQB 5BS6A 6PAXA 3F21A 3WTYC 3T8TA 4UUVA 1U2WA 5DCMA 1R7JA 1W5TA 4HZFA 4BAYA 3I58A 1XMAA 1TW2A 3S2WA 3ABUA 2VBZA 4M71A 4A2UA 1LDJA 1UHWA 1G3TA 5J8CA 2PI0A 1S6LA 4G9YA 4Q47A 3F22A 3RTRA 2OZ6A 1QGPA 1JHFA 2Z99A 4RB2C 4KNYA 4EJVA 5CVVA 1FYLA 2ETHA 3IKTA 3PQJA 1ON1A 3MEXA 2KKOA 1IN4A 5JI6A 3H3ZA 3ZN1A 3I54A 4EVIA 1E17A 4XRFA 2VE9A 5HLGA 4EM1A 2ESHA 3HSFA 2JPBA 4OIQF 4EGYA 4BYYA 5BQTA 3DFGA 2JSCA 4GYIA 2QQAA 4A5MA 3E6CC 2P7CB 1Z91A 4EM0B 2PMUA 3IWZA 1CGPA 4IHTA 3RKYA 2ZXJA 1FBQA 1H0MA 4KFCA 2XAQA 2BEOA 4YFNF 4WK8F 4OOIA 1RI7A 3LSTA 4RB0A 5TRDA 1BIAA 2ADUA 2WV0A 5FFZA 2VT3A 1SD4A 1R00A 1FC3A 4XLPF 5FB2A 2Q2EA 1O3SA 2VXZA 2NS0A 2XASA 2BE5F 2KIFA 1ZGAA 2COMA 1KU2A 4LD5A 2HS5A 2CFXA 4KDPA 1KU7A 3K1NA 4OIRF 2GAUA 1RUOA 3P9KA 3R4KA 3K69A 2IA2A 3H3UA 2IJLA 2MH9A 4L18B 4NB5A 1T0FA 3U2RA 2WC2A 2ZMEB 2H6CA 2HR3A 2EV5A 4PDKA 3GFLA 3SXYA 4M72A 2FMYA 1PDNC 2PEXA 3LAPA 3FM3A 4GXOA 3RKXA 2E7XA 3BY6A 1HW1A 4NHJA 4BXUA 4A12A 1F1ZA 3G3ZA 1XD7A 5EEGA 2EFPA 2QYOA 1L0OC 3I59B 4I98B 4FHTA 1HW2A 3HRTA 3F6VA 4LK1F 5DD8A 1QO0D 5L3DA 1SMYF 1LNWA 3LQQA 4EQQA 1FBUA 4LLNA 1DPRA 2L3DA 4HQMA 4OIPF 3VB2A 1BM9A 2CO5A 5LGUA 3T5XA 1D5VA 1Z7UA 4EJOA 4I7HA 2YX7A 2QLZA 3DV8A 1UB9A 2E1NA 2ZFWA 4Q4ZF 4G8XA 2O0YA 3KLNA 2RV8A 5LGNA 3F6OA 4MNUA 3R0AA 2BYVE 1BBYA 3ZMUA 1FSHA 2DQLA 1I6XA 4NQWA 4EM2A 4KA4A 1J5YA 2M8EA 1QBJA 3CTAA 2OU2A 3CO7C 1U8RA 4DNCA 2RGVA 2JT1A 2W57A 4FT8A 5LGTA 1CF7A 4KICA 3KEQA 3ZMDA 3WTXC 1LB2A 3TO6A 2LF7A 2RVCA 1ZRFA 2PLYA 1FWZA 3E5UA 4CYDA 3WTWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3X A;  4BH9 A;  2HQR A;  2QQ9 A;  4JQF A;  4MQV A;  5ILV A;  1L3L A;  5LHG A;  4XBF A;  3LA7 A;  1MKM A;  2G7U A;  1GXQ A;  2YR2 A;  2GXG A;  3GO5 A;  1OMI A;  3KEO A;  1YW8 A;  4I01 A;  4LB5 A;  1X3U A;  3HTU A;  4N0B A;  3F23 A;  5ILU A;  1KYW A;  1F9N A;  1KU3 A;  2M5W A;  1ODD A;  4LK0 F;  2NRA C;  1JHH A;  1R22 A;  1ZH5 A;  3ZP5 A;  3WE3 A;  2E7W A;  2D2W A;  3V4G A;  1IN7 A;  3ECH A;  2K27 A;  4HF0 A;  1ZRE A;  2V1X A;  2XRO A;  3EDP A;  4HLY A;  3TO9 A;  1I1S A;  4I0A A;  2EWN A;  1HXD A;  3O3K A;  5D5V B;  3DP7 A;  4LGW A;  5DUK A;  4UVB A;  3EYI A;  4K2E A;  3RIR A;  3J80 Z;  3I64 A;  1TW3 A;  1FOK A;  3O6B B;  1P2F A;  5H6Q A;  2RC4 A;  3EQL F;  5DEQ A;  1U5T A;  5J6X A;  3C1D A;  4HX8 A;  4KIB A;  1YW7 A;  3DF8 A;  1K78 B;  4G7H F;  1XCB A;  1XSX A;  3KP2 A;  4XSX F;  4N9H A;  1OYW A;  3CJN A;  1P4A A;  1TQM A;  2P5L C;  4FX0 A;  2VOP A;  2DFI A;  2DI3 A;  2M30 A;  1QQI A;  3V8K A;  4D0P A;  1O3R A;  2UWM A;  4AWX B;  4F7Z A;  4AVP A;  5JVT A;  1S3J A;  1I5Z A;  4YIF A;  1WRJ A;  3FXR A;  1KA8 A;  1VTN C;  1O7L A;  3QRF F;  2YPR A;  2M87 A;  1KQ8 A;  2UXX A;  3CUQ A;  5A2Q Z;  4M73 A;  3JSP A;  2X4H A;  4ZYE A;  4PGH A;  2XKO A;  3VFZ A;  3AAF A;  4TV7 A;  4XLN F;  4IXA A;  4P96 A;  4ENM A;  1BN5 A;  1Q1H A;  2XKP A;  3ZMS A;  3MZY A;  4ZZD A;  3HHH A;  2GA1 A;  4O6J A;  4O3M A;  2FF4 A;  2H27 A;  1YS6 A;  4OIN F;  3M8F A;  4G94 A;  5HDK A;  2FSW A;  4M9Z A;  4P5O A;  4ZYH A;  1KQ9 A;  5L3B A;  3ELK A;  2IA0 A;  1QNT A;  1XGN A;  1YG2 A;  3RDI A;  5ILS A;  2M45 A;  1XDU A;  4WCG A;  3T1B A;  4WXC A;  4RGX A;  3LWF A;  3OV8 A;  3GWZ A;  1Y0U A;  1O3T A;  2FEZ A;  4ESF A;  3KFW X;  1YW9 A;  4EGZ A;  4ZYG A;  1DPU A;  4WF2 A;  3T0Y A;  3IRQ A;  5E8I A;  4FX4 A;  4ASN A;  1SD6 A;  2KIU A;  3LA2 A;  3WTS C;  2UZK A;  4BHP A;  2OAZ A;  1U6G A;  4HF1 A;  2DK5 A;  3JTG A;  1Z9C A;  4UHT A;  3WTT C;  4RAY A;  5BPI A;  1OPC A;  3JSO A;  1JXS A;  1ZHF A;  1BJA A;  4R1H A;  1TQP A;  4KN4 X;  4CZZ A;  2L54 A;  3PFI A;  4A0Y A;  3DQV C;  5H6R A;  3HUG A;  3JW4 A;  1PUE E;  1ZAO A;  3QPH A;  1G6N A;  5F1R A;  5FFX A;  5D5X B;  2F2E A;  1ZRD A;  3GVA A;  2MLK A;  2VOO A;  4Y17 A;  1W7P B;  1ZYR F;  2D1V A;  1K79 A;  2H6B A;  4BHB A;  2A3S A;  3ECO A;  2ZME A;  1MJB A;  2QWW A;  4IRG A;  4KMU X;  2P7V B;  4KYW A;  5E20 A;  3RKW A;  2L4M A;  1S7O A;  2FML A;  2XIG A;  5L3C A;  4ETS A;  1J59 A;  1HW5 A;  2FNA A;  3P7N A;  2YU3 A;  3BJA A;  1KU9 A;  4GO1 A;  3BOQ A;  4YFX F;  2A6H F;  4MEX F;  4Q48 A;  3QP6 A;  2B0L A;  3GLX A;  3I59 A;  4IF4 A;  2VOD A;  2EFN A;  3M1E A;  2IT0 A;  3W6K B;  2A69 F;  3N4M A;  3MZH A;  3SQN A;  5DCM B;  5D8L B;  4IHS A;  1UCR A;  1FYK A;  2AS5 F;  2P4W A;  5K5R A;  4U7D A;  1J75 A;  1IN8 A;  1FSE A;  2HFH A;  2DK8 A;  4HOB A;  3ULQ B;  2XVC A;  2HKO A;  3FHZ A;  1RUN A;  2IW5 A;  3NRV A;  2STW A;  4MGR A;  2F5F A;  1HKT A;  4OMY A;  5E1Z B;  1ZG3 A;  4RS8 A;  1TQI A;  1W7P D;  1F4K A;  3GZ6 A;  4MTD A;  4U0Y A;  2FXA A;  3KP4 A;  2OD5 A;  1IF1 A;  2FBK A;  4WWC A;  2QM3 A;  2EK5 A;  4UVC A;  1RIO H;  2W24 A;  2ZNZ A;  2RQP A;  5K1Y A;  1MD0 A;  1FX7 A;  1T98 A;  1T38 A;  2IA1 A;  5L3G A;  1SFX A;  5HS7 A;  2NNY A;  2OBP A;  2DPD A;  3BPV A;  4M9X A;  2HDC A;  3C7J A;  2CSO A;  3E6B A;  5L3F A;  2OQR A;  1RNL A;  3JAM K;  2P6S A;  1S29 A;  2IP2 A;  1AWC A;  5E17 F;  3OOP A;  1XGM A;  3QOP A;  2Y48 A;  3VOE A;  1LEB A;  1IRF A;  3Q9S A;  3FWE A;  2YSR A;  1YTY A;  2PBI A;  1STZ A;  4PGG A;  4KN7 X;  4BNC A;  4HQE A;  1K6O A;  3RI4 A;  1WQ2 A;  2EFO A;  2VBX A;  4KIF A;  4KIG A;  2HGC A;  1V3F A;  3GEZ A;  1ON2 A;  4RB1 A;  1BOA A;  2QBY B;  4AIK A;  1SMT A;  2DTR A;  3HRS A;  2K4B A;  4EJT A;  3J81 K;  2XAG A;  4M6Y A;  2NYX A;  2UXN A;  3TDZ C;  5K5Q A;  2J5O A;  2XHK A;  1QPM A;  4MTE A;  2VE8 A;  3D5L A;  2VBW A;  4WX9 A;  1T6S A;  2HTJ A;  2OZU A;  4U0V A;  2XUB A;  4S05 A;  3DPT A;  4OU0 A;  4HA8 A;  3FM5 A;  2EFQ A;  1WKM A;  3W6J B;  2P8T A;  1DUX C;  2AXL A;  2EA4 A;  5EEH A;  2NNN A;  4CHU A;  4WXD A;  3HTS B;  3PQK A;  1R36 A;  2QZ8 A;  1K78 A;  2HYF A;  4Y13 A;  5HS8 A;  4ZYD A;  5DUI A;  2V79 A;  2CWE A;  3NEU A;  3I0T A;  2Z9O A;  1R1V A;  3QU3 A;  4U0W A;  4ESJ A;  4U7B A;  3KLO A;  1J9I A;  1IXS B;  1I1G A;  2R7F A;  3P9C A;  4IVN A;  2FNP A;  3REO A;  1JGS A;  5JFR A;  2Y0M A;  1GXP A;  3TOA A;  4B09 A;  4A6D A;  4R79 A;  4R8H A;  3E6D A;  5E18 F;  1HKS A;  5IT3 A;  4YII A;  3QU6 A;  2LDU A;  1UST A;  2K02 A;  2XV4 S;  2KJB A;  1FYM A;  4H0E A;  4ON0 A;  1MJA A;  1G3W A;  3FXQ A;  3IWF A;  4P9U A;  1ZRC A;  2FA5 A;  5BPD A;  4HAM A;  3MCZ A;  3HYI A;  3CDH A;  1FP1 D;  2K86 A;  1BI0 A;  5DYM A;  4WXH A;  3ZPL A;  1EH8 A;  5LHH A;  1QZY A;  4GCV A;  3IL2 A;  4G6D A;  3R6S A;  1XGO A;  3V8L A;  2ELH A;  5AON A;  1B9M A;  2W84 A;  5FLX K;  3QP5 A;  2BGC A;  3WGG A;  2DLL A;  2OQG A;  2ZO4 A;  1G4D A;  2D45 A;  1OR7 A;  1J0R A;  2HYG D;  2EA2 A;  4U88 A;  2HTS A;  3N97 A;  3L00 A;  2GXB A;  2A68 F;  2KIM A;  3TOB A;  3M7G A;  2X0L A;  5L3E A;  3HOS A;  2MLG A;  3ZMV A;  4MHG A;  2NAZ A;  4CXF A;  3DEU A;  2FQ3 A;  1FNN A;  2V1D A;  3HSE A;  3I71 A;  4CIC A;  4L5J A;  1P4X A;  5D4S A;  3TGN A;  1B1B A;  2M1B A;  2XRN A;  3F8M A;  2LF8 A;  3GUD A;  1S8N A;  2RNJ A;  3WTV C;  3GX4 X;  3F8F A;  4JK1 X;  1BIB A;  5ICF A;  1B6A A;  1MDM B;  1FP2 A;  4HV5 A;  4YG2 F;  3EET A;  3H92 A;  1C0W A;  1R58 A;  5CVJ A;  4L9V A;  5TJJ A;  4A5N A;  1OYY A;  1YFH A;  3FX3 A;  1ULY A;  2DQR A;  3IRR A;  1XCV A;  1UFM A;  4L9N A;  3SFZ A;  4GGG A;  3VEP A;  2XAF A;  4ESB A;  5BMZ A;  2HQN A;  2A61 A;  1XMK A;  4AIJ A;  1ZLJ A;  2CYY A;  4HBL A;  3WU1 B;  2TDX A;  4RB3 C;  1IXR C;  3WGH A;  4LG0 B;  3WTZ A;  1FZP B;  4QWQ A;  1XSV A;  2O3F A;  4HLX A;  1ZLK A;  2F5D A;  3GFM A;  2Q0O A;  1IW7 F;  1ZAR A;  2XAH A;  1IXC A;  3WOD F;  3C18 A;  1GHC A;  3K1M A;  1LJ9 A;  2DO7 A;  1KYZ A;  5CYV A;  3V7R A;  3E3V A;  2BBY A;  1FPQ A;  3GFI A;  2H09 A;  4DQ2 A;  3T8R A;  4KMF A;  4M9S A;  2H94 A;  1O3Q A;  2IVM A;  2MC3 A;  3Q5F A;  1IAW A;  5HOO A;  1XN7 A;  4BHC A;  3J7A O;  4ZH4 F;  4RGU A;  2KJC A;  2LKP A;  2CQK A;  2QVO A;  2RN7 A;  3U9G A;  2DAO A;  4LB6 B;  5D4R A;  4CGZ A;  1W4M A;  2C6Y A;  2VC1 A;  2RDP A;  4M74 A;  2K7L A;  2YX4 A;  1R1T A;  2MBF A;  4LJZ F;  2MA3 A;  1U5T C;  2RKH A;  2FOK A;  3HRM A;  2ISY A;  3L09 A;  5D6E A;  2ZBK A;  2DPU A;  5F6F A;  1XGS A;  2GZW A;  2V9V A;  5H20 A;  2VC0 A;  3U1D A;  3FMQ A;  1YS7 A;  5CVR A;  3ZQ7 A;  2QUF A;  3TKY A;  2KRF A;  5LEJ A;  3KP7 A;  1HSJ A;  2R3S A;  4LMY A;  4QLC U;  3DPL C;  1YIO A;  1GVJ A;  4RGS A;  1H9T A;  2HZT A;  2EJR A;  1KQ0 A;  2MD5 A;  2EV0 A;  1SD7 A;  3BJ6 A;  4G6Q A;  2V1U A;  2F5E A;  3Q9V A;  4OIO F;  4N9I A;  2Z33 A;  5LLQ A;  4M6X A;  3HSR A;  1B4A A;  4HF2 A;  2VN2 A;  4ENN A;  3O2P E;  3DKW A;  3V7C A;  4HW0 A;  3HHG A;  1E2X A;  5E8G A;  3K2Z A;  4HYE A;  2L01 A;  3CUQ C;  1P92 A;  2A5Y B;  4ENK A;  2ACJ A;  2GA2 A;  1G3Y A;  3EYY A;  2O8X A;  2V6C A;  5CVU A;  4I0B A;  1IZ1 A;  1H9G A;  1BI3 A;  4P55 A;  3GW2 A;  4LLL A;  3M8E A;  4Q5S F;  1YYV A;  1NHA A;  2JPC A;  1D8J A;  2FE3 A;  2CG4 A;  3FXU A;  1LVA A;  1V4R A;  1S7A A;  2L4A A;  3GYH X;  3GF2 A;  2D1H A;  1IN5 A;  5IT9 K;  1Z1D A;  1P4W A;  2QBY A;  3GFJ A;  3BJO A;  4HX4 A;  2GIV A;  5HDG A;  2VON A;  4L0Y B;  5LRR A;  3RYR A;  1HKQ A;  3ABT A;  1LQ1 A;  5AIP A;  4UV9 A;  2PJP A;  4LLG F;  5LEK A;  5IT9 Z;  3R60 A;  2L02 A;  2ISZ A;  3FMR A;  2HEO A;  4IPA A;  1QZZ A;  4PZJ A;  1U78 A;  4RGR A;  3RPQ A;  4L9J A;  2Z3Y A;  1HQC A;  5DDG A;  2A6E F;  3CUO A;  1TBX A;  2QEN A;  3KZY A;  5D8K B;  5ICC A;  3COA C;  5FD6 A;  3NQO A;  2FRH A;  3F8B A;  5D5U B;  2DBB A;  3QAH A;  3JAM Z;  1WI9 A;  1SFE A;  3R0J A;  3G73 A;  4HX7 A;  1REP C;  2K4J A;  2PQ8 A;  2P5V A;  4YFK F;  2J5P A;  3B73 A;  3WG9 A;  1DDN A;  1FLI A;  4MEY F;  3BP8 A;  4Z2Y A;  2WWY A;  3WE2 A;  2HWV A;  4EJU A;  1ZG5 A;  3MAJ A;  2Y75 A;  3FZV A;  2EV6 A;  1IUY A;  3KE2 A;  4G7Z F;  4AD9 A;  1R5H A;  3J81 Z;  2O03 A;  1ZGJ A;  1HBX G;  5JR3 A;  3ML6 A;  4A0Z A;  5KK1 A;  2R7D A;  3V8J A;  1FY7 A;  2W25 A;  2Q8K A;  4B8X A;  2FU4 A;  1FBS A;  3I5U A;  5LRS A;  4JBA A;  5FO5 A;  1IRG A;  3LA3 A;  3HOT A;  1O57 A;  3SZT A;  3EUH A;  4OMZ A;  1G3S A;  3E5X A;  3BWG A;  4GYG A;  1LDD A;  3BPX A;  4UVA A;  4ENJ A;  3KET A;  3MFK A;  2ZNY A;  3KP5 A;  2QQB A;  4A6E A;  3ZMT A;  3GXO A;  1B59 A;  1OKR A;  3B02 A;  5CLS A;  3P9I A;  1T2K A;  5ICE A;  3E97 A;  4MQ9 F;  2LNB A;  5LHI A;  4PCQ A;  5KVR A;  1ONV A;  1MJ9 A;  2OA4 A;  1Z6T A;  4P9F A;  4HDV A;  1IN6 A;  1J2X A;  1K7A A;  1MZB A;  1D3Y A;  3L9F A;  1W5S A;  4EMS A;  4E70 A;  5HDN A;  3D0S A;  2PMH A;  3CLO A;  3HIF A;  2CW0 F;  1WSU A;  1LEA A;  5ERI A;  5HS9 A;  2PN6 A;  3RJP A;  1R23 A;  3LFK A;  1WWX A;  2PG4 A;  2PFB A;  3J80 K;  1FT9 A;  2EFW A;  3BRO A;  3ZN0 A;  3L7W A;  3ROU A;  4KUM A;  1R5G A;  1MDM A;  1XSD A;  2FBH A;  3FMS A;  4CO8 A;  3IC7 A;  1CF7 B;  2G9W A;  1LDK B;  3F8C A;  4A0X A;  3SZP A;  5HLI A;  1BC8 C;  2BV6 A;  3BZ6 A;  2JZY A;  1EH6 A;  3E5Q A;  3QPT A;  2A07 F;  3K1P A;  1PP8 F;  1USS A;  1TNS A;  3ZMZ A;  3F8N A;  5DCF A;  2F5C A;  4ZZL A;  3KZZ A;  3LAJ A;  3VOD A;  2VT2 A;  1XB4 A;  2IPQ X;  2IRF G;  3WGI A;  3LQR A;  2G7H A;  2Z5U A;  4UV8 A;  1EV7 A;  4UXN A;  1BI1 A;  1ZG1 A;  3WU0 A;  4AIH A;  4IRH A;  4BQA A;  2GQQ A;  3HRU A;  2P5K A;  2DW4 A;  1D8K A;  5FLX Z;  4LG0 A;  5HLH A;  1ZN2 A;  5JHU A;  3TO7 A;  4L0Z B;  3ERE D;  3RYP A;  3IHU A;  1AOY A;  3R61 A;  2CGP A;  2STT A;  4UNO A;  1MGT A;  2WTE A;  1TNT A;  2P6T A;  3GZ5 A;  1YQA A;  2HKX A;  3BDD A;  5ED4 A;  1J7K A;  1JE8 A;  1EH7 A;  2E1C A;  2ZJ2 A;  3V7S A;  2W85 A;  2ZCW A;  4HDU A;  1O7F A;  4XSZ F;  4RAZ A;  1YO5 C;  3SHF A;  5A2Q K;  3I53 A;  4L9T A;  1BI2 A;  2DU9 A;  1F5T A;  3MQ0 A;  1Z05 A;  3C3W A;  1RZ4 A;  3WTU C;  5AIQ A;  2GWR A;  5E1W A;  3KP6 A;  1PP7 U;  3TQN A;  1TTY A;  3JTH A;  2XAJ A;  1U5T B;  5J8F A;  1TLH B;  3K9T A;  4KT5 C;  3IKV A;  3KP3 A;  2JTV A;  4LFU A;  1SD5 A;  2DT5 A;  4Y15 A;  4IJA A;  4EV0 A;  5K5O A;  2HOE A;  5FGM A;  3MWM A;  1B9N A;  1SFU A;  1SAX A;  5FD5 A;  1HST A;  1Z6R A;  4HV6 A;  5CJ9 A;  5BOX A;  1DP7 P;  5LBQ A;  2MH2 A;  4CDG A;  1W7P A;  1UHM A;  1XDS A;  5HVQ C;  3E6M A;  1BC7 C;  1U3E M;  3TDU C;  2XGX A;  4G7O F;  3RPU A;  5ICG A;  5D6F A;  5D5W B;  2O61 A;  3M9A A;  5E1X A;  3K0L A;  1YLF A;  3KCC A;  4EJW A;  4I09 A;  2VBY A;  3DXJ F;  4L5I A;  1OYI A;  1P6R A;  2JRT A;  4O5V A;  3FF5 A;  1A04 A;  1R1U A;  3ISP A;  5F64 A;  2O6G E;  5DD4 A;  2ESN A;  2ZKZ A;  5CVI A;  1KGS A;  4I2O A;  4IRI A;  3F72 A;  2LSO A;  3I4P A;  1T39 A;  3L2C A;  4I02 A;  1I27 A;  5DV5 A;  2EB7 A;  4S04 A;  2FBI A;  3CO6 C;  3CUQ B;  5BS6 A;  6PAX A;  3F21 A;  3WTY C;  3T8T A;  4UUV A;  1U2W A;  5DCM A;  1R7J A;  1W5T A;  4HZF A;  4BAY A;  3I58 A;  1XMA A;  1TW2 A;  3S2W A;  3ABU A;  2VBZ A;  4M71 A;  4A2U A;  1LDJ A;  1UHW A;  1G3T A;  5J8C A;  2PI0 A;  1S6L A;  4G9Y A;  4Q47 A;  3F22 A;  3RTR A;  2OZ6 A;  1QGP A;  1JHF A;  2Z99 A;  4RB2 C;  4KNY A;  4EJV A;  5CVV A;  1FYL A;  2ETH A;  3IKT A;  3PQJ A;  1ON1 A;  3MEX A;  2KKO A;  1IN4 A;  5JI6 A;  3H3Z A;  3ZN1 A;  3I54 A;  4EVI A;  1E17 A;  4XRF A;  2VE9 A;  5HLG A;  4EM1 A;  2ESH A;  3HSF A;  2JPB A;  4OIQ F;  4EGY A;  4BYY A;  5BQT A;  3DFG A;  2JSC A;  4GYI A;  2QQA A;  4A5M A;  3E6C C;  2P7C B;  1Z91 A;  4EM0 B;  2PMU A;  3IWZ A;  1CGP A;  4IHT A;  3RKY A;  2ZXJ A;  1FBQ A;  1H0M A;  4KFC A;  2XAQ A;  2BEO A;  4YFN F;  4WK8 F;  4OOI A;  1RI7 A;  3LST A;  4RB0 A;  5TRD A;  1BIA A;  2ADU A;  2WV0 A;  5FFZ A;  2VT3 A;  1SD4 A;  1R00 A;  1FC3 A;  4XLP F;  5FB2 A;  2Q2E A;  1O3S A;  2VXZ A;  2NS0 A;  2XAS A;  2BE5 F;  2KIF A;  1ZGA A;  2COM A;  1KU2 A;  4LD5 A;  2HS5 A;  2CFX A;  4KDP A;  1KU7 A;  3K1N A;  4OIR F;  2GAU A;  1RUO A;  3P9K A;  3R4K A;  3K69 A;  2IA2 A;  3H3U A;  2IJL A;  2MH9 A;  4L18 B;  4NB5 A;  1T0F A;  3U2R A;  2WC2 A;  2ZME B;  2H6C A;  2HR3 A;  2EV5 A;  4PDK A;  3GFL A;  3SXY A;  4M72 A;  2FMY A;  1PDN C;  2PEX A;  3LAP A;  3FM3 A;  4GXO A;  3RKX A;  2E7X A;  3BY6 A;  1HW1 A;  4NHJ A;  4BXU A;  4A12 A;  1F1Z A;  3G3Z A;  1XD7 A;  5EEG A;  2EFP A;  2QYO A;  1L0O C;  3I59 B;  4I98 B;  4FHT A;  1HW2 A;  3HRT A;  3F6V A;  4LK1 F;  5DD8 A;  1QO0 D;  5L3D A;  1SMY F;  1LNW A;  3LQQ A;  4EQQ A;  1FBU A;  4LLN A;  1DPR A;  2L3D A;  4HQM A;  4OIP F;  3VB2 A;  1BM9 A;  2CO5 A;  5LGU A;  3T5X A;  1D5V A;  1Z7U A;  4EJO A;  4I7H A;  2YX7 A;  2QLZ A;  3DV8 A;  1UB9 A;  2E1N A;  2ZFW A;  4Q4Z F;  4G8X A;  2O0Y A;  3KLN A;  2RV8 A;  5LGN A;  3F6O A;  4MNU A;  3R0A A;  2BYV E;  1BBY A;  3ZMU A;  1FSH A;  2DQL A;  1I6X A;  4NQW A;  4EM2 A;  4KA4 A;  1J5Y A;  2M8E A;  1QBJ A;  3CTA A;  2OU2 A;  3CO7 C;  1U8R A;  4DNC A;  2RGV A;  2JT1 A;  2W57 A;  4FT8 A;  5LGT A;  1CF7 A;  4KIC A;  3KEQ A;  3ZMD A;  3WTX C;  1LB2 A;  3TO6 A;  2LF7 A;  2RVC A;  1ZRF A;  2PLY A;  1FWZ A;  3E5U A;  4CYD A;  3WTW C; 
#chains in the Genus database with same CATH topology
 3F3X A;  4BH9 A;  2E1M C;  2HQR A;  2QQ9 A;  4JQF A;  4MQV A;  1GUU A;  5B3S H;  2ECB A;  5ILV A;  2YUS A;  4DJA A;  3I4M J;  1L3L A;  4F93 B;  5LHG A;  1JKO C;  4EEF G;  4XBF A;  3LA7 A;  2CS3 A;  1MKM A;  2G7U A;  1MSF C;  1GXQ A;  2YR2 A;  1F36 A;  2GXG A;  3GO5 A;  1XX5 A;  2LOO A;  3S1Q J;  1OMI A;  4XL9 A;  3KEO A;  5CPR B;  1WJA A;  2E60 A;  1YW8 A;  1YX3 A;  4I01 A;  4LB5 A;  1X3U A;  3HTU A;  1I3A A;  1RKW A;  3K4K A;  4XR6 A;  4N0B A;  3F23 A;  4AC0 A;  1AKH A;  5ILU A;  1KYW A;  1F9N A;  1KZH A;  1D1C A;  1KU3 A;  2M5W A;  3AG4 H;  3OY9 A;  1YRN B;  1B72 A;  1ODD A;  4LK0 F;  2NRA C;  1UAA A;  1JHH A;  1R22 A;  2X6Y A;  1ZH5 A;  1T0F C;  5LFA A;  3ZP5 A;  5FKL A;  3WE3 A;  2E7W A;  4E7I A;  2RQQ A;  2D2W A;  3CLQ A;  3V4G A;  5K7Z A;  3LSR A;  1IN7 A;  5M5W J;  1DU6 A;  3ECH A;  2K27 A;  4HF0 A;  4IL6 C;  2EQR A;  1R9T J;  2ZJP F;  1ZRE A;  2V1X A;  2XRO A;  2RAE A;  4IHW A;  3G71 I;  4ZJZ A;  3EDP A;  5EZG A;  1NG7 A;  4HLY A;  3TO9 A;  3PO3 J;  2GXA A;  4NC6 A;  4I0A A;  1I1S A;  2EWN A;  2K5C A;  4PFO A;  3MZ8 A;  1HXD A;  1TZL A;  3O3K A;  5D5V B;  3BQZ A;  3DP7 A;  1MH3 A;  1XMX A;  3I56 I;  4LGW A;  5DUK A;  4UVB A;  4XID A;  3E7L A;  3EYI A;  2OCE A;  2VKH A;  3ERM A;  2IBD A;  1YIJ I;  4K2E A;  3RIR A;  3J80 Z;  4OWR B;  3I64 A;  2JMW A;  1TW3 A;  1FOK A;  4JP0 A;  3O6B B;  4IEJ A;  3D5R C;  1P2F A;  5H6Q A;  3S8P A;  2RC4 A;  3CMY A;  3EQL F;  4AU7 A;  5DEQ A;  1U5T A;  5J6X A;  1R49 A;  3HBL A;  4ZDP A;  3C1D A;  4HX8 A;  2R7S A;  3CDL A;  4KIB A;  1YW7 A;  2JA2 A;  3DF8 A;  1K78 B;  4G7H F;  1XCB A;  1XSX A;  3KP2 A;  4XSX F;  2KMU A;  3ZRG A;  2O9L A;  5F0F A;  4C2U A;  4BXX J;  4E7H A;  4N9H A;  4BXF A;  2FX0 A;  3FKI J;  1OYW A;  3CJN A;  3AFH A;  1P4A A;  1TQM A;  4AYB N;  3IH4 A;  2DN0 A;  3JRD A;  2P5L C;  4GDF A;  5IOY A;  4FX0 A;  2VOP A;  3O8G A;  1IO2 A;  2DFI A;  3SEQ A;  3DTE A;  4C2T A;  1ETV A;  2JK3 A;  2EIL H;  2DI3 A;  1LFP A;  2M30 A;  2XGD A;  1QQI A;  3VWB A;  3V8K A;  4XIC A;  1W36 C;  5TGT A;  4XKW A;  4D0P A;  3J7Y J;  3OYI A;  2DOD A;  1O3R A;  2BY0 A;  4CCL A;  4XKV A;  4J19 A;  2UWM A;  3KYL A;  4AWX B;  4F7Z A;  1VQN I;  4U87 A;  2JSP A;  3HJE A;  3H9J A;  2E71 A;  1X2N A;  2FOW A;  1DP3 A;  2KHM A;  4YEJ A;  4XMY A;  4AVP A;  5JVT A;  2MAB A;  1NK2 P;  1WH5 A;  1S3J A;  1IUF A;  3GTO J;  1I5Z A;  4YIF A;  1WRJ A;  4F55 A;  1VQM I;  3FXR A;  1KA8 A;  1B8I B;  1VTN C;  2MW8 A;  1O7L A;  3GTG J;  1PVE A;  2F4O B;  3QRF F;  4BDY A;  2YPR A;  2M87 A;  5EG0 B;  4BJT A;  2CFO A;  1KQ8 A;  1QVU A;  2UXX A;  3BR1 A;  3CUQ A;  2UUZ A;  4CCO A;  1ZGW A;  1MBG A;  1LE8 A;  5A2Q Z;  4M73 A;  3JSP A;  5KNL A;  2X4H A;  4ZYE A;  4PGH A;  4BS9 A;  2K9Q A;  3LSM A;  1MMN A;  3UKG A;  2XKO A;  3F0C A;  2HVQ A;  5JLX A;  3EUH C;  3VFZ A;  3PIO F;  1K4T A;  3AL0 C;  3AAF A;  3TP0 A;  3ZXS A;  4TV7 A;  4CSW A;  3LFU A;  3LSK A;  1K4S A;  4XLN F;  1RPW A;  4IXA A;  4P96 A;  1BN5 A;  1Q1H A;  1UG2 A;  2XKP A;  3ZMS A;  4ENM A;  2K40 A;  3GME A;  3MZY A;  4ZZD A;  1RKT A;  3HHH A;  2NVQ J;  4C3I J;  4S0H B;  2GA1 A;  3VYU B;  3OYL A;  2X1D A;  4O6J A;  2KPM A;  4O3M A;  2FF4 A;  2H27 A;  1YS6 A;  4OIN F;  3M8F A;  3S3N A;  1OIS A;  4G94 A;  5HDK A;  2FSW A;  2LTP A;  1HOM A;  5CKT A;  4M9Z A;  4P5O A;  4Y4R A;  4ZYH A;  3DEE A;  1KQ9 A;  5L3B A;  3ELK A;  3HG9 A;  2IA0 A;  3ZQC A;  1QNT A;  5CQG A;  1XGN A;  4RMN A;  1YG2 A;  3RDI A;  5ILS A;  2M45 A;  1SC7 A;  1XDU A;  2TRT A;  1WJB A;  4WCG A;  3AG3 H;  2L9S A;  1HDD C;  2M4K A;  3T1B A;  4WXC A;  1V54 H;  2NOG A;  4RGX A;  3LWF A;  4RA2 A;  3FXM A;  3OV8 A;  3E1S A;  3GWZ A;  1Y0U A;  4W1U A;  4OAY A;  5F0C A;  1O3T A;  1UEL B;  2FEZ A;  4A3B J;  2JN6 A;  1POG A;  4BE0 A;  2E35 A;  4ESF A;  3KFW X;  3CJQ B;  1YW9 A;  4EGZ A;  2DXI A;  4ZYG A;  1DPU A;  4C3H J;  2M7A A;  3JRI A;  2EZL A;  1VQ6 I;  4WF2 A;  3T0Y A;  1JT0 A;  1Z3Y A;  3IRQ A;  4UUS A;  3BG7 A;  4BBS J;  2JVG A;  5E8I A;  2E2H J;  3K4C A;  2M9H A;  1RRJ A;  4FX4 A;  4DBR A;  4A3I J;  4II3 A;  2R5Y B;  4ASN A;  4D1Q A;  1TWG J;  3OYJ A;  2CUE A;  1SD6 A;  3OR1 C;  1QPI A;  2KIU A;  3PSF A;  3LA2 A;  3WTS C;  1F43 A;  2UZK A;  4BHP A;  2EIN H;  2OAZ A;  1U6G A;  4HF1 A;  1MND A;  2DK5 A;  3OS1 A;  2L7F P;  3JTG A;  1Z9C A;  1TC3 C;  4UHT A;  3WTT C;  5CQE A;  4RAY A;  1QU3 A;  5BPI A;  1OPC A;  2ECC A;  5J1R A;  3CCE I;  4X6A J;  3JSO A;  1M1E B;  4XKC A;  1JXS A;  2A05 A;  3BCB A;  3CCR I;  1ZHF A;  3KPH A;  2LRD A;  1BJA A;  4R1H A;  1TQP A;  2EZK A;  4KN4 X;  2MSY A;  2CUZ A;  5IYD J;  2WB1 A;  3Q0V A;  2L54 A;  3HGY A;  3G1L A;  4CZZ A;  3PFI A;  3JCU C;  4A0Y A;  1WJD A;  3DQV C;  5H6R A;  3HUG A;  3PNT A;  5KAI C;  3JW4 A;  1SVL A;  1PUE E;  1ZAO A;  3W2W A;  3QPH A;  2VPL A;  1G6N A;  5F1R A;  1P7J A;  4Z6Y A;  1UJ8 A;  5FFX A;  5D5X B;  2H8R A;  2F2E A;  3RSN A;  2L2O A;  2DA2 A;  2VKE A;  1ZRD A;  4XLH A;  3GVA A;  2MLK A;  2VOO A;  3WHB A;  4Y17 A;  5F27 A;  1W0T A;  4IKF A;  1W7P B;  1ZYR F;  2E2I J;  2OF7 A;  2DTZ A;  2D1V A;  4E7S A;  1K79 A;  1TP4 A;  1MMG A;  3L2R A;  3CP8 A;  2W82 A;  2X85 A;  3G4S I;  2O8K A;  2H6B A;  4HNT A;  1VQ7 I;  4BHB A;  2F48 A;  2PMZ A;  2A3S A;  3ECO A;  2ZME A;  1MJB A;  2QWW A;  2CQN A;  3FBI B;  3DCF A;  4ZDO A;  3BT9 A;  2WAE A;  4BQQ A;  1OCP A;  4X0G A;  3K10 A;  3H35 A;  4IRG A;  4KMU X;  2NOJ B;  2P7V B;  4KYW A;  5E20 A;  3RKW A;  2L4M A;  2CJJ A;  1S7O A;  2FML A;  2XIG A;  4M6V A;  4PJL A;  5L3C A;  4ETS A;  2COB A;  1J59 A;  1HW5 A;  2W7N A;  2FNA A;  2W48 A;  3A1Y A;  1SFK A;  3P7N A;  3ZR8 X;  2YU3 A;  3BJA A;  3M4O J;  2M4G A;  1WJF A;  4HSR A;  1RET A;  5FRO A;  1KU9 A;  4GO1 A;  1ZEL A;  3BOQ A;  3D5S C;  2A6H F;  4YFX F;  4MEX F;  2LVS A;  4Q48 A;  3CCL I;  2EBI A;  2IGM A;  3QP6 A;  3HKZ N;  4ABZ A;  2B0L A;  2R0Q C;  1QHG A;  1OCT C;  4II2 A;  1X1C A;  2DDB A;  2DFH A;  3GLX A;  3I59 A;  4IF4 A;  3S3M A;  2VOD A;  4NC8 A;  2CRG A;  2EFN A;  3M1E A;  1VQO I;  1A5J A;  2IT0 A;  3K2A A;  3W6K B;  2A69 F;  3MKY B;  3N4M A;  2LC2 A;  3OL4 A;  5C3E J;  3MZH A;  2QA4 I;  3SQN A;  5DCM B;  5D8L B;  4IHS A;  1UCR A;  4DYQ A;  1TT5 B;  1FYK A;  2AS5 F;  2P4W A;  2E1O A;  5K5R A;  1MMS A;  1WHU A;  4U7D A;  1J75 A;  2WAQ N;  1IN8 A;  2KL4 A;  1FSE A;  2HFH A;  2GBY A;  2DK8 A;  2R7V A;  2VKV A;  4HOB A;  3ULQ B;  2K9S A;  2XVC A;  2XSD C;  2HKO A;  2XAU A;  5J3L A;  1SAN A;  2EH3 A;  3FHZ A;  3CCS I;  1RUN A;  2F4I A;  2IW5 A;  3NRV A;  2CV0 A;  2STW A;  4MGR A;  4KT6 A;  2HVR A;  3L2W A;  4E7J A;  3M8J A;  2F5F A;  3DBL B;  2KP6 A;  1HKT A;  2VPR A;  3S32 A;  4OMY A;  5E1Z B;  3K7A J;  1EKE A;  1ZG3 A;  3MD2 A;  3VSL A;  1HLV A;  4RS8 A;  1TQI A;  1W7P D;  2XGE A;  4YRV A;  1F4K A;  2VQL A;  5IP6 A;  3TW7 A;  2R7W A;  2LRE A;  3GZ6 A;  2LH9 A;  2V9P A;  4UY8 I;  4MTD A;  2EIK H;  4U0Y A;  1FOW A;  2FXA A;  3KP4 A;  2OD5 A;  4KJZ A;  3J7A Y;  1IF1 A;  2MC4 A;  2FBK A;  3PJR A;  4E7Z A;  4WWC A;  1HDP A;  1D1B A;  2QM3 A;  2EK5 A;  4UVC A;  1RIO H;  1OFC X;  3LNQ A;  1V5E A;  3D1N I;  1X1B A;  3DU6 A;  2W24 A;  2BW3 A;  3OIQ A;  4RAF A;  2AXT C;  2ZNZ A;  3ONQ A;  2CH0 A;  2RQP A;  2HPI A;  5K1Y A;  1MD0 A;  3KEY A;  1FX7 A;  4V19 K;  1T98 A;  3LSP A;  1T38 A;  2IA1 A;  3RCO A;  3AKZ A;  1RR8 C;  5L3G A;  1SFX A;  4RLF A;  5C4J J;  3PNV A;  1ERD A;  5HS7 A;  3A0B C;  2NNY A;  1G2H A;  2OBP A;  2DPD A;  3JRE A;  2H1K A;  3BPV A;  3FDY A;  4M9X A;  2HDC A;  3C7J A;  2ZB9 A;  2CSO A;  3E6B A;  5LD2 C;  4RBO A;  5L3F A;  3FIW A;  2OQR A;  4HNV A;  1OQY A;  3HB9 A;  1S72 I;  2E1M B;  3A4C A;  3FXJ A;  1RNL A;  4M3E A;  3JAM K;  3M3Y J;  3S17 J;  2P6S A;  2R7Q A;  1S29 A;  3ZQG A;  3JRH A;  2IP2 A;  4FIS A;  2K9M A;  1AWC A;  1U8B A;  1RES A;  2IGN A;  5E17 F;  2VQH A;  1Y8Q B;  3OOP A;  4DIQ A;  4BE2 A;  1XGM A;  3QOP A;  2Y48 A;  3VOE A;  4HRI A;  1LEB A;  1IRF A;  3Q9S A;  3FWE A;  5IOZ A;  3SEZ A;  2YSR A;  1J09 A;  1A31 A;  1X3Z B;  1YTY A;  2PBI A;  2VKD A;  1STZ A;  4A3D J;  4PGG A;  4KN7 X;  2AO9 A;  4BNC A;  1IG7 A;  4HQE A;  1ZTR A;  3RI4 A;  1K6O A;  1W0U A;  4B3X A;  1WQ2 A;  1EA3 A;  1UHS A;  2EFO A;  2VBX A;  4KIF A;  4KIG A;  2HGC A;  1V3F A;  3GEZ A;  3SJM A;  1ON2 A;  4RB1 A;  5GPA A;  1BOA A;  4JX4 A;  2JA8 J;  4F92 B;  2M8G X;  4AIK A;  2QBY B;  3A2K A;  4BY7 J;  1SMT A;  2DTR A;  3FK6 A;  2OCC H;  1GV2 A;  4AVZ A;  3GTQ J;  4A3L J;  3HRS A;  2K4B A;  4EJT A;  2P0W A;  3J81 K;  1ZR2 A;  3VYS B;  2XAG A;  2B63 J;  4M6Y A;  2NYX A;  1BR2 A;  2UXN A;  2LBF B;  3TDZ C;  5K5Q A;  2J5O A;  1G59 A;  3CMM A;  1MH4 A;  3GZN B;  2XHK A;  1QPM A;  4MTE A;  2VE8 A;  2XRL A;  3D5L A;  4Y33 A;  2VBW A;  4XOP A;  3BTL A;  4WX9 A;  1T6S A;  1MSE C;  3S1R J;  3OYD A;  1IC8 A;  5FKN A;  2HTJ A;  1YJN I;  2I8D A;  3A01 B;  2HXI A;  2OZU A;  1N75 A;  2DYS H;  4U0V A;  3CF5 F;  4HEA 2;  4ZTJ A;  2XUB A;  4Y7N J;  3TMO A;  4S05 A;  3DPT A;  4OU0 A;  1VI0 A;  4HA8 A;  4BKX A;  3FM5 A;  4JX5 A;  2EFQ A;  5J47 A;  1WKM A;  3IAM 2;  3W6J B;  2P8T A;  1DUX C;  2AXL A;  2EA4 A;  2Y31 A;  4CCN A;  3BR0 A;  3OYE A;  5EEH A;  2NNN A;  2QKM B;  4CHU A;  2K9L A;  1EJ9 A;  4WXD A;  3HTS B;  1BJZ A;  2X1C A;  3PQK A;  4DYC A;  4JOM A;  1R36 A;  3HGG A;  5B1B H;  1MMA A;  1IV6 A;  2QZ8 A;  4BL0 B;  3NWT A;  4XNF A;  1K78 A;  1DQU A;  2HYF A;  4Y13 A;  3TED A;  5HS8 A;  2IGK A;  4ZYD A;  5DUI A;  2V79 A;  2CWE A;  2GLO A;  3G1M A;  1BOB A;  3NEU A;  4IOA F;  2QSH X;  3I0T A;  5GAE J;  3CD6 I;  1X1A A;  2Z9O A;  2DMN A;  1R1V A;  3QU3 A;  4N4N B;  4U0W A;  4ESJ A;  3BG3 A;  4U7B A;  3KLO A;  1J9I A;  1JUS A;  1IXS B;  2HOA A;  3L2U A;  3HC7 A;  1I1G A;  2R7F A;  2V7F A;  3P9C A;  2FNP A;  4IVN A;  3REO A;  1JGS A;  1LKX A;  2HDW A;  3ZQH A;  5FRN A;  3GTK J;  5JFR A;  2Y0M A;  1GXP A;  3TOA A;  4B09 A;  4A6D A;  1ACI A;  4R79 A;  4R8H A;  3E6D A;  1JJ8 C;  5E18 F;  1HKS A;  5IT3 A;  4YII A;  3QU6 A;  3GTJ J;  3Q0W A;  5F0H A;  3BG5 A;  2HXO A;  2LDU A;  1UST A;  2K02 A;  2XV4 S;  3C2H A;  2KJB A;  1FYM A;  1B8I A;  3C2B A;  1WGX A;  4ON0 A;  4H0E A;  2Q1Z B;  3HOU J;  2JA5 J;  1HC8 A;  1MJA A;  1G3W A;  1FTZ A;  3FXQ A;  3IWF A;  5B5E C;  4P9U A;  1ZRC A;  4M3F A;  1VF9 A;  5EGO A;  2FA5 A;  2K9N A;  5BPD A;  4HAM A;  3MCZ A;  2L5Q A;  3HYI A;  1PUF B;  3VYR B;  3CDH A;  1FP1 D;  2K86 A;  1BI0 A;  5DYM A;  1X4P A;  3AL0 B;  4WXH A;  3ZPL A;  1EH8 A;  4CH7 A;  3W3C A;  5LHH A;  1QZY A;  4GCV A;  1VQP I;  3IL2 A;  3OYF A;  4G6D A;  3R6S A;  1ENH A;  1G8X A;  3S1N J;  1XGO A;  3V8L A;  2ELH A;  3OR2 C;  5AON A;  4CCJ A;  1B9M A;  4XLF A;  2W84 A;  3NWS A;  5FLX K;  3QP5 A;  3K4N A;  4UB6 C;  1JJ6 C;  2Y9Y A;  2ICW G;  1MNM C;  2B9S A;  2BGC A;  3WGG A;  2DLL A;  4UB8 C;  2OQG A;  3KIO A;  5F08 A;  2ZO4 A;  4HG2 A;  5EF6 A;  1G4D A;  2D45 A;  1OR7 A;  1J0R A;  2HYG D;  2RRE A;  2IS6 A;  2EA2 A;  4RM2 A;  2CW7 A;  4CCM A;  4U88 A;  2HTS A;  3CQZ J;  1TWC J;  2GIZ A;  2HYJ A;  4KIS A;  3N97 A;  2VJJ A;  3L00 A;  1W5C C;  2GXB A;  2R7R A;  3PNY A;  2A68 F;  2KIM A;  3HM5 A;  3TOB A;  3H3V K;  3M7G A;  2X0L A;  5L3E A;  2HDD A;  2DA4 A;  5EZH A;  2AHQ A;  2MLG A;  3HOS A;  2GM4 A;  3ZMV A;  4MHG A;  2NAZ A;  4CXF A;  3DEU A;  1JKQ C;  3OYG A;  3I4N J;  2FQ3 A;  2Z16 A;  4CA0 A;  1FNN A;  2V1D A;  3HSE A;  5J1Y A;  4RDU A;  2VQC A;  4YEL A;  3G6E I;  3PM1 A;  4F91 B;  1U0J A;  3I71 A;  4CIC A;  4L5J A;  4XM3 A;  1W36 D;  1P4X A;  5D4S A;  3S15 J;  2NS7 A;  1OCC H;  1B1B A;  2M1B A;  3TGN A;  2XRN A;  3F8M A;  3W2A A;  2LF8 A;  4IOC F;  3CF2 A;  3GUD A;  1XG1 A;  1S8N A;  2RNJ A;  3WTV C;  3GX4 X;  3F8F A;  4JK1 X;  1BIB A;  5ICF A;  4HST A;  4QPO A;  1QHH D;  1B6A A;  1MDM B;  1FP2 A;  4HV5 A;  1S5L C;  4YG2 F;  2M0C A;  3EET A;  3H92 A;  3BQY A;  1C0W A;  1R58 A;  2ZJR F;  2W4S A;  3GTP J;  3RKQ A;  4F3Q A;  3A03 A;  5CVJ A;  4L9V A;  5TJJ A;  1JKR C;  4A5N A;  1X19 A;  2BVL A;  1JUP A;  2DT6 A;  1OYY A;  2IXS A;  2VI6 A;  1YFH A;  3FX3 A;  1D5Y A;  1ULY A;  2DQR A;  3IRR A;  1V5G A;  1XCV A;  2JVH A;  1VZ0 A;  1UFM A;  4L9N A;  3SFZ A;  2LK2 A;  4GGG A;  2FJ1 A;  2XAF A;  3VEP A;  1ORK A;  1A35 A;  3QYE A;  4ESB A;  5BMZ A;  1IDZ A;  3K70 C;  2HQN A;  1I39 A;  2A61 A;  3HDD A;  1XMK A;  2DA1 A;  3DKX A;  2V1N A;  2XB0 X;  3CDI A;  1T56 A;  4AIJ A;  4FE7 A;  1ZLJ A;  5F1J A;  1D0X A;  2NVY J;  2JRM A;  2CYY A;  4HBL A;  3WU1 B;  2TDX A;  2RNG A;  1OLT A;  1NK3 P;  2OTJ I;  4RB3 C;  1IXR C;  2VJ5 A;  3WGH A;  4LG0 B;  4HPQ A;  4IQJ A;  3TW6 A;  3WTZ A;  1X58 A;  5IPA A;  1VQL I;  3BLY A;  4BE1 A;  1SEU A;  1FZP B;  5C44 J;  4QWQ A;  1XSV A;  2O3F A;  4HLX A;  1ZLK A;  1BW6 A;  2F5D A;  2Z1D A;  4M3D A;  2JJ7 A;  2CMP A;  1IW7 F;  1ZAR A;  2Q0O A;  3GFM A;  3Q3S A;  1FEX A;  1IJW C;  2XAH A;  1R5I D;  3SDG A;  4AYB A;  4L5E A;  1IXC A;  2MFZ A;  3C18 A;  3WOD F;  2R92 J;  1GHC A;  3K1M A;  1LJ9 A;  2DO7 A;  5DM7 F;  1KYZ A;  5CYV A;  3V7R A;  3E3V A;  1E0E A;  2BBY A;  1FPQ A;  3GFI A;  2H09 A;  2CQX A;  3AG2 H;  4LIV A;  4DQ2 A;  3WU2 C;  3T8R A;  4KMF A;  4M9S A;  2H94 A;  4RM3 A;  1O3Q A;  2IVM A;  2HU9 A;  2MC3 A;  3Q5F A;  1IAW A;  5HOO A;  1XN7 A;  4BHC A;  3J7A O;  4ZH4 F;  2KT0 A;  4RGU A;  2KJC A;  2LKP A;  2CQK A;  2Z2S B;  2QVO A;  3B6C A;  1N77 A;  4MIM A;  2HZD A;  2LP0 A;  2P81 A;  1H8A C;  2RN7 A;  3I55 I;  1BW5 A;  3U9G A;  2DAO A;  4LB6 B;  5D4R A;  4CGZ A;  3H5A A;  1D1A A;  1GDT A;  5GTH C;  3OMY A;  1W4M A;  1V5F A;  2C6Y A;  2VC1 A;  2RDP A;  4DOZ A;  4M74 A;  1ZQ3 P;  5FLM J;  2K7L A;  2YX4 A;  3CCV I;  1YIT I;  3H0G J;  1R1T A;  1FMV A;  2MBF A;  4LJZ F;  3PUF A;  5KAF C;  2MA3 A;  1Z67 A;  1U5T C;  2DOE A;  2RKH A;  4A3K J;  2BHY A;  4MFE A;  2FOK A;  1ITY A;  3HRM A;  2ISY A;  3L09 A;  4XN3 A;  5D6E A;  2ZBK A;  4B47 A;  2DPU A;  3HEF A;  2ZXI A;  5F6F A;  1MBH A;  3JRG A;  1R4N B;  1XGS A;  2L7K A;  2GZW A;  2V9V A;  5H20 A;  2VC0 A;  3HOX J;  3DTI A;  3U1D A;  5M5Y J;  3FMQ A;  2OJE D;  1YS7 A;  5CVR A;  3ZQ7 A;  2V9K A;  2QUF A;  3DEW A;  3TKY A;  2OTL I;  2KRF A;  5LEJ A;  3KP7 A;  1MBE A;  1FOY A;  3ABL H;  1MNE A;  2QSG X;  2WY8 Q;  1HSJ A;  2R3S A;  4LMY A;  4QLC U;  1IRX A;  3DPL C;  3H9G A;  1YIO A;  1GVJ A;  2PJR B;  3S16 J;  4RGS A;  3OYH A;  1H9T A;  3I3L A;  2HZT A;  2QF7 A;  3CCY A;  2EJR A;  1KQ0 A;  1Z77 A;  3OYA A;  2MD5 A;  4QPQ A;  1NTC A;  2EV0 A;  1S7E A;  1SD7 A;  4A3F J;  1Y39 A;  2R7O A;  3BJ6 A;  1KON A;  2HPM A;  4G6Q A;  2E2J J;  2V1U A;  1H89 C;  2F5E A;  4PUS A;  3Q9V A;  2M34 A;  2K85 A;  5E79 C;  4OIO F;  4DZJ A;  1Y6I A;  1QA6 A;  2YU9 J;  3BR2 A;  4N9I A;  3WHC A;  2L9R A;  3U1K A;  2ZSH B;  1QRY A;  2ZXH A;  4LIU A;  4V2G A;  2Z33 A;  3QOE A;  2DFF A;  2A5W A;  1IGN A;  2CQQ A;  5LLQ A;  4M6X A;  3HSR A;  1B4A A;  4HF2 A;  1GLN A;  2VN2 A;  4ENN A;  5HNH A;  1VQ4 I;  3O2P E;  3DKW A;  3V7C A;  2KLO A;  2A6T A;  2OPT A;  3PFY A;  4HW0 A;  3HHG A;  1E2X A;  5E8G A;  3K2Z A;  3FXL A;  3BC8 A;  2VIX A;  3FIS A;  4HYE A;  2L01 A;  2F4M B;  3CUQ C;  3CC4 I;  1P92 A;  4UUT A;  2A5Y B;  2JWT A;  1O4X A;  5KCM A;  3K4B A;  4ENK A;  2QCO A;  3BG9 A;  3RQI A;  2ACJ A;  3N05 A;  2GA2 A;  2R5Z B;  1G3Y A;  3EYY A;  3A0H C;  3BG6 A;  5E3N A;  2O8X A;  5M3F J;  1T8I A;  4ITV A;  1K83 J;  2V6C A;  3CCQ I;  5CVU A;  3SYT A;  4I0B A;  5IP7 J;  1IZ1 A;  1MBK A;  1H9G A;  3KYD B;  1BI3 A;  3G1O A;  3UNG C;  2KDZ A;  4P55 A;  5EYR A;  3GW2 A;  2QQ8 A;  3CJT B;  2E19 A;  4LLL A;  3M8E A;  5JHF A;  1Y0N A;  4Q5S F;  2G0E A;  2M2E A;  1YYV A;  1NHA A;  2N8G A;  2JPC A;  2QKL B;  1D8J A;  5GPC A;  2FE3 A;  2CG4 A;  1FOX A;  3FXU A;  2CUJ A;  1LVA A;  5TIS C;  1FIA A;  1S7A A;  1LVK A;  1V4R A;  2DT7 B;  2L4A A;  3GYH X;  3GF2 A;  2HOT A;  2D1H A;  1IN5 A;  5IT9 K;  1Z1D A;  1P4W A;  3RPU D;  2QBY A;  3BR3 A;  3GFJ A;  3BJO A;  4HX4 A;  3S14 J;  2GIV A;  3AG1 H;  1X4O A;  2HI3 A;  3ESW B;  5HDG A;  2YS9 A;  2W1O A;  2VON A;  4XLA A;  4L0Y B;  5LRR A;  3RYR A;  1T08 B;  1HKQ A;  3G2B A;  3GTL J;  4BQN A;  1Q1V A;  3ABT A;  3FXK A;  1LQ1 A;  1YJ9 I;  5AIP A;  4UV9 A;  2PJP A;  4NNJ A;  2DOF A;  4CZC A;  4LLG F;  5LEK A;  5IT9 Z;  3ASN H;  2BZT A;  3R60 A;  1GV5 A;  3A01 A;  2JQ7 A;  2L02 A;  2ISZ A;  1JKP C;  3OS2 A;  2QGU A;  2L7M P;  2Y0S N;  4IHY A;  3FMR A;  2KZG A;  2QEX I;  2HEO A;  4IPA A;  2AQE A;  1QZZ A;  4BEH B;  4PZJ A;  3QQA A;  4J00 A;  2Q2E B;  1U78 A;  4RGR A;  3RPQ A;  1WJC A;  4MO7 A;  3HKZ A;  4L9J A;  2Z3Y A;  5FKK A;  2LD5 A;  1HQC A;  5DDG A;  2A6E F;  2R4G A;  3C2G A;  3JRA A;  1AU7 A;  2MYS A;  2JUC A;  1Z0X A;  3CUO A;  1R6R A;  1TBX A;  2E34 A;  2QEN A;  1I6H J;  3FK7 A;  3H9Q A;  4LIT A;  3KZY A;  4A93 J;  1OCO H;  4KIT B;  1YHQ I;  5D8K B;  4W97 A;  3TBI A;  1I3Q J;  5ICC A;  4PFP A;  3COA C;  4I99 C;  5FD6 A;  3NQO A;  2FRH A;  1JGG A;  4GRI A;  3HOV J;  4IHV A;  1LPQ A;  2WAQ A;  3F8B A;  3HXL A;  4PSX A;  1YX5 A;  2CQ7 A;  5D5U B;  2DBB A;  3QAH A;  3JAM Z;  2VLA A;  4AID A;  1WI9 A;  1SFO J;  2V26 A;  1SFE A;  4BGD A;  3R0J A;  3ZQF A;  1YRN A;  3G73 A;  4OAZ A;  3BZK A;  2XGC A;  4HX7 A;  1REP C;  2K4J A;  2PQ8 A;  5FKM A;  2P5V A;  4YFK F;  3EPZ A;  1S9H A;  2J5P A;  3FKJ A;  3B73 A;  2IS4 A;  3WG9 A;  1DDN A;  1FLI A;  2ZME C;  4MEY F;  1D0Y A;  4NUB A;  3BP8 A;  1BA5 A;  4Z2Y A;  1SAU A;  2M0M A;  2WWY A;  3WE2 A;  2HWV A;  4EJU A;  1ZG5 A;  1AA7 A;  3MKW B;  3PO2 J;  3HZJ A;  3A02 A;  3M1C A;  1YI2 I;  4B4C A;  1T95 A;  3U21 A;  4D7N A;  1X3W B;  3MAJ A;  2Y75 A;  3FZV A;  2EV6 A;  1OJL A;  1E3H A;  3KE2 A;  1IUY A;  1HA8 A;  2HQ5 A;  3DPU A;  2KFD A;  4G7Z F;  4AD9 A;  1R5H A;  3J81 Z;  5GAG J;  2ID3 A;  2O03 A;  4C30 A;  3IH3 A;  1ZGJ A;  2K3P A;  3ABM H;  1HBX G;  5JR3 A;  3ML6 A;  4A0Z A;  5GTI C;  5KK1 A;  1X1P A;  2R7D A;  3ABK H;  3K4L A;  3V8J A;  1FY7 A;  4DZP A;  2W25 A;  2XC7 A;  2IGO A;  2Q8K A;  2F5V A;  4B8X A;  4CYC B;  1CQT A;  2FU4 A;  1QZE A;  2KIS A;  1FBS A;  2L9N A;  3I5U A;  2MGQ A;  5LRS A;  4JBA A;  5FO5 A;  1IRG A;  2XF6 A;  2CU7 A;  3LA3 A;  4BQO A;  1PUF A;  4ZDL A;  3HOT A;  4Y52 J;  1O57 A;  1P9Q C;  3SZT A;  3EUH A;  4OMZ A;  1G3S A;  3FBN B;  2LYC A;  2I10 A;  3E5X A;  4XLE A;  1DGR M;  3BWG A;  1VND A;  4GYG A;  4XON A;  3H0D A;  2ZJQ F;  1LDD A;  2MD0 A;  3CJR B;  4HNU A;  3BPX A;  4UVA A;  3L2Q A;  4ENJ A;  3KET A;  2R7X A;  1Z21 A;  2LLK A;  1JT6 A;  3CC7 I;  3MFK A;  3JRC A;  2ZNY A;  1U9O A;  3GBG A;  4P1W A;  4EAT A;  3KX2 A;  3KP5 A;  3OL3 A;  4LOC A;  2FD5 A;  2QQB A;  4J01 A;  4A6E A;  3ZMT A;  2FQ4 A;  3GXO A;  1OCR H;  1B59 A;  1OKR A;  2AQF A;  2DJN A;  1X1D A;  3B02 A;  5CLS A;  3P9I A;  4B44 A;  4A3J J;  2VUM J;  1T2K A;  4RAG A;  5ICE A;  3E97 A;  3P5J A;  4MQ9 F;  2DDA A;  2LNB A;  2R93 J;  4PCQ A;  5KVR A;  5LHI A;  1ONV A;  1K61 A;  1MJ9 A;  2OA4 A;  1Z6T A;  3NAU A;  4P9F A;  4HDV A;  2ELJ A;  3W2V A;  1IN6 A;  1J2X A;  1K7A A;  1MZB A;  4E7K A;  1D3Y A;  3L9F A;  1W5S A;  3MMY B;  2UV1 A;  4EMS A;  4NQW B;  5K7F A;  5M3M J;  3JR9 A;  1XS9 A;  4E70 A;  1TT0 A;  3TL4 X;  4B3A A;  5HDN A;  3D0S A;  2PMH A;  3CLO A;  3HIF A;  1VQ9 I;  2CW0 F;  1WSU A;  1LEA A;  5ERI A;  5HS9 A;  1XTA A;  2PN6 A;  3ZQQ A;  2DOA A;  3OIO A;  1R23 A;  2JUG A;  3LFK A;  3RJP A;  4C9Y A;  4B48 A;  1WWX A;  2X9D A;  3LSH A;  2PG4 A;  2PFB A;  1IV8 A;  3J80 K;  3CCU I;  1FT9 A;  3ZCO A;  4E6K G;  4ZTF A;  3M07 A;  4NBQ A;  2EFW A;  2XPU A;  3CP2 A;  3BRO A;  3L7W A;  3ROU A;  3ZN0 A;  4KUM A;  1R5G A;  2WA0 A;  1MDM A;  1XSD A;  5EG0 A;  2FBH A;  3FMS A;  4CO8 A;  3IC7 A;  4I6Z A;  2M3A A;  5EDN A;  2BY1 A;  1CF7 B;  2G9W A;  2L9V A;  1LDK B;  3F8C A;  4XQF A;  3GCM A;  4A0X A;  3SZP A;  5HLI A;  1BC8 C;  3J7Z I;  2BXY A;  2CV2 A;  2BV6 A;  3BZ6 A;  2JZY A;  1EH6 A;  3E5Q A;  3QPT A;  2A07 F;  3EUK L;  3K1P A;  1PP8 F;  1USS A;  3KZI C;  1TNS A;  3ZMZ A;  3F8N A;  5DCF A;  3CCM I;  1R4M B;  2F5C A;  4ZZL A;  3KZZ A;  2O7O A;  3LAJ A;  3O8H A;  1X2M A;  3MN2 A;  4XKB A;  3VOD A;  2NS8 A;  2DCE A;  2VT2 A;  1XB4 A;  2IPQ X;  3DU5 A;  2IRF G;  3WGI A;  3LQR A;  1MMD A;  2G7H A;  4X1E A;  4XRS G;  3S2H J;  2Z5U A;  4UV8 A;  1EV7 A;  3BTI A;  4ZYA A;  4UXN A;  3S93 A;  1BI1 A;  4MLO A;  1ZG1 A;  3WU0 A;  2LKX A;  2V4J C;  4AIH A;  4IRH A;  4BQA A;  2GQQ A;  3HRU A;  3EUA A;  2P5K A;  1UMQ A;  2DW4 A;  1D8K A;  5FLX Z;  1AKH B;  2X48 A;  4LG0 A;  5HLH A;  1ZN2 A;  5JHU A;  3TO7 A;  1MBJ A;  2VJI A;  3ERE D;  4L0Z B;  1B72 B;  3RYP A;  2KDO A;  1WJ5 A;  3IHU A;  1TWA J;  2L0K A;  3UR3 C;  1AOY A;  3R61 A;  3OYM A;  3HOY J;  4PJM A;  2CGP A;  1JUM A;  2STT A;  4UNO A;  1N25 A;  1MGT A;  2WAD A;  2WTE A;  1MBF A;  3ZOB A;  3QOD A;  1TNT A;  2OC6 A;  2P6T A;  3GZ5 A;  3MKZ A;  1YQA A;  2WY7 Q;  2HKX A;  3BDD A;  1ETW A;  1J7K A;  4C3J J;  5ED4 A;  4QTR A;  1JE8 A;  1EH7 A;  3LL7 A;  2DYR H;  2E1C A;  2ZJ2 A;  3V7S A;  4QIW N;  1A6Q A;  3QWL A;  5IP9 J;  2W85 A;  2Y69 H;  2XF7 A;  1ZR4 A;  1V55 H;  2R7Z J;  2ZCW A;  4NDL A;  2VJ4 A;  4HDU A;  1O7F A;  2X6W A;  4XSZ F;  4RAZ A;  1YO5 C;  3SHF A;  5A2Q K;  3PIP F;  2R5Y A;  3I53 A;  4I76 A;  4L9T A;  1BI2 A;  2D5V A;  2DU9 A;  3CC2 I;  2DA7 A;  3FXO A;  1FIP A;  5FJ8 J;  3OYN A;  3DBR B;  1F5T A;  3MQ0 A;  1Z05 A;  3C3W A;  1VQ8 I;  1RZ4 A;  3DKY A;  3WTU C;  3CME I;  5AIQ A;  2F6C A;  2GWR A;  5E1W A;  3W6V A;  4PJ0 C;  3KP6 A;  1PP7 U;  4BY1 J;  4D9J A;  2VXD A;  3TQN A;  2NXN B;  1BR1 A;  1HF0 A;  1EF4 A;  5EGO B;  2LMD A;  1TTY A;  4Y3O A;  3JTH A;  3K4M A;  5KHD A;  3OYK A;  4V2F A;  4PK4 A;  2XAJ A;  5GP9 A;  1WJE A;  1U5T B;  5J8F A;  1TLH B;  2WB1 N;  1E3O C;  2KQR A;  3K9T A;  1ETX A;  4KT5 C;  3K70 D;  5C4X J;  3IKV A;  5FRM A;  3KP3 A;  5DS9 A;  2JTV A;  4B43 A;  1AHD P;  4LFU A;  1SD5 A;  2DT5 A;  4FTH A;  2W00 A;  2XSJ C;  4Y15 A;  5HNF A;  4IJA A;  4EV0 A;  3BR6 A;  5K5O A;  1ETK A;  3SDB A;  2HOE A;  2LY9 A;  5FGM A;  3MWM A;  3OIP A;  1B9N A;  3BTC A;  3F9K A;  1SFU A;  2VAS A;  1SAX A;  5FD5 A;  3HL2 A;  3RQ4 A;  1HST A;  2NVT J;  2R7U A;  4D5F A;  1Z6R A;  1Z3X A;  4HV6 A;  5CJ9 A;  5BOX A;  1DP7 P;  2JA6 J;  5LBQ A;  2MH2 A;  2PMZ N;  4CDG A;  2IEK A;  1W7P A;  1UHM A;  3DWL E;  1XDS A;  2QSF X;  5HVQ C;  3E6M A;  1BC7 C;  1U3E M;  2VL8 A;  1IRZ A;  3TDU C;  3PUB A;  2PJR A;  2LR8 A;  2XGX A;  4G7O F;  5E3O A;  3RPU A;  5ICG A;  5D6F A;  3LSG A;  5D5W B;  2O61 A;  3H5R A;  3M9A A;  5E1X A;  3K0L A;  1YLF A;  3KCC A;  4EJW A;  3H36 A;  2VBY A;  4I09 A;  5EJC A;  3VSK A;  3DXJ F;  2DFE A;  1OYI A;  3B6A A;  1A6I A;  4L5I A;  1P6R A;  2JRT A;  4O5V A;  3RZO J;  2XPV A;  3FF5 A;  5HLT A;  1A04 A;  5DM6 F;  5IY5 H;  1R1U A;  3ISP A;  2NVU B;  1VQK I;  5F64 A;  2O6G E;  5GAD J;  4IQ4 A;  5DD4 A;  2HNH A;  4FET A;  2ESN A;  2ZKZ A;  5CVI A;  1KGS A;  2NVX J;  1DGW Y;  2ZC2 A;  3IAS 2;  4IRI A;  4I2O A;  3F72 A;  2LSO A;  3I4P A;  3V42 A;  5FLV A;  1T39 A;  1TWF J;  2CW8 A;  3L2C A;  4I02 A;  1I27 A;  1JTX A;  5DV5 A;  2EB7 A;  4GFB A;  1FTT A;  1Y8R B;  2LG4 A;  4S04 A;  2LY1 A;  2FBI A;  2ZSI B;  3CO6 C;  1WFX A;  1N78 A;  2XB5 A;  1BR4 A;  1MIJ A;  3CUQ B;  5BS6 A;  6PAX A;  2H1L A;  1LE8 B;  3F21 A;  3WTY C;  3T8T A;  4UUV A;  3ZGK A;  1W1W E;  1U2W A;  5DCM A;  1R7J A;  2EZI A;  3LMM A;  3QYF A;  1FMW A;  1WZ2 A;  2WBM A;  1W5T A;  5H2F C;  5E3L A;  3DLA A;  4HZF A;  2R5Z A;  4BAY A;  3I58 A;  1XMA A;  1TW2 A;  3S2W A;  4E7L A;  3ABU A;  2VBZ A;  4M71 A;  4A2U A;  4BBR J;  1LDJ A;  3HOZ J;  1UHW A;  1G3T A;  3GTM J;  5J8C A;  5K7H A;  2ID6 A;  2PI0 A;  1S6L A;  4G9Y A;  4Q47 A;  3CCJ I;  3F22 A;  3I9V 2;  4IX7 A;  3JRF A;  3BR5 A;  3RTR A;  2OZ6 A;  1QGP A;  1JHF A;  2Z99 A;  4RB2 C;  4KNY A;  2DA6 A;  4EJV A;  5CVV A;  2R7T A;  1WVR A;  1OR7 C;  3WG7 H;  1IDY A;  3DTK A;  4DYR A;  3BTJ A;  2EIM H;  1FYL A;  1ZK8 A;  2ETH A;  1WI3 A;  3IKT A;  3PQJ A;  1ON1 A;  2XF5 A;  3MEX A;  3K6G A;  2KKO A;  2ZXW H;  4M3B A;  4PJN A;  1IN4 A;  3S2D J;  5JI6 A;  2XPW A;  1ZKG A;  3H3Z A;  3ZN1 A;  3I54 A;  4D5C A;  4EVI A;  1E17 A;  4DW6 A;  3NAR A;  4F52 A;  3ASO H;  4XRF A;  2VE9 A;  5BNG A;  5HLG A;  2BOL A;  4EM1 A;  4XK4 A;  2ESH A;  2LFB A;  3HSF A;  2JPB A;  1BL0 A;  5B66 C;  1UZC A;  4CCK A;  4XRS A;  4OIQ F;  3OOU A;  4EGY A;  4DBQ A;  4PSW A;  4BYY A;  3ZQI A;  5JLW A;  2X6X A;  2E36 A;  5BQT A;  3DFG A;  2JSC A;  1Y56 A;  4GYI A;  2QQA A;  4A5M A;  1OCZ H;  5F04 A;  3E6C C;  2P7C B;  1Z91 A;  4EM0 B;  2MG4 A;  3FHN A;  4XLC A;  1APL C;  2PMU A;  1A36 A;  3IWZ A;  4RLQ A;  1CGP A;  3OWT A;  3RKY A;  2ZXJ A;  4IHT A;  1FBQ A;  1H0M A;  4KFC A;  4UUS B;  2Y2Z A;  3IP4 B;  2XAQ A;  5M5X J;  1JI8 A;  2BEO A;  2CUF A;  4YFN F;  4WK8 F;  3Q0U A;  4OOI A;  1RI7 A;  3LST A;  4RB0 A;  3H5N A;  5TRD A;  1BIA A;  2ADU A;  2WV0 A;  3IH2 A;  3HPG A;  5FFZ A;  2KIQ A;  1QVT A;  2X51 A;  2VT3 A;  1SD4 A;  2WV1 A;  4XOR A;  1R00 A;  2E5Z A;  3OS0 A;  1FC3 A;  2DMT A;  4XLP F;  4BEH A;  2K3F A;  5FB2 A;  2HVS A;  2Q2E A;  4IZZ A;  5FKO A;  1YJW I;  1RR7 A;  1O3S A;  2OV7 A;  2VXZ A;  4D7M A;  4E4H A;  2NS0 A;  2HQA A;  3QPL A;  2XAS A;  1PYV A;  2BE5 F;  2KIF A;  1P7I A;  3KYC B;  4YIR X;  3K4J A;  2IS2 A;  9ANT A;  2OUM A;  1ZGA A;  2ME6 A;  2EZH A;  2IS1 A;  4BDZ A;  2COM A;  1KU2 A;  3S1M J;  3HOW J;  2XDV A;  4LD5 A;  3LSI A;  2DMU A;  2H8W A;  2HS5 A;  2WAF A;  1ETY A;  3DBH B;  2CFX A;  1E3P A;  4KDP A;  1KU7 A;  1VFC A;  3HUG B;  3ZQL A;  3K1N A;  1GVD A;  2ZFU A;  4OIR F;  2BXZ A;  4C2M J;  2BY3 A;  1LFB A;  3TP3 A;  5IYC J;  2GAU A;  4NC7 A;  1RUO A;  1TL8 A;  2LKS A;  2TCT A;  3P9K A;  3R4K A;  3H1C A;  1Y1V J;  1MW7 A;  3K69 A;  2IA2 A;  3H3U A;  1TWH J;  2IJL A;  3OYC A;  2MH9 A;  3GLL A;  4DGW B;  2X6O A;  3IUO A;  4L18 B;  3MKL A;  1RC9 A;  4NB5 A;  2GOM A;  1T0F A;  1YE9 A;  3QPS A;  3U2R A;  1ETO A;  2WC2 A;  2ZME B;  4AM3 A;  2CV1 A;  2H6C A;  2HR3 A;  4JYK A;  4FE4 A;  2EV5 A;  4G6T B;  4PDK A;  1K6Y A;  3GFL A;  2IAI A;  2LBF A;  3LSJ A;  3SXY A;  4M72 A;  1NH3 A;  1JTY A;  2FMY A;  1PDN C;  4A3C J;  3PL8 A;  2PEX A;  3VYT B;  4BU2 A;  3LAP A;  3FM3 A;  2KRH A;  4GXO A;  4XOT A;  3OSF A;  3RKX A;  2EPF A;  2BHZ A;  3VPR A;  1U9N A;  1XPX A;  2E7X A;  3BY6 A;  1HW1 A;  1Y1W J;  2PX9 A;  4NHJ A;  4BXU A;  5J4V A;  4A12 A;  2DJI A;  1F1Z A;  3G3Z A;  1XD7 A;  3BCA A;  5IYB J;  5EEG A;  2DA3 A;  2EFP A;  2QYO A;  4BAC A;  1LFU P;  1L0O C;  3I59 B;  4I98 B;  5E3M A;  4FHT A;  3L2V A;  3BZC A;  4A3G J;  4CYC A;  1HW2 A;  3HRT A;  3F6V A;  2BVM A;  4CUG A;  1D0Z A;  2LY2 A;  1GT0 C;  1T33 A;  5J4Y A;  4FQG A;  4FCY A;  4LK1 F;  5DD8 A;  1QO0 D;  2I5U A;  5L3D A;  1SMY F;  1LNW A;  3LQQ A;  4EQQ A;  1FBU A;  4LLN A;  1DPR A;  2X1E A;  5HOD A;  2L3D A;  4HQM A;  1WCM J;  4LG3 A;  2V6E A;  4OIP F;  3VB2 A;  3L1P A;  4N4O B;  1HCR A;  1BM9 A;  3CES A;  4PJJ A;  3DLL F;  2CO5 A;  5LGU A;  5GAH J;  3OSG A;  4A3M J;  4BUP A;  3T5X A;  4AUX A;  3CZ6 A;  4A3E J;  1D5V A;  1LUJ B;  1WH7 A;  1Z7U A;  3SZG A;  4IO9 F;  4EJO A;  4I7H A;  2YX7 A;  2QLZ A;  2Y9Z A;  3DV8 A;  1UB9 A;  1XC5 A;  1YOV B;  2M7B A;  2E1N A;  5EEA A;  2Y30 A;  2L7Z A;  2ZFW A;  2DMQ A;  2ME0 A;  4BJ5 C;  2JA7 J;  4Q4Z F;  3X2Q H;  4G8X A;  3SFI A;  2GOX B;  2KZV A;  3E0J B;  3CMA I;  2O0Y A;  2HOS A;  3KLN A;  2RV8 A;  2ELK A;  5LGN A;  2EIJ H;  3IV5 A;  2DMP A;  3F6O A;  4MNU A;  3R0A A;  3RZD J;  4BJ6 C;  2BYV E;  4QSH A;  1DU0 A;  2KRC A;  1BBY A;  1PJR A;  3VDX A;  4ZC3 A;  3ZMU A;  2BY2 A;  5J1U A;  1FSH A;  1SVO A;  2DQL A;  1I6X A;  4NQW A;  4EM2 A;  4KA4 A;  4M3G A;  4ANJ A;  1J5Y A;  2M8E A;  4A69 C;  3JRB A;  1SVM A;  1QBJ A;  3HPH A;  3CTA A;  1WPK A;  4XRM A;  2OU2 A;  3CO7 C;  1NG6 A;  1U8R A;  4IHX A;  4DNC A;  1I50 J;  2BW3 B;  3LOC A;  1H88 C;  4B1R A;  2VQG A;  2RGV A;  4XN0 A;  5B1A H;  2JT1 A;  3S3O A;  5J40 A;  3QYB A;  2O5R A;  1UG0 A;  2W57 A;  4FT8 A;  1Z7L A;  5LGT A;  4FAS D;  2DA5 A;  3PSI A;  1FJL A;  1CF7 A;  4KIC A;  3KEQ A;  3ZMD A;  1VQ5 I;  5JVG F;  5DTD A;  4MFD A;  1ETQ A;  3WTX C;  3MVP A;  1LB2 A;  3TO6 A;  2B7E A;  2LF7 A;  2RVC A;  1ZRF A;  2PLY A;  2Y0S A;  1R71 A;  2E5N A;  2FUG 2;  1FWZ A;  4G12 A;  2VB6 A;  3E5U A;  4CYD A;  4JX6 A;  3WTW C;  4H4K C;  3OYB A; 
#chains in the Genus database with same CATH homology
 3F3X A;  4BH9 A;  2HQR A;  2QQ9 A;  4JQF A;  4MQV A;  5ILV A;  1L3L A;  5LHG A;  4XBF A;  3LA7 A;  1MKM A;  2G7U A;  1GXQ A;  2YR2 A;  2GXG A;  3GO5 A;  1OMI A;  3KEO A;  1YW8 A;  4I01 A;  4LB5 A;  1X3U A;  3HTU A;  4N0B A;  3F23 A;  5ILU A;  1KYW A;  1F9N A;  1KU3 A;  2M5W A;  1ODD A;  4LK0 F;  2NRA C;  1JHH A;  1R22 A;  1ZH5 A;  3ZP5 A;  3WE3 A;  2E7W A;  2D2W A;  3V4G A;  1IN7 A;  3ECH A;  2K27 A;  4HF0 A;  1ZRE A;  2V1X A;  2XRO A;  3EDP A;  4HLY A;  3TO9 A;  1I1S A;  4I0A A;  2EWN A;  1HXD A;  3O3K A;  5D5V B;  3DP7 A;  4LGW A;  5DUK A;  4UVB A;  3EYI A;  4K2E A;  3RIR A;  3J80 Z;  3I64 A;  1TW3 A;  1FOK A;  3O6B B;  1P2F A;  5H6Q A;  2RC4 A;  3EQL F;  5DEQ A;  1U5T A;  5J6X A;  3C1D A;  4HX8 A;  4KIB A;  1YW7 A;  3DF8 A;  1K78 B;  4G7H F;  1XCB A;  1XSX A;  3KP2 A;  4XSX F;  4N9H A;  1OYW A;  3CJN A;  1P4A A;  1TQM A;  2P5L C;  4FX0 A;  2VOP A;  2DFI A;  2DI3 A;  2M30 A;  1QQI A;  3V8K A;  4D0P A;  1O3R A;  2UWM A;  4AWX B;  4F7Z A;  4AVP A;  5JVT A;  1S3J A;  1I5Z A;  4YIF A;  1WRJ A;  3FXR A;  1KA8 A;  1VTN C;  1O7L A;  3QRF F;  2YPR A;  2M87 A;  1KQ8 A;  2UXX A;  3CUQ A;  5A2Q Z;  4M73 A;  3JSP A;  2X4H A;  4ZYE A;  4PGH A;  2XKO A;  3VFZ A;  3AAF A;  4TV7 A;  4XLN F;  4IXA A;  4P96 A;  4ENM A;  1BN5 A;  1Q1H A;  2XKP A;  3ZMS A;  3MZY A;  4ZZD A;  3HHH A;  2GA1 A;  4O6J A;  4O3M A;  2FF4 A;  2H27 A;  1YS6 A;  4OIN F;  3M8F A;  4G94 A;  5HDK A;  2FSW A;  4M9Z A;  4P5O A;  4ZYH A;  1KQ9 A;  5L3B A;  3ELK A;  2IA0 A;  1QNT A;  1XGN A;  1YG2 A;  3RDI A;  5ILS A;  2M45 A;  1XDU A;  4WCG A;  3T1B A;  4WXC A;  4RGX A;  3LWF A;  3OV8 A;  3GWZ A;  1Y0U A;  1O3T A;  2FEZ A;  4ESF A;  3KFW X;  1YW9 A;  4EGZ A;  4ZYG A;  1DPU A;  4WF2 A;  3T0Y A;  3IRQ A;  5E8I A;  4FX4 A;  4ASN A;  1SD6 A;  2KIU A;  3LA2 A;  3WTS C;  2UZK A;  4BHP A;  2OAZ A;  1U6G A;  4HF1 A;  2DK5 A;  3JTG A;  1Z9C A;  4UHT A;  3WTT C;  4RAY A;  5BPI A;  1OPC A;  3JSO A;  1JXS A;  1ZHF A;  1BJA A;  4R1H A;  1TQP A;  4KN4 X;  4CZZ A;  2L54 A;  3PFI A;  4A0Y A;  3DQV C;  5H6R A;  3HUG A;  3JW4 A;  1PUE E;  1ZAO A;  3QPH A;  1G6N A;  5F1R A;  5FFX A;  5D5X B;  2F2E A;  1ZRD A;  3GVA A;  2MLK A;  2VOO A;  4Y17 A;  1W7P B;  1ZYR F;  2D1V A;  1K79 A;  2H6B A;  4BHB A;  2A3S A;  3ECO A;  2ZME A;  1MJB A;  2QWW A;  4IRG A;  4KMU X;  2P7V B;  4KYW A;  5E20 A;  3RKW A;  2L4M A;  1S7O A;  2FML A;  2XIG A;  5L3C A;  4ETS A;  1J59 A;  1HW5 A;  2FNA A;  3P7N A;  2YU3 A;  3BJA A;  1KU9 A;  4GO1 A;  3BOQ A;  4YFX F;  2A6H F;  4MEX F;  4Q48 A;  3QP6 A;  2B0L A;  3GLX A;  3I59 A;  4IF4 A;  2VOD A;  2EFN A;  3M1E A;  2IT0 A;  3W6K B;  2A69 F;  3N4M A;  3MZH A;  3SQN A;  5DCM B;  5D8L B;  4IHS A;  1UCR A;  1FYK A;  2AS5 F;  2P4W A;  5K5R A;  4U7D A;  1J75 A;  1IN8 A;  1FSE A;  2HFH A;  2DK8 A;  4HOB A;  3ULQ B;  2XVC A;  2HKO A;  3FHZ A;  1RUN A;  2IW5 A;  3NRV A;  2STW A;  4MGR A;  2F5F A;  1HKT A;  4OMY A;  5E1Z B;  1ZG3 A;  4RS8 A;  1TQI A;  1W7P D;  1F4K A;  3GZ6 A;  4MTD A;  4U0Y A;  2FXA A;  3KP4 A;  2OD5 A;  1IF1 A;  2FBK A;  4WWC A;  2QM3 A;  2EK5 A;  4UVC A;  1RIO H;  2W24 A;  2ZNZ A;  2RQP A;  5K1Y A;  1MD0 A;  1FX7 A;  1T98 A;  1T38 A;  2IA1 A;  5L3G A;  1SFX A;  5HS7 A;  2NNY A;  2OBP A;  2DPD A;  3BPV A;  4M9X A;  2HDC A;  3C7J A;  2CSO A;  3E6B A;  5L3F A;  2OQR A;  1RNL A;  3JAM K;  2P6S A;  1S29 A;  2IP2 A;  1AWC A;  5E17 F;  3OOP A;  1XGM A;  3QOP A;  2Y48 A;  3VOE A;  1LEB A;  1IRF A;  3Q9S A;  3FWE A;  2YSR A;  1YTY A;  2PBI A;  1STZ A;  4PGG A;  4KN7 X;  4BNC A;  4HQE A;  1K6O A;  3RI4 A;  1WQ2 A;  2EFO A;  2VBX A;  4KIF A;  4KIG A;  2HGC A;  1V3F A;  3GEZ A;  1ON2 A;  4RB1 A;  1BOA A;  2QBY B;  4AIK A;  1SMT A;  2DTR A;  3HRS A;  2K4B A;  4EJT A;  3J81 K;  2XAG A;  4M6Y A;  2NYX A;  2UXN A;  3TDZ C;  5K5Q A;  2J5O A;  2XHK A;  1QPM A;  4MTE A;  2VE8 A;  3D5L A;  2VBW A;  4WX9 A;  1T6S A;  2HTJ A;  2OZU A;  4U0V A;  2XUB A;  4S05 A;  3DPT A;  4OU0 A;  4HA8 A;  3FM5 A;  2EFQ A;  1WKM A;  3W6J B;  2P8T A;  1DUX C;  2AXL A;  2EA4 A;  5EEH A;  2NNN A;  4CHU A;  4WXD A;  3HTS B;  3PQK A;  1R36 A;  2QZ8 A;  1K78 A;  2HYF A;  4Y13 A;  5HS8 A;  4ZYD A;  5DUI A;  2V79 A;  2CWE A;  3NEU A;  3I0T A;  2Z9O A;  1R1V A;  3QU3 A;  4U0W A;  4ESJ A;  4U7B A;  3KLO A;  1J9I A;  1IXS B;  1I1G A;  2R7F A;  3P9C A;  4IVN A;  2FNP A;  3REO A;  1JGS A;  5JFR A;  2Y0M A;  1GXP A;  3TOA A;  4B09 A;  4A6D A;  4R79 A;  4R8H A;  3E6D A;  5E18 F;  1HKS A;  5IT3 A;  4YII A;  3QU6 A;  2LDU A;  1UST A;  2K02 A;  2XV4 S;  2KJB A;  1FYM A;  4H0E A;  4ON0 A;  1MJA A;  1G3W A;  3FXQ A;  3IWF A;  4P9U A;  1ZRC A;  2FA5 A;  5BPD A;  4HAM A;  3MCZ A;  3HYI A;  3CDH A;  1FP1 D;  2K86 A;  1BI0 A;  5DYM A;  4WXH A;  3ZPL A;  1EH8 A;  5LHH A;  1QZY A;  4GCV A;  3IL2 A;  4G6D A;  3R6S A;  1XGO A;  3V8L A;  2ELH A;  5AON A;  1B9M A;  2W84 A;  5FLX K;  3QP5 A;  2BGC A;  3WGG A;  2DLL A;  2OQG A;  2ZO4 A;  1G4D A;  2D45 A;  1OR7 A;  1J0R A;  2HYG D;  2EA2 A;  4U88 A;  2HTS A;  3N97 A;  3L00 A;  2GXB A;  2A68 F;  2KIM A;  3TOB A;  3M7G A;  2X0L A;  5L3E A;  3HOS A;  2MLG A;  3ZMV A;  4MHG A;  2NAZ A;  4CXF A;  3DEU A;  2FQ3 A;  1FNN A;  2V1D A;  3HSE A;  3I71 A;  4CIC A;  4L5J A;  1P4X A;  5D4S A;  3TGN A;  1B1B A;  2M1B A;  2XRN A;  3F8M A;  2LF8 A;  3GUD A;  1S8N A;  2RNJ A;  3WTV C;  3GX4 X;  3F8F A;  4JK1 X;  1BIB A;  5ICF A;  1B6A A;  1MDM B;  1FP2 A;  4HV5 A;  4YG2 F;  3EET A;  3H92 A;  1C0W A;  1R58 A;  5CVJ A;  4L9V A;  5TJJ A;  4A5N A;  1OYY A;  1YFH A;  3FX3 A;  1ULY A;  2DQR A;  3IRR A;  1XCV A;  1UFM A;  4L9N A;  3SFZ A;  4GGG A;  3VEP A;  2XAF A;  4ESB A;  5BMZ A;  2HQN A;  2A61 A;  1XMK A;  4AIJ A;  1ZLJ A;  2CYY A;  4HBL A;  3WU1 B;  2TDX A;  4RB3 C;  1IXR C;  3WGH A;  4LG0 B;  3WTZ A;  1FZP B;  4QWQ A;  1XSV A;  2O3F A;  4HLX A;  1ZLK A;  2F5D A;  3GFM A;  2Q0O A;  1IW7 F;  1ZAR A;  2XAH A;  1IXC A;  3WOD F;  3C18 A;  1GHC A;  3K1M A;  1LJ9 A;  2DO7 A;  1KYZ A;  5CYV A;  3V7R A;  3E3V A;  2BBY A;  1FPQ A;  3GFI A;  2H09 A;  4DQ2 A;  3T8R A;  4KMF A;  4M9S A;  2H94 A;  1O3Q A;  2IVM A;  2MC3 A;  3Q5F A;  1IAW A;  5HOO A;  1XN7 A;  4BHC A;  3J7A O;  4ZH4 F;  4RGU A;  2KJC A;  2LKP A;  2CQK A;  2QVO A;  2RN7 A;  3U9G A;  2DAO A;  4LB6 B;  5D4R A;  4CGZ A;  1W4M A;  2C6Y A;  2VC1 A;  2RDP A;  4M74 A;  2K7L A;  2YX4 A;  1R1T A;  2MBF A;  4LJZ F;  2MA3 A;  1U5T C;  2RKH A;  2FOK A;  3HRM A;  2ISY A;  3L09 A;  5D6E A;  2ZBK A;  2DPU A;  5F6F A;  1XGS A;  2GZW A;  2V9V A;  5H20 A;  2VC0 A;  3U1D A;  3FMQ A;  1YS7 A;  5CVR A;  3ZQ7 A;  2QUF A;  3TKY A;  2KRF A;  5LEJ A;  3KP7 A;  1HSJ A;  2R3S A;  4LMY A;  4QLC U;  3DPL C;  1YIO A;  1GVJ A;  4RGS A;  1H9T A;  2HZT A;  2EJR A;  1KQ0 A;  2MD5 A;  2EV0 A;  1SD7 A;  3BJ6 A;  4G6Q A;  2V1U A;  2F5E A;  3Q9V A;  4OIO F;  4N9I A;  2Z33 A;  5LLQ A;  4M6X A;  3HSR A;  1B4A A;  4HF2 A;  2VN2 A;  4ENN A;  3O2P E;  3DKW A;  3V7C A;  4HW0 A;  3HHG A;  1E2X A;  5E8G A;  3K2Z A;  4HYE A;  2L01 A;  3CUQ C;  1P92 A;  2A5Y B;  4ENK A;  2ACJ A;  2GA2 A;  1G3Y A;  3EYY A;  2O8X A;  2V6C A;  5CVU A;  4I0B A;  1IZ1 A;  1H9G A;  1BI3 A;  4P55 A;  3GW2 A;  4LLL A;  3M8E A;  4Q5S F;  1YYV A;  1NHA A;  2JPC A;  1D8J A;  2FE3 A;  2CG4 A;  3FXU A;  1LVA A;  1V4R A;  1S7A A;  2L4A A;  3GYH X;  3GF2 A;  2D1H A;  1IN5 A;  5IT9 K;  1Z1D A;  1P4W A;  2QBY A;  3GFJ A;  3BJO A;  4HX4 A;  2GIV A;  5HDG A;  2VON A;  4L0Y B;  5LRR A;  3RYR A;  1HKQ A;  3ABT A;  1LQ1 A;  5AIP A;  4UV9 A;  2PJP A;  4LLG F;  5LEK A;  5IT9 Z;  3R60 A;  2L02 A;  2ISZ A;  3FMR A;  2HEO A;  4IPA A;  1QZZ A;  4PZJ A;  1U78 A;  4RGR A;  3RPQ A;  4L9J A;  2Z3Y A;  1HQC A;  5DDG A;  2A6E F;  3CUO A;  1TBX A;  2QEN A;  3KZY A;  5D8K B;  5ICC A;  3COA C;  5FD6 A;  3NQO A;  2FRH A;  3F8B A;  5D5U B;  2DBB A;  3QAH A;  3JAM Z;  1WI9 A;  1SFE A;  3R0J A;  3G73 A;  4HX7 A;  1REP C;  2K4J A;  2PQ8 A;  2P5V A;  4YFK F;  2J5P A;  3B73 A;  3WG9 A;  1DDN A;  1FLI A;  4MEY F;  3BP8 A;  4Z2Y A;  2WWY A;  3WE2 A;  2HWV A;  4EJU A;  1ZG5 A;  3MAJ A;  2Y75 A;  3FZV A;  2EV6 A;  1IUY A;  3KE2 A;  4G7Z F;  4AD9 A;  1R5H A;  3J81 Z;  2O03 A;  1ZGJ A;  1HBX G;  5JR3 A;  3ML6 A;  4A0Z A;  5KK1 A;  2R7D A;  3V8J A;  1FY7 A;  2W25 A;  2Q8K A;  4B8X A;  2FU4 A;  1FBS A;  3I5U A;  5LRS A;  4JBA A;  5FO5 A;  1IRG A;  3LA3 A;  3HOT A;  1O57 A;  3SZT A;  3EUH A;  4OMZ A;  1G3S A;  3E5X A;  3BWG A;  4GYG A;  1LDD A;  3BPX A;  4UVA A;  4ENJ A;  3KET A;  3MFK A;  2ZNY A;  3KP5 A;  2QQB A;  4A6E A;  3ZMT A;  3GXO A;  1B59 A;  1OKR A;  3B02 A;  5CLS A;  3P9I A;  1T2K A;  5ICE A;  3E97 A;  4MQ9 F;  2LNB A;  5LHI A;  4PCQ A;  5KVR A;  1ONV A;  1MJ9 A;  2OA4 A;  1Z6T A;  4P9F A;  4HDV A;  1IN6 A;  1J2X A;  1K7A A;  1MZB A;  1D3Y A;  3L9F A;  1W5S A;  4EMS A;  4E70 A;  5HDN A;  3D0S A;  2PMH A;  3CLO A;  3HIF A;  2CW0 F;  1WSU A;  1LEA A;  5ERI A;  5HS9 A;  2PN6 A;  3RJP A;  1R23 A;  3LFK A;  1WWX A;  2PG4 A;  2PFB A;  3J80 K;  1FT9 A;  2EFW A;  3BRO A;  3ZN0 A;  3L7W A;  3ROU A;  4KUM A;  1R5G A;  1MDM A;  1XSD A;  2FBH A;  3FMS A;  4CO8 A;  3IC7 A;  1CF7 B;  2G9W A;  1LDK B;  3F8C A;  4A0X A;  3SZP A;  5HLI A;  1BC8 C;  2BV6 A;  3BZ6 A;  2JZY A;  1EH6 A;  3E5Q A;  3QPT A;  2A07 F;  3K1P A;  1PP8 F;  1USS A;  1TNS A;  3ZMZ A;  3F8N A;  5DCF A;  2F5C A;  4ZZL A;  3KZZ A;  3LAJ A;  3VOD A;  2VT2 A;  1XB4 A;  2IPQ X;  2IRF G;  3WGI A;  3LQR A;  2G7H A;  2Z5U A;  4UV8 A;  1EV7 A;  4UXN A;  1BI1 A;  1ZG1 A;  3WU0 A;  4AIH A;  4IRH A;  4BQA A;  2GQQ A;  3HRU A;  2P5K A;  2DW4 A;  1D8K A;  5FLX Z;  4LG0 A;  5HLH A;  1ZN2 A;  5JHU A;  3TO7 A;  4L0Z B;  3ERE D;  3RYP A;  3IHU A;  1AOY A;  3R61 A;  2CGP A;  2STT A;  4UNO A;  1MGT A;  2WTE A;  1TNT A;  2P6T A;  3GZ5 A;  1YQA A;  2HKX A;  3BDD A;  5ED4 A;  1J7K A;  1JE8 A;  1EH7 A;  2E1C A;  2ZJ2 A;  3V7S A;  2W85 A;  2ZCW A;  4HDU A;  1O7F A;  4XSZ F;  4RAZ A;  1YO5 C;  3SHF A;  5A2Q K;  3I53 A;  4L9T A;  1BI2 A;  2DU9 A;  1F5T A;  3MQ0 A;  1Z05 A;  3C3W A;  1RZ4 A;  3WTU C;  5AIQ A;  2GWR A;  5E1W A;  3KP6 A;  1PP7 U;  3TQN A;  1TTY A;  3JTH A;  2XAJ A;  1U5T B;  5J8F A;  1TLH B;  3K9T A;  4KT5 C;  3IKV A;  3KP3 A;  2JTV A;  4LFU A;  1SD5 A;  2DT5 A;  4Y15 A;  4IJA A;  4EV0 A;  5K5O A;  2HOE A;  5FGM A;  3MWM A;  1B9N A;  1SFU A;  1SAX A;  5FD5 A;  1HST A;  1Z6R A;  4HV6 A;  5CJ9 A;  5BOX A;  1DP7 P;  5LBQ A;  2MH2 A;  4CDG A;  1W7P A;  1UHM A;  1XDS A;  5HVQ C;  3E6M A;  1BC7 C;  1U3E M;  3TDU C;  2XGX A;  4G7O F;  3RPU A;  5ICG A;  5D6F A;  5D5W B;  2O61 A;  3M9A A;  5E1X A;  3K0L A;  1YLF A;  3KCC A;  4EJW A;  4I09 A;  2VBY A;  3DXJ F;  4L5I A;  1OYI A;  1P6R A;  2JRT A;  4O5V A;  3FF5 A;  1A04 A;  1R1U A;  3ISP A;  5F64 A;  2O6G E;  5DD4 A;  2ESN A;  2ZKZ A;  5CVI A;  1KGS A;  4I2O A;  4IRI A;  3F72 A;  2LSO A;  3I4P A;  1T39 A;  3L2C A;  4I02 A;  1I27 A;  5DV5 A;  2EB7 A;  4S04 A;  2FBI A;  3CO6 C;  3CUQ B;  5BS6 A;  6PAX A;  3F21 A;  3WTY C;  3T8T A;  4UUV A;  1U2W A;  5DCM A;  1R7J A;  1W5T A;  4HZF A;  4BAY A;  3I58 A;  1XMA A;  1TW2 A;  3S2W A;  3ABU A;  2VBZ A;  4M71 A;  4A2U A;  1LDJ A;  1UHW A;  1G3T A;  5J8C A;  2PI0 A;  1S6L A;  4G9Y A;  4Q47 A;  3F22 A;  3RTR A;  2OZ6 A;  1QGP A;  1JHF A;  2Z99 A;  4RB2 C;  4KNY A;  4EJV A;  5CVV A;  1FYL A;  2ETH A;  3IKT A;  3PQJ A;  1ON1 A;  3MEX A;  2KKO A;  1IN4 A;  5JI6 A;  3H3Z A;  3ZN1 A;  3I54 A;  4EVI A;  1E17 A;  4XRF A;  2VE9 A;  5HLG A;  4EM1 A;  2ESH A;  3HSF A;  2JPB A;  4OIQ F;  4EGY A;  4BYY A;  5BQT A;  3DFG A;  2JSC A;  4GYI A;  2QQA A;  4A5M A;  3E6C C;  2P7C B;  1Z91 A;  4EM0 B;  2PMU A;  3IWZ A;  1CGP A;  4IHT A;  3RKY A;  2ZXJ A;  1FBQ A;  1H0M A;  4KFC A;  2XAQ A;  2BEO A;  4YFN F;  4WK8 F;  4OOI A;  1RI7 A;  3LST A;  4RB0 A;  5TRD A;  1BIA A;  2ADU A;  2WV0 A;  5FFZ A;  2VT3 A;  1SD4 A;  1R00 A;  1FC3 A;  4XLP F;  5FB2 A;  2Q2E A;  1O3S A;  2VXZ A;  2NS0 A;  2XAS A;  2BE5 F;  2KIF A;  1ZGA A;  2COM A;  1KU2 A;  4LD5 A;  2HS5 A;  2CFX A;  4KDP A;  1KU7 A;  3K1N A;  4OIR F;  2GAU A;  1RUO A;  3P9K A;  3R4K A;  3K69 A;  2IA2 A;  3H3U A;  2IJL A;  2MH9 A;  4L18 B;  4NB5 A;  1T0F A;  3U2R A;  2WC2 A;  2ZME B;  2H6C A;  2HR3 A;  2EV5 A;  4PDK A;  3GFL A;  3SXY A;  4M72 A;  2FMY A;  1PDN C;  2PEX A;  3LAP A;  3FM3 A;  4GXO A;  3RKX A;  2E7X A;  3BY6 A;  1HW1 A;  4NHJ A;  4BXU A;  4A12 A;  1F1Z A;  3G3Z A;  1XD7 A;  5EEG A;  2EFP A;  2QYO A;  1L0O C;  3I59 B;  4I98 B;  4FHT A;  1HW2 A;  3HRT A;  3F6V A;  4LK1 F;  5DD8 A;  1QO0 D;  5L3D A;  1SMY F;  1LNW A;  3LQQ A;  4EQQ A;  1FBU A;  4LLN A;  1DPR A;  2L3D A;  4HQM A;  4OIP F;  3VB2 A;  1BM9 A;  2CO5 A;  5LGU A;  3T5X A;  1D5V A;  1Z7U A;  4EJO A;  4I7H A;  2YX7 A;  2QLZ A;  3DV8 A;  1UB9 A;  2E1N A;  2ZFW A;  4Q4Z F;  4G8X A;  2O0Y A;  3KLN A;  2RV8 A;  5LGN A;  3F6O A;  4MNU A;  3R0A A;  2BYV E;  1BBY A;  3ZMU A;  1FSH A;  2DQL A;  1I6X A;  4NQW A;  4EM2 A;  4KA4 A;  1J5Y A;  2M8E A;  1QBJ A;  3CTA A;  2OU2 A;  3CO7 C;  1U8R A;  4DNC A;  2RGV A;  2JT1 A;  2W57 A;  4FT8 A;  5LGT A;  1CF7 A;  4KIC A;  3KEQ A;  3ZMD A;  3WTX C;  1LB2 A;  3TO6 A;  2LF7 A;  2RVC A;  1ZRF A;  2PLY A;  1FWZ A;  3E5U A;  4CYD A;  3WTW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...