4HQMA

The crystal structure of qsrr-menadione complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
VCPYLEETFKILGRSWNGLIINYLSRSNDSSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription regulator
molecule keywords QsrR protein
total genus 35
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hqmA00
5HLGA 4BQAA 3QPTA 3BDDA 1R1VA 2H6CA 2NS0A 2VBWA 2MA3A 3RYPA 2L4AA 2V9VA 2P5VA 5H20A 2M1BA 3K0LA 1FZPB 4WF2A 2PJPA 1TBXA 4I0AA 2E7XA 1T98A 2OA4A 2ELHA 4M6YA 2XHKA 4ZYDA 4GXOA 3QOPA 1KQ9A 4S04A 2XROA 3GF2A 2XRNA 4RGXA 2J5OA 1FP2A 4I98B 4ENMA 4OOIA 2V1XA 5LEKA 3R60A 3I4PA 3FMRA 5H6QA 4DNCA 1YYVA 3JTGA 2JTVA 4ETSA 3I5UA 2WV0A 5K5OA 5DYMA 3I53A 1YIOA 5DD8A 2H27A 2EA4A 2QUFA 4KICA 4I01A 2XV4S 1ZYRF 4HLYA 1T39A 4OIOF 5K5RA 4M6XA 5HS8A 3O6BB 4MHGA 3EDPA 3M8EA 1ZREA 1TW2A 5D6EA 3ISPA 3ZMVA 1R7JA 3I0TA 1Z9CA 3L00A 2STTA 4AIJA 1ZRCA 1B4AA 1CF7B 4P9FA 4HBLA 4AIHA 5HDNA 2Z33A 1IXSB 1T2KA 5BOXA 1TNTA 1U6GA 4KUMA 4EV0A 3ZMSA 2EFQA 4CGZA 2QQ9A 4MQVA 2VXZA 2Z5UA 3F72A 1FWZA 1YW8A 2EJRA 3E6CC 4WK8F 4U7BA 1D5VA 3WTUC 2AXLA 1ZHFA 3ECHA 4I09A 3KP7A 2DK5A 2L01A 5DD4A 4M9ZA 4XSZF 3GFLA 3GUDA 3FXUA 5FLXZ 2FRHA 2PMUA 2CFXA 1MD0A 2KIMA 5HOOA 1WWXA 3ZMZA 4G94A 3OOPA 2NNYA 4Q48A 5D8LB 4BHCA 2JRTA 2GXBA 1J9IA 4IRIA 2DFIA 3KEQA 3GXOA 1J59A 2EV6A 2AS5F 2A07F 3V8JA 2EWNA 3FZVA 4LD5A 3VB2A 3HRUA 3PFIA 3CDHA 2YX7A 2Q2EA 5J8FA 2GAUA 4PCQA 5IT9K 2UXNA 2XASA 2H6BA 4ZZDA 2P5LC 1IW7F 2W57A 4EJWA 2VC1A 1XDSA 3P9CA 1LDDA 1O3RA 1TQPA 2O6GE 3JSOA 2COMA 1LJ9A 1BI3A 5LGNA 1RUOA 2R3SA 4UV8A 4RGUA 3SQNA 2DLLA 5CVIA 2UWMA 1QQIA 1LEAA 2A6HF 4ENKA 5DDGA 2GXGA 1G6NA 1TQIA 4L9TA 3ZP5A 4YG2F 4HZFA 4G8XA 2EA2A 1FYMA 1SD7A 2P4WA 4UVAA 2IW5A 3KZYA 4HA8A 3LQQA 1ZGAA 1J5YA 1NHAA 2HQNA 1R58A 3LA2A 1XGNA 2IA0A 3U1DA 3RPUA 4U88A 2XAJA 2B0LA 3F8FA 4G7OF 1U5TB 4HAMA 3OV8A 1IN6A 3S2WA 1FX7A 1KU2A 4L9VA 4RS8A 3I71A 3P9IA 1LEBA 4LG0B 3M8FA 1USSA 4XLNF 1R22A 4M9SA 4N9IA 3FX3A 2G9WA 4CO8A 4CDGA 1PP8F 3BOQA 3R61A 5E8IA 5E20A 3LFKA 2Y0MA 1FBUA 1K78B 5ILSA 4A0YA 2HYGD 1ODDA 5LGTA 1I27A 1FT9A 4UNOA 2LKPA 3D5LA 1QBJA 3MAJA 2DU9A 4G9YA 4P96A 3KLNA 2DQRA 1XDUA 4A2UA 1XGSA 4ESJA 2Y75A 2DQLA 2VBZA 5K5QA 3V7CA 3EUHA 3HSFA 5F6FA 1B9NA 2QYOA 1T6SA 2MH2A 1O7LA 1S29A 1R23A 1YW9A 4NB5A 1X3UA 2XAQA 4LK0F 2QBYA 2L54A 2IJLA 3FXRA 4Z2YA 3MZYA 2K27A 1BOAA 1MJ9A 5ICCA 4P5OA 1K79A 4B09A 3DPTA 4DQ2A 5D5XB 3V7SA 3M9AA 2NRAC 3T8RA 1XSVA 1KQ0A 1USTA 2ZKZA 4WXCA 2LF7A 4UVCA 3JAMZ 4WWCA 2VODA 1GVJA 3WGIA 3P9KA 5HLIA 1EV7A 2K4BA 1W7PA 2FNPA 3R4KA 4RGRA 1XN7A 5D6FA 3DV8A 4XLPF 1WKMA 5D5WB 3GZ6A 1IF1A 3MEXA 1JHHA 1LVAA 1W4MA 3G3ZA 3I54A 3ROUA 4WCGA 1QGPA 3J80Z 3RKYA 1U8RA 4UV9A 2RVCA 4G7HF 2O0YA 1TTYA 1KGSA 3PQJA 3L09A 3RPQA 2ACJA 4H0EA 2DPUA 4EMSA 2GA1A 4YFKF 5LEJA 2PG4A 5LRSA 2ZJ2A 1GHCA 2PFBA 2MLGA 1P2FA 3DEUA 5TRDA 1IXCA 1JE8A 3SHFA 1I1SA 4HF1A 2W25A 4S05A 1LDJA 2BV6A 3J81K 2NYXA 1IN8A 2DK8A 3IC7A 3ZN1A 4TV7A 4PZJA 4OIPF 3FM3A 3E5UA 5D8KB 4UXNA 5FD6A 5EEHA 3WTSC 1KU7A 3FMQA 2JZYA 1IZ1A 1MJAA 4NHJA 4KN7X 2HS5A 1HQCA 1H9GA 1UFMA 1XCVA 1UHMA 4I2OA 3TDUC 4Q5SF 2IA1A 4RB3C 3WTXC 5IT3A 2HOEA 1P4WA 1MDMB 2M30A 4ENNA 5LHGA 2A3SA 2VBXA 2QVOA 1U3EM 3E97A 4LB5A 1H0MA 2P5KA 2OQGA 2FMYA 4ESFA 4PDKA 3M1EA 1XD7A 1DPRA 2W24A 4R8HA 1TQMA 4A0XA 5E1ZB 1YG2A 5JVTA 4LB6B 4HF0A 3QU3A 2CSOA 1GXPA 2ZCWA 3BROA 2RGVA 1W5SA 1ZN2A 1BC8C 3T8TA 5KK1A 4XBFA 4O3MA 5AIQA 4PGHA 2EK5A 4LFUA 3WTVC 2HFHA 5J6XA 3V8KA 3VFZA 3ZMUA 3GVAA 2XUBA 2W85A 1B59A 2RN7A 1JXSA 4HDUA 3F8CA 3RYRA 1MDMA 5FLXK 3I58A 3KEOA 2BBYA 1WQ2A 3SZPA 3BY6A 1U5TC 4A5MA 1XMAA 2XIGA 2Z3YA 1JGSA 4RB0A 1DDNA 4KIBA 4KDPA 1RNLA 1FPQA 3C1DA 4EM2A 5D4SA 4RAYA 1ZG5A 4G6QA 2OZ6A 3TGNA 4AIKA 2ZBKA 3HYIA 4UVBA 3RKXA 1R36A 3ZMTA 1QO0D 1BC7C 2XAHA 4YIFA 2YU3A 1ZAOA 2RNJA 3IRQA 1W7PD 1O3SA 2FSWA 4HYEA 1RI7A 5DUIA 1PDNC 1IN4A 1OYYA 2A69F 3PQKA 2FQ3A 5ERIA 3T5XA 2BGCA 1ZH5A 1FBQA 1G3WA 3CJNA 1L3LA 5LGUA 3EYIA 4M72A 4Q47A 3LWFA 3MWMA 2J5PA 2K02A 4M73A 2EV5A 2FXAA 2ESHA 3HUGA 2PMHA 4CXFA 4L5JA 5FB2A 3KCCA 3GX4X 2H94A 5CYVA 1OR7A 4EGYA 3BP8A 4OINF 2W84A 3E6MA 2STWA 5D4RA 3ABUA 4KFCA 5E17F 2XVCA 5ICEA 2PQ8A 4AVPA 5J8CA 1EH6A 4WX9A 3M7GA 2VBYA 2ADUA 1F1ZA 2VONA 3LA7A 1CGPA 4KYWA 3B73A 3C3WA 2DT5A 2IPQX 2EFOA 1YFHA 3GLXA 3BJAA 1JHFA 2GIVA 1V4RA 2LDUA 3IWFA 1YS6A 4NQWA 3NEUA 5CJ9A 3QAHA 2QBYB 1ZRDA 1OKRA 3FM5A 4GCVA 3RKWA 3I59A 4BXUA 5E1XA 2K86A 1FBSA 1DPUA 5A2QK 1BIBA 2GWRA 4U0YA 3RI4A 2ZNZA 3QP6A 2X4HA 1Z1DA 1BIAA 1D3YA 3BWGA 2HTSA 3MQ0A 2OQRA 5FO5A 2CGPA 3J81Z 3FXQA 4ZYEA 5HVQC 4HX4A 5HS7A 1D8JA 1FLIA 3F6OA 2GQQA 3U2RA 1KA8A 1R1TA 4LMYA 2P7CB 3JSPA 3SZTA 2YPRA 1ZGJA 5A2QZ 4LG0A 2ISZA 4HV6A 2FBIA 3KP4A 2ZFWA 1XGMA 3MZHA 4KMFA 1HW2A 4HF2A 3IWZA 6PAXA 2EFWA 1AWCA 3SXYA 1Z91A 1ZARA 1U5TA 2GZWA 1OYIA 1E17A 1GXQA 4M9XA 3LA3A 4IVNA 3DXJF 4I7HA 2P8TA 4GYGA 2V79A 2V1DA 3ML6A 1O57A 4IJAA 3E6BA 4A6DA 4WXHA 2ISYA 1R5HA 1B9MA 4IHTA 3O3KA 3RIRA 1J0RA 1Z05A 2XKPA 3H3ZA 5L3CA 4KMUX 4WXDA 2FBHA 1WI9A 5H6RA 2BEOA 1P92A 5ILVA 4ZYGA 2ESNA 4AWXB 2CO5A 5CVVA 3REOA 3TOAA 3BJOA 4A5NA 1KU3A 3RJPA 3V8LA 1G3YA 3LQRA 4Y15A 4LGWA 3VODA 2XAGA 5BS6A 1HW1A 2FBKA 2RKHA 3DF8A 2RC4A 4L9NA 4CICA 2MLKA 4HQEA 3F3XA 2ZNYA 2MH9A 2PBIA 2R7DA 4RAZA 5EEGA 1PUEE 5LHHA 4OIRF 1J75A 4L5IA 3W6JB 1J7KA 1ULYA 3R6SA 4U0VA 2A68F 3KLOA 1QNTA 3O2PE 4I0BA 3HRSA 4EJTA 3K9TA 2DAOA 4M71A 2TDXA 1R1UA 4LLNA 5IT9Z 1YTYA 2L3DA 3F22A 1HSTA 3F8MA 2EV0A 1FC3A 2OAZA 3DFGA 1W7PB 4OU0A 1KU9A 4HDVA 4O5VA 3L9FA 1QZYA 1OYWA 1F9NA 4G7ZF 5E8GA 1IUYA 4MEYF 2E7WA 4KNYA 2WWYA 3GFIA 1C0WA 1Z6TA 4ESBA 2YSRA 1LNWA 2RV8A 4GO1A 1YW7A 5DV5A 4HOBA 1FYKA 1B1BA 1OMIA 3KP2A 1G3SA 3CO6C 5JR3A 1HXDA 2G7HA 2OBPA 3GFJA 2KJCA 1HW5A 2BYVE 4F7ZA 1ONVA 3G73A 1FOKA 3R0JA 3LSTA 5L3DA 3FMSA 2PI0A 4N0BA 5BMZA 5AONA 3HOSA 1UCRA 3WGHA 1YLFA 2FMLA 4BHPA 2IA2A 4GYIA 1ON1A 1FY7A 3U9GA 3J80K 1RZ4A 1TLHB 3H3UA 3V4GA 3DKWA 5K1YA 2OZUA 4EM1A 4MTDA 4EJUA 3BPVA 1Z6RA 3WTWC 2DW4A 2HKOA 4KIGA 4G6DA 2VT2A 4GGGA 4L9JA 1SD6A 2O3FA 2L4MA 3COAC 2HYFA 3TO6A 1SD5A 5HS9A 4L0YB 3CUQB 1HSJA 3C7JA 5JI6A 2CW0F 4A12A 2NNNA 4K2EA 2M87A 3LAJA 3GYHX 5F64A 1J2XA 4N9HA 4YFXF 5ED4A 2JPBA 2OD5A 1SMYF 4EM0B 4BHBA 4XSXF 1F4KA 1HKSA 2DBBA 2Z99A 3ZPLA 1B6AA 3T1BA 5JHUA 1V3FA 3FWEA 4P55A 2Y48A 4LK1F 2P6TA 1BI1A 3WTYC 2HEOA 2QWWA 2DPDA 4FX0A 5FD5A 1G3TA 2FOKA 4IF4A 4BAYA 2D45A 2QZ8A 3I59B 1EH7A 2ZXJA 2WC2A 3KZZA 2RDPA 3JW4A 2XKOA 1XCBA 2A61A 3E6DA 4YIIA 1U78A 1XGOA 1STZA 2IT0A 3TOBA 3GWZA 1BI2A 5HDKA 5ICGA 5FFXA 1PP7U 2KRFA 4P9UA 4IRGA 2D1VA 3MCZA 4OMZA 4HV5A 5AIPA 2O61A 3WU1B 1BI0A 3N4MA 4LLLA 3NRVA 3BPXA 1BM9A 2LSOA 1IAWA 1KYWA 5BPIA 3HRMA 1R00A 4PGGA 4ASNA 4MTEA 1XMKA 1K7AA 3ERED 1IRFA 1ZLJA 1U2WA 4CZZA 3F6VA 3F23A 3JAMK 1Y0UA 4D0PA 5L3BA 2Q0OA 2V1UA 2XGXA 2IP2A 2RQPA 2VE8A 5L3EA 2BE5F 5CVJA 1RIOH 1MZBA 1KQ8A 2CWEA 2X0LA 2JSCA 1KYZA 2HR3A 2IVMA 1P4AA 3IL2A 1E2XA 3MFKA 1LB2A 4RB1A 2E1CA 2Z9OA 4CYDA 4B8XA 1FSHA 4L18B 5LRRA 4JBAA 2FA5A 2WTEA 2QQBA 3HIFA 2HTJA 2KKOA 1FNNA 3LAPA 5E1WA 4HW0A 1I5ZA 2UZKA 4I02A 2CQKA 2MD5A 1S6LA 4IRHA 3K1MA 3ELKA 4LLGF 2EFNA 4BH9A 3CUQC 3CUQA 2OU2A 1MJBA 4XRFA 1G4DA 1F5TA 4MEXF 3ULQB 4U0WA 2HKXA 3GEZA 5D5UB 3VOEA 3WGGA 3TKYA 4JK1X 5FGMA 1SMTA 3WTTC 2KJBA 4Y17A 1S7AA 4OMYA 2HZTA 2HDCA 1K78A 5JFRA 4A0ZA 1YO5C 3WTZA 2XAFA 4R79A 3K69A 1TW3A 4HLXA 3QRFF 2ZMEA 3IRRA 5DCFA 1DP7P 3KP6A 2JPCA 4O6JA 5LLQA 4EGZA 1WRJA 2FE3A 2H09A 3HHGA 3ZN0A 2FEZA 3CLOA 3D0SA 3GFMA 4Y13A 3TO9A 2PN6A 3QP5A 4EQQA 4ON0A 4RGSA 2IRFG 5KVRA 2LNBA 1S7OA 1VTNC 3F8NA 1I1GA 1HBXG 1HKQA 3RTRA 1OPCA 1Q1HA 3CO7C 5F1RA 3E5XA 3J7AO 3EQLF 2HGCA 3BZ6A 3N97A 5FFZA 1P6RA 3TQNA 3HSEA 4MGRA 1EH8A 4MNUA 5L3FA 1P4XA 1SD4A 2F5FA 1S8NA 2KIFA 4BYYA 3QPHA 5DCMA 3KP3A 3VEPA 2ZO4A 3K1NA 3TDZC 3IHUA 1ZLKA 2EFPA 2M8EA 2VT3A 3CUOA 5LHIA 1T0FA 4FX4A 3TO7A 4YFNF 1XB4A 1ZRFA 3CTAA 1YQAA 2CYYA 1Z7UA 3I64A 2GA2A 2K4JA 3HHHA 1MKMA 1O3QA 3WG9A 3WODF 3RDIA 1TNSA 1LQ1A 3JTHA 4OIQF 3R0AA 4M74A 3H92A 4KN4X 3V7RA 2VOOA 3IKVA 2VOPA 3KE2A 4RB2C 2DTRA 5D5VB 3WE3A 1WSUA 2MC3A 4E70A 3F8BA 3K2ZA 5BPDA 2PEXA 2V6CA 3P7NA 2R7FA 5LBQA 2F5CA 2NAZA 3HSRA 1I6XA 3KETA 3EETA 4KA4A 2HWVA 1QPMA 3GO5A 4LJZF 4IPAA 2F2EA 5CLSA 2DO7A 2EB7A 4R1HA 3E5QA 1XSXA 1HKTA 3FHZA 4CHUA 4QLCU 2VN2A 2F5DA 2A6EF 3EYYA 5CVRA 2MBFA 3AAFA 2KIUA 1D8KA 2E1NA 2QQAA 3Q9VA 4MQ9F 4HX7A 4ZYHA 1O7FA 3ZQ7A 2CG4A 1FP1D 1MGTA 2ZMEB 3DPLC 3HOTA 5ICFA 3SFZA 2JT1A 4Q4ZF 4FHTA 2Q8KA 1BN5A 5BQTA 2PLYA 3HTUA 4EJOA 5DEQA 3DP7A 3WU0A 1ZG3A 1SFEA 1H9TA 3QU6A 4AD9A 1IXRC 4ZH4F 2D1HA 3ZMDA 5E18F 2LF8A 1T38A 3KFWX 1RUNA 2O8XA 1XSDA 2UXXA 1UB9A 3W6KB 1O3TA 1IN5A 4EVIA 2O03A 4BNCA 1FYLA 5ILUA 4KT5C 1K6OA 2A5YB 4EJVA 1DUXC 3IKTA 2P7VB 1AOYA 4QWQA 1S3JA 4L0ZB 1L0OC 1ON2A 4ZZLA 5HLHA 1SFUA 3HRTA 2FNAA 1BBYA 1W5TA 2DI3A 1YS7A 2K7LA 3NQOA 2M5WA 1A04A 3ABTA 3C18A 3B02A 1BJAA 3FF5A 2G7UA 4U7DA 4HQMA 5TJJA 2C6YA 2FF4A 2L02A 1REPC 3L2CA 1SFXA 4FT8A 2P6SA 3BJ6A 2VE9A 4A6EA 2YR2A 1IN7A 3Q5FA 2YX4A 2D2WA 5DUKA 3Q9SA 5HDGA 2F5EA 1CF7A 4IXAA 4KIFA 3L7WA 3KP5A 4UUVA 4IHSA 3GW2A 3K1PA 4UHTA 2ETHA 5CVUA 1FSEA 1QZZA 2M45A 3GZ5A 1R5GA 4JQFA 1UHWA 2QLZA 3HTSB 4HX8A 2QENA 3DQVC 2VC0A 1IRGA 2HQRA 1LDKB 1SAXA 4ENJA 5L3GA 3F21A 1ZG1A 3T0YA 3E3VA 2FU4A 3ECOA 3WE2A 5DCMB 2QM3A
chains in the Genus database with same CATH superfamily
1BW5A 3X2QH 1XC5A 3HDDA 5HLGA 2PX9A 4PJJA 2CQ7A 3TL4X 4BQAA 5B3SH 2HVSA 2L7KA 4DBQA 3QPTA 3BDDA 3K70C 1R1VA 3G71I 2H6CA 2NS0A 2E71A 4IO9F 2VBWA 5J47A 5EGOA 2MA3A 3RYPA 2L4AA 2V9VA 3D5RC 2P5VA 3H36A 3QWLA 5H20A 2M1BA 3K0LA 1FZPB 3H1CA 4WF2A 2PJPA 1DGWY 1TBXA 1QRYA 4I0AA 2E7XA 1T98A 1LUJB 2OA4A 3GBGA 1ZQ3P 2ELHA 3CCVI 3MZ8A 1X2MA 3JRIA 2X1DA 4M6YA 2FD5A 1I6HJ 3M8JA 1MH3A 2XHKA 1ZELA 1TT0A 4ZYDA 2EPFA 4JX5A 4GXOA 1YX3A 4NNJA 4LG3A 4QIWN 3QOPA 1KQ9A 4S04A 2E2HJ 1R71A 2E5ZA 3GMEA 3U1KA 3RCOA 2XROA 1X3ZB 3GF2A 2XRNA 4RGXA 4PJLA 2J5OA 4JYKA 1FP2A 2CUEA 2W00A 1JUMA 4I98B 4I76A 2VQGA 4ENMA 1FJLA 2E1MB 4OOIA 2V1XA 5LEKA 2F4OB 2QEXI 3CCLI 3R60A 1HBXG 3I4PA 3FMRA 5H6QA 4DNCA 2X6YA 2VUMJ 1YYVA 3JTGA 2JTVA 2I10A 2ZJRF 2ME6A 4JP0A 4ETSA 3I5UA 2WV0A 5K5OA 2R7QA 3HXLA 3IH2A 5DYMA 3I9V2 4HSRA 5B5EC 3I53A 1YIOA 4CSWA 1OCCH 4RAFA 5DD8A 2EA4A 4BEHA 2QUFA 2H27A 2A6TA 3DTIA 3S16J 4KICA 4I01A 2XV4S 3K2AA 2H8WA 4C9YA 1ZYRF 1ETQA 2V9PA 4HLYA 5JVGF 1X1CA 1T39A 3HM5A 1V54H 3Q0VA 2LLKA 3LSJA 4OIOF 3BTLA 4BQQA 4M6XA 5K5RA 5HS8A 3O6BB 1BJZA 4MHGA 3H0GJ 3FIWA 3MKLA 3OYNA 3DKXA 2XF6A 1I50J 1QHHD 3EDPA 3M8EA 1ZREA 1ETOA 1RKTA 3K4LA 1UHSA 5FKLA 3KYCB 1TW2A 5D6EA 1Y6IA 3ISPA 3ZMVA 3WU2C 3S2HJ 3BCAA 1R7JA 3I0TA 1Z9CA 1W0TA 1T8IA 3DEWA 2VKEA 3L00A 4AIJA 1ZRCA 3JRAA 2STTA 2WV1A 1BL0A 1W5CC 4ITVA 1B4AA 1CF7B 2R5ZA 1TWFJ 4P9FA 4HBLA 4XN3A 2CQXA 1LFPA 1FIAA 3FBIB 4FASD 4RAGA 4AIHA 5HDNA 2Z33A 1IXSB 1BR1A 1T2KA 5BOXA 5JLXA 1TNTA 3LSIA 1AHDP 1OCPA 2GXAA 2CQQA 3PFYA 1U6GA 4KUMA 2BHYA 4EV0A 3ZMSA 2O7OA 1HOMA 4NQWB 2EFQA 1VFCA 4CGZA 3L2QA 2QQ9A 4MQVA 4D7NA 1YHQI 1ZKGA 1D0XA 2VXZA 2WY7Q 2Z5UA 4BDYA 3F72A 1FWZA 1YW8A 4FETA 2EJRA 2K85A 3CJRB 4RLFA 3E6CC 4WK8F 1G8XA 2K5CA 5KAIC 4U7BA 1D5VA 3WTUC 3H5NA 3TEDA 2AXLA 1MMAA 1ZHFA 3S2DJ 4D5CA 2ZXWH 3ECHA 4I09A 3KP7A 2DK5A 2L01A 3ABLH 5DD4A 4M9ZA 3HKZN 4E7SA 1ETVA 4XSZF 3GFLA 3GUDA 1K4SA 3FXUA 5E3NA 5FLXZ 4XIDA 2FRHA 3DBLB 1D1AA 2PMUA 1YJWI 5B66C 2CFXA 1MD0A 2KIMA 5HOOA 1WWXA 3ZMZA 4G94A 3OOPA 2NNYA 4Q48A 3ZRGA 1H8AC 5D8LB 3A1YA 2XPUA 4BHCA 2XSJC 2JRTA 2GXBA 5FKOA 4IRIA 1J9IA 2DFIA 3KEQA 3IV5A 3GXOA 1J59A 2EV6A 2AS5F 4CYCB 2A07F 1TP4A 3V8JA 5B1AH 3FHNA 2EWNA 3FZVA 2HOAA 3H9QA 2Y2ZA 2HYJA 3CCJI 3L2RA 3OS2A 4B3XA 4LD5A 3FBNB 4AVZA 3HG9A 3VB2A 3HRUA 3IUOA 3PFIA 3CDHA 4MO7A 1T0FC 1IRZA 2YX7A 1F36A 4B44A 2Q2EA 5J8FA 3A03A 2GAUA 1IDYA 4PCQA 5IT9K 2UXNA 5K7FA 2NVQJ 4A3MJ 3DU6A 1UG2A 2H6BA 2XASA 4ZZDA 4U87A 1IW7F 2W57A 3AG4H 2P5LC 2R7ZJ 4EJWA 2VC1A 3BG6A 1XDSA 3MN2A 3P9CA 2VI6A 4IQJA 4NC7A 3CCMI 5F0HA 1LDDA 1O3RA 3H35A 1TQPA 3HC7A 2MD0A 4I6ZA 2O6GE 3JSOA 4IL6C 4DOZA 5EG0A 2COMA 1YRNA 1LJ9A 1BI3A 5LGNA 1Y1WJ 1RUOA 2R3SA 4UV8A 4RGUA 3SQNA 4X6AJ 3NARA 2CJJA 2DLLA 3GTOJ 5CVIA 5DM7F 2UWMA 1QQIA 1FOXA 1D0ZA 2CH0A 4X1EA 2X85A 3CCUI 1LEAA 2A6HF 2KPMA 5DDGA 2GXGA 4ENKA 4RA2A 1G6NA 1TQIA 3RQIA 4QPQA 2KQRA 5EEAA 2ICWG 4L9TA 3BT9A 1IGNA 1N75A 2PJRA 3QPSA 1FTTA 3ZP5A 4YG2F 3SJMA 4X0GA 4MLOA 4HZFA 4G8XA 1X1AA 2EA2A 1P9QC 3Q0WA 1FYMA 1SD7A 1ORKA 1VZ0A 2P4WA 4UVAA 2IW5A 3RKQA 3KZYA 2KDOA 4C2TA 4HA8A 3LQQA 2L9RA 1ZGAA 1UJ8A 2JQ7A 5E3MA 4PFOA 3ZQGA 1J5YA 1MNMC 1HCRA 1NHAA 2HQNA 1R58A 3LA2A 1XGNA 2RREA 3P5JA 4JX6A 2IA0A 5F0CA 1HDDC 3U1DA 3I3LA 3RPUA 2BY3A 2L7FP 4U88A 2EINH 5EDNA 2XAJA 2MW8A 4J01A 2B0LA 5IOYA 3F8FA 4G7OF 5IYBJ 1U5TB 4HAMA 4DZJA 3OV8A 1IN6A 4Y4RA 5FKMA 5M3MJ 3S2WA 4BJTA 2P81A 4MFDA 2COBA 1FX7A 1KU2A 3GTKJ 4F3QA 2NS7A 3FXLA 4L9VA 3H5AA 4RS8A 3I71A 2KIQA 3P9IA 4XR6A 2MC4A 4IKFA 1LEBA 2KL4A 3KPHA 4LG0B 3M8FA 3M07A 3JRHA 1USSA 4XLNF 1R22A 4M9SA 3DTKA 4N9IA 3CESA 3FX3A 2XRLA 2RNGA 2G9WA 4CO8A 4CDGA 1U0JA 1PP8F 3CCRI 2HI3A 4B43A 3BOQA 3R61A 1JKOC 4M3GA 5E20A 5E8IA 1SFOJ 3W2VA 2IS2A 1T08B 3KZIC 3LFKA 2Y0MA 4L5EA 1FBUA 4BKXA 2DOAA 5HODA 1K78B 5ILSA 5K7HA 1WH7A 4A0YA 2HYGD 1ODDA 5LGTA 1I27A 1FT9A 4N4NB 2LMDA 2VQCA 4UNOA 2JRMA 3F9KA 4XLAA 4HNVA 2LKPA 2MG4A 2HXIA 2KMUA 4JOMA 3D5LA 3H9GA 3MAJA 1QBJA 3LOCA 2DU9A 2XDVA 4G9YA 3KLNA 4P96A 2DQRA 1XDUA 2WB1A 4A93J 5EZHA 4A2UA 1WGXA 3HOXJ 3DLLF 1N78A 3DWLE 1XGSA 4A69C 1JGGA 4ESJA 2Y75A 2DQLA 2VBZA 5K5QA 3OYDA 4BE1A 2VPLA 3V7CA 2DMPA 4A3EJ 3EUHA 4ZDOA 3HSFA 5F6FA 5FLVA 1B9NA 2QYOA 1T6SA 2MH2A 1H88C 4FTHA 1RR7A 2XSDC 1O7LA 1S29A 1R23A 1YW9A 2Y0SN 4NB5A 4GFBA 1YOVB 1X3UA 2XAQA 4EEFG 2FJ1A 4KJZA 4LK0F 2QBYA 2L54A 4N4OB 1X58A 4ZDLA 2L9SA 2IJLA 2Z1DA 5J4YA 3OIOA 3FXRA 4F93B 4NC6A 4BU2A 4Z2YA 3MZYA 3K7AJ 3WHBA 3PNVA 2K27A 1BOAA 4BXXJ 2M8GX 1I39A 1VQ4I 3HOUJ 1JUPA 1MJ9A 2BVLA 5ICCA 1X4PA 3K4CA 1HLVA 4P5OA 2V4JC 1K79A 1MNEA 1NTCA 1MIJA 4B09A 3VPRA 3DPTA 4DQ2A 5D5XB 3V7SA 1I3AA 3HPHA 3KX2A 3M9AA 2NRAC 3T8RA 1ENHA 2HXOA 1XSVA 1KQ0A 1USTA 2V6EA 1RKWA 2ZKZA 2JMWA 4WXCA 1LFBA 2LF7A 1S7EA 4UVCA 3JAMZ 1Y8RB 4WWCA 2VODA 1WPKA 1GVJA 3WGIA 2K40A 3P9KA 1YJNI 3HOWJ 2VJIA 5HLIA 4B3AA 1EV7A 2K4BA 3AL0B 2VLAA 1W7PA 2FNPA 3FXOA 3R4KA 4RGRA 5IY5H 2OTJI 1XN7A 5D6FA 3DV8A 1V5GA 1OFCX 4XLPF 1WKMA 5D5WB 3GZ6A 1X19A 1VF9A 1IF1A 3MEXA 4NDLA 1JHHA 1LVAA 1W4MA 3G3ZA 3HGGA 3I54A 5B1BH 3ROUA 4WCGA 1QGPA 3J80Z 2VPRA 4E7JA 3S1RJ 3RKYA 1U8RA 1LE8A 4UV9A 2RVCA 4RM3A 3FXJA 4DGWB 1NG7A 2DDBA 4G7HF 2O0YA 1TTYA 1KGSA 3BZCA 3PQJA 3L09A 3RPQA 2ACJA 4H0EA 1KZHA 2DPUA 3HOZJ 4EMSA 2OCEA 2GA1A 1RR8C 5KNLA 2VQHA 2A5WA 3PIOF 4YFKF 5LEJA 2PG4A 5LRSA 2M0MA 2ZJ2A 1JJ6C 1GHCA 2PFBA 1B72B 2VJ5A 2MLGA 4HRIA 1P2FA 3DEUA 3O8GA 1B8IA 5TRDA 1JT6A 5EG0B 1YIJI 1IXCA 1JE8A 3GTJJ 3SHFA 1VQPI 1I1SA 1QA6A 3S3OA 2ZXHA 4HF1A 2W25A 4S05A 4XK4A 1N25A 1MNDA 4FISA 1LDJA 1MMDA 2BV6A 4S0HB 3NAUA 3MKWB 2R0QC 3J81K 2NYXA 1IN8A 2KDZA 2DK8A 2EQRA 3S1MJ 3TBIA 3IC7A 4OWRB 2GOMA 3G4SI 3BZKA 5HNFA 3ZN1A 4TV7A 4PZJA 2D5VA 2E5NA 4OIPF 1HDPA 3FM3A 3E5UA 2B7EA 5D8KB 4UXNA 5DTDA 4FQGA 5FD6A 2DYRH 1R5ID 5EEHA 3WTSC 5GPCA 1JKQC 1KU7A 3FMQA 2R7OA 2JZYA 3C2GA 3GCMA 2HDWA 2Y9YA 1MBFA 1IZ1A 1MJAA 4NHJA 4KN7X 2HS5A 4AYBA 1HQCA 1H9GA 1IRXA 1UFMA 2WAQN 1XCVA 1UHMA 4Y7NJ 4I2OA 3TDUC 1MH4A 2X1CA 4Q5SF 4XKCA 4A3DJ 2IA1A 4QSHA 3PJRA 4RB3C 3WTXC 1JI8A 5IT3A 2WAEA 2LRDA 5K7ZA 2RQQA 2HOEA 1P4WA 1MDMB 3JRDA 1FMWA 3CF2A 2M30A 3KYDB 4ENNA 5LHGA 2A3SA 2VBXA 2O9LA 2QVOA 1U3EM 3E97A 3CP2A 4LB5A 1H0MA 3A01A 1R4NB 2P5KA 5GAHJ 1E0EA 2FQ4A 2OQGA 3ZOBA 2ZJPF 2LD5A 2FMYA 1WH5A 1R9TJ 4ESFA 4PDKA 3CQZJ 2ID6A 3M1EA 1XD7A 2BY0A 1DPRA 2W24A 1OCOH 4R8HA 1TQMA 2HNHA 4A0XA 5E1ZB 1YG2A 5FKKA 5JVTA 4LB6B 1GV5A 4HF0A 3SZGA 3B6AA 3HEFA 3E1SA 2W7NA 2LYCA 3QU3A 1VQ6I 2VQLA 2CSOA 3AKZA 1GXPA 3OYIA 2ZCWA 3BROA 2RGVA 1W5SA 1ZN2A 3ONQA 2CV2A 4BJ5C 4E6KG 1BC8C 3T8TA 4PJMA 1TC3C 5KK1A 4XBFA 4O3MA 5AIQA 4PGHA 2AXTC 2ELKA 3H3VK 1R4MB 2EK5A 1MBHA 4LFUA 3WTVC 3ABKH 4ANJA 2HFHA 2WAQA 5J6XA 3V8KA 3VFZA 3ZMUA 2R7XA 3GVAA 4EATA 3K10A 2XUBA 2W85A 2WA0A 1S5LC 5HNHA 1B59A 3VYTB 2RN7A 2JVHA 1JXSA 4HDUA 2V26A 3F8CA 3RYRA 2DT7B 5M5XJ 1SC7A 5JHFA 1MDMA 4G12A 5FLXK 3I58A 1VQMI 3KEOA 4LITA 2BBYA 2R7VA 1WQ2A 3SZPA 3OYFA 3HOYJ 3BY6A 1U5TC 4A5MA 1XMAA 2XIGA 1E3OC 2Z3YA 1JGSA 1ETWA 3UKGA 4A3BJ 1TWCJ 4RB0A 1DDNA 4KIBA 1RNLA 1FPQA 4KDPA 3DLAA 2XPVA 2PMZA 3N05A 2DMQA 3C1DA 4EM2A 5D4SA 1SANA 4RAYA 1ZG5A 4G6QA 4DW6A 2OZ6A 2BY2A 4BGDA 4RM2A 3TGNA 3KYLA 4AIKA 1Y8QB 2ZBKA 2XF5A 3HYIA 4UVBA 3RKXA 1R36A 5GADJ 3CCQI 2VJ4A 1ZR4A 4XOTA 4B1RA 3ZMTA 3JRCA 2NOGA 1S72I 2LP0A 3K70D 1QO0D 1BC7C 3S15J 2XAHA 4YIFA 4PFPA 2YU3A 1ZAOA 2RNJA 3BR5A 3IRQA 4CCOA 1W7PD 3H5RA 1O3SA 1GLNA 2BW3B 3CDLA 3TW7A 2FSWA 4HYEA 3IP4B 3TMOA 1Z21A 1RI7A 4II2A 3Q3SA 5FRNA 3M4OJ 2M3AA 5DUIA 1PDNC 1IN4A 1OYYA 4E7LA 4RLQA 4BS9A 2A69F 3PQKA 2FQ3A 5ERIA 3T5XA 2BGCA 4A3JJ 1ZH5A 1FBQA 1G3WA 3CJNA 4F55A 1L3LA 5LGUA 3EYIA 4A3CJ 1TWGJ 2UV1A 4M72A 4Q47A 3LWFA 2K9MA 3MWMA 1M1EB 1B72A 2HOTA 4BJ6C 2HDDA 2MGQA 1WVRA 2J5PA 5CQGA 2K02A 3CCSI 4M73A 2EV5A 2FXAA 2ESHA 1K4TA 2V1NA 3HUGA 4BXFA 2PMHA 2ZJQF 1EKEA 3S8PA 2DMNA 1D0YA 4CXFA 5EF6A 4L5JA 1FEXA 1AU7A 2QSHX 5FB2A 3KCCA 3GX4X 5GTHC 2H94A 5CYVA 2EZLA 1OR7A 4F52A 4EGYA 2E1OA 2OC6A 3KIOA 2F5VA 3BP8A 4OINF 2W84A 3E6MA 2STWA 3OYAA 5D4RA 2BXZA 4MIMA 3ABUA 2DTZA 1Y56A 4KFCA 1PYVA 4C3JJ 3HZJA 2PJRB 5E17F 2XVCA 3S17J 5ICEA 2EIKH 2PQ8A 2LKSA 1A31A 4AVPA 5J8CA 1EH6A 4WX9A 3CC2I 1WI3A 1OISA 3M7GA 2DA6A 2VBYA 4D9JA 2ADUA 1WJBA 4XL9A 5F1JA 1F1ZA 5LD2C 2VONA 3LL7A 1Q1VA 2DA1A 3LA7A 2K9NA 3HKZA 5IPAA 1CGPA 1NG6A 1ETXA 5KCMA 3B73A 3C3WA 4XLCA 4KYWA 1X2NA 2IXSA 1SEUA 4J00A 3G2BA 2DT5A 2IPQX 3LSHA 3HPGA 4AC0A 3RQ4A 2BW3A 2F48A 1VQOI 2EFOA 1YFHA 2EIJH 1MW7A 2ZFUA 3GLXA 1WJAA 3BJAA 1JHFA 3HB9A 2LH9A 3FKJA 3M3YJ 2GIVA 1P7IA 2ME0A 1A35A 3QODA 3U21A 1D1CA 1V4RA 2LDUA 3JREA 2BHZA 3IWFA 3QOEA 5FJ8J 1YS6A 4NQWA 3NEUA 5CJ9A 3SYTA 3QAHA 2QBYB 2GIZA 1T33A 1ZRDA 1WHUA 4PSXA 1OKRA 3FM5A 4GCVA 3RKWA 2CS3A 3B6CA 2N8GA 3I59A 4ABZA 3NWTA 4BXUA 3OYEA 5E1XA 2K86A 5GP9A 1FBSA 2M7AA 2CU7A 4AIDA 1LKXA 1NK3P 1DPUA 3J7YJ 3O8HA 2CV0A 3BR2A 1BIBA 2GWRA 5A2QK 4U0YA 3I4NJ 5IOZA 3RI4A 2ZNZA 3QP6A 2X4HA 2DXIA 1Z1DA 3OYBA 1FIPA 1BIAA 3BG9A 1D3YA 3BWGA 1OCZH 3ZQIA 2B63J 1FOWA 2HPIA 2HTSA 3MQ0A 3K4NA 1VQKI 2ECCA 2OQRA 5FO5A 1ERDA 2CGPA 3J81Z 3FXQA 5GAEJ 4ZYEA 5HVQC 4HX4A 1TWHJ 5HS7A 1D8JA 1WJ5A 2MABA 1TL8A 2LREA 1IJWC 1FLIA 3F6OA 2GQQA 1XS9A 1PUFB 1JUSA 4XKVA 3U2RA 1KA8A 1R1TA 2X6WA 4LMYA 2P7CB 4BEHB 3JSPA 3BR6A 3SZTA 2YPRA 2O5RA 1ZGJA 5A2QZ 4LG0A 2X9DA 4BL0B 2ISZA 2CQNA 4HV6A 2FBIA 3KP4A 2ZFWA 1XGMA 5IP7J 3MZHA 4KMFA 1HW2A 4YELA 1GDTA 4HF2A 3IWZA 2ECBA 6PAXA 3GZNB 2EFWA 1AWCA 3SXYA 2R5YB 3LSGA 1Z91A 1ZARA 2R7TA 5F27A 1U5TA 2GZWA 5CQEA 1S9HA 1OYIA 1E17A 1GXQA 4M9XA 3LA3A 1GT0C 4IVNA 2DFHA 2LTPA 3DXJF 1VQ7I 4I7HA 4LOCA 2P8TA 4GYGA 2B9SA 2KLOA 2EZKA 4NBQA 2V79A 4A3LJ 2V1DA 3ML6A 1O57A 4IJAA 3E6BA 4V2GA 4A6DA 2EBIA 4WXHA 2ISYA 1R5HA 1W36C 3OYMA 2M4KA 1CQTA 1B9MA 4IHTA 3O3KA 3RIRA 1J0RA 1Z05A 2XKPA 3H3ZA 4UY8I 3AG2H 4IQ4A 3BTIA 2K9SA 4UUTA 5L3CA 4KMUX 4WXDA 3CJTB 2FBHA 3RPUD 3SFIA 2ZSIB 4C3HJ 1WI9A 5H6RA 5F0FA 2R7RA 2G0EA 2BEOA 1P92A 5ILVA 4XICA 3FXKA 1Z67A 2K3PA 2CW7A 2ZSHB 3SEQA 3SDBA 2XPWA 4ZYGA 2KZGA 3TW6A 2ESNA 4AWXB 2CO5A 5CVVA 3REOA 5E3LA 3PSIA 3TOAA 3BJOA 4A5NA 1KU3A 2IEKA 3RJPA 1XPXA 3V8LA 1B8IB 2Y9ZA 1G3YA 3LQRA 4Y15A 4A3GJ 2ZMEC 2HVRA 3JRFA 9ANTA 4BQOA 4LGWA 3SEZA 2LY1A 3VODA 2JK3A 2M9HA 1N77A 2XAGA 1WJEA 5BS6A 1HW1A 1RRJA 2FBKA 3BG7A 2RKHA 2EIMH 3DF8A 4DBRA 2OCCH 2RC4A 4IHYA 3HL2A 4L9NA 4CICA 5LFAA 3FK7A 2MLKA 3G1LA 4HQEA 3OYKA 3BR0A 3F3XA 3RZOJ 2ZNYA 3I56I 2MH9A 3DCFA 4M3FA 4XRSA 2PBIA 2R7DA 1GUUA 5CPRB 2K3FA 4RAZA 5EEGA 2DJNA 1PUEE 3OIPA 2IS6A 2IGKA 5LHHA 2JA8J 2L5QA 4OIRF 1J75A 1MBJA 3LMMA 4M6VA 1YI2I 4L5IA 3VDXA 3W6JB 1J7KA 1ULYA 3R6SA 3LSRA 1BA5A 4CYCA 4U0VA 2A68F 3G1OA 3K4BA 3KLOA 1QNTA 4E7IA 3O2PE 4I0BA 3HRSA 4EJTA 3K9TA 2DAOA 3RSNA 4M71A 2DFEA 2FX0A 2JUGA 3GTPJ 1XMXA 2TDXA 1QVUA 1R1UA 1SVMA 4LLNA 5IT9Z 1YTYA 2K9LA 4IZZA 2L3DA 3F22A 1POGA 1HSTA 2WY8Q 3F8MA 2EV0A 3S3NA 2KZVA 1FC3A 1EF4A 2OAZA 2DOFA 3DFGA 2H8RA 3CMMA 2NVYJ 1W7PB 4OU0A 1KU9A 2F4MB 2W4SA 3J7ZI 4HDVA 3W2AA 4O5VA 2IS1A 5EJCA 5C44J 1I3QJ 3L9FA 2ELJA 2DCEA 1QZYA 2I8DA 2VJJA 4CCLA 2H1LA 1OYWA 1ETKA 1F9NA 3DTEA 1OJLA 4XKBA 4G7ZF 2QA4I 5E8GA 1IUYA 4MEYF 2E7WA 4C2UA 1XTAA 4KNYA 2O8KA 2XAUA 2WWYA 1FTZA 3GFIA 2QKLB 4PK4A 1C0WA 1Z6TA 2QF7A 2W48A 5JLWA 3S32A 3W2WA 5M5YJ 2PMZN 4ESBA 1H89C 1DP3A 2L7MP 2R92J 2YSRA 1LNWA 1TT5B 4D1QA 2RV8A 4GO1A 4D7MA 4Y3OA 4HNUA 1X3WB 3AFHA 1YW7A 3G1MA 5DV5A 4HOBA 1FYKA 4GRIA 1B1BA 2OTLI 5GAGJ 3JCUC 1OMIA 2BOLA 3E0JB 2LR8A 3KP2A 1G3SA 3CO6C 5JR3A 4XLEA 1HXDA 1MBKA 3LFUA 1WCMJ 4ZJZA 1MMSA 2G7HA 2OBPA 3GFJA 2KJCA 1HW5A 3OL4A 2BYVE 4DYRA 3C2BA 4F7ZA 4CCKA 1ONVA 1IV8A 3G73A 1FOKA 3R0JA 1JJ8C 3LSTA 3MD2A 5L3DA 3BQYA 3E7LA 3FMSA 4N0BA 2PI0A 1XG1A 5BMZA 2UUZA 4G6TB 5AONA 2KT0A 1P7JA 1YJ9I 3HOSA 1UCRA 3WGHA 1DU0A 3BCBA 1YLFA 2FMLA 2HU9A 4BHPA 2IA2A 4GYIA 2M34A 1ON1A 5J1YA 1FY7A 3U9GA 3J80K 1RZ4A 1TLHB 1SVOA 3H3UA 2DA3A 3V4GA 3DKWA 5K1YA 2OZUA 4EM1A 4MTDA 4EJUA 3OYGA 2XGCA 3BPVA 1Z6RA 3WTWC 3CMYA 1JKPC 2V9KA 5J4VA 2H1KA 2DW4A 4BY7J 2HKOA 4KIGA 2KRCA 4G6DA 3L2VA 2VT2A 4GGGA 4L9JA 4KITB 2M0CA 1SD6A 2O3FA 2L4MA 2CUJA 1YE9A 3COAC 2HYFA 3TO6A 1SD5A 1OLTA 4C3IJ 5HS9A 4L0YB 1WJDA 3CUQB 1HSJA 3C7JA 2CV1A 1WJCA 1JTXA 4IOCF 1NK2P 4PJ0C 3VSLA 5JI6A 3MKZA 2NVXJ 2JA6J 2CW0F 2IBDA 4A12A 3ZQCA 2OJED 2NNNA 4K2EA 3KEYA 1QHGA 2M87A 4OAYA 3ZCOA 3LAJA 2R7WA 2TRTA 3GYHX 2LY2A 4XM3A 5F64A 1J2XA 4N9HA 4YFXF 5ED4A 2JPBA 4IEJA 4ZTJA 2OD5A 1SMYF 3HGYA 3VYSB 4MFEA 4EM0B 4BHBA 4Y33A 1Z3XA 3OS0A 1Z3YA 4W97A 4XSXF 1F4KA 1IDZA 2CUZA 1HKSA 2DBBA 2Z99A 3ZPLA 2WBMA 1B6AA 3T1BA 5JHUA 3L2UA 1OCTC 2AHQA 1V3FA 2CRGA 3FWEA 3PUFA 2F4IA 4KISA 3S14J 4BY1J 2JA2A 2ZB9A 3CC4I 4P55A 2Y48A 4BBRJ 1ZK8A 4LK1F 1FOYA 2XC7A 1YRNB 3CF5F 1UMQA 2WAFA 4V2FA 2P6TA 1BI1A 3ASOH 3WTYC 4J19A 2VKHA 3OS1A 2HEOA 2QWWA 1IO2A 2QGUA 2DPDA 3Q0UA 4FX0A 3K4MA 5FD5A 3AG3H 1G3TA 2FOKA 2L2OA 3EUAA 4IF4A 4BAYA 4RDUA 2D45A 1RESA 4H4KC 2NVTJ 3K6GA 2QZ8A 3I59B 2AQEA 1EH7A 1VNDA 2ZXJA 4DJAA 2WC2A 2LK2A 3BTJA 3KZZA 2RDPA 3JW4A 2XKOA 1XCBA 2A61A 2LG4A 3E6DA 4YEJA 4YIIA 5E79C 1U78A 2YUSA 1XGOA 2M4GA 3EUHC 2L9VA 2BXYA 1STZA 5H2FC 3CP8A 2IT0A 1AKHA 3FK6A 3TOBA 2Q2EB 2JA7J 3GWZA 1BI2A 4LIVA 4BUPA 5HDKA 5ICGA 3I4MJ 3QYFA 5FFXA 3W3CA 5J3LA 1PP7U 2KRFA 2VXDA 4P9UA 2KRHA 3LNQA 2W1OA 2ZC2A 4IRGA 2D1VA 2X48A 4UB6C 3MCZA 4OMZA 4HV5A 5AIPA 2O61A 2HOSA 3WU1B 2QSFX 1U9OA 3PO2J 1BI0A 3UR3C 3N4MA 4LLLA 3NRVA 3BPXA 2HVQA 1BM9A 2LSOA 3FXMA 1IAWA 1MMGA 1KYWA 5BPIA 4IOAF 3HRMA 3PIPF 1R00A 4PGGA 4ASNA 4MTEA 1XMKA 1K7AA 3L1PA 3RZDJ 1RC9A 3D1NI 1EJ9A 4JX4A 3ERED 1IRFA 2CMPA 1ZLJA 3PM1A 2F6CA 3ABMH 1U2WA 2E2JJ 4CZZA 2Y0SA 3F6VA 3JAMK 3F23A 1Y0UA 4D0PA 2JUCA 5L3BA 2Q0OA 2V1UA 2XGXA 2IP2A 1KONA 2VE8A 2RQPA 5M3FJ 5L3EA 2BE5F 5CVJA 4CCMA 1MZBA 1RIOH 2XGDA 3CD6I 4BBSJ 1KQ8A 3I55I 2CWEA 2X0LA 2ZXIA 2R5YA 1BW6A 2JSCA 1KYZA 2DYSH 2MYSA 2HR3A 2MSYA 2LKXA 1ZGWA 2IVMA 1P4AA 2Q1ZB 3IL2A 1E2XA 3MFKA 4QTRA 1LB2A 3GTQJ 4RB1A 1EA3A 2E1CA 2Z9OA 1K83J 4CYDA 4Z6YA 4B8XA 1FSHA 4L18B 1SVLA 5LRRA 4JBAA 2FA5A 4B47A 1MSFC 2WTEA 2QQBA 3HIFA 3HOVJ 3ASNH 2HTJA 1Y1VJ 2KKOA 1FNNA 3LAPA 5E1WA 4HW0A 1I5ZA 2UZKA 4I02A 3QYEA 2CQKA 1G2HA 2MD5A 3A0HC 1S6LA 4IRHA 2JSPA 3ELKA 3K1MA 4LLGF 2EFNA 2IGOA 4M3EA 4A3FJ 3LSPA 1X4OA 4BH9A 2KP6A 3CUQC 3CUQA 1UAAA 2OU2A 3MKYB 3V42A 1MJBA 4XRFA 4BE0A 1F5TA 1G4DA 2GLOA 1QVTA 2Y31A 3UNGC 2V7FA 4ZYAA 4MEXF 3ULQB 1ACIA 4U0WA 2HKXA 3GEZA 5D5UB 1RPWA 3VOEA 3WGGA 4JK1X 3TKYA 1V5EA 5FGMA 3OL3A 1SMTA 2LFBA 3WTTC 1APLC 2KJBA 2M2EA 3BLYA 4DZPA 2WB1N 4A3IJ 4B48A 4Y17A 4RMNA 3FKIJ 1S7AA 5IP6A 3ERMA 1T56A 5EGOB 1ZR2A 1A5JA 4OMYA 1MMNA 2HZTA 2HDCA 1K78A 1HC8A 5JFRA 4A0ZA 5J40A 1YO5C 3WTZA 2XAFA 4CCJA 3QPLA 4R79A 3K69A 3TP0A 2HZDA 1MBGA 4XOPA 5FROA 2NXNB 1TW3A 4HLXA 3QRFF 2ZMEA 2QSGX 3IRRA 5DCFA 4DYQA 2ID3A 1DGRM 2VKVA 3WHCA 1DP7P 1LVKA 3KP6A 2JPCA 1Z77A 4O6JA 2DA2A 5LLQA 4EGZA 1XX5A 2DN0A 4UUSA 4ZDPA 3OSGA 3OR2C 2DFFA 1LFUP 1WRJA 2FE3A 1K6YA 1X1BA 2H09A 2FEZA 2QCOA 3CLOA 3HHGA 3ZN0A 3S1QJ 3D0SA 3OMYA 2XB5A 4E7HA 3BTCA 3GFMA 4Y13A 2L0KA 2CUFA 2X1EA 3TO9A 3ZGKA 2PN6A 4BQNA 2R93J 3QP5A 2HPMA 4EQQA 2HQAA 2HQ5A 2EZHA 4ON0A 2GOXB 2VIXA 4RGSA 1QZEA 2E35A 2IRFG 4XNFA 2AQFA 4YRVA 5KVRA 2LNBA 1R6RA 3GLLA 1S7OA 1VTNC 3DBRB 3F8NA 1OR7C 2DA4A 5F04A 1VI0A 1I1GA 3K4JA 3DU5A 4UUSB 2GBYA 3LSKA 1HKQA 1DQUA 1OPCA 2NVUB 1Q1HA 3RTRA 1U8BA 5IP9J 3CO7C 2VASA 5F1RA 1PUFA 4FE7A 3VYUB 3E5XA 3PUBA 4E7KA 1PJRA 2BZTA 1SAUA 1TZLA 3J7AO 3EQLF 2HGCA 2CFOA 3BZ6A 3N97A 2IGNA 4XORA 4F92B 4DIQA 5FFZA 2BVMA 3QYBA 3DBHB 4P1WA 1P6RA 3A01B 3TQNA 2DT6A 3OIQA 2KFDA 4LIUA 3HSEA 3CCEI 4MGRA 1EH8A 4MNUA 4D5FA 5L3FA 2JA5J 2EZIA 2A05A 1P4XA 4QPOA 1SD4A 2JN6A 4PJNA 4FCYA 4PSWA 2F5FA 1S8NA 2KHMA 2KIFA 4OAZA 4BYYA 3QPHA 1A6QA 5DCMA 3JR9A 5C3EJ 1WZ2A 2VL8A 3OWTA 3KP3A 3VEPA 2ZO4A 3K1NA 3TDZC 4YIRX 5C4JJ 3DKYA 3OYLA 3VYRB 2DA5A 3IHUA 4XRMA 2EFPA 1ZLKA 2M8EA 2VT3A 2E34A 3CUOA 1QPIA 5LHIA 1T0FA 3BC8A 4FX4A 2DMTA 1U9NA 4HSTA 5C4XJ 3QQAA 3TO7A 2JWTA 4HPQA 4YFNF 1XB4A 1ZRFA 3CLQA 2W82A 1YQAA 2CYYA 2MFZA 3CTAA 4I99C 4C30A 1Z7UA 1ITYA 4M3DA 3I64A 4B4CA 2GA2A 3J7AY 2K4JA 1MSEC 3HHHA 1MKMA 1G59A 3OOUA 1O3QA 1AKHB 3BR3A 5CKTA 1VQNI 3WG9A 3WODF 3RDIA 5KAFC 3GTMJ 1Y0NA 4XKWA 2AO9A 1TNSA 1LQ1A 3JTHA 4OIQF 3R0AA 4PUSA 1VQLI 4M74A 3S1NJ 1V55H 1K61A 3H92A 2E2IJ 2EH3A 4UB8C 1QU3A 4KN4X 2LVSA 3V7RA 2VOOA 1X1PA 5TGTA 3CC7I 2QQ8A 2WADA 2R4GA 3IKVA 5J1UA 4IHWA 2VOPA 3KE2A 2E60A 4Y52J 2LC2A 3CMAI 2XB0X 3D5SC 4RB2C 2DTRA 5D5VB 1GV2A 3IAS2 3WE3A 3LSMA 4A3KJ 2MC3A 1WSUA 4E70A 3F8BA 1IUFA 2IGMA 5FKNA 3K2ZA 5BPDA 1JKRC 2YS9A 3NWSA 4V19K 4BDZA 3A4CA 2PEXA 2V6CA 3P7NA 3S93A 4CCNA 2R7FA 5LBQA 4DYCA 1WFXA 4HNTA 4AUXA 3L2WA 2F5CA 5BNGA 2IS4A 2NAZA 1F43A 3HSRA 3BG3A 1I6XA 4ZTFA 4E7ZA 3KETA 1BR4A 1LE8B 2Y69H 3CCYA 1Z0XA 2HWVA 3EETA 4KA4A 1WJFA 5TISC 1QPMA 4IHVA 2L9NA 1GVDA 1RETA 4II3A 4CUGA 4KT6A 3GO5A 2JVGA 5KHDA 3CJQB 4LJZF 1UELB 1BOBA 4IPAA 2F2EA 5CLSA 3ZXSA 2DO7A 4FE4A 2EB7A 4R1HA 3E5QA 2R5ZB 3ZQQA 1XSXA 1HKTA 3FHZA 4CHUA 2DA7A 4QLCU 5IYDJ 2VN2A 4GDFA 3OR1C 2OV7A 3JRBA 2F5DA 2A6EF 3EYYA 1Y39A 5CVRA 5HLTA 2MBFA 3AAFA 1OCRH 2EILH 3WG7H 3PNTA 1HA8A 2KIUA 1D8KA 1YITI 4NUBA 4IHXA 3G6EI 3AG1H 2E1NA 2QQAA 3Q9VA 5DS9A 3EUKL 1ZTRA 2XGEA 2LY9A 4MQ9F 2OF7A 4HX7A 4ZYHA 2OUMA 2YU9J 1O7FA 4CA0A 2BY1A 3ZQ7A 2K9QA 2CG4A 1FP1D 1W0UA 1E3PA 1MGTA 2ZMEB 3DPLC 3EPZA 2CW8A 2IAIA 3IH3A 3HOTA 5FRMA 5ICFA 3SFZA 1VQ9I 1D5YA 2JT1A 2VKDA 4XLHA 4Q4ZF 4FHTA 2Q8KA 1BN5A 2DJIA 5BQTA 1E3HA 2PLYA 3HTUA 1TWAJ 4EJOA 3IAM2 3MVPA 5DEQA 1JT0A 3A0BC 3DP7A 3WU0A 1ZG3A 2E1MC 3PNYA 3AL0C 4XMYA 4F91B 1SFEA 1H9TA 3QU6A 4AD9A 1IXRC 3ESWB 5F08A 1JTYA 3PSFA 4RBOA 4XONA 3W6VA 4ZH4F 2D1HA 2DMUA 1R49A 3ZMDA 1AA7A 5E18F 1O4XA 2LF8A 1T38A 5EYRA 3KFWX 1RUNA 5GPAA 1DU6A 2O8XA 1NH3A 5IYCJ 2X6OA 2XF7A 1XSDA 2QKMB 2UXXA 1UB9A 4CZCA 3W6KB 3ZQLA 1O3TA 1IN5A 3GTGJ 4AU7A 4EVIA 4IX7A 4BE2A 2NS8A 2DODA 2O03A 4BNCA 3BQZA 2TCTA 1PVEA 1LPQA 1FYLA 4W1UA 1OQYA 2Y30A 5ILUA 3JRGA 4KT5C 1K6OA 2FUG2 2A5YB 1X1DA 2I5UA 1W36D 3FISA 4EJVA 5DM6F 3OY9A 1VQ5I 1DUXC 3IKTA 3VWBA 2FOWA 3FDYA 2P7VB 1AOYA 4BACA 4QWQA 1S3JA 4XRSG 2LBFA 3CDIA 2DOEA 4L0ZB 1L0OC 4XQFA 1UZCA 1ON2A 4ZZLA 5HLHA 3A02A 1Z7LA 1ETYA 3TP3A 1SFUA 3OSFA 3HRTA 3MMYB 3IH4A 2FNAA 2VB6A 4XN0A 1BBYA 1W5TA 2OPTA 2DI3A 1IC8A 1YS7A 2K7LA 3NQOA 2Z16A 5E3OA 3CZ6A 3ZR8X 3CMEI 3PO3J 2R7SA 2M5WA 1A04A 3ABTA 2NOJB 3C18A 1J09A 1VQ8I 3B02A 1BJAA 2KISA 1T95A 2GM4A 4E4HA 3F0CA 3FF5A 3ZQFA 2G7UA 3A2KA 4U7DA 3GTLJ 2JJ7A 5J1RA 4HEA2 4AYBN 4HQMA 3OYCA 2E36A 5TJJA 2C6YA 1W1WE 2FF4A 2LOOA 2L02A 4C2MJ 1REPC 3L2CA 1V5FA 3ZQHA 3K4KA 1SFXA 1YX5A 2E19A 4FT8A 1MBEA 2P6SA 3BJ6A 1IG7A 2VE9A 2X51A 2LBFB 4A6EA 2YR2A 4M3BA 1IN7A 3Q5FA 2YX4A 1UG0A 2D2WA 2X6XA 3H9JA 5DUKA 3HJEA 3Q9SA 1D1BA 1BR2A 3HBLA 3PL8A 5HDGA 3C2HA 2F5EA 3HUGB 2P0WA 4NC8A 3M1CA 4IXAA 5FLMJ 3OYJA 3H0DA 1CF7A 3OYHA 4KIFA 3L7WA 3KP5A 4UUVA 1SFKA 1IV6A 4IHSA 3GW2A 3K1PA 4UHTA 2ETHA 1A36A 5CVUA 1FSEA 1QZZA 2DDAA 2M45A 3GZ5A 4CH7A 1R5GA 3BG5A 2R7UA 4AM3A 4JQFA 1UHWA 5M5WJ 5GTIC 2QLZA 3DPUA 3HTSB 4HX8A 2QENA 3DEEA 2VC0A 3DQVC 4XLFA 2HQRA 1IRGA 1LDKB 3SDGA 4HG2A 5EZGA 2L7ZA 1SAXA 1HF0A 3S3MA 2RAEA 4ENJA 5L3GA 3F21A 4ZC3A 2Z2SB 1FMVA 2M7BA 1ZG1A 3T0YA 3BR1A 3E3VA 2FU4A 1A6IA 3ECOA 3WE2A 5DCMB 2QM3A 3VSKA
chains in the Genus database with same CATH topology
5HLGA 4BQAA 3QPTA 3BDDA 1R1VA 2H6CA 2NS0A 2VBWA 2MA3A 3RYPA 2L4AA 2V9VA 2P5VA 5H20A 2M1BA 3K0LA 1FZPB 4WF2A 2PJPA 1TBXA 4I0AA 2E7XA 1T98A 2OA4A 2ELHA 4M6YA 2XHKA 4ZYDA 4GXOA 3QOPA 1KQ9A 4S04A 2XROA 3GF2A 2XRNA 4RGXA 2J5OA 1FP2A 4I98B 4ENMA 4OOIA 2V1XA 5LEKA 3R60A 3I4PA 3FMRA 5H6QA 4DNCA 1YYVA 3JTGA 2JTVA 4ETSA 3I5UA 2WV0A 5K5OA 5DYMA 3I53A 1YIOA 5DD8A 2H27A 2EA4A 2QUFA 4KICA 4I01A 2XV4S 1ZYRF 4HLYA 1T39A 4OIOF 5K5RA 4M6XA 5HS8A 3O6BB 4MHGA 3EDPA 3M8EA 1ZREA 1TW2A 5D6EA 3ISPA 3ZMVA 1R7JA 3I0TA 1Z9CA 3L00A 2STTA 4AIJA 1ZRCA 1B4AA 1CF7B 4P9FA 4HBLA 4AIHA 5HDNA 2Z33A 1IXSB 1T2KA 5BOXA 1TNTA 1U6GA 4KUMA 4EV0A 3ZMSA 2EFQA 4CGZA 2QQ9A 4MQVA 2VXZA 2Z5UA 3F72A 1FWZA 1YW8A 2EJRA 3E6CC 4WK8F 4U7BA 1D5VA 3WTUC 2AXLA 1ZHFA 3ECHA 4I09A 3KP7A 2DK5A 2L01A 5DD4A 4M9ZA 4XSZF 3GFLA 3GUDA 3FXUA 5FLXZ 2FRHA 2PMUA 2CFXA 1MD0A 2KIMA 5HOOA 1WWXA 3ZMZA 4G94A 3OOPA 2NNYA 4Q48A 5D8LB 4BHCA 2JRTA 2GXBA 1J9IA 4IRIA 2DFIA 3KEQA 3GXOA 1J59A 2EV6A 2AS5F 2A07F 3V8JA 2EWNA 3FZVA 4LD5A 3VB2A 3HRUA 3PFIA 3CDHA 2YX7A 2Q2EA 5J8FA 2GAUA 4PCQA 5IT9K 2UXNA 2XASA 2H6BA 4ZZDA 2P5LC 1IW7F 2W57A 4EJWA 2VC1A 1XDSA 3P9CA 1LDDA 1O3RA 1TQPA 2O6GE 3JSOA 2COMA 1LJ9A 1BI3A 5LGNA 1RUOA 2R3SA 4UV8A 4RGUA 3SQNA 2DLLA 5CVIA 2UWMA 1QQIA 1LEAA 2A6HF 4ENKA 5DDGA 2GXGA 1G6NA 1TQIA 4L9TA 3ZP5A 4YG2F 4HZFA 4G8XA 2EA2A 1FYMA 1SD7A 2P4WA 4UVAA 2IW5A 3KZYA 4HA8A 3LQQA 1ZGAA 1J5YA 1NHAA 2HQNA 1R58A 3LA2A 1XGNA 2IA0A 3U1DA 3RPUA 4U88A 2XAJA 2B0LA 3F8FA 4G7OF 1U5TB 4HAMA 3OV8A 1IN6A 3S2WA 1FX7A 1KU2A 4L9VA 4RS8A 3I71A 3P9IA 1LEBA 4LG0B 3M8FA 1USSA 4XLNF 1R22A 4M9SA 4N9IA 3FX3A 2G9WA 4CO8A 4CDGA 1PP8F 3BOQA 3R61A 5E8IA 5E20A 3LFKA 2Y0MA 1FBUA 1K78B 5ILSA 4A0YA 2HYGD 1ODDA 5LGTA 1I27A 1FT9A 4UNOA 2LKPA 3D5LA 1QBJA 3MAJA 2DU9A 4G9YA 4P96A 3KLNA 2DQRA 1XDUA 4A2UA 1XGSA 4ESJA 2Y75A 2DQLA 2VBZA 5K5QA 3V7CA 3EUHA 3HSFA 5F6FA 1B9NA 2QYOA 1T6SA 2MH2A 1O7LA 1S29A 1R23A 1YW9A 4NB5A 1X3UA 2XAQA 4LK0F 2QBYA 2L54A 2IJLA 3FXRA 4Z2YA 3MZYA 2K27A 1BOAA 1MJ9A 5ICCA 4P5OA 1K79A 4B09A 3DPTA 4DQ2A 5D5XB 3V7SA 3M9AA 2NRAC 3T8RA 1XSVA 1KQ0A 1USTA 2ZKZA 4WXCA 2LF7A 4UVCA 3JAMZ 4WWCA 2VODA 1GVJA 3WGIA 3P9KA 5HLIA 1EV7A 2K4BA 1W7PA 2FNPA 3R4KA 4RGRA 1XN7A 5D6FA 3DV8A 4XLPF 1WKMA 5D5WB 3GZ6A 1IF1A 3MEXA 1JHHA 1LVAA 1W4MA 3G3ZA 3I54A 3ROUA 4WCGA 1QGPA 3J80Z 3RKYA 1U8RA 4UV9A 2RVCA 4G7HF 2O0YA 1TTYA 1KGSA 3PQJA 3L09A 3RPQA 2ACJA 4H0EA 2DPUA 4EMSA 2GA1A 4YFKF 5LEJA 2PG4A 5LRSA 2ZJ2A 1GHCA 2PFBA 2MLGA 1P2FA 3DEUA 5TRDA 1IXCA 1JE8A 3SHFA 1I1SA 4HF1A 2W25A 4S05A 1LDJA 2BV6A 3J81K 2NYXA 1IN8A 2DK8A 3IC7A 3ZN1A 4TV7A 4PZJA 4OIPF 3FM3A 3E5UA 5D8KB 4UXNA 5FD6A 5EEHA 3WTSC 1KU7A 3FMQA 2JZYA 1IZ1A 1MJAA 4NHJA 4KN7X 2HS5A 1HQCA 1H9GA 1UFMA 1XCVA 1UHMA 4I2OA 3TDUC 4Q5SF 2IA1A 4RB3C 3WTXC 5IT3A 2HOEA 1P4WA 1MDMB 2M30A 4ENNA 5LHGA 2A3SA 2VBXA 2QVOA 1U3EM 3E97A 4LB5A 1H0MA 2P5KA 2OQGA 2FMYA 4ESFA 4PDKA 3M1EA 1XD7A 1DPRA 2W24A 4R8HA 1TQMA 4A0XA 5E1ZB 1YG2A 5JVTA 4LB6B 4HF0A 3QU3A 2CSOA 1GXPA 2ZCWA 3BROA 2RGVA 1W5SA 1ZN2A 1BC8C 3T8TA 5KK1A 4XBFA 4O3MA 5AIQA 4PGHA 2EK5A 4LFUA 3WTVC 2HFHA 5J6XA 3V8KA 3VFZA 3ZMUA 3GVAA 2XUBA 2W85A 1B59A 2RN7A 1JXSA 4HDUA 3F8CA 3RYRA 1MDMA 5FLXK 3I58A 3KEOA 2BBYA 1WQ2A 3SZPA 3BY6A 1U5TC 4A5MA 1XMAA 2XIGA 2Z3YA 1JGSA 4RB0A 1DDNA 4KIBA 4KDPA 1RNLA 1FPQA 3C1DA 4EM2A 5D4SA 4RAYA 1ZG5A 4G6QA 2OZ6A 3TGNA 4AIKA 2ZBKA 3HYIA 4UVBA 3RKXA 1R36A 3ZMTA 1QO0D 1BC7C 2XAHA 4YIFA 2YU3A 1ZAOA 2RNJA 3IRQA 1W7PD 1O3SA 2FSWA 4HYEA 1RI7A 5DUIA 1PDNC 1IN4A 1OYYA 2A69F 3PQKA 2FQ3A 5ERIA 3T5XA 2BGCA 1ZH5A 1FBQA 1G3WA 3CJNA 1L3LA 5LGUA 3EYIA 4M72A 4Q47A 3LWFA 3MWMA 2J5PA 2K02A 4M73A 2EV5A 2FXAA 2ESHA 3HUGA 2PMHA 4CXFA 4L5JA 5FB2A 3KCCA 3GX4X 2H94A 5CYVA 1OR7A 4EGYA 3BP8A 4OINF 2W84A 3E6MA 2STWA 5D4RA 3ABUA 4KFCA 5E17F 2XVCA 5ICEA 2PQ8A 4AVPA 5J8CA 1EH6A 4WX9A 3M7GA 2VBYA 2ADUA 1F1ZA 2VONA 3LA7A 1CGPA 4KYWA 3B73A 3C3WA 2DT5A 2IPQX 2EFOA 1YFHA 3GLXA 3BJAA 1JHFA 2GIVA 1V4RA 2LDUA 3IWFA 1YS6A 4NQWA 3NEUA 5CJ9A 3QAHA 2QBYB 1ZRDA 1OKRA 3FM5A 4GCVA 3RKWA 3I59A 4BXUA 5E1XA 2K86A 1FBSA 1DPUA 5A2QK 1BIBA 2GWRA 4U0YA 3RI4A 2ZNZA 3QP6A 2X4HA 1Z1DA 1BIAA 1D3YA 3BWGA 2HTSA 3MQ0A 2OQRA 5FO5A 2CGPA 3J81Z 3FXQA 4ZYEA 5HVQC 4HX4A 5HS7A 1D8JA 1FLIA 3F6OA 2GQQA 3U2RA 1KA8A 1R1TA 4LMYA 2P7CB 3JSPA 3SZTA 2YPRA 1ZGJA 5A2QZ 4LG0A 2ISZA 4HV6A 2FBIA 3KP4A 2ZFWA 1XGMA 3MZHA 4KMFA 1HW2A 4HF2A 3IWZA 6PAXA 2EFWA 1AWCA 3SXYA 1Z91A 1ZARA 1U5TA 2GZWA 1OYIA 1E17A 1GXQA 4M9XA 3LA3A 4IVNA 3DXJF 4I7HA 2P8TA 4GYGA 2V79A 2V1DA 3ML6A 1O57A 4IJAA 3E6BA 4A6DA 4WXHA 2ISYA 1R5HA 1B9MA 4IHTA 3O3KA 3RIRA 1J0RA 1Z05A 2XKPA 3H3ZA 5L3CA 4KMUX 4WXDA 2FBHA 1WI9A 5H6RA 2BEOA 1P92A 5ILVA 4ZYGA 2ESNA 4AWXB 2CO5A 5CVVA 3REOA 3TOAA 3BJOA 4A5NA 1KU3A 3RJPA 3V8LA 1G3YA 3LQRA 4Y15A 4LGWA 3VODA 2XAGA 5BS6A 1HW1A 2FBKA 2RKHA 3DF8A 2RC4A 4L9NA 4CICA 2MLKA 4HQEA 3F3XA 2ZNYA 2MH9A 2PBIA 2R7DA 4RAZA 5EEGA 1PUEE 5LHHA 4OIRF 1J75A 4L5IA 3W6JB 1J7KA 1ULYA 3R6SA 4U0VA 2A68F 3KLOA 1QNTA 3O2PE 4I0BA 3HRSA 4EJTA 3K9TA 2DAOA 4M71A 2TDXA 1R1UA 4LLNA 5IT9Z 1YTYA 2L3DA 3F22A 1HSTA 3F8MA 2EV0A 1FC3A 2OAZA 3DFGA 1W7PB 4OU0A 1KU9A 4HDVA 4O5VA 3L9FA 1QZYA 1OYWA 1F9NA 4G7ZF 5E8GA 1IUYA 4MEYF 2E7WA 4KNYA 2WWYA 3GFIA 1C0WA 1Z6TA 4ESBA 2YSRA 1LNWA 2RV8A 4GO1A 1YW7A 5DV5A 4HOBA 1FYKA 1B1BA 1OMIA 3KP2A 1G3SA 3CO6C 5JR3A 1HXDA 2G7HA 2OBPA 3GFJA 2KJCA 1HW5A 2BYVE 4F7ZA 1ONVA 3G73A 1FOKA 3R0JA 3LSTA 5L3DA 3FMSA 2PI0A 4N0BA 5BMZA 5AONA 3HOSA 1UCRA 3WGHA 1YLFA 2FMLA 4BHPA 2IA2A 4GYIA 1ON1A 1FY7A 3U9GA 3J80K 1RZ4A 1TLHB 3H3UA 3V4GA 3DKWA 5K1YA 2OZUA 4EM1A 4MTDA 4EJUA 3BPVA 1Z6RA 3WTWC 2DW4A 2HKOA 4KIGA 4G6DA 2VT2A 4GGGA 4L9JA 1SD6A 2O3FA 2L4MA 3COAC 2HYFA 3TO6A 1SD5A 5HS9A 4L0YB 3CUQB 1HSJA 3C7JA 5JI6A 2CW0F 4A12A 2NNNA 4K2EA 2M87A 3LAJA 3GYHX 5F64A 1J2XA 4N9HA 4YFXF 5ED4A 2JPBA 2OD5A 1SMYF 4EM0B 4BHBA 4XSXF 1F4KA 1HKSA 2DBBA 2Z99A 3ZPLA 1B6AA 3T1BA 5JHUA 1V3FA 3FWEA 4P55A 2Y48A 4LK1F 2P6TA 1BI1A 3WTYC 2HEOA 2QWWA 2DPDA 4FX0A 5FD5A 1G3TA 2FOKA 4IF4A 4BAYA 2D45A 2QZ8A 3I59B 1EH7A 2ZXJA 2WC2A 3KZZA 2RDPA 3JW4A 2XKOA 1XCBA 2A61A 3E6DA 4YIIA 1U78A 1XGOA 1STZA 2IT0A 3TOBA 3GWZA 1BI2A 5HDKA 5ICGA 5FFXA 1PP7U 2KRFA 4P9UA 4IRGA 2D1VA 3MCZA 4OMZA 4HV5A 5AIPA 2O61A 3WU1B 1BI0A 3N4MA 4LLLA 3NRVA 3BPXA 1BM9A 2LSOA 1IAWA 1KYWA 5BPIA 3HRMA 1R00A 4PGGA 4ASNA 4MTEA 1XMKA 1K7AA 3ERED 1IRFA 1ZLJA 1U2WA 4CZZA 3F6VA 3F23A 3JAMK 1Y0UA 4D0PA 5L3BA 2Q0OA 2V1UA 2XGXA 2IP2A 2RQPA 2VE8A 5L3EA 2BE5F 5CVJA 1RIOH 1MZBA 1KQ8A 2CWEA 2X0LA 2JSCA 1KYZA 2HR3A 2IVMA 1P4AA 3IL2A 1E2XA 3MFKA 1LB2A 4RB1A 2E1CA 2Z9OA 4CYDA 4B8XA 1FSHA 4L18B 5LRRA 4JBAA 2FA5A 2WTEA 2QQBA 3HIFA 2HTJA 2KKOA 1FNNA 3LAPA 5E1WA 4HW0A 1I5ZA 2UZKA 4I02A 2CQKA 2MD5A 1S6LA 4IRHA 3K1MA 3ELKA 4LLGF 2EFNA 4BH9A 3CUQC 3CUQA 2OU2A 1MJBA 4XRFA 1G4DA 1F5TA 4MEXF 3ULQB 4U0WA 2HKXA 3GEZA 5D5UB 3VOEA 3WGGA 3TKYA 4JK1X 5FGMA 1SMTA 3WTTC 2KJBA 4Y17A 1S7AA 4OMYA 2HZTA 2HDCA 1K78A 5JFRA 4A0ZA 1YO5C 3WTZA 2XAFA 4R79A 3K69A 1TW3A 4HLXA 3QRFF 2ZMEA 3IRRA 5DCFA 1DP7P 3KP6A 2JPCA 4O6JA 5LLQA 4EGZA 1WRJA 2FE3A 2H09A 3HHGA 3ZN0A 2FEZA 3CLOA 3D0SA 3GFMA 4Y13A 3TO9A 2PN6A 3QP5A 4EQQA 4ON0A 4RGSA 2IRFG 5KVRA 2LNBA 1S7OA 1VTNC 3F8NA 1I1GA 1HBXG 1HKQA 3RTRA 1OPCA 1Q1HA 3CO7C 5F1RA 3E5XA 3J7AO 3EQLF 2HGCA 3BZ6A 3N97A 5FFZA 1P6RA 3TQNA 3HSEA 4MGRA 1EH8A 4MNUA 5L3FA 1P4XA 1SD4A 2F5FA 1S8NA 2KIFA 4BYYA 3QPHA 5DCMA 3KP3A 3VEPA 2ZO4A 3K1NA 3TDZC 3IHUA 1ZLKA 2EFPA 2M8EA 2VT3A 3CUOA 5LHIA 1T0FA 4FX4A 3TO7A 4YFNF 1XB4A 1ZRFA 3CTAA 1YQAA 2CYYA 1Z7UA 3I64A 2GA2A 2K4JA 3HHHA 1MKMA 1O3QA 3WG9A 3WODF 3RDIA 1TNSA 1LQ1A 3JTHA 4OIQF 3R0AA 4M74A 3H92A 4KN4X 3V7RA 2VOOA 3IKVA 2VOPA 3KE2A 4RB2C 2DTRA 5D5VB 3WE3A 1WSUA 2MC3A 4E70A 3F8BA 3K2ZA 5BPDA 2PEXA 2V6CA 3P7NA 2R7FA 5LBQA 2F5CA 2NAZA 3HSRA 1I6XA 3KETA 3EETA 4KA4A 2HWVA 1QPMA 3GO5A 4LJZF 4IPAA 2F2EA 5CLSA 2DO7A 2EB7A 4R1HA 3E5QA 1XSXA 1HKTA 3FHZA 4CHUA 4QLCU 2VN2A 2F5DA 2A6EF 3EYYA 5CVRA 2MBFA 3AAFA 2KIUA 1D8KA 2E1NA 2QQAA 3Q9VA 4MQ9F 4HX7A 4ZYHA 1O7FA 3ZQ7A 2CG4A 1FP1D 1MGTA 2ZMEB 3DPLC 3HOTA 5ICFA 3SFZA 2JT1A 4Q4ZF 4FHTA 2Q8KA 1BN5A 5BQTA 2PLYA 3HTUA 4EJOA 5DEQA 3DP7A 3WU0A 1ZG3A 1SFEA 1H9TA 3QU6A 4AD9A 1IXRC 4ZH4F 2D1HA 3ZMDA 5E18F 2LF8A 1T38A 3KFWX 1RUNA 2O8XA 1XSDA 2UXXA 1UB9A 3W6KB 1O3TA 1IN5A 4EVIA 2O03A 4BNCA 1FYLA 5ILUA 4KT5C 1K6OA 2A5YB 4EJVA 1DUXC 3IKTA 2P7VB 1AOYA 4QWQA 1S3JA 4L0ZB 1L0OC 1ON2A 4ZZLA 5HLHA 1SFUA 3HRTA 2FNAA 1BBYA 1W5TA 2DI3A 1YS7A 2K7LA 3NQOA 2M5WA 1A04A 3ABTA 3C18A 3B02A 1BJAA 3FF5A 2G7UA 4U7DA 4HQMA 5TJJA 2C6YA 2FF4A 2L02A 1REPC 3L2CA 1SFXA 4FT8A 2P6SA 3BJ6A 2VE9A 4A6EA 2YR2A 1IN7A 3Q5FA 2YX4A 2D2WA 5DUKA 3Q9SA 5HDGA 2F5EA 1CF7A 4IXAA 4KIFA 3L7WA 3KP5A 4UUVA 4IHSA 3GW2A 3K1PA 4UHTA 2ETHA 5CVUA 1FSEA 1QZZA 2M45A 3GZ5A 1R5GA 4JQFA 1UHWA 2QLZA 3HTSB 4HX8A 2QENA 3DQVC 2VC0A 1IRGA 2HQRA 1LDKB 1SAXA 4ENJA 5L3GA 3F21A 1ZG1A 3T0YA 3E3VA 2FU4A 3ECOA 3WE2A 5DCMB 2QM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLG A;  4BQA A;  3QPT A;  3BDD A;  1R1V A;  2H6C A;  2NS0 A;  2VBW A;  2MA3 A;  3RYP A;  2L4A A;  2V9V A;  2P5V A;  5H20 A;  2M1B A;  3K0L A;  1FZP B;  4WF2 A;  2PJP A;  1TBX A;  4I0A A;  2E7X A;  1T98 A;  2OA4 A;  2ELH A;  4M6Y A;  2XHK A;  4ZYD A;  4GXO A;  3QOP A;  1KQ9 A;  4S04 A;  2XRO A;  3GF2 A;  2XRN A;  4RGX A;  2J5O A;  1FP2 A;  4I98 B;  4ENM A;  4OOI A;  2V1X A;  5LEK A;  3R60 A;  3I4P A;  3FMR A;  5H6Q A;  4DNC A;  1YYV A;  3JTG A;  2JTV A;  4ETS A;  3I5U A;  2WV0 A;  5K5O A;  5DYM A;  3I53 A;  1YIO A;  5DD8 A;  2H27 A;  2EA4 A;  2QUF A;  4KIC A;  4I01 A;  2XV4 S;  1ZYR F;  4HLY A;  1T39 A;  4OIO F;  5K5R A;  4M6X A;  5HS8 A;  3O6B B;  4MHG A;  3EDP A;  3M8E A;  1ZRE A;  1TW2 A;  5D6E A;  3ISP A;  3ZMV A;  1R7J A;  3I0T A;  1Z9C A;  3L00 A;  2STT A;  4AIJ A;  1ZRC A;  1B4A A;  1CF7 B;  4P9F A;  4HBL A;  4AIH A;  5HDN A;  2Z33 A;  1IXS B;  1T2K A;  5BOX A;  1TNT A;  1U6G A;  4KUM A;  4EV0 A;  3ZMS A;  2EFQ A;  4CGZ A;  2QQ9 A;  4MQV A;  2VXZ A;  2Z5U A;  3F72 A;  1FWZ A;  1YW8 A;  2EJR A;  3E6C C;  4WK8 F;  4U7B A;  1D5V A;  3WTU C;  2AXL A;  1ZHF A;  3ECH A;  4I09 A;  3KP7 A;  2DK5 A;  2L01 A;  5DD4 A;  4M9Z A;  4XSZ F;  3GFL A;  3GUD A;  3FXU A;  5FLX Z;  2FRH A;  2PMU A;  2CFX A;  1MD0 A;  2KIM A;  5HOO A;  1WWX A;  3ZMZ A;  4G94 A;  3OOP A;  2NNY A;  4Q48 A;  5D8L B;  4BHC A;  2JRT A;  2GXB A;  1J9I A;  4IRI A;  2DFI A;  3KEQ A;  3GXO A;  1J59 A;  2EV6 A;  2AS5 F;  2A07 F;  3V8J A;  2EWN A;  3FZV A;  4LD5 A;  3VB2 A;  3HRU A;  3PFI A;  3CDH A;  2YX7 A;  2Q2E A;  5J8F A;  2GAU A;  4PCQ A;  5IT9 K;  2UXN A;  2XAS A;  2H6B A;  4ZZD A;  2P5L C;  1IW7 F;  2W57 A;  4EJW A;  2VC1 A;  1XDS A;  3P9C A;  1LDD A;  1O3R A;  1TQP A;  2O6G E;  3JSO A;  2COM A;  1LJ9 A;  1BI3 A;  5LGN A;  1RUO A;  2R3S A;  4UV8 A;  4RGU A;  3SQN A;  2DLL A;  5CVI A;  2UWM A;  1QQI A;  1LEA A;  2A6H F;  4ENK A;  5DDG A;  2GXG A;  1G6N A;  1TQI A;  4L9T A;  3ZP5 A;  4YG2 F;  4HZF A;  4G8X A;  2EA2 A;  1FYM A;  1SD7 A;  2P4W A;  4UVA A;  2IW5 A;  3KZY A;  4HA8 A;  3LQQ A;  1ZGA A;  1J5Y A;  1NHA A;  2HQN A;  1R58 A;  3LA2 A;  1XGN A;  2IA0 A;  3U1D A;  3RPU A;  4U88 A;  2XAJ A;  2B0L A;  3F8F A;  4G7O F;  1U5T B;  4HAM A;  3OV8 A;  1IN6 A;  3S2W A;  1FX7 A;  1KU2 A;  4L9V A;  4RS8 A;  3I71 A;  3P9I A;  1LEB A;  4LG0 B;  3M8F A;  1USS A;  4XLN F;  1R22 A;  4M9S A;  4N9I A;  3FX3 A;  2G9W A;  4CO8 A;  4CDG A;  1PP8 F;  3BOQ A;  3R61 A;  5E8I A;  5E20 A;  3LFK A;  2Y0M A;  1FBU A;  1K78 B;  5ILS A;  4A0Y A;  2HYG D;  1ODD A;  5LGT A;  1I27 A;  1FT9 A;  4UNO A;  2LKP A;  3D5L A;  1QBJ A;  3MAJ A;  2DU9 A;  4G9Y A;  4P96 A;  3KLN A;  2DQR A;  1XDU A;  4A2U A;  1XGS A;  4ESJ A;  2Y75 A;  2DQL A;  2VBZ A;  5K5Q A;  3V7C A;  3EUH A;  3HSF A;  5F6F A;  1B9N A;  2QYO A;  1T6S A;  2MH2 A;  1O7L A;  1S29 A;  1R23 A;  1YW9 A;  4NB5 A;  1X3U A;  2XAQ A;  4LK0 F;  2QBY A;  2L54 A;  2IJL A;  3FXR A;  4Z2Y A;  3MZY A;  2K27 A;  1BOA A;  1MJ9 A;  5ICC A;  4P5O A;  1K79 A;  4B09 A;  3DPT A;  4DQ2 A;  5D5X B;  3V7S A;  3M9A A;  2NRA C;  3T8R A;  1XSV A;  1KQ0 A;  1UST A;  2ZKZ A;  4WXC A;  2LF7 A;  4UVC A;  3JAM Z;  4WWC A;  2VOD A;  1GVJ A;  3WGI A;  3P9K A;  5HLI A;  1EV7 A;  2K4B A;  1W7P A;  2FNP A;  3R4K A;  4RGR A;  1XN7 A;  5D6F A;  3DV8 A;  4XLP F;  1WKM A;  5D5W B;  3GZ6 A;  1IF1 A;  3MEX A;  1JHH A;  1LVA A;  1W4M A;  3G3Z A;  3I54 A;  3ROU A;  4WCG A;  1QGP A;  3J80 Z;  3RKY A;  1U8R A;  4UV9 A;  2RVC A;  4G7H F;  2O0Y A;  1TTY A;  1KGS A;  3PQJ A;  3L09 A;  3RPQ A;  2ACJ A;  4H0E A;  2DPU A;  4EMS A;  2GA1 A;  4YFK F;  5LEJ A;  2PG4 A;  5LRS A;  2ZJ2 A;  1GHC A;  2PFB A;  2MLG A;  1P2F A;  3DEU A;  5TRD A;  1IXC A;  1JE8 A;  3SHF A;  1I1S A;  4HF1 A;  2W25 A;  4S05 A;  1LDJ A;  2BV6 A;  3J81 K;  2NYX A;  1IN8 A;  2DK8 A;  3IC7 A;  3ZN1 A;  4TV7 A;  4PZJ A;  4OIP F;  3FM3 A;  3E5U A;  5D8K B;  4UXN A;  5FD6 A;  5EEH A;  3WTS C;  1KU7 A;  3FMQ A;  2JZY A;  1IZ1 A;  1MJA A;  4NHJ A;  4KN7 X;  2HS5 A;  1HQC A;  1H9G A;  1UFM A;  1XCV A;  1UHM A;  4I2O A;  3TDU C;  4Q5S F;  2IA1 A;  4RB3 C;  3WTX C;  5IT3 A;  2HOE A;  1P4W A;  1MDM B;  2M30 A;  4ENN A;  5LHG A;  2A3S A;  2VBX A;  2QVO A;  1U3E M;  3E97 A;  4LB5 A;  1H0M A;  2P5K A;  2OQG A;  2FMY A;  4ESF A;  4PDK A;  3M1E A;  1XD7 A;  1DPR A;  2W24 A;  4R8H A;  1TQM A;  4A0X A;  5E1Z B;  1YG2 A;  5JVT A;  4LB6 B;  4HF0 A;  3QU3 A;  2CSO A;  1GXP A;  2ZCW A;  3BRO A;  2RGV A;  1W5S A;  1ZN2 A;  1BC8 C;  3T8T A;  5KK1 A;  4XBF A;  4O3M A;  5AIQ A;  4PGH A;  2EK5 A;  4LFU A;  3WTV C;  2HFH A;  5J6X A;  3V8K A;  3VFZ A;  3ZMU A;  3GVA A;  2XUB A;  2W85 A;  1B59 A;  2RN7 A;  1JXS A;  4HDU A;  3F8C A;  3RYR A;  1MDM A;  5FLX K;  3I58 A;  3KEO A;  2BBY A;  1WQ2 A;  3SZP A;  3BY6 A;  1U5T C;  4A5M A;  1XMA A;  2XIG A;  2Z3Y A;  1JGS A;  4RB0 A;  1DDN A;  4KIB A;  4KDP A;  1RNL A;  1FPQ A;  3C1D A;  4EM2 A;  5D4S A;  4RAY A;  1ZG5 A;  4G6Q A;  2OZ6 A;  3TGN A;  4AIK A;  2ZBK A;  3HYI A;  4UVB A;  3RKX A;  1R36 A;  3ZMT A;  1QO0 D;  1BC7 C;  2XAH A;  4YIF A;  2YU3 A;  1ZAO A;  2RNJ A;  3IRQ A;  1W7P D;  1O3S A;  2FSW A;  4HYE A;  1RI7 A;  5DUI A;  1PDN C;  1IN4 A;  1OYY A;  2A69 F;  3PQK A;  2FQ3 A;  5ERI A;  3T5X A;  2BGC A;  1ZH5 A;  1FBQ A;  1G3W A;  3CJN A;  1L3L A;  5LGU A;  3EYI A;  4M72 A;  4Q47 A;  3LWF A;  3MWM A;  2J5P A;  2K02 A;  4M73 A;  2EV5 A;  2FXA A;  2ESH A;  3HUG A;  2PMH A;  4CXF A;  4L5J A;  5FB2 A;  3KCC A;  3GX4 X;  2H94 A;  5CYV A;  1OR7 A;  4EGY A;  3BP8 A;  4OIN F;  2W84 A;  3E6M A;  2STW A;  5D4R A;  3ABU A;  4KFC A;  5E17 F;  2XVC A;  5ICE A;  2PQ8 A;  4AVP A;  5J8C A;  1EH6 A;  4WX9 A;  3M7G A;  2VBY A;  2ADU A;  1F1Z A;  2VON A;  3LA7 A;  1CGP A;  4KYW A;  3B73 A;  3C3W A;  2DT5 A;  2IPQ X;  2EFO A;  1YFH A;  3GLX A;  3BJA A;  1JHF A;  2GIV A;  1V4R A;  2LDU A;  3IWF A;  1YS6 A;  4NQW A;  3NEU A;  5CJ9 A;  3QAH A;  2QBY B;  1ZRD A;  1OKR A;  3FM5 A;  4GCV A;  3RKW A;  3I59 A;  4BXU A;  5E1X A;  2K86 A;  1FBS A;  1DPU A;  5A2Q K;  1BIB A;  2GWR A;  4U0Y A;  3RI4 A;  2ZNZ A;  3QP6 A;  2X4H A;  1Z1D A;  1BIA A;  1D3Y A;  3BWG A;  2HTS A;  3MQ0 A;  2OQR A;  5FO5 A;  2CGP A;  3J81 Z;  3FXQ A;  4ZYE A;  5HVQ C;  4HX4 A;  5HS7 A;  1D8J A;  1FLI A;  3F6O A;  2GQQ A;  3U2R A;  1KA8 A;  1R1T A;  4LMY A;  2P7C B;  3JSP A;  3SZT A;  2YPR A;  1ZGJ A;  5A2Q Z;  4LG0 A;  2ISZ A;  4HV6 A;  2FBI A;  3KP4 A;  2ZFW A;  1XGM A;  3MZH A;  4KMF A;  1HW2 A;  4HF2 A;  3IWZ A;  6PAX A;  2EFW A;  1AWC A;  3SXY A;  1Z91 A;  1ZAR A;  1U5T A;  2GZW A;  1OYI A;  1E17 A;  1GXQ A;  4M9X A;  3LA3 A;  4IVN A;  3DXJ F;  4I7H A;  2P8T A;  4GYG A;  2V79 A;  2V1D A;  3ML6 A;  1O57 A;  4IJA A;  3E6B A;  4A6D A;  4WXH A;  2ISY A;  1R5H A;  1B9M A;  4IHT A;  3O3K A;  3RIR A;  1J0R A;  1Z05 A;  2XKP A;  3H3Z A;  5L3C A;  4KMU X;  4WXD A;  2FBH A;  1WI9 A;  5H6R A;  2BEO A;  1P92 A;  5ILV A;  4ZYG A;  2ESN A;  4AWX B;  2CO5 A;  5CVV A;  3REO A;  3TOA A;  3BJO A;  4A5N A;  1KU3 A;  3RJP A;  3V8L A;  1G3Y A;  3LQR A;  4Y15 A;  4LGW A;  3VOD A;  2XAG A;  5BS6 A;  1HW1 A;  2FBK A;  2RKH A;  3DF8 A;  2RC4 A;  4L9N A;  4CIC A;  2MLK A;  4HQE A;  3F3X A;  2ZNY A;  2MH9 A;  2PBI A;  2R7D A;  4RAZ A;  5EEG A;  1PUE E;  5LHH A;  4OIR F;  1J75 A;  4L5I A;  3W6J B;  1J7K A;  1ULY A;  3R6S A;  4U0V A;  2A68 F;  3KLO A;  1QNT A;  3O2P E;  4I0B A;  3HRS A;  4EJT A;  3K9T A;  2DAO A;  4M71 A;  2TDX A;  1R1U A;  4LLN A;  5IT9 Z;  1YTY A;  2L3D A;  3F22 A;  1HST A;  3F8M A;  2EV0 A;  1FC3 A;  2OAZ A;  3DFG A;  1W7P B;  4OU0 A;  1KU9 A;  4HDV A;  4O5V A;  3L9F A;  1QZY A;  1OYW A;  1F9N A;  4G7Z F;  5E8G A;  1IUY A;  4MEY F;  2E7W A;  4KNY A;  2WWY A;  3GFI A;  1C0W A;  1Z6T A;  4ESB A;  2YSR A;  1LNW A;  2RV8 A;  4GO1 A;  1YW7 A;  5DV5 A;  4HOB A;  1FYK A;  1B1B A;  1OMI A;  3KP2 A;  1G3S A;  3CO6 C;  5JR3 A;  1HXD A;  2G7H A;  2OBP A;  3GFJ A;  2KJC A;  1HW5 A;  2BYV E;  4F7Z A;  1ONV A;  3G73 A;  1FOK A;  3R0J A;  3LST A;  5L3D A;  3FMS A;  2PI0 A;  4N0B A;  5BMZ A;  5AON A;  3HOS A;  1UCR A;  3WGH A;  1YLF A;  2FML A;  4BHP A;  2IA2 A;  4GYI A;  1ON1 A;  1FY7 A;  3U9G A;  3J80 K;  1RZ4 A;  1TLH B;  3H3U A;  3V4G A;  3DKW A;  5K1Y A;  2OZU A;  4EM1 A;  4MTD A;  4EJU A;  3BPV A;  1Z6R A;  3WTW C;  2DW4 A;  2HKO A;  4KIG A;  4G6D A;  2VT2 A;  4GGG A;  4L9J A;  1SD6 A;  2O3F A;  2L4M A;  3COA C;  2HYF A;  3TO6 A;  1SD5 A;  5HS9 A;  4L0Y B;  3CUQ B;  1HSJ A;  3C7J A;  5JI6 A;  2CW0 F;  4A12 A;  2NNN A;  4K2E A;  2M87 A;  3LAJ A;  3GYH X;  5F64 A;  1J2X A;  4N9H A;  4YFX F;  5ED4 A;  2JPB A;  2OD5 A;  1SMY F;  4EM0 B;  4BHB A;  4XSX F;  1F4K A;  1HKS A;  2DBB A;  2Z99 A;  3ZPL A;  1B6A A;  3T1B A;  5JHU A;  1V3F A;  3FWE A;  4P55 A;  2Y48 A;  4LK1 F;  2P6T A;  1BI1 A;  3WTY C;  2HEO A;  2QWW A;  2DPD A;  4FX0 A;  5FD5 A;  1G3T A;  2FOK A;  4IF4 A;  4BAY A;  2D45 A;  2QZ8 A;  3I59 B;  1EH7 A;  2ZXJ A;  2WC2 A;  3KZZ A;  2RDP A;  3JW4 A;  2XKO A;  1XCB A;  2A61 A;  3E6D A;  4YII A;  1U78 A;  1XGO A;  1STZ A;  2IT0 A;  3TOB A;  3GWZ A;  1BI2 A;  5HDK A;  5ICG A;  5FFX A;  1PP7 U;  2KRF A;  4P9U A;  4IRG A;  2D1V A;  3MCZ A;  4OMZ A;  4HV5 A;  5AIP A;  2O61 A;  3WU1 B;  1BI0 A;  3N4M A;  4LLL A;  3NRV A;  3BPX A;  1BM9 A;  2LSO A;  1IAW A;  1KYW A;  5BPI A;  3HRM A;  1R00 A;  4PGG A;  4ASN A;  4MTE A;  1XMK A;  1K7A A;  3ERE D;  1IRF A;  1ZLJ A;  1U2W A;  4CZZ A;  3F6V A;  3F23 A;  3JAM K;  1Y0U A;  4D0P A;  5L3B A;  2Q0O A;  2V1U A;  2XGX A;  2IP2 A;  2RQP A;  2VE8 A;  5L3E A;  2BE5 F;  5CVJ A;  1RIO H;  1MZB A;  1KQ8 A;  2CWE A;  2X0L A;  2JSC A;  1KYZ A;  2HR3 A;  2IVM A;  1P4A A;  3IL2 A;  1E2X A;  3MFK A;  1LB2 A;  4RB1 A;  2E1C A;  2Z9O A;  4CYD A;  4B8X A;  1FSH A;  4L18 B;  5LRR A;  4JBA A;  2FA5 A;  2WTE A;  2QQB A;  3HIF A;  2HTJ A;  2KKO A;  1FNN A;  3LAP A;  5E1W A;  4HW0 A;  1I5Z A;  2UZK A;  4I02 A;  2CQK A;  2MD5 A;  1S6L A;  4IRH A;  3K1M A;  3ELK A;  4LLG F;  2EFN A;  4BH9 A;  3CUQ C;  3CUQ A;  2OU2 A;  1MJB A;  4XRF A;  1G4D A;  1F5T A;  4MEX F;  3ULQ B;  4U0W A;  2HKX A;  3GEZ A;  5D5U B;  3VOE A;  3WGG A;  3TKY A;  4JK1 X;  5FGM A;  1SMT A;  3WTT C;  2KJB A;  4Y17 A;  1S7A A;  4OMY A;  2HZT A;  2HDC A;  1K78 A;  5JFR A;  4A0Z A;  1YO5 C;  3WTZ A;  2XAF A;  4R79 A;  3K69 A;  1TW3 A;  4HLX A;  3QRF F;  2ZME A;  3IRR A;  5DCF A;  1DP7 P;  3KP6 A;  2JPC A;  4O6J A;  5LLQ A;  4EGZ A;  1WRJ A;  2FE3 A;  2H09 A;  3HHG A;  3ZN0 A;  2FEZ A;  3CLO A;  3D0S A;  3GFM A;  4Y13 A;  3TO9 A;  2PN6 A;  3QP5 A;  4EQQ A;  4ON0 A;  4RGS A;  2IRF G;  5KVR A;  2LNB A;  1S7O A;  1VTN C;  3F8N A;  1I1G A;  1HBX G;  1HKQ A;  3RTR A;  1OPC A;  1Q1H A;  3CO7 C;  5F1R A;  3E5X A;  3J7A O;  3EQL F;  2HGC A;  3BZ6 A;  3N97 A;  5FFZ A;  1P6R A;  3TQN A;  3HSE A;  4MGR A;  1EH8 A;  4MNU A;  5L3F A;  1P4X A;  1SD4 A;  2F5F A;  1S8N A;  2KIF A;  4BYY A;  3QPH A;  5DCM A;  3KP3 A;  3VEP A;  2ZO4 A;  3K1N A;  3TDZ C;  3IHU A;  1ZLK A;  2EFP A;  2M8E A;  2VT3 A;  3CUO A;  5LHI A;  1T0F A;  4FX4 A;  3TO7 A;  4YFN F;  1XB4 A;  1ZRF A;  3CTA A;  1YQA A;  2CYY A;  1Z7U A;  3I64 A;  2GA2 A;  2K4J A;  3HHH A;  1MKM A;  1O3Q A;  3WG9 A;  3WOD F;  3RDI A;  1TNS A;  1LQ1 A;  3JTH A;  4OIQ F;  3R0A A;  4M74 A;  3H92 A;  4KN4 X;  3V7R A;  2VOO A;  3IKV A;  2VOP A;  3KE2 A;  4RB2 C;  2DTR A;  5D5V B;  3WE3 A;  1WSU A;  2MC3 A;  4E70 A;  3F8B A;  3K2Z A;  5BPD A;  2PEX A;  2V6C A;  3P7N A;  2R7F A;  5LBQ A;  2F5C A;  2NAZ A;  3HSR A;  1I6X A;  3KET A;  3EET A;  4KA4 A;  2HWV A;  1QPM A;  3GO5 A;  4LJZ F;  4IPA A;  2F2E A;  5CLS A;  2DO7 A;  2EB7 A;  4R1H A;  3E5Q A;  1XSX A;  1HKT A;  3FHZ A;  4CHU A;  4QLC U;  2VN2 A;  2F5D A;  2A6E F;  3EYY A;  5CVR A;  2MBF A;  3AAF A;  2KIU A;  1D8K A;  2E1N A;  2QQA A;  3Q9V A;  4MQ9 F;  4HX7 A;  4ZYH A;  1O7F A;  3ZQ7 A;  2CG4 A;  1FP1 D;  1MGT A;  2ZME B;  3DPL C;  3HOT A;  5ICF A;  3SFZ A;  2JT1 A;  4Q4Z F;  4FHT A;  2Q8K A;  1BN5 A;  5BQT A;  2PLY A;  3HTU A;  4EJO A;  5DEQ A;  3DP7 A;  3WU0 A;  1ZG3 A;  1SFE A;  1H9T A;  3QU6 A;  4AD9 A;  1IXR C;  4ZH4 F;  2D1H A;  3ZMD A;  5E18 F;  2LF8 A;  1T38 A;  3KFW X;  1RUN A;  2O8X A;  1XSD A;  2UXX A;  1UB9 A;  3W6K B;  1O3T A;  1IN5 A;  4EVI A;  2O03 A;  4BNC A;  1FYL A;  5ILU A;  4KT5 C;  1K6O A;  2A5Y B;  4EJV A;  1DUX C;  3IKT A;  2P7V B;  1AOY A;  4QWQ A;  1S3J A;  4L0Z B;  1L0O C;  1ON2 A;  4ZZL A;  5HLH A;  1SFU A;  3HRT A;  2FNA A;  1BBY A;  1W5T A;  2DI3 A;  1YS7 A;  2K7L A;  3NQO A;  2M5W A;  1A04 A;  3ABT A;  3C18 A;  3B02 A;  1BJA A;  3FF5 A;  2G7U A;  4U7D A;  4HQM A;  5TJJ A;  2C6Y A;  2FF4 A;  2L02 A;  1REP C;  3L2C A;  1SFX A;  4FT8 A;  2P6S A;  3BJ6 A;  2VE9 A;  4A6E A;  2YR2 A;  1IN7 A;  3Q5F A;  2YX4 A;  2D2W A;  5DUK A;  3Q9S A;  5HDG A;  2F5E A;  1CF7 A;  4IXA A;  4KIF A;  3L7W A;  3KP5 A;  4UUV A;  4IHS A;  3GW2 A;  3K1P A;  4UHT A;  2ETH A;  5CVU A;  1FSE A;  1QZZ A;  2M45 A;  3GZ5 A;  1R5G A;  4JQF A;  1UHW A;  2QLZ A;  3HTS B;  4HX8 A;  2QEN A;  3DQV C;  2VC0 A;  1IRG A;  2HQR A;  1LDK B;  1SAX A;  4ENJ A;  5L3G A;  3F21 A;  1ZG1 A;  3T0Y A;  3E3V A;  2FU4 A;  3ECO A;  3WE2 A;  5DCM B;  2QM3 A; 
#chains in the Genus database with same CATH topology
 1BW5 A;  3X2Q H;  1XC5 A;  3HDD A;  5HLG A;  2PX9 A;  4PJJ A;  2CQ7 A;  3TL4 X;  4BQA A;  5B3S H;  2HVS A;  2L7K A;  4DBQ A;  3QPT A;  3BDD A;  3K70 C;  1R1V A;  3G71 I;  2H6C A;  2NS0 A;  2E71 A;  4IO9 F;  2VBW A;  5J47 A;  5EGO A;  2MA3 A;  3RYP A;  2L4A A;  2V9V A;  3D5R C;  2P5V A;  3H36 A;  3QWL A;  5H20 A;  2M1B A;  3K0L A;  1FZP B;  3H1C A;  4WF2 A;  2PJP A;  1DGW Y;  1TBX A;  1QRY A;  4I0A A;  2E7X A;  1T98 A;  1LUJ B;  2OA4 A;  3GBG A;  1ZQ3 P;  2ELH A;  3CCV I;  3MZ8 A;  1X2M A;  3JRI A;  2X1D A;  4M6Y A;  2FD5 A;  1I6H J;  3M8J A;  1MH3 A;  2XHK A;  1ZEL A;  1TT0 A;  4ZYD A;  2EPF A;  4JX5 A;  4GXO A;  1YX3 A;  4NNJ A;  4LG3 A;  4QIW N;  3QOP A;  1KQ9 A;  4S04 A;  2E2H J;  1R71 A;  2E5Z A;  3GME A;  3U1K A;  3RCO A;  2XRO A;  1X3Z B;  3GF2 A;  2XRN A;  4RGX A;  4PJL A;  2J5O A;  4JYK A;  1FP2 A;  2CUE A;  2W00 A;  1JUM A;  4I98 B;  4I76 A;  2VQG A;  4ENM A;  1FJL A;  2E1M B;  4OOI A;  2V1X A;  5LEK A;  2F4O B;  2QEX I;  3CCL I;  3R60 A;  1HBX G;  3I4P A;  3FMR A;  5H6Q A;  4DNC A;  2X6Y A;  2VUM J;  1YYV A;  3JTG A;  2JTV A;  2I10 A;  2ZJR F;  2ME6 A;  4JP0 A;  4ETS A;  3I5U A;  2WV0 A;  5K5O A;  2R7Q A;  3HXL A;  3IH2 A;  5DYM A;  3I9V 2;  4HSR A;  5B5E C;  3I53 A;  1YIO A;  4CSW A;  1OCC H;  4RAF A;  5DD8 A;  2EA4 A;  4BEH A;  2QUF A;  2H27 A;  2A6T A;  3DTI A;  3S16 J;  4KIC A;  4I01 A;  2XV4 S;  3K2A A;  2H8W A;  4C9Y A;  1ZYR F;  1ETQ A;  2V9P A;  4HLY A;  5JVG F;  1X1C A;  1T39 A;  3HM5 A;  1V54 H;  3Q0V A;  2LLK A;  3LSJ A;  4OIO F;  3BTL A;  4BQQ A;  4M6X A;  5K5R A;  5HS8 A;  3O6B B;  1BJZ A;  4MHG A;  3H0G J;  3FIW A;  3MKL A;  3OYN A;  3DKX A;  2XF6 A;  1I50 J;  1QHH D;  3EDP A;  3M8E A;  1ZRE A;  1ETO A;  1RKT A;  3K4L A;  1UHS A;  5FKL A;  3KYC B;  1TW2 A;  5D6E A;  1Y6I A;  3ISP A;  3ZMV A;  3WU2 C;  3S2H J;  3BCA A;  1R7J A;  3I0T A;  1Z9C A;  1W0T A;  1T8I A;  3DEW A;  2VKE A;  3L00 A;  4AIJ A;  1ZRC A;  3JRA A;  2STT A;  2WV1 A;  1BL0 A;  1W5C C;  4ITV A;  1B4A A;  1CF7 B;  2R5Z A;  1TWF J;  4P9F A;  4HBL A;  4XN3 A;  2CQX A;  1LFP A;  1FIA A;  3FBI B;  4FAS D;  4RAG A;  4AIH A;  5HDN A;  2Z33 A;  1IXS B;  1BR1 A;  1T2K A;  5BOX A;  5JLX A;  1TNT A;  3LSI A;  1AHD P;  1OCP A;  2GXA A;  2CQQ A;  3PFY A;  1U6G A;  4KUM A;  2BHY A;  4EV0 A;  3ZMS A;  2O7O A;  1HOM A;  4NQW B;  2EFQ A;  1VFC A;  4CGZ A;  3L2Q A;  2QQ9 A;  4MQV A;  4D7N A;  1YHQ I;  1ZKG A;  1D0X A;  2VXZ A;  2WY7 Q;  2Z5U A;  4BDY A;  3F72 A;  1FWZ A;  1YW8 A;  4FET A;  2EJR A;  2K85 A;  3CJR B;  4RLF A;  3E6C C;  4WK8 F;  1G8X A;  2K5C A;  5KAI C;  4U7B A;  1D5V A;  3WTU C;  3H5N A;  3TED A;  2AXL A;  1MMA A;  1ZHF A;  3S2D J;  4D5C A;  2ZXW H;  3ECH A;  4I09 A;  3KP7 A;  2DK5 A;  2L01 A;  3ABL H;  5DD4 A;  4M9Z A;  3HKZ N;  4E7S A;  1ETV A;  4XSZ F;  3GFL A;  3GUD A;  1K4S A;  3FXU A;  5E3N A;  5FLX Z;  4XID A;  2FRH A;  3DBL B;  1D1A A;  2PMU A;  1YJW I;  5B66 C;  2CFX A;  1MD0 A;  2KIM A;  5HOO A;  1WWX A;  3ZMZ A;  4G94 A;  3OOP A;  2NNY A;  4Q48 A;  3ZRG A;  1H8A C;  5D8L B;  3A1Y A;  2XPU A;  4BHC A;  2XSJ C;  2JRT A;  2GXB A;  5FKO A;  4IRI A;  1J9I A;  2DFI A;  3KEQ A;  3IV5 A;  3GXO A;  1J59 A;  2EV6 A;  2AS5 F;  4CYC B;  2A07 F;  1TP4 A;  3V8J A;  5B1A H;  3FHN A;  2EWN A;  3FZV A;  2HOA A;  3H9Q A;  2Y2Z A;  2HYJ A;  3CCJ I;  3L2R A;  3OS2 A;  4B3X A;  4LD5 A;  3FBN B;  4AVZ A;  3HG9 A;  3VB2 A;  3HRU A;  3IUO A;  3PFI A;  3CDH A;  4MO7 A;  1T0F C;  1IRZ A;  2YX7 A;  1F36 A;  4B44 A;  2Q2E A;  5J8F A;  3A03 A;  2GAU A;  1IDY A;  4PCQ A;  5IT9 K;  2UXN A;  5K7F A;  2NVQ J;  4A3M J;  3DU6 A;  1UG2 A;  2H6B A;  2XAS A;  4ZZD A;  4U87 A;  1IW7 F;  2W57 A;  3AG4 H;  2P5L C;  2R7Z J;  4EJW A;  2VC1 A;  3BG6 A;  1XDS A;  3MN2 A;  3P9C A;  2VI6 A;  4IQJ A;  4NC7 A;  3CCM I;  5F0H A;  1LDD A;  1O3R A;  3H35 A;  1TQP A;  3HC7 A;  2MD0 A;  4I6Z A;  2O6G E;  3JSO A;  4IL6 C;  4DOZ A;  5EG0 A;  2COM A;  1YRN A;  1LJ9 A;  1BI3 A;  5LGN A;  1Y1W J;  1RUO A;  2R3S A;  4UV8 A;  4RGU A;  3SQN A;  4X6A J;  3NAR A;  2CJJ A;  2DLL A;  3GTO J;  5CVI A;  5DM7 F;  2UWM A;  1QQI A;  1FOX A;  1D0Z A;  2CH0 A;  4X1E A;  2X85 A;  3CCU I;  1LEA A;  2A6H F;  2KPM A;  5DDG A;  2GXG A;  4ENK A;  4RA2 A;  1G6N A;  1TQI A;  3RQI A;  4QPQ A;  2KQR A;  5EEA A;  2ICW G;  4L9T A;  3BT9 A;  1IGN A;  1N75 A;  2PJR A;  3QPS A;  1FTT A;  3ZP5 A;  4YG2 F;  3SJM A;  4X0G A;  4MLO A;  4HZF A;  4G8X A;  1X1A A;  2EA2 A;  1P9Q C;  3Q0W A;  1FYM A;  1SD7 A;  1ORK A;  1VZ0 A;  2P4W A;  4UVA A;  2IW5 A;  3RKQ A;  3KZY A;  2KDO A;  4C2T A;  4HA8 A;  3LQQ A;  2L9R A;  1ZGA A;  1UJ8 A;  2JQ7 A;  5E3M A;  4PFO A;  3ZQG A;  1J5Y A;  1MNM C;  1HCR A;  1NHA A;  2HQN A;  1R58 A;  3LA2 A;  1XGN A;  2RRE A;  3P5J A;  4JX6 A;  2IA0 A;  5F0C A;  1HDD C;  3U1D A;  3I3L A;  3RPU A;  2BY3 A;  2L7F P;  4U88 A;  2EIN H;  5EDN A;  2XAJ A;  2MW8 A;  4J01 A;  2B0L A;  5IOY A;  3F8F A;  4G7O F;  5IYB J;  1U5T B;  4HAM A;  4DZJ A;  3OV8 A;  1IN6 A;  4Y4R A;  5FKM A;  5M3M J;  3S2W A;  4BJT A;  2P81 A;  4MFD A;  2COB A;  1FX7 A;  1KU2 A;  3GTK J;  4F3Q A;  2NS7 A;  3FXL A;  4L9V A;  3H5A A;  4RS8 A;  3I71 A;  2KIQ A;  3P9I A;  4XR6 A;  2MC4 A;  4IKF A;  1LEB A;  2KL4 A;  3KPH A;  4LG0 B;  3M8F A;  3M07 A;  3JRH A;  1USS A;  4XLN F;  1R22 A;  4M9S A;  3DTK A;  4N9I A;  3CES A;  3FX3 A;  2XRL A;  2RNG A;  2G9W A;  4CO8 A;  4CDG A;  1U0J A;  1PP8 F;  3CCR I;  2HI3 A;  4B43 A;  3BOQ A;  3R61 A;  1JKO C;  4M3G A;  5E20 A;  5E8I A;  1SFO J;  3W2V A;  2IS2 A;  1T08 B;  3KZI C;  3LFK A;  2Y0M A;  4L5E A;  1FBU A;  4BKX A;  2DOA A;  5HOD A;  1K78 B;  5ILS A;  5K7H A;  1WH7 A;  4A0Y A;  2HYG D;  1ODD A;  5LGT A;  1I27 A;  1FT9 A;  4N4N B;  2LMD A;  2VQC A;  4UNO A;  2JRM A;  3F9K A;  4XLA A;  4HNV A;  2LKP A;  2MG4 A;  2HXI A;  2KMU A;  4JOM A;  3D5L A;  3H9G A;  3MAJ A;  1QBJ A;  3LOC A;  2DU9 A;  2XDV A;  4G9Y A;  3KLN A;  4P96 A;  2DQR A;  1XDU A;  2WB1 A;  4A93 J;  5EZH A;  4A2U A;  1WGX A;  3HOX J;  3DLL F;  1N78 A;  3DWL E;  1XGS A;  4A69 C;  1JGG A;  4ESJ A;  2Y75 A;  2DQL A;  2VBZ A;  5K5Q A;  3OYD A;  4BE1 A;  2VPL A;  3V7C A;  2DMP A;  4A3E J;  3EUH A;  4ZDO A;  3HSF A;  5F6F A;  5FLV A;  1B9N A;  2QYO A;  1T6S A;  2MH2 A;  1H88 C;  4FTH A;  1RR7 A;  2XSD C;  1O7L A;  1S29 A;  1R23 A;  1YW9 A;  2Y0S N;  4NB5 A;  4GFB A;  1YOV B;  1X3U A;  2XAQ A;  4EEF G;  2FJ1 A;  4KJZ A;  4LK0 F;  2QBY A;  2L54 A;  4N4O B;  1X58 A;  4ZDL A;  2L9S A;  2IJL A;  2Z1D A;  5J4Y A;  3OIO A;  3FXR A;  4F93 B;  4NC6 A;  4BU2 A;  4Z2Y A;  3MZY A;  3K7A J;  3WHB A;  3PNV A;  2K27 A;  1BOA A;  4BXX J;  2M8G X;  1I39 A;  1VQ4 I;  3HOU J;  1JUP A;  1MJ9 A;  2BVL A;  5ICC A;  1X4P A;  3K4C A;  1HLV A;  4P5O A;  2V4J C;  1K79 A;  1MNE A;  1NTC A;  1MIJ A;  4B09 A;  3VPR A;  3DPT A;  4DQ2 A;  5D5X B;  3V7S A;  1I3A A;  3HPH A;  3KX2 A;  3M9A A;  2NRA C;  3T8R A;  1ENH A;  2HXO A;  1XSV A;  1KQ0 A;  1UST A;  2V6E A;  1RKW A;  2ZKZ A;  2JMW A;  4WXC A;  1LFB A;  2LF7 A;  1S7E A;  4UVC A;  3JAM Z;  1Y8R B;  4WWC A;  2VOD A;  1WPK A;  1GVJ A;  3WGI A;  2K40 A;  3P9K A;  1YJN I;  3HOW J;  2VJI A;  5HLI A;  4B3A A;  1EV7 A;  2K4B A;  3AL0 B;  2VLA A;  1W7P A;  2FNP A;  3FXO A;  3R4K A;  4RGR A;  5IY5 H;  2OTJ I;  1XN7 A;  5D6F A;  3DV8 A;  1V5G A;  1OFC X;  4XLP F;  1WKM A;  5D5W B;  3GZ6 A;  1X19 A;  1VF9 A;  1IF1 A;  3MEX A;  4NDL A;  1JHH A;  1LVA A;  1W4M A;  3G3Z A;  3HGG A;  3I54 A;  5B1B H;  3ROU A;  4WCG A;  1QGP A;  3J80 Z;  2VPR A;  4E7J A;  3S1R J;  3RKY A;  1U8R A;  1LE8 A;  4UV9 A;  2RVC A;  4RM3 A;  3FXJ A;  4DGW B;  1NG7 A;  2DDB A;  4G7H F;  2O0Y A;  1TTY A;  1KGS A;  3BZC A;  3PQJ A;  3L09 A;  3RPQ A;  2ACJ A;  4H0E A;  1KZH A;  2DPU A;  3HOZ J;  4EMS A;  2OCE A;  2GA1 A;  1RR8 C;  5KNL A;  2VQH A;  2A5W A;  3PIO F;  4YFK F;  5LEJ A;  2PG4 A;  5LRS A;  2M0M A;  2ZJ2 A;  1JJ6 C;  1GHC A;  2PFB A;  1B72 B;  2VJ5 A;  2MLG A;  4HRI A;  1P2F A;  3DEU A;  3O8G A;  1B8I A;  5TRD A;  1JT6 A;  5EG0 B;  1YIJ I;  1IXC A;  1JE8 A;  3GTJ J;  3SHF A;  1VQP I;  1I1S A;  1QA6 A;  3S3O A;  2ZXH A;  4HF1 A;  2W25 A;  4S05 A;  4XK4 A;  1N25 A;  1MND A;  4FIS A;  1LDJ A;  1MMD A;  2BV6 A;  4S0H B;  3NAU A;  3MKW B;  2R0Q C;  3J81 K;  2NYX A;  1IN8 A;  2KDZ A;  2DK8 A;  2EQR A;  3S1M J;  3TBI A;  3IC7 A;  4OWR B;  2GOM A;  3G4S I;  3BZK A;  5HNF A;  3ZN1 A;  4TV7 A;  4PZJ A;  2D5V A;  2E5N A;  4OIP F;  1HDP A;  3FM3 A;  3E5U A;  2B7E A;  5D8K B;  4UXN A;  5DTD A;  4FQG A;  5FD6 A;  2DYR H;  1R5I D;  5EEH A;  3WTS C;  5GPC A;  1JKQ C;  1KU7 A;  3FMQ A;  2R7O A;  2JZY A;  3C2G A;  3GCM A;  2HDW A;  2Y9Y A;  1MBF A;  1IZ1 A;  1MJA A;  4NHJ A;  4KN7 X;  2HS5 A;  4AYB A;  1HQC A;  1H9G A;  1IRX A;  1UFM A;  2WAQ N;  1XCV A;  1UHM A;  4Y7N J;  4I2O A;  3TDU C;  1MH4 A;  2X1C A;  4Q5S F;  4XKC A;  4A3D J;  2IA1 A;  4QSH A;  3PJR A;  4RB3 C;  3WTX C;  1JI8 A;  5IT3 A;  2WAE A;  2LRD A;  5K7Z A;  2RQQ A;  2HOE A;  1P4W A;  1MDM B;  3JRD A;  1FMW A;  3CF2 A;  2M30 A;  3KYD B;  4ENN A;  5LHG A;  2A3S A;  2VBX A;  2O9L A;  2QVO A;  1U3E M;  3E97 A;  3CP2 A;  4LB5 A;  1H0M A;  3A01 A;  1R4N B;  2P5K A;  5GAH J;  1E0E A;  2FQ4 A;  2OQG A;  3ZOB A;  2ZJP F;  2LD5 A;  2FMY A;  1WH5 A;  1R9T J;  4ESF A;  4PDK A;  3CQZ J;  2ID6 A;  3M1E A;  1XD7 A;  2BY0 A;  1DPR A;  2W24 A;  1OCO H;  4R8H A;  1TQM A;  2HNH A;  4A0X A;  5E1Z B;  1YG2 A;  5FKK A;  5JVT A;  4LB6 B;  1GV5 A;  4HF0 A;  3SZG A;  3B6A A;  3HEF A;  3E1S A;  2W7N A;  2LYC A;  3QU3 A;  1VQ6 I;  2VQL A;  2CSO A;  3AKZ A;  1GXP A;  3OYI A;  2ZCW A;  3BRO A;  2RGV A;  1W5S A;  1ZN2 A;  3ONQ A;  2CV2 A;  4BJ5 C;  4E6K G;  1BC8 C;  3T8T A;  4PJM A;  1TC3 C;  5KK1 A;  4XBF A;  4O3M A;  5AIQ A;  4PGH A;  2AXT C;  2ELK A;  3H3V K;  1R4M B;  2EK5 A;  1MBH A;  4LFU A;  3WTV C;  3ABK H;  4ANJ A;  2HFH A;  2WAQ A;  5J6X A;  3V8K A;  3VFZ A;  3ZMU A;  2R7X A;  3GVA A;  4EAT A;  3K10 A;  2XUB A;  2W85 A;  2WA0 A;  1S5L C;  5HNH A;  1B59 A;  3VYT B;  2RN7 A;  2JVH A;  1JXS A;  4HDU A;  2V26 A;  3F8C A;  3RYR A;  2DT7 B;  5M5X J;  1SC7 A;  5JHF A;  1MDM A;  4G12 A;  5FLX K;  3I58 A;  1VQM I;  3KEO A;  4LIT A;  2BBY A;  2R7V A;  1WQ2 A;  3SZP A;  3OYF A;  3HOY J;  3BY6 A;  1U5T C;  4A5M A;  1XMA A;  2XIG A;  1E3O C;  2Z3Y A;  1JGS A;  1ETW A;  3UKG A;  4A3B J;  1TWC J;  4RB0 A;  1DDN A;  4KIB A;  1RNL A;  1FPQ A;  4KDP A;  3DLA A;  2XPV A;  2PMZ A;  3N05 A;  2DMQ A;  3C1D A;  4EM2 A;  5D4S A;  1SAN A;  4RAY A;  1ZG5 A;  4G6Q A;  4DW6 A;  2OZ6 A;  2BY2 A;  4BGD A;  4RM2 A;  3TGN A;  3KYL A;  4AIK A;  1Y8Q B;  2ZBK A;  2XF5 A;  3HYI A;  4UVB A;  3RKX A;  1R36 A;  5GAD J;  3CCQ I;  2VJ4 A;  1ZR4 A;  4XOT A;  4B1R A;  3ZMT A;  3JRC A;  2NOG A;  1S72 I;  2LP0 A;  3K70 D;  1QO0 D;  1BC7 C;  3S15 J;  2XAH A;  4YIF A;  4PFP A;  2YU3 A;  1ZAO A;  2RNJ A;  3BR5 A;  3IRQ A;  4CCO A;  1W7P D;  3H5R A;  1O3S A;  1GLN A;  2BW3 B;  3CDL A;  3TW7 A;  2FSW A;  4HYE A;  3IP4 B;  3TMO A;  1Z21 A;  1RI7 A;  4II2 A;  3Q3S A;  5FRN A;  3M4O J;  2M3A A;  5DUI A;  1PDN C;  1IN4 A;  1OYY A;  4E7L A;  4RLQ A;  4BS9 A;  2A69 F;  3PQK A;  2FQ3 A;  5ERI A;  3T5X A;  2BGC A;  4A3J J;  1ZH5 A;  1FBQ A;  1G3W A;  3CJN A;  4F55 A;  1L3L A;  5LGU A;  3EYI A;  4A3C J;  1TWG J;  2UV1 A;  4M72 A;  4Q47 A;  3LWF A;  2K9M A;  3MWM A;  1M1E B;  1B72 A;  2HOT A;  4BJ6 C;  2HDD A;  2MGQ A;  1WVR A;  2J5P A;  5CQG A;  2K02 A;  3CCS I;  4M73 A;  2EV5 A;  2FXA A;  2ESH A;  1K4T A;  2V1N A;  3HUG A;  4BXF A;  2PMH A;  2ZJQ F;  1EKE A;  3S8P A;  2DMN A;  1D0Y A;  4CXF A;  5EF6 A;  4L5J A;  1FEX A;  1AU7 A;  2QSH X;  5FB2 A;  3KCC A;  3GX4 X;  5GTH C;  2H94 A;  5CYV A;  2EZL A;  1OR7 A;  4F52 A;  4EGY A;  2E1O A;  2OC6 A;  3KIO A;  2F5V A;  3BP8 A;  4OIN F;  2W84 A;  3E6M A;  2STW A;  3OYA A;  5D4R A;  2BXZ A;  4MIM A;  3ABU A;  2DTZ A;  1Y56 A;  4KFC A;  1PYV A;  4C3J J;  3HZJ A;  2PJR B;  5E17 F;  2XVC A;  3S17 J;  5ICE A;  2EIK H;  2PQ8 A;  2LKS A;  1A31 A;  4AVP A;  5J8C A;  1EH6 A;  4WX9 A;  3CC2 I;  1WI3 A;  1OIS A;  3M7G A;  2DA6 A;  2VBY A;  4D9J A;  2ADU A;  1WJB A;  4XL9 A;  5F1J A;  1F1Z A;  5LD2 C;  2VON A;  3LL7 A;  1Q1V A;  2DA1 A;  3LA7 A;  2K9N A;  3HKZ A;  5IPA A;  1CGP A;  1NG6 A;  1ETX A;  5KCM A;  3B73 A;  3C3W A;  4XLC A;  4KYW A;  1X2N A;  2IXS A;  1SEU A;  4J00 A;  3G2B A;  2DT5 A;  2IPQ X;  3LSH A;  3HPG A;  4AC0 A;  3RQ4 A;  2BW3 A;  2F48 A;  1VQO I;  2EFO A;  1YFH A;  2EIJ H;  1MW7 A;  2ZFU A;  3GLX A;  1WJA A;  3BJA A;  1JHF A;  3HB9 A;  2LH9 A;  3FKJ A;  3M3Y J;  2GIV A;  1P7I A;  2ME0 A;  1A35 A;  3QOD A;  3U21 A;  1D1C A;  1V4R A;  2LDU A;  3JRE A;  2BHZ A;  3IWF A;  3QOE A;  5FJ8 J;  1YS6 A;  4NQW A;  3NEU A;  5CJ9 A;  3SYT A;  3QAH A;  2QBY B;  2GIZ A;  1T33 A;  1ZRD A;  1WHU A;  4PSX A;  1OKR A;  3FM5 A;  4GCV A;  3RKW A;  2CS3 A;  3B6C A;  2N8G A;  3I59 A;  4ABZ A;  3NWT A;  4BXU A;  3OYE A;  5E1X A;  2K86 A;  5GP9 A;  1FBS A;  2M7A A;  2CU7 A;  4AID A;  1LKX A;  1NK3 P;  1DPU A;  3J7Y J;  3O8H A;  2CV0 A;  3BR2 A;  1BIB A;  2GWR A;  5A2Q K;  4U0Y A;  3I4N J;  5IOZ A;  3RI4 A;  2ZNZ A;  3QP6 A;  2X4H A;  2DXI A;  1Z1D A;  3OYB A;  1FIP A;  1BIA A;  3BG9 A;  1D3Y A;  3BWG A;  1OCZ H;  3ZQI A;  2B63 J;  1FOW A;  2HPI A;  2HTS A;  3MQ0 A;  3K4N A;  1VQK I;  2ECC A;  2OQR A;  5FO5 A;  1ERD A;  2CGP A;  3J81 Z;  3FXQ A;  5GAE J;  4ZYE A;  5HVQ C;  4HX4 A;  1TWH J;  5HS7 A;  1D8J A;  1WJ5 A;  2MAB A;  1TL8 A;  2LRE A;  1IJW C;  1FLI A;  3F6O A;  2GQQ A;  1XS9 A;  1PUF B;  1JUS A;  4XKV A;  3U2R A;  1KA8 A;  1R1T A;  2X6W A;  4LMY A;  2P7C B;  4BEH B;  3JSP A;  3BR6 A;  3SZT A;  2YPR A;  2O5R A;  1ZGJ A;  5A2Q Z;  4LG0 A;  2X9D A;  4BL0 B;  2ISZ A;  2CQN A;  4HV6 A;  2FBI A;  3KP4 A;  2ZFW A;  1XGM A;  5IP7 J;  3MZH A;  4KMF A;  1HW2 A;  4YEL A;  1GDT A;  4HF2 A;  3IWZ A;  2ECB A;  6PAX A;  3GZN B;  2EFW A;  1AWC A;  3SXY A;  2R5Y B;  3LSG A;  1Z91 A;  1ZAR A;  2R7T A;  5F27 A;  1U5T A;  2GZW A;  5CQE A;  1S9H A;  1OYI A;  1E17 A;  1GXQ A;  4M9X A;  3LA3 A;  1GT0 C;  4IVN A;  2DFH A;  2LTP A;  3DXJ F;  1VQ7 I;  4I7H A;  4LOC A;  2P8T A;  4GYG A;  2B9S A;  2KLO A;  2EZK A;  4NBQ A;  2V79 A;  4A3L J;  2V1D A;  3ML6 A;  1O57 A;  4IJA A;  3E6B A;  4V2G A;  4A6D A;  2EBI A;  4WXH A;  2ISY A;  1R5H A;  1W36 C;  3OYM A;  2M4K A;  1CQT A;  1B9M A;  4IHT A;  3O3K A;  3RIR A;  1J0R A;  1Z05 A;  2XKP A;  3H3Z A;  4UY8 I;  3AG2 H;  4IQ4 A;  3BTI A;  2K9S A;  4UUT A;  5L3C A;  4KMU X;  4WXD A;  3CJT B;  2FBH A;  3RPU D;  3SFI A;  2ZSI B;  4C3H J;  1WI9 A;  5H6R A;  5F0F A;  2R7R A;  2G0E A;  2BEO A;  1P92 A;  5ILV A;  4XIC A;  3FXK A;  1Z67 A;  2K3P A;  2CW7 A;  2ZSH B;  3SEQ A;  3SDB A;  2XPW A;  4ZYG A;  2KZG A;  3TW6 A;  2ESN A;  4AWX B;  2CO5 A;  5CVV A;  3REO A;  5E3L A;  3PSI A;  3TOA A;  3BJO A;  4A5N A;  1KU3 A;  2IEK A;  3RJP A;  1XPX A;  3V8L A;  1B8I B;  2Y9Z A;  1G3Y A;  3LQR A;  4Y15 A;  4A3G J;  2ZME C;  2HVR A;  3JRF A;  9ANT A;  4BQO A;  4LGW A;  3SEZ A;  2LY1 A;  3VOD A;  2JK3 A;  2M9H A;  1N77 A;  2XAG A;  1WJE A;  5BS6 A;  1HW1 A;  1RRJ A;  2FBK A;  3BG7 A;  2RKH A;  2EIM H;  3DF8 A;  4DBR A;  2OCC H;  2RC4 A;  4IHY A;  3HL2 A;  4L9N A;  4CIC A;  5LFA A;  3FK7 A;  2MLK A;  3G1L A;  4HQE A;  3OYK A;  3BR0 A;  3F3X A;  3RZO J;  2ZNY A;  3I56 I;  2MH9 A;  3DCF A;  4M3F A;  4XRS A;  2PBI A;  2R7D A;  1GUU A;  5CPR B;  2K3F A;  4RAZ A;  5EEG A;  2DJN A;  1PUE E;  3OIP A;  2IS6 A;  2IGK A;  5LHH A;  2JA8 J;  2L5Q A;  4OIR F;  1J75 A;  1MBJ A;  3LMM A;  4M6V A;  1YI2 I;  4L5I A;  3VDX A;  3W6J B;  1J7K A;  1ULY A;  3R6S A;  3LSR A;  1BA5 A;  4CYC A;  4U0V A;  2A68 F;  3G1O A;  3K4B A;  3KLO A;  1QNT A;  4E7I A;  3O2P E;  4I0B A;  3HRS A;  4EJT A;  3K9T A;  2DAO A;  3RSN A;  4M71 A;  2DFE A;  2FX0 A;  2JUG A;  3GTP J;  1XMX A;  2TDX A;  1QVU A;  1R1U A;  1SVM A;  4LLN A;  5IT9 Z;  1YTY A;  2K9L A;  4IZZ A;  2L3D A;  3F22 A;  1POG A;  1HST A;  2WY8 Q;  3F8M A;  2EV0 A;  3S3N A;  2KZV A;  1FC3 A;  1EF4 A;  2OAZ A;  2DOF A;  3DFG A;  2H8R A;  3CMM A;  2NVY J;  1W7P B;  4OU0 A;  1KU9 A;  2F4M B;  2W4S A;  3J7Z I;  4HDV A;  3W2A A;  4O5V A;  2IS1 A;  5EJC A;  5C44 J;  1I3Q J;  3L9F A;  2ELJ A;  2DCE A;  1QZY A;  2I8D A;  2VJJ A;  4CCL A;  2H1L A;  1OYW A;  1ETK A;  1F9N A;  3DTE A;  1OJL A;  4XKB A;  4G7Z F;  2QA4 I;  5E8G A;  1IUY A;  4MEY F;  2E7W A;  4C2U A;  1XTA A;  4KNY A;  2O8K A;  2XAU A;  2WWY A;  1FTZ A;  3GFI A;  2QKL B;  4PK4 A;  1C0W A;  1Z6T A;  2QF7 A;  2W48 A;  5JLW A;  3S32 A;  3W2W A;  5M5Y J;  2PMZ N;  4ESB A;  1H89 C;  1DP3 A;  2L7M P;  2R92 J;  2YSR A;  1LNW A;  1TT5 B;  4D1Q A;  2RV8 A;  4GO1 A;  4D7M A;  4Y3O A;  4HNU A;  1X3W B;  3AFH A;  1YW7 A;  3G1M A;  5DV5 A;  4HOB A;  1FYK A;  4GRI A;  1B1B A;  2OTL I;  5GAG J;  3JCU C;  1OMI A;  2BOL A;  3E0J B;  2LR8 A;  3KP2 A;  1G3S A;  3CO6 C;  5JR3 A;  4XLE A;  1HXD A;  1MBK A;  3LFU A;  1WCM J;  4ZJZ A;  1MMS A;  2G7H A;  2OBP A;  3GFJ A;  2KJC A;  1HW5 A;  3OL4 A;  2BYV E;  4DYR A;  3C2B A;  4F7Z A;  4CCK A;  1ONV A;  1IV8 A;  3G73 A;  1FOK A;  3R0J A;  1JJ8 C;  3LST A;  3MD2 A;  5L3D A;  3BQY A;  3E7L A;  3FMS A;  4N0B A;  2PI0 A;  1XG1 A;  5BMZ A;  2UUZ A;  4G6T B;  5AON A;  2KT0 A;  1P7J A;  1YJ9 I;  3HOS A;  1UCR A;  3WGH A;  1DU0 A;  3BCB A;  1YLF A;  2FML A;  2HU9 A;  4BHP A;  2IA2 A;  4GYI A;  2M34 A;  1ON1 A;  5J1Y A;  1FY7 A;  3U9G A;  3J80 K;  1RZ4 A;  1TLH B;  1SVO A;  3H3U A;  2DA3 A;  3V4G A;  3DKW A;  5K1Y A;  2OZU A;  4EM1 A;  4MTD A;  4EJU A;  3OYG A;  2XGC A;  3BPV A;  1Z6R A;  3WTW C;  3CMY A;  1JKP C;  2V9K A;  5J4V A;  2H1K A;  2DW4 A;  4BY7 J;  2HKO A;  4KIG A;  2KRC A;  4G6D A;  3L2V A;  2VT2 A;  4GGG A;  4L9J A;  4KIT B;  2M0C A;  1SD6 A;  2O3F A;  2L4M A;  2CUJ A;  1YE9 A;  3COA C;  2HYF A;  3TO6 A;  1SD5 A;  1OLT A;  4C3I J;  5HS9 A;  4L0Y B;  1WJD A;  3CUQ B;  1HSJ A;  3C7J A;  2CV1 A;  1WJC A;  1JTX A;  4IOC F;  1NK2 P;  4PJ0 C;  3VSL A;  5JI6 A;  3MKZ A;  2NVX J;  2JA6 J;  2CW0 F;  2IBD A;  4A12 A;  3ZQC A;  2OJE D;  2NNN A;  4K2E A;  3KEY A;  1QHG A;  2M87 A;  4OAY A;  3ZCO A;  3LAJ A;  2R7W A;  2TRT A;  3GYH X;  2LY2 A;  4XM3 A;  5F64 A;  1J2X A;  4N9H A;  4YFX F;  5ED4 A;  2JPB A;  4IEJ A;  4ZTJ A;  2OD5 A;  1SMY F;  3HGY A;  3VYS B;  4MFE A;  4EM0 B;  4BHB A;  4Y33 A;  1Z3X A;  3OS0 A;  1Z3Y A;  4W97 A;  4XSX F;  1F4K A;  1IDZ A;  2CUZ A;  1HKS A;  2DBB A;  2Z99 A;  3ZPL A;  2WBM A;  1B6A A;  3T1B A;  5JHU A;  3L2U A;  1OCT C;  2AHQ A;  1V3F A;  2CRG A;  3FWE A;  3PUF A;  2F4I A;  4KIS A;  3S14 J;  4BY1 J;  2JA2 A;  2ZB9 A;  3CC4 I;  4P55 A;  2Y48 A;  4BBR J;  1ZK8 A;  4LK1 F;  1FOY A;  2XC7 A;  1YRN B;  3CF5 F;  1UMQ A;  2WAF A;  4V2F A;  2P6T A;  1BI1 A;  3ASO H;  3WTY C;  4J19 A;  2VKH A;  3OS1 A;  2HEO A;  2QWW A;  1IO2 A;  2QGU A;  2DPD A;  3Q0U A;  4FX0 A;  3K4M A;  5FD5 A;  3AG3 H;  1G3T A;  2FOK A;  2L2O A;  3EUA A;  4IF4 A;  4BAY A;  4RDU A;  2D45 A;  1RES A;  4H4K C;  2NVT J;  3K6G A;  2QZ8 A;  3I59 B;  2AQE A;  1EH7 A;  1VND A;  2ZXJ A;  4DJA A;  2WC2 A;  2LK2 A;  3BTJ A;  3KZZ A;  2RDP A;  3JW4 A;  2XKO A;  1XCB A;  2A61 A;  2LG4 A;  3E6D A;  4YEJ A;  4YII A;  5E79 C;  1U78 A;  2YUS A;  1XGO A;  2M4G A;  3EUH C;  2L9V A;  2BXY A;  1STZ A;  5H2F C;  3CP8 A;  2IT0 A;  1AKH A;  3FK6 A;  3TOB A;  2Q2E B;  2JA7 J;  3GWZ A;  1BI2 A;  4LIV A;  4BUP A;  5HDK A;  5ICG A;  3I4M J;  3QYF A;  5FFX A;  3W3C A;  5J3L A;  1PP7 U;  2KRF A;  2VXD A;  4P9U A;  2KRH A;  3LNQ A;  2W1O A;  2ZC2 A;  4IRG A;  2D1V A;  2X48 A;  4UB6 C;  3MCZ A;  4OMZ A;  4HV5 A;  5AIP A;  2O61 A;  2HOS A;  3WU1 B;  2QSF X;  1U9O A;  3PO2 J;  1BI0 A;  3UR3 C;  3N4M A;  4LLL A;  3NRV A;  3BPX A;  2HVQ A;  1BM9 A;  2LSO A;  3FXM A;  1IAW A;  1MMG A;  1KYW A;  5BPI A;  4IOA F;  3HRM A;  3PIP F;  1R00 A;  4PGG A;  4ASN A;  4MTE A;  1XMK A;  1K7A A;  3L1P A;  3RZD J;  1RC9 A;  3D1N I;  1EJ9 A;  4JX4 A;  3ERE D;  1IRF A;  2CMP A;  1ZLJ A;  3PM1 A;  2F6C A;  3ABM H;  1U2W A;  2E2J J;  4CZZ A;  2Y0S A;  3F6V A;  3JAM K;  3F23 A;  1Y0U A;  4D0P A;  2JUC A;  5L3B A;  2Q0O A;  2V1U A;  2XGX A;  2IP2 A;  1KON A;  2VE8 A;  2RQP A;  5M3F J;  5L3E A;  2BE5 F;  5CVJ A;  4CCM A;  1MZB A;  1RIO H;  2XGD A;  3CD6 I;  4BBS J;  1KQ8 A;  3I55 I;  2CWE A;  2X0L A;  2ZXI A;  2R5Y A;  1BW6 A;  2JSC A;  1KYZ A;  2DYS H;  2MYS A;  2HR3 A;  2MSY A;  2LKX A;  1ZGW A;  2IVM A;  1P4A A;  2Q1Z B;  3IL2 A;  1E2X A;  3MFK A;  4QTR A;  1LB2 A;  3GTQ J;  4RB1 A;  1EA3 A;  2E1C A;  2Z9O A;  1K83 J;  4CYD A;  4Z6Y A;  4B8X A;  1FSH A;  4L18 B;  1SVL A;  5LRR A;  4JBA A;  2FA5 A;  4B47 A;  1MSF C;  2WTE A;  2QQB A;  3HIF A;  3HOV J;  3ASN H;  2HTJ A;  1Y1V J;  2KKO A;  1FNN A;  3LAP A;  5E1W A;  4HW0 A;  1I5Z A;  2UZK A;  4I02 A;  3QYE A;  2CQK A;  1G2H A;  2MD5 A;  3A0H C;  1S6L A;  4IRH A;  2JSP A;  3ELK A;  3K1M A;  4LLG F;  2EFN A;  2IGO A;  4M3E A;  4A3F J;  3LSP A;  1X4O A;  4BH9 A;  2KP6 A;  3CUQ C;  3CUQ A;  1UAA A;  2OU2 A;  3MKY B;  3V42 A;  1MJB A;  4XRF A;  4BE0 A;  1F5T A;  1G4D A;  2GLO A;  1QVT A;  2Y31 A;  3UNG C;  2V7F A;  4ZYA A;  4MEX F;  3ULQ B;  1ACI A;  4U0W A;  2HKX A;  3GEZ A;  5D5U B;  1RPW A;  3VOE A;  3WGG A;  4JK1 X;  3TKY A;  1V5E A;  5FGM A;  3OL3 A;  1SMT A;  2LFB A;  3WTT C;  1APL C;  2KJB A;  2M2E A;  3BLY A;  4DZP A;  2WB1 N;  4A3I J;  4B48 A;  4Y17 A;  4RMN A;  3FKI J;  1S7A A;  5IP6 A;  3ERM A;  1T56 A;  5EGO B;  1ZR2 A;  1A5J A;  4OMY A;  1MMN A;  2HZT A;  2HDC A;  1K78 A;  1HC8 A;  5JFR A;  4A0Z A;  5J40 A;  1YO5 C;  3WTZ A;  2XAF A;  4CCJ A;  3QPL A;  4R79 A;  3K69 A;  3TP0 A;  2HZD A;  1MBG A;  4XOP A;  5FRO A;  2NXN B;  1TW3 A;  4HLX A;  3QRF F;  2ZME A;  2QSG X;  3IRR A;  5DCF A;  4DYQ A;  2ID3 A;  1DGR M;  2VKV A;  3WHC A;  1DP7 P;  1LVK A;  3KP6 A;  2JPC A;  1Z77 A;  4O6J A;  2DA2 A;  5LLQ A;  4EGZ A;  1XX5 A;  2DN0 A;  4UUS A;  4ZDP A;  3OSG A;  3OR2 C;  2DFF A;  1LFU P;  1WRJ A;  2FE3 A;  1K6Y A;  1X1B A;  2H09 A;  2FEZ A;  2QCO A;  3CLO A;  3HHG A;  3ZN0 A;  3S1Q J;  3D0S A;  3OMY A;  2XB5 A;  4E7H A;  3BTC A;  3GFM A;  4Y13 A;  2L0K A;  2CUF A;  2X1E A;  3TO9 A;  3ZGK A;  2PN6 A;  4BQN A;  2R93 J;  3QP5 A;  2HPM A;  4EQQ A;  2HQA A;  2HQ5 A;  2EZH A;  4ON0 A;  2GOX B;  2VIX A;  4RGS A;  1QZE A;  2E35 A;  2IRF G;  4XNF A;  2AQF A;  4YRV A;  5KVR A;  2LNB A;  1R6R A;  3GLL A;  1S7O A;  1VTN C;  3DBR B;  3F8N A;  1OR7 C;  2DA4 A;  5F04 A;  1VI0 A;  1I1G A;  3K4J A;  3DU5 A;  4UUS B;  2GBY A;  3LSK A;  1HKQ A;  1DQU A;  1OPC A;  2NVU B;  1Q1H A;  3RTR A;  1U8B A;  5IP9 J;  3CO7 C;  2VAS A;  5F1R A;  1PUF A;  4FE7 A;  3VYU B;  3E5X A;  3PUB A;  4E7K A;  1PJR A;  2BZT A;  1SAU A;  1TZL A;  3J7A O;  3EQL F;  2HGC A;  2CFO A;  3BZ6 A;  3N97 A;  2IGN A;  4XOR A;  4F92 B;  4DIQ A;  5FFZ A;  2BVM A;  3QYB A;  3DBH B;  4P1W A;  1P6R A;  3A01 B;  3TQN A;  2DT6 A;  3OIQ A;  2KFD A;  4LIU A;  3HSE A;  3CCE I;  4MGR A;  1EH8 A;  4MNU A;  4D5F A;  5L3F A;  2JA5 J;  2EZI A;  2A05 A;  1P4X A;  4QPO A;  1SD4 A;  2JN6 A;  4PJN A;  4FCY A;  4PSW A;  2F5F A;  1S8N A;  2KHM A;  2KIF A;  4OAZ A;  4BYY A;  3QPH A;  1A6Q A;  5DCM A;  3JR9 A;  5C3E J;  1WZ2 A;  2VL8 A;  3OWT A;  3KP3 A;  3VEP A;  2ZO4 A;  3K1N A;  3TDZ C;  4YIR X;  5C4J J;  3DKY A;  3OYL A;  3VYR B;  2DA5 A;  3IHU A;  4XRM A;  2EFP A;  1ZLK A;  2M8E A;  2VT3 A;  2E34 A;  3CUO A;  1QPI A;  5LHI A;  1T0F A;  3BC8 A;  4FX4 A;  2DMT A;  1U9N A;  4HST A;  5C4X J;  3QQA A;  3TO7 A;  2JWT A;  4HPQ A;  4YFN F;  1XB4 A;  1ZRF A;  3CLQ A;  2W82 A;  1YQA A;  2CYY A;  2MFZ A;  3CTA A;  4I99 C;  4C30 A;  1Z7U A;  1ITY A;  4M3D A;  3I64 A;  4B4C A;  2GA2 A;  3J7A Y;  2K4J A;  1MSE C;  3HHH A;  1MKM A;  1G59 A;  3OOU A;  1O3Q A;  1AKH B;  3BR3 A;  5CKT A;  1VQN I;  3WG9 A;  3WOD F;  3RDI A;  5KAF C;  3GTM J;  1Y0N A;  4XKW A;  2AO9 A;  1TNS A;  1LQ1 A;  3JTH A;  4OIQ F;  3R0A A;  4PUS A;  1VQL I;  4M74 A;  3S1N J;  1V55 H;  1K61 A;  3H92 A;  2E2I J;  2EH3 A;  4UB8 C;  1QU3 A;  4KN4 X;  2LVS A;  3V7R A;  2VOO A;  1X1P A;  5TGT A;  3CC7 I;  2QQ8 A;  2WAD A;  2R4G A;  3IKV A;  5J1U A;  4IHW A;  2VOP A;  3KE2 A;  2E60 A;  4Y52 J;  2LC2 A;  3CMA I;  2XB0 X;  3D5S C;  4RB2 C;  2DTR A;  5D5V B;  1GV2 A;  3IAS 2;  3WE3 A;  3LSM A;  4A3K J;  2MC3 A;  1WSU A;  4E70 A;  3F8B A;  1IUF A;  2IGM A;  5FKN A;  3K2Z A;  5BPD A;  1JKR C;  2YS9 A;  3NWS A;  4V19 K;  4BDZ A;  3A4C A;  2PEX A;  2V6C A;  3P7N A;  3S93 A;  4CCN A;  2R7F A;  5LBQ A;  4DYC A;  1WFX A;  4HNT A;  4AUX A;  3L2W A;  2F5C A;  5BNG A;  2IS4 A;  2NAZ A;  1F43 A;  3HSR A;  3BG3 A;  1I6X A;  4ZTF A;  4E7Z A;  3KET A;  1BR4 A;  1LE8 B;  2Y69 H;  3CCY A;  1Z0X A;  2HWV A;  3EET A;  4KA4 A;  1WJF A;  5TIS C;  1QPM A;  4IHV A;  2L9N A;  1GVD A;  1RET A;  4II3 A;  4CUG A;  4KT6 A;  3GO5 A;  2JVG A;  5KHD A;  3CJQ B;  4LJZ F;  1UEL B;  1BOB A;  4IPA A;  2F2E A;  5CLS A;  3ZXS A;  2DO7 A;  4FE4 A;  2EB7 A;  4R1H A;  3E5Q A;  2R5Z B;  3ZQQ A;  1XSX A;  1HKT A;  3FHZ A;  4CHU A;  2DA7 A;  4QLC U;  5IYD J;  2VN2 A;  4GDF A;  3OR1 C;  2OV7 A;  3JRB A;  2F5D A;  2A6E F;  3EYY A;  1Y39 A;  5CVR A;  5HLT A;  2MBF A;  3AAF A;  1OCR H;  2EIL H;  3WG7 H;  3PNT A;  1HA8 A;  2KIU A;  1D8K A;  1YIT I;  4NUB A;  4IHX A;  3G6E I;  3AG1 H;  2E1N A;  2QQA A;  3Q9V A;  5DS9 A;  3EUK L;  1ZTR A;  2XGE A;  2LY9 A;  4MQ9 F;  2OF7 A;  4HX7 A;  4ZYH A;  2OUM A;  2YU9 J;  1O7F A;  4CA0 A;  2BY1 A;  3ZQ7 A;  2K9Q A;  2CG4 A;  1FP1 D;  1W0U A;  1E3P A;  1MGT A;  2ZME B;  3DPL C;  3EPZ A;  2CW8 A;  2IAI A;  3IH3 A;  3HOT A;  5FRM A;  5ICF A;  3SFZ A;  1VQ9 I;  1D5Y A;  2JT1 A;  2VKD A;  4XLH A;  4Q4Z F;  4FHT A;  2Q8K A;  1BN5 A;  2DJI A;  5BQT A;  1E3H A;  2PLY A;  3HTU A;  1TWA J;  4EJO A;  3IAM 2;  3MVP A;  5DEQ A;  1JT0 A;  3A0B C;  3DP7 A;  3WU0 A;  1ZG3 A;  2E1M C;  3PNY A;  3AL0 C;  4XMY A;  4F91 B;  1SFE A;  1H9T A;  3QU6 A;  4AD9 A;  1IXR C;  3ESW B;  5F08 A;  1JTY A;  3PSF A;  4RBO A;  4XON A;  3W6V A;  4ZH4 F;  2D1H A;  2DMU A;  1R49 A;  3ZMD A;  1AA7 A;  5E18 F;  1O4X A;  2LF8 A;  1T38 A;  5EYR A;  3KFW X;  1RUN A;  5GPA A;  1DU6 A;  2O8X A;  1NH3 A;  5IYC J;  2X6O A;  2XF7 A;  1XSD A;  2QKM B;  2UXX A;  1UB9 A;  4CZC A;  3W6K B;  3ZQL A;  1O3T A;  1IN5 A;  3GTG J;  4AU7 A;  4EVI A;  4IX7 A;  4BE2 A;  2NS8 A;  2DOD A;  2O03 A;  4BNC A;  3BQZ A;  2TCT A;  1PVE A;  1LPQ A;  1FYL A;  4W1U A;  1OQY A;  2Y30 A;  5ILU A;  3JRG A;  4KT5 C;  1K6O A;  2FUG 2;  2A5Y B;  1X1D A;  2I5U A;  1W36 D;  3FIS A;  4EJV A;  5DM6 F;  3OY9 A;  1VQ5 I;  1DUX C;  3IKT A;  3VWB A;  2FOW A;  3FDY A;  2P7V B;  1AOY A;  4BAC A;  4QWQ A;  1S3J A;  4XRS G;  2LBF A;  3CDI A;  2DOE A;  4L0Z B;  1L0O C;  4XQF A;  1UZC A;  1ON2 A;  4ZZL A;  5HLH A;  3A02 A;  1Z7L A;  1ETY A;  3TP3 A;  1SFU A;  3OSF A;  3HRT A;  3MMY B;  3IH4 A;  2FNA A;  2VB6 A;  4XN0 A;  1BBY A;  1W5T A;  2OPT A;  2DI3 A;  1IC8 A;  1YS7 A;  2K7L A;  3NQO A;  2Z16 A;  5E3O A;  3CZ6 A;  3ZR8 X;  3CME I;  3PO3 J;  2R7S A;  2M5W A;  1A04 A;  3ABT A;  2NOJ B;  3C18 A;  1J09 A;  1VQ8 I;  3B02 A;  1BJA A;  2KIS A;  1T95 A;  2GM4 A;  4E4H A;  3F0C A;  3FF5 A;  3ZQF A;  2G7U A;  3A2K A;  4U7D A;  3GTL J;  2JJ7 A;  5J1R A;  4HEA 2;  4AYB N;  4HQM A;  3OYC A;  2E36 A;  5TJJ A;  2C6Y A;  1W1W E;  2FF4 A;  2LOO A;  2L02 A;  4C2M J;  1REP C;  3L2C A;  1V5F A;  3ZQH A;  3K4K A;  1SFX A;  1YX5 A;  2E19 A;  4FT8 A;  1MBE A;  2P6S A;  3BJ6 A;  1IG7 A;  2VE9 A;  2X51 A;  2LBF B;  4A6E A;  2YR2 A;  4M3B A;  1IN7 A;  3Q5F A;  2YX4 A;  1UG0 A;  2D2W A;  2X6X A;  3H9J A;  5DUK A;  3HJE A;  3Q9S A;  1D1B A;  1BR2 A;  3HBL A;  3PL8 A;  5HDG A;  3C2H A;  2F5E A;  3HUG B;  2P0W A;  4NC8 A;  3M1C A;  4IXA A;  5FLM J;  3OYJ A;  3H0D A;  1CF7 A;  3OYH A;  4KIF A;  3L7W A;  3KP5 A;  4UUV A;  1SFK A;  1IV6 A;  4IHS A;  3GW2 A;  3K1P A;  4UHT A;  2ETH A;  1A36 A;  5CVU A;  1FSE A;  1QZZ A;  2DDA A;  2M45 A;  3GZ5 A;  4CH7 A;  1R5G A;  3BG5 A;  2R7U A;  4AM3 A;  4JQF A;  1UHW A;  5M5W J;  5GTI C;  2QLZ A;  3DPU A;  3HTS B;  4HX8 A;  2QEN A;  3DEE A;  2VC0 A;  3DQV C;  4XLF A;  2HQR A;  1IRG A;  1LDK B;  3SDG A;  4HG2 A;  5EZG A;  2L7Z A;  1SAX A;  1HF0 A;  3S3M A;  2RAE A;  4ENJ A;  5L3G A;  3F21 A;  4ZC3 A;  2Z2S B;  1FMV A;  2M7B A;  1ZG1 A;  3T0Y A;  3BR1 A;  3E3V A;  2FU4 A;  1A6I A;  3ECO A;  3WE2 A;  5DCM B;  2QM3 A;  3VSK A; 
#chains in the Genus database with same CATH homology
 5HLG A;  4BQA A;  3QPT A;  3BDD A;  1R1V A;  2H6C A;  2NS0 A;  2VBW A;  2MA3 A;  3RYP A;  2L4A A;  2V9V A;  2P5V A;  5H20 A;  2M1B A;  3K0L A;  1FZP B;  4WF2 A;  2PJP A;  1TBX A;  4I0A A;  2E7X A;  1T98 A;  2OA4 A;  2ELH A;  4M6Y A;  2XHK A;  4ZYD A;  4GXO A;  3QOP A;  1KQ9 A;  4S04 A;  2XRO A;  3GF2 A;  2XRN A;  4RGX A;  2J5O A;  1FP2 A;  4I98 B;  4ENM A;  4OOI A;  2V1X A;  5LEK A;  3R60 A;  3I4P A;  3FMR A;  5H6Q A;  4DNC A;  1YYV A;  3JTG A;  2JTV A;  4ETS A;  3I5U A;  2WV0 A;  5K5O A;  5DYM A;  3I53 A;  1YIO A;  5DD8 A;  2H27 A;  2EA4 A;  2QUF A;  4KIC A;  4I01 A;  2XV4 S;  1ZYR F;  4HLY A;  1T39 A;  4OIO F;  5K5R A;  4M6X A;  5HS8 A;  3O6B B;  4MHG A;  3EDP A;  3M8E A;  1ZRE A;  1TW2 A;  5D6E A;  3ISP A;  3ZMV A;  1R7J A;  3I0T A;  1Z9C A;  3L00 A;  2STT A;  4AIJ A;  1ZRC A;  1B4A A;  1CF7 B;  4P9F A;  4HBL A;  4AIH A;  5HDN A;  2Z33 A;  1IXS B;  1T2K A;  5BOX A;  1TNT A;  1U6G A;  4KUM A;  4EV0 A;  3ZMS A;  2EFQ A;  4CGZ A;  2QQ9 A;  4MQV A;  2VXZ A;  2Z5U A;  3F72 A;  1FWZ A;  1YW8 A;  2EJR A;  3E6C C;  4WK8 F;  4U7B A;  1D5V A;  3WTU C;  2AXL A;  1ZHF A;  3ECH A;  4I09 A;  3KP7 A;  2DK5 A;  2L01 A;  5DD4 A;  4M9Z A;  4XSZ F;  3GFL A;  3GUD A;  3FXU A;  5FLX Z;  2FRH A;  2PMU A;  2CFX A;  1MD0 A;  2KIM A;  5HOO A;  1WWX A;  3ZMZ A;  4G94 A;  3OOP A;  2NNY A;  4Q48 A;  5D8L B;  4BHC A;  2JRT A;  2GXB A;  1J9I A;  4IRI A;  2DFI A;  3KEQ A;  3GXO A;  1J59 A;  2EV6 A;  2AS5 F;  2A07 F;  3V8J A;  2EWN A;  3FZV A;  4LD5 A;  3VB2 A;  3HRU A;  3PFI A;  3CDH A;  2YX7 A;  2Q2E A;  5J8F A;  2GAU A;  4PCQ A;  5IT9 K;  2UXN A;  2XAS A;  2H6B A;  4ZZD A;  2P5L C;  1IW7 F;  2W57 A;  4EJW A;  2VC1 A;  1XDS A;  3P9C A;  1LDD A;  1O3R A;  1TQP A;  2O6G E;  3JSO A;  2COM A;  1LJ9 A;  1BI3 A;  5LGN A;  1RUO A;  2R3S A;  4UV8 A;  4RGU A;  3SQN A;  2DLL A;  5CVI A;  2UWM A;  1QQI A;  1LEA A;  2A6H F;  4ENK A;  5DDG A;  2GXG A;  1G6N A;  1TQI A;  4L9T A;  3ZP5 A;  4YG2 F;  4HZF A;  4G8X A;  2EA2 A;  1FYM A;  1SD7 A;  2P4W A;  4UVA A;  2IW5 A;  3KZY A;  4HA8 A;  3LQQ A;  1ZGA A;  1J5Y A;  1NHA A;  2HQN A;  1R58 A;  3LA2 A;  1XGN A;  2IA0 A;  3U1D A;  3RPU A;  4U88 A;  2XAJ A;  2B0L A;  3F8F A;  4G7O F;  1U5T B;  4HAM A;  3OV8 A;  1IN6 A;  3S2W A;  1FX7 A;  1KU2 A;  4L9V A;  4RS8 A;  3I71 A;  3P9I A;  1LEB A;  4LG0 B;  3M8F A;  1USS A;  4XLN F;  1R22 A;  4M9S A;  4N9I A;  3FX3 A;  2G9W A;  4CO8 A;  4CDG A;  1PP8 F;  3BOQ A;  3R61 A;  5E8I A;  5E20 A;  3LFK A;  2Y0M A;  1FBU A;  1K78 B;  5ILS A;  4A0Y A;  2HYG D;  1ODD A;  5LGT A;  1I27 A;  1FT9 A;  4UNO A;  2LKP A;  3D5L A;  1QBJ A;  3MAJ A;  2DU9 A;  4G9Y A;  4P96 A;  3KLN A;  2DQR A;  1XDU A;  4A2U A;  1XGS A;  4ESJ A;  2Y75 A;  2DQL A;  2VBZ A;  5K5Q A;  3V7C A;  3EUH A;  3HSF A;  5F6F A;  1B9N A;  2QYO A;  1T6S A;  2MH2 A;  1O7L A;  1S29 A;  1R23 A;  1YW9 A;  4NB5 A;  1X3U A;  2XAQ A;  4LK0 F;  2QBY A;  2L54 A;  2IJL A;  3FXR A;  4Z2Y A;  3MZY A;  2K27 A;  1BOA A;  1MJ9 A;  5ICC A;  4P5O A;  1K79 A;  4B09 A;  3DPT A;  4DQ2 A;  5D5X B;  3V7S A;  3M9A A;  2NRA C;  3T8R A;  1XSV A;  1KQ0 A;  1UST A;  2ZKZ A;  4WXC A;  2LF7 A;  4UVC A;  3JAM Z;  4WWC A;  2VOD A;  1GVJ A;  3WGI A;  3P9K A;  5HLI A;  1EV7 A;  2K4B A;  1W7P A;  2FNP A;  3R4K A;  4RGR A;  1XN7 A;  5D6F A;  3DV8 A;  4XLP F;  1WKM A;  5D5W B;  3GZ6 A;  1IF1 A;  3MEX A;  1JHH A;  1LVA A;  1W4M A;  3G3Z A;  3I54 A;  3ROU A;  4WCG A;  1QGP A;  3J80 Z;  3RKY A;  1U8R A;  4UV9 A;  2RVC A;  4G7H F;  2O0Y A;  1TTY A;  1KGS A;  3PQJ A;  3L09 A;  3RPQ A;  2ACJ A;  4H0E A;  2DPU A;  4EMS A;  2GA1 A;  4YFK F;  5LEJ A;  2PG4 A;  5LRS A;  2ZJ2 A;  1GHC A;  2PFB A;  2MLG A;  1P2F A;  3DEU A;  5TRD A;  1IXC A;  1JE8 A;  3SHF A;  1I1S A;  4HF1 A;  2W25 A;  4S05 A;  1LDJ A;  2BV6 A;  3J81 K;  2NYX A;  1IN8 A;  2DK8 A;  3IC7 A;  3ZN1 A;  4TV7 A;  4PZJ A;  4OIP F;  3FM3 A;  3E5U A;  5D8K B;  4UXN A;  5FD6 A;  5EEH A;  3WTS C;  1KU7 A;  3FMQ A;  2JZY A;  1IZ1 A;  1MJA A;  4NHJ A;  4KN7 X;  2HS5 A;  1HQC A;  1H9G A;  1UFM A;  1XCV A;  1UHM A;  4I2O A;  3TDU C;  4Q5S F;  2IA1 A;  4RB3 C;  3WTX C;  5IT3 A;  2HOE A;  1P4W A;  1MDM B;  2M30 A;  4ENN A;  5LHG A;  2A3S A;  2VBX A;  2QVO A;  1U3E M;  3E97 A;  4LB5 A;  1H0M A;  2P5K A;  2OQG A;  2FMY A;  4ESF A;  4PDK A;  3M1E A;  1XD7 A;  1DPR A;  2W24 A;  4R8H A;  1TQM A;  4A0X A;  5E1Z B;  1YG2 A;  5JVT A;  4LB6 B;  4HF0 A;  3QU3 A;  2CSO A;  1GXP A;  2ZCW A;  3BRO A;  2RGV A;  1W5S A;  1ZN2 A;  1BC8 C;  3T8T A;  5KK1 A;  4XBF A;  4O3M A;  5AIQ A;  4PGH A;  2EK5 A;  4LFU A;  3WTV C;  2HFH A;  5J6X A;  3V8K A;  3VFZ A;  3ZMU A;  3GVA A;  2XUB A;  2W85 A;  1B59 A;  2RN7 A;  1JXS A;  4HDU A;  3F8C A;  3RYR A;  1MDM A;  5FLX K;  3I58 A;  3KEO A;  2BBY A;  1WQ2 A;  3SZP A;  3BY6 A;  1U5T C;  4A5M A;  1XMA A;  2XIG A;  2Z3Y A;  1JGS A;  4RB0 A;  1DDN A;  4KIB A;  4KDP A;  1RNL A;  1FPQ A;  3C1D A;  4EM2 A;  5D4S A;  4RAY A;  1ZG5 A;  4G6Q A;  2OZ6 A;  3TGN A;  4AIK A;  2ZBK A;  3HYI A;  4UVB A;  3RKX A;  1R36 A;  3ZMT A;  1QO0 D;  1BC7 C;  2XAH A;  4YIF A;  2YU3 A;  1ZAO A;  2RNJ A;  3IRQ A;  1W7P D;  1O3S A;  2FSW A;  4HYE A;  1RI7 A;  5DUI A;  1PDN C;  1IN4 A;  1OYY A;  2A69 F;  3PQK A;  2FQ3 A;  5ERI A;  3T5X A;  2BGC A;  1ZH5 A;  1FBQ A;  1G3W A;  3CJN A;  1L3L A;  5LGU A;  3EYI A;  4M72 A;  4Q47 A;  3LWF A;  3MWM A;  2J5P A;  2K02 A;  4M73 A;  2EV5 A;  2FXA A;  2ESH A;  3HUG A;  2PMH A;  4CXF A;  4L5J A;  5FB2 A;  3KCC A;  3GX4 X;  2H94 A;  5CYV A;  1OR7 A;  4EGY A;  3BP8 A;  4OIN F;  2W84 A;  3E6M A;  2STW A;  5D4R A;  3ABU A;  4KFC A;  5E17 F;  2XVC A;  5ICE A;  2PQ8 A;  4AVP A;  5J8C A;  1EH6 A;  4WX9 A;  3M7G A;  2VBY A;  2ADU A;  1F1Z A;  2VON A;  3LA7 A;  1CGP A;  4KYW A;  3B73 A;  3C3W A;  2DT5 A;  2IPQ X;  2EFO A;  1YFH A;  3GLX A;  3BJA A;  1JHF A;  2GIV A;  1V4R A;  2LDU A;  3IWF A;  1YS6 A;  4NQW A;  3NEU A;  5CJ9 A;  3QAH A;  2QBY B;  1ZRD A;  1OKR A;  3FM5 A;  4GCV A;  3RKW A;  3I59 A;  4BXU A;  5E1X A;  2K86 A;  1FBS A;  1DPU A;  5A2Q K;  1BIB A;  2GWR A;  4U0Y A;  3RI4 A;  2ZNZ A;  3QP6 A;  2X4H A;  1Z1D A;  1BIA A;  1D3Y A;  3BWG A;  2HTS A;  3MQ0 A;  2OQR A;  5FO5 A;  2CGP A;  3J81 Z;  3FXQ A;  4ZYE A;  5HVQ C;  4HX4 A;  5HS7 A;  1D8J A;  1FLI A;  3F6O A;  2GQQ A;  3U2R A;  1KA8 A;  1R1T A;  4LMY A;  2P7C B;  3JSP A;  3SZT A;  2YPR A;  1ZGJ A;  5A2Q Z;  4LG0 A;  2ISZ A;  4HV6 A;  2FBI A;  3KP4 A;  2ZFW A;  1XGM A;  3MZH A;  4KMF A;  1HW2 A;  4HF2 A;  3IWZ A;  6PAX A;  2EFW A;  1AWC A;  3SXY A;  1Z91 A;  1ZAR A;  1U5T A;  2GZW A;  1OYI A;  1E17 A;  1GXQ A;  4M9X A;  3LA3 A;  4IVN A;  3DXJ F;  4I7H A;  2P8T A;  4GYG A;  2V79 A;  2V1D A;  3ML6 A;  1O57 A;  4IJA A;  3E6B A;  4A6D A;  4WXH A;  2ISY A;  1R5H A;  1B9M A;  4IHT A;  3O3K A;  3RIR A;  1J0R A;  1Z05 A;  2XKP A;  3H3Z A;  5L3C A;  4KMU X;  4WXD A;  2FBH A;  1WI9 A;  5H6R A;  2BEO A;  1P92 A;  5ILV A;  4ZYG A;  2ESN A;  4AWX B;  2CO5 A;  5CVV A;  3REO A;  3TOA A;  3BJO A;  4A5N A;  1KU3 A;  3RJP A;  3V8L A;  1G3Y A;  3LQR A;  4Y15 A;  4LGW A;  3VOD A;  2XAG A;  5BS6 A;  1HW1 A;  2FBK A;  2RKH A;  3DF8 A;  2RC4 A;  4L9N A;  4CIC A;  2MLK A;  4HQE A;  3F3X A;  2ZNY A;  2MH9 A;  2PBI A;  2R7D A;  4RAZ A;  5EEG A;  1PUE E;  5LHH A;  4OIR F;  1J75 A;  4L5I A;  3W6J B;  1J7K A;  1ULY A;  3R6S A;  4U0V A;  2A68 F;  3KLO A;  1QNT A;  3O2P E;  4I0B A;  3HRS A;  4EJT A;  3K9T A;  2DAO A;  4M71 A;  2TDX A;  1R1U A;  4LLN A;  5IT9 Z;  1YTY A;  2L3D A;  3F22 A;  1HST A;  3F8M A;  2EV0 A;  1FC3 A;  2OAZ A;  3DFG A;  1W7P B;  4OU0 A;  1KU9 A;  4HDV A;  4O5V A;  3L9F A;  1QZY A;  1OYW A;  1F9N A;  4G7Z F;  5E8G A;  1IUY A;  4MEY F;  2E7W A;  4KNY A;  2WWY A;  3GFI A;  1C0W A;  1Z6T A;  4ESB A;  2YSR A;  1LNW A;  2RV8 A;  4GO1 A;  1YW7 A;  5DV5 A;  4HOB A;  1FYK A;  1B1B A;  1OMI A;  3KP2 A;  1G3S A;  3CO6 C;  5JR3 A;  1HXD A;  2G7H A;  2OBP A;  3GFJ A;  2KJC A;  1HW5 A;  2BYV E;  4F7Z A;  1ONV A;  3G73 A;  1FOK A;  3R0J A;  3LST A;  5L3D A;  3FMS A;  2PI0 A;  4N0B A;  5BMZ A;  5AON A;  3HOS A;  1UCR A;  3WGH A;  1YLF A;  2FML A;  4BHP A;  2IA2 A;  4GYI A;  1ON1 A;  1FY7 A;  3U9G A;  3J80 K;  1RZ4 A;  1TLH B;  3H3U A;  3V4G A;  3DKW A;  5K1Y A;  2OZU A;  4EM1 A;  4MTD A;  4EJU A;  3BPV A;  1Z6R A;  3WTW C;  2DW4 A;  2HKO A;  4KIG A;  4G6D A;  2VT2 A;  4GGG A;  4L9J A;  1SD6 A;  2O3F A;  2L4M A;  3COA C;  2HYF A;  3TO6 A;  1SD5 A;  5HS9 A;  4L0Y B;  3CUQ B;  1HSJ A;  3C7J A;  5JI6 A;  2CW0 F;  4A12 A;  2NNN A;  4K2E A;  2M87 A;  3LAJ A;  3GYH X;  5F64 A;  1J2X A;  4N9H A;  4YFX F;  5ED4 A;  2JPB A;  2OD5 A;  1SMY F;  4EM0 B;  4BHB A;  4XSX F;  1F4K A;  1HKS A;  2DBB A;  2Z99 A;  3ZPL A;  1B6A A;  3T1B A;  5JHU A;  1V3F A;  3FWE A;  4P55 A;  2Y48 A;  4LK1 F;  2P6T A;  1BI1 A;  3WTY C;  2HEO A;  2QWW A;  2DPD A;  4FX0 A;  5FD5 A;  1G3T A;  2FOK A;  4IF4 A;  4BAY A;  2D45 A;  2QZ8 A;  3I59 B;  1EH7 A;  2ZXJ A;  2WC2 A;  3KZZ A;  2RDP A;  3JW4 A;  2XKO A;  1XCB A;  2A61 A;  3E6D A;  4YII A;  1U78 A;  1XGO A;  1STZ A;  2IT0 A;  3TOB A;  3GWZ A;  1BI2 A;  5HDK A;  5ICG A;  5FFX A;  1PP7 U;  2KRF A;  4P9U A;  4IRG A;  2D1V A;  3MCZ A;  4OMZ A;  4HV5 A;  5AIP A;  2O61 A;  3WU1 B;  1BI0 A;  3N4M A;  4LLL A;  3NRV A;  3BPX A;  1BM9 A;  2LSO A;  1IAW A;  1KYW A;  5BPI A;  3HRM A;  1R00 A;  4PGG A;  4ASN A;  4MTE A;  1XMK A;  1K7A A;  3ERE D;  1IRF A;  1ZLJ A;  1U2W A;  4CZZ A;  3F6V A;  3F23 A;  3JAM K;  1Y0U A;  4D0P A;  5L3B A;  2Q0O A;  2V1U A;  2XGX A;  2IP2 A;  2RQP A;  2VE8 A;  5L3E A;  2BE5 F;  5CVJ A;  1RIO H;  1MZB A;  1KQ8 A;  2CWE A;  2X0L A;  2JSC A;  1KYZ A;  2HR3 A;  2IVM A;  1P4A A;  3IL2 A;  1E2X A;  3MFK A;  1LB2 A;  4RB1 A;  2E1C A;  2Z9O A;  4CYD A;  4B8X A;  1FSH A;  4L18 B;  5LRR A;  4JBA A;  2FA5 A;  2WTE A;  2QQB A;  3HIF A;  2HTJ A;  2KKO A;  1FNN A;  3LAP A;  5E1W A;  4HW0 A;  1I5Z A;  2UZK A;  4I02 A;  2CQK A;  2MD5 A;  1S6L A;  4IRH A;  3K1M A;  3ELK A;  4LLG F;  2EFN A;  4BH9 A;  3CUQ C;  3CUQ A;  2OU2 A;  1MJB A;  4XRF A;  1G4D A;  1F5T A;  4MEX F;  3ULQ B;  4U0W A;  2HKX A;  3GEZ A;  5D5U B;  3VOE A;  3WGG A;  3TKY A;  4JK1 X;  5FGM A;  1SMT A;  3WTT C;  2KJB A;  4Y17 A;  1S7A A;  4OMY A;  2HZT A;  2HDC A;  1K78 A;  5JFR A;  4A0Z A;  1YO5 C;  3WTZ A;  2XAF A;  4R79 A;  3K69 A;  1TW3 A;  4HLX A;  3QRF F;  2ZME A;  3IRR A;  5DCF A;  1DP7 P;  3KP6 A;  2JPC A;  4O6J A;  5LLQ A;  4EGZ A;  1WRJ A;  2FE3 A;  2H09 A;  3HHG A;  3ZN0 A;  2FEZ A;  3CLO A;  3D0S A;  3GFM A;  4Y13 A;  3TO9 A;  2PN6 A;  3QP5 A;  4EQQ A;  4ON0 A;  4RGS A;  2IRF G;  5KVR A;  2LNB A;  1S7O A;  1VTN C;  3F8N A;  1I1G A;  1HBX G;  1HKQ A;  3RTR A;  1OPC A;  1Q1H A;  3CO7 C;  5F1R A;  3E5X A;  3J7A O;  3EQL F;  2HGC A;  3BZ6 A;  3N97 A;  5FFZ A;  1P6R A;  3TQN A;  3HSE A;  4MGR A;  1EH8 A;  4MNU A;  5L3F A;  1P4X A;  1SD4 A;  2F5F A;  1S8N A;  2KIF A;  4BYY A;  3QPH A;  5DCM A;  3KP3 A;  3VEP A;  2ZO4 A;  3K1N A;  3TDZ C;  3IHU A;  1ZLK A;  2EFP A;  2M8E A;  2VT3 A;  3CUO A;  5LHI A;  1T0F A;  4FX4 A;  3TO7 A;  4YFN F;  1XB4 A;  1ZRF A;  3CTA A;  1YQA A;  2CYY A;  1Z7U A;  3I64 A;  2GA2 A;  2K4J A;  3HHH A;  1MKM A;  1O3Q A;  3WG9 A;  3WOD F;  3RDI A;  1TNS A;  1LQ1 A;  3JTH A;  4OIQ F;  3R0A A;  4M74 A;  3H92 A;  4KN4 X;  3V7R A;  2VOO A;  3IKV A;  2VOP A;  3KE2 A;  4RB2 C;  2DTR A;  5D5V B;  3WE3 A;  1WSU A;  2MC3 A;  4E70 A;  3F8B A;  3K2Z A;  5BPD A;  2PEX A;  2V6C A;  3P7N A;  2R7F A;  5LBQ A;  2F5C A;  2NAZ A;  3HSR A;  1I6X A;  3KET A;  3EET A;  4KA4 A;  2HWV A;  1QPM A;  3GO5 A;  4LJZ F;  4IPA A;  2F2E A;  5CLS A;  2DO7 A;  2EB7 A;  4R1H A;  3E5Q A;  1XSX A;  1HKT A;  3FHZ A;  4CHU A;  4QLC U;  2VN2 A;  2F5D A;  2A6E F;  3EYY A;  5CVR A;  2MBF A;  3AAF A;  2KIU A;  1D8K A;  2E1N A;  2QQA A;  3Q9V A;  4MQ9 F;  4HX7 A;  4ZYH A;  1O7F A;  3ZQ7 A;  2CG4 A;  1FP1 D;  1MGT A;  2ZME B;  3DPL C;  3HOT A;  5ICF A;  3SFZ A;  2JT1 A;  4Q4Z F;  4FHT A;  2Q8K A;  1BN5 A;  5BQT A;  2PLY A;  3HTU A;  4EJO A;  5DEQ A;  3DP7 A;  3WU0 A;  1ZG3 A;  1SFE A;  1H9T A;  3QU6 A;  4AD9 A;  1IXR C;  4ZH4 F;  2D1H A;  3ZMD A;  5E18 F;  2LF8 A;  1T38 A;  3KFW X;  1RUN A;  2O8X A;  1XSD A;  2UXX A;  1UB9 A;  3W6K B;  1O3T A;  1IN5 A;  4EVI A;  2O03 A;  4BNC A;  1FYL A;  5ILU A;  4KT5 C;  1K6O A;  2A5Y B;  4EJV A;  1DUX C;  3IKT A;  2P7V B;  1AOY A;  4QWQ A;  1S3J A;  4L0Z B;  1L0O C;  1ON2 A;  4ZZL A;  5HLH A;  1SFU A;  3HRT A;  2FNA A;  1BBY A;  1W5T A;  2DI3 A;  1YS7 A;  2K7L A;  3NQO A;  2M5W A;  1A04 A;  3ABT A;  3C18 A;  3B02 A;  1BJA A;  3FF5 A;  2G7U A;  4U7D A;  4HQM A;  5TJJ A;  2C6Y A;  2FF4 A;  2L02 A;  1REP C;  3L2C A;  1SFX A;  4FT8 A;  2P6S A;  3BJ6 A;  2VE9 A;  4A6E A;  2YR2 A;  1IN7 A;  3Q5F A;  2YX4 A;  2D2W A;  5DUK A;  3Q9S A;  5HDG A;  2F5E A;  1CF7 A;  4IXA A;  4KIF A;  3L7W A;  3KP5 A;  4UUV A;  4IHS A;  3GW2 A;  3K1P A;  4UHT A;  2ETH A;  5CVU A;  1FSE A;  1QZZ A;  2M45 A;  3GZ5 A;  1R5G A;  4JQF A;  1UHW A;  2QLZ A;  3HTS B;  4HX8 A;  2QEN A;  3DQV C;  2VC0 A;  1IRG A;  2HQR A;  1LDK B;  1SAX A;  4ENJ A;  5L3G A;  3F21 A;  1ZG1 A;  3T0Y A;  3E3V A;  2FU4 A;  3ECO A;  3WE2 A;  5DCM B;  2QM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...