4HQMA

The crystal structure of qsrr-menadione complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
VCPYLEETFKILGRSWNGLIINYLSRSNDSSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription regulator
molecule keywords QsrR protein
total genus 35
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hqmA00
1D8JA 4L5JA 2RC4A 2DQLA 5HLIA 2QUFA 4EVIA 2VXZA 2A69F 2XVCA 1H9TA 2JT1A 4HX8A 3KZZA 2FA5A 4AIJA 1R00A 3NQOA 4YFNF 2XASA 5E1XA 2OAZA 5LHGA 5FLXZ 3WTUC 2RKHA 3RDIA 4RGXA 3IRQA 4H0EA 5JI6A 1T2KA 5AIQA 2DFIA 2CWEA 1U78A 3BOQA 3WGHA 1ZLJA 3REOA 1ZG1A 1TBXA 2RV8A 1LB2A 1LVAA 2M8EA 5D6EA 1ZAOA 3K1MA 1O7FA 4EM2A 4MGRA 1ONVA 3KP7A 5LGUA 1KU7A 2UXNA 3ZPLA 5ED4A 3MEXA 3CO6C 3F23A 2A6EF 1QZYA 2OU2A 2HYFA 2PFBA 2ZCWA 5BPDA 5TRDA 4U7DA 3DPLC 2FBIA 1SMTA 1XDSA 2XRNA 1GXQA 1PUEE 1Z6RA 5H20A 2PMUA 2P6SA 2YSRA 2XKOA 2K7LA 3E6CC 4KNYA 4ZZDA 3K1NA 4G8XA 3VEPA 1E2XA 1ZRDA 1XMKA 3R6SA 4CZZA 1BN5A 2ELHA 3EUHA 1SD4A 2L54A 4L5IA 1SAXA 2GXGA 4I01A 4CDGA 5AONA 3TGNA 5HDKA 2GAUA 2EWNA 3CJNA 4MHGA 4HF2A 2LSOA 4IXAA 1ZHFA 4U0YA 3LFKA 2HQRA 4CYDA 2D1VA 2L01A 1J2XA 5L3CA 4HLYA 3P7NA 4UV9A 3HSEA 3M8EA 5D5XB 3ZMDA 3ULQB 4WX9A 3P9IA 4L0ZB 5CLSA 4IF4A 1LDDA 1S29A 4IHSA 4I98B 5HVQC 1HW1A 4EJVA 4EGYA 3LSTA 1RUOA 1YFHA 4MQVA 1TQPA 4UHTA 1QQIA 1QZZA 4CICA 2A3SA 1DUXC 1W4MA 5E8GA 2DK5A 5D5VB 3V7RA 2OZ6A 1WWXA 1YW8A 3JW4A 4XSZF 3K1PA 2L4MA 1JHHA 2NRAC 2NAZA 1TW2A 4RAYA 3VOEA 1R1UA 4G6QA 1BJAA 2UWMA 4I0BA 3H92A 2IA1A 3K69A 2YX7A 3VFZA 3HIFA 1WSUA 1PP8F 2LNBA 1MKMA 4RB2C 3KETA 2COMA 1BOAA 1P6RA 1TQMA 1KQ8A 3W6JB 2DQRA 2ESNA 4L9JA 4HZFA 4GGGA 4P5OA 1DP7P 2H6BA 3V7SA 4B09A 1FC3A 4AVPA 4ASNA 4N9HA 4LGWA 2NNYA 4ENNA 2P8TA 4KIBA 1F5TA 4I0AA 2O0YA 4NB5A 1T38A 4ZYHA 2ZNYA 4KUMA 4KN4X 1ZARA 1O3RA 1W7PB 2F5CA 1YYVA 1T6SA 3F6VA 4MQ9F 2BEOA 3ZP5A 1OYWA 1JHFA 4BXUA 4UVAA 2QVOA 3NRVA 4RGUA 2K02A 4M9ZA 4HLXA 5DCMB 1R23A 2W24A 3WE3A 1BI2A 2EFQA 3FHZA 3PQJA 3QP5A 3EYYA 1ZGAA 3SHFA 2QBYA 4UV8A 1DPRA 4KIGA 2XROA 3LA3A 1BIAA 1YQAA 3CTAA 1B6AA 1BI0A 3WGGA 4P9UA 4G7OF 3S2WA 3GWZA 2H6CA 1WQ2A 3H3UA 3LWFA 1O3QA 4IHTA 4M6YA 5BQTA 1F9NA 4HA8A 3HOTA 2L4AA 4M71A 2XIGA 1SFUA 1Z91A 4LLGF 2A68F 5CJ9A 1IRFA 2VC0A 1GHCA 1XB4A 4RB1A 1MJAA 4O3MA 2IPQX 2P5LC 1J0RA 1USTA 1UCRA 2XAJA 4LMYA 2CW0F 3BZ6A 4M72A 1K7AA 5HS7A 2FNAA 4HX4A 5D6FA 1UHWA 3J81K 1RUNA 3ZMUA 1FPQA 2XAHA 3ZMSA 1TNTA 1U2WA 4Y15A 4A2UA 4L0YB 2HKXA 2G7HA 1X3UA 1U8RA 2M30A 4MEYF 5HLHA 1UFMA 1BI3A 2V6CA 2RGVA 1KGSA 2DK8A 4GYGA 3EYIA 2Z5UA 4R79A 2WWYA 4YIIA 3BJ6A 1MGTA 2GZWA 2K27A 4OIRF 2JSCA 1G3TA 3W6KB 3IL2A 5F64A 2MH9A 4GXOA 3KZYA 5F1RA 1FBSA 2D2WA 3CUQC 3IC7A 2XAQA 1BIBA 2VT3A 3M1EA 3WE2A 1YG2A 3G73A 2LKPA 5A2QZ 2A07F 3M8FA 3JTHA 1IRGA 4PDKA 1LJ9A 3ZN0A 3BJAA 2MBFA 3VODA 3IWZA 1CF7A 3HTUA 1EH8A 4LFUA 1P2FA 5FD6A 4Q5SF 2NNNA 4U0WA 2ZBKA 4KFCA 3F72A 3L00A 2JTVA 2P6TA 4BAYA 2QLZA 1S6LA 4IRHA 4MEXF 1TW3A 1REPC 3F8CA 3RI4A 4A0XA 3HSFA 3DPTA 2XV4S 1CGPA 4CHUA 4HW0A 4M74A 4M9SA 2ZFWA 1G3WA 2HR3A 3MQ0A 1BC7C 4RGRA 2VBZA 2E7XA 2R7FA 4DQ2A 4HF0A 1TNSA 4I02A 2FMYA 4L9TA 4KYWA 2F5FA 3ABTA 2XKPA 3RPUA 2EV6A 3TDUC 2HOEA 1I1GA 4EM0B 2A5YB 3O3KA 3TO7A 3TO6A 3JAMK 5ICEA 1ODDA 1ZYRF 3I64A 1USSA 3KP3A 2Y48A 4UVBA 4AIKA 4RAZA 1HKSA 4IPAA 2EFWA 4GYIA 4I7HA 2FSWA 5ERIA 3SZPA 1ZLKA 2GQQA 1FBQA 4A5MA 3MAJA 3HRTA 1FNNA 1RI7A 1IXSB 2QQBA 3ZMVA 5FO5A 5D4SA 2Z9OA 4HF1A 1FSEA 2GA1A 4PCQA 1OYYA 3FMQA 3TDZC 1RZ4A 4JQFA 2ZKZA 1FZPB 4FX4A 3LQQA 3MWMA 4OINF 2W25A 4A0ZA 2EB7A 4WXDA 3SXYA 3ZMZA 5D8LB 1Z1DA 2CG4A 4EJOA 3K2ZA 2VN2A 1R58A 5DUKA 3CO7C 1QBJA 1V4RA 5K5OA 4ZZLA 3HRMA 1FOKA 1O57A 3L7WA 1U5TA 5AIPA 4ZYDA 4QWQA 1H9GA 3H3ZA 4ESFA 1C0WA 2ZJ2A 4JBAA 3RPQA 4EJTA 3FXQA 2OQRA 3BJOA 5DYMA 4LJZF 3QOPA 3GEZA 2QENA 3IHUA 3WTZA 1G3SA 1YS7A 4G6DA 1P4AA 2Q0OA 2KIMA 3T1BA 4YG2F 1RIOH 3L09A 2GA2A 4FT8A 5K5RA 5LHHA 2BYVE 5JHUA 2Z33A 3F22A 2XAGA 3CDHA 1FYKA 2FEZA 1J5YA 2VODA 3IKVA 3Q9VA 3IWFA 2DPUA 2Q2EA 2EA2A 2HTJA 5ICGA 1HQCA 2VBYA 3ROUA 2QZ8A 3U1DA 3F8MA 3ABUA 3U2RA 4Z2YA 2PLYA 3DF8A 2JZYA 1HBXG 1ZRCA 4PZJA 2HDCA 2GXBA 2A61A 5FGMA 1B59A 1F1ZA 2HYGD 4OU0A 5LRSA 3E97A 2DBBA 3FX3A 3GF2A 5LLQA 4UNOA 1D5VA 2FE3A 1HKQA 3ZMTA 2V1XA 2Z99A 4OIOF 4YIFA 1XMAA 1WI9A 3MZHA 2O61A 4LK0F 3IKTA 4IRIA 2DT5A 2R3SA 4OIQF 4IRGA 1IUYA 4HAMA 3V8LA 1YTYA 1YIOA 1MZBA 2ZMEB 2E1CA 1BI1A 2RN7A 1ZN2A 2HWVA 1ZGJA 5J8FA 3KCCA 4KT5C 4BHBA 4ENKA 3E6MA 1AOYA 3M9AA 3RKYA 1XGOA 3FXUA 2IT0A 4L18B 3WU0A 4BQAA 2WC2A 3DP7A 5E20A 2GIVA 1T39A 4R8HA 1R5HA 2YX4A 4G9YA 4XBFA 4A6EA 4S05A 3RYPA 2K4JA 3KLNA 1YLFA 3RKXA 1J59A 3HSRA 1IXCA 3C7JA 1SFXA 3GYHX 2W57A 1YS6A 1L0OC 1UHMA 1XSDA 5HS8A 4EJWA 5EEGA 2C6YA 4EMSA 2RDPA 3Q5FA 2VBWA 1OMIA 2JPBA 3TKYA 2M1BA 1LNWA 3BDDA 1RNLA 5ICCA 3J80K 1IXRC 5FB2A 4E70A 3MFKA 3CUQA 4LB5A 2VONA 2A6HF 1LEBA 1MJBA 2LF7A 4PGGA 1HKTA 2FXAA 2OZUA 1EH7A 4MNUA 3LAJA 1WRJA 2IP2A 1YW7A 5TJJA 4WXHA 3EETA 2EJRA 1ZG3A 2VE9A 2JRTA 3WODF 2H94A 1J7KA 1D3YA 1MDMB 2XAFA 2R7DA 5L3DA 1STZA 1MD0A 5LRRA 1PP7U 3IRRA 5D8KB 3U9GA 1AWCA 4KICA 3GZ6A 4YFXF 4KIFA 3MCZA 2EFNA 4HYEA 3RKWA 1E17A 2XUBA 4JK1X 2DLLA 1XSXA 1S8NA 3TOBA 2V79A 4I09A 2D45A 5ILUA 4F7ZA 1LDJA 1IN6A 4FX0A 3F21A 1D8KA 3O6BB 4P9FA 5DCFA 4Y13A 1J75A 1BBYA 2OD5A 4MTDA 3ZQ7A 5K1YA 1NHAA 5L3FA 5ILVA 2LF8A 4Q48A 3WTWC 3RIRA 3NEUA 3J80Z 4RS8A 1CF7B 2V1DA 3JAMZ 2K4BA 4U7BA 1IN7A 2O03A 4EGZA 1JXSA 3ISPA 3Q9SA 1XCVA 5DCMA 2UZKA 1OYIA 2MLGA 4P55A 1J9IA 5EEHA 4OMYA 4U88A 2FOKA 3PFIA 5IT3A 3QP6A 2W84A 2ESHA 3JTGA 2IRFG 3LA2A 4LK1F 3VB2A 3CUOA 4CGZA 4XLPF 4NQWA 5D5UB 4HQMA 5LBQA 1EH6A 3V7CA 5HDGA 3PQKA 1L3LA 4KMUX 3WU1B 3OOPA 4ZYGA 2NS0A 2VBXA 3I0TA 1V3FA 5DUIA 5K5QA 2H27A 4WK8F 4G94A 2OA4A 3QPTA 3DKWA 4O6JA 3WTXC 2AS5F 3R61A 1EV7A 2HQNA 2P4WA 2VE8A 3BP8A 4XSXF 4UXNA 4AD9A 2E7WA 3JSOA 1F4KA 5DDGA 2ACJA 3E5QA 1H0MA 1K6OA 1IW7F 5H6RA 5FD5A 3QRFF 1W5TA 3DEUA 3CUQB 3GFMA 4HDUA 5CVVA 2CFXA 1ZREA 2ZMEA 1XSVA 5FFXA 4DNCA 4EJUA 2G7UA 2FF4A 1MJ9A 2DAOA 3GFLA 1T0FA 4BYYA 1BC8C 1IN5A 4WWCA 1KA8A 3SZTA 1ULYA 2O6GE 1Y0UA 5D4RA 2FBHA 3I59B 2O8XA 4WF2A 3I59A 2HGCA 3HHGA 1XD7A 2VOPA 3BROA 4L9VA 3T5XA 2EV0A 2XGXA 3KEOA 4GO1A 1XDUA 2OBPA 2W85A 1U6GA 1FYLA 2Y75A 1O7LA 1FSHA 1LEAA 1IN4A 3J7AO 1ZG5A 2KIUA 4CXFA 1MDMA 4HV6A 1YO5C 4O5VA 2MD5A 3GLXA 1ZH5A 5E1ZB 5JFRA 4QLCU 3KE2A 5A2QK 1KU3A 3LAPA 1HSTA 5E18F 5E17F 4L9NA 2BV6A 3ML6A 3WTVC 1QGPA 5J8CA 5JVTA 1IZ1A 5LEKA 5KK1A 2EK5A 5ICFA 2LDUA 2YU3A 3FF5A 1S7AA 1R7JA 2BE5F 4XRFA 2MH2A 1P4WA 4OOIA 3C3WA 4OMZA 3R60A 3B73A 4ENJA 5LEJA 3HYIA 4OIPF 5DD8A 1FX7A 2HTSA 4EM1A 4A12A 1O3SA 1KU9A 2FQ3A 4KMFA 3AAFA 4R1HA 1WKMA 4UVCA 2P5VA 3DFGA 4MTEA 5ILSA 1R1VA 5IT9K 3KP6A 5E1WA 1I5ZA 4TV7A 1SMYF 4ENMA 3ECHA 5CVJA 2CYYA 1JGSA 4IVNA 1B9NA 3N4MA 3ERED 2DO7A 4N9IA 3R0JA 1KQ9A 5L3GA 3E5XA 4LD5A 3BPVA 3E5UA 2ZXJA 1JE8A 3C1DA 2NYXA 1IN8A 2PMHA 2MC3A 5J6XA 5L3BA 4P96A 3TO9A 2DI3A 2DW4A 4ESJA 1R36A 2UXXA 5FFZA 3FWEA 2RVCA 3RYRA 1OKRA 4BH9A 1S3JA 2B0LA 4KN7X 2HKOA 3V8KA 4FHTA 3FM3A 5DEQA 1VTNC 3L9FA 2L02A 3FMRA 3KLOA 1HXDA 4HBLA 4BHCA 3L2CA 2IA2A 4ON0A 3GX4X 1I1SA 3E6DA 1Z05A 1KU2A 5DV5A 1SFEA 2OQGA 5JR3A 4Q4ZF 2JPCA 5DD4A 2CSOA 3QPHA 3FM5A 3I4PA 4HQEA 2FMLA 3EQLF 1I6XA 1P4XA 4ZYEA 4LLNA 1U3EM 3T0YA 4IJAA 1FP1D 1G3YA 3FZVA 4M6XA 1O3TA 3ZN1A 2QQ9A 4RB3C 1HSJA 2X0LA 4CO8A 1Z7UA 3OV8A 4LG0B 2P5KA 4HDVA 2P7CB 2CO5A 4S04A 5F6FA 3V8JA 1Z9CA 3O2PE 3TQNA 2VC1A 3F6OA 5BOXA 5CVUA 4ZH4F 4ESBA 4KDPA 1K78B 4PGHA 1R22A 2STWA 2HEOA 2M87A 2KJBA 5H6QA 1PDNC 3I53A 2Q8KA 6PAXA 2QM3A 2BGCA 3GW2A 4HOBA 1U5TB 3KEQA 1R5GA 4A6DA 3D5LA 2M5WA 3G3ZA 3D0SA 5HLGA 2E1NA 2F2EA 3HUGA 2ISZA 2DU9A 1SD5A 2FBKA 1GVJA 3K0LA 1XGSA 2PG4A 1SD6A 1KYWA 3WG9A 3KP5A 1OPCA 4YFKF 3GUDA 2F5EA 1S7OA 4G7HF 2IJLA 5CVIA 4LB6B 1XGNA 5HOOA 1FP2A 1B4AA 2O3FA 2CGPA 4N0BA 4B8XA 3T8TA 4BNCA 3QU3A 5BMZA 4U0VA 2VOOA 1W7PD 3KFWX 5E8IA 3FXRA 3LA7A 2BBYA 1FY7A 4AWXB 1LQ1A 4Y17A 1YW9A 3WTYC 4Q47A 3B02A 4M9XA 4I2OA 3R4KA 5CVRA 1A04A 1QNTA 1XGMA 3I5UA 4AIHA 1QO0D 2TDXA 3EDPA 2HFHA 4XLNF 1XCBA 2QQAA 4M73A 2PBIA 3V4GA 2FU4A 2EFOA 3GO5A 5FLXK 3SQNA 2ZO4A 1T98A 3DQVC 3E3VA 3CLOA 2WV0A 1KYZA 1FWZA 1Z6TA 4BHPA 2HS5A 3MZYA 3C18A 1DDNA 2IA0A 1U5TC 2KKOA 3R0AA 3BWGA 1HW2A 4RB0A 1R1TA 2ETHA 2KRFA 2IW5A 1B9MA 3HRSA 3COAC 3WGIA 2K86A 3F8NA 1W5SA 1LDKB 4LG0A 1IAWA 1UB9A 2EA4A 4A0YA 2PQ8A 2ISYA 4KA4A 1G6NA 3HHHA 3KP4A 3F8BA 1BM9A 3P9KA 3E6BA 2RQPA 1SD7A 3P9CA 2X4HA 2RNJA 2H09A 2V1UA 2KIFA 1QPMA 5IT9Z 2PI0A 1XN7A 5CYVA 4HX7A 2Z3YA 2L3DA 2STTA 1KQ0A 3FMSA 5LGNA 1Q1HA 2D1HA 1FBUA 5HDNA 2V9VA 3HOSA 2PEXA 3K9TA 5HS9A 4WCGA 2MLKA 2XHKA 1K79A 1G4DA 1P92A 2GWRA 1TLHB 3HTSB 2QWWA 3DV8A 2QBYB 3GFJA 2HZTA 3ECOA 3RJPA 2DPDA 3GFIA 5BS6A 3JSPA 4NHJA 3HRUA 3SFZA 5LHIA 1I27A 1ON2A 5LGTA 4UUVA 1OR7A 2FNPA 1W7PA 3I71A 5L3EA 5KVRA 4A5NA 2KJCA 2VT2A 4EQQA 2J5PA 3F3XA 4RGSA 1FT9A 1FYMA 2CQKA 3BPXA 2ADUA 3GVAA 3QU6A 2EFPA 2Y0MA 3F8FA 3DXJF 2FRHA 4GCVA 2F5DA 2DTRA 1FLIA 2G9WA 2M45A 3KP2A 4WXCA 1DPUA 3N97A 1B1BA 2YPRA 3M7GA 3I54A 4HV5A 2AXLA 3RTRA 2PN6A 3QAHA 2MA3A 1TQIA 1HW5A 2QYOA 5BPIA 2J5OA 3GZ5A 1GXPA 4K2EA 3WTSC 1IF1A 3ELKA 2P7VB 4EV0A 2PJPA 1K78A 1TTYA 4ETSA 2EV5A 4G7ZF 2IVMA 1ON1A 2YR2A 3TOAA 3WTTC 2WTEA 4LLLA 3BY6A 3T8RA 3LQRA 3GXOA 1ZRFA 3I58A 4D0PA 3J81Z 5D5WB 2ZNZA
chains in the Genus database with same CATH superfamily
1D8JA 3OYAA 1DQUA 5M5YJ 4L5JA 1JUMA 2RC4A 2DQLA 3HBLA 1LPQA 5HLIA 2QUFA 4EVIA 2VXZA 2A69F 3JRAA 2XVCA 1OCCH 2JT1A 1H9TA 4HX8A 2L9RA 4DBRA 4MLOA 3KZZA 3A0BC 2KZVA 2CS3A 2FA5A 2X85A 4AIJA 1R00A 3NQOA 4YFNF 2XASA 1BW5A 5E1XA 4PK4A 5DTDA 2HQ5A 1VQNI 2OAZA 5LHGA 2EPFA 5FLXZ 3AL0C 3WTUC 2RKHA 1IDYA 3RDIA 4RGXA 2BY0A 5BNGA 3IRQA 1ZTRA 4H0EA 4HNTA 5JI6A 1T2KA 5AIQA 2DFIA 3CD6I 2CWEA 1U78A 3BOQA 3WGHA 1ZLJA 3REOA 1ZG1A 1TBXA 1NH3A 3Q3SA 2RV8A 1LB2A 3M8JA 1LVAA 4GRIA 5M5XJ 2M8EA 5EGOA 5D6EA 1ZAOA 3K1MA 1D1BA 4N4OB 1O7FA 4A3GJ 1TWHJ 4EM2A 4MGRA 1ONVA 2VASA 3LSKA 3CP8A 3RQ4A 4XRMA 3KP7A 5LGUA 1KU7A 2UXNA 2E2JJ 3ZPLA 5ED4A 5FRNA 4RDUA 5GP9A 3MEXA 3CQZJ 4MO7A 2BW3A 3CO6C 3F23A 4F55A 1UZCA 2A6EF 1QZYA 2DFFA 5F0CA 2OU2A 2ZB9A 3Q0WA 2QSGX 2M0MA 1WI3A 2HYFA 2PFBA 1HA8A 2ZCWA 1K4SA 5BPDA 5TRDA 4N4NB 4U7DA 3DPLC 2FBIA 1SMTA 1IDZA 1XDSA 4QTRA 2XRNA 1GXQA 2LLKA 3CESA 1Z6RA 3O8GA 1PUEE 3H36A 2R7QA 5H20A 5F1JA 2PMUA 2P6SA 2D5VA 2YSRA 2XKOA 2K7LA 3E0JB 4IHXA 3E6CC 4KNYA 3J7AY 4ZZDA 4BDZA 3GTKJ 2XF6A 3K1NA 4G8XA 3VEPA 2VIXA 3SYTA 1E2XA 3CCVI 1ZRDA 1XMKA 2CMPA 3R6SA 1TL8A 4PSWA 4CZZA 1EF4A 1BN5A 1WGXA 2ELHA 3EUHA 1SD4A 2HVQA 2L54A 1NTCA 4L5IA 3FBNB 1SAXA 2GXGA 5JHFA 2KQRA 4FQGA 4I01A 4CDGA 5AONA 3TGNA 2DA1A 3VYTB 5HDKA 2GAUA 3PM1A 2EWNA 3CJNA 4MHGA 4HF2A 2Y9ZA 3L1PA 2DA2A 4DGWB 1X3WB 2BHYA 2LSOA 3MD2A 3OR1C 5CKTA 3JRCA 4IXAA 5JVGF 1ZHFA 4U0YA 3A01A 1XS9A 3LFKA 2HQRA 4CYDA 4D5FA 4BXXJ 2D1VA 3H0DA 2L01A 1J2XA 5L3CA 2HI3A 4HLYA 1Z3XA 5FKOA 2NVQJ 2RAEA 3P7NA 4UV9A 1D0YA 1A6IA 3HSEA 3M8EA 3VPRA 2M34A 5D5XB 2KLOA 3LMMA 3AL0B 3ZMDA 4IX7A 3RPUD 3SDBA 3ULQB 1GLNA 3P9IA 3D5SC 3DU5A 4WX9A 5CLSA 2HVRA 4L0ZB 4IF4A 3HDDA 2Q2EB 2QCOA 4JP0A 1LDDA 1S29A 1OCZH 3K7AJ 1BJZA 3LSPA 4IHSA 1MMDA 2ECBA 4I98B 2X1DA 5HVQC 1HW1A 3FXJA 3HZJA 4EJVA 4EGYA 3LSTA 1RUOA 1YFHA 4BACA 2ME6A 4GFBA 4MQVA 3QODA 2WAEA 1TQPA 4NC8A 1VQ5I 2DCEA 5E3MA 4UHTA 1QQIA 1QZZA 3CC7I 4CICA 2A6TA 3A03A 2A3SA 3AG1H 1DUXC 1W4MA 5H2FC 5E8GA 3GTOJ 2DK5A 5D5VB 3V7RA 3RZDJ 3OYHA 3AKZA 2KL4A 2OZ6A 3ZR8X 1WWXA 1YW8A 3JW4A 4XSZF 3K1PA 1OCTC 2KDZA 4ZDLA 2L4MA 1I3QJ 1NG7A 1JHHA 1X2NA 2NRAC 2NAZA 1TW2A 4M3EA 4RAYA 1UHSA 5F08A 3VOEA 2GXAA 1R1UA 2DDBA 4G6QA 1BJAA 2UWMA 4I0BA 1ORKA 1T56A 3H35A 1HDPA 3H92A 2IA1A 3W2WA 3K69A 2YX7A 3VFZA 3HIFA 4QPOA 2DYRH 1PJRA 1WSUA 1PP8F 1S7EA 3K70C 3HOZJ 2LNBA 1MKMA 4RB2C 3KETA 3OS2A 3GTJJ 2COMA 4ZTFA 2CH0A 2JN6A 2MG4A 1BOAA 1P6RA 1TQMA 3IP4B 1KQ8A 3W6JB 2DQRA 2BY2A 2ESNA 1MSFC 3S16J 2K5CA 1ERDA 4QSHA 4L9JA 2WAQA 4HZFA 2GBYA 4GGGA 1JTYA 4P5OA 1DP7P 2H6BA 3V7SA 4B09A 2DA4A 1NK2P 1LFPA 5K7FA 1FC3A 3B6CA 3IAS2 4AVPA 2E1OA 4N9HA 4LGWA 5EZGA 4ASNA 1F36A 2R93J 2NXNB 3HL2A 2NNYA 4ENNA 2P8TA 2KIQA 2KP6A 1VQ9I 4HNUA 4KIBA 3EUKL 1F5TA 4I0AA 3BR6A 3S1MJ 2QGUA 1P7JA 2O0YA 4NB5A 2CQNA 1T38A 5KAIC 4ZYHA 3CMAI 4B3XA 3LSJA 2ZNYA 4KUMA 2MC4A 2M2EA 4KN4X 1R71A 1ZARA 1O3RA 1W7PB 3RSNA 1Y39A 2F5CA 1YYVA 1T6SA 2Z1DA 3F6VA 4MQ9F 4ZYAA 3LNQA 3S14J 2BEOA 3ZP5A 1OYWA 1JHFA 2M9HA 4BXUA 4UVAA 3RCOA 3ERMA 2QVOA 3JRBA 3NRVA 1WHUA 4HSRA 3VYSB 1T08B 4RGUA 2K02A 1X2MA 2R7WA 4M9ZA 4HLXA 4RAGA 4A3FJ 5DCMB 1R23A 2L9SA 2W24A 3WE3A 5EG0A 1BI2A 2EFQA 3FHZA 5KCMA 1DGWY 3PQJA 2WY8Q 2ECCA 3HGYA 3CMEI 3QP5A 3EYYA 2L7MP 4LIVA 1ZGAA 4J19A 3BG9A 3SHFA 1SFKA 2QBYA 4UV8A 1DPRA 4EATA 2HQAA 2DXIA 4KIGA 2JA8J 2DTZA 2R7VA 4BEHB 4AVZA 2NVYJ 3A1YA 1WJDA 4KISA 1IC8A 2XROA 3LA3A 3K4JA 3ZQLA 3PSIA 1YI2I 1BIAA 1YQAA 3DEEA 4XRSA 2K9SA 2X1CA 3CTAA 1B6AA 1BI0A 2FUG2 3WGGA 3DBRB 4P9UA 1W36C 3NARA 4V2GA 4G7OF 1TWAJ 1ZR2A 5DM7F 3S2WA 1G59A 1HF0A 1LE8B 3GWZA 3I4NJ 2H6CA 2X6XA 3HKZA 1WQ2A 2TCTA 2N8GA 1GVDA 4BJTA 3H3UA 3OIQA 2R5YB 3LWFA 1O3QA 2XC7A 3BQZA 2IS2A 4IHTA 2L0KA 4M6YA 5F0FA 1IV8A 1VFCA 5B5EC 1RKTA 5BQTA 3G2BA 1F9NA 4HA8A 3ESWB 2L4AA 2DOEA 3HOTA 4M71A 1E3OC 2XIGA 1SFUA 1Z91A 3BG6A 1U0JA 4LLGF 2A68F 4BUPA 5CJ9A 3JRHA 5E79C 1F43A 1IRFA 1Z3YA 4A3KJ 2VC0A 4NC6A 1GHCA 1D0XA 1WCMJ 2LTPA 3U21A 4JYKA 1XB4A 3CCMI 2OC6A 2WAQN 3ZXSA 4RB1A 4I6ZA 1MJAA 4O3MA 2IPQX 2DT6A 2P5LC 1QZEA 3TEDA 1J0RA 3FKJA 3JRDA 1USTA 3FBIB 1UCRA 1IUFA 2XAJA 1VZ0A 4E7SA 9ANTA 4XLCA 2P81A 4LMYA 3G1MA 2CW0F 3BZ6A 4M72A 1K83J 5B3SH 3OL3A 1K7AA 3N05A 2FNAA 5CQEA 4HX4A 5D6FA 5HS7A 1UHWA 3ZCOA 5J47A 3V42A 3J81K 1RUNA 1OCPA 3ZMUA 1FPQA 2KPMA 1YJ9I 2OCEA 3PO2J 2XAHA 2MSYA 3ZMSA 1TNTA 2KHMA 1U2WA 3PNVA 4YRVA 4Y15A 4A2UA 1HLVA 4L0YB 2HKXA 2G7HA 2E35A 4FCYA 4XKBA 2JK3A 2XB5A 2F48A 5C4JJ 2RNGA 3L2WA 1X3UA 1U8RA 2M7AA 1RETA 2DMNA 2M30A 5FRMA 2XF7A 1K61A 4MEYF 3S1NJ 1A5JA 5HLHA 1UFMA 2H1LA 2L9NA 1BI3A 3K6GA 2V6CA 2P0WA 2RGVA 1KGSA 2DK8A 4GYGA 1UAAA 2Z5UA 3EYIA 4R79A 2BY1A 2HXOA 2WWYA 4YIIA 3BJ6A 1MGTA 2GZWA 2W4SA 3ZQQA 2K27A 1T8IA 4OIRF 2JSCA 3DTKA 1G3TA 1VI0A 3W6KB 4XNFA 3CCJI 3IL2A 5F64A 2MH9A 5HODA 4GXOA 3KZYA 2CW7A 5HNHA 2YU9J 2KRCA 3GLLA 5F1RA 1FBSA 4Y3OA 2CQXA 1WJCA 2D2WA 3CUQC 3H9GA 4XOPA 3IC7A 1X58A 4FTHA 2XAQA 1BIBA 3GTQJ 2V7FA 2VT3A 3M1EA 4BDYA 4OAYA 4C2MJ 2ID3A 3MKYB 3WE2A 3RKQA 1YG2A 3DU6A 3G73A 2LKPA 2DT7B 5A2QZ 2A07F 3M8FA 3JTHA 3ZQGA 1IRGA 4PDKA 1LJ9A 5K7HA 3H3VK 1V54H 3ZN0A 3IAM2 2PMZN 3BJAA 2MBFA 1MBKA 1B72B 3VODA 3IWZA 3I56I 1CF7A 3HTUA 1EH8A 4LFUA 2VJIA 2LVSA 1AHDP 1P2FA 1OLTA 5FD6A 4Q5SF 2NNNA 3PL8A 1FMVA 2OCCH 4U0WA 1HCRA 2LD5A 2ZBKA 4KFCA 3H0GJ 3F72A 3L00A 2JTVA 2R7XA 2P6TA 4BAYA 1QPIA 1OCOH 1I50J 2QLZA 1S6LA 3FK7A 4IRHA 3BR1A 4MEXF 2O5RA 1TW3A 2LC2A 1REPC 3F8CA 2QSFX 3RI4A 4A0XA 3HSFA 1BR2A 3DPTA 2XV4S 1CGPA 4CHUA 4HW0A 2E19A 2QQ8A 4M74A 1SFOJ 3OY9A 1E3HA 3PNYA 4M9SA 2ZFWA 2EZLA 1G3WA 2HNHA 2HR3A 3UR3C 3MQ0A 1BC7C 4RGRA 2VBZA 5J1UA 2E7XA 2R7FA 2FJ1A 4DQ2A 4HF0A 5F0HA 1TNSA 4I02A 4NDLA 4GDFA 2FMYA 2LOOA 4L9TA 4KYWA 2F5FA 2E34A 3ABTA 2XKPA 3RPUA 2R5ZA 4BBSJ 1ITYA 2EV6A 3J7YJ 3TDUC 2HOEA 1I1GA 1JT6A 4D7NA 3OS1A 4EM0B 1R49A 3ABKH 4IQ4A 2A5YB 3ZGKA 2X6WA 3O3KA 4DIQA 4IKFA 3TO7A 3I9V2 3TO6A 3JAMK 3P5JA 5ICEA 1ODDA 1JKQC 1ZYRF 1WJAA 3I64A 4XIDA 4BE2A 1USSA 1JKOC 2LRDA 1V55H 3VYRB 3KP3A 3AFHA 4E6KG 2Y48A 4UVBA 4AIKA 4UUSB 4RAZA 1HKSA 4IPAA 3BLYA 2EFWA 4GYIA 2DOAA 2F4MB 4I7HA 2AHQA 2JMWA 2FSWA 5J1YA 1YJWI 5ERIA 4X1EA 1Z7LA 3SZPA 2K9QA 3OYGA 1ZLKA 2GQQA 1BR1A 1ENHA 2DMPA 2R7OA 1FBQA 3WG7H 4A5MA 3DPUA 1R4NB 4DYCA 5IYCJ 3MAJA 3HRTA 1FNNA 1RI7A 3S32A 3OYFA 3BR3A 1IXSB 2QQBA 3PIPF 1X4PA 4D1QA 4CH7A 3ZMVA 5FO5A 2MD0A 1KONA 5D4SA 2R5YA 2Z9OA 4NUBA 3QYBA 3TMOA 4HF1A 1FSEA 2GA1A 4PCQA 1OYYA 3FMQA 3KPHA 2HOTA 3TDZC 5F27A 1K4TA 2XGEA 2BY3A 1VQ8I 1RZ4A 4JQFA 4DJAA 3OYDA 2V4JC 2ZKZA 3VDXA 1FZPB 2E60A 1V5GA 3TBIA 4FX4A 2F4OB 3NAUA 2E5ZA 4LITA 3LQQA 3MWMA 4A93J 2VXDA 4OINF 3CF5F 3FDYA 4AIDA 1VQ6I 2W25A 2LP0A 4A0ZA 4B43A 4Y7NJ 2EB7A 1ZQ3P 4WXDA 3CC2I 1R5ID 3SXYA 4JX5A 1FOYA 3ZMZA 1FJLA 1WJ5A 1Z1DA 2CG4A 5D8LB 1V5FA 2VUMJ 4EJOA 3K2ZA 1RR7A 2VN2A 3PO3J 1ETYA 1R58A 1MNDA 2M4GA 2BZTA 2WADA 5DUKA 3CC4I 1R6RA 3CO7C 1QBJA 1V4RA 5K5OA 4ZZLA 3HRMA 1FOKA 3E7LA 5E3LA 4CCNA 2DMUA 1O57A 3L7WA 2JA2A 1U5TA 5AIPA 4ZYDA 2XSJC 4QWQA 1H9GA 3CCLI 2CUZA 3H3ZA 3H9QA 1SANA 4ESFA 1C0WA 2ZJ2A 4JBAA 3RPQA 1ZGWA 4XLFA 4EJTA 5IOYA 4B48A 3FXQA 2OQRA 3BJOA 3EUHC 5DYMA 4LJZF 4IO9F 3QOPA 4W97A 2E1MB 3GEZA 4FE4A 4BY1J 2HOAA 2QENA 5HLTA 1BW6A 3IHUA 2X1EA 3H1CA 3WTZA 1ETXA 1IV6A 3LSMA 1G3SA 1ZELA 4PJLA 5GAEJ 2BVMA 4BL0B 1RESA 4CCKA 4B4CA 4C3JJ 1YS7A 1WH7A 3KYDB 4FISA 5EJCA 3ABMH 4G6DA 4CSWA 3K4NA 2MYSA 4HPQA 5C44J 1MNMC 2YS9A 5FKNA 1P4AA 2Q0OA 2BHZA 2KIMA 5FKLA 4HEA2 3T1BA 4YG2F 2JQ7A 1RIOH 3L09A 3W6VA 3J7ZI 1D5YA 3BT9A 2GA2A 4FT8A 1YX5A 2OUMA 5K5RA 3BTCA 5LHHA 1MBFA 2BYVE 1X1PA 5JHUA 4QPQA 2Z33A 3F22A 4PSXA 2LR8A 2XAGA 3CDHA 1FYKA 4FASD 5TGTA 2FEZA 1J5YA 1MH3A 1S5LC 4M3BA 3BG5A 2VODA 3IKVA 2O9LA 3Q9VA 1QRYA 3IWFA 2Y0SN 2DPUA 2Q2EA 4ABZA 2EA2A 2HTJA 5ICGA 1HQCA 2V26A 2W48A 2XGCA 3E1SA 3FISA 2W7NA 2VBYA 1WJFA 3DCFA 5DM6F 2MFZA 3ROUA 1VQKI 2QZ8A 4S0HB 3QYEA 3U1DA 1U8BA 3FXKA 5B66C 3F8MA 3ABUA 2XPVA 4Z6YA 2I8DA 4Z2YA 3U2RA 2PLYA 3DF8A 1OQYA 2DJIA 4XONA 5M3FJ 2JZYA 4CCOA 5J1RA 1HBXG 4PZJA 1ZRCA 1RKWA 1UG2A 4E4HA 1TC3C 2HDCA 2FOWA 1VQ7I 2TRTA 2GXBA 3CDLA 2A61A 1VNDA 2DA3A 5FGMA 2LBFA 4X0GA 1B59A 1F1ZA 4ZC3A 2HYGD 4OU0A 5LRSA 3E97A 2DBBA 2KDOA 3FX3A 3GF2A 2A05A 2QSHX 3X2QH 3I3LA 3WU2C 5LLQA 4UNOA 1D5VA 1HKQA 2FE3A 3ZMTA 2V1XA 2Z99A 4OIOF 2VJ4A 4YIFA 4XRSG 1XMAA 4XKCA 3KYLA 1WI9A 3MZHA 2O61A 4LK0F 3LSRA 3IKTA 1ETKA 4IRIA 2DT5A 2R3SA 1BOBA 2EZKA 2FQ4A 4IOAF 4OIQF 4IRGA 1IUYA 4HAMA 2EH3A 3V8LA 2KRHA 4HNVA 4FETA 4IHYA 2H1KA 2IGNA 4D5CA 1YTYA 1YIOA 2XGDA 1MZBA 1FIPA 2LREA 2ZMEB 2E1CA 5KNLA 1BI1A 2RN7A 3GZNB 4KJZA 1ZN2A 2DFHA 2HWVA 3FKIJ 1ZGJA 1AU7A 5J8FA 2ZC2A 1T95A 3KCCA 4KT5C 2H8WA 3LSGA 4BHBA 4ENKA 2IAIA 1TWCJ 2CUFA 3BTJA 4IQJA 4ZDPA 3E6MA 3GTMJ 3ASOH 2QEXI 4BBRJ 5M3MJ 4W1UA 5J4YA 1ETOA 1SVMA 2BOLA 1AOYA 3M9AA 3RKYA 3TW7A 1XGOA 3FXUA 3PUFA 3K4CA 2IT0A 2JJ7A 4L18B 1R9TJ 2HDDA 3WU0A 4BQAA 2WC2A 4DZPA 3DP7A 3OWTA 5E20A 2GIVA 5IY5H 2VKEA 3OMYA 3PNTA 1JTXA 1T39A 1LE8A 3CCUI 2EZIA 3DTEA 4R8HA 1R5HA 4CCMA 2YX4A 4G9YA 4XBFA 2WV1A 1VQLI 4A6EA 4S05A 3RYPA 2K4JA 3CCQI 3KLNA 1YLFA 3RKXA 4RBOA 1J59A 3HSRA 1GV5A 3H5RA 5GPAA 1IXCA 4X6AJ 4A3MJ 3C7JA 1SFXA 3K4BA 1SVOA 4AC0A 3GYHX 2W57A 3GMEA 1YS6A 1L0OC 2WBMA 1UHMA 3OSGA 1JI8A 2LBFB 1XSDA 1TZLA 1UELB 5HS8A 4EJWA 2HZDA 2Y31A 4JX4A 5EZHA 2NS8A 3CJQB 3DWLE 1WJEA 2VJ5A 5EEGA 2C6YA 4EMSA 2RDPA 3Q5FA 3OYNA 2VBWA 1YHQI 1OMIA 4XN3A 2JPBA 1ZK8A 3TKYA 3FXMA 4II3A 2ID6A 2M1BA 3IH4A 4XMYA 2KMUA 1LNWA 2R0QC 1SC7A 2V6EA 3BDDA 1RNLA 5ICCA 5FJ8J 3J80K 2LY2A 1IXRC 4AU7A 5FB2A 2AQEA 2ZJQF 2EIKH 4E70A 2B63J 4PJJA 3MFKA 1FOWA 3CUQA 2CQ7A 2BXYA 4JOMA 4A3JJ 4LB5A 2VONA 2PX9A 2R4GA 2A6HF 2LK2A 1LEBA 2JA7J 1FOXA 4XOTA 1GV2A 1MJBA 5KAFC 2LF7A 3HOXJ 4UB8C 4PGGA 1HKTA 2FXAA 2V1NA 2JVGA 2OZUA 3H5NA 1BA5A 1EH7A 3SFIA 4MNUA 2ZXWH 3PFYA 2I10A 4IHVA 3MN2A 3LAJA 1WRJA 2IP2A 3BG7A 1YW7A 5TJJA 1OCRH 1TWGJ 4WXHA 3VSKA 2JUCA 1RPWA 3EETA 2EJRA 1ZG3A 2VE9A 2PJRA 2VQGA 2JRTA 3F0CA 1U9OA 1XG1A 2H94A 2X9DA 3WODF 1A35A 1J7KA 1ZKGA 3S3MA 1N25A 1D3YA 1MDMB 1X3ZB 2XAFA 3CJTB 3BCBA 2R7DA 2M3AA 1WPKA 1P9QC 2OF7A 3HPGA 4XLHA 5L3DA 2GIZA 1STZA 1MD0A 5LRRA 1PP7U 1B8IB 2IGOA 3MKWB 3IRRA 4LIUA 5D8KB 3U9GA 4UY8I 1AWCA 3A4CA 4KICA 2H8RA 3CZ6A 3GZ6A 1W36D 4YFXF 4KIFA 3MCZA 2EFNA 3HUGB 4HYEA 3K4KA 5FLMJ 3HB9A 1APLC 1QA6A 3RKWA 1E17A 2XUBA 4JK1X 2DLLA 1XSXA 1S8NA 3TOBA 2V79A 2ZXHA 3L2UA 1CQTA 4I09A 2D45A 1X1BA 5ILUA 4F7ZA 1IGNA 1FEXA 5B1BH 1LDJA 1IN6A 4FX0A 3F21A 1D8KA 3O6BB 4A3DJ 4QIWN 3S1RJ 1PVEA 3PSFA 4P9FA 1VQOI 5DCFA 4Y13A 1J75A 1BBYA 3A02A 2OD5A 4MTDA 2L9VA 1DP3A 3ZQ7A 3FK6A 5GTHC 5K1YA 3C2BA 1NHAA 5L3FA 5ILVA 2L2OA 2LF8A 4Q48A 3KYCB 3WTWC 2IEKA 1B8IA 4AM3A 3RIRA 3CP2A 5C4XJ 3NEUA 3J80Z 4RS8A 1CF7B 2CW8A 1Y6IA 2V1DA 3JAMZ 3OYIA 1UJ8A 2K4BA 1K6YA 4U7BA 2EIJH 1IN7A 2O03A 4P1WA 4EGZA 1Z0XA 2O8KA 3JRFA 2LH9A 1JXSA 3ISPA 3Q9SA 1XCVA 4F93B 2CV1A 5DCMA 3RZOJ 2UZKA 1OYIA 2MLGA 4P55A 1X1CA 3HOUJ 3M3YJ 1J9IA 4M6VA 5EEHA 4OMYA 4U88A 3HPHA 2FOKA 3PFIA 1YX3A 5IT3A 2JA5J 3ZQHA 3QP6A 2W84A 2ESHA 3HXLA 3OIPA 4LOCA 1H89C 2MABA 3QPSA 3JTGA 2IRFG 3EUAA 4C9YA 4BGDA 3CJRB 3LA2A 4LK1F 3JR9A 3G1OA 3VB2A 3CUOA 4CGZA 5IP9J 2QF7A 4XLPF 1Y8RB 1R4MB 4NQWA 5B1AH 5D5UB 4HQMA 3DKYA 5LBQA 1EH6A 3V7CA 5HDGA 2Y9YA 3PQKA 2Z16A 1L3LA 4I99C 1MBEA 4KMUX 1I3AA 5CPRB 5E3OA 2LFBA 2R5ZB 4A3LJ 2PMZA 3WU1B 3AG4H 3OOPA 4ZYGA 1OISA 2JVHA 2NS0A 3F9KA 4F92B 2VBXA 3I0TA 1MBJA 3W2VA 3D1NI 1V3FA 1A31A 3JRIA 4B44A 5DUIA 5K5QA 2H27A 2VKHA 3GBGA 4WK8F 4G94A 2OA4A 1MMNA 3CCEI 3QPTA 3CCYA 2R92J 3DKWA 3D5RC 4O6JA 5EF6A 3WTXC 2AS5F 4XKWA 2JSPA 3R61A 4J01A 2QKLB 3HJEA 2VLAA 2VQCA 1EV7A 2HQNA 2P4WA 5FROA 5IP7J 3M1CA 1U9NA 3S17J 2VE8A 3BP8A 4XSXF 4UXNA 4AD9A 2E7WA 3OYCA 3JSOA 5LD2C 1F4KA 3OS0A 5DDGA 2ACJA 1MMSA 3E5QA 1H0MA 1K6OA 3OL4A 4IOCF 1IW7F 3S2DJ 5H6RA 5FD5A 3QRFF 1Z21A 1YRNB 1W5TA 3DEUA 1JJ8C 1MNEA 3CUQB 3GFMA 3HOYJ 1DGRM 4HDUA 5CVVA 2CFXA 2WY7Q 1ZREA 2X48A 2ZMEA 1XSVA 5DS9A 3BQYA 5FFXA 3W2AA 3I4MJ 3QQAA 4DNCA 4EJUA 4AYBN 1JJ6C 2G7UA 2R7SA 2FF4A 2HPIA 1T0FC 3QPLA 1MJ9A 1WH5A 2DAOA 3GFLA 3OOUA 1T0FA 4YEJA 4BYYA 5LFAA 2KZGA 3O8HA 2XDVA 1BC8C 2Y30A 1PYVA 1IN5A 3RQIA 4WWCA 1KA8A 3OYMA 3SZTA 2M0CA 2LMDA 1ULYA 2O6GE 1Y0UA 4G6TB 4BE1A 2X6YA 4DOZA 5D4RA 1B72A 3Q0UA 2FBHA 2OJED 3I59B 2O8XA 3TL4X 2HU9A 3DTIA 4WF2A 2OPTA 1VQ4I 4BXFA 2CQQA 3I59A 4ZDOA 2HGCA 4XR6A 3BR0A 3HHGA 4F52A 1XD7A 5GAGJ 2VOPA 3BROA 2L7KA 4L9VA 3PJRA 2ZSIB 3T5XA 2EV0A 3SEZA 2XGXA 3BCAA 1IJWC 3KEOA 4GO1A 1HC8A 2DMTA 1XDUA 2OBPA 2Z2SB 2W85A 5TISC 1U6GA 1FYLA 2BXZA 4ITVA 2Y75A 1O7LA 1VQMI 1LEAA 4XM3A 3JRGA 2R7RA 1FSHA 1IN4A 1XTAA 2I5UA 4ZJZA 3J7AO 3IUOA 1ZG5A 2KIUA 3IH3A 4CXFA 2HYJA 4M3FA 5EGOB 3BTIA 4HV6A 1MDMA 2XPWA 1YO5C 4O5VA 2MD5A 3GLXA 2M4KA 1ZH5A 5E1ZB 3MKZA 1AKHA 5JFRA 2NOGA 4QLCU 1HDDC 3KE2A 5A2QK 1KU3A 2HPMA 3LAPA 1HSTA 2XAUA 1WZ2A 1XX5A 2EQRA 5E18F 1LFBA 5E17F 4L9NA 2BV6A 2L7ZA 3ML6A 3WTVC 1QGPA 5C3EJ 2B9SA 1YE9A 5J8CA 5JVTA 2R7UA 1IZ1A 2UUZA 2LY9A 5LEKA 5KK1A 2EK5A 2VL8A 2F5VA 5ICFA 4A3EJ 1Y0NA 2LDUA 2YU3A 3FF5A 2NVUB 3ZQIA 2VPLA 3OYJA 1S7AA 1R7JA 2BVLA 2VQLA 2BE5F 2KISA 4DBQA 4XRFA 1YRNA 3ZRGA 2MH2A 1P4WA 1W5CC 4XLEA 1MSEC 2RREA 3MZ8A 3TW6A 3G6EI 4OOIA 3C3WA 4OMZA 3R60A 4NNJA 4IL6C 3B73A 4ENJA 5LEJA 2QKMB 3HYIA 5IPAA 4OIPF 3OYEA 5DD8A 1FX7A 2HTSA 4EM1A 4BJ6C 4A12A 1O3SA 1KU9A 2FQ3A 3G1LA 1MBHA 2BW3B 2VKDA 4KMFA 1I6HJ 3AAFA 4R1HA 2ZJPF 2IS4A 1WKMA 4UVCA 2P5VA 3DFGA 4MTEA 4XORA 5ILSA 2E71A 1R1VA 5IT9K 2OV7A 5IP6A 3KP6A 5E1WA 1I5ZA 4DZJA 3JCUC 1QU3A 4TV7A 2IGKA 1X1DA 1SMYF 2WA0A 2K9NA 4ENMA 3ECHA 3MMYB 5CVJA 2CYYA 1JGSA 1D0ZA 4IVNA 3GCMA 1POGA 1B9NA 3N4MA 1Y1WJ 3ERED 1G2HA 2DO7A 4N9IA 5JLXA 4XK4A 1AA7A 4A3IJ 3HEFA 4C30A 3R0JA 1KQ9A 5L3GA 3E5XA 4LD5A 3UKGA 1OR7C 2EZHA 3BPVA 4PUSA 3E5UA 2ZXJA 5GTIC 2CV0A 1HOMA 4ZTJA 4XICA 4B1RA 1JE8A 2JUGA 1ETVA 3C1DA 2NYXA 2ZJRF 1IN8A 2PMHA 2MC3A 4V19K 3SJMA 5J6XA 2FX0A 5L3BA 1X19A 4P96A 3DLAA 3TO9A 1SVLA 1D1CA 2DI3A 2DW4A 4DYRA 1JKPC 4ESJA 3VWBA 3BR5A 1R36A 2UXXA 5FFZA 3K70D 3FWEA 2RVCA 3RYRA 1OKRA 4BH9A 1S3JA 3KIOA 3CF2A 1TP4A 4RLQA 3S15J 5EDNA 2B0LA 4KN7X 2HKOA 3KZIC 3FHNA 3V8KA 4CYCA 4FHTA 3FM3A 2AXTC 3CDIA 2JWTA 1SAUA 4C3HJ 4E7ZA 3K2AA 5DEQA 1VTNC 2B7EA 3L9FA 2HXIA 2L02A 2VPRA 3FMRA 2W00A 3KLOA 1A36A 1HXDA 2XRLA 4LG3A 4XLAA 3OR2C 4HBLA 4BHCA 3L2CA 2IA2A 2VJJA 3QYFA 4ON0A 2AO9A 1M1EB 3GX4X 1ZR4A 2Y0SA 5KHDA 1I1SA 3E6DA 1Z05A 1KU2A 3S1QJ 2DA6A 2K3FA 2XB0X 5DV5A 1MBGA 4E7KA 1SFEA 2A5WA 4M3GA 2OQGA 5JR3A 2E1MC 2MW8A 1N75A 4BKXA 4DYQA 4Q4ZF 1OFCX 5CQGA 2JPCA 2ZFUA 5DD4A 2CSOA 4RM3A 3MVPA 4PJ0C 3QPHA 3FM5A 3I4PA 2ICWG 3LSHA 1FTZA 4HQEA 1S72I 3BZCA 4RMNA 4DW6A 5J4VA 3G71I 2FMLA 3HGGA 2XSDC 3EQLF 1QVTA 1I6XA 2K3PA 1GUUA 2ME0A 1BR4A 1N77A 1QHHD 1P4XA 1I39A 4ZYEA 2DDAA 1DU6A 1NK3P 4LLNA 2K40A 2ZXIA 4C2TA 1U3EM 2MGQA 3W3CA 3T0YA 4IJAA 2HDWA 1FP1D 3M4OJ 1G3YA 3FZVA 1BL0A 4M6XA 4CA0A 3WHCA 3ZN1A 5GAHJ 2KFDA 1O3TA 3H5AA 2CJJA 2QQ9A 4RB3C 5HNFA 5J3LA 4Y33A 1HSJA 2X0LA 4BS9A 4HSTA 1JUPA 3JREA 4CO8A 4IZZA 2CUEA 2DMQA 1Z7UA 3S2HJ 3OV8A 3BZKA 1MIJA 4LG0B 1V5EA 2GOXB 2P5KA 4HDVA 4M3DA 2P7CB 4BQOA 2CO5A 1MW7A 5F6FA 4S04A 3V8JA 3L2VA 2ZSHB 1Z9CA 3O2PE 2DA7A 3MKLA 3TQNA 2VC1A 2LYCA 4UB6C 2F4IA 3F6OA 2O7OA 2HOSA 5BOXA 1Y1VJ 5F04A 1NG6A 2HVSA 2YUSA 3NWSA 4E7HA 5CVUA 4ZH4F 1W0TA 1RRJA 3LOCA 4MIMA 3OIOA 2EBIA 4ESBA 4KDPA 2OTLI 2L5QA 1PUFB 1K78B 4PGHA 1R22A 2E2IJ 1H8AC 2STWA 2CUJA 2HEOA 2M87A 4OWRB 3ASNH 2EINH 3GTPJ 2KJBA 5FKMA 5H6QA 1PDNC 3I53A 1W1WE 2DFEA 2Q8KA 6PAXA 2QM3A 1S9HA 2BGCA 3GW2A 3S3NA 4HOBA 4MFEA 1JKRC 2LKSA 1U5TB 3OYBA 2NVXJ 3KEQA 1R5GA 4A6DA 3D5LA 1FTTA 4KT6A 2M5WA 2VB6A 3NWTA 3G3ZA 3D0SA 5HLGA 2Y69H 2E1NA 3VYUB 2F2EA 3HUGA 2ISZA 2DU9A 3H9JA 2IGMA 1SD5A 4XL9A 4BQQA 1OJLA 4A3BJ 2FBKA 3HM5A 1GVJA 1LUJB 2PJRB 3K0LA 1XGSA 2PG4A 1SD6A 1KYWA 1KZHA 1N78A 2VQHA 3I55I 4G12A 1YJNI 2RQQA 3WG9A 3KP5A 2E36A 1ACIA 5E3NA 4F91B 5EEAA 1WVRA 1OPCA 3WHBA 4YFKF 3SEQA 1VQPI 3GUDA 2CU7A 1SEUA 3VSLA 2F5EA 1S7OA 4G7HF 2IJLA 5CVIA 4LB6B 4RM2A 2EIMH 4HRIA 1XGNA 5HOOA 1Z77A 3BC8A 1FP2A 1B4AA 2O3FA 2CGPA 4N0BA 1ETWA 2V9KA 4B8XA 3BR2A 3T8TA 3CMMA 3DLLF 4BNCA 2DA5A 3U1KA 3QU3A 2Y2ZA 4IEJA 5BMZA 4U0VA 2VOOA 2G0EA 3TP3A 2LKXA 2NS7A 1W7PD 3KFWX 3L2QA 4I76A 4A69C 5E8IA 4CYCB 1AKHB 2IXSA 3FXRA 3LA7A 2BBYA 4C3IJ 1FY7A 4AWXB 4D7MA 1LQ1A 4Y17A 1YW9A 3WTYC 1DU0A 1Q1VA 3HOWJ 2X51A 2EILH 4Q47A 3B02A 4M9XA 2K9LA 3CCRI 4I2OA 3R4KA 3OSFA 5CVRA 3B6AA 1A04A 1QNTA 1XGMA 3A0HC 3I5UA 1QO0D 4AIHA 3K4LA 5K7ZA 1GDTA 3DBHB 3OYKA 3SZGA 1FIAA 2TDXA 4UUTA 3EDPA 2HFHA 2IS6A 4XLNF 1FMWA 4KITB 1XCBA 4NQWB 4RA2A 2QQAA 4M73A 2JA6J 2PBIA 5FKKA 4CCJA 3V4GA 2FU4A 2GLOA 1LKXA 4AYBA 3M07A 2EFOA 3GO5A 4BJ5C 5FLXK 5EG0B 3SQNA 2ZO4A 5IYBJ 1XC5A 1Y8QB 3QOEA 1E0EA 1T98A 3K4MA 3DQVC 3HG9A 2DN0A 1LFUP 2DJNA 3E3VA 3CLOA 2WV0A 1KYZA 1FWZA 5EYRA 2UV1A 1Z6TA 4BHPA 4V2FA 5GPCA 1Y56A 4L5EA 2HS5A 3MZYA 3C18A 1XMXA 3PUBA 3ZQCA 1DDNA 1QHGA 4BE0A 2IA0A 2IS1A 4OAZA 3CLQA 4MFDA 1U5TC 1EA3A 4XQFA 3G4SI 2KKOA 2JRMA 4B47A 1EJ9A 3R0AA 3BWGA 1HW2A 4RB0A 1MMGA 5JLWA 1R1TA 3CMYA 2ETHA 2KRFA 3LL7A 2IW5A 3LFUA 4XN0A 1B9MA 3HRSA 3COAC 5M5WJ 3WGIA 4A3CJ 2K9MA 2K86A 3F8NA 4ANJA 3CCSI 2F6CA 1W5SA 2R7TA 1LDKB 4LG0A 1XPXA 1IAWA 1YOVB 1UB9A 1X1AA 5IOZA 4RLFA 2EA4A 4A0YA 2PQ8A 2ISYA 1IO2A 4KA4A 1G6NA 3HHHA 3KP4A 1E3PA 2M8GX 1BM9A 3F8BA 3P9KA 2OTJI 3E6BA 4FE7A 2RQPA 1SD7A 4RAFA 2IBDA 1UG0A 4CZCA 3S8PA 4PFPA 3QWLA 3P9CA 2X4HA 2RNJA 2H09A 4UUSA 2V1UA 2KIFA 2WB1N 3A01B 1QPMA 5IT9Z 3DKXA 2PI0A 3HOVJ 1XN7A 2GOMA 5CYVA 1X4OA 4HX7A 2Z3YA 2L3DA 3ZQFA 2NVTJ 1KQ0A 2STTA 3FMSA 5LGNA 1IG7A 1Q1HA 2D1HA 3FIWA 2GM4A 1LVKA 2DYSH 1J09A 1FBUA 1A6QA 5HDNA 3OYLA 2V9VA 3A2KA 1YITI 3K10A 3HOSA 2PEXA 2V9PA 3K9TA 1ETQA 3SDGA 2VKVA 1QVUA 5HS9A 4BQNA 4WCGA 2MLKA 4JX6A 1TT5B 2XHKA 1K79A 1H88C 1WFXA 1G4DA 1P92A 2GWRA 2FD5A 1TLHB 3HTSB 5GADJ 3KEYA 2QWWA 3LSIA 3BG3A 2DOFA 3BTLA 3DV8A 2QBYB 3GFJA 2WAFA 3TP0A 4AUXA 2HZTA 2E5NA 3ECOA 3RJPA 2DPDA 3GFIA 5BS6A 2AQFA 3JSPA 4PJMA 1O4XA 4NHJA 3HRUA 4PFOA 4BU2A 3SFZA 2W1OA 2CRGA 5LHIA 3Q0VA 3C2HA 2M7BA 3C2GA 1JGGA 2WB1A 1I27A 1W0UA 1ON2A 5LGTA 3FXLA 4UUVA 3ABLH 1OR7A 3HKZN 2FNPA 1WJBA 1YIJI 2XPUA 1W7PA 4CCLA 3DBLB 4D9JA 3I71A 3UNGC 5L3EA 5KVRA 2K85A 4B3AA 4A5NA 4XKVA 3ONQA 2KJCA 2CFOA 2VT2A 5IYDJ 3S93A 2VI6A 4II2A 4EQQA 2J5PA 3F3XA 4RGSA 1FT9A 3EPZA 1FYMA 2CQKA 4EEFG 3BPXA 1Z67A 2ADUA 3GVAA 4E7IA 3QU6A 2EFPA 2Y0MA 4U87A 4E7JA 3L2RA 1RC9A 1IRXA 4C2UA 3F8FA 4NC7A 2CV2A 5FLVA 1GT0C 4F3QA 3DXJF 2FRHA 4GCVA 3GTGJ 2F5DA 2DTRA 1FLIA 2G9WA 3HC7A 2ELKA 2M45A 1G8XA 3KP2A 4WXCA 2KT0A 1DPUA 1MH4A 4YELA 3N97A 1JT0A 1B1BA 2LG4A 2YPRA 5J40A 3M7GA 3I54A 4HV5A 2XF5A 4CUGA 1JUSA 2AXLA 3RTRA 3PIOF 4E7LA 2PN6A 3QAHA 3ZOBA 1IRZA 2ZMEC 2W82A 2NOJB 2MA3A 4Y4RA 3S3OA 1TQIA 1HW5A 2QYOA 2L7FP 5BPIA 1D1AA 2J5OA 3GZ5A 2E2HJ 1GXPA 1EKEA 1TT0A 4K2EA 3AG3H 3WTSC 1UMQA 3IV5A 1P7IA 1IF1A 3GTLJ 3ELKA 4BY7J 2P7VB 4EV0A 2PJPA 1PUFA 1K78A 1TTYA 4ETSA 1T33A 1MMAA 3AG2H 2EV5A 4PJNA 4YIRX 4G7ZF 3IH2A 2ELJA 2IVMA 4IHWA 4BEHA 2QA4I 1ON1A 4H4KC 2DODA 2X6OA 2COBA 2YR2A 3TOAA 1TWFJ 3WTTC 3FXOA 1RR8C 4Y52J 3KX2A 2WTEA 2R7ZJ 4LLLA 3BY6A 3T8RA 4J00A 4HG2A 3LQRA 3GXOA 1ZRFA 3I58A 2Q1ZB 2LY1A 4D0PA 5D5WB 3J81Z 1VF9A 2ZNZA 4NBQA 3DEWA
chains in the Genus database with same CATH topology
1D8JA 4L5JA 2RC4A 2DQLA 5HLIA 2QUFA 4EVIA 2VXZA 2A69F 2XVCA 1H9TA 2JT1A 4HX8A 3KZZA 2FA5A 4AIJA 1R00A 3NQOA 4YFNF 2XASA 5E1XA 2OAZA 5LHGA 5FLXZ 3WTUC 2RKHA 3RDIA 4RGXA 3IRQA 4H0EA 5JI6A 1T2KA 5AIQA 2DFIA 2CWEA 1U78A 3BOQA 3WGHA 1ZLJA 3REOA 1ZG1A 1TBXA 2RV8A 1LB2A 1LVAA 2M8EA 5D6EA 1ZAOA 3K1MA 1O7FA 4EM2A 4MGRA 1ONVA 3KP7A 5LGUA 1KU7A 2UXNA 3ZPLA 5ED4A 3MEXA 3CO6C 3F23A 2A6EF 1QZYA 2OU2A 2HYFA 2PFBA 2ZCWA 5BPDA 5TRDA 4U7DA 3DPLC 2FBIA 1SMTA 1XDSA 2XRNA 1GXQA 1PUEE 1Z6RA 5H20A 2PMUA 2P6SA 2YSRA 2XKOA 2K7LA 3E6CC 4KNYA 4ZZDA 3K1NA 4G8XA 3VEPA 1E2XA 1ZRDA 1XMKA 3R6SA 4CZZA 1BN5A 2ELHA 3EUHA 1SD4A 2L54A 4L5IA 1SAXA 2GXGA 4I01A 4CDGA 5AONA 3TGNA 5HDKA 2GAUA 2EWNA 3CJNA 4MHGA 4HF2A 2LSOA 4IXAA 1ZHFA 4U0YA 3LFKA 2HQRA 4CYDA 2D1VA 2L01A 1J2XA 5L3CA 4HLYA 3P7NA 4UV9A 3HSEA 3M8EA 5D5XB 3ZMDA 3ULQB 4WX9A 3P9IA 4L0ZB 5CLSA 4IF4A 1LDDA 1S29A 4IHSA 4I98B 5HVQC 1HW1A 4EJVA 4EGYA 3LSTA 1RUOA 1YFHA 4MQVA 1TQPA 4UHTA 1QQIA 1QZZA 4CICA 2A3SA 1DUXC 1W4MA 5E8GA 2DK5A 5D5VB 3V7RA 2OZ6A 1WWXA 1YW8A 3JW4A 4XSZF 3K1PA 2L4MA 1JHHA 2NRAC 2NAZA 1TW2A 4RAYA 3VOEA 1R1UA 4G6QA 1BJAA 2UWMA 4I0BA 3H92A 2IA1A 3K69A 2YX7A 3VFZA 3HIFA 1WSUA 1PP8F 2LNBA 1MKMA 4RB2C 3KETA 2COMA 1BOAA 1P6RA 1TQMA 1KQ8A 3W6JB 2DQRA 2ESNA 4L9JA 4HZFA 4GGGA 4P5OA 1DP7P 2H6BA 3V7SA 4B09A 1FC3A 4AVPA 4ASNA 4N9HA 4LGWA 2NNYA 4ENNA 2P8TA 4KIBA 1F5TA 4I0AA 2O0YA 4NB5A 1T38A 4ZYHA 2ZNYA 4KUMA 4KN4X 1ZARA 1O3RA 1W7PB 2F5CA 1YYVA 1T6SA 3F6VA 4MQ9F 2BEOA 3ZP5A 1OYWA 1JHFA 4BXUA 4UVAA 2QVOA 3NRVA 4RGUA 2K02A 4M9ZA 4HLXA 5DCMB 1R23A 2W24A 3WE3A 1BI2A 2EFQA 3FHZA 3PQJA 3QP5A 3EYYA 1ZGAA 3SHFA 2QBYA 4UV8A 1DPRA 4KIGA 2XROA 3LA3A 1BIAA 1YQAA 3CTAA 1B6AA 1BI0A 3WGGA 4P9UA 4G7OF 3S2WA 3GWZA 2H6CA 1WQ2A 3H3UA 3LWFA 1O3QA 4IHTA 4M6YA 5BQTA 1F9NA 4HA8A 3HOTA 2L4AA 4M71A 2XIGA 1SFUA 1Z91A 4LLGF 2A68F 5CJ9A 1IRFA 2VC0A 1GHCA 1XB4A 4RB1A 1MJAA 4O3MA 2IPQX 2P5LC 1J0RA 1USTA 1UCRA 2XAJA 4LMYA 2CW0F 3BZ6A 4M72A 1K7AA 5HS7A 2FNAA 4HX4A 5D6FA 1UHWA 3J81K 1RUNA 3ZMUA 1FPQA 2XAHA 3ZMSA 1TNTA 1U2WA 4Y15A 4A2UA 4L0YB 2HKXA 2G7HA 1X3UA 1U8RA 2M30A 4MEYF 5HLHA 1UFMA 1BI3A 2V6CA 2RGVA 1KGSA 2DK8A 4GYGA 3EYIA 2Z5UA 4R79A 2WWYA 4YIIA 3BJ6A 1MGTA 2GZWA 2K27A 4OIRF 2JSCA 1G3TA 3W6KB 3IL2A 5F64A 2MH9A 4GXOA 3KZYA 5F1RA 1FBSA 2D2WA 3CUQC 3IC7A 2XAQA 1BIBA 2VT3A 3M1EA 3WE2A 1YG2A 3G73A 2LKPA 5A2QZ 2A07F 3M8FA 3JTHA 1IRGA 4PDKA 1LJ9A 3ZN0A 3BJAA 2MBFA 3VODA 3IWZA 1CF7A 3HTUA 1EH8A 4LFUA 1P2FA 5FD6A 4Q5SF 2NNNA 4U0WA 2ZBKA 4KFCA 3F72A 3L00A 2JTVA 2P6TA 4BAYA 2QLZA 1S6LA 4IRHA 4MEXF 1TW3A 1REPC 3F8CA 3RI4A 4A0XA 3HSFA 3DPTA 2XV4S 1CGPA 4CHUA 4HW0A 4M74A 4M9SA 2ZFWA 1G3WA 2HR3A 3MQ0A 1BC7C 4RGRA 2VBZA 2E7XA 2R7FA 4DQ2A 4HF0A 1TNSA 4I02A 2FMYA 4L9TA 4KYWA 2F5FA 3ABTA 2XKPA 3RPUA 2EV6A 3TDUC 2HOEA 1I1GA 4EM0B 2A5YB 3O3KA 3TO7A 3TO6A 3JAMK 5ICEA 1ODDA 1ZYRF 3I64A 1USSA 3KP3A 2Y48A 4UVBA 4AIKA 4RAZA 1HKSA 4IPAA 2EFWA 4GYIA 4I7HA 2FSWA 5ERIA 3SZPA 1ZLKA 2GQQA 1FBQA 4A5MA 3MAJA 3HRTA 1FNNA 1RI7A 1IXSB 2QQBA 3ZMVA 5FO5A 5D4SA 2Z9OA 4HF1A 1FSEA 2GA1A 4PCQA 1OYYA 3FMQA 3TDZC 1RZ4A 4JQFA 2ZKZA 1FZPB 4FX4A 3LQQA 3MWMA 4OINF 2W25A 4A0ZA 2EB7A 4WXDA 3SXYA 3ZMZA 5D8LB 1Z1DA 2CG4A 4EJOA 3K2ZA 2VN2A 1R58A 5DUKA 3CO7C 1QBJA 1V4RA 5K5OA 4ZZLA 3HRMA 1FOKA 1O57A 3L7WA 1U5TA 5AIPA 4ZYDA 4QWQA 1H9GA 3H3ZA 4ESFA 1C0WA 2ZJ2A 4JBAA 3RPQA 4EJTA 3FXQA 2OQRA 3BJOA 5DYMA 4LJZF 3QOPA 3GEZA 2QENA 3IHUA 3WTZA 1G3SA 1YS7A 4G6DA 1P4AA 2Q0OA 2KIMA 3T1BA 4YG2F 1RIOH 3L09A 2GA2A 4FT8A 5K5RA 5LHHA 2BYVE 5JHUA 2Z33A 3F22A 2XAGA 3CDHA 1FYKA 2FEZA 1J5YA 2VODA 3IKVA 3Q9VA 3IWFA 2DPUA 2Q2EA 2EA2A 2HTJA 5ICGA 1HQCA 2VBYA 3ROUA 2QZ8A 3U1DA 3F8MA 3ABUA 3U2RA 4Z2YA 2PLYA 3DF8A 2JZYA 1HBXG 1ZRCA 4PZJA 2HDCA 2GXBA 2A61A 5FGMA 1B59A 1F1ZA 2HYGD 4OU0A 5LRSA 3E97A 2DBBA 3FX3A 3GF2A 5LLQA 4UNOA 1D5VA 2FE3A 1HKQA 3ZMTA 2V1XA 2Z99A 4OIOF 4YIFA 1XMAA 1WI9A 3MZHA 2O61A 4LK0F 3IKTA 4IRIA 2DT5A 2R3SA 4OIQF 4IRGA 1IUYA 4HAMA 3V8LA 1YTYA 1YIOA 1MZBA 2ZMEB 2E1CA 1BI1A 2RN7A 1ZN2A 2HWVA 1ZGJA 5J8FA 3KCCA 4KT5C 4BHBA 4ENKA 3E6MA 1AOYA 3M9AA 3RKYA 1XGOA 3FXUA 2IT0A 4L18B 3WU0A 4BQAA 2WC2A 3DP7A 5E20A 2GIVA 1T39A 4R8HA 1R5HA 2YX4A 4G9YA 4XBFA 4A6EA 4S05A 3RYPA 2K4JA 3KLNA 1YLFA 3RKXA 1J59A 3HSRA 1IXCA 3C7JA 1SFXA 3GYHX 2W57A 1YS6A 1L0OC 1UHMA 1XSDA 5HS8A 4EJWA 5EEGA 2C6YA 4EMSA 2RDPA 3Q5FA 2VBWA 1OMIA 2JPBA 3TKYA 2M1BA 1LNWA 3BDDA 1RNLA 5ICCA 3J80K 1IXRC 5FB2A 4E70A 3MFKA 3CUQA 4LB5A 2VONA 2A6HF 1LEBA 1MJBA 2LF7A 4PGGA 1HKTA 2FXAA 2OZUA 1EH7A 4MNUA 3LAJA 1WRJA 2IP2A 1YW7A 5TJJA 4WXHA 3EETA 2EJRA 1ZG3A 2VE9A 2JRTA 3WODF 2H94A 1J7KA 1D3YA 1MDMB 2XAFA 2R7DA 5L3DA 1STZA 1MD0A 5LRRA 1PP7U 3IRRA 5D8KB 3U9GA 1AWCA 4KICA 3GZ6A 4YFXF 4KIFA 3MCZA 2EFNA 4HYEA 3RKWA 1E17A 2XUBA 4JK1X 2DLLA 1XSXA 1S8NA 3TOBA 2V79A 4I09A 2D45A 5ILUA 4F7ZA 1LDJA 1IN6A 4FX0A 3F21A 1D8KA 3O6BB 4P9FA 5DCFA 4Y13A 1J75A 1BBYA 2OD5A 4MTDA 3ZQ7A 5K1YA 1NHAA 5L3FA 5ILVA 2LF8A 4Q48A 3WTWC 3RIRA 3NEUA 3J80Z 4RS8A 1CF7B 2V1DA 3JAMZ 2K4BA 4U7BA 1IN7A 2O03A 4EGZA 1JXSA 3ISPA 3Q9SA 1XCVA 5DCMA 2UZKA 1OYIA 2MLGA 4P55A 1J9IA 5EEHA 4OMYA 4U88A 2FOKA 3PFIA 5IT3A 3QP6A 2W84A 2ESHA 3JTGA 2IRFG 3LA2A 4LK1F 3VB2A 3CUOA 4CGZA 4XLPF 4NQWA 5D5UB 4HQMA 5LBQA 1EH6A 3V7CA 5HDGA 3PQKA 1L3LA 4KMUX 3WU1B 3OOPA 4ZYGA 2NS0A 2VBXA 3I0TA 1V3FA 5DUIA 5K5QA 2H27A 4WK8F 4G94A 2OA4A 3QPTA 3DKWA 4O6JA 3WTXC 2AS5F 3R61A 1EV7A 2HQNA 2P4WA 2VE8A 3BP8A 4XSXF 4UXNA 4AD9A 2E7WA 3JSOA 1F4KA 5DDGA 2ACJA 3E5QA 1H0MA 1K6OA 1IW7F 5H6RA 5FD5A 3QRFF 1W5TA 3DEUA 3CUQB 3GFMA 4HDUA 5CVVA 2CFXA 1ZREA 2ZMEA 1XSVA 5FFXA 4DNCA 4EJUA 2G7UA 2FF4A 1MJ9A 2DAOA 3GFLA 1T0FA 4BYYA 1BC8C 1IN5A 4WWCA 1KA8A 3SZTA 1ULYA 2O6GE 1Y0UA 5D4RA 2FBHA 3I59B 2O8XA 4WF2A 3I59A 2HGCA 3HHGA 1XD7A 2VOPA 3BROA 4L9VA 3T5XA 2EV0A 2XGXA 3KEOA 4GO1A 1XDUA 2OBPA 2W85A 1U6GA 1FYLA 2Y75A 1O7LA 1FSHA 1LEAA 1IN4A 3J7AO 1ZG5A 2KIUA 4CXFA 1MDMA 4HV6A 1YO5C 4O5VA 2MD5A 3GLXA 1ZH5A 5E1ZB 5JFRA 4QLCU 3KE2A 5A2QK 1KU3A 3LAPA 1HSTA 5E18F 5E17F 4L9NA 2BV6A 3ML6A 3WTVC 1QGPA 5J8CA 5JVTA 1IZ1A 5LEKA 5KK1A 2EK5A 5ICFA 2LDUA 2YU3A 3FF5A 1S7AA 1R7JA 2BE5F 4XRFA 2MH2A 1P4WA 4OOIA 3C3WA 4OMZA 3R60A 3B73A 4ENJA 5LEJA 3HYIA 4OIPF 5DD8A 1FX7A 2HTSA 4EM1A 4A12A 1O3SA 1KU9A 2FQ3A 4KMFA 3AAFA 4R1HA 1WKMA 4UVCA 2P5VA 3DFGA 4MTEA 5ILSA 1R1VA 5IT9K 3KP6A 5E1WA 1I5ZA 4TV7A 1SMYF 4ENMA 3ECHA 5CVJA 2CYYA 1JGSA 4IVNA 1B9NA 3N4MA 3ERED 2DO7A 4N9IA 3R0JA 1KQ9A 5L3GA 3E5XA 4LD5A 3BPVA 3E5UA 2ZXJA 1JE8A 3C1DA 2NYXA 1IN8A 2PMHA 2MC3A 5J6XA 5L3BA 4P96A 3TO9A 2DI3A 2DW4A 4ESJA 1R36A 2UXXA 5FFZA 3FWEA 2RVCA 3RYRA 1OKRA 4BH9A 1S3JA 2B0LA 4KN7X 2HKOA 3V8KA 4FHTA 3FM3A 5DEQA 1VTNC 3L9FA 2L02A 3FMRA 3KLOA 1HXDA 4HBLA 4BHCA 3L2CA 2IA2A 4ON0A 3GX4X 1I1SA 3E6DA 1Z05A 1KU2A 5DV5A 1SFEA 2OQGA 5JR3A 4Q4ZF 2JPCA 5DD4A 2CSOA 3QPHA 3FM5A 3I4PA 4HQEA 2FMLA 3EQLF 1I6XA 1P4XA 4ZYEA 4LLNA 1U3EM 3T0YA 4IJAA 1FP1D 1G3YA 3FZVA 4M6XA 1O3TA 3ZN1A 2QQ9A 4RB3C 1HSJA 2X0LA 4CO8A 1Z7UA 3OV8A 4LG0B 2P5KA 4HDVA 2P7CB 2CO5A 4S04A 5F6FA 3V8JA 1Z9CA 3O2PE 3TQNA 2VC1A 3F6OA 5BOXA 5CVUA 4ZH4F 4ESBA 4KDPA 1K78B 4PGHA 1R22A 2STWA 2HEOA 2M87A 2KJBA 5H6QA 1PDNC 3I53A 2Q8KA 6PAXA 2QM3A 2BGCA 3GW2A 4HOBA 1U5TB 3KEQA 1R5GA 4A6DA 3D5LA 2M5WA 3G3ZA 3D0SA 5HLGA 2E1NA 2F2EA 3HUGA 2ISZA 2DU9A 1SD5A 2FBKA 1GVJA 3K0LA 1XGSA 2PG4A 1SD6A 1KYWA 3WG9A 3KP5A 1OPCA 4YFKF 3GUDA 2F5EA 1S7OA 4G7HF 2IJLA 5CVIA 4LB6B 1XGNA 5HOOA 1FP2A 1B4AA 2O3FA 2CGPA 4N0BA 4B8XA 3T8TA 4BNCA 3QU3A 5BMZA 4U0VA 2VOOA 1W7PD 3KFWX 5E8IA 3FXRA 3LA7A 2BBYA 1FY7A 4AWXB 1LQ1A 4Y17A 1YW9A 3WTYC 4Q47A 3B02A 4M9XA 4I2OA 3R4KA 5CVRA 1A04A 1QNTA 1XGMA 3I5UA 4AIHA 1QO0D 2TDXA 3EDPA 2HFHA 4XLNF 1XCBA 2QQAA 4M73A 2PBIA 3V4GA 2FU4A 2EFOA 3GO5A 5FLXK 3SQNA 2ZO4A 1T98A 3DQVC 3E3VA 3CLOA 2WV0A 1KYZA 1FWZA 1Z6TA 4BHPA 2HS5A 3MZYA 3C18A 1DDNA 2IA0A 1U5TC 2KKOA 3R0AA 3BWGA 1HW2A 4RB0A 1R1TA 2ETHA 2KRFA 2IW5A 1B9MA 3HRSA 3COAC 3WGIA 2K86A 3F8NA 1W5SA 1LDKB 4LG0A 1IAWA 1UB9A 2EA4A 4A0YA 2PQ8A 2ISYA 4KA4A 1G6NA 3HHHA 3KP4A 3F8BA 1BM9A 3P9KA 3E6BA 2RQPA 1SD7A 3P9CA 2X4HA 2RNJA 2H09A 2V1UA 2KIFA 1QPMA 5IT9Z 2PI0A 1XN7A 5CYVA 4HX7A 2Z3YA 2L3DA 2STTA 1KQ0A 3FMSA 5LGNA 1Q1HA 2D1HA 1FBUA 5HDNA 2V9VA 3HOSA 2PEXA 3K9TA 5HS9A 4WCGA 2MLKA 2XHKA 1K79A 1G4DA 1P92A 2GWRA 1TLHB 3HTSB 2QWWA 3DV8A 2QBYB 3GFJA 2HZTA 3ECOA 3RJPA 2DPDA 3GFIA 5BS6A 3JSPA 4NHJA 3HRUA 3SFZA 5LHIA 1I27A 1ON2A 5LGTA 4UUVA 1OR7A 2FNPA 1W7PA 3I71A 5L3EA 5KVRA 4A5NA 2KJCA 2VT2A 4EQQA 2J5PA 3F3XA 4RGSA 1FT9A 1FYMA 2CQKA 3BPXA 2ADUA 3GVAA 3QU6A 2EFPA 2Y0MA 3F8FA 3DXJF 2FRHA 4GCVA 2F5DA 2DTRA 1FLIA 2G9WA 2M45A 3KP2A 4WXCA 1DPUA 3N97A 1B1BA 2YPRA 3M7GA 3I54A 4HV5A 2AXLA 3RTRA 2PN6A 3QAHA 2MA3A 1TQIA 1HW5A 2QYOA 5BPIA 2J5OA 3GZ5A 1GXPA 4K2EA 3WTSC 1IF1A 3ELKA 2P7VB 4EV0A 2PJPA 1K78A 1TTYA 4ETSA 2EV5A 4G7ZF 2IVMA 1ON1A 2YR2A 3TOAA 3WTTC 2WTEA 4LLLA 3BY6A 3T8RA 3LQRA 3GXOA 1ZRFA 3I58A 4D0PA 3J81Z 5D5WB 2ZNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8J A;  4L5J A;  2RC4 A;  2DQL A;  5HLI A;  2QUF A;  4EVI A;  2VXZ A;  2A69 F;  2XVC A;  1H9T A;  2JT1 A;  4HX8 A;  3KZZ A;  2FA5 A;  4AIJ A;  1R00 A;  3NQO A;  4YFN F;  2XAS A;  5E1X A;  2OAZ A;  5LHG A;  5FLX Z;  3WTU C;  2RKH A;  3RDI A;  4RGX A;  3IRQ A;  4H0E A;  5JI6 A;  1T2K A;  5AIQ A;  2DFI A;  2CWE A;  1U78 A;  3BOQ A;  3WGH A;  1ZLJ A;  3REO A;  1ZG1 A;  1TBX A;  2RV8 A;  1LB2 A;  1LVA A;  2M8E A;  5D6E A;  1ZAO A;  3K1M A;  1O7F A;  4EM2 A;  4MGR A;  1ONV A;  3KP7 A;  5LGU A;  1KU7 A;  2UXN A;  3ZPL A;  5ED4 A;  3MEX A;  3CO6 C;  3F23 A;  2A6E F;  1QZY A;  2OU2 A;  2HYF A;  2PFB A;  2ZCW A;  5BPD A;  5TRD A;  4U7D A;  3DPL C;  2FBI A;  1SMT A;  1XDS A;  2XRN A;  1GXQ A;  1PUE E;  1Z6R A;  5H20 A;  2PMU A;  2P6S A;  2YSR A;  2XKO A;  2K7L A;  3E6C C;  4KNY A;  4ZZD A;  3K1N A;  4G8X A;  3VEP A;  1E2X A;  1ZRD A;  1XMK A;  3R6S A;  4CZZ A;  1BN5 A;  2ELH A;  3EUH A;  1SD4 A;  2L54 A;  4L5I A;  1SAX A;  2GXG A;  4I01 A;  4CDG A;  5AON A;  3TGN A;  5HDK A;  2GAU A;  2EWN A;  3CJN A;  4MHG A;  4HF2 A;  2LSO A;  4IXA A;  1ZHF A;  4U0Y A;  3LFK A;  2HQR A;  4CYD A;  2D1V A;  2L01 A;  1J2X A;  5L3C A;  4HLY A;  3P7N A;  4UV9 A;  3HSE A;  3M8E A;  5D5X B;  3ZMD A;  3ULQ B;  4WX9 A;  3P9I A;  4L0Z B;  5CLS A;  4IF4 A;  1LDD A;  1S29 A;  4IHS A;  4I98 B;  5HVQ C;  1HW1 A;  4EJV A;  4EGY A;  3LST A;  1RUO A;  1YFH A;  4MQV A;  1TQP A;  4UHT A;  1QQI A;  1QZZ A;  4CIC A;  2A3S A;  1DUX C;  1W4M A;  5E8G A;  2DK5 A;  5D5V B;  3V7R A;  2OZ6 A;  1WWX A;  1YW8 A;  3JW4 A;  4XSZ F;  3K1P A;  2L4M A;  1JHH A;  2NRA C;  2NAZ A;  1TW2 A;  4RAY A;  3VOE A;  1R1U A;  4G6Q A;  1BJA A;  2UWM A;  4I0B A;  3H92 A;  2IA1 A;  3K69 A;  2YX7 A;  3VFZ A;  3HIF A;  1WSU A;  1PP8 F;  2LNB A;  1MKM A;  4RB2 C;  3KET A;  2COM A;  1BOA A;  1P6R A;  1TQM A;  1KQ8 A;  3W6J B;  2DQR A;  2ESN A;  4L9J A;  4HZF A;  4GGG A;  4P5O A;  1DP7 P;  2H6B A;  3V7S A;  4B09 A;  1FC3 A;  4AVP A;  4ASN A;  4N9H A;  4LGW A;  2NNY A;  4ENN A;  2P8T A;  4KIB A;  1F5T A;  4I0A A;  2O0Y A;  4NB5 A;  1T38 A;  4ZYH A;  2ZNY A;  4KUM A;  4KN4 X;  1ZAR A;  1O3R A;  1W7P B;  2F5C A;  1YYV A;  1T6S A;  3F6V A;  4MQ9 F;  2BEO A;  3ZP5 A;  1OYW A;  1JHF A;  4BXU A;  4UVA A;  2QVO A;  3NRV A;  4RGU A;  2K02 A;  4M9Z A;  4HLX A;  5DCM B;  1R23 A;  2W24 A;  3WE3 A;  1BI2 A;  2EFQ A;  3FHZ A;  3PQJ A;  3QP5 A;  3EYY A;  1ZGA A;  3SHF A;  2QBY A;  4UV8 A;  1DPR A;  4KIG A;  2XRO A;  3LA3 A;  1BIA A;  1YQA A;  3CTA A;  1B6A A;  1BI0 A;  3WGG A;  4P9U A;  4G7O F;  3S2W A;  3GWZ A;  2H6C A;  1WQ2 A;  3H3U A;  3LWF A;  1O3Q A;  4IHT A;  4M6Y A;  5BQT A;  1F9N A;  4HA8 A;  3HOT A;  2L4A A;  4M71 A;  2XIG A;  1SFU A;  1Z91 A;  4LLG F;  2A68 F;  5CJ9 A;  1IRF A;  2VC0 A;  1GHC A;  1XB4 A;  4RB1 A;  1MJA A;  4O3M A;  2IPQ X;  2P5L C;  1J0R A;  1UST A;  1UCR A;  2XAJ A;  4LMY A;  2CW0 F;  3BZ6 A;  4M72 A;  1K7A A;  5HS7 A;  2FNA A;  4HX4 A;  5D6F A;  1UHW A;  3J81 K;  1RUN A;  3ZMU A;  1FPQ A;  2XAH A;  3ZMS A;  1TNT A;  1U2W A;  4Y15 A;  4A2U A;  4L0Y B;  2HKX A;  2G7H A;  1X3U A;  1U8R A;  2M30 A;  4MEY F;  5HLH A;  1UFM A;  1BI3 A;  2V6C A;  2RGV A;  1KGS A;  2DK8 A;  4GYG A;  3EYI A;  2Z5U A;  4R79 A;  2WWY A;  4YII A;  3BJ6 A;  1MGT A;  2GZW A;  2K27 A;  4OIR F;  2JSC A;  1G3T A;  3W6K B;  3IL2 A;  5F64 A;  2MH9 A;  4GXO A;  3KZY A;  5F1R A;  1FBS A;  2D2W A;  3CUQ C;  3IC7 A;  2XAQ A;  1BIB A;  2VT3 A;  3M1E A;  3WE2 A;  1YG2 A;  3G73 A;  2LKP A;  5A2Q Z;  2A07 F;  3M8F A;  3JTH A;  1IRG A;  4PDK A;  1LJ9 A;  3ZN0 A;  3BJA A;  2MBF A;  3VOD A;  3IWZ A;  1CF7 A;  3HTU A;  1EH8 A;  4LFU A;  1P2F A;  5FD6 A;  4Q5S F;  2NNN A;  4U0W A;  2ZBK A;  4KFC A;  3F72 A;  3L00 A;  2JTV A;  2P6T A;  4BAY A;  2QLZ A;  1S6L A;  4IRH A;  4MEX F;  1TW3 A;  1REP C;  3F8C A;  3RI4 A;  4A0X A;  3HSF A;  3DPT A;  2XV4 S;  1CGP A;  4CHU A;  4HW0 A;  4M74 A;  4M9S A;  2ZFW A;  1G3W A;  2HR3 A;  3MQ0 A;  1BC7 C;  4RGR A;  2VBZ A;  2E7X A;  2R7F A;  4DQ2 A;  4HF0 A;  1TNS A;  4I02 A;  2FMY A;  4L9T A;  4KYW A;  2F5F A;  3ABT A;  2XKP A;  3RPU A;  2EV6 A;  3TDU C;  2HOE A;  1I1G A;  4EM0 B;  2A5Y B;  3O3K A;  3TO7 A;  3TO6 A;  3JAM K;  5ICE A;  1ODD A;  1ZYR F;  3I64 A;  1USS A;  3KP3 A;  2Y48 A;  4UVB A;  4AIK A;  4RAZ A;  1HKS A;  4IPA A;  2EFW A;  4GYI A;  4I7H A;  2FSW A;  5ERI A;  3SZP A;  1ZLK A;  2GQQ A;  1FBQ A;  4A5M A;  3MAJ A;  3HRT A;  1FNN A;  1RI7 A;  1IXS B;  2QQB A;  3ZMV A;  5FO5 A;  5D4S A;  2Z9O A;  4HF1 A;  1FSE A;  2GA1 A;  4PCQ A;  1OYY A;  3FMQ A;  3TDZ C;  1RZ4 A;  4JQF A;  2ZKZ A;  1FZP B;  4FX4 A;  3LQQ A;  3MWM A;  4OIN F;  2W25 A;  4A0Z A;  2EB7 A;  4WXD A;  3SXY A;  3ZMZ A;  5D8L B;  1Z1D A;  2CG4 A;  4EJO A;  3K2Z A;  2VN2 A;  1R58 A;  5DUK A;  3CO7 C;  1QBJ A;  1V4R A;  5K5O A;  4ZZL A;  3HRM A;  1FOK A;  1O57 A;  3L7W A;  1U5T A;  5AIP A;  4ZYD A;  4QWQ A;  1H9G A;  3H3Z A;  4ESF A;  1C0W A;  2ZJ2 A;  4JBA A;  3RPQ A;  4EJT A;  3FXQ A;  2OQR A;  3BJO A;  5DYM A;  4LJZ F;  3QOP A;  3GEZ A;  2QEN A;  3IHU A;  3WTZ A;  1G3S A;  1YS7 A;  4G6D A;  1P4A A;  2Q0O A;  2KIM A;  3T1B A;  4YG2 F;  1RIO H;  3L09 A;  2GA2 A;  4FT8 A;  5K5R A;  5LHH A;  2BYV E;  5JHU A;  2Z33 A;  3F22 A;  2XAG A;  3CDH A;  1FYK A;  2FEZ A;  1J5Y A;  2VOD A;  3IKV A;  3Q9V A;  3IWF A;  2DPU A;  2Q2E A;  2EA2 A;  2HTJ A;  5ICG A;  1HQC A;  2VBY A;  3ROU A;  2QZ8 A;  3U1D A;  3F8M A;  3ABU A;  3U2R A;  4Z2Y A;  2PLY A;  3DF8 A;  2JZY A;  1HBX G;  1ZRC A;  4PZJ A;  2HDC A;  2GXB A;  2A61 A;  5FGM A;  1B59 A;  1F1Z A;  2HYG D;  4OU0 A;  5LRS A;  3E97 A;  2DBB A;  3FX3 A;  3GF2 A;  5LLQ A;  4UNO A;  1D5V A;  2FE3 A;  1HKQ A;  3ZMT A;  2V1X A;  2Z99 A;  4OIO F;  4YIF A;  1XMA A;  1WI9 A;  3MZH A;  2O61 A;  4LK0 F;  3IKT A;  4IRI A;  2DT5 A;  2R3S A;  4OIQ F;  4IRG A;  1IUY A;  4HAM A;  3V8L A;  1YTY A;  1YIO A;  1MZB A;  2ZME B;  2E1C A;  1BI1 A;  2RN7 A;  1ZN2 A;  2HWV A;  1ZGJ A;  5J8F A;  3KCC A;  4KT5 C;  4BHB A;  4ENK A;  3E6M A;  1AOY A;  3M9A A;  3RKY A;  1XGO A;  3FXU A;  2IT0 A;  4L18 B;  3WU0 A;  4BQA A;  2WC2 A;  3DP7 A;  5E20 A;  2GIV A;  1T39 A;  4R8H A;  1R5H A;  2YX4 A;  4G9Y A;  4XBF A;  4A6E A;  4S05 A;  3RYP A;  2K4J A;  3KLN A;  1YLF A;  3RKX A;  1J59 A;  3HSR A;  1IXC A;  3C7J A;  1SFX A;  3GYH X;  2W57 A;  1YS6 A;  1L0O C;  1UHM A;  1XSD A;  5HS8 A;  4EJW A;  5EEG A;  2C6Y A;  4EMS A;  2RDP A;  3Q5F A;  2VBW A;  1OMI A;  2JPB A;  3TKY A;  2M1B A;  1LNW A;  3BDD A;  1RNL A;  5ICC A;  3J80 K;  1IXR C;  5FB2 A;  4E70 A;  3MFK A;  3CUQ A;  4LB5 A;  2VON A;  2A6H F;  1LEB A;  1MJB A;  2LF7 A;  4PGG A;  1HKT A;  2FXA A;  2OZU A;  1EH7 A;  4MNU A;  3LAJ A;  1WRJ A;  2IP2 A;  1YW7 A;  5TJJ A;  4WXH A;  3EET A;  2EJR A;  1ZG3 A;  2VE9 A;  2JRT A;  3WOD F;  2H94 A;  1J7K A;  1D3Y A;  1MDM B;  2XAF A;  2R7D A;  5L3D A;  1STZ A;  1MD0 A;  5LRR A;  1PP7 U;  3IRR A;  5D8K B;  3U9G A;  1AWC A;  4KIC A;  3GZ6 A;  4YFX F;  4KIF A;  3MCZ A;  2EFN A;  4HYE A;  3RKW A;  1E17 A;  2XUB A;  4JK1 X;  2DLL A;  1XSX A;  1S8N A;  3TOB A;  2V79 A;  4I09 A;  2D45 A;  5ILU A;  4F7Z A;  1LDJ A;  1IN6 A;  4FX0 A;  3F21 A;  1D8K A;  3O6B B;  4P9F A;  5DCF A;  4Y13 A;  1J75 A;  1BBY A;  2OD5 A;  4MTD A;  3ZQ7 A;  5K1Y A;  1NHA A;  5L3F A;  5ILV A;  2LF8 A;  4Q48 A;  3WTW C;  3RIR A;  3NEU A;  3J80 Z;  4RS8 A;  1CF7 B;  2V1D A;  3JAM Z;  2K4B A;  4U7B A;  1IN7 A;  2O03 A;  4EGZ A;  1JXS A;  3ISP A;  3Q9S A;  1XCV A;  5DCM A;  2UZK A;  1OYI A;  2MLG A;  4P55 A;  1J9I A;  5EEH A;  4OMY A;  4U88 A;  2FOK A;  3PFI A;  5IT3 A;  3QP6 A;  2W84 A;  2ESH A;  3JTG A;  2IRF G;  3LA2 A;  4LK1 F;  3VB2 A;  3CUO A;  4CGZ A;  4XLP F;  4NQW A;  5D5U B;  4HQM A;  5LBQ A;  1EH6 A;  3V7C A;  5HDG A;  3PQK A;  1L3L A;  4KMU X;  3WU1 B;  3OOP A;  4ZYG A;  2NS0 A;  2VBX A;  3I0T A;  1V3F A;  5DUI A;  5K5Q A;  2H27 A;  4WK8 F;  4G94 A;  2OA4 A;  3QPT A;  3DKW A;  4O6J A;  3WTX C;  2AS5 F;  3R61 A;  1EV7 A;  2HQN A;  2P4W A;  2VE8 A;  3BP8 A;  4XSX F;  4UXN A;  4AD9 A;  2E7W A;  3JSO A;  1F4K A;  5DDG A;  2ACJ A;  3E5Q A;  1H0M A;  1K6O A;  1IW7 F;  5H6R A;  5FD5 A;  3QRF F;  1W5T A;  3DEU A;  3CUQ B;  3GFM A;  4HDU A;  5CVV A;  2CFX A;  1ZRE A;  2ZME A;  1XSV A;  5FFX A;  4DNC A;  4EJU A;  2G7U A;  2FF4 A;  1MJ9 A;  2DAO A;  3GFL A;  1T0F A;  4BYY A;  1BC8 C;  1IN5 A;  4WWC A;  1KA8 A;  3SZT A;  1ULY A;  2O6G E;  1Y0U A;  5D4R A;  2FBH A;  3I59 B;  2O8X A;  4WF2 A;  3I59 A;  2HGC A;  3HHG A;  1XD7 A;  2VOP A;  3BRO A;  4L9V A;  3T5X A;  2EV0 A;  2XGX A;  3KEO A;  4GO1 A;  1XDU A;  2OBP A;  2W85 A;  1U6G A;  1FYL A;  2Y75 A;  1O7L A;  1FSH A;  1LEA A;  1IN4 A;  3J7A O;  1ZG5 A;  2KIU A;  4CXF A;  1MDM A;  4HV6 A;  1YO5 C;  4O5V A;  2MD5 A;  3GLX A;  1ZH5 A;  5E1Z B;  5JFR A;  4QLC U;  3KE2 A;  5A2Q K;  1KU3 A;  3LAP A;  1HST A;  5E18 F;  5E17 F;  4L9N A;  2BV6 A;  3ML6 A;  3WTV C;  1QGP A;  5J8C A;  5JVT A;  1IZ1 A;  5LEK A;  5KK1 A;  2EK5 A;  5ICF A;  2LDU A;  2YU3 A;  3FF5 A;  1S7A A;  1R7J A;  2BE5 F;  4XRF A;  2MH2 A;  1P4W A;  4OOI A;  3C3W A;  4OMZ A;  3R60 A;  3B73 A;  4ENJ A;  5LEJ A;  3HYI A;  4OIP F;  5DD8 A;  1FX7 A;  2HTS A;  4EM1 A;  4A12 A;  1O3S A;  1KU9 A;  2FQ3 A;  4KMF A;  3AAF A;  4R1H A;  1WKM A;  4UVC A;  2P5V A;  3DFG A;  4MTE A;  5ILS A;  1R1V A;  5IT9 K;  3KP6 A;  5E1W A;  1I5Z A;  4TV7 A;  1SMY F;  4ENM A;  3ECH A;  5CVJ A;  2CYY A;  1JGS A;  4IVN A;  1B9N A;  3N4M A;  3ERE D;  2DO7 A;  4N9I A;  3R0J A;  1KQ9 A;  5L3G A;  3E5X A;  4LD5 A;  3BPV A;  3E5U A;  2ZXJ A;  1JE8 A;  3C1D A;  2NYX A;  1IN8 A;  2PMH A;  2MC3 A;  5J6X A;  5L3B A;  4P96 A;  3TO9 A;  2DI3 A;  2DW4 A;  4ESJ A;  1R36 A;  2UXX A;  5FFZ A;  3FWE A;  2RVC A;  3RYR A;  1OKR A;  4BH9 A;  1S3J A;  2B0L A;  4KN7 X;  2HKO A;  3V8K A;  4FHT A;  3FM3 A;  5DEQ A;  1VTN C;  3L9F A;  2L02 A;  3FMR A;  3KLO A;  1HXD A;  4HBL A;  4BHC A;  3L2C A;  2IA2 A;  4ON0 A;  3GX4 X;  1I1S A;  3E6D A;  1Z05 A;  1KU2 A;  5DV5 A;  1SFE A;  2OQG A;  5JR3 A;  4Q4Z F;  2JPC A;  5DD4 A;  2CSO A;  3QPH A;  3FM5 A;  3I4P A;  4HQE A;  2FML A;  3EQL F;  1I6X A;  1P4X A;  4ZYE A;  4LLN A;  1U3E M;  3T0Y A;  4IJA A;  1FP1 D;  1G3Y A;  3FZV A;  4M6X A;  1O3T A;  3ZN1 A;  2QQ9 A;  4RB3 C;  1HSJ A;  2X0L A;  4CO8 A;  1Z7U A;  3OV8 A;  4LG0 B;  2P5K A;  4HDV A;  2P7C B;  2CO5 A;  4S04 A;  5F6F A;  3V8J A;  1Z9C A;  3O2P E;  3TQN A;  2VC1 A;  3F6O A;  5BOX A;  5CVU A;  4ZH4 F;  4ESB A;  4KDP A;  1K78 B;  4PGH A;  1R22 A;  2STW A;  2HEO A;  2M87 A;  2KJB A;  5H6Q A;  1PDN C;  3I53 A;  2Q8K A;  6PAX A;  2QM3 A;  2BGC A;  3GW2 A;  4HOB A;  1U5T B;  3KEQ A;  1R5G A;  4A6D A;  3D5L A;  2M5W A;  3G3Z A;  3D0S A;  5HLG A;  2E1N A;  2F2E A;  3HUG A;  2ISZ A;  2DU9 A;  1SD5 A;  2FBK A;  1GVJ A;  3K0L A;  1XGS A;  2PG4 A;  1SD6 A;  1KYW A;  3WG9 A;  3KP5 A;  1OPC A;  4YFK F;  3GUD A;  2F5E A;  1S7O A;  4G7H F;  2IJL A;  5CVI A;  4LB6 B;  1XGN A;  5HOO A;  1FP2 A;  1B4A A;  2O3F A;  2CGP A;  4N0B A;  4B8X A;  3T8T A;  4BNC A;  3QU3 A;  5BMZ A;  4U0V A;  2VOO A;  1W7P D;  3KFW X;  5E8I A;  3FXR A;  3LA7 A;  2BBY A;  1FY7 A;  4AWX B;  1LQ1 A;  4Y17 A;  1YW9 A;  3WTY C;  4Q47 A;  3B02 A;  4M9X A;  4I2O A;  3R4K A;  5CVR A;  1A04 A;  1QNT A;  1XGM A;  3I5U A;  4AIH A;  1QO0 D;  2TDX A;  3EDP A;  2HFH A;  4XLN F;  1XCB A;  2QQA A;  4M73 A;  2PBI A;  3V4G A;  2FU4 A;  2EFO A;  3GO5 A;  5FLX K;  3SQN A;  2ZO4 A;  1T98 A;  3DQV C;  3E3V A;  3CLO A;  2WV0 A;  1KYZ A;  1FWZ A;  1Z6T A;  4BHP A;  2HS5 A;  3MZY A;  3C18 A;  1DDN A;  2IA0 A;  1U5T C;  2KKO A;  3R0A A;  3BWG A;  1HW2 A;  4RB0 A;  1R1T A;  2ETH A;  2KRF A;  2IW5 A;  1B9M A;  3HRS A;  3COA C;  3WGI A;  2K86 A;  3F8N A;  1W5S A;  1LDK B;  4LG0 A;  1IAW A;  1UB9 A;  2EA4 A;  4A0Y A;  2PQ8 A;  2ISY A;  4KA4 A;  1G6N A;  3HHH A;  3KP4 A;  3F8B A;  1BM9 A;  3P9K A;  3E6B A;  2RQP A;  1SD7 A;  3P9C A;  2X4H A;  2RNJ A;  2H09 A;  2V1U A;  2KIF A;  1QPM A;  5IT9 Z;  2PI0 A;  1XN7 A;  5CYV A;  4HX7 A;  2Z3Y A;  2L3D A;  2STT A;  1KQ0 A;  3FMS A;  5LGN A;  1Q1H A;  2D1H A;  1FBU A;  5HDN A;  2V9V A;  3HOS A;  2PEX A;  3K9T A;  5HS9 A;  4WCG A;  2MLK A;  2XHK A;  1K79 A;  1G4D A;  1P92 A;  2GWR A;  1TLH B;  3HTS B;  2QWW A;  3DV8 A;  2QBY B;  3GFJ A;  2HZT A;  3ECO A;  3RJP A;  2DPD A;  3GFI A;  5BS6 A;  3JSP A;  4NHJ A;  3HRU A;  3SFZ A;  5LHI A;  1I27 A;  1ON2 A;  5LGT A;  4UUV A;  1OR7 A;  2FNP A;  1W7P A;  3I71 A;  5L3E A;  5KVR A;  4A5N A;  2KJC A;  2VT2 A;  4EQQ A;  2J5P A;  3F3X A;  4RGS A;  1FT9 A;  1FYM A;  2CQK A;  3BPX A;  2ADU A;  3GVA A;  3QU6 A;  2EFP A;  2Y0M A;  3F8F A;  3DXJ F;  2FRH A;  4GCV A;  2F5D A;  2DTR A;  1FLI A;  2G9W A;  2M45 A;  3KP2 A;  4WXC A;  1DPU A;  3N97 A;  1B1B A;  2YPR A;  3M7G A;  3I54 A;  4HV5 A;  2AXL A;  3RTR A;  2PN6 A;  3QAH A;  2MA3 A;  1TQI A;  1HW5 A;  2QYO A;  5BPI A;  2J5O A;  3GZ5 A;  1GXP A;  4K2E A;  3WTS C;  1IF1 A;  3ELK A;  2P7V B;  4EV0 A;  2PJP A;  1K78 A;  1TTY A;  4ETS A;  2EV5 A;  4G7Z F;  2IVM A;  1ON1 A;  2YR2 A;  3TOA A;  3WTT C;  2WTE A;  4LLL A;  3BY6 A;  3T8R A;  3LQR A;  3GXO A;  1ZRF A;  3I58 A;  4D0P A;  3J81 Z;  5D5W B;  2ZNZ A; 
#chains in the Genus database with same CATH topology
 1D8J A;  3OYA A;  1DQU A;  5M5Y J;  4L5J A;  1JUM A;  2RC4 A;  2DQL A;  3HBL A;  1LPQ A;  5HLI A;  2QUF A;  4EVI A;  2VXZ A;  2A69 F;  3JRA A;  2XVC A;  1OCC H;  2JT1 A;  1H9T A;  4HX8 A;  2L9R A;  4DBR A;  4MLO A;  3KZZ A;  3A0B C;  2KZV A;  2CS3 A;  2FA5 A;  2X85 A;  4AIJ A;  1R00 A;  3NQO A;  4YFN F;  2XAS A;  1BW5 A;  5E1X A;  4PK4 A;  5DTD A;  2HQ5 A;  1VQN I;  2OAZ A;  5LHG A;  2EPF A;  5FLX Z;  3AL0 C;  3WTU C;  2RKH A;  1IDY A;  3RDI A;  4RGX A;  2BY0 A;  5BNG A;  3IRQ A;  1ZTR A;  4H0E A;  4HNT A;  5JI6 A;  1T2K A;  5AIQ A;  2DFI A;  3CD6 I;  2CWE A;  1U78 A;  3BOQ A;  3WGH A;  1ZLJ A;  3REO A;  1ZG1 A;  1TBX A;  1NH3 A;  3Q3S A;  2RV8 A;  1LB2 A;  3M8J A;  1LVA A;  4GRI A;  5M5X J;  2M8E A;  5EGO A;  5D6E A;  1ZAO A;  3K1M A;  1D1B A;  4N4O B;  1O7F A;  4A3G J;  1TWH J;  4EM2 A;  4MGR A;  1ONV A;  2VAS A;  3LSK A;  3CP8 A;  3RQ4 A;  4XRM A;  3KP7 A;  5LGU A;  1KU7 A;  2UXN A;  2E2J J;  3ZPL A;  5ED4 A;  5FRN A;  4RDU A;  5GP9 A;  3MEX A;  3CQZ J;  4MO7 A;  2BW3 A;  3CO6 C;  3F23 A;  4F55 A;  1UZC A;  2A6E F;  1QZY A;  2DFF A;  5F0C A;  2OU2 A;  2ZB9 A;  3Q0W A;  2QSG X;  2M0M A;  1WI3 A;  2HYF A;  2PFB A;  1HA8 A;  2ZCW A;  1K4S A;  5BPD A;  5TRD A;  4N4N B;  4U7D A;  3DPL C;  2FBI A;  1SMT A;  1IDZ A;  1XDS A;  4QTR A;  2XRN A;  1GXQ A;  2LLK A;  3CES A;  1Z6R A;  3O8G A;  1PUE E;  3H36 A;  2R7Q A;  5H20 A;  5F1J A;  2PMU A;  2P6S A;  2D5V A;  2YSR A;  2XKO A;  2K7L A;  3E0J B;  4IHX A;  3E6C C;  4KNY A;  3J7A Y;  4ZZD A;  4BDZ A;  3GTK J;  2XF6 A;  3K1N A;  4G8X A;  3VEP A;  2VIX A;  3SYT A;  1E2X A;  3CCV I;  1ZRD A;  1XMK A;  2CMP A;  3R6S A;  1TL8 A;  4PSW A;  4CZZ A;  1EF4 A;  1BN5 A;  1WGX A;  2ELH A;  3EUH A;  1SD4 A;  2HVQ A;  2L54 A;  1NTC A;  4L5I A;  3FBN B;  1SAX A;  2GXG A;  5JHF A;  2KQR A;  4FQG A;  4I01 A;  4CDG A;  5AON A;  3TGN A;  2DA1 A;  3VYT B;  5HDK A;  2GAU A;  3PM1 A;  2EWN A;  3CJN A;  4MHG A;  4HF2 A;  2Y9Z A;  3L1P A;  2DA2 A;  4DGW B;  1X3W B;  2BHY A;  2LSO A;  3MD2 A;  3OR1 C;  5CKT A;  3JRC A;  4IXA A;  5JVG F;  1ZHF A;  4U0Y A;  3A01 A;  1XS9 A;  3LFK A;  2HQR A;  4CYD A;  4D5F A;  4BXX J;  2D1V A;  3H0D A;  2L01 A;  1J2X A;  5L3C A;  2HI3 A;  4HLY A;  1Z3X A;  5FKO A;  2NVQ J;  2RAE A;  3P7N A;  4UV9 A;  1D0Y A;  1A6I A;  3HSE A;  3M8E A;  3VPR A;  2M34 A;  5D5X B;  2KLO A;  3LMM A;  3AL0 B;  3ZMD A;  4IX7 A;  3RPU D;  3SDB A;  3ULQ B;  1GLN A;  3P9I A;  3D5S C;  3DU5 A;  4WX9 A;  5CLS A;  2HVR A;  4L0Z B;  4IF4 A;  3HDD A;  2Q2E B;  2QCO A;  4JP0 A;  1LDD A;  1S29 A;  1OCZ H;  3K7A J;  1BJZ A;  3LSP A;  4IHS A;  1MMD A;  2ECB A;  4I98 B;  2X1D A;  5HVQ C;  1HW1 A;  3FXJ A;  3HZJ A;  4EJV A;  4EGY A;  3LST A;  1RUO A;  1YFH A;  4BAC A;  2ME6 A;  4GFB A;  4MQV A;  3QOD A;  2WAE A;  1TQP A;  4NC8 A;  1VQ5 I;  2DCE A;  5E3M A;  4UHT A;  1QQI A;  1QZZ A;  3CC7 I;  4CIC A;  2A6T A;  3A03 A;  2A3S A;  3AG1 H;  1DUX C;  1W4M A;  5H2F C;  5E8G A;  3GTO J;  2DK5 A;  5D5V B;  3V7R A;  3RZD J;  3OYH A;  3AKZ A;  2KL4 A;  2OZ6 A;  3ZR8 X;  1WWX A;  1YW8 A;  3JW4 A;  4XSZ F;  3K1P A;  1OCT C;  2KDZ A;  4ZDL A;  2L4M A;  1I3Q J;  1NG7 A;  1JHH A;  1X2N A;  2NRA C;  2NAZ A;  1TW2 A;  4M3E A;  4RAY A;  1UHS A;  5F08 A;  3VOE A;  2GXA A;  1R1U A;  2DDB A;  4G6Q A;  1BJA A;  2UWM A;  4I0B A;  1ORK A;  1T56 A;  3H35 A;  1HDP A;  3H92 A;  2IA1 A;  3W2W A;  3K69 A;  2YX7 A;  3VFZ A;  3HIF A;  4QPO A;  2DYR H;  1PJR A;  1WSU A;  1PP8 F;  1S7E A;  3K70 C;  3HOZ J;  2LNB A;  1MKM A;  4RB2 C;  3KET A;  3OS2 A;  3GTJ J;  2COM A;  4ZTF A;  2CH0 A;  2JN6 A;  2MG4 A;  1BOA A;  1P6R A;  1TQM A;  3IP4 B;  1KQ8 A;  3W6J B;  2DQR A;  2BY2 A;  2ESN A;  1MSF C;  3S16 J;  2K5C A;  1ERD A;  4QSH A;  4L9J A;  2WAQ A;  4HZF A;  2GBY A;  4GGG A;  1JTY A;  4P5O A;  1DP7 P;  2H6B A;  3V7S A;  4B09 A;  2DA4 A;  1NK2 P;  1LFP A;  5K7F A;  1FC3 A;  3B6C A;  3IAS 2;  4AVP A;  2E1O A;  4N9H A;  4LGW A;  5EZG A;  4ASN A;  1F36 A;  2R93 J;  2NXN B;  3HL2 A;  2NNY A;  4ENN A;  2P8T A;  2KIQ A;  2KP6 A;  1VQ9 I;  4HNU A;  4KIB A;  3EUK L;  1F5T A;  4I0A A;  3BR6 A;  3S1M J;  2QGU A;  1P7J A;  2O0Y A;  4NB5 A;  2CQN A;  1T38 A;  5KAI C;  4ZYH A;  3CMA I;  4B3X A;  3LSJ A;  2ZNY A;  4KUM A;  2MC4 A;  2M2E A;  4KN4 X;  1R71 A;  1ZAR A;  1O3R A;  1W7P B;  3RSN A;  1Y39 A;  2F5C A;  1YYV A;  1T6S A;  2Z1D A;  3F6V A;  4MQ9 F;  4ZYA A;  3LNQ A;  3S14 J;  2BEO A;  3ZP5 A;  1OYW A;  1JHF A;  2M9H A;  4BXU A;  4UVA A;  3RCO A;  3ERM A;  2QVO A;  3JRB A;  3NRV A;  1WHU A;  4HSR A;  3VYS B;  1T08 B;  4RGU A;  2K02 A;  1X2M A;  2R7W A;  4M9Z A;  4HLX A;  4RAG A;  4A3F J;  5DCM B;  1R23 A;  2L9S A;  2W24 A;  3WE3 A;  5EG0 A;  1BI2 A;  2EFQ A;  3FHZ A;  5KCM A;  1DGW Y;  3PQJ A;  2WY8 Q;  2ECC A;  3HGY A;  3CME I;  3QP5 A;  3EYY A;  2L7M P;  4LIV A;  1ZGA A;  4J19 A;  3BG9 A;  3SHF A;  1SFK A;  2QBY A;  4UV8 A;  1DPR A;  4EAT A;  2HQA A;  2DXI A;  4KIG A;  2JA8 J;  2DTZ A;  2R7V A;  4BEH B;  4AVZ A;  2NVY J;  3A1Y A;  1WJD A;  4KIS A;  1IC8 A;  2XRO A;  3LA3 A;  3K4J A;  3ZQL A;  3PSI A;  1YI2 I;  1BIA A;  1YQA A;  3DEE A;  4XRS A;  2K9S A;  2X1C A;  3CTA A;  1B6A A;  1BI0 A;  2FUG 2;  3WGG A;  3DBR B;  4P9U A;  1W36 C;  3NAR A;  4V2G A;  4G7O F;  1TWA J;  1ZR2 A;  5DM7 F;  3S2W A;  1G59 A;  1HF0 A;  1LE8 B;  3GWZ A;  3I4N J;  2H6C A;  2X6X A;  3HKZ A;  1WQ2 A;  2TCT A;  2N8G A;  1GVD A;  4BJT A;  3H3U A;  3OIQ A;  2R5Y B;  3LWF A;  1O3Q A;  2XC7 A;  3BQZ A;  2IS2 A;  4IHT A;  2L0K A;  4M6Y A;  5F0F A;  1IV8 A;  1VFC A;  5B5E C;  1RKT A;  5BQT A;  3G2B A;  1F9N A;  4HA8 A;  3ESW B;  2L4A A;  2DOE A;  3HOT A;  4M71 A;  1E3O C;  2XIG A;  1SFU A;  1Z91 A;  3BG6 A;  1U0J A;  4LLG F;  2A68 F;  4BUP A;  5CJ9 A;  3JRH A;  5E79 C;  1F43 A;  1IRF A;  1Z3Y A;  4A3K J;  2VC0 A;  4NC6 A;  1GHC A;  1D0X A;  1WCM J;  2LTP A;  3U21 A;  4JYK A;  1XB4 A;  3CCM I;  2OC6 A;  2WAQ N;  3ZXS A;  4RB1 A;  4I6Z A;  1MJA A;  4O3M A;  2IPQ X;  2DT6 A;  2P5L C;  1QZE A;  3TED A;  1J0R A;  3FKJ A;  3JRD A;  1UST A;  3FBI B;  1UCR A;  1IUF A;  2XAJ A;  1VZ0 A;  4E7S A;  9ANT A;  4XLC A;  2P81 A;  4LMY A;  3G1M A;  2CW0 F;  3BZ6 A;  4M72 A;  1K83 J;  5B3S H;  3OL3 A;  1K7A A;  3N05 A;  2FNA A;  5CQE A;  4HX4 A;  5D6F A;  5HS7 A;  1UHW A;  3ZCO A;  5J47 A;  3V42 A;  3J81 K;  1RUN A;  1OCP A;  3ZMU A;  1FPQ A;  2KPM A;  1YJ9 I;  2OCE A;  3PO2 J;  2XAH A;  2MSY A;  3ZMS A;  1TNT A;  2KHM A;  1U2W A;  3PNV A;  4YRV A;  4Y15 A;  4A2U A;  1HLV A;  4L0Y B;  2HKX A;  2G7H A;  2E35 A;  4FCY A;  4XKB A;  2JK3 A;  2XB5 A;  2F48 A;  5C4J J;  2RNG A;  3L2W A;  1X3U A;  1U8R A;  2M7A A;  1RET A;  2DMN A;  2M30 A;  5FRM A;  2XF7 A;  1K61 A;  4MEY F;  3S1N J;  1A5J A;  5HLH A;  1UFM A;  2H1L A;  2L9N A;  1BI3 A;  3K6G A;  2V6C A;  2P0W A;  2RGV A;  1KGS A;  2DK8 A;  4GYG A;  1UAA A;  2Z5U A;  3EYI A;  4R79 A;  2BY1 A;  2HXO A;  2WWY A;  4YII A;  3BJ6 A;  1MGT A;  2GZW A;  2W4S A;  3ZQQ A;  2K27 A;  1T8I A;  4OIR F;  2JSC A;  3DTK A;  1G3T A;  1VI0 A;  3W6K B;  4XNF A;  3CCJ I;  3IL2 A;  5F64 A;  2MH9 A;  5HOD A;  4GXO A;  3KZY A;  2CW7 A;  5HNH A;  2YU9 J;  2KRC A;  3GLL A;  5F1R A;  1FBS A;  4Y3O A;  2CQX A;  1WJC A;  2D2W A;  3CUQ C;  3H9G A;  4XOP A;  3IC7 A;  1X58 A;  4FTH A;  2XAQ A;  1BIB A;  3GTQ J;  2V7F A;  2VT3 A;  3M1E A;  4BDY A;  4OAY A;  4C2M J;  2ID3 A;  3MKY B;  3WE2 A;  3RKQ A;  1YG2 A;  3DU6 A;  3G73 A;  2LKP A;  2DT7 B;  5A2Q Z;  2A07 F;  3M8F A;  3JTH A;  3ZQG A;  1IRG A;  4PDK A;  1LJ9 A;  5K7H A;  3H3V K;  1V54 H;  3ZN0 A;  3IAM 2;  2PMZ N;  3BJA A;  2MBF A;  1MBK A;  1B72 B;  3VOD A;  3IWZ A;  3I56 I;  1CF7 A;  3HTU A;  1EH8 A;  4LFU A;  2VJI A;  2LVS A;  1AHD P;  1P2F A;  1OLT A;  5FD6 A;  4Q5S F;  2NNN A;  3PL8 A;  1FMV A;  2OCC H;  4U0W A;  1HCR A;  2LD5 A;  2ZBK A;  4KFC A;  3H0G J;  3F72 A;  3L00 A;  2JTV A;  2R7X A;  2P6T A;  4BAY A;  1QPI A;  1OCO H;  1I50 J;  2QLZ A;  1S6L A;  3FK7 A;  4IRH A;  3BR1 A;  4MEX F;  2O5R A;  1TW3 A;  2LC2 A;  1REP C;  3F8C A;  2QSF X;  3RI4 A;  4A0X A;  3HSF A;  1BR2 A;  3DPT A;  2XV4 S;  1CGP A;  4CHU A;  4HW0 A;  2E19 A;  2QQ8 A;  4M74 A;  1SFO J;  3OY9 A;  1E3H A;  3PNY A;  4M9S A;  2ZFW A;  2EZL A;  1G3W A;  2HNH A;  2HR3 A;  3UR3 C;  3MQ0 A;  1BC7 C;  4RGR A;  2VBZ A;  5J1U A;  2E7X A;  2R7F A;  2FJ1 A;  4DQ2 A;  4HF0 A;  5F0H A;  1TNS A;  4I02 A;  4NDL A;  4GDF A;  2FMY A;  2LOO A;  4L9T A;  4KYW A;  2F5F A;  2E34 A;  3ABT A;  2XKP A;  3RPU A;  2R5Z A;  4BBS J;  1ITY A;  2EV6 A;  3J7Y J;  3TDU C;  2HOE A;  1I1G A;  1JT6 A;  4D7N A;  3OS1 A;  4EM0 B;  1R49 A;  3ABK H;  4IQ4 A;  2A5Y B;  3ZGK A;  2X6W A;  3O3K A;  4DIQ A;  4IKF A;  3TO7 A;  3I9V 2;  3TO6 A;  3JAM K;  3P5J A;  5ICE A;  1ODD A;  1JKQ C;  1ZYR F;  1WJA A;  3I64 A;  4XID A;  4BE2 A;  1USS A;  1JKO C;  2LRD A;  1V55 H;  3VYR B;  3KP3 A;  3AFH A;  4E6K G;  2Y48 A;  4UVB A;  4AIK A;  4UUS B;  4RAZ A;  1HKS A;  4IPA A;  3BLY A;  2EFW A;  4GYI A;  2DOA A;  2F4M B;  4I7H A;  2AHQ A;  2JMW A;  2FSW A;  5J1Y A;  1YJW I;  5ERI A;  4X1E A;  1Z7L A;  3SZP A;  2K9Q A;  3OYG A;  1ZLK A;  2GQQ A;  1BR1 A;  1ENH A;  2DMP A;  2R7O A;  1FBQ A;  3WG7 H;  4A5M A;  3DPU A;  1R4N B;  4DYC A;  5IYC J;  3MAJ A;  3HRT A;  1FNN A;  1RI7 A;  3S32 A;  3OYF A;  3BR3 A;  1IXS B;  2QQB A;  3PIP F;  1X4P A;  4D1Q A;  4CH7 A;  3ZMV A;  5FO5 A;  2MD0 A;  1KON A;  5D4S A;  2R5Y A;  2Z9O A;  4NUB A;  3QYB A;  3TMO A;  4HF1 A;  1FSE A;  2GA1 A;  4PCQ A;  1OYY A;  3FMQ A;  3KPH A;  2HOT A;  3TDZ C;  5F27 A;  1K4T A;  2XGE A;  2BY3 A;  1VQ8 I;  1RZ4 A;  4JQF A;  4DJA A;  3OYD A;  2V4J C;  2ZKZ A;  3VDX A;  1FZP B;  2E60 A;  1V5G A;  3TBI A;  4FX4 A;  2F4O B;  3NAU A;  2E5Z A;  4LIT A;  3LQQ A;  3MWM A;  4A93 J;  2VXD A;  4OIN F;  3CF5 F;  3FDY A;  4AID A;  1VQ6 I;  2W25 A;  2LP0 A;  4A0Z A;  4B43 A;  4Y7N J;  2EB7 A;  1ZQ3 P;  4WXD A;  3CC2 I;  1R5I D;  3SXY A;  4JX5 A;  1FOY A;  3ZMZ A;  1FJL A;  1WJ5 A;  1Z1D A;  2CG4 A;  5D8L B;  1V5F A;  2VUM J;  4EJO A;  3K2Z A;  1RR7 A;  2VN2 A;  3PO3 J;  1ETY A;  1R58 A;  1MND A;  2M4G A;  2BZT A;  2WAD A;  5DUK A;  3CC4 I;  1R6R A;  3CO7 C;  1QBJ A;  1V4R A;  5K5O A;  4ZZL A;  3HRM A;  1FOK A;  3E7L A;  5E3L A;  4CCN A;  2DMU A;  1O57 A;  3L7W A;  2JA2 A;  1U5T A;  5AIP A;  4ZYD A;  2XSJ C;  4QWQ A;  1H9G A;  3CCL I;  2CUZ A;  3H3Z A;  3H9Q A;  1SAN A;  4ESF A;  1C0W A;  2ZJ2 A;  4JBA A;  3RPQ A;  1ZGW A;  4XLF A;  4EJT A;  5IOY A;  4B48 A;  3FXQ A;  2OQR A;  3BJO A;  3EUH C;  5DYM A;  4LJZ F;  4IO9 F;  3QOP A;  4W97 A;  2E1M B;  3GEZ A;  4FE4 A;  4BY1 J;  2HOA A;  2QEN A;  5HLT A;  1BW6 A;  3IHU A;  2X1E A;  3H1C A;  3WTZ A;  1ETX A;  1IV6 A;  3LSM A;  1G3S A;  1ZEL A;  4PJL A;  5GAE J;  2BVM A;  4BL0 B;  1RES A;  4CCK A;  4B4C A;  4C3J J;  1YS7 A;  1WH7 A;  3KYD B;  4FIS A;  5EJC A;  3ABM H;  4G6D A;  4CSW A;  3K4N A;  2MYS A;  4HPQ A;  5C44 J;  1MNM C;  2YS9 A;  5FKN A;  1P4A A;  2Q0O A;  2BHZ A;  2KIM A;  5FKL A;  4HEA 2;  3T1B A;  4YG2 F;  2JQ7 A;  1RIO H;  3L09 A;  3W6V A;  3J7Z I;  1D5Y A;  3BT9 A;  2GA2 A;  4FT8 A;  1YX5 A;  2OUM A;  5K5R A;  3BTC A;  5LHH A;  1MBF A;  2BYV E;  1X1P A;  5JHU A;  4QPQ A;  2Z33 A;  3F22 A;  4PSX A;  2LR8 A;  2XAG A;  3CDH A;  1FYK A;  4FAS D;  5TGT A;  2FEZ A;  1J5Y A;  1MH3 A;  1S5L C;  4M3B A;  3BG5 A;  2VOD A;  3IKV A;  2O9L A;  3Q9V A;  1QRY A;  3IWF A;  2Y0S N;  2DPU A;  2Q2E A;  4ABZ A;  2EA2 A;  2HTJ A;  5ICG A;  1HQC A;  2V26 A;  2W48 A;  2XGC A;  3E1S A;  3FIS A;  2W7N A;  2VBY A;  1WJF A;  3DCF A;  5DM6 F;  2MFZ A;  3ROU A;  1VQK I;  2QZ8 A;  4S0H B;  3QYE A;  3U1D A;  1U8B A;  3FXK A;  5B66 C;  3F8M A;  3ABU A;  2XPV A;  4Z6Y A;  2I8D A;  4Z2Y A;  3U2R A;  2PLY A;  3DF8 A;  1OQY A;  2DJI A;  4XON A;  5M3F J;  2JZY A;  4CCO A;  5J1R A;  1HBX G;  4PZJ A;  1ZRC A;  1RKW A;  1UG2 A;  4E4H A;  1TC3 C;  2HDC A;  2FOW A;  1VQ7 I;  2TRT A;  2GXB A;  3CDL A;  2A61 A;  1VND A;  2DA3 A;  5FGM A;  2LBF A;  4X0G A;  1B59 A;  1F1Z A;  4ZC3 A;  2HYG D;  4OU0 A;  5LRS A;  3E97 A;  2DBB A;  2KDO A;  3FX3 A;  3GF2 A;  2A05 A;  2QSH X;  3X2Q H;  3I3L A;  3WU2 C;  5LLQ A;  4UNO A;  1D5V A;  1HKQ A;  2FE3 A;  3ZMT A;  2V1X A;  2Z99 A;  4OIO F;  2VJ4 A;  4YIF A;  4XRS G;  1XMA A;  4XKC A;  3KYL A;  1WI9 A;  3MZH A;  2O61 A;  4LK0 F;  3LSR A;  3IKT A;  1ETK A;  4IRI A;  2DT5 A;  2R3S A;  1BOB A;  2EZK A;  2FQ4 A;  4IOA F;  4OIQ F;  4IRG A;  1IUY A;  4HAM A;  2EH3 A;  3V8L A;  2KRH A;  4HNV A;  4FET A;  4IHY A;  2H1K A;  2IGN A;  4D5C A;  1YTY A;  1YIO A;  2XGD A;  1MZB A;  1FIP A;  2LRE A;  2ZME B;  2E1C A;  5KNL A;  1BI1 A;  2RN7 A;  3GZN B;  4KJZ A;  1ZN2 A;  2DFH A;  2HWV A;  3FKI J;  1ZGJ A;  1AU7 A;  5J8F A;  2ZC2 A;  1T95 A;  3KCC A;  4KT5 C;  2H8W A;  3LSG A;  4BHB A;  4ENK A;  2IAI A;  1TWC J;  2CUF A;  3BTJ A;  4IQJ A;  4ZDP A;  3E6M A;  3GTM J;  3ASO H;  2QEX I;  4BBR J;  5M3M J;  4W1U A;  5J4Y A;  1ETO A;  1SVM A;  2BOL A;  1AOY A;  3M9A A;  3RKY A;  3TW7 A;  1XGO A;  3FXU A;  3PUF A;  3K4C A;  2IT0 A;  2JJ7 A;  4L18 B;  1R9T J;  2HDD A;  3WU0 A;  4BQA A;  2WC2 A;  4DZP A;  3DP7 A;  3OWT A;  5E20 A;  2GIV A;  5IY5 H;  2VKE A;  3OMY A;  3PNT A;  1JTX A;  1T39 A;  1LE8 A;  3CCU I;  2EZI A;  3DTE A;  4R8H A;  1R5H A;  4CCM A;  2YX4 A;  4G9Y A;  4XBF A;  2WV1 A;  1VQL I;  4A6E A;  4S05 A;  3RYP A;  2K4J A;  3CCQ I;  3KLN A;  1YLF A;  3RKX A;  4RBO A;  1J59 A;  3HSR A;  1GV5 A;  3H5R A;  5GPA A;  1IXC A;  4X6A J;  4A3M J;  3C7J A;  1SFX A;  3K4B A;  1SVO A;  4AC0 A;  3GYH X;  2W57 A;  3GME A;  1YS6 A;  1L0O C;  2WBM A;  1UHM A;  3OSG A;  1JI8 A;  2LBF B;  1XSD A;  1TZL A;  1UEL B;  5HS8 A;  4EJW A;  2HZD A;  2Y31 A;  4JX4 A;  5EZH A;  2NS8 A;  3CJQ B;  3DWL E;  1WJE A;  2VJ5 A;  5EEG A;  2C6Y A;  4EMS A;  2RDP A;  3Q5F A;  3OYN A;  2VBW A;  1YHQ I;  1OMI A;  4XN3 A;  2JPB A;  1ZK8 A;  3TKY A;  3FXM A;  4II3 A;  2ID6 A;  2M1B A;  3IH4 A;  4XMY A;  2KMU A;  1LNW A;  2R0Q C;  1SC7 A;  2V6E A;  3BDD A;  1RNL A;  5ICC A;  5FJ8 J;  3J80 K;  2LY2 A;  1IXR C;  4AU7 A;  5FB2 A;  2AQE A;  2ZJQ F;  2EIK H;  4E70 A;  2B63 J;  4PJJ A;  3MFK A;  1FOW A;  3CUQ A;  2CQ7 A;  2BXY A;  4JOM A;  4A3J J;  4LB5 A;  2VON A;  2PX9 A;  2R4G A;  2A6H F;  2LK2 A;  1LEB A;  2JA7 J;  1FOX A;  4XOT A;  1GV2 A;  1MJB A;  5KAF C;  2LF7 A;  3HOX J;  4UB8 C;  4PGG A;  1HKT A;  2FXA A;  2V1N A;  2JVG A;  2OZU A;  3H5N A;  1BA5 A;  1EH7 A;  3SFI A;  4MNU A;  2ZXW H;  3PFY A;  2I10 A;  4IHV A;  3MN2 A;  3LAJ A;  1WRJ A;  2IP2 A;  3BG7 A;  1YW7 A;  5TJJ A;  1OCR H;  1TWG J;  4WXH A;  3VSK A;  2JUC A;  1RPW A;  3EET A;  2EJR A;  1ZG3 A;  2VE9 A;  2PJR A;  2VQG A;  2JRT A;  3F0C A;  1U9O A;  1XG1 A;  2H94 A;  2X9D A;  3WOD F;  1A35 A;  1J7K A;  1ZKG A;  3S3M A;  1N25 A;  1D3Y A;  1MDM B;  1X3Z B;  2XAF A;  3CJT B;  3BCB A;  2R7D A;  2M3A A;  1WPK A;  1P9Q C;  2OF7 A;  3HPG A;  4XLH A;  5L3D A;  2GIZ A;  1STZ A;  1MD0 A;  5LRR A;  1PP7 U;  1B8I B;  2IGO A;  3MKW B;  3IRR A;  4LIU A;  5D8K B;  3U9G A;  4UY8 I;  1AWC A;  3A4C A;  4KIC A;  2H8R A;  3CZ6 A;  3GZ6 A;  1W36 D;  4YFX F;  4KIF A;  3MCZ A;  2EFN A;  3HUG B;  4HYE A;  3K4K A;  5FLM J;  3HB9 A;  1APL C;  1QA6 A;  3RKW A;  1E17 A;  2XUB A;  4JK1 X;  2DLL A;  1XSX A;  1S8N A;  3TOB A;  2V79 A;  2ZXH A;  3L2U A;  1CQT A;  4I09 A;  2D45 A;  1X1B A;  5ILU A;  4F7Z A;  1IGN A;  1FEX A;  5B1B H;  1LDJ A;  1IN6 A;  4FX0 A;  3F21 A;  1D8K A;  3O6B B;  4A3D J;  4QIW N;  3S1R J;  1PVE A;  3PSF A;  4P9F A;  1VQO I;  5DCF A;  4Y13 A;  1J75 A;  1BBY A;  3A02 A;  2OD5 A;  4MTD A;  2L9V A;  1DP3 A;  3ZQ7 A;  3FK6 A;  5GTH C;  5K1Y A;  3C2B A;  1NHA A;  5L3F A;  5ILV A;  2L2O A;  2LF8 A;  4Q48 A;  3KYC B;  3WTW C;  2IEK A;  1B8I A;  4AM3 A;  3RIR A;  3CP2 A;  5C4X J;  3NEU A;  3J80 Z;  4RS8 A;  1CF7 B;  2CW8 A;  1Y6I A;  2V1D A;  3JAM Z;  3OYI A;  1UJ8 A;  2K4B A;  1K6Y A;  4U7B A;  2EIJ H;  1IN7 A;  2O03 A;  4P1W A;  4EGZ A;  1Z0X A;  2O8K A;  3JRF A;  2LH9 A;  1JXS A;  3ISP A;  3Q9S A;  1XCV A;  4F93 B;  2CV1 A;  5DCM A;  3RZO J;  2UZK A;  1OYI A;  2MLG A;  4P55 A;  1X1C A;  3HOU J;  3M3Y J;  1J9I A;  4M6V A;  5EEH A;  4OMY A;  4U88 A;  3HPH A;  2FOK A;  3PFI A;  1YX3 A;  5IT3 A;  2JA5 J;  3ZQH A;  3QP6 A;  2W84 A;  2ESH A;  3HXL A;  3OIP A;  4LOC A;  1H89 C;  2MAB A;  3QPS A;  3JTG A;  2IRF G;  3EUA A;  4C9Y A;  4BGD A;  3CJR B;  3LA2 A;  4LK1 F;  3JR9 A;  3G1O A;  3VB2 A;  3CUO A;  4CGZ A;  5IP9 J;  2QF7 A;  4XLP F;  1Y8R B;  1R4M B;  4NQW A;  5B1A H;  5D5U B;  4HQM A;  3DKY A;  5LBQ A;  1EH6 A;  3V7C A;  5HDG A;  2Y9Y A;  3PQK A;  2Z16 A;  1L3L A;  4I99 C;  1MBE A;  4KMU X;  1I3A A;  5CPR B;  5E3O A;  2LFB A;  2R5Z B;  4A3L J;  2PMZ A;  3WU1 B;  3AG4 H;  3OOP A;  4ZYG A;  1OIS A;  2JVH A;  2NS0 A;  3F9K A;  4F92 B;  2VBX A;  3I0T A;  1MBJ A;  3W2V A;  3D1N I;  1V3F A;  1A31 A;  3JRI A;  4B44 A;  5DUI A;  5K5Q A;  2H27 A;  2VKH A;  3GBG A;  4WK8 F;  4G94 A;  2OA4 A;  1MMN A;  3CCE I;  3QPT A;  3CCY A;  2R92 J;  3DKW A;  3D5R C;  4O6J A;  5EF6 A;  3WTX C;  2AS5 F;  4XKW A;  2JSP A;  3R61 A;  4J01 A;  2QKL B;  3HJE A;  2VLA A;  2VQC A;  1EV7 A;  2HQN A;  2P4W A;  5FRO A;  5IP7 J;  3M1C A;  1U9N A;  3S17 J;  2VE8 A;  3BP8 A;  4XSX F;  4UXN A;  4AD9 A;  2E7W A;  3OYC A;  3JSO A;  5LD2 C;  1F4K A;  3OS0 A;  5DDG A;  2ACJ A;  1MMS A;  3E5Q A;  1H0M A;  1K6O A;  3OL4 A;  4IOC F;  1IW7 F;  3S2D J;  5H6R A;  5FD5 A;  3QRF F;  1Z21 A;  1YRN B;  1W5T A;  3DEU A;  1JJ8 C;  1MNE A;  3CUQ B;  3GFM A;  3HOY J;  1DGR M;  4HDU A;  5CVV A;  2CFX A;  2WY7 Q;  1ZRE A;  2X48 A;  2ZME A;  1XSV A;  5DS9 A;  3BQY A;  5FFX A;  3W2A A;  3I4M J;  3QQA A;  4DNC A;  4EJU A;  4AYB N;  1JJ6 C;  2G7U A;  2R7S A;  2FF4 A;  2HPI A;  1T0F C;  3QPL A;  1MJ9 A;  1WH5 A;  2DAO A;  3GFL A;  3OOU A;  1T0F A;  4YEJ A;  4BYY A;  5LFA A;  2KZG A;  3O8H A;  2XDV A;  1BC8 C;  2Y30 A;  1PYV A;  1IN5 A;  3RQI A;  4WWC A;  1KA8 A;  3OYM A;  3SZT A;  2M0C A;  2LMD A;  1ULY A;  2O6G E;  1Y0U A;  4G6T B;  4BE1 A;  2X6Y A;  4DOZ A;  5D4R A;  1B72 A;  3Q0U A;  2FBH A;  2OJE D;  3I59 B;  2O8X A;  3TL4 X;  2HU9 A;  3DTI A;  4WF2 A;  2OPT A;  1VQ4 I;  4BXF A;  2CQQ A;  3I59 A;  4ZDO A;  2HGC A;  4XR6 A;  3BR0 A;  3HHG A;  4F52 A;  1XD7 A;  5GAG J;  2VOP A;  3BRO A;  2L7K A;  4L9V A;  3PJR A;  2ZSI B;  3T5X A;  2EV0 A;  3SEZ A;  2XGX A;  3BCA A;  1IJW C;  3KEO A;  4GO1 A;  1HC8 A;  2DMT A;  1XDU A;  2OBP A;  2Z2S B;  2W85 A;  5TIS C;  1U6G A;  1FYL A;  2BXZ A;  4ITV A;  2Y75 A;  1O7L A;  1VQM I;  1LEA A;  4XM3 A;  3JRG A;  2R7R A;  1FSH A;  1IN4 A;  1XTA A;  2I5U A;  4ZJZ A;  3J7A O;  3IUO A;  1ZG5 A;  2KIU A;  3IH3 A;  4CXF A;  2HYJ A;  4M3F A;  5EGO B;  3BTI A;  4HV6 A;  1MDM A;  2XPW A;  1YO5 C;  4O5V A;  2MD5 A;  3GLX A;  2M4K A;  1ZH5 A;  5E1Z B;  3MKZ A;  1AKH A;  5JFR A;  2NOG A;  4QLC U;  1HDD C;  3KE2 A;  5A2Q K;  1KU3 A;  2HPM A;  3LAP A;  1HST A;  2XAU A;  1WZ2 A;  1XX5 A;  2EQR A;  5E18 F;  1LFB A;  5E17 F;  4L9N A;  2BV6 A;  2L7Z A;  3ML6 A;  3WTV C;  1QGP A;  5C3E J;  2B9S A;  1YE9 A;  5J8C A;  5JVT A;  2R7U A;  1IZ1 A;  2UUZ A;  2LY9 A;  5LEK A;  5KK1 A;  2EK5 A;  2VL8 A;  2F5V A;  5ICF A;  4A3E J;  1Y0N A;  2LDU A;  2YU3 A;  3FF5 A;  2NVU B;  3ZQI A;  2VPL A;  3OYJ A;  1S7A A;  1R7J A;  2BVL A;  2VQL A;  2BE5 F;  2KIS A;  4DBQ A;  4XRF A;  1YRN A;  3ZRG A;  2MH2 A;  1P4W A;  1W5C C;  4XLE A;  1MSE C;  2RRE A;  3MZ8 A;  3TW6 A;  3G6E I;  4OOI A;  3C3W A;  4OMZ A;  3R60 A;  4NNJ A;  4IL6 C;  3B73 A;  4ENJ A;  5LEJ A;  2QKM B;  3HYI A;  5IPA A;  4OIP F;  3OYE A;  5DD8 A;  1FX7 A;  2HTS A;  4EM1 A;  4BJ6 C;  4A12 A;  1O3S A;  1KU9 A;  2FQ3 A;  3G1L A;  1MBH A;  2BW3 B;  2VKD A;  4KMF A;  1I6H J;  3AAF A;  4R1H A;  2ZJP F;  2IS4 A;  1WKM A;  4UVC A;  2P5V A;  3DFG A;  4MTE A;  4XOR A;  5ILS A;  2E71 A;  1R1V A;  5IT9 K;  2OV7 A;  5IP6 A;  3KP6 A;  5E1W A;  1I5Z A;  4DZJ A;  3JCU C;  1QU3 A;  4TV7 A;  2IGK A;  1X1D A;  1SMY F;  2WA0 A;  2K9N A;  4ENM A;  3ECH A;  3MMY B;  5CVJ A;  2CYY A;  1JGS A;  1D0Z A;  4IVN A;  3GCM A;  1POG A;  1B9N A;  3N4M A;  1Y1W J;  3ERE D;  1G2H A;  2DO7 A;  4N9I A;  5JLX A;  4XK4 A;  1AA7 A;  4A3I J;  3HEF A;  4C30 A;  3R0J A;  1KQ9 A;  5L3G A;  3E5X A;  4LD5 A;  3UKG A;  1OR7 C;  2EZH A;  3BPV A;  4PUS A;  3E5U A;  2ZXJ A;  5GTI C;  2CV0 A;  1HOM A;  4ZTJ A;  4XIC A;  4B1R A;  1JE8 A;  2JUG A;  1ETV A;  3C1D A;  2NYX A;  2ZJR F;  1IN8 A;  2PMH A;  2MC3 A;  4V19 K;  3SJM A;  5J6X A;  2FX0 A;  5L3B A;  1X19 A;  4P96 A;  3DLA A;  3TO9 A;  1SVL A;  1D1C A;  2DI3 A;  2DW4 A;  4DYR A;  1JKP C;  4ESJ A;  3VWB A;  3BR5 A;  1R36 A;  2UXX A;  5FFZ A;  3K70 D;  3FWE A;  2RVC A;  3RYR A;  1OKR A;  4BH9 A;  1S3J A;  3KIO A;  3CF2 A;  1TP4 A;  4RLQ A;  3S15 J;  5EDN A;  2B0L A;  4KN7 X;  2HKO A;  3KZI C;  3FHN A;  3V8K A;  4CYC A;  4FHT A;  3FM3 A;  2AXT C;  3CDI A;  2JWT A;  1SAU A;  4C3H J;  4E7Z A;  3K2A A;  5DEQ A;  1VTN C;  2B7E A;  3L9F A;  2HXI A;  2L02 A;  2VPR A;  3FMR A;  2W00 A;  3KLO A;  1A36 A;  1HXD A;  2XRL A;  4LG3 A;  4XLA A;  3OR2 C;  4HBL A;  4BHC A;  3L2C A;  2IA2 A;  2VJJ A;  3QYF A;  4ON0 A;  2AO9 A;  1M1E B;  3GX4 X;  1ZR4 A;  2Y0S A;  5KHD A;  1I1S A;  3E6D A;  1Z05 A;  1KU2 A;  3S1Q J;  2DA6 A;  2K3F A;  2XB0 X;  5DV5 A;  1MBG A;  4E7K A;  1SFE A;  2A5W A;  4M3G A;  2OQG A;  5JR3 A;  2E1M C;  2MW8 A;  1N75 A;  4BKX A;  4DYQ A;  4Q4Z F;  1OFC X;  5CQG A;  2JPC A;  2ZFU A;  5DD4 A;  2CSO A;  4RM3 A;  3MVP A;  4PJ0 C;  3QPH A;  3FM5 A;  3I4P A;  2ICW G;  3LSH A;  1FTZ A;  4HQE A;  1S72 I;  3BZC A;  4RMN A;  4DW6 A;  5J4V A;  3G71 I;  2FML A;  3HGG A;  2XSD C;  3EQL F;  1QVT A;  1I6X A;  2K3P A;  1GUU A;  2ME0 A;  1BR4 A;  1N77 A;  1QHH D;  1P4X A;  1I39 A;  4ZYE A;  2DDA A;  1DU6 A;  1NK3 P;  4LLN A;  2K40 A;  2ZXI A;  4C2T A;  1U3E M;  2MGQ A;  3W3C A;  3T0Y A;  4IJA A;  2HDW A;  1FP1 D;  3M4O J;  1G3Y A;  3FZV A;  1BL0 A;  4M6X A;  4CA0 A;  3WHC A;  3ZN1 A;  5GAH J;  2KFD A;  1O3T A;  3H5A A;  2CJJ A;  2QQ9 A;  4RB3 C;  5HNF A;  5J3L A;  4Y33 A;  1HSJ A;  2X0L A;  4BS9 A;  4HST A;  1JUP A;  3JRE A;  4CO8 A;  4IZZ A;  2CUE A;  2DMQ A;  1Z7U A;  3S2H J;  3OV8 A;  3BZK A;  1MIJ A;  4LG0 B;  1V5E A;  2GOX B;  2P5K A;  4HDV A;  4M3D A;  2P7C B;  4BQO A;  2CO5 A;  1MW7 A;  5F6F A;  4S04 A;  3V8J A;  3L2V A;  2ZSH B;  1Z9C A;  3O2P E;  2DA7 A;  3MKL A;  3TQN A;  2VC1 A;  2LYC A;  4UB6 C;  2F4I A;  3F6O A;  2O7O A;  2HOS A;  5BOX A;  1Y1V J;  5F04 A;  1NG6 A;  2HVS A;  2YUS A;  3NWS A;  4E7H A;  5CVU A;  4ZH4 F;  1W0T A;  1RRJ A;  3LOC A;  4MIM A;  3OIO A;  2EBI A;  4ESB A;  4KDP A;  2OTL I;  2L5Q A;  1PUF B;  1K78 B;  4PGH A;  1R22 A;  2E2I J;  1H8A C;  2STW A;  2CUJ A;  2HEO A;  2M87 A;  4OWR B;  3ASN H;  2EIN H;  3GTP J;  2KJB A;  5FKM A;  5H6Q A;  1PDN C;  3I53 A;  1W1W E;  2DFE A;  2Q8K A;  6PAX A;  2QM3 A;  1S9H A;  2BGC A;  3GW2 A;  3S3N A;  4HOB A;  4MFE A;  1JKR C;  2LKS A;  1U5T B;  3OYB A;  2NVX J;  3KEQ A;  1R5G A;  4A6D A;  3D5L A;  1FTT A;  4KT6 A;  2M5W A;  2VB6 A;  3NWT A;  3G3Z A;  3D0S A;  5HLG A;  2Y69 H;  2E1N A;  3VYU B;  2F2E A;  3HUG A;  2ISZ A;  2DU9 A;  3H9J A;  2IGM A;  1SD5 A;  4XL9 A;  4BQQ A;  1OJL A;  4A3B J;  2FBK A;  3HM5 A;  1GVJ A;  1LUJ B;  2PJR B;  3K0L A;  1XGS A;  2PG4 A;  1SD6 A;  1KYW A;  1KZH A;  1N78 A;  2VQH A;  3I55 I;  4G12 A;  1YJN I;  2RQQ A;  3WG9 A;  3KP5 A;  2E36 A;  1ACI A;  5E3N A;  4F91 B;  5EEA A;  1WVR A;  1OPC A;  3WHB A;  4YFK F;  3SEQ A;  1VQP I;  3GUD A;  2CU7 A;  1SEU A;  3VSL A;  2F5E A;  1S7O A;  4G7H F;  2IJL A;  5CVI A;  4LB6 B;  4RM2 A;  2EIM H;  4HRI A;  1XGN A;  5HOO A;  1Z77 A;  3BC8 A;  1FP2 A;  1B4A A;  2O3F A;  2CGP A;  4N0B A;  1ETW A;  2V9K A;  4B8X A;  3BR2 A;  3T8T A;  3CMM A;  3DLL F;  4BNC A;  2DA5 A;  3U1K A;  3QU3 A;  2Y2Z A;  4IEJ A;  5BMZ A;  4U0V A;  2VOO A;  2G0E A;  3TP3 A;  2LKX A;  2NS7 A;  1W7P D;  3KFW X;  3L2Q A;  4I76 A;  4A69 C;  5E8I A;  4CYC B;  1AKH B;  2IXS A;  3FXR A;  3LA7 A;  2BBY A;  4C3I J;  1FY7 A;  4AWX B;  4D7M A;  1LQ1 A;  4Y17 A;  1YW9 A;  3WTY C;  1DU0 A;  1Q1V A;  3HOW J;  2X51 A;  2EIL H;  4Q47 A;  3B02 A;  4M9X A;  2K9L A;  3CCR I;  4I2O A;  3R4K A;  3OSF A;  5CVR A;  3B6A A;  1A04 A;  1QNT A;  1XGM A;  3A0H C;  3I5U A;  1QO0 D;  4AIH A;  3K4L A;  5K7Z A;  1GDT A;  3DBH B;  3OYK A;  3SZG A;  1FIA A;  2TDX A;  4UUT A;  3EDP A;  2HFH A;  2IS6 A;  4XLN F;  1FMW A;  4KIT B;  1XCB A;  4NQW B;  4RA2 A;  2QQA A;  4M73 A;  2JA6 J;  2PBI A;  5FKK A;  4CCJ A;  3V4G A;  2FU4 A;  2GLO A;  1LKX A;  4AYB A;  3M07 A;  2EFO A;  3GO5 A;  4BJ5 C;  5FLX K;  5EG0 B;  3SQN A;  2ZO4 A;  5IYB J;  1XC5 A;  1Y8Q B;  3QOE A;  1E0E A;  1T98 A;  3K4M A;  3DQV C;  3HG9 A;  2DN0 A;  1LFU P;  2DJN A;  3E3V A;  3CLO A;  2WV0 A;  1KYZ A;  1FWZ A;  5EYR A;  2UV1 A;  1Z6T A;  4BHP A;  4V2F A;  5GPC A;  1Y56 A;  4L5E A;  2HS5 A;  3MZY A;  3C18 A;  1XMX A;  3PUB A;  3ZQC A;  1DDN A;  1QHG A;  4BE0 A;  2IA0 A;  2IS1 A;  4OAZ A;  3CLQ A;  4MFD A;  1U5T C;  1EA3 A;  4XQF A;  3G4S I;  2KKO A;  2JRM A;  4B47 A;  1EJ9 A;  3R0A A;  3BWG A;  1HW2 A;  4RB0 A;  1MMG A;  5JLW A;  1R1T A;  3CMY A;  2ETH A;  2KRF A;  3LL7 A;  2IW5 A;  3LFU A;  4XN0 A;  1B9M A;  3HRS A;  3COA C;  5M5W J;  3WGI A;  4A3C J;  2K9M A;  2K86 A;  3F8N A;  4ANJ A;  3CCS I;  2F6C A;  1W5S A;  2R7T A;  1LDK B;  4LG0 A;  1XPX A;  1IAW A;  1YOV B;  1UB9 A;  1X1A A;  5IOZ A;  4RLF A;  2EA4 A;  4A0Y A;  2PQ8 A;  2ISY A;  1IO2 A;  4KA4 A;  1G6N A;  3HHH A;  3KP4 A;  1E3P A;  2M8G X;  1BM9 A;  3F8B A;  3P9K A;  2OTJ I;  3E6B A;  4FE7 A;  2RQP A;  1SD7 A;  4RAF A;  2IBD A;  1UG0 A;  4CZC A;  3S8P A;  4PFP A;  3QWL A;  3P9C A;  2X4H A;  2RNJ A;  2H09 A;  4UUS A;  2V1U A;  2KIF A;  2WB1 N;  3A01 B;  1QPM A;  5IT9 Z;  3DKX A;  2PI0 A;  3HOV J;  1XN7 A;  2GOM A;  5CYV A;  1X4O A;  4HX7 A;  2Z3Y A;  2L3D A;  3ZQF A;  2NVT J;  1KQ0 A;  2STT A;  3FMS A;  5LGN A;  1IG7 A;  1Q1H A;  2D1H A;  3FIW A;  2GM4 A;  1LVK A;  2DYS H;  1J09 A;  1FBU A;  1A6Q A;  5HDN A;  3OYL A;  2V9V A;  3A2K A;  1YIT I;  3K10 A;  3HOS A;  2PEX A;  2V9P A;  3K9T A;  1ETQ A;  3SDG A;  2VKV A;  1QVU A;  5HS9 A;  4BQN A;  4WCG A;  2MLK A;  4JX6 A;  1TT5 B;  2XHK A;  1K79 A;  1H88 C;  1WFX A;  1G4D A;  1P92 A;  2GWR A;  2FD5 A;  1TLH B;  3HTS B;  5GAD J;  3KEY A;  2QWW A;  3LSI A;  3BG3 A;  2DOF A;  3BTL A;  3DV8 A;  2QBY B;  3GFJ A;  2WAF A;  3TP0 A;  4AUX A;  2HZT A;  2E5N A;  3ECO A;  3RJP A;  2DPD A;  3GFI A;  5BS6 A;  2AQF A;  3JSP A;  4PJM A;  1O4X A;  4NHJ A;  3HRU A;  4PFO A;  4BU2 A;  3SFZ A;  2W1O A;  2CRG A;  5LHI A;  3Q0V A;  3C2H A;  2M7B A;  3C2G A;  1JGG A;  2WB1 A;  1I27 A;  1W0U A;  1ON2 A;  5LGT A;  3FXL A;  4UUV A;  3ABL H;  1OR7 A;  3HKZ N;  2FNP A;  1WJB A;  1YIJ I;  2XPU A;  1W7P A;  4CCL A;  3DBL B;  4D9J A;  3I71 A;  3UNG C;  5L3E A;  5KVR A;  2K85 A;  4B3A A;  4A5N A;  4XKV A;  3ONQ A;  2KJC A;  2CFO A;  2VT2 A;  5IYD J;  3S93 A;  2VI6 A;  4II2 A;  4EQQ A;  2J5P A;  3F3X A;  4RGS A;  1FT9 A;  3EPZ A;  1FYM A;  2CQK A;  4EEF G;  3BPX A;  1Z67 A;  2ADU A;  3GVA A;  4E7I A;  3QU6 A;  2EFP A;  2Y0M A;  4U87 A;  4E7J A;  3L2R A;  1RC9 A;  1IRX A;  4C2U A;  3F8F A;  4NC7 A;  2CV2 A;  5FLV A;  1GT0 C;  4F3Q A;  3DXJ F;  2FRH A;  4GCV A;  3GTG J;  2F5D A;  2DTR A;  1FLI A;  2G9W A;  3HC7 A;  2ELK A;  2M45 A;  1G8X A;  3KP2 A;  4WXC A;  2KT0 A;  1DPU A;  1MH4 A;  4YEL A;  3N97 A;  1JT0 A;  1B1B A;  2LG4 A;  2YPR A;  5J40 A;  3M7G A;  3I54 A;  4HV5 A;  2XF5 A;  4CUG A;  1JUS A;  2AXL A;  3RTR A;  3PIO F;  4E7L A;  2PN6 A;  3QAH A;  3ZOB A;  1IRZ A;  2ZME C;  2W82 A;  2NOJ B;  2MA3 A;  4Y4R A;  3S3O A;  1TQI A;  1HW5 A;  2QYO A;  2L7F P;  5BPI A;  1D1A A;  2J5O A;  3GZ5 A;  2E2H J;  1GXP A;  1EKE A;  1TT0 A;  4K2E A;  3AG3 H;  3WTS C;  1UMQ A;  3IV5 A;  1P7I A;  1IF1 A;  3GTL J;  3ELK A;  4BY7 J;  2P7V B;  4EV0 A;  2PJP A;  1PUF A;  1K78 A;  1TTY A;  4ETS A;  1T33 A;  1MMA A;  3AG2 H;  2EV5 A;  4PJN A;  4YIR X;  4G7Z F;  3IH2 A;  2ELJ A;  2IVM A;  4IHW A;  4BEH A;  2QA4 I;  1ON1 A;  4H4K C;  2DOD A;  2X6O A;  2COB A;  2YR2 A;  3TOA A;  1TWF J;  3WTT C;  3FXO A;  1RR8 C;  4Y52 J;  3KX2 A;  2WTE A;  2R7Z J;  4LLL A;  3BY6 A;  3T8R A;  4J00 A;  4HG2 A;  3LQR A;  3GXO A;  1ZRF A;  3I58 A;  2Q1Z B;  2LY1 A;  4D0P A;  5D5W B;  3J81 Z;  1VF9 A;  2ZNZ A;  4NBQ A;  3DEW A; 
#chains in the Genus database with same CATH homology
 1D8J A;  4L5J A;  2RC4 A;  2DQL A;  5HLI A;  2QUF A;  4EVI A;  2VXZ A;  2A69 F;  2XVC A;  1H9T A;  2JT1 A;  4HX8 A;  3KZZ A;  2FA5 A;  4AIJ A;  1R00 A;  3NQO A;  4YFN F;  2XAS A;  5E1X A;  2OAZ A;  5LHG A;  5FLX Z;  3WTU C;  2RKH A;  3RDI A;  4RGX A;  3IRQ A;  4H0E A;  5JI6 A;  1T2K A;  5AIQ A;  2DFI A;  2CWE A;  1U78 A;  3BOQ A;  3WGH A;  1ZLJ A;  3REO A;  1ZG1 A;  1TBX A;  2RV8 A;  1LB2 A;  1LVA A;  2M8E A;  5D6E A;  1ZAO A;  3K1M A;  1O7F A;  4EM2 A;  4MGR A;  1ONV A;  3KP7 A;  5LGU A;  1KU7 A;  2UXN A;  3ZPL A;  5ED4 A;  3MEX A;  3CO6 C;  3F23 A;  2A6E F;  1QZY A;  2OU2 A;  2HYF A;  2PFB A;  2ZCW A;  5BPD A;  5TRD A;  4U7D A;  3DPL C;  2FBI A;  1SMT A;  1XDS A;  2XRN A;  1GXQ A;  1PUE E;  1Z6R A;  5H20 A;  2PMU A;  2P6S A;  2YSR A;  2XKO A;  2K7L A;  3E6C C;  4KNY A;  4ZZD A;  3K1N A;  4G8X A;  3VEP A;  1E2X A;  1ZRD A;  1XMK A;  3R6S A;  4CZZ A;  1BN5 A;  2ELH A;  3EUH A;  1SD4 A;  2L54 A;  4L5I A;  1SAX A;  2GXG A;  4I01 A;  4CDG A;  5AON A;  3TGN A;  5HDK A;  2GAU A;  2EWN A;  3CJN A;  4MHG A;  4HF2 A;  2LSO A;  4IXA A;  1ZHF A;  4U0Y A;  3LFK A;  2HQR A;  4CYD A;  2D1V A;  2L01 A;  1J2X A;  5L3C A;  4HLY A;  3P7N A;  4UV9 A;  3HSE A;  3M8E A;  5D5X B;  3ZMD A;  3ULQ B;  4WX9 A;  3P9I A;  4L0Z B;  5CLS A;  4IF4 A;  1LDD A;  1S29 A;  4IHS A;  4I98 B;  5HVQ C;  1HW1 A;  4EJV A;  4EGY A;  3LST A;  1RUO A;  1YFH A;  4MQV A;  1TQP A;  4UHT A;  1QQI A;  1QZZ A;  4CIC A;  2A3S A;  1DUX C;  1W4M A;  5E8G A;  2DK5 A;  5D5V B;  3V7R A;  2OZ6 A;  1WWX A;  1YW8 A;  3JW4 A;  4XSZ F;  3K1P A;  2L4M A;  1JHH A;  2NRA C;  2NAZ A;  1TW2 A;  4RAY A;  3VOE A;  1R1U A;  4G6Q A;  1BJA A;  2UWM A;  4I0B A;  3H92 A;  2IA1 A;  3K69 A;  2YX7 A;  3VFZ A;  3HIF A;  1WSU A;  1PP8 F;  2LNB A;  1MKM A;  4RB2 C;  3KET A;  2COM A;  1BOA A;  1P6R A;  1TQM A;  1KQ8 A;  3W6J B;  2DQR A;  2ESN A;  4L9J A;  4HZF A;  4GGG A;  4P5O A;  1DP7 P;  2H6B A;  3V7S A;  4B09 A;  1FC3 A;  4AVP A;  4ASN A;  4N9H A;  4LGW A;  2NNY A;  4ENN A;  2P8T A;  4KIB A;  1F5T A;  4I0A A;  2O0Y A;  4NB5 A;  1T38 A;  4ZYH A;  2ZNY A;  4KUM A;  4KN4 X;  1ZAR A;  1O3R A;  1W7P B;  2F5C A;  1YYV A;  1T6S A;  3F6V A;  4MQ9 F;  2BEO A;  3ZP5 A;  1OYW A;  1JHF A;  4BXU A;  4UVA A;  2QVO A;  3NRV A;  4RGU A;  2K02 A;  4M9Z A;  4HLX A;  5DCM B;  1R23 A;  2W24 A;  3WE3 A;  1BI2 A;  2EFQ A;  3FHZ A;  3PQJ A;  3QP5 A;  3EYY A;  1ZGA A;  3SHF A;  2QBY A;  4UV8 A;  1DPR A;  4KIG A;  2XRO A;  3LA3 A;  1BIA A;  1YQA A;  3CTA A;  1B6A A;  1BI0 A;  3WGG A;  4P9U A;  4G7O F;  3S2W A;  3GWZ A;  2H6C A;  1WQ2 A;  3H3U A;  3LWF A;  1O3Q A;  4IHT A;  4M6Y A;  5BQT A;  1F9N A;  4HA8 A;  3HOT A;  2L4A A;  4M71 A;  2XIG A;  1SFU A;  1Z91 A;  4LLG F;  2A68 F;  5CJ9 A;  1IRF A;  2VC0 A;  1GHC A;  1XB4 A;  4RB1 A;  1MJA A;  4O3M A;  2IPQ X;  2P5L C;  1J0R A;  1UST A;  1UCR A;  2XAJ A;  4LMY A;  2CW0 F;  3BZ6 A;  4M72 A;  1K7A A;  5HS7 A;  2FNA A;  4HX4 A;  5D6F A;  1UHW A;  3J81 K;  1RUN A;  3ZMU A;  1FPQ A;  2XAH A;  3ZMS A;  1TNT A;  1U2W A;  4Y15 A;  4A2U A;  4L0Y B;  2HKX A;  2G7H A;  1X3U A;  1U8R A;  2M30 A;  4MEY F;  5HLH A;  1UFM A;  1BI3 A;  2V6C A;  2RGV A;  1KGS A;  2DK8 A;  4GYG A;  3EYI A;  2Z5U A;  4R79 A;  2WWY A;  4YII A;  3BJ6 A;  1MGT A;  2GZW A;  2K27 A;  4OIR F;  2JSC A;  1G3T A;  3W6K B;  3IL2 A;  5F64 A;  2MH9 A;  4GXO A;  3KZY A;  5F1R A;  1FBS A;  2D2W A;  3CUQ C;  3IC7 A;  2XAQ A;  1BIB A;  2VT3 A;  3M1E A;  3WE2 A;  1YG2 A;  3G73 A;  2LKP A;  5A2Q Z;  2A07 F;  3M8F A;  3JTH A;  1IRG A;  4PDK A;  1LJ9 A;  3ZN0 A;  3BJA A;  2MBF A;  3VOD A;  3IWZ A;  1CF7 A;  3HTU A;  1EH8 A;  4LFU A;  1P2F A;  5FD6 A;  4Q5S F;  2NNN A;  4U0W A;  2ZBK A;  4KFC A;  3F72 A;  3L00 A;  2JTV A;  2P6T A;  4BAY A;  2QLZ A;  1S6L A;  4IRH A;  4MEX F;  1TW3 A;  1REP C;  3F8C A;  3RI4 A;  4A0X A;  3HSF A;  3DPT A;  2XV4 S;  1CGP A;  4CHU A;  4HW0 A;  4M74 A;  4M9S A;  2ZFW A;  1G3W A;  2HR3 A;  3MQ0 A;  1BC7 C;  4RGR A;  2VBZ A;  2E7X A;  2R7F A;  4DQ2 A;  4HF0 A;  1TNS A;  4I02 A;  2FMY A;  4L9T A;  4KYW A;  2F5F A;  3ABT A;  2XKP A;  3RPU A;  2EV6 A;  3TDU C;  2HOE A;  1I1G A;  4EM0 B;  2A5Y B;  3O3K A;  3TO7 A;  3TO6 A;  3JAM K;  5ICE A;  1ODD A;  1ZYR F;  3I64 A;  1USS A;  3KP3 A;  2Y48 A;  4UVB A;  4AIK A;  4RAZ A;  1HKS A;  4IPA A;  2EFW A;  4GYI A;  4I7H A;  2FSW A;  5ERI A;  3SZP A;  1ZLK A;  2GQQ A;  1FBQ A;  4A5M A;  3MAJ A;  3HRT A;  1FNN A;  1RI7 A;  1IXS B;  2QQB A;  3ZMV A;  5FO5 A;  5D4S A;  2Z9O A;  4HF1 A;  1FSE A;  2GA1 A;  4PCQ A;  1OYY A;  3FMQ A;  3TDZ C;  1RZ4 A;  4JQF A;  2ZKZ A;  1FZP B;  4FX4 A;  3LQQ A;  3MWM A;  4OIN F;  2W25 A;  4A0Z A;  2EB7 A;  4WXD A;  3SXY A;  3ZMZ A;  5D8L B;  1Z1D A;  2CG4 A;  4EJO A;  3K2Z A;  2VN2 A;  1R58 A;  5DUK A;  3CO7 C;  1QBJ A;  1V4R A;  5K5O A;  4ZZL A;  3HRM A;  1FOK A;  1O57 A;  3L7W A;  1U5T A;  5AIP A;  4ZYD A;  4QWQ A;  1H9G A;  3H3Z A;  4ESF A;  1C0W A;  2ZJ2 A;  4JBA A;  3RPQ A;  4EJT A;  3FXQ A;  2OQR A;  3BJO A;  5DYM A;  4LJZ F;  3QOP A;  3GEZ A;  2QEN A;  3IHU A;  3WTZ A;  1G3S A;  1YS7 A;  4G6D A;  1P4A A;  2Q0O A;  2KIM A;  3T1B A;  4YG2 F;  1RIO H;  3L09 A;  2GA2 A;  4FT8 A;  5K5R A;  5LHH A;  2BYV E;  5JHU A;  2Z33 A;  3F22 A;  2XAG A;  3CDH A;  1FYK A;  2FEZ A;  1J5Y A;  2VOD A;  3IKV A;  3Q9V A;  3IWF A;  2DPU A;  2Q2E A;  2EA2 A;  2HTJ A;  5ICG A;  1HQC A;  2VBY A;  3ROU A;  2QZ8 A;  3U1D A;  3F8M A;  3ABU A;  3U2R A;  4Z2Y A;  2PLY A;  3DF8 A;  2JZY A;  1HBX G;  1ZRC A;  4PZJ A;  2HDC A;  2GXB A;  2A61 A;  5FGM A;  1B59 A;  1F1Z A;  2HYG D;  4OU0 A;  5LRS A;  3E97 A;  2DBB A;  3FX3 A;  3GF2 A;  5LLQ A;  4UNO A;  1D5V A;  2FE3 A;  1HKQ A;  3ZMT A;  2V1X A;  2Z99 A;  4OIO F;  4YIF A;  1XMA A;  1WI9 A;  3MZH A;  2O61 A;  4LK0 F;  3IKT A;  4IRI A;  2DT5 A;  2R3S A;  4OIQ F;  4IRG A;  1IUY A;  4HAM A;  3V8L A;  1YTY A;  1YIO A;  1MZB A;  2ZME B;  2E1C A;  1BI1 A;  2RN7 A;  1ZN2 A;  2HWV A;  1ZGJ A;  5J8F A;  3KCC A;  4KT5 C;  4BHB A;  4ENK A;  3E6M A;  1AOY A;  3M9A A;  3RKY A;  1XGO A;  3FXU A;  2IT0 A;  4L18 B;  3WU0 A;  4BQA A;  2WC2 A;  3DP7 A;  5E20 A;  2GIV A;  1T39 A;  4R8H A;  1R5H A;  2YX4 A;  4G9Y A;  4XBF A;  4A6E A;  4S05 A;  3RYP A;  2K4J A;  3KLN A;  1YLF A;  3RKX A;  1J59 A;  3HSR A;  1IXC A;  3C7J A;  1SFX A;  3GYH X;  2W57 A;  1YS6 A;  1L0O C;  1UHM A;  1XSD A;  5HS8 A;  4EJW A;  5EEG A;  2C6Y A;  4EMS A;  2RDP A;  3Q5F A;  2VBW A;  1OMI A;  2JPB A;  3TKY A;  2M1B A;  1LNW A;  3BDD A;  1RNL A;  5ICC A;  3J80 K;  1IXR C;  5FB2 A;  4E70 A;  3MFK A;  3CUQ A;  4LB5 A;  2VON A;  2A6H F;  1LEB A;  1MJB A;  2LF7 A;  4PGG A;  1HKT A;  2FXA A;  2OZU A;  1EH7 A;  4MNU A;  3LAJ A;  1WRJ A;  2IP2 A;  1YW7 A;  5TJJ A;  4WXH A;  3EET A;  2EJR A;  1ZG3 A;  2VE9 A;  2JRT A;  3WOD F;  2H94 A;  1J7K A;  1D3Y A;  1MDM B;  2XAF A;  2R7D A;  5L3D A;  1STZ A;  1MD0 A;  5LRR A;  1PP7 U;  3IRR A;  5D8K B;  3U9G A;  1AWC A;  4KIC A;  3GZ6 A;  4YFX F;  4KIF A;  3MCZ A;  2EFN A;  4HYE A;  3RKW A;  1E17 A;  2XUB A;  4JK1 X;  2DLL A;  1XSX A;  1S8N A;  3TOB A;  2V79 A;  4I09 A;  2D45 A;  5ILU A;  4F7Z A;  1LDJ A;  1IN6 A;  4FX0 A;  3F21 A;  1D8K A;  3O6B B;  4P9F A;  5DCF A;  4Y13 A;  1J75 A;  1BBY A;  2OD5 A;  4MTD A;  3ZQ7 A;  5K1Y A;  1NHA A;  5L3F A;  5ILV A;  2LF8 A;  4Q48 A;  3WTW C;  3RIR A;  3NEU A;  3J80 Z;  4RS8 A;  1CF7 B;  2V1D A;  3JAM Z;  2K4B A;  4U7B A;  1IN7 A;  2O03 A;  4EGZ A;  1JXS A;  3ISP A;  3Q9S A;  1XCV A;  5DCM A;  2UZK A;  1OYI A;  2MLG A;  4P55 A;  1J9I A;  5EEH A;  4OMY A;  4U88 A;  2FOK A;  3PFI A;  5IT3 A;  3QP6 A;  2W84 A;  2ESH A;  3JTG A;  2IRF G;  3LA2 A;  4LK1 F;  3VB2 A;  3CUO A;  4CGZ A;  4XLP F;  4NQW A;  5D5U B;  4HQM A;  5LBQ A;  1EH6 A;  3V7C A;  5HDG A;  3PQK A;  1L3L A;  4KMU X;  3WU1 B;  3OOP A;  4ZYG A;  2NS0 A;  2VBX A;  3I0T A;  1V3F A;  5DUI A;  5K5Q A;  2H27 A;  4WK8 F;  4G94 A;  2OA4 A;  3QPT A;  3DKW A;  4O6J A;  3WTX C;  2AS5 F;  3R61 A;  1EV7 A;  2HQN A;  2P4W A;  2VE8 A;  3BP8 A;  4XSX F;  4UXN A;  4AD9 A;  2E7W A;  3JSO A;  1F4K A;  5DDG A;  2ACJ A;  3E5Q A;  1H0M A;  1K6O A;  1IW7 F;  5H6R A;  5FD5 A;  3QRF F;  1W5T A;  3DEU A;  3CUQ B;  3GFM A;  4HDU A;  5CVV A;  2CFX A;  1ZRE A;  2ZME A;  1XSV A;  5FFX A;  4DNC A;  4EJU A;  2G7U A;  2FF4 A;  1MJ9 A;  2DAO A;  3GFL A;  1T0F A;  4BYY A;  1BC8 C;  1IN5 A;  4WWC A;  1KA8 A;  3SZT A;  1ULY A;  2O6G E;  1Y0U A;  5D4R A;  2FBH A;  3I59 B;  2O8X A;  4WF2 A;  3I59 A;  2HGC A;  3HHG A;  1XD7 A;  2VOP A;  3BRO A;  4L9V A;  3T5X A;  2EV0 A;  2XGX A;  3KEO A;  4GO1 A;  1XDU A;  2OBP A;  2W85 A;  1U6G A;  1FYL A;  2Y75 A;  1O7L A;  1FSH A;  1LEA A;  1IN4 A;  3J7A O;  1ZG5 A;  2KIU A;  4CXF A;  1MDM A;  4HV6 A;  1YO5 C;  4O5V A;  2MD5 A;  3GLX A;  1ZH5 A;  5E1Z B;  5JFR A;  4QLC U;  3KE2 A;  5A2Q K;  1KU3 A;  3LAP A;  1HST A;  5E18 F;  5E17 F;  4L9N A;  2BV6 A;  3ML6 A;  3WTV C;  1QGP A;  5J8C A;  5JVT A;  1IZ1 A;  5LEK A;  5KK1 A;  2EK5 A;  5ICF A;  2LDU A;  2YU3 A;  3FF5 A;  1S7A A;  1R7J A;  2BE5 F;  4XRF A;  2MH2 A;  1P4W A;  4OOI A;  3C3W A;  4OMZ A;  3R60 A;  3B73 A;  4ENJ A;  5LEJ A;  3HYI A;  4OIP F;  5DD8 A;  1FX7 A;  2HTS A;  4EM1 A;  4A12 A;  1O3S A;  1KU9 A;  2FQ3 A;  4KMF A;  3AAF A;  4R1H A;  1WKM A;  4UVC A;  2P5V A;  3DFG A;  4MTE A;  5ILS A;  1R1V A;  5IT9 K;  3KP6 A;  5E1W A;  1I5Z A;  4TV7 A;  1SMY F;  4ENM A;  3ECH A;  5CVJ A;  2CYY A;  1JGS A;  4IVN A;  1B9N A;  3N4M A;  3ERE D;  2DO7 A;  4N9I A;  3R0J A;  1KQ9 A;  5L3G A;  3E5X A;  4LD5 A;  3BPV A;  3E5U A;  2ZXJ A;  1JE8 A;  3C1D A;  2NYX A;  1IN8 A;  2PMH A;  2MC3 A;  5J6X A;  5L3B A;  4P96 A;  3TO9 A;  2DI3 A;  2DW4 A;  4ESJ A;  1R36 A;  2UXX A;  5FFZ A;  3FWE A;  2RVC A;  3RYR A;  1OKR A;  4BH9 A;  1S3J A;  2B0L A;  4KN7 X;  2HKO A;  3V8K A;  4FHT A;  3FM3 A;  5DEQ A;  1VTN C;  3L9F A;  2L02 A;  3FMR A;  3KLO A;  1HXD A;  4HBL A;  4BHC A;  3L2C A;  2IA2 A;  4ON0 A;  3GX4 X;  1I1S A;  3E6D A;  1Z05 A;  1KU2 A;  5DV5 A;  1SFE A;  2OQG A;  5JR3 A;  4Q4Z F;  2JPC A;  5DD4 A;  2CSO A;  3QPH A;  3FM5 A;  3I4P A;  4HQE A;  2FML A;  3EQL F;  1I6X A;  1P4X A;  4ZYE A;  4LLN A;  1U3E M;  3T0Y A;  4IJA A;  1FP1 D;  1G3Y A;  3FZV A;  4M6X A;  1O3T A;  3ZN1 A;  2QQ9 A;  4RB3 C;  1HSJ A;  2X0L A;  4CO8 A;  1Z7U A;  3OV8 A;  4LG0 B;  2P5K A;  4HDV A;  2P7C B;  2CO5 A;  4S04 A;  5F6F A;  3V8J A;  1Z9C A;  3O2P E;  3TQN A;  2VC1 A;  3F6O A;  5BOX A;  5CVU A;  4ZH4 F;  4ESB A;  4KDP A;  1K78 B;  4PGH A;  1R22 A;  2STW A;  2HEO A;  2M87 A;  2KJB A;  5H6Q A;  1PDN C;  3I53 A;  2Q8K A;  6PAX A;  2QM3 A;  2BGC A;  3GW2 A;  4HOB A;  1U5T B;  3KEQ A;  1R5G A;  4A6D A;  3D5L A;  2M5W A;  3G3Z A;  3D0S A;  5HLG A;  2E1N A;  2F2E A;  3HUG A;  2ISZ A;  2DU9 A;  1SD5 A;  2FBK A;  1GVJ A;  3K0L A;  1XGS A;  2PG4 A;  1SD6 A;  1KYW A;  3WG9 A;  3KP5 A;  1OPC A;  4YFK F;  3GUD A;  2F5E A;  1S7O A;  4G7H F;  2IJL A;  5CVI A;  4LB6 B;  1XGN A;  5HOO A;  1FP2 A;  1B4A A;  2O3F A;  2CGP A;  4N0B A;  4B8X A;  3T8T A;  4BNC A;  3QU3 A;  5BMZ A;  4U0V A;  2VOO A;  1W7P D;  3KFW X;  5E8I A;  3FXR A;  3LA7 A;  2BBY A;  1FY7 A;  4AWX B;  1LQ1 A;  4Y17 A;  1YW9 A;  3WTY C;  4Q47 A;  3B02 A;  4M9X A;  4I2O A;  3R4K A;  5CVR A;  1A04 A;  1QNT A;  1XGM A;  3I5U A;  4AIH A;  1QO0 D;  2TDX A;  3EDP A;  2HFH A;  4XLN F;  1XCB A;  2QQA A;  4M73 A;  2PBI A;  3V4G A;  2FU4 A;  2EFO A;  3GO5 A;  5FLX K;  3SQN A;  2ZO4 A;  1T98 A;  3DQV C;  3E3V A;  3CLO A;  2WV0 A;  1KYZ A;  1FWZ A;  1Z6T A;  4BHP A;  2HS5 A;  3MZY A;  3C18 A;  1DDN A;  2IA0 A;  1U5T C;  2KKO A;  3R0A A;  3BWG A;  1HW2 A;  4RB0 A;  1R1T A;  2ETH A;  2KRF A;  2IW5 A;  1B9M A;  3HRS A;  3COA C;  3WGI A;  2K86 A;  3F8N A;  1W5S A;  1LDK B;  4LG0 A;  1IAW A;  1UB9 A;  2EA4 A;  4A0Y A;  2PQ8 A;  2ISY A;  4KA4 A;  1G6N A;  3HHH A;  3KP4 A;  3F8B A;  1BM9 A;  3P9K A;  3E6B A;  2RQP A;  1SD7 A;  3P9C A;  2X4H A;  2RNJ A;  2H09 A;  2V1U A;  2KIF A;  1QPM A;  5IT9 Z;  2PI0 A;  1XN7 A;  5CYV A;  4HX7 A;  2Z3Y A;  2L3D A;  2STT A;  1KQ0 A;  3FMS A;  5LGN A;  1Q1H A;  2D1H A;  1FBU A;  5HDN A;  2V9V A;  3HOS A;  2PEX A;  3K9T A;  5HS9 A;  4WCG A;  2MLK A;  2XHK A;  1K79 A;  1G4D A;  1P92 A;  2GWR A;  1TLH B;  3HTS B;  2QWW A;  3DV8 A;  2QBY B;  3GFJ A;  2HZT A;  3ECO A;  3RJP A;  2DPD A;  3GFI A;  5BS6 A;  3JSP A;  4NHJ A;  3HRU A;  3SFZ A;  5LHI A;  1I27 A;  1ON2 A;  5LGT A;  4UUV A;  1OR7 A;  2FNP A;  1W7P A;  3I71 A;  5L3E A;  5KVR A;  4A5N A;  2KJC A;  2VT2 A;  4EQQ A;  2J5P A;  3F3X A;  4RGS A;  1FT9 A;  1FYM A;  2CQK A;  3BPX A;  2ADU A;  3GVA A;  3QU6 A;  2EFP A;  2Y0M A;  3F8F A;  3DXJ F;  2FRH A;  4GCV A;  2F5D A;  2DTR A;  1FLI A;  2G9W A;  2M45 A;  3KP2 A;  4WXC A;  1DPU A;  3N97 A;  1B1B A;  2YPR A;  3M7G A;  3I54 A;  4HV5 A;  2AXL A;  3RTR A;  2PN6 A;  3QAH A;  2MA3 A;  1TQI A;  1HW5 A;  2QYO A;  5BPI A;  2J5O A;  3GZ5 A;  1GXP A;  4K2E A;  3WTS C;  1IF1 A;  3ELK A;  2P7V B;  4EV0 A;  2PJP A;  1K78 A;  1TTY A;  4ETS A;  2EV5 A;  4G7Z F;  2IVM A;  1ON1 A;  2YR2 A;  3TOA A;  3WTT C;  2WTE A;  4LLL A;  3BY6 A;  3T8R A;  3LQR A;  3GXO A;  1ZRF A;  3I58 A;  4D0P A;  3J81 Z;  5D5W B;  2ZNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...