4HQMA

The crystal structure of qsrr-menadione complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
VCPYLEETFKILGRSWNGLIINYLSRSNDSSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords QsrR protein
publication title Molecular mechanism of quinone signaling mediated through S-quinonization of a YodB family repressor QsrR.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hqmA00
5A2QZ 2FOKA 2CSOA 2PN6A 1Z7UA 3WE2A 2X4HA 4Q48A 3MWMA 1O7FA 4OMYA 1R00A 4U88A 1YYVA 4I98B 2XV4S 2KJBA 1O3SA 2Y0MA 2DPUA 3EDPA 1IN7A 4CZZA 5HOOA 1WI9A 5DCMA 1J7KA 4HYEA 4A5MA 4U7BA 3D0SA 2BGCA 3DXJF 3QPTA 1DDNA 1IRFA 2E1NA 4YIFA 2P7VB 2A07F 1FWZA 1YW7A 2PMUA 1UHWA 4RB0A 3GFIA 3K1PA 2VC1A 1LDJA 1XGOA 1BBYA 3E5QA 1S7AA 1YQAA 5CVUA 2KJCA 5K5RA 3R4KA 2DW4A 2RV8A 4LJZF 2HTJA 2P5LC 3QU3A 3JTGA 4KN4X 2YR2A 2L4AA 1BI0A 2VBXA 1FC3A 5LEKA 4L9VA 2A69F 5FO5A 1ZG1A 4N0BA 3D5LA 2DBBA 4MHGA 3SQNA 1U2WA 3TDUC 2K4JA 2EFOA 3RPUA 1EH7A 3KP4A 4MEXF 3IWZA 5CVRA 3RKYA 4BYYA 1U6GA 4EVIA 5E8IA 5D5WB 2Z33A 4EJWA 4LG0B 1B9MA 5HDKA 3ZMZA 1SFXA 1MD0A 1U5TC 3KP5A 3WODF 3I54A 4PGGA 3V8LA 2EK5A 5FGMA 3F8NA 3REOA 4A5NA 1Q1HA 5K5QA 4KA4A 5FFZA 1QGPA 1G4DA 3WGHA 2FEZA 4GYGA 1D3YA 2GQQA 2Z9OA 4MGRA 2C6YA 2YU3A 5E1WA 2IA0A 3M8FA 1Z6RA 2PFBA 3ABTA 3HOTA 2BV6A 4M71A 4AWXB 3GF2A 3E6MA 2CW0F 1AOYA 4RB3C 2OAZA 3O6BB 5AIPA 3H92A 1FSEA 2JZYA 3ISPA 4G94A 3F6VA 4MTDA 1XGMA 3V8JA 1YFHA 5D6EA 1K79A 3IRQA 1D5VA 3FWEA 1V4RA 2OQRA 3N4MA 4HF2A 1LQ1A 3S2WA 3ML6A 2QQ9A 4EGZA 4LK0F 3E6DA 2PLYA 4FX4A 2H94A 2EV0A 4YIIA 1F4KA 3GO5A 2O3FA 2PI0A 2L54A 1KGSA 2HQRA 1LB2A 4EJVA 2CG4A 3J81Z 4KMUX 3BWGA 4JBAA 2RGVA 1S29A 5LHHA 2F5DA 2FQ3A 3TOAA 2COMA 4I0BA 1F5TA 2L02A 5BQTA 4YG2F 1H0MA 4M74A 2F5EA 4XLNF 3FM3A 3B73A 1BOAA 4TV7A 3C7JA 5LEJA 3E5XA 2NNNA 5IT3A 1KYWA 3PFIA 3F3XA 5BPDA 3KZZA 2VC0A 1FPQA 1R36A 2XGXA 3WTVC 1J2XA 3W6JB 1JXSA 4L0YB 5CVVA 3NQOA 2DPDA 5HDNA 1TTYA 3L00A 4IHTA 3QOPA 2BEOA 3CUQB 4EJUA 2MLKA 5JI6A 2H09A 4ZZLA 1CF7A 2P6TA 1X3UA 3KETA 5JHUA 2FMYA 3KP3A 1YW8A 3JTHA 2QENA 2QQAA 5TRDA 1QNTA 2OBPA 1T2KA 3CDHA 2XAQA 2M45A 4HBLA 1LDKB 1ZYRF 1XN7A 2ZNYA 4YFKF 3JAMZ 3ZMUA 3CLOA 2KIFA 3RTRA 1B59A 4Y15A 1IXSB 5D5XB 5D8LB 2IT0A 3T8RA 5DV5A 4RGSA 4Y13A 5LHIA 3F6OA 5D8KB 3QPHA 1K7AA 4UVCA 3DEUA 1IAWA 2V9VA 3V8KA 4I01A 3F8MA 1TQPA 4PZJA 3LSTA 2DO7A 1ZLKA 2VT2A 4I7HA 4LK1F 4G8XA 2UXXA 1I6XA 4OU0A 1CGPA 1ZRDA 5JVTA 3RIRA 1QO0D 4Y17A 5L3DA 2IA2A 3HSRA 1XSDA 4U0VA 4EQQA 3DF8A 1PP7U 2XAJA 4P5OA 5H6QA 4ENJA 2P4WA 4DQ2A 1KQ8A 2IW5A 1Z6TA 3FXQA 2HDCA 3P9KA 2VBWA 4XSZF 1W4MA 3C3WA 3KFWX 5J6XA 1P4XA 3I58A 3Q5FA 2MH2A 3LA7A 3LA2A 2EFWA 5JFRA 4FT8A 4ETSA 2FXAA 2ZO4A 2OZUA 3GUDA 2NAZA 5FLXZ 2MD5A 4OIRF 4BH9A 3E5UA 3KP6A 5CLSA 1S8NA 2UWMA 1BN5A 2Y48A 4HQEA 5E18F 3GVAA 2MA3A 1R5GA 5TJJA 1SD6A 2QM3A 1XD7A 1G3SA 1ZN2A 2LDUA 1S7OA 1IZ1A 4K2EA 2P6SA 4QWQA 1SD4A 5D4SA 3TGNA 5BS6A 2JPBA 4WF2A 2STTA 2EA2A 3GFJA 3RYPA 5DYMA 2IP2A 4RGXA 1S6LA 3TQNA 1P4WA 1RIOH 1SAXA 3FX3A 3GZ5A 3TO9A 2FBHA 5ICFA 3J80Z 3QRFF 4HX4A 4IJAA 4EM2A 1ZH5A 1XSVA 5EEGA 1LEAA 4A0XA 4KDPA 1G6NA 3I4PA 3KCCA 4XLPF 3P7NA 4Q4ZF 2YX4A 4M9XA 1O7LA 4ZYEA 1OKRA 4HX8A 4KT5C 5HLIA 1KYZA 1K78B 4ZYHA 2ISZA 2ADUA 2ETHA 3KLNA 2FA5A 3LQRA 4KYWA 2A61A 2JSCA 3BJAA 1YTYA 5LLQA 1H9TA 3C18A 1F1ZA 2DI3A 4YFXF 4M9SA 3T8TA 5E17F 3K2ZA 3FF5A 1R22A 5ICEA 1ON2A 2V79A 3HUGA 3HSFA 2EV5A 4L5JA 3DV8A 1J75A 2OU2A 5DD4A 2CO5A 4KUMA 1W7PD 3K1MA 3MZHA 1WKMA 4N9IA 2HYFA 3GX4X 1ZGAA 5ED4A 1IN4A 2O0YA 2ELHA 2B0LA 2Z99A 3RPQA 5FD6A 5LGTA 4HW0A 5CYVA 1QZZA 5HS8A 1SFUA 2ESNA 3WU0A 3E6BA 1WRJA 3BZ6A 3CJNA 3I71A 2IJLA 1OR7A 1XGSA 3RDIA 1QZYA 4FHTA 2GWRA 1U5TA 4BNCA 2CQKA 3L7WA 2J5OA 2JPCA 1OPCA 4L9TA 1T6SA 1ZRFA 3KEOA 3T5XA 4OINF 1KA8A 1TQMA 2QWWA 3ZN1A 1OYWA 3ECHA 3TO7A 4UV8A 1ZAOA 5F64A 1AWCA 5DUKA 3V7CA 1HW5A 4ZYGA 3R60A 4LB5A 4UXNA 5DD8A 3JSPA 2DK8A 1J5YA 1LDDA 2FE3A 1J9IA 4ESBA 4L9JA 1TW2A 3RKWA 4G7ZF 3R0JA 2HWVA 4KIGA 2FRHA 2DLLA 1P92A 2JRTA 2GXGA 2GXBA 1TQIA 1FBUA 3SZTA 3JSOA 2G9WA 3DQVC 2NRAC 1YS7A 3SXYA 4UVBA 3G73A 2ZMEB 2FSWA 2MLGA 1YO5C 4O5VA 4EMSA 2BYVE 3VEPA 1D8JA 3GZ6A 1STZA 3RJPA 4Q47A 2MH9A 3LFKA 2JTVA 1HW1A 2M87A 1GHCA 1SD5A 2NS0A 5H6RA 5LBQA 2DK5A 3BP8A 2FU4A 3ECOA 3IHUA 5IT9K 3WE3A 1MGTA 2EFNA 3TKYA 2H27A 3QP5A 1XMAA 2AXLA 5F6FA 2IPQX 2QBYB 3CO7C 4PCQA 3BPVA 1Z9CA 4AIJA 2PEXA 2V1XA 1ZG3A 1O3RA 4BHPA 3DP7A 1QQIA 4HDVA 4L5IA 4GGGA 2EB7A 4RAZA 4AIKA 2X0LA 3OV8A 3WTXC 1IXRC 3LAJA 3MFKA 4LLNA 5HLHA 2M1BA 4RGRA 3TOBA 4HA8A 5FFXA 4HF0A 2G7HA 4PGHA 4NB5A 3EQLF 3LAPA 1BC8C 4ZZDA 2CYYA 3VB2A 4UUVA 2EA4A 2P8TA 4AIHA 3HHHA 4HDUA 3Q9SA 2A68F 2GZWA 4ENMA 1MDMB 2A5YB 5CVIA 2Y75A 4M73A 4EJTA 1FP2A 2MBFA 3Q9VA 5LRSA 4O3MA 1JGSA 4XSXF 4LGWA 3IL2A 4Z2YA 1Y0UA 1ONVA 4CICA 3WU1B 3FMQA 1REPC 3R6SA 4A2UA 1JHFA 1K6OA 5HS7A 4GYIA 4CHUA 4P96A 4LFUA 3ZMSA 4KMFA 3ZMDA 3KE2A 4R1HA 4HOBA 3HRUA 5LGNA 2XIGA 4HLXA 3T1BA 2LSOA 3VOEA 3IKVA 3I64A 3E3VA 2XVCA 2GIVA 4OIOF 1E2XA 4WWCA 4IXAA 5ILSA 3I59B 1FYLA 2HEOA 1T39A 1HKQA 1PUEE 2XAGA 2G7UA 1B6AA 3NEUA 1OMIA 1ZGJA 4A0YA 2VN2A 3COAC 2DFIA 1UHMA 4LMYA 3MZYA 3ZQ7A 3FHZA 5L3BA 4WCGA 3G3ZA 2FF4A 2ACJA 1SD7A 1UFMA 3HTUA 2HGCA 3GEZA 3F8CA 2IRFG 1U3EM 2Q2EA 1B9NA 2OZ6A 2PMHA 5E1XA 5FD5A 1FLIA 4KFCA 1WSUA 3I5UA 4AVPA 1V3FA 4LB6B 5A2QK 2MC3A 1FOKA 4I02A 2TDXA 2QZ8A 2D1HA 3C1DA 2VOOA 5AONA 3ULQB 4JQFA 1RI7A 2PQ8A 3FXRA 5CVJA 4RB1A 1OYIA 4I0AA 3BY6A 3OOPA 4WXCA 5DCMB 1GXQA 1OYYA 3NRVA 1I1SA 1BI2A 4G6QA 1ULYA 1DUXC 3ABUA 5ICCA 4UVAA 4MTEA 1U5TB 3BJ6A 2XKOA 2OQGA 2L4MA 3O2PE 5KVRA 5BPIA 2ZFWA 1FZPB 2VT3A 2GA2A 1TLHB 2HKOA 2W85A 3SFZA 2IA1A 1ON1A 1R58A 4M6XA 2O03A 2LKPA 2E1CA 3RKXA 2QUFA 4M6YA 2KIUA 2DAOA 2HQNA 2HTSA 1S3JA 1HKSA 1RUNA 2H6BA 2PBIA 2AS5F 2HYGD 3ZP5A 1TNSA 1FT9A 1H9GA 1IF1A 4ENKA 4CGZA 5BOXA 4EV0A 1YLFA 1Z1DA 3PQJA 1KQ0A 1KU2A 3RYRA 3CO6C 5D4RA 5L3EA 3DPLC 3K1NA 5HLGA 1FYMA 2H6CA 1DPRA 2F5CA 2ZXJA 4ESFA 5EEHA 1E17A 3CUOA 3B02A 2EFPA 3BJOA 2M5WA 1HSTA 2JT1A 2K4BA 1IN8A 2F5FA 3WTZA 3CUQA 2IVMA 1IXCA 1USTA 2W84A 2ISYA 3L09A 1ODDA 2UZKA 1U78A 4D0PA 1BIBA 5J8CA 2VBZA 2O6GE 1TW3A 5L3GA 4RGUA 5DUIA 4BHBA 3QU6A 3H3UA 3P9IA 2VXZA 2EV6A 4I2OA 3WGGA 2XAFA 4BHCA 4EM1A 1PP8F 4E70A 4CO8A 3IRRA 4MQ9F 1KQ9A 4CXFA 5ILVA 1TNTA 3E97A 3FM5A 4PDKA 4LLLA 3F22A 4ASNA 3HYIA 2HOEA 3K69A 4MEYF 3SZPA 3CTAA 1KU9A 1R7JA 3DPTA 2FBKA 3LA3A 1W7PA 2M8EA 3L2CA 1XDSA 2FMLA 2XHKA 4UV9A 2J5PA 2W24A 1HSJA 1USSA 1J0RA 4P9FA 3QP6A 5BMZA 3V7SA 3CUQC 2OD5A 1GVJA 1UB9A 1BI1A 1LVAA 1KU3A 3GFMA 4HAMA 3J81K 1QPMA 4WX9A 2HFHA 3FMRA 3FXUA 1I27A 2R7FA 1LNWA 3BOQA 3WGIA 3F23A 2YPRA 3KLOA 2V6CA 2WWYA 2FBIA 4H0EA 1MJBA 1G3TA 3ZMTA 4WXHA 1XGNA 2CWEA 1EH6A 4KIFA 2QQBA 3WTYC 2Z3YA 3JW4A 3LWFA 2P7CB 3WTUC 3KP2A 1LJ9A 3VODA 2XROA 1P6RA 2V1DA 2YSRA 2E7XA 2LNBA 4GCVA 2RKHA 1CF7B 4HZFA 1ZHFA 4G7HF 5K5OA 2LF7A 1YS6A 1YG2A 3KZYA 1NHAA 2HZTA 3AAFA 4ON0A 1R1UA 3HTSB 4G9YA 5KK1A 1BIAA 2HR3A 3K0LA 1G3YA 1A04A 2LF8A 3SHFA 3JAMK 2XUBA 4A6EA 2M30A 2KKOA 3GXOA 5D6FA 3EYIA 4A0ZA 4IRGA 4BAYA 2DQLA 3ELKA 4Q5SF 4M72A 4O6JA 1FBSA 4IHSA 3ZPLA 2STWA 1F9NA 1O3QA 4ZYDA 4YFNF 4NHJA 4CYDA 4A6DA 4EGYA 1K78A 1KU7A 3H3ZA 1FX7A 4LLGF 4GO1A 1L0OC 4S04A 2XASA 3I0TA 4F7ZA 3GLXA 6PAXA 3N97A 4B8XA 1MJ9A 2GA1A 2KRFA 2R7DA 1DPUA 2NNYA 4RB2C 2DQRA 3I53A 3QAHA 4QLCU 1ZARA 5D5UB 5E20A 2KIMA 3P9CA 1YW9A 2K86A 3E6CC 3F21A 1FY7A 2O61A 2Q0OA 3IWFA 1BJAA 4JK1X 3TO6A 2EFQA 1IN6A 3M1EA 1ZREA 4HQMA 2L3DA 1L3LA 5L3CA 1RUOA 5H20A 5E8GA 3GWZA 2ZJ2A 2VOPA 3WTSC 1BI3A 1O57A 4U0WA 5ICGA 2HS5A 5FLXK 1HBXG 2W57A 4N9HA 4OIQF 1C0WA 1GXPA 3EYYA 1QBJA 1DP7P 1MKMA 2Q8KA 3F8BA 2PG4A 2CFXA 2WV0A 2W25A 4HV5A 5J8FA 2YX7A 2A3SA 3LQQA 3HOSA 1HW2A 3HIFA 3HRMA 4L9NA 2P5VA 4EJOA 3HSEA 3FMSA 4NQWA 4RAYA 3R61A 5HVQC 3T0YA 5HDGA 4P55A 1XB4A 3W6KB 4OOIA 2XRNA 3RI4A 2E7WA 1EV7A 2RVCA 3MEXA 2XAHA 2ZCWA 1BM9A 4EM0B 1R23A 3J80K 3U2RA 3BDDA 4CDGA 2FNAA 1FSHA 2DT5A 3GW2A 2DU9A 3M9AA 4AD9A 4UNOA 4KN7X 4KIBA 4A12A 5LHGA 1G3WA 3M8EA 1SMYF 3GYHX 5K1YA 4G7OF 1T0FA 1T98A 2D1VA 2F2EA 2QLZA 3TDZC 4LG0A 1WWXA 3WTTC 3J7AO 1HXDA 1IW7F 1O3TA 4M9ZA 2L01A 3BROA 2VE8A 2ZMEA 3HRTA 3O3KA 4XRFA 4ESJA 1VTNC 1R1TA 1R1VA 4I09A 1MZBA 4FX0A 3ZN0A 4R8HA 3F8FA 2K27A 1B1BA 3M7GA 4UHTA 4HV6A 5IT9Z 4S05A 1D8KA 1FYKA 5LRRA 4KICA 3V4GA 2VONA 1XMKA 1W7PB 2OA4A 1XCBA 1FP1D 2P5KA 1Z91A 2GAUA 5DCFA 4OIPF 2QBYA 3U1DA 2UXNA 4IRIA 2HKXA 4MQVA 4BXUA 2K02A 2ZNZA 5AIQA 1W5TA 1RNLA 1Z05A 3DKWA 3PQKA 1I5ZA 3FZVA 4L0ZB 3WTWC 4L18B 4GXOA 2RC4A 3WG9A 2Z5UA 2BE5F 1IUYA 4U7DA 4IF4A 4ZH4F 4HLYA 3DFGA 1JE8A 2RDPA 2ZKZA 3MAJA 3L9FA 3ZMVA 1U8RA 2DTRA 2O8XA 2EWNA 2QVOA 4IRHA 3KP7A 4OMZA 1BC7C 1FBQA 2NYXA 4U0YA 3IC7A 1FNNA 4HX7A 1SFEA 1XCVA 3BPXA 2VE9A 1T38A 1MDMA 1J59A 4RS8A 1P2FA 3ERED 4B09A 2RN7A 1P4AA 4LD5A 4IVNA 1EH8A 2PJPA 3KEQA 1JHHA 1XSXA 1ZG5A 2D45A 2XKPA 3VFZA 1WQ2A 3F72A 4KNYA 2RNJA 3U9GA 5F1RA 4MNUA 2BBYA 2EJRA 2V1UA 3HRSA 3K9TA 5D5VB 4HF1A 1LEBA 3HHGA 1YIOA 5ERIA 1ZRCA 3V7RA 1HKTA 4BQAA 2CGPA 2ZBKA 3EETA 1RZ4A 2FNPA 4ENNA 1MJAA 3I59A 1W5SA 1ZLJA 3MQ0A 1IN5A 5HS9A 4WXDA 5CJ9A 4P9UA 4WK8F 3EUHA 1PDNC 1IRGA 2A6EF 3IKTA 5ILUA 3GFLA 3ROUA 1UCRA 2QYOA 2A6HF 5DDGA 1XDUA 2RQPA 1B4AA 2WTEA 5E1ZB 5LGUA 2D2WA 1SMTA 4R79A 1HQCA 1I1GA 1R5HA 2VODA 1TBXA 2R3SA 4XBFA 5FB2A 4DNCA 3MCZA 5DEQA 2ESHA 4G6DA 5L3FA 5JR3A 2K7LA 3R0AA 2WC2A 2VBYA 4IPAA
chains in the Genus database with same CATH superfamily
5A2QZ 1MH3A 2FOKA 2ZFUA 2CSOA 2K3PA 5KAFC 3PIPF 4M3FA 4Y4RA 2M7BA 3S3NA 2PN6A 1SFKA 2LBFA 5FKKA 1Z7UA 1X1CA 4EATA 3WE2A 2X4HA 4Q48A 3MWMA 3ZQQA 1NG6A 3SFIA 1O7FA 3M8JA 3TEDA 1HCRA 4OMYA 1FEXA 2VJ4A 1R00A 2PX9A 2E5ZA 4U88A 4BBSJ 1YYVA 5EG0A 4I98B 4IHXA 4BXXJ 1WJFA 1X3ZB 2XV4S 4II3A 2NXNB 1IRXA 2DDAA 2KJBA 1O3SA 2R7XA 1UHSA 3WHBA 3K4JA 2Y0MA 2DPUA 3EDPA 1IN7A 4CZZA 5HOOA 3K10A 1WI9A 1V55H 1V5FA 2R0QC 1RRJA 5DCMA 4IQJA 2BXZA 1J7KA 2BY3A 4HYEA 4A5MA 4U7BA 1POGA 3D0SA 2BGCA 3DXJF 2E1MC 3QPTA 1IRFA 4L5EA 4A3FJ 1DDNA 2E1NA 1VQ9I 4YIFA 2P7VB 2A07F 4LIVA 1FWZA 1OCZH 4DYQA 1YW7A 2PMUA 1UHWA 3J7AY 4PJJA 4RB0A 3H35A 3CJTB 3GFIA 2XGEA 3K1PA 4J19A 2VC1A 4RLFA 1LDJA 4NC8A 1XGOA 1BBYA 3E5QA 2K5CA 1S7AA 1YQAA 1MBHA 4C3IJ 5CVUA 2UV1A 4MO7A 2Z2SB 3AG4H 5J47A 2KJCA 5K5RA 3R4KA 2DW4A 2RV8A 4LJZF 3TMOA 1R49A 2DA7A 1WGXA 2LREA 2HTJA 3GTLJ 1A6IA 2P5LC 3QU3A 3J7YJ 1Q1VA 3JTGA 3I4MJ 4KN4X 4XK4A 2YR2A 2L4AA 2PJRA 3QYBA 1SVMA 1BI0A 2VBXA 3MKZA 4FE4A 3KIOA 1FC3A 1HA8A 3CP2A 3PSIA 5LEKA 4L9VA 3PNVA 2A69F 5K7HA 1ZK8A 3A1YA 5FO5A 3IAS2 1ZG1A 4N0BA 2DODA 4PUSA 3D5LA 1ETXA 1FOYA 2DBBA 1R71A 3OIPA 4MHGA 2JA2A 2W4SA 3SQNA 1U2WA 3TDUC 1OQYA 1E3PA 2K4JA 2I5UA 2COBA 3UR3C 5M5XJ 1IC8A 2EFOA 2JJ7A 4XIDA 3ASNH 3RPUA 3HOVJ 1EH7A 2V1NA 3KP4A 4MEXF 3IWZA 5CVRA 3RKYA 3BG9A 4BYYA 1U6GA 1B8IB 4EVIA 5E8IA 5D5WB 1IG7A 2Z33A 5FROA 2KQRA 4EJWA 4LG0B 1B9MA 1WJCA 5HDKA 3W6VA 2B63J 3ZMZA 1X1BA 1SFXA 1MD0A 1U5TC 3KP5A 1GVDA 3WODF 1P7IA 3I54A 4PGGA 4XLAA 3LMMA 3QQAA 3V8LA 1W36D 2EK5A 5FGMA 4B47A 2KMUA 3F8NA 3REOA 5FJ8J 2XF6A 4A5NA 1Q1HA 2CUJA 2Q2EB 2ZSHB 5K5QA 4KA4A 3NWTA 2DMQA 5EEAA 3K4CA 1T56A 2IXSA 1FJLA 1MW7A 2Y30A 5FFZA 4C3JJ 1QGPA 5M5YJ 1G4DA 2O7OA 2BHZA 2VASA 3WGHA 1D1AA 2BXYA 2FEZA 4ZDOA 3BG6A 4GYGA 1D3YA 2GQQA 2Z9OA 1JT6A 4MGRA 2C6YA 1QHGA 2YU3A 3D1NI 2VKDA 2DCEA 2IA0A 5E1WA 3QYEA 1E3HA 3M8FA 1Z6RA 2PFBA 2K85A 3ABTA 1YJNI 3HOTA 2BV6A 4M71A 4AWXB 3GF2A 4E7HA 4PJ0C 2DJNA 3E6MA 4XLFA 2L7MP 2CW0F 2JUGA 4RBOA 1AOYA 4RB3C 2OAZA 3O6BB 5FKNA 5AIPA 5B1BH 1X1PA 1VI0A 3FXLA 3H92A 1Y1VJ 2X51A 3GTQJ 3C2GA 1YIJI 1FSEA 3BR3A 2JZYA 1YE9A 1T95A 2XPVA 1SEUA 2F5VA 3ISPA 4IOCF 4G94A 5B3SH 3F6VA 5KHDA 1XGMA 3V8JA 4MTDA 1GV5A 1YFHA 3HOZJ 5D6EA 3HGGA 4DZPA 5M5WJ 1K79A 3IRQA 1D5VA 2JMWA 3FWEA 2ELKA 1V4RA 3VSKA 1LKXA 2OQRA 3AG2H 3N4MA 4HF2A 3ONQA 1LQ1A 2F48A 1DQUA 3TL4X 2VPLA 3LSGA 4ZYAA 3S2WA 3ML6A 3OYCA 2QQ9A 2XC7A 2R5YB 1SVOA 4EGZA 4LK0F 2KIQA 3E6DA 2PLYA 4XLEA 3SZGA 4FX4A 2H94A 2EV0A 2BVMA 1W36C 4YIIA 1MSEC 1F4KA 1ERDA 3GO5A 2O3FA 3CESA 5EZHA 3SDBA 5B1AH 2PI0A 2L54A 3LSIA 3K2AA 3NWSA 1KGSA 3H36A 2HYJA 3DTIA 2HQRA 3HDDA 1LB2A 4EJVA 2CG4A 3J81Z 2VKVA 4KMUX 1DP3A 4CCMA 3TW6A 1QVUA 3BWGA 3O8GA 4JBAA 2RGVA 1VFCA 1S29A 2E36A 5LHHA 2F5DA 2FQ3A 3TOAA 2QF7A 2Y2ZA 2X6YA 2OC6A 1R5ID 2COMA 4I0BA 1F5TA 2WB1A 1W5CC 2L02A 4QPQA 5BQTA 4YG2F 1H0MA 2MYSA 4M74A 2F5EA 4XLNF 3FM3A 2ID3A 4DYRA 3B73A 2X6XA 4M3EA 3OYBA 1BOAA 4XR6A 3S2HJ 4TV7A 1ITYA 1T33A 3C7JA 5LEJA 1VQ4I 4BUPA 2DMNA 1ETKA 2XPUA 3E5XA 2NNNA 3ASOH 2ELJA 5IT3A 1Y1WJ 1KYWA 3PFIA 2LTPA 4Y33A 3U1KA 2VJ5A 3F3XA 5BPDA 3KZZA 1DU6A 2VC0A 3BZKA 4LITA 1FPQA 3KPHA 1R36A 2XGXA 3MKYB 1D0XA 1EJ9A 2NVUB 3WTVC 1J2XA 3W6JB 3ZXSA 1JXSA 4L0YB 1VNDA 1Z77A 5E3MA 5CVVA 3NQOA 2Y9YA 2DPDA 5HDNA 1TTYA 3L00A 4V2GA 4IHTA 3QOPA 2VJJA 2IS4A 2BEOA 3CUQB 2IS2A 4EJUA 2MLKA 2H09A 5JI6A 4ZZLA 1LE8B 1CF7A 1AKHA 3JRBA 2P6TA 1X3UA 3KETA 5JHUA 2FMYA 3OSFA 4HSTA 5GPCA 3KP3A 1YW8A 3JTHA 2QENA 2QQAA 5TRDA 3S3OA 1FTZA 1QNTA 2OBPA 3BLYA 1T2KA 3CDHA 2XAQA 2DA2A 2M45A 4HBLA 1LDKB 1ZYRF 1XN7A 2ZNYA 3CD6I 2W7NA 4E6KG 2VQHA 3GBGA 1T8IA 3D5RC 1WH5A 4YFKF 2PMZA 3JAMZ 3H5AA 2WAEA 3OS0A 3PFYA 3ZMUA 3S15J 4ZDLA 3CLOA 3K4NA 2KIFA 3RTRA 1B59A 2DYRH 4Y15A 3PL8A 1IXSB 2R5ZA 3K7AJ 3ZR8X 5D5XB 5D8LB 3PNYA 2IT0A 3T8RA 5C44J 3A0HC 3CLQA 1R6RA 3DBLB 5DV5A 4RGSA 4Y13A 3GTKJ 5LHIA 2RQQA 3F6OA 5D8KB 1RC9A 3QPHA 2I10A 1K7AA 2KDZA 4UVCA 3DEUA 1IAWA 2V9VA 3KYDB 3SYTA 3V8KA 5K7FA 3CC4I 3OYMA 1B72A 3RKQA 2VXDA 4I01A 3F8MA 1TQPA 4PZJA 5EGOA 3LSTA 2DO7A 2W48A 2WB1N 1HOMA 5GAHJ 1TWGJ 1ZLKA 2VT2A 3PUFA 4I7HA 4LK1F 1S72I 3S1NJ 4G8XA 2UXXA 1I6XA 4OU0A 1CGPA 1JUMA 1ZRDA 5JVTA 2E71A 3RIRA 1QO0D 4Y17A 3ZCOA 4LOCA 5L3DA 2IA2A 3HSRA 4BE1A 1TWAJ 1H8AC 1XSDA 4U0VA 3BTJA 4EQQA 3DF8A 1PP7U 2XAJA 4C9YA 4P5OA 5H6QA 2JK3A 4ENJA 1FMVA 5IOYA 2P4WA 1VQNI 4DQ2A 4B1RA 1KQ8A 2IW5A 1Z6TA 4M3DA 3FXQA 2HDCA 3P9KA 1X2NA 2JVGA 2VBWA 4CA0A 2QCOA 3JRGA 4XSZF 1W4MA 3OYDA 3C3WA 1V5GA 3ZRGA 3S14J 4YRVA 3KFWX 5J6XA 1P4XA 3I58A 3Q5FA 2GOXB 2MH2A 1RESA 1EA3A 2LRDA 3LA7A 2HI3A 3LA2A 1MMAA 2EFWA 1JJ8C 1XC5A 3FHNA 3CCRI 5JFRA 2JVHA 3MVPA 4FT8A 4ETSA 2FXAA 3RZOJ 2ZO4A 2OZUA 3OYHA 3GUDA 4QIWN 2MABA 2NAZA 2HZDA 3FXJA 5FLXZ 2MD5A 3LSJA 4OIRF 4BH9A 3E5UA 3KP6A 5CLSA 2LY9A 1S8NA 2KL4A 2UWMA 3HOXJ 4Z6YA 1BN5A 2Y48A 4HQEA 2IGOA 2Z1DA 5E18F 3GVAA 2MA3A 1R5GA 5TJJA 2LR8A 3A0BC 5EDNA 2B9SA 1SD6A 2QM3A 1XD7A 1JGGA 1G3SA 2A05A 1ZN2A 2LDUA 3HGYA 4OWRB 2PMZN 1A31A 1S7OA 1IZ1A 4K2EA 2P6SA 4II2A 3CCLI 2DT7B 4BJ5C 4QWQA 2PJRB 1SD4A 5D4SA 3H0GJ 3TGNA 2DFHA 2LYCA 3HEFA 5BS6A 4D1QA 2JPBA 3SJMA 1FIPA 2P81A 5EF6A 3H5NA 3MN2A 4WF2A 3GTMJ 1QRYA 2STTA 2EA2A 3GFJA 3RYPA 1ETQA 4B43A 2DOEA 2IP2A 4RGXA 5DYMA 4CCJA 1S6LA 4ZJZA 2R7RA 3KYCB 3TQNA 5CQEA 4XQFA 1P4WA 1RETA 1RIOH 1GUUA 2V4JC 1SAXA 1SFOJ 5IYDJ 5EYRA 5E3OA 2R7TA 4D5CA 2WY7Q 2W82A 1Y39A 1ZTRA 3FX3A 3GZ5A 1VQPI 3TO9A 4QPOA 2MFZA 2FBHA 1IO2A 3CZ6A 4FETA 5ICFA 5H2FC 3S17J 3BT9A 1TZLA 2OCCH 3J80Z 3QRFF 1N75A 3ZQLA 3CCYA 4HX4A 4IJAA 2YU9J 3E7LA 4Y3OA 4OAYA 4B4CA 3OYGA 4BQQA 4EM2A 1ZH5A 1XSVA 4XNFA 5EEGA 3ZQHA 1IUFA 1LEAA 3FXOA 4A0XA 2LD5A 4KDPA 3ABMH 4H4KC 1G6NA 3I4PA 3KCCA 1X1AA 2DA5A 5JHFA 2EIJH 1EF4A 4XLPF 4XRSA 2VUMJ 3OMYA 1Y56A 2CQNA 1JTXA 3P7NA 4Q4ZF 2YX4A 4M9XA 1K83J 3E1SA 3HC7A 1O7LA 1JKPC 4ZYEA 1OKRA 1P9QC 3PSFA 4HX8A 4KT5C 4PSWA 5HLIA 4D7NA 4J00A 1KYZA 1K78B 4ZYHA 2ISZA 1DGWY 1X2MA 4QTRA 2ADUA 4QSHA 2ETHA 1U9OA 3KLNA 2FA5A 3LQRA 3I9V2 4KYWA 5CKTA 3X2QH 2A61A 2JSCA 2ZJRF 3BJAA 2HOTA 1YTYA 5LLQA 2TRTA 2L5QA 1TL8A 3O8HA 2FD5A 1H9TA 4IKFA 3AFHA 3C18A 1F1ZA 2DI3A 4YFXF 2OCEA 4BY1J 1MIJA 4M9SA 3T8TA 5E17F 2ZB9A 2AHQA 4XN0A 3K2ZA 3ZQCA 2LMDA 1IJWC 2LY2A 3FF5A 1R22A 5ICEA 3H5RA 1ON2A 2KRHA 4J01A 3G4SI 2WBMA 1OISA 2V79A 2KPMA 3M3YJ 3HUGA 2CQ7A 3S1RJ 3K70D 3FKIJ 3MZ8A 3HSFA 4GDFA 4BEHA 1OCCH 2EV5A 4L5JA 3DV8A 1J75A 2KZVA 2OU2A 5DD4A 3PIOF 2CO5A 4PFOA 2HU9A 2V7FA 4XM3A 2XB5A 4DGWB 2VL8A 5LD2C 4XLHA 4KUMA 1W7PD 3K1MA 1BR1A 3S8PA 3MZHA 1WKMA 4N9IA 2HYFA 2OTJI 3GX4X 3AG3H 1ZGAA 5ED4A 1IN4A 2O0YA 2LOOA 2ELHA 2B0LA 2Z99A 2V9KA 1W1WE 4HG2A 3RPQA 1TWCJ 1K4SA 5FD6A 5LGTA 4HW0A 5CYVA 2QKLB 2M9HA 1QZZA 2BY1A 3WG7H 4PJNA 4BBRJ 3BG7A 5HS8A 3KYLA 1SFUA 2ESNA 1T08B 3OS1A 3WU0A 1F36A 2Q1ZB 3E6BA 1WRJA 2ZJPF 4BXFA 2DFEA 2MGQA 4CYCB 3BZ6A 3CJNA 3I71A 2IJLA 2NS7A 1OR7A 3DEWA 1XGSA 3RDIA 1QZYA 3BTLA 4FHTA 2K3FA 2GWRA 1U5TA 4BNCA 4AYBA 3HM5A 2CQKA 2ECCA 3L7WA 5C3EJ 2J5OA 4ZTFA 4NQWB 1ZKGA 4NC7A 2JPCA 1OPCA 4L9TA 1T6SA 1WCMJ 1ZELA 1ZRFA 3KEOA 5J1YA 2E60A 3T5XA 4OINF 1KA8A 4MIMA 3RSNA 1FOXA 1TQMA 2QWWA 3ZN1A 1OYWA 3ECHA 3TO7A 1LFBA 4UV8A 1ZAOA 1P7JA 3L2RA 2DOAA 1WVRA 2F4MB 2OJED 3CF2A 4BACA 3HOWJ 5F64A 1Z21A 1AWCA 5DUKA 3V7CA 1HW5A 5J3LA 4ZYGA 3K70C 3R60A 4LB5A 4UXNA 5DD8A 5B5EC 3JSPA 2DK8A 3JRDA 4JP0A 2QQ8A 2GLOA 1J5YA 1LDDA 4CCKA 4D9JA 1VQOI 4C30A 3BR2A 2FE3A 1J9IA 2BW3A 4JYKA 1VF9A 1OCPA 4ESBA 2K9NA 1YOVB 4L9JA 1BJZA 1TW2A 3RKWA 4CCOA 3CMAI 2DMUA 1QPIA 4IEJA 3OYFA 3IP4B 3NARA 4G7ZF 2L0KA 3R0JA 2HWVA 3BQYA 2NVTJ 3K4MA 1FMWA 1UJ8A 4KIGA 1GV2A 3PO3J 5F1JA 3CDIA 2FRHA 3N05A 3A4CA 2DLLA 1OR7C 4IOAF 1P92A 2H8WA 2JRTA 2GXGA 4BDZA 1JKOC 5JVGF 2GXBA 1UZCA 2JA6J 1TQIA 1ETOA 1ZQ3P 1E0EA 1FBUA 3SZTA 3JSOA 2G9WA 2HPMA 3DQVC 1UG2A 3H9JA 2NRAC 1YS7A 2QSFX 3NAUA 3SXYA 5HLTA 4UVBA 3QPLA 4N4OB 2KLOA 3G73A 1V5EA 1U8BA 3ESWB 2ZMEB 3SDGA 4X6AJ 2FSWA 1QZEA 2K9LA 2MLGA 3CCVI 1YO5C 2KT0A 4O5VA 4EMSA 2BYVE 3VEPA 2V9PA 1D8JA 3GZ6A 1E3OC 1STZA 1JKQC 3RJPA 4Q47A 5HNHA 5DM6F 1RKWA 2MH9A 5C4XJ 3LFKA 3DBRB 3L2QA 2JTVA 3CDLA 4AU7A 3A03A 3DWLE 1HW1A 1XG1A 2M87A 2HVSA 1GHCA 4MFDA 1SD5A 2NS0A 5IP7J 4AYBN 5H6RA 5LBQA 2DK5A 2M7AA 2HDWA 2EBIA 1WH7A 3ZOBA 3BP8A 1JKRC 2FU4A 1QVTA 1K61A 3ECOA 3IHUA 5IT9K 3WE3A 1MGTA 1D0ZA 2EFNA 3TKYA 3ZQGA 2OV7A 2H27A 5EGOB 2FOWA 3CQZJ 3C2HA 3QP5A 1XMAA 3U21A 1ETVA 2AXLA 2K9QA 3VYRB 1Z0XA 3CJQB 4XOTA 5F6FA 2IPQX 2QBYB 3HJEA 3CC2I 1EKEA 4JX5A 1LFUP 3S1MJ 3CO7C 2IS1A 1WJEA 4PCQA 3BPVA 1NK3P 1IV6A 2E2JJ 1Z9CA 4AIJA 2PEXA 2V1XA 1ZG3A 1O3RA 4BHPA 3DP7A 2YS9A 1QQIA 1Z3XA 4A3MJ 3S3MA 1N78A 1X3WB 3FK7A 4HDVA 4A3EJ 4IO9F 2R7WA 4L5IA 3V42A 2GXAA 4GGGA 2EB7A 5IY5H 3B6AA 3A01A 5IYBJ 2HXIA 4RAZA 4RMNA 3GMEA 3BCBA 4AIKA 4BL0B 4F3QA 1YRNA 3AG1H 1BR2A 2G0EA 5EJCA 2X0LA 3OV8A 5J1RA 1X19A 3OYJA 2IGKA 1QHHD 2WV1A 4C2UA 3WTXC 1IXRC 3LAJA 3MFKA 2XGCA 2E5NA 4LLNA 2X85A 5HLHA 2Y31A 4XRMA 3HOUJ 2M1BA 2WAFA 4RGRA 3TOBA 4HA8A 1BR4A 4FQGA 5F04A 1D1BA 2B7EA 4HF0A 5FFXA 4CCNA 2G7HA 1NK2P 4RDUA 4PGHA 4NB5A 3EQLF 3LAPA 1BC8C 3CJRB 4ZZDA 3KX2A 2CV0A 5K7ZA 2CYYA 4NC6A 3VB2A 4UUVA 2EA4A 2E2HJ 1PJRA 2FQ4A 2P8TA 4AIHA 1H88C 3FBNB 3LNQA 3HHHA 4HDUA 3Q9SA 5GTHC 2EIMH 4UUSB 2P0WA 2A68F 2BHYA 2GZWA 4IHWA 4ENMA 1MDMB 3BR0A 2A5YB 5CVIA 2Y75A 4M73A 4EJTA 2ID6A 1FP2A 2MBFA 3DU6A 3Q9VA 5LRSA 4DBQA 2JA7J 1ZR4A 4O3MA 1JGSA 4XSXF 2R93J 1MMDA 4LGWA 2HQAA 1OCRH 3GCMA 3IL2A 4Z2YA 1Y0UA 2EILH 4XONA 1ONVA 2NOGA 4CICA 3WU1B 3FMQA 2CW7A 4UB6C 1REPC 3PO2J 1BA5A 3R6SA 1ZR2A 4A2UA 1JHFA 1XS9A 1K6OA 5HS7A 4GYIA 4PJMA 4CHUA 4P96A 2XPWA 2VPRA 1UELB 4LFUA 3ZMSA 4W1UA 4KMFA 4IX7A 3ZGKA 3ZMDA 1X4OA 4BY7J 2IGNA 4FASD 3KE2A 4R1HA 4B44A 3ERMA 3DEEA 2DDBA 2DA6A 1IGNA 1I3AA 1HLVA 2IEKA 4HOBA 3HRUA 1LPQA 5LGNA 2XIGA 4HLXA 3T1BA 1Y8QB 2LSOA 1MMSA 4Y52J 2EZIA 3VOEA 3IKVA 3RQ4A 3I64A 2DMTA 1MNDA 3E3VA 2XVCA 1OLTA 2GIVA 2FX0A 1Y0NA 4NDLA 4OIOF 1E2XA 3JREA 4WWCA 3BC8A 2A5WA 4IXAA 2N8GA 5ILSA 2MG4A 2VKEA 3I59B 5F27A 1MBKA 4KISA 1FYLA 1V54H 2HEOA 2LH9A 1T39A 3WU2C 2GIZA 1HKQA 1PUEE 1VQ8I 5HNFA 4KJZA 2XAGA 2G7UA 1B6AA 5J40A 5E3NA 2ZXHA 3UNGC 3NEUA 1OMIA 1OFCX 2XAUA 1ZGJA 4U87A 4A0YA 1A6QA 1TP4A 1B8IA 2IS6A 2VN2A 4B3AA 1I3QJ 1MBJA 4A3JJ 1SC7A 3BQZA 3COAC 2DFIA 1UHMA 4LMYA 3MZYA 4JX6A 3ZQ7A 3FHZA 2ECBA 3I4NJ 5L3BA 3K4KA 1RKTA 1WI3A 4WCGA 3G3ZA 4CSWA 2FF4A 2ACJA 4XKWA 1SD7A 1UFMA 3W2WA 3HTUA 3VDXA 2HGCA 3L2VA 2GM4A 2XF7A 3GEZA 2DYSH 3F8CA 1VQ7I 2IRFG 1U3EM 4BJ6C 2Q2EA 1B9NA 5GTIC 2OZ6A 2PMHA 5E1XA 2VI6A 2R7OA 5FD5A 1RR7A 2KP6A 1FLIA 4RAGA 3HG9A 4KFCA 4AVZA 3W2AA 1WSUA 5GAEJ 1JT0A 3I5UA 4XLCA 2LKSA 4AVPA 1V3FA 4PK4A 4LB6B 5A2QK 2MC3A 1FOKA 4I02A 2TDXA 2M34A 2LBFB 2QZ8A 3GTPJ 2D1HA 3C1DA 2VQCA 3OIOA 4EEFG 2VOOA 2X48A 5AONA 3ULQB 3HPHA 4JQFA 1RI7A 3FKJA 5EG0B 2PQ8A 3FXRA 1ORKA 1JUPA 5CVJA 4RB1A 1OYIA 4AM3A 3S16J 4I0AA 3OYKA 3BY6A 3TBIA 1LUJB 1VZ0A 3OOPA 5GAGJ 5FKLA 4XKCA 4WXCA 5DCMB 1GXQA 1OYYA 3HBLA 3NRVA 1AU7A 1RR8C 1I1SA 1WHUA 4I76A 1BI2A 3FDYA 3FK6A 2L2OA 4G6QA 1ULYA 1DUXC 5JLWA 3ABUA 1T0FC 5ICCA 3FIWA 4UVAA 1YHQI 3M1CA 4MTEA 1U5TB 3BJ6A 4FCYA 2XKOA 2LFBA 2UUZA 3OYEA 3IAM2 2OQGA 3GLLA 2L4MA 3O2PE 5KVRA 5BPIA 2H8RA 2ZFWA 4NUBA 1N77A 1OJLA 1FZPB 2VT3A 4HNVA 1LFPA 2GA2A 3JCUC 1TLHB 4ZDPA 2HKOA 2W85A 2R5YA 3E0JB 3SFZA 2DT6A 2IA1A 3QWLA 1ON1A 4V2FA 1JTYA 4YELA 3D5SC 1R58A 1SVLA 4V19K 4M6XA 4ANJA 3RCOA 3S2DJ 2O03A 3HPGA 3OL4A 5FRNA 2LKPA 2E1CA 3RKXA 4IL6C 2QUFA 4M6YA 2KIUA 4RLQA 3OYIA 2DAOA 2HQNA 2HTSA 1YJWI 1S3JA 1TWFJ 4DBRA 1HKSA 2JSPA 2F4OB 1RUNA 2H6BA 2PBIA 2AS5F 2HYGD 3ZP5A 1TNSA 1FT9A 3CCSI 1H9GA 1IF1A 4ENKA 4XN3A 2WAQA 4CGZA 5BOXA 4EV0A 1YLFA 2M8GX 2IBDA 3FBIB 1Z1DA 4LIUA 2VIXA 4B3XA 3PQJA 1KQ0A 1KU2A 3RYRA 3CO6C 5D4RA 4YEJA 5L3EA 5GP9A 2IGMA 3DPLC 3K1NA 1TT0A 5HLGA 1FYMA 1WJ5A 2H6CA 1K4TA 1DPRA 1Z7LA 3CCJI 2F5CA 5E79C 2ZXJA 4ESFA 5EEHA 1E17A 4XMYA 3BR6A 2LK2A 3CUOA 1MH4A 4A3KJ 1BL0A 3B02A 3EPZA 4HPQA 2DA1A 2EFPA 3BJOA 2JQ7A 2M5WA 1HSTA 2HVQA 2Y0SA 2JT1A 2K4BA 1G2HA 1IN8A 5GADJ 4GFBA 2F5FA 2DOFA 3WTZA 3DLLF 1S7EA 3CUQA 1DU0A 2JWTA 3HZJA 2CV2A 5KAIC 1XMXA 2IVMA 3LSMA 1IXCA 1D1CA 2LP0A 1BOBA 3JRCA 4PFPA 1USTA 4E7LA 2W84A 4A3DJ 2ISYA 3L09A 1ODDA 2UZKA 2HQ5A 1U78A 4FE7A 2JUCA 3P5JA 4D0PA 1BIBA 5J8CA 3IH3A 2VBZA 1X58A 3L2WA 2O6GE 3A2KA 4F93B 5DM7F 1TW3A 5L3GA 2CU7A 4RGUA 5DUIA 4BHBA 2CV1A 3QU6A 3H3UA 2L9VA 3P9IA 2VXZA 3DU5A 2EV6A 4I2OA 2LVSA 2VB6A 3WGGA 2XAFA 5J4YA 3CC7I 3PNTA 3GTJJ 4BHCA 2BOLA 4EM1A 3MKLA 4E7JA 1PP8F 2ZXWH 4E70A 4W97A 4CO8A 3G2BA 4F55A 3IRRA 2HPIA 4MQ9F 4RM2A 1KQ9A 4CXFA 5ILVA 1TNTA 3E97A 4E7KA 5CQGA 4ABZA 3FM5A 3LFUA 3F9KA 4IZZA 4PDKA 4LLLA 9ANTA 1I50J 2E2IJ 3F22A 4ASNA 4UUTA 3HYIA 3A01B 2HOEA 2E35A 3K69A 4MEYF 3SZPA 3CTAA 2KZGA 1YITI 5IOZA 3L2UA 1KU9A 3OS2A 1R7JA 3DPTA 1YRNB 2FBKA 3LA3A 2F4IA 1W7PA 3UKGA 2M8EA 3L2CA 3I3LA 4DIQA 2WAQN 1XDSA 2O8KA 2KISA 4XICA 3SEQA 1FTTA 1ETWA 2FMLA 2L7FP 2XHKA 2J5PA 4RA2A 4UV9A 5F0FA 2H1KA 1GT0C 3HXLA 3K4LA 2W24A 2DA4A 1HSJA 1USSA 1J0RA 3QP6A 4P9FA 5BMZA 5FKOA 5FRMA 1Y6IA 3V7SA 3CUQC 2OD5A 1GVJA 1UB9A 1BI1A 4D7MA 1FIAA 1LVAA 4CZCA 3IV5A 2VQGA 1KU3A 2HNHA 3GFMA 3AL0B 3HL2A 4HAMA 2CH0A 3J81K 1QPMA 4WX9A 4LG3A 2HFHA 3FMRA 3FXUA 4CUGA 4S0HB 1I27A 3I55I 2R7FA 1LNWA 3BOQA 3DBHB 3WGIA 1VQLI 2KRCA 2Y0SN 3F23A 3DLAA 1ENHA 2YPRA 3EUHC 5KNLA 3KLOA 1MBGA 4A3GJ 1IV8A 2V6CA 2WWYA 2FBIA 2LC2A 4H0EA 1MJBA 1R4MB 2XSJC 3RZDJ 3H1CA 2M4KA 5IP6A 1G3TA 5CPRB 2NVYJ 3ZMTA 4BDYA 3LSHA 3CMEI 1Y8RB 4ITVA 4WXHA 5HODA 3QOEA 4BE2A 3H9GA 3K6GA 4IQ4A 4BE0A 2JA8J 1XGNA 2CWEA 4MLOA 1EH6A 4PSXA 4KIFA 2M3AA 4F52A 2GBYA 3L1PA 4HSRA 2QQBA 5C4JJ 3WTYC 3LSRA 4BGDA 2Z3YA 3JW4A 3LWFA 2M2EA 4XOPA 3J7ZI 2K40A 2P7CB 3PM1A 3QYFA 4CH7A 4Y7NJ 2W1OA 3WTUC 1GLNA 1K6YA 4I6ZA 3KP2A 1LJ9A 3IUOA 3VODA 2XROA 1P6RA 2V1DA 2YSRA 3JRIA 1YI2I 3BZCA 3DKXA 2E7XA 2XGDA 2LNBA 1UG0A 2ICWG 1TWHJ 1WFXA 2DTZA 4GCVA 2RKHA 1WJAA 3JRAA 1CF7B 4HZFA 1KZHA 1ZHFA 5F0HA 1AKHB 5FLVA 3RPUD 1NTCA 4G7HF 5K5OA 2MW8A 2LF7A 1YS6A 1YG2A 3KZYA 1NHAA 1XTAA 1M1EB 2X1DA 2HZTA 3I56I 3AAFA 4ON0A 1SANA 1R1UA 1D0YA 3HTSB 1CQTA 2A6TA 4G9YA 5KK1A 2X1CA 3DKYA 4C3HJ 2V26A 5GPAA 1ZGWA 1BIAA 2R7QA 2HR3A 3K0LA 1G3YA 3FXMA 4RAFA 1A04A 4IHVA 1MNMC 4C2TA 2LF8A 5LFAA 4HRIA 1AA7A 1WPKA 3CCMI 3ABLH 2DN0A 2DMPA 3CCEI 3Q0WA 3SHFA 3JAMK 2AQEA 2XUBA 4A6EA 3QPSA 2M30A 1F43A 2FJ1A 3BR5A 2KKOA 3GXOA 5D6FA 1HDDC 3EYIA 4A0ZA 4IRGA 4BAYA 3BR1A 2DQLA 2R5ZB 3M07A 3ELKA 2CUEA 2NOJB 4Q5SF 3HB9A 3S1QJ 1PUFA 4M72A 2EZLA 2M4GA 4O6JA 1FBSA 3MKWB 1SAUA 4IHSA 1A36A 3ZPLA 2STWA 1F9NA 1O3QA 4ZYDA 2H1LA 5M3FJ 4A69C 1O4XA 2JRMA 3VYTB 4YFNF 1B72B 3EUAA 2NVXJ 4NHJA 2LY1A 4BS9A 4CYDA 4E4HA 4A6DA 3IH2A 4EGYA 1K78A 5DTDA 1KU7A 3H3ZA 1FX7A 2JN6A 4GO1A 2CFOA 4LLGF 1L0OC 4S04A 4X0GA 3OYNA 2XASA 4HNUA 2RAEA 2VQLA 3I0TA 2QGUA 3S93A 3W2VA 4F7ZA 3GLXA 1ETYA 6PAXA 3G1MA 3TP3A 1I39A 2XDVA 3N97A 4B8XA 2HVRA 1MJ9A 2GA1A 2KRFA 2R7DA 1DPUA 2NNYA 4RB2C 3ABKH 2DQRA 2CQXA 4A3CJ 3I53A 4DYCA 1YJ9I 3QAHA 4QLCU 2DA3A 2HDDA 1ZARA 3FXKA 5D5UB 2I8DA 2KIMA 3P9CA 5E20A 1YW9A 2K86A 3IH4A 3E6CC 4D5FA 3F21A 1FY7A 1YX3A 2O61A 2Q0OA 3IWFA 2ME6A 1W0UA 3H0DA 1BJAA 4JK1X 1BW6A 3TO6A 2EFQA 1IN6A 3M1EA 1VQ5I 2R4GA 1JI8A 1ZREA 4HQMA 2L3DA 1L3LA 4BQNA 4XRSG 5L3CA 1RUOA 2GOMA 4BKXA 4XKBA 2XB0X 1ACIA 5H20A 5E8GA 3GWZA 2ZJ2A 1IRZA 3LSPA 2VOPA 1IDZA 2CMPA 1KONA 1LVKA 2VJIA 3WTSC 1BI3A 1O57A 1NG7A 4U0WA 3B6CA 5ICGA 3GTOJ 2HS5A 5FLXK 2LKXA 1XX5A 1JJ6C 1HBXG 2W57A 2DJIA 2V6EA 1PVEA 4N9HA 4IHYA 4OIQF 1C0WA 1N25A 3OR1C 3BTIA 2Y69H 1GXPA 1MBEA 4KT6A 4KITB 5J4VA 3EYYA 3HKZA 3VSLA 2OPTA 2EPFA 4E7IA 3OSGA 4B48A 1DP7P 1QBJA 1MKMA 4AIDA 3CCUI 4AUXA 4CYCA 4NNJA 2Q8KA 3F8BA 2PG4A 1MMNA 2CFXA 2WV0A 2W25A 3OWTA 2ZJQF 2E1OA 4HV5A 5J8FA 2YX7A 2A3SA 2EIKH 2VLAA 1W0TA 3LQQA 3HOSA 1HW2A 3HIFA 3CMYA 3HRMA 4L9NA 3VPRA 2OTLI 2P5VA 2M0MA 4EJOA 3HSEA 3FMSA 4NQWA 2ZXIA 4DZJA 2KDOA 4RAYA 1NH3A 1TC3C 2XSDC 3R61A 4A3BJ 1AHDP 2E19A 5HVQC 3T0YA 2LLKA 5DS9A 4DOZA 5HDGA 4P55A 1XB4A 3W6KB 4OOIA 2XRNA 4CCLA 2KFDA 3RI4A 2E7WA 2ZC2A 1EV7A 3LL7A 1QU3A 2RVCA 1HF0A 2O9LA 3MEXA 2XAHA 2ZCWA 1BM9A 1A35A 3OYLA 2MD0A 1XPXA 4EM0B 4A93J 1R23A 3J80K 3U2RA 4BU2A 3C2BA 1A5JA 3BDDA 2X9DA 1RPWA 4CDGA 3CCQI 2D5VA 2FNAA 1FSHA 2DT5A 3GW2A 2DU9A 3M9AA 4AD9A 4UNOA 4KN7X 3M4OJ 4KIBA 4A12A 5LHGA 1S5LC 2O5RA 1IDYA 1G3WA 4F92B 3G6EI 3DPUA 4BJTA 3M8EA 1SMYF 3GYHX 2VKHA 2E1MB 1HC8A 5K1YA 1TT5B 4G7OF 2BY2A 3JRFA 3G71I 1X4PA 1T0FA 4A3LJ 1T98A 2D1VA 2OUMA 2XF5A 2Z16A 2F2EA 2W00A 2QLZA 3TDZC 4LG0A 1WWXA 3WTTC 3W3CA 3J7AO 3AL0C 3G1LA 1HXDA 1IW7F 1Z67A 2L9NA 2MC4A 1O3TA 4M9ZA 5F08A 3MD2A 2L01A 2F6CA 3PJRA 3BROA 3OIQA 4X1EA 4E7SA 3HKZN 2HOSA 2VE8A 4AC0A 2ZMEA 2RNGA 3HRTA 2QKMB 3O3KA 4XRFA 4ESJA 1VTNC 1R1TA 1R1VA 2AXTC 2DFFA 3TW7A 4UB8C 3HUGB 3OR2C 4BEHB 4I09A 5BNGA 3OL3A 1MZBA 4I99C 3K4BA 3H3VK 1OCTC 2HOAA 4FX0A 3ZN0A 1VQ6I 2CS3A 5TGTA 4R8HA 1HDPA 3F8FA 2K27A 1B1BA 3M7GA 4UHTA 4HV6A 5IT9Z 4S05A 1D8KA 5JLXA 1FYKA 3S32A 5LRRA 4KICA 4JOMA 2QA4I 3V4GA 4DW6A 2VONA 4PJLA 1XMKA 4ZC3A 1H89C 1W7PB 3QODA 2OA4A 1XCBA 1FP1D 1U9NA 2P5KA 1G59A 1Z91A 2GAUA 1UAAA 5DCFA 4OIPF 2QBYA 1WZ2A 3U1DA 3JRHA 4XORA 2UXNA 4IRIA 2HKXA 4MQVA 2R92J 4BXUA 5IP9J 2K02A 2NVQJ 1U0JA 2ZNZA 5AIQA 1W5TA 1J09A 1RNLA 3CMMA 1WJBA 1Z05A 3DKWA 3PQKA 2KHMA 1I5ZA 3CF5F 1Z3YA 3FZVA 4L0ZB 3WTWC 3FISA 4XL9A 2WY8Q 3F0CA 4L18B 1JUSA 4GXOA 3ZQIA 2RC4A 3WG9A 2Z5UA 2BE5F 3EUKL 4P1WA 2IAIA 1IUYA 4U7DA 4IF4A 4ZH4F 4HLYA 3DFGA 1JE8A 2RDPA 2ZKZA 3MAJA 4OAZA 2QSGX 2RREA 3L9FA 3ZMVA 4M6VA 3H9QA 5FKMA 1U8RA 2ZMEC 4YIRX 2CUFA 2DTRA 2O8XA 1I6HJ 3HOYJ 2R7UA 1OCOH 3DCFA 1R9TJ 1APLC 2EWNA 2QVOA 4IRHA 2FUG2 3LSKA 3KP7A 3SEZA 4OMZA 1BC7C 1DGRM 1FBQA 2NYXA 1S9HA 4U0YA 1BW5A 2R7ZJ 3IC7A 1FNNA 4UUSA 1WJDA 2NS8A 4HX7A 1SFEA 4N4NB 1XCVA 3BPXA 2VE9A 1T38A 1MDMA 4HNTA 1J59A 4RS8A 1P2FA 3ERED 3Q0UA 4B09A 2BW3B 2RN7A 1D5YA 5EZGA 3Q0VA 1P4AA 4LD5A 3VYSB 4IVNA 1EH8A 2PJPA 3KEQA 3BG3A 1MNEA 1JHHA 4XKVA 2L9SA 5F0CA 5KCMA 5IYCJ 3G1OA 4HEA2 2L7ZA 3KEYA 2EH3A 1XSXA 1ZG5A 2ZSIB 2D45A 2AQFA 2CQQA 3AKZA 4GRIA 2QSHX 2XKPA 3WHCA 3BCAA 3VFZA 1WQ2A 3MMYB 3JR9A 1UMQA 2R7SA 3F72A 1R4NB 4KNYA 2RNJA 3U9GA 2LG4A 2BVLA 3BG5A 2HXOA 2ME0A 5J1UA 5F1RA 4MNUA 5IPAA 2BBYA 3DTKA 2EJRA 2V1UA 2M0CA 3HRSA 3K9TA 5D5VB 4NBQA 4HF1A 1X1DA 1FOWA 1LEBA 3HHGA 2QEXI 1YIOA 5ERIA 2XRLA 2JA5J 1ZRCA 2DXIA 3OY9A 3V7RA 4A3IJ 4G6TB 1HKTA 4FTHA 2WA0A 4BQAA 2CGPA 2ZBKA 4JX4A 2L9RA 4M3GA 4RM3A 3EETA 1VQMI 1RZ4A 3BTCA 2FNPA 2K9SA 2YUSA 2CRGA 1MBFA 4ENNA 1LE8A 3TP0A 1MJAA 5B66C 3I59A 1G8XA 1MSFC 1PUFB 5FLMJ 1W5SA 1ZLJA 2BY0A 2MSYA 3MQ0A 1IN5A 2X6OA 2EZHA 5HS9A 1QA6A 4BQOA 5E3LA 2EQRA 2X1EA 4WXDA 2TCTA 5CJ9A 4P9UA 4WK8F 4FISA 3VYUB 3GZNB 2EZKA 3OYAA 3EUHA 1VQKI 1PDNC 1IRGA 2A6EF 2OF7A 3IKTA 5ILUA 3RQIA 3Q3SA 1PYVA 2E34A 4UY8I 2AO9A 3GFLA 2L7KA 1UCRA 3ROUA 4DJAA 2CUZA 2QYOA 4E7ZA 2X6WA 5TISC 2A6HF 5DDGA 1XDUA 2RQPA 1B4AA 2WTEA 5E1ZB 4F91B 5LGUA 1MMGA 4C2MJ 3CP8A 2D2WA 3KZIC 1SMTA 3PUBA 1HQCA 1I1GA 4R79A 1R5HA 2K9MA 2VODA 1TBXA 2R3SA 3VWBA 3LOCA 4XBFA 3DTEA 4M3BA 3ZQFA 5M3MJ 5FB2A 4DNCA 1GDTA 3MCZA 5DEQA 2ESHA 4G6DA 2CW8A 2WADA 5L3FA 5JR3A 3OOUA 4G12A 3A02A 2K7LA 2CJJA 2EINH 2WC2A 2BZTA 3R0AA 4MFEA 2Y9ZA 3GTGJ 2VBYA 2R7VA 4IPAA 1YX5A 4ZTJA
chains in the Genus database with same CATH topology
5A2QZ 2FOKA 2CSOA 2PN6A 1Z7UA 3WE2A 2X4HA 4Q48A 3MWMA 1O7FA 4OMYA 1R00A 4U88A 1YYVA 4I98B 2XV4S 2KJBA 1O3SA 2Y0MA 2DPUA 3EDPA 1IN7A 4CZZA 5HOOA 1WI9A 5DCMA 1J7KA 4HYEA 4A5MA 4U7BA 3D0SA 2BGCA 3DXJF 3QPTA 1DDNA 1IRFA 2E1NA 4YIFA 2P7VB 2A07F 1FWZA 1YW7A 2PMUA 1UHWA 4RB0A 3GFIA 3K1PA 2VC1A 1LDJA 1XGOA 1BBYA 3E5QA 1S7AA 1YQAA 5CVUA 2KJCA 5K5RA 3R4KA 2DW4A 2RV8A 4LJZF 2HTJA 2P5LC 3QU3A 3JTGA 4KN4X 2YR2A 2L4AA 1BI0A 2VBXA 1FC3A 5LEKA 4L9VA 2A69F 5FO5A 1ZG1A 4N0BA 3D5LA 2DBBA 4MHGA 3SQNA 1U2WA 3TDUC 2K4JA 2EFOA 3RPUA 1EH7A 3KP4A 4MEXF 3IWZA 5CVRA 3RKYA 4BYYA 1U6GA 4EVIA 5E8IA 5D5WB 2Z33A 4EJWA 4LG0B 1B9MA 5HDKA 3ZMZA 1SFXA 1MD0A 1U5TC 3KP5A 3WODF 3I54A 4PGGA 3V8LA 2EK5A 5FGMA 3F8NA 3REOA 4A5NA 1Q1HA 5K5QA 4KA4A 5FFZA 1QGPA 1G4DA 3WGHA 2FEZA 4GYGA 1D3YA 2GQQA 2Z9OA 4MGRA 2C6YA 2YU3A 5E1WA 2IA0A 3M8FA 1Z6RA 2PFBA 3ABTA 3HOTA 2BV6A 4M71A 4AWXB 3GF2A 3E6MA 2CW0F 1AOYA 4RB3C 2OAZA 3O6BB 5AIPA 3H92A 1FSEA 2JZYA 3ISPA 4G94A 3F6VA 4MTDA 1XGMA 3V8JA 1YFHA 5D6EA 1K79A 3IRQA 1D5VA 3FWEA 1V4RA 2OQRA 3N4MA 4HF2A 1LQ1A 3S2WA 3ML6A 2QQ9A 4EGZA 4LK0F 3E6DA 2PLYA 4FX4A 2H94A 2EV0A 4YIIA 1F4KA 3GO5A 2O3FA 2PI0A 2L54A 1KGSA 2HQRA 1LB2A 4EJVA 2CG4A 3J81Z 4KMUX 3BWGA 4JBAA 2RGVA 1S29A 5LHHA 2F5DA 2FQ3A 3TOAA 2COMA 4I0BA 1F5TA 2L02A 5BQTA 4YG2F 1H0MA 4M74A 2F5EA 4XLNF 3FM3A 3B73A 1BOAA 4TV7A 3C7JA 5LEJA 3E5XA 2NNNA 5IT3A 1KYWA 3PFIA 3F3XA 5BPDA 3KZZA 2VC0A 1FPQA 1R36A 2XGXA 3WTVC 1J2XA 3W6JB 1JXSA 4L0YB 5CVVA 3NQOA 2DPDA 5HDNA 1TTYA 3L00A 4IHTA 3QOPA 2BEOA 3CUQB 4EJUA 2MLKA 5JI6A 2H09A 4ZZLA 1CF7A 2P6TA 1X3UA 3KETA 5JHUA 2FMYA 3KP3A 1YW8A 3JTHA 2QENA 2QQAA 5TRDA 1QNTA 2OBPA 1T2KA 3CDHA 2XAQA 2M45A 4HBLA 1LDKB 1ZYRF 1XN7A 2ZNYA 4YFKF 3JAMZ 3ZMUA 3CLOA 2KIFA 3RTRA 1B59A 4Y15A 1IXSB 5D5XB 5D8LB 2IT0A 3T8RA 5DV5A 4RGSA 4Y13A 5LHIA 3F6OA 5D8KB 3QPHA 1K7AA 4UVCA 3DEUA 1IAWA 2V9VA 3V8KA 4I01A 3F8MA 1TQPA 4PZJA 3LSTA 2DO7A 1ZLKA 2VT2A 4I7HA 4LK1F 4G8XA 2UXXA 1I6XA 4OU0A 1CGPA 1ZRDA 5JVTA 3RIRA 1QO0D 4Y17A 5L3DA 2IA2A 3HSRA 1XSDA 4U0VA 4EQQA 3DF8A 1PP7U 2XAJA 4P5OA 5H6QA 4ENJA 2P4WA 4DQ2A 1KQ8A 2IW5A 1Z6TA 3FXQA 2HDCA 3P9KA 2VBWA 4XSZF 1W4MA 3C3WA 3KFWX 5J6XA 1P4XA 3I58A 3Q5FA 2MH2A 3LA7A 3LA2A 2EFWA 5JFRA 4FT8A 4ETSA 2FXAA 2ZO4A 2OZUA 3GUDA 2NAZA 5FLXZ 2MD5A 4OIRF 4BH9A 3E5UA 3KP6A 5CLSA 1S8NA 2UWMA 1BN5A 2Y48A 4HQEA 5E18F 3GVAA 2MA3A 1R5GA 5TJJA 1SD6A 2QM3A 1XD7A 1G3SA 1ZN2A 2LDUA 1S7OA 1IZ1A 4K2EA 2P6SA 4QWQA 1SD4A 5D4SA 3TGNA 5BS6A 2JPBA 4WF2A 2STTA 2EA2A 3GFJA 3RYPA 5DYMA 2IP2A 4RGXA 1S6LA 3TQNA 1P4WA 1RIOH 1SAXA 3FX3A 3GZ5A 3TO9A 2FBHA 5ICFA 3J80Z 3QRFF 4HX4A 4IJAA 4EM2A 1ZH5A 1XSVA 5EEGA 1LEAA 4A0XA 4KDPA 1G6NA 3I4PA 3KCCA 4XLPF 3P7NA 4Q4ZF 2YX4A 4M9XA 1O7LA 4ZYEA 1OKRA 4HX8A 4KT5C 5HLIA 1KYZA 1K78B 4ZYHA 2ISZA 2ADUA 2ETHA 3KLNA 2FA5A 3LQRA 4KYWA 2A61A 2JSCA 3BJAA 1YTYA 5LLQA 1H9TA 3C18A 1F1ZA 2DI3A 4YFXF 4M9SA 3T8TA 5E17F 3K2ZA 3FF5A 1R22A 5ICEA 1ON2A 2V79A 3HUGA 3HSFA 2EV5A 4L5JA 3DV8A 1J75A 2OU2A 5DD4A 2CO5A 4KUMA 1W7PD 3K1MA 3MZHA 1WKMA 4N9IA 2HYFA 3GX4X 1ZGAA 5ED4A 1IN4A 2O0YA 2ELHA 2B0LA 2Z99A 3RPQA 5FD6A 5LGTA 4HW0A 5CYVA 1QZZA 5HS8A 1SFUA 2ESNA 3WU0A 3E6BA 1WRJA 3BZ6A 3CJNA 3I71A 2IJLA 1OR7A 1XGSA 3RDIA 1QZYA 4FHTA 2GWRA 1U5TA 4BNCA 2CQKA 3L7WA 2J5OA 2JPCA 1OPCA 4L9TA 1T6SA 1ZRFA 3KEOA 3T5XA 4OINF 1KA8A 1TQMA 2QWWA 3ZN1A 1OYWA 3ECHA 3TO7A 4UV8A 1ZAOA 5F64A 1AWCA 5DUKA 3V7CA 1HW5A 4ZYGA 3R60A 4LB5A 4UXNA 5DD8A 3JSPA 2DK8A 1J5YA 1LDDA 2FE3A 1J9IA 4ESBA 4L9JA 1TW2A 3RKWA 4G7ZF 3R0JA 2HWVA 4KIGA 2FRHA 2DLLA 1P92A 2JRTA 2GXGA 2GXBA 1TQIA 1FBUA 3SZTA 3JSOA 2G9WA 3DQVC 2NRAC 1YS7A 3SXYA 4UVBA 3G73A 2ZMEB 2FSWA 2MLGA 1YO5C 4O5VA 4EMSA 2BYVE 3VEPA 1D8JA 3GZ6A 1STZA 3RJPA 4Q47A 2MH9A 3LFKA 2JTVA 1HW1A 2M87A 1GHCA 1SD5A 2NS0A 5H6RA 5LBQA 2DK5A 3BP8A 2FU4A 3ECOA 3IHUA 5IT9K 3WE3A 1MGTA 2EFNA 3TKYA 2H27A 3QP5A 1XMAA 2AXLA 5F6FA 2IPQX 2QBYB 3CO7C 4PCQA 3BPVA 1Z9CA 4AIJA 2PEXA 2V1XA 1ZG3A 1O3RA 4BHPA 3DP7A 1QQIA 4HDVA 4L5IA 4GGGA 2EB7A 4RAZA 4AIKA 2X0LA 3OV8A 3WTXC 1IXRC 3LAJA 3MFKA 4LLNA 5HLHA 2M1BA 4RGRA 3TOBA 4HA8A 5FFXA 4HF0A 2G7HA 4PGHA 4NB5A 3EQLF 3LAPA 1BC8C 4ZZDA 2CYYA 3VB2A 4UUVA 2EA4A 2P8TA 4AIHA 3HHHA 4HDUA 3Q9SA 2A68F 2GZWA 4ENMA 1MDMB 2A5YB 5CVIA 2Y75A 4M73A 4EJTA 1FP2A 2MBFA 3Q9VA 5LRSA 4O3MA 1JGSA 4XSXF 4LGWA 3IL2A 4Z2YA 1Y0UA 1ONVA 4CICA 3WU1B 3FMQA 1REPC 3R6SA 4A2UA 1JHFA 1K6OA 5HS7A 4GYIA 4CHUA 4P96A 4LFUA 3ZMSA 4KMFA 3ZMDA 3KE2A 4R1HA 4HOBA 3HRUA 5LGNA 2XIGA 4HLXA 3T1BA 2LSOA 3VOEA 3IKVA 3I64A 3E3VA 2XVCA 2GIVA 4OIOF 1E2XA 4WWCA 4IXAA 5ILSA 3I59B 1FYLA 2HEOA 1T39A 1HKQA 1PUEE 2XAGA 2G7UA 1B6AA 3NEUA 1OMIA 1ZGJA 4A0YA 2VN2A 3COAC 2DFIA 1UHMA 4LMYA 3MZYA 3ZQ7A 3FHZA 5L3BA 4WCGA 3G3ZA 2FF4A 2ACJA 1SD7A 1UFMA 3HTUA 2HGCA 3GEZA 3F8CA 2IRFG 1U3EM 2Q2EA 1B9NA 2OZ6A 2PMHA 5E1XA 5FD5A 1FLIA 4KFCA 1WSUA 3I5UA 4AVPA 1V3FA 4LB6B 5A2QK 2MC3A 1FOKA 4I02A 2TDXA 2QZ8A 2D1HA 3C1DA 2VOOA 5AONA 3ULQB 4JQFA 1RI7A 2PQ8A 3FXRA 5CVJA 4RB1A 1OYIA 4I0AA 3BY6A 3OOPA 4WXCA 5DCMB 1GXQA 1OYYA 3NRVA 1I1SA 1BI2A 4G6QA 1ULYA 1DUXC 3ABUA 5ICCA 4UVAA 4MTEA 1U5TB 3BJ6A 2XKOA 2OQGA 2L4MA 3O2PE 5KVRA 5BPIA 2ZFWA 1FZPB 2VT3A 2GA2A 1TLHB 2HKOA 2W85A 3SFZA 2IA1A 1ON1A 1R58A 4M6XA 2O03A 2LKPA 2E1CA 3RKXA 2QUFA 4M6YA 2KIUA 2DAOA 2HQNA 2HTSA 1S3JA 1HKSA 1RUNA 2H6BA 2PBIA 2AS5F 2HYGD 3ZP5A 1TNSA 1FT9A 1H9GA 1IF1A 4ENKA 4CGZA 5BOXA 4EV0A 1YLFA 1Z1DA 3PQJA 1KQ0A 1KU2A 3RYRA 3CO6C 5D4RA 5L3EA 3DPLC 3K1NA 5HLGA 1FYMA 2H6CA 1DPRA 2F5CA 2ZXJA 4ESFA 5EEHA 1E17A 3CUOA 3B02A 2EFPA 3BJOA 2M5WA 1HSTA 2JT1A 2K4BA 1IN8A 2F5FA 3WTZA 3CUQA 2IVMA 1IXCA 1USTA 2W84A 2ISYA 3L09A 1ODDA 2UZKA 1U78A 4D0PA 1BIBA 5J8CA 2VBZA 2O6GE 1TW3A 5L3GA 4RGUA 5DUIA 4BHBA 3QU6A 3H3UA 3P9IA 2VXZA 2EV6A 4I2OA 3WGGA 2XAFA 4BHCA 4EM1A 1PP8F 4E70A 4CO8A 3IRRA 4MQ9F 1KQ9A 4CXFA 5ILVA 1TNTA 3E97A 3FM5A 4PDKA 4LLLA 3F22A 4ASNA 3HYIA 2HOEA 3K69A 4MEYF 3SZPA 3CTAA 1KU9A 1R7JA 3DPTA 2FBKA 3LA3A 1W7PA 2M8EA 3L2CA 1XDSA 2FMLA 2XHKA 4UV9A 2J5PA 2W24A 1HSJA 1USSA 1J0RA 4P9FA 3QP6A 5BMZA 3V7SA 3CUQC 2OD5A 1GVJA 1UB9A 1BI1A 1LVAA 1KU3A 3GFMA 4HAMA 3J81K 1QPMA 4WX9A 2HFHA 3FMRA 3FXUA 1I27A 2R7FA 1LNWA 3BOQA 3WGIA 3F23A 2YPRA 3KLOA 2V6CA 2WWYA 2FBIA 4H0EA 1MJBA 1G3TA 3ZMTA 4WXHA 1XGNA 2CWEA 1EH6A 4KIFA 2QQBA 3WTYC 2Z3YA 3JW4A 3LWFA 2P7CB 3WTUC 3KP2A 1LJ9A 3VODA 2XROA 1P6RA 2V1DA 2YSRA 2E7XA 2LNBA 4GCVA 2RKHA 1CF7B 4HZFA 1ZHFA 4G7HF 5K5OA 2LF7A 1YS6A 1YG2A 3KZYA 1NHAA 2HZTA 3AAFA 4ON0A 1R1UA 3HTSB 4G9YA 5KK1A 1BIAA 2HR3A 3K0LA 1G3YA 1A04A 2LF8A 3SHFA 3JAMK 2XUBA 4A6EA 2M30A 2KKOA 3GXOA 5D6FA 3EYIA 4A0ZA 4IRGA 4BAYA 2DQLA 3ELKA 4Q5SF 4M72A 4O6JA 1FBSA 4IHSA 3ZPLA 2STWA 1F9NA 1O3QA 4ZYDA 4YFNF 4NHJA 4CYDA 4A6DA 4EGYA 1K78A 1KU7A 3H3ZA 1FX7A 4LLGF 4GO1A 1L0OC 4S04A 2XASA 3I0TA 4F7ZA 3GLXA 6PAXA 3N97A 4B8XA 1MJ9A 2GA1A 2KRFA 2R7DA 1DPUA 2NNYA 4RB2C 2DQRA 3I53A 3QAHA 4QLCU 1ZARA 5D5UB 5E20A 2KIMA 3P9CA 1YW9A 2K86A 3E6CC 3F21A 1FY7A 2O61A 2Q0OA 3IWFA 1BJAA 4JK1X 3TO6A 2EFQA 1IN6A 3M1EA 1ZREA 4HQMA 2L3DA 1L3LA 5L3CA 1RUOA 5H20A 5E8GA 3GWZA 2ZJ2A 2VOPA 3WTSC 1BI3A 1O57A 4U0WA 5ICGA 2HS5A 5FLXK 1HBXG 2W57A 4N9HA 4OIQF 1C0WA 1GXPA 3EYYA 1QBJA 1DP7P 1MKMA 2Q8KA 3F8BA 2PG4A 2CFXA 2WV0A 2W25A 4HV5A 5J8FA 2YX7A 2A3SA 3LQQA 3HOSA 1HW2A 3HIFA 3HRMA 4L9NA 2P5VA 4EJOA 3HSEA 3FMSA 4NQWA 4RAYA 3R61A 5HVQC 3T0YA 5HDGA 4P55A 1XB4A 3W6KB 4OOIA 2XRNA 3RI4A 2E7WA 1EV7A 2RVCA 3MEXA 2XAHA 2ZCWA 1BM9A 4EM0B 1R23A 3J80K 3U2RA 3BDDA 4CDGA 2FNAA 1FSHA 2DT5A 3GW2A 2DU9A 3M9AA 4AD9A 4UNOA 4KN7X 4KIBA 4A12A 5LHGA 1G3WA 3M8EA 1SMYF 3GYHX 5K1YA 4G7OF 1T0FA 1T98A 2D1VA 2F2EA 2QLZA 3TDZC 4LG0A 1WWXA 3WTTC 3J7AO 1HXDA 1IW7F 1O3TA 4M9ZA 2L01A 3BROA 2VE8A 2ZMEA 3HRTA 3O3KA 4XRFA 4ESJA 1VTNC 1R1TA 1R1VA 4I09A 1MZBA 4FX0A 3ZN0A 4R8HA 3F8FA 2K27A 1B1BA 3M7GA 4UHTA 4HV6A 5IT9Z 4S05A 1D8KA 1FYKA 5LRRA 4KICA 3V4GA 2VONA 1XMKA 1W7PB 2OA4A 1XCBA 1FP1D 2P5KA 1Z91A 2GAUA 5DCFA 4OIPF 2QBYA 3U1DA 2UXNA 4IRIA 2HKXA 4MQVA 4BXUA 2K02A 2ZNZA 5AIQA 1W5TA 1RNLA 1Z05A 3DKWA 3PQKA 1I5ZA 3FZVA 4L0ZB 3WTWC 4L18B 4GXOA 2RC4A 3WG9A 2Z5UA 2BE5F 1IUYA 4U7DA 4IF4A 4ZH4F 4HLYA 3DFGA 1JE8A 2RDPA 2ZKZA 3MAJA 3L9FA 3ZMVA 1U8RA 2DTRA 2O8XA 2EWNA 2QVOA 4IRHA 3KP7A 4OMZA 1BC7C 1FBQA 2NYXA 4U0YA 3IC7A 1FNNA 4HX7A 1SFEA 1XCVA 3BPXA 2VE9A 1T38A 1MDMA 1J59A 4RS8A 1P2FA 3ERED 4B09A 2RN7A 1P4AA 4LD5A 4IVNA 1EH8A 2PJPA 3KEQA 1JHHA 1XSXA 1ZG5A 2D45A 2XKPA 3VFZA 1WQ2A 3F72A 4KNYA 2RNJA 3U9GA 5F1RA 4MNUA 2BBYA 2EJRA 2V1UA 3HRSA 3K9TA 5D5VB 4HF1A 1LEBA 3HHGA 1YIOA 5ERIA 1ZRCA 3V7RA 1HKTA 4BQAA 2CGPA 2ZBKA 3EETA 1RZ4A 2FNPA 4ENNA 1MJAA 3I59A 1W5SA 1ZLJA 3MQ0A 1IN5A 5HS9A 4WXDA 5CJ9A 4P9UA 4WK8F 3EUHA 1PDNC 1IRGA 2A6EF 3IKTA 5ILUA 3GFLA 3ROUA 1UCRA 2QYOA 2A6HF 5DDGA 1XDUA 2RQPA 1B4AA 2WTEA 5E1ZB 5LGUA 2D2WA 1SMTA 4R79A 1HQCA 1I1GA 1R5HA 2VODA 1TBXA 2R3SA 4XBFA 5FB2A 4DNCA 3MCZA 5DEQA 2ESHA 4G6DA 5L3FA 5JR3A 2K7LA 3R0AA 2WC2A 2VBYA 4IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q Z;  2FOK A;  2CSO A;  2PN6 A;  1Z7U A;  3WE2 A;  2X4H A;  4Q48 A;  3MWM A;  1O7F A;  4OMY A;  1R00 A;  4U88 A;  1YYV A;  4I98 B;  2XV4 S;  2KJB A;  1O3S A;  2Y0M A;  2DPU A;  3EDP A;  1IN7 A;  4CZZ A;  5HOO A;  1WI9 A;  5DCM A;  1J7K A;  4HYE A;  4A5M A;  4U7B A;  3D0S A;  2BGC A;  3DXJ F;  3QPT A;  1DDN A;  1IRF A;  2E1N A;  4YIF A;  2P7V B;  2A07 F;  1FWZ A;  1YW7 A;  2PMU A;  1UHW A;  4RB0 A;  3GFI A;  3K1P A;  2VC1 A;  1LDJ A;  1XGO A;  1BBY A;  3E5Q A;  1S7A A;  1YQA A;  5CVU A;  2KJC A;  5K5R A;  3R4K A;  2DW4 A;  2RV8 A;  4LJZ F;  2HTJ A;  2P5L C;  3QU3 A;  3JTG A;  4KN4 X;  2YR2 A;  2L4A A;  1BI0 A;  2VBX A;  1FC3 A;  5LEK A;  4L9V A;  2A69 F;  5FO5 A;  1ZG1 A;  4N0B A;  3D5L A;  2DBB A;  4MHG A;  3SQN A;  1U2W A;  3TDU C;  2K4J A;  2EFO A;  3RPU A;  1EH7 A;  3KP4 A;  4MEX F;  3IWZ A;  5CVR A;  3RKY A;  4BYY A;  1U6G A;  4EVI A;  5E8I A;  5D5W B;  2Z33 A;  4EJW A;  4LG0 B;  1B9M A;  5HDK A;  3ZMZ A;  1SFX A;  1MD0 A;  1U5T C;  3KP5 A;  3WOD F;  3I54 A;  4PGG A;  3V8L A;  2EK5 A;  5FGM A;  3F8N A;  3REO A;  4A5N A;  1Q1H A;  5K5Q A;  4KA4 A;  5FFZ A;  1QGP A;  1G4D A;  3WGH A;  2FEZ A;  4GYG A;  1D3Y A;  2GQQ A;  2Z9O A;  4MGR A;  2C6Y A;  2YU3 A;  5E1W A;  2IA0 A;  3M8F A;  1Z6R A;  2PFB A;  3ABT A;  3HOT A;  2BV6 A;  4M71 A;  4AWX B;  3GF2 A;  3E6M A;  2CW0 F;  1AOY A;  4RB3 C;  2OAZ A;  3O6B B;  5AIP A;  3H92 A;  1FSE A;  2JZY A;  3ISP A;  4G94 A;  3F6V A;  4MTD A;  1XGM A;  3V8J A;  1YFH A;  5D6E A;  1K79 A;  3IRQ A;  1D5V A;  3FWE A;  1V4R A;  2OQR A;  3N4M A;  4HF2 A;  1LQ1 A;  3S2W A;  3ML6 A;  2QQ9 A;  4EGZ A;  4LK0 F;  3E6D A;  2PLY A;  4FX4 A;  2H94 A;  2EV0 A;  4YII A;  1F4K A;  3GO5 A;  2O3F A;  2PI0 A;  2L54 A;  1KGS A;  2HQR A;  1LB2 A;  4EJV A;  2CG4 A;  3J81 Z;  4KMU X;  3BWG A;  4JBA A;  2RGV A;  1S29 A;  5LHH A;  2F5D A;  2FQ3 A;  3TOA A;  2COM A;  4I0B A;  1F5T A;  2L02 A;  5BQT A;  4YG2 F;  1H0M A;  4M74 A;  2F5E A;  4XLN F;  3FM3 A;  3B73 A;  1BOA A;  4TV7 A;  3C7J A;  5LEJ A;  3E5X A;  2NNN A;  5IT3 A;  1KYW A;  3PFI A;  3F3X A;  5BPD A;  3KZZ A;  2VC0 A;  1FPQ A;  1R36 A;  2XGX A;  3WTV C;  1J2X A;  3W6J B;  1JXS A;  4L0Y B;  5CVV A;  3NQO A;  2DPD A;  5HDN A;  1TTY A;  3L00 A;  4IHT A;  3QOP A;  2BEO A;  3CUQ B;  4EJU A;  2MLK A;  5JI6 A;  2H09 A;  4ZZL A;  1CF7 A;  2P6T A;  1X3U A;  3KET A;  5JHU A;  2FMY A;  3KP3 A;  1YW8 A;  3JTH A;  2QEN A;  2QQA A;  5TRD A;  1QNT A;  2OBP A;  1T2K A;  3CDH A;  2XAQ A;  2M45 A;  4HBL A;  1LDK B;  1ZYR F;  1XN7 A;  2ZNY A;  4YFK F;  3JAM Z;  3ZMU A;  3CLO A;  2KIF A;  3RTR A;  1B59 A;  4Y15 A;  1IXS B;  5D5X B;  5D8L B;  2IT0 A;  3T8R A;  5DV5 A;  4RGS A;  4Y13 A;  5LHI A;  3F6O A;  5D8K B;  3QPH A;  1K7A A;  4UVC A;  3DEU A;  1IAW A;  2V9V A;  3V8K A;  4I01 A;  3F8M A;  1TQP A;  4PZJ A;  3LST A;  2DO7 A;  1ZLK A;  2VT2 A;  4I7H A;  4LK1 F;  4G8X A;  2UXX A;  1I6X A;  4OU0 A;  1CGP A;  1ZRD A;  5JVT A;  3RIR A;  1QO0 D;  4Y17 A;  5L3D A;  2IA2 A;  3HSR A;  1XSD A;  4U0V A;  4EQQ A;  3DF8 A;  1PP7 U;  2XAJ A;  4P5O A;  5H6Q A;  4ENJ A;  2P4W A;  4DQ2 A;  1KQ8 A;  2IW5 A;  1Z6T A;  3FXQ A;  2HDC A;  3P9K A;  2VBW A;  4XSZ F;  1W4M A;  3C3W A;  3KFW X;  5J6X A;  1P4X A;  3I58 A;  3Q5F A;  2MH2 A;  3LA7 A;  3LA2 A;  2EFW A;  5JFR A;  4FT8 A;  4ETS A;  2FXA A;  2ZO4 A;  2OZU A;  3GUD A;  2NAZ A;  5FLX Z;  2MD5 A;  4OIR F;  4BH9 A;  3E5U A;  3KP6 A;  5CLS A;  1S8N A;  2UWM A;  1BN5 A;  2Y48 A;  4HQE A;  5E18 F;  3GVA A;  2MA3 A;  1R5G A;  5TJJ A;  1SD6 A;  2QM3 A;  1XD7 A;  1G3S A;  1ZN2 A;  2LDU A;  1S7O A;  1IZ1 A;  4K2E A;  2P6S A;  4QWQ A;  1SD4 A;  5D4S A;  3TGN A;  5BS6 A;  2JPB A;  4WF2 A;  2STT A;  2EA2 A;  3GFJ A;  3RYP A;  5DYM A;  2IP2 A;  4RGX A;  1S6L A;  3TQN A;  1P4W A;  1RIO H;  1SAX A;  3FX3 A;  3GZ5 A;  3TO9 A;  2FBH A;  5ICF A;  3J80 Z;  3QRF F;  4HX4 A;  4IJA A;  4EM2 A;  1ZH5 A;  1XSV A;  5EEG A;  1LEA A;  4A0X A;  4KDP A;  1G6N A;  3I4P A;  3KCC A;  4XLP F;  3P7N A;  4Q4Z F;  2YX4 A;  4M9X A;  1O7L A;  4ZYE A;  1OKR A;  4HX8 A;  4KT5 C;  5HLI A;  1KYZ A;  1K78 B;  4ZYH A;  2ISZ A;  2ADU A;  2ETH A;  3KLN A;  2FA5 A;  3LQR A;  4KYW A;  2A61 A;  2JSC A;  3BJA A;  1YTY A;  5LLQ A;  1H9T A;  3C18 A;  1F1Z A;  2DI3 A;  4YFX F;  4M9S A;  3T8T A;  5E17 F;  3K2Z A;  3FF5 A;  1R22 A;  5ICE A;  1ON2 A;  2V79 A;  3HUG A;  3HSF A;  2EV5 A;  4L5J A;  3DV8 A;  1J75 A;  2OU2 A;  5DD4 A;  2CO5 A;  4KUM A;  1W7P D;  3K1M A;  3MZH A;  1WKM A;  4N9I A;  2HYF A;  3GX4 X;  1ZGA A;  5ED4 A;  1IN4 A;  2O0Y A;  2ELH A;  2B0L A;  2Z99 A;  3RPQ A;  5FD6 A;  5LGT A;  4HW0 A;  5CYV A;  1QZZ A;  5HS8 A;  1SFU A;  2ESN A;  3WU0 A;  3E6B A;  1WRJ A;  3BZ6 A;  3CJN A;  3I71 A;  2IJL A;  1OR7 A;  1XGS A;  3RDI A;  1QZY A;  4FHT A;  2GWR A;  1U5T A;  4BNC A;  2CQK A;  3L7W A;  2J5O A;  2JPC A;  1OPC A;  4L9T A;  1T6S A;  1ZRF A;  3KEO A;  3T5X A;  4OIN F;  1KA8 A;  1TQM A;  2QWW A;  3ZN1 A;  1OYW A;  3ECH A;  3TO7 A;  4UV8 A;  1ZAO A;  5F64 A;  1AWC A;  5DUK A;  3V7C A;  1HW5 A;  4ZYG A;  3R60 A;  4LB5 A;  4UXN A;  5DD8 A;  3JSP A;  2DK8 A;  1J5Y A;  1LDD A;  2FE3 A;  1J9I A;  4ESB A;  4L9J A;  1TW2 A;  3RKW A;  4G7Z F;  3R0J A;  2HWV A;  4KIG A;  2FRH A;  2DLL A;  1P92 A;  2JRT A;  2GXG A;  2GXB A;  1TQI A;  1FBU A;  3SZT A;  3JSO A;  2G9W A;  3DQV C;  2NRA C;  1YS7 A;  3SXY A;  4UVB A;  3G73 A;  2ZME B;  2FSW A;  2MLG A;  1YO5 C;  4O5V A;  4EMS A;  2BYV E;  3VEP A;  1D8J A;  3GZ6 A;  1STZ A;  3RJP A;  4Q47 A;  2MH9 A;  3LFK A;  2JTV A;  1HW1 A;  2M87 A;  1GHC A;  1SD5 A;  2NS0 A;  5H6R A;  5LBQ A;  2DK5 A;  3BP8 A;  2FU4 A;  3ECO A;  3IHU A;  5IT9 K;  3WE3 A;  1MGT A;  2EFN A;  3TKY A;  2H27 A;  3QP5 A;  1XMA A;  2AXL A;  5F6F A;  2IPQ X;  2QBY B;  3CO7 C;  4PCQ A;  3BPV A;  1Z9C A;  4AIJ A;  2PEX A;  2V1X A;  1ZG3 A;  1O3R A;  4BHP A;  3DP7 A;  1QQI A;  4HDV A;  4L5I A;  4GGG A;  2EB7 A;  4RAZ A;  4AIK A;  2X0L A;  3OV8 A;  3WTX C;  1IXR C;  3LAJ A;  3MFK A;  4LLN A;  5HLH A;  2M1B A;  4RGR A;  3TOB A;  4HA8 A;  5FFX A;  4HF0 A;  2G7H A;  4PGH A;  4NB5 A;  3EQL F;  3LAP A;  1BC8 C;  4ZZD A;  2CYY A;  3VB2 A;  4UUV A;  2EA4 A;  2P8T A;  4AIH A;  3HHH A;  4HDU A;  3Q9S A;  2A68 F;  2GZW A;  4ENM A;  1MDM B;  2A5Y B;  5CVI A;  2Y75 A;  4M73 A;  4EJT A;  1FP2 A;  2MBF A;  3Q9V A;  5LRS A;  4O3M A;  1JGS A;  4XSX F;  4LGW A;  3IL2 A;  4Z2Y A;  1Y0U A;  1ONV A;  4CIC A;  3WU1 B;  3FMQ A;  1REP C;  3R6S A;  4A2U A;  1JHF A;  1K6O A;  5HS7 A;  4GYI A;  4CHU A;  4P96 A;  4LFU A;  3ZMS A;  4KMF A;  3ZMD A;  3KE2 A;  4R1H A;  4HOB A;  3HRU A;  5LGN A;  2XIG A;  4HLX A;  3T1B A;  2LSO A;  3VOE A;  3IKV A;  3I64 A;  3E3V A;  2XVC A;  2GIV A;  4OIO F;  1E2X A;  4WWC A;  4IXA A;  5ILS A;  3I59 B;  1FYL A;  2HEO A;  1T39 A;  1HKQ A;  1PUE E;  2XAG A;  2G7U A;  1B6A A;  3NEU A;  1OMI A;  1ZGJ A;  4A0Y A;  2VN2 A;  3COA C;  2DFI A;  1UHM A;  4LMY A;  3MZY A;  3ZQ7 A;  3FHZ A;  5L3B A;  4WCG A;  3G3Z A;  2FF4 A;  2ACJ A;  1SD7 A;  1UFM A;  3HTU A;  2HGC A;  3GEZ A;  3F8C A;  2IRF G;  1U3E M;  2Q2E A;  1B9N A;  2OZ6 A;  2PMH A;  5E1X A;  5FD5 A;  1FLI A;  4KFC A;  1WSU A;  3I5U A;  4AVP A;  1V3F A;  4LB6 B;  5A2Q K;  2MC3 A;  1FOK A;  4I02 A;  2TDX A;  2QZ8 A;  2D1H A;  3C1D A;  2VOO A;  5AON A;  3ULQ B;  4JQF A;  1RI7 A;  2PQ8 A;  3FXR A;  5CVJ A;  4RB1 A;  1OYI A;  4I0A A;  3BY6 A;  3OOP A;  4WXC A;  5DCM B;  1GXQ A;  1OYY A;  3NRV A;  1I1S A;  1BI2 A;  4G6Q A;  1ULY A;  1DUX C;  3ABU A;  5ICC A;  4UVA A;  4MTE A;  1U5T B;  3BJ6 A;  2XKO A;  2OQG A;  2L4M A;  3O2P E;  5KVR A;  5BPI A;  2ZFW A;  1FZP B;  2VT3 A;  2GA2 A;  1TLH B;  2HKO A;  2W85 A;  3SFZ A;  2IA1 A;  1ON1 A;  1R58 A;  4M6X A;  2O03 A;  2LKP A;  2E1C A;  3RKX A;  2QUF A;  4M6Y A;  2KIU A;  2DAO A;  2HQN A;  2HTS A;  1S3J A;  1HKS A;  1RUN A;  2H6B A;  2PBI A;  2AS5 F;  2HYG D;  3ZP5 A;  1TNS A;  1FT9 A;  1H9G A;  1IF1 A;  4ENK A;  4CGZ A;  5BOX A;  4EV0 A;  1YLF A;  1Z1D A;  3PQJ A;  1KQ0 A;  1KU2 A;  3RYR A;  3CO6 C;  5D4R A;  5L3E A;  3DPL C;  3K1N A;  5HLG A;  1FYM A;  2H6C A;  1DPR A;  2F5C A;  2ZXJ A;  4ESF A;  5EEH A;  1E17 A;  3CUO A;  3B02 A;  2EFP A;  3BJO A;  2M5W A;  1HST A;  2JT1 A;  2K4B A;  1IN8 A;  2F5F A;  3WTZ A;  3CUQ A;  2IVM A;  1IXC A;  1UST A;  2W84 A;  2ISY A;  3L09 A;  1ODD A;  2UZK A;  1U78 A;  4D0P A;  1BIB A;  5J8C A;  2VBZ A;  2O6G E;  1TW3 A;  5L3G A;  4RGU A;  5DUI A;  4BHB A;  3QU6 A;  3H3U A;  3P9I A;  2VXZ A;  2EV6 A;  4I2O A;  3WGG A;  2XAF A;  4BHC A;  4EM1 A;  1PP8 F;  4E70 A;  4CO8 A;  3IRR A;  4MQ9 F;  1KQ9 A;  4CXF A;  5ILV A;  1TNT A;  3E97 A;  3FM5 A;  4PDK A;  4LLL A;  3F22 A;  4ASN A;  3HYI A;  2HOE A;  3K69 A;  4MEY F;  3SZP A;  3CTA A;  1KU9 A;  1R7J A;  3DPT A;  2FBK A;  3LA3 A;  1W7P A;  2M8E A;  3L2C A;  1XDS A;  2FML A;  2XHK A;  4UV9 A;  2J5P A;  2W24 A;  1HSJ A;  1USS A;  1J0R A;  4P9F A;  3QP6 A;  5BMZ A;  3V7S A;  3CUQ C;  2OD5 A;  1GVJ A;  1UB9 A;  1BI1 A;  1LVA A;  1KU3 A;  3GFM A;  4HAM A;  3J81 K;  1QPM A;  4WX9 A;  2HFH A;  3FMR A;  3FXU A;  1I27 A;  2R7F A;  1LNW A;  3BOQ A;  3WGI A;  3F23 A;  2YPR A;  3KLO A;  2V6C A;  2WWY A;  2FBI A;  4H0E A;  1MJB A;  1G3T A;  3ZMT A;  4WXH A;  1XGN A;  2CWE A;  1EH6 A;  4KIF A;  2QQB A;  3WTY C;  2Z3Y A;  3JW4 A;  3LWF A;  2P7C B;  3WTU C;  3KP2 A;  1LJ9 A;  3VOD A;  2XRO A;  1P6R A;  2V1D A;  2YSR A;  2E7X A;  2LNB A;  4GCV A;  2RKH A;  1CF7 B;  4HZF A;  1ZHF A;  4G7H F;  5K5O A;  2LF7 A;  1YS6 A;  1YG2 A;  3KZY A;  1NHA A;  2HZT A;  3AAF A;  4ON0 A;  1R1U A;  3HTS B;  4G9Y A;  5KK1 A;  1BIA A;  2HR3 A;  3K0L A;  1G3Y A;  1A04 A;  2LF8 A;  3SHF A;  3JAM K;  2XUB A;  4A6E A;  2M30 A;  2KKO A;  3GXO A;  5D6F A;  3EYI A;  4A0Z A;  4IRG A;  4BAY A;  2DQL A;  3ELK A;  4Q5S F;  4M72 A;  4O6J A;  1FBS A;  4IHS A;  3ZPL A;  2STW A;  1F9N A;  1O3Q A;  4ZYD A;  4YFN F;  4NHJ A;  4CYD A;  4A6D A;  4EGY A;  1K78 A;  1KU7 A;  3H3Z A;  1FX7 A;  4LLG F;  4GO1 A;  1L0O C;  4S04 A;  2XAS A;  3I0T A;  4F7Z A;  3GLX A;  6PAX A;  3N97 A;  4B8X A;  1MJ9 A;  2GA1 A;  2KRF A;  2R7D A;  1DPU A;  2NNY A;  4RB2 C;  2DQR A;  3I53 A;  3QAH A;  4QLC U;  1ZAR A;  5D5U B;  5E20 A;  2KIM A;  3P9C A;  1YW9 A;  2K86 A;  3E6C C;  3F21 A;  1FY7 A;  2O61 A;  2Q0O A;  3IWF A;  1BJA A;  4JK1 X;  3TO6 A;  2EFQ A;  1IN6 A;  3M1E A;  1ZRE A;  4HQM A;  2L3D A;  1L3L A;  5L3C A;  1RUO A;  5H20 A;  5E8G A;  3GWZ A;  2ZJ2 A;  2VOP A;  3WTS C;  1BI3 A;  1O57 A;  4U0W A;  5ICG A;  2HS5 A;  5FLX K;  1HBX G;  2W57 A;  4N9H A;  4OIQ F;  1C0W A;  1GXP A;  3EYY A;  1QBJ A;  1DP7 P;  1MKM A;  2Q8K A;  3F8B A;  2PG4 A;  2CFX A;  2WV0 A;  2W25 A;  4HV5 A;  5J8F A;  2YX7 A;  2A3S A;  3LQQ A;  3HOS A;  1HW2 A;  3HIF A;  3HRM A;  4L9N A;  2P5V A;  4EJO A;  3HSE A;  3FMS A;  4NQW A;  4RAY A;  3R61 A;  5HVQ C;  3T0Y A;  5HDG A;  4P55 A;  1XB4 A;  3W6K B;  4OOI A;  2XRN A;  3RI4 A;  2E7W A;  1EV7 A;  2RVC A;  3MEX A;  2XAH A;  2ZCW A;  1BM9 A;  4EM0 B;  1R23 A;  3J80 K;  3U2R A;  3BDD A;  4CDG A;  2FNA A;  1FSH A;  2DT5 A;  3GW2 A;  2DU9 A;  3M9A A;  4AD9 A;  4UNO A;  4KN7 X;  4KIB A;  4A12 A;  5LHG A;  1G3W A;  3M8E A;  1SMY F;  3GYH X;  5K1Y A;  4G7O F;  1T0F A;  1T98 A;  2D1V A;  2F2E A;  2QLZ A;  3TDZ C;  4LG0 A;  1WWX A;  3WTT C;  3J7A O;  1HXD A;  1IW7 F;  1O3T A;  4M9Z A;  2L01 A;  3BRO A;  2VE8 A;  2ZME A;  3HRT A;  3O3K A;  4XRF A;  4ESJ A;  1VTN C;  1R1T A;  1R1V A;  4I09 A;  1MZB A;  4FX0 A;  3ZN0 A;  4R8H A;  3F8F A;  2K27 A;  1B1B A;  3M7G A;  4UHT A;  4HV6 A;  5IT9 Z;  4S05 A;  1D8K A;  1FYK A;  5LRR A;  4KIC A;  3V4G A;  2VON A;  1XMK A;  1W7P B;  2OA4 A;  1XCB A;  1FP1 D;  2P5K A;  1Z91 A;  2GAU A;  5DCF A;  4OIP F;  2QBY A;  3U1D A;  2UXN A;  4IRI A;  2HKX A;  4MQV A;  4BXU A;  2K02 A;  2ZNZ A;  5AIQ A;  1W5T A;  1RNL A;  1Z05 A;  3DKW A;  3PQK A;  1I5Z A;  3FZV A;  4L0Z B;  3WTW C;  4L18 B;  4GXO A;  2RC4 A;  3WG9 A;  2Z5U A;  2BE5 F;  1IUY A;  4U7D A;  4IF4 A;  4ZH4 F;  4HLY A;  3DFG A;  1JE8 A;  2RDP A;  2ZKZ A;  3MAJ A;  3L9F A;  3ZMV A;  1U8R A;  2DTR A;  2O8X A;  2EWN A;  2QVO A;  4IRH A;  3KP7 A;  4OMZ A;  1BC7 C;  1FBQ A;  2NYX A;  4U0Y A;  3IC7 A;  1FNN A;  4HX7 A;  1SFE A;  1XCV A;  3BPX A;  2VE9 A;  1T38 A;  1MDM A;  1J59 A;  4RS8 A;  1P2F A;  3ERE D;  4B09 A;  2RN7 A;  1P4A A;  4LD5 A;  4IVN A;  1EH8 A;  2PJP A;  3KEQ A;  1JHH A;  1XSX A;  1ZG5 A;  2D45 A;  2XKP A;  3VFZ A;  1WQ2 A;  3F72 A;  4KNY A;  2RNJ A;  3U9G A;  5F1R A;  4MNU A;  2BBY A;  2EJR A;  2V1U A;  3HRS A;  3K9T A;  5D5V B;  4HF1 A;  1LEB A;  3HHG A;  1YIO A;  5ERI A;  1ZRC A;  3V7R A;  1HKT A;  4BQA A;  2CGP A;  2ZBK A;  3EET A;  1RZ4 A;  2FNP A;  4ENN A;  1MJA A;  3I59 A;  1W5S A;  1ZLJ A;  3MQ0 A;  1IN5 A;  5HS9 A;  4WXD A;  5CJ9 A;  4P9U A;  4WK8 F;  3EUH A;  1PDN C;  1IRG A;  2A6E F;  3IKT A;  5ILU A;  3GFL A;  3ROU A;  1UCR A;  2QYO A;  2A6H F;  5DDG A;  1XDU A;  2RQP A;  1B4A A;  2WTE A;  5E1Z B;  5LGU A;  2D2W A;  1SMT A;  4R79 A;  1HQC A;  1I1G A;  1R5H A;  2VOD A;  1TBX A;  2R3S A;  4XBF A;  5FB2 A;  4DNC A;  3MCZ A;  5DEQ A;  2ESH A;  4G6D A;  5L3F A;  5JR3 A;  2K7L A;  3R0A A;  2WC2 A;  2VBY A;  4IPA A; 
#chains in the Genus database with same CATH topology
 5A2Q Z;  1MH3 A;  2FOK A;  2ZFU A;  2CSO A;  2K3P A;  5KAF C;  3PIP F;  4M3F A;  4Y4R A;  2M7B A;  3S3N A;  2PN6 A;  1SFK A;  2LBF A;  5FKK A;  1Z7U A;  1X1C A;  4EAT A;  3WE2 A;  2X4H A;  4Q48 A;  3MWM A;  3ZQQ A;  1NG6 A;  3SFI A;  1O7F A;  3M8J A;  3TED A;  1HCR A;  4OMY A;  1FEX A;  2VJ4 A;  1R00 A;  2PX9 A;  2E5Z A;  4U88 A;  4BBS J;  1YYV A;  5EG0 A;  4I98 B;  4IHX A;  4BXX J;  1WJF A;  1X3Z B;  2XV4 S;  4II3 A;  2NXN B;  1IRX A;  2DDA A;  2KJB A;  1O3S A;  2R7X A;  1UHS A;  3WHB A;  3K4J A;  2Y0M A;  2DPU A;  3EDP A;  1IN7 A;  4CZZ A;  5HOO A;  3K10 A;  1WI9 A;  1V55 H;  1V5F A;  2R0Q C;  1RRJ A;  5DCM A;  4IQJ A;  2BXZ A;  1J7K A;  2BY3 A;  4HYE A;  4A5M A;  4U7B A;  1POG A;  3D0S A;  2BGC A;  3DXJ F;  2E1M C;  3QPT A;  1IRF A;  4L5E A;  4A3F J;  1DDN A;  2E1N A;  1VQ9 I;  4YIF A;  2P7V B;  2A07 F;  4LIV A;  1FWZ A;  1OCZ H;  4DYQ A;  1YW7 A;  2PMU A;  1UHW A;  3J7A Y;  4PJJ A;  4RB0 A;  3H35 A;  3CJT B;  3GFI A;  2XGE A;  3K1P A;  4J19 A;  2VC1 A;  4RLF A;  1LDJ A;  4NC8 A;  1XGO A;  1BBY A;  3E5Q A;  2K5C A;  1S7A A;  1YQA A;  1MBH A;  4C3I J;  5CVU A;  2UV1 A;  4MO7 A;  2Z2S B;  3AG4 H;  5J47 A;  2KJC A;  5K5R A;  3R4K A;  2DW4 A;  2RV8 A;  4LJZ F;  3TMO A;  1R49 A;  2DA7 A;  1WGX A;  2LRE A;  2HTJ A;  3GTL J;  1A6I A;  2P5L C;  3QU3 A;  3J7Y J;  1Q1V A;  3JTG A;  3I4M J;  4KN4 X;  4XK4 A;  2YR2 A;  2L4A A;  2PJR A;  3QYB A;  1SVM A;  1BI0 A;  2VBX A;  3MKZ A;  4FE4 A;  3KIO A;  1FC3 A;  1HA8 A;  3CP2 A;  3PSI A;  5LEK A;  4L9V A;  3PNV A;  2A69 F;  5K7H A;  1ZK8 A;  3A1Y A;  5FO5 A;  3IAS 2;  1ZG1 A;  4N0B A;  2DOD A;  4PUS A;  3D5L A;  1ETX A;  1FOY A;  2DBB A;  1R71 A;  3OIP A;  4MHG A;  2JA2 A;  2W4S A;  3SQN A;  1U2W A;  3TDU C;  1OQY A;  1E3P A;  2K4J A;  2I5U A;  2COB A;  3UR3 C;  5M5X J;  1IC8 A;  2EFO A;  2JJ7 A;  4XID A;  3ASN H;  3RPU A;  3HOV J;  1EH7 A;  2V1N A;  3KP4 A;  4MEX F;  3IWZ A;  5CVR A;  3RKY A;  3BG9 A;  4BYY A;  1U6G A;  1B8I B;  4EVI A;  5E8I A;  5D5W B;  1IG7 A;  2Z33 A;  5FRO A;  2KQR A;  4EJW A;  4LG0 B;  1B9M A;  1WJC A;  5HDK A;  3W6V A;  2B63 J;  3ZMZ A;  1X1B A;  1SFX A;  1MD0 A;  1U5T C;  3KP5 A;  1GVD A;  3WOD F;  1P7I A;  3I54 A;  4PGG A;  4XLA A;  3LMM A;  3QQA A;  3V8L A;  1W36 D;  2EK5 A;  5FGM A;  4B47 A;  2KMU A;  3F8N A;  3REO A;  5FJ8 J;  2XF6 A;  4A5N A;  1Q1H A;  2CUJ A;  2Q2E B;  2ZSH B;  5K5Q A;  4KA4 A;  3NWT A;  2DMQ A;  5EEA A;  3K4C A;  1T56 A;  2IXS A;  1FJL A;  1MW7 A;  2Y30 A;  5FFZ A;  4C3J J;  1QGP A;  5M5Y J;  1G4D A;  2O7O A;  2BHZ A;  2VAS A;  3WGH A;  1D1A A;  2BXY A;  2FEZ A;  4ZDO A;  3BG6 A;  4GYG A;  1D3Y A;  2GQQ A;  2Z9O A;  1JT6 A;  4MGR A;  2C6Y A;  1QHG A;  2YU3 A;  3D1N I;  2VKD A;  2DCE A;  2IA0 A;  5E1W A;  3QYE A;  1E3H A;  3M8F A;  1Z6R A;  2PFB A;  2K85 A;  3ABT A;  1YJN I;  3HOT A;  2BV6 A;  4M71 A;  4AWX B;  3GF2 A;  4E7H A;  4PJ0 C;  2DJN A;  3E6M A;  4XLF A;  2L7M P;  2CW0 F;  2JUG A;  4RBO A;  1AOY A;  4RB3 C;  2OAZ A;  3O6B B;  5FKN A;  5AIP A;  5B1B H;  1X1P A;  1VI0 A;  3FXL A;  3H92 A;  1Y1V J;  2X51 A;  3GTQ J;  3C2G A;  1YIJ I;  1FSE A;  3BR3 A;  2JZY A;  1YE9 A;  1T95 A;  2XPV A;  1SEU A;  2F5V A;  3ISP A;  4IOC F;  4G94 A;  5B3S H;  3F6V A;  5KHD A;  1XGM A;  3V8J A;  4MTD A;  1GV5 A;  1YFH A;  3HOZ J;  5D6E A;  3HGG A;  4DZP A;  5M5W J;  1K79 A;  3IRQ A;  1D5V A;  2JMW A;  3FWE A;  2ELK A;  1V4R A;  3VSK A;  1LKX A;  2OQR A;  3AG2 H;  3N4M A;  4HF2 A;  3ONQ A;  1LQ1 A;  2F48 A;  1DQU A;  3TL4 X;  2VPL A;  3LSG A;  4ZYA A;  3S2W A;  3ML6 A;  3OYC A;  2QQ9 A;  2XC7 A;  2R5Y B;  1SVO A;  4EGZ A;  4LK0 F;  2KIQ A;  3E6D A;  2PLY A;  4XLE A;  3SZG A;  4FX4 A;  2H94 A;  2EV0 A;  2BVM A;  1W36 C;  4YII A;  1MSE C;  1F4K A;  1ERD A;  3GO5 A;  2O3F A;  3CES A;  5EZH A;  3SDB A;  5B1A H;  2PI0 A;  2L54 A;  3LSI A;  3K2A A;  3NWS A;  1KGS A;  3H36 A;  2HYJ A;  3DTI A;  2HQR A;  3HDD A;  1LB2 A;  4EJV A;  2CG4 A;  3J81 Z;  2VKV A;  4KMU X;  1DP3 A;  4CCM A;  3TW6 A;  1QVU A;  3BWG A;  3O8G A;  4JBA A;  2RGV A;  1VFC A;  1S29 A;  2E36 A;  5LHH A;  2F5D A;  2FQ3 A;  3TOA A;  2QF7 A;  2Y2Z A;  2X6Y A;  2OC6 A;  1R5I D;  2COM A;  4I0B A;  1F5T A;  2WB1 A;  1W5C C;  2L02 A;  4QPQ A;  5BQT A;  4YG2 F;  1H0M A;  2MYS A;  4M74 A;  2F5E A;  4XLN F;  3FM3 A;  2ID3 A;  4DYR A;  3B73 A;  2X6X A;  4M3E A;  3OYB A;  1BOA A;  4XR6 A;  3S2H J;  4TV7 A;  1ITY A;  1T33 A;  3C7J A;  5LEJ A;  1VQ4 I;  4BUP A;  2DMN A;  1ETK A;  2XPU A;  3E5X A;  2NNN A;  3ASO H;  2ELJ A;  5IT3 A;  1Y1W J;  1KYW A;  3PFI A;  2LTP A;  4Y33 A;  3U1K A;  2VJ5 A;  3F3X A;  5BPD A;  3KZZ A;  1DU6 A;  2VC0 A;  3BZK A;  4LIT A;  1FPQ A;  3KPH A;  1R36 A;  2XGX A;  3MKY B;  1D0X A;  1EJ9 A;  2NVU B;  3WTV C;  1J2X A;  3W6J B;  3ZXS A;  1JXS A;  4L0Y B;  1VND A;  1Z77 A;  5E3M A;  5CVV A;  3NQO A;  2Y9Y A;  2DPD A;  5HDN A;  1TTY A;  3L00 A;  4V2G A;  4IHT A;  3QOP A;  2VJJ A;  2IS4 A;  2BEO A;  3CUQ B;  2IS2 A;  4EJU A;  2MLK A;  2H09 A;  5JI6 A;  4ZZL A;  1LE8 B;  1CF7 A;  1AKH A;  3JRB A;  2P6T A;  1X3U A;  3KET A;  5JHU A;  2FMY A;  3OSF A;  4HST A;  5GPC A;  3KP3 A;  1YW8 A;  3JTH A;  2QEN A;  2QQA A;  5TRD A;  3S3O A;  1FTZ A;  1QNT A;  2OBP A;  3BLY A;  1T2K A;  3CDH A;  2XAQ A;  2DA2 A;  2M45 A;  4HBL A;  1LDK B;  1ZYR F;  1XN7 A;  2ZNY A;  3CD6 I;  2W7N A;  4E6K G;  2VQH A;  3GBG A;  1T8I A;  3D5R C;  1WH5 A;  4YFK F;  2PMZ A;  3JAM Z;  3H5A A;  2WAE A;  3OS0 A;  3PFY A;  3ZMU A;  3S15 J;  4ZDL A;  3CLO A;  3K4N A;  2KIF A;  3RTR A;  1B59 A;  2DYR H;  4Y15 A;  3PL8 A;  1IXS B;  2R5Z A;  3K7A J;  3ZR8 X;  5D5X B;  5D8L B;  3PNY A;  2IT0 A;  3T8R A;  5C44 J;  3A0H C;  3CLQ A;  1R6R A;  3DBL B;  5DV5 A;  4RGS A;  4Y13 A;  3GTK J;  5LHI A;  2RQQ A;  3F6O A;  5D8K B;  1RC9 A;  3QPH A;  2I10 A;  1K7A A;  2KDZ A;  4UVC A;  3DEU A;  1IAW A;  2V9V A;  3KYD B;  3SYT A;  3V8K A;  5K7F A;  3CC4 I;  3OYM A;  1B72 A;  3RKQ A;  2VXD A;  4I01 A;  3F8M A;  1TQP A;  4PZJ A;  5EGO A;  3LST A;  2DO7 A;  2W48 A;  2WB1 N;  1HOM A;  5GAH J;  1TWG J;  1ZLK A;  2VT2 A;  3PUF A;  4I7H A;  4LK1 F;  1S72 I;  3S1N J;  4G8X A;  2UXX A;  1I6X A;  4OU0 A;  1CGP A;  1JUM A;  1ZRD A;  5JVT A;  2E71 A;  3RIR A;  1QO0 D;  4Y17 A;  3ZCO A;  4LOC A;  5L3D A;  2IA2 A;  3HSR A;  4BE1 A;  1TWA J;  1H8A C;  1XSD A;  4U0V A;  3BTJ A;  4EQQ A;  3DF8 A;  1PP7 U;  2XAJ A;  4C9Y A;  4P5O A;  5H6Q A;  2JK3 A;  4ENJ A;  1FMV A;  5IOY A;  2P4W A;  1VQN I;  4DQ2 A;  4B1R A;  1KQ8 A;  2IW5 A;  1Z6T A;  4M3D A;  3FXQ A;  2HDC A;  3P9K A;  1X2N A;  2JVG A;  2VBW A;  4CA0 A;  2QCO A;  3JRG A;  4XSZ F;  1W4M A;  3OYD A;  3C3W A;  1V5G A;  3ZRG A;  3S14 J;  4YRV A;  3KFW X;  5J6X A;  1P4X A;  3I58 A;  3Q5F A;  2GOX B;  2MH2 A;  1RES A;  1EA3 A;  2LRD A;  3LA7 A;  2HI3 A;  3LA2 A;  1MMA A;  2EFW A;  1JJ8 C;  1XC5 A;  3FHN A;  3CCR I;  5JFR A;  2JVH A;  3MVP A;  4FT8 A;  4ETS A;  2FXA A;  3RZO J;  2ZO4 A;  2OZU A;  3OYH A;  3GUD A;  4QIW N;  2MAB A;  2NAZ A;  2HZD A;  3FXJ A;  5FLX Z;  2MD5 A;  3LSJ A;  4OIR F;  4BH9 A;  3E5U A;  3KP6 A;  5CLS A;  2LY9 A;  1S8N A;  2KL4 A;  2UWM A;  3HOX J;  4Z6Y A;  1BN5 A;  2Y48 A;  4HQE A;  2IGO A;  2Z1D A;  5E18 F;  3GVA A;  2MA3 A;  1R5G A;  5TJJ A;  2LR8 A;  3A0B C;  5EDN A;  2B9S A;  1SD6 A;  2QM3 A;  1XD7 A;  1JGG A;  1G3S A;  2A05 A;  1ZN2 A;  2LDU A;  3HGY A;  4OWR B;  2PMZ N;  1A31 A;  1S7O A;  1IZ1 A;  4K2E A;  2P6S A;  4II2 A;  3CCL I;  2DT7 B;  4BJ5 C;  4QWQ A;  2PJR B;  1SD4 A;  5D4S A;  3H0G J;  3TGN A;  2DFH A;  2LYC A;  3HEF A;  5BS6 A;  4D1Q A;  2JPB A;  3SJM A;  1FIP A;  2P81 A;  5EF6 A;  3H5N A;  3MN2 A;  4WF2 A;  3GTM J;  1QRY A;  2STT A;  2EA2 A;  3GFJ A;  3RYP A;  1ETQ A;  4B43 A;  2DOE A;  2IP2 A;  4RGX A;  5DYM A;  4CCJ A;  1S6L A;  4ZJZ A;  2R7R A;  3KYC B;  3TQN A;  5CQE A;  4XQF A;  1P4W A;  1RET A;  1RIO H;  1GUU A;  2V4J C;  1SAX A;  1SFO J;  5IYD J;  5EYR A;  5E3O A;  2R7T A;  4D5C A;  2WY7 Q;  2W82 A;  1Y39 A;  1ZTR A;  3FX3 A;  3GZ5 A;  1VQP I;  3TO9 A;  4QPO A;  2MFZ A;  2FBH A;  1IO2 A;  3CZ6 A;  4FET A;  5ICF A;  5H2F C;  3S17 J;  3BT9 A;  1TZL A;  2OCC H;  3J80 Z;  3QRF F;  1N75 A;  3ZQL A;  3CCY A;  4HX4 A;  4IJA A;  2YU9 J;  3E7L A;  4Y3O A;  4OAY A;  4B4C A;  3OYG A;  4BQQ A;  4EM2 A;  1ZH5 A;  1XSV A;  4XNF A;  5EEG A;  3ZQH A;  1IUF A;  1LEA A;  3FXO A;  4A0X A;  2LD5 A;  4KDP A;  3ABM H;  4H4K C;  1G6N A;  3I4P A;  3KCC A;  1X1A A;  2DA5 A;  5JHF A;  2EIJ H;  1EF4 A;  4XLP F;  4XRS A;  2VUM J;  3OMY A;  1Y56 A;  2CQN A;  1JTX A;  3P7N A;  4Q4Z F;  2YX4 A;  4M9X A;  1K83 J;  3E1S A;  3HC7 A;  1O7L A;  1JKP C;  4ZYE A;  1OKR A;  1P9Q C;  3PSF A;  4HX8 A;  4KT5 C;  4PSW A;  5HLI A;  4D7N A;  4J00 A;  1KYZ A;  1K78 B;  4ZYH A;  2ISZ A;  1DGW Y;  1X2M A;  4QTR A;  2ADU A;  4QSH A;  2ETH A;  1U9O A;  3KLN A;  2FA5 A;  3LQR A;  3I9V 2;  4KYW A;  5CKT A;  3X2Q H;  2A61 A;  2JSC A;  2ZJR F;  3BJA A;  2HOT A;  1YTY A;  5LLQ A;  2TRT A;  2L5Q A;  1TL8 A;  3O8H A;  2FD5 A;  1H9T A;  4IKF A;  3AFH A;  3C18 A;  1F1Z A;  2DI3 A;  4YFX F;  2OCE A;  4BY1 J;  1MIJ A;  4M9S A;  3T8T A;  5E17 F;  2ZB9 A;  2AHQ A;  4XN0 A;  3K2Z A;  3ZQC A;  2LMD A;  1IJW C;  2LY2 A;  3FF5 A;  1R22 A;  5ICE A;  3H5R A;  1ON2 A;  2KRH A;  4J01 A;  3G4S I;  2WBM A;  1OIS A;  2V79 A;  2KPM A;  3M3Y J;  3HUG A;  2CQ7 A;  3S1R J;  3K70 D;  3FKI J;  3MZ8 A;  3HSF A;  4GDF A;  4BEH A;  1OCC H;  2EV5 A;  4L5J A;  3DV8 A;  1J75 A;  2KZV A;  2OU2 A;  5DD4 A;  3PIO F;  2CO5 A;  4PFO A;  2HU9 A;  2V7F A;  4XM3 A;  2XB5 A;  4DGW B;  2VL8 A;  5LD2 C;  4XLH A;  4KUM A;  1W7P D;  3K1M A;  1BR1 A;  3S8P A;  3MZH A;  1WKM A;  4N9I A;  2HYF A;  2OTJ I;  3GX4 X;  3AG3 H;  1ZGA A;  5ED4 A;  1IN4 A;  2O0Y A;  2LOO A;  2ELH A;  2B0L A;  2Z99 A;  2V9K A;  1W1W E;  4HG2 A;  3RPQ A;  1TWC J;  1K4S A;  5FD6 A;  5LGT A;  4HW0 A;  5CYV A;  2QKL B;  2M9H A;  1QZZ A;  2BY1 A;  3WG7 H;  4PJN A;  4BBR J;  3BG7 A;  5HS8 A;  3KYL A;  1SFU A;  2ESN A;  1T08 B;  3OS1 A;  3WU0 A;  1F36 A;  2Q1Z B;  3E6B A;  1WRJ A;  2ZJP F;  4BXF A;  2DFE A;  2MGQ A;  4CYC B;  3BZ6 A;  3CJN A;  3I71 A;  2IJL A;  2NS7 A;  1OR7 A;  3DEW A;  1XGS A;  3RDI A;  1QZY A;  3BTL A;  4FHT A;  2K3F A;  2GWR A;  1U5T A;  4BNC A;  4AYB A;  3HM5 A;  2CQK A;  2ECC A;  3L7W A;  5C3E J;  2J5O A;  4ZTF A;  4NQW B;  1ZKG A;  4NC7 A;  2JPC A;  1OPC A;  4L9T A;  1T6S A;  1WCM J;  1ZEL A;  1ZRF A;  3KEO A;  5J1Y A;  2E60 A;  3T5X A;  4OIN F;  1KA8 A;  4MIM A;  3RSN A;  1FOX A;  1TQM A;  2QWW A;  3ZN1 A;  1OYW A;  3ECH A;  3TO7 A;  1LFB A;  4UV8 A;  1ZAO A;  1P7J A;  3L2R A;  2DOA A;  1WVR A;  2F4M B;  2OJE D;  3CF2 A;  4BAC A;  3HOW J;  5F64 A;  1Z21 A;  1AWC A;  5DUK A;  3V7C A;  1HW5 A;  5J3L A;  4ZYG A;  3K70 C;  3R60 A;  4LB5 A;  4UXN A;  5DD8 A;  5B5E C;  3JSP A;  2DK8 A;  3JRD A;  4JP0 A;  2QQ8 A;  2GLO A;  1J5Y A;  1LDD A;  4CCK A;  4D9J A;  1VQO I;  4C30 A;  3BR2 A;  2FE3 A;  1J9I A;  2BW3 A;  4JYK A;  1VF9 A;  1OCP A;  4ESB A;  2K9N A;  1YOV B;  4L9J A;  1BJZ A;  1TW2 A;  3RKW A;  4CCO A;  3CMA I;  2DMU A;  1QPI A;  4IEJ A;  3OYF A;  3IP4 B;  3NAR A;  4G7Z F;  2L0K A;  3R0J A;  2HWV A;  3BQY A;  2NVT J;  3K4M A;  1FMW A;  1UJ8 A;  4KIG A;  1GV2 A;  3PO3 J;  5F1J A;  3CDI A;  2FRH A;  3N05 A;  3A4C A;  2DLL A;  1OR7 C;  4IOA F;  1P92 A;  2H8W A;  2JRT A;  2GXG A;  4BDZ A;  1JKO C;  5JVG F;  2GXB A;  1UZC A;  2JA6 J;  1TQI A;  1ETO A;  1ZQ3 P;  1E0E A;  1FBU A;  3SZT A;  3JSO A;  2G9W A;  2HPM A;  3DQV C;  1UG2 A;  3H9J A;  2NRA C;  1YS7 A;  2QSF X;  3NAU A;  3SXY A;  5HLT A;  4UVB A;  3QPL A;  4N4O B;  2KLO A;  3G73 A;  1V5E A;  1U8B A;  3ESW B;  2ZME B;  3SDG A;  4X6A J;  2FSW A;  1QZE A;  2K9L A;  2MLG A;  3CCV I;  1YO5 C;  2KT0 A;  4O5V A;  4EMS A;  2BYV E;  3VEP A;  2V9P A;  1D8J A;  3GZ6 A;  1E3O C;  1STZ A;  1JKQ C;  3RJP A;  4Q47 A;  5HNH A;  5DM6 F;  1RKW A;  2MH9 A;  5C4X J;  3LFK A;  3DBR B;  3L2Q A;  2JTV A;  3CDL A;  4AU7 A;  3A03 A;  3DWL E;  1HW1 A;  1XG1 A;  2M87 A;  2HVS A;  1GHC A;  4MFD A;  1SD5 A;  2NS0 A;  5IP7 J;  4AYB N;  5H6R A;  5LBQ A;  2DK5 A;  2M7A A;  2HDW A;  2EBI A;  1WH7 A;  3ZOB A;  3BP8 A;  1JKR C;  2FU4 A;  1QVT A;  1K61 A;  3ECO A;  3IHU A;  5IT9 K;  3WE3 A;  1MGT A;  1D0Z A;  2EFN A;  3TKY A;  3ZQG A;  2OV7 A;  2H27 A;  5EGO B;  2FOW A;  3CQZ J;  3C2H A;  3QP5 A;  1XMA A;  3U21 A;  1ETV A;  2AXL A;  2K9Q A;  3VYR B;  1Z0X A;  3CJQ B;  4XOT A;  5F6F A;  2IPQ X;  2QBY B;  3HJE A;  3CC2 I;  1EKE A;  4JX5 A;  1LFU P;  3S1M J;  3CO7 C;  2IS1 A;  1WJE A;  4PCQ A;  3BPV A;  1NK3 P;  1IV6 A;  2E2J J;  1Z9C A;  4AIJ A;  2PEX A;  2V1X A;  1ZG3 A;  1O3R A;  4BHP A;  3DP7 A;  2YS9 A;  1QQI A;  1Z3X A;  4A3M J;  3S3M A;  1N78 A;  1X3W B;  3FK7 A;  4HDV A;  4A3E J;  4IO9 F;  2R7W A;  4L5I A;  3V42 A;  2GXA A;  4GGG A;  2EB7 A;  5IY5 H;  3B6A A;  3A01 A;  5IYB J;  2HXI A;  4RAZ A;  4RMN A;  3GME A;  3BCB A;  4AIK A;  4BL0 B;  4F3Q A;  1YRN A;  3AG1 H;  1BR2 A;  2G0E A;  5EJC A;  2X0L A;  3OV8 A;  5J1R A;  1X19 A;  3OYJ A;  2IGK A;  1QHH D;  2WV1 A;  4C2U A;  3WTX C;  1IXR C;  3LAJ A;  3MFK A;  2XGC A;  2E5N A;  4LLN A;  2X85 A;  5HLH A;  2Y31 A;  4XRM A;  3HOU J;  2M1B A;  2WAF A;  4RGR A;  3TOB A;  4HA8 A;  1BR4 A;  4FQG A;  5F04 A;  1D1B A;  2B7E A;  4HF0 A;  5FFX A;  4CCN A;  2G7H A;  1NK2 P;  4RDU A;  4PGH A;  4NB5 A;  3EQL F;  3LAP A;  1BC8 C;  3CJR B;  4ZZD A;  3KX2 A;  2CV0 A;  5K7Z A;  2CYY A;  4NC6 A;  3VB2 A;  4UUV A;  2EA4 A;  2E2H J;  1PJR A;  2FQ4 A;  2P8T A;  4AIH A;  1H88 C;  3FBN B;  3LNQ A;  3HHH A;  4HDU A;  3Q9S A;  5GTH C;  2EIM H;  4UUS B;  2P0W A;  2A68 F;  2BHY A;  2GZW A;  4IHW A;  4ENM A;  1MDM B;  3BR0 A;  2A5Y B;  5CVI A;  2Y75 A;  4M73 A;  4EJT A;  2ID6 A;  1FP2 A;  2MBF A;  3DU6 A;  3Q9V A;  5LRS A;  4DBQ A;  2JA7 J;  1ZR4 A;  4O3M A;  1JGS A;  4XSX F;  2R93 J;  1MMD A;  4LGW A;  2HQA A;  1OCR H;  3GCM A;  3IL2 A;  4Z2Y A;  1Y0U A;  2EIL H;  4XON A;  1ONV A;  2NOG A;  4CIC A;  3WU1 B;  3FMQ A;  2CW7 A;  4UB6 C;  1REP C;  3PO2 J;  1BA5 A;  3R6S A;  1ZR2 A;  4A2U A;  1JHF A;  1XS9 A;  1K6O A;  5HS7 A;  4GYI A;  4PJM A;  4CHU A;  4P96 A;  2XPW A;  2VPR A;  1UEL B;  4LFU A;  3ZMS A;  4W1U A;  4KMF A;  4IX7 A;  3ZGK A;  3ZMD A;  1X4O A;  4BY7 J;  2IGN A;  4FAS D;  3KE2 A;  4R1H A;  4B44 A;  3ERM A;  3DEE A;  2DDB A;  2DA6 A;  1IGN A;  1I3A A;  1HLV A;  2IEK A;  4HOB A;  3HRU A;  1LPQ A;  5LGN A;  2XIG A;  4HLX A;  3T1B A;  1Y8Q B;  2LSO A;  1MMS A;  4Y52 J;  2EZI A;  3VOE A;  3IKV A;  3RQ4 A;  3I64 A;  2DMT A;  1MND A;  3E3V A;  2XVC A;  1OLT A;  2GIV A;  2FX0 A;  1Y0N A;  4NDL A;  4OIO F;  1E2X A;  3JRE A;  4WWC A;  3BC8 A;  2A5W A;  4IXA A;  2N8G A;  5ILS A;  2MG4 A;  2VKE A;  3I59 B;  5F27 A;  1MBK A;  4KIS A;  1FYL A;  1V54 H;  2HEO A;  2LH9 A;  1T39 A;  3WU2 C;  2GIZ A;  1HKQ A;  1PUE E;  1VQ8 I;  5HNF A;  4KJZ A;  2XAG A;  2G7U A;  1B6A A;  5J40 A;  5E3N A;  2ZXH A;  3UNG C;  3NEU A;  1OMI A;  1OFC X;  2XAU A;  1ZGJ A;  4U87 A;  4A0Y A;  1A6Q A;  1TP4 A;  1B8I A;  2IS6 A;  2VN2 A;  4B3A A;  1I3Q J;  1MBJ A;  4A3J J;  1SC7 A;  3BQZ A;  3COA C;  2DFI A;  1UHM A;  4LMY A;  3MZY A;  4JX6 A;  3ZQ7 A;  3FHZ A;  2ECB A;  3I4N J;  5L3B A;  3K4K A;  1RKT A;  1WI3 A;  4WCG A;  3G3Z A;  4CSW A;  2FF4 A;  2ACJ A;  4XKW A;  1SD7 A;  1UFM A;  3W2W A;  3HTU A;  3VDX A;  2HGC A;  3L2V A;  2GM4 A;  2XF7 A;  3GEZ A;  2DYS H;  3F8C A;  1VQ7 I;  2IRF G;  1U3E M;  4BJ6 C;  2Q2E A;  1B9N A;  5GTI C;  2OZ6 A;  2PMH A;  5E1X A;  2VI6 A;  2R7O A;  5FD5 A;  1RR7 A;  2KP6 A;  1FLI A;  4RAG A;  3HG9 A;  4KFC A;  4AVZ A;  3W2A A;  1WSU A;  5GAE J;  1JT0 A;  3I5U A;  4XLC A;  2LKS A;  4AVP A;  1V3F A;  4PK4 A;  4LB6 B;  5A2Q K;  2MC3 A;  1FOK A;  4I02 A;  2TDX A;  2M34 A;  2LBF B;  2QZ8 A;  3GTP J;  2D1H A;  3C1D A;  2VQC A;  3OIO A;  4EEF G;  2VOO A;  2X48 A;  5AON A;  3ULQ B;  3HPH A;  4JQF A;  1RI7 A;  3FKJ A;  5EG0 B;  2PQ8 A;  3FXR A;  1ORK A;  1JUP A;  5CVJ A;  4RB1 A;  1OYI A;  4AM3 A;  3S16 J;  4I0A A;  3OYK A;  3BY6 A;  3TBI A;  1LUJ B;  1VZ0 A;  3OOP A;  5GAG J;  5FKL A;  4XKC A;  4WXC A;  5DCM B;  1GXQ A;  1OYY A;  3HBL A;  3NRV A;  1AU7 A;  1RR8 C;  1I1S A;  1WHU A;  4I76 A;  1BI2 A;  3FDY A;  3FK6 A;  2L2O A;  4G6Q A;  1ULY A;  1DUX C;  5JLW A;  3ABU A;  1T0F C;  5ICC A;  3FIW A;  4UVA A;  1YHQ I;  3M1C A;  4MTE A;  1U5T B;  3BJ6 A;  4FCY A;  2XKO A;  2LFB A;  2UUZ A;  3OYE A;  3IAM 2;  2OQG A;  3GLL A;  2L4M A;  3O2P E;  5KVR A;  5BPI A;  2H8R A;  2ZFW A;  4NUB A;  1N77 A;  1OJL A;  1FZP B;  2VT3 A;  4HNV A;  1LFP A;  2GA2 A;  3JCU C;  1TLH B;  4ZDP A;  2HKO A;  2W85 A;  2R5Y A;  3E0J B;  3SFZ A;  2DT6 A;  2IA1 A;  3QWL A;  1ON1 A;  4V2F A;  1JTY A;  4YEL A;  3D5S C;  1R58 A;  1SVL A;  4V19 K;  4M6X A;  4ANJ A;  3RCO A;  3S2D J;  2O03 A;  3HPG A;  3OL4 A;  5FRN A;  2LKP A;  2E1C A;  3RKX A;  4IL6 C;  2QUF A;  4M6Y A;  2KIU A;  4RLQ A;  3OYI A;  2DAO A;  2HQN A;  2HTS A;  1YJW I;  1S3J A;  1TWF J;  4DBR A;  1HKS A;  2JSP A;  2F4O B;  1RUN A;  2H6B A;  2PBI A;  2AS5 F;  2HYG D;  3ZP5 A;  1TNS A;  1FT9 A;  3CCS I;  1H9G A;  1IF1 A;  4ENK A;  4XN3 A;  2WAQ A;  4CGZ A;  5BOX A;  4EV0 A;  1YLF A;  2M8G X;  2IBD A;  3FBI B;  1Z1D A;  4LIU A;  2VIX A;  4B3X A;  3PQJ A;  1KQ0 A;  1KU2 A;  3RYR A;  3CO6 C;  5D4R A;  4YEJ A;  5L3E A;  5GP9 A;  2IGM A;  3DPL C;  3K1N A;  1TT0 A;  5HLG A;  1FYM A;  1WJ5 A;  2H6C A;  1K4T A;  1DPR A;  1Z7L A;  3CCJ I;  2F5C A;  5E79 C;  2ZXJ A;  4ESF A;  5EEH A;  1E17 A;  4XMY A;  3BR6 A;  2LK2 A;  3CUO A;  1MH4 A;  4A3K J;  1BL0 A;  3B02 A;  3EPZ A;  4HPQ A;  2DA1 A;  2EFP A;  3BJO A;  2JQ7 A;  2M5W A;  1HST A;  2HVQ A;  2Y0S A;  2JT1 A;  2K4B A;  1G2H A;  1IN8 A;  5GAD J;  4GFB A;  2F5F A;  2DOF A;  3WTZ A;  3DLL F;  1S7E A;  3CUQ A;  1DU0 A;  2JWT A;  3HZJ A;  2CV2 A;  5KAI C;  1XMX A;  2IVM A;  3LSM A;  1IXC A;  1D1C A;  2LP0 A;  1BOB A;  3JRC A;  4PFP A;  1UST A;  4E7L A;  2W84 A;  4A3D J;  2ISY A;  3L09 A;  1ODD A;  2UZK A;  2HQ5 A;  1U78 A;  4FE7 A;  2JUC A;  3P5J A;  4D0P A;  1BIB A;  5J8C A;  3IH3 A;  2VBZ A;  1X58 A;  3L2W A;  2O6G E;  3A2K A;  4F93 B;  5DM7 F;  1TW3 A;  5L3G A;  2CU7 A;  4RGU A;  5DUI A;  4BHB A;  2CV1 A;  3QU6 A;  3H3U A;  2L9V A;  3P9I A;  2VXZ A;  3DU5 A;  2EV6 A;  4I2O A;  2LVS A;  2VB6 A;  3WGG A;  2XAF A;  5J4Y A;  3CC7 I;  3PNT A;  3GTJ J;  4BHC A;  2BOL A;  4EM1 A;  3MKL A;  4E7J A;  1PP8 F;  2ZXW H;  4E70 A;  4W97 A;  4CO8 A;  3G2B A;  4F55 A;  3IRR A;  2HPI A;  4MQ9 F;  4RM2 A;  1KQ9 A;  4CXF A;  5ILV A;  1TNT A;  3E97 A;  4E7K A;  5CQG A;  4ABZ A;  3FM5 A;  3LFU A;  3F9K A;  4IZZ A;  4PDK A;  4LLL A;  9ANT A;  1I50 J;  2E2I J;  3F22 A;  4ASN A;  4UUT A;  3HYI A;  3A01 B;  2HOE A;  2E35 A;  3K69 A;  4MEY F;  3SZP A;  3CTA A;  2KZG A;  1YIT I;  5IOZ A;  3L2U A;  1KU9 A;  3OS2 A;  1R7J A;  3DPT A;  1YRN B;  2FBK A;  3LA3 A;  2F4I A;  1W7P A;  3UKG A;  2M8E A;  3L2C A;  3I3L A;  4DIQ A;  2WAQ N;  1XDS A;  2O8K A;  2KIS A;  4XIC A;  3SEQ A;  1FTT A;  1ETW A;  2FML A;  2L7F P;  2XHK A;  2J5P A;  4RA2 A;  4UV9 A;  5F0F A;  2H1K A;  1GT0 C;  3HXL A;  3K4L A;  2W24 A;  2DA4 A;  1HSJ A;  1USS A;  1J0R A;  3QP6 A;  4P9F A;  5BMZ A;  5FKO A;  5FRM A;  1Y6I A;  3V7S A;  3CUQ C;  2OD5 A;  1GVJ A;  1UB9 A;  1BI1 A;  4D7M A;  1FIA A;  1LVA A;  4CZC A;  3IV5 A;  2VQG A;  1KU3 A;  2HNH A;  3GFM A;  3AL0 B;  3HL2 A;  4HAM A;  2CH0 A;  3J81 K;  1QPM A;  4WX9 A;  4LG3 A;  2HFH A;  3FMR A;  3FXU A;  4CUG A;  4S0H B;  1I27 A;  3I55 I;  2R7F A;  1LNW A;  3BOQ A;  3DBH B;  3WGI A;  1VQL I;  2KRC A;  2Y0S N;  3F23 A;  3DLA A;  1ENH A;  2YPR A;  3EUH C;  5KNL A;  3KLO A;  1MBG A;  4A3G J;  1IV8 A;  2V6C A;  2WWY A;  2FBI A;  2LC2 A;  4H0E A;  1MJB A;  1R4M B;  2XSJ C;  3RZD J;  3H1C A;  2M4K A;  5IP6 A;  1G3T A;  5CPR B;  2NVY J;  3ZMT A;  4BDY A;  3LSH A;  3CME I;  1Y8R B;  4ITV A;  4WXH A;  5HOD A;  3QOE A;  4BE2 A;  3H9G A;  3K6G A;  4IQ4 A;  4BE0 A;  2JA8 J;  1XGN A;  2CWE A;  4MLO A;  1EH6 A;  4PSX A;  4KIF A;  2M3A A;  4F52 A;  2GBY A;  3L1P A;  4HSR A;  2QQB A;  5C4J J;  3WTY C;  3LSR A;  4BGD A;  2Z3Y A;  3JW4 A;  3LWF A;  2M2E A;  4XOP A;  3J7Z I;  2K40 A;  2P7C B;  3PM1 A;  3QYF A;  4CH7 A;  4Y7N J;  2W1O A;  3WTU C;  1GLN A;  1K6Y A;  4I6Z A;  3KP2 A;  1LJ9 A;  3IUO A;  3VOD A;  2XRO A;  1P6R A;  2V1D A;  2YSR A;  3JRI A;  1YI2 I;  3BZC A;  3DKX A;  2E7X A;  2XGD A;  2LNB A;  1UG0 A;  2ICW G;  1TWH J;  1WFX A;  2DTZ A;  4GCV A;  2RKH A;  1WJA A;  3JRA A;  1CF7 B;  4HZF A;  1KZH A;  1ZHF A;  5F0H A;  1AKH B;  5FLV A;  3RPU D;  1NTC A;  4G7H F;  5K5O A;  2MW8 A;  2LF7 A;  1YS6 A;  1YG2 A;  3KZY A;  1NHA A;  1XTA A;  1M1E B;  2X1D A;  2HZT A;  3I56 I;  3AAF A;  4ON0 A;  1SAN A;  1R1U A;  1D0Y A;  3HTS B;  1CQT A;  2A6T A;  4G9Y A;  5KK1 A;  2X1C A;  3DKY A;  4C3H J;  2V26 A;  5GPA A;  1ZGW A;  1BIA A;  2R7Q A;  2HR3 A;  3K0L A;  1G3Y A;  3FXM A;  4RAF A;  1A04 A;  4IHV A;  1MNM C;  4C2T A;  2LF8 A;  5LFA A;  4HRI A;  1AA7 A;  1WPK A;  3CCM I;  3ABL H;  2DN0 A;  2DMP A;  3CCE I;  3Q0W A;  3SHF A;  3JAM K;  2AQE A;  2XUB A;  4A6E A;  3QPS A;  2M30 A;  1F43 A;  2FJ1 A;  3BR5 A;  2KKO A;  3GXO A;  5D6F A;  1HDD C;  3EYI A;  4A0Z A;  4IRG A;  4BAY A;  3BR1 A;  2DQL A;  2R5Z B;  3M07 A;  3ELK A;  2CUE A;  2NOJ B;  4Q5S F;  3HB9 A;  3S1Q J;  1PUF A;  4M72 A;  2EZL A;  2M4G A;  4O6J A;  1FBS A;  3MKW B;  1SAU A;  4IHS A;  1A36 A;  3ZPL A;  2STW A;  1F9N A;  1O3Q A;  4ZYD A;  2H1L A;  5M3F J;  4A69 C;  1O4X A;  2JRM A;  3VYT B;  4YFN F;  1B72 B;  3EUA A;  2NVX J;  4NHJ A;  2LY1 A;  4BS9 A;  4CYD A;  4E4H A;  4A6D A;  3IH2 A;  4EGY A;  1K78 A;  5DTD A;  1KU7 A;  3H3Z A;  1FX7 A;  2JN6 A;  4GO1 A;  2CFO A;  4LLG F;  1L0O C;  4S04 A;  4X0G A;  3OYN A;  2XAS A;  4HNU A;  2RAE A;  2VQL A;  3I0T A;  2QGU A;  3S93 A;  3W2V A;  4F7Z A;  3GLX A;  1ETY A;  6PAX A;  3G1M A;  3TP3 A;  1I39 A;  2XDV A;  3N97 A;  4B8X A;  2HVR A;  1MJ9 A;  2GA1 A;  2KRF A;  2R7D A;  1DPU A;  2NNY A;  4RB2 C;  3ABK H;  2DQR A;  2CQX A;  4A3C J;  3I53 A;  4DYC A;  1YJ9 I;  3QAH A;  4QLC U;  2DA3 A;  2HDD A;  1ZAR A;  3FXK A;  5D5U B;  2I8D A;  2KIM A;  3P9C A;  5E20 A;  1YW9 A;  2K86 A;  3IH4 A;  3E6C C;  4D5F A;  3F21 A;  1FY7 A;  1YX3 A;  2O61 A;  2Q0O A;  3IWF A;  2ME6 A;  1W0U A;  3H0D A;  1BJA A;  4JK1 X;  1BW6 A;  3TO6 A;  2EFQ A;  1IN6 A;  3M1E A;  1VQ5 I;  2R4G A;  1JI8 A;  1ZRE A;  4HQM A;  2L3D A;  1L3L A;  4BQN A;  4XRS G;  5L3C A;  1RUO A;  2GOM A;  4BKX A;  4XKB A;  2XB0 X;  1ACI A;  5H20 A;  5E8G A;  3GWZ A;  2ZJ2 A;  1IRZ A;  3LSP A;  2VOP A;  1IDZ A;  2CMP A;  1KON A;  1LVK A;  2VJI A;  3WTS C;  1BI3 A;  1O57 A;  1NG7 A;  4U0W A;  3B6C A;  5ICG A;  3GTO J;  2HS5 A;  5FLX K;  2LKX A;  1XX5 A;  1JJ6 C;  1HBX G;  2W57 A;  2DJI A;  2V6E A;  1PVE A;  4N9H A;  4IHY A;  4OIQ F;  1C0W A;  1N25 A;  3OR1 C;  3BTI A;  2Y69 H;  1GXP A;  1MBE A;  4KT6 A;  4KIT B;  5J4V A;  3EYY A;  3HKZ A;  3VSL A;  2OPT A;  2EPF A;  4E7I A;  3OSG A;  4B48 A;  1DP7 P;  1QBJ A;  1MKM A;  4AID A;  3CCU I;  4AUX A;  4CYC A;  4NNJ A;  2Q8K A;  3F8B A;  2PG4 A;  1MMN A;  2CFX A;  2WV0 A;  2W25 A;  3OWT A;  2ZJQ F;  2E1O A;  4HV5 A;  5J8F A;  2YX7 A;  2A3S A;  2EIK H;  2VLA A;  1W0T A;  3LQQ A;  3HOS A;  1HW2 A;  3HIF A;  3CMY A;  3HRM A;  4L9N A;  3VPR A;  2OTL I;  2P5V A;  2M0M A;  4EJO A;  3HSE A;  3FMS A;  4NQW A;  2ZXI A;  4DZJ A;  2KDO A;  4RAY A;  1NH3 A;  1TC3 C;  2XSD C;  3R61 A;  4A3B J;  1AHD P;  2E19 A;  5HVQ C;  3T0Y A;  2LLK A;  5DS9 A;  4DOZ A;  5HDG A;  4P55 A;  1XB4 A;  3W6K B;  4OOI A;  2XRN A;  4CCL A;  2KFD A;  3RI4 A;  2E7W A;  2ZC2 A;  1EV7 A;  3LL7 A;  1QU3 A;  2RVC A;  1HF0 A;  2O9L A;  3MEX A;  2XAH A;  2ZCW A;  1BM9 A;  1A35 A;  3OYL A;  2MD0 A;  1XPX A;  4EM0 B;  4A93 J;  1R23 A;  3J80 K;  3U2R A;  4BU2 A;  3C2B A;  1A5J A;  3BDD A;  2X9D A;  1RPW A;  4CDG A;  3CCQ I;  2D5V A;  2FNA A;  1FSH A;  2DT5 A;  3GW2 A;  2DU9 A;  3M9A A;  4AD9 A;  4UNO A;  4KN7 X;  3M4O J;  4KIB A;  4A12 A;  5LHG A;  1S5L C;  2O5R A;  1IDY A;  1G3W A;  4F92 B;  3G6E I;  3DPU A;  4BJT A;  3M8E A;  1SMY F;  3GYH X;  2VKH A;  2E1M B;  1HC8 A;  5K1Y A;  1TT5 B;  4G7O F;  2BY2 A;  3JRF A;  3G71 I;  1X4P A;  1T0F A;  4A3L J;  1T98 A;  2D1V A;  2OUM A;  2XF5 A;  2Z16 A;  2F2E A;  2W00 A;  2QLZ A;  3TDZ C;  4LG0 A;  1WWX A;  3WTT C;  3W3C A;  3J7A O;  3AL0 C;  3G1L A;  1HXD A;  1IW7 F;  1Z67 A;  2L9N A;  2MC4 A;  1O3T A;  4M9Z A;  5F08 A;  3MD2 A;  2L01 A;  2F6C A;  3PJR A;  3BRO A;  3OIQ A;  4X1E A;  4E7S A;  3HKZ N;  2HOS A;  2VE8 A;  4AC0 A;  2ZME A;  2RNG A;  3HRT A;  2QKM B;  3O3K A;  4XRF A;  4ESJ A;  1VTN C;  1R1T A;  1R1V A;  2AXT C;  2DFF A;  3TW7 A;  4UB8 C;  3HUG B;  3OR2 C;  4BEH B;  4I09 A;  5BNG A;  3OL3 A;  1MZB A;  4I99 C;  3K4B A;  3H3V K;  1OCT C;  2HOA A;  4FX0 A;  3ZN0 A;  1VQ6 I;  2CS3 A;  5TGT A;  4R8H A;  1HDP A;  3F8F A;  2K27 A;  1B1B A;  3M7G A;  4UHT A;  4HV6 A;  5IT9 Z;  4S05 A;  1D8K A;  5JLX A;  1FYK A;  3S32 A;  5LRR A;  4KIC A;  4JOM A;  2QA4 I;  3V4G A;  4DW6 A;  2VON A;  4PJL A;  1XMK A;  4ZC3 A;  1H89 C;  1W7P B;  3QOD A;  2OA4 A;  1XCB A;  1FP1 D;  1U9N A;  2P5K A;  1G59 A;  1Z91 A;  2GAU A;  1UAA A;  5DCF A;  4OIP F;  2QBY A;  1WZ2 A;  3U1D A;  3JRH A;  4XOR A;  2UXN A;  4IRI A;  2HKX A;  4MQV A;  2R92 J;  4BXU A;  5IP9 J;  2K02 A;  2NVQ J;  1U0J A;  2ZNZ A;  5AIQ A;  1W5T A;  1J09 A;  1RNL A;  3CMM A;  1WJB A;  1Z05 A;  3DKW A;  3PQK A;  2KHM A;  1I5Z A;  3CF5 F;  1Z3Y A;  3FZV A;  4L0Z B;  3WTW C;  3FIS A;  4XL9 A;  2WY8 Q;  3F0C A;  4L18 B;  1JUS A;  4GXO A;  3ZQI A;  2RC4 A;  3WG9 A;  2Z5U A;  2BE5 F;  3EUK L;  4P1W A;  2IAI A;  1IUY A;  4U7D A;  4IF4 A;  4ZH4 F;  4HLY A;  3DFG A;  1JE8 A;  2RDP A;  2ZKZ A;  3MAJ A;  4OAZ A;  2QSG X;  2RRE A;  3L9F A;  3ZMV A;  4M6V A;  3H9Q A;  5FKM A;  1U8R A;  2ZME C;  4YIR X;  2CUF A;  2DTR A;  2O8X A;  1I6H J;  3HOY J;  2R7U A;  1OCO H;  3DCF A;  1R9T J;  1APL C;  2EWN A;  2QVO A;  4IRH A;  2FUG 2;  3LSK A;  3KP7 A;  3SEZ A;  4OMZ A;  1BC7 C;  1DGR M;  1FBQ A;  2NYX A;  1S9H A;  4U0Y A;  1BW5 A;  2R7Z J;  3IC7 A;  1FNN A;  4UUS A;  1WJD A;  2NS8 A;  4HX7 A;  1SFE A;  4N4N B;  1XCV A;  3BPX A;  2VE9 A;  1T38 A;  1MDM A;  4HNT A;  1J59 A;  4RS8 A;  1P2F A;  3ERE D;  3Q0U A;  4B09 A;  2BW3 B;  2RN7 A;  1D5Y A;  5EZG A;  3Q0V A;  1P4A A;  4LD5 A;  3VYS B;  4IVN A;  1EH8 A;  2PJP A;  3KEQ A;  3BG3 A;  1MNE A;  1JHH A;  4XKV A;  2L9S A;  5F0C A;  5KCM A;  5IYC J;  3G1O A;  4HEA 2;  2L7Z A;  3KEY A;  2EH3 A;  1XSX A;  1ZG5 A;  2ZSI B;  2D45 A;  2AQF A;  2CQQ A;  3AKZ A;  4GRI A;  2QSH X;  2XKP A;  3WHC A;  3BCA A;  3VFZ A;  1WQ2 A;  3MMY B;  3JR9 A;  1UMQ A;  2R7S A;  3F72 A;  1R4N B;  4KNY A;  2RNJ A;  3U9G A;  2LG4 A;  2BVL A;  3BG5 A;  2HXO A;  2ME0 A;  5J1U A;  5F1R A;  4MNU A;  5IPA A;  2BBY A;  3DTK A;  2EJR A;  2V1U A;  2M0C A;  3HRS A;  3K9T A;  5D5V B;  4NBQ A;  4HF1 A;  1X1D A;  1FOW A;  1LEB A;  3HHG A;  2QEX I;  1YIO A;  5ERI A;  2XRL A;  2JA5 J;  1ZRC A;  2DXI A;  3OY9 A;  3V7R A;  4A3I J;  4G6T B;  1HKT A;  4FTH A;  2WA0 A;  4BQA A;  2CGP A;  2ZBK A;  4JX4 A;  2L9R A;  4M3G A;  4RM3 A;  3EET A;  1VQM I;  1RZ4 A;  3BTC A;  2FNP A;  2K9S A;  2YUS A;  2CRG A;  1MBF A;  4ENN A;  1LE8 A;  3TP0 A;  1MJA A;  5B66 C;  3I59 A;  1G8X A;  1MSF C;  1PUF B;  5FLM J;  1W5S A;  1ZLJ A;  2BY0 A;  2MSY A;  3MQ0 A;  1IN5 A;  2X6O A;  2EZH A;  5HS9 A;  1QA6 A;  4BQO A;  5E3L A;  2EQR A;  2X1E A;  4WXD A;  2TCT A;  5CJ9 A;  4P9U A;  4WK8 F;  4FIS A;  3VYU B;  3GZN B;  2EZK A;  3OYA A;  3EUH A;  1VQK I;  1PDN C;  1IRG A;  2A6E F;  2OF7 A;  3IKT A;  5ILU A;  3RQI A;  3Q3S A;  1PYV A;  2E34 A;  4UY8 I;  2AO9 A;  3GFL A;  2L7K A;  1UCR A;  3ROU A;  4DJA A;  2CUZ A;  2QYO A;  4E7Z A;  2X6W A;  5TIS C;  2A6H F;  5DDG A;  1XDU A;  2RQP A;  1B4A A;  2WTE A;  5E1Z B;  4F91 B;  5LGU A;  1MMG A;  4C2M J;  3CP8 A;  2D2W A;  3KZI C;  1SMT A;  3PUB A;  1HQC A;  1I1G A;  4R79 A;  1R5H A;  2K9M A;  2VOD A;  1TBX A;  2R3S A;  3VWB A;  3LOC A;  4XBF A;  3DTE A;  4M3B A;  3ZQF A;  5M3M J;  5FB2 A;  4DNC A;  1GDT A;  3MCZ A;  5DEQ A;  2ESH A;  4G6D A;  2CW8 A;  2WAD A;  5L3F A;  5JR3 A;  3OOU A;  4G12 A;  3A02 A;  2K7L A;  2CJJ A;  2EIN H;  2WC2 A;  2BZT A;  3R0A A;  4MFE A;  2Y9Z A;  3GTG J;  2VBY A;  2R7V A;  4IPA A;  1YX5 A;  4ZTJ A; 
#chains in the Genus database with same CATH homology
 5A2Q Z;  2FOK A;  2CSO A;  2PN6 A;  1Z7U A;  3WE2 A;  2X4H A;  4Q48 A;  3MWM A;  1O7F A;  4OMY A;  1R00 A;  4U88 A;  1YYV A;  4I98 B;  2XV4 S;  2KJB A;  1O3S A;  2Y0M A;  2DPU A;  3EDP A;  1IN7 A;  4CZZ A;  5HOO A;  1WI9 A;  5DCM A;  1J7K A;  4HYE A;  4A5M A;  4U7B A;  3D0S A;  2BGC A;  3DXJ F;  3QPT A;  1DDN A;  1IRF A;  2E1N A;  4YIF A;  2P7V B;  2A07 F;  1FWZ A;  1YW7 A;  2PMU A;  1UHW A;  4RB0 A;  3GFI A;  3K1P A;  2VC1 A;  1LDJ A;  1XGO A;  1BBY A;  3E5Q A;  1S7A A;  1YQA A;  5CVU A;  2KJC A;  5K5R A;  3R4K A;  2DW4 A;  2RV8 A;  4LJZ F;  2HTJ A;  2P5L C;  3QU3 A;  3JTG A;  4KN4 X;  2YR2 A;  2L4A A;  1BI0 A;  2VBX A;  1FC3 A;  5LEK A;  4L9V A;  2A69 F;  5FO5 A;  1ZG1 A;  4N0B A;  3D5L A;  2DBB A;  4MHG A;  3SQN A;  1U2W A;  3TDU C;  2K4J A;  2EFO A;  3RPU A;  1EH7 A;  3KP4 A;  4MEX F;  3IWZ A;  5CVR A;  3RKY A;  4BYY A;  1U6G A;  4EVI A;  5E8I A;  5D5W B;  2Z33 A;  4EJW A;  4LG0 B;  1B9M A;  5HDK A;  3ZMZ A;  1SFX A;  1MD0 A;  1U5T C;  3KP5 A;  3WOD F;  3I54 A;  4PGG A;  3V8L A;  2EK5 A;  5FGM A;  3F8N A;  3REO A;  4A5N A;  1Q1H A;  5K5Q A;  4KA4 A;  5FFZ A;  1QGP A;  1G4D A;  3WGH A;  2FEZ A;  4GYG A;  1D3Y A;  2GQQ A;  2Z9O A;  4MGR A;  2C6Y A;  2YU3 A;  5E1W A;  2IA0 A;  3M8F A;  1Z6R A;  2PFB A;  3ABT A;  3HOT A;  2BV6 A;  4M71 A;  4AWX B;  3GF2 A;  3E6M A;  2CW0 F;  1AOY A;  4RB3 C;  2OAZ A;  3O6B B;  5AIP A;  3H92 A;  1FSE A;  2JZY A;  3ISP A;  4G94 A;  3F6V A;  4MTD A;  1XGM A;  3V8J A;  1YFH A;  5D6E A;  1K79 A;  3IRQ A;  1D5V A;  3FWE A;  1V4R A;  2OQR A;  3N4M A;  4HF2 A;  1LQ1 A;  3S2W A;  3ML6 A;  2QQ9 A;  4EGZ A;  4LK0 F;  3E6D A;  2PLY A;  4FX4 A;  2H94 A;  2EV0 A;  4YII A;  1F4K A;  3GO5 A;  2O3F A;  2PI0 A;  2L54 A;  1KGS A;  2HQR A;  1LB2 A;  4EJV A;  2CG4 A;  3J81 Z;  4KMU X;  3BWG A;  4JBA A;  2RGV A;  1S29 A;  5LHH A;  2F5D A;  2FQ3 A;  3TOA A;  2COM A;  4I0B A;  1F5T A;  2L02 A;  5BQT A;  4YG2 F;  1H0M A;  4M74 A;  2F5E A;  4XLN F;  3FM3 A;  3B73 A;  1BOA A;  4TV7 A;  3C7J A;  5LEJ A;  3E5X A;  2NNN A;  5IT3 A;  1KYW A;  3PFI A;  3F3X A;  5BPD A;  3KZZ A;  2VC0 A;  1FPQ A;  1R36 A;  2XGX A;  3WTV C;  1J2X A;  3W6J B;  1JXS A;  4L0Y B;  5CVV A;  3NQO A;  2DPD A;  5HDN A;  1TTY A;  3L00 A;  4IHT A;  3QOP A;  2BEO A;  3CUQ B;  4EJU A;  2MLK A;  5JI6 A;  2H09 A;  4ZZL A;  1CF7 A;  2P6T A;  1X3U A;  3KET A;  5JHU A;  2FMY A;  3KP3 A;  1YW8 A;  3JTH A;  2QEN A;  2QQA A;  5TRD A;  1QNT A;  2OBP A;  1T2K A;  3CDH A;  2XAQ A;  2M45 A;  4HBL A;  1LDK B;  1ZYR F;  1XN7 A;  2ZNY A;  4YFK F;  3JAM Z;  3ZMU A;  3CLO A;  2KIF A;  3RTR A;  1B59 A;  4Y15 A;  1IXS B;  5D5X B;  5D8L B;  2IT0 A;  3T8R A;  5DV5 A;  4RGS A;  4Y13 A;  5LHI A;  3F6O A;  5D8K B;  3QPH A;  1K7A A;  4UVC A;  3DEU A;  1IAW A;  2V9V A;  3V8K A;  4I01 A;  3F8M A;  1TQP A;  4PZJ A;  3LST A;  2DO7 A;  1ZLK A;  2VT2 A;  4I7H A;  4LK1 F;  4G8X A;  2UXX A;  1I6X A;  4OU0 A;  1CGP A;  1ZRD A;  5JVT A;  3RIR A;  1QO0 D;  4Y17 A;  5L3D A;  2IA2 A;  3HSR A;  1XSD A;  4U0V A;  4EQQ A;  3DF8 A;  1PP7 U;  2XAJ A;  4P5O A;  5H6Q A;  4ENJ A;  2P4W A;  4DQ2 A;  1KQ8 A;  2IW5 A;  1Z6T A;  3FXQ A;  2HDC A;  3P9K A;  2VBW A;  4XSZ F;  1W4M A;  3C3W A;  3KFW X;  5J6X A;  1P4X A;  3I58 A;  3Q5F A;  2MH2 A;  3LA7 A;  3LA2 A;  2EFW A;  5JFR A;  4FT8 A;  4ETS A;  2FXA A;  2ZO4 A;  2OZU A;  3GUD A;  2NAZ A;  5FLX Z;  2MD5 A;  4OIR F;  4BH9 A;  3E5U A;  3KP6 A;  5CLS A;  1S8N A;  2UWM A;  1BN5 A;  2Y48 A;  4HQE A;  5E18 F;  3GVA A;  2MA3 A;  1R5G A;  5TJJ A;  1SD6 A;  2QM3 A;  1XD7 A;  1G3S A;  1ZN2 A;  2LDU A;  1S7O A;  1IZ1 A;  4K2E A;  2P6S A;  4QWQ A;  1SD4 A;  5D4S A;  3TGN A;  5BS6 A;  2JPB A;  4WF2 A;  2STT A;  2EA2 A;  3GFJ A;  3RYP A;  5DYM A;  2IP2 A;  4RGX A;  1S6L A;  3TQN A;  1P4W A;  1RIO H;  1SAX A;  3FX3 A;  3GZ5 A;  3TO9 A;  2FBH A;  5ICF A;  3J80 Z;  3QRF F;  4HX4 A;  4IJA A;  4EM2 A;  1ZH5 A;  1XSV A;  5EEG A;  1LEA A;  4A0X A;  4KDP A;  1G6N A;  3I4P A;  3KCC A;  4XLP F;  3P7N A;  4Q4Z F;  2YX4 A;  4M9X A;  1O7L A;  4ZYE A;  1OKR A;  4HX8 A;  4KT5 C;  5HLI A;  1KYZ A;  1K78 B;  4ZYH A;  2ISZ A;  2ADU A;  2ETH A;  3KLN A;  2FA5 A;  3LQR A;  4KYW A;  2A61 A;  2JSC A;  3BJA A;  1YTY A;  5LLQ A;  1H9T A;  3C18 A;  1F1Z A;  2DI3 A;  4YFX F;  4M9S A;  3T8T A;  5E17 F;  3K2Z A;  3FF5 A;  1R22 A;  5ICE A;  1ON2 A;  2V79 A;  3HUG A;  3HSF A;  2EV5 A;  4L5J A;  3DV8 A;  1J75 A;  2OU2 A;  5DD4 A;  2CO5 A;  4KUM A;  1W7P D;  3K1M A;  3MZH A;  1WKM A;  4N9I A;  2HYF A;  3GX4 X;  1ZGA A;  5ED4 A;  1IN4 A;  2O0Y A;  2ELH A;  2B0L A;  2Z99 A;  3RPQ A;  5FD6 A;  5LGT A;  4HW0 A;  5CYV A;  1QZZ A;  5HS8 A;  1SFU A;  2ESN A;  3WU0 A;  3E6B A;  1WRJ A;  3BZ6 A;  3CJN A;  3I71 A;  2IJL A;  1OR7 A;  1XGS A;  3RDI A;  1QZY A;  4FHT A;  2GWR A;  1U5T A;  4BNC A;  2CQK A;  3L7W A;  2J5O A;  2JPC A;  1OPC A;  4L9T A;  1T6S A;  1ZRF A;  3KEO A;  3T5X A;  4OIN F;  1KA8 A;  1TQM A;  2QWW A;  3ZN1 A;  1OYW A;  3ECH A;  3TO7 A;  4UV8 A;  1ZAO A;  5F64 A;  1AWC A;  5DUK A;  3V7C A;  1HW5 A;  4ZYG A;  3R60 A;  4LB5 A;  4UXN A;  5DD8 A;  3JSP A;  2DK8 A;  1J5Y A;  1LDD A;  2FE3 A;  1J9I A;  4ESB A;  4L9J A;  1TW2 A;  3RKW A;  4G7Z F;  3R0J A;  2HWV A;  4KIG A;  2FRH A;  2DLL A;  1P92 A;  2JRT A;  2GXG A;  2GXB A;  1TQI A;  1FBU A;  3SZT A;  3JSO A;  2G9W A;  3DQV C;  2NRA C;  1YS7 A;  3SXY A;  4UVB A;  3G73 A;  2ZME B;  2FSW A;  2MLG A;  1YO5 C;  4O5V A;  4EMS A;  2BYV E;  3VEP A;  1D8J A;  3GZ6 A;  1STZ A;  3RJP A;  4Q47 A;  2MH9 A;  3LFK A;  2JTV A;  1HW1 A;  2M87 A;  1GHC A;  1SD5 A;  2NS0 A;  5H6R A;  5LBQ A;  2DK5 A;  3BP8 A;  2FU4 A;  3ECO A;  3IHU A;  5IT9 K;  3WE3 A;  1MGT A;  2EFN A;  3TKY A;  2H27 A;  3QP5 A;  1XMA A;  2AXL A;  5F6F A;  2IPQ X;  2QBY B;  3CO7 C;  4PCQ A;  3BPV A;  1Z9C A;  4AIJ A;  2PEX A;  2V1X A;  1ZG3 A;  1O3R A;  4BHP A;  3DP7 A;  1QQI A;  4HDV A;  4L5I A;  4GGG A;  2EB7 A;  4RAZ A;  4AIK A;  2X0L A;  3OV8 A;  3WTX C;  1IXR C;  3LAJ A;  3MFK A;  4LLN A;  5HLH A;  2M1B A;  4RGR A;  3TOB A;  4HA8 A;  5FFX A;  4HF0 A;  2G7H A;  4PGH A;  4NB5 A;  3EQL F;  3LAP A;  1BC8 C;  4ZZD A;  2CYY A;  3VB2 A;  4UUV A;  2EA4 A;  2P8T A;  4AIH A;  3HHH A;  4HDU A;  3Q9S A;  2A68 F;  2GZW A;  4ENM A;  1MDM B;  2A5Y B;  5CVI A;  2Y75 A;  4M73 A;  4EJT A;  1FP2 A;  2MBF A;  3Q9V A;  5LRS A;  4O3M A;  1JGS A;  4XSX F;  4LGW A;  3IL2 A;  4Z2Y A;  1Y0U A;  1ONV A;  4CIC A;  3WU1 B;  3FMQ A;  1REP C;  3R6S A;  4A2U A;  1JHF A;  1K6O A;  5HS7 A;  4GYI A;  4CHU A;  4P96 A;  4LFU A;  3ZMS A;  4KMF A;  3ZMD A;  3KE2 A;  4R1H A;  4HOB A;  3HRU A;  5LGN A;  2XIG A;  4HLX A;  3T1B A;  2LSO A;  3VOE A;  3IKV A;  3I64 A;  3E3V A;  2XVC A;  2GIV A;  4OIO F;  1E2X A;  4WWC A;  4IXA A;  5ILS A;  3I59 B;  1FYL A;  2HEO A;  1T39 A;  1HKQ A;  1PUE E;  2XAG A;  2G7U A;  1B6A A;  3NEU A;  1OMI A;  1ZGJ A;  4A0Y A;  2VN2 A;  3COA C;  2DFI A;  1UHM A;  4LMY A;  3MZY A;  3ZQ7 A;  3FHZ A;  5L3B A;  4WCG A;  3G3Z A;  2FF4 A;  2ACJ A;  1SD7 A;  1UFM A;  3HTU A;  2HGC A;  3GEZ A;  3F8C A;  2IRF G;  1U3E M;  2Q2E A;  1B9N A;  2OZ6 A;  2PMH A;  5E1X A;  5FD5 A;  1FLI A;  4KFC A;  1WSU A;  3I5U A;  4AVP A;  1V3F A;  4LB6 B;  5A2Q K;  2MC3 A;  1FOK A;  4I02 A;  2TDX A;  2QZ8 A;  2D1H A;  3C1D A;  2VOO A;  5AON A;  3ULQ B;  4JQF A;  1RI7 A;  2PQ8 A;  3FXR A;  5CVJ A;  4RB1 A;  1OYI A;  4I0A A;  3BY6 A;  3OOP A;  4WXC A;  5DCM B;  1GXQ A;  1OYY A;  3NRV A;  1I1S A;  1BI2 A;  4G6Q A;  1ULY A;  1DUX C;  3ABU A;  5ICC A;  4UVA A;  4MTE A;  1U5T B;  3BJ6 A;  2XKO A;  2OQG A;  2L4M A;  3O2P E;  5KVR A;  5BPI A;  2ZFW A;  1FZP B;  2VT3 A;  2GA2 A;  1TLH B;  2HKO A;  2W85 A;  3SFZ A;  2IA1 A;  1ON1 A;  1R58 A;  4M6X A;  2O03 A;  2LKP A;  2E1C A;  3RKX A;  2QUF A;  4M6Y A;  2KIU A;  2DAO A;  2HQN A;  2HTS A;  1S3J A;  1HKS A;  1RUN A;  2H6B A;  2PBI A;  2AS5 F;  2HYG D;  3ZP5 A;  1TNS A;  1FT9 A;  1H9G A;  1IF1 A;  4ENK A;  4CGZ A;  5BOX A;  4EV0 A;  1YLF A;  1Z1D A;  3PQJ A;  1KQ0 A;  1KU2 A;  3RYR A;  3CO6 C;  5D4R A;  5L3E A;  3DPL C;  3K1N A;  5HLG A;  1FYM A;  2H6C A;  1DPR A;  2F5C A;  2ZXJ A;  4ESF A;  5EEH A;  1E17 A;  3CUO A;  3B02 A;  2EFP A;  3BJO A;  2M5W A;  1HST A;  2JT1 A;  2K4B A;  1IN8 A;  2F5F A;  3WTZ A;  3CUQ A;  2IVM A;  1IXC A;  1UST A;  2W84 A;  2ISY A;  3L09 A;  1ODD A;  2UZK A;  1U78 A;  4D0P A;  1BIB A;  5J8C A;  2VBZ A;  2O6G E;  1TW3 A;  5L3G A;  4RGU A;  5DUI A;  4BHB A;  3QU6 A;  3H3U A;  3P9I A;  2VXZ A;  2EV6 A;  4I2O A;  3WGG A;  2XAF A;  4BHC A;  4EM1 A;  1PP8 F;  4E70 A;  4CO8 A;  3IRR A;  4MQ9 F;  1KQ9 A;  4CXF A;  5ILV A;  1TNT A;  3E97 A;  3FM5 A;  4PDK A;  4LLL A;  3F22 A;  4ASN A;  3HYI A;  2HOE A;  3K69 A;  4MEY F;  3SZP A;  3CTA A;  1KU9 A;  1R7J A;  3DPT A;  2FBK A;  3LA3 A;  1W7P A;  2M8E A;  3L2C A;  1XDS A;  2FML A;  2XHK A;  4UV9 A;  2J5P A;  2W24 A;  1HSJ A;  1USS A;  1J0R A;  4P9F A;  3QP6 A;  5BMZ A;  3V7S A;  3CUQ C;  2OD5 A;  1GVJ A;  1UB9 A;  1BI1 A;  1LVA A;  1KU3 A;  3GFM A;  4HAM A;  3J81 K;  1QPM A;  4WX9 A;  2HFH A;  3FMR A;  3FXU A;  1I27 A;  2R7F A;  1LNW A;  3BOQ A;  3WGI A;  3F23 A;  2YPR A;  3KLO A;  2V6C A;  2WWY A;  2FBI A;  4H0E A;  1MJB A;  1G3T A;  3ZMT A;  4WXH A;  1XGN A;  2CWE A;  1EH6 A;  4KIF A;  2QQB A;  3WTY C;  2Z3Y A;  3JW4 A;  3LWF A;  2P7C B;  3WTU C;  3KP2 A;  1LJ9 A;  3VOD A;  2XRO A;  1P6R A;  2V1D A;  2YSR A;  2E7X A;  2LNB A;  4GCV A;  2RKH A;  1CF7 B;  4HZF A;  1ZHF A;  4G7H F;  5K5O A;  2LF7 A;  1YS6 A;  1YG2 A;  3KZY A;  1NHA A;  2HZT A;  3AAF A;  4ON0 A;  1R1U A;  3HTS B;  4G9Y A;  5KK1 A;  1BIA A;  2HR3 A;  3K0L A;  1G3Y A;  1A04 A;  2LF8 A;  3SHF A;  3JAM K;  2XUB A;  4A6E A;  2M30 A;  2KKO A;  3GXO A;  5D6F A;  3EYI A;  4A0Z A;  4IRG A;  4BAY A;  2DQL A;  3ELK A;  4Q5S F;  4M72 A;  4O6J A;  1FBS A;  4IHS A;  3ZPL A;  2STW A;  1F9N A;  1O3Q A;  4ZYD A;  4YFN F;  4NHJ A;  4CYD A;  4A6D A;  4EGY A;  1K78 A;  1KU7 A;  3H3Z A;  1FX7 A;  4LLG F;  4GO1 A;  1L0O C;  4S04 A;  2XAS A;  3I0T A;  4F7Z A;  3GLX A;  6PAX A;  3N97 A;  4B8X A;  1MJ9 A;  2GA1 A;  2KRF A;  2R7D A;  1DPU A;  2NNY A;  4RB2 C;  2DQR A;  3I53 A;  3QAH A;  4QLC U;  1ZAR A;  5D5U B;  5E20 A;  2KIM A;  3P9C A;  1YW9 A;  2K86 A;  3E6C C;  3F21 A;  1FY7 A;  2O61 A;  2Q0O A;  3IWF A;  1BJA A;  4JK1 X;  3TO6 A;  2EFQ A;  1IN6 A;  3M1E A;  1ZRE A;  4HQM A;  2L3D A;  1L3L A;  5L3C A;  1RUO A;  5H20 A;  5E8G A;  3GWZ A;  2ZJ2 A;  2VOP A;  3WTS C;  1BI3 A;  1O57 A;  4U0W A;  5ICG A;  2HS5 A;  5FLX K;  1HBX G;  2W57 A;  4N9H A;  4OIQ F;  1C0W A;  1GXP A;  3EYY A;  1QBJ A;  1DP7 P;  1MKM A;  2Q8K A;  3F8B A;  2PG4 A;  2CFX A;  2WV0 A;  2W25 A;  4HV5 A;  5J8F A;  2YX7 A;  2A3S A;  3LQQ A;  3HOS A;  1HW2 A;  3HIF A;  3HRM A;  4L9N A;  2P5V A;  4EJO A;  3HSE A;  3FMS A;  4NQW A;  4RAY A;  3R61 A;  5HVQ C;  3T0Y A;  5HDG A;  4P55 A;  1XB4 A;  3W6K B;  4OOI A;  2XRN A;  3RI4 A;  2E7W A;  1EV7 A;  2RVC A;  3MEX A;  2XAH A;  2ZCW A;  1BM9 A;  4EM0 B;  1R23 A;  3J80 K;  3U2R A;  3BDD A;  4CDG A;  2FNA A;  1FSH A;  2DT5 A;  3GW2 A;  2DU9 A;  3M9A A;  4AD9 A;  4UNO A;  4KN7 X;  4KIB A;  4A12 A;  5LHG A;  1G3W A;  3M8E A;  1SMY F;  3GYH X;  5K1Y A;  4G7O F;  1T0F A;  1T98 A;  2D1V A;  2F2E A;  2QLZ A;  3TDZ C;  4LG0 A;  1WWX A;  3WTT C;  3J7A O;  1HXD A;  1IW7 F;  1O3T A;  4M9Z A;  2L01 A;  3BRO A;  2VE8 A;  2ZME A;  3HRT A;  3O3K A;  4XRF A;  4ESJ A;  1VTN C;  1R1T A;  1R1V A;  4I09 A;  1MZB A;  4FX0 A;  3ZN0 A;  4R8H A;  3F8F A;  2K27 A;  1B1B A;  3M7G A;  4UHT A;  4HV6 A;  5IT9 Z;  4S05 A;  1D8K A;  1FYK A;  5LRR A;  4KIC A;  3V4G A;  2VON A;  1XMK A;  1W7P B;  2OA4 A;  1XCB A;  1FP1 D;  2P5K A;  1Z91 A;  2GAU A;  5DCF A;  4OIP F;  2QBY A;  3U1D A;  2UXN A;  4IRI A;  2HKX A;  4MQV A;  4BXU A;  2K02 A;  2ZNZ A;  5AIQ A;  1W5T A;  1RNL A;  1Z05 A;  3DKW A;  3PQK A;  1I5Z A;  3FZV A;  4L0Z B;  3WTW C;  4L18 B;  4GXO A;  2RC4 A;  3WG9 A;  2Z5U A;  2BE5 F;  1IUY A;  4U7D A;  4IF4 A;  4ZH4 F;  4HLY A;  3DFG A;  1JE8 A;  2RDP A;  2ZKZ A;  3MAJ A;  3L9F A;  3ZMV A;  1U8R A;  2DTR A;  2O8X A;  2EWN A;  2QVO A;  4IRH A;  3KP7 A;  4OMZ A;  1BC7 C;  1FBQ A;  2NYX A;  4U0Y A;  3IC7 A;  1FNN A;  4HX7 A;  1SFE A;  1XCV A;  3BPX A;  2VE9 A;  1T38 A;  1MDM A;  1J59 A;  4RS8 A;  1P2F A;  3ERE D;  4B09 A;  2RN7 A;  1P4A A;  4LD5 A;  4IVN A;  1EH8 A;  2PJP A;  3KEQ A;  1JHH A;  1XSX A;  1ZG5 A;  2D45 A;  2XKP A;  3VFZ A;  1WQ2 A;  3F72 A;  4KNY A;  2RNJ A;  3U9G A;  5F1R A;  4MNU A;  2BBY A;  2EJR A;  2V1U A;  3HRS A;  3K9T A;  5D5V B;  4HF1 A;  1LEB A;  3HHG A;  1YIO A;  5ERI A;  1ZRC A;  3V7R A;  1HKT A;  4BQA A;  2CGP A;  2ZBK A;  3EET A;  1RZ4 A;  2FNP A;  4ENN A;  1MJA A;  3I59 A;  1W5S A;  1ZLJ A;  3MQ0 A;  1IN5 A;  5HS9 A;  4WXD A;  5CJ9 A;  4P9U A;  4WK8 F;  3EUH A;  1PDN C;  1IRG A;  2A6E F;  3IKT A;  5ILU A;  3GFL A;  3ROU A;  1UCR A;  2QYO A;  2A6H F;  5DDG A;  1XDU A;  2RQP A;  1B4A A;  2WTE A;  5E1Z B;  5LGU A;  2D2W A;  1SMT A;  4R79 A;  1HQC A;  1I1G A;  1R5H A;  2VOD A;  1TBX A;  2R3S A;  4XBF A;  5FB2 A;  4DNC A;  3MCZ A;  5DEQ A;  2ESH A;  4G6D A;  5L3F A;  5JR3 A;  2K7L A;  3R0A A;  2WC2 A;  2VBY A;  4IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...