2ME0A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens solved in the presence of the dna sequence cgactaattagtcg
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens solved in the presence of the DNA sequence CGACTAATTAGTCG
rcsb
source organism Homo sapiens
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2me0A00
2JJ7A 2OF7A 1HCRA 3OOUA 4CYCA 5F27A 3BTLA 1P7JA 2P81A 9ANTA 4NDLA 4V2FA 2R5YB 2JA6J 3O8GA 3JRDA 3JRAA 1ETQA 3HGGA 4X1EA 2NVTJ 3M4OJ 1HDPA 3Q0VA 3IH2A 1Y1WJ 1ZGWA 2VKEA 2YU9J 3JRGA 3G1OA 3LSGA 5DTDA 3BG9A 3PM1A 2Y31A 4MO7A 3F0CA 2XB5A 4FISA 3LNQA 2LD5A 1IC8A 2JA7J 2ELKA 4BXXJ 2XB0X 3GTKJ 5FKMA 2JMWA 2Y9ZA 1FIPA 1X2MA 1JUSA 5IPAA 5K7HA 2DMNA 2PMZN 4FCYA 5FLMJ 4A3EJ 1I6HJ 2L7MP 2R5YA 1LE8B 4M3GA 2DA2A 3RQIA 2B63J 3SFIA 3IH4A 3IV5A 1ZR4A 4IEJA 3HGYA 4A3FJ 3BR5A 2JA5J 4IHWA 3S1NJ 2EQRA 2KDZA 1HDDC 1B8IB 1ZR2A 3B6CA 1A5JA 1H89C 2NS8A 2M2EA 2CQXA 3MKLA 1X58A 3RZOJ 2M34A 2GBYA 1RKWA 2XPVA 2O8KA 1ETOA 1RKTA 1MBGA 1WCMJ 3A01B 4A3MJ 1ITYA 3TP3A 5J3LA 1G2HA 3GTOJ 2WAQN 5C44J 3K7AJ 4BBRJ 1SFOJ 1LE8A 1WGXA 1U8BA 2EZLA 1TC3C 1FTZA 2FX0A 5DS9A 1XG1A 3QQAA 2DA4A 1GV2A 2IBDA 2IAIA 1SANA 1MBEA 4Y52J 1JTXA 4BBSJ 4QSHA 1Q1VA 1B8IA 3A02A 3L1PA 5HODA 3NARA 1WI3A 1Z0XA 3DEWA 1X2NA 1OCTC 2DMQA 3CDLA 4V2GA 2JN6A 3GBGA 1ZK8A 3S2DJ 1MSEC 2XGEA 1R9TJ 4CYCB 3OSGA 1YRNB 2DN0A 2CJJA 2Y2ZA 2EH3A 2HOAA 5F04A 2CRGA 3A01A 2HI3A 3S16J 5FKNA 2W48A 3BR1A 3JRFA 2XGDA 1ZKGA 3C2BA 5IYBJ 1WH5A 3DCFA 1BL0A 3HDDA 3GTQJ 1ORKA 2R92J 5IYDJ 4A3JJ 3OIOA 1AKHB 5M3MJ 5EDNA 5F1JA 3SDGA 2M8GX 5E3NA 4JP0A 2R5ZB 4A69C 5J1RA 1U9OA 2ZB9A 1DU6A 5IYCJ 1A6IA 1TWAJ 4D5FA 1ETVA 1YRNA 5IP6A 4C3HJ 2FJ1A 2XSDC 1W0UA 1O4XA 1MNMC 2OPTA 3BR3A 3JRBA 3JRHA 3HOUJ 1H8AC 2HYJA 2HXIA 5FKLA 2NVYJ 4M3FA 4RDUA 1APLC 5E3OA 3HBLA 1AKHA 2HXOA 3BG3A 5E3LA 2ME6A 1Y1VJ 2DMTA 1MH4A 2R5ZA 2DA7A 3CQZJ 2E2HJ 3VPRA 1ETWA 2EZHA 4B3AA 1XS9A 4A3KJ 4W1UA 2FQ4A 2D5VA 5EZHA 2DMUA 3HEFA 1GUUA 2ID3A 3HB9A 5M5YJ 1K61A 2L7FP 2ME0A 1ETKA 2DA1A 1PUFB 3ZQGA 3JRCA 3QPSA 4XRSA 1NK3P 3TEDA 4JYKA 4BKXA 1IRZA 2E2JJ 5JLXA 2EZIA 2Y30A 2QF7A 4FE4A 4G12A 3H3VK 1F36A 3S1QJ 2NVQJ 3Q3SA 3Q0UA 4UUSB 2MW8A 2ECCA 5BNGA 3M3YJ 4I6ZA 1T56A 2M0CA 2LR8A 2HQ5A 4LOCA 2K9QA 4BY1J 3MVPA 3GTLJ 4FE7A 3I4MJ 3BTJA 2TRTA 5F0CA 2MSYA 3BTCA 5C4XJ 5EEAA 1W0TA 1VF9A 5IOZA 4M3DA 2CQQA 1ETYA 3HM5A 4X6AJ 3FKIJ 1P7IA 1IDZA 2MG4A 2LKXA 1GT0C 1DU0A 3OSFA 2I10A 1PUFA 1TWHJ 2CUFA 1FTTA 5F08A 1JKQC 1NK2P 2R7ZJ 2E19A 1ENHA 4L5EA 2N8GA 5M5XJ 1OJLA 5EF6A 3ZQFA 2XGCA 4UUSA 1I3QJ 4MFEA 2HOSA 2AHQA 4A3IJ 2DTZA 1S7EA 1OCPA 2ID6A 3GTJJ 3TP0A 4DYQA 1HLVA 4M3EA 2CUEA 1FIAA 3PO2J 4MIMA 4QIWN 3TW7A 5IOYA 5IP7J 5IP9J 1U78A 4XRSG 3HOXJ 1WH7A 2DMPA 3HKZN 5F0FA 3ZQCA 2DA5A 5K7FA 4DZJA 2LTPA 1JTYA 1QVTA 3D1NI 2XRLA 3A03A 2LP0A 2JWTA 1RESA 3HOVJ 2DA3A 2K9NA 2X6OA 1JJ8C 2RAEA 3HOWJ 3S17J 2IEKA 4Y7NJ 3H0GJ 1Z77A 2JK3A 4IHYA 1RETA 5J1UA 3B6AA 3MN2A 1EF4A 2VI6A 1JUMA 1H88C 1BW6A 4A93J 1BA5A 3LSRA 3JR9A 1POGA 4DZPA 1RR7A 1VNDA 2AO9A 2LVSA 3BQZA 1JT0A 3ZQIA 4JX5A 4C3IJ 3BT9A 5J1YA 1QVUA 2L7ZA 4UUTA 1BJZA 1JGGA 4C3JJ 1TWCJ 5FKOA 5F0HA 4A3BJ 4AUXA 4B4CA 2R0QC 1MSFC 4I76A 1XC5A 3NAUA 4M6VA 4BY7J 3BG5A 4D7MA 4XIDA 1LFUP 5EGOA 3FIWA 1IV6A 1FJLA 1ZTRA 1JKRC 2LY9A 3S14J 1VI0A 3BR0A 2M9HA 2GLOA 2NVXJ 5FJ8J 4HNVA 3TW6A 1F43A 4A3CJ 4DW6A 3K2AA 3UKGA 4J19A 3LSJA 5K7ZA 1U9NA 4D5CA 1JUPA 5FLVA 3IH3A 5M5WJ 1MBFA 2L0KA 2XPUA 4IHXA 2NOGA 2VKVA 5GP9A 2MGQA 1AU7A 2EZKA 2TCTA 5C4JJ 4IHVA 2JA8J 1WPKA 1JKOC 2DA6A 1MBKA 2E1OA 2EBIA 1TWFJ 2FD5A 2LLKA 4M3BA 5GPAA 2H8RA 3S15J 3S1MJ 4A3GJ 2XPWA 3HOZJ 1NTCA 3RKQA 2GM4A 3WHBA 3ZQHA 2O9LA 3GTMJ 4S0HB 1B72B 1HOMA 1LFBA 3ZOBA 3I4NJ 1ETXA 4C2MJ 3PO3J 1CQTA 3S2HJ 3BR2A 3RZDJ 2QCOA 1E3OC 2Y9YA 2L9RA 4XICA 2H1KA 1TWGJ 3S1RJ 3FK7A 1AHDP 1UG2A 2LFBA 2WV1A 2O7OA 2WB1N 4MFDA 1FEXA 4GFBA 2YUSA 3CCYA 3QPLA 2X9DA 4W97A 3BR6A 3SJMA 2CU7A 3FK6A 3WHCA 4AC0A 1GVDA 5JLWA 1B72A 3G1MA 3JREA 2HOTA 5C3EJ 3Q0WA 4JX6A 3HOYJ 4D7NA 5EZGA 2E2IJ 3JRIA 1BW5A 1QPIA 2KT0A 2DJNA 2K9SA 2HDDA 2NS7A 4MLOA 2K40A 1UHSA 4A3DJ 5FKKA 4FTHA 1MBJA 2COBA 5E3MA 1QRYA 1K83J 1UMQA 4RBOA 1JJ6C 5EGOB 5EG0B 3W6VA 4JX4A 1ZQ3P 3G1LA 1GDTA 3O8HA 2VPRA 1D5YA 3ZQLA 1IUFA 1IG7A 2LK2A 1HF0A 2X48A 3GTPJ 1MBHA 3BTIA 3FISA 1T33A 2YS9A 1VFCA 3GTGJ 2G0EA 5M3FJ 5GPCA 1IGNA 4A3LJ 4AYBN 1OFCX 1MH3A 1IJWC 4XK4A 2R93J 3LOCA 2ECBA 4DYRA 4QTRA 4XRMA 1JT6A 3BQYA 1RPWA 4B1RA 3LSPA 1JKPC 1GV5A 2Y0SN 1I50J 4EEFG 2VUMJ 4ABZA 1IDYA 3E7LA 4DYCA 5EG0A 5EYRA 3CMYA
chains in the Genus database with same CATH superfamily
1RUNA 2VODA 3FF5A 3W3CA 5E8GA 4BU2A 2H6CA 5F27A 1YX5A 2BBYA 3T0YA 3BTLA 1Y8RB 3RJPA 2K85A 4NDLA 4E7HA 3OS0A 1X3WB 5HLIA 4O3MA 2IA0A 4NBQA 3K4NA 3I64A 2XASA 2HVQA 3C2HA 3Q5FA 3O3KA 4IOAF 2EFQA 4XLNF 3QU3A 3G1OA 2PJRA 3LSGA 3TL4X 4M9SA 4OIQF 4OIRF 3F0CA 3KPHA 2ZSHB 3LNQA 2DYSH 3M07A 5A2QZ 2LD5A 2ELKA 1IC8A 3VDXA 2XB0X 2Y9ZA 1FIPA 2DTRA 3A1YA 1JUSA 1OR7C 2V6CA 2CGPA 2LY2A 5TISC 2QUFA 4AIJA 4BHCA 1IN6A 4NQWB 1U0JA 4DIQA 3VOEA 4YFKF 1FYLA 3ZPLA 2B63J 4S04A 3SZPA 1UB9A 3ESWB 4OMYA 5J6XA 5E18F 1T0FC 2KKOA 3ZGKA 3F8BA 4E7ZA 3HGYA 2OC6A 2JA5J 2R7FA 4A12A 3QYEA 1SEUA 2K5CA 4XMYA 1HDDC 5DM6F 4II3A 4Z2YA 1LJ9A 4B8XA 4HG2A 1TP4A 2CS3A 1YS6A 4XBFA 4ESJA 2CQXA 3V8JA 1LB2A 3MKLA 5B66C 5ICEA 1X58A 3OIPA 2NXNB 2GBYA 3D5SC 3RZOJ 4B48A 2O8KA 3DEEA 1DP3A 1WJDA 3SDBA 1WCMJ 3A01B 1A31A 2XAQA 3TDUC 4U7BA 3K7AJ 4Q48A 1SFOJ 2CH0A 3QP6A 3K6GA 1KQ8A 1RIOH 4NQWA 2FF4A 2E60A 1FTZA 2FX0A 1J75A 4ZDOA 1XG1A 3KCCA 4MEXF 1ZYRF 1LPQA 4AIKA 1Z1DA 2ACJA 4ESFA 1MBEA 2XAJA 3P5JA 4UUVA 1JTXA 4BBSJ 4QSHA 1Q1VA 2ZFWA 4AVPA 2O03A 4CCKA 5HODA 3E3VA 2MH2A 1Z0XA 3DEWA 5HLHA 3NWSA 1OCTC 1D8KA 3CDLA 4A6DA 4RB0A 3F8FA 3DKYA 4CYCB 5K1YA 2X1EA 2Y2ZA 3W6JB 2EH3A 3GX4X 5F04A 3A01A 2HI3A 3A2KA 3ISPA 4I02A 5FKNA 2JRTA 3BR1A 3COAC 1ZKGA 2X4HA 5K5QA 1WH5A 4PJLA 5CVUA 1IUYA 4N4NB 4XR6A 3DCFA 1LNWA 3LSKA 3GTQJ 1ORKA 2R92J 2OQGA 2HEOA 1Z21A 3CDHA 3RPQA 2XROA 4LG3A 2BEOA 5EDNA 4U0YA 1YTYA 3SDGA 1NG7A 2M8GX 2Q0OA 2Z3YA 5E3NA 3HTSB 4XKCA 4BH9A 2QQBA 1WWXA 3H3UA 1R36A 5FD6A 5J1RA 1U9OA 1V54H 1VQ9I 4XSZF 1DU6A 1A6IA 3OYNA 4UNOA 1MNDA 3EPZA 2BOLA 3K2ZA 3U21A 3KP7A 4EJUA 3OYLA 2ESNA 1G3WA 2ADUA 2IGKA 3HIFA 1MNMC 2KPMA 2OPTA 3BR3A 4RS8A 1MJBA 3JRHA 1H8AC 1YW7A 2XAGA 3DEUA 2HDDA 1APLC 1ACIA 5E3OA 3HBLA 5E3LA 1I27A 1K7AA 2XF6A 1R22A 1XPXA 4HBLA 2JA2A 2VE9A 1C0WA 2WTEA 3L9FA 3RIRA 1GXPA 5LLQA 2E2HJ 2DJIA 1XS9A 3VFZA 2QGUA 3DBRB 3CC4I 4W1UA 4LD5A 2K3PA 2Y75A 2OTLI 2ZJ2A 1MMNA 1GUUA 1YYVA 2L7FP 1K6OA 5KAFC 2W85A 3ZQGA 3JRCA 2W82A 3ZMDA 4HZFA 4BL0B 2R7OA 1ZG5A 1QU3A 5JLXA 3ULQB 2QF7A 4G12A 3S1QJ 1F36A 2FU4A 2NVQJ 4E7JA 5F64A 3BPVA 2MW8A 1VQMI 1BR1A 1ODDA 3OYCA 2VIXA 2BY3A 2JPBA 4A5NA 1I6XA 3HKZA 1SFKA 3HJEA 1EH8A 4XNFA 2HQ5A 2E5NA 4BY1J 4QPQA 1FY7A 4BJ6C 3H35A 2NNYA 5KHDA 3BTJA 1LQ1A 3V4GA 1XDUA 3A4CA 3MWMA 2VC1A 4M3DA 5IOZA 1H0MA 5BS6A 5DYMA 1ETYA 3HM5A 4AIDA 5JFRA 5HNFA 2LKXA 1GT0C 2X51A 2DT6A 2GAUA 3H5RA 2I10A 3RDIA 3ERED 2CUFA 5F08A 4YFXF 5FB2A 3L09A 2E19A 3O6BB 2P5KA 3FDYA 2N8GA 2C6YA 3J7YJ 2Z9OA 1I3QJ 2QSGX 4RGUA 4Y33A 5HNHA 5DD8A 1OCPA 2ID6A 4HYEA 3J81Z 1VQ6I 4CZCA 2DW4A 3AFHA 4DYQA 3V8KA 1MNEA 3DPTA 3L7WA 5HDKA 2EV5A 1FIAA 2MD0A 4X0GA 1QGPA 6PAXA 2M1BA 2FEZA 4QIWN 4G7ZF 2K86A 2CQKA 3TW7A 5IOYA 1QQIA 1S5LC 1ZAOA 5IP7J 1U78A 4XRSG 3OWTA 1WH7A 3EUHC 4EM2A 4KYWA 1NG6A 5K7FA 4DZJA 2LTPA 3DKWA 4LK0F 4N9IA 1XGNA 2XRLA 3A03A 4M6XA 1D1BA 2ZJQF 1CGPA 4HQMA 5GAEJ 2OJED 1Z91A 1IW7F 2MLGA 3RSNA 1OCCH 4MGRA 2JT1A 3S3MA 4IHYA 2CW7A 4IZZA 1FBSA 3F21A 1EF4A 4BS9A 3KE2A 3CCRI 1BR4A 2EINH 1BW6A 4A93J 4A6EA 2MBFA 1BA5A 4BYYA 5IT9K 3K4MA 2JUGA 1RC9A 1YS7A 4DZPA 2HOEA 3E97A 4LB5A 4Y4RA 1S29A 1BI3A 1RR7A 1VNDA 1G8XA 4ZYHA 3GLXA 2P7CB 2W25A 4KA4A 1BIAA 2ZMEC 4MNUA 1X4PA 3DPLC 4UUTA 1G59A 1TWCJ 5K5OA 2P8TA 2YX7A 4L9TA 4KISA 4ZYAA 1MSFC 5BPDA 1Y8QB 2CQNA 3WU1B 2M3AA 2IS2A 2OD5A 3FIWA 1FJLA 1N25A 1JKRC 3KLOA 3BR0A 2M9HA 3DV8A 1FMVA 3QOPA 3E6MA 2GLOA 5KVRA 3GFJA 3HHHA 5CPRB 2NVXJ 3OYDA 2DLLA 5F1RA 2W00A 5KAIC 3ZMTA 4A3CJ 1BI1A 2QQ8A 5DCFA 3RQ4A 4CICA 4DW6A 2ZC2A 2PJPA 4WXCA 3OV8A 2IA1A 5K7ZA 3I0TA 1JUPA 5FLVA 2LYCA 5ILVA 3IH3A 2FE3A 3NQOA 3T8TA 2R7TA 1A36A 4IHXA 2NOGA 2VJJA 2R7RA 1BC8C 4IQJA 3CUQB 1YLFA 2FRHA 1XSXA 3E1SA 2EZKA 2TCTA 2A05A 4ESBA 1TQPA 2W57A 3RYPA 5C4JJ 2HZDA 2G7UA 2RQQA 2IW5A 4RAZA 2ZSIB 5D4RA 2WC2A 2HU9A 2H8RA 4A3GJ 3S1MJ 2KP6A 2XRNA 1NTCA 2GM4A 2O9LA 2HWVA 3GTMJ 1I39A 4S0HB 2HVRA 3PSIA 2FOWA 1B9MA 1HOMA 1LFBA 1TTYA 3I4NJ 3G6EI 3WGGA 3T1BA 1ETXA 4BE1A 2W4SA 5HOOA 4OAYA 4L18B 2AXTC 3N4MA 2QCOA 2XKOA 2A6TA 3GZNB 2EIKH 5DEQA 4HRIA 2BHYA 2Y9YA 2BZTA 4HAMA 1W1WE 2DU9A 5DCMB 2A5WA 3QPTA 3S1RJ 1PUEE 3CUQA 1VQ8I 1UG2A 3FXRA 2EFPA 4G9YA 2LFBA 3BZ6A 4E7IA 2F4MB 2WV1A 4OMZA 2DT5A 2WB1N 4YIIA 4MFDA 3QYBA 3QPHA 4HDUA 1F5TA 2X6YA 1BN5A 3CCYA 3IAM2 4W97A 3BR6A 3IWFA 3IRRA 2XAUA 1GVDA 3IWZA 5F6FA 3C3WA 3OL3A 1IRXA 3JRIA 2QBYB 2XC7A 1QPIA 2IS4A 2CQ7A 3CC7I 4RB1A 2RKHA 2JVGA 3SZTA 4CCJA 2EILH 2R7UA 3KZZA 3G3ZA 5FKKA 5E1WA 5DCMA 4CXFA 2COBA 5E3MA 1K83J 1NHAA 1D0YA 5FGMA 3F8CA 3N97A 4DBRA 1USTA 3Q9SA 3W6VA 4UVCA 1I1GA 4EVIA 1SFXA 1UELB 1F9NA 1XCBA 3G1LA 3WTUC 3MEXA 4ZC3A 1KQ9A 3PUFA 3J80K 1IXSB 5LHHA 1S6LA 1HF0A 3K4KA 2V9KA 2VQHA 1IV8A 5L3FA 1LEBA 1T33A 2BYVE 1T2KA 5M3FJ 4ANJA 5J4VA 2KZGA 3VYTB 2QBYA 3GZ5A 4AYBN 1OFCX 3E6BA 2H27A 5FRNA 3AG1H 3S32A 2GA2A 4HV5A 2R93J 1GLNA 3HYIA 2R7XA 1I1SA 4HNTA 1JT6A 4BDYA 2F2EA 3BQYA 3DKXA 2NOJB 3VEPA 1BR2A 1QHHD 3FXMA 2Y0SN 3LSPA 1JKPC 4EEFG 3GMEA 2CMPA 1SD4A 1IRFA 1DP7P 5EYRA 1RR8C 4B3XA 2DBBA 5HS9A 2E34A 3WTTC 2STTA 3CMAI 1ZN2A 1R00A 2M30A 2P81A 4TV7A 9ANTA 4AWXB 2P6SA 3OL4A 2R5YB 3ZN0A 3DLLF 3JRDA 4O6JA 1E0EA 4E7KA 3M4OJ 4KICA 4LGWA 5HLTA 1QO0D 1TLHB 2VKEA 3M1CA 3BG9A 2A68F 4BACA 2Y31A 3K4JA 3MD2A 4MO7A 2ZCWA 2XB5A 2IGMA 2P6TA 2JA7J 2XF7A 4IRHA 1EA3A 4G7HF 1T95A 4BXXJ 2DOFA 5LEKA 3GTKJ 5IT9Z 2JMWA 5IPAA 4FHTA 5E8IA 5KK1A 2QKLB 1BC7C 1SVOA 4FCYA 5FLMJ 4LLNA 2L7MP 1K79A 4IRGA 2R5YA 1LE8B 4Y3OA 2DA2A 3OYMA 3HOSA 5BOXA 2W84A 3SFIA 4Z6YA 2HDWA 1Y56A 2AQEA 2OA4A 4IEJA 4XOTA 4NHJA 4IHWA 2HPIA 5HLGA 2O8XA 3V7RA 2KDZA 4PCQA 1MMAA 3IKVA 1A5JA 4HSTA 2CV2A 5CVIA 1FWZA 1OCOH 3BG6A 1W7PB 3KYCB 1B6AA 2KIQA 2VKHA 4CDGA 4KT5C 2XPVA 1S9HA 3HUGB 4M9ZA 2LF7A 4M73A 5JVGF 2VXZA 4A3MJ 1R6RA 4XONA 2WAEA 1ZHFA 2WAQN 1G2HA 5C44J 1UZCA 4BBRJ 1LE8A 1WGXA 1LDJA 1R1UA 2HQAA 4DNCA 1TC3C 1FOWA 3CMEI 1A6QA 3DF8A 4I7HA 4ZH4F 4WXHA 2JTVA 3K10A 2Z16A 3I3LA 2Y48A 1QPMA 3QQAA 2F5FA 1GXQA 3LSTA 2IBDA 3CCVI 2IAIA 4XSXF 3KETA 4JOMA 1R1VA 1VQPI 3FXOA 4YIFA 2M5WA 3PNTA 3L1PA 3MCZA 3VB2A 2DMQA 1ON1A 4L9VA 2JN6A 3GBGA 5BPIA 1H9GA 2XAFA 3ZMVA 1ZGAA 3S2DJ 1W7PA 2BW3B 2XGEA 4ETSA 3DTIA 2RVCA 2CJJA 2DN0A 5J8FA 1K4SA 1J09A 2QWWA 5LGUA 3CLOA 2H6BA 4C2TA 2W48A 3JRFA 2DODA 1H9TA 2DFHA 1BJAA 1IRGA 3OYIA 1AOYA 1WJEA 1TL8A 3HDDA 1BM9A 5IYDJ 4BXUA 2M7AA 2NS0A 4ZYGA 1LEAA 2K4BA 5M3MJ 4EMSA 2RGVA 2LF8A 3U9GA 3CP2A 5LRSA 3R0JA 4HX7A 2K3FA 4PZJA 3K0LA 4A69C 1U5TB 2ZBKA 4IRIA 3IHUA 4B09A 4XLPF 2XHKA 2ZB9A 3JCUC 3IKTA 5IYCJ 4RB3C 2BW3A 1O3RA 1ONVA 1U2WA 2OQRA 2LDUA 2VT3A 2FXAA 2RN7A 1IN4A 2ZXJA 2FJ1A 2OUMA 2XSDC 3OYBA 5L3BA 3OIQA 2L9VA 4HEA2 3PNVA 4C30A 2DPDA 3ROUA 2VBZA 4Q5SF 3H1CA 1JHHA 3BG3A 2ME6A 3J80Z 1HSJA 2ZNYA 1TW2A 1ERDA 2WAFA 3A0BC 4HOBA 3CQZJ 1U5TA 2J5OA 3S3NA 1FOKA 1KU3A 2PFBA 2DMUA 2E1MC 1K61A 4CH7A 2L4MA 1R5GA 1ETKA 1T39A 1JHFA 3QPSA 1NK3P 2JQ7A 3TEDA 1X1CA 4JYKA 3WU0A 2E2JJ 1HKSA 2EZIA 2PMUA 2BVLA 3WGIA 4GYGA 4U7DA 4CCOA 3Q3SA 5L3CA 4JBAA 2ECCA 4ENNA 1W7PD 4H0EA 3WGHA 2K4JA 4NB5A 3DLAA 1Z3XA 1DGWY 2QKMB 4UB8C 3M3YJ 3RPUA 2LR8A 2JPCA 2K9QA 2UXNA 4PUSA 3KP3A 3CD6I 3K4BA 2PI0A 3I4MJ 2TRTA 1U3EM 5E20A 3ONQA 3KP4A 1WJCA 2FBIA 4ITVA 4YEJA 2CUZA 3S3OA 4HSRA 2CQQA 5CVVA 4CA0A 1IDZA 2EV6A 1DU0A 3FMSA 3OSFA 2D45A 3F6VA 4JQFA 1P92A 4QWQA 1YIOA 4ZJZA 1TWHJ 2K9LA 2FNPA 3OYEA 1X1BA 1IXRC 2R7ZJ 5GAHJ 3MKYB 2JSCA 1OJLA 2ELHA 2OZUA 2ZXWH 5EF6A 3OYGA 2M7BA 1OR7A 2E35A 1JI8A 2BGCA 1R7JA 2KZVA 3KP5A 4A3IJ 1S7EA 2VONA 4IQ4A 4GRIA 3TP0A 2WBMA 2R7VA 1HLVA 2HZTA 1ZELA 2DFIA 5JHFA 5H20A 5ILSA 4XKWA 1YIJI 4LJZF 1W5SA 1WQ2A 1T0FA 2BXYA 3HOXJ 2DDBA 5CJ9A 4I99C 3LL7A 3DTEA 2GIVA 3LMMA 4N9HA 2M87A 4EGZA 4BE0A 1TW3A 4A2UA 2X1CA 3CESA 2CFXA 2K9NA 2QQAA 4LFUA 3EYIA 1JJ8C 3KLNA 5BMZA 2A6HF 3S17J 3LA7A 4AU7A 2IEKA 5GTIC 3WODF 3ABUA 1SD7A 2BY1A 4P5OA 3L2UA 3H0GJ 1Z77A 2RDPA 4A0XA 5CVRA 2L4AA 1RETA 2B9SA 5J1UA 3B6AA 3BLYA 1PP8F 1Y39A 2VI6A 1LFPA 4KMFA 2JSPA 2RNJA 1POGA 1SD6A 3EUKL 4NC7A 3OYAA 3WTXC 2F5VA 2AO9A 3KEYA 1JT0A 3F8NA 3ZQIA 4DGWB 4C3IJ 3WG9A 3FM3A 4U0WA 3CJTB 2MFZA 3ELKA 1P4AA 3S2WA 2A61A 2R0QC 3K69A 4ZZLA 1XC5A 5DUIA 3F6OA 3BG5A 5KNLA 3QRFF 4RM3A 1KYZA 2P4WA 5E1XA 3GYHX 4B43A 2KRHA 2DOAA 5D5VB 1R5ID 3S14J 1UHMA 4V19K 2GXGA 4F93B 2KFDA 2MC3A 3DQVC 3MMYB 2YU3A 1F43A 3TBIA 1P2FA 2L7KA 1O7LA 2VXDA 3LSJA 3ZP5A 3IC7A 4F3QA 1I5ZA 2WB1A 2CW8A 1HW2A 1BOAA 4E7LA 1GVJA 4PSXA 2KDOA 4PJNA 2L0KA 2XPUA 3JW4A 1MD0A 1SC7A 1FT9A 5GP9A 2HQNA 4OINF 3SYTA 2FBHA 3L00A 3V8LA 4CCNA 1AU7A 5EEGA 3L2QA 1OMIA 1Z7UA 2QQ9A 2NVUB 3F8MA 2UV1A 2GXAA 5TGTA 1MBKA 2E1OA 2EBIA 2FD5A 1D3YA 2HTSA 1PJRA 3LSMA 3RKQA 2V1DA 1FP2A 3P9CA 4J00A 1SVMA 1ZG3A 3PFIA 2DOEA 3U1DA 1MZBA 3OYJA 3HG9A 5D6EA 3S2HJ 3M7GA 2IVMA 4DBQA 2K02A 2LBFB 3R6SA 4GDFA 2L9RA 2HKXA 1TWGJ 2IGNA 1AHDP 3FK7A 1T08B 2DFFA 4I0BA 1WRJA 4HLXA 3BJ6A 2DXIA 3ASNH 2O7OA 1YJWI 3O2PE 1MMGA 2BXZA 2HYFA 4AYBA 1ZRDA 5HVQC 3G73A 2PLYA 1Z05A 2FMLA 3QPLA 4EM0B 4LG0B 2L2OA 1D1AA 2CU7A 3FK6A 3DFGA 1GHCA 5CKTA 4G6QA 3G1MA 3Q0WA 3CZ6A 4JX6A 3BDDA 5J47A 1LUJB 2Y0SA 3HRUA 1FOXA 2IGOA 2P7VB 4CUGA 2KT0A 2KMUA 2K9SA 3R60A 2NS7A 2F5DA 3EETA 3I5UA 2LBFA 3OS2A 2DPUA 4KIGA 2OCCH 2J5PA 4RBOA 3SQNA 4ZDPA 4FASD 3UNGC 4KT6A 1QZEA 1RRJA 1GDTA 2X6WA 3M8FA 1P4WA 3B73A 3G4SI 1OPCA 3G2BA 1IG7A 2LH9A 4LG0A 5FLXK 3QWLA 2X48A 3C2GA 1KQ0A 4H4KC 5CQGA 3LAPA 1F1ZA 4FETA 4KN4X 4L9NA 4YIRX 1VFCA 2DK8A 4P55A 2V9PA 1XTAA 4E70A 1N75A 1R1TA 4GCVA 5GPCA 3FBIB 3E6CC 2QYOA 3FXUA 2KRFA 1YFHA 2KJBA 1WHUA 5D6FA 4XK4A 4IF4A 1WI9A 3RCOA 4IL6C 2CO5A 2WADA 4ZDLA 2PEXA 2V1XA 1STZA 3BROA 3HZJA 3FMRA 2O6GE 4WF2A 2E1CA 3HL2A 3S93A 3J7AO 3T5XA 4L5JA 2UWMA 3ZQQA 2HVSA 1Z6RA 3EUHA 4HF0A 1J9IA 3HSFA 2JJ7A 2OF7A 1HCRA 1G3SA 2X85A 2ZMEB 1B1BA 3OOUA 5L3DA 4YFNF 3RI4A 1G6NA 5J4YA 2I8DA 1UFMA 2YR2A 3K4CA 4V2FA 4LLLA 2VKDA 1FPQA 4WK8F 4UV9A 1ETQA 1UG0A 3HTUA 3HGGA 3HOTA 2B7EA 1WJAA 4X1EA 2NVTJ 4P1WA 3CO6C 3Q0VA 3W2WA 1X1DA 3IH2A 1V5EA 1Y1WJ 1ZGWA 2YU9J 4IHSA 5LRRA 2F6CA 3I54A 5DUKA 2LMDA 1DPUA 4XOPA 1IN7A 3K1PA 2WAQA 2K27A 3V7SA 2A69F 1KZHA 1FSEA 2LY1A 4NC8A 5CQEA 3E0JB 1X2MA 2VJIA 3ZMUA 3FBNB 1IXCA 1JXSA 3OR2C 4HPQA 3LSIA 1Z3YA 2ZMEA 2CFOA 2PMZN 4Y13A 4A3EJ 1HKTA 1I6HJ 1XD7A 5ICGA 1MGTA 2H1LA 4M3GA 1VTNC 3HPHA 5IY5H 2QEXI 3NRVA 3M1EA 1MMDA 3CJQB 1V3FA 2BHZA 2GOXB 2LSOA 2O3FA 4BE2A 2JVHA 2VBYA 3F23A 1ZR4A 2H09A 4ZTFA 4A3FJ 3BR5A 1J59A 3S1NJ 2HTJA 2VOPA 3GFIA 4PK4A 1ZR2A 1XDSA 3LQQA 4QPOA 4XRFA 3LA3A 5B3SH 3W2VA 5ED4A 1V4RA 3DTKA 3GFLA 2ZKZA 2M34A 1RKWA 1O3SA 3FHZA 2M0MA 2CWEA 3J7ZI 1ZLJA 3FMQA 4XORA 1MBGA 3TP3A 2EJRA 2A07F 3OOPA 3GTOJ 2EFNA 3M9AA 4Q47A 3KFWX 1A35A 1U8BA 3ABLH 4N4OB 3FHNA 5DS9A 4L0ZB 3N05A 1S72I 2DA4A 1GV2A 5HDNA 3OYFA 2V7FA 1SANA 3CJRB 1SFEA 2D1HA 2Q1ZB 3SHFA 3F72A 1Q1HA 4Y52J 2VBWA 2PN6A 2XSJC 4HA8A 2P5LC 3A02A 2XUBA 2LRDA 2WY8Q 1WI3A 4UY8I 1X2NA 2R3SA 3HSRA 4V2GA 4BAYA 1X1AA 2HPMA 1A04A 2CUJA 4Y15A 3OSGA 3CTAA 1YRNB 3VWBA 2I5UA 2HOAA 4P9FA 3WTZA 3AAFA 1HKQA 2XGDA 4IO9F 3KZYA 3C2BA 4P96A 5IYBJ 4LMYA 3K70D 1OISA 5FRMA 2KIUA 1ZH5A 5DV5A 1BL0A 2FA5A 2QSFX 2HR3A 1W36D 3I4PA 5TRDA 3B02A 3EYYA 3WG7H 2MA3A 1IZ1A 1PYVA 2GXBA 1AKHB 5F1JA 4Y17A 4EJTA 3LQRA 1M1EB 1REPC 4C2UA 4IPAA 3MQ0A 5HS7A 3CCMI 3KX2A 3SZGA 5J8CA 5FD5A 2ZXIA 3RKXA 1VQOI 2HS5A 4F55A 2OU2A 2WY7Q 1YRNA 5IP6A 2V1NA 2BY2A 1V5GA 2EB7A 2A3SA 3E6DA 1IAWA 5L3GA 3KEOA 2E7WA 1O4XA 2GIZA 3JRBA 5B1BH 1ZREA 3H9JA 3I9V2 4MQ9F 4BUPA 4WWCA 5IT3A 2BVMA 2M4KA 4L5IA 2HXIA 2E7XA 2NVYJ 3AL0B 2OBPA 2HNHA 2R7QA 1AKHA 3I59B 3DWLE 1JE8A 1Z6TA 1Y1VJ 3EUAA 3TMOA 5HDGA 2IT0A 1AA7A 1MH4A 5JVTA 3AG4H 3QOEA 4LIUA 1XCVA 2QSHX 1ETWA 2EZHA 3GUDA 4B3AA 4ZZDA 2KIFA 1ZRFA 1XGOA 2FQ4A 2D5VA 4GXOA 3EQLF 4IXAA 1B4AA 2E1NA 3HEFA 3UR3C 1TT0A 3FXLA 2PQ8A 4XRSA 4NC6A 2R7SA 1S8NA 2W1OA 4IOCF 3MAJA 1TNSA 2Y30A 1SAXA 4FE4A 3H3VK 1OYWA 2NYXA 3DU5A 3ABMH 2JZYA 2DT7B 5BNGA 4I6ZA 3VYRB 4UXNA 2M0CA 3I59A 2XF5A 4LOCA 2NNNA 3AG3H 1PP7U 3GTLJ 4LITA 4FE7A 2AQFA 3H9QA 4CCLA 4UHTA 2MSYA 2RQPA 3BTCA 3OYKA 1FX7A 1VF9A 3K4LA 4X6AJ 1FZPB 3QP5A 3FKIJ 1XMAA 4AD9A 3TQNA 1VZ0A 2W24A 4RM2A 1DPRA 4OIOF 1LDDA 2ISYA 3GXOA 1QZYA 4XN0A 2ZJPF 5GTHC 1JKQC 1YW9A 4E6KG 2MD5A 2HQRA 1ENHA 2IP2A 1QNTA 1X1PA 5M5XJ 3PJRA 1VQLI 2ESHA 2LOOA 3ZQFA 3F22A 4MFEA 2DAOA 4C9YA 2E36A 5CYVA 2AHQA 2DTZA 3CP8A 3RYRA 3CF2A 3GTJJ 1O7FA 3FXQA 2RREA 4RB2C 4CHUA 1DQUA 1Y6IA 2OCEA 4M3EA 4MIMA 1MKMA 1WJFA 4HW0A 2DQRA 1X3ZB 5DD4A 4OU0A 2IA2A 4PJMA 5IP9J 3H9GA 2DMPA 5F0FA 3SEZA 2IPQX 2LKSA 4P9UA 3IP4B 3CCSI 1JTYA 1D8JA 3D1NI 4K2EA 4UVAA 3CCEI 3ZMZA 1X4OA 1XGSA 5JR3A 1R4NB 3HHGA 5B1AH 3HOVJ 1LVAA 2DA3A 3WTVC 2X6OA 2RAEA 2PMHA 2XAHA 1LDKB 2HYGD 4MEYF 3REOA 1P9QC 4Y7NJ 3E5QA 3TO6A 1OQYA 1FP1D 2JK3A 2V6EA 3MN2A 2D1VA 4ENJA 2YX4A 3FZVA 3DPUA 4J01A 3GCMA 4GGGA 2CV1A 3BQZA 1VQ4I 2RC4A 1R23A 4JX5A 4ZTJA 3BT9A 5J1YA 3KYLA 2P5VA 4UVBA 2CG4A 1BJZA 3JSPA 2DDAA 5FKOA 4A3BJ 2IXSA 3ASOH 3BWGA 4M6VA 4PDKA 5TJJA 3E5XA 4BY7J 1EKEA 4KJZA 1BI2A 3SEQA 1LFUP 2L3DA 2OTJI 5EGOA 3RKYA 1IV6A 2XGXA 1FOYA 2EA2A 2GOMA 2F4OB 1N78A 4CZZA 4PSWA 5FJ8J 4G6TB 3PNYA 4HNVA 2IRFG 1J5YA 3TW6A 5ERIA 3K2AA 4J19A 2V26A 3GLLA 1HBXG 3M8EA 4CO8A 1Z9CA 4IKFA 5FO5A 1D0ZA 4F91B 3CLQA 5M5WJ 1MBFA 1LKXA 1I3AA 3SFZA 2UUZA 2VKVA 2E71A 2ETHA 4AM3A 2R7WA 1YW8A 1OCZH 2WV0A 4XKVA 1WPKA 4HLYA 2E1MB 4GO1A 1T8IA 1JKOC 5LHIA 1HA8A 3BJOA 3TDZC 3AG2H 3BCBA 1UJ8A 3H3ZA 5GPAA 1TWFJ 2LLKA 3KP2A 3S15J 3J81K 3ABKH 3HOZJ 1ZARA 3F9KA 1B72B 2MLKA 3KEQA 2LC2A 4L9JA 4PFOA 3LA2A 3VODA 3ZOBA 2RNGA 4RGRA 4WXDA 2UZKA 1LVKA 4B44A 4BQOA 1QA6A 3BR2A 3RZDJ 2Q2EB 4XKBA 4G94A 1E3OC 3BJAA 2L01A 3D0SA 3QU6A 4XICA 4I98B 3V42A 1TT5B 4LK1F 2EFOA 3Q9VA 1D1CA 4KIFA 1Y0UA 1MJAA 2V79A 1E3PA 3NWTA 1QZZA 4U0VA 1FEXA 1TNTA 3FXKA 4GFBA 2YUSA 3GO5A 2R4GA 1L0OC 1UHWA 5HS8A 2X9DA 2VC0A 2G7HA 4HDVA 5LGNA 2QZ8A 1B72A 4NUBA 3JREA 1YO5C 4MQVA 4M9XA 2M8EA 3HOYJ 5EZGA 2E2IJ 3I56I 1XMXA 4KITB 2AXLA 2IS6A 4U88A 3CF5F 1FYMA 1G3TA 1K6YA 2ELJA 3HRMA 4PJ0C 2HGCA 2Q2EA 4MLOA 2O5RA 2LKPA 1XSVA 2VQLA 1VQNI 4EJVA 4XLHA 1WJBA 2XIGA 4FTHA 3QYFA 4RA2A 3LFKA 5EJCA 3PL8A 1JJ6C 4F92B 3PFYA 5LBQA 5EG0B 1KYWA 2DK5A 1SD5A 3OYHA 2VLAA 3PUBA 1IUFA 4XM3A 2LK2A 4O5VA 4FX0A 4UB6C 2G9WA 3GTPJ 3DP7A 3CCUI 1MBHA 4GYIA 4CCMA 3FISA 2VOOA 4R8HA 2G0EA 2XKPA 3ZN1A 3I55I 1NH3A 2Z2SB 1IGNA 1MH3A 2ZFUA 4F52A 4ON0A 2IJLA 3H36A 4OAZA 2ECBA 3RPUD 4RAFA 4R1HA 2XDVA 1ZLKA 4XRMA 4BQQA 1MMSA 2PMZA 2PBIA 2L9SA 1RPWA 4B1RA 4EJWA 5ICCA 4R79A 1I50J 4OWRB 3CO7C 4S05A 5ILUA 2CSOA 5EG0A 2X6XA 2KISA 4FX4A 3TKYA 2DQLA 2FUG2 3HSEA 4G7OF 2EV0A 3BOQA 4CYCA 1K78B 5H6QA 1BIBA 1BI0A 1P7JA 2QENA 2L5QA 3DBHB 4BDZA 2XV4S 1VQ5I 2JA6J 3O8GA 1Y0NA 3JRAA 1J7KA 3GZ6A 2AS5F 1KONA 1S7OA 4DJAA 4NNJA 3IRQA 1HDPA 3MKWB 1R5HA 3JRGA 5D5UB 3RTRA 3GEZA 4PGGA 4B47A 5DTDA 1VQKI 1RI7A 3PM1A 3ZRGA 1E17A 2L9NA 1KGSA 3DU6A 1YITI 4FISA 2H94A 1B9NA 1YJ9I 2GQQA 4L0YB 5FKMA 1VQ7I 2JUCA 5K7HA 2F5CA 2DMNA 3KIOA 4M71A 1OCRH 2WA0A 2XVCA 3GFMA 4ENMA 1K78A 2QLZA 2FQ3A 4PJJA 3JTHA 3H5NA 2EIMH 2OZ6A 3MZ8A 2ZXHA 1T98A 3RQIA 3R0AA 2F5EA 5CLSA 3IH4A 1SMYF 2H8WA 3IV5A 5LFAA 4IVNA 2EPFA 2VJ5A 5E17F 1U6GA 3U1KA 3LSHA 1R49A 4DQ2A 3PIOF 2EQRA 2VT2A 1B8IB 1HSTA 3B6CA 3ZR8X 1H89C 4BHPA 3VYSB 3I53A 2NS8A 2M2EA 4XLCA 4DOZA 3AKZA 1WVRA 5LGTA 1YX3A 3FM5A 1ETOA 1TBXA 5GADJ 1RKTA 2LNBA 2V9VA 5DDGA 3C1DA 1ITYA 4G6DA 5J3LA 2HDCA 4IHTA 2ICWG 2LG4A 3GF2A 2Z33A 3K1MA 2EZLA 1SFUA 4YG2F 4KNYA 1E3HA 2KRCA 2BE5F 2DFEA 2GZWA 4KMUX 2DYRH 4F7ZA 3WTYC 3WTWC 1WJ5A 2Z5UA 1YI2I 1L3LA 1B8IA 3C7JA 4EM1A 3BC8A 3NARA 1QHGA 1G4DA 4KFCA 4MHGA 1ZK8A 3OR1C 2LREA 1MSEC 2F4IA 3GWZA 1R9TJ 2FNAA 5H6RA 2NRAC 1TQMA 2L54A 2CRGA 3S16J 2VB6A 1UAAA 3TOAA 2K9MA 1WFXA 2P0WA 3TO7A 2B0LA 1HC8A 4WCGA 2RV8A 1IO2A 5GAGJ 5BQTA 5JI6A 4A3JJ 2IS1A 4CYDA 1W5TA 3OIOA 4BQAA 3BPXA 1EV7A 4ZYEA 2M45A 5AONA 2CYYA 4JP0A 2R5ZB 3S8PA 2Q8KA 2Y69H 1IF1A 2QVOA 4ENKA 4XLEA 2WWYA 4QLCU 3K70C 1ZGJA 4II2A 3MZYA 4EGYA 1F4KA 1TWAJ 3ABTA 4D5FA 1ETVA 1W36C 2VJ4A 3CCQI 1FBUA 3VSKA 1DDNA 1MDMB 4C3HJ 4ZYDA 3D5LA 3HC7A 3PQKA 2ZJRF 1W0UA 4MTEA 4M6YA 3KYDB 1T38A 5EEHA 1J0RA 4RAGA 3HOUJ 2OAZA 2FOKA 1KU2A 1FLIA 2HYJA 1AWCA 4BNCA 4XN3A 5FKLA 4M3FA 4PFPA 2MABA 4RDUA 2HXOA 1WKMA 4M74A 3BCAA 2DMTA 3ZCOA 1D5VA 1FMWA 3KP6A 2R5ZA 3CUQC 2DA7A 3DBLB 2JRMA 3VPRA 1PDNC 3T8RA 3P9KA 4A3KJ 2E5ZA 4KDPA 4RLFA 3F3XA 5EZHA 3OY9A 2ID3A 3HB9A 3VSLA 5M5YJ 4FT8A 1S7AA 2ME0A 3JAMK 1PUFB 2DA1A 3CCJI 1MDMA 1OYYA 2FSWA 4JK1X 1ZRCA 4BGDA 3BG7A 4A0YA 1TQIA 4BKXA 1IRZA 4XLFA 1ON2A 5E79C 3CCLI 4FQGA 1U8RA 3HRTA 4HF2A 1R4MB 3Q0UA 4UUSB 1ULYA 2FBKA 3K1NA 1D0XA 1R58A 1T56A 3A0HC 3QAHA 3BP8A 2ISZA 3MVPA 3LWFA 1RZ4A 1XB4A 5AIQA 5F0CA 4D9JA 2NAZA 1XN7A 3OMYA 4HX8A 5EEAA 1W0TA 1O3QA 5C4XJ 4LB6B 2FMYA 3C18A 1P7IA 5KCMA 2MG4A 4OIPF 3BY6A 1PUFA 1WSUA 3R61A 1YJNI 4I09A 5B5EC 1FTTA 1FBQA 1IN5A 1OKRA 4XLAA 1FNNA 2F48A 1NK2P 1HQCA 4L5EA 1R71A 1SMTA 2MYSA 3CDIA 5J40A 4AVZA 4EV0A 2XGCA 4YELA 4UUSA 3P7NA 4CSWA 4RAYA 4EQQA 2HOSA 2VQCA 1PVEA 1CF7B 1EH7A 3W2AA 2CV0A 4KIBA 5AIPA 1RNLA 4N0BA 1MJ9A 3TOBA 2CUEA 4IJAA 1YG2A 3PO2J 1X3UA 5FROA 3CMMA 1G3YA 1SVLA 3HKZN 3ZQCA 2DA5A 2Z99A 1RUOA 2VBXA 3ZQ7A 4HF1A 2A6EF 3GW2A 1QVTA 3MFKA 1OYIA 2DI3A 4YRVA 2LP0A 3FKJA 3PSFA 2JWTA 1RESA 2M4GA 3BZKA 4PGHA 3ECHA 4BJTA 2YPRA 1HXDA 3HOWJ 2Y0MA 3ZMSA 3EDPA 4XQFA 1YOVB 2KQRA 1Z67A 2VN2A 2ZNZA 1CF7A 3E5UA 1Z7LA 2O0YA 1DGRM 3LAJA 1ZG1A 1N77A 4G8XA 2TDXA 2D2WA 1KU7A 5A2QK 2BV6A 4BJ5C 1JUMA 1H88C 3QODA 5D5WB 3WE2A 3H0DA 3LSRA 3JR9A 4A5MA 2QM3A 2DO7A 4A0ZA 1OLTA 1XSDA 2LVSA 3H5AA 1QVUA 1J2XA 5D4SA 2L02A 2CW0F 2L7ZA 4WX9A 4RLQA 4ASNA 4C3JJ 1JGGA 5F0HA 4AUXA 2COMA 4B4CA 1E2XA 4I76A 3NAUA 5LEJA 4E7SA 3RKWA 4D7MA 1FC3A 4XIDA 3JSOA 3SXYA 1X19A 2KLOA 1ZTRA 2LY9A 4BHBA 1VI0A 3HPGA 4OOIA 4M72A 5FLXZ 1HW5A 2EWNA 1FYKA 3AL0C 2DCEA 4UV8A 5JHUA 2KIMA 3WU2C 3J7AY 3BZCA 1EH6A 2EK5A 3MKZA 3UKGA 3MZHA 1U9NA 5D5XB 4D5CA 2GA1A 3I58A 2BY0A 1V5FA 3ECOA 2EA4A 3IAS2 3TGNA 1KU9A 4BEHB 4EATA 3DXJF 1IN8A 3ERMA 2KJCA 5LHGA 3FXJA 2MGQA 4LIVA 2VL8A 3L2RA 2STWA 3IL2A 4AIHA 4IHVA 3R4KA 1MIJA 2JA8J 4I01A 4XL9A 2KL4A 3WE3A 2DA6A 5CVJA 1O3TA 3FX3A 5D8KB 4M3BA 3NEUA 3JTGA 2XPWA 2PG4A 3HXLA 3VYUB 3L2VA 1USSA 3WHBA 3ZQHA 2O61A 1KA8A 2VE8A 5FFZA 2K7LA 4Q4ZF 4EJOA 1JGSA 2HFHA 2X0LA 3K9TA 1XX5A 3L2WA 3PO3J 4C2MJ 3LFUA 4RMNA 1CQTA 3H92A 3W6KB 2V4JC 1P6RA 5LD2C 4BEHA 2H1KA 1T6SA 1SAUA 4I2OA 4HQEA 1W4MA 3TO9A 5H2FC 1WZ2A 2X1DA 1UCRA 1B59A 2UXXA 3G71I 2OV7A 4HNUA 2R7DA 3P9IA 3WTSC 2VPLA 3PQJA 3CC2I 1S3JA 4HV6A 1W5CC 3SJMA 4MTDA 1TZLA 3WHCA 3FWEA 4AC0A 3JAMZ 2VASA 5E1ZB 3X2QH 5JLWA 2HOTA 4RGSA 5C3EJ 3M8JA 4BXFA 5ICFA 1YE9A 4D7NA 3KZIC 5K5RA 1BW5A 5L3EA 1MW7A 5D8LB 2DJNA 3U2RA 1YQAA 1O57A 2VQGA 4RGXA 1HW1A 2K40A 1K4TA 3D5RC 1UHSA 4A3DJ 1MBJA 3GVAA 2ZO4A 1QRYA 4LLGF 1UMQA 1BBYA 5DM7F 1XMKA 3L2CA 5EGOB 2EFWA 4JX4A 2HKOA 2Z1DA 4U87A 1DUXC 3I71A 1ZQ3P 1FSHA 3ZXSA 3O8HA 2MH9A 2VPRA 1D5YA 1BOBA 2KHMA 3ZQLA 1YHQI 4D1QA 4KN7X 3CUOA 3HUGA 3BTIA 4E4HA 1V55H 2V1UA 2YS9A 3GTGJ 2A5YB 4I0AA 2MC4A 1U5TC 4A3LJ 4D0PA 2QA4I 2PX9A 2W7NA 2YSRA 3IUOA 4HX4A 1EJ9A 1IJWC 1P4XA 3LOCA 3ML6A 2PJRB 2EIJH 4DYRA 4QTRA 3HRSA 4BQNA 5FFXA 1QBJA 1GV5A 3OS1A 4CGZA 4ABZA 2VUMJ 1IDYA 1XGMA 3E7LA 2GWRA 3CJNA 4KUMA 3V7CA 4DYCA 4IX7A 3CMYA 3PIPF
chains in the Genus database with same CATH topology
2JJ7A 2OF7A 1HCRA 3OOUA 4CYCA 5F27A 3BTLA 1P7JA 2P81A 9ANTA 4NDLA 4V2FA 2R5YB 2JA6J 3O8GA 3JRDA 3JRAA 1ETQA 3HGGA 4X1EA 2NVTJ 3M4OJ 1HDPA 3Q0VA 3IH2A 1Y1WJ 1ZGWA 2VKEA 2YU9J 3JRGA 3G1OA 3LSGA 5DTDA 3BG9A 3PM1A 2Y31A 4MO7A 3F0CA 2XB5A 4FISA 3LNQA 2LD5A 1IC8A 2JA7J 2ELKA 4BXXJ 2XB0X 3GTKJ 5FKMA 2JMWA 2Y9ZA 1FIPA 1X2MA 1JUSA 5IPAA 5K7HA 2DMNA 2PMZN 4FCYA 5FLMJ 4A3EJ 1I6HJ 2L7MP 2R5YA 1LE8B 4M3GA 2DA2A 3RQIA 2B63J 3SFIA 3IH4A 3IV5A 1ZR4A 4IEJA 3HGYA 4A3FJ 3BR5A 2JA5J 4IHWA 3S1NJ 2EQRA 2KDZA 1HDDC 1B8IB 1ZR2A 3B6CA 1A5JA 1H89C 2NS8A 2M2EA 2CQXA 3MKLA 1X58A 3RZOJ 2M34A 2GBYA 1RKWA 2XPVA 2O8KA 1ETOA 1RKTA 1MBGA 1WCMJ 3A01B 4A3MJ 1ITYA 3TP3A 5J3LA 1G2HA 3GTOJ 2WAQN 5C44J 3K7AJ 4BBRJ 1SFOJ 1LE8A 1WGXA 1U8BA 2EZLA 1TC3C 1FTZA 2FX0A 5DS9A 1XG1A 3QQAA 2DA4A 1GV2A 2IBDA 2IAIA 1SANA 1MBEA 4Y52J 1JTXA 4BBSJ 4QSHA 1Q1VA 1B8IA 3A02A 3L1PA 5HODA 3NARA 1WI3A 1Z0XA 3DEWA 1X2NA 1OCTC 2DMQA 3CDLA 4V2GA 2JN6A 3GBGA 1ZK8A 3S2DJ 1MSEC 2XGEA 1R9TJ 4CYCB 3OSGA 1YRNB 2DN0A 2CJJA 2Y2ZA 2EH3A 2HOAA 5F04A 2CRGA 3A01A 2HI3A 3S16J 5FKNA 2W48A 3BR1A 3JRFA 2XGDA 1ZKGA 3C2BA 5IYBJ 1WH5A 3DCFA 1BL0A 3HDDA 3GTQJ 1ORKA 2R92J 5IYDJ 4A3JJ 3OIOA 1AKHB 5M3MJ 5EDNA 5F1JA 3SDGA 2M8GX 5E3NA 4JP0A 2R5ZB 4A69C 5J1RA 1U9OA 2ZB9A 1DU6A 5IYCJ 1A6IA 1TWAJ 4D5FA 1ETVA 1YRNA 5IP6A 4C3HJ 2FJ1A 2XSDC 1W0UA 1O4XA 1MNMC 2OPTA 3BR3A 3JRBA 3JRHA 3HOUJ 1H8AC 2HYJA 2HXIA 5FKLA 2NVYJ 4M3FA 4RDUA 1APLC 5E3OA 3HBLA 1AKHA 2HXOA 3BG3A 5E3LA 2ME6A 1Y1VJ 2DMTA 1MH4A 2R5ZA 2DA7A 3CQZJ 2E2HJ 3VPRA 1ETWA 2EZHA 4B3AA 1XS9A 4A3KJ 4W1UA 2FQ4A 2D5VA 5EZHA 2DMUA 3HEFA 1GUUA 2ID3A 3HB9A 5M5YJ 1K61A 2L7FP 2ME0A 1ETKA 2DA1A 1PUFB 3ZQGA 3JRCA 3QPSA 4XRSA 1NK3P 3TEDA 4JYKA 4BKXA 1IRZA 2E2JJ 5JLXA 2EZIA 2Y30A 2QF7A 4FE4A 4G12A 3H3VK 1F36A 3S1QJ 2NVQJ 3Q3SA 3Q0UA 4UUSB 2MW8A 2ECCA 5BNGA 3M3YJ 4I6ZA 1T56A 2M0CA 2LR8A 2HQ5A 4LOCA 2K9QA 4BY1J 3MVPA 3GTLJ 4FE7A 3I4MJ 3BTJA 2TRTA 5F0CA 2MSYA 3BTCA 5C4XJ 5EEAA 1W0TA 1VF9A 5IOZA 4M3DA 2CQQA 1ETYA 3HM5A 4X6AJ 3FKIJ 1P7IA 1IDZA 2MG4A 2LKXA 1GT0C 1DU0A 3OSFA 2I10A 1PUFA 1TWHJ 2CUFA 1FTTA 5F08A 1JKQC 1NK2P 2R7ZJ 2E19A 1ENHA 4L5EA 2N8GA 5M5XJ 1OJLA 5EF6A 3ZQFA 2XGCA 4UUSA 1I3QJ 4MFEA 2HOSA 2AHQA 4A3IJ 2DTZA 1S7EA 1OCPA 2ID6A 3GTJJ 3TP0A 4DYQA 1HLVA 4M3EA 2CUEA 1FIAA 3PO2J 4MIMA 4QIWN 3TW7A 5IOYA 5IP7J 5IP9J 1U78A 4XRSG 3HOXJ 1WH7A 2DMPA 3HKZN 5F0FA 3ZQCA 2DA5A 5K7FA 4DZJA 2LTPA 1JTYA 1QVTA 3D1NI 2XRLA 3A03A 2LP0A 2JWTA 1RESA 3HOVJ 2DA3A 2K9NA 2X6OA 1JJ8C 2RAEA 3HOWJ 3S17J 2IEKA 4Y7NJ 3H0GJ 1Z77A 2JK3A 4IHYA 1RETA 5J1UA 3B6AA 3MN2A 1EF4A 2VI6A 1JUMA 1H88C 1BW6A 4A93J 1BA5A 3LSRA 3JR9A 1POGA 4DZPA 1RR7A 1VNDA 2AO9A 2LVSA 3BQZA 1JT0A 3ZQIA 4JX5A 4C3IJ 3BT9A 5J1YA 1QVUA 2L7ZA 4UUTA 1BJZA 1JGGA 4C3JJ 1TWCJ 5FKOA 5F0HA 4A3BJ 4AUXA 4B4CA 2R0QC 1MSFC 4I76A 1XC5A 3NAUA 4M6VA 4BY7J 3BG5A 4D7MA 4XIDA 1LFUP 5EGOA 3FIWA 1IV6A 1FJLA 1ZTRA 1JKRC 2LY9A 3S14J 1VI0A 3BR0A 2M9HA 2GLOA 2NVXJ 5FJ8J 4HNVA 3TW6A 1F43A 4A3CJ 4DW6A 3K2AA 3UKGA 4J19A 3LSJA 5K7ZA 1U9NA 4D5CA 1JUPA 5FLVA 3IH3A 5M5WJ 1MBFA 2L0KA 2XPUA 4IHXA 2NOGA 2VKVA 5GP9A 2MGQA 1AU7A 2EZKA 2TCTA 5C4JJ 4IHVA 2JA8J 1WPKA 1JKOC 2DA6A 1MBKA 2E1OA 2EBIA 1TWFJ 2FD5A 2LLKA 4M3BA 5GPAA 2H8RA 3S15J 3S1MJ 4A3GJ 2XPWA 3HOZJ 1NTCA 3RKQA 2GM4A 3WHBA 3ZQHA 2O9LA 3GTMJ 4S0HB 1B72B 1HOMA 1LFBA 3ZOBA 3I4NJ 1ETXA 4C2MJ 3PO3J 1CQTA 3S2HJ 3BR2A 3RZDJ 2QCOA 1E3OC 2Y9YA 2L9RA 4XICA 2H1KA 1TWGJ 3S1RJ 3FK7A 1AHDP 1UG2A 2LFBA 2WV1A 2O7OA 2WB1N 4MFDA 1FEXA 4GFBA 2YUSA 3CCYA 3QPLA 2X9DA 4W97A 3BR6A 3SJMA 2CU7A 3FK6A 3WHCA 4AC0A 1GVDA 5JLWA 1B72A 3G1MA 3JREA 2HOTA 5C3EJ 3Q0WA 4JX6A 3HOYJ 4D7NA 5EZGA 2E2IJ 3JRIA 1BW5A 1QPIA 2KT0A 2DJNA 2K9SA 2HDDA 2NS7A 4MLOA 2K40A 1UHSA 4A3DJ 5FKKA 4FTHA 1MBJA 2COBA 5E3MA 1QRYA 1K83J 1UMQA 4RBOA 1JJ6C 5EGOB 5EG0B 3W6VA 4JX4A 1ZQ3P 3G1LA 1GDTA 3O8HA 2VPRA 1D5YA 3ZQLA 1IUFA 1IG7A 2LK2A 1HF0A 2X48A 3GTPJ 1MBHA 3BTIA 3FISA 1T33A 2YS9A 1VFCA 3GTGJ 2G0EA 5M3FJ 5GPCA 1IGNA 4A3LJ 4AYBN 1OFCX 1MH3A 1IJWC 4XK4A 2R93J 3LOCA 2ECBA 4DYRA 4QTRA 4XRMA 1JT6A 3BQYA 1RPWA 4B1RA 3LSPA 1JKPC 1GV5A 2Y0SN 1I50J 4EEFG 2VUMJ 4ABZA 1IDYA 3E7LA 4DYCA 5EG0A 5EYRA 3CMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJ7 A;  2OF7 A;  1HCR A;  3OOU A;  4CYC A;  5F27 A;  3BTL A;  1P7J A;  2P81 A;  9ANT A;  4NDL A;  4V2F A;  2R5Y B;  2JA6 J;  3O8G A;  3JRD A;  3JRA A;  1ETQ A;  3HGG A;  4X1E A;  2NVT J;  3M4O J;  1HDP A;  3Q0V A;  3IH2 A;  1Y1W J;  1ZGW A;  2VKE A;  2YU9 J;  3JRG A;  3G1O A;  3LSG A;  5DTD A;  3BG9 A;  3PM1 A;  2Y31 A;  4MO7 A;  3F0C A;  2XB5 A;  4FIS A;  3LNQ A;  2LD5 A;  1IC8 A;  2JA7 J;  2ELK A;  4BXX J;  2XB0 X;  3GTK J;  5FKM A;  2JMW A;  2Y9Z A;  1FIP A;  1X2M A;  1JUS A;  5IPA A;  5K7H A;  2DMN A;  2PMZ N;  4FCY A;  5FLM J;  4A3E J;  1I6H J;  2L7M P;  2R5Y A;  1LE8 B;  4M3G A;  2DA2 A;  3RQI A;  2B63 J;  3SFI A;  3IH4 A;  3IV5 A;  1ZR4 A;  4IEJ A;  3HGY A;  4A3F J;  3BR5 A;  2JA5 J;  4IHW A;  3S1N J;  2EQR A;  2KDZ A;  1HDD C;  1B8I B;  1ZR2 A;  3B6C A;  1A5J A;  1H89 C;  2NS8 A;  2M2E A;  2CQX A;  3MKL A;  1X58 A;  3RZO J;  2M34 A;  2GBY A;  1RKW A;  2XPV A;  2O8K A;  1ETO A;  1RKT A;  1MBG A;  1WCM J;  3A01 B;  4A3M J;  1ITY A;  3TP3 A;  5J3L A;  1G2H A;  3GTO J;  2WAQ N;  5C44 J;  3K7A J;  4BBR J;  1SFO J;  1LE8 A;  1WGX A;  1U8B A;  2EZL A;  1TC3 C;  1FTZ A;  2FX0 A;  5DS9 A;  1XG1 A;  3QQA A;  2DA4 A;  1GV2 A;  2IBD A;  2IAI A;  1SAN A;  1MBE A;  4Y52 J;  1JTX A;  4BBS J;  4QSH A;  1Q1V A;  1B8I A;  3A02 A;  3L1P A;  5HOD A;  3NAR A;  1WI3 A;  1Z0X A;  3DEW A;  1X2N A;  1OCT C;  2DMQ A;  3CDL A;  4V2G A;  2JN6 A;  3GBG A;  1ZK8 A;  3S2D J;  1MSE C;  2XGE A;  1R9T J;  4CYC B;  3OSG A;  1YRN B;  2DN0 A;  2CJJ A;  2Y2Z A;  2EH3 A;  2HOA A;  5F04 A;  2CRG A;  3A01 A;  2HI3 A;  3S16 J;  5FKN A;  2W48 A;  3BR1 A;  3JRF A;  2XGD A;  1ZKG A;  3C2B A;  5IYB J;  1WH5 A;  3DCF A;  1BL0 A;  3HDD A;  3GTQ J;  1ORK A;  2R92 J;  5IYD J;  4A3J J;  3OIO A;  1AKH B;  5M3M J;  5EDN A;  5F1J A;  3SDG A;  2M8G X;  5E3N A;  4JP0 A;  2R5Z B;  4A69 C;  5J1R A;  1U9O A;  2ZB9 A;  1DU6 A;  5IYC J;  1A6I A;  1TWA J;  4D5F A;  1ETV A;  1YRN A;  5IP6 A;  4C3H J;  2FJ1 A;  2XSD C;  1W0U A;  1O4X A;  1MNM C;  2OPT A;  3BR3 A;  3JRB A;  3JRH A;  3HOU J;  1H8A C;  2HYJ A;  2HXI A;  5FKL A;  2NVY J;  4M3F A;  4RDU A;  1APL C;  5E3O A;  3HBL A;  1AKH A;  2HXO A;  3BG3 A;  5E3L A;  2ME6 A;  1Y1V J;  2DMT A;  1MH4 A;  2R5Z A;  2DA7 A;  3CQZ J;  2E2H J;  3VPR A;  1ETW A;  2EZH A;  4B3A A;  1XS9 A;  4A3K J;  4W1U A;  2FQ4 A;  2D5V A;  5EZH A;  2DMU A;  3HEF A;  1GUU A;  2ID3 A;  3HB9 A;  5M5Y J;  1K61 A;  2L7F P;  2ME0 A;  1ETK A;  2DA1 A;  1PUF B;  3ZQG A;  3JRC A;  3QPS A;  4XRS A;  1NK3 P;  3TED A;  4JYK A;  4BKX A;  1IRZ A;  2E2J J;  5JLX A;  2EZI A;  2Y30 A;  2QF7 A;  4FE4 A;  4G12 A;  3H3V K;  1F36 A;  3S1Q J;  2NVQ J;  3Q3S A;  3Q0U A;  4UUS B;  2MW8 A;  2ECC A;  5BNG A;  3M3Y J;  4I6Z A;  1T56 A;  2M0C A;  2LR8 A;  2HQ5 A;  4LOC A;  2K9Q A;  4BY1 J;  3MVP A;  3GTL J;  4FE7 A;  3I4M J;  3BTJ A;  2TRT A;  5F0C A;  2MSY A;  3BTC A;  5C4X J;  5EEA A;  1W0T A;  1VF9 A;  5IOZ A;  4M3D A;  2CQQ A;  1ETY A;  3HM5 A;  4X6A J;  3FKI J;  1P7I A;  1IDZ A;  2MG4 A;  2LKX A;  1GT0 C;  1DU0 A;  3OSF A;  2I10 A;  1PUF A;  1TWH J;  2CUF A;  1FTT A;  5F08 A;  1JKQ C;  1NK2 P;  2R7Z J;  2E19 A;  1ENH A;  4L5E A;  2N8G A;  5M5X J;  1OJL A;  5EF6 A;  3ZQF A;  2XGC A;  4UUS A;  1I3Q J;  4MFE A;  2HOS A;  2AHQ A;  4A3I J;  2DTZ A;  1S7E A;  1OCP A;  2ID6 A;  3GTJ J;  3TP0 A;  4DYQ A;  1HLV A;  4M3E A;  2CUE A;  1FIA A;  3PO2 J;  4MIM A;  4QIW N;  3TW7 A;  5IOY A;  5IP7 J;  5IP9 J;  1U78 A;  4XRS G;  3HOX J;  1WH7 A;  2DMP A;  3HKZ N;  5F0F A;  3ZQC A;  2DA5 A;  5K7F A;  4DZJ A;  2LTP A;  1JTY A;  1QVT A;  3D1N I;  2XRL A;  3A03 A;  2LP0 A;  2JWT A;  1RES A;  3HOV J;  2DA3 A;  2K9N A;  2X6O A;  1JJ8 C;  2RAE A;  3HOW J;  3S17 J;  2IEK A;  4Y7N J;  3H0G J;  1Z77 A;  2JK3 A;  4IHY A;  1RET A;  5J1U A;  3B6A A;  3MN2 A;  1EF4 A;  2VI6 A;  1JUM A;  1H88 C;  1BW6 A;  4A93 J;  1BA5 A;  3LSR A;  3JR9 A;  1POG A;  4DZP A;  1RR7 A;  1VND A;  2AO9 A;  2LVS A;  3BQZ A;  1JT0 A;  3ZQI A;  4JX5 A;  4C3I J;  3BT9 A;  5J1Y A;  1QVU A;  2L7Z A;  4UUT A;  1BJZ A;  1JGG A;  4C3J J;  1TWC J;  5FKO A;  5F0H A;  4A3B J;  4AUX A;  4B4C A;  2R0Q C;  1MSF C;  4I76 A;  1XC5 A;  3NAU A;  4M6V A;  4BY7 J;  3BG5 A;  4D7M A;  4XID A;  1LFU P;  5EGO A;  3FIW A;  1IV6 A;  1FJL A;  1ZTR A;  1JKR C;  2LY9 A;  3S14 J;  1VI0 A;  3BR0 A;  2M9H A;  2GLO A;  2NVX J;  5FJ8 J;  4HNV A;  3TW6 A;  1F43 A;  4A3C J;  4DW6 A;  3K2A A;  3UKG A;  4J19 A;  3LSJ A;  5K7Z A;  1U9N A;  4D5C A;  1JUP A;  5FLV A;  3IH3 A;  5M5W J;  1MBF A;  2L0K A;  2XPU A;  4IHX A;  2NOG A;  2VKV A;  5GP9 A;  2MGQ A;  1AU7 A;  2EZK A;  2TCT A;  5C4J J;  4IHV A;  2JA8 J;  1WPK A;  1JKO C;  2DA6 A;  1MBK A;  2E1O A;  2EBI A;  1TWF J;  2FD5 A;  2LLK A;  4M3B A;  5GPA A;  2H8R A;  3S15 J;  3S1M J;  4A3G J;  2XPW A;  3HOZ J;  1NTC A;  3RKQ A;  2GM4 A;  3WHB A;  3ZQH A;  2O9L A;  3GTM J;  4S0H B;  1B72 B;  1HOM A;  1LFB A;  3ZOB A;  3I4N J;  1ETX A;  4C2M J;  3PO3 J;  1CQT A;  3S2H J;  3BR2 A;  3RZD J;  2QCO A;  1E3O C;  2Y9Y A;  2L9R A;  4XIC A;  2H1K A;  1TWG J;  3S1R J;  3FK7 A;  1AHD P;  1UG2 A;  2LFB A;  2WV1 A;  2O7O A;  2WB1 N;  4MFD A;  1FEX A;  4GFB A;  2YUS A;  3CCY A;  3QPL A;  2X9D A;  4W97 A;  3BR6 A;  3SJM A;  2CU7 A;  3FK6 A;  3WHC A;  4AC0 A;  1GVD A;  5JLW A;  1B72 A;  3G1M A;  3JRE A;  2HOT A;  5C3E J;  3Q0W A;  4JX6 A;  3HOY J;  4D7N A;  5EZG A;  2E2I J;  3JRI A;  1BW5 A;  1QPI A;  2KT0 A;  2DJN A;  2K9S A;  2HDD A;  2NS7 A;  4MLO A;  2K40 A;  1UHS A;  4A3D J;  5FKK A;  4FTH A;  1MBJ A;  2COB A;  5E3M A;  1QRY A;  1K83 J;  1UMQ A;  4RBO A;  1JJ6 C;  5EGO B;  5EG0 B;  3W6V A;  4JX4 A;  1ZQ3 P;  3G1L A;  1GDT A;  3O8H A;  2VPR A;  1D5Y A;  3ZQL A;  1IUF A;  1IG7 A;  2LK2 A;  1HF0 A;  2X48 A;  3GTP J;  1MBH A;  3BTI A;  3FIS A;  1T33 A;  2YS9 A;  1VFC A;  3GTG J;  2G0E A;  5M3F J;  5GPC A;  1IGN A;  4A3L J;  4AYB N;  1OFC X;  1MH3 A;  1IJW C;  4XK4 A;  2R93 J;  3LOC A;  2ECB A;  4DYR A;  4QTR A;  4XRM A;  1JT6 A;  3BQY A;  1RPW A;  4B1R A;  3LSP A;  1JKP C;  1GV5 A;  2Y0S N;  1I50 J;  4EEF G;  2VUM J;  4ABZ A;  1IDY A;  3E7L A;  4DYC A;  5EG0 A;  5EYR A;  3CMY A; 
#chains in the Genus database with same CATH topology
 1RUN A;  2VOD A;  3FF5 A;  3W3C A;  5E8G A;  4BU2 A;  2H6C A;  5F27 A;  1YX5 A;  2BBY A;  3T0Y A;  3BTL A;  1Y8R B;  3RJP A;  2K85 A;  4NDL A;  4E7H A;  3OS0 A;  1X3W B;  5HLI A;  4O3M A;  2IA0 A;  4NBQ A;  3K4N A;  3I64 A;  2XAS A;  2HVQ A;  3C2H A;  3Q5F A;  3O3K A;  4IOA F;  2EFQ A;  4XLN F;  3QU3 A;  3G1O A;  2PJR A;  3LSG A;  3TL4 X;  4M9S A;  4OIQ F;  4OIR F;  3F0C A;  3KPH A;  2ZSH B;  3LNQ A;  2DYS H;  3M07 A;  5A2Q Z;  2LD5 A;  2ELK A;  1IC8 A;  3VDX A;  2XB0 X;  2Y9Z A;  1FIP A;  2DTR A;  3A1Y A;  1JUS A;  1OR7 C;  2V6C A;  2CGP A;  2LY2 A;  5TIS C;  2QUF A;  4AIJ A;  4BHC A;  1IN6 A;  4NQW B;  1U0J A;  4DIQ A;  3VOE A;  4YFK F;  1FYL A;  3ZPL A;  2B63 J;  4S04 A;  3SZP A;  1UB9 A;  3ESW B;  4OMY A;  5J6X A;  5E18 F;  1T0F C;  2KKO A;  3ZGK A;  3F8B A;  4E7Z A;  3HGY A;  2OC6 A;  2JA5 J;  2R7F A;  4A12 A;  3QYE A;  1SEU A;  2K5C A;  4XMY A;  1HDD C;  5DM6 F;  4II3 A;  4Z2Y A;  1LJ9 A;  4B8X A;  4HG2 A;  1TP4 A;  2CS3 A;  1YS6 A;  4XBF A;  4ESJ A;  2CQX A;  3V8J A;  1LB2 A;  3MKL A;  5B66 C;  5ICE A;  1X58 A;  3OIP A;  2NXN B;  2GBY A;  3D5S C;  3RZO J;  4B48 A;  2O8K A;  3DEE A;  1DP3 A;  1WJD A;  3SDB A;  1WCM J;  3A01 B;  1A31 A;  2XAQ A;  3TDU C;  4U7B A;  3K7A J;  4Q48 A;  1SFO J;  2CH0 A;  3QP6 A;  3K6G A;  1KQ8 A;  1RIO H;  4NQW A;  2FF4 A;  2E60 A;  1FTZ A;  2FX0 A;  1J75 A;  4ZDO A;  1XG1 A;  3KCC A;  4MEX F;  1ZYR F;  1LPQ A;  4AIK A;  1Z1D A;  2ACJ A;  4ESF A;  1MBE A;  2XAJ A;  3P5J A;  4UUV A;  1JTX A;  4BBS J;  4QSH A;  1Q1V A;  2ZFW A;  4AVP A;  2O03 A;  4CCK A;  5HOD A;  3E3V A;  2MH2 A;  1Z0X A;  3DEW A;  5HLH A;  3NWS A;  1OCT C;  1D8K A;  3CDL A;  4A6D A;  4RB0 A;  3F8F A;  3DKY A;  4CYC B;  5K1Y A;  2X1E A;  2Y2Z A;  3W6J B;  2EH3 A;  3GX4 X;  5F04 A;  3A01 A;  2HI3 A;  3A2K A;  3ISP A;  4I02 A;  5FKN A;  2JRT A;  3BR1 A;  3COA C;  1ZKG A;  2X4H A;  5K5Q A;  1WH5 A;  4PJL A;  5CVU A;  1IUY A;  4N4N B;  4XR6 A;  3DCF A;  1LNW A;  3LSK A;  3GTQ J;  1ORK A;  2R92 J;  2OQG A;  2HEO A;  1Z21 A;  3CDH A;  3RPQ A;  2XRO A;  4LG3 A;  2BEO A;  5EDN A;  4U0Y A;  1YTY A;  3SDG A;  1NG7 A;  2M8G X;  2Q0O A;  2Z3Y A;  5E3N A;  3HTS B;  4XKC A;  4BH9 A;  2QQB A;  1WWX A;  3H3U A;  1R36 A;  5FD6 A;  5J1R A;  1U9O A;  1V54 H;  1VQ9 I;  4XSZ F;  1DU6 A;  1A6I A;  3OYN A;  4UNO A;  1MND A;  3EPZ A;  2BOL A;  3K2Z A;  3U21 A;  3KP7 A;  4EJU A;  3OYL A;  2ESN A;  1G3W A;  2ADU A;  2IGK A;  3HIF A;  1MNM C;  2KPM A;  2OPT A;  3BR3 A;  4RS8 A;  1MJB A;  3JRH A;  1H8A C;  1YW7 A;  2XAG A;  3DEU A;  2HDD A;  1APL C;  1ACI A;  5E3O A;  3HBL A;  5E3L A;  1I27 A;  1K7A A;  2XF6 A;  1R22 A;  1XPX A;  4HBL A;  2JA2 A;  2VE9 A;  1C0W A;  2WTE A;  3L9F A;  3RIR A;  1GXP A;  5LLQ A;  2E2H J;  2DJI A;  1XS9 A;  3VFZ A;  2QGU A;  3DBR B;  3CC4 I;  4W1U A;  4LD5 A;  2K3P A;  2Y75 A;  2OTL I;  2ZJ2 A;  1MMN A;  1GUU A;  1YYV A;  2L7F P;  1K6O A;  5KAF C;  2W85 A;  3ZQG A;  3JRC A;  2W82 A;  3ZMD A;  4HZF A;  4BL0 B;  2R7O A;  1ZG5 A;  1QU3 A;  5JLX A;  3ULQ B;  2QF7 A;  4G12 A;  3S1Q J;  1F36 A;  2FU4 A;  2NVQ J;  4E7J A;  5F64 A;  3BPV A;  2MW8 A;  1VQM I;  1BR1 A;  1ODD A;  3OYC A;  2VIX A;  2BY3 A;  2JPB A;  4A5N A;  1I6X A;  3HKZ A;  1SFK A;  3HJE A;  1EH8 A;  4XNF A;  2HQ5 A;  2E5N A;  4BY1 J;  4QPQ A;  1FY7 A;  4BJ6 C;  3H35 A;  2NNY A;  5KHD A;  3BTJ A;  1LQ1 A;  3V4G A;  1XDU A;  3A4C A;  3MWM A;  2VC1 A;  4M3D A;  5IOZ A;  1H0M A;  5BS6 A;  5DYM A;  1ETY A;  3HM5 A;  4AID A;  5JFR A;  5HNF A;  2LKX A;  1GT0 C;  2X51 A;  2DT6 A;  2GAU A;  3H5R A;  2I10 A;  3RDI A;  3ERE D;  2CUF A;  5F08 A;  4YFX F;  5FB2 A;  3L09 A;  2E19 A;  3O6B B;  2P5K A;  3FDY A;  2N8G A;  2C6Y A;  3J7Y J;  2Z9O A;  1I3Q J;  2QSG X;  4RGU A;  4Y33 A;  5HNH A;  5DD8 A;  1OCP A;  2ID6 A;  4HYE A;  3J81 Z;  1VQ6 I;  4CZC A;  2DW4 A;  3AFH A;  4DYQ A;  3V8K A;  1MNE A;  3DPT A;  3L7W A;  5HDK A;  2EV5 A;  1FIA A;  2MD0 A;  4X0G A;  1QGP A;  6PAX A;  2M1B A;  2FEZ A;  4QIW N;  4G7Z F;  2K86 A;  2CQK A;  3TW7 A;  5IOY A;  1QQI A;  1S5L C;  1ZAO A;  5IP7 J;  1U78 A;  4XRS G;  3OWT A;  1WH7 A;  3EUH C;  4EM2 A;  4KYW A;  1NG6 A;  5K7F A;  4DZJ A;  2LTP A;  3DKW A;  4LK0 F;  4N9I A;  1XGN A;  2XRL A;  3A03 A;  4M6X A;  1D1B A;  2ZJQ F;  1CGP A;  4HQM A;  5GAE J;  2OJE D;  1Z91 A;  1IW7 F;  2MLG A;  3RSN A;  1OCC H;  4MGR A;  2JT1 A;  3S3M A;  4IHY A;  2CW7 A;  4IZZ A;  1FBS A;  3F21 A;  1EF4 A;  4BS9 A;  3KE2 A;  3CCR I;  1BR4 A;  2EIN H;  1BW6 A;  4A93 J;  4A6E A;  2MBF A;  1BA5 A;  4BYY A;  5IT9 K;  3K4M A;  2JUG A;  1RC9 A;  1YS7 A;  4DZP A;  2HOE A;  3E97 A;  4LB5 A;  4Y4R A;  1S29 A;  1BI3 A;  1RR7 A;  1VND A;  1G8X A;  4ZYH A;  3GLX A;  2P7C B;  2W25 A;  4KA4 A;  1BIA A;  2ZME C;  4MNU A;  1X4P A;  3DPL C;  4UUT A;  1G59 A;  1TWC J;  5K5O A;  2P8T A;  2YX7 A;  4L9T A;  4KIS A;  4ZYA A;  1MSF C;  5BPD A;  1Y8Q B;  2CQN A;  3WU1 B;  2M3A A;  2IS2 A;  2OD5 A;  3FIW A;  1FJL A;  1N25 A;  1JKR C;  3KLO A;  3BR0 A;  2M9H A;  3DV8 A;  1FMV A;  3QOP A;  3E6M A;  2GLO A;  5KVR A;  3GFJ A;  3HHH A;  5CPR B;  2NVX J;  3OYD A;  2DLL A;  5F1R A;  2W00 A;  5KAI C;  3ZMT A;  4A3C J;  1BI1 A;  2QQ8 A;  5DCF A;  3RQ4 A;  4CIC A;  4DW6 A;  2ZC2 A;  2PJP A;  4WXC A;  3OV8 A;  2IA1 A;  5K7Z A;  3I0T A;  1JUP A;  5FLV A;  2LYC A;  5ILV A;  3IH3 A;  2FE3 A;  3NQO A;  3T8T A;  2R7T A;  1A36 A;  4IHX A;  2NOG A;  2VJJ A;  2R7R A;  1BC8 C;  4IQJ A;  3CUQ B;  1YLF A;  2FRH A;  1XSX A;  3E1S A;  2EZK A;  2TCT A;  2A05 A;  4ESB A;  1TQP A;  2W57 A;  3RYP A;  5C4J J;  2HZD A;  2G7U A;  2RQQ A;  2IW5 A;  4RAZ A;  2ZSI B;  5D4R A;  2WC2 A;  2HU9 A;  2H8R A;  4A3G J;  3S1M J;  2KP6 A;  2XRN A;  1NTC A;  2GM4 A;  2O9L A;  2HWV A;  3GTM J;  1I39 A;  4S0H B;  2HVR A;  3PSI A;  2FOW A;  1B9M A;  1HOM A;  1LFB A;  1TTY A;  3I4N J;  3G6E I;  3WGG A;  3T1B A;  1ETX A;  4BE1 A;  2W4S A;  5HOO A;  4OAY A;  4L18 B;  2AXT C;  3N4M A;  2QCO A;  2XKO A;  2A6T A;  3GZN B;  2EIK H;  5DEQ A;  4HRI A;  2BHY A;  2Y9Y A;  2BZT A;  4HAM A;  1W1W E;  2DU9 A;  5DCM B;  2A5W A;  3QPT A;  3S1R J;  1PUE E;  3CUQ A;  1VQ8 I;  1UG2 A;  3FXR A;  2EFP A;  4G9Y A;  2LFB A;  3BZ6 A;  4E7I A;  2F4M B;  2WV1 A;  4OMZ A;  2DT5 A;  2WB1 N;  4YII A;  4MFD A;  3QYB A;  3QPH A;  4HDU A;  1F5T A;  2X6Y A;  1BN5 A;  3CCY A;  3IAM 2;  4W97 A;  3BR6 A;  3IWF A;  3IRR A;  2XAU A;  1GVD A;  3IWZ A;  5F6F A;  3C3W A;  3OL3 A;  1IRX A;  3JRI A;  2QBY B;  2XC7 A;  1QPI A;  2IS4 A;  2CQ7 A;  3CC7 I;  4RB1 A;  2RKH A;  2JVG A;  3SZT A;  4CCJ A;  2EIL H;  2R7U A;  3KZZ A;  3G3Z A;  5FKK A;  5E1W A;  5DCM A;  4CXF A;  2COB A;  5E3M A;  1K83 J;  1NHA A;  1D0Y A;  5FGM A;  3F8C A;  3N97 A;  4DBR A;  1UST A;  3Q9S A;  3W6V A;  4UVC A;  1I1G A;  4EVI A;  1SFX A;  1UEL B;  1F9N A;  1XCB A;  3G1L A;  3WTU C;  3MEX A;  4ZC3 A;  1KQ9 A;  3PUF A;  3J80 K;  1IXS B;  5LHH A;  1S6L A;  1HF0 A;  3K4K A;  2V9K A;  2VQH A;  1IV8 A;  5L3F A;  1LEB A;  1T33 A;  2BYV E;  1T2K A;  5M3F J;  4ANJ A;  5J4V A;  2KZG A;  3VYT B;  2QBY A;  3GZ5 A;  4AYB N;  1OFC X;  3E6B A;  2H27 A;  5FRN A;  3AG1 H;  3S32 A;  2GA2 A;  4HV5 A;  2R93 J;  1GLN A;  3HYI A;  2R7X A;  1I1S A;  4HNT A;  1JT6 A;  4BDY A;  2F2E A;  3BQY A;  3DKX A;  2NOJ B;  3VEP A;  1BR2 A;  1QHH D;  3FXM A;  2Y0S N;  3LSP A;  1JKP C;  4EEF G;  3GME A;  2CMP A;  1SD4 A;  1IRF A;  1DP7 P;  5EYR A;  1RR8 C;  4B3X A;  2DBB A;  5HS9 A;  2E34 A;  3WTT C;  2STT A;  3CMA I;  1ZN2 A;  1R00 A;  2M30 A;  2P81 A;  4TV7 A;  9ANT A;  4AWX B;  2P6S A;  3OL4 A;  2R5Y B;  3ZN0 A;  3DLL F;  3JRD A;  4O6J A;  1E0E A;  4E7K A;  3M4O J;  4KIC A;  4LGW A;  5HLT A;  1QO0 D;  1TLH B;  2VKE A;  3M1C A;  3BG9 A;  2A68 F;  4BAC A;  2Y31 A;  3K4J A;  3MD2 A;  4MO7 A;  2ZCW A;  2XB5 A;  2IGM A;  2P6T A;  2JA7 J;  2XF7 A;  4IRH A;  1EA3 A;  4G7H F;  1T95 A;  4BXX J;  2DOF A;  5LEK A;  3GTK J;  5IT9 Z;  2JMW A;  5IPA A;  4FHT A;  5E8I A;  5KK1 A;  2QKL B;  1BC7 C;  1SVO A;  4FCY A;  5FLM J;  4LLN A;  2L7M P;  1K79 A;  4IRG A;  2R5Y A;  1LE8 B;  4Y3O A;  2DA2 A;  3OYM A;  3HOS A;  5BOX A;  2W84 A;  3SFI A;  4Z6Y A;  2HDW A;  1Y56 A;  2AQE A;  2OA4 A;  4IEJ A;  4XOT A;  4NHJ A;  4IHW A;  2HPI A;  5HLG A;  2O8X A;  3V7R A;  2KDZ A;  4PCQ A;  1MMA A;  3IKV A;  1A5J A;  4HST A;  2CV2 A;  5CVI A;  1FWZ A;  1OCO H;  3BG6 A;  1W7P B;  3KYC B;  1B6A A;  2KIQ A;  2VKH A;  4CDG A;  4KT5 C;  2XPV A;  1S9H A;  3HUG B;  4M9Z A;  2LF7 A;  4M73 A;  5JVG F;  2VXZ A;  4A3M J;  1R6R A;  4XON A;  2WAE A;  1ZHF A;  2WAQ N;  1G2H A;  5C44 J;  1UZC A;  4BBR J;  1LE8 A;  1WGX A;  1LDJ A;  1R1U A;  2HQA A;  4DNC A;  1TC3 C;  1FOW A;  3CME I;  1A6Q A;  3DF8 A;  4I7H A;  4ZH4 F;  4WXH A;  2JTV A;  3K10 A;  2Z16 A;  3I3L A;  2Y48 A;  1QPM A;  3QQA A;  2F5F A;  1GXQ A;  3LST A;  2IBD A;  3CCV I;  2IAI A;  4XSX F;  3KET A;  4JOM A;  1R1V A;  1VQP I;  3FXO A;  4YIF A;  2M5W A;  3PNT A;  3L1P A;  3MCZ A;  3VB2 A;  2DMQ A;  1ON1 A;  4L9V A;  2JN6 A;  3GBG A;  5BPI A;  1H9G A;  2XAF A;  3ZMV A;  1ZGA A;  3S2D J;  1W7P A;  2BW3 B;  2XGE A;  4ETS A;  3DTI A;  2RVC A;  2CJJ A;  2DN0 A;  5J8F A;  1K4S A;  1J09 A;  2QWW A;  5LGU A;  3CLO A;  2H6B A;  4C2T A;  2W48 A;  3JRF A;  2DOD A;  1H9T A;  2DFH A;  1BJA A;  1IRG A;  3OYI A;  1AOY A;  1WJE A;  1TL8 A;  3HDD A;  1BM9 A;  5IYD J;  4BXU A;  2M7A A;  2NS0 A;  4ZYG A;  1LEA A;  2K4B A;  5M3M J;  4EMS A;  2RGV A;  2LF8 A;  3U9G A;  3CP2 A;  5LRS A;  3R0J A;  4HX7 A;  2K3F A;  4PZJ A;  3K0L A;  4A69 C;  1U5T B;  2ZBK A;  4IRI A;  3IHU A;  4B09 A;  4XLP F;  2XHK A;  2ZB9 A;  3JCU C;  3IKT A;  5IYC J;  4RB3 C;  2BW3 A;  1O3R A;  1ONV A;  1U2W A;  2OQR A;  2LDU A;  2VT3 A;  2FXA A;  2RN7 A;  1IN4 A;  2ZXJ A;  2FJ1 A;  2OUM A;  2XSD C;  3OYB A;  5L3B A;  3OIQ A;  2L9V A;  4HEA 2;  3PNV A;  4C30 A;  2DPD A;  3ROU A;  2VBZ A;  4Q5S F;  3H1C A;  1JHH A;  3BG3 A;  2ME6 A;  3J80 Z;  1HSJ A;  2ZNY A;  1TW2 A;  1ERD A;  2WAF A;  3A0B C;  4HOB A;  3CQZ J;  1U5T A;  2J5O A;  3S3N A;  1FOK A;  1KU3 A;  2PFB A;  2DMU A;  2E1M C;  1K61 A;  4CH7 A;  2L4M A;  1R5G A;  1ETK A;  1T39 A;  1JHF A;  3QPS A;  1NK3 P;  2JQ7 A;  3TED A;  1X1C A;  4JYK A;  3WU0 A;  2E2J J;  1HKS A;  2EZI A;  2PMU A;  2BVL A;  3WGI A;  4GYG A;  4U7D A;  4CCO A;  3Q3S A;  5L3C A;  4JBA A;  2ECC A;  4ENN A;  1W7P D;  4H0E A;  3WGH A;  2K4J A;  4NB5 A;  3DLA A;  1Z3X A;  1DGW Y;  2QKM B;  4UB8 C;  3M3Y J;  3RPU A;  2LR8 A;  2JPC A;  2K9Q A;  2UXN A;  4PUS A;  3KP3 A;  3CD6 I;  3K4B A;  2PI0 A;  3I4M J;  2TRT A;  1U3E M;  5E20 A;  3ONQ A;  3KP4 A;  1WJC A;  2FBI A;  4ITV A;  4YEJ A;  2CUZ A;  3S3O A;  4HSR A;  2CQQ A;  5CVV A;  4CA0 A;  1IDZ A;  2EV6 A;  1DU0 A;  3FMS A;  3OSF A;  2D45 A;  3F6V A;  4JQF A;  1P92 A;  4QWQ A;  1YIO A;  4ZJZ A;  1TWH J;  2K9L A;  2FNP A;  3OYE A;  1X1B A;  1IXR C;  2R7Z J;  5GAH J;  3MKY B;  2JSC A;  1OJL A;  2ELH A;  2OZU A;  2ZXW H;  5EF6 A;  3OYG A;  2M7B A;  1OR7 A;  2E35 A;  1JI8 A;  2BGC A;  1R7J A;  2KZV A;  3KP5 A;  4A3I J;  1S7E A;  2VON A;  4IQ4 A;  4GRI A;  3TP0 A;  2WBM A;  2R7V A;  1HLV A;  2HZT A;  1ZEL A;  2DFI A;  5JHF A;  5H20 A;  5ILS A;  4XKW A;  1YIJ I;  4LJZ F;  1W5S A;  1WQ2 A;  1T0F A;  2BXY A;  3HOX J;  2DDB A;  5CJ9 A;  4I99 C;  3LL7 A;  3DTE A;  2GIV A;  3LMM A;  4N9H A;  2M87 A;  4EGZ A;  4BE0 A;  1TW3 A;  4A2U A;  2X1C A;  3CES A;  2CFX A;  2K9N A;  2QQA A;  4LFU A;  3EYI A;  1JJ8 C;  3KLN A;  5BMZ A;  2A6H F;  3S17 J;  3LA7 A;  4AU7 A;  2IEK A;  5GTI C;  3WOD F;  3ABU A;  1SD7 A;  2BY1 A;  4P5O A;  3L2U A;  3H0G J;  1Z77 A;  2RDP A;  4A0X A;  5CVR A;  2L4A A;  1RET A;  2B9S A;  5J1U A;  3B6A A;  3BLY A;  1PP8 F;  1Y39 A;  2VI6 A;  1LFP A;  4KMF A;  2JSP A;  2RNJ A;  1POG A;  1SD6 A;  3EUK L;  4NC7 A;  3OYA A;  3WTX C;  2F5V A;  2AO9 A;  3KEY A;  1JT0 A;  3F8N A;  3ZQI A;  4DGW B;  4C3I J;  3WG9 A;  3FM3 A;  4U0W A;  3CJT B;  2MFZ A;  3ELK A;  1P4A A;  3S2W A;  2A61 A;  2R0Q C;  3K69 A;  4ZZL A;  1XC5 A;  5DUI A;  3F6O A;  3BG5 A;  5KNL A;  3QRF F;  4RM3 A;  1KYZ A;  2P4W A;  5E1X A;  3GYH X;  4B43 A;  2KRH A;  2DOA A;  5D5V B;  1R5I D;  3S14 J;  1UHM A;  4V19 K;  2GXG A;  4F93 B;  2KFD A;  2MC3 A;  3DQV C;  3MMY B;  2YU3 A;  1F43 A;  3TBI A;  1P2F A;  2L7K A;  1O7L A;  2VXD A;  3LSJ A;  3ZP5 A;  3IC7 A;  4F3Q A;  1I5Z A;  2WB1 A;  2CW8 A;  1HW2 A;  1BOA A;  4E7L A;  1GVJ A;  4PSX A;  2KDO A;  4PJN A;  2L0K A;  2XPU A;  3JW4 A;  1MD0 A;  1SC7 A;  1FT9 A;  5GP9 A;  2HQN A;  4OIN F;  3SYT A;  2FBH A;  3L00 A;  3V8L A;  4CCN A;  1AU7 A;  5EEG A;  3L2Q A;  1OMI A;  1Z7U A;  2QQ9 A;  2NVU B;  3F8M A;  2UV1 A;  2GXA A;  5TGT A;  1MBK A;  2E1O A;  2EBI A;  2FD5 A;  1D3Y A;  2HTS A;  1PJR A;  3LSM A;  3RKQ A;  2V1D A;  1FP2 A;  3P9C A;  4J00 A;  1SVM A;  1ZG3 A;  3PFI A;  2DOE A;  3U1D A;  1MZB A;  3OYJ A;  3HG9 A;  5D6E A;  3S2H J;  3M7G A;  2IVM A;  4DBQ A;  2K02 A;  2LBF B;  3R6S A;  4GDF A;  2L9R A;  2HKX A;  1TWG J;  2IGN A;  1AHD P;  3FK7 A;  1T08 B;  2DFF A;  4I0B A;  1WRJ A;  4HLX A;  3BJ6 A;  2DXI A;  3ASN H;  2O7O A;  1YJW I;  3O2P E;  1MMG A;  2BXZ A;  2HYF A;  4AYB A;  1ZRD A;  5HVQ C;  3G73 A;  2PLY A;  1Z05 A;  2FML A;  3QPL A;  4EM0 B;  4LG0 B;  2L2O A;  1D1A A;  2CU7 A;  3FK6 A;  3DFG A;  1GHC A;  5CKT A;  4G6Q A;  3G1M A;  3Q0W A;  3CZ6 A;  4JX6 A;  3BDD A;  5J47 A;  1LUJ B;  2Y0S A;  3HRU A;  1FOX A;  2IGO A;  2P7V B;  4CUG A;  2KT0 A;  2KMU A;  2K9S A;  3R60 A;  2NS7 A;  2F5D A;  3EET A;  3I5U A;  2LBF A;  3OS2 A;  2DPU A;  4KIG A;  2OCC H;  2J5P A;  4RBO A;  3SQN A;  4ZDP A;  4FAS D;  3UNG C;  4KT6 A;  1QZE A;  1RRJ A;  1GDT A;  2X6W A;  3M8F A;  1P4W A;  3B73 A;  3G4S I;  1OPC A;  3G2B A;  1IG7 A;  2LH9 A;  4LG0 A;  5FLX K;  3QWL A;  2X48 A;  3C2G A;  1KQ0 A;  4H4K C;  5CQG A;  3LAP A;  1F1Z A;  4FET A;  4KN4 X;  4L9N A;  4YIR X;  1VFC A;  2DK8 A;  4P55 A;  2V9P A;  1XTA A;  4E70 A;  1N75 A;  1R1T A;  4GCV A;  5GPC A;  3FBI B;  3E6C C;  2QYO A;  3FXU A;  2KRF A;  1YFH A;  2KJB A;  1WHU A;  5D6F A;  4XK4 A;  4IF4 A;  1WI9 A;  3RCO A;  4IL6 C;  2CO5 A;  2WAD A;  4ZDL A;  2PEX A;  2V1X A;  1STZ A;  3BRO A;  3HZJ A;  3FMR A;  2O6G E;  4WF2 A;  2E1C A;  3HL2 A;  3S93 A;  3J7A O;  3T5X A;  4L5J A;  2UWM A;  3ZQQ A;  2HVS A;  1Z6R A;  3EUH A;  4HF0 A;  1J9I A;  3HSF A;  2JJ7 A;  2OF7 A;  1HCR A;  1G3S A;  2X85 A;  2ZME B;  1B1B A;  3OOU A;  5L3D A;  4YFN F;  3RI4 A;  1G6N A;  5J4Y A;  2I8D A;  1UFM A;  2YR2 A;  3K4C A;  4V2F A;  4LLL A;  2VKD A;  1FPQ A;  4WK8 F;  4UV9 A;  1ETQ A;  1UG0 A;  3HTU A;  3HGG A;  3HOT A;  2B7E A;  1WJA A;  4X1E A;  2NVT J;  4P1W A;  3CO6 C;  3Q0V A;  3W2W A;  1X1D A;  3IH2 A;  1V5E A;  1Y1W J;  1ZGW A;  2YU9 J;  4IHS A;  5LRR A;  2F6C A;  3I54 A;  5DUK A;  2LMD A;  1DPU A;  4XOP A;  1IN7 A;  3K1P A;  2WAQ A;  2K27 A;  3V7S A;  2A69 F;  1KZH A;  1FSE A;  2LY1 A;  4NC8 A;  5CQE A;  3E0J B;  1X2M A;  2VJI A;  3ZMU A;  3FBN B;  1IXC A;  1JXS A;  3OR2 C;  4HPQ A;  3LSI A;  1Z3Y A;  2ZME A;  2CFO A;  2PMZ N;  4Y13 A;  4A3E J;  1HKT A;  1I6H J;  1XD7 A;  5ICG A;  1MGT A;  2H1L A;  4M3G A;  1VTN C;  3HPH A;  5IY5 H;  2QEX I;  3NRV A;  3M1E A;  1MMD A;  3CJQ B;  1V3F A;  2BHZ A;  2GOX B;  2LSO A;  2O3F A;  4BE2 A;  2JVH A;  2VBY A;  3F23 A;  1ZR4 A;  2H09 A;  4ZTF A;  4A3F J;  3BR5 A;  1J59 A;  3S1N J;  2HTJ A;  2VOP A;  3GFI A;  4PK4 A;  1ZR2 A;  1XDS A;  3LQQ A;  4QPO A;  4XRF A;  3LA3 A;  5B3S H;  3W2V A;  5ED4 A;  1V4R A;  3DTK A;  3GFL A;  2ZKZ A;  2M34 A;  1RKW A;  1O3S A;  3FHZ A;  2M0M A;  2CWE A;  3J7Z I;  1ZLJ A;  3FMQ A;  4XOR A;  1MBG A;  3TP3 A;  2EJR A;  2A07 F;  3OOP A;  3GTO J;  2EFN A;  3M9A A;  4Q47 A;  3KFW X;  1A35 A;  1U8B A;  3ABL H;  4N4O B;  3FHN A;  5DS9 A;  4L0Z B;  3N05 A;  1S72 I;  2DA4 A;  1GV2 A;  5HDN A;  3OYF A;  2V7F A;  1SAN A;  3CJR B;  1SFE A;  2D1H A;  2Q1Z B;  3SHF A;  3F72 A;  1Q1H A;  4Y52 J;  2VBW A;  2PN6 A;  2XSJ C;  4HA8 A;  2P5L C;  3A02 A;  2XUB A;  2LRD A;  2WY8 Q;  1WI3 A;  4UY8 I;  1X2N A;  2R3S A;  3HSR A;  4V2G A;  4BAY A;  1X1A A;  2HPM A;  1A04 A;  2CUJ A;  4Y15 A;  3OSG A;  3CTA A;  1YRN B;  3VWB A;  2I5U A;  2HOA A;  4P9F A;  3WTZ A;  3AAF A;  1HKQ A;  2XGD A;  4IO9 F;  3KZY A;  3C2B A;  4P96 A;  5IYB J;  4LMY A;  3K70 D;  1OIS A;  5FRM A;  2KIU A;  1ZH5 A;  5DV5 A;  1BL0 A;  2FA5 A;  2QSF X;  2HR3 A;  1W36 D;  3I4P A;  5TRD A;  3B02 A;  3EYY A;  3WG7 H;  2MA3 A;  1IZ1 A;  1PYV A;  2GXB A;  1AKH B;  5F1J A;  4Y17 A;  4EJT A;  3LQR A;  1M1E B;  1REP C;  4C2U A;  4IPA A;  3MQ0 A;  5HS7 A;  3CCM I;  3KX2 A;  3SZG A;  5J8C A;  5FD5 A;  2ZXI A;  3RKX A;  1VQO I;  2HS5 A;  4F55 A;  2OU2 A;  2WY7 Q;  1YRN A;  5IP6 A;  2V1N A;  2BY2 A;  1V5G A;  2EB7 A;  2A3S A;  3E6D A;  1IAW A;  5L3G A;  3KEO A;  2E7W A;  1O4X A;  2GIZ A;  3JRB A;  5B1B H;  1ZRE A;  3H9J A;  3I9V 2;  4MQ9 F;  4BUP A;  4WWC A;  5IT3 A;  2BVM A;  2M4K A;  4L5I A;  2HXI A;  2E7X A;  2NVY J;  3AL0 B;  2OBP A;  2HNH A;  2R7Q A;  1AKH A;  3I59 B;  3DWL E;  1JE8 A;  1Z6T A;  1Y1V J;  3EUA A;  3TMO A;  5HDG A;  2IT0 A;  1AA7 A;  1MH4 A;  5JVT A;  3AG4 H;  3QOE A;  4LIU A;  1XCV A;  2QSH X;  1ETW A;  2EZH A;  3GUD A;  4B3A A;  4ZZD A;  2KIF A;  1ZRF A;  1XGO A;  2FQ4 A;  2D5V A;  4GXO A;  3EQL F;  4IXA A;  1B4A A;  2E1N A;  3HEF A;  3UR3 C;  1TT0 A;  3FXL A;  2PQ8 A;  4XRS A;  4NC6 A;  2R7S A;  1S8N A;  2W1O A;  4IOC F;  3MAJ A;  1TNS A;  2Y30 A;  1SAX A;  4FE4 A;  3H3V K;  1OYW A;  2NYX A;  3DU5 A;  3ABM H;  2JZY A;  2DT7 B;  5BNG A;  4I6Z A;  3VYR B;  4UXN A;  2M0C A;  3I59 A;  2XF5 A;  4LOC A;  2NNN A;  3AG3 H;  1PP7 U;  3GTL J;  4LIT A;  4FE7 A;  2AQF A;  3H9Q A;  4CCL A;  4UHT A;  2MSY A;  2RQP A;  3BTC A;  3OYK A;  1FX7 A;  1VF9 A;  3K4L A;  4X6A J;  1FZP B;  3QP5 A;  3FKI J;  1XMA A;  4AD9 A;  3TQN A;  1VZ0 A;  2W24 A;  4RM2 A;  1DPR A;  4OIO F;  1LDD A;  2ISY A;  3GXO A;  1QZY A;  4XN0 A;  2ZJP F;  5GTH C;  1JKQ C;  1YW9 A;  4E6K G;  2MD5 A;  2HQR A;  1ENH A;  2IP2 A;  1QNT A;  1X1P A;  5M5X J;  3PJR A;  1VQL I;  2ESH A;  2LOO A;  3ZQF A;  3F22 A;  4MFE A;  2DAO A;  4C9Y A;  2E36 A;  5CYV A;  2AHQ A;  2DTZ A;  3CP8 A;  3RYR A;  3CF2 A;  3GTJ J;  1O7F A;  3FXQ A;  2RRE A;  4RB2 C;  4CHU A;  1DQU A;  1Y6I A;  2OCE A;  4M3E A;  4MIM A;  1MKM A;  1WJF A;  4HW0 A;  2DQR A;  1X3Z B;  5DD4 A;  4OU0 A;  2IA2 A;  4PJM A;  5IP9 J;  3H9G A;  2DMP A;  5F0F A;  3SEZ A;  2IPQ X;  2LKS A;  4P9U A;  3IP4 B;  3CCS I;  1JTY A;  1D8J A;  3D1N I;  4K2E A;  4UVA A;  3CCE I;  3ZMZ A;  1X4O A;  1XGS A;  5JR3 A;  1R4N B;  3HHG A;  5B1A H;  3HOV J;  1LVA A;  2DA3 A;  3WTV C;  2X6O A;  2RAE A;  2PMH A;  2XAH A;  1LDK B;  2HYG D;  4MEY F;  3REO A;  1P9Q C;  4Y7N J;  3E5Q A;  3TO6 A;  1OQY A;  1FP1 D;  2JK3 A;  2V6E A;  3MN2 A;  2D1V A;  4ENJ A;  2YX4 A;  3FZV A;  3DPU A;  4J01 A;  3GCM A;  4GGG A;  2CV1 A;  3BQZ A;  1VQ4 I;  2RC4 A;  1R23 A;  4JX5 A;  4ZTJ A;  3BT9 A;  5J1Y A;  3KYL A;  2P5V A;  4UVB A;  2CG4 A;  1BJZ A;  3JSP A;  2DDA A;  5FKO A;  4A3B J;  2IXS A;  3ASO H;  3BWG A;  4M6V A;  4PDK A;  5TJJ A;  3E5X A;  4BY7 J;  1EKE A;  4KJZ A;  1BI2 A;  3SEQ A;  1LFU P;  2L3D A;  2OTJ I;  5EGO A;  3RKY A;  1IV6 A;  2XGX A;  1FOY A;  2EA2 A;  2GOM A;  2F4O B;  1N78 A;  4CZZ A;  4PSW A;  5FJ8 J;  4G6T B;  3PNY A;  4HNV A;  2IRF G;  1J5Y A;  3TW6 A;  5ERI A;  3K2A A;  4J19 A;  2V26 A;  3GLL A;  1HBX G;  3M8E A;  4CO8 A;  1Z9C A;  4IKF A;  5FO5 A;  1D0Z A;  4F91 B;  3CLQ A;  5M5W J;  1MBF A;  1LKX A;  1I3A A;  3SFZ A;  2UUZ A;  2VKV A;  2E71 A;  2ETH A;  4AM3 A;  2R7W A;  1YW8 A;  1OCZ H;  2WV0 A;  4XKV A;  1WPK A;  4HLY A;  2E1M B;  4GO1 A;  1T8I A;  1JKO C;  5LHI A;  1HA8 A;  3BJO A;  3TDZ C;  3AG2 H;  3BCB A;  1UJ8 A;  3H3Z A;  5GPA A;  1TWF J;  2LLK A;  3KP2 A;  3S15 J;  3J81 K;  3ABK H;  3HOZ J;  1ZAR A;  3F9K A;  1B72 B;  2MLK A;  3KEQ A;  2LC2 A;  4L9J A;  4PFO A;  3LA2 A;  3VOD A;  3ZOB A;  2RNG A;  4RGR A;  4WXD A;  2UZK A;  1LVK A;  4B44 A;  4BQO A;  1QA6 A;  3BR2 A;  3RZD J;  2Q2E B;  4XKB A;  4G94 A;  1E3O C;  3BJA A;  2L01 A;  3D0S A;  3QU6 A;  4XIC A;  4I98 B;  3V42 A;  1TT5 B;  4LK1 F;  2EFO A;  3Q9V A;  1D1C A;  4KIF A;  1Y0U A;  1MJA A;  2V79 A;  1E3P A;  3NWT A;  1QZZ A;  4U0V A;  1FEX A;  1TNT A;  3FXK A;  4GFB A;  2YUS A;  3GO5 A;  2R4G A;  1L0O C;  1UHW A;  5HS8 A;  2X9D A;  2VC0 A;  2G7H A;  4HDV A;  5LGN A;  2QZ8 A;  1B72 A;  4NUB A;  3JRE A;  1YO5 C;  4MQV A;  4M9X A;  2M8E A;  3HOY J;  5EZG A;  2E2I J;  3I56 I;  1XMX A;  4KIT B;  2AXL A;  2IS6 A;  4U88 A;  3CF5 F;  1FYM A;  1G3T A;  1K6Y A;  2ELJ A;  3HRM A;  4PJ0 C;  2HGC A;  2Q2E A;  4MLO A;  2O5R A;  2LKP A;  1XSV A;  2VQL A;  1VQN I;  4EJV A;  4XLH A;  1WJB A;  2XIG A;  4FTH A;  3QYF A;  4RA2 A;  3LFK A;  5EJC A;  3PL8 A;  1JJ6 C;  4F92 B;  3PFY A;  5LBQ A;  5EG0 B;  1KYW A;  2DK5 A;  1SD5 A;  3OYH A;  2VLA A;  3PUB A;  1IUF A;  4XM3 A;  2LK2 A;  4O5V A;  4FX0 A;  4UB6 C;  2G9W A;  3GTP J;  3DP7 A;  3CCU I;  1MBH A;  4GYI A;  4CCM A;  3FIS A;  2VOO A;  4R8H A;  2G0E A;  2XKP A;  3ZN1 A;  3I55 I;  1NH3 A;  2Z2S B;  1IGN A;  1MH3 A;  2ZFU A;  4F52 A;  4ON0 A;  2IJL A;  3H36 A;  4OAZ A;  2ECB A;  3RPU D;  4RAF A;  4R1H A;  2XDV A;  1ZLK A;  4XRM A;  4BQQ A;  1MMS A;  2PMZ A;  2PBI A;  2L9S A;  1RPW A;  4B1R A;  4EJW A;  5ICC A;  4R79 A;  1I50 J;  4OWR B;  3CO7 C;  4S05 A;  5ILU A;  2CSO A;  5EG0 A;  2X6X A;  2KIS A;  4FX4 A;  3TKY A;  2DQL A;  2FUG 2;  3HSE A;  4G7O F;  2EV0 A;  3BOQ A;  4CYC A;  1K78 B;  5H6Q A;  1BIB A;  1BI0 A;  1P7J A;  2QEN A;  2L5Q A;  3DBH B;  4BDZ A;  2XV4 S;  1VQ5 I;  2JA6 J;  3O8G A;  1Y0N A;  3JRA A;  1J7K A;  3GZ6 A;  2AS5 F;  1KON A;  1S7O A;  4DJA A;  4NNJ A;  3IRQ A;  1HDP A;  3MKW B;  1R5H A;  3JRG A;  5D5U B;  3RTR A;  3GEZ A;  4PGG A;  4B47 A;  5DTD A;  1VQK I;  1RI7 A;  3PM1 A;  3ZRG A;  1E17 A;  2L9N A;  1KGS A;  3DU6 A;  1YIT I;  4FIS A;  2H94 A;  1B9N A;  1YJ9 I;  2GQQ A;  4L0Y B;  5FKM A;  1VQ7 I;  2JUC A;  5K7H A;  2F5C A;  2DMN A;  3KIO A;  4M71 A;  1OCR H;  2WA0 A;  2XVC A;  3GFM A;  4ENM A;  1K78 A;  2QLZ A;  2FQ3 A;  4PJJ A;  3JTH A;  3H5N A;  2EIM H;  2OZ6 A;  3MZ8 A;  2ZXH A;  1T98 A;  3RQI A;  3R0A A;  2F5E A;  5CLS A;  3IH4 A;  1SMY F;  2H8W A;  3IV5 A;  5LFA A;  4IVN A;  2EPF A;  2VJ5 A;  5E17 F;  1U6G A;  3U1K A;  3LSH A;  1R49 A;  4DQ2 A;  3PIO F;  2EQR A;  2VT2 A;  1B8I B;  1HST A;  3B6C A;  3ZR8 X;  1H89 C;  4BHP A;  3VYS B;  3I53 A;  2NS8 A;  2M2E A;  4XLC A;  4DOZ A;  3AKZ A;  1WVR A;  5LGT A;  1YX3 A;  3FM5 A;  1ETO A;  1TBX A;  5GAD J;  1RKT A;  2LNB A;  2V9V A;  5DDG A;  3C1D A;  1ITY A;  4G6D A;  5J3L A;  2HDC A;  4IHT A;  2ICW G;  2LG4 A;  3GF2 A;  2Z33 A;  3K1M A;  2EZL A;  1SFU A;  4YG2 F;  4KNY A;  1E3H A;  2KRC A;  2BE5 F;  2DFE A;  2GZW A;  4KMU X;  2DYR H;  4F7Z A;  3WTY C;  3WTW C;  1WJ5 A;  2Z5U A;  1YI2 I;  1L3L A;  1B8I A;  3C7J A;  4EM1 A;  3BC8 A;  3NAR A;  1QHG A;  1G4D A;  4KFC A;  4MHG A;  1ZK8 A;  3OR1 C;  2LRE A;  1MSE C;  2F4I A;  3GWZ A;  1R9T J;  2FNA A;  5H6R A;  2NRA C;  1TQM A;  2L54 A;  2CRG A;  3S16 J;  2VB6 A;  1UAA A;  3TOA A;  2K9M A;  1WFX A;  2P0W A;  3TO7 A;  2B0L A;  1HC8 A;  4WCG A;  2RV8 A;  1IO2 A;  5GAG J;  5BQT A;  5JI6 A;  4A3J J;  2IS1 A;  4CYD A;  1W5T A;  3OIO A;  4BQA A;  3BPX A;  1EV7 A;  4ZYE A;  2M45 A;  5AON A;  2CYY A;  4JP0 A;  2R5Z B;  3S8P A;  2Q8K A;  2Y69 H;  1IF1 A;  2QVO A;  4ENK A;  4XLE A;  2WWY A;  4QLC U;  3K70 C;  1ZGJ A;  4II2 A;  3MZY A;  4EGY A;  1F4K A;  1TWA J;  3ABT A;  4D5F A;  1ETV A;  1W36 C;  2VJ4 A;  3CCQ I;  1FBU A;  3VSK A;  1DDN A;  1MDM B;  4C3H J;  4ZYD A;  3D5L A;  3HC7 A;  3PQK A;  2ZJR F;  1W0U A;  4MTE A;  4M6Y A;  3KYD B;  1T38 A;  5EEH A;  1J0R A;  4RAG A;  3HOU J;  2OAZ A;  2FOK A;  1KU2 A;  1FLI A;  2HYJ A;  1AWC A;  4BNC A;  4XN3 A;  5FKL A;  4M3F A;  4PFP A;  2MAB A;  4RDU A;  2HXO A;  1WKM A;  4M74 A;  3BCA A;  2DMT A;  3ZCO A;  1D5V A;  1FMW A;  3KP6 A;  2R5Z A;  3CUQ C;  2DA7 A;  3DBL B;  2JRM A;  3VPR A;  1PDN C;  3T8R A;  3P9K A;  4A3K J;  2E5Z A;  4KDP A;  4RLF A;  3F3X A;  5EZH A;  3OY9 A;  2ID3 A;  3HB9 A;  3VSL A;  5M5Y J;  4FT8 A;  1S7A A;  2ME0 A;  3JAM K;  1PUF B;  2DA1 A;  3CCJ I;  1MDM A;  1OYY A;  2FSW A;  4JK1 X;  1ZRC A;  4BGD A;  3BG7 A;  4A0Y A;  1TQI A;  4BKX A;  1IRZ A;  4XLF A;  1ON2 A;  5E79 C;  3CCL I;  4FQG A;  1U8R A;  3HRT A;  4HF2 A;  1R4M B;  3Q0U A;  4UUS B;  1ULY A;  2FBK A;  3K1N A;  1D0X A;  1R58 A;  1T56 A;  3A0H C;  3QAH A;  3BP8 A;  2ISZ A;  3MVP A;  3LWF A;  1RZ4 A;  1XB4 A;  5AIQ A;  5F0C A;  4D9J A;  2NAZ A;  1XN7 A;  3OMY A;  4HX8 A;  5EEA A;  1W0T A;  1O3Q A;  5C4X J;  4LB6 B;  2FMY A;  3C18 A;  1P7I A;  5KCM A;  2MG4 A;  4OIP F;  3BY6 A;  1PUF A;  1WSU A;  3R61 A;  1YJN I;  4I09 A;  5B5E C;  1FTT A;  1FBQ A;  1IN5 A;  1OKR A;  4XLA A;  1FNN A;  2F48 A;  1NK2 P;  1HQC A;  4L5E A;  1R71 A;  1SMT A;  2MYS A;  3CDI A;  5J40 A;  4AVZ A;  4EV0 A;  2XGC A;  4YEL A;  4UUS A;  3P7N A;  4CSW A;  4RAY A;  4EQQ A;  2HOS A;  2VQC A;  1PVE A;  1CF7 B;  1EH7 A;  3W2A A;  2CV0 A;  4KIB A;  5AIP A;  1RNL A;  4N0B A;  1MJ9 A;  3TOB A;  2CUE A;  4IJA A;  1YG2 A;  3PO2 J;  1X3U A;  5FRO A;  3CMM A;  1G3Y A;  1SVL A;  3HKZ N;  3ZQC A;  2DA5 A;  2Z99 A;  1RUO A;  2VBX A;  3ZQ7 A;  4HF1 A;  2A6E F;  3GW2 A;  1QVT A;  3MFK A;  1OYI A;  2DI3 A;  4YRV A;  2LP0 A;  3FKJ A;  3PSF A;  2JWT A;  1RES A;  2M4G A;  3BZK A;  4PGH A;  3ECH A;  4BJT A;  2YPR A;  1HXD A;  3HOW J;  2Y0M A;  3ZMS A;  3EDP A;  4XQF A;  1YOV B;  2KQR A;  1Z67 A;  2VN2 A;  2ZNZ A;  1CF7 A;  3E5U A;  1Z7L A;  2O0Y A;  1DGR M;  3LAJ A;  1ZG1 A;  1N77 A;  4G8X A;  2TDX A;  2D2W A;  1KU7 A;  5A2Q K;  2BV6 A;  4BJ5 C;  1JUM A;  1H88 C;  3QOD A;  5D5W B;  3WE2 A;  3H0D A;  3LSR A;  3JR9 A;  4A5M A;  2QM3 A;  2DO7 A;  4A0Z A;  1OLT A;  1XSD A;  2LVS A;  3H5A A;  1QVU A;  1J2X A;  5D4S A;  2L02 A;  2CW0 F;  2L7Z A;  4WX9 A;  4RLQ A;  4ASN A;  4C3J J;  1JGG A;  5F0H A;  4AUX A;  2COM A;  4B4C A;  1E2X A;  4I76 A;  3NAU A;  5LEJ A;  4E7S A;  3RKW A;  4D7M A;  1FC3 A;  4XID A;  3JSO A;  3SXY A;  1X19 A;  2KLO A;  1ZTR A;  2LY9 A;  4BHB A;  1VI0 A;  3HPG A;  4OOI A;  4M72 A;  5FLX Z;  1HW5 A;  2EWN A;  1FYK A;  3AL0 C;  2DCE A;  4UV8 A;  5JHU A;  2KIM A;  3WU2 C;  3J7A Y;  3BZC A;  1EH6 A;  2EK5 A;  3MKZ A;  3UKG A;  3MZH A;  1U9N A;  5D5X B;  4D5C A;  2GA1 A;  3I58 A;  2BY0 A;  1V5F A;  3ECO A;  2EA4 A;  3IAS 2;  3TGN A;  1KU9 A;  4BEH B;  4EAT A;  3DXJ F;  1IN8 A;  3ERM A;  2KJC A;  5LHG A;  3FXJ A;  2MGQ A;  4LIV A;  2VL8 A;  3L2R A;  2STW A;  3IL2 A;  4AIH A;  4IHV A;  3R4K A;  1MIJ A;  2JA8 J;  4I01 A;  4XL9 A;  2KL4 A;  3WE3 A;  2DA6 A;  5CVJ A;  1O3T A;  3FX3 A;  5D8K B;  4M3B A;  3NEU A;  3JTG A;  2XPW A;  2PG4 A;  3HXL A;  3VYU B;  3L2V A;  1USS A;  3WHB A;  3ZQH A;  2O61 A;  1KA8 A;  2VE8 A;  5FFZ A;  2K7L A;  4Q4Z F;  4EJO A;  1JGS A;  2HFH A;  2X0L A;  3K9T A;  1XX5 A;  3L2W A;  3PO3 J;  4C2M J;  3LFU A;  4RMN A;  1CQT A;  3H92 A;  3W6K B;  2V4J C;  1P6R A;  5LD2 C;  4BEH A;  2H1K A;  1T6S A;  1SAU A;  4I2O A;  4HQE A;  1W4M A;  3TO9 A;  5H2F C;  1WZ2 A;  2X1D A;  1UCR A;  1B59 A;  2UXX A;  3G71 I;  2OV7 A;  4HNU A;  2R7D A;  3P9I A;  3WTS C;  2VPL A;  3PQJ A;  3CC2 I;  1S3J A;  4HV6 A;  1W5C C;  3SJM A;  4MTD A;  1TZL A;  3WHC A;  3FWE A;  4AC0 A;  3JAM Z;  2VAS A;  5E1Z B;  3X2Q H;  5JLW A;  2HOT A;  4RGS A;  5C3E J;  3M8J A;  4BXF A;  5ICF A;  1YE9 A;  4D7N A;  3KZI C;  5K5R A;  1BW5 A;  5L3E A;  1MW7 A;  5D8L B;  2DJN A;  3U2R A;  1YQA A;  1O57 A;  2VQG A;  4RGX A;  1HW1 A;  2K40 A;  1K4T A;  3D5R C;  1UHS A;  4A3D J;  1MBJ A;  3GVA A;  2ZO4 A;  1QRY A;  4LLG F;  1UMQ A;  1BBY A;  5DM7 F;  1XMK A;  3L2C A;  5EGO B;  2EFW A;  4JX4 A;  2HKO A;  2Z1D A;  4U87 A;  1DUX C;  3I71 A;  1ZQ3 P;  1FSH A;  3ZXS A;  3O8H A;  2MH9 A;  2VPR A;  1D5Y A;  1BOB A;  2KHM A;  3ZQL A;  1YHQ I;  4D1Q A;  4KN7 X;  3CUO A;  3HUG A;  3BTI A;  4E4H A;  1V55 H;  2V1U A;  2YS9 A;  3GTG J;  2A5Y B;  4I0A A;  2MC4 A;  1U5T C;  4A3L J;  4D0P A;  2QA4 I;  2PX9 A;  2W7N A;  2YSR A;  3IUO A;  4HX4 A;  1EJ9 A;  1IJW C;  1P4X A;  3LOC A;  3ML6 A;  2PJR B;  2EIJ H;  4DYR A;  4QTR A;  3HRS A;  4BQN A;  5FFX A;  1QBJ A;  1GV5 A;  3OS1 A;  4CGZ A;  4ABZ A;  2VUM J;  1IDY A;  1XGM A;  3E7L A;  2GWR A;  3CJN A;  4KUM A;  3V7C A;  4DYC A;  4IX7 A;  3CMY A;  3PIP F; 
#chains in the Genus database with same CATH homology
 2JJ7 A;  2OF7 A;  1HCR A;  3OOU A;  4CYC A;  5F27 A;  3BTL A;  1P7J A;  2P81 A;  9ANT A;  4NDL A;  4V2F A;  2R5Y B;  2JA6 J;  3O8G A;  3JRD A;  3JRA A;  1ETQ A;  3HGG A;  4X1E A;  2NVT J;  3M4O J;  1HDP A;  3Q0V A;  3IH2 A;  1Y1W J;  1ZGW A;  2VKE A;  2YU9 J;  3JRG A;  3G1O A;  3LSG A;  5DTD A;  3BG9 A;  3PM1 A;  2Y31 A;  4MO7 A;  3F0C A;  2XB5 A;  4FIS A;  3LNQ A;  2LD5 A;  1IC8 A;  2JA7 J;  2ELK A;  4BXX J;  2XB0 X;  3GTK J;  5FKM A;  2JMW A;  2Y9Z A;  1FIP A;  1X2M A;  1JUS A;  5IPA A;  5K7H A;  2DMN A;  2PMZ N;  4FCY A;  5FLM J;  4A3E J;  1I6H J;  2L7M P;  2R5Y A;  1LE8 B;  4M3G A;  2DA2 A;  3RQI A;  2B63 J;  3SFI A;  3IH4 A;  3IV5 A;  1ZR4 A;  4IEJ A;  3HGY A;  4A3F J;  3BR5 A;  2JA5 J;  4IHW A;  3S1N J;  2EQR A;  2KDZ A;  1HDD C;  1B8I B;  1ZR2 A;  3B6C A;  1A5J A;  1H89 C;  2NS8 A;  2M2E A;  2CQX A;  3MKL A;  1X58 A;  3RZO J;  2M34 A;  2GBY A;  1RKW A;  2XPV A;  2O8K A;  1ETO A;  1RKT A;  1MBG A;  1WCM J;  3A01 B;  4A3M J;  1ITY A;  3TP3 A;  5J3L A;  1G2H A;  3GTO J;  2WAQ N;  5C44 J;  3K7A J;  4BBR J;  1SFO J;  1LE8 A;  1WGX A;  1U8B A;  2EZL A;  1TC3 C;  1FTZ A;  2FX0 A;  5DS9 A;  1XG1 A;  3QQA A;  2DA4 A;  1GV2 A;  2IBD A;  2IAI A;  1SAN A;  1MBE A;  4Y52 J;  1JTX A;  4BBS J;  4QSH A;  1Q1V A;  1B8I A;  3A02 A;  3L1P A;  5HOD A;  3NAR A;  1WI3 A;  1Z0X A;  3DEW A;  1X2N A;  1OCT C;  2DMQ A;  3CDL A;  4V2G A;  2JN6 A;  3GBG A;  1ZK8 A;  3S2D J;  1MSE C;  2XGE A;  1R9T J;  4CYC B;  3OSG A;  1YRN B;  2DN0 A;  2CJJ A;  2Y2Z A;  2EH3 A;  2HOA A;  5F04 A;  2CRG A;  3A01 A;  2HI3 A;  3S16 J;  5FKN A;  2W48 A;  3BR1 A;  3JRF A;  2XGD A;  1ZKG A;  3C2B A;  5IYB J;  1WH5 A;  3DCF A;  1BL0 A;  3HDD A;  3GTQ J;  1ORK A;  2R92 J;  5IYD J;  4A3J J;  3OIO A;  1AKH B;  5M3M J;  5EDN A;  5F1J A;  3SDG A;  2M8G X;  5E3N A;  4JP0 A;  2R5Z B;  4A69 C;  5J1R A;  1U9O A;  2ZB9 A;  1DU6 A;  5IYC J;  1A6I A;  1TWA J;  4D5F A;  1ETV A;  1YRN A;  5IP6 A;  4C3H J;  2FJ1 A;  2XSD C;  1W0U A;  1O4X A;  1MNM C;  2OPT A;  3BR3 A;  3JRB A;  3JRH A;  3HOU J;  1H8A C;  2HYJ A;  2HXI A;  5FKL A;  2NVY J;  4M3F A;  4RDU A;  1APL C;  5E3O A;  3HBL A;  1AKH A;  2HXO A;  3BG3 A;  5E3L A;  2ME6 A;  1Y1V J;  2DMT A;  1MH4 A;  2R5Z A;  2DA7 A;  3CQZ J;  2E2H J;  3VPR A;  1ETW A;  2EZH A;  4B3A A;  1XS9 A;  4A3K J;  4W1U A;  2FQ4 A;  2D5V A;  5EZH A;  2DMU A;  3HEF A;  1GUU A;  2ID3 A;  3HB9 A;  5M5Y J;  1K61 A;  2L7F P;  2ME0 A;  1ETK A;  2DA1 A;  1PUF B;  3ZQG A;  3JRC A;  3QPS A;  4XRS A;  1NK3 P;  3TED A;  4JYK A;  4BKX A;  1IRZ A;  2E2J J;  5JLX A;  2EZI A;  2Y30 A;  2QF7 A;  4FE4 A;  4G12 A;  3H3V K;  1F36 A;  3S1Q J;  2NVQ J;  3Q3S A;  3Q0U A;  4UUS B;  2MW8 A;  2ECC A;  5BNG A;  3M3Y J;  4I6Z A;  1T56 A;  2M0C A;  2LR8 A;  2HQ5 A;  4LOC A;  2K9Q A;  4BY1 J;  3MVP A;  3GTL J;  4FE7 A;  3I4M J;  3BTJ A;  2TRT A;  5F0C A;  2MSY A;  3BTC A;  5C4X J;  5EEA A;  1W0T A;  1VF9 A;  5IOZ A;  4M3D A;  2CQQ A;  1ETY A;  3HM5 A;  4X6A J;  3FKI J;  1P7I A;  1IDZ A;  2MG4 A;  2LKX A;  1GT0 C;  1DU0 A;  3OSF A;  2I10 A;  1PUF A;  1TWH J;  2CUF A;  1FTT A;  5F08 A;  1JKQ C;  1NK2 P;  2R7Z J;  2E19 A;  1ENH A;  4L5E A;  2N8G A;  5M5X J;  1OJL A;  5EF6 A;  3ZQF A;  2XGC A;  4UUS A;  1I3Q J;  4MFE A;  2HOS A;  2AHQ A;  4A3I J;  2DTZ A;  1S7E A;  1OCP A;  2ID6 A;  3GTJ J;  3TP0 A;  4DYQ A;  1HLV A;  4M3E A;  2CUE A;  1FIA A;  3PO2 J;  4MIM A;  4QIW N;  3TW7 A;  5IOY A;  5IP7 J;  5IP9 J;  1U78 A;  4XRS G;  3HOX J;  1WH7 A;  2DMP A;  3HKZ N;  5F0F A;  3ZQC A;  2DA5 A;  5K7F A;  4DZJ A;  2LTP A;  1JTY A;  1QVT A;  3D1N I;  2XRL A;  3A03 A;  2LP0 A;  2JWT A;  1RES A;  3HOV J;  2DA3 A;  2K9N A;  2X6O A;  1JJ8 C;  2RAE A;  3HOW J;  3S17 J;  2IEK A;  4Y7N J;  3H0G J;  1Z77 A;  2JK3 A;  4IHY A;  1RET A;  5J1U A;  3B6A A;  3MN2 A;  1EF4 A;  2VI6 A;  1JUM A;  1H88 C;  1BW6 A;  4A93 J;  1BA5 A;  3LSR A;  3JR9 A;  1POG A;  4DZP A;  1RR7 A;  1VND A;  2AO9 A;  2LVS A;  3BQZ A;  1JT0 A;  3ZQI A;  4JX5 A;  4C3I J;  3BT9 A;  5J1Y A;  1QVU A;  2L7Z A;  4UUT A;  1BJZ A;  1JGG A;  4C3J J;  1TWC J;  5FKO A;  5F0H A;  4A3B J;  4AUX A;  4B4C A;  2R0Q C;  1MSF C;  4I76 A;  1XC5 A;  3NAU A;  4M6V A;  4BY7 J;  3BG5 A;  4D7M A;  4XID A;  1LFU P;  5EGO A;  3FIW A;  1IV6 A;  1FJL A;  1ZTR A;  1JKR C;  2LY9 A;  3S14 J;  1VI0 A;  3BR0 A;  2M9H A;  2GLO A;  2NVX J;  5FJ8 J;  4HNV A;  3TW6 A;  1F43 A;  4A3C J;  4DW6 A;  3K2A A;  3UKG A;  4J19 A;  3LSJ A;  5K7Z A;  1U9N A;  4D5C A;  1JUP A;  5FLV A;  3IH3 A;  5M5W J;  1MBF A;  2L0K A;  2XPU A;  4IHX A;  2NOG A;  2VKV A;  5GP9 A;  2MGQ A;  1AU7 A;  2EZK A;  2TCT A;  5C4J J;  4IHV A;  2JA8 J;  1WPK A;  1JKO C;  2DA6 A;  1MBK A;  2E1O A;  2EBI A;  1TWF J;  2FD5 A;  2LLK A;  4M3B A;  5GPA A;  2H8R A;  3S15 J;  3S1M J;  4A3G J;  2XPW A;  3HOZ J;  1NTC A;  3RKQ A;  2GM4 A;  3WHB A;  3ZQH A;  2O9L A;  3GTM J;  4S0H B;  1B72 B;  1HOM A;  1LFB A;  3ZOB A;  3I4N J;  1ETX A;  4C2M J;  3PO3 J;  1CQT A;  3S2H J;  3BR2 A;  3RZD J;  2QCO A;  1E3O C;  2Y9Y A;  2L9R A;  4XIC A;  2H1K A;  1TWG J;  3S1R J;  3FK7 A;  1AHD P;  1UG2 A;  2LFB A;  2WV1 A;  2O7O A;  2WB1 N;  4MFD A;  1FEX A;  4GFB A;  2YUS A;  3CCY A;  3QPL A;  2X9D A;  4W97 A;  3BR6 A;  3SJM A;  2CU7 A;  3FK6 A;  3WHC A;  4AC0 A;  1GVD A;  5JLW A;  1B72 A;  3G1M A;  3JRE A;  2HOT A;  5C3E J;  3Q0W A;  4JX6 A;  3HOY J;  4D7N A;  5EZG A;  2E2I J;  3JRI A;  1BW5 A;  1QPI A;  2KT0 A;  2DJN A;  2K9S A;  2HDD A;  2NS7 A;  4MLO A;  2K40 A;  1UHS A;  4A3D J;  5FKK A;  4FTH A;  1MBJ A;  2COB A;  5E3M A;  1QRY A;  1K83 J;  1UMQ A;  4RBO A;  1JJ6 C;  5EGO B;  5EG0 B;  3W6V A;  4JX4 A;  1ZQ3 P;  3G1L A;  1GDT A;  3O8H A;  2VPR A;  1D5Y A;  3ZQL A;  1IUF A;  1IG7 A;  2LK2 A;  1HF0 A;  2X48 A;  3GTP J;  1MBH A;  3BTI A;  3FIS A;  1T33 A;  2YS9 A;  1VFC A;  3GTG J;  2G0E A;  5M3F J;  5GPC A;  1IGN A;  4A3L J;  4AYB N;  1OFC X;  1MH3 A;  1IJW C;  4XK4 A;  2R93 J;  3LOC A;  2ECB A;  4DYR A;  4QTR A;  4XRM A;  1JT6 A;  3BQY A;  1RPW A;  4B1R A;  3LSP A;  1JKP C;  1GV5 A;  2Y0S N;  1I50 J;  4EEF G;  2VUM J;  4ABZ A;  1IDY A;  3E7L A;  4DYC A;  5EG0 A;  5EYR A;  3CMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...