2ME0A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens solved in the presence of the dna sequence cgactaattagtcg
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
b'SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens solved in the presence of the DNA sequence CGACTAATTAGTCG
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2me0A00
4CYCA 3JREA 2DA5A 5F27A 3GTJJ 3S2HJ 4XICA 1PUFB 3HOXJ 4A3EJ 1BA5A 3PO3J 3JRDA 4W1UA 1MSEC 2CJJA 1FIAA 5FKLA 4CYCB 1F36A 5M5XJ 4W97A 1I50J 2KT0A 3TEDA 3JR9A 5EZGA 1NK2P 3H0GJ 2R7ZJ 2YS9A 3GTPJ 3K7AJ 3ZOBA 4DZJA 5M3MJ 5JLWA 3LSPA 1ETKA 4FE4A 4JP0A 4DYQA 2X9DA 2CRGA 3WHCA 1QVTA 4M3EA 2R93J 2DN0A 4HNVA 1LE8A 5F0CA 3A02A 3OIOA 1BW6A 1LFUP 2EH3A 1R9TJ 2XB5A 3HKZN 1UG2A 3BTIA 5M5YJ 4RBOA 3IH2A 4QSHA 2E2IJ 2O7OA 4X1EA 5J1YA 1LE8B 4V2FA 1U9NA 3G1MA 4B1RA 2YUSA 4A3IJ 4IHWA 2W48A 1JUSA 4M3GA 3Q0VA 1JUPA 4A69C 5FLVA 3IH3A 5IYCJ 2QCOA 4JYKA 2R92J 4UUSA 1ZTRA 1TWCJ 3G1OA 3GTMJ 3HOWJ 2XPWA 4IHVA 4D7NA 3S14J 3ZQCA 1JKOC 4MO7A 2DA1A 1JJ6C 2H1KA 4G12A 3BTJA 2ID3A 1AU7A 3I4MJ 3PO2J 1QRYA 4DZPA 2K40A 3FK6A 4MLOA 2X48A 2LTPA 5K7HA 2NS7A 4UUSB 1OCPA 2NOGA 2D5VA 2MG4A 5EDNA 3W6VA 2MSYA 2HI3A 4IEJA 1QVUA 1MBEA 3FKIJ 1HCRA 5DTDA 1P7IA 3S1RJ 5EG0A 3TW6A 2DMPA 5FKMA 2EQRA 1WCMJ 2TCTA 3LOCA 2HYJA 4BBRJ 4A3LJ 2WB1N 2L0KA 3OSGA 2FX0A 5EG0B 1ORKA 1HDDC 2MW8A 3BQYA 2NVXJ 1WH5A 3HOVJ 3LNQA 1DU0A 5FKKA 1A5JA 1H8AC 4NDLA 1NTCA 1JTYA 2LFBA 4FISA 1IRZA 1Y1VJ 3C2BA 3Q0WA 4A3MJ 3GTGJ 2VKVA 2OF7A 3CCYA 3E7LA 3HM5A 1MH3A 2DMUA 3PM1A 3UKGA 1ZQ3P 2DMTA 1HOMA 2X6OA 3SDGA 3IH4A 1MBJA 5EYRA 3NAUA 4XIDA 2HQ5A 2K9SA 3CQZJ 5IPAA 3DCFA 1JGGA 4FE7A 3K2AA 3B6AA 2XSDC 2O8KA 4DYRA 3JRHA 4AC0A 3FK7A 4LOCA 2LKXA 2E1OA 4IHXA 1UHSA 4Y7NJ 5GPCA 1E3OC 1ETYA 2M2EA 4JX5A 4GFBA 2P81A 3ZQLA 3H3VK 1H88C 2B63J 4C3IJ 1MBKA 3M3YJ 1ZKGA 2HOTA 1D5YA 1X58A 2JA7J 1JTXA 2LP0A 1HF0A 1TWFJ 4EEFG 5IOZA 2GBYA 3FIWA 2CU7A 1APLC 5EZHA 3BR0A 3GTKJ 4MFDA 4MIMA 4A3CJ 2XPUA 4B3AA 5FKNA 3S2DJ 2I10A 1GV5A 3O8GA 1K61A 2EZIA 1MH4A 2DTZA 2HXIA 1MBGA 1I6HJ 1IGNA 3TW7A 5EF6A 3JRBA 1XS9A 2K9QA 3F0CA 1ETOA 1JT0A 1IV6A 3LSGA 1XC5A 3HOYJ 4DW6A 2NS8A 5BNGA 1AKHA 1T56A 2E2JJ 2QF7A 1RPWA 4M3DA 2VI6A 5J1RA 9ANTA 4BY7J 1B72A 3S16J 2ID6A 3Q3SA 1AKHB 2JN6A 2AO9A 3GTLJ 1IG7A 5C44J 3Q0UA 2R5ZA 1BL0A 4XRMA 1F43A 5EGOA 1B72B 3S1MJ 1ETQA 3QPSA 3RZOJ 4JX4A 2NVQJ 5HODA 2CQXA 5IP9J 4A3FJ 5M3FJ 1RKWA 1GDTA 5GPAA 1VNDA 4QIWN 5C4JJ 1AHDP 4M3FA 2Y31A 2L9RA 2R5ZB 4B4CA 3JRFA 5EGOB 1JUMA 2DJNA 4RDUA 2Y2ZA 3GTQJ 1A6IA 2ECCA 3QPLA 1WH7A 3BR1A 3LSJA 1NK3P 1LFBA 4A3GJ 1RR7A 2JMWA 1TC3C 1IDZA 5C3EJ 3BR2A 1TWHJ 5IOYA 3CMYA 2K9NA 5F0HA 2IAIA 4V2GA 2YU9J 2CQQA 3HDDA 5F0FA 1IUFA 2DMNA 2GLOA 1VI0A 2LY9A 3TP3A 2LD5A 2AHQA 1RKTA 2E2HJ 1ZGWA 4ABZA 1OFCX 3HGYA 3BR5A 3SFIA 3O8HA 3IV5A 1Z0XA 1Y1WJ 2HDDA 1GT0C 2M9HA 1FJLA 1OCTC 3WHBA 5C4XJ 3HOUJ 2JJ7A 1W0TA 2NVYJ 1T33A 3GTOJ 3SJMA 1GVDA 1FEXA 1ZR4A 1TWAJ 1VF9A 2LK2A 3QQAA 4QTRA 1ZK8A 3JRAA 1S7EA 4MFEA 2EZHA 1JKRC 4C2MJ 1QPIA 3D1NI 3JRIA 1ZR2A 2GM4A 3HOZJ 5IYDJ 5IP7J 3B6CA 2DA4A 2FJ1A 4BBSJ 4AUXA 2ME6A 2JWTA 5FJ8J 2LVSA 2ELKA 3OOUA 5J1UA 1VFCA 5DS9A 2HOAA 1ETXA 1MBFA 1SFOJ 2Y30A 4D5FA 3ZQIA 2HOSA 1POGA 5E3NA 2JA8J 3HB9A 3BG3A 3BTLA 2JA6J 1JKQC 3BT9A 5GP9A 2VKEA 3ZQGA 4JX6A 4XRSA 3JRGA 2L7ZA 4A3JJ 5IYBJ 3VPRA 1U78A 4XRSG 2O9LA 3S1NJ 1CQTA 4IHYA 1DU6A 4J19A 3MVPA 2DA6A 2E19A 2OPTA 4UUTA 2KDZA 2ZB9A 1Q1VA 1GUUA 1HDPA 2Y0SN 2VUMJ 2NVTJ 4A3KJ 1Z77A 5EEAA 3LSRA 2EZLA 2ECBA 1P7JA 1MNMC 3S15J 2RAEA 1YRNA 1FIPA 1B8IA 1ITYA 2ME0A 3BR3A 5JLXA 2WV1A 2DA2A 2PMZN 3JRCA 1GV2A 1BJZA 4A3DJ 1IJWC 1O4XA 3S1QJ 3A01A 2MGQA 3GBGA 3HGGA 5F08A 2Y9ZA 1X2NA 2L7MP 1WI3A 4BXXJ 2M34A 1YRNB 2XGCA 5F1JA 2R5YA 2XB0X 1B8IB 3A03A 3TP0A 2LLKA 4M3BA 4A93J 2JA5J 1BW5A 2HXOA 4M6VA 2TRTA 3L1PA 3A01B 4D5CA 1JJ8C 5J3LA 2Y9YA 1FTTA 2FQ4A 2EZKA 1U8BA 4BY1J 5M5WJ 2R5YB 3OSFA 1OJLA 2CUFA 2XRLA 2XPVA 4C3HJ 1EF4A 3BR6A 2R0QC 1IC8A 1X2MA 2G0EA 3BG9A 2L7FP 4I76A 2XGDA 3RZDJ 1JT6A 2N8GA 3DEWA 1IDYA 1HLVA 3CDLA 2DA7A 5FLMJ 4DYCA 5K7ZA 4I6ZA 1MBHA 2COBA 2DA3A 4XK4A 1G2HA 3MN2A 4C3JJ 4FTHA 1SANA 3G1LA 5F04A 4S0HB 2FD5A 2JK3A 2VPRA 1I3QJ 4Y52J 2LR8A 3BG5A 3HBLA 1WGXA 2H8RA 4FCYA 3NARA 2IEKA 3HEFA 5E3LA 2M8GX 3ZQHA 4BKXA 1W0UA 1RESA 1H89C 1JKPC 3RKQA 1UMQA 5FKOA 1FTZA 1K83J 2WAQN 4D7MA 1TWGJ 3I4NJ 4L5EA 5IP6A 2XGEA 4AYBN 3MKLA 2EBIA 2M0CA 2CUEA 1ENHA 1ETVA 2IBDA 3BQZA 5E3OA 1ETWA 3ZQFA 1RETA 1MSFC 3S17J 3FISA 1PUFA 5E3MA 4A3BJ 2DMQA 1U9OA 3BTCA 3RQIA 3M4OJ 1WPKA 5K7FA 4X6AJ 1XG1A
chains in the Genus database with same CATH superfamily
4CYCA 1K78B 1D0XA 1RI7A 5GAHJ 1JI8A 1I1SA 3H9QA 2V1UA 1ZREA 3FMQA 3OYJA 4XICA 1SD6A 1R1VA 1BA5A 4G6DA 4BJTA 4EM0B 4W1UA 3BPVA 3E5QA 1UELB 4DJAA 4CYCB 2JZYA 5GAGJ 2JUGA 3DKWA 1J75A 1HA8A 2F48A 3CUOA 3CC7I 2R7ZJ 3TGNA 3MFKA 4P55A 3K7AJ 2IVMA 5M3MJ 4U7BA 3PJRA 1TZLA 1ZG3A 1ETKA 4RAGA 1FSEA 2E1MC 1ZG5A 2CRGA 2H8WA 4M3EA 2DN0A 5HS9A 3DPTA 2C6YA 1LE8A 5F0CA 1OYWA 4CCMA 3T0YA 3HOSA 3VSKA 1R9TJ 2KZGA 2ZJPF 2JSPA 2XB5A 1FPQA 1TLHB 3ECHA 3RJPA 3WTVC 3W6JB 3WTTC 5FO5A 3LA3A 2WADA 5J1YA 3E6CC 1K7AA 1LE8B 4LLGF 2EK5A 1U9NA 2FNPA 2KHMA 4B1RA 2DCEA 2W48A 4HV6A 3R61A 4NNJA 1JUPA 2QM3A 4OMZA 5K1YA 3OYHA 4JYKA 4UUSA 1ZTRA 3GTMJ 5D8LB 4RM2A 3A1YA 2EFQA 4D7NA 2YR2A 3CCLI 3ROUA 2ZNZA 2DA1A 4G12A 3M8JA 1X3WB 4I0BA 4MLOA 4G7OF 3I71A 2YPRA 1HW5A 5K7HA 4UUSB 2NOGA 4M73A 2D5VA 1RUNA 2VBZA 3L2VA 1YX5A 2GXGA 2HI3A 3N05A 1MBEA 2XKOA 3FKIJ 5DTDA 4C2UA 1P7IA 4XL9A 3S1RJ 2QLZA 1W5SA 4MHGA 2VOPA 4DBRA 3RPUA 2Y75A 2DMPA 3J81Z 1X1BA 2TCTA 3LOCA 4A0ZA 4BBRJ 1E17A 1YOVB 1PJRA 1GHCA 2L0KA 3BLYA 3JSPA 4M6XA 4L0YB 3AL0C 4RB2C 1ORKA 3DEUA 3BQYA 5LGNA 5HDGA 4X0GA 5FKKA 1H8AC 3E0JB 1QA6A 4O6JA 2E1NA 2EPFA 2KP6A 2XV4S 3WTWC 3CCJI 1D1BA 1OPCA 3JTGA 2XSJC 3Q5FA 2R7RA 3Q0WA 1LDDA 4IKFA 1HXDA 2E7WA 1ZQ3P 1YTYA 4ESJA 2X6OA 1HOMA 1BI0A 1MBJA 2F6CA 3GX4X 1LB2A 2K9SA 1JGGA 3ZN0A 3B02A 1D1CA 1ZRFA 2O8KA 2GA2A 2UV1A 4AC0A 5LD2C 3FK7A 1WRJA 2CW0F 4OOIA 4QPOA 4I02A 4Y7NJ 1RC9A 4YFXF 4UV8A 2XF7A 3ERED 1R58A 3ZQLA 4MGRA 3DBRB 3H3VK 1RUOA 2KL4A 1BI3A 2B63J 4C3IJ 1Q1HA 1ZKGA 1I5ZA 5FRMA 2K3FA 2OCEA 3Q9VA 2D1HA 2BYVE 4F91B 3CDHA 1XTAA 2LP0A 2A6EF 1HF0A 2OA4A 3DTIA 4EGYA 3K4LA 3A2KA 3SFZA 2K4BA 3TDUC 3BR0A 2Y0SA 2QBYB 2V1NA 2A6TA 3AFHA 3F22A 3ZGKA 3H92A 2X6XA 4B3AA 2QSGX 2GWRA 5FGMA 2XDVA 2VONA 3O8GA 1MH4A 4HSRA 3E6MA 1XS9A 2V9PA 3RPUD 4H0EA 2K9QA 3U1KA 1LUJB 3HZJA 5B66C 1IV6A 1HKTA 3T1BA 1DDNA 1OCCH 3CUQA 2QVOA 2CQNA 2E2JJ 4G6QA 2V1DA 3BROA 1RPWA 5CVIA 1XPXA 2VI6A 3HTUA 5J1RA 2XROA 2M3AA 1WKMA 4RMNA 1SAUA 2I5UA 2R4GA 4BY7J 4B47A 4RAFA 3S16J 1Z21A 5HLIA 1ZYRF 2WAEA 4GO1A 2ID6A 1G3SA 2HVSA 4BQOA 2HZTA 5KCMA 1WJAA 2DXIA 2BVLA 5HLGA 3HYIA 5KHDA 4XRMA 2K7LA 2PBIA 5EGOA 2XC7A 2CMPA 4F52A 2DAOA 3S1MJ 4ENMA 4JX4A 2CO5A 2CQXA 5GTHC 1X1DA 1RKWA 4XSXF 2QZ8A 1Y56A 2DT5A 2KRFA 4I0AA 3V42A 5IT3A 2VT2A 4M3FA 2GXAA 2L9RA 4KISA 2GAUA 3JRFA 3WU0A 5JVGF 1WQ2A 5EGOB 1YITI 4OIPF 2DJNA 3BWGA 3VYTB 4HOBA 4AVZA 2Y2ZA 4RGXA 3ABTA 4A3GJ 1XD7A 3H3ZA 1IDZA 2LBFA 4RGRA 4XLEA 1HSJA 3IKTA 4CA0A 3KP4A 1KQ8A 5LEJA 5IOYA 3CC4I 1X1PA 4F7ZA 2F5CA 3MWMA 1MJ9A 1WJ5A 3L7WA 2DMNA 2PQ8A 2LBFB 3VEPA 4ZC3A 4AYBA 1PP7U 4M9ZA 5CVJA 4CCLA 2R7QA 3G6EI 1OISA 3LAJA 3O8HA 3QYFA 4C2TA 2DU9A 3P5JA 5B1BH 2X85A 3MD2A 4IJAA 1WFXA 4XOPA 1Z0XA 3EPZA 2XUBA 1FJLA 4CCNA 3K70D 4LD5A 4ZTJA 4ETSA 1W0TA 2HVRA 2ZXIA 2QQ8A 2EFPA 1G59A 3C2HA 2BGCA 4IHTA 3V7CA 1GVDA 2EIKH 2KIMA 1NG7A 1QZEA 3JSOA 2OQGA 3OL4A 1VF9A 2LK2A 4LG0A 3F72A 1ZK8A 1X1CA 3OR2C 1S7EA 1X1AA 1TNTA 5D4SA 4E4HA 4MFEA 3PSIA 1FOXA 3PQKA 4C2MJ 3A0HC 2GIVA 3P9KA 3VSLA 2GM4A 3HOZJ 2IS1A 2NNNA 2FJ1A 2XVCA 1E3HA 1VQPI 2ME6A 2JWTA 5FJ8J 4LG0B 3FXQA 1TP4A 4YRVA 2ICWG 4ZDOA 1FZPB 1E2XA 3OL3A 1KQ0A 2HGCA 1SFOJ 3L2RA 1IN5A 1O3TA 1T0FC 2HOSA 2GA1A 5E3NA 4HBLA 2P0WA 4HQEA 3KETA 5IT9K 3JCUC 4XN0A 3ZRGA 2VKEA 2W1OA 2L9SA 3B73A 4J00A 2CUJA 5L3DA 2HYFA 3O3KA 4D9JA 4HNUA 2HQRA 3VYRB 3MKWB 3OV8A 3PIOF 5FRNA 2AXTC 2KJBA 1CQTA 4NC8A 1O7LA 2IW5A 1DU6A 4HX7A 3WU2C 3HHHA 3ESWB 2LY2A 4UVAA 3H5NA 1VQ4I 2PFBA 1G3YA 4BACA 3KPHA 1WJFA 4KN4X 3OYKA 1D0ZA 1SAXA 4OU0A 3ASNH 1HKQA 4BHPA 3W6KB 1MNMC 4ZH4F 1HBXG 4UUVA 3S15J 1W36C 2RAEA 1YRNA 5JHFA 2ME0A 4G94A 5JLXA 1UB9A 2DA2A 2WV1A 3OOPA 1OKRA 1VQKI 4A3DJ 4Y4RA 3S1QJ 3IWZA 3GBGA 3RPQA 5F08A 3H0DA 1KU2A 3PNYA 3QU3A 3CMMA 4XNFA 1WI3A 2CS3A 1YRNB 1R7JA 1UCRA 1X19A 3MAJA 4LK0F 1OLTA 3JTHA 4IO9F 4PDKA 4U0YA 4XR6A 4D1QA 2B0LA 1BW5A 2HXOA 3OIQA 1YJWI 2O0YA 3HJEA 2BY3A 3AG2H 2GQQA 3LSTA 4XN3A 2DTRA 1VTNC 2L9NA 3QP5A 5J3LA 3FWEA 1XSDA 1OJLA 5CYVA 2VKDA 1S8NA 4KNYA 4G6TB 3MKZA 2FOKA 3U21A 4XLFA 1VQ5I 5J8CA 2XAUA 4E70A 4B09A 3BG9A 2FQ3A 2L7FP 2Z16A 1S29A 2VJ4A 1FOKA 1JT6A 3OYMA 4FX4A 1QQIA 4B3XA 5D4RA 2M7AA 3C3WA 3F6OA 4AD9A 3CDLA 3K2ZA 3SDBA 4DYCA 1FOYA 2W4SA 5K7ZA 4I6ZA 2ELHA 1O3RA 4RGUA 2COBA 4XK4A 4BHCA 3LSIA 2EFNA 1G2HA 4AVPA 4C3JJ 4FTHA 1LPQA 2WBMA 2FD5A 2JK3A 3S3OA 4C30A 2VPRA 5HS7A 2LR8A 5FB2A 3DV8A 3HBLA 4D0PA 1OR7C 3E3VA 1S7OA 1IW7F 1RZ4A 2M8GX 4RB3C 2K85A 3ZQHA 2CG4A 2NXNB 2X1DA 1UMQA 2XRNA 3DLLF 6PAXA 1FTZA 3DPLC 3LL7A 4NUBA 3TO7A 1IXSB 1TWGJ 2D1VA 3CF2A 4L5EA 4CZCA 4CYDA 1AA7A 1N25A 4BE2A 1T39A 3ZMSA 2PJPA 3E6BA 3OIPA 4BL0B 1T6SA 3ZXSA 5H2FC 1ETVA 5LHIA 4XONA 3P7NA 2UXXA 1LKXA 3K1NA 3FISA 2OU2A 5FLXZ 1SC7A 4A3BJ 3S93A 3ZCOA 3GF2A 4M9SA 4O3MA 3BTCA 3M4OJ 5K5QA 4Q48A 3WGHA 1WVRA 2DQLA 1BOBA 3K4KA 2DA5A 4CCOA 5F27A 1SVMA 3KFWX 3OS2A 3GTJJ 3S2HJ 3RKYA 3ASOH 4KITB 1O57A 2M45A 4U7DA 1KU7A 1XGMA 1HSTA 3PUFA 4WF2A 5H6QA 5LFAA 4E7HA 1MSEC 1F9NA 1FIAA 3EDPA 2QKMB 2XAQA 5M5XJ 1XB4A 5LLQA 5HLTA 1I50J 2JPBA 5E1ZB 2RN7A 3HSRA 3FMSA 3TEDA 4A6DA 2X6WA 1I3AA 5EZGA 2DOAA 1NK2P 4KN7X 3H0GJ 5J8FA 3GTPJ 4F93B 4DZJA 3LSPA 1Y8QB 4JP0A 2X9DA 1XSVA 3WHCA 5GAEJ 4BEHA 1CF7A 4OIOF 4OIQF 2V79A 2MYSA 1ZG1A 1BW6A 3KCCA 4P9UA 1T98A 4Q5SF 1NH3A 3CMAI 3CMEI 2LKSA 5M5YJ 3IH2A 1J0RA 4QSHA 5J47A 3MMYB 4CSWA 3BJAA 4BEHB 4X1EA 1CF7B 2XF5A 3F8FA 4BXUA 4YIIA 2VQHA 4EJOA 2O3FA 2V4JC 4BS9A 1XX5A 3FBIB 3IP4B 3K69A 3V8KA 3KZIC 2EINH 5HNFA 2KQRA 3MKYB 3R0JA 4A69C 1I1GA 3Q0VA 4KIFA 4U0WA 1G3TA 1ZHFA 4DGWB 3IWFA 3DP7A 4KIBA 3OYEA 1YS7A 1TWCJ 3G2BA 3ZP5A 2H27A 2EFWA 3HOWJ 1QHHD 4IF4A 1JKOC 2PN6A 2Q2EA 4MO7A 3K9TA 3BTJA 1R22A 3I4MJ 1QRYA 3O6BB 2QENA 1KU9A 1P4AA 4OMYA 4ENNA 4IXAA 3W6VA 4HQMA 4IEJA 2MFZA 1QVUA 1H0MA 2Q2EB 3F21A 4MNUA 4RGSA 1OQYA 1IRGA 1F5TA 2DPUA 3I0TA 4Y17A 2BHYA 5K5RA 5D6FA 2EQRA 2HZDA 3KEQA 4CXFA 2HYJA 4BU2A 4Y13A 2WB1N 4WX9A 2IS2A 3JW4A 4ENJA 4IL6C 2W84A 3KP3A 3M1EA 2FXAA 2LY1A 3ECOA 1HDDC 2MW8A 2LKPA 2Z1DA 4LG3A 3GWZA 4NDLA 2QA4I 1EJ9A 1NTCA 4E7SA 1JTYA 3GW2A 3K4NA 3PUBA 4FISA 3WGGA 1IRZA 1J5YA 2YSRA 3FXJA 1X4OA 2VPLA 4BJ5C 2DFEA 4BJ6C 4S05A 3J80K 2DW4A 1O3QA 5AIPA 4AIHA 2MLGA 3CCYA 3E7LA 1MH3A 3IAS2 2DI3A 3PM1A 3VFZA 2VE9A 2FRHA 3LAPA 2Z9OA 4BE0A 3IH4A 2EILH 4HW0A 4UB6C 5BPIA 2HQ5A 2KRCA 1ZARA 4FE7A 1IN6A 1ZGJA 3GLLA 3SZPA 2JTVA 2WY7Q 2KIUA 3B6AA 3K2AA 2K27A 2CSOA 1BI2A 1R36A 3OYNA 4ESBA 3S3NA 2E1OA 1P2FA 3I58A 5GPCA 2RQPA 5D6EA 5DD8A 4Y3OA 3T8RA 1UG0A 4A0XA 2VQCA 2M2EA 4JX5A 1HW1A 1BR2A 3CJRB 5ICEA 2IRFG 1N77A 1D1AA 3DFGA 3WTYC 3EYYA 3GFMA 3TKYA 1MBKA 4KYWA 3E1SA 5CVUA 1XMAA 3GVAA 2HOTA 2PG4A 1DP3A 1D5YA 1G8XA 1X58A 2ZSHB 3GFLA 1V3FA 2JA7J 3OYFA 3KYDB 1ACIA 4AIJA 3IL2A 3FIWA 1JGSA 2WV0A 5EZHA 4A3CJ 4MFDA 1MW7A 1U5TC 3EYIA 1Y0NA 4A5NA 1T95A 3ZR8X 5ILVA 4RAZA 2OZUA 4ZYGA 2BXZA 3D5LA 4HV5A 4CICA 3S2DJ 2IA2A 1Z91A 2I10A 5LRRA 2RV8A 2EZIA 3KEOA 2HXIA 3HPGA 1MBGA 4XSZF 1IGNA 4LIUA 3F0CA 1ZRDA 1JT0A 2HPMA 3BJOA 5D5XB 4EVIA 1S9HA 4DW6A 5BNGA 5D5WB 3BCBA 1AKHA 3D5RC 2Y0MA 1ZGAA 2E5NA 3NQOA 4PGHA 2NVUB 3PQJA 4M3DA 1XGSA 9ANTA 1SD7A 2EA2A 2H94A 1SMTA 3BY6A 5FLXK 2DT6A 2E7XA 3Q3SA 3WTXC 1AKHB 1R5GA 2AO9A 2JN6A 2RNJA 2YX7A 3FM5A 3GTLJ 1IG7A 3Q0UA 4BHBA 2R5ZA 3KP2A 1BL0A 4JOMA 2MD0A 1YQAA 3P9IA 5DCFA 3NRVA 2XAJA 2QEXI 4HX8A 4E7ZA 3RZOJ 4ZZLA 5HODA 2J5OA 4Y15A 1S3JA 5DD4A 3OYBA 1J59A 5BQTA 5GPAA 1VNDA 4QIWN 2RREA 1LEAA 2R5ZB 4B4CA 1FMWA 4PJNA 3DBLB 4WXCA 4CDGA 3K70C 2G7UA 1LVAA 4CHUA 1R5HA 4DOZA 2LF7A 2VODA 2VXDA 3DBHB 2ECCA 2K3PA 3QPLA 5KVRA 3GTQJ 1LFBA 1YFHA 1WZ2A 5IT9Z 1TC3C 1J9IA 2HNHA 2CV0A 2BV6A 3BR2A 2R7VA 1E0EA 1B6AA 2K9NA 5LGUA 4XRFA 4EM2A 5F0HA 3FKJA 2LOOA 4V2GA 4PZJA 2CQQA 3HDDA 2W24A 1G3WA 1WJBA 2HOEA 3HPHA 2O5RA 4AWXB 3ZMDA 2GLOA 1VI0A 4PK4A 2AHQA 2DT7B 3G3ZA 4R8HA 2IA0A 2LD5A 3FXRA 1RKTA 1MD0A 4L9TA 4A2UA 2NRAC 3HRSA 3DEEA 3LQRA 3BR5A 2DYRH 4ABZA 1SD5A 5B1AH 1YW9A 3NWSA 1CGPA 3IV5A 4ZYDA 2H1LA 3HL2A 1GLNA 1Y1WJ 4BDYA 2HDDA 1GT0C 1XGNA 2M9HA 3WHBA 3W3CA 5C4XJ 3V8JA 2EIMH 2JJ7A 2KMUA 4F55A 2NVYJ 1R1UA 1T33A 1K6OA 1W5CC 2D2WA 2L54A 2OZ6A 4J01A 1REPC 3COAC 3SJMA 4CGZA 1VQ7I 2KPMA 4E6KG 1EH8A 1TWAJ 3PFYA 3QQAA 2ZJQF 1SFXA 3JRAA 4V19K 4M71A 1JKRC 4IHSA 3D1NI 3GYHX 2A61A 1B1BA 3JRIA 1ZR2A 3QOPA 2I8DA 4CUGA 3B6CA 1FLIA 2OTLI 2IP2A 3I64A 3ZMUA 1QHGA 1MIJA 2E1MB 4HF0A 1VFCA 2LNBA 5DS9A 1F1ZA 2HOAA 3BCAA 3M8FA 1ETXA 1MBFA 3E6DA 2MC3A 4D5FA 2ZO4A 2JVHA 2CGPA 1D3YA 1QZYA 1POGA 4NC6A 2COMA 4BQAA 1WWXA 2P7VB 5AONA 5GP9A 1JKQC 3ZQGA 4JX6A 1IRXA 1U2WA 4LFUA 3WTUC 3ELKA 3JRGA 2L7ZA 4A3JJ 3VPRA 4A6EA 4XRSG 2DK8A 1T38A 1P4XA 3LA2A 4E7LA 3TOAA 1LEBA 2PMHA 1VQOI 4J19A 3MVPA 3R0AA 2O8XA 3PFIA 3DTEA 5CVVA 4B8XA 1Q1VA 2KDZA 4LLNA 1GUUA 1NG6A 1FMVA 1T2KA 1HDPA 2Y0SN 2VUMJ 2P5KA 5HLHA 1SVOA 2VASA 3K1MA 1Z6TA 2EZLA 4XKWA 2R7OA 2QYOA 3DTKA 4HF1A 4EJTA 1B8IA 1ITYA 3CUQB 1IXCA 1FBQA 5DYMA 1A31A 5E8IA 5FFZA 1GVJA 1GV2A 1HKSA 1XMXA 2K5CA 3R4KA 4YFNF 1O4XA 1D8JA 4Q47A 3HGGA 2VE8A 1X2NA 4PJ0C 4YEJA 4BXXJ 2M34A 5F1JA 2ISZA 4EGZA 1B8IB 3TP0A 2ETHA 3TMOA 2FBKA 1KGSA 2Z2SB 2JA5J 4M6VA 4RLFA 3I4PA 2TRTA 2XAFA 1J09A 5CJ9A 3QWLA 4DQ2A 3AL0B 2Y9YA 3CCEI 3KEYA 4BY1J 3GXOA 3PSFA 1BJAA 1R4MB 2CUFA 3AG4H 2BY0A 1P9QC 1S7AA 2XPVA 5L3CA 2KZVA 3I55I 4E7JA 3IAM2 1S6LA 3N97A 4M72A 4ZYAA 2OV7A 2D45A 1IC8A 1X3UA 2DYSH 3F6VA 2G0EA 3H35A 4M9XA 3KIOA 1MMNA 3EUHC 2XGDA 2RNGA 3W2VA 2JRMA 3LA7A 3DEWA 2OQRA 5KK1A 3WTZA 1IDYA 1LFPA 1JE8A 1EKEA 2DA3A 3W2AA 3C18A 1PVEA 1KA8A 5F04A 4S0HB 2K02A 4Y52J 1WJCA 2UUZA 3X2QH 1WGXA 2H8RA 4O5VA 3NARA 4FCYA 3HEFA 2BY1A 3KP6A 2K9MA 4OAYA 1EH7A 2LH9A 3MCZA 4BKXA 1RESA 1JKPC 3RKQA 5FKOA 1YJNI 2ZFWA 2CW8A 1K83J 2HDWA 3T8TA 1HC8A 4AYBN 4Z2YA 3FBNB 5FFXA 2CFXA 2Q8KA 2XAGA 5L3FA 4RS8A 2GZWA 1O3SA 2DPDA 1W4MA 1IF1A 2OD5A 2EIJH 2P8TA 3H3UA 4XKVA 2V6CA 2IGKA 4NBQA 2RGVA 3LSKA 1MSFC 5BMZA 3S17J 4ITVA 2Z5UA 1MMDA 1PUFA 4LJZF 2QKLB 2X0LA 2FE3A 1WPKA 4U0VA 4YG2F 2J5PA 5K7FA 3C7JA 2MA3A 4LITA 2KFDA 3I56I 1SFEA 1B9MA 4RLQA 3U1DA 3WG9A 2JT1A 2IS4A 4HRIA 1ZH5A 1PUFB 3HOXJ 4RM3A 3TO6A 2P4WA 2LRDA 3CO6C 3KE2A 2M7BA 2Y48A 3CJQB 3U2RA 3WODF 1QO0D 4GDFA 1F36A 4JK1X 1W7PA 3D0SA 1FYKA 4AIDA 1U8RA 4LK1F 3HKZA 4GYGA 2JUCA 3EUAA 3SXYA 4Y33A 3ZOBA 3T5XA 4XLAA 3ABMH 2VBYA 3F8BA 1W7PB 2B7EA 3ML6A 4JBAA 5JVTA 3FDYA 1BIBA 4FX0A 1QVTA 1FYLA 2R93J 4EJVA 5F6FA 4HNVA 1TQMA 2VXZA 3DU5A 2ELJA 5HDNA 4HLYA 3GO5A 3J80Z 4EQQA 3HKZN 1RIOH 1UG2A 1YW8A 5HNHA 2O6GE 2HTSA 2HR3A 1U3EM 3J7ZI 3CDIA 3P9CA 2E2IJ 2BY2A 2O7OA 1X4PA 1BC8C 2CW7A 1JHFA 4V2FA 2JPCA 1YO5C 5CQEA 2YUSA 4IHWA 5H20A 3FHNA 5FROA 1VQ8I 3WE3A 5TJJA 2M0MA 1V55H 2ZC2A 3F23A 4LMYA 1XCBA 2F4MB 2QCOA 2R92J 3AG1H 1FC3A 1B4AA 1Z9CA 3G1OA 2VL8A 3IHUA 4IHVA 2R7DA 2QWWA 2ZSIB 2FMLA 2Z33A 2M4GA 2H1KA 1Z3YA 3PO2J 3VOEA 3BG7A 4DZPA 2R7WA 1ODDA 2X48A 1PYVA 4B44A 1VQMI 2K9LA 1LDJA 2NS7A 4XKBA 5EDNA 4Q4ZF 3CLQA 2MSYA 1UZCA 3OR1C 2MH2A 3DKYA 2A5YB 1YIOA 5E8GA 5EG0A 2CV2A 1R1TA 3TW6A 5KNLA 3ZMZA 1NHAA 4BQNA 2IGNA 4C9YA 5L3EA 3EUKL 1YG2A 2L4AA 3OWTA 3TDZC 1IZ1A 5F64A 5EG0B 3LFUA 1DP7P 2H6CA 1ZLJA 2NVXJ 1W7PD 1FBSA 5TRDA 3HOVJ 1A5JA 1R00A 3RKXA 1R5ID 4EJWA 2P5VA 5ICGA 4G9YA 2LFBA 1T0FA 1Z6RA 3KYCB 3C2BA 5EEGA 2ZJ2A 1R23A 3EETA 2VKHA 3GTGJ 2BOLA 2VKVA 4B43A 4BH9A 2OF7A 2ZXJA 4NB5A 5J4VA 4DBQA 2W00A 3QYEA 2OJED 2VBWA 2IGOA 5EYRA 3NAUA 2MABA 3CQZJ 2ISYA 5IPAA 1U6GA 3CD6I 1G6NA 2HWVA 2ESNA 4KMUX 1N78A 5ILUA 1SFUA 5E1WA 1Y6IA 4WWCA 2PEXA 4PFPA 3CJTB 5AIQA 4PSXA 1QBJA 4Z6YA 2JSCA 2A3SA 4IHXA 1QGPA 4WCGA 2PJRA 3FZVA 1E3OC 1S5LC 1ETYA 2EV5A 1X3ZB 3GZ5A 4GFBA 2STWA 1BR1A 2BXYA 1FSHA 2P81A 1QZZA 4FASD 3M9AA 1YX3A 3HRUA 3L00A 3LWFA 1J7KA 5K5OA 4CH7A 2XHKA 2DDAA 3F9KA 2PJRB 5CPRB 3UNGC 3OYGA 3SEZA 4HDUA 1TWFJ 1XGOA 2RVCA 5IY5H 3OS0A 4KDPA 2GBYA 4ZYEA 2CU7A 1ZLKA 3GTKJ 2M8EA 4CCKA 4IOAF 3AG3H 2BHZA 2E34A 2E36A 3OMYA 2IJLA 3C2GA 3RYPA 1TT0A 3HRTA 5FKNA 3BDDA 4UVBA 4CZZA 2A07F 3MZ8A 3MZYA 4RA2A 3FXUA 5EF6A 5LRSA 3JRBA 2E1CA 1ETOA 2W85A 3ZQ7A 1VQLI 3BG6A 3HOYJ 1BM9A 2EJRA 4L9VA 4JQFA 2QF7A 3FMRA 2XASA 1DGWY 2DJIA 3ZMTA 4I7HA 3V7RA 5A2QZ 2X1EA 5CKTA 5GADJ 1I6XA 3KLNA 1K79A 4IX7A 4KICA 3CTAA 1BI1A 2EFOA 5C44J 1OR7A 3L9FA 2VJ5A 4CO8A 1F43A 3R6SA 3HUGA 3M7GA 4MQVA 1Z05A 2K86A 3QPSA 2NVQJ 5IP9J 4A3FJ 1WI9A 1IO2A 5M3FJ 2X4HA 3ZPLA 1GDTA 4OINF 3GZNB 2E35A 2L02A 5C4JJ 2CWEA 3N4MA 4BQQA 5DV5A 3LFKA 3SHFA 3HUGB 1L3LA 4IZZA 3AAFA 3S32A 4RDUA 3PNTA 3ZQQA 3H5RA 3GUDA 4H4KC 4GRIA 1RR7A 2FUG2 1WJDA 2VJJA 2FSWA 1A6QA 3ISPA 4YELA 1ZRCA 1IUYA 2G7HA 1W36D 2W57A 4N4NB 5FD5A 3L2UA 2XKPA 2A5WA 4IQ4A 1USTA 4IQJA 3G4SI 2NAZA 1FOWA 2IXSA 3TP3A 2LY9A 1V5GA 3L2CA 1R49A 1VQ9I 2E2HJ 4P5OA 2WA0A 1ZGWA 4WXHA 1OFCX 3HGYA 2CQ7A 3OS1A 4M6YA 2WC2A 4ZZDA 3O2PE 2E5ZA 4U87A 2W25A 3QPTA 4U88A 1BOAA 2KLOA 1TQPA 4CCJA 3MEXA 2WY8Q 4II3A 3CCUI 2FBIA 1ONVA 1OCRH 4YFKF 3ABLH 3DXJF 3K4JA 3KLOA 4B48A 3GTOJ 1DQUA 2DO7A 3V8LA 1HW2A 1IRFA 3F3XA 1FEXA 2P6SA 2BZTA 1MZBA 1ZR4A 5ICFA 3QPHA 3TOBA 4QTRA 3RIRA 2V1XA 2YU3A 3PNVA 2VJIA 3RI4A 3PL8A 1R4NB 2UWMA 2DA4A 4LB6B 3FXLA 5ILSA 3MQ0A 5E1XA 3CCMI 4BBSJ 4L9JA 1Z7LA 3TQNA 4AUXA 5B5EC 5JI6A 2W7NA 2ELKA 3CJNA 1DPRA 4I98B 4KUMA 4KFCA 3K10A 2DBBA 2JA8J 2HS5A 4NQWA 3RKWA 4HNTA 5JR3A 2JA6J 3BT9A 2VQGA 4ANJA 2XIGA 4XRSA 3HTSB 4OAZA 1KONA 5IYBJ 1U78A 2L9VA 2ZJRF 2F5FA 3FHZA 2AQEA 2OBPA 2O9LA 4NQWB 2PMZA 3PIPF 3CCQI 1YI2I 2DA6A 2E19A 2JRTA 3KP7A 4PJLA 1TTYA 2OPTA 4UUTA 4WK8F 2ZB9A 1MNDA 3K0LA 1XCVA 1KZHA 4A3KJ 2R7SA 1Z77A 3LSRA 1UJ8A 3BOQA 4GCVA 1P7JA 2V9VA 3NWTA 4BUPA 2F5EA 1KYWA 1JHHA 2OCCH 2LG4A 3KX2A 4FT8A 3R60A 3BR3A 2PMZN 3JRCA 4YIFA 1ERDA 1BJZA 1XN7A 4HLXA 1E3PA 2MGQA 3IRQA 2IS6A 2Y9ZA 2L7MP 3ERMA 1IV8A 3F8MA 2XGCA 2KDOA 2R5YA 1UFMA 4GYIA 2DOEA 2ZMEA 2LLKA 4M3BA 4A93J 2FU4A 5D8KB 2JQ7A 4ZTFA 2MLKA 3L1PA 4D5CA 2CH0A 1OCZH 3JAMZ 3KP5A 1FTTA 4UHTA 3GZ6A 1A35A 5TGTA 5M5WJ 2R5YB 1IN4A 2QSFX 2ZMEB 1T08B 1SMYF 3L2WA 4C3HJ 4TV7A 1B59A 1VZ0A 3H9GA 1X2MA 2VOOA 1XDUA 3VB2A 3CUQC 4I76A 1R6RA 2GXBA 4L0ZB 3GFJA 2N8GA 2STTA 2WAFA 1PP8F 2M1BA 2X6YA 1S72I 2DA7A 2WAQA 4BAYA 1XDSA 1M1EB 2HQAA 3DQVC 2X51A 5DCMA 3G1LA 1DUXC 5J4YA 1AOYA 2NOJB 2ADUA 2L7KA 1FT9A 3LMMA 3BZKA 1FBUA 3A4CA 4L9NA 2HEOA 1FNNA 1STZA 1H89C 4GGGA 5ERIA 4I01A 2IA1A 5DCMB 4PCQA 3GCMA 2O03A 2VT3A 2WAQN 5A2QK 4HPQA 3I4NJ 2FBHA 4N9IA 5IP6A 4HF2A 2EBIA 2M0CA 2L3DA 1ENHA 1U5TA 2AQFA 3Q9SA 1I39A 2P5LC 2IBDA 2DQRA 2LC2A 2EWNA 4LIVA 4PSWA 3VODA 3OYIA 2LYCA 2DMQA 1U5TB 3CCSI 3GEZA 1XG1A 4S04A 4XM3A 2VIXA 3JREA 1D5VA 2R7UA 3K4BA 2A68F 3FXOA 4A3EJ 2L5QA 3HG9A 1P92A 3PO3J 3JRDA 2A69F 2ZBKA 3CLOA 2FMYA 2CJJA 1EV7A 5FKLA 4IOCF 1KU3A 4EJUA 4W97A 4M74A 2QBYA 1H9GA 5F1RA 2BVMA 2F5DA 2KT0A 5LBQA 3JR9A 2PI0A 1UHMA 3DF8A 4QLCU 5JFRA 4I2OA 4DIQA 4XLPF 3SZTA 4HDVA 2EA4A 2YS9A 2X1CA 1Z67A 3BP8A 2ACJA 4KT6A 5JLWA 2ZXWH 5D5VB 2Q1ZB 4FE4A 4HZFA 1JXSA 4DYQA 1MNEA 2KIFA 2HFHA 4MTDA 2DFHA 2DFIA 1LJ9A 3SZGA 2H6BA 2HPIA 3BZCA 3A02A 3H1CA 3DLAA 4F3QA 2QSHX 3OIOA 1P4WA 2F2EA 1LFUP 1Z1DA 2EH3A 2RC4A 3I3LA 4BGDA 3U9GA 3RSNA 1LDKB 3WG7H 3BTIA 2HTJA 4RBOA 1GXQA 4XLHA 1V54H 2XF6A 4MEXF 2ZXHA 1USSA 4KMFA 3G1MA 4A3IJ 2LDUA 1JUSA 1K6YA 2OC6A 4M3GA 5FLVA 3IH3A 4XQFA 5IYCJ 2BW3A 4FHTA 2V6EA 5LHGA 2XPWA 5J40A 3S14J 2P7CB 3ZQCA 3M8EA 2NNYA 5LHHA 4N9HA 1UHWA 1JJ6C 2ID3A 1AU7A 2HQNA 2K40A 3FK6A 4P96A 1IN8A 2MH9A 1H9TA 1QNTA 2LTPA 2QGUA 2RKHA 3ABUA 2BW3B 1RR8C 1OCPA 4HA8A 3L2QA 1VQ6I 1EH6A 4HYEA 2MG4A 3CP8A 1TNSA 1P6RA 2DOFA 3V7SA 4IRIA 3FXKA 2FF4A 2V9KA 4LGWA 4ZYHA 4ON0A 1HCRA 1OYYA 1YHQI 2LF8A 4DNCA 2GOXB 5FKMA 1WCMJ 3L09A 4A3LJ 5HS8A 3CCRI 4E7KA 1MGTA 1ZELA 4XBFA 3HHGA 3FXMA 3OSGA 5H6RA 1O7FA 4UVCA 2FX0A 4A12A 5ED4A 2QUFA 3OYLA 4L18B 4P1WA 1WH5A 3LNQA 1DU0A 2M87A 3I9V2 5DDGA 3MZHA 2FA5A 4BNCA 1Y1VJ 1A36A 4A3MJ 3SEQA 2CUZA 2ZFUA 1QPMA 4PUSA 1GXPA 2H09A 2A05A 3HM5A 2DMUA 1FYMA 3UKGA 4MEYF 3QU6A 3BPXA 2M5WA 5DUIA 2DMTA 4EM1A 1MJAA 3SDGA 3TO9A 3QAHA 1RNLA 4XIDA 2ZNYA 3RCOA 3DCFA 3TL4X 4RB1A 3OYCA 2WWYA 4ZDLA 2XSDC 2XAHA 4DYRA 3JRHA 2DFFA 3JAMK 4LOCA 4G8XA 4OWRB 4ENKA 2LKXA 1R71A 5TISC 1UHSA 4G7HF 3ZN1A 4G7ZF 3IKVA 2DDBA 1TQIA 2IT0A 5GTIC 1WSUA 3ABKH 4K2EA 3RDIA 1EA3A 4MTEA 3S3MA 1H88C 2ZCWA 4RB0A 3M3YJ 2BBYA 2CQKA 2V26A 1YYVA 2JVGA 2VC1A 2A6HF 5LGTA 2LREA 4N4OB 4EEFG 3HIFA 5IOZA 3J81K 3WU1B 4BXFA 1APLC 2L01A 1DPUA 4MIMA 1AWCA 1HQCA 3ZMVA 2XPUA 3QRFF 2V7FA 2W82A 3OY9A 1GV5A 2F4IA 1K61A 2DTZA 4XORA 1I6HJ 1C0WA 4E7IA 1BIAA 3RQ4A 3TW7A 3H5AA 1RRJA 2PMUA 4BYYA 1MJBA 1ULYA 3EQLF 1YE9A 3H9JA 3LSGA 1XC5A 4N0BA 2NS8A 4ZDPA 1Y39A 1QU3A 3EUHA 3FM3A 2AS5F 2OTJI 1T56A 1YW7A 1SEUA 1SVLA 1J2XA 2L4MA 4PFOA 2GIZA 2R7FA 4A0YA 5J6XA 3IRRA 3I59A 2KKOA 2E60A 3BJ6A 3I5UA 5LEKA 2DK5A 1B72A 1V5EA 2FOWA 3QOEA 3I53A 3SQNA 2JA2A 3K4MA 3ONQA 3I59B 3J7AY 2KJCA 2GOMA 5KAFC 1B72B 1YS6A 4KT5C 1BC7C 1ETQA 2Y69H 3KZYA 1VQNI 3S2WA 3HOTA 5JHUA 2UXNA 4UXNA 3CP2A 1L0OC 3HRMA 1AHDP 1A04A 2Y31A 1PDNC 3C1DA 1D0YA 4A5MA 3E5UA 3W2WA 3DU6A 2VN2A 3K6GA 1JUMA 2UZKA 2OAZA 2RDPA 2RQQA 1A6IA 3ULQB 1WH7A 3BR1A 3LSJA 3LSMA 2AXLA 5BPDA 1NK3P 1U0JA 1FY7A 2JMWA 4ASNA 1K4TA 4I09A 5C3EJ 3LSHA 2F4OB 3K1PA 1TWHJ 3LQQA 5EEHA 3CMYA 2IAIA 3HXLA 5B3SH 2YU9J 5F0FA 4R1HA 4QWQA 1IUFA 5HDKA 5BOXA 5DM6F 2P6TA 3SYTA 4BE1A 3BC8A 1YJ9I 3GFIA 1MKMA 1F4KA 2VLAA 5DM7F 3SFIA 1W1WE 2LMDA 1ZAOA 3QODA 2IPQX 1MMGA 3WTSC 3CZ6A 1IN7A 4YIRX 2L2OA 1OCTC 3VYUB 1MMAA 3HOUJ 4NC7A 3FF5A 1UAAA 3CC2I 3VWBA 4AIKA 5FD6A 3H36A 1B9NA 2KISA 2QQ9A 3UR3C 1KYZA 2HVQA 3DWLE 5BS6A 1LQ1A 3J7AO 3J7YJ 5ICCA 2EZHA 1SFKA 5E18F 4L5IA 4AU7A 1QPIA 4UY8I 1LNWA 2OUMA 3CO7C 2KIQA 4IRHA 2R3SA 5IYDJ 5IP7J 4ESFA 3K4CA 5HVQC 1FP2A 1G4DA 3REOA 2MC4A 4EV0A 2R7XA 2LVSA 4R79A 4PJJA 2WTEA 3OOUA 5J1UA 2TDXA 2EB7A 5E20A 1MMSA 3AKZA 2E71A 3DKXA 4EMSA 2Y30A 2NYXA 1V4RA 1XMKA 4IVNA 3ZQIA 1PUEE 3HSEA 4XLNF 4NHJA 4RAYA 1BN5A 4HSTA 4IRGA 3HB9A 1Y0UA 3BG3A 3BTLA 2ESHA 1K4SA 1ON1A 4BDZA 4XKCA 3F8NA 3CESA 3QP6A 4FETA 3DPUA 2BE5F 2CYYA 1WJEA 2QQAA 4XLCA 1FWZA 3S1NJ 4XMYA 4IHYA 4L5JA 3OYAA 2DLLA 2Z99A 2VB6A 1BBYA 4HG2A 4XOTA 3CF5F 2DODA 1YIJI 2NVTJ 1TBXA 4KIGA 5EEAA 3G73A 5E17F 2ECBA 3M1CA 4HEA2 4KA4A 3RTRA 2CV1A 3VDXA 4OIRF 2R7TA 1OMIA 1FX7A 1FIPA 4PJMA 2M4KA 3M07A 1N75A 3WGIA 2QQBA 5D5UB 1TW2A 3RYRA 1T8IA 1IJWC 3A01A 4HX4A 4HAMA 4ZJZA 3S8PA 2B9SA 4KJZA 2EV6A 4FQGA 3QYBA 1Y8RB 1YLFA 2VQLA 3FX3A 3F8CA 2XB0X 3A03A 4MQ9F 1DGRM 2VBXA 5L3BA 1MDMA 1TT5B 2HKOA 3A01B 2BEOA 1JJ8C 4LLLA 1IXRC 3HSFA 3GMEA 3HC7A 2FQ4A 5KAIC 2EZKA 3I54A 1U8BA 3OSFA 3IUOA 2XRLA 1EF4A 2WB1A 3BR6A 2R0QC 2PLYA 5DUKA 2YX4A 5CVRA 1MDMB 3CCVI 3WE2A 5DEQA 3RZDJ 2ZKZA 1LVKA 3V4GA 1BR4A 2O61A 4WXDA 4UB8C 1TL8A 1HLVA 2F5VA 2MBFA 4EATA 1OCOH 1XSXA 2KRHA 5FLMJ 3KZZA 4UNOA 5CQGA 5E79C 3OYDA 1MBHA 1IAWA 2M30A 1Z7UA 4IPAA 3E97A 3GLXA 3MN2A 1OYIA 1SANA 2HU9A 1Z3XA 4LB5A 1ZN2A 1I3QJ 1WHUA 3BG5A 1I27A 2MD5A 2IEKA 5E3LA 5L3GA 1D8KA 1W0UA 1KQ9A 3A0BC 3KYLA 4UV9A 4F92B 2CFOA 5CLSA 1SD4A 2LSOA 1FP1D 2Q0OA 2ZMEC 3D5SC 4GXOA 4I99C 2EV0A 3VYSB 4D7MA 2HDCA 2XGEA 2HYGD 3NEUA 3MKLA 4P9FA 2G9WA 2HKXA 1ON2A 4PGGA 1TW3A 2FNAA 2FEZA 2PX9A 2CUEA 3BZ6A 1V5FA 4QPQA 2XGXA 5EJCA 3BQZA 1K78A 3IC7A 5E3OA 1ETWA 1W5TA 2NS0A 3ZQFA 1RETA 4II2A 3TBIA 2IGMA 2VC0A 2Z3YA 5HOOA 4AM3A 5E3MA 3G71I 1U9OA 2K4JA 3RQIA 3E5XA 4X6AJ 1JTXA
chains in the Genus database with same CATH topology
4CYCA 3JREA 2DA5A 5F27A 3GTJJ 3S2HJ 4XICA 1PUFB 3HOXJ 4A3EJ 1BA5A 3PO3J 3JRDA 4W1UA 1MSEC 2CJJA 1FIAA 5FKLA 4CYCB 1F36A 5M5XJ 4W97A 1I50J 2KT0A 3TEDA 3JR9A 5EZGA 1NK2P 3H0GJ 2R7ZJ 2YS9A 3GTPJ 3K7AJ 3ZOBA 4DZJA 5M3MJ 5JLWA 3LSPA 1ETKA 4FE4A 4JP0A 4DYQA 2X9DA 2CRGA 3WHCA 1QVTA 4M3EA 2R93J 2DN0A 4HNVA 1LE8A 5F0CA 3A02A 3OIOA 1BW6A 1LFUP 2EH3A 1R9TJ 2XB5A 3HKZN 1UG2A 3BTIA 5M5YJ 4RBOA 3IH2A 4QSHA 2E2IJ 2O7OA 4X1EA 5J1YA 1LE8B 4V2FA 1U9NA 3G1MA 4B1RA 2YUSA 4A3IJ 4IHWA 2W48A 1JUSA 4M3GA 3Q0VA 1JUPA 4A69C 5FLVA 3IH3A 5IYCJ 2QCOA 4JYKA 2R92J 4UUSA 1ZTRA 1TWCJ 3G1OA 3GTMJ 3HOWJ 2XPWA 4IHVA 4D7NA 3S14J 3ZQCA 1JKOC 4MO7A 2DA1A 1JJ6C 2H1KA 4G12A 3BTJA 2ID3A 1AU7A 3I4MJ 3PO2J 1QRYA 4DZPA 2K40A 3FK6A 4MLOA 2X48A 2LTPA 5K7HA 2NS7A 4UUSB 1OCPA 2NOGA 2D5VA 2MG4A 5EDNA 3W6VA 2MSYA 2HI3A 4IEJA 1QVUA 1MBEA 3FKIJ 1HCRA 5DTDA 1P7IA 3S1RJ 5EG0A 3TW6A 2DMPA 5FKMA 2EQRA 1WCMJ 2TCTA 3LOCA 2HYJA 4BBRJ 4A3LJ 2WB1N 2L0KA 3OSGA 2FX0A 5EG0B 1ORKA 1HDDC 2MW8A 3BQYA 2NVXJ 1WH5A 3HOVJ 3LNQA 1DU0A 5FKKA 1A5JA 1H8AC 4NDLA 1NTCA 1JTYA 2LFBA 4FISA 1IRZA 1Y1VJ 3C2BA 3Q0WA 4A3MJ 3GTGJ 2VKVA 2OF7A 3CCYA 3E7LA 3HM5A 1MH3A 2DMUA 3PM1A 3UKGA 1ZQ3P 2DMTA 1HOMA 2X6OA 3SDGA 3IH4A 1MBJA 5EYRA 3NAUA 4XIDA 2HQ5A 2K9SA 3CQZJ 5IPAA 3DCFA 1JGGA 4FE7A 3K2AA 3B6AA 2XSDC 2O8KA 4DYRA 3JRHA 4AC0A 3FK7A 4LOCA 2LKXA 2E1OA 4IHXA 1UHSA 4Y7NJ 5GPCA 1E3OC 1ETYA 2M2EA 4JX5A 4GFBA 2P81A 3ZQLA 3H3VK 1H88C 2B63J 4C3IJ 1MBKA 3M3YJ 1ZKGA 2HOTA 1D5YA 1X58A 2JA7J 1JTXA 2LP0A 1HF0A 1TWFJ 4EEFG 5IOZA 2GBYA 3FIWA 2CU7A 1APLC 5EZHA 3BR0A 3GTKJ 4MFDA 4MIMA 4A3CJ 2XPUA 4B3AA 5FKNA 3S2DJ 2I10A 1GV5A 3O8GA 1K61A 2EZIA 1MH4A 2DTZA 2HXIA 1MBGA 1I6HJ 1IGNA 3TW7A 5EF6A 3JRBA 1XS9A 2K9QA 3F0CA 1ETOA 1JT0A 1IV6A 3LSGA 1XC5A 3HOYJ 4DW6A 2NS8A 5BNGA 1AKHA 1T56A 2E2JJ 2QF7A 1RPWA 4M3DA 2VI6A 5J1RA 9ANTA 4BY7J 1B72A 3S16J 2ID6A 3Q3SA 1AKHB 2JN6A 2AO9A 3GTLJ 1IG7A 5C44J 3Q0UA 2R5ZA 1BL0A 4XRMA 1F43A 5EGOA 1B72B 3S1MJ 1ETQA 3QPSA 3RZOJ 4JX4A 2NVQJ 5HODA 2CQXA 5IP9J 4A3FJ 5M3FJ 1RKWA 1GDTA 5GPAA 1VNDA 4QIWN 5C4JJ 1AHDP 4M3FA 2Y31A 2L9RA 2R5ZB 4B4CA 3JRFA 5EGOB 1JUMA 2DJNA 4RDUA 2Y2ZA 3GTQJ 1A6IA 2ECCA 3QPLA 1WH7A 3BR1A 3LSJA 1NK3P 1LFBA 4A3GJ 1RR7A 2JMWA 1TC3C 1IDZA 5C3EJ 3BR2A 1TWHJ 5IOYA 3CMYA 2K9NA 5F0HA 2IAIA 4V2GA 2YU9J 2CQQA 3HDDA 5F0FA 1IUFA 2DMNA 2GLOA 1VI0A 2LY9A 3TP3A 2LD5A 2AHQA 1RKTA 2E2HJ 1ZGWA 4ABZA 1OFCX 3HGYA 3BR5A 3SFIA 3O8HA 3IV5A 1Z0XA 1Y1WJ 2HDDA 1GT0C 2M9HA 1FJLA 1OCTC 3WHBA 5C4XJ 3HOUJ 2JJ7A 1W0TA 2NVYJ 1T33A 3GTOJ 3SJMA 1GVDA 1FEXA 1ZR4A 1TWAJ 1VF9A 2LK2A 3QQAA 4QTRA 1ZK8A 3JRAA 1S7EA 4MFEA 2EZHA 1JKRC 4C2MJ 1QPIA 3D1NI 3JRIA 1ZR2A 2GM4A 3HOZJ 5IYDJ 5IP7J 3B6CA 2DA4A 2FJ1A 4BBSJ 4AUXA 2ME6A 2JWTA 5FJ8J 2LVSA 2ELKA 3OOUA 5J1UA 1VFCA 5DS9A 2HOAA 1ETXA 1MBFA 1SFOJ 2Y30A 4D5FA 3ZQIA 2HOSA 1POGA 5E3NA 2JA8J 3HB9A 3BG3A 3BTLA 2JA6J 1JKQC 3BT9A 5GP9A 2VKEA 3ZQGA 4JX6A 4XRSA 3JRGA 2L7ZA 4A3JJ 5IYBJ 3VPRA 1U78A 4XRSG 2O9LA 3S1NJ 1CQTA 4IHYA 1DU6A 4J19A 3MVPA 2DA6A 2E19A 2OPTA 4UUTA 2KDZA 2ZB9A 1Q1VA 1GUUA 1HDPA 2Y0SN 2VUMJ 2NVTJ 4A3KJ 1Z77A 5EEAA 3LSRA 2EZLA 2ECBA 1P7JA 1MNMC 3S15J 2RAEA 1YRNA 1FIPA 1B8IA 1ITYA 2ME0A 3BR3A 5JLXA 2WV1A 2DA2A 2PMZN 3JRCA 1GV2A 1BJZA 4A3DJ 1IJWC 1O4XA 3S1QJ 3A01A 2MGQA 3GBGA 3HGGA 5F08A 2Y9ZA 1X2NA 2L7MP 1WI3A 4BXXJ 2M34A 1YRNB 2XGCA 5F1JA 2R5YA 2XB0X 1B8IB 3A03A 3TP0A 2LLKA 4M3BA 4A93J 2JA5J 1BW5A 2HXOA 4M6VA 2TRTA 3L1PA 3A01B 4D5CA 1JJ8C 5J3LA 2Y9YA 1FTTA 2FQ4A 2EZKA 1U8BA 4BY1J 5M5WJ 2R5YB 3OSFA 1OJLA 2CUFA 2XRLA 2XPVA 4C3HJ 1EF4A 3BR6A 2R0QC 1IC8A 1X2MA 2G0EA 3BG9A 2L7FP 4I76A 2XGDA 3RZDJ 1JT6A 2N8GA 3DEWA 1IDYA 1HLVA 3CDLA 2DA7A 5FLMJ 4DYCA 5K7ZA 4I6ZA 1MBHA 2COBA 2DA3A 4XK4A 1G2HA 3MN2A 4C3JJ 4FTHA 1SANA 3G1LA 5F04A 4S0HB 2FD5A 2JK3A 2VPRA 1I3QJ 4Y52J 2LR8A 3BG5A 3HBLA 1WGXA 2H8RA 4FCYA 3NARA 2IEKA 3HEFA 5E3LA 2M8GX 3ZQHA 4BKXA 1W0UA 1RESA 1H89C 1JKPC 3RKQA 1UMQA 5FKOA 1FTZA 1K83J 2WAQN 4D7MA 1TWGJ 3I4NJ 4L5EA 5IP6A 2XGEA 4AYBN 3MKLA 2EBIA 2M0CA 2CUEA 1ENHA 1ETVA 2IBDA 3BQZA 5E3OA 1ETWA 3ZQFA 1RETA 1MSFC 3S17J 3FISA 1PUFA 5E3MA 4A3BJ 2DMQA 1U9OA 3BTCA 3RQIA 3M4OJ 1WPKA 5K7FA 4X6AJ 1XG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYC A;  3JRE A;  2DA5 A;  5F27 A;  3GTJ J;  3S2H J;  4XIC A;  1PUF B;  3HOX J;  4A3E J;  1BA5 A;  3PO3 J;  3JRD A;  4W1U A;  1MSE C;  2CJJ A;  1FIA A;  5FKL A;  4CYC B;  1F36 A;  5M5X J;  4W97 A;  1I50 J;  2KT0 A;  3TED A;  3JR9 A;  5EZG A;  1NK2 P;  3H0G J;  2R7Z J;  2YS9 A;  3GTP J;  3K7A J;  3ZOB A;  4DZJ A;  5M3M J;  5JLW A;  3LSP A;  1ETK A;  4FE4 A;  4JP0 A;  4DYQ A;  2X9D A;  2CRG A;  3WHC A;  1QVT A;  4M3E A;  2R93 J;  2DN0 A;  4HNV A;  1LE8 A;  5F0C A;  3A02 A;  3OIO A;  1BW6 A;  1LFU P;  2EH3 A;  1R9T J;  2XB5 A;  3HKZ N;  1UG2 A;  3BTI A;  5M5Y J;  4RBO A;  3IH2 A;  4QSH A;  2E2I J;  2O7O A;  4X1E A;  5J1Y A;  1LE8 B;  4V2F A;  1U9N A;  3G1M A;  4B1R A;  2YUS A;  4A3I J;  4IHW A;  2W48 A;  1JUS A;  4M3G A;  3Q0V A;  1JUP A;  4A69 C;  5FLV A;  3IH3 A;  5IYC J;  2QCO A;  4JYK A;  2R92 J;  4UUS A;  1ZTR A;  1TWC J;  3G1O A;  3GTM J;  3HOW J;  2XPW A;  4IHV A;  4D7N A;  3S14 J;  3ZQC A;  1JKO C;  4MO7 A;  2DA1 A;  1JJ6 C;  2H1K A;  4G12 A;  3BTJ A;  2ID3 A;  1AU7 A;  3I4M J;  3PO2 J;  1QRY A;  4DZP A;  2K40 A;  3FK6 A;  4MLO A;  2X48 A;  2LTP A;  5K7H A;  2NS7 A;  4UUS B;  1OCP A;  2NOG A;  2D5V A;  2MG4 A;  5EDN A;  3W6V A;  2MSY A;  2HI3 A;  4IEJ A;  1QVU A;  1MBE A;  3FKI J;  1HCR A;  5DTD A;  1P7I A;  3S1R J;  5EG0 A;  3TW6 A;  2DMP A;  5FKM A;  2EQR A;  1WCM J;  2TCT A;  3LOC A;  2HYJ A;  4BBR J;  4A3L J;  2WB1 N;  2L0K A;  3OSG A;  2FX0 A;  5EG0 B;  1ORK A;  1HDD C;  2MW8 A;  3BQY A;  2NVX J;  1WH5 A;  3HOV J;  3LNQ A;  1DU0 A;  5FKK A;  1A5J A;  1H8A C;  4NDL A;  1NTC A;  1JTY A;  2LFB A;  4FIS A;  1IRZ A;  1Y1V J;  3C2B A;  3Q0W A;  4A3M J;  3GTG J;  2VKV A;  2OF7 A;  3CCY A;  3E7L A;  3HM5 A;  1MH3 A;  2DMU A;  3PM1 A;  3UKG A;  1ZQ3 P;  2DMT A;  1HOM A;  2X6O A;  3SDG A;  3IH4 A;  1MBJ A;  5EYR A;  3NAU A;  4XID A;  2HQ5 A;  2K9S A;  3CQZ J;  5IPA A;  3DCF A;  1JGG A;  4FE7 A;  3K2A A;  3B6A A;  2XSD C;  2O8K A;  4DYR A;  3JRH A;  4AC0 A;  3FK7 A;  4LOC A;  2LKX A;  2E1O A;  4IHX A;  1UHS A;  4Y7N J;  5GPC A;  1E3O C;  1ETY A;  2M2E A;  4JX5 A;  4GFB A;  2P81 A;  3ZQL A;  3H3V K;  1H88 C;  2B63 J;  4C3I J;  1MBK A;  3M3Y J;  1ZKG A;  2HOT A;  1D5Y A;  1X58 A;  2JA7 J;  1JTX A;  2LP0 A;  1HF0 A;  1TWF J;  4EEF G;  5IOZ A;  2GBY A;  3FIW A;  2CU7 A;  1APL C;  5EZH A;  3BR0 A;  3GTK J;  4MFD A;  4MIM A;  4A3C J;  2XPU A;  4B3A A;  5FKN A;  3S2D J;  2I10 A;  1GV5 A;  3O8G A;  1K61 A;  2EZI A;  1MH4 A;  2DTZ A;  2HXI A;  1MBG A;  1I6H J;  1IGN A;  3TW7 A;  5EF6 A;  3JRB A;  1XS9 A;  2K9Q A;  3F0C A;  1ETO A;  1JT0 A;  1IV6 A;  3LSG A;  1XC5 A;  3HOY J;  4DW6 A;  2NS8 A;  5BNG A;  1AKH A;  1T56 A;  2E2J J;  2QF7 A;  1RPW A;  4M3D A;  2VI6 A;  5J1R A;  9ANT A;  4BY7 J;  1B72 A;  3S16 J;  2ID6 A;  3Q3S A;  1AKH B;  2JN6 A;  2AO9 A;  3GTL J;  1IG7 A;  5C44 J;  3Q0U A;  2R5Z A;  1BL0 A;  4XRM A;  1F43 A;  5EGO A;  1B72 B;  3S1M J;  1ETQ A;  3QPS A;  3RZO J;  4JX4 A;  2NVQ J;  5HOD A;  2CQX A;  5IP9 J;  4A3F J;  5M3F J;  1RKW A;  1GDT A;  5GPA A;  1VND A;  4QIW N;  5C4J J;  1AHD P;  4M3F A;  2Y31 A;  2L9R A;  2R5Z B;  4B4C A;  3JRF A;  5EGO B;  1JUM A;  2DJN A;  4RDU A;  2Y2Z A;  3GTQ J;  1A6I A;  2ECC A;  3QPL A;  1WH7 A;  3BR1 A;  3LSJ A;  1NK3 P;  1LFB A;  4A3G J;  1RR7 A;  2JMW A;  1TC3 C;  1IDZ A;  5C3E J;  3BR2 A;  1TWH J;  5IOY A;  3CMY A;  2K9N A;  5F0H A;  2IAI A;  4V2G A;  2YU9 J;  2CQQ A;  3HDD A;  5F0F A;  1IUF A;  2DMN A;  2GLO A;  1VI0 A;  2LY9 A;  3TP3 A;  2LD5 A;  2AHQ A;  1RKT A;  2E2H J;  1ZGW A;  4ABZ A;  1OFC X;  3HGY A;  3BR5 A;  3SFI A;  3O8H A;  3IV5 A;  1Z0X A;  1Y1W J;  2HDD A;  1GT0 C;  2M9H A;  1FJL A;  1OCT C;  3WHB A;  5C4X J;  3HOU J;  2JJ7 A;  1W0T A;  2NVY J;  1T33 A;  3GTO J;  3SJM A;  1GVD A;  1FEX A;  1ZR4 A;  1TWA J;  1VF9 A;  2LK2 A;  3QQA A;  4QTR A;  1ZK8 A;  3JRA A;  1S7E A;  4MFE A;  2EZH A;  1JKR C;  4C2M J;  1QPI A;  3D1N I;  3JRI A;  1ZR2 A;  2GM4 A;  3HOZ J;  5IYD J;  5IP7 J;  3B6C A;  2DA4 A;  2FJ1 A;  4BBS J;  4AUX A;  2ME6 A;  2JWT A;  5FJ8 J;  2LVS A;  2ELK A;  3OOU A;  5J1U A;  1VFC A;  5DS9 A;  2HOA A;  1ETX A;  1MBF A;  1SFO J;  2Y30 A;  4D5F A;  3ZQI A;  2HOS A;  1POG A;  5E3N A;  2JA8 J;  3HB9 A;  3BG3 A;  3BTL A;  2JA6 J;  1JKQ C;  3BT9 A;  5GP9 A;  2VKE A;  3ZQG A;  4JX6 A;  4XRS A;  3JRG A;  2L7Z A;  4A3J J;  5IYB J;  3VPR A;  1U78 A;  4XRS G;  2O9L A;  3S1N J;  1CQT A;  4IHY A;  1DU6 A;  4J19 A;  3MVP A;  2DA6 A;  2E19 A;  2OPT A;  4UUT A;  2KDZ A;  2ZB9 A;  1Q1V A;  1GUU A;  1HDP A;  2Y0S N;  2VUM J;  2NVT J;  4A3K J;  1Z77 A;  5EEA A;  3LSR A;  2EZL A;  2ECB A;  1P7J A;  1MNM C;  3S15 J;  2RAE A;  1YRN A;  1FIP A;  1B8I A;  1ITY A;  2ME0 A;  3BR3 A;  5JLX A;  2WV1 A;  2DA2 A;  2PMZ N;  3JRC A;  1GV2 A;  1BJZ A;  4A3D J;  1IJW C;  1O4X A;  3S1Q J;  3A01 A;  2MGQ A;  3GBG A;  3HGG A;  5F08 A;  2Y9Z A;  1X2N A;  2L7M P;  1WI3 A;  4BXX J;  2M34 A;  1YRN B;  2XGC A;  5F1J A;  2R5Y A;  2XB0 X;  1B8I B;  3A03 A;  3TP0 A;  2LLK A;  4M3B A;  4A93 J;  2JA5 J;  1BW5 A;  2HXO A;  4M6V A;  2TRT A;  3L1P A;  3A01 B;  4D5C A;  1JJ8 C;  5J3L A;  2Y9Y A;  1FTT A;  2FQ4 A;  2EZK A;  1U8B A;  4BY1 J;  5M5W J;  2R5Y B;  3OSF A;  1OJL A;  2CUF A;  2XRL A;  2XPV A;  4C3H J;  1EF4 A;  3BR6 A;  2R0Q C;  1IC8 A;  1X2M A;  2G0E A;  3BG9 A;  2L7F P;  4I76 A;  2XGD A;  3RZD J;  1JT6 A;  2N8G A;  3DEW A;  1IDY A;  1HLV A;  3CDL A;  2DA7 A;  5FLM J;  4DYC A;  5K7Z A;  4I6Z A;  1MBH A;  2COB A;  2DA3 A;  4XK4 A;  1G2H A;  3MN2 A;  4C3J J;  4FTH A;  1SAN A;  3G1L A;  5F04 A;  4S0H B;  2FD5 A;  2JK3 A;  2VPR A;  1I3Q J;  4Y52 J;  2LR8 A;  3BG5 A;  3HBL A;  1WGX A;  2H8R A;  4FCY A;  3NAR A;  2IEK A;  3HEF A;  5E3L A;  2M8G X;  3ZQH A;  4BKX A;  1W0U A;  1RES A;  1H89 C;  1JKP C;  3RKQ A;  1UMQ A;  5FKO A;  1FTZ A;  1K83 J;  2WAQ N;  4D7M A;  1TWG J;  3I4N J;  4L5E A;  5IP6 A;  2XGE A;  4AYB N;  3MKL A;  2EBI A;  2M0C A;  2CUE A;  1ENH A;  1ETV A;  2IBD A;  3BQZ A;  5E3O A;  1ETW A;  3ZQF A;  1RET A;  1MSF C;  3S17 J;  3FIS A;  1PUF A;  5E3M A;  4A3B J;  2DMQ A;  1U9O A;  3BTC A;  3RQI A;  3M4O J;  1WPK A;  5K7F A;  4X6A J;  1XG1 A; 
#chains in the Genus database with same CATH topology
 4CYC A;  1K78 B;  1D0X A;  1RI7 A;  5GAH J;  1JI8 A;  1I1S A;  3H9Q A;  2V1U A;  1ZRE A;  3FMQ A;  3OYJ A;  4XIC A;  1SD6 A;  1R1V A;  1BA5 A;  4G6D A;  4BJT A;  4EM0 B;  4W1U A;  3BPV A;  3E5Q A;  1UEL B;  4DJA A;  4CYC B;  2JZY A;  5GAG J;  2JUG A;  3DKW A;  1J75 A;  1HA8 A;  2F48 A;  3CUO A;  3CC7 I;  2R7Z J;  3TGN A;  3MFK A;  4P55 A;  3K7A J;  2IVM A;  5M3M J;  4U7B A;  3PJR A;  1TZL A;  1ZG3 A;  1ETK A;  4RAG A;  1FSE A;  2E1M C;  1ZG5 A;  2CRG A;  2H8W A;  4M3E A;  2DN0 A;  5HS9 A;  3DPT A;  2C6Y A;  1LE8 A;  5F0C A;  1OYW A;  4CCM A;  3T0Y A;  3HOS A;  3VSK A;  1R9T J;  2KZG A;  2ZJP F;  2JSP A;  2XB5 A;  1FPQ A;  1TLH B;  3ECH A;  3RJP A;  3WTV C;  3W6J B;  3WTT C;  5FO5 A;  3LA3 A;  2WAD A;  5J1Y A;  3E6C C;  1K7A A;  1LE8 B;  4LLG F;  2EK5 A;  1U9N A;  2FNP A;  2KHM A;  4B1R A;  2DCE A;  2W48 A;  4HV6 A;  3R61 A;  4NNJ A;  1JUP A;  2QM3 A;  4OMZ A;  5K1Y A;  3OYH A;  4JYK A;  4UUS A;  1ZTR A;  3GTM J;  5D8L B;  4RM2 A;  3A1Y A;  2EFQ A;  4D7N A;  2YR2 A;  3CCL I;  3ROU A;  2ZNZ A;  2DA1 A;  4G12 A;  3M8J A;  1X3W B;  4I0B A;  4MLO A;  4G7O F;  3I71 A;  2YPR A;  1HW5 A;  5K7H A;  4UUS B;  2NOG A;  4M73 A;  2D5V A;  1RUN A;  2VBZ A;  3L2V A;  1YX5 A;  2GXG A;  2HI3 A;  3N05 A;  1MBE A;  2XKO A;  3FKI J;  5DTD A;  4C2U A;  1P7I A;  4XL9 A;  3S1R J;  2QLZ A;  1W5S A;  4MHG A;  2VOP A;  4DBR A;  3RPU A;  2Y75 A;  2DMP A;  3J81 Z;  1X1B A;  2TCT A;  3LOC A;  4A0Z A;  4BBR J;  1E17 A;  1YOV B;  1PJR A;  1GHC A;  2L0K A;  3BLY A;  3JSP A;  4M6X A;  4L0Y B;  3AL0 C;  4RB2 C;  1ORK A;  3DEU A;  3BQY A;  5LGN A;  5HDG A;  4X0G A;  5FKK A;  1H8A C;  3E0J B;  1QA6 A;  4O6J A;  2E1N A;  2EPF A;  2KP6 A;  2XV4 S;  3WTW C;  3CCJ I;  1D1B A;  1OPC A;  3JTG A;  2XSJ C;  3Q5F A;  2R7R A;  3Q0W A;  1LDD A;  4IKF A;  1HXD A;  2E7W A;  1ZQ3 P;  1YTY A;  4ESJ A;  2X6O A;  1HOM A;  1BI0 A;  1MBJ A;  2F6C A;  3GX4 X;  1LB2 A;  2K9S A;  1JGG A;  3ZN0 A;  3B02 A;  1D1C A;  1ZRF A;  2O8K A;  2GA2 A;  2UV1 A;  4AC0 A;  5LD2 C;  3FK7 A;  1WRJ A;  2CW0 F;  4OOI A;  4QPO A;  4I02 A;  4Y7N J;  1RC9 A;  4YFX F;  4UV8 A;  2XF7 A;  3ERE D;  1R58 A;  3ZQL A;  4MGR A;  3DBR B;  3H3V K;  1RUO A;  2KL4 A;  1BI3 A;  2B63 J;  4C3I J;  1Q1H A;  1ZKG A;  1I5Z A;  5FRM A;  2K3F A;  2OCE A;  3Q9V A;  2D1H A;  2BYV E;  4F91 B;  3CDH A;  1XTA A;  2LP0 A;  2A6E F;  1HF0 A;  2OA4 A;  3DTI A;  4EGY A;  3K4L A;  3A2K A;  3SFZ A;  2K4B A;  3TDU C;  3BR0 A;  2Y0S A;  2QBY B;  2V1N A;  2A6T A;  3AFH A;  3F22 A;  3ZGK A;  3H92 A;  2X6X A;  4B3A A;  2QSG X;  2GWR A;  5FGM A;  2XDV A;  2VON A;  3O8G A;  1MH4 A;  4HSR A;  3E6M A;  1XS9 A;  2V9P A;  3RPU D;  4H0E A;  2K9Q A;  3U1K A;  1LUJ B;  3HZJ A;  5B66 C;  1IV6 A;  1HKT A;  3T1B A;  1DDN A;  1OCC H;  3CUQ A;  2QVO A;  2CQN A;  2E2J J;  4G6Q A;  2V1D A;  3BRO A;  1RPW A;  5CVI A;  1XPX A;  2VI6 A;  3HTU A;  5J1R A;  2XRO A;  2M3A A;  1WKM A;  4RMN A;  1SAU A;  2I5U A;  2R4G A;  4BY7 J;  4B47 A;  4RAF A;  3S16 J;  1Z21 A;  5HLI A;  1ZYR F;  2WAE A;  4GO1 A;  2ID6 A;  1G3S A;  2HVS A;  4BQO A;  2HZT A;  5KCM A;  1WJA A;  2DXI A;  2BVL A;  5HLG A;  3HYI A;  5KHD A;  4XRM A;  2K7L A;  2PBI A;  5EGO A;  2XC7 A;  2CMP A;  4F52 A;  2DAO A;  3S1M J;  4ENM A;  4JX4 A;  2CO5 A;  2CQX A;  5GTH C;  1X1D A;  1RKW A;  4XSX F;  2QZ8 A;  1Y56 A;  2DT5 A;  2KRF A;  4I0A A;  3V42 A;  5IT3 A;  2VT2 A;  4M3F A;  2GXA A;  2L9R A;  4KIS A;  2GAU A;  3JRF A;  3WU0 A;  5JVG F;  1WQ2 A;  5EGO B;  1YIT I;  4OIP F;  2DJN A;  3BWG A;  3VYT B;  4HOB A;  4AVZ A;  2Y2Z A;  4RGX A;  3ABT A;  4A3G J;  1XD7 A;  3H3Z A;  1IDZ A;  2LBF A;  4RGR A;  4XLE A;  1HSJ A;  3IKT A;  4CA0 A;  3KP4 A;  1KQ8 A;  5LEJ A;  5IOY A;  3CC4 I;  1X1P A;  4F7Z A;  2F5C A;  3MWM A;  1MJ9 A;  1WJ5 A;  3L7W A;  2DMN A;  2PQ8 A;  2LBF B;  3VEP A;  4ZC3 A;  4AYB A;  1PP7 U;  4M9Z A;  5CVJ A;  4CCL A;  2R7Q A;  3G6E I;  1OIS A;  3LAJ A;  3O8H A;  3QYF A;  4C2T A;  2DU9 A;  3P5J A;  5B1B H;  2X85 A;  3MD2 A;  4IJA A;  1WFX A;  4XOP A;  1Z0X A;  3EPZ A;  2XUB A;  1FJL A;  4CCN A;  3K70 D;  4LD5 A;  4ZTJ A;  4ETS A;  1W0T A;  2HVR A;  2ZXI A;  2QQ8 A;  2EFP A;  1G59 A;  3C2H A;  2BGC A;  4IHT A;  3V7C A;  1GVD A;  2EIK H;  2KIM A;  1NG7 A;  1QZE A;  3JSO A;  2OQG A;  3OL4 A;  1VF9 A;  2LK2 A;  4LG0 A;  3F72 A;  1ZK8 A;  1X1C A;  3OR2 C;  1S7E A;  1X1A A;  1TNT A;  5D4S A;  4E4H A;  4MFE A;  3PSI A;  1FOX A;  3PQK A;  4C2M J;  3A0H C;  2GIV A;  3P9K A;  3VSL A;  2GM4 A;  3HOZ J;  2IS1 A;  2NNN A;  2FJ1 A;  2XVC A;  1E3H A;  1VQP I;  2ME6 A;  2JWT A;  5FJ8 J;  4LG0 B;  3FXQ A;  1TP4 A;  4YRV A;  2ICW G;  4ZDO A;  1FZP B;  1E2X A;  3OL3 A;  1KQ0 A;  2HGC A;  1SFO J;  3L2R A;  1IN5 A;  1O3T A;  1T0F C;  2HOS A;  2GA1 A;  5E3N A;  4HBL A;  2P0W A;  4HQE A;  3KET A;  5IT9 K;  3JCU C;  4XN0 A;  3ZRG A;  2VKE A;  2W1O A;  2L9S A;  3B73 A;  4J00 A;  2CUJ A;  5L3D A;  2HYF A;  3O3K A;  4D9J A;  4HNU A;  2HQR A;  3VYR B;  3MKW B;  3OV8 A;  3PIO F;  5FRN A;  2AXT C;  2KJB A;  1CQT A;  4NC8 A;  1O7L A;  2IW5 A;  1DU6 A;  4HX7 A;  3WU2 C;  3HHH A;  3ESW B;  2LY2 A;  4UVA A;  3H5N A;  1VQ4 I;  2PFB A;  1G3Y A;  4BAC A;  3KPH A;  1WJF A;  4KN4 X;  3OYK A;  1D0Z A;  1SAX A;  4OU0 A;  3ASN H;  1HKQ A;  4BHP A;  3W6K B;  1MNM C;  4ZH4 F;  1HBX G;  4UUV A;  3S15 J;  1W36 C;  2RAE A;  1YRN A;  5JHF A;  2ME0 A;  4G94 A;  5JLX A;  1UB9 A;  2DA2 A;  2WV1 A;  3OOP A;  1OKR A;  1VQK I;  4A3D J;  4Y4R A;  3S1Q J;  3IWZ A;  3GBG A;  3RPQ A;  5F08 A;  3H0D A;  1KU2 A;  3PNY A;  3QU3 A;  3CMM A;  4XNF A;  1WI3 A;  2CS3 A;  1YRN B;  1R7J A;  1UCR A;  1X19 A;  3MAJ A;  4LK0 F;  1OLT A;  3JTH A;  4IO9 F;  4PDK A;  4U0Y A;  4XR6 A;  4D1Q A;  2B0L A;  1BW5 A;  2HXO A;  3OIQ A;  1YJW I;  2O0Y A;  3HJE A;  2BY3 A;  3AG2 H;  2GQQ A;  3LST A;  4XN3 A;  2DTR A;  1VTN C;  2L9N A;  3QP5 A;  5J3L A;  3FWE A;  1XSD A;  1OJL A;  5CYV A;  2VKD A;  1S8N A;  4KNY A;  4G6T B;  3MKZ A;  2FOK A;  3U21 A;  4XLF A;  1VQ5 I;  5J8C A;  2XAU A;  4E70 A;  4B09 A;  3BG9 A;  2FQ3 A;  2L7F P;  2Z16 A;  1S29 A;  2VJ4 A;  1FOK A;  1JT6 A;  3OYM A;  4FX4 A;  1QQI A;  4B3X A;  5D4R A;  2M7A A;  3C3W A;  3F6O A;  4AD9 A;  3CDL A;  3K2Z A;  3SDB A;  4DYC A;  1FOY A;  2W4S A;  5K7Z A;  4I6Z A;  2ELH A;  1O3R A;  4RGU A;  2COB A;  4XK4 A;  4BHC A;  3LSI A;  2EFN A;  1G2H A;  4AVP A;  4C3J J;  4FTH A;  1LPQ A;  2WBM A;  2FD5 A;  2JK3 A;  3S3O A;  4C30 A;  2VPR A;  5HS7 A;  2LR8 A;  5FB2 A;  3DV8 A;  3HBL A;  4D0P A;  1OR7 C;  3E3V A;  1S7O A;  1IW7 F;  1RZ4 A;  2M8G X;  4RB3 C;  2K85 A;  3ZQH A;  2CG4 A;  2NXN B;  2X1D A;  1UMQ A;  2XRN A;  3DLL F;  6PAX A;  1FTZ A;  3DPL C;  3LL7 A;  4NUB A;  3TO7 A;  1IXS B;  1TWG J;  2D1V A;  3CF2 A;  4L5E A;  4CZC A;  4CYD A;  1AA7 A;  1N25 A;  4BE2 A;  1T39 A;  3ZMS A;  2PJP A;  3E6B A;  3OIP A;  4BL0 B;  1T6S A;  3ZXS A;  5H2F C;  1ETV A;  5LHI A;  4XON A;  3P7N A;  2UXX A;  1LKX A;  3K1N A;  3FIS A;  2OU2 A;  5FLX Z;  1SC7 A;  4A3B J;  3S93 A;  3ZCO A;  3GF2 A;  4M9S A;  4O3M A;  3BTC A;  3M4O J;  5K5Q A;  4Q48 A;  3WGH A;  1WVR A;  2DQL A;  1BOB A;  3K4K A;  2DA5 A;  4CCO A;  5F27 A;  1SVM A;  3KFW X;  3OS2 A;  3GTJ J;  3S2H J;  3RKY A;  3ASO H;  4KIT B;  1O57 A;  2M45 A;  4U7D A;  1KU7 A;  1XGM A;  1HST A;  3PUF A;  4WF2 A;  5H6Q A;  5LFA A;  4E7H A;  1MSE C;  1F9N A;  1FIA A;  3EDP A;  2QKM B;  2XAQ A;  5M5X J;  1XB4 A;  5LLQ A;  5HLT A;  1I50 J;  2JPB A;  5E1Z B;  2RN7 A;  3HSR A;  3FMS A;  3TED A;  4A6D A;  2X6W A;  1I3A A;  5EZG A;  2DOA A;  1NK2 P;  4KN7 X;  3H0G J;  5J8F A;  3GTP J;  4F93 B;  4DZJ A;  3LSP A;  1Y8Q B;  4JP0 A;  2X9D A;  1XSV A;  3WHC A;  5GAE J;  4BEH A;  1CF7 A;  4OIO F;  4OIQ F;  2V79 A;  2MYS A;  1ZG1 A;  1BW6 A;  3KCC A;  4P9U A;  1T98 A;  4Q5S F;  1NH3 A;  3CMA I;  3CME I;  2LKS A;  5M5Y J;  3IH2 A;  1J0R A;  4QSH A;  5J47 A;  3MMY B;  4CSW A;  3BJA A;  4BEH B;  4X1E A;  1CF7 B;  2XF5 A;  3F8F A;  4BXU A;  4YII A;  2VQH A;  4EJO A;  2O3F A;  2V4J C;  4BS9 A;  1XX5 A;  3FBI B;  3IP4 B;  3K69 A;  3V8K A;  3KZI C;  2EIN H;  5HNF A;  2KQR A;  3MKY B;  3R0J A;  4A69 C;  1I1G A;  3Q0V A;  4KIF A;  4U0W A;  1G3T A;  1ZHF A;  4DGW B;  3IWF A;  3DP7 A;  4KIB A;  3OYE A;  1YS7 A;  1TWC J;  3G2B A;  3ZP5 A;  2H27 A;  2EFW A;  3HOW J;  1QHH D;  4IF4 A;  1JKO C;  2PN6 A;  2Q2E A;  4MO7 A;  3K9T A;  3BTJ A;  1R22 A;  3I4M J;  1QRY A;  3O6B B;  2QEN A;  1KU9 A;  1P4A A;  4OMY A;  4ENN A;  4IXA A;  3W6V A;  4HQM A;  4IEJ A;  2MFZ A;  1QVU A;  1H0M A;  2Q2E B;  3F21 A;  4MNU A;  4RGS A;  1OQY A;  1IRG A;  1F5T A;  2DPU A;  3I0T A;  4Y17 A;  2BHY A;  5K5R A;  5D6F A;  2EQR A;  2HZD A;  3KEQ A;  4CXF A;  2HYJ A;  4BU2 A;  4Y13 A;  2WB1 N;  4WX9 A;  2IS2 A;  3JW4 A;  4ENJ A;  4IL6 C;  2W84 A;  3KP3 A;  3M1E A;  2FXA A;  2LY1 A;  3ECO A;  1HDD C;  2MW8 A;  2LKP A;  2Z1D A;  4LG3 A;  3GWZ A;  4NDL A;  2QA4 I;  1EJ9 A;  1NTC A;  4E7S A;  1JTY A;  3GW2 A;  3K4N A;  3PUB A;  4FIS A;  3WGG A;  1IRZ A;  1J5Y A;  2YSR A;  3FXJ A;  1X4O A;  2VPL A;  4BJ5 C;  2DFE A;  4BJ6 C;  4S05 A;  3J80 K;  2DW4 A;  1O3Q A;  5AIP A;  4AIH A;  2MLG A;  3CCY A;  3E7L A;  1MH3 A;  3IAS 2;  2DI3 A;  3PM1 A;  3VFZ A;  2VE9 A;  2FRH A;  3LAP A;  2Z9O A;  4BE0 A;  3IH4 A;  2EIL H;  4HW0 A;  4UB6 C;  5BPI A;  2HQ5 A;  2KRC A;  1ZAR A;  4FE7 A;  1IN6 A;  1ZGJ A;  3GLL A;  3SZP A;  2JTV A;  2WY7 Q;  2KIU A;  3B6A A;  3K2A A;  2K27 A;  2CSO A;  1BI2 A;  1R36 A;  3OYN A;  4ESB A;  3S3N A;  2E1O A;  1P2F A;  3I58 A;  5GPC A;  2RQP A;  5D6E A;  5DD8 A;  4Y3O A;  3T8R A;  1UG0 A;  4A0X A;  2VQC A;  2M2E A;  4JX5 A;  1HW1 A;  1BR2 A;  3CJR B;  5ICE A;  2IRF G;  1N77 A;  1D1A A;  3DFG A;  3WTY C;  3EYY A;  3GFM A;  3TKY A;  1MBK A;  4KYW A;  3E1S A;  5CVU A;  1XMA A;  3GVA A;  2HOT A;  2PG4 A;  1DP3 A;  1D5Y A;  1G8X A;  1X58 A;  2ZSH B;  3GFL A;  1V3F A;  2JA7 J;  3OYF A;  3KYD B;  1ACI A;  4AIJ A;  3IL2 A;  3FIW A;  1JGS A;  2WV0 A;  5EZH A;  4A3C J;  4MFD A;  1MW7 A;  1U5T C;  3EYI A;  1Y0N A;  4A5N A;  1T95 A;  3ZR8 X;  5ILV A;  4RAZ A;  2OZU A;  4ZYG A;  2BXZ A;  3D5L A;  4HV5 A;  4CIC A;  3S2D J;  2IA2 A;  1Z91 A;  2I10 A;  5LRR A;  2RV8 A;  2EZI A;  3KEO A;  2HXI A;  3HPG A;  1MBG A;  4XSZ F;  1IGN A;  4LIU A;  3F0C A;  1ZRD A;  1JT0 A;  2HPM A;  3BJO A;  5D5X B;  4EVI A;  1S9H A;  4DW6 A;  5BNG A;  5D5W B;  3BCB A;  1AKH A;  3D5R C;  2Y0M A;  1ZGA A;  2E5N A;  3NQO A;  4PGH A;  2NVU B;  3PQJ A;  4M3D A;  1XGS A;  9ANT A;  1SD7 A;  2EA2 A;  2H94 A;  1SMT A;  3BY6 A;  5FLX K;  2DT6 A;  2E7X A;  3Q3S A;  3WTX C;  1AKH B;  1R5G A;  2AO9 A;  2JN6 A;  2RNJ A;  2YX7 A;  3FM5 A;  3GTL J;  1IG7 A;  3Q0U A;  4BHB A;  2R5Z A;  3KP2 A;  1BL0 A;  4JOM A;  2MD0 A;  1YQA A;  3P9I A;  5DCF A;  3NRV A;  2XAJ A;  2QEX I;  4HX8 A;  4E7Z A;  3RZO J;  4ZZL A;  5HOD A;  2J5O A;  4Y15 A;  1S3J A;  5DD4 A;  3OYB A;  1J59 A;  5BQT A;  5GPA A;  1VND A;  4QIW N;  2RRE A;  1LEA A;  2R5Z B;  4B4C A;  1FMW A;  4PJN A;  3DBL B;  4WXC A;  4CDG A;  3K70 C;  2G7U A;  1LVA A;  4CHU A;  1R5H A;  4DOZ A;  2LF7 A;  2VOD A;  2VXD A;  3DBH B;  2ECC A;  2K3P A;  3QPL A;  5KVR A;  3GTQ J;  1LFB A;  1YFH A;  1WZ2 A;  5IT9 Z;  1TC3 C;  1J9I A;  2HNH A;  2CV0 A;  2BV6 A;  3BR2 A;  2R7V A;  1E0E A;  1B6A A;  2K9N A;  5LGU A;  4XRF A;  4EM2 A;  5F0H A;  3FKJ A;  2LOO A;  4V2G A;  4PZJ A;  2CQQ A;  3HDD A;  2W24 A;  1G3W A;  1WJB A;  2HOE A;  3HPH A;  2O5R A;  4AWX B;  3ZMD A;  2GLO A;  1VI0 A;  4PK4 A;  2AHQ A;  2DT7 B;  3G3Z A;  4R8H A;  2IA0 A;  2LD5 A;  3FXR A;  1RKT A;  1MD0 A;  4L9T A;  4A2U A;  2NRA C;  3HRS A;  3DEE A;  3LQR A;  3BR5 A;  2DYR H;  4ABZ A;  1SD5 A;  5B1A H;  1YW9 A;  3NWS A;  1CGP A;  3IV5 A;  4ZYD A;  2H1L A;  3HL2 A;  1GLN A;  1Y1W J;  4BDY A;  2HDD A;  1GT0 C;  1XGN A;  2M9H A;  3WHB A;  3W3C A;  5C4X J;  3V8J A;  2EIM H;  2JJ7 A;  2KMU A;  4F55 A;  2NVY J;  1R1U A;  1T33 A;  1K6O A;  1W5C C;  2D2W A;  2L54 A;  2OZ6 A;  4J01 A;  1REP C;  3COA C;  3SJM A;  4CGZ A;  1VQ7 I;  2KPM A;  4E6K G;  1EH8 A;  1TWA J;  3PFY A;  3QQA A;  2ZJQ F;  1SFX A;  3JRA A;  4V19 K;  4M71 A;  1JKR C;  4IHS A;  3D1N I;  3GYH X;  2A61 A;  1B1B A;  3JRI A;  1ZR2 A;  3QOP A;  2I8D A;  4CUG A;  3B6C A;  1FLI A;  2OTL I;  2IP2 A;  3I64 A;  3ZMU A;  1QHG A;  1MIJ A;  2E1M B;  4HF0 A;  1VFC A;  2LNB A;  5DS9 A;  1F1Z A;  2HOA A;  3BCA A;  3M8F A;  1ETX A;  1MBF A;  3E6D A;  2MC3 A;  4D5F A;  2ZO4 A;  2JVH A;  2CGP A;  1D3Y A;  1QZY A;  1POG A;  4NC6 A;  2COM A;  4BQA A;  1WWX A;  2P7V B;  5AON A;  5GP9 A;  1JKQ C;  3ZQG A;  4JX6 A;  1IRX A;  1U2W A;  4LFU A;  3WTU C;  3ELK A;  3JRG A;  2L7Z A;  4A3J J;  3VPR A;  4A6E A;  4XRS G;  2DK8 A;  1T38 A;  1P4X A;  3LA2 A;  4E7L A;  3TOA A;  1LEB A;  2PMH A;  1VQO I;  4J19 A;  3MVP A;  3R0A A;  2O8X A;  3PFI A;  3DTE A;  5CVV A;  4B8X A;  1Q1V A;  2KDZ A;  4LLN A;  1GUU A;  1NG6 A;  1FMV A;  1T2K A;  1HDP A;  2Y0S N;  2VUM J;  2P5K A;  5HLH A;  1SVO A;  2VAS A;  3K1M A;  1Z6T A;  2EZL A;  4XKW A;  2R7O A;  2QYO A;  3DTK A;  4HF1 A;  4EJT A;  1B8I A;  1ITY A;  3CUQ B;  1IXC A;  1FBQ A;  5DYM A;  1A31 A;  5E8I A;  5FFZ A;  1GVJ A;  1GV2 A;  1HKS A;  1XMX A;  2K5C A;  3R4K A;  4YFN F;  1O4X A;  1D8J A;  4Q47 A;  3HGG A;  2VE8 A;  1X2N A;  4PJ0 C;  4YEJ A;  4BXX J;  2M34 A;  5F1J A;  2ISZ A;  4EGZ A;  1B8I B;  3TP0 A;  2ETH A;  3TMO A;  2FBK A;  1KGS A;  2Z2S B;  2JA5 J;  4M6V A;  4RLF A;  3I4P A;  2TRT A;  2XAF A;  1J09 A;  5CJ9 A;  3QWL A;  4DQ2 A;  3AL0 B;  2Y9Y A;  3CCE I;  3KEY A;  4BY1 J;  3GXO A;  3PSF A;  1BJA A;  1R4M B;  2CUF A;  3AG4 H;  2BY0 A;  1P9Q C;  1S7A A;  2XPV A;  5L3C A;  2KZV A;  3I55 I;  4E7J A;  3IAM 2;  1S6L A;  3N97 A;  4M72 A;  4ZYA A;  2OV7 A;  2D45 A;  1IC8 A;  1X3U A;  2DYS H;  3F6V A;  2G0E A;  3H35 A;  4M9X A;  3KIO A;  1MMN A;  3EUH C;  2XGD A;  2RNG A;  3W2V A;  2JRM A;  3LA7 A;  3DEW A;  2OQR A;  5KK1 A;  3WTZ A;  1IDY A;  1LFP A;  1JE8 A;  1EKE A;  2DA3 A;  3W2A A;  3C18 A;  1PVE A;  1KA8 A;  5F04 A;  4S0H B;  2K02 A;  4Y52 J;  1WJC A;  2UUZ A;  3X2Q H;  1WGX A;  2H8R A;  4O5V A;  3NAR A;  4FCY A;  3HEF A;  2BY1 A;  3KP6 A;  2K9M A;  4OAY A;  1EH7 A;  2LH9 A;  3MCZ A;  4BKX A;  1RES A;  1JKP C;  3RKQ A;  5FKO A;  1YJN I;  2ZFW A;  2CW8 A;  1K83 J;  2HDW A;  3T8T A;  1HC8 A;  4AYB N;  4Z2Y A;  3FBN B;  5FFX A;  2CFX A;  2Q8K A;  2XAG A;  5L3F A;  4RS8 A;  2GZW A;  1O3S A;  2DPD A;  1W4M A;  1IF1 A;  2OD5 A;  2EIJ H;  2P8T A;  3H3U A;  4XKV A;  2V6C A;  2IGK A;  4NBQ A;  2RGV A;  3LSK A;  1MSF C;  5BMZ A;  3S17 J;  4ITV A;  2Z5U A;  1MMD A;  1PUF A;  4LJZ F;  2QKL B;  2X0L A;  2FE3 A;  1WPK A;  4U0V A;  4YG2 F;  2J5P A;  5K7F A;  3C7J A;  2MA3 A;  4LIT A;  2KFD A;  3I56 I;  1SFE A;  1B9M A;  4RLQ A;  3U1D A;  3WG9 A;  2JT1 A;  2IS4 A;  4HRI A;  1ZH5 A;  1PUF B;  3HOX J;  4RM3 A;  3TO6 A;  2P4W A;  2LRD A;  3CO6 C;  3KE2 A;  2M7B A;  2Y48 A;  3CJQ B;  3U2R A;  3WOD F;  1QO0 D;  4GDF A;  1F36 A;  4JK1 X;  1W7P A;  3D0S A;  1FYK A;  4AID A;  1U8R A;  4LK1 F;  3HKZ A;  4GYG A;  2JUC A;  3EUA A;  3SXY A;  4Y33 A;  3ZOB A;  3T5X A;  4XLA A;  3ABM H;  2VBY A;  3F8B A;  1W7P B;  2B7E A;  3ML6 A;  4JBA A;  5JVT A;  3FDY A;  1BIB A;  4FX0 A;  1QVT A;  1FYL A;  2R93 J;  4EJV A;  5F6F A;  4HNV A;  1TQM A;  2VXZ A;  3DU5 A;  2ELJ A;  5HDN A;  4HLY A;  3GO5 A;  3J80 Z;  4EQQ A;  3HKZ N;  1RIO H;  1UG2 A;  1YW8 A;  5HNH A;  2O6G E;  2HTS A;  2HR3 A;  1U3E M;  3J7Z I;  3CDI A;  3P9C A;  2E2I J;  2BY2 A;  2O7O A;  1X4P A;  1BC8 C;  2CW7 A;  1JHF A;  4V2F A;  2JPC A;  1YO5 C;  5CQE A;  2YUS A;  4IHW A;  5H20 A;  3FHN A;  5FRO A;  1VQ8 I;  3WE3 A;  5TJJ A;  2M0M A;  1V55 H;  2ZC2 A;  3F23 A;  4LMY A;  1XCB A;  2F4M B;  2QCO A;  2R92 J;  3AG1 H;  1FC3 A;  1B4A A;  1Z9C A;  3G1O A;  2VL8 A;  3IHU A;  4IHV A;  2R7D A;  2QWW A;  2ZSI B;  2FML A;  2Z33 A;  2M4G A;  2H1K A;  1Z3Y A;  3PO2 J;  3VOE A;  3BG7 A;  4DZP A;  2R7W A;  1ODD A;  2X48 A;  1PYV A;  4B44 A;  1VQM I;  2K9L A;  1LDJ A;  2NS7 A;  4XKB A;  5EDN A;  4Q4Z F;  3CLQ A;  2MSY A;  1UZC A;  3OR1 C;  2MH2 A;  3DKY A;  2A5Y B;  1YIO A;  5E8G A;  5EG0 A;  2CV2 A;  1R1T A;  3TW6 A;  5KNL A;  3ZMZ A;  1NHA A;  4BQN A;  2IGN A;  4C9Y A;  5L3E A;  3EUK L;  1YG2 A;  2L4A A;  3OWT A;  3TDZ C;  1IZ1 A;  5F64 A;  5EG0 B;  3LFU A;  1DP7 P;  2H6C A;  1ZLJ A;  2NVX J;  1W7P D;  1FBS A;  5TRD A;  3HOV J;  1A5J A;  1R00 A;  3RKX A;  1R5I D;  4EJW A;  2P5V A;  5ICG A;  4G9Y A;  2LFB A;  1T0F A;  1Z6R A;  3KYC B;  3C2B A;  5EEG A;  2ZJ2 A;  1R23 A;  3EET A;  2VKH A;  3GTG J;  2BOL A;  2VKV A;  4B43 A;  4BH9 A;  2OF7 A;  2ZXJ A;  4NB5 A;  5J4V A;  4DBQ A;  2W00 A;  3QYE A;  2OJE D;  2VBW A;  2IGO A;  5EYR A;  3NAU A;  2MAB A;  3CQZ J;  2ISY A;  5IPA A;  1U6G A;  3CD6 I;  1G6N A;  2HWV A;  2ESN A;  4KMU X;  1N78 A;  5ILU A;  1SFU A;  5E1W A;  1Y6I A;  4WWC A;  2PEX A;  4PFP A;  3CJT B;  5AIQ A;  4PSX A;  1QBJ A;  4Z6Y A;  2JSC A;  2A3S A;  4IHX A;  1QGP A;  4WCG A;  2PJR A;  3FZV A;  1E3O C;  1S5L C;  1ETY A;  2EV5 A;  1X3Z B;  3GZ5 A;  4GFB A;  2STW A;  1BR1 A;  2BXY A;  1FSH A;  2P81 A;  1QZZ A;  4FAS D;  3M9A A;  1YX3 A;  3HRU A;  3L00 A;  3LWF A;  1J7K A;  5K5O A;  4CH7 A;  2XHK A;  2DDA A;  3F9K A;  2PJR B;  5CPR B;  3UNG C;  3OYG A;  3SEZ A;  4HDU A;  1TWF J;  1XGO A;  2RVC A;  5IY5 H;  3OS0 A;  4KDP A;  2GBY A;  4ZYE A;  2CU7 A;  1ZLK A;  3GTK J;  2M8E A;  4CCK A;  4IOA F;  3AG3 H;  2BHZ A;  2E34 A;  2E36 A;  3OMY A;  2IJL A;  3C2G A;  3RYP A;  1TT0 A;  3HRT A;  5FKN A;  3BDD A;  4UVB A;  4CZZ A;  2A07 F;  3MZ8 A;  3MZY A;  4RA2 A;  3FXU A;  5EF6 A;  5LRS A;  3JRB A;  2E1C A;  1ETO A;  2W85 A;  3ZQ7 A;  1VQL I;  3BG6 A;  3HOY J;  1BM9 A;  2EJR A;  4L9V A;  4JQF A;  2QF7 A;  3FMR A;  2XAS A;  1DGW Y;  2DJI A;  3ZMT A;  4I7H A;  3V7R A;  5A2Q Z;  2X1E A;  5CKT A;  5GAD J;  1I6X A;  3KLN A;  1K79 A;  4IX7 A;  4KIC A;  3CTA A;  1BI1 A;  2EFO A;  5C44 J;  1OR7 A;  3L9F A;  2VJ5 A;  4CO8 A;  1F43 A;  3R6S A;  3HUG A;  3M7G A;  4MQV A;  1Z05 A;  2K86 A;  3QPS A;  2NVQ J;  5IP9 J;  4A3F J;  1WI9 A;  1IO2 A;  5M3F J;  2X4H A;  3ZPL A;  1GDT A;  4OIN F;  3GZN B;  2E35 A;  2L02 A;  5C4J J;  2CWE A;  3N4M A;  4BQQ A;  5DV5 A;  3LFK A;  3SHF A;  3HUG B;  1L3L A;  4IZZ A;  3AAF A;  3S32 A;  4RDU A;  3PNT A;  3ZQQ A;  3H5R A;  3GUD A;  4H4K C;  4GRI A;  1RR7 A;  2FUG 2;  1WJD A;  2VJJ A;  2FSW A;  1A6Q A;  3ISP A;  4YEL A;  1ZRC A;  1IUY A;  2G7H A;  1W36 D;  2W57 A;  4N4N B;  5FD5 A;  3L2U A;  2XKP A;  2A5W A;  4IQ4 A;  1UST A;  4IQJ A;  3G4S I;  2NAZ A;  1FOW A;  2IXS A;  3TP3 A;  2LY9 A;  1V5G A;  3L2C A;  1R49 A;  1VQ9 I;  2E2H J;  4P5O A;  2WA0 A;  1ZGW A;  4WXH A;  1OFC X;  3HGY A;  2CQ7 A;  3OS1 A;  4M6Y A;  2WC2 A;  4ZZD A;  3O2P E;  2E5Z A;  4U87 A;  2W25 A;  3QPT A;  4U88 A;  1BOA A;  2KLO A;  1TQP A;  4CCJ A;  3MEX A;  2WY8 Q;  4II3 A;  3CCU I;  2FBI A;  1ONV A;  1OCR H;  4YFK F;  3ABL H;  3DXJ F;  3K4J A;  3KLO A;  4B48 A;  3GTO J;  1DQU A;  2DO7 A;  3V8L A;  1HW2 A;  1IRF A;  3F3X A;  1FEX A;  2P6S A;  2BZT A;  1MZB A;  1ZR4 A;  5ICF A;  3QPH A;  3TOB A;  4QTR A;  3RIR A;  2V1X A;  2YU3 A;  3PNV A;  2VJI A;  3RI4 A;  3PL8 A;  1R4N B;  2UWM A;  2DA4 A;  4LB6 B;  3FXL A;  5ILS A;  3MQ0 A;  5E1X A;  3CCM I;  4BBS J;  4L9J A;  1Z7L A;  3TQN A;  4AUX A;  5B5E C;  5JI6 A;  2W7N A;  2ELK A;  3CJN A;  1DPR A;  4I98 B;  4KUM A;  4KFC A;  3K10 A;  2DBB A;  2JA8 J;  2HS5 A;  4NQW A;  3RKW A;  4HNT A;  5JR3 A;  2JA6 J;  3BT9 A;  2VQG A;  4ANJ A;  2XIG A;  4XRS A;  3HTS B;  4OAZ A;  1KON A;  5IYB J;  1U78 A;  2L9V A;  2ZJR F;  2F5F A;  3FHZ A;  2AQE A;  2OBP A;  2O9L A;  4NQW B;  2PMZ A;  3PIP F;  3CCQ I;  1YI2 I;  2DA6 A;  2E19 A;  2JRT A;  3KP7 A;  4PJL A;  1TTY A;  2OPT A;  4UUT A;  4WK8 F;  2ZB9 A;  1MND A;  3K0L A;  1XCV A;  1KZH A;  4A3K J;  2R7S A;  1Z77 A;  3LSR A;  1UJ8 A;  3BOQ A;  4GCV A;  1P7J A;  2V9V A;  3NWT A;  4BUP A;  2F5E A;  1KYW A;  1JHH A;  2OCC H;  2LG4 A;  3KX2 A;  4FT8 A;  3R60 A;  3BR3 A;  2PMZ N;  3JRC A;  4YIF A;  1ERD A;  1BJZ A;  1XN7 A;  4HLX A;  1E3P A;  2MGQ A;  3IRQ A;  2IS6 A;  2Y9Z A;  2L7M P;  3ERM A;  1IV8 A;  3F8M A;  2XGC A;  2KDO A;  2R5Y A;  1UFM A;  4GYI A;  2DOE A;  2ZME A;  2LLK A;  4M3B A;  4A93 J;  2FU4 A;  5D8K B;  2JQ7 A;  4ZTF A;  2MLK A;  3L1P A;  4D5C A;  2CH0 A;  1OCZ H;  3JAM Z;  3KP5 A;  1FTT A;  4UHT A;  3GZ6 A;  1A35 A;  5TGT A;  5M5W J;  2R5Y B;  1IN4 A;  2QSF X;  2ZME B;  1T08 B;  1SMY F;  3L2W A;  4C3H J;  4TV7 A;  1B59 A;  1VZ0 A;  3H9G A;  1X2M A;  2VOO A;  1XDU A;  3VB2 A;  3CUQ C;  4I76 A;  1R6R A;  2GXB A;  4L0Z B;  3GFJ A;  2N8G A;  2STT A;  2WAF A;  1PP8 F;  2M1B A;  2X6Y A;  1S72 I;  2DA7 A;  2WAQ A;  4BAY A;  1XDS A;  1M1E B;  2HQA A;  3DQV C;  2X51 A;  5DCM A;  3G1L A;  1DUX C;  5J4Y A;  1AOY A;  2NOJ B;  2ADU A;  2L7K A;  1FT9 A;  3LMM A;  3BZK A;  1FBU A;  3A4C A;  4L9N A;  2HEO A;  1FNN A;  1STZ A;  1H89 C;  4GGG A;  5ERI A;  4I01 A;  2IA1 A;  5DCM B;  4PCQ A;  3GCM A;  2O03 A;  2VT3 A;  2WAQ N;  5A2Q K;  4HPQ A;  3I4N J;  2FBH A;  4N9I A;  5IP6 A;  4HF2 A;  2EBI A;  2M0C A;  2L3D A;  1ENH A;  1U5T A;  2AQF A;  3Q9S A;  1I39 A;  2P5L C;  2IBD A;  2DQR A;  2LC2 A;  2EWN A;  4LIV A;  4PSW A;  3VOD A;  3OYI A;  2LYC A;  2DMQ A;  1U5T B;  3CCS I;  3GEZ A;  1XG1 A;  4S04 A;  4XM3 A;  2VIX A;  3JRE A;  1D5V A;  2R7U A;  3K4B A;  2A68 F;  3FXO A;  4A3E J;  2L5Q A;  3HG9 A;  1P92 A;  3PO3 J;  3JRD A;  2A69 F;  2ZBK A;  3CLO A;  2FMY A;  2CJJ A;  1EV7 A;  5FKL A;  4IOC F;  1KU3 A;  4EJU A;  4W97 A;  4M74 A;  2QBY A;  1H9G A;  5F1R A;  2BVM A;  2F5D A;  2KT0 A;  5LBQ A;  3JR9 A;  2PI0 A;  1UHM A;  3DF8 A;  4QLC U;  5JFR A;  4I2O A;  4DIQ A;  4XLP F;  3SZT A;  4HDV A;  2EA4 A;  2YS9 A;  2X1C A;  1Z67 A;  3BP8 A;  2ACJ A;  4KT6 A;  5JLW A;  2ZXW H;  5D5V B;  2Q1Z B;  4FE4 A;  4HZF A;  1JXS A;  4DYQ A;  1MNE A;  2KIF A;  2HFH A;  4MTD A;  2DFH A;  2DFI A;  1LJ9 A;  3SZG A;  2H6B A;  2HPI A;  3BZC A;  3A02 A;  3H1C A;  3DLA A;  4F3Q A;  2QSH X;  3OIO A;  1P4W A;  2F2E A;  1LFU P;  1Z1D A;  2EH3 A;  2RC4 A;  3I3L A;  4BGD A;  3U9G A;  3RSN A;  1LDK B;  3WG7 H;  3BTI A;  2HTJ A;  4RBO A;  1GXQ A;  4XLH A;  1V54 H;  2XF6 A;  4MEX F;  2ZXH A;  1USS A;  4KMF A;  3G1M A;  4A3I J;  2LDU A;  1JUS A;  1K6Y A;  2OC6 A;  4M3G A;  5FLV A;  3IH3 A;  4XQF A;  5IYC J;  2BW3 A;  4FHT A;  2V6E A;  5LHG A;  2XPW A;  5J40 A;  3S14 J;  2P7C B;  3ZQC A;  3M8E A;  2NNY A;  5LHH A;  4N9H A;  1UHW A;  1JJ6 C;  2ID3 A;  1AU7 A;  2HQN A;  2K40 A;  3FK6 A;  4P96 A;  1IN8 A;  2MH9 A;  1H9T A;  1QNT A;  2LTP A;  2QGU A;  2RKH A;  3ABU A;  2BW3 B;  1RR8 C;  1OCP A;  4HA8 A;  3L2Q A;  1VQ6 I;  1EH6 A;  4HYE A;  2MG4 A;  3CP8 A;  1TNS A;  1P6R A;  2DOF A;  3V7S A;  4IRI A;  3FXK A;  2FF4 A;  2V9K A;  4LGW A;  4ZYH A;  4ON0 A;  1HCR A;  1OYY A;  1YHQ I;  2LF8 A;  4DNC A;  2GOX B;  5FKM A;  1WCM J;  3L09 A;  4A3L J;  5HS8 A;  3CCR I;  4E7K A;  1MGT A;  1ZEL A;  4XBF A;  3HHG A;  3FXM A;  3OSG A;  5H6R A;  1O7F A;  4UVC A;  2FX0 A;  4A12 A;  5ED4 A;  2QUF A;  3OYL A;  4L18 B;  4P1W A;  1WH5 A;  3LNQ A;  1DU0 A;  2M87 A;  3I9V 2;  5DDG A;  3MZH A;  2FA5 A;  4BNC A;  1Y1V J;  1A36 A;  4A3M J;  3SEQ A;  2CUZ A;  2ZFU A;  1QPM A;  4PUS A;  1GXP A;  2H09 A;  2A05 A;  3HM5 A;  2DMU A;  1FYM A;  3UKG A;  4MEY F;  3QU6 A;  3BPX A;  2M5W A;  5DUI A;  2DMT A;  4EM1 A;  1MJA A;  3SDG A;  3TO9 A;  3QAH A;  1RNL A;  4XID A;  2ZNY A;  3RCO A;  3DCF A;  3TL4 X;  4RB1 A;  3OYC A;  2WWY A;  4ZDL A;  2XSD C;  2XAH A;  4DYR A;  3JRH A;  2DFF A;  3JAM K;  4LOC A;  4G8X A;  4OWR B;  4ENK A;  2LKX A;  1R71 A;  5TIS C;  1UHS A;  4G7H F;  3ZN1 A;  4G7Z F;  3IKV A;  2DDB A;  1TQI A;  2IT0 A;  5GTI C;  1WSU A;  3ABK H;  4K2E A;  3RDI A;  1EA3 A;  4MTE A;  3S3M A;  1H88 C;  2ZCW A;  4RB0 A;  3M3Y J;  2BBY A;  2CQK A;  2V26 A;  1YYV A;  2JVG A;  2VC1 A;  2A6H F;  5LGT A;  2LRE A;  4N4O B;  4EEF G;  3HIF A;  5IOZ A;  3J81 K;  3WU1 B;  4BXF A;  1APL C;  2L01 A;  1DPU A;  4MIM A;  1AWC A;  1HQC A;  3ZMV A;  2XPU A;  3QRF F;  2V7F A;  2W82 A;  3OY9 A;  1GV5 A;  2F4I A;  1K61 A;  2DTZ A;  4XOR A;  1I6H J;  1C0W A;  4E7I A;  1BIA A;  3RQ4 A;  3TW7 A;  3H5A A;  1RRJ A;  2PMU A;  4BYY A;  1MJB A;  1ULY A;  3EQL F;  1YE9 A;  3H9J A;  3LSG A;  1XC5 A;  4N0B A;  2NS8 A;  4ZDP A;  1Y39 A;  1QU3 A;  3EUH A;  3FM3 A;  2AS5 F;  2OTJ I;  1T56 A;  1YW7 A;  1SEU A;  1SVL A;  1J2X A;  2L4M A;  4PFO A;  2GIZ A;  2R7F A;  4A0Y A;  5J6X A;  3IRR A;  3I59 A;  2KKO A;  2E60 A;  3BJ6 A;  3I5U A;  5LEK A;  2DK5 A;  1B72 A;  1V5E A;  2FOW A;  3QOE A;  3I53 A;  3SQN A;  2JA2 A;  3K4M A;  3ONQ A;  3I59 B;  3J7A Y;  2KJC A;  2GOM A;  5KAF C;  1B72 B;  1YS6 A;  4KT5 C;  1BC7 C;  1ETQ A;  2Y69 H;  3KZY A;  1VQN I;  3S2W A;  3HOT A;  5JHU A;  2UXN A;  4UXN A;  3CP2 A;  1L0O C;  3HRM A;  1AHD P;  1A04 A;  2Y31 A;  1PDN C;  3C1D A;  1D0Y A;  4A5M A;  3E5U A;  3W2W A;  3DU6 A;  2VN2 A;  3K6G A;  1JUM A;  2UZK A;  2OAZ A;  2RDP A;  2RQQ A;  1A6I A;  3ULQ B;  1WH7 A;  3BR1 A;  3LSJ A;  3LSM A;  2AXL A;  5BPD A;  1NK3 P;  1U0J A;  1FY7 A;  2JMW A;  4ASN A;  1K4T A;  4I09 A;  5C3E J;  3LSH A;  2F4O B;  3K1P A;  1TWH J;  3LQQ A;  5EEH A;  3CMY A;  2IAI A;  3HXL A;  5B3S H;  2YU9 J;  5F0F A;  4R1H A;  4QWQ A;  1IUF A;  5HDK A;  5BOX A;  5DM6 F;  2P6T A;  3SYT A;  4BE1 A;  3BC8 A;  1YJ9 I;  3GFI A;  1MKM A;  1F4K A;  2VLA A;  5DM7 F;  3SFI A;  1W1W E;  2LMD A;  1ZAO A;  3QOD A;  2IPQ X;  1MMG A;  3WTS C;  3CZ6 A;  1IN7 A;  4YIR X;  2L2O A;  1OCT C;  3VYU B;  1MMA A;  3HOU J;  4NC7 A;  3FF5 A;  1UAA A;  3CC2 I;  3VWB A;  4AIK A;  5FD6 A;  3H36 A;  1B9N A;  2KIS A;  2QQ9 A;  3UR3 C;  1KYZ A;  2HVQ A;  3DWL E;  5BS6 A;  1LQ1 A;  3J7A O;  3J7Y J;  5ICC A;  2EZH A;  1SFK A;  5E18 F;  4L5I A;  4AU7 A;  1QPI A;  4UY8 I;  1LNW A;  2OUM A;  3CO7 C;  2KIQ A;  4IRH A;  2R3S A;  5IYD J;  5IP7 J;  4ESF A;  3K4C A;  5HVQ C;  1FP2 A;  1G4D A;  3REO A;  2MC4 A;  4EV0 A;  2R7X A;  2LVS A;  4R79 A;  4PJJ A;  2WTE A;  3OOU A;  5J1U A;  2TDX A;  2EB7 A;  5E20 A;  1MMS A;  3AKZ A;  2E71 A;  3DKX A;  4EMS A;  2Y30 A;  2NYX A;  1V4R A;  1XMK A;  4IVN A;  3ZQI A;  1PUE E;  3HSE A;  4XLN F;  4NHJ A;  4RAY A;  1BN5 A;  4HST A;  4IRG A;  3HB9 A;  1Y0U A;  3BG3 A;  3BTL A;  2ESH A;  1K4S A;  1ON1 A;  4BDZ A;  4XKC A;  3F8N A;  3CES A;  3QP6 A;  4FET A;  3DPU A;  2BE5 F;  2CYY A;  1WJE A;  2QQA A;  4XLC A;  1FWZ A;  3S1N J;  4XMY A;  4IHY A;  4L5J A;  3OYA A;  2DLL A;  2Z99 A;  2VB6 A;  1BBY A;  4HG2 A;  4XOT A;  3CF5 F;  2DOD A;  1YIJ I;  2NVT J;  1TBX A;  4KIG A;  5EEA A;  3G73 A;  5E17 F;  2ECB A;  3M1C A;  4HEA 2;  4KA4 A;  3RTR A;  2CV1 A;  3VDX A;  4OIR F;  2R7T A;  1OMI A;  1FX7 A;  1FIP A;  4PJM A;  2M4K A;  3M07 A;  1N75 A;  3WGI A;  2QQB A;  5D5U B;  1TW2 A;  3RYR A;  1T8I A;  1IJW C;  3A01 A;  4HX4 A;  4HAM A;  4ZJZ A;  3S8P A;  2B9S A;  4KJZ A;  2EV6 A;  4FQG A;  3QYB A;  1Y8R B;  1YLF A;  2VQL A;  3FX3 A;  3F8C A;  2XB0 X;  3A03 A;  4MQ9 F;  1DGR M;  2VBX A;  5L3B A;  1MDM A;  1TT5 B;  2HKO A;  3A01 B;  2BEO A;  1JJ8 C;  4LLL A;  1IXR C;  3HSF A;  3GME A;  3HC7 A;  2FQ4 A;  5KAI C;  2EZK A;  3I54 A;  1U8B A;  3OSF A;  3IUO A;  2XRL A;  1EF4 A;  2WB1 A;  3BR6 A;  2R0Q C;  2PLY A;  5DUK A;  2YX4 A;  5CVR A;  1MDM B;  3CCV I;  3WE2 A;  5DEQ A;  3RZD J;  2ZKZ A;  1LVK A;  3V4G A;  1BR4 A;  2O61 A;  4WXD A;  4UB8 C;  1TL8 A;  1HLV A;  2F5V A;  2MBF A;  4EAT A;  1OCO H;  1XSX A;  2KRH A;  5FLM J;  3KZZ A;  4UNO A;  5CQG A;  5E79 C;  3OYD A;  1MBH A;  1IAW A;  2M30 A;  1Z7U A;  4IPA A;  3E97 A;  3GLX A;  3MN2 A;  1OYI A;  1SAN A;  2HU9 A;  1Z3X A;  4LB5 A;  1ZN2 A;  1I3Q J;  1WHU A;  3BG5 A;  1I27 A;  2MD5 A;  2IEK A;  5E3L A;  5L3G A;  1D8K A;  1W0U A;  1KQ9 A;  3A0B C;  3KYL A;  4UV9 A;  4F92 B;  2CFO A;  5CLS A;  1SD4 A;  2LSO A;  1FP1 D;  2Q0O A;  2ZME C;  3D5S C;  4GXO A;  4I99 C;  2EV0 A;  3VYS B;  4D7M A;  2HDC A;  2XGE A;  2HYG D;  3NEU A;  3MKL A;  4P9F A;  2G9W A;  2HKX A;  1ON2 A;  4PGG A;  1TW3 A;  2FNA A;  2FEZ A;  2PX9 A;  2CUE A;  3BZ6 A;  1V5F A;  4QPQ A;  2XGX A;  5EJC A;  3BQZ A;  1K78 A;  3IC7 A;  5E3O A;  1ETW A;  1W5T A;  2NS0 A;  3ZQF A;  1RET A;  4II2 A;  3TBI A;  2IGM A;  2VC0 A;  2Z3Y A;  5HOO A;  4AM3 A;  5E3M A;  3G71 I;  1U9O A;  2K4J A;  3RQI A;  3E5X A;  4X6A J;  1JTX A; 
#chains in the Genus database with same CATH homology
 4CYC A;  3JRE A;  2DA5 A;  5F27 A;  3GTJ J;  3S2H J;  4XIC A;  1PUF B;  3HOX J;  4A3E J;  1BA5 A;  3PO3 J;  3JRD A;  4W1U A;  1MSE C;  2CJJ A;  1FIA A;  5FKL A;  4CYC B;  1F36 A;  5M5X J;  4W97 A;  1I50 J;  2KT0 A;  3TED A;  3JR9 A;  5EZG A;  1NK2 P;  3H0G J;  2R7Z J;  2YS9 A;  3GTP J;  3K7A J;  3ZOB A;  4DZJ A;  5M3M J;  5JLW A;  3LSP A;  1ETK A;  4FE4 A;  4JP0 A;  4DYQ A;  2X9D A;  2CRG A;  3WHC A;  1QVT A;  4M3E A;  2R93 J;  2DN0 A;  4HNV A;  1LE8 A;  5F0C A;  3A02 A;  3OIO A;  1BW6 A;  1LFU P;  2EH3 A;  1R9T J;  2XB5 A;  3HKZ N;  1UG2 A;  3BTI A;  5M5Y J;  4RBO A;  3IH2 A;  4QSH A;  2E2I J;  2O7O A;  4X1E A;  5J1Y A;  1LE8 B;  4V2F A;  1U9N A;  3G1M A;  4B1R A;  2YUS A;  4A3I J;  4IHW A;  2W48 A;  1JUS A;  4M3G A;  3Q0V A;  1JUP A;  4A69 C;  5FLV A;  3IH3 A;  5IYC J;  2QCO A;  4JYK A;  2R92 J;  4UUS A;  1ZTR A;  1TWC J;  3G1O A;  3GTM J;  3HOW J;  2XPW A;  4IHV A;  4D7N A;  3S14 J;  3ZQC A;  1JKO C;  4MO7 A;  2DA1 A;  1JJ6 C;  2H1K A;  4G12 A;  3BTJ A;  2ID3 A;  1AU7 A;  3I4M J;  3PO2 J;  1QRY A;  4DZP A;  2K40 A;  3FK6 A;  4MLO A;  2X48 A;  2LTP A;  5K7H A;  2NS7 A;  4UUS B;  1OCP A;  2NOG A;  2D5V A;  2MG4 A;  5EDN A;  3W6V A;  2MSY A;  2HI3 A;  4IEJ A;  1QVU A;  1MBE A;  3FKI J;  1HCR A;  5DTD A;  1P7I A;  3S1R J;  5EG0 A;  3TW6 A;  2DMP A;  5FKM A;  2EQR A;  1WCM J;  2TCT A;  3LOC A;  2HYJ A;  4BBR J;  4A3L J;  2WB1 N;  2L0K A;  3OSG A;  2FX0 A;  5EG0 B;  1ORK A;  1HDD C;  2MW8 A;  3BQY A;  2NVX J;  1WH5 A;  3HOV J;  3LNQ A;  1DU0 A;  5FKK A;  1A5J A;  1H8A C;  4NDL A;  1NTC A;  1JTY A;  2LFB A;  4FIS A;  1IRZ A;  1Y1V J;  3C2B A;  3Q0W A;  4A3M J;  3GTG J;  2VKV A;  2OF7 A;  3CCY A;  3E7L A;  3HM5 A;  1MH3 A;  2DMU A;  3PM1 A;  3UKG A;  1ZQ3 P;  2DMT A;  1HOM A;  2X6O A;  3SDG A;  3IH4 A;  1MBJ A;  5EYR A;  3NAU A;  4XID A;  2HQ5 A;  2K9S A;  3CQZ J;  5IPA A;  3DCF A;  1JGG A;  4FE7 A;  3K2A A;  3B6A A;  2XSD C;  2O8K A;  4DYR A;  3JRH A;  4AC0 A;  3FK7 A;  4LOC A;  2LKX A;  2E1O A;  4IHX A;  1UHS A;  4Y7N J;  5GPC A;  1E3O C;  1ETY A;  2M2E A;  4JX5 A;  4GFB A;  2P81 A;  3ZQL A;  3H3V K;  1H88 C;  2B63 J;  4C3I J;  1MBK A;  3M3Y J;  1ZKG A;  2HOT A;  1D5Y A;  1X58 A;  2JA7 J;  1JTX A;  2LP0 A;  1HF0 A;  1TWF J;  4EEF G;  5IOZ A;  2GBY A;  3FIW A;  2CU7 A;  1APL C;  5EZH A;  3BR0 A;  3GTK J;  4MFD A;  4MIM A;  4A3C J;  2XPU A;  4B3A A;  5FKN A;  3S2D J;  2I10 A;  1GV5 A;  3O8G A;  1K61 A;  2EZI A;  1MH4 A;  2DTZ A;  2HXI A;  1MBG A;  1I6H J;  1IGN A;  3TW7 A;  5EF6 A;  3JRB A;  1XS9 A;  2K9Q A;  3F0C A;  1ETO A;  1JT0 A;  1IV6 A;  3LSG A;  1XC5 A;  3HOY J;  4DW6 A;  2NS8 A;  5BNG A;  1AKH A;  1T56 A;  2E2J J;  2QF7 A;  1RPW A;  4M3D A;  2VI6 A;  5J1R A;  9ANT A;  4BY7 J;  1B72 A;  3S16 J;  2ID6 A;  3Q3S A;  1AKH B;  2JN6 A;  2AO9 A;  3GTL J;  1IG7 A;  5C44 J;  3Q0U A;  2R5Z A;  1BL0 A;  4XRM A;  1F43 A;  5EGO A;  1B72 B;  3S1M J;  1ETQ A;  3QPS A;  3RZO J;  4JX4 A;  2NVQ J;  5HOD A;  2CQX A;  5IP9 J;  4A3F J;  5M3F J;  1RKW A;  1GDT A;  5GPA A;  1VND A;  4QIW N;  5C4J J;  1AHD P;  4M3F A;  2Y31 A;  2L9R A;  2R5Z B;  4B4C A;  3JRF A;  5EGO B;  1JUM A;  2DJN A;  4RDU A;  2Y2Z A;  3GTQ J;  1A6I A;  2ECC A;  3QPL A;  1WH7 A;  3BR1 A;  3LSJ A;  1NK3 P;  1LFB A;  4A3G J;  1RR7 A;  2JMW A;  1TC3 C;  1IDZ A;  5C3E J;  3BR2 A;  1TWH J;  5IOY A;  3CMY A;  2K9N A;  5F0H A;  2IAI A;  4V2G A;  2YU9 J;  2CQQ A;  3HDD A;  5F0F A;  1IUF A;  2DMN A;  2GLO A;  1VI0 A;  2LY9 A;  3TP3 A;  2LD5 A;  2AHQ A;  1RKT A;  2E2H J;  1ZGW A;  4ABZ A;  1OFC X;  3HGY A;  3BR5 A;  3SFI A;  3O8H A;  3IV5 A;  1Z0X A;  1Y1W J;  2HDD A;  1GT0 C;  2M9H A;  1FJL A;  1OCT C;  3WHB A;  5C4X J;  3HOU J;  2JJ7 A;  1W0T A;  2NVY J;  1T33 A;  3GTO J;  3SJM A;  1GVD A;  1FEX A;  1ZR4 A;  1TWA J;  1VF9 A;  2LK2 A;  3QQA A;  4QTR A;  1ZK8 A;  3JRA A;  1S7E A;  4MFE A;  2EZH A;  1JKR C;  4C2M J;  1QPI A;  3D1N I;  3JRI A;  1ZR2 A;  2GM4 A;  3HOZ J;  5IYD J;  5IP7 J;  3B6C A;  2DA4 A;  2FJ1 A;  4BBS J;  4AUX A;  2ME6 A;  2JWT A;  5FJ8 J;  2LVS A;  2ELK A;  3OOU A;  5J1U A;  1VFC A;  5DS9 A;  2HOA A;  1ETX A;  1MBF A;  1SFO J;  2Y30 A;  4D5F A;  3ZQI A;  2HOS A;  1POG A;  5E3N A;  2JA8 J;  3HB9 A;  3BG3 A;  3BTL A;  2JA6 J;  1JKQ C;  3BT9 A;  5GP9 A;  2VKE A;  3ZQG A;  4JX6 A;  4XRS A;  3JRG A;  2L7Z A;  4A3J J;  5IYB J;  3VPR A;  1U78 A;  4XRS G;  2O9L A;  3S1N J;  1CQT A;  4IHY A;  1DU6 A;  4J19 A;  3MVP A;  2DA6 A;  2E19 A;  2OPT A;  4UUT A;  2KDZ A;  2ZB9 A;  1Q1V A;  1GUU A;  1HDP A;  2Y0S N;  2VUM J;  2NVT J;  4A3K J;  1Z77 A;  5EEA A;  3LSR A;  2EZL A;  2ECB A;  1P7J A;  1MNM C;  3S15 J;  2RAE A;  1YRN A;  1FIP A;  1B8I A;  1ITY A;  2ME0 A;  3BR3 A;  5JLX A;  2WV1 A;  2DA2 A;  2PMZ N;  3JRC A;  1GV2 A;  1BJZ A;  4A3D J;  1IJW C;  1O4X A;  3S1Q J;  3A01 A;  2MGQ A;  3GBG A;  3HGG A;  5F08 A;  2Y9Z A;  1X2N A;  2L7M P;  1WI3 A;  4BXX J;  2M34 A;  1YRN B;  2XGC A;  5F1J A;  2R5Y A;  2XB0 X;  1B8I B;  3A03 A;  3TP0 A;  2LLK A;  4M3B A;  4A93 J;  2JA5 J;  1BW5 A;  2HXO A;  4M6V A;  2TRT A;  3L1P A;  3A01 B;  4D5C A;  1JJ8 C;  5J3L A;  2Y9Y A;  1FTT A;  2FQ4 A;  2EZK A;  1U8B A;  4BY1 J;  5M5W J;  2R5Y B;  3OSF A;  1OJL A;  2CUF A;  2XRL A;  2XPV A;  4C3H J;  1EF4 A;  3BR6 A;  2R0Q C;  1IC8 A;  1X2M A;  2G0E A;  3BG9 A;  2L7F P;  4I76 A;  2XGD A;  3RZD J;  1JT6 A;  2N8G A;  3DEW A;  1IDY A;  1HLV A;  3CDL A;  2DA7 A;  5FLM J;  4DYC A;  5K7Z A;  4I6Z A;  1MBH A;  2COB A;  2DA3 A;  4XK4 A;  1G2H A;  3MN2 A;  4C3J J;  4FTH A;  1SAN A;  3G1L A;  5F04 A;  4S0H B;  2FD5 A;  2JK3 A;  2VPR A;  1I3Q J;  4Y52 J;  2LR8 A;  3BG5 A;  3HBL A;  1WGX A;  2H8R A;  4FCY A;  3NAR A;  2IEK A;  3HEF A;  5E3L A;  2M8G X;  3ZQH A;  4BKX A;  1W0U A;  1RES A;  1H89 C;  1JKP C;  3RKQ A;  1UMQ A;  5FKO A;  1FTZ A;  1K83 J;  2WAQ N;  4D7M A;  1TWG J;  3I4N J;  4L5E A;  5IP6 A;  2XGE A;  4AYB N;  3MKL A;  2EBI A;  2M0C A;  2CUE A;  1ENH A;  1ETV A;  2IBD A;  3BQZ A;  5E3O A;  1ETW A;  3ZQF A;  1RET A;  1MSF C;  3S17 J;  3FIS A;  1PUF A;  5E3M A;  4A3B J;  2DMQ A;  1U9O A;  3BTC A;  3RQI A;  3M4O J;  1WPK A;  5K7F A;  4X6A J;  1XG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...