2ME0A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens solved in the presence of the dna sequence cgactaattagtcg
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens solved in the presence of the DNA sequence CGACTAATTAGTCG
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2me0A00
1FJLA 3BTIA 5EYRA 1ETWA 2ID3A 4IHYA 4IHVA 1U78A 1BW5A 4MLOA 2FD5A 3IV5A 2HXIA 1ETXA 2ECBA 4AUXA 1U9NA 5F27A 2NVYJ 3HOUJ 5F08A 3ZQHA 3FK7A 1BL0A 1JUSA 3S16J 5C3EJ 2VKEA 5C4XJ 3BR2A 1ZTRA 2DN0A 3I4MJ 3CQZJ 2HXOA 3SJMA 1O4XA 2LLKA 2MW8A 1GVDA 3A01B 2H8RA 5DTDA 1T33A 1ITYA 2LK2A 1OCTC 3JRCA 4X1EA 1IJWC 1TWCJ 5F0HA 2DMNA 4FCYA 2XB0X 3MN2A 2L7FP 1NK2P 2WV1A 2M9HA 4NDLA 5IOZA 5FLMJ 2DMPA 1A5JA 2LY9A 2LVSA 3HGGA 2G0EA 3ZOBA 1PUFB 4A3IJ 3O8HA 1JT6A 3ZQGA 3JRDA 1BW6A 2WB1N 4LOCA 4XICA 4AYBN 2W48A 3BQYA 2OPTA 3OSFA 1K83J 4C3JJ 4RDUA 1BA5A 1APLC 3QPSA 5IYCJ 1JT0A 1X58A 4IHWA 2X9DA 2HYJA 2HDDA 3IH3A 3G1MA 3JRGA 1IDZA 3S1MJ 4XRSG 2XPVA 4Y7NJ 3D1NI 5DS9A 4BBSJ 1LFBA 2DJNA 2MSYA 1MBJA 4ABZA 1W0UA 5GPAA 3ZQCA 4I76A 3HKZN 3Q3SA 1JKQC 2XSDC 4FTHA 2GLOA 1ZR2A 4JYKA 2K9NA 2R93J 4B4CA 2XGDA 4XK4A 3TP3A 2EQRA 2NVXJ 3L1PA 2M34A 1MBKA 3S14J 4MO7A 3BG3A 1T56A 2CJJA 1GUUA 1JUMA 1IGNA 3A02A 3OIOA 4A3MJ 4A3GJ 3GTOJ 4C2MJ 1FTTA 4M3BA 2Y2ZA 4UUSA 1AHDP 2GM4A 1XG1A 3UKGA 2R7ZJ 1XS9A 3GTGJ 1POGA 2E19A 1SFOJ 3S15J 1JJ8C 3HOZJ 4M3EA 3LSRA 1BJZA 2HOAA 1TWGJ 3MVPA 3NAUA 4M6VA 2I10A 4BY7J 1QVTA 4DYCA 3M4OJ 3FISA 1RR7A 4A69C 3S1RJ 2E2IJ 5EF6A 1WCMJ 2JK3A 1LE8B 3G1LA 2QCOA 2ME0A 3GTMJ 4M3FA 3BR3A 3RZOJ 5IPAA 5JLXA 3BR1A 3VPRA 2COBA 2NOGA 1ETOA 2OF7A 1ZKGA 1U8BA 2R0QC 2ZB9A 4A3EJ 1ZR4A 1QPIA 1TWFJ 1TC3C 4W97A 5GP9A 3OSGA 2Y9YA 1MNMC 4XRSA 1WH7A 1HF0A 3JRBA 2JWTA 2GBYA 2N8GA 2XGEA 3BR6A 1FIPA 3A01A 5E3LA 2R5ZB 1GV2A 5EZHA 2YUSA 1H89C 1IDYA 2YS9A 5FKLA 2HI3A 1Y1VJ 3FKIJ 5J3LA 4A3JJ 4J19A 3SDGA 1NK3P 1MH3A 2KT0A 2IEKA 5M5WJ 3HOVJ 3Q0WA 4A3FJ 2DA5A 1ZGWA 1H8AC 3WHCA 2XRLA 3K2AA 2VUMJ 1I6HJ 4UUTA 1MBFA 4CYCB 1K61A 3BTJA 2CRGA 4DYRA 1ETVA 4IEJA 4B3AA 2DA7A 3HGYA 4W1UA 3WHBA 3HDDA 1H88C 4HNVA 1PUFA 2O9LA 3CMYA 4BXXJ 1HCRA 3PO3J 1MH4A 5C4JJ 3JRHA 2VI6A 5F0CA 2Y30A 2E2JJ 1EF4A 2EBIA 1ETQA 1LFUP 2JA7J 5FKNA 1AKHB 5J1UA 1G2HA 2NS8A 1MSFC 4M3DA 4GFBA 2EZKA 2NVTJ 4EEFG 1ZK8A 4FISA 1P7IA 5M3FJ 5M5YJ 3Q0VA 2AO9A 1MBEA 1Z77A 2Y9ZA 3TEDA 1RPWA 3DCFA 3SFIA 2DA4A 1B8IB 4A3KJ 1F36A 1WPKA 3TW7A 2EH3A 1Q1VA 1TWAJ 4AC0A 5EGOB 1JKRC 1NTCA 2X6OA 4B1RA 2XB5A 1E3OC 2K9QA 2DA3A 3HM5A 2L9RA 3BG9A 5FKOA 3HEFA 4DZPA 2E1OA 4QTRA 1OJLA 3W6VA 2L0KA 2NS7A 3BT9A 1Z0XA 1DU0A 3DEWA 4RBOA 1RESA 2LD5A 2AHQA 3S2HJ 2QF7A 1I3QJ 1JTYA 3F0CA 2DA1A 2LKXA 4MFEA 5E3NA 2LFBA 1ENHA 2VKVA 1S7EA 4BY1J 3A03A 2DTZA 3LNQA 4MIMA 1JKPC 5J1YA 2HQ5A 3ZQIA 1TWHJ 3GTLJ 2DA2A 3HOWJ 2D5VA 1LE8A 3TP0A 3JR9A 1IC8A 1B72B 5FJ8J 1QRYA 4JX6A 4MFDA 4L5EA 1VFCA 3CDLA 1MBHA 4G12A 3H3VK 2YU9J 2TCTA 2MGQA 1SANA 2E2HJ 4X6AJ 5EDNA 1UMQA 4JP0A 4DYQA 3C2BA 2O7OA 2ID6A 4D5CA 4QIWN 1VNDA 4D5FA 3GTJJ 2EZLA 3HB9A 1W0TA 5IP9J 1FIAA 1QVUA 3S2DJ 1FEXA 2ME6A 1GV5A 4BKXA 9ANTA 4BBRJ 2IBDA 1WGXA 3CCYA 5EG0B 2R5ZA 2HOTA 1JKOC 1X2MA 2JN6A 2K9SA 2LP0A 1IG7A 3BR0A 3QQAA 5GPCA 2WAQN 1UHSA 5K7HA 2M2EA 4A93J 4A3CJ 4M3GA 1RKWA 1MBGA 3I4NJ 3B6CA 1HDDC 2JA6J 2XPWA 1CQTA 3FK6A 5IYBJ 5BNGA 4CYCA 3HOXJ 4DZJA 2CUEA 5M5XJ 4A3LJ 2JJ7A 2DMQA 4C3IJ 1ETYA 1JJ6C 3JRFA 1IV6A 3E7LA 4C3HJ 4A3BJ 2DA6A 2MG4A 3LSGA 4A3DJ 5K7ZA 5FLVA 3RKQA 2EZHA 2LTPA 3PM1A 2H1KA 1AKHA 2O8KA 5FKKA 1ETKA 1RKTA 1WH5A 4QSHA 3HBLA 3IH4A 2XGCA 3FIWA 3H0GJ 2RAEA 3K7AJ 3RQIA 2FX0A 1ORKA 3LOCA 1WI3A 1DU6A 3S17J 2DMTA 1GDTA 3BR5A 1MSEC 3O8GA 1X2NA 2L7ZA 5F1JA 5K7FA 5J1RA 1B8IA 1XC5A 4IHXA 2M0CA 5F0FA 2CQQA 4D7MA 3G1OA 5EGOA 2CU7A 2PMZN 3GTPJ 4Y52J 3TW6A 2FQ4A 4XIDA 2L7MP 2R5YA 4FE4A 1RETA 1YRNA 3BQZA 3JREA 1HDPA 5IOYA 2M8GX 3IH2A 1JTXA 2JA8J 3M3YJ 2JMWA 5IP6A 5FKMA 4JX4A 5HODA 2R5YB 1VF9A 4S0HB 1OCPA 5M3MJ 1YRNB 3QPLA 3GBGA 3PO2J 5E3OA 1UG2A 2FJ1A 2TRTA 2HOSA 2ELKA 1Y1WJ 4D7NA 1P7JA 3RZDJ 1VI0A 1JGGA 1JUPA 2Y31A 3GTQJ 1U9OA 2IAIA 3Q0UA 1B72A 1OFCX 2LR8A 4V2GA 1IRZA 2R92J 2NVQJ 2KDZA 2CQXA 2EZIA 2K40A 3GTKJ 4XRMA 3BG5A 2VPRA 5F04A 2B63J 1HOMA 3BTLA 1FTZA 2XPUA 1R9TJ 3OOUA 2CUFA 2P81A 5C44J 5EEAA 4I6ZA 3JRAA 1D5YA 3S1QJ 1A6IA 3ZQFA 5IYDJ 5JLWA 3JRIA 1GT0C 1AU7A 2X48A 5EZGA 1ZQ3P 3S1NJ 2ECCA 4FE7A 5EG0A 2JA5J 1I50J 3B6AA 3MKLA 4UUSB 3HOYJ 1HLVA 3LSPA 4V2FA 2Y0SN 2DMUA 3LSJA 3ZQLA 4DW6A 1F43A 5IP7J 1IUFA 3BTCA 3NARA 5E3MA 4JX5A
chains in the Genus database with same CATH superfamily
1SVLA 2XC7A 1FJLA 2LSOA 4PJ0C 5EYRA 1Z67A 3OYDA 3R0JA 1DPRA 2DFHA 1DGWY 5E79C 3M1EA 3CJRB 3K4BA 5FB2A 2HTSA 4IRHA 2DDAA 2X51A 3N05A 3R6SA 1U9NA 5F27A 4BHCA 3HOUJ 3V7CA 5F08A 3W6JB 3DBLB 1JUSA 4Y15A 3JAMZ 4E7ZA 4RGXA 3J81K 4OIRF 4F3QA 5C3EJ 2VKEA 3AKZA 2AXLA 2YU3A 4BE0A 1ZTRA 1D0XA 2DN0A 2L02A 1K79A 3SFZA 3CQZJ 1UFMA 1O4XA 4A6DA 2LLKA 1KQ0A 2LK2A 1D5VA 2IS4A 4X1EA 2PMHA 3FBIB 1IJWC 1R49A 2DMNA 4GYIA 1V54H 1E17A 4J01A 3OYBA 1WQ2A 2E1CA 1LKXA 1R00A 2CQNA 4NDLA 4N4OB 4G6DA 4ENJA 1NK2P 3I58A 4MNUA 5DEQA 2LBFB 4Q47A 4PGGA 3I56I 2DMPA 5CJ9A 1S6LA 2A6EF 3R60A 4I98B 2XF7A 1PUFB 1VZ0A 1JT6A 3ZQGA 3JRDA 2HVQA 2R7DA 3HPGA 3AG1H 2HPIA 3WTSC 4LOCA 4XICA 2W48A 3BQYA 4BDZA 1SFXA 1BA5A 1R7JA 1W7PD 3QPSA 1JT0A 4OAZA 4IHWA 2H94A 2DJIA 1FWZA 4AU7A 4AWXB 3E6DA 5HDKA 4V19K 3S1MJ 4EJUA 3D1NI 1SAXA 4YFXF 3M1CA 1IN8A 4BBSJ 1P2FA 2GQQA 3HTSB 3F22A 2FXAA 2MSYA 4ABZA 1DGRM 3F9KA 4I76A 2HKXA 1UELB 3CDHA 3HKZN 3GLXA 1XPXA 4HOBA 3KIOA 2R93J 3BJOA 3F8CA 3VSKA 3A0HC 1MBKA 4MO7A 5TRDA 2ZXWH 3PSFA 4G6TB 4KT5C 2VKHA 3HOSA 1WJFA 4M3BA 1AHDP 4CCOA 1ZGJA 1VQ4I 3KZIC 2BY0A 4ESJA 2E19A 1MNDA 3WTUC 3CUQC 3HOZJ 4M3EA 1XCVA 3OYNA 2L3DA 2HOAA 2JPBA 1BN5A 2CFXA 1EA3A 2K3FA 4XKWA 3BPXA 1W5TA 4DYCA 2WY7Q 1K7AA 3JAMK 2X85A 2QZ8A 2R7VA 1WCMJ 2JK3A 3G1LA 3DXJF 1JE8A 5J40A 4M3FA 3RZOJ 3QODA 3K0LA 4LGWA 5IPAA 3BJ6A 3SHFA 4HX8A 4BDYA 2AQFA 3QP6A 2KIMA 2OF7A 1U8BA 2O6GE 2ZB9A 2FU4A 1I5ZA 3HIFA 5JR3A 1C0WA 1OCCH 2YX7A 2V9PA 3HC7A 2DK8A 3ZMDA 2UZKA 1WH7A 1Z7UA 1HF0A 1N78A 1MKMA 2JWTA 3FM5A 3PNYA 3CCSI 4II3A 1LDKB 3WU1B 1LFPA 4BQNA 2DTRA 3WTXC 4UNOA 5J6XA 3K4NA 2R5ZB 4XLPF 5EZHA 2J5PA 2YUSA 4MTDA 1K4SA 5FKLA 1X19A 2A6TA 3W2VA 3VB2A 3HSEA 3OYEA 1UJ8A 1IN5A 4QWQA 4NNJA 4EVIA 1J0RA 2X1EA 3HYIA 1T6SA 1FOWA 2IEKA 4MGRA 5M5WJ 3F8NA 2L5QA 1O3RA 2ETHA 1H8AC 3HOVJ 3WHCA 3OYAA 2VUMJ 3NWSA 1I6HJ 3RI4A 2LBFA 1Z3YA 3DTIA 3OL3A 1P4WA 1J2XA 2CRGA 3TDUC 2BVMA 4DYRA 4IEJA 2DPUA 2DAOA 3HGYA 1ON1A 1QZEA 2P5KA 2E5NA 4M6YA 1PUFA 2HQRA 3F3XA 1PP8F 3PO3J 4HBLA 5C4JJ 1MZBA 2VI6A 3VODA 4NBQA 2VQCA 2WADA 1LJ9A 5F0CA 4A12A 3K70C 2Y30A 4E70A 2E2JJ 2MLGA 2EBIA 4WXDA 1ETQA 3WTTC 1IXSB 1R4NB 1MSFC 1QZYA 4GFBA 1EH6A 1XDUA 3GZ6A 2OBPA 5M5YJ 2FNAA 2AO9A 1OPCA 4G6QA 4BNCA 2HTJA 3I9V2 1RPWA 2O03A 3DCFA 2MYSA 2WWYA 4A3KJ 1F36A 4TV7A 3CO7C 1X1AA 2EH3A 1TWAJ 3CCQI 2ZBKA 3MMYB 1X1PA 4AC0A 1QO0D 1WWXA 4Q5SF 1K4TA 3H5RA 3FXMA 1E3OC 3ABUA 3OR1C 3HM5A 2R3SA 1WHUA 4QTRA 2R7WA 1OJLA 1OISA 3W6VA 1DU0A 2EFOA 2DDBA 2HWVA 3TMOA 1U3EM 2D45A 2DA1A 2HDWA 2LKXA 4IHTA 2PEXA 1BIBA 1D8KA 2R7OA 1H9TA 5TGTA 1YYVA 2XAUA 1Z21A 4WK8F 1K6YA 3I64A 2FMLA 3BCBA 3KPHA 1NH3A 4B44A 2WB1A 3VDXA 4NC8A 4P55A 4AYBA 3ZQIA 4LLNA 2V79A 4HAMA 2C6YA 4LMYA 4UHTA 1MDMB 5FJ8J 1UHMA 2A68F 4L5EA 3OIPA 3WGHA 1VTNC 2OCEA 9ANTA 2TCTA 3WODF 2K4BA 3SYTA 2W24A 3IRQA 4E7HA 2NRAC 1DQUA 4RGSA 4O5VA 2GZWA 2QQBA 2IGMA 3FXLA 3LSTA 2VKDA 4BS9A 4EJVA 5E1WA 4BH9A 3GTJJ 1J59A 1WVRA 1FC3A 4I0BA 2W4SA 1Z6RA 3S2DJ 2ME6A 4I0AA 4DBRA 2YX4A 2IBDA 5EG0B 2R5ZA 4AVZA 3PUFA 1JKOC 4LD5A 1F9NA 4L0ZB 2KLOA 2LP0A 4UUVA 4HX7A 3CJTB 5CVJA 4M71A 1SC7A 1RNLA 3QQAA 4C2UA 2GOMA 2M2EA 3QPHA 4L18B 4A93J 4IZZA 3IRRA 3C3WA 2QVOA 2OQRA 4EATA 5K5QA 1OMIA 5L3EA 1W1WE 3B6CA 4OAYA 3FK6A 5IYBJ 5BNGA 3HOXJ 4DZJA 2VL8A 3DV8A 2Y0MA 4HQEA 4Y33A 2FRHA 3F21A 5DDGA 1JJ6C 5A2QZ 4CXFA 2IGNA 1VQLI 1WJ5A 5ILUA 2VT3A 2V6CA 2LMDA 1UG0A 2VJIA 4A3DJ 1HA8A 3SEQA 4BE2A 3RPUA 5HDGA 4YG2F 5FKKA 2E1MC 2ZNZA 3ELKA 3CMEI 1KYWA 2JRMA 2RAEA 1BR1A 3C7JA 1LVKA 4CYDA 4ENNA 2V26A 2XGXA 2PJPA 2VJJA 1DU6A 4RAYA 3C1DA 4OU0A 3OWTA 2CWEA 3CC4I 3O8GA 2L7ZA 4OINF 2M0CA 1R4MB 5KNLA 2H6BA 2EJRA 3DWLE 3IWFA 3EYYA 1TNSA 4HSTA 3GTPJ 2FQ4A 3D5RC 4U7BA 2O61A 2OUMA 1T2KA 5FD6A 1KU9A 4U0VA 3U21A 1RETA 5D5WB 3IAS2 1LDDA 3K2ZA 1R6RA 1T08B 5IOYA 2M8GX 3IH2A 2JA8J 3QOEA 1P9QC 1WJEA 3E1SA 2W25A 1TNTA 4RGRA 5H6QA 2VASA 3KLOA 5JVTA 4UV9A 1VF9A 4UB6C 3U1DA 5M3MJ 3GBGA 2KL4A 2ZKZA 2KIQA 2GIVA 1G3YA 1W7PB 1ULYA 2HOSA 3FMSA 3C18A 3PIPF 2I5UA 2WA0A 1S3JA 3FM3A 3AL0B 1Y1WJ 1P7JA 3RZDJ 3CJNA 2WTEA 4UV8A 3M8EA 1JUPA 4JK1X 2VQGA 1X3WB 3ZN0A 3MEXA 3GTQJ 2FOWA 4IRIA 5AIPA 2CH0A 2K86A 1T0FA 4RLQA 2GAUA 3HUGB 3K4KA 1W4MA 3FKJA 4KMUX 4XKVA 4Y4RA 3T1BA 1MDMA 4KYWA 1D3YA 2R92J 1NG6A 2NVQJ 3VYUB 4ZYGA 3M9AA 4HA8A 3C2GA 5F04A 3LA3A 3MCZA 1HOMA 2LKSA 4YFKF 1ON2A 5LHIA 2E36A 1FTZA 2QKLB 4KISA 1R9TJ 3OOUA 1DPUA 3CCVI 2P81A 2GXAA 4KNYA 2LG4A 3MZYA 4A0XA 1D5YA 1J7KA 1A6IA 2ELHA 2YPRA 1ZRCA 2HDCA 1GT0C 3T8TA 3EQLF 1AU7A 1S7OA 3S1NJ 2ZJRF 1ONVA 3DF8A 1VQ7I 4ENKA 2JA2A 4YIIA 5JVGF 1R22A 2LOOA 2COMA 5EG0A 1I50J 3LSMA 4G8XA 2VOOA 4XM3A 5DCFA 3RDIA 2KHMA 1BI0A 5A2QK 2HQAA 2OA4A 3V42A 3FZVA 2E1NA 2ZSHB 2XAHA 2ZC2A 3P9IA 2Y0SN 1OCOH 4JQFA 3VYRB 2F5DA 3JTGA 2BYVE 3LMMA 1ZRFA 3ZQLA 4YIRX 1EJ9A 1YX3A 1GXQA 1CGPA 3HL2A 3KE2A 5HS7A 5K5RA 2BY1A 3HPHA 3Q9SA 1YIJI 2IW5A 3TOBA 3FXJA 1ZG3A 1YITI 5H20A 3G4SI 1FOYA 3OYHA 2VJ4A 1DDNA 3GWZA 1BW5A 3ZCOA 1B4AA 3IV5A 4AUXA 1S29A 3L9FA 4Z2YA 2NVYJ 1YG2A 1TTYA 2BHYA 3FK7A 4HF0A 3IL2A 1WKMA 3BDDA 3RKXA 3BROA 2JPCA 2X6WA 3FF5A 3E6MA 3I4MJ 2B9SA 2MFZA 2W84A 3SJMA 3ROUA 2OQGA 5DTDA 2DT6A 1T33A 1J5YA 1ITYA 3OS1A 2DYRH 4WF2A 4BUPA 3H9JA 4CICA 2H27A 1TWCJ 5F0HA 3DEUA 4XOPA 3WTVC 2XB0X 2XF6A 2GXGA 2OJED 2NAZA 3CDIA 3TOAA 1JI8A 1TLHB 5ICEA 2XSJC 5FLMJ 2WAQA 1USTA 3KYCB 4XKCA 3CF5F 1F4KA 2KMUA 2LVSA 5CVIA 3ZOBA 1E3HA 1BW6A 4PJNA 1U0JA 1XGMA 3GFJA 1YIOA 2CUJA 1W7PA 1UHWA 3OSFA 3MKYB 1K83J 4PSWA 4RDUA 3V8LA 3ZRGA 2EFQA 2Z5UA 2DPDA 4ZC3A 2M3AA 3CCUI 1YJ9I 3G1MA 2CG4A 5BQTA 5CQGA 3HUGA 4XRSG 4Y7NJ 5E8GA 3TO7A 3FHNA 3QP5A 4LG3A 1V55H 5LEJA 1MBJA 5J4YA 3ASOH 3ZQCA 2CO5A 1G8XA 1JKQC 2XSDC 1KZHA 1SD7A 3K6GA 5TJJA 1Y56A 4JYKA 2K9NA 3PNVA 4CZZA 2MBFA 1WRJA 2Q2EB 1D1AA 4XK4A 3TP3A 1HSJA 2NVXJ 2YR2A 2PMZA 3TGNA 3S14J 4EV0A 3BG3A 2R7QA 1ZG5A 2QYOA 1IGNA 3X2QH 2ADUA 3OIOA 4A3MJ 1KQ8A 3AG4H 3ZMVA 2Y2ZA 2F4MB 1XX5A 3LAJA 3GLLA 4RLFA 5CQEA 3S32A 4B47A 2R7ZJ 2A5YB 3GTGJ 2IXSA 3S15J 2ZMEC 2LKPA 3ABLH 2RNGA 3CP2A 1ACIA 4BY7J 4IO9F 1E3PA 2EV6A 1WJBA 4A69C 4F91B 2NNYA 1R36A 2L9NA 2QCOA 2ME0A 3DFGA 3I54A 3DEEA 4HZFA 2H8WA 3BR3A 3KFWX 1PUEE 3N4MA 5BPDA 4QPOA 5JLXA 5E1XA 3DBHB 1O3TA 4LFUA 5DV5A 4HPQA 2QSFX 1R5ID 1ZR4A 5F6FA 3BJAA 5L3CA 2VE8A 1TWFJ 2XKOA 1S5LC 4U88A 2MC4A 2P0WA 1MNMC 2CS3A 3JRBA 2DU9A 5LGTA 3OYCA 1YTYA 2ZO4A 2MD5A 3J7YJ 2NOJB 3I53A 3K70D 2WAEA 4XLAA 1IDYA 4I01A 4AIHA 4NHJA 1Z9CA 4PCQA 4EJTA 3FKIJ 4DOZA 4KICA 2DT7B 1IO2A 3F6VA 1MH3A 2ICWG 1X3ZB 2DYSH 2V1UA 4RB1A 1XGSA 4I7HA 3Q0WA 3ZMZA 1V5FA 3KYDB 1P4XA 4UUTA 4N4NB 3BY6A 4IF4A 1K61A 5HS9A 3H35A 2K27A 2VLAA 2OTJI 3OY9A 1SMYF 3GVAA 2KP6A 4HQMA 4B3AA 3HDDA 1XB4A 1R5GA 2M4KA 2O9LA 2B7EA 3RIRA 1SD5A 5ICFA 1MH4A 3O3KA 4ITVA 3JRHA 3I5UA 5DUKA 2GA2A 4G7OF 3K1MA 2CGPA 1G2HA 3MAJA 2D2WA 1Z6TA 3ERED 3OYJA 2NVTJ 4HV5A 4FISA 4HNUA 1USSA 3IKTA 2CW7A 3P7NA 1YFHA 4Y13A 2ESHA 2EK5A 2IVMA 2Y69H 5D8KB 3E3VA 4WXHA 4D9JA 1L3LA 1FYKA 1KONA 3Q0VA 3L2QA 3V8JA 5CLSA 2IP2A 1LEAA 1QNTA 2DA4A 1W36C 1WPKA 2HR3A 3TW7A 1FBUA 5J8CA 5LFAA 5K1YA 5EGOB 3QPTA 4ETSA 1JKRC 3F72A 4XSZF 2EIJH 4M9XA 4DGWB 4J00A 4HF2A 2DA3A 3EETA 4EM1A 2Q2EA 2ZMEB 2M7BA 4DZPA 2IA1A 1FT9A 4XLFA 3R61A 3BPVA 2QSHX 2L0KA 2WC2A 4BQQA 2L9VA 1WFXA 3PNTA 1RESA 5DUIA 1Z7LA 4HLXA 5D5UB 3PJRA 4Q48A 5HNFA 2FE3A 4H4KC 1ENHA 3ZMSA 4B3XA 4LB6B 1I3AA 2BXZA 1U5TC 3A03A 1W5SA 2OV7A 1EH7A 2FSWA 4MIMA 3OL4A 3V4GA 1YO5C 4E6KG 1R23A 3H3UA 4RM3A 4U0WA 1KYZA 5J1YA 2R7XA 3S8PA 1KQ9A 3S3NA 3GTLJ 5DD4A 4EM0B 3EYIA 4QPQA 3LL7A 1B72B 1QRYA 1BI3A 2LH9A 4JX6A 4MFDA 3OR2C 1D0ZA 4A5MA 3HJEA 2VC0A 3RKYA 2L4MA 4XLNF 3H3VK 2RC4A 1SANA 2M7AA 4X6AJ 5EDNA 1UMQA 3S3MA 4D5CA 2IS6A 3OYFA 4Y3OA 2OZUA 1VNDA 1E0EA 3BLYA 3G3ZA 1UCRA 3OYMA 4MEXF 3VWBA 3QU6A 1W0TA 2JVGA 1LDJA 2CV0A 3G6EI 1FEXA 1T0FC 3ERMA 1GV5A 1BOBA 4PUSA 4BBRJ 2HOTA 4XQFA 2W00A 3AG3H 4C9YA 4OMZA 2VN2A 2P6SA 2XHKA 4DQ2A 3DBRB 1N75A 4ENMA 5K7HA 2BV6A 1UZCA 1IZ1A 2XRNA 2DO7A 4NQWB 4D1QA 4ZJZA 5CPRB 1I39A 2XPWA 1IRFA 4FASD 1ZN2A 2CUEA 4A3LJ 2JJ7A 3LSKA 2QENA 1A31A 4HEA2 1VQPI 4C3IJ 3KYLA 3L2VA 2XAQA 3E7LA 3F8BA 4K2EA 4CO8A 4A3BJ 2VBXA 5KVRA 2DA6A 4CCJA 3I3LA 3CCRI 3H9GA 3IUOA 1LB2A 2AS5F 4PJMA 5HLTA 4P96A 2EZHA 1GXPA 4GRIA 5E18F 2FOKA 3HSRA 2HU9A 3H5NA 4NB5A 4QSHA 2V4JC 3HBLA 2XGCA 3H0GJ 4AIKA 4ESBA 2M0MA 3J80Z 2KQRA 3OS2A 2FX0A 4ZDOA 3G2BA 3LOCA 1WI3A 2V1NA 1TT5B 3KZZA 1I1GA 4UVAA 1GDTA 2IGOA 1MSEC 3KP4A 1BJAA 3PQJA 1UB9A 2DXIA 5EGOA 2P7VB 4ZDPA 4Y52J 2LF7A 3D5LA 5BS6A 1ODDA 1SAUA 3CESA 1EV7A 3DKXA 1IW7F 3FBNB 5J8FA 3OYIA 4UB8C 2KJCA 1U5TB 2WY8Q 2ZMEA 1Z1DA 3ULQB 4HX4A 2HFHA 2EA2A 4UVCA 1HSTA 5H6RA 5B3SH 1IRGA 3KP3A 4UXNA 3K9TA 5B1BH 3SXYA 2IS2A 3FXKA 3PO2J 2BW3B 1EH8A 4IPAA 4LG0B 3ABKH 2JTVA 1ZGAA 4EJWA 2R7UA 1YJNI 1HBXG 2OCCH 3VYTB 3JW4A 3IC7A 5EJCA 5GAEJ 3FXUA 2CQ7A 2OAZA 3TDZC 2ZJQF 2MABA 1SFKA 1ZH5A 5JFRA 1R71A 1B72A 3P9CA 1OQYA 2I8DA 4V2GA 1U2WA 2KDZA 2LF8A 1FMVA 2HEOA 3GFLA 3GTKJ 4XRMA 1WI9A 4F93B 2XF5A 1R1UA 2DOAA 2MH2A 2QQ9A 4LIVA 4KITB 1Y8QB 2B63J 1YE9A 2XPUA 2BVLA 3GYHX 3AL0C 1FYLA 3R4KA 2E60A 2HNHA 3H5AA 5JLWA 2FQ3A 2X48A 3DKYA 2EIKH 4NUBA 4FE7A 4M72A 1RUNA 2ZNYA 3CD6I 4E7SA 1OR7A 4O6JA 3K4CA 2JA5J 1Y0NA 3I71A 3KLNA 1D1CA 2DW4A 4P9UA 4IXAA 1TW2A 2LREA 4XLEA 3VFZA 2PN6A 4FX0A 3UR3C 4GCVA 3SEZA 1CF7B 4N9IA 4NQWA 3SDBA 3U9GA 2X6YA 1F43A 1S72I 4B8XA 3BTCA 3W3CA 3NARA 5H2FC 4LLLA 3LQRA 3BCAA 5E3MA 1YS6A 2R7SA 5IY5H 3J80K 1ETWA 2LNBA 2EB7A 4P5OA 3N97A 2A05A 2K7LA 3S3OA 3GMEA 4E7JA 3KEYA 4PSXA 4IHVA 1U78A 3A1YA 4C30A 2W1OA 2FD5A 4BU2A 1BR2A 1ETXA 1GVJA 5HLIA 4GDFA 2UWMA 2BEOA 1L0OC 4NC7A 4BEHB 4XNFA 5FFXA 3BR2A 2BHZA 3HHHA 3UNGC 1T95A 3LAPA 2DOFA 3QWLA 3G71I 1HW5A 2ZJPF 4EGYA 2MW8A 2JSCA 4KDPA 3QOPA 3ZPLA 1SVOA 1FP1D 3TL4X 1Z3XA 3QRFF 3A4CA 4HG2A 3JRCA 1ZAOA 1VQOI 5CVUA 1I27A 1W5CC 3JTHA 2DOEA 2CV2A 2ZFUA 2L7FP 2BE5F 2WV1A 3WGGA 3HSFA 4CA0A 3CLQA 2M1BA 1GLNA 1U5TA 1IRXA 2MC3A 2R7RA 3E5QA 1OCRH 5HVQC 1A5JA 5DM6F 1B9MA 1BR4A 2JRTA 3HGGA 4HYEA 3DQVC 2G0EA 3F6OA 1BC7C 4U7DA 4A3IJ 3DLAA 1GHCA 2WB1N 1YJWI 2E7XA 2BW3A 2JVHA 2ZXIA 4AYBN 4LG0A 2DT5A 2RNJA 2XAJA 1BM9A 4IOAF 2UUZA 3A2KA 4IJAA 1FMWA 1APLC 5IYCJ 4PGHA 3SQNA 1X58A 3ECOA 3K4MA 2X9DA 3ZMTA 2HDDA 4Z6YA 3IH3A 4D0PA 5KAIC 2K9MA 3EUKL 1K6OA 2ZSIB 1IDZA 2NYXA 2V1DA 4YELA 4E7IA 2XPVA 3FHZA 1Y39A 5F1RA 5DS9A 2X0LA 4XSXF 3S2WA 2DJNA 2E34A 1ZRDA 2LYCA 2Y75A 1PDNC 1G6NA 5GPAA 4ZDLA 2D1HA 3Q3SA 3QAHA 3ASNH 2GLOA 4NC6A 4CGZA 5DYMA 1TP4A 2XGDA 4R79A 3L1PA 2HKOA 1KGSA 3KP2A 4N9HA 1KU2A 1Y8RB 2CJJA 1JUMA 4BHBA 2RV8A 1KU3A 2GWRA 2XROA 4A3GJ 1VQ6I 4C2MJ 1FTTA 2A3SA 4Y17A 2OU2A 5ICGA 4WCGA 2B0LA 4AVPA 4IOCF 4ZYHA 3I0TA 2OTLI 2M30A 2KRHA 1JJ8C 1CF7A 3LA7A 3L2RA 3Q5FA 3LSRA 2A69F 3MVPA 2H6CA 3NAUA 4IHSA 4O3MA 2I10A 3F23A 3CLOA 2NXNB 3DTEA 3SZPA 3M4OJ 2R7FA 3FISA 1OYYA 1RR7A 4KFCA 2EILH 2ACJA 2E2IJ 4LITA 3PL8A 2P4WA 2KISA 3LFKA 5E1ZB 3F8FA 5EF6A 3GTMJ 4OIQF 2X1CA 5ILSA 1QBJA 4WWCA 1G59A 2MLKA 3CZ6A 2Z33A 2EA4A 3DP7A 3ABMH 2COBA 4L9NA 1QA6A 3IKVA 2VBWA 2RQPA 1ETOA 1VQMI 1ZKGA 1XN7A 3MD2A 2KPMA 4MQVA 4A3EJ 5LHGA 2BGCA 4UVBA 1IXCA 1HKQA 1FBSA 1TQMA 2UV1A 3BG6A 4BEHA 1TC3C 5GP9A 3OSGA 3L2WA 2GBYA 2VJ5A 1SEUA 2N8GA 2GXBA 2RGVA 1BI1A 3E6BA 3OYKA 3BR6A 3RCOA 1QGPA 2EINH 1J75A 5GTHC 4RB0A 3WU2C 5J47A 2KDOA 4L9TA 5J3LA 4JBAA 4IVNA 2DLLA 3DU5A 4A3JJ 3LSIA 1FX7A 1NK3P 2V1XA 1B6AA 3EUHA 4RS8A 2KT0A 2FA5A 1TQPA 2V7FA 3CUOA 3VYSB 4RA2A 2K02A 4A3FJ 2XRLA 5KK1A 1K78B 3I4PA 1MBFA 4CYCB 3BTJA 3E0JB 1IV8A 3NQOA 2WAFA 4KUMA 1ETVA 1QHGA 2DA7A 4W1UA 4P1WA 1H88C 2PJRB 2JUGA 4HNVA 1FNNA 4BXXJ 2XV4S 1XMKA 1HCRA 3H36A 2ZJ2A 4BXFA 3LQQA 2O3FA 2Z99A 1O3SA 2HPMA 1P4AA 2BBYA 1FLIA 3PSIA 4XONA 1Z05A 1EF4A 1LFUP 1V4RA 5DCMA 5FKNA 4EQQA 3WG7H 1TW3A 2EZKA 1T38A 1FY7A 3HXLA 4EEFG 2QWWA 4RMNA 1AWCA 5D6FA 1ZHFA 1MMDA 2Z3YA 2VODA 5M3FJ 5BPIA 3EDPA 1X1CA 2XVCA 1VQ8I 2GIZA 3EUAA 1KU7A 3TEDA 3H1CA 4MHGA 4I2OA 3GCMA 1Z91A 4JOMA 3J81Z 1OLTA 3P9KA 1X1BA 3GX4X 2STWA 1OKRA 2MH9A 1XCBA 3CP8A 1LPQA 2V6EA 2KRFA 4HNTA 2X1DA 3E97A 4E7KA 1NTCA 5BOXA 1ZYRF 4B1RA 1XDSA 4U0YA 1VQ9I 2CMPA 2XB5A 3L00A 2K9QA 1TQIA 4ON0A 1OYWA 5FKOA 1IAWA 2O0YA 3L7WA 3VEPA 2E1OA 5FGMA 4WX9A 1V5EA 2XAGA 3TBIA 5LRSA 1YX5A 2P5LC 1Z0XA 4PZJA 3DEWA 1O7FA 2AHQA 3HTUA 4LB5A 5HLGA 3S2HJ 1I3QJ 2X4HA 3DPLC 3O2PE 1MMSA 5E3NA 1TZLA 1SFEA 5B1AH 2ZXHA 2G7UA 3L2CA 1FPQA 1MJ9A 1S7EA 2QLZA 3MWMA 2R4GA 3LNQA 1T8IA 1R1VA 2QQ8A 3J7ZI 2HZDA 3IP4B 3T8RA 2XUBA 1TWHJ 2VE9A 3R0AA 2DA2A 3DLLF 5GAGJ 3HOWJ 1AA7A 4RAFA 3TP0A 3OYGA 3JR9A 2F2EA 2QKMB 5JHFA 1RUOA 4G7HF 4GGGA 2L9SA 2OD5A 1MBHA 3TO6A 2E2HJ 1HW1A 2VIXA 4DYQA 3FXRA 1SVMA 3CTAA 2HYGD 2ID6A 4FX4A 4QIWN 2K85A 3U2RA 2VQHA 3HKZA 1WSUA 3BC8A 3HB9A 3KP5A 2JT1A 2K3PA 1S9HA 2NNNA 4B48A 5IP9J 2RN7A 1QVUA 4CCNA 3HHGA 3MZHA 2F4IA 1D0YA 2KRCA 1WGXA 4BJTA 5B5EC 2VBYA 4BE1A 2R7TA 3I59B 3RTRA 3MFKA 2LRDA 3J7AY 1N77A 2JN6A 2K9SA 1IG7A 5D4SA 3BR0A 5GPCA 2WAQN 5GADJ 1UHSA 4A3CJ 3ABTA 1RKWA 5FFZA 2KIUA 2FUG2 4YRVA 3I4NJ 2M87A 3BOQA 3GXOA 2A07F 1HDDC 2JA6J 1B59A 1CQTA 1K78A 4KN7X 4CYCA 4CHUA 2P7CB 1WJCA 1QPMA 1ZARA 3PQKA 3C2HA 5EEGA 5TISC 1H0MA 2PJRA 4CCMA 1ETYA 1LNWA 2F5FA 3JSPA 3MKZA 1OR7C 3ESWB 4C3HJ 3KZYA 4WXCA 2KZGA 2EV0A 1MJAA 4YEJA 1X4PA 2MG4A 3LSGA 1HKSA 4XBFA 5LEKA 5K7ZA 2QUFA 3IHUA 5FLVA 2O8KA 2ESNA 4S05A 2EFNA 2WBMA 3L2UA 3F8MA 3TKYA 1WH5A 1PYVA 3IH4A 4I09A 1FSHA 3K7AJ 4XL9A 1O7LA 4MQ9F 4PJLA 3GO5A 3D5SC 1SD6A 4ZTJA 4YIFA 2IGKA 3BR5A 4B09A 4IHXA 1X2NA 5F1JA 4KIBA 5K7FA 2VT2A 2K9LA 1XC5A 2VB6A 5F0FA 2RQQA 2CQQA 4RAGA 1MMAA 4F52A 4XORA 1HW2A 2EV5A 3G1OA 3VOEA 2CU7A 2PMZN 3DKWA 4I02A 3CCJI 1O3QA 2L7MP 3V8KA 3K10A 1WJAA 2OC6A 3ISPA 2R5YA 3AFHA 4FE4A 2VOPA 3ZR8X 1YRNA 3BQZA 3JREA 3MKWB 1F1ZA 1FYMA 5BMZA 1HDPA 1WZ2A 1H9GA 2Z16A 3OMYA 1A36A 3M3YJ 4RB3C 2HS5A 4FQGA 5FKMA 2E71A 2EFPA 3AG2H 5HODA 3G73A 4BL0B 4S0HB 1BBYA 2HOEA 5KAFC 2BXYA 4IX7A 3OV8A 3QYBA 5E3OA 1UG2A 4ZH4F 2TDXA 4HSRA 4RAZA 2ELKA 2F5CA 3RJPA 4D7NA 2P5VA 1VI0A 1JGGA 3DPUA 2W57A 1RIOH 3GW2A 3DU6A 5ICCA 2Z2SB 4DIQA 4M6XA 2IA2A 2WV0A 4OWRB 4XOTA 4F92B 4DNCA 1XMAA 2CQXA 2EZIA 3CCLI 1REPC 3CC7I 2K40A 5ILVA 4BJ5C 1X3UA 2HZTA 4A2UA 2CW8A 3BTLA 3KCCA 4A0ZA 4LK1F 2CUFA 2PMUA 2Q8KA 4AD9A 5EEAA 3JRAA 2K5CA 5IYDJ 3M8FA 2Y48A 1RZ4A 5EZGA 1ZQ3P 2ECCA 2QBYB 5LD2C 4CSWA 3HRSA 3ZMUA 2E5ZA 2LY1A 5L3DA 4IKFA 3A0BC 3B6AA 3GZ5A 3I59A 3MKLA 1XTAA 4UUSB 2D1VA 2HQNA 3ZXSA 4RB2C 3HOYJ 1FZPB 3EPZA 3TQNA 1HLVA 3DTKA 1ZELA 3PIOF 2BOLA 3LSPA 1Q1HA 2L01A 3ML6A 4PFPA 2DMUA 4KMFA 4DW6A 5AONA 2W85A 1IUFA 4LK0F 4XLHA 4OMYA 2Z1DA 2MD0A 5FROA 5D8LB 1E2XA 3BTIA 3HRUA 2XKPA 2ID3A 4M9ZA 3W6KB 1G3TA 3FDYA 3LA2A 4LIUA 1A35A 2IT0A 4IHYA 2L2OA 2AQEA 3BWGA 3D0SA 4M73A 4MLOA 1XSVA 3M7GA 4LLGF 2HXIA 2ECBA 1FP2A 3KEOA 4BHPA 1XD7A 2DBBA 1QHHD 3ZQHA 3FMQA 1NHAA 3ZQQA 2PI0A 1BL0A 2M4GA 3S16J 3LSHA 5C4XJ 5CVVA 4C2TA 4EGZA 3RPQA 1BIAA 4XN3A 3COAC 3K4LA 2HXOA 3M8JA 1IN6A 1IXRC 1GVDA 3A01B 2H8RA 2FBIA 3FXOA 3HRTA 1OCTC 2IPQX 2F5VA 2CQKA 2OZ6A 2CV1A 4FCYA 3MN2A 2M9HA 2FF4A 2M8EA 4RM2A 5IOZA 1JHHA 1DUXC 1X4OA 2NS0A 1R58A 3GFMA 1QU3A 5LBQA 1DP3A 5FRNA 2P6TA 1ZG1A 4BACA 2LY9A 3V7SA 2DODA 4KIFA 3O8HA 3BZKA 4GYGA 1TT0A 1TL8A 4BQAA 2OPTA 5J4VA 2IA0A 4AIDA 4C3JJ 4CDGA 4MEYF 5CYVA 2E7WA 3ECHA 3EUHC 4PFOA 2QGUA 1HXDA 4XN0A 2CYYA 2HYJA 5LGNA 2DFIA 3FWEA 2DFEA 2CSOA 3E5XA 3JRGA 1MNEA 1HC8A 2DFFA 5AIQA 4FT8A 1IUYA 2VQLA 4AIJA 1LFBA 1P92A 2ISYA 1W0UA 1P6RA 3WGIA 1U8RA 1XSDA 5HOOA 4P9FA 3ZGKA 3CUQB 5HDNA 2VPLA 4CCKA 4FTHA 2A5WA 4GO1A 2PX9A 1ZR2A 5HLHA 5HNHA 4ZYDA 4BJ6C 2KFDA 4IL6C 3GF2A 4B4CA 2GOXB 3NRVA 2EQRA 3SZGA 4HDVA 3GFIA 2M34A 2FBHA 2QBYA 2ZCWA 1T56A 4G7ZF 1GUUA 1SFUA 1XGNA 1RC9A 2L54A 1OYIA 1J9IA 3A02A 5CVRA 1XGOA 3AAFA 4HDUA 5FLXZ 3GTOJ 3RSNA 4UUSA 2GM4A 4AM3A 3KEQA 1XG1A 5DD8A 5FO5A 5GAHJ 3UKGA 2KZVA 2L4AA 1IN4A 2PG4A 1G4DA 1XS9A 1FSEA 1POGA 1SFOJ 1YW9A 2DK5A 3NEUA 3DPTA 4ZYAA 5DM7F 1HQCA 4M9SA 1BJZA 3L09A 3RKWA 3OYLA 2JQ7A 1TWGJ 4ZZLA 4M6VA 2ZXJA 1ZLJA 4CUGA 1ZREA 3CC2I 1VQNI 2LDUA 4EJOA 1QVTA 3H0DA 3S1RJ 4BXUA 2F4OB 1YLFA 1LE8B 5D4RA 1LQ1A 5GTIC 3ZQ7A 2L7KA 5KCMA 3GUDA 3BR1A 1MMNA 4M74A 1XSXA 5FD5A 3VPRA 2NOGA 1U6GA 5IT9Z 2R0QC 5HS8A 3I55I 4I99C 1QPIA 4W97A 2Y9YA 4XRSA 1YS7A 2PFBA 3O6BB 2QM3A 1OCZH 2XGEA 4KA4A 1FIPA 2IRFG 3WTZA 1EKEA 5E3LA 3A01A 1AOYA 1GV2A 1H89C 2YS9A 1R5HA 2HI3A 2J5OA 5D5XB 1Y1VJ 2VC1A 4J19A 3TO9A 5D6EA 1SMTA 3SDGA 3KX2A 3WTYC 1MGTA 3WTWC 2DA5A 1ZGWA 3K2AA 3T5XA 4H0EA 3VSLA 2Y0SA 3FXQA 3WHBA 4X0GA 3E5UA 3REOA 3CMYA 3KETA 4B43A 2O5RA 3HG9A 2PQ8A 3RYPA 3B02A 1O57A 2W82A 2JA7J 1AKHB 5J1UA 4MTEA 2NS8A 4M3DA 4ZZDA 2GA1A 4KIGA 1MW7A 4LJZF 3OIQA 1TBXA 3T0YA 1ZK8A 4BGDA 1P7IA 5DCMB 2H1LA 5LHHA 4HLYA 1MBEA 1Z77A 3BG7A 3P5JA 1PJRA 4BYYA 4YFNF 2Y9ZA 3SFIA 2EWNA 1BOAA 1B8IB 4HW0A 5FLXK 4ZTFA 3CMMA 1YHQI 2G9WA 2DQLA 3CUQA 2A6HF 1Q1VA 1IF1A 1WJDA 4RGUA 3OOPA 2ELJA 2CW0F 2X6OA 1Y0UA 4PK4A 2K4JA 2L9RA 3CCMI 3BG9A 4OOIA 2UXNA 4HF1A 3HEFA 2VONA 3PFYA 2HVSA 3GEZA 2H09A 2LY2A 3BP8A 4L5JA 2NS7A 2IS1A 2AXTC 3BT9A 2E35A 2XASA 4N0BA 2A61A 4RBOA 2LD5A 2HYFA 2QF7A 1RR8C 1JTYA 4OIOF 3F0CA 4PJJA 2KKOA 1MIJA 1QQIA 4MFEA 2LFBA 4OIPF 3K1PA 2VKVA 1V3FA 1XMXA 1YW7A 1VQ5I 4KT6A 4BY1J 1S7AA 3Q9VA 4A0YA 2DTZA 2YSRA 1Y6IA 1JKPC 5IT9K 2HQ5A 3LWFA 1STZA 4ZYEA 1B9NA 1JGSA 2EFWA 1PP7U 2D5VA 1T98A 1LE8A 5K5OA 1IC8A 4A6EA 1YQAA 1MJBA 5CKTA 3PUBA 1VFCA 3CDLA 3H3ZA 2FEZA 3M07A 2BY2A 1RI7A 4G12A 2XIGA 4PDKA 3FX3A 3HOTA 2MGQA 3JCUC 2YU9J 5FRMA 1N25A 2LC2A 1VQKI 2FNPA 4JP0A 4R1HA 3C2BA 4L9JA 2O7OA 2Q1ZB 2QSGX 1SD4A 2XAFA 4ESFA 4KN4X 2V9KA 3BZCA 4II2A 4ASNA 4D5FA 4S04A 2EZLA 4R8HA 3HRMA 4IQ4A 2VXZA 1FIAA 2QA4I 1A6QA 4BKXA 3CCYA 3U1KA 4DJAA 1X2MA 3ZN1A 1ERDA 6PAXA 4G94A 2CUZA 4F7ZA 1F5TA 2DI3A 3V7RA 2RREA 1LEBA 1QZZA 4XR6A 2NVUB 4F55A 2KIFA 1T39A 1JHFA 4M3GA 2RKHA 1MBGA 2E1MB 2JSPA 2ISZA 2JZYA 2M45A 3K4JA 1S8NA 3SZTA 5LRRA 4BQOA 5M5XJ 2DMQA 2F48A 3CMAI 4CCLA 2EPFA 2F5EA 3WE3A 3JRFA 1IV6A 1A04A 2BZTA 2G7HA 1ZLKA 4CZCA 2FBKA 2HGCA 1LVAA 1HKTA 4L5IA 1KA8A 5IT3A 3RKQA 1W36D 3CO6C 2LTPA 3PM1A 5ERIA 4GXOA 3ONQA 1AKHA 2H1KA 5E17F 3WE2A 5ED4A 3KP7A 2V9VA 2IJLA 1ETKA 1X1DA 1RKTA 2DQRA 3WG9A 3RPUD 3FIWA 3QU3A 3RQIA 3K69A 4BAYA 1G3WA 1ORKA 3BZ6A 1JXSA 5E20A 3S17J 2JUCA 5L3FA 1FOXA 1MD0A 2DMTA 2PBIA 2QQAA 3HZJA 3H9QA 5J1RA 1B8IA 4D7MA 4HV6A 5LLQA 1NG7A 2BY3A 2UXXA 4A5NA 2HVRA 2STTA 4FETA 1FBQA 5E8IA 4XLCA 1D8JA 3TW6A 4ANJA 4XIDA 3W2AA 4XKBA 1YW8A 3W2WA 2RDPA 3OS0A 3E6CC 3IAM2 1JTXA 4U87A 5JHUA 2DCEA 2JMWA 3KP6A 5IP6A 5L3BA 3PFIA 4JX4A 2FMYA 2R5YB 1OCPA 1I1SA 5L3GA 3QPLA 1YRNB 4L0YB 1PVEA 1I6XA 4E4HA 4E7LA 1BI2A 5KHDA 1YI2I 2FJ1A 4IRGA 2TRTA 4HRIA 5JI6A 2Q0OA 1B1BA 2P8TA 2QEXI 1DP7P 3MQ0A 1G3SA 1V5GA 2Y31A 2VXDA 1U9OA 2IAIA 4KJZA 3RQ4A 2F6CA 2VBZA 3RYRA 3Q0UA 4XRFA 3ZP5A 1OFCX 2LR8A 4G9YA 1IRZA 4EMSA 4XMYA 5B66C 1D1BA 1FOKA 3CF2A 3GZNB 1IN7A 2O8XA 3IWZA 4Q4ZF 3BG5A 1R1TA 2VPRA 2CFOA 1LUJB 3B73A 4QLCU 4DBQA 2Z9OA 1J09A 4CH7A 5LGUA 4IQJA 2ZFWA 2M5WA 5C44J 3NWTA 3JSOA 2W7NA 4I6ZA 3S1QJ 5EEHA 3ZQFA 3LFUA 3JRIA 3CCEI 3K1NA 3MZ8A 2PLYA 1MMGA 2RVCA 1RRJA 2X6XA 4EM2A 2MA3A 3WU0A 5D5VB 2XDVA 1UAAA 3FMRA 1YOVB 4FHTA 3J7AO 4L9VA 3QYEA 3CJQB 5F64A 2EIMH 3H92A 1BC8C 4V2FA 4UY8I 3LSJA 3S93A 5IP7J 3QYFA 1M1EB 2KJBA 4JX5A
chains in the Genus database with same CATH topology
1FJLA 3BTIA 5EYRA 1ETWA 2ID3A 4IHYA 4IHVA 1U78A 1BW5A 4MLOA 2FD5A 3IV5A 2HXIA 1ETXA 2ECBA 4AUXA 1U9NA 5F27A 2NVYJ 3HOUJ 5F08A 3ZQHA 3FK7A 1BL0A 1JUSA 3S16J 5C3EJ 2VKEA 5C4XJ 3BR2A 1ZTRA 2DN0A 3I4MJ 3CQZJ 2HXOA 3SJMA 1O4XA 2LLKA 2MW8A 1GVDA 3A01B 2H8RA 5DTDA 1T33A 1ITYA 2LK2A 1OCTC 3JRCA 4X1EA 1IJWC 1TWCJ 5F0HA 2DMNA 4FCYA 2XB0X 3MN2A 2L7FP 1NK2P 2WV1A 2M9HA 4NDLA 5IOZA 5FLMJ 2DMPA 1A5JA 2LY9A 2LVSA 3HGGA 2G0EA 3ZOBA 1PUFB 4A3IJ 3O8HA 1JT6A 3ZQGA 3JRDA 1BW6A 2WB1N 4LOCA 4XICA 4AYBN 2W48A 3BQYA 2OPTA 3OSFA 1K83J 4C3JJ 4RDUA 1BA5A 1APLC 3QPSA 5IYCJ 1JT0A 1X58A 4IHWA 2X9DA 2HYJA 2HDDA 3IH3A 3G1MA 3JRGA 1IDZA 3S1MJ 4XRSG 2XPVA 4Y7NJ 3D1NI 5DS9A 4BBSJ 1LFBA 2DJNA 2MSYA 1MBJA 4ABZA 1W0UA 5GPAA 3ZQCA 4I76A 3HKZN 3Q3SA 1JKQC 2XSDC 4FTHA 2GLOA 1ZR2A 4JYKA 2K9NA 2R93J 4B4CA 2XGDA 4XK4A 3TP3A 2EQRA 2NVXJ 3L1PA 2M34A 1MBKA 3S14J 4MO7A 3BG3A 1T56A 2CJJA 1GUUA 1JUMA 1IGNA 3A02A 3OIOA 4A3MJ 4A3GJ 3GTOJ 4C2MJ 1FTTA 4M3BA 2Y2ZA 4UUSA 1AHDP 2GM4A 1XG1A 3UKGA 2R7ZJ 1XS9A 3GTGJ 1POGA 2E19A 1SFOJ 3S15J 1JJ8C 3HOZJ 4M3EA 3LSRA 1BJZA 2HOAA 1TWGJ 3MVPA 3NAUA 4M6VA 2I10A 4BY7J 1QVTA 4DYCA 3M4OJ 3FISA 1RR7A 4A69C 3S1RJ 2E2IJ 5EF6A 1WCMJ 2JK3A 1LE8B 3G1LA 2QCOA 2ME0A 3GTMJ 4M3FA 3BR3A 3RZOJ 5IPAA 5JLXA 3BR1A 3VPRA 2COBA 2NOGA 1ETOA 2OF7A 1ZKGA 1U8BA 2R0QC 2ZB9A 4A3EJ 1ZR4A 1QPIA 1TWFJ 1TC3C 4W97A 5GP9A 3OSGA 2Y9YA 1MNMC 4XRSA 1WH7A 1HF0A 3JRBA 2JWTA 2GBYA 2N8GA 2XGEA 3BR6A 1FIPA 3A01A 5E3LA 2R5ZB 1GV2A 5EZHA 2YUSA 1H89C 1IDYA 2YS9A 5FKLA 2HI3A 1Y1VJ 3FKIJ 5J3LA 4A3JJ 4J19A 3SDGA 1NK3P 1MH3A 2KT0A 2IEKA 5M5WJ 3HOVJ 3Q0WA 4A3FJ 2DA5A 1ZGWA 1H8AC 3WHCA 2XRLA 3K2AA 2VUMJ 1I6HJ 4UUTA 1MBFA 4CYCB 1K61A 3BTJA 2CRGA 4DYRA 1ETVA 4IEJA 4B3AA 2DA7A 3HGYA 4W1UA 3WHBA 3HDDA 1H88C 4HNVA 1PUFA 2O9LA 3CMYA 4BXXJ 1HCRA 3PO3J 1MH4A 5C4JJ 3JRHA 2VI6A 5F0CA 2Y30A 2E2JJ 1EF4A 2EBIA 1ETQA 1LFUP 2JA7J 5FKNA 1AKHB 5J1UA 1G2HA 2NS8A 1MSFC 4M3DA 4GFBA 2EZKA 2NVTJ 4EEFG 1ZK8A 4FISA 1P7IA 5M3FJ 5M5YJ 3Q0VA 2AO9A 1MBEA 1Z77A 2Y9ZA 3TEDA 1RPWA 3DCFA 3SFIA 2DA4A 1B8IB 4A3KJ 1F36A 1WPKA 3TW7A 2EH3A 1Q1VA 1TWAJ 4AC0A 5EGOB 1JKRC 1NTCA 2X6OA 4B1RA 2XB5A 1E3OC 2K9QA 2DA3A 3HM5A 2L9RA 3BG9A 5FKOA 3HEFA 4DZPA 2E1OA 4QTRA 1OJLA 3W6VA 2L0KA 2NS7A 3BT9A 1Z0XA 1DU0A 3DEWA 4RBOA 1RESA 2LD5A 2AHQA 3S2HJ 2QF7A 1I3QJ 1JTYA 3F0CA 2DA1A 2LKXA 4MFEA 5E3NA 2LFBA 1ENHA 2VKVA 1S7EA 4BY1J 3A03A 2DTZA 3LNQA 4MIMA 1JKPC 5J1YA 2HQ5A 3ZQIA 1TWHJ 3GTLJ 2DA2A 3HOWJ 2D5VA 1LE8A 3TP0A 3JR9A 1IC8A 1B72B 5FJ8J 1QRYA 4JX6A 4MFDA 4L5EA 1VFCA 3CDLA 1MBHA 4G12A 3H3VK 2YU9J 2TCTA 2MGQA 1SANA 2E2HJ 4X6AJ 5EDNA 1UMQA 4JP0A 4DYQA 3C2BA 2O7OA 2ID6A 4D5CA 4QIWN 1VNDA 4D5FA 3GTJJ 2EZLA 3HB9A 1W0TA 5IP9J 1FIAA 1QVUA 3S2DJ 1FEXA 2ME6A 1GV5A 4BKXA 9ANTA 4BBRJ 2IBDA 1WGXA 3CCYA 5EG0B 2R5ZA 2HOTA 1JKOC 1X2MA 2JN6A 2K9SA 2LP0A 1IG7A 3BR0A 3QQAA 5GPCA 2WAQN 1UHSA 5K7HA 2M2EA 4A93J 4A3CJ 4M3GA 1RKWA 1MBGA 3I4NJ 3B6CA 1HDDC 2JA6J 2XPWA 1CQTA 3FK6A 5IYBJ 5BNGA 4CYCA 3HOXJ 4DZJA 2CUEA 5M5XJ 4A3LJ 2JJ7A 2DMQA 4C3IJ 1ETYA 1JJ6C 3JRFA 1IV6A 3E7LA 4C3HJ 4A3BJ 2DA6A 2MG4A 3LSGA 4A3DJ 5K7ZA 5FLVA 3RKQA 2EZHA 2LTPA 3PM1A 2H1KA 1AKHA 2O8KA 5FKKA 1ETKA 1RKTA 1WH5A 4QSHA 3HBLA 3IH4A 2XGCA 3FIWA 3H0GJ 2RAEA 3K7AJ 3RQIA 2FX0A 1ORKA 3LOCA 1WI3A 1DU6A 3S17J 2DMTA 1GDTA 3BR5A 1MSEC 3O8GA 1X2NA 2L7ZA 5F1JA 5K7FA 5J1RA 1B8IA 1XC5A 4IHXA 2M0CA 5F0FA 2CQQA 4D7MA 3G1OA 5EGOA 2CU7A 2PMZN 3GTPJ 4Y52J 3TW6A 2FQ4A 4XIDA 2L7MP 2R5YA 4FE4A 1RETA 1YRNA 3BQZA 3JREA 1HDPA 5IOYA 2M8GX 3IH2A 1JTXA 2JA8J 3M3YJ 2JMWA 5IP6A 5FKMA 4JX4A 5HODA 2R5YB 1VF9A 4S0HB 1OCPA 5M3MJ 1YRNB 3QPLA 3GBGA 3PO2J 5E3OA 1UG2A 2FJ1A 2TRTA 2HOSA 2ELKA 1Y1WJ 4D7NA 1P7JA 3RZDJ 1VI0A 1JGGA 1JUPA 2Y31A 3GTQJ 1U9OA 2IAIA 3Q0UA 1B72A 1OFCX 2LR8A 4V2GA 1IRZA 2R92J 2NVQJ 2KDZA 2CQXA 2EZIA 2K40A 3GTKJ 4XRMA 3BG5A 2VPRA 5F04A 2B63J 1HOMA 3BTLA 1FTZA 2XPUA 1R9TJ 3OOUA 2CUFA 2P81A 5C44J 5EEAA 4I6ZA 3JRAA 1D5YA 3S1QJ 1A6IA 3ZQFA 5IYDJ 5JLWA 3JRIA 1GT0C 1AU7A 2X48A 5EZGA 1ZQ3P 3S1NJ 2ECCA 4FE7A 5EG0A 2JA5J 1I50J 3B6AA 3MKLA 4UUSB 3HOYJ 1HLVA 3LSPA 4V2FA 2Y0SN 2DMUA 3LSJA 3ZQLA 4DW6A 1F43A 5IP7J 1IUFA 3BTCA 3NARA 5E3MA 4JX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJL A;  3BTI A;  5EYR A;  1ETW A;  2ID3 A;  4IHY A;  4IHV A;  1U78 A;  1BW5 A;  4MLO A;  2FD5 A;  3IV5 A;  2HXI A;  1ETX A;  2ECB A;  4AUX A;  1U9N A;  5F27 A;  2NVY J;  3HOU J;  5F08 A;  3ZQH A;  3FK7 A;  1BL0 A;  1JUS A;  3S16 J;  5C3E J;  2VKE A;  5C4X J;  3BR2 A;  1ZTR A;  2DN0 A;  3I4M J;  3CQZ J;  2HXO A;  3SJM A;  1O4X A;  2LLK A;  2MW8 A;  1GVD A;  3A01 B;  2H8R A;  5DTD A;  1T33 A;  1ITY A;  2LK2 A;  1OCT C;  3JRC A;  4X1E A;  1IJW C;  1TWC J;  5F0H A;  2DMN A;  4FCY A;  2XB0 X;  3MN2 A;  2L7F P;  1NK2 P;  2WV1 A;  2M9H A;  4NDL A;  5IOZ A;  5FLM J;  2DMP A;  1A5J A;  2LY9 A;  2LVS A;  3HGG A;  2G0E A;  3ZOB A;  1PUF B;  4A3I J;  3O8H A;  1JT6 A;  3ZQG A;  3JRD A;  1BW6 A;  2WB1 N;  4LOC A;  4XIC A;  4AYB N;  2W48 A;  3BQY A;  2OPT A;  3OSF A;  1K83 J;  4C3J J;  4RDU A;  1BA5 A;  1APL C;  3QPS A;  5IYC J;  1JT0 A;  1X58 A;  4IHW A;  2X9D A;  2HYJ A;  2HDD A;  3IH3 A;  3G1M A;  3JRG A;  1IDZ A;  3S1M J;  4XRS G;  2XPV A;  4Y7N J;  3D1N I;  5DS9 A;  4BBS J;  1LFB A;  2DJN A;  2MSY A;  1MBJ A;  4ABZ A;  1W0U A;  5GPA A;  3ZQC A;  4I76 A;  3HKZ N;  3Q3S A;  1JKQ C;  2XSD C;  4FTH A;  2GLO A;  1ZR2 A;  4JYK A;  2K9N A;  2R93 J;  4B4C A;  2XGD A;  4XK4 A;  3TP3 A;  2EQR A;  2NVX J;  3L1P A;  2M34 A;  1MBK A;  3S14 J;  4MO7 A;  3BG3 A;  1T56 A;  2CJJ A;  1GUU A;  1JUM A;  1IGN A;  3A02 A;  3OIO A;  4A3M J;  4A3G J;  3GTO J;  4C2M J;  1FTT A;  4M3B A;  2Y2Z A;  4UUS A;  1AHD P;  2GM4 A;  1XG1 A;  3UKG A;  2R7Z J;  1XS9 A;  3GTG J;  1POG A;  2E19 A;  1SFO J;  3S15 J;  1JJ8 C;  3HOZ J;  4M3E A;  3LSR A;  1BJZ A;  2HOA A;  1TWG J;  3MVP A;  3NAU A;  4M6V A;  2I10 A;  4BY7 J;  1QVT A;  4DYC A;  3M4O J;  3FIS A;  1RR7 A;  4A69 C;  3S1R J;  2E2I J;  5EF6 A;  1WCM J;  2JK3 A;  1LE8 B;  3G1L A;  2QCO A;  2ME0 A;  3GTM J;  4M3F A;  3BR3 A;  3RZO J;  5IPA A;  5JLX A;  3BR1 A;  3VPR A;  2COB A;  2NOG A;  1ETO A;  2OF7 A;  1ZKG A;  1U8B A;  2R0Q C;  2ZB9 A;  4A3E J;  1ZR4 A;  1QPI A;  1TWF J;  1TC3 C;  4W97 A;  5GP9 A;  3OSG A;  2Y9Y A;  1MNM C;  4XRS A;  1WH7 A;  1HF0 A;  3JRB A;  2JWT A;  2GBY A;  2N8G A;  2XGE A;  3BR6 A;  1FIP A;  3A01 A;  5E3L A;  2R5Z B;  1GV2 A;  5EZH A;  2YUS A;  1H89 C;  1IDY A;  2YS9 A;  5FKL A;  2HI3 A;  1Y1V J;  3FKI J;  5J3L A;  4A3J J;  4J19 A;  3SDG A;  1NK3 P;  1MH3 A;  2KT0 A;  2IEK A;  5M5W J;  3HOV J;  3Q0W A;  4A3F J;  2DA5 A;  1ZGW A;  1H8A C;  3WHC A;  2XRL A;  3K2A A;  2VUM J;  1I6H J;  4UUT A;  1MBF A;  4CYC B;  1K61 A;  3BTJ A;  2CRG A;  4DYR A;  1ETV A;  4IEJ A;  4B3A A;  2DA7 A;  3HGY A;  4W1U A;  3WHB A;  3HDD A;  1H88 C;  4HNV A;  1PUF A;  2O9L A;  3CMY A;  4BXX J;  1HCR A;  3PO3 J;  1MH4 A;  5C4J J;  3JRH A;  2VI6 A;  5F0C A;  2Y30 A;  2E2J J;  1EF4 A;  2EBI A;  1ETQ A;  1LFU P;  2JA7 J;  5FKN A;  1AKH B;  5J1U A;  1G2H A;  2NS8 A;  1MSF C;  4M3D A;  4GFB A;  2EZK A;  2NVT J;  4EEF G;  1ZK8 A;  4FIS A;  1P7I A;  5M3F J;  5M5Y J;  3Q0V A;  2AO9 A;  1MBE A;  1Z77 A;  2Y9Z A;  3TED A;  1RPW A;  3DCF A;  3SFI A;  2DA4 A;  1B8I B;  4A3K J;  1F36 A;  1WPK A;  3TW7 A;  2EH3 A;  1Q1V A;  1TWA J;  4AC0 A;  5EGO B;  1JKR C;  1NTC A;  2X6O A;  4B1R A;  2XB5 A;  1E3O C;  2K9Q A;  2DA3 A;  3HM5 A;  2L9R A;  3BG9 A;  5FKO A;  3HEF A;  4DZP A;  2E1O A;  4QTR A;  1OJL A;  3W6V A;  2L0K A;  2NS7 A;  3BT9 A;  1Z0X A;  1DU0 A;  3DEW A;  4RBO A;  1RES A;  2LD5 A;  2AHQ A;  3S2H J;  2QF7 A;  1I3Q J;  1JTY A;  3F0C A;  2DA1 A;  2LKX A;  4MFE A;  5E3N A;  2LFB A;  1ENH A;  2VKV A;  1S7E A;  4BY1 J;  3A03 A;  2DTZ A;  3LNQ A;  4MIM A;  1JKP C;  5J1Y A;  2HQ5 A;  3ZQI A;  1TWH J;  3GTL J;  2DA2 A;  3HOW J;  2D5V A;  1LE8 A;  3TP0 A;  3JR9 A;  1IC8 A;  1B72 B;  5FJ8 J;  1QRY A;  4JX6 A;  4MFD A;  4L5E A;  1VFC A;  3CDL A;  1MBH A;  4G12 A;  3H3V K;  2YU9 J;  2TCT A;  2MGQ A;  1SAN A;  2E2H J;  4X6A J;  5EDN A;  1UMQ A;  4JP0 A;  4DYQ A;  3C2B A;  2O7O A;  2ID6 A;  4D5C A;  4QIW N;  1VND A;  4D5F A;  3GTJ J;  2EZL A;  3HB9 A;  1W0T A;  5IP9 J;  1FIA A;  1QVU A;  3S2D J;  1FEX A;  2ME6 A;  1GV5 A;  4BKX A;  9ANT A;  4BBR J;  2IBD A;  1WGX A;  3CCY A;  5EG0 B;  2R5Z A;  2HOT A;  1JKO C;  1X2M A;  2JN6 A;  2K9S A;  2LP0 A;  1IG7 A;  3BR0 A;  3QQA A;  5GPC A;  2WAQ N;  1UHS A;  5K7H A;  2M2E A;  4A93 J;  4A3C J;  4M3G A;  1RKW A;  1MBG A;  3I4N J;  3B6C A;  1HDD C;  2JA6 J;  2XPW A;  1CQT A;  3FK6 A;  5IYB J;  5BNG A;  4CYC A;  3HOX J;  4DZJ A;  2CUE A;  5M5X J;  4A3L J;  2JJ7 A;  2DMQ A;  4C3I J;  1ETY A;  1JJ6 C;  3JRF A;  1IV6 A;  3E7L A;  4C3H J;  4A3B J;  2DA6 A;  2MG4 A;  3LSG A;  4A3D J;  5K7Z A;  5FLV A;  3RKQ A;  2EZH A;  2LTP A;  3PM1 A;  2H1K A;  1AKH A;  2O8K A;  5FKK A;  1ETK A;  1RKT A;  1WH5 A;  4QSH A;  3HBL A;  3IH4 A;  2XGC A;  3FIW A;  3H0G J;  2RAE A;  3K7A J;  3RQI A;  2FX0 A;  1ORK A;  3LOC A;  1WI3 A;  1DU6 A;  3S17 J;  2DMT A;  1GDT A;  3BR5 A;  1MSE C;  3O8G A;  1X2N A;  2L7Z A;  5F1J A;  5K7F A;  5J1R A;  1B8I A;  1XC5 A;  4IHX A;  2M0C A;  5F0F A;  2CQQ A;  4D7M A;  3G1O A;  5EGO A;  2CU7 A;  2PMZ N;  3GTP J;  4Y52 J;  3TW6 A;  2FQ4 A;  4XID A;  2L7M P;  2R5Y A;  4FE4 A;  1RET A;  1YRN A;  3BQZ A;  3JRE A;  1HDP A;  5IOY A;  2M8G X;  3IH2 A;  1JTX A;  2JA8 J;  3M3Y J;  2JMW A;  5IP6 A;  5FKM A;  4JX4 A;  5HOD A;  2R5Y B;  1VF9 A;  4S0H B;  1OCP A;  5M3M J;  1YRN B;  3QPL A;  3GBG A;  3PO2 J;  5E3O A;  1UG2 A;  2FJ1 A;  2TRT A;  2HOS A;  2ELK A;  1Y1W J;  4D7N A;  1P7J A;  3RZD J;  1VI0 A;  1JGG A;  1JUP A;  2Y31 A;  3GTQ J;  1U9O A;  2IAI A;  3Q0U A;  1B72 A;  1OFC X;  2LR8 A;  4V2G A;  1IRZ A;  2R92 J;  2NVQ J;  2KDZ A;  2CQX A;  2EZI A;  2K40 A;  3GTK J;  4XRM A;  3BG5 A;  2VPR A;  5F04 A;  2B63 J;  1HOM A;  3BTL A;  1FTZ A;  2XPU A;  1R9T J;  3OOU A;  2CUF A;  2P81 A;  5C44 J;  5EEA A;  4I6Z A;  3JRA A;  1D5Y A;  3S1Q J;  1A6I A;  3ZQF A;  5IYD J;  5JLW A;  3JRI A;  1GT0 C;  1AU7 A;  2X48 A;  5EZG A;  1ZQ3 P;  3S1N J;  2ECC A;  4FE7 A;  5EG0 A;  2JA5 J;  1I50 J;  3B6A A;  3MKL A;  4UUS B;  3HOY J;  1HLV A;  3LSP A;  4V2F A;  2Y0S N;  2DMU A;  3LSJ A;  3ZQL A;  4DW6 A;  1F43 A;  5IP7 J;  1IUF A;  3BTC A;  3NAR A;  5E3M A;  4JX5 A; 
#chains in the Genus database with same CATH topology
 1SVL A;  2XC7 A;  1FJL A;  2LSO A;  4PJ0 C;  5EYR A;  1Z67 A;  3OYD A;  3R0J A;  1DPR A;  2DFH A;  1DGW Y;  5E79 C;  3M1E A;  3CJR B;  3K4B A;  5FB2 A;  2HTS A;  4IRH A;  2DDA A;  2X51 A;  3N05 A;  3R6S A;  1U9N A;  5F27 A;  4BHC A;  3HOU J;  3V7C A;  5F08 A;  3W6J B;  3DBL B;  1JUS A;  4Y15 A;  3JAM Z;  4E7Z A;  4RGX A;  3J81 K;  4OIR F;  4F3Q A;  5C3E J;  2VKE A;  3AKZ A;  2AXL A;  2YU3 A;  4BE0 A;  1ZTR A;  1D0X A;  2DN0 A;  2L02 A;  1K79 A;  3SFZ A;  3CQZ J;  1UFM A;  1O4X A;  4A6D A;  2LLK A;  1KQ0 A;  2LK2 A;  1D5V A;  2IS4 A;  4X1E A;  2PMH A;  3FBI B;  1IJW C;  1R49 A;  2DMN A;  4GYI A;  1V54 H;  1E17 A;  4J01 A;  3OYB A;  1WQ2 A;  2E1C A;  1LKX A;  1R00 A;  2CQN A;  4NDL A;  4N4O B;  4G6D A;  4ENJ A;  1NK2 P;  3I58 A;  4MNU A;  5DEQ A;  2LBF B;  4Q47 A;  4PGG A;  3I56 I;  2DMP A;  5CJ9 A;  1S6L A;  2A6E F;  3R60 A;  4I98 B;  2XF7 A;  1PUF B;  1VZ0 A;  1JT6 A;  3ZQG A;  3JRD A;  2HVQ A;  2R7D A;  3HPG A;  3AG1 H;  2HPI A;  3WTS C;  4LOC A;  4XIC A;  2W48 A;  3BQY A;  4BDZ A;  1SFX A;  1BA5 A;  1R7J A;  1W7P D;  3QPS A;  1JT0 A;  4OAZ A;  4IHW A;  2H94 A;  2DJI A;  1FWZ A;  4AU7 A;  4AWX B;  3E6D A;  5HDK A;  4V19 K;  3S1M J;  4EJU A;  3D1N I;  1SAX A;  4YFX F;  3M1C A;  1IN8 A;  4BBS J;  1P2F A;  2GQQ A;  3HTS B;  3F22 A;  2FXA A;  2MSY A;  4ABZ A;  1DGR M;  3F9K A;  4I76 A;  2HKX A;  1UEL B;  3CDH A;  3HKZ N;  3GLX A;  1XPX A;  4HOB A;  3KIO A;  2R93 J;  3BJO A;  3F8C A;  3VSK A;  3A0H C;  1MBK A;  4MO7 A;  5TRD A;  2ZXW H;  3PSF A;  4G6T B;  4KT5 C;  2VKH A;  3HOS A;  1WJF A;  4M3B A;  1AHD P;  4CCO A;  1ZGJ A;  1VQ4 I;  3KZI C;  2BY0 A;  4ESJ A;  2E19 A;  1MND A;  3WTU C;  3CUQ C;  3HOZ J;  4M3E A;  1XCV A;  3OYN A;  2L3D A;  2HOA A;  2JPB A;  1BN5 A;  2CFX A;  1EA3 A;  2K3F A;  4XKW A;  3BPX A;  1W5T A;  4DYC A;  2WY7 Q;  1K7A A;  3JAM K;  2X85 A;  2QZ8 A;  2R7V A;  1WCM J;  2JK3 A;  3G1L A;  3DXJ F;  1JE8 A;  5J40 A;  4M3F A;  3RZO J;  3QOD A;  3K0L A;  4LGW A;  5IPA A;  3BJ6 A;  3SHF A;  4HX8 A;  4BDY A;  2AQF A;  3QP6 A;  2KIM A;  2OF7 A;  1U8B A;  2O6G E;  2ZB9 A;  2FU4 A;  1I5Z A;  3HIF A;  5JR3 A;  1C0W A;  1OCC H;  2YX7 A;  2V9P A;  3HC7 A;  2DK8 A;  3ZMD A;  2UZK A;  1WH7 A;  1Z7U A;  1HF0 A;  1N78 A;  1MKM A;  2JWT A;  3FM5 A;  3PNY A;  3CCS I;  4II3 A;  1LDK B;  3WU1 B;  1LFP A;  4BQN A;  2DTR A;  3WTX C;  4UNO A;  5J6X A;  3K4N A;  2R5Z B;  4XLP F;  5EZH A;  2J5P A;  2YUS A;  4MTD A;  1K4S A;  5FKL A;  1X19 A;  2A6T A;  3W2V A;  3VB2 A;  3HSE A;  3OYE A;  1UJ8 A;  1IN5 A;  4QWQ A;  4NNJ A;  4EVI A;  1J0R A;  2X1E A;  3HYI A;  1T6S A;  1FOW A;  2IEK A;  4MGR A;  5M5W J;  3F8N A;  2L5Q A;  1O3R A;  2ETH A;  1H8A C;  3HOV J;  3WHC A;  3OYA A;  2VUM J;  3NWS A;  1I6H J;  3RI4 A;  2LBF A;  1Z3Y A;  3DTI A;  3OL3 A;  1P4W A;  1J2X A;  2CRG A;  3TDU C;  2BVM A;  4DYR A;  4IEJ A;  2DPU A;  2DAO A;  3HGY A;  1ON1 A;  1QZE A;  2P5K A;  2E5N A;  4M6Y A;  1PUF A;  2HQR A;  3F3X A;  1PP8 F;  3PO3 J;  4HBL A;  5C4J J;  1MZB A;  2VI6 A;  3VOD A;  4NBQ A;  2VQC A;  2WAD A;  1LJ9 A;  5F0C A;  4A12 A;  3K70 C;  2Y30 A;  4E70 A;  2E2J J;  2MLG A;  2EBI A;  4WXD A;  1ETQ A;  3WTT C;  1IXS B;  1R4N B;  1MSF C;  1QZY A;  4GFB A;  1EH6 A;  1XDU A;  3GZ6 A;  2OBP A;  5M5Y J;  2FNA A;  2AO9 A;  1OPC A;  4G6Q A;  4BNC A;  2HTJ A;  3I9V 2;  1RPW A;  2O03 A;  3DCF A;  2MYS A;  2WWY A;  4A3K J;  1F36 A;  4TV7 A;  3CO7 C;  1X1A A;  2EH3 A;  1TWA J;  3CCQ I;  2ZBK A;  3MMY B;  1X1P A;  4AC0 A;  1QO0 D;  1WWX A;  4Q5S F;  1K4T A;  3H5R A;  3FXM A;  1E3O C;  3ABU A;  3OR1 C;  3HM5 A;  2R3S A;  1WHU A;  4QTR A;  2R7W A;  1OJL A;  1OIS A;  3W6V A;  1DU0 A;  2EFO A;  2DDB A;  2HWV A;  3TMO A;  1U3E M;  2D45 A;  2DA1 A;  2HDW A;  2LKX A;  4IHT A;  2PEX A;  1BIB A;  1D8K A;  2R7O A;  1H9T A;  5TGT A;  1YYV A;  2XAU A;  1Z21 A;  4WK8 F;  1K6Y A;  3I64 A;  2FML A;  3BCB A;  3KPH A;  1NH3 A;  4B44 A;  2WB1 A;  3VDX A;  4NC8 A;  4P55 A;  4AYB A;  3ZQI A;  4LLN A;  2V79 A;  4HAM A;  2C6Y A;  4LMY A;  4UHT A;  1MDM B;  5FJ8 J;  1UHM A;  2A68 F;  4L5E A;  3OIP A;  3WGH A;  1VTN C;  2OCE A;  9ANT A;  2TCT A;  3WOD F;  2K4B A;  3SYT A;  2W24 A;  3IRQ A;  4E7H A;  2NRA C;  1DQU A;  4RGS A;  4O5V A;  2GZW A;  2QQB A;  2IGM A;  3FXL A;  3LST A;  2VKD A;  4BS9 A;  4EJV A;  5E1W A;  4BH9 A;  3GTJ J;  1J59 A;  1WVR A;  1FC3 A;  4I0B A;  2W4S A;  1Z6R A;  3S2D J;  2ME6 A;  4I0A A;  4DBR A;  2YX4 A;  2IBD A;  5EG0 B;  2R5Z A;  4AVZ A;  3PUF A;  1JKO C;  4LD5 A;  1F9N A;  4L0Z B;  2KLO A;  2LP0 A;  4UUV A;  4HX7 A;  3CJT B;  5CVJ A;  4M71 A;  1SC7 A;  1RNL A;  3QQA A;  4C2U A;  2GOM A;  2M2E A;  3QPH A;  4L18 B;  4A93 J;  4IZZ A;  3IRR A;  3C3W A;  2QVO A;  2OQR A;  4EAT A;  5K5Q A;  1OMI A;  5L3E A;  1W1W E;  3B6C A;  4OAY A;  3FK6 A;  5IYB J;  5BNG A;  3HOX J;  4DZJ A;  2VL8 A;  3DV8 A;  2Y0M A;  4HQE A;  4Y33 A;  2FRH A;  3F21 A;  5DDG A;  1JJ6 C;  5A2Q Z;  4CXF A;  2IGN A;  1VQL I;  1WJ5 A;  5ILU A;  2VT3 A;  2V6C A;  2LMD A;  1UG0 A;  2VJI A;  4A3D J;  1HA8 A;  3SEQ A;  4BE2 A;  3RPU A;  5HDG A;  4YG2 F;  5FKK A;  2E1M C;  2ZNZ A;  3ELK A;  3CME I;  1KYW A;  2JRM A;  2RAE A;  1BR1 A;  3C7J A;  1LVK A;  4CYD A;  4ENN A;  2V26 A;  2XGX A;  2PJP A;  2VJJ A;  1DU6 A;  4RAY A;  3C1D A;  4OU0 A;  3OWT A;  2CWE A;  3CC4 I;  3O8G A;  2L7Z A;  4OIN F;  2M0C A;  1R4M B;  5KNL A;  2H6B A;  2EJR A;  3DWL E;  3IWF A;  3EYY A;  1TNS A;  4HST A;  3GTP J;  2FQ4 A;  3D5R C;  4U7B A;  2O61 A;  2OUM A;  1T2K A;  5FD6 A;  1KU9 A;  4U0V A;  3U21 A;  1RET A;  5D5W B;  3IAS 2;  1LDD A;  3K2Z A;  1R6R A;  1T08 B;  5IOY A;  2M8G X;  3IH2 A;  2JA8 J;  3QOE A;  1P9Q C;  1WJE A;  3E1S A;  2W25 A;  1TNT A;  4RGR A;  5H6Q A;  2VAS A;  3KLO A;  5JVT A;  4UV9 A;  1VF9 A;  4UB6 C;  3U1D A;  5M3M J;  3GBG A;  2KL4 A;  2ZKZ A;  2KIQ A;  2GIV A;  1G3Y A;  1W7P B;  1ULY A;  2HOS A;  3FMS A;  3C18 A;  3PIP F;  2I5U A;  2WA0 A;  1S3J A;  3FM3 A;  3AL0 B;  1Y1W J;  1P7J A;  3RZD J;  3CJN A;  2WTE A;  4UV8 A;  3M8E A;  1JUP A;  4JK1 X;  2VQG A;  1X3W B;  3ZN0 A;  3MEX A;  3GTQ J;  2FOW A;  4IRI A;  5AIP A;  2CH0 A;  2K86 A;  1T0F A;  4RLQ A;  2GAU A;  3HUG B;  3K4K A;  1W4M A;  3FKJ A;  4KMU X;  4XKV A;  4Y4R A;  3T1B A;  1MDM A;  4KYW A;  1D3Y A;  2R92 J;  1NG6 A;  2NVQ J;  3VYU B;  4ZYG A;  3M9A A;  4HA8 A;  3C2G A;  5F04 A;  3LA3 A;  3MCZ A;  1HOM A;  2LKS A;  4YFK F;  1ON2 A;  5LHI A;  2E36 A;  1FTZ A;  2QKL B;  4KIS A;  1R9T J;  3OOU A;  1DPU A;  3CCV I;  2P81 A;  2GXA A;  4KNY A;  2LG4 A;  3MZY A;  4A0X A;  1D5Y A;  1J7K A;  1A6I A;  2ELH A;  2YPR A;  1ZRC A;  2HDC A;  1GT0 C;  3T8T A;  3EQL F;  1AU7 A;  1S7O A;  3S1N J;  2ZJR F;  1ONV A;  3DF8 A;  1VQ7 I;  4ENK A;  2JA2 A;  4YII A;  5JVG F;  1R22 A;  2LOO A;  2COM A;  5EG0 A;  1I50 J;  3LSM A;  4G8X A;  2VOO A;  4XM3 A;  5DCF A;  3RDI A;  2KHM A;  1BI0 A;  5A2Q K;  2HQA A;  2OA4 A;  3V42 A;  3FZV A;  2E1N A;  2ZSH B;  2XAH A;  2ZC2 A;  3P9I A;  2Y0S N;  1OCO H;  4JQF A;  3VYR B;  2F5D A;  3JTG A;  2BYV E;  3LMM A;  1ZRF A;  3ZQL A;  4YIR X;  1EJ9 A;  1YX3 A;  1GXQ A;  1CGP A;  3HL2 A;  3KE2 A;  5HS7 A;  5K5R A;  2BY1 A;  3HPH A;  3Q9S A;  1YIJ I;  2IW5 A;  3TOB A;  3FXJ A;  1ZG3 A;  1YIT I;  5H20 A;  3G4S I;  1FOY A;  3OYH A;  2VJ4 A;  1DDN A;  3GWZ A;  1BW5 A;  3ZCO A;  1B4A A;  3IV5 A;  4AUX A;  1S29 A;  3L9F A;  4Z2Y A;  2NVY J;  1YG2 A;  1TTY A;  2BHY A;  3FK7 A;  4HF0 A;  3IL2 A;  1WKM A;  3BDD A;  3RKX A;  3BRO A;  2JPC A;  2X6W A;  3FF5 A;  3E6M A;  3I4M J;  2B9S A;  2MFZ A;  2W84 A;  3SJM A;  3ROU A;  2OQG A;  5DTD A;  2DT6 A;  1T33 A;  1J5Y A;  1ITY A;  3OS1 A;  2DYR H;  4WF2 A;  4BUP A;  3H9J A;  4CIC A;  2H27 A;  1TWC J;  5F0H A;  3DEU A;  4XOP A;  3WTV C;  2XB0 X;  2XF6 A;  2GXG A;  2OJE D;  2NAZ A;  3CDI A;  3TOA A;  1JI8 A;  1TLH B;  5ICE A;  2XSJ C;  5FLM J;  2WAQ A;  1UST A;  3KYC B;  4XKC A;  3CF5 F;  1F4K A;  2KMU A;  2LVS A;  5CVI A;  3ZOB A;  1E3H A;  1BW6 A;  4PJN A;  1U0J A;  1XGM A;  3GFJ A;  1YIO A;  2CUJ A;  1W7P A;  1UHW A;  3OSF A;  3MKY B;  1K83 J;  4PSW A;  4RDU A;  3V8L A;  3ZRG A;  2EFQ A;  2Z5U A;  2DPD A;  4ZC3 A;  2M3A A;  3CCU I;  1YJ9 I;  3G1M A;  2CG4 A;  5BQT A;  5CQG A;  3HUG A;  4XRS G;  4Y7N J;  5E8G A;  3TO7 A;  3FHN A;  3QP5 A;  4LG3 A;  1V55 H;  5LEJ A;  1MBJ A;  5J4Y A;  3ASO H;  3ZQC A;  2CO5 A;  1G8X A;  1JKQ C;  2XSD C;  1KZH A;  1SD7 A;  3K6G A;  5TJJ A;  1Y56 A;  4JYK A;  2K9N A;  3PNV A;  4CZZ A;  2MBF A;  1WRJ A;  2Q2E B;  1D1A A;  4XK4 A;  3TP3 A;  1HSJ A;  2NVX J;  2YR2 A;  2PMZ A;  3TGN A;  3S14 J;  4EV0 A;  3BG3 A;  2R7Q A;  1ZG5 A;  2QYO A;  1IGN A;  3X2Q H;  2ADU A;  3OIO A;  4A3M J;  1KQ8 A;  3AG4 H;  3ZMV A;  2Y2Z A;  2F4M B;  1XX5 A;  3LAJ A;  3GLL A;  4RLF A;  5CQE A;  3S32 A;  4B47 A;  2R7Z J;  2A5Y B;  3GTG J;  2IXS A;  3S15 J;  2ZME C;  2LKP A;  3ABL H;  2RNG A;  3CP2 A;  1ACI A;  4BY7 J;  4IO9 F;  1E3P A;  2EV6 A;  1WJB A;  4A69 C;  4F91 B;  2NNY A;  1R36 A;  2L9N A;  2QCO A;  2ME0 A;  3DFG A;  3I54 A;  3DEE A;  4HZF A;  2H8W A;  3BR3 A;  3KFW X;  1PUE E;  3N4M A;  5BPD A;  4QPO A;  5JLX A;  5E1X A;  3DBH B;  1O3T A;  4LFU A;  5DV5 A;  4HPQ A;  2QSF X;  1R5I D;  1ZR4 A;  5F6F A;  3BJA A;  5L3C A;  2VE8 A;  1TWF J;  2XKO A;  1S5L C;  4U88 A;  2MC4 A;  2P0W A;  1MNM C;  2CS3 A;  3JRB A;  2DU9 A;  5LGT A;  3OYC A;  1YTY A;  2ZO4 A;  2MD5 A;  3J7Y J;  2NOJ B;  3I53 A;  3K70 D;  2WAE A;  4XLA A;  1IDY A;  4I01 A;  4AIH A;  4NHJ A;  1Z9C A;  4PCQ A;  4EJT A;  3FKI J;  4DOZ A;  4KIC A;  2DT7 B;  1IO2 A;  3F6V A;  1MH3 A;  2ICW G;  1X3Z B;  2DYS H;  2V1U A;  4RB1 A;  1XGS A;  4I7H A;  3Q0W A;  3ZMZ A;  1V5F A;  3KYD B;  1P4X A;  4UUT A;  4N4N B;  3BY6 A;  4IF4 A;  1K61 A;  5HS9 A;  3H35 A;  2K27 A;  2VLA A;  2OTJ I;  3OY9 A;  1SMY F;  3GVA A;  2KP6 A;  4HQM A;  4B3A A;  3HDD A;  1XB4 A;  1R5G A;  2M4K A;  2O9L A;  2B7E A;  3RIR A;  1SD5 A;  5ICF A;  1MH4 A;  3O3K A;  4ITV A;  3JRH A;  3I5U A;  5DUK A;  2GA2 A;  4G7O F;  3K1M A;  2CGP A;  1G2H A;  3MAJ A;  2D2W A;  1Z6T A;  3ERE D;  3OYJ A;  2NVT J;  4HV5 A;  4FIS A;  4HNU A;  1USS A;  3IKT A;  2CW7 A;  3P7N A;  1YFH A;  4Y13 A;  2ESH A;  2EK5 A;  2IVM A;  2Y69 H;  5D8K B;  3E3V A;  4WXH A;  4D9J A;  1L3L A;  1FYK A;  1KON A;  3Q0V A;  3L2Q A;  3V8J A;  5CLS A;  2IP2 A;  1LEA A;  1QNT A;  2DA4 A;  1W36 C;  1WPK A;  2HR3 A;  3TW7 A;  1FBU A;  5J8C A;  5LFA A;  5K1Y A;  5EGO B;  3QPT A;  4ETS A;  1JKR C;  3F72 A;  4XSZ F;  2EIJ H;  4M9X A;  4DGW B;  4J00 A;  4HF2 A;  2DA3 A;  3EET A;  4EM1 A;  2Q2E A;  2ZME B;  2M7B A;  4DZP A;  2IA1 A;  1FT9 A;  4XLF A;  3R61 A;  3BPV A;  2QSH X;  2L0K A;  2WC2 A;  4BQQ A;  2L9V A;  1WFX A;  3PNT A;  1RES A;  5DUI A;  1Z7L A;  4HLX A;  5D5U B;  3PJR A;  4Q48 A;  5HNF A;  2FE3 A;  4H4K C;  1ENH A;  3ZMS A;  4B3X A;  4LB6 B;  1I3A A;  2BXZ A;  1U5T C;  3A03 A;  1W5S A;  2OV7 A;  1EH7 A;  2FSW A;  4MIM A;  3OL4 A;  3V4G A;  1YO5 C;  4E6K G;  1R23 A;  3H3U A;  4RM3 A;  4U0W A;  1KYZ A;  5J1Y A;  2R7X A;  3S8P A;  1KQ9 A;  3S3N A;  3GTL J;  5DD4 A;  4EM0 B;  3EYI A;  4QPQ A;  3LL7 A;  1B72 B;  1QRY A;  1BI3 A;  2LH9 A;  4JX6 A;  4MFD A;  3OR2 C;  1D0Z A;  4A5M A;  3HJE A;  2VC0 A;  3RKY A;  2L4M A;  4XLN F;  3H3V K;  2RC4 A;  1SAN A;  2M7A A;  4X6A J;  5EDN A;  1UMQ A;  3S3M A;  4D5C A;  2IS6 A;  3OYF A;  4Y3O A;  2OZU A;  1VND A;  1E0E A;  3BLY A;  3G3Z A;  1UCR A;  3OYM A;  4MEX F;  3VWB A;  3QU6 A;  1W0T A;  2JVG A;  1LDJ A;  2CV0 A;  3G6E I;  1FEX A;  1T0F C;  3ERM A;  1GV5 A;  1BOB A;  4PUS A;  4BBR J;  2HOT A;  4XQF A;  2W00 A;  3AG3 H;  4C9Y A;  4OMZ A;  2VN2 A;  2P6S A;  2XHK A;  4DQ2 A;  3DBR B;  1N75 A;  4ENM A;  5K7H A;  2BV6 A;  1UZC A;  1IZ1 A;  2XRN A;  2DO7 A;  4NQW B;  4D1Q A;  4ZJZ A;  5CPR B;  1I39 A;  2XPW A;  1IRF A;  4FAS D;  1ZN2 A;  2CUE A;  4A3L J;  2JJ7 A;  3LSK A;  2QEN A;  1A31 A;  4HEA 2;  1VQP I;  4C3I J;  3KYL A;  3L2V A;  2XAQ A;  3E7L A;  3F8B A;  4K2E A;  4CO8 A;  4A3B J;  2VBX A;  5KVR A;  2DA6 A;  4CCJ A;  3I3L A;  3CCR I;  3H9G A;  3IUO A;  1LB2 A;  2AS5 F;  4PJM A;  5HLT A;  4P96 A;  2EZH A;  1GXP A;  4GRI A;  5E18 F;  2FOK A;  3HSR A;  2HU9 A;  3H5N A;  4NB5 A;  4QSH A;  2V4J C;  3HBL A;  2XGC A;  3H0G J;  4AIK A;  4ESB A;  2M0M A;  3J80 Z;  2KQR A;  3OS2 A;  2FX0 A;  4ZDO A;  3G2B A;  3LOC A;  1WI3 A;  2V1N A;  1TT5 B;  3KZZ A;  1I1G A;  4UVA A;  1GDT A;  2IGO A;  1MSE C;  3KP4 A;  1BJA A;  3PQJ A;  1UB9 A;  2DXI A;  5EGO A;  2P7V B;  4ZDP A;  4Y52 J;  2LF7 A;  3D5L A;  5BS6 A;  1ODD A;  1SAU A;  3CES A;  1EV7 A;  3DKX A;  1IW7 F;  3FBN B;  5J8F A;  3OYI A;  4UB8 C;  2KJC A;  1U5T B;  2WY8 Q;  2ZME A;  1Z1D A;  3ULQ B;  4HX4 A;  2HFH A;  2EA2 A;  4UVC A;  1HST A;  5H6R A;  5B3S H;  1IRG A;  3KP3 A;  4UXN A;  3K9T A;  5B1B H;  3SXY A;  2IS2 A;  3FXK A;  3PO2 J;  2BW3 B;  1EH8 A;  4IPA A;  4LG0 B;  3ABK H;  2JTV A;  1ZGA A;  4EJW A;  2R7U A;  1YJN I;  1HBX G;  2OCC H;  3VYT B;  3JW4 A;  3IC7 A;  5EJC A;  5GAE J;  3FXU A;  2CQ7 A;  2OAZ A;  3TDZ C;  2ZJQ F;  2MAB A;  1SFK A;  1ZH5 A;  5JFR A;  1R71 A;  1B72 A;  3P9C A;  1OQY A;  2I8D A;  4V2G A;  1U2W A;  2KDZ A;  2LF8 A;  1FMV A;  2HEO A;  3GFL A;  3GTK J;  4XRM A;  1WI9 A;  4F93 B;  2XF5 A;  1R1U A;  2DOA A;  2MH2 A;  2QQ9 A;  4LIV A;  4KIT B;  1Y8Q B;  2B63 J;  1YE9 A;  2XPU A;  2BVL A;  3GYH X;  3AL0 C;  1FYL A;  3R4K A;  2E60 A;  2HNH A;  3H5A A;  5JLW A;  2FQ3 A;  2X48 A;  3DKY A;  2EIK H;  4NUB A;  4FE7 A;  4M72 A;  1RUN A;  2ZNY A;  3CD6 I;  4E7S A;  1OR7 A;  4O6J A;  3K4C A;  2JA5 J;  1Y0N A;  3I71 A;  3KLN A;  1D1C A;  2DW4 A;  4P9U A;  4IXA A;  1TW2 A;  2LRE A;  4XLE A;  3VFZ A;  2PN6 A;  4FX0 A;  3UR3 C;  4GCV A;  3SEZ A;  1CF7 B;  4N9I A;  4NQW A;  3SDB A;  3U9G A;  2X6Y A;  1F43 A;  1S72 I;  4B8X A;  3BTC A;  3W3C A;  3NAR A;  5H2F C;  4LLL A;  3LQR A;  3BCA A;  5E3M A;  1YS6 A;  2R7S A;  5IY5 H;  3J80 K;  1ETW A;  2LNB A;  2EB7 A;  4P5O A;  3N97 A;  2A05 A;  2K7L A;  3S3O A;  3GME A;  4E7J A;  3KEY A;  4PSX A;  4IHV A;  1U78 A;  3A1Y A;  4C30 A;  2W1O A;  2FD5 A;  4BU2 A;  1BR2 A;  1ETX A;  1GVJ A;  5HLI A;  4GDF A;  2UWM A;  2BEO A;  1L0O C;  4NC7 A;  4BEH B;  4XNF A;  5FFX A;  3BR2 A;  2BHZ A;  3HHH A;  3UNG C;  1T95 A;  3LAP A;  2DOF A;  3QWL A;  3G71 I;  1HW5 A;  2ZJP F;  4EGY A;  2MW8 A;  2JSC A;  4KDP A;  3QOP A;  3ZPL A;  1SVO A;  1FP1 D;  3TL4 X;  1Z3X A;  3QRF F;  3A4C A;  4HG2 A;  3JRC A;  1ZAO A;  1VQO I;  5CVU A;  1I27 A;  1W5C C;  3JTH A;  2DOE A;  2CV2 A;  2ZFU A;  2L7F P;  2BE5 F;  2WV1 A;  3WGG A;  3HSF A;  4CA0 A;  3CLQ A;  2M1B A;  1GLN A;  1U5T A;  1IRX A;  2MC3 A;  2R7R A;  3E5Q A;  1OCR H;  5HVQ C;  1A5J A;  5DM6 F;  1B9M A;  1BR4 A;  2JRT A;  3HGG A;  4HYE A;  3DQV C;  2G0E A;  3F6O A;  1BC7 C;  4U7D A;  4A3I J;  3DLA A;  1GHC A;  2WB1 N;  1YJW I;  2E7X A;  2BW3 A;  2JVH A;  2ZXI A;  4AYB N;  4LG0 A;  2DT5 A;  2RNJ A;  2XAJ A;  1BM9 A;  4IOA F;  2UUZ A;  3A2K A;  4IJA A;  1FMW A;  1APL C;  5IYC J;  4PGH A;  3SQN A;  1X58 A;  3ECO A;  3K4M A;  2X9D A;  3ZMT A;  2HDD A;  4Z6Y A;  3IH3 A;  4D0P A;  5KAI C;  2K9M A;  3EUK L;  1K6O A;  2ZSI B;  1IDZ A;  2NYX A;  2V1D A;  4YEL A;  4E7I A;  2XPV A;  3FHZ A;  1Y39 A;  5F1R A;  5DS9 A;  2X0L A;  4XSX F;  3S2W A;  2DJN A;  2E34 A;  1ZRD A;  2LYC A;  2Y75 A;  1PDN C;  1G6N A;  5GPA A;  4ZDL A;  2D1H A;  3Q3S A;  3QAH A;  3ASN H;  2GLO A;  4NC6 A;  4CGZ A;  5DYM A;  1TP4 A;  2XGD A;  4R79 A;  3L1P A;  2HKO A;  1KGS A;  3KP2 A;  4N9H A;  1KU2 A;  1Y8R B;  2CJJ A;  1JUM A;  4BHB A;  2RV8 A;  1KU3 A;  2GWR A;  2XRO A;  4A3G J;  1VQ6 I;  4C2M J;  1FTT A;  2A3S A;  4Y17 A;  2OU2 A;  5ICG A;  4WCG A;  2B0L A;  4AVP A;  4IOC F;  4ZYH A;  3I0T A;  2OTL I;  2M30 A;  2KRH A;  1JJ8 C;  1CF7 A;  3LA7 A;  3L2R A;  3Q5F A;  3LSR A;  2A69 F;  3MVP A;  2H6C A;  3NAU A;  4IHS A;  4O3M A;  2I10 A;  3F23 A;  3CLO A;  2NXN B;  3DTE A;  3SZP A;  3M4O J;  2R7F A;  3FIS A;  1OYY A;  1RR7 A;  4KFC A;  2EIL H;  2ACJ A;  2E2I J;  4LIT A;  3PL8 A;  2P4W A;  2KIS A;  3LFK A;  5E1Z B;  3F8F A;  5EF6 A;  3GTM J;  4OIQ F;  2X1C A;  5ILS A;  1QBJ A;  4WWC A;  1G59 A;  2MLK A;  3CZ6 A;  2Z33 A;  2EA4 A;  3DP7 A;  3ABM H;  2COB A;  4L9N A;  1QA6 A;  3IKV A;  2VBW A;  2RQP A;  1ETO A;  1VQM I;  1ZKG A;  1XN7 A;  3MD2 A;  2KPM A;  4MQV A;  4A3E J;  5LHG A;  2BGC A;  4UVB A;  1IXC A;  1HKQ A;  1FBS A;  1TQM A;  2UV1 A;  3BG6 A;  4BEH A;  1TC3 C;  5GP9 A;  3OSG A;  3L2W A;  2GBY A;  2VJ5 A;  1SEU A;  2N8G A;  2GXB A;  2RGV A;  1BI1 A;  3E6B A;  3OYK A;  3BR6 A;  3RCO A;  1QGP A;  2EIN H;  1J75 A;  5GTH C;  4RB0 A;  3WU2 C;  5J47 A;  2KDO A;  4L9T A;  5J3L A;  4JBA A;  4IVN A;  2DLL A;  3DU5 A;  4A3J J;  3LSI A;  1FX7 A;  1NK3 P;  2V1X A;  1B6A A;  3EUH A;  4RS8 A;  2KT0 A;  2FA5 A;  1TQP A;  2V7F A;  3CUO A;  3VYS B;  4RA2 A;  2K02 A;  4A3F J;  2XRL A;  5KK1 A;  1K78 B;  3I4P A;  1MBF A;  4CYC B;  3BTJ A;  3E0J B;  1IV8 A;  3NQO A;  2WAF A;  4KUM A;  1ETV A;  1QHG A;  2DA7 A;  4W1U A;  4P1W A;  1H88 C;  2PJR B;  2JUG A;  4HNV A;  1FNN A;  4BXX J;  2XV4 S;  1XMK A;  1HCR A;  3H36 A;  2ZJ2 A;  4BXF A;  3LQQ A;  2O3F A;  2Z99 A;  1O3S A;  2HPM A;  1P4A A;  2BBY A;  1FLI A;  3PSI A;  4XON A;  1Z05 A;  1EF4 A;  1LFU P;  1V4R A;  5DCM A;  5FKN A;  4EQQ A;  3WG7 H;  1TW3 A;  2EZK A;  1T38 A;  1FY7 A;  3HXL A;  4EEF G;  2QWW A;  4RMN A;  1AWC A;  5D6F A;  1ZHF A;  1MMD A;  2Z3Y A;  2VOD A;  5M3F J;  5BPI A;  3EDP A;  1X1C A;  2XVC A;  1VQ8 I;  2GIZ A;  3EUA A;  1KU7 A;  3TED A;  3H1C A;  4MHG A;  4I2O A;  3GCM A;  1Z91 A;  4JOM A;  3J81 Z;  1OLT A;  3P9K A;  1X1B A;  3GX4 X;  2STW A;  1OKR A;  2MH9 A;  1XCB A;  3CP8 A;  1LPQ A;  2V6E A;  2KRF A;  4HNT A;  2X1D A;  3E97 A;  4E7K A;  1NTC A;  5BOX A;  1ZYR F;  4B1R A;  1XDS A;  4U0Y A;  1VQ9 I;  2CMP A;  2XB5 A;  3L00 A;  2K9Q A;  1TQI A;  4ON0 A;  1OYW A;  5FKO A;  1IAW A;  2O0Y A;  3L7W A;  3VEP A;  2E1O A;  5FGM A;  4WX9 A;  1V5E A;  2XAG A;  3TBI A;  5LRS A;  1YX5 A;  2P5L C;  1Z0X A;  4PZJ A;  3DEW A;  1O7F A;  2AHQ A;  3HTU A;  4LB5 A;  5HLG A;  3S2H J;  1I3Q J;  2X4H A;  3DPL C;  3O2P E;  1MMS A;  5E3N A;  1TZL A;  1SFE A;  5B1A H;  2ZXH A;  2G7U A;  3L2C A;  1FPQ A;  1MJ9 A;  1S7E A;  2QLZ A;  3MWM A;  2R4G A;  3LNQ A;  1T8I A;  1R1V A;  2QQ8 A;  3J7Z I;  2HZD A;  3IP4 B;  3T8R A;  2XUB A;  1TWH J;  2VE9 A;  3R0A A;  2DA2 A;  3DLL F;  5GAG J;  3HOW J;  1AA7 A;  4RAF A;  3TP0 A;  3OYG A;  3JR9 A;  2F2E A;  2QKM B;  5JHF A;  1RUO A;  4G7H F;  4GGG A;  2L9S A;  2OD5 A;  1MBH A;  3TO6 A;  2E2H J;  1HW1 A;  2VIX A;  4DYQ A;  3FXR A;  1SVM A;  3CTA A;  2HYG D;  2ID6 A;  4FX4 A;  4QIW N;  2K85 A;  3U2R A;  2VQH A;  3HKZ A;  1WSU A;  3BC8 A;  3HB9 A;  3KP5 A;  2JT1 A;  2K3P A;  1S9H A;  2NNN A;  4B48 A;  5IP9 J;  2RN7 A;  1QVU A;  4CCN A;  3HHG A;  3MZH A;  2F4I A;  1D0Y A;  2KRC A;  1WGX A;  4BJT A;  5B5E C;  2VBY A;  4BE1 A;  2R7T A;  3I59 B;  3RTR A;  3MFK A;  2LRD A;  3J7A Y;  1N77 A;  2JN6 A;  2K9S A;  1IG7 A;  5D4S A;  3BR0 A;  5GPC A;  2WAQ N;  5GAD J;  1UHS A;  4A3C J;  3ABT A;  1RKW A;  5FFZ A;  2KIU A;  2FUG 2;  4YRV A;  3I4N J;  2M87 A;  3BOQ A;  3GXO A;  2A07 F;  1HDD C;  2JA6 J;  1B59 A;  1CQT A;  1K78 A;  4KN7 X;  4CYC A;  4CHU A;  2P7C B;  1WJC A;  1QPM A;  1ZAR A;  3PQK A;  3C2H A;  5EEG A;  5TIS C;  1H0M A;  2PJR A;  4CCM A;  1ETY A;  1LNW A;  2F5F A;  3JSP A;  3MKZ A;  1OR7 C;  3ESW B;  4C3H J;  3KZY A;  4WXC A;  2KZG A;  2EV0 A;  1MJA A;  4YEJ A;  1X4P A;  2MG4 A;  3LSG A;  1HKS A;  4XBF A;  5LEK A;  5K7Z A;  2QUF A;  3IHU A;  5FLV A;  2O8K A;  2ESN A;  4S05 A;  2EFN A;  2WBM A;  3L2U A;  3F8M A;  3TKY A;  1WH5 A;  1PYV A;  3IH4 A;  4I09 A;  1FSH A;  3K7A J;  4XL9 A;  1O7L A;  4MQ9 F;  4PJL A;  3GO5 A;  3D5S C;  1SD6 A;  4ZTJ A;  4YIF A;  2IGK A;  3BR5 A;  4B09 A;  4IHX A;  1X2N A;  5F1J A;  4KIB A;  5K7F A;  2VT2 A;  2K9L A;  1XC5 A;  2VB6 A;  5F0F A;  2RQQ A;  2CQQ A;  4RAG A;  1MMA A;  4F52 A;  4XOR A;  1HW2 A;  2EV5 A;  3G1O A;  3VOE A;  2CU7 A;  2PMZ N;  3DKW A;  4I02 A;  3CCJ I;  1O3Q A;  2L7M P;  3V8K A;  3K10 A;  1WJA A;  2OC6 A;  3ISP A;  2R5Y A;  3AFH A;  4FE4 A;  2VOP A;  3ZR8 X;  1YRN A;  3BQZ A;  3JRE A;  3MKW B;  1F1Z A;  1FYM A;  5BMZ A;  1HDP A;  1WZ2 A;  1H9G A;  2Z16 A;  3OMY A;  1A36 A;  3M3Y J;  4RB3 C;  2HS5 A;  4FQG A;  5FKM A;  2E71 A;  2EFP A;  3AG2 H;  5HOD A;  3G73 A;  4BL0 B;  4S0H B;  1BBY A;  2HOE A;  5KAF C;  2BXY A;  4IX7 A;  3OV8 A;  3QYB A;  5E3O A;  1UG2 A;  4ZH4 F;  2TDX A;  4HSR A;  4RAZ A;  2ELK A;  2F5C A;  3RJP A;  4D7N A;  2P5V A;  1VI0 A;  1JGG A;  3DPU A;  2W57 A;  1RIO H;  3GW2 A;  3DU6 A;  5ICC A;  2Z2S B;  4DIQ A;  4M6X A;  2IA2 A;  2WV0 A;  4OWR B;  4XOT A;  4F92 B;  4DNC A;  1XMA A;  2CQX A;  2EZI A;  3CCL I;  1REP C;  3CC7 I;  2K40 A;  5ILV A;  4BJ5 C;  1X3U A;  2HZT A;  4A2U A;  2CW8 A;  3BTL A;  3KCC A;  4A0Z A;  4LK1 F;  2CUF A;  2PMU A;  2Q8K A;  4AD9 A;  5EEA A;  3JRA A;  2K5C A;  5IYD J;  3M8F A;  2Y48 A;  1RZ4 A;  5EZG A;  1ZQ3 P;  2ECC A;  2QBY B;  5LD2 C;  4CSW A;  3HRS A;  3ZMU A;  2E5Z A;  2LY1 A;  5L3D A;  4IKF A;  3A0B C;  3B6A A;  3GZ5 A;  3I59 A;  3MKL A;  1XTA A;  4UUS B;  2D1V A;  2HQN A;  3ZXS A;  4RB2 C;  3HOY J;  1FZP B;  3EPZ A;  3TQN A;  1HLV A;  3DTK A;  1ZEL A;  3PIO F;  2BOL A;  3LSP A;  1Q1H A;  2L01 A;  3ML6 A;  4PFP A;  2DMU A;  4KMF A;  4DW6 A;  5AON A;  2W85 A;  1IUF A;  4LK0 F;  4XLH A;  4OMY A;  2Z1D A;  2MD0 A;  5FRO A;  5D8L B;  1E2X A;  3BTI A;  3HRU A;  2XKP A;  2ID3 A;  4M9Z A;  3W6K B;  1G3T A;  3FDY A;  3LA2 A;  4LIU A;  1A35 A;  2IT0 A;  4IHY A;  2L2O A;  2AQE A;  3BWG A;  3D0S A;  4M73 A;  4MLO A;  1XSV A;  3M7G A;  4LLG F;  2HXI A;  2ECB A;  1FP2 A;  3KEO A;  4BHP A;  1XD7 A;  2DBB A;  1QHH D;  3ZQH A;  3FMQ A;  1NHA A;  3ZQQ A;  2PI0 A;  1BL0 A;  2M4G A;  3S16 J;  3LSH A;  5C4X J;  5CVV A;  4C2T A;  4EGZ A;  3RPQ A;  1BIA A;  4XN3 A;  3COA C;  3K4L A;  2HXO A;  3M8J A;  1IN6 A;  1IXR C;  1GVD A;  3A01 B;  2H8R A;  2FBI A;  3FXO A;  3HRT A;  1OCT C;  2IPQ X;  2F5V A;  2CQK A;  2OZ6 A;  2CV1 A;  4FCY A;  3MN2 A;  2M9H A;  2FF4 A;  2M8E A;  4RM2 A;  5IOZ A;  1JHH A;  1DUX C;  1X4O A;  2NS0 A;  1R58 A;  3GFM A;  1QU3 A;  5LBQ A;  1DP3 A;  5FRN A;  2P6T A;  1ZG1 A;  4BAC A;  2LY9 A;  3V7S A;  2DOD A;  4KIF A;  3O8H A;  3BZK A;  4GYG A;  1TT0 A;  1TL8 A;  4BQA A;  2OPT A;  5J4V A;  2IA0 A;  4AID A;  4C3J J;  4CDG A;  4MEY F;  5CYV A;  2E7W A;  3ECH A;  3EUH C;  4PFO A;  2QGU A;  1HXD A;  4XN0 A;  2CYY A;  2HYJ A;  5LGN A;  2DFI A;  3FWE A;  2DFE A;  2CSO A;  3E5X A;  3JRG A;  1MNE A;  1HC8 A;  2DFF A;  5AIQ A;  4FT8 A;  1IUY A;  2VQL A;  4AIJ A;  1LFB A;  1P92 A;  2ISY A;  1W0U A;  1P6R A;  3WGI A;  1U8R A;  1XSD A;  5HOO A;  4P9F A;  3ZGK A;  3CUQ B;  5HDN A;  2VPL A;  4CCK A;  4FTH A;  2A5W A;  4GO1 A;  2PX9 A;  1ZR2 A;  5HLH A;  5HNH A;  4ZYD A;  4BJ6 C;  2KFD A;  4IL6 C;  3GF2 A;  4B4C A;  2GOX B;  3NRV A;  2EQR A;  3SZG A;  4HDV A;  3GFI A;  2M34 A;  2FBH A;  2QBY A;  2ZCW A;  1T56 A;  4G7Z F;  1GUU A;  1SFU A;  1XGN A;  1RC9 A;  2L54 A;  1OYI A;  1J9I A;  3A02 A;  5CVR A;  1XGO A;  3AAF A;  4HDU A;  5FLX Z;  3GTO J;  3RSN A;  4UUS A;  2GM4 A;  4AM3 A;  3KEQ A;  1XG1 A;  5DD8 A;  5FO5 A;  5GAH J;  3UKG A;  2KZV A;  2L4A A;  1IN4 A;  2PG4 A;  1G4D A;  1XS9 A;  1FSE A;  1POG A;  1SFO J;  1YW9 A;  2DK5 A;  3NEU A;  3DPT A;  4ZYA A;  5DM7 F;  1HQC A;  4M9S A;  1BJZ A;  3L09 A;  3RKW A;  3OYL A;  2JQ7 A;  1TWG J;  4ZZL A;  4M6V A;  2ZXJ A;  1ZLJ A;  4CUG A;  1ZRE A;  3CC2 I;  1VQN I;  2LDU A;  4EJO A;  1QVT A;  3H0D A;  3S1R J;  4BXU A;  2F4O B;  1YLF A;  1LE8 B;  5D4R A;  1LQ1 A;  5GTI C;  3ZQ7 A;  2L7K A;  5KCM A;  3GUD A;  3BR1 A;  1MMN A;  4M74 A;  1XSX A;  5FD5 A;  3VPR A;  2NOG A;  1U6G A;  5IT9 Z;  2R0Q C;  5HS8 A;  3I55 I;  4I99 C;  1QPI A;  4W97 A;  2Y9Y A;  4XRS A;  1YS7 A;  2PFB A;  3O6B B;  2QM3 A;  1OCZ H;  2XGE A;  4KA4 A;  1FIP A;  2IRF G;  3WTZ A;  1EKE A;  5E3L A;  3A01 A;  1AOY A;  1GV2 A;  1H89 C;  2YS9 A;  1R5H A;  2HI3 A;  2J5O A;  5D5X B;  1Y1V J;  2VC1 A;  4J19 A;  3TO9 A;  5D6E A;  1SMT A;  3SDG A;  3KX2 A;  3WTY C;  1MGT A;  3WTW C;  2DA5 A;  1ZGW A;  3K2A A;  3T5X A;  4H0E A;  3VSL A;  2Y0S A;  3FXQ A;  3WHB A;  4X0G A;  3E5U A;  3REO A;  3CMY A;  3KET A;  4B43 A;  2O5R A;  3HG9 A;  2PQ8 A;  3RYP A;  3B02 A;  1O57 A;  2W82 A;  2JA7 J;  1AKH B;  5J1U A;  4MTE A;  2NS8 A;  4M3D A;  4ZZD A;  2GA1 A;  4KIG A;  1MW7 A;  4LJZ F;  3OIQ A;  1TBX A;  3T0Y A;  1ZK8 A;  4BGD A;  1P7I A;  5DCM B;  2H1L A;  5LHH A;  4HLY A;  1MBE A;  1Z77 A;  3BG7 A;  3P5J A;  1PJR A;  4BYY A;  4YFN F;  2Y9Z A;  3SFI A;  2EWN A;  1BOA A;  1B8I B;  4HW0 A;  5FLX K;  4ZTF A;  3CMM A;  1YHQ I;  2G9W A;  2DQL A;  3CUQ A;  2A6H F;  1Q1V A;  1IF1 A;  1WJD A;  4RGU A;  3OOP A;  2ELJ A;  2CW0 F;  2X6O A;  1Y0U A;  4PK4 A;  2K4J A;  2L9R A;  3CCM I;  3BG9 A;  4OOI A;  2UXN A;  4HF1 A;  3HEF A;  2VON A;  3PFY A;  2HVS A;  3GEZ A;  2H09 A;  2LY2 A;  3BP8 A;  4L5J A;  2NS7 A;  2IS1 A;  2AXT C;  3BT9 A;  2E35 A;  2XAS A;  4N0B A;  2A61 A;  4RBO A;  2LD5 A;  2HYF A;  2QF7 A;  1RR8 C;  1JTY A;  4OIO F;  3F0C A;  4PJJ A;  2KKO A;  1MIJ A;  1QQI A;  4MFE A;  2LFB A;  4OIP F;  3K1P A;  2VKV A;  1V3F A;  1XMX A;  1YW7 A;  1VQ5 I;  4KT6 A;  4BY1 J;  1S7A A;  3Q9V A;  4A0Y A;  2DTZ A;  2YSR A;  1Y6I A;  1JKP C;  5IT9 K;  2HQ5 A;  3LWF A;  1STZ A;  4ZYE A;  1B9N A;  1JGS A;  2EFW A;  1PP7 U;  2D5V A;  1T98 A;  1LE8 A;  5K5O A;  1IC8 A;  4A6E A;  1YQA A;  1MJB A;  5CKT A;  3PUB A;  1VFC A;  3CDL A;  3H3Z A;  2FEZ A;  3M07 A;  2BY2 A;  1RI7 A;  4G12 A;  2XIG A;  4PDK A;  3FX3 A;  3HOT A;  2MGQ A;  3JCU C;  2YU9 J;  5FRM A;  1N25 A;  2LC2 A;  1VQK I;  2FNP A;  4JP0 A;  4R1H A;  3C2B A;  4L9J A;  2O7O A;  2Q1Z B;  2QSG X;  1SD4 A;  2XAF A;  4ESF A;  4KN4 X;  2V9K A;  3BZC A;  4II2 A;  4ASN A;  4D5F A;  4S04 A;  2EZL A;  4R8H A;  3HRM A;  4IQ4 A;  2VXZ A;  1FIA A;  2QA4 I;  1A6Q A;  4BKX A;  3CCY A;  3U1K A;  4DJA A;  1X2M A;  3ZN1 A;  1ERD A;  6PAX A;  4G94 A;  2CUZ A;  4F7Z A;  1F5T A;  2DI3 A;  3V7R A;  2RRE A;  1LEB A;  1QZZ A;  4XR6 A;  2NVU B;  4F55 A;  2KIF A;  1T39 A;  1JHF A;  4M3G A;  2RKH A;  1MBG A;  2E1M B;  2JSP A;  2ISZ A;  2JZY A;  2M45 A;  3K4J A;  1S8N A;  3SZT A;  5LRR A;  4BQO A;  5M5X J;  2DMQ A;  2F48 A;  3CMA I;  4CCL A;  2EPF A;  2F5E A;  3WE3 A;  3JRF A;  1IV6 A;  1A04 A;  2BZT A;  2G7H A;  1ZLK A;  4CZC A;  2FBK A;  2HGC A;  1LVA A;  1HKT A;  4L5I A;  1KA8 A;  5IT3 A;  3RKQ A;  1W36 D;  3CO6 C;  2LTP A;  3PM1 A;  5ERI A;  4GXO A;  3ONQ A;  1AKH A;  2H1K A;  5E17 F;  3WE2 A;  5ED4 A;  3KP7 A;  2V9V A;  2IJL A;  1ETK A;  1X1D A;  1RKT A;  2DQR A;  3WG9 A;  3RPU D;  3FIW A;  3QU3 A;  3RQI A;  3K69 A;  4BAY A;  1G3W A;  1ORK A;  3BZ6 A;  1JXS A;  5E20 A;  3S17 J;  2JUC A;  5L3F A;  1FOX A;  1MD0 A;  2DMT A;  2PBI A;  2QQA A;  3HZJ A;  3H9Q A;  5J1R A;  1B8I A;  4D7M A;  4HV6 A;  5LLQ A;  1NG7 A;  2BY3 A;  2UXX A;  4A5N A;  2HVR A;  2STT A;  4FET A;  1FBQ A;  5E8I A;  4XLC A;  1D8J A;  3TW6 A;  4ANJ A;  4XID A;  3W2A A;  4XKB A;  1YW8 A;  3W2W A;  2RDP A;  3OS0 A;  3E6C C;  3IAM 2;  1JTX A;  4U87 A;  5JHU A;  2DCE A;  2JMW A;  3KP6 A;  5IP6 A;  5L3B A;  3PFI A;  4JX4 A;  2FMY A;  2R5Y B;  1OCP A;  1I1S A;  5L3G A;  3QPL A;  1YRN B;  4L0Y B;  1PVE A;  1I6X A;  4E4H A;  4E7L A;  1BI2 A;  5KHD A;  1YI2 I;  2FJ1 A;  4IRG A;  2TRT A;  4HRI A;  5JI6 A;  2Q0O A;  1B1B A;  2P8T A;  2QEX I;  1DP7 P;  3MQ0 A;  1G3S A;  1V5G A;  2Y31 A;  2VXD A;  1U9O A;  2IAI A;  4KJZ A;  3RQ4 A;  2F6C A;  2VBZ A;  3RYR A;  3Q0U A;  4XRF A;  3ZP5 A;  1OFC X;  2LR8 A;  4G9Y A;  1IRZ A;  4EMS A;  4XMY A;  5B66 C;  1D1B A;  1FOK A;  3CF2 A;  3GZN B;  1IN7 A;  2O8X A;  3IWZ A;  4Q4Z F;  3BG5 A;  1R1T A;  2VPR A;  2CFO A;  1LUJ B;  3B73 A;  4QLC U;  4DBQ A;  2Z9O A;  1J09 A;  4CH7 A;  5LGU A;  4IQJ A;  2ZFW A;  2M5W A;  5C44 J;  3NWT A;  3JSO A;  2W7N A;  4I6Z A;  3S1Q J;  5EEH A;  3ZQF A;  3LFU A;  3JRI A;  3CCE I;  3K1N A;  3MZ8 A;  2PLY A;  1MMG A;  2RVC A;  1RRJ A;  2X6X A;  4EM2 A;  2MA3 A;  3WU0 A;  5D5V B;  2XDV A;  1UAA A;  3FMR A;  1YOV B;  4FHT A;  3J7A O;  4L9V A;  3QYE A;  3CJQ B;  5F64 A;  2EIM H;  3H92 A;  1BC8 C;  4V2F A;  4UY8 I;  3LSJ A;  3S93 A;  5IP7 J;  3QYF A;  1M1E B;  2KJB A;  4JX5 A; 
#chains in the Genus database with same CATH homology
 1FJL A;  3BTI A;  5EYR A;  1ETW A;  2ID3 A;  4IHY A;  4IHV A;  1U78 A;  1BW5 A;  4MLO A;  2FD5 A;  3IV5 A;  2HXI A;  1ETX A;  2ECB A;  4AUX A;  1U9N A;  5F27 A;  2NVY J;  3HOU J;  5F08 A;  3ZQH A;  3FK7 A;  1BL0 A;  1JUS A;  3S16 J;  5C3E J;  2VKE A;  5C4X J;  3BR2 A;  1ZTR A;  2DN0 A;  3I4M J;  3CQZ J;  2HXO A;  3SJM A;  1O4X A;  2LLK A;  2MW8 A;  1GVD A;  3A01 B;  2H8R A;  5DTD A;  1T33 A;  1ITY A;  2LK2 A;  1OCT C;  3JRC A;  4X1E A;  1IJW C;  1TWC J;  5F0H A;  2DMN A;  4FCY A;  2XB0 X;  3MN2 A;  2L7F P;  1NK2 P;  2WV1 A;  2M9H A;  4NDL A;  5IOZ A;  5FLM J;  2DMP A;  1A5J A;  2LY9 A;  2LVS A;  3HGG A;  2G0E A;  3ZOB A;  1PUF B;  4A3I J;  3O8H A;  1JT6 A;  3ZQG A;  3JRD A;  1BW6 A;  2WB1 N;  4LOC A;  4XIC A;  4AYB N;  2W48 A;  3BQY A;  2OPT A;  3OSF A;  1K83 J;  4C3J J;  4RDU A;  1BA5 A;  1APL C;  3QPS A;  5IYC J;  1JT0 A;  1X58 A;  4IHW A;  2X9D A;  2HYJ A;  2HDD A;  3IH3 A;  3G1M A;  3JRG A;  1IDZ A;  3S1M J;  4XRS G;  2XPV A;  4Y7N J;  3D1N I;  5DS9 A;  4BBS J;  1LFB A;  2DJN A;  2MSY A;  1MBJ A;  4ABZ A;  1W0U A;  5GPA A;  3ZQC A;  4I76 A;  3HKZ N;  3Q3S A;  1JKQ C;  2XSD C;  4FTH A;  2GLO A;  1ZR2 A;  4JYK A;  2K9N A;  2R93 J;  4B4C A;  2XGD A;  4XK4 A;  3TP3 A;  2EQR A;  2NVX J;  3L1P A;  2M34 A;  1MBK A;  3S14 J;  4MO7 A;  3BG3 A;  1T56 A;  2CJJ A;  1GUU A;  1JUM A;  1IGN A;  3A02 A;  3OIO A;  4A3M J;  4A3G J;  3GTO J;  4C2M J;  1FTT A;  4M3B A;  2Y2Z A;  4UUS A;  1AHD P;  2GM4 A;  1XG1 A;  3UKG A;  2R7Z J;  1XS9 A;  3GTG J;  1POG A;  2E19 A;  1SFO J;  3S15 J;  1JJ8 C;  3HOZ J;  4M3E A;  3LSR A;  1BJZ A;  2HOA A;  1TWG J;  3MVP A;  3NAU A;  4M6V A;  2I10 A;  4BY7 J;  1QVT A;  4DYC A;  3M4O J;  3FIS A;  1RR7 A;  4A69 C;  3S1R J;  2E2I J;  5EF6 A;  1WCM J;  2JK3 A;  1LE8 B;  3G1L A;  2QCO A;  2ME0 A;  3GTM J;  4M3F A;  3BR3 A;  3RZO J;  5IPA A;  5JLX A;  3BR1 A;  3VPR A;  2COB A;  2NOG A;  1ETO A;  2OF7 A;  1ZKG A;  1U8B A;  2R0Q C;  2ZB9 A;  4A3E J;  1ZR4 A;  1QPI A;  1TWF J;  1TC3 C;  4W97 A;  5GP9 A;  3OSG A;  2Y9Y A;  1MNM C;  4XRS A;  1WH7 A;  1HF0 A;  3JRB A;  2JWT A;  2GBY A;  2N8G A;  2XGE A;  3BR6 A;  1FIP A;  3A01 A;  5E3L A;  2R5Z B;  1GV2 A;  5EZH A;  2YUS A;  1H89 C;  1IDY A;  2YS9 A;  5FKL A;  2HI3 A;  1Y1V J;  3FKI J;  5J3L A;  4A3J J;  4J19 A;  3SDG A;  1NK3 P;  1MH3 A;  2KT0 A;  2IEK A;  5M5W J;  3HOV J;  3Q0W A;  4A3F J;  2DA5 A;  1ZGW A;  1H8A C;  3WHC A;  2XRL A;  3K2A A;  2VUM J;  1I6H J;  4UUT A;  1MBF A;  4CYC B;  1K61 A;  3BTJ A;  2CRG A;  4DYR A;  1ETV A;  4IEJ A;  4B3A A;  2DA7 A;  3HGY A;  4W1U A;  3WHB A;  3HDD A;  1H88 C;  4HNV A;  1PUF A;  2O9L A;  3CMY A;  4BXX J;  1HCR A;  3PO3 J;  1MH4 A;  5C4J J;  3JRH A;  2VI6 A;  5F0C A;  2Y30 A;  2E2J J;  1EF4 A;  2EBI A;  1ETQ A;  1LFU P;  2JA7 J;  5FKN A;  1AKH B;  5J1U A;  1G2H A;  2NS8 A;  1MSF C;  4M3D A;  4GFB A;  2EZK A;  2NVT J;  4EEF G;  1ZK8 A;  4FIS A;  1P7I A;  5M3F J;  5M5Y J;  3Q0V A;  2AO9 A;  1MBE A;  1Z77 A;  2Y9Z A;  3TED A;  1RPW A;  3DCF A;  3SFI A;  2DA4 A;  1B8I B;  4A3K J;  1F36 A;  1WPK A;  3TW7 A;  2EH3 A;  1Q1V A;  1TWA J;  4AC0 A;  5EGO B;  1JKR C;  1NTC A;  2X6O A;  4B1R A;  2XB5 A;  1E3O C;  2K9Q A;  2DA3 A;  3HM5 A;  2L9R A;  3BG9 A;  5FKO A;  3HEF A;  4DZP A;  2E1O A;  4QTR A;  1OJL A;  3W6V A;  2L0K A;  2NS7 A;  3BT9 A;  1Z0X A;  1DU0 A;  3DEW A;  4RBO A;  1RES A;  2LD5 A;  2AHQ A;  3S2H J;  2QF7 A;  1I3Q J;  1JTY A;  3F0C A;  2DA1 A;  2LKX A;  4MFE A;  5E3N A;  2LFB A;  1ENH A;  2VKV A;  1S7E A;  4BY1 J;  3A03 A;  2DTZ A;  3LNQ A;  4MIM A;  1JKP C;  5J1Y A;  2HQ5 A;  3ZQI A;  1TWH J;  3GTL J;  2DA2 A;  3HOW J;  2D5V A;  1LE8 A;  3TP0 A;  3JR9 A;  1IC8 A;  1B72 B;  5FJ8 J;  1QRY A;  4JX6 A;  4MFD A;  4L5E A;  1VFC A;  3CDL A;  1MBH A;  4G12 A;  3H3V K;  2YU9 J;  2TCT A;  2MGQ A;  1SAN A;  2E2H J;  4X6A J;  5EDN A;  1UMQ A;  4JP0 A;  4DYQ A;  3C2B A;  2O7O A;  2ID6 A;  4D5C A;  4QIW N;  1VND A;  4D5F A;  3GTJ J;  2EZL A;  3HB9 A;  1W0T A;  5IP9 J;  1FIA A;  1QVU A;  3S2D J;  1FEX A;  2ME6 A;  1GV5 A;  4BKX A;  9ANT A;  4BBR J;  2IBD A;  1WGX A;  3CCY A;  5EG0 B;  2R5Z A;  2HOT A;  1JKO C;  1X2M A;  2JN6 A;  2K9S A;  2LP0 A;  1IG7 A;  3BR0 A;  3QQA A;  5GPC A;  2WAQ N;  1UHS A;  5K7H A;  2M2E A;  4A93 J;  4A3C J;  4M3G A;  1RKW A;  1MBG A;  3I4N J;  3B6C A;  1HDD C;  2JA6 J;  2XPW A;  1CQT A;  3FK6 A;  5IYB J;  5BNG A;  4CYC A;  3HOX J;  4DZJ A;  2CUE A;  5M5X J;  4A3L J;  2JJ7 A;  2DMQ A;  4C3I J;  1ETY A;  1JJ6 C;  3JRF A;  1IV6 A;  3E7L A;  4C3H J;  4A3B J;  2DA6 A;  2MG4 A;  3LSG A;  4A3D J;  5K7Z A;  5FLV A;  3RKQ A;  2EZH A;  2LTP A;  3PM1 A;  2H1K A;  1AKH A;  2O8K A;  5FKK A;  1ETK A;  1RKT A;  1WH5 A;  4QSH A;  3HBL A;  3IH4 A;  2XGC A;  3FIW A;  3H0G J;  2RAE A;  3K7A J;  3RQI A;  2FX0 A;  1ORK A;  3LOC A;  1WI3 A;  1DU6 A;  3S17 J;  2DMT A;  1GDT A;  3BR5 A;  1MSE C;  3O8G A;  1X2N A;  2L7Z A;  5F1J A;  5K7F A;  5J1R A;  1B8I A;  1XC5 A;  4IHX A;  2M0C A;  5F0F A;  2CQQ A;  4D7M A;  3G1O A;  5EGO A;  2CU7 A;  2PMZ N;  3GTP J;  4Y52 J;  3TW6 A;  2FQ4 A;  4XID A;  2L7M P;  2R5Y A;  4FE4 A;  1RET A;  1YRN A;  3BQZ A;  3JRE A;  1HDP A;  5IOY A;  2M8G X;  3IH2 A;  1JTX A;  2JA8 J;  3M3Y J;  2JMW A;  5IP6 A;  5FKM A;  4JX4 A;  5HOD A;  2R5Y B;  1VF9 A;  4S0H B;  1OCP A;  5M3M J;  1YRN B;  3QPL A;  3GBG A;  3PO2 J;  5E3O A;  1UG2 A;  2FJ1 A;  2TRT A;  2HOS A;  2ELK A;  1Y1W J;  4D7N A;  1P7J A;  3RZD J;  1VI0 A;  1JGG A;  1JUP A;  2Y31 A;  3GTQ J;  1U9O A;  2IAI A;  3Q0U A;  1B72 A;  1OFC X;  2LR8 A;  4V2G A;  1IRZ A;  2R92 J;  2NVQ J;  2KDZ A;  2CQX A;  2EZI A;  2K40 A;  3GTK J;  4XRM A;  3BG5 A;  2VPR A;  5F04 A;  2B63 J;  1HOM A;  3BTL A;  1FTZ A;  2XPU A;  1R9T J;  3OOU A;  2CUF A;  2P81 A;  5C44 J;  5EEA A;  4I6Z A;  3JRA A;  1D5Y A;  3S1Q J;  1A6I A;  3ZQF A;  5IYD J;  5JLW A;  3JRI A;  1GT0 C;  1AU7 A;  2X48 A;  5EZG A;  1ZQ3 P;  3S1N J;  2ECC A;  4FE7 A;  5EG0 A;  2JA5 J;  1I50 J;  3B6A A;  3MKL A;  4UUS B;  3HOY J;  1HLV A;  3LSP A;  4V2F A;  2Y0S N;  2DMU A;  3LSJ A;  3ZQL A;  4DW6 A;  1F43 A;  5IP7 J;  1IUF A;  3BTC A;  3NAR A;  5E3M A;  4JX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...