2ME0A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens solved in the presence of the dna sequence cgactaattagtcg
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens solved in the presence of the DNA sequence CGACTAATTAGTCG
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2me0A00
2OPTA 4BBRJ 1JJ6C 3S2HJ 4JP0A 4AC0A 2NVTJ 4FTHA 4B3AA 1I6HJ 2ID3A 3DEWA 3G1OA 4D7MA 3FIWA 2DA3A 1POGA 2CUEA 4DZPA 1U8BA 4L5EA 4W97A 3A01B 1FTTA 3M3YJ 3CDLA 3L1PA 3TW6A 4X1EA 2M9HA 2JA7J 4A93J 3QPSA 3GTQJ 2ECCA 1GV2A 2EZLA 1ZGWA 4BY7J 3CMYA 3FISA 4V2FA 2P81A 3DCFA 1BL0A 2O8KA 4UUTA 3ZQCA 3VPRA 3MN2A 2YUSA 5IYCJ 2JA8J 1K83J 3HKZN 3HEFA 5M3FJ 1MNMC 1XS9A 1P7JA 3Q3SA 3JRDA 1APLC 4EEFG 1GDTA 4A3DJ 2X48A 3GTPJ 4RBOA 1UG2A 2HQ5A 3S2DJ 2HXOA 4C2MJ 4W1UA 1FIAA 2R5ZA 1BW6A 1IRZA 1BW5A 5HODA 3PO2J 4A3BJ 5J1YA 2ECBA 1AU7A 4S0HB 3ZQGA 3S15J 3GTKJ 1WGXA 2NVYJ 2DMQA 1JKRC 3LSGA 2LLKA 5F0HA 3FK6A 1OFCX 1RKWA 5IP6A 2CQXA 2R5ZB 3ZQLA 1JUMA 1WH5A 2EZKA 2TRTA 2B63J 2HOTA 3RKQA 5FJ8J 3BQZA 5FKOA 2OF7A 3I4NJ 3TP0A 1QRYA 4A3EJ 3JRCA 2R5YA 1IDZA 5IYDJ 5JLWA 1TWCJ 4C3IJ 3GTOJ 5K7ZA 1G2HA 2XGCA 1GVDA 1JUSA 3Q0UA 3LSPA 2XPUA 3BR3A 2LP0A 2Y9YA 1LFUP 5BNGA 1WI3A 4LOCA 4A69C 1ETKA 1GV5A 3BG9A 3IV5A 1RETA 3TW7A 2R5YB 5M3MJ 1JKOC 4Y7NJ 4D5CA 1HLVA 2XB0X 2ZB9A 3JRGA 1UHSA 1IV6A 3IH3A 2XPVA 5C4JJ 3S1MJ 1W0UA 4DW6A 4D7NA 1JT0A 5E3NA 5J3LA 3JRFA 3QPLA 5F04A 4A3KJ 4XRMA 5FLVA 1U78A 2JN6A 3BTLA 2LKXA 2I10A 1XC5A 2EBIA 5IP9J 1MBEA 1HOMA 3JR9A 1Q1VA 4ABZA 2R93J 1HDDC 1B72A 3MVPA 1MBFA 1X2NA 2G0EA 2E1OA 3QQAA 4QIWN 5C3EJ 3E7LA 1MBHA 2E19A 5FKMA 2DMUA 3A02A 3HOYJ 5F27A 2M0CA 3ZQFA 2MG4A 2DA4A 4AUXA 1AHDP 1ZQ3P 3SDGA 5J1UA 2DA5A 1B72B 1TWFJ 1FJLA 3LSJA 1JUPA 5EDNA 4FE4A 1LFBA 4A3GJ 3HB9A 3GTLJ 3ZOBA 2EQRA 4HNVA 1ETXA 2CRGA 5EG0A 4QSHA 1T33A 2E2HJ 2CU7A 3GTJJ 1K61A 3PO3J 3K7AJ 3HOZJ 3FKIJ 4MLOA 4V2GA 5F1JA 2R0QC 1E3OC 3IH4A 4I6ZA 2N8GA 5EG0B 3HDDA 2NS7A 3SFIA 1HDPA 4MFDA 2L9RA 3S14J 3LNQA 2ID6A 3JRAA 3NARA 4Y52J 3H0GJ 2L7ZA 4UUSB 2D5VA 4M3EA 1X58A 4C3JJ 1JTXA 4M3BA 3OIOA 2VUMJ 2L7MP 2ME6A 4A3FJ 1ENHA 5IYBJ 1I50J 1RKTA 1SFOJ 3BR0A 3BG3A 1P7IA 3UKGA 5JLXA 2HI3A 2M34A 3S17J 2COBA 4JX6A 1PUFA 2VKVA 3WHBA 5IOYA 1F36A 5EZHA 3JREA 1Y1VJ 4DYQA 2XB5A 4A3IJ 2EH3A 5C44J 4MFEA 4X6AJ 3BR5A 1IDYA 1BJZA 1JTYA 3HBLA 1VFCA 2RAEA 2HOSA 5M5WJ 3JRHA 2K40A 2LFBA 3D1NI 4FE7A 2W48A 1PUFB 3BR6A 3A03A 1FEXA 3BTCA 3O8GA 1JGGA 2ELKA 3BTIA 3S16J 1MBGA 4IEJA 4M3GA 1NK2P 1ETYA 1IC8A 2GBYA 5M5YJ 4G12A 5GP9A 3K2AA 2YU9J 4FISA 4JYKA 4DYCA 4DZJA 5K7HA 2HOAA 2JJ7A 1HF0A 2DA1A 3H3VK 3ZQHA 1H89C 4I76A 2VKEA 4B1RA 1GT0C 2IBDA 2HXIA 1QVTA 1EF4A 3F0CA 3CQZJ 3B6AA 1MSFC 2K9SA 2EZHA 1ETVA 5FKNA 4A3MJ 1LE8A 2XGDA 5IPAA 5FKKA 1Z0XA 2DMNA 4BXXJ 2JA5J 1RESA 2DA2A 1TWAJ 3PM1A 1WCMJ 4XICA 4J19A 2Y31A 3BQYA 5EEAA 1VF9A 1WPKA 5IP7J 1YRNA 3JRIA 4A3LJ 2XPWA 1LE8B 2R7ZJ 3GTMJ 5IOZA 2Y9ZA 3OSFA 1FTZA 2K9NA 2GM4A 5EZGA 2DMPA 2WV1A 1TWGJ 2VI6A 2K9QA 1YRNB 2L7FP 2PMZN 4M3FA 3I4MJ 2DA6A 5FKLA 1R9TJ 1MSEC 3RZDJ 2IEKA 2M8GX 5K7FA 1IUFA 3JRBA 2GLOA 2MW8A 1D5YA 1XG1A 2EZIA 3HGYA 5M5XJ 4IHXA 2Y2ZA 9ANTA 1FIPA 5F08A 3HOUJ 2CQQA 4C3HJ 1ZR2A 4UUSA 1A6IA 3MKLA 4B4CA 2FX0A 2XGEA 3S1QJ 3NAUA 1B8IA 2WB1N 1SANA 5F0CA 5FLMJ 2X9DA 3LSRA 2ME0A 4JX5A 2H8RA 2AHQA 1ITYA 5EYRA 3TEDA 2WAQN 1ETQA 2LD5A 1ETWA 4QTRA 1ETOA 2XRLA 2AO9A 3HM5A 2LTPA 2HDDA 3BG5A 2L0KA 2HYJA 3BTJA 4XK4A 1O4XA 2DJNA 2JMWA 5E3OA 1B8IB 1HCRA 2X6OA 1F43A 3G1LA 3BR1A 5J1RA 3M4OJ 2M2EA 2JA6J 1ORKA 3OSGA 5F0FA 3C2BA 4D5FA 2Y0SN 1BA5A 3BR2A 3FK7A 5GPCA 1DU6A 4A3CJ 2CUFA 2QF7A 1UMQA 2Y30A 4BBSJ 1Z77A 3GBGA 2NVXJ 1WH7A 2FQ4A 3Q0VA 4XIDA 2DMTA 1W0TA 1JKPC 1X2MA 1MH3A 1IGNA 4M6VA 1NK3P 1RPWA 4XRSA 5DTDA 3IH2A 2KDZA 1TWHJ 4JX4A 3HOVJ 2LY9A 2DA7A 1U9OA 1JT6A 1MBJA 3WHCA 1QPIA 1VNDA 3B6CA 2H1KA 1JKQC 3RQIA 1RR7A 1DU0A 1ZR4A 2NS8A 2DTZA 2MGQA 2FD5A 5C4XJ 4GFBA 2JK3A 4MO7A 1TC3C 1IJWC 1S7EA 2DN0A 2IAIA 3G1MA 1OCPA 5EF6A 2E2JJ 2CJJA 4MIMA 4NDLA 1AKHA 4BY1J 1ZKGA 4M3DA 1CQTA 4DYRA 3SJMA 1ZTRA 1MH4A 2FJ1A 2QCOA 1I3QJ 2XSDC 1A5JA 2VPRA 1H88C 1JJ8C 1VI0A 5EGOA 3HGGA 3GTGJ 3S1RJ 3ZQIA 3OOUA 1AKHB 2O9LA 4AYBN 5E3MA 1Y1WJ 4XRSG 2TCTA 3HOWJ 3BT9A 2KT0A 4RDUA 2JWTA 1MBKA 2LK2A 4IHVA 2NVQJ 1GUUA 5EGOB 1QVUA 3Q0WA 2YS9A 3TP3A 4BKXA 3LOCA 3CCYA 4IHWA 3W6VA 2MSYA 4IHYA 2NOGA 4CYCA 1H8AC 4A3JJ 5GPAA 1U9NA 1IG7A 2E2IJ 1NTCA 3HOXJ 1OJLA 1T56A 3O8HA 5DS9A 3S1NJ 2O7OA 4FCYA 2LVSA 1ZK8A 3A01A 1OCTC 3RZOJ 2LR8A 4CYCB 2R92J 5E3LA
chains in the Genus database with same CATH superfamily
1X1AA 2FE3A 2NVTJ 2K7LA 2R7XA 2LH9A 3E5XA 3CCVI 4FX0A 4FETA 2ID3A 4BHPA 5A2QK 3DEWA 5IT3A 4D7MA 3FIWA 2DA3A 1EV7A 4DZPA 3EUHC 3WU0A 3LFKA 4AVZA 3TW6A 5DD8A 4U7BA 2ZJRF 1QU3A 2J5PA 2M9HA 3KZYA 3RKYA 3HSFA 5E8GA 2XROA 1ZARA 4BY7J 3FM3A 1WHUA 4MQ9F 2VIXA 2AXTC 4UUTA 2IS2A 5CVUA 4CCNA 4I98B 3MN2A 2YUSA 1KU3A 4OIPF 1K83J 3HKZN 3CTAA 3IWZA 2IA0A 4HA8A 3Q3SA 4RAFA 4A3DJ 2X6WA 1P92A 2W1OA 3K4BA 2W00A 4L5IA 3GTPJ 4XLAA 4RBOA 4XSXF 3S2DJ 2LF7A 2Q2EA 4LG0B 1X3UA 2FRHA 2IA1A 1UG0A 2QZ8A 1BW6A 2DU9A 5HDGA 5HODA 3PO2J 4A3BJ 5CVRA 1AU7A 4X0GA 1Z6RA 3CO7C 3G6EI 2FNAA 3OYDA 3S15J 1XD7A 1XGSA 2PJPA 2FOKA 2NVYJ 2DMQA 2IS6A 2DT5A 3LA7A 4GRIA 1Q1HA 2BZTA 2ZBKA 4Y33A 1S3JA 1T6SA 3H92A 1FOYA 1L0OC 2EZKA 4KIBA 1BOBA 2K9LA 4BXUA 2WTEA 5HLTA 3RKQA 4PSWA 1YW7A 3BQZA 4KN7X 1WKMA 1KZHA 4HX8A 4KITB 3I4NJ 3HRMA 4HBLA 2QQ9A 3JTHA 1SAXA 2EA4A 5IYDJ 3DBHB 2HVSA 1NG7A 2EA2A 4RB0A 4FQGA 1GVDA 2VJ5A 4RGSA 1KU7A 4XN3A 3LSPA 5FRNA 1GHCA 2OBPA 4CA0A 4RGXA 2K85A 3ASNH 5BNGA 3JCUC 4HAMA 1ETKA 1EJ9A 2HQRA 3BG9A 3A0HC 2R5YB 2DDBA 3HPGA 4P96A 1JKOC 4LIVA 2R7DA 2IT0A 3LSMA 3QRFF 2EK5A 1X3ZB 4EV0A 2A05A 3KETA 2IRFG 5HOOA 5E3NA 2BXYA 4ZTJA 1YJNI 3DQVC 1TW2A 3V8JA 4L0ZB 5HS7A 2NS0A 2HU9A 4XRMA 5FLVA 1LDDA 4YIFA 3VSKA 3ZMDA 3MWMA 3DTKA 3RSNA 5CYVA 3OY9A 4IRHA 1Q1VA 3F22A 4AIHA 4Z2YA 1Y6IA 1B72A 4OIQF 2VONA 3MVPA 1YE9A 4XONA 1SFUA 4L9TA 1LKXA 2KHMA 1W7PD 4PGGA 3L2CA 2NAZA 3A02A 2CQ7A 2VXZA 3HOYJ 3AL0C 2M0CA 3ZQFA 2EILH 4RA2A 2VQGA 2XKOA 2HVQA 3CUOA 2OC6A 4XORA 5J1UA 3EQLF 2DA5A 1MNEA 1FJLA 4B43A 3J80Z 2XRNA 1TQPA 2P6TA 1W5CC 1LFBA 4HPQA 3SEQA 1BJAA 1YFHA 5D5WB 4KIFA 1WRJA 2COMA 5EG0A 4QSHA 3HOSA 1XMXA 4IVNA 4HLXA 5J40A 1S29A 2ISYA 1K61A 5ED4A 3BJ6A 3QOPA 3PO3J 2UXXA 5ICGA 4KUMA 5JVGF 5ERIA 1G4DA 1B4AA 1V5FA 1P4WA 4RM3A 2DYSH 3HRSA 3OR2C 4L18B 3E6MA 1E17A 1XPXA 1F9NA 3VWBA 3ECHA 1JE8A 3BY6A 1HDPA 3R4KA 2H8WA 2ID6A 2CUZA 1MMNA 2K4JA 2EV0A 3H0GJ 3OYJA 3M7GA 3L7WA 3CJNA 4M3EA 4XRFA 2K86A 4R8HA 4KISA 1E3PA 2L7MP 2ME6A 2GOMA 4A2UA 5LHHA 1UZCA 3M8EA 2VL8A 3GLLA 4CUGA 2JZYA 1K7AA 1SFOJ 1P7IA 3UKGA 1OYWA 1KYZA 1BM9A 4G94A 3OYLA 4QLCU 2OAZA 5FFXA 2M34A 1H9TA 5FB2A 1X3WB 3SZGA 1PUFA 3F23A 3WHBA 1O3SA 1O3RA 2ZFWA 4XQFA 2BV6A 2BY3A 2D1HA 1I6XA 4RM2A 4DYQA 2XB5A 2MLKA 4CZZA 3QPHA 1BJZA 1OQYA 2ISZA 2RAEA 2D2WA 2L9NA 2K40A 1IXSB 2LFBA 4YFXF 3WTXC 3D1NI 4FE7A 4ESBA 3F6OA 4CCKA 4YFNF 1LB2A 1RUOA 1FOWA 1XB4A 1X1DA 3O8GA 4KFCA 2HVRA 3PNYA 1JGGA 2F4OB 2P5VA 2M0MA 3S16J 5JVTA 4IEJA 1NK2P 1D0ZA 1R5HA 1H9GA 2E60A 5GP9A 4D1QA 1OLTA 3WGGA 2HOAA 3VOEA 2DA1A 1W36C 1H89C 3NWSA 5GTHC 2VKEA 4B1RA 5K1YA 1U0JA 2IBDA 2HXIA 2V6CA 4G7OF 2X1CA 1FWZA 6PAXA 3PIOF 2CQNA 2K4BA 3BP8A 3ZMUA 3J81K 3I55I 2ACJA 3RYRA 5FRMA 1L3LA 2I5UA 3SZTA 1Y8RB 1LE8A 3OYAA 3BPXA 1Z0XA 4BXXJ 3MEXA 3WE3A 1BN5A 4F52A 3O6BB 4O6JA 1FYMA 1D0XA 4U0WA 1VQPI 4P9FA 4HQEA 3FMQA 1BIAA 1K78A 1I5ZA 4A3LJ 2XPWA 2R7ZJ 3PQKA 3TDZC 3MKWB 2XIGA 1K4TA 2A61A 1USTA 1ZN2A 4XKBA 3IRQA 2HZTA 1BI2A 5DM7F 1GLNA 1FTZA 3HUGA 3I58A 4O5VA 4E7JA 2E5ZA 2WV1A 3X2QH 1FC3A 1NHAA 1N75A 3QAHA 4XLPF 3I4MJ 1J2XA 5BOXA 3DKWA 3KEOA 3R6SA 2ZMEB 3WTZA 1PDNC 1IV8A 2M8GX 2AS5F 2GLOA 5E1ZB 3ZN1A 1XG1A 3R61A 2EZIA 3HGYA 1DDNA 2YX7A 1ON2A 3OYIA 1YW9A 3ABTA 2ZO4A 3HJEA 2OUMA 4E70A 1A6IA 4MHGA 4BEHB 1HSTA 1S9HA 2O61A 5D8KB 1B8IA 2HOEA 4WK8F 4WWCA 5HLHA 3ASOH 4JX5A 1SD4A 1OCRH 5EYRA 2OZ6A 4ZZLA 5J6XA 4LLNA 2LBFB 1QZZA 2XRLA 4Q47A 4GGGA 4ESFA 1PP7U 2HDDA 2LTPA 3C7JA 3BTJA 4XK4A 5LFAA 3CMMA 2VASA 1WJCA 1ZGJA 2X6OA 3ZN0A 1F43A 4EJOA 1W5SA 4MEXF 5J1RA 3CCRI 5GTIC 1QGPA 1O7FA 2IP2A 1SVLA 5LRSA 3KLOA 3L2WA 2AQEA 3K1PA 5F0FA 1U5TB 3PQJA 1BA5A 3FK7A 5LRRA 4E4HA 3DU5A 4N4OB 3KE2A 5KAIC 2Y75A 5BPDA 2Y30A 4BBSJ 3GBGA 5K5OA 1WH7A 1LPQA 2ELJA 1Z1DA 1DPUA 2JSCA 4ZTFA 2R7FA 3EETA 3GZ6A 1FNNA 3MD2A 1RPWA 4XRSA 2KDZA 3K6GA 3GYHX 2ESNA 3ZRGA 4DQ2A 1JGSA 2QEXI 3MQ0A 4XBFA 3R0JA 2DA7A 2K3PA 3FBIB 2HPMA 2FMLA 3N4MA 3QODA 2L3DA 2RGVA 4EM1A 3B6CA 3ZGKA 3KYLA 3JSPA 2NS8A 1S72I 2XV4S 5C4XJ 3IP4B 2LG4A 4A0YA 1S7EA 2EINH 3ZXSA 2QGUA 2XF6A 3G1MA 5DD4A 1V5EA 5KCMA 2IGKA 3DBLB 2CJJA 4NDLA 3ZMSA 2E7WA 1Y39A 3E0JB 1IZ1A 1O7LA 2DK8A 4DYRA 2FJ1A 4D0PA 1I3QJ 3QOEA 1HKQA 1XGOA 3GXOA 1JJ8C 3L09A 1VI0A 3IAS2 3W3CA 3H9JA 2PI0A 3BOQA 3FXOA 3CCJI 3S1RJ 5E20A 4ZH4F 3ZQIA 2DK5A 1FZPB 1OISA 2ZMEA 4BE0A 1VZ0A 2R7WA 2DT6A 2E1CA 2O9LA 3CJTB 4XRSG 4RB3C 4EGZA 2X51A 1UJ8A 2WY8Q 1WVRA 1J09A 2LK2A 3E1SA 3A4CA 3IC7A 4IHVA 2RKHA 4MTDA 3GEZA 4B09A 3K69A 2K27A 3TP3A 3WTVC 3VYUB 4BKXA 3LOCA 3H5RA 2EJRA 2FU4A 1SMTA 3W6VA 4IRGA 2KLOA 3LSTA 2MSYA 1WSUA 4IHYA 1LUJB 3CLOA 1H8AC 1SMYF 2JRMA 3AL0B 2GIZA 1IG7A 4G8XA 1KONA 3HOXJ 2DW4A 4EATA 5DUIA 2O7OA 1CF7B 2QSHX 2ZC2A 3IUOA 3MCZA 4IX7A 2Z9OA 4RLQA 1X1CA 3LWFA 3G73A 3A01A 1OCTC 2GXGA 4EGYA 1V4RA 4C2TA 3FX3A 2WAQA 2PMUA 4GO1A 3S2HJ 4AC0A 1MZBA 1STZA 1KA8A 2HKXA 2L9SA 5LLQA 4FTHA 4HSTA 4E7LA 3VFZA 1A35A 4D9JA 3G1OA 3PUFA 1U5TA 2CUEA 4W97A 2M30A 2VT2A 3I53A 3M3YJ 3CDLA 2KRHA 3JSOA 1HKTA 3BCAA 2QLZA 5IY5H 4IKFA 3CCQI 1WJAA 4B47A 1EH8A 4XKWA 4OINF 3QPSA 2JA7J 4Q5SF 2ECCA 1HXDA 3LAJA 1ZGWA 4RAYA 2P81A 4BQQA 1IRGA 1Z91A 2Y0SA 2KZVA 3S8PA 5IYCJ 1TQIA 5M3FJ 3BPVA 1DP3A 2FF4A 2E1NA 1APLC 1GDTA 4EEFG 1VQ5I 1SFEA 2VC1A 4L9JA 1ON1A 4DGWB 3O3KA 1UG2A 3TMOA 3D5LA 2HXOA 2DFIA 2IXSA 2GA1A 3VYSB 3W2AA 2O03A 1BI1A 3GFMA 1FIAA 3GFJA 3OV8A 4WXDA 1IRZA 1BW5A 5KK1A 3KCCA 3KFWX 1EA3A 1LNWA 4M6YA 3ZQGA 3CMAI 2QM3A 3L2UA 1I39A 3GTKJ 2EIMH 3OIPA 2JVGA 4RMNA 2DPDA 4UV8A 4BXFA 2Q2EB 2LLKA 2F5CA 5F0HA 3E6CC 2DLLA 4A0XA 2ZKZA 4HRIA 1WH5A 5A2QZ 5LGNA 1QHGA 4BJTA 2HOTA 4YELA 4BL0B 3LAPA 1HW2A 1SD5A 3KLNA 3MMYB 3BC8A 2K02A 2IA2A 1QRYA 3DKXA 3TO9A 3JRCA 5ICCA 3ZP5A 2YPRA 1S7OA 1T0FA 1FP2A 4C3IJ 4F55A 3GTOJ 2XGCA 3FXMA 2QKLB 1JUSA 1P9QC 4BDYA 1QHHD 2OZUA 2XPUA 3BR3A 3VYRB 1WI3A 2KFDA 3DEUA 3HSRA 5JHFA 2RREA 2JTVA 1IAWA 3Q9VA 5DDGA 4AIKA 2W84A 1RETA 1QO0D 4ZC3A 4D5CA 1HLVA 2XB0X 1UHSA 4N4NB 2HFHA 4BQNA 1IV6A 3IH3A 5GAEJ 3QYBA 5C4JJ 4JQFA 1YS7A 3TGNA 3JRFA 2XSJC 1BIBA 4A3KJ 2JA2A 4YG2F 1J9IA 4P9UA 1IUYA 3VB2A 1WJ5A 3A1YA 2BBYA 4LB6B 1U78A 3BTLA 4A12A 2DPUA 2I10A 3RCOA 1XDUA 3PNVA 5JI6A 3TL4X 2EBIA 2F5DA 4R79A 1MBEA 2G7UA 5GADJ 1HOMA 2KDOA 3PL8A 1PP8F 3KPHA 3SEZA 3QP5A 2VN2A 2ZMEC 2PN6A 2J5OA 2X6YA 3QQAA 4PCQA 5FKMA 2OTJI 2Z1DA 5F27A 1ZG1A 4Q48A 1TZLA 3QYFA 2MG4A 3TBIA 4AUXA 3SYTA 1P2FA 4HQMA 2WAFA 5H6QA 1MMSA 1H0MA 2PEXA 3DBRB 1B72B 3UNGC 1JUPA 5D6FA 4BDZA 2CYYA 4OMZA 5B5EC 2VOOA 3I71A 3ZOBA 4HNVA 5HNHA 2HEOA 1ETXA 3ISPA 2CRGA 4EJVA 2E2HJ 2OV7A 3QYEA 2R3SA 5HS8A 2M1BA 3KZIC 3TO6A 3CJQB 4V2GA 4PJJA 4HSRA 3IH4A 2OCEA 5EEHA 2N8GA 3I59A 5EG0B 2Q0OA 3KIOA 4ITVA 2BVLA 1WQ2A 1QNTA 3BZKA 3LNQA 3JRAA 3NARA 5BS6A 1IN6A 4Y52J 3RPUD 2RDPA 4E7HA 1U5TC 2X4HA 1G3WA 4M3BA 1J75A 1U3EM 3WE2A 3UR3C 3AFHA 4A3FJ 1KYWA 2W57A 1YX5A 1ENHA 5IYBJ 2V1XA 1I50J 1NG6A 1RKTA 1MGTA 5TISC 3N05A 4BJ5C 3J7AO 3AKZA 4EMSA 3PSFA 1O57A 4N0BA 5JLXA 3ZPLA 2JRTA 2F2EA 3JAMK 1G59A 3S17J 3EUAA 2HTJA 2X1EA 3FXRA 4JX6A 3I54A 3LL7A 1PVEA 3G4SI 3U2RA 2EIKH 2EFNA 2WA0A 2YSRA 1YI2I 1YX3A 4A3IJ 4Y15A 4MFEA 3CC7I 3L9FA 3DTEA 1IDYA 3CCLI 2HOSA 3HBLA 3WU1B 1R23A 5D5XB 2HQNA 4II3A 2YR2A 3FKJA 2CFOA 1PUFB 3BR6A 1R58A 3A03A 3E5UA 3BTCA 4ZYGA 3CMEI 1D1BA 3K4JA 2LF8A 5D4SA 1WJEA 5DCFA 3BTIA 4ASNA 4PFOA 2OQGA 2E35A 1SD7A 3BCBA 2GXBA 5E1XA 1KGSA 4FISA 4DYCA 2QA4I 3S3MA 1HF0A 2IGMA 4CICA 1A36A 4PGHA 1EF4A 3V42A 3I4PA 5F1RA 1FSHA 5ILUA 2A6TA 3M07A 4BUPA 4XL9A 2UXNA 1AWCA 2BY0A 2KIQA 4A3MJ 3CC2I 1OPCA 1IRXA 5IPAA 4UNOA 2DMNA 1W36D 1MJAA 2JA5J 2DA2A 1TWAJ 3PM1A 1WCMJ 3F8CA 3WTSC 1R7JA 2Y31A 3BQYA 5EEAA 1XMKA 2F6CA 2W7NA 2XKPA 4BE1A 4MNUA 1BC8C 1T38A 3I3LA 1LE8B 5D5VB 3Q9SA 5IOZA 2Q8KA 1R5ID 4NBQA 5LEKA 4UXNA 2UZKA 2L4MA 2MLGA 4PUSA 4PJ0C 2VKDA 5EZGA 4M71A 4WCGA 1QQIA 1XCVA 2MD5A 4A5NA 1TWGJ 1K78B 5FO5A 5J8CA 2FBHA 4M3FA 2V6EA 2DA6A 2DFHA 1HW5A 3AG1H 4BYYA 4I0BA 4NUBA 2ICWG 1MSEC 2CMPA 1X4OA 4ENKA 2IEKA 3KP6A 3HUGB 5AIPA 1IUFA 3E97A 5ICEA 4HW0A 3FXUA 1BI3A 9ANTA 1R1UA 2O5RA 2ZCWA 3AAFA 5F08A 1E2XA 1GXQA 3J81Z 1JXSA 2P7VB 3T5XA 3BZ6A 3PIPF 4RGRA 2RNJA 4K2EA 3W6JB 4B4CA 1TL8A 2WB1N 1SANA 2LMDA 5FLMJ 3OYBA 2OTLI 2X9DA 4EQQA 2H8RA 1YJ9I 2WAQN 1ETQA 2LD5A 2HS5A 4A6EA 1V3FA 3TOAA 2A68F 1XSVA 3C1DA 1IXRC 2AO9A 2DTRA 4RS8A 1VQOI 2KPMA 5KNLA 3DU6A 2L0KA 5BPIA 3M8FA 1LEAA 2DJNA 5E3OA 2MH2A 2O8XA 4I01A 1O4XA 1B8IB 2KJCA 2R7QA 1HSJA 2HNHA 1W4MA 2P0WA 2M45A 1ORKA 5H20A 2V1NA 1MMAA 1WZ2A 3C2BA 4HF2A 2Y0SN 3BR2A 2CQKA 3CDHA 2H6BA 2PG4A 1DU6A 2BY2A 2DODA 3OYNA 1Z77A 2B9SA 1IW7F 3OYKA 4UVBA 2FQ4A 4WXHA 3C2HA 5FD5A 4CDGA 2R7TA 4NC6A 1MH3A 4DIQA 4FASD 4OAZA 2MC4A 4KJZA 4M6VA 4BGDA 4YIRX 3K1MA 2GZWA 3IH2A 2VB6A 3KP5A 1IF1A 4JX4A 2LY9A 3ABLH 3SFZA 1JT6A 4ZDPA 4LIUA 1A31A 2RVCA 4I02A 2IGOA 2HYFA 3OWTA 4UV9A 2KP6A 3RQIA 1TTYA 1VTNC 3WTYC 4UB6C 3OYHA 3F72A 4LITA 2GIVA 4MO7A 3KX2A 4A0ZA 1IJWC 4G6QA 2RC4A 3F6VA 2IAIA 2DQRA 2CV0A 2Q1ZB 3FMRA 1OCPA 2E2JJ 4OIRF 3T1BA 1ZKGA 3I5UA 4M3DA 5D5UB 4M9SA 3U1KA 1UAAA 1UHWA 3HXLA 2EFQA 2VBXA 3SJMA 4LK1F 2W4SA 1MJBA 3H35A 4OAYA 3Q5FA 1VQ6I 1MH4A 2V1DA 4AU7A 5FLXK 5CQGA 1K4SA 4YIIA 4QPQA 1KQ0A 4B8XA 4AIDA 1M1EB 4BJ6C 2FQ3A 1ZH5A 3GTGJ 3L2QA 2GA2A 2Y0MA 4IQ4A 3A0BC 4KN4X 5E3MA 4KYWA 1RC9A 3GF2A 1FPQA 3OR1C 3BG7A 4ZDLA 1Y1WJ 3BT9A 3IHUA 2KT0A 2CW8A 2A07F 3DLLF 1MBKA 4UB8C 3H9QA 5B66C 2E71A 1UCRA 4F93B 1B9MA 1R5GA 4HG2A 3K0LA 3TOBA 4IOCF 2ZNZA 3CCMI 1XMAA 2YS9A 2BW3A 2P5KA 5J47A 3ABMH 1KQ9A 1ODDA 3HRUA 5LEJA 1FT9A 4A5MA 2GXAA 5LGTA 4CYCA 1YYVA 1RRJA 1OCCH 1DQUA 1T98A 1U9NA 2XF7A 1R71A 1NTCA 4HV5A 2IPQX 3WTTC 1Z3YA 1K6YA 4KIGA 5H6RA 1PJRA 5DS9A 3S1NJ 4FCYA 2EB7A 2A6HF 2CW7A 2FXAA 4M6XA 2F5FA 1ZRDA 5CQEA 4L9VA 3FF5A 1RI7A 2KIMA 2DXIA 5LHGA 3TDUC 2LR8A 2R4GA 2R92J 5LD2C 2VXDA 5E3LA 3CCSI 4AM3A 2AXLA 3SZPA 3OMYA 1JJ6C 4JP0A 2VOPA 1I6HJ 2W82A 1BR4A 2PQ8A 1OKRA 2WV0A 1U8BA 1ZG5A 1VQ8I 3BLYA 3C3WA 3DPLC 3KYCB 3A01B 2XDVA 3L1PA 5FD6A 4MEYF 4CYDA 4Q4ZF 4X1EA 5CLSA 3WU2C 1GV2A 2EZLA 3GWZA 1XSDA 4HV6A 4E7SA 2CO5A 3FISA 1P4AA 1FBSA 3DCFA 3FXJA 1BL0A 1QA6A 3ZQCA 4LK0F 3VPRA 3EPZA 3VDXA 2JA8J 2BXZA 3HEFA 5F6FA 4G6TB 3AG3H 1AA7A 2YU3A 3JRDA 1XS9A 4KT6A 2X48A 1FY7A 3RIRA 1I27A 1VQ9I 3GZNB 4PJNA 4W1UA 3SHFA 4ZYHA 2L2OA 2VKHA 2NNYA 2R5ZA 3HTUA 3C2GA 2L4AA 3TQNA 2LY2A 4GCVA 2MC3A 1DPRA 1JKRC 2BY1A 1ZLJA 2KRCA 4OWRB 2CQXA 3P9KA 1X1BA 1JUMA 1HQCA 2O6GE 1Z6TA 3OYEA 3QWLA 2DFEA 5FJ8J 1FSEA 1KU2A 2OF7A 1YIOA 3S32A 2JQ7A 3TP0A 3I56I 4A3EJ 1XGMA 2W24A 2ZXHA 2VE9A 3U21A 1IDZA 5JLWA 2H27A 4E7IA 5K7ZA 1J5YA 2R7RA 1GVJA 2QVOA 1NH3A 2JUCA 4H4KC 3Q0UA 4HZFA 2R7OA 2FBKA 3FXQA 1LFUP 3ZMVA 4LOCA 1WI9A 4A69C 4II2A 3S2WA 3ABUA 3PSIA 1GV5A 1XCBA 1OYIA 3IV5A 3GO5A 4XKCA 3TW7A 4Y7NJ 3CF2A 3JRGA 2XPVA 3DFGA 4D7NA 1JT0A 5J3LA 3KP3A 4PK4A 2CSOA 2QQBA 1ZYRF 1TNTA 2V7FA 4LJZF 3CJRB 5FROA 4NHJA 2MBFA 2JN6A 2ADUA 2VE8A 2LKXA 4YRVA 3JW4A 1VQNI 3LSKA 5IP9J 2QBYA 3NRVA 4UUVA 3CC4I 2JUGA 1RIOH 5J4YA 3WGIA 1X4PA 3CCUI 2G0EA 1FX7A 4U7DA 3E7LA 2E19A 3CUQA 3WG7H 3GZ5A 1YTYA 1Y8QB 2DA4A 4HEA2 1AHDP 1MMGA 2DAOA 3G2BA 4Z6YA 1TWFJ 5B1BH 2WB1A 2FA5A 3H5AA 4A3GJ 5FGMA 3FHZA 4BU2A 4G9YA 5ILVA 3GTLJ 5HLIA 2EQRA 4ZYDA 2XAHA 1T33A 4XLNF 5K5RA 2CU7A 3IRRA 2B0LA 1G3TA 3GTJJ 2STWA 2ZSIB 2M7AA 2XAUA 3K7AJ 3FHNA 3DV8A 4BHCA 4E6KG 2PBIA 3HOZJ 4EM2A 3NEUA 1JI8A 4MLOA 1E3OC 5F1JA 5HNFA 2RV8A 1FMWA 2NVUB 3CZ6A 4I6ZA 2K3FA 4F92B 3LSIA 3DPUA 3HDDA 2ZXWH 3SFIA 2F48A 1QZYA 4MFDA 3VSLA 2L9RA 3OYCA 3LFUA 1DGWY 2L7ZA 2WAEA 4GXOA 5HDNA 1JTXA 3OIOA 2VUMJ 3CLQA 4KMFA 1S5LC 3I59B 3F8MA 4L9NA 5H2FC 1W5TA 1A04A 1YW8A 5DYMA 4IHSA 3DF8A 3I9V2 3RDIA 5HDKA 3BR0A 1PUEE 1HKSA 1U2WA 1K79A 2E36A 3KEYA 2HI3A 2COBA 3SXYA 2VKVA 4HF1A 1F36A 1ZREA 3JREA 1MD0A 5F64A 2EH3A 1Y56A 2RNGA 1FBUA 2KQRA 3BR5A 3LQQA 2XAQA 5HVQC 5C44J 1N78A 5DV5A 4E7KA 5M5WJ 3JRHA 2KZGA 2CWEA 3EDPA 1YIJI 3JTGA 5E17F 4OU0A 4N9HA 5GAHJ 3MZ8A 4XLHA 2K5CA 1YLFA 2L54A 3LMMA 5L3DA 2CUJA 2MYSA 1UHMA 2ELKA 4CZCA 4RAGA 2QENA 3EUKL 3FXKA 2GBYA 3SQNA 5M5YJ 4G12A 1IC8A 1KU9A 4PJLA 2YU9J 2F5VA 4JYKA 3HHGA 5K7HA 2ELHA 3G71I 4I76A 2VQCA 1QVTA 2MA3A 3F0CA 3R0AA 3CQZJ 1IO2A 3B6AA 1MSFC 5TJJA 2K9SA 1R4MB 2CH0A 3BWGA 2EZHA 1PYVA 5FKNA 1Z9CA 1RNLA 5KVRA 2XGDA 5L3GA 5FKKA 5IT9K 5DM6F 4ZYEA 3E6DA 3CO6C 1RESA 2L9VA 1V55H 3OYMA 3S3NA 4G7HF 3JAMZ 2BEOA 2F4IA 2IS4A 3CF5F 2W25A 2IVMA 5L3CA 3EYIA 4M72A 1LFPA 1YRNA 3HRTA 2EFPA 5DEQA 1G6NA 4IJAA 1TNSA 2EFOA 4L0YB 2Y9ZA 3OSFA 1LJ9A 5JHUA 4UY8I 1MJ9A 4EM0B 1D0YA 3ROUA 5K5QA 2K9NA 1W7PB 4IOAF 1LQ1A 5KAFC 4C30A 2VI6A 2K9QA 2QSGX 3F9KA 1FLIA 2BHYA 4RAZA 2DBBA 2ZJQF 3RZDJ 4CSWA 1JHFA 1O3TA 4NB5A 1ZAOA 2XUBA 5K7FA 3JRBA 1TW3A 1MDMA 1HBXG 4IHXA 3R60A 2CFXA 2VLAA 1B9NA 3E5QA 4F91B 1WJBA 2HGCA 2CQQA 4C3HJ 1ZR2A 3BJAA 2V1UA 1FBQA 3GCMA 5GAGJ 2BHZA 4DNCA 3KP2A 2V26A 1XGNA 3RPUA 1ZHFA 1ZG3A 4ETSA 2P5LC 3NAUA 1J0RA 4IXAA 3K70C 2JVHA 2VJ4A 4I99C 3LSRA 2ME0A 1BOAA 2AHQA 2E34A 2NYXA 4M9ZA 3TEDA 2KIUA 3J7ZI 3K4CA 1ETWA 4QTRA 1J59A 4HNUA 3F8BA 4HLYA 3WG9A 4Y13A 4OIOF 2KMUA 3HM5A 1D3YA 3GX4X 2F5EA 2P7CB 1HCRA 2M87A 5LBQA 2P4WA 4KMUX 3J7YJ 3PFIA 3G1LA 3IWFA 3WTUC 1Z21A 2ZJPF 2JA6J 1IN7A 1T95A 1HW1A 3OSGA 4ESJA 3M8JA 1OYYA 4B3XA 1VQ4I 2Z16A 1IN5A 4GDFA 1Y0NA 3V7RA 3HTSB 1UMQA 2LSOA 1X1PA 2Z2SB 2CV1A 3Q0VA 4S05A 4XIDA 4U87A 1JKPC 1X2MA 2IGNA 4YFKF 3AG4H 1IGNA 2VJIA 1NK3P 1LEBA 2P6SA 3QPTA 4I7HA 1REPC 1OMIA 1SVOA 5DCMA 2HYGD 3O2PE 2JPCA 1TWHJ 1I1GA 1XX5A 2BE5F 4XLEA 4IO9F 4YEJA 5E18F 3HOVJ 3WODF 4XN0A 1T8IA 2EFWA 2EWNA 3OOPA 2OD5A 1QPIA 1TP4A 2FSWA 1J7KA 1R4NB 2H1KA 2LYCA 1FP1D 1I1SA 2M4KA 1ZR4A 5L3BA 2DTZA 5ILSA 1R00A 4B48A 4F3QA 1T0FC 3H3ZA 3P9CA 4XSZF 3CESA 2PX9A 1TC3C 1B6AA 5EJCA 2DN0A 1DUXC 3ZR8X 2OA4A 3H3UA 3N97A 2HTSA 1AKHA 3MZHA 1CQTA 4M73A 4S04A 1HC8A 1W7PA 2A5WA 1R1VA 2XSDC 4ENMA 2VPRA 1H88C 3LSHA 3S3OA 2KJBA 3KYDB 1VQKI 5BQTA 5EGOA 3HGGA 5J4VA 4UVAA 4OMYA 5D8LB 2PLYA 2TCTA 3HOWJ 3W2VA 5JR3A 4RDUA 2CW0F 1E3HA 2HZDA 2JWTA 1T08B 5LGUA 2OJED 2VC0A 3FXLA 3L2RA 3HL2A 2PMZA 5CPRB 2NVQJ 2LC2A 2PJRA 1QVUA 2WADA 3Q0WA 1Z67A 3HZJA 3RI4A 2LNBA 3U9GA 2VT3A 2XAFA 4IHWA 4RB2C 2A69F 2NOJB 5FFZA 4DBQA 1N25A 3GUDA 4A3JJ 5GPAA 4LLLA 1ZRFA 3VYTB 2UV1A 2VBWA 3O8HA 2LVSA 4KA4A 2BW3B 1HA8A 4ZYAA 1ZK8A 3DPTA 2A3SA 4CH7A 4CYCB 1U8RA 2OPTA 3GLXA 3B73A 2KRFA 5CJ9A 4BBRJ 4I0AA 4ON0A 5FLXZ 4B3AA 3GMEA 3ECOA 2LREA 2JSPA 4IRIA 4JBAA 1POGA 3SDBA 4L5EA 1FTTA 3NQOA 3BJOA 3T0YA 2D1VA 2X85A 4LMYA 5E8IA 2BVMA 4AWXB 5L3EA 2FBIA 3U1DA 4A93J 3GTQJ 4Y3OA 1ZRCA 2LKSA 1V54H 4LG0A 1A6QA 3PFYA 4PDKA 3HIFA 4BQOA 3M1EA 3CMYA 2CGPA 4V2FA 2O8KA 2G9WA 4XR6A 3ZQ7A 2KKOA 1SFKA 3D0SA 3OS0A 4LB5A 1MNMC 1P7JA 1BI0A 3L00A 4JK1X 3CP8A 1FYLA 2HQ5A 2QYOA 2HDWA 4C2MJ 1S6LA 2BYVE 4HF0A 2M5WA 4HDUA 3ERMA 3HG9A 3QU3A 1LDKB 4ZZDA 1D8KA 2ECBA 5J1YA 4S0HB 3GVAA 4KICA 1YQAA 2H6CA 3MKYB 2EV5A 1WGXA 2F4MB 4R1HA 2KIFA 2L5QA 3LSGA 4ENJA 4B44A 1TLHB 3F3XA 3FK6A 1OFCX 1RKWA 5IP6A 3B02A 2R5ZB 3ZQLA 2H09A 3OS1A 2TRTA 3DKYA 2MD0A 2B63J 5HLGA 4CXFA 1VQLI 4UHTA 2RQQA 1R1TA 2ZJ2A 5FKOA 4Y4RA 2MFZA 2QQ8A 4XMYA 2QQAA 2I8DA 2E7XA 4CCLA 2AQFA 2R5YA 3H9GA 3OYFA 3MKZA 1TWCJ 2E1MB 1OR7A 1G2HA 1SFXA 4XM3A 1U6GA 1Z7LA 1S8NA 2ZXIA 3I0TA 3J80K 2DJIA 3DP7A 3FMSA 3G3ZA 3RPQA 2LP0A 2Y9YA 4PJMA 1YS6A 1F1ZA 2XHKA 2M4GA 1UELB 4P1WA 1YJWI 3M9AA 2UUZA 5M3MJ 1MKMA 5AIQA 3WGHA 1YITI 1YO5C 1WWXA 2ZB9A 4AYBA 2O0YA 4V19K 3S1MJ 1E0EA 1W0UA 2GQQA 4DW6A 3L2VA 1LDJA 1TT0A 1SAUA 3QPLA 3K4LA 5F04A 3ZMTA 1BC7C 4ZJZA 3IKVA 1EH6A 4N9IA 2C6YA 4UVCA 2W85A 1Z05A 3K9TA 5HS9A 1F4KA 1FOKA 1XTAA 1Z3XA 3GFIA 4IPAA 1XC5A 3RKXA 1UFMA 3DXJF 3JR9A 1R22A 3BDDA 4BNCA 3RKWA 3FBNB 4M74A 4ABZA 2R93J 1HDDC 4QPOA 4U0YA 2FMYA 3LA2A 1JHHA 1MBFA 1UB9A 1X2NA 2E1OA 4QIWN 3OIQA 5C3EJ 1MBHA 4NNJA 2ZXJA 2CS3A 2DMUA 3ZQQA 5LHIA 4MQVA 2GOXB 2D45A 4HX7A 1ZQ3P 4ENNA 3SDGA 4HYEA 2QBYB 4CHUA 2X0LA 3QU6A 2Y48A 4XLFA 4GYGA 3K1NA 4LLGF 5TRDA 3LSJA 5EDNA 3C18A 3RYPA 4FE4A 1VQMI 3F8FA 2V4JC 3HB9A 2FOWA 2NNNA 4PSXA 2DI3A 2EV6A 3CUQB 3ZCOA 2XAGA 4BACA 3HSEA 2EIJH 1W1WE 5DUKA 1N77A 4EJUA 2JT1A 3FKIJ 2R0QC 4P5OA 1X19A 2GAUA 1YG2A 3F8NA 4BH9A 2NS7A 3HKZA 4C2UA 1RR8C 1D1AA 1F5TA 4BQAA 3S14J 3V8LA 3M1CA 4CCMA 4IQJA 2DOFA 4BHBA 2BGCA 4DOZA 2K9MA 4PZJA 4RLFA 4UUSB 4NC8A 5J8FA 2VODA 3HPHA 1ONVA 2D5VA 4EJTA 1X58A 4C3JJ 2VBZA 2MABA 3HYIA 2Z5UA 5L3FA 1WFXA 1BBYA 1AOYA 3CDIA 4FT8A 3H0DA 1SVMA 1R36A 4IF4A 4EJWA 4F7ZA 3FZVA 3BG3A 2JPBA 3T8RA 2RN7A 4KDPA 3CD6I 3BG6A 4NC7A 2IS1A 5CVJA 1FOXA 5IOYA 3V7SA 5EZHA 3KP4A 1Y1VJ 3FM5A 4AD9A 2B7EA 5E1WA 2WY7Q 1XDSA 3KEQA 4X6AJ 4G7ZF 2HDCA 1JTYA 1VFCA 1FYKA 4DJAA 4FX4A 1T2KA 1EKEA 2EPFA 2X1DA 3FDYA 3K10A 4PFPA 1ACIA 3OYGA 2W48A 2DCEA 3CP2A 1FEXA 2GWRA 3ZMZA 1B1BA 5B1AH 1D8JA 1USSA 1XN7A 1TBXA 1MBGA 3MZYA 4M3GA 1ETYA 1DP7P 2M3AA 2PFBA 3K2AA 1I3AA 2O3FA 2FNPA 2HWVA 4DZJA 2JJ7A 3REOA 3VODA 4ZDOA 4NQWB 3FWEA 3H36A 4OOIA 3ZQHA 5B3SH 2NRAC 4MTEA 3H3VK 2R7SA 4ANJA 1GT0C 3ABKH 1MNDA 1GXPA 3CCEI 3GW2A 1ERDA 3F21A 3PJRA 1P4XA 2LRDA 3DEEA 1ETVA 3GFLA 4I09A 2OQRA 3P5JA 4XOTA 3K2ZA 1OR7C 4MGRA 2G7HA 4WXCA 1VQ7I 4TV7A 2YX4A 4XICA 2OU2A 3H1CA 2DOAA 2HKOA 3P7NA 4J19A 2L01A 1MIJA 1VF9A 1WPKA 3RJPA 1WJFA 5IP7J 1XSXA 1ULYA 1FMVA 3D5RC 3K4KA 3JRIA 1WJDA 3RTRA 4E7ZA 2ZSHB 1G3SA 2VJJA 2WBMA 1YHQI 3GTMJ 2QWWA 2LY1A 1EH7A 3P9IA 3ERED 2DOEA 4KNYA 1B59A 2GM4A 4H0EA 2DMPA 4M9XA 4CCJA 1C0WA 2ESHA 3BZCA 5ICFA 1YRNB 2NXNB 4HOBA 4XLCA 2A6EF 2L7FP 3TKYA 2PMZN 2XVCA 2QSFX 5FKLA 1R9TJ 3ESWB 5JFRA 4BEHA 3E3VA 1Y0UA 2VPLA 2MW8A 3KZZA 3MAJA 1D5YA 5M5XJ 2R7VA 2Y2ZA 5AONA 5D6EA 1ZELA 1FIPA 3PNTA 4J00A 3HOUJ 3H5NA 4XOPA 3EUHA 2CV2A 2DYRH 2LBFA 4BAYA 3D5SC 4UUSA 5IT9Z 3MKLA 2FX0A 4BS9A 2XGEA 3S1QJ 1MDMB 2M8EA 2KISA 2L02A 3A2KA 2H1LA 5F0CA 2XC7A 4Y17A 1BR1A 3K4NA 1ITYA 4U0VA 4RGUA 5EEGA 1ETOA 5CKTA 2V9PA 2A5YB 3BG5A 3OL4A 2HYJA 1IN4A 3S93A 5D4RA 3PUBA 2JMWA 3K70D 1IRFA 4KT5C 3TO7A 1RZ4A 4I2OA 1TT5B 2Y69H 4CO8A 3MFKA 3BR1A 2DT7B 4A6DA 4WX9A 3M4OJ 3COAC 2M2EA 1O3QA 1T39A 3IL2A 1V5GA 3K4MA 2BOLA 5E79C 3J7AY 4D5FA 2UWMA 3DLAA 2FUG2 5GPCA 4A3CJ 2CUFA 2QF7A 3RQ4A 1P6RA 2XF5A 2CG4A 2NVXJ 4DBRA 2RQPA 3E6BA 3I64A 4L5JA 2V79A 3HHHA 2DMTA 3W2WA 1W0TA 2HQAA 2XASA 2V9VA 4XNFA 2XAJA 1MW7A 4FHTA 1R49A 3ELKA 4NQWA 4RB1A 2R7UA 2IW5A 2ZNYA 5TGTA 5DTDA 2WWYA 2KL4A 3NWTA 4WF2A 5KHDA 4BE2A 4CGZA 2E5NA 2STTA 1OCZH 1BR2A 1U9OA 2HR3A 2E1MC 1MBJA 3QP6A 3WHCA 3W6KB 2MH9A 3KP7A 1VNDA 1KQ8A 4IL6C 1JKQC 2DDAA 1RR7A 5DCMB 1DU0A 3EYYA 3OL3A 2DO7A 2MGQA 4CCOA 2FD5A 1SEUA 4LFUA 2Z99A 4GFBA 2JK3A 2OCCH 4C9YA 1K6OA 1YOVB 2M7BA 2HPIA 2PMHA 2X6XA 4IHTA 1TQMA 3IAM2 1SD6A 4O3MA 2L7KA 4AIJA 2DFFA 4AVPA 5EF6A 4MIMA 1LVKA 1R6RA 2Z3YA 4BY1J 1D5VA 4HDVA 4HX4A 3V7CA 3ONQA 4LGWA 3LA3A 3HOTA 4J01A 1ZTRA 1DGRM 4XKVA 3LQRA 3VEPA 2QCOA 2QUFA 2LOOA 3ML6A 2LDUA 3OS2A 1A5JA 1G8XA 1LVAA 4HNTA 2ETHA 4LD5A 2IJLA 3DTIA 1SC7A 4P55A 2H94A 3OOUA 1RUNA 1AKHB 2LKPA 3HC7A 3T8TA 4AYBN 3WTWC 1G3YA 5CVVA 4JOMA 2XGXA 4U88A 2VQHA 3IKTA 1GUUA 1CGPA 3DWLE 1S7AA 1CF7A 5EGOB 3ULQB 2TDXA 2WC2A 2QKMB 4IZZA 3V8KA 1Z7UA 2ZFUA 3CCYA 2DQLA 2FEZA 2NOGA 5BMZA 1IXCA 4EVIA 5CVIA 2E2IJ 4GYIA 1MMDA 1QPMA 3AG2H 2V9KA 1OJLA 1T56A 3CUQC 1ZLKA 1IN8A 2Z33A 1QZEA 2PJRB 1D1CA 4LG3A 1ZGAA 4G6DA 3BROA 2P8TA 2VQLA 4QWQA 1OCOH 2VBYA 3V4GA 1QBJA 3RZOJ
chains in the Genus database with same CATH topology
2OPTA 4BBRJ 1JJ6C 3S2HJ 4JP0A 4AC0A 2NVTJ 4FTHA 4B3AA 1I6HJ 2ID3A 3DEWA 3G1OA 4D7MA 3FIWA 2DA3A 1POGA 2CUEA 4DZPA 1U8BA 4L5EA 4W97A 3A01B 1FTTA 3M3YJ 3CDLA 3L1PA 3TW6A 4X1EA 2M9HA 2JA7J 4A93J 3QPSA 3GTQJ 2ECCA 1GV2A 2EZLA 1ZGWA 4BY7J 3CMYA 3FISA 4V2FA 2P81A 3DCFA 1BL0A 2O8KA 4UUTA 3ZQCA 3VPRA 3MN2A 2YUSA 5IYCJ 2JA8J 1K83J 3HKZN 3HEFA 5M3FJ 1MNMC 1XS9A 1P7JA 3Q3SA 3JRDA 1APLC 4EEFG 1GDTA 4A3DJ 2X48A 3GTPJ 4RBOA 1UG2A 2HQ5A 3S2DJ 2HXOA 4C2MJ 4W1UA 1FIAA 2R5ZA 1BW6A 1IRZA 1BW5A 5HODA 3PO2J 4A3BJ 5J1YA 2ECBA 1AU7A 4S0HB 3ZQGA 3S15J 3GTKJ 1WGXA 2NVYJ 2DMQA 1JKRC 3LSGA 2LLKA 5F0HA 3FK6A 1OFCX 1RKWA 5IP6A 2CQXA 2R5ZB 3ZQLA 1JUMA 1WH5A 2EZKA 2TRTA 2B63J 2HOTA 3RKQA 5FJ8J 3BQZA 5FKOA 2OF7A 3I4NJ 3TP0A 1QRYA 4A3EJ 3JRCA 2R5YA 1IDZA 5IYDJ 5JLWA 1TWCJ 4C3IJ 3GTOJ 5K7ZA 1G2HA 2XGCA 1GVDA 1JUSA 3Q0UA 3LSPA 2XPUA 3BR3A 2LP0A 2Y9YA 1LFUP 5BNGA 1WI3A 4LOCA 4A69C 1ETKA 1GV5A 3BG9A 3IV5A 1RETA 3TW7A 2R5YB 5M3MJ 1JKOC 4Y7NJ 4D5CA 1HLVA 2XB0X 2ZB9A 3JRGA 1UHSA 1IV6A 3IH3A 2XPVA 5C4JJ 3S1MJ 1W0UA 4DW6A 4D7NA 1JT0A 5E3NA 5J3LA 3JRFA 3QPLA 5F04A 4A3KJ 4XRMA 5FLVA 1U78A 2JN6A 3BTLA 2LKXA 2I10A 1XC5A 2EBIA 5IP9J 1MBEA 1HOMA 3JR9A 1Q1VA 4ABZA 2R93J 1HDDC 1B72A 3MVPA 1MBFA 1X2NA 2G0EA 2E1OA 3QQAA 4QIWN 5C3EJ 3E7LA 1MBHA 2E19A 5FKMA 2DMUA 3A02A 3HOYJ 5F27A 2M0CA 3ZQFA 2MG4A 2DA4A 4AUXA 1AHDP 1ZQ3P 3SDGA 5J1UA 2DA5A 1B72B 1TWFJ 1FJLA 3LSJA 1JUPA 5EDNA 4FE4A 1LFBA 4A3GJ 3HB9A 3GTLJ 3ZOBA 2EQRA 4HNVA 1ETXA 2CRGA 5EG0A 4QSHA 1T33A 2E2HJ 2CU7A 3GTJJ 1K61A 3PO3J 3K7AJ 3HOZJ 3FKIJ 4MLOA 4V2GA 5F1JA 2R0QC 1E3OC 3IH4A 4I6ZA 2N8GA 5EG0B 3HDDA 2NS7A 3SFIA 1HDPA 4MFDA 2L9RA 3S14J 3LNQA 2ID6A 3JRAA 3NARA 4Y52J 3H0GJ 2L7ZA 4UUSB 2D5VA 4M3EA 1X58A 4C3JJ 1JTXA 4M3BA 3OIOA 2VUMJ 2L7MP 2ME6A 4A3FJ 1ENHA 5IYBJ 1I50J 1RKTA 1SFOJ 3BR0A 3BG3A 1P7IA 3UKGA 5JLXA 2HI3A 2M34A 3S17J 2COBA 4JX6A 1PUFA 2VKVA 3WHBA 5IOYA 1F36A 5EZHA 3JREA 1Y1VJ 4DYQA 2XB5A 4A3IJ 2EH3A 5C44J 4MFEA 4X6AJ 3BR5A 1IDYA 1BJZA 1JTYA 3HBLA 1VFCA 2RAEA 2HOSA 5M5WJ 3JRHA 2K40A 2LFBA 3D1NI 4FE7A 2W48A 1PUFB 3BR6A 3A03A 1FEXA 3BTCA 3O8GA 1JGGA 2ELKA 3BTIA 3S16J 1MBGA 4IEJA 4M3GA 1NK2P 1ETYA 1IC8A 2GBYA 5M5YJ 4G12A 5GP9A 3K2AA 2YU9J 4FISA 4JYKA 4DYCA 4DZJA 5K7HA 2HOAA 2JJ7A 1HF0A 2DA1A 3H3VK 3ZQHA 1H89C 4I76A 2VKEA 4B1RA 1GT0C 2IBDA 2HXIA 1QVTA 1EF4A 3F0CA 3CQZJ 3B6AA 1MSFC 2K9SA 2EZHA 1ETVA 5FKNA 4A3MJ 1LE8A 2XGDA 5IPAA 5FKKA 1Z0XA 2DMNA 4BXXJ 2JA5J 1RESA 2DA2A 1TWAJ 3PM1A 1WCMJ 4XICA 4J19A 2Y31A 3BQYA 5EEAA 1VF9A 1WPKA 5IP7J 1YRNA 3JRIA 4A3LJ 2XPWA 1LE8B 2R7ZJ 3GTMJ 5IOZA 2Y9ZA 3OSFA 1FTZA 2K9NA 2GM4A 5EZGA 2DMPA 2WV1A 1TWGJ 2VI6A 2K9QA 1YRNB 2L7FP 2PMZN 4M3FA 3I4MJ 2DA6A 5FKLA 1R9TJ 1MSEC 3RZDJ 2IEKA 2M8GX 5K7FA 1IUFA 3JRBA 2GLOA 2MW8A 1D5YA 1XG1A 2EZIA 3HGYA 5M5XJ 4IHXA 2Y2ZA 9ANTA 1FIPA 5F08A 3HOUJ 2CQQA 4C3HJ 1ZR2A 4UUSA 1A6IA 3MKLA 4B4CA 2FX0A 2XGEA 3S1QJ 3NAUA 1B8IA 2WB1N 1SANA 5F0CA 5FLMJ 2X9DA 3LSRA 2ME0A 4JX5A 2H8RA 2AHQA 1ITYA 5EYRA 3TEDA 2WAQN 1ETQA 2LD5A 1ETWA 4QTRA 1ETOA 2XRLA 2AO9A 3HM5A 2LTPA 2HDDA 3BG5A 2L0KA 2HYJA 3BTJA 4XK4A 1O4XA 2DJNA 2JMWA 5E3OA 1B8IB 1HCRA 2X6OA 1F43A 3G1LA 3BR1A 5J1RA 3M4OJ 2M2EA 2JA6J 1ORKA 3OSGA 5F0FA 3C2BA 4D5FA 2Y0SN 1BA5A 3BR2A 3FK7A 5GPCA 1DU6A 4A3CJ 2CUFA 2QF7A 1UMQA 2Y30A 4BBSJ 1Z77A 3GBGA 2NVXJ 1WH7A 2FQ4A 3Q0VA 4XIDA 2DMTA 1W0TA 1JKPC 1X2MA 1MH3A 1IGNA 4M6VA 1NK3P 1RPWA 4XRSA 5DTDA 3IH2A 2KDZA 1TWHJ 4JX4A 3HOVJ 2LY9A 2DA7A 1U9OA 1JT6A 1MBJA 3WHCA 1QPIA 1VNDA 3B6CA 2H1KA 1JKQC 3RQIA 1RR7A 1DU0A 1ZR4A 2NS8A 2DTZA 2MGQA 2FD5A 5C4XJ 4GFBA 2JK3A 4MO7A 1TC3C 1IJWC 1S7EA 2DN0A 2IAIA 3G1MA 1OCPA 5EF6A 2E2JJ 2CJJA 4MIMA 4NDLA 1AKHA 4BY1J 1ZKGA 4M3DA 1CQTA 4DYRA 3SJMA 1ZTRA 1MH4A 2FJ1A 2QCOA 1I3QJ 2XSDC 1A5JA 2VPRA 1H88C 1JJ8C 1VI0A 5EGOA 3HGGA 3GTGJ 3S1RJ 3ZQIA 3OOUA 1AKHB 2O9LA 4AYBN 5E3MA 1Y1WJ 4XRSG 2TCTA 3HOWJ 3BT9A 2KT0A 4RDUA 2JWTA 1MBKA 2LK2A 4IHVA 2NVQJ 1GUUA 5EGOB 1QVUA 3Q0WA 2YS9A 3TP3A 4BKXA 3LOCA 3CCYA 4IHWA 3W6VA 2MSYA 4IHYA 2NOGA 4CYCA 1H8AC 4A3JJ 5GPAA 1U9NA 1IG7A 2E2IJ 1NTCA 3HOXJ 1OJLA 1T56A 3O8HA 5DS9A 3S1NJ 2O7OA 4FCYA 2LVSA 1ZK8A 3A01A 1OCTC 3RZOJ 2LR8A 4CYCB 2R92J 5E3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPT A;  4BBR J;  1JJ6 C;  3S2H J;  4JP0 A;  4AC0 A;  2NVT J;  4FTH A;  4B3A A;  1I6H J;  2ID3 A;  3DEW A;  3G1O A;  4D7M A;  3FIW A;  2DA3 A;  1POG A;  2CUE A;  4DZP A;  1U8B A;  4L5E A;  4W97 A;  3A01 B;  1FTT A;  3M3Y J;  3CDL A;  3L1P A;  3TW6 A;  4X1E A;  2M9H A;  2JA7 J;  4A93 J;  3QPS A;  3GTQ J;  2ECC A;  1GV2 A;  2EZL A;  1ZGW A;  4BY7 J;  3CMY A;  3FIS A;  4V2F A;  2P81 A;  3DCF A;  1BL0 A;  2O8K A;  4UUT A;  3ZQC A;  3VPR A;  3MN2 A;  2YUS A;  5IYC J;  2JA8 J;  1K83 J;  3HKZ N;  3HEF A;  5M3F J;  1MNM C;  1XS9 A;  1P7J A;  3Q3S A;  3JRD A;  1APL C;  4EEF G;  1GDT A;  4A3D J;  2X48 A;  3GTP J;  4RBO A;  1UG2 A;  2HQ5 A;  3S2D J;  2HXO A;  4C2M J;  4W1U A;  1FIA A;  2R5Z A;  1BW6 A;  1IRZ A;  1BW5 A;  5HOD A;  3PO2 J;  4A3B J;  5J1Y A;  2ECB A;  1AU7 A;  4S0H B;  3ZQG A;  3S15 J;  3GTK J;  1WGX A;  2NVY J;  2DMQ A;  1JKR C;  3LSG A;  2LLK A;  5F0H A;  3FK6 A;  1OFC X;  1RKW A;  5IP6 A;  2CQX A;  2R5Z B;  3ZQL A;  1JUM A;  1WH5 A;  2EZK A;  2TRT A;  2B63 J;  2HOT A;  3RKQ A;  5FJ8 J;  3BQZ A;  5FKO A;  2OF7 A;  3I4N J;  3TP0 A;  1QRY A;  4A3E J;  3JRC A;  2R5Y A;  1IDZ A;  5IYD J;  5JLW A;  1TWC J;  4C3I J;  3GTO J;  5K7Z A;  1G2H A;  2XGC A;  1GVD A;  1JUS A;  3Q0U A;  3LSP A;  2XPU A;  3BR3 A;  2LP0 A;  2Y9Y A;  1LFU P;  5BNG A;  1WI3 A;  4LOC A;  4A69 C;  1ETK A;  1GV5 A;  3BG9 A;  3IV5 A;  1RET A;  3TW7 A;  2R5Y B;  5M3M J;  1JKO C;  4Y7N J;  4D5C A;  1HLV A;  2XB0 X;  2ZB9 A;  3JRG A;  1UHS A;  1IV6 A;  3IH3 A;  2XPV A;  5C4J J;  3S1M J;  1W0U A;  4DW6 A;  4D7N A;  1JT0 A;  5E3N A;  5J3L A;  3JRF A;  3QPL A;  5F04 A;  4A3K J;  4XRM A;  5FLV A;  1U78 A;  2JN6 A;  3BTL A;  2LKX A;  2I10 A;  1XC5 A;  2EBI A;  5IP9 J;  1MBE A;  1HOM A;  3JR9 A;  1Q1V A;  4ABZ A;  2R93 J;  1HDD C;  1B72 A;  3MVP A;  1MBF A;  1X2N A;  2G0E A;  2E1O A;  3QQA A;  4QIW N;  5C3E J;  3E7L A;  1MBH A;  2E19 A;  5FKM A;  2DMU A;  3A02 A;  3HOY J;  5F27 A;  2M0C A;  3ZQF A;  2MG4 A;  2DA4 A;  4AUX A;  1AHD P;  1ZQ3 P;  3SDG A;  5J1U A;  2DA5 A;  1B72 B;  1TWF J;  1FJL A;  3LSJ A;  1JUP A;  5EDN A;  4FE4 A;  1LFB A;  4A3G J;  3HB9 A;  3GTL J;  3ZOB A;  2EQR A;  4HNV A;  1ETX A;  2CRG A;  5EG0 A;  4QSH A;  1T33 A;  2E2H J;  2CU7 A;  3GTJ J;  1K61 A;  3PO3 J;  3K7A J;  3HOZ J;  3FKI J;  4MLO A;  4V2G A;  5F1J A;  2R0Q C;  1E3O C;  3IH4 A;  4I6Z A;  2N8G A;  5EG0 B;  3HDD A;  2NS7 A;  3SFI A;  1HDP A;  4MFD A;  2L9R A;  3S14 J;  3LNQ A;  2ID6 A;  3JRA A;  3NAR A;  4Y52 J;  3H0G J;  2L7Z A;  4UUS B;  2D5V A;  4M3E A;  1X58 A;  4C3J J;  1JTX A;  4M3B A;  3OIO A;  2VUM J;  2L7M P;  2ME6 A;  4A3F J;  1ENH A;  5IYB J;  1I50 J;  1RKT A;  1SFO J;  3BR0 A;  3BG3 A;  1P7I A;  3UKG A;  5JLX A;  2HI3 A;  2M34 A;  3S17 J;  2COB A;  4JX6 A;  1PUF A;  2VKV A;  3WHB A;  5IOY A;  1F36 A;  5EZH A;  3JRE A;  1Y1V J;  4DYQ A;  2XB5 A;  4A3I J;  2EH3 A;  5C44 J;  4MFE A;  4X6A J;  3BR5 A;  1IDY A;  1BJZ A;  1JTY A;  3HBL A;  1VFC A;  2RAE A;  2HOS A;  5M5W J;  3JRH A;  2K40 A;  2LFB A;  3D1N I;  4FE7 A;  2W48 A;  1PUF B;  3BR6 A;  3A03 A;  1FEX A;  3BTC A;  3O8G A;  1JGG A;  2ELK A;  3BTI A;  3S16 J;  1MBG A;  4IEJ A;  4M3G A;  1NK2 P;  1ETY A;  1IC8 A;  2GBY A;  5M5Y J;  4G12 A;  5GP9 A;  3K2A A;  2YU9 J;  4FIS A;  4JYK A;  4DYC A;  4DZJ A;  5K7H A;  2HOA A;  2JJ7 A;  1HF0 A;  2DA1 A;  3H3V K;  3ZQH A;  1H89 C;  4I76 A;  2VKE A;  4B1R A;  1GT0 C;  2IBD A;  2HXI A;  1QVT A;  1EF4 A;  3F0C A;  3CQZ J;  3B6A A;  1MSF C;  2K9S A;  2EZH A;  1ETV A;  5FKN A;  4A3M J;  1LE8 A;  2XGD A;  5IPA A;  5FKK A;  1Z0X A;  2DMN A;  4BXX J;  2JA5 J;  1RES A;  2DA2 A;  1TWA J;  3PM1 A;  1WCM J;  4XIC A;  4J19 A;  2Y31 A;  3BQY A;  5EEA A;  1VF9 A;  1WPK A;  5IP7 J;  1YRN A;  3JRI A;  4A3L J;  2XPW A;  1LE8 B;  2R7Z J;  3GTM J;  5IOZ A;  2Y9Z A;  3OSF A;  1FTZ A;  2K9N A;  2GM4 A;  5EZG A;  2DMP A;  2WV1 A;  1TWG J;  2VI6 A;  2K9Q A;  1YRN B;  2L7F P;  2PMZ N;  4M3F A;  3I4M J;  2DA6 A;  5FKL A;  1R9T J;  1MSE C;  3RZD J;  2IEK A;  2M8G X;  5K7F A;  1IUF A;  3JRB A;  2GLO A;  2MW8 A;  1D5Y A;  1XG1 A;  2EZI A;  3HGY A;  5M5X J;  4IHX A;  2Y2Z A;  9ANT A;  1FIP A;  5F08 A;  3HOU J;  2CQQ A;  4C3H J;  1ZR2 A;  4UUS A;  1A6I A;  3MKL A;  4B4C A;  2FX0 A;  2XGE A;  3S1Q J;  3NAU A;  1B8I A;  2WB1 N;  1SAN A;  5F0C A;  5FLM J;  2X9D A;  3LSR A;  2ME0 A;  4JX5 A;  2H8R A;  2AHQ A;  1ITY A;  5EYR A;  3TED A;  2WAQ N;  1ETQ A;  2LD5 A;  1ETW A;  4QTR A;  1ETO A;  2XRL A;  2AO9 A;  3HM5 A;  2LTP A;  2HDD A;  3BG5 A;  2L0K A;  2HYJ A;  3BTJ A;  4XK4 A;  1O4X A;  2DJN A;  2JMW A;  5E3O A;  1B8I B;  1HCR A;  2X6O A;  1F43 A;  3G1L A;  3BR1 A;  5J1R A;  3M4O J;  2M2E A;  2JA6 J;  1ORK A;  3OSG A;  5F0F A;  3C2B A;  4D5F A;  2Y0S N;  1BA5 A;  3BR2 A;  3FK7 A;  5GPC A;  1DU6 A;  4A3C J;  2CUF A;  2QF7 A;  1UMQ A;  2Y30 A;  4BBS J;  1Z77 A;  3GBG A;  2NVX J;  1WH7 A;  2FQ4 A;  3Q0V A;  4XID A;  2DMT A;  1W0T A;  1JKP C;  1X2M A;  1MH3 A;  1IGN A;  4M6V A;  1NK3 P;  1RPW A;  4XRS A;  5DTD A;  3IH2 A;  2KDZ A;  1TWH J;  4JX4 A;  3HOV J;  2LY9 A;  2DA7 A;  1U9O A;  1JT6 A;  1MBJ A;  3WHC A;  1QPI A;  1VND A;  3B6C A;  2H1K A;  1JKQ C;  3RQI A;  1RR7 A;  1DU0 A;  1ZR4 A;  2NS8 A;  2DTZ A;  2MGQ A;  2FD5 A;  5C4X J;  4GFB A;  2JK3 A;  4MO7 A;  1TC3 C;  1IJW C;  1S7E A;  2DN0 A;  2IAI A;  3G1M A;  1OCP A;  5EF6 A;  2E2J J;  2CJJ A;  4MIM A;  4NDL A;  1AKH A;  4BY1 J;  1ZKG A;  4M3D A;  1CQT A;  4DYR A;  3SJM A;  1ZTR A;  1MH4 A;  2FJ1 A;  2QCO A;  1I3Q J;  2XSD C;  1A5J A;  2VPR A;  1H88 C;  1JJ8 C;  1VI0 A;  5EGO A;  3HGG A;  3GTG J;  3S1R J;  3ZQI A;  3OOU A;  1AKH B;  2O9L A;  4AYB N;  5E3M A;  1Y1W J;  4XRS G;  2TCT A;  3HOW J;  3BT9 A;  2KT0 A;  4RDU A;  2JWT A;  1MBK A;  2LK2 A;  4IHV A;  2NVQ J;  1GUU A;  5EGO B;  1QVU A;  3Q0W A;  2YS9 A;  3TP3 A;  4BKX A;  3LOC A;  3CCY A;  4IHW A;  3W6V A;  2MSY A;  4IHY A;  2NOG A;  4CYC A;  1H8A C;  4A3J J;  5GPA A;  1U9N A;  1IG7 A;  2E2I J;  1NTC A;  3HOX J;  1OJL A;  1T56 A;  3O8H A;  5DS9 A;  3S1N J;  2O7O A;  4FCY A;  2LVS A;  1ZK8 A;  3A01 A;  1OCT C;  3RZO J;  2LR8 A;  4CYC B;  2R92 J;  5E3L A; 
#chains in the Genus database with same CATH topology
 1X1A A;  2FE3 A;  2NVT J;  2K7L A;  2R7X A;  2LH9 A;  3E5X A;  3CCV I;  4FX0 A;  4FET A;  2ID3 A;  4BHP A;  5A2Q K;  3DEW A;  5IT3 A;  4D7M A;  3FIW A;  2DA3 A;  1EV7 A;  4DZP A;  3EUH C;  3WU0 A;  3LFK A;  4AVZ A;  3TW6 A;  5DD8 A;  4U7B A;  2ZJR F;  1QU3 A;  2J5P A;  2M9H A;  3KZY A;  3RKY A;  3HSF A;  5E8G A;  2XRO A;  1ZAR A;  4BY7 J;  3FM3 A;  1WHU A;  4MQ9 F;  2VIX A;  2AXT C;  4UUT A;  2IS2 A;  5CVU A;  4CCN A;  4I98 B;  3MN2 A;  2YUS A;  1KU3 A;  4OIP F;  1K83 J;  3HKZ N;  3CTA A;  3IWZ A;  2IA0 A;  4HA8 A;  3Q3S A;  4RAF A;  4A3D J;  2X6W A;  1P92 A;  2W1O A;  3K4B A;  2W00 A;  4L5I A;  3GTP J;  4XLA A;  4RBO A;  4XSX F;  3S2D J;  2LF7 A;  2Q2E A;  4LG0 B;  1X3U A;  2FRH A;  2IA1 A;  1UG0 A;  2QZ8 A;  1BW6 A;  2DU9 A;  5HDG A;  5HOD A;  3PO2 J;  4A3B J;  5CVR A;  1AU7 A;  4X0G A;  1Z6R A;  3CO7 C;  3G6E I;  2FNA A;  3OYD A;  3S15 J;  1XD7 A;  1XGS A;  2PJP A;  2FOK A;  2NVY J;  2DMQ A;  2IS6 A;  2DT5 A;  3LA7 A;  4GRI A;  1Q1H A;  2BZT A;  2ZBK A;  4Y33 A;  1S3J A;  1T6S A;  3H92 A;  1FOY A;  1L0O C;  2EZK A;  4KIB A;  1BOB A;  2K9L A;  4BXU A;  2WTE A;  5HLT A;  3RKQ A;  4PSW A;  1YW7 A;  3BQZ A;  4KN7 X;  1WKM A;  1KZH A;  4HX8 A;  4KIT B;  3I4N J;  3HRM A;  4HBL A;  2QQ9 A;  3JTH A;  1SAX A;  2EA4 A;  5IYD J;  3DBH B;  2HVS A;  1NG7 A;  2EA2 A;  4RB0 A;  4FQG A;  1GVD A;  2VJ5 A;  4RGS A;  1KU7 A;  4XN3 A;  3LSP A;  5FRN A;  1GHC A;  2OBP A;  4CA0 A;  4RGX A;  2K85 A;  3ASN H;  5BNG A;  3JCU C;  4HAM A;  1ETK A;  1EJ9 A;  2HQR A;  3BG9 A;  3A0H C;  2R5Y B;  2DDB A;  3HPG A;  4P96 A;  1JKO C;  4LIV A;  2R7D A;  2IT0 A;  3LSM A;  3QRF F;  2EK5 A;  1X3Z B;  4EV0 A;  2A05 A;  3KET A;  2IRF G;  5HOO A;  5E3N A;  2BXY A;  4ZTJ A;  1YJN I;  3DQV C;  1TW2 A;  3V8J A;  4L0Z B;  5HS7 A;  2NS0 A;  2HU9 A;  4XRM A;  5FLV A;  1LDD A;  4YIF A;  3VSK A;  3ZMD A;  3MWM A;  3DTK A;  3RSN A;  5CYV A;  3OY9 A;  4IRH A;  1Q1V A;  3F22 A;  4AIH A;  4Z2Y A;  1Y6I A;  1B72 A;  4OIQ F;  2VON A;  3MVP A;  1YE9 A;  4XON A;  1SFU A;  4L9T A;  1LKX A;  2KHM A;  1W7P D;  4PGG A;  3L2C A;  2NAZ A;  3A02 A;  2CQ7 A;  2VXZ A;  3HOY J;  3AL0 C;  2M0C A;  3ZQF A;  2EIL H;  4RA2 A;  2VQG A;  2XKO A;  2HVQ A;  3CUO A;  2OC6 A;  4XOR A;  5J1U A;  3EQL F;  2DA5 A;  1MNE A;  1FJL A;  4B43 A;  3J80 Z;  2XRN A;  1TQP A;  2P6T A;  1W5C C;  1LFB A;  4HPQ A;  3SEQ A;  1BJA A;  1YFH A;  5D5W B;  4KIF A;  1WRJ A;  2COM A;  5EG0 A;  4QSH A;  3HOS A;  1XMX A;  4IVN A;  4HLX A;  5J40 A;  1S29 A;  2ISY A;  1K61 A;  5ED4 A;  3BJ6 A;  3QOP A;  3PO3 J;  2UXX A;  5ICG A;  4KUM A;  5JVG F;  5ERI A;  1G4D A;  1B4A A;  1V5F A;  1P4W A;  4RM3 A;  2DYS H;  3HRS A;  3OR2 C;  4L18 B;  3E6M A;  1E17 A;  1XPX A;  1F9N A;  3VWB A;  3ECH A;  1JE8 A;  3BY6 A;  1HDP A;  3R4K A;  2H8W A;  2ID6 A;  2CUZ A;  1MMN A;  2K4J A;  2EV0 A;  3H0G J;  3OYJ A;  3M7G A;  3L7W A;  3CJN A;  4M3E A;  4XRF A;  2K86 A;  4R8H A;  4KIS A;  1E3P A;  2L7M P;  2ME6 A;  2GOM A;  4A2U A;  5LHH A;  1UZC A;  3M8E A;  2VL8 A;  3GLL A;  4CUG A;  2JZY A;  1K7A A;  1SFO J;  1P7I A;  3UKG A;  1OYW A;  1KYZ A;  1BM9 A;  4G94 A;  3OYL A;  4QLC U;  2OAZ A;  5FFX A;  2M34 A;  1H9T A;  5FB2 A;  1X3W B;  3SZG A;  1PUF A;  3F23 A;  3WHB A;  1O3S A;  1O3R A;  2ZFW A;  4XQF A;  2BV6 A;  2BY3 A;  2D1H A;  1I6X A;  4RM2 A;  4DYQ A;  2XB5 A;  2MLK A;  4CZZ A;  3QPH A;  1BJZ A;  1OQY A;  2ISZ A;  2RAE A;  2D2W A;  2L9N A;  2K40 A;  1IXS B;  2LFB A;  4YFX F;  3WTX C;  3D1N I;  4FE7 A;  4ESB A;  3F6O A;  4CCK A;  4YFN F;  1LB2 A;  1RUO A;  1FOW A;  1XB4 A;  1X1D A;  3O8G A;  4KFC A;  2HVR A;  3PNY A;  1JGG A;  2F4O B;  2P5V A;  2M0M A;  3S16 J;  5JVT A;  4IEJ A;  1NK2 P;  1D0Z A;  1R5H A;  1H9G A;  2E60 A;  5GP9 A;  4D1Q A;  1OLT A;  3WGG A;  2HOA A;  3VOE A;  2DA1 A;  1W36 C;  1H89 C;  3NWS A;  5GTH C;  2VKE A;  4B1R A;  5K1Y A;  1U0J A;  2IBD A;  2HXI A;  2V6C A;  4G7O F;  2X1C A;  1FWZ A;  6PAX A;  3PIO F;  2CQN A;  2K4B A;  3BP8 A;  3ZMU A;  3J81 K;  3I55 I;  2ACJ A;  3RYR A;  5FRM A;  1L3L A;  2I5U A;  3SZT A;  1Y8R B;  1LE8 A;  3OYA A;  3BPX A;  1Z0X A;  4BXX J;  3MEX A;  3WE3 A;  1BN5 A;  4F52 A;  3O6B B;  4O6J A;  1FYM A;  1D0X A;  4U0W A;  1VQP I;  4P9F A;  4HQE A;  3FMQ A;  1BIA A;  1K78 A;  1I5Z A;  4A3L J;  2XPW A;  2R7Z J;  3PQK A;  3TDZ C;  3MKW B;  2XIG A;  1K4T A;  2A61 A;  1UST A;  1ZN2 A;  4XKB A;  3IRQ A;  2HZT A;  1BI2 A;  5DM7 F;  1GLN A;  1FTZ A;  3HUG A;  3I58 A;  4O5V A;  4E7J A;  2E5Z A;  2WV1 A;  3X2Q H;  1FC3 A;  1NHA A;  1N75 A;  3QAH A;  4XLP F;  3I4M J;  1J2X A;  5BOX A;  3DKW A;  3KEO A;  3R6S A;  2ZME B;  3WTZ A;  1PDN C;  1IV8 A;  2M8G X;  2AS5 F;  2GLO A;  5E1Z B;  3ZN1 A;  1XG1 A;  3R61 A;  2EZI A;  3HGY A;  1DDN A;  2YX7 A;  1ON2 A;  3OYI A;  1YW9 A;  3ABT A;  2ZO4 A;  3HJE A;  2OUM A;  4E70 A;  1A6I A;  4MHG A;  4BEH B;  1HST A;  1S9H A;  2O61 A;  5D8K B;  1B8I A;  2HOE A;  4WK8 F;  4WWC A;  5HLH A;  3ASO H;  4JX5 A;  1SD4 A;  1OCR H;  5EYR A;  2OZ6 A;  4ZZL A;  5J6X A;  4LLN A;  2LBF B;  1QZZ A;  2XRL A;  4Q47 A;  4GGG A;  4ESF A;  1PP7 U;  2HDD A;  2LTP A;  3C7J A;  3BTJ A;  4XK4 A;  5LFA A;  3CMM A;  2VAS A;  1WJC A;  1ZGJ A;  2X6O A;  3ZN0 A;  1F43 A;  4EJO A;  1W5S A;  4MEX F;  5J1R A;  3CCR I;  5GTI C;  1QGP A;  1O7F A;  2IP2 A;  1SVL A;  5LRS A;  3KLO A;  3L2W A;  2AQE A;  3K1P A;  5F0F A;  1U5T B;  3PQJ A;  1BA5 A;  3FK7 A;  5LRR A;  4E4H A;  3DU5 A;  4N4O B;  3KE2 A;  5KAI C;  2Y75 A;  5BPD A;  2Y30 A;  4BBS J;  3GBG A;  5K5O A;  1WH7 A;  1LPQ A;  2ELJ A;  1Z1D A;  1DPU A;  2JSC A;  4ZTF A;  2R7F A;  3EET A;  3GZ6 A;  1FNN A;  3MD2 A;  1RPW A;  4XRS A;  2KDZ A;  3K6G A;  3GYH X;  2ESN A;  3ZRG A;  4DQ2 A;  1JGS A;  2QEX I;  3MQ0 A;  4XBF A;  3R0J A;  2DA7 A;  2K3P A;  3FBI B;  2HPM A;  2FML A;  3N4M A;  3QOD A;  2L3D A;  2RGV A;  4EM1 A;  3B6C A;  3ZGK A;  3KYL A;  3JSP A;  2NS8 A;  1S72 I;  2XV4 S;  5C4X J;  3IP4 B;  2LG4 A;  4A0Y A;  1S7E A;  2EIN H;  3ZXS A;  2QGU A;  2XF6 A;  3G1M A;  5DD4 A;  1V5E A;  5KCM A;  2IGK A;  3DBL B;  2CJJ A;  4NDL A;  3ZMS A;  2E7W A;  1Y39 A;  3E0J B;  1IZ1 A;  1O7L A;  2DK8 A;  4DYR A;  2FJ1 A;  4D0P A;  1I3Q J;  3QOE A;  1HKQ A;  1XGO A;  3GXO A;  1JJ8 C;  3L09 A;  1VI0 A;  3IAS 2;  3W3C A;  3H9J A;  2PI0 A;  3BOQ A;  3FXO A;  3CCJ I;  3S1R J;  5E20 A;  4ZH4 F;  3ZQI A;  2DK5 A;  1FZP B;  1OIS A;  2ZME A;  4BE0 A;  1VZ0 A;  2R7W A;  2DT6 A;  2E1C A;  2O9L A;  3CJT B;  4XRS G;  4RB3 C;  4EGZ A;  2X51 A;  1UJ8 A;  2WY8 Q;  1WVR A;  1J09 A;  2LK2 A;  3E1S A;  3A4C A;  3IC7 A;  4IHV A;  2RKH A;  4MTD A;  3GEZ A;  4B09 A;  3K69 A;  2K27 A;  3TP3 A;  3WTV C;  3VYU B;  4BKX A;  3LOC A;  3H5R A;  2EJR A;  2FU4 A;  1SMT A;  3W6V A;  4IRG A;  2KLO A;  3LST A;  2MSY A;  1WSU A;  4IHY A;  1LUJ B;  3CLO A;  1H8A C;  1SMY F;  2JRM A;  3AL0 B;  2GIZ A;  1IG7 A;  4G8X A;  1KON A;  3HOX J;  2DW4 A;  4EAT A;  5DUI A;  2O7O A;  1CF7 B;  2QSH X;  2ZC2 A;  3IUO A;  3MCZ A;  4IX7 A;  2Z9O A;  4RLQ A;  1X1C A;  3LWF A;  3G73 A;  3A01 A;  1OCT C;  2GXG A;  4EGY A;  1V4R A;  4C2T A;  3FX3 A;  2WAQ A;  2PMU A;  4GO1 A;  3S2H J;  4AC0 A;  1MZB A;  1STZ A;  1KA8 A;  2HKX A;  2L9S A;  5LLQ A;  4FTH A;  4HST A;  4E7L A;  3VFZ A;  1A35 A;  4D9J A;  3G1O A;  3PUF A;  1U5T A;  2CUE A;  4W97 A;  2M30 A;  2VT2 A;  3I53 A;  3M3Y J;  3CDL A;  2KRH A;  3JSO A;  1HKT A;  3BCA A;  2QLZ A;  5IY5 H;  4IKF A;  3CCQ I;  1WJA A;  4B47 A;  1EH8 A;  4XKW A;  4OIN F;  3QPS A;  2JA7 J;  4Q5S F;  2ECC A;  1HXD A;  3LAJ A;  1ZGW A;  4RAY A;  2P81 A;  4BQQ A;  1IRG A;  1Z91 A;  2Y0S A;  2KZV A;  3S8P A;  5IYC J;  1TQI A;  5M3F J;  3BPV A;  1DP3 A;  2FF4 A;  2E1N A;  1APL C;  1GDT A;  4EEF G;  1VQ5 I;  1SFE A;  2VC1 A;  4L9J A;  1ON1 A;  4DGW B;  3O3K A;  1UG2 A;  3TMO A;  3D5L A;  2HXO A;  2DFI A;  2IXS A;  2GA1 A;  3VYS B;  3W2A A;  2O03 A;  1BI1 A;  3GFM A;  1FIA A;  3GFJ A;  3OV8 A;  4WXD A;  1IRZ A;  1BW5 A;  5KK1 A;  3KCC A;  3KFW X;  1EA3 A;  1LNW A;  4M6Y A;  3ZQG A;  3CMA I;  2QM3 A;  3L2U A;  1I39 A;  3GTK J;  2EIM H;  3OIP A;  2JVG A;  4RMN A;  2DPD A;  4UV8 A;  4BXF A;  2Q2E B;  2LLK A;  2F5C A;  5F0H A;  3E6C C;  2DLL A;  4A0X A;  2ZKZ A;  4HRI A;  1WH5 A;  5A2Q Z;  5LGN A;  1QHG A;  4BJT A;  2HOT A;  4YEL A;  4BL0 B;  3LAP A;  1HW2 A;  1SD5 A;  3KLN A;  3MMY B;  3BC8 A;  2K02 A;  2IA2 A;  1QRY A;  3DKX A;  3TO9 A;  3JRC A;  5ICC A;  3ZP5 A;  2YPR A;  1S7O A;  1T0F A;  1FP2 A;  4C3I J;  4F55 A;  3GTO J;  2XGC A;  3FXM A;  2QKL B;  1JUS A;  1P9Q C;  4BDY A;  1QHH D;  2OZU A;  2XPU A;  3BR3 A;  3VYR B;  1WI3 A;  2KFD A;  3DEU A;  3HSR A;  5JHF A;  2RRE A;  2JTV A;  1IAW A;  3Q9V A;  5DDG A;  4AIK A;  2W84 A;  1RET A;  1QO0 D;  4ZC3 A;  4D5C A;  1HLV A;  2XB0 X;  1UHS A;  4N4N B;  2HFH A;  4BQN A;  1IV6 A;  3IH3 A;  5GAE J;  3QYB A;  5C4J J;  4JQF A;  1YS7 A;  3TGN A;  3JRF A;  2XSJ C;  1BIB A;  4A3K J;  2JA2 A;  4YG2 F;  1J9I A;  4P9U A;  1IUY A;  3VB2 A;  1WJ5 A;  3A1Y A;  2BBY A;  4LB6 B;  1U78 A;  3BTL A;  4A12 A;  2DPU A;  2I10 A;  3RCO A;  1XDU A;  3PNV A;  5JI6 A;  3TL4 X;  2EBI A;  2F5D A;  4R79 A;  1MBE A;  2G7U A;  5GAD J;  1HOM A;  2KDO A;  3PL8 A;  1PP8 F;  3KPH A;  3SEZ A;  3QP5 A;  2VN2 A;  2ZME C;  2PN6 A;  2J5O A;  2X6Y A;  3QQA A;  4PCQ A;  5FKM A;  2OTJ I;  2Z1D A;  5F27 A;  1ZG1 A;  4Q48 A;  1TZL A;  3QYF A;  2MG4 A;  3TBI A;  4AUX A;  3SYT A;  1P2F A;  4HQM A;  2WAF A;  5H6Q A;  1MMS A;  1H0M A;  2PEX A;  3DBR B;  1B72 B;  3UNG C;  1JUP A;  5D6F A;  4BDZ A;  2CYY A;  4OMZ A;  5B5E C;  2VOO A;  3I71 A;  3ZOB A;  4HNV A;  5HNH A;  2HEO A;  1ETX A;  3ISP A;  2CRG A;  4EJV A;  2E2H J;  2OV7 A;  3QYE A;  2R3S A;  5HS8 A;  2M1B A;  3KZI C;  3TO6 A;  3CJQ B;  4V2G A;  4PJJ A;  4HSR A;  3IH4 A;  2OCE A;  5EEH A;  2N8G A;  3I59 A;  5EG0 B;  2Q0O A;  3KIO A;  4ITV A;  2BVL A;  1WQ2 A;  1QNT A;  3BZK A;  3LNQ A;  3JRA A;  3NAR A;  5BS6 A;  1IN6 A;  4Y52 J;  3RPU D;  2RDP A;  4E7H A;  1U5T C;  2X4H A;  1G3W A;  4M3B A;  1J75 A;  1U3E M;  3WE2 A;  3UR3 C;  3AFH A;  4A3F J;  1KYW A;  2W57 A;  1YX5 A;  1ENH A;  5IYB J;  2V1X A;  1I50 J;  1NG6 A;  1RKT A;  1MGT A;  5TIS C;  3N05 A;  4BJ5 C;  3J7A O;  3AKZ A;  4EMS A;  3PSF A;  1O57 A;  4N0B A;  5JLX A;  3ZPL A;  2JRT A;  2F2E A;  3JAM K;  1G59 A;  3S17 J;  3EUA A;  2HTJ A;  2X1E A;  3FXR A;  4JX6 A;  3I54 A;  3LL7 A;  1PVE A;  3G4S I;  3U2R A;  2EIK H;  2EFN A;  2WA0 A;  2YSR A;  1YI2 I;  1YX3 A;  4A3I J;  4Y15 A;  4MFE A;  3CC7 I;  3L9F A;  3DTE A;  1IDY A;  3CCL I;  2HOS A;  3HBL A;  3WU1 B;  1R23 A;  5D5X B;  2HQN A;  4II3 A;  2YR2 A;  3FKJ A;  2CFO A;  1PUF B;  3BR6 A;  1R58 A;  3A03 A;  3E5U A;  3BTC A;  4ZYG A;  3CME I;  1D1B A;  3K4J A;  2LF8 A;  5D4S A;  1WJE A;  5DCF A;  3BTI A;  4ASN A;  4PFO A;  2OQG A;  2E35 A;  1SD7 A;  3BCB A;  2GXB A;  5E1X A;  1KGS A;  4FIS A;  4DYC A;  2QA4 I;  3S3M A;  1HF0 A;  2IGM A;  4CIC A;  1A36 A;  4PGH A;  1EF4 A;  3V42 A;  3I4P A;  5F1R A;  1FSH A;  5ILU A;  2A6T A;  3M07 A;  4BUP A;  4XL9 A;  2UXN A;  1AWC A;  2BY0 A;  2KIQ A;  4A3M J;  3CC2 I;  1OPC A;  1IRX A;  5IPA A;  4UNO A;  2DMN A;  1W36 D;  1MJA A;  2JA5 J;  2DA2 A;  1TWA J;  3PM1 A;  1WCM J;  3F8C A;  3WTS C;  1R7J A;  2Y31 A;  3BQY A;  5EEA A;  1XMK A;  2F6C A;  2W7N A;  2XKP A;  4BE1 A;  4MNU A;  1BC8 C;  1T38 A;  3I3L A;  1LE8 B;  5D5V B;  3Q9S A;  5IOZ A;  2Q8K A;  1R5I D;  4NBQ A;  5LEK A;  4UXN A;  2UZK A;  2L4M A;  2MLG A;  4PUS A;  4PJ0 C;  2VKD A;  5EZG A;  4M71 A;  4WCG A;  1QQI A;  1XCV A;  2MD5 A;  4A5N A;  1TWG J;  1K78 B;  5FO5 A;  5J8C A;  2FBH A;  4M3F A;  2V6E A;  2DA6 A;  2DFH A;  1HW5 A;  3AG1 H;  4BYY A;  4I0B A;  4NUB A;  2ICW G;  1MSE C;  2CMP A;  1X4O A;  4ENK A;  2IEK A;  3KP6 A;  3HUG B;  5AIP A;  1IUF A;  3E97 A;  5ICE A;  4HW0 A;  3FXU A;  1BI3 A;  9ANT A;  1R1U A;  2O5R A;  2ZCW A;  3AAF A;  5F08 A;  1E2X A;  1GXQ A;  3J81 Z;  1JXS A;  2P7V B;  3T5X A;  3BZ6 A;  3PIP F;  4RGR A;  2RNJ A;  4K2E A;  3W6J B;  4B4C A;  1TL8 A;  2WB1 N;  1SAN A;  2LMD A;  5FLM J;  3OYB A;  2OTL I;  2X9D A;  4EQQ A;  2H8R A;  1YJ9 I;  2WAQ N;  1ETQ A;  2LD5 A;  2HS5 A;  4A6E A;  1V3F A;  3TOA A;  2A68 F;  1XSV A;  3C1D A;  1IXR C;  2AO9 A;  2DTR A;  4RS8 A;  1VQO I;  2KPM A;  5KNL A;  3DU6 A;  2L0K A;  5BPI A;  3M8F A;  1LEA A;  2DJN A;  5E3O A;  2MH2 A;  2O8X A;  4I01 A;  1O4X A;  1B8I B;  2KJC A;  2R7Q A;  1HSJ A;  2HNH A;  1W4M A;  2P0W A;  2M45 A;  1ORK A;  5H20 A;  2V1N A;  1MMA A;  1WZ2 A;  3C2B A;  4HF2 A;  2Y0S N;  3BR2 A;  2CQK A;  3CDH A;  2H6B A;  2PG4 A;  1DU6 A;  2BY2 A;  2DOD A;  3OYN A;  1Z77 A;  2B9S A;  1IW7 F;  3OYK A;  4UVB A;  2FQ4 A;  4WXH A;  3C2H A;  5FD5 A;  4CDG A;  2R7T A;  4NC6 A;  1MH3 A;  4DIQ A;  4FAS D;  4OAZ A;  2MC4 A;  4KJZ A;  4M6V A;  4BGD A;  4YIR X;  3K1M A;  2GZW A;  3IH2 A;  2VB6 A;  3KP5 A;  1IF1 A;  4JX4 A;  2LY9 A;  3ABL H;  3SFZ A;  1JT6 A;  4ZDP A;  4LIU A;  1A31 A;  2RVC A;  4I02 A;  2IGO A;  2HYF A;  3OWT A;  4UV9 A;  2KP6 A;  3RQI A;  1TTY A;  1VTN C;  3WTY C;  4UB6 C;  3OYH A;  3F72 A;  4LIT A;  2GIV A;  4MO7 A;  3KX2 A;  4A0Z A;  1IJW C;  4G6Q A;  2RC4 A;  3F6V A;  2IAI A;  2DQR A;  2CV0 A;  2Q1Z B;  3FMR A;  1OCP A;  2E2J J;  4OIR F;  3T1B A;  1ZKG A;  3I5U A;  4M3D A;  5D5U B;  4M9S A;  3U1K A;  1UAA A;  1UHW A;  3HXL A;  2EFQ A;  2VBX A;  3SJM A;  4LK1 F;  2W4S A;  1MJB A;  3H35 A;  4OAY A;  3Q5F A;  1VQ6 I;  1MH4 A;  2V1D A;  4AU7 A;  5FLX K;  5CQG A;  1K4S A;  4YII A;  4QPQ A;  1KQ0 A;  4B8X A;  4AID A;  1M1E B;  4BJ6 C;  2FQ3 A;  1ZH5 A;  3GTG J;  3L2Q A;  2GA2 A;  2Y0M A;  4IQ4 A;  3A0B C;  4KN4 X;  5E3M A;  4KYW A;  1RC9 A;  3GF2 A;  1FPQ A;  3OR1 C;  3BG7 A;  4ZDL A;  1Y1W J;  3BT9 A;  3IHU A;  2KT0 A;  2CW8 A;  2A07 F;  3DLL F;  1MBK A;  4UB8 C;  3H9Q A;  5B66 C;  2E71 A;  1UCR A;  4F93 B;  1B9M A;  1R5G A;  4HG2 A;  3K0L A;  3TOB A;  4IOC F;  2ZNZ A;  3CCM I;  1XMA A;  2YS9 A;  2BW3 A;  2P5K A;  5J47 A;  3ABM H;  1KQ9 A;  1ODD A;  3HRU A;  5LEJ A;  1FT9 A;  4A5M A;  2GXA A;  5LGT A;  4CYC A;  1YYV A;  1RRJ A;  1OCC H;  1DQU A;  1T98 A;  1U9N A;  2XF7 A;  1R71 A;  1NTC A;  4HV5 A;  2IPQ X;  3WTT C;  1Z3Y A;  1K6Y A;  4KIG A;  5H6R A;  1PJR A;  5DS9 A;  3S1N J;  4FCY A;  2EB7 A;  2A6H F;  2CW7 A;  2FXA A;  4M6X A;  2F5F A;  1ZRD A;  5CQE A;  4L9V A;  3FF5 A;  1RI7 A;  2KIM A;  2DXI A;  5LHG A;  3TDU C;  2LR8 A;  2R4G A;  2R92 J;  5LD2 C;  2VXD A;  5E3L A;  3CCS I;  4AM3 A;  2AXL A;  3SZP A;  3OMY A;  1JJ6 C;  4JP0 A;  2VOP A;  1I6H J;  2W82 A;  1BR4 A;  2PQ8 A;  1OKR A;  2WV0 A;  1U8B A;  1ZG5 A;  1VQ8 I;  3BLY A;  3C3W A;  3DPL C;  3KYC B;  3A01 B;  2XDV A;  3L1P A;  5FD6 A;  4MEY F;  4CYD A;  4Q4Z F;  4X1E A;  5CLS A;  3WU2 C;  1GV2 A;  2EZL A;  3GWZ A;  1XSD A;  4HV6 A;  4E7S A;  2CO5 A;  3FIS A;  1P4A A;  1FBS A;  3DCF A;  3FXJ A;  1BL0 A;  1QA6 A;  3ZQC A;  4LK0 F;  3VPR A;  3EPZ A;  3VDX A;  2JA8 J;  2BXZ A;  3HEF A;  5F6F A;  4G6T B;  3AG3 H;  1AA7 A;  2YU3 A;  3JRD A;  1XS9 A;  4KT6 A;  2X48 A;  1FY7 A;  3RIR A;  1I27 A;  1VQ9 I;  3GZN B;  4PJN A;  4W1U A;  3SHF A;  4ZYH A;  2L2O A;  2VKH A;  2NNY A;  2R5Z A;  3HTU A;  3C2G A;  2L4A A;  3TQN A;  2LY2 A;  4GCV A;  2MC3 A;  1DPR A;  1JKR C;  2BY1 A;  1ZLJ A;  2KRC A;  4OWR B;  2CQX A;  3P9K A;  1X1B A;  1JUM A;  1HQC A;  2O6G E;  1Z6T A;  3OYE A;  3QWL A;  2DFE A;  5FJ8 J;  1FSE A;  1KU2 A;  2OF7 A;  1YIO A;  3S32 A;  2JQ7 A;  3TP0 A;  3I56 I;  4A3E J;  1XGM A;  2W24 A;  2ZXH A;  2VE9 A;  3U21 A;  1IDZ A;  5JLW A;  2H27 A;  4E7I A;  5K7Z A;  1J5Y A;  2R7R A;  1GVJ A;  2QVO A;  1NH3 A;  2JUC A;  4H4K C;  3Q0U A;  4HZF A;  2R7O A;  2FBK A;  3FXQ A;  1LFU P;  3ZMV A;  4LOC A;  1WI9 A;  4A69 C;  4II2 A;  3S2W A;  3ABU A;  3PSI A;  1GV5 A;  1XCB A;  1OYI A;  3IV5 A;  3GO5 A;  4XKC A;  3TW7 A;  4Y7N J;  3CF2 A;  3JRG A;  2XPV A;  3DFG A;  4D7N A;  1JT0 A;  5J3L A;  3KP3 A;  4PK4 A;  2CSO A;  2QQB A;  1ZYR F;  1TNT A;  2V7F A;  4LJZ F;  3CJR B;  5FRO A;  4NHJ A;  2MBF A;  2JN6 A;  2ADU A;  2VE8 A;  2LKX A;  4YRV A;  3JW4 A;  1VQN I;  3LSK A;  5IP9 J;  2QBY A;  3NRV A;  4UUV A;  3CC4 I;  2JUG A;  1RIO H;  5J4Y A;  3WGI A;  1X4P A;  3CCU I;  2G0E A;  1FX7 A;  4U7D A;  3E7L A;  2E19 A;  3CUQ A;  3WG7 H;  3GZ5 A;  1YTY A;  1Y8Q B;  2DA4 A;  4HEA 2;  1AHD P;  1MMG A;  2DAO A;  3G2B A;  4Z6Y A;  1TWF J;  5B1B H;  2WB1 A;  2FA5 A;  3H5A A;  4A3G J;  5FGM A;  3FHZ A;  4BU2 A;  4G9Y A;  5ILV A;  3GTL J;  5HLI A;  2EQR A;  4ZYD A;  2XAH A;  1T33 A;  4XLN F;  5K5R A;  2CU7 A;  3IRR A;  2B0L A;  1G3T A;  3GTJ J;  2STW A;  2ZSI B;  2M7A A;  2XAU A;  3K7A J;  3FHN A;  3DV8 A;  4BHC A;  4E6K G;  2PBI A;  3HOZ J;  4EM2 A;  3NEU A;  1JI8 A;  4MLO A;  1E3O C;  5F1J A;  5HNF A;  2RV8 A;  1FMW A;  2NVU B;  3CZ6 A;  4I6Z A;  2K3F A;  4F92 B;  3LSI A;  3DPU A;  3HDD A;  2ZXW H;  3SFI A;  2F48 A;  1QZY A;  4MFD A;  3VSL A;  2L9R A;  3OYC A;  3LFU A;  1DGW Y;  2L7Z A;  2WAE A;  4GXO A;  5HDN A;  1JTX A;  3OIO A;  2VUM J;  3CLQ A;  4KMF A;  1S5L C;  3I59 B;  3F8M A;  4L9N A;  5H2F C;  1W5T A;  1A04 A;  1YW8 A;  5DYM A;  4IHS A;  3DF8 A;  3I9V 2;  3RDI A;  5HDK A;  3BR0 A;  1PUE E;  1HKS A;  1U2W A;  1K79 A;  2E36 A;  3KEY A;  2HI3 A;  2COB A;  3SXY A;  2VKV A;  4HF1 A;  1F36 A;  1ZRE A;  3JRE A;  1MD0 A;  5F64 A;  2EH3 A;  1Y56 A;  2RNG A;  1FBU A;  2KQR A;  3BR5 A;  3LQQ A;  2XAQ A;  5HVQ C;  5C44 J;  1N78 A;  5DV5 A;  4E7K A;  5M5W J;  3JRH A;  2KZG A;  2CWE A;  3EDP A;  1YIJ I;  3JTG A;  5E17 F;  4OU0 A;  4N9H A;  5GAH J;  3MZ8 A;  4XLH A;  2K5C A;  1YLF A;  2L54 A;  3LMM A;  5L3D A;  2CUJ A;  2MYS A;  1UHM A;  2ELK A;  4CZC A;  4RAG A;  2QEN A;  3EUK L;  3FXK A;  2GBY A;  3SQN A;  5M5Y J;  4G12 A;  1IC8 A;  1KU9 A;  4PJL A;  2YU9 J;  2F5V A;  4JYK A;  3HHG A;  5K7H A;  2ELH A;  3G71 I;  4I76 A;  2VQC A;  1QVT A;  2MA3 A;  3F0C A;  3R0A A;  3CQZ J;  1IO2 A;  3B6A A;  1MSF C;  5TJJ A;  2K9S A;  1R4M B;  2CH0 A;  3BWG A;  2EZH A;  1PYV A;  5FKN A;  1Z9C A;  1RNL A;  5KVR A;  2XGD A;  5L3G A;  5FKK A;  5IT9 K;  5DM6 F;  4ZYE A;  3E6D A;  3CO6 C;  1RES A;  2L9V A;  1V55 H;  3OYM A;  3S3N A;  4G7H F;  3JAM Z;  2BEO A;  2F4I A;  2IS4 A;  3CF5 F;  2W25 A;  2IVM A;  5L3C A;  3EYI A;  4M72 A;  1LFP A;  1YRN A;  3HRT A;  2EFP A;  5DEQ A;  1G6N A;  4IJA A;  1TNS A;  2EFO A;  4L0Y B;  2Y9Z A;  3OSF A;  1LJ9 A;  5JHU A;  4UY8 I;  1MJ9 A;  4EM0 B;  1D0Y A;  3ROU A;  5K5Q A;  2K9N A;  1W7P B;  4IOA F;  1LQ1 A;  5KAF C;  4C30 A;  2VI6 A;  2K9Q A;  2QSG X;  3F9K A;  1FLI A;  2BHY A;  4RAZ A;  2DBB A;  2ZJQ F;  3RZD J;  4CSW A;  1JHF A;  1O3T A;  4NB5 A;  1ZAO A;  2XUB A;  5K7F A;  3JRB A;  1TW3 A;  1MDM A;  1HBX G;  4IHX A;  3R60 A;  2CFX A;  2VLA A;  1B9N A;  3E5Q A;  4F91 B;  1WJB A;  2HGC A;  2CQQ A;  4C3H J;  1ZR2 A;  3BJA A;  2V1U A;  1FBQ A;  3GCM A;  5GAG J;  2BHZ A;  4DNC A;  3KP2 A;  2V26 A;  1XGN A;  3RPU A;  1ZHF A;  1ZG3 A;  4ETS A;  2P5L C;  3NAU A;  1J0R A;  4IXA A;  3K70 C;  2JVH A;  2VJ4 A;  4I99 C;  3LSR A;  2ME0 A;  1BOA A;  2AHQ A;  2E34 A;  2NYX A;  4M9Z A;  3TED A;  2KIU A;  3J7Z I;  3K4C A;  1ETW A;  4QTR A;  1J59 A;  4HNU A;  3F8B A;  4HLY A;  3WG9 A;  4Y13 A;  4OIO F;  2KMU A;  3HM5 A;  1D3Y A;  3GX4 X;  2F5E A;  2P7C B;  1HCR A;  2M87 A;  5LBQ A;  2P4W A;  4KMU X;  3J7Y J;  3PFI A;  3G1L A;  3IWF A;  3WTU C;  1Z21 A;  2ZJP F;  2JA6 J;  1IN7 A;  1T95 A;  1HW1 A;  3OSG A;  4ESJ A;  3M8J A;  1OYY A;  4B3X A;  1VQ4 I;  2Z16 A;  1IN5 A;  4GDF A;  1Y0N A;  3V7R A;  3HTS B;  1UMQ A;  2LSO A;  1X1P A;  2Z2S B;  2CV1 A;  3Q0V A;  4S05 A;  4XID A;  4U87 A;  1JKP C;  1X2M A;  2IGN A;  4YFK F;  3AG4 H;  1IGN A;  2VJI A;  1NK3 P;  1LEB A;  2P6S A;  3QPT A;  4I7H A;  1REP C;  1OMI A;  1SVO A;  5DCM A;  2HYG D;  3O2P E;  2JPC A;  1TWH J;  1I1G A;  1XX5 A;  2BE5 F;  4XLE A;  4IO9 F;  4YEJ A;  5E18 F;  3HOV J;  3WOD F;  4XN0 A;  1T8I A;  2EFW A;  2EWN A;  3OOP A;  2OD5 A;  1QPI A;  1TP4 A;  2FSW A;  1J7K A;  1R4N B;  2H1K A;  2LYC A;  1FP1 D;  1I1S A;  2M4K A;  1ZR4 A;  5L3B A;  2DTZ A;  5ILS A;  1R00 A;  4B48 A;  4F3Q A;  1T0F C;  3H3Z A;  3P9C A;  4XSZ F;  3CES A;  2PX9 A;  1TC3 C;  1B6A A;  5EJC A;  2DN0 A;  1DUX C;  3ZR8 X;  2OA4 A;  3H3U A;  3N97 A;  2HTS A;  1AKH A;  3MZH A;  1CQT A;  4M73 A;  4S04 A;  1HC8 A;  1W7P A;  2A5W A;  1R1V A;  2XSD C;  4ENM A;  2VPR A;  1H88 C;  3LSH A;  3S3O A;  2KJB A;  3KYD B;  1VQK I;  5BQT A;  5EGO A;  3HGG A;  5J4V A;  4UVA A;  4OMY A;  5D8L B;  2PLY A;  2TCT A;  3HOW J;  3W2V A;  5JR3 A;  4RDU A;  2CW0 F;  1E3H A;  2HZD A;  2JWT A;  1T08 B;  5LGU A;  2OJE D;  2VC0 A;  3FXL A;  3L2R A;  3HL2 A;  2PMZ A;  5CPR B;  2NVQ J;  2LC2 A;  2PJR A;  1QVU A;  2WAD A;  3Q0W A;  1Z67 A;  3HZJ A;  3RI4 A;  2LNB A;  3U9G A;  2VT3 A;  2XAF A;  4IHW A;  4RB2 C;  2A69 F;  2NOJ B;  5FFZ A;  4DBQ A;  1N25 A;  3GUD A;  4A3J J;  5GPA A;  4LLL A;  1ZRF A;  3VYT B;  2UV1 A;  2VBW A;  3O8H A;  2LVS A;  4KA4 A;  2BW3 B;  1HA8 A;  4ZYA A;  1ZK8 A;  3DPT A;  2A3S A;  4CH7 A;  4CYC B;  1U8R A;  2OPT A;  3GLX A;  3B73 A;  2KRF A;  5CJ9 A;  4BBR J;  4I0A A;  4ON0 A;  5FLX Z;  4B3A A;  3GME A;  3ECO A;  2LRE A;  2JSP A;  4IRI A;  4JBA A;  1POG A;  3SDB A;  4L5E A;  1FTT A;  3NQO A;  3BJO A;  3T0Y A;  2D1V A;  2X85 A;  4LMY A;  5E8I A;  2BVM A;  4AWX B;  5L3E A;  2FBI A;  3U1D A;  4A93 J;  3GTQ J;  4Y3O A;  1ZRC A;  2LKS A;  1V54 H;  4LG0 A;  1A6Q A;  3PFY A;  4PDK A;  3HIF A;  4BQO A;  3M1E A;  3CMY A;  2CGP A;  4V2F A;  2O8K A;  2G9W A;  4XR6 A;  3ZQ7 A;  2KKO A;  1SFK A;  3D0S A;  3OS0 A;  4LB5 A;  1MNM C;  1P7J A;  1BI0 A;  3L00 A;  4JK1 X;  3CP8 A;  1FYL A;  2HQ5 A;  2QYO A;  2HDW A;  4C2M J;  1S6L A;  2BYV E;  4HF0 A;  2M5W A;  4HDU A;  3ERM A;  3HG9 A;  3QU3 A;  1LDK B;  4ZZD A;  1D8K A;  2ECB A;  5J1Y A;  4S0H B;  3GVA A;  4KIC A;  1YQA A;  2H6C A;  3MKY B;  2EV5 A;  1WGX A;  2F4M B;  4R1H A;  2KIF A;  2L5Q A;  3LSG A;  4ENJ A;  4B44 A;  1TLH B;  3F3X A;  3FK6 A;  1OFC X;  1RKW A;  5IP6 A;  3B02 A;  2R5Z B;  3ZQL A;  2H09 A;  3OS1 A;  2TRT A;  3DKY A;  2MD0 A;  2B63 J;  5HLG A;  4CXF A;  1VQL I;  4UHT A;  2RQQ A;  1R1T A;  2ZJ2 A;  5FKO A;  4Y4R A;  2MFZ A;  2QQ8 A;  4XMY A;  2QQA A;  2I8D A;  2E7X A;  4CCL A;  2AQF A;  2R5Y A;  3H9G A;  3OYF A;  3MKZ A;  1TWC J;  2E1M B;  1OR7 A;  1G2H A;  1SFX A;  4XM3 A;  1U6G A;  1Z7L A;  1S8N A;  2ZXI A;  3I0T A;  3J80 K;  2DJI A;  3DP7 A;  3FMS A;  3G3Z A;  3RPQ A;  2LP0 A;  2Y9Y A;  4PJM A;  1YS6 A;  1F1Z A;  2XHK A;  2M4G A;  1UEL B;  4P1W A;  1YJW I;  3M9A A;  2UUZ A;  5M3M J;  1MKM A;  5AIQ A;  3WGH A;  1YIT I;  1YO5 C;  1WWX A;  2ZB9 A;  4AYB A;  2O0Y A;  4V19 K;  3S1M J;  1E0E A;  1W0U A;  2GQQ A;  4DW6 A;  3L2V A;  1LDJ A;  1TT0 A;  1SAU A;  3QPL A;  3K4L A;  5F04 A;  3ZMT A;  1BC7 C;  4ZJZ A;  3IKV A;  1EH6 A;  4N9I A;  2C6Y A;  4UVC A;  2W85 A;  1Z05 A;  3K9T A;  5HS9 A;  1F4K A;  1FOK A;  1XTA A;  1Z3X A;  3GFI A;  4IPA A;  1XC5 A;  3RKX A;  1UFM A;  3DXJ F;  3JR9 A;  1R22 A;  3BDD A;  4BNC A;  3RKW A;  3FBN B;  4M74 A;  4ABZ A;  2R93 J;  1HDD C;  4QPO A;  4U0Y A;  2FMY A;  3LA2 A;  1JHH A;  1MBF A;  1UB9 A;  1X2N A;  2E1O A;  4QIW N;  3OIQ A;  5C3E J;  1MBH A;  4NNJ A;  2ZXJ A;  2CS3 A;  2DMU A;  3ZQQ A;  5LHI A;  4MQV A;  2GOX B;  2D45 A;  4HX7 A;  1ZQ3 P;  4ENN A;  3SDG A;  4HYE A;  2QBY B;  4CHU A;  2X0L A;  3QU6 A;  2Y48 A;  4XLF A;  4GYG A;  3K1N A;  4LLG F;  5TRD A;  3LSJ A;  5EDN A;  3C18 A;  3RYP A;  4FE4 A;  1VQM I;  3F8F A;  2V4J C;  3HB9 A;  2FOW A;  2NNN A;  4PSX A;  2DI3 A;  2EV6 A;  3CUQ B;  3ZCO A;  2XAG A;  4BAC A;  3HSE A;  2EIJ H;  1W1W E;  5DUK A;  1N77 A;  4EJU A;  2JT1 A;  3FKI J;  2R0Q C;  4P5O A;  1X19 A;  2GAU A;  1YG2 A;  3F8N A;  4BH9 A;  2NS7 A;  3HKZ A;  4C2U A;  1RR8 C;  1D1A A;  1F5T A;  4BQA A;  3S14 J;  3V8L A;  3M1C A;  4CCM A;  4IQJ A;  2DOF A;  4BHB A;  2BGC A;  4DOZ A;  2K9M A;  4PZJ A;  4RLF A;  4UUS B;  4NC8 A;  5J8F A;  2VOD A;  3HPH A;  1ONV A;  2D5V A;  4EJT A;  1X58 A;  4C3J J;  2VBZ A;  2MAB A;  3HYI A;  2Z5U A;  5L3F A;  1WFX A;  1BBY A;  1AOY A;  3CDI A;  4FT8 A;  3H0D A;  1SVM A;  1R36 A;  4IF4 A;  4EJW A;  4F7Z A;  3FZV A;  3BG3 A;  2JPB A;  3T8R A;  2RN7 A;  4KDP A;  3CD6 I;  3BG6 A;  4NC7 A;  2IS1 A;  5CVJ A;  1FOX A;  5IOY A;  3V7S A;  5EZH A;  3KP4 A;  1Y1V J;  3FM5 A;  4AD9 A;  2B7E A;  5E1W A;  2WY7 Q;  1XDS A;  3KEQ A;  4X6A J;  4G7Z F;  2HDC A;  1JTY A;  1VFC A;  1FYK A;  4DJA A;  4FX4 A;  1T2K A;  1EKE A;  2EPF A;  2X1D A;  3FDY A;  3K10 A;  4PFP A;  1ACI A;  3OYG A;  2W48 A;  2DCE A;  3CP2 A;  1FEX A;  2GWR A;  3ZMZ A;  1B1B A;  5B1A H;  1D8J A;  1USS A;  1XN7 A;  1TBX A;  1MBG A;  3MZY A;  4M3G A;  1ETY A;  1DP7 P;  2M3A A;  2PFB A;  3K2A A;  1I3A A;  2O3F A;  2FNP A;  2HWV A;  4DZJ A;  2JJ7 A;  3REO A;  3VOD A;  4ZDO A;  4NQW B;  3FWE A;  3H36 A;  4OOI A;  3ZQH A;  5B3S H;  2NRA C;  4MTE A;  3H3V K;  2R7S A;  4ANJ A;  1GT0 C;  3ABK H;  1MND A;  1GXP A;  3CCE I;  3GW2 A;  1ERD A;  3F21 A;  3PJR A;  1P4X A;  2LRD A;  3DEE A;  1ETV A;  3GFL A;  4I09 A;  2OQR A;  3P5J A;  4XOT A;  3K2Z A;  1OR7 C;  4MGR A;  2G7H A;  4WXC A;  1VQ7 I;  4TV7 A;  2YX4 A;  4XIC A;  2OU2 A;  3H1C A;  2DOA A;  2HKO A;  3P7N A;  4J19 A;  2L01 A;  1MIJ A;  1VF9 A;  1WPK A;  3RJP A;  1WJF A;  5IP7 J;  1XSX A;  1ULY A;  1FMV A;  3D5R C;  3K4K A;  3JRI A;  1WJD A;  3RTR A;  4E7Z A;  2ZSH B;  1G3S A;  2VJJ A;  2WBM A;  1YHQ I;  3GTM J;  2QWW A;  2LY1 A;  1EH7 A;  3P9I A;  3ERE D;  2DOE A;  4KNY A;  1B59 A;  2GM4 A;  4H0E A;  2DMP A;  4M9X A;  4CCJ A;  1C0W A;  2ESH A;  3BZC A;  5ICF A;  1YRN B;  2NXN B;  4HOB A;  4XLC A;  2A6E F;  2L7F P;  3TKY A;  2PMZ N;  2XVC A;  2QSF X;  5FKL A;  1R9T J;  3ESW B;  5JFR A;  4BEH A;  3E3V A;  1Y0U A;  2VPL A;  2MW8 A;  3KZZ A;  3MAJ A;  1D5Y A;  5M5X J;  2R7V A;  2Y2Z A;  5AON A;  5D6E A;  1ZEL A;  1FIP A;  3PNT A;  4J00 A;  3HOU J;  3H5N A;  4XOP A;  3EUH A;  2CV2 A;  2DYR H;  2LBF A;  4BAY A;  3D5S C;  4UUS A;  5IT9 Z;  3MKL A;  2FX0 A;  4BS9 A;  2XGE A;  3S1Q J;  1MDM B;  2M8E A;  2KIS A;  2L02 A;  3A2K A;  2H1L A;  5F0C A;  2XC7 A;  4Y17 A;  1BR1 A;  3K4N A;  1ITY A;  4U0V A;  4RGU A;  5EEG A;  1ETO A;  5CKT A;  2V9P A;  2A5Y B;  3BG5 A;  3OL4 A;  2HYJ A;  1IN4 A;  3S93 A;  5D4R A;  3PUB A;  2JMW A;  3K70 D;  1IRF A;  4KT5 C;  3TO7 A;  1RZ4 A;  4I2O A;  1TT5 B;  2Y69 H;  4CO8 A;  3MFK A;  3BR1 A;  2DT7 B;  4A6D A;  4WX9 A;  3M4O J;  3COA C;  2M2E A;  1O3Q A;  1T39 A;  3IL2 A;  1V5G A;  3K4M A;  2BOL A;  5E79 C;  3J7A Y;  4D5F A;  2UWM A;  3DLA A;  2FUG 2;  5GPC A;  4A3C J;  2CUF A;  2QF7 A;  3RQ4 A;  1P6R A;  2XF5 A;  2CG4 A;  2NVX J;  4DBR A;  2RQP A;  3E6B A;  3I64 A;  4L5J A;  2V79 A;  3HHH A;  2DMT A;  3W2W A;  1W0T A;  2HQA A;  2XAS A;  2V9V A;  4XNF A;  2XAJ A;  1MW7 A;  4FHT A;  1R49 A;  3ELK A;  4NQW A;  4RB1 A;  2R7U A;  2IW5 A;  2ZNY A;  5TGT A;  5DTD A;  2WWY A;  2KL4 A;  3NWT A;  4WF2 A;  5KHD A;  4BE2 A;  4CGZ A;  2E5N A;  2STT A;  1OCZ H;  1BR2 A;  1U9O A;  2HR3 A;  2E1M C;  1MBJ A;  3QP6 A;  3WHC A;  3W6K B;  2MH9 A;  3KP7 A;  1VND A;  1KQ8 A;  4IL6 C;  1JKQ C;  2DDA A;  1RR7 A;  5DCM B;  1DU0 A;  3EYY A;  3OL3 A;  2DO7 A;  2MGQ A;  4CCO A;  2FD5 A;  1SEU A;  4LFU A;  2Z99 A;  4GFB A;  2JK3 A;  2OCC H;  4C9Y A;  1K6O A;  1YOV B;  2M7B A;  2HPI A;  2PMH A;  2X6X A;  4IHT A;  1TQM A;  3IAM 2;  1SD6 A;  4O3M A;  2L7K A;  4AIJ A;  2DFF A;  4AVP A;  5EF6 A;  4MIM A;  1LVK A;  1R6R A;  2Z3Y A;  4BY1 J;  1D5V A;  4HDV A;  4HX4 A;  3V7C A;  3ONQ A;  4LGW A;  3LA3 A;  3HOT A;  4J01 A;  1ZTR A;  1DGR M;  4XKV A;  3LQR A;  3VEP A;  2QCO A;  2QUF A;  2LOO A;  3ML6 A;  2LDU A;  3OS2 A;  1A5J A;  1G8X A;  1LVA A;  4HNT A;  2ETH A;  4LD5 A;  2IJL A;  3DTI A;  1SC7 A;  4P55 A;  2H94 A;  3OOU A;  1RUN A;  1AKH B;  2LKP A;  3HC7 A;  3T8T A;  4AYB N;  3WTW C;  1G3Y A;  5CVV A;  4JOM A;  2XGX A;  4U88 A;  2VQH A;  3IKT A;  1GUU A;  1CGP A;  3DWL E;  1S7A A;  1CF7 A;  5EGO B;  3ULQ B;  2TDX A;  2WC2 A;  2QKM B;  4IZZ A;  3V8K A;  1Z7U A;  2ZFU A;  3CCY A;  2DQL A;  2FEZ A;  2NOG A;  5BMZ A;  1IXC A;  4EVI A;  5CVI A;  2E2I J;  4GYI A;  1MMD A;  1QPM A;  3AG2 H;  2V9K A;  1OJL A;  1T56 A;  3CUQ C;  1ZLK A;  1IN8 A;  2Z33 A;  1QZE A;  2PJR B;  1D1C A;  4LG3 A;  1ZGA A;  4G6D A;  3BRO A;  2P8T A;  2VQL A;  4QWQ A;  1OCO H;  2VBY A;  3V4G A;  1QBJ A;  3RZO J; 
#chains in the Genus database with same CATH homology
 2OPT A;  4BBR J;  1JJ6 C;  3S2H J;  4JP0 A;  4AC0 A;  2NVT J;  4FTH A;  4B3A A;  1I6H J;  2ID3 A;  3DEW A;  3G1O A;  4D7M A;  3FIW A;  2DA3 A;  1POG A;  2CUE A;  4DZP A;  1U8B A;  4L5E A;  4W97 A;  3A01 B;  1FTT A;  3M3Y J;  3CDL A;  3L1P A;  3TW6 A;  4X1E A;  2M9H A;  2JA7 J;  4A93 J;  3QPS A;  3GTQ J;  2ECC A;  1GV2 A;  2EZL A;  1ZGW A;  4BY7 J;  3CMY A;  3FIS A;  4V2F A;  2P81 A;  3DCF A;  1BL0 A;  2O8K A;  4UUT A;  3ZQC A;  3VPR A;  3MN2 A;  2YUS A;  5IYC J;  2JA8 J;  1K83 J;  3HKZ N;  3HEF A;  5M3F J;  1MNM C;  1XS9 A;  1P7J A;  3Q3S A;  3JRD A;  1APL C;  4EEF G;  1GDT A;  4A3D J;  2X48 A;  3GTP J;  4RBO A;  1UG2 A;  2HQ5 A;  3S2D J;  2HXO A;  4C2M J;  4W1U A;  1FIA A;  2R5Z A;  1BW6 A;  1IRZ A;  1BW5 A;  5HOD A;  3PO2 J;  4A3B J;  5J1Y A;  2ECB A;  1AU7 A;  4S0H B;  3ZQG A;  3S15 J;  3GTK J;  1WGX A;  2NVY J;  2DMQ A;  1JKR C;  3LSG A;  2LLK A;  5F0H A;  3FK6 A;  1OFC X;  1RKW A;  5IP6 A;  2CQX A;  2R5Z B;  3ZQL A;  1JUM A;  1WH5 A;  2EZK A;  2TRT A;  2B63 J;  2HOT A;  3RKQ A;  5FJ8 J;  3BQZ A;  5FKO A;  2OF7 A;  3I4N J;  3TP0 A;  1QRY A;  4A3E J;  3JRC A;  2R5Y A;  1IDZ A;  5IYD J;  5JLW A;  1TWC J;  4C3I J;  3GTO J;  5K7Z A;  1G2H A;  2XGC A;  1GVD A;  1JUS A;  3Q0U A;  3LSP A;  2XPU A;  3BR3 A;  2LP0 A;  2Y9Y A;  1LFU P;  5BNG A;  1WI3 A;  4LOC A;  4A69 C;  1ETK A;  1GV5 A;  3BG9 A;  3IV5 A;  1RET A;  3TW7 A;  2R5Y B;  5M3M J;  1JKO C;  4Y7N J;  4D5C A;  1HLV A;  2XB0 X;  2ZB9 A;  3JRG A;  1UHS A;  1IV6 A;  3IH3 A;  2XPV A;  5C4J J;  3S1M J;  1W0U A;  4DW6 A;  4D7N A;  1JT0 A;  5E3N A;  5J3L A;  3JRF A;  3QPL A;  5F04 A;  4A3K J;  4XRM A;  5FLV A;  1U78 A;  2JN6 A;  3BTL A;  2LKX A;  2I10 A;  1XC5 A;  2EBI A;  5IP9 J;  1MBE A;  1HOM A;  3JR9 A;  1Q1V A;  4ABZ A;  2R93 J;  1HDD C;  1B72 A;  3MVP A;  1MBF A;  1X2N A;  2G0E A;  2E1O A;  3QQA A;  4QIW N;  5C3E J;  3E7L A;  1MBH A;  2E19 A;  5FKM A;  2DMU A;  3A02 A;  3HOY J;  5F27 A;  2M0C A;  3ZQF A;  2MG4 A;  2DA4 A;  4AUX A;  1AHD P;  1ZQ3 P;  3SDG A;  5J1U A;  2DA5 A;  1B72 B;  1TWF J;  1FJL A;  3LSJ A;  1JUP A;  5EDN A;  4FE4 A;  1LFB A;  4A3G J;  3HB9 A;  3GTL J;  3ZOB A;  2EQR A;  4HNV A;  1ETX A;  2CRG A;  5EG0 A;  4QSH A;  1T33 A;  2E2H J;  2CU7 A;  3GTJ J;  1K61 A;  3PO3 J;  3K7A J;  3HOZ J;  3FKI J;  4MLO A;  4V2G A;  5F1J A;  2R0Q C;  1E3O C;  3IH4 A;  4I6Z A;  2N8G A;  5EG0 B;  3HDD A;  2NS7 A;  3SFI A;  1HDP A;  4MFD A;  2L9R A;  3S14 J;  3LNQ A;  2ID6 A;  3JRA A;  3NAR A;  4Y52 J;  3H0G J;  2L7Z A;  4UUS B;  2D5V A;  4M3E A;  1X58 A;  4C3J J;  1JTX A;  4M3B A;  3OIO A;  2VUM J;  2L7M P;  2ME6 A;  4A3F J;  1ENH A;  5IYB J;  1I50 J;  1RKT A;  1SFO J;  3BR0 A;  3BG3 A;  1P7I A;  3UKG A;  5JLX A;  2HI3 A;  2M34 A;  3S17 J;  2COB A;  4JX6 A;  1PUF A;  2VKV A;  3WHB A;  5IOY A;  1F36 A;  5EZH A;  3JRE A;  1Y1V J;  4DYQ A;  2XB5 A;  4A3I J;  2EH3 A;  5C44 J;  4MFE A;  4X6A J;  3BR5 A;  1IDY A;  1BJZ A;  1JTY A;  3HBL A;  1VFC A;  2RAE A;  2HOS A;  5M5W J;  3JRH A;  2K40 A;  2LFB A;  3D1N I;  4FE7 A;  2W48 A;  1PUF B;  3BR6 A;  3A03 A;  1FEX A;  3BTC A;  3O8G A;  1JGG A;  2ELK A;  3BTI A;  3S16 J;  1MBG A;  4IEJ A;  4M3G A;  1NK2 P;  1ETY A;  1IC8 A;  2GBY A;  5M5Y J;  4G12 A;  5GP9 A;  3K2A A;  2YU9 J;  4FIS A;  4JYK A;  4DYC A;  4DZJ A;  5K7H A;  2HOA A;  2JJ7 A;  1HF0 A;  2DA1 A;  3H3V K;  3ZQH A;  1H89 C;  4I76 A;  2VKE A;  4B1R A;  1GT0 C;  2IBD A;  2HXI A;  1QVT A;  1EF4 A;  3F0C A;  3CQZ J;  3B6A A;  1MSF C;  2K9S A;  2EZH A;  1ETV A;  5FKN A;  4A3M J;  1LE8 A;  2XGD A;  5IPA A;  5FKK A;  1Z0X A;  2DMN A;  4BXX J;  2JA5 J;  1RES A;  2DA2 A;  1TWA J;  3PM1 A;  1WCM J;  4XIC A;  4J19 A;  2Y31 A;  3BQY A;  5EEA A;  1VF9 A;  1WPK A;  5IP7 J;  1YRN A;  3JRI A;  4A3L J;  2XPW A;  1LE8 B;  2R7Z J;  3GTM J;  5IOZ A;  2Y9Z A;  3OSF A;  1FTZ A;  2K9N A;  2GM4 A;  5EZG A;  2DMP A;  2WV1 A;  1TWG J;  2VI6 A;  2K9Q A;  1YRN B;  2L7F P;  2PMZ N;  4M3F A;  3I4M J;  2DA6 A;  5FKL A;  1R9T J;  1MSE C;  3RZD J;  2IEK A;  2M8G X;  5K7F A;  1IUF A;  3JRB A;  2GLO A;  2MW8 A;  1D5Y A;  1XG1 A;  2EZI A;  3HGY A;  5M5X J;  4IHX A;  2Y2Z A;  9ANT A;  1FIP A;  5F08 A;  3HOU J;  2CQQ A;  4C3H J;  1ZR2 A;  4UUS A;  1A6I A;  3MKL A;  4B4C A;  2FX0 A;  2XGE A;  3S1Q J;  3NAU A;  1B8I A;  2WB1 N;  1SAN A;  5F0C A;  5FLM J;  2X9D A;  3LSR A;  2ME0 A;  4JX5 A;  2H8R A;  2AHQ A;  1ITY A;  5EYR A;  3TED A;  2WAQ N;  1ETQ A;  2LD5 A;  1ETW A;  4QTR A;  1ETO A;  2XRL A;  2AO9 A;  3HM5 A;  2LTP A;  2HDD A;  3BG5 A;  2L0K A;  2HYJ A;  3BTJ A;  4XK4 A;  1O4X A;  2DJN A;  2JMW A;  5E3O A;  1B8I B;  1HCR A;  2X6O A;  1F43 A;  3G1L A;  3BR1 A;  5J1R A;  3M4O J;  2M2E A;  2JA6 J;  1ORK A;  3OSG A;  5F0F A;  3C2B A;  4D5F A;  2Y0S N;  1BA5 A;  3BR2 A;  3FK7 A;  5GPC A;  1DU6 A;  4A3C J;  2CUF A;  2QF7 A;  1UMQ A;  2Y30 A;  4BBS J;  1Z77 A;  3GBG A;  2NVX J;  1WH7 A;  2FQ4 A;  3Q0V A;  4XID A;  2DMT A;  1W0T A;  1JKP C;  1X2M A;  1MH3 A;  1IGN A;  4M6V A;  1NK3 P;  1RPW A;  4XRS A;  5DTD A;  3IH2 A;  2KDZ A;  1TWH J;  4JX4 A;  3HOV J;  2LY9 A;  2DA7 A;  1U9O A;  1JT6 A;  1MBJ A;  3WHC A;  1QPI A;  1VND A;  3B6C A;  2H1K A;  1JKQ C;  3RQI A;  1RR7 A;  1DU0 A;  1ZR4 A;  2NS8 A;  2DTZ A;  2MGQ A;  2FD5 A;  5C4X J;  4GFB A;  2JK3 A;  4MO7 A;  1TC3 C;  1IJW C;  1S7E A;  2DN0 A;  2IAI A;  3G1M A;  1OCP A;  5EF6 A;  2E2J J;  2CJJ A;  4MIM A;  4NDL A;  1AKH A;  4BY1 J;  1ZKG A;  4M3D A;  1CQT A;  4DYR A;  3SJM A;  1ZTR A;  1MH4 A;  2FJ1 A;  2QCO A;  1I3Q J;  2XSD C;  1A5J A;  2VPR A;  1H88 C;  1JJ8 C;  1VI0 A;  5EGO A;  3HGG A;  3GTG J;  3S1R J;  3ZQI A;  3OOU A;  1AKH B;  2O9L A;  4AYB N;  5E3M A;  1Y1W J;  4XRS G;  2TCT A;  3HOW J;  3BT9 A;  2KT0 A;  4RDU A;  2JWT A;  1MBK A;  2LK2 A;  4IHV A;  2NVQ J;  1GUU A;  5EGO B;  1QVU A;  3Q0W A;  2YS9 A;  3TP3 A;  4BKX A;  3LOC A;  3CCY A;  4IHW A;  3W6V A;  2MSY A;  4IHY A;  2NOG A;  4CYC A;  1H8A C;  4A3J J;  5GPA A;  1U9N A;  1IG7 A;  2E2I J;  1NTC A;  3HOX J;  1OJL A;  1T56 A;  3O8H A;  5DS9 A;  3S1N J;  2O7O A;  4FCY A;  2LVS A;  1ZK8 A;  3A01 A;  1OCT C;  3RZO J;  2LR8 A;  4CYC B;  2R92 J;  5E3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...