4C3HJ

Structure of 14-subunit rna polymerase i at 3.27 a resolution, crystal form c2-93
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
total genus 13
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4c3hJ00
2LP0A 2JMWA 1DU0A 1MBKA 1JUPA 3Q0VA 3HB9A 1FTZA 3CQZJ 3HOYJ 2DJNA 3FK7A 3BR3A 2K9NA 3I4NJ 3OSGA 1P7IA 3ZQGA 4BY1J 3GTJJ 2ECBA 2KDZA 2MGQA 4Y7NJ 4IHYA 2VPRA 3S2DJ 5C44J 3A01B 1S7EA 2B63J 2L7ZA 3M4OJ 4JX4A 5BNGA 4DYQA 3TW7A 2Y31A 3HBLA 2IEKA 1IGNA 2LK2A 5EGOB 2MW8A 4A3EJ 1NTCA 1OFCX 3S1NJ 4AUXA 2N8GA 2TRTA 1H88C 4XRSG 3S1QJ 2R5ZA 1JJ8C 2MG4A 3IH4A 2I10A 5IP6A 4FTHA 5F0FA 4C3JJ 2LR8A 2XGCA 4DZJA 2QF7A 2XPWA 3LSJA 3JR9A 4MIMA 3TP0A 1MNMC 1WCMJ 5F27A 1ENHA 3IH3A 1O4XA 3S14J 5J1RA 2H1KA 1ETYA 1G2HA 3HOVJ 2LFBA 4C2MJ 1GV5A 2G0EA 2DMTA 1QVUA 3RKQA 3HOUJ 3JREA 1U78A 3BR0A 2E1OA 2HXOA 3H3VK 2GBYA 4L5EA 4UUTA 3GTPJ 2HQ5A 2TCTA 1FEXA 2LVSA 4DZPA 3SJMA 4IHXA 2M34A 3D1NI 4RDUA 3A01A 1JKRC 1RKTA 1TWGJ 1I3QJ 2EQRA 3SDGA 5HODA 1MBEA 4C3IJ 3FISA 4BXXJ 2AHQA 2JJ7A 3BR6A 4FE7A 4LOCA 4MLOA 1W0TA 5EGOA 1TWHJ 2DTZA 3BR1A 5FJ8J 1B72B 5FLMJ 2E2HJ 4QTRA 2DA3A 5J3LA 3JRGA 1WH5A 5E3NA 5K7ZA 4JX6A 5EDNA 2CUEA 5FKOA 2H8RA 2OPTA 2NS7A 2R0QC 3DCFA 1WH7A 3RZDJ 2K40A 1B8IA 1FIPA 1K83J 3PM1A 2ID6A 3VPRA 3GTKJ 3LSRA 5F04A 3DEWA 1MBGA 1JKQC 2ELKA 4G12A 1JJ6C 2WB1N 1UHSA 3S17J 4M3GA 4V2GA 5E3LA 3ZQIA 4D7MA 1FTTA 3CDLA 5IP9J 2YS9A 5FLVA 3JRIA 1X2MA 1ITYA 5EYRA 1JT6A 2K9QA 4S0HB 5JLWA 3S1RJ 1U9NA 2HI3A 2Y9ZA 3HOXJ 1T33A 3QQAA 1SFOJ 4A3JJ 3JRDA 4A3IJ 2NVXJ 1ORKA 3FIWA 1QPIA 2EZIA 2XB5A 3GTGJ 3TEDA 2L7FP 2CRGA 2LLKA 1A6IA 2JA8J 2M9HA 4C3HJ 2LTPA 2KT0A 1YRNB 5EEAA 1B72A 4FISA 3BR2A 1T56A 2FJ1A 4M3DA 2XRLA 3ZOBA 1ETOA 2JN6A 4M3FA 4W97A 3B6CA 1FJLA 2M8GX 2QCOA 3PO3J 3NAUA 1ETKA 4A3KJ 1X2NA 3ZQLA 1CQTA 3O8HA 1RR7A 4XK4A 1BW6A 1JUSA 1APLC 3IH2A 2XGEA 3BTIA 1JKPC 2XPUA 4MFDA 2DA2A 2Y30A 3O8GA 2YUSA 1Q1VA 1AU7A 5JLXA 2DA1A 4MFEA 1MSFC 3SFIA 4EEFG 3A02A 2JWTA 3NARA 4Y52J 2RAEA 5FKKA 2EH3A 3BQZA 3C2BA 5E3OA 2ME6A 4A3FJ 2DMQA 1TWAJ 1D5YA 2DMPA 1ZGWA 3HDDA 4IHVA 4A93J 4BBSJ 3LSGA 5C4JJ 1IC8A 9ANTA 4BY7J 1GUUA 1Y1VJ 5GPCA 2P81A 2FQ4A 1VNDA 2E19A 4A3MJ 5EF6A 5GPAA 2XSDC 3HOWJ 2FX0A 2JK3A 2X48A 2R5YB 2GLOA 1IDZA 3GTOJ 1JTXA 4BKXA 2NVYJ 4IHWA 3A03A 1YRNA 5F08A 2EZHA 3Q0WA 2O7OA 3W6VA 4A3DJ 3GTLJ 1UMQA 3TW6A 4D7NA 1UG2A 3S16J 1RPWA 4B1RA 4RBOA 5M5WJ 1LFUP 1VI0A 2NOGA 4JYKA 3ZQFA 3S2HJ 4I6ZA 1H89C 2X9DA 1RETA 2D5VA 2CUFA 3LOCA 2XPVA 1IUFA 4M3EA 2W48A 1LFBA 2MSYA 2EZLA 3BTLA 4IEJA 2CQXA 2LKXA 4A3GJ 3HOZJ 4A3BJ 1F36A 2HXIA 5IYBJ 3HKZN 1HDDC 1EF4A 2OF7A 2NVQJ 2DN0A 3ZQHA 2PMZN 3F0CA 2VUMJ 3B6AA 3JRAA 5M3MJ 2DA7A 3UKGA 2AO9A 4AYBN 3K7AJ 3PO2J 5EZGA 4XRMA 3HEFA 2R92J 2ID3A 3I4MJ 5IOZA 2JA6J 1IRZA 2VKEA 3FK6A 4DYCA 1ZR4A 1E3OC 4DW6A 1AKHB 4QSHA 1JUMA 4M6VA 4XIDA 2R5YA 4M3BA 5K7FA 1XC5A 2IAIA 1Z77A 1U9OA 1Z0XA 3BTJA 1WPKA 2VKVA 4A3CJ 2DA5A 2Y2ZA 1TC3C 4I76A 1WGXA 3H0GJ 3OOUA 3QPLA 1VF9A 4B4CA 5E3MA 3Q3SA 1I6HJ 1H8AC 3HM5A 4XRSA 5DS9A 3BG3A 5FKMA 3LNQA 3CCYA 1BJZA 1HLVA 3M3YJ 3ZQCA 5EG0B 1MBFA 2E2IJ 2CQQA 2VI6A 1ZK8A 4HNVA 3GBGA 1TWFJ 1MH4A 1VFCA 1ZR2A 1K61A 3WHCA 1HF0A 4UUSB 2L7MP 2R93J 2LD5A 1OCPA 1I50J 4JP0A 1XG1A 4NDLA 1MH3A 3MKLA 1WI3A 3JRBA 1GT0C 4X6AJ 3BTCA 4D5CA 3IV5A 2GM4A 1RKWA 1AHDP 2YU9J 2COBA 2Y0SN 4B3AA 2CU7A 1JKOC 4W1UA 2E2JJ 3TP3A 1TWCJ 1AKHA 5F0CA 1ZTRA 3Q0UA 2ECCA 3OIOA 1RESA 1OJLA 1GV2A 3BR5A 3K2AA 1ZKGA 3G1OA 1XS9A 1IJWC 1NK3P 4DYRA 1PUFB 4A3LJ 2NS8A 2M0CA 3BT9A 1IV6A 1ETVA 2NVTJ 2EZKA 5C4XJ 1ETWA 5M5XJ 2O8KA 3GTMJ 1B8IB 5DTDA 2ME0A 1DU6A 1NK2P 1MSEC 5IOYA 1W0UA 4GFBA 5C3EJ 2HOSA 2HYJA 1JTYA 3WHBA 3JRCA 5GP9A 2M2EA 3CMYA 5M3FJ 2L0KA 3S15J 3MN2A 5J1UA 2XGDA 2IBDA 5EG0A 2DA6A 3JRHA 1LE8B 5K7HA 3FKIJ 1MBJA 2HOAA 4UUSA 1HOMA 1BW5A 4X1EA 4CYCB 1JGGA 4QIWN 4FCYA 4BBRJ 3G1LA 1R9TJ 1MBHA 5F1JA 2HOTA 3HGGA 2FD5A 1POGA 1F43A 1A5JA 2EBIA 1OCTC 1X58A 2X6OA 3GTQJ 4ABZA 2DA4A 3BQYA 2Y9YA 1IG7A 1FIAA 1SANA 5IYDJ 1GVDA 3G1MA 5IYCJ 2O9LA 1ETXA 3E7LA 1P7JA 4D5FA 1PUFA 1ZQ3P 1QVTA 2LY9A 2XB0X 3JRFA 2DMUA 3RZOJ 1GDTA 1HDPA 5J1YA 4XICA 2K9SA 3RQIA 5FKNA 3LSPA 4FE4A 4J19A 2R5ZB 4A69C 1JT0A 1ETQA 2ZB9A 3QPSA 5EZHA 3L1PA 1U8BA 2WV1A 1IDYA 1QRYA 5IP7J 3S1MJ 4V2FA 1BA5A 4JX5A 5M5YJ 1LE8A 2HDDA 3HGYA 5IPAA 2CJJA 5FKLA 5F0HA 1Y1WJ 3MVPA 2JA5J 2JA7J 2L9RA 2WAQN 4AC0A 3OSFA 4CYCA 1BL0A 2R7ZJ 1HCRA 2DMNA 3BG9A 4MO7A 3BG5A
chains in the Genus database with same CATH superfamily
4LMYA 1BBYA 5ILUA 4HDVA 1X3ZB 5FLXZ 3F8FA 1YITI 3HB9A 1K4TA 1ZLJA 1RR8C 1EH7A 3HOYJ 5JVTA 3DBRB 2KZVA 4WCGA 2K9NA 4AU7A 3I4NJ 4UB6C 3R4KA 2IPQX 1B59A 3GTJJ 3PSIA 2MGQA 4XMYA 2HPIA 2M30A 4HLXA 5JVGF 4IX7A 4JX4A 4CSWA 2ZFWA 2XAUA 1Z7LA 4JQFA 2IEKA 2L9VA 3IAM2 1DUXC 2HNHA 2MW8A 4A3EJ 2M87A 2X1EA 4M9ZA 4XKVA 4AUXA 3DWLE 3DV8A 4IF4A 3RYPA 2OTLI 1ON1A 1JJ8C 1KYZA 5B5EC 4UVAA 1A31A 4BJTA 3IH4A 1MGTA 2I10A 4FTHA 4C3JJ 3L2WA 2KZGA 3X2QH 3R0AA 2XGCA 2IGMA 3L00A 4RAYA 2L4AA 2BVLA 2P6TA 4BEHB 3TP0A 4ZYEA 2EFQA 1YS7A 1WCMJ 5D8KB 1ENHA 4IL6C 3AG1H 5E1XA 3S14J 2A69F 2XUBA 1Y0NA 1G8XA 2NNNA 1G2HA 4KICA 4C2MJ 3I53A 2X1DA 1MNEA 2VJ4A 1DDNA 3KE2A 3DFGA 5FGMA 2JSPA 3U1DA 3H1CA 3HOUJ 4ITVA 4QPOA 1U78A 5ICFA 4BUPA 2JZYA 1I1SA 4L5EA 1Y0UA 2AXLA 4U0VA 2M3AA 2ZXJA 2P8TA 3DTIA 4UUTA 1FEXA 1SMYF 4F91B 3J7ZI 1J59A 2M34A 3D1NI 1E0EA 3A01A 2RVCA 1RKTA 2XSJC 4U0YA 1USSA 2QSGX 5E1WA 5D8LB 4BNCA 4BXXJ 2JJ7A 1DGWY 4OMYA 2M5WA 3PIPF 3EETA 4EGYA 3FMQA 1TWHJ 4YRVA 1MDMB 1R36A 1MJBA 3BR1A 3ZN1A 3OIPA 2DA3A 3JRGA 2BOLA 3T8TA 1N77A 3BP8A 3CD6I 4KT5C 5L3EA 1KU2A 4UY8I 3K6GA 3BG7A 3VSKA 2NS7A 3H5NA 2R0QC 4A12A 3RZDJ 5HDKA 1B8IA 3VEPA 4MEXF 3SQNA 1HXDA 2O61A 3PM1A 3COAC 2ZXHA 2RNJA 3K70C 3I54A 1HSTA 2ELKA 3OOPA 4G12A 4AD9A 1JJ6C 1UHSA 1C0WA 3S17J 4V2GA 5CLSA 1EH8A 4UUVA 2BV6A 4PJNA 4L9NA 1GXQA 2ELHA 2L9NA 1UCRA 2JPBA 1MJAA 2IW5A 2D1HA 2YR2A 3JRIA 4BJ5C 1GHCA 3RKWA 4G6TB 3GFIA 5JLWA 2F48A 4YFKF 3S1RJ 4B48A 4FX4A 1SAUA 2HI3A 3BLYA 3JSOA 2M4KA 3OYIA 2L54A 2FA5A 4A0XA 1O7LA 5D6FA 4F55A 3CLOA 5AONA 3VODA 3WTTC 4A3JJ 3GX4X 1S7OA 4AVZA 4A3IJ 2HQAA 4PSXA 3L9FA 3JTGA 4U7BA 4BAYA 1WKMA 3CUQA 3U9GA 2LLKA 1A6IA 2CYYA 2RKHA 3L7WA 2KT0A 1BC8C 2KISA 1LDJA 4FISA 3BR2A 3VWBA 4UHTA 1OCZH 3E6CC 5CYVA 5HS7A 4CCOA 4M3DA 4KITB 1SMTA 4IRIA 2FBKA 3ZOBA 2V1DA 5GAGJ 1HSJA 4ZZDA 4RB1A 4W97A 1FJLA 2BEOA 1YIOA 3NAUA 2DPUA 4KN4X 3ISPA 1ETKA 1S7AA 3G4SI 2HDWA 3VYUB 1JUSA 2MBFA 3BG6A 5HDGA 1O3TA 1APLC 4FETA 1PDNC 2MABA 5BOXA 4MFDA 3OYCA 3CUOA 2YUSA 3DTKA 3R0JA 1AU7A 2WAFA 3P9CA 2E1MB 2LKPA 3HRSA 4BE1A 1MSFC 2HTSA 2HPMA 1D1CA 4OINF 4LLGF 2QKLB 4GYGA 2R7SA 2Z2SB 2LDUA 3KZYA 3LSHA 5BS6A 1P4AA 1WJCA 5E3OA 5DCMB 1YQAA 1P6RA 2O5RA 4EJVA 1WJ5A 1XGMA 3H3UA 1D5YA 1ZGWA 4BBSJ 2JUGA 3LSGA 4CCMA 3KP3A 9ANTA 1Y1VJ 2CO5A 3BJAA 3SDBA 1IDZA 1N25A 3GTOJ 2RNGA 5IT9Z 2PI0A 3M7GA 3A03A 1Z3XA 2EZHA 3LSIA 5ICCA 2DFFA 3BWGA 4A3DJ 3GTLJ 4RGUA 3JCUC 2ESNA 3QPTA 4ANJA 1VQ7I 1UG2A 3CUQC 2UUZA 3PIOF 1BI0A 5LFAA 4RB2C 4ZDLA 2NOGA 5M5WJ 1OMIA 2DFHA 2HEOA 1T2KA 2VODA 3I56I 2MD0A 3AL0B 3DEUA 4P5OA 3CF2A 1Z9CA 2G7HA 2DFEA 5K5OA 1F36A 1MZBA 3E6BA 4OOIA 5LRRA 3A2KA 4F52A 2MH9A 3G73A 3ZQQA 2RC4A 3I3LA 3TO7A 2QZ8A 1W5CC 1R6RA 2E71A 2Q8KA 1BIAA 5E1ZB 3F0CA 1EH6A 1B1BA 3L09A 3IKTA 3UKGA 2AO9A 4UV9A 1X1AA 3K7AJ 3NRVA 3CCMI 4MTDA 1CGPA 1LDKB 2JA6J 2VKEA 5DUIA 4IOAF 3CZ6A 1FBSA 2TDXA 4DW6A 4M6VA 3VDXA 1B4AA 1TT0A 4IXAA 5GTIC 3QP5A 2IAIA 2DCEA 2OA4A 3LWFA 2XKOA 3ASNH 4ZC3A 3P9KA 3C2HA 4L9JA 1W7PB 4RB3C 1NH3A 2DA5A 4BHCA 2R7TA 1TC3C 4CCJA 1TQMA 3MWMA 4IOCF 2E1CA 4GGGA 3G2BA 3GCMA 4EQQA 3Q5FA 4B4CA 2DTRA 1VQKI 4P9FA 3KP6A 1WJAA 3CMAI 3S3NA 4XRSA 1U0JA 2RGVA 1R7JA 4E4HA 1T08B 3K4BA 1Y6IA 1ZELA 4II2A 1MBFA 2CQQA 3CLQA 2BW3A 3WGHA 2VI6A 1ZK8A 4HNVA 2IP2A 2H94A 1K61A 1X3UA 3WHCA 1HF0A 4EATA 3I64A 2BGCA 2LD5A 4U87A 3K0LA 1F9NA 1XG1A 1HW5A 1UFMA 5HS8A 4NQWB 2ACJA 1UHMA 3A0BC 1E3PA 3MAJA 3BTCA 1RNLA 3PFIA 2FOWA 1K78A 3SYTA 2Y0SN 4B3AA 2CU7A 1HKTA 4W1UA 2GOMA 2GIZA 2L5QA 3C1DA 5H6RA 5DDGA 4RB0A 1AKHA 5GAHJ 1T98A 1ZTRA 2CV2A 5HLTA 2ECCA 4LK1F 1ZKGA 3RPUA 2HR3A 3GW2A 1PUFB 2NS8A 2HKOA 2H27A 3KYDB 1IV6A 1ETVA 4HDUA 3HHHA 4GYIA 1JHFA 2JUCA 3C7JA 1FBQA 3PL8A 2IJLA 5HLGA 5M5XJ 3GTMJ 1X4PA 4CDGA 1SVMA 4YFXF 2ETHA 5DTDA 3SZTA 2DOAA 3RCOA 1VZ0A 3WTSC 3CC7I 1NK2P 1MSEC 5IOYA 5C3EJ 2M7AA 2QYOA 2XF6A 4WXCA 4M6YA 3KLOA 1Z3YA 4CO8A 2M2EA 3JRCA 4ENJA 2VBXA 4LG3A 4LG0A 3CMEI 2XGDA 4YIFA 4L0ZB 1FOKA 5EG0A 4Y13A 3JRHA 3CC2I 2OUMA 4GXOA 5K7HA 2P7CB 3R6SA 2IGKA 3FKIJ 1RC9A 1Z6RA 4UUSA 5J4YA 1WJBA 4PZJA 1YFHA 4S04A 1R9TJ 1V55H 2D1VA 5F1JA 5DM6F 3HGGA 4HNUA 3UR3C 4B8XA 2QGUA 4G6DA 1R22A 2EBIA 1ZHFA 4DBQA 2X6OA 2RQQA 3W2WA 1XX5A 3LSTA 4EM0B 3RI4A 3PUFA 3BQYA 3KEYA 5BPIA 3P7NA 2CFXA 1W36D 1TQIA 1K6OA 3VFZA 2FE3A 5D6EA 1G59A 4DIQA 5DEQA 3FHZA 4AM3A 2XHKA 2GXAA 4D5FA 5LRSA 4BQAA 2V6EA 4L18B 2RQPA 2LG4A 2DMUA 2UZKA 2R4GA 1HDPA 2V7FA 3CCUI 3HTSB 4TV7A 3FXQA 4ZTJA 2B0LA 2QBYA 3H9JA 3E97A 4XLAA 1MMNA 1QNTA 2IA1A 1XGSA 5FD6A 5CVIA 2RDPA 2ZFUA 4XLHA 2VBYA 2KQRA 2NYXA 2EFPA 4HW0A 3WU2C 3T8RA 1W4MA 1RRJA 4G7HF 3WU1B 1WSUA 4KIGA 1IDYA 4CCKA 4JX5A 1LE8A 2XVCA 1DP7P 5GADJ 1X19A 3ESWB 5F0HA 1Z67A 1Y1WJ 2V79A 2WAQN 3ERMA 5HLIA 1A04A 4AC0A 3OSFA 2LMDA 4F93B 1I39A 2R7ZJ 1HCRA 2AS5F 2LY1A 1TQPA 1S5LC 4NUBA 1B9MA 2ZO4A 1O57A 3R61A 3BG5A 1YOVB 1CF7A 2JMWA 1N78A 2VT3A 3F23A 1J7KA 2LSOA 1LQ1A 3H5RA 4YEJA 1A36A 1XSXA 3CP2A 2WA0A 3TL4X 3CQZJ 3F22A 2CW7A 2PJRA 3OSGA 1JI8A 2OCEA 3K4CA 4BYYA 4BE2A 4G8XA 4UXNA 3ZQGA 4OAZA 3MKWB 1WJEA 1Z1DA 3CCVI 4BY1J 3V8KA 4LB6B 2KDZA 4IHYA 3S2DJ 3A01B 1S7EA 3S8PA 3V4GA 2L7ZA 4CCLA 4E6KG 3J80K 4KFCA 1ZRCA 2UV1A 3DPUA 1W5SA 5AIPA 3TW7A 3OYMA 4NHJA 1R4MB 4R79A 3H92A 3GZ5A 2VE8A 1T0FA 2F4MB 3ZMZA 2LK2A 4PSWA 1IGNA 2ZC2A 3BDDA 3WG7H 1SFEA 2N8GA 4NC8A 2MC3A 1S3JA 4HV5A 3ABTA 4HBLA 4GDFA 1LUJB 3WTUC 1E2XA 1W7PA 3GLXA 4I0BA 4AIHA 2JRMA 2DYSH 1I6XA 2QF7A 2XPWA 4OIOF 3MFKA 3HSEA 3QU6A 3OYGA 1RUOA 3B73A 2PBIA 1MNMC 3OYFA 3IH3A 3K4KA 2CH0A 4I01A 5KCMA 3RTRA 3S93A 4EJUA 1VQLI 4B3XA 1ON2A 3J81K 2M7BA 1E3HA 1GV5A 5HLHA 4J00A 2A5YB 1QZZA 3KP2A 1KU3A 1RZ4A 2E36A 1WI9A 2K4JA 3TO6A 2JPCA 4Y3OA 2XKPA 3BR0A 2YU3A 1YTYA 2FQ3A 4KMFA 3RPQA 2E35A 4KYWA 3GTPJ 4KIFA 4PJ0C 4KNYA 3SJMA 3KETA 1IN7A 5BPDA 2VIXA 4EMSA 1REPC 3JW4A 2DAOA 2FNPA 1JKRC 2STTA 2CS3A 3T1BA 2CFOA 3LQRA 5HODA 1MBEA 3WGGA 2OAZA 3OV8A 3RKYA 1K4SA 2AHQA 2OC6A 3MQ0A 3CUQB 1W0TA 2ISZA 4HQMA 5EGOA 2GZWA 1FSEA 3GMEA 2WAEA 4NNJA 4ZJZA 1OKRA 1XDUA 3KFWX 5FJ8J 3H9GA 2EPFA 4YELA 4QTRA 3BPVA 1OR7C 1T0FC 1WH5A 4LIVA 1HC8A 2M4GA 3ELKA 1G3TA 5CQGA 4JX6A 4PJLA 1I27A 2CUEA 2WB1A 4LK0F 3FXOA 3OL4A 5FKOA 3FXMA 1G3WA 4RA2A 3FXKA 1FWZA 3DCFA 2VC0A 2K40A 2IA2A 1FIPA 1L0OC 3IWZA 3VB2A 2IT0A 2MD5A 1LEBA 3P9IA 3VPRA 3FBNB 4XM3A 1GLNA 4FQGA 4KMUX 4KUMA 3ZQIA 1Y56A 3CMMA 4YIRX 3A1YA 4XOTA 4IZZA 3FM5A 3HC7A 1ZN2A 2ICWG 3ZRGA 4PK4A 3WE3A 2DU9A 2XV4S 1ITYA 3D0SA 5EYRA 2NOJB 2FMYA 1KU7A 1U9NA 3HOSA 3Q9SA 4DBRA 4A6DA 4E7IA 1DGRM 4E7ZA 4H4KC 1SAXA 4HF1A 3V7CA 3IRQA 1OYIA 1SFOJ 3JRDA 2NVXJ 2VL8A 2DBBA 1USTA 4G7ZF 2XB5A 3OIQA 5H6QA 4Q4ZF 3FM3A 1FY7A 3GTGJ 2O0YA 1R58A 2QUFA 3NEUA 4RS8A 2DDAA 2I8DA 2DYRH 3WTYC 3W6KB 5EEAA 4OMZA 3LA3A 3DKWA 1B72A 1IAWA 3PNYA 4XSXF 2DQLA 3HYIA 2XRLA 3H9QA 2KRHA 3F21A 3I55I 4JK1X 3GEZA 2LF8A 3PO3J 4I02A 2HDCA 2HYGD 2RN7A 5KAIC 1SD7A 2Q2EB 4M73A 1RR7A 4XK4A 2VONA 4KA4A 1MKMA 1EV7A 3IH2A 2PMUA 3BTIA 1JKPC 5K1YA 1STZA 5FD5A 1UG0A 5L3BA 1Q1VA 4BQOA 5LD2C 5JLXA 4EEFG 2X6WA 2IS1A 2JQ7A 1D1AA 3ONQA 2JWTA 3NARA 3OWTA 2RAEA 5FKKA 4Y52J 4HSRA 4RMNA 2EIKH 3HJEA 2EH3A 1KQ9A 3J7YJ 1WRJA 2QQ8A 3CJQB 3JAMK 2O3FA 3ABKH 4BU2A 2PG4A 3ECOA 4BQQA 3RYRA 3IAS2 4A93J 1YLFA 3E5XA 1Z6TA 4ENNA 4L5JA 5C4JJ 2IS6A 1QU3A 4RAFA 4HRIA 1U5TC 2DODA 1GUUA 3DEEA 2P81A 3GVAA 1VNDA 5EF6A 2XSDC 3FZVA 2BXZA 2X48A 2GLOA 4CA0A 1JTXA 3PQKA 3E5UA 4BKXA 2VQCA 2NVYJ 4C30A 1YRNA 5F08A 2HS5A 2WBMA 3VYSB 3DLLF 3L2VA 1W5TA 3QU3A 2IS2A 2DDBA 3K1PA 4D1QA 5KHDA 5LBQA 2LY2A 3V8JA 5D5UB 1U8RA 1P9QC 4FT8A 3TW6A 2GXGA 2F4IA 4NC7A 4B47A 1SFKA 2LH9A 1XB4A 4HF0A 3CCSI 1VI0A 4LLNA 3S2HJ 1H89C 4FASD 2X9DA 2LBFB 3HKZA 4I09A 2XPVA 1W7PD 3FHNA 5L3FA 1LFBA 2EZLA 5K5RA 1YYVA 2CQXA 2BHZA 5ILSA 2WTEA 3P5JA 3OY9A 3IP4B 2O8XA 2BW3B 2EIMH 3IUOA 4Y4RA 2FEZA 2WY7Q 4AIDA 3OS0A 2L02A 3IHUA 2NVQJ 1ZARA 2PMZN 3ZQHA 4II3A 2VUMJ 2DOFA 2CWEA 3O6BB 5M3MJ 3JRAA 2QQAA 2B9SA 3AFHA 1FYLA 2F5FA 2CQNA 5A2QK 3GFLA 2HFHA 1D3YA 3HEFA 3W2AA 1UAAA 2A6HF 5IOZA 1K78B 4A6EA 3FK6A 1M1EB 1YW9A 2A05A 3BC8A 2K02A 4HQEA 1AKHB 4QSHA 1R1TA 4MHGA 4RM2A 1I5ZA 1U9OA 1Z0XA 3HPGA 2BY0A 2WAQA 3BTJA 2GXBA 5FB2A 3OYAA 1WPKA 2KJCA 1ZG3A 2Y2ZA 4PFOA 5D5VB 4YFNF 3H0GJ 3N4MA 2WC2A 3QPLA 2ZXWH 2DJIA 4M9SA 1FYKA 4Q47A 2LNBA 2MC4A 1I6HJ 2XAGA 1H8AC 2VXDA 2IVMA 3HM5A 2VB6A 5DS9A 3BG3A 2BY2A 1TW3A 2CUZA 4EM1A 3QYBA 2HKXA 3H35A 1TBXA 4LG0B 2QVOA 3K2ZA 1HLVA 1J09A 3M3YJ 3ZQCA 5EG0B 2E2IJ 4KIBA 4M74A 1EJ9A 1ZREA 2EFOA 1D8JA 3JTHA 1WWXA 2I5UA 4DQ2A 4UUSB 2A6TA 5AIQA 1I50J 4AIKA 4JP0A 4CZCA 1YJNI 1MH3A 3DU6A 3KLNA 4I7HA 2IXSA 1GT0C 2NS0A 3H0DA 3IV5A 1MMDA 4L9VA 2K3FA 1OCRH 3EQLF 4O6JA 2E2JJ 5LEKA 5HOOA 1D0ZA 2BHYA 2QSFX 4O5VA 2XROA 1AA7A 1AWCA 3BROA 5E79C 2Y69H 1YX5A 3V7RA 4E7KA 1NHAA 1OISA 2Z33A 4J01A 3LFKA 4UV8A 2R7UA 1NK3P 3K4JA 4DYRA 1N75A 4XLEA 2JVHA 4A3LJ 3DQVC 2M0CA 1DPUA 2GQQA 2R3SA 4NB5A 2O8KA 1SEUA 2QBYB 2P0WA 2FUG2 1D5VA 1K6YA 3ZP5A 3CJNA 1QO0D 1IZ1A 2LOOA 5KK1A 2K7LA 3HIFA 2HOSA 1JTYA 3WHBA 3CMYA 2DQRA 1QHGA 2DO7A 4GCVA 3FMRA 3LQQA 3MN2A 1IN6A 2OJED 1P4XA 2DA6A 1X1CA 2XF7A 3E0JB 4BHPA 2EK5A 1LE8B 2V9KA 5CVUA 2VOOA 2DXIA 1IRFA 2Q2EA 3ZXSA 4P9UA 1HOMA 3SXYA 3K70D 4QIWN 1BM9A 4BBRJ 2A6EF 4DJAA 2KLOA 4F92B 3HSFA 3BY6A 1CF7B 3GF2A 4HSTA 5CVRA 4N4OB 3K69A 3VYRB 4CHUA 2VJIA 5K5QA 5JR3A 2PLYA 4YIIA 2HGCA 2V1XA 1T95A 2PJRB 3M8FA 2Y9YA 1SANA 5KNLA 1J9IA 1ZRDA 2HWVA 2EIJH 2IGNA 2Z99A 2O9LA 1ZQ3P 3E7LA 2V1UA 3RQ4A 2LY9A 3JRFA 4ZDOA 1GVJA 3RZOJ 2MLGA 2H1LA 2F5CA 3AG2H 4ZYGA 1YS6A 3B02A 2LRDA 1YJWI 1IUYA 2BXYA 1TT5B 4P96A 4XKCA 4N9IA 3GZ6A 4A69C 4WF2A 1MMGA 1ODDA 1OYYA 2MFZA 1JT0A 3MMYB 5CVVA 2V26A 2E1NA 3QPSA 4M71A 1QBJA 1JE8A 1QRYA 5IP7J 3S1MJ 3EUHA 3LFUA 2LBFA 5FKLA 4YG2F 3F3XA 3MVPA 3WGIA 2L9RA 2JA7J 3J7AY 2W82A 1G4DA 2VQHA 3BG9A 1A6QA 3OYDA 4GFBA 1FYMA 4OIRF 3KEOA 4XN3A 4AVPA 3PSFA 1MBKA 4ENMA 2CGPA 2GA2A 1JUPA 1ERDA 3CESA 3ZMSA 2QLZA 1FTZA 2KJBA 1XN7A 3FK7A 1FOXA 3OYLA 3LAPA 4EJOA 2XRNA 4RLFA 1P7IA 2COMA 4BH9A 4XLPF 2XAJA 1XGNA 2ECBA 2WY8Q 1Y39A 1ACIA 2X85A 4CCNA 4Y7NJ 5J8FA 2VPRA 5C44J 1IO2A 2B63J 4XKBA 3OS2A 5BNGA 1VQ5I 4DYQA 4B43A 5J8CA 5EEGA 2IRFG 3IL2A 3WTVC 2MYSA 3RDIA 5EGOB 5HS9A 2K86A 1NTCA 1OFCX 3S1NJ 1PP8F 2TRTA 1GXPA 1KQ8A 4XRSG 3O3KA 3L2CA 5D5XB 1ZRFA 5HVQC 2R5ZA 2Z3YA 2MG4A 3EYYA 2STWA 2CW8A 5IP6A 2L9SA 5F0FA 4DZJA 1OQYA 4JBAA 2W84A 2OZUA 3JR9A 4F7ZA 1BR2A 5CVJA 4GO1A 3KZZA 2EJRA 5F27A 4OAYA 2GWRA 4LGWA 2H6CA 4RLQA 2QQ9A 5F6FA 3HOVJ 2LFBA 2PN6A 3RIRA 2G0EA 1X1PA 2NVUB 3UNGC 1FOWA 4IPAA 1QVUA 1WVRA 3EUHC 2A07F 2VPLA 3NQOA 1WJFA 1BOBA 3HL2A 5FLXK 3H3VK 4CGZA 2NNYA 3SHFA 2HQ5A 1YI2I 1OCCH 1NG6A 1XCBA 4IKFA 1OLTA 4RDUA 2Y48A 2VOPA 1I3QJ 1TWGJ 2EQRA 3G71I 1PP7U 4C3IJ 4DNCA 4B44A 3WE2A 3BOQA 1OYWA 4FE7A 2YX7A 4KT6A 1R5GA 2W1OA 2QWWA 1J2XA 1KA8A 2DTZA 4L9TA 2KIMA 1G3SA 3CCEI 1B72B 2KPMA 1YW8A 2E2HJ 2PMZA 1D8KA 3RKXA 5ICGA 4ESBA 5K7ZA 1BI1A 3FDYA 5EDNA 4BHBA 3CC4I 1P4WA 2Y0MA 3GUDA 4C2UA 2HVSA 2H8RA 2IS4A 1XMAA 3LA7A 1WH7A 3H3ZA 3IRRA 3G3ZA 2Z16A 4XRFA 2VT2A 1K83J 3NWSA 4HEA2 1HKQA 2W25A 4HG2A 4HYEA 3J7AO 2ID6A 2QSHX 3WU0A 5F04A 3DEWA 5FROA 3DKYA 1KQ0A 2K5CA 3R60A 5E3LA 1IW7F 4D7MA 1J0RA 1FTTA 5TJJA 3CDLA 5IP9J 1LVKA 5IY5H 4QLCU 3OYNA 5FLVA 1TW2A 2XAQA 1LEAA 1X2MA 1JT6A 2Y9ZA 3HOXJ 2O03A 2VE9A 3ERED 2KRFA 3WTXC 1IF1A 1J5YA 3QQAA 3ULQB 3S3MA 3G6EI 3HUGA 3KP4A 2MH2A 5DD4A 1ORKA 4P1WA 2EZIA 4XQFA 3CP8A 5FFZA 2L7FP 4E70A 4G7OF 3FWEA 2CUJA 2V1NA 2LTPA 1YRNB 1RI7A 3GXOA 1UZCA 2H6BA 3CJRB 4XN0A 2VQLA 1XSVA 2VKDA 1ONVA 4LJZF 3HRMA 4A5NA 2F5VA 1UELB 3W3CA 2W24A 4LD5A 4M3FA 1OR7A 2QCOA 1UJ8A 3F72A 2ISYA 1X2NA 3ZQLA 3FXRA 2CQKA 2CV0A 2F2EA 3CTAA 1P2FA 3CCLI 2DI3A 2E1MC 2XGEA 4BJ6C 2XPUA 2BY3A 2DA2A 3O8GA 4EJTA 2EFWA 3D5SC 3VOEA 2DA1A 4MFEA 3SFIA 2X0LA 5E8GA 5FFXA 2K9MA 4CICA 2LYCA 1BI3A 2L4MA 5B1BH 4RAGA 1BN5A 2H8WA 4DGWB 2FU4A 2MA3A 5FO5A 1EA3A 2EV5A 1H9GA 3C2BA 1FT9A 4A3FJ 4E7SA 2DMQA 1FBUA 2Q0OA 1TWAJ 1SFUA 3HDDA 1T38A 4IHVA 1DQUA 1XD7A 3ROUA 1LFPA 4BY7J 4I99C 5GPCA 2XF5A 2E19A 2ELJA 4ETSA 5GPAA 1SD6A 5E18F 3WG9A 1KONA 2JK3A 1WZ2A 2LC2A 3BZKA 4ZDPA 3DPTA 1FLIA 5LHIA 3I71A 3CO7C 1K7AA 2O7OA 3L2QA 3PJRA 2E34A 2CMPA 1XMKA 1UMQA 3F6OA 4K2EA 4QWQA 4PFPA 2OQRA 2BE5F 5KVRA 1TLHB 2HZDA 4RBOA 4R1HA 2K9LA 1S29A 2FF4A 1LFUP 1ZH5A 3RPUD 3ZQFA 1LKXA 2P4WA 1ZLKA 4I6ZA 1RETA 2CV1A 2D5VA 2CUFA 3LOCA 4OIQF 2LKSA 1IUFA 2W48A 2MSYA 3BTLA 4G6QA 1O3QA 2FMLA 2RREA 3ABMH 3M1EA 2YX4A 2HQRA 3CCRI 2M1BA 1BIBA 3HOZJ 4A3BJ 1O3SA 4Q5SF 2HXIA 2FSWA 3V42A 5IYBJ 1EF4A 1R71A 2W00A 3M8JA 4M72A 2EA4A 2OF7A 3OR1C 3T5XA 3HOTA 2JA2A 3B6AA 4L0YB 2DA7A 4AYBN 4HOBA 3PO2J 5EZGA 2Z5UA 4PJJA 1B6AA 2R92J 2ID3A 1VQNI 1QQIA 3KPHA 2HYFA 1IRZA 4DYCA 3ASOH 3S32A 4G9YA 3FXUA 3VYTB 1U5TA 2A3SA 3HTUA 2R5YA 2EWNA 4M3BA 4UVCA 4BQNA 5K7FA 1XC5A 4Z2YA 4BGDA 3V7SA 1Z77A 3DBHB 2A68F 5IT9K 3BJOA 2ADUA 2XAFA 2DT6A 1X4OA 5L3GA 4WWCA 3BPXA 3TQNA 3U21A 3MZ8A 4I76A 3TDZC 1VQ6I 1WGXA 1WQ2A 3L2UA 4OWRB 2M0MA 1VF9A 4Q48A 1FC3A 3LAJA 4HZFA 4BACA 4XOPA 1QPMA 3Q3SA 2WV0A 3QAHA 2R7DA 2R7RA 2ZKZA 5HNHA 3JSPA 2ESHA 4ON0A 3FXLA 5FKMA 4RGSA 3I5UA 3CCYA 2DK8A 4CYDA 3LNQA 5LHHA 1G6NA 1F1ZA 3GYHX 4MGRA 2VBWA 1Z21A 3IC7A 3AAFA 4C2TA 3E6MA 1HA8A 1KGSA 3TO9A 4XKWA 1U3EM 1E17A 4N9HA 2Y0SA 1YE9A 1ZR2A 2V9PA 1XDSA 1IXRC 3M9AA 2R93J 3M1CA 1OCPA 4KDPA 3HZJA 3HXLA 4XONA 3FBIB 4NDLA 3MKLA 3K4LA 1WI3A 4X6AJ 1QZYA 1YO5C 4D5CA 3L2RA 1AHDP 2YU9J 1YJ9I 1SFXA 4XBFA 2KP6A 4HX8A 1Y8RB 3E3VA 2VBZA 3U2RA 2G9WA 3BCBA 1Y8QB 3CDHA 3Q0UA 1VQ8I 5J6XA 4MTEA 2Y75A 3I59A 1BR4A 1XS9A 1VQOI 1IJWC 3CDIA 4RGRA 4D0PA 1PVEA 2E60A 5D5WB 3BT9A 3PUBA 2XC7A 4A5MA 2VN2A 2NVTJ 2EZKA 2QQBA 3NWTA 5C4XJ 1ETWA 3OYEA 4PJMA 2A5WA 2P7VB 1XMXA 1KYWA 2W57A 1P92A 1TNSA 2EB7A 1FMWA 2AQFA 3CJTB 2OV7A 2HYJA 1KZHA 5H20A 4M6XA 4ZYAA 5M3FJ 2L0KA 2BZTA 3S15J 1ZG1A 4LFUA 5J1UA 1B9NA 4N0BA 2IBDA 4ZZLA 4MEYF 2KIFA 1ZYRF 3F6VA 4L5IA 2HOAA 2ZNYA 5D4SA 3C2GA 3QOPA 2ZNZA 4X1EA 1IV8A 1MNDA 3E6DA 1MBHA 1ULYA 3TDUC 2HOTA 2XGXA 1A5JA 1ZGJA 4ENKA 2EINH 5LGNA 1OCTC 1IRXA 1X58A 4IVNA 4A2UA 2UXXA 3OYKA 4C9YA 3GTQJ 2PEXA 1R1VA 3QWLA 3DU5A 3EUAA 1FIAA 4IRGA 1D0XA 1Q1HA 2PX9A 4ZYHA 2PMHA 4PGHA 3J80Z 2KKOA 2Z9OA 1F5TA 1ETXA 1P7JA 1X1BA 1QGPA 3LA2A 4OIPF 3F8MA 3W2VA 2HU9A 1GDTA 4IQ4A 3EPZA 3QYFA 1G3YA 3DXJF 2YSRA 4XICA 3I58A 3PNVA 5JFRA 5FKNA 3LSPA 4FE4A 1IRGA 1ZAOA 4J19A 1MW7A 3H36A 2JRTA 2R5ZB 5F1RA 4HV6A 2HVQA 4AIJA 3GZNB 2KIUA 2ZB9A 5JI6A 3KYCB 2PQ8A 3ZMTA 1U8BA 4MQ9F 2WV1A 1BA5A 4V2FA 4HPQA 5CKTA 2JT1A 3HGYA 5IPAA 3J81Z 4E7HA 4KISA 4MNUA 4CYCA 2E7WA 3KIOA 4MO7A 1V4RA 1PJRA 2LP0A 2ZCWA 2OD5A 1DU0A 3Q0VA 2GIVA 1KU9A 2X6XA 3C3WA 2DJNA 3T0YA 3BR3A 2KMUA 2OBPA 1BR1A 4BDYA 4U7DA 3S2WA 1VQPI 2DLLA 3H5AA 3FF5A 4BL0B 2AQEA 3M4OJ 1IXSB 2Y31A 1FOYA 2V9VA 3DKXA 3HBLA 4BXUA 1HW2A 3SZPA 3HPHA 1T6SA 1V5EA 4XLCA 1H88C 2DFIA 3S1QJ 2R7VA 3IKVA 2QM3A 2K3PA 4I2OA 1HW1A 2LREA 2EILH 3MEXA 3W6JB 1TL8A 1MMAA 2LR8A 2KDOA 2P5KA 3DPLC 3HSRA 2K4BA 2ZXIA 3LSJA 1SD5A 5B3SH 4MIMA 3OL3A 2LF7A 3PFYA 4PGGA 5J47A 4Y33A 2ZJRF 3EUKL 1O4XA 4HAMA 1XTAA 5J1RA 1RUNA 2H1KA 1ETYA 1UHWA 3ZCOA 2ZMEA 1PYVA 2BYVE 3HRTA 6PAXA 3REOA 1FX7A 5EJCA 2H09A 2DMTA 3RKQA 3JREA 4ESJA 1YG2A 1BI2A 1QZEA 2E1OA 2HXOA 2GBYA 2M45A 1YX3A 2NAZA 3ML6A 1JGSA 1SVOA 2QKMB 2BY1A 2TCTA 2LVSA 4DZPA 2DPDA 2QENA 1Z91A 4IHXA 4XR6A 3ZMDA 1DP3A 2ZJ2A 2F6CA 3EDPA 2HQNA 5DYMA 5E20A 3RJPA 3SDGA 3HUGB 5ICEA 3QP6A 3FISA 4ZYDA 1O7FA 3BR6A 3FMSA 4LOCA 3D5RC 4MLOA 1FMVA 1XGOA 2X4HA 1LPQA 2HVRA 3K9TA 1YW7A 2DK5A 1F4KA 3QODA 1DPRA 3KCCA 4CUGA 1YIJI 5LGTA 3WTZA 5FLMJ 1VQMI 1I1GA 5J3LA 5LLQA 1V54H 3HG9A 3F9KA 4AYBA 1EKEA 5BQTA 5E3NA 3CCQI 2CQ7A 1MMSA 4KN7X 4Z6YA 2OPTA 4BEHA 2UXNA 2QEXI 1XPXA 3WODF 1R23A 2EV6A 1AOYA 1WFXA 1HBXG 2XASA 3GTKJ 3FX3A 4UB8C 3ZQ7A 3LSRA 5FRNA 1MBGA 1JKQC 2DT7B 3QRFF 2WB1N 3I4PA 3M8EA 1PUEE 4M3GA 2XIGA 4CH7A 1OCOH 1V3FA 5DCFA 2HTJA 2L01A 4CZZA 2YS9A 5TGTA 5HNFA 1WJDA 2X51A 5L3CA 3JAMZ 2ZMEC 3ZR8X 3WTWC 2Z1DA 2K9QA 4S0HB 5KAFC 1IN5A 2W7NA 5E17F 1W36C 2C6YA 4X0GA 3KX2A 1T33A 4HF2A 3GWZA 2VQGA 2P6SA 3N05A 1S8NA 2KHMA 3FIWA 3LL7A 2EV0A 1X3WB 3OR2C 1QPIA 5LEJA 2IA0A 1U2WA 2X6YA 2KRCA 2V4JC 3TEDA 1Z05A 2CRGA 1MDMA 2JA8J 2M9HA 4C3HJ 2P5VA 3FKJA 1JHHA 1IN8A 4WXHA 3K10A 3K1MA 4BDZA 2GA1A 4PCQA 2ZJPF 1T56A 2FJ1A 3BZCA 4HLYA 3OYJA 4UNOA 2GOXB 1ETOA 1NG7A 2FBHA 4N4NB 2JN6A 3B6CA 2M8GX 1S6LA 2G7UA 1TTYA 5DV5A 2FNAA 4DOZA 5J4VA 4A3KJ 3MCZA 1CQTA 4O3MA 3O8HA 4G94A 1D0YA 2F5DA 1Z7UA 1BW6A 2R7OA 2CSOA 3A0HC 1V5GA 3U1KA 3BJ6A 2E5NA 2Y30A 4BXFA 4V19K 3QYEA 3A02A 1X1DA 2DW4A 2O6GE 1R00A 2DOEA 3PNTA 4XLNF 3DLAA 3BQZA 4ESFA 2J5PA 5A2QZ 2V6CA 2VXZA 3MZYA 2ME6A 1U6GA 3K1NA 2VLAA 2E7XA 2DMPA 3QPHA 3ABLH 3MD2A 1MJ9A 4IRHA 2L3DA 3RSNA 1IC8A 2VJJA 2F4OB 2ZBKA 2CG4A 2FQ4A 4A3MJ 1XCVA 1JXSA 4HA8A 3HOWJ 1U5TB 1HQCA 2FX0A 3OYHA 2R5YB 3M07A 4QPQA 2FBIA 2AXTC 2M8EA 3F8CA 5F64A 4IHTA 2FXAA 4IHWA 4D9JA 3Q0WA 1FZPB 3W6VA 1MD0A 2FRHA 3DBLB 1S9HA 1J75A 2J5OA 4D7NA 1QHHD 3CCJI 3N97A 3OS1A 1RPWA 3S16J 4B1RA 2L2OA 4JYKA 2WADA 1R49A 2KL4A 3PQJA 4M9XA 1SD4A 4FX0A 4ASNA 1TNTA 4M3EA 5FRMA 1FSHA 2KIQA 1QA6A 4IEJA 2HOEA 2ZJQF 4E7JA 3TOBA 2LKXA 3DP7A 3K4NA 4A3GJ 2L7KA 3KP7A 3BCAA 3GLLA 4EGZA 3ZMUA 2KFDA 2YPRA 4XNFA 3K4MA 4EM2A 3HKZN 4LIUA 1HDDC 4UVBA 1R1UA 2DN0A 3A4CA 1LVAA 5DCMA 4RAZA 1BOAA 4LITA 1YHQI 4XRMA 3SZGA 2EFNA 2R7FA 1VQ9I 3LSMA 5IT3A 4FHTA 3I4MJ 1D1BA 1IN4A 3MZHA 4ZTFA 3TKYA 1UB9A 1T8IA 1E3OC 4KJZA 3ZMVA 1JUMA 3GFJA 4XIDA 3SEZA 2E5ZA 3I59B 1IXCA 1LJ9A 4IHSA 5H2FC 1W1WE 2VJ5A 4R8HA 3QOEA 2PFBA 2VKVA 4NC6A 2UWMA 1FNNA 3IWFA 4A3CJ 3ZN0A 2IGOA 4ZH4F 3MKYB 3OOUA 3AKZA 2MLKA 2QA4I 5E3MA 1VTNC 3O2PE 3S3OA 3LMMA 4XLFA 5LHGA 1BC7C 4IJAA 2D45A 1BJZA 3TMOA 1H0MA 4AWXB 4P55A 2OTJI 2OQGA 1R4NB 3LSKA 3SEQA 2BBYA 3ABUA 4PUSA 3GBGA 1MH4A 1TWFJ 1VFCA 2JTVA 4HX4A 2NRAC 2OZ6A 4LLLA 4WK8F 1LNWA 2PJPA 3VSLA 2L7MP 1WHUA 4A0ZA 3Q9VA 2B7EA 5EEHA 1K79A 2VC1A 3I0TA 4XSZF 3JRBA 2R7XA 3GFMA 2GM4A 1RKWA 4I0AA 1L3LA 5ERIA 5L3DA 3TBIA 1XSDA 2COBA 2BVMA 2K85A 1JKOC 3TP3A 3HRUA 1TWCJ 2JSCA 3E1SA 4E7LA 1A35A 3EYIA 1RIOH 3BZ6A 5F0CA 3OMYA 5B66C 4HNTA 3MKZA 5HDNA 2D2WA 1V5FA 3OIOA 1RESA 1OJLA 1HKSA 1R5HA 1GV2A 3BR5A 3G1OA 2VASA 3K2AA 4HX7A 4NBQA 2OU2A 4RM3A 2RV8A 4Y15A 3F8NA 1FP1D 4EJWA 2FOKA 3TOAA 1H9TA 2GAUA 3KYLA 4WXDA 4XL9A 1B8IB 2NXNB 3DTEA 2A61A 2ME0A 2X1CA 3CF5F 1DU6A 5ED4A 1W0UA 1T39A 5GP9A 5GTHC 5BMZA 4BE0A 3GO5A 4S05A 4BS9A 1FPQA 2EA2A 4PDKA 1LDDA 5GAEJ 3ECHA 3AL0C 3AG3H 4A0YA 1MBJA 2DT5A 1OPCA 1SVLA 3DF8A 4GRIA 1BW5A 2XDVA 4CYCB 1JGGA 4FCYA 3G1LA 5CQEA 4CXFA 4NQWA 4U88A 1VQ4I 1BJAA 2F5EA 2FD5A 4LB5A 1POGA 4EVIA 1F43A 1SC7A 2CW0F 2W85A 5JHFA 4WX9A 3KEQA 5CPRB 4ABZA 2DA4A 3FXJA 4RGXA 4XORA 2ZSIB 3HHGA 3ZPLA 1IG7A 5IYDJ 1R5ID 2OCCH 2R7WA 1GVDA 2P5LC 1TZLA 3G1MA 5DM7F 5CJ9A 5IYCJ 3TGNA 1PUFA 1QVTA 4Y17A 2VKHA 2XB0X 1S72I 5DUKA 5ILVA 4I98B 5JHUA 5J1YA 5LGUA 2K9SA 3RQIA 2W4SA 1LB2A 3F8BA 5TISC 3CO6C 1ZG5A 3AG4H 3KP5A 4EV0A 4H0EA 1I3AA 1ZGAA 4JOMA 5D4RA 2WWYA 3V8LA 3KZIC 3E5QA 1ETQA 5B1AH 5TRDA 4U0WA 3OYBA 1O3RA 2Q1ZB 4OU0A 1TP4A 4IO9F 1FP2A 5EZHA 3L1PA 5E8IA 5J40A 4IQJA 5M5YJ 2HDDA 2ZSHB 2CJJA 3C18A 1MIJA 2K27A 4F3QA 2JA5J 4B09A 4MQVA 3ZGKA 3I9V2 2R7QA 1BL0A 2JVGA 3D5LA 2ZMEB 2HZTA 3SFZA 2DMNA 1ZR4A 2XAHA 5DD8A
chains in the Genus database with same CATH topology
2LP0A 2JMWA 1DU0A 1MBKA 1JUPA 3Q0VA 3HB9A 1FTZA 3CQZJ 3HOYJ 2DJNA 3FK7A 3BR3A 2K9NA 3I4NJ 3OSGA 1P7IA 3ZQGA 4BY1J 3GTJJ 2ECBA 2KDZA 2MGQA 4Y7NJ 4IHYA 2VPRA 3S2DJ 5C44J 3A01B 1S7EA 2B63J 2L7ZA 3M4OJ 4JX4A 5BNGA 4DYQA 3TW7A 2Y31A 3HBLA 2IEKA 1IGNA 2LK2A 5EGOB 2MW8A 4A3EJ 1NTCA 1OFCX 3S1NJ 4AUXA 2N8GA 2TRTA 1H88C 4XRSG 3S1QJ 2R5ZA 1JJ8C 2MG4A 3IH4A 2I10A 5IP6A 4FTHA 5F0FA 4C3JJ 2LR8A 2XGCA 4DZJA 2QF7A 2XPWA 3LSJA 3JR9A 4MIMA 3TP0A 1MNMC 1WCMJ 5F27A 1ENHA 3IH3A 1O4XA 3S14J 5J1RA 2H1KA 1ETYA 1G2HA 3HOVJ 2LFBA 4C2MJ 1GV5A 2G0EA 2DMTA 1QVUA 3RKQA 3HOUJ 3JREA 1U78A 3BR0A 2E1OA 2HXOA 3H3VK 2GBYA 4L5EA 4UUTA 3GTPJ 2HQ5A 2TCTA 1FEXA 2LVSA 4DZPA 3SJMA 4IHXA 2M34A 3D1NI 4RDUA 3A01A 1JKRC 1RKTA 1TWGJ 1I3QJ 2EQRA 3SDGA 5HODA 1MBEA 4C3IJ 3FISA 4BXXJ 2AHQA 2JJ7A 3BR6A 4FE7A 4LOCA 4MLOA 1W0TA 5EGOA 1TWHJ 2DTZA 3BR1A 5FJ8J 1B72B 5FLMJ 2E2HJ 4QTRA 2DA3A 5J3LA 3JRGA 1WH5A 5E3NA 5K7ZA 4JX6A 5EDNA 2CUEA 5FKOA 2H8RA 2OPTA 2NS7A 2R0QC 3DCFA 1WH7A 3RZDJ 2K40A 1B8IA 1FIPA 1K83J 3PM1A 2ID6A 3VPRA 3GTKJ 3LSRA 5F04A 3DEWA 1MBGA 1JKQC 2ELKA 4G12A 1JJ6C 2WB1N 1UHSA 3S17J 4M3GA 4V2GA 5E3LA 3ZQIA 4D7MA 1FTTA 3CDLA 5IP9J 2YS9A 5FLVA 3JRIA 1X2MA 1ITYA 5EYRA 1JT6A 2K9QA 4S0HB 5JLWA 3S1RJ 1U9NA 2HI3A 2Y9ZA 3HOXJ 1T33A 3QQAA 1SFOJ 4A3JJ 3JRDA 4A3IJ 2NVXJ 1ORKA 3FIWA 1QPIA 2EZIA 2XB5A 3GTGJ 3TEDA 2L7FP 2CRGA 2LLKA 1A6IA 2JA8J 2M9HA 4C3HJ 2LTPA 2KT0A 1YRNB 5EEAA 1B72A 4FISA 3BR2A 1T56A 2FJ1A 4M3DA 2XRLA 3ZOBA 1ETOA 2JN6A 4M3FA 4W97A 3B6CA 1FJLA 2M8GX 2QCOA 3PO3J 3NAUA 1ETKA 4A3KJ 1X2NA 3ZQLA 1CQTA 3O8HA 1RR7A 4XK4A 1BW6A 1JUSA 1APLC 3IH2A 2XGEA 3BTIA 1JKPC 2XPUA 4MFDA 2DA2A 2Y30A 3O8GA 2YUSA 1Q1VA 1AU7A 5JLXA 2DA1A 4MFEA 1MSFC 3SFIA 4EEFG 3A02A 2JWTA 3NARA 4Y52J 2RAEA 5FKKA 2EH3A 3BQZA 3C2BA 5E3OA 2ME6A 4A3FJ 2DMQA 1TWAJ 1D5YA 2DMPA 1ZGWA 3HDDA 4IHVA 4A93J 4BBSJ 3LSGA 5C4JJ 1IC8A 9ANTA 4BY7J 1GUUA 1Y1VJ 5GPCA 2P81A 2FQ4A 1VNDA 2E19A 4A3MJ 5EF6A 5GPAA 2XSDC 3HOWJ 2FX0A 2JK3A 2X48A 2R5YB 2GLOA 1IDZA 3GTOJ 1JTXA 4BKXA 2NVYJ 4IHWA 3A03A 1YRNA 5F08A 2EZHA 3Q0WA 2O7OA 3W6VA 4A3DJ 3GTLJ 1UMQA 3TW6A 4D7NA 1UG2A 3S16J 1RPWA 4B1RA 4RBOA 5M5WJ 1LFUP 1VI0A 2NOGA 4JYKA 3ZQFA 3S2HJ 4I6ZA 1H89C 2X9DA 1RETA 2D5VA 2CUFA 3LOCA 2XPVA 1IUFA 4M3EA 2W48A 1LFBA 2MSYA 2EZLA 3BTLA 4IEJA 2CQXA 2LKXA 4A3GJ 3HOZJ 4A3BJ 1F36A 2HXIA 5IYBJ 3HKZN 1HDDC 1EF4A 2OF7A 2NVQJ 2DN0A 3ZQHA 2PMZN 3F0CA 2VUMJ 3B6AA 3JRAA 5M3MJ 2DA7A 3UKGA 2AO9A 4AYBN 3K7AJ 3PO2J 5EZGA 4XRMA 3HEFA 2R92J 2ID3A 3I4MJ 5IOZA 2JA6J 1IRZA 2VKEA 3FK6A 4DYCA 1ZR4A 1E3OC 4DW6A 1AKHB 4QSHA 1JUMA 4M6VA 4XIDA 2R5YA 4M3BA 5K7FA 1XC5A 2IAIA 1Z77A 1U9OA 1Z0XA 3BTJA 1WPKA 2VKVA 4A3CJ 2DA5A 2Y2ZA 1TC3C 4I76A 1WGXA 3H0GJ 3OOUA 3QPLA 1VF9A 4B4CA 5E3MA 3Q3SA 1I6HJ 1H8AC 3HM5A 4XRSA 5DS9A 3BG3A 5FKMA 3LNQA 3CCYA 1BJZA 1HLVA 3M3YJ 3ZQCA 5EG0B 1MBFA 2E2IJ 2CQQA 2VI6A 1ZK8A 4HNVA 3GBGA 1TWFJ 1MH4A 1VFCA 1ZR2A 1K61A 3WHCA 1HF0A 4UUSB 2L7MP 2R93J 2LD5A 1OCPA 1I50J 4JP0A 1XG1A 4NDLA 1MH3A 3MKLA 1WI3A 3JRBA 1GT0C 4X6AJ 3BTCA 4D5CA 3IV5A 2GM4A 1RKWA 1AHDP 2YU9J 2COBA 2Y0SN 4B3AA 2CU7A 1JKOC 4W1UA 2E2JJ 3TP3A 1TWCJ 1AKHA 5F0CA 1ZTRA 3Q0UA 2ECCA 3OIOA 1RESA 1OJLA 1GV2A 3BR5A 3K2AA 1ZKGA 3G1OA 1XS9A 1IJWC 1NK3P 4DYRA 1PUFB 4A3LJ 2NS8A 2M0CA 3BT9A 1IV6A 1ETVA 2NVTJ 2EZKA 5C4XJ 1ETWA 5M5XJ 2O8KA 3GTMJ 1B8IB 5DTDA 2ME0A 1DU6A 1NK2P 1MSEC 5IOYA 1W0UA 4GFBA 5C3EJ 2HOSA 2HYJA 1JTYA 3WHBA 3JRCA 5GP9A 2M2EA 3CMYA 5M3FJ 2L0KA 3S15J 3MN2A 5J1UA 2XGDA 2IBDA 5EG0A 2DA6A 3JRHA 1LE8B 5K7HA 3FKIJ 1MBJA 2HOAA 4UUSA 1HOMA 1BW5A 4X1EA 4CYCB 1JGGA 4QIWN 4FCYA 4BBRJ 3G1LA 1R9TJ 1MBHA 5F1JA 2HOTA 3HGGA 2FD5A 1POGA 1F43A 1A5JA 2EBIA 1OCTC 1X58A 2X6OA 3GTQJ 4ABZA 2DA4A 3BQYA 2Y9YA 1IG7A 1FIAA 1SANA 5IYDJ 1GVDA 3G1MA 5IYCJ 2O9LA 1ETXA 3E7LA 1P7JA 4D5FA 1PUFA 1ZQ3P 1QVTA 2LY9A 2XB0X 3JRFA 2DMUA 3RZOJ 1GDTA 1HDPA 5J1YA 4XICA 2K9SA 3RQIA 5FKNA 3LSPA 4FE4A 4J19A 2R5ZB 4A69C 1JT0A 1ETQA 2ZB9A 3QPSA 5EZHA 3L1PA 1U8BA 2WV1A 1IDYA 1QRYA 5IP7J 3S1MJ 4V2FA 1BA5A 4JX5A 5M5YJ 1LE8A 2HDDA 3HGYA 5IPAA 2CJJA 5FKLA 5F0HA 1Y1WJ 3MVPA 2JA5J 2JA7J 2L9RA 2WAQN 4AC0A 3OSFA 4CYCA 1BL0A 2R7ZJ 1HCRA 2DMNA 3BG9A 4MO7A 3BG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP0 A;  2JMW A;  1DU0 A;  1MBK A;  1JUP A;  3Q0V A;  3HB9 A;  1FTZ A;  3CQZ J;  3HOY J;  2DJN A;  3FK7 A;  3BR3 A;  2K9N A;  3I4N J;  3OSG A;  1P7I A;  3ZQG A;  4BY1 J;  3GTJ J;  2ECB A;  2KDZ A;  2MGQ A;  4Y7N J;  4IHY A;  2VPR A;  3S2D J;  5C44 J;  3A01 B;  1S7E A;  2B63 J;  2L7Z A;  3M4O J;  4JX4 A;  5BNG A;  4DYQ A;  3TW7 A;  2Y31 A;  3HBL A;  2IEK A;  1IGN A;  2LK2 A;  5EGO B;  2MW8 A;  4A3E J;  1NTC A;  1OFC X;  3S1N J;  4AUX A;  2N8G A;  2TRT A;  1H88 C;  4XRS G;  3S1Q J;  2R5Z A;  1JJ8 C;  2MG4 A;  3IH4 A;  2I10 A;  5IP6 A;  4FTH A;  5F0F A;  4C3J J;  2LR8 A;  2XGC A;  4DZJ A;  2QF7 A;  2XPW A;  3LSJ A;  3JR9 A;  4MIM A;  3TP0 A;  1MNM C;  1WCM J;  5F27 A;  1ENH A;  3IH3 A;  1O4X A;  3S14 J;  5J1R A;  2H1K A;  1ETY A;  1G2H A;  3HOV J;  2LFB A;  4C2M J;  1GV5 A;  2G0E A;  2DMT A;  1QVU A;  3RKQ A;  3HOU J;  3JRE A;  1U78 A;  3BR0 A;  2E1O A;  2HXO A;  3H3V K;  2GBY A;  4L5E A;  4UUT A;  3GTP J;  2HQ5 A;  2TCT A;  1FEX A;  2LVS A;  4DZP A;  3SJM A;  4IHX A;  2M34 A;  3D1N I;  4RDU A;  3A01 A;  1JKR C;  1RKT A;  1TWG J;  1I3Q J;  2EQR A;  3SDG A;  5HOD A;  1MBE A;  4C3I J;  3FIS A;  4BXX J;  2AHQ A;  2JJ7 A;  3BR6 A;  4FE7 A;  4LOC A;  4MLO A;  1W0T A;  5EGO A;  1TWH J;  2DTZ A;  3BR1 A;  5FJ8 J;  1B72 B;  5FLM J;  2E2H J;  4QTR A;  2DA3 A;  5J3L A;  3JRG A;  1WH5 A;  5E3N A;  5K7Z A;  4JX6 A;  5EDN A;  2CUE A;  5FKO A;  2H8R A;  2OPT A;  2NS7 A;  2R0Q C;  3DCF A;  1WH7 A;  3RZD J;  2K40 A;  1B8I A;  1FIP A;  1K83 J;  3PM1 A;  2ID6 A;  3VPR A;  3GTK J;  3LSR A;  5F04 A;  3DEW A;  1MBG A;  1JKQ C;  2ELK A;  4G12 A;  1JJ6 C;  2WB1 N;  1UHS A;  3S17 J;  4M3G A;  4V2G A;  5E3L A;  3ZQI A;  4D7M A;  1FTT A;  3CDL A;  5IP9 J;  2YS9 A;  5FLV A;  3JRI A;  1X2M A;  1ITY A;  5EYR A;  1JT6 A;  2K9Q A;  4S0H B;  5JLW A;  3S1R J;  1U9N A;  2HI3 A;  2Y9Z A;  3HOX J;  1T33 A;  3QQA A;  1SFO J;  4A3J J;  3JRD A;  4A3I J;  2NVX J;  1ORK A;  3FIW A;  1QPI A;  2EZI A;  2XB5 A;  3GTG J;  3TED A;  2L7F P;  2CRG A;  2LLK A;  1A6I A;  2JA8 J;  2M9H A;  4C3H J;  2LTP A;  2KT0 A;  1YRN B;  5EEA A;  1B72 A;  4FIS A;  3BR2 A;  1T56 A;  2FJ1 A;  4M3D A;  2XRL A;  3ZOB A;  1ETO A;  2JN6 A;  4M3F A;  4W97 A;  3B6C A;  1FJL A;  2M8G X;  2QCO A;  3PO3 J;  3NAU A;  1ETK A;  4A3K J;  1X2N A;  3ZQL A;  1CQT A;  3O8H A;  1RR7 A;  4XK4 A;  1BW6 A;  1JUS A;  1APL C;  3IH2 A;  2XGE A;  3BTI A;  1JKP C;  2XPU A;  4MFD A;  2DA2 A;  2Y30 A;  3O8G A;  2YUS A;  1Q1V A;  1AU7 A;  5JLX A;  2DA1 A;  4MFE A;  1MSF C;  3SFI A;  4EEF G;  3A02 A;  2JWT A;  3NAR A;  4Y52 J;  2RAE A;  5FKK A;  2EH3 A;  3BQZ A;  3C2B A;  5E3O A;  2ME6 A;  4A3F J;  2DMQ A;  1TWA J;  1D5Y A;  2DMP A;  1ZGW A;  3HDD A;  4IHV A;  4A93 J;  4BBS J;  3LSG A;  5C4J J;  1IC8 A;  9ANT A;  4BY7 J;  1GUU A;  1Y1V J;  5GPC A;  2P81 A;  2FQ4 A;  1VND A;  2E19 A;  4A3M J;  5EF6 A;  5GPA A;  2XSD C;  3HOW J;  2FX0 A;  2JK3 A;  2X48 A;  2R5Y B;  2GLO A;  1IDZ A;  3GTO J;  1JTX A;  4BKX A;  2NVY J;  4IHW A;  3A03 A;  1YRN A;  5F08 A;  2EZH A;  3Q0W A;  2O7O A;  3W6V A;  4A3D J;  3GTL J;  1UMQ A;  3TW6 A;  4D7N A;  1UG2 A;  3S16 J;  1RPW A;  4B1R A;  4RBO A;  5M5W J;  1LFU P;  1VI0 A;  2NOG A;  4JYK A;  3ZQF A;  3S2H J;  4I6Z A;  1H89 C;  2X9D A;  1RET A;  2D5V A;  2CUF A;  3LOC A;  2XPV A;  1IUF A;  4M3E A;  2W48 A;  1LFB A;  2MSY A;  2EZL A;  3BTL A;  4IEJ A;  2CQX A;  2LKX A;  4A3G J;  3HOZ J;  4A3B J;  1F36 A;  2HXI A;  5IYB J;  3HKZ N;  1HDD C;  1EF4 A;  2OF7 A;  2NVQ J;  2DN0 A;  3ZQH A;  2PMZ N;  3F0C A;  2VUM J;  3B6A A;  3JRA A;  5M3M J;  2DA7 A;  3UKG A;  2AO9 A;  4AYB N;  3K7A J;  3PO2 J;  5EZG A;  4XRM A;  3HEF A;  2R92 J;  2ID3 A;  3I4M J;  5IOZ A;  2JA6 J;  1IRZ A;  2VKE A;  3FK6 A;  4DYC A;  1ZR4 A;  1E3O C;  4DW6 A;  1AKH B;  4QSH A;  1JUM A;  4M6V A;  4XID A;  2R5Y A;  4M3B A;  5K7F A;  1XC5 A;  2IAI A;  1Z77 A;  1U9O A;  1Z0X A;  3BTJ A;  1WPK A;  2VKV A;  4A3C J;  2DA5 A;  2Y2Z A;  1TC3 C;  4I76 A;  1WGX A;  3H0G J;  3OOU A;  3QPL A;  1VF9 A;  4B4C A;  5E3M A;  3Q3S A;  1I6H J;  1H8A C;  3HM5 A;  4XRS A;  5DS9 A;  3BG3 A;  5FKM A;  3LNQ A;  3CCY A;  1BJZ A;  1HLV A;  3M3Y J;  3ZQC A;  5EG0 B;  1MBF A;  2E2I J;  2CQQ A;  2VI6 A;  1ZK8 A;  4HNV A;  3GBG A;  1TWF J;  1MH4 A;  1VFC A;  1ZR2 A;  1K61 A;  3WHC A;  1HF0 A;  4UUS B;  2L7M P;  2R93 J;  2LD5 A;  1OCP A;  1I50 J;  4JP0 A;  1XG1 A;  4NDL A;  1MH3 A;  3MKL A;  1WI3 A;  3JRB A;  1GT0 C;  4X6A J;  3BTC A;  4D5C A;  3IV5 A;  2GM4 A;  1RKW A;  1AHD P;  2YU9 J;  2COB A;  2Y0S N;  4B3A A;  2CU7 A;  1JKO C;  4W1U A;  2E2J J;  3TP3 A;  1TWC J;  1AKH A;  5F0C A;  1ZTR A;  3Q0U A;  2ECC A;  3OIO A;  1RES A;  1OJL A;  1GV2 A;  3BR5 A;  3K2A A;  1ZKG A;  3G1O A;  1XS9 A;  1IJW C;  1NK3 P;  4DYR A;  1PUF B;  4A3L J;  2NS8 A;  2M0C A;  3BT9 A;  1IV6 A;  1ETV A;  2NVT J;  2EZK A;  5C4X J;  1ETW A;  5M5X J;  2O8K A;  3GTM J;  1B8I B;  5DTD A;  2ME0 A;  1DU6 A;  1NK2 P;  1MSE C;  5IOY A;  1W0U A;  4GFB A;  5C3E J;  2HOS A;  2HYJ A;  1JTY A;  3WHB A;  3JRC A;  5GP9 A;  2M2E A;  3CMY A;  5M3F J;  2L0K A;  3S15 J;  3MN2 A;  5J1U A;  2XGD A;  2IBD A;  5EG0 A;  2DA6 A;  3JRH A;  1LE8 B;  5K7H A;  3FKI J;  1MBJ A;  2HOA A;  4UUS A;  1HOM A;  1BW5 A;  4X1E A;  4CYC B;  1JGG A;  4QIW N;  4FCY A;  4BBR J;  3G1L A;  1R9T J;  1MBH A;  5F1J A;  2HOT A;  3HGG A;  2FD5 A;  1POG A;  1F43 A;  1A5J A;  2EBI A;  1OCT C;  1X58 A;  2X6O A;  3GTQ J;  4ABZ A;  2DA4 A;  3BQY A;  2Y9Y A;  1IG7 A;  1FIA A;  1SAN A;  5IYD J;  1GVD A;  3G1M A;  5IYC J;  2O9L A;  1ETX A;  3E7L A;  1P7J A;  4D5F A;  1PUF A;  1ZQ3 P;  1QVT A;  2LY9 A;  2XB0 X;  3JRF A;  2DMU A;  3RZO J;  1GDT A;  1HDP A;  5J1Y A;  4XIC A;  2K9S A;  3RQI A;  5FKN A;  3LSP A;  4FE4 A;  4J19 A;  2R5Z B;  4A69 C;  1JT0 A;  1ETQ A;  2ZB9 A;  3QPS A;  5EZH A;  3L1P A;  1U8B A;  2WV1 A;  1IDY A;  1QRY A;  5IP7 J;  3S1M J;  4V2F A;  1BA5 A;  4JX5 A;  5M5Y J;  1LE8 A;  2HDD A;  3HGY A;  5IPA A;  2CJJ A;  5FKL A;  5F0H A;  1Y1W J;  3MVP A;  2JA5 J;  2JA7 J;  2L9R A;  2WAQ N;  4AC0 A;  3OSF A;  4CYC A;  1BL0 A;  2R7Z J;  1HCR A;  2DMN A;  3BG9 A;  4MO7 A;  3BG5 A; 
#chains in the Genus database with same CATH topology
 4LMY A;  1BBY A;  5ILU A;  4HDV A;  1X3Z B;  5FLX Z;  3F8F A;  1YIT I;  3HB9 A;  1K4T A;  1ZLJ A;  1RR8 C;  1EH7 A;  3HOY J;  5JVT A;  3DBR B;  2KZV A;  4WCG A;  2K9N A;  4AU7 A;  3I4N J;  4UB6 C;  3R4K A;  2IPQ X;  1B59 A;  3GTJ J;  3PSI A;  2MGQ A;  4XMY A;  2HPI A;  2M30 A;  4HLX A;  5JVG F;  4IX7 A;  4JX4 A;  4CSW A;  2ZFW A;  2XAU A;  1Z7L A;  4JQF A;  2IEK A;  2L9V A;  3IAM 2;  1DUX C;  2HNH A;  2MW8 A;  4A3E J;  2M87 A;  2X1E A;  4M9Z A;  4XKV A;  4AUX A;  3DWL E;  3DV8 A;  4IF4 A;  3RYP A;  2OTL I;  1ON1 A;  1JJ8 C;  1KYZ A;  5B5E C;  4UVA A;  1A31 A;  4BJT A;  3IH4 A;  1MGT A;  2I10 A;  4FTH A;  4C3J J;  3L2W A;  2KZG A;  3X2Q H;  3R0A A;  2XGC A;  2IGM A;  3L00 A;  4RAY A;  2L4A A;  2BVL A;  2P6T A;  4BEH B;  3TP0 A;  4ZYE A;  2EFQ A;  1YS7 A;  1WCM J;  5D8K B;  1ENH A;  4IL6 C;  3AG1 H;  5E1X A;  3S14 J;  2A69 F;  2XUB A;  1Y0N A;  1G8X A;  2NNN A;  1G2H A;  4KIC A;  4C2M J;  3I53 A;  2X1D A;  1MNE A;  2VJ4 A;  1DDN A;  3KE2 A;  3DFG A;  5FGM A;  2JSP A;  3U1D A;  3H1C A;  3HOU J;  4ITV A;  4QPO A;  1U78 A;  5ICF A;  4BUP A;  2JZY A;  1I1S A;  4L5E A;  1Y0U A;  2AXL A;  4U0V A;  2M3A A;  2ZXJ A;  2P8T A;  3DTI A;  4UUT A;  1FEX A;  1SMY F;  4F91 B;  3J7Z I;  1J59 A;  2M34 A;  3D1N I;  1E0E A;  3A01 A;  2RVC A;  1RKT A;  2XSJ C;  4U0Y A;  1USS A;  2QSG X;  5E1W A;  5D8L B;  4BNC A;  4BXX J;  2JJ7 A;  1DGW Y;  4OMY A;  2M5W A;  3PIP F;  3EET A;  4EGY A;  3FMQ A;  1TWH J;  4YRV A;  1MDM B;  1R36 A;  1MJB A;  3BR1 A;  3ZN1 A;  3OIP A;  2DA3 A;  3JRG A;  2BOL A;  3T8T A;  1N77 A;  3BP8 A;  3CD6 I;  4KT5 C;  5L3E A;  1KU2 A;  4UY8 I;  3K6G A;  3BG7 A;  3VSK A;  2NS7 A;  3H5N A;  2R0Q C;  4A12 A;  3RZD J;  5HDK A;  1B8I A;  3VEP A;  4MEX F;  3SQN A;  1HXD A;  2O61 A;  3PM1 A;  3COA C;  2ZXH A;  2RNJ A;  3K70 C;  3I54 A;  1HST A;  2ELK A;  3OOP A;  4G12 A;  4AD9 A;  1JJ6 C;  1UHS A;  1C0W A;  3S17 J;  4V2G A;  5CLS A;  1EH8 A;  4UUV A;  2BV6 A;  4PJN A;  4L9N A;  1GXQ A;  2ELH A;  2L9N A;  1UCR A;  2JPB A;  1MJA A;  2IW5 A;  2D1H A;  2YR2 A;  3JRI A;  4BJ5 C;  1GHC A;  3RKW A;  4G6T B;  3GFI A;  5JLW A;  2F48 A;  4YFK F;  3S1R J;  4B48 A;  4FX4 A;  1SAU A;  2HI3 A;  3BLY A;  3JSO A;  2M4K A;  3OYI A;  2L54 A;  2FA5 A;  4A0X A;  1O7L A;  5D6F A;  4F55 A;  3CLO A;  5AON A;  3VOD A;  3WTT C;  4A3J J;  3GX4 X;  1S7O A;  4AVZ A;  4A3I J;  2HQA A;  4PSX A;  3L9F A;  3JTG A;  4U7B A;  4BAY A;  1WKM A;  3CUQ A;  3U9G A;  2LLK A;  1A6I A;  2CYY A;  2RKH A;  3L7W A;  2KT0 A;  1BC8 C;  2KIS A;  1LDJ A;  4FIS A;  3BR2 A;  3VWB A;  4UHT A;  1OCZ H;  3E6C C;  5CYV A;  5HS7 A;  4CCO A;  4M3D A;  4KIT B;  1SMT A;  4IRI A;  2FBK A;  3ZOB A;  2V1D A;  5GAG J;  1HSJ A;  4ZZD A;  4RB1 A;  4W97 A;  1FJL A;  2BEO A;  1YIO A;  3NAU A;  2DPU A;  4KN4 X;  3ISP A;  1ETK A;  1S7A A;  3G4S I;  2HDW A;  3VYU B;  1JUS A;  2MBF A;  3BG6 A;  5HDG A;  1O3T A;  1APL C;  4FET A;  1PDN C;  2MAB A;  5BOX A;  4MFD A;  3OYC A;  3CUO A;  2YUS A;  3DTK A;  3R0J A;  1AU7 A;  2WAF A;  3P9C A;  2E1M B;  2LKP A;  3HRS A;  4BE1 A;  1MSF C;  2HTS A;  2HPM A;  1D1C A;  4OIN F;  4LLG F;  2QKL B;  4GYG A;  2R7S A;  2Z2S B;  2LDU A;  3KZY A;  3LSH A;  5BS6 A;  1P4A A;  1WJC A;  5E3O A;  5DCM B;  1YQA A;  1P6R A;  2O5R A;  4EJV A;  1WJ5 A;  1XGM A;  3H3U A;  1D5Y A;  1ZGW A;  4BBS J;  2JUG A;  3LSG A;  4CCM A;  3KP3 A;  9ANT A;  1Y1V J;  2CO5 A;  3BJA A;  3SDB A;  1IDZ A;  1N25 A;  3GTO J;  2RNG A;  5IT9 Z;  2PI0 A;  3M7G A;  3A03 A;  1Z3X A;  2EZH A;  3LSI A;  5ICC A;  2DFF A;  3BWG A;  4A3D J;  3GTL J;  4RGU A;  3JCU C;  2ESN A;  3QPT A;  4ANJ A;  1VQ7 I;  1UG2 A;  3CUQ C;  2UUZ A;  3PIO F;  1BI0 A;  5LFA A;  4RB2 C;  4ZDL A;  2NOG A;  5M5W J;  1OMI A;  2DFH A;  2HEO A;  1T2K A;  2VOD A;  3I56 I;  2MD0 A;  3AL0 B;  3DEU A;  4P5O A;  3CF2 A;  1Z9C A;  2G7H A;  2DFE A;  5K5O A;  1F36 A;  1MZB A;  3E6B A;  4OOI A;  5LRR A;  3A2K A;  4F52 A;  2MH9 A;  3G73 A;  3ZQQ A;  2RC4 A;  3I3L A;  3TO7 A;  2QZ8 A;  1W5C C;  1R6R A;  2E71 A;  2Q8K A;  1BIA A;  5E1Z B;  3F0C A;  1EH6 A;  1B1B A;  3L09 A;  3IKT A;  3UKG A;  2AO9 A;  4UV9 A;  1X1A A;  3K7A J;  3NRV A;  3CCM I;  4MTD A;  1CGP A;  1LDK B;  2JA6 J;  2VKE A;  5DUI A;  4IOA F;  3CZ6 A;  1FBS A;  2TDX A;  4DW6 A;  4M6V A;  3VDX A;  1B4A A;  1TT0 A;  4IXA A;  5GTI C;  3QP5 A;  2IAI A;  2DCE A;  2OA4 A;  3LWF A;  2XKO A;  3ASN H;  4ZC3 A;  3P9K A;  3C2H A;  4L9J A;  1W7P B;  4RB3 C;  1NH3 A;  2DA5 A;  4BHC A;  2R7T A;  1TC3 C;  4CCJ A;  1TQM A;  3MWM A;  4IOC F;  2E1C A;  4GGG A;  3G2B A;  3GCM A;  4EQQ A;  3Q5F A;  4B4C A;  2DTR A;  1VQK I;  4P9F A;  3KP6 A;  1WJA A;  3CMA I;  3S3N A;  4XRS A;  1U0J A;  2RGV A;  1R7J A;  4E4H A;  1T08 B;  3K4B A;  1Y6I A;  1ZEL A;  4II2 A;  1MBF A;  2CQQ A;  3CLQ A;  2BW3 A;  3WGH A;  2VI6 A;  1ZK8 A;  4HNV A;  2IP2 A;  2H94 A;  1K61 A;  1X3U A;  3WHC A;  1HF0 A;  4EAT A;  3I64 A;  2BGC A;  2LD5 A;  4U87 A;  3K0L A;  1F9N A;  1XG1 A;  1HW5 A;  1UFM A;  5HS8 A;  4NQW B;  2ACJ A;  1UHM A;  3A0B C;  1E3P A;  3MAJ A;  3BTC A;  1RNL A;  3PFI A;  2FOW A;  1K78 A;  3SYT A;  2Y0S N;  4B3A A;  2CU7 A;  1HKT A;  4W1U A;  2GOM A;  2GIZ A;  2L5Q A;  3C1D A;  5H6R A;  5DDG A;  4RB0 A;  1AKH A;  5GAH J;  1T98 A;  1ZTR A;  2CV2 A;  5HLT A;  2ECC A;  4LK1 F;  1ZKG A;  3RPU A;  2HR3 A;  3GW2 A;  1PUF B;  2NS8 A;  2HKO A;  2H27 A;  3KYD B;  1IV6 A;  1ETV A;  4HDU A;  3HHH A;  4GYI A;  1JHF A;  2JUC A;  3C7J A;  1FBQ A;  3PL8 A;  2IJL A;  5HLG A;  5M5X J;  3GTM J;  1X4P A;  4CDG A;  1SVM A;  4YFX F;  2ETH A;  5DTD A;  3SZT A;  2DOA A;  3RCO A;  1VZ0 A;  3WTS C;  3CC7 I;  1NK2 P;  1MSE C;  5IOY A;  5C3E J;  2M7A A;  2QYO A;  2XF6 A;  4WXC A;  4M6Y A;  3KLO A;  1Z3Y A;  4CO8 A;  2M2E A;  3JRC A;  4ENJ A;  2VBX A;  4LG3 A;  4LG0 A;  3CME I;  2XGD A;  4YIF A;  4L0Z B;  1FOK A;  5EG0 A;  4Y13 A;  3JRH A;  3CC2 I;  2OUM A;  4GXO A;  5K7H A;  2P7C B;  3R6S A;  2IGK A;  3FKI J;  1RC9 A;  1Z6R A;  4UUS A;  5J4Y A;  1WJB A;  4PZJ A;  1YFH A;  4S04 A;  1R9T J;  1V55 H;  2D1V A;  5F1J A;  5DM6 F;  3HGG A;  4HNU A;  3UR3 C;  4B8X A;  2QGU A;  4G6D A;  1R22 A;  2EBI A;  1ZHF A;  4DBQ A;  2X6O A;  2RQQ A;  3W2W A;  1XX5 A;  3LST A;  4EM0 B;  3RI4 A;  3PUF A;  3BQY A;  3KEY A;  5BPI A;  3P7N A;  2CFX A;  1W36 D;  1TQI A;  1K6O A;  3VFZ A;  2FE3 A;  5D6E A;  1G59 A;  4DIQ A;  5DEQ A;  3FHZ A;  4AM3 A;  2XHK A;  2GXA A;  4D5F A;  5LRS A;  4BQA A;  2V6E A;  4L18 B;  2RQP A;  2LG4 A;  2DMU A;  2UZK A;  2R4G A;  1HDP A;  2V7F A;  3CCU I;  3HTS B;  4TV7 A;  3FXQ A;  4ZTJ A;  2B0L A;  2QBY A;  3H9J A;  3E97 A;  4XLA A;  1MMN A;  1QNT A;  2IA1 A;  1XGS A;  5FD6 A;  5CVI A;  2RDP A;  2ZFU A;  4XLH A;  2VBY A;  2KQR A;  2NYX A;  2EFP A;  4HW0 A;  3WU2 C;  3T8R A;  1W4M A;  1RRJ A;  4G7H F;  3WU1 B;  1WSU A;  4KIG A;  1IDY A;  4CCK A;  4JX5 A;  1LE8 A;  2XVC A;  1DP7 P;  5GAD J;  1X19 A;  3ESW B;  5F0H A;  1Z67 A;  1Y1W J;  2V79 A;  2WAQ N;  3ERM A;  5HLI A;  1A04 A;  4AC0 A;  3OSF A;  2LMD A;  4F93 B;  1I39 A;  2R7Z J;  1HCR A;  2AS5 F;  2LY1 A;  1TQP A;  1S5L C;  4NUB A;  1B9M A;  2ZO4 A;  1O57 A;  3R61 A;  3BG5 A;  1YOV B;  1CF7 A;  2JMW A;  1N78 A;  2VT3 A;  3F23 A;  1J7K A;  2LSO A;  1LQ1 A;  3H5R A;  4YEJ A;  1A36 A;  1XSX A;  3CP2 A;  2WA0 A;  3TL4 X;  3CQZ J;  3F22 A;  2CW7 A;  2PJR A;  3OSG A;  1JI8 A;  2OCE A;  3K4C A;  4BYY A;  4BE2 A;  4G8X A;  4UXN A;  3ZQG A;  4OAZ A;  3MKW B;  1WJE A;  1Z1D A;  3CCV I;  4BY1 J;  3V8K A;  4LB6 B;  2KDZ A;  4IHY A;  3S2D J;  3A01 B;  1S7E A;  3S8P A;  3V4G A;  2L7Z A;  4CCL A;  4E6K G;  3J80 K;  4KFC A;  1ZRC A;  2UV1 A;  3DPU A;  1W5S A;  5AIP A;  3TW7 A;  3OYM A;  4NHJ A;  1R4M B;  4R79 A;  3H92 A;  3GZ5 A;  2VE8 A;  1T0F A;  2F4M B;  3ZMZ A;  2LK2 A;  4PSW A;  1IGN A;  2ZC2 A;  3BDD A;  3WG7 H;  1SFE A;  2N8G A;  4NC8 A;  2MC3 A;  1S3J A;  4HV5 A;  3ABT A;  4HBL A;  4GDF A;  1LUJ B;  3WTU C;  1E2X A;  1W7P A;  3GLX A;  4I0B A;  4AIH A;  2JRM A;  2DYS H;  1I6X A;  2QF7 A;  2XPW A;  4OIO F;  3MFK A;  3HSE A;  3QU6 A;  3OYG A;  1RUO A;  3B73 A;  2PBI A;  1MNM C;  3OYF A;  3IH3 A;  3K4K A;  2CH0 A;  4I01 A;  5KCM A;  3RTR A;  3S93 A;  4EJU A;  1VQL I;  4B3X A;  1ON2 A;  3J81 K;  2M7B A;  1E3H A;  1GV5 A;  5HLH A;  4J00 A;  2A5Y B;  1QZZ A;  3KP2 A;  1KU3 A;  1RZ4 A;  2E36 A;  1WI9 A;  2K4J A;  3TO6 A;  2JPC A;  4Y3O A;  2XKP A;  3BR0 A;  2YU3 A;  1YTY A;  2FQ3 A;  4KMF A;  3RPQ A;  2E35 A;  4KYW A;  3GTP J;  4KIF A;  4PJ0 C;  4KNY A;  3SJM A;  3KET A;  1IN7 A;  5BPD A;  2VIX A;  4EMS A;  1REP C;  3JW4 A;  2DAO A;  2FNP A;  1JKR C;  2STT A;  2CS3 A;  3T1B A;  2CFO A;  3LQR A;  5HOD A;  1MBE A;  3WGG A;  2OAZ A;  3OV8 A;  3RKY A;  1K4S A;  2AHQ A;  2OC6 A;  3MQ0 A;  3CUQ B;  1W0T A;  2ISZ A;  4HQM A;  5EGO A;  2GZW A;  1FSE A;  3GME A;  2WAE A;  4NNJ A;  4ZJZ A;  1OKR A;  1XDU A;  3KFW X;  5FJ8 J;  3H9G A;  2EPF A;  4YEL A;  4QTR A;  3BPV A;  1OR7 C;  1T0F C;  1WH5 A;  4LIV A;  1HC8 A;  2M4G A;  3ELK A;  1G3T A;  5CQG A;  4JX6 A;  4PJL A;  1I27 A;  2CUE A;  2WB1 A;  4LK0 F;  3FXO A;  3OL4 A;  5FKO A;  3FXM A;  1G3W A;  4RA2 A;  3FXK A;  1FWZ A;  3DCF A;  2VC0 A;  2K40 A;  2IA2 A;  1FIP A;  1L0O C;  3IWZ A;  3VB2 A;  2IT0 A;  2MD5 A;  1LEB A;  3P9I A;  3VPR A;  3FBN B;  4XM3 A;  1GLN A;  4FQG A;  4KMU X;  4KUM A;  3ZQI A;  1Y56 A;  3CMM A;  4YIR X;  3A1Y A;  4XOT A;  4IZZ A;  3FM5 A;  3HC7 A;  1ZN2 A;  2ICW G;  3ZRG A;  4PK4 A;  3WE3 A;  2DU9 A;  2XV4 S;  1ITY A;  3D0S A;  5EYR A;  2NOJ B;  2FMY A;  1KU7 A;  1U9N A;  3HOS A;  3Q9S A;  4DBR A;  4A6D A;  4E7I A;  1DGR M;  4E7Z A;  4H4K C;  1SAX A;  4HF1 A;  3V7C A;  3IRQ A;  1OYI A;  1SFO J;  3JRD A;  2NVX J;  2VL8 A;  2DBB A;  1UST A;  4G7Z F;  2XB5 A;  3OIQ A;  5H6Q A;  4Q4Z F;  3FM3 A;  1FY7 A;  3GTG J;  2O0Y A;  1R58 A;  2QUF A;  3NEU A;  4RS8 A;  2DDA A;  2I8D A;  2DYR H;  3WTY C;  3W6K B;  5EEA A;  4OMZ A;  3LA3 A;  3DKW A;  1B72 A;  1IAW A;  3PNY A;  4XSX F;  2DQL A;  3HYI A;  2XRL A;  3H9Q A;  2KRH A;  3F21 A;  3I55 I;  4JK1 X;  3GEZ A;  2LF8 A;  3PO3 J;  4I02 A;  2HDC A;  2HYG D;  2RN7 A;  5KAI C;  1SD7 A;  2Q2E B;  4M73 A;  1RR7 A;  4XK4 A;  2VON A;  4KA4 A;  1MKM A;  1EV7 A;  3IH2 A;  2PMU A;  3BTI A;  1JKP C;  5K1Y A;  1STZ A;  5FD5 A;  1UG0 A;  5L3B A;  1Q1V A;  4BQO A;  5LD2 C;  5JLX A;  4EEF G;  2X6W A;  2IS1 A;  2JQ7 A;  1D1A A;  3ONQ A;  2JWT A;  3NAR A;  3OWT A;  2RAE A;  5FKK A;  4Y52 J;  4HSR A;  4RMN A;  2EIK H;  3HJE A;  2EH3 A;  1KQ9 A;  3J7Y J;  1WRJ A;  2QQ8 A;  3CJQ B;  3JAM K;  2O3F A;  3ABK H;  4BU2 A;  2PG4 A;  3ECO A;  4BQQ A;  3RYR A;  3IAS 2;  4A93 J;  1YLF A;  3E5X A;  1Z6T A;  4ENN A;  4L5J A;  5C4J J;  2IS6 A;  1QU3 A;  4RAF A;  4HRI A;  1U5T C;  2DOD A;  1GUU A;  3DEE A;  2P81 A;  3GVA A;  1VND A;  5EF6 A;  2XSD C;  3FZV A;  2BXZ A;  2X48 A;  2GLO A;  4CA0 A;  1JTX A;  3PQK A;  3E5U A;  4BKX A;  2VQC A;  2NVY J;  4C30 A;  1YRN A;  5F08 A;  2HS5 A;  2WBM A;  3VYS B;  3DLL F;  3L2V A;  1W5T A;  3QU3 A;  2IS2 A;  2DDB A;  3K1P A;  4D1Q A;  5KHD A;  5LBQ A;  2LY2 A;  3V8J A;  5D5U B;  1U8R A;  1P9Q C;  4FT8 A;  3TW6 A;  2GXG A;  2F4I A;  4NC7 A;  4B47 A;  1SFK A;  2LH9 A;  1XB4 A;  4HF0 A;  3CCS I;  1VI0 A;  4LLN A;  3S2H J;  1H89 C;  4FAS D;  2X9D A;  2LBF B;  3HKZ A;  4I09 A;  2XPV A;  1W7P D;  3FHN A;  5L3F A;  1LFB A;  2EZL A;  5K5R A;  1YYV A;  2CQX A;  2BHZ A;  5ILS A;  2WTE A;  3P5J A;  3OY9 A;  3IP4 B;  2O8X A;  2BW3 B;  2EIM H;  3IUO A;  4Y4R A;  2FEZ A;  2WY7 Q;  4AID A;  3OS0 A;  2L02 A;  3IHU A;  2NVQ J;  1ZAR A;  2PMZ N;  3ZQH A;  4II3 A;  2VUM J;  2DOF A;  2CWE A;  3O6B B;  5M3M J;  3JRA A;  2QQA A;  2B9S A;  3AFH A;  1FYL A;  2F5F A;  2CQN A;  5A2Q K;  3GFL A;  2HFH A;  1D3Y A;  3HEF A;  3W2A A;  1UAA A;  2A6H F;  5IOZ A;  1K78 B;  4A6E A;  3FK6 A;  1M1E B;  1YW9 A;  2A05 A;  3BC8 A;  2K02 A;  4HQE A;  1AKH B;  4QSH A;  1R1T A;  4MHG A;  4RM2 A;  1I5Z A;  1U9O A;  1Z0X A;  3HPG A;  2BY0 A;  2WAQ A;  3BTJ A;  2GXB A;  5FB2 A;  3OYA A;  1WPK A;  2KJC A;  1ZG3 A;  2Y2Z A;  4PFO A;  5D5V B;  4YFN F;  3H0G J;  3N4M A;  2WC2 A;  3QPL A;  2ZXW H;  2DJI A;  4M9S A;  1FYK A;  4Q47 A;  2LNB A;  2MC4 A;  1I6H J;  2XAG A;  1H8A C;  2VXD A;  2IVM A;  3HM5 A;  2VB6 A;  5DS9 A;  3BG3 A;  2BY2 A;  1TW3 A;  2CUZ A;  4EM1 A;  3QYB A;  2HKX A;  3H35 A;  1TBX A;  4LG0 B;  2QVO A;  3K2Z A;  1HLV A;  1J09 A;  3M3Y J;  3ZQC A;  5EG0 B;  2E2I J;  4KIB A;  4M74 A;  1EJ9 A;  1ZRE A;  2EFO A;  1D8J A;  3JTH A;  1WWX A;  2I5U A;  4DQ2 A;  4UUS B;  2A6T A;  5AIQ A;  1I50 J;  4AIK A;  4JP0 A;  4CZC A;  1YJN I;  1MH3 A;  3DU6 A;  3KLN A;  4I7H A;  2IXS A;  1GT0 C;  2NS0 A;  3H0D A;  3IV5 A;  1MMD A;  4L9V A;  2K3F A;  1OCR H;  3EQL F;  4O6J A;  2E2J J;  5LEK A;  5HOO A;  1D0Z A;  2BHY A;  2QSF X;  4O5V A;  2XRO A;  1AA7 A;  1AWC A;  3BRO A;  5E79 C;  2Y69 H;  1YX5 A;  3V7R A;  4E7K A;  1NHA A;  1OIS A;  2Z33 A;  4J01 A;  3LFK A;  4UV8 A;  2R7U A;  1NK3 P;  3K4J A;  4DYR A;  1N75 A;  4XLE A;  2JVH A;  4A3L J;  3DQV C;  2M0C A;  1DPU A;  2GQQ A;  2R3S A;  4NB5 A;  2O8K A;  1SEU A;  2QBY B;  2P0W A;  2FUG 2;  1D5V A;  1K6Y A;  3ZP5 A;  3CJN A;  1QO0 D;  1IZ1 A;  2LOO A;  5KK1 A;  2K7L A;  3HIF A;  2HOS A;  1JTY A;  3WHB A;  3CMY A;  2DQR A;  1QHG A;  2DO7 A;  4GCV A;  3FMR A;  3LQQ A;  3MN2 A;  1IN6 A;  2OJE D;  1P4X A;  2DA6 A;  1X1C A;  2XF7 A;  3E0J B;  4BHP A;  2EK5 A;  1LE8 B;  2V9K A;  5CVU A;  2VOO A;  2DXI A;  1IRF A;  2Q2E A;  3ZXS A;  4P9U A;  1HOM A;  3SXY A;  3K70 D;  4QIW N;  1BM9 A;  4BBR J;  2A6E F;  4DJA A;  2KLO A;  4F92 B;  3HSF A;  3BY6 A;  1CF7 B;  3GF2 A;  4HST A;  5CVR A;  4N4O B;  3K69 A;  3VYR B;  4CHU A;  2VJI A;  5K5Q A;  5JR3 A;  2PLY A;  4YII A;  2HGC A;  2V1X A;  1T95 A;  2PJR B;  3M8F A;  2Y9Y A;  1SAN A;  5KNL A;  1J9I A;  1ZRD A;  2HWV A;  2EIJ H;  2IGN A;  2Z99 A;  2O9L A;  1ZQ3 P;  3E7L A;  2V1U A;  3RQ4 A;  2LY9 A;  3JRF A;  4ZDO A;  1GVJ A;  3RZO J;  2MLG A;  2H1L A;  2F5C A;  3AG2 H;  4ZYG A;  1YS6 A;  3B02 A;  2LRD A;  1YJW I;  1IUY A;  2BXY A;  1TT5 B;  4P96 A;  4XKC A;  4N9I A;  3GZ6 A;  4A69 C;  4WF2 A;  1MMG A;  1ODD A;  1OYY A;  2MFZ A;  1JT0 A;  3MMY B;  5CVV A;  2V26 A;  2E1N A;  3QPS A;  4M71 A;  1QBJ A;  1JE8 A;  1QRY A;  5IP7 J;  3S1M J;  3EUH A;  3LFU A;  2LBF A;  5FKL A;  4YG2 F;  3F3X A;  3MVP A;  3WGI A;  2L9R A;  2JA7 J;  3J7A Y;  2W82 A;  1G4D A;  2VQH A;  3BG9 A;  1A6Q A;  3OYD A;  4GFB A;  1FYM A;  4OIR F;  3KEO A;  4XN3 A;  4AVP A;  3PSF A;  1MBK A;  4ENM A;  2CGP A;  2GA2 A;  1JUP A;  1ERD A;  3CES A;  3ZMS A;  2QLZ A;  1FTZ A;  2KJB A;  1XN7 A;  3FK7 A;  1FOX A;  3OYL A;  3LAP A;  4EJO A;  2XRN A;  4RLF A;  1P7I A;  2COM A;  4BH9 A;  4XLP F;  2XAJ A;  1XGN A;  2ECB A;  2WY8 Q;  1Y39 A;  1ACI A;  2X85 A;  4CCN A;  4Y7N J;  5J8F A;  2VPR A;  5C44 J;  1IO2 A;  2B63 J;  4XKB A;  3OS2 A;  5BNG A;  1VQ5 I;  4DYQ A;  4B43 A;  5J8C A;  5EEG A;  2IRF G;  3IL2 A;  3WTV C;  2MYS A;  3RDI A;  5EGO B;  5HS9 A;  2K86 A;  1NTC A;  1OFC X;  3S1N J;  1PP8 F;  2TRT A;  1GXP A;  1KQ8 A;  4XRS G;  3O3K A;  3L2C A;  5D5X B;  1ZRF A;  5HVQ C;  2R5Z A;  2Z3Y A;  2MG4 A;  3EYY A;  2STW A;  2CW8 A;  5IP6 A;  2L9S A;  5F0F A;  4DZJ A;  1OQY A;  4JBA A;  2W84 A;  2OZU A;  3JR9 A;  4F7Z A;  1BR2 A;  5CVJ A;  4GO1 A;  3KZZ A;  2EJR A;  5F27 A;  4OAY A;  2GWR A;  4LGW A;  2H6C A;  4RLQ A;  2QQ9 A;  5F6F A;  3HOV J;  2LFB A;  2PN6 A;  3RIR A;  2G0E A;  1X1P A;  2NVU B;  3UNG C;  1FOW A;  4IPA A;  1QVU A;  1WVR A;  3EUH C;  2A07 F;  2VPL A;  3NQO A;  1WJF A;  1BOB A;  3HL2 A;  5FLX K;  3H3V K;  4CGZ A;  2NNY A;  3SHF A;  2HQ5 A;  1YI2 I;  1OCC H;  1NG6 A;  1XCB A;  4IKF A;  1OLT A;  4RDU A;  2Y48 A;  2VOP A;  1I3Q J;  1TWG J;  2EQR A;  3G71 I;  1PP7 U;  4C3I J;  4DNC A;  4B44 A;  3WE2 A;  3BOQ A;  1OYW A;  4FE7 A;  2YX7 A;  4KT6 A;  1R5G A;  2W1O A;  2QWW A;  1J2X A;  1KA8 A;  2DTZ A;  4L9T A;  2KIM A;  1G3S A;  3CCE I;  1B72 B;  2KPM A;  1YW8 A;  2E2H J;  2PMZ A;  1D8K A;  3RKX A;  5ICG A;  4ESB A;  5K7Z A;  1BI1 A;  3FDY A;  5EDN A;  4BHB A;  3CC4 I;  1P4W A;  2Y0M A;  3GUD A;  4C2U A;  2HVS A;  2H8R A;  2IS4 A;  1XMA A;  3LA7 A;  1WH7 A;  3H3Z A;  3IRR A;  3G3Z A;  2Z16 A;  4XRF A;  2VT2 A;  1K83 J;  3NWS A;  4HEA 2;  1HKQ A;  2W25 A;  4HG2 A;  4HYE A;  3J7A O;  2ID6 A;  2QSH X;  3WU0 A;  5F04 A;  3DEW A;  5FRO A;  3DKY A;  1KQ0 A;  2K5C A;  3R60 A;  5E3L A;  1IW7 F;  4D7M A;  1J0R A;  1FTT A;  5TJJ A;  3CDL A;  5IP9 J;  1LVK A;  5IY5 H;  4QLC U;  3OYN A;  5FLV A;  1TW2 A;  2XAQ A;  1LEA A;  1X2M A;  1JT6 A;  2Y9Z A;  3HOX J;  2O03 A;  2VE9 A;  3ERE D;  2KRF A;  3WTX C;  1IF1 A;  1J5Y A;  3QQA A;  3ULQ B;  3S3M A;  3G6E I;  3HUG A;  3KP4 A;  2MH2 A;  5DD4 A;  1ORK A;  4P1W A;  2EZI A;  4XQF A;  3CP8 A;  5FFZ A;  2L7F P;  4E70 A;  4G7O F;  3FWE A;  2CUJ A;  2V1N A;  2LTP A;  1YRN B;  1RI7 A;  3GXO A;  1UZC A;  2H6B A;  3CJR B;  4XN0 A;  2VQL A;  1XSV A;  2VKD A;  1ONV A;  4LJZ F;  3HRM A;  4A5N A;  2F5V A;  1UEL B;  3W3C A;  2W24 A;  4LD5 A;  4M3F A;  1OR7 A;  2QCO A;  1UJ8 A;  3F72 A;  2ISY A;  1X2N A;  3ZQL A;  3FXR A;  2CQK A;  2CV0 A;  2F2E A;  3CTA A;  1P2F A;  3CCL I;  2DI3 A;  2E1M C;  2XGE A;  4BJ6 C;  2XPU A;  2BY3 A;  2DA2 A;  3O8G A;  4EJT A;  2EFW A;  3D5S C;  3VOE A;  2DA1 A;  4MFE A;  3SFI A;  2X0L A;  5E8G A;  5FFX A;  2K9M A;  4CIC A;  2LYC A;  1BI3 A;  2L4M A;  5B1B H;  4RAG A;  1BN5 A;  2H8W A;  4DGW B;  2FU4 A;  2MA3 A;  5FO5 A;  1EA3 A;  2EV5 A;  1H9G A;  3C2B A;  1FT9 A;  4A3F J;  4E7S A;  2DMQ A;  1FBU A;  2Q0O A;  1TWA J;  1SFU A;  3HDD A;  1T38 A;  4IHV A;  1DQU A;  1XD7 A;  3ROU A;  1LFP A;  4BY7 J;  4I99 C;  5GPC A;  2XF5 A;  2E19 A;  2ELJ A;  4ETS A;  5GPA A;  1SD6 A;  5E18 F;  3WG9 A;  1KON A;  2JK3 A;  1WZ2 A;  2LC2 A;  3BZK A;  4ZDP A;  3DPT A;  1FLI A;  5LHI A;  3I71 A;  3CO7 C;  1K7A A;  2O7O A;  3L2Q A;  3PJR A;  2E34 A;  2CMP A;  1XMK A;  1UMQ A;  3F6O A;  4K2E A;  4QWQ A;  4PFP A;  2OQR A;  2BE5 F;  5KVR A;  1TLH B;  2HZD A;  4RBO A;  4R1H A;  2K9L A;  1S29 A;  2FF4 A;  1LFU P;  1ZH5 A;  3RPU D;  3ZQF A;  1LKX A;  2P4W A;  1ZLK A;  4I6Z A;  1RET A;  2CV1 A;  2D5V A;  2CUF A;  3LOC A;  4OIQ F;  2LKS A;  1IUF A;  2W48 A;  2MSY A;  3BTL A;  4G6Q A;  1O3Q A;  2FML A;  2RRE A;  3ABM H;  3M1E A;  2YX4 A;  2HQR A;  3CCR I;  2M1B A;  1BIB A;  3HOZ J;  4A3B J;  1O3S A;  4Q5S F;  2HXI A;  2FSW A;  3V42 A;  5IYB J;  1EF4 A;  1R71 A;  2W00 A;  3M8J A;  4M72 A;  2EA4 A;  2OF7 A;  3OR1 C;  3T5X A;  3HOT A;  2JA2 A;  3B6A A;  4L0Y B;  2DA7 A;  4AYB N;  4HOB A;  3PO2 J;  5EZG A;  2Z5U A;  4PJJ A;  1B6A A;  2R92 J;  2ID3 A;  1VQN I;  1QQI A;  3KPH A;  2HYF A;  1IRZ A;  4DYC A;  3ASO H;  3S32 A;  4G9Y A;  3FXU A;  3VYT B;  1U5T A;  2A3S A;  3HTU A;  2R5Y A;  2EWN A;  4M3B A;  4UVC A;  4BQN A;  5K7F A;  1XC5 A;  4Z2Y A;  4BGD A;  3V7S A;  1Z77 A;  3DBH B;  2A68 F;  5IT9 K;  3BJO A;  2ADU A;  2XAF A;  2DT6 A;  1X4O A;  5L3G A;  4WWC A;  3BPX A;  3TQN A;  3U21 A;  3MZ8 A;  4I76 A;  3TDZ C;  1VQ6 I;  1WGX A;  1WQ2 A;  3L2U A;  4OWR B;  2M0M A;  1VF9 A;  4Q48 A;  1FC3 A;  3LAJ A;  4HZF A;  4BAC A;  4XOP A;  1QPM A;  3Q3S A;  2WV0 A;  3QAH A;  2R7D A;  2R7R A;  2ZKZ A;  5HNH A;  3JSP A;  2ESH A;  4ON0 A;  3FXL A;  5FKM A;  4RGS A;  3I5U A;  3CCY A;  2DK8 A;  4CYD A;  3LNQ A;  5LHH A;  1G6N A;  1F1Z A;  3GYH X;  4MGR A;  2VBW A;  1Z21 A;  3IC7 A;  3AAF A;  4C2T A;  3E6M A;  1HA8 A;  1KGS A;  3TO9 A;  4XKW A;  1U3E M;  1E17 A;  4N9H A;  2Y0S A;  1YE9 A;  1ZR2 A;  2V9P A;  1XDS A;  1IXR C;  3M9A A;  2R93 J;  3M1C A;  1OCP A;  4KDP A;  3HZJ A;  3HXL A;  4XON A;  3FBI B;  4NDL A;  3MKL A;  3K4L A;  1WI3 A;  4X6A J;  1QZY A;  1YO5 C;  4D5C A;  3L2R A;  1AHD P;  2YU9 J;  1YJ9 I;  1SFX A;  4XBF A;  2KP6 A;  4HX8 A;  1Y8R B;  3E3V A;  2VBZ A;  3U2R A;  2G9W A;  3BCB A;  1Y8Q B;  3CDH A;  3Q0U A;  1VQ8 I;  5J6X A;  4MTE A;  2Y75 A;  3I59 A;  1BR4 A;  1XS9 A;  1VQO I;  1IJW C;  3CDI A;  4RGR A;  4D0P A;  1PVE A;  2E60 A;  5D5W B;  3BT9 A;  3PUB A;  2XC7 A;  4A5M A;  2VN2 A;  2NVT J;  2EZK A;  2QQB A;  3NWT A;  5C4X J;  1ETW A;  3OYE A;  4PJM A;  2A5W A;  2P7V B;  1XMX A;  1KYW A;  2W57 A;  1P92 A;  1TNS A;  2EB7 A;  1FMW A;  2AQF A;  3CJT B;  2OV7 A;  2HYJ A;  1KZH A;  5H20 A;  4M6X A;  4ZYA A;  5M3F J;  2L0K A;  2BZT A;  3S15 J;  1ZG1 A;  4LFU A;  5J1U A;  1B9N A;  4N0B A;  2IBD A;  4ZZL A;  4MEY F;  2KIF A;  1ZYR F;  3F6V A;  4L5I A;  2HOA A;  2ZNY A;  5D4S A;  3C2G A;  3QOP A;  2ZNZ A;  4X1E A;  1IV8 A;  1MND A;  3E6D A;  1MBH A;  1ULY A;  3TDU C;  2HOT A;  2XGX A;  1A5J A;  1ZGJ A;  4ENK A;  2EIN H;  5LGN A;  1OCT C;  1IRX A;  1X58 A;  4IVN A;  4A2U A;  2UXX A;  3OYK A;  4C9Y A;  3GTQ J;  2PEX A;  1R1V A;  3QWL A;  3DU5 A;  3EUA A;  1FIA A;  4IRG A;  1D0X A;  1Q1H A;  2PX9 A;  4ZYH A;  2PMH A;  4PGH A;  3J80 Z;  2KKO A;  2Z9O A;  1F5T A;  1ETX A;  1P7J A;  1X1B A;  1QGP A;  3LA2 A;  4OIP F;  3F8M A;  3W2V A;  2HU9 A;  1GDT A;  4IQ4 A;  3EPZ A;  3QYF A;  1G3Y A;  3DXJ F;  2YSR A;  4XIC A;  3I58 A;  3PNV A;  5JFR A;  5FKN A;  3LSP A;  4FE4 A;  1IRG A;  1ZAO A;  4J19 A;  1MW7 A;  3H36 A;  2JRT A;  2R5Z B;  5F1R A;  4HV6 A;  2HVQ A;  4AIJ A;  3GZN B;  2KIU A;  2ZB9 A;  5JI6 A;  3KYC B;  2PQ8 A;  3ZMT A;  1U8B A;  4MQ9 F;  2WV1 A;  1BA5 A;  4V2F A;  4HPQ A;  5CKT A;  2JT1 A;  3HGY A;  5IPA A;  3J81 Z;  4E7H A;  4KIS A;  4MNU A;  4CYC A;  2E7W A;  3KIO A;  4MO7 A;  1V4R A;  1PJR A;  2LP0 A;  2ZCW A;  2OD5 A;  1DU0 A;  3Q0V A;  2GIV A;  1KU9 A;  2X6X A;  3C3W A;  2DJN A;  3T0Y A;  3BR3 A;  2KMU A;  2OBP A;  1BR1 A;  4BDY A;  4U7D A;  3S2W A;  1VQP I;  2DLL A;  3H5A A;  3FF5 A;  4BL0 B;  2AQE A;  3M4O J;  1IXS B;  2Y31 A;  1FOY A;  2V9V A;  3DKX A;  3HBL A;  4BXU A;  1HW2 A;  3SZP A;  3HPH A;  1T6S A;  1V5E A;  4XLC A;  1H88 C;  2DFI A;  3S1Q J;  2R7V A;  3IKV A;  2QM3 A;  2K3P A;  4I2O A;  1HW1 A;  2LRE A;  2EIL H;  3MEX A;  3W6J B;  1TL8 A;  1MMA A;  2LR8 A;  2KDO A;  2P5K A;  3DPL C;  3HSR A;  2K4B A;  2ZXI A;  3LSJ A;  1SD5 A;  5B3S H;  4MIM A;  3OL3 A;  2LF7 A;  3PFY A;  4PGG A;  5J47 A;  4Y33 A;  2ZJR F;  3EUK L;  1O4X A;  4HAM A;  1XTA A;  5J1R A;  1RUN A;  2H1K A;  1ETY A;  1UHW A;  3ZCO A;  2ZME A;  1PYV A;  2BYV E;  3HRT A;  6PAX A;  3REO A;  1FX7 A;  5EJC A;  2H09 A;  2DMT A;  3RKQ A;  3JRE A;  4ESJ A;  1YG2 A;  1BI2 A;  1QZE A;  2E1O A;  2HXO A;  2GBY A;  2M45 A;  1YX3 A;  2NAZ A;  3ML6 A;  1JGS A;  1SVO A;  2QKM B;  2BY1 A;  2TCT A;  2LVS A;  4DZP A;  2DPD A;  2QEN A;  1Z91 A;  4IHX A;  4XR6 A;  3ZMD A;  1DP3 A;  2ZJ2 A;  2F6C A;  3EDP A;  2HQN A;  5DYM A;  5E20 A;  3RJP A;  3SDG A;  3HUG B;  5ICE A;  3QP6 A;  3FIS A;  4ZYD A;  1O7F A;  3BR6 A;  3FMS A;  4LOC A;  3D5R C;  4MLO A;  1FMV A;  1XGO A;  2X4H A;  1LPQ A;  2HVR A;  3K9T A;  1YW7 A;  2DK5 A;  1F4K A;  3QOD A;  1DPR A;  3KCC A;  4CUG A;  1YIJ I;  5LGT A;  3WTZ A;  5FLM J;  1VQM I;  1I1G A;  5J3L A;  5LLQ A;  1V54 H;  3HG9 A;  3F9K A;  4AYB A;  1EKE A;  5BQT A;  5E3N A;  3CCQ I;  2CQ7 A;  1MMS A;  4KN7 X;  4Z6Y A;  2OPT A;  4BEH A;  2UXN A;  2QEX I;  1XPX A;  3WOD F;  1R23 A;  2EV6 A;  1AOY A;  1WFX A;  1HBX G;  2XAS A;  3GTK J;  3FX3 A;  4UB8 C;  3ZQ7 A;  3LSR A;  5FRN A;  1MBG A;  1JKQ C;  2DT7 B;  3QRF F;  2WB1 N;  3I4P A;  3M8E A;  1PUE E;  4M3G A;  2XIG A;  4CH7 A;  1OCO H;  1V3F A;  5DCF A;  2HTJ A;  2L01 A;  4CZZ A;  2YS9 A;  5TGT A;  5HNF A;  1WJD A;  2X51 A;  5L3C A;  3JAM Z;  2ZME C;  3ZR8 X;  3WTW C;  2Z1D A;  2K9Q A;  4S0H B;  5KAF C;  1IN5 A;  2W7N A;  5E17 F;  1W36 C;  2C6Y A;  4X0G A;  3KX2 A;  1T33 A;  4HF2 A;  3GWZ A;  2VQG A;  2P6S A;  3N05 A;  1S8N A;  2KHM A;  3FIW A;  3LL7 A;  2EV0 A;  1X3W B;  3OR2 C;  1QPI A;  5LEJ A;  2IA0 A;  1U2W A;  2X6Y A;  2KRC A;  2V4J C;  3TED A;  1Z05 A;  2CRG A;  1MDM A;  2JA8 J;  2M9H A;  4C3H J;  2P5V A;  3FKJ A;  1JHH A;  1IN8 A;  4WXH A;  3K10 A;  3K1M A;  4BDZ A;  2GA1 A;  4PCQ A;  2ZJP F;  1T56 A;  2FJ1 A;  3BZC A;  4HLY A;  3OYJ A;  4UNO A;  2GOX B;  1ETO A;  1NG7 A;  2FBH A;  4N4N B;  2JN6 A;  3B6C A;  2M8G X;  1S6L A;  2G7U A;  1TTY A;  5DV5 A;  2FNA A;  4DOZ A;  5J4V A;  4A3K J;  3MCZ A;  1CQT A;  4O3M A;  3O8H A;  4G94 A;  1D0Y A;  2F5D A;  1Z7U A;  1BW6 A;  2R7O A;  2CSO A;  3A0H C;  1V5G A;  3U1K A;  3BJ6 A;  2E5N A;  2Y30 A;  4BXF A;  4V19 K;  3QYE A;  3A02 A;  1X1D A;  2DW4 A;  2O6G E;  1R00 A;  2DOE A;  3PNT A;  4XLN F;  3DLA A;  3BQZ A;  4ESF A;  2J5P A;  5A2Q Z;  2V6C A;  2VXZ A;  3MZY A;  2ME6 A;  1U6G A;  3K1N A;  2VLA A;  2E7X A;  2DMP A;  3QPH A;  3ABL H;  3MD2 A;  1MJ9 A;  4IRH A;  2L3D A;  3RSN A;  1IC8 A;  2VJJ A;  2F4O B;  2ZBK A;  2CG4 A;  2FQ4 A;  4A3M J;  1XCV A;  1JXS A;  4HA8 A;  3HOW J;  1U5T B;  1HQC A;  2FX0 A;  3OYH A;  2R5Y B;  3M07 A;  4QPQ A;  2FBI A;  2AXT C;  2M8E A;  3F8C A;  5F64 A;  4IHT A;  2FXA A;  4IHW A;  4D9J A;  3Q0W A;  1FZP B;  3W6V A;  1MD0 A;  2FRH A;  3DBL B;  1S9H A;  1J75 A;  2J5O A;  4D7N A;  1QHH D;  3CCJ I;  3N97 A;  3OS1 A;  1RPW A;  3S16 J;  4B1R A;  2L2O A;  4JYK A;  2WAD A;  1R49 A;  2KL4 A;  3PQJ A;  4M9X A;  1SD4 A;  4FX0 A;  4ASN A;  1TNT A;  4M3E A;  5FRM A;  1FSH A;  2KIQ A;  1QA6 A;  4IEJ A;  2HOE A;  2ZJQ F;  4E7J A;  3TOB A;  2LKX A;  3DP7 A;  3K4N A;  4A3G J;  2L7K A;  3KP7 A;  3BCA A;  3GLL A;  4EGZ A;  3ZMU A;  2KFD A;  2YPR A;  4XNF A;  3K4M A;  4EM2 A;  3HKZ N;  4LIU A;  1HDD C;  4UVB A;  1R1U A;  2DN0 A;  3A4C A;  1LVA A;  5DCM A;  4RAZ A;  1BOA A;  4LIT A;  1YHQ I;  4XRM A;  3SZG A;  2EFN A;  2R7F A;  1VQ9 I;  3LSM A;  5IT3 A;  4FHT A;  3I4M J;  1D1B A;  1IN4 A;  3MZH A;  4ZTF A;  3TKY A;  1UB9 A;  1T8I A;  1E3O C;  4KJZ A;  3ZMV A;  1JUM A;  3GFJ A;  4XID A;  3SEZ A;  2E5Z A;  3I59 B;  1IXC A;  1LJ9 A;  4IHS A;  5H2F C;  1W1W E;  2VJ5 A;  4R8H A;  3QOE A;  2PFB A;  2VKV A;  4NC6 A;  2UWM A;  1FNN A;  3IWF A;  4A3C J;  3ZN0 A;  2IGO A;  4ZH4 F;  3MKY B;  3OOU A;  3AKZ A;  2MLK A;  2QA4 I;  5E3M A;  1VTN C;  3O2P E;  3S3O A;  3LMM A;  4XLF A;  5LHG A;  1BC7 C;  4IJA A;  2D45 A;  1BJZ A;  3TMO A;  1H0M A;  4AWX B;  4P55 A;  2OTJ I;  2OQG A;  1R4N B;  3LSK A;  3SEQ A;  2BBY A;  3ABU A;  4PUS A;  3GBG A;  1MH4 A;  1TWF J;  1VFC A;  2JTV A;  4HX4 A;  2NRA C;  2OZ6 A;  4LLL A;  4WK8 F;  1LNW A;  2PJP A;  3VSL A;  2L7M P;  1WHU A;  4A0Z A;  3Q9V A;  2B7E A;  5EEH A;  1K79 A;  2VC1 A;  3I0T A;  4XSZ F;  3JRB A;  2R7X A;  3GFM A;  2GM4 A;  1RKW A;  4I0A A;  1L3L A;  5ERI A;  5L3D A;  3TBI A;  1XSD A;  2COB A;  2BVM A;  2K85 A;  1JKO C;  3TP3 A;  3HRU A;  1TWC J;  2JSC A;  3E1S A;  4E7L A;  1A35 A;  3EYI A;  1RIO H;  3BZ6 A;  5F0C A;  3OMY A;  5B66 C;  4HNT A;  3MKZ A;  5HDN A;  2D2W A;  1V5F A;  3OIO A;  1RES A;  1OJL A;  1HKS A;  1R5H A;  1GV2 A;  3BR5 A;  3G1O A;  2VAS A;  3K2A A;  4HX7 A;  4NBQ A;  2OU2 A;  4RM3 A;  2RV8 A;  4Y15 A;  3F8N A;  1FP1 D;  4EJW A;  2FOK A;  3TOA A;  1H9T A;  2GAU A;  3KYL A;  4WXD A;  4XL9 A;  1B8I B;  2NXN B;  3DTE A;  2A61 A;  2ME0 A;  2X1C A;  3CF5 F;  1DU6 A;  5ED4 A;  1W0U A;  1T39 A;  5GP9 A;  5GTH C;  5BMZ A;  4BE0 A;  3GO5 A;  4S05 A;  4BS9 A;  1FPQ A;  2EA2 A;  4PDK A;  1LDD A;  5GAE J;  3ECH A;  3AL0 C;  3AG3 H;  4A0Y A;  1MBJ A;  2DT5 A;  1OPC A;  1SVL A;  3DF8 A;  4GRI A;  1BW5 A;  2XDV A;  4CYC B;  1JGG A;  4FCY A;  3G1L A;  5CQE A;  4CXF A;  4NQW A;  4U88 A;  1VQ4 I;  1BJA A;  2F5E A;  2FD5 A;  4LB5 A;  1POG A;  4EVI A;  1F43 A;  1SC7 A;  2CW0 F;  2W85 A;  5JHF A;  4WX9 A;  3KEQ A;  5CPR B;  4ABZ A;  2DA4 A;  3FXJ A;  4RGX A;  4XOR A;  2ZSI B;  3HHG A;  3ZPL A;  1IG7 A;  5IYD J;  1R5I D;  2OCC H;  2R7W A;  1GVD A;  2P5L C;  1TZL A;  3G1M A;  5DM7 F;  5CJ9 A;  5IYC J;  3TGN A;  1PUF A;  1QVT A;  4Y17 A;  2VKH A;  2XB0 X;  1S72 I;  5DUK A;  5ILV A;  4I98 B;  5JHU A;  5J1Y A;  5LGU A;  2K9S A;  3RQI A;  2W4S A;  1LB2 A;  3F8B A;  5TIS C;  3CO6 C;  1ZG5 A;  3AG4 H;  3KP5 A;  4EV0 A;  4H0E A;  1I3A A;  1ZGA A;  4JOM A;  5D4R A;  2WWY A;  3V8L A;  3KZI C;  3E5Q A;  1ETQ A;  5B1A H;  5TRD A;  4U0W A;  3OYB A;  1O3R A;  2Q1Z B;  4OU0 A;  1TP4 A;  4IO9 F;  1FP2 A;  5EZH A;  3L1P A;  5E8I A;  5J40 A;  4IQJ A;  5M5Y J;  2HDD A;  2ZSH B;  2CJJ A;  3C18 A;  1MIJ A;  2K27 A;  4F3Q A;  2JA5 J;  4B09 A;  4MQV A;  3ZGK A;  3I9V 2;  2R7Q A;  1BL0 A;  2JVG A;  3D5L A;  2ZME B;  2HZT A;  3SFZ A;  2DMN A;  1ZR4 A;  2XAH A;  5DD8 A; 
#chains in the Genus database with same CATH homology
 2LP0 A;  2JMW A;  1DU0 A;  1MBK A;  1JUP A;  3Q0V A;  3HB9 A;  1FTZ A;  3CQZ J;  3HOY J;  2DJN A;  3FK7 A;  3BR3 A;  2K9N A;  3I4N J;  3OSG A;  1P7I A;  3ZQG A;  4BY1 J;  3GTJ J;  2ECB A;  2KDZ A;  2MGQ A;  4Y7N J;  4IHY A;  2VPR A;  3S2D J;  5C44 J;  3A01 B;  1S7E A;  2B63 J;  2L7Z A;  3M4O J;  4JX4 A;  5BNG A;  4DYQ A;  3TW7 A;  2Y31 A;  3HBL A;  2IEK A;  1IGN A;  2LK2 A;  5EGO B;  2MW8 A;  4A3E J;  1NTC A;  1OFC X;  3S1N J;  4AUX A;  2N8G A;  2TRT A;  1H88 C;  4XRS G;  3S1Q J;  2R5Z A;  1JJ8 C;  2MG4 A;  3IH4 A;  2I10 A;  5IP6 A;  4FTH A;  5F0F A;  4C3J J;  2LR8 A;  2XGC A;  4DZJ A;  2QF7 A;  2XPW A;  3LSJ A;  3JR9 A;  4MIM A;  3TP0 A;  1MNM C;  1WCM J;  5F27 A;  1ENH A;  3IH3 A;  1O4X A;  3S14 J;  5J1R A;  2H1K A;  1ETY A;  1G2H A;  3HOV J;  2LFB A;  4C2M J;  1GV5 A;  2G0E A;  2DMT A;  1QVU A;  3RKQ A;  3HOU J;  3JRE A;  1U78 A;  3BR0 A;  2E1O A;  2HXO A;  3H3V K;  2GBY A;  4L5E A;  4UUT A;  3GTP J;  2HQ5 A;  2TCT A;  1FEX A;  2LVS A;  4DZP A;  3SJM A;  4IHX A;  2M34 A;  3D1N I;  4RDU A;  3A01 A;  1JKR C;  1RKT A;  1TWG J;  1I3Q J;  2EQR A;  3SDG A;  5HOD A;  1MBE A;  4C3I J;  3FIS A;  4BXX J;  2AHQ A;  2JJ7 A;  3BR6 A;  4FE7 A;  4LOC A;  4MLO A;  1W0T A;  5EGO A;  1TWH J;  2DTZ A;  3BR1 A;  5FJ8 J;  1B72 B;  5FLM J;  2E2H J;  4QTR A;  2DA3 A;  5J3L A;  3JRG A;  1WH5 A;  5E3N A;  5K7Z A;  4JX6 A;  5EDN A;  2CUE A;  5FKO A;  2H8R A;  2OPT A;  2NS7 A;  2R0Q C;  3DCF A;  1WH7 A;  3RZD J;  2K40 A;  1B8I A;  1FIP A;  1K83 J;  3PM1 A;  2ID6 A;  3VPR A;  3GTK J;  3LSR A;  5F04 A;  3DEW A;  1MBG A;  1JKQ C;  2ELK A;  4G12 A;  1JJ6 C;  2WB1 N;  1UHS A;  3S17 J;  4M3G A;  4V2G A;  5E3L A;  3ZQI A;  4D7M A;  1FTT A;  3CDL A;  5IP9 J;  2YS9 A;  5FLV A;  3JRI A;  1X2M A;  1ITY A;  5EYR A;  1JT6 A;  2K9Q A;  4S0H B;  5JLW A;  3S1R J;  1U9N A;  2HI3 A;  2Y9Z A;  3HOX J;  1T33 A;  3QQA A;  1SFO J;  4A3J J;  3JRD A;  4A3I J;  2NVX J;  1ORK A;  3FIW A;  1QPI A;  2EZI A;  2XB5 A;  3GTG J;  3TED A;  2L7F P;  2CRG A;  2LLK A;  1A6I A;  2JA8 J;  2M9H A;  4C3H J;  2LTP A;  2KT0 A;  1YRN B;  5EEA A;  1B72 A;  4FIS A;  3BR2 A;  1T56 A;  2FJ1 A;  4M3D A;  2XRL A;  3ZOB A;  1ETO A;  2JN6 A;  4M3F A;  4W97 A;  3B6C A;  1FJL A;  2M8G X;  2QCO A;  3PO3 J;  3NAU A;  1ETK A;  4A3K J;  1X2N A;  3ZQL A;  1CQT A;  3O8H A;  1RR7 A;  4XK4 A;  1BW6 A;  1JUS A;  1APL C;  3IH2 A;  2XGE A;  3BTI A;  1JKP C;  2XPU A;  4MFD A;  2DA2 A;  2Y30 A;  3O8G A;  2YUS A;  1Q1V A;  1AU7 A;  5JLX A;  2DA1 A;  4MFE A;  1MSF C;  3SFI A;  4EEF G;  3A02 A;  2JWT A;  3NAR A;  4Y52 J;  2RAE A;  5FKK A;  2EH3 A;  3BQZ A;  3C2B A;  5E3O A;  2ME6 A;  4A3F J;  2DMQ A;  1TWA J;  1D5Y A;  2DMP A;  1ZGW A;  3HDD A;  4IHV A;  4A93 J;  4BBS J;  3LSG A;  5C4J J;  1IC8 A;  9ANT A;  4BY7 J;  1GUU A;  1Y1V J;  5GPC A;  2P81 A;  2FQ4 A;  1VND A;  2E19 A;  4A3M J;  5EF6 A;  5GPA A;  2XSD C;  3HOW J;  2FX0 A;  2JK3 A;  2X48 A;  2R5Y B;  2GLO A;  1IDZ A;  3GTO J;  1JTX A;  4BKX A;  2NVY J;  4IHW A;  3A03 A;  1YRN A;  5F08 A;  2EZH A;  3Q0W A;  2O7O A;  3W6V A;  4A3D J;  3GTL J;  1UMQ A;  3TW6 A;  4D7N A;  1UG2 A;  3S16 J;  1RPW A;  4B1R A;  4RBO A;  5M5W J;  1LFU P;  1VI0 A;  2NOG A;  4JYK A;  3ZQF A;  3S2H J;  4I6Z A;  1H89 C;  2X9D A;  1RET A;  2D5V A;  2CUF A;  3LOC A;  2XPV A;  1IUF A;  4M3E A;  2W48 A;  1LFB A;  2MSY A;  2EZL A;  3BTL A;  4IEJ A;  2CQX A;  2LKX A;  4A3G J;  3HOZ J;  4A3B J;  1F36 A;  2HXI A;  5IYB J;  3HKZ N;  1HDD C;  1EF4 A;  2OF7 A;  2NVQ J;  2DN0 A;  3ZQH A;  2PMZ N;  3F0C A;  2VUM J;  3B6A A;  3JRA A;  5M3M J;  2DA7 A;  3UKG A;  2AO9 A;  4AYB N;  3K7A J;  3PO2 J;  5EZG A;  4XRM A;  3HEF A;  2R92 J;  2ID3 A;  3I4M J;  5IOZ A;  2JA6 J;  1IRZ A;  2VKE A;  3FK6 A;  4DYC A;  1ZR4 A;  1E3O C;  4DW6 A;  1AKH B;  4QSH A;  1JUM A;  4M6V A;  4XID A;  2R5Y A;  4M3B A;  5K7F A;  1XC5 A;  2IAI A;  1Z77 A;  1U9O A;  1Z0X A;  3BTJ A;  1WPK A;  2VKV A;  4A3C J;  2DA5 A;  2Y2Z A;  1TC3 C;  4I76 A;  1WGX A;  3H0G J;  3OOU A;  3QPL A;  1VF9 A;  4B4C A;  5E3M A;  3Q3S A;  1I6H J;  1H8A C;  3HM5 A;  4XRS A;  5DS9 A;  3BG3 A;  5FKM A;  3LNQ A;  3CCY A;  1BJZ A;  1HLV A;  3M3Y J;  3ZQC A;  5EG0 B;  1MBF A;  2E2I J;  2CQQ A;  2VI6 A;  1ZK8 A;  4HNV A;  3GBG A;  1TWF J;  1MH4 A;  1VFC A;  1ZR2 A;  1K61 A;  3WHC A;  1HF0 A;  4UUS B;  2L7M P;  2R93 J;  2LD5 A;  1OCP A;  1I50 J;  4JP0 A;  1XG1 A;  4NDL A;  1MH3 A;  3MKL A;  1WI3 A;  3JRB A;  1GT0 C;  4X6A J;  3BTC A;  4D5C A;  3IV5 A;  2GM4 A;  1RKW A;  1AHD P;  2YU9 J;  2COB A;  2Y0S N;  4B3A A;  2CU7 A;  1JKO C;  4W1U A;  2E2J J;  3TP3 A;  1TWC J;  1AKH A;  5F0C A;  1ZTR A;  3Q0U A;  2ECC A;  3OIO A;  1RES A;  1OJL A;  1GV2 A;  3BR5 A;  3K2A A;  1ZKG A;  3G1O A;  1XS9 A;  1IJW C;  1NK3 P;  4DYR A;  1PUF B;  4A3L J;  2NS8 A;  2M0C A;  3BT9 A;  1IV6 A;  1ETV A;  2NVT J;  2EZK A;  5C4X J;  1ETW A;  5M5X J;  2O8K A;  3GTM J;  1B8I B;  5DTD A;  2ME0 A;  1DU6 A;  1NK2 P;  1MSE C;  5IOY A;  1W0U A;  4GFB A;  5C3E J;  2HOS A;  2HYJ A;  1JTY A;  3WHB A;  3JRC A;  5GP9 A;  2M2E A;  3CMY A;  5M3F J;  2L0K A;  3S15 J;  3MN2 A;  5J1U A;  2XGD A;  2IBD A;  5EG0 A;  2DA6 A;  3JRH A;  1LE8 B;  5K7H A;  3FKI J;  1MBJ A;  2HOA A;  4UUS A;  1HOM A;  1BW5 A;  4X1E A;  4CYC B;  1JGG A;  4QIW N;  4FCY A;  4BBR J;  3G1L A;  1R9T J;  1MBH A;  5F1J A;  2HOT A;  3HGG A;  2FD5 A;  1POG A;  1F43 A;  1A5J A;  2EBI A;  1OCT C;  1X58 A;  2X6O A;  3GTQ J;  4ABZ A;  2DA4 A;  3BQY A;  2Y9Y A;  1IG7 A;  1FIA A;  1SAN A;  5IYD J;  1GVD A;  3G1M A;  5IYC J;  2O9L A;  1ETX A;  3E7L A;  1P7J A;  4D5F A;  1PUF A;  1ZQ3 P;  1QVT A;  2LY9 A;  2XB0 X;  3JRF A;  2DMU A;  3RZO J;  1GDT A;  1HDP A;  5J1Y A;  4XIC A;  2K9S A;  3RQI A;  5FKN A;  3LSP A;  4FE4 A;  4J19 A;  2R5Z B;  4A69 C;  1JT0 A;  1ETQ A;  2ZB9 A;  3QPS A;  5EZH A;  3L1P A;  1U8B A;  2WV1 A;  1IDY A;  1QRY A;  5IP7 J;  3S1M J;  4V2F A;  1BA5 A;  4JX5 A;  5M5Y J;  1LE8 A;  2HDD A;  3HGY A;  5IPA A;  2CJJ A;  5FKL A;  5F0H A;  1Y1W J;  3MVP A;  2JA5 J;  2JA7 J;  2L9R A;  2WAQ N;  4AC0 A;  3OSF A;  4CYC A;  1BL0 A;  2R7Z J;  1HCR A;  2DMN A;  3BG9 A;  4MO7 A;  3BG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...