2MA3A

Nmr solution structure of the c-terminus of the minichromosome maintenance protein mcm from methanothermobacter thermautotrophicus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
88
structure length
88
Chain Sequence
GAMGETGKIDIDKVEGRTPKSERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNVSEEKVEELIRILKDKGAIFEPARGYLKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords DNA replication initiator (Cdc21/Cdc54)
publication title Structure and regulatory role of the C-terminal winged helix domain of the archaeal minichromosome maintenance complex.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 24
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ma3A00
4AIKA 5E18F 4G7HF 2G9WA 1LQ1A 2QYOA 4S05A 3BPVA 5FLXZ 3ZPLA 4OIRF 2K27A 1KU3A 4HX7A 3HOSA 2KIUA 2HKOA 4ON0A 3O3KA 2LF8A 3LQRA 5D4RA 4U0WA 3N4MA 4MNUA 2J5PA 3BPXA 3DKWA 3V7SA 4EMSA 1YIOA 1MGTA 3HRMA 4IVNA 4A5MA 2HEOA 4PZJA 3R6SA 3E6BA 4HV6A 3JW4A 4MTEA 4HLXA 4BHCA 4ZYGA 2IP2A 1FY7A 3T0YA 3SHFA 2STWA 3KP2A 4P9UA 5J8CA 3WTXC 1R5HA 3DXJF 4LG0A 3VFZA 1KU7A 3Q5FA 2DO7A 3F6VA 4I09A 1XMAA 2MH9A 1U5TA 4BQAA 4A2UA 1H9TA 5H20A 5E8IA 4EJUA 2RKHA 4HF2A 1H9GA 3JTGA 2GA2A 4XSZF 4HLYA 3CO7C 5LEKA 2JPBA 4M6YA 6PAXA 5BMZA 3C18A 3IRRA 1W7PB 1LDDA 2QWWA 1O7LA 4EJVA 2DFIA 5LHIA 3GYHX 2FRHA 5CVVA 4GGGA 2XAGA 1K79A 4EJOA 1ZGAA 2O3FA 5IT9K 3IKVA 3IRQA 4LK1F 2CWEA 3SXYA 1QGPA 5HS7A 3FXRA 5E1ZB 5BPDA 2UXNA 3GVAA 1K6OA 4M9XA 1S6LA 3LQQA 5BOXA 3TKYA 1PP7U 1BC7C 4Z2YA 2V79A 2YU3A 1YTYA 5LRRA 4KIGA 3C3WA 1XD7A 2JTVA 1IAWA 4WF2A 4OU0A 3D0SA 3E5UA 1FBQA 2HFHA 3H3ZA 5LHGA 3CJNA 4KA4A 4JK1X 5K5OA 2HS5A 1ONVA 3TO7A 4EGYA 2M30A 3JSPA 3RI4A 2FBHA 4KFCA 2EJRA 2RN7A 3I53A 4WXCA 1R1TA 3MEXA 3KLNA 5K5RA 1XCVA 3KE2A 3I4PA 3B73A 5CVUA 2VBYA 1FYKA 2C6YA 3RKXA 3RDIA 4L18B 3SFZA 3JTHA 5FB2A 3L9FA 1X3UA 4RGSA 1ZHFA 2K02A 3V8KA 2STTA 1G3TA 4ETSA 1FT9A 4IHSA 4ESBA 4Q4ZF 1RIOH 1K7AA 3KETA 4UV9A 2XAQA 4HDVA 3V4GA 3CUQA 1GHCA 1IN8A 1YW7A 3DV8A 1FYMA 4L9JA 4WXHA 4AVPA 2V1UA 1YW9A 1LEAA 1GVJA 2PEXA 1EV7A 2W25A 1ZARA 1KYZA 3FMSA 2PI0A 1KQ9A 5CLSA 5ERIA 3J80Z 2OAZA 1G4DA 1P4WA 2M45A 5DCMB 1ZAOA 1TQIA 2V6CA 3K1PA 2FSWA 3EYYA 3WTZA 2VODA 1A04A 3IWFA 2DW4A 2IT0A 2O03A 1XGNA 2G7UA 5BQTA 4UUVA 2HQNA 3WTYC 1ON1A 2EV5A 3KCCA 2A3SA 3ZMDA 1YQAA 3BOQA 3EUHA 2QUFA 1BI1A 4IF4A 2GIVA 1F9NA 5E8GA 4R8HA 2MC3A 1OYWA 4YIFA 3WU1B 3AAFA 1DPRA 1KQ0A 3R61A 2D1VA 2HTSA 1U3EM 3E3VA 1F1ZA 1BBYA 1SFXA 3R4KA 3M7GA 1MD0A 1R1VA 4KMFA 1G3YA 3TO9A 3RPQA 1K78B 2Z5UA 4DQ2A 5CJ9A 2QQ9A 4U7DA 1J7KA 2PN6A 2HWVA 3HRTA 3K1MA 3HYIA 2MLGA 2YSRA 1BI0A 3MWMA 4QWQA 1D8JA 3KZZA 2DAOA 1HW5A 4PGGA 2DPDA 2CQKA 5D6EA 3ZMVA 4B8XA 5LGTA 4OIPF 3D5LA 1R36A 4LB6B 4ENKA 3F8BA 2PQ8A 3ISPA 3ELKA 3WTVC 2BYVE 2ZO4A 3H92A 4P96A 2QBYB 2ZCWA 3KP6A 2P5KA 3DFGA 2EA2A 3LA3A 1T98A 1QO0D 2CYYA 3ULQB 1LEBA 2LDUA 2ZKZA 2VXZA 4UNOA 3DPTA 4OMYA 4R79A 1P4AA 2GA1A 4RGUA 2DU9A 4LLGF 3NQOA 4ESFA 2K4JA 4LLNA 4FT8A 3J81Z 3CUOA 3WTSC 2GQQA 1YS7A 1S8NA 3CTAA 1FOKA 2JRTA 1RUNA 2H09A 4WWCA 1FWZA 3LA7A 1LJ9A 1KYWA 1ZRDA 4IRHA 4HOBA 5E1XA 5K1YA 1LB2A 1SFUA 1D5VA 3FXUA 1P92A 4Q47A 3F8CA 1OR7A 5HS8A 3FM3A 2NS0A 3PQKA 1EH6A 3BJ6A 3TQNA 3FM5A 1O3TA 4PDKA 4RAZA 4UVCA 3K2ZA 1IN5A 1S29A 1E2XA 1WKMA 2BE5F 1AOYA 3K0LA 3GFLA 2XRNA 3F23A 4DNCA 3CLOA 1OMIA 3J7AO 5BPIA 2IPQX 2ZMEA 5EEGA 1I27A 3HRSA 2D1HA 3W6KB 2QQBA 1YFHA 1DPUA 3GF2A 3HHHA 1RNLA 3QAHA 4KMUX 2WTEA 3SQNA 1YW8A 2QENA 3WODF 2QBYA 1D3YA 1WWXA 1RI7A 2Y0MA 4JQFA 3JAMZ 4RGXA 3L7WA 2XAHA 2V9VA 2Z33A 5CVJA 2VONA 1B4AA 3M8FA 5CVIA 3ECHA 3E6MA 2GXGA 3TOBA 3WTUC 4U0VA 5FGMA 1ZREA 5F64A 1QQIA 4KUMA 1EH7A 3U9GA 2XKOA 4BXUA 3HUGA 2PG4A 1IXRC 1I1SA 3E5XA 4HF0A 1PP8F 1ZG1A 3VOEA 4N0BA 3ECOA 4Y13A 2M87A 3WGIA 3MQ0A 1P6RA 5L3DA 2Z9OA 2H94A 4L5JA 1ZG3A 3KP4A 4UVBA 3I59A 3ZN0A 4WXDA 2XVCA 3R0AA 1U78A 4BYYA 1XGOA 2NRAC 1ZYRF 5HOOA 4RS8A 4U7BA 2XUBA 5FFZA 3B02A 2DI3A 4G7OF 4L9NA 1HKSA 1T38A 2H27A 3K69A 2K4BA 4HA8A 3IHUA 4UVAA 1J9IA 2H6BA 5LGUA 4CDGA 4HF1A 3OOPA 4HX4A 4M72A 3HSEA 2A5YB 1TW2A 4GYGA 2OU2A 2YX4A 4UXNA 1QBJA 4G9YA 3WG9A 4HQMA 4Y17A 4IJAA 4LB5A 1LDKB 3QP5A 5E17F 2ZFWA 1TLHB 3G73A 2P5LC 5HVQC 1IRGA 5LRSA 4GCVA 1HSTA 2DLLA 4YIIA 3V7RA 1DP7P 5F1RA 2MA3A 1HXDA 2HZTA 4RAYA 2AS5F 1WSUA 3ZN1A 4HYEA 3V7CA 2P7VB 3CUQC 2VOPA 1ZRCA 2L3DA 3O6BB 1Z9CA 1QZYA 3KLOA 2DQRA 2R3SA 1MZBA 4RB0A 1SMTA 1FPQA 4BHPA 3L2CA 2RGVA 2M8EA 1BIAA 3LWFA 5DUKA 3BWGA 2ESNA 2K7LA 3WTTC 3W6JB 4FX0A 4RGRA 4XBFA 2O8XA 5JR3A 3RYPA 3F6OA 3NEUA 3NRVA 2FQ3A 2HGCA 3E6CC 4LJZF 1HKQA 3RJPA 4IXAA 1SD7A 3GEZA 4EGZA 1B9NA 3TDUC 3DPLC 3U1DA 4YFKF 4M73A 3FMQA 4BNCA 2JZYA 4PGHA 5HDNA 1QNTA 5JHUA 1FP1D 5D4SA 4LMYA 3P7NA 2Y48A 2VC1A 3KP3A 4KIFA 5FFXA 3TOAA 1UHWA 3Q9SA 1IRFA 2VT2A 2P6TA 2EFQA 4NHJA 1IXCA 1P2FA 1S3JA 1ZLKA 2GAUA 4G6QA 3U2RA 1IW7F 2NAZA 1WRJA 1YS6A 2M1BA 4F7ZA 4N9IA 1J0RA 1XDSA 4M71A 2LNBA 5ICEA 1JGSA 1T6SA 4I0AA 1XGSA 1YG2A 3E5QA 4MEYF 5ICCA 1E17A 1KA8A 4ZYDA 2L54A 1B1BA 4L5IA 2EB7A 3GW2A 3QPTA 3TO6A 1W7PA 2JT1A 3EDPA 4E70A 1QPMA 2QM3A 1IN4A 4G94A 1J59A 5HLHA 1RZ4A 2Y75A 1R5GA 4OIQF 4XSXF 3T8TA 2FE3A 2PMHA 4D0PA 4XLPF 2IVMA 2V1DA 2VE8A 4IRIA 4RB1A 4O6JA 4Q5SF 2FMLA 1O3RA 4MHGA 2YPRA 2DTRA 2QQAA 1W4MA 5ICFA 4ZYEA 2CGPA 2CFXA 3M1EA 3FMRA 5AONA 3F8MA 2XHKA 2ACJA 3V8LA 2P6SA 4AWXB 1F4KA 5AIPA 3REOA 1FC3A 1XMKA 2E7XA 2GZWA 5K5QA 3BP8A 1ZRFA 2M5WA 5FD6A 4LGWA 1Z91A 2FOKA 3ZMUA 3WE3A 4ZZDA 3CO6C 3QRFF 4M6XA 3I54A 3M9AA 4LFUA 4HZFA 2HTJA 4G6DA 3ZMZA 4OIOF 4L9TA 2O61A 2QZ8A 5HLIA 4EQQA 2L4AA 2GXBA 1SFEA 5FLXK 1D8KA 4S04A 1Q1HA 1B9MA 4A6DA 4ZZLA 5LLQA 3ROUA 5IT9Z 1MDMB 3P9CA 5JI6A 1RUOA 2VBXA 3P9KA 4P9FA 3F8NA 2K86A 4CYDA 3DEUA 3HRUA 1W5SA 3BJOA 4IHTA 2VBWA 4BHBA 2ELHA 3OV8A 1EH8A 3SZPA 4I98B 1ZG5A 2XASA 4UV8A 5DCMA 5IT3A 1Z6RA 2X0LA 2G7HA 3DP7A 1R7JA 1XCBA 3L00A 3I64A 3I5UA 3V8JA 2ISZA 3L09A 4KT5C 2JPCA 4XLNF 2E1CA 1C0WA 3HOTA 2CW0F 3ZMTA 3VEPA 1TQPA 4I01A 1AWCA 2RDPA 4EV0A 5JFRA 3R60A 2A68F 3JSOA 1MJAA 2LKPA 2L02A 2ZJ2A 3IC7A 2Q0OA 2NNNA 1DDNA 1T39A 1CF7B 5ILUA 2O6GE 4AIHA 2IRFG 4CXFA 2NNYA 5FO5A 5DEQA 2IA1A 4O3MA 5DD8A 1XN7A 2KJBA 1R23A 5L3CA 1I1GA 3I71A 3BZ6A 5EEHA 4KIBA 1K78A 2UWMA 5DDGA 5J6XA 1MJBA 1H0MA 2KRFA 4A5NA 1R1UA 4RB2C 1F5TA 4I02A 4GXOA 3ZMSA 1UHMA 1IUYA 2HDCA 5J8FA 2RC4A 2W84A 4Q48A 4I0BA 4U0YA 4N9HA 1YO5C 3GZ6A 3MAJA 3BDDA 3HTUA 1XSDA 3HSFA 2X4HA 3PQJA 5DD4A 2O0YA 2XROA 1HKTA 2R7FA 5ED4A 2F5CA 4HAMA 4YFXF 4CHUA 4P55A 3T1BA 3E97A 1KGSA 1YLFA 1ODDA 1TW3A 3GLXA 2ZNZA 3R0JA 4TV7A 3RIRA 1T2KA 3LAJA 5A2QZ 4XRFA 1HBXG 5E20A 1JHHA 1J75A 3SZTA 4KN7X 4A6EA 1L3LA 1DUXC 1Z05A 1USTA 4YG2F 4YFNF 2ZXJA 3S2WA 1ON2A 2OBPA 2ESHA 4JBAA 4LG0B 2B0LA 1UB9A 1U5TB 2H6CA 2OA4A 2W85A 4O5VA 3GZ5A 1KQ8A 1BI3A 4H0EA 1T0FA 1WQ2A 2Q2EA 2XIGA 4LK0F 2DK8A 3C1DA 5D5UB 2WWYA 4A0ZA 4A12A 2FNAA 1HW2A 2RNJA 4L9VA 3MZHA 4KYWA 1FSEA 4U88A 1V4RA 3PFIA 2RVCA 4HV5A 3GFMA 2MBFA 2IA0A 3GO5A 3F3XA 2EFWA 2PMUA 5TRDA 2D2WA 3RKYA 5F6FA 4LLLA 4BH9A 4GYIA 4HQEA 3M8EA 3HHGA 3IKTA 5LGNA 3WU0A 2J5OA 3F72A 1CGPA 2CSOA 5JVTA 2FNPA 5KK1A 3J80K 2WC2A 2IJLA 2E1NA 1G3SA 1BN5A 5HS9A 3F8FA 2OZ6A 1FLIA 3MCZA 3LAPA 2MD5A 1V3FA 3MFKA 4WCGA 3RTRA 4KDPA 2ZBKA 5D8LB 4CO8A 4MGRA 1JE8A 1USSA 2EFOA 5E1WA 1UCRA 2VC0A 2FXAA 1J2XA 5L3EA 3KEOA 1TNTA 5LEJA 5HLGA 2XV4S 1Z7UA 4ENNA 2P7CB 1YYVA 2RV8A 4K2EA 2W24A 2TDXA 1OYYA 5TJJA 3QPHA 2A6EF 5H6QA 2L4MA 2VBZA 1B6AA 3LSTA 3KZYA 4CICA 2R7DA 1TNSA 3WTWC 3IL2A 2DQLA 2P4WA 2OZUA 2XKPA 3EQLF 1ZH5A 4HX8A 3CUQB 2PJPA 5DYMA 2EFPA 4P5OA 2DT5A 3VB2A 1SMYF 3GX4X 2V1XA 4KICA 4AD9A 1P4XA 4EVIA 1FBUA 3K9TA 4GO1A 3KP5A 2BBYA 1R00A 4EM2A 4QLCU 2VN2A 2WV0A 3QOPA 4EJTA 1JXSA 4I7HA 3G3ZA 3HTSB 3F22A 4ESJA 4M74A 3T8RA 3IWZA 1TBXA 1OPCA 2UXXA 1U2WA 4NB5A 3TDZC 2BGCA 2XGXA 1W7PD 1WI9A 5ICGA 3TGNA 3GWZA 2W57A 2HR3A 2IW5A 4MQ9F 1PDNC 1G3WA 4MQVA 1BJAA 3GFIA 3J81K 4B09A 4WK8F 2ISYA 3LA2A 2KIFA 2HQRA 1B59A 2HKXA 4ZYHA 2AXLA 4HDUA 2EK5A 4ZH4F 2MLKA 2PBIA 2DBBA 3VODA 3GFJA 1J5YA 2DK5A 5CVRA 2CO5A 1U8RA 1LDJA 5DV5A 2MH2A 1XSVA 4M9SA 4KN4X 3WGGA 1O3SA 2VOOA 5L3GA 2P8TA 2ETHA 3I0TA 1LVAA 5D6FA 1SD5A 5KVRA 2EV0A 3GUDA 2F5FA 5ILSA 3ABUA 3EYIA 2Z99A 3T5XA 4BAYA 2FBKA 1ZGJA 1SD4A 2E7WA 3BROA 2QLZA 3HSRA 4AIJA 1BI2A 2Z3YA 2GWRA 1HSJA 3WGHA 1R58A 2PFBA 3BY6A 4KNYA 3JAMK 3QU3A 3RYRA 3KFWX 5A2QK 2DPUA 2FBIA 2Q8KA 2F5EA 2A6HF 2EWNA 2A07F 4LD5A 4EM0B 2XAJA 1XSXA 1JHFA 4PCQA 4NQWA 1O3QA 1I6XA 1BIBA 2VT3A 5L3BA 2BEOA 3ZP5A 1FNNA 2LF7A 2QVOA 4ENMA 4R1HA 3I58A 1IXSB 2FMYA 4IRGA 4OOIA 3FF5A 3ERED 2FEZA 3BJAA 5D5XB 1IN6A 1HQCA 1MJ9A 1XGMA 3ZQ7A 3Q9VA 1I5ZA 4Y15A 5FD5A 2JSCA 4MTDA 5DUIA 5DCFA 2IA2A 2EFNA 3K1NA 1Y0UA 2KKOA 1LNWA 2HYGD 3FWEA 1GXQA 1ULYA 2CG4A 5BS6A 5HDGA 2F5DA 1Z6TA 3MZYA 2A61A 3DQVC 2HOEA 1XB4A 1NHAA 1KU9A 1R22A 4G7ZF 1XDUA 1FP2A 5CYVA 2ZMEB 2YR2A 1IN7A 4OMZA 1OYIA 2XAFA 5AIQA 3COAC 1QZZA 1IF1A 1ZN2A 1O7FA 3ML6A 3QU6A 2FF4A 3HIFA 2HYFA 3QP6A 3FXQA 1SAXA 5D5WB 4A0YA 3CDHA 4FHTA 2FA5A 2ZNYA 3F21A 1REPC 2NYXA 3E6DA 2EV6A 1HW1A 5ILVA 2A69F 1OKRA 4EM1A 4UHTA 3C7JA 4IPAA 2OQGA 3O2PE 2OD5A 2VE9A 1FZPB 1BM9A 1L0OC 4A0XA 2OQRA 1Z1DA 5D8KB 3FX3A 1VTNC 3EETA 1FBSA 4FX4A 2FU4A 1SD6A 3I59B 4ASNA 4OINF 1GXPA 5LBQA 2ADUA 3N97A 5H6RA 2D45A 1TQMA 4ENJA 3FHZA 3P9IA 1PUEE 2UZKA 4I2OA 3RKWA 1ZLJA 2P5VA 3GXOA 1S7AA 1S7OA 3KP7A 1MDMA 1BC8C 1BOAA 2LSOA 1FX7A 3KEQA 4L0YB 5LHHA 2KJCA 2PLYA 1TTYA 5L3FA 1U5TC 5HDKA 2COMA 4G8XA 3RPUA 1UFMA 1FYLA 2KIMA 4CGZA 1G6NA 1MKMA 4HBLA 3H3UA 4L0ZB 2EA4A 2L01A 2YX7A 3DF8A 3WE2A 4MEXF 1STZA 4HW0A 4EJWA 1W5TA 3LFKA 3FZVA 4CZZA 3ABTA 4M9ZA 1FSHA 1IZ1A 1O57A 2F2EA 2BV6A 5D5VB 4RB3C 1KU2A 2RQPA 4WX9A 1U6GA 1CF7A
chains in the Genus database with same CATH superfamily
4AIKA 2IGKA 5E18F 4G7HF 3NWSA 2G9WA 1LQ1A 2QYOA 4S05A 3DCFA 1SANA 2HXOA 2L9SA 3BPVA 5FLXZ 4CCJA 3ZPLA 4OIRF 1X3ZB 3JRFA 2K27A 2JWTA 2W48A 1KU3A 2OJED 1WJCA 2KDZA 4HX7A 3HOSA 1NH3A 2NS7A 1S5LC 2ECBA 2R7SA 2KIUA 5KHDA 3DTKA 3GTPJ 2HKOA 4G12A 1R5ID 2VQGA 4ON0A 4RAFA 1T56A 3O3KA 2DMPA 2LF8A 3OS1A 3LQRA 2F5VA 5D4RA 2OTJI 3HGYA 4U0WA 2E1MC 5IYBJ 3N4MA 3H5AA 5KAIC 4MNUA 3OYJA 2J5PA 3BPXA 3DKWA 3OYMA 3V7SA 4EMSA 4NC6A 1YIOA 5F0FA 1MGTA 4XMYA 2JN6A 4BL0B 2R7RA 3HRMA 4IVNA 1QVTA 1VI0A 4A5MA 2HEOA 4PZJA 2FOWA 4BGDA 4XKVA 3R6SA 3E6BA 1I3AA 4HV6A 3JW4A 3H0GJ 4HLXA 2VIXA 4MTEA 4BHCA 4ZYGA 2QKMB 4PJNA 4XK4A 2IP2A 1FY7A 3CCRI 2ZXHA 4D9JA 3T0YA 3SHFA 2STWA 1JGGA 5C4XJ 1XX5A 1GV2A 1BJZA 3VSLA 3OYLA 2QKLB 3KP2A 4P9UA 5J8CA 2LMDA 5GAGJ 3WTXC 4J00A 4IQJA 1R5HA 3DXJF 4LG0A 3PUFA 3VFZA 4HG2A 3LSRA 1KU7A 3Q5FA 2DO7A 3F6VA 4D1QA 3S2HJ 4I09A 3AG2H 3RKQA 1XMAA 2LY9A 2MH9A 1U5TA 5M5XJ 3BTIA 4FCYA 4BJ6C 1D0ZA 1N75A 4BQAA 1JJ6C 2F4IA 4A2UA 2XGCA 2ZFUA 1H9TA 3UR3C 4NC8A 5H20A 5E8IA 1RKWA 4EJUA 2RKHA 4HF2A 1H9GA 3OWTA 4B47A 3JTGA 2GA2A 4XSZF 4HLYA 5E3NA 4BDZA 4KITB 2LC2A 4IOCF 2BW3A 3CO7C 5LEKA 2JPBA 4M6YA 1WHUA 6PAXA 2CW8A 5BMZA 3C18A 3IRRA 1W7PB 1LDDA 2QWWA 2RNGA 1ETQA 1O7LA 4EJVA 2DFIA 5LHIA 1VQ8I 3GYHX 3G1MA 2FRHA 2FX0A 1X1DA 5CVVA 4GGGA 5IPAA 1WH7A 2DA6A 2XAGA 1K79A 4EJOA 2L7KA 1ZGAA 2O3FA 5IT9K 3IKVA 3IRQA 2ID6A 2NS8A 3HM5A 4LK1F 4N4OB 3DEEA 2CWEA 3SXYA 1QGPA 3CJRB 5HS7A 2AHQA 4BU2A 4FE4A 3FXRA 3HG9A 4Z6YA 5E1ZB 5BPDA 1VQ7I 2UXNA 2LYCA 3CCJI 1TWHJ 3GVAA 1K6OA 5F08A 4M9XA 2E34A 5EF6A 1S6LA 1F36A 3CCMI 3G4SI 3LQQA 3CMAI 3H1CA 2I10A 1G59A 5BOXA 4MO7A 3HGGA 3TKYA 2K9SA 1PP7U 1GUUA 1ETXA 2VKVA 3N05A 1BC7C 2KDOA 4Z2YA 1SVMA 4ZDOA 1NG7A 3HOZJ 2JUCA 2V79A 2YU3A 1YTYA 1R49A 5LRRA 4KIGA 2E60A 3C3WA 1XD7A 2JTVA 4FTHA 1IAWA 4WF2A 5IOZA 3ZQLA 4OU0A 2PMZN 3D0SA 3E5UA 3TP3A 2EQRA 4XR6A 2CH0A 2ELKA 3GTLJ 4DBRA 4E7ZA 5J40A 1Z7LA 3WHBA 1FBQA 5EDNA 2HFHA 3H3ZA 1I50J 2XRLA 2CQNA 3BQYA 2QSGX 5LHGA 3CJNA 4KA4A 1YHQI 2M0MA 2P0WA 4JK1X 5K5OA 2EPFA 3NARA 2HS5A 2RQQA 1YJ9I 4QTRA 5FLMJ 1UG0A 4UUSB 2GOXB 1ONVA 3TO7A 4NBQA 2M30A 4EGYA 4MFEA 4DYQA 3OR2C 3JSPA 1W0UA 2O8KA 1K61A 3RI4A 2FBHA 5GADJ 3A1YA 4KFCA 2EJRA 2RN7A 3AG4H 3I53A 2DA4A 4WXCA 1R1TA 3SDBA 3MEXA 3VPRA 3KLNA 3JRIA 5J3LA 3U1KA 3VSKA 3IH4A 4J19A 5K5RA 1XCVA 3KE2A 3I4PA 1CQTA 1MBGA 4HNVA 2M2EA 1U0JA 3B73A 1E0EA 5CVUA 2VBYA 4ZDLA 2VQLA 1FYKA 3BZCA 3RKXA 2C6YA 3RDIA 5H2FC 3SFZA 4L18B 3JTHA 3OSGA 5E3MA 4XIDA 1IC8A 5FB2A 3L9FA 1X3UA 4RGSA 4ZJZA 1UAAA 1ZHFA 2K02A 3V8KA 4CUGA 3PL8A 2B9SA 2STTA 2F4MB 2X51A 1G3TA 1YIJI 4ETSA 5DM7F 3I55I 2F4OB 4A3GJ 1FT9A 5F04A 5J1UA 4IHSA 4ESBA 4Q4ZF 3DBHB 1RIOH 1K7AA 4B44A 2Y69H 3KETA 2RAEA 4UV9A 2XAQA 1VQOI 4HDVA 2L9RA 2X85A 3V4GA 3OR1C 1ZKGA 3CUQA 1FIPA 3GZNB 1GHCA 1IN8A 2B63J 1ETWA 1YW7A 4NDLA 3DV8A 1FYMA 4L9JA 4WXHA 4AVPA 2PX9A 2JVGA 1JKOC 2V1UA 1YW9A 2L0KA 3CCVI 1FTZA 1LEAA 1MIJA 3MKZA 1GVJA 2JA7J 2PEXA 5K7ZA 4HSTA 1QA6A 1EV7A 2W25A 3SFIA 1ZARA 1KYZA 4Y3OA 3FMSA 2PI0A 3IAM2 1TT0A 3IH2A 4F3QA 1KQ9A 2NVUB 5CLSA 5ERIA 3J80Z 2OAZA 2MABA 1G4DA 1P4WA 5EEAA 1R71A 1B72A 4CCMA 2M45A 2DT7B 5DCMB 4E6KG 1ZAOA 1TQIA 2V6CA 2XC7A 3K1PA 2FSWA 3BR5A 3EYYA 4A3EJ 2DYRH 5JVGF 4NC7A 2QSHX 2KISA 1R9TJ 2HDDA 3WTZA 2VODA 3K2AA 1A04A 1OCZH 3IWFA 2DW4A 2IT0A 4D5CA 2O03A 1XGNA 2G7UA 5BQTA 4UUVA 5M3MJ 2K9QA 2DMTA 2HQNA 3WTYC 3ONQA 4LIVA 4M3FA 1ON1A 2OCCH 4B1RA 2CUEA 4A69C 2EV5A 2OF7A 3KCCA 2A3SA 3ZMDA 3W2VA 4DW6A 3TL4X 2HVQA 3BTJA 3BR0A 4GFBA 3FIWA 1YQAA 2X1DA 2ZSHB 3BOQA 3EUHA 2QUFA 1BI1A 1NG6A 4IF4A 2GIVA 2M7BA 3GTMJ 1F9NA 3A01A 5E8GA 1QU3A 4R8HA 2MC3A 1OYWA 4YIFA 3WU1B 3AAFA 1W36D 3OS0A 1DPRA 1KQ0A 3R61A 2D1VA 3TMOA 2HTSA 3LNQA 1U3EM 1FJLA 3OL4A 2FUG2 3G2BA 1VFCA 3E3VA 1F1ZA 1BBYA 1SFXA 3R4KA 3M7GA 1MD0A 4LOCA 1HC8A 1P9QC 1FTTA 4C3JJ 1R1VA 5IP9J 4KMFA 1G3YA 3TO9A 2R4GA 2YUSA 3RPQA 1HF0A 3ZXSA 1UG2A 2H1KA 1K78B 1I39A 2Z5UA 4DQ2A 5CJ9A 5J1YA 1N77A 2QQ9A 4U7DA 1WPKA 1J7KA 2PN6A 2PJRB 3JRDA 2UUZA 4B4CA 2HWVA 3HRTA 1G8XA 1LE8A 3K1MA 3HYIA 4XRSA 4ABZA 2MLGA 2YSRA 2JA2A 1BI0A 4KT6A 3HL2A 3MWMA 4QWQA 1D8JA 3KZZA 1MH4A 2DAOA 1HW5A 4PGGA 2DPDA 3TW6A 1W5CC 2CQKA 3D5RC 5D6EA 3ZMVA 5EGOA 4B8XA 5LGTA 4OIPF 3D5LA 3AL0C 2LKXA 1R36A 3MKLA 4LB6B 1DGRM 3C2HA 3CMYA 4ENKA 3F8BA 1K83J 2PQ8A 2R93J 2GBYA 3ISPA 3ELKA 4UB6C 3WTVC 2BYVE 4QPQA 3HOWJ 4X6AJ 2ZO4A 3PNTA 1MMSA 1ERDA 3H92A 4P96A 4D5FA 2QBYB 4C2MJ 2Y2ZA 2ZCWA 1JTXA 1QHGA 3KP6A 2P5KA 1VQ4I 1MNEA 3HPHA 1RR8C 2WV1A 3DFGA 2FJ1A 2AQFA 2EA2A 3LA3A 1T98A 1QO0D 2VB6A 2CYYA 5F0CA 2TCTA 1IRXA 2DJNA 2WAFA 3ULQB 1LEBA 2LDUA 2ZKZA 1SVLA 4BBSJ 3OS2A 2V1NA 2VXZA 1SAUA 3PM1A 1YE9A 1FOWA 1MNMC 1MBKA 2TRTA 4UNOA 2JA8J 2WAQA 3DPTA 4OMYA 4R79A 1P4AA 3HJEA 2GA1A 4RGUA 2DU9A 1MBHA 1Y1VJ 2W00A 4LLGF 3NQOA 2I8DA 4ESFA 2K4JA 4LLNA 1W1WE 2LBFB 1MBEA 2QA4I 5EG0B 2HVRA 4IEJA 4ZC3A 4FT8A 3J81Z 1JUMA 2Q2EB 3CUOA 1Y1WJ 1VQ6I 3WTSC 2GQQA 1YS7A 1BR4A 1UHSA 1S8NA 3CTAA 4A3CJ 4MFDA 1FOKA 2JRTA 1WJAA 1RUNA 2H09A 4WWCA 3HOXJ 4XM3A 1QVUA 1FWZA 2Q1ZB 3BG3A 3RZOJ 2BHYA 2EH3A 2QF7A 4S0HB 1Z77A 2ZSIB 3JRGA 1BOBA 3LA7A 4PUSA 4JX5A 1X1PA 1LJ9A 4OWRB 1KYWA 1ZRDA 4IRHA 2IAIA 4HOBA 3H5NA 5E1XA 5K1YA 1LB2A 1SFUA 1D5VA 3FXUA 2X6WA 1P92A 4Q47A 2HQ5A 3F8CA 3H9QA 1OR7A 5HS8A 3FM3A 2NS0A 3J7ZI 1AHDP 3PQKA 1EH6A 3BJ6A 3TQNA 3FM5A 1O3TA 4H4KC 5EZHA 4PDKA 4RAZA 2HOAA 4UVCA 3K2ZA 3HKZA 1IN5A 4JOMA 1S29A 1E2XA 1WKMA 2K40A 2BE5F 4ITVA 4PSWA 3TW7A 3S1NJ 2DN0A 2LY2A 4C9YA 3CP8A 4BY7J 1AOYA 1K6YA 3K0LA 3GFLA 2XRNA 3F23A 4QPOA 3BR3A 3HC7A 4DNCA 1X58A 3CLOA 3CESA 1OMIA 3J7AO 4C3IJ 5BPIA 2IPQX 3K4NA 2ZJQF 2ZMEA 3BQZA 5EEGA 1I27A 1LKXA 1TT5B 3OYAA 3HRSA 3E1SA 2D1HA 3W6KB 2QQBA 1YFHA 1A35A 3GF2A 1DPUA 1YJWI 3HHHA 3AG1H 4RM2A 3H5RA 5IP6A 1RNLA 3QAHA 4BKXA 1TWCJ 2BY1A 4KMUX 2WTEA 3SQNA 2VJ4A 4BJ5C 1YW8A 2QENA 3WODF 4RDUA 3OL3A 2DA7A 1VQMI 2QBYA 3H0DA 1D3YA 1WWXA 1RI7A 2Y0MA 4JQFA 1IGNA 3JAMZ 4RGXA 1WZ2A 1N78A 2M9HA 3L7WA 2XAHA 1ZK8A 2V9VA 3BG7A 2Z33A 3QPSA 3AG3H 5CVJA 2VONA 3K4CA 1B4AA 4XLAA 3M8FA 5CVIA 1YRNB 2EZIA 4IX7A 3BLYA 1V54H 3ECHA 3CCQI 5E79C 2MG4A 3IV5A 3E6MA 1D1AA 2GXGA 3TOBA 2JK3A 2L7MP 2LVSA 3WTUC 4U0VA 3ZQFA 1OLTA 5FGMA 5F64A 4CZCA 1ZREA 1QQIA 4KUMA 1EH7A 3KZIC 3U9GA 4BE0A 4IHVA 5HNHA 4DYCA 4C3HJ 5DTDA 2XKOA 4BXUA 3HUGA 2PG4A 1IXRC 1OCPA 4FETA 4DIQA 1I1SA 3E5XA 3IAS2 4HF0A 3LL7A 4N4NB 1PP8F 4M3DA 1ZG1A 3VOEA 3C2GA 1JT6A 4N0BA 3ECOA 4Y13A 2LKSA 1RESA 2M87A 2KRCA 3WGIA 2CQ7A 2Y0SN 2WA0A 1WCMJ 3DTIA 2B7EA 2CS3A 2KLOA 1GDTA 3MQ0A 2EIKH 1P6RA 1VQ5I 4ZDPA 5L3DA 2Z9OA 2H94A 4L5JA 1ZG3A 3KP4A 4UVBA 1YI2I 3I59A 1VQLI 4BXXJ 2VKDA 3ZN0A 3W6VA 1JKRC 3PO3J 4WXDA 2VQHA 2XVCA 3R0AA 2LP0A 3E7LA 4AYBN 3Q0WA 2KRHA 1U78A 2F48A 2Y9YA 4YEJA 4BYYA 1XGOA 2R7XA 1NTCA 3X2QH 1ZYRF 2X48A 3CDIA 4RS8A 5HOOA 4U7BA 2XUBA 3A0BC 2NRAC 5FFZA 3B02A 2O9LA 5GTIC 2DI3A 4E7LA 4G7OF 4L9NA 1FMVA 2VLAA 1HKSA 1T38A 2H27A 3K69A 2K4BA 4HA8A 4XONA 2EIMH 3IHUA 4A93J 2KFDA 3QPLA 4UVAA 1P7IA 3LFUA 4PK4A 1J9IA 3SEQA 2H6BA 3KEYA 2DDBA 4CDGA 5LGUA 4HF1A 3OOPA 3M3YJ 4HX4A 2ZXWH 3TP0A 2CW7A 4M72A 3FISA 3HSEA 1UZCA 2A5YB 3GTQJ 1TW2A 1MH3A 3OSFA 4CCKA 1TWFJ 4GYGA 2VQCA 2OU2A 3RQ4A 2YX4A 4UXNA 1QBJA 4G9YA 3WG9A 4HQMA 3OYIA 4Y17A 4IJAA 4LB5A 1LDKB 3QP5A 5E17F 2ZFWA 1TLHB 1DGWY 3RSNA 3G73A 5M3FJ 1X2NA 3S16J 2P5LC 3S3MA 5HVQC 2M34A 4XKCA 1AKHA 2KIQA 1A5JA 1IRGA 5LRSA 3HOUJ 4GCVA 3CP2A 1HSTA 2DLLA 1X4OA 3LSGA 2IS2A 3OYCA 2EBIA 2QEXI 1GV5A 2E5ZA 4YIIA 3V7RA 2L9NA 1DP7P 5F1RA 2E1MB 2VJJA 1SVOA 1Y56A 2MA3A 2X6YA 2YU9J 2VASA 2LTPA 1HXDA 1I3QJ 4AYBA 5B5EC 2HZTA 4RAYA 2AS5F 1Z67A 2E35A 1WSUA 1I6HJ 3ZN1A 1V55H 4HYEA 3S2DJ 3V7CA 2P7VB 3CUQC 1WGXA 2UV1A 4RBOA 2VOPA 1ZRCA 2JQ7A 2L3DA 1HA8A 1OCRH 1MBJA 2WY8Q 3O6BB 4E4HA 1Z9CA 1QZYA 3KLOA 1Y39A 1JTYA 2DQRA 2R3SA 2ZB9A 1MZBA 4F93B 4RB0A 5GTHC 1SMTA 3JRCA 2E2JJ 1FPQA 3VYRB 2X6OA 5IY5H 1RR7A 4BQQA 1LPQA 4RLFA 2AXTC 3F0CA 4BHPA 3L2CA 2RGVA 2M8EA 3CLQA 4AM3A 1BIAA 1U9NA 4YIRX 2L9VA 3LWFA 5DUKA 3BWGA 2ESNA 2K7LA 3WTTC 1XC5A 2IXSA 3W6JB 4FX0A 4KJZA 3OY9A 1NK3P 4RGRA 4XBFA 2O8XA 5JR3A 4CCNA 3ZCOA 2CUJA 1U9OA 2MYSA 3RYPA 4PJMA 3MKYB 1OQYA 1ZR4A 3QYBA 5FRNA 3ZR8X 2NOGA 3F6OA 3QYFA 3NEUA 3NRVA 2R7ZJ 1IUFA 1ITYA 2FQ3A 5KNLA 2NVTJ 3GTKJ 2HGCA 1X1AA 3WG7H 4HPQA 2R7QA 3E6CC 4LJZF 4AC0A 1HKQA 2R5ZB 4IHXA 2KT0A 2AQEA 3RJPA 4IXAA 2LLKA 1XPXA 1SD7A 3GEZA 4EGZA 3JREA 1B9NA 4RAGA 1PJRA 3TDUC 3M8JA 5C3EJ 3PSFA 1WJ5A 3DPLC 3U1DA 4YFKF 4M73A 2MW8A 1QPIA 1X3WB 3FMQA 4PFOA 2CUFA 2JZYA 3EUHC 4PGHA 4BNCA 5HDNA 4IOAF 1QNTA 5JHUA 1FP1D 2DMNA 5D4SA 4LMYA 3P7NA 4BJTA 2R7VA 2Y48A 2VC1A 1X1CA 3GBGA 2IGOA 3ABKH 2KZGA 3KP3A 2HDWA 4KIFA 1LUJB 2RREA 4P1WA 2BY0A 2LR8A 5FFXA 3TOAA 1UHWA 3A4CA 3L2WA 2EZLA 2NVYJ 3Q9SA 1IRFA 5M5YJ 2VT2A 2K3FA 2HVSA 2P6TA 2EFQA 5CPRB 4B43A 4NHJA 4FE7A 1IXCA 2E1OA 1P2FA 1E3HA 1S3JA 1ZLKA 4NQWB 2XGDA 2BY2A 3PO2J 2GAUA 1BA5A 1MMAA 3H3VK 4G6QA 3U2RA 1IW7F 2NAZA 1WRJA 1YS6A 1HDDC 2M1BA 4A3KJ 3S3NA 1ENHA 2W4SA 3HPGA 3LSPA 1ZQ3P 4F7ZA 3FBIB 1FMWA 2L7FP 2V7FA 4N9IA 3PNYA 1J0RA 1XDSA 4M71A 1OJLA 2LNBA 2XAUA 5ICEA 5B3SH 1JGSA 4IKFA 1T6SA 2XF6A 4CYCB 2DA2A 1OCCH 1W36C 2KHMA 4I0AA 4JYKA 4BEHB 1D5YA 1XGSA 1YG2A 2HNHA 3E5QA 3U21A 4MEYF 3ESWB 5ICCA 5J1RA 2M0CA 1E17A 1KA8A 1ETVA 1WJEA 2H8WA 4ZYDA 2E71A 2L54A 3M07A 4XRSG 1B1BA 3CCEI 1RPWA 4E7KA 5IYCJ 4L5IA 2EB7A 3GW2A 4GDFA 3QPTA 4XLFA 1D0XA 1PUFB 3TO6A 1W7PA 3MVPA 4J01A 4JP0A 3KIOA 3JR9A 4XORA 2XF5A 2JT1A 3EDPA 1WVRA 2HYJA 2PMZA 4E70A 1ETYA 1QPMA 2QM3A 1TWGJ 1IN4A 2R5YB 3PIOF 4UUTA 4G94A 1J59A 5HLHA 1RZ4A 3CC4I 5FRMA 2Y75A 1R5GA 3DWLE 1JI8A 4OIQF 4XSXF 3T8TA 2M8GX 3L2RA 2DYSH 3BG5A 2FE3A 2PMHA 4D0PA 5FKKA 3ERMA 4XLPF 2IVMA 2V1DA 5FLVA 2VE8A 2MSYA 2X6XA 4AU7A 4IRIA 4RB1A 4O6JA 1YOVB 4Q5SF 3ZGKA 1WFXA 2FMLA 1O3RA 1WJDA 4MHGA 2YPRA 2DTRA 2F6CA 5FJ8J 2A05A 2QQAA 1N25A 1P7JA 1W4MA 3HB9A 5ICFA 4ZYEA 2CGPA 1H8AC 2CFXA 3M1EA 3FMRA 2LD5A 5JHFA 4GRIA 5AONA 3DEWA 3SDGA 3F8MA 3SJMA 3RZDJ 2XHKA 2ACJA 2VL8A 2LH9A 4E7IA 3V8LA 2JSPA 2P6SA 3LSHA 5EYRA 3VYTB 4AWXB 1F4KA 5AIPA 3REOA 1FC3A 2R92J 2I5UA 2L5QA 1XMKA 2E7XA 1YJNI 2GZWA 3K4KA 5K5QA 3BP8A 2BXZA 1MMDA 1OR7C 2CU7A 5FKMA 1ZRFA 1PYVA 2M5WA 4XQFA 1Y8RB 4B3AA 5FD6A 3KYCB 4LGWA 2MGQA 1Z91A 3UKGA 2FOKA 3BCBA 3M4OJ 1EJ9A 4UUSA 1VQ9I 2ECCA 4G6TB 3ZMUA 4A3FJ 3WE3A 2GOMA 4ZZDA 3CO6C 2X1CA 3QRFF 4M6XA 4FQGA 3GTGJ 3I54A 3M9AA 3ZRGA 3DLLF 4LFUA 4Y52J 4HZFA 5HODA 2HTJA 4G6DA 3ZMZA 4OIOF 4L9TA 2ZMEC 2O61A 2QZ8A 5HLIA 1WH5A 4EQQA 4CYCA 2L4AA 2GXBA 5C4JJ 1SFEA 3W2WA 1FEXA 3B6AA 3K70C 3PNVA 5FLXK 1XS9A 5J4YA 2DDAA 4W97A 1D8KA 2AO9A 5B1BH 4X0GA 2HI3A 3Q3SA 4IZZA 2X1EA 4S04A 1Q1HA 3LMMA 1B9MA 4A6DA 1T8IA 1SFKA 4ZZLA 5LLQA 2JA5J 2XPWA 3ROUA 2VJIA 1QRYA 2E2IJ 5IT9Z 4XLCA 1MDMB 1HOMA 3P9CA 5JI6A 1UJ8A 1RUOA 4DZJA 1ZELA 2R7UA 2V26A 5LD2C 2QGUA 2VBXA 1FIAA 3P9KA 4XOPA 3OYHA 4P9FA 2R7OA 3F8NA 1F43A 2ELJA 2K86A 3ZQIA 4CYDA 3DEUA 3HRUA 2KL4A 1GT0C 2CJJA 1W5SA 2EIJH 3BJOA 4W1UA 2GLOA 2Y30A 4XN3A 1V5EA 4IHTA 1WJFA 2LK2A 4MIMA 1HCRA 1IG7A 2VBWA 4ZYAA 4XICA 3VWBA 4BHBA 2ELHA 2DJIA 3OV8A 5EJCA 3S32A 1EH8A 1VQNI 1HDPA 3SZPA 3EPZA 4I98B 2CQQA 1ZG5A 2XASA 2WADA 4UV8A 2OV7A 5DCMA 5IT3A 2ZC2A 4RM3A 3ZQHA 4BACA 1Z6RA 2X0LA 2XB0X 1VF9A 2G7HA 3FXKA 4L5EA 3DP7A 2GXAA 3L2VA 1R7JA 1XCBA 3L00A 3HOYJ 3I64A 1D1CA 1Z3YA 3I5UA 3BTCA 3LOCA 3V8JA 4ANJA 2VJ5A 3L09A 2JPCA 4KT5C 2HXIA 4XLNF 2EZHA 2ISZA 5FKOA 2M4KA 2E1CA 2GM4A 1C0WA 3HOTA 2CW0F 3ZMTA 3F9KA 2LY1A 3DTEA 3VEPA 1TQPA 1HLVA 4I01A 2OUMA 1AWCA 2RDPA 4EV0A 5JFRA 2MD0A 3R60A 2A68F 3P5JA 3JSOA 3GTOJ 1MJAA 2LKPA 2L02A 2ZJ2A 3IC7A 1RRJA 2Q0OA 3GLLA 2NNNA 5F1JA 3M1CA 1DDNA 5GAEJ 1T39A 1CF7B 5ILUA 4BQNA 2O6GE 1SFOJ 1DQUA 1OISA 4AIHA 3E0JB 2IRFG 4CXFA 2NNYA 5FO5A 5DEQA 2DOEA 2IA1A 4F55A 4O3MA 5DD8A 5KCMA 4D7MA 1MBFA 1XN7A 2KJBA 1R23A 5L3CA 3K70D 3VYSB 3FHNA 1I1GA 3I71A 3BZ6A 3GCMA 5EEHA 1QHHD 4KIBA 2DMUA 3BG6A 2OTLI 1K78A 2UWMA 5DDGA 2K9NA 5J6XA 2DA1A 2PJRA 1MJBA 1H0MA 4U87A 2KRFA 4C2TA 4A5NA 1LFUP 1R1UA 2W1OA 5J47A 2K9MA 4RB2C 1F5TA 4B48A 4I02A 4GXOA 3ZMSA 5E3OA 1O4XA 4HNTA 1UHMA 1IUYA 2HDCA 2OCEA 5J8FA 2RC4A 2W84A 4XKWA 4Q48A 4I0BA 4U0YA 4N9HA 1YO5C 2Z16A 1ZTRA 3GZ6A 4XRMA 3MAJA 3BDDA 3CCYA 3HTUA 4A3BJ 2BVMA 1XSDA 3HSFA 3WU2C 1DU0A 2ID3A 2O5RA 2X4HA 3PQJA 5DD4A 1S72I 2O0YA 2XROA 1XG1A 1HKTA 2ICWG 2R7FA 4XNFA 2F5CA 5ED4A 3MKWB 4JX6A 4FASD 2HQAA 4HAMA 4YFXF 4CHUA 1MNDA 4FISA 4P55A 3T1BA 3A2KA 3E97A 1KGSA 1YLFA 3OOUA 1ODDA 1TW3A 4BE1A 1H88C 3GLXA 2ZNZA 3R0JA 4TV7A 3RIRA 1T2KA 3LAJA 2FD5A 1RETA 5BNGA 5A2QZ 1AA7A 4XRFA 4C30A 2XPVA 2IGMA 2KPMA 3OIOA 1HBXG 5E20A 5B66C 1JHHA 1VNDA 5GP9A 1J75A 5EZGA 3SZTA 2DFFA 4KN7X 4A6EA 1L3LA 1DUXC 1PVEA 1USTA 1Z05A 4YG2F 2E2HJ 4YFNF 3SEZA 2ZXJA 3S2WA 1ON2A 5HLTA 2OBPA 2ESHA 4JBAA 4LG0B 2HZDA 2B0LA 3G71I 2ME6A 1T95A 3HDDA 1M1EB 3BCAA 2X9DA 1UB9A 1U5TB 2H6CA 2OA4A 4PJ0C 2W85A 4O5VA 2LBFA 3GZ5A 3H9GA 4HNUA 5EG0A 3OYGA 1KQ8A 1BI3A 4H0EA 2BVLA 3L2UA 1T0FA 3GMEA 1WQ2A 4IL6C 2OPTA 3K10A 2Q2EA 3TEDA 4ZTJA 2XIGA 4LK0F 3PSIA 2DK8A 3C1DA 5D5UB 2WWYA 1U8BA 3QQAA 1WJBA 4B3XA 4A0ZA 4A12A 3LSMA 2FNAA 1JT0A 3S17J 2WAEA 1HW2A 2RNJA 2BW3B 4L9VA 4M6VA 2HPIA 3MZHA 4KYWA 1QZEA 1FSEA 1RC9A 2LG4A 4BS9A 4U88A 1GVDA 3O8GA 1V4RA 3IUOA 4PJLA 3PFIA 2M7AA 3A0HC 2RVCA 4AVZA 5B1AH 4LG3A 4HV5A 2DOFA 3GFMA 2MBFA 2V6EA 2IA0A 2DXIA 1ORKA 2MC4A 3ASNH 3GO5A 1ZGWA 3G1OA 1IJWC 3F3XA 4DZPA 1OFCX 3BT9A 3HBLA 2EFWA 2PMUA 5C44J 5TRDA 4DOZA 4C2UA 2D2WA 3RKYA 5F6FA 4LLLA 4BH9A 4AIDA 4GYIA 4HQEA 3M8EA 3ABLH 4XLHA 2CFOA 3S93A 1DP3A 3HHGA 3CJTB 3CCSI 3IKTA 2DCEA 4UB8C 2XDVA 5LGNA 2IGNA 3DKYA 3WU0A 2J5OA 3F72A 1CGPA 2WBMA 2CSOA 5JVTA 1TZLA 2VXDA 4IHWA 3SZGA 1TL8A 2WY7Q 3HZJA 2LFBA 2FNPA 4RA2A 5KK1A 3J80K 5KAFC 2WC2A 2IJLA 3L2QA 2E1NA 1G3SA 5J4VA 3CC7I 4F52A 2W82A 1BN5A 5HS9A 2FQ4A 3F8FA 2V4JC 2QCOA 2OZ6A 1Z21A 3BR2A 1FLIA 2LREA 1H89C 3MCZA 2Y0SA 4CCOA 3D1NI 3LAPA 1S7EA 1TWAJ 2MD5A 1V3FA 1D1BA 3MFKA 4WCGA 1AU7A 3RTRA 9ANTA 4KDPA 2ZBKA 3CF5F 1X2MA 1V5FA 5F0HA 1YITI 3DBLB 4QIWN 1T08B 2JA6J 5D8LB 4CO8A 3BTLA 4MGRA 1JE8A 1USSA 3J7YJ 2ME0A 2EFOA 3OIQA 1YRNA 2ZXIA 5FKNA 2E5NA 5E1WA 1NK2P 2BHZA 1UCRA 2VC0A 2Z1DA 1TP4A 2FXAA 1J2XA 5L3EA 1LFPA 3K7AJ 1POGA 2M4GA 2VKEA 3KEOA 1TNTA 4I76A 3L1PA 5LEJA 5HLGA 2HOTA 4BBRJ 2XV4S 1Z7UA 4ENNA 2P7CB 1BW6A 1YYVA 1OCTC 3FK7A 2RV8A 3W3CA 4CCLA 1FOXA 4K2EA 2W24A 4IO9F 2TDXA 1OYYA 2K3PA 3QODA 5TJJA 5GPAA 1J09A 2HU9A 3QPHA 2A6EF 5H6QA 4EATA 2L4MA 1A31A 4UY8I 2VBZA 1W0TA 1B6AA 3LSTA 3KZYA 4CICA 1S9HA 2JUGA 4IHYA 4CH7A 3CCUI 4A3MJ 2R7DA 1TNSA 3WTWC 3IL2A 1APLC 2DQLA 2P4WA 1E3OC 3IP4B 2OZUA 2XKPA 3EQLF 1ZH5A 1R4MB 4HX8A 2IEKA 3CUQB 4II3A 3PIPF 2PJPA 1K4TA 4IQ4A 5DYMA 2EFPA 4P5OA 2DT5A 3S14J 4RLQA 1SC7A 3VB2A 1SMYF 3OYBA 2CV0A 4XLEA 3GX4X 3S1RJ 3DU5A 1MSFC 2V1XA 5F27A 4KICA 4AD9A 1P4XA 4EVIA 1FBUA 3I3LA 2KZVA 3FXLA 3K9TA 4GO1A 3CC2I 2CV1A 3KP5A 2BBYA 1BW5A 1R00A 3S3OA 2XSJC 1A36A 1EKEA 4X1EA 4EM2A 3OMYA 4QLCU 2VN2A 4A3IJ 2WV0A 3QOPA 4EJTA 1JXSA 4I7HA 4V2GA 1B72B 3G3ZA 3HTSB 1G2HA 3F22A 1KONA 4ESJA 4M74A 3T8RA 3IWZA 1TBXA 3FK6A 3NWTA 1OPCA 2ZJPF 2UXXA 3FKJA 1U2WA 3QOEA 1V5GA 4NB5A 3TDZC 2BGCA 2XGXA 3CMMA 1W7PD 3TBIA 2DFEA 1WI9A 4XOTA 5ICGA 3TGNA 3GWZA 2W57A 3KX2A 4HEA2 2HR3A 3OYKA 2DMQA 2IW5A 3DBRB 1JJ8C 4MQ9F 1PDNC 1G3WA 4MQVA 1BJAA 3GFIA 3J81K 4B09A 4WK8F 2BOLA 2H1LA 2ISYA 2VKHA 1UMQA 3LA2A 1VQKI 2V9KA 3SYTA 2KIFA 2JRMA 2JVHA 2HQRA 2P81A 5K7HA 4HRIA 1B59A 2HKXA 2XSDC 1ETKA 3JRBA 4ZYHA 2AXLA 4HDUA 4PFPA 3A01B 1LVKA 2EK5A 4ZH4F 2MLKA 2PBIA 2DBBA 3S1MJ 3VODA 3GFJA 1J5YA 1Y8QB 2DK5A 2LOOA 3CQZJ 5CVRA 2CO5A 3KPHA 4Y7NJ 1U8RA 2HOSA 1LDJA 5DV5A 2MH2A 3ZQQA 1XSVA 4DGWB 4M9SA 4KN4X 2CRGA 3WGGA 1O3SA 2VOOA 5L3GA 2P8TA 2ETHA 4BDYA 3I0TA 1LVAA 2WB1N 5D6FA 1SD5A 5KVRA 1LE8B 2EV0A 3V42A 2QSFX 3FXOA 4CSWA 3GUDA 3LSJA 3K4JA 2F5FA 5ILSA 2Z2SB 3DKXA 2A5WA 3ABUA 3EYIA 1BR1A 2Z99A 3C2BA 2DA3A 4MLOA 3T5XA 5EGOB 4BAYA 5FKLA 2DFHA 3FBNB 3EUKL 3OYNA 2FBKA 1ZGJA 2CV2A 4QSHA 2R0QC 1SD4A 2E7WA 3BROA 2NXNB 2QLZA 4ZTFA 4YELA 2R5ZA 1ACIA 3HSRA 4AIJA 3MZ8A 1BI2A 2Z3YA 2VPLA 5CKTA 2E19A 4BUPA 1MMNA 2GWRA 1HSJA 2MFZA 1MSEC 3WGHA 1R58A 1FOYA 2PFBA 2Y31A 3JRAA 2COBA 1T33A 4OAZA 3BY6A 1IV8A 1XMXA 3DLAA 3I9V2 4KNYA 3JAMK 3QU3A 4BE2A 3LSIA 2N8GA 3CCLI 3RYRA 3KFWX 3PUBA 5A2QK 5CQGA 2M3AA 2NOJB 3HOVJ 2DPUA 2FBIA 2Q8KA 1K4SA 2F5EA 5JLXA 2A6HF 2EWNA 3OIPA 2A07F 5IYDJ 4LD5A 4EM0B 4AUXA 5IOYA 2DA5A 3G1LA 2CUZA 2BXYA 1Q1VA 2XAJA 2VPRA 2D5VA 4YRVA 3FKIJ 1XSXA 2HPMA 3H35A 1JHFA 3CF2A 4A3LJ 4PCQA 3I4MJ 1EA3A 4NQWA 1O3QA 2WB1A 1X19A 1I6XA 1BIBA 3K4MA 2VT3A 4Y4RA 5GPCA 4II2A 5L3BA 2BEOA 3WHCA 1EF4A 3HXLA 1R6RA 1Z0XA 2A6TA 1JUSA 3K4LA 3ZP5A 1FNNA 1Z3XA 3J7AY 3W2AA 2LF7A 2QVOA 4ENMA 3I4NJ 4R1HA 3I58A 4BY1J 1IXSB 2IS4A 2FMYA 4IRGA 3A02A 4EEFG 2IS6A 4BEHA 3KYDB 4OOIA 3FF5A 1XTAA 4BXFA 3ERED 4M3EA 3Q0UA 2FEZA 3BJAA 5D5XB 1IN6A 1HQCA 4I6ZA 1MJ9A 1XGMA 3ZQ7A 5K7FA 3Q9VA 3S15J 3MD2A 1I5ZA 4Y15A 4LIUA 3RQIA 1A6QA 2WAQN 5FD5A 2JSCA 2K9LA 1IDZA 4MTDA 5DUIA 2R7TA 1PUFA 2IA2A 3IH3A 2EFNA 3K1NA 5DCFA 1Y0UA 4DJAA 1YX3A 3BR1A 2KKOA 1LNWA 2QQ8A 4DBQA 2HYGD 3FWEA 1VQPI 1GXQA 1BR2A 1ULYA 2CG4A 2DOAA 4NNJA 5BS6A 5HDGA 2W7NA 3Q0VA 1JKPC 2F5DA 1Z6TA 2R5YA 1JUPA 3MZYA 2A61A 1MW7A 2KP6A 3DQVC 2HOEA 4I99C 3OYFA 1XB4A 1NHAA 1KU9A 4JX4A 1R22A 1X1BA 1IDYA 4G7ZF 5GAHJ 2EINH 2KMUA 1XDUA 1FP2A 3RCOA 5CYVA 4A3DJ 2ZMEB 5E3LA 2L2OA 2YR2A 1ZR2A 1IN7A 4OMZA 5IP7J 1OYIA 1T0FC 2XAFA 5AIQA 3BG9A 3A03A 3COAC 1R4NB 3JRHA 2R7WA 1QZZA 1IF1A 2G0EA 1ZN2A 2VUMJ 1YX5A 3G6EI 1O7FA 2O7OA 3ML6A 3QU6A 2FF4A 3HIFA 4E7JA 3HKZN 2HYFA 3EUAA 3QP6A 3FXQA 2NVQJ 1IO2A 1SAXA 3AL0B 5D5WB 3QWLA 4A0YA 3CDHA 3S1QJ 4LITA 3OYEA 4DYRA 3PJRA 5LFAA 4FHTA 2NVXJ 2FA5A 5CQEA 3CD6I 2ZNYA 3F21A 1REPC 3PFYA 2IBDA 2NYXA 3JCUC 3VYUB 2GIZA 3E6DA 5M5WJ 4CA0A 2EV6A 1HW1A 4RMNA 5ILVA 2A69F 1OKRA 3HUGB 4EM1A 1ETOA 4NUBA 4UHTA 2EZKA 3C7JA 1MMGA 3FXMA 4IPAA 2OQGA 3LSKA 1B8IB 3AFHA 3O2PE 2L7ZA 2OD5A 1IV6A 2VE9A 1FZPB 1BM9A 1L0OC 4A0XA 2OQRA 1DU6A 2XB5A 3CJQB 1Z1DA 5D8KB 3FX3A 1VTNC 3EETA 1FBSA 1E3PA 5TISC 4BQOA 2V9PA 1Y6IA 4FX4A 3KYLA 1BL0A 2FU4A 1SD6A 4M3BA 5DS9A 3I59B 3ZQGA 4ASNA 4OINF 3AKZA 3HEFA 3RPUD 1GXPA 2CMPA 5LBQA 2ADUA 1D0YA 3N97A 5H6RA 2D45A 1TQMA 4ENJA 4XL9A 3FHZA 2E36A 3GTJJ 3P9IA 1VZ0A 3H9JA 5HNFA 3ZOBA 1PUEE 2UZKA 4F91B 4I2OA 5DM6F 3K6GA 3ABMH 3RKWA 1ZLJA 2P5VA 1IRZA 3GXOA 4XN0A 2DTZA 1JKQC 1S7AA 1S7OA 3KP7A 2K85A 1MDMA 3UNGC 1SEUA 3B6CA 1BC8C 1LFBA 1BOAA 3QYEA 2LSOA 3BC8A 1FX7A 2Y9ZA 3KEQA 4L0YB 3FDYA 5LHHA 2KJCA 3BR6A 2BZTA 2PLYA 4V19K 1TTYA 3D5SC 5L3FA 1U5TC 5HDKA 1OCOH 2OC6A 2COMA 2JMWA 1GLNA 2XPUA 4A3JJ 4G8XA 3RPUA 1UFMA 4PJJA 1FYLA 1UELB 3DU6A 4KISA 2KIMA 4CGZA 1G6NA 1MKMA 4HBLA 2KQRA 3H3UA 3DPUA 1KZHA 4L0ZB 3VDXA 2EA4A 2LRDA 1AKHB 3MMYB 2ZJRF 2L01A 1Y0NA 2BY3A 2YX7A 3DF8A 3WE2A 4MEXF 2H8RA 1STZA 4V2FA 5FROA 1RKTA 3ASOH 3NAUA 3MN2A 4HW0A 4EJWA 1W5TA 2VI6A 3LFKA 3FZVA 3FXJA 3O8HA 1TC3C 1WI3A 4M3GA 4CZZA 3CMEI 2YS9A 3OYDA 4PSXA 3ABTA 1X4PA 4E7HA 3BZKA 1A6IA 3CZ6A 4M9ZA 1FSHA 1IZ1A 4E7SA 5TGTA 2K5CA 3I56I 1O57A 2DODA 2F2EA 2CQXA 3K4BA 2BV6A 2JJ7A 4XKBA 4F92B 3S8PA 2IS1A 2EILH 5D5VB 2XF7A 4OAYA 3CDLA 4RB3C 3ZQCA 2XGEA 4HSRA 4Y33A 4D7NA 5JLWA 2DT6A 1B8IA 1KU2A 2RQPA 4WX9A 1U6GA 3H36A 1CF7A
chains in the Genus database with same CATH topology
4AIKA 5E18F 4G7HF 2G9WA 1LQ1A 2QYOA 4S05A 3BPVA 5FLXZ 3ZPLA 4OIRF 2K27A 1KU3A 4HX7A 3HOSA 2KIUA 2HKOA 4ON0A 3O3KA 2LF8A 3LQRA 5D4RA 4U0WA 3N4MA 4MNUA 2J5PA 3BPXA 3DKWA 3V7SA 4EMSA 1YIOA 1MGTA 3HRMA 4IVNA 4A5MA 2HEOA 4PZJA 3R6SA 3E6BA 4HV6A 3JW4A 4MTEA 4HLXA 4BHCA 4ZYGA 2IP2A 1FY7A 3T0YA 3SHFA 2STWA 3KP2A 4P9UA 5J8CA 3WTXC 1R5HA 3DXJF 4LG0A 3VFZA 1KU7A 3Q5FA 2DO7A 3F6VA 4I09A 1XMAA 2MH9A 1U5TA 4BQAA 4A2UA 1H9TA 5H20A 5E8IA 4EJUA 2RKHA 4HF2A 1H9GA 3JTGA 2GA2A 4XSZF 4HLYA 3CO7C 5LEKA 2JPBA 4M6YA 6PAXA 5BMZA 3C18A 3IRRA 1W7PB 1LDDA 2QWWA 1O7LA 4EJVA 2DFIA 5LHIA 3GYHX 2FRHA 5CVVA 4GGGA 2XAGA 1K79A 4EJOA 1ZGAA 2O3FA 5IT9K 3IKVA 3IRQA 4LK1F 2CWEA 3SXYA 1QGPA 5HS7A 3FXRA 5E1ZB 5BPDA 2UXNA 3GVAA 1K6OA 4M9XA 1S6LA 3LQQA 5BOXA 3TKYA 1PP7U 1BC7C 4Z2YA 2V79A 2YU3A 1YTYA 5LRRA 4KIGA 3C3WA 1XD7A 2JTVA 1IAWA 4WF2A 4OU0A 3D0SA 3E5UA 1FBQA 2HFHA 3H3ZA 5LHGA 3CJNA 4KA4A 4JK1X 5K5OA 2HS5A 1ONVA 3TO7A 4EGYA 2M30A 3JSPA 3RI4A 2FBHA 4KFCA 2EJRA 2RN7A 3I53A 4WXCA 1R1TA 3MEXA 3KLNA 5K5RA 1XCVA 3KE2A 3I4PA 3B73A 5CVUA 2VBYA 1FYKA 2C6YA 3RKXA 3RDIA 4L18B 3SFZA 3JTHA 5FB2A 3L9FA 1X3UA 4RGSA 1ZHFA 2K02A 3V8KA 2STTA 1G3TA 4ETSA 1FT9A 4IHSA 4ESBA 4Q4ZF 1RIOH 1K7AA 3KETA 4UV9A 2XAQA 4HDVA 3V4GA 3CUQA 1GHCA 1IN8A 1YW7A 3DV8A 1FYMA 4L9JA 4WXHA 4AVPA 2V1UA 1YW9A 1LEAA 1GVJA 2PEXA 1EV7A 2W25A 1ZARA 1KYZA 3FMSA 2PI0A 1KQ9A 5CLSA 5ERIA 3J80Z 2OAZA 1G4DA 1P4WA 2M45A 5DCMB 1ZAOA 1TQIA 2V6CA 3K1PA 2FSWA 3EYYA 3WTZA 2VODA 1A04A 3IWFA 2DW4A 2IT0A 2O03A 1XGNA 2G7UA 5BQTA 4UUVA 2HQNA 3WTYC 1ON1A 2EV5A 3KCCA 2A3SA 3ZMDA 1YQAA 3BOQA 3EUHA 2QUFA 1BI1A 4IF4A 2GIVA 1F9NA 5E8GA 4R8HA 2MC3A 1OYWA 4YIFA 3WU1B 3AAFA 1DPRA 1KQ0A 3R61A 2D1VA 2HTSA 1U3EM 3E3VA 1F1ZA 1BBYA 1SFXA 3R4KA 3M7GA 1MD0A 1R1VA 4KMFA 1G3YA 3TO9A 3RPQA 1K78B 2Z5UA 4DQ2A 5CJ9A 2QQ9A 4U7DA 1J7KA 2PN6A 2HWVA 3HRTA 3K1MA 3HYIA 2MLGA 2YSRA 1BI0A 3MWMA 4QWQA 1D8JA 3KZZA 2DAOA 1HW5A 4PGGA 2DPDA 2CQKA 5D6EA 3ZMVA 4B8XA 5LGTA 4OIPF 3D5LA 1R36A 4LB6B 4ENKA 3F8BA 2PQ8A 3ISPA 3ELKA 3WTVC 2BYVE 2ZO4A 3H92A 4P96A 2QBYB 2ZCWA 3KP6A 2P5KA 3DFGA 2EA2A 3LA3A 1T98A 1QO0D 2CYYA 3ULQB 1LEBA 2LDUA 2ZKZA 2VXZA 4UNOA 3DPTA 4OMYA 4R79A 1P4AA 2GA1A 4RGUA 2DU9A 4LLGF 3NQOA 4ESFA 2K4JA 4LLNA 4FT8A 3J81Z 3CUOA 3WTSC 2GQQA 1YS7A 1S8NA 3CTAA 1FOKA 2JRTA 1RUNA 2H09A 4WWCA 1FWZA 3LA7A 1LJ9A 1KYWA 1ZRDA 4IRHA 4HOBA 5E1XA 5K1YA 1LB2A 1SFUA 1D5VA 3FXUA 1P92A 4Q47A 3F8CA 1OR7A 5HS8A 3FM3A 2NS0A 3PQKA 1EH6A 3BJ6A 3TQNA 3FM5A 1O3TA 4PDKA 4RAZA 4UVCA 3K2ZA 1IN5A 1S29A 1E2XA 1WKMA 2BE5F 1AOYA 3K0LA 3GFLA 2XRNA 3F23A 4DNCA 3CLOA 1OMIA 3J7AO 5BPIA 2IPQX 2ZMEA 5EEGA 1I27A 3HRSA 2D1HA 3W6KB 2QQBA 1YFHA 1DPUA 3GF2A 3HHHA 1RNLA 3QAHA 4KMUX 2WTEA 3SQNA 1YW8A 2QENA 3WODF 2QBYA 1D3YA 1WWXA 1RI7A 2Y0MA 4JQFA 3JAMZ 4RGXA 3L7WA 2XAHA 2V9VA 2Z33A 5CVJA 2VONA 1B4AA 3M8FA 5CVIA 3ECHA 3E6MA 2GXGA 3TOBA 3WTUC 4U0VA 5FGMA 1ZREA 5F64A 1QQIA 4KUMA 1EH7A 3U9GA 2XKOA 4BXUA 3HUGA 2PG4A 1IXRC 1I1SA 3E5XA 4HF0A 1PP8F 1ZG1A 3VOEA 4N0BA 3ECOA 4Y13A 2M87A 3WGIA 3MQ0A 1P6RA 5L3DA 2Z9OA 2H94A 4L5JA 1ZG3A 3KP4A 4UVBA 3I59A 3ZN0A 4WXDA 2XVCA 3R0AA 1U78A 4BYYA 1XGOA 2NRAC 1ZYRF 5HOOA 4RS8A 4U7BA 2XUBA 5FFZA 3B02A 2DI3A 4G7OF 4L9NA 1HKSA 1T38A 2H27A 3K69A 2K4BA 4HA8A 3IHUA 4UVAA 1J9IA 2H6BA 5LGUA 4CDGA 4HF1A 3OOPA 4HX4A 4M72A 3HSEA 2A5YB 1TW2A 4GYGA 2OU2A 2YX4A 4UXNA 1QBJA 4G9YA 3WG9A 4HQMA 4Y17A 4IJAA 4LB5A 1LDKB 3QP5A 5E17F 2ZFWA 1TLHB 3G73A 2P5LC 5HVQC 1IRGA 5LRSA 4GCVA 1HSTA 2DLLA 4YIIA 3V7RA 1DP7P 5F1RA 2MA3A 1HXDA 2HZTA 4RAYA 2AS5F 1WSUA 3ZN1A 4HYEA 3V7CA 2P7VB 3CUQC 2VOPA 1ZRCA 2L3DA 3O6BB 1Z9CA 1QZYA 3KLOA 2DQRA 2R3SA 1MZBA 4RB0A 1SMTA 1FPQA 4BHPA 3L2CA 2RGVA 2M8EA 1BIAA 3LWFA 5DUKA 3BWGA 2ESNA 2K7LA 3WTTC 3W6JB 4FX0A 4RGRA 4XBFA 2O8XA 5JR3A 3RYPA 3F6OA 3NEUA 3NRVA 2FQ3A 2HGCA 3E6CC 4LJZF 1HKQA 3RJPA 4IXAA 1SD7A 3GEZA 4EGZA 1B9NA 3TDUC 3DPLC 3U1DA 4YFKF 4M73A 3FMQA 4BNCA 2JZYA 4PGHA 5HDNA 1QNTA 5JHUA 1FP1D 5D4SA 4LMYA 3P7NA 2Y48A 2VC1A 3KP3A 4KIFA 5FFXA 3TOAA 1UHWA 3Q9SA 1IRFA 2VT2A 2P6TA 2EFQA 4NHJA 1IXCA 1P2FA 1S3JA 1ZLKA 2GAUA 4G6QA 3U2RA 1IW7F 2NAZA 1WRJA 1YS6A 2M1BA 4F7ZA 4N9IA 1J0RA 1XDSA 4M71A 2LNBA 5ICEA 1JGSA 1T6SA 4I0AA 1XGSA 1YG2A 3E5QA 4MEYF 5ICCA 1E17A 1KA8A 4ZYDA 2L54A 1B1BA 4L5IA 2EB7A 3GW2A 3QPTA 3TO6A 1W7PA 2JT1A 3EDPA 4E70A 1QPMA 2QM3A 1IN4A 4G94A 1J59A 5HLHA 1RZ4A 2Y75A 1R5GA 4OIQF 4XSXF 3T8TA 2FE3A 2PMHA 4D0PA 4XLPF 2IVMA 2V1DA 2VE8A 4IRIA 4RB1A 4O6JA 4Q5SF 2FMLA 1O3RA 4MHGA 2YPRA 2DTRA 2QQAA 1W4MA 5ICFA 4ZYEA 2CGPA 2CFXA 3M1EA 3FMRA 5AONA 3F8MA 2XHKA 2ACJA 3V8LA 2P6SA 4AWXB 1F4KA 5AIPA 3REOA 1FC3A 1XMKA 2E7XA 2GZWA 5K5QA 3BP8A 1ZRFA 2M5WA 5FD6A 4LGWA 1Z91A 2FOKA 3ZMUA 3WE3A 4ZZDA 3CO6C 3QRFF 4M6XA 3I54A 3M9AA 4LFUA 4HZFA 2HTJA 4G6DA 3ZMZA 4OIOF 4L9TA 2O61A 2QZ8A 5HLIA 4EQQA 2L4AA 2GXBA 1SFEA 5FLXK 1D8KA 4S04A 1Q1HA 1B9MA 4A6DA 4ZZLA 5LLQA 3ROUA 5IT9Z 1MDMB 3P9CA 5JI6A 1RUOA 2VBXA 3P9KA 4P9FA 3F8NA 2K86A 4CYDA 3DEUA 3HRUA 1W5SA 3BJOA 4IHTA 2VBWA 4BHBA 2ELHA 3OV8A 1EH8A 3SZPA 4I98B 1ZG5A 2XASA 4UV8A 5DCMA 5IT3A 1Z6RA 2X0LA 2G7HA 3DP7A 1R7JA 1XCBA 3L00A 3I64A 3I5UA 3V8JA 2ISZA 3L09A 4KT5C 2JPCA 4XLNF 2E1CA 1C0WA 3HOTA 2CW0F 3ZMTA 3VEPA 1TQPA 4I01A 1AWCA 2RDPA 4EV0A 5JFRA 3R60A 2A68F 3JSOA 1MJAA 2LKPA 2L02A 2ZJ2A 3IC7A 2Q0OA 2NNNA 1DDNA 1T39A 1CF7B 5ILUA 2O6GE 4AIHA 2IRFG 4CXFA 2NNYA 5FO5A 5DEQA 2IA1A 4O3MA 5DD8A 1XN7A 2KJBA 1R23A 5L3CA 1I1GA 3I71A 3BZ6A 5EEHA 4KIBA 1K78A 2UWMA 5DDGA 5J6XA 1MJBA 1H0MA 2KRFA 4A5NA 1R1UA 4RB2C 1F5TA 4I02A 4GXOA 3ZMSA 1UHMA 1IUYA 2HDCA 5J8FA 2RC4A 2W84A 4Q48A 4I0BA 4U0YA 4N9HA 1YO5C 3GZ6A 3MAJA 3BDDA 3HTUA 1XSDA 3HSFA 2X4HA 3PQJA 5DD4A 2O0YA 2XROA 1HKTA 2R7FA 5ED4A 2F5CA 4HAMA 4YFXF 4CHUA 4P55A 3T1BA 3E97A 1KGSA 1YLFA 1ODDA 1TW3A 3GLXA 2ZNZA 3R0JA 4TV7A 3RIRA 1T2KA 3LAJA 5A2QZ 4XRFA 1HBXG 5E20A 1JHHA 1J75A 3SZTA 4KN7X 4A6EA 1L3LA 1DUXC 1Z05A 1USTA 4YG2F 4YFNF 2ZXJA 3S2WA 1ON2A 2OBPA 2ESHA 4JBAA 4LG0B 2B0LA 1UB9A 1U5TB 2H6CA 2OA4A 2W85A 4O5VA 3GZ5A 1KQ8A 1BI3A 4H0EA 1T0FA 1WQ2A 2Q2EA 2XIGA 4LK0F 2DK8A 3C1DA 5D5UB 2WWYA 4A0ZA 4A12A 2FNAA 1HW2A 2RNJA 4L9VA 3MZHA 4KYWA 1FSEA 4U88A 1V4RA 3PFIA 2RVCA 4HV5A 3GFMA 2MBFA 2IA0A 3GO5A 3F3XA 2EFWA 2PMUA 5TRDA 2D2WA 3RKYA 5F6FA 4LLLA 4BH9A 4GYIA 4HQEA 3M8EA 3HHGA 3IKTA 5LGNA 3WU0A 2J5OA 3F72A 1CGPA 2CSOA 5JVTA 2FNPA 5KK1A 3J80K 2WC2A 2IJLA 2E1NA 1G3SA 1BN5A 5HS9A 3F8FA 2OZ6A 1FLIA 3MCZA 3LAPA 2MD5A 1V3FA 3MFKA 4WCGA 3RTRA 4KDPA 2ZBKA 5D8LB 4CO8A 4MGRA 1JE8A 1USSA 2EFOA 5E1WA 1UCRA 2VC0A 2FXAA 1J2XA 5L3EA 3KEOA 1TNTA 5LEJA 5HLGA 2XV4S 1Z7UA 4ENNA 2P7CB 1YYVA 2RV8A 4K2EA 2W24A 2TDXA 1OYYA 5TJJA 3QPHA 2A6EF 5H6QA 2L4MA 2VBZA 1B6AA 3LSTA 3KZYA 4CICA 2R7DA 1TNSA 3WTWC 3IL2A 2DQLA 2P4WA 2OZUA 2XKPA 3EQLF 1ZH5A 4HX8A 3CUQB 2PJPA 5DYMA 2EFPA 4P5OA 2DT5A 3VB2A 1SMYF 3GX4X 2V1XA 4KICA 4AD9A 1P4XA 4EVIA 1FBUA 3K9TA 4GO1A 3KP5A 2BBYA 1R00A 4EM2A 4QLCU 2VN2A 2WV0A 3QOPA 4EJTA 1JXSA 4I7HA 3G3ZA 3HTSB 3F22A 4ESJA 4M74A 3T8RA 3IWZA 1TBXA 1OPCA 2UXXA 1U2WA 4NB5A 3TDZC 2BGCA 2XGXA 1W7PD 1WI9A 5ICGA 3TGNA 3GWZA 2W57A 2HR3A 2IW5A 4MQ9F 1PDNC 1G3WA 4MQVA 1BJAA 3GFIA 3J81K 4B09A 4WK8F 2ISYA 3LA2A 2KIFA 2HQRA 1B59A 2HKXA 4ZYHA 2AXLA 4HDUA 2EK5A 4ZH4F 2MLKA 2PBIA 2DBBA 3VODA 3GFJA 1J5YA 2DK5A 5CVRA 2CO5A 1U8RA 1LDJA 5DV5A 2MH2A 1XSVA 4M9SA 4KN4X 3WGGA 1O3SA 2VOOA 5L3GA 2P8TA 2ETHA 3I0TA 1LVAA 5D6FA 1SD5A 5KVRA 2EV0A 3GUDA 2F5FA 5ILSA 3ABUA 3EYIA 2Z99A 3T5XA 4BAYA 2FBKA 1ZGJA 1SD4A 2E7WA 3BROA 2QLZA 3HSRA 4AIJA 1BI2A 2Z3YA 2GWRA 1HSJA 3WGHA 1R58A 2PFBA 3BY6A 4KNYA 3JAMK 3QU3A 3RYRA 3KFWX 5A2QK 2DPUA 2FBIA 2Q8KA 2F5EA 2A6HF 2EWNA 2A07F 4LD5A 4EM0B 2XAJA 1XSXA 1JHFA 4PCQA 4NQWA 1O3QA 1I6XA 1BIBA 2VT3A 5L3BA 2BEOA 3ZP5A 1FNNA 2LF7A 2QVOA 4ENMA 4R1HA 3I58A 1IXSB 2FMYA 4IRGA 4OOIA 3FF5A 3ERED 2FEZA 3BJAA 5D5XB 1IN6A 1HQCA 1MJ9A 1XGMA 3ZQ7A 3Q9VA 1I5ZA 4Y15A 5FD5A 2JSCA 4MTDA 5DUIA 5DCFA 2IA2A 2EFNA 3K1NA 1Y0UA 2KKOA 1LNWA 2HYGD 3FWEA 1GXQA 1ULYA 2CG4A 5BS6A 5HDGA 2F5DA 1Z6TA 3MZYA 2A61A 3DQVC 2HOEA 1XB4A 1NHAA 1KU9A 1R22A 4G7ZF 1XDUA 1FP2A 5CYVA 2ZMEB 2YR2A 1IN7A 4OMZA 1OYIA 2XAFA 5AIQA 3COAC 1QZZA 1IF1A 1ZN2A 1O7FA 3ML6A 3QU6A 2FF4A 3HIFA 2HYFA 3QP6A 3FXQA 1SAXA 5D5WB 4A0YA 3CDHA 4FHTA 2FA5A 2ZNYA 3F21A 1REPC 2NYXA 3E6DA 2EV6A 1HW1A 5ILVA 2A69F 1OKRA 4EM1A 4UHTA 3C7JA 4IPAA 2OQGA 3O2PE 2OD5A 2VE9A 1FZPB 1BM9A 1L0OC 4A0XA 2OQRA 1Z1DA 5D8KB 3FX3A 1VTNC 3EETA 1FBSA 4FX4A 2FU4A 1SD6A 3I59B 4ASNA 4OINF 1GXPA 5LBQA 2ADUA 3N97A 5H6RA 2D45A 1TQMA 4ENJA 3FHZA 3P9IA 1PUEE 2UZKA 4I2OA 3RKWA 1ZLJA 2P5VA 3GXOA 1S7AA 1S7OA 3KP7A 1MDMA 1BC8C 1BOAA 2LSOA 1FX7A 3KEQA 4L0YB 5LHHA 2KJCA 2PLYA 1TTYA 5L3FA 1U5TC 5HDKA 2COMA 4G8XA 3RPUA 1UFMA 1FYLA 2KIMA 4CGZA 1G6NA 1MKMA 4HBLA 3H3UA 4L0ZB 2EA4A 2L01A 2YX7A 3DF8A 3WE2A 4MEXF 1STZA 4HW0A 4EJWA 1W5TA 3LFKA 3FZVA 4CZZA 3ABTA 4M9ZA 1FSHA 1IZ1A 1O57A 2F2EA 2BV6A 5D5VB 4RB3C 1KU2A 2RQPA 4WX9A 1U6GA 1CF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIK A;  5E18 F;  4G7H F;  2G9W A;  1LQ1 A;  2QYO A;  4S05 A;  3BPV A;  5FLX Z;  3ZPL A;  4OIR F;  2K27 A;  1KU3 A;  4HX7 A;  3HOS A;  2KIU A;  2HKO A;  4ON0 A;  3O3K A;  2LF8 A;  3LQR A;  5D4R A;  4U0W A;  3N4M A;  4MNU A;  2J5P A;  3BPX A;  3DKW A;  3V7S A;  4EMS A;  1YIO A;  1MGT A;  3HRM A;  4IVN A;  4A5M A;  2HEO A;  4PZJ A;  3R6S A;  3E6B A;  4HV6 A;  3JW4 A;  4MTE A;  4HLX A;  4BHC A;  4ZYG A;  2IP2 A;  1FY7 A;  3T0Y A;  3SHF A;  2STW A;  3KP2 A;  4P9U A;  5J8C A;  3WTX C;  1R5H A;  3DXJ F;  4LG0 A;  3VFZ A;  1KU7 A;  3Q5F A;  2DO7 A;  3F6V A;  4I09 A;  1XMA A;  2MH9 A;  1U5T A;  4BQA A;  4A2U A;  1H9T A;  5H20 A;  5E8I A;  4EJU A;  2RKH A;  4HF2 A;  1H9G A;  3JTG A;  2GA2 A;  4XSZ F;  4HLY A;  3CO7 C;  5LEK A;  2JPB A;  4M6Y A;  6PAX A;  5BMZ A;  3C18 A;  3IRR A;  1W7P B;  1LDD A;  2QWW A;  1O7L A;  4EJV A;  2DFI A;  5LHI A;  3GYH X;  2FRH A;  5CVV A;  4GGG A;  2XAG A;  1K79 A;  4EJO A;  1ZGA A;  2O3F A;  5IT9 K;  3IKV A;  3IRQ A;  4LK1 F;  2CWE A;  3SXY A;  1QGP A;  5HS7 A;  3FXR A;  5E1Z B;  5BPD A;  2UXN A;  3GVA A;  1K6O A;  4M9X A;  1S6L A;  3LQQ A;  5BOX A;  3TKY A;  1PP7 U;  1BC7 C;  4Z2Y A;  2V79 A;  2YU3 A;  1YTY A;  5LRR A;  4KIG A;  3C3W A;  1XD7 A;  2JTV A;  1IAW A;  4WF2 A;  4OU0 A;  3D0S A;  3E5U A;  1FBQ A;  2HFH A;  3H3Z A;  5LHG A;  3CJN A;  4KA4 A;  4JK1 X;  5K5O A;  2HS5 A;  1ONV A;  3TO7 A;  4EGY A;  2M30 A;  3JSP A;  3RI4 A;  2FBH A;  4KFC A;  2EJR A;  2RN7 A;  3I53 A;  4WXC A;  1R1T A;  3MEX A;  3KLN A;  5K5R A;  1XCV A;  3KE2 A;  3I4P A;  3B73 A;  5CVU A;  2VBY A;  1FYK A;  2C6Y A;  3RKX A;  3RDI A;  4L18 B;  3SFZ A;  3JTH A;  5FB2 A;  3L9F A;  1X3U A;  4RGS A;  1ZHF A;  2K02 A;  3V8K A;  2STT A;  1G3T A;  4ETS A;  1FT9 A;  4IHS A;  4ESB A;  4Q4Z F;  1RIO H;  1K7A A;  3KET A;  4UV9 A;  2XAQ A;  4HDV A;  3V4G A;  3CUQ A;  1GHC A;  1IN8 A;  1YW7 A;  3DV8 A;  1FYM A;  4L9J A;  4WXH A;  4AVP A;  2V1U A;  1YW9 A;  1LEA A;  1GVJ A;  2PEX A;  1EV7 A;  2W25 A;  1ZAR A;  1KYZ A;  3FMS A;  2PI0 A;  1KQ9 A;  5CLS A;  5ERI A;  3J80 Z;  2OAZ A;  1G4D A;  1P4W A;  2M45 A;  5DCM B;  1ZAO A;  1TQI A;  2V6C A;  3K1P A;  2FSW A;  3EYY A;  3WTZ A;  2VOD A;  1A04 A;  3IWF A;  2DW4 A;  2IT0 A;  2O03 A;  1XGN A;  2G7U A;  5BQT A;  4UUV A;  2HQN A;  3WTY C;  1ON1 A;  2EV5 A;  3KCC A;  2A3S A;  3ZMD A;  1YQA A;  3BOQ A;  3EUH A;  2QUF A;  1BI1 A;  4IF4 A;  2GIV A;  1F9N A;  5E8G A;  4R8H A;  2MC3 A;  1OYW A;  4YIF A;  3WU1 B;  3AAF A;  1DPR A;  1KQ0 A;  3R61 A;  2D1V A;  2HTS A;  1U3E M;  3E3V A;  1F1Z A;  1BBY A;  1SFX A;  3R4K A;  3M7G A;  1MD0 A;  1R1V A;  4KMF A;  1G3Y A;  3TO9 A;  3RPQ A;  1K78 B;  2Z5U A;  4DQ2 A;  5CJ9 A;  2QQ9 A;  4U7D A;  1J7K A;  2PN6 A;  2HWV A;  3HRT A;  3K1M A;  3HYI A;  2MLG A;  2YSR A;  1BI0 A;  3MWM A;  4QWQ A;  1D8J A;  3KZZ A;  2DAO A;  1HW5 A;  4PGG A;  2DPD A;  2CQK A;  5D6E A;  3ZMV A;  4B8X A;  5LGT A;  4OIP F;  3D5L A;  1R36 A;  4LB6 B;  4ENK A;  3F8B A;  2PQ8 A;  3ISP A;  3ELK A;  3WTV C;  2BYV E;  2ZO4 A;  3H92 A;  4P96 A;  2QBY B;  2ZCW A;  3KP6 A;  2P5K A;  3DFG A;  2EA2 A;  3LA3 A;  1T98 A;  1QO0 D;  2CYY A;  3ULQ B;  1LEB A;  2LDU A;  2ZKZ A;  2VXZ A;  4UNO A;  3DPT A;  4OMY A;  4R79 A;  1P4A A;  2GA1 A;  4RGU A;  2DU9 A;  4LLG F;  3NQO A;  4ESF A;  2K4J A;  4LLN A;  4FT8 A;  3J81 Z;  3CUO A;  3WTS C;  2GQQ A;  1YS7 A;  1S8N A;  3CTA A;  1FOK A;  2JRT A;  1RUN A;  2H09 A;  4WWC A;  1FWZ A;  3LA7 A;  1LJ9 A;  1KYW A;  1ZRD A;  4IRH A;  4HOB A;  5E1X A;  5K1Y A;  1LB2 A;  1SFU A;  1D5V A;  3FXU A;  1P92 A;  4Q47 A;  3F8C A;  1OR7 A;  5HS8 A;  3FM3 A;  2NS0 A;  3PQK A;  1EH6 A;  3BJ6 A;  3TQN A;  3FM5 A;  1O3T A;  4PDK A;  4RAZ A;  4UVC A;  3K2Z A;  1IN5 A;  1S29 A;  1E2X A;  1WKM A;  2BE5 F;  1AOY A;  3K0L A;  3GFL A;  2XRN A;  3F23 A;  4DNC A;  3CLO A;  1OMI A;  3J7A O;  5BPI A;  2IPQ X;  2ZME A;  5EEG A;  1I27 A;  3HRS A;  2D1H A;  3W6K B;  2QQB A;  1YFH A;  1DPU A;  3GF2 A;  3HHH A;  1RNL A;  3QAH A;  4KMU X;  2WTE A;  3SQN A;  1YW8 A;  2QEN A;  3WOD F;  2QBY A;  1D3Y A;  1WWX A;  1RI7 A;  2Y0M A;  4JQF A;  3JAM Z;  4RGX A;  3L7W A;  2XAH A;  2V9V A;  2Z33 A;  5CVJ A;  2VON A;  1B4A A;  3M8F A;  5CVI A;  3ECH A;  3E6M A;  2GXG A;  3TOB A;  3WTU C;  4U0V A;  5FGM A;  1ZRE A;  5F64 A;  1QQI A;  4KUM A;  1EH7 A;  3U9G A;  2XKO A;  4BXU A;  3HUG A;  2PG4 A;  1IXR C;  1I1S A;  3E5X A;  4HF0 A;  1PP8 F;  1ZG1 A;  3VOE A;  4N0B A;  3ECO A;  4Y13 A;  2M87 A;  3WGI A;  3MQ0 A;  1P6R A;  5L3D A;  2Z9O A;  2H94 A;  4L5J A;  1ZG3 A;  3KP4 A;  4UVB A;  3I59 A;  3ZN0 A;  4WXD A;  2XVC A;  3R0A A;  1U78 A;  4BYY A;  1XGO A;  2NRA C;  1ZYR F;  5HOO A;  4RS8 A;  4U7B A;  2XUB A;  5FFZ A;  3B02 A;  2DI3 A;  4G7O F;  4L9N A;  1HKS A;  1T38 A;  2H27 A;  3K69 A;  2K4B A;  4HA8 A;  3IHU A;  4UVA A;  1J9I A;  2H6B A;  5LGU A;  4CDG A;  4HF1 A;  3OOP A;  4HX4 A;  4M72 A;  3HSE A;  2A5Y B;  1TW2 A;  4GYG A;  2OU2 A;  2YX4 A;  4UXN A;  1QBJ A;  4G9Y A;  3WG9 A;  4HQM A;  4Y17 A;  4IJA A;  4LB5 A;  1LDK B;  3QP5 A;  5E17 F;  2ZFW A;  1TLH B;  3G73 A;  2P5L C;  5HVQ C;  1IRG A;  5LRS A;  4GCV A;  1HST A;  2DLL A;  4YII A;  3V7R A;  1DP7 P;  5F1R A;  2MA3 A;  1HXD A;  2HZT A;  4RAY A;  2AS5 F;  1WSU A;  3ZN1 A;  4HYE A;  3V7C A;  2P7V B;  3CUQ C;  2VOP A;  1ZRC A;  2L3D A;  3O6B B;  1Z9C A;  1QZY A;  3KLO A;  2DQR A;  2R3S A;  1MZB A;  4RB0 A;  1SMT A;  1FPQ A;  4BHP A;  3L2C A;  2RGV A;  2M8E A;  1BIA A;  3LWF A;  5DUK A;  3BWG A;  2ESN A;  2K7L A;  3WTT C;  3W6J B;  4FX0 A;  4RGR A;  4XBF A;  2O8X A;  5JR3 A;  3RYP A;  3F6O A;  3NEU A;  3NRV A;  2FQ3 A;  2HGC A;  3E6C C;  4LJZ F;  1HKQ A;  3RJP A;  4IXA A;  1SD7 A;  3GEZ A;  4EGZ A;  1B9N A;  3TDU C;  3DPL C;  3U1D A;  4YFK F;  4M73 A;  3FMQ A;  4BNC A;  2JZY A;  4PGH A;  5HDN A;  1QNT A;  5JHU A;  1FP1 D;  5D4S A;  4LMY A;  3P7N A;  2Y48 A;  2VC1 A;  3KP3 A;  4KIF A;  5FFX A;  3TOA A;  1UHW A;  3Q9S A;  1IRF A;  2VT2 A;  2P6T A;  2EFQ A;  4NHJ A;  1IXC A;  1P2F A;  1S3J A;  1ZLK A;  2GAU A;  4G6Q A;  3U2R A;  1IW7 F;  2NAZ A;  1WRJ A;  1YS6 A;  2M1B A;  4F7Z A;  4N9I A;  1J0R A;  1XDS A;  4M71 A;  2LNB A;  5ICE A;  1JGS A;  1T6S A;  4I0A A;  1XGS A;  1YG2 A;  3E5Q A;  4MEY F;  5ICC A;  1E17 A;  1KA8 A;  4ZYD A;  2L54 A;  1B1B A;  4L5I A;  2EB7 A;  3GW2 A;  3QPT A;  3TO6 A;  1W7P A;  2JT1 A;  3EDP A;  4E70 A;  1QPM A;  2QM3 A;  1IN4 A;  4G94 A;  1J59 A;  5HLH A;  1RZ4 A;  2Y75 A;  1R5G A;  4OIQ F;  4XSX F;  3T8T A;  2FE3 A;  2PMH A;  4D0P A;  4XLP F;  2IVM A;  2V1D A;  2VE8 A;  4IRI A;  4RB1 A;  4O6J A;  4Q5S F;  2FML A;  1O3R A;  4MHG A;  2YPR A;  2DTR A;  2QQA A;  1W4M A;  5ICF A;  4ZYE A;  2CGP A;  2CFX A;  3M1E A;  3FMR A;  5AON A;  3F8M A;  2XHK A;  2ACJ A;  3V8L A;  2P6S A;  4AWX B;  1F4K A;  5AIP A;  3REO A;  1FC3 A;  1XMK A;  2E7X A;  2GZW A;  5K5Q A;  3BP8 A;  1ZRF A;  2M5W A;  5FD6 A;  4LGW A;  1Z91 A;  2FOK A;  3ZMU A;  3WE3 A;  4ZZD A;  3CO6 C;  3QRF F;  4M6X A;  3I54 A;  3M9A A;  4LFU A;  4HZF A;  2HTJ A;  4G6D A;  3ZMZ A;  4OIO F;  4L9T A;  2O61 A;  2QZ8 A;  5HLI A;  4EQQ A;  2L4A A;  2GXB A;  1SFE A;  5FLX K;  1D8K A;  4S04 A;  1Q1H A;  1B9M A;  4A6D A;  4ZZL A;  5LLQ A;  3ROU A;  5IT9 Z;  1MDM B;  3P9C A;  5JI6 A;  1RUO A;  2VBX A;  3P9K A;  4P9F A;  3F8N A;  2K86 A;  4CYD A;  3DEU A;  3HRU A;  1W5S A;  3BJO A;  4IHT A;  2VBW A;  4BHB A;  2ELH A;  3OV8 A;  1EH8 A;  3SZP A;  4I98 B;  1ZG5 A;  2XAS A;  4UV8 A;  5DCM A;  5IT3 A;  1Z6R A;  2X0L A;  2G7H A;  3DP7 A;  1R7J A;  1XCB A;  3L00 A;  3I64 A;  3I5U A;  3V8J A;  2ISZ A;  3L09 A;  4KT5 C;  2JPC A;  4XLN F;  2E1C A;  1C0W A;  3HOT A;  2CW0 F;  3ZMT A;  3VEP A;  1TQP A;  4I01 A;  1AWC A;  2RDP A;  4EV0 A;  5JFR A;  3R60 A;  2A68 F;  3JSO A;  1MJA A;  2LKP A;  2L02 A;  2ZJ2 A;  3IC7 A;  2Q0O A;  2NNN A;  1DDN A;  1T39 A;  1CF7 B;  5ILU A;  2O6G E;  4AIH A;  2IRF G;  4CXF A;  2NNY A;  5FO5 A;  5DEQ A;  2IA1 A;  4O3M A;  5DD8 A;  1XN7 A;  2KJB A;  1R23 A;  5L3C A;  1I1G A;  3I71 A;  3BZ6 A;  5EEH A;  4KIB A;  1K78 A;  2UWM A;  5DDG A;  5J6X A;  1MJB A;  1H0M A;  2KRF A;  4A5N A;  1R1U A;  4RB2 C;  1F5T A;  4I02 A;  4GXO A;  3ZMS A;  1UHM A;  1IUY A;  2HDC A;  5J8F A;  2RC4 A;  2W84 A;  4Q48 A;  4I0B A;  4U0Y A;  4N9H A;  1YO5 C;  3GZ6 A;  3MAJ A;  3BDD A;  3HTU A;  1XSD A;  3HSF A;  2X4H A;  3PQJ A;  5DD4 A;  2O0Y A;  2XRO A;  1HKT A;  2R7F A;  5ED4 A;  2F5C A;  4HAM A;  4YFX F;  4CHU A;  4P55 A;  3T1B A;  3E97 A;  1KGS A;  1YLF A;  1ODD A;  1TW3 A;  3GLX A;  2ZNZ A;  3R0J A;  4TV7 A;  3RIR A;  1T2K A;  3LAJ A;  5A2Q Z;  4XRF A;  1HBX G;  5E20 A;  1JHH A;  1J75 A;  3SZT A;  4KN7 X;  4A6E A;  1L3L A;  1DUX C;  1Z05 A;  1UST A;  4YG2 F;  4YFN F;  2ZXJ A;  3S2W A;  1ON2 A;  2OBP A;  2ESH A;  4JBA A;  4LG0 B;  2B0L A;  1UB9 A;  1U5T B;  2H6C A;  2OA4 A;  2W85 A;  4O5V A;  3GZ5 A;  1KQ8 A;  1BI3 A;  4H0E A;  1T0F A;  1WQ2 A;  2Q2E A;  2XIG A;  4LK0 F;  2DK8 A;  3C1D A;  5D5U B;  2WWY A;  4A0Z A;  4A12 A;  2FNA A;  1HW2 A;  2RNJ A;  4L9V A;  3MZH A;  4KYW A;  1FSE A;  4U88 A;  1V4R A;  3PFI A;  2RVC A;  4HV5 A;  3GFM A;  2MBF A;  2IA0 A;  3GO5 A;  3F3X A;  2EFW A;  2PMU A;  5TRD A;  2D2W A;  3RKY A;  5F6F A;  4LLL A;  4BH9 A;  4GYI A;  4HQE A;  3M8E A;  3HHG A;  3IKT A;  5LGN A;  3WU0 A;  2J5O A;  3F72 A;  1CGP A;  2CSO A;  5JVT A;  2FNP A;  5KK1 A;  3J80 K;  2WC2 A;  2IJL A;  2E1N A;  1G3S A;  1BN5 A;  5HS9 A;  3F8F A;  2OZ6 A;  1FLI A;  3MCZ A;  3LAP A;  2MD5 A;  1V3F A;  3MFK A;  4WCG A;  3RTR A;  4KDP A;  2ZBK A;  5D8L B;  4CO8 A;  4MGR A;  1JE8 A;  1USS A;  2EFO A;  5E1W A;  1UCR A;  2VC0 A;  2FXA A;  1J2X A;  5L3E A;  3KEO A;  1TNT A;  5LEJ A;  5HLG A;  2XV4 S;  1Z7U A;  4ENN A;  2P7C B;  1YYV A;  2RV8 A;  4K2E A;  2W24 A;  2TDX A;  1OYY A;  5TJJ A;  3QPH A;  2A6E F;  5H6Q A;  2L4M A;  2VBZ A;  1B6A A;  3LST A;  3KZY A;  4CIC A;  2R7D A;  1TNS A;  3WTW C;  3IL2 A;  2DQL A;  2P4W A;  2OZU A;  2XKP A;  3EQL F;  1ZH5 A;  4HX8 A;  3CUQ B;  2PJP A;  5DYM A;  2EFP A;  4P5O A;  2DT5 A;  3VB2 A;  1SMY F;  3GX4 X;  2V1X A;  4KIC A;  4AD9 A;  1P4X A;  4EVI A;  1FBU A;  3K9T A;  4GO1 A;  3KP5 A;  2BBY A;  1R00 A;  4EM2 A;  4QLC U;  2VN2 A;  2WV0 A;  3QOP A;  4EJT A;  1JXS A;  4I7H A;  3G3Z A;  3HTS B;  3F22 A;  4ESJ A;  4M74 A;  3T8R A;  3IWZ A;  1TBX A;  1OPC A;  2UXX A;  1U2W A;  4NB5 A;  3TDZ C;  2BGC A;  2XGX A;  1W7P D;  1WI9 A;  5ICG A;  3TGN A;  3GWZ A;  2W57 A;  2HR3 A;  2IW5 A;  4MQ9 F;  1PDN C;  1G3W A;  4MQV A;  1BJA A;  3GFI A;  3J81 K;  4B09 A;  4WK8 F;  2ISY A;  3LA2 A;  2KIF A;  2HQR A;  1B59 A;  2HKX A;  4ZYH A;  2AXL A;  4HDU A;  2EK5 A;  4ZH4 F;  2MLK A;  2PBI A;  2DBB A;  3VOD A;  3GFJ A;  1J5Y A;  2DK5 A;  5CVR A;  2CO5 A;  1U8R A;  1LDJ A;  5DV5 A;  2MH2 A;  1XSV A;  4M9S A;  4KN4 X;  3WGG A;  1O3S A;  2VOO A;  5L3G A;  2P8T A;  2ETH A;  3I0T A;  1LVA A;  5D6F A;  1SD5 A;  5KVR A;  2EV0 A;  3GUD A;  2F5F A;  5ILS A;  3ABU A;  3EYI A;  2Z99 A;  3T5X A;  4BAY A;  2FBK A;  1ZGJ A;  1SD4 A;  2E7W A;  3BRO A;  2QLZ A;  3HSR A;  4AIJ A;  1BI2 A;  2Z3Y A;  2GWR A;  1HSJ A;  3WGH A;  1R58 A;  2PFB A;  3BY6 A;  4KNY A;  3JAM K;  3QU3 A;  3RYR A;  3KFW X;  5A2Q K;  2DPU A;  2FBI A;  2Q8K A;  2F5E A;  2A6H F;  2EWN A;  2A07 F;  4LD5 A;  4EM0 B;  2XAJ A;  1XSX A;  1JHF A;  4PCQ A;  4NQW A;  1O3Q A;  1I6X A;  1BIB A;  2VT3 A;  5L3B A;  2BEO A;  3ZP5 A;  1FNN A;  2LF7 A;  2QVO A;  4ENM A;  4R1H A;  3I58 A;  1IXS B;  2FMY A;  4IRG A;  4OOI A;  3FF5 A;  3ERE D;  2FEZ A;  3BJA A;  5D5X B;  1IN6 A;  1HQC A;  1MJ9 A;  1XGM A;  3ZQ7 A;  3Q9V A;  1I5Z A;  4Y15 A;  5FD5 A;  2JSC A;  4MTD A;  5DUI A;  5DCF A;  2IA2 A;  2EFN A;  3K1N A;  1Y0U A;  2KKO A;  1LNW A;  2HYG D;  3FWE A;  1GXQ A;  1ULY A;  2CG4 A;  5BS6 A;  5HDG A;  2F5D A;  1Z6T A;  3MZY A;  2A61 A;  3DQV C;  2HOE A;  1XB4 A;  1NHA A;  1KU9 A;  1R22 A;  4G7Z F;  1XDU A;  1FP2 A;  5CYV A;  2ZME B;  2YR2 A;  1IN7 A;  4OMZ A;  1OYI A;  2XAF A;  5AIQ A;  3COA C;  1QZZ A;  1IF1 A;  1ZN2 A;  1O7F A;  3ML6 A;  3QU6 A;  2FF4 A;  3HIF A;  2HYF A;  3QP6 A;  3FXQ A;  1SAX A;  5D5W B;  4A0Y A;  3CDH A;  4FHT A;  2FA5 A;  2ZNY A;  3F21 A;  1REP C;  2NYX A;  3E6D A;  2EV6 A;  1HW1 A;  5ILV A;  2A69 F;  1OKR A;  4EM1 A;  4UHT A;  3C7J A;  4IPA A;  2OQG A;  3O2P E;  2OD5 A;  2VE9 A;  1FZP B;  1BM9 A;  1L0O C;  4A0X A;  2OQR A;  1Z1D A;  5D8K B;  3FX3 A;  1VTN C;  3EET A;  1FBS A;  4FX4 A;  2FU4 A;  1SD6 A;  3I59 B;  4ASN A;  4OIN F;  1GXP A;  5LBQ A;  2ADU A;  3N97 A;  5H6R A;  2D45 A;  1TQM A;  4ENJ A;  3FHZ A;  3P9I A;  1PUE E;  2UZK A;  4I2O A;  3RKW A;  1ZLJ A;  2P5V A;  3GXO A;  1S7A A;  1S7O A;  3KP7 A;  1MDM A;  1BC8 C;  1BOA A;  2LSO A;  1FX7 A;  3KEQ A;  4L0Y B;  5LHH A;  2KJC A;  2PLY A;  1TTY A;  5L3F A;  1U5T C;  5HDK A;  2COM A;  4G8X A;  3RPU A;  1UFM A;  1FYL A;  2KIM A;  4CGZ A;  1G6N A;  1MKM A;  4HBL A;  3H3U A;  4L0Z B;  2EA4 A;  2L01 A;  2YX7 A;  3DF8 A;  3WE2 A;  4MEX F;  1STZ A;  4HW0 A;  4EJW A;  1W5T A;  3LFK A;  3FZV A;  4CZZ A;  3ABT A;  4M9Z A;  1FSH A;  1IZ1 A;  1O57 A;  2F2E A;  2BV6 A;  5D5V B;  4RB3 C;  1KU2 A;  2RQP A;  4WX9 A;  1U6G A;  1CF7 A; 
#chains in the Genus database with same CATH topology
 4AIK A;  2IGK A;  5E18 F;  4G7H F;  3NWS A;  2G9W A;  1LQ1 A;  2QYO A;  4S05 A;  3DCF A;  1SAN A;  2HXO A;  2L9S A;  3BPV A;  5FLX Z;  4CCJ A;  3ZPL A;  4OIR F;  1X3Z B;  3JRF A;  2K27 A;  2JWT A;  2W48 A;  1KU3 A;  2OJE D;  1WJC A;  2KDZ A;  4HX7 A;  3HOS A;  1NH3 A;  2NS7 A;  1S5L C;  2ECB A;  2R7S A;  2KIU A;  5KHD A;  3DTK A;  3GTP J;  2HKO A;  4G12 A;  1R5I D;  2VQG A;  4ON0 A;  4RAF A;  1T56 A;  3O3K A;  2DMP A;  2LF8 A;  3OS1 A;  3LQR A;  2F5V A;  5D4R A;  2OTJ I;  3HGY A;  4U0W A;  2E1M C;  5IYB J;  3N4M A;  3H5A A;  5KAI C;  4MNU A;  3OYJ A;  2J5P A;  3BPX A;  3DKW A;  3OYM A;  3V7S A;  4EMS A;  4NC6 A;  1YIO A;  5F0F A;  1MGT A;  4XMY A;  2JN6 A;  4BL0 B;  2R7R A;  3HRM A;  4IVN A;  1QVT A;  1VI0 A;  4A5M A;  2HEO A;  4PZJ A;  2FOW A;  4BGD A;  4XKV A;  3R6S A;  3E6B A;  1I3A A;  4HV6 A;  3JW4 A;  3H0G J;  4HLX A;  2VIX A;  4MTE A;  4BHC A;  4ZYG A;  2QKM B;  4PJN A;  4XK4 A;  2IP2 A;  1FY7 A;  3CCR I;  2ZXH A;  4D9J A;  3T0Y A;  3SHF A;  2STW A;  1JGG A;  5C4X J;  1XX5 A;  1GV2 A;  1BJZ A;  3VSL A;  3OYL A;  2QKL B;  3KP2 A;  4P9U A;  5J8C A;  2LMD A;  5GAG J;  3WTX C;  4J00 A;  4IQJ A;  1R5H A;  3DXJ F;  4LG0 A;  3PUF A;  3VFZ A;  4HG2 A;  3LSR A;  1KU7 A;  3Q5F A;  2DO7 A;  3F6V A;  4D1Q A;  3S2H J;  4I09 A;  3AG2 H;  3RKQ A;  1XMA A;  2LY9 A;  2MH9 A;  1U5T A;  5M5X J;  3BTI A;  4FCY A;  4BJ6 C;  1D0Z A;  1N75 A;  4BQA A;  1JJ6 C;  2F4I A;  4A2U A;  2XGC A;  2ZFU A;  1H9T A;  3UR3 C;  4NC8 A;  5H20 A;  5E8I A;  1RKW A;  4EJU A;  2RKH A;  4HF2 A;  1H9G A;  3OWT A;  4B47 A;  3JTG A;  2GA2 A;  4XSZ F;  4HLY A;  5E3N A;  4BDZ A;  4KIT B;  2LC2 A;  4IOC F;  2BW3 A;  3CO7 C;  5LEK A;  2JPB A;  4M6Y A;  1WHU A;  6PAX A;  2CW8 A;  5BMZ A;  3C18 A;  3IRR A;  1W7P B;  1LDD A;  2QWW A;  2RNG A;  1ETQ A;  1O7L A;  4EJV A;  2DFI A;  5LHI A;  1VQ8 I;  3GYH X;  3G1M A;  2FRH A;  2FX0 A;  1X1D A;  5CVV A;  4GGG A;  5IPA A;  1WH7 A;  2DA6 A;  2XAG A;  1K79 A;  4EJO A;  2L7K A;  1ZGA A;  2O3F A;  5IT9 K;  3IKV A;  3IRQ A;  2ID6 A;  2NS8 A;  3HM5 A;  4LK1 F;  4N4O B;  3DEE A;  2CWE A;  3SXY A;  1QGP A;  3CJR B;  5HS7 A;  2AHQ A;  4BU2 A;  4FE4 A;  3FXR A;  3HG9 A;  4Z6Y A;  5E1Z B;  5BPD A;  1VQ7 I;  2UXN A;  2LYC A;  3CCJ I;  1TWH J;  3GVA A;  1K6O A;  5F08 A;  4M9X A;  2E34 A;  5EF6 A;  1S6L A;  1F36 A;  3CCM I;  3G4S I;  3LQQ A;  3CMA I;  3H1C A;  2I10 A;  1G59 A;  5BOX A;  4MO7 A;  3HGG A;  3TKY A;  2K9S A;  1PP7 U;  1GUU A;  1ETX A;  2VKV A;  3N05 A;  1BC7 C;  2KDO A;  4Z2Y A;  1SVM A;  4ZDO A;  1NG7 A;  3HOZ J;  2JUC A;  2V79 A;  2YU3 A;  1YTY A;  1R49 A;  5LRR A;  4KIG A;  2E60 A;  3C3W A;  1XD7 A;  2JTV A;  4FTH A;  1IAW A;  4WF2 A;  5IOZ A;  3ZQL A;  4OU0 A;  2PMZ N;  3D0S A;  3E5U A;  3TP3 A;  2EQR A;  4XR6 A;  2CH0 A;  2ELK A;  3GTL J;  4DBR A;  4E7Z A;  5J40 A;  1Z7L A;  3WHB A;  1FBQ A;  5EDN A;  2HFH A;  3H3Z A;  1I50 J;  2XRL A;  2CQN A;  3BQY A;  2QSG X;  5LHG A;  3CJN A;  4KA4 A;  1YHQ I;  2M0M A;  2P0W A;  4JK1 X;  5K5O A;  2EPF A;  3NAR A;  2HS5 A;  2RQQ A;  1YJ9 I;  4QTR A;  5FLM J;  1UG0 A;  4UUS B;  2GOX B;  1ONV A;  3TO7 A;  4NBQ A;  2M30 A;  4EGY A;  4MFE A;  4DYQ A;  3OR2 C;  3JSP A;  1W0U A;  2O8K A;  1K61 A;  3RI4 A;  2FBH A;  5GAD J;  3A1Y A;  4KFC A;  2EJR A;  2RN7 A;  3AG4 H;  3I53 A;  2DA4 A;  4WXC A;  1R1T A;  3SDB A;  3MEX A;  3VPR A;  3KLN A;  3JRI A;  5J3L A;  3U1K A;  3VSK A;  3IH4 A;  4J19 A;  5K5R A;  1XCV A;  3KE2 A;  3I4P A;  1CQT A;  1MBG A;  4HNV A;  2M2E A;  1U0J A;  3B73 A;  1E0E A;  5CVU A;  2VBY A;  4ZDL A;  2VQL A;  1FYK A;  3BZC A;  3RKX A;  2C6Y A;  3RDI A;  5H2F C;  3SFZ A;  4L18 B;  3JTH A;  3OSG A;  5E3M A;  4XID A;  1IC8 A;  5FB2 A;  3L9F A;  1X3U A;  4RGS A;  4ZJZ A;  1UAA A;  1ZHF A;  2K02 A;  3V8K A;  4CUG A;  3PL8 A;  2B9S A;  2STT A;  2F4M B;  2X51 A;  1G3T A;  1YIJ I;  4ETS A;  5DM7 F;  3I55 I;  2F4O B;  4A3G J;  1FT9 A;  5F04 A;  5J1U A;  4IHS A;  4ESB A;  4Q4Z F;  3DBH B;  1RIO H;  1K7A A;  4B44 A;  2Y69 H;  3KET A;  2RAE A;  4UV9 A;  2XAQ A;  1VQO I;  4HDV A;  2L9R A;  2X85 A;  3V4G A;  3OR1 C;  1ZKG A;  3CUQ A;  1FIP A;  3GZN B;  1GHC A;  1IN8 A;  2B63 J;  1ETW A;  1YW7 A;  4NDL A;  3DV8 A;  1FYM A;  4L9J A;  4WXH A;  4AVP A;  2PX9 A;  2JVG A;  1JKO C;  2V1U A;  1YW9 A;  2L0K A;  3CCV I;  1FTZ A;  1LEA A;  1MIJ A;  3MKZ A;  1GVJ A;  2JA7 J;  2PEX A;  5K7Z A;  4HST A;  1QA6 A;  1EV7 A;  2W25 A;  3SFI A;  1ZAR A;  1KYZ A;  4Y3O A;  3FMS A;  2PI0 A;  3IAM 2;  1TT0 A;  3IH2 A;  4F3Q A;  1KQ9 A;  2NVU B;  5CLS A;  5ERI A;  3J80 Z;  2OAZ A;  2MAB A;  1G4D A;  1P4W A;  5EEA A;  1R71 A;  1B72 A;  4CCM A;  2M45 A;  2DT7 B;  5DCM B;  4E6K G;  1ZAO A;  1TQI A;  2V6C A;  2XC7 A;  3K1P A;  2FSW A;  3BR5 A;  3EYY A;  4A3E J;  2DYR H;  5JVG F;  4NC7 A;  2QSH X;  2KIS A;  1R9T J;  2HDD A;  3WTZ A;  2VOD A;  3K2A A;  1A04 A;  1OCZ H;  3IWF A;  2DW4 A;  2IT0 A;  4D5C A;  2O03 A;  1XGN A;  2G7U A;  5BQT A;  4UUV A;  5M3M J;  2K9Q A;  2DMT A;  2HQN A;  3WTY C;  3ONQ A;  4LIV A;  4M3F A;  1ON1 A;  2OCC H;  4B1R A;  2CUE A;  4A69 C;  2EV5 A;  2OF7 A;  3KCC A;  2A3S A;  3ZMD A;  3W2V A;  4DW6 A;  3TL4 X;  2HVQ A;  3BTJ A;  3BR0 A;  4GFB A;  3FIW A;  1YQA A;  2X1D A;  2ZSH B;  3BOQ A;  3EUH A;  2QUF A;  1BI1 A;  1NG6 A;  4IF4 A;  2GIV A;  2M7B A;  3GTM J;  1F9N A;  3A01 A;  5E8G A;  1QU3 A;  4R8H A;  2MC3 A;  1OYW A;  4YIF A;  3WU1 B;  3AAF A;  1W36 D;  3OS0 A;  1DPR A;  1KQ0 A;  3R61 A;  2D1V A;  3TMO A;  2HTS A;  3LNQ A;  1U3E M;  1FJL A;  3OL4 A;  2FUG 2;  3G2B A;  1VFC A;  3E3V A;  1F1Z A;  1BBY A;  1SFX A;  3R4K A;  3M7G A;  1MD0 A;  4LOC A;  1HC8 A;  1P9Q C;  1FTT A;  4C3J J;  1R1V A;  5IP9 J;  4KMF A;  1G3Y A;  3TO9 A;  2R4G A;  2YUS A;  3RPQ A;  1HF0 A;  3ZXS A;  1UG2 A;  2H1K A;  1K78 B;  1I39 A;  2Z5U A;  4DQ2 A;  5CJ9 A;  5J1Y A;  1N77 A;  2QQ9 A;  4U7D A;  1WPK A;  1J7K A;  2PN6 A;  2PJR B;  3JRD A;  2UUZ A;  4B4C A;  2HWV A;  3HRT A;  1G8X A;  1LE8 A;  3K1M A;  3HYI A;  4XRS A;  4ABZ A;  2MLG A;  2YSR A;  2JA2 A;  1BI0 A;  4KT6 A;  3HL2 A;  3MWM A;  4QWQ A;  1D8J A;  3KZZ A;  1MH4 A;  2DAO A;  1HW5 A;  4PGG A;  2DPD A;  3TW6 A;  1W5C C;  2CQK A;  3D5R C;  5D6E A;  3ZMV A;  5EGO A;  4B8X A;  5LGT A;  4OIP F;  3D5L A;  3AL0 C;  2LKX A;  1R36 A;  3MKL A;  4LB6 B;  1DGR M;  3C2H A;  3CMY A;  4ENK A;  3F8B A;  1K83 J;  2PQ8 A;  2R93 J;  2GBY A;  3ISP A;  3ELK A;  4UB6 C;  3WTV C;  2BYV E;  4QPQ A;  3HOW J;  4X6A J;  2ZO4 A;  3PNT A;  1MMS A;  1ERD A;  3H92 A;  4P96 A;  4D5F A;  2QBY B;  4C2M J;  2Y2Z A;  2ZCW A;  1JTX A;  1QHG A;  3KP6 A;  2P5K A;  1VQ4 I;  1MNE A;  3HPH A;  1RR8 C;  2WV1 A;  3DFG A;  2FJ1 A;  2AQF A;  2EA2 A;  3LA3 A;  1T98 A;  1QO0 D;  2VB6 A;  2CYY A;  5F0C A;  2TCT A;  1IRX A;  2DJN A;  2WAF A;  3ULQ B;  1LEB A;  2LDU A;  2ZKZ A;  1SVL A;  4BBS J;  3OS2 A;  2V1N A;  2VXZ A;  1SAU A;  3PM1 A;  1YE9 A;  1FOW A;  1MNM C;  1MBK A;  2TRT A;  4UNO A;  2JA8 J;  2WAQ A;  3DPT A;  4OMY A;  4R79 A;  1P4A A;  3HJE A;  2GA1 A;  4RGU A;  2DU9 A;  1MBH A;  1Y1V J;  2W00 A;  4LLG F;  3NQO A;  2I8D A;  4ESF A;  2K4J A;  4LLN A;  1W1W E;  2LBF B;  1MBE A;  2QA4 I;  5EG0 B;  2HVR A;  4IEJ A;  4ZC3 A;  4FT8 A;  3J81 Z;  1JUM A;  2Q2E B;  3CUO A;  1Y1W J;  1VQ6 I;  3WTS C;  2GQQ A;  1YS7 A;  1BR4 A;  1UHS A;  1S8N A;  3CTA A;  4A3C J;  4MFD A;  1FOK A;  2JRT A;  1WJA A;  1RUN A;  2H09 A;  4WWC A;  3HOX J;  4XM3 A;  1QVU A;  1FWZ A;  2Q1Z B;  3BG3 A;  3RZO J;  2BHY A;  2EH3 A;  2QF7 A;  4S0H B;  1Z77 A;  2ZSI B;  3JRG A;  1BOB A;  3LA7 A;  4PUS A;  4JX5 A;  1X1P A;  1LJ9 A;  4OWR B;  1KYW A;  1ZRD A;  4IRH A;  2IAI A;  4HOB A;  3H5N A;  5E1X A;  5K1Y A;  1LB2 A;  1SFU A;  1D5V A;  3FXU A;  2X6W A;  1P92 A;  4Q47 A;  2HQ5 A;  3F8C A;  3H9Q A;  1OR7 A;  5HS8 A;  3FM3 A;  2NS0 A;  3J7Z I;  1AHD P;  3PQK A;  1EH6 A;  3BJ6 A;  3TQN A;  3FM5 A;  1O3T A;  4H4K C;  5EZH A;  4PDK A;  4RAZ A;  2HOA A;  4UVC A;  3K2Z A;  3HKZ A;  1IN5 A;  4JOM A;  1S29 A;  1E2X A;  1WKM A;  2K40 A;  2BE5 F;  4ITV A;  4PSW A;  3TW7 A;  3S1N J;  2DN0 A;  2LY2 A;  4C9Y A;  3CP8 A;  4BY7 J;  1AOY A;  1K6Y A;  3K0L A;  3GFL A;  2XRN A;  3F23 A;  4QPO A;  3BR3 A;  3HC7 A;  4DNC A;  1X58 A;  3CLO A;  3CES A;  1OMI A;  3J7A O;  4C3I J;  5BPI A;  2IPQ X;  3K4N A;  2ZJQ F;  2ZME A;  3BQZ A;  5EEG A;  1I27 A;  1LKX A;  1TT5 B;  3OYA A;  3HRS A;  3E1S A;  2D1H A;  3W6K B;  2QQB A;  1YFH A;  1A35 A;  3GF2 A;  1DPU A;  1YJW I;  3HHH A;  3AG1 H;  4RM2 A;  3H5R A;  5IP6 A;  1RNL A;  3QAH A;  4BKX A;  1TWC J;  2BY1 A;  4KMU X;  2WTE A;  3SQN A;  2VJ4 A;  4BJ5 C;  1YW8 A;  2QEN A;  3WOD F;  4RDU A;  3OL3 A;  2DA7 A;  1VQM I;  2QBY A;  3H0D A;  1D3Y A;  1WWX A;  1RI7 A;  2Y0M A;  4JQF A;  1IGN A;  3JAM Z;  4RGX A;  1WZ2 A;  1N78 A;  2M9H A;  3L7W A;  2XAH A;  1ZK8 A;  2V9V A;  3BG7 A;  2Z33 A;  3QPS A;  3AG3 H;  5CVJ A;  2VON A;  3K4C A;  1B4A A;  4XLA A;  3M8F A;  5CVI A;  1YRN B;  2EZI A;  4IX7 A;  3BLY A;  1V54 H;  3ECH A;  3CCQ I;  5E79 C;  2MG4 A;  3IV5 A;  3E6M A;  1D1A A;  2GXG A;  3TOB A;  2JK3 A;  2L7M P;  2LVS A;  3WTU C;  4U0V A;  3ZQF A;  1OLT A;  5FGM A;  5F64 A;  4CZC A;  1ZRE A;  1QQI A;  4KUM A;  1EH7 A;  3KZI C;  3U9G A;  4BE0 A;  4IHV A;  5HNH A;  4DYC A;  4C3H J;  5DTD A;  2XKO A;  4BXU A;  3HUG A;  2PG4 A;  1IXR C;  1OCP A;  4FET A;  4DIQ A;  1I1S A;  3E5X A;  3IAS 2;  4HF0 A;  3LL7 A;  4N4N B;  1PP8 F;  4M3D A;  1ZG1 A;  3VOE A;  3C2G A;  1JT6 A;  4N0B A;  3ECO A;  4Y13 A;  2LKS A;  1RES A;  2M87 A;  2KRC A;  3WGI A;  2CQ7 A;  2Y0S N;  2WA0 A;  1WCM J;  3DTI A;  2B7E A;  2CS3 A;  2KLO A;  1GDT A;  3MQ0 A;  2EIK H;  1P6R A;  1VQ5 I;  4ZDP A;  5L3D A;  2Z9O A;  2H94 A;  4L5J A;  1ZG3 A;  3KP4 A;  4UVB A;  1YI2 I;  3I59 A;  1VQL I;  4BXX J;  2VKD A;  3ZN0 A;  3W6V A;  1JKR C;  3PO3 J;  4WXD A;  2VQH A;  2XVC A;  3R0A A;  2LP0 A;  3E7L A;  4AYB N;  3Q0W A;  2KRH A;  1U78 A;  2F48 A;  2Y9Y A;  4YEJ A;  4BYY A;  1XGO A;  2R7X A;  1NTC A;  3X2Q H;  1ZYR F;  2X48 A;  3CDI A;  4RS8 A;  5HOO A;  4U7B A;  2XUB A;  3A0B C;  2NRA C;  5FFZ A;  3B02 A;  2O9L A;  5GTI C;  2DI3 A;  4E7L A;  4G7O F;  4L9N A;  1FMV A;  2VLA A;  1HKS A;  1T38 A;  2H27 A;  3K69 A;  2K4B A;  4HA8 A;  4XON A;  2EIM H;  3IHU A;  4A93 J;  2KFD A;  3QPL A;  4UVA A;  1P7I A;  3LFU A;  4PK4 A;  1J9I A;  3SEQ A;  2H6B A;  3KEY A;  2DDB A;  4CDG A;  5LGU A;  4HF1 A;  3OOP A;  3M3Y J;  4HX4 A;  2ZXW H;  3TP0 A;  2CW7 A;  4M72 A;  3FIS A;  3HSE A;  1UZC A;  2A5Y B;  3GTQ J;  1TW2 A;  1MH3 A;  3OSF A;  4CCK A;  1TWF J;  4GYG A;  2VQC A;  2OU2 A;  3RQ4 A;  2YX4 A;  4UXN A;  1QBJ A;  4G9Y A;  3WG9 A;  4HQM A;  3OYI A;  4Y17 A;  4IJA A;  4LB5 A;  1LDK B;  3QP5 A;  5E17 F;  2ZFW A;  1TLH B;  1DGW Y;  3RSN A;  3G73 A;  5M3F J;  1X2N A;  3S16 J;  2P5L C;  3S3M A;  5HVQ C;  2M34 A;  4XKC A;  1AKH A;  2KIQ A;  1A5J A;  1IRG A;  5LRS A;  3HOU J;  4GCV A;  3CP2 A;  1HST A;  2DLL A;  1X4O A;  3LSG A;  2IS2 A;  3OYC A;  2EBI A;  2QEX I;  1GV5 A;  2E5Z A;  4YII A;  3V7R A;  2L9N A;  1DP7 P;  5F1R A;  2E1M B;  2VJJ A;  1SVO A;  1Y56 A;  2MA3 A;  2X6Y A;  2YU9 J;  2VAS A;  2LTP A;  1HXD A;  1I3Q J;  4AYB A;  5B5E C;  2HZT A;  4RAY A;  2AS5 F;  1Z67 A;  2E35 A;  1WSU A;  1I6H J;  3ZN1 A;  1V55 H;  4HYE A;  3S2D J;  3V7C A;  2P7V B;  3CUQ C;  1WGX A;  2UV1 A;  4RBO A;  2VOP A;  1ZRC A;  2JQ7 A;  2L3D A;  1HA8 A;  1OCR H;  1MBJ A;  2WY8 Q;  3O6B B;  4E4H A;  1Z9C A;  1QZY A;  3KLO A;  1Y39 A;  1JTY A;  2DQR A;  2R3S A;  2ZB9 A;  1MZB A;  4F93 B;  4RB0 A;  5GTH C;  1SMT A;  3JRC A;  2E2J J;  1FPQ A;  3VYR B;  2X6O A;  5IY5 H;  1RR7 A;  4BQQ A;  1LPQ A;  4RLF A;  2AXT C;  3F0C A;  4BHP A;  3L2C A;  2RGV A;  2M8E A;  3CLQ A;  4AM3 A;  1BIA A;  1U9N A;  4YIR X;  2L9V A;  3LWF A;  5DUK A;  3BWG A;  2ESN A;  2K7L A;  3WTT C;  1XC5 A;  2IXS A;  3W6J B;  4FX0 A;  4KJZ A;  3OY9 A;  1NK3 P;  4RGR A;  4XBF A;  2O8X A;  5JR3 A;  4CCN A;  3ZCO A;  2CUJ A;  1U9O A;  2MYS A;  3RYP A;  4PJM A;  3MKY B;  1OQY A;  1ZR4 A;  3QYB A;  5FRN A;  3ZR8 X;  2NOG A;  3F6O A;  3QYF A;  3NEU A;  3NRV A;  2R7Z J;  1IUF A;  1ITY A;  2FQ3 A;  5KNL A;  2NVT J;  3GTK J;  2HGC A;  1X1A A;  3WG7 H;  4HPQ A;  2R7Q A;  3E6C C;  4LJZ F;  4AC0 A;  1HKQ A;  2R5Z B;  4IHX A;  2KT0 A;  2AQE A;  3RJP A;  4IXA A;  2LLK A;  1XPX A;  1SD7 A;  3GEZ A;  4EGZ A;  3JRE A;  1B9N A;  4RAG A;  1PJR A;  3TDU C;  3M8J A;  5C3E J;  3PSF A;  1WJ5 A;  3DPL C;  3U1D A;  4YFK F;  4M73 A;  2MW8 A;  1QPI A;  1X3W B;  3FMQ A;  4PFO A;  2CUF A;  2JZY A;  3EUH C;  4PGH A;  4BNC A;  5HDN A;  4IOA F;  1QNT A;  5JHU A;  1FP1 D;  2DMN A;  5D4S A;  4LMY A;  3P7N A;  4BJT A;  2R7V A;  2Y48 A;  2VC1 A;  1X1C A;  3GBG A;  2IGO A;  3ABK H;  2KZG A;  3KP3 A;  2HDW A;  4KIF A;  1LUJ B;  2RRE A;  4P1W A;  2BY0 A;  2LR8 A;  5FFX A;  3TOA A;  1UHW A;  3A4C A;  3L2W A;  2EZL A;  2NVY J;  3Q9S A;  1IRF A;  5M5Y J;  2VT2 A;  2K3F A;  2HVS A;  2P6T A;  2EFQ A;  5CPR B;  4B43 A;  4NHJ A;  4FE7 A;  1IXC A;  2E1O A;  1P2F A;  1E3H A;  1S3J A;  1ZLK A;  4NQW B;  2XGD A;  2BY2 A;  3PO2 J;  2GAU A;  1BA5 A;  1MMA A;  3H3V K;  4G6Q A;  3U2R A;  1IW7 F;  2NAZ A;  1WRJ A;  1YS6 A;  1HDD C;  2M1B A;  4A3K J;  3S3N A;  1ENH A;  2W4S A;  3HPG A;  3LSP A;  1ZQ3 P;  4F7Z A;  3FBI B;  1FMW A;  2L7F P;  2V7F A;  4N9I A;  3PNY A;  1J0R A;  1XDS A;  4M71 A;  1OJL A;  2LNB A;  2XAU A;  5ICE A;  5B3S H;  1JGS A;  4IKF A;  1T6S A;  2XF6 A;  4CYC B;  2DA2 A;  1OCC H;  1W36 C;  2KHM A;  4I0A A;  4JYK A;  4BEH B;  1D5Y A;  1XGS A;  1YG2 A;  2HNH A;  3E5Q A;  3U21 A;  4MEY F;  3ESW B;  5ICC A;  5J1R A;  2M0C A;  1E17 A;  1KA8 A;  1ETV A;  1WJE A;  2H8W A;  4ZYD A;  2E71 A;  2L54 A;  3M07 A;  4XRS G;  1B1B A;  3CCE I;  1RPW A;  4E7K A;  5IYC J;  4L5I A;  2EB7 A;  3GW2 A;  4GDF A;  3QPT A;  4XLF A;  1D0X A;  1PUF B;  3TO6 A;  1W7P A;  3MVP A;  4J01 A;  4JP0 A;  3KIO A;  3JR9 A;  4XOR A;  2XF5 A;  2JT1 A;  3EDP A;  1WVR A;  2HYJ A;  2PMZ A;  4E70 A;  1ETY A;  1QPM A;  2QM3 A;  1TWG J;  1IN4 A;  2R5Y B;  3PIO F;  4UUT A;  4G94 A;  1J59 A;  5HLH A;  1RZ4 A;  3CC4 I;  5FRM A;  2Y75 A;  1R5G A;  3DWL E;  1JI8 A;  4OIQ F;  4XSX F;  3T8T A;  2M8G X;  3L2R A;  2DYS H;  3BG5 A;  2FE3 A;  2PMH A;  4D0P A;  5FKK A;  3ERM A;  4XLP F;  2IVM A;  2V1D A;  5FLV A;  2VE8 A;  2MSY A;  2X6X A;  4AU7 A;  4IRI A;  4RB1 A;  4O6J A;  1YOV B;  4Q5S F;  3ZGK A;  1WFX A;  2FML A;  1O3R A;  1WJD A;  4MHG A;  2YPR A;  2DTR A;  2F6C A;  5FJ8 J;  2A05 A;  2QQA A;  1N25 A;  1P7J A;  1W4M A;  3HB9 A;  5ICF A;  4ZYE A;  2CGP A;  1H8A C;  2CFX A;  3M1E A;  3FMR A;  2LD5 A;  5JHF A;  4GRI A;  5AON A;  3DEW A;  3SDG A;  3F8M A;  3SJM A;  3RZD J;  2XHK A;  2ACJ A;  2VL8 A;  2LH9 A;  4E7I A;  3V8L A;  2JSP A;  2P6S A;  3LSH A;  5EYR A;  3VYT B;  4AWX B;  1F4K A;  5AIP A;  3REO A;  1FC3 A;  2R92 J;  2I5U A;  2L5Q A;  1XMK A;  2E7X A;  1YJN I;  2GZW A;  3K4K A;  5K5Q A;  3BP8 A;  2BXZ A;  1MMD A;  1OR7 C;  2CU7 A;  5FKM A;  1ZRF A;  1PYV A;  2M5W A;  4XQF A;  1Y8R B;  4B3A A;  5FD6 A;  3KYC B;  4LGW A;  2MGQ A;  1Z91 A;  3UKG A;  2FOK A;  3BCB A;  3M4O J;  1EJ9 A;  4UUS A;  1VQ9 I;  2ECC A;  4G6T B;  3ZMU A;  4A3F J;  3WE3 A;  2GOM A;  4ZZD A;  3CO6 C;  2X1C A;  3QRF F;  4M6X A;  4FQG A;  3GTG J;  3I54 A;  3M9A A;  3ZRG A;  3DLL F;  4LFU A;  4Y52 J;  4HZF A;  5HOD A;  2HTJ A;  4G6D A;  3ZMZ A;  4OIO F;  4L9T A;  2ZME C;  2O61 A;  2QZ8 A;  5HLI A;  1WH5 A;  4EQQ A;  4CYC A;  2L4A A;  2GXB A;  5C4J J;  1SFE A;  3W2W A;  1FEX A;  3B6A A;  3K70 C;  3PNV A;  5FLX K;  1XS9 A;  5J4Y A;  2DDA A;  4W97 A;  1D8K A;  2AO9 A;  5B1B H;  4X0G A;  2HI3 A;  3Q3S A;  4IZZ A;  2X1E A;  4S04 A;  1Q1H A;  3LMM A;  1B9M A;  4A6D A;  1T8I A;  1SFK A;  4ZZL A;  5LLQ A;  2JA5 J;  2XPW A;  3ROU A;  2VJI A;  1QRY A;  2E2I J;  5IT9 Z;  4XLC A;  1MDM B;  1HOM A;  3P9C A;  5JI6 A;  1UJ8 A;  1RUO A;  4DZJ A;  1ZEL A;  2R7U A;  2V26 A;  5LD2 C;  2QGU A;  2VBX A;  1FIA A;  3P9K A;  4XOP A;  3OYH A;  4P9F A;  2R7O A;  3F8N A;  1F43 A;  2ELJ A;  2K86 A;  3ZQI A;  4CYD A;  3DEU A;  3HRU A;  2KL4 A;  1GT0 C;  2CJJ A;  1W5S A;  2EIJ H;  3BJO A;  4W1U A;  2GLO A;  2Y30 A;  4XN3 A;  1V5E A;  4IHT A;  1WJF A;  2LK2 A;  4MIM A;  1HCR A;  1IG7 A;  2VBW A;  4ZYA A;  4XIC A;  3VWB A;  4BHB A;  2ELH A;  2DJI A;  3OV8 A;  5EJC A;  3S32 A;  1EH8 A;  1VQN I;  1HDP A;  3SZP A;  3EPZ A;  4I98 B;  2CQQ A;  1ZG5 A;  2XAS A;  2WAD A;  4UV8 A;  2OV7 A;  5DCM A;  5IT3 A;  2ZC2 A;  4RM3 A;  3ZQH A;  4BAC A;  1Z6R A;  2X0L A;  2XB0 X;  1VF9 A;  2G7H A;  3FXK A;  4L5E A;  3DP7 A;  2GXA A;  3L2V A;  1R7J A;  1XCB A;  3L00 A;  3HOY J;  3I64 A;  1D1C A;  1Z3Y A;  3I5U A;  3BTC A;  3LOC A;  3V8J A;  4ANJ A;  2VJ5 A;  3L09 A;  2JPC A;  4KT5 C;  2HXI A;  4XLN F;  2EZH A;  2ISZ A;  5FKO A;  2M4K A;  2E1C A;  2GM4 A;  1C0W A;  3HOT A;  2CW0 F;  3ZMT A;  3F9K A;  2LY1 A;  3DTE A;  3VEP A;  1TQP A;  1HLV A;  4I01 A;  2OUM A;  1AWC A;  2RDP A;  4EV0 A;  5JFR A;  2MD0 A;  3R60 A;  2A68 F;  3P5J A;  3JSO A;  3GTO J;  1MJA A;  2LKP A;  2L02 A;  2ZJ2 A;  3IC7 A;  1RRJ A;  2Q0O A;  3GLL A;  2NNN A;  5F1J A;  3M1C A;  1DDN A;  5GAE J;  1T39 A;  1CF7 B;  5ILU A;  4BQN A;  2O6G E;  1SFO J;  1DQU A;  1OIS A;  4AIH A;  3E0J B;  2IRF G;  4CXF A;  2NNY A;  5FO5 A;  5DEQ A;  2DOE A;  2IA1 A;  4F55 A;  4O3M A;  5DD8 A;  5KCM A;  4D7M A;  1MBF A;  1XN7 A;  2KJB A;  1R23 A;  5L3C A;  3K70 D;  3VYS B;  3FHN A;  1I1G A;  3I71 A;  3BZ6 A;  3GCM A;  5EEH A;  1QHH D;  4KIB A;  2DMU A;  3BG6 A;  2OTL I;  1K78 A;  2UWM A;  5DDG A;  2K9N A;  5J6X A;  2DA1 A;  2PJR A;  1MJB A;  1H0M A;  4U87 A;  2KRF A;  4C2T A;  4A5N A;  1LFU P;  1R1U A;  2W1O A;  5J47 A;  2K9M A;  4RB2 C;  1F5T A;  4B48 A;  4I02 A;  4GXO A;  3ZMS A;  5E3O A;  1O4X A;  4HNT A;  1UHM A;  1IUY A;  2HDC A;  2OCE A;  5J8F A;  2RC4 A;  2W84 A;  4XKW A;  4Q48 A;  4I0B A;  4U0Y A;  4N9H A;  1YO5 C;  2Z16 A;  1ZTR A;  3GZ6 A;  4XRM A;  3MAJ A;  3BDD A;  3CCY A;  3HTU A;  4A3B J;  2BVM A;  1XSD A;  3HSF A;  3WU2 C;  1DU0 A;  2ID3 A;  2O5R A;  2X4H A;  3PQJ A;  5DD4 A;  1S72 I;  2O0Y A;  2XRO A;  1XG1 A;  1HKT A;  2ICW G;  2R7F A;  4XNF A;  2F5C A;  5ED4 A;  3MKW B;  4JX6 A;  4FAS D;  2HQA A;  4HAM A;  4YFX F;  4CHU A;  1MND A;  4FIS A;  4P55 A;  3T1B A;  3A2K A;  3E97 A;  1KGS A;  1YLF A;  3OOU A;  1ODD A;  1TW3 A;  4BE1 A;  1H88 C;  3GLX A;  2ZNZ A;  3R0J A;  4TV7 A;  3RIR A;  1T2K A;  3LAJ A;  2FD5 A;  1RET A;  5BNG A;  5A2Q Z;  1AA7 A;  4XRF A;  4C30 A;  2XPV A;  2IGM A;  2KPM A;  3OIO A;  1HBX G;  5E20 A;  5B66 C;  1JHH A;  1VND A;  5GP9 A;  1J75 A;  5EZG A;  3SZT A;  2DFF A;  4KN7 X;  4A6E A;  1L3L A;  1DUX C;  1PVE A;  1UST A;  1Z05 A;  4YG2 F;  2E2H J;  4YFN F;  3SEZ A;  2ZXJ A;  3S2W A;  1ON2 A;  5HLT A;  2OBP A;  2ESH A;  4JBA A;  4LG0 B;  2HZD A;  2B0L A;  3G71 I;  2ME6 A;  1T95 A;  3HDD A;  1M1E B;  3BCA A;  2X9D A;  1UB9 A;  1U5T B;  2H6C A;  2OA4 A;  4PJ0 C;  2W85 A;  4O5V A;  2LBF A;  3GZ5 A;  3H9G A;  4HNU A;  5EG0 A;  3OYG A;  1KQ8 A;  1BI3 A;  4H0E A;  2BVL A;  3L2U A;  1T0F A;  3GME A;  1WQ2 A;  4IL6 C;  2OPT A;  3K10 A;  2Q2E A;  3TED A;  4ZTJ A;  2XIG A;  4LK0 F;  3PSI A;  2DK8 A;  3C1D A;  5D5U B;  2WWY A;  1U8B A;  3QQA A;  1WJB A;  4B3X A;  4A0Z A;  4A12 A;  3LSM A;  2FNA A;  1JT0 A;  3S17 J;  2WAE A;  1HW2 A;  2RNJ A;  2BW3 B;  4L9V A;  4M6V A;  2HPI A;  3MZH A;  4KYW A;  1QZE A;  1FSE A;  1RC9 A;  2LG4 A;  4BS9 A;  4U88 A;  1GVD A;  3O8G A;  1V4R A;  3IUO A;  4PJL A;  3PFI A;  2M7A A;  3A0H C;  2RVC A;  4AVZ A;  5B1A H;  4LG3 A;  4HV5 A;  2DOF A;  3GFM A;  2MBF A;  2V6E A;  2IA0 A;  2DXI A;  1ORK A;  2MC4 A;  3ASN H;  3GO5 A;  1ZGW A;  3G1O A;  1IJW C;  3F3X A;  4DZP A;  1OFC X;  3BT9 A;  3HBL A;  2EFW A;  2PMU A;  5C44 J;  5TRD A;  4DOZ A;  4C2U A;  2D2W A;  3RKY A;  5F6F A;  4LLL A;  4BH9 A;  4AID A;  4GYI A;  4HQE A;  3M8E A;  3ABL H;  4XLH A;  2CFO A;  3S93 A;  1DP3 A;  3HHG A;  3CJT B;  3CCS I;  3IKT A;  2DCE A;  4UB8 C;  2XDV A;  5LGN A;  2IGN A;  3DKY A;  3WU0 A;  2J5O A;  3F72 A;  1CGP A;  2WBM A;  2CSO A;  5JVT A;  1TZL A;  2VXD A;  4IHW A;  3SZG A;  1TL8 A;  2WY7 Q;  3HZJ A;  2LFB A;  2FNP A;  4RA2 A;  5KK1 A;  3J80 K;  5KAF C;  2WC2 A;  2IJL A;  3L2Q A;  2E1N A;  1G3S A;  5J4V A;  3CC7 I;  4F52 A;  2W82 A;  1BN5 A;  5HS9 A;  2FQ4 A;  3F8F A;  2V4J C;  2QCO A;  2OZ6 A;  1Z21 A;  3BR2 A;  1FLI A;  2LRE A;  1H89 C;  3MCZ A;  2Y0S A;  4CCO A;  3D1N I;  3LAP A;  1S7E A;  1TWA J;  2MD5 A;  1V3F A;  1D1B A;  3MFK A;  4WCG A;  1AU7 A;  3RTR A;  9ANT A;  4KDP A;  2ZBK A;  3CF5 F;  1X2M A;  1V5F A;  5F0H A;  1YIT I;  3DBL B;  4QIW N;  1T08 B;  2JA6 J;  5D8L B;  4CO8 A;  3BTL A;  4MGR A;  1JE8 A;  1USS A;  3J7Y J;  2ME0 A;  2EFO A;  3OIQ A;  1YRN A;  2ZXI A;  5FKN A;  2E5N A;  5E1W A;  1NK2 P;  2BHZ A;  1UCR A;  2VC0 A;  2Z1D A;  1TP4 A;  2FXA A;  1J2X A;  5L3E A;  1LFP A;  3K7A J;  1POG A;  2M4G A;  2VKE A;  3KEO A;  1TNT A;  4I76 A;  3L1P A;  5LEJ A;  5HLG A;  2HOT A;  4BBR J;  2XV4 S;  1Z7U A;  4ENN A;  2P7C B;  1BW6 A;  1YYV A;  1OCT C;  3FK7 A;  2RV8 A;  3W3C A;  4CCL A;  1FOX A;  4K2E A;  2W24 A;  4IO9 F;  2TDX A;  1OYY A;  2K3P A;  3QOD A;  5TJJ A;  5GPA A;  1J09 A;  2HU9 A;  3QPH A;  2A6E F;  5H6Q A;  4EAT A;  2L4M A;  1A31 A;  4UY8 I;  2VBZ A;  1W0T A;  1B6A A;  3LST A;  3KZY A;  4CIC A;  1S9H A;  2JUG A;  4IHY A;  4CH7 A;  3CCU I;  4A3M J;  2R7D A;  1TNS A;  3WTW C;  3IL2 A;  1APL C;  2DQL A;  2P4W A;  1E3O C;  3IP4 B;  2OZU A;  2XKP A;  3EQL F;  1ZH5 A;  1R4M B;  4HX8 A;  2IEK A;  3CUQ B;  4II3 A;  3PIP F;  2PJP A;  1K4T A;  4IQ4 A;  5DYM A;  2EFP A;  4P5O A;  2DT5 A;  3S14 J;  4RLQ A;  1SC7 A;  3VB2 A;  1SMY F;  3OYB A;  2CV0 A;  4XLE A;  3GX4 X;  3S1R J;  3DU5 A;  1MSF C;  2V1X A;  5F27 A;  4KIC A;  4AD9 A;  1P4X A;  4EVI A;  1FBU A;  3I3L A;  2KZV A;  3FXL A;  3K9T A;  4GO1 A;  3CC2 I;  2CV1 A;  3KP5 A;  2BBY A;  1BW5 A;  1R00 A;  3S3O A;  2XSJ C;  1A36 A;  1EKE A;  4X1E A;  4EM2 A;  3OMY A;  4QLC U;  2VN2 A;  4A3I J;  2WV0 A;  3QOP A;  4EJT A;  1JXS A;  4I7H A;  4V2G A;  1B72 B;  3G3Z A;  3HTS B;  1G2H A;  3F22 A;  1KON A;  4ESJ A;  4M74 A;  3T8R A;  3IWZ A;  1TBX A;  3FK6 A;  3NWT A;  1OPC A;  2ZJP F;  2UXX A;  3FKJ A;  1U2W A;  3QOE A;  1V5G A;  4NB5 A;  3TDZ C;  2BGC A;  2XGX A;  3CMM A;  1W7P D;  3TBI A;  2DFE A;  1WI9 A;  4XOT A;  5ICG A;  3TGN A;  3GWZ A;  2W57 A;  3KX2 A;  4HEA 2;  2HR3 A;  3OYK A;  2DMQ A;  2IW5 A;  3DBR B;  1JJ8 C;  4MQ9 F;  1PDN C;  1G3W A;  4MQV A;  1BJA A;  3GFI A;  3J81 K;  4B09 A;  4WK8 F;  2BOL A;  2H1L A;  2ISY A;  2VKH A;  1UMQ A;  3LA2 A;  1VQK I;  2V9K A;  3SYT A;  2KIF A;  2JRM A;  2JVH A;  2HQR A;  2P81 A;  5K7H A;  4HRI A;  1B59 A;  2HKX A;  2XSD C;  1ETK A;  3JRB A;  4ZYH A;  2AXL A;  4HDU A;  4PFP A;  3A01 B;  1LVK A;  2EK5 A;  4ZH4 F;  2MLK A;  2PBI A;  2DBB A;  3S1M J;  3VOD A;  3GFJ A;  1J5Y A;  1Y8Q B;  2DK5 A;  2LOO A;  3CQZ J;  5CVR A;  2CO5 A;  3KPH A;  4Y7N J;  1U8R A;  2HOS A;  1LDJ A;  5DV5 A;  2MH2 A;  3ZQQ A;  1XSV A;  4DGW B;  4M9S A;  4KN4 X;  2CRG A;  3WGG A;  1O3S A;  2VOO A;  5L3G A;  2P8T A;  2ETH A;  4BDY A;  3I0T A;  1LVA A;  2WB1 N;  5D6F A;  1SD5 A;  5KVR A;  1LE8 B;  2EV0 A;  3V42 A;  2QSF X;  3FXO A;  4CSW A;  3GUD A;  3LSJ A;  3K4J A;  2F5F A;  5ILS A;  2Z2S B;  3DKX A;  2A5W A;  3ABU A;  3EYI A;  1BR1 A;  2Z99 A;  3C2B A;  2DA3 A;  4MLO A;  3T5X A;  5EGO B;  4BAY A;  5FKL A;  2DFH A;  3FBN B;  3EUK L;  3OYN A;  2FBK A;  1ZGJ A;  2CV2 A;  4QSH A;  2R0Q C;  1SD4 A;  2E7W A;  3BRO A;  2NXN B;  2QLZ A;  4ZTF A;  4YEL A;  2R5Z A;  1ACI A;  3HSR A;  4AIJ A;  3MZ8 A;  1BI2 A;  2Z3Y A;  2VPL A;  5CKT A;  2E19 A;  4BUP A;  1MMN A;  2GWR A;  1HSJ A;  2MFZ A;  1MSE C;  3WGH A;  1R58 A;  1FOY A;  2PFB A;  2Y31 A;  3JRA A;  2COB A;  1T33 A;  4OAZ A;  3BY6 A;  1IV8 A;  1XMX A;  3DLA A;  3I9V 2;  4KNY A;  3JAM K;  3QU3 A;  4BE2 A;  3LSI A;  2N8G A;  3CCL I;  3RYR A;  3KFW X;  3PUB A;  5A2Q K;  5CQG A;  2M3A A;  2NOJ B;  3HOV J;  2DPU A;  2FBI A;  2Q8K A;  1K4S A;  2F5E A;  5JLX A;  2A6H F;  2EWN A;  3OIP A;  2A07 F;  5IYD J;  4LD5 A;  4EM0 B;  4AUX A;  5IOY A;  2DA5 A;  3G1L A;  2CUZ A;  2BXY A;  1Q1V A;  2XAJ A;  2VPR A;  2D5V A;  4YRV A;  3FKI J;  1XSX A;  2HPM A;  3H35 A;  1JHF A;  3CF2 A;  4A3L J;  4PCQ A;  3I4M J;  1EA3 A;  4NQW A;  1O3Q A;  2WB1 A;  1X19 A;  1I6X A;  1BIB A;  3K4M A;  2VT3 A;  4Y4R A;  5GPC A;  4II2 A;  5L3B A;  2BEO A;  3WHC A;  1EF4 A;  3HXL A;  1R6R A;  1Z0X A;  2A6T A;  1JUS A;  3K4L A;  3ZP5 A;  1FNN A;  1Z3X A;  3J7A Y;  3W2A A;  2LF7 A;  2QVO A;  4ENM A;  3I4N J;  4R1H A;  3I58 A;  4BY1 J;  1IXS B;  2IS4 A;  2FMY A;  4IRG A;  3A02 A;  4EEF G;  2IS6 A;  4BEH A;  3KYD B;  4OOI A;  3FF5 A;  1XTA A;  4BXF A;  3ERE D;  4M3E A;  3Q0U A;  2FEZ A;  3BJA A;  5D5X B;  1IN6 A;  1HQC A;  4I6Z A;  1MJ9 A;  1XGM A;  3ZQ7 A;  5K7F A;  3Q9V A;  3S15 J;  3MD2 A;  1I5Z A;  4Y15 A;  4LIU A;  3RQI A;  1A6Q A;  2WAQ N;  5FD5 A;  2JSC A;  2K9L A;  1IDZ A;  4MTD A;  5DUI A;  2R7T A;  1PUF A;  2IA2 A;  3IH3 A;  2EFN A;  3K1N A;  5DCF A;  1Y0U A;  4DJA A;  1YX3 A;  3BR1 A;  2KKO A;  1LNW A;  2QQ8 A;  4DBQ A;  2HYG D;  3FWE A;  1VQP I;  1GXQ A;  1BR2 A;  1ULY A;  2CG4 A;  2DOA A;  4NNJ A;  5BS6 A;  5HDG A;  2W7N A;  3Q0V A;  1JKP C;  2F5D A;  1Z6T A;  2R5Y A;  1JUP A;  3MZY A;  2A61 A;  1MW7 A;  2KP6 A;  3DQV C;  2HOE A;  4I99 C;  3OYF A;  1XB4 A;  1NHA A;  1KU9 A;  4JX4 A;  1R22 A;  1X1B A;  1IDY A;  4G7Z F;  5GAH J;  2EIN H;  2KMU A;  1XDU A;  1FP2 A;  3RCO A;  5CYV A;  4A3D J;  2ZME B;  5E3L A;  2L2O A;  2YR2 A;  1ZR2 A;  1IN7 A;  4OMZ A;  5IP7 J;  1OYI A;  1T0F C;  2XAF A;  5AIQ A;  3BG9 A;  3A03 A;  3COA C;  1R4N B;  3JRH A;  2R7W A;  1QZZ A;  1IF1 A;  2G0E A;  1ZN2 A;  2VUM J;  1YX5 A;  3G6E I;  1O7F A;  2O7O A;  3ML6 A;  3QU6 A;  2FF4 A;  3HIF A;  4E7J A;  3HKZ N;  2HYF A;  3EUA A;  3QP6 A;  3FXQ A;  2NVQ J;  1IO2 A;  1SAX A;  3AL0 B;  5D5W B;  3QWL A;  4A0Y A;  3CDH A;  3S1Q J;  4LIT A;  3OYE A;  4DYR A;  3PJR A;  5LFA A;  4FHT A;  2NVX J;  2FA5 A;  5CQE A;  3CD6 I;  2ZNY A;  3F21 A;  1REP C;  3PFY A;  2IBD A;  2NYX A;  3JCU C;  3VYU B;  2GIZ A;  3E6D A;  5M5W J;  4CA0 A;  2EV6 A;  1HW1 A;  4RMN A;  5ILV A;  2A69 F;  1OKR A;  3HUG B;  4EM1 A;  1ETO A;  4NUB A;  4UHT A;  2EZK A;  3C7J A;  1MMG A;  3FXM A;  4IPA A;  2OQG A;  3LSK A;  1B8I B;  3AFH A;  3O2P E;  2L7Z A;  2OD5 A;  1IV6 A;  2VE9 A;  1FZP B;  1BM9 A;  1L0O C;  4A0X A;  2OQR A;  1DU6 A;  2XB5 A;  3CJQ B;  1Z1D A;  5D8K B;  3FX3 A;  1VTN C;  3EET A;  1FBS A;  1E3P A;  5TIS C;  4BQO A;  2V9P A;  1Y6I A;  4FX4 A;  3KYL A;  1BL0 A;  2FU4 A;  1SD6 A;  4M3B A;  5DS9 A;  3I59 B;  3ZQG A;  4ASN A;  4OIN F;  3AKZ A;  3HEF A;  3RPU D;  1GXP A;  2CMP A;  5LBQ A;  2ADU A;  1D0Y A;  3N97 A;  5H6R A;  2D45 A;  1TQM A;  4ENJ A;  4XL9 A;  3FHZ A;  2E36 A;  3GTJ J;  3P9I A;  1VZ0 A;  3H9J A;  5HNF A;  3ZOB A;  1PUE E;  2UZK A;  4F91 B;  4I2O A;  5DM6 F;  3K6G A;  3ABM H;  3RKW A;  1ZLJ A;  2P5V A;  1IRZ A;  3GXO A;  4XN0 A;  2DTZ A;  1JKQ C;  1S7A A;  1S7O A;  3KP7 A;  2K85 A;  1MDM A;  3UNG C;  1SEU A;  3B6C A;  1BC8 C;  1LFB A;  1BOA A;  3QYE A;  2LSO A;  3BC8 A;  1FX7 A;  2Y9Z A;  3KEQ A;  4L0Y B;  3FDY A;  5LHH A;  2KJC A;  3BR6 A;  2BZT A;  2PLY A;  4V19 K;  1TTY A;  3D5S C;  5L3F A;  1U5T C;  5HDK A;  1OCO H;  2OC6 A;  2COM A;  2JMW A;  1GLN A;  2XPU A;  4A3J J;  4G8X A;  3RPU A;  1UFM A;  4PJJ A;  1FYL A;  1UEL B;  3DU6 A;  4KIS A;  2KIM A;  4CGZ A;  1G6N A;  1MKM A;  4HBL A;  2KQR A;  3H3U A;  3DPU A;  1KZH A;  4L0Z B;  3VDX A;  2EA4 A;  2LRD A;  1AKH B;  3MMY B;  2ZJR F;  2L01 A;  1Y0N A;  2BY3 A;  2YX7 A;  3DF8 A;  3WE2 A;  4MEX F;  2H8R A;  1STZ A;  4V2F A;  5FRO A;  1RKT A;  3ASO H;  3NAU A;  3MN2 A;  4HW0 A;  4EJW A;  1W5T A;  2VI6 A;  3LFK A;  3FZV A;  3FXJ A;  3O8H A;  1TC3 C;  1WI3 A;  4M3G A;  4CZZ A;  3CME I;  2YS9 A;  3OYD A;  4PSX A;  3ABT A;  1X4P A;  4E7H A;  3BZK A;  1A6I A;  3CZ6 A;  4M9Z A;  1FSH A;  1IZ1 A;  4E7S A;  5TGT A;  2K5C A;  3I56 I;  1O57 A;  2DOD A;  2F2E A;  2CQX A;  3K4B A;  2BV6 A;  2JJ7 A;  4XKB A;  4F92 B;  3S8P A;  2IS1 A;  2EIL H;  5D5V B;  2XF7 A;  4OAY A;  3CDL A;  4RB3 C;  3ZQC A;  2XGE A;  4HSR A;  4Y33 A;  4D7N A;  5JLW A;  2DT6 A;  1B8I A;  1KU2 A;  2RQP A;  4WX9 A;  1U6G A;  3H36 A;  1CF7 A; 
#chains in the Genus database with same CATH homology
 4AIK A;  5E18 F;  4G7H F;  2G9W A;  1LQ1 A;  2QYO A;  4S05 A;  3BPV A;  5FLX Z;  3ZPL A;  4OIR F;  2K27 A;  1KU3 A;  4HX7 A;  3HOS A;  2KIU A;  2HKO A;  4ON0 A;  3O3K A;  2LF8 A;  3LQR A;  5D4R A;  4U0W A;  3N4M A;  4MNU A;  2J5P A;  3BPX A;  3DKW A;  3V7S A;  4EMS A;  1YIO A;  1MGT A;  3HRM A;  4IVN A;  4A5M A;  2HEO A;  4PZJ A;  3R6S A;  3E6B A;  4HV6 A;  3JW4 A;  4MTE A;  4HLX A;  4BHC A;  4ZYG A;  2IP2 A;  1FY7 A;  3T0Y A;  3SHF A;  2STW A;  3KP2 A;  4P9U A;  5J8C A;  3WTX C;  1R5H A;  3DXJ F;  4LG0 A;  3VFZ A;  1KU7 A;  3Q5F A;  2DO7 A;  3F6V A;  4I09 A;  1XMA A;  2MH9 A;  1U5T A;  4BQA A;  4A2U A;  1H9T A;  5H20 A;  5E8I A;  4EJU A;  2RKH A;  4HF2 A;  1H9G A;  3JTG A;  2GA2 A;  4XSZ F;  4HLY A;  3CO7 C;  5LEK A;  2JPB A;  4M6Y A;  6PAX A;  5BMZ A;  3C18 A;  3IRR A;  1W7P B;  1LDD A;  2QWW A;  1O7L A;  4EJV A;  2DFI A;  5LHI A;  3GYH X;  2FRH A;  5CVV A;  4GGG A;  2XAG A;  1K79 A;  4EJO A;  1ZGA A;  2O3F A;  5IT9 K;  3IKV A;  3IRQ A;  4LK1 F;  2CWE A;  3SXY A;  1QGP A;  5HS7 A;  3FXR A;  5E1Z B;  5BPD A;  2UXN A;  3GVA A;  1K6O A;  4M9X A;  1S6L A;  3LQQ A;  5BOX A;  3TKY A;  1PP7 U;  1BC7 C;  4Z2Y A;  2V79 A;  2YU3 A;  1YTY A;  5LRR A;  4KIG A;  3C3W A;  1XD7 A;  2JTV A;  1IAW A;  4WF2 A;  4OU0 A;  3D0S A;  3E5U A;  1FBQ A;  2HFH A;  3H3Z A;  5LHG A;  3CJN A;  4KA4 A;  4JK1 X;  5K5O A;  2HS5 A;  1ONV A;  3TO7 A;  4EGY A;  2M30 A;  3JSP A;  3RI4 A;  2FBH A;  4KFC A;  2EJR A;  2RN7 A;  3I53 A;  4WXC A;  1R1T A;  3MEX A;  3KLN A;  5K5R A;  1XCV A;  3KE2 A;  3I4P A;  3B73 A;  5CVU A;  2VBY A;  1FYK A;  2C6Y A;  3RKX A;  3RDI A;  4L18 B;  3SFZ A;  3JTH A;  5FB2 A;  3L9F A;  1X3U A;  4RGS A;  1ZHF A;  2K02 A;  3V8K A;  2STT A;  1G3T A;  4ETS A;  1FT9 A;  4IHS A;  4ESB A;  4Q4Z F;  1RIO H;  1K7A A;  3KET A;  4UV9 A;  2XAQ A;  4HDV A;  3V4G A;  3CUQ A;  1GHC A;  1IN8 A;  1YW7 A;  3DV8 A;  1FYM A;  4L9J A;  4WXH A;  4AVP A;  2V1U A;  1YW9 A;  1LEA A;  1GVJ A;  2PEX A;  1EV7 A;  2W25 A;  1ZAR A;  1KYZ A;  3FMS A;  2PI0 A;  1KQ9 A;  5CLS A;  5ERI A;  3J80 Z;  2OAZ A;  1G4D A;  1P4W A;  2M45 A;  5DCM B;  1ZAO A;  1TQI A;  2V6C A;  3K1P A;  2FSW A;  3EYY A;  3WTZ A;  2VOD A;  1A04 A;  3IWF A;  2DW4 A;  2IT0 A;  2O03 A;  1XGN A;  2G7U A;  5BQT A;  4UUV A;  2HQN A;  3WTY C;  1ON1 A;  2EV5 A;  3KCC A;  2A3S A;  3ZMD A;  1YQA A;  3BOQ A;  3EUH A;  2QUF A;  1BI1 A;  4IF4 A;  2GIV A;  1F9N A;  5E8G A;  4R8H A;  2MC3 A;  1OYW A;  4YIF A;  3WU1 B;  3AAF A;  1DPR A;  1KQ0 A;  3R61 A;  2D1V A;  2HTS A;  1U3E M;  3E3V A;  1F1Z A;  1BBY A;  1SFX A;  3R4K A;  3M7G A;  1MD0 A;  1R1V A;  4KMF A;  1G3Y A;  3TO9 A;  3RPQ A;  1K78 B;  2Z5U A;  4DQ2 A;  5CJ9 A;  2QQ9 A;  4U7D A;  1J7K A;  2PN6 A;  2HWV A;  3HRT A;  3K1M A;  3HYI A;  2MLG A;  2YSR A;  1BI0 A;  3MWM A;  4QWQ A;  1D8J A;  3KZZ A;  2DAO A;  1HW5 A;  4PGG A;  2DPD A;  2CQK A;  5D6E A;  3ZMV A;  4B8X A;  5LGT A;  4OIP F;  3D5L A;  1R36 A;  4LB6 B;  4ENK A;  3F8B A;  2PQ8 A;  3ISP A;  3ELK A;  3WTV C;  2BYV E;  2ZO4 A;  3H92 A;  4P96 A;  2QBY B;  2ZCW A;  3KP6 A;  2P5K A;  3DFG A;  2EA2 A;  3LA3 A;  1T98 A;  1QO0 D;  2CYY A;  3ULQ B;  1LEB A;  2LDU A;  2ZKZ A;  2VXZ A;  4UNO A;  3DPT A;  4OMY A;  4R79 A;  1P4A A;  2GA1 A;  4RGU A;  2DU9 A;  4LLG F;  3NQO A;  4ESF A;  2K4J A;  4LLN A;  4FT8 A;  3J81 Z;  3CUO A;  3WTS C;  2GQQ A;  1YS7 A;  1S8N A;  3CTA A;  1FOK A;  2JRT A;  1RUN A;  2H09 A;  4WWC A;  1FWZ A;  3LA7 A;  1LJ9 A;  1KYW A;  1ZRD A;  4IRH A;  4HOB A;  5E1X A;  5K1Y A;  1LB2 A;  1SFU A;  1D5V A;  3FXU A;  1P92 A;  4Q47 A;  3F8C A;  1OR7 A;  5HS8 A;  3FM3 A;  2NS0 A;  3PQK A;  1EH6 A;  3BJ6 A;  3TQN A;  3FM5 A;  1O3T A;  4PDK A;  4RAZ A;  4UVC A;  3K2Z A;  1IN5 A;  1S29 A;  1E2X A;  1WKM A;  2BE5 F;  1AOY A;  3K0L A;  3GFL A;  2XRN A;  3F23 A;  4DNC A;  3CLO A;  1OMI A;  3J7A O;  5BPI A;  2IPQ X;  2ZME A;  5EEG A;  1I27 A;  3HRS A;  2D1H A;  3W6K B;  2QQB A;  1YFH A;  1DPU A;  3GF2 A;  3HHH A;  1RNL A;  3QAH A;  4KMU X;  2WTE A;  3SQN A;  1YW8 A;  2QEN A;  3WOD F;  2QBY A;  1D3Y A;  1WWX A;  1RI7 A;  2Y0M A;  4JQF A;  3JAM Z;  4RGX A;  3L7W A;  2XAH A;  2V9V A;  2Z33 A;  5CVJ A;  2VON A;  1B4A A;  3M8F A;  5CVI A;  3ECH A;  3E6M A;  2GXG A;  3TOB A;  3WTU C;  4U0V A;  5FGM A;  1ZRE A;  5F64 A;  1QQI A;  4KUM A;  1EH7 A;  3U9G A;  2XKO A;  4BXU A;  3HUG A;  2PG4 A;  1IXR C;  1I1S A;  3E5X A;  4HF0 A;  1PP8 F;  1ZG1 A;  3VOE A;  4N0B A;  3ECO A;  4Y13 A;  2M87 A;  3WGI A;  3MQ0 A;  1P6R A;  5L3D A;  2Z9O A;  2H94 A;  4L5J A;  1ZG3 A;  3KP4 A;  4UVB A;  3I59 A;  3ZN0 A;  4WXD A;  2XVC A;  3R0A A;  1U78 A;  4BYY A;  1XGO A;  2NRA C;  1ZYR F;  5HOO A;  4RS8 A;  4U7B A;  2XUB A;  5FFZ A;  3B02 A;  2DI3 A;  4G7O F;  4L9N A;  1HKS A;  1T38 A;  2H27 A;  3K69 A;  2K4B A;  4HA8 A;  3IHU A;  4UVA A;  1J9I A;  2H6B A;  5LGU A;  4CDG A;  4HF1 A;  3OOP A;  4HX4 A;  4M72 A;  3HSE A;  2A5Y B;  1TW2 A;  4GYG A;  2OU2 A;  2YX4 A;  4UXN A;  1QBJ A;  4G9Y A;  3WG9 A;  4HQM A;  4Y17 A;  4IJA A;  4LB5 A;  1LDK B;  3QP5 A;  5E17 F;  2ZFW A;  1TLH B;  3G73 A;  2P5L C;  5HVQ C;  1IRG A;  5LRS A;  4GCV A;  1HST A;  2DLL A;  4YII A;  3V7R A;  1DP7 P;  5F1R A;  2MA3 A;  1HXD A;  2HZT A;  4RAY A;  2AS5 F;  1WSU A;  3ZN1 A;  4HYE A;  3V7C A;  2P7V B;  3CUQ C;  2VOP A;  1ZRC A;  2L3D A;  3O6B B;  1Z9C A;  1QZY A;  3KLO A;  2DQR A;  2R3S A;  1MZB A;  4RB0 A;  1SMT A;  1FPQ A;  4BHP A;  3L2C A;  2RGV A;  2M8E A;  1BIA A;  3LWF A;  5DUK A;  3BWG A;  2ESN A;  2K7L A;  3WTT C;  3W6J B;  4FX0 A;  4RGR A;  4XBF A;  2O8X A;  5JR3 A;  3RYP A;  3F6O A;  3NEU A;  3NRV A;  2FQ3 A;  2HGC A;  3E6C C;  4LJZ F;  1HKQ A;  3RJP A;  4IXA A;  1SD7 A;  3GEZ A;  4EGZ A;  1B9N A;  3TDU C;  3DPL C;  3U1D A;  4YFK F;  4M73 A;  3FMQ A;  4BNC A;  2JZY A;  4PGH A;  5HDN A;  1QNT A;  5JHU A;  1FP1 D;  5D4S A;  4LMY A;  3P7N A;  2Y48 A;  2VC1 A;  3KP3 A;  4KIF A;  5FFX A;  3TOA A;  1UHW A;  3Q9S A;  1IRF A;  2VT2 A;  2P6T A;  2EFQ A;  4NHJ A;  1IXC A;  1P2F A;  1S3J A;  1ZLK A;  2GAU A;  4G6Q A;  3U2R A;  1IW7 F;  2NAZ A;  1WRJ A;  1YS6 A;  2M1B A;  4F7Z A;  4N9I A;  1J0R A;  1XDS A;  4M71 A;  2LNB A;  5ICE A;  1JGS A;  1T6S A;  4I0A A;  1XGS A;  1YG2 A;  3E5Q A;  4MEY F;  5ICC A;  1E17 A;  1KA8 A;  4ZYD A;  2L54 A;  1B1B A;  4L5I A;  2EB7 A;  3GW2 A;  3QPT A;  3TO6 A;  1W7P A;  2JT1 A;  3EDP A;  4E70 A;  1QPM A;  2QM3 A;  1IN4 A;  4G94 A;  1J59 A;  5HLH A;  1RZ4 A;  2Y75 A;  1R5G A;  4OIQ F;  4XSX F;  3T8T A;  2FE3 A;  2PMH A;  4D0P A;  4XLP F;  2IVM A;  2V1D A;  2VE8 A;  4IRI A;  4RB1 A;  4O6J A;  4Q5S F;  2FML A;  1O3R A;  4MHG A;  2YPR A;  2DTR A;  2QQA A;  1W4M A;  5ICF A;  4ZYE A;  2CGP A;  2CFX A;  3M1E A;  3FMR A;  5AON A;  3F8M A;  2XHK A;  2ACJ A;  3V8L A;  2P6S A;  4AWX B;  1F4K A;  5AIP A;  3REO A;  1FC3 A;  1XMK A;  2E7X A;  2GZW A;  5K5Q A;  3BP8 A;  1ZRF A;  2M5W A;  5FD6 A;  4LGW A;  1Z91 A;  2FOK A;  3ZMU A;  3WE3 A;  4ZZD A;  3CO6 C;  3QRF F;  4M6X A;  3I54 A;  3M9A A;  4LFU A;  4HZF A;  2HTJ A;  4G6D A;  3ZMZ A;  4OIO F;  4L9T A;  2O61 A;  2QZ8 A;  5HLI A;  4EQQ A;  2L4A A;  2GXB A;  1SFE A;  5FLX K;  1D8K A;  4S04 A;  1Q1H A;  1B9M A;  4A6D A;  4ZZL A;  5LLQ A;  3ROU A;  5IT9 Z;  1MDM B;  3P9C A;  5JI6 A;  1RUO A;  2VBX A;  3P9K A;  4P9F A;  3F8N A;  2K86 A;  4CYD A;  3DEU A;  3HRU A;  1W5S A;  3BJO A;  4IHT A;  2VBW A;  4BHB A;  2ELH A;  3OV8 A;  1EH8 A;  3SZP A;  4I98 B;  1ZG5 A;  2XAS A;  4UV8 A;  5DCM A;  5IT3 A;  1Z6R A;  2X0L A;  2G7H A;  3DP7 A;  1R7J A;  1XCB A;  3L00 A;  3I64 A;  3I5U A;  3V8J A;  2ISZ A;  3L09 A;  4KT5 C;  2JPC A;  4XLN F;  2E1C A;  1C0W A;  3HOT A;  2CW0 F;  3ZMT A;  3VEP A;  1TQP A;  4I01 A;  1AWC A;  2RDP A;  4EV0 A;  5JFR A;  3R60 A;  2A68 F;  3JSO A;  1MJA A;  2LKP A;  2L02 A;  2ZJ2 A;  3IC7 A;  2Q0O A;  2NNN A;  1DDN A;  1T39 A;  1CF7 B;  5ILU A;  2O6G E;  4AIH A;  2IRF G;  4CXF A;  2NNY A;  5FO5 A;  5DEQ A;  2IA1 A;  4O3M A;  5DD8 A;  1XN7 A;  2KJB A;  1R23 A;  5L3C A;  1I1G A;  3I71 A;  3BZ6 A;  5EEH A;  4KIB A;  1K78 A;  2UWM A;  5DDG A;  5J6X A;  1MJB A;  1H0M A;  2KRF A;  4A5N A;  1R1U A;  4RB2 C;  1F5T A;  4I02 A;  4GXO A;  3ZMS A;  1UHM A;  1IUY A;  2HDC A;  5J8F A;  2RC4 A;  2W84 A;  4Q48 A;  4I0B A;  4U0Y A;  4N9H A;  1YO5 C;  3GZ6 A;  3MAJ A;  3BDD A;  3HTU A;  1XSD A;  3HSF A;  2X4H A;  3PQJ A;  5DD4 A;  2O0Y A;  2XRO A;  1HKT A;  2R7F A;  5ED4 A;  2F5C A;  4HAM A;  4YFX F;  4CHU A;  4P55 A;  3T1B A;  3E97 A;  1KGS A;  1YLF A;  1ODD A;  1TW3 A;  3GLX A;  2ZNZ A;  3R0J A;  4TV7 A;  3RIR A;  1T2K A;  3LAJ A;  5A2Q Z;  4XRF A;  1HBX G;  5E20 A;  1JHH A;  1J75 A;  3SZT A;  4KN7 X;  4A6E A;  1L3L A;  1DUX C;  1Z05 A;  1UST A;  4YG2 F;  4YFN F;  2ZXJ A;  3S2W A;  1ON2 A;  2OBP A;  2ESH A;  4JBA A;  4LG0 B;  2B0L A;  1UB9 A;  1U5T B;  2H6C A;  2OA4 A;  2W85 A;  4O5V A;  3GZ5 A;  1KQ8 A;  1BI3 A;  4H0E A;  1T0F A;  1WQ2 A;  2Q2E A;  2XIG A;  4LK0 F;  2DK8 A;  3C1D A;  5D5U B;  2WWY A;  4A0Z A;  4A12 A;  2FNA A;  1HW2 A;  2RNJ A;  4L9V A;  3MZH A;  4KYW A;  1FSE A;  4U88 A;  1V4R A;  3PFI A;  2RVC A;  4HV5 A;  3GFM A;  2MBF A;  2IA0 A;  3GO5 A;  3F3X A;  2EFW A;  2PMU A;  5TRD A;  2D2W A;  3RKY A;  5F6F A;  4LLL A;  4BH9 A;  4GYI A;  4HQE A;  3M8E A;  3HHG A;  3IKT A;  5LGN A;  3WU0 A;  2J5O A;  3F72 A;  1CGP A;  2CSO A;  5JVT A;  2FNP A;  5KK1 A;  3J80 K;  2WC2 A;  2IJL A;  2E1N A;  1G3S A;  1BN5 A;  5HS9 A;  3F8F A;  2OZ6 A;  1FLI A;  3MCZ A;  3LAP A;  2MD5 A;  1V3F A;  3MFK A;  4WCG A;  3RTR A;  4KDP A;  2ZBK A;  5D8L B;  4CO8 A;  4MGR A;  1JE8 A;  1USS A;  2EFO A;  5E1W A;  1UCR A;  2VC0 A;  2FXA A;  1J2X A;  5L3E A;  3KEO A;  1TNT A;  5LEJ A;  5HLG A;  2XV4 S;  1Z7U A;  4ENN A;  2P7C B;  1YYV A;  2RV8 A;  4K2E A;  2W24 A;  2TDX A;  1OYY A;  5TJJ A;  3QPH A;  2A6E F;  5H6Q A;  2L4M A;  2VBZ A;  1B6A A;  3LST A;  3KZY A;  4CIC A;  2R7D A;  1TNS A;  3WTW C;  3IL2 A;  2DQL A;  2P4W A;  2OZU A;  2XKP A;  3EQL F;  1ZH5 A;  4HX8 A;  3CUQ B;  2PJP A;  5DYM A;  2EFP A;  4P5O A;  2DT5 A;  3VB2 A;  1SMY F;  3GX4 X;  2V1X A;  4KIC A;  4AD9 A;  1P4X A;  4EVI A;  1FBU A;  3K9T A;  4GO1 A;  3KP5 A;  2BBY A;  1R00 A;  4EM2 A;  4QLC U;  2VN2 A;  2WV0 A;  3QOP A;  4EJT A;  1JXS A;  4I7H A;  3G3Z A;  3HTS B;  3F22 A;  4ESJ A;  4M74 A;  3T8R A;  3IWZ A;  1TBX A;  1OPC A;  2UXX A;  1U2W A;  4NB5 A;  3TDZ C;  2BGC A;  2XGX A;  1W7P D;  1WI9 A;  5ICG A;  3TGN A;  3GWZ A;  2W57 A;  2HR3 A;  2IW5 A;  4MQ9 F;  1PDN C;  1G3W A;  4MQV A;  1BJA A;  3GFI A;  3J81 K;  4B09 A;  4WK8 F;  2ISY A;  3LA2 A;  2KIF A;  2HQR A;  1B59 A;  2HKX A;  4ZYH A;  2AXL A;  4HDU A;  2EK5 A;  4ZH4 F;  2MLK A;  2PBI A;  2DBB A;  3VOD A;  3GFJ A;  1J5Y A;  2DK5 A;  5CVR A;  2CO5 A;  1U8R A;  1LDJ A;  5DV5 A;  2MH2 A;  1XSV A;  4M9S A;  4KN4 X;  3WGG A;  1O3S A;  2VOO A;  5L3G A;  2P8T A;  2ETH A;  3I0T A;  1LVA A;  5D6F A;  1SD5 A;  5KVR A;  2EV0 A;  3GUD A;  2F5F A;  5ILS A;  3ABU A;  3EYI A;  2Z99 A;  3T5X A;  4BAY A;  2FBK A;  1ZGJ A;  1SD4 A;  2E7W A;  3BRO A;  2QLZ A;  3HSR A;  4AIJ A;  1BI2 A;  2Z3Y A;  2GWR A;  1HSJ A;  3WGH A;  1R58 A;  2PFB A;  3BY6 A;  4KNY A;  3JAM K;  3QU3 A;  3RYR A;  3KFW X;  5A2Q K;  2DPU A;  2FBI A;  2Q8K A;  2F5E A;  2A6H F;  2EWN A;  2A07 F;  4LD5 A;  4EM0 B;  2XAJ A;  1XSX A;  1JHF A;  4PCQ A;  4NQW A;  1O3Q A;  1I6X A;  1BIB A;  2VT3 A;  5L3B A;  2BEO A;  3ZP5 A;  1FNN A;  2LF7 A;  2QVO A;  4ENM A;  4R1H A;  3I58 A;  1IXS B;  2FMY A;  4IRG A;  4OOI A;  3FF5 A;  3ERE D;  2FEZ A;  3BJA A;  5D5X B;  1IN6 A;  1HQC A;  1MJ9 A;  1XGM A;  3ZQ7 A;  3Q9V A;  1I5Z A;  4Y15 A;  5FD5 A;  2JSC A;  4MTD A;  5DUI A;  5DCF A;  2IA2 A;  2EFN A;  3K1N A;  1Y0U A;  2KKO A;  1LNW A;  2HYG D;  3FWE A;  1GXQ A;  1ULY A;  2CG4 A;  5BS6 A;  5HDG A;  2F5D A;  1Z6T A;  3MZY A;  2A61 A;  3DQV C;  2HOE A;  1XB4 A;  1NHA A;  1KU9 A;  1R22 A;  4G7Z F;  1XDU A;  1FP2 A;  5CYV A;  2ZME B;  2YR2 A;  1IN7 A;  4OMZ A;  1OYI A;  2XAF A;  5AIQ A;  3COA C;  1QZZ A;  1IF1 A;  1ZN2 A;  1O7F A;  3ML6 A;  3QU6 A;  2FF4 A;  3HIF A;  2HYF A;  3QP6 A;  3FXQ A;  1SAX A;  5D5W B;  4A0Y A;  3CDH A;  4FHT A;  2FA5 A;  2ZNY A;  3F21 A;  1REP C;  2NYX A;  3E6D A;  2EV6 A;  1HW1 A;  5ILV A;  2A69 F;  1OKR A;  4EM1 A;  4UHT A;  3C7J A;  4IPA A;  2OQG A;  3O2P E;  2OD5 A;  2VE9 A;  1FZP B;  1BM9 A;  1L0O C;  4A0X A;  2OQR A;  1Z1D A;  5D8K B;  3FX3 A;  1VTN C;  3EET A;  1FBS A;  4FX4 A;  2FU4 A;  1SD6 A;  3I59 B;  4ASN A;  4OIN F;  1GXP A;  5LBQ A;  2ADU A;  3N97 A;  5H6R A;  2D45 A;  1TQM A;  4ENJ A;  3FHZ A;  3P9I A;  1PUE E;  2UZK A;  4I2O A;  3RKW A;  1ZLJ A;  2P5V A;  3GXO A;  1S7A A;  1S7O A;  3KP7 A;  1MDM A;  1BC8 C;  1BOA A;  2LSO A;  1FX7 A;  3KEQ A;  4L0Y B;  5LHH A;  2KJC A;  2PLY A;  1TTY A;  5L3F A;  1U5T C;  5HDK A;  2COM A;  4G8X A;  3RPU A;  1UFM A;  1FYL A;  2KIM A;  4CGZ A;  1G6N A;  1MKM A;  4HBL A;  3H3U A;  4L0Z B;  2EA4 A;  2L01 A;  2YX7 A;  3DF8 A;  3WE2 A;  4MEX F;  1STZ A;  4HW0 A;  4EJW A;  1W5T A;  3LFK A;  3FZV A;  4CZZ A;  3ABT A;  4M9Z A;  1FSH A;  1IZ1 A;  1O57 A;  2F2E A;  2BV6 A;  5D5V B;  4RB3 C;  1KU2 A;  2RQP A;  4WX9 A;  1U6G A;  1CF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...