2CSOA

Solution structure of the dep domain of human pleckstrin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
GSSGSSGRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DEP domain of human pleckstrin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Pleckstrin
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2csoA00
1EH8A 3ULQB 2OZ6A 2AS5F 4EQQA 3I71A 1J9IA 4O3MA 2O6GE 2O8XA 2RDPA 3K2ZA 3P9KA 3HHGA 2VOPA 4EGYA 1TQMA 1U5TB 4U7DA 1K7AA 4U88A 2RQPA 3DF8A 3RPUA 3WTYC 3WTUC 4WWCA 1R1TA 2FU4A 1ZN2A 1BOAA 2ESNA 2FF4A 5K5OA 2MLGA 3BWGA 4AWXB 2P7CB 2XGXA 5HOOA 1IXCA 3EETA 5DDGA 2FBKA 1Z05A 4RGRA 2GQQA 2V1DA 1FSHA 2QQBA 3V7RA 1O3RA 2TDXA 3PQJA 1VTNC 4ESFA 3EYIA 3I64A 3G73A 3HRTA 4S04A 1B4AA 1OMIA 5ICEA 1BIBA 2ZO4A 1G3SA 5E1ZB 1DDNA 2PI0A 1KU9A 4MNUA 3B02A 4G9YA 5L3EA 4LLGF 4M71A 2EA4A 1TW2A 1JXSA 2G9WA 1XCVA 5EEHA 5CJ9A 1OYIA 5DUIA 1R5GA 1R1VA 4IRIA 2GA2A 3FM3A 2KJBA 3CUQC 4KT5C 5LGUA 2CWEA 4KIBA 5K5QA 3L9FA 1IXSB 3F22A 3BPVA 4EJOA 5FD6A 4OMYA 1O7LA 3L09A 1ZRDA 1J59A 1ZGJA 2VT2A 1QPMA 2RGVA 1YW8A 2RNJA 2HOEA 2XAHA 4P9FA 1BJAA 4KMUX 3HTSB 4UV8A 4HOBA 2Y75A 4Q48A 4HX4A 3FMRA 3LFKA 3I54A 3MFKA 4IHTA 3V7SA 3QRFF 1UB9A 1G3WA 3GF2A 3I0TA 4DQ2A 4KIFA 1XCBA 2QVOA 3QP5A 3EDPA 1R5HA 1W7PB 4HDUA 4U0VA 4ESBA 3FWEA 1HW1A 3L7WA 5A2QK 1FYMA 3DXJF 4M9ZA 4KA4A 2FSWA 2PFBA 6PAXA 1PP8F 2MBFA 2VT3A 4S05A 2KIFA 5LRRA 4ENMA 4OINF 3HSFA 1YIOA 1U8RA 2VXZA 4U7BA 4AVPA 1LQ1A 2VBWA 1XSDA 3LA2A 2VE9A 4GYGA 1IN7A 2EFNA 1FYLA 2F2EA 2Z9OA 3RJPA 2Q2EA 1YLFA 5L3BA 2GAUA 2EB7A 2EWNA 4KIGA 2DK5A 3Q5FA 3WTXC 2DI3A 2HTSA 2P4WA 1LJ9A 1GXQA 3TDUC 2OQRA 4E70A 1FPQA 4M6YA 3ABTA 2P6SA 3MAJA 4I0AA 4ESJA 1ZRCA 5JVTA 3J80Z 2W57A 4HQEA 3L00A 3T8RA 1K78A 3QOPA 2DO7A 3KZZA 1O3TA 2LSOA 2JZYA 3BROA 4P55A 5J8FA 5D6FA 2BE5F 3EQLF 1SMTA 4D0PA 1ZLJA 5H20A 4M73A 4G94A 3LA3A 3SXYA 4PZJA 1B9MA 2O03A 4RB3C 3HSRA 5AIQA 2M8EA 1I5ZA 4L9NA 2HKOA 2XVCA 2YU3A 2DT5A 3CUQB 2ADUA 3F8CA 5FLXK 3KEOA 5ICCA 1LEBA 3MZYA 1YFHA 3BJOA 3P7NA 4FX4A 3HTUA 3GZ5A 1P4AA 4F7ZA 2LF7A 5HDKA 1P4WA 3GO5A 1R7JA 2YPRA 4I01A 3HRMA 1ZG5A 1YQAA 4UVCA 2P7VB 3TO6A 3DV8A 5CVRA 2V79A 4HDVA 3H3ZA 1NHAA 3DQVC 3KE2A 2QENA 3FMQA 1ZH5A 2YX4A 4HW0A 4LLLA 2K4BA 2XROA 2R7FA 1XGSA 2EV5A 4GCVA 1MDMA 5DUKA 3IL2A 1IRFA 1S3JA 2QBYB 4BYYA 4XRFA 4M9SA 4OIOF 4LB5A 2Z33A 1B59A 2YX7A 3MZHA 1G6NA 1SFUA 3WTWC 1O3SA 4BAYA 1MDMB 5JI6A 2L4AA 2Q8KA 1R1UA 2JSCA 2ACJA 1KU3A 4A0ZA 1QQIA 1TNTA 1U5TC 1MD0A 5CVJA 4Q47A 3CUQA 3F6OA 1JHHA 3JSPA 5HVQC 3FMSA 4G6QA 1IUYA 3F8NA 3NEUA 4KDPA 2J5PA 1X3UA 1E2XA 3IC7A 5LBQA 2OA4A 1QZYA 3I59A 3TO7A 1B6AA 2WTEA 3B73A 3IWZA 1U6GA 1ZHFA 4P5OA 5LHHA 3IRQA 1LDJA 4MEYF 3MWMA 1Q1HA 2P5LC 5CVIA 4L0YB 2CW0F 2ELHA 5FB2A 2V6CA 1IXRC 3ECOA 1LVAA 2BGCA 3DKWA 2FMLA 4A12A 2ZKZA 4G7ZF 4UVAA 1BBYA 1FLIA 3M1EA 3IHUA 4FHTA 3V8LA 1GVJA 1CF7A 3GUDA 3IWFA 3K1MA 4I09A 1YW7A 1W4MA 2ZNYA 1R58A 3E6MA 3QU6A 5DCMB 2V1UA 3HRUA 2PLYA 4ZYHA 1J75A 2HYGD 4MTDA 1ULYA 4I0BA 1OR7A 2BBYA 3QU3A 3K0LA 3E5UA 1Y0UA 3CJNA 3KLNA 2GZWA 1XGOA 3COAC 3WGIA 4N9HA 3ISPA 2EFWA 2FEZA 4CYDA 3EYYA 3GLXA 5KVRA 4EJWA 3F23A 1J2XA 2NS0A 2QYOA 1KA8A 1FZPB 4EGZA 2RN7A 3RI4A 4IF4A 3WU0A 1SMYF 1YTYA 2VBYA 4CXFA 5E20A 2XRNA 5E8IA 4G7HF 3VEPA 1QNTA 2LNBA 5FFZA 3KFWX 4P9UA 1YW9A 5LGTA 1ON2A 2STWA 2ETHA 1T2KA 4WCGA 1PDNC 4N0BA 2PQ8A 3K9TA 1C0WA 1KQ9A 1R00A 1G4DA 4ON0A 4OU0A 2E1CA 4GXOA 2A69F 4I2OA 4ETSA 5CVVA 5DEQA 2VC1A 4EV0A 2EFQA 4Q5SF 4BHCA 1MKMA 1TLHB 2K86A 2BV6A 3C7JA 2IT0A 2OU2A 5BS6A 4HLXA 1KGSA 1T0FA 1Z6TA 2O61A 2JPBA 4ZZDA 1TW3A 4RAYA 5FGMA 1ZAOA 4EVIA 4BXUA 4EJVA 3KP6A 5J6XA 3S2WA 4A6DA 2HFHA 1XN7A 2M5WA 1OPCA 1U5TA 3REOA 2VC0A 2D1VA 1D8KA 3ZQ7A 2DU9A 2IA2A 1XSXA 4U0WA 1W5SA 3MQ0A 3RKYA 3U9GA 2BYVE 2XKOA 1XGNA 3SFZA 3GZ6A 3CO7C 4BH9A 1BC8C 2DK8A 5LGNA 2MD5A 4JQFA 4UVBA 1TQIA 2UWMA 4WXHA 3ZN0A 4BHBA 3KP2A 2FBHA 4QLCU 2IW5A 5HDGA 3AAFA 1UFMA 4MGRA 3QAHA 1S7OA 4R8HA 4UUVA 2NRAC 2K02A 5JR3A 4UV9A 1SD4A 1FWZA 2QZ8A 3RYRA 3KLOA 2E7XA 1TBXA 5K5RA 2ZMEB 3C18A 2Z5UA 4HX7A 4B09A 1Z7UA 2HWVA 1PUEE 1MJ9A 1ZLKA 1FY7A 4CICA 3GFMA 3LQRA 1HXDA 4MQ9F 2A61A 4IPAA 2RKHA 2WC2A 3SQNA 2GA1A 4PCQA 2IA0A 3FX3A 4UXNA 2M30A 3T5XA 2P8TA 3DEUA 1BC7C 3KP5A 4RGXA 2FXAA 2M87A 3HRSA 1S29A 2LF8A 2J5OA 5FFXA 1OKRA 1J0RA 5FLXZ 3LQQA 4GYIA 2QQAA 4FX0A 2W24A 3SHFA 1ZARA 1I27A 3I59B 1H9TA 1P92A 2B0LA 1FSEA 5D6EA 1HSJA 1HKTA 4LB6B 2OQGA 3E97A 3F8MA 2QBYA 2A6HF 4KYWA 3VODA 1S8NA 2R3SA 2PEXA 2P5KA 1F9NA 1BI0A 1USTA 5BMZA 3BZ6A 4WK8F 3V4GA 5ILSA 3BJAA 4L9JA 3ZMDA 1XMAA 3DP7A 3R4KA 5DD8A 1DPRA 3K69A 2O0YA 1FNNA 2OAZA 1WI9A 2QQ9A 2GWRA 4IVNA 4HLYA 3E5QA 5E17F 1E17A 2R7DA 4I7HA 3MEXA 3N97A 3RKXA 2FE3A 4B8XA 4KMFA 4A0XA 5LEJA 2W84A 2HZTA 1FOKA 3W6KB 4XSXF 3F3XA 3GYHX 2XAGA 3R0JA 2KIUA 2VONA 5CYVA 4GGGA 5K1YA 1ONVA 3LAPA 2DQLA 3BOQA 3J7AO 4OIPF 2L02A 1J7KA 4NB5A 2FBIA 2HGCA 1L0OC 5IT3A 3BY6A 2HKXA 2Q0OA 1F5TA 4LMYA 3KP7A 2CG4A 3W6JB 4ZYEA 3FF5A 2F5FA 1HKQA 1J5YA 2DW4A 1RUOA 1D5VA 1CGPA 5D5UB 1ZYRF 3ABUA 3WTZA 2VOOA 4Y17A 3TOBA 2H27A 2KJCA 1TNSA 4R1HA 3IKVA 3T0YA 1REPC 1L3LA 3RKWA 1PP7U 1K78B 3GWZA 1ZG1A 5D5VB 2A07F 2IJLA 3F72A 2KIMA 1SD7A 3R6SA 4YIFA 1R23A 4NQWA 2EA2A 1YS6A 5F1RA 5BPIA 3T1BA 1U3EM 2A3SA 4KUMA 5IT9Z 2RC4A 1O7FA 5A2QZ 4IRGA 3U2RA 4MHGA 5DCFA 2KRFA 5D8KB 4BNCA 2UXNA 5FD5A 2ISYA 4AIKA 2DTRA 3CUOA 1EV7A 1UHMA 2ZFWA 3SZPA 2OZUA 2CQKA 3Q9VA 1RNLA 2CFXA 2MH2A 4RB2C 3WTVC 1EH7A 1T38A 4AD9A 4N9IA 4I02A 1ON1A 2XHKA 1G3TA 1QO0D 4R79A 3GFJA 4HAMA 4EM2A 1BM9A 1IRGA 5F6FA 3WE2A 1KQ8A 2C6YA 3BJ6A 5ICFA 2LKPA 2H09A 1FP2A 2EFPA 3C1DA 1B1BA 2EJRA 4JBAA 2WV0A 3WODF 2XV4S 3J81K 3TQNA 4M9XA 4LJZF 5CLSA 1EH6A 1S7AA 1RI7A 5JHUA 3HOTA 5D4SA 4LLNA 2ZMEA 3GW2A 2XAFA 1XDUA 5DD4A 2IVMA 5HS8A 3FHZA 1FX7A 5H6RA 1ODDA 1WSUA 2DPDA 4GO1A 5D4RA 2F5DA 4Q4ZF 1WRJA 2STTA 5DV5A 2XIGA 1LNWA 5JFRA 3ZMZA 2JRTA 3E6BA 3NRVA 1IN8A 3WTTC 1H0MA 5AONA 1P2FA 2D1HA 1SFEA 1T98A 4M72A 1WQ2A 4MQVA 2RV8A 2E7WA 1Z91A 1JGSA 4QWQA 1QZZA 1FYKA 5FO5A 4L18B 3JTGA 4LG0B 4RGUA 2L54A 1LEAA 2K7LA 5D5XB 1IN4A 2UXXA 3E6CC 2CYYA 4KN4X 3ZMVA 1SAXA 2QM3A 5BOXA 3F21A 5L3CA 2V1XA 1H9GA 2CO5A 3BDDA 2JTVA 2NYXA 4HZFA 1HW2A 3F8BA 4A6EA 3E5XA 1G3YA 2X0LA 1MGTA 1FT9A 3V8JA 4FT8A 3ML6A 3L2CA 1V3FA 3JSOA 1JE8A 1QBJA 4OIRF 4YFXF 1WWXA 1IZ1A 4KN7X 3FZVA 3ELKA 2HYFA 4L5JA 5E8GA 5TJJA 3RDIA 2VBZA 3F6VA 1YYVA 4ZYGA 1HSTA 4L5IA 1RIOH 2E1NA 3ZMSA 5BPDA 2ISZA 3I4PA 3H3UA 3QP6A 2XUBA 1DUXC 1BN5A 4HQMA 1HBXG 4CZZA 2D2WA 2PMUA 2V9VA 4I98B 3GFLA 1XGMA 2P5VA 4RB0A 5EEGA 1SD5A 3H92A 2XASA 1XB4A 4XSZF 3RIRA 4LFUA 4LK1F 4MEXF 4Y15A 2FQ3A 3R60A 5LEKA 3M8FA 2COMA 5ERIA 4M74A 4KNYA 2W85A 3KZYA 3KP3A 1USSA 4HF2A 3D0SA 3HOSA 4G6DA 3IRRA 2CSOA 3U1DA 4YIIA 4HF0A 3LWFA 3WGHA 5L3DA 3VB2A 4L0ZB 2Z3YA 4G7OF 2PBIA 2K27A 3JW4A 3GEZA 3VOEA 5ILUA 5HS7A 1YS7A 4EM0B 3R61A 3GX4X 2FMYA 2DFIA 4BHPA 1ZGAA 4Y13A 3ZP5A 4AIJA 2RVCA 4L9VA 1IW7F 1ZG3A 2PG4A 4Z2YA 1FBSA 1FBUA 3DFGA 2ZBKA 1BI1A 1MJAA 2YR2A 5D8LB 3WE3A 3QPHA 1OYWA 3G3ZA 3TGNA 1D3YA 2K4JA 4ENKA 2L01A 4A5NA 1KYZA 3KCCA 4IJAA 2NAZA 1IF1A 4MTEA 2JT1A 4IRHA 4XLNF 4EMSA 3VFZA 2YSRA 2IRFG 1I1SA 1UHWA 2DBBA 1SFXA 4O5VA 2XKPA 2FNAA 1HQCA 4LGWA 3O3KA 2DPUA 2X4HA 5HLGA 3O6BB 4U0YA 4PGHA 3HYIA 2MC3A 4A0YA 1GHCA 1BIAA 1K6OA 2H94A 4XBFA 1K79A 4YG2F 1XDSA 2WWYA 4WXCA 4K2EA 2FNPA 3M9AA 1R36A 1HKSA 3FM5A 5TRDA 2FOKA 2IA1A 2ESHA 2IPQX 5HDNA 5IT9K 3JTHA 4G8XA 4CGZA 3DPLC 3PQKA 1IN5A 5BQTA 3E6DA 5F64A 4ENJA 2G7HA 1WKMA 2VODA 2EV6A 2DAOA 2IP2A 2Z99A 1BI2A 3TO9A 3ZN1A 5LRSA 1Z1DA 4LG0A 4EJUA 2MH9A 4OIQF 2F5CA 3I58A 4WF2A 4CO8A 3M7GA 4M6XA 3TOAA 2HDCA 3BP8A 2QUFA 3P9IA 3QPTA 2ZCWA 2FA5A 1KYWA 3HHHA 2ZJ2A 2GXGA 4A5MA 4PDKA 4WXDA 3RPQA 3WGGA 2XAJA 1STZA 4RB1A 1P4XA 3LSTA 3TKYA 5DYMA 1LB2A 3R0AA 4WX9A 1CF7B 1W7PA 3CDHA 5HLHA 1FP1D 3J80K 3KEQA 4AIHA 2PMHA 3J81Z 2Y0MA 2NNYA 1P6RA 4ASNA 4XLPF 2P6TA 3OOPA 4A2UA 1GXPA 4LD5A 2D45A 2UZKA 1LDKB 3HSEA 2HQNA 2OD5A 1DP7P 3TDZC 1V4RA 3RYPA 4HX8A 4HF1A 2A6EF 1FC3A 2NNNA 5HS9A 2HTJA 3KP4A 2OBPA 1W5TA 4HA8A 1AOYA 4P96A 2H6BA 3HUGA 2A5YB 2ZXJA 3JAMZ 1B9NA 3Q9SA 2M1BA 3GFIA 2ZNZA 1U78A 1XSVA 3FXRA 3MCZA 1SD6A 1KU2A 4LK0F 3ZMUA 1AWCA 2EK5A 4RGSA 1BI3A 5LHIA 1XMKA 1O3QA 5E18F 1HW5A 5HLIA 5L3FA 2G7UA 2MA3A 3V7CA 3T8TA 3ZPLA 3ECHA 2O3FA 3D5LA 5CVUA 1I1GA 3WU1B 3I5UA 3PFIA 1MJBA 1T39A 2EFOA 4EJTA 2BEOA 1KQ0A 3HIFA 2QWWA 3LA7A 1IAWA 3RTRA 4PGGA 5KK1A 4UNOA 3I53A 1TTYA 4NHJA 4IXAA 3BPXA 3DPTA 5E1XA 2GXBA 2JPCA 1FBQA 4HV5A 3M8EA 3N4MA 1Z6RA 1RZ4A 2F5EA 3O2PE 1ZREA 5DCMA 5H6QA 4HBLA 4OOIA 3E3VA 1KU7A 1QGPA 4H0EA 4YFNF 1XD7A 2HQRA 2VE8A 1MZBA 3ZMTA 1F4KA 1RUNA 3FXUA 2QLZA 4RS8A 3SZTA 5AIPA 2PJPA 2H6CA 2L3DA 2VN2A 2XAQA 1UCRA 3GVAA 4JK1X 4ZH4F 1YG2A 2EV0A 3CO6C 3V8KA 3C3WA 2KKOA 4CHUA 1JHFA 2HS5A 3GXOA 1T6SA 5D5WB 4L9TA 1W7PD 4O6JA 1R22A 1DPUA 3NQOA 4BQAA 5E1WA 1Z9CA 4YFKF 4TV7A 4EM1A 5ICGA 4ZYDA 1I6XA 1ZRFA 3KETA 4KFCA 3CLOA 4KICA 4UHTA 3ROUA 5J8CA 3ERED 4RAZA 2PN6A 4HV6A 1S6LA 2Y48A 1YO5C 2HEOA 3IKTA 3K1NA 1D8JA 2W25A 1A04A 5LLQA 3EUHA 3P9CA 1U2WA 4ZZLA 2CGPA 1TQPA 2GIVA 2LDUA 3F8FA 3CTAA 3WG9A 2FRHA 3OV8A 2MLKA 2DQRA 1F1ZA 3WTSC 3FXQA 1IN6A 1OYYA 2AXLA 4HYEA 5LHGA 5L3GA 2M45A 4ENNA 5ED4A 4DNCA 1LDDA 3LAJA 3JAMK 4IHSA 2A68F 4OMZA 5ILVA 3K1PA 2VBXA 1O57A 4CDGA 2HR3A 2L4MA 2DLLA
chains in the Genus database with same CATH superfamily
1EH8A 1GLNA 2AO9A 3ULQB 2OZ6A 2AS5F 4EQQA 3I71A 1J9IA 2LREA 4O3MA 2O6GE 2O8XA 2RDPA 2RQQA 3K2ZA 3P9KA 1D5YA 3HHGA 2VOPA 4EGYA 3LSPA 4HNUA 3MKYB 1TQMA 2LKSA 3TL4X 1U5TB 4U7DA 1K7AA 1X1AA 4U88A 2RQPA 3DF8A 3K4BA 1POGA 4AIDA 2IS2A 3RPUA 4Y33A 4BY7J 3UNGC 3WTYC 3WTUC 3OSFA 2XGEA 4WWCA 2GXAA 1SEUA 1R1TA 3ZQHA 2FU4A 2JJ7A 1ZN2A 1BOAA 2ESNA 2FF4A 4DZJA 5K5OA 2R7ZJ 4ZTJA 2MLGA 3BWGA 4AWXB 4II2A 2OCCH 3PFYA 2P7CB 2OUMA 2XGXA 2WAFA 2Q1ZB 5HOOA 2DXIA 4N4OB 1IXCA 3EETA 5DDGA 2L9VA 2HPIA 2FBKA 1Z05A 5IOYA 2BY1A 4RGRA 2GQQA 3A0BC 1X2MA 2V1DA 1FSHA 2JA7J 3BG9A 4CUGA 2QQBA 1VQLI 2M3AA 3V7RA 1R4MB 1O3RA 2TDXA 2TRTA 3PQJA 1YE9A 4IHVA 4RLFA 2ECCA 2VLAA 2BHZA 2JSPA 5FKKA 1VTNC 4ESFA 2BVMA 3EYIA 2XSDC 3I64A 3G73A 3HRTA 2VKVA 4S04A 1B4AA 1F43A 1OMIA 5ICEA 1BIBA 4XRMA 4V19K 3CF5F 2ZO4A 4DYRA 1G3SA 2L9NA 5E1ZB 1DDNA 1V5EA 1KONA 2KRHA 1KU9A 2ZSHB 3N05A 3LMMA 3JRGA 4IO9F 1JJ6C 4MNUA 4PSXA 1X58A 1HOMA 3PSFA 3B02A 4G9YA 3BZKA 5L3EA 2LR8A 4LLGF 4M71A 3FXJA 3MZ8A 3K4NA 2EA4A 1WZ2A 2JA8J 1TW2A 1JXSA 2G9WA 3OIPA 2HOSA 1XCVA 5EEHA 3I9V2 5CJ9A 1OYIA 4F52A 1WJEA 5DUIA 1R5GA 2IGOA 1ETXA 2EILH 4Z6YA 1R1VA 3JRDA 4IRIA 2GA2A 4JX4A 3FM3A 2KJBA 3CUQC 4KT5C 5LGUA 4ABZA 2CWEA 1LFUP 4KIBA 3CC7I 5K5QA 3MD2A 3L9FA 1IXSB 3LFUA 3CP8A 3F22A 3BPVA 4EJOA 1LE8A 5DM6F 2HNHA 5FD6A 4OMYA 2G0EA 1OR7C 3BTIA 1O7LA 3L09A 2CQNA 2VQGA 2GLOA 1ZRDA 1J59A 1MBJA 4Y3OA 4M6VA 1XS9A 2LG4A 4OWRB 1ZGJA 3HM5A 2VT2A 1QPMA 2RGVA 3EUHC 3UKGA 4NNJA 1YW8A 2RNJA 2HOEA 2XAHA 4P9FA 1BJAA 4KMUX 5E3NA 2XPUA 3HTSB 4CYCB 4UV8A 4HOBA 3OYDA 5E3LA 3GTJJ 3HKZA 2Y75A 4Q48A 5EG0B 2DA6A 4HX4A 5KHDA 2M4KA 3FMRA 3HOVJ 3LFKA 3I54A 3MFKA 5M5WJ 4IHTA 3V7SA 3QRFF 1UB9A 1VZ0A 3J7YJ 1W36D 2ME6A 3OYGA 5JVGF 2IAIA 3FISA 1G3WA 3GF2A 4LIVA 3I0TA 1D1AA 4C2MJ 4DQ2A 4KIFA 1XCBA 2QVOA 4HEA2 2VXDA 4CZCA 3CCJI 3QP5A 2F6CA 3EDPA 1R5HA 3G6EI 2IEKA 2JN6A 1W7PB 3AKZA 4HDUA 2NVQJ 4HPQA 1YJ9I 4U0VA 2HDDA 5E3OA 4ESBA 3FWEA 1HW1A 3L7WA 1YJNI 4BE1A 1R6RA 5A2QK 2N8GA 1FYMA 3DXJF 3ABKH 4M9ZA 5KCMA 4XKCA 1PJRA 4QPOA 3HUGB 1X1DA 3IH2A 4KA4A 2FSWA 2PFBA 3OIOA 1R49A 6PAXA 5H2FC 3BTCA 1YJWI 1PP8F 2MBFA 2VT3A 4E7JA 4S05A 2KIFA 4FQGA 5LRRA 4XLHA 3OYMA 3BT9A 3H0GJ 3CCUI 4ENMA 4OINF 3HSFA 1QRYA 1YIOA 4ZTFA 1U8RA 2WAQA 2VXZA 4BY1J 4U7BA 1KZHA 4AVPA 4NDLA 1LQ1A 4UB8C 2VBWA 1XSDA 1FMVA 3LA2A 4JX6A 4XMYA 2VE9A 1W0UA 4GYGA 1LPQA 2R7RA 2CUEA 1IN7A 4BE0A 1QVUA 3CJQB 2EFNA 4DYQA 2VJIA 1FYLA 4XLFA 2F2EA 3CCVI 3VYUB 1Y1WJ 2MGQA 2Z9OA 3RJPA 3UR3C 1U8BA 2F5VA 1YLFA 2Q2EA 5L3BA 2GAUA 2EB7A 4NC7A 1Z77A 4QIWN 2EWNA 4KIGA 2OPTA 1R4NB 2DK5A 3Q5FA 3WTXC 2DI3A 2HTSA 2P4WA 2EZHA 2KPMA 1LJ9A 1GXQA 1JUMA 3TDUC 4GFBA 2PJRA 3X2QH 1MSFC 2OQRA 5GADJ 4E70A 1FPQA 1JT6A 3H5RA 4M6YA 5FKMA 3TW6A 3ABTA 4QSHA 2P6SA 3MAJA 4I0AA 4ESJA 1ZRCA 3LSRA 1TWFJ 5JVTA 3ZCOA 2BHYA 3LNQA 1ETWA 3J80Z 1QHHD 2W57A 3CDIA 3L00A 3T8RA 1DQUA 2VKHA 4HQEA 1UHSA 3QOPA 1K78A 2BXYA 2DO7A 1VFCA 1WVRA 3KZZA 3CCQI 2M8GX 3Q0WA 1O3TA 4FCYA 2LSOA 2JZYA 4CYCA 2KZGA 3G2BA 3BROA 4P55A 5J8FA 5D6FA 3OYBA 2BE5F 3EQLF 1SMTA 4D0PA 1ZLJA 5H20A 4M73A 4G94A 2ZXWH 3LA3A 4UUTA 3SXYA 1APLC 1VQ7I 4PZJA 1HF0A 1B9MA 4QTRA 3NWSA 1T0FC 1JUPA 1MNEA 2O03A 4RB3C 3HSRA 5AIQA 2M8EA 1I5ZA 4XN3A 1Z7LA 4L9NA 3PNVA 2HKOA 2XVCA 3CESA 2YU3A 2DT5A 3CUQB 1YX3A 2ADUA 1WJDA 2AHQA 3HOZJ 3F8CA 3W3CA 5FLXK 3KEOA 2DMPA 5ICCA 1FIPA 1LEBA 2XAUA 3I3LA 3MZYA 1YFHA 1VF9A 3BJOA 3P7NA 4FX4A 1T8IA 3HTUA 4P1WA 3FHNA 3GZ5A 1P4AA 4F7ZA 1I39A 3A0HC 1OCCH 3BG6A 4UY8I 3CD6I 3H36A 4S0HB 2LF7A 4YEJA 5HDKA 2E71A 2EIKH 1P4WA 1JKPC 4XRSG 3U1KA 3GO5A 1R7JA 2YPRA 4I01A 3TMOA 4FETA 3HRMA 1ZG5A 1YQAA 2WB1A 3FKJA 4UVCA 2P7VB 4A3GJ 3TO6A 3DV8A 3PJRA 3KZIC 2GBYA 5CVRA 2V79A 2DT7B 2CW8A 2I5UA 4HDVA 3H3ZA 4B43A 3OS1A 1NHAA 3DQVC 3KE2A 2QENA 2ELJA 2KIQA 3FMQA 1OCZH 1ZH5A 2YX4A 4HW0A 4D7MA 4LLLA 2K4BA 3CDLA 2XROA 1WJAA 2R7FA 2KDZA 3CJTB 3DWLE 1XGSA 2EV5A 4X1EA 4GCVA 3BG7A 1MDMA 3FK7A 5DUKA 3HZJA 3IL2A 1ZGWA 2EINH 1IRFA 2WV1A 1S3JA 4I6ZA 2QBYB 2BW3B 4BYYA 4XRFA 2O9LA 4M9SA 4C2UA 4OIOF 4LB5A 1FOXA 2Z33A 2FOWA 2JVGA 3CJRB 1B59A 2M7AA 2YX7A 4L5EA 3MZHA 2M34A 1G6NA 1SFUA 3WTWC 2LKXA 1O3SA 4A3JJ 4BAYA 1MDMB 5JI6A 2K9QA 2ECBA 2L4AA 2Q8KA 1R1UA 1A5JA 3F9KA 2JSCA 2LYCA 2K9NA 2ACJA 2XF6A 1KU3A 4A0ZA 1QQIA 1TNTA 2DFEA 1U5TC 1MIJA 3HPHA 1MD0A 3CMMA 3QQAA 5CVJA 3VPRA 4E7SA 4Q47A 3CUQA 3BG5A 3U21A 1BOBA 3F6OA 3A1YA 1ETKA 4CCKA 1JHHA 3JSPA 2HOTA 5HVQC 2Z1DA 3FMSA 4G6QA 4GRIA 3I56I 1IUYA 3OYAA 2X1CA 3F8NA 3NEUA 4KDPA 2J5PA 1X3UA 1E2XA 1X3ZB 3H0DA 3IC7A 1BR2A 5LBQA 2DN0A 4BJTA 2OA4A 1QZYA 2DJNA 3CZ6A 3I59A 3TO7A 3S2DJ 1B6AA 2R7OA 2WTEA 3B73A 3IWZA 3PL8A 2X6YA 1U6GA 1ZHFA 4P5OA 2E2JJ 2B9SA 2RAEA 2CW7A 3ONQA 3AG2H 5LHHA 3IRQA 1K4SA 1LDJA 4Y7NJ 4MEYF 3MWMA 1Q1HA 2ID6A 2P5LC 5CVIA 2R7WA 4L0YB 1ITYA 2CW0F 2ELHA 5FB2A 1RRJA 3WHCA 2BVLA 1IXRC 1RR7A 1UJ8A 2HOAA 2V6CA 3ECOA 3PIOF 3HL2A 1LVAA 2BGCA 1IGNA 1V55H 3ZQIA 3BC8A 3DKWA 4A3CJ 2HU9A 2FMLA 2DODA 5HNFA 4A12A 2ZKZA 4G7ZF 4UVAA 1BBYA 1FLIA 2V7FA 1TT5B 3M1EA 2I10A 3IHUA 2WAQN 2PJRB 4FHTA 3V8LA 1GVJA 2R5ZB 1CF7A 3S17J 3PNTA 2DMTA 2FQ4A 2GOXB 5J1UA 3ESWB 3GUDA 3IWFA 3K1MA 4I09A 1YW7A 4PSWA 1RESA 1W4MA 2QF7A 4D5FA 4UUSB 4BE2A 4CSWA 4II3A 2ZNYA 1UMQA 3KX2A 1R58A 3E6MA 3QU6A 1S5LC 5DCMB 5IYDJ 2PLYA 3HRUA 2V1UA 4ZYHA 1Z67A 2BY2A 1J75A 4E4HA 2HYGD 4MTDA 4M3BA 4XRSA 2ZJRF 5FROA 1ULYA 1IG7A 4I0BA 5EF6A 2NVYJ 1OR7A 2BBYA 1E3OC 2Y0SA 3QU3A 5HODA 2QSHX 2E1OA 3K0LA 5J1RA 2VKDA 2ZFUA 3E5UA 4IHWA 1Y0UA 2LY9A 3CJNA 3KLNA 2GZWA 1XGOA 1ZR2A 1P9QC 3COAC 3WGIA 1U9NA 4N9HA 3ISPA 3TEDA 3S3MA 2EFWA 3DLLF 2FEZA 3BR1A 4CYDA 2FD5A 5EZGA 5M3MJ 3EYYA 3BQZA 3GLXA 3ZQQA 3ZXSA 5KVRA 5M5YJ 2KRCA 4B47A 2CMPA 4EJWA 2X6XA 3F23A 1J2XA 2NS0A 3ASNH 1IO2A 1OJLA 2QYOA 3ZQLA 1KA8A 1FIAA 1FZPB 3W6VA 4EGZA 2RN7A 3RI4A 1K6YA 1RR8C 4E7HA 4IF4A 2HI3A 3WU0A 1SMYF 1YTYA 2VBYA 1FOYA 4CXFA 5E20A 2QSGX 2XRNA 2YS9A 5E8IA 4G7HF 1T95A 3VEPA 1QNTA 2LNBA 5FFZA 5F08A 3KFWX 4P9UA 1UAAA 2EIMH 1RC9A 1T33A 1YW9A 2JVHA 5LGTA 3MKZA 1OCPA 2NXNB 1ON2A 2A5WA 2STWA 3K6GA 2ETHA 3CMEI 1T2KA 2LRDA 4WCGA 1PDNC 2HDWA 4N0BA 5EGOA 2PQ8A 3C2GA 2QGUA 3K9TA 1C0WA 2QKLB 1MSEC 2LBFB 1KQ9A 1R00A 1RETA 1TZLA 4XKVA 1G4DA 1FOWA 4ON0A 4OU0A 2QCOA 2E1CA 3DU6A 2VPRA 2IS4A 4GXOA 4A69C 1ZTRA 5DTDA 2E2IJ 2A69F 4I2OA 4ETSA 5CVVA 5DEQA 1D0ZA 2Q2EB 3PSIA 2VC1A 4EV0A 2M0MA 2DFFA 2EFQA 2VUMJ 4Q5SF 4BHCA 1MKMA 1TLHB 1MBFA 2K86A 2BV6A 3S32A 3C7JA 2R92J 1Y39A 4BACA 2IT0A 4A3MJ 2OU2A 3HJEA 5TISC 1V54H 2L9RA 5BS6A 1RKTA 1LE8B 4HLXA 1KGSA 1T0FA 1Z6TA 2R4GA 4DZPA 2O61A 2JPBA 4ZZDA 1TW3A 2DA1A 2BXZA 2MABA 4PUSA 3S14J 3I4NJ 4Y52J 5EDNA 1QHGA 4RAYA 5FGMA 1ZAOA 4IOCF 3DU5A 4G12A 4EVIA 1ZK8A 1VQMI 4BXUA 4EJVA 3KP6A 1SVLA 3VWBA 3CCRI 3ABMH 3QOEA 3S2WA 5J6XA 4A6DA 2HFHA 4B48A 4RA2A 2P0WA 4ZDPA 1XN7A 2M5WA 1OPCA 2R93J 1U5TA 4BS9A 3REOA 2VC0A 4BGDA 2D1VA 1D8KA 3ZQ7A 2DU9A 2IA2A 1XSXA 2M0CA 4U0WA 4BJ6C 3MKLA 3FXKA 1W5SA 3MQ0A 3RKYA 3U9GA 3BR3A 2BYVE 1CQTA 2XKOA 1XGNA 3SFZA 4XLEA 4DIQA 2O5RA 3GZ6A 1WPKA 3CO7C 2H1LA 2EIJH 4XK4A 1YRNA 4BH9A 1U9OA 4RAGA 3GLLA 3QWLA 1BC8C 2DK8A 5CPRB 2R7QA 2MD5A 1TWAJ 4JQFA 5LGNA 3OSGA 3FK6A 4BEHB 3NAUA 4UVBA 1TQIA 3KIOA 2LVSA 1W5CC 2UWMA 3NWTA 4WXHA 3K4JA 3ZN0A 4BHBA 1VQ4I 3H9GA 5J40A 3KP2A 2FBHA 1UG0A 5KAFC 4QLCU 2LY2A 3V42A 2IW5A 2WY8Q 5HDGA 3AAFA 1UFMA 4MGRA 3QAHA 1S7OA 4CH7A 4R8HA 4QPQA 4H4KC 2FUG2 4UUVA 1Z21A 2QSFX 1W0TA 2K02A 2NRAC 5JR3A 2LK2A 4DOZA 2XSJC 4KT6A 4UV9A 1SD4A 1FWZA 2QZ8A 2DMUA 4XLCA 3GCMA 3RYRA 1G8XA 4A3LJ 1VQKI 1H88C 3KLOA 3AL0B 2E7XA 1TBXA 2AXTC 4W97A 5K5RA 3C18A 2HQAA 2ZMEB 4IHYA 2Z5UA 4HX7A 1MNDA 3MVPA 4B09A 1Z7UA 2HWVA 1PUFB 2CV2A 1PUEE 5FKOA 2XC7A 1MH4A 1MJ9A 1ZLKA 2VJJA 1FY7A 4CICA 1Y0NA 2CQ7A 3GFMA 4KJZA 3LQRA 3D5SC 5E79C 1HXDA 4MQ9F 2A61A 2L9SA 1LFBA 3J7AY 4IPAA 1XPXA 3DEEA 2V6EA 1PYVA 2RKHA 2WC2A 3SQNA 1NG6A 2GA1A 3HOUJ 1YITI 1NG7A 4PCQA 2IA0A 3FX3A 4UXNA 2M30A 3T5XA 2P8TA 3W2WA 3DEUA 1BC7C 3KP5A 2MG4A 3CC4I 2JQ7A 2BOLA 4RGXA 2FXAA 2M87A 3HRSA 4HG2A 1S29A 2NVXJ 1RPWA 4X0GA 2LF8A 1Z3YA 2J5OA 3IP4B 3P5JA 5GAHJ 2FJ1A 2LOOA 5FFXA 1OKRA 1XC5A 2PI0A 1J0RA 5LFAA 5FLXZ 3BTLA 4HNTA 3LQQA 4GYIA 4M3EA 2QQAA 4XKBA 3MKWB 4FX0A 3KPHA 2W24A 2W4SA 5IYCJ 3SHFA 1ZARA 3HOYJ 3K4KA 2EZIA 1I27A 1GV5A 3HEFA 4YIRX 1IC8A 1QU3A 3I59B 5F0HA 1H9TA 1P92A 1BL0A 3JRFA 2B0LA 1FSEA 5D6EA 1HSJA 1HKTA 2NS7A 4LB6B 2OQGA 4LITA 1WGXA 3S93A 3E97A 5FRNA 3CF2A 3OR2C 3HG9A 3F8MA 1ACIA 2QBYA 1QVTA 2XGCA 2Y0SN 2A6HF 5B3SH 4KYWA 2XDVA 3VODA 1S8NA 4D5CA 2XF7A 2DOEA 2COBA 2R3SA 2PEXA 1H8AC 2P5KA 1F9NA 4JOMA 4M3DA 4AC0A 1BI0A 1USTA 5BMZA 1IDZA 3BZ6A 4IKFA 4WK8F 3PNYA 3SEZA 3V4GA 3PO2J 5ILSA 3BJAA 4L9JA 3ZMDA 1YHQI 1XMAA 2JMWA 3PUBA 3DP7A 4IX7A 2DOFA 3R4KA 5EYRA 2E34A 1X3WB 3AG4H 5DD8A 3RZOJ 1I3QJ 1OFCX 1DPRA 1A6QA 3K69A 2O0YA 1FNNA 4ZYAA 2OAZA 4IL6C 2AQEA 2BW3A 4MFEA 4E7ZA 1WI9A 2QQ9A 2GWRA 1S9HA 4PFOA 3FBNB 3DLAA 4IVNA 4N4NB 4HLYA 3E5QA 3I4MJ 1WJ5A 5JLXA 5E17F 1E17A 2R7DA 2V4JC 4I7HA 3AG1H 3MEXA 3N97A 3RKXA 1N77A 1ETOA 1MBHA 2MYSA 2FE3A 1O4XA 1V5FA 4B8XA 2DFHA 4CCJA 4KMFA 4A0XA 5LEJA 2W84A 2GOMA 2HZTA 1FOKA 2DJIA 3W6KB 3HBLA 4XSXF 1GUUA 3G1MA 1SVOA 3F3XA 3DKYA 3GYHX 2XAGA 3GBGA 1X1PA 2V9KA 3R0JA 2KIUA 3ERMA 2VQCA 2X51A 2K3PA 2VONA 5CYVA 4GGGA 5K1YA 1HA8A 1VNDA 1ONVA 2KT0A 3BR2A 4C3JJ 4HSRA 3LAPA 3FXOA 3DTKA 2DQLA 3BOQA 3IH4A 4B4CA 3J7AO 4OIPF 2L02A 1J7KA 1D1CA 1BA5A 2CQXA 4NB5A 3K4CA 2FBIA 3GTGJ 2HGCA 3PIPF 1ZQ3P 1L0OC 5IT3A 3BY6A 4E6KG 2HKXA 1K4TA 2Q0OA 3OYJA 1F5TA 3DCFA 2LLKA 4LMYA 3KP7A 3S1MJ 2Y31A 4AM3A 2Y2ZA 1A35A 3JR9A 1ZELA 2CG4A 2OC6A 4YRVA 3MN2A 4B3XA 2VB6A 3W6JB 3HXLA 2LP0A 4DBQA 4IHXA 4ZYEA 1JTXA 3FF5A 4EATA 1I3AA 2KP6A 1B8IA 2F5FA 2XPWA 2LD5A 1R71A 3DPUA 2ZSIB 4XLAA 5BNGA 1B72A 1HKQA 2KL4A 1J5YA 5FKNA 2DW4A 4E7IA 4A3FJ 1RUOA 2HXOA 1D5VA 2E5ZA 1CGPA 3K4LA 2KFDA 2QA4I 4PJLA 5D5UB 1NK3P 1ZYRF 3ABUA 3WTZA 2VOOA 1JJ8C 4Y17A 3OWTA 3TOBA 3QYEA 2R0QC 2H27A 2XF5A 1AKHB 2KJCA 1MMNA 1TNSA 4R1HA 1JGGA 3IKVA 3T0YA 1IV6A 1REPC 1E0EA 1L3LA 3RKWA 4V2GA 2Z2SB 3KYCB 1PP7U 3QPLA 1K78B 3S2HJ 3GWZA 1ZG1A 2NVTJ 5D5VB 2A07F 3G1OA 2X6WA 2IJLA 4C2TA 2QEXI 4AU7A 3F72A 1DGWY 2KIMA 2JA2A 1SD7A 3R6SA 4YIFA 4D7NA 1R23A 4NQWA 2KQRA 4FE4A 3CCMI 2EA2A 3VYRB 1NK2P 1YS6A 3K4MA 3LSMA 5F1RA 4HRIA 2O8KA 2WA0A 2M2EA 2ZJQF 4BDYA 5BPIA 3T1BA 1U3EM 2A3SA 3RZDJ 3HGGA 2HVQA 4KUMA 5IT9Z 1EF4A 2Y9ZA 1K83J 2RC4A 3L2UA 9ANTA 1ETQA 1O7FA 5A2QZ 4IRGA 1BR1A 3U2RA 4MHGA 4DJAA 5DCFA 2KRFA 5D8KB 1N78A 4LIUA 4BNCA 2UXNA 4E7LA 2L5QA 3HC7A 2HVRA 5FD5A 2ISYA 4AIKA 1GV2A 1HDDC 3G71I 1YRNB 2ZB9A 2DTRA 1Y8QB 3CUOA 4A3IJ 1EV7A 1UHMA 2ZFWA 3SZPA 3OS0A 1XX5A 2OZUA 2CQKA 1XMXA 1S7EA 3ABLH 3Q9VA 2H8RA 1D1BA 1ETYA 1RNLA 2CFXA 2K9LA 2MH2A 2R7VA 2ME0A 2HZDA 3BCAA 2DDAA 1HDPA 4RB2C 2R7SA 4BUPA 3WTVC 1IJWC 3I55I 1EH7A 4F92B 1T38A 4C3IJ 4AD9A 2M7BA 4N9IA 4I02A 1ON1A 5DS9A 3Q0VA 2XHKA 1G3TA 3KYLA 1QO0D 3LSGA 1W1WE 4R79A 1MMAA 3GFJA 2VL8A 2O7OA 2PMZN 4HAMA 1BM9A 4RAFA 5F6FA 4EM2A 3WE2A 4J19A 1IRGA 5C3EJ 5KNLA 1SFOJ 2C6YA 1KQ8A 3BJ6A 2PX9A 1X4OA 5ICFA 2LKPA 2IGMA 1WH7A 2H09A 2JA6J 1FP2A 2EFPA 3C1DA 5CKTA 1B1BA 2EJRA 4JBAA 2R5YB 2WV0A 3WODF 1WCMJ 2XV4S 3J81K 3TQNA 4M9XA 3CLQA 3HPGA 4LJZF 5CLSA 3ZQGA 2HVSA 4J01A 1EH6A 1PUFA 3HDDA 1S7AA 3M1CA 1RI7A 3W2AA 5JHUA 3HOTA 5D4SA 4LLNA 1X2NA 2ZMEA 3GW2A 1Q1VA 4PJ0C 2CUJA 2XAFA 1XG1A 4Y4RA 1XDUA 5DD4A 3D1NI 1LUJB 2DT6A 2IVMA 2E35A 5HS8A 3FHZA 1A36A 2R7UA 2LTPA 4IQ4A 3C2HA 3S8PA 4F3QA 1IRZA 2DMNA 4AYBA 1FX7A 4JYKA 2MW8A 2CQQA 2Y9YA 5H6RA 4IOAF 1ODDA 5K7HA 1WSUA 2DPDA 4GO1A 1I6HJ 4F93B 3GTQJ 5D4RA 2F5DA 4ZJZA 4Q4ZF 4IZZA 1TL8A 1WRJA 2L2OA 1AA7A 2STTA 5DV5A 2CRGA 1DU6A 3O8GA 2VQHA 3ZQFA 2XIGA 5EGOB 3M8JA 1LNWA 3ZR8X 5JFRA 3ZMZA 2JRTA 4MLOA 3E6BA 3QPSA 4MFDA 2VQLA 3NRVA 1J09A 3L1PA 3DBRB 1DU0A 4RBOA 4CA0A 2GIZA 1IN8A 3WTTC 1H0MA 4XOTA 3BTJA 2DDBA 2WY7Q 5CQEA 5AONA 4RMNA 3Q3SA 5FJ8J 3F0CA 1P2FA 2D1HA 4BQNA 1SFEA 1T98A 2E60A 4M72A 1WQ2A 3AG3H 3HKZN 3OL4A 2B7EA 1WJCA 3DBLB 4MQVA 2RV8A 1OQYA 2E7WA 1Z91A 1JGSA 5B66C 4QWQA 1QZZA 2HXIA 1FYKA 4NQWB 3H9QA 5FO5A 4L18B 3CMYA 1HCRA 3CCSI 3JTGA 2LY1A 5FKLA 2TCTA 2V1NA 4LG0B 3OY9A 4RGUA 1X19A 2L54A 1JKQC 1LEAA 3VYTB 1T08B 2K7LA 5D5XB 1IN4A 4UUSA 1K61A 3BQYA 1JT0A 1VQ8I 2UXXA 1IDYA 3E6CC 5E3MA 3A4CA 1MH3A 2CYYA 4KN4X 3K7AJ 1OCOH 3C2BA 5FRMA 3ZMVA 5M3FJ 4OAZA 1SAXA 2QM3A 5BOXA 2K3FA 3F21A 5L3CA 2L7KA 5C4JJ 3A01A 2V1XA 3QODA 1H9GA 2L7FP 1YI2I 2CO5A 3BDDA 3CCEI 5FLMJ 5IP7J 1G2HA 2CUFA 2JTVA 2NYXA 4HZFA 2QQ8A 1P7JA 1HW2A 3F8BA 2OTJI 5J47A 2ICWG 4A6EA 3E5XA 1G3YA 3JRHA 3IV5A 2X0LA 1MGTA 1U0JA 1FT9A 3G4SI 3V8JA 4FT8A 3ML6A 1UZCA 3L2CA 1V3FA 3JSOA 1JE8A 1QBJA 3OYEA 4OIRF 1D0XA 3E1SA 3EPZA 4YFXF 1WWXA 2MC4A 1IZ1A 2CFOA 4KN7X 3FZVA 5J3LA 3ELKA 3JRIA 2HYFA 4D1QA 4L5JA 1UELB 3ZOBA 5E8GA 2OF7A 3DTIA 2E2HJ 1Z0XA 1NH3A 5TJJA 4BQOA 3RDIA 3S1RJ 2VBZA 2YUSA 3F6VA 1G59A 2W00A 1YYVA 3JRBA 4ZYGA 1B72B 1HSTA 4L5IA 1VI0A 1RIOH 5B5EC 2E1NA 4RLQA 3ZMSA 5BPDA 4KISA 2ZXIA 3VDXA 2JK3A 2ISZA 3BCBA 3I4PA 3JCUC 3H3UA 3QP6A 3GTKJ 1WJFA 2XUBA 1DUXC 1BN5A 4HQMA 1HBXG 2VJ5A 1WFXA 1UG2A 3JRAA 3K70C 1IV8A 4DGWB 2F4IA 4CZZA 3LSIA 4U87A 3S3NA 4CCLA 2D2WA 2PMUA 2V9VA 4I98B 4I99C 1H89C 1HLVA 4PFPA 3GFLA 1XGMA 3VYSB 2P5VA 4RB0A 5EEGA 1SD5A 3H92A 3LL7A 5GTIC 1GDTA 1BW5A 2XASA 3IAM2 3AFHA 1V5GA 1XB4A 4A3KJ 4XSZF 3RIRA 4PJJA 4LFUA 4LK1F 4MEXF 4Y15A 1DP3A 2FQ3A 4W1UA 3HB9A 3R60A 5LEKA 3M8FA 2COMA 2IS6A 5ERIA 4M74A 2DTZA 3K70D 4XL9A 4KNYA 2W85A 4FASD 3Q0UA 2CUZA 1SC7A 1SANA 2JUGA 3KZYA 4B3AA 4B1RA 2X1EA 3KP3A 3AL0C 1USSA 1VQNI 4PK4A 4HF2A 3D0SA 3HOSA 4G6DA 2WAEA 3IRRA 1GT0C 2CSOA 3U1DA 4YIIA 4HF0A 3LWFA 4C3HJ 1WH5A 4HSTA 3WGHA 5L3DA 3GTLJ 3RQIA 3VB2A 1QZEA 2A05A 4L0ZB 2Z3YA 3BZCA 3A01B 2E19A 3K10A 3OYHA 3OYCA 4G7OF 2PBIA 1WJBA 1OCTC 1E3HA 2K27A 2W82A 2KZVA 3M07A 3JW4A 3KEYA 3GEZA 2WB1N 1ZKGA 3VOEA 5ILUA 5HS7A 1YS7A 4EM0B 3S16J 4BL0B 3B6AA 3R61A 5EEAA 3HGYA 3LSHA 2JWTA 4NC8A 1BJZA 2DA4A 3GX4X 2DOAA 2X85A 2OV7A 2FMYA 2DFIA 4BHPA 2DA3A 1MBGA 3W2VA 5IP9J 1ZGAA 2ELKA 2VPLA 2OJED 4JP0A 3MMYB 4Y13A 1EKEA 3ZP5A 2NVUB 2RVCA 1OISA 4L9VA 1IW7F 4AIJA 2HYJA 5IPAA 1ZG3A 2PG4A 4Z2YA 3D5RC 1FBSA 1FBUA 5J4VA 2KDOA 3DFGA 2ZBKA 1BI1A 1MJAA 4A3EJ 2YR2A 3JRCA 5IP6A 5D8LB 2HPMA 3WE3A 1JI8A 3CQZJ 3GTOJ 4GDFA 3QPHA 1OYWA 3G3ZA 3TGNA 1D3YA 2K4JA 5F1JA 4ENKA 2M4GA 5EJCA 2L01A 4A5NA 4E7KA 1ZR4A 1TWGJ 4J00A 1KYZA 3KCCA 2V26A 1BW6A 2XPVA 2Y30A 4IJAA 2CV0A 2A6TA 2NAZA 1IF1A 1MMGA 4MTEA 5HNHA 3TP0A 3PUFA 4BXFA 3S1QJ 3FIWA 2JT1A 4IRHA 4XLNF 1JTYA 3SJMA 4EMSA 2I8DA 3VFZA 2YSRA 5HLTA 2IRFG 4FISA 4JX5A 3LOCA 1I1SA 5FLVA 1UHWA 2DBBA 1SFXA 4O5VA 3FDYA 1JKOC 2XKPA 3WG7H 2H1KA 2FNAA 2YU9J 1YX5A 2CS3A 5JLWA 3FBIB 1HQCA 3BR6A 1TC3C 3WHBA 4LGWA 3O3KA 3OR1C 1MMDA 1YOVB 2K40A 3B6CA 2DPUA 2X4HA 2X9DA 1E3PA 1JUSA 2R7TA 4C9YA 2CJJA 2RREA 3H5AA 5HLGA 3IH3A 3O6BB 4U0YA 4PGHA 2BZTA 3HYIA 2MC3A 2WBMA 4A0YA 1GHCA 2MFZA 4ITVA 2KHMA 3OYNA 2X1DA 1BIAA 1K6OA 2H94A 4XBFA 1K79A 3WU2C 1XDSA 1MW7A 1N75A 4YG2F 3CMAI 2WWYA 1Z3XA 4NUBA 4WXCA 2VKEA 3ZGKA 1SVMA 4K2EA 2FNPA 1NTCA 3M9AA 1LKXA 1R36A 2MD0A 3SYTA 3CCYA 3RKQA 1HKSA 2DA7A 3FM5A 2DA2A 5TRDA 4XR6A 2FOKA 4ANJA 3OYKA 3EUAA 2IA1A 2ESHA 2IPQX 5HDNA 3JREA 3GMEA 3JTHA 3CCLI 5IT9K 4G8XA 4CGZA 2AQFA 3FXMA 3G1LA 3DPLC 5K7ZA 3PQKA 4BBRJ 5B1AH 1IN5A 2IS1A 2VIXA 1SAUA 3E6DA 5F64A 5BQTA 4ENJA 2G7HA 4XNFA 2CU7A 1WKMA 4F55A 2B63J 3OS2A 2EBIA 3QYBA 2VODA 2EV6A 3PM1A 1RKWA 2DAOA 4V2FA 3RPUD 2IP2A 2Z99A 1Y6IA 1BI2A 3TO9A 3ZN1A 5LRSA 1Z1DA 1HC8A 2F4OB 3SZGA 3TW7A 4LG0A 4FTHA 1FEXA 2IGKA 4EJUA 2VASA 2MH9A 3LSKA 2CV1A 4PJNA 3TP3A 2F5CA 1X1CA 3H1CA 3I58A 1Y1VJ 4WF2A 4CO8A 2OTLI 4OIQF 3M7GA 2BY3A 4UB6C 2K9SA 2EZLA 4M6XA 3FKIJ 3TOAA 1W36C 2LC2A 3L2WA 1YIJI 1TWHJ 2HDCA 3BP8A 2QUFA 3P9IA 3QPTA 2ZCWA 2FA5A 1KYWA 2KISA 3HHHA 1ERDA 3H5NA 2ZJ2A 2GXGA 2XRLA 4NC6A 3IUOA 4A5MA 4BBSJ 4PDKA 4WXDA 3A02A 4RM2A 3RPQA 3HOWJ 2UUZA 2X48A 4FE7A 3WGGA 2FX0A 2XAJA 1STZA 2RNGA 1TT0A 4M3FA 4RB1A 1EA3A 1P4XA 3LSTA 3TKYA 5DYMA 1LB2A 2XB5A 4AUXA 3DEWA 2X6OA 2IGNA 3R0AA 4WX9A 4D9JA 2BY0A 2R5ZA 1CF7B 5GP9A 2M9HA 1W7PA 3CDHA 5HLHA 5IYBJ 1FP1D 2EPFA 1VQ9I 2R5YA 3J80K 3KEQA 4AIHA 5GPAA 2PMHA 2ZMEC 3J81Z 2Y0MA 3VSLA 4DBRA 1ENHA 2LBFA 2NNYA 3OYFA 2JA5J 4XICA 1P6RA 3TBIA 3O8HA 4BEHA 3SDBA 2K5CA 4ASNA 4BKXA 2IBDA 4XLPF 1X1BA 2ZC2A 2P6TA 4A3DJ 3OOPA 4A2UA 1GXPA 4G6TB 1WHUA 4LD5A 2D45A 3OMYA 1IUFA 4XM3A 3EUKL 5F0FA 2UZKA 1LDKB 3HSEA 2HQNA 2OD5A 1DP7P 3TDZC 1V4RA 1S72I 3RYPA 1R9TJ 3OYLA 3RQ4A 2JRMA 4HX8A 2W7NA 4HF1A 4I76A 5KAIC 5EG0A 2A6EF 4IEJA 5F0CA 1FC3A 4CCMA 4A93J 4A3BJ 2NNNA 3ASOH 5HS9A 2HTJA 2R7XA 3KP4A 2OBPA 1W5TA 4HA8A 4BQQA 5IOZA 1AOYA 4P96A 2H6BA 3HUGA 2GM4A 2A5YB 4BXXJ 2ZXJA 3JAMZ 1MNMC 4XORA 4ZC3A 1VQOI 1B9NA 3Q9SA 2M1BA 3GFIA 2DA5A 2ZNZA 4XONA 1U78A 1XSVA 2HQ5A 3FXRA 3MCZA 5CQGA 1SD6A 1WI3A 1KU2A 5IY5H 4LK0F 3ZMUA 1AWCA 2EK5A 2EZKA 4RGSA 4MO7A 1A6IA 1BI3A 5LHIA 2W1OA 2F4MB 2LH9A 1XMKA 2KLOA 1O3QA 2E1MB 5E18F 2XGDA 1HW5A 5HLIA 5L3FA 4OAYA 2G7UA 2MA3A 1JKRC 2VJ4A 3V7CA 3T8TA 1AHDP 1GVDA 5F04A 3ZPLA 3A03A 3ECHA 1XTAA 2XB0X 2O3FA 3D5LA 5CVUA 5J4YA 1I1GA 3WU1B 3I5UA 2MSYA 4LOCA 3ZRGA 2E36A 3PFIA 3DBHB 3ZQCA 1PVEA 1TP4A 1MJBA 1T39A 4XN0A 3H35A 1DGRM 1MBEA 2EFOA 4EJTA 2BEOA 1KQ0A 3HIFA 2QWWA 3LA7A 3L2QA 2WADA 3RTRA 1IAWA 4PGGA 5KK1A 4AVZA 4UNOA 3I53A 1TTYA 4NHJA 2L7MP 5M5XJ 4IXAA 3BPXA 3DPTA 3QYFA 5DM7F 5E1XA 2GXBA 2QKMB 2JPCA 1FBQA 4HV5A 2W48A 3M8EA 3N4MA 1Z6RA 1RZ4A 3BR5A 2F5EA 2ZXHA 1LFPA 3O2PE 3OL3A 5DCMA 5H6QA 4KITB 3KYDB 1ZREA 5J1YA 2CH0A 4HBLA 3RSNA 2Z16A 4OOIA 3GTMJ 2DYSH 3LSJA 5GAGJ 1Y8RB 4RM3A 4AYBN 3E3VA 1KU7A 1QGPA 4H0EA 2EQRA 4YFNF 1XD7A 2HQRA 2LMDA 2VE8A 1MZBA 3PO3J 3ZMTA 5GPCA 3FXLA 1F4KA 1RUNA 3FXUA 3IAS2 2QLZA 4RS8A 4B44A 2OCEA 4M3GA 1VQ6I 3NARA 1OCRH 3SZTA 5AIPA 2P81A 2PJPA 1MMSA 5GAEJ 2H6CA 2IXSA 4C30A 4DW6A 2L3DA 2VN2A 2XAQA 2L7ZA 3GVAA 1UCRA 4JK1X 4YELA 4ZH4F 1AU7A 1Y56A 5TGTA 4ZDOA 1YG2A 1OLTA 2EV0A 3CO6C 3V8KA 1LVKA 3C3WA 2NOGA 2NOJB 3S1NJ 2KKOA 4CHUA 2ID3A 4RDUA 2F48A 1JHFA 2HS5A 3GXOA 1T6SA 5D5WB 2V9PA 3OIQA 5EZHA 4L9TA 1D0YA 2L0KA 3SEQA 1W7PD 2VI6A 4O6JA 1R22A 3E7LA 1DPUA 3CP2A 3NQOA 4HNVA 2JUCA 2E1MC 3VSKA 4F91B 5JHFA 4BQAA 4NBQA 5E1WA 2K85A 1BR4A 1FJLA 1I50J 1QA6A 1Z9CA 2EH3A 4YFKF 4TV7A 4EM1A 5ICGA 3H3VK 2DYRH 4ZYDA 1I6XA 1ZRFA 1N25A 2UV1A 2ZJPF 3KETA 4KFCA 3CLOA 3SFIA 3OYIA 4KICA 4UHTA 3SDGA 3ROUA 5J8CA 1B8IB 3ERED 5GTHC 5C4XJ 5K7FA 4XIDA 4RAZA 2PN6A 1FTZA 3BR0A 3M3YJ 3OOUA 4HV6A 1S6LA 1F36A 2Y48A 1X4PA 4IQJA 1YO5C 3S3OA 4CCOA 2HEOA 3S15J 1ORKA 3IKTA 3K1NA 1D8JA 5F27A 3L2VA 1P7IA 2W25A 4XQFA 1AKHA 1A04A 5LLQA 3EUHA 4BJ5C 3P9CA 1U2WA 4ZZLA 4X6AJ 4EEFG 3RCOA 2CGPA 1IRXA 1TQPA 1TWCJ 2GIVA 2PMZA 3DTEA 4ZDLA 1MBKA 4BU2A 3H9JA 2LDUA 1FTTA 3F8FA 3CTAA 3WG9A 3HOXJ 2FRHA 3OV8A 2MLKA 4LG3A 3L2RA 2DQRA 2D5VA 3E0JB 3J7ZI 1F1ZA 3WTSC 1ETVA 2DMQA 3BG3A 1IN6A 1OYYA 3FXQA 1R5ID 3BLYA 2AXLA 4HYEA 5LHGA 2KMUA 1SFKA 4PJMA 5L3GA 2LFBA 2E5NA 2M45A 2DCEA 2Y69H 4BDZA 4ENNA 5ED4A 1VQ5I 3DKXA 1A31A 4MIMA 3K2AA 2K9MA 3CC2I 4DNCA 5C44J 1LDDA 3LAJA 4XOPA 5B1BH 3JAMK 4CCNA 1QPIA 4IHSA 3A2KA 2A68F 4OMZA 5ILVA 1EJ9A 1T56A 3GZNB 3K1PA 1M1EB 3GTPJ 4DYCA 4XKWA 1VQPI 3M4OJ 2VBXA 5LD2C 2NS8A 1FMWA 1O57A 4CDGA 2HR3A 2L4MA 2H8WA 2DLLA
chains in the Genus database with same CATH topology
1EH8A 3ULQB 2OZ6A 2AS5F 4EQQA 3I71A 1J9IA 4O3MA 2O6GE 2O8XA 2RDPA 3K2ZA 3P9KA 3HHGA 2VOPA 4EGYA 1TQMA 1U5TB 4U7DA 1K7AA 4U88A 2RQPA 3DF8A 3RPUA 3WTYC 3WTUC 4WWCA 1R1TA 2FU4A 1ZN2A 1BOAA 2ESNA 2FF4A 5K5OA 2MLGA 3BWGA 4AWXB 2P7CB 2XGXA 5HOOA 1IXCA 3EETA 5DDGA 2FBKA 1Z05A 4RGRA 2GQQA 2V1DA 1FSHA 2QQBA 3V7RA 1O3RA 2TDXA 3PQJA 1VTNC 4ESFA 3EYIA 3I64A 3G73A 3HRTA 4S04A 1B4AA 1OMIA 5ICEA 1BIBA 2ZO4A 1G3SA 5E1ZB 1DDNA 2PI0A 1KU9A 4MNUA 3B02A 4G9YA 5L3EA 4LLGF 4M71A 2EA4A 1TW2A 1JXSA 2G9WA 1XCVA 5EEHA 5CJ9A 1OYIA 5DUIA 1R5GA 1R1VA 4IRIA 2GA2A 3FM3A 2KJBA 3CUQC 4KT5C 5LGUA 2CWEA 4KIBA 5K5QA 3L9FA 1IXSB 3F22A 3BPVA 4EJOA 5FD6A 4OMYA 1O7LA 3L09A 1ZRDA 1J59A 1ZGJA 2VT2A 1QPMA 2RGVA 1YW8A 2RNJA 2HOEA 2XAHA 4P9FA 1BJAA 4KMUX 3HTSB 4UV8A 4HOBA 2Y75A 4Q48A 4HX4A 3FMRA 3LFKA 3I54A 3MFKA 4IHTA 3V7SA 3QRFF 1UB9A 1G3WA 3GF2A 3I0TA 4DQ2A 4KIFA 1XCBA 2QVOA 3QP5A 3EDPA 1R5HA 1W7PB 4HDUA 4U0VA 4ESBA 3FWEA 1HW1A 3L7WA 5A2QK 1FYMA 3DXJF 4M9ZA 4KA4A 2FSWA 2PFBA 6PAXA 1PP8F 2MBFA 2VT3A 4S05A 2KIFA 5LRRA 4ENMA 4OINF 3HSFA 1YIOA 1U8RA 2VXZA 4U7BA 4AVPA 1LQ1A 2VBWA 1XSDA 3LA2A 2VE9A 4GYGA 1IN7A 2EFNA 1FYLA 2F2EA 2Z9OA 3RJPA 2Q2EA 1YLFA 5L3BA 2GAUA 2EB7A 2EWNA 4KIGA 2DK5A 3Q5FA 3WTXC 2DI3A 2HTSA 2P4WA 1LJ9A 1GXQA 3TDUC 2OQRA 4E70A 1FPQA 4M6YA 3ABTA 2P6SA 3MAJA 4I0AA 4ESJA 1ZRCA 5JVTA 3J80Z 2W57A 4HQEA 3L00A 3T8RA 1K78A 3QOPA 2DO7A 3KZZA 1O3TA 2LSOA 2JZYA 3BROA 4P55A 5J8FA 5D6FA 2BE5F 3EQLF 1SMTA 4D0PA 1ZLJA 5H20A 4M73A 4G94A 3LA3A 3SXYA 4PZJA 1B9MA 2O03A 4RB3C 3HSRA 5AIQA 2M8EA 1I5ZA 4L9NA 2HKOA 2XVCA 2YU3A 2DT5A 3CUQB 2ADUA 3F8CA 5FLXK 3KEOA 5ICCA 1LEBA 3MZYA 1YFHA 3BJOA 3P7NA 4FX4A 3HTUA 3GZ5A 1P4AA 4F7ZA 2LF7A 5HDKA 1P4WA 3GO5A 1R7JA 2YPRA 4I01A 3HRMA 1ZG5A 1YQAA 4UVCA 2P7VB 3TO6A 3DV8A 5CVRA 2V79A 4HDVA 3H3ZA 1NHAA 3DQVC 3KE2A 2QENA 3FMQA 1ZH5A 2YX4A 4HW0A 4LLLA 2K4BA 2XROA 2R7FA 1XGSA 2EV5A 4GCVA 1MDMA 5DUKA 3IL2A 1IRFA 1S3JA 2QBYB 4BYYA 4XRFA 4M9SA 4OIOF 4LB5A 2Z33A 1B59A 2YX7A 3MZHA 1G6NA 1SFUA 3WTWC 1O3SA 4BAYA 1MDMB 5JI6A 2L4AA 2Q8KA 1R1UA 2JSCA 2ACJA 1KU3A 4A0ZA 1QQIA 1TNTA 1U5TC 1MD0A 5CVJA 4Q47A 3CUQA 3F6OA 1JHHA 3JSPA 5HVQC 3FMSA 4G6QA 1IUYA 3F8NA 3NEUA 4KDPA 2J5PA 1X3UA 1E2XA 3IC7A 5LBQA 2OA4A 1QZYA 3I59A 3TO7A 1B6AA 2WTEA 3B73A 3IWZA 1U6GA 1ZHFA 4P5OA 5LHHA 3IRQA 1LDJA 4MEYF 3MWMA 1Q1HA 2P5LC 5CVIA 4L0YB 2CW0F 2ELHA 5FB2A 2V6CA 1IXRC 3ECOA 1LVAA 2BGCA 3DKWA 2FMLA 4A12A 2ZKZA 4G7ZF 4UVAA 1BBYA 1FLIA 3M1EA 3IHUA 4FHTA 3V8LA 1GVJA 1CF7A 3GUDA 3IWFA 3K1MA 4I09A 1YW7A 1W4MA 2ZNYA 1R58A 3E6MA 3QU6A 5DCMB 2V1UA 3HRUA 2PLYA 4ZYHA 1J75A 2HYGD 4MTDA 1ULYA 4I0BA 1OR7A 2BBYA 3QU3A 3K0LA 3E5UA 1Y0UA 3CJNA 3KLNA 2GZWA 1XGOA 3COAC 3WGIA 4N9HA 3ISPA 2EFWA 2FEZA 4CYDA 3EYYA 3GLXA 5KVRA 4EJWA 3F23A 1J2XA 2NS0A 2QYOA 1KA8A 1FZPB 4EGZA 2RN7A 3RI4A 4IF4A 3WU0A 1SMYF 1YTYA 2VBYA 4CXFA 5E20A 2XRNA 5E8IA 4G7HF 3VEPA 1QNTA 2LNBA 5FFZA 3KFWX 4P9UA 1YW9A 5LGTA 1ON2A 2STWA 2ETHA 1T2KA 4WCGA 1PDNC 4N0BA 2PQ8A 3K9TA 1C0WA 1KQ9A 1R00A 1G4DA 4ON0A 4OU0A 2E1CA 4GXOA 2A69F 4I2OA 4ETSA 5CVVA 5DEQA 2VC1A 4EV0A 2EFQA 4Q5SF 4BHCA 1MKMA 1TLHB 2K86A 2BV6A 3C7JA 2IT0A 2OU2A 5BS6A 4HLXA 1KGSA 1T0FA 1Z6TA 2O61A 2JPBA 4ZZDA 1TW3A 4RAYA 5FGMA 1ZAOA 4EVIA 4BXUA 4EJVA 3KP6A 5J6XA 3S2WA 4A6DA 2HFHA 1XN7A 2M5WA 1OPCA 1U5TA 3REOA 2VC0A 2D1VA 1D8KA 3ZQ7A 2DU9A 2IA2A 1XSXA 4U0WA 1W5SA 3MQ0A 3RKYA 3U9GA 2BYVE 2XKOA 1XGNA 3SFZA 3GZ6A 3CO7C 4BH9A 1BC8C 2DK8A 5LGNA 2MD5A 4JQFA 4UVBA 1TQIA 2UWMA 4WXHA 3ZN0A 4BHBA 3KP2A 2FBHA 4QLCU 2IW5A 5HDGA 3AAFA 1UFMA 4MGRA 3QAHA 1S7OA 4R8HA 4UUVA 2NRAC 2K02A 5JR3A 4UV9A 1SD4A 1FWZA 2QZ8A 3RYRA 3KLOA 2E7XA 1TBXA 5K5RA 2ZMEB 3C18A 2Z5UA 4HX7A 4B09A 1Z7UA 2HWVA 1PUEE 1MJ9A 1ZLKA 1FY7A 4CICA 3GFMA 3LQRA 1HXDA 4MQ9F 2A61A 4IPAA 2RKHA 2WC2A 3SQNA 2GA1A 4PCQA 2IA0A 3FX3A 4UXNA 2M30A 3T5XA 2P8TA 3DEUA 1BC7C 3KP5A 4RGXA 2FXAA 2M87A 3HRSA 1S29A 2LF8A 2J5OA 5FFXA 1OKRA 1J0RA 5FLXZ 3LQQA 4GYIA 2QQAA 4FX0A 2W24A 3SHFA 1ZARA 1I27A 3I59B 1H9TA 1P92A 2B0LA 1FSEA 5D6EA 1HSJA 1HKTA 4LB6B 2OQGA 3E97A 3F8MA 2QBYA 2A6HF 4KYWA 3VODA 1S8NA 2R3SA 2PEXA 2P5KA 1F9NA 1BI0A 1USTA 5BMZA 3BZ6A 4WK8F 3V4GA 5ILSA 3BJAA 4L9JA 3ZMDA 1XMAA 3DP7A 3R4KA 5DD8A 1DPRA 3K69A 2O0YA 1FNNA 2OAZA 1WI9A 2QQ9A 2GWRA 4IVNA 4HLYA 3E5QA 5E17F 1E17A 2R7DA 4I7HA 3MEXA 3N97A 3RKXA 2FE3A 4B8XA 4KMFA 4A0XA 5LEJA 2W84A 2HZTA 1FOKA 3W6KB 4XSXF 3F3XA 3GYHX 2XAGA 3R0JA 2KIUA 2VONA 5CYVA 4GGGA 5K1YA 1ONVA 3LAPA 2DQLA 3BOQA 3J7AO 4OIPF 2L02A 1J7KA 4NB5A 2FBIA 2HGCA 1L0OC 5IT3A 3BY6A 2HKXA 2Q0OA 1F5TA 4LMYA 3KP7A 2CG4A 3W6JB 4ZYEA 3FF5A 2F5FA 1HKQA 1J5YA 2DW4A 1RUOA 1D5VA 1CGPA 5D5UB 1ZYRF 3ABUA 3WTZA 2VOOA 4Y17A 3TOBA 2H27A 2KJCA 1TNSA 4R1HA 3IKVA 3T0YA 1REPC 1L3LA 3RKWA 1PP7U 1K78B 3GWZA 1ZG1A 5D5VB 2A07F 2IJLA 3F72A 2KIMA 1SD7A 3R6SA 4YIFA 1R23A 4NQWA 2EA2A 1YS6A 5F1RA 5BPIA 3T1BA 1U3EM 2A3SA 4KUMA 5IT9Z 2RC4A 1O7FA 5A2QZ 4IRGA 3U2RA 4MHGA 5DCFA 2KRFA 5D8KB 4BNCA 2UXNA 5FD5A 2ISYA 4AIKA 2DTRA 3CUOA 1EV7A 1UHMA 2ZFWA 3SZPA 2OZUA 2CQKA 3Q9VA 1RNLA 2CFXA 2MH2A 4RB2C 3WTVC 1EH7A 1T38A 4AD9A 4N9IA 4I02A 1ON1A 2XHKA 1G3TA 1QO0D 4R79A 3GFJA 4HAMA 4EM2A 1BM9A 1IRGA 5F6FA 3WE2A 1KQ8A 2C6YA 3BJ6A 5ICFA 2LKPA 2H09A 1FP2A 2EFPA 3C1DA 1B1BA 2EJRA 4JBAA 2WV0A 3WODF 2XV4S 3J81K 3TQNA 4M9XA 4LJZF 5CLSA 1EH6A 1S7AA 1RI7A 5JHUA 3HOTA 5D4SA 4LLNA 2ZMEA 3GW2A 2XAFA 1XDUA 5DD4A 2IVMA 5HS8A 3FHZA 1FX7A 5H6RA 1ODDA 1WSUA 2DPDA 4GO1A 5D4RA 2F5DA 4Q4ZF 1WRJA 2STTA 5DV5A 2XIGA 1LNWA 5JFRA 3ZMZA 2JRTA 3E6BA 3NRVA 1IN8A 3WTTC 1H0MA 5AONA 1P2FA 2D1HA 1SFEA 1T98A 4M72A 1WQ2A 4MQVA 2RV8A 2E7WA 1Z91A 1JGSA 4QWQA 1QZZA 1FYKA 5FO5A 4L18B 3JTGA 4LG0B 4RGUA 2L54A 1LEAA 2K7LA 5D5XB 1IN4A 2UXXA 3E6CC 2CYYA 4KN4X 3ZMVA 1SAXA 2QM3A 5BOXA 3F21A 5L3CA 2V1XA 1H9GA 2CO5A 3BDDA 2JTVA 2NYXA 4HZFA 1HW2A 3F8BA 4A6EA 3E5XA 1G3YA 2X0LA 1MGTA 1FT9A 3V8JA 4FT8A 3ML6A 3L2CA 1V3FA 3JSOA 1JE8A 1QBJA 4OIRF 4YFXF 1WWXA 1IZ1A 4KN7X 3FZVA 3ELKA 2HYFA 4L5JA 5E8GA 5TJJA 3RDIA 2VBZA 3F6VA 1YYVA 4ZYGA 1HSTA 4L5IA 1RIOH 2E1NA 3ZMSA 5BPDA 2ISZA 3I4PA 3H3UA 3QP6A 2XUBA 1DUXC 1BN5A 4HQMA 1HBXG 4CZZA 2D2WA 2PMUA 2V9VA 4I98B 3GFLA 1XGMA 2P5VA 4RB0A 5EEGA 1SD5A 3H92A 2XASA 1XB4A 4XSZF 3RIRA 4LFUA 4LK1F 4MEXF 4Y15A 2FQ3A 3R60A 5LEKA 3M8FA 2COMA 5ERIA 4M74A 4KNYA 2W85A 3KZYA 3KP3A 1USSA 4HF2A 3D0SA 3HOSA 4G6DA 3IRRA 2CSOA 3U1DA 4YIIA 4HF0A 3LWFA 3WGHA 5L3DA 3VB2A 4L0ZB 2Z3YA 4G7OF 2PBIA 2K27A 3JW4A 3GEZA 3VOEA 5ILUA 5HS7A 1YS7A 4EM0B 3R61A 3GX4X 2FMYA 2DFIA 4BHPA 1ZGAA 4Y13A 3ZP5A 4AIJA 2RVCA 4L9VA 1IW7F 1ZG3A 2PG4A 4Z2YA 1FBSA 1FBUA 3DFGA 2ZBKA 1BI1A 1MJAA 2YR2A 5D8LB 3WE3A 3QPHA 1OYWA 3G3ZA 3TGNA 1D3YA 2K4JA 4ENKA 2L01A 4A5NA 1KYZA 3KCCA 4IJAA 2NAZA 1IF1A 4MTEA 2JT1A 4IRHA 4XLNF 4EMSA 3VFZA 2YSRA 2IRFG 1I1SA 1UHWA 2DBBA 1SFXA 4O5VA 2XKPA 2FNAA 1HQCA 4LGWA 3O3KA 2DPUA 2X4HA 5HLGA 3O6BB 4U0YA 4PGHA 3HYIA 2MC3A 4A0YA 1GHCA 1BIAA 1K6OA 2H94A 4XBFA 1K79A 4YG2F 1XDSA 2WWYA 4WXCA 4K2EA 2FNPA 3M9AA 1R36A 1HKSA 3FM5A 5TRDA 2FOKA 2IA1A 2ESHA 2IPQX 5HDNA 5IT9K 3JTHA 4G8XA 4CGZA 3DPLC 3PQKA 1IN5A 5BQTA 3E6DA 5F64A 4ENJA 2G7HA 1WKMA 2VODA 2EV6A 2DAOA 2IP2A 2Z99A 1BI2A 3TO9A 3ZN1A 5LRSA 1Z1DA 4LG0A 4EJUA 2MH9A 4OIQF 2F5CA 3I58A 4WF2A 4CO8A 3M7GA 4M6XA 3TOAA 2HDCA 3BP8A 2QUFA 3P9IA 3QPTA 2ZCWA 2FA5A 1KYWA 3HHHA 2ZJ2A 2GXGA 4A5MA 4PDKA 4WXDA 3RPQA 3WGGA 2XAJA 1STZA 4RB1A 1P4XA 3LSTA 3TKYA 5DYMA 1LB2A 3R0AA 4WX9A 1CF7B 1W7PA 3CDHA 5HLHA 1FP1D 3J80K 3KEQA 4AIHA 2PMHA 3J81Z 2Y0MA 2NNYA 1P6RA 4ASNA 4XLPF 2P6TA 3OOPA 4A2UA 1GXPA 4LD5A 2D45A 2UZKA 1LDKB 3HSEA 2HQNA 2OD5A 1DP7P 3TDZC 1V4RA 3RYPA 4HX8A 4HF1A 2A6EF 1FC3A 2NNNA 5HS9A 2HTJA 3KP4A 2OBPA 1W5TA 4HA8A 1AOYA 4P96A 2H6BA 3HUGA 2A5YB 2ZXJA 3JAMZ 1B9NA 3Q9SA 2M1BA 3GFIA 2ZNZA 1U78A 1XSVA 3FXRA 3MCZA 1SD6A 1KU2A 4LK0F 3ZMUA 1AWCA 2EK5A 4RGSA 1BI3A 5LHIA 1XMKA 1O3QA 5E18F 1HW5A 5HLIA 5L3FA 2G7UA 2MA3A 3V7CA 3T8TA 3ZPLA 3ECHA 2O3FA 3D5LA 5CVUA 1I1GA 3WU1B 3I5UA 3PFIA 1MJBA 1T39A 2EFOA 4EJTA 2BEOA 1KQ0A 3HIFA 2QWWA 3LA7A 1IAWA 3RTRA 4PGGA 5KK1A 4UNOA 3I53A 1TTYA 4NHJA 4IXAA 3BPXA 3DPTA 5E1XA 2GXBA 2JPCA 1FBQA 4HV5A 3M8EA 3N4MA 1Z6RA 1RZ4A 2F5EA 3O2PE 1ZREA 5DCMA 5H6QA 4HBLA 4OOIA 3E3VA 1KU7A 1QGPA 4H0EA 4YFNF 1XD7A 2HQRA 2VE8A 1MZBA 3ZMTA 1F4KA 1RUNA 3FXUA 2QLZA 4RS8A 3SZTA 5AIPA 2PJPA 2H6CA 2L3DA 2VN2A 2XAQA 1UCRA 3GVAA 4JK1X 4ZH4F 1YG2A 2EV0A 3CO6C 3V8KA 3C3WA 2KKOA 4CHUA 1JHFA 2HS5A 3GXOA 1T6SA 5D5WB 4L9TA 1W7PD 4O6JA 1R22A 1DPUA 3NQOA 4BQAA 5E1WA 1Z9CA 4YFKF 4TV7A 4EM1A 5ICGA 4ZYDA 1I6XA 1ZRFA 3KETA 4KFCA 3CLOA 4KICA 4UHTA 3ROUA 5J8CA 3ERED 4RAZA 2PN6A 4HV6A 1S6LA 2Y48A 1YO5C 2HEOA 3IKTA 3K1NA 1D8JA 2W25A 1A04A 5LLQA 3EUHA 3P9CA 1U2WA 4ZZLA 2CGPA 1TQPA 2GIVA 2LDUA 3F8FA 3CTAA 3WG9A 2FRHA 3OV8A 2MLKA 2DQRA 1F1ZA 3WTSC 3FXQA 1IN6A 1OYYA 2AXLA 4HYEA 5LHGA 5L3GA 2M45A 4ENNA 5ED4A 4DNCA 1LDDA 3LAJA 3JAMK 4IHSA 2A68F 4OMZA 5ILVA 3K1PA 2VBXA 1O57A 4CDGA 2HR3A 2L4MA 2DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH8 A;  3ULQ B;  2OZ6 A;  2AS5 F;  4EQQ A;  3I71 A;  1J9I A;  4O3M A;  2O6G E;  2O8X A;  2RDP A;  3K2Z A;  3P9K A;  3HHG A;  2VOP A;  4EGY A;  1TQM A;  1U5T B;  4U7D A;  1K7A A;  4U88 A;  2RQP A;  3DF8 A;  3RPU A;  3WTY C;  3WTU C;  4WWC A;  1R1T A;  2FU4 A;  1ZN2 A;  1BOA A;  2ESN A;  2FF4 A;  5K5O A;  2MLG A;  3BWG A;  4AWX B;  2P7C B;  2XGX A;  5HOO A;  1IXC A;  3EET A;  5DDG A;  2FBK A;  1Z05 A;  4RGR A;  2GQQ A;  2V1D A;  1FSH A;  2QQB A;  3V7R A;  1O3R A;  2TDX A;  3PQJ A;  1VTN C;  4ESF A;  3EYI A;  3I64 A;  3G73 A;  3HRT A;  4S04 A;  1B4A A;  1OMI A;  5ICE A;  1BIB A;  2ZO4 A;  1G3S A;  5E1Z B;  1DDN A;  2PI0 A;  1KU9 A;  4MNU A;  3B02 A;  4G9Y A;  5L3E A;  4LLG F;  4M71 A;  2EA4 A;  1TW2 A;  1JXS A;  2G9W A;  1XCV A;  5EEH A;  5CJ9 A;  1OYI A;  5DUI A;  1R5G A;  1R1V A;  4IRI A;  2GA2 A;  3FM3 A;  2KJB A;  3CUQ C;  4KT5 C;  5LGU A;  2CWE A;  4KIB A;  5K5Q A;  3L9F A;  1IXS B;  3F22 A;  3BPV A;  4EJO A;  5FD6 A;  4OMY A;  1O7L A;  3L09 A;  1ZRD A;  1J59 A;  1ZGJ A;  2VT2 A;  1QPM A;  2RGV A;  1YW8 A;  2RNJ A;  2HOE A;  2XAH A;  4P9F A;  1BJA A;  4KMU X;  3HTS B;  4UV8 A;  4HOB A;  2Y75 A;  4Q48 A;  4HX4 A;  3FMR A;  3LFK A;  3I54 A;  3MFK A;  4IHT A;  3V7S A;  3QRF F;  1UB9 A;  1G3W A;  3GF2 A;  3I0T A;  4DQ2 A;  4KIF A;  1XCB A;  2QVO A;  3QP5 A;  3EDP A;  1R5H A;  1W7P B;  4HDU A;  4U0V A;  4ESB A;  3FWE A;  1HW1 A;  3L7W A;  5A2Q K;  1FYM A;  3DXJ F;  4M9Z A;  4KA4 A;  2FSW A;  2PFB A;  6PAX A;  1PP8 F;  2MBF A;  2VT3 A;  4S05 A;  2KIF A;  5LRR A;  4ENM A;  4OIN F;  3HSF A;  1YIO A;  1U8R A;  2VXZ A;  4U7B A;  4AVP A;  1LQ1 A;  2VBW A;  1XSD A;  3LA2 A;  2VE9 A;  4GYG A;  1IN7 A;  2EFN A;  1FYL A;  2F2E A;  2Z9O A;  3RJP A;  2Q2E A;  1YLF A;  5L3B A;  2GAU A;  2EB7 A;  2EWN A;  4KIG A;  2DK5 A;  3Q5F A;  3WTX C;  2DI3 A;  2HTS A;  2P4W A;  1LJ9 A;  1GXQ A;  3TDU C;  2OQR A;  4E70 A;  1FPQ A;  4M6Y A;  3ABT A;  2P6S A;  3MAJ A;  4I0A A;  4ESJ A;  1ZRC A;  5JVT A;  3J80 Z;  2W57 A;  4HQE A;  3L00 A;  3T8R A;  1K78 A;  3QOP A;  2DO7 A;  3KZZ A;  1O3T A;  2LSO A;  2JZY A;  3BRO A;  4P55 A;  5J8F A;  5D6F A;  2BE5 F;  3EQL F;  1SMT A;  4D0P A;  1ZLJ A;  5H20 A;  4M73 A;  4G94 A;  3LA3 A;  3SXY A;  4PZJ A;  1B9M A;  2O03 A;  4RB3 C;  3HSR A;  5AIQ A;  2M8E A;  1I5Z A;  4L9N A;  2HKO A;  2XVC A;  2YU3 A;  2DT5 A;  3CUQ B;  2ADU A;  3F8C A;  5FLX K;  3KEO A;  5ICC A;  1LEB A;  3MZY A;  1YFH A;  3BJO A;  3P7N A;  4FX4 A;  3HTU A;  3GZ5 A;  1P4A A;  4F7Z A;  2LF7 A;  5HDK A;  1P4W A;  3GO5 A;  1R7J A;  2YPR A;  4I01 A;  3HRM A;  1ZG5 A;  1YQA A;  4UVC A;  2P7V B;  3TO6 A;  3DV8 A;  5CVR A;  2V79 A;  4HDV A;  3H3Z A;  1NHA A;  3DQV C;  3KE2 A;  2QEN A;  3FMQ A;  1ZH5 A;  2YX4 A;  4HW0 A;  4LLL A;  2K4B A;  2XRO A;  2R7F A;  1XGS A;  2EV5 A;  4GCV A;  1MDM A;  5DUK A;  3IL2 A;  1IRF A;  1S3J A;  2QBY B;  4BYY A;  4XRF A;  4M9S A;  4OIO F;  4LB5 A;  2Z33 A;  1B59 A;  2YX7 A;  3MZH A;  1G6N A;  1SFU A;  3WTW C;  1O3S A;  4BAY A;  1MDM B;  5JI6 A;  2L4A A;  2Q8K A;  1R1U A;  2JSC A;  2ACJ A;  1KU3 A;  4A0Z A;  1QQI A;  1TNT A;  1U5T C;  1MD0 A;  5CVJ A;  4Q47 A;  3CUQ A;  3F6O A;  1JHH A;  3JSP A;  5HVQ C;  3FMS A;  4G6Q A;  1IUY A;  3F8N A;  3NEU A;  4KDP A;  2J5P A;  1X3U A;  1E2X A;  3IC7 A;  5LBQ A;  2OA4 A;  1QZY A;  3I59 A;  3TO7 A;  1B6A A;  2WTE A;  3B73 A;  3IWZ A;  1U6G A;  1ZHF A;  4P5O A;  5LHH A;  3IRQ A;  1LDJ A;  4MEY F;  3MWM A;  1Q1H A;  2P5L C;  5CVI A;  4L0Y B;  2CW0 F;  2ELH A;  5FB2 A;  2V6C A;  1IXR C;  3ECO A;  1LVA A;  2BGC A;  3DKW A;  2FML A;  4A12 A;  2ZKZ A;  4G7Z F;  4UVA A;  1BBY A;  1FLI A;  3M1E A;  3IHU A;  4FHT A;  3V8L A;  1GVJ A;  1CF7 A;  3GUD A;  3IWF A;  3K1M A;  4I09 A;  1YW7 A;  1W4M A;  2ZNY A;  1R58 A;  3E6M A;  3QU6 A;  5DCM B;  2V1U A;  3HRU A;  2PLY A;  4ZYH A;  1J75 A;  2HYG D;  4MTD A;  1ULY A;  4I0B A;  1OR7 A;  2BBY A;  3QU3 A;  3K0L A;  3E5U A;  1Y0U A;  3CJN A;  3KLN A;  2GZW A;  1XGO A;  3COA C;  3WGI A;  4N9H A;  3ISP A;  2EFW A;  2FEZ A;  4CYD A;  3EYY A;  3GLX A;  5KVR A;  4EJW A;  3F23 A;  1J2X A;  2NS0 A;  2QYO A;  1KA8 A;  1FZP B;  4EGZ A;  2RN7 A;  3RI4 A;  4IF4 A;  3WU0 A;  1SMY F;  1YTY A;  2VBY A;  4CXF A;  5E20 A;  2XRN A;  5E8I A;  4G7H F;  3VEP A;  1QNT A;  2LNB A;  5FFZ A;  3KFW X;  4P9U A;  1YW9 A;  5LGT A;  1ON2 A;  2STW A;  2ETH A;  1T2K A;  4WCG A;  1PDN C;  4N0B A;  2PQ8 A;  3K9T A;  1C0W A;  1KQ9 A;  1R00 A;  1G4D A;  4ON0 A;  4OU0 A;  2E1C A;  4GXO A;  2A69 F;  4I2O A;  4ETS A;  5CVV A;  5DEQ A;  2VC1 A;  4EV0 A;  2EFQ A;  4Q5S F;  4BHC A;  1MKM A;  1TLH B;  2K86 A;  2BV6 A;  3C7J A;  2IT0 A;  2OU2 A;  5BS6 A;  4HLX A;  1KGS A;  1T0F A;  1Z6T A;  2O61 A;  2JPB A;  4ZZD A;  1TW3 A;  4RAY A;  5FGM A;  1ZAO A;  4EVI A;  4BXU A;  4EJV A;  3KP6 A;  5J6X A;  3S2W A;  4A6D A;  2HFH A;  1XN7 A;  2M5W A;  1OPC A;  1U5T A;  3REO A;  2VC0 A;  2D1V A;  1D8K A;  3ZQ7 A;  2DU9 A;  2IA2 A;  1XSX A;  4U0W A;  1W5S A;  3MQ0 A;  3RKY A;  3U9G A;  2BYV E;  2XKO A;  1XGN A;  3SFZ A;  3GZ6 A;  3CO7 C;  4BH9 A;  1BC8 C;  2DK8 A;  5LGN A;  2MD5 A;  4JQF A;  4UVB A;  1TQI A;  2UWM A;  4WXH A;  3ZN0 A;  4BHB A;  3KP2 A;  2FBH A;  4QLC U;  2IW5 A;  5HDG A;  3AAF A;  1UFM A;  4MGR A;  3QAH A;  1S7O A;  4R8H A;  4UUV A;  2NRA C;  2K02 A;  5JR3 A;  4UV9 A;  1SD4 A;  1FWZ A;  2QZ8 A;  3RYR A;  3KLO A;  2E7X A;  1TBX A;  5K5R A;  2ZME B;  3C18 A;  2Z5U A;  4HX7 A;  4B09 A;  1Z7U A;  2HWV A;  1PUE E;  1MJ9 A;  1ZLK A;  1FY7 A;  4CIC A;  3GFM A;  3LQR A;  1HXD A;  4MQ9 F;  2A61 A;  4IPA A;  2RKH A;  2WC2 A;  3SQN A;  2GA1 A;  4PCQ A;  2IA0 A;  3FX3 A;  4UXN A;  2M30 A;  3T5X A;  2P8T A;  3DEU A;  1BC7 C;  3KP5 A;  4RGX A;  2FXA A;  2M87 A;  3HRS A;  1S29 A;  2LF8 A;  2J5O A;  5FFX A;  1OKR A;  1J0R A;  5FLX Z;  3LQQ A;  4GYI A;  2QQA A;  4FX0 A;  2W24 A;  3SHF A;  1ZAR A;  1I27 A;  3I59 B;  1H9T A;  1P92 A;  2B0L A;  1FSE A;  5D6E A;  1HSJ A;  1HKT A;  4LB6 B;  2OQG A;  3E97 A;  3F8M A;  2QBY A;  2A6H F;  4KYW A;  3VOD A;  1S8N A;  2R3S A;  2PEX A;  2P5K A;  1F9N A;  1BI0 A;  1UST A;  5BMZ A;  3BZ6 A;  4WK8 F;  3V4G A;  5ILS A;  3BJA A;  4L9J A;  3ZMD A;  1XMA A;  3DP7 A;  3R4K A;  5DD8 A;  1DPR A;  3K69 A;  2O0Y A;  1FNN A;  2OAZ A;  1WI9 A;  2QQ9 A;  2GWR A;  4IVN A;  4HLY A;  3E5Q A;  5E17 F;  1E17 A;  2R7D A;  4I7H A;  3MEX A;  3N97 A;  3RKX A;  2FE3 A;  4B8X A;  4KMF A;  4A0X A;  5LEJ A;  2W84 A;  2HZT A;  1FOK A;  3W6K B;  4XSX F;  3F3X A;  3GYH X;  2XAG A;  3R0J A;  2KIU A;  2VON A;  5CYV A;  4GGG A;  5K1Y A;  1ONV A;  3LAP A;  2DQL A;  3BOQ A;  3J7A O;  4OIP F;  2L02 A;  1J7K A;  4NB5 A;  2FBI A;  2HGC A;  1L0O C;  5IT3 A;  3BY6 A;  2HKX A;  2Q0O A;  1F5T A;  4LMY A;  3KP7 A;  2CG4 A;  3W6J B;  4ZYE A;  3FF5 A;  2F5F A;  1HKQ A;  1J5Y A;  2DW4 A;  1RUO A;  1D5V A;  1CGP A;  5D5U B;  1ZYR F;  3ABU A;  3WTZ A;  2VOO A;  4Y17 A;  3TOB A;  2H27 A;  2KJC A;  1TNS A;  4R1H A;  3IKV A;  3T0Y A;  1REP C;  1L3L A;  3RKW A;  1PP7 U;  1K78 B;  3GWZ A;  1ZG1 A;  5D5V B;  2A07 F;  2IJL A;  3F72 A;  2KIM A;  1SD7 A;  3R6S A;  4YIF A;  1R23 A;  4NQW A;  2EA2 A;  1YS6 A;  5F1R A;  5BPI A;  3T1B A;  1U3E M;  2A3S A;  4KUM A;  5IT9 Z;  2RC4 A;  1O7F A;  5A2Q Z;  4IRG A;  3U2R A;  4MHG A;  5DCF A;  2KRF A;  5D8K B;  4BNC A;  2UXN A;  5FD5 A;  2ISY A;  4AIK A;  2DTR A;  3CUO A;  1EV7 A;  1UHM A;  2ZFW A;  3SZP A;  2OZU A;  2CQK A;  3Q9V A;  1RNL A;  2CFX A;  2MH2 A;  4RB2 C;  3WTV C;  1EH7 A;  1T38 A;  4AD9 A;  4N9I A;  4I02 A;  1ON1 A;  2XHK A;  1G3T A;  1QO0 D;  4R79 A;  3GFJ A;  4HAM A;  4EM2 A;  1BM9 A;  1IRG A;  5F6F A;  3WE2 A;  1KQ8 A;  2C6Y A;  3BJ6 A;  5ICF A;  2LKP A;  2H09 A;  1FP2 A;  2EFP A;  3C1D A;  1B1B A;  2EJR A;  4JBA A;  2WV0 A;  3WOD F;  2XV4 S;  3J81 K;  3TQN A;  4M9X A;  4LJZ F;  5CLS A;  1EH6 A;  1S7A A;  1RI7 A;  5JHU A;  3HOT A;  5D4S A;  4LLN A;  2ZME A;  3GW2 A;  2XAF A;  1XDU A;  5DD4 A;  2IVM A;  5HS8 A;  3FHZ A;  1FX7 A;  5H6R A;  1ODD A;  1WSU A;  2DPD A;  4GO1 A;  5D4R A;  2F5D A;  4Q4Z F;  1WRJ A;  2STT A;  5DV5 A;  2XIG A;  1LNW A;  5JFR A;  3ZMZ A;  2JRT A;  3E6B A;  3NRV A;  1IN8 A;  3WTT C;  1H0M A;  5AON A;  1P2F A;  2D1H A;  1SFE A;  1T98 A;  4M72 A;  1WQ2 A;  4MQV A;  2RV8 A;  2E7W A;  1Z91 A;  1JGS A;  4QWQ A;  1QZZ A;  1FYK A;  5FO5 A;  4L18 B;  3JTG A;  4LG0 B;  4RGU A;  2L54 A;  1LEA A;  2K7L A;  5D5X B;  1IN4 A;  2UXX A;  3E6C C;  2CYY A;  4KN4 X;  3ZMV A;  1SAX A;  2QM3 A;  5BOX A;  3F21 A;  5L3C A;  2V1X A;  1H9G A;  2CO5 A;  3BDD A;  2JTV A;  2NYX A;  4HZF A;  1HW2 A;  3F8B A;  4A6E A;  3E5X A;  1G3Y A;  2X0L A;  1MGT A;  1FT9 A;  3V8J A;  4FT8 A;  3ML6 A;  3L2C A;  1V3F A;  3JSO A;  1JE8 A;  1QBJ A;  4OIR F;  4YFX F;  1WWX A;  1IZ1 A;  4KN7 X;  3FZV A;  3ELK A;  2HYF A;  4L5J A;  5E8G A;  5TJJ A;  3RDI A;  2VBZ A;  3F6V A;  1YYV A;  4ZYG A;  1HST A;  4L5I A;  1RIO H;  2E1N A;  3ZMS A;  5BPD A;  2ISZ A;  3I4P A;  3H3U A;  3QP6 A;  2XUB A;  1DUX C;  1BN5 A;  4HQM A;  1HBX G;  4CZZ A;  2D2W A;  2PMU A;  2V9V A;  4I98 B;  3GFL A;  1XGM A;  2P5V A;  4RB0 A;  5EEG A;  1SD5 A;  3H92 A;  2XAS A;  1XB4 A;  4XSZ F;  3RIR A;  4LFU A;  4LK1 F;  4MEX F;  4Y15 A;  2FQ3 A;  3R60 A;  5LEK A;  3M8F A;  2COM A;  5ERI A;  4M74 A;  4KNY A;  2W85 A;  3KZY A;  3KP3 A;  1USS A;  4HF2 A;  3D0S A;  3HOS A;  4G6D A;  3IRR A;  2CSO A;  3U1D A;  4YII A;  4HF0 A;  3LWF A;  3WGH A;  5L3D A;  3VB2 A;  4L0Z B;  2Z3Y A;  4G7O F;  2PBI A;  2K27 A;  3JW4 A;  3GEZ A;  3VOE A;  5ILU A;  5HS7 A;  1YS7 A;  4EM0 B;  3R61 A;  3GX4 X;  2FMY A;  2DFI A;  4BHP A;  1ZGA A;  4Y13 A;  3ZP5 A;  4AIJ A;  2RVC A;  4L9V A;  1IW7 F;  1ZG3 A;  2PG4 A;  4Z2Y A;  1FBS A;  1FBU A;  3DFG A;  2ZBK A;  1BI1 A;  1MJA A;  2YR2 A;  5D8L B;  3WE3 A;  3QPH A;  1OYW A;  3G3Z A;  3TGN A;  1D3Y A;  2K4J A;  4ENK A;  2L01 A;  4A5N A;  1KYZ A;  3KCC A;  4IJA A;  2NAZ A;  1IF1 A;  4MTE A;  2JT1 A;  4IRH A;  4XLN F;  4EMS A;  3VFZ A;  2YSR A;  2IRF G;  1I1S A;  1UHW A;  2DBB A;  1SFX A;  4O5V A;  2XKP A;  2FNA A;  1HQC A;  4LGW A;  3O3K A;  2DPU A;  2X4H A;  5HLG A;  3O6B B;  4U0Y A;  4PGH A;  3HYI A;  2MC3 A;  4A0Y A;  1GHC A;  1BIA A;  1K6O A;  2H94 A;  4XBF A;  1K79 A;  4YG2 F;  1XDS A;  2WWY A;  4WXC A;  4K2E A;  2FNP A;  3M9A A;  1R36 A;  1HKS A;  3FM5 A;  5TRD A;  2FOK A;  2IA1 A;  2ESH A;  2IPQ X;  5HDN A;  5IT9 K;  3JTH A;  4G8X A;  4CGZ A;  3DPL C;  3PQK A;  1IN5 A;  5BQT A;  3E6D A;  5F64 A;  4ENJ A;  2G7H A;  1WKM A;  2VOD A;  2EV6 A;  2DAO A;  2IP2 A;  2Z99 A;  1BI2 A;  3TO9 A;  3ZN1 A;  5LRS A;  1Z1D A;  4LG0 A;  4EJU A;  2MH9 A;  4OIQ F;  2F5C A;  3I58 A;  4WF2 A;  4CO8 A;  3M7G A;  4M6X A;  3TOA A;  2HDC A;  3BP8 A;  2QUF A;  3P9I A;  3QPT A;  2ZCW A;  2FA5 A;  1KYW A;  3HHH A;  2ZJ2 A;  2GXG A;  4A5M A;  4PDK A;  4WXD A;  3RPQ A;  3WGG A;  2XAJ A;  1STZ A;  4RB1 A;  1P4X A;  3LST A;  3TKY A;  5DYM A;  1LB2 A;  3R0A A;  4WX9 A;  1CF7 B;  1W7P A;  3CDH A;  5HLH A;  1FP1 D;  3J80 K;  3KEQ A;  4AIH A;  2PMH A;  3J81 Z;  2Y0M A;  2NNY A;  1P6R A;  4ASN A;  4XLP F;  2P6T A;  3OOP A;  4A2U A;  1GXP A;  4LD5 A;  2D45 A;  2UZK A;  1LDK B;  3HSE A;  2HQN A;  2OD5 A;  1DP7 P;  3TDZ C;  1V4R A;  3RYP A;  4HX8 A;  4HF1 A;  2A6E F;  1FC3 A;  2NNN A;  5HS9 A;  2HTJ A;  3KP4 A;  2OBP A;  1W5T A;  4HA8 A;  1AOY A;  4P96 A;  2H6B A;  3HUG A;  2A5Y B;  2ZXJ A;  3JAM Z;  1B9N A;  3Q9S A;  2M1B A;  3GFI A;  2ZNZ A;  1U78 A;  1XSV A;  3FXR A;  3MCZ A;  1SD6 A;  1KU2 A;  4LK0 F;  3ZMU A;  1AWC A;  2EK5 A;  4RGS A;  1BI3 A;  5LHI A;  1XMK A;  1O3Q A;  5E18 F;  1HW5 A;  5HLI A;  5L3F A;  2G7U A;  2MA3 A;  3V7C A;  3T8T A;  3ZPL A;  3ECH A;  2O3F A;  3D5L A;  5CVU A;  1I1G A;  3WU1 B;  3I5U A;  3PFI A;  1MJB A;  1T39 A;  2EFO A;  4EJT A;  2BEO A;  1KQ0 A;  3HIF A;  2QWW A;  3LA7 A;  1IAW A;  3RTR A;  4PGG A;  5KK1 A;  4UNO A;  3I53 A;  1TTY A;  4NHJ A;  4IXA A;  3BPX A;  3DPT A;  5E1X A;  2GXB A;  2JPC A;  1FBQ A;  4HV5 A;  3M8E A;  3N4M A;  1Z6R A;  1RZ4 A;  2F5E A;  3O2P E;  1ZRE A;  5DCM A;  5H6Q A;  4HBL A;  4OOI A;  3E3V A;  1KU7 A;  1QGP A;  4H0E A;  4YFN F;  1XD7 A;  2HQR A;  2VE8 A;  1MZB A;  3ZMT A;  1F4K A;  1RUN A;  3FXU A;  2QLZ A;  4RS8 A;  3SZT A;  5AIP A;  2PJP A;  2H6C A;  2L3D A;  2VN2 A;  2XAQ A;  1UCR A;  3GVA A;  4JK1 X;  4ZH4 F;  1YG2 A;  2EV0 A;  3CO6 C;  3V8K A;  3C3W A;  2KKO A;  4CHU A;  1JHF A;  2HS5 A;  3GXO A;  1T6S A;  5D5W B;  4L9T A;  1W7P D;  4O6J A;  1R22 A;  1DPU A;  3NQO A;  4BQA A;  5E1W A;  1Z9C A;  4YFK F;  4TV7 A;  4EM1 A;  5ICG A;  4ZYD A;  1I6X A;  1ZRF A;  3KET A;  4KFC A;  3CLO A;  4KIC A;  4UHT A;  3ROU A;  5J8C A;  3ERE D;  4RAZ A;  2PN6 A;  4HV6 A;  1S6L A;  2Y48 A;  1YO5 C;  2HEO A;  3IKT A;  3K1N A;  1D8J A;  2W25 A;  1A04 A;  5LLQ A;  3EUH A;  3P9C A;  1U2W A;  4ZZL A;  2CGP A;  1TQP A;  2GIV A;  2LDU A;  3F8F A;  3CTA A;  3WG9 A;  2FRH A;  3OV8 A;  2MLK A;  2DQR A;  1F1Z A;  3WTS C;  3FXQ A;  1IN6 A;  1OYY A;  2AXL A;  4HYE A;  5LHG A;  5L3G A;  2M45 A;  4ENN A;  5ED4 A;  4DNC A;  1LDD A;  3LAJ A;  3JAM K;  4IHS A;  2A68 F;  4OMZ A;  5ILV A;  3K1P A;  2VBX A;  1O57 A;  4CDG A;  2HR3 A;  2L4M A;  2DLL A; 
#chains in the Genus database with same CATH topology
 1EH8 A;  1GLN A;  2AO9 A;  3ULQ B;  2OZ6 A;  2AS5 F;  4EQQ A;  3I71 A;  1J9I A;  2LRE A;  4O3M A;  2O6G E;  2O8X A;  2RDP A;  2RQQ A;  3K2Z A;  3P9K A;  1D5Y A;  3HHG A;  2VOP A;  4EGY A;  3LSP A;  4HNU A;  3MKY B;  1TQM A;  2LKS A;  3TL4 X;  1U5T B;  4U7D A;  1K7A A;  1X1A A;  4U88 A;  2RQP A;  3DF8 A;  3K4B A;  1POG A;  4AID A;  2IS2 A;  3RPU A;  4Y33 A;  4BY7 J;  3UNG C;  3WTY C;  3WTU C;  3OSF A;  2XGE A;  4WWC A;  2GXA A;  1SEU A;  1R1T A;  3ZQH A;  2FU4 A;  2JJ7 A;  1ZN2 A;  1BOA A;  2ESN A;  2FF4 A;  4DZJ A;  5K5O A;  2R7Z J;  4ZTJ A;  2MLG A;  3BWG A;  4AWX B;  4II2 A;  2OCC H;  3PFY A;  2P7C B;  2OUM A;  2XGX A;  2WAF A;  2Q1Z B;  5HOO A;  2DXI A;  4N4O B;  1IXC A;  3EET A;  5DDG A;  2L9V A;  2HPI A;  2FBK A;  1Z05 A;  5IOY A;  2BY1 A;  4RGR A;  2GQQ A;  3A0B C;  1X2M A;  2V1D A;  1FSH A;  2JA7 J;  3BG9 A;  4CUG A;  2QQB A;  1VQL I;  2M3A A;  3V7R A;  1R4M B;  1O3R A;  2TDX A;  2TRT A;  3PQJ A;  1YE9 A;  4IHV A;  4RLF A;  2ECC A;  2VLA A;  2BHZ A;  2JSP A;  5FKK A;  1VTN C;  4ESF A;  2BVM A;  3EYI A;  2XSD C;  3I64 A;  3G73 A;  3HRT A;  2VKV A;  4S04 A;  1B4A A;  1F43 A;  1OMI A;  5ICE A;  1BIB A;  4XRM A;  4V19 K;  3CF5 F;  2ZO4 A;  4DYR A;  1G3S A;  2L9N A;  5E1Z B;  1DDN A;  1V5E A;  1KON A;  2KRH A;  1KU9 A;  2ZSH B;  3N05 A;  3LMM A;  3JRG A;  4IO9 F;  1JJ6 C;  4MNU A;  4PSX A;  1X58 A;  1HOM A;  3PSF A;  3B02 A;  4G9Y A;  3BZK A;  5L3E A;  2LR8 A;  4LLG F;  4M71 A;  3FXJ A;  3MZ8 A;  3K4N A;  2EA4 A;  1WZ2 A;  2JA8 J;  1TW2 A;  1JXS A;  2G9W A;  3OIP A;  2HOS A;  1XCV A;  5EEH A;  3I9V 2;  5CJ9 A;  1OYI A;  4F52 A;  1WJE A;  5DUI A;  1R5G A;  2IGO A;  1ETX A;  2EIL H;  4Z6Y A;  1R1V A;  3JRD A;  4IRI A;  2GA2 A;  4JX4 A;  3FM3 A;  2KJB A;  3CUQ C;  4KT5 C;  5LGU A;  4ABZ A;  2CWE A;  1LFU P;  4KIB A;  3CC7 I;  5K5Q A;  3MD2 A;  3L9F A;  1IXS B;  3LFU A;  3CP8 A;  3F22 A;  3BPV A;  4EJO A;  1LE8 A;  5DM6 F;  2HNH A;  5FD6 A;  4OMY A;  2G0E A;  1OR7 C;  3BTI A;  1O7L A;  3L09 A;  2CQN A;  2VQG A;  2GLO A;  1ZRD A;  1J59 A;  1MBJ A;  4Y3O A;  4M6V A;  1XS9 A;  2LG4 A;  4OWR B;  1ZGJ A;  3HM5 A;  2VT2 A;  1QPM A;  2RGV A;  3EUH C;  3UKG A;  4NNJ A;  1YW8 A;  2RNJ A;  2HOE A;  2XAH A;  4P9F A;  1BJA A;  4KMU X;  5E3N A;  2XPU A;  3HTS B;  4CYC B;  4UV8 A;  4HOB A;  3OYD A;  5E3L A;  3GTJ J;  3HKZ A;  2Y75 A;  4Q48 A;  5EG0 B;  2DA6 A;  4HX4 A;  5KHD A;  2M4K A;  3FMR A;  3HOV J;  3LFK A;  3I54 A;  3MFK A;  5M5W J;  4IHT A;  3V7S A;  3QRF F;  1UB9 A;  1VZ0 A;  3J7Y J;  1W36 D;  2ME6 A;  3OYG A;  5JVG F;  2IAI A;  3FIS A;  1G3W A;  3GF2 A;  4LIV A;  3I0T A;  1D1A A;  4C2M J;  4DQ2 A;  4KIF A;  1XCB A;  2QVO A;  4HEA 2;  2VXD A;  4CZC A;  3CCJ I;  3QP5 A;  2F6C A;  3EDP A;  1R5H A;  3G6E I;  2IEK A;  2JN6 A;  1W7P B;  3AKZ A;  4HDU A;  2NVQ J;  4HPQ A;  1YJ9 I;  4U0V A;  2HDD A;  5E3O A;  4ESB A;  3FWE A;  1HW1 A;  3L7W A;  1YJN I;  4BE1 A;  1R6R A;  5A2Q K;  2N8G A;  1FYM A;  3DXJ F;  3ABK H;  4M9Z A;  5KCM A;  4XKC A;  1PJR A;  4QPO A;  3HUG B;  1X1D A;  3IH2 A;  4KA4 A;  2FSW A;  2PFB A;  3OIO A;  1R49 A;  6PAX A;  5H2F C;  3BTC A;  1YJW I;  1PP8 F;  2MBF A;  2VT3 A;  4E7J A;  4S05 A;  2KIF A;  4FQG A;  5LRR A;  4XLH A;  3OYM A;  3BT9 A;  3H0G J;  3CCU I;  4ENM A;  4OIN F;  3HSF A;  1QRY A;  1YIO A;  4ZTF A;  1U8R A;  2WAQ A;  2VXZ A;  4BY1 J;  4U7B A;  1KZH A;  4AVP A;  4NDL A;  1LQ1 A;  4UB8 C;  2VBW A;  1XSD A;  1FMV A;  3LA2 A;  4JX6 A;  4XMY A;  2VE9 A;  1W0U A;  4GYG A;  1LPQ A;  2R7R A;  2CUE A;  1IN7 A;  4BE0 A;  1QVU A;  3CJQ B;  2EFN A;  4DYQ A;  2VJI A;  1FYL A;  4XLF A;  2F2E A;  3CCV I;  3VYU B;  1Y1W J;  2MGQ A;  2Z9O A;  3RJP A;  3UR3 C;  1U8B A;  2F5V A;  1YLF A;  2Q2E A;  5L3B A;  2GAU A;  2EB7 A;  4NC7 A;  1Z77 A;  4QIW N;  2EWN A;  4KIG A;  2OPT A;  1R4N B;  2DK5 A;  3Q5F A;  3WTX C;  2DI3 A;  2HTS A;  2P4W A;  2EZH A;  2KPM A;  1LJ9 A;  1GXQ A;  1JUM A;  3TDU C;  4GFB A;  2PJR A;  3X2Q H;  1MSF C;  2OQR A;  5GAD J;  4E70 A;  1FPQ A;  1JT6 A;  3H5R A;  4M6Y A;  5FKM A;  3TW6 A;  3ABT A;  4QSH A;  2P6S A;  3MAJ A;  4I0A A;  4ESJ A;  1ZRC A;  3LSR A;  1TWF J;  5JVT A;  3ZCO A;  2BHY A;  3LNQ A;  1ETW A;  3J80 Z;  1QHH D;  2W57 A;  3CDI A;  3L00 A;  3T8R A;  1DQU A;  2VKH A;  4HQE A;  1UHS A;  3QOP A;  1K78 A;  2BXY A;  2DO7 A;  1VFC A;  1WVR A;  3KZZ A;  3CCQ I;  2M8G X;  3Q0W A;  1O3T A;  4FCY A;  2LSO A;  2JZY A;  4CYC A;  2KZG A;  3G2B A;  3BRO A;  4P55 A;  5J8F A;  5D6F A;  3OYB A;  2BE5 F;  3EQL F;  1SMT A;  4D0P A;  1ZLJ A;  5H20 A;  4M73 A;  4G94 A;  2ZXW H;  3LA3 A;  4UUT A;  3SXY A;  1APL C;  1VQ7 I;  4PZJ A;  1HF0 A;  1B9M A;  4QTR A;  3NWS A;  1T0F C;  1JUP A;  1MNE A;  2O03 A;  4RB3 C;  3HSR A;  5AIQ A;  2M8E A;  1I5Z A;  4XN3 A;  1Z7L A;  4L9N A;  3PNV A;  2HKO A;  2XVC A;  3CES A;  2YU3 A;  2DT5 A;  3CUQ B;  1YX3 A;  2ADU A;  1WJD A;  2AHQ A;  3HOZ J;  3F8C A;  3W3C A;  5FLX K;  3KEO A;  2DMP A;  5ICC A;  1FIP A;  1LEB A;  2XAU A;  3I3L A;  3MZY A;  1YFH A;  1VF9 A;  3BJO A;  3P7N A;  4FX4 A;  1T8I A;  3HTU A;  4P1W A;  3FHN A;  3GZ5 A;  1P4A A;  4F7Z A;  1I39 A;  3A0H C;  1OCC H;  3BG6 A;  4UY8 I;  3CD6 I;  3H36 A;  4S0H B;  2LF7 A;  4YEJ A;  5HDK A;  2E71 A;  2EIK H;  1P4W A;  1JKP C;  4XRS G;  3U1K A;  3GO5 A;  1R7J A;  2YPR A;  4I01 A;  3TMO A;  4FET A;  3HRM A;  1ZG5 A;  1YQA A;  2WB1 A;  3FKJ A;  4UVC A;  2P7V B;  4A3G J;  3TO6 A;  3DV8 A;  3PJR A;  3KZI C;  2GBY A;  5CVR A;  2V79 A;  2DT7 B;  2CW8 A;  2I5U A;  4HDV A;  3H3Z A;  4B43 A;  3OS1 A;  1NHA A;  3DQV C;  3KE2 A;  2QEN A;  2ELJ A;  2KIQ A;  3FMQ A;  1OCZ H;  1ZH5 A;  2YX4 A;  4HW0 A;  4D7M A;  4LLL A;  2K4B A;  3CDL A;  2XRO A;  1WJA A;  2R7F A;  2KDZ A;  3CJT B;  3DWL E;  1XGS A;  2EV5 A;  4X1E A;  4GCV A;  3BG7 A;  1MDM A;  3FK7 A;  5DUK A;  3HZJ A;  3IL2 A;  1ZGW A;  2EIN H;  1IRF A;  2WV1 A;  1S3J A;  4I6Z A;  2QBY B;  2BW3 B;  4BYY A;  4XRF A;  2O9L A;  4M9S A;  4C2U A;  4OIO F;  4LB5 A;  1FOX A;  2Z33 A;  2FOW A;  2JVG A;  3CJR B;  1B59 A;  2M7A A;  2YX7 A;  4L5E A;  3MZH A;  2M34 A;  1G6N A;  1SFU A;  3WTW C;  2LKX A;  1O3S A;  4A3J J;  4BAY A;  1MDM B;  5JI6 A;  2K9Q A;  2ECB A;  2L4A A;  2Q8K A;  1R1U A;  1A5J A;  3F9K A;  2JSC A;  2LYC A;  2K9N A;  2ACJ A;  2XF6 A;  1KU3 A;  4A0Z A;  1QQI A;  1TNT A;  2DFE A;  1U5T C;  1MIJ A;  3HPH A;  1MD0 A;  3CMM A;  3QQA A;  5CVJ A;  3VPR A;  4E7S A;  4Q47 A;  3CUQ A;  3BG5 A;  3U21 A;  1BOB A;  3F6O A;  3A1Y A;  1ETK A;  4CCK A;  1JHH A;  3JSP A;  2HOT A;  5HVQ C;  2Z1D A;  3FMS A;  4G6Q A;  4GRI A;  3I56 I;  1IUY A;  3OYA A;  2X1C A;  3F8N A;  3NEU A;  4KDP A;  2J5P A;  1X3U A;  1E2X A;  1X3Z B;  3H0D A;  3IC7 A;  1BR2 A;  5LBQ A;  2DN0 A;  4BJT A;  2OA4 A;  1QZY A;  2DJN A;  3CZ6 A;  3I59 A;  3TO7 A;  3S2D J;  1B6A A;  2R7O A;  2WTE A;  3B73 A;  3IWZ A;  3PL8 A;  2X6Y A;  1U6G A;  1ZHF A;  4P5O A;  2E2J J;  2B9S A;  2RAE A;  2CW7 A;  3ONQ A;  3AG2 H;  5LHH A;  3IRQ A;  1K4S A;  1LDJ A;  4Y7N J;  4MEY F;  3MWM A;  1Q1H A;  2ID6 A;  2P5L C;  5CVI A;  2R7W A;  4L0Y B;  1ITY A;  2CW0 F;  2ELH A;  5FB2 A;  1RRJ A;  3WHC A;  2BVL A;  1IXR C;  1RR7 A;  1UJ8 A;  2HOA A;  2V6C A;  3ECO A;  3PIO F;  3HL2 A;  1LVA A;  2BGC A;  1IGN A;  1V55 H;  3ZQI A;  3BC8 A;  3DKW A;  4A3C J;  2HU9 A;  2FML A;  2DOD A;  5HNF A;  4A12 A;  2ZKZ A;  4G7Z F;  4UVA A;  1BBY A;  1FLI A;  2V7F A;  1TT5 B;  3M1E A;  2I10 A;  3IHU A;  2WAQ N;  2PJR B;  4FHT A;  3V8L A;  1GVJ A;  2R5Z B;  1CF7 A;  3S17 J;  3PNT A;  2DMT A;  2FQ4 A;  2GOX B;  5J1U A;  3ESW B;  3GUD A;  3IWF A;  3K1M A;  4I09 A;  1YW7 A;  4PSW A;  1RES A;  1W4M A;  2QF7 A;  4D5F A;  4UUS B;  4BE2 A;  4CSW A;  4II3 A;  2ZNY A;  1UMQ A;  3KX2 A;  1R58 A;  3E6M A;  3QU6 A;  1S5L C;  5DCM B;  5IYD J;  2PLY A;  3HRU A;  2V1U A;  4ZYH A;  1Z67 A;  2BY2 A;  1J75 A;  4E4H A;  2HYG D;  4MTD A;  4M3B A;  4XRS A;  2ZJR F;  5FRO A;  1ULY A;  1IG7 A;  4I0B A;  5EF6 A;  2NVY J;  1OR7 A;  2BBY A;  1E3O C;  2Y0S A;  3QU3 A;  5HOD A;  2QSH X;  2E1O A;  3K0L A;  5J1R A;  2VKD A;  2ZFU A;  3E5U A;  4IHW A;  1Y0U A;  2LY9 A;  3CJN A;  3KLN A;  2GZW A;  1XGO A;  1ZR2 A;  1P9Q C;  3COA C;  3WGI A;  1U9N A;  4N9H A;  3ISP A;  3TED A;  3S3M A;  2EFW A;  3DLL F;  2FEZ A;  3BR1 A;  4CYD A;  2FD5 A;  5EZG A;  5M3M J;  3EYY A;  3BQZ A;  3GLX A;  3ZQQ A;  3ZXS A;  5KVR A;  5M5Y J;  2KRC A;  4B47 A;  2CMP A;  4EJW A;  2X6X A;  3F23 A;  1J2X A;  2NS0 A;  3ASN H;  1IO2 A;  1OJL A;  2QYO A;  3ZQL A;  1KA8 A;  1FIA A;  1FZP B;  3W6V A;  4EGZ A;  2RN7 A;  3RI4 A;  1K6Y A;  1RR8 C;  4E7H A;  4IF4 A;  2HI3 A;  3WU0 A;  1SMY F;  1YTY A;  2VBY A;  1FOY A;  4CXF A;  5E20 A;  2QSG X;  2XRN A;  2YS9 A;  5E8I A;  4G7H F;  1T95 A;  3VEP A;  1QNT A;  2LNB A;  5FFZ A;  5F08 A;  3KFW X;  4P9U A;  1UAA A;  2EIM H;  1RC9 A;  1T33 A;  1YW9 A;  2JVH A;  5LGT A;  3MKZ A;  1OCP A;  2NXN B;  1ON2 A;  2A5W A;  2STW A;  3K6G A;  2ETH A;  3CME I;  1T2K A;  2LRD A;  4WCG A;  1PDN C;  2HDW A;  4N0B A;  5EGO A;  2PQ8 A;  3C2G A;  2QGU A;  3K9T A;  1C0W A;  2QKL B;  1MSE C;  2LBF B;  1KQ9 A;  1R00 A;  1RET A;  1TZL A;  4XKV A;  1G4D A;  1FOW A;  4ON0 A;  4OU0 A;  2QCO A;  2E1C A;  3DU6 A;  2VPR A;  2IS4 A;  4GXO A;  4A69 C;  1ZTR A;  5DTD A;  2E2I J;  2A69 F;  4I2O A;  4ETS A;  5CVV A;  5DEQ A;  1D0Z A;  2Q2E B;  3PSI A;  2VC1 A;  4EV0 A;  2M0M A;  2DFF A;  2EFQ A;  2VUM J;  4Q5S F;  4BHC A;  1MKM A;  1TLH B;  1MBF A;  2K86 A;  2BV6 A;  3S32 A;  3C7J A;  2R92 J;  1Y39 A;  4BAC A;  2IT0 A;  4A3M J;  2OU2 A;  3HJE A;  5TIS C;  1V54 H;  2L9R A;  5BS6 A;  1RKT A;  1LE8 B;  4HLX A;  1KGS A;  1T0F A;  1Z6T A;  2R4G A;  4DZP A;  2O61 A;  2JPB A;  4ZZD A;  1TW3 A;  2DA1 A;  2BXZ A;  2MAB A;  4PUS A;  3S14 J;  3I4N J;  4Y52 J;  5EDN A;  1QHG A;  4RAY A;  5FGM A;  1ZAO A;  4IOC F;  3DU5 A;  4G12 A;  4EVI A;  1ZK8 A;  1VQM I;  4BXU A;  4EJV A;  3KP6 A;  1SVL A;  3VWB A;  3CCR I;  3ABM H;  3QOE A;  3S2W A;  5J6X A;  4A6D A;  2HFH A;  4B48 A;  4RA2 A;  2P0W A;  4ZDP A;  1XN7 A;  2M5W A;  1OPC A;  2R93 J;  1U5T A;  4BS9 A;  3REO A;  2VC0 A;  4BGD A;  2D1V A;  1D8K A;  3ZQ7 A;  2DU9 A;  2IA2 A;  1XSX A;  2M0C A;  4U0W A;  4BJ6 C;  3MKL A;  3FXK A;  1W5S A;  3MQ0 A;  3RKY A;  3U9G A;  3BR3 A;  2BYV E;  1CQT A;  2XKO A;  1XGN A;  3SFZ A;  4XLE A;  4DIQ A;  2O5R A;  3GZ6 A;  1WPK A;  3CO7 C;  2H1L A;  2EIJ H;  4XK4 A;  1YRN A;  4BH9 A;  1U9O A;  4RAG A;  3GLL A;  3QWL A;  1BC8 C;  2DK8 A;  5CPR B;  2R7Q A;  2MD5 A;  1TWA J;  4JQF A;  5LGN A;  3OSG A;  3FK6 A;  4BEH B;  3NAU A;  4UVB A;  1TQI A;  3KIO A;  2LVS A;  1W5C C;  2UWM A;  3NWT A;  4WXH A;  3K4J A;  3ZN0 A;  4BHB A;  1VQ4 I;  3H9G A;  5J40 A;  3KP2 A;  2FBH A;  1UG0 A;  5KAF C;  4QLC U;  2LY2 A;  3V42 A;  2IW5 A;  2WY8 Q;  5HDG A;  3AAF A;  1UFM A;  4MGR A;  3QAH A;  1S7O A;  4CH7 A;  4R8H A;  4QPQ A;  4H4K C;  2FUG 2;  4UUV A;  1Z21 A;  2QSF X;  1W0T A;  2K02 A;  2NRA C;  5JR3 A;  2LK2 A;  4DOZ A;  2XSJ C;  4KT6 A;  4UV9 A;  1SD4 A;  1FWZ A;  2QZ8 A;  2DMU A;  4XLC A;  3GCM A;  3RYR A;  1G8X A;  4A3L J;  1VQK I;  1H88 C;  3KLO A;  3AL0 B;  2E7X A;  1TBX A;  2AXT C;  4W97 A;  5K5R A;  3C18 A;  2HQA A;  2ZME B;  4IHY A;  2Z5U A;  4HX7 A;  1MND A;  3MVP A;  4B09 A;  1Z7U A;  2HWV A;  1PUF B;  2CV2 A;  1PUE E;  5FKO A;  2XC7 A;  1MH4 A;  1MJ9 A;  1ZLK A;  2VJJ A;  1FY7 A;  4CIC A;  1Y0N A;  2CQ7 A;  3GFM A;  4KJZ A;  3LQR A;  3D5S C;  5E79 C;  1HXD A;  4MQ9 F;  2A61 A;  2L9S A;  1LFB A;  3J7A Y;  4IPA A;  1XPX A;  3DEE A;  2V6E A;  1PYV A;  2RKH A;  2WC2 A;  3SQN A;  1NG6 A;  2GA1 A;  3HOU J;  1YIT I;  1NG7 A;  4PCQ A;  2IA0 A;  3FX3 A;  4UXN A;  2M30 A;  3T5X A;  2P8T A;  3W2W A;  3DEU A;  1BC7 C;  3KP5 A;  2MG4 A;  3CC4 I;  2JQ7 A;  2BOL A;  4RGX A;  2FXA A;  2M87 A;  3HRS A;  4HG2 A;  1S29 A;  2NVX J;  1RPW A;  4X0G A;  2LF8 A;  1Z3Y A;  2J5O A;  3IP4 B;  3P5J A;  5GAH J;  2FJ1 A;  2LOO A;  5FFX A;  1OKR A;  1XC5 A;  2PI0 A;  1J0R A;  5LFA A;  5FLX Z;  3BTL A;  4HNT A;  3LQQ A;  4GYI A;  4M3E A;  2QQA A;  4XKB A;  3MKW B;  4FX0 A;  3KPH A;  2W24 A;  2W4S A;  5IYC J;  3SHF A;  1ZAR A;  3HOY J;  3K4K A;  2EZI A;  1I27 A;  1GV5 A;  3HEF A;  4YIR X;  1IC8 A;  1QU3 A;  3I59 B;  5F0H A;  1H9T A;  1P92 A;  1BL0 A;  3JRF A;  2B0L A;  1FSE A;  5D6E A;  1HSJ A;  1HKT A;  2NS7 A;  4LB6 B;  2OQG A;  4LIT A;  1WGX A;  3S93 A;  3E97 A;  5FRN A;  3CF2 A;  3OR2 C;  3HG9 A;  3F8M A;  1ACI A;  2QBY A;  1QVT A;  2XGC A;  2Y0S N;  2A6H F;  5B3S H;  4KYW A;  2XDV A;  3VOD A;  1S8N A;  4D5C A;  2XF7 A;  2DOE A;  2COB A;  2R3S A;  2PEX A;  1H8A C;  2P5K A;  1F9N A;  4JOM A;  4M3D A;  4AC0 A;  1BI0 A;  1UST A;  5BMZ A;  1IDZ A;  3BZ6 A;  4IKF A;  4WK8 F;  3PNY A;  3SEZ A;  3V4G A;  3PO2 J;  5ILS A;  3BJA A;  4L9J A;  3ZMD A;  1YHQ I;  1XMA A;  2JMW A;  3PUB A;  3DP7 A;  4IX7 A;  2DOF A;  3R4K A;  5EYR A;  2E34 A;  1X3W B;  3AG4 H;  5DD8 A;  3RZO J;  1I3Q J;  1OFC X;  1DPR A;  1A6Q A;  3K69 A;  2O0Y A;  1FNN A;  4ZYA A;  2OAZ A;  4IL6 C;  2AQE A;  2BW3 A;  4MFE A;  4E7Z A;  1WI9 A;  2QQ9 A;  2GWR A;  1S9H A;  4PFO A;  3FBN B;  3DLA A;  4IVN A;  4N4N B;  4HLY A;  3E5Q A;  3I4M J;  1WJ5 A;  5JLX A;  5E17 F;  1E17 A;  2R7D A;  2V4J C;  4I7H A;  3AG1 H;  3MEX A;  3N97 A;  3RKX A;  1N77 A;  1ETO A;  1MBH A;  2MYS A;  2FE3 A;  1O4X A;  1V5F A;  4B8X A;  2DFH A;  4CCJ A;  4KMF A;  4A0X A;  5LEJ A;  2W84 A;  2GOM A;  2HZT A;  1FOK A;  2DJI A;  3W6K B;  3HBL A;  4XSX F;  1GUU A;  3G1M A;  1SVO A;  3F3X A;  3DKY A;  3GYH X;  2XAG A;  3GBG A;  1X1P A;  2V9K A;  3R0J A;  2KIU A;  3ERM A;  2VQC A;  2X51 A;  2K3P A;  2VON A;  5CYV A;  4GGG A;  5K1Y A;  1HA8 A;  1VND A;  1ONV A;  2KT0 A;  3BR2 A;  4C3J J;  4HSR A;  3LAP A;  3FXO A;  3DTK A;  2DQL A;  3BOQ A;  3IH4 A;  4B4C A;  3J7A O;  4OIP F;  2L02 A;  1J7K A;  1D1C A;  1BA5 A;  2CQX A;  4NB5 A;  3K4C A;  2FBI A;  3GTG J;  2HGC A;  3PIP F;  1ZQ3 P;  1L0O C;  5IT3 A;  3BY6 A;  4E6K G;  2HKX A;  1K4T A;  2Q0O A;  3OYJ A;  1F5T A;  3DCF A;  2LLK A;  4LMY A;  3KP7 A;  3S1M J;  2Y31 A;  4AM3 A;  2Y2Z A;  1A35 A;  3JR9 A;  1ZEL A;  2CG4 A;  2OC6 A;  4YRV A;  3MN2 A;  4B3X A;  2VB6 A;  3W6J B;  3HXL A;  2LP0 A;  4DBQ A;  4IHX A;  4ZYE A;  1JTX A;  3FF5 A;  4EAT A;  1I3A A;  2KP6 A;  1B8I A;  2F5F A;  2XPW A;  2LD5 A;  1R71 A;  3DPU A;  2ZSI B;  4XLA A;  5BNG A;  1B72 A;  1HKQ A;  2KL4 A;  1J5Y A;  5FKN A;  2DW4 A;  4E7I A;  4A3F J;  1RUO A;  2HXO A;  1D5V A;  2E5Z A;  1CGP A;  3K4L A;  2KFD A;  2QA4 I;  4PJL A;  5D5U B;  1NK3 P;  1ZYR F;  3ABU A;  3WTZ A;  2VOO A;  1JJ8 C;  4Y17 A;  3OWT A;  3TOB A;  3QYE A;  2R0Q C;  2H27 A;  2XF5 A;  1AKH B;  2KJC A;  1MMN A;  1TNS A;  4R1H A;  1JGG A;  3IKV A;  3T0Y A;  1IV6 A;  1REP C;  1E0E A;  1L3L A;  3RKW A;  4V2G A;  2Z2S B;  3KYC B;  1PP7 U;  3QPL A;  1K78 B;  3S2H J;  3GWZ A;  1ZG1 A;  2NVT J;  5D5V B;  2A07 F;  3G1O A;  2X6W A;  2IJL A;  4C2T A;  2QEX I;  4AU7 A;  3F72 A;  1DGW Y;  2KIM A;  2JA2 A;  1SD7 A;  3R6S A;  4YIF A;  4D7N A;  1R23 A;  4NQW A;  2KQR A;  4FE4 A;  3CCM I;  2EA2 A;  3VYR B;  1NK2 P;  1YS6 A;  3K4M A;  3LSM A;  5F1R A;  4HRI A;  2O8K A;  2WA0 A;  2M2E A;  2ZJQ F;  4BDY A;  5BPI A;  3T1B A;  1U3E M;  2A3S A;  3RZD J;  3HGG A;  2HVQ A;  4KUM A;  5IT9 Z;  1EF4 A;  2Y9Z A;  1K83 J;  2RC4 A;  3L2U A;  9ANT A;  1ETQ A;  1O7F A;  5A2Q Z;  4IRG A;  1BR1 A;  3U2R A;  4MHG A;  4DJA A;  5DCF A;  2KRF A;  5D8K B;  1N78 A;  4LIU A;  4BNC A;  2UXN A;  4E7L A;  2L5Q A;  3HC7 A;  2HVR A;  5FD5 A;  2ISY A;  4AIK A;  1GV2 A;  1HDD C;  3G71 I;  1YRN B;  2ZB9 A;  2DTR A;  1Y8Q B;  3CUO A;  4A3I J;  1EV7 A;  1UHM A;  2ZFW A;  3SZP A;  3OS0 A;  1XX5 A;  2OZU A;  2CQK A;  1XMX A;  1S7E A;  3ABL H;  3Q9V A;  2H8R A;  1D1B A;  1ETY A;  1RNL A;  2CFX A;  2K9L A;  2MH2 A;  2R7V A;  2ME0 A;  2HZD A;  3BCA A;  2DDA A;  1HDP A;  4RB2 C;  2R7S A;  4BUP A;  3WTV C;  1IJW C;  3I55 I;  1EH7 A;  4F92 B;  1T38 A;  4C3I J;  4AD9 A;  2M7B A;  4N9I A;  4I02 A;  1ON1 A;  5DS9 A;  3Q0V A;  2XHK A;  1G3T A;  3KYL A;  1QO0 D;  3LSG A;  1W1W E;  4R79 A;  1MMA A;  3GFJ A;  2VL8 A;  2O7O A;  2PMZ N;  4HAM A;  1BM9 A;  4RAF A;  5F6F A;  4EM2 A;  3WE2 A;  4J19 A;  1IRG A;  5C3E J;  5KNL A;  1SFO J;  2C6Y A;  1KQ8 A;  3BJ6 A;  2PX9 A;  1X4O A;  5ICF A;  2LKP A;  2IGM A;  1WH7 A;  2H09 A;  2JA6 J;  1FP2 A;  2EFP A;  3C1D A;  5CKT A;  1B1B A;  2EJR A;  4JBA A;  2R5Y B;  2WV0 A;  3WOD F;  1WCM J;  2XV4 S;  3J81 K;  3TQN A;  4M9X A;  3CLQ A;  3HPG A;  4LJZ F;  5CLS A;  3ZQG A;  2HVS A;  4J01 A;  1EH6 A;  1PUF A;  3HDD A;  1S7A A;  3M1C A;  1RI7 A;  3W2A A;  5JHU A;  3HOT A;  5D4S A;  4LLN A;  1X2N A;  2ZME A;  3GW2 A;  1Q1V A;  4PJ0 C;  2CUJ A;  2XAF A;  1XG1 A;  4Y4R A;  1XDU A;  5DD4 A;  3D1N I;  1LUJ B;  2DT6 A;  2IVM A;  2E35 A;  5HS8 A;  3FHZ A;  1A36 A;  2R7U A;  2LTP A;  4IQ4 A;  3C2H A;  3S8P A;  4F3Q A;  1IRZ A;  2DMN A;  4AYB A;  1FX7 A;  4JYK A;  2MW8 A;  2CQQ A;  2Y9Y A;  5H6R A;  4IOA F;  1ODD A;  5K7H A;  1WSU A;  2DPD A;  4GO1 A;  1I6H J;  4F93 B;  3GTQ J;  5D4R A;  2F5D A;  4ZJZ A;  4Q4Z F;  4IZZ A;  1TL8 A;  1WRJ A;  2L2O A;  1AA7 A;  2STT A;  5DV5 A;  2CRG A;  1DU6 A;  3O8G A;  2VQH A;  3ZQF A;  2XIG A;  5EGO B;  3M8J A;  1LNW A;  3ZR8 X;  5JFR A;  3ZMZ A;  2JRT A;  4MLO A;  3E6B A;  3QPS A;  4MFD A;  2VQL A;  3NRV A;  1J09 A;  3L1P A;  3DBR B;  1DU0 A;  4RBO A;  4CA0 A;  2GIZ A;  1IN8 A;  3WTT C;  1H0M A;  4XOT A;  3BTJ A;  2DDB A;  2WY7 Q;  5CQE A;  5AON A;  4RMN A;  3Q3S A;  5FJ8 J;  3F0C A;  1P2F A;  2D1H A;  4BQN A;  1SFE A;  1T98 A;  2E60 A;  4M72 A;  1WQ2 A;  3AG3 H;  3HKZ N;  3OL4 A;  2B7E A;  1WJC A;  3DBL B;  4MQV A;  2RV8 A;  1OQY A;  2E7W A;  1Z91 A;  1JGS A;  5B66 C;  4QWQ A;  1QZZ A;  2HXI A;  1FYK A;  4NQW B;  3H9Q A;  5FO5 A;  4L18 B;  3CMY A;  1HCR A;  3CCS I;  3JTG A;  2LY1 A;  5FKL A;  2TCT A;  2V1N A;  4LG0 B;  3OY9 A;  4RGU A;  1X19 A;  2L54 A;  1JKQ C;  1LEA A;  3VYT B;  1T08 B;  2K7L A;  5D5X B;  1IN4 A;  4UUS A;  1K61 A;  3BQY A;  1JT0 A;  1VQ8 I;  2UXX A;  1IDY A;  3E6C C;  5E3M A;  3A4C A;  1MH3 A;  2CYY A;  4KN4 X;  3K7A J;  1OCO H;  3C2B A;  5FRM A;  3ZMV A;  5M3F J;  4OAZ A;  1SAX A;  2QM3 A;  5BOX A;  2K3F A;  3F21 A;  5L3C A;  2L7K A;  5C4J J;  3A01 A;  2V1X A;  3QOD A;  1H9G A;  2L7F P;  1YI2 I;  2CO5 A;  3BDD A;  3CCE I;  5FLM J;  5IP7 J;  1G2H A;  2CUF A;  2JTV A;  2NYX A;  4HZF A;  2QQ8 A;  1P7J A;  1HW2 A;  3F8B A;  2OTJ I;  5J47 A;  2ICW G;  4A6E A;  3E5X A;  1G3Y A;  3JRH A;  3IV5 A;  2X0L A;  1MGT A;  1U0J A;  1FT9 A;  3G4S I;  3V8J A;  4FT8 A;  3ML6 A;  1UZC A;  3L2C A;  1V3F A;  3JSO A;  1JE8 A;  1QBJ A;  3OYE A;  4OIR F;  1D0X A;  3E1S A;  3EPZ A;  4YFX F;  1WWX A;  2MC4 A;  1IZ1 A;  2CFO A;  4KN7 X;  3FZV A;  5J3L A;  3ELK A;  3JRI A;  2HYF A;  4D1Q A;  4L5J A;  1UEL B;  3ZOB A;  5E8G A;  2OF7 A;  3DTI A;  2E2H J;  1Z0X A;  1NH3 A;  5TJJ A;  4BQO A;  3RDI A;  3S1R J;  2VBZ A;  2YUS A;  3F6V A;  1G59 A;  2W00 A;  1YYV A;  3JRB A;  4ZYG A;  1B72 B;  1HST A;  4L5I A;  1VI0 A;  1RIO H;  5B5E C;  2E1N A;  4RLQ A;  3ZMS A;  5BPD A;  4KIS A;  2ZXI A;  3VDX A;  2JK3 A;  2ISZ A;  3BCB A;  3I4P A;  3JCU C;  3H3U A;  3QP6 A;  3GTK J;  1WJF A;  2XUB A;  1DUX C;  1BN5 A;  4HQM A;  1HBX G;  2VJ5 A;  1WFX A;  1UG2 A;  3JRA A;  3K70 C;  1IV8 A;  4DGW B;  2F4I A;  4CZZ A;  3LSI A;  4U87 A;  3S3N A;  4CCL A;  2D2W A;  2PMU A;  2V9V A;  4I98 B;  4I99 C;  1H89 C;  1HLV A;  4PFP A;  3GFL A;  1XGM A;  3VYS B;  2P5V A;  4RB0 A;  5EEG A;  1SD5 A;  3H92 A;  3LL7 A;  5GTI C;  1GDT A;  1BW5 A;  2XAS A;  3IAM 2;  3AFH A;  1V5G A;  1XB4 A;  4A3K J;  4XSZ F;  3RIR A;  4PJJ A;  4LFU A;  4LK1 F;  4MEX F;  4Y15 A;  1DP3 A;  2FQ3 A;  4W1U A;  3HB9 A;  3R60 A;  5LEK A;  3M8F A;  2COM A;  2IS6 A;  5ERI A;  4M74 A;  2DTZ A;  3K70 D;  4XL9 A;  4KNY A;  2W85 A;  4FAS D;  3Q0U A;  2CUZ A;  1SC7 A;  1SAN A;  2JUG A;  3KZY A;  4B3A A;  4B1R A;  2X1E A;  3KP3 A;  3AL0 C;  1USS A;  1VQN I;  4PK4 A;  4HF2 A;  3D0S A;  3HOS A;  4G6D A;  2WAE A;  3IRR A;  1GT0 C;  2CSO A;  3U1D A;  4YII A;  4HF0 A;  3LWF A;  4C3H J;  1WH5 A;  4HST A;  3WGH A;  5L3D A;  3GTL J;  3RQI A;  3VB2 A;  1QZE A;  2A05 A;  4L0Z B;  2Z3Y A;  3BZC A;  3A01 B;  2E19 A;  3K10 A;  3OYH A;  3OYC A;  4G7O F;  2PBI A;  1WJB A;  1OCT C;  1E3H A;  2K27 A;  2W82 A;  2KZV A;  3M07 A;  3JW4 A;  3KEY A;  3GEZ A;  2WB1 N;  1ZKG A;  3VOE A;  5ILU A;  5HS7 A;  1YS7 A;  4EM0 B;  3S16 J;  4BL0 B;  3B6A A;  3R61 A;  5EEA A;  3HGY A;  3LSH A;  2JWT A;  4NC8 A;  1BJZ A;  2DA4 A;  3GX4 X;  2DOA A;  2X85 A;  2OV7 A;  2FMY A;  2DFI A;  4BHP A;  2DA3 A;  1MBG A;  3W2V A;  5IP9 J;  1ZGA A;  2ELK A;  2VPL A;  2OJE D;  4JP0 A;  3MMY B;  4Y13 A;  1EKE A;  3ZP5 A;  2NVU B;  2RVC A;  1OIS A;  4L9V A;  1IW7 F;  4AIJ A;  2HYJ A;  5IPA A;  1ZG3 A;  2PG4 A;  4Z2Y A;  3D5R C;  1FBS A;  1FBU A;  5J4V A;  2KDO A;  3DFG A;  2ZBK A;  1BI1 A;  1MJA A;  4A3E J;  2YR2 A;  3JRC A;  5IP6 A;  5D8L B;  2HPM A;  3WE3 A;  1JI8 A;  3CQZ J;  3GTO J;  4GDF A;  3QPH A;  1OYW A;  3G3Z A;  3TGN A;  1D3Y A;  2K4J A;  5F1J A;  4ENK A;  2M4G A;  5EJC A;  2L01 A;  4A5N A;  4E7K A;  1ZR4 A;  1TWG J;  4J00 A;  1KYZ A;  3KCC A;  2V26 A;  1BW6 A;  2XPV A;  2Y30 A;  4IJA A;  2CV0 A;  2A6T A;  2NAZ A;  1IF1 A;  1MMG A;  4MTE A;  5HNH A;  3TP0 A;  3PUF A;  4BXF A;  3S1Q J;  3FIW A;  2JT1 A;  4IRH A;  4XLN F;  1JTY A;  3SJM A;  4EMS A;  2I8D A;  3VFZ A;  2YSR A;  5HLT A;  2IRF G;  4FIS A;  4JX5 A;  3LOC A;  1I1S A;  5FLV A;  1UHW A;  2DBB A;  1SFX A;  4O5V A;  3FDY A;  1JKO C;  2XKP A;  3WG7 H;  2H1K A;  2FNA A;  2YU9 J;  1YX5 A;  2CS3 A;  5JLW A;  3FBI B;  1HQC A;  3BR6 A;  1TC3 C;  3WHB A;  4LGW A;  3O3K A;  3OR1 C;  1MMD A;  1YOV B;  2K40 A;  3B6C A;  2DPU A;  2X4H A;  2X9D A;  1E3P A;  1JUS A;  2R7T A;  4C9Y A;  2CJJ A;  2RRE A;  3H5A A;  5HLG A;  3IH3 A;  3O6B B;  4U0Y A;  4PGH A;  2BZT A;  3HYI A;  2MC3 A;  2WBM A;  4A0Y A;  1GHC A;  2MFZ A;  4ITV A;  2KHM A;  3OYN A;  2X1D A;  1BIA A;  1K6O A;  2H94 A;  4XBF A;  1K79 A;  3WU2 C;  1XDS A;  1MW7 A;  1N75 A;  4YG2 F;  3CMA I;  2WWY A;  1Z3X A;  4NUB A;  4WXC A;  2VKE A;  3ZGK A;  1SVM A;  4K2E A;  2FNP A;  1NTC A;  3M9A A;  1LKX A;  1R36 A;  2MD0 A;  3SYT A;  3CCY A;  3RKQ A;  1HKS A;  2DA7 A;  3FM5 A;  2DA2 A;  5TRD A;  4XR6 A;  2FOK A;  4ANJ A;  3OYK A;  3EUA A;  2IA1 A;  2ESH A;  2IPQ X;  5HDN A;  3JRE A;  3GME A;  3JTH A;  3CCL I;  5IT9 K;  4G8X A;  4CGZ A;  2AQF A;  3FXM A;  3G1L A;  3DPL C;  5K7Z A;  3PQK A;  4BBR J;  5B1A H;  1IN5 A;  2IS1 A;  2VIX A;  1SAU A;  3E6D A;  5F64 A;  5BQT A;  4ENJ A;  2G7H A;  4XNF A;  2CU7 A;  1WKM A;  4F55 A;  2B63 J;  3OS2 A;  2EBI A;  3QYB A;  2VOD A;  2EV6 A;  3PM1 A;  1RKW A;  2DAO A;  4V2F A;  3RPU D;  2IP2 A;  2Z99 A;  1Y6I A;  1BI2 A;  3TO9 A;  3ZN1 A;  5LRS A;  1Z1D A;  1HC8 A;  2F4O B;  3SZG A;  3TW7 A;  4LG0 A;  4FTH A;  1FEX A;  2IGK A;  4EJU A;  2VAS A;  2MH9 A;  3LSK A;  2CV1 A;  4PJN A;  3TP3 A;  2F5C A;  1X1C A;  3H1C A;  3I58 A;  1Y1V J;  4WF2 A;  4CO8 A;  2OTL I;  4OIQ F;  3M7G A;  2BY3 A;  4UB6 C;  2K9S A;  2EZL A;  4M6X A;  3FKI J;  3TOA A;  1W36 C;  2LC2 A;  3L2W A;  1YIJ I;  1TWH J;  2HDC A;  3BP8 A;  2QUF A;  3P9I A;  3QPT A;  2ZCW A;  2FA5 A;  1KYW A;  2KIS A;  3HHH A;  1ERD A;  3H5N A;  2ZJ2 A;  2GXG A;  2XRL A;  4NC6 A;  3IUO A;  4A5M A;  4BBS J;  4PDK A;  4WXD A;  3A02 A;  4RM2 A;  3RPQ A;  3HOW J;  2UUZ A;  2X48 A;  4FE7 A;  3WGG A;  2FX0 A;  2XAJ A;  1STZ A;  2RNG A;  1TT0 A;  4M3F A;  4RB1 A;  1EA3 A;  1P4X A;  3LST A;  3TKY A;  5DYM A;  1LB2 A;  2XB5 A;  4AUX A;  3DEW A;  2X6O A;  2IGN A;  3R0A A;  4WX9 A;  4D9J A;  2BY0 A;  2R5Z A;  1CF7 B;  5GP9 A;  2M9H A;  1W7P A;  3CDH A;  5HLH A;  5IYB J;  1FP1 D;  2EPF A;  1VQ9 I;  2R5Y A;  3J80 K;  3KEQ A;  4AIH A;  5GPA A;  2PMH A;  2ZME C;  3J81 Z;  2Y0M A;  3VSL A;  4DBR A;  1ENH A;  2LBF A;  2NNY A;  3OYF A;  2JA5 J;  4XIC A;  1P6R A;  3TBI A;  3O8H A;  4BEH A;  3SDB A;  2K5C A;  4ASN A;  4BKX A;  2IBD A;  4XLP F;  1X1B A;  2ZC2 A;  2P6T A;  4A3D J;  3OOP A;  4A2U A;  1GXP A;  4G6T B;  1WHU A;  4LD5 A;  2D45 A;  3OMY A;  1IUF A;  4XM3 A;  3EUK L;  5F0F A;  2UZK A;  1LDK B;  3HSE A;  2HQN A;  2OD5 A;  1DP7 P;  3TDZ C;  1V4R A;  1S72 I;  3RYP A;  1R9T J;  3OYL A;  3RQ4 A;  2JRM A;  4HX8 A;  2W7N A;  4HF1 A;  4I76 A;  5KAI C;  5EG0 A;  2A6E F;  4IEJ A;  5F0C A;  1FC3 A;  4CCM A;  4A93 J;  4A3B J;  2NNN A;  3ASO H;  5HS9 A;  2HTJ A;  2R7X A;  3KP4 A;  2OBP A;  1W5T A;  4HA8 A;  4BQQ A;  5IOZ A;  1AOY A;  4P96 A;  2H6B A;  3HUG A;  2GM4 A;  2A5Y B;  4BXX J;  2ZXJ A;  3JAM Z;  1MNM C;  4XOR A;  4ZC3 A;  1VQO I;  1B9N A;  3Q9S A;  2M1B A;  3GFI A;  2DA5 A;  2ZNZ A;  4XON A;  1U78 A;  1XSV A;  2HQ5 A;  3FXR A;  3MCZ A;  5CQG A;  1SD6 A;  1WI3 A;  1KU2 A;  5IY5 H;  4LK0 F;  3ZMU A;  1AWC A;  2EK5 A;  2EZK A;  4RGS A;  4MO7 A;  1A6I A;  1BI3 A;  5LHI A;  2W1O A;  2F4M B;  2LH9 A;  1XMK A;  2KLO A;  1O3Q A;  2E1M B;  5E18 F;  2XGD A;  1HW5 A;  5HLI A;  5L3F A;  4OAY A;  2G7U A;  2MA3 A;  1JKR C;  2VJ4 A;  3V7C A;  3T8T A;  1AHD P;  1GVD A;  5F04 A;  3ZPL A;  3A03 A;  3ECH A;  1XTA A;  2XB0 X;  2O3F A;  3D5L A;  5CVU A;  5J4Y A;  1I1G A;  3WU1 B;  3I5U A;  2MSY A;  4LOC A;  3ZRG A;  2E36 A;  3PFI A;  3DBH B;  3ZQC A;  1PVE A;  1TP4 A;  1MJB A;  1T39 A;  4XN0 A;  3H35 A;  1DGR M;  1MBE A;  2EFO A;  4EJT A;  2BEO A;  1KQ0 A;  3HIF A;  2QWW A;  3LA7 A;  3L2Q A;  2WAD A;  3RTR A;  1IAW A;  4PGG A;  5KK1 A;  4AVZ A;  4UNO A;  3I53 A;  1TTY A;  4NHJ A;  2L7M P;  5M5X J;  4IXA A;  3BPX A;  3DPT A;  3QYF A;  5DM7 F;  5E1X A;  2GXB A;  2QKM B;  2JPC A;  1FBQ A;  4HV5 A;  2W48 A;  3M8E A;  3N4M A;  1Z6R A;  1RZ4 A;  3BR5 A;  2F5E A;  2ZXH A;  1LFP A;  3O2P E;  3OL3 A;  5DCM A;  5H6Q A;  4KIT B;  3KYD B;  1ZRE A;  5J1Y A;  2CH0 A;  4HBL A;  3RSN A;  2Z16 A;  4OOI A;  3GTM J;  2DYS H;  3LSJ A;  5GAG J;  1Y8R B;  4RM3 A;  4AYB N;  3E3V A;  1KU7 A;  1QGP A;  4H0E A;  2EQR A;  4YFN F;  1XD7 A;  2HQR A;  2LMD A;  2VE8 A;  1MZB A;  3PO3 J;  3ZMT A;  5GPC A;  3FXL A;  1F4K A;  1RUN A;  3FXU A;  3IAS 2;  2QLZ A;  4RS8 A;  4B44 A;  2OCE A;  4M3G A;  1VQ6 I;  3NAR A;  1OCR H;  3SZT A;  5AIP A;  2P81 A;  2PJP A;  1MMS A;  5GAE J;  2H6C A;  2IXS A;  4C30 A;  4DW6 A;  2L3D A;  2VN2 A;  2XAQ A;  2L7Z A;  3GVA A;  1UCR A;  4JK1 X;  4YEL A;  4ZH4 F;  1AU7 A;  1Y56 A;  5TGT A;  4ZDO A;  1YG2 A;  1OLT A;  2EV0 A;  3CO6 C;  3V8K A;  1LVK A;  3C3W A;  2NOG A;  2NOJ B;  3S1N J;  2KKO A;  4CHU A;  2ID3 A;  4RDU A;  2F48 A;  1JHF A;  2HS5 A;  3GXO A;  1T6S A;  5D5W B;  2V9P A;  3OIQ A;  5EZH A;  4L9T A;  1D0Y A;  2L0K A;  3SEQ A;  1W7P D;  2VI6 A;  4O6J A;  1R22 A;  3E7L A;  1DPU A;  3CP2 A;  3NQO A;  4HNV A;  2JUC A;  2E1M C;  3VSK A;  4F91 B;  5JHF A;  4BQA A;  4NBQ A;  5E1W A;  2K85 A;  1BR4 A;  1FJL A;  1I50 J;  1QA6 A;  1Z9C A;  2EH3 A;  4YFK F;  4TV7 A;  4EM1 A;  5ICG A;  3H3V K;  2DYR H;  4ZYD A;  1I6X A;  1ZRF A;  1N25 A;  2UV1 A;  2ZJP F;  3KET A;  4KFC A;  3CLO A;  3SFI A;  3OYI A;  4KIC A;  4UHT A;  3SDG A;  3ROU A;  5J8C A;  1B8I B;  3ERE D;  5GTH C;  5C4X J;  5K7F A;  4XID A;  4RAZ A;  2PN6 A;  1FTZ A;  3BR0 A;  3M3Y J;  3OOU A;  4HV6 A;  1S6L A;  1F36 A;  2Y48 A;  1X4P A;  4IQJ A;  1YO5 C;  3S3O A;  4CCO A;  2HEO A;  3S15 J;  1ORK A;  3IKT A;  3K1N A;  1D8J A;  5F27 A;  3L2V A;  1P7I A;  2W25 A;  4XQF A;  1AKH A;  1A04 A;  5LLQ A;  3EUH A;  4BJ5 C;  3P9C A;  1U2W A;  4ZZL A;  4X6A J;  4EEF G;  3RCO A;  2CGP A;  1IRX A;  1TQP A;  1TWC J;  2GIV A;  2PMZ A;  3DTE A;  4ZDL A;  1MBK A;  4BU2 A;  3H9J A;  2LDU A;  1FTT A;  3F8F A;  3CTA A;  3WG9 A;  3HOX J;  2FRH A;  3OV8 A;  2MLK A;  4LG3 A;  3L2R A;  2DQR A;  2D5V A;  3E0J B;  3J7Z I;  1F1Z A;  3WTS C;  1ETV A;  2DMQ A;  3BG3 A;  1IN6 A;  1OYY A;  3FXQ A;  1R5I D;  3BLY A;  2AXL A;  4HYE A;  5LHG A;  2KMU A;  1SFK A;  4PJM A;  5L3G A;  2LFB A;  2E5N A;  2M45 A;  2DCE A;  2Y69 H;  4BDZ A;  4ENN A;  5ED4 A;  1VQ5 I;  3DKX A;  1A31 A;  4MIM A;  3K2A A;  2K9M A;  3CC2 I;  4DNC A;  5C44 J;  1LDD A;  3LAJ A;  4XOP A;  5B1B H;  3JAM K;  4CCN A;  1QPI A;  4IHS A;  3A2K A;  2A68 F;  4OMZ A;  5ILV A;  1EJ9 A;  1T56 A;  3GZN B;  3K1P A;  1M1E B;  3GTP J;  4DYC A;  4XKW A;  1VQP I;  3M4O J;  2VBX A;  5LD2 C;  2NS8 A;  1FMW A;  1O57 A;  4CDG A;  2HR3 A;  2L4M A;  2H8W A;  2DLL A; 
#chains in the Genus database with same CATH homology
 1EH8 A;  3ULQ B;  2OZ6 A;  2AS5 F;  4EQQ A;  3I71 A;  1J9I A;  4O3M A;  2O6G E;  2O8X A;  2RDP A;  3K2Z A;  3P9K A;  3HHG A;  2VOP A;  4EGY A;  1TQM A;  1U5T B;  4U7D A;  1K7A A;  4U88 A;  2RQP A;  3DF8 A;  3RPU A;  3WTY C;  3WTU C;  4WWC A;  1R1T A;  2FU4 A;  1ZN2 A;  1BOA A;  2ESN A;  2FF4 A;  5K5O A;  2MLG A;  3BWG A;  4AWX B;  2P7C B;  2XGX A;  5HOO A;  1IXC A;  3EET A;  5DDG A;  2FBK A;  1Z05 A;  4RGR A;  2GQQ A;  2V1D A;  1FSH A;  2QQB A;  3V7R A;  1O3R A;  2TDX A;  3PQJ A;  1VTN C;  4ESF A;  3EYI A;  3I64 A;  3G73 A;  3HRT A;  4S04 A;  1B4A A;  1OMI A;  5ICE A;  1BIB A;  2ZO4 A;  1G3S A;  5E1Z B;  1DDN A;  2PI0 A;  1KU9 A;  4MNU A;  3B02 A;  4G9Y A;  5L3E A;  4LLG F;  4M71 A;  2EA4 A;  1TW2 A;  1JXS A;  2G9W A;  1XCV A;  5EEH A;  5CJ9 A;  1OYI A;  5DUI A;  1R5G A;  1R1V A;  4IRI A;  2GA2 A;  3FM3 A;  2KJB A;  3CUQ C;  4KT5 C;  5LGU A;  2CWE A;  4KIB A;  5K5Q A;  3L9F A;  1IXS B;  3F22 A;  3BPV A;  4EJO A;  5FD6 A;  4OMY A;  1O7L A;  3L09 A;  1ZRD A;  1J59 A;  1ZGJ A;  2VT2 A;  1QPM A;  2RGV A;  1YW8 A;  2RNJ A;  2HOE A;  2XAH A;  4P9F A;  1BJA A;  4KMU X;  3HTS B;  4UV8 A;  4HOB A;  2Y75 A;  4Q48 A;  4HX4 A;  3FMR A;  3LFK A;  3I54 A;  3MFK A;  4IHT A;  3V7S A;  3QRF F;  1UB9 A;  1G3W A;  3GF2 A;  3I0T A;  4DQ2 A;  4KIF A;  1XCB A;  2QVO A;  3QP5 A;  3EDP A;  1R5H A;  1W7P B;  4HDU A;  4U0V A;  4ESB A;  3FWE A;  1HW1 A;  3L7W A;  5A2Q K;  1FYM A;  3DXJ F;  4M9Z A;  4KA4 A;  2FSW A;  2PFB A;  6PAX A;  1PP8 F;  2MBF A;  2VT3 A;  4S05 A;  2KIF A;  5LRR A;  4ENM A;  4OIN F;  3HSF A;  1YIO A;  1U8R A;  2VXZ A;  4U7B A;  4AVP A;  1LQ1 A;  2VBW A;  1XSD A;  3LA2 A;  2VE9 A;  4GYG A;  1IN7 A;  2EFN A;  1FYL A;  2F2E A;  2Z9O A;  3RJP A;  2Q2E A;  1YLF A;  5L3B A;  2GAU A;  2EB7 A;  2EWN A;  4KIG A;  2DK5 A;  3Q5F A;  3WTX C;  2DI3 A;  2HTS A;  2P4W A;  1LJ9 A;  1GXQ A;  3TDU C;  2OQR A;  4E70 A;  1FPQ A;  4M6Y A;  3ABT A;  2P6S A;  3MAJ A;  4I0A A;  4ESJ A;  1ZRC A;  5JVT A;  3J80 Z;  2W57 A;  4HQE A;  3L00 A;  3T8R A;  1K78 A;  3QOP A;  2DO7 A;  3KZZ A;  1O3T A;  2LSO A;  2JZY A;  3BRO A;  4P55 A;  5J8F A;  5D6F A;  2BE5 F;  3EQL F;  1SMT A;  4D0P A;  1ZLJ A;  5H20 A;  4M73 A;  4G94 A;  3LA3 A;  3SXY A;  4PZJ A;  1B9M A;  2O03 A;  4RB3 C;  3HSR A;  5AIQ A;  2M8E A;  1I5Z A;  4L9N A;  2HKO A;  2XVC A;  2YU3 A;  2DT5 A;  3CUQ B;  2ADU A;  3F8C A;  5FLX K;  3KEO A;  5ICC A;  1LEB A;  3MZY A;  1YFH A;  3BJO A;  3P7N A;  4FX4 A;  3HTU A;  3GZ5 A;  1P4A A;  4F7Z A;  2LF7 A;  5HDK A;  1P4W A;  3GO5 A;  1R7J A;  2YPR A;  4I01 A;  3HRM A;  1ZG5 A;  1YQA A;  4UVC A;  2P7V B;  3TO6 A;  3DV8 A;  5CVR A;  2V79 A;  4HDV A;  3H3Z A;  1NHA A;  3DQV C;  3KE2 A;  2QEN A;  3FMQ A;  1ZH5 A;  2YX4 A;  4HW0 A;  4LLL A;  2K4B A;  2XRO A;  2R7F A;  1XGS A;  2EV5 A;  4GCV A;  1MDM A;  5DUK A;  3IL2 A;  1IRF A;  1S3J A;  2QBY B;  4BYY A;  4XRF A;  4M9S A;  4OIO F;  4LB5 A;  2Z33 A;  1B59 A;  2YX7 A;  3MZH A;  1G6N A;  1SFU A;  3WTW C;  1O3S A;  4BAY A;  1MDM B;  5JI6 A;  2L4A A;  2Q8K A;  1R1U A;  2JSC A;  2ACJ A;  1KU3 A;  4A0Z A;  1QQI A;  1TNT A;  1U5T C;  1MD0 A;  5CVJ A;  4Q47 A;  3CUQ A;  3F6O A;  1JHH A;  3JSP A;  5HVQ C;  3FMS A;  4G6Q A;  1IUY A;  3F8N A;  3NEU A;  4KDP A;  2J5P A;  1X3U A;  1E2X A;  3IC7 A;  5LBQ A;  2OA4 A;  1QZY A;  3I59 A;  3TO7 A;  1B6A A;  2WTE A;  3B73 A;  3IWZ A;  1U6G A;  1ZHF A;  4P5O A;  5LHH A;  3IRQ A;  1LDJ A;  4MEY F;  3MWM A;  1Q1H A;  2P5L C;  5CVI A;  4L0Y B;  2CW0 F;  2ELH A;  5FB2 A;  2V6C A;  1IXR C;  3ECO A;  1LVA A;  2BGC A;  3DKW A;  2FML A;  4A12 A;  2ZKZ A;  4G7Z F;  4UVA A;  1BBY A;  1FLI A;  3M1E A;  3IHU A;  4FHT A;  3V8L A;  1GVJ A;  1CF7 A;  3GUD A;  3IWF A;  3K1M A;  4I09 A;  1YW7 A;  1W4M A;  2ZNY A;  1R58 A;  3E6M A;  3QU6 A;  5DCM B;  2V1U A;  3HRU A;  2PLY A;  4ZYH A;  1J75 A;  2HYG D;  4MTD A;  1ULY A;  4I0B A;  1OR7 A;  2BBY A;  3QU3 A;  3K0L A;  3E5U A;  1Y0U A;  3CJN A;  3KLN A;  2GZW A;  1XGO A;  3COA C;  3WGI A;  4N9H A;  3ISP A;  2EFW A;  2FEZ A;  4CYD A;  3EYY A;  3GLX A;  5KVR A;  4EJW A;  3F23 A;  1J2X A;  2NS0 A;  2QYO A;  1KA8 A;  1FZP B;  4EGZ A;  2RN7 A;  3RI4 A;  4IF4 A;  3WU0 A;  1SMY F;  1YTY A;  2VBY A;  4CXF A;  5E20 A;  2XRN A;  5E8I A;  4G7H F;  3VEP A;  1QNT A;  2LNB A;  5FFZ A;  3KFW X;  4P9U A;  1YW9 A;  5LGT A;  1ON2 A;  2STW A;  2ETH A;  1T2K A;  4WCG A;  1PDN C;  4N0B A;  2PQ8 A;  3K9T A;  1C0W A;  1KQ9 A;  1R00 A;  1G4D A;  4ON0 A;  4OU0 A;  2E1C A;  4GXO A;  2A69 F;  4I2O A;  4ETS A;  5CVV A;  5DEQ A;  2VC1 A;  4EV0 A;  2EFQ A;  4Q5S F;  4BHC A;  1MKM A;  1TLH B;  2K86 A;  2BV6 A;  3C7J A;  2IT0 A;  2OU2 A;  5BS6 A;  4HLX A;  1KGS A;  1T0F A;  1Z6T A;  2O61 A;  2JPB A;  4ZZD A;  1TW3 A;  4RAY A;  5FGM A;  1ZAO A;  4EVI A;  4BXU A;  4EJV A;  3KP6 A;  5J6X A;  3S2W A;  4A6D A;  2HFH A;  1XN7 A;  2M5W A;  1OPC A;  1U5T A;  3REO A;  2VC0 A;  2D1V A;  1D8K A;  3ZQ7 A;  2DU9 A;  2IA2 A;  1XSX A;  4U0W A;  1W5S A;  3MQ0 A;  3RKY A;  3U9G A;  2BYV E;  2XKO A;  1XGN A;  3SFZ A;  3GZ6 A;  3CO7 C;  4BH9 A;  1BC8 C;  2DK8 A;  5LGN A;  2MD5 A;  4JQF A;  4UVB A;  1TQI A;  2UWM A;  4WXH A;  3ZN0 A;  4BHB A;  3KP2 A;  2FBH A;  4QLC U;  2IW5 A;  5HDG A;  3AAF A;  1UFM A;  4MGR A;  3QAH A;  1S7O A;  4R8H A;  4UUV A;  2NRA C;  2K02 A;  5JR3 A;  4UV9 A;  1SD4 A;  1FWZ A;  2QZ8 A;  3RYR A;  3KLO A;  2E7X A;  1TBX A;  5K5R A;  2ZME B;  3C18 A;  2Z5U A;  4HX7 A;  4B09 A;  1Z7U A;  2HWV A;  1PUE E;  1MJ9 A;  1ZLK A;  1FY7 A;  4CIC A;  3GFM A;  3LQR A;  1HXD A;  4MQ9 F;  2A61 A;  4IPA A;  2RKH A;  2WC2 A;  3SQN A;  2GA1 A;  4PCQ A;  2IA0 A;  3FX3 A;  4UXN A;  2M30 A;  3T5X A;  2P8T A;  3DEU A;  1BC7 C;  3KP5 A;  4RGX A;  2FXA A;  2M87 A;  3HRS A;  1S29 A;  2LF8 A;  2J5O A;  5FFX A;  1OKR A;  1J0R A;  5FLX Z;  3LQQ A;  4GYI A;  2QQA A;  4FX0 A;  2W24 A;  3SHF A;  1ZAR A;  1I27 A;  3I59 B;  1H9T A;  1P92 A;  2B0L A;  1FSE A;  5D6E A;  1HSJ A;  1HKT A;  4LB6 B;  2OQG A;  3E97 A;  3F8M A;  2QBY A;  2A6H F;  4KYW A;  3VOD A;  1S8N A;  2R3S A;  2PEX A;  2P5K A;  1F9N A;  1BI0 A;  1UST A;  5BMZ A;  3BZ6 A;  4WK8 F;  3V4G A;  5ILS A;  3BJA A;  4L9J A;  3ZMD A;  1XMA A;  3DP7 A;  3R4K A;  5DD8 A;  1DPR A;  3K69 A;  2O0Y A;  1FNN A;  2OAZ A;  1WI9 A;  2QQ9 A;  2GWR A;  4IVN A;  4HLY A;  3E5Q A;  5E17 F;  1E17 A;  2R7D A;  4I7H A;  3MEX A;  3N97 A;  3RKX A;  2FE3 A;  4B8X A;  4KMF A;  4A0X A;  5LEJ A;  2W84 A;  2HZT A;  1FOK A;  3W6K B;  4XSX F;  3F3X A;  3GYH X;  2XAG A;  3R0J A;  2KIU A;  2VON A;  5CYV A;  4GGG A;  5K1Y A;  1ONV A;  3LAP A;  2DQL A;  3BOQ A;  3J7A O;  4OIP F;  2L02 A;  1J7K A;  4NB5 A;  2FBI A;  2HGC A;  1L0O C;  5IT3 A;  3BY6 A;  2HKX A;  2Q0O A;  1F5T A;  4LMY A;  3KP7 A;  2CG4 A;  3W6J B;  4ZYE A;  3FF5 A;  2F5F A;  1HKQ A;  1J5Y A;  2DW4 A;  1RUO A;  1D5V A;  1CGP A;  5D5U B;  1ZYR F;  3ABU A;  3WTZ A;  2VOO A;  4Y17 A;  3TOB A;  2H27 A;  2KJC A;  1TNS A;  4R1H A;  3IKV A;  3T0Y A;  1REP C;  1L3L A;  3RKW A;  1PP7 U;  1K78 B;  3GWZ A;  1ZG1 A;  5D5V B;  2A07 F;  2IJL A;  3F72 A;  2KIM A;  1SD7 A;  3R6S A;  4YIF A;  1R23 A;  4NQW A;  2EA2 A;  1YS6 A;  5F1R A;  5BPI A;  3T1B A;  1U3E M;  2A3S A;  4KUM A;  5IT9 Z;  2RC4 A;  1O7F A;  5A2Q Z;  4IRG A;  3U2R A;  4MHG A;  5DCF A;  2KRF A;  5D8K B;  4BNC A;  2UXN A;  5FD5 A;  2ISY A;  4AIK A;  2DTR A;  3CUO A;  1EV7 A;  1UHM A;  2ZFW A;  3SZP A;  2OZU A;  2CQK A;  3Q9V A;  1RNL A;  2CFX A;  2MH2 A;  4RB2 C;  3WTV C;  1EH7 A;  1T38 A;  4AD9 A;  4N9I A;  4I02 A;  1ON1 A;  2XHK A;  1G3T A;  1QO0 D;  4R79 A;  3GFJ A;  4HAM A;  4EM2 A;  1BM9 A;  1IRG A;  5F6F A;  3WE2 A;  1KQ8 A;  2C6Y A;  3BJ6 A;  5ICF A;  2LKP A;  2H09 A;  1FP2 A;  2EFP A;  3C1D A;  1B1B A;  2EJR A;  4JBA A;  2WV0 A;  3WOD F;  2XV4 S;  3J81 K;  3TQN A;  4M9X A;  4LJZ F;  5CLS A;  1EH6 A;  1S7A A;  1RI7 A;  5JHU A;  3HOT A;  5D4S A;  4LLN A;  2ZME A;  3GW2 A;  2XAF A;  1XDU A;  5DD4 A;  2IVM A;  5HS8 A;  3FHZ A;  1FX7 A;  5H6R A;  1ODD A;  1WSU A;  2DPD A;  4GO1 A;  5D4R A;  2F5D A;  4Q4Z F;  1WRJ A;  2STT A;  5DV5 A;  2XIG A;  1LNW A;  5JFR A;  3ZMZ A;  2JRT A;  3E6B A;  3NRV A;  1IN8 A;  3WTT C;  1H0M A;  5AON A;  1P2F A;  2D1H A;  1SFE A;  1T98 A;  4M72 A;  1WQ2 A;  4MQV A;  2RV8 A;  2E7W A;  1Z91 A;  1JGS A;  4QWQ A;  1QZZ A;  1FYK A;  5FO5 A;  4L18 B;  3JTG A;  4LG0 B;  4RGU A;  2L54 A;  1LEA A;  2K7L A;  5D5X B;  1IN4 A;  2UXX A;  3E6C C;  2CYY A;  4KN4 X;  3ZMV A;  1SAX A;  2QM3 A;  5BOX A;  3F21 A;  5L3C A;  2V1X A;  1H9G A;  2CO5 A;  3BDD A;  2JTV A;  2NYX A;  4HZF A;  1HW2 A;  3F8B A;  4A6E A;  3E5X A;  1G3Y A;  2X0L A;  1MGT A;  1FT9 A;  3V8J A;  4FT8 A;  3ML6 A;  3L2C A;  1V3F A;  3JSO A;  1JE8 A;  1QBJ A;  4OIR F;  4YFX F;  1WWX A;  1IZ1 A;  4KN7 X;  3FZV A;  3ELK A;  2HYF A;  4L5J A;  5E8G A;  5TJJ A;  3RDI A;  2VBZ A;  3F6V A;  1YYV A;  4ZYG A;  1HST A;  4L5I A;  1RIO H;  2E1N A;  3ZMS A;  5BPD A;  2ISZ A;  3I4P A;  3H3U A;  3QP6 A;  2XUB A;  1DUX C;  1BN5 A;  4HQM A;  1HBX G;  4CZZ A;  2D2W A;  2PMU A;  2V9V A;  4I98 B;  3GFL A;  1XGM A;  2P5V A;  4RB0 A;  5EEG A;  1SD5 A;  3H92 A;  2XAS A;  1XB4 A;  4XSZ F;  3RIR A;  4LFU A;  4LK1 F;  4MEX F;  4Y15 A;  2FQ3 A;  3R60 A;  5LEK A;  3M8F A;  2COM A;  5ERI A;  4M74 A;  4KNY A;  2W85 A;  3KZY A;  3KP3 A;  1USS A;  4HF2 A;  3D0S A;  3HOS A;  4G6D A;  3IRR A;  2CSO A;  3U1D A;  4YII A;  4HF0 A;  3LWF A;  3WGH A;  5L3D A;  3VB2 A;  4L0Z B;  2Z3Y A;  4G7O F;  2PBI A;  2K27 A;  3JW4 A;  3GEZ A;  3VOE A;  5ILU A;  5HS7 A;  1YS7 A;  4EM0 B;  3R61 A;  3GX4 X;  2FMY A;  2DFI A;  4BHP A;  1ZGA A;  4Y13 A;  3ZP5 A;  4AIJ A;  2RVC A;  4L9V A;  1IW7 F;  1ZG3 A;  2PG4 A;  4Z2Y A;  1FBS A;  1FBU A;  3DFG A;  2ZBK A;  1BI1 A;  1MJA A;  2YR2 A;  5D8L B;  3WE3 A;  3QPH A;  1OYW A;  3G3Z A;  3TGN A;  1D3Y A;  2K4J A;  4ENK A;  2L01 A;  4A5N A;  1KYZ A;  3KCC A;  4IJA A;  2NAZ A;  1IF1 A;  4MTE A;  2JT1 A;  4IRH A;  4XLN F;  4EMS A;  3VFZ A;  2YSR A;  2IRF G;  1I1S A;  1UHW A;  2DBB A;  1SFX A;  4O5V A;  2XKP A;  2FNA A;  1HQC A;  4LGW A;  3O3K A;  2DPU A;  2X4H A;  5HLG A;  3O6B B;  4U0Y A;  4PGH A;  3HYI A;  2MC3 A;  4A0Y A;  1GHC A;  1BIA A;  1K6O A;  2H94 A;  4XBF A;  1K79 A;  4YG2 F;  1XDS A;  2WWY A;  4WXC A;  4K2E A;  2FNP A;  3M9A A;  1R36 A;  1HKS A;  3FM5 A;  5TRD A;  2FOK A;  2IA1 A;  2ESH A;  2IPQ X;  5HDN A;  5IT9 K;  3JTH A;  4G8X A;  4CGZ A;  3DPL C;  3PQK A;  1IN5 A;  5BQT A;  3E6D A;  5F64 A;  4ENJ A;  2G7H A;  1WKM A;  2VOD A;  2EV6 A;  2DAO A;  2IP2 A;  2Z99 A;  1BI2 A;  3TO9 A;  3ZN1 A;  5LRS A;  1Z1D A;  4LG0 A;  4EJU A;  2MH9 A;  4OIQ F;  2F5C A;  3I58 A;  4WF2 A;  4CO8 A;  3M7G A;  4M6X A;  3TOA A;  2HDC A;  3BP8 A;  2QUF A;  3P9I A;  3QPT A;  2ZCW A;  2FA5 A;  1KYW A;  3HHH A;  2ZJ2 A;  2GXG A;  4A5M A;  4PDK A;  4WXD A;  3RPQ A;  3WGG A;  2XAJ A;  1STZ A;  4RB1 A;  1P4X A;  3LST A;  3TKY A;  5DYM A;  1LB2 A;  3R0A A;  4WX9 A;  1CF7 B;  1W7P A;  3CDH A;  5HLH A;  1FP1 D;  3J80 K;  3KEQ A;  4AIH A;  2PMH A;  3J81 Z;  2Y0M A;  2NNY A;  1P6R A;  4ASN A;  4XLP F;  2P6T A;  3OOP A;  4A2U A;  1GXP A;  4LD5 A;  2D45 A;  2UZK A;  1LDK B;  3HSE A;  2HQN A;  2OD5 A;  1DP7 P;  3TDZ C;  1V4R A;  3RYP A;  4HX8 A;  4HF1 A;  2A6E F;  1FC3 A;  2NNN A;  5HS9 A;  2HTJ A;  3KP4 A;  2OBP A;  1W5T A;  4HA8 A;  1AOY A;  4P96 A;  2H6B A;  3HUG A;  2A5Y B;  2ZXJ A;  3JAM Z;  1B9N A;  3Q9S A;  2M1B A;  3GFI A;  2ZNZ A;  1U78 A;  1XSV A;  3FXR A;  3MCZ A;  1SD6 A;  1KU2 A;  4LK0 F;  3ZMU A;  1AWC A;  2EK5 A;  4RGS A;  1BI3 A;  5LHI A;  1XMK A;  1O3Q A;  5E18 F;  1HW5 A;  5HLI A;  5L3F A;  2G7U A;  2MA3 A;  3V7C A;  3T8T A;  3ZPL A;  3ECH A;  2O3F A;  3D5L A;  5CVU A;  1I1G A;  3WU1 B;  3I5U A;  3PFI A;  1MJB A;  1T39 A;  2EFO A;  4EJT A;  2BEO A;  1KQ0 A;  3HIF A;  2QWW A;  3LA7 A;  1IAW A;  3RTR A;  4PGG A;  5KK1 A;  4UNO A;  3I53 A;  1TTY A;  4NHJ A;  4IXA A;  3BPX A;  3DPT A;  5E1X A;  2GXB A;  2JPC A;  1FBQ A;  4HV5 A;  3M8E A;  3N4M A;  1Z6R A;  1RZ4 A;  2F5E A;  3O2P E;  1ZRE A;  5DCM A;  5H6Q A;  4HBL A;  4OOI A;  3E3V A;  1KU7 A;  1QGP A;  4H0E A;  4YFN F;  1XD7 A;  2HQR A;  2VE8 A;  1MZB A;  3ZMT A;  1F4K A;  1RUN A;  3FXU A;  2QLZ A;  4RS8 A;  3SZT A;  5AIP A;  2PJP A;  2H6C A;  2L3D A;  2VN2 A;  2XAQ A;  1UCR A;  3GVA A;  4JK1 X;  4ZH4 F;  1YG2 A;  2EV0 A;  3CO6 C;  3V8K A;  3C3W A;  2KKO A;  4CHU A;  1JHF A;  2HS5 A;  3GXO A;  1T6S A;  5D5W B;  4L9T A;  1W7P D;  4O6J A;  1R22 A;  1DPU A;  3NQO A;  4BQA A;  5E1W A;  1Z9C A;  4YFK F;  4TV7 A;  4EM1 A;  5ICG A;  4ZYD A;  1I6X A;  1ZRF A;  3KET A;  4KFC A;  3CLO A;  4KIC A;  4UHT A;  3ROU A;  5J8C A;  3ERE D;  4RAZ A;  2PN6 A;  4HV6 A;  1S6L A;  2Y48 A;  1YO5 C;  2HEO A;  3IKT A;  3K1N A;  1D8J A;  2W25 A;  1A04 A;  5LLQ A;  3EUH A;  3P9C A;  1U2W A;  4ZZL A;  2CGP A;  1TQP A;  2GIV A;  2LDU A;  3F8F A;  3CTA A;  3WG9 A;  2FRH A;  3OV8 A;  2MLK A;  2DQR A;  1F1Z A;  3WTS C;  3FXQ A;  1IN6 A;  1OYY A;  2AXL A;  4HYE A;  5LHG A;  5L3G A;  2M45 A;  4ENN A;  5ED4 A;  4DNC A;  1LDD A;  3LAJ A;  3JAM K;  4IHS A;  2A68 F;  4OMZ A;  5ILV A;  3K1P A;  2VBX A;  1O57 A;  4CDG A;  2HR3 A;  2L4M A;  2DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...