2CSOA

Solution structure of the dep domain of human pleckstrin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
GSSGSSGRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Pleckstrin
publication title Solution structure of the DEP domain of human pleckstrin
rcsb
source organism Homo sapiens
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2csoA00
3SQNA 3E5UA 4QWQA 4ESJA 3D5LA 1U5TB 4N0BA 4P55A 1V3FA 3R61A 2FOKA 2PN6A 3ROUA 2L54A 1QNTA 2FNPA 4O6JA 4H0EA 3V7SA 2JPCA 4RB3C 3BP8A 1OYYA 2NYXA 5K1YA 2K86A 3GW2A 2YR2A 3FMQA 4HW0A 4KYWA 4HV6A 1WKMA 4BH9A 3LA3A 3TDZC 4IRGA 4M71A 1HW1A 2VC1A 4OMYA 2M5WA 3SFZA 4CICA 1UHMA 1ZH5A 2XHKA 3R0AA 1F1ZA 2ADUA 4GYGA 1IXRC 5F6FA 5EEGA 5HS9A 2FBIA 1XD7A 2ISZA 4HOBA 1HKSA 3QP6A 3QPHA 1XSDA 5BQTA 1YS6A 1OPCA 2JSCA 1Z6RA 1U5TA 3DPLC 2CSOA 2E1CA 5LBQA 1LDJA 1OYIA 4RGRA 3F6VA 3F8MA 1S3JA 3ZMUA 2UXXA 3CUQC 4OINF 3SXYA 2L3DA 2H27A 2J5PA 1R1UA 1IF1A 2NS0A 3R60A 2GQQA 1PDNC 4L9JA 3ABTA 5E1ZB 3K1MA 4D0PA 1SD4A 2VC0A 1F4KA 4RS8A 5LEJA 2D1HA 3WTZA 1FYLA 4EJWA 4I0AA 1JHFA 2QM3A 2XROA 3WTUC 3GFIA 5HVQC 5CYVA 3ISPA 4Q47A 1TW2A 1CF7B 4M73A 4WK8F 4KNYA 2W57A 1J9IA 1ZLJA 3RJPA 2G7HA 5DCFA 3P9KA 3HSRA 3GVAA 4L18B 3F72A 4P9FA 1U8RA 4ZZLA 1G4DA 3WTXC 2KKOA 2IA2A 1S29A 1QZYA 4JQFA 2VT3A 1G3SA 2HR3A 4L0ZB 5EEHA 1T98A 4HLXA 3LFKA 2P8TA 2IP2A 1KYZA 3GF2A 3CJNA 1U78A 4OIPF 1XSVA 4WF2A 1MJAA 1Z05A 1IN6A 2XAGA 1Q1HA 1QZZA 3D0SA 4ENNA 1HQCA 3B02A 1XGSA 2PBIA 4LK1F 4G7OF 2V79A 2RNJA 2BBYA 1RIOH 2EK5A 3GZ5A 1CF7A 1GVJA 4Q4ZF 4A12A 2DO7A 2IA1A 3ECHA 4P5OA 4U0VA 4MTEA 3R6SA 2QBYB 1LNWA 3Q9VA 4HBLA 3GZ6A 3I0TA 3DPTA 1DUXC 2HKOA 1E17A 4E70A 4EJVA 3WGHA 4A2UA 1S7AA 2RQPA 3WTWC 1XN7A 1RZ4A 5TRDA 1F9NA 2BV6A 2GXGA 4F7ZA 1YW9A 1R5HA 4I09A 3VODA 3KP2A 5LLQA 1LB2A 5HS8A 4WXCA 1BC7C 1K7AA 4GYIA 3TOBA 3WU0A 4OMZA 4HF1A 1BJAA 4EV0A 3ZMTA 1ZLKA 2P7CB 1B59A 5H20A 4RGSA 3T0YA 4HX7A 2VT2A 2E1NA 2PMUA 1L0OC 3TOAA 1XB4A 2RN7A 1FLIA 2XAJA 1BI1A 4BXUA 4Q48A 1TQIA 2V1XA 3IWFA 2JT1A 1FBSA 1YTYA 3ZMZA 4ENKA 1KQ8A 5ERIA 3FMRA 1X3UA 4BAYA 3GUDA 5LGNA 2FBHA 2VBXA 4I2OA 2COMA 2JPBA 5L3CA 5HDKA 4UV8A 1FWZA 1ZG3A 2CW0F 3H92A 3ULQB 2E7XA 3MAJA 1KU9A 1YYVA 1JHHA 2PMHA 2CGPA 1XDSA 1MJBA 1UB9A 2GA2A 4XLPF 2UWMA 3SZTA 2Z5UA 2MBFA 2EWNA 3IHUA 4R8HA 4HQEA 3H3UA 4OIOF 1U3EM 4O5VA 4KIFA 1XCBA 2P4WA 4RGXA 5AONA 1YO5C 3F21A 3Q9SA 1O3QA 2VE8A 3KLNA 3TO7A 1TW3A 2VOPA 4FHTA 4IHSA 1J0RA 3M1EA 2GWRA 2CQKA 3RKWA 4KFCA 3JSOA 1MDMB 4CO8A 3B73A 2GAUA 3QU3A 3KE2A 2Y48A 2DW4A 2J5OA 3PQJA 5DUKA 1I6XA 3IKTA 2GIVA 5LGUA 1I5ZA 2P5KA 4LLGF 2HS5A 2Z33A 2EV6A 2P7VB 1D8KA 4TV7A 3OV8A 4L5JA 2VONA 3K1PA 3M9AA 4YIIA 4EM2A 4BNCA 1FT9A 3J7AO 2EFOA 4Y13A 1FC3A 3LSTA 1C0WA 5D6FA 4AIHA 1J75A 1LEBA 1IXCA 1HW2A 2EA2A 5BMZA 1B6AA 1RNLA 2L01A 4LLLA 3L2CA 1MDMA 1ZRDA 1IRFA 1FBQA 2E7WA 1LQ1A 4O3MA 1YLFA 3RDIA 2V1UA 1O7LA 1ODDA 4KA4A 5DD4A 5BOXA 3CDHA 2G9WA 5JVTA 5J8CA 1R58A 3ZPLA 1OKRA 1K6OA 5D8LB 2RVCA 4UVAA 1WRJA 2HDCA 3KETA 2EFWA 4KT5C 3MZYA 2R3SA 2H6BA 4G7HF 1HKQA 2HQRA 3KEOA 1R1TA 2IT0A 1JE8A 3KP5A 4UNOA 3HRMA 2QZ8A 3MEXA 2K4JA 2ZFWA 2R7DA 4G9YA 3RKYA 1FSHA 1FPQA 3PQKA 1FP1D 1TBXA 5D5WB 4ENJA 5FD5A 1VTNC 2YSRA 2P5VA 1Y0UA 4IRIA 4L9NA 3RPQA 3CTAA 3CUOA 2ESHA 1S8NA 5F64A 3ZN1A 3CUQB 3BJAA 4LD5A 5D4RA 1MJ9A 1SD6A 3W6JB 3KFWX 1R22A 3M7GA 2UZKA 3C18A 1H9GA 2DI3A 2MD5A 3O3KA 5AIQA 1HXDA 2L4AA 3MFKA 3HOSA 1E2XA 1R36A 3GXOA 4MTDA 2LKPA 4BHCA 3HHGA 1LDDA 2CYYA 2F5FA 1BBYA 2GXBA 1LJ9A 2XV4S 4MGRA 5CVRA 5D5VB 1SAXA 1U2WA 2OU2A 3QU6A 3GO5A 5E8GA 3U2RA 4N9IA 3QOPA 1KQ0A 2AS5F 5D8KB 3K2ZA 1YG2A 2PFBA 3CUQA 1FP2A 1YS7A 2FMYA 3BJOA 2MC3A 2QWWA 3TO6A 1FZPB 2RDPA 1IN5A 2Z3YA 5CJ9A 2YX7A 4IHTA 3HTSB 5FO5A 2VOOA 1J5YA 1HSTA 1J2XA 2HFHA 4GCVA 2NNNA 1QPMA 4L0YB 2VBZA 2O3FA 3KP7A 5LHGA 4UVCA 3E6MA 1WWXA 4YIFA 4NQWA 4KUMA 2RC4A 1R5GA 3KZYA 1BIAA 2Q8KA 1XGOA 4U7DA 4A5MA 1BI0A 4CXFA 3N4MA 1JGSA 5DCMA 3I59A 4BHPA 4LMYA 3F8CA 2MH9A 3PFIA 2QLZA 3JTHA 1KU3A 3KP4A 2XKOA 2DPDA 2DQLA 4EVIA 4HLYA 2K02A 3I4PA 4UVBA 4G6QA 2FQ3A 2GA1A 5HLHA 3RPUA 2FEZA 2WV0A 1QO0D 5L3DA 1D8JA 4CYDA 4EJOA 2IPQX 2OBPA 1KQ9A 1SD5A 1Z91A 1ZYRF 2BEOA 3GFJA 2FBKA 1F5TA 1XGMA 1ZG5A 1TNSA 1USSA 2UXNA 2IJLA 4CGZA 1P6RA 3ZQ7A 4LB6B 2IW5A 3MQ0A 1I1GA 4M72A 1PP7U 1SFXA 5D5XB 4ESFA 3WU1B 1R23A 1S6LA 2JRTA 4N9HA 1K79A 4M9ZA 1EV7A 4AWXB 5CVJA 1GXPA 4HX8A 4PGHA 2Z9OA 3S2WA 3BDDA 1BI2A 2D1VA 3KLOA 2A6EF 4LFUA 4Y15A 4RB0A 4LG0B 1OYWA 1MKMA 2HGCA 3ZP5A 1HSJA 4UXNA 2Z99A 5E1WA 3LQRA 2V6CA 4BYYA 2OQRA 2XRNA 4EMSA 4ETSA 2DT5A 3ECOA 3R0JA 3G73A 1T38A 1J7KA 2VN2A 2ACJA 3ML6A 1TTYA 1RUNA 4KIGA 2IA0A 4HV5A 1ONVA 1ZRCA 5H6QA 3E97A 1IAWA 3IL2A 1BOAA 4WCGA 4A0YA 2MA3A 4HYEA 4EM0B 3HSEA 3K69A 1XDUA 4PDKA 3FWEA 4PCQA 2K4BA 1O3RA 3DFGA 4LG0A 4XSZF 4KICA 2FU4A 5JFRA 2L02A 1P4AA 1J59A 4ASNA 2NAZA 4IJAA 4GGGA 3EYYA 2V9VA 2W84A 3U1DA 1G6NA 1SD7A 5FFZA 4ZH4F 1KU2A 2BYVE 2LNBA 2QYOA 2FMLA 1Z7UA 4JK1X 1MGTA 4GXOA 4HDUA 3WE3A 2KJBA 2ISYA 3RYPA 4HZFA 5FB2A 1ULYA 1TLHB 2L4MA 2V1DA 3WTVC 1ZG1A 4KDPA 2XAFA 4IPAA 1H0MA 1HW5A 1FYKA 5TJJA 1QBJA 2QQ9A 2OD5A 2VE9A 4I02A 4Y17A 2OA4A 4ZYEA 5FLXK 1IZ1A 3V4GA 3O6BB 1QGPA 2Y0MA 1KYWA 1TQPA 3ZN0A 3TQNA 3HRUA 1R7JA 2CWEA 1EH6A 2O03A 1I1SA 4MHGA 3O2PE 2EFPA 4WX9A 1ON1A 3ELKA 2XKPA 3C7JA 2KIFA 5LRRA 1XCVA 2F5CA 3BZ6A 4HQMA 5BPDA 3CO7C 1FOKA 5IT9K 3I64A 3J80K 1YW8A 2A07F 3DF8A 2EFQA 5L3EA 3DP7A 3FM5A 5JI6A 2ZNZA 3L9FA 2MLGA 1PP8F 1ZREA 4IVNA 1Z1DA 1V4RA 2BGCA 1NHAA 1EH7A 1KGSA 4P96A 1W7PD 2YU3A 4S04A 2DLLA 2X4HA 2C6YA 2DBBA 4B8XA 1IUYA 3T8TA 3WTTC 4UHTA 3JTGA 2HKXA 1YFHA 5ICGA 3I5UA 1PUEE 1A04A 3CLOA 2ZNYA 3BPVA 4BQAA 3E5XA 4YFNF 2DPUA 4I7HA 4NHJA 3FM3A 1LEAA 3J81Z 1GXQA 5HLIA 5E17F 5D6EA 4U0YA 1WI9A 2RV8A 2PG4A 2PLYA 3VOEA 3BOQA 3AAFA 3E6BA 2KJCA 2O8XA 1B9MA 4ZZDA 2CO5A 4HF0A 2W25A 2ZBKA 2QUFA 5BPIA 4NB5A 3K1NA 5L3GA 3I71A 1P92A 2XGXA 5D4SA 5DYMA 4ZYHA 3ERED 3MZHA 5HLGA 1D5VA 2F2EA 5LHHA 4EQQA 6PAXA 3GFMA 2HZTA 2PEXA 1W7PB 3SZPA 3BJ6A 2MLKA 4B09A 2CG4A 5IT3A 3F8NA 3IWZA 3P9IA 2ZXJA 1HKTA 2LF8A 1WQ2A 1T2KA 3HTUA 2M45A 3HYIA 1Z9CA 4BHBA 4GO1A 3LAJA 4KMUX 2AXLA 4FX4A 3EETA 4EJUA 4MQVA 4HAMA 4CHUA 2G7UA 3EDPA 3DV8A 2ZMEA 5KVRA 4JBAA 2F5EA 2D45A 1IXSB 2A6HF 3WG9A 3R4KA 4L9VA 1SMTA 4S05A 5D5UB 2XAQA 2EFNA 4A0XA 1P4WA 5AIPA 4L9TA 1O7FA 3IKVA 1TNTA 4ESBA 1IN4A 3DKWA 3JAMK 1P2FA 3ABUA 1W7PA 1I27A 3GX4X 2A69F 4CDGA 4FT8A 3WTSC 5H6RA 1BI3A 3N97A 3DEUA 1DPRA 3Q5FA 3F8FA 3JW4A 4HF2A 4M6XA 3V8JA 3RTRA 4ENMA 2A3SA 5DCMB 3I59B 4LLNA 5LRSA 1R1VA 5ILVA 3F6OA 4I98B 3KP6A 3OOPA 3VB2A 1HBXG 3BY6A 3I53A 2QENA 3L00A 3NQOA 1SFUA 5HS7A 2VODA 2P6SA 2VXZA 4A0ZA 3U9GA 1K78B 5K5QA 1MD0A 4G94A 5JHUA 2PJPA 1CGPA 3QAHA 2HQNA 1IN8A 3DQVC 5FLXZ 5LEKA 5HOOA 3FMSA 5CVIA 2GZWA 1AOYA 3FXRA 3EQLF 3GLXA 5DV5A 3V7CA 3COAC 3BROA 1JXSA 1BM9A 3LAPA 2FA5A 3VEPA 1GHCA 4XRFA 3K9TA 4RGUA 5ICCA 4KMFA 2HOEA 4ZYDA 3F22A 2ESNA 4G6DA 2XIGA 1FX7A 3KP3A 3G3ZA 2XVCA 1XGNA 4IRHA 3NRVA 4U7BA 5ICEA 5IT9Z 1DP7P 4I0BA 4WXHA 3HIFA 3J80Z 2WC2A 3FX3A 4WWCA 1XMKA 2OZ6A 2PI0A 4P9UA 1T39A 2EA4A 1U5TC 2K27A 5CVUA 2XUBA 2DAOA 1K78A 5DUIA 1REPC 3WE2A 3HOTA 1S7OA 3T8RA 1IW7F 3V8LA 5J6XA 5J8FA 4IF4A 4G8XA 2OQGA 4PZJA 1UHWA 4XSXF 2FSWA 3HUGA 3J81K 3MCZA 2A68F 1FYMA 2OZUA 1KU7A 3HHHA 4KIBA 3FF5A 1FY7A 3F23A 3LQQA 4ON0A 2K7LA 1O3TA 3GEZA 2RKHA 2WTEA 2W85A 4DQ2A 2FNAA 3W6KB 1FNNA 2QQBA 2DK8A 3RI4A 1ZAOA 1O57A 2MH2A 5A2QZ 3MWMA 1EH8A 4MEYF 3T5XA 5FFXA 2HYFA 1TQMA 4MEXF 4AIKA 4R79A 2A61A 3E6CC 4EGYA 3FXQA 4IXAA 3TKYA 4PGGA 3KCCA 4RB1A 2CFXA 2STTA 5K5OA 1ZRFA 5KK1A 2EJRA 3RIRA 1ZHFA 3E3VA 5FD6A 4R1HA 2Q0OA 3LA7A 2O6GE 4HDVA 1G3YA 4KN7X 2STWA 2LSOA 1W4MA 3RYRA 3JSPA 3L7WA 4M9SA 2FF4A 3HRTA 4XBFA 3SHFA 1R00A 4A6EA 5DDGA 3HRSA 4HA8A 1BC8C 2DTRA 2RGVA 3DXJF 2DQRA 3GYHX 2QQAA 5DEQA 3RKXA 2JZYA 3BWGA 5LGTA 5L3BA 2M8EA 1RUOA 1LVAA 2W24A 3WGGA 1ZGJA 1O3SA 1DDNA 1D3YA 5E1XA 4OIRF 4WXDA 3I54A 5E8IA 2QBYA 3GWZA 3CO6C 1B1BA 2HTSA 4YG2F 3F8BA 2KRFA 4YFKF 1T0FA 2VBWA 4AVPA 1STZA 1U6GA 2YPRA 3JAMZ 2D2WA 1ON2A 3ZMDA 1BN5A 3NEUA 2O0YA 1B4AA 4A5NA 5DD8A 3M8EA 1W5SA 1DPUA 5HDGA 5CVVA 2P5LC 4I01A 4K2EA 3QRFF 2IVMA 2HYGD 2KIMA 5ED4A 3I58A 4LJZF 4L5IA 3EYIA 5ILSA 2QVOA 1H9TA 1LDKB 3TDUC 3FXUA 1KA8A 2LF7A 4KN4X 2P6TA 1WSUA 3EUHA 1P4XA 1MZBA 4LB5A 4AIJA 3H3ZA 3C3WA 1RI7A 3QP5A 2OAZA 1ZARA 3M8FA 3P9CA 2Y75A 4HX4A 2BE5F 1ZGAA 2FE3A 1Z6TA 1USTA 4LGWA 1L3LA 2FRHA 2ELHA 2TDXA 2ZKZA 4M6YA 3REOA 1W5TA 1BIBA 1UCRA 4M74A 5HDNA 4U88A 1YIOA 3LWFA 2H09A 1IN7A 4MQ9F 4XLNF 4AD9A 5K5RA 1OR7A 3LA2A 3HSFA 5ILUA 5BS6A 3IC7A 4DNCA 3T1BA 2KIUA 5L3FA 3WTYC 3K0LA 1SMYF 3P7NA 2EV5A 4RAYA 4RAZA 2M87A 2VBYA 3WGIA 4OOIA 5FGMA 5CLSA 4RB2C 5A2QK 1UFMA 1FBUA 4QLCU 5ICFA 2WWYA 2ZO4A 4A6DA 2FXAA 4ZYGA 4YFXF 3IRQA 1IRGA 3BPXA 2LDUA 3L09A 3WODF 4Q5SF 1G3WA 4OIQF 2R7FA 1SFEA 3VFZA 1FSEA 3KEQA 1T6SA 4M9XA 1B9NA 1XSXA 2HWVA 3F3XA 4MNUA 4EJTA 2ZMEB 2XASA 5E20A 2X0LA 2H94A 5F1RA 4EGZA 5LHIA 2HTJA 2NRAC 1XMAA 4U0WA 3E6DA 4OU0A 1YW7A 2DFIA 3V7RA 1G3TA 4Z2YA 5JR3A 3TGNA 2A5YB 4UUVA 2B0LA 3KZZA 2NNYA 2ETHA 3E5QA 2O61A 3IRRA 1OMIA 2Q2EA 3TO9A 1ZN2A 4FX0A 2M1BA 2DK5A 2DU9A 2XAHA 3QPTA 2IRFG 4CZZA 4EM1A 3ZMVA 5E18F 3C1DA 3V8KA 2EB7A 4LK0F 2EV0A 1AWCA 3ZMSA 2ZCWA 2F5DA 4G7ZF 2M30A 2YX4A 2HEOA 2ZJ2A 4UV9A 2PQ8A 3FZVA 2H6CA 3FHZA 3GFLA 1YQAA 1QQIA 2JTVA
chains in the Genus database with same CATH superfamily
5J40A 3SQNA 3E5UA 2VLAA 4QWQA 2HNHA 4XKVA 4ESJA 3D5LA 1U5TB 4N0BA 2XSDC 3LSKA 4P55A 1V3FA 4C2TA 3R61A 2FOKA 2PN6A 3TP3A 4BY1J 1MMSA 1WCMJ 2LR8A 3ROUA 5TISC 1G2HA 2HQ5A 2DFFA 2L54A 1QNTA 2FNPA 2W1OA 4O6JA 4CYCA 4H0EA 2BW3B 2GBYA 4IL6C 5EYRA 3V7SA 2JPCA 3UKGA 4RB3C 3BP8A 1OYYA 2NYXA 5FRMA 5K1YA 2K86A 1AKHA 3GW2A 2YR2A 2MG4A 2L9RA 3OS1A 3S15J 3FMQA 5IY5H 4A3MJ 4HW0A 2IS6A 5F04A 4KYWA 4HV6A 1WKMA 1PVEA 1Z7LA 3K4MA 4BH9A 3BG3A 3LA3A 3TDZC 1LE8B 2RNGA 4ZDOA 4IRGA 4M71A 1HW1A 2VC1A 4GDFA 2ZJPF 2M5WA 4OMYA 3SFZA 1FMWA 2DYRH 4CICA 1UHMA 1ZH5A 3OYKA 2X1DA 2XHKA 1A6IA 4RMNA 2M9HA 4B44A 3R0AA 2L5QA 1F1ZA 3HKZN 2ADUA 4GYGA 1IXRC 4XKBA 5F6FA 4CCLA 1JT0A 4BQNA 5EEGA 3HUGB 5HS9A 2FBIA 1XD7A 2ISZA 1AA7A 4HOBA 1HKSA 1EKEA 2JQ7A 3QP6A 3QPHA 1XSDA 5BQTA 1YS6A 1IDZA 1OPCA 2JSCA 1Z6RA 3RCOA 1U5TA 3DPLC 2CSOA 2L9SA 1LDJA 5LBQA 1OYIA 1FOWA 2E1CA 4ZTJA 4RGRA 2GXAA 1R9TJ 3F6VA 3F8MA 1VQ4I 1S3JA 4BS9A 2WAFA 3ZMUA 2UXXA 3CUQC 4OINF 3SXYA 2L3DA 2H27A 3AG3H 4FQGA 2W4SA 2EIMH 1JUMA 2J5PA 5DS9A 3PFYA 2BW3A 3QYFA 3WHCA 1R1UA 1PUFB 1IF1A 2M7BA 2GIZA 2CUFA 2NS0A 3R60A 1W0TA 1MSFC 2GQQA 5E3MA 2ELKA 2WAEA 2IS4A 2WADA 1PDNC 2JA8J 4L9JA 4A3EJ 2PJRB 2D5VA 2KFDA 3PUBA 2E35A 3ABTA 3OYBA 1XC5A 5E1ZB 3K1MA 3D5SC 3X2QH 4FE4A 4D0PA 1SD4A 3BLYA 2VC0A 1H89C 3G2BA 1F4KA 4RS8A 3D1NI 5LEJA 2D1HA 3WTZA 1JUPA 1FYLA 4EJWA 3ABLH 4I0AA 1ZGWA 2TRTA 1I39A 2XPWA 1JHFA 4XM3A 3H9JA 3W6VA 2QM3A 2XROA 4M3DA 2KISA 3WTUC 2CU7A 3GFIA 5HVQC 2HOAA 2ZFUA 1QPIA 2DDAA 1A36A 5CYVA 3V42A 3ISPA 1T56A 4Q47A 1TW2A 1M1EB 1CF7B 2V6EA 4M73A 4WK8F 4KNYA 2W57A 1J9IA 1ZLJA 3RJPA 2G7HA 5DCFA 2LREA 3P9KA 3HSRA 3LSRA 3GVAA 1ZKGA 4L18B 1JTXA 3F72A 4P9FA 1U8RA 1PUFA 4ZZLA 4A69C 4A3DJ 1G4DA 3WTXC 2KKOA 3B6AA 1YRNA 2IA2A 5GPAA 1S29A 4Y3OA 2X6WA 1SVMA 1QZYA 2VQHA 4JQFA 2PJRA 2VT3A 1RKWA 1G3SA 1Z21A 4C2MJ 2DCEA 2HR3A 5EEHA 3BC8A 3CCJI 3PSIA 4L0ZB 1T98A 4HLXA 2HVQA 4ABZA 1NG7A 3TL4X 3CCEI 3LFKA 2E19A 2P8TA 4IO9F 2IP2A 1OISA 1KYZA 3GF2A 3CJNA 1U78A 4OIPF 1XSVA 1IO2A 4WF2A 3OYDA 1MJAA 4B1RA 1FTZA 1Z05A 4XLEA 1IN6A 3A03A 4BDZA 2XAGA 3P5JA 1Q1HA 3ZQIA 1QZZA 2K9MA 3D0SA 4PFOA 3ERMA 4ENNA 4Y7NJ 1HQCA 3B02A 1XGSA 4CUGA 2FOWA 2PBIA 4LK1F 3CC4I 2OTLI 4G7OF 2V79A 2RNJA 3PSFA 2BBYA 1RIOH 1X19A 2EK5A 1WHUA 3GZ5A 4C30A 1CF7A 3CCLI 1GVJA 3BQZA 2XGEA 2QSFX 4Q4ZF 4A12A 2DO7A 2IA1A 3ECHA 1WPKA 4P5OA 4U0VA 3KX2A 4MTEA 2XRLA 4BJ5C 3R6SA 1VQ9I 2QBYB 3CDLA 1LNWA 4M3FA 5DM6F 4LG3A 2IBDA 3Q9VA 4HBLA 5TGTA 3GZ6A 4A3JJ 1HOMA 3ESWB 4AC0A 3I0TA 3DPTA 3WU2C 5FLVA 1DUXC 2HKOA 3H9GA 3HGYA 4CA0A 4E70A 4EJVA 1E17A 5M5WJ 3WGHA 4A2UA 4LITA 1HDDC 4NC6A 1BW5A 1S7AA 2DMTA 2RQPA 5E79C 3OYCA 3WTWC 2K85A 1XN7A 1HCRA 1RZ4A 5TRDA 4E7JA 1F9NA 2BV6A 2GXGA 3SYTA 4F7ZA 3RKQA 4HPQA 4RAGA 2XB0X 4L5EA 2W00A 1YW9A 1R5HA 4I09A 3VODA 2AHQA 4DYCA 3E7LA 3KP2A 5LLQA 1LB2A 1HLVA 4XNFA 3JRBA 5HS8A 4WXCA 2IGMA 1BC7C 3H5AA 1ETXA 4F52A 1RR7A 2XF7A 1K7AA 4B48A 1DU6A 2WY8Q 4GYIA 3TOBA 3WU0A 4OMZA 2K9SA 2OV7A 1POGA 4HF1A 1BJAA 4DZJA 4EV0A 2R4GA 4ZC3A 2X1CA 3ZMTA 1ZLKA 5FJ8J 2P7CB 2CUZA 1B59A 5H20A 4RGSA 2LKSA 1BW6A 3T0YA 4HX7A 4B43A 2VT2A 2E1NA 3IAS2 1JKPC 3NWTA 2KZGA 1L0OC 2PMUA 3TOAA 1XB4A 2LD5A 2RN7A 1FLIA 2XAJA 1W5CC 2LMDA 1BI1A 3OOUA 4BXUA 4Q48A 3RSNA 1TT0A 2HDWA 1TQIA 4KISA 2V1XA 3IWFA 2O8KA 2JT1A 1FBSA 1YTYA 3ZMZA 4XONA 4XQFA 4BXXJ 4ENKA 2CV0A 1KQ8A 5ERIA 5B66C 3FMRA 1X3UA 4BAYA 3GUDA 2OTJI 3VYTB 3HPGA 3CP2A 2OC6A 5LGNA 2FBHA 3FIWA 1ETQA 3TP0A 2VBXA 1R4NB 4I2OA 2COMA 2JPBA 5L3CA 2HPIA 5HDKA 3A01A 4UV8A 2R5YA 1FWZA 3K4CA 2BHZA 1ZG3A 3IV5A 1WH5A 2KQRA 3H5RA 2QKLB 2DFHA 2CW0F 3H92A 3OR1C 4DBQA 2NVQJ 3ULQB 3ZQGA 1UELB 1B8IB 2E7XA 4XKCA 2CQ7A 2F4OB 3M3YJ 2YS9A 3TW7A 3MAJA 1ORKA 1KU9A 1YYVA 1X4OA 1VQLI 3OS0A 1JHHA 3CCQI 3BR1A 3GTGJ 3GCMA 2PMHA 2CGPA 1XDSA 1MJBA 1V54H 3FBIB 1UB9A 2KHMA 2GA2A 4XLPF 1SFOJ 2UWMA 1V5FA 3BR6A 3G1LA 2H1LA 2R7QA 3GZNB 2V9KA 3MMYB 4IZZA 3SZTA 3BR0A 1YOVB 2Z5UA 1UJ8A 4XRSG 2MBFA 4F55A 2V7FA 2EWNA 3IHUA 2Z16A 4R8HA 4RLFA 4CCNA 3OYIA 4HQEA 3S3MA 3H3UA 4OIOF 1U3EM 2N8GA 4O5VA 4KIFA 1XCBA 2P4WA 4RGXA 5AONA 3DLLF 2A6TA 1YO5C 3F21A 1K6YA 3JREA 3HEFA 1VNDA 3BZCA 1ETYA 3DBHB 3Q9SA 4HNTA 1O3QA 2VE8A 3KLNA 3DTIA 3TO7A 1TW3A 2VOPA 4FHTA 4YIRX 4YELA 4IHSA 3AKZA 3TW6A 2VPRA 1HF0A 3JRGA 1J0RA 3M1EA 3LL7A 1W0UA 2GWRA 2VJIA 2CQKA 4RLQA 3RKWA 4KFCA 1U8BA 3C2HA 1UZCA 3JSOA 3S1RJ 1T95A 1LUJB 4B47A 4CO8A 1MDMB 3B73A 2GAUA 3QU3A 2R7ZJ 3HG9A 3KE2A 4LOCA 2Y48A 2DW4A 1PYVA 1UG0A 2J5OA 3PQJA 1MMNA 3VSKA 5DUKA 1I6XA 3IKTA 3DU6A 2GIVA 4BQOA 5LGUA 1I5ZA 2P5KA 1FMVA 4LLGF 1APLC 3ZR8X 2HS5A 3GTLJ 2Z33A 2EV6A 1Z67A 3HXLA 2DOEA 5EGOB 5JHFA 2P7VB 1D8KA 4TV7A 3OV8A 2JRMA 4L5JA 4BJ6C 2O5RA 3OWTA 2Q2EB 2VONA 5J1UA 3K1PA 3L2UA 3M9AA 4YIIA 4EM2A 2NOGA 3SEZA 3HOVJ 4X6AJ 2BHYA 4BNCA 3CJRB 1IV6A 1FT9A 4QIWN 2B63J 1XG1A 3J7AO 2JA7J 2EFOA 4Y13A 1FC3A 2HYJA 3LSTA 3ZGKA 1C0WA 5D6FA 4AIHA 5LFAA 3K4BA 1J75A 1LEBA 1XX5A 1IXCA 1HW2A 2EA2A 5BMZA 1B6AA 4CCMA 3CC2I 2CQQA 2P81A 4D7NA 1RNLA 1YJ9I 4Y4RA 2JJ7A 1ZK8A 2L01A 4LLLA 1B72B 1Z0XA 4A3GJ 1OLTA 2XPUA 3L2CA 3BQYA 1MDMA 1ZRDA 1IRFA 1FBQA 4YEJA 2VL8A 2E7WA 1K83J 1LQ1A 4O3MA 1WZ2A 1BR2A 1YLFA 2DA4A 4J01A 3RDIA 3L2RA 2V1UA 2JA6J 1MBGA 2COBA 1O7LA 1JGGA 1X2MA 1ODDA 4KA4A 1OCZH 2VI6A 3CDHA 2X48A 5DD4A 2G9WA 5JVTA 5BOXA 3K4LA 3FK7A 5J8CA 3H0DA 1R58A 3L1PA 3H3VK 1W1WE 3ZPLA 1RPWA 1OKRA 3K7AJ 1XPXA 1K6OA 3VSLA 4IX7A 5D8LB 2RVCA 5EGOA 1JI8A 5B1AH 3S1NJ 3OL4A 4UVAA 1WRJA 1AU7A 2HDCA 1Z3XA 3KETA 2EFWA 4KT5C 3W3CA 3MZYA 3OYFA 2R3SA 9ANTA 2H6BA 1HKQA 1N75A 2HQRA 2IGNA 3KEOA 4C3HJ 1R1TA 4G7HF 2OUMA 1JJ6C 2IT0A 1JE8A 4UUSB 3RPUD 3BR5A 4E7ZA 2IGOA 3KP5A 1WGXA 4UNOA 3HRMA 2K5CA 3HPHA 2QZ8A 3PO3J 1MH3A 4CYCB 1OCRH 3H0GJ 3ZQLA 3S3OA 3MEXA 4N4OB 2K4JA 1KONA 2ZFWA 1B72A 3ZCOA 2R7DA 4G9YA 1AKHB 3G4SI 3RKYA 1FSHA 1FPQA 3PQKA 1FP1D 4HSRA 4X0GA 1TBXA 5D5WB 2UUZA 4ENJA 3A02A 3KZIC 4AYBN 4XICA 3OYHA 3A2KA 5FD5A 1VTNC 2YSRA 2P5VA 2ZSHB 1SC7A 1Y0UA 4IKFA 4IRIA 4L9NA 3RPQA 3CTAA 3I4MJ 3CUOA 3ABMH 2ESHA 2E34A 1S8NA 3BTLA 1X4PA 5F64A 2K9QA 3ZN1A 1XTAA 5M3MJ 3CUQB 3BJAA 3GLLA 4LD5A 5D4RA 2AO9A 3K70C 1MJ9A 1SD6A 4PSWA 4BE1A 3W6JB 4AUXA 3KFWX 2R7RA 1R22A 3M7GA 2UZKA 3C18A 1H9GA 2DI3A 3FXMA 3S14J 1OCCH 2MD5A 3O3KA 1P7IA 1SAUA 5AIQA 2VKDA 1WJEA 1HXDA 4N4NB 2L4AA 3CCUI 4UUSA 3MFKA 3I56I 4D7MA 3HOSA 1E2XA 3PO2J 1R36A 3K4KA 2BY2A 3GXOA 4MTDA 1H88C 2LKPA 1RKTA 4BEHA 4NQWB 4BHCA 5B5EC 3HHGA 4FASD 1LDDA 4X1EA 1BR4A 2CYYA 4BBRJ 2F6CA 2F5FA 2QKMB 1BBYA 1S9HA 5C4JJ 2GXBA 1O4XA 3BTJA 1LJ9A 2NXNB 4XN3A 2XV4S 4MGRA 4HNVA 5CVRA 5D5VB 1SAXA 1LPQA 3TMOA 1U0JA 2L7FP 4M3BA 1H8AC 1U2WA 2CW7A 2OU2A 3BG9A 3AG4H 3S2HJ 4A93J 4ITVA 3QU6A 3GO5A 2ZJQF 5E8GA 1K4SA 3U2RA 4N9IA 3QOPA 2DA2A 5KAIC 1KQ0A 2AS5F 5D8KB 2E5NA 3K2ZA 1YG2A 2GOXB 3ZOBA 5EZHA 2PFBA 3FDYA 3FXOA 4XRSA 3CUQA 1FP2A 1YS7A 2FMYA 3BJOA 2LH9A 4XLAA 4GRIA 2R7VA 2MC3A 2QWWA 1WH7A 3TO6A 1FZPB 2RDPA 3HOXJ 1IN5A 1K4TA 4BJTA 4OAZA 3W2WA 1E3HA 3HDDA 2Z3YA 5CJ9A 2YX7A 4IHTA 2E2JJ 3HTSB 5FO5A 2VOOA 3K4JA 3RZOJ 1J5YA 1HSTA 2EINH 4XL9A 2QGUA 1J2XA 3GTMJ 2HFHA 4GCVA 2NNNA 2VJ5A 1QPMA 2DT7B 2R7WA 4IHVA 4L0YB 2VBZA 2LRDA 2O3FA 3KP7A 5LHGA 5FKLA 4UVCA 3E6MA 3JRAA 1WWXA 4YIFA 1FOYA 4NQWA 2E71A 4DBRA 1MSEC 3IUOA 4KUMA 2RC4A 1R5GA 3KZYA 1BIAA 2Q8KA 2I10A 1QHHD 3CZ6A 4YRVA 3BCAA 1XGOA 3JCUC 3W2AA 4U7DA 2W82A 4A5MA 1BI0A 3LSPA 3MKYB 4CXFA 1YRNB 1JGSA 1R6RA 3N4MA 5DCMA 3I59A 4BHPA 3HC7A 1NG6A 4LMYA 3S1MJ 1VQ5I 1A5JA 3H9QA 5JVGF 3F8CA 1Y8RB 3UNGC 2MH9A 1SFKA 3PFIA 2QLZA 3JTHA 1KU3A 5IOZA 3KP4A 2M0MA 4BUPA 4QSHA 2XKOA 5KAFC 2DPDA 2DQLA 4EVIA 4HLYA 2HZDA 1G59A 2K02A 3I4PA 4UVBA 1X1AA 2CW8A 4G6QA 2FQ3A 2GA1A 2Z1DA 1IRXA 2VB6A 3L2WA 4BE0A 4BU2A 5HLHA 3RPUA 2FEZA 2WV0A 3ONQA 4E7SA 4AM3A 4JYKA 1QO0D 5L3DA 5KCMA 1D0ZA 1D1BA 1D8JA 2ID6A 2E1OA 2HI3A 3AFHA 4CYDA 1TWAJ 4EJOA 2IPQX 1VQ7I 3HOZJ 1YX5A 2OBPA 2E2IJ 3DCFA 3NAUA 2KZVA 1A31A 1KQ9A 4MIMA 1SD5A 1Z91A 1ZYRF 2DOFA 2EZLA 2OCCH 3HJEA 2BEOA 3GFJA 2R7TA 5GP9A 2FBKA 3CLQA 3JRDA 1ZR2A 1F5TA 1XGMA 3HZJA 2EPFA 1ETKA 1ZG5A 1TNSA 5K7ZA 2JUCA 3A1YA 1USSA 2DT6A 2UXNA 2IJLA 2IAIA 4XOTA 4CGZA 1P6RA 4ZDPA 3ZQ7A 3JRIA 4LB6B 5IP7J 2IW5A 3MQ0A 3O8GA 1I1GA 4M72A 2ZC2A 3M8JA 4XN0A 3D5RC 1PP7U 1SFXA 5D5XB 1JJ8C 4ESFA 3WU1B 5FKMA 3PL8A 1R23A 1S6LA 4UB8C 2R92J 2JRTA 2BVLA 4N9HA 2KT0A 1K79A 4M9ZA 1EV7A 4AWXB 3OYNA 2ZXWH 5CVJA 3LFUA 1GXPA 4HX8A 4PGHA 1GVDA 2Z9OA 5CQEA 3S2WA 3EUAA 3BDDA 4ZTFA 1BI2A 2D1VA 3MN2A 3KLOA 2A6EF 2MW8A 4LFUA 4Y15A 1RESA 1J09A 4RB0A 5IYCJ 3S32A 4LG0B 1OYWA 4P1WA 1MKMA 3DTEA 2E5ZA 2HGCA 3ZP5A 1HSJA 2CUJA 4E7KA 4UXNA 1MMGA 2Z99A 5E1WA 3LQRA 2V6CA 4BYYA 2M34A 2OQRA 2XRNA 1WJ5A 4EMSA 2KIQA 4ETSA 3Q0VA 4CCKA 2DT5A 3ECOA 3R0JA 1S7EA 3G73A 1T38A 2VJ4A 2ZXHA 1A35A 3S93A 2K3PA 4EATA 1J7KA 2ME6A 1X3WB 3HOWJ 2VN2A 2ACJA 3ML6A 1DU0A 1TTYA 5C4XJ 1ACIA 3LMMA 1RUNA 3GTQJ 2ME0A 4KIGA 5BNGA 2IA0A 4HV5A 2IS1A 2R7UA 3IH4A 4PJJA 4JX4A 1E3PA 1UAAA 4CSWA 3S2DJ 1ONVA 5EF6A 1ZRCA 2QSHX 5H6QA 2QF7A 2MABA 2LVSA 3E97A 2K3FA 5M5XJ 1IAWA 3BR2A 2DN0A 2BY1A 3IL2A 3S1QJ 1BOAA 4WCGA 4PK4A 2MA3A 4HYEA 4A0YA 4DIQA 4EM0B 1BJZA 3HSEA 3A01B 3S3NA 2LBFB 2R5YB 3K69A 3HL2A 1XDUA 4PDKA 3OSGA 3FWEA 4PCQA 2K4BA 1MW7A 3OSFA 1FOXA 2OF7A 1O3RA 3DFGA 2Y30A 1YX3A 4LG0A 4XSZF 4KICA 1VZ0A 2KDZA 2MSYA 2HQAA 3DKXA 2FU4A 5JFRA 1F36A 2L02A 1P4AA 4JP0A 1J59A 4ASNA 2NAZA 4IJAA 4GGGA 3EYYA 2V9VA 2W84A 3U1DA 3JR9A 2EH3A 2E2HJ 1BOBA 3J7ZI 1G6NA 1SD7A 1ETVA 5FFZA 4AVZA 1TL8A 3DBRB 3I3LA 4ZH4F 1IRZA 2BYVE 1KU2A 2LNBA 2JVHA 3FXLA 2QYOA 2FMLA 4J00A 1JTYA 1Z7UA 4JOMA 1LFPA 2LFBA 1JUSA 4JK1X 2I8DA 2X51A 1MGTA 2XF6A 4GXOA 3BG7A 3CCSI 3WE3A 3BG5A 4HDUA 1N77A 4AYBA 1WJAA 3Q3SA 3S8PA 2KJBA 3UR3C 2HOTA 2ISYA 2LBFA 3RYPA 3BZKA 2DMPA 2F48A 4HZFA 5FB2A 1X2NA 1FEXA 1ULYA 2Z2SB 1TWCJ 1TLHB 2L4MA 2V1DA 2E60A 3WTVC 1ZG1A 2XAFA 4KDPA 3W2VA 3PUFA 4IPAA 1HW5A 1YIJI 2WB1N 1H0MA 5TJJA 1FYKA 1QBJA 2QQ9A 5FKNA 3OYAA 3GTJJ 3KEYA 1FTTA 2OD5A 5FLMJ 2VE9A 4I02A 3VYUB 3SJMA 4Y17A 3MZ8A 3OYLA 2OA4A 4HRIA 4ZYEA 5FLXK 3FKIJ 1IZ1A 3V4GA 3I55I 1SVLA 3O8HA 2XB5A 1OQYA 3O6BB 4I76A 4A3BJ 1QGPA 2Y0MA 1KYWA 1TQPA 3DU5A 4RAFA 3ZN0A 1MNDA 3TQNA 1GT0C 3HRUA 1R7JA 1T0FC 5IP6A 2CWEA 1F43A 3SZGA 1MBKA 2VJJA 3IP4B 1EH6A 2O03A 2KRHA 3C2BA 3CF5F 2VKVA 1QVUA 1WJDA 4I6ZA 1EF4A 3ABKH 4E6KG 3K70D 2RQQA 4PJNA 1I1SA 1T33A 4MHGA 3O2PE 1GUUA 2H8WA 2EFPA 2DJIA 2A05A 1Q1VA 4WX9A 1R71A 1ON1A 3ELKA 3K2AA 2XKPA 3C7JA 4HNUA 3N05A 2KIFA 2M4KA 4D1QA 1SVOA 3CP8A 1U9OA 2FX0A 4RM3A 5LRRA 4S0HB 1XCVA 2F5CA 3BZ6A 4HQMA 3OIOA 3CO7C 5BPDA 1FOKA 2VUMJ 1ZELA 5F1JA 5IT9K 1Y56A 1QZEA 3I64A 4KITB 3J80K 4LIVA 1YW8A 4F92B 2A07F 3OYMA 2YU9J 3H35A 3BTCA 3DF8A 3CCMI 4E7IA 3FK6A 3KPHA 2EFQA 3EUHC 2CV2A 5L3EA 2MYSA 3DP7A 4M6VA 3FM5A 5JI6A 2ZNZA 3L9FA 2MLGA 2LLKA 1PP8F 1ZREA 5B3SH 2JN6A 3OIPA 4IVNA 1Z1DA 1V4RA 2BGCA 1NHAA 1EH7A 1GV5A 4IHXA 1KGSA 4P96A 1W7PD 2YU3A 4S04A 2R93J 3CQZJ 1GLNA 2DLLA 2LTPA 2X4HA 2C6YA 5FROA 2DMQA 4D5FA 3ZQFA 2DBBA 2NVXJ 1WJFA 4B8XA 1VFCA 1IUYA 3T8TA 2VPLA 4RDUA 1MIJA 3WTTC 3OR2C 1VQKI 4UHTA 4DW6A 3JTGA 2DA3A 4BDYA 3U1KA 1VQOI 2HKXA 1WI3A 3G1MA 4U87A 1YFHA 5ICGA 1YITI 1X3ZB 3DWLE 3I5UA 5J3LA 4F91B 5H2FC 5FRNA 1OCPA 3DLAA 1PUEE 1A04A 3PM1A 2K9NA 3CLOA 2ZNYA 4HG2A 1BR1A 3BPVA 1FJLA 4BQAA 5GADJ 3E5XA 4YFNF 3OS2A 3TBIA 4DOZA 5KHDA 2DPUA 4I7HA 1OR7C 4NHJA 3H1CA 4V2GA 3FM3A 4ANJA 4V19K 1GV2A 1LEAA 1DGRM 3J81Z 4DYQA 2L0KA 3HGGA 2FJ1A 5J47A 1GXQA 5HLIA 2QSGX 1MH4A 1JKRC 5E17F 5D6EA 4U0YA 1JT6A 4CH7A 1WI9A 2RV8A 4NC7A 2FD5A 5KNLA 2PG4A 2PLYA 3VOEA 2E36A 3BOQA 3VPRA 3AAFA 3E6BA 2NVUB 1QHGA 4HEA2 2KJCA 2O8XA 2GLOA 1B9MA 3G71I 4ZZDA 2CO5A 4HF0A 2W25A 2ZBKA 2QUFA 5BPIA 4NB5A 5IP9J 3K1NA 5L3GA 2EIKH 1NK2P 3AL0C 3A0BC 2MFZA 3I71A 2BZTA 1ZR4A 1P92A 3NARA 2XGXA 3F0CA 2WV1A 2DA7A 3LSJA 5D4SA 5DYMA 4ZYHA 4D9JA 3FXJA 2KRCA 5F0FA 5EJCA 5LD2C 3L2QA 3ERED 3MZHA 5HLGA 1DGWY 1D5VA 3I9V2 2VKHA 4MFDA 3U21A 4E7LA 2F2EA 4LIUA 3KIOA 5LHHA 2GOMA 4EQQA 4UY8I 1DP3A 6PAXA 2B7EA 3GFMA 1U9NA 2HZTA 4QPOA 2VIXA 3CMEI 1ETOA 2PEXA 1W7PB 1MBFA 4BEHB 4BL0B 3DTKA 3SZPA 4FTHA 4OAYA 3PNTA 4C3IJ 3BJ6A 5J1RA 1MMAA 2MLKA 2BY0A 4B09A 3QOEA 4G6TB 2CG4A 5JLWA 5IT3A 3F8NA 1FIAA 3IWZA 5M5YJ 3P9IA 2ZXJA 3BTIA 1HKTA 2DOAA 5EG0A 2LF8A 1WQ2A 1T2KA 3HTUA 5IYBJ 2M45A 3HYIA 2L9VA 1Z9CA 1E0EA 1V55H 4RA2A 4BHBA 1TWGJ 2M3AA 1NTCA 1IV8A 4GO1A 5GAHJ 3VWBA 3LAJA 3GMEA 5JLXA 2DFEA 2AXLA 2FQ4A 4KMUX 2LY9A 4FX4A 3EETA 2KLOA 4EJUA 3QPLA 4DYRA 4MQVA 4HAMA 4CHUA 2G7UA 1Y1VJ 3EDPA 3DV8A 2ZMEA 2EZIA 1P9QC 2E1MC 2LOOA 2M2EA 3CMMA 5KVRA 4JBAA 4QPQA 2F5EA 4NUBA 2F5VA 1W36C 2D45A 1IXSB 2L7MP 2A6HF 5E3LA 3R4KA 3WG9A 2M7AA 2CFOA 4L9VA 2P0WA 1SMTA 4S05A 2QA4I 5D5UB 2XAQA 3KYDB 2NS8A 2EFNA 4A0XA 1P4WA 5AIPA 3CCVI 4IOCF 4L9TA 3HM5A 2HVSA 3DEWA 1MBEA 4HSTA 1O7FA 3IKVA 2Y0SN 4RM2A 1TNTA 4C3JJ 4ESBA 1QU3A 3IAM2 3ZRGA 1IN4A 4XLHA 4MFEA 3DKWA 4KJZA 1P2FA 3ABUA 2A5WA 2ZMEC 5F08A 1W7PA 4NNJA 2XSJC 1I27A 3GX4X 1IJWC 2YUSA 2A69F 4PFPA 3RQIA 4CDGA 5HNHA 3ZQHA 4FT8A 3J7YJ 3WTSC 5H6RA 1BI3A 3N97A 3DEUA 1DPRA 3Q5FA 3CF2A 3F8FA 3JW4A 4HF2A 4M6XA 3V8JA 3RTRA 4ENMA 2A3SA 5DCMB 3QPSA 3I59B 4LLNA 3A4CA 5LRSA 1R1VA 1YHQI 5ILVA 1N78A 3F6OA 2XGCA 4RBOA 4I98B 3KP6A 2TCTA 2DJNA 3OOPA 3VB2A 1HBXG 3BY6A 2K9LA 3MKLA 1RETA 3I53A 2CMPA 2QENA 3L00A 2DA6A 2L7ZA 2LKXA 1OCOH 3NQOA 1WFXA 2ICWG 1X1PA 2DYSH 1SFUA 2JA2A 2XGDA 5HS7A 1VQ6I 2VODA 2P6SA 2M0CA 2VXZA 2ZXIA 4ZDLA 3OMYA 2FUG2 3U9GA 4A0ZA 2G0EA 1K78B 5K5QA 1MD0A 4G94A 1T8IA 2W7NA 5JHUA 2PJPA 3MD2A 1CGPA 3QAHA 2HQNA 1IN8A 3DQVC 2KMUA 4B3XA 5FLXZ 5LEKA 3LNQA 2DA5A 5HOOA 2ZJRF 3FMSA 4PSXA 5CVIA 3A0HC 2ID3A 2CQNA 2GZWA 5J4YA 2KPMA 2IEKA 3FXRA 1AOYA 1BA5A 5E3OA 4A3KJ 3LSHA 1IG7A 3EQLF 3GLXA 5DV5A 3V7CA 5F0HA 2LY1A 1UMQA 2IGKA 3COAC 2H1KA 3SEQA 2GM4A 3BROA 2Q1ZB 1JXSA 2V26A 1BM9A 3FISA 3LAPA 1ENHA 2FA5A 3VEPA 2PMZA 2WB1A 1GHCA 3DBLB 4XRFA 3K9TA 4RGUA 5ICCA 4OWRB 4KMFA 1I3AA 2CJJA 2HOEA 2V1NA 1ETWA 2NOJB 1I3QJ 2DODA 4MLOA 4ZYDA 4PJ0C 3F22A 2CV1A 2ESNA 4G6DA 3PIPF 5EDNA 2XIGA 1FX7A 3KP3A 3G3ZA 3ZXSA 1T08B 2XVCA 4W97A 1XGNA 3ZQCA 4IRHA 3NRVA 4U7BA 5ICEA 5IT9Z 1DP7P 4I0BA 4WXHA 3HIFA 3J80Z 3QQAA 2Y9ZA 2WC2A 1YI2I 3FX3A 4WWCA 1XMKA 2OZ6A 2PI0A 4P9UA 1T39A 2EA4A 1MNMC 1D0YA 1U5TC 5DM7F 2K27A 5CVUA 2XUBA 2DAOA 4E7HA 1K78A 5DUIA 1LE8A 1REPC 4FETA 3WE2A 2WY7Q 3HOTA 4II2A 1S7OA 4UB6C 3T8RA 1VQPI 1IW7F 2WBMA 3H5NA 3M07A 2ZSIB 3V8LA 5J6XA 5J8FA 4IF4A 1ZQ3P 1VQ8I 4BBSJ 4H4KC 4G8XA 2QQ8A 3OIQA 1OJLA 2OQGA 4PZJA 3EPZA 1UHWA 4XSXF 2FSWA 2HOSA 3HUGA 3J81K 1S5LC 3MCZA 3KYCB 3JRCA 2A68F 1FYMA 2OZUA 3FXKA 1KU7A 3HHHA 4KIBA 3HOYJ 3FF5A 1FY7A 3F23A 3LQQA 2KP6A 4ON0A 2K7LA 2VKEA 2QEXI 1O3TA 1YJNI 3G6EI 3GEZA 1V5GA 2RKHA 2X6YA 1UG2A 2F4MB 2WTEA 2W85A 4DQ2A 4M3EA 2FNAA 3HB9A 3W6KB 1I6HJ 1FNNA 2V9PA 1D1CA 2XC7A 3PIOF 2QQBA 1X58A 2DK8A 3RI4A 1ZAOA 1E3OC 1O57A 2JWTA 2MH2A 2LG4A 5A2QZ 1MBJA 2EILH 1PJRA 3MWMA 1EH8A 4MEYF 1QRYA 5K7FA 4XLFA 1D5YA 1R4MB 4PJMA 3T5XA 5EEAA 1R5ID 5FFXA 3KYLA 2HYFA 1TQMA 4MEXF 4AIKA 4Y52J 2WAQA 4R79A 3F9KA 3MKZA 2A61A 3E6CC 4EGYA 3HOUJ 5IYDJ 5J1YA 1I50J 4XLCA 3FXQA 2I5UA 2KL4A 2W48A 1X1CA 1R49A 3OYGA 2L9NA 2IXSA 3PNVA 3CCYA 2PX9A 3EUKL 4IXAA 3CJQB 4J19A 3TKYA 4PGGA 4XORA 3PNYA 3KCCA 2X1EA 4RB1A 3WHBA 1SANA 2DXIA 2CFXA 2STTA 2R0QC 2MD0A 1D1AA 2Y9YA 5K5OA 3S17J 1ZRFA 2BY3A 2EJRA 5KK1A 3RIRA 1ZHFA 3E3VA 5FD6A 4Z6YA 2R7XA 4R1HA 2Q0OA 3SDGA 3LA7A 2O6GE 2NVYJ 4D5CA 4HDVA 1D0XA 1G3YA 1YE9A 3WG7H 4KN7X 2STWA 2LSOA 1W4MA 1UHSA 1Z77A 4G12A 2UV1A 2CS3A 4V2FA 3RYRA 3JSPA 3L7WA 3QYEA 4M9SA 2FF4A 3HRTA 4XBFA 3SHFA 4XIDA 1R00A 1AHDP 2DA1A 4A6EA 2Y31A 4A3LJ 5DDGA 2VQLA 3HRSA 3MVPA 4DGWB 4HA8A 3CESA 1BC8C 2EZHA 2LC2A 2DTRA 2RGVA 1XMXA 1LVKA 3E1SA 3DXJF 1BL0A 2DQRA 3LSIA 1MMDA 1DQUA 3GYHX 5HLTA 2QQAA 5DEQA 3RKXA 2JZYA 3BWGA 3QWLA 4KT6A 5LGTA 1Y6IA 5L3BA 2Y69H 3H36A 2JMWA 3DPUA 4BACA 2LP0A 2HPMA 2M8EA 2CRGA 3OY9A 1RUOA 1LVAA 4CZCA 2W24A 1VQNI 4BKXA 4JX5A 2DDBA 3WGGA 1ZGJA 2EBIA 1O3SA 1DDNA 4Y33A 1D3YA 2BOLA 5E1XA 4OIRF 4DJAA 4A3IJ 3CDIA 4WXDA 4FISA 3I54A 1LKXA 5E8IA 2QBYA 2NVTJ 3GWZA 2XF5A 1B1BA 3JRHA 2HTSA 3CO6C 1QVTA 2IS2A 4BGDA 4YG2F 1TC3C 1VQMI 3F8BA 2KRFA 4IOAF 3ASOH 4YFKF 1T0FA 3L2VA 2X6OA 2VBWA 5C3EJ 2JK3A 2VQCA 4AVPA 1STZA 3RQ4A 1U6GA 2ECBA 2YPRA 3JAMZ 2PMZN 1FIPA 2D2WA 1ON2A 3AG1H 1X1DA 3ZMDA 1BN5A 2LY2A 2H8RA 3NEUA 2O0YA 1B4AA 4A5NA 1IC8A 5DD8A 2X85A 3M8EA 2EIJH 1W5SA 4ZJZA 1DPUA 5HDGA 5F0CA 2O9LA 5CVVA 3M1CA 2P5LC 4PJLA 4I01A 4E4HA 3JRFA 4K2EA 5E3NA 3QRFF 2IVMA 2HYGD 2KIMA 4XK4A 4XR6A 5ED4A 5M3FJ 3I58A 4LJZF 2JUGA 4L5IA 1ITYA 2X6XA 3EYIA 3OYJA 5ILSA 2VASA 3IH2A 5EZGA 1JKOC 2QVOA 3B6CA 2Y0SA 1OCTC 1H9TA 3BG6A 4UUTA 1LDKB 4A3FJ 1S72I 3TDUC 1W36D 3FXUA 4IHWA 1MBHA 1KA8A 2LF7A 4NDLA 3TEDA 1EJ9A 4KN4X 2P6TA 4C9YA 3EUHA 5IOYA 2CH0A 1WSUA 1P4XA 4IHYA 2L2OA 3QODA 3OYEA 4F93B 1MZBA 4LB5A 1TWFJ 2NS7A 2JA5J 4JX6A 4AIJA 3LOCA 3H3ZA 3ZQQA 3C3WA 3K10A 1RI7A 1V5EA 1OFCX 2AQFA 3QP5A 2OAZA 2CQXA 3C2GA 2F4IA 1ZARA 3M8FA 3VYRB 3P9CA 1VI0A 4BE2A 2AQEA 2X9DA 2HDDA 2Y75A 4BXFA 2R7OA 1TWHJ 2XPVA 2Y2ZA 4HX4A 1P7JA 4AU7A 1G8XA 1ZGAA 2BE5F 2FE3A 1Z6TA 2DTZA 2ZB9A 3FBNB 5HODA 1USTA 4LGWA 1L3LA 3ASNH 3GTPJ 2BXYA 2FRHA 2ELHA 2TDXA 2ZKZA 3K4NA 4M6YA 3AL0B 5DTDA 4I99C 3REOA 1W5TA 1BIBA 1UCRA 4M74A 5HDNA 4U88A 4IEJA 3I4NJ 1RR8C 1YIOA 3LWFA 2H09A 1IN7A 4XOPA 5GPCA 1TZLA 5C44J 2HU9A 2HXOA 1B8IA 4MQ9F 2M8GX 1WJCA 1ZTRA 1NH3A 4XLNF 4AD9A 1A6QA 1XS9A 3CCRI 2HXIA 1OR7A 3HKZA 3LA2A 5K5RA 2OCEA 4FCYA 2WA0A 3HSFA 5GAGJ 5CKTA 5ILUA 3OL3A 2MC4A 5BS6A 4CCJA 3IC7A 4II3A 1Y0NA 2WAQN 4B4CA 4DNCA 3T1BA 2KIUA 5L3FA 3SFIA 3WTYC 3HBLA 3G1OA 3K0LA 1SEUA 1SMYF 3P7NA 4GFBA 2EV5A 4RAYA 4RAZA 2M87A 5GAEJ 5CPRB 3CD6I 3K6GA 3AG2H 2K40A 2VBYA 2V4JC 3WGIA 4IQ4A 2KDOA 4OOIA 4XMYA 5FGMA 3RZDJ 5CLSA 1NK3P 4RB2C 5A2QK 1Y39A 1UFMA 1IGNA 1FBUA 1WJBA 5CQGA 5ICFA 3VDXA 1Y8QB 4QLCU 1LFBA 2WWYA 5K7HA 2DMNA 2ZO4A 2EQRA 4IQJA 4A6DA 1LFUP 3CC7I 3NWSA 2FXAA 4ZYGA 2B9SA 3E0JB 3JAMK 3IH3A 4W1UA 4YFXF 5HNFA 3CJTB 3IRQA 1IRGA 1KZHA 2ELJA 3BPXA 2L7KA 2E1MB 1N25A 5FKKA 2LDUA 2RREA 3L09A 3DEEA 3WODF 5GTHC 4AIDA 4Q5SF 2CUEA 4BY7J 4QTRA 1G3WA 4OIQF 5EG0B 2R7FA 4BQQA 4F3QA 1SFEA 3VFZA 1FSEA 3CMYA 4XKWA 3KEQA 1Y1WJ 1IDYA 1T6SA 3LSGA 4M9XA 2QCOA 4NC8A 1B9NA 1EA3A 1XSXA 1CQTA 1HA8A 3SDBA 2HWVA 3F3XA 3M4OJ 2R7SA 1IUFA 4MNUA 4XRMA 2BXZA 3QYBA 2XDVA 4EJTA 2DMUA 2ZMEB 2XASA 3GBGA 4NBQA 5E20A 1MNEA 1JKQC 5FKOA 4C2UA 2VQGA 2X0LA 2H94A 5F1RA 4EGZA 5LHIA 2R5ZB 2HTJA 2EZKA 2NRAC 1XMAA 4U0WA 3E6DA 4OU0A 1YW7A 2DFIA 3V7RA 2OJED 1G3TA 3PJRA 4Z2YA 4DZPA 5JR3A 3TGNA 2A5YB 3MKWB 4UUVA 3DKYA 1HDPA 3Q0UA 4ZYAA 2LYCA 1YJWI 2B0LA 3BR3A 5B1BH 2LK2A 1Z3YA 2VXDA 3KZZA 3LSMA 2NNYA 4FE7A 1K61A 2ETHA 4MO7A 3E5QA 2O61A 3IRRA 1OMIA 2Q2EA 1TT5B 3TO9A 1ZN2A 4FX0A 2M1BA 2DK5A 3Q0WA 2DU9A 2XAHA 3QPTA 1QA6A 3VYSB 2IRFG 5IPAA 3FHNA 4CZZA 1RRJA 4EM1A 5F27A 1HC8A 2RAEA 3ZMVA 5E18F 2HVRA 3C1DA 1ERDA 3J7AY 2BVMA 1RC9A 3V8KA 3GTOJ 2JVGA 2EB7A 3FKJA 3BCBA 4LK0F 3BT9A 3S16J 3GTKJ 2O7OA 2EV0A 1VF9A 1AWCA 2OPTA 2AXTC 4PUSA 4B3AA 3ZMSA 2R5ZA 2ZCWA 2F5DA 4G7ZF 2XAUA 2M30A 2YX4A 2HEOA 1TP4A 5GTIC 2MGQA 1GDTA 4CCOA 2ZJ2A 2M4GA 1X1BA 4UV9A 4A3CJ 2PQ8A 3FZVA 1WVRA 2ECCA 4M3GA 2JSPA 2H6CA 3CMAI 4EEFG 3FHZA 3GFLA 1YQAA 1QQIA 2JTVA 5J4VA
chains in the Genus database with same CATH topology
3SQNA 3E5UA 4QWQA 4ESJA 3D5LA 1U5TB 4N0BA 4P55A 1V3FA 3R61A 2FOKA 2PN6A 3ROUA 2L54A 1QNTA 2FNPA 4O6JA 4H0EA 3V7SA 2JPCA 4RB3C 3BP8A 1OYYA 2NYXA 5K1YA 2K86A 3GW2A 2YR2A 3FMQA 4HW0A 4KYWA 4HV6A 1WKMA 4BH9A 3LA3A 3TDZC 4IRGA 4M71A 1HW1A 2VC1A 4OMYA 2M5WA 3SFZA 4CICA 1UHMA 1ZH5A 2XHKA 3R0AA 1F1ZA 2ADUA 4GYGA 1IXRC 5F6FA 5EEGA 5HS9A 2FBIA 1XD7A 2ISZA 4HOBA 1HKSA 3QP6A 3QPHA 1XSDA 5BQTA 1YS6A 1OPCA 2JSCA 1Z6RA 1U5TA 3DPLC 2CSOA 2E1CA 5LBQA 1LDJA 1OYIA 4RGRA 3F6VA 3F8MA 1S3JA 3ZMUA 2UXXA 3CUQC 4OINF 3SXYA 2L3DA 2H27A 2J5PA 1R1UA 1IF1A 2NS0A 3R60A 2GQQA 1PDNC 4L9JA 3ABTA 5E1ZB 3K1MA 4D0PA 1SD4A 2VC0A 1F4KA 4RS8A 5LEJA 2D1HA 3WTZA 1FYLA 4EJWA 4I0AA 1JHFA 2QM3A 2XROA 3WTUC 3GFIA 5HVQC 5CYVA 3ISPA 4Q47A 1TW2A 1CF7B 4M73A 4WK8F 4KNYA 2W57A 1J9IA 1ZLJA 3RJPA 2G7HA 5DCFA 3P9KA 3HSRA 3GVAA 4L18B 3F72A 4P9FA 1U8RA 4ZZLA 1G4DA 3WTXC 2KKOA 2IA2A 1S29A 1QZYA 4JQFA 2VT3A 1G3SA 2HR3A 4L0ZB 5EEHA 1T98A 4HLXA 3LFKA 2P8TA 2IP2A 1KYZA 3GF2A 3CJNA 1U78A 4OIPF 1XSVA 4WF2A 1MJAA 1Z05A 1IN6A 2XAGA 1Q1HA 1QZZA 3D0SA 4ENNA 1HQCA 3B02A 1XGSA 2PBIA 4LK1F 4G7OF 2V79A 2RNJA 2BBYA 1RIOH 2EK5A 3GZ5A 1CF7A 1GVJA 4Q4ZF 4A12A 2DO7A 2IA1A 3ECHA 4P5OA 4U0VA 4MTEA 3R6SA 2QBYB 1LNWA 3Q9VA 4HBLA 3GZ6A 3I0TA 3DPTA 1DUXC 2HKOA 1E17A 4E70A 4EJVA 3WGHA 4A2UA 1S7AA 2RQPA 3WTWC 1XN7A 1RZ4A 5TRDA 1F9NA 2BV6A 2GXGA 4F7ZA 1YW9A 1R5HA 4I09A 3VODA 3KP2A 5LLQA 1LB2A 5HS8A 4WXCA 1BC7C 1K7AA 4GYIA 3TOBA 3WU0A 4OMZA 4HF1A 1BJAA 4EV0A 3ZMTA 1ZLKA 2P7CB 1B59A 5H20A 4RGSA 3T0YA 4HX7A 2VT2A 2E1NA 2PMUA 1L0OC 3TOAA 1XB4A 2RN7A 1FLIA 2XAJA 1BI1A 4BXUA 4Q48A 1TQIA 2V1XA 3IWFA 2JT1A 1FBSA 1YTYA 3ZMZA 4ENKA 1KQ8A 5ERIA 3FMRA 1X3UA 4BAYA 3GUDA 5LGNA 2FBHA 2VBXA 4I2OA 2COMA 2JPBA 5L3CA 5HDKA 4UV8A 1FWZA 1ZG3A 2CW0F 3H92A 3ULQB 2E7XA 3MAJA 1KU9A 1YYVA 1JHHA 2PMHA 2CGPA 1XDSA 1MJBA 1UB9A 2GA2A 4XLPF 2UWMA 3SZTA 2Z5UA 2MBFA 2EWNA 3IHUA 4R8HA 4HQEA 3H3UA 4OIOF 1U3EM 4O5VA 4KIFA 1XCBA 2P4WA 4RGXA 5AONA 1YO5C 3F21A 3Q9SA 1O3QA 2VE8A 3KLNA 3TO7A 1TW3A 2VOPA 4FHTA 4IHSA 1J0RA 3M1EA 2GWRA 2CQKA 3RKWA 4KFCA 3JSOA 1MDMB 4CO8A 3B73A 2GAUA 3QU3A 3KE2A 2Y48A 2DW4A 2J5OA 3PQJA 5DUKA 1I6XA 3IKTA 2GIVA 5LGUA 1I5ZA 2P5KA 4LLGF 2HS5A 2Z33A 2EV6A 2P7VB 1D8KA 4TV7A 3OV8A 4L5JA 2VONA 3K1PA 3M9AA 4YIIA 4EM2A 4BNCA 1FT9A 3J7AO 2EFOA 4Y13A 1FC3A 3LSTA 1C0WA 5D6FA 4AIHA 1J75A 1LEBA 1IXCA 1HW2A 2EA2A 5BMZA 1B6AA 1RNLA 2L01A 4LLLA 3L2CA 1MDMA 1ZRDA 1IRFA 1FBQA 2E7WA 1LQ1A 4O3MA 1YLFA 3RDIA 2V1UA 1O7LA 1ODDA 4KA4A 5DD4A 5BOXA 3CDHA 2G9WA 5JVTA 5J8CA 1R58A 3ZPLA 1OKRA 1K6OA 5D8LB 2RVCA 4UVAA 1WRJA 2HDCA 3KETA 2EFWA 4KT5C 3MZYA 2R3SA 2H6BA 4G7HF 1HKQA 2HQRA 3KEOA 1R1TA 2IT0A 1JE8A 3KP5A 4UNOA 3HRMA 2QZ8A 3MEXA 2K4JA 2ZFWA 2R7DA 4G9YA 3RKYA 1FSHA 1FPQA 3PQKA 1FP1D 1TBXA 5D5WB 4ENJA 5FD5A 1VTNC 2YSRA 2P5VA 1Y0UA 4IRIA 4L9NA 3RPQA 3CTAA 3CUOA 2ESHA 1S8NA 5F64A 3ZN1A 3CUQB 3BJAA 4LD5A 5D4RA 1MJ9A 1SD6A 3W6JB 3KFWX 1R22A 3M7GA 2UZKA 3C18A 1H9GA 2DI3A 2MD5A 3O3KA 5AIQA 1HXDA 2L4AA 3MFKA 3HOSA 1E2XA 1R36A 3GXOA 4MTDA 2LKPA 4BHCA 3HHGA 1LDDA 2CYYA 2F5FA 1BBYA 2GXBA 1LJ9A 2XV4S 4MGRA 5CVRA 5D5VB 1SAXA 1U2WA 2OU2A 3QU6A 3GO5A 5E8GA 3U2RA 4N9IA 3QOPA 1KQ0A 2AS5F 5D8KB 3K2ZA 1YG2A 2PFBA 3CUQA 1FP2A 1YS7A 2FMYA 3BJOA 2MC3A 2QWWA 3TO6A 1FZPB 2RDPA 1IN5A 2Z3YA 5CJ9A 2YX7A 4IHTA 3HTSB 5FO5A 2VOOA 1J5YA 1HSTA 1J2XA 2HFHA 4GCVA 2NNNA 1QPMA 4L0YB 2VBZA 2O3FA 3KP7A 5LHGA 4UVCA 3E6MA 1WWXA 4YIFA 4NQWA 4KUMA 2RC4A 1R5GA 3KZYA 1BIAA 2Q8KA 1XGOA 4U7DA 4A5MA 1BI0A 4CXFA 3N4MA 1JGSA 5DCMA 3I59A 4BHPA 4LMYA 3F8CA 2MH9A 3PFIA 2QLZA 3JTHA 1KU3A 3KP4A 2XKOA 2DPDA 2DQLA 4EVIA 4HLYA 2K02A 3I4PA 4UVBA 4G6QA 2FQ3A 2GA1A 5HLHA 3RPUA 2FEZA 2WV0A 1QO0D 5L3DA 1D8JA 4CYDA 4EJOA 2IPQX 2OBPA 1KQ9A 1SD5A 1Z91A 1ZYRF 2BEOA 3GFJA 2FBKA 1F5TA 1XGMA 1ZG5A 1TNSA 1USSA 2UXNA 2IJLA 4CGZA 1P6RA 3ZQ7A 4LB6B 2IW5A 3MQ0A 1I1GA 4M72A 1PP7U 1SFXA 5D5XB 4ESFA 3WU1B 1R23A 1S6LA 2JRTA 4N9HA 1K79A 4M9ZA 1EV7A 4AWXB 5CVJA 1GXPA 4HX8A 4PGHA 2Z9OA 3S2WA 3BDDA 1BI2A 2D1VA 3KLOA 2A6EF 4LFUA 4Y15A 4RB0A 4LG0B 1OYWA 1MKMA 2HGCA 3ZP5A 1HSJA 4UXNA 2Z99A 5E1WA 3LQRA 2V6CA 4BYYA 2OQRA 2XRNA 4EMSA 4ETSA 2DT5A 3ECOA 3R0JA 3G73A 1T38A 1J7KA 2VN2A 2ACJA 3ML6A 1TTYA 1RUNA 4KIGA 2IA0A 4HV5A 1ONVA 1ZRCA 5H6QA 3E97A 1IAWA 3IL2A 1BOAA 4WCGA 4A0YA 2MA3A 4HYEA 4EM0B 3HSEA 3K69A 1XDUA 4PDKA 3FWEA 4PCQA 2K4BA 1O3RA 3DFGA 4LG0A 4XSZF 4KICA 2FU4A 5JFRA 2L02A 1P4AA 1J59A 4ASNA 2NAZA 4IJAA 4GGGA 3EYYA 2V9VA 2W84A 3U1DA 1G6NA 1SD7A 5FFZA 4ZH4F 1KU2A 2BYVE 2LNBA 2QYOA 2FMLA 1Z7UA 4JK1X 1MGTA 4GXOA 4HDUA 3WE3A 2KJBA 2ISYA 3RYPA 4HZFA 5FB2A 1ULYA 1TLHB 2L4MA 2V1DA 3WTVC 1ZG1A 4KDPA 2XAFA 4IPAA 1H0MA 1HW5A 1FYKA 5TJJA 1QBJA 2QQ9A 2OD5A 2VE9A 4I02A 4Y17A 2OA4A 4ZYEA 5FLXK 1IZ1A 3V4GA 3O6BB 1QGPA 2Y0MA 1KYWA 1TQPA 3ZN0A 3TQNA 3HRUA 1R7JA 2CWEA 1EH6A 2O03A 1I1SA 4MHGA 3O2PE 2EFPA 4WX9A 1ON1A 3ELKA 2XKPA 3C7JA 2KIFA 5LRRA 1XCVA 2F5CA 3BZ6A 4HQMA 5BPDA 3CO7C 1FOKA 5IT9K 3I64A 3J80K 1YW8A 2A07F 3DF8A 2EFQA 5L3EA 3DP7A 3FM5A 5JI6A 2ZNZA 3L9FA 2MLGA 1PP8F 1ZREA 4IVNA 1Z1DA 1V4RA 2BGCA 1NHAA 1EH7A 1KGSA 4P96A 1W7PD 2YU3A 4S04A 2DLLA 2X4HA 2C6YA 2DBBA 4B8XA 1IUYA 3T8TA 3WTTC 4UHTA 3JTGA 2HKXA 1YFHA 5ICGA 3I5UA 1PUEE 1A04A 3CLOA 2ZNYA 3BPVA 4BQAA 3E5XA 4YFNF 2DPUA 4I7HA 4NHJA 3FM3A 1LEAA 3J81Z 1GXQA 5HLIA 5E17F 5D6EA 4U0YA 1WI9A 2RV8A 2PG4A 2PLYA 3VOEA 3BOQA 3AAFA 3E6BA 2KJCA 2O8XA 1B9MA 4ZZDA 2CO5A 4HF0A 2W25A 2ZBKA 2QUFA 5BPIA 4NB5A 3K1NA 5L3GA 3I71A 1P92A 2XGXA 5D4SA 5DYMA 4ZYHA 3ERED 3MZHA 5HLGA 1D5VA 2F2EA 5LHHA 4EQQA 6PAXA 3GFMA 2HZTA 2PEXA 1W7PB 3SZPA 3BJ6A 2MLKA 4B09A 2CG4A 5IT3A 3F8NA 3IWZA 3P9IA 2ZXJA 1HKTA 2LF8A 1WQ2A 1T2KA 3HTUA 2M45A 3HYIA 1Z9CA 4BHBA 4GO1A 3LAJA 4KMUX 2AXLA 4FX4A 3EETA 4EJUA 4MQVA 4HAMA 4CHUA 2G7UA 3EDPA 3DV8A 2ZMEA 5KVRA 4JBAA 2F5EA 2D45A 1IXSB 2A6HF 3WG9A 3R4KA 4L9VA 1SMTA 4S05A 5D5UB 2XAQA 2EFNA 4A0XA 1P4WA 5AIPA 4L9TA 1O7FA 3IKVA 1TNTA 4ESBA 1IN4A 3DKWA 3JAMK 1P2FA 3ABUA 1W7PA 1I27A 3GX4X 2A69F 4CDGA 4FT8A 3WTSC 5H6RA 1BI3A 3N97A 3DEUA 1DPRA 3Q5FA 3F8FA 3JW4A 4HF2A 4M6XA 3V8JA 3RTRA 4ENMA 2A3SA 5DCMB 3I59B 4LLNA 5LRSA 1R1VA 5ILVA 3F6OA 4I98B 3KP6A 3OOPA 3VB2A 1HBXG 3BY6A 3I53A 2QENA 3L00A 3NQOA 1SFUA 5HS7A 2VODA 2P6SA 2VXZA 4A0ZA 3U9GA 1K78B 5K5QA 1MD0A 4G94A 5JHUA 2PJPA 1CGPA 3QAHA 2HQNA 1IN8A 3DQVC 5FLXZ 5LEKA 5HOOA 3FMSA 5CVIA 2GZWA 1AOYA 3FXRA 3EQLF 3GLXA 5DV5A 3V7CA 3COAC 3BROA 1JXSA 1BM9A 3LAPA 2FA5A 3VEPA 1GHCA 4XRFA 3K9TA 4RGUA 5ICCA 4KMFA 2HOEA 4ZYDA 3F22A 2ESNA 4G6DA 2XIGA 1FX7A 3KP3A 3G3ZA 2XVCA 1XGNA 4IRHA 3NRVA 4U7BA 5ICEA 5IT9Z 1DP7P 4I0BA 4WXHA 3HIFA 3J80Z 2WC2A 3FX3A 4WWCA 1XMKA 2OZ6A 2PI0A 4P9UA 1T39A 2EA4A 1U5TC 2K27A 5CVUA 2XUBA 2DAOA 1K78A 5DUIA 1REPC 3WE2A 3HOTA 1S7OA 3T8RA 1IW7F 3V8LA 5J6XA 5J8FA 4IF4A 4G8XA 2OQGA 4PZJA 1UHWA 4XSXF 2FSWA 3HUGA 3J81K 3MCZA 2A68F 1FYMA 2OZUA 1KU7A 3HHHA 4KIBA 3FF5A 1FY7A 3F23A 3LQQA 4ON0A 2K7LA 1O3TA 3GEZA 2RKHA 2WTEA 2W85A 4DQ2A 2FNAA 3W6KB 1FNNA 2QQBA 2DK8A 3RI4A 1ZAOA 1O57A 2MH2A 5A2QZ 3MWMA 1EH8A 4MEYF 3T5XA 5FFXA 2HYFA 1TQMA 4MEXF 4AIKA 4R79A 2A61A 3E6CC 4EGYA 3FXQA 4IXAA 3TKYA 4PGGA 3KCCA 4RB1A 2CFXA 2STTA 5K5OA 1ZRFA 5KK1A 2EJRA 3RIRA 1ZHFA 3E3VA 5FD6A 4R1HA 2Q0OA 3LA7A 2O6GE 4HDVA 1G3YA 4KN7X 2STWA 2LSOA 1W4MA 3RYRA 3JSPA 3L7WA 4M9SA 2FF4A 3HRTA 4XBFA 3SHFA 1R00A 4A6EA 5DDGA 3HRSA 4HA8A 1BC8C 2DTRA 2RGVA 3DXJF 2DQRA 3GYHX 2QQAA 5DEQA 3RKXA 2JZYA 3BWGA 5LGTA 5L3BA 2M8EA 1RUOA 1LVAA 2W24A 3WGGA 1ZGJA 1O3SA 1DDNA 1D3YA 5E1XA 4OIRF 4WXDA 3I54A 5E8IA 2QBYA 3GWZA 3CO6C 1B1BA 2HTSA 4YG2F 3F8BA 2KRFA 4YFKF 1T0FA 2VBWA 4AVPA 1STZA 1U6GA 2YPRA 3JAMZ 2D2WA 1ON2A 3ZMDA 1BN5A 3NEUA 2O0YA 1B4AA 4A5NA 5DD8A 3M8EA 1W5SA 1DPUA 5HDGA 5CVVA 2P5LC 4I01A 4K2EA 3QRFF 2IVMA 2HYGD 2KIMA 5ED4A 3I58A 4LJZF 4L5IA 3EYIA 5ILSA 2QVOA 1H9TA 1LDKB 3TDUC 3FXUA 1KA8A 2LF7A 4KN4X 2P6TA 1WSUA 3EUHA 1P4XA 1MZBA 4LB5A 4AIJA 3H3ZA 3C3WA 1RI7A 3QP5A 2OAZA 1ZARA 3M8FA 3P9CA 2Y75A 4HX4A 2BE5F 1ZGAA 2FE3A 1Z6TA 1USTA 4LGWA 1L3LA 2FRHA 2ELHA 2TDXA 2ZKZA 4M6YA 3REOA 1W5TA 1BIBA 1UCRA 4M74A 5HDNA 4U88A 1YIOA 3LWFA 2H09A 1IN7A 4MQ9F 4XLNF 4AD9A 5K5RA 1OR7A 3LA2A 3HSFA 5ILUA 5BS6A 3IC7A 4DNCA 3T1BA 2KIUA 5L3FA 3WTYC 3K0LA 1SMYF 3P7NA 2EV5A 4RAYA 4RAZA 2M87A 2VBYA 3WGIA 4OOIA 5FGMA 5CLSA 4RB2C 5A2QK 1UFMA 1FBUA 4QLCU 5ICFA 2WWYA 2ZO4A 4A6DA 2FXAA 4ZYGA 4YFXF 3IRQA 1IRGA 3BPXA 2LDUA 3L09A 3WODF 4Q5SF 1G3WA 4OIQF 2R7FA 1SFEA 3VFZA 1FSEA 3KEQA 1T6SA 4M9XA 1B9NA 1XSXA 2HWVA 3F3XA 4MNUA 4EJTA 2ZMEB 2XASA 5E20A 2X0LA 2H94A 5F1RA 4EGZA 5LHIA 2HTJA 2NRAC 1XMAA 4U0WA 3E6DA 4OU0A 1YW7A 2DFIA 3V7RA 1G3TA 4Z2YA 5JR3A 3TGNA 2A5YB 4UUVA 2B0LA 3KZZA 2NNYA 2ETHA 3E5QA 2O61A 3IRRA 1OMIA 2Q2EA 3TO9A 1ZN2A 4FX0A 2M1BA 2DK5A 2DU9A 2XAHA 3QPTA 2IRFG 4CZZA 4EM1A 3ZMVA 5E18F 3C1DA 3V8KA 2EB7A 4LK0F 2EV0A 1AWCA 3ZMSA 2ZCWA 2F5DA 4G7ZF 2M30A 2YX4A 2HEOA 2ZJ2A 4UV9A 2PQ8A 3FZVA 2H6CA 3FHZA 3GFLA 1YQAA 1QQIA 2JTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQN A;  3E5U A;  4QWQ A;  4ESJ A;  3D5L A;  1U5T B;  4N0B A;  4P55 A;  1V3F A;  3R61 A;  2FOK A;  2PN6 A;  3ROU A;  2L54 A;  1QNT A;  2FNP A;  4O6J A;  4H0E A;  3V7S A;  2JPC A;  4RB3 C;  3BP8 A;  1OYY A;  2NYX A;  5K1Y A;  2K86 A;  3GW2 A;  2YR2 A;  3FMQ A;  4HW0 A;  4KYW A;  4HV6 A;  1WKM A;  4BH9 A;  3LA3 A;  3TDZ C;  4IRG A;  4M71 A;  1HW1 A;  2VC1 A;  4OMY A;  2M5W A;  3SFZ A;  4CIC A;  1UHM A;  1ZH5 A;  2XHK A;  3R0A A;  1F1Z A;  2ADU A;  4GYG A;  1IXR C;  5F6F A;  5EEG A;  5HS9 A;  2FBI A;  1XD7 A;  2ISZ A;  4HOB A;  1HKS A;  3QP6 A;  3QPH A;  1XSD A;  5BQT A;  1YS6 A;  1OPC A;  2JSC A;  1Z6R A;  1U5T A;  3DPL C;  2CSO A;  2E1C A;  5LBQ A;  1LDJ A;  1OYI A;  4RGR A;  3F6V A;  3F8M A;  1S3J A;  3ZMU A;  2UXX A;  3CUQ C;  4OIN F;  3SXY A;  2L3D A;  2H27 A;  2J5P A;  1R1U A;  1IF1 A;  2NS0 A;  3R60 A;  2GQQ A;  1PDN C;  4L9J A;  3ABT A;  5E1Z B;  3K1M A;  4D0P A;  1SD4 A;  2VC0 A;  1F4K A;  4RS8 A;  5LEJ A;  2D1H A;  3WTZ A;  1FYL A;  4EJW A;  4I0A A;  1JHF A;  2QM3 A;  2XRO A;  3WTU C;  3GFI A;  5HVQ C;  5CYV A;  3ISP A;  4Q47 A;  1TW2 A;  1CF7 B;  4M73 A;  4WK8 F;  4KNY A;  2W57 A;  1J9I A;  1ZLJ A;  3RJP A;  2G7H A;  5DCF A;  3P9K A;  3HSR A;  3GVA A;  4L18 B;  3F72 A;  4P9F A;  1U8R A;  4ZZL A;  1G4D A;  3WTX C;  2KKO A;  2IA2 A;  1S29 A;  1QZY A;  4JQF A;  2VT3 A;  1G3S A;  2HR3 A;  4L0Z B;  5EEH A;  1T98 A;  4HLX A;  3LFK A;  2P8T A;  2IP2 A;  1KYZ A;  3GF2 A;  3CJN A;  1U78 A;  4OIP F;  1XSV A;  4WF2 A;  1MJA A;  1Z05 A;  1IN6 A;  2XAG A;  1Q1H A;  1QZZ A;  3D0S A;  4ENN A;  1HQC A;  3B02 A;  1XGS A;  2PBI A;  4LK1 F;  4G7O F;  2V79 A;  2RNJ A;  2BBY A;  1RIO H;  2EK5 A;  3GZ5 A;  1CF7 A;  1GVJ A;  4Q4Z F;  4A12 A;  2DO7 A;  2IA1 A;  3ECH A;  4P5O A;  4U0V A;  4MTE A;  3R6S A;  2QBY B;  1LNW A;  3Q9V A;  4HBL A;  3GZ6 A;  3I0T A;  3DPT A;  1DUX C;  2HKO A;  1E17 A;  4E70 A;  4EJV A;  3WGH A;  4A2U A;  1S7A A;  2RQP A;  3WTW C;  1XN7 A;  1RZ4 A;  5TRD A;  1F9N A;  2BV6 A;  2GXG A;  4F7Z A;  1YW9 A;  1R5H A;  4I09 A;  3VOD A;  3KP2 A;  5LLQ A;  1LB2 A;  5HS8 A;  4WXC A;  1BC7 C;  1K7A A;  4GYI A;  3TOB A;  3WU0 A;  4OMZ A;  4HF1 A;  1BJA A;  4EV0 A;  3ZMT A;  1ZLK A;  2P7C B;  1B59 A;  5H20 A;  4RGS A;  3T0Y A;  4HX7 A;  2VT2 A;  2E1N A;  2PMU A;  1L0O C;  3TOA A;  1XB4 A;  2RN7 A;  1FLI A;  2XAJ A;  1BI1 A;  4BXU A;  4Q48 A;  1TQI A;  2V1X A;  3IWF A;  2JT1 A;  1FBS A;  1YTY A;  3ZMZ A;  4ENK A;  1KQ8 A;  5ERI A;  3FMR A;  1X3U A;  4BAY A;  3GUD A;  5LGN A;  2FBH A;  2VBX A;  4I2O A;  2COM A;  2JPB A;  5L3C A;  5HDK A;  4UV8 A;  1FWZ A;  1ZG3 A;  2CW0 F;  3H92 A;  3ULQ B;  2E7X A;  3MAJ A;  1KU9 A;  1YYV A;  1JHH A;  2PMH A;  2CGP A;  1XDS A;  1MJB A;  1UB9 A;  2GA2 A;  4XLP F;  2UWM A;  3SZT A;  2Z5U A;  2MBF A;  2EWN A;  3IHU A;  4R8H A;  4HQE A;  3H3U A;  4OIO F;  1U3E M;  4O5V A;  4KIF A;  1XCB A;  2P4W A;  4RGX A;  5AON A;  1YO5 C;  3F21 A;  3Q9S A;  1O3Q A;  2VE8 A;  3KLN A;  3TO7 A;  1TW3 A;  2VOP A;  4FHT A;  4IHS A;  1J0R A;  3M1E A;  2GWR A;  2CQK A;  3RKW A;  4KFC A;  3JSO A;  1MDM B;  4CO8 A;  3B73 A;  2GAU A;  3QU3 A;  3KE2 A;  2Y48 A;  2DW4 A;  2J5O A;  3PQJ A;  5DUK A;  1I6X A;  3IKT A;  2GIV A;  5LGU A;  1I5Z A;  2P5K A;  4LLG F;  2HS5 A;  2Z33 A;  2EV6 A;  2P7V B;  1D8K A;  4TV7 A;  3OV8 A;  4L5J A;  2VON A;  3K1P A;  3M9A A;  4YII A;  4EM2 A;  4BNC A;  1FT9 A;  3J7A O;  2EFO A;  4Y13 A;  1FC3 A;  3LST A;  1C0W A;  5D6F A;  4AIH A;  1J75 A;  1LEB A;  1IXC A;  1HW2 A;  2EA2 A;  5BMZ A;  1B6A A;  1RNL A;  2L01 A;  4LLL A;  3L2C A;  1MDM A;  1ZRD A;  1IRF A;  1FBQ A;  2E7W A;  1LQ1 A;  4O3M A;  1YLF A;  3RDI A;  2V1U A;  1O7L A;  1ODD A;  4KA4 A;  5DD4 A;  5BOX A;  3CDH A;  2G9W A;  5JVT A;  5J8C A;  1R58 A;  3ZPL A;  1OKR A;  1K6O A;  5D8L B;  2RVC A;  4UVA A;  1WRJ A;  2HDC A;  3KET A;  2EFW A;  4KT5 C;  3MZY A;  2R3S A;  2H6B A;  4G7H F;  1HKQ A;  2HQR A;  3KEO A;  1R1T A;  2IT0 A;  1JE8 A;  3KP5 A;  4UNO A;  3HRM A;  2QZ8 A;  3MEX A;  2K4J A;  2ZFW A;  2R7D A;  4G9Y A;  3RKY A;  1FSH A;  1FPQ A;  3PQK A;  1FP1 D;  1TBX A;  5D5W B;  4ENJ A;  5FD5 A;  1VTN C;  2YSR A;  2P5V A;  1Y0U A;  4IRI A;  4L9N A;  3RPQ A;  3CTA A;  3CUO A;  2ESH A;  1S8N A;  5F64 A;  3ZN1 A;  3CUQ B;  3BJA A;  4LD5 A;  5D4R A;  1MJ9 A;  1SD6 A;  3W6J B;  3KFW X;  1R22 A;  3M7G A;  2UZK A;  3C18 A;  1H9G A;  2DI3 A;  2MD5 A;  3O3K A;  5AIQ A;  1HXD A;  2L4A A;  3MFK A;  3HOS A;  1E2X A;  1R36 A;  3GXO A;  4MTD A;  2LKP A;  4BHC A;  3HHG A;  1LDD A;  2CYY A;  2F5F A;  1BBY A;  2GXB A;  1LJ9 A;  2XV4 S;  4MGR A;  5CVR A;  5D5V B;  1SAX A;  1U2W A;  2OU2 A;  3QU6 A;  3GO5 A;  5E8G A;  3U2R A;  4N9I A;  3QOP A;  1KQ0 A;  2AS5 F;  5D8K B;  3K2Z A;  1YG2 A;  2PFB A;  3CUQ A;  1FP2 A;  1YS7 A;  2FMY A;  3BJO A;  2MC3 A;  2QWW A;  3TO6 A;  1FZP B;  2RDP A;  1IN5 A;  2Z3Y A;  5CJ9 A;  2YX7 A;  4IHT A;  3HTS B;  5FO5 A;  2VOO A;  1J5Y A;  1HST A;  1J2X A;  2HFH A;  4GCV A;  2NNN A;  1QPM A;  4L0Y B;  2VBZ A;  2O3F A;  3KP7 A;  5LHG A;  4UVC A;  3E6M A;  1WWX A;  4YIF A;  4NQW A;  4KUM A;  2RC4 A;  1R5G A;  3KZY A;  1BIA A;  2Q8K A;  1XGO A;  4U7D A;  4A5M A;  1BI0 A;  4CXF A;  3N4M A;  1JGS A;  5DCM A;  3I59 A;  4BHP A;  4LMY A;  3F8C A;  2MH9 A;  3PFI A;  2QLZ A;  3JTH A;  1KU3 A;  3KP4 A;  2XKO A;  2DPD A;  2DQL A;  4EVI A;  4HLY A;  2K02 A;  3I4P A;  4UVB A;  4G6Q A;  2FQ3 A;  2GA1 A;  5HLH A;  3RPU A;  2FEZ A;  2WV0 A;  1QO0 D;  5L3D A;  1D8J A;  4CYD A;  4EJO A;  2IPQ X;  2OBP A;  1KQ9 A;  1SD5 A;  1Z91 A;  1ZYR F;  2BEO A;  3GFJ A;  2FBK A;  1F5T A;  1XGM A;  1ZG5 A;  1TNS A;  1USS A;  2UXN A;  2IJL A;  4CGZ A;  1P6R A;  3ZQ7 A;  4LB6 B;  2IW5 A;  3MQ0 A;  1I1G A;  4M72 A;  1PP7 U;  1SFX A;  5D5X B;  4ESF A;  3WU1 B;  1R23 A;  1S6L A;  2JRT A;  4N9H A;  1K79 A;  4M9Z A;  1EV7 A;  4AWX B;  5CVJ A;  1GXP A;  4HX8 A;  4PGH A;  2Z9O A;  3S2W A;  3BDD A;  1BI2 A;  2D1V A;  3KLO A;  2A6E F;  4LFU A;  4Y15 A;  4RB0 A;  4LG0 B;  1OYW A;  1MKM A;  2HGC A;  3ZP5 A;  1HSJ A;  4UXN A;  2Z99 A;  5E1W A;  3LQR A;  2V6C A;  4BYY A;  2OQR A;  2XRN A;  4EMS A;  4ETS A;  2DT5 A;  3ECO A;  3R0J A;  3G73 A;  1T38 A;  1J7K A;  2VN2 A;  2ACJ A;  3ML6 A;  1TTY A;  1RUN A;  4KIG A;  2IA0 A;  4HV5 A;  1ONV A;  1ZRC A;  5H6Q A;  3E97 A;  1IAW A;  3IL2 A;  1BOA A;  4WCG A;  4A0Y A;  2MA3 A;  4HYE A;  4EM0 B;  3HSE A;  3K69 A;  1XDU A;  4PDK A;  3FWE A;  4PCQ A;  2K4B A;  1O3R A;  3DFG A;  4LG0 A;  4XSZ F;  4KIC A;  2FU4 A;  5JFR A;  2L02 A;  1P4A A;  1J59 A;  4ASN A;  2NAZ A;  4IJA A;  4GGG A;  3EYY A;  2V9V A;  2W84 A;  3U1D A;  1G6N A;  1SD7 A;  5FFZ A;  4ZH4 F;  1KU2 A;  2BYV E;  2LNB A;  2QYO A;  2FML A;  1Z7U A;  4JK1 X;  1MGT A;  4GXO A;  4HDU A;  3WE3 A;  2KJB A;  2ISY A;  3RYP A;  4HZF A;  5FB2 A;  1ULY A;  1TLH B;  2L4M A;  2V1D A;  3WTV C;  1ZG1 A;  4KDP A;  2XAF A;  4IPA A;  1H0M A;  1HW5 A;  1FYK A;  5TJJ A;  1QBJ A;  2QQ9 A;  2OD5 A;  2VE9 A;  4I02 A;  4Y17 A;  2OA4 A;  4ZYE A;  5FLX K;  1IZ1 A;  3V4G A;  3O6B B;  1QGP A;  2Y0M A;  1KYW A;  1TQP A;  3ZN0 A;  3TQN A;  3HRU A;  1R7J A;  2CWE A;  1EH6 A;  2O03 A;  1I1S A;  4MHG A;  3O2P E;  2EFP A;  4WX9 A;  1ON1 A;  3ELK A;  2XKP A;  3C7J A;  2KIF A;  5LRR A;  1XCV A;  2F5C A;  3BZ6 A;  4HQM A;  5BPD A;  3CO7 C;  1FOK A;  5IT9 K;  3I64 A;  3J80 K;  1YW8 A;  2A07 F;  3DF8 A;  2EFQ A;  5L3E A;  3DP7 A;  3FM5 A;  5JI6 A;  2ZNZ A;  3L9F A;  2MLG A;  1PP8 F;  1ZRE A;  4IVN A;  1Z1D A;  1V4R A;  2BGC A;  1NHA A;  1EH7 A;  1KGS A;  4P96 A;  1W7P D;  2YU3 A;  4S04 A;  2DLL A;  2X4H A;  2C6Y A;  2DBB A;  4B8X A;  1IUY A;  3T8T A;  3WTT C;  4UHT A;  3JTG A;  2HKX A;  1YFH A;  5ICG A;  3I5U A;  1PUE E;  1A04 A;  3CLO A;  2ZNY A;  3BPV A;  4BQA A;  3E5X A;  4YFN F;  2DPU A;  4I7H A;  4NHJ A;  3FM3 A;  1LEA A;  3J81 Z;  1GXQ A;  5HLI A;  5E17 F;  5D6E A;  4U0Y A;  1WI9 A;  2RV8 A;  2PG4 A;  2PLY A;  3VOE A;  3BOQ A;  3AAF A;  3E6B A;  2KJC A;  2O8X A;  1B9M A;  4ZZD A;  2CO5 A;  4HF0 A;  2W25 A;  2ZBK A;  2QUF A;  5BPI A;  4NB5 A;  3K1N A;  5L3G A;  3I71 A;  1P92 A;  2XGX A;  5D4S A;  5DYM A;  4ZYH A;  3ERE D;  3MZH A;  5HLG A;  1D5V A;  2F2E A;  5LHH A;  4EQQ A;  6PAX A;  3GFM A;  2HZT A;  2PEX A;  1W7P B;  3SZP A;  3BJ6 A;  2MLK A;  4B09 A;  2CG4 A;  5IT3 A;  3F8N A;  3IWZ A;  3P9I A;  2ZXJ A;  1HKT A;  2LF8 A;  1WQ2 A;  1T2K A;  3HTU A;  2M45 A;  3HYI A;  1Z9C A;  4BHB A;  4GO1 A;  3LAJ A;  4KMU X;  2AXL A;  4FX4 A;  3EET A;  4EJU A;  4MQV A;  4HAM A;  4CHU A;  2G7U A;  3EDP A;  3DV8 A;  2ZME A;  5KVR A;  4JBA A;  2F5E A;  2D45 A;  1IXS B;  2A6H F;  3WG9 A;  3R4K A;  4L9V A;  1SMT A;  4S05 A;  5D5U B;  2XAQ A;  2EFN A;  4A0X A;  1P4W A;  5AIP A;  4L9T A;  1O7F A;  3IKV A;  1TNT A;  4ESB A;  1IN4 A;  3DKW A;  3JAM K;  1P2F A;  3ABU A;  1W7P A;  1I27 A;  3GX4 X;  2A69 F;  4CDG A;  4FT8 A;  3WTS C;  5H6R A;  1BI3 A;  3N97 A;  3DEU A;  1DPR A;  3Q5F A;  3F8F A;  3JW4 A;  4HF2 A;  4M6X A;  3V8J A;  3RTR A;  4ENM A;  2A3S A;  5DCM B;  3I59 B;  4LLN A;  5LRS A;  1R1V A;  5ILV A;  3F6O A;  4I98 B;  3KP6 A;  3OOP A;  3VB2 A;  1HBX G;  3BY6 A;  3I53 A;  2QEN A;  3L00 A;  3NQO A;  1SFU A;  5HS7 A;  2VOD A;  2P6S A;  2VXZ A;  4A0Z A;  3U9G A;  1K78 B;  5K5Q A;  1MD0 A;  4G94 A;  5JHU A;  2PJP A;  1CGP A;  3QAH A;  2HQN A;  1IN8 A;  3DQV C;  5FLX Z;  5LEK A;  5HOO A;  3FMS A;  5CVI A;  2GZW A;  1AOY A;  3FXR A;  3EQL F;  3GLX A;  5DV5 A;  3V7C A;  3COA C;  3BRO A;  1JXS A;  1BM9 A;  3LAP A;  2FA5 A;  3VEP A;  1GHC A;  4XRF A;  3K9T A;  4RGU A;  5ICC A;  4KMF A;  2HOE A;  4ZYD A;  3F22 A;  2ESN A;  4G6D A;  2XIG A;  1FX7 A;  3KP3 A;  3G3Z A;  2XVC A;  1XGN A;  4IRH A;  3NRV A;  4U7B A;  5ICE A;  5IT9 Z;  1DP7 P;  4I0B A;  4WXH A;  3HIF A;  3J80 Z;  2WC2 A;  3FX3 A;  4WWC A;  1XMK A;  2OZ6 A;  2PI0 A;  4P9U A;  1T39 A;  2EA4 A;  1U5T C;  2K27 A;  5CVU A;  2XUB A;  2DAO A;  1K78 A;  5DUI A;  1REP C;  3WE2 A;  3HOT A;  1S7O A;  3T8R A;  1IW7 F;  3V8L A;  5J6X A;  5J8F A;  4IF4 A;  4G8X A;  2OQG A;  4PZJ A;  1UHW A;  4XSX F;  2FSW A;  3HUG A;  3J81 K;  3MCZ A;  2A68 F;  1FYM A;  2OZU A;  1KU7 A;  3HHH A;  4KIB A;  3FF5 A;  1FY7 A;  3F23 A;  3LQQ A;  4ON0 A;  2K7L A;  1O3T A;  3GEZ A;  2RKH A;  2WTE A;  2W85 A;  4DQ2 A;  2FNA A;  3W6K B;  1FNN A;  2QQB A;  2DK8 A;  3RI4 A;  1ZAO A;  1O57 A;  2MH2 A;  5A2Q Z;  3MWM A;  1EH8 A;  4MEY F;  3T5X A;  5FFX A;  2HYF A;  1TQM A;  4MEX F;  4AIK A;  4R79 A;  2A61 A;  3E6C C;  4EGY A;  3FXQ A;  4IXA A;  3TKY A;  4PGG A;  3KCC A;  4RB1 A;  2CFX A;  2STT A;  5K5O A;  1ZRF A;  5KK1 A;  2EJR A;  3RIR A;  1ZHF A;  3E3V A;  5FD6 A;  4R1H A;  2Q0O A;  3LA7 A;  2O6G E;  4HDV A;  1G3Y A;  4KN7 X;  2STW A;  2LSO A;  1W4M A;  3RYR A;  3JSP A;  3L7W A;  4M9S A;  2FF4 A;  3HRT A;  4XBF A;  3SHF A;  1R00 A;  4A6E A;  5DDG A;  3HRS A;  4HA8 A;  1BC8 C;  2DTR A;  2RGV A;  3DXJ F;  2DQR A;  3GYH X;  2QQA A;  5DEQ A;  3RKX A;  2JZY A;  3BWG A;  5LGT A;  5L3B A;  2M8E A;  1RUO A;  1LVA A;  2W24 A;  3WGG A;  1ZGJ A;  1O3S A;  1DDN A;  1D3Y A;  5E1X A;  4OIR F;  4WXD A;  3I54 A;  5E8I A;  2QBY A;  3GWZ A;  3CO6 C;  1B1B A;  2HTS A;  4YG2 F;  3F8B A;  2KRF A;  4YFK F;  1T0F A;  2VBW A;  4AVP A;  1STZ A;  1U6G A;  2YPR A;  3JAM Z;  2D2W A;  1ON2 A;  3ZMD A;  1BN5 A;  3NEU A;  2O0Y A;  1B4A A;  4A5N A;  5DD8 A;  3M8E A;  1W5S A;  1DPU A;  5HDG A;  5CVV A;  2P5L C;  4I01 A;  4K2E A;  3QRF F;  2IVM A;  2HYG D;  2KIM A;  5ED4 A;  3I58 A;  4LJZ F;  4L5I A;  3EYI A;  5ILS A;  2QVO A;  1H9T A;  1LDK B;  3TDU C;  3FXU A;  1KA8 A;  2LF7 A;  4KN4 X;  2P6T A;  1WSU A;  3EUH A;  1P4X A;  1MZB A;  4LB5 A;  4AIJ A;  3H3Z A;  3C3W A;  1RI7 A;  3QP5 A;  2OAZ A;  1ZAR A;  3M8F A;  3P9C A;  2Y75 A;  4HX4 A;  2BE5 F;  1ZGA A;  2FE3 A;  1Z6T A;  1UST A;  4LGW A;  1L3L A;  2FRH A;  2ELH A;  2TDX A;  2ZKZ A;  4M6Y A;  3REO A;  1W5T A;  1BIB A;  1UCR A;  4M74 A;  5HDN A;  4U88 A;  1YIO A;  3LWF A;  2H09 A;  1IN7 A;  4MQ9 F;  4XLN F;  4AD9 A;  5K5R A;  1OR7 A;  3LA2 A;  3HSF A;  5ILU A;  5BS6 A;  3IC7 A;  4DNC A;  3T1B A;  2KIU A;  5L3F A;  3WTY C;  3K0L A;  1SMY F;  3P7N A;  2EV5 A;  4RAY A;  4RAZ A;  2M87 A;  2VBY A;  3WGI A;  4OOI A;  5FGM A;  5CLS A;  4RB2 C;  5A2Q K;  1UFM A;  1FBU A;  4QLC U;  5ICF A;  2WWY A;  2ZO4 A;  4A6D A;  2FXA A;  4ZYG A;  4YFX F;  3IRQ A;  1IRG A;  3BPX A;  2LDU A;  3L09 A;  3WOD F;  4Q5S F;  1G3W A;  4OIQ F;  2R7F A;  1SFE A;  3VFZ A;  1FSE A;  3KEQ A;  1T6S A;  4M9X A;  1B9N A;  1XSX A;  2HWV A;  3F3X A;  4MNU A;  4EJT A;  2ZME B;  2XAS A;  5E20 A;  2X0L A;  2H94 A;  5F1R A;  4EGZ A;  5LHI A;  2HTJ A;  2NRA C;  1XMA A;  4U0W A;  3E6D A;  4OU0 A;  1YW7 A;  2DFI A;  3V7R A;  1G3T A;  4Z2Y A;  5JR3 A;  3TGN A;  2A5Y B;  4UUV A;  2B0L A;  3KZZ A;  2NNY A;  2ETH A;  3E5Q A;  2O61 A;  3IRR A;  1OMI A;  2Q2E A;  3TO9 A;  1ZN2 A;  4FX0 A;  2M1B A;  2DK5 A;  2DU9 A;  2XAH A;  3QPT A;  2IRF G;  4CZZ A;  4EM1 A;  3ZMV A;  5E18 F;  3C1D A;  3V8K A;  2EB7 A;  4LK0 F;  2EV0 A;  1AWC A;  3ZMS A;  2ZCW A;  2F5D A;  4G7Z F;  2M30 A;  2YX4 A;  2HEO A;  2ZJ2 A;  4UV9 A;  2PQ8 A;  3FZV A;  2H6C A;  3FHZ A;  3GFL A;  1YQA A;  1QQI A;  2JTV A; 
#chains in the Genus database with same CATH topology
 5J40 A;  3SQN A;  3E5U A;  2VLA A;  4QWQ A;  2HNH A;  4XKV A;  4ESJ A;  3D5L A;  1U5T B;  4N0B A;  2XSD C;  3LSK A;  4P55 A;  1V3F A;  4C2T A;  3R61 A;  2FOK A;  2PN6 A;  3TP3 A;  4BY1 J;  1MMS A;  1WCM J;  2LR8 A;  3ROU A;  5TIS C;  1G2H A;  2HQ5 A;  2DFF A;  2L54 A;  1QNT A;  2FNP A;  2W1O A;  4O6J A;  4CYC A;  4H0E A;  2BW3 B;  2GBY A;  4IL6 C;  5EYR A;  3V7S A;  2JPC A;  3UKG A;  4RB3 C;  3BP8 A;  1OYY A;  2NYX A;  5FRM A;  5K1Y A;  2K86 A;  1AKH A;  3GW2 A;  2YR2 A;  2MG4 A;  2L9R A;  3OS1 A;  3S15 J;  3FMQ A;  5IY5 H;  4A3M J;  4HW0 A;  2IS6 A;  5F04 A;  4KYW A;  4HV6 A;  1WKM A;  1PVE A;  1Z7L A;  3K4M A;  4BH9 A;  3BG3 A;  3LA3 A;  3TDZ C;  1LE8 B;  2RNG A;  4ZDO A;  4IRG A;  4M71 A;  1HW1 A;  2VC1 A;  4GDF A;  2ZJP F;  2M5W A;  4OMY A;  3SFZ A;  1FMW A;  2DYR H;  4CIC A;  1UHM A;  1ZH5 A;  3OYK A;  2X1D A;  2XHK A;  1A6I A;  4RMN A;  2M9H A;  4B44 A;  3R0A A;  2L5Q A;  1F1Z A;  3HKZ N;  2ADU A;  4GYG A;  1IXR C;  4XKB A;  5F6F A;  4CCL A;  1JT0 A;  4BQN A;  5EEG A;  3HUG B;  5HS9 A;  2FBI A;  1XD7 A;  2ISZ A;  1AA7 A;  4HOB A;  1HKS A;  1EKE A;  2JQ7 A;  3QP6 A;  3QPH A;  1XSD A;  5BQT A;  1YS6 A;  1IDZ A;  1OPC A;  2JSC A;  1Z6R A;  3RCO A;  1U5T A;  3DPL C;  2CSO A;  2L9S A;  1LDJ A;  5LBQ A;  1OYI A;  1FOW A;  2E1C A;  4ZTJ A;  4RGR A;  2GXA A;  1R9T J;  3F6V A;  3F8M A;  1VQ4 I;  1S3J A;  4BS9 A;  2WAF A;  3ZMU A;  2UXX A;  3CUQ C;  4OIN F;  3SXY A;  2L3D A;  2H27 A;  3AG3 H;  4FQG A;  2W4S A;  2EIM H;  1JUM A;  2J5P A;  5DS9 A;  3PFY A;  2BW3 A;  3QYF A;  3WHC A;  1R1U A;  1PUF B;  1IF1 A;  2M7B A;  2GIZ A;  2CUF A;  2NS0 A;  3R60 A;  1W0T A;  1MSF C;  2GQQ A;  5E3M A;  2ELK A;  2WAE A;  2IS4 A;  2WAD A;  1PDN C;  2JA8 J;  4L9J A;  4A3E J;  2PJR B;  2D5V A;  2KFD A;  3PUB A;  2E35 A;  3ABT A;  3OYB A;  1XC5 A;  5E1Z B;  3K1M A;  3D5S C;  3X2Q H;  4FE4 A;  4D0P A;  1SD4 A;  3BLY A;  2VC0 A;  1H89 C;  3G2B A;  1F4K A;  4RS8 A;  3D1N I;  5LEJ A;  2D1H A;  3WTZ A;  1JUP A;  1FYL A;  4EJW A;  3ABL H;  4I0A A;  1ZGW A;  2TRT A;  1I39 A;  2XPW A;  1JHF A;  4XM3 A;  3H9J A;  3W6V A;  2QM3 A;  2XRO A;  4M3D A;  2KIS A;  3WTU C;  2CU7 A;  3GFI A;  5HVQ C;  2HOA A;  2ZFU A;  1QPI A;  2DDA A;  1A36 A;  5CYV A;  3V42 A;  3ISP A;  1T56 A;  4Q47 A;  1TW2 A;  1M1E B;  1CF7 B;  2V6E A;  4M73 A;  4WK8 F;  4KNY A;  2W57 A;  1J9I A;  1ZLJ A;  3RJP A;  2G7H A;  5DCF A;  2LRE A;  3P9K A;  3HSR A;  3LSR A;  3GVA A;  1ZKG A;  4L18 B;  1JTX A;  3F72 A;  4P9F A;  1U8R A;  1PUF A;  4ZZL A;  4A69 C;  4A3D J;  1G4D A;  3WTX C;  2KKO A;  3B6A A;  1YRN A;  2IA2 A;  5GPA A;  1S29 A;  4Y3O A;  2X6W A;  1SVM A;  1QZY A;  2VQH A;  4JQF A;  2PJR A;  2VT3 A;  1RKW A;  1G3S A;  1Z21 A;  4C2M J;  2DCE A;  2HR3 A;  5EEH A;  3BC8 A;  3CCJ I;  3PSI A;  4L0Z B;  1T98 A;  4HLX A;  2HVQ A;  4ABZ A;  1NG7 A;  3TL4 X;  3CCE I;  3LFK A;  2E19 A;  2P8T A;  4IO9 F;  2IP2 A;  1OIS A;  1KYZ A;  3GF2 A;  3CJN A;  1U78 A;  4OIP F;  1XSV A;  1IO2 A;  4WF2 A;  3OYD A;  1MJA A;  4B1R A;  1FTZ A;  1Z05 A;  4XLE A;  1IN6 A;  3A03 A;  4BDZ A;  2XAG A;  3P5J A;  1Q1H A;  3ZQI A;  1QZZ A;  2K9M A;  3D0S A;  4PFO A;  3ERM A;  4ENN A;  4Y7N J;  1HQC A;  3B02 A;  1XGS A;  4CUG A;  2FOW A;  2PBI A;  4LK1 F;  3CC4 I;  2OTL I;  4G7O F;  2V79 A;  2RNJ A;  3PSF A;  2BBY A;  1RIO H;  1X19 A;  2EK5 A;  1WHU A;  3GZ5 A;  4C30 A;  1CF7 A;  3CCL I;  1GVJ A;  3BQZ A;  2XGE A;  2QSF X;  4Q4Z F;  4A12 A;  2DO7 A;  2IA1 A;  3ECH A;  1WPK A;  4P5O A;  4U0V A;  3KX2 A;  4MTE A;  2XRL A;  4BJ5 C;  3R6S A;  1VQ9 I;  2QBY B;  3CDL A;  1LNW A;  4M3F A;  5DM6 F;  4LG3 A;  2IBD A;  3Q9V A;  4HBL A;  5TGT A;  3GZ6 A;  4A3J J;  1HOM A;  3ESW B;  4AC0 A;  3I0T A;  3DPT A;  3WU2 C;  5FLV A;  1DUX C;  2HKO A;  3H9G A;  3HGY A;  4CA0 A;  4E70 A;  4EJV A;  1E17 A;  5M5W J;  3WGH A;  4A2U A;  4LIT A;  1HDD C;  4NC6 A;  1BW5 A;  1S7A A;  2DMT A;  2RQP A;  5E79 C;  3OYC A;  3WTW C;  2K85 A;  1XN7 A;  1HCR A;  1RZ4 A;  5TRD A;  4E7J A;  1F9N A;  2BV6 A;  2GXG A;  3SYT A;  4F7Z A;  3RKQ A;  4HPQ A;  4RAG A;  2XB0 X;  4L5E A;  2W00 A;  1YW9 A;  1R5H A;  4I09 A;  3VOD A;  2AHQ A;  4DYC A;  3E7L A;  3KP2 A;  5LLQ A;  1LB2 A;  1HLV A;  4XNF A;  3JRB A;  5HS8 A;  4WXC A;  2IGM A;  1BC7 C;  3H5A A;  1ETX A;  4F52 A;  1RR7 A;  2XF7 A;  1K7A A;  4B48 A;  1DU6 A;  2WY8 Q;  4GYI A;  3TOB A;  3WU0 A;  4OMZ A;  2K9S A;  2OV7 A;  1POG A;  4HF1 A;  1BJA A;  4DZJ A;  4EV0 A;  2R4G A;  4ZC3 A;  2X1C A;  3ZMT A;  1ZLK A;  5FJ8 J;  2P7C B;  2CUZ A;  1B59 A;  5H20 A;  4RGS A;  2LKS A;  1BW6 A;  3T0Y A;  4HX7 A;  4B43 A;  2VT2 A;  2E1N A;  3IAS 2;  1JKP C;  3NWT A;  2KZG A;  1L0O C;  2PMU A;  3TOA A;  1XB4 A;  2LD5 A;  2RN7 A;  1FLI A;  2XAJ A;  1W5C C;  2LMD A;  1BI1 A;  3OOU A;  4BXU A;  4Q48 A;  3RSN A;  1TT0 A;  2HDW A;  1TQI A;  4KIS A;  2V1X A;  3IWF A;  2O8K A;  2JT1 A;  1FBS A;  1YTY A;  3ZMZ A;  4XON A;  4XQF A;  4BXX J;  4ENK A;  2CV0 A;  1KQ8 A;  5ERI A;  5B66 C;  3FMR A;  1X3U A;  4BAY A;  3GUD A;  2OTJ I;  3VYT B;  3HPG A;  3CP2 A;  2OC6 A;  5LGN A;  2FBH A;  3FIW A;  1ETQ A;  3TP0 A;  2VBX A;  1R4N B;  4I2O A;  2COM A;  2JPB A;  5L3C A;  2HPI A;  5HDK A;  3A01 A;  4UV8 A;  2R5Y A;  1FWZ A;  3K4C A;  2BHZ A;  1ZG3 A;  3IV5 A;  1WH5 A;  2KQR A;  3H5R A;  2QKL B;  2DFH A;  2CW0 F;  3H92 A;  3OR1 C;  4DBQ A;  2NVQ J;  3ULQ B;  3ZQG A;  1UEL B;  1B8I B;  2E7X A;  4XKC A;  2CQ7 A;  2F4O B;  3M3Y J;  2YS9 A;  3TW7 A;  3MAJ A;  1ORK A;  1KU9 A;  1YYV A;  1X4O A;  1VQL I;  3OS0 A;  1JHH A;  3CCQ I;  3BR1 A;  3GTG J;  3GCM A;  2PMH A;  2CGP A;  1XDS A;  1MJB A;  1V54 H;  3FBI B;  1UB9 A;  2KHM A;  2GA2 A;  4XLP F;  1SFO J;  2UWM A;  1V5F A;  3BR6 A;  3G1L A;  2H1L A;  2R7Q A;  3GZN B;  2V9K A;  3MMY B;  4IZZ A;  3SZT A;  3BR0 A;  1YOV B;  2Z5U A;  1UJ8 A;  4XRS G;  2MBF A;  4F55 A;  2V7F A;  2EWN A;  3IHU A;  2Z16 A;  4R8H A;  4RLF A;  4CCN A;  3OYI A;  4HQE A;  3S3M A;  3H3U A;  4OIO F;  1U3E M;  2N8G A;  4O5V A;  4KIF A;  1XCB A;  2P4W A;  4RGX A;  5AON A;  3DLL F;  2A6T A;  1YO5 C;  3F21 A;  1K6Y A;  3JRE A;  3HEF A;  1VND A;  3BZC A;  1ETY A;  3DBH B;  3Q9S A;  4HNT A;  1O3Q A;  2VE8 A;  3KLN A;  3DTI A;  3TO7 A;  1TW3 A;  2VOP A;  4FHT A;  4YIR X;  4YEL A;  4IHS A;  3AKZ A;  3TW6 A;  2VPR A;  1HF0 A;  3JRG A;  1J0R A;  3M1E A;  3LL7 A;  1W0U A;  2GWR A;  2VJI A;  2CQK A;  4RLQ A;  3RKW A;  4KFC A;  1U8B A;  3C2H A;  1UZC A;  3JSO A;  3S1R J;  1T95 A;  1LUJ B;  4B47 A;  4CO8 A;  1MDM B;  3B73 A;  2GAU A;  3QU3 A;  2R7Z J;  3HG9 A;  3KE2 A;  4LOC A;  2Y48 A;  2DW4 A;  1PYV A;  1UG0 A;  2J5O A;  3PQJ A;  1MMN A;  3VSK A;  5DUK A;  1I6X A;  3IKT A;  3DU6 A;  2GIV A;  4BQO A;  5LGU A;  1I5Z A;  2P5K A;  1FMV A;  4LLG F;  1APL C;  3ZR8 X;  2HS5 A;  3GTL J;  2Z33 A;  2EV6 A;  1Z67 A;  3HXL A;  2DOE A;  5EGO B;  5JHF A;  2P7V B;  1D8K A;  4TV7 A;  3OV8 A;  2JRM A;  4L5J A;  4BJ6 C;  2O5R A;  3OWT A;  2Q2E B;  2VON A;  5J1U A;  3K1P A;  3L2U A;  3M9A A;  4YII A;  4EM2 A;  2NOG A;  3SEZ A;  3HOV J;  4X6A J;  2BHY A;  4BNC A;  3CJR B;  1IV6 A;  1FT9 A;  4QIW N;  2B63 J;  1XG1 A;  3J7A O;  2JA7 J;  2EFO A;  4Y13 A;  1FC3 A;  2HYJ A;  3LST A;  3ZGK A;  1C0W A;  5D6F A;  4AIH A;  5LFA A;  3K4B A;  1J75 A;  1LEB A;  1XX5 A;  1IXC A;  1HW2 A;  2EA2 A;  5BMZ A;  1B6A A;  4CCM A;  3CC2 I;  2CQQ A;  2P81 A;  4D7N A;  1RNL A;  1YJ9 I;  4Y4R A;  2JJ7 A;  1ZK8 A;  2L01 A;  4LLL A;  1B72 B;  1Z0X A;  4A3G J;  1OLT A;  2XPU A;  3L2C A;  3BQY A;  1MDM A;  1ZRD A;  1IRF A;  1FBQ A;  4YEJ A;  2VL8 A;  2E7W A;  1K83 J;  1LQ1 A;  4O3M A;  1WZ2 A;  1BR2 A;  1YLF A;  2DA4 A;  4J01 A;  3RDI A;  3L2R A;  2V1U A;  2JA6 J;  1MBG A;  2COB A;  1O7L A;  1JGG A;  1X2M A;  1ODD A;  4KA4 A;  1OCZ H;  2VI6 A;  3CDH A;  2X48 A;  5DD4 A;  2G9W A;  5JVT A;  5BOX A;  3K4L A;  3FK7 A;  5J8C A;  3H0D A;  1R58 A;  3L1P A;  3H3V K;  1W1W E;  3ZPL A;  1RPW A;  1OKR A;  3K7A J;  1XPX A;  1K6O A;  3VSL A;  4IX7 A;  5D8L B;  2RVC A;  5EGO A;  1JI8 A;  5B1A H;  3S1N J;  3OL4 A;  4UVA A;  1WRJ A;  1AU7 A;  2HDC A;  1Z3X A;  3KET A;  2EFW A;  4KT5 C;  3W3C A;  3MZY A;  3OYF A;  2R3S A;  9ANT A;  2H6B A;  1HKQ A;  1N75 A;  2HQR A;  2IGN A;  3KEO A;  4C3H J;  1R1T A;  4G7H F;  2OUM A;  1JJ6 C;  2IT0 A;  1JE8 A;  4UUS B;  3RPU D;  3BR5 A;  4E7Z A;  2IGO A;  3KP5 A;  1WGX A;  4UNO A;  3HRM A;  2K5C A;  3HPH A;  2QZ8 A;  3PO3 J;  1MH3 A;  4CYC B;  1OCR H;  3H0G J;  3ZQL A;  3S3O A;  3MEX A;  4N4O B;  2K4J A;  1KON A;  2ZFW A;  1B72 A;  3ZCO A;  2R7D A;  4G9Y A;  1AKH B;  3G4S I;  3RKY A;  1FSH A;  1FPQ A;  3PQK A;  1FP1 D;  4HSR A;  4X0G A;  1TBX A;  5D5W B;  2UUZ A;  4ENJ A;  3A02 A;  3KZI C;  4AYB N;  4XIC A;  3OYH A;  3A2K A;  5FD5 A;  1VTN C;  2YSR A;  2P5V A;  2ZSH B;  1SC7 A;  1Y0U A;  4IKF A;  4IRI A;  4L9N A;  3RPQ A;  3CTA A;  3I4M J;  3CUO A;  3ABM H;  2ESH A;  2E34 A;  1S8N A;  3BTL A;  1X4P A;  5F64 A;  2K9Q A;  3ZN1 A;  1XTA A;  5M3M J;  3CUQ B;  3BJA A;  3GLL A;  4LD5 A;  5D4R A;  2AO9 A;  3K70 C;  1MJ9 A;  1SD6 A;  4PSW A;  4BE1 A;  3W6J B;  4AUX A;  3KFW X;  2R7R A;  1R22 A;  3M7G A;  2UZK A;  3C18 A;  1H9G A;  2DI3 A;  3FXM A;  3S14 J;  1OCC H;  2MD5 A;  3O3K A;  1P7I A;  1SAU A;  5AIQ A;  2VKD A;  1WJE A;  1HXD A;  4N4N B;  2L4A A;  3CCU I;  4UUS A;  3MFK A;  3I56 I;  4D7M A;  3HOS A;  1E2X A;  3PO2 J;  1R36 A;  3K4K A;  2BY2 A;  3GXO A;  4MTD A;  1H88 C;  2LKP A;  1RKT A;  4BEH A;  4NQW B;  4BHC A;  5B5E C;  3HHG A;  4FAS D;  1LDD A;  4X1E A;  1BR4 A;  2CYY A;  4BBR J;  2F6C A;  2F5F A;  2QKM B;  1BBY A;  1S9H A;  5C4J J;  2GXB A;  1O4X A;  3BTJ A;  1LJ9 A;  2NXN B;  4XN3 A;  2XV4 S;  4MGR A;  4HNV A;  5CVR A;  5D5V B;  1SAX A;  1LPQ A;  3TMO A;  1U0J A;  2L7F P;  4M3B A;  1H8A C;  1U2W A;  2CW7 A;  2OU2 A;  3BG9 A;  3AG4 H;  3S2H J;  4A93 J;  4ITV A;  3QU6 A;  3GO5 A;  2ZJQ F;  5E8G A;  1K4S A;  3U2R A;  4N9I A;  3QOP A;  2DA2 A;  5KAI C;  1KQ0 A;  2AS5 F;  5D8K B;  2E5N A;  3K2Z A;  1YG2 A;  2GOX B;  3ZOB A;  5EZH A;  2PFB A;  3FDY A;  3FXO A;  4XRS A;  3CUQ A;  1FP2 A;  1YS7 A;  2FMY A;  3BJO A;  2LH9 A;  4XLA A;  4GRI A;  2R7V A;  2MC3 A;  2QWW A;  1WH7 A;  3TO6 A;  1FZP B;  2RDP A;  3HOX J;  1IN5 A;  1K4T A;  4BJT A;  4OAZ A;  3W2W A;  1E3H A;  3HDD A;  2Z3Y A;  5CJ9 A;  2YX7 A;  4IHT A;  2E2J J;  3HTS B;  5FO5 A;  2VOO A;  3K4J A;  3RZO J;  1J5Y A;  1HST A;  2EIN H;  4XL9 A;  2QGU A;  1J2X A;  3GTM J;  2HFH A;  4GCV A;  2NNN A;  2VJ5 A;  1QPM A;  2DT7 B;  2R7W A;  4IHV A;  4L0Y B;  2VBZ A;  2LRD A;  2O3F A;  3KP7 A;  5LHG A;  5FKL A;  4UVC A;  3E6M A;  3JRA A;  1WWX A;  4YIF A;  1FOY A;  4NQW A;  2E71 A;  4DBR A;  1MSE C;  3IUO A;  4KUM A;  2RC4 A;  1R5G A;  3KZY A;  1BIA A;  2Q8K A;  2I10 A;  1QHH D;  3CZ6 A;  4YRV A;  3BCA A;  1XGO A;  3JCU C;  3W2A A;  4U7D A;  2W82 A;  4A5M A;  1BI0 A;  3LSP A;  3MKY B;  4CXF A;  1YRN B;  1JGS A;  1R6R A;  3N4M A;  5DCM A;  3I59 A;  4BHP A;  3HC7 A;  1NG6 A;  4LMY A;  3S1M J;  1VQ5 I;  1A5J A;  3H9Q A;  5JVG F;  3F8C A;  1Y8R B;  3UNG C;  2MH9 A;  1SFK A;  3PFI A;  2QLZ A;  3JTH A;  1KU3 A;  5IOZ A;  3KP4 A;  2M0M A;  4BUP A;  4QSH A;  2XKO A;  5KAF C;  2DPD A;  2DQL A;  4EVI A;  4HLY A;  2HZD A;  1G59 A;  2K02 A;  3I4P A;  4UVB A;  1X1A A;  2CW8 A;  4G6Q A;  2FQ3 A;  2GA1 A;  2Z1D A;  1IRX A;  2VB6 A;  3L2W A;  4BE0 A;  4BU2 A;  5HLH A;  3RPU A;  2FEZ A;  2WV0 A;  3ONQ A;  4E7S A;  4AM3 A;  4JYK A;  1QO0 D;  5L3D A;  5KCM A;  1D0Z A;  1D1B A;  1D8J A;  2ID6 A;  2E1O A;  2HI3 A;  3AFH A;  4CYD A;  1TWA J;  4EJO A;  2IPQ X;  1VQ7 I;  3HOZ J;  1YX5 A;  2OBP A;  2E2I J;  3DCF A;  3NAU A;  2KZV A;  1A31 A;  1KQ9 A;  4MIM A;  1SD5 A;  1Z91 A;  1ZYR F;  2DOF A;  2EZL A;  2OCC H;  3HJE A;  2BEO A;  3GFJ A;  2R7T A;  5GP9 A;  2FBK A;  3CLQ A;  3JRD A;  1ZR2 A;  1F5T A;  1XGM A;  3HZJ A;  2EPF A;  1ETK A;  1ZG5 A;  1TNS A;  5K7Z A;  2JUC A;  3A1Y A;  1USS A;  2DT6 A;  2UXN A;  2IJL A;  2IAI A;  4XOT A;  4CGZ A;  1P6R A;  4ZDP A;  3ZQ7 A;  3JRI A;  4LB6 B;  5IP7 J;  2IW5 A;  3MQ0 A;  3O8G A;  1I1G A;  4M72 A;  2ZC2 A;  3M8J A;  4XN0 A;  3D5R C;  1PP7 U;  1SFX A;  5D5X B;  1JJ8 C;  4ESF A;  3WU1 B;  5FKM A;  3PL8 A;  1R23 A;  1S6L A;  4UB8 C;  2R92 J;  2JRT A;  2BVL A;  4N9H A;  2KT0 A;  1K79 A;  4M9Z A;  1EV7 A;  4AWX B;  3OYN A;  2ZXW H;  5CVJ A;  3LFU A;  1GXP A;  4HX8 A;  4PGH A;  1GVD A;  2Z9O A;  5CQE A;  3S2W A;  3EUA A;  3BDD A;  4ZTF A;  1BI2 A;  2D1V A;  3MN2 A;  3KLO A;  2A6E F;  2MW8 A;  4LFU A;  4Y15 A;  1RES A;  1J09 A;  4RB0 A;  5IYC J;  3S32 A;  4LG0 B;  1OYW A;  4P1W A;  1MKM A;  3DTE A;  2E5Z A;  2HGC A;  3ZP5 A;  1HSJ A;  2CUJ A;  4E7K A;  4UXN A;  1MMG A;  2Z99 A;  5E1W A;  3LQR A;  2V6C A;  4BYY A;  2M34 A;  2OQR A;  2XRN A;  1WJ5 A;  4EMS A;  2KIQ A;  4ETS A;  3Q0V A;  4CCK A;  2DT5 A;  3ECO A;  3R0J A;  1S7E A;  3G73 A;  1T38 A;  2VJ4 A;  2ZXH A;  1A35 A;  3S93 A;  2K3P A;  4EAT A;  1J7K A;  2ME6 A;  1X3W B;  3HOW J;  2VN2 A;  2ACJ A;  3ML6 A;  1DU0 A;  1TTY A;  5C4X J;  1ACI A;  3LMM A;  1RUN A;  3GTQ J;  2ME0 A;  4KIG A;  5BNG A;  2IA0 A;  4HV5 A;  2IS1 A;  2R7U A;  3IH4 A;  4PJJ A;  4JX4 A;  1E3P A;  1UAA A;  4CSW A;  3S2D J;  1ONV A;  5EF6 A;  1ZRC A;  2QSH X;  5H6Q A;  2QF7 A;  2MAB A;  2LVS A;  3E97 A;  2K3F A;  5M5X J;  1IAW A;  3BR2 A;  2DN0 A;  2BY1 A;  3IL2 A;  3S1Q J;  1BOA A;  4WCG A;  4PK4 A;  2MA3 A;  4HYE A;  4A0Y A;  4DIQ A;  4EM0 B;  1BJZ A;  3HSE A;  3A01 B;  3S3N A;  2LBF B;  2R5Y B;  3K69 A;  3HL2 A;  1XDU A;  4PDK A;  3OSG A;  3FWE A;  4PCQ A;  2K4B A;  1MW7 A;  3OSF A;  1FOX A;  2OF7 A;  1O3R A;  3DFG A;  2Y30 A;  1YX3 A;  4LG0 A;  4XSZ F;  4KIC A;  1VZ0 A;  2KDZ A;  2MSY A;  2HQA A;  3DKX A;  2FU4 A;  5JFR A;  1F36 A;  2L02 A;  1P4A A;  4JP0 A;  1J59 A;  4ASN A;  2NAZ A;  4IJA A;  4GGG A;  3EYY A;  2V9V A;  2W84 A;  3U1D A;  3JR9 A;  2EH3 A;  2E2H J;  1BOB A;  3J7Z I;  1G6N A;  1SD7 A;  1ETV A;  5FFZ A;  4AVZ A;  1TL8 A;  3DBR B;  3I3L A;  4ZH4 F;  1IRZ A;  2BYV E;  1KU2 A;  2LNB A;  2JVH A;  3FXL A;  2QYO A;  2FML A;  4J00 A;  1JTY A;  1Z7U A;  4JOM A;  1LFP A;  2LFB A;  1JUS A;  4JK1 X;  2I8D A;  2X51 A;  1MGT A;  2XF6 A;  4GXO A;  3BG7 A;  3CCS I;  3WE3 A;  3BG5 A;  4HDU A;  1N77 A;  4AYB A;  1WJA A;  3Q3S A;  3S8P A;  2KJB A;  3UR3 C;  2HOT A;  2ISY A;  2LBF A;  3RYP A;  3BZK A;  2DMP A;  2F48 A;  4HZF A;  5FB2 A;  1X2N A;  1FEX A;  1ULY A;  2Z2S B;  1TWC J;  1TLH B;  2L4M A;  2V1D A;  2E60 A;  3WTV C;  1ZG1 A;  2XAF A;  4KDP A;  3W2V A;  3PUF A;  4IPA A;  1HW5 A;  1YIJ I;  2WB1 N;  1H0M A;  5TJJ A;  1FYK A;  1QBJ A;  2QQ9 A;  5FKN A;  3OYA A;  3GTJ J;  3KEY A;  1FTT A;  2OD5 A;  5FLM J;  2VE9 A;  4I02 A;  3VYU B;  3SJM A;  4Y17 A;  3MZ8 A;  3OYL A;  2OA4 A;  4HRI A;  4ZYE A;  5FLX K;  3FKI J;  1IZ1 A;  3V4G A;  3I55 I;  1SVL A;  3O8H A;  2XB5 A;  1OQY A;  3O6B B;  4I76 A;  4A3B J;  1QGP A;  2Y0M A;  1KYW A;  1TQP A;  3DU5 A;  4RAF A;  3ZN0 A;  1MND A;  3TQN A;  1GT0 C;  3HRU A;  1R7J A;  1T0F C;  5IP6 A;  2CWE A;  1F43 A;  3SZG A;  1MBK A;  2VJJ A;  3IP4 B;  1EH6 A;  2O03 A;  2KRH A;  3C2B A;  3CF5 F;  2VKV A;  1QVU A;  1WJD A;  4I6Z A;  1EF4 A;  3ABK H;  4E6K G;  3K70 D;  2RQQ A;  4PJN A;  1I1S A;  1T33 A;  4MHG A;  3O2P E;  1GUU A;  2H8W A;  2EFP A;  2DJI A;  2A05 A;  1Q1V A;  4WX9 A;  1R71 A;  1ON1 A;  3ELK A;  3K2A A;  2XKP A;  3C7J A;  4HNU A;  3N05 A;  2KIF A;  2M4K A;  4D1Q A;  1SVO A;  3CP8 A;  1U9O A;  2FX0 A;  4RM3 A;  5LRR A;  4S0H B;  1XCV A;  2F5C A;  3BZ6 A;  4HQM A;  3OIO A;  3CO7 C;  5BPD A;  1FOK A;  2VUM J;  1ZEL A;  5F1J A;  5IT9 K;  1Y56 A;  1QZE A;  3I64 A;  4KIT B;  3J80 K;  4LIV A;  1YW8 A;  4F92 B;  2A07 F;  3OYM A;  2YU9 J;  3H35 A;  3BTC A;  3DF8 A;  3CCM I;  4E7I A;  3FK6 A;  3KPH A;  2EFQ A;  3EUH C;  2CV2 A;  5L3E A;  2MYS A;  3DP7 A;  4M6V A;  3FM5 A;  5JI6 A;  2ZNZ A;  3L9F A;  2MLG A;  2LLK A;  1PP8 F;  1ZRE A;  5B3S H;  2JN6 A;  3OIP A;  4IVN A;  1Z1D A;  1V4R A;  2BGC A;  1NHA A;  1EH7 A;  1GV5 A;  4IHX A;  1KGS A;  4P96 A;  1W7P D;  2YU3 A;  4S04 A;  2R93 J;  3CQZ J;  1GLN A;  2DLL A;  2LTP A;  2X4H A;  2C6Y A;  5FRO A;  2DMQ A;  4D5F A;  3ZQF A;  2DBB A;  2NVX J;  1WJF A;  4B8X A;  1VFC A;  1IUY A;  3T8T A;  2VPL A;  4RDU A;  1MIJ A;  3WTT C;  3OR2 C;  1VQK I;  4UHT A;  4DW6 A;  3JTG A;  2DA3 A;  4BDY A;  3U1K A;  1VQO I;  2HKX A;  1WI3 A;  3G1M A;  4U87 A;  1YFH A;  5ICG A;  1YIT I;  1X3Z B;  3DWL E;  3I5U A;  5J3L A;  4F91 B;  5H2F C;  5FRN A;  1OCP A;  3DLA A;  1PUE E;  1A04 A;  3PM1 A;  2K9N A;  3CLO A;  2ZNY A;  4HG2 A;  1BR1 A;  3BPV A;  1FJL A;  4BQA A;  5GAD J;  3E5X A;  4YFN F;  3OS2 A;  3TBI A;  4DOZ A;  5KHD A;  2DPU A;  4I7H A;  1OR7 C;  4NHJ A;  3H1C A;  4V2G A;  3FM3 A;  4ANJ A;  4V19 K;  1GV2 A;  1LEA A;  1DGR M;  3J81 Z;  4DYQ A;  2L0K A;  3HGG A;  2FJ1 A;  5J47 A;  1GXQ A;  5HLI A;  2QSG X;  1MH4 A;  1JKR C;  5E17 F;  5D6E A;  4U0Y A;  1JT6 A;  4CH7 A;  1WI9 A;  2RV8 A;  4NC7 A;  2FD5 A;  5KNL A;  2PG4 A;  2PLY A;  3VOE A;  2E36 A;  3BOQ A;  3VPR A;  3AAF A;  3E6B A;  2NVU B;  1QHG A;  4HEA 2;  2KJC A;  2O8X A;  2GLO A;  1B9M A;  3G71 I;  4ZZD A;  2CO5 A;  4HF0 A;  2W25 A;  2ZBK A;  2QUF A;  5BPI A;  4NB5 A;  5IP9 J;  3K1N A;  5L3G A;  2EIK H;  1NK2 P;  3AL0 C;  3A0B C;  2MFZ A;  3I71 A;  2BZT A;  1ZR4 A;  1P92 A;  3NAR A;  2XGX A;  3F0C A;  2WV1 A;  2DA7 A;  3LSJ A;  5D4S A;  5DYM A;  4ZYH A;  4D9J A;  3FXJ A;  2KRC A;  5F0F A;  5EJC A;  5LD2 C;  3L2Q A;  3ERE D;  3MZH A;  5HLG A;  1DGW Y;  1D5V A;  3I9V 2;  2VKH A;  4MFD A;  3U21 A;  4E7L A;  2F2E A;  4LIU A;  3KIO A;  5LHH A;  2GOM A;  4EQQ A;  4UY8 I;  1DP3 A;  6PAX A;  2B7E A;  3GFM A;  1U9N A;  2HZT A;  4QPO A;  2VIX A;  3CME I;  1ETO A;  2PEX A;  1W7P B;  1MBF A;  4BEH B;  4BL0 B;  3DTK A;  3SZP A;  4FTH A;  4OAY A;  3PNT A;  4C3I J;  3BJ6 A;  5J1R A;  1MMA A;  2MLK A;  2BY0 A;  4B09 A;  3QOE A;  4G6T B;  2CG4 A;  5JLW A;  5IT3 A;  3F8N A;  1FIA A;  3IWZ A;  5M5Y J;  3P9I A;  2ZXJ A;  3BTI A;  1HKT A;  2DOA A;  5EG0 A;  2LF8 A;  1WQ2 A;  1T2K A;  3HTU A;  5IYB J;  2M45 A;  3HYI A;  2L9V A;  1Z9C A;  1E0E A;  1V55 H;  4RA2 A;  4BHB A;  1TWG J;  2M3A A;  1NTC A;  1IV8 A;  4GO1 A;  5GAH J;  3VWB A;  3LAJ A;  3GME A;  5JLX A;  2DFE A;  2AXL A;  2FQ4 A;  4KMU X;  2LY9 A;  4FX4 A;  3EET A;  2KLO A;  4EJU A;  3QPL A;  4DYR A;  4MQV A;  4HAM A;  4CHU A;  2G7U A;  1Y1V J;  3EDP A;  3DV8 A;  2ZME A;  2EZI A;  1P9Q C;  2E1M C;  2LOO A;  2M2E A;  3CMM A;  5KVR A;  4JBA A;  4QPQ A;  2F5E A;  4NUB A;  2F5V A;  1W36 C;  2D45 A;  1IXS B;  2L7M P;  2A6H F;  5E3L A;  3R4K A;  3WG9 A;  2M7A A;  2CFO A;  4L9V A;  2P0W A;  1SMT A;  4S05 A;  2QA4 I;  5D5U B;  2XAQ A;  3KYD B;  2NS8 A;  2EFN A;  4A0X A;  1P4W A;  5AIP A;  3CCV I;  4IOC F;  4L9T A;  3HM5 A;  2HVS A;  3DEW A;  1MBE A;  4HST A;  1O7F A;  3IKV A;  2Y0S N;  4RM2 A;  1TNT A;  4C3J J;  4ESB A;  1QU3 A;  3IAM 2;  3ZRG A;  1IN4 A;  4XLH A;  4MFE A;  3DKW A;  4KJZ A;  1P2F A;  3ABU A;  2A5W A;  2ZME C;  5F08 A;  1W7P A;  4NNJ A;  2XSJ C;  1I27 A;  3GX4 X;  1IJW C;  2YUS A;  2A69 F;  4PFP A;  3RQI A;  4CDG A;  5HNH A;  3ZQH A;  4FT8 A;  3J7Y J;  3WTS C;  5H6R A;  1BI3 A;  3N97 A;  3DEU A;  1DPR A;  3Q5F A;  3CF2 A;  3F8F A;  3JW4 A;  4HF2 A;  4M6X A;  3V8J A;  3RTR A;  4ENM A;  2A3S A;  5DCM B;  3QPS A;  3I59 B;  4LLN A;  3A4C A;  5LRS A;  1R1V A;  1YHQ I;  5ILV A;  1N78 A;  3F6O A;  2XGC A;  4RBO A;  4I98 B;  3KP6 A;  2TCT A;  2DJN A;  3OOP A;  3VB2 A;  1HBX G;  3BY6 A;  2K9L A;  3MKL A;  1RET A;  3I53 A;  2CMP A;  2QEN A;  3L00 A;  2DA6 A;  2L7Z A;  2LKX A;  1OCO H;  3NQO A;  1WFX A;  2ICW G;  1X1P A;  2DYS H;  1SFU A;  2JA2 A;  2XGD A;  5HS7 A;  1VQ6 I;  2VOD A;  2P6S A;  2M0C A;  2VXZ A;  2ZXI A;  4ZDL A;  3OMY A;  2FUG 2;  3U9G A;  4A0Z A;  2G0E A;  1K78 B;  5K5Q A;  1MD0 A;  4G94 A;  1T8I A;  2W7N A;  5JHU A;  2PJP A;  3MD2 A;  1CGP A;  3QAH A;  2HQN A;  1IN8 A;  3DQV C;  2KMU A;  4B3X A;  5FLX Z;  5LEK A;  3LNQ A;  2DA5 A;  5HOO A;  2ZJR F;  3FMS A;  4PSX A;  5CVI A;  3A0H C;  2ID3 A;  2CQN A;  2GZW A;  5J4Y A;  2KPM A;  2IEK A;  3FXR A;  1AOY A;  1BA5 A;  5E3O A;  4A3K J;  3LSH A;  1IG7 A;  3EQL F;  3GLX A;  5DV5 A;  3V7C A;  5F0H A;  2LY1 A;  1UMQ A;  2IGK A;  3COA C;  2H1K A;  3SEQ A;  2GM4 A;  3BRO A;  2Q1Z B;  1JXS A;  2V26 A;  1BM9 A;  3FIS A;  3LAP A;  1ENH A;  2FA5 A;  3VEP A;  2PMZ A;  2WB1 A;  1GHC A;  3DBL B;  4XRF A;  3K9T A;  4RGU A;  5ICC A;  4OWR B;  4KMF A;  1I3A A;  2CJJ A;  2HOE A;  2V1N A;  1ETW A;  2NOJ B;  1I3Q J;  2DOD A;  4MLO A;  4ZYD A;  4PJ0 C;  3F22 A;  2CV1 A;  2ESN A;  4G6D A;  3PIP F;  5EDN A;  2XIG A;  1FX7 A;  3KP3 A;  3G3Z A;  3ZXS A;  1T08 B;  2XVC A;  4W97 A;  1XGN A;  3ZQC A;  4IRH A;  3NRV A;  4U7B A;  5ICE A;  5IT9 Z;  1DP7 P;  4I0B A;  4WXH A;  3HIF A;  3J80 Z;  3QQA A;  2Y9Z A;  2WC2 A;  1YI2 I;  3FX3 A;  4WWC A;  1XMK A;  2OZ6 A;  2PI0 A;  4P9U A;  1T39 A;  2EA4 A;  1MNM C;  1D0Y A;  1U5T C;  5DM7 F;  2K27 A;  5CVU A;  2XUB A;  2DAO A;  4E7H A;  1K78 A;  5DUI A;  1LE8 A;  1REP C;  4FET A;  3WE2 A;  2WY7 Q;  3HOT A;  4II2 A;  1S7O A;  4UB6 C;  3T8R A;  1VQP I;  1IW7 F;  2WBM A;  3H5N A;  3M07 A;  2ZSI B;  3V8L A;  5J6X A;  5J8F A;  4IF4 A;  1ZQ3 P;  1VQ8 I;  4BBS J;  4H4K C;  4G8X A;  2QQ8 A;  3OIQ A;  1OJL A;  2OQG A;  4PZJ A;  3EPZ A;  1UHW A;  4XSX F;  2FSW A;  2HOS A;  3HUG A;  3J81 K;  1S5L C;  3MCZ A;  3KYC B;  3JRC A;  2A68 F;  1FYM A;  2OZU A;  3FXK A;  1KU7 A;  3HHH A;  4KIB A;  3HOY J;  3FF5 A;  1FY7 A;  3F23 A;  3LQQ A;  2KP6 A;  4ON0 A;  2K7L A;  2VKE A;  2QEX I;  1O3T A;  1YJN I;  3G6E I;  3GEZ A;  1V5G A;  2RKH A;  2X6Y A;  1UG2 A;  2F4M B;  2WTE A;  2W85 A;  4DQ2 A;  4M3E A;  2FNA A;  3HB9 A;  3W6K B;  1I6H J;  1FNN A;  2V9P A;  1D1C A;  2XC7 A;  3PIO F;  2QQB A;  1X58 A;  2DK8 A;  3RI4 A;  1ZAO A;  1E3O C;  1O57 A;  2JWT A;  2MH2 A;  2LG4 A;  5A2Q Z;  1MBJ A;  2EIL H;  1PJR A;  3MWM A;  1EH8 A;  4MEY F;  1QRY A;  5K7F A;  4XLF A;  1D5Y A;  1R4M B;  4PJM A;  3T5X A;  5EEA A;  1R5I D;  5FFX A;  3KYL A;  2HYF A;  1TQM A;  4MEX F;  4AIK A;  4Y52 J;  2WAQ A;  4R79 A;  3F9K A;  3MKZ A;  2A61 A;  3E6C C;  4EGY A;  3HOU J;  5IYD J;  5J1Y A;  1I50 J;  4XLC A;  3FXQ A;  2I5U A;  2KL4 A;  2W48 A;  1X1C A;  1R49 A;  3OYG A;  2L9N A;  2IXS A;  3PNV A;  3CCY A;  2PX9 A;  3EUK L;  4IXA A;  3CJQ B;  4J19 A;  3TKY A;  4PGG A;  4XOR A;  3PNY A;  3KCC A;  2X1E A;  4RB1 A;  3WHB A;  1SAN A;  2DXI A;  2CFX A;  2STT A;  2R0Q C;  2MD0 A;  1D1A A;  2Y9Y A;  5K5O A;  3S17 J;  1ZRF A;  2BY3 A;  2EJR A;  5KK1 A;  3RIR A;  1ZHF A;  3E3V A;  5FD6 A;  4Z6Y A;  2R7X A;  4R1H A;  2Q0O A;  3SDG A;  3LA7 A;  2O6G E;  2NVY J;  4D5C A;  4HDV A;  1D0X A;  1G3Y A;  1YE9 A;  3WG7 H;  4KN7 X;  2STW A;  2LSO A;  1W4M A;  1UHS A;  1Z77 A;  4G12 A;  2UV1 A;  2CS3 A;  4V2F A;  3RYR A;  3JSP A;  3L7W A;  3QYE A;  4M9S A;  2FF4 A;  3HRT A;  4XBF A;  3SHF A;  4XID A;  1R00 A;  1AHD P;  2DA1 A;  4A6E A;  2Y31 A;  4A3L J;  5DDG A;  2VQL A;  3HRS A;  3MVP A;  4DGW B;  4HA8 A;  3CES A;  1BC8 C;  2EZH A;  2LC2 A;  2DTR A;  2RGV A;  1XMX A;  1LVK A;  3E1S A;  3DXJ F;  1BL0 A;  2DQR A;  3LSI A;  1MMD A;  1DQU A;  3GYH X;  5HLT A;  2QQA A;  5DEQ A;  3RKX A;  2JZY A;  3BWG A;  3QWL A;  4KT6 A;  5LGT A;  1Y6I A;  5L3B A;  2Y69 H;  3H36 A;  2JMW A;  3DPU A;  4BAC A;  2LP0 A;  2HPM A;  2M8E A;  2CRG A;  3OY9 A;  1RUO A;  1LVA A;  4CZC A;  2W24 A;  1VQN I;  4BKX A;  4JX5 A;  2DDB A;  3WGG A;  1ZGJ A;  2EBI A;  1O3S A;  1DDN A;  4Y33 A;  1D3Y A;  2BOL A;  5E1X A;  4OIR F;  4DJA A;  4A3I J;  3CDI A;  4WXD A;  4FIS A;  3I54 A;  1LKX A;  5E8I A;  2QBY A;  2NVT J;  3GWZ A;  2XF5 A;  1B1B A;  3JRH A;  2HTS A;  3CO6 C;  1QVT A;  2IS2 A;  4BGD A;  4YG2 F;  1TC3 C;  1VQM I;  3F8B A;  2KRF A;  4IOA F;  3ASO H;  4YFK F;  1T0F A;  3L2V A;  2X6O A;  2VBW A;  5C3E J;  2JK3 A;  2VQC A;  4AVP A;  1STZ A;  3RQ4 A;  1U6G A;  2ECB A;  2YPR A;  3JAM Z;  2PMZ N;  1FIP A;  2D2W A;  1ON2 A;  3AG1 H;  1X1D A;  3ZMD A;  1BN5 A;  2LY2 A;  2H8R A;  3NEU A;  2O0Y A;  1B4A A;  4A5N A;  1IC8 A;  5DD8 A;  2X85 A;  3M8E A;  2EIJ H;  1W5S A;  4ZJZ A;  1DPU A;  5HDG A;  5F0C A;  2O9L A;  5CVV A;  3M1C A;  2P5L C;  4PJL A;  4I01 A;  4E4H A;  3JRF A;  4K2E A;  5E3N A;  3QRF F;  2IVM A;  2HYG D;  2KIM A;  4XK4 A;  4XR6 A;  5ED4 A;  5M3F J;  3I58 A;  4LJZ F;  2JUG A;  4L5I A;  1ITY A;  2X6X A;  3EYI A;  3OYJ A;  5ILS A;  2VAS A;  3IH2 A;  5EZG A;  1JKO C;  2QVO A;  3B6C A;  2Y0S A;  1OCT C;  1H9T A;  3BG6 A;  4UUT A;  1LDK B;  4A3F J;  1S72 I;  3TDU C;  1W36 D;  3FXU A;  4IHW A;  1MBH A;  1KA8 A;  2LF7 A;  4NDL A;  3TED A;  1EJ9 A;  4KN4 X;  2P6T A;  4C9Y A;  3EUH A;  5IOY A;  2CH0 A;  1WSU A;  1P4X A;  4IHY A;  2L2O A;  3QOD A;  3OYE A;  4F93 B;  1MZB A;  4LB5 A;  1TWF J;  2NS7 A;  2JA5 J;  4JX6 A;  4AIJ A;  3LOC A;  3H3Z A;  3ZQQ A;  3C3W A;  3K10 A;  1RI7 A;  1V5E A;  1OFC X;  2AQF A;  3QP5 A;  2OAZ A;  2CQX A;  3C2G A;  2F4I A;  1ZAR A;  3M8F A;  3VYR B;  3P9C A;  1VI0 A;  4BE2 A;  2AQE A;  2X9D A;  2HDD A;  2Y75 A;  4BXF A;  2R7O A;  1TWH J;  2XPV A;  2Y2Z A;  4HX4 A;  1P7J A;  4AU7 A;  1G8X A;  1ZGA A;  2BE5 F;  2FE3 A;  1Z6T A;  2DTZ A;  2ZB9 A;  3FBN B;  5HOD A;  1UST A;  4LGW A;  1L3L A;  3ASN H;  3GTP J;  2BXY A;  2FRH A;  2ELH A;  2TDX A;  2ZKZ A;  3K4N A;  4M6Y A;  3AL0 B;  5DTD A;  4I99 C;  3REO A;  1W5T A;  1BIB A;  1UCR A;  4M74 A;  5HDN A;  4U88 A;  4IEJ A;  3I4N J;  1RR8 C;  1YIO A;  3LWF A;  2H09 A;  1IN7 A;  4XOP A;  5GPC A;  1TZL A;  5C44 J;  2HU9 A;  2HXO A;  1B8I A;  4MQ9 F;  2M8G X;  1WJC A;  1ZTR A;  1NH3 A;  4XLN F;  4AD9 A;  1A6Q A;  1XS9 A;  3CCR I;  2HXI A;  1OR7 A;  3HKZ A;  3LA2 A;  5K5R A;  2OCE A;  4FCY A;  2WA0 A;  3HSF A;  5GAG J;  5CKT A;  5ILU A;  3OL3 A;  2MC4 A;  5BS6 A;  4CCJ A;  3IC7 A;  4II3 A;  1Y0N A;  2WAQ N;  4B4C A;  4DNC A;  3T1B A;  2KIU A;  5L3F A;  3SFI A;  3WTY C;  3HBL A;  3G1O A;  3K0L A;  1SEU A;  1SMY F;  3P7N A;  4GFB A;  2EV5 A;  4RAY A;  4RAZ A;  2M87 A;  5GAE J;  5CPR B;  3CD6 I;  3K6G A;  3AG2 H;  2K40 A;  2VBY A;  2V4J C;  3WGI A;  4IQ4 A;  2KDO A;  4OOI A;  4XMY A;  5FGM A;  3RZD J;  5CLS A;  1NK3 P;  4RB2 C;  5A2Q K;  1Y39 A;  1UFM A;  1IGN A;  1FBU A;  1WJB A;  5CQG A;  5ICF A;  3VDX A;  1Y8Q B;  4QLC U;  1LFB A;  2WWY A;  5K7H A;  2DMN A;  2ZO4 A;  2EQR A;  4IQJ A;  4A6D A;  1LFU P;  3CC7 I;  3NWS A;  2FXA A;  4ZYG A;  2B9S A;  3E0J B;  3JAM K;  3IH3 A;  4W1U A;  4YFX F;  5HNF A;  3CJT B;  3IRQ A;  1IRG A;  1KZH A;  2ELJ A;  3BPX A;  2L7K A;  2E1M B;  1N25 A;  5FKK A;  2LDU A;  2RRE A;  3L09 A;  3DEE A;  3WOD F;  5GTH C;  4AID A;  4Q5S F;  2CUE A;  4BY7 J;  4QTR A;  1G3W A;  4OIQ F;  5EG0 B;  2R7F A;  4BQQ A;  4F3Q A;  1SFE A;  3VFZ A;  1FSE A;  3CMY A;  4XKW A;  3KEQ A;  1Y1W J;  1IDY A;  1T6S A;  3LSG A;  4M9X A;  2QCO A;  4NC8 A;  1B9N A;  1EA3 A;  1XSX A;  1CQT A;  1HA8 A;  3SDB A;  2HWV A;  3F3X A;  3M4O J;  2R7S A;  1IUF A;  4MNU A;  4XRM A;  2BXZ A;  3QYB A;  2XDV A;  4EJT A;  2DMU A;  2ZME B;  2XAS A;  3GBG A;  4NBQ A;  5E20 A;  1MNE A;  1JKQ C;  5FKO A;  4C2U A;  2VQG A;  2X0L A;  2H94 A;  5F1R A;  4EGZ A;  5LHI A;  2R5Z B;  2HTJ A;  2EZK A;  2NRA C;  1XMA A;  4U0W A;  3E6D A;  4OU0 A;  1YW7 A;  2DFI A;  3V7R A;  2OJE D;  1G3T A;  3PJR A;  4Z2Y A;  4DZP A;  5JR3 A;  3TGN A;  2A5Y B;  3MKW B;  4UUV A;  3DKY A;  1HDP A;  3Q0U A;  4ZYA A;  2LYC A;  1YJW I;  2B0L A;  3BR3 A;  5B1B H;  2LK2 A;  1Z3Y A;  2VXD A;  3KZZ A;  3LSM A;  2NNY A;  4FE7 A;  1K61 A;  2ETH A;  4MO7 A;  3E5Q A;  2O61 A;  3IRR A;  1OMI A;  2Q2E A;  1TT5 B;  3TO9 A;  1ZN2 A;  4FX0 A;  2M1B A;  2DK5 A;  3Q0W A;  2DU9 A;  2XAH A;  3QPT A;  1QA6 A;  3VYS B;  2IRF G;  5IPA A;  3FHN A;  4CZZ A;  1RRJ A;  4EM1 A;  5F27 A;  1HC8 A;  2RAE A;  3ZMV A;  5E18 F;  2HVR A;  3C1D A;  1ERD A;  3J7A Y;  2BVM A;  1RC9 A;  3V8K A;  3GTO J;  2JVG A;  2EB7 A;  3FKJ A;  3BCB A;  4LK0 F;  3BT9 A;  3S16 J;  3GTK J;  2O7O A;  2EV0 A;  1VF9 A;  1AWC A;  2OPT A;  2AXT C;  4PUS A;  4B3A A;  3ZMS A;  2R5Z A;  2ZCW A;  2F5D A;  4G7Z F;  2XAU A;  2M30 A;  2YX4 A;  2HEO A;  1TP4 A;  5GTI C;  2MGQ A;  1GDT A;  4CCO A;  2ZJ2 A;  2M4G A;  1X1B A;  4UV9 A;  4A3C J;  2PQ8 A;  3FZV A;  1WVR A;  2ECC A;  4M3G A;  2JSP A;  2H6C A;  3CMA I;  4EEF G;  3FHZ A;  3GFL A;  1YQA A;  1QQI A;  2JTV A;  5J4V A; 
#chains in the Genus database with same CATH homology
 3SQN A;  3E5U A;  4QWQ A;  4ESJ A;  3D5L A;  1U5T B;  4N0B A;  4P55 A;  1V3F A;  3R61 A;  2FOK A;  2PN6 A;  3ROU A;  2L54 A;  1QNT A;  2FNP A;  4O6J A;  4H0E A;  3V7S A;  2JPC A;  4RB3 C;  3BP8 A;  1OYY A;  2NYX A;  5K1Y A;  2K86 A;  3GW2 A;  2YR2 A;  3FMQ A;  4HW0 A;  4KYW A;  4HV6 A;  1WKM A;  4BH9 A;  3LA3 A;  3TDZ C;  4IRG A;  4M71 A;  1HW1 A;  2VC1 A;  4OMY A;  2M5W A;  3SFZ A;  4CIC A;  1UHM A;  1ZH5 A;  2XHK A;  3R0A A;  1F1Z A;  2ADU A;  4GYG A;  1IXR C;  5F6F A;  5EEG A;  5HS9 A;  2FBI A;  1XD7 A;  2ISZ A;  4HOB A;  1HKS A;  3QP6 A;  3QPH A;  1XSD A;  5BQT A;  1YS6 A;  1OPC A;  2JSC A;  1Z6R A;  1U5T A;  3DPL C;  2CSO A;  2E1C A;  5LBQ A;  1LDJ A;  1OYI A;  4RGR A;  3F6V A;  3F8M A;  1S3J A;  3ZMU A;  2UXX A;  3CUQ C;  4OIN F;  3SXY A;  2L3D A;  2H27 A;  2J5P A;  1R1U A;  1IF1 A;  2NS0 A;  3R60 A;  2GQQ A;  1PDN C;  4L9J A;  3ABT A;  5E1Z B;  3K1M A;  4D0P A;  1SD4 A;  2VC0 A;  1F4K A;  4RS8 A;  5LEJ A;  2D1H A;  3WTZ A;  1FYL A;  4EJW A;  4I0A A;  1JHF A;  2QM3 A;  2XRO A;  3WTU C;  3GFI A;  5HVQ C;  5CYV A;  3ISP A;  4Q47 A;  1TW2 A;  1CF7 B;  4M73 A;  4WK8 F;  4KNY A;  2W57 A;  1J9I A;  1ZLJ A;  3RJP A;  2G7H A;  5DCF A;  3P9K A;  3HSR A;  3GVA A;  4L18 B;  3F72 A;  4P9F A;  1U8R A;  4ZZL A;  1G4D A;  3WTX C;  2KKO A;  2IA2 A;  1S29 A;  1QZY A;  4JQF A;  2VT3 A;  1G3S A;  2HR3 A;  4L0Z B;  5EEH A;  1T98 A;  4HLX A;  3LFK A;  2P8T A;  2IP2 A;  1KYZ A;  3GF2 A;  3CJN A;  1U78 A;  4OIP F;  1XSV A;  4WF2 A;  1MJA A;  1Z05 A;  1IN6 A;  2XAG A;  1Q1H A;  1QZZ A;  3D0S A;  4ENN A;  1HQC A;  3B02 A;  1XGS A;  2PBI A;  4LK1 F;  4G7O F;  2V79 A;  2RNJ A;  2BBY A;  1RIO H;  2EK5 A;  3GZ5 A;  1CF7 A;  1GVJ A;  4Q4Z F;  4A12 A;  2DO7 A;  2IA1 A;  3ECH A;  4P5O A;  4U0V A;  4MTE A;  3R6S A;  2QBY B;  1LNW A;  3Q9V A;  4HBL A;  3GZ6 A;  3I0T A;  3DPT A;  1DUX C;  2HKO A;  1E17 A;  4E70 A;  4EJV A;  3WGH A;  4A2U A;  1S7A A;  2RQP A;  3WTW C;  1XN7 A;  1RZ4 A;  5TRD A;  1F9N A;  2BV6 A;  2GXG A;  4F7Z A;  1YW9 A;  1R5H A;  4I09 A;  3VOD A;  3KP2 A;  5LLQ A;  1LB2 A;  5HS8 A;  4WXC A;  1BC7 C;  1K7A A;  4GYI A;  3TOB A;  3WU0 A;  4OMZ A;  4HF1 A;  1BJA A;  4EV0 A;  3ZMT A;  1ZLK A;  2P7C B;  1B59 A;  5H20 A;  4RGS A;  3T0Y A;  4HX7 A;  2VT2 A;  2E1N A;  2PMU A;  1L0O C;  3TOA A;  1XB4 A;  2RN7 A;  1FLI A;  2XAJ A;  1BI1 A;  4BXU A;  4Q48 A;  1TQI A;  2V1X A;  3IWF A;  2JT1 A;  1FBS A;  1YTY A;  3ZMZ A;  4ENK A;  1KQ8 A;  5ERI A;  3FMR A;  1X3U A;  4BAY A;  3GUD A;  5LGN A;  2FBH A;  2VBX A;  4I2O A;  2COM A;  2JPB A;  5L3C A;  5HDK A;  4UV8 A;  1FWZ A;  1ZG3 A;  2CW0 F;  3H92 A;  3ULQ B;  2E7X A;  3MAJ A;  1KU9 A;  1YYV A;  1JHH A;  2PMH A;  2CGP A;  1XDS A;  1MJB A;  1UB9 A;  2GA2 A;  4XLP F;  2UWM A;  3SZT A;  2Z5U A;  2MBF A;  2EWN A;  3IHU A;  4R8H A;  4HQE A;  3H3U A;  4OIO F;  1U3E M;  4O5V A;  4KIF A;  1XCB A;  2P4W A;  4RGX A;  5AON A;  1YO5 C;  3F21 A;  3Q9S A;  1O3Q A;  2VE8 A;  3KLN A;  3TO7 A;  1TW3 A;  2VOP A;  4FHT A;  4IHS A;  1J0R A;  3M1E A;  2GWR A;  2CQK A;  3RKW A;  4KFC A;  3JSO A;  1MDM B;  4CO8 A;  3B73 A;  2GAU A;  3QU3 A;  3KE2 A;  2Y48 A;  2DW4 A;  2J5O A;  3PQJ A;  5DUK A;  1I6X A;  3IKT A;  2GIV A;  5LGU A;  1I5Z A;  2P5K A;  4LLG F;  2HS5 A;  2Z33 A;  2EV6 A;  2P7V B;  1D8K A;  4TV7 A;  3OV8 A;  4L5J A;  2VON A;  3K1P A;  3M9A A;  4YII A;  4EM2 A;  4BNC A;  1FT9 A;  3J7A O;  2EFO A;  4Y13 A;  1FC3 A;  3LST A;  1C0W A;  5D6F A;  4AIH A;  1J75 A;  1LEB A;  1IXC A;  1HW2 A;  2EA2 A;  5BMZ A;  1B6A A;  1RNL A;  2L01 A;  4LLL A;  3L2C A;  1MDM A;  1ZRD A;  1IRF A;  1FBQ A;  2E7W A;  1LQ1 A;  4O3M A;  1YLF A;  3RDI A;  2V1U A;  1O7L A;  1ODD A;  4KA4 A;  5DD4 A;  5BOX A;  3CDH A;  2G9W A;  5JVT A;  5J8C A;  1R58 A;  3ZPL A;  1OKR A;  1K6O A;  5D8L B;  2RVC A;  4UVA A;  1WRJ A;  2HDC A;  3KET A;  2EFW A;  4KT5 C;  3MZY A;  2R3S A;  2H6B A;  4G7H F;  1HKQ A;  2HQR A;  3KEO A;  1R1T A;  2IT0 A;  1JE8 A;  3KP5 A;  4UNO A;  3HRM A;  2QZ8 A;  3MEX A;  2K4J A;  2ZFW A;  2R7D A;  4G9Y A;  3RKY A;  1FSH A;  1FPQ A;  3PQK A;  1FP1 D;  1TBX A;  5D5W B;  4ENJ A;  5FD5 A;  1VTN C;  2YSR A;  2P5V A;  1Y0U A;  4IRI A;  4L9N A;  3RPQ A;  3CTA A;  3CUO A;  2ESH A;  1S8N A;  5F64 A;  3ZN1 A;  3CUQ B;  3BJA A;  4LD5 A;  5D4R A;  1MJ9 A;  1SD6 A;  3W6J B;  3KFW X;  1R22 A;  3M7G A;  2UZK A;  3C18 A;  1H9G A;  2DI3 A;  2MD5 A;  3O3K A;  5AIQ A;  1HXD A;  2L4A A;  3MFK A;  3HOS A;  1E2X A;  1R36 A;  3GXO A;  4MTD A;  2LKP A;  4BHC A;  3HHG A;  1LDD A;  2CYY A;  2F5F A;  1BBY A;  2GXB A;  1LJ9 A;  2XV4 S;  4MGR A;  5CVR A;  5D5V B;  1SAX A;  1U2W A;  2OU2 A;  3QU6 A;  3GO5 A;  5E8G A;  3U2R A;  4N9I A;  3QOP A;  1KQ0 A;  2AS5 F;  5D8K B;  3K2Z A;  1YG2 A;  2PFB A;  3CUQ A;  1FP2 A;  1YS7 A;  2FMY A;  3BJO A;  2MC3 A;  2QWW A;  3TO6 A;  1FZP B;  2RDP A;  1IN5 A;  2Z3Y A;  5CJ9 A;  2YX7 A;  4IHT A;  3HTS B;  5FO5 A;  2VOO A;  1J5Y A;  1HST A;  1J2X A;  2HFH A;  4GCV A;  2NNN A;  1QPM A;  4L0Y B;  2VBZ A;  2O3F A;  3KP7 A;  5LHG A;  4UVC A;  3E6M A;  1WWX A;  4YIF A;  4NQW A;  4KUM A;  2RC4 A;  1R5G A;  3KZY A;  1BIA A;  2Q8K A;  1XGO A;  4U7D A;  4A5M A;  1BI0 A;  4CXF A;  3N4M A;  1JGS A;  5DCM A;  3I59 A;  4BHP A;  4LMY A;  3F8C A;  2MH9 A;  3PFI A;  2QLZ A;  3JTH A;  1KU3 A;  3KP4 A;  2XKO A;  2DPD A;  2DQL A;  4EVI A;  4HLY A;  2K02 A;  3I4P A;  4UVB A;  4G6Q A;  2FQ3 A;  2GA1 A;  5HLH A;  3RPU A;  2FEZ A;  2WV0 A;  1QO0 D;  5L3D A;  1D8J A;  4CYD A;  4EJO A;  2IPQ X;  2OBP A;  1KQ9 A;  1SD5 A;  1Z91 A;  1ZYR F;  2BEO A;  3GFJ A;  2FBK A;  1F5T A;  1XGM A;  1ZG5 A;  1TNS A;  1USS A;  2UXN A;  2IJL A;  4CGZ A;  1P6R A;  3ZQ7 A;  4LB6 B;  2IW5 A;  3MQ0 A;  1I1G A;  4M72 A;  1PP7 U;  1SFX A;  5D5X B;  4ESF A;  3WU1 B;  1R23 A;  1S6L A;  2JRT A;  4N9H A;  1K79 A;  4M9Z A;  1EV7 A;  4AWX B;  5CVJ A;  1GXP A;  4HX8 A;  4PGH A;  2Z9O A;  3S2W A;  3BDD A;  1BI2 A;  2D1V A;  3KLO A;  2A6E F;  4LFU A;  4Y15 A;  4RB0 A;  4LG0 B;  1OYW A;  1MKM A;  2HGC A;  3ZP5 A;  1HSJ A;  4UXN A;  2Z99 A;  5E1W A;  3LQR A;  2V6C A;  4BYY A;  2OQR A;  2XRN A;  4EMS A;  4ETS A;  2DT5 A;  3ECO A;  3R0J A;  3G73 A;  1T38 A;  1J7K A;  2VN2 A;  2ACJ A;  3ML6 A;  1TTY A;  1RUN A;  4KIG A;  2IA0 A;  4HV5 A;  1ONV A;  1ZRC A;  5H6Q A;  3E97 A;  1IAW A;  3IL2 A;  1BOA A;  4WCG A;  4A0Y A;  2MA3 A;  4HYE A;  4EM0 B;  3HSE A;  3K69 A;  1XDU A;  4PDK A;  3FWE A;  4PCQ A;  2K4B A;  1O3R A;  3DFG A;  4LG0 A;  4XSZ F;  4KIC A;  2FU4 A;  5JFR A;  2L02 A;  1P4A A;  1J59 A;  4ASN A;  2NAZ A;  4IJA A;  4GGG A;  3EYY A;  2V9V A;  2W84 A;  3U1D A;  1G6N A;  1SD7 A;  5FFZ A;  4ZH4 F;  1KU2 A;  2BYV E;  2LNB A;  2QYO A;  2FML A;  1Z7U A;  4JK1 X;  1MGT A;  4GXO A;  4HDU A;  3WE3 A;  2KJB A;  2ISY A;  3RYP A;  4HZF A;  5FB2 A;  1ULY A;  1TLH B;  2L4M A;  2V1D A;  3WTV C;  1ZG1 A;  4KDP A;  2XAF A;  4IPA A;  1H0M A;  1HW5 A;  1FYK A;  5TJJ A;  1QBJ A;  2QQ9 A;  2OD5 A;  2VE9 A;  4I02 A;  4Y17 A;  2OA4 A;  4ZYE A;  5FLX K;  1IZ1 A;  3V4G A;  3O6B B;  1QGP A;  2Y0M A;  1KYW A;  1TQP A;  3ZN0 A;  3TQN A;  3HRU A;  1R7J A;  2CWE A;  1EH6 A;  2O03 A;  1I1S A;  4MHG A;  3O2P E;  2EFP A;  4WX9 A;  1ON1 A;  3ELK A;  2XKP A;  3C7J A;  2KIF A;  5LRR A;  1XCV A;  2F5C A;  3BZ6 A;  4HQM A;  5BPD A;  3CO7 C;  1FOK A;  5IT9 K;  3I64 A;  3J80 K;  1YW8 A;  2A07 F;  3DF8 A;  2EFQ A;  5L3E A;  3DP7 A;  3FM5 A;  5JI6 A;  2ZNZ A;  3L9F A;  2MLG A;  1PP8 F;  1ZRE A;  4IVN A;  1Z1D A;  1V4R A;  2BGC A;  1NHA A;  1EH7 A;  1KGS A;  4P96 A;  1W7P D;  2YU3 A;  4S04 A;  2DLL A;  2X4H A;  2C6Y A;  2DBB A;  4B8X A;  1IUY A;  3T8T A;  3WTT C;  4UHT A;  3JTG A;  2HKX A;  1YFH A;  5ICG A;  3I5U A;  1PUE E;  1A04 A;  3CLO A;  2ZNY A;  3BPV A;  4BQA A;  3E5X A;  4YFN F;  2DPU A;  4I7H A;  4NHJ A;  3FM3 A;  1LEA A;  3J81 Z;  1GXQ A;  5HLI A;  5E17 F;  5D6E A;  4U0Y A;  1WI9 A;  2RV8 A;  2PG4 A;  2PLY A;  3VOE A;  3BOQ A;  3AAF A;  3E6B A;  2KJC A;  2O8X A;  1B9M A;  4ZZD A;  2CO5 A;  4HF0 A;  2W25 A;  2ZBK A;  2QUF A;  5BPI A;  4NB5 A;  3K1N A;  5L3G A;  3I71 A;  1P92 A;  2XGX A;  5D4S A;  5DYM A;  4ZYH A;  3ERE D;  3MZH A;  5HLG A;  1D5V A;  2F2E A;  5LHH A;  4EQQ A;  6PAX A;  3GFM A;  2HZT A;  2PEX A;  1W7P B;  3SZP A;  3BJ6 A;  2MLK A;  4B09 A;  2CG4 A;  5IT3 A;  3F8N A;  3IWZ A;  3P9I A;  2ZXJ A;  1HKT A;  2LF8 A;  1WQ2 A;  1T2K A;  3HTU A;  2M45 A;  3HYI A;  1Z9C A;  4BHB A;  4GO1 A;  3LAJ A;  4KMU X;  2AXL A;  4FX4 A;  3EET A;  4EJU A;  4MQV A;  4HAM A;  4CHU A;  2G7U A;  3EDP A;  3DV8 A;  2ZME A;  5KVR A;  4JBA A;  2F5E A;  2D45 A;  1IXS B;  2A6H F;  3WG9 A;  3R4K A;  4L9V A;  1SMT A;  4S05 A;  5D5U B;  2XAQ A;  2EFN A;  4A0X A;  1P4W A;  5AIP A;  4L9T A;  1O7F A;  3IKV A;  1TNT A;  4ESB A;  1IN4 A;  3DKW A;  3JAM K;  1P2F A;  3ABU A;  1W7P A;  1I27 A;  3GX4 X;  2A69 F;  4CDG A;  4FT8 A;  3WTS C;  5H6R A;  1BI3 A;  3N97 A;  3DEU A;  1DPR A;  3Q5F A;  3F8F A;  3JW4 A;  4HF2 A;  4M6X A;  3V8J A;  3RTR A;  4ENM A;  2A3S A;  5DCM B;  3I59 B;  4LLN A;  5LRS A;  1R1V A;  5ILV A;  3F6O A;  4I98 B;  3KP6 A;  3OOP A;  3VB2 A;  1HBX G;  3BY6 A;  3I53 A;  2QEN A;  3L00 A;  3NQO A;  1SFU A;  5HS7 A;  2VOD A;  2P6S A;  2VXZ A;  4A0Z A;  3U9G A;  1K78 B;  5K5Q A;  1MD0 A;  4G94 A;  5JHU A;  2PJP A;  1CGP A;  3QAH A;  2HQN A;  1IN8 A;  3DQV C;  5FLX Z;  5LEK A;  5HOO A;  3FMS A;  5CVI A;  2GZW A;  1AOY A;  3FXR A;  3EQL F;  3GLX A;  5DV5 A;  3V7C A;  3COA C;  3BRO A;  1JXS A;  1BM9 A;  3LAP A;  2FA5 A;  3VEP A;  1GHC A;  4XRF A;  3K9T A;  4RGU A;  5ICC A;  4KMF A;  2HOE A;  4ZYD A;  3F22 A;  2ESN A;  4G6D A;  2XIG A;  1FX7 A;  3KP3 A;  3G3Z A;  2XVC A;  1XGN A;  4IRH A;  3NRV A;  4U7B A;  5ICE A;  5IT9 Z;  1DP7 P;  4I0B A;  4WXH A;  3HIF A;  3J80 Z;  2WC2 A;  3FX3 A;  4WWC A;  1XMK A;  2OZ6 A;  2PI0 A;  4P9U A;  1T39 A;  2EA4 A;  1U5T C;  2K27 A;  5CVU A;  2XUB A;  2DAO A;  1K78 A;  5DUI A;  1REP C;  3WE2 A;  3HOT A;  1S7O A;  3T8R A;  1IW7 F;  3V8L A;  5J6X A;  5J8F A;  4IF4 A;  4G8X A;  2OQG A;  4PZJ A;  1UHW A;  4XSX F;  2FSW A;  3HUG A;  3J81 K;  3MCZ A;  2A68 F;  1FYM A;  2OZU A;  1KU7 A;  3HHH A;  4KIB A;  3FF5 A;  1FY7 A;  3F23 A;  3LQQ A;  4ON0 A;  2K7L A;  1O3T A;  3GEZ A;  2RKH A;  2WTE A;  2W85 A;  4DQ2 A;  2FNA A;  3W6K B;  1FNN A;  2QQB A;  2DK8 A;  3RI4 A;  1ZAO A;  1O57 A;  2MH2 A;  5A2Q Z;  3MWM A;  1EH8 A;  4MEY F;  3T5X A;  5FFX A;  2HYF A;  1TQM A;  4MEX F;  4AIK A;  4R79 A;  2A61 A;  3E6C C;  4EGY A;  3FXQ A;  4IXA A;  3TKY A;  4PGG A;  3KCC A;  4RB1 A;  2CFX A;  2STT A;  5K5O A;  1ZRF A;  5KK1 A;  2EJR A;  3RIR A;  1ZHF A;  3E3V A;  5FD6 A;  4R1H A;  2Q0O A;  3LA7 A;  2O6G E;  4HDV A;  1G3Y A;  4KN7 X;  2STW A;  2LSO A;  1W4M A;  3RYR A;  3JSP A;  3L7W A;  4M9S A;  2FF4 A;  3HRT A;  4XBF A;  3SHF A;  1R00 A;  4A6E A;  5DDG A;  3HRS A;  4HA8 A;  1BC8 C;  2DTR A;  2RGV A;  3DXJ F;  2DQR A;  3GYH X;  2QQA A;  5DEQ A;  3RKX A;  2JZY A;  3BWG A;  5LGT A;  5L3B A;  2M8E A;  1RUO A;  1LVA A;  2W24 A;  3WGG A;  1ZGJ A;  1O3S A;  1DDN A;  1D3Y A;  5E1X A;  4OIR F;  4WXD A;  3I54 A;  5E8I A;  2QBY A;  3GWZ A;  3CO6 C;  1B1B A;  2HTS A;  4YG2 F;  3F8B A;  2KRF A;  4YFK F;  1T0F A;  2VBW A;  4AVP A;  1STZ A;  1U6G A;  2YPR A;  3JAM Z;  2D2W A;  1ON2 A;  3ZMD A;  1BN5 A;  3NEU A;  2O0Y A;  1B4A A;  4A5N A;  5DD8 A;  3M8E A;  1W5S A;  1DPU A;  5HDG A;  5CVV A;  2P5L C;  4I01 A;  4K2E A;  3QRF F;  2IVM A;  2HYG D;  2KIM A;  5ED4 A;  3I58 A;  4LJZ F;  4L5I A;  3EYI A;  5ILS A;  2QVO A;  1H9T A;  1LDK B;  3TDU C;  3FXU A;  1KA8 A;  2LF7 A;  4KN4 X;  2P6T A;  1WSU A;  3EUH A;  1P4X A;  1MZB A;  4LB5 A;  4AIJ A;  3H3Z A;  3C3W A;  1RI7 A;  3QP5 A;  2OAZ A;  1ZAR A;  3M8F A;  3P9C A;  2Y75 A;  4HX4 A;  2BE5 F;  1ZGA A;  2FE3 A;  1Z6T A;  1UST A;  4LGW A;  1L3L A;  2FRH A;  2ELH A;  2TDX A;  2ZKZ A;  4M6Y A;  3REO A;  1W5T A;  1BIB A;  1UCR A;  4M74 A;  5HDN A;  4U88 A;  1YIO A;  3LWF A;  2H09 A;  1IN7 A;  4MQ9 F;  4XLN F;  4AD9 A;  5K5R A;  1OR7 A;  3LA2 A;  3HSF A;  5ILU A;  5BS6 A;  3IC7 A;  4DNC A;  3T1B A;  2KIU A;  5L3F A;  3WTY C;  3K0L A;  1SMY F;  3P7N A;  2EV5 A;  4RAY A;  4RAZ A;  2M87 A;  2VBY A;  3WGI A;  4OOI A;  5FGM A;  5CLS A;  4RB2 C;  5A2Q K;  1UFM A;  1FBU A;  4QLC U;  5ICF A;  2WWY A;  2ZO4 A;  4A6D A;  2FXA A;  4ZYG A;  4YFX F;  3IRQ A;  1IRG A;  3BPX A;  2LDU A;  3L09 A;  3WOD F;  4Q5S F;  1G3W A;  4OIQ F;  2R7F A;  1SFE A;  3VFZ A;  1FSE A;  3KEQ A;  1T6S A;  4M9X A;  1B9N A;  1XSX A;  2HWV A;  3F3X A;  4MNU A;  4EJT A;  2ZME B;  2XAS A;  5E20 A;  2X0L A;  2H94 A;  5F1R A;  4EGZ A;  5LHI A;  2HTJ A;  2NRA C;  1XMA A;  4U0W A;  3E6D A;  4OU0 A;  1YW7 A;  2DFI A;  3V7R A;  1G3T A;  4Z2Y A;  5JR3 A;  3TGN A;  2A5Y B;  4UUV A;  2B0L A;  3KZZ A;  2NNY A;  2ETH A;  3E5Q A;  2O61 A;  3IRR A;  1OMI A;  2Q2E A;  3TO9 A;  1ZN2 A;  4FX0 A;  2M1B A;  2DK5 A;  2DU9 A;  2XAH A;  3QPT A;  2IRF G;  4CZZ A;  4EM1 A;  3ZMV A;  5E18 F;  3C1D A;  3V8K A;  2EB7 A;  4LK0 F;  2EV0 A;  1AWC A;  3ZMS A;  2ZCW A;  2F5D A;  4G7Z F;  2M30 A;  2YX4 A;  2HEO A;  2ZJ2 A;  4UV9 A;  2PQ8 A;  3FZV A;  2H6C A;  3FHZ A;  3GFL A;  1YQA A;  1QQI A;  2JTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...