2CSOA

Solution structure of the dep domain of human pleckstrin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
GSSGSSGRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin
publication title Solution structure of the DEP domain of human pleckstrin
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2csoA00
4MHGA 1U6GA 4RAYA 1EH6A 4KA4A 4ZZLA 4YFNF 4K2EA 1RNLA 4OOIA 1XDUA 1C0WA 3DEUA 1Z1DA 3MFKA 1QPMA 3FXQA 5FB2A 3M7GA 3N97A 1L0OC 1TQIA 5HS7A 2NNYA 3P9IA 1HQCA 3SZPA 5CJ9A 2OZ6A 2HR3A 1O3QA 2BYVE 2B0LA 4PCQA 1R23A 2DAOA 2W57A 2ZKZA 1T98A 4LLNA 3T8TA 2HKXA 3BJ6A 1BIBA 3EUHA 2P7VB 2PMHA 1IRGA 3HTUA 2FOKA 3E3VA 3VOEA 2O61A 1FSEA 4QWQA 1T39A 2DT5A 4U7BA 3I71A 5ICCA 2HS5A 3BPVA 2PMUA 2R7DA 4LMYA 1J5YA 3BPXA 2XASA 4OIRF 1JHFA 1U2WA 2BEOA 2F5CA 2K86A 2MD5A 3R0JA 1FX7A 4M73A 3M8FA 3GUDA 1LDKB 5JR3A 1SFXA 2LSOA 2KJCA 3IL2A 5ICEA 4HLXA 2JSCA 1HBXG 1ZARA 1HSJA 4AIJA 2XAHA 2VONA 3HSEA 3PQKA 2O8XA 5HS9A 4P55A 4KFCA 2OD5A 1E2XA 3IRQA 1OYWA 1SD7A 4G7OF 3CO7C 2M1BA 3JTHA 1R36A 2RV8A 4EGZA 2KIUA 4O5VA 4LGWA 4KIFA 3LA3A 5TRDA 3ZPLA 3QPHA 2QLZA 4KICA 3ELKA 1JXSA 3KP3A 5DD4A 6PAXA 1XCVA 3W6KB 3O2PE 2WC2A 1I5ZA 3ZP5A 4Q47A 2HFHA 4WK8F 3DV8A 4AD9A 2DO7A 1J75A 3J81K 5FGMA 4A6EA 4GCVA 1UHWA 1P92A 2STTA 1BC7C 2QVOA 4UNOA 1S7AA 3LAPA 1JE8A 4G6DA 2LKPA 2BBYA 2DBBA 1BC8C 3ECHA 2FSWA 3NEUA 2RQPA 3GW2A 3R4KA 3ZMZA 1ON2A 4KMFA 2RN7A 3QU6A 2V6CA 3CUQB 2D2WA 3ML6A 5LGNA 1XSDA 2XRNA 2UWMA 2ISZA 1SD4A 1CF7A 1B6AA 4L9NA 1G3WA 4XSXF 4GYGA 2RNJA 1R00A 2X4HA 2HQNA 1OMIA 3BROA 1BM9A 5ILSA 2K7LA 1ZREA 4LLGF 1K7AA 1KQ0A 2XUBA 2MH2A 4I0AA 1KYWA 2EK5A 3F6VA 2H09A 3L9FA 4G94A 1I27A 2W25A 3K9TA 4GXOA 1H9TA 2ACJA 4MTEA 3TDZC 3VEPA 1MGTA 3CTAA 1OPCA 4LD5A 3KE2A 4WXDA 4MGRA 1LEAA 3IHUA 1R58A 1KU9A 3IKVA 1PP8F 2P5KA 2O0YA 4TV7A 5BQTA 1YIOA 2UXNA 4KDPA 2F5EA 1G4DA 2BV6A 2DFIA 1XGSA 4GO1A 1R5GA 2HTJA 4L5JA 4ENJA 1IN5A 2K4BA 3WU0A 1R7JA 2NYXA 3O6BB 1FBUA 4I01A 1HW2A 2OQRA 3WGHA 3L09A 3J80Z 1LQ1A 3I59A 4R79A 2VBWA 3ROUA 4L5IA 1IUYA 2XKOA 1HKQA 4I98B 1BJAA 2P5VA 3MQ0A 3SFZA 2KIMA 3HYIA 3I59B 3QU3A 1IN6A 1WRJA 1ZYRF 3CLOA 4XRFA 1ZG1A 5DDGA 2VT3A 3KP7A 2V79A 1W4MA 3B02A 3NRVA 1XMKA 1RZ4A 1ULYA 3T8RA 1SMYF 3HUGA 3EYIA 1TBXA 1DPUA 2PFBA 2EJRA 1USSA 3HRMA 1FPQA 1O7FA 2Y48A 5DYMA 5TJJA 3GX4X 1X3UA 3HRUA 4EQQA 3GFJA 3LAJA 1B9NA 3I58A 3F23A 2J5OA 1A04A 3U1DA 2MLGA 4KIGA 1LDJA 3DKWA 3TO6A 3DXJF 2WWYA 4BHBA 2L01A 3RPUA 2DK8A 1MJAA 2OBPA 5BPDA 2NRAC 3KETA 2IA0A 4KUMA 3JSPA 1R5HA 2L02A 1QGPA 1B4AA 2EFNA 5KK1A 2K4JA 5BOXA 2RVCA 2CW0F 5HDGA 4M74A 5FD6A 1S29A 1W7PA 4I2OA 5DUKA 3JAMZ 4ESBA 3E6BA 3TGNA 1OR7A 1JGSA 1FZPB 1W5SA 2P8TA 1D8KA 3BJAA 3E6CC 2QQAA 1FP2A 1W7PB 2Y75A 2XVCA 1USTA 3KP2A 2K27A 2Z3YA 3JSOA 3F21A 4HOBA 5DUIA 2EV6A 4CYDA 1LVAA 3IKTA 4WWCA 1ZHFA 3I53A 3M8EA 1ZRCA 4LLLA 4LJZF 5L3CA 5ILUA 1F9NA 3VFZA 2IA1A 1S3JA 3H3ZA 5D4RA 3LQQA 3OV8A 5CVIA 3RKYA 3JW4A 4HX7A 1TQPA 2E7XA 3U9GA 3NQOA 4I0BA 2LNBA 4M71A 2M30A 4Z2YA 1O7LA 5D6EA 4XBFA 1G6NA 2Y0MA 4RB3C 1UFMA 2F5FA 1H0MA 3TOAA 4UUVA 3FWEA 3FM3A 2ELHA 4MQVA 2HYFA 3GEZA 4YIIA 2FNPA 4AIHA 3GLXA 4KT5C 3IC7A 3HSFA 4A5MA 2D45A 2QM3A 1QQIA 3F22A 2PLYA 1QO0D 5DEQA 4MQ9F 3MEXA 3H92A 1WQ2A 3BDDA 2OQGA 1LEBA 3CUQC 5HVQC 4RB0A 4L0YB 4P96A 5H6QA 4NB5A 5CVJA 5A2QZ 4U88A 2GXGA 1Z7UA 3PQJA 4NHJA 3DPLC 1R1UA 4FX0A 2VBXA 4G8XA 2IVMA 2IJLA 1XDSA 5LBQA 4YIFA 2A68F 3V8LA 2ZBKA 4MEXF 2ETHA 4M9SA 2DLLA 2DI3A 4MNUA 2GZWA 4E70A 4D0PA 1ZRFA 2MBFA 2XGXA 2KKOA 3F8MA 4G7HF 2QBYB 4AWXB 2A69F 2NAZA 2EFPA 3TDUC 4BQAA 4A2UA 5L3EA 2CG4A 1QZYA 1KQ8A 2JZYA 1EH7A 5IT9K 2J5PA 3FMRA 1IF1A 4BXUA 2P5LC 1G3YA 5FLXZ 1F4KA 5E18F 3LA7A 2W84A 3QP5A 2HYGD 2AS5F 4EMSA 3Q5FA 4HZFA 4GGGA 1OYIA 4RB1A 2ZNZA 4Y15A 1KU2A 2ZNYA 3RYRA 1DUXC 5JI6A 4N0BA 1NHAA 2CFXA 3QOPA 3HIFA 2XAGA 2MA3A 2HZTA 1XSVA 1YS6A 1YW7A 3J80K 3BY6A 5D5UB 5HLGA 3KP6A 3P7NA 1MZBA 4YFXF 4S04A 2Z99A 4JBAA 1ZG3A 5ICGA 2PJPA 1O3TA 1TW3A 3LA2A 4IRIA 4Y17A 5D8LB 3FMQA 3WE2A 3ZMDA 3RDIA 2EWNA 2DW4A 2M45A 5CVUA 1MJBA 1BI0A 2MC3A 3F8BA 2FXAA 4CHUA 2L3DA 4RB2C 3GWZA 3DFGA 4HX8A 5D8KB 5JHUA 1FYMA 3HRTA 1P4WA 3WTXC 2GAUA 3WTVC 4WXHA 3K1PA 1SD5A 3ZN1A 5HDNA 4HAMA 2ADUA 2JPBA 4BNCA 3CUQA 3VB2A 3L00A 4ESFA 5DCMA 4IRGA 2QQBA 2MLKA 4ESJA 3ZMTA 4LK1F 2JT1A 1YS7A 3GVAA 3GF2A 2VODA 1Q1HA 4EJVA 2OU2A 3RKXA 2HEOA 1REPC 5D5VB 2E1NA 5LRRA 2A6EF 3ABTA 3ECOA 1HW5A 2L54A 5DCMB 3ERED 3KLNA 2FBIA 5D4SA 2XAJA 4B8XA 4M72A 4Q5SF 4AVPA 2P4WA 3H3UA 4N9IA 2OZUA 4U0YA 4HBLA 1O57A 1JHHA 1XSXA 1ZN2A 2DTRA 2OA4A 4HLYA 2M87A 2L4MA 5K1YA 3EYYA 3K2ZA 3JAMK 1MDMB 2HDCA 4HF1A 4QLCU 2EA2A 5HLHA 2FF4A 2JRTA 3WTUC 1FYKA 1MKMA 4UXNA 4UVBA 1PDNC 3EQLF 5E8GA 1ZG5A 2QENA 3IWFA 1XD7A 3KP5A 3ZMVA 2VC0A 3WE3A 2HQRA 1Y0UA 1FOKA 3C1DA 2JTVA 4G6QA 2PI0A 3QRFF 2G9WA 3R0AA 2UXXA 3PFIA 1ZLKA 1LNWA 4UVAA 2FBHA 2PQ8A 3E5XA 4OMZA 2BGCA 2COMA 5F64A 4S05A 4XLPF 2E1CA 3O3KA 2CQKA 2IA2A 3F8NA 2FMYA 3GYHX 4A5NA 1YLFA 5ILVA 2PG4A 5F6FA 2VC1A 2M8EA 5E17F 2PBIA 2V1UA 1T6SA 1GHCA 3FMSA 3QAHA 4BHPA 4MTDA 3RTRA 2A3SA 4OIPF 1HSTA 3HHGA 2FMLA 3EETA 5EEGA 1XGNA 1RUOA 4JK1X 5KVRA 5LHIA 4HYEA 5H20A 4BYYA 1TNTA 5CYVA 3SXYA 4RS8A 1RUNA 3ZQ7A 1XB4A 2VXZA 3R60A 5LRSA 4KIBA 2VN2A 3T5XA 3WODF 5LGTA 2FU4A 2V1DA 1ONVA 5CVVA 2ZXJA 3P9KA 4OIOF 3T1BA 1YG2A 3C18A 2FA5A 2GA2A 5AIPA 2KIFA 4DNCA 3K0LA 3RPQA 1Z91A 2GWRA 1QZZA 3GO5A 3ULQB 3CDHA 2NS0A 1IXRC 2P6SA 5FFZA 1O3RA 3RYPA 1K79A 5J6XA 3K69A 5HOOA 3WTSC 1R1VA 3MAJA 1BI3A 1ZGJA 4FHTA 3KEQA 2VT2A 4ASNA 4Y13A 4EJTA 3TOBA 3RKWA 1KGSA 3GZ6A 4M6YA 2HOEA 3AAFA 4ZZDA 3TQNA 3IRRA 4WF2A 2BE5F 1QNTA 2CWEA 3V7SA 2ZO4A 2RKHA 5H6RA 5DD8A 1B9MA 4A12A 1J0RA 1Z9CA 2MH9A 3MWMA 4HDVA 1XGOA 1IN4A 2H94A 4PZJA 2RC4A 5FLXK 4LFUA 1SAXA 2FRHA 1UHMA 3I4PA 5L3GA 3HTSB 1STZA 4HQMA 1FSHA 3WTYC 2ZMEB 3RI4A 4HX4A 1SFEA 3IWZA 4A0ZA 3DP7A 4ETSA 1IW7F 1Z05A 2Z5UA 1BOAA 5CLSA 4L0ZB 1HKSA 1U5TB 4I7HA 1XGMA 5FD5A 5JVTA 2W24A 5JFRA 1ZH5A 4O3MA 3C7JA 1K78B 2HKOA 4UVCA 5LLQA 1E17A 1QBJA 3REOA 4WX9A 1W7PD 4M6XA 2IW5A 1MD0A 1YYVA 3WTZA 1I1SA 5F1RA 4KNYA 5K5QA 3GZ5A 1F5TA 4RGRA 2GA1A 4CZZA 4P9UA 5CVRA 2YR2A 4P5OA 2CGPA 3LFKA 3HOTA 3ABUA 1P4XA 3WGIA 4HV5A 3L7WA 1B1BA 2FQ3A 2DQLA 1YW9A 3M9AA 1AWCA 2A5YB 2VBZA 1XCBA 4CGZA 3ZMSA 4ENNA 5D5WB 4XSZF 3WTTC 3KEOA 1P6RA 1RIOH 4UV9A 4U0WA 4KMUX 2YSRA 5AONA 4EM0B 3SQNA 4HDUA 3FHZA 1J7KA 1FLIA 2QBYA 2VOPA 4IRHA 3WU1B 2E7WA 3LSTA 1O3SA 1KU3A 3KCCA 3HHHA 4UV8A 5E1ZB 4M9ZA 3RIRA 2KJBA 3F8CA 3KZZA 5D5XB 1I6XA 3TKYA 3K1MA 2F2EA 3FX3A 1VTNC 2M5WA 3GFLA 2HTSA 2ESNA 4YFKF 1SD6A 2LF7A 5FFXA 2VBYA 3KFWX 2Q8KA 3CJNA 4BAYA 1G3SA 1FP1D 4U7DA 4IXAA 4EV0A 4OMYA 5L3DA 1U3EM 1EH8A 5ERIA 1V4RA 3DPTA 3EDPA 1AOYA 4UHTA 1XMAA 1HW1A 1U78A 1IN8A 4ON0A 1DP7P 1KQ9A 2O03A 4M9XA 5LGUA 2HGCA 3SZTA 3RJPA 2EB7A 1FWZA 2ZCWA 4HQEA 5E1WA 3VODA 3LQRA 5E20A 1S6LA 2ESHA 1YFHA 1YTYA 1GXQA 1ODDA 2EA4A 2ZFWA 1OKRA 3MZHA 1ZGAA 2DU9A 2IP2A 2H6BA 3V8JA 1J2XA 1SFUA 4GYIA 4ZYHA 4HA8A 1YO5C 3U2RA 2TDXA 1RI7A 3F8FA 2XROA 3N4MA 2VE8A 4IHTA 4Q4ZF 1LDDA 4DQ2A 3I64A 1KA8A 3GXOA 2YPRA 1FC3A 2VOOA 2LF8A 1TTYA 4IJAA 4Q48A 3DF8A 4ENMA 3DQVC 2EFOA 1B59A 2X0LA 3HRSA 2A6HF 1SMTA 2WV0A 2XAQA 3WTWC 2XAFA 4WCGA 4A0YA 4ZH4F 3V4GA 2G7HA 1UCRA 3W6JB 4KN4X 5EEHA 1T38A 4G9YA 1L3LA 1BI2A 2O3FA 1XN7A 1I1GA 2IRFG 4KN7X 2EFWA 5LHHA 2RGVA 3F3XA 3V7CA 3C3WA 5LHGA 1PP7U 3BWGA 3ISPA 4KYWA 2YU3A 3I5UA 5E8IA 2NNNA 2D1VA 1IXCA 2QWWA 4EVIA 2G7UA 4CDGA 4PGHA 4L18B 4BHCA 1BN5A 2PN6A 2QYOA 1MDMA 4EJOA 4IVNA 1FYLA 4NQWA 5HS8A 4RGSA 2CSOA 2Z33A 1P2FA 1Z6RA 3CUOA 3L2CA 5LEJA 5K5RA 1KYZA 3WGGA 1P4AA 3BOQA 1WWXA 4LK0F 4L9TA 2EV5A 2A61A 1IN7A 1CF7B 3TO7A 1WKMA 4PGGA 2FEZA 3K1NA 5J8CA 4MEYF 3ZN0A 2CYYA 4JQFA 3MZYA 5L3BA 1U5TC 4H0EA 4RAZA 2XV4S 1HKTA 3JTGA 2WTEA 5IT9Z 1YW8A 2F5DA 2XKPA 1D5VA 1FNNA 3QP6A 5FO5A 3FXRA 1ZAOA 4F7ZA 3E6DA 2JPCA 5HDKA 4I09A 4LB5A 5LEKA 1R22A 3P9CA 3OOPA 2RDPA 4IHSA 4EJUA 4PDKA 3R61A 2QUFA 3FZVA 3I54A 3SHFA 4P9FA 2D1HA 3BJOA 1T2KA 4CXFA 5IT3A 5ED4A 2DK5A 5D6FA 3KP4A 3V7RA 5BPIA 3HSRA 1FT9A 4ZYEA 4O6JA 2O6GE 2V1XA 5BS6A 1K6OA 2Q2EA 1FBSA 4AIKA 1GXPA 2DPDA 1J9IA 5AIQA 1FY7A 4YG2F 1F1ZA 4CICA 1J59A 4IF4A 1DPRA 4ENKA 4R8HA 1LJ9A 4LG0A 3TO9A 2C6YA 2QZ8A 5DCFA 3COAC 4FX4A 3D5LA 3ZMUA 4OU0A 2FNAA 1BI1A 1TLHB 1GVJA 1IXSB 2QQ9A 2IT0A 1U8RA 1D3YA 4R1HA 2A07F 3GFIA 5A2QK 2CO5A 1BIAA 1UB9A 3I0TA 3E97A 1HXDA 4LG0B 1DDNA 4EJWA 3J81Z 2HWVA 5L3FA 1FBQA 1TW2A 2H27A 2Q0OA 2FBKA 4WXCA 2PEXA 1EV7A 3V8KA 2GXBA 4HV6A 2KRFA 2V9VA 4U0VA 1W5TA 3M1EA 4L9JA 2R3SA 1OYYA 3G73A 2LDUA 4G7ZF 1V3FA 4OINF 3BP8A 4IPAA 1PUEE 1MJ9A 5J8FA 2STWA 1R1TA 1IRFA 4B09A 4RGXA 2H6CA 2DQRA 2XHKA 3FXUA 2DPUA 4HW0A 4RGUA 3GFMA 2ZMEA 3E6MA 3QPTA 4EM2A 3J7AO 2IPQX 3FM5A 3Q9VA 1ZLJA 3G3ZA 3B73A 4ZYDA 3MCZA 3S2WA 4N9HA 1U5TA 4HF2A 3F6OA 4BH9A 3KLOA 5DV5A 4OIQF 2L4AA 4L9VA 1CGPA 3LWFA 1S7OA 3BZ6A 1WSUA 1K78A 1S8NA 2VE9A 3WG9A 1H9GA 2ISYA 1Z6TA 1KU7A 1IZ1A 1T0FA 2AXLA 2FE3A 3E5UA 4XLNF 2EFQA 3R6SA 2GIVA 2OAZA 4EGYA 3T0YA 3KZYA 2GQQA 5HLIA 2R7FA 4A6DA 4ZYGA 1G3TA 3HOSA 1D8JA 5K5OA 2YX4A 2P6TA 5E1XA 1TNSA 1LB2A 2XIGA 5BMZA 2UZKA 1TQMA 1WI9A 1BBYA 4HF0A 4CO8A 3D0SA 2YX7A 2EV0A 2P7CB 1YQAA 4LB6B 2K02A 5ICFA 1ZRDA 1ON1A 4EM1A 4A0XA 4FT8A 1IAWA 2Z9OA 3FF5A 3Q9SA 3F72A 4I02A 3CO6C 2ZJ2A 2W85A 3E5QA
chains in the Genus database with same CATH superfamily
4MHGA 2LP0A 3S16J 2XB0X 2XSDC 1U6GA 4D5FA 4RAYA 1EH6A 2EIMH 2DA4A 1HOMA 4KA4A 2QKMB 4ZZLA 1WGXA 4YFNF 4E6KG 2EILH 4XMYA 2HXIA 4RLFA 4K2EA 1RNLA 4OOIA 2DFFA 2IAIA 3L2VA 5EZGA 1KONA 2E34A 1XDUA 1C0WA 3DEUA 1Z1DA 4FQGA 4XL9A 3OYNA 3SDGA 3MFKA 2EQRA 4M6VA 4E7HA 2KLOA 4ZDLA 1QPMA 3FXQA 3UNGC 5FB2A 3M7GA 3N97A 1L0OC 3CCYA 1TQIA 5HS7A 2NNYA 4BEHA 3P9IA 3HJEA 1HQCA 3X2QH 5EF6A 4DIQA 3SZPA 4E4HA 1VQ6I 5CJ9A 2OZ6A 4XIDA 1AKHB 2HR3A 1O3QA 1WJAA 4PJNA 2BYVE 2XRLA 2B0LA 1A6IA 5DS9A 3W2AA 1ZKGA 3KYDB 2A5WA 4PCQA 1R23A 3BTLA 2DAOA 2W57A 1K4TA 2ZKZA 1T98A 4LLNA 3T8TA 2BOLA 2KL4A 2HKXA 3BJ6A 5DTDA 1BIBA 3EUHA 2P7VB 2VPLA 3OR1C 2PMHA 2Y2ZA 1IRGA 3HTUA 2FOKA 3E3VA 5F27A 3W6VA 4M3BA 3VOEA 2O61A 1FSEA 1OQYA 2L9SA 2MFZA 4QWQA 1LE8A 1T39A 2DT5A 4U7BA 3BC8A 2VASA 1AA7A 2DMUA 4RM3A 1TWAJ 3BQZA 3I71A 5ICCA 2HS5A 1X3ZB 2CW8A 4RA2A 3BPVA 2PMUA 2R7DA 3HDDA 4LMYA 4BKXA 1J5YA 1T56A 3BPXA 2XASA 4OIRF 1JHFA 1G8XA 3ZR8X 2JSPA 1U2WA 2BEOA 2F5CA 2K86A 4AC0A 2BW3A 2HVQA 2MD5A 3R0JA 4B3XA 1W36C 1S5LC 3PNVA 2R93J 2K9QA 1FX7A 4JX6A 4M73A 4XKVA 3M8FA 3GUDA 1LDKB 2M7BA 5JR3A 3CJRB 4MFEA 4XRSG 4DYQA 4IZZA 2JA7J 1SFXA 2DOFA 1B8IA 2LSOA 2KJCA 3IL2A 2GOXB 1LFPA 5ICEA 4HLXA 2JSCA 1HBXG 3JRDA 2XDVA 2CFOA 1ZARA 2ZC2A 1HSJA 4AIJA 2XAHA 2VONA 3HSEA 1MBKA 3PQKA 2EZHA 2O8XA 5HS9A 3KYLA 4P55A 1JUPA 3BG3A 3ONQA 2OD5A 4KFCA 2NS8A 1E2XA 3IRQA 2CQ7A 4E7JA 1NG6A 1OYWA 1SD7A 2RAEA 4MIMA 4II2A 2ID3A 2MG4A 4G7OF 3CO7C 2M1BA 3JTHA 1R36A 5B1BH 3OYCA 2RV8A 4EGZA 4A3GJ 5EGOB 2HOAA 4Y33A 4DJAA 3E0JB 4M3GA 2KIUA 3D5RC 4O5VA 4CZCA 1DU6A 3KEYA 4LGWA 3GTKJ 2R7ZJ 2BHYA 3LSJA 1VQMI 4KIFA 3LA3A 3S1RJ 5FJ8J 1VF9A 3OYJA 4F92B 4BJTA 4IQ4A 2CQNA 5TRDA 3ZPLA 4C2UA 2AQEA 3QPHA 4M3FA 4LOCA 2QLZA 4KICA 3ELKA 1JXSA 2EIKH 3SEZA 3KP3A 1E3OC 5DD4A 6PAXA 3FKJA 1X2MA 2HQ5A 3WHCA 2DA2A 1XCVA 3W6KB 2EZKA 3H0DA 2X85A 3O2PE 2WC2A 2WADA 4RLQA 3DU6A 4CCKA 1I5ZA 3P5JA 4PUSA 2R5ZA 3ZP5A 2ECBA 1MMDA 4Q47A 2HFHA 4WK8F 1UG0A 3F9KA 3DV8A 3OIPA 4AD9A 4XLFA 2DO7A 1J75A 4L5EA 2LG4A 3G1MA 3J81K 4PSWA 5FGMA 3G4SI 4A6EA 1MMAA 4GCVA 2H8WA 1UHWA 1P92A 2ZXIA 1BC7C 2STTA 2MD0A 2QVOA 1V55H 2Y69H 3E1SA 3H9GA 4UNOA 3OOUA 1S7AA 3BG5A 3LAPA 1JE8A 4G6DA 2LKPA 2BBYA 2DBBA 1Z7LA 3H3VK 3DPUA 2F4MB 1X1BA 2ZJPF 1BC8C 3OS1A 3ECHA 3RQIA 1SVMA 4HSTA 2E1MB 2FSWA 3NEUA 5K7HA 1QVUA 2HDWA 3OSFA 2RQPA 2HNHA 1ITYA 3J7AY 3GW2A 3R4KA 3ZMZA 1ON2A 4KMFA 2ZFUA 1E0EA 1TWCJ 2RN7A 2IGKA 3QU6A 3ABKH 2V6CA 1IG7A 4KT6A 5GP9A 2K9LA 3CUQB 2X1CA 4N4NB 2D2WA 3ML6A 4CA0A 1UZCA 5LGNA 3HPHA 1XSDA 2XRNA 2EPFA 2UWMA 2ISZA 5GTIC 1SD4A 2KZGA 1CF7A 4BE0A 5FROA 1B6AA 4L9NA 3OYDA 4D1QA 2I8DA 1MMGA 1G3WA 4XSXF 4GYGA 2RNJA 2MC4A 1R00A 3TBIA 2X4HA 3Q0VA 2O9LA 4W1UA 4PJMA 2HQNA 1OMIA 3BROA 1BM9A 3MMYB 5ILSA 2K7LA 1UHSA 1ZREA 2RQQA 4LLGF 1K7AA 1KQ0A 2XUBA 2MH2A 4I0AA 1KYWA 2EK5A 2VB6A 2H09A 3F6VA 3L9FA 4GRIA 4G94A 1I27A 4U87A 2W25A 4XLCA 3ESWB 2IEKA 3FXLA 5FKLA 3K9TA 2V1NA 4GXOA 1H9TA 3GTLJ 3AG1H 2Y9ZA 2ACJA 2K85A 1EKEA 4MTEA 2VKDA 3TDZC 3VEPA 2DTZA 4C3JJ 1MGTA 3CTAA 1OPCA 1JTYA 1WHUA 2YUSA 3MKWB 2F5VA 4LD5A 3KE2A 5CKTA 1QU3A 1X19A 2QSHX 1JTXA 4WXDA 2EIJH 4MGRA 2YU9J 1LEAA 1FTTA 2FOWA 1GUUA 2VJ4A 3IHUA 1R58A 3H9QA 1KU9A 1OCRH 2Y31A 4YELA 3HOUJ 3IKVA 1PP8F 3DWLE 2P5KA 5CPRB 2O0YA 3OYLA 4TV7A 5BQTA 2E36A 2CMPA 3ZGKA 1YIOA 2UXNA 5F0CA 1EJ9A 2W1OA 4KDPA 3K4MA 2HOSA 1QA6A 2F5EA 2ZXWH 5F08A 2BY0A 1T0FC 3BG6A 3VYSB 1G4DA 2BV6A 2DFIA 1XGSA 4GO1A 1R5GA 2VKHA 2HTJA 4L5JA 5IYCJ 4ENJA 1IN5A 5FLMJ 3CCQI 3CCSI 2OJED 3DBLB 2K4BA 3WU0A 2R7VA 1R7JA 2NYXA 2LBFB 3O6BB 4PJJA 1FBUA 4I01A 2ME0A 3J7YJ 1Z3XA 1QPIA 1HW2A 1D0YA 2OQRA 3JRCA 3WGHA 1Z77A 3OL3A 3CD6I 3L09A 3J80Z 4F55A 2VQHA 3FIWA 3QQAA 2WBMA 1LQ1A 3I59A 4A3DJ 4R79A 4PK4A 2VBWA 2L9VA 3GTQJ 4UUSB 1WCMJ 3ROUA 1O4XA 4BQNA 4L5IA 1IUYA 1JT0A 2ZSIB 2XKOA 4MFDA 1HKQA 2QEXI 3PNYA 3CCJI 2JN6A 1N75A 4I98B 3ABLH 1BJAA 2P5VA 3MQ0A 3SFZA 2KIMA 3HYIA 3I59B 3QU3A 5J1UA 2OPTA 1IN6A 1WRJA 2XGEA 1W36D 1ZYRF 3CLOA 1BW5A 4XRFA 1ZG1A 5DDGA 2X6XA 3HKZN 2VT3A 3KP7A 2V79A 1W4MA 2Y0SA 3B02A 4G12A 3NRVA 1XMKA 2MYSA 2IS6A 1J09A 1RZ4A 1ULYA 2L2OA 3T8RA 4Z6YA 1T8IA 2LVSA 1SMYF 1SFKA 2WB1A 2HI3A 2NXNB 1SFOJ 3HUGA 3EYIA 1TBXA 1DPUA 1QRYA 4JX4A 2PFBA 4DYCA 2EJRA 1USSA 2F6CA 2HQAA 3LSPA 2CRGA 3C2GA 2R0QC 3DLAA 4X1EA 1GDTA 3EUKL 3HRMA 1FPQA 1O7FA 2Y48A 5DYMA 1TP4A 5TJJA 4CSWA 3GX4X 1X3UA 3HRUA 4EQQA 4IHWA 3I4MJ 3GFJA 3LAJA 2CU7A 1B9NA 2MW8A 2L7ZA 3I58A 3F23A 1YRNA 3ZQQA 2J5OA 1NG7A 3J7ZI 1OCZH 1A04A 3U1DA 2M2EA 3SJMA 2MLGA 1VQLI 4KIGA 5H2FC 4BE2A 1LDJA 3DKWA 3TO6A 3DXJF 2QQ8A 2WWYA 2MABA 1A5JA 4BHBA 4OWRB 4UB8C 2L01A 3RPUA 2DK8A 1MJAA 3U1KA 2NOJB 2OBPA 5EEAA 2H1LA 5F1JA 3QWLA 5BPDA 2NRAC 1F43A 3KETA 2IA0A 2Z2SB 3K10A 4KUMA 3JSPA 1R5HA 2L02A 3AG3H 1YRNB 3VYUB 1QGPA 4E7IA 4A3BJ 2CQXA 1B4AA 2EFNA 1U0JA 3EUHC 3DBRB 3K4JA 5KK1A 2K4JA 5BOXA 3H0GJ 2RVCA 2CW0F 5HDGA 3VSKA 1DGRM 2KQRA 4M74A 2XF6A 4P1WA 2L7KA 5FD6A 1S29A 1W7PA 1JJ8C 4I2OA 5DUKA 4ZDOA 5KAIC 1DGWY 2IS4A 4HPQA 3BTIA 3JAMZ 1I39A 4ESBA 3E6BA 3A4CA 1OR7A 3TGNA 1JGSA 1FZPB 1I3AA 1W5SA 2CUJA 2P8TA 1D8KA 1EA3A 2GOMA 3BJAA 4N4OB 3DLLF 3ZQFA 3E6CC 2QQAA 1FP2A 1PVEA 3NAUA 5CQGA 2F48A 5KHDA 4Y4RA 1W7PB 4X0GA 3FK6A 2JVGA 2Y75A 2W48A 2XVCA 2X1EA 1IC8A 2R7XA 3BR5A 1USTA 1X4OA 3KP2A 3HC7A 2X1DA 1WH7A 2K27A 2Z3YA 3JSOA 3F21A 4HOBA 1VQ8I 5DUIA 4ABZA 2EV6A 3L2RA 4CYDA 1LVAA 1Y39A 1VQ9I 1QHGA 3IKTA 4WWCA 1ZHFA 3I53A 2DDAA 2JA2A 2LKSA 1DQUA 3M8EA 4NUBA 1ZRCA 3A02A 4LJZF 4LLLA 5L3CA 4DOZA 5ILUA 4LITA 1ZTRA 1F9NA 2VXDA 3CCUI 2JK3A 3VFZA 3TL4X 2IA1A 1S3JA 3H3ZA 2V4JC 1V54H 5D4RA 3LQQA 1WI3A 3OV8A 5CVIA 1HDDC 3RKYA 1YI2I 3PUBA 3JW4A 4HX7A 4A3LJ 1TQPA 2E7XA 3U9GA 3NQOA 3HB9A 4I0BA 2R92J 2LNBA 3I4NJ 3ZCOA 5C4XJ 4M71A 2HVRA 3A0BC 4JOMA 5CQEA 2M30A 2DFEA 3Q0WA 4Z2YA 1N78A 1MBHA 3DTIA 4KITB 2OTJI 1ZR2A 1O7LA 2NVYJ 5D6EA 2QF7A 5KCMA 4XBFA 1G6NA 1X3WB 2Y0MA 4RB3C 1AU7A 1UFMA 2F5FA 1H0MA 3TOAA 4UUVA 3JRHA 4XKWA 1E3HA 2O7OA 3CC4I 4CCJA 3BZKA 2PX9A 1V5FA 5E3LA 3OS0A 4XOTA 3FWEA 1LPQA 4QTRA 4KISA 2JUCA 2GBYA 3FM3A 5BNGA 4CYCA 2ELHA 3CF5F 1H89C 4MQVA 2R7UA 2HYFA 3GEZA 4YIIA 2FNPA 4AIHA 3GLXA 5HNHA 1K61A 4BY1J 2WAQA 1LKXA 4KT5C 3IC7A 3HSFA 4A5MA 2E1MC 2D45A 3A0HC 3JCUC 4BDYA 1T33A 2QM3A 5B1AH 1QQIA 3F22A 2PLYA 1QO0D 2JMWA 2KDOA 5DEQA 4MQ9F 4W97A 3CP2A 3MEXA 5JLXA 3H92A 1WQ2A 3BDDA 3BCAA 4AU7A 2OQGA 1LEBA 3CUQC 4CYCB 1AKHA 4E7LA 5HVQC 4RB0A 4L0YB 3MZ8A 4P96A 4GFBA 5H6QA 1D1BA 4NB5A 5CVJA 3H5RA 4OAYA 5A2QZ 4U88A 2GLOA 2GXGA 2KISA 4NBQA 1Z7UA 4GDFA 3PQJA 4NHJA 3DPLC 1R1UA 3M4OJ 1RESA 5J4YA 4FX0A 3SEQA 1PUFB 4C9YA 2VBXA 3SDBA 2CQQA 4BS9A 4A3FJ 3A03A 3GTPJ 3G2BA 4G8XA 2IVMA 3HM5A 2IJLA 1XDSA 4LIVA 5LBQA 3HL2A 4YIFA 2A68F 1X1CA 3BR1A 3V8LA 2ZBKA 4G6TB 4MEXF 2ETHA 3BTJA 4M9SA 2E5ZA 3ZQGA 1H8AC 1IRXA 2DLLA 2DI3A 2KZVA 4MNUA 2GZWA 4E70A 4D0PA 3RZOJ 1VFCA 4XRSA 1ZRFA 2MBFA 3M8JA 1LFUP 1V5GA 2XGXA 2KKOA 3F8MA 4G7HF 2QBYB 4AVZA 4AWXB 1GVDA 2LKXA 4BXFA 2A69F 2NAZA 2DJNA 4J19A 2EFPA 3TDUC 4B1RA 4E7KA 2VQGA 4BQAA 3PL8A 4HSRA 4CCNA 4A2UA 5L3EA 2FX0A 3OYHA 2CG4A 3ERMA 5HODA 3VWBA 1P7JA 1QZYA 2DOEA 2RNGA 2JZYA 4C3HJ 1KQ8A 4XICA 1PJRA 1GLNA 1JKPC 1EH7A 1DP3A 5IT9K 1WJDA 2J5PA 3FMRA 1IF1A 3GTJJ 4BXUA 2P5LC 1G3YA 5FLXZ 2VKVA 1OLTA 3K4CA 1F4KA 2VUMJ 4BJ5C 2JUGA 4E7SA 5E18F 3CF2A 4D7NA 5GPCA 5GAGJ 3LA7A 4IHVA 2W84A 1QHHD 4DGWB 1POGA 3QP5A 3MKZA 2HYGD 1WJCA 3BR3A 1HA8A 2AS5F 4YRVA 4EMSA 1MNEA 3GZNB 3Q0UA 5EGOA 4BBSJ 1X1DA 3Q5FA 4HZFA 4GGGA 1OYIA 4RB1A 2ZNZA 5DM6F 3BR2A 1I6HJ 3K4NA 4Y15A 1KU2A 2ZNYA 3RYRA 1DUXC 5JI6A 3CZ6A 2DA3A 3LFUA 4N0BA 4B43A 4YEJA 1NHAA 1YITI 2CFXA 2M9HA 4XONA 3QOPA 2L9NA 3JRFA 3HIFA 2XAGA 2DMTA 3I55I 2MA3A 2HZTA 5KNLA 4B47A 9ANTA 5B3SH 1QVTA 1XSVA 1YS6A 1YW7A 3J80K 1X4PA 3BY6A 3M07A 3CMMA 1MNMC 5D5UB 1WJ5A 5HLGA 3KP6A 3P7NA 1MZBA 3KYCB 4YFXF 3BT9A 4S04A 2Z99A 2VJIA 4JBAA 1ZG3A 4JX5A 3AL0B 1EF4A 1BW6A 5ICGA 1SEUA 2HOTA 2PJPA 1BA5A 3HZJA 1NTCA 3GTGJ 3ZRGA 3W3CA 1O3TA 3GCMA 1TW3A 3LA2A 4IRIA 4Y17A 4LIUA 5D8LB 2V9PA 3FMQA 3WE2A 3TW7A 4MLOA 3ZMDA 3RDIA 5F0FA 2BVLA 2EWNA 4BBRJ 4IO9F 2DW4A 2M45A 2W4SA 5CVUA 4CUGA 1MW7A 4F52A 3NWSA 1MJBA 1BI0A 2MC3A 3GBGA 1ZGWA 3BR6A 2EINH 1M1EB 3PO3J 2ELJA 3F8BA 2FXAA 4CHUA 2L3DA 1WJFA 2L9RA 2XF7A 4RB2C 4Y52J 3GWZA 5J1YA 3CCRI 1AHDP 3DFGA 4HX8A 5D8KB 2R7OA 5JHUA 3L1PA 3HRTA 1FYMA 1P4WA 3WTXC 2GAUA 3WTVC 1MSFC 3BG7A 4WXHA 2OCCH 4AYBN 1ORKA 3K1PA 1SD5A 3ZN1A 5HDNA 3JREA 1SANA 4HAMA 1LFBA 3S15J 2ADUA 2JPBA 1U9OA 4BNCA 3CUQA 3VB2A 3L00A 4ESFA 2ZJQF 5DCMA 3S1NJ 4IRGA 2QQBA 2MLKA 4ESJA 2H1KA 3ZMTA 4LK1F 2GXAA 2JT1A 4RBOA 1IV8A 1YS7A 4A3EJ 3NARA 3GVAA 3GF2A 2VODA 1Q1HA 4B48A 4EJVA 1Z67A 2KFDA 4D9JA 2OU2A 3RKXA 2HEOA 1REPC 4ZYAA 5D5VB 2E1NA 5LRRA 2A6EF 5EDNA 1MH4A 3ABTA 3ECOA 1HW5A 2L54A 4UB6C 5DCMB 1BOBA 3ERED 3KLNA 2FBIA 1VNDA 5D4SA 3HGYA 2JRMA 3QODA 2XAJA 4B8XA 4M72A 4Q5SF 3CDIA 4AVPA 2P4WA 3H3UA 4N9IA 2OZUA 4U0YA 4HBLA 4Y3OA 4PFOA 1O57A 1DU0A 1JHHA 1TZLA 1XSXA 1ZN2A 2DTRA 2OA4A 3G1LA 4HLYA 2DMQA 2M87A 2W7NA 1RKTA 4B3AA 2R5YA 3RCOA 2L4MA 1HF0A 1JT6A 3HOWJ 4XN3A 5K1YA 3EYYA 1ETYA 3K2ZA 3JAMK 1MDMB 1Y1WJ 2WV1A 2HDCA 4HF1A 4QLCU 2EA2A 5HLHA 2FF4A 2JRTA 3WTUC 2EH3A 2WY8Q 1MKMA 4B44A 4UXNA 3FK7A 1FYKA 1A31A 4V19K 4NQWB 2DA7A 5C44J 2NVXJ 3S32A 1CQTA 1OR7C 4NDLA 4UVBA 2XPWA 1PDNC 2DYRH 3EQLF 5E8GA 3ZOBA 3BCBA 2E5NA 2R5YB 4JYKA 1ZG5A 1BJZA 2QENA 4V2FA 3IWFA 4CCMA 3ASOH 1XD7A 4A3JJ 4ANJA 3LMMA 3PM1A 2KPMA 3KP5A 3ZMVA 2JWTA 2LBFA 3FBNB 2VC0A 1X58A 1Y56A 4QPQA 3WE3A 2HQRA 5DM7F 2HVSA 2E35A 1YE9A 1Y0UA 1NK3P 1FOKA 3C1DA 2VI6A 2JTVA 4G6QA 5M5XJ 3S17J 2PI0A 3V42A 3QRFF 2G9WA 3B6AA 3R0AA 2UXXA 5J40A 3PFIA 1ZLKA 1R4NB 1LNWA 4UVAA 2FBHA 2PQ8A 3E5XA 1MNDA 4OMZA 1JI8A 1E3PA 4UUSA 2BGCA 2COMA 3VYTB 2X6YA 5F64A 3KX2A 4S05A 4XLPF 3OYMA 2E1CA 2A05A 4D7MA 1YHQI 3O3KA 2K9NA 2CQKA 2IA2A 4XLHA 3SZGA 3F8NA 4KJZA 1UJ8A 5FKMA 2FMYA 5KAFC 2DN0A 2DFHA 3S1MJ 2JVHA 4J00A 3GYHX 4II3A 4A5NA 2NS7A 1R9TJ 1YLFA 4J01A 2DT7B 5ILVA 2PG4A 2OV7A 3K6GA 5F6FA 2VC1A 2M8EA 5E17F 2PBIA 2V1UA 5IY5H 4I76A 3S8PA 1P7IA 1T6SA 2BXYA 1GHCA 3FMSA 3QAHA 4BHPA 4MTDA 1KZHA 3RTRA 5GPAA 2ID6A 2XGCA 1ZELA 2A3SA 3FHNA 2TRTA 3KZIC 4OIPF 1IDYA 3QOEA 1HLVA 1HSTA 3CCEI 1W1WE 3HHGA 3Q3SA 2FMLA 3ASNH 3K70C 3EETA 2HPIA 1RPWA 2ZB9A 1OCOH 3HPGA 3HXLA 5EEGA 1K83J 1XGNA 1RUOA 4JK1X 5KVRA 5LHIA 1S9HA 4HYEA 3JRGA 1Y0NA 5H20A 2K5CA 4BYYA 1TNTA 2Y30A 1BR2A 5CYVA 3SXYA 1XS9A 3HKZA 4RMNA 4RS8A 1TWGJ 1RUNA 4ZC3A 1XG1A 3ZQ7A 2JJ7A 2E19A 2HZDA 3PO2J 3OR2C 1XB4A 3S1QJ 1ETOA 4LG3A 2VXZA 3R60A 3RKQA 2JQ7A 3CJTB 5LRSA 4KIBA 2VN2A 3T5XA 3WODF 5LGTA 2CUFA 2FU4A 2V1DA 1ONVA 5CVVA 1D1AA 2ZXJA 3PJRA 3P9KA 4OIOF 3T1BA 1YG2A 3LSGA 3C18A 3JR9A 4IOCF 2FA5A 3WU2C 1MBEA 2GA2A 5AIPA 2KIFA 4DNCA 3K0LA 1MMSA 3RPQA 1Z91A 2GWRA 1QZZA 2I10A 3GO5A 3W2VA 1FEXA 3ULQB 3CDHA 2X51A 5JHFA 2NS0A 3JRIA 3RQ4A 5K7ZA 1IXRC 1X2NA 2P6SA 5FFZA 1O3RA 3IH3A 1Z0XA 3RYPA 1K79A 3O8HA 5J6XA 1VQNI 3K69A 3FXJA 4RM2A 5HOOA 3BR0A 3WTSC 2LOOA 1R1VA 2DYSH 2VQCA 3MAJA 1BI3A 1ZGJA 4FHTA 3KEQA 1GT0C 2VT2A 1OISA 2X9DA 4ASNA 2LR8A 4Y13A 3TOBA 1FOYA 4EJTA 4PJLA 3RKWA 1KGSA 3OSGA 1NH3A 3GZ6A 1T08B 3CJQB 2DA6A 2COBA 4M6YA 4HNTA 3ZQHA 2DCEA 2HOEA 3AAFA 4ZZDA 2IGOA 3TQNA 4WF2A 3IRRA 2BE5F 2LRDA 1QNTA 5HLTA 2M7AA 1RR8C 4BXXJ 2CWEA 3V7SA 2R7RA 1GV2A 2ZO4A 2RKHA 3FKIJ 5H6RA 5IOYA 1SVLA 1WJEA 5GAHJ 4CH7A 5DD8A 1B9MA 2MSYA 2V7FA 1OJLA 4A12A 1J0RA 3BLYA 5J3LA 1Z9CA 2MH9A 3MWMA 4DBQA 2NOGA 5HNFA 4HDVA 1XGOA 1MSEC 1IN4A 2IBDA 2FD5A 2H94A 4EATA 4PZJA 3ZQLA 2F4OB 2RC4A 5FLXK 4LFUA 1SAXA 2G0EA 2FRHA 3G71I 3MKLA 4FISA 1SAUA 1UHMA 2DOAA 3UR3C 3OYFA 2LREA 1W0TA 2Z16A 3VYRB 2CUZA 3I9V2 4XM3A 1IGNA 3I4PA 2M0MA 5L3GA 2NVTJ 1R49A 4RDUA 3HTSB 4D5CA 3H36A 2I5UA 1UG2A 3QYEA 3LSRA 1STZA 4HQMA 1FSHA 3PFYA 3WTYC 2ZMEB 3IUOA 2PMZN 3RI4A 1TT5B 4HX4A 1MH3A 1SFEA 3S2HJ 3IWZA 1B72A 4A0ZA 3DP7A 4ETSA 4I6ZA 5B66C 1IW7F 5IP6A 1Z05A 2DODA 2Z5UA 1JKRC 1BOAA 5CLSA 4L0ZB 3RPUD 3TP0A 5IYDJ 4XKBA 1HKSA 1U5TB 3AL0C 2KDZA 1XMXA 3DU5A 4I7HA 3CMYA 1XGMA 5FD5A 4RAFA 2MGQA 2BHZA 4BGDA 5JVTA 2W24A 5JFRA 4H4KC 1ZH5A 2IGMA 4O3MA 2QSGX 1S7EA 3C7JA 5IYBJ 1GV5A 4XORA 4C2TA 1K78B 3EPZA 3KIOA 2AO9A 2HKOA 1B72B 1VQ7I 3GMEA 2OF7A 1VQ5I 4UVCA 1WJBA 5LLQA 1Z3YA 1E17A 1QBJA 3REOA 4WX9A 1W7PD 3KPHA 3LSKA 4M6XA 2IW5A 1MD0A 1YYVA 3L2UA 3WTZA 4PSXA 3PUFA 2HU9A 5FRMA 3C2BA 5E3OA 2WA0A 2RREA 1I1SA 2LK2A 5F1RA 3VDXA 4DYRA 4KNYA 5K5QA 3GZ5A 1F5TA 4RGRA 2GA1A 2PJRB 4XLAA 4CZZA 4P9UA 4IQJA 2HDDA 3LOCA 4ZTJA 5CVRA 3MN2A 2H8RA 2YR2A 4P5OA 2CGPA 2CV1A 3PNTA 2WAFA 2W82A 3LFKA 3HOTA 1H88C 5EYRA 3ABUA 3QYFA 2OTLI 1YOVB 5M3MJ 4QPOA 1P4XA 2VL8A 3WGIA 4HV5A 2M3AA 3L7WA 1B1BA 2FQ3A 3RSNA 2DQLA 1YW9A 2F4IA 3M9AA 2VJ5A 1AWCA 2A5YB 2DXIA 1PUFA 2OCEA 2E60A 2VBZA 1R5ID 1XCBA 4HNUA 4YIRX 4CGZA 3ZMSA 4AIDA 3K4BA 4ENNA 2R7SA 5D5WB 2X6WA 4XSZF 1ENHA 3WTTC 3UKGA 3KEOA 1P6RA 1RIOH 4UV9A 2B63J 1Y8QB 2EZIA 1A36A 5B5EC 4U0WA 4ZJZA 4KMUX 1F36A 4FE7A 1R71A 1FJLA 3H5NA 2YSRA 3MD2A 5AONA 4EM0B 3OMYA 3SQNA 2DDBA 2W00A 2P0WA 3FDYA 4HDUA 3FHZA 3OWTA 1J7KA 1FMWA 1FLIA 2DT6A 4OAZA 2QBYA 2VOPA 4IRHA 3WU1B 2E7WA 3LSTA 1O3SA 1KU3A 1XX5A 3ABMH 2K9SA 3KCCA 3HHHA 4UV8A 5E1ZB 2LD5A 4M9ZA 3RIRA 4A3CJ 5F04A 4AUXA 2KJBA 3F8CA 3KZZA 4IKFA 5D5XB 4Y7NJ 1I6XA 3K70D 3TKYA 3K1MA 2F2EA 1WVRA 3FX3A 1VTNC 2EZLA 2M5WA 3GFLA 5M3FJ 2HTSA 3OYEA 2ESNA 4YFKF 1SD6A 3LSHA 2LF7A 3OYKA 4HRIA 2ZJRF 5FFXA 3TEDA 3BQYA 5FKOA 3TMOA 4M3EA 2VBYA 1YJWI 1X1PA 4BEHB 5E3MA 1PYVA 3KFWX 2Q8KA 1XPXA 3CJNA 4BAYA 1G3SA 1SC7A 2K9MA 1FP1D 2A6TA 4U7DA 4IXAA 4BY7J 4EV0A 4A3KJ 4OMYA 5TISC 3A01A 5L3DA 3MKYB 2CJJA 3AG2H 2VPRA 1U3EM 1EH8A 1LUJB 3PIPF 2R7WA 5ERIA 4E7ZA 3CMAI 1V4RA 3DPTA 3EDPA 1Z21A 1AOYA 4UHTA 1XMAA 1HW1A 1U78A 4FTHA 3HGGA 3HOZJ 1IN8A 4ON0A 1DP7P 1KQ9A 4ZTFA 2O03A 4FETA 4M9XA 2Z1DA 5LGUA 2HGCA 3SZTA 3RJPA 4DW6A 2ZSHB 2XB5A 2JA8J 2X6OA 2L7MP 2VQLA 2E2IJ 1LE8B 3A01B 2EB7A 1FWZA 2ELKA 2M4KA 2ZCWA 4HQEA 1TWFJ 1R4MB 5E1WA 2N8GA 3VODA 3OIOA 1QZEA 3LQRA 5E20A 1WPKA 1D0XA 1S6LA 1I50J 1YX3A 2ESHA 3W2WA 4DZJA 1YFHA 2XGDA 1YTYA 2XF5A 1JKQC 1GXQA 1ODDA 2EA4A 2ZFWA 3VSLA 2QA4I 1OKRA 3MZHA 1ZGAA 2BW3B 2DU9A 2IP2A 2H6BA 3V8JA 1J2XA 2R4GA 1SFUA 1MIJA 2BY3A 4GYIA 4ZYHA 3LL7A 4HA8A 1YO5C 3K7AJ 3U2RA 2TDXA 2R7TA 1V5EA 2E71A 1RI7A 3F8FA 2XROA 1B8IB 2NVQJ 4BL0B 3N4MA 3IH2A 3CCVI 2VE8A 3D5SC 4IHTA 4Q4ZF 1LDDA 4DQ2A 3I64A 1KA8A 3GXOA 4RAGA 2YPRA 1FC3A 2IXSA 1BL0A 1XTAA 2VOOA 1YIJI 2LF8A 1UAAA 5IP7J 1TTYA 2QSFX 3E7LA 4IJAA 4IHYA 3PSIA 5E79C 4Q48A 2DA5A 3DF8A 4ENMA 4IX7A 4IEJA 3DQVC 2EFOA 2IS2A 2GM4A 4FASD 1B59A 2X0LA 5LFAA 3IAS2 3HRSA 2A6HF 4A3MJ 2V9KA 2CV2A 4XOPA 1RETA 1SMTA 5IPAA 2LYCA 5K7FA 2WV0A 2AHQA 2XAQA 3WTWC 2XAFA 3FXKA 2FQ4A 2UV1A 4WCGA 3DCFA 2CH0A 2UUZA 4A0YA 4ZH4F 1WFXA 4AYBA 1RKWA 2G7HA 3V4GA 1UCRA 3HOXJ 3W6JB 4KN4X 2E2JJ 2K3FA 2XSJC 3DKYA 5EEHA 4F91B 4G9YA 1U8BA 1T38A 1BI2A 2O3FA 1L3LA 1XN7A 1I1GA 2YS9A 2IRFG 1YJNI 4KN7X 2EFWA 5LHHA 2RGVA 3F3XA 2LLKA 3GLLA 3V7CA 3C3WA 3QPSA 1P9QC 5LHGA 3VPRA 1PP7U 2LMDA 2R7QA 3BWGA 3HBLA 3ISPA 2K3PA 3MVPA 2R5ZB 4KYWA 2YU3A 2M0CA 3I5UA 3CESA 4X6AJ 5E8IA 2B9SA 2P81A 2NNNA 2D1VA 4XK4A 2DJIA 1IXCA 2QWWA 4EVIA 2G7UA 3DBHB 3DTEA 4CDGA 4PGHA 2KHMA 4L18B 4BHCA 1WH5A 2KIQA 1BN5A 4V2GA 3OYIA 2PN6A 2QYOA 1MDMA 2QCOA 3I3LA 3S3NA 2HYJA 1MBJA 3QYBA 4NC6A 3HG9A 4EJOA 2KMUA 4IVNA 5M5YJ 4MO7A 3LSMA 5IOZA 5EG0A 2LTPA 3ZXSA 1FYLA 4NQWA 5HS8A 4RGSA 3CP8A 5FKKA 2CSOA 2OUMA 2Z33A 2ICWG 2FJ1A 2O5RA 3C2HA 1FMVA 1P2FA 3I56I 1T95A 1Z6RA 2XPUA 3CUOA 4XKCA 3L2CA 5LEJA 2ZXHA 4BU2A 1WZ2A 4A3IJ 5K5RA 1ETKA 1KYZA 3WGGA 1P4AA 3CCMI 3BOQA 1IUFA 3A1YA 1Y1VJ 2QGUA 3OYAA 1WWXA 5FKNA 4FCYA 5EG0B 2XC7A 4LK0F 4L9TA 1OFCX 2VIXA 2EV5A 2KRHA 1N77A 2A61A 3H1CA 4BDZA 1IN7A 1CF7B 2ZMEC 1FOXA 1K6YA 3TO7A 1WKMA 1FTZA 4PGGA 2FEZA 4C3IJ 1K4SA 3S93A 4A69C 3GTMJ 4DZPA 1JUSA 3K1NA 5J8CA 4MEYF 3ZN0A 1ZR4A 2D5VA 2CYYA 2Y9YA 4JQFA 1VQKI 3MZYA 5L3BA 1RRJA 1U5TC 4H0EA 4A93J 1W5CC 4RAZA 2XV4S 2M34A 1HKTA 3JTGA 2WTEA 2DMNA 4S0HB 1ZK8A 5IT9Z 1YW8A 2F5DA 2XKPA 4F93B 1D5VA 1FNNA 3QP6A 5FO5A 3WHBA 4AM3A 3AKZA 3FXRA 1IRZA 1IJWC 1ZAOA 3IH4A 4FE4A 4F7ZA 1S72I 3E6DA 4BJ6C 4BUPA 2JPCA 1FIPA 5HDKA 4I09A 4LB5A 3OYBA 5LEKA 1R22A 1FOWA 3P9CA 3OOPA 2KRCA 2RDPA 4IHSA 4EJUA 4PDKA 3R61A 1RC9A 2QUFA 1SVOA 3FZVA 3I54A 4BQOA 3SHFA 1ETQA 4P9FA 2D1HA 5J1RA 3BJOA 4XQFA 3AG4H 1T2KA 3S14J 5EZHA 4CXFA 5IT3A 4I99C 5ED4A 1JJ6C 1ERDA 4DBRA 3JRBA 2DK5A 1HDPA 3KP4A 4ITVA 5D6FA 3V7RA 4ZDPA 5BPIA 3HSRA 4IHXA 1FT9A 3CDLA 4ZYEA 5JLWA 4O6JA 2O6GE 2V1XA 5BS6A 3HEFA 3HOVJ 4QSHA 3JRAA 2V6EA 1K6OA 2KP6A 2Q2EA 1FBSA 5JVGF 4AIKA 1GXPA 2DPDA 4XNFA 3OL4A 1J9IA 1D1CA 5AIQA 1FY7A 4YG2F 1F1ZA 4CICA 4C30A 1J59A 4IF4A 3S3OA 2L0KA 3DEEA 3DEWA 1TC3C 1HC8A 1OCTC 1DPRA 4ENKA 2BY2A 4R8HA 1LJ9A 4LG0A 3O8GA 3TO9A 2C6YA 2M8GX 3BG9A 1RR7A 2QZ8A 1JGGA 5DCFA 4NC8A 1ACIA 3COAC 4FX4A 2Q2EB 3D5LA 3ZMUA 2AQFA 5IP9J 2JA6J 3S2DJ 4OU0A 1G2HA 2FNAA 2Y0SN 3H5AA 1BI1A 1TLHB 1GVJA 2AXTC 4XR6A 1IXSB 2QQ9A 1OCCH 2IT0A 3L2QA 1U8RA 3G1OA 1D3YA 4R1HA 2WB1N 5GTHC 2A07F 3L2WA 2BVMA 5C4JJ 3GFIA 5E3NA 2CO5A 2LC2A 4PJ0C 5A2QK 1YJ9I 1BIAA 1UB9A 3I0TA 4F3QA 3E97A 3CLQA 1HXDA 4LG0B 1UELB 2LFBA 1DDNA 2O8KA 1D0ZA 1MMNA 4EJWA 2HWVA 3J81Z 3OS2A 5L3FA 1FBQA 1IV6A 3F0CA 1TW2A 2X48A 3CQZJ 2H27A 2Q0OA 2FBKA 1ETXA 4WXCA 2PEXA 3FXMA 1EV7A 1BR4A 3K4KA 1TT0A 3V8KA 3CC2I 4NNJA 2GXBA 2GIZA 1UMQA 1NK2P 4HV6A 1APLC 4HEA2 2EBIA 2KRFA 3HUGB 2V9VA 4U0VA 1W5TA 2NVUB 4PFPA 4C2MJ 1A35A 5FRNA 3H9JA 3M1EA 3M3YJ 4L9JA 2R3SA 3LSIA 4XRMA 1ETVA 1OYYA 2DA1A 3G73A 2LDUA 4G7ZF 1V3FA 2DMPA 2QKLB 4HG2A 3N05A 1W0UA 1OCPA 5GADJ 4OINF 2XAUA 3BP8A 2BY1A 4IPAA 1PUEE 2WY7Q 1MJ9A 5J8FA 4HNVA 2STWA 1R1TA 3CMEI 1IRFA 2LY9A 3SFIA 4B09A 3HOYJ 2BZTA 4RGXA 2H6CA 2DQRA 2XHKA 3FXUA 2DPUA 4HW0A 2CV0A 4RGUA 3GFMA 5TGTA 3PSFA 3DTKA 3CC7I 2ZMEA 3E6MA 5FLVA 3QPTA 4EM2A 4IOAF 3J7AO 2IPQX 3FM5A 1A6QA 3EUAA 5LD2C 3Q9VA 1ZLJA 4XLEA 3G3ZA 3B73A 2TCTA 3TP3A 2HXOA 3OYGA 4M3DA 4ZYDA 3MCZA 3S2WA 4N9HA 2FUG2 1U5TA 4HF2A 1I3QJ 4BQQA 1FIAA 3F6OA 2E2HJ 4BH9A 1D5YA 3KLOA 5DV5A 4OIQF 2KT0A 2E1OA 3M1CA 2L4AA 4L9VA 1CGPA 2Q1ZB 3LWFA 1XC5A 2CS3A 1S7OA 4XN0A 2BXZA 2XPVA 5EJCA 4EEFG 3BZ6A 1TWHJ 3U21A 1WSUA 3ZQCA 1K78A 1MBGA 1S8NA 2PMZA 4JP0A 3LNQA 2VE9A 5J47A 4IL6C 3SYTA 5F0HA 1R6RA 3WG9A 3A2KA 1H9GA 4BE1A 2ISYA 3D1NI 2IS1A 1Z6TA 2LY1A 1KU7A 3FISA 3GTOJ 1IZ1A 2V26A 1T0FA 2AXLA 2FE3A 3QPLA 2VLAA 1VQPI 3E5UA 4CCOA 1VI0A 3FBIB 1JUMA 4XLNF 1VZ0A 2EFQA 3R6SA 4B4CA 1YX5A 2GIVA 3OY9A 2VKEA 2OAZA 3S3MA 1VQOI 4UUTA 3FXOA 1X1AA 1Y6IA 3G6EI 1LVKA 3H35A 2PJRA 4EGYA 3T0YA 2HPMA 3KZYA 2IGNA 2GQQA 2ECCA 5HLIA 2R7FA 2M4GA 2WAEA 1G59A 4A6DA 3AFHA 1Q1VA 4QIWN 1IO2A 1HCRA 4ZYGA 1G3TA 3BZCA 2ME6A 3HOSA 5C3EJ 1MBFA 3K4LA 1D8JA 3BTCA 2VJJA 5K5OA 3PIOF 3ZQIA 2YX4A 5GAEJ 3DKXA 2LY2A 2P6TA 5E1XA 1TNSA 1LB2A 2B7EA 2XIGA 1BR1A 3IV5A 1JKOC 2CW7A 5BMZA 5J4VA 2UZKA 2OC6A 4NC7A 1TQMA 3TW6A 1WI9A 1BBYA 4UY8I 4BACA 1N25A 3B6CA 4HF0A 4CO8A 3D0SA 2YX7A 2EV0A 2P7CB 1ZQ3P 1YQAA 4LB6B 2LH9A 3K2AA 3IP4B 2CUEA 2K02A 2L7FP 5ICFA 1ETWA 2JA5J 3IAM2 1TL8A 1ON1A 3NWTA 1ZRDA 1IDZA 3RZDJ 4EM1A 5M5WJ 4A0XA 2K40A 3WG7H 1U9NA 4FT8A 3CCLI 1IAWA 4CCLA 2Z9OA 3FF5A 3Q9SA 3F72A 4I02A 3CO6C 2ZJ2A 2L5QA 1Y8RB 2W85A 3E5QA 2WAQN 3OIQA 1VQ4I
chains in the Genus database with same CATH topology
4MHGA 1U6GA 4RAYA 1EH6A 4KA4A 4ZZLA 4YFNF 4K2EA 1RNLA 4OOIA 1XDUA 1C0WA 3DEUA 1Z1DA 3MFKA 1QPMA 3FXQA 5FB2A 3M7GA 3N97A 1L0OC 1TQIA 5HS7A 2NNYA 3P9IA 1HQCA 3SZPA 5CJ9A 2OZ6A 2HR3A 1O3QA 2BYVE 2B0LA 4PCQA 1R23A 2DAOA 2W57A 2ZKZA 1T98A 4LLNA 3T8TA 2HKXA 3BJ6A 1BIBA 3EUHA 2P7VB 2PMHA 1IRGA 3HTUA 2FOKA 3E3VA 3VOEA 2O61A 1FSEA 4QWQA 1T39A 2DT5A 4U7BA 3I71A 5ICCA 2HS5A 3BPVA 2PMUA 2R7DA 4LMYA 1J5YA 3BPXA 2XASA 4OIRF 1JHFA 1U2WA 2BEOA 2F5CA 2K86A 2MD5A 3R0JA 1FX7A 4M73A 3M8FA 3GUDA 1LDKB 5JR3A 1SFXA 2LSOA 2KJCA 3IL2A 5ICEA 4HLXA 2JSCA 1HBXG 1ZARA 1HSJA 4AIJA 2XAHA 2VONA 3HSEA 3PQKA 2O8XA 5HS9A 4P55A 4KFCA 2OD5A 1E2XA 3IRQA 1OYWA 1SD7A 4G7OF 3CO7C 2M1BA 3JTHA 1R36A 2RV8A 4EGZA 2KIUA 4O5VA 4LGWA 4KIFA 3LA3A 5TRDA 3ZPLA 3QPHA 2QLZA 4KICA 3ELKA 1JXSA 3KP3A 5DD4A 6PAXA 1XCVA 3W6KB 3O2PE 2WC2A 1I5ZA 3ZP5A 4Q47A 2HFHA 4WK8F 3DV8A 4AD9A 2DO7A 1J75A 3J81K 5FGMA 4A6EA 4GCVA 1UHWA 1P92A 2STTA 1BC7C 2QVOA 4UNOA 1S7AA 3LAPA 1JE8A 4G6DA 2LKPA 2BBYA 2DBBA 1BC8C 3ECHA 2FSWA 3NEUA 2RQPA 3GW2A 3R4KA 3ZMZA 1ON2A 4KMFA 2RN7A 3QU6A 2V6CA 3CUQB 2D2WA 3ML6A 5LGNA 1XSDA 2XRNA 2UWMA 2ISZA 1SD4A 1CF7A 1B6AA 4L9NA 1G3WA 4XSXF 4GYGA 2RNJA 1R00A 2X4HA 2HQNA 1OMIA 3BROA 1BM9A 5ILSA 2K7LA 1ZREA 4LLGF 1K7AA 1KQ0A 2XUBA 2MH2A 4I0AA 1KYWA 2EK5A 3F6VA 2H09A 3L9FA 4G94A 1I27A 2W25A 3K9TA 4GXOA 1H9TA 2ACJA 4MTEA 3TDZC 3VEPA 1MGTA 3CTAA 1OPCA 4LD5A 3KE2A 4WXDA 4MGRA 1LEAA 3IHUA 1R58A 1KU9A 3IKVA 1PP8F 2P5KA 2O0YA 4TV7A 5BQTA 1YIOA 2UXNA 4KDPA 2F5EA 1G4DA 2BV6A 2DFIA 1XGSA 4GO1A 1R5GA 2HTJA 4L5JA 4ENJA 1IN5A 2K4BA 3WU0A 1R7JA 2NYXA 3O6BB 1FBUA 4I01A 1HW2A 2OQRA 3WGHA 3L09A 3J80Z 1LQ1A 3I59A 4R79A 2VBWA 3ROUA 4L5IA 1IUYA 2XKOA 1HKQA 4I98B 1BJAA 2P5VA 3MQ0A 3SFZA 2KIMA 3HYIA 3I59B 3QU3A 1IN6A 1WRJA 1ZYRF 3CLOA 4XRFA 1ZG1A 5DDGA 2VT3A 3KP7A 2V79A 1W4MA 3B02A 3NRVA 1XMKA 1RZ4A 1ULYA 3T8RA 1SMYF 3HUGA 3EYIA 1TBXA 1DPUA 2PFBA 2EJRA 1USSA 3HRMA 1FPQA 1O7FA 2Y48A 5DYMA 5TJJA 3GX4X 1X3UA 3HRUA 4EQQA 3GFJA 3LAJA 1B9NA 3I58A 3F23A 2J5OA 1A04A 3U1DA 2MLGA 4KIGA 1LDJA 3DKWA 3TO6A 3DXJF 2WWYA 4BHBA 2L01A 3RPUA 2DK8A 1MJAA 2OBPA 5BPDA 2NRAC 3KETA 2IA0A 4KUMA 3JSPA 1R5HA 2L02A 1QGPA 1B4AA 2EFNA 5KK1A 2K4JA 5BOXA 2RVCA 2CW0F 5HDGA 4M74A 5FD6A 1S29A 1W7PA 4I2OA 5DUKA 3JAMZ 4ESBA 3E6BA 3TGNA 1OR7A 1JGSA 1FZPB 1W5SA 2P8TA 1D8KA 3BJAA 3E6CC 2QQAA 1FP2A 1W7PB 2Y75A 2XVCA 1USTA 3KP2A 2K27A 2Z3YA 3JSOA 3F21A 4HOBA 5DUIA 2EV6A 4CYDA 1LVAA 3IKTA 4WWCA 1ZHFA 3I53A 3M8EA 1ZRCA 4LLLA 4LJZF 5L3CA 5ILUA 1F9NA 3VFZA 2IA1A 1S3JA 3H3ZA 5D4RA 3LQQA 3OV8A 5CVIA 3RKYA 3JW4A 4HX7A 1TQPA 2E7XA 3U9GA 3NQOA 4I0BA 2LNBA 4M71A 2M30A 4Z2YA 1O7LA 5D6EA 4XBFA 1G6NA 2Y0MA 4RB3C 1UFMA 2F5FA 1H0MA 3TOAA 4UUVA 3FWEA 3FM3A 2ELHA 4MQVA 2HYFA 3GEZA 4YIIA 2FNPA 4AIHA 3GLXA 4KT5C 3IC7A 3HSFA 4A5MA 2D45A 2QM3A 1QQIA 3F22A 2PLYA 1QO0D 5DEQA 4MQ9F 3MEXA 3H92A 1WQ2A 3BDDA 2OQGA 1LEBA 3CUQC 5HVQC 4RB0A 4L0YB 4P96A 5H6QA 4NB5A 5CVJA 5A2QZ 4U88A 2GXGA 1Z7UA 3PQJA 4NHJA 3DPLC 1R1UA 4FX0A 2VBXA 4G8XA 2IVMA 2IJLA 1XDSA 5LBQA 4YIFA 2A68F 3V8LA 2ZBKA 4MEXF 2ETHA 4M9SA 2DLLA 2DI3A 4MNUA 2GZWA 4E70A 4D0PA 1ZRFA 2MBFA 2XGXA 2KKOA 3F8MA 4G7HF 2QBYB 4AWXB 2A69F 2NAZA 2EFPA 3TDUC 4BQAA 4A2UA 5L3EA 2CG4A 1QZYA 1KQ8A 2JZYA 1EH7A 5IT9K 2J5PA 3FMRA 1IF1A 4BXUA 2P5LC 1G3YA 5FLXZ 1F4KA 5E18F 3LA7A 2W84A 3QP5A 2HYGD 2AS5F 4EMSA 3Q5FA 4HZFA 4GGGA 1OYIA 4RB1A 2ZNZA 4Y15A 1KU2A 2ZNYA 3RYRA 1DUXC 5JI6A 4N0BA 1NHAA 2CFXA 3QOPA 3HIFA 2XAGA 2MA3A 2HZTA 1XSVA 1YS6A 1YW7A 3J80K 3BY6A 5D5UB 5HLGA 3KP6A 3P7NA 1MZBA 4YFXF 4S04A 2Z99A 4JBAA 1ZG3A 5ICGA 2PJPA 1O3TA 1TW3A 3LA2A 4IRIA 4Y17A 5D8LB 3FMQA 3WE2A 3ZMDA 3RDIA 2EWNA 2DW4A 2M45A 5CVUA 1MJBA 1BI0A 2MC3A 3F8BA 2FXAA 4CHUA 2L3DA 4RB2C 3GWZA 3DFGA 4HX8A 5D8KB 5JHUA 1FYMA 3HRTA 1P4WA 3WTXC 2GAUA 3WTVC 4WXHA 3K1PA 1SD5A 3ZN1A 5HDNA 4HAMA 2ADUA 2JPBA 4BNCA 3CUQA 3VB2A 3L00A 4ESFA 5DCMA 4IRGA 2QQBA 2MLKA 4ESJA 3ZMTA 4LK1F 2JT1A 1YS7A 3GVAA 3GF2A 2VODA 1Q1HA 4EJVA 2OU2A 3RKXA 2HEOA 1REPC 5D5VB 2E1NA 5LRRA 2A6EF 3ABTA 3ECOA 1HW5A 2L54A 5DCMB 3ERED 3KLNA 2FBIA 5D4SA 2XAJA 4B8XA 4M72A 4Q5SF 4AVPA 2P4WA 3H3UA 4N9IA 2OZUA 4U0YA 4HBLA 1O57A 1JHHA 1XSXA 1ZN2A 2DTRA 2OA4A 4HLYA 2M87A 2L4MA 5K1YA 3EYYA 3K2ZA 3JAMK 1MDMB 2HDCA 4HF1A 4QLCU 2EA2A 5HLHA 2FF4A 2JRTA 3WTUC 1FYKA 1MKMA 4UXNA 4UVBA 1PDNC 3EQLF 5E8GA 1ZG5A 2QENA 3IWFA 1XD7A 3KP5A 3ZMVA 2VC0A 3WE3A 2HQRA 1Y0UA 1FOKA 3C1DA 2JTVA 4G6QA 2PI0A 3QRFF 2G9WA 3R0AA 2UXXA 3PFIA 1ZLKA 1LNWA 4UVAA 2FBHA 2PQ8A 3E5XA 4OMZA 2BGCA 2COMA 5F64A 4S05A 4XLPF 2E1CA 3O3KA 2CQKA 2IA2A 3F8NA 2FMYA 3GYHX 4A5NA 1YLFA 5ILVA 2PG4A 5F6FA 2VC1A 2M8EA 5E17F 2PBIA 2V1UA 1T6SA 1GHCA 3FMSA 3QAHA 4BHPA 4MTDA 3RTRA 2A3SA 4OIPF 1HSTA 3HHGA 2FMLA 3EETA 5EEGA 1XGNA 1RUOA 4JK1X 5KVRA 5LHIA 4HYEA 5H20A 4BYYA 1TNTA 5CYVA 3SXYA 4RS8A 1RUNA 3ZQ7A 1XB4A 2VXZA 3R60A 5LRSA 4KIBA 2VN2A 3T5XA 3WODF 5LGTA 2FU4A 2V1DA 1ONVA 5CVVA 2ZXJA 3P9KA 4OIOF 3T1BA 1YG2A 3C18A 2FA5A 2GA2A 5AIPA 2KIFA 4DNCA 3K0LA 3RPQA 1Z91A 2GWRA 1QZZA 3GO5A 3ULQB 3CDHA 2NS0A 1IXRC 2P6SA 5FFZA 1O3RA 3RYPA 1K79A 5J6XA 3K69A 5HOOA 3WTSC 1R1VA 3MAJA 1BI3A 1ZGJA 4FHTA 3KEQA 2VT2A 4ASNA 4Y13A 4EJTA 3TOBA 3RKWA 1KGSA 3GZ6A 4M6YA 2HOEA 3AAFA 4ZZDA 3TQNA 3IRRA 4WF2A 2BE5F 1QNTA 2CWEA 3V7SA 2ZO4A 2RKHA 5H6RA 5DD8A 1B9MA 4A12A 1J0RA 1Z9CA 2MH9A 3MWMA 4HDVA 1XGOA 1IN4A 2H94A 4PZJA 2RC4A 5FLXK 4LFUA 1SAXA 2FRHA 1UHMA 3I4PA 5L3GA 3HTSB 1STZA 4HQMA 1FSHA 3WTYC 2ZMEB 3RI4A 4HX4A 1SFEA 3IWZA 4A0ZA 3DP7A 4ETSA 1IW7F 1Z05A 2Z5UA 1BOAA 5CLSA 4L0ZB 1HKSA 1U5TB 4I7HA 1XGMA 5FD5A 5JVTA 2W24A 5JFRA 1ZH5A 4O3MA 3C7JA 1K78B 2HKOA 4UVCA 5LLQA 1E17A 1QBJA 3REOA 4WX9A 1W7PD 4M6XA 2IW5A 1MD0A 1YYVA 3WTZA 1I1SA 5F1RA 4KNYA 5K5QA 3GZ5A 1F5TA 4RGRA 2GA1A 4CZZA 4P9UA 5CVRA 2YR2A 4P5OA 2CGPA 3LFKA 3HOTA 3ABUA 1P4XA 3WGIA 4HV5A 3L7WA 1B1BA 2FQ3A 2DQLA 1YW9A 3M9AA 1AWCA 2A5YB 2VBZA 1XCBA 4CGZA 3ZMSA 4ENNA 5D5WB 4XSZF 3WTTC 3KEOA 1P6RA 1RIOH 4UV9A 4U0WA 4KMUX 2YSRA 5AONA 4EM0B 3SQNA 4HDUA 3FHZA 1J7KA 1FLIA 2QBYA 2VOPA 4IRHA 3WU1B 2E7WA 3LSTA 1O3SA 1KU3A 3KCCA 3HHHA 4UV8A 5E1ZB 4M9ZA 3RIRA 2KJBA 3F8CA 3KZZA 5D5XB 1I6XA 3TKYA 3K1MA 2F2EA 3FX3A 1VTNC 2M5WA 3GFLA 2HTSA 2ESNA 4YFKF 1SD6A 2LF7A 5FFXA 2VBYA 3KFWX 2Q8KA 3CJNA 4BAYA 1G3SA 1FP1D 4U7DA 4IXAA 4EV0A 4OMYA 5L3DA 1U3EM 1EH8A 5ERIA 1V4RA 3DPTA 3EDPA 1AOYA 4UHTA 1XMAA 1HW1A 1U78A 1IN8A 4ON0A 1DP7P 1KQ9A 2O03A 4M9XA 5LGUA 2HGCA 3SZTA 3RJPA 2EB7A 1FWZA 2ZCWA 4HQEA 5E1WA 3VODA 3LQRA 5E20A 1S6LA 2ESHA 1YFHA 1YTYA 1GXQA 1ODDA 2EA4A 2ZFWA 1OKRA 3MZHA 1ZGAA 2DU9A 2IP2A 2H6BA 3V8JA 1J2XA 1SFUA 4GYIA 4ZYHA 4HA8A 1YO5C 3U2RA 2TDXA 1RI7A 3F8FA 2XROA 3N4MA 2VE8A 4IHTA 4Q4ZF 1LDDA 4DQ2A 3I64A 1KA8A 3GXOA 2YPRA 1FC3A 2VOOA 2LF8A 1TTYA 4IJAA 4Q48A 3DF8A 4ENMA 3DQVC 2EFOA 1B59A 2X0LA 3HRSA 2A6HF 1SMTA 2WV0A 2XAQA 3WTWC 2XAFA 4WCGA 4A0YA 4ZH4F 3V4GA 2G7HA 1UCRA 3W6JB 4KN4X 5EEHA 1T38A 4G9YA 1L3LA 1BI2A 2O3FA 1XN7A 1I1GA 2IRFG 4KN7X 2EFWA 5LHHA 2RGVA 3F3XA 3V7CA 3C3WA 5LHGA 1PP7U 3BWGA 3ISPA 4KYWA 2YU3A 3I5UA 5E8IA 2NNNA 2D1VA 1IXCA 2QWWA 4EVIA 2G7UA 4CDGA 4PGHA 4L18B 4BHCA 1BN5A 2PN6A 2QYOA 1MDMA 4EJOA 4IVNA 1FYLA 4NQWA 5HS8A 4RGSA 2CSOA 2Z33A 1P2FA 1Z6RA 3CUOA 3L2CA 5LEJA 5K5RA 1KYZA 3WGGA 1P4AA 3BOQA 1WWXA 4LK0F 4L9TA 2EV5A 2A61A 1IN7A 1CF7B 3TO7A 1WKMA 4PGGA 2FEZA 3K1NA 5J8CA 4MEYF 3ZN0A 2CYYA 4JQFA 3MZYA 5L3BA 1U5TC 4H0EA 4RAZA 2XV4S 1HKTA 3JTGA 2WTEA 5IT9Z 1YW8A 2F5DA 2XKPA 1D5VA 1FNNA 3QP6A 5FO5A 3FXRA 1ZAOA 4F7ZA 3E6DA 2JPCA 5HDKA 4I09A 4LB5A 5LEKA 1R22A 3P9CA 3OOPA 2RDPA 4IHSA 4EJUA 4PDKA 3R61A 2QUFA 3FZVA 3I54A 3SHFA 4P9FA 2D1HA 3BJOA 1T2KA 4CXFA 5IT3A 5ED4A 2DK5A 5D6FA 3KP4A 3V7RA 5BPIA 3HSRA 1FT9A 4ZYEA 4O6JA 2O6GE 2V1XA 5BS6A 1K6OA 2Q2EA 1FBSA 4AIKA 1GXPA 2DPDA 1J9IA 5AIQA 1FY7A 4YG2F 1F1ZA 4CICA 1J59A 4IF4A 1DPRA 4ENKA 4R8HA 1LJ9A 4LG0A 3TO9A 2C6YA 2QZ8A 5DCFA 3COAC 4FX4A 3D5LA 3ZMUA 4OU0A 2FNAA 1BI1A 1TLHB 1GVJA 1IXSB 2QQ9A 2IT0A 1U8RA 1D3YA 4R1HA 2A07F 3GFIA 5A2QK 2CO5A 1BIAA 1UB9A 3I0TA 3E97A 1HXDA 4LG0B 1DDNA 4EJWA 3J81Z 2HWVA 5L3FA 1FBQA 1TW2A 2H27A 2Q0OA 2FBKA 4WXCA 2PEXA 1EV7A 3V8KA 2GXBA 4HV6A 2KRFA 2V9VA 4U0VA 1W5TA 3M1EA 4L9JA 2R3SA 1OYYA 3G73A 2LDUA 4G7ZF 1V3FA 4OINF 3BP8A 4IPAA 1PUEE 1MJ9A 5J8FA 2STWA 1R1TA 1IRFA 4B09A 4RGXA 2H6CA 2DQRA 2XHKA 3FXUA 2DPUA 4HW0A 4RGUA 3GFMA 2ZMEA 3E6MA 3QPTA 4EM2A 3J7AO 2IPQX 3FM5A 3Q9VA 1ZLJA 3G3ZA 3B73A 4ZYDA 3MCZA 3S2WA 4N9HA 1U5TA 4HF2A 3F6OA 4BH9A 3KLOA 5DV5A 4OIQF 2L4AA 4L9VA 1CGPA 3LWFA 1S7OA 3BZ6A 1WSUA 1K78A 1S8NA 2VE9A 3WG9A 1H9GA 2ISYA 1Z6TA 1KU7A 1IZ1A 1T0FA 2AXLA 2FE3A 3E5UA 4XLNF 2EFQA 3R6SA 2GIVA 2OAZA 4EGYA 3T0YA 3KZYA 2GQQA 5HLIA 2R7FA 4A6DA 4ZYGA 1G3TA 3HOSA 1D8JA 5K5OA 2YX4A 2P6TA 5E1XA 1TNSA 1LB2A 2XIGA 5BMZA 2UZKA 1TQMA 1WI9A 1BBYA 4HF0A 4CO8A 3D0SA 2YX7A 2EV0A 2P7CB 1YQAA 4LB6B 2K02A 5ICFA 1ZRDA 1ON1A 4EM1A 4A0XA 4FT8A 1IAWA 2Z9OA 3FF5A 3Q9SA 3F72A 4I02A 3CO6C 2ZJ2A 2W85A 3E5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHG A;  1U6G A;  4RAY A;  1EH6 A;  4KA4 A;  4ZZL A;  4YFN F;  4K2E A;  1RNL A;  4OOI A;  1XDU A;  1C0W A;  3DEU A;  1Z1D A;  3MFK A;  1QPM A;  3FXQ A;  5FB2 A;  3M7G A;  3N97 A;  1L0O C;  1TQI A;  5HS7 A;  2NNY A;  3P9I A;  1HQC A;  3SZP A;  5CJ9 A;  2OZ6 A;  2HR3 A;  1O3Q A;  2BYV E;  2B0L A;  4PCQ A;  1R23 A;  2DAO A;  2W57 A;  2ZKZ A;  1T98 A;  4LLN A;  3T8T A;  2HKX A;  3BJ6 A;  1BIB A;  3EUH A;  2P7V B;  2PMH A;  1IRG A;  3HTU A;  2FOK A;  3E3V A;  3VOE A;  2O61 A;  1FSE A;  4QWQ A;  1T39 A;  2DT5 A;  4U7B A;  3I71 A;  5ICC A;  2HS5 A;  3BPV A;  2PMU A;  2R7D A;  4LMY A;  1J5Y A;  3BPX A;  2XAS A;  4OIR F;  1JHF A;  1U2W A;  2BEO A;  2F5C A;  2K86 A;  2MD5 A;  3R0J A;  1FX7 A;  4M73 A;  3M8F A;  3GUD A;  1LDK B;  5JR3 A;  1SFX A;  2LSO A;  2KJC A;  3IL2 A;  5ICE A;  4HLX A;  2JSC A;  1HBX G;  1ZAR A;  1HSJ A;  4AIJ A;  2XAH A;  2VON A;  3HSE A;  3PQK A;  2O8X A;  5HS9 A;  4P55 A;  4KFC A;  2OD5 A;  1E2X A;  3IRQ A;  1OYW A;  1SD7 A;  4G7O F;  3CO7 C;  2M1B A;  3JTH A;  1R36 A;  2RV8 A;  4EGZ A;  2KIU A;  4O5V A;  4LGW A;  4KIF A;  3LA3 A;  5TRD A;  3ZPL A;  3QPH A;  2QLZ A;  4KIC A;  3ELK A;  1JXS A;  3KP3 A;  5DD4 A;  6PAX A;  1XCV A;  3W6K B;  3O2P E;  2WC2 A;  1I5Z A;  3ZP5 A;  4Q47 A;  2HFH A;  4WK8 F;  3DV8 A;  4AD9 A;  2DO7 A;  1J75 A;  3J81 K;  5FGM A;  4A6E A;  4GCV A;  1UHW A;  1P92 A;  2STT A;  1BC7 C;  2QVO A;  4UNO A;  1S7A A;  3LAP A;  1JE8 A;  4G6D A;  2LKP A;  2BBY A;  2DBB A;  1BC8 C;  3ECH A;  2FSW A;  3NEU A;  2RQP A;  3GW2 A;  3R4K A;  3ZMZ A;  1ON2 A;  4KMF A;  2RN7 A;  3QU6 A;  2V6C A;  3CUQ B;  2D2W A;  3ML6 A;  5LGN A;  1XSD A;  2XRN A;  2UWM A;  2ISZ A;  1SD4 A;  1CF7 A;  1B6A A;  4L9N A;  1G3W A;  4XSX F;  4GYG A;  2RNJ A;  1R00 A;  2X4H A;  2HQN A;  1OMI A;  3BRO A;  1BM9 A;  5ILS A;  2K7L A;  1ZRE A;  4LLG F;  1K7A A;  1KQ0 A;  2XUB A;  2MH2 A;  4I0A A;  1KYW A;  2EK5 A;  3F6V A;  2H09 A;  3L9F A;  4G94 A;  1I27 A;  2W25 A;  3K9T A;  4GXO A;  1H9T A;  2ACJ A;  4MTE A;  3TDZ C;  3VEP A;  1MGT A;  3CTA A;  1OPC A;  4LD5 A;  3KE2 A;  4WXD A;  4MGR A;  1LEA A;  3IHU A;  1R58 A;  1KU9 A;  3IKV A;  1PP8 F;  2P5K A;  2O0Y A;  4TV7 A;  5BQT A;  1YIO A;  2UXN A;  4KDP A;  2F5E A;  1G4D A;  2BV6 A;  2DFI A;  1XGS A;  4GO1 A;  1R5G A;  2HTJ A;  4L5J A;  4ENJ A;  1IN5 A;  2K4B A;  3WU0 A;  1R7J A;  2NYX A;  3O6B B;  1FBU A;  4I01 A;  1HW2 A;  2OQR A;  3WGH A;  3L09 A;  3J80 Z;  1LQ1 A;  3I59 A;  4R79 A;  2VBW A;  3ROU A;  4L5I A;  1IUY A;  2XKO A;  1HKQ A;  4I98 B;  1BJA A;  2P5V A;  3MQ0 A;  3SFZ A;  2KIM A;  3HYI A;  3I59 B;  3QU3 A;  1IN6 A;  1WRJ A;  1ZYR F;  3CLO A;  4XRF A;  1ZG1 A;  5DDG A;  2VT3 A;  3KP7 A;  2V79 A;  1W4M A;  3B02 A;  3NRV A;  1XMK A;  1RZ4 A;  1ULY A;  3T8R A;  1SMY F;  3HUG A;  3EYI A;  1TBX A;  1DPU A;  2PFB A;  2EJR A;  1USS A;  3HRM A;  1FPQ A;  1O7F A;  2Y48 A;  5DYM A;  5TJJ A;  3GX4 X;  1X3U A;  3HRU A;  4EQQ A;  3GFJ A;  3LAJ A;  1B9N A;  3I58 A;  3F23 A;  2J5O A;  1A04 A;  3U1D A;  2MLG A;  4KIG A;  1LDJ A;  3DKW A;  3TO6 A;  3DXJ F;  2WWY A;  4BHB A;  2L01 A;  3RPU A;  2DK8 A;  1MJA A;  2OBP A;  5BPD A;  2NRA C;  3KET A;  2IA0 A;  4KUM A;  3JSP A;  1R5H A;  2L02 A;  1QGP A;  1B4A A;  2EFN A;  5KK1 A;  2K4J A;  5BOX A;  2RVC A;  2CW0 F;  5HDG A;  4M74 A;  5FD6 A;  1S29 A;  1W7P A;  4I2O A;  5DUK A;  3JAM Z;  4ESB A;  3E6B A;  3TGN A;  1OR7 A;  1JGS A;  1FZP B;  1W5S A;  2P8T A;  1D8K A;  3BJA A;  3E6C C;  2QQA A;  1FP2 A;  1W7P B;  2Y75 A;  2XVC A;  1UST A;  3KP2 A;  2K27 A;  2Z3Y A;  3JSO A;  3F21 A;  4HOB A;  5DUI A;  2EV6 A;  4CYD A;  1LVA A;  3IKT A;  4WWC A;  1ZHF A;  3I53 A;  3M8E A;  1ZRC A;  4LLL A;  4LJZ F;  5L3C A;  5ILU A;  1F9N A;  3VFZ A;  2IA1 A;  1S3J A;  3H3Z A;  5D4R A;  3LQQ A;  3OV8 A;  5CVI A;  3RKY A;  3JW4 A;  4HX7 A;  1TQP A;  2E7X A;  3U9G A;  3NQO A;  4I0B A;  2LNB A;  4M71 A;  2M30 A;  4Z2Y A;  1O7L A;  5D6E A;  4XBF A;  1G6N A;  2Y0M A;  4RB3 C;  1UFM A;  2F5F A;  1H0M A;  3TOA A;  4UUV A;  3FWE A;  3FM3 A;  2ELH A;  4MQV A;  2HYF A;  3GEZ A;  4YII A;  2FNP A;  4AIH A;  3GLX A;  4KT5 C;  3IC7 A;  3HSF A;  4A5M A;  2D45 A;  2QM3 A;  1QQI A;  3F22 A;  2PLY A;  1QO0 D;  5DEQ A;  4MQ9 F;  3MEX A;  3H92 A;  1WQ2 A;  3BDD A;  2OQG A;  1LEB A;  3CUQ C;  5HVQ C;  4RB0 A;  4L0Y B;  4P96 A;  5H6Q A;  4NB5 A;  5CVJ A;  5A2Q Z;  4U88 A;  2GXG A;  1Z7U A;  3PQJ A;  4NHJ A;  3DPL C;  1R1U A;  4FX0 A;  2VBX A;  4G8X A;  2IVM A;  2IJL A;  1XDS A;  5LBQ A;  4YIF A;  2A68 F;  3V8L A;  2ZBK A;  4MEX F;  2ETH A;  4M9S A;  2DLL A;  2DI3 A;  4MNU A;  2GZW A;  4E70 A;  4D0P A;  1ZRF A;  2MBF A;  2XGX A;  2KKO A;  3F8M A;  4G7H F;  2QBY B;  4AWX B;  2A69 F;  2NAZ A;  2EFP A;  3TDU C;  4BQA A;  4A2U A;  5L3E A;  2CG4 A;  1QZY A;  1KQ8 A;  2JZY A;  1EH7 A;  5IT9 K;  2J5P A;  3FMR A;  1IF1 A;  4BXU A;  2P5L C;  1G3Y A;  5FLX Z;  1F4K A;  5E18 F;  3LA7 A;  2W84 A;  3QP5 A;  2HYG D;  2AS5 F;  4EMS A;  3Q5F A;  4HZF A;  4GGG A;  1OYI A;  4RB1 A;  2ZNZ A;  4Y15 A;  1KU2 A;  2ZNY A;  3RYR A;  1DUX C;  5JI6 A;  4N0B A;  1NHA A;  2CFX A;  3QOP A;  3HIF A;  2XAG A;  2MA3 A;  2HZT A;  1XSV A;  1YS6 A;  1YW7 A;  3J80 K;  3BY6 A;  5D5U B;  5HLG A;  3KP6 A;  3P7N A;  1MZB A;  4YFX F;  4S04 A;  2Z99 A;  4JBA A;  1ZG3 A;  5ICG A;  2PJP A;  1O3T A;  1TW3 A;  3LA2 A;  4IRI A;  4Y17 A;  5D8L B;  3FMQ A;  3WE2 A;  3ZMD A;  3RDI A;  2EWN A;  2DW4 A;  2M45 A;  5CVU A;  1MJB A;  1BI0 A;  2MC3 A;  3F8B A;  2FXA A;  4CHU A;  2L3D A;  4RB2 C;  3GWZ A;  3DFG A;  4HX8 A;  5D8K B;  5JHU A;  1FYM A;  3HRT A;  1P4W A;  3WTX C;  2GAU A;  3WTV C;  4WXH A;  3K1P A;  1SD5 A;  3ZN1 A;  5HDN A;  4HAM A;  2ADU A;  2JPB A;  4BNC A;  3CUQ A;  3VB2 A;  3L00 A;  4ESF A;  5DCM A;  4IRG A;  2QQB A;  2MLK A;  4ESJ A;  3ZMT A;  4LK1 F;  2JT1 A;  1YS7 A;  3GVA A;  3GF2 A;  2VOD A;  1Q1H A;  4EJV A;  2OU2 A;  3RKX A;  2HEO A;  1REP C;  5D5V B;  2E1N A;  5LRR A;  2A6E F;  3ABT A;  3ECO A;  1HW5 A;  2L54 A;  5DCM B;  3ERE D;  3KLN A;  2FBI A;  5D4S A;  2XAJ A;  4B8X A;  4M72 A;  4Q5S F;  4AVP A;  2P4W A;  3H3U A;  4N9I A;  2OZU A;  4U0Y A;  4HBL A;  1O57 A;  1JHH A;  1XSX A;  1ZN2 A;  2DTR A;  2OA4 A;  4HLY A;  2M87 A;  2L4M A;  5K1Y A;  3EYY A;  3K2Z A;  3JAM K;  1MDM B;  2HDC A;  4HF1 A;  4QLC U;  2EA2 A;  5HLH A;  2FF4 A;  2JRT A;  3WTU C;  1FYK A;  1MKM A;  4UXN A;  4UVB A;  1PDN C;  3EQL F;  5E8G A;  1ZG5 A;  2QEN A;  3IWF A;  1XD7 A;  3KP5 A;  3ZMV A;  2VC0 A;  3WE3 A;  2HQR A;  1Y0U A;  1FOK A;  3C1D A;  2JTV A;  4G6Q A;  2PI0 A;  3QRF F;  2G9W A;  3R0A A;  2UXX A;  3PFI A;  1ZLK A;  1LNW A;  4UVA A;  2FBH A;  2PQ8 A;  3E5X A;  4OMZ A;  2BGC A;  2COM A;  5F64 A;  4S05 A;  4XLP F;  2E1C A;  3O3K A;  2CQK A;  2IA2 A;  3F8N A;  2FMY A;  3GYH X;  4A5N A;  1YLF A;  5ILV A;  2PG4 A;  5F6F A;  2VC1 A;  2M8E A;  5E17 F;  2PBI A;  2V1U A;  1T6S A;  1GHC A;  3FMS A;  3QAH A;  4BHP A;  4MTD A;  3RTR A;  2A3S A;  4OIP F;  1HST A;  3HHG A;  2FML A;  3EET A;  5EEG A;  1XGN A;  1RUO A;  4JK1 X;  5KVR A;  5LHI A;  4HYE A;  5H20 A;  4BYY A;  1TNT A;  5CYV A;  3SXY A;  4RS8 A;  1RUN A;  3ZQ7 A;  1XB4 A;  2VXZ A;  3R60 A;  5LRS A;  4KIB A;  2VN2 A;  3T5X A;  3WOD F;  5LGT A;  2FU4 A;  2V1D A;  1ONV A;  5CVV A;  2ZXJ A;  3P9K A;  4OIO F;  3T1B A;  1YG2 A;  3C18 A;  2FA5 A;  2GA2 A;  5AIP A;  2KIF A;  4DNC A;  3K0L A;  3RPQ A;  1Z91 A;  2GWR A;  1QZZ A;  3GO5 A;  3ULQ B;  3CDH A;  2NS0 A;  1IXR C;  2P6S A;  5FFZ A;  1O3R A;  3RYP A;  1K79 A;  5J6X A;  3K69 A;  5HOO A;  3WTS C;  1R1V A;  3MAJ A;  1BI3 A;  1ZGJ A;  4FHT A;  3KEQ A;  2VT2 A;  4ASN A;  4Y13 A;  4EJT A;  3TOB A;  3RKW A;  1KGS A;  3GZ6 A;  4M6Y A;  2HOE A;  3AAF A;  4ZZD A;  3TQN A;  3IRR A;  4WF2 A;  2BE5 F;  1QNT A;  2CWE A;  3V7S A;  2ZO4 A;  2RKH A;  5H6R A;  5DD8 A;  1B9M A;  4A12 A;  1J0R A;  1Z9C A;  2MH9 A;  3MWM A;  4HDV A;  1XGO A;  1IN4 A;  2H94 A;  4PZJ A;  2RC4 A;  5FLX K;  4LFU A;  1SAX A;  2FRH A;  1UHM A;  3I4P A;  5L3G A;  3HTS B;  1STZ A;  4HQM A;  1FSH A;  3WTY C;  2ZME B;  3RI4 A;  4HX4 A;  1SFE A;  3IWZ A;  4A0Z A;  3DP7 A;  4ETS A;  1IW7 F;  1Z05 A;  2Z5U A;  1BOA A;  5CLS A;  4L0Z B;  1HKS A;  1U5T B;  4I7H A;  1XGM A;  5FD5 A;  5JVT A;  2W24 A;  5JFR A;  1ZH5 A;  4O3M A;  3C7J A;  1K78 B;  2HKO A;  4UVC A;  5LLQ A;  1E17 A;  1QBJ A;  3REO A;  4WX9 A;  1W7P D;  4M6X A;  2IW5 A;  1MD0 A;  1YYV A;  3WTZ A;  1I1S A;  5F1R A;  4KNY A;  5K5Q A;  3GZ5 A;  1F5T A;  4RGR A;  2GA1 A;  4CZZ A;  4P9U A;  5CVR A;  2YR2 A;  4P5O A;  2CGP A;  3LFK A;  3HOT A;  3ABU A;  1P4X A;  3WGI A;  4HV5 A;  3L7W A;  1B1B A;  2FQ3 A;  2DQL A;  1YW9 A;  3M9A A;  1AWC A;  2A5Y B;  2VBZ A;  1XCB A;  4CGZ A;  3ZMS A;  4ENN A;  5D5W B;  4XSZ F;  3WTT C;  3KEO A;  1P6R A;  1RIO H;  4UV9 A;  4U0W A;  4KMU X;  2YSR A;  5AON A;  4EM0 B;  3SQN A;  4HDU A;  3FHZ A;  1J7K A;  1FLI A;  2QBY A;  2VOP A;  4IRH A;  3WU1 B;  2E7W A;  3LST A;  1O3S A;  1KU3 A;  3KCC A;  3HHH A;  4UV8 A;  5E1Z B;  4M9Z A;  3RIR A;  2KJB A;  3F8C A;  3KZZ A;  5D5X B;  1I6X A;  3TKY A;  3K1M A;  2F2E A;  3FX3 A;  1VTN C;  2M5W A;  3GFL A;  2HTS A;  2ESN A;  4YFK F;  1SD6 A;  2LF7 A;  5FFX A;  2VBY A;  3KFW X;  2Q8K A;  3CJN A;  4BAY A;  1G3S A;  1FP1 D;  4U7D A;  4IXA A;  4EV0 A;  4OMY A;  5L3D A;  1U3E M;  1EH8 A;  5ERI A;  1V4R A;  3DPT A;  3EDP A;  1AOY A;  4UHT A;  1XMA A;  1HW1 A;  1U78 A;  1IN8 A;  4ON0 A;  1DP7 P;  1KQ9 A;  2O03 A;  4M9X A;  5LGU A;  2HGC A;  3SZT A;  3RJP A;  2EB7 A;  1FWZ A;  2ZCW A;  4HQE A;  5E1W A;  3VOD A;  3LQR A;  5E20 A;  1S6L A;  2ESH A;  1YFH A;  1YTY A;  1GXQ A;  1ODD A;  2EA4 A;  2ZFW A;  1OKR A;  3MZH A;  1ZGA A;  2DU9 A;  2IP2 A;  2H6B A;  3V8J A;  1J2X A;  1SFU A;  4GYI A;  4ZYH A;  4HA8 A;  1YO5 C;  3U2R A;  2TDX A;  1RI7 A;  3F8F A;  2XRO A;  3N4M A;  2VE8 A;  4IHT A;  4Q4Z F;  1LDD A;  4DQ2 A;  3I64 A;  1KA8 A;  3GXO A;  2YPR A;  1FC3 A;  2VOO A;  2LF8 A;  1TTY A;  4IJA A;  4Q48 A;  3DF8 A;  4ENM A;  3DQV C;  2EFO A;  1B59 A;  2X0L A;  3HRS A;  2A6H F;  1SMT A;  2WV0 A;  2XAQ A;  3WTW C;  2XAF A;  4WCG A;  4A0Y A;  4ZH4 F;  3V4G A;  2G7H A;  1UCR A;  3W6J B;  4KN4 X;  5EEH A;  1T38 A;  4G9Y A;  1L3L A;  1BI2 A;  2O3F A;  1XN7 A;  1I1G A;  2IRF G;  4KN7 X;  2EFW A;  5LHH A;  2RGV A;  3F3X A;  3V7C A;  3C3W A;  5LHG A;  1PP7 U;  3BWG A;  3ISP A;  4KYW A;  2YU3 A;  3I5U A;  5E8I A;  2NNN A;  2D1V A;  1IXC A;  2QWW A;  4EVI A;  2G7U A;  4CDG A;  4PGH A;  4L18 B;  4BHC A;  1BN5 A;  2PN6 A;  2QYO A;  1MDM A;  4EJO A;  4IVN A;  1FYL A;  4NQW A;  5HS8 A;  4RGS A;  2CSO A;  2Z33 A;  1P2F A;  1Z6R A;  3CUO A;  3L2C A;  5LEJ A;  5K5R A;  1KYZ A;  3WGG A;  1P4A A;  3BOQ A;  1WWX A;  4LK0 F;  4L9T A;  2EV5 A;  2A61 A;  1IN7 A;  1CF7 B;  3TO7 A;  1WKM A;  4PGG A;  2FEZ A;  3K1N A;  5J8C A;  4MEY F;  3ZN0 A;  2CYY A;  4JQF A;  3MZY A;  5L3B A;  1U5T C;  4H0E A;  4RAZ A;  2XV4 S;  1HKT A;  3JTG A;  2WTE A;  5IT9 Z;  1YW8 A;  2F5D A;  2XKP A;  1D5V A;  1FNN A;  3QP6 A;  5FO5 A;  3FXR A;  1ZAO A;  4F7Z A;  3E6D A;  2JPC A;  5HDK A;  4I09 A;  4LB5 A;  5LEK A;  1R22 A;  3P9C A;  3OOP A;  2RDP A;  4IHS A;  4EJU A;  4PDK A;  3R61 A;  2QUF A;  3FZV A;  3I54 A;  3SHF A;  4P9F A;  2D1H A;  3BJO A;  1T2K A;  4CXF A;  5IT3 A;  5ED4 A;  2DK5 A;  5D6F A;  3KP4 A;  3V7R A;  5BPI A;  3HSR A;  1FT9 A;  4ZYE A;  4O6J A;  2O6G E;  2V1X A;  5BS6 A;  1K6O A;  2Q2E A;  1FBS A;  4AIK A;  1GXP A;  2DPD A;  1J9I A;  5AIQ A;  1FY7 A;  4YG2 F;  1F1Z A;  4CIC A;  1J59 A;  4IF4 A;  1DPR A;  4ENK A;  4R8H A;  1LJ9 A;  4LG0 A;  3TO9 A;  2C6Y A;  2QZ8 A;  5DCF A;  3COA C;  4FX4 A;  3D5L A;  3ZMU A;  4OU0 A;  2FNA A;  1BI1 A;  1TLH B;  1GVJ A;  1IXS B;  2QQ9 A;  2IT0 A;  1U8R A;  1D3Y A;  4R1H A;  2A07 F;  3GFI A;  5A2Q K;  2CO5 A;  1BIA A;  1UB9 A;  3I0T A;  3E97 A;  1HXD A;  4LG0 B;  1DDN A;  4EJW A;  3J81 Z;  2HWV A;  5L3F A;  1FBQ A;  1TW2 A;  2H27 A;  2Q0O A;  2FBK A;  4WXC A;  2PEX A;  1EV7 A;  3V8K A;  2GXB A;  4HV6 A;  2KRF A;  2V9V A;  4U0V A;  1W5T A;  3M1E A;  4L9J A;  2R3S A;  1OYY A;  3G73 A;  2LDU A;  4G7Z F;  1V3F A;  4OIN F;  3BP8 A;  4IPA A;  1PUE E;  1MJ9 A;  5J8F A;  2STW A;  1R1T A;  1IRF A;  4B09 A;  4RGX A;  2H6C A;  2DQR A;  2XHK A;  3FXU A;  2DPU A;  4HW0 A;  4RGU A;  3GFM A;  2ZME A;  3E6M A;  3QPT A;  4EM2 A;  3J7A O;  2IPQ X;  3FM5 A;  3Q9V A;  1ZLJ A;  3G3Z A;  3B73 A;  4ZYD A;  3MCZ A;  3S2W A;  4N9H A;  1U5T A;  4HF2 A;  3F6O A;  4BH9 A;  3KLO A;  5DV5 A;  4OIQ F;  2L4A A;  4L9V A;  1CGP A;  3LWF A;  1S7O A;  3BZ6 A;  1WSU A;  1K78 A;  1S8N A;  2VE9 A;  3WG9 A;  1H9G A;  2ISY A;  1Z6T A;  1KU7 A;  1IZ1 A;  1T0F A;  2AXL A;  2FE3 A;  3E5U A;  4XLN F;  2EFQ A;  3R6S A;  2GIV A;  2OAZ A;  4EGY A;  3T0Y A;  3KZY A;  2GQQ A;  5HLI A;  2R7F A;  4A6D A;  4ZYG A;  1G3T A;  3HOS A;  1D8J A;  5K5O A;  2YX4 A;  2P6T A;  5E1X A;  1TNS A;  1LB2 A;  2XIG A;  5BMZ A;  2UZK A;  1TQM A;  1WI9 A;  1BBY A;  4HF0 A;  4CO8 A;  3D0S A;  2YX7 A;  2EV0 A;  2P7C B;  1YQA A;  4LB6 B;  2K02 A;  5ICF A;  1ZRD A;  1ON1 A;  4EM1 A;  4A0X A;  4FT8 A;  1IAW A;  2Z9O A;  3FF5 A;  3Q9S A;  3F72 A;  4I02 A;  3CO6 C;  2ZJ2 A;  2W85 A;  3E5Q A; 
#chains in the Genus database with same CATH topology
 4MHG A;  2LP0 A;  3S16 J;  2XB0 X;  2XSD C;  1U6G A;  4D5F A;  4RAY A;  1EH6 A;  2EIM H;  2DA4 A;  1HOM A;  4KA4 A;  2QKM B;  4ZZL A;  1WGX A;  4YFN F;  4E6K G;  2EIL H;  4XMY A;  2HXI A;  4RLF A;  4K2E A;  1RNL A;  4OOI A;  2DFF A;  2IAI A;  3L2V A;  5EZG A;  1KON A;  2E34 A;  1XDU A;  1C0W A;  3DEU A;  1Z1D A;  4FQG A;  4XL9 A;  3OYN A;  3SDG A;  3MFK A;  2EQR A;  4M6V A;  4E7H A;  2KLO A;  4ZDL A;  1QPM A;  3FXQ A;  3UNG C;  5FB2 A;  3M7G A;  3N97 A;  1L0O C;  3CCY A;  1TQI A;  5HS7 A;  2NNY A;  4BEH A;  3P9I A;  3HJE A;  1HQC A;  3X2Q H;  5EF6 A;  4DIQ A;  3SZP A;  4E4H A;  1VQ6 I;  5CJ9 A;  2OZ6 A;  4XID A;  1AKH B;  2HR3 A;  1O3Q A;  1WJA A;  4PJN A;  2BYV E;  2XRL A;  2B0L A;  1A6I A;  5DS9 A;  3W2A A;  1ZKG A;  3KYD B;  2A5W A;  4PCQ A;  1R23 A;  3BTL A;  2DAO A;  2W57 A;  1K4T A;  2ZKZ A;  1T98 A;  4LLN A;  3T8T A;  2BOL A;  2KL4 A;  2HKX A;  3BJ6 A;  5DTD A;  1BIB A;  3EUH A;  2P7V B;  2VPL A;  3OR1 C;  2PMH A;  2Y2Z A;  1IRG A;  3HTU A;  2FOK A;  3E3V A;  5F27 A;  3W6V A;  4M3B A;  3VOE A;  2O61 A;  1FSE A;  1OQY A;  2L9S A;  2MFZ A;  4QWQ A;  1LE8 A;  1T39 A;  2DT5 A;  4U7B A;  3BC8 A;  2VAS A;  1AA7 A;  2DMU A;  4RM3 A;  1TWA J;  3BQZ A;  3I71 A;  5ICC A;  2HS5 A;  1X3Z B;  2CW8 A;  4RA2 A;  3BPV A;  2PMU A;  2R7D A;  3HDD A;  4LMY A;  4BKX A;  1J5Y A;  1T56 A;  3BPX A;  2XAS A;  4OIR F;  1JHF A;  1G8X A;  3ZR8 X;  2JSP A;  1U2W A;  2BEO A;  2F5C A;  2K86 A;  4AC0 A;  2BW3 A;  2HVQ A;  2MD5 A;  3R0J A;  4B3X A;  1W36 C;  1S5L C;  3PNV A;  2R93 J;  2K9Q A;  1FX7 A;  4JX6 A;  4M73 A;  4XKV A;  3M8F A;  3GUD A;  1LDK B;  2M7B A;  5JR3 A;  3CJR B;  4MFE A;  4XRS G;  4DYQ A;  4IZZ A;  2JA7 J;  1SFX A;  2DOF A;  1B8I A;  2LSO A;  2KJC A;  3IL2 A;  2GOX B;  1LFP A;  5ICE A;  4HLX A;  2JSC A;  1HBX G;  3JRD A;  2XDV A;  2CFO A;  1ZAR A;  2ZC2 A;  1HSJ A;  4AIJ A;  2XAH A;  2VON A;  3HSE A;  1MBK A;  3PQK A;  2EZH A;  2O8X A;  5HS9 A;  3KYL A;  4P55 A;  1JUP A;  3BG3 A;  3ONQ A;  2OD5 A;  4KFC A;  2NS8 A;  1E2X A;  3IRQ A;  2CQ7 A;  4E7J A;  1NG6 A;  1OYW A;  1SD7 A;  2RAE A;  4MIM A;  4II2 A;  2ID3 A;  2MG4 A;  4G7O F;  3CO7 C;  2M1B A;  3JTH A;  1R36 A;  5B1B H;  3OYC A;  2RV8 A;  4EGZ A;  4A3G J;  5EGO B;  2HOA A;  4Y33 A;  4DJA A;  3E0J B;  4M3G A;  2KIU A;  3D5R C;  4O5V A;  4CZC A;  1DU6 A;  3KEY A;  4LGW A;  3GTK J;  2R7Z J;  2BHY A;  3LSJ A;  1VQM I;  4KIF A;  3LA3 A;  3S1R J;  5FJ8 J;  1VF9 A;  3OYJ A;  4F92 B;  4BJT A;  4IQ4 A;  2CQN A;  5TRD A;  3ZPL A;  4C2U A;  2AQE A;  3QPH A;  4M3F A;  4LOC A;  2QLZ A;  4KIC A;  3ELK A;  1JXS A;  2EIK H;  3SEZ A;  3KP3 A;  1E3O C;  5DD4 A;  6PAX A;  3FKJ A;  1X2M A;  2HQ5 A;  3WHC A;  2DA2 A;  1XCV A;  3W6K B;  2EZK A;  3H0D A;  2X85 A;  3O2P E;  2WC2 A;  2WAD A;  4RLQ A;  3DU6 A;  4CCK A;  1I5Z A;  3P5J A;  4PUS A;  2R5Z A;  3ZP5 A;  2ECB A;  1MMD A;  4Q47 A;  2HFH A;  4WK8 F;  1UG0 A;  3F9K A;  3DV8 A;  3OIP A;  4AD9 A;  4XLF A;  2DO7 A;  1J75 A;  4L5E A;  2LG4 A;  3G1M A;  3J81 K;  4PSW A;  5FGM A;  3G4S I;  4A6E A;  1MMA A;  4GCV A;  2H8W A;  1UHW A;  1P92 A;  2ZXI A;  1BC7 C;  2STT A;  2MD0 A;  2QVO A;  1V55 H;  2Y69 H;  3E1S A;  3H9G A;  4UNO A;  3OOU A;  1S7A A;  3BG5 A;  3LAP A;  1JE8 A;  4G6D A;  2LKP A;  2BBY A;  2DBB A;  1Z7L A;  3H3V K;  3DPU A;  2F4M B;  1X1B A;  2ZJP F;  1BC8 C;  3OS1 A;  3ECH A;  3RQI A;  1SVM A;  4HST A;  2E1M B;  2FSW A;  3NEU A;  5K7H A;  1QVU A;  2HDW A;  3OSF A;  2RQP A;  2HNH A;  1ITY A;  3J7A Y;  3GW2 A;  3R4K A;  3ZMZ A;  1ON2 A;  4KMF A;  2ZFU A;  1E0E A;  1TWC J;  2RN7 A;  2IGK A;  3QU6 A;  3ABK H;  2V6C A;  1IG7 A;  4KT6 A;  5GP9 A;  2K9L A;  3CUQ B;  2X1C A;  4N4N B;  2D2W A;  3ML6 A;  4CA0 A;  1UZC A;  5LGN A;  3HPH A;  1XSD A;  2XRN A;  2EPF A;  2UWM A;  2ISZ A;  5GTI C;  1SD4 A;  2KZG A;  1CF7 A;  4BE0 A;  5FRO A;  1B6A A;  4L9N A;  3OYD A;  4D1Q A;  2I8D A;  1MMG A;  1G3W A;  4XSX F;  4GYG A;  2RNJ A;  2MC4 A;  1R00 A;  3TBI A;  2X4H A;  3Q0V A;  2O9L A;  4W1U A;  4PJM A;  2HQN A;  1OMI A;  3BRO A;  1BM9 A;  3MMY B;  5ILS A;  2K7L A;  1UHS A;  1ZRE A;  2RQQ A;  4LLG F;  1K7A A;  1KQ0 A;  2XUB A;  2MH2 A;  4I0A A;  1KYW A;  2EK5 A;  2VB6 A;  2H09 A;  3F6V A;  3L9F A;  4GRI A;  4G94 A;  1I27 A;  4U87 A;  2W25 A;  4XLC A;  3ESW B;  2IEK A;  3FXL A;  5FKL A;  3K9T A;  2V1N A;  4GXO A;  1H9T A;  3GTL J;  3AG1 H;  2Y9Z A;  2ACJ A;  2K85 A;  1EKE A;  4MTE A;  2VKD A;  3TDZ C;  3VEP A;  2DTZ A;  4C3J J;  1MGT A;  3CTA A;  1OPC A;  1JTY A;  1WHU A;  2YUS A;  3MKW B;  2F5V A;  4LD5 A;  3KE2 A;  5CKT A;  1QU3 A;  1X19 A;  2QSH X;  1JTX A;  4WXD A;  2EIJ H;  4MGR A;  2YU9 J;  1LEA A;  1FTT A;  2FOW A;  1GUU A;  2VJ4 A;  3IHU A;  1R58 A;  3H9Q A;  1KU9 A;  1OCR H;  2Y31 A;  4YEL A;  3HOU J;  3IKV A;  1PP8 F;  3DWL E;  2P5K A;  5CPR B;  2O0Y A;  3OYL A;  4TV7 A;  5BQT A;  2E36 A;  2CMP A;  3ZGK A;  1YIO A;  2UXN A;  5F0C A;  1EJ9 A;  2W1O A;  4KDP A;  3K4M A;  2HOS A;  1QA6 A;  2F5E A;  2ZXW H;  5F08 A;  2BY0 A;  1T0F C;  3BG6 A;  3VYS B;  1G4D A;  2BV6 A;  2DFI A;  1XGS A;  4GO1 A;  1R5G A;  2VKH A;  2HTJ A;  4L5J A;  5IYC J;  4ENJ A;  1IN5 A;  5FLM J;  3CCQ I;  3CCS I;  2OJE D;  3DBL B;  2K4B A;  3WU0 A;  2R7V A;  1R7J A;  2NYX A;  2LBF B;  3O6B B;  4PJJ A;  1FBU A;  4I01 A;  2ME0 A;  3J7Y J;  1Z3X A;  1QPI A;  1HW2 A;  1D0Y A;  2OQR A;  3JRC A;  3WGH A;  1Z77 A;  3OL3 A;  3CD6 I;  3L09 A;  3J80 Z;  4F55 A;  2VQH A;  3FIW A;  3QQA A;  2WBM A;  1LQ1 A;  3I59 A;  4A3D J;  4R79 A;  4PK4 A;  2VBW A;  2L9V A;  3GTQ J;  4UUS B;  1WCM J;  3ROU A;  1O4X A;  4BQN A;  4L5I A;  1IUY A;  1JT0 A;  2ZSI B;  2XKO A;  4MFD A;  1HKQ A;  2QEX I;  3PNY A;  3CCJ I;  2JN6 A;  1N75 A;  4I98 B;  3ABL H;  1BJA A;  2P5V A;  3MQ0 A;  3SFZ A;  2KIM A;  3HYI A;  3I59 B;  3QU3 A;  5J1U A;  2OPT A;  1IN6 A;  1WRJ A;  2XGE A;  1W36 D;  1ZYR F;  3CLO A;  1BW5 A;  4XRF A;  1ZG1 A;  5DDG A;  2X6X A;  3HKZ N;  2VT3 A;  3KP7 A;  2V79 A;  1W4M A;  2Y0S A;  3B02 A;  4G12 A;  3NRV A;  1XMK A;  2MYS A;  2IS6 A;  1J09 A;  1RZ4 A;  1ULY A;  2L2O A;  3T8R A;  4Z6Y A;  1T8I A;  2LVS A;  1SMY F;  1SFK A;  2WB1 A;  2HI3 A;  2NXN B;  1SFO J;  3HUG A;  3EYI A;  1TBX A;  1DPU A;  1QRY A;  4JX4 A;  2PFB A;  4DYC A;  2EJR A;  1USS A;  2F6C A;  2HQA A;  3LSP A;  2CRG A;  3C2G A;  2R0Q C;  3DLA A;  4X1E A;  1GDT A;  3EUK L;  3HRM A;  1FPQ A;  1O7F A;  2Y48 A;  5DYM A;  1TP4 A;  5TJJ A;  4CSW A;  3GX4 X;  1X3U A;  3HRU A;  4EQQ A;  4IHW A;  3I4M J;  3GFJ A;  3LAJ A;  2CU7 A;  1B9N A;  2MW8 A;  2L7Z A;  3I58 A;  3F23 A;  1YRN A;  3ZQQ A;  2J5O A;  1NG7 A;  3J7Z I;  1OCZ H;  1A04 A;  3U1D A;  2M2E A;  3SJM A;  2MLG A;  1VQL I;  4KIG A;  5H2F C;  4BE2 A;  1LDJ A;  3DKW A;  3TO6 A;  3DXJ F;  2QQ8 A;  2WWY A;  2MAB A;  1A5J A;  4BHB A;  4OWR B;  4UB8 C;  2L01 A;  3RPU A;  2DK8 A;  1MJA A;  3U1K A;  2NOJ B;  2OBP A;  5EEA A;  2H1L A;  5F1J A;  3QWL A;  5BPD A;  2NRA C;  1F43 A;  3KET A;  2IA0 A;  2Z2S B;  3K10 A;  4KUM A;  3JSP A;  1R5H A;  2L02 A;  3AG3 H;  1YRN B;  3VYU B;  1QGP A;  4E7I A;  4A3B J;  2CQX A;  1B4A A;  2EFN A;  1U0J A;  3EUH C;  3DBR B;  3K4J A;  5KK1 A;  2K4J A;  5BOX A;  3H0G J;  2RVC A;  2CW0 F;  5HDG A;  3VSK A;  1DGR M;  2KQR A;  4M74 A;  2XF6 A;  4P1W A;  2L7K A;  5FD6 A;  1S29 A;  1W7P A;  1JJ8 C;  4I2O A;  5DUK A;  4ZDO A;  5KAI C;  1DGW Y;  2IS4 A;  4HPQ A;  3BTI A;  3JAM Z;  1I39 A;  4ESB A;  3E6B A;  3A4C A;  1OR7 A;  3TGN A;  1JGS A;  1FZP B;  1I3A A;  1W5S A;  2CUJ A;  2P8T A;  1D8K A;  1EA3 A;  2GOM A;  3BJA A;  4N4O B;  3DLL F;  3ZQF A;  3E6C C;  2QQA A;  1FP2 A;  1PVE A;  3NAU A;  5CQG A;  2F48 A;  5KHD A;  4Y4R A;  1W7P B;  4X0G A;  3FK6 A;  2JVG A;  2Y75 A;  2W48 A;  2XVC A;  2X1E A;  1IC8 A;  2R7X A;  3BR5 A;  1UST A;  1X4O A;  3KP2 A;  3HC7 A;  2X1D A;  1WH7 A;  2K27 A;  2Z3Y A;  3JSO A;  3F21 A;  4HOB A;  1VQ8 I;  5DUI A;  4ABZ A;  2EV6 A;  3L2R A;  4CYD A;  1LVA A;  1Y39 A;  1VQ9 I;  1QHG A;  3IKT A;  4WWC A;  1ZHF A;  3I53 A;  2DDA A;  2JA2 A;  2LKS A;  1DQU A;  3M8E A;  4NUB A;  1ZRC A;  3A02 A;  4LJZ F;  4LLL A;  5L3C A;  4DOZ A;  5ILU A;  4LIT A;  1ZTR A;  1F9N A;  2VXD A;  3CCU I;  2JK3 A;  3VFZ A;  3TL4 X;  2IA1 A;  1S3J A;  3H3Z A;  2V4J C;  1V54 H;  5D4R A;  3LQQ A;  1WI3 A;  3OV8 A;  5CVI A;  1HDD C;  3RKY A;  1YI2 I;  3PUB A;  3JW4 A;  4HX7 A;  4A3L J;  1TQP A;  2E7X A;  3U9G A;  3NQO A;  3HB9 A;  4I0B A;  2R92 J;  2LNB A;  3I4N J;  3ZCO A;  5C4X J;  4M71 A;  2HVR A;  3A0B C;  4JOM A;  5CQE A;  2M30 A;  2DFE A;  3Q0W A;  4Z2Y A;  1N78 A;  1MBH A;  3DTI A;  4KIT B;  2OTJ I;  1ZR2 A;  1O7L A;  2NVY J;  5D6E A;  2QF7 A;  5KCM A;  4XBF A;  1G6N A;  1X3W B;  2Y0M A;  4RB3 C;  1AU7 A;  1UFM A;  2F5F A;  1H0M A;  3TOA A;  4UUV A;  3JRH A;  4XKW A;  1E3H A;  2O7O A;  3CC4 I;  4CCJ A;  3BZK A;  2PX9 A;  1V5F A;  5E3L A;  3OS0 A;  4XOT A;  3FWE A;  1LPQ A;  4QTR A;  4KIS A;  2JUC A;  2GBY A;  3FM3 A;  5BNG A;  4CYC A;  2ELH A;  3CF5 F;  1H89 C;  4MQV A;  2R7U A;  2HYF A;  3GEZ A;  4YII A;  2FNP A;  4AIH A;  3GLX A;  5HNH A;  1K61 A;  4BY1 J;  2WAQ A;  1LKX A;  4KT5 C;  3IC7 A;  3HSF A;  4A5M A;  2E1M C;  2D45 A;  3A0H C;  3JCU C;  4BDY A;  1T33 A;  2QM3 A;  5B1A H;  1QQI A;  3F22 A;  2PLY A;  1QO0 D;  2JMW A;  2KDO A;  5DEQ A;  4MQ9 F;  4W97 A;  3CP2 A;  3MEX A;  5JLX A;  3H92 A;  1WQ2 A;  3BDD A;  3BCA A;  4AU7 A;  2OQG A;  1LEB A;  3CUQ C;  4CYC B;  1AKH A;  4E7L A;  5HVQ C;  4RB0 A;  4L0Y B;  3MZ8 A;  4P96 A;  4GFB A;  5H6Q A;  1D1B A;  4NB5 A;  5CVJ A;  3H5R A;  4OAY A;  5A2Q Z;  4U88 A;  2GLO A;  2GXG A;  2KIS A;  4NBQ A;  1Z7U A;  4GDF A;  3PQJ A;  4NHJ A;  3DPL C;  1R1U A;  3M4O J;  1RES A;  5J4Y A;  4FX0 A;  3SEQ A;  1PUF B;  4C9Y A;  2VBX A;  3SDB A;  2CQQ A;  4BS9 A;  4A3F J;  3A03 A;  3GTP J;  3G2B A;  4G8X A;  2IVM A;  3HM5 A;  2IJL A;  1XDS A;  4LIV A;  5LBQ A;  3HL2 A;  4YIF A;  2A68 F;  1X1C A;  3BR1 A;  3V8L A;  2ZBK A;  4G6T B;  4MEX F;  2ETH A;  3BTJ A;  4M9S A;  2E5Z A;  3ZQG A;  1H8A C;  1IRX A;  2DLL A;  2DI3 A;  2KZV A;  4MNU A;  2GZW A;  4E70 A;  4D0P A;  3RZO J;  1VFC A;  4XRS A;  1ZRF A;  2MBF A;  3M8J A;  1LFU P;  1V5G A;  2XGX A;  2KKO A;  3F8M A;  4G7H F;  2QBY B;  4AVZ A;  4AWX B;  1GVD A;  2LKX A;  4BXF A;  2A69 F;  2NAZ A;  2DJN A;  4J19 A;  2EFP A;  3TDU C;  4B1R A;  4E7K A;  2VQG A;  4BQA A;  3PL8 A;  4HSR A;  4CCN A;  4A2U A;  5L3E A;  2FX0 A;  3OYH A;  2CG4 A;  3ERM A;  5HOD A;  3VWB A;  1P7J A;  1QZY A;  2DOE A;  2RNG A;  2JZY A;  4C3H J;  1KQ8 A;  4XIC A;  1PJR A;  1GLN A;  1JKP C;  1EH7 A;  1DP3 A;  5IT9 K;  1WJD A;  2J5P A;  3FMR A;  1IF1 A;  3GTJ J;  4BXU A;  2P5L C;  1G3Y A;  5FLX Z;  2VKV A;  1OLT A;  3K4C A;  1F4K A;  2VUM J;  4BJ5 C;  2JUG A;  4E7S A;  5E18 F;  3CF2 A;  4D7N A;  5GPC A;  5GAG J;  3LA7 A;  4IHV A;  2W84 A;  1QHH D;  4DGW B;  1POG A;  3QP5 A;  3MKZ A;  2HYG D;  1WJC A;  3BR3 A;  1HA8 A;  2AS5 F;  4YRV A;  4EMS A;  1MNE A;  3GZN B;  3Q0U A;  5EGO A;  4BBS J;  1X1D A;  3Q5F A;  4HZF A;  4GGG A;  1OYI A;  4RB1 A;  2ZNZ A;  5DM6 F;  3BR2 A;  1I6H J;  3K4N A;  4Y15 A;  1KU2 A;  2ZNY A;  3RYR A;  1DUX C;  5JI6 A;  3CZ6 A;  2DA3 A;  3LFU A;  4N0B A;  4B43 A;  4YEJ A;  1NHA A;  1YIT I;  2CFX A;  2M9H A;  4XON A;  3QOP A;  2L9N A;  3JRF A;  3HIF A;  2XAG A;  2DMT A;  3I55 I;  2MA3 A;  2HZT A;  5KNL A;  4B47 A;  9ANT A;  5B3S H;  1QVT A;  1XSV A;  1YS6 A;  1YW7 A;  3J80 K;  1X4P A;  3BY6 A;  3M07 A;  3CMM A;  1MNM C;  5D5U B;  1WJ5 A;  5HLG A;  3KP6 A;  3P7N A;  1MZB A;  3KYC B;  4YFX F;  3BT9 A;  4S04 A;  2Z99 A;  2VJI A;  4JBA A;  1ZG3 A;  4JX5 A;  3AL0 B;  1EF4 A;  1BW6 A;  5ICG A;  1SEU A;  2HOT A;  2PJP A;  1BA5 A;  3HZJ A;  1NTC A;  3GTG J;  3ZRG A;  3W3C A;  1O3T A;  3GCM A;  1TW3 A;  3LA2 A;  4IRI A;  4Y17 A;  4LIU A;  5D8L B;  2V9P A;  3FMQ A;  3WE2 A;  3TW7 A;  4MLO A;  3ZMD A;  3RDI A;  5F0F A;  2BVL A;  2EWN A;  4BBR J;  4IO9 F;  2DW4 A;  2M45 A;  2W4S A;  5CVU A;  4CUG A;  1MW7 A;  4F52 A;  3NWS A;  1MJB A;  1BI0 A;  2MC3 A;  3GBG A;  1ZGW A;  3BR6 A;  2EIN H;  1M1E B;  3PO3 J;  2ELJ A;  3F8B A;  2FXA A;  4CHU A;  2L3D A;  1WJF A;  2L9R A;  2XF7 A;  4RB2 C;  4Y52 J;  3GWZ A;  5J1Y A;  3CCR I;  1AHD P;  3DFG A;  4HX8 A;  5D8K B;  2R7O A;  5JHU A;  3L1P A;  3HRT A;  1FYM A;  1P4W A;  3WTX C;  2GAU A;  3WTV C;  1MSF C;  3BG7 A;  4WXH A;  2OCC H;  4AYB N;  1ORK A;  3K1P A;  1SD5 A;  3ZN1 A;  5HDN A;  3JRE A;  1SAN A;  4HAM A;  1LFB A;  3S15 J;  2ADU A;  2JPB A;  1U9O A;  4BNC A;  3CUQ A;  3VB2 A;  3L00 A;  4ESF A;  2ZJQ F;  5DCM A;  3S1N J;  4IRG A;  2QQB A;  2MLK A;  4ESJ A;  2H1K A;  3ZMT A;  4LK1 F;  2GXA A;  2JT1 A;  4RBO A;  1IV8 A;  1YS7 A;  4A3E J;  3NAR A;  3GVA A;  3GF2 A;  2VOD A;  1Q1H A;  4B48 A;  4EJV A;  1Z67 A;  2KFD A;  4D9J A;  2OU2 A;  3RKX A;  2HEO A;  1REP C;  4ZYA A;  5D5V B;  2E1N A;  5LRR A;  2A6E F;  5EDN A;  1MH4 A;  3ABT A;  3ECO A;  1HW5 A;  2L54 A;  4UB6 C;  5DCM B;  1BOB A;  3ERE D;  3KLN A;  2FBI A;  1VND A;  5D4S A;  3HGY A;  2JRM A;  3QOD A;  2XAJ A;  4B8X A;  4M72 A;  4Q5S F;  3CDI A;  4AVP A;  2P4W A;  3H3U A;  4N9I A;  2OZU A;  4U0Y A;  4HBL A;  4Y3O A;  4PFO A;  1O57 A;  1DU0 A;  1JHH A;  1TZL A;  1XSX A;  1ZN2 A;  2DTR A;  2OA4 A;  3G1L A;  4HLY A;  2DMQ A;  2M87 A;  2W7N A;  1RKT A;  4B3A A;  2R5Y A;  3RCO A;  2L4M A;  1HF0 A;  1JT6 A;  3HOW J;  4XN3 A;  5K1Y A;  3EYY A;  1ETY A;  3K2Z A;  3JAM K;  1MDM B;  1Y1W J;  2WV1 A;  2HDC A;  4HF1 A;  4QLC U;  2EA2 A;  5HLH A;  2FF4 A;  2JRT A;  3WTU C;  2EH3 A;  2WY8 Q;  1MKM A;  4B44 A;  4UXN A;  3FK7 A;  1FYK A;  1A31 A;  4V19 K;  4NQW B;  2DA7 A;  5C44 J;  2NVX J;  3S32 A;  1CQT A;  1OR7 C;  4NDL A;  4UVB A;  2XPW A;  1PDN C;  2DYR H;  3EQL F;  5E8G A;  3ZOB A;  3BCB A;  2E5N A;  2R5Y B;  4JYK A;  1ZG5 A;  1BJZ A;  2QEN A;  4V2F A;  3IWF A;  4CCM A;  3ASO H;  1XD7 A;  4A3J J;  4ANJ A;  3LMM A;  3PM1 A;  2KPM A;  3KP5 A;  3ZMV A;  2JWT A;  2LBF A;  3FBN B;  2VC0 A;  1X58 A;  1Y56 A;  4QPQ A;  3WE3 A;  2HQR A;  5DM7 F;  2HVS A;  2E35 A;  1YE9 A;  1Y0U A;  1NK3 P;  1FOK A;  3C1D A;  2VI6 A;  2JTV A;  4G6Q A;  5M5X J;  3S17 J;  2PI0 A;  3V42 A;  3QRF F;  2G9W A;  3B6A A;  3R0A A;  2UXX A;  5J40 A;  3PFI A;  1ZLK A;  1R4N B;  1LNW A;  4UVA A;  2FBH A;  2PQ8 A;  3E5X A;  1MND A;  4OMZ A;  1JI8 A;  1E3P A;  4UUS A;  2BGC A;  2COM A;  3VYT B;  2X6Y A;  5F64 A;  3KX2 A;  4S05 A;  4XLP F;  3OYM A;  2E1C A;  2A05 A;  4D7M A;  1YHQ I;  3O3K A;  2K9N A;  2CQK A;  2IA2 A;  4XLH A;  3SZG A;  3F8N A;  4KJZ A;  1UJ8 A;  5FKM A;  2FMY A;  5KAF C;  2DN0 A;  2DFH A;  3S1M J;  2JVH A;  4J00 A;  3GYH X;  4II3 A;  4A5N A;  2NS7 A;  1R9T J;  1YLF A;  4J01 A;  2DT7 B;  5ILV A;  2PG4 A;  2OV7 A;  3K6G A;  5F6F A;  2VC1 A;  2M8E A;  5E17 F;  2PBI A;  2V1U A;  5IY5 H;  4I76 A;  3S8P A;  1P7I A;  1T6S A;  2BXY A;  1GHC A;  3FMS A;  3QAH A;  4BHP A;  4MTD A;  1KZH A;  3RTR A;  5GPA A;  2ID6 A;  2XGC A;  1ZEL A;  2A3S A;  3FHN A;  2TRT A;  3KZI C;  4OIP F;  1IDY A;  3QOE A;  1HLV A;  1HST A;  3CCE I;  1W1W E;  3HHG A;  3Q3S A;  2FML A;  3ASN H;  3K70 C;  3EET A;  2HPI A;  1RPW A;  2ZB9 A;  1OCO H;  3HPG A;  3HXL A;  5EEG A;  1K83 J;  1XGN A;  1RUO A;  4JK1 X;  5KVR A;  5LHI A;  1S9H A;  4HYE A;  3JRG A;  1Y0N A;  5H20 A;  2K5C A;  4BYY A;  1TNT A;  2Y30 A;  1BR2 A;  5CYV A;  3SXY A;  1XS9 A;  3HKZ A;  4RMN A;  4RS8 A;  1TWG J;  1RUN A;  4ZC3 A;  1XG1 A;  3ZQ7 A;  2JJ7 A;  2E19 A;  2HZD A;  3PO2 J;  3OR2 C;  1XB4 A;  3S1Q J;  1ETO A;  4LG3 A;  2VXZ A;  3R60 A;  3RKQ A;  2JQ7 A;  3CJT B;  5LRS A;  4KIB A;  2VN2 A;  3T5X A;  3WOD F;  5LGT A;  2CUF A;  2FU4 A;  2V1D A;  1ONV A;  5CVV A;  1D1A A;  2ZXJ A;  3PJR A;  3P9K A;  4OIO F;  3T1B A;  1YG2 A;  3LSG A;  3C18 A;  3JR9 A;  4IOC F;  2FA5 A;  3WU2 C;  1MBE A;  2GA2 A;  5AIP A;  2KIF A;  4DNC A;  3K0L A;  1MMS A;  3RPQ A;  1Z91 A;  2GWR A;  1QZZ A;  2I10 A;  3GO5 A;  3W2V A;  1FEX A;  3ULQ B;  3CDH A;  2X51 A;  5JHF A;  2NS0 A;  3JRI A;  3RQ4 A;  5K7Z A;  1IXR C;  1X2N A;  2P6S A;  5FFZ A;  1O3R A;  3IH3 A;  1Z0X A;  3RYP A;  1K79 A;  3O8H A;  5J6X A;  1VQN I;  3K69 A;  3FXJ A;  4RM2 A;  5HOO A;  3BR0 A;  3WTS C;  2LOO A;  1R1V A;  2DYS H;  2VQC A;  3MAJ A;  1BI3 A;  1ZGJ A;  4FHT A;  3KEQ A;  1GT0 C;  2VT2 A;  1OIS A;  2X9D A;  4ASN A;  2LR8 A;  4Y13 A;  3TOB A;  1FOY A;  4EJT A;  4PJL A;  3RKW A;  1KGS A;  3OSG A;  1NH3 A;  3GZ6 A;  1T08 B;  3CJQ B;  2DA6 A;  2COB A;  4M6Y A;  4HNT A;  3ZQH A;  2DCE A;  2HOE A;  3AAF A;  4ZZD A;  2IGO A;  3TQN A;  4WF2 A;  3IRR A;  2BE5 F;  2LRD A;  1QNT A;  5HLT A;  2M7A A;  1RR8 C;  4BXX J;  2CWE A;  3V7S A;  2R7R A;  1GV2 A;  2ZO4 A;  2RKH A;  3FKI J;  5H6R A;  5IOY A;  1SVL A;  1WJE A;  5GAH J;  4CH7 A;  5DD8 A;  1B9M A;  2MSY A;  2V7F A;  1OJL A;  4A12 A;  1J0R A;  3BLY A;  5J3L A;  1Z9C A;  2MH9 A;  3MWM A;  4DBQ A;  2NOG A;  5HNF A;  4HDV A;  1XGO A;  1MSE C;  1IN4 A;  2IBD A;  2FD5 A;  2H94 A;  4EAT A;  4PZJ A;  3ZQL A;  2F4O B;  2RC4 A;  5FLX K;  4LFU A;  1SAX A;  2G0E A;  2FRH A;  3G71 I;  3MKL A;  4FIS A;  1SAU A;  1UHM A;  2DOA A;  3UR3 C;  3OYF A;  2LRE A;  1W0T A;  2Z16 A;  3VYR B;  2CUZ A;  3I9V 2;  4XM3 A;  1IGN A;  3I4P A;  2M0M A;  5L3G A;  2NVT J;  1R49 A;  4RDU A;  3HTS B;  4D5C A;  3H36 A;  2I5U A;  1UG2 A;  3QYE A;  3LSR A;  1STZ A;  4HQM A;  1FSH A;  3PFY A;  3WTY C;  2ZME B;  3IUO A;  2PMZ N;  3RI4 A;  1TT5 B;  4HX4 A;  1MH3 A;  1SFE A;  3S2H J;  3IWZ A;  1B72 A;  4A0Z A;  3DP7 A;  4ETS A;  4I6Z A;  5B66 C;  1IW7 F;  5IP6 A;  1Z05 A;  2DOD A;  2Z5U A;  1JKR C;  1BOA A;  5CLS A;  4L0Z B;  3RPU D;  3TP0 A;  5IYD J;  4XKB A;  1HKS A;  1U5T B;  3AL0 C;  2KDZ A;  1XMX A;  3DU5 A;  4I7H A;  3CMY A;  1XGM A;  5FD5 A;  4RAF A;  2MGQ A;  2BHZ A;  4BGD A;  5JVT A;  2W24 A;  5JFR A;  4H4K C;  1ZH5 A;  2IGM A;  4O3M A;  2QSG X;  1S7E A;  3C7J A;  5IYB J;  1GV5 A;  4XOR A;  4C2T A;  1K78 B;  3EPZ A;  3KIO A;  2AO9 A;  2HKO A;  1B72 B;  1VQ7 I;  3GME A;  2OF7 A;  1VQ5 I;  4UVC A;  1WJB A;  5LLQ A;  1Z3Y A;  1E17 A;  1QBJ A;  3REO A;  4WX9 A;  1W7P D;  3KPH A;  3LSK A;  4M6X A;  2IW5 A;  1MD0 A;  1YYV A;  3L2U A;  3WTZ A;  4PSX A;  3PUF A;  2HU9 A;  5FRM A;  3C2B A;  5E3O A;  2WA0 A;  2RRE A;  1I1S A;  2LK2 A;  5F1R A;  3VDX A;  4DYR A;  4KNY A;  5K5Q A;  3GZ5 A;  1F5T A;  4RGR A;  2GA1 A;  2PJR B;  4XLA A;  4CZZ A;  4P9U A;  4IQJ A;  2HDD A;  3LOC A;  4ZTJ A;  5CVR A;  3MN2 A;  2H8R A;  2YR2 A;  4P5O A;  2CGP A;  2CV1 A;  3PNT A;  2WAF A;  2W82 A;  3LFK A;  3HOT A;  1H88 C;  5EYR A;  3ABU A;  3QYF A;  2OTL I;  1YOV B;  5M3M J;  4QPO A;  1P4X A;  2VL8 A;  3WGI A;  4HV5 A;  2M3A A;  3L7W A;  1B1B A;  2FQ3 A;  3RSN A;  2DQL A;  1YW9 A;  2F4I A;  3M9A A;  2VJ5 A;  1AWC A;  2A5Y B;  2DXI A;  1PUF A;  2OCE A;  2E60 A;  2VBZ A;  1R5I D;  1XCB A;  4HNU A;  4YIR X;  4CGZ A;  3ZMS A;  4AID A;  3K4B A;  4ENN A;  2R7S A;  5D5W B;  2X6W A;  4XSZ F;  1ENH A;  3WTT C;  3UKG A;  3KEO A;  1P6R A;  1RIO H;  4UV9 A;  2B63 J;  1Y8Q B;  2EZI A;  1A36 A;  5B5E C;  4U0W A;  4ZJZ A;  4KMU X;  1F36 A;  4FE7 A;  1R71 A;  1FJL A;  3H5N A;  2YSR A;  3MD2 A;  5AON A;  4EM0 B;  3OMY A;  3SQN A;  2DDB A;  2W00 A;  2P0W A;  3FDY A;  4HDU A;  3FHZ A;  3OWT A;  1J7K A;  1FMW A;  1FLI A;  2DT6 A;  4OAZ A;  2QBY A;  2VOP A;  4IRH A;  3WU1 B;  2E7W A;  3LST A;  1O3S A;  1KU3 A;  1XX5 A;  3ABM H;  2K9S A;  3KCC A;  3HHH A;  4UV8 A;  5E1Z B;  2LD5 A;  4M9Z A;  3RIR A;  4A3C J;  5F04 A;  4AUX A;  2KJB A;  3F8C A;  3KZZ A;  4IKF A;  5D5X B;  4Y7N J;  1I6X A;  3K70 D;  3TKY A;  3K1M A;  2F2E A;  1WVR A;  3FX3 A;  1VTN C;  2EZL A;  2M5W A;  3GFL A;  5M3F J;  2HTS A;  3OYE A;  2ESN A;  4YFK F;  1SD6 A;  3LSH A;  2LF7 A;  3OYK A;  4HRI A;  2ZJR F;  5FFX A;  3TED A;  3BQY A;  5FKO A;  3TMO A;  4M3E A;  2VBY A;  1YJW I;  1X1P A;  4BEH B;  5E3M A;  1PYV A;  3KFW X;  2Q8K A;  1XPX A;  3CJN A;  4BAY A;  1G3S A;  1SC7 A;  2K9M A;  1FP1 D;  2A6T A;  4U7D A;  4IXA A;  4BY7 J;  4EV0 A;  4A3K J;  4OMY A;  5TIS C;  3A01 A;  5L3D A;  3MKY B;  2CJJ A;  3AG2 H;  2VPR A;  1U3E M;  1EH8 A;  1LUJ B;  3PIP F;  2R7W A;  5ERI A;  4E7Z A;  3CMA I;  1V4R A;  3DPT A;  3EDP A;  1Z21 A;  1AOY A;  4UHT A;  1XMA A;  1HW1 A;  1U78 A;  4FTH A;  3HGG A;  3HOZ J;  1IN8 A;  4ON0 A;  1DP7 P;  1KQ9 A;  4ZTF A;  2O03 A;  4FET A;  4M9X A;  2Z1D A;  5LGU A;  2HGC A;  3SZT A;  3RJP A;  4DW6 A;  2ZSH B;  2XB5 A;  2JA8 J;  2X6O A;  2L7M P;  2VQL A;  2E2I J;  1LE8 B;  3A01 B;  2EB7 A;  1FWZ A;  2ELK A;  2M4K A;  2ZCW A;  4HQE A;  1TWF J;  1R4M B;  5E1W A;  2N8G A;  3VOD A;  3OIO A;  1QZE A;  3LQR A;  5E20 A;  1WPK A;  1D0X A;  1S6L A;  1I50 J;  1YX3 A;  2ESH A;  3W2W A;  4DZJ A;  1YFH A;  2XGD A;  1YTY A;  2XF5 A;  1JKQ C;  1GXQ A;  1ODD A;  2EA4 A;  2ZFW A;  3VSL A;  2QA4 I;  1OKR A;  3MZH A;  1ZGA A;  2BW3 B;  2DU9 A;  2IP2 A;  2H6B A;  3V8J A;  1J2X A;  2R4G A;  1SFU A;  1MIJ A;  2BY3 A;  4GYI A;  4ZYH A;  3LL7 A;  4HA8 A;  1YO5 C;  3K7A J;  3U2R A;  2TDX A;  2R7T A;  1V5E A;  2E71 A;  1RI7 A;  3F8F A;  2XRO A;  1B8I B;  2NVQ J;  4BL0 B;  3N4M A;  3IH2 A;  3CCV I;  2VE8 A;  3D5S C;  4IHT A;  4Q4Z F;  1LDD A;  4DQ2 A;  3I64 A;  1KA8 A;  3GXO A;  4RAG A;  2YPR A;  1FC3 A;  2IXS A;  1BL0 A;  1XTA A;  2VOO A;  1YIJ I;  2LF8 A;  1UAA A;  5IP7 J;  1TTY A;  2QSF X;  3E7L A;  4IJA A;  4IHY A;  3PSI A;  5E79 C;  4Q48 A;  2DA5 A;  3DF8 A;  4ENM A;  4IX7 A;  4IEJ A;  3DQV C;  2EFO A;  2IS2 A;  2GM4 A;  4FAS D;  1B59 A;  2X0L A;  5LFA A;  3IAS 2;  3HRS A;  2A6H F;  4A3M J;  2V9K A;  2CV2 A;  4XOP A;  1RET A;  1SMT A;  5IPA A;  2LYC A;  5K7F A;  2WV0 A;  2AHQ A;  2XAQ A;  3WTW C;  2XAF A;  3FXK A;  2FQ4 A;  2UV1 A;  4WCG A;  3DCF A;  2CH0 A;  2UUZ A;  4A0Y A;  4ZH4 F;  1WFX A;  4AYB A;  1RKW A;  2G7H A;  3V4G A;  1UCR A;  3HOX J;  3W6J B;  4KN4 X;  2E2J J;  2K3F A;  2XSJ C;  3DKY A;  5EEH A;  4F91 B;  4G9Y A;  1U8B A;  1T38 A;  1BI2 A;  2O3F A;  1L3L A;  1XN7 A;  1I1G A;  2YS9 A;  2IRF G;  1YJN I;  4KN7 X;  2EFW A;  5LHH A;  2RGV A;  3F3X A;  2LLK A;  3GLL A;  3V7C A;  3C3W A;  3QPS A;  1P9Q C;  5LHG A;  3VPR A;  1PP7 U;  2LMD A;  2R7Q A;  3BWG A;  3HBL A;  3ISP A;  2K3P A;  3MVP A;  2R5Z B;  4KYW A;  2YU3 A;  2M0C A;  3I5U A;  3CES A;  4X6A J;  5E8I A;  2B9S A;  2P81 A;  2NNN A;  2D1V A;  4XK4 A;  2DJI A;  1IXC A;  2QWW A;  4EVI A;  2G7U A;  3DBH B;  3DTE A;  4CDG A;  4PGH A;  2KHM A;  4L18 B;  4BHC A;  1WH5 A;  2KIQ A;  1BN5 A;  4V2G A;  3OYI A;  2PN6 A;  2QYO A;  1MDM A;  2QCO A;  3I3L A;  3S3N A;  2HYJ A;  1MBJ A;  3QYB A;  4NC6 A;  3HG9 A;  4EJO A;  2KMU A;  4IVN A;  5M5Y J;  4MO7 A;  3LSM A;  5IOZ A;  5EG0 A;  2LTP A;  3ZXS A;  1FYL A;  4NQW A;  5HS8 A;  4RGS A;  3CP8 A;  5FKK A;  2CSO A;  2OUM A;  2Z33 A;  2ICW G;  2FJ1 A;  2O5R A;  3C2H A;  1FMV A;  1P2F A;  3I56 I;  1T95 A;  1Z6R A;  2XPU A;  3CUO A;  4XKC A;  3L2C A;  5LEJ A;  2ZXH A;  4BU2 A;  1WZ2 A;  4A3I J;  5K5R A;  1ETK A;  1KYZ A;  3WGG A;  1P4A A;  3CCM I;  3BOQ A;  1IUF A;  3A1Y A;  1Y1V J;  2QGU A;  3OYA A;  1WWX A;  5FKN A;  4FCY A;  5EG0 B;  2XC7 A;  4LK0 F;  4L9T A;  1OFC X;  2VIX A;  2EV5 A;  2KRH A;  1N77 A;  2A61 A;  3H1C A;  4BDZ A;  1IN7 A;  1CF7 B;  2ZME C;  1FOX A;  1K6Y A;  3TO7 A;  1WKM A;  1FTZ A;  4PGG A;  2FEZ A;  4C3I J;  1K4S A;  3S93 A;  4A69 C;  3GTM J;  4DZP A;  1JUS A;  3K1N A;  5J8C A;  4MEY F;  3ZN0 A;  1ZR4 A;  2D5V A;  2CYY A;  2Y9Y A;  4JQF A;  1VQK I;  3MZY A;  5L3B A;  1RRJ A;  1U5T C;  4H0E A;  4A93 J;  1W5C C;  4RAZ A;  2XV4 S;  2M34 A;  1HKT A;  3JTG A;  2WTE A;  2DMN A;  4S0H B;  1ZK8 A;  5IT9 Z;  1YW8 A;  2F5D A;  2XKP A;  4F93 B;  1D5V A;  1FNN A;  3QP6 A;  5FO5 A;  3WHB A;  4AM3 A;  3AKZ A;  3FXR A;  1IRZ A;  1IJW C;  1ZAO A;  3IH4 A;  4FE4 A;  4F7Z A;  1S72 I;  3E6D A;  4BJ6 C;  4BUP A;  2JPC A;  1FIP A;  5HDK A;  4I09 A;  4LB5 A;  3OYB A;  5LEK A;  1R22 A;  1FOW A;  3P9C A;  3OOP A;  2KRC A;  2RDP A;  4IHS A;  4EJU A;  4PDK A;  3R61 A;  1RC9 A;  2QUF A;  1SVO A;  3FZV A;  3I54 A;  4BQO A;  3SHF A;  1ETQ A;  4P9F A;  2D1H A;  5J1R A;  3BJO A;  4XQF A;  3AG4 H;  1T2K A;  3S14 J;  5EZH A;  4CXF A;  5IT3 A;  4I99 C;  5ED4 A;  1JJ6 C;  1ERD A;  4DBR A;  3JRB A;  2DK5 A;  1HDP A;  3KP4 A;  4ITV A;  5D6F A;  3V7R A;  4ZDP A;  5BPI A;  3HSR A;  4IHX A;  1FT9 A;  3CDL A;  4ZYE A;  5JLW A;  4O6J A;  2O6G E;  2V1X A;  5BS6 A;  3HEF A;  3HOV J;  4QSH A;  3JRA A;  2V6E A;  1K6O A;  2KP6 A;  2Q2E A;  1FBS A;  5JVG F;  4AIK A;  1GXP A;  2DPD A;  4XNF A;  3OL4 A;  1J9I A;  1D1C A;  5AIQ A;  1FY7 A;  4YG2 F;  1F1Z A;  4CIC A;  4C30 A;  1J59 A;  4IF4 A;  3S3O A;  2L0K A;  3DEE A;  3DEW A;  1TC3 C;  1HC8 A;  1OCT C;  1DPR A;  4ENK A;  2BY2 A;  4R8H A;  1LJ9 A;  4LG0 A;  3O8G A;  3TO9 A;  2C6Y A;  2M8G X;  3BG9 A;  1RR7 A;  2QZ8 A;  1JGG A;  5DCF A;  4NC8 A;  1ACI A;  3COA C;  4FX4 A;  2Q2E B;  3D5L A;  3ZMU A;  2AQF A;  5IP9 J;  2JA6 J;  3S2D J;  4OU0 A;  1G2H A;  2FNA A;  2Y0S N;  3H5A A;  1BI1 A;  1TLH B;  1GVJ A;  2AXT C;  4XR6 A;  1IXS B;  2QQ9 A;  1OCC H;  2IT0 A;  3L2Q A;  1U8R A;  3G1O A;  1D3Y A;  4R1H A;  2WB1 N;  5GTH C;  2A07 F;  3L2W A;  2BVM A;  5C4J J;  3GFI A;  5E3N A;  2CO5 A;  2LC2 A;  4PJ0 C;  5A2Q K;  1YJ9 I;  1BIA A;  1UB9 A;  3I0T A;  4F3Q A;  3E97 A;  3CLQ A;  1HXD A;  4LG0 B;  1UEL B;  2LFB A;  1DDN A;  2O8K A;  1D0Z A;  1MMN A;  4EJW A;  2HWV A;  3J81 Z;  3OS2 A;  5L3F A;  1FBQ A;  1IV6 A;  3F0C A;  1TW2 A;  2X48 A;  3CQZ J;  2H27 A;  2Q0O A;  2FBK A;  1ETX A;  4WXC A;  2PEX A;  3FXM A;  1EV7 A;  1BR4 A;  3K4K A;  1TT0 A;  3V8K A;  3CC2 I;  4NNJ A;  2GXB A;  2GIZ A;  1UMQ A;  1NK2 P;  4HV6 A;  1APL C;  4HEA 2;  2EBI A;  2KRF A;  3HUG B;  2V9V A;  4U0V A;  1W5T A;  2NVU B;  4PFP A;  4C2M J;  1A35 A;  5FRN A;  3H9J A;  3M1E A;  3M3Y J;  4L9J A;  2R3S A;  3LSI A;  4XRM A;  1ETV A;  1OYY A;  2DA1 A;  3G73 A;  2LDU A;  4G7Z F;  1V3F A;  2DMP A;  2QKL B;  4HG2 A;  3N05 A;  1W0U A;  1OCP A;  5GAD J;  4OIN F;  2XAU A;  3BP8 A;  2BY1 A;  4IPA A;  1PUE E;  2WY7 Q;  1MJ9 A;  5J8F A;  4HNV A;  2STW A;  1R1T A;  3CME I;  1IRF A;  2LY9 A;  3SFI A;  4B09 A;  3HOY J;  2BZT A;  4RGX A;  2H6C A;  2DQR A;  2XHK A;  3FXU A;  2DPU A;  4HW0 A;  2CV0 A;  4RGU A;  3GFM A;  5TGT A;  3PSF A;  3DTK A;  3CC7 I;  2ZME A;  3E6M A;  5FLV A;  3QPT A;  4EM2 A;  4IOA F;  3J7A O;  2IPQ X;  3FM5 A;  1A6Q A;  3EUA A;  5LD2 C;  3Q9V A;  1ZLJ A;  4XLE A;  3G3Z A;  3B73 A;  2TCT A;  3TP3 A;  2HXO A;  3OYG A;  4M3D A;  4ZYD A;  3MCZ A;  3S2W A;  4N9H A;  2FUG 2;  1U5T A;  4HF2 A;  1I3Q J;  4BQQ A;  1FIA A;  3F6O A;  2E2H J;  4BH9 A;  1D5Y A;  3KLO A;  5DV5 A;  4OIQ F;  2KT0 A;  2E1O A;  3M1C A;  2L4A A;  4L9V A;  1CGP A;  2Q1Z B;  3LWF A;  1XC5 A;  2CS3 A;  1S7O A;  4XN0 A;  2BXZ A;  2XPV A;  5EJC A;  4EEF G;  3BZ6 A;  1TWH J;  3U21 A;  1WSU A;  3ZQC A;  1K78 A;  1MBG A;  1S8N A;  2PMZ A;  4JP0 A;  3LNQ A;  2VE9 A;  5J47 A;  4IL6 C;  3SYT A;  5F0H A;  1R6R A;  3WG9 A;  3A2K A;  1H9G A;  4BE1 A;  2ISY A;  3D1N I;  2IS1 A;  1Z6T A;  2LY1 A;  1KU7 A;  3FIS A;  3GTO J;  1IZ1 A;  2V26 A;  1T0F A;  2AXL A;  2FE3 A;  3QPL A;  2VLA A;  1VQP I;  3E5U A;  4CCO A;  1VI0 A;  3FBI B;  1JUM A;  4XLN F;  1VZ0 A;  2EFQ A;  3R6S A;  4B4C A;  1YX5 A;  2GIV A;  3OY9 A;  2VKE A;  2OAZ A;  3S3M A;  1VQO I;  4UUT A;  3FXO A;  1X1A A;  1Y6I A;  3G6E I;  1LVK A;  3H35 A;  2PJR A;  4EGY A;  3T0Y A;  2HPM A;  3KZY A;  2IGN A;  2GQQ A;  2ECC A;  5HLI A;  2R7F A;  2M4G A;  2WAE A;  1G59 A;  4A6D A;  3AFH A;  1Q1V A;  4QIW N;  1IO2 A;  1HCR A;  4ZYG A;  1G3T A;  3BZC A;  2ME6 A;  3HOS A;  5C3E J;  1MBF A;  3K4L A;  1D8J A;  3BTC A;  2VJJ A;  5K5O A;  3PIO F;  3ZQI A;  2YX4 A;  5GAE J;  3DKX A;  2LY2 A;  2P6T A;  5E1X A;  1TNS A;  1LB2 A;  2B7E A;  2XIG A;  1BR1 A;  3IV5 A;  1JKO C;  2CW7 A;  5BMZ A;  5J4V A;  2UZK A;  2OC6 A;  4NC7 A;  1TQM A;  3TW6 A;  1WI9 A;  1BBY A;  4UY8 I;  4BAC A;  1N25 A;  3B6C A;  4HF0 A;  4CO8 A;  3D0S A;  2YX7 A;  2EV0 A;  2P7C B;  1ZQ3 P;  1YQA A;  4LB6 B;  2LH9 A;  3K2A A;  3IP4 B;  2CUE A;  2K02 A;  2L7F P;  5ICF A;  1ETW A;  2JA5 J;  3IAM 2;  1TL8 A;  1ON1 A;  3NWT A;  1ZRD A;  1IDZ A;  3RZD J;  4EM1 A;  5M5W J;  4A0X A;  2K40 A;  3WG7 H;  1U9N A;  4FT8 A;  3CCL I;  1IAW A;  4CCL A;  2Z9O A;  3FF5 A;  3Q9S A;  3F72 A;  4I02 A;  3CO6 C;  2ZJ2 A;  2L5Q A;  1Y8R B;  2W85 A;  3E5Q A;  2WAQ N;  3OIQ A;  1VQ4 I; 
#chains in the Genus database with same CATH homology
 4MHG A;  1U6G A;  4RAY A;  1EH6 A;  4KA4 A;  4ZZL A;  4YFN F;  4K2E A;  1RNL A;  4OOI A;  1XDU A;  1C0W A;  3DEU A;  1Z1D A;  3MFK A;  1QPM A;  3FXQ A;  5FB2 A;  3M7G A;  3N97 A;  1L0O C;  1TQI A;  5HS7 A;  2NNY A;  3P9I A;  1HQC A;  3SZP A;  5CJ9 A;  2OZ6 A;  2HR3 A;  1O3Q A;  2BYV E;  2B0L A;  4PCQ A;  1R23 A;  2DAO A;  2W57 A;  2ZKZ A;  1T98 A;  4LLN A;  3T8T A;  2HKX A;  3BJ6 A;  1BIB A;  3EUH A;  2P7V B;  2PMH A;  1IRG A;  3HTU A;  2FOK A;  3E3V A;  3VOE A;  2O61 A;  1FSE A;  4QWQ A;  1T39 A;  2DT5 A;  4U7B A;  3I71 A;  5ICC A;  2HS5 A;  3BPV A;  2PMU A;  2R7D A;  4LMY A;  1J5Y A;  3BPX A;  2XAS A;  4OIR F;  1JHF A;  1U2W A;  2BEO A;  2F5C A;  2K86 A;  2MD5 A;  3R0J A;  1FX7 A;  4M73 A;  3M8F A;  3GUD A;  1LDK B;  5JR3 A;  1SFX A;  2LSO A;  2KJC A;  3IL2 A;  5ICE A;  4HLX A;  2JSC A;  1HBX G;  1ZAR A;  1HSJ A;  4AIJ A;  2XAH A;  2VON A;  3HSE A;  3PQK A;  2O8X A;  5HS9 A;  4P55 A;  4KFC A;  2OD5 A;  1E2X A;  3IRQ A;  1OYW A;  1SD7 A;  4G7O F;  3CO7 C;  2M1B A;  3JTH A;  1R36 A;  2RV8 A;  4EGZ A;  2KIU A;  4O5V A;  4LGW A;  4KIF A;  3LA3 A;  5TRD A;  3ZPL A;  3QPH A;  2QLZ A;  4KIC A;  3ELK A;  1JXS A;  3KP3 A;  5DD4 A;  6PAX A;  1XCV A;  3W6K B;  3O2P E;  2WC2 A;  1I5Z A;  3ZP5 A;  4Q47 A;  2HFH A;  4WK8 F;  3DV8 A;  4AD9 A;  2DO7 A;  1J75 A;  3J81 K;  5FGM A;  4A6E A;  4GCV A;  1UHW A;  1P92 A;  2STT A;  1BC7 C;  2QVO A;  4UNO A;  1S7A A;  3LAP A;  1JE8 A;  4G6D A;  2LKP A;  2BBY A;  2DBB A;  1BC8 C;  3ECH A;  2FSW A;  3NEU A;  2RQP A;  3GW2 A;  3R4K A;  3ZMZ A;  1ON2 A;  4KMF A;  2RN7 A;  3QU6 A;  2V6C A;  3CUQ B;  2D2W A;  3ML6 A;  5LGN A;  1XSD A;  2XRN A;  2UWM A;  2ISZ A;  1SD4 A;  1CF7 A;  1B6A A;  4L9N A;  1G3W A;  4XSX F;  4GYG A;  2RNJ A;  1R00 A;  2X4H A;  2HQN A;  1OMI A;  3BRO A;  1BM9 A;  5ILS A;  2K7L A;  1ZRE A;  4LLG F;  1K7A A;  1KQ0 A;  2XUB A;  2MH2 A;  4I0A A;  1KYW A;  2EK5 A;  3F6V A;  2H09 A;  3L9F A;  4G94 A;  1I27 A;  2W25 A;  3K9T A;  4GXO A;  1H9T A;  2ACJ A;  4MTE A;  3TDZ C;  3VEP A;  1MGT A;  3CTA A;  1OPC A;  4LD5 A;  3KE2 A;  4WXD A;  4MGR A;  1LEA A;  3IHU A;  1R58 A;  1KU9 A;  3IKV A;  1PP8 F;  2P5K A;  2O0Y A;  4TV7 A;  5BQT A;  1YIO A;  2UXN A;  4KDP A;  2F5E A;  1G4D A;  2BV6 A;  2DFI A;  1XGS A;  4GO1 A;  1R5G A;  2HTJ A;  4L5J A;  4ENJ A;  1IN5 A;  2K4B A;  3WU0 A;  1R7J A;  2NYX A;  3O6B B;  1FBU A;  4I01 A;  1HW2 A;  2OQR A;  3WGH A;  3L09 A;  3J80 Z;  1LQ1 A;  3I59 A;  4R79 A;  2VBW A;  3ROU A;  4L5I A;  1IUY A;  2XKO A;  1HKQ A;  4I98 B;  1BJA A;  2P5V A;  3MQ0 A;  3SFZ A;  2KIM A;  3HYI A;  3I59 B;  3QU3 A;  1IN6 A;  1WRJ A;  1ZYR F;  3CLO A;  4XRF A;  1ZG1 A;  5DDG A;  2VT3 A;  3KP7 A;  2V79 A;  1W4M A;  3B02 A;  3NRV A;  1XMK A;  1RZ4 A;  1ULY A;  3T8R A;  1SMY F;  3HUG A;  3EYI A;  1TBX A;  1DPU A;  2PFB A;  2EJR A;  1USS A;  3HRM A;  1FPQ A;  1O7F A;  2Y48 A;  5DYM A;  5TJJ A;  3GX4 X;  1X3U A;  3HRU A;  4EQQ A;  3GFJ A;  3LAJ A;  1B9N A;  3I58 A;  3F23 A;  2J5O A;  1A04 A;  3U1D A;  2MLG A;  4KIG A;  1LDJ A;  3DKW A;  3TO6 A;  3DXJ F;  2WWY A;  4BHB A;  2L01 A;  3RPU A;  2DK8 A;  1MJA A;  2OBP A;  5BPD A;  2NRA C;  3KET A;  2IA0 A;  4KUM A;  3JSP A;  1R5H A;  2L02 A;  1QGP A;  1B4A A;  2EFN A;  5KK1 A;  2K4J A;  5BOX A;  2RVC A;  2CW0 F;  5HDG A;  4M74 A;  5FD6 A;  1S29 A;  1W7P A;  4I2O A;  5DUK A;  3JAM Z;  4ESB A;  3E6B A;  3TGN A;  1OR7 A;  1JGS A;  1FZP B;  1W5S A;  2P8T A;  1D8K A;  3BJA A;  3E6C C;  2QQA A;  1FP2 A;  1W7P B;  2Y75 A;  2XVC A;  1UST A;  3KP2 A;  2K27 A;  2Z3Y A;  3JSO A;  3F21 A;  4HOB A;  5DUI A;  2EV6 A;  4CYD A;  1LVA A;  3IKT A;  4WWC A;  1ZHF A;  3I53 A;  3M8E A;  1ZRC A;  4LLL A;  4LJZ F;  5L3C A;  5ILU A;  1F9N A;  3VFZ A;  2IA1 A;  1S3J A;  3H3Z A;  5D4R A;  3LQQ A;  3OV8 A;  5CVI A;  3RKY A;  3JW4 A;  4HX7 A;  1TQP A;  2E7X A;  3U9G A;  3NQO A;  4I0B A;  2LNB A;  4M71 A;  2M30 A;  4Z2Y A;  1O7L A;  5D6E A;  4XBF A;  1G6N A;  2Y0M A;  4RB3 C;  1UFM A;  2F5F A;  1H0M A;  3TOA A;  4UUV A;  3FWE A;  3FM3 A;  2ELH A;  4MQV A;  2HYF A;  3GEZ A;  4YII A;  2FNP A;  4AIH A;  3GLX A;  4KT5 C;  3IC7 A;  3HSF A;  4A5M A;  2D45 A;  2QM3 A;  1QQI A;  3F22 A;  2PLY A;  1QO0 D;  5DEQ A;  4MQ9 F;  3MEX A;  3H92 A;  1WQ2 A;  3BDD A;  2OQG A;  1LEB A;  3CUQ C;  5HVQ C;  4RB0 A;  4L0Y B;  4P96 A;  5H6Q A;  4NB5 A;  5CVJ A;  5A2Q Z;  4U88 A;  2GXG A;  1Z7U A;  3PQJ A;  4NHJ A;  3DPL C;  1R1U A;  4FX0 A;  2VBX A;  4G8X A;  2IVM A;  2IJL A;  1XDS A;  5LBQ A;  4YIF A;  2A68 F;  3V8L A;  2ZBK A;  4MEX F;  2ETH A;  4M9S A;  2DLL A;  2DI3 A;  4MNU A;  2GZW A;  4E70 A;  4D0P A;  1ZRF A;  2MBF A;  2XGX A;  2KKO A;  3F8M A;  4G7H F;  2QBY B;  4AWX B;  2A69 F;  2NAZ A;  2EFP A;  3TDU C;  4BQA A;  4A2U A;  5L3E A;  2CG4 A;  1QZY A;  1KQ8 A;  2JZY A;  1EH7 A;  5IT9 K;  2J5P A;  3FMR A;  1IF1 A;  4BXU A;  2P5L C;  1G3Y A;  5FLX Z;  1F4K A;  5E18 F;  3LA7 A;  2W84 A;  3QP5 A;  2HYG D;  2AS5 F;  4EMS A;  3Q5F A;  4HZF A;  4GGG A;  1OYI A;  4RB1 A;  2ZNZ A;  4Y15 A;  1KU2 A;  2ZNY A;  3RYR A;  1DUX C;  5JI6 A;  4N0B A;  1NHA A;  2CFX A;  3QOP A;  3HIF A;  2XAG A;  2MA3 A;  2HZT A;  1XSV A;  1YS6 A;  1YW7 A;  3J80 K;  3BY6 A;  5D5U B;  5HLG A;  3KP6 A;  3P7N A;  1MZB A;  4YFX F;  4S04 A;  2Z99 A;  4JBA A;  1ZG3 A;  5ICG A;  2PJP A;  1O3T A;  1TW3 A;  3LA2 A;  4IRI A;  4Y17 A;  5D8L B;  3FMQ A;  3WE2 A;  3ZMD A;  3RDI A;  2EWN A;  2DW4 A;  2M45 A;  5CVU A;  1MJB A;  1BI0 A;  2MC3 A;  3F8B A;  2FXA A;  4CHU A;  2L3D A;  4RB2 C;  3GWZ A;  3DFG A;  4HX8 A;  5D8K B;  5JHU A;  1FYM A;  3HRT A;  1P4W A;  3WTX C;  2GAU A;  3WTV C;  4WXH A;  3K1P A;  1SD5 A;  3ZN1 A;  5HDN A;  4HAM A;  2ADU A;  2JPB A;  4BNC A;  3CUQ A;  3VB2 A;  3L00 A;  4ESF A;  5DCM A;  4IRG A;  2QQB A;  2MLK A;  4ESJ A;  3ZMT A;  4LK1 F;  2JT1 A;  1YS7 A;  3GVA A;  3GF2 A;  2VOD A;  1Q1H A;  4EJV A;  2OU2 A;  3RKX A;  2HEO A;  1REP C;  5D5V B;  2E1N A;  5LRR A;  2A6E F;  3ABT A;  3ECO A;  1HW5 A;  2L54 A;  5DCM B;  3ERE D;  3KLN A;  2FBI A;  5D4S A;  2XAJ A;  4B8X A;  4M72 A;  4Q5S F;  4AVP A;  2P4W A;  3H3U A;  4N9I A;  2OZU A;  4U0Y A;  4HBL A;  1O57 A;  1JHH A;  1XSX A;  1ZN2 A;  2DTR A;  2OA4 A;  4HLY A;  2M87 A;  2L4M A;  5K1Y A;  3EYY A;  3K2Z A;  3JAM K;  1MDM B;  2HDC A;  4HF1 A;  4QLC U;  2EA2 A;  5HLH A;  2FF4 A;  2JRT A;  3WTU C;  1FYK A;  1MKM A;  4UXN A;  4UVB A;  1PDN C;  3EQL F;  5E8G A;  1ZG5 A;  2QEN A;  3IWF A;  1XD7 A;  3KP5 A;  3ZMV A;  2VC0 A;  3WE3 A;  2HQR A;  1Y0U A;  1FOK A;  3C1D A;  2JTV A;  4G6Q A;  2PI0 A;  3QRF F;  2G9W A;  3R0A A;  2UXX A;  3PFI A;  1ZLK A;  1LNW A;  4UVA A;  2FBH A;  2PQ8 A;  3E5X A;  4OMZ A;  2BGC A;  2COM A;  5F64 A;  4S05 A;  4XLP F;  2E1C A;  3O3K A;  2CQK A;  2IA2 A;  3F8N A;  2FMY A;  3GYH X;  4A5N A;  1YLF A;  5ILV A;  2PG4 A;  5F6F A;  2VC1 A;  2M8E A;  5E17 F;  2PBI A;  2V1U A;  1T6S A;  1GHC A;  3FMS A;  3QAH A;  4BHP A;  4MTD A;  3RTR A;  2A3S A;  4OIP F;  1HST A;  3HHG A;  2FML A;  3EET A;  5EEG A;  1XGN A;  1RUO A;  4JK1 X;  5KVR A;  5LHI A;  4HYE A;  5H20 A;  4BYY A;  1TNT A;  5CYV A;  3SXY A;  4RS8 A;  1RUN A;  3ZQ7 A;  1XB4 A;  2VXZ A;  3R60 A;  5LRS A;  4KIB A;  2VN2 A;  3T5X A;  3WOD F;  5LGT A;  2FU4 A;  2V1D A;  1ONV A;  5CVV A;  2ZXJ A;  3P9K A;  4OIO F;  3T1B A;  1YG2 A;  3C18 A;  2FA5 A;  2GA2 A;  5AIP A;  2KIF A;  4DNC A;  3K0L A;  3RPQ A;  1Z91 A;  2GWR A;  1QZZ A;  3GO5 A;  3ULQ B;  3CDH A;  2NS0 A;  1IXR C;  2P6S A;  5FFZ A;  1O3R A;  3RYP A;  1K79 A;  5J6X A;  3K69 A;  5HOO A;  3WTS C;  1R1V A;  3MAJ A;  1BI3 A;  1ZGJ A;  4FHT A;  3KEQ A;  2VT2 A;  4ASN A;  4Y13 A;  4EJT A;  3TOB A;  3RKW A;  1KGS A;  3GZ6 A;  4M6Y A;  2HOE A;  3AAF A;  4ZZD A;  3TQN A;  3IRR A;  4WF2 A;  2BE5 F;  1QNT A;  2CWE A;  3V7S A;  2ZO4 A;  2RKH A;  5H6R A;  5DD8 A;  1B9M A;  4A12 A;  1J0R A;  1Z9C A;  2MH9 A;  3MWM A;  4HDV A;  1XGO A;  1IN4 A;  2H94 A;  4PZJ A;  2RC4 A;  5FLX K;  4LFU A;  1SAX A;  2FRH A;  1UHM A;  3I4P A;  5L3G A;  3HTS B;  1STZ A;  4HQM A;  1FSH A;  3WTY C;  2ZME B;  3RI4 A;  4HX4 A;  1SFE A;  3IWZ A;  4A0Z A;  3DP7 A;  4ETS A;  1IW7 F;  1Z05 A;  2Z5U A;  1BOA A;  5CLS A;  4L0Z B;  1HKS A;  1U5T B;  4I7H A;  1XGM A;  5FD5 A;  5JVT A;  2W24 A;  5JFR A;  1ZH5 A;  4O3M A;  3C7J A;  1K78 B;  2HKO A;  4UVC A;  5LLQ A;  1E17 A;  1QBJ A;  3REO A;  4WX9 A;  1W7P D;  4M6X A;  2IW5 A;  1MD0 A;  1YYV A;  3WTZ A;  1I1S A;  5F1R A;  4KNY A;  5K5Q A;  3GZ5 A;  1F5T A;  4RGR A;  2GA1 A;  4CZZ A;  4P9U A;  5CVR A;  2YR2 A;  4P5O A;  2CGP A;  3LFK A;  3HOT A;  3ABU A;  1P4X A;  3WGI A;  4HV5 A;  3L7W A;  1B1B A;  2FQ3 A;  2DQL A;  1YW9 A;  3M9A A;  1AWC A;  2A5Y B;  2VBZ A;  1XCB A;  4CGZ A;  3ZMS A;  4ENN A;  5D5W B;  4XSZ F;  3WTT C;  3KEO A;  1P6R A;  1RIO H;  4UV9 A;  4U0W A;  4KMU X;  2YSR A;  5AON A;  4EM0 B;  3SQN A;  4HDU A;  3FHZ A;  1J7K A;  1FLI A;  2QBY A;  2VOP A;  4IRH A;  3WU1 B;  2E7W A;  3LST A;  1O3S A;  1KU3 A;  3KCC A;  3HHH A;  4UV8 A;  5E1Z B;  4M9Z A;  3RIR A;  2KJB A;  3F8C A;  3KZZ A;  5D5X B;  1I6X A;  3TKY A;  3K1M A;  2F2E A;  3FX3 A;  1VTN C;  2M5W A;  3GFL A;  2HTS A;  2ESN A;  4YFK F;  1SD6 A;  2LF7 A;  5FFX A;  2VBY A;  3KFW X;  2Q8K A;  3CJN A;  4BAY A;  1G3S A;  1FP1 D;  4U7D A;  4IXA A;  4EV0 A;  4OMY A;  5L3D A;  1U3E M;  1EH8 A;  5ERI A;  1V4R A;  3DPT A;  3EDP A;  1AOY A;  4UHT A;  1XMA A;  1HW1 A;  1U78 A;  1IN8 A;  4ON0 A;  1DP7 P;  1KQ9 A;  2O03 A;  4M9X A;  5LGU A;  2HGC A;  3SZT A;  3RJP A;  2EB7 A;  1FWZ A;  2ZCW A;  4HQE A;  5E1W A;  3VOD A;  3LQR A;  5E20 A;  1S6L A;  2ESH A;  1YFH A;  1YTY A;  1GXQ A;  1ODD A;  2EA4 A;  2ZFW A;  1OKR A;  3MZH A;  1ZGA A;  2DU9 A;  2IP2 A;  2H6B A;  3V8J A;  1J2X A;  1SFU A;  4GYI A;  4ZYH A;  4HA8 A;  1YO5 C;  3U2R A;  2TDX A;  1RI7 A;  3F8F A;  2XRO A;  3N4M A;  2VE8 A;  4IHT A;  4Q4Z F;  1LDD A;  4DQ2 A;  3I64 A;  1KA8 A;  3GXO A;  2YPR A;  1FC3 A;  2VOO A;  2LF8 A;  1TTY A;  4IJA A;  4Q48 A;  3DF8 A;  4ENM A;  3DQV C;  2EFO A;  1B59 A;  2X0L A;  3HRS A;  2A6H F;  1SMT A;  2WV0 A;  2XAQ A;  3WTW C;  2XAF A;  4WCG A;  4A0Y A;  4ZH4 F;  3V4G A;  2G7H A;  1UCR A;  3W6J B;  4KN4 X;  5EEH A;  1T38 A;  4G9Y A;  1L3L A;  1BI2 A;  2O3F A;  1XN7 A;  1I1G A;  2IRF G;  4KN7 X;  2EFW A;  5LHH A;  2RGV A;  3F3X A;  3V7C A;  3C3W A;  5LHG A;  1PP7 U;  3BWG A;  3ISP A;  4KYW A;  2YU3 A;  3I5U A;  5E8I A;  2NNN A;  2D1V A;  1IXC A;  2QWW A;  4EVI A;  2G7U A;  4CDG A;  4PGH A;  4L18 B;  4BHC A;  1BN5 A;  2PN6 A;  2QYO A;  1MDM A;  4EJO A;  4IVN A;  1FYL A;  4NQW A;  5HS8 A;  4RGS A;  2CSO A;  2Z33 A;  1P2F A;  1Z6R A;  3CUO A;  3L2C A;  5LEJ A;  5K5R A;  1KYZ A;  3WGG A;  1P4A A;  3BOQ A;  1WWX A;  4LK0 F;  4L9T A;  2EV5 A;  2A61 A;  1IN7 A;  1CF7 B;  3TO7 A;  1WKM A;  4PGG A;  2FEZ A;  3K1N A;  5J8C A;  4MEY F;  3ZN0 A;  2CYY A;  4JQF A;  3MZY A;  5L3B A;  1U5T C;  4H0E A;  4RAZ A;  2XV4 S;  1HKT A;  3JTG A;  2WTE A;  5IT9 Z;  1YW8 A;  2F5D A;  2XKP A;  1D5V A;  1FNN A;  3QP6 A;  5FO5 A;  3FXR A;  1ZAO A;  4F7Z A;  3E6D A;  2JPC A;  5HDK A;  4I09 A;  4LB5 A;  5LEK A;  1R22 A;  3P9C A;  3OOP A;  2RDP A;  4IHS A;  4EJU A;  4PDK A;  3R61 A;  2QUF A;  3FZV A;  3I54 A;  3SHF A;  4P9F A;  2D1H A;  3BJO A;  1T2K A;  4CXF A;  5IT3 A;  5ED4 A;  2DK5 A;  5D6F A;  3KP4 A;  3V7R A;  5BPI A;  3HSR A;  1FT9 A;  4ZYE A;  4O6J A;  2O6G E;  2V1X A;  5BS6 A;  1K6O A;  2Q2E A;  1FBS A;  4AIK A;  1GXP A;  2DPD A;  1J9I A;  5AIQ A;  1FY7 A;  4YG2 F;  1F1Z A;  4CIC A;  1J59 A;  4IF4 A;  1DPR A;  4ENK A;  4R8H A;  1LJ9 A;  4LG0 A;  3TO9 A;  2C6Y A;  2QZ8 A;  5DCF A;  3COA C;  4FX4 A;  3D5L A;  3ZMU A;  4OU0 A;  2FNA A;  1BI1 A;  1TLH B;  1GVJ A;  1IXS B;  2QQ9 A;  2IT0 A;  1U8R A;  1D3Y A;  4R1H A;  2A07 F;  3GFI A;  5A2Q K;  2CO5 A;  1BIA A;  1UB9 A;  3I0T A;  3E97 A;  1HXD A;  4LG0 B;  1DDN A;  4EJW A;  3J81 Z;  2HWV A;  5L3F A;  1FBQ A;  1TW2 A;  2H27 A;  2Q0O A;  2FBK A;  4WXC A;  2PEX A;  1EV7 A;  3V8K A;  2GXB A;  4HV6 A;  2KRF A;  2V9V A;  4U0V A;  1W5T A;  3M1E A;  4L9J A;  2R3S A;  1OYY A;  3G73 A;  2LDU A;  4G7Z F;  1V3F A;  4OIN F;  3BP8 A;  4IPA A;  1PUE E;  1MJ9 A;  5J8F A;  2STW A;  1R1T A;  1IRF A;  4B09 A;  4RGX A;  2H6C A;  2DQR A;  2XHK A;  3FXU A;  2DPU A;  4HW0 A;  4RGU A;  3GFM A;  2ZME A;  3E6M A;  3QPT A;  4EM2 A;  3J7A O;  2IPQ X;  3FM5 A;  3Q9V A;  1ZLJ A;  3G3Z A;  3B73 A;  4ZYD A;  3MCZ A;  3S2W A;  4N9H A;  1U5T A;  4HF2 A;  3F6O A;  4BH9 A;  3KLO A;  5DV5 A;  4OIQ F;  2L4A A;  4L9V A;  1CGP A;  3LWF A;  1S7O A;  3BZ6 A;  1WSU A;  1K78 A;  1S8N A;  2VE9 A;  3WG9 A;  1H9G A;  2ISY A;  1Z6T A;  1KU7 A;  1IZ1 A;  1T0F A;  2AXL A;  2FE3 A;  3E5U A;  4XLN F;  2EFQ A;  3R6S A;  2GIV A;  2OAZ A;  4EGY A;  3T0Y A;  3KZY A;  2GQQ A;  5HLI A;  2R7F A;  4A6D A;  4ZYG A;  1G3T A;  3HOS A;  1D8J A;  5K5O A;  2YX4 A;  2P6T A;  5E1X A;  1TNS A;  1LB2 A;  2XIG A;  5BMZ A;  2UZK A;  1TQM A;  1WI9 A;  1BBY A;  4HF0 A;  4CO8 A;  3D0S A;  2YX7 A;  2EV0 A;  2P7C B;  1YQA A;  4LB6 B;  2K02 A;  5ICF A;  1ZRD A;  1ON1 A;  4EM1 A;  4A0X A;  4FT8 A;  1IAW A;  2Z9O A;  3FF5 A;  3Q9S A;  3F72 A;  4I02 A;  3CO6 C;  2ZJ2 A;  2W85 A;  3E5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...