4BNCA

Crystal structure of the dna-binding domain of human etv1 complexed with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords HUMAN ETV1
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bncA00
3ZMDA 5HLHA 2FNPA 4N9IA 4HQMA 1D8KA 5FFXA 1F5TA 2CYYA 2EA2A 3F8NA 3CO6C 1S29A 2K4BA 1R1UA 2A69F 2FXAA 2HYFA 3HSFA 5D5UB 2QZ8A 4RAYA 2FBIA 5H20A 3KZYA 2FF4A 5JVTA 1QBJA 1O7FA 2KJBA 5L3EA 1YO5C 2GQQA 3BPXA 4PGHA 2PQ8A 4G7ZF 1SFXA 1RUOA 3RJPA 3JW4A 4S05A 2HZTA 3GUDA 3GYHX 4KNYA 1VTNC 3LQQA 1QZZA 2XAFA 2QQBA 1FSEA 3CUQC 1FWZA 5ED4A 1IF1A 1PDNC 1IW7F 4KMUX 2EA4A 3R4KA 4RB3C 3ZN1A 4ZYHA 3ZMZA 3F8CA 2O6GE 2VN2A 4S04A 2QLZA 4CHUA 3ECHA 4RGRA 2K86A 2LF7A 4CDGA 1ZG1A 3C1DA 1JE8A 1OPCA 2MH9A 4WF2A 2YR2A 3RDIA 5DCMB 2IA0A 2DAOA 1U2WA 4EJWA 1HSJA 4A0YA 1LJ9A 4LB6B 4LG0A 1MJBA 3WU1B 2EFWA 4IRIA 4LLLA 1BBYA 4A6DA 2F5DA 2D1HA 4BHBA 3ML6A 3E97A 4P96A 1XMKA 4QLCU 3I59A 3MFKA 3SQNA 3HRSA 3JSOA 4MHGA 3ERED 1Z91A 2M5WA 1BC7C 3GZ6A 2EV0A 1O3TA 4UHTA 1T39A 4ENJA 3TGNA 5A2QZ 3LAPA 2EK5A 1I1SA 5BS6A 1RNLA 2ESHA 2FMYA 5FFZA 3D0SA 2W24A 1U5TC 1HSTA 3TDZC 1FPQA 2RC4A 3MAJA 2R3SA 3LA7A 1KA8A 4ESBA 2IA2A 5D5WB 1L0OC 4M71A 3BPVA 3ZQ7A 3N97A 2L54A 3HIFA 1YLFA 1T98A 1Z05A 1DPRA 2VOOA 2RQPA 1SMYF 4M9XA 1XCBA 4A0XA 3CUQA 2DPDA 2ZMEB 2IRFG 2L3DA 2E1NA 3ROUA 2HR3A 1BI0A 4KICA 4RGSA 4RS8A 4HLYA 1HW1A 3L7WA 2K02A 3QAHA 1ZARA 2GZWA 5JR3A 1SD7A 3P9CA 3IKVA 3G73A 4BYYA 1HW2A 3NEUA 5CVIA 1BN5A 3R6SA 1H0MA 3DQVC 2QVOA 3KETA 4G8XA 2RKHA 1LDDA 5J6XA 2OBPA 1IXRC 1J75A 3GW2A 2QUFA 4HDUA 1T2KA 2QYOA 1MDMB 1FYKA 4ZYGA 1H9TA 4A12A 3N4MA 3IWZA 3CLOA 1YW9A 1GXPA 3J81K 5LLQA 5BPIA 2R7DA 3T8TA 2D45A 2VBZA 2ETHA 2ZKZA 3ELKA 3I58A 1Y0UA 2G7HA 1U8RA 1O57A 2VBWA 3I4PA 1FLIA 3ULQB 2P6SA 2CG4A 4I0AA 2UWMA 2ESNA 2ELHA 2YX7A 3HSRA 4LK1F 2DI3A 1ZRCA 4HV6A 3OOPA 3D5LA 1W4MA 4CXFA 2MBFA 2OAZA 3PQKA 4EJTA 3HYIA 3I71A 3QOPA 4KYWA 4HZFA 4P9UA 3LAJA 3RTRA 5J8FA 4Q48A 1MDMA 4I0BA 2W85A 2STWA 3DPTA 2VBXA 1QPMA 2KRFA 1LNWA 3GX4X 4XLPF 5ICCA 5DCFA 3EUHA 1EH7A 4M73A 1Z6TA 3C7JA 2ZFWA 4JBAA 1L3LA 4I01A 1WQ2A 2HGCA 5EEGA 3I53A 2CQKA 4CZZA 2GA1A 3GZ5A 4YIIA 1SD6A 2VC0A 3R0JA 1YS7A 1ONVA 3JSPA 3WGIA 1YIOA 4OMYA 3B02A 4O5VA 5HLIA 1XB4A 1I6XA 4M6XA 4G6QA 4G6DA 1REPC 1ZYRF 2ZCWA 1FSHA 2Q0OA 4GYGA 3V7RA 3GFJA 4HAMA 3MZHA 1DPUA 2HKXA 1XSXA 4LB5A 3REOA 3BP8A 4EM0B 3SXYA 1B9MA 2XROA 4BNCA 3DKWA 1Q1HA 4EJVA 3HUGA 4LLNA 1B1BA 4N0BA 2KIUA 4H0EA 3DV8A 4HX4A 3U1DA 1ZGAA 5D4RA 2OZ6A 2CO5A 4M74A 1IAWA 3BZ6A 3IWFA 1P6RA 2UXXA 4ETSA 4I2OA 1TQIA 2L01A 4UVCA 2DO7A 1WI9A 4FX4A 2F5FA 1R5HA 5AIQA 3WE3A 2OA4A 1KU2A 2YSRA 4G9YA 2K7LA 1KQ9A 1JXSA 5D6FA 5IT9Z 3C3WA 4EQQA 5DD4A 2A6HF 1ON1A 3FM3A 3R61A 4OIPF 3CDHA 3T1BA 3LA3A 4A5MA 2IA1A 3IHUA 3E6DA 1TTYA 2XAGA 3HOTA 1S8NA 2XGXA 3L2CA 1TNTA 3R0AA 4L5IA 4XRFA 1BI3A 3HHHA 4AD9A 1USTA 4UV8A 4HX8A 3T0YA 3FXUA 4Q5SF 1Z7UA 2DFIA 2CGPA 5LHIA 5E20A 3RPUA 4BQAA 1O3QA 4ZYDA 2WC2A 2VE8A 4A0ZA 2E7XA 3RPQA 1WWXA 2ZJ2A 3FXRA 4IPAA 4AIKA 1R1VA 4RAZA 1X3UA 5DV5A 1F9NA 2HEOA 5CJ9A 1IXSB 4D0PA 4KDPA 5E18F 2M45A 2LF8A 1CGPA 3IRQA 2VBYA 3OV8A 3KFWX 5DUKA 1ZLJA 1XGOA 2PN6A 5E1ZB 1B4AA 2L4AA 4AVPA 1J9IA 1LVAA 5H6RA 3KP2A 3TQNA 4R1HA 1D5VA 2EFQA 1K6OA 5ILVA 2FBKA 2D1VA 3CO7C 4CYDA 5JI6A 1LQ1A 2RN7A 3FMSA 4MEYF 1STZA 2VOPA 1FT9A 1SAXA 2JRTA 3P9IA 3K9TA 4O6JA 2AS5F 2ZBKA 5LRRA 3CTAA 1FC3A 4U0WA 2Y75A 1KGSA 2ZNYA 2P8TA 4Y15A 5FLXK 1DDNA 5JHUA 2A61A 3L09A 1WSUA 3LA2A 1SD5A 5L3DA 2JSCA 3Q9SA 2EB7A 2P5VA 1G3TA 3G3ZA 5DCMA 2CSOA 1NHAA 4ZYEA 3H3ZA 1FNNA 2ADUA 3E6MA 3K0LA 4ESFA 3DF8A 3QU3A 3BJOA 2IPQX 3B73A 1LEBA 1KU3A 5K5OA 3TO6A 2K4JA 1G6NA 2EFOA 2KJCA 3WTVC 1V3FA 1FP2A 2FRHA 2COMA 1ZREA 2JZYA 4A5NA 2V79A 1Z9CA 3FWEA 2OU2A 4WXHA 4I09A 1ZRDA 1XGMA 1YFHA 4OIOF 5J8CA 3GF2A 2FSWA 3CJNA 4IXAA 1E17A 3HTSB 5EEHA 1FX7A 4M72A 4BXUA 3MWMA 1J7KA 1I5ZA 1BOAA 1OYYA 4M9ZA 5L3GA 1UFMA 4L0ZB 4U88A 4MTEA 3TDUC 3O3KA 2IT0A 1IXCA 3GFIA 5FB2A 1BI1A 2G7UA 4P55A 2QM3A 3T8RA 2PFBA 4L9NA 5F64A 3DFGA 4L18B 3VOEA 2W84A 3EYIA 5FGMA 3FMQA 4IVNA 3TO9A 4M9SA 5HS9A 1HKTA 3KP3A 1K79A 2BE5F 4KA4A 4UVBA 3BDDA 2RGVA 2GXBA 5L3BA 1IN4A 1A04A 1IN5A 1OMIA 1DP7P 3FF5A 5LEJA 5FD5A 4PGGA 2NAZA 2PJPA 3IKTA 2XASA 3E3VA 1R22A 2IVMA 5ICGA 1FYMA 2HS5A 4LMYA 1XDUA 2HDCA 3BWGA 1ODDA 4IRGA 1RIOH 1MJAA 3LSTA 2XVCA 1QNTA 2FOKA 3J7AO 3M8FA 1TW3A 4MQVA 3ZMSA 5HOOA 3F6OA 2P4WA 3M1EA 4KT5C 5ICEA 1QO0D 1U78A 4AWXB 2NS0A 2H09A 3TOAA 1FP1D 4EGZA 2AXLA 4E70A 4XBFA 1SFUA 4FHTA 3RI4A 4WXCA 5BPDA 2FA5A 3V8KA 1D3YA 4ZZLA 4KN7X 3E5XA 1D8JA 5ILUA 2VE9A 4EMSA 3W6JB 1FZPB 1PP8F 5A2QK 3EYYA 1ZH5A 4KUMA 1LEAA 2OZUA 3PFIA 1C0WA 2H6BA 1MD0A 4BAYA 1U6GA 4JQFA 2XKPA 3LFKA 1O7LA 2Z33A 1LDKB 5LBQA 2GWRA 4I02A 5LGTA 4Y13A 1DUXC 3CUOA 4KIBA 4EVIA 2Z5UA 2J5PA 2ZNZA 4ENMA 4XSZF 5ICFA 2H27A 2MLKA 1OKRA 1HBXG 3WTZA 2XHKA 3I59B 3WTYC 2HWVA 5LHGA 3QRFF 3PQJA 2DPUA 2XIGA 1T0FA 4LK0F 5K5QA 2JPBA 4EJOA 5E17F 2DT5A 3KP7A 2PLYA 5H6QA 3KLNA 1V4RA 1R58A 1F4KA 1KU9A 3F72A 4IRHA 1W7PA 5LGNA 3BROA 3V8LA 4ESJA 3V7SA 2O0YA 4P5OA 1JHFA 2PI0A 3KCCA 2VXZA 1R5GA 4U7DA 2A07F 4MGRA 1XD7A 1P2FA 1YS6A 2LDUA 2P5KA 3JAMK 4O3MA 4L9TA 4N9HA 3DP7A 4F7ZA 2XRNA 5KVRA 1B59A 2QQAA 3RYRA 1XMAA 2DBBA 1J5YA 2IP2A 3P7NA 2STTA 4G7HF 4EM1A 1I1GA 4ENNA 3WTXC 1PUEE 2V9VA 3V4GA 4EM2A 1XCVA 2W25A 3QU6A 1BI2A 3FMRA 3NQOA 4ENKA 5HS7A 4HF1A 4UXNA 2WWYA 1FOKA 1ZG5A 4WX9A 4U7BA 3T5XA 4OMZA 1G3WA 1J0RA 3WE2A 4HF2A 2XAJA 3WTUC 2MD5A 4WK8F 4RGXA 3SHFA 1SD4A 1FY7A 2MLGA 1XSDA 2DQLA 2A5YB 1HKSA 2PBIA 3WTSC 1TQMA 3QP6A 3TO7A 3GVAA 4HBLA 3AAFA 2RDPA 1KYWA 5LRSA 1YG2A 3U9GA 2HKOA 4A2UA 4YFXF 1TNSA 2XV4S 2MH2A 4UNOA 4L9VA 2HTSA 2P5LC 2O03A 1EH6A 3E5UA 4L5JA 1RUNA 3KP5A 5L3CA 3F22A 3I64A 4HQEA 4YIFA 5FD6A 3KE2A 3RKXA 2ACJA 1H9GA 3HHGA 2NNNA 2ZMEA 4ZH4F 1XSVA 5CYVA 1JGSA 5FLXZ 4AIJA 2VC1A 1UHWA 1F1ZA 4HF0A 1GVJA 2KIMA 2B0LA 2MA3A 3NRVA 1K78A 2L4MA 3BOQA 1QGPA 2PMUA 5E8IA 3HRUA 1ZG3A 1SFEA 2GAUA 2OQGA 3IC7A 3QPTA 1ZAOA 5BMZA 4UVAA 1JHHA 3H3UA 4UUVA 3Q9VA 1U5TA 1IZ1A 4DNCA 4FT8A 1P92A 3DXJF 2P7VB 1ZRFA 1OYWA 2DU9A 2EV6A 3FZVA 4KN4X 2M87A 4ON0A 3ZPLA 3KP4A 4U0YA 4GYIA 3WODF 2DQRA 3F6VA 3L00A 2FE3A 3F21A 3I54A 3GFMA 5F6FA 3U2RA 3M7GA 1BJAA 2NNYA 2WV0A 3ABTA 2JPCA 1MKMA 1IUYA 1Z1DA 4HW0A 3I0TA 5HDGA 3KP6A 5ILSA 5DD8A 3GEZA 4UV9A 5BOXA 4HYEA 4OIQF 1YW8A 2ISYA 2VT2A 3M9AA 4L0YB 2WTEA 2IW5A 3TKYA 2FBHA 4WCGA 1BIBA 3F8FA 2Q2EA 2BYVE 2F5EA 4GO1A 2V1UA 1XGSA 1WKMA 1HKQA 2ISZA 3V7CA 1FBQA 1IRGA 1U3EM 1PP7U 2Q8KA 2R7FA 4WXDA 2FMLA 1U5TB 4ASNA 5E1XA 2BGCA 4EV0A 5KK1A 2CFXA 1KQ0A 3VFZA 5LHHA 3MCZA 2HQRA 1WRJA 4LD5A 4HLXA 1S6LA 2X0LA 5D5XB 2YPRA 3K69A 1CF7A 1USSA 4LLGF 2FNAA 5DEQA 3MEXA 3I5UA 3O6BB 2DW4A 4XLNF 1AWCA 5FO5A 5IT3A 3IRRA 1CF7B 2VODA 2UXNA 2P7CB 1LDJA 2MC3A 1O3SA 2DLLA 5D4SA 2CWEA 3F23A 2QBYA 3ABUA 2PG4A 5AONA 4IF4A 2QQ9A 3HTUA 1MJ9A 3FM5A 1QZYA 4HV5A 4PCQA 2EFNA 3Q5FA 3S2WA 1ON2A 1XGNA 1RZ4A 2Z3YA 1R00A 1HW5A 2D2WA 1HXDA 4GGGA 1J2XA 2OQRA 3RKWA 2GA2A 2O8XA 5CVVA 4LJZF 2A3SA 2M8EA 4RB2C 1P4AA 2KIFA 2EV5A 3COAC 2FQ3A 4CO8A 5E8GA 4LGWA 4MQ9F 2EJRA 4LG0B 3J80K 2E7WA 1MZBA 3BJ6A 3GLXA 2V1DA 2P6TA 3ZMTA 2M1BA 3J80Z 5DUIA 2RNJA 2DK5A 4B8XA 3CUQB 2QWWA 2HQNA 5ERIA 2YU3A 5LEKA 4MEXF 1TW2A 2FEZA 4TV7A 4EJUA 3HRTA 3K1NA 3R60A 4HA8A 2EWNA 4KFCA 3MZYA 4A6EA 4RB1A 2Z99A 2L02A 3K2ZA 4I98B 5AIPA 4IHTA 1P4XA 2GIVA 4FX0A 2JTVA 4CGZA 2V6CA 3RKYA 2F2EA 4EGYA 1FBSA 2DTRA 5CVJA 3TOBA 5IT9K 3L9FA 4R79A 3O2PE 4HOBA 1ZGJA 1K78B 2TDXA 1W7PB 3BY6A 3HRMA 2Y48A 3KEOA 2FU4A 1OR7A 4RB0A 4BH9A 3ZMUA 1B6AA 3HSEA 1KQ8A 3BJAA 2RV8A 6PAXA 2VT3A 2NRAC 1J59A 1E2XA 3JAMZ 3EQLF 1IRFA 1R7JA 1Z6RA 2RVCA 4YFNF 4P9FA 1S7AA 1UCRA 3SZPA 5CVRA 4DQ2A 4G94A 2Z9OA 1P4WA 1ULYA 2A6EF 3P9KA 3ZMVA 4G7OF 2H94A 3VEPA 4KIGA 1ZLKA 4HDVA 3WG9A 2ZO4A 5CLSA 1R36A 3H92A 5TJJA 5F1RA 2C6YA 3GWZA 1MGTA 5HS8A 1G3SA 2G9WA 4U0VA 4PDKA 2HYGD 2XKOA 2KKOA 4RGUA 3FHZA 2JT1A 1IN7A 4XSXF 1W7PD 5DDGA 4B09A 4JK1X 2BBYA 3EDPA 5HDKA 5BQTA 2LKPA 3IL2A 2XAQA 3GXOA 1K7AA 5LGUA 4CICA 1UB9A 3K1PA 1SMTA 3GO5A 3RYPA 1G4DA 4QWQA 2XAHA 1S7OA 2EFPA 4OINF 4L9JA 4YFKF 5CVUA 3WTWC 1UHMA 5TRDA 2QENA 4Y17A 1TBXA 3KZZA 1T38A 2PMHA 3WTTC 4HX7A 2O61A 2J5OA 1GXQA 4Q47A 5D8LB 3JTGA 1BC8C 3E5QA 3M8EA 1HQCA 1LB2A 3ZP5A 3C18A 4Q4ZF 4R8HA 4ZZDA 3EETA 3DEUA 1R23A 1RI7A 3KLOA 3WU0A 4BHCA 3WGGA 2M30A 4K2EA 5D6EA 1W5SA 2OD5A 3E6CC 1KYZA 4BHPA 3E6BA 2UZKA 3WGHA 2DK8A 2W57A 3VB2A 2IJLA 3V8JA 4MTDA 4GCVA 5D5VB 3LQRA 3VODA 2A68F 5JFRA 1B9NA 5HLGA 5K5RA 1YQAA 2K27A 2GXGA 5HDNA 4Z2YA 5K1YA 3RIRA 3ZN0A 3F8MA 4KIFA 1XN7A 1IN8A 1BM9A 4PZJA 3ISPA 3DPLC 3W6KB 3GFLA 3FXQA 2VONA 1AOYA 2LNBA 1TLHB 3F3XA 2LSOA 2Y0MA 5HVQC 1YYVA 2E1CA 4KMFA 4OU0A 3LWFA 3HOSA 2HFHA 3SFZA 2ZXJA 1R1TA 2X4HA 1I27A 4NHJA 1O3RA 2HTJA 1KU7A 4MNUA 4NB5A 2QBYB 4WWCA 4GXOA 2XUBA 2BEOA 2YX4A 1G3YA 5E1WA 3FX3A 1ZN2A 4OIRF 1FBUA 3SZTA 1BIAA 2PEXA 3MQ0A 5DYMA 4IJAA 3QPHA 3JTHA 4NQWA 4LFUA 3QP5A 1T6SA 1S3JA 2CW0F 3F8BA 3J81Z 4AIHA 4IHSA 2V1XA 1ZHFA 5L3FA 2F5CA 1GHCA 1YW7A 3K1MA 1YTYA 1OYIA 1XDSA 1EH8A 5D8KB 2NYXA 1FYLA 1TQPA 2HOEA 3KEQA 4OOIA 1QQIA 1IN6A 1W5TA 4I7HA 2H6CA 1EV7A 2BV6A 2O3FA 4YG2F 3ECOA 4M6YA
chains in the Genus database with same CATH superfamily
3ZMDA 5HLHA 1POGA 2PMZA 1QA6A 2FNPA 4N9IA 3TL4X 4HQMA 1D8KA 2D5VA 4A3BJ 5FFXA 1F5TA 2CYYA 2EA2A 3F8NA 5EDNA 3A02A 3CO6C 1S29A 2ID3A 1Y1VJ 2K4BA 2RREA 2ZXIA 1R1UA 2A69F 2FXAA 2HYFA 3HSFA 5D5UB 3LSKA 5GAEJ 4BJ6C 2XAUA 3BZKA 4XK4A 2QZ8A 4RAYA 1IDYA 1Y1WJ 2FBIA 3S93A 2FD5A 5H20A 3H0DA 4IQJA 1ERDA 3K4LA 3KZYA 2Y31A 3F0CA 2FF4A 5JVTA 1QBJA 2WBMA 2MG4A 1O7FA 2KJBA 2R0QC 5L3EA 5GAGJ 1YO5C 3RZOJ 3B6AA 1D5YA 2GQQA 3BPXA 5IPAA 4PGHA 2PQ8A 2R7UA 2IS6A 2DMTA 4G7ZF 1V5FA 1SFXA 3BG6A 2VPLA 1RUOA 1K4TA 4CYCA 3ESWB 3AG3H 4IQ4A 3RJPA 2K40A 3JW4A 2VKVA 4S05A 3ZOBA 2HZTA 3GUDA 1FOWA 3GYHX 4KNYA 1VTNC 2O9LA 3LQQA 4NC7A 3NARA 1QZZA 5J40A 2XAFA 2QQBA 4MLOA 3S16J 1FSEA 1VI0A 2BY1A 1T56A 3CUQC 1FWZA 5ED4A 3BTCA 1IF1A 1PDNC 4BQQA 1IW7F 4RM2A 1OCRH 4KMUX 3JREA 2EA4A 1AKHB 1XS9A 3CQZJ 3R4KA 4RB3C 4ZDPA 3ZN1A 1ZKGA 3DLLF 4ZYHA 2JSPA 2ZFUA 2CUEA 3ZMZA 3HOUJ 3CESA 1S7EA 4F92B 3F8CA 2EZHA 2DA4A 2O6GE 2VN2A 4S04A 2HOSA 1OCTC 1OCPA 2QLZA 4XNFA 4BUPA 4CCKA 4CHUA 5EEAA 3ECHA 2VI6A 4JOMA 4RGRA 2K86A 1WVRA 2R92J 2LF7A 4CDGA 1ZG1A 1Z3YA 2W48A 3C1DA 1D1CA 1JE8A 4RAGA 1OPCA 1WCMJ 2H1LA 3A01A 2MH9A 4WF2A 3KPHA 2YR2A 3RDIA 5DCMB 2IA0A 2DAOA 3QOEA 1AA7A 4RLFA 2M9HA 1U2WA 3LSHA 4EJWA 1HSJA 1PUFA 3FKIJ 4CUGA 5J47A 1NK2P 2HQAA 4A0YA 3CCQI 2WAFA 3LSMA 2VJIA 1LJ9A 1F36A 2BZTA 4LB6B 3OR2C 3CC4I 1WJFA 4LG0A 1B8IA 5FJ8J 1W0UA 1MJBA 1TWGJ 4JX6A 4XMYA 5FKNA 3WU1B 2EFWA 4IRIA 4LLLA 4AIDA 2L7KA 1OISA 1BBYA 1WH5A 1ZELA 4A6DA 1MBJA 2F5DA 2LC2A 2D1HA 4BHBA 3ML6A 3E97A 4P96A 1XMKA 3GLLA 4QLCU 3I59A 3MFKA 3SQNA 5CKTA 3HRSA 2OTLI 1R4MB 3JSOA 4XRSG 3EUHC 3CF2A 4MHGA 3ERED 1Z91A 2KDZA 2M5WA 1I39A 1BC7C 3OYBA 3S1NJ 2B9SA 3GZ6A 5LFAA 2EV0A 1O3TA 4UHTA 4DYQA 1WPKA 4B3XA 3DCFA 5J3LA 1T39A 3CCJI 4ENJA 5F0FA 1ETOA 5CQGA 3TGNA 1MMDA 5A2QZ 3LAPA 2EK5A 1I1SA 2WB1A 2X85A 4J19A 4DW6A 5BS6A 4PFOA 1X2MA 1RNLA 2ESHA 2FMYA 5FFZA 9ANTA 2DFEA 3D0SA 2W24A 4DJAA 3ZQFA 1VQ5I 2NXNB 2KZVA 1U5TC 1T95A 1HSTA 3A2KA 4UB8C 2EZKA 2DCEA 3RCOA 3RPUD 3TDZC 2R4GA 1ZR4A 1FPQA 2RC4A 3L1PA 2R7SA 3MAJA 3H9GA 3OYFA 4W1UA 2R3SA 4B4CA 2ZSIB 3LA7A 4NQWB 2CFOA 3H5RA 4IO9F 3UNGC 1KA8A 4ESBA 2IA2A 1Y56A 2KMUA 5D5WB 1L0OC 4M71A 5KAFC 1K61A 1Y8QB 3BPVA 3CCEI 2L0KA 3ZQ7A 1SFKA 2UV1A 3N97A 3FXOA 1D1BA 3HIFA 1YLFA 1T98A 4CZCA 4GDFA 1Z05A 1DPRA 1P9QC 2VOOA 3LFUA 1IO2A 3I55I 2RQPA 1SMYF 4M9XA 1XCBA 4A0XA 3CUQA 2DPDA 2LBFA 4DOZA 1MH3A 3QYFA 2M7BA 3PSFA 4V19K 2ZMEB 2IRFG 2L3DA 2E1NA 3ROUA 3HEFA 2HR3A 1BI0A 3IH2A 3A1YA 1D0XA 3A4CA 4KICA 3OYGA 2RAEA 4B47A 4RGSA 4RS8A 4HLYA 1HW1A 1ETQA 2K02A 2CU7A 3L7WA 3QAHA 1ZARA 4CCMA 4MO7A 5EG0B 3FXMA 2GZWA 5JR3A 5HODA 1SD7A 5F27A 1MBEA 3P9CA 1LFBA 3IKVA 3QPSA 4YRVA 3G73A 4BYYA 1MMSA 1HW2A 3CF5F 3NEUA 5CVIA 1JJ8C 1BN5A 2H8WA 3PJRA 3R6SA 4NBQA 1H0MA 3DQVC 2QVOA 3KETA 3HJEA 4G8XA 2RKHA 1LDDA 3AG2H 2GIZA 2ZMEC 5J6XA 2COBA 3IAS2 4LG3A 4BQOA 2OBPA 1RR8C 1IXRC 2WB1N 1J75A 3GW2A 2R7ZJ 2QUFA 4IL6C 4HDUA 1MNMC 5J1UA 2Q2EB 3JRGA 1T2KA 1ACIA 2I5UA 2QYOA 1MDMB 1FYKA 4ZYGA 1H9TA 3K2AA 4A93J 3VPRA 2BOLA 4A12A 3N4MA 3IWZA 2Z1DA 3CLOA 1YW9A 1GXPA 1VQOI 1P7IA 2LLKA 5LLQA 2P81A 3J81K 2R7DA 5BPIA 3T8TA 4QTRA 2D45A 2VBZA 2ETHA 2ZKZA 3ELKA 2KT0A 3I58A 4E7KA 1Y0UA 2G7HA 1U8RA 1O57A 4HRIA 3H35A 2VBWA 3I4PA 1FLIA 3BTLA 3ULQB 2P6SA 1UMQA 2CG4A 4I0AA 4D1QA 2UWMA 2ESNA 2I10A 2ELHA 2YX7A 3HSRA 4LK1F 2DI3A 1ZRCA 2R7OA 4HV6A 1EA3A 3OS1A 2JMWA 2BVMA 1NG7A 1Y6IA 3OOPA 1TZLA 1FTTA 3D5LA 1W4MA 2DJIA 4CXFA 3PUFA 2MBFA 2OAZA 3PQKA 4EJTA 4XL9A 3HYIA 3I71A 3QOPA 4IOAF 2K9LA 4KYWA 4HZFA 4F52A 4P9UA 1VFCA 3AFHA 2CW7A 3LAJA 3DU5A 3BQZA 2QQ8A 3RTRA 4Q48A 5J8FA 1MDMA 2ELJA 4I0BA 2KPMA 1ITYA 4HNUA 2W85A 3SFIA 2V7FA 2STWA 3S1QJ 4Z6YA 4XKWA 3DPTA 2VBXA 1MBGA 1QPMA 2BHZA 2I8DA 4I99C 2KRFA 1LNWA 2JA7J 3GX4X 2RNGA 4XLPF 2L7FP 1SAUA 5ICCA 3KYLA 5DCFA 3EUHA 1EH7A 4M73A 1Z6TA 1BW5A 3C7JA 2ZFWA 4XM3A 2A05A 4JBAA 1L3LA 1YHQI 4I01A 1SFOJ 4XOTA 1IGNA 1WQ2A 2UUZA 4XKBA 2KISA 3CP2A 2R93J 1LVKA 5IOYA 2M3AA 2OV7A 2HGCA 2LH9A 1OCOH 5EEGA 3I53A 2CQKA 1VQ7I 4CZZA 2F48A 4OAZA 2GA1A 3GZ5A 4BY1J 4ZC3A 3Q3SA 2DODA 2E71A 3HOYJ 4YIIA 1SD6A 3S3NA 2VC0A 3CDIA 2L5QA 2E1MB 2M0MA 3OYEA 3R0JA 1YS7A 1ONVA 3JSPA 3CLQA 4M3EA 3WGIA 1YIOA 1DQUA 2VUMJ 3LSRA 2OPTA 1F43A 1K6YA 4M3GA 4BE2A 4OMYA 3B02A 4BGDA 2LD5A 3ZR8X 3CJTB 2GOXB 4O5VA 1XB4A 5HLIA 3PUBA 1YX5A 3K10A 1I6XA 4M6XA 4G6QA 4G6DA 2QSGX 1REPC 3HOWJ 1ZYRF 2B7EA 2ZCWA 3TP3A 3CC7I 5EF6A 1FSHA 2WAQN 1OR7C 1NK3P 2Q0OA 4GYGA 3V7RA 3GFJA 4RDUA 1MMGA 4V2FA 4HAMA 4JX4A 3MZHA 1TT0A 1VQ8I 1DPUA 2HKXA 1XSXA 4LB5A 1FEXA 3REOA 3S8PA 1ZTRA 2KZGA 1U9OA 2KFDA 1TP4A 3BP8A 1S5LC 5GPAA 4EM0B 3SXYA 5F04A 1B9MA 2OCCH 2XROA 5FKOA 3K4KA 4BNCA 1MNDA 3DKWA 1Q1HA 3HUGB 2W82A 4IHYA 2BXZA 1EKEA 4EJVA 3HUGA 2JA6J 4LLNA 1B1BA 2R7TA 2Y0SN 4N0BA 3OSFA 4BKXA 2KIUA 2DMUA 1H89C 4H0EA 3DV8A 4HX4A 3U1DA 5E3MA 1EF4A 1ZGAA 5D4RA 2OZ6A 2CO5A 2KIQA 1GV5A 4M74A 1WI3A 3W2VA 1IAWA 2XGEA 3BZ6A 4IEJA 4FCYA 3IWFA 1P6RA 3BR0A 2UXXA 5BNGA 2DMQA 5J1RA 2TRTA 4ETSA 4BXXJ 4I2OA 1TQIA 2L01A 4UVCA 1IJWC 2DO7A 1WI9A 4FX4A 1X1BA 2Y69H 3K4NA 4LIVA 3VSKA 2F5FA 3EUKL 1R5HA 2X48A 5AIQA 1G59A 3MKYB 3WE3A 2XB0X 2OA4A 2DA3A 1KU2A 2YSRA 2VL8A 4CSWA 3HOZJ 1H88C 4G9YA 4ABZA 2K7LA 4MFDA 1KQ9A 1JXSA 5D6FA 5IT9Z 3C3WA 1D0YA 4HNTA 3A01B 4C3HJ 4EQQA 3RZDJ 2BY2A 5DD4A 2A6HF 3G2BA 1ON1A 3FM3A 3R61A 4OIPF 2Z2SB 1D1AA 2LRDA 3G71I 3CDHA 3T1BA 3LA3A 4A69C 1HLVA 4A5MA 2IA1A 2VQHA 3BTJA 4GRIA 4D5CA 1X4OA 3BR3A 3IHUA 1WJDA 3E6DA 3G6EI 5M3FJ 1TTYA 2XAGA 3HOTA 1S8NA 1Z0XA 2XGXA 3KYCB 3L2CA 1QU3A 1TNTA 3R0AA 1BW6A 2CUFA 2MFZA 4L5IA 3GZNB 4XRFA 1BI3A 3HHHA 4AD9A 4M3BA 1USTA 2BXYA 1Y0NA 4UV8A 4HX8A 3T0YA 3FXUA 4Q5SF 1Z7UA 2AXTC 2DFIA 2GOMA 5LHIA 2CGPA 3BCAA 5E20A 2WV1A 3RPUA 4BQAA 2X1CA 4XN3A 3BC8A 3OYIA 1O3QA 4ZYDA 3U1KA 2ECCA 2WC2A 2AQEA 4BL0B 3I56I 1OCZH 1XX5A 2HI3A 2VE8A 4A0ZA 2E7XA 3RPQA 1WWXA 2ZJ2A 1X58A 2MGQA 3FXRA 1ZK8A 4IPAA 4AIKA 2DJNA 1R1VA 4RAZA 1X3UA 5DV5A 2JJ7A 3FISA 2O8KA 2JA8J 4KT6A 1F9NA 2HEOA 2IS1A 5CJ9A 3KZIC 1YJNI 1YJ9I 2HYJA 1IXSB 1WH7A 4D0PA 4KDPA 4F91B 5E18F 1ETWA 1WGXA 2M45A 2PMZN 3BG3A 1XPXA 2ZJRF 2NOJB 2LF8A 1U8BA 1CGPA 3IRQA 2VBYA 4L5EA 2X1DA 3OV8A 3KFWX 2V4JC 4UB6C 5DUKA 3MKLA 1ZLJA 1OLTA 1XGOA 1GV2A 2NVTJ 2PN6A 3HOXJ 3H5NA 4U87A 3FHNA 2DDBA 1FOYA 5E1ZB 1B4AA 2L4AA 4AVPA 2LY1A 4F3QA 1J9IA 1LVAA 5EYRA 5H6RA 3KP2A 2KHMA 4OWRB 3TQNA 2EZIA 1YE9A 3CCSI 2OF7A 4M6YA 4R1HA 3PNTA 1D5VA 2EFQA 1K6OA 5ILVA 3ONQA 2FBKA 3TP0A 3QODA 5E3OA 4BU2A 3HM5A 2D1VA 1A36A 3CO7C 2Y2ZA 4CYDA 1W0TA 1W36C 5JI6A 2X6OA 1KZHA 2JVHA 1LQ1A 1G8XA 2RN7A 3FMSA 2XF6A 2LKSA 4MEYF 1STZA 1TWCJ 1K4SA 2VOPA 1XG1A 1FT9A 3BZCA 2M7AA 1SAXA 5F0HA 2JRTA 1TT5B 3P9IA 3K9TA 4O6JA 2AS5F 4QSHA 2ZBKA 4BXFA 5LRRA 3WHBA 3CTAA 1FC3A 4U0WA 2Y75A 1KGSA 2R7QA 2ZNYA 2P8TA 5B3SH 4HSTA 2E35A 4Y15A 5FLXK 1DDNA 1K83J 5JHUA 1N75A 2A61A 3L09A 3FK6A 1JT6A 2L9RA 2R7WA 3TMOA 1WSUA 3LA2A 1SD5A 5L3DA 2JSCA 3Q9SA 2EB7A 2P5VA 1G3TA 2DYSH 3BG7A 3WU2C 4XONA 1UJ8A 3G3ZA 5DCMA 2CSOA 2G0EA 1JGGA 1RKWA 1NHAA 4ZYEA 2GXAA 1GDTA 3H3ZA 1FNNA 4B48A 2O5RA 1LKXA 2IAIA 5C3EJ 2ADUA 3E6MA 2PJRA 3K0LA 2ME6A 1SC7A 2VQGA 3SZGA 3OOUA 4ESFA 3DF8A 2RQQA 3B6CA 3M3YJ 1WHUA 3QU3A 1I6HJ 3BJOA 2IPQX 3B73A 2CQ7A 2DA1A 3FIWA 3OMYA 1LEBA 4NC8A 3GBGA 2XPUA 1KU3A 5K5OA 4BBSJ 3TO6A 1UG0A 4XLAA 1GUUA 2K4JA 1G6NA 2EFOA 5E79C 4YEJA 2OC6A 4FISA 2KJCA 3JRDA 1HA8A 1AKHA 3WTVC 2Z16A 1V3FA 1FP2A 3RQIA 2ME0A 2FRHA 2COMA 4XLEA 3HBLA 1ZREA 3ZCOA 3LOCA 2JZYA 4A5NA 2V79A 1Z9CA 3FWEA 2OU2A 4WXHA 1JJ6C 4I09A 1ZRDA 1XGMA 1YFHA 4OIOF 5J8CA 3GF2A 3M1CA 2CRGA 1DP3A 2FSWA 4B1RA 3CJNA 4IXAA 3GTMJ 3H9QA 1BOBA 3CCYA 2QSFX 2JRMA 3H9JA 5KNLA 2LVSA 3OY9A 1E17A 4AU7A 3HTSB 5EEHA 4X1EA 2VKHA 4C2MJ 1FX7A 4M72A 4BXUA 3JRBA 1U0JA 3MWMA 1J7KA 1I5ZA 2CH0A 4ANJA 1BOAA 1OYYA 4M9ZA 5L3GA 1UFMA 2ZJPF 4L0ZB 2L2OA 4U88A 4KISA 4MTEA 3DEWA 3TDUC 1WJ5A 4QIWN 3DBLB 1D0ZA 1JI8A 3O3KA 4HSRA 2IT0A 1IXCA 3GFIA 5FB2A 2KQRA 1TL8A 1BI1A 1LFPA 2O7OA 2DA5A 2G7UA 4P55A 2F4MB 2QM3A 3T8RA 3RKQA 2PFBA 4L9NA 2CW8A 5F64A 3DFGA 5K7ZA 2W7NA 3VOEA 4L18B 2W84A 3VYUB 3EYIA 5FGMA 4E7HA 3ABMH 3FMQA 5K7HA 4IVNA 3S15J 3TO9A 4M9SA 5HS9A 3HC7A 1I3AA 1HKTA 3OS2A 3KP3A 3OYAA 1QHGA 2BE5F 4KA4A 1K79A 4UVBA 3BDDA 1VNDA 2H8RA 2JUCA 2RGVA 2GXBA 1X1PA 1UZCA 3F9KA 4BACA 5L3BA 1IN4A 1A04A 1IN5A 1OMIA 1DP7P 1GVDA 1RPWA 2R5ZB 2L9NA 3FF5A 5LEJA 5FD5A 3CP8A 1RETA 4PGGA 3H5AA 2NAZA 3NAUA 2PJPA 3P5JA 3IKTA 2XASA 3OL3A 2LY9A 3AG1H 3E3VA 1R22A 2IVMA 2EILH 2OJED 3O8GA 4NNJA 5ICGA 1FYMA 1WZ2A 2HS5A 1JTXA 4LMYA 4E7SA 2GBYA 4HNVA 1OJLA 1XDUA 5GTIC 2HDCA 3BWGA 3PO2J 1ODDA 4G6TB 4IRGA 1RIOH 1MJAA 5E3LA 3LSTA 5M5WJ 5LD2C 3Q0VA 1HDPA 2XVCA 1QNTA 1X2NA 3K4CA 4M3FA 3S2HJ 1JUMA 2FOKA 3J7AO 4KITB 5GTHC 1VQNI 3M8FA 4BS9A 1TW3A 4MQVA 1ZR2A 3ZMSA 2EQRA 4E7JA 2DT6A 2K9MA 3HKZN 5GADJ 4A3LJ 4UUSB 5HOOA 1FJLA 3F6OA 4XRSA 2LY2A 3ZQGA 3GTJJ 1R71A 4DBQA 2P4WA 4UUTA 5EGOA 1YITI 2LBFB 1TWFJ 3IH3A 3M1EA 4KT5C 5ICEA 1QO0D 1U78A 4AWXB 2HQ5A 2NS0A 1LE8A 2H09A 3TOAA 1DGWY 1FP1D 1VF9A 2ECBA 4FTHA 4EGZA 2AXLA 4E70A 4XBFA 2AQFA 4LIUA 1WJEA 2HOTA 3FDYA 4ZTJA 1SFUA 4FHTA 3S3OA 4RA2A 3RI4A 4WXCA 5BPDA 4IOCF 2FA5A 1XC5A 3V8KA 1APLC 1D3YA 1B8IB 5C4XJ 4ZZLA 4KN7X 3E5XA 1JKQC 1D8JA 3BQYA 4EMSA 5ILUA 2VE9A 2OUMA 3W6JB 2E2HJ 2KP6A 2M8GX 5FRNA 3CDLA 1O4XA 1PP8F 2QGUA 1X4PA 1FZPB 5A2QK 3EYYA 1ZH5A 4KUMA 1LEAA 3FXJA 2OZUA 1V55H 3PFIA 1C0WA 2H6BA 3X2QH 1MD0A 4BAYA 1U6GA 4JQFA 4II3A 1QPIA 2XKPA 2MW8A 3G1MA 4XRMA 3LFKA 1O7LA 4FE7A 2Z33A 1QVTA 4B43A 1LDKB 5LBQA 2LTPA 3RQ4A 4CYCB 2GWRA 2CQXA 3DU6A 4I02A 2GLOA 3S1MJ 1HC8A 4C2TA 4KJZA 5LGTA 4Y13A 4XORA 3IAM2 1DUXC 1BR4A 3CUOA 4KIBA 5B1AH 4E7ZA 4DYRA 1SANA 4D5FA 2R5YB 4EVIA 2Z5UA 2J5PA 2ZNZA 2DMNA 4ENMA 4XSZF 3VYRB 3IUOA 5ICFA 1RR7A 2H27A 2MLKA 1OKRA 1HBXG 3WTZA 2XHKA 3I59B 3WTYC 2HWVA 5LHGA 2XSDC 5IP9J 3QRFF 3PQJA 3E7LA 2EINH 3TEDA 2DPUA 2XIGA 3CD6I 4B3AA 2K5CA 1IDZA 3D1NI 1T0FA 4LK0F 4BEHA 5K5QA 3OR1C 3EUAA 2JPBA 2V9PA 4EJOA 3BR1A 3V42A 5E17F 2DT5A 2QSHX 2CS3A 3KP7A 4DGWB 3IH4A 5HNHA 2PLYA 3K7AJ 5H6QA 3KLNA 1V4RA 1R58A 4Y4RA 1HDDC 1BL0A 3BR2A 3ZGKA 3OIQA 2HVSA 2EIJH 5DM7F 5JHFA 1F4KA 1IV6A 2IGOA 1KU9A 3F72A 4IRHA 4XOPA 1M1EB 1W7PA 3BLYA 5LGNA 3PIOF 3BROA 5GP9A 3V8LA 1ORKA 2F6CA 4DIQA 1NTCA 3M07A 4ESJA 2IXSA 4ZYAA 3CCRI 1TC3C 3V7SA 2O0YA 5IYBJ 4P5OA 2L9SA 2EIMH 2DT7B 1JHFA 4ZTFA 2PI0A 3KCCA 2VXZA 5HLTA 1R5GA 4U7DA 4OAYA 2A07F 4MGRA 2NOGA 1XD7A 1P2FA 1I50J 1YS6A 2LDUA 2P5KA 4PJLA 5DTDA 3JAMK 4O3MA 4L9TA 4N9HA 1WJAA 1P7JA 3DP7A 4NC6A 4F7ZA 2XRNA 5KVRA 1B59A 2QQAA 1N25A 3RYRA 3ZQLA 1XMAA 2DBBA 1J5YA 1QRYA 2IP2A 3FXLA 3P7NA 4IHXA 2EIKH 1MMAA 2LP0A 2ZB9A 2STTA 3QYEA 4G7HF 4EM1A 3W2AA 1I1GA 4XLFA 4ENNA 3MMYB 3WTXC 1DU0A 1PUEE 4LITA 2K3PA 2V9VA 3V4GA 4EM2A 1XCVA 1VQPI 1MIJA 2MYSA 2W25A 2WY8Q 1BI2A 3QU6A 3FMRA 3OYCA 3L2QA 3NQOA 4ENKA 1DU6A 3SEQA 1LUJB 4G12A 5HS7A 4HF1A 4UXNA 2DDAA 2WWYA 4ZDOA 3OWTA 1B72A 2E2IJ 1QZEA 1FOKA 1ZG5A 2NVXJ 1IRZA 1KONA 3G4SI 3ZQHA 4M3DA 4EATA 3VYSB 4WX9A 3NWSA 4U7BA 1E3OC 3T5XA 2DOAA 2CMPA 2XDVA 3A0HC 4OMZA 3J7AY 1Z21A 1AU7A 1G3WA 1J0RA 3WE2A 4HF2A 1YI2I 1G2HA 2XAJA 3WTUC 2MD5A 3OYMA 3LSGA 4WK8F 4RGXA 3E1SA 3SHFA 2E1MC 1SD4A 1FY7A 2MLGA 1XSDA 2DQLA 2A5YB 2JQ7A 1HKSA 2W00A 1ETYA 2PBIA 1R9TJ 3Q0UA 2XGCA 3CCUI 3WTSC 1TQMA 3QP6A 3TO7A 3GVAA 1HCRA 2A6TA 4HBLA 3AAFA 2XF5A 4XLCA 1MBKA 1WJCA 2RDPA 2WAQA 3O8HA 1KYWA 1UG2A 1MSEC 1PJRA 2LK2A 5LRSA 1YG2A 3LSIA 3U9GA 2HKOA 3ABKH 2NS7A 4A2UA 3SDGA 2VKEA 3BT9A 1TNSA 4YFXF 3PL8A 2XV4S 2MH2A 4C3JJ 4UNOA 1SVOA 4L9VA 2HTSA 2P5LC 2O03A 1E3HA 2H1KA 1OFCX 1EH6A 2LMDA 3E5UA 3L2WA 5KHDA 4L5JA 3KP5A 5L3CA 3F22A 1RUNA 3I64A 4HQEA 1QHHD 4YIFA 2TCTA 5FD6A 4FETA 3KE2A 4UY8I 3ZQQA 4BJTA 3ZQCA 4JX5A 4D9JA 3RKXA 3CJRB 3AKZA 3SJMA 2ACJA 1H9GA 3QQAA 3HHGA 1Q1VA 3OYHA 2NNNA 2AHQA 2ZMEA 4DZJA 4ZH4F 3W6VA 1XSVA 5CYVA 2WAEA 3S32A 1BR2A 1JGSA 5B66C 3VSLA 5FLXZ 4J01A 4AIJA 4E6KG 4FASD 2VC1A 2XC7A 1UHWA 2KRCA 1F1ZA 4HF0A 1GVJA 3RSNA 2QA4I 4ITVA 2KIMA 2VQCA 1VQLI 2B0LA 4XN0A 3OL4A 2MA3A 3NRVA 1K78A 4UUSA 2L4MA 3BOQA 1QGPA 2PMUA 2BW3A 5E8IA 3HRUA 3BR6A 1ZG3A 1SFEA 4PJJA 2GAUA 2OQGA 3IC7A 1Y39A 3QPTA 1ZAOA 1XTAA 4V2GA 1X3ZB 5BMZA 4UVAA 1SEUA 1JHHA 3H3UA 1R5ID 4UUVA 1FTZA 3Q0WA 3L2VA 3GMEA 1Z7LA 3Q9VA 1U5TA 1IZ1A 4DNCA 1MH4A 2KDOA 4DYCA 4FT8A 3J7YJ 2JA5J 1N78A 2YS9A 1VQ4I 4A3IJ 2EPFA 1P92A 4ZDLA 4IZZA 4Y33A 3DXJF 2DYRH 4E7IA 2E5NA 2P7VB 1ZRFA 1OYWA 2DU9A 2EV6A 3C2HA 3FZVA 4E4HA 4KN4X 2M87A 3HPHA 3ASOH 4ON0A 5HNFA 5GPCA 3CCMI 5GAHJ 4RAFA 4CH7A 3ZPLA 3KP4A 3W3CA 4U0YA 3G1LA 4GYIA 5F0CA 2OCEA 2NVQJ 3WODF 2AO9A 2DQRA 2IS2A 2DFFA 2ELKA 3F6VA 2VJ4A 3L00A 3OIOA 4BY7J 4ZJZA 1JT0A 2FE3A 3F21A 4IHWA 3I54A 4A3GJ 3GFMA 5F6FA 1JKRC 3U2RA 3L2RA 3M7GA 1BJAA 2NNYA 2P0WA 2WV0A 3HB9A 3ABTA 1T33A 2JPCA 5CPRB 2JK3A 1MKMA 1IUYA 4PSWA 2XSJC 1Z1DA 4HW0A 3I0TA 5EZHA 2K3FA 2LREA 5HDGA 3I3LA 3KP6A 1ETKA 2CJJA 2F4OB 2HOAA 2JUGA 5J1YA 5ILSA 1W1WE 5DD8A 4CA0A 3TBIA 3GEZA 4UV9A 5BOXA 4HYEA 4OIQF 1EJ9A 1YW8A 1RKTA 2M4GA 4W97A 2ISYA 3MN2A 5K7FA 1Z77A 2VT2A 3M9AA 2X6WA 3JR9A 3C2GA 4CCNA 1T8IA 4IHVA 3BG5A 4Y7NJ 4QPOA 4HG2A 4L0YB 2WTEA 2IW5A 2EH3A 2X6YA 1PVEA 5EZGA 3JRIA 3TKYA 5FKKA 2FBHA 4WCGA 1BIBA 3F8FA 2Q2EA 2BYVE 2K9NA 2F5EA 3UR3C 3S2DJ 4GO1A 5C4JJ 1IG7A 2Y30A 4BE1A 4A3JJ 2V1UA 4N4OB 1S9HA 1XGSA 5JLWA 1FMVA 1ETVA 1E0EA 1WKMA 1HKQA 2ISZA 2FOWA 3V7CA 1FBQA 1IRGA 1U3EM 2DOFA 1PP7U 2Q8KA 1GLNA 3BR5A 2R7FA 1FIAA 4WXDA 4Y3OA 1R6RA 1UELB 2DFHA 4GFBA 3MVPA 2FMLA 1HF0A 4BBRJ 1U5TB 4JP0A 3SYTA 4ASNA 2V6EA 3WG7H 1JKPC 5E1XA 2BGCA 2K85A 4EV0A 5KK1A 2CFXA 1KQ0A 2PJRB 3DEEA 3VFZA 3ZRGA 5LHHA 3AL0B 4XICA 3JRAA 3MCZA 2HQRA 1WRJA 4LD5A 4AYBN 4HLXA 1S6LA 2X0LA 5D5XB 3LSJA 5IOZA 2YPRA 3K69A 4CCJA 3W2WA 1AHDP 4P1WA 1CF7A 1USSA 2HXOA 4LLGF 2CV2A 2VJJA 2FNAA 5DEQA 3OYDA 3MEXA 3I5UA 3O6BB 3CC2I 2DA7A 2DW4A 2MD0A 4XLNF 3D5RC 3HGYA 1AWCA 5FO5A 5IT3A 4DZPA 2QEXI 3IRRA 4II2A 3ZXSA 1CF7B 2VODA 3QWLA 4A3CJ 2UXNA 2P7CB 4X0GA 3K70D 2KRHA 4D7NA 1LDJA 1T08B 2IGKA 3I9V2 5C44J 4F55A 4IKFA 2X1EA 2MC3A 2DLLA 1O3SA 5D4SA 2CWEA 3FXKA 3F23A 2QBYA 3ABUA 2DN0A 2PG4A 5AONA 4IF4A 3KX2A 3DKXA 3M8JA 2QQ9A 3DLAA 3HTUA 4NDLA 2NS8A 1MJ9A 3FM5A 4MIMA 2JVGA 1QZYA 4HV5A 4PCQA 2CV0A 2EFNA 3Q5FA 3I4NJ 3S2WA 4D7MA 5IP6A 3HGGA 1ON2A 1XGNA 1RZ4A 2M4KA 2Z3YA 1R00A 1HW5A 2D2WA 1MSFC 2CV1A 1HXDA 4GGGA 1FIPA 3HZJA 1J2XA 2JN6A 2ICWG 5DM6F 2OQRA 3RKWA 3PSIA 2VKDA 2VLAA 2GA2A 4YELA 3FBNB 2O8XA 3OYLA 4RMNA 1FOXA 3SDBA 5IP7J 5CVVA 2YU9J 4LJZF 2A3SA 2HU9A 1NH3A 2M8EA 1U9NA 2A5WA 1E3PA 4RB2C 2IGMA 1MBHA 1P4AA 3FKJA 2MABA 3PM1A 2KIFA 2EV5A 2Y0SA 3COAC 4C30A 2FQ4A 3N05A 2FQ3A 4CO8A 5E8GA 4LGWA 2FX0A 4MQ9F 5KCMA 2ZJQF 2EJRA 3DBRB 4LG0B 4XLHA 3BTIA 4AM3A 2DOEA 2E7WA 3J80K 1MZBA 3BJ6A 3GLXA 3J7ZI 2V1DA 2IGNA 4RBOA 2NVUB 1PUFB 4C9YA 3PIPF 2P6TA 3OYNA 3U21A 3ZMTA 2FUG2 3PO3J 1A6IA 2M1BA 3J80Z 5DUIA 1RRJA 2E5ZA 2RNJA 3TW7A 2DK5A 3GTOJ 4A3KJ 4B8XA 2IEKA 3CUQB 2X9DA 5FKLA 2QWWA 2HQNA 2W1OA 5ERIA 3HXLA 3K6GA 2B63J 3G1OA 3JRCA 5JVGF 1XMXA 2YU3A 5LEKA 1YX3A 3VDXA 4NUBA 4MEXF 2OTJI 1TW2A 3JRFA 3EPZA 4IX7A 2FEZA 1YRNA 2R7XA 4TV7A 4QPQA 4EJUA 3HRTA 1W5CC 5B1BH 4DBRA 3K1NA 4XKCA 3R60A 4HA8A 2IS4A 1MNEA 2EWNA 3S1RJ 4KFCA 1ETXA 3MZYA 4A6EA 4RB1A 2Z99A 3H1CA 2L02A 1A35A 3OIPA 3K2ZA 4I98B 5AIPA 3ABLH 1PYVA 4IHTA 1P4XA 2X6XA 4A3DJ 2M0CA 5M5XJ 2GIVA 3GTKJ 3DKYA 1JTYA 4FX0A 1Y8RB 1BA5A 2JTVA 3KEYA 4CGZA 3S14J 2V6CA 3OS0A 1FMWA 3K70C 3RKYA 3TW6A 2E19A 3VWBA 2F2EA 3FK7A 4EGYA 1FBSA 4AYBA 2DTRA 2XB5A 4PFPA 5CVJA 3A03A 5JLXA 1GT0C 3CMEI 5TISC 3TOBA 5IT9K 4AUXA 4PJNA 4PJ0C 3L9FA 3GTGJ 4R79A 4JYKA 3OSGA 3O2PE 4HOBA 4A3EJ 2EBIA 3OYKA 5M3MJ 1YRNB 2R5ZA 1ZGJA 1S72I 1K78B 2BY3A 2HXIA 3ERMA 1SVLA 2TDXA 1DGRM 3DTKA 5F1JA 1W7PB 1X19A 2EZLA 3BY6A 2K9QA 3HRMA 3MKZA 2Y48A 3KEOA 2FU4A 5J4VA 3HKZA 4M6VA 1OR7A 4PUSA 2BVLA 3SEZA 1HOMA 2E1OA 3E0JB 4H4KC 4RB0A 4BH9A 3ZMUA 5B5EC 1B6AA 2ZSHB 3HSEA 3CZ6A 1KQ8A 5IY5H 3BJAA 2RV8A 6PAXA 2VT3A 2NRAC 1J59A 2DTZA 1E2XA 3JAMZ 3EQLF 1IRFA 1R7JA 1Z6RA 2RVCA 4YFNF 4P9FA 3S17J 1S7AA 1UCRA 3SZPA 2XGDA 2KLOA 5CVRA 4XKVA 4DQ2A 2HDWA 4YIRX 4BDZA 2QCOA 4G94A 2Z9OA 1P4WA 1ULYA 2A6EF 2CQNA 3P9KA 3M4OJ 3ZMVA 3UKGA 4G7OF 2H94A 3VEPA 2R5YA 4J00A 4KIGA 3NWTA 1R4NB 1ZLKA 3AG4H 4HDVA 2V1NA 3K4MA 3WG9A 2ZO4A 3C2BA 2YUSA 1TWHJ 5CLSA 1V5EA 1X1AA 1ZQ3P 1R36A 2ZC2A 3H92A 5TJJA 5F1RA 1TWAJ 3BG9A 2C6YA 4I76A 1A31A 2M34A 3GWZA 1R49A 2E2JJ 5IYDJ 4HPQA 3VYTB 1MGTA 5HS8A 2LFBA 1G3SA 2G9WA 4U0VA 4A3FJ 4PDKA 2HYGD 2XKOA 2KKOA 4PJMA 4RGUA 2WADA 3FHZA 1X1CA 2JT1A 3HDDA 1IN7A 1IRXA 1W7PD 4XSXF 4B09A 5DDGA 4F93B 4JK1X 1MBFA 2BBYA 3EDPA 5HDKA 2E34A 5BQTA 2F4IA 3CMMA 2LKPA 2DA2A 3IL2A 2XAQA 2VIXA 4PK4A 5FRMA 3LSPA 3DTEA 3GXOA 3LMMA 5IYCJ 1K7AA 2LYCA 5M5YJ 1IC8A 5LGUA 2L9VA 4CICA 2VQLA 2VASA 1UB9A 2HZDA 2PX9A 1RC9A 3K1PA 4CCLA 4HEA2 1SMTA 3GO5A 4XIDA 1VQMI 3RYPA 3S3MA 1WFXA 1G4DA 4QWQA 2XAHA 1S7OA 2EFPA 3IP4B 4OINF 5H2FC 4L9JA 4A3MJ 1RESA 5TGTA 4YFKF 1LE8B 2BY0A 3H0GJ 5CVUA 2N8GA 3WTWC 3H36A 1LFUP 1UHMA 2IBDA 5E3NA 5TRDA 3HG9A 4EEFG 2QENA 5EGOB 3WHCA 3GTQJ 1SVMA 2HNHA 4Y17A 1TBXA 4FE4A 3AL0C 3KZZA 3DTIA 1T38A 4BE0A 2PMHA 3K4BA 3WTTC 4HX7A 2O61A 1CQTA 2J5OA 1GXQA 3LNQA 4Q47A 2K9SA 2QF7A 5D8LB 3JTGA 1BC8C 4C3IJ 3E5QA 3M8EA 3PNVA 1HQCA 1LB2A 3D5SC 3HPGA 3ZP5A 3JCUC 1UAAA 3C18A 1I3QJ 3CMAI 4Q4ZF 2L7MP 1OCCH 2ID6A 2HVQA 4R8HA 2E36A 4ZZDA 1H8AC 3PNYA 4MFEA 2GM4A 1NG6A 3EETA 5KAIC 2JA2A 5FLVA 1YOVB 1A6QA 3DEUA 2MSYA 2BW3B 1IUFA 2X51A 1R23A 1RI7A 3FBIB 3KLOA 3WU0A 4BHCA 3WGGA 3DPUA 2M30A 1J09A 4K2EA 5DS9A 5D6EA 2MC4A 2WY7Q 1W5SA 5FKMA 1BR1A 2JWTA 2KL4A 2OD5A 2XPVA 5J4YA 3E6CC 4PSXA 1KYZA 4BHPA 2Y9YA 4LOCA 2M2EA 3BCBA 3E6BA 4FQGA 3GTLJ 2UZKA 3WGHA 2DK8A 1UHSA 1LPQA 2W57A 3OYJA 3VB2A 2IJLA 3V8JA 4MTDA 3ZQIA 4GCVA 3HL2A 1VZ0A 3LQRA 5D5VB 2V26A 3VODA 2A68F 4BDYA 2L7ZA 1YIJI 4BJ5C 1ZGWA 4XQFA 4XR6A 5JFRA 1B9NA 5HLGA 1V5GA 5K5RA 1YQAA 2CUZA 2K27A 4BEHB 1IV8A 2GXGA 1JUPA 5HDNA 2XF7A 3MZ8A 4Z2YA 5K1YA 3H3VK 1JUSA 3RIRA 3ZN0A 3F8MA 4KIFA 1XN7A 1IN8A 2DXIA 2CQQA 2VXDA 1BM9A 4PZJA 3ISPA 2W4SA 3DPLC 3K4JA 2VPRA 3LL7A 3W6KB 3GFLA 3FXQA 2LR8A 2VONA 1AOYA 1ENHA 3HOVJ 2LNBA 2R7RA 2VJ5A 1TLHB 2V9KA 3F3XA 2LSOA 2Y0MA 2F5VA 1X1DA 1YYVA 2XRLA 5HVQC 2R7VA 3CJQB 2E1CA 4KMFA 3QYBA 1BJZA 4OU0A 3LWFA 3HOSA 4C2UA 2HPIA 2HFHA 2NVYJ 3SFZA 2ZXJA 1R1TA 5FROA 2X4HA 2Y9ZA 1I27A 4NHJA 5EG0A 1O3RA 1N77A 4Y52J 3GCMA 2HTJA 3DWLE 2HPMA 1JKOC 4N4NB 2E60A 1KU7A 4MNUA 3MKWB 4NB5A 2QKMB 2QBYB 4BQNA 3QPLA 4S0HB 1Z67A 4WWCA 1T0FC 3I4MJ 4RLQA 4GXOA 2XUBA 3KIOA 3CCLI 3GTPJ 2BEOA 2YX4A 3PFYA 3L2UA 1G3YA 5E1WA 3FX3A 4E7LA 1ZN2A 4OIRF 1OQYA 1B72B 1A5JA 1MW7A 2BHYA 1FBUA 2DA6A 3SZTA 4CCOA 3DBHB 1BIAA 2PEXA 3MQ0A 5F08A 3CCVI 1MMNA 5DYMA 4RM3A 4IJAA 3QPHA 1V54H 2LKXA 2CUJA 3JTHA 2QKLB 3JRHA 4NQWA 5FLMJ 4AVZA 4LFUA 3ASNH 1VQKI 3QP5A 1T6SA 1S3JA 2CW0F 3F8BA 1WJBA 2HDDA 5CQEA 2FJ1A 5EJCA 3J81Z 4AIHA 3IV5A 3KYDB 1X3WB 2WA0A 2V1XA 1ZHFA 5L3FA 1YJWI 4IHSA 2F5CA 1GHCA 4X6AJ 1YW7A 3K1MA 1YTYA 2ZXHA 1OYIA 1XDSA 1W36D 1EH8A 5D8KB 2XPWA 2DMPA 2NYXA 3CMYA 2Q1ZB 1FYLA 1TQPA 2HOEA 2VB6A 1Z3XA 3KEQA 4OOIA 2LOOA 4AC0A 3A0BC 1QQIA 1VQ6I 4B44A 1IN6A 1W5TA 4I7HA 1VQ9I 2LG4A 2H6CA 3MD2A 1EV7A 1QVUA 2BV6A 2O3FA 2ZXWH 2HVRA 4YG2F 3ECOA 2L54A 4I6ZA
chains in the Genus database with same CATH topology
3ZMDA 5HLHA 2FNPA 4N9IA 4HQMA 1D8KA 5FFXA 1F5TA 2CYYA 2EA2A 3F8NA 3CO6C 1S29A 2K4BA 1R1UA 2A69F 2FXAA 2HYFA 3HSFA 5D5UB 2QZ8A 4RAYA 2FBIA 5H20A 3KZYA 2FF4A 5JVTA 1QBJA 1O7FA 2KJBA 5L3EA 1YO5C 2GQQA 3BPXA 4PGHA 2PQ8A 4G7ZF 1SFXA 1RUOA 3RJPA 3JW4A 4S05A 2HZTA 3GUDA 3GYHX 4KNYA 1VTNC 3LQQA 1QZZA 2XAFA 2QQBA 1FSEA 3CUQC 1FWZA 5ED4A 1IF1A 1PDNC 1IW7F 4KMUX 2EA4A 3R4KA 4RB3C 3ZN1A 4ZYHA 3ZMZA 3F8CA 2O6GE 2VN2A 4S04A 2QLZA 4CHUA 3ECHA 4RGRA 2K86A 2LF7A 4CDGA 1ZG1A 3C1DA 1JE8A 1OPCA 2MH9A 4WF2A 2YR2A 3RDIA 5DCMB 2IA0A 2DAOA 1U2WA 4EJWA 1HSJA 4A0YA 1LJ9A 4LB6B 4LG0A 1MJBA 3WU1B 2EFWA 4IRIA 4LLLA 1BBYA 4A6DA 2F5DA 2D1HA 4BHBA 3ML6A 3E97A 4P96A 1XMKA 4QLCU 3I59A 3MFKA 3SQNA 3HRSA 3JSOA 4MHGA 3ERED 1Z91A 2M5WA 1BC7C 3GZ6A 2EV0A 1O3TA 4UHTA 1T39A 4ENJA 3TGNA 5A2QZ 3LAPA 2EK5A 1I1SA 5BS6A 1RNLA 2ESHA 2FMYA 5FFZA 3D0SA 2W24A 1U5TC 1HSTA 3TDZC 1FPQA 2RC4A 3MAJA 2R3SA 3LA7A 1KA8A 4ESBA 2IA2A 5D5WB 1L0OC 4M71A 3BPVA 3ZQ7A 3N97A 2L54A 3HIFA 1YLFA 1T98A 1Z05A 1DPRA 2VOOA 2RQPA 1SMYF 4M9XA 1XCBA 4A0XA 3CUQA 2DPDA 2ZMEB 2IRFG 2L3DA 2E1NA 3ROUA 2HR3A 1BI0A 4KICA 4RGSA 4RS8A 4HLYA 1HW1A 3L7WA 2K02A 3QAHA 1ZARA 2GZWA 5JR3A 1SD7A 3P9CA 3IKVA 3G73A 4BYYA 1HW2A 3NEUA 5CVIA 1BN5A 3R6SA 1H0MA 3DQVC 2QVOA 3KETA 4G8XA 2RKHA 1LDDA 5J6XA 2OBPA 1IXRC 1J75A 3GW2A 2QUFA 4HDUA 1T2KA 2QYOA 1MDMB 1FYKA 4ZYGA 1H9TA 4A12A 3N4MA 3IWZA 3CLOA 1YW9A 1GXPA 3J81K 5LLQA 5BPIA 2R7DA 3T8TA 2D45A 2VBZA 2ETHA 2ZKZA 3ELKA 3I58A 1Y0UA 2G7HA 1U8RA 1O57A 2VBWA 3I4PA 1FLIA 3ULQB 2P6SA 2CG4A 4I0AA 2UWMA 2ESNA 2ELHA 2YX7A 3HSRA 4LK1F 2DI3A 1ZRCA 4HV6A 3OOPA 3D5LA 1W4MA 4CXFA 2MBFA 2OAZA 3PQKA 4EJTA 3HYIA 3I71A 3QOPA 4KYWA 4HZFA 4P9UA 3LAJA 3RTRA 5J8FA 4Q48A 1MDMA 4I0BA 2W85A 2STWA 3DPTA 2VBXA 1QPMA 2KRFA 1LNWA 3GX4X 4XLPF 5ICCA 5DCFA 3EUHA 1EH7A 4M73A 1Z6TA 3C7JA 2ZFWA 4JBAA 1L3LA 4I01A 1WQ2A 2HGCA 5EEGA 3I53A 2CQKA 4CZZA 2GA1A 3GZ5A 4YIIA 1SD6A 2VC0A 3R0JA 1YS7A 1ONVA 3JSPA 3WGIA 1YIOA 4OMYA 3B02A 4O5VA 5HLIA 1XB4A 1I6XA 4M6XA 4G6QA 4G6DA 1REPC 1ZYRF 2ZCWA 1FSHA 2Q0OA 4GYGA 3V7RA 3GFJA 4HAMA 3MZHA 1DPUA 2HKXA 1XSXA 4LB5A 3REOA 3BP8A 4EM0B 3SXYA 1B9MA 2XROA 4BNCA 3DKWA 1Q1HA 4EJVA 3HUGA 4LLNA 1B1BA 4N0BA 2KIUA 4H0EA 3DV8A 4HX4A 3U1DA 1ZGAA 5D4RA 2OZ6A 2CO5A 4M74A 1IAWA 3BZ6A 3IWFA 1P6RA 2UXXA 4ETSA 4I2OA 1TQIA 2L01A 4UVCA 2DO7A 1WI9A 4FX4A 2F5FA 1R5HA 5AIQA 3WE3A 2OA4A 1KU2A 2YSRA 4G9YA 2K7LA 1KQ9A 1JXSA 5D6FA 5IT9Z 3C3WA 4EQQA 5DD4A 2A6HF 1ON1A 3FM3A 3R61A 4OIPF 3CDHA 3T1BA 3LA3A 4A5MA 2IA1A 3IHUA 3E6DA 1TTYA 2XAGA 3HOTA 1S8NA 2XGXA 3L2CA 1TNTA 3R0AA 4L5IA 4XRFA 1BI3A 3HHHA 4AD9A 1USTA 4UV8A 4HX8A 3T0YA 3FXUA 4Q5SF 1Z7UA 2DFIA 2CGPA 5LHIA 5E20A 3RPUA 4BQAA 1O3QA 4ZYDA 2WC2A 2VE8A 4A0ZA 2E7XA 3RPQA 1WWXA 2ZJ2A 3FXRA 4IPAA 4AIKA 1R1VA 4RAZA 1X3UA 5DV5A 1F9NA 2HEOA 5CJ9A 1IXSB 4D0PA 4KDPA 5E18F 2M45A 2LF8A 1CGPA 3IRQA 2VBYA 3OV8A 3KFWX 5DUKA 1ZLJA 1XGOA 2PN6A 5E1ZB 1B4AA 2L4AA 4AVPA 1J9IA 1LVAA 5H6RA 3KP2A 3TQNA 4R1HA 1D5VA 2EFQA 1K6OA 5ILVA 2FBKA 2D1VA 3CO7C 4CYDA 5JI6A 1LQ1A 2RN7A 3FMSA 4MEYF 1STZA 2VOPA 1FT9A 1SAXA 2JRTA 3P9IA 3K9TA 4O6JA 2AS5F 2ZBKA 5LRRA 3CTAA 1FC3A 4U0WA 2Y75A 1KGSA 2ZNYA 2P8TA 4Y15A 5FLXK 1DDNA 5JHUA 2A61A 3L09A 1WSUA 3LA2A 1SD5A 5L3DA 2JSCA 3Q9SA 2EB7A 2P5VA 1G3TA 3G3ZA 5DCMA 2CSOA 1NHAA 4ZYEA 3H3ZA 1FNNA 2ADUA 3E6MA 3K0LA 4ESFA 3DF8A 3QU3A 3BJOA 2IPQX 3B73A 1LEBA 1KU3A 5K5OA 3TO6A 2K4JA 1G6NA 2EFOA 2KJCA 3WTVC 1V3FA 1FP2A 2FRHA 2COMA 1ZREA 2JZYA 4A5NA 2V79A 1Z9CA 3FWEA 2OU2A 4WXHA 4I09A 1ZRDA 1XGMA 1YFHA 4OIOF 5J8CA 3GF2A 2FSWA 3CJNA 4IXAA 1E17A 3HTSB 5EEHA 1FX7A 4M72A 4BXUA 3MWMA 1J7KA 1I5ZA 1BOAA 1OYYA 4M9ZA 5L3GA 1UFMA 4L0ZB 4U88A 4MTEA 3TDUC 3O3KA 2IT0A 1IXCA 3GFIA 5FB2A 1BI1A 2G7UA 4P55A 2QM3A 3T8RA 2PFBA 4L9NA 5F64A 3DFGA 4L18B 3VOEA 2W84A 3EYIA 5FGMA 3FMQA 4IVNA 3TO9A 4M9SA 5HS9A 1HKTA 3KP3A 1K79A 2BE5F 4KA4A 4UVBA 3BDDA 2RGVA 2GXBA 5L3BA 1IN4A 1A04A 1IN5A 1OMIA 1DP7P 3FF5A 5LEJA 5FD5A 4PGGA 2NAZA 2PJPA 3IKTA 2XASA 3E3VA 1R22A 2IVMA 5ICGA 1FYMA 2HS5A 4LMYA 1XDUA 2HDCA 3BWGA 1ODDA 4IRGA 1RIOH 1MJAA 3LSTA 2XVCA 1QNTA 2FOKA 3J7AO 3M8FA 1TW3A 4MQVA 3ZMSA 5HOOA 3F6OA 2P4WA 3M1EA 4KT5C 5ICEA 1QO0D 1U78A 4AWXB 2NS0A 2H09A 3TOAA 1FP1D 4EGZA 2AXLA 4E70A 4XBFA 1SFUA 4FHTA 3RI4A 4WXCA 5BPDA 2FA5A 3V8KA 1D3YA 4ZZLA 4KN7X 3E5XA 1D8JA 5ILUA 2VE9A 4EMSA 3W6JB 1FZPB 1PP8F 5A2QK 3EYYA 1ZH5A 4KUMA 1LEAA 2OZUA 3PFIA 1C0WA 2H6BA 1MD0A 4BAYA 1U6GA 4JQFA 2XKPA 3LFKA 1O7LA 2Z33A 1LDKB 5LBQA 2GWRA 4I02A 5LGTA 4Y13A 1DUXC 3CUOA 4KIBA 4EVIA 2Z5UA 2J5PA 2ZNZA 4ENMA 4XSZF 5ICFA 2H27A 2MLKA 1OKRA 1HBXG 3WTZA 2XHKA 3I59B 3WTYC 2HWVA 5LHGA 3QRFF 3PQJA 2DPUA 2XIGA 1T0FA 4LK0F 5K5QA 2JPBA 4EJOA 5E17F 2DT5A 3KP7A 2PLYA 5H6QA 3KLNA 1V4RA 1R58A 1F4KA 1KU9A 3F72A 4IRHA 1W7PA 5LGNA 3BROA 3V8LA 4ESJA 3V7SA 2O0YA 4P5OA 1JHFA 2PI0A 3KCCA 2VXZA 1R5GA 4U7DA 2A07F 4MGRA 1XD7A 1P2FA 1YS6A 2LDUA 2P5KA 3JAMK 4O3MA 4L9TA 4N9HA 3DP7A 4F7ZA 2XRNA 5KVRA 1B59A 2QQAA 3RYRA 1XMAA 2DBBA 1J5YA 2IP2A 3P7NA 2STTA 4G7HF 4EM1A 1I1GA 4ENNA 3WTXC 1PUEE 2V9VA 3V4GA 4EM2A 1XCVA 2W25A 3QU6A 1BI2A 3FMRA 3NQOA 4ENKA 5HS7A 4HF1A 4UXNA 2WWYA 1FOKA 1ZG5A 4WX9A 4U7BA 3T5XA 4OMZA 1G3WA 1J0RA 3WE2A 4HF2A 2XAJA 3WTUC 2MD5A 4WK8F 4RGXA 3SHFA 1SD4A 1FY7A 2MLGA 1XSDA 2DQLA 2A5YB 1HKSA 2PBIA 3WTSC 1TQMA 3QP6A 3TO7A 3GVAA 4HBLA 3AAFA 2RDPA 1KYWA 5LRSA 1YG2A 3U9GA 2HKOA 4A2UA 4YFXF 1TNSA 2XV4S 2MH2A 4UNOA 4L9VA 2HTSA 2P5LC 2O03A 1EH6A 3E5UA 4L5JA 1RUNA 3KP5A 5L3CA 3F22A 3I64A 4HQEA 4YIFA 5FD6A 3KE2A 3RKXA 2ACJA 1H9GA 3HHGA 2NNNA 2ZMEA 4ZH4F 1XSVA 5CYVA 1JGSA 5FLXZ 4AIJA 2VC1A 1UHWA 1F1ZA 4HF0A 1GVJA 2KIMA 2B0LA 2MA3A 3NRVA 1K78A 2L4MA 3BOQA 1QGPA 2PMUA 5E8IA 3HRUA 1ZG3A 1SFEA 2GAUA 2OQGA 3IC7A 3QPTA 1ZAOA 5BMZA 4UVAA 1JHHA 3H3UA 4UUVA 3Q9VA 1U5TA 1IZ1A 4DNCA 4FT8A 1P92A 3DXJF 2P7VB 1ZRFA 1OYWA 2DU9A 2EV6A 3FZVA 4KN4X 2M87A 4ON0A 3ZPLA 3KP4A 4U0YA 4GYIA 3WODF 2DQRA 3F6VA 3L00A 2FE3A 3F21A 3I54A 3GFMA 5F6FA 3U2RA 3M7GA 1BJAA 2NNYA 2WV0A 3ABTA 2JPCA 1MKMA 1IUYA 1Z1DA 4HW0A 3I0TA 5HDGA 3KP6A 5ILSA 5DD8A 3GEZA 4UV9A 5BOXA 4HYEA 4OIQF 1YW8A 2ISYA 2VT2A 3M9AA 4L0YB 2WTEA 2IW5A 3TKYA 2FBHA 4WCGA 1BIBA 3F8FA 2Q2EA 2BYVE 2F5EA 4GO1A 2V1UA 1XGSA 1WKMA 1HKQA 2ISZA 3V7CA 1FBQA 1IRGA 1U3EM 1PP7U 2Q8KA 2R7FA 4WXDA 2FMLA 1U5TB 4ASNA 5E1XA 2BGCA 4EV0A 5KK1A 2CFXA 1KQ0A 3VFZA 5LHHA 3MCZA 2HQRA 1WRJA 4LD5A 4HLXA 1S6LA 2X0LA 5D5XB 2YPRA 3K69A 1CF7A 1USSA 4LLGF 2FNAA 5DEQA 3MEXA 3I5UA 3O6BB 2DW4A 4XLNF 1AWCA 5FO5A 5IT3A 3IRRA 1CF7B 2VODA 2UXNA 2P7CB 1LDJA 2MC3A 1O3SA 2DLLA 5D4SA 2CWEA 3F23A 2QBYA 3ABUA 2PG4A 5AONA 4IF4A 2QQ9A 3HTUA 1MJ9A 3FM5A 1QZYA 4HV5A 4PCQA 2EFNA 3Q5FA 3S2WA 1ON2A 1XGNA 1RZ4A 2Z3YA 1R00A 1HW5A 2D2WA 1HXDA 4GGGA 1J2XA 2OQRA 3RKWA 2GA2A 2O8XA 5CVVA 4LJZF 2A3SA 2M8EA 4RB2C 1P4AA 2KIFA 2EV5A 3COAC 2FQ3A 4CO8A 5E8GA 4LGWA 4MQ9F 2EJRA 4LG0B 3J80K 2E7WA 1MZBA 3BJ6A 3GLXA 2V1DA 2P6TA 3ZMTA 2M1BA 3J80Z 5DUIA 2RNJA 2DK5A 4B8XA 3CUQB 2QWWA 2HQNA 5ERIA 2YU3A 5LEKA 4MEXF 1TW2A 2FEZA 4TV7A 4EJUA 3HRTA 3K1NA 3R60A 4HA8A 2EWNA 4KFCA 3MZYA 4A6EA 4RB1A 2Z99A 2L02A 3K2ZA 4I98B 5AIPA 4IHTA 1P4XA 2GIVA 4FX0A 2JTVA 4CGZA 2V6CA 3RKYA 2F2EA 4EGYA 1FBSA 2DTRA 5CVJA 3TOBA 5IT9K 3L9FA 4R79A 3O2PE 4HOBA 1ZGJA 1K78B 2TDXA 1W7PB 3BY6A 3HRMA 2Y48A 3KEOA 2FU4A 1OR7A 4RB0A 4BH9A 3ZMUA 1B6AA 3HSEA 1KQ8A 3BJAA 2RV8A 6PAXA 2VT3A 2NRAC 1J59A 1E2XA 3JAMZ 3EQLF 1IRFA 1R7JA 1Z6RA 2RVCA 4YFNF 4P9FA 1S7AA 1UCRA 3SZPA 5CVRA 4DQ2A 4G94A 2Z9OA 1P4WA 1ULYA 2A6EF 3P9KA 3ZMVA 4G7OF 2H94A 3VEPA 4KIGA 1ZLKA 4HDVA 3WG9A 2ZO4A 5CLSA 1R36A 3H92A 5TJJA 5F1RA 2C6YA 3GWZA 1MGTA 5HS8A 1G3SA 2G9WA 4U0VA 4PDKA 2HYGD 2XKOA 2KKOA 4RGUA 3FHZA 2JT1A 1IN7A 4XSXF 1W7PD 5DDGA 4B09A 4JK1X 2BBYA 3EDPA 5HDKA 5BQTA 2LKPA 3IL2A 2XAQA 3GXOA 1K7AA 5LGUA 4CICA 1UB9A 3K1PA 1SMTA 3GO5A 3RYPA 1G4DA 4QWQA 2XAHA 1S7OA 2EFPA 4OINF 4L9JA 4YFKF 5CVUA 3WTWC 1UHMA 5TRDA 2QENA 4Y17A 1TBXA 3KZZA 1T38A 2PMHA 3WTTC 4HX7A 2O61A 2J5OA 1GXQA 4Q47A 5D8LB 3JTGA 1BC8C 3E5QA 3M8EA 1HQCA 1LB2A 3ZP5A 3C18A 4Q4ZF 4R8HA 4ZZDA 3EETA 3DEUA 1R23A 1RI7A 3KLOA 3WU0A 4BHCA 3WGGA 2M30A 4K2EA 5D6EA 1W5SA 2OD5A 3E6CC 1KYZA 4BHPA 3E6BA 2UZKA 3WGHA 2DK8A 2W57A 3VB2A 2IJLA 3V8JA 4MTDA 4GCVA 5D5VB 3LQRA 3VODA 2A68F 5JFRA 1B9NA 5HLGA 5K5RA 1YQAA 2K27A 2GXGA 5HDNA 4Z2YA 5K1YA 3RIRA 3ZN0A 3F8MA 4KIFA 1XN7A 1IN8A 1BM9A 4PZJA 3ISPA 3DPLC 3W6KB 3GFLA 3FXQA 2VONA 1AOYA 2LNBA 1TLHB 3F3XA 2LSOA 2Y0MA 5HVQC 1YYVA 2E1CA 4KMFA 4OU0A 3LWFA 3HOSA 2HFHA 3SFZA 2ZXJA 1R1TA 2X4HA 1I27A 4NHJA 1O3RA 2HTJA 1KU7A 4MNUA 4NB5A 2QBYB 4WWCA 4GXOA 2XUBA 2BEOA 2YX4A 1G3YA 5E1WA 3FX3A 1ZN2A 4OIRF 1FBUA 3SZTA 1BIAA 2PEXA 3MQ0A 5DYMA 4IJAA 3QPHA 3JTHA 4NQWA 4LFUA 3QP5A 1T6SA 1S3JA 2CW0F 3F8BA 3J81Z 4AIHA 4IHSA 2V1XA 1ZHFA 5L3FA 2F5CA 1GHCA 1YW7A 3K1MA 1YTYA 1OYIA 1XDSA 1EH8A 5D8KB 2NYXA 1FYLA 1TQPA 2HOEA 3KEQA 4OOIA 1QQIA 1IN6A 1W5TA 4I7HA 2H6CA 1EV7A 2BV6A 2O3FA 4YG2F 3ECOA 4M6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZMD A;  5HLH A;  2FNP A;  4N9I A;  4HQM A;  1D8K A;  5FFX A;  1F5T A;  2CYY A;  2EA2 A;  3F8N A;  3CO6 C;  1S29 A;  2K4B A;  1R1U A;  2A69 F;  2FXA A;  2HYF A;  3HSF A;  5D5U B;  2QZ8 A;  4RAY A;  2FBI A;  5H20 A;  3KZY A;  2FF4 A;  5JVT A;  1QBJ A;  1O7F A;  2KJB A;  5L3E A;  1YO5 C;  2GQQ A;  3BPX A;  4PGH A;  2PQ8 A;  4G7Z F;  1SFX A;  1RUO A;  3RJP A;  3JW4 A;  4S05 A;  2HZT A;  3GUD A;  3GYH X;  4KNY A;  1VTN C;  3LQQ A;  1QZZ A;  2XAF A;  2QQB A;  1FSE A;  3CUQ C;  1FWZ A;  5ED4 A;  1IF1 A;  1PDN C;  1IW7 F;  4KMU X;  2EA4 A;  3R4K A;  4RB3 C;  3ZN1 A;  4ZYH A;  3ZMZ A;  3F8C A;  2O6G E;  2VN2 A;  4S04 A;  2QLZ A;  4CHU A;  3ECH A;  4RGR A;  2K86 A;  2LF7 A;  4CDG A;  1ZG1 A;  3C1D A;  1JE8 A;  1OPC A;  2MH9 A;  4WF2 A;  2YR2 A;  3RDI A;  5DCM B;  2IA0 A;  2DAO A;  1U2W A;  4EJW A;  1HSJ A;  4A0Y A;  1LJ9 A;  4LB6 B;  4LG0 A;  1MJB A;  3WU1 B;  2EFW A;  4IRI A;  4LLL A;  1BBY A;  4A6D A;  2F5D A;  2D1H A;  4BHB A;  3ML6 A;  3E97 A;  4P96 A;  1XMK A;  4QLC U;  3I59 A;  3MFK A;  3SQN A;  3HRS A;  3JSO A;  4MHG A;  3ERE D;  1Z91 A;  2M5W A;  1BC7 C;  3GZ6 A;  2EV0 A;  1O3T A;  4UHT A;  1T39 A;  4ENJ A;  3TGN A;  5A2Q Z;  3LAP A;  2EK5 A;  1I1S A;  5BS6 A;  1RNL A;  2ESH A;  2FMY A;  5FFZ A;  3D0S A;  2W24 A;  1U5T C;  1HST A;  3TDZ C;  1FPQ A;  2RC4 A;  3MAJ A;  2R3S A;  3LA7 A;  1KA8 A;  4ESB A;  2IA2 A;  5D5W B;  1L0O C;  4M71 A;  3BPV A;  3ZQ7 A;  3N97 A;  2L54 A;  3HIF A;  1YLF A;  1T98 A;  1Z05 A;  1DPR A;  2VOO A;  2RQP A;  1SMY F;  4M9X A;  1XCB A;  4A0X A;  3CUQ A;  2DPD A;  2ZME B;  2IRF G;  2L3D A;  2E1N A;  3ROU A;  2HR3 A;  1BI0 A;  4KIC A;  4RGS A;  4RS8 A;  4HLY A;  1HW1 A;  3L7W A;  2K02 A;  3QAH A;  1ZAR A;  2GZW A;  5JR3 A;  1SD7 A;  3P9C A;  3IKV A;  3G73 A;  4BYY A;  1HW2 A;  3NEU A;  5CVI A;  1BN5 A;  3R6S A;  1H0M A;  3DQV C;  2QVO A;  3KET A;  4G8X A;  2RKH A;  1LDD A;  5J6X A;  2OBP A;  1IXR C;  1J75 A;  3GW2 A;  2QUF A;  4HDU A;  1T2K A;  2QYO A;  1MDM B;  1FYK A;  4ZYG A;  1H9T A;  4A12 A;  3N4M A;  3IWZ A;  3CLO A;  1YW9 A;  1GXP A;  3J81 K;  5LLQ A;  5BPI A;  2R7D A;  3T8T A;  2D45 A;  2VBZ A;  2ETH A;  2ZKZ A;  3ELK A;  3I58 A;  1Y0U A;  2G7H A;  1U8R A;  1O57 A;  2VBW A;  3I4P A;  1FLI A;  3ULQ B;  2P6S A;  2CG4 A;  4I0A A;  2UWM A;  2ESN A;  2ELH A;  2YX7 A;  3HSR A;  4LK1 F;  2DI3 A;  1ZRC A;  4HV6 A;  3OOP A;  3D5L A;  1W4M A;  4CXF A;  2MBF A;  2OAZ A;  3PQK A;  4EJT A;  3HYI A;  3I71 A;  3QOP A;  4KYW A;  4HZF A;  4P9U A;  3LAJ A;  3RTR A;  5J8F A;  4Q48 A;  1MDM A;  4I0B A;  2W85 A;  2STW A;  3DPT A;  2VBX A;  1QPM A;  2KRF A;  1LNW A;  3GX4 X;  4XLP F;  5ICC A;  5DCF A;  3EUH A;  1EH7 A;  4M73 A;  1Z6T A;  3C7J A;  2ZFW A;  4JBA A;  1L3L A;  4I01 A;  1WQ2 A;  2HGC A;  5EEG A;  3I53 A;  2CQK A;  4CZZ A;  2GA1 A;  3GZ5 A;  4YII A;  1SD6 A;  2VC0 A;  3R0J A;  1YS7 A;  1ONV A;  3JSP A;  3WGI A;  1YIO A;  4OMY A;  3B02 A;  4O5V A;  5HLI A;  1XB4 A;  1I6X A;  4M6X A;  4G6Q A;  4G6D A;  1REP C;  1ZYR F;  2ZCW A;  1FSH A;  2Q0O A;  4GYG A;  3V7R A;  3GFJ A;  4HAM A;  3MZH A;  1DPU A;  2HKX A;  1XSX A;  4LB5 A;  3REO A;  3BP8 A;  4EM0 B;  3SXY A;  1B9M A;  2XRO A;  4BNC A;  3DKW A;  1Q1H A;  4EJV A;  3HUG A;  4LLN A;  1B1B A;  4N0B A;  2KIU A;  4H0E A;  3DV8 A;  4HX4 A;  3U1D A;  1ZGA A;  5D4R A;  2OZ6 A;  2CO5 A;  4M74 A;  1IAW A;  3BZ6 A;  3IWF A;  1P6R A;  2UXX A;  4ETS A;  4I2O A;  1TQI A;  2L01 A;  4UVC A;  2DO7 A;  1WI9 A;  4FX4 A;  2F5F A;  1R5H A;  5AIQ A;  3WE3 A;  2OA4 A;  1KU2 A;  2YSR A;  4G9Y A;  2K7L A;  1KQ9 A;  1JXS A;  5D6F A;  5IT9 Z;  3C3W A;  4EQQ A;  5DD4 A;  2A6H F;  1ON1 A;  3FM3 A;  3R61 A;  4OIP F;  3CDH A;  3T1B A;  3LA3 A;  4A5M A;  2IA1 A;  3IHU A;  3E6D A;  1TTY A;  2XAG A;  3HOT A;  1S8N A;  2XGX A;  3L2C A;  1TNT A;  3R0A A;  4L5I A;  4XRF A;  1BI3 A;  3HHH A;  4AD9 A;  1UST A;  4UV8 A;  4HX8 A;  3T0Y A;  3FXU A;  4Q5S F;  1Z7U A;  2DFI A;  2CGP A;  5LHI A;  5E20 A;  3RPU A;  4BQA A;  1O3Q A;  4ZYD A;  2WC2 A;  2VE8 A;  4A0Z A;  2E7X A;  3RPQ A;  1WWX A;  2ZJ2 A;  3FXR A;  4IPA A;  4AIK A;  1R1V A;  4RAZ A;  1X3U A;  5DV5 A;  1F9N A;  2HEO A;  5CJ9 A;  1IXS B;  4D0P A;  4KDP A;  5E18 F;  2M45 A;  2LF8 A;  1CGP A;  3IRQ A;  2VBY A;  3OV8 A;  3KFW X;  5DUK A;  1ZLJ A;  1XGO A;  2PN6 A;  5E1Z B;  1B4A A;  2L4A A;  4AVP A;  1J9I A;  1LVA A;  5H6R A;  3KP2 A;  3TQN A;  4R1H A;  1D5V A;  2EFQ A;  1K6O A;  5ILV A;  2FBK A;  2D1V A;  3CO7 C;  4CYD A;  5JI6 A;  1LQ1 A;  2RN7 A;  3FMS A;  4MEY F;  1STZ A;  2VOP A;  1FT9 A;  1SAX A;  2JRT A;  3P9I A;  3K9T A;  4O6J A;  2AS5 F;  2ZBK A;  5LRR A;  3CTA A;  1FC3 A;  4U0W A;  2Y75 A;  1KGS A;  2ZNY A;  2P8T A;  4Y15 A;  5FLX K;  1DDN A;  5JHU A;  2A61 A;  3L09 A;  1WSU A;  3LA2 A;  1SD5 A;  5L3D A;  2JSC A;  3Q9S A;  2EB7 A;  2P5V A;  1G3T A;  3G3Z A;  5DCM A;  2CSO A;  1NHA A;  4ZYE A;  3H3Z A;  1FNN A;  2ADU A;  3E6M A;  3K0L A;  4ESF A;  3DF8 A;  3QU3 A;  3BJO A;  2IPQ X;  3B73 A;  1LEB A;  1KU3 A;  5K5O A;  3TO6 A;  2K4J A;  1G6N A;  2EFO A;  2KJC A;  3WTV C;  1V3F A;  1FP2 A;  2FRH A;  2COM A;  1ZRE A;  2JZY A;  4A5N A;  2V79 A;  1Z9C A;  3FWE A;  2OU2 A;  4WXH A;  4I09 A;  1ZRD A;  1XGM A;  1YFH A;  4OIO F;  5J8C A;  3GF2 A;  2FSW A;  3CJN A;  4IXA A;  1E17 A;  3HTS B;  5EEH A;  1FX7 A;  4M72 A;  4BXU A;  3MWM A;  1J7K A;  1I5Z A;  1BOA A;  1OYY A;  4M9Z A;  5L3G A;  1UFM A;  4L0Z B;  4U88 A;  4MTE A;  3TDU C;  3O3K A;  2IT0 A;  1IXC A;  3GFI A;  5FB2 A;  1BI1 A;  2G7U A;  4P55 A;  2QM3 A;  3T8R A;  2PFB A;  4L9N A;  5F64 A;  3DFG A;  4L18 B;  3VOE A;  2W84 A;  3EYI A;  5FGM A;  3FMQ A;  4IVN A;  3TO9 A;  4M9S A;  5HS9 A;  1HKT A;  3KP3 A;  1K79 A;  2BE5 F;  4KA4 A;  4UVB A;  3BDD A;  2RGV A;  2GXB A;  5L3B A;  1IN4 A;  1A04 A;  1IN5 A;  1OMI A;  1DP7 P;  3FF5 A;  5LEJ A;  5FD5 A;  4PGG A;  2NAZ A;  2PJP A;  3IKT A;  2XAS A;  3E3V A;  1R22 A;  2IVM A;  5ICG A;  1FYM A;  2HS5 A;  4LMY A;  1XDU A;  2HDC A;  3BWG A;  1ODD A;  4IRG A;  1RIO H;  1MJA A;  3LST A;  2XVC A;  1QNT A;  2FOK A;  3J7A O;  3M8F A;  1TW3 A;  4MQV A;  3ZMS A;  5HOO A;  3F6O A;  2P4W A;  3M1E A;  4KT5 C;  5ICE A;  1QO0 D;  1U78 A;  4AWX B;  2NS0 A;  2H09 A;  3TOA A;  1FP1 D;  4EGZ A;  2AXL A;  4E70 A;  4XBF A;  1SFU A;  4FHT A;  3RI4 A;  4WXC A;  5BPD A;  2FA5 A;  3V8K A;  1D3Y A;  4ZZL A;  4KN7 X;  3E5X A;  1D8J A;  5ILU A;  2VE9 A;  4EMS A;  3W6J B;  1FZP B;  1PP8 F;  5A2Q K;  3EYY A;  1ZH5 A;  4KUM A;  1LEA A;  2OZU A;  3PFI A;  1C0W A;  2H6B A;  1MD0 A;  4BAY A;  1U6G A;  4JQF A;  2XKP A;  3LFK A;  1O7L A;  2Z33 A;  1LDK B;  5LBQ A;  2GWR A;  4I02 A;  5LGT A;  4Y13 A;  1DUX C;  3CUO A;  4KIB A;  4EVI A;  2Z5U A;  2J5P A;  2ZNZ A;  4ENM A;  4XSZ F;  5ICF A;  2H27 A;  2MLK A;  1OKR A;  1HBX G;  3WTZ A;  2XHK A;  3I59 B;  3WTY C;  2HWV A;  5LHG A;  3QRF F;  3PQJ A;  2DPU A;  2XIG A;  1T0F A;  4LK0 F;  5K5Q A;  2JPB A;  4EJO A;  5E17 F;  2DT5 A;  3KP7 A;  2PLY A;  5H6Q A;  3KLN A;  1V4R A;  1R58 A;  1F4K A;  1KU9 A;  3F72 A;  4IRH A;  1W7P A;  5LGN A;  3BRO A;  3V8L A;  4ESJ A;  3V7S A;  2O0Y A;  4P5O A;  1JHF A;  2PI0 A;  3KCC A;  2VXZ A;  1R5G A;  4U7D A;  2A07 F;  4MGR A;  1XD7 A;  1P2F A;  1YS6 A;  2LDU A;  2P5K A;  3JAM K;  4O3M A;  4L9T A;  4N9H A;  3DP7 A;  4F7Z A;  2XRN A;  5KVR A;  1B59 A;  2QQA A;  3RYR A;  1XMA A;  2DBB A;  1J5Y A;  2IP2 A;  3P7N A;  2STT A;  4G7H F;  4EM1 A;  1I1G A;  4ENN A;  3WTX C;  1PUE E;  2V9V A;  3V4G A;  4EM2 A;  1XCV A;  2W25 A;  3QU6 A;  1BI2 A;  3FMR A;  3NQO A;  4ENK A;  5HS7 A;  4HF1 A;  4UXN A;  2WWY A;  1FOK A;  1ZG5 A;  4WX9 A;  4U7B A;  3T5X A;  4OMZ A;  1G3W A;  1J0R A;  3WE2 A;  4HF2 A;  2XAJ A;  3WTU C;  2MD5 A;  4WK8 F;  4RGX A;  3SHF A;  1SD4 A;  1FY7 A;  2MLG A;  1XSD A;  2DQL A;  2A5Y B;  1HKS A;  2PBI A;  3WTS C;  1TQM A;  3QP6 A;  3TO7 A;  3GVA A;  4HBL A;  3AAF A;  2RDP A;  1KYW A;  5LRS A;  1YG2 A;  3U9G A;  2HKO A;  4A2U A;  4YFX F;  1TNS A;  2XV4 S;  2MH2 A;  4UNO A;  4L9V A;  2HTS A;  2P5L C;  2O03 A;  1EH6 A;  3E5U A;  4L5J A;  1RUN A;  3KP5 A;  5L3C A;  3F22 A;  3I64 A;  4HQE A;  4YIF A;  5FD6 A;  3KE2 A;  3RKX A;  2ACJ A;  1H9G A;  3HHG A;  2NNN A;  2ZME A;  4ZH4 F;  1XSV A;  5CYV A;  1JGS A;  5FLX Z;  4AIJ A;  2VC1 A;  1UHW A;  1F1Z A;  4HF0 A;  1GVJ A;  2KIM A;  2B0L A;  2MA3 A;  3NRV A;  1K78 A;  2L4M A;  3BOQ A;  1QGP A;  2PMU A;  5E8I A;  3HRU A;  1ZG3 A;  1SFE A;  2GAU A;  2OQG A;  3IC7 A;  3QPT A;  1ZAO A;  5BMZ A;  4UVA A;  1JHH A;  3H3U A;  4UUV A;  3Q9V A;  1U5T A;  1IZ1 A;  4DNC A;  4FT8 A;  1P92 A;  3DXJ F;  2P7V B;  1ZRF A;  1OYW A;  2DU9 A;  2EV6 A;  3FZV A;  4KN4 X;  2M87 A;  4ON0 A;  3ZPL A;  3KP4 A;  4U0Y A;  4GYI A;  3WOD F;  2DQR A;  3F6V A;  3L00 A;  2FE3 A;  3F21 A;  3I54 A;  3GFM A;  5F6F A;  3U2R A;  3M7G A;  1BJA A;  2NNY A;  2WV0 A;  3ABT A;  2JPC A;  1MKM A;  1IUY A;  1Z1D A;  4HW0 A;  3I0T A;  5HDG A;  3KP6 A;  5ILS A;  5DD8 A;  3GEZ A;  4UV9 A;  5BOX A;  4HYE A;  4OIQ F;  1YW8 A;  2ISY A;  2VT2 A;  3M9A A;  4L0Y B;  2WTE A;  2IW5 A;  3TKY A;  2FBH A;  4WCG A;  1BIB A;  3F8F A;  2Q2E A;  2BYV E;  2F5E A;  4GO1 A;  2V1U A;  1XGS A;  1WKM A;  1HKQ A;  2ISZ A;  3V7C A;  1FBQ A;  1IRG A;  1U3E M;  1PP7 U;  2Q8K A;  2R7F A;  4WXD A;  2FML A;  1U5T B;  4ASN A;  5E1X A;  2BGC A;  4EV0 A;  5KK1 A;  2CFX A;  1KQ0 A;  3VFZ A;  5LHH A;  3MCZ A;  2HQR A;  1WRJ A;  4LD5 A;  4HLX A;  1S6L A;  2X0L A;  5D5X B;  2YPR A;  3K69 A;  1CF7 A;  1USS A;  4LLG F;  2FNA A;  5DEQ A;  3MEX A;  3I5U A;  3O6B B;  2DW4 A;  4XLN F;  1AWC A;  5FO5 A;  5IT3 A;  3IRR A;  1CF7 B;  2VOD A;  2UXN A;  2P7C B;  1LDJ A;  2MC3 A;  1O3S A;  2DLL A;  5D4S A;  2CWE A;  3F23 A;  2QBY A;  3ABU A;  2PG4 A;  5AON A;  4IF4 A;  2QQ9 A;  3HTU A;  1MJ9 A;  3FM5 A;  1QZY A;  4HV5 A;  4PCQ A;  2EFN A;  3Q5F A;  3S2W A;  1ON2 A;  1XGN A;  1RZ4 A;  2Z3Y A;  1R00 A;  1HW5 A;  2D2W A;  1HXD A;  4GGG A;  1J2X A;  2OQR A;  3RKW A;  2GA2 A;  2O8X A;  5CVV A;  4LJZ F;  2A3S A;  2M8E A;  4RB2 C;  1P4A A;  2KIF A;  2EV5 A;  3COA C;  2FQ3 A;  4CO8 A;  5E8G A;  4LGW A;  4MQ9 F;  2EJR A;  4LG0 B;  3J80 K;  2E7W A;  1MZB A;  3BJ6 A;  3GLX A;  2V1D A;  2P6T A;  3ZMT A;  2M1B A;  3J80 Z;  5DUI A;  2RNJ A;  2DK5 A;  4B8X A;  3CUQ B;  2QWW A;  2HQN A;  5ERI A;  2YU3 A;  5LEK A;  4MEX F;  1TW2 A;  2FEZ A;  4TV7 A;  4EJU A;  3HRT A;  3K1N A;  3R60 A;  4HA8 A;  2EWN A;  4KFC A;  3MZY A;  4A6E A;  4RB1 A;  2Z99 A;  2L02 A;  3K2Z A;  4I98 B;  5AIP A;  4IHT A;  1P4X A;  2GIV A;  4FX0 A;  2JTV A;  4CGZ A;  2V6C A;  3RKY A;  2F2E A;  4EGY A;  1FBS A;  2DTR A;  5CVJ A;  3TOB A;  5IT9 K;  3L9F A;  4R79 A;  3O2P E;  4HOB A;  1ZGJ A;  1K78 B;  2TDX A;  1W7P B;  3BY6 A;  3HRM A;  2Y48 A;  3KEO A;  2FU4 A;  1OR7 A;  4RB0 A;  4BH9 A;  3ZMU A;  1B6A A;  3HSE A;  1KQ8 A;  3BJA A;  2RV8 A;  6PAX A;  2VT3 A;  2NRA C;  1J59 A;  1E2X A;  3JAM Z;  3EQL F;  1IRF A;  1R7J A;  1Z6R A;  2RVC A;  4YFN F;  4P9F A;  1S7A A;  1UCR A;  3SZP A;  5CVR A;  4DQ2 A;  4G94 A;  2Z9O A;  1P4W A;  1ULY A;  2A6E F;  3P9K A;  3ZMV A;  4G7O F;  2H94 A;  3VEP A;  4KIG A;  1ZLK A;  4HDV A;  3WG9 A;  2ZO4 A;  5CLS A;  1R36 A;  3H92 A;  5TJJ A;  5F1R A;  2C6Y A;  3GWZ A;  1MGT A;  5HS8 A;  1G3S A;  2G9W A;  4U0V A;  4PDK A;  2HYG D;  2XKO A;  2KKO A;  4RGU A;  3FHZ A;  2JT1 A;  1IN7 A;  4XSX F;  1W7P D;  5DDG A;  4B09 A;  4JK1 X;  2BBY A;  3EDP A;  5HDK A;  5BQT A;  2LKP A;  3IL2 A;  2XAQ A;  3GXO A;  1K7A A;  5LGU A;  4CIC A;  1UB9 A;  3K1P A;  1SMT A;  3GO5 A;  3RYP A;  1G4D A;  4QWQ A;  2XAH A;  1S7O A;  2EFP A;  4OIN F;  4L9J A;  4YFK F;  5CVU A;  3WTW C;  1UHM A;  5TRD A;  2QEN A;  4Y17 A;  1TBX A;  3KZZ A;  1T38 A;  2PMH A;  3WTT C;  4HX7 A;  2O61 A;  2J5O A;  1GXQ A;  4Q47 A;  5D8L B;  3JTG A;  1BC8 C;  3E5Q A;  3M8E A;  1HQC A;  1LB2 A;  3ZP5 A;  3C18 A;  4Q4Z F;  4R8H A;  4ZZD A;  3EET A;  3DEU A;  1R23 A;  1RI7 A;  3KLO A;  3WU0 A;  4BHC A;  3WGG A;  2M30 A;  4K2E A;  5D6E A;  1W5S A;  2OD5 A;  3E6C C;  1KYZ A;  4BHP A;  3E6B A;  2UZK A;  3WGH A;  2DK8 A;  2W57 A;  3VB2 A;  2IJL A;  3V8J A;  4MTD A;  4GCV A;  5D5V B;  3LQR A;  3VOD A;  2A68 F;  5JFR A;  1B9N A;  5HLG A;  5K5R A;  1YQA A;  2K27 A;  2GXG A;  5HDN A;  4Z2Y A;  5K1Y A;  3RIR A;  3ZN0 A;  3F8M A;  4KIF A;  1XN7 A;  1IN8 A;  1BM9 A;  4PZJ A;  3ISP A;  3DPL C;  3W6K B;  3GFL A;  3FXQ A;  2VON A;  1AOY A;  2LNB A;  1TLH B;  3F3X A;  2LSO A;  2Y0M A;  5HVQ C;  1YYV A;  2E1C A;  4KMF A;  4OU0 A;  3LWF A;  3HOS A;  2HFH A;  3SFZ A;  2ZXJ A;  1R1T A;  2X4H A;  1I27 A;  4NHJ A;  1O3R A;  2HTJ A;  1KU7 A;  4MNU A;  4NB5 A;  2QBY B;  4WWC A;  4GXO A;  2XUB A;  2BEO A;  2YX4 A;  1G3Y A;  5E1W A;  3FX3 A;  1ZN2 A;  4OIR F;  1FBU A;  3SZT A;  1BIA A;  2PEX A;  3MQ0 A;  5DYM A;  4IJA A;  3QPH A;  3JTH A;  4NQW A;  4LFU A;  3QP5 A;  1T6S A;  1S3J A;  2CW0 F;  3F8B A;  3J81 Z;  4AIH A;  4IHS A;  2V1X A;  1ZHF A;  5L3F A;  2F5C A;  1GHC A;  1YW7 A;  3K1M A;  1YTY A;  1OYI A;  1XDS A;  1EH8 A;  5D8K B;  2NYX A;  1FYL A;  1TQP A;  2HOE A;  3KEQ A;  4OOI A;  1QQI A;  1IN6 A;  1W5T A;  4I7H A;  2H6C A;  1EV7 A;  2BV6 A;  2O3F A;  4YG2 F;  3ECO A;  4M6Y A; 
#chains in the Genus database with same CATH topology
 3ZMD A;  5HLH A;  1POG A;  2PMZ A;  1QA6 A;  2FNP A;  4N9I A;  3TL4 X;  4HQM A;  1D8K A;  2D5V A;  4A3B J;  5FFX A;  1F5T A;  2CYY A;  2EA2 A;  3F8N A;  5EDN A;  3A02 A;  3CO6 C;  1S29 A;  2ID3 A;  1Y1V J;  2K4B A;  2RRE A;  2ZXI A;  1R1U A;  2A69 F;  2FXA A;  2HYF A;  3HSF A;  5D5U B;  3LSK A;  5GAE J;  4BJ6 C;  2XAU A;  3BZK A;  4XK4 A;  2QZ8 A;  4RAY A;  1IDY A;  1Y1W J;  2FBI A;  3S93 A;  2FD5 A;  5H20 A;  3H0D A;  4IQJ A;  1ERD A;  3K4L A;  3KZY A;  2Y31 A;  3F0C A;  2FF4 A;  5JVT A;  1QBJ A;  2WBM A;  2MG4 A;  1O7F A;  2KJB A;  2R0Q C;  5L3E A;  5GAG J;  1YO5 C;  3RZO J;  3B6A A;  1D5Y A;  2GQQ A;  3BPX A;  5IPA A;  4PGH A;  2PQ8 A;  2R7U A;  2IS6 A;  2DMT A;  4G7Z F;  1V5F A;  1SFX A;  3BG6 A;  2VPL A;  1RUO A;  1K4T A;  4CYC A;  3ESW B;  3AG3 H;  4IQ4 A;  3RJP A;  2K40 A;  3JW4 A;  2VKV A;  4S05 A;  3ZOB A;  2HZT A;  3GUD A;  1FOW A;  3GYH X;  4KNY A;  1VTN C;  2O9L A;  3LQQ A;  4NC7 A;  3NAR A;  1QZZ A;  5J40 A;  2XAF A;  2QQB A;  4MLO A;  3S16 J;  1FSE A;  1VI0 A;  2BY1 A;  1T56 A;  3CUQ C;  1FWZ A;  5ED4 A;  3BTC A;  1IF1 A;  1PDN C;  4BQQ A;  1IW7 F;  4RM2 A;  1OCR H;  4KMU X;  3JRE A;  2EA4 A;  1AKH B;  1XS9 A;  3CQZ J;  3R4K A;  4RB3 C;  4ZDP A;  3ZN1 A;  1ZKG A;  3DLL F;  4ZYH A;  2JSP A;  2ZFU A;  2CUE A;  3ZMZ A;  3HOU J;  3CES A;  1S7E A;  4F92 B;  3F8C A;  2EZH A;  2DA4 A;  2O6G E;  2VN2 A;  4S04 A;  2HOS A;  1OCT C;  1OCP A;  2QLZ A;  4XNF A;  4BUP A;  4CCK A;  4CHU A;  5EEA A;  3ECH A;  2VI6 A;  4JOM A;  4RGR A;  2K86 A;  1WVR A;  2R92 J;  2LF7 A;  4CDG A;  1ZG1 A;  1Z3Y A;  2W48 A;  3C1D A;  1D1C A;  1JE8 A;  4RAG A;  1OPC A;  1WCM J;  2H1L A;  3A01 A;  2MH9 A;  4WF2 A;  3KPH A;  2YR2 A;  3RDI A;  5DCM B;  2IA0 A;  2DAO A;  3QOE A;  1AA7 A;  4RLF A;  2M9H A;  1U2W A;  3LSH A;  4EJW A;  1HSJ A;  1PUF A;  3FKI J;  4CUG A;  5J47 A;  1NK2 P;  2HQA A;  4A0Y A;  3CCQ I;  2WAF A;  3LSM A;  2VJI A;  1LJ9 A;  1F36 A;  2BZT A;  4LB6 B;  3OR2 C;  3CC4 I;  1WJF A;  4LG0 A;  1B8I A;  5FJ8 J;  1W0U A;  1MJB A;  1TWG J;  4JX6 A;  4XMY A;  5FKN A;  3WU1 B;  2EFW A;  4IRI A;  4LLL A;  4AID A;  2L7K A;  1OIS A;  1BBY A;  1WH5 A;  1ZEL A;  4A6D A;  1MBJ A;  2F5D A;  2LC2 A;  2D1H A;  4BHB A;  3ML6 A;  3E97 A;  4P96 A;  1XMK A;  3GLL A;  4QLC U;  3I59 A;  3MFK A;  3SQN A;  5CKT A;  3HRS A;  2OTL I;  1R4M B;  3JSO A;  4XRS G;  3EUH C;  3CF2 A;  4MHG A;  3ERE D;  1Z91 A;  2KDZ A;  2M5W A;  1I39 A;  1BC7 C;  3OYB A;  3S1N J;  2B9S A;  3GZ6 A;  5LFA A;  2EV0 A;  1O3T A;  4UHT A;  4DYQ A;  1WPK A;  4B3X A;  3DCF A;  5J3L A;  1T39 A;  3CCJ I;  4ENJ A;  5F0F A;  1ETO A;  5CQG A;  3TGN A;  1MMD A;  5A2Q Z;  3LAP A;  2EK5 A;  1I1S A;  2WB1 A;  2X85 A;  4J19 A;  4DW6 A;  5BS6 A;  4PFO A;  1X2M A;  1RNL A;  2ESH A;  2FMY A;  5FFZ A;  9ANT A;  2DFE A;  3D0S A;  2W24 A;  4DJA A;  3ZQF A;  1VQ5 I;  2NXN B;  2KZV A;  1U5T C;  1T95 A;  1HST A;  3A2K A;  4UB8 C;  2EZK A;  2DCE A;  3RCO A;  3RPU D;  3TDZ C;  2R4G A;  1ZR4 A;  1FPQ A;  2RC4 A;  3L1P A;  2R7S A;  3MAJ A;  3H9G A;  3OYF A;  4W1U A;  2R3S A;  4B4C A;  2ZSI B;  3LA7 A;  4NQW B;  2CFO A;  3H5R A;  4IO9 F;  3UNG C;  1KA8 A;  4ESB A;  2IA2 A;  1Y56 A;  2KMU A;  5D5W B;  1L0O C;  4M71 A;  5KAF C;  1K61 A;  1Y8Q B;  3BPV A;  3CCE I;  2L0K A;  3ZQ7 A;  1SFK A;  2UV1 A;  3N97 A;  3FXO A;  1D1B A;  3HIF A;  1YLF A;  1T98 A;  4CZC A;  4GDF A;  1Z05 A;  1DPR A;  1P9Q C;  2VOO A;  3LFU A;  1IO2 A;  3I55 I;  2RQP A;  1SMY F;  4M9X A;  1XCB A;  4A0X A;  3CUQ A;  2DPD A;  2LBF A;  4DOZ A;  1MH3 A;  3QYF A;  2M7B A;  3PSF A;  4V19 K;  2ZME B;  2IRF G;  2L3D A;  2E1N A;  3ROU A;  3HEF A;  2HR3 A;  1BI0 A;  3IH2 A;  3A1Y A;  1D0X A;  3A4C A;  4KIC A;  3OYG A;  2RAE A;  4B47 A;  4RGS A;  4RS8 A;  4HLY A;  1HW1 A;  1ETQ A;  2K02 A;  2CU7 A;  3L7W A;  3QAH A;  1ZAR A;  4CCM A;  4MO7 A;  5EG0 B;  3FXM A;  2GZW A;  5JR3 A;  5HOD A;  1SD7 A;  5F27 A;  1MBE A;  3P9C A;  1LFB A;  3IKV A;  3QPS A;  4YRV A;  3G73 A;  4BYY A;  1MMS A;  1HW2 A;  3CF5 F;  3NEU A;  5CVI A;  1JJ8 C;  1BN5 A;  2H8W A;  3PJR A;  3R6S A;  4NBQ A;  1H0M A;  3DQV C;  2QVO A;  3KET A;  3HJE A;  4G8X A;  2RKH A;  1LDD A;  3AG2 H;  2GIZ A;  2ZME C;  5J6X A;  2COB A;  3IAS 2;  4LG3 A;  4BQO A;  2OBP A;  1RR8 C;  1IXR C;  2WB1 N;  1J75 A;  3GW2 A;  2R7Z J;  2QUF A;  4IL6 C;  4HDU A;  1MNM C;  5J1U A;  2Q2E B;  3JRG A;  1T2K A;  1ACI A;  2I5U A;  2QYO A;  1MDM B;  1FYK A;  4ZYG A;  1H9T A;  3K2A A;  4A93 J;  3VPR A;  2BOL A;  4A12 A;  3N4M A;  3IWZ A;  2Z1D A;  3CLO A;  1YW9 A;  1GXP A;  1VQO I;  1P7I A;  2LLK A;  5LLQ A;  2P81 A;  3J81 K;  2R7D A;  5BPI A;  3T8T A;  4QTR A;  2D45 A;  2VBZ A;  2ETH A;  2ZKZ A;  3ELK A;  2KT0 A;  3I58 A;  4E7K A;  1Y0U A;  2G7H A;  1U8R A;  1O57 A;  4HRI A;  3H35 A;  2VBW A;  3I4P A;  1FLI A;  3BTL A;  3ULQ B;  2P6S A;  1UMQ A;  2CG4 A;  4I0A A;  4D1Q A;  2UWM A;  2ESN A;  2I10 A;  2ELH A;  2YX7 A;  3HSR A;  4LK1 F;  2DI3 A;  1ZRC A;  2R7O A;  4HV6 A;  1EA3 A;  3OS1 A;  2JMW A;  2BVM A;  1NG7 A;  1Y6I A;  3OOP A;  1TZL A;  1FTT A;  3D5L A;  1W4M A;  2DJI A;  4CXF A;  3PUF A;  2MBF A;  2OAZ A;  3PQK A;  4EJT A;  4XL9 A;  3HYI A;  3I71 A;  3QOP A;  4IOA F;  2K9L A;  4KYW A;  4HZF A;  4F52 A;  4P9U A;  1VFC A;  3AFH A;  2CW7 A;  3LAJ A;  3DU5 A;  3BQZ A;  2QQ8 A;  3RTR A;  4Q48 A;  5J8F A;  1MDM A;  2ELJ A;  4I0B A;  2KPM A;  1ITY A;  4HNU A;  2W85 A;  3SFI A;  2V7F A;  2STW A;  3S1Q J;  4Z6Y A;  4XKW A;  3DPT A;  2VBX A;  1MBG A;  1QPM A;  2BHZ A;  2I8D A;  4I99 C;  2KRF A;  1LNW A;  2JA7 J;  3GX4 X;  2RNG A;  4XLP F;  2L7F P;  1SAU A;  5ICC A;  3KYL A;  5DCF A;  3EUH A;  1EH7 A;  4M73 A;  1Z6T A;  1BW5 A;  3C7J A;  2ZFW A;  4XM3 A;  2A05 A;  4JBA A;  1L3L A;  1YHQ I;  4I01 A;  1SFO J;  4XOT A;  1IGN A;  1WQ2 A;  2UUZ A;  4XKB A;  2KIS A;  3CP2 A;  2R93 J;  1LVK A;  5IOY A;  2M3A A;  2OV7 A;  2HGC A;  2LH9 A;  1OCO H;  5EEG A;  3I53 A;  2CQK A;  1VQ7 I;  4CZZ A;  2F48 A;  4OAZ A;  2GA1 A;  3GZ5 A;  4BY1 J;  4ZC3 A;  3Q3S A;  2DOD A;  2E71 A;  3HOY J;  4YII A;  1SD6 A;  3S3N A;  2VC0 A;  3CDI A;  2L5Q A;  2E1M B;  2M0M A;  3OYE A;  3R0J A;  1YS7 A;  1ONV A;  3JSP A;  3CLQ A;  4M3E A;  3WGI A;  1YIO A;  1DQU A;  2VUM J;  3LSR A;  2OPT A;  1F43 A;  1K6Y A;  4M3G A;  4BE2 A;  4OMY A;  3B02 A;  4BGD A;  2LD5 A;  3ZR8 X;  3CJT B;  2GOX B;  4O5V A;  1XB4 A;  5HLI A;  3PUB A;  1YX5 A;  3K10 A;  1I6X A;  4M6X A;  4G6Q A;  4G6D A;  2QSG X;  1REP C;  3HOW J;  1ZYR F;  2B7E A;  2ZCW A;  3TP3 A;  3CC7 I;  5EF6 A;  1FSH A;  2WAQ N;  1OR7 C;  1NK3 P;  2Q0O A;  4GYG A;  3V7R A;  3GFJ A;  4RDU A;  1MMG A;  4V2F A;  4HAM A;  4JX4 A;  3MZH A;  1TT0 A;  1VQ8 I;  1DPU A;  2HKX A;  1XSX A;  4LB5 A;  1FEX A;  3REO A;  3S8P A;  1ZTR A;  2KZG A;  1U9O A;  2KFD A;  1TP4 A;  3BP8 A;  1S5L C;  5GPA A;  4EM0 B;  3SXY A;  5F04 A;  1B9M A;  2OCC H;  2XRO A;  5FKO A;  3K4K A;  4BNC A;  1MND A;  3DKW A;  1Q1H A;  3HUG B;  2W82 A;  4IHY A;  2BXZ A;  1EKE A;  4EJV A;  3HUG A;  2JA6 J;  4LLN A;  1B1B A;  2R7T A;  2Y0S N;  4N0B A;  3OSF A;  4BKX A;  2KIU A;  2DMU A;  1H89 C;  4H0E A;  3DV8 A;  4HX4 A;  3U1D A;  5E3M A;  1EF4 A;  1ZGA A;  5D4R A;  2OZ6 A;  2CO5 A;  2KIQ A;  1GV5 A;  4M74 A;  1WI3 A;  3W2V A;  1IAW A;  2XGE A;  3BZ6 A;  4IEJ A;  4FCY A;  3IWF A;  1P6R A;  3BR0 A;  2UXX A;  5BNG A;  2DMQ A;  5J1R A;  2TRT A;  4ETS A;  4BXX J;  4I2O A;  1TQI A;  2L01 A;  4UVC A;  1IJW C;  2DO7 A;  1WI9 A;  4FX4 A;  1X1B A;  2Y69 H;  3K4N A;  4LIV A;  3VSK A;  2F5F A;  3EUK L;  1R5H A;  2X48 A;  5AIQ A;  1G59 A;  3MKY B;  3WE3 A;  2XB0 X;  2OA4 A;  2DA3 A;  1KU2 A;  2YSR A;  2VL8 A;  4CSW A;  3HOZ J;  1H88 C;  4G9Y A;  4ABZ A;  2K7L A;  4MFD A;  1KQ9 A;  1JXS A;  5D6F A;  5IT9 Z;  3C3W A;  1D0Y A;  4HNT A;  3A01 B;  4C3H J;  4EQQ A;  3RZD J;  2BY2 A;  5DD4 A;  2A6H F;  3G2B A;  1ON1 A;  3FM3 A;  3R61 A;  4OIP F;  2Z2S B;  1D1A A;  2LRD A;  3G71 I;  3CDH A;  3T1B A;  3LA3 A;  4A69 C;  1HLV A;  4A5M A;  2IA1 A;  2VQH A;  3BTJ A;  4GRI A;  4D5C A;  1X4O A;  3BR3 A;  3IHU A;  1WJD A;  3E6D A;  3G6E I;  5M3F J;  1TTY A;  2XAG A;  3HOT A;  1S8N A;  1Z0X A;  2XGX A;  3KYC B;  3L2C A;  1QU3 A;  1TNT A;  3R0A A;  1BW6 A;  2CUF A;  2MFZ A;  4L5I A;  3GZN B;  4XRF A;  1BI3 A;  3HHH A;  4AD9 A;  4M3B A;  1UST A;  2BXY A;  1Y0N A;  4UV8 A;  4HX8 A;  3T0Y A;  3FXU A;  4Q5S F;  1Z7U A;  2AXT C;  2DFI A;  2GOM A;  5LHI A;  2CGP A;  3BCA A;  5E20 A;  2WV1 A;  3RPU A;  4BQA A;  2X1C A;  4XN3 A;  3BC8 A;  3OYI A;  1O3Q A;  4ZYD A;  3U1K A;  2ECC A;  2WC2 A;  2AQE A;  4BL0 B;  3I56 I;  1OCZ H;  1XX5 A;  2HI3 A;  2VE8 A;  4A0Z A;  2E7X A;  3RPQ A;  1WWX A;  2ZJ2 A;  1X58 A;  2MGQ A;  3FXR A;  1ZK8 A;  4IPA A;  4AIK A;  2DJN A;  1R1V A;  4RAZ A;  1X3U A;  5DV5 A;  2JJ7 A;  3FIS A;  2O8K A;  2JA8 J;  4KT6 A;  1F9N A;  2HEO A;  2IS1 A;  5CJ9 A;  3KZI C;  1YJN I;  1YJ9 I;  2HYJ A;  1IXS B;  1WH7 A;  4D0P A;  4KDP A;  4F91 B;  5E18 F;  1ETW A;  1WGX A;  2M45 A;  2PMZ N;  3BG3 A;  1XPX A;  2ZJR F;  2NOJ B;  2LF8 A;  1U8B A;  1CGP A;  3IRQ A;  2VBY A;  4L5E A;  2X1D A;  3OV8 A;  3KFW X;  2V4J C;  4UB6 C;  5DUK A;  3MKL A;  1ZLJ A;  1OLT A;  1XGO A;  1GV2 A;  2NVT J;  2PN6 A;  3HOX J;  3H5N A;  4U87 A;  3FHN A;  2DDB A;  1FOY A;  5E1Z B;  1B4A A;  2L4A A;  4AVP A;  2LY1 A;  4F3Q A;  1J9I A;  1LVA A;  5EYR A;  5H6R A;  3KP2 A;  2KHM A;  4OWR B;  3TQN A;  2EZI A;  1YE9 A;  3CCS I;  2OF7 A;  4M6Y A;  4R1H A;  3PNT A;  1D5V A;  2EFQ A;  1K6O A;  5ILV A;  3ONQ A;  2FBK A;  3TP0 A;  3QOD A;  5E3O A;  4BU2 A;  3HM5 A;  2D1V A;  1A36 A;  3CO7 C;  2Y2Z A;  4CYD A;  1W0T A;  1W36 C;  5JI6 A;  2X6O A;  1KZH A;  2JVH A;  1LQ1 A;  1G8X A;  2RN7 A;  3FMS A;  2XF6 A;  2LKS A;  4MEY F;  1STZ A;  1TWC J;  1K4S A;  2VOP A;  1XG1 A;  1FT9 A;  3BZC A;  2M7A A;  1SAX A;  5F0H A;  2JRT A;  1TT5 B;  3P9I A;  3K9T A;  4O6J A;  2AS5 F;  4QSH A;  2ZBK A;  4BXF A;  5LRR A;  3WHB A;  3CTA A;  1FC3 A;  4U0W A;  2Y75 A;  1KGS A;  2R7Q A;  2ZNY A;  2P8T A;  5B3S H;  4HST A;  2E35 A;  4Y15 A;  5FLX K;  1DDN A;  1K83 J;  5JHU A;  1N75 A;  2A61 A;  3L09 A;  3FK6 A;  1JT6 A;  2L9R A;  2R7W A;  3TMO A;  1WSU A;  3LA2 A;  1SD5 A;  5L3D A;  2JSC A;  3Q9S A;  2EB7 A;  2P5V A;  1G3T A;  2DYS H;  3BG7 A;  3WU2 C;  4XON A;  1UJ8 A;  3G3Z A;  5DCM A;  2CSO A;  2G0E A;  1JGG A;  1RKW A;  1NHA A;  4ZYE A;  2GXA A;  1GDT A;  3H3Z A;  1FNN A;  4B48 A;  2O5R A;  1LKX A;  2IAI A;  5C3E J;  2ADU A;  3E6M A;  2PJR A;  3K0L A;  2ME6 A;  1SC7 A;  2VQG A;  3SZG A;  3OOU A;  4ESF A;  3DF8 A;  2RQQ A;  3B6C A;  3M3Y J;  1WHU A;  3QU3 A;  1I6H J;  3BJO A;  2IPQ X;  3B73 A;  2CQ7 A;  2DA1 A;  3FIW A;  3OMY A;  1LEB A;  4NC8 A;  3GBG A;  2XPU A;  1KU3 A;  5K5O A;  4BBS J;  3TO6 A;  1UG0 A;  4XLA A;  1GUU A;  2K4J A;  1G6N A;  2EFO A;  5E79 C;  4YEJ A;  2OC6 A;  4FIS A;  2KJC A;  3JRD A;  1HA8 A;  1AKH A;  3WTV C;  2Z16 A;  1V3F A;  1FP2 A;  3RQI A;  2ME0 A;  2FRH A;  2COM A;  4XLE A;  3HBL A;  1ZRE A;  3ZCO A;  3LOC A;  2JZY A;  4A5N A;  2V79 A;  1Z9C A;  3FWE A;  2OU2 A;  4WXH A;  1JJ6 C;  4I09 A;  1ZRD A;  1XGM A;  1YFH A;  4OIO F;  5J8C A;  3GF2 A;  3M1C A;  2CRG A;  1DP3 A;  2FSW A;  4B1R A;  3CJN A;  4IXA A;  3GTM J;  3H9Q A;  1BOB A;  3CCY A;  2QSF X;  2JRM A;  3H9J A;  5KNL A;  2LVS A;  3OY9 A;  1E17 A;  4AU7 A;  3HTS B;  5EEH A;  4X1E A;  2VKH A;  4C2M J;  1FX7 A;  4M72 A;  4BXU A;  3JRB A;  1U0J A;  3MWM A;  1J7K A;  1I5Z A;  2CH0 A;  4ANJ A;  1BOA A;  1OYY A;  4M9Z A;  5L3G A;  1UFM A;  2ZJP F;  4L0Z B;  2L2O A;  4U88 A;  4KIS A;  4MTE A;  3DEW A;  3TDU C;  1WJ5 A;  4QIW N;  3DBL B;  1D0Z A;  1JI8 A;  3O3K A;  4HSR A;  2IT0 A;  1IXC A;  3GFI A;  5FB2 A;  2KQR A;  1TL8 A;  1BI1 A;  1LFP A;  2O7O A;  2DA5 A;  2G7U A;  4P55 A;  2F4M B;  2QM3 A;  3T8R A;  3RKQ A;  2PFB A;  4L9N A;  2CW8 A;  5F64 A;  3DFG A;  5K7Z A;  2W7N A;  3VOE A;  4L18 B;  2W84 A;  3VYU B;  3EYI A;  5FGM A;  4E7H A;  3ABM H;  3FMQ A;  5K7H A;  4IVN A;  3S15 J;  3TO9 A;  4M9S A;  5HS9 A;  3HC7 A;  1I3A A;  1HKT A;  3OS2 A;  3KP3 A;  3OYA A;  1QHG A;  2BE5 F;  4KA4 A;  1K79 A;  4UVB A;  3BDD A;  1VND A;  2H8R A;  2JUC A;  2RGV A;  2GXB A;  1X1P A;  1UZC A;  3F9K A;  4BAC A;  5L3B A;  1IN4 A;  1A04 A;  1IN5 A;  1OMI A;  1DP7 P;  1GVD A;  1RPW A;  2R5Z B;  2L9N A;  3FF5 A;  5LEJ A;  5FD5 A;  3CP8 A;  1RET A;  4PGG A;  3H5A A;  2NAZ A;  3NAU A;  2PJP A;  3P5J A;  3IKT A;  2XAS A;  3OL3 A;  2LY9 A;  3AG1 H;  3E3V A;  1R22 A;  2IVM A;  2EIL H;  2OJE D;  3O8G A;  4NNJ A;  5ICG A;  1FYM A;  1WZ2 A;  2HS5 A;  1JTX A;  4LMY A;  4E7S A;  2GBY A;  4HNV A;  1OJL A;  1XDU A;  5GTI C;  2HDC A;  3BWG A;  3PO2 J;  1ODD A;  4G6T B;  4IRG A;  1RIO H;  1MJA A;  5E3L A;  3LST A;  5M5W J;  5LD2 C;  3Q0V A;  1HDP A;  2XVC A;  1QNT A;  1X2N A;  3K4C A;  4M3F A;  3S2H J;  1JUM A;  2FOK A;  3J7A O;  4KIT B;  5GTH C;  1VQN I;  3M8F A;  4BS9 A;  1TW3 A;  4MQV A;  1ZR2 A;  3ZMS A;  2EQR A;  4E7J A;  2DT6 A;  2K9M A;  3HKZ N;  5GAD J;  4A3L J;  4UUS B;  5HOO A;  1FJL A;  3F6O A;  4XRS A;  2LY2 A;  3ZQG A;  3GTJ J;  1R71 A;  4DBQ A;  2P4W A;  4UUT A;  5EGO A;  1YIT I;  2LBF B;  1TWF J;  3IH3 A;  3M1E A;  4KT5 C;  5ICE A;  1QO0 D;  1U78 A;  4AWX B;  2HQ5 A;  2NS0 A;  1LE8 A;  2H09 A;  3TOA A;  1DGW Y;  1FP1 D;  1VF9 A;  2ECB A;  4FTH A;  4EGZ A;  2AXL A;  4E70 A;  4XBF A;  2AQF A;  4LIU A;  1WJE A;  2HOT A;  3FDY A;  4ZTJ A;  1SFU A;  4FHT A;  3S3O A;  4RA2 A;  3RI4 A;  4WXC A;  5BPD A;  4IOC F;  2FA5 A;  1XC5 A;  3V8K A;  1APL C;  1D3Y A;  1B8I B;  5C4X J;  4ZZL A;  4KN7 X;  3E5X A;  1JKQ C;  1D8J A;  3BQY A;  4EMS A;  5ILU A;  2VE9 A;  2OUM A;  3W6J B;  2E2H J;  2KP6 A;  2M8G X;  5FRN A;  3CDL A;  1O4X A;  1PP8 F;  2QGU A;  1X4P A;  1FZP B;  5A2Q K;  3EYY A;  1ZH5 A;  4KUM A;  1LEA A;  3FXJ A;  2OZU A;  1V55 H;  3PFI A;  1C0W A;  2H6B A;  3X2Q H;  1MD0 A;  4BAY A;  1U6G A;  4JQF A;  4II3 A;  1QPI A;  2XKP A;  2MW8 A;  3G1M A;  4XRM A;  3LFK A;  1O7L A;  4FE7 A;  2Z33 A;  1QVT A;  4B43 A;  1LDK B;  5LBQ A;  2LTP A;  3RQ4 A;  4CYC B;  2GWR A;  2CQX A;  3DU6 A;  4I02 A;  2GLO A;  3S1M J;  1HC8 A;  4C2T A;  4KJZ A;  5LGT A;  4Y13 A;  4XOR A;  3IAM 2;  1DUX C;  1BR4 A;  3CUO A;  4KIB A;  5B1A H;  4E7Z A;  4DYR A;  1SAN A;  4D5F A;  2R5Y B;  4EVI A;  2Z5U A;  2J5P A;  2ZNZ A;  2DMN A;  4ENM A;  4XSZ F;  3VYR B;  3IUO A;  5ICF A;  1RR7 A;  2H27 A;  2MLK A;  1OKR A;  1HBX G;  3WTZ A;  2XHK A;  3I59 B;  3WTY C;  2HWV A;  5LHG A;  2XSD C;  5IP9 J;  3QRF F;  3PQJ A;  3E7L A;  2EIN H;  3TED A;  2DPU A;  2XIG A;  3CD6 I;  4B3A A;  2K5C A;  1IDZ A;  3D1N I;  1T0F A;  4LK0 F;  4BEH A;  5K5Q A;  3OR1 C;  3EUA A;  2JPB A;  2V9P A;  4EJO A;  3BR1 A;  3V42 A;  5E17 F;  2DT5 A;  2QSH X;  2CS3 A;  3KP7 A;  4DGW B;  3IH4 A;  5HNH A;  2PLY A;  3K7A J;  5H6Q A;  3KLN A;  1V4R A;  1R58 A;  4Y4R A;  1HDD C;  1BL0 A;  3BR2 A;  3ZGK A;  3OIQ A;  2HVS A;  2EIJ H;  5DM7 F;  5JHF A;  1F4K A;  1IV6 A;  2IGO A;  1KU9 A;  3F72 A;  4IRH A;  4XOP A;  1M1E B;  1W7P A;  3BLY A;  5LGN A;  3PIO F;  3BRO A;  5GP9 A;  3V8L A;  1ORK A;  2F6C A;  4DIQ A;  1NTC A;  3M07 A;  4ESJ A;  2IXS A;  4ZYA A;  3CCR I;  1TC3 C;  3V7S A;  2O0Y A;  5IYB J;  4P5O A;  2L9S A;  2EIM H;  2DT7 B;  1JHF A;  4ZTF A;  2PI0 A;  3KCC A;  2VXZ A;  5HLT A;  1R5G A;  4U7D A;  4OAY A;  2A07 F;  4MGR A;  2NOG A;  1XD7 A;  1P2F A;  1I50 J;  1YS6 A;  2LDU A;  2P5K A;  4PJL A;  5DTD A;  3JAM K;  4O3M A;  4L9T A;  4N9H A;  1WJA A;  1P7J A;  3DP7 A;  4NC6 A;  4F7Z A;  2XRN A;  5KVR A;  1B59 A;  2QQA A;  1N25 A;  3RYR A;  3ZQL A;  1XMA A;  2DBB A;  1J5Y A;  1QRY A;  2IP2 A;  3FXL A;  3P7N A;  4IHX A;  2EIK H;  1MMA A;  2LP0 A;  2ZB9 A;  2STT A;  3QYE A;  4G7H F;  4EM1 A;  3W2A A;  1I1G A;  4XLF A;  4ENN A;  3MMY B;  3WTX C;  1DU0 A;  1PUE E;  4LIT A;  2K3P A;  2V9V A;  3V4G A;  4EM2 A;  1XCV A;  1VQP I;  1MIJ A;  2MYS A;  2W25 A;  2WY8 Q;  1BI2 A;  3QU6 A;  3FMR A;  3OYC A;  3L2Q A;  3NQO A;  4ENK A;  1DU6 A;  3SEQ A;  1LUJ B;  4G12 A;  5HS7 A;  4HF1 A;  4UXN A;  2DDA A;  2WWY A;  4ZDO A;  3OWT A;  1B72 A;  2E2I J;  1QZE A;  1FOK A;  1ZG5 A;  2NVX J;  1IRZ A;  1KON A;  3G4S I;  3ZQH A;  4M3D A;  4EAT A;  3VYS B;  4WX9 A;  3NWS A;  4U7B A;  1E3O C;  3T5X A;  2DOA A;  2CMP A;  2XDV A;  3A0H C;  4OMZ A;  3J7A Y;  1Z21 A;  1AU7 A;  1G3W A;  1J0R A;  3WE2 A;  4HF2 A;  1YI2 I;  1G2H A;  2XAJ A;  3WTU C;  2MD5 A;  3OYM A;  3LSG A;  4WK8 F;  4RGX A;  3E1S A;  3SHF A;  2E1M C;  1SD4 A;  1FY7 A;  2MLG A;  1XSD A;  2DQL A;  2A5Y B;  2JQ7 A;  1HKS A;  2W00 A;  1ETY A;  2PBI A;  1R9T J;  3Q0U A;  2XGC A;  3CCU I;  3WTS C;  1TQM A;  3QP6 A;  3TO7 A;  3GVA A;  1HCR A;  2A6T A;  4HBL A;  3AAF A;  2XF5 A;  4XLC A;  1MBK A;  1WJC A;  2RDP A;  2WAQ A;  3O8H A;  1KYW A;  1UG2 A;  1MSE C;  1PJR A;  2LK2 A;  5LRS A;  1YG2 A;  3LSI A;  3U9G A;  2HKO A;  3ABK H;  2NS7 A;  4A2U A;  3SDG A;  2VKE A;  3BT9 A;  1TNS A;  4YFX F;  3PL8 A;  2XV4 S;  2MH2 A;  4C3J J;  4UNO A;  1SVO A;  4L9V A;  2HTS A;  2P5L C;  2O03 A;  1E3H A;  2H1K A;  1OFC X;  1EH6 A;  2LMD A;  3E5U A;  3L2W A;  5KHD A;  4L5J A;  3KP5 A;  5L3C A;  3F22 A;  1RUN A;  3I64 A;  4HQE A;  1QHH D;  4YIF A;  2TCT A;  5FD6 A;  4FET A;  3KE2 A;  4UY8 I;  3ZQQ A;  4BJT A;  3ZQC A;  4JX5 A;  4D9J A;  3RKX A;  3CJR B;  3AKZ A;  3SJM A;  2ACJ A;  1H9G A;  3QQA A;  3HHG A;  1Q1V A;  3OYH A;  2NNN A;  2AHQ A;  2ZME A;  4DZJ A;  4ZH4 F;  3W6V A;  1XSV A;  5CYV A;  2WAE A;  3S32 A;  1BR2 A;  1JGS A;  5B66 C;  3VSL A;  5FLX Z;  4J01 A;  4AIJ A;  4E6K G;  4FAS D;  2VC1 A;  2XC7 A;  1UHW A;  2KRC A;  1F1Z A;  4HF0 A;  1GVJ A;  3RSN A;  2QA4 I;  4ITV A;  2KIM A;  2VQC A;  1VQL I;  2B0L A;  4XN0 A;  3OL4 A;  2MA3 A;  3NRV A;  1K78 A;  4UUS A;  2L4M A;  3BOQ A;  1QGP A;  2PMU A;  2BW3 A;  5E8I A;  3HRU A;  3BR6 A;  1ZG3 A;  1SFE A;  4PJJ A;  2GAU A;  2OQG A;  3IC7 A;  1Y39 A;  3QPT A;  1ZAO A;  1XTA A;  4V2G A;  1X3Z B;  5BMZ A;  4UVA A;  1SEU A;  1JHH A;  3H3U A;  1R5I D;  4UUV A;  1FTZ A;  3Q0W A;  3L2V A;  3GME A;  1Z7L A;  3Q9V A;  1U5T A;  1IZ1 A;  4DNC A;  1MH4 A;  2KDO A;  4DYC A;  4FT8 A;  3J7Y J;  2JA5 J;  1N78 A;  2YS9 A;  1VQ4 I;  4A3I J;  2EPF A;  1P92 A;  4ZDL A;  4IZZ A;  4Y33 A;  3DXJ F;  2DYR H;  4E7I A;  2E5N A;  2P7V B;  1ZRF A;  1OYW A;  2DU9 A;  2EV6 A;  3C2H A;  3FZV A;  4E4H A;  4KN4 X;  2M87 A;  3HPH A;  3ASO H;  4ON0 A;  5HNF A;  5GPC A;  3CCM I;  5GAH J;  4RAF A;  4CH7 A;  3ZPL A;  3KP4 A;  3W3C A;  4U0Y A;  3G1L A;  4GYI A;  5F0C A;  2OCE A;  2NVQ J;  3WOD F;  2AO9 A;  2DQR A;  2IS2 A;  2DFF A;  2ELK A;  3F6V A;  2VJ4 A;  3L00 A;  3OIO A;  4BY7 J;  4ZJZ A;  1JT0 A;  2FE3 A;  3F21 A;  4IHW A;  3I54 A;  4A3G J;  3GFM A;  5F6F A;  1JKR C;  3U2R A;  3L2R A;  3M7G A;  1BJA A;  2NNY A;  2P0W A;  2WV0 A;  3HB9 A;  3ABT A;  1T33 A;  2JPC A;  5CPR B;  2JK3 A;  1MKM A;  1IUY A;  4PSW A;  2XSJ C;  1Z1D A;  4HW0 A;  3I0T A;  5EZH A;  2K3F A;  2LRE A;  5HDG A;  3I3L A;  3KP6 A;  1ETK A;  2CJJ A;  2F4O B;  2HOA A;  2JUG A;  5J1Y A;  5ILS A;  1W1W E;  5DD8 A;  4CA0 A;  3TBI A;  3GEZ A;  4UV9 A;  5BOX A;  4HYE A;  4OIQ F;  1EJ9 A;  1YW8 A;  1RKT A;  2M4G A;  4W97 A;  2ISY A;  3MN2 A;  5K7F A;  1Z77 A;  2VT2 A;  3M9A A;  2X6W A;  3JR9 A;  3C2G A;  4CCN A;  1T8I A;  4IHV A;  3BG5 A;  4Y7N J;  4QPO A;  4HG2 A;  4L0Y B;  2WTE A;  2IW5 A;  2EH3 A;  2X6Y A;  1PVE A;  5EZG A;  3JRI A;  3TKY A;  5FKK A;  2FBH A;  4WCG A;  1BIB A;  3F8F A;  2Q2E A;  2BYV E;  2K9N A;  2F5E A;  3UR3 C;  3S2D J;  4GO1 A;  5C4J J;  1IG7 A;  2Y30 A;  4BE1 A;  4A3J J;  2V1U A;  4N4O B;  1S9H A;  1XGS A;  5JLW A;  1FMV A;  1ETV A;  1E0E A;  1WKM A;  1HKQ A;  2ISZ A;  2FOW A;  3V7C A;  1FBQ A;  1IRG A;  1U3E M;  2DOF A;  1PP7 U;  2Q8K A;  1GLN A;  3BR5 A;  2R7F A;  1FIA A;  4WXD A;  4Y3O A;  1R6R A;  1UEL B;  2DFH A;  4GFB A;  3MVP A;  2FML A;  1HF0 A;  4BBR J;  1U5T B;  4JP0 A;  3SYT A;  4ASN A;  2V6E A;  3WG7 H;  1JKP C;  5E1X A;  2BGC A;  2K85 A;  4EV0 A;  5KK1 A;  2CFX A;  1KQ0 A;  2PJR B;  3DEE A;  3VFZ A;  3ZRG A;  5LHH A;  3AL0 B;  4XIC A;  3JRA A;  3MCZ A;  2HQR A;  1WRJ A;  4LD5 A;  4AYB N;  4HLX A;  1S6L A;  2X0L A;  5D5X B;  3LSJ A;  5IOZ A;  2YPR A;  3K69 A;  4CCJ A;  3W2W A;  1AHD P;  4P1W A;  1CF7 A;  1USS A;  2HXO A;  4LLG F;  2CV2 A;  2VJJ A;  2FNA A;  5DEQ A;  3OYD A;  3MEX A;  3I5U A;  3O6B B;  3CC2 I;  2DA7 A;  2DW4 A;  2MD0 A;  4XLN F;  3D5R C;  3HGY A;  1AWC A;  5FO5 A;  5IT3 A;  4DZP A;  2QEX I;  3IRR A;  4II2 A;  3ZXS A;  1CF7 B;  2VOD A;  3QWL A;  4A3C J;  2UXN A;  2P7C B;  4X0G A;  3K70 D;  2KRH A;  4D7N A;  1LDJ A;  1T08 B;  2IGK A;  3I9V 2;  5C44 J;  4F55 A;  4IKF A;  2X1E A;  2MC3 A;  2DLL A;  1O3S A;  5D4S A;  2CWE A;  3FXK A;  3F23 A;  2QBY A;  3ABU A;  2DN0 A;  2PG4 A;  5AON A;  4IF4 A;  3KX2 A;  3DKX A;  3M8J A;  2QQ9 A;  3DLA A;  3HTU A;  4NDL A;  2NS8 A;  1MJ9 A;  3FM5 A;  4MIM A;  2JVG A;  1QZY A;  4HV5 A;  4PCQ A;  2CV0 A;  2EFN A;  3Q5F A;  3I4N J;  3S2W A;  4D7M A;  5IP6 A;  3HGG A;  1ON2 A;  1XGN A;  1RZ4 A;  2M4K A;  2Z3Y A;  1R00 A;  1HW5 A;  2D2W A;  1MSF C;  2CV1 A;  1HXD A;  4GGG A;  1FIP A;  3HZJ A;  1J2X A;  2JN6 A;  2ICW G;  5DM6 F;  2OQR A;  3RKW A;  3PSI A;  2VKD A;  2VLA A;  2GA2 A;  4YEL A;  3FBN B;  2O8X A;  3OYL A;  4RMN A;  1FOX A;  3SDB A;  5IP7 J;  5CVV A;  2YU9 J;  4LJZ F;  2A3S A;  2HU9 A;  1NH3 A;  2M8E A;  1U9N A;  2A5W A;  1E3P A;  4RB2 C;  2IGM A;  1MBH A;  1P4A A;  3FKJ A;  2MAB A;  3PM1 A;  2KIF A;  2EV5 A;  2Y0S A;  3COA C;  4C30 A;  2FQ4 A;  3N05 A;  2FQ3 A;  4CO8 A;  5E8G A;  4LGW A;  2FX0 A;  4MQ9 F;  5KCM A;  2ZJQ F;  2EJR A;  3DBR B;  4LG0 B;  4XLH A;  3BTI A;  4AM3 A;  2DOE A;  2E7W A;  3J80 K;  1MZB A;  3BJ6 A;  3GLX A;  3J7Z I;  2V1D A;  2IGN A;  4RBO A;  2NVU B;  1PUF B;  4C9Y A;  3PIP F;  2P6T A;  3OYN A;  3U21 A;  3ZMT A;  2FUG 2;  3PO3 J;  1A6I A;  2M1B A;  3J80 Z;  5DUI A;  1RRJ A;  2E5Z A;  2RNJ A;  3TW7 A;  2DK5 A;  3GTO J;  4A3K J;  4B8X A;  2IEK A;  3CUQ B;  2X9D A;  5FKL A;  2QWW A;  2HQN A;  2W1O A;  5ERI A;  3HXL A;  3K6G A;  2B63 J;  3G1O A;  3JRC A;  5JVG F;  1XMX A;  2YU3 A;  5LEK A;  1YX3 A;  3VDX A;  4NUB A;  4MEX F;  2OTJ I;  1TW2 A;  3JRF A;  3EPZ A;  4IX7 A;  2FEZ A;  1YRN A;  2R7X A;  4TV7 A;  4QPQ A;  4EJU A;  3HRT A;  1W5C C;  5B1B H;  4DBR A;  3K1N A;  4XKC A;  3R60 A;  4HA8 A;  2IS4 A;  1MNE A;  2EWN A;  3S1R J;  4KFC A;  1ETX A;  3MZY A;  4A6E A;  4RB1 A;  2Z99 A;  3H1C A;  2L02 A;  1A35 A;  3OIP A;  3K2Z A;  4I98 B;  5AIP A;  3ABL H;  1PYV A;  4IHT A;  1P4X A;  2X6X A;  4A3D J;  2M0C A;  5M5X J;  2GIV A;  3GTK J;  3DKY A;  1JTY A;  4FX0 A;  1Y8R B;  1BA5 A;  2JTV A;  3KEY A;  4CGZ A;  3S14 J;  2V6C A;  3OS0 A;  1FMW A;  3K70 C;  3RKY A;  3TW6 A;  2E19 A;  3VWB A;  2F2E A;  3FK7 A;  4EGY A;  1FBS A;  4AYB A;  2DTR A;  2XB5 A;  4PFP A;  5CVJ A;  3A03 A;  5JLX A;  1GT0 C;  3CME I;  5TIS C;  3TOB A;  5IT9 K;  4AUX A;  4PJN A;  4PJ0 C;  3L9F A;  3GTG J;  4R79 A;  4JYK A;  3OSG A;  3O2P E;  4HOB A;  4A3E J;  2EBI A;  3OYK A;  5M3M J;  1YRN B;  2R5Z A;  1ZGJ A;  1S72 I;  1K78 B;  2BY3 A;  2HXI A;  3ERM A;  1SVL A;  2TDX A;  1DGR M;  3DTK A;  5F1J A;  1W7P B;  1X19 A;  2EZL A;  3BY6 A;  2K9Q A;  3HRM A;  3MKZ A;  2Y48 A;  3KEO A;  2FU4 A;  5J4V A;  3HKZ A;  4M6V A;  1OR7 A;  4PUS A;  2BVL A;  3SEZ A;  1HOM A;  2E1O A;  3E0J B;  4H4K C;  4RB0 A;  4BH9 A;  3ZMU A;  5B5E C;  1B6A A;  2ZSH B;  3HSE A;  3CZ6 A;  1KQ8 A;  5IY5 H;  3BJA A;  2RV8 A;  6PAX A;  2VT3 A;  2NRA C;  1J59 A;  2DTZ A;  1E2X A;  3JAM Z;  3EQL F;  1IRF A;  1R7J A;  1Z6R A;  2RVC A;  4YFN F;  4P9F A;  3S17 J;  1S7A A;  1UCR A;  3SZP A;  2XGD A;  2KLO A;  5CVR A;  4XKV A;  4DQ2 A;  2HDW A;  4YIR X;  4BDZ A;  2QCO A;  4G94 A;  2Z9O A;  1P4W A;  1ULY A;  2A6E F;  2CQN A;  3P9K A;  3M4O J;  3ZMV A;  3UKG A;  4G7O F;  2H94 A;  3VEP A;  2R5Y A;  4J00 A;  4KIG A;  3NWT A;  1R4N B;  1ZLK A;  3AG4 H;  4HDV A;  2V1N A;  3K4M A;  3WG9 A;  2ZO4 A;  3C2B A;  2YUS A;  1TWH J;  5CLS A;  1V5E A;  1X1A A;  1ZQ3 P;  1R36 A;  2ZC2 A;  3H92 A;  5TJJ A;  5F1R A;  1TWA J;  3BG9 A;  2C6Y A;  4I76 A;  1A31 A;  2M34 A;  3GWZ A;  1R49 A;  2E2J J;  5IYD J;  4HPQ A;  3VYT B;  1MGT A;  5HS8 A;  2LFB A;  1G3S A;  2G9W A;  4U0V A;  4A3F J;  4PDK A;  2HYG D;  2XKO A;  2KKO A;  4PJM A;  4RGU A;  2WAD A;  3FHZ A;  1X1C A;  2JT1 A;  3HDD A;  1IN7 A;  1IRX A;  1W7P D;  4XSX F;  4B09 A;  5DDG A;  4F93 B;  4JK1 X;  1MBF A;  2BBY A;  3EDP A;  5HDK A;  2E34 A;  5BQT A;  2F4I A;  3CMM A;  2LKP A;  2DA2 A;  3IL2 A;  2XAQ A;  2VIX A;  4PK4 A;  5FRM A;  3LSP A;  3DTE A;  3GXO A;  3LMM A;  5IYC J;  1K7A A;  2LYC A;  5M5Y J;  1IC8 A;  5LGU A;  2L9V A;  4CIC A;  2VQL A;  2VAS A;  1UB9 A;  2HZD A;  2PX9 A;  1RC9 A;  3K1P A;  4CCL A;  4HEA 2;  1SMT A;  3GO5 A;  4XID A;  1VQM I;  3RYP A;  3S3M A;  1WFX A;  1G4D A;  4QWQ A;  2XAH A;  1S7O A;  2EFP A;  3IP4 B;  4OIN F;  5H2F C;  4L9J A;  4A3M J;  1RES A;  5TGT A;  4YFK F;  1LE8 B;  2BY0 A;  3H0G J;  5CVU A;  2N8G A;  3WTW C;  3H36 A;  1LFU P;  1UHM A;  2IBD A;  5E3N A;  5TRD A;  3HG9 A;  4EEF G;  2QEN A;  5EGO B;  3WHC A;  3GTQ J;  1SVM A;  2HNH A;  4Y17 A;  1TBX A;  4FE4 A;  3AL0 C;  3KZZ A;  3DTI A;  1T38 A;  4BE0 A;  2PMH A;  3K4B A;  3WTT C;  4HX7 A;  2O61 A;  1CQT A;  2J5O A;  1GXQ A;  3LNQ A;  4Q47 A;  2K9S A;  2QF7 A;  5D8L B;  3JTG A;  1BC8 C;  4C3I J;  3E5Q A;  3M8E A;  3PNV A;  1HQC A;  1LB2 A;  3D5S C;  3HPG A;  3ZP5 A;  3JCU C;  1UAA A;  3C18 A;  1I3Q J;  3CMA I;  4Q4Z F;  2L7M P;  1OCC H;  2ID6 A;  2HVQ A;  4R8H A;  2E36 A;  4ZZD A;  1H8A C;  3PNY A;  4MFE A;  2GM4 A;  1NG6 A;  3EET A;  5KAI C;  2JA2 A;  5FLV A;  1YOV B;  1A6Q A;  3DEU A;  2MSY A;  2BW3 B;  1IUF A;  2X51 A;  1R23 A;  1RI7 A;  3FBI B;  3KLO A;  3WU0 A;  4BHC A;  3WGG A;  3DPU A;  2M30 A;  1J09 A;  4K2E A;  5DS9 A;  5D6E A;  2MC4 A;  2WY7 Q;  1W5S A;  5FKM A;  1BR1 A;  2JWT A;  2KL4 A;  2OD5 A;  2XPV A;  5J4Y A;  3E6C C;  4PSX A;  1KYZ A;  4BHP A;  2Y9Y A;  4LOC A;  2M2E A;  3BCB A;  3E6B A;  4FQG A;  3GTL J;  2UZK A;  3WGH A;  2DK8 A;  1UHS A;  1LPQ A;  2W57 A;  3OYJ A;  3VB2 A;  2IJL A;  3V8J A;  4MTD A;  3ZQI A;  4GCV A;  3HL2 A;  1VZ0 A;  3LQR A;  5D5V B;  2V26 A;  3VOD A;  2A68 F;  4BDY A;  2L7Z A;  1YIJ I;  4BJ5 C;  1ZGW A;  4XQF A;  4XR6 A;  5JFR A;  1B9N A;  5HLG A;  1V5G A;  5K5R A;  1YQA A;  2CUZ A;  2K27 A;  4BEH B;  1IV8 A;  2GXG A;  1JUP A;  5HDN A;  2XF7 A;  3MZ8 A;  4Z2Y A;  5K1Y A;  3H3V K;  1JUS A;  3RIR A;  3ZN0 A;  3F8M A;  4KIF A;  1XN7 A;  1IN8 A;  2DXI A;  2CQQ A;  2VXD A;  1BM9 A;  4PZJ A;  3ISP A;  2W4S A;  3DPL C;  3K4J A;  2VPR A;  3LL7 A;  3W6K B;  3GFL A;  3FXQ A;  2LR8 A;  2VON A;  1AOY A;  1ENH A;  3HOV J;  2LNB A;  2R7R A;  2VJ5 A;  1TLH B;  2V9K A;  3F3X A;  2LSO A;  2Y0M A;  2F5V A;  1X1D A;  1YYV A;  2XRL A;  5HVQ C;  2R7V A;  3CJQ B;  2E1C A;  4KMF A;  3QYB A;  1BJZ A;  4OU0 A;  3LWF A;  3HOS A;  4C2U A;  2HPI A;  2HFH A;  2NVY J;  3SFZ A;  2ZXJ A;  1R1T A;  5FRO A;  2X4H A;  2Y9Z A;  1I27 A;  4NHJ A;  5EG0 A;  1O3R A;  1N77 A;  4Y52 J;  3GCM A;  2HTJ A;  3DWL E;  2HPM A;  1JKO C;  4N4N B;  2E60 A;  1KU7 A;  4MNU A;  3MKW B;  4NB5 A;  2QKM B;  2QBY B;  4BQN A;  3QPL A;  4S0H B;  1Z67 A;  4WWC A;  1T0F C;  3I4M J;  4RLQ A;  4GXO A;  2XUB A;  3KIO A;  3CCL I;  3GTP J;  2BEO A;  2YX4 A;  3PFY A;  3L2U A;  1G3Y A;  5E1W A;  3FX3 A;  4E7L A;  1ZN2 A;  4OIR F;  1OQY A;  1B72 B;  1A5J A;  1MW7 A;  2BHY A;  1FBU A;  2DA6 A;  3SZT A;  4CCO A;  3DBH B;  1BIA A;  2PEX A;  3MQ0 A;  5F08 A;  3CCV I;  1MMN A;  5DYM A;  4RM3 A;  4IJA A;  3QPH A;  1V54 H;  2LKX A;  2CUJ A;  3JTH A;  2QKL B;  3JRH A;  4NQW A;  5FLM J;  4AVZ A;  4LFU A;  3ASN H;  1VQK I;  3QP5 A;  1T6S A;  1S3J A;  2CW0 F;  3F8B A;  1WJB A;  2HDD A;  5CQE A;  2FJ1 A;  5EJC A;  3J81 Z;  4AIH A;  3IV5 A;  3KYD B;  1X3W B;  2WA0 A;  2V1X A;  1ZHF A;  5L3F A;  1YJW I;  4IHS A;  2F5C A;  1GHC A;  4X6A J;  1YW7 A;  3K1M A;  1YTY A;  2ZXH A;  1OYI A;  1XDS A;  1W36 D;  1EH8 A;  5D8K B;  2XPW A;  2DMP A;  2NYX A;  3CMY A;  2Q1Z B;  1FYL A;  1TQP A;  2HOE A;  2VB6 A;  1Z3X A;  3KEQ A;  4OOI A;  2LOO A;  4AC0 A;  3A0B C;  1QQI A;  1VQ6 I;  4B44 A;  1IN6 A;  1W5T A;  4I7H A;  1VQ9 I;  2LG4 A;  2H6C A;  3MD2 A;  1EV7 A;  1QVU A;  2BV6 A;  2O3F A;  2ZXW H;  2HVR A;  4YG2 F;  3ECO A;  2L54 A;  4I6Z A; 
#chains in the Genus database with same CATH homology
 3ZMD A;  5HLH A;  2FNP A;  4N9I A;  4HQM A;  1D8K A;  5FFX A;  1F5T A;  2CYY A;  2EA2 A;  3F8N A;  3CO6 C;  1S29 A;  2K4B A;  1R1U A;  2A69 F;  2FXA A;  2HYF A;  3HSF A;  5D5U B;  2QZ8 A;  4RAY A;  2FBI A;  5H20 A;  3KZY A;  2FF4 A;  5JVT A;  1QBJ A;  1O7F A;  2KJB A;  5L3E A;  1YO5 C;  2GQQ A;  3BPX A;  4PGH A;  2PQ8 A;  4G7Z F;  1SFX A;  1RUO A;  3RJP A;  3JW4 A;  4S05 A;  2HZT A;  3GUD A;  3GYH X;  4KNY A;  1VTN C;  3LQQ A;  1QZZ A;  2XAF A;  2QQB A;  1FSE A;  3CUQ C;  1FWZ A;  5ED4 A;  1IF1 A;  1PDN C;  1IW7 F;  4KMU X;  2EA4 A;  3R4K A;  4RB3 C;  3ZN1 A;  4ZYH A;  3ZMZ A;  3F8C A;  2O6G E;  2VN2 A;  4S04 A;  2QLZ A;  4CHU A;  3ECH A;  4RGR A;  2K86 A;  2LF7 A;  4CDG A;  1ZG1 A;  3C1D A;  1JE8 A;  1OPC A;  2MH9 A;  4WF2 A;  2YR2 A;  3RDI A;  5DCM B;  2IA0 A;  2DAO A;  1U2W A;  4EJW A;  1HSJ A;  4A0Y A;  1LJ9 A;  4LB6 B;  4LG0 A;  1MJB A;  3WU1 B;  2EFW A;  4IRI A;  4LLL A;  1BBY A;  4A6D A;  2F5D A;  2D1H A;  4BHB A;  3ML6 A;  3E97 A;  4P96 A;  1XMK A;  4QLC U;  3I59 A;  3MFK A;  3SQN A;  3HRS A;  3JSO A;  4MHG A;  3ERE D;  1Z91 A;  2M5W A;  1BC7 C;  3GZ6 A;  2EV0 A;  1O3T A;  4UHT A;  1T39 A;  4ENJ A;  3TGN A;  5A2Q Z;  3LAP A;  2EK5 A;  1I1S A;  5BS6 A;  1RNL A;  2ESH A;  2FMY A;  5FFZ A;  3D0S A;  2W24 A;  1U5T C;  1HST A;  3TDZ C;  1FPQ A;  2RC4 A;  3MAJ A;  2R3S A;  3LA7 A;  1KA8 A;  4ESB A;  2IA2 A;  5D5W B;  1L0O C;  4M71 A;  3BPV A;  3ZQ7 A;  3N97 A;  2L54 A;  3HIF A;  1YLF A;  1T98 A;  1Z05 A;  1DPR A;  2VOO A;  2RQP A;  1SMY F;  4M9X A;  1XCB A;  4A0X A;  3CUQ A;  2DPD A;  2ZME B;  2IRF G;  2L3D A;  2E1N A;  3ROU A;  2HR3 A;  1BI0 A;  4KIC A;  4RGS A;  4RS8 A;  4HLY A;  1HW1 A;  3L7W A;  2K02 A;  3QAH A;  1ZAR A;  2GZW A;  5JR3 A;  1SD7 A;  3P9C A;  3IKV A;  3G73 A;  4BYY A;  1HW2 A;  3NEU A;  5CVI A;  1BN5 A;  3R6S A;  1H0M A;  3DQV C;  2QVO A;  3KET A;  4G8X A;  2RKH A;  1LDD A;  5J6X A;  2OBP A;  1IXR C;  1J75 A;  3GW2 A;  2QUF A;  4HDU A;  1T2K A;  2QYO A;  1MDM B;  1FYK A;  4ZYG A;  1H9T A;  4A12 A;  3N4M A;  3IWZ A;  3CLO A;  1YW9 A;  1GXP A;  3J81 K;  5LLQ A;  5BPI A;  2R7D A;  3T8T A;  2D45 A;  2VBZ A;  2ETH A;  2ZKZ A;  3ELK A;  3I58 A;  1Y0U A;  2G7H A;  1U8R A;  1O57 A;  2VBW A;  3I4P A;  1FLI A;  3ULQ B;  2P6S A;  2CG4 A;  4I0A A;  2UWM A;  2ESN A;  2ELH A;  2YX7 A;  3HSR A;  4LK1 F;  2DI3 A;  1ZRC A;  4HV6 A;  3OOP A;  3D5L A;  1W4M A;  4CXF A;  2MBF A;  2OAZ A;  3PQK A;  4EJT A;  3HYI A;  3I71 A;  3QOP A;  4KYW A;  4HZF A;  4P9U A;  3LAJ A;  3RTR A;  5J8F A;  4Q48 A;  1MDM A;  4I0B A;  2W85 A;  2STW A;  3DPT A;  2VBX A;  1QPM A;  2KRF A;  1LNW A;  3GX4 X;  4XLP F;  5ICC A;  5DCF A;  3EUH A;  1EH7 A;  4M73 A;  1Z6T A;  3C7J A;  2ZFW A;  4JBA A;  1L3L A;  4I01 A;  1WQ2 A;  2HGC A;  5EEG A;  3I53 A;  2CQK A;  4CZZ A;  2GA1 A;  3GZ5 A;  4YII A;  1SD6 A;  2VC0 A;  3R0J A;  1YS7 A;  1ONV A;  3JSP A;  3WGI A;  1YIO A;  4OMY A;  3B02 A;  4O5V A;  5HLI A;  1XB4 A;  1I6X A;  4M6X A;  4G6Q A;  4G6D A;  1REP C;  1ZYR F;  2ZCW A;  1FSH A;  2Q0O A;  4GYG A;  3V7R A;  3GFJ A;  4HAM A;  3MZH A;  1DPU A;  2HKX A;  1XSX A;  4LB5 A;  3REO A;  3BP8 A;  4EM0 B;  3SXY A;  1B9M A;  2XRO A;  4BNC A;  3DKW A;  1Q1H A;  4EJV A;  3HUG A;  4LLN A;  1B1B A;  4N0B A;  2KIU A;  4H0E A;  3DV8 A;  4HX4 A;  3U1D A;  1ZGA A;  5D4R A;  2OZ6 A;  2CO5 A;  4M74 A;  1IAW A;  3BZ6 A;  3IWF A;  1P6R A;  2UXX A;  4ETS A;  4I2O A;  1TQI A;  2L01 A;  4UVC A;  2DO7 A;  1WI9 A;  4FX4 A;  2F5F A;  1R5H A;  5AIQ A;  3WE3 A;  2OA4 A;  1KU2 A;  2YSR A;  4G9Y A;  2K7L A;  1KQ9 A;  1JXS A;  5D6F A;  5IT9 Z;  3C3W A;  4EQQ A;  5DD4 A;  2A6H F;  1ON1 A;  3FM3 A;  3R61 A;  4OIP F;  3CDH A;  3T1B A;  3LA3 A;  4A5M A;  2IA1 A;  3IHU A;  3E6D A;  1TTY A;  2XAG A;  3HOT A;  1S8N A;  2XGX A;  3L2C A;  1TNT A;  3R0A A;  4L5I A;  4XRF A;  1BI3 A;  3HHH A;  4AD9 A;  1UST A;  4UV8 A;  4HX8 A;  3T0Y A;  3FXU A;  4Q5S F;  1Z7U A;  2DFI A;  2CGP A;  5LHI A;  5E20 A;  3RPU A;  4BQA A;  1O3Q A;  4ZYD A;  2WC2 A;  2VE8 A;  4A0Z A;  2E7X A;  3RPQ A;  1WWX A;  2ZJ2 A;  3FXR A;  4IPA A;  4AIK A;  1R1V A;  4RAZ A;  1X3U A;  5DV5 A;  1F9N A;  2HEO A;  5CJ9 A;  1IXS B;  4D0P A;  4KDP A;  5E18 F;  2M45 A;  2LF8 A;  1CGP A;  3IRQ A;  2VBY A;  3OV8 A;  3KFW X;  5DUK A;  1ZLJ A;  1XGO A;  2PN6 A;  5E1Z B;  1B4A A;  2L4A A;  4AVP A;  1J9I A;  1LVA A;  5H6R A;  3KP2 A;  3TQN A;  4R1H A;  1D5V A;  2EFQ A;  1K6O A;  5ILV A;  2FBK A;  2D1V A;  3CO7 C;  4CYD A;  5JI6 A;  1LQ1 A;  2RN7 A;  3FMS A;  4MEY F;  1STZ A;  2VOP A;  1FT9 A;  1SAX A;  2JRT A;  3P9I A;  3K9T A;  4O6J A;  2AS5 F;  2ZBK A;  5LRR A;  3CTA A;  1FC3 A;  4U0W A;  2Y75 A;  1KGS A;  2ZNY A;  2P8T A;  4Y15 A;  5FLX K;  1DDN A;  5JHU A;  2A61 A;  3L09 A;  1WSU A;  3LA2 A;  1SD5 A;  5L3D A;  2JSC A;  3Q9S A;  2EB7 A;  2P5V A;  1G3T A;  3G3Z A;  5DCM A;  2CSO A;  1NHA A;  4ZYE A;  3H3Z A;  1FNN A;  2ADU A;  3E6M A;  3K0L A;  4ESF A;  3DF8 A;  3QU3 A;  3BJO A;  2IPQ X;  3B73 A;  1LEB A;  1KU3 A;  5K5O A;  3TO6 A;  2K4J A;  1G6N A;  2EFO A;  2KJC A;  3WTV C;  1V3F A;  1FP2 A;  2FRH A;  2COM A;  1ZRE A;  2JZY A;  4A5N A;  2V79 A;  1Z9C A;  3FWE A;  2OU2 A;  4WXH A;  4I09 A;  1ZRD A;  1XGM A;  1YFH A;  4OIO F;  5J8C A;  3GF2 A;  2FSW A;  3CJN A;  4IXA A;  1E17 A;  3HTS B;  5EEH A;  1FX7 A;  4M72 A;  4BXU A;  3MWM A;  1J7K A;  1I5Z A;  1BOA A;  1OYY A;  4M9Z A;  5L3G A;  1UFM A;  4L0Z B;  4U88 A;  4MTE A;  3TDU C;  3O3K A;  2IT0 A;  1IXC A;  3GFI A;  5FB2 A;  1BI1 A;  2G7U A;  4P55 A;  2QM3 A;  3T8R A;  2PFB A;  4L9N A;  5F64 A;  3DFG A;  4L18 B;  3VOE A;  2W84 A;  3EYI A;  5FGM A;  3FMQ A;  4IVN A;  3TO9 A;  4M9S A;  5HS9 A;  1HKT A;  3KP3 A;  1K79 A;  2BE5 F;  4KA4 A;  4UVB A;  3BDD A;  2RGV A;  2GXB A;  5L3B A;  1IN4 A;  1A04 A;  1IN5 A;  1OMI A;  1DP7 P;  3FF5 A;  5LEJ A;  5FD5 A;  4PGG A;  2NAZ A;  2PJP A;  3IKT A;  2XAS A;  3E3V A;  1R22 A;  2IVM A;  5ICG A;  1FYM A;  2HS5 A;  4LMY A;  1XDU A;  2HDC A;  3BWG A;  1ODD A;  4IRG A;  1RIO H;  1MJA A;  3LST A;  2XVC A;  1QNT A;  2FOK A;  3J7A O;  3M8F A;  1TW3 A;  4MQV A;  3ZMS A;  5HOO A;  3F6O A;  2P4W A;  3M1E A;  4KT5 C;  5ICE A;  1QO0 D;  1U78 A;  4AWX B;  2NS0 A;  2H09 A;  3TOA A;  1FP1 D;  4EGZ A;  2AXL A;  4E70 A;  4XBF A;  1SFU A;  4FHT A;  3RI4 A;  4WXC A;  5BPD A;  2FA5 A;  3V8K A;  1D3Y A;  4ZZL A;  4KN7 X;  3E5X A;  1D8J A;  5ILU A;  2VE9 A;  4EMS A;  3W6J B;  1FZP B;  1PP8 F;  5A2Q K;  3EYY A;  1ZH5 A;  4KUM A;  1LEA A;  2OZU A;  3PFI A;  1C0W A;  2H6B A;  1MD0 A;  4BAY A;  1U6G A;  4JQF A;  2XKP A;  3LFK A;  1O7L A;  2Z33 A;  1LDK B;  5LBQ A;  2GWR A;  4I02 A;  5LGT A;  4Y13 A;  1DUX C;  3CUO A;  4KIB A;  4EVI A;  2Z5U A;  2J5P A;  2ZNZ A;  4ENM A;  4XSZ F;  5ICF A;  2H27 A;  2MLK A;  1OKR A;  1HBX G;  3WTZ A;  2XHK A;  3I59 B;  3WTY C;  2HWV A;  5LHG A;  3QRF F;  3PQJ A;  2DPU A;  2XIG A;  1T0F A;  4LK0 F;  5K5Q A;  2JPB A;  4EJO A;  5E17 F;  2DT5 A;  3KP7 A;  2PLY A;  5H6Q A;  3KLN A;  1V4R A;  1R58 A;  1F4K A;  1KU9 A;  3F72 A;  4IRH A;  1W7P A;  5LGN A;  3BRO A;  3V8L A;  4ESJ A;  3V7S A;  2O0Y A;  4P5O A;  1JHF A;  2PI0 A;  3KCC A;  2VXZ A;  1R5G A;  4U7D A;  2A07 F;  4MGR A;  1XD7 A;  1P2F A;  1YS6 A;  2LDU A;  2P5K A;  3JAM K;  4O3M A;  4L9T A;  4N9H A;  3DP7 A;  4F7Z A;  2XRN A;  5KVR A;  1B59 A;  2QQA A;  3RYR A;  1XMA A;  2DBB A;  1J5Y A;  2IP2 A;  3P7N A;  2STT A;  4G7H F;  4EM1 A;  1I1G A;  4ENN A;  3WTX C;  1PUE E;  2V9V A;  3V4G A;  4EM2 A;  1XCV A;  2W25 A;  3QU6 A;  1BI2 A;  3FMR A;  3NQO A;  4ENK A;  5HS7 A;  4HF1 A;  4UXN A;  2WWY A;  1FOK A;  1ZG5 A;  4WX9 A;  4U7B A;  3T5X A;  4OMZ A;  1G3W A;  1J0R A;  3WE2 A;  4HF2 A;  2XAJ A;  3WTU C;  2MD5 A;  4WK8 F;  4RGX A;  3SHF A;  1SD4 A;  1FY7 A;  2MLG A;  1XSD A;  2DQL A;  2A5Y B;  1HKS A;  2PBI A;  3WTS C;  1TQM A;  3QP6 A;  3TO7 A;  3GVA A;  4HBL A;  3AAF A;  2RDP A;  1KYW A;  5LRS A;  1YG2 A;  3U9G A;  2HKO A;  4A2U A;  4YFX F;  1TNS A;  2XV4 S;  2MH2 A;  4UNO A;  4L9V A;  2HTS A;  2P5L C;  2O03 A;  1EH6 A;  3E5U A;  4L5J A;  1RUN A;  3KP5 A;  5L3C A;  3F22 A;  3I64 A;  4HQE A;  4YIF A;  5FD6 A;  3KE2 A;  3RKX A;  2ACJ A;  1H9G A;  3HHG A;  2NNN A;  2ZME A;  4ZH4 F;  1XSV A;  5CYV A;  1JGS A;  5FLX Z;  4AIJ A;  2VC1 A;  1UHW A;  1F1Z A;  4HF0 A;  1GVJ A;  2KIM A;  2B0L A;  2MA3 A;  3NRV A;  1K78 A;  2L4M A;  3BOQ A;  1QGP A;  2PMU A;  5E8I A;  3HRU A;  1ZG3 A;  1SFE A;  2GAU A;  2OQG A;  3IC7 A;  3QPT A;  1ZAO A;  5BMZ A;  4UVA A;  1JHH A;  3H3U A;  4UUV A;  3Q9V A;  1U5T A;  1IZ1 A;  4DNC A;  4FT8 A;  1P92 A;  3DXJ F;  2P7V B;  1ZRF A;  1OYW A;  2DU9 A;  2EV6 A;  3FZV A;  4KN4 X;  2M87 A;  4ON0 A;  3ZPL A;  3KP4 A;  4U0Y A;  4GYI A;  3WOD F;  2DQR A;  3F6V A;  3L00 A;  2FE3 A;  3F21 A;  3I54 A;  3GFM A;  5F6F A;  3U2R A;  3M7G A;  1BJA A;  2NNY A;  2WV0 A;  3ABT A;  2JPC A;  1MKM A;  1IUY A;  1Z1D A;  4HW0 A;  3I0T A;  5HDG A;  3KP6 A;  5ILS A;  5DD8 A;  3GEZ A;  4UV9 A;  5BOX A;  4HYE A;  4OIQ F;  1YW8 A;  2ISY A;  2VT2 A;  3M9A A;  4L0Y B;  2WTE A;  2IW5 A;  3TKY A;  2FBH A;  4WCG A;  1BIB A;  3F8F A;  2Q2E A;  2BYV E;  2F5E A;  4GO1 A;  2V1U A;  1XGS A;  1WKM A;  1HKQ A;  2ISZ A;  3V7C A;  1FBQ A;  1IRG A;  1U3E M;  1PP7 U;  2Q8K A;  2R7F A;  4WXD A;  2FML A;  1U5T B;  4ASN A;  5E1X A;  2BGC A;  4EV0 A;  5KK1 A;  2CFX A;  1KQ0 A;  3VFZ A;  5LHH A;  3MCZ A;  2HQR A;  1WRJ A;  4LD5 A;  4HLX A;  1S6L A;  2X0L A;  5D5X B;  2YPR A;  3K69 A;  1CF7 A;  1USS A;  4LLG F;  2FNA A;  5DEQ A;  3MEX A;  3I5U A;  3O6B B;  2DW4 A;  4XLN F;  1AWC A;  5FO5 A;  5IT3 A;  3IRR A;  1CF7 B;  2VOD A;  2UXN A;  2P7C B;  1LDJ A;  2MC3 A;  1O3S A;  2DLL A;  5D4S A;  2CWE A;  3F23 A;  2QBY A;  3ABU A;  2PG4 A;  5AON A;  4IF4 A;  2QQ9 A;  3HTU A;  1MJ9 A;  3FM5 A;  1QZY A;  4HV5 A;  4PCQ A;  2EFN A;  3Q5F A;  3S2W A;  1ON2 A;  1XGN A;  1RZ4 A;  2Z3Y A;  1R00 A;  1HW5 A;  2D2W A;  1HXD A;  4GGG A;  1J2X A;  2OQR A;  3RKW A;  2GA2 A;  2O8X A;  5CVV A;  4LJZ F;  2A3S A;  2M8E A;  4RB2 C;  1P4A A;  2KIF A;  2EV5 A;  3COA C;  2FQ3 A;  4CO8 A;  5E8G A;  4LGW A;  4MQ9 F;  2EJR A;  4LG0 B;  3J80 K;  2E7W A;  1MZB A;  3BJ6 A;  3GLX A;  2V1D A;  2P6T A;  3ZMT A;  2M1B A;  3J80 Z;  5DUI A;  2RNJ A;  2DK5 A;  4B8X A;  3CUQ B;  2QWW A;  2HQN A;  5ERI A;  2YU3 A;  5LEK A;  4MEX F;  1TW2 A;  2FEZ A;  4TV7 A;  4EJU A;  3HRT A;  3K1N A;  3R60 A;  4HA8 A;  2EWN A;  4KFC A;  3MZY A;  4A6E A;  4RB1 A;  2Z99 A;  2L02 A;  3K2Z A;  4I98 B;  5AIP A;  4IHT A;  1P4X A;  2GIV A;  4FX0 A;  2JTV A;  4CGZ A;  2V6C A;  3RKY A;  2F2E A;  4EGY A;  1FBS A;  2DTR A;  5CVJ A;  3TOB A;  5IT9 K;  3L9F A;  4R79 A;  3O2P E;  4HOB A;  1ZGJ A;  1K78 B;  2TDX A;  1W7P B;  3BY6 A;  3HRM A;  2Y48 A;  3KEO A;  2FU4 A;  1OR7 A;  4RB0 A;  4BH9 A;  3ZMU A;  1B6A A;  3HSE A;  1KQ8 A;  3BJA A;  2RV8 A;  6PAX A;  2VT3 A;  2NRA C;  1J59 A;  1E2X A;  3JAM Z;  3EQL F;  1IRF A;  1R7J A;  1Z6R A;  2RVC A;  4YFN F;  4P9F A;  1S7A A;  1UCR A;  3SZP A;  5CVR A;  4DQ2 A;  4G94 A;  2Z9O A;  1P4W A;  1ULY A;  2A6E F;  3P9K A;  3ZMV A;  4G7O F;  2H94 A;  3VEP A;  4KIG A;  1ZLK A;  4HDV A;  3WG9 A;  2ZO4 A;  5CLS A;  1R36 A;  3H92 A;  5TJJ A;  5F1R A;  2C6Y A;  3GWZ A;  1MGT A;  5HS8 A;  1G3S A;  2G9W A;  4U0V A;  4PDK A;  2HYG D;  2XKO A;  2KKO A;  4RGU A;  3FHZ A;  2JT1 A;  1IN7 A;  4XSX F;  1W7P D;  5DDG A;  4B09 A;  4JK1 X;  2BBY A;  3EDP A;  5HDK A;  5BQT A;  2LKP A;  3IL2 A;  2XAQ A;  3GXO A;  1K7A A;  5LGU A;  4CIC A;  1UB9 A;  3K1P A;  1SMT A;  3GO5 A;  3RYP A;  1G4D A;  4QWQ A;  2XAH A;  1S7O A;  2EFP A;  4OIN F;  4L9J A;  4YFK F;  5CVU A;  3WTW C;  1UHM A;  5TRD A;  2QEN A;  4Y17 A;  1TBX A;  3KZZ A;  1T38 A;  2PMH A;  3WTT C;  4HX7 A;  2O61 A;  2J5O A;  1GXQ A;  4Q47 A;  5D8L B;  3JTG A;  1BC8 C;  3E5Q A;  3M8E A;  1HQC A;  1LB2 A;  3ZP5 A;  3C18 A;  4Q4Z F;  4R8H A;  4ZZD A;  3EET A;  3DEU A;  1R23 A;  1RI7 A;  3KLO A;  3WU0 A;  4BHC A;  3WGG A;  2M30 A;  4K2E A;  5D6E A;  1W5S A;  2OD5 A;  3E6C C;  1KYZ A;  4BHP A;  3E6B A;  2UZK A;  3WGH A;  2DK8 A;  2W57 A;  3VB2 A;  2IJL A;  3V8J A;  4MTD A;  4GCV A;  5D5V B;  3LQR A;  3VOD A;  2A68 F;  5JFR A;  1B9N A;  5HLG A;  5K5R A;  1YQA A;  2K27 A;  2GXG A;  5HDN A;  4Z2Y A;  5K1Y A;  3RIR A;  3ZN0 A;  3F8M A;  4KIF A;  1XN7 A;  1IN8 A;  1BM9 A;  4PZJ A;  3ISP A;  3DPL C;  3W6K B;  3GFL A;  3FXQ A;  2VON A;  1AOY A;  2LNB A;  1TLH B;  3F3X A;  2LSO A;  2Y0M A;  5HVQ C;  1YYV A;  2E1C A;  4KMF A;  4OU0 A;  3LWF A;  3HOS A;  2HFH A;  3SFZ A;  2ZXJ A;  1R1T A;  2X4H A;  1I27 A;  4NHJ A;  1O3R A;  2HTJ A;  1KU7 A;  4MNU A;  4NB5 A;  2QBY B;  4WWC A;  4GXO A;  2XUB A;  2BEO A;  2YX4 A;  1G3Y A;  5E1W A;  3FX3 A;  1ZN2 A;  4OIR F;  1FBU A;  3SZT A;  1BIA A;  2PEX A;  3MQ0 A;  5DYM A;  4IJA A;  3QPH A;  3JTH A;  4NQW A;  4LFU A;  3QP5 A;  1T6S A;  1S3J A;  2CW0 F;  3F8B A;  3J81 Z;  4AIH A;  4IHS A;  2V1X A;  1ZHF A;  5L3F A;  2F5C A;  1GHC A;  1YW7 A;  3K1M A;  1YTY A;  1OYI A;  1XDS A;  1EH8 A;  5D8K B;  2NYX A;  1FYL A;  1TQP A;  2HOE A;  3KEQ A;  4OOI A;  1QQI A;  1IN6 A;  1W5T A;  4I7H A;  2H6C A;  1EV7 A;  2BV6 A;  2O3F A;  4YG2 F;  3ECO A;  4M6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...