4BNCA

Crystal structure of the dna-binding domain of human etv1 complexed with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
b'SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HUMAN ETV1
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bncA00
2HFHA 2ZJ2A 3ZN0A 1XCVA 1GHCA 1TQPA 1ZARA 1S7AA 2CW0F 3D0SA 2HR3A 5J8CA 2LDUA 3H3ZA 3V4GA 2HYFA 1X3UA 1YW8A 4A0XA 2F5DA 5CJ9A 3KP3A 1E17A 1SMTA 5ILUA 2Q2EA 4ENKA 4IHTA 4P5OA 5FD5A 4WX9A 2VODA 3BJOA 3HHGA 3BPXA 2GXGA 3GW2A 1U2WA 1HQCA 3RJPA 4ZYDA 3M1EA 1HSJA 1UCRA 2DT5A 1J5YA 2GQQA 3WTYC 1BC7C 3E5UA 2KKOA 1HSTA 1OYIA 1KQ8A 2RC4A 2QM3A 3PFIA 2P7VB 5KVRA 4EVIA 3K69A 2K4BA 2VE8A 3BROA 3C7JA 3LWFA 2OQGA 3ZMTA 2G9WA 2QQ9A 3TOAA 4LGWA 3G73A 4CICA 2YPRA 3Q5FA 1ZRFA 4M6YA 5L3DA 3C3WA 5FFZA 3J7AO 4R79A 1HXDA 2EFPA 3IHUA 3DV8A 1MKMA 1DDNA 2Y0MA 2GA2A 3WGHA 3NRVA 2HQNA 1KQ0A 1O3TA 1BM9A 2VC0A 4I01A 3GUDA 3QRFF 5E1XA 1MJBA 2KIUA 3ISPA 2FMYA 2G7UA 1YW7A 5CYVA 1KGSA 3FXQA 5LEKA 5A2QZ 1R5HA 5DD4A 2H09A 1MDMA 3J80K 3W6KB 4IRHA 1R1VA 3WGIA 4ZZDA 4A2UA 1W7PB 4WXHA 3ZP5A 2JPCA 4A6EA 4EGYA 3CUQB 4B09A 4XBFA 2ISYA 2ELHA 5DUKA 3F21A 3H92A 2P6SA 3WG9A 4HV6A 1PDNC 3ECHA 1JXSA 1J59A 2XROA 5D5VB 1ONVA 5LGNA 2XAQA 3LFKA 4JBAA 2EK5A 2R3SA 5ICCA 3K1NA 2Q0OA 2DU9A 2EJRA 4G7OF 2BYVE 4FT8A 4YIIA 3DXJF 4ESBA 1OKRA 5D4SA 1J0RA 3GFMA 2K86A 1H9GA 1XDSA 5ICFA 4G7HF 2ETHA 2M5WA 4EJVA 5DYMA 5LLQA 4L5IA 4YG2F 1B9NA 4AIHA 3SFZA 3I59A 1AOYA 2DW4A 1FP1D 1LEBA 2W84A 4KT5C 4QLCU 1DUXC 1FSHA 2PLYA 2PN6A 3SQNA 3R0AA 1CF7A 1IUYA 2Z3YA 3HRMA 3HHHA 3E5QA 2DQLA 3P9CA 4WXDA 2QUFA 5D5UB 1KA8A 1I5ZA 2F2EA 5FD6A 1B9MA 1Z7UA 3E6DA 1QPMA 1ZLKA 1KU3A 4KN7X 5LGUA 3EDPA 3U2RA 3I64A 5TRDA 2D1VA 5FLXZ 1FX7A 5E8IA 1AWCA 1IN8A 4HX4A 1FNNA 2STTA 3L9FA 3TO7A 2HS5A 1FSEA 3R61A 2E1NA 1QO0D 4O5VA 4CXFA 3GYHX 3HSEA 2IA0A 3COAC 1XN7A 5HOOA 1LJ9A 3L09A 3T8TA 3VB2A 3C18A 3ZPLA 4LB5A 2V9VA 1CGPA 3HYIA 1IW7F 3KP7A 4HDUA 1TTYA 2PEXA 1IAWA 4LG0B 2DAOA 3J81Z 5HS9A 4AVPA 1JHHA 1I6XA 2AXLA 3N4MA 5DCMA 4KMUX 1FT9A 4XSZF 3O2PE 4EJTA 4MEYF 2DFIA 4RGRA 1F5TA 2CO5A 2OZUA 4IRIA 4PGHA 1S3JA 3HRSA 2STWA 1U78A 1KYZA 2OU2A 4CGZA 2RNJA 1V4RA 2ZO4A 1B4AA 1K7AA 3M9AA 2V1DA 1YFHA 3HRUA 2EB7A 2V79A 5JR3A 4WWCA 3FM5A 1OR7A 1ZRCA 2F5FA 5D4RA 1L0OC 2XKPA 3FWEA 2K7LA 3CDHA 2RVCA 1RUOA 1Z05A 3I54A 3CLOA 2PJPA 4XLNF 5E17F 1FLIA 2LNBA 2M1BA 5DCFA 3BOQA 3ZMUA 3E3VA 5L3BA 5FB2A 1HKQA 5E18F 1QQIA 1K78A 2MA3A 2E7WA 2FU4A 1LB2A 1DPRA 2XHKA 4F7ZA 2O8XA 4GO1A 3FHZA 5EEGA 3GEZA 1K6OA 2Z5UA 2HOEA 2IJLA 3TDZC 3WU1B 1ZG5A 1R36A 3V8LA 5K5RA 4KA4A 1FWZA 4HX8A 3HTUA 2IA1A 1EH7A 2BBYA 4ZYEA 2P8TA 3JAMZ 3RKYA 3EUHA 4L18B 2FA5A 2QQAA 3F23A 1O7FA 1FY7A 1ZAOA 3PQJA 5D5WB 3LAJA 2P5VA 1Z6RA 5H6RA 2XUBA 3HOSA 2CSOA 2CFXA 2BE5F 2BEOA 2DTRA 2DK8A 1W5SA 2XAGA 4HLXA 1B1BA 3RYPA 1JGSA 1U5TB 2GXBA 4AIJA 3R60A 2EA4A 3R6SA 3TKYA 2XVCA 3ZQ7A 1PP8F 5HLHA 1YW9A 2Z33A 4YFNF 2OA4A 4RB2C 5LEJA 2VT2A 4IHSA 1L3LA 2XASA 2EFQA 5FGMA 4LK1F 3JSOA 2MH9A 3FXUA 1FBSA 2L02A 1JE8A 3BPVA 3F72A 1DPUA 2D2WA 3FM3A 5IT9Z 2ACJA 3RPQA 2LF7A 1P4AA 3L2CA 1BIAA 3GLXA 3F8CA 2CGPA 3I71A 5TJJA 3KLOA 3R0JA 2M30A 1HKTA 3TGNA 2V1XA 1ZH5A 3QU3A 2EWNA 2A5YB 2PG4A 4NHJA 4LMYA 5ICEA 1BN5A 4IXAA 4MQVA 4HV5A 1IXCA 1G6NA 3CTAA 4MHGA 5LHIA 4L9VA 3KP6A 1UFMA 3MZYA 4KIGA 1G3YA 4EJUA 4P9UA 2OD5A 4YIFA 4CHUA 1T39A 3CUQC 1GVJA 3GVAA 1BC8C 3RTRA 1IRGA 2RV8A 1F1ZA 4M9XA 3FMRA 3GZ5A 1FOKA 3I5UA 2MH2A 4I0BA 2JRTA 1RIOH 3QU6A 1WKMA 4BNCA 1I1GA 2H6CA 2EV0A 2ZMEA 5CLSA 4FX4A 2KIFA 2ZXJA 2LSOA 3WE3A 2QLZA 2A3SA 1S8NA 2X0LA 1R00A 4O6JA 5L3CA 4U88A 5F64A 4EV0A 3EYYA 3MFKA 4PCQA 3I0TA 2C6YA 4R1HA 4BYYA 2JPBA 3LQQA 1FBUA 1J75A 2ZBKA 3RDIA 2FBKA 4EGZA 1ZG1A 2J5PA 1HW2A 1LDJA 5E1WA 1ZN2A 4EJOA 2VN2A 2EA2A 1LQ1A 1FYKA 3QP6A 3WTZA 1BI2A 1QZZA 1IN7A 2MD5A 2QVOA 4WCGA 2MC3A 5HVQC 3S2WA 4UVBA 4U0VA 1XMKA 2ISZA 3N97A 1EH6A 1O3QA 4M72A 1J9IA 1R22A 4L5JA 1B59A 1XSVA 4Y13A 3Q9VA 4NQWA 4RAYA 3V7RA 5FO5A 2O0YA 1IN5A 4NB5A 1C0WA 3BWGA 1WI9A 3GO5A 1FZPB 1FP2A 2P5LC 1ZG3A 3QPTA 1R58A 3KCCA 2DPUA 2DO7A 3P7NA 4LLNA 1OYWA 1KQ9A 3BP8A 2PBIA 4A0YA 4ENJA 4R8HA 3MEXA 1LVAA 1TNSA 2EV6A 5E8GA 3WU0A 4UHTA 1KU7A 5F6FA 3K0LA 1O7LA 1I1SA 4I09A 3F6VA 3MCZA 3RPUA 4HZFA 5E20A 1G4DA 4HA8A 1Y0UA 4BH9A 2EFNA 1FC3A 2IP2A 2M45A 4MTEA 4Y17A 5BQTA 4HF1A 4G94A 1ON2A 1W7PA 3GF2A 4EMSA 5ILVA 4E70A 3HRTA 3CUQA 1E2XA 2JSCA 2IRFG 2E7XA 2QBYB 4CYDA 1ULYA 3VOEA 5F1RA 1YS6A 3ABTA 4FX0A 5LBQA 3D5LA 2GZWA 1YYVA 1XCBA 1TW2A 3LQRA 4ETSA 1MZBA 1R7JA 5BS6A 2E1CA 3ZN1A 3HOTA 1XD7A 3F8BA 1FYMA 2LKPA 5L3EA 3QP5A 3FMQA 3L00A 3F8NA 4L9NA 4RB3C 3TO6A 1T98A 4HDVA 4KIBA 2WC2A 4HOBA 3F8FA 2G7HA 4UXNA 3KP4A 2W57A 3NEUA 2FF4A 3JTGA 2DI3A 4BHCA 2L4MA 1T0FA 2FBIA 4MEXF 3BJAA 4JK1X 2H27A 5K5OA 3CO7C 3I58A 4KIFA 4PZJA 4A12A 4AD9A 2UWMA 4RB1A 3HSRA 2L3DA 5CVRA 2CYYA 4ASNA 3RKWA 3MZHA 5HDNA 4P9FA 3V8KA 5LRSA 2VOPA 1SFUA 1G3SA 2H6BA 1V3FA 3WE2A 4QWQA 2XGXA 4OMZA 1R1TA 4I7HA 4HW0A 2KIMA 3WTVC 2V1UA 4L0ZB 3EETA 2TDXA 5A2QK 3KETA 2NRAC 4G7ZF 2MLKA 5ICGA 5LHHA 2K02A 4U7DA 3OV8A 1O3RA 1T38A 5HS8A 2YX7A 4TV7A 1H9TA 4OIOF 3MQ0A 2FBHA 4A0ZA 1FBQA 3MWMA 4IRGA 1U5TC 1IZ1A 3IRQA 3LAPA 3DP7A 1YLFA 3O3KA 1HW1A 2ZFWA 3VEPA 4RGXA 4MNUA 1TBXA 1TNTA 4CO8A 4LG0A 3H3UA 3DF8A 3KEOA 3F22A 2DPDA 5EEHA 3E6BA 1DP7P 2YR2A 3JSPA 3JTHA 2IVMA 2D45A 1K79A 1TQMA 1REPC 2XKOA 4EM2A 2L4AA 4GCVA 3CO6C 1W5TA 1O3SA 1F4KA 2V6CA 5D6EA 2FOKA 1UHWA 3K1PA 4HF2A 5LRRA 3LA2A 4Q4ZF 2O03A 2R7DA 1S29A 2VXZA 1H0MA 4L0YB 5D5XB 2VC1A 3TO9A 4M71A 4MQ9F 3EQLF 3GFLA 5BPIA 1UHMA 4BHPA 1EH8A 3OOPA 1MD0A 5H20A 1WWXA 2ADUA 3M8FA 2OZ6A 2WV0A 2YU3A 3KZYA 4U0YA 1HW5A 4LFUA 1SD6A 4HQMA 3LA7A 2HYGD 2R7FA 2FNAA 2RN7A 4A5NA 4U0WA 5CVVA 4UUVA 4A5MA 2XAHA 4LJZF 1MJ9A 4CZZA 4GYGA 2DBBA 5BMZA 4YFKF 5JI6A 2KJBA 4AWXB 1HBXG 3WTUC 2WTEA 1BJAA 2YSRA 3FX3A 4PGGA 2PMHA 4K2EA 2XV4S 1R23A 3SZTA 4HYEA 3VFZA 3ELKA 4I02A 4OINF 1ODDA 1VTNC 2M87A 3HUGA 3AAFA 3LA3A 3K1MA 1G3TA 3KFWX 4S04A 1XSXA 1TQIA 1XGNA 2VBYA 1YG2A 5HLGA 4KNYA 3F3XA 1YO5C 2L54A 4GYIA 3WTTC 4KMFA 5DEQA 3ERED 4I98B 3IKTA 1XGMA 3IWZA 4A6DA 3J80Z 3IRRA 3V7SA 1U5TA 4LB6B 1P4XA 6PAXA 3B02A 2UZKA 2Z9OA 3V7CA 5IT3A 5DUIA 1P2FA 3DPTA 3WTXC 4KUMA 2RGVA 3P9IA 4UVCA 4RS8A 3FXRA 5H6QA 5AIPA 1B6AA 2JZYA 2QZ8A 4M6XA 2H94A 3ML6A 5J6XA 5BOXA 4HX7A 1XMAA 4Q5SF 2BGCA 2X4HA 3E6MA 3CUOA 2L01A 1ZRDA 2FNPA 1LEAA 4BHBA 3RYRA 2GA1A 2WWYA 1IXSB 2COMA 2NAZA 3T8RA 1Z9CA 3E6CC 1T6SA 3IL2A 1MJAA 1LDKB 1MGTA 1P4WA 4OIPF 2XAJA 4HBLA 1PP7U 2RQPA 2PMUA 4OIRF 2HKXA 3GFJA 2DK5A 1ON1A 4GXOA 3FMSA 1T2KA 4DNCA 4YFXF 1R1UA 2FRHA 3JAMK 2LF8A 1SD4A 5D8LB 1IN6A 2VE9A 1TLHB 4BQAA 1RZ4A 2IW5A 1IF1A 2VOOA 3F6OA 2PI0A 3M7GA 1BI3A 3BJ6A 1TW3A 1USSA 2PFBA 2B0LA 5DD8A 1SD5A 3WGGA 2VBXA 3E97A 1MDMB 3KZZA 1P6RA 1USTA 3B73A 1Z91A 3QPHA 1KU9A 1PUEE 1BOAA 1J7KA 1XGOA 5K1YA 1QZYA 2HZTA 1RNLA 1D8KA 4HQEA 2HQRA 4WF2A 4HAMA 2KRFA 5JHUA 2HDCA 2NNYA 1QNTA 3P9KA 3RI4A 4RGUA 1RI7A 3DQVC 5IT9K 1WRJA 4ZYGA 3ZMVA 4UV9A 1S7OA 5K5QA 4HF0A 4IVNA 4AIKA 2NS0A 4G6QA 4ENMA 3KE2A 3K2ZA 4IF4A 1P92A 4M74A 2Z99A 2AS5F 1WQ2A 4BXUA 1BI0A 2FQ3A 4DQ2A 2K27A 1Z1DA 4UVAA 4ESFA 4P96A 3GZ6A 4OMYA 5CVUA 5HS7A 4FHTA 4S05A 1KU2A 3I59B 3TDUC 2A6EF 2OBPA 1OPCA 2ESNA 1BBYA 3NQOA 4XRFA 3FF5A 4G9YA 2QWWA 2VBWA 1YTYA 2NYXA 1QBJA 5DDGA 1CF7B 5CVJA 2O6GE 3DEUA 2K4JA 2CG4A 4ZYHA 1S6LA 3PQKA 2DLLA 2RDPA 4WXCA 2UXNA 5DV5A 1GXQA 2J5OA 4ZZLA 1SAXA 4EM1A 3JW4A 3C1DA 1GXPA 5ERIA 1XB4A 4LK0F 2ZNYA 2VT3A 3ZMSA 2QBYA 1KYWA 2A68F 4P55A 2MLGA 3T1BA 2JTVA 3WTWC 3ABUA 4CDGA 1ZYRF 4EQQA 1D8JA 3SHFA 1Z6TA 2FMLA 2HWVA 4B8XA 1R5GA 2P5KA 5HDKA 4OIQF 3QOPA 4IPAA 1I27A 5L3GA 2Y48A 4XSXF 3V8JA 2XRNA 3GWZA 5J8FA 5KK1A 5JFRA 2A61A 4KDPA 4RAZA 4N9HA 1O57A 3KEQA 3TOBA 3LSTA 4H0EA 5DCMB 3DKWA 2Q8KA 3L7WA 2VBZA 1G3WA 3ZMDA 2RKHA 3HIFA 3IKVA 5BPDA 3IC7A 1IN4A 2HKOA 3M8EA 2OQRA 1SFEA 5CVIA 2VONA 2W85A 4ENNA 2JT1A 2BV6A 5E1ZB 4LD5A 1IRFA 3ECOA 1FYLA 3KP2A 3ROUA 2XAFA 2GIVA 4KICA 5ILSA 1ZREA 5D6FA 1STZA 2OAZA 1XGSA 2ZNZA 1W7PD 2MBFA 3T5XA 4EJWA 2XIGA 2FEZA 4L9JA 3ZMZA 2PQ8A 4RB0A 2KJCA 1JHFA 3I53A 1YS7A 2HGCA 5JVTA 2CQKA 3U1DA 3GX4X 1J2XA 1K78B 4M73A 2HTJA 3MAJA 2P6TA 1U8RA 2W24A 1Q1HA 2A07F 3KLNA 1YQAA 3G3ZA 4KFCA 3RKXA 3GFIA 2FE3A 3QAHA 1ZGJA 1XSDA 1OMIA 1D5VA 4RGSA 2ESHA 1NHAA 3WODF 4GGGA 2EV5A 1HKSA 4G8XA 3E5XA 4MGRA 3SXYA 5LHGA 2NNNA 1OYYA 5ED4A 3DFGA 1SMYF 1UB9A 1QGPA 3REOA 2F5EA 2F5CA 3DPLC 5HDGA 3RIRA 2QYOA 4Y15A 2O61A 4MTDA 4HLYA 4OU0A 3TQNA 5LGTA 2FXAA 3VODA 1U3EM 4OOIA 3W6JB 2ZKZA 3GXOA 1SFXA 1ZGAA 2UXXA 2A69F 4N0BA 4I2OA 3ULQB 4KYWA 2M8EA 3SZPA 2IPQX 1A04A 2IA2A 5HLIA 1BI1A 5FLXK 4XLPF 2IT0A 4Q47A 3F8MA 2ZCWA 3CJNA 5FFXA 3KP5A 4G6DA 3FZVA 3WTSC 4WK8F 4IJAA 4L9TA 1FPQA 2FSWA 3K9TA 4LLGF 2GAUA 5AIQA 2HEOA 4D0PA 2HTSA 4I0AA 4M9ZA 3BDDA 1EV7A 3O6BB 4UNOA 3R4KA 2P4WA 3U9GA 4PDKA 3HSFA 1F9NA 3I4PA 5D8KB 2W25A 3J81K 4M9SA 3EYIA 4LLLA 4Q48A 1W4MA 1WSUA 3Q9SA 1IXRC 1ZHFA 4JQFA 3T0YA 2DQRA 2D1HA 2EFOA 1LDDA 2CWEA 2YX4A 1XDUA 4Z2YA 4O3MA 3HTSB 2GWRA 2O3FA 4KN4X 3BY6A 2A6HF 1ZLJA 2QQBA 4U7BA 5L3FA 3IWFA 1U6GA 2Y75A 4N9IA 4ZH4F 5AONA 1LNWA 1RUNA 4BAYA 2P7CB 1YIOA 3BZ6A 4UV8A 1SD7A 2ZMEB 1BIBA 2QENA 4ESJA 2EFWA 4EM0B 4ON0A 1D3YA
chains in the Genus database with same CATH superfamily
3H5NA 2HFHA 2A05A 1VQ9I 2CU7A 2ZJ2A 2FUG2 3ZN0A 1XCVA 3G1LA 1GHCA 1TQPA 4G6TB 4G12A 2CQNA 3L2RA 3JR9A 3ZGKA 1ZARA 3CP8A 1MNMC 1S7AA 2CW0F 3BG3A 3D0SA 2HR3A 3I56I 3CCJI 5J8CA 2LDUA 1RPWA 1P7IA 2HDWA 3H3ZA 1X2NA 3BTJA 3V4GA 2HYFA 1X3UA 1YW8A 4A0XA 2VUMJ 2YUSA 1NK2P 2F5DA 2DDAA 5CJ9A 4PJJA 1QVUA 3KP3A 3JRFA 1OLTA 1WVRA 2ZJPF 1E17A 4M3BA 1SMTA 1UMQA 2K9QA 2Q2EA 5ILUA 3PIPF 3ZQLA 4FCYA 4ENKA 4PUSA 2E2IJ 4IHTA 1Y0NA 3HC7A 3CCUI 4ZDPA 4P5OA 5FD5A 4WX9A 4EM0B 4RBOA 2QEXI 1D5YA 3HKZN 2VODA 1UJ8A 3BJOA 3HHGA 5B5EC 4XLFA 3BPXA 2GXGA 3GW2A 1U2WA 1HQCA 3A1YA 2R5ZB 3RJPA 4ZYDA 1EF4A 4BBSJ 3M1EA 1HSJA 1UCRA 2DFHA 4RM3A 2DT5A 1ZR4A 1J5YA 2GQQA 3WTYC 1BC7C 3E5UA 2KKOA 3BG5A 4AU7A 1HSTA 1OYIA 3LMMA 1KQ8A 2E1OA 3HPGA 3K6GA 2RC4A 4F92B 1OCRH 5E3OA 2DA6A 2RREA 4ZDOA 2QM3A 3PFIA 4NQWB 2P7VB 2K9NA 3GTOJ 5KVRA 2V7FA 3OY9A 3LSPA 1YJNI 3CLQA 4EVIA 4YRVA 3K69A 2K4BA 2VE8A 3BROA 3C7JA 3ZQCA 3LWFA 2OQGA 5J1UA 1E3PA 2K9LA 5EG0B 3ZMTA 2G9WA 2QQ9A 2BW3B 3TOAA 1WZ2A 4LGWA 3G73A 4CICA 2YPRA 3Q5FA 1ZRFA 4M6YA 2JWTA 5L3DA 3C3WA 3IAS2 2HDDA 1JJ8C 1S72I 5FFZA 3OR2C 3J7AO 4E7ZA 3TW6A 1P9QC 4BUPA 4R79A 4U87A 1T08B 1HXDA 2EFPA 3IHUA 2I8DA 3CMMA 4XLHA 3DV8A 1MKMA 1DDNA 2Y0MA 2GA2A 2KRHA 3QYBA 4NNJA 3WGHA 4BE2A 3NRVA 2M3AA 2X1CA 2HQNA 1KQ0A 3C2GA 1O3TA 5HODA 3TW7A 3LSIA 1BM9A 3CMEI 2VC0A 1OCOH 1X2MA 2XAUA 3CMAI 4I01A 3EUKL 4YELA 3C2HA 3GUDA 3AL0B 3QRFF 5E1XA 1MJBA 3DU6A 2KIUA 1H88C 3ISPA 2FMYA 2G7UA 1YW7A 5CYVA 1KGSA 3FXQA 2HQ5A 5LEKA 4IL6C 5A2QZ 1R5HA 4I99C 5DD4A 2HXIA 2H09A 1MDMA 1APLC 1I50J 3J80K 5GAHJ 3W6KB 4IRHA 1R1VA 3VYSB 2HVRA 1K83J 2MSYA 3WGIA 3ZCOA 4ZZDA 4A2UA 5C4JJ 1W7PB 4WXHA 3ZP5A 3KX2A 2CUFA 3OYDA 2JPCA 4A6EA 1IUFA 4EGYA 3CUQB 4B09A 4XBFA 2ISYA 2ELHA 5DUKA 3F21A 2X51A 3H92A 2P6SA 1R4MB 3WG9A 4HV6A 5DM6F 1DU6A 1PDNC 3ECHA 1JXSA 1J59A 2XROA 2KDOA 2ZFUA 5D5VB 1ONVA 5LGNA 2XAQA 3LFKA 1MMAA 3B6AA 1TWGJ 4JBAA 4A3LJ 2EK5A 2LR8A 3HXLA 1UAAA 1A5JA 2R3SA 5ICCA 4W97A 3K1NA 2M7AA 2Q0OA 2DU9A 2EJRA 4OAYA 4G7OF 4HNTA 1K6YA 2BYVE 4FT8A 4YIIA 1NTCA 4XICA 3MD2A 3DXJF 4ESBA 1OKRA 5D4SA 1J0RA 4A3FJ 1OFCX 2M34A 3GFMA 2K86A 4RMNA 1OR7C 4OWRB 1H9GA 1XDSA 3A03A 2E2JJ 4IQJA 3OIPA 5ICFA 1JT0A 4G7HF 3AG4H 2KMUA 3BT9A 4IZZA 5EGOA 1JUMA 4BU2A 4XL9A 2VXDA 2ETHA 2M5WA 4EJVA 1SFOJ 5DYMA 4DW6A 4ZYAA 5LLQA 3VYRB 4L5IA 4YG2F 1B9NA 1PJRA 4ZC3A 3SFZA 4AIHA 3I59A 1AOYA 2DW4A 5K7HA 1DGWY 1FP1D 1P7JA 1LEBA 3BTCA 3CP2A 1BR1A 3RZOJ 2PJRB 2MGQA 2R7SA 3WHBA 5M5YJ 2W84A 4BBRJ 1Z3YA 2JVGA 4KT5C 3OR1C 2VJ5A 3IH2A 4QLCU 1LFUP 1DUXC 3M07A 1FSHA 3H3VK 2PLYA 3JRIA 2PN6A 3SQNA 1YOVB 3W2VA 2IAIA 2B9SA 2O8KA 3R0AA 1CF7A 1IUYA 2Z3YA 3HRMA 4B48A 4XKWA 2DDBA 2H1LA 3HHHA 1VQ6I 3E5QA 2DQLA 1NH3A 3CD6I 2O7OA 3P9CA 1OCPA 2R7WA 3FXMA 3CCMI 4WXDA 2QUFA 5CKTA 4CCLA 5D5UB 1KA8A 1I5ZA 2BXYA 2F2EA 5FD6A 4A3EJ 3H9GA 1B9MA 3CDLA 3KZIC 1Z7UA 3E6DA 2X6WA 1XPXA 1QPMA 1SAUA 1ZLKA 1IC8A 1KU3A 4KN7X 1D0YA 3FIWA 3E7LA 5LGUA 3CC2I 2HI3A 3EDPA 3U2RA 3I64A 3QODA 4BXFA 5TRDA 3EUHC 2D1VA 5FLXZ 1FX7A 5E8IA 3AG3H 1AWCA 2K5CA 1IN8A 4HX4A 2LBFA 3BR5A 1FNNA 2STTA 5IPAA 3L9FA 3DPUA 3TO7A 1MMSA 5GTIC 3HOYJ 2HS5A 1HF0A 5F0HA 3GTMJ 1FSEA 1XC5A 3KIOA 4KJZA 3R61A 2E1NA 1QO0D 2M4GA 4O5VA 4CXFA 2XPVA 3SEZA 3GYHX 2W1OA 3HSEA 1MSEC 2LKSA 2IA0A 1VQLI 5JHFA 3COAC 1XN7A 2KT0A 5HOOA 1LJ9A 3L09A 3TEDA 1WFXA 3T8TA 1KZHA 3VB2A 2JMWA 3C18A 1KONA 3ZPLA 2ZXIA 4LB5A 2DA7A 2V9VA 3LSJA 4XKCA 2LTPA 1CGPA 1R5ID 4C2TA 2FQ4A 3HYIA 1IW7F 2JJ7A 3KP7A 4J19A 1RRJA 4HDUA 1TTYA 2VASA 2PEXA 4NUBA 3EUAA 1IAWA 3HB9A 4LG0B 3DU5A 2DAOA 3J81Z 3MMYB 5HS9A 4E7SA 4AVPA 4NC8A 1UHSA 1JHHA 2XGCA 4RA2A 1I6XA 2V1NA 1DP3A 5BNGA 2AXLA 3N4MA 3CDIA 1GV2A 3A4CA 4XK4A 5DCMA 2QA4I 1Y39A 1Z21A 4KMUX 2OUMA 3S2HJ 1FT9A 1RR7A 2O9LA 1JUSA 2M7BA 2V26A 5EYRA 2ID3A 4XSZF 5IOYA 4A3KJ 3A2KA 1U0JA 3O2PE 4S0HB 4EJTA 4MEYF 2DFIA 4ANJA 1ZQ3P 3BTIA 4RGRA 1F5TA 2VKDA 2CO5A 2OZUA 4C2MJ 3BR0A 4IRIA 4PGHA 1S3JA 3HRSA 2STWA 1EKEA 1JT6A 1KYZA 2MD0A 1YJWI 1U78A 2OU2A 4CGZA 2KISA 1V4RA 2RNJA 1YX5A 3GMEA 2ZO4A 2ZSIB 1B4AA 2MFZA 1K7AA 3M9AA 1BR2A 2V1DA 1YFHA 4CCKA 2EBIA 3HRUA 2EB7A 2V79A 5JR3A 4WWCA 3FM5A 1OR7A 2K3FA 1ZRCA 2F5FA 2ELJA 4XOPA 5D4RA 1L0OC 3SYTA 3FXOA 1B72B 1BA5A 2XKPA 3FWEA 2K7LA 3ABMH 3FDYA 2F48A 4DIQA 3CDHA 1XMXA 2RVCA 1SVOA 2DT6A 1RUOA 5KAIC 2AHQA 1Z05A 2XPWA 3I54A 3JRHA 3CLOA 3V42A 3HOVJ 3K2AA 4BQNA 2PJPA 4E6KG 4XLNF 3GTGJ 5E17F 2XF7A 1FLIA 2LNBA 3CCQI 3U21A 2M1BA 3WHCA 5DCFA 4IOCF 2OV7A 3BC8A 3BOQA 3ZMUA 2DJNA 3E3VA 5L3BA 2ZC2A 4MIMA 5FB2A 3O8GA 1HKQA 3K70C 5GPCA 5E18F 1QQIA 3OOUA 4Y7NJ 2WV1A 1K78A 3I55I 2MA3A 3LSHA 3GTJJ 1IDZA 3CCRI 3FK7A 4EEFG 2E7WA 3G2BA 2FU4A 1LB2A 1DPRA 3CCYA 2L7FP 2XHKA 3B6CA 2XGDA 3CQZJ 3RCOA 4F7ZA 2Y2ZA 2O8XA 4GO1A 1S5LC 2KZVA 5EEGA 3FHZA 3GEZA 1K6OA 1ENHA 2DA4A 2F5VA 2Z5UA 2HOEA 2IJLA 3HDDA 3H5RA 3TDZC 2ZMEC 2M0CA 3WU1B 3OYLA 1ZG5A 1R36A 2HOAA 3V8LA 5K5RA 4KA4A 1FWZA 1NG6A 1G59A 4HX8A 2YS9A 3HTUA 4HRIA 3AG1H 1QHGA 2IA1A 1AKHB 2LKXA 4ZDLA 3S1QJ 1EH7A 2GIZA 5IYCJ 2BBYA 2WY8Q 4ZYEA 3DTEA 3LSKA 2P8TA 3JAMZ 2VLAA 4D7MA 3DCFA 3A01A 3RKYA 1YI2I 3EUHA 4B3XA 3EPZA 2QCOA 3QYFA 4L18B 2FA5A 3HUGB 2QQAA 3F23A 3K4LA 1RR8C 2HZDA 2VB6A 1O7FA 3ZQHA 3JREA 1FY7A 3J7AY 1VF9A 1ZAOA 2A5WA 3PQJA 3QQAA 5D5WB 3LAJA 2JK3A 2P5VA 1Z6RA 1G8XA 1AU7A 1Z77A 5H6RA 2EIJH 2XUBA 4BEHA 3HOSA 2CSOA 2CFXA 2BE5F 1G2HA 2BEOA 2DTRA 2DK8A 1W5SA 2LMDA 2XAGA 4HLXA 1B1BA 1X4OA 1QVTA 4HG2A 3RYPA 1ITYA 1JGSA 1U5TB 1DGRM 2DA3A 2GXBA 2OTJI 4AIJA 2KL4A 2QF7A 3R60A 3SDGA 3JRCA 2EA4A 3R6SA 1IO2A 3TKYA 3BG7A 3ERMA 2LK2A 2XVCA 3S1NJ 3ZQ7A 1PP8F 5HLHA 3PNVA 1YW9A 4NDLA 2Z33A 4YFNF 1N77A 2OA4A 4ZJZA 4GDFA 4RB2C 4N4NB 5LEJA 3FBIB 2V6EA 2L2OA 4XLCA 3KYCB 5IY5H 2VT2A 4IHSA 1L3LA 2XASA 2EFQA 2B63J 3I3LA 5FGMA 4LK1F 4J00A 3VWBA 3JSOA 5FLMJ 2MH9A 3RQIA 3FXUA 2KP6A 1FBSA 2L02A 3NARA 4QSHA 2E60A 2DMNA 3Q0VA 1JE8A 3BPVA 3PSIA 5CQEA 3F72A 1DPUA 4XMYA 2X9DA 4N4OB 2D2WA 2F4IA 1FMVA 3FM3A 3K4MA 5IT9Z 1MBEA 3UKGA 2ACJA 3AKZA 3ABKH 3RPQA 2AXTC 4E7HA 3OYJA 1H8AC 5IYBJ 2LF7A 1P4AA 3L2CA 2GOMA 2ECBA 1BIAA 3GLXA 1I3QJ 3F8CA 4FISA 1NK3P 2QKLB 2CGPA 3I71A 5TJJA 3KLOA 4BL0B 3R0JA 2M30A 3RQ4A 2V4JC 1HKTA 2EIMH 2OPTA 3TGNA 2V1XA 1ZH5A 3QU3A 2EWNA 5TISC 2A5YB 3X2QH 4X1EA 1PUFA 2PG4A 4NHJA 2KDZA 2HPIA 4LMYA 3LNQA 1FTZA 5ICEA 1WJAA 1BN5A 2R92J 1GUUA 4MLOA 2VIXA 4IXAA 4MQVA 4HV5A 5F08A 4DYQA 1IXCA 1G6NA 3CTAA 4MHGA 5LHIA 4XLEA 4L9VA 3OS0A 3FISA 1WHUA 3KP6A 1UFMA 3MZYA 4KIGA 3CCLI 3E0JB 5M3FJ 4EATA 1G3YA 4EJUA 4P9UA 2OD5A 3AG2H 4B47A 4BS9A 4YIFA 4II2A 4CHUA 1T39A 3BLYA 4KT6A 3CUQC 1A6QA 1GVJA 4CZCA 3GVAA 1BC8C 3RTRA 1IRGA 4M6VA 2RV8A 2JA2A 1F1ZA 4M9XA 3FXLA 3FMRA 3G1MA 3GZ5A 3I5UA 2FD5A 1FOKA 2MH2A 2XB5A 4I0BA 3S3MA 4CSWA 2JRTA 3ZQIA 4RAGA 3VSKA 4Y3OA 1RIOH 4IO9F 3QU6A 2HOTA 2P0WA 3S17J 2E1MB 2Y9YA 5CQGA 1WKMA 4BNCA 1I1GA 2H6CA 2EV0A 2ZMEA 3OYNA 5CLSA 3CJQB 4FX4A 2KIFA 2ZXJA 4UUTA 2LSOA 3WE3A 2OTLI 4IHVA 2ZSHB 2K9MA 3HGGA 1XS9A 5EF6A 2QLZA 5FKLA 2A3SA 1S8NA 1YX3A 1V5EA 2X0LA 1R00A 4O6JA 5L3CA 4U88A 5F64A 3ONQA 3C2BA 4EV0A 4Y52J 3EYYA 1JJ6C 3MFKA 2HXOA 4PCQA 2Y9ZA 4DYRA 1SANA 2L9NA 1J09A 4JYKA 4PSWA 3S15J 2PMZN 1SFKA 4XR6A 3I0TA 5B3SH 2C6YA 3SJMA 4R1HA 2RQQA 1NG7A 1WJCA 1YITI 4BYYA 2JPBA 3LQQA 1FBUA 1WJEA 3VDXA 1J75A 2ZBKA 3RDIA 4IX7A 2FBKA 4EGZA 2EQRA 4DZPA 4B3AA 1ZG1A 2J5PA 1HW2A 3I4NJ 1T0FC 5KCMA 1LDJA 5E1WA 1ZN2A 4EJOA 2VN2A 2EA2A 1LQ1A 1WGXA 1TWFJ 3IUOA 3PNYA 3GLLA 5HLTA 3OS2A 3J7ZI 1FYKA 3QP6A 3WTZA 3A0HC 4ZTFA 1BI2A 2XF5A 1QZZA 3LFUA 2OF7A 1IN7A 2MD5A 2QVOA 4WCGA 3PJRA 2R5ZA 2MC3A 5HVQC 4HNVA 1EA3A 4J01A 2LY9A 3S2WA 4UVBA 3G4SI 4AM3A 1Z3XA 2LLKA 4QTRA 2CW7A 4U0VA 1XMKA 2M8GX 2ISZA 3N97A 1EH6A 1O3QA 2EZKA 4M72A 1WCMJ 1J9IA 2EIKH 1R22A 1TP4A 3Q0WA 1B59A 1XSVA 4IEJA 4L5JA 4B43A 4Y13A 1Z67A 2TCTA 3Q9VA 3UNGC 4NQWA 4RAYA 3V7RA 1ZELA 2ID6A 5FO5A 3NAUA 2O0YA 3CMYA 1ETYA 1IN5A 4NB5A 3U1KA 1C0WA 3GTQJ 3BWGA 1WI9A 3GO5A 2DODA 5EG0A 1FZPB 2LC2A 1ETKA 5CPRB 2BW3A 1FP2A 3PO3J 2P5LC 1ZG3A 1WH5A 3QPTA 1R58A 3KCCA 2ZJRF 2MABA 4CA0A 2DO7A 3P7NA 1U9NA 2DPUA 4LLNA 5E3MA 1IRXA 1IDYA 2CFOA 1OYWA 2CUJA 2K85A 3S1RJ 1KQ9A 4X0GA 3BP8A 2PBIA 2XSJC 4A0YA 4ENJA 1TWHJ 1CQTA 4R8HA 3MEXA 1LVAA 1TNSA 2EV6A 5E8GA 3WU0A 1ETWA 2M4KA 4RAFA 3CC7I 4UHTA 2UV1A 1KU7A 2G0EA 4UY8I 1IV8A 5F6FA 3K0LA 1O7LA 1I1SA 4I09A 3F6VA 1W1WE 2KFDA 3MCZA 3FXJA 3RPUA 4PJLA 4HZFA 5E20A 1G4DA 3OYFA 4IHYA 4HA8A 4UUSB 1Y0UA 1WJDA 1TT5B 1WJBA 4BH9A 5B1AH 1W36C 2EFNA 3IAM2 1FC3A 3CCVI 1LVKA 4II3A 2IP2A 2E2HJ 1MW7A 1VZ0A 2M45A 1JUPA 3CCEI 4MTEA 2E36A 3PSFA 5GADJ 1BW5A 3S3NA 4Y17A 1MIJA 5BQTA 2W82A 1UG0A 4HF1A 5JLXA 2Y69H 4D5FA 4G94A 1ON2A 1W7PA 3GF2A 4EMSA 5ILVA 4ITVA 5FLVA 1FJLA 4E70A 3HRTA 1Z0XA 3CUQA 1E2XA 3FKIJ 2JSCA 5F0CA 2IRFG 2E7XA 1QA6A 2QBYB 4CYDA 1ULYA 3VOEA 3BR3A 1E3OC 5F1RA 1T8IA 1BOBA 1YS6A 2OCCH 1T56A 3M1CA 2COBA 4LOCA 2ZJQF 2NS8A 1GT0C 2Z16A 4A93J 1X3ZB 3ABTA 4XIDA 4PJNA 4FX0A 5LBQA 3JRDA 3D5LA 5FRNA 2GZWA 1YYVA 1XCBA 1TW2A 3LQRA 1WI3A 2K3PA 1R6RA 3ZQFA 2CV0A 4ETSA 1MZBA 1R7JA 2XGEA 3PIOF 5BS6A 2E1CA 9ANTA 3ZN1A 3HOTA 1XD7A 3F8BA 1IJWC 2KHMA 1FYMA 2LKPA 5EDNA 1GVDA 4C9YA 5L3EA 2JA6J 3QP5A 2Y0SA 3S3OA 1W5CC 3FMQA 3L00A 3F8NA 4L9NA 1A31A 3HZJA 1JI8A 3MKZA 4RB3C 2CV2A 3D5SC 1T98A 3KEYA 3TO6A 4HDVA 3K10A 4KIBA 1RKTA 3TL4X 4OAZA 3MN2A 3N05A 4YEJA 4C30A 2WC2A 1LE8B 2LG4A 3PFYA 4HOBA 4W1UA 3F8FA 2G7HA 1K61A 1MBGA 1T33A 4UXNA 3KP4A 2W57A 3NEUA 2FF4A 2BHZA 3DEEA 3JTGA 2NOJB 2DI3A 4BHCA 2L4MA 1T0FA 2FBIA 3H35A 4MEXF 2VKHA 5IOZA 3BJAA 4JK1X 2QSGX 3FKJA 4DZJA 2H27A 2WB1N 2NVXJ 2PJRA 3HOZJ 5K5OA 3CO7C 3I58A 4KIFA 4PZJA 3TP0A 4A12A 2MG4A 4AD9A 2UWMA 4RB1A 3HSRA 1FTTA 2L3DA 4A3JJ 5CVRA 5FKOA 1MMGA 4JX5A 2CYYA 2GXAA 4ASNA 2DT7B 2DMQA 3RKWA 5KHDA 3HOWJ 3HM5A 3MZHA 5HDNA 5C4XJ 4P9FA 3V8KA 5LRSA 2VOPA 1SFUA 1PVEA 1G3SA 3VYTB 2H6BA 1V3FA 3OSGA 2RNGA 2DYRH 4BACA 3WE2A 3ZR8X 4QWQA 4RM2A 2XGXA 3G71I 4OMZA 2Q1ZB 1X3WB 1OISA 1R1TA 2R7QA 4I7HA 3ZOBA 3S16J 4HW0A 2HOSA 2KIMA 1GDTA 2X85A 3WTVC 4NC7A 2V1UA 4L0ZB 3EETA 1DU0A 2XF6A 4KISA 4XM3A 2TDXA 5A2QK 3KETA 1RC9A 4I6ZA 2NRAC 3CJTB 2IBDA 2Y0SN 5IP7J 4G7ZF 2EZLA 1MBHA 2MLKA 5ICGA 5LHHA 2K02A 4U7DA 4D1QA 5JLWA 4DBRA 1VQ4I 2R5YB 1UG2A 4A3GJ 2NXNB 4M3EA 3OV8A 1O3RA 5TGTA 1T38A 2WBMA 5HS8A 2YX7A 2VKEA 3BCBA 4TV7A 1H9TA 3D1NI 2L7ZA 4OIOF 1U9OA 3MQ0A 4AVZA 2FBHA 4A0ZA 5H2FC 1JKOC 2JQ7A 1FBQA 1WPKA 3SEQA 2CJJA 3DBLB 3MWMA 2W7NA 4A3MJ 4IRGA 1O4XA 1U5TC 1IZ1A 3IRQA 3LAPA 3DP7A 2XDVA 1YLFA 3O3KA 4BE1A 1HW1A 1ETXA 3F0CA 2ZFWA 3HPHA 1LFPA 3BZCA 3I9V2 3VEPA 4RGXA 4MNUA 1TBXA 1TNTA 2JVHA 4CO8A 3WG7H 1N78A 4LG0A 3H3UA 3DF8A 3KEOA 3F22A 3S93A 2DPDA 1YHQI 2ME6A 5EEHA 2HQAA 3E6BA 1DP7P 2YR2A 3JSPA 1Y1WJ 3JTHA 2IVMA 2X1EA 2IGMA 1BW6A 2D45A 1K79A 3OYEA 1TQMA 1REPC 2XKOA 4EM2A 2UUZA 2L4AA 4GCVA 3CO6C 2W4SA 1W5TA 1O3SA 3LSMA 1F4KA 5C44J 2V6CA 1JKQC 4A3CJ 2WAEA 5D6EA 2FOKA 2LREA 2MW8A 5HNHA 1UHWA 1X1PA 3K1PA 1AA7A 1N75A 4HF2A 5LRRA 3LA2A 2I5UA 4Q4ZF 2O03A 2LVSA 1ZTRA 2VPLA 2R7DA 1S29A 1Z7LA 2VXZA 4KITB 1H0MA 2CQXA 4L0YB 5D5XB 3GTPJ 2DA2A 2VC1A 4BXXJ 3TO9A 2Z1DA 4M71A 4JX4A 4XRMA 4MQ9F 3CF5F 1I39A 3EQLF 1B72A 2NOGA 3GFLA 4PJ0C 2TRTA 5BPIA 1UHMA 4BHPA 3P5JA 4DGWB 2BY0A 3NWTA 1EH8A 2PX9A 3OOPA 1MD0A 4LG3A 4LIUA 4XORA 1IRZA 4V2GA 5H20A 4CYCB 1WWXA 2ADUA 3M8FA 1MNEA 2OZ6A 2WV0A 3L2VA 2YU3A 2W48A 3KZYA 1X1DA 1TT0A 1POGA 2CQQA 2OC6A 1HW5A 2V9PA 4LFUA 2AQEA 4U0YA 1MBJA 2H1KA 1SD6A 4HQMA 3LA7A 1TWAJ 2HYGD 2K9SA 1JKRC 3DTIA 4F3QA 1HDPA 2JN6A 2I10A 2R7FA 2FNAA 2RN7A 2VJJA 4A5NA 4U0WA 4HNUA 1LPQA 1OJLA 5CVVA 4HEA2 4UUVA 4E7KA 1OCTC 2ELKA 4A5MA 2L9VA 3K7AJ 2R93J 2XAHA 4LJZF 1MJ9A 4CZZA 4GYGA 1YRNB 5F1JA 1MH4A 2GOXB 2DBBA 4H4KC 3BG9A 5BMZA 4YFKF 3NWSA 4XOTA 3CF2A 5JI6A 3M8JA 1B8IB 1ZGWA 2KJBA 2X6OA 1HC8A 4AWXB 1HBXG 3WTUC 2XB0X 2WTEA 3D5RC 1BJAA 3L2QA 2YSRA 1BL0A 1FOXA 1JKPC 1SC7A 5DS9A 3FX3A 4PGGA 4D7NA 2PMHA 3BQZA 4K2EA 3PNTA 5EEAA 1AKHA 4L5EA 2XV4S 1R23A 1JGGA 4FETA 3SZTA 3ESWB 1X58A 3DBRB 1PYVA 4HYEA 3VFZA 3Q3SA 3ELKA 4I02A 1W0TA 1SEUA 1XX5A 4OINF 1ODDA 3KYLA 1VTNC 2M87A 3H1CA 3BR6A 3HUGA 3WU2C 3AAFA 3LA3A 3OMYA 4V19K 5EZHA 2BVLA 3K1MA 1G3TA 2ZXHA 3QYEA 3KFWX 4S04A 1XSXA 4QPOA 1TQIA 2AO9A 1XGNA 2EPFA 2VBYA 3TMOA 1YG2A 4M3DA 2IGOA 5HLGA 3F3XA 4KNYA 2L0KA 3SFIA 5F04A 1YO5C 1IGNA 2L54A 1OCCH 2GBYA 4GYIA 3WTTC 1IV6A 4KMFA 3GBGA 5DEQA 5M5XJ 1GV5A 1PUFB 3ERED 1VQMI 4I98B 3IKTA 1XGMA 3ZQQA 3FBNB 3IWZA 1K4SA 2CH0A 4A6DA 3GTKJ 3J80Z 1FIPA 3IRRA 3V7SA 1U5TA 3OL3A 4LB6B 1P4XA 4FTHA 3GZNB 3M3YJ 6PAXA 1R4NB 3PO2J 1ZK8A 3B02A 3VPRA 5KNLA 5EZGA 2KPMA 2UZKA 1MBKA 3H9QA 2IS4A 2VQLA 1V54H 2Z9OA 3V7CA 4JP0A 2DOAA 3ASNH 5IT3A 5DUIA 3GTLJ 2R7UA 2KZGA 1ORKA 1P2FA 2BHYA 5EJCA 2PMZA 3DPTA 3H0GJ 4XQFA 3DLAA 3WTXC 2R7OA 4KUMA 2L7MP 2RGVA 3P9IA 4UVCA 3J7YJ 1RKWA 4RS8A 3RZDJ 3FXRA 2ZB9A 1UZCA 5H6QA 3AL0C 1E3HA 5AIPA 1B6AA 2JZYA 2QZ8A 4M6XA 2R7TA 2H94A 1X19A 3ML6A 5J6XA 1OCZH 5BOXA 3K4BA 4HX7A 1XMAA 4Q5SF 2IEKA 1ETQA 4A69C 2BGCA 3OS1A 5FRMA 1R71A 2X4HA 4MFDA 2Q2EB 4XONA 2LFBA 3AFHA 2HYJA 3E6MA 4XRSG 4XNFA 3CUOA 3E1SA 2L01A 3OSFA 1ZRDA 4ZTJA 3OYMA 2IGKA 2VJ4A 1FIAA 2FNPA 1LEAA 4BHBA 2VQCA 2VKVA 3RYRA 2GA1A 2F4OB 2KRCA 2WWYA 1IXSB 2COMA 1VI0A 2VJIA 3MVPA 5JVGF 4IHWA 2JSPA 2NAZA 3S1MJ 3T8RA 2W00A 1ZKGA 1Z9CA 1ETVA 5GP9A 3JRBA 2DOFA 5DTDA 3E6CC 2DJIA 4PFPA 1T6SA 2NVUB 3IL2A 1ZR2A 1MJAA 4E7IA 1LDKB 3OYBA 2LD5A 3HOUJ 1MGTA 1P4WA 4OIPF 3OYKA 2HU9A 2XAJA 4DBQA 4HBLA 1PP7U 2RQPA 1RESA 2PMUA 1DQUA 3OYHA 1ERDA 4F91B 1FMWA 4OIRF 4Y33A 4HSTA 5J4VA 1RETA 2HKXA 3GFJA 2LH9A 2DK5A 1ON1A 4GXOA 2K40A 1W0UA 1XG1A 3FMSA 3JCUC 1T2KA 4DNCA 4YFXF 1R1UA 2FRHA 5IP9J 4CUGA 3JAMK 4GFBA 2LF8A 2HVQA 1SD4A 2EINH 5D8LB 2X6XA 1IN6A 2VE9A 1T95A 2DMUA 4BKXA 3OYIA 4X6AJ 1TLHB 2N8GA 4BQAA 3BR2A 3QPSA 2ME0A 1RZ4A 4PFOA 4XN3A 4AIDA 1MSFC 3G6EI 1FOYA 4BY7J 2WAQA 1Y8QB 2IW5A 2E19A 1IF1A 2VOOA 1D0XA 3F6OA 1MMNA 2PI0A 4FE4A 3M7GA 1BI3A 4F93B 2IS6A 3BJ6A 1VQ8I 1A35A 1TW3A 1USSA 2PFBA 3UR3C 2B0LA 5DD8A 2EZHA 1SD5A 3HL2A 3WGGA 4E4HA 4BE0A 2VBXA 2WADA 2DTZA 1BJZA 3E97A 1MDMB 3KZZA 4M3FA 4YIRX 2OJED 3VYUB 3MKLA 1E0EA 1P6RA 1SVLA 1USTA 3B73A 4IQ4A 3VSLA 1F36A 3BR1A 1V5FA 1HOMA 1Z91A 3QPHA 1KU9A 1PUEE 1BOAA 1J7KA 1XGOA 5K1YA 1QZYA 4XKVA 3H0DA 2HZTA 1RNLA 1YJ9I 1D8KA 2NVQJ 1LKXA 2RAEA 2BOLA 2CMPA 4HQEA 2HQRA 2DA1A 5GPAA 4Y4RA 4WF2A 4HAMA 3OYGA 2KRFA 3TP3A 3Q0UA 5JHUA 2DXIA 2HDCA 2BY3A 2DFFA 1QNTA 2NNYA 3CC4I 2ECCA 4PK4A 3TBIA 3A0BC 2R7RA 2CS3A 3P9KA 3RI4A 1FOWA 4RGUA 5FROA 5J1YA 1RI7A 2P81A 1Y6IA 3DQVC 5IT9K 1FEXA 5C3EJ 1WRJA 4LIVA 1JTXA 4ZYGA 2DMPA 2DA5A 3ZMVA 1D1CA 4UV9A 3ZRGA 1S7OA 3QOEA 5K5QA 4HF0A 4IVNA 3JRAA 3BQYA 4AIKA 2NS0A 4G6QA 2YU9J 3S14J 4ENMA 3IP4B 3KE2A 3W2AA 3K2ZA 4IF4A 5J4YA 1P92A 3FXKA 1Y56A 2WY7Q 4M74A 1H89C 2Z99A 3CESA 2M0MA 2AS5F 3IH4A 1WQ2A 2O5RA 4BXUA 1BI0A 2FQ3A 4PSXA 2WAQN 4DQ2A 1TL8A 2K27A 1Z1DA 2Z2SB 4UVAA 4C3HJ 3K70D 4JX6A 4ESFA 5LFAA 5EGOB 4P96A 3GZ6A 4OMYA 1X1CA 2CRGA 5CVUA 2WB1A 5IP6A 1Q1VA 5HS7A 1I3AA 4FHTA 4A3IJ 4S05A 1KU2A 2NVTJ 2JA8J 2E34A 3I59B 3TDUC 2A6EF 2CUEA 2OBPA 1OPCA 2ESNA 2JUGA 1BBYA 4MO7A 1D1BA 2IS2A 1X4PA 3NQOA 4XRFA 1Y8RB 3FF5A 4G9YA 3S2DJ 2KIQA 2QWWA 3GCMA 2VBWA 2ZXWH 5HNFA 1YTYA 2NYXA 3DTKA 1QBJA 1OQYA 5DDGA 1CF7B 5CVJA 4CCOA 4UUSA 2O6GE 3DEUA 2K4JA 3BTLA 2CG4A 2VPRA 4ZYHA 1S6LA 2GM4A 3PQKA 3QPLA 2DLLA 2RDPA 4WXCA 3DWLE 2UXNA 5DV5A 1LUJB 1VQOI 2R7ZJ 2E5ZA 2JA7J 5B66C 1F43A 4BGDA 1JTYA 2HNHA 1GXQA 4D9JA 2EH3A 2J5OA 4DJAA 2HVSA 2LY1A 4ZZLA 4B44A 1LFBA 1SAXA 4LITA 4EM1A 3JW4A 2M9HA 3C1DA 1GXPA 5ERIA 2EZIA 1XB4A 1VQ7I 2WA0A 4LK0F 4B1RA 2ZNYA 2VT3A 3HJEA 3ZMSA 4BQQA 2LBFB 1HDDC 2LYCA 2QBYA 1KYWA 2A68F 4P55A 2MLGA 3T1BA 2JTVA 3MKYB 3WTWC 2F6CA 3ABUA 3HBLA 4CDGA 1ZYRF 2H8RA 2EILH 4EQQA 3M4OJ 1D8JA 3SHFA 2QQ8A 2HPMA 3IH3A 1MMDA 1Z6TA 2FMLA 2HWVA 4IOAF 4B8XA 2FJ1A 2QSHX 2B7EA 2R7XA 5B1BH 1IG7A 3F9KA 1MNDA 1R5GA 2P5KA 3HGYA 5HDKA 5FKKA 3S32A 4HPQA 3K4NA 4OIQF 3H36A 4XKBA 4D5CA 3I4MJ 3QOPA 4IPAA 1I27A 2R0QC 5L3GA 2JRMA 2Y48A 4AUXA 1QRYA 2KLOA 4XSXF 3PL8A 3V8JA 2XRNA 1VNDA 3GWZA 1M1EB 5J8FA 5KK1A 1HA8A 3KPHA 2A61A 3PM1A 5JFRA 4KDPA 4RAZA 4N9HA 1WJ5A 1O57A 3KEQA 3TOBA 4F52A 2LY2A 4MFEA 4E7LA 2A6TA 3LSTA 4H0EA 3K4JA 5J3LA 3W6VA 5DCMB 3DKWA 2Q8KA 3L7WA 1R49A 2VBZA 2E5NA 1LE8A 1G3WA 4B4CA 3ZMDA 2RKHA 3HIFA 3IKVA 5BPDA 3IC7A 4JOMA 1YE9A 1IN4A 5E3NA 4UB6C 2HKOA 2GLOA 3OIQA 3RPUD 3M8EA 2OQRA 1SFEA 5CVIA 2VONA 1V5GA 2W85A 4ENNA 1YIJI 2JT1A 2IS1A 2BV6A 5E1ZB 4LD5A 1IRFA 3ECOA 5GTHC 1FYLA 1BR4A 1UELB 3H9JA 2V9KA 3KP2A 3ROUA 2XAFA 3A02A 4C3IJ 2GIVA 4FE7A 2XPUA 4KICA 4C3JJ 5ILSA 5M3MJ 2XSDC 2WAFA 3KYDB 3BZKA 1ZREA 3BG6A 5KAFC 5D6FA 3OYAA 2DN0A 4NBQA 1STZA 2OAZA 2ZNZA 1XGSA 2QKMB 3O8HA 4P1WA 1N25A 1W7PD 2MBFA 3OL4A 2NS7A 2X1DA 3T5XA 4EJWA 2XIGA 2DMTA 1D1AA 2FEZA 4DOZA 4L9JA 3ZMZA 2PQ8A 4RB0A 1QPIA 2KJCA 3PUBA 3OYCA 4V2FA 4BJ6C 2MYSA 1JHFA 3I53A 1MBFA 1V55H 1YS7A 2MC4A 4RLFA 1GLNA 2HGCA 5J47A 2LOOA 5JVTA 2CQKA 3U1DA 1A6IA 1QHHD 3K4KA 2F4MB 3GX4X 1J2XA 1K78B 4M73A 4BJTA 3DEWA 2HTJA 2R5YA 3LOCA 3MAJA 3SDBA 2P6TA 1VQPI 1U8RA 2CUZA 2W24A 1A36A 4IHXA 1Q1HA 4AYBA 2A07F 1XTAA 3KLNA 4XLAA 1YQAA 3G3ZA 4KFCA 4HSRA 5FKMA 3RKXA 3GFIA 3RKQA 2FE3A 3QAHA 1ZGJA 1XSDA 1OMIA 1EJ9A 2VL8A 1D5VA 4RGSA 2ESHA 5M5WJ 3DKYA 1NHAA 3WODF 4AC0A 4XRSA 4GGGA 2EV5A 2BVMA 4IKFA 1HKSA 4G8XA 2JA5J 2BXZA 3E5XA 4MGRA 3SXYA 4CCMA 2NNNA 5LHGA 1OYYA 3A01B 5ED4A 2FX0A 3DFGA 1SMYF 1UB9A 1WJFA 3FK6A 1QGPA 1S9HA 2AQFA 3OWTA 5J40A 3REOA 2XC7A 2F5EA 3BCAA 1SVMA 2F5CA 3DPLC 5HDGA 4DYCA 3L2WA 3RIRA 4NC6A 2QYOA 2R4GA 4Y15A 2O61A 4MTDA 2L9RA 4HLYA 3QWLA 5IYDJ 4QIWN 1MH3A 4OU0A 3TQNA 5LD2C 5LGTA 2FXAA 1ACIA 5F27A 4BEHB 4F55A 3VODA 3W3CA 4A3DJ 1U3EM 2DFEA 1X1BA 4BJ5C 2KQRA 4OOIA 3W6JB 2ZKZA 3GXOA 1SFXA 1ZGAA 2VI6A 2UXXA 3MZ8A 1TZLA 4M3GA 3ZXSA 2A69F 4N0BA 3HG9A 4I2OA 3ULQB 1D0ZA 4XN0A 5K7FA 4KYWA 2M8EA 4BQOA 2IXSA 2CW8A 4A3BJ 3SZPA 5J1RA 2IPQX 3S8PA 4RLQA 1VFCA 1K4TA 1A04A 2IA2A 2H8WA 5HLIA 3CJRB 1BI1A 5FLXK 4XLPF 2DYSH 3FHNA 4I76A 4Q47A 3HOXJ 2CV1A 3F8MA 2IT0A 2R7VA 3LL7A 2IGNA 2DCEA 3ABLH 2ZCWA 4CCJA 1VQKI 2E35A 3CJNA 5FFXA 2L5QA 2VQHA 3KP5A 2E1MC 4G6DA 2ICWG 1QZEA 3FZVA 3WTSC 3H5AA 4WK8F 4IJAA 1HCRA 1X1AA 3G1OA 4L9TA 4AYBN 2L7KA 3DLLF 1FPQA 4FASD 2L9SA 3MKWB 2FSWA 3K9TA 2JUCA 4LLGF 2GAUA 2Y31A 5AIQA 5GAEJ 2X48A 4Z6YA 2HEOA 4D0PA 4CYCA 2HTSA 5F0FA 3L1PA 2BY2A 4I0AA 5FJ8J 4M9ZA 1Y1VJ 3BDDA 2OCEA 1EV7A 3O6BB 3W2WA 1AHDP 2Y30A 4UNOA 4CCNA 3RSNA 5GAGJ 3R4KA 2P4WA 3U9GA 4PDKA 1W36D 2VQGA 3HSFA 3K4CA 1F9NA 3I4PA 5D8KB 2W25A 3ASOH 1VQNI 2X6YA 3J81K 4M9SA 2DOEA 3EYIA 4LLLA 4Q48A 1W4MA 2QGUA 5E3LA 3DKXA 3IV5A 1YRNA 4C2UA 1WSUA 4ABZA 3OIOA 3Q9SA 2D5VA 1B8IA 1ETOA 4BDYA 2BZTA 2LP0A 2QSFX 1IXRC 1TWCJ 3ZQGA 1ZHFA 2FOWA 1VQ5I 2XRLA 4JQFA 2DQRA 3T0YA 4RDUA 4BDZA 2E71A 4FQGA 3DBHB 4UB8C 5DM7F 3HKZA 1HLVA 4CH7A 5FKNA 2D1HA 3LSGA 2EFOA 1LDDA 2CWEA 3JRGA 1R9TJ 2YX4A 3HEFA 1XDUA 4Z2YA 2M2EA 4O3MA 3LSRA 2GWRA 3L2UA 3HTSB 2O3FA 2BY1A 4KN4X 3BY6A 1TC3C 2A6HF 5E79C 1ZLJA 2QQBA 4GRIA 4U7BA 5L3FA 3IWFA 1U6GA 2Y75A 4N9IA 4ZH4F 5AONA 2NVYJ 3PUFA 1I6HJ 1LNWA 4PJMA 1RUNA 2CQ7A 1WH7A 1S7EA 4BAYA 4E7JA 2P7CB 3SZGA 1U8BA 1YIOA 3BZ6A 4UV8A 3CZ6A 5K7ZA 3CCSI 4BY1J 1SD7A 2ZMEB 4QPQA 1BIBA 2QENA 4ESJA 2EFWA 1QU3A 2LRDA 4ON0A 1D3YA
chains in the Genus database with same CATH topology
2HFHA 2ZJ2A 3ZN0A 1XCVA 1GHCA 1TQPA 1ZARA 1S7AA 2CW0F 3D0SA 2HR3A 5J8CA 2LDUA 3H3ZA 3V4GA 2HYFA 1X3UA 1YW8A 4A0XA 2F5DA 5CJ9A 3KP3A 1E17A 1SMTA 5ILUA 2Q2EA 4ENKA 4IHTA 4P5OA 5FD5A 4WX9A 2VODA 3BJOA 3HHGA 3BPXA 2GXGA 3GW2A 1U2WA 1HQCA 3RJPA 4ZYDA 3M1EA 1HSJA 1UCRA 2DT5A 1J5YA 2GQQA 3WTYC 1BC7C 3E5UA 2KKOA 1HSTA 1OYIA 1KQ8A 2RC4A 2QM3A 3PFIA 2P7VB 5KVRA 4EVIA 3K69A 2K4BA 2VE8A 3BROA 3C7JA 3LWFA 2OQGA 3ZMTA 2G9WA 2QQ9A 3TOAA 4LGWA 3G73A 4CICA 2YPRA 3Q5FA 1ZRFA 4M6YA 5L3DA 3C3WA 5FFZA 3J7AO 4R79A 1HXDA 2EFPA 3IHUA 3DV8A 1MKMA 1DDNA 2Y0MA 2GA2A 3WGHA 3NRVA 2HQNA 1KQ0A 1O3TA 1BM9A 2VC0A 4I01A 3GUDA 3QRFF 5E1XA 1MJBA 2KIUA 3ISPA 2FMYA 2G7UA 1YW7A 5CYVA 1KGSA 3FXQA 5LEKA 5A2QZ 1R5HA 5DD4A 2H09A 1MDMA 3J80K 3W6KB 4IRHA 1R1VA 3WGIA 4ZZDA 4A2UA 1W7PB 4WXHA 3ZP5A 2JPCA 4A6EA 4EGYA 3CUQB 4B09A 4XBFA 2ISYA 2ELHA 5DUKA 3F21A 3H92A 2P6SA 3WG9A 4HV6A 1PDNC 3ECHA 1JXSA 1J59A 2XROA 5D5VB 1ONVA 5LGNA 2XAQA 3LFKA 4JBAA 2EK5A 2R3SA 5ICCA 3K1NA 2Q0OA 2DU9A 2EJRA 4G7OF 2BYVE 4FT8A 4YIIA 3DXJF 4ESBA 1OKRA 5D4SA 1J0RA 3GFMA 2K86A 1H9GA 1XDSA 5ICFA 4G7HF 2ETHA 2M5WA 4EJVA 5DYMA 5LLQA 4L5IA 4YG2F 1B9NA 4AIHA 3SFZA 3I59A 1AOYA 2DW4A 1FP1D 1LEBA 2W84A 4KT5C 4QLCU 1DUXC 1FSHA 2PLYA 2PN6A 3SQNA 3R0AA 1CF7A 1IUYA 2Z3YA 3HRMA 3HHHA 3E5QA 2DQLA 3P9CA 4WXDA 2QUFA 5D5UB 1KA8A 1I5ZA 2F2EA 5FD6A 1B9MA 1Z7UA 3E6DA 1QPMA 1ZLKA 1KU3A 4KN7X 5LGUA 3EDPA 3U2RA 3I64A 5TRDA 2D1VA 5FLXZ 1FX7A 5E8IA 1AWCA 1IN8A 4HX4A 1FNNA 2STTA 3L9FA 3TO7A 2HS5A 1FSEA 3R61A 2E1NA 1QO0D 4O5VA 4CXFA 3GYHX 3HSEA 2IA0A 3COAC 1XN7A 5HOOA 1LJ9A 3L09A 3T8TA 3VB2A 3C18A 3ZPLA 4LB5A 2V9VA 1CGPA 3HYIA 1IW7F 3KP7A 4HDUA 1TTYA 2PEXA 1IAWA 4LG0B 2DAOA 3J81Z 5HS9A 4AVPA 1JHHA 1I6XA 2AXLA 3N4MA 5DCMA 4KMUX 1FT9A 4XSZF 3O2PE 4EJTA 4MEYF 2DFIA 4RGRA 1F5TA 2CO5A 2OZUA 4IRIA 4PGHA 1S3JA 3HRSA 2STWA 1U78A 1KYZA 2OU2A 4CGZA 2RNJA 1V4RA 2ZO4A 1B4AA 1K7AA 3M9AA 2V1DA 1YFHA 3HRUA 2EB7A 2V79A 5JR3A 4WWCA 3FM5A 1OR7A 1ZRCA 2F5FA 5D4RA 1L0OC 2XKPA 3FWEA 2K7LA 3CDHA 2RVCA 1RUOA 1Z05A 3I54A 3CLOA 2PJPA 4XLNF 5E17F 1FLIA 2LNBA 2M1BA 5DCFA 3BOQA 3ZMUA 3E3VA 5L3BA 5FB2A 1HKQA 5E18F 1QQIA 1K78A 2MA3A 2E7WA 2FU4A 1LB2A 1DPRA 2XHKA 4F7ZA 2O8XA 4GO1A 3FHZA 5EEGA 3GEZA 1K6OA 2Z5UA 2HOEA 2IJLA 3TDZC 3WU1B 1ZG5A 1R36A 3V8LA 5K5RA 4KA4A 1FWZA 4HX8A 3HTUA 2IA1A 1EH7A 2BBYA 4ZYEA 2P8TA 3JAMZ 3RKYA 3EUHA 4L18B 2FA5A 2QQAA 3F23A 1O7FA 1FY7A 1ZAOA 3PQJA 5D5WB 3LAJA 2P5VA 1Z6RA 5H6RA 2XUBA 3HOSA 2CSOA 2CFXA 2BE5F 2BEOA 2DTRA 2DK8A 1W5SA 2XAGA 4HLXA 1B1BA 3RYPA 1JGSA 1U5TB 2GXBA 4AIJA 3R60A 2EA4A 3R6SA 3TKYA 2XVCA 3ZQ7A 1PP8F 5HLHA 1YW9A 2Z33A 4YFNF 2OA4A 4RB2C 5LEJA 2VT2A 4IHSA 1L3LA 2XASA 2EFQA 5FGMA 4LK1F 3JSOA 2MH9A 3FXUA 1FBSA 2L02A 1JE8A 3BPVA 3F72A 1DPUA 2D2WA 3FM3A 5IT9Z 2ACJA 3RPQA 2LF7A 1P4AA 3L2CA 1BIAA 3GLXA 3F8CA 2CGPA 3I71A 5TJJA 3KLOA 3R0JA 2M30A 1HKTA 3TGNA 2V1XA 1ZH5A 3QU3A 2EWNA 2A5YB 2PG4A 4NHJA 4LMYA 5ICEA 1BN5A 4IXAA 4MQVA 4HV5A 1IXCA 1G6NA 3CTAA 4MHGA 5LHIA 4L9VA 3KP6A 1UFMA 3MZYA 4KIGA 1G3YA 4EJUA 4P9UA 2OD5A 4YIFA 4CHUA 1T39A 3CUQC 1GVJA 3GVAA 1BC8C 3RTRA 1IRGA 2RV8A 1F1ZA 4M9XA 3FMRA 3GZ5A 1FOKA 3I5UA 2MH2A 4I0BA 2JRTA 1RIOH 3QU6A 1WKMA 4BNCA 1I1GA 2H6CA 2EV0A 2ZMEA 5CLSA 4FX4A 2KIFA 2ZXJA 2LSOA 3WE3A 2QLZA 2A3SA 1S8NA 2X0LA 1R00A 4O6JA 5L3CA 4U88A 5F64A 4EV0A 3EYYA 3MFKA 4PCQA 3I0TA 2C6YA 4R1HA 4BYYA 2JPBA 3LQQA 1FBUA 1J75A 2ZBKA 3RDIA 2FBKA 4EGZA 1ZG1A 2J5PA 1HW2A 1LDJA 5E1WA 1ZN2A 4EJOA 2VN2A 2EA2A 1LQ1A 1FYKA 3QP6A 3WTZA 1BI2A 1QZZA 1IN7A 2MD5A 2QVOA 4WCGA 2MC3A 5HVQC 3S2WA 4UVBA 4U0VA 1XMKA 2ISZA 3N97A 1EH6A 1O3QA 4M72A 1J9IA 1R22A 4L5JA 1B59A 1XSVA 4Y13A 3Q9VA 4NQWA 4RAYA 3V7RA 5FO5A 2O0YA 1IN5A 4NB5A 1C0WA 3BWGA 1WI9A 3GO5A 1FZPB 1FP2A 2P5LC 1ZG3A 3QPTA 1R58A 3KCCA 2DPUA 2DO7A 3P7NA 4LLNA 1OYWA 1KQ9A 3BP8A 2PBIA 4A0YA 4ENJA 4R8HA 3MEXA 1LVAA 1TNSA 2EV6A 5E8GA 3WU0A 4UHTA 1KU7A 5F6FA 3K0LA 1O7LA 1I1SA 4I09A 3F6VA 3MCZA 3RPUA 4HZFA 5E20A 1G4DA 4HA8A 1Y0UA 4BH9A 2EFNA 1FC3A 2IP2A 2M45A 4MTEA 4Y17A 5BQTA 4HF1A 4G94A 1ON2A 1W7PA 3GF2A 4EMSA 5ILVA 4E70A 3HRTA 3CUQA 1E2XA 2JSCA 2IRFG 2E7XA 2QBYB 4CYDA 1ULYA 3VOEA 5F1RA 1YS6A 3ABTA 4FX0A 5LBQA 3D5LA 2GZWA 1YYVA 1XCBA 1TW2A 3LQRA 4ETSA 1MZBA 1R7JA 5BS6A 2E1CA 3ZN1A 3HOTA 1XD7A 3F8BA 1FYMA 2LKPA 5L3EA 3QP5A 3FMQA 3L00A 3F8NA 4L9NA 4RB3C 3TO6A 1T98A 4HDVA 4KIBA 2WC2A 4HOBA 3F8FA 2G7HA 4UXNA 3KP4A 2W57A 3NEUA 2FF4A 3JTGA 2DI3A 4BHCA 2L4MA 1T0FA 2FBIA 4MEXF 3BJAA 4JK1X 2H27A 5K5OA 3CO7C 3I58A 4KIFA 4PZJA 4A12A 4AD9A 2UWMA 4RB1A 3HSRA 2L3DA 5CVRA 2CYYA 4ASNA 3RKWA 3MZHA 5HDNA 4P9FA 3V8KA 5LRSA 2VOPA 1SFUA 1G3SA 2H6BA 1V3FA 3WE2A 4QWQA 2XGXA 4OMZA 1R1TA 4I7HA 4HW0A 2KIMA 3WTVC 2V1UA 4L0ZB 3EETA 2TDXA 5A2QK 3KETA 2NRAC 4G7ZF 2MLKA 5ICGA 5LHHA 2K02A 4U7DA 3OV8A 1O3RA 1T38A 5HS8A 2YX7A 4TV7A 1H9TA 4OIOF 3MQ0A 2FBHA 4A0ZA 1FBQA 3MWMA 4IRGA 1U5TC 1IZ1A 3IRQA 3LAPA 3DP7A 1YLFA 3O3KA 1HW1A 2ZFWA 3VEPA 4RGXA 4MNUA 1TBXA 1TNTA 4CO8A 4LG0A 3H3UA 3DF8A 3KEOA 3F22A 2DPDA 5EEHA 3E6BA 1DP7P 2YR2A 3JSPA 3JTHA 2IVMA 2D45A 1K79A 1TQMA 1REPC 2XKOA 4EM2A 2L4AA 4GCVA 3CO6C 1W5TA 1O3SA 1F4KA 2V6CA 5D6EA 2FOKA 1UHWA 3K1PA 4HF2A 5LRRA 3LA2A 4Q4ZF 2O03A 2R7DA 1S29A 2VXZA 1H0MA 4L0YB 5D5XB 2VC1A 3TO9A 4M71A 4MQ9F 3EQLF 3GFLA 5BPIA 1UHMA 4BHPA 1EH8A 3OOPA 1MD0A 5H20A 1WWXA 2ADUA 3M8FA 2OZ6A 2WV0A 2YU3A 3KZYA 4U0YA 1HW5A 4LFUA 1SD6A 4HQMA 3LA7A 2HYGD 2R7FA 2FNAA 2RN7A 4A5NA 4U0WA 5CVVA 4UUVA 4A5MA 2XAHA 4LJZF 1MJ9A 4CZZA 4GYGA 2DBBA 5BMZA 4YFKF 5JI6A 2KJBA 4AWXB 1HBXG 3WTUC 2WTEA 1BJAA 2YSRA 3FX3A 4PGGA 2PMHA 4K2EA 2XV4S 1R23A 3SZTA 4HYEA 3VFZA 3ELKA 4I02A 4OINF 1ODDA 1VTNC 2M87A 3HUGA 3AAFA 3LA3A 3K1MA 1G3TA 3KFWX 4S04A 1XSXA 1TQIA 1XGNA 2VBYA 1YG2A 5HLGA 4KNYA 3F3XA 1YO5C 2L54A 4GYIA 3WTTC 4KMFA 5DEQA 3ERED 4I98B 3IKTA 1XGMA 3IWZA 4A6DA 3J80Z 3IRRA 3V7SA 1U5TA 4LB6B 1P4XA 6PAXA 3B02A 2UZKA 2Z9OA 3V7CA 5IT3A 5DUIA 1P2FA 3DPTA 3WTXC 4KUMA 2RGVA 3P9IA 4UVCA 4RS8A 3FXRA 5H6QA 5AIPA 1B6AA 2JZYA 2QZ8A 4M6XA 2H94A 3ML6A 5J6XA 5BOXA 4HX7A 1XMAA 4Q5SF 2BGCA 2X4HA 3E6MA 3CUOA 2L01A 1ZRDA 2FNPA 1LEAA 4BHBA 3RYRA 2GA1A 2WWYA 1IXSB 2COMA 2NAZA 3T8RA 1Z9CA 3E6CC 1T6SA 3IL2A 1MJAA 1LDKB 1MGTA 1P4WA 4OIPF 2XAJA 4HBLA 1PP7U 2RQPA 2PMUA 4OIRF 2HKXA 3GFJA 2DK5A 1ON1A 4GXOA 3FMSA 1T2KA 4DNCA 4YFXF 1R1UA 2FRHA 3JAMK 2LF8A 1SD4A 5D8LB 1IN6A 2VE9A 1TLHB 4BQAA 1RZ4A 2IW5A 1IF1A 2VOOA 3F6OA 2PI0A 3M7GA 1BI3A 3BJ6A 1TW3A 1USSA 2PFBA 2B0LA 5DD8A 1SD5A 3WGGA 2VBXA 3E97A 1MDMB 3KZZA 1P6RA 1USTA 3B73A 1Z91A 3QPHA 1KU9A 1PUEE 1BOAA 1J7KA 1XGOA 5K1YA 1QZYA 2HZTA 1RNLA 1D8KA 4HQEA 2HQRA 4WF2A 4HAMA 2KRFA 5JHUA 2HDCA 2NNYA 1QNTA 3P9KA 3RI4A 4RGUA 1RI7A 3DQVC 5IT9K 1WRJA 4ZYGA 3ZMVA 4UV9A 1S7OA 5K5QA 4HF0A 4IVNA 4AIKA 2NS0A 4G6QA 4ENMA 3KE2A 3K2ZA 4IF4A 1P92A 4M74A 2Z99A 2AS5F 1WQ2A 4BXUA 1BI0A 2FQ3A 4DQ2A 2K27A 1Z1DA 4UVAA 4ESFA 4P96A 3GZ6A 4OMYA 5CVUA 5HS7A 4FHTA 4S05A 1KU2A 3I59B 3TDUC 2A6EF 2OBPA 1OPCA 2ESNA 1BBYA 3NQOA 4XRFA 3FF5A 4G9YA 2QWWA 2VBWA 1YTYA 2NYXA 1QBJA 5DDGA 1CF7B 5CVJA 2O6GE 3DEUA 2K4JA 2CG4A 4ZYHA 1S6LA 3PQKA 2DLLA 2RDPA 4WXCA 2UXNA 5DV5A 1GXQA 2J5OA 4ZZLA 1SAXA 4EM1A 3JW4A 3C1DA 1GXPA 5ERIA 1XB4A 4LK0F 2ZNYA 2VT3A 3ZMSA 2QBYA 1KYWA 2A68F 4P55A 2MLGA 3T1BA 2JTVA 3WTWC 3ABUA 4CDGA 1ZYRF 4EQQA 1D8JA 3SHFA 1Z6TA 2FMLA 2HWVA 4B8XA 1R5GA 2P5KA 5HDKA 4OIQF 3QOPA 4IPAA 1I27A 5L3GA 2Y48A 4XSXF 3V8JA 2XRNA 3GWZA 5J8FA 5KK1A 5JFRA 2A61A 4KDPA 4RAZA 4N9HA 1O57A 3KEQA 3TOBA 3LSTA 4H0EA 5DCMB 3DKWA 2Q8KA 3L7WA 2VBZA 1G3WA 3ZMDA 2RKHA 3HIFA 3IKVA 5BPDA 3IC7A 1IN4A 2HKOA 3M8EA 2OQRA 1SFEA 5CVIA 2VONA 2W85A 4ENNA 2JT1A 2BV6A 5E1ZB 4LD5A 1IRFA 3ECOA 1FYLA 3KP2A 3ROUA 2XAFA 2GIVA 4KICA 5ILSA 1ZREA 5D6FA 1STZA 2OAZA 1XGSA 2ZNZA 1W7PD 2MBFA 3T5XA 4EJWA 2XIGA 2FEZA 4L9JA 3ZMZA 2PQ8A 4RB0A 2KJCA 1JHFA 3I53A 1YS7A 2HGCA 5JVTA 2CQKA 3U1DA 3GX4X 1J2XA 1K78B 4M73A 2HTJA 3MAJA 2P6TA 1U8RA 2W24A 1Q1HA 2A07F 3KLNA 1YQAA 3G3ZA 4KFCA 3RKXA 3GFIA 2FE3A 3QAHA 1ZGJA 1XSDA 1OMIA 1D5VA 4RGSA 2ESHA 1NHAA 3WODF 4GGGA 2EV5A 1HKSA 4G8XA 3E5XA 4MGRA 3SXYA 5LHGA 2NNNA 1OYYA 5ED4A 3DFGA 1SMYF 1UB9A 1QGPA 3REOA 2F5EA 2F5CA 3DPLC 5HDGA 3RIRA 2QYOA 4Y15A 2O61A 4MTDA 4HLYA 4OU0A 3TQNA 5LGTA 2FXAA 3VODA 1U3EM 4OOIA 3W6JB 2ZKZA 3GXOA 1SFXA 1ZGAA 2UXXA 2A69F 4N0BA 4I2OA 3ULQB 4KYWA 2M8EA 3SZPA 2IPQX 1A04A 2IA2A 5HLIA 1BI1A 5FLXK 4XLPF 2IT0A 4Q47A 3F8MA 2ZCWA 3CJNA 5FFXA 3KP5A 4G6DA 3FZVA 3WTSC 4WK8F 4IJAA 4L9TA 1FPQA 2FSWA 3K9TA 4LLGF 2GAUA 5AIQA 2HEOA 4D0PA 2HTSA 4I0AA 4M9ZA 3BDDA 1EV7A 3O6BB 4UNOA 3R4KA 2P4WA 3U9GA 4PDKA 3HSFA 1F9NA 3I4PA 5D8KB 2W25A 3J81K 4M9SA 3EYIA 4LLLA 4Q48A 1W4MA 1WSUA 3Q9SA 1IXRC 1ZHFA 4JQFA 3T0YA 2DQRA 2D1HA 2EFOA 1LDDA 2CWEA 2YX4A 1XDUA 4Z2YA 4O3MA 3HTSB 2GWRA 2O3FA 4KN4X 3BY6A 2A6HF 1ZLJA 2QQBA 4U7BA 5L3FA 3IWFA 1U6GA 2Y75A 4N9IA 4ZH4F 5AONA 1LNWA 1RUNA 4BAYA 2P7CB 1YIOA 3BZ6A 4UV8A 1SD7A 2ZMEB 1BIBA 2QENA 4ESJA 2EFWA 4EM0B 4ON0A 1D3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFH A;  2ZJ2 A;  3ZN0 A;  1XCV A;  1GHC A;  1TQP A;  1ZAR A;  1S7A A;  2CW0 F;  3D0S A;  2HR3 A;  5J8C A;  2LDU A;  3H3Z A;  3V4G A;  2HYF A;  1X3U A;  1YW8 A;  4A0X A;  2F5D A;  5CJ9 A;  3KP3 A;  1E17 A;  1SMT A;  5ILU A;  2Q2E A;  4ENK A;  4IHT A;  4P5O A;  5FD5 A;  4WX9 A;  2VOD A;  3BJO A;  3HHG A;  3BPX A;  2GXG A;  3GW2 A;  1U2W A;  1HQC A;  3RJP A;  4ZYD A;  3M1E A;  1HSJ A;  1UCR A;  2DT5 A;  1J5Y A;  2GQQ A;  3WTY C;  1BC7 C;  3E5U A;  2KKO A;  1HST A;  1OYI A;  1KQ8 A;  2RC4 A;  2QM3 A;  3PFI A;  2P7V B;  5KVR A;  4EVI A;  3K69 A;  2K4B A;  2VE8 A;  3BRO A;  3C7J A;  3LWF A;  2OQG A;  3ZMT A;  2G9W A;  2QQ9 A;  3TOA A;  4LGW A;  3G73 A;  4CIC A;  2YPR A;  3Q5F A;  1ZRF A;  4M6Y A;  5L3D A;  3C3W A;  5FFZ A;  3J7A O;  4R79 A;  1HXD A;  2EFP A;  3IHU A;  3DV8 A;  1MKM A;  1DDN A;  2Y0M A;  2GA2 A;  3WGH A;  3NRV A;  2HQN A;  1KQ0 A;  1O3T A;  1BM9 A;  2VC0 A;  4I01 A;  3GUD A;  3QRF F;  5E1X A;  1MJB A;  2KIU A;  3ISP A;  2FMY A;  2G7U A;  1YW7 A;  5CYV A;  1KGS A;  3FXQ A;  5LEK A;  5A2Q Z;  1R5H A;  5DD4 A;  2H09 A;  1MDM A;  3J80 K;  3W6K B;  4IRH A;  1R1V A;  3WGI A;  4ZZD A;  4A2U A;  1W7P B;  4WXH A;  3ZP5 A;  2JPC A;  4A6E A;  4EGY A;  3CUQ B;  4B09 A;  4XBF A;  2ISY A;  2ELH A;  5DUK A;  3F21 A;  3H92 A;  2P6S A;  3WG9 A;  4HV6 A;  1PDN C;  3ECH A;  1JXS A;  1J59 A;  2XRO A;  5D5V B;  1ONV A;  5LGN A;  2XAQ A;  3LFK A;  4JBA A;  2EK5 A;  2R3S A;  5ICC A;  3K1N A;  2Q0O A;  2DU9 A;  2EJR A;  4G7O F;  2BYV E;  4FT8 A;  4YII A;  3DXJ F;  4ESB A;  1OKR A;  5D4S A;  1J0R A;  3GFM A;  2K86 A;  1H9G A;  1XDS A;  5ICF A;  4G7H F;  2ETH A;  2M5W A;  4EJV A;  5DYM A;  5LLQ A;  4L5I A;  4YG2 F;  1B9N A;  4AIH A;  3SFZ A;  3I59 A;  1AOY A;  2DW4 A;  1FP1 D;  1LEB A;  2W84 A;  4KT5 C;  4QLC U;  1DUX C;  1FSH A;  2PLY A;  2PN6 A;  3SQN A;  3R0A A;  1CF7 A;  1IUY A;  2Z3Y A;  3HRM A;  3HHH A;  3E5Q A;  2DQL A;  3P9C A;  4WXD A;  2QUF A;  5D5U B;  1KA8 A;  1I5Z A;  2F2E A;  5FD6 A;  1B9M A;  1Z7U A;  3E6D A;  1QPM A;  1ZLK A;  1KU3 A;  4KN7 X;  5LGU A;  3EDP A;  3U2R A;  3I64 A;  5TRD A;  2D1V A;  5FLX Z;  1FX7 A;  5E8I A;  1AWC A;  1IN8 A;  4HX4 A;  1FNN A;  2STT A;  3L9F A;  3TO7 A;  2HS5 A;  1FSE A;  3R61 A;  2E1N A;  1QO0 D;  4O5V A;  4CXF A;  3GYH X;  3HSE A;  2IA0 A;  3COA C;  1XN7 A;  5HOO A;  1LJ9 A;  3L09 A;  3T8T A;  3VB2 A;  3C18 A;  3ZPL A;  4LB5 A;  2V9V A;  1CGP A;  3HYI A;  1IW7 F;  3KP7 A;  4HDU A;  1TTY A;  2PEX A;  1IAW A;  4LG0 B;  2DAO A;  3J81 Z;  5HS9 A;  4AVP A;  1JHH A;  1I6X A;  2AXL A;  3N4M A;  5DCM A;  4KMU X;  1FT9 A;  4XSZ F;  3O2P E;  4EJT A;  4MEY F;  2DFI A;  4RGR A;  1F5T A;  2CO5 A;  2OZU A;  4IRI A;  4PGH A;  1S3J A;  3HRS A;  2STW A;  1U78 A;  1KYZ A;  2OU2 A;  4CGZ A;  2RNJ A;  1V4R A;  2ZO4 A;  1B4A A;  1K7A A;  3M9A A;  2V1D A;  1YFH A;  3HRU A;  2EB7 A;  2V79 A;  5JR3 A;  4WWC A;  3FM5 A;  1OR7 A;  1ZRC A;  2F5F A;  5D4R A;  1L0O C;  2XKP A;  3FWE A;  2K7L A;  3CDH A;  2RVC A;  1RUO A;  1Z05 A;  3I54 A;  3CLO A;  2PJP A;  4XLN F;  5E17 F;  1FLI A;  2LNB A;  2M1B A;  5DCF A;  3BOQ A;  3ZMU A;  3E3V A;  5L3B A;  5FB2 A;  1HKQ A;  5E18 F;  1QQI A;  1K78 A;  2MA3 A;  2E7W A;  2FU4 A;  1LB2 A;  1DPR A;  2XHK A;  4F7Z A;  2O8X A;  4GO1 A;  3FHZ A;  5EEG A;  3GEZ A;  1K6O A;  2Z5U A;  2HOE A;  2IJL A;  3TDZ C;  3WU1 B;  1ZG5 A;  1R36 A;  3V8L A;  5K5R A;  4KA4 A;  1FWZ A;  4HX8 A;  3HTU A;  2IA1 A;  1EH7 A;  2BBY A;  4ZYE A;  2P8T A;  3JAM Z;  3RKY A;  3EUH A;  4L18 B;  2FA5 A;  2QQA A;  3F23 A;  1O7F A;  1FY7 A;  1ZAO A;  3PQJ A;  5D5W B;  3LAJ A;  2P5V A;  1Z6R A;  5H6R A;  2XUB A;  3HOS A;  2CSO A;  2CFX A;  2BE5 F;  2BEO A;  2DTR A;  2DK8 A;  1W5S A;  2XAG A;  4HLX A;  1B1B A;  3RYP A;  1JGS A;  1U5T B;  2GXB A;  4AIJ A;  3R60 A;  2EA4 A;  3R6S A;  3TKY A;  2XVC A;  3ZQ7 A;  1PP8 F;  5HLH A;  1YW9 A;  2Z33 A;  4YFN F;  2OA4 A;  4RB2 C;  5LEJ A;  2VT2 A;  4IHS A;  1L3L A;  2XAS A;  2EFQ A;  5FGM A;  4LK1 F;  3JSO A;  2MH9 A;  3FXU A;  1FBS A;  2L02 A;  1JE8 A;  3BPV A;  3F72 A;  1DPU A;  2D2W A;  3FM3 A;  5IT9 Z;  2ACJ A;  3RPQ A;  2LF7 A;  1P4A A;  3L2C A;  1BIA A;  3GLX A;  3F8C A;  2CGP A;  3I71 A;  5TJJ A;  3KLO A;  3R0J A;  2M30 A;  1HKT A;  3TGN A;  2V1X A;  1ZH5 A;  3QU3 A;  2EWN A;  2A5Y B;  2PG4 A;  4NHJ A;  4LMY A;  5ICE A;  1BN5 A;  4IXA A;  4MQV A;  4HV5 A;  1IXC A;  1G6N A;  3CTA A;  4MHG A;  5LHI A;  4L9V A;  3KP6 A;  1UFM A;  3MZY A;  4KIG A;  1G3Y A;  4EJU A;  4P9U A;  2OD5 A;  4YIF A;  4CHU A;  1T39 A;  3CUQ C;  1GVJ A;  3GVA A;  1BC8 C;  3RTR A;  1IRG A;  2RV8 A;  1F1Z A;  4M9X A;  3FMR A;  3GZ5 A;  1FOK A;  3I5U A;  2MH2 A;  4I0B A;  2JRT A;  1RIO H;  3QU6 A;  1WKM A;  4BNC A;  1I1G A;  2H6C A;  2EV0 A;  2ZME A;  5CLS A;  4FX4 A;  2KIF A;  2ZXJ A;  2LSO A;  3WE3 A;  2QLZ A;  2A3S A;  1S8N A;  2X0L A;  1R00 A;  4O6J A;  5L3C A;  4U88 A;  5F64 A;  4EV0 A;  3EYY A;  3MFK A;  4PCQ A;  3I0T A;  2C6Y A;  4R1H A;  4BYY A;  2JPB A;  3LQQ A;  1FBU A;  1J75 A;  2ZBK A;  3RDI A;  2FBK A;  4EGZ A;  1ZG1 A;  2J5P A;  1HW2 A;  1LDJ A;  5E1W A;  1ZN2 A;  4EJO A;  2VN2 A;  2EA2 A;  1LQ1 A;  1FYK A;  3QP6 A;  3WTZ A;  1BI2 A;  1QZZ A;  1IN7 A;  2MD5 A;  2QVO A;  4WCG A;  2MC3 A;  5HVQ C;  3S2W A;  4UVB A;  4U0V A;  1XMK A;  2ISZ A;  3N97 A;  1EH6 A;  1O3Q A;  4M72 A;  1J9I A;  1R22 A;  4L5J A;  1B59 A;  1XSV A;  4Y13 A;  3Q9V A;  4NQW A;  4RAY A;  3V7R A;  5FO5 A;  2O0Y A;  1IN5 A;  4NB5 A;  1C0W A;  3BWG A;  1WI9 A;  3GO5 A;  1FZP B;  1FP2 A;  2P5L C;  1ZG3 A;  3QPT A;  1R58 A;  3KCC A;  2DPU A;  2DO7 A;  3P7N A;  4LLN A;  1OYW A;  1KQ9 A;  3BP8 A;  2PBI A;  4A0Y A;  4ENJ A;  4R8H A;  3MEX A;  1LVA A;  1TNS A;  2EV6 A;  5E8G A;  3WU0 A;  4UHT A;  1KU7 A;  5F6F A;  3K0L A;  1O7L A;  1I1S A;  4I09 A;  3F6V A;  3MCZ A;  3RPU A;  4HZF A;  5E20 A;  1G4D A;  4HA8 A;  1Y0U A;  4BH9 A;  2EFN A;  1FC3 A;  2IP2 A;  2M45 A;  4MTE A;  4Y17 A;  5BQT A;  4HF1 A;  4G94 A;  1ON2 A;  1W7P A;  3GF2 A;  4EMS A;  5ILV A;  4E70 A;  3HRT A;  3CUQ A;  1E2X A;  2JSC A;  2IRF G;  2E7X A;  2QBY B;  4CYD A;  1ULY A;  3VOE A;  5F1R A;  1YS6 A;  3ABT A;  4FX0 A;  5LBQ A;  3D5L A;  2GZW A;  1YYV A;  1XCB A;  1TW2 A;  3LQR A;  4ETS A;  1MZB A;  1R7J A;  5BS6 A;  2E1C A;  3ZN1 A;  3HOT A;  1XD7 A;  3F8B A;  1FYM A;  2LKP A;  5L3E A;  3QP5 A;  3FMQ A;  3L00 A;  3F8N A;  4L9N A;  4RB3 C;  3TO6 A;  1T98 A;  4HDV A;  4KIB A;  2WC2 A;  4HOB A;  3F8F A;  2G7H A;  4UXN A;  3KP4 A;  2W57 A;  3NEU A;  2FF4 A;  3JTG A;  2DI3 A;  4BHC A;  2L4M A;  1T0F A;  2FBI A;  4MEX F;  3BJA A;  4JK1 X;  2H27 A;  5K5O A;  3CO7 C;  3I58 A;  4KIF A;  4PZJ A;  4A12 A;  4AD9 A;  2UWM A;  4RB1 A;  3HSR A;  2L3D A;  5CVR A;  2CYY A;  4ASN A;  3RKW A;  3MZH A;  5HDN A;  4P9F A;  3V8K A;  5LRS A;  2VOP A;  1SFU A;  1G3S A;  2H6B A;  1V3F A;  3WE2 A;  4QWQ A;  2XGX A;  4OMZ A;  1R1T A;  4I7H A;  4HW0 A;  2KIM A;  3WTV C;  2V1U A;  4L0Z B;  3EET A;  2TDX A;  5A2Q K;  3KET A;  2NRA C;  4G7Z F;  2MLK A;  5ICG A;  5LHH A;  2K02 A;  4U7D A;  3OV8 A;  1O3R A;  1T38 A;  5HS8 A;  2YX7 A;  4TV7 A;  1H9T A;  4OIO F;  3MQ0 A;  2FBH A;  4A0Z A;  1FBQ A;  3MWM A;  4IRG A;  1U5T C;  1IZ1 A;  3IRQ A;  3LAP A;  3DP7 A;  1YLF A;  3O3K A;  1HW1 A;  2ZFW A;  3VEP A;  4RGX A;  4MNU A;  1TBX A;  1TNT A;  4CO8 A;  4LG0 A;  3H3U A;  3DF8 A;  3KEO A;  3F22 A;  2DPD A;  5EEH A;  3E6B A;  1DP7 P;  2YR2 A;  3JSP A;  3JTH A;  2IVM A;  2D45 A;  1K79 A;  1TQM A;  1REP C;  2XKO A;  4EM2 A;  2L4A A;  4GCV A;  3CO6 C;  1W5T A;  1O3S A;  1F4K A;  2V6C A;  5D6E A;  2FOK A;  1UHW A;  3K1P A;  4HF2 A;  5LRR A;  3LA2 A;  4Q4Z F;  2O03 A;  2R7D A;  1S29 A;  2VXZ A;  1H0M A;  4L0Y B;  5D5X B;  2VC1 A;  3TO9 A;  4M71 A;  4MQ9 F;  3EQL F;  3GFL A;  5BPI A;  1UHM A;  4BHP A;  1EH8 A;  3OOP A;  1MD0 A;  5H20 A;  1WWX A;  2ADU A;  3M8F A;  2OZ6 A;  2WV0 A;  2YU3 A;  3KZY A;  4U0Y A;  1HW5 A;  4LFU A;  1SD6 A;  4HQM A;  3LA7 A;  2HYG D;  2R7F A;  2FNA A;  2RN7 A;  4A5N A;  4U0W A;  5CVV A;  4UUV A;  4A5M A;  2XAH A;  4LJZ F;  1MJ9 A;  4CZZ A;  4GYG A;  2DBB A;  5BMZ A;  4YFK F;  5JI6 A;  2KJB A;  4AWX B;  1HBX G;  3WTU C;  2WTE A;  1BJA A;  2YSR A;  3FX3 A;  4PGG A;  2PMH A;  4K2E A;  2XV4 S;  1R23 A;  3SZT A;  4HYE A;  3VFZ A;  3ELK A;  4I02 A;  4OIN F;  1ODD A;  1VTN C;  2M87 A;  3HUG A;  3AAF A;  3LA3 A;  3K1M A;  1G3T A;  3KFW X;  4S04 A;  1XSX A;  1TQI A;  1XGN A;  2VBY A;  1YG2 A;  5HLG A;  4KNY A;  3F3X A;  1YO5 C;  2L54 A;  4GYI A;  3WTT C;  4KMF A;  5DEQ A;  3ERE D;  4I98 B;  3IKT A;  1XGM A;  3IWZ A;  4A6D A;  3J80 Z;  3IRR A;  3V7S A;  1U5T A;  4LB6 B;  1P4X A;  6PAX A;  3B02 A;  2UZK A;  2Z9O A;  3V7C A;  5IT3 A;  5DUI A;  1P2F A;  3DPT A;  3WTX C;  4KUM A;  2RGV A;  3P9I A;  4UVC A;  4RS8 A;  3FXR A;  5H6Q A;  5AIP A;  1B6A A;  2JZY A;  2QZ8 A;  4M6X A;  2H94 A;  3ML6 A;  5J6X A;  5BOX A;  4HX7 A;  1XMA A;  4Q5S F;  2BGC A;  2X4H A;  3E6M A;  3CUO A;  2L01 A;  1ZRD A;  2FNP A;  1LEA A;  4BHB A;  3RYR A;  2GA1 A;  2WWY A;  1IXS B;  2COM A;  2NAZ A;  3T8R A;  1Z9C A;  3E6C C;  1T6S A;  3IL2 A;  1MJA A;  1LDK B;  1MGT A;  1P4W A;  4OIP F;  2XAJ A;  4HBL A;  1PP7 U;  2RQP A;  2PMU A;  4OIR F;  2HKX A;  3GFJ A;  2DK5 A;  1ON1 A;  4GXO A;  3FMS A;  1T2K A;  4DNC A;  4YFX F;  1R1U A;  2FRH A;  3JAM K;  2LF8 A;  1SD4 A;  5D8L B;  1IN6 A;  2VE9 A;  1TLH B;  4BQA A;  1RZ4 A;  2IW5 A;  1IF1 A;  2VOO A;  3F6O A;  2PI0 A;  3M7G A;  1BI3 A;  3BJ6 A;  1TW3 A;  1USS A;  2PFB A;  2B0L A;  5DD8 A;  1SD5 A;  3WGG A;  2VBX A;  3E97 A;  1MDM B;  3KZZ A;  1P6R A;  1UST A;  3B73 A;  1Z91 A;  3QPH A;  1KU9 A;  1PUE E;  1BOA A;  1J7K A;  1XGO A;  5K1Y A;  1QZY A;  2HZT A;  1RNL A;  1D8K A;  4HQE A;  2HQR A;  4WF2 A;  4HAM A;  2KRF A;  5JHU A;  2HDC A;  2NNY A;  1QNT A;  3P9K A;  3RI4 A;  4RGU A;  1RI7 A;  3DQV C;  5IT9 K;  1WRJ A;  4ZYG A;  3ZMV A;  4UV9 A;  1S7O A;  5K5Q A;  4HF0 A;  4IVN A;  4AIK A;  2NS0 A;  4G6Q A;  4ENM A;  3KE2 A;  3K2Z A;  4IF4 A;  1P92 A;  4M74 A;  2Z99 A;  2AS5 F;  1WQ2 A;  4BXU A;  1BI0 A;  2FQ3 A;  4DQ2 A;  2K27 A;  1Z1D A;  4UVA A;  4ESF A;  4P96 A;  3GZ6 A;  4OMY A;  5CVU A;  5HS7 A;  4FHT A;  4S05 A;  1KU2 A;  3I59 B;  3TDU C;  2A6E F;  2OBP A;  1OPC A;  2ESN A;  1BBY A;  3NQO A;  4XRF A;  3FF5 A;  4G9Y A;  2QWW A;  2VBW A;  1YTY A;  2NYX A;  1QBJ A;  5DDG A;  1CF7 B;  5CVJ A;  2O6G E;  3DEU A;  2K4J A;  2CG4 A;  4ZYH A;  1S6L A;  3PQK A;  2DLL A;  2RDP A;  4WXC A;  2UXN A;  5DV5 A;  1GXQ A;  2J5O A;  4ZZL A;  1SAX A;  4EM1 A;  3JW4 A;  3C1D A;  1GXP A;  5ERI A;  1XB4 A;  4LK0 F;  2ZNY A;  2VT3 A;  3ZMS A;  2QBY A;  1KYW A;  2A68 F;  4P55 A;  2MLG A;  3T1B A;  2JTV A;  3WTW C;  3ABU A;  4CDG A;  1ZYR F;  4EQQ A;  1D8J A;  3SHF A;  1Z6T A;  2FML A;  2HWV A;  4B8X A;  1R5G A;  2P5K A;  5HDK A;  4OIQ F;  3QOP A;  4IPA A;  1I27 A;  5L3G A;  2Y48 A;  4XSX F;  3V8J A;  2XRN A;  3GWZ A;  5J8F A;  5KK1 A;  5JFR A;  2A61 A;  4KDP A;  4RAZ A;  4N9H A;  1O57 A;  3KEQ A;  3TOB A;  3LST A;  4H0E A;  5DCM B;  3DKW A;  2Q8K A;  3L7W A;  2VBZ A;  1G3W A;  3ZMD A;  2RKH A;  3HIF A;  3IKV A;  5BPD A;  3IC7 A;  1IN4 A;  2HKO A;  3M8E A;  2OQR A;  1SFE A;  5CVI A;  2VON A;  2W85 A;  4ENN A;  2JT1 A;  2BV6 A;  5E1Z B;  4LD5 A;  1IRF A;  3ECO A;  1FYL A;  3KP2 A;  3ROU A;  2XAF A;  2GIV A;  4KIC A;  5ILS A;  1ZRE A;  5D6F A;  1STZ A;  2OAZ A;  1XGS A;  2ZNZ A;  1W7P D;  2MBF A;  3T5X A;  4EJW A;  2XIG A;  2FEZ A;  4L9J A;  3ZMZ A;  2PQ8 A;  4RB0 A;  2KJC A;  1JHF A;  3I53 A;  1YS7 A;  2HGC A;  5JVT A;  2CQK A;  3U1D A;  3GX4 X;  1J2X A;  1K78 B;  4M73 A;  2HTJ A;  3MAJ A;  2P6T A;  1U8R A;  2W24 A;  1Q1H A;  2A07 F;  3KLN A;  1YQA A;  3G3Z A;  4KFC A;  3RKX A;  3GFI A;  2FE3 A;  3QAH A;  1ZGJ A;  1XSD A;  1OMI A;  1D5V A;  4RGS A;  2ESH A;  1NHA A;  3WOD F;  4GGG A;  2EV5 A;  1HKS A;  4G8X A;  3E5X A;  4MGR A;  3SXY A;  5LHG A;  2NNN A;  1OYY A;  5ED4 A;  3DFG A;  1SMY F;  1UB9 A;  1QGP A;  3REO A;  2F5E A;  2F5C A;  3DPL C;  5HDG A;  3RIR A;  2QYO A;  4Y15 A;  2O61 A;  4MTD A;  4HLY A;  4OU0 A;  3TQN A;  5LGT A;  2FXA A;  3VOD A;  1U3E M;  4OOI A;  3W6J B;  2ZKZ A;  3GXO A;  1SFX A;  1ZGA A;  2UXX A;  2A69 F;  4N0B A;  4I2O A;  3ULQ B;  4KYW A;  2M8E A;  3SZP A;  2IPQ X;  1A04 A;  2IA2 A;  5HLI A;  1BI1 A;  5FLX K;  4XLP F;  2IT0 A;  4Q47 A;  3F8M A;  2ZCW A;  3CJN A;  5FFX A;  3KP5 A;  4G6D A;  3FZV A;  3WTS C;  4WK8 F;  4IJA A;  4L9T A;  1FPQ A;  2FSW A;  3K9T A;  4LLG F;  2GAU A;  5AIQ A;  2HEO A;  4D0P A;  2HTS A;  4I0A A;  4M9Z A;  3BDD A;  1EV7 A;  3O6B B;  4UNO A;  3R4K A;  2P4W A;  3U9G A;  4PDK A;  3HSF A;  1F9N A;  3I4P A;  5D8K B;  2W25 A;  3J81 K;  4M9S A;  3EYI A;  4LLL A;  4Q48 A;  1W4M A;  1WSU A;  3Q9S A;  1IXR C;  1ZHF A;  4JQF A;  3T0Y A;  2DQR A;  2D1H A;  2EFO A;  1LDD A;  2CWE A;  2YX4 A;  1XDU A;  4Z2Y A;  4O3M A;  3HTS B;  2GWR A;  2O3F A;  4KN4 X;  3BY6 A;  2A6H F;  1ZLJ A;  2QQB A;  4U7B A;  5L3F A;  3IWF A;  1U6G A;  2Y75 A;  4N9I A;  4ZH4 F;  5AON A;  1LNW A;  1RUN A;  4BAY A;  2P7C B;  1YIO A;  3BZ6 A;  4UV8 A;  1SD7 A;  2ZME B;  1BIB A;  2QEN A;  4ESJ A;  2EFW A;  4EM0 B;  4ON0 A;  1D3Y A; 
#chains in the Genus database with same CATH topology
 3H5N A;  2HFH A;  2A05 A;  1VQ9 I;  2CU7 A;  2ZJ2 A;  2FUG 2;  3ZN0 A;  1XCV A;  3G1L A;  1GHC A;  1TQP A;  4G6T B;  4G12 A;  2CQN A;  3L2R A;  3JR9 A;  3ZGK A;  1ZAR A;  3CP8 A;  1MNM C;  1S7A A;  2CW0 F;  3BG3 A;  3D0S A;  2HR3 A;  3I56 I;  3CCJ I;  5J8C A;  2LDU A;  1RPW A;  1P7I A;  2HDW A;  3H3Z A;  1X2N A;  3BTJ A;  3V4G A;  2HYF A;  1X3U A;  1YW8 A;  4A0X A;  2VUM J;  2YUS A;  1NK2 P;  2F5D A;  2DDA A;  5CJ9 A;  4PJJ A;  1QVU A;  3KP3 A;  3JRF A;  1OLT A;  1WVR A;  2ZJP F;  1E17 A;  4M3B A;  1SMT A;  1UMQ A;  2K9Q A;  2Q2E A;  5ILU A;  3PIP F;  3ZQL A;  4FCY A;  4ENK A;  4PUS A;  2E2I J;  4IHT A;  1Y0N A;  3HC7 A;  3CCU I;  4ZDP A;  4P5O A;  5FD5 A;  4WX9 A;  4EM0 B;  4RBO A;  2QEX I;  1D5Y A;  3HKZ N;  2VOD A;  1UJ8 A;  3BJO A;  3HHG A;  5B5E C;  4XLF A;  3BPX A;  2GXG A;  3GW2 A;  1U2W A;  1HQC A;  3A1Y A;  2R5Z B;  3RJP A;  4ZYD A;  1EF4 A;  4BBS J;  3M1E A;  1HSJ A;  1UCR A;  2DFH A;  4RM3 A;  2DT5 A;  1ZR4 A;  1J5Y A;  2GQQ A;  3WTY C;  1BC7 C;  3E5U A;  2KKO A;  3BG5 A;  4AU7 A;  1HST A;  1OYI A;  3LMM A;  1KQ8 A;  2E1O A;  3HPG A;  3K6G A;  2RC4 A;  4F92 B;  1OCR H;  5E3O A;  2DA6 A;  2RRE A;  4ZDO A;  2QM3 A;  3PFI A;  4NQW B;  2P7V B;  2K9N A;  3GTO J;  5KVR A;  2V7F A;  3OY9 A;  3LSP A;  1YJN I;  3CLQ A;  4EVI A;  4YRV A;  3K69 A;  2K4B A;  2VE8 A;  3BRO A;  3C7J A;  3ZQC A;  3LWF A;  2OQG A;  5J1U A;  1E3P A;  2K9L A;  5EG0 B;  3ZMT A;  2G9W A;  2QQ9 A;  2BW3 B;  3TOA A;  1WZ2 A;  4LGW A;  3G73 A;  4CIC A;  2YPR A;  3Q5F A;  1ZRF A;  4M6Y A;  2JWT A;  5L3D A;  3C3W A;  3IAS 2;  2HDD A;  1JJ8 C;  1S72 I;  5FFZ A;  3OR2 C;  3J7A O;  4E7Z A;  3TW6 A;  1P9Q C;  4BUP A;  4R79 A;  4U87 A;  1T08 B;  1HXD A;  2EFP A;  3IHU A;  2I8D A;  3CMM A;  4XLH A;  3DV8 A;  1MKM A;  1DDN A;  2Y0M A;  2GA2 A;  2KRH A;  3QYB A;  4NNJ A;  3WGH A;  4BE2 A;  3NRV A;  2M3A A;  2X1C A;  2HQN A;  1KQ0 A;  3C2G A;  1O3T A;  5HOD A;  3TW7 A;  3LSI A;  1BM9 A;  3CME I;  2VC0 A;  1OCO H;  1X2M A;  2XAU A;  3CMA I;  4I01 A;  3EUK L;  4YEL A;  3C2H A;  3GUD A;  3AL0 B;  3QRF F;  5E1X A;  1MJB A;  3DU6 A;  2KIU A;  1H88 C;  3ISP A;  2FMY A;  2G7U A;  1YW7 A;  5CYV A;  1KGS A;  3FXQ A;  2HQ5 A;  5LEK A;  4IL6 C;  5A2Q Z;  1R5H A;  4I99 C;  5DD4 A;  2HXI A;  2H09 A;  1MDM A;  1APL C;  1I50 J;  3J80 K;  5GAH J;  3W6K B;  4IRH A;  1R1V A;  3VYS B;  2HVR A;  1K83 J;  2MSY A;  3WGI A;  3ZCO A;  4ZZD A;  4A2U A;  5C4J J;  1W7P B;  4WXH A;  3ZP5 A;  3KX2 A;  2CUF A;  3OYD A;  2JPC A;  4A6E A;  1IUF A;  4EGY A;  3CUQ B;  4B09 A;  4XBF A;  2ISY A;  2ELH A;  5DUK A;  3F21 A;  2X51 A;  3H92 A;  2P6S A;  1R4M B;  3WG9 A;  4HV6 A;  5DM6 F;  1DU6 A;  1PDN C;  3ECH A;  1JXS A;  1J59 A;  2XRO A;  2KDO A;  2ZFU A;  5D5V B;  1ONV A;  5LGN A;  2XAQ A;  3LFK A;  1MMA A;  3B6A A;  1TWG J;  4JBA A;  4A3L J;  2EK5 A;  2LR8 A;  3HXL A;  1UAA A;  1A5J A;  2R3S A;  5ICC A;  4W97 A;  3K1N A;  2M7A A;  2Q0O A;  2DU9 A;  2EJR A;  4OAY A;  4G7O F;  4HNT A;  1K6Y A;  2BYV E;  4FT8 A;  4YII A;  1NTC A;  4XIC A;  3MD2 A;  3DXJ F;  4ESB A;  1OKR A;  5D4S A;  1J0R A;  4A3F J;  1OFC X;  2M34 A;  3GFM A;  2K86 A;  4RMN A;  1OR7 C;  4OWR B;  1H9G A;  1XDS A;  3A03 A;  2E2J J;  4IQJ A;  3OIP A;  5ICF A;  1JT0 A;  4G7H F;  3AG4 H;  2KMU A;  3BT9 A;  4IZZ A;  5EGO A;  1JUM A;  4BU2 A;  4XL9 A;  2VXD A;  2ETH A;  2M5W A;  4EJV A;  1SFO J;  5DYM A;  4DW6 A;  4ZYA A;  5LLQ A;  3VYR B;  4L5I A;  4YG2 F;  1B9N A;  1PJR A;  4ZC3 A;  3SFZ A;  4AIH A;  3I59 A;  1AOY A;  2DW4 A;  5K7H A;  1DGW Y;  1FP1 D;  1P7J A;  1LEB A;  3BTC A;  3CP2 A;  1BR1 A;  3RZO J;  2PJR B;  2MGQ A;  2R7S A;  3WHB A;  5M5Y J;  2W84 A;  4BBR J;  1Z3Y A;  2JVG A;  4KT5 C;  3OR1 C;  2VJ5 A;  3IH2 A;  4QLC U;  1LFU P;  1DUX C;  3M07 A;  1FSH A;  3H3V K;  2PLY A;  3JRI A;  2PN6 A;  3SQN A;  1YOV B;  3W2V A;  2IAI A;  2B9S A;  2O8K A;  3R0A A;  1CF7 A;  1IUY A;  2Z3Y A;  3HRM A;  4B48 A;  4XKW A;  2DDB A;  2H1L A;  3HHH A;  1VQ6 I;  3E5Q A;  2DQL A;  1NH3 A;  3CD6 I;  2O7O A;  3P9C A;  1OCP A;  2R7W A;  3FXM A;  3CCM I;  4WXD A;  2QUF A;  5CKT A;  4CCL A;  5D5U B;  1KA8 A;  1I5Z A;  2BXY A;  2F2E A;  5FD6 A;  4A3E J;  3H9G A;  1B9M A;  3CDL A;  3KZI C;  1Z7U A;  3E6D A;  2X6W A;  1XPX A;  1QPM A;  1SAU A;  1ZLK A;  1IC8 A;  1KU3 A;  4KN7 X;  1D0Y A;  3FIW A;  3E7L A;  5LGU A;  3CC2 I;  2HI3 A;  3EDP A;  3U2R A;  3I64 A;  3QOD A;  4BXF A;  5TRD A;  3EUH C;  2D1V A;  5FLX Z;  1FX7 A;  5E8I A;  3AG3 H;  1AWC A;  2K5C A;  1IN8 A;  4HX4 A;  2LBF A;  3BR5 A;  1FNN A;  2STT A;  5IPA A;  3L9F A;  3DPU A;  3TO7 A;  1MMS A;  5GTI C;  3HOY J;  2HS5 A;  1HF0 A;  5F0H A;  3GTM J;  1FSE A;  1XC5 A;  3KIO A;  4KJZ A;  3R61 A;  2E1N A;  1QO0 D;  2M4G A;  4O5V A;  4CXF A;  2XPV A;  3SEZ A;  3GYH X;  2W1O A;  3HSE A;  1MSE C;  2LKS A;  2IA0 A;  1VQL I;  5JHF A;  3COA C;  1XN7 A;  2KT0 A;  5HOO A;  1LJ9 A;  3L09 A;  3TED A;  1WFX A;  3T8T A;  1KZH A;  3VB2 A;  2JMW A;  3C18 A;  1KON A;  3ZPL A;  2ZXI A;  4LB5 A;  2DA7 A;  2V9V A;  3LSJ A;  4XKC A;  2LTP A;  1CGP A;  1R5I D;  4C2T A;  2FQ4 A;  3HYI A;  1IW7 F;  2JJ7 A;  3KP7 A;  4J19 A;  1RRJ A;  4HDU A;  1TTY A;  2VAS A;  2PEX A;  4NUB A;  3EUA A;  1IAW A;  3HB9 A;  4LG0 B;  3DU5 A;  2DAO A;  3J81 Z;  3MMY B;  5HS9 A;  4E7S A;  4AVP A;  4NC8 A;  1UHS A;  1JHH A;  2XGC A;  4RA2 A;  1I6X A;  2V1N A;  1DP3 A;  5BNG A;  2AXL A;  3N4M A;  3CDI A;  1GV2 A;  3A4C A;  4XK4 A;  5DCM A;  2QA4 I;  1Y39 A;  1Z21 A;  4KMU X;  2OUM A;  3S2H J;  1FT9 A;  1RR7 A;  2O9L A;  1JUS A;  2M7B A;  2V26 A;  5EYR A;  2ID3 A;  4XSZ F;  5IOY A;  4A3K J;  3A2K A;  1U0J A;  3O2P E;  4S0H B;  4EJT A;  4MEY F;  2DFI A;  4ANJ A;  1ZQ3 P;  3BTI A;  4RGR A;  1F5T A;  2VKD A;  2CO5 A;  2OZU A;  4C2M J;  3BR0 A;  4IRI A;  4PGH A;  1S3J A;  3HRS A;  2STW A;  1EKE A;  1JT6 A;  1KYZ A;  2MD0 A;  1YJW I;  1U78 A;  2OU2 A;  4CGZ A;  2KIS A;  1V4R A;  2RNJ A;  1YX5 A;  3GME A;  2ZO4 A;  2ZSI B;  1B4A A;  2MFZ A;  1K7A A;  3M9A A;  1BR2 A;  2V1D A;  1YFH A;  4CCK A;  2EBI A;  3HRU A;  2EB7 A;  2V79 A;  5JR3 A;  4WWC A;  3FM5 A;  1OR7 A;  2K3F A;  1ZRC A;  2F5F A;  2ELJ A;  4XOP A;  5D4R A;  1L0O C;  3SYT A;  3FXO A;  1B72 B;  1BA5 A;  2XKP A;  3FWE A;  2K7L A;  3ABM H;  3FDY A;  2F48 A;  4DIQ A;  3CDH A;  1XMX A;  2RVC A;  1SVO A;  2DT6 A;  1RUO A;  5KAI C;  2AHQ A;  1Z05 A;  2XPW A;  3I54 A;  3JRH A;  3CLO A;  3V42 A;  3HOV J;  3K2A A;  4BQN A;  2PJP A;  4E6K G;  4XLN F;  3GTG J;  5E17 F;  2XF7 A;  1FLI A;  2LNB A;  3CCQ I;  3U21 A;  2M1B A;  3WHC A;  5DCF A;  4IOC F;  2OV7 A;  3BC8 A;  3BOQ A;  3ZMU A;  2DJN A;  3E3V A;  5L3B A;  2ZC2 A;  4MIM A;  5FB2 A;  3O8G A;  1HKQ A;  3K70 C;  5GPC A;  5E18 F;  1QQI A;  3OOU A;  4Y7N J;  2WV1 A;  1K78 A;  3I55 I;  2MA3 A;  3LSH A;  3GTJ J;  1IDZ A;  3CCR I;  3FK7 A;  4EEF G;  2E7W A;  3G2B A;  2FU4 A;  1LB2 A;  1DPR A;  3CCY A;  2L7F P;  2XHK A;  3B6C A;  2XGD A;  3CQZ J;  3RCO A;  4F7Z A;  2Y2Z A;  2O8X A;  4GO1 A;  1S5L C;  2KZV A;  5EEG A;  3FHZ A;  3GEZ A;  1K6O A;  1ENH A;  2DA4 A;  2F5V A;  2Z5U A;  2HOE A;  2IJL A;  3HDD A;  3H5R A;  3TDZ C;  2ZME C;  2M0C A;  3WU1 B;  3OYL A;  1ZG5 A;  1R36 A;  2HOA A;  3V8L A;  5K5R A;  4KA4 A;  1FWZ A;  1NG6 A;  1G59 A;  4HX8 A;  2YS9 A;  3HTU A;  4HRI A;  3AG1 H;  1QHG A;  2IA1 A;  1AKH B;  2LKX A;  4ZDL A;  3S1Q J;  1EH7 A;  2GIZ A;  5IYC J;  2BBY A;  2WY8 Q;  4ZYE A;  3DTE A;  3LSK A;  2P8T A;  3JAM Z;  2VLA A;  4D7M A;  3DCF A;  3A01 A;  3RKY A;  1YI2 I;  3EUH A;  4B3X A;  3EPZ A;  2QCO A;  3QYF A;  4L18 B;  2FA5 A;  3HUG B;  2QQA A;  3F23 A;  3K4L A;  1RR8 C;  2HZD A;  2VB6 A;  1O7F A;  3ZQH A;  3JRE A;  1FY7 A;  3J7A Y;  1VF9 A;  1ZAO A;  2A5W A;  3PQJ A;  3QQA A;  5D5W B;  3LAJ A;  2JK3 A;  2P5V A;  1Z6R A;  1G8X A;  1AU7 A;  1Z77 A;  5H6R A;  2EIJ H;  2XUB A;  4BEH A;  3HOS A;  2CSO A;  2CFX A;  2BE5 F;  1G2H A;  2BEO A;  2DTR A;  2DK8 A;  1W5S A;  2LMD A;  2XAG A;  4HLX A;  1B1B A;  1X4O A;  1QVT A;  4HG2 A;  3RYP A;  1ITY A;  1JGS A;  1U5T B;  1DGR M;  2DA3 A;  2GXB A;  2OTJ I;  4AIJ A;  2KL4 A;  2QF7 A;  3R60 A;  3SDG A;  3JRC A;  2EA4 A;  3R6S A;  1IO2 A;  3TKY A;  3BG7 A;  3ERM A;  2LK2 A;  2XVC A;  3S1N J;  3ZQ7 A;  1PP8 F;  5HLH A;  3PNV A;  1YW9 A;  4NDL A;  2Z33 A;  4YFN F;  1N77 A;  2OA4 A;  4ZJZ A;  4GDF A;  4RB2 C;  4N4N B;  5LEJ A;  3FBI B;  2V6E A;  2L2O A;  4XLC A;  3KYC B;  5IY5 H;  2VT2 A;  4IHS A;  1L3L A;  2XAS A;  2EFQ A;  2B63 J;  3I3L A;  5FGM A;  4LK1 F;  4J00 A;  3VWB A;  3JSO A;  5FLM J;  2MH9 A;  3RQI A;  3FXU A;  2KP6 A;  1FBS A;  2L02 A;  3NAR A;  4QSH A;  2E60 A;  2DMN A;  3Q0V A;  1JE8 A;  3BPV A;  3PSI A;  5CQE A;  3F72 A;  1DPU A;  4XMY A;  2X9D A;  4N4O B;  2D2W A;  2F4I A;  1FMV A;  3FM3 A;  3K4M A;  5IT9 Z;  1MBE A;  3UKG A;  2ACJ A;  3AKZ A;  3ABK H;  3RPQ A;  2AXT C;  4E7H A;  3OYJ A;  1H8A C;  5IYB J;  2LF7 A;  1P4A A;  3L2C A;  2GOM A;  2ECB A;  1BIA A;  3GLX A;  1I3Q J;  3F8C A;  4FIS A;  1NK3 P;  2QKL B;  2CGP A;  3I71 A;  5TJJ A;  3KLO A;  4BL0 B;  3R0J A;  2M30 A;  3RQ4 A;  2V4J C;  1HKT A;  2EIM H;  2OPT A;  3TGN A;  2V1X A;  1ZH5 A;  3QU3 A;  2EWN A;  5TIS C;  2A5Y B;  3X2Q H;  4X1E A;  1PUF A;  2PG4 A;  4NHJ A;  2KDZ A;  2HPI A;  4LMY A;  3LNQ A;  1FTZ A;  5ICE A;  1WJA A;  1BN5 A;  2R92 J;  1GUU A;  4MLO A;  2VIX A;  4IXA A;  4MQV A;  4HV5 A;  5F08 A;  4DYQ A;  1IXC A;  1G6N A;  3CTA A;  4MHG A;  5LHI A;  4XLE A;  4L9V A;  3OS0 A;  3FIS A;  1WHU A;  3KP6 A;  1UFM A;  3MZY A;  4KIG A;  3CCL I;  3E0J B;  5M3F J;  4EAT A;  1G3Y A;  4EJU A;  4P9U A;  2OD5 A;  3AG2 H;  4B47 A;  4BS9 A;  4YIF A;  4II2 A;  4CHU A;  1T39 A;  3BLY A;  4KT6 A;  3CUQ C;  1A6Q A;  1GVJ A;  4CZC A;  3GVA A;  1BC8 C;  3RTR A;  1IRG A;  4M6V A;  2RV8 A;  2JA2 A;  1F1Z A;  4M9X A;  3FXL A;  3FMR A;  3G1M A;  3GZ5 A;  3I5U A;  2FD5 A;  1FOK A;  2MH2 A;  2XB5 A;  4I0B A;  3S3M A;  4CSW A;  2JRT A;  3ZQI A;  4RAG A;  3VSK A;  4Y3O A;  1RIO H;  4IO9 F;  3QU6 A;  2HOT A;  2P0W A;  3S17 J;  2E1M B;  2Y9Y A;  5CQG A;  1WKM A;  4BNC A;  1I1G A;  2H6C A;  2EV0 A;  2ZME A;  3OYN A;  5CLS A;  3CJQ B;  4FX4 A;  2KIF A;  2ZXJ A;  4UUT A;  2LSO A;  3WE3 A;  2OTL I;  4IHV A;  2ZSH B;  2K9M A;  3HGG A;  1XS9 A;  5EF6 A;  2QLZ A;  5FKL A;  2A3S A;  1S8N A;  1YX3 A;  1V5E A;  2X0L A;  1R00 A;  4O6J A;  5L3C A;  4U88 A;  5F64 A;  3ONQ A;  3C2B A;  4EV0 A;  4Y52 J;  3EYY A;  1JJ6 C;  3MFK A;  2HXO A;  4PCQ A;  2Y9Z A;  4DYR A;  1SAN A;  2L9N A;  1J09 A;  4JYK A;  4PSW A;  3S15 J;  2PMZ N;  1SFK A;  4XR6 A;  3I0T A;  5B3S H;  2C6Y A;  3SJM A;  4R1H A;  2RQQ A;  1NG7 A;  1WJC A;  1YIT I;  4BYY A;  2JPB A;  3LQQ A;  1FBU A;  1WJE A;  3VDX A;  1J75 A;  2ZBK A;  3RDI A;  4IX7 A;  2FBK A;  4EGZ A;  2EQR A;  4DZP A;  4B3A A;  1ZG1 A;  2J5P A;  1HW2 A;  3I4N J;  1T0F C;  5KCM A;  1LDJ A;  5E1W A;  1ZN2 A;  4EJO A;  2VN2 A;  2EA2 A;  1LQ1 A;  1WGX A;  1TWF J;  3IUO A;  3PNY A;  3GLL A;  5HLT A;  3OS2 A;  3J7Z I;  1FYK A;  3QP6 A;  3WTZ A;  3A0H C;  4ZTF A;  1BI2 A;  2XF5 A;  1QZZ A;  3LFU A;  2OF7 A;  1IN7 A;  2MD5 A;  2QVO A;  4WCG A;  3PJR A;  2R5Z A;  2MC3 A;  5HVQ C;  4HNV A;  1EA3 A;  4J01 A;  2LY9 A;  3S2W A;  4UVB A;  3G4S I;  4AM3 A;  1Z3X A;  2LLK A;  4QTR A;  2CW7 A;  4U0V A;  1XMK A;  2M8G X;  2ISZ A;  3N97 A;  1EH6 A;  1O3Q A;  2EZK A;  4M72 A;  1WCM J;  1J9I A;  2EIK H;  1R22 A;  1TP4 A;  3Q0W A;  1B59 A;  1XSV A;  4IEJ A;  4L5J A;  4B43 A;  4Y13 A;  1Z67 A;  2TCT A;  3Q9V A;  3UNG C;  4NQW A;  4RAY A;  3V7R A;  1ZEL A;  2ID6 A;  5FO5 A;  3NAU A;  2O0Y A;  3CMY A;  1ETY A;  1IN5 A;  4NB5 A;  3U1K A;  1C0W A;  3GTQ J;  3BWG A;  1WI9 A;  3GO5 A;  2DOD A;  5EG0 A;  1FZP B;  2LC2 A;  1ETK A;  5CPR B;  2BW3 A;  1FP2 A;  3PO3 J;  2P5L C;  1ZG3 A;  1WH5 A;  3QPT A;  1R58 A;  3KCC A;  2ZJR F;  2MAB A;  4CA0 A;  2DO7 A;  3P7N A;  1U9N A;  2DPU A;  4LLN A;  5E3M A;  1IRX A;  1IDY A;  2CFO A;  1OYW A;  2CUJ A;  2K85 A;  3S1R J;  1KQ9 A;  4X0G A;  3BP8 A;  2PBI A;  2XSJ C;  4A0Y A;  4ENJ A;  1TWH J;  1CQT A;  4R8H A;  3MEX A;  1LVA A;  1TNS A;  2EV6 A;  5E8G A;  3WU0 A;  1ETW A;  2M4K A;  4RAF A;  3CC7 I;  4UHT A;  2UV1 A;  1KU7 A;  2G0E A;  4UY8 I;  1IV8 A;  5F6F A;  3K0L A;  1O7L A;  1I1S A;  4I09 A;  3F6V A;  1W1W E;  2KFD A;  3MCZ A;  3FXJ A;  3RPU A;  4PJL A;  4HZF A;  5E20 A;  1G4D A;  3OYF A;  4IHY A;  4HA8 A;  4UUS B;  1Y0U A;  1WJD A;  1TT5 B;  1WJB A;  4BH9 A;  5B1A H;  1W36 C;  2EFN A;  3IAM 2;  1FC3 A;  3CCV I;  1LVK A;  4II3 A;  2IP2 A;  2E2H J;  1MW7 A;  1VZ0 A;  2M45 A;  1JUP A;  3CCE I;  4MTE A;  2E36 A;  3PSF A;  5GAD J;  1BW5 A;  3S3N A;  4Y17 A;  1MIJ A;  5BQT A;  2W82 A;  1UG0 A;  4HF1 A;  5JLX A;  2Y69 H;  4D5F A;  4G94 A;  1ON2 A;  1W7P A;  3GF2 A;  4EMS A;  5ILV A;  4ITV A;  5FLV A;  1FJL A;  4E70 A;  3HRT A;  1Z0X A;  3CUQ A;  1E2X A;  3FKI J;  2JSC A;  5F0C A;  2IRF G;  2E7X A;  1QA6 A;  2QBY B;  4CYD A;  1ULY A;  3VOE A;  3BR3 A;  1E3O C;  5F1R A;  1T8I A;  1BOB A;  1YS6 A;  2OCC H;  1T56 A;  3M1C A;  2COB A;  4LOC A;  2ZJQ F;  2NS8 A;  1GT0 C;  2Z16 A;  4A93 J;  1X3Z B;  3ABT A;  4XID A;  4PJN A;  4FX0 A;  5LBQ A;  3JRD A;  3D5L A;  5FRN A;  2GZW A;  1YYV A;  1XCB A;  1TW2 A;  3LQR A;  1WI3 A;  2K3P A;  1R6R A;  3ZQF A;  2CV0 A;  4ETS A;  1MZB A;  1R7J A;  2XGE A;  3PIO F;  5BS6 A;  2E1C A;  9ANT A;  3ZN1 A;  3HOT A;  1XD7 A;  3F8B A;  1IJW C;  2KHM A;  1FYM A;  2LKP A;  5EDN A;  1GVD A;  4C9Y A;  5L3E A;  2JA6 J;  3QP5 A;  2Y0S A;  3S3O A;  1W5C C;  3FMQ A;  3L00 A;  3F8N A;  4L9N A;  1A31 A;  3HZJ A;  1JI8 A;  3MKZ A;  4RB3 C;  2CV2 A;  3D5S C;  1T98 A;  3KEY A;  3TO6 A;  4HDV A;  3K10 A;  4KIB A;  1RKT A;  3TL4 X;  4OAZ A;  3MN2 A;  3N05 A;  4YEJ A;  4C30 A;  2WC2 A;  1LE8 B;  2LG4 A;  3PFY A;  4HOB A;  4W1U A;  3F8F A;  2G7H A;  1K61 A;  1MBG A;  1T33 A;  4UXN A;  3KP4 A;  2W57 A;  3NEU A;  2FF4 A;  2BHZ A;  3DEE A;  3JTG A;  2NOJ B;  2DI3 A;  4BHC A;  2L4M A;  1T0F A;  2FBI A;  3H35 A;  4MEX F;  2VKH A;  5IOZ A;  3BJA A;  4JK1 X;  2QSG X;  3FKJ A;  4DZJ A;  2H27 A;  2WB1 N;  2NVX J;  2PJR A;  3HOZ J;  5K5O A;  3CO7 C;  3I58 A;  4KIF A;  4PZJ A;  3TP0 A;  4A12 A;  2MG4 A;  4AD9 A;  2UWM A;  4RB1 A;  3HSR A;  1FTT A;  2L3D A;  4A3J J;  5CVR A;  5FKO A;  1MMG A;  4JX5 A;  2CYY A;  2GXA A;  4ASN A;  2DT7 B;  2DMQ A;  3RKW A;  5KHD A;  3HOW J;  3HM5 A;  3MZH A;  5HDN A;  5C4X J;  4P9F A;  3V8K A;  5LRS A;  2VOP A;  1SFU A;  1PVE A;  1G3S A;  3VYT B;  2H6B A;  1V3F A;  3OSG A;  2RNG A;  2DYR H;  4BAC A;  3WE2 A;  3ZR8 X;  4QWQ A;  4RM2 A;  2XGX A;  3G71 I;  4OMZ A;  2Q1Z B;  1X3W B;  1OIS A;  1R1T A;  2R7Q A;  4I7H A;  3ZOB A;  3S16 J;  4HW0 A;  2HOS A;  2KIM A;  1GDT A;  2X85 A;  3WTV C;  4NC7 A;  2V1U A;  4L0Z B;  3EET A;  1DU0 A;  2XF6 A;  4KIS A;  4XM3 A;  2TDX A;  5A2Q K;  3KET A;  1RC9 A;  4I6Z A;  2NRA C;  3CJT B;  2IBD A;  2Y0S N;  5IP7 J;  4G7Z F;  2EZL A;  1MBH A;  2MLK A;  5ICG A;  5LHH A;  2K02 A;  4U7D A;  4D1Q A;  5JLW A;  4DBR A;  1VQ4 I;  2R5Y B;  1UG2 A;  4A3G J;  2NXN B;  4M3E A;  3OV8 A;  1O3R A;  5TGT A;  1T38 A;  2WBM A;  5HS8 A;  2YX7 A;  2VKE A;  3BCB A;  4TV7 A;  1H9T A;  3D1N I;  2L7Z A;  4OIO F;  1U9O A;  3MQ0 A;  4AVZ A;  2FBH A;  4A0Z A;  5H2F C;  1JKO C;  2JQ7 A;  1FBQ A;  1WPK A;  3SEQ A;  2CJJ A;  3DBL B;  3MWM A;  2W7N A;  4A3M J;  4IRG A;  1O4X A;  1U5T C;  1IZ1 A;  3IRQ A;  3LAP A;  3DP7 A;  2XDV A;  1YLF A;  3O3K A;  4BE1 A;  1HW1 A;  1ETX A;  3F0C A;  2ZFW A;  3HPH A;  1LFP A;  3BZC A;  3I9V 2;  3VEP A;  4RGX A;  4MNU A;  1TBX A;  1TNT A;  2JVH A;  4CO8 A;  3WG7 H;  1N78 A;  4LG0 A;  3H3U A;  3DF8 A;  3KEO A;  3F22 A;  3S93 A;  2DPD A;  1YHQ I;  2ME6 A;  5EEH A;  2HQA A;  3E6B A;  1DP7 P;  2YR2 A;  3JSP A;  1Y1W J;  3JTH A;  2IVM A;  2X1E A;  2IGM A;  1BW6 A;  2D45 A;  1K79 A;  3OYE A;  1TQM A;  1REP C;  2XKO A;  4EM2 A;  2UUZ A;  2L4A A;  4GCV A;  3CO6 C;  2W4S A;  1W5T A;  1O3S A;  3LSM A;  1F4K A;  5C44 J;  2V6C A;  1JKQ C;  4A3C J;  2WAE A;  5D6E A;  2FOK A;  2LRE A;  2MW8 A;  5HNH A;  1UHW A;  1X1P A;  3K1P A;  1AA7 A;  1N75 A;  4HF2 A;  5LRR A;  3LA2 A;  2I5U A;  4Q4Z F;  2O03 A;  2LVS A;  1ZTR A;  2VPL A;  2R7D A;  1S29 A;  1Z7L A;  2VXZ A;  4KIT B;  1H0M A;  2CQX A;  4L0Y B;  5D5X B;  3GTP J;  2DA2 A;  2VC1 A;  4BXX J;  3TO9 A;  2Z1D A;  4M71 A;  4JX4 A;  4XRM A;  4MQ9 F;  3CF5 F;  1I39 A;  3EQL F;  1B72 A;  2NOG A;  3GFL A;  4PJ0 C;  2TRT A;  5BPI A;  1UHM A;  4BHP A;  3P5J A;  4DGW B;  2BY0 A;  3NWT A;  1EH8 A;  2PX9 A;  3OOP A;  1MD0 A;  4LG3 A;  4LIU A;  4XOR A;  1IRZ A;  4V2G A;  5H20 A;  4CYC B;  1WWX A;  2ADU A;  3M8F A;  1MNE A;  2OZ6 A;  2WV0 A;  3L2V A;  2YU3 A;  2W48 A;  3KZY A;  1X1D A;  1TT0 A;  1POG A;  2CQQ A;  2OC6 A;  1HW5 A;  2V9P A;  4LFU A;  2AQE A;  4U0Y A;  1MBJ A;  2H1K A;  1SD6 A;  4HQM A;  3LA7 A;  1TWA J;  2HYG D;  2K9S A;  1JKR C;  3DTI A;  4F3Q A;  1HDP A;  2JN6 A;  2I10 A;  2R7F A;  2FNA A;  2RN7 A;  2VJJ A;  4A5N A;  4U0W A;  4HNU A;  1LPQ A;  1OJL A;  5CVV A;  4HEA 2;  4UUV A;  4E7K A;  1OCT C;  2ELK A;  4A5M A;  2L9V A;  3K7A J;  2R93 J;  2XAH A;  4LJZ F;  1MJ9 A;  4CZZ A;  4GYG A;  1YRN B;  5F1J A;  1MH4 A;  2GOX B;  2DBB A;  4H4K C;  3BG9 A;  5BMZ A;  4YFK F;  3NWS A;  4XOT A;  3CF2 A;  5JI6 A;  3M8J A;  1B8I B;  1ZGW A;  2KJB A;  2X6O A;  1HC8 A;  4AWX B;  1HBX G;  3WTU C;  2XB0 X;  2WTE A;  3D5R C;  1BJA A;  3L2Q A;  2YSR A;  1BL0 A;  1FOX A;  1JKP C;  1SC7 A;  5DS9 A;  3FX3 A;  4PGG A;  4D7N A;  2PMH A;  3BQZ A;  4K2E A;  3PNT A;  5EEA A;  1AKH A;  4L5E A;  2XV4 S;  1R23 A;  1JGG A;  4FET A;  3SZT A;  3ESW B;  1X58 A;  3DBR B;  1PYV A;  4HYE A;  3VFZ A;  3Q3S A;  3ELK A;  4I02 A;  1W0T A;  1SEU A;  1XX5 A;  4OIN F;  1ODD A;  3KYL A;  1VTN C;  2M87 A;  3H1C A;  3BR6 A;  3HUG A;  3WU2 C;  3AAF A;  3LA3 A;  3OMY A;  4V19 K;  5EZH A;  2BVL A;  3K1M A;  1G3T A;  2ZXH A;  3QYE A;  3KFW X;  4S04 A;  1XSX A;  4QPO A;  1TQI A;  2AO9 A;  1XGN A;  2EPF A;  2VBY A;  3TMO A;  1YG2 A;  4M3D A;  2IGO A;  5HLG A;  3F3X A;  4KNY A;  2L0K A;  3SFI A;  5F04 A;  1YO5 C;  1IGN A;  2L54 A;  1OCC H;  2GBY A;  4GYI A;  3WTT C;  1IV6 A;  4KMF A;  3GBG A;  5DEQ A;  5M5X J;  1GV5 A;  1PUF B;  3ERE D;  1VQM I;  4I98 B;  3IKT A;  1XGM A;  3ZQQ A;  3FBN B;  3IWZ A;  1K4S A;  2CH0 A;  4A6D A;  3GTK J;  3J80 Z;  1FIP A;  3IRR A;  3V7S A;  1U5T A;  3OL3 A;  4LB6 B;  1P4X A;  4FTH A;  3GZN B;  3M3Y J;  6PAX A;  1R4N B;  3PO2 J;  1ZK8 A;  3B02 A;  3VPR A;  5KNL A;  5EZG A;  2KPM A;  2UZK A;  1MBK A;  3H9Q A;  2IS4 A;  2VQL A;  1V54 H;  2Z9O A;  3V7C A;  4JP0 A;  2DOA A;  3ASN H;  5IT3 A;  5DUI A;  3GTL J;  2R7U A;  2KZG A;  1ORK A;  1P2F A;  2BHY A;  5EJC A;  2PMZ A;  3DPT A;  3H0G J;  4XQF A;  3DLA A;  3WTX C;  2R7O A;  4KUM A;  2L7M P;  2RGV A;  3P9I A;  4UVC A;  3J7Y J;  1RKW A;  4RS8 A;  3RZD J;  3FXR A;  2ZB9 A;  1UZC A;  5H6Q A;  3AL0 C;  1E3H A;  5AIP A;  1B6A A;  2JZY A;  2QZ8 A;  4M6X A;  2R7T A;  2H94 A;  1X19 A;  3ML6 A;  5J6X A;  1OCZ H;  5BOX A;  3K4B A;  4HX7 A;  1XMA A;  4Q5S F;  2IEK A;  1ETQ A;  4A69 C;  2BGC A;  3OS1 A;  5FRM A;  1R71 A;  2X4H A;  4MFD A;  2Q2E B;  4XON A;  2LFB A;  3AFH A;  2HYJ A;  3E6M A;  4XRS G;  4XNF A;  3CUO A;  3E1S A;  2L01 A;  3OSF A;  1ZRD A;  4ZTJ A;  3OYM A;  2IGK A;  2VJ4 A;  1FIA A;  2FNP A;  1LEA A;  4BHB A;  2VQC A;  2VKV A;  3RYR A;  2GA1 A;  2F4O B;  2KRC A;  2WWY A;  1IXS B;  2COM A;  1VI0 A;  2VJI A;  3MVP A;  5JVG F;  4IHW A;  2JSP A;  2NAZ A;  3S1M J;  3T8R A;  2W00 A;  1ZKG A;  1Z9C A;  1ETV A;  5GP9 A;  3JRB A;  2DOF A;  5DTD A;  3E6C C;  2DJI A;  4PFP A;  1T6S A;  2NVU B;  3IL2 A;  1ZR2 A;  1MJA A;  4E7I A;  1LDK B;  3OYB A;  2LD5 A;  3HOU J;  1MGT A;  1P4W A;  4OIP F;  3OYK A;  2HU9 A;  2XAJ A;  4DBQ A;  4HBL A;  1PP7 U;  2RQP A;  1RES A;  2PMU A;  1DQU A;  3OYH A;  1ERD A;  4F91 B;  1FMW A;  4OIR F;  4Y33 A;  4HST A;  5J4V A;  1RET A;  2HKX A;  3GFJ A;  2LH9 A;  2DK5 A;  1ON1 A;  4GXO A;  2K40 A;  1W0U A;  1XG1 A;  3FMS A;  3JCU C;  1T2K A;  4DNC A;  4YFX F;  1R1U A;  2FRH A;  5IP9 J;  4CUG A;  3JAM K;  4GFB A;  2LF8 A;  2HVQ A;  1SD4 A;  2EIN H;  5D8L B;  2X6X A;  1IN6 A;  2VE9 A;  1T95 A;  2DMU A;  4BKX A;  3OYI A;  4X6A J;  1TLH B;  2N8G A;  4BQA A;  3BR2 A;  3QPS A;  2ME0 A;  1RZ4 A;  4PFO A;  4XN3 A;  4AID A;  1MSF C;  3G6E I;  1FOY A;  4BY7 J;  2WAQ A;  1Y8Q B;  2IW5 A;  2E19 A;  1IF1 A;  2VOO A;  1D0X A;  3F6O A;  1MMN A;  2PI0 A;  4FE4 A;  3M7G A;  1BI3 A;  4F93 B;  2IS6 A;  3BJ6 A;  1VQ8 I;  1A35 A;  1TW3 A;  1USS A;  2PFB A;  3UR3 C;  2B0L A;  5DD8 A;  2EZH A;  1SD5 A;  3HL2 A;  3WGG A;  4E4H A;  4BE0 A;  2VBX A;  2WAD A;  2DTZ A;  1BJZ A;  3E97 A;  1MDM B;  3KZZ A;  4M3F A;  4YIR X;  2OJE D;  3VYU B;  3MKL A;  1E0E A;  1P6R A;  1SVL A;  1UST A;  3B73 A;  4IQ4 A;  3VSL A;  1F36 A;  3BR1 A;  1V5F A;  1HOM A;  1Z91 A;  3QPH A;  1KU9 A;  1PUE E;  1BOA A;  1J7K A;  1XGO A;  5K1Y A;  1QZY A;  4XKV A;  3H0D A;  2HZT A;  1RNL A;  1YJ9 I;  1D8K A;  2NVQ J;  1LKX A;  2RAE A;  2BOL A;  2CMP A;  4HQE A;  2HQR A;  2DA1 A;  5GPA A;  4Y4R A;  4WF2 A;  4HAM A;  3OYG A;  2KRF A;  3TP3 A;  3Q0U A;  5JHU A;  2DXI A;  2HDC A;  2BY3 A;  2DFF A;  1QNT A;  2NNY A;  3CC4 I;  2ECC A;  4PK4 A;  3TBI A;  3A0B C;  2R7R A;  2CS3 A;  3P9K A;  3RI4 A;  1FOW A;  4RGU A;  5FRO A;  5J1Y A;  1RI7 A;  2P81 A;  1Y6I A;  3DQV C;  5IT9 K;  1FEX A;  5C3E J;  1WRJ A;  4LIV A;  1JTX A;  4ZYG A;  2DMP A;  2DA5 A;  3ZMV A;  1D1C A;  4UV9 A;  3ZRG A;  1S7O A;  3QOE A;  5K5Q A;  4HF0 A;  4IVN A;  3JRA A;  3BQY A;  4AIK A;  2NS0 A;  4G6Q A;  2YU9 J;  3S14 J;  4ENM A;  3IP4 B;  3KE2 A;  3W2A A;  3K2Z A;  4IF4 A;  5J4Y A;  1P92 A;  3FXK A;  1Y56 A;  2WY7 Q;  4M74 A;  1H89 C;  2Z99 A;  3CES A;  2M0M A;  2AS5 F;  3IH4 A;  1WQ2 A;  2O5R A;  4BXU A;  1BI0 A;  2FQ3 A;  4PSX A;  2WAQ N;  4DQ2 A;  1TL8 A;  2K27 A;  1Z1D A;  2Z2S B;  4UVA A;  4C3H J;  3K70 D;  4JX6 A;  4ESF A;  5LFA A;  5EGO B;  4P96 A;  3GZ6 A;  4OMY A;  1X1C A;  2CRG A;  5CVU A;  2WB1 A;  5IP6 A;  1Q1V A;  5HS7 A;  1I3A A;  4FHT A;  4A3I J;  4S05 A;  1KU2 A;  2NVT J;  2JA8 J;  2E34 A;  3I59 B;  3TDU C;  2A6E F;  2CUE A;  2OBP A;  1OPC A;  2ESN A;  2JUG A;  1BBY A;  4MO7 A;  1D1B A;  2IS2 A;  1X4P A;  3NQO A;  4XRF A;  1Y8R B;  3FF5 A;  4G9Y A;  3S2D J;  2KIQ A;  2QWW A;  3GCM A;  2VBW A;  2ZXW H;  5HNF A;  1YTY A;  2NYX A;  3DTK A;  1QBJ A;  1OQY A;  5DDG A;  1CF7 B;  5CVJ A;  4CCO A;  4UUS A;  2O6G E;  3DEU A;  2K4J A;  3BTL A;  2CG4 A;  2VPR A;  4ZYH A;  1S6L A;  2GM4 A;  3PQK A;  3QPL A;  2DLL A;  2RDP A;  4WXC A;  3DWL E;  2UXN A;  5DV5 A;  1LUJ B;  1VQO I;  2R7Z J;  2E5Z A;  2JA7 J;  5B66 C;  1F43 A;  4BGD A;  1JTY A;  2HNH A;  1GXQ A;  4D9J A;  2EH3 A;  2J5O A;  4DJA A;  2HVS A;  2LY1 A;  4ZZL A;  4B44 A;  1LFB A;  1SAX A;  4LIT A;  4EM1 A;  3JW4 A;  2M9H A;  3C1D A;  1GXP A;  5ERI A;  2EZI A;  1XB4 A;  1VQ7 I;  2WA0 A;  4LK0 F;  4B1R A;  2ZNY A;  2VT3 A;  3HJE A;  3ZMS A;  4BQQ A;  2LBF B;  1HDD C;  2LYC A;  2QBY A;  1KYW A;  2A68 F;  4P55 A;  2MLG A;  3T1B A;  2JTV A;  3MKY B;  3WTW C;  2F6C A;  3ABU A;  3HBL A;  4CDG A;  1ZYR F;  2H8R A;  2EIL H;  4EQQ A;  3M4O J;  1D8J A;  3SHF A;  2QQ8 A;  2HPM A;  3IH3 A;  1MMD A;  1Z6T A;  2FML A;  2HWV A;  4IOA F;  4B8X A;  2FJ1 A;  2QSH X;  2B7E A;  2R7X A;  5B1B H;  1IG7 A;  3F9K A;  1MND A;  1R5G A;  2P5K A;  3HGY A;  5HDK A;  5FKK A;  3S32 A;  4HPQ A;  3K4N A;  4OIQ F;  3H36 A;  4XKB A;  4D5C A;  3I4M J;  3QOP A;  4IPA A;  1I27 A;  2R0Q C;  5L3G A;  2JRM A;  2Y48 A;  4AUX A;  1QRY A;  2KLO A;  4XSX F;  3PL8 A;  3V8J A;  2XRN A;  1VND A;  3GWZ A;  1M1E B;  5J8F A;  5KK1 A;  1HA8 A;  3KPH A;  2A61 A;  3PM1 A;  5JFR A;  4KDP A;  4RAZ A;  4N9H A;  1WJ5 A;  1O57 A;  3KEQ A;  3TOB A;  4F52 A;  2LY2 A;  4MFE A;  4E7L A;  2A6T A;  3LST A;  4H0E A;  3K4J A;  5J3L A;  3W6V A;  5DCM B;  3DKW A;  2Q8K A;  3L7W A;  1R49 A;  2VBZ A;  2E5N A;  1LE8 A;  1G3W A;  4B4C A;  3ZMD A;  2RKH A;  3HIF A;  3IKV A;  5BPD A;  3IC7 A;  4JOM A;  1YE9 A;  1IN4 A;  5E3N A;  4UB6 C;  2HKO A;  2GLO A;  3OIQ A;  3RPU D;  3M8E A;  2OQR A;  1SFE A;  5CVI A;  2VON A;  1V5G A;  2W85 A;  4ENN A;  1YIJ I;  2JT1 A;  2IS1 A;  2BV6 A;  5E1Z B;  4LD5 A;  1IRF A;  3ECO A;  5GTH C;  1FYL A;  1BR4 A;  1UEL B;  3H9J A;  2V9K A;  3KP2 A;  3ROU A;  2XAF A;  3A02 A;  4C3I J;  2GIV A;  4FE7 A;  2XPU A;  4KIC A;  4C3J J;  5ILS A;  5M3M J;  2XSD C;  2WAF A;  3KYD B;  3BZK A;  1ZRE A;  3BG6 A;  5KAF C;  5D6F A;  3OYA A;  2DN0 A;  4NBQ A;  1STZ A;  2OAZ A;  2ZNZ A;  1XGS A;  2QKM B;  3O8H A;  4P1W A;  1N25 A;  1W7P D;  2MBF A;  3OL4 A;  2NS7 A;  2X1D A;  3T5X A;  4EJW A;  2XIG A;  2DMT A;  1D1A A;  2FEZ A;  4DOZ A;  4L9J A;  3ZMZ A;  2PQ8 A;  4RB0 A;  1QPI A;  2KJC A;  3PUB A;  3OYC A;  4V2F A;  4BJ6 C;  2MYS A;  1JHF A;  3I53 A;  1MBF A;  1V55 H;  1YS7 A;  2MC4 A;  4RLF A;  1GLN A;  2HGC A;  5J47 A;  2LOO A;  5JVT A;  2CQK A;  3U1D A;  1A6I A;  1QHH D;  3K4K A;  2F4M B;  3GX4 X;  1J2X A;  1K78 B;  4M73 A;  4BJT A;  3DEW A;  2HTJ A;  2R5Y A;  3LOC A;  3MAJ A;  3SDB A;  2P6T A;  1VQP I;  1U8R A;  2CUZ A;  2W24 A;  1A36 A;  4IHX A;  1Q1H A;  4AYB A;  2A07 F;  1XTA A;  3KLN A;  4XLA A;  1YQA A;  3G3Z A;  4KFC A;  4HSR A;  5FKM A;  3RKX A;  3GFI A;  3RKQ A;  2FE3 A;  3QAH A;  1ZGJ A;  1XSD A;  1OMI A;  1EJ9 A;  2VL8 A;  1D5V A;  4RGS A;  2ESH A;  5M5W J;  3DKY A;  1NHA A;  3WOD F;  4AC0 A;  4XRS A;  4GGG A;  2EV5 A;  2BVM A;  4IKF A;  1HKS A;  4G8X A;  2JA5 J;  2BXZ A;  3E5X A;  4MGR A;  3SXY A;  4CCM A;  2NNN A;  5LHG A;  1OYY A;  3A01 B;  5ED4 A;  2FX0 A;  3DFG A;  1SMY F;  1UB9 A;  1WJF A;  3FK6 A;  1QGP A;  1S9H A;  2AQF A;  3OWT A;  5J40 A;  3REO A;  2XC7 A;  2F5E A;  3BCA A;  1SVM A;  2F5C A;  3DPL C;  5HDG A;  4DYC A;  3L2W A;  3RIR A;  4NC6 A;  2QYO A;  2R4G A;  4Y15 A;  2O61 A;  4MTD A;  2L9R A;  4HLY A;  3QWL A;  5IYD J;  4QIW N;  1MH3 A;  4OU0 A;  3TQN A;  5LD2 C;  5LGT A;  2FXA A;  1ACI A;  5F27 A;  4BEH B;  4F55 A;  3VOD A;  3W3C A;  4A3D J;  1U3E M;  2DFE A;  1X1B A;  4BJ5 C;  2KQR A;  4OOI A;  3W6J B;  2ZKZ A;  3GXO A;  1SFX A;  1ZGA A;  2VI6 A;  2UXX A;  3MZ8 A;  1TZL A;  4M3G A;  3ZXS A;  2A69 F;  4N0B A;  3HG9 A;  4I2O A;  3ULQ B;  1D0Z A;  4XN0 A;  5K7F A;  4KYW A;  2M8E A;  4BQO A;  2IXS A;  2CW8 A;  4A3B J;  3SZP A;  5J1R A;  2IPQ X;  3S8P A;  4RLQ A;  1VFC A;  1K4T A;  1A04 A;  2IA2 A;  2H8W A;  5HLI A;  3CJR B;  1BI1 A;  5FLX K;  4XLP F;  2DYS H;  3FHN A;  4I76 A;  4Q47 A;  3HOX J;  2CV1 A;  3F8M A;  2IT0 A;  2R7V A;  3LL7 A;  2IGN A;  2DCE A;  3ABL H;  2ZCW A;  4CCJ A;  1VQK I;  2E35 A;  3CJN A;  5FFX A;  2L5Q A;  2VQH A;  3KP5 A;  2E1M C;  4G6D A;  2ICW G;  1QZE A;  3FZV A;  3WTS C;  3H5A A;  4WK8 F;  4IJA A;  1HCR A;  1X1A A;  3G1O A;  4L9T A;  4AYB N;  2L7K A;  3DLL F;  1FPQ A;  4FAS D;  2L9S A;  3MKW B;  2FSW A;  3K9T A;  2JUC A;  4LLG F;  2GAU A;  2Y31 A;  5AIQ A;  5GAE J;  2X48 A;  4Z6Y A;  2HEO A;  4D0P A;  4CYC A;  2HTS A;  5F0F A;  3L1P A;  2BY2 A;  4I0A A;  5FJ8 J;  4M9Z A;  1Y1V J;  3BDD A;  2OCE A;  1EV7 A;  3O6B B;  3W2W A;  1AHD P;  2Y30 A;  4UNO A;  4CCN A;  3RSN A;  5GAG J;  3R4K A;  2P4W A;  3U9G A;  4PDK A;  1W36 D;  2VQG A;  3HSF A;  3K4C A;  1F9N A;  3I4P A;  5D8K B;  2W25 A;  3ASO H;  1VQN I;  2X6Y A;  3J81 K;  4M9S A;  2DOE A;  3EYI A;  4LLL A;  4Q48 A;  1W4M A;  2QGU A;  5E3L A;  3DKX A;  3IV5 A;  1YRN A;  4C2U A;  1WSU A;  4ABZ A;  3OIO A;  3Q9S A;  2D5V A;  1B8I A;  1ETO A;  4BDY A;  2BZT A;  2LP0 A;  2QSF X;  1IXR C;  1TWC J;  3ZQG A;  1ZHF A;  2FOW A;  1VQ5 I;  2XRL A;  4JQF A;  2DQR A;  3T0Y A;  4RDU A;  4BDZ A;  2E71 A;  4FQG A;  3DBH B;  4UB8 C;  5DM7 F;  3HKZ A;  1HLV A;  4CH7 A;  5FKN A;  2D1H A;  3LSG A;  2EFO A;  1LDD A;  2CWE A;  3JRG A;  1R9T J;  2YX4 A;  3HEF A;  1XDU A;  4Z2Y A;  2M2E A;  4O3M A;  3LSR A;  2GWR A;  3L2U A;  3HTS B;  2O3F A;  2BY1 A;  4KN4 X;  3BY6 A;  1TC3 C;  2A6H F;  5E79 C;  1ZLJ A;  2QQB A;  4GRI A;  4U7B A;  5L3F A;  3IWF A;  1U6G A;  2Y75 A;  4N9I A;  4ZH4 F;  5AON A;  2NVY J;  3PUF A;  1I6H J;  1LNW A;  4PJM A;  1RUN A;  2CQ7 A;  1WH7 A;  1S7E A;  4BAY A;  4E7J A;  2P7C B;  3SZG A;  1U8B A;  1YIO A;  3BZ6 A;  4UV8 A;  3CZ6 A;  5K7Z A;  3CCS I;  4BY1 J;  1SD7 A;  2ZME B;  4QPQ A;  1BIB A;  2QEN A;  4ESJ A;  2EFW A;  1QU3 A;  2LRD A;  4ON0 A;  1D3Y A; 
#chains in the Genus database with same CATH homology
 2HFH A;  2ZJ2 A;  3ZN0 A;  1XCV A;  1GHC A;  1TQP A;  1ZAR A;  1S7A A;  2CW0 F;  3D0S A;  2HR3 A;  5J8C A;  2LDU A;  3H3Z A;  3V4G A;  2HYF A;  1X3U A;  1YW8 A;  4A0X A;  2F5D A;  5CJ9 A;  3KP3 A;  1E17 A;  1SMT A;  5ILU A;  2Q2E A;  4ENK A;  4IHT A;  4P5O A;  5FD5 A;  4WX9 A;  2VOD A;  3BJO A;  3HHG A;  3BPX A;  2GXG A;  3GW2 A;  1U2W A;  1HQC A;  3RJP A;  4ZYD A;  3M1E A;  1HSJ A;  1UCR A;  2DT5 A;  1J5Y A;  2GQQ A;  3WTY C;  1BC7 C;  3E5U A;  2KKO A;  1HST A;  1OYI A;  1KQ8 A;  2RC4 A;  2QM3 A;  3PFI A;  2P7V B;  5KVR A;  4EVI A;  3K69 A;  2K4B A;  2VE8 A;  3BRO A;  3C7J A;  3LWF A;  2OQG A;  3ZMT A;  2G9W A;  2QQ9 A;  3TOA A;  4LGW A;  3G73 A;  4CIC A;  2YPR A;  3Q5F A;  1ZRF A;  4M6Y A;  5L3D A;  3C3W A;  5FFZ A;  3J7A O;  4R79 A;  1HXD A;  2EFP A;  3IHU A;  3DV8 A;  1MKM A;  1DDN A;  2Y0M A;  2GA2 A;  3WGH A;  3NRV A;  2HQN A;  1KQ0 A;  1O3T A;  1BM9 A;  2VC0 A;  4I01 A;  3GUD A;  3QRF F;  5E1X A;  1MJB A;  2KIU A;  3ISP A;  2FMY A;  2G7U A;  1YW7 A;  5CYV A;  1KGS A;  3FXQ A;  5LEK A;  5A2Q Z;  1R5H A;  5DD4 A;  2H09 A;  1MDM A;  3J80 K;  3W6K B;  4IRH A;  1R1V A;  3WGI A;  4ZZD A;  4A2U A;  1W7P B;  4WXH A;  3ZP5 A;  2JPC A;  4A6E A;  4EGY A;  3CUQ B;  4B09 A;  4XBF A;  2ISY A;  2ELH A;  5DUK A;  3F21 A;  3H92 A;  2P6S A;  3WG9 A;  4HV6 A;  1PDN C;  3ECH A;  1JXS A;  1J59 A;  2XRO A;  5D5V B;  1ONV A;  5LGN A;  2XAQ A;  3LFK A;  4JBA A;  2EK5 A;  2R3S A;  5ICC A;  3K1N A;  2Q0O A;  2DU9 A;  2EJR A;  4G7O F;  2BYV E;  4FT8 A;  4YII A;  3DXJ F;  4ESB A;  1OKR A;  5D4S A;  1J0R A;  3GFM A;  2K86 A;  1H9G A;  1XDS A;  5ICF A;  4G7H F;  2ETH A;  2M5W A;  4EJV A;  5DYM A;  5LLQ A;  4L5I A;  4YG2 F;  1B9N A;  4AIH A;  3SFZ A;  3I59 A;  1AOY A;  2DW4 A;  1FP1 D;  1LEB A;  2W84 A;  4KT5 C;  4QLC U;  1DUX C;  1FSH A;  2PLY A;  2PN6 A;  3SQN A;  3R0A A;  1CF7 A;  1IUY A;  2Z3Y A;  3HRM A;  3HHH A;  3E5Q A;  2DQL A;  3P9C A;  4WXD A;  2QUF A;  5D5U B;  1KA8 A;  1I5Z A;  2F2E A;  5FD6 A;  1B9M A;  1Z7U A;  3E6D A;  1QPM A;  1ZLK A;  1KU3 A;  4KN7 X;  5LGU A;  3EDP A;  3U2R A;  3I64 A;  5TRD A;  2D1V A;  5FLX Z;  1FX7 A;  5E8I A;  1AWC A;  1IN8 A;  4HX4 A;  1FNN A;  2STT A;  3L9F A;  3TO7 A;  2HS5 A;  1FSE A;  3R61 A;  2E1N A;  1QO0 D;  4O5V A;  4CXF A;  3GYH X;  3HSE A;  2IA0 A;  3COA C;  1XN7 A;  5HOO A;  1LJ9 A;  3L09 A;  3T8T A;  3VB2 A;  3C18 A;  3ZPL A;  4LB5 A;  2V9V A;  1CGP A;  3HYI A;  1IW7 F;  3KP7 A;  4HDU A;  1TTY A;  2PEX A;  1IAW A;  4LG0 B;  2DAO A;  3J81 Z;  5HS9 A;  4AVP A;  1JHH A;  1I6X A;  2AXL A;  3N4M A;  5DCM A;  4KMU X;  1FT9 A;  4XSZ F;  3O2P E;  4EJT A;  4MEY F;  2DFI A;  4RGR A;  1F5T A;  2CO5 A;  2OZU A;  4IRI A;  4PGH A;  1S3J A;  3HRS A;  2STW A;  1U78 A;  1KYZ A;  2OU2 A;  4CGZ A;  2RNJ A;  1V4R A;  2ZO4 A;  1B4A A;  1K7A A;  3M9A A;  2V1D A;  1YFH A;  3HRU A;  2EB7 A;  2V79 A;  5JR3 A;  4WWC A;  3FM5 A;  1OR7 A;  1ZRC A;  2F5F A;  5D4R A;  1L0O C;  2XKP A;  3FWE A;  2K7L A;  3CDH A;  2RVC A;  1RUO A;  1Z05 A;  3I54 A;  3CLO A;  2PJP A;  4XLN F;  5E17 F;  1FLI A;  2LNB A;  2M1B A;  5DCF A;  3BOQ A;  3ZMU A;  3E3V A;  5L3B A;  5FB2 A;  1HKQ A;  5E18 F;  1QQI A;  1K78 A;  2MA3 A;  2E7W A;  2FU4 A;  1LB2 A;  1DPR A;  2XHK A;  4F7Z A;  2O8X A;  4GO1 A;  3FHZ A;  5EEG A;  3GEZ A;  1K6O A;  2Z5U A;  2HOE A;  2IJL A;  3TDZ C;  3WU1 B;  1ZG5 A;  1R36 A;  3V8L A;  5K5R A;  4KA4 A;  1FWZ A;  4HX8 A;  3HTU A;  2IA1 A;  1EH7 A;  2BBY A;  4ZYE A;  2P8T A;  3JAM Z;  3RKY A;  3EUH A;  4L18 B;  2FA5 A;  2QQA A;  3F23 A;  1O7F A;  1FY7 A;  1ZAO A;  3PQJ A;  5D5W B;  3LAJ A;  2P5V A;  1Z6R A;  5H6R A;  2XUB A;  3HOS A;  2CSO A;  2CFX A;  2BE5 F;  2BEO A;  2DTR A;  2DK8 A;  1W5S A;  2XAG A;  4HLX A;  1B1B A;  3RYP A;  1JGS A;  1U5T B;  2GXB A;  4AIJ A;  3R60 A;  2EA4 A;  3R6S A;  3TKY A;  2XVC A;  3ZQ7 A;  1PP8 F;  5HLH A;  1YW9 A;  2Z33 A;  4YFN F;  2OA4 A;  4RB2 C;  5LEJ A;  2VT2 A;  4IHS A;  1L3L A;  2XAS A;  2EFQ A;  5FGM A;  4LK1 F;  3JSO A;  2MH9 A;  3FXU A;  1FBS A;  2L02 A;  1JE8 A;  3BPV A;  3F72 A;  1DPU A;  2D2W A;  3FM3 A;  5IT9 Z;  2ACJ A;  3RPQ A;  2LF7 A;  1P4A A;  3L2C A;  1BIA A;  3GLX A;  3F8C A;  2CGP A;  3I71 A;  5TJJ A;  3KLO A;  3R0J A;  2M30 A;  1HKT A;  3TGN A;  2V1X A;  1ZH5 A;  3QU3 A;  2EWN A;  2A5Y B;  2PG4 A;  4NHJ A;  4LMY A;  5ICE A;  1BN5 A;  4IXA A;  4MQV A;  4HV5 A;  1IXC A;  1G6N A;  3CTA A;  4MHG A;  5LHI A;  4L9V A;  3KP6 A;  1UFM A;  3MZY A;  4KIG A;  1G3Y A;  4EJU A;  4P9U A;  2OD5 A;  4YIF A;  4CHU A;  1T39 A;  3CUQ C;  1GVJ A;  3GVA A;  1BC8 C;  3RTR A;  1IRG A;  2RV8 A;  1F1Z A;  4M9X A;  3FMR A;  3GZ5 A;  1FOK A;  3I5U A;  2MH2 A;  4I0B A;  2JRT A;  1RIO H;  3QU6 A;  1WKM A;  4BNC A;  1I1G A;  2H6C A;  2EV0 A;  2ZME A;  5CLS A;  4FX4 A;  2KIF A;  2ZXJ A;  2LSO A;  3WE3 A;  2QLZ A;  2A3S A;  1S8N A;  2X0L A;  1R00 A;  4O6J A;  5L3C A;  4U88 A;  5F64 A;  4EV0 A;  3EYY A;  3MFK A;  4PCQ A;  3I0T A;  2C6Y A;  4R1H A;  4BYY A;  2JPB A;  3LQQ A;  1FBU A;  1J75 A;  2ZBK A;  3RDI A;  2FBK A;  4EGZ A;  1ZG1 A;  2J5P A;  1HW2 A;  1LDJ A;  5E1W A;  1ZN2 A;  4EJO A;  2VN2 A;  2EA2 A;  1LQ1 A;  1FYK A;  3QP6 A;  3WTZ A;  1BI2 A;  1QZZ A;  1IN7 A;  2MD5 A;  2QVO A;  4WCG A;  2MC3 A;  5HVQ C;  3S2W A;  4UVB A;  4U0V A;  1XMK A;  2ISZ A;  3N97 A;  1EH6 A;  1O3Q A;  4M72 A;  1J9I A;  1R22 A;  4L5J A;  1B59 A;  1XSV A;  4Y13 A;  3Q9V A;  4NQW A;  4RAY A;  3V7R A;  5FO5 A;  2O0Y A;  1IN5 A;  4NB5 A;  1C0W A;  3BWG A;  1WI9 A;  3GO5 A;  1FZP B;  1FP2 A;  2P5L C;  1ZG3 A;  3QPT A;  1R58 A;  3KCC A;  2DPU A;  2DO7 A;  3P7N A;  4LLN A;  1OYW A;  1KQ9 A;  3BP8 A;  2PBI A;  4A0Y A;  4ENJ A;  4R8H A;  3MEX A;  1LVA A;  1TNS A;  2EV6 A;  5E8G A;  3WU0 A;  4UHT A;  1KU7 A;  5F6F A;  3K0L A;  1O7L A;  1I1S A;  4I09 A;  3F6V A;  3MCZ A;  3RPU A;  4HZF A;  5E20 A;  1G4D A;  4HA8 A;  1Y0U A;  4BH9 A;  2EFN A;  1FC3 A;  2IP2 A;  2M45 A;  4MTE A;  4Y17 A;  5BQT A;  4HF1 A;  4G94 A;  1ON2 A;  1W7P A;  3GF2 A;  4EMS A;  5ILV A;  4E70 A;  3HRT A;  3CUQ A;  1E2X A;  2JSC A;  2IRF G;  2E7X A;  2QBY B;  4CYD A;  1ULY A;  3VOE A;  5F1R A;  1YS6 A;  3ABT A;  4FX0 A;  5LBQ A;  3D5L A;  2GZW A;  1YYV A;  1XCB A;  1TW2 A;  3LQR A;  4ETS A;  1MZB A;  1R7J A;  5BS6 A;  2E1C A;  3ZN1 A;  3HOT A;  1XD7 A;  3F8B A;  1FYM A;  2LKP A;  5L3E A;  3QP5 A;  3FMQ A;  3L00 A;  3F8N A;  4L9N A;  4RB3 C;  3TO6 A;  1T98 A;  4HDV A;  4KIB A;  2WC2 A;  4HOB A;  3F8F A;  2G7H A;  4UXN A;  3KP4 A;  2W57 A;  3NEU A;  2FF4 A;  3JTG A;  2DI3 A;  4BHC A;  2L4M A;  1T0F A;  2FBI A;  4MEX F;  3BJA A;  4JK1 X;  2H27 A;  5K5O A;  3CO7 C;  3I58 A;  4KIF A;  4PZJ A;  4A12 A;  4AD9 A;  2UWM A;  4RB1 A;  3HSR A;  2L3D A;  5CVR A;  2CYY A;  4ASN A;  3RKW A;  3MZH A;  5HDN A;  4P9F A;  3V8K A;  5LRS A;  2VOP A;  1SFU A;  1G3S A;  2H6B A;  1V3F A;  3WE2 A;  4QWQ A;  2XGX A;  4OMZ A;  1R1T A;  4I7H A;  4HW0 A;  2KIM A;  3WTV C;  2V1U A;  4L0Z B;  3EET A;  2TDX A;  5A2Q K;  3KET A;  2NRA C;  4G7Z F;  2MLK A;  5ICG A;  5LHH A;  2K02 A;  4U7D A;  3OV8 A;  1O3R A;  1T38 A;  5HS8 A;  2YX7 A;  4TV7 A;  1H9T A;  4OIO F;  3MQ0 A;  2FBH A;  4A0Z A;  1FBQ A;  3MWM A;  4IRG A;  1U5T C;  1IZ1 A;  3IRQ A;  3LAP A;  3DP7 A;  1YLF A;  3O3K A;  1HW1 A;  2ZFW A;  3VEP A;  4RGX A;  4MNU A;  1TBX A;  1TNT A;  4CO8 A;  4LG0 A;  3H3U A;  3DF8 A;  3KEO A;  3F22 A;  2DPD A;  5EEH A;  3E6B A;  1DP7 P;  2YR2 A;  3JSP A;  3JTH A;  2IVM A;  2D45 A;  1K79 A;  1TQM A;  1REP C;  2XKO A;  4EM2 A;  2L4A A;  4GCV A;  3CO6 C;  1W5T A;  1O3S A;  1F4K A;  2V6C A;  5D6E A;  2FOK A;  1UHW A;  3K1P A;  4HF2 A;  5LRR A;  3LA2 A;  4Q4Z F;  2O03 A;  2R7D A;  1S29 A;  2VXZ A;  1H0M A;  4L0Y B;  5D5X B;  2VC1 A;  3TO9 A;  4M71 A;  4MQ9 F;  3EQL F;  3GFL A;  5BPI A;  1UHM A;  4BHP A;  1EH8 A;  3OOP A;  1MD0 A;  5H20 A;  1WWX A;  2ADU A;  3M8F A;  2OZ6 A;  2WV0 A;  2YU3 A;  3KZY A;  4U0Y A;  1HW5 A;  4LFU A;  1SD6 A;  4HQM A;  3LA7 A;  2HYG D;  2R7F A;  2FNA A;  2RN7 A;  4A5N A;  4U0W A;  5CVV A;  4UUV A;  4A5M A;  2XAH A;  4LJZ F;  1MJ9 A;  4CZZ A;  4GYG A;  2DBB A;  5BMZ A;  4YFK F;  5JI6 A;  2KJB A;  4AWX B;  1HBX G;  3WTU C;  2WTE A;  1BJA A;  2YSR A;  3FX3 A;  4PGG A;  2PMH A;  4K2E A;  2XV4 S;  1R23 A;  3SZT A;  4HYE A;  3VFZ A;  3ELK A;  4I02 A;  4OIN F;  1ODD A;  1VTN C;  2M87 A;  3HUG A;  3AAF A;  3LA3 A;  3K1M A;  1G3T A;  3KFW X;  4S04 A;  1XSX A;  1TQI A;  1XGN A;  2VBY A;  1YG2 A;  5HLG A;  4KNY A;  3F3X A;  1YO5 C;  2L54 A;  4GYI A;  3WTT C;  4KMF A;  5DEQ A;  3ERE D;  4I98 B;  3IKT A;  1XGM A;  3IWZ A;  4A6D A;  3J80 Z;  3IRR A;  3V7S A;  1U5T A;  4LB6 B;  1P4X A;  6PAX A;  3B02 A;  2UZK A;  2Z9O A;  3V7C A;  5IT3 A;  5DUI A;  1P2F A;  3DPT A;  3WTX C;  4KUM A;  2RGV A;  3P9I A;  4UVC A;  4RS8 A;  3FXR A;  5H6Q A;  5AIP A;  1B6A A;  2JZY A;  2QZ8 A;  4M6X A;  2H94 A;  3ML6 A;  5J6X A;  5BOX A;  4HX7 A;  1XMA A;  4Q5S F;  2BGC A;  2X4H A;  3E6M A;  3CUO A;  2L01 A;  1ZRD A;  2FNP A;  1LEA A;  4BHB A;  3RYR A;  2GA1 A;  2WWY A;  1IXS B;  2COM A;  2NAZ A;  3T8R A;  1Z9C A;  3E6C C;  1T6S A;  3IL2 A;  1MJA A;  1LDK B;  1MGT A;  1P4W A;  4OIP F;  2XAJ A;  4HBL A;  1PP7 U;  2RQP A;  2PMU A;  4OIR F;  2HKX A;  3GFJ A;  2DK5 A;  1ON1 A;  4GXO A;  3FMS A;  1T2K A;  4DNC A;  4YFX F;  1R1U A;  2FRH A;  3JAM K;  2LF8 A;  1SD4 A;  5D8L B;  1IN6 A;  2VE9 A;  1TLH B;  4BQA A;  1RZ4 A;  2IW5 A;  1IF1 A;  2VOO A;  3F6O A;  2PI0 A;  3M7G A;  1BI3 A;  3BJ6 A;  1TW3 A;  1USS A;  2PFB A;  2B0L A;  5DD8 A;  1SD5 A;  3WGG A;  2VBX A;  3E97 A;  1MDM B;  3KZZ A;  1P6R A;  1UST A;  3B73 A;  1Z91 A;  3QPH A;  1KU9 A;  1PUE E;  1BOA A;  1J7K A;  1XGO A;  5K1Y A;  1QZY A;  2HZT A;  1RNL A;  1D8K A;  4HQE A;  2HQR A;  4WF2 A;  4HAM A;  2KRF A;  5JHU A;  2HDC A;  2NNY A;  1QNT A;  3P9K A;  3RI4 A;  4RGU A;  1RI7 A;  3DQV C;  5IT9 K;  1WRJ A;  4ZYG A;  3ZMV A;  4UV9 A;  1S7O A;  5K5Q A;  4HF0 A;  4IVN A;  4AIK A;  2NS0 A;  4G6Q A;  4ENM A;  3KE2 A;  3K2Z A;  4IF4 A;  1P92 A;  4M74 A;  2Z99 A;  2AS5 F;  1WQ2 A;  4BXU A;  1BI0 A;  2FQ3 A;  4DQ2 A;  2K27 A;  1Z1D A;  4UVA A;  4ESF A;  4P96 A;  3GZ6 A;  4OMY A;  5CVU A;  5HS7 A;  4FHT A;  4S05 A;  1KU2 A;  3I59 B;  3TDU C;  2A6E F;  2OBP A;  1OPC A;  2ESN A;  1BBY A;  3NQO A;  4XRF A;  3FF5 A;  4G9Y A;  2QWW A;  2VBW A;  1YTY A;  2NYX A;  1QBJ A;  5DDG A;  1CF7 B;  5CVJ A;  2O6G E;  3DEU A;  2K4J A;  2CG4 A;  4ZYH A;  1S6L A;  3PQK A;  2DLL A;  2RDP A;  4WXC A;  2UXN A;  5DV5 A;  1GXQ A;  2J5O A;  4ZZL A;  1SAX A;  4EM1 A;  3JW4 A;  3C1D A;  1GXP A;  5ERI A;  1XB4 A;  4LK0 F;  2ZNY A;  2VT3 A;  3ZMS A;  2QBY A;  1KYW A;  2A68 F;  4P55 A;  2MLG A;  3T1B A;  2JTV A;  3WTW C;  3ABU A;  4CDG A;  1ZYR F;  4EQQ A;  1D8J A;  3SHF A;  1Z6T A;  2FML A;  2HWV A;  4B8X A;  1R5G A;  2P5K A;  5HDK A;  4OIQ F;  3QOP A;  4IPA A;  1I27 A;  5L3G A;  2Y48 A;  4XSX F;  3V8J A;  2XRN A;  3GWZ A;  5J8F A;  5KK1 A;  5JFR A;  2A61 A;  4KDP A;  4RAZ A;  4N9H A;  1O57 A;  3KEQ A;  3TOB A;  3LST A;  4H0E A;  5DCM B;  3DKW A;  2Q8K A;  3L7W A;  2VBZ A;  1G3W A;  3ZMD A;  2RKH A;  3HIF A;  3IKV A;  5BPD A;  3IC7 A;  1IN4 A;  2HKO A;  3M8E A;  2OQR A;  1SFE A;  5CVI A;  2VON A;  2W85 A;  4ENN A;  2JT1 A;  2BV6 A;  5E1Z B;  4LD5 A;  1IRF A;  3ECO A;  1FYL A;  3KP2 A;  3ROU A;  2XAF A;  2GIV A;  4KIC A;  5ILS A;  1ZRE A;  5D6F A;  1STZ A;  2OAZ A;  1XGS A;  2ZNZ A;  1W7P D;  2MBF A;  3T5X A;  4EJW A;  2XIG A;  2FEZ A;  4L9J A;  3ZMZ A;  2PQ8 A;  4RB0 A;  2KJC A;  1JHF A;  3I53 A;  1YS7 A;  2HGC A;  5JVT A;  2CQK A;  3U1D A;  3GX4 X;  1J2X A;  1K78 B;  4M73 A;  2HTJ A;  3MAJ A;  2P6T A;  1U8R A;  2W24 A;  1Q1H A;  2A07 F;  3KLN A;  1YQA A;  3G3Z A;  4KFC A;  3RKX A;  3GFI A;  2FE3 A;  3QAH A;  1ZGJ A;  1XSD A;  1OMI A;  1D5V A;  4RGS A;  2ESH A;  1NHA A;  3WOD F;  4GGG A;  2EV5 A;  1HKS A;  4G8X A;  3E5X A;  4MGR A;  3SXY A;  5LHG A;  2NNN A;  1OYY A;  5ED4 A;  3DFG A;  1SMY F;  1UB9 A;  1QGP A;  3REO A;  2F5E A;  2F5C A;  3DPL C;  5HDG A;  3RIR A;  2QYO A;  4Y15 A;  2O61 A;  4MTD A;  4HLY A;  4OU0 A;  3TQN A;  5LGT A;  2FXA A;  3VOD A;  1U3E M;  4OOI A;  3W6J B;  2ZKZ A;  3GXO A;  1SFX A;  1ZGA A;  2UXX A;  2A69 F;  4N0B A;  4I2O A;  3ULQ B;  4KYW A;  2M8E A;  3SZP A;  2IPQ X;  1A04 A;  2IA2 A;  5HLI A;  1BI1 A;  5FLX K;  4XLP F;  2IT0 A;  4Q47 A;  3F8M A;  2ZCW A;  3CJN A;  5FFX A;  3KP5 A;  4G6D A;  3FZV A;  3WTS C;  4WK8 F;  4IJA A;  4L9T A;  1FPQ A;  2FSW A;  3K9T A;  4LLG F;  2GAU A;  5AIQ A;  2HEO A;  4D0P A;  2HTS A;  4I0A A;  4M9Z A;  3BDD A;  1EV7 A;  3O6B B;  4UNO A;  3R4K A;  2P4W A;  3U9G A;  4PDK A;  3HSF A;  1F9N A;  3I4P A;  5D8K B;  2W25 A;  3J81 K;  4M9S A;  3EYI A;  4LLL A;  4Q48 A;  1W4M A;  1WSU A;  3Q9S A;  1IXR C;  1ZHF A;  4JQF A;  3T0Y A;  2DQR A;  2D1H A;  2EFO A;  1LDD A;  2CWE A;  2YX4 A;  1XDU A;  4Z2Y A;  4O3M A;  3HTS B;  2GWR A;  2O3F A;  4KN4 X;  3BY6 A;  2A6H F;  1ZLJ A;  2QQB A;  4U7B A;  5L3F A;  3IWF A;  1U6G A;  2Y75 A;  4N9I A;  4ZH4 F;  5AON A;  1LNW A;  1RUN A;  4BAY A;  2P7C B;  1YIO A;  3BZ6 A;  4UV8 A;  1SD7 A;  2ZME B;  1BIB A;  2QEN A;  4ESJ A;  2EFW A;  4EM0 B;  4ON0 A;  1D3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...