4BNCA

Crystal structure of the dna-binding domain of human etv1 complexed with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
95
structure length
95
Chain Sequence
SLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HUMAN ETV1
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bncA00
2M45A 1J5YA 1XGSA 5KK1A 2QBYA 3IWFA 3C7JA 2MH2A 4ZZLA 3HTSB 3MAJA 1R00A 5JHUA 1IN6A 1SMTA 1IW7F 4M72A 1DUXC 4OIOF 4EV0A 2RGVA 3CUQC 2IPQX 1K6OA 4ON0A 2GAUA 5DCFA 1FYKA 1UHWA 4O6JA 3ECHA 2DTRA 2HQRA 4LLLA 1YO5C 2QLZA 5HS7A 4HF2A 3WTUC 4L18B 1BI2A 3CJNA 2XROA 3JTHA 3O6BB 2MA3A 1OR7A 1TTYA 4L5IA 5ICCA 2P7VB 4KUMA 5BMZA 1EH6A 3M8FA 1YG2A 2DQRA 2RVCA 3BP8A 2UZKA 2FBKA 4KIGA 4M6YA 5BOXA 4BHCA 2XAGA 1R1TA 4U0VA 4L9NA 4RGUA 1JXSA 3WGHA 4AIHA 3GUDA 2Y75A 1UHMA 2P6SA 1GXPA 2YR2A 4A2UA 3L09A 3GVAA 3MZYA 1DP7P 3F23A 2ZNZA 1V4RA 4BQAA 2EA2A 1HW2A 2DBBA 3ZQ7A 5KVRA 2ZNYA 5D8LB 2PLYA 4G7OF 1ZYRF 1O57A 3M7GA 2F5CA 5ICFA 1HQCA 2CG4A 3FX3A 2GZWA 5FB2A 2R3SA 4K2EA 1AWCA 1U5TB 4DNCA 4LB5A 4EGYA 2XASA 3TOAA 1BM9A 2L02A 3TO9A 3RYRA 5FLXZ 4LGWA 1SFUA 1TW2A 3IL2A 4ZYEA 2TDXA 2HFHA 1QO0D 4L9TA 1CF7A 1MDMA 4P9UA 3CTAA 2KJCA 3BPXA 4U0WA 3QPTA 4G8XA 1R58A 2D1VA 4CGZA 1FLIA 2Q8KA 2MC3A 1S29A 2MLGA 2OQRA 5H6QA 1R36A 1ON1A 3I58A 5F1RA 1XD7A 1WSUA 1FYMA 2OAZA 2M8EA 3NEUA 1D5VA 2GA2A 2Y0MA 2G9WA 1MZBA 2JT1A 4DQ2A 2ESNA 3HOSA 4HF1A 1OKRA 4ETSA 1S3JA 2QBYB 3K2ZA 4MGRA 2XHKA 1MJ9A 2FE3A 2DT5A 3QP5A 4BNCA 1O3SA 3GEZA 5HDKA 5AONA 3O2PE 2ZMEB 1RUOA 4EM2A 3WTXC 4RB1A 2ELHA 3LWFA 4G94A 4OIQF 3KP7A 3JAMK 3HSEA 3DQVC 4L5JA 3E6CC 1E17A 3BY6A 4ZZDA 4YFNF 2V1DA 4I01A 3KP6A 2P5VA 4I2OA 3K0LA 1IN7A 4NHJA 1T39A 1J75A 3WE2A 2F5EA 4YFXF 1Z6TA 4UXNA 4RS8A 5LHIA 2PN6A 1F4KA 1T98A 3IHUA 3RPQA 1G6NA 3WE3A 2FBIA 2EFWA 3LA7A 2VOPA 4M9ZA 4Y15A 4JQFA 4GYGA 3J81Z 2MH9A 4JK1X 4NB5A 2L3DA 2H27A 5DEQA 5ILUA 4IJAA 3ROUA 4I98B 5ILVA 4GO1A 5DDGA 2W25A 1XMKA 2JTVA 3QPHA 5ILSA 3F8CA 1JE8A 3L7WA 1OYIA 2JPBA 2VN2A 2XV4S 2L4AA 3I59A 1YQAA 1YS7A 1IZ1A 1D3YA 4Z2YA 1FOKA 1YS6A 5JFRA 4HF0A 3ZMSA 5BPIA 3VOEA 2O6GE 5BQTA 3OV8A 4OIRF 2QUFA 4CZZA 5D5UB 1LVAA 4BAYA 5LEKA 2HKXA 2ZKZA 2A61A 3N97A 4XSZF 4HAMA 5H20A 3TO6A 2V79A 1T38A 2QQ9A 5ICEA 1BN5A 1WKMA 3R0AA 4IVNA 5IT3A 2DLLA 2W85A 4U7BA 4G6QA 4MTDA 2QVOA 3DXJF 5HLGA 1HSTA 1T0FA 5HS8A 3V8LA 3WG9A 2GXGA 5IT9Z 1OYWA 5D4RA 2PG4A 1ON2A 1TLHB 3IRRA 1JHFA 4ENJA 3ML6A 2NS0A 1IAWA 4XLPF 3HSFA 1L0OC 2PQ8A 3RKYA 2W57A 1KU2A 4MTEA 2P4WA 3V7SA 3V7RA 3BDDA 3B73A 1BC7C 3U2RA 1SD6A 5K5OA 2XAHA 5FFZA 3LFKA 2IJLA 1IN8A 1LNWA 3KE2A 4MHGA 5DD4A 5TJJA 2QM3A 1FSEA 3HSRA 2DQLA 1SD4A 4PDKA 4LK0F 3SHFA 4QWQA 5H6RA 1ZG3A 3PQKA 2FSWA 3RIRA 1U2WA 5LEJA 1GHCA 1XMAA 5L3GA 4MEYF 1ZRCA 4LG0B 3REOA 3WTTC 4I02A 2BYVE 4G9YA 2JZYA 2DK8A 1FBQA 1K79A 4WXHA 4O5VA 3HRTA 2ZXJA 1CGPA 2C6YA 3ZPLA 4EJUA 3SXYA 1Q1HA 1ZLJA 1LEAA 2K4BA 2HKOA 1DDNA 1U5TA 1TQMA 4Q47A 2DK5A 2LKPA 4U7DA 2CWEA 1O3RA 4NQWA 1YW8A 3H3UA 4I0BA 3COAC 2KIMA 3SZTA 2EFPA 4RB3C 4GCVA 3I54A 4D0PA 4L0YB 4MNUA 5HVQC 2QWWA 4CDGA 1ZGAA 4KIFA 2RV8A 3I64A 2F5FA 2DW4A 1ULYA 3ZN1A 1OMIA 2VODA 2YU3A 2DFIA 4I7HA 1B1BA 1RUNA 1A04A 1SMYF 2YX7A 1O3QA 2ISYA 4UVAA 1SAXA 2IW5A 5FLXK 4CYDA 2UXXA 4M6XA 2KKOA 3RYPA 2STWA 3K9TA 3R60A 3EYIA 3I0TA 2D2WA 3HYIA 3DEUA 1YTYA 1D8KA 3OOPA 2XGXA 5E1XA 2XRNA 3S2WA 3E97A 4HZFA 3C18A 1IN4A 3FMQA 1S7OA 3GFJA 1U8RA 1ZREA 4EJTA 2DI3A 2ZMEA 4WWCA 1ZH5A 2V9VA 3KLOA 3GX4X 1OYYA 2R7DA 4KICA 1XCVA 2KIFA 3E6DA 4PGGA 1YW9A 2M87A 3QOPA 2DAOA 4HA8A 2J5PA 2HTSA 5HLHA 2GXBA 2DPUA 3VEPA 4ZYDA 4HQMA 3FMRA 2D45A 2IT0A 3HHHA 3KFWX 4IHTA 4XRFA 4MQVA 1XSDA 2PJPA 4PCQA 2FMLA 1XB4A 3KP5A 3CLOA 2RC4A 3I5UA 1H0MA 1TNSA 4HV6A 4MQ9F 3I53A 5LBQA 2O0YA 2EA4A 1FNNA 1BIAA 2RKHA 3HRUA 3ZMVA 5JI6A 4KA4A 4HLYA 4PZJA 3GW2A 5CVVA 4N9HA 2QQBA 3Q9SA 4EJWA 3EUHA 3E3VA 2ZO4A 2DPDA 5K1YA 3KCCA 1HW1A 3ZMZA 3K69A 5E1ZB 5DCMB 3IC7A 3W6KB 2CW0F 5AIQA 3KEOA 3E5QA 3RDIA 2O61A 2EK5A 4YIFA 1B9NA 1IXCA 3I4PA 2GA1A 3O3KA 1F1ZA 1FBUA 3DPLC 5J8FA 1KQ8A 1KGSA 4P55A 5LLQA 2FBHA 3F3XA 3GYHX 3C3WA 3FZVA 2QQAA 4G7HF 3RPUA 3LAPA 1YIOA 3KZYA 4A0XA 3K1PA 1D8JA 1RI7A 1J9IA 3WU0A 1ZN2A 4IF4A 1V3FA 2FA5A 1EV7A 1P4XA 4LLNA 3E6MA 1B4AA 5DV5A 1FT9A 3GLXA 1FZPB 2OBPA 3DV8A 4LLGF 4IPAA 3GXOA 5BS6A 4M71A 1K7AA 2A5YB 2RN7A 1ZG5A 5D8KB 5D6FA 4Q5SF 1FC3A 5HS9A 2WV0A 2CYYA 1R22A 4ESFA 2BGCA 1MKMA 4PGHA 3EETA 3NQOA 2FXAA 2XIGA 4UHTA 4AD9A 1B59A 3CDHA 1ONVA 3L9FA 3ZMDA 3LA3A 2KJBA 4IHSA 3ABTA 3Q9VA 2BBYA 2J5OA 1BBYA 2BE5F 1BOAA 1KU7A 1QQIA 2YPRA 1S7AA 3EQLF 2PBIA 5ERIA 1H9TA 1HKSA 3KETA 2FNPA 5D5VB 2Q2EA 4LB6B 3V7CA 2OA4A 2IVMA 3HTUA 1Y0UA 4CXFA 2ZCWA 5JR3A 4RAZA 5F6FA 1ZG1A 1QPMA 1FWZA 2OZUA 2E1NA 4IRIA 1SFEA 1XSXA 5LHHA 4KNYA 1F9NA 5IT9K 2IRFG 1IN5A 2E7XA 2PEXA 4LG0A 3KP4A 4Y17A 4Y13A 2XAFA 2A69F 2YX4A 3I71A 2CFXA 3L00A 3U1DA 1HKTA 4YIIA 4EM1A 4UNOA 2STTA 1STZA 3T5XA 4I09A 1W7PD 1XCBA 5E18F 2VBWA 5LGNA 1Z9CA 3C1DA 4OIPF 1G3SA 2M1BA 4U0YA 1W7PB 3IWZA 1U3EM 3GWZA 2O3FA 1FPQA 5F64A 1KQ0A 4RGSA 4KN4X 2ESHA 3N4MA 4R1HA 1B6AA 3K1NA 3F8BA 5EEGA 2XKOA 1RZ4A 3GFIA 2GQQA 1P6RA 1FX7A 1REPC 4BYYA 1E2XA 4ESJA 2KRFA 3T8RA 5E8IA 4KYWA 4ENNA 1XGMA 3VFZA 2ADUA 2FOKA 3H92A 3JSOA 4ENKA 3MWMA 2JSCA 3L2CA 1MGTA 4N9IA 5A2QZ 2EV5A 4AVPA 2A68F 1QGPA 2OQGA 2XUBA 3F72A 2A07F 4MEXF 3CUQB 2Y48A 2P5KA 4EGZA 2DO7A 3DF8A 1J0RA 3FM3A 2G7UA 5CVJA 5CYVA 1TBXA 4RAYA 1AOYA 3D5LA 4UV9A 5E20A 4GXOA 2EV0A 1IXSB 1XN7A 1FP1D 4M74A 1SD5A 3BPVA 4I0AA 1ZLKA 3WGIA 4OU0A 3GZ5A 3V8JA 2P6TA 1ZAOA 1OPCA 2F5DA 2COMA 1PUEE 4KT5C 4HDVA 4RB2C 1PP7U 3E6BA 3IKTA 2A6HF 4L0ZB 3RTRA 2VONA 1HXDA 1W4MA 5JVTA 2VBXA 4L9JA 4RGRA 1I1SA 2IA1A 5ICGA 2EFOA 1G3WA 1Z05A 3LAJA 1K78B 3RKWA 3WU1B 1FSHA 1ZHFA 3DPTA 2ZFWA 5HOOA 1U78A 4RB0A 1S8NA 2X4HA 4CICA 2H6CA 2MBFA 3KP3A 2PFBA 2P5LC 3KZZA 4BXUA 4HOBA 2M5WA 4AWXB 3T0YA 2WTEA 4G6DA 5DD8A 3FWEA 5ED4A 5DCMA 3R6SA 3F22A 3QAHA 3FF5A 1X3UA 1Z91A 1YW7A 2A3SA 2Z99A 1BC8C 4LMYA 4FT8A 4LFUA 1I5ZA 3HHGA 5J6XA 2Q0OA 3E5UA 2L54A 3T8TA 1IRGA 2BV6A 4A0ZA 1G3YA 3SZPA 4WF2A 1BI1A 4HX4A 3TGNA 3J80Z 1LDJA 3WGGA 3T1BA 2QZ8A 2XAQA 3SQNA 1BI0A 1P4WA 1C0WA 1KU3A 3KLNA 2L01A 1USSA 3ZN0A 1EH8A 2A6EF 1PP8F 2OU2A 1H9GA 2XVCA 3HRSA 2O03A 2HZTA 2K86A 3ISPA 3MFKA 5BPDA 3F21A 2YSRA 1B9MA 5CVRA 4ESBA 1MJBA 1WI9A 1W5SA 4WXDA 1KYWA 4A12A 2EWNA 1ZRFA 2NAZA 4LD5A 2E1CA 2LF7A 5DUKA 3FXRA 2Z3YA 3BWGA 2NNNA 2V1XA 2WWYA 1GVJA 4XLNF 2VBYA 5D5WB 3CUOA 5CLSA 3PFIA 5TRDA 1P2FA 4HQEA 4IRGA 2ISZA 2LSOA 2K02A 3E5XA 1NHAA 1ODDA 3U9GA 3ECOA 4XSXF 4BHBA 2M30A 1TQPA 5L3FA 2HYFA 3TQNA 1J7KA 3JTGA 2K7LA 3F8NA 1F5TA 2KIUA 1WQ2A 5D5XB 1QNTA 2RDPA 4IXAA 3BZ6A 4EVIA 1W5TA 5FO5A 3G73A 1G4DA 2L4MA 2IA0A 3IKVA 3GZ6A 2FEZA 4ZYGA 1HBXG 3QP6A 3WTYC 2Z33A 1GXQA 1R7JA 1YLFA 4B09A 1W7PA 2IP2A 1DPUA 3V4GA 1YFHA 1UCRA 2FRHA 2V1UA 2IA2A 2OD5A 2VC0A 2VT3A 1HKQA 2H94A 2O8XA 3KP2A 4WXCA 4UVCA 2NYXA 3BJOA 3LQRA 4M9XA 4A0YA 2LDUA 3J81K 2W24A 4HX8A 3R0JA 3WODF 3P9CA 3MEXA 3BJAA 3KEQA 4UUVA 4KDPA 3P9KA 4M73A 1LQ1A 4HBLA 6PAXA 3P7NA 4AIKA 4OMYA 3SFZA 5L3EA 4CO8A 2EJRA 1LEBA 5AIPA 3R61A 4LJZF 1SD7A 4QLCU 5CJ9A 3CUQA 2PMHA 4A5MA 2FQ3A 3JSPA 4S04A 1VTNC 3G3ZA 2LF8A 3NRVA 2FU4A 1HW5A 3D0SA 3TO7A 4FHTA 4A6DA 4OINF 2R7FA 1RIOH 2E7WA 3MQ0A 2VE9A 4R79A 4B8XA 2X0LA 1FY7A 2BEOA 5CVIA 4FX0A 5LGUA 2EB7A 3K1MA 3M9AA 5LHGA 3QU6A 1KQ9A 1R5HA 2VXZA 5A2QK 3VODA 1KYZA 2HS5A 2QENA 2JRTA 4P5OA 2K4JA 4BHPA 1HSJA 3GFLA 1R1VA 1XGOA 5FD5A 1FP2A 5E1WA 2ZJ2A 4P9FA 5LGTA 1R1UA 3DP7A 2ACJA 3FMSA 2B0LA 2HGCA 2NNYA 1YYVA 1K78A 1UFMA 3ZMUA 5LRSA 2GWRA 2HEOA 3BOQA 3TDUC 3H3ZA 5D6EA 1KA8A 1XSVA 4LK1F 5CVUA 5K5QA 2HQNA 3GF2A 1MD0A 1SFXA 2MD5A 3MCZA 1T6SA 4S05A 3M8EA 4Q4ZF 4KN7X 2EFNA 2VBZA 3FXUA 3FHZA 2FNAA 4WK8F 4EJOA 2P7CB 2HDCA 1IUYA 2RNJA 1KU9A 3V8KA 3W6JB 1USTA 2XKPA 3ZMTA 3JW4A 3PQJA 1I27A 2WC2A 1BJAA 1WWXA 4CHUA 4IRHA 2JPCA 4GGGA 1ZRDA 1ZARA 5J8CA 2NRAC 4GYIA 1U5TC 4P96A 4HDUA 3IRQA 5DUIA 4RGXA 2VT2A 1O7FA 4KMFA 1O3TA 3ULQB 1IRFA 4OMZA 2EFQA 3WTVC 5FD6A 1CF7B 1MDMB 2VOOA 4KMUX 4L9VA 3ERED 2HWVA 1R5GA 4EM0B 1T2KA 2H09A 3BJ6A 3WTZA 1LDKB 4UVBA 1S6LA 2QYOA 1U6GA 1PDNC 3BROA 2Z5UA 1R23A 1LB2A 4EJVA 3JAMZ 2CGPA 3M1EA 3CO7C 5L3DA 4UV8A 2PMUA 5EEHA 4BH9A 1XDUA 1IXRC 5FGMA 3J80K 2Z9OA 1P92A 3F6VA 1ZGJA 4M9SA 3EYYA 2GIVA 4ZYHA 3CO6C 1FBSA 1G3TA 4Q48A 3Q5FA 2AS5F 1LDDA 2CO5A 1JHHA 2HTJA 2V6CA 2AXLA 1WRJA 2K27A 1XDSA 3LSTA 3ABUA 4AIJA 2CQKA 2XAJA 2DU9A 4XBFA 1XGNA 4A6EA 1BI3A 3RI4A 1J2XA 4JBAA 1IF1A 5LRRA 5D4SA 3DFGA 3B02A 1QZYA 2D1HA 4YG2F 5HDNA 3MZHA 2VE8A 3GO5A 4HV5A 3HUGA 2VC1A 2UXNA 2LNBA 4YFKF 3LQQA 3F8MA 1I6XA 4HX7A 2ETHA 1FYLA 5L3CA 1TNTA 2FF4A 4E70A 1BIBA 1I1GA 2HOEA 2G7HA 2ZBKA 4O3MA 4OOIA 4WX9A 3LA2A 3HOTA 1LJ9A 1Z6RA 2MLKA 1DPRA 1P4AA 3HRMA 5DYMA 2PI0A 5HLIA 3ZP5A 1O7LA 4FX4A 3FXQA 4EMSA 2FMYA 1UB9A 1TW3A 1EH7A 4HYEA 4KIBA 4N0BA 1L3LA 1J59A 4G7ZF 5L3BA 3F6OA 4HLXA 4ASNA 3I59B 3VB2A 4F7ZA 2OZ6A 2HYGD 1RNLA 3TOBA 3GFMA 3RJPA 4ENMA 4HW0A 2UWMA 3F8FA 3EDPA 3TDZC 5E17F 2RQPA 3WTWC 1QBJA 4R8HA 4A5NA 5K5RA 3ELKA 3FM5A 3R4KA 1Z7UA 2HR3A 1Z1DA 3QU3A 1JGSA 3TKYA 2H6BA 1QZZA 3P9IA 2F2EA 3QRFF 3HIFA 2W84A 3RKXA 2P8TA 4KFCA 5HDGA 4U88A 4H0EA 4WCGA 5FFXA 2EV6A 3J7AO 3AAFA 2CSOA 5E8GA 4ZH4F 1MJAA 1TQIA 3WTSC 4TV7A 3DKWA 4EQQA
chains in the Genus database with same CATH superfamily
2M45A 3K4BA 1J5YA 3MKZA 1XGSA 5KK1A 2QBYA 3GTKJ 2L9SA 3IWFA 3CC7I 3C7JA 2F4OB 2MH2A 3KIOA 2KZVA 4ZZLA 3HTSB 3LSRA 3MAJA 1R00A 4LIUA 5JHUA 1IN6A 4BXXJ 1SMTA 1IW7F 3J7AY 4M72A 2NOJB 1DUXC 4OIOF 4A3JJ 4EV0A 2RGVA 3QQAA 1GT0C 3CUQC 4QPQA 5EYRA 2IPQX 1K6OA 1XS9A 4ON0A 2GAUA 3PUFA 5DCFA 3H9QA 2BY2A 1FYKA 1UHWA 4O6JA 2IAIA 3ECHA 5EG0A 3S1MJ 2DTRA 2HQRA 4LLLA 1YO5C 2QLZA 5HS7A 4HF2A 5HNHA 3FBIB 3WTUC 3LSPA 4L18B 1YE9A 1SVLA 2DOAA 4XK4A 1GV2A 2X6YA 1BI2A 3CJNA 2XROA 3JTHA 3O6BB 2MA3A 1BL0A 2H1KA 2WA0A 1OR7A 1TTYA 3BC8A 4JOMA 4L5IA 2GM4A 5ICCA 1A6QA 2NVTJ 4KT6A 5E79C 2P7VB 4KUMA 2HU9A 5BMZA 1EH6A 3M8FA 3GTLJ 1YG2A 2DQRA 2RVCA 3BP8A 3FHNA 2UZKA 2FBKA 4KIGA 4KJZA 4M6YA 5BOXA 1IRZA 1WZ2A 2COBA 4BHCA 3GTMJ 2XAGA 1R1TA 4U0VA 1ZR4A 3I9V2 4L9NA 4XL9A 2WY7Q 3F9KA 4RGUA 1JXSA 3WGHA 3ZQIA 5J1YA 3ZXSA 4AIHA 2KRHA 3QWLA 3H1CA 3GUDA 1GV5A 2IEKA 3CC2I 1Z7LA 2DA1A 3HL2A 2Y75A 3M4OJ 3PSIA 1UHMA 2P6SA 1GXPA 1RR7A 3JRHA 2YR2A 2HVQA 4B4CA 2JQ7A 1R5ID 4A2UA 2N8GA 3L09A 3H5NA 3S8PA 4HNVA 3GVAA 4B43A 4CYCB 3MZYA 1DP7P 3F23A 4F91B 2ZNZA 1V4RA 3OL3A 1Y1WJ 4BQAA 2EA2A 1HW2A 2DBBA 3ZQ7A 5KVRA 2ZNYA 5D8LB 2R7XA 2PLYA 4G7OF 2LBFA 4IHWA 1ZYRF 1O57A 3M7GA 1RESA 2F5CA 5ICFA 3VWBA 4UB6C 4AM3A 1HQCA 2CG4A 2EQRA 3ESWB 2H8WA 2GZWA 3FX3A 5JLXA 2R3SA 4BKXA 5FB2A 4V19K 4K2EA 1AWCA 1U5TB 2VPRA 4DNCA 4ZDOA 4LB5A 4EGYA 2XASA 3K7AJ 4NNJA 3S3OA 3H9GA 4FASD 3TOAA 2ZSIB 1K83J 4NQWB 5EJCA 3PL8A 2V1NA 3CZ6A 3CCJI 1BM9A 2L02A 1I39A 3TO9A 3K6GA 3RYRA 3H0DA 5FLXZ 5LFAA 1GVDA 4LGWA 3KEYA 1SFUA 2DT6A 1TW2A 5IYBJ 1DGWY 2VJ4A 1A5JA 3IL2A 2HI3A 3ZR8X 4ZYEA 4PJ0C 2TDXA 3S1RJ 2HFHA 3HKZN 4CCKA 2RQQA 1QO0D 2HXOA 3RZOJ 4A3CJ 4L9TA 1JJ8C 2CV2A 2EZLA 1CF7A 4JX4A 1MDMA 2R5ZB 1YRNA 4P9UA 3CTAA 2KJCA 3BPXA 3KZIC 4U0WA 4DOZA 1UZCA 4Y3OA 2X1DA 3S93A 3JR9A 1WH7A 3GMEA 2W1OA 3DLLF 2VLAA 2IS1A 3QPTA 1UMQA 4YELA 4G8XA 1R58A 3S2DJ 3ZQGA 2D1VA 5GAEJ 4CGZA 2JJ7A 1FLIA 2LMDA 2Q8KA 2MC3A 4XLEA 1JKQC 1S29A 2MLGA 2OQRA 3H0GJ 2EH3A 4UUSB 2GLOA 1ZR2A 1V5GA 2E71A 3O8HA 5M5WJ 3A2KA 3CD6I 3K2AA 3QPLA 5FLVA 5H6QA 1R36A 2L0KA 4IX7A 3CCYA 3CDIA 3HC7A 3HBLA 2JA5J 1M1EB 1ON1A 2JA8J 3I58A 2FX0A 4NC8A 1I3AA 4DBQA 5F1RA 1XD7A 3UKGA 1WSUA 2Q1ZB 2PX9A 5HNFA 1FYMA 1Z3YA 2OAZA 2M8EA 1ETKA 4J01A 4D9JA 3NEUA 4B48A 1D5VA 2AHQA 2GA2A 1VQ5I 2Y0MA 2G9WA 3I3LA 1MZBA 2DJNA 2JT1A 1JUMA 4DQ2A 2ESNA 1MMDA 3MKWB 3HOSA 3CMYA 2VPLA 3H5RA 1OCRH 4HF1A 1OKRA 3BG5A 4ETSA 1S3JA 2QBYB 3K2ZA 4MGRA 4PFOA 4MFDA 1QPIA 1TWFJ 2XHKA 1MJ9A 2FE3A 2DT5A 2XSJC 3QP5A 4BNCA 5M3MJ 3I4NJ 4XMYA 1O3SA 3GEZA 5HDKA 4ZDLA 5AONA 3EUKL 3O2PE 1N77A 1WJBA 2GOXB 5LD2C 2ZMEB 1TP4A 4EM2A 1RUOA 3WTXC 4RB1A 3OYFA 3JRCA 2ELHA 1MBGA 1D0XA 1T8IA 3LWFA 2RAEA 4G94A 4OIQF 3DCFA 3KP7A 3DU6A 1Y6IA 3OYAA 3JAMK 3HSEA 2L7MP 3DQVC 4L5JA 3KYLA 3IAS2 3E6CC 4UUTA 1E17A 3BY6A 2DMPA 1K6YA 4YFNF 2V1DA 4ZZDA 4I01A 3KP6A 1QZEA 2DOEA 4DBRA 3CCRI 2P5VA 2I8DA 3FXLA 3KYDB 4OAYA 4I2OA 4PJJA 5GAGJ 3QOEA 3K0LA 1IN7A 5IY5H 4NHJA 1T39A 1J75A 3WE2A 3OS2A 2Z2SB 2F5EA 4YFXF 1Z6TA 4HEA2 4M3DA 4UXNA 4RS8A 5LHIA 2PN6A 5B66C 3NARA 1F4KA 2CV1A 1T98A 4CCOA 2HQAA 3IHUA 3RPQA 3SEQA 3BG6A 1G6NA 2M9HA 3QYFA 3WE3A 4PJNA 3CQZJ 1TZLA 2QKLB 3A01A 2FBIA 1OLTA 3OYJA 2EFWA 3LA7A 2VOPA 4M9ZA 1Z0XA 2CFOA 4Y15A 3TP0A 2PJRB 5CQEA 3OS0A 2Z16A 4JQFA 4M3EA 1FOWA 4GYGA 1EKEA 3J81Z 2QCOA 2MH9A 4JK1X 4NB5A 3OYCA 2L3DA 2H27A 2EZKA 3O8GA 5DEQA 3BTJA 5ILUA 3B6AA 3OL4A 3MMYB 4IQJA 2K9SA 2H1LA 4IJAA 1ZGWA 2L5QA 3ROUA 1HLVA 4I98B 1LFBA 4B3AA 5ILVA 2L7KA 3AG1H 1TWHJ 4GO1A 5DDGA 3OWTA 5IYCJ 3ONQA 3CJQB 2W25A 1XMKA 1ETVA 2BHYA 5KNLA 3W2AA 1A6IA 2JTVA 4Y4RA 3DPUA 4NUBA 3QPHA 5ILSA 2E1OA 3RCOA 3F8CA 4DYCA 1JE8A 4MFEA 5F0FA 3L7WA 2R5YB 1YI2I 1OYIA 2JPBA 2VN2A 2CMPA 2XV4S 2L4AA 3I59A 1YQAA 1YS7A 1ACIA 1FOXA 1Y8RB 1IZ1A 3VYTB 4AYBN 4XLCA 1D3YA 2K9QA 1Z67A 4Z2YA 2LKSA 1FOKA 1YS6A 1MBKA 2NVXJ 5JFRA 2GIZA 3PSFA 4HF0A 3ZMSA 5BPIA 4XR6A 4C2MJ 3VOEA 4BBRJ 4PSWA 1YX3A 2O6GE 4AU7A 1GDTA 5BQTA 3OV8A 4OIRF 2QUFA 1VF9A 4CZZA 1LPQA 5HODA 1SAUA 3HG9A 2OUMA 3RPUD 1UELB 2W4SA 5D5UB 1LVAA 3VYSB 4BAYA 3FISA 5LEKA 1VQLI 4N4NB 2HKXA 2OC6A 2ZKZA 2A61A 1A36A 1RPWA 3F0CA 3N97A 4XSZF 4LG3A 2V6EA 4HAMA 1ZQ3P 3SYTA 5H20A 3KX2A 1FOYA 3TO6A 2V79A 1T95A 1T38A 2QQ9A 1JUPA 5ICEA 2EILH 1BN5A 5EGOA 3HEFA 1RC9A 1WKMA 2NXNB 3H9JA 2DDBA 3R0AA 2XF6A 4IVNA 1WJEA 5IT3A 3OYBA 2DLLA 2W85A 3FXJA 1I6HJ 2MABA 4N4OB 2NS7A 4U7BA 4G6QA 4MTDA 2QVOA 2VB6A 3DXJF 2LREA 5HLGA 1HSTA 1T0FA 4ZYAA 5HS8A 3V8LA 3Q0UA 3WG9A 2GXGA 2M3AA 5IT9Z 4LOCA 1OYWA 5D4RA 1SFKA 2PG4A 1ON2A 2HPIA 1TLHB 3IRRA 3LNQA 1JHFA 4ENJA 1FEXA 2Y9YA 3ML6A 5E3OA 2ZXIA 1R71A 2NS0A 1IAWA 2R7VA 4B3XA 4XLPF 2FOWA 1VQ9I 5GTHC 3HSFA 1L0OC 2PQ8A 1IGNA 2Y69H 2A5WA 5FKLA 3RKYA 2W57A 1KU2A 3H36A 4MTEA 1RKWA 2P4WA 3PO2J 2CU7A 3V7SA 2XPVA 5EZHA 3V7RA 3TMOA 3BDDA 3B73A 2DA6A 4HNUA 1BC7C 3OIQA 3U2RA 1SD6A 2OV7A 4D5CA 4J19A 4IQ4A 5K5OA 2XAHA 1YJNI 5FFZA 3LFKA 4XQFA 2IJLA 1IN8A 1LNWA 3KE2A 1ZELA 5KAFC 2Q2EB 4MHGA 5DD4A 2OF7A 5TJJA 2QM3A 1FSEA 3CF5F 2VI6A 5B1BH 2Y9ZA 3HSRA 2DQLA 4CCNA 1SD4A 2JA7J 4PDKA 3JCUC 2BXZA 4LK0F 3SHFA 4QWQA 5H6RA 1ZG3A 3PQKA 2FSWA 3RIRA 1W36D 4C2TA 1U2WA 4W1UA 3CMMA 5LEJA 1NH3A 2HXIA 1GHCA 2DA4A 1Z77A 2VIXA 2LOOA 2W7NA 4QSHA 1HA8A 1XMAA 5L3GA 4MEYF 1ZRCA 2DYSH 5JLWA 4LG0B 5DS9A 2CS3A 3REOA 4BJ6C 3WTTC 1K4TA 3CP8A 4A3FJ 4I02A 2CUEA 2BYVE 3CMEI 3OSGA 4G9YA 1MBFA 1DGRM 2JZYA 2DK8A 1FBQA 2BOLA 1XPXA 1K79A 3LSKA 4WXHA 3L2WA 4O5VA 4CYCA 3HRTA 2ZXJA 1K61A 5IYDJ 1CGPA 3M8JA 5E3MA 2C6YA 4DZJA 3ZPLA 3HPHA 4EJUA 3SXYA 1G8XA 2EZHA 2JRMA 1Q1HA 1ZLJA 2HVSA 4RDUA 4F3QA 1LEAA 2K4BA 2HKOA 1Y39A 1DDNA 1T56A 3DTKA 1U5TA 1SVMA 1TQMA 3G1OA 3CCEI 2LY1A 4Q47A 2DK5A 2LKPA 4U7DA 1NTCA 2DYRH 2CWEA 1O3RA 4NQWA 4D5FA 4C30A 1YW8A 3H3UA 4XN0A 5IOZA 4I0BA 3COAC 1S72I 2KIMA 2JUCA 3SZTA 2KFDA 5F0CA 2EFPA 2XF5A 4RB3C 4B44A 2XB0X 3PM1A 1YJWI 3TEDA 3GTOJ 5FKKA 4GCVA 3BTLA 3I54A 4D7MA 4D0PA 2JA2A 3QYEA 4BS9A 4L0YB 4MNUA 1HOMA 2GBYA 1SEUA 1V5FA 5HVQC 2MGQA 2AXTC 2VQGA 2QWWA 1S7EA 2LVSA 4AC0A 4CDGA 1ZGAA 4KIFA 2RV8A 4B47A 2R5ZA 3I64A 1VZ0A 2R7QA 2OJED 2F5FA 2DW4A 4CCMA 1ULYA 3ZN1A 2O5RA 3FDYA 2V9PA 5M5XJ 1OMIA 3ZGKA 1ITYA 2PMZN 1RETA 3C2HA 2HZDA 3RKQA 2VODA 3V42A 1MMSA 4UUSA 2YU3A 3FIWA 1P7JA 2NOGA 3UNGC 1RR8C 2DFIA 4I7HA 4S0HB 1B1BA 2KLOA 3RQ4A 1RUNA 1A04A 4M3FA 1SMYF 2CV0A 2Y0SA 2YX7A 1O3QA 2ISYA 4UVAA 1R4MB 2IW5A 1SAXA 5FLXK 4CYDA 2UXXA 4M6XA 2KKOA 3RYPA 2K40A 2KPMA 3BTCA 2STWA 3K9TA 3R60A 3EYIA 2Y31A 3I0TA 2D2WA 3HYIA 3DEUA 1YTYA 1D8KA 1XMXA 3OOPA 2DMQA 1X3WB 2XGXA 1N75A 2XRNA 5E1XA 3S2WA 3K70C 3E97A 4HZFA 3C18A 3LL7A 5J47A 1IN4A 3FMQA 1S7OA 3GFJA 1U8RA 3WG7H 4DYRA 3J7YJ 1QU3A 3TBIA 1ZREA 4NBQA 4BY1J 4EJTA 1E0EA 3J7ZI 2P0WA 5M5YJ 2DI3A 2ME6A 3PNYA 3L2VA 2ZMEA 4WWCA 2CQ7A 3JREA 2R7RA 4FTHA 1V5EA 1ZH5A 2EPFA 3VSLA 4BQNA 1E3PA 2V9VA 3KLOA 3GX4X 1WHUA 3FXMA 1KONA 2DTZA 3U1KA 1OYYA 2R7DA 1B8IB 3ASOH 2E5ZA 2VL8A 3BR6A 3DKYA 4KICA 2L7ZA 3DBHB 1PJRA 1XCVA 2KIFA 3E6DA 4PGGA 3OYKA 1YW9A 2M87A 3QOPA 2DAOA 4HA8A 2J5PA 2HTSA 5HLHA 2GXBA 2I5UA 2DPUA 1X1PA 3VEPA 3I56I 4Z6YA 4ZYDA 3CCMI 2ZXWH 4HQMA 3FMRA 2D45A 2IT0A 3HHHA 3P5JA 4OWRB 1QVUA 5DM6F 3VPRA 3CLQA 2E1MC 3KFWX 2WBMA 3ZQQA 4IHTA 1TWCJ 4XRFA 4MQVA 1XSDA 1E3OC 2PJPA 4PCQA 3IP4B 2FMLA 1XB4A 2F4MB 4DIQA 3KP5A 3S3MA 1QHHD 3CLOA 1SANA 2K85A 2RC4A 3FBNB 1PUFB 2RNGA 4A3MJ 3FKIJ 3PUBA 2KQRA 4ITVA 3I5UA 1H0MA 1TNSA 4CSWA 2PJRA 2W48A 3BQZA 4HV6A 4MQ9F 3I53A 2WB1N 5LBQA 2O0YA 4D1QA 2EA4A 1FNNA 4RLFA 1JUSA 4PUSA 1BIAA 2RKHA 3HRUA 3ZMVA 5JI6A 4UB8C 4KA4A 4HLYA 2XGEA 1MNEA 4PZJA 2XSDC 4BEHB 2QSGX 3GW2A 5CVVA 3VYRB 4N9HA 2XRLA 2QQBA 3DLAA 3PJRA 2LC2A 3Q9SA 2VQLA 3EUHA 4RAGA 4BQQA 2Z1DA 4EJWA 4Y7NJ 4X0GA 1AU7A 4XN3A 3HXLA 3E3VA 1OISA 2KRCA 3ZQLA 3BLYA 2ZO4A 3GCMA 1NG7A 2DPDA 2IS6A 3I55I 4ANJA 2VXDA 2QGUA 2R5YA 4IHXA 5K1YA 3IV5A 3KCCA 1WH5A 2HVRA 1HW1A 3ZMZA 3K69A 4BQOA 3HOZJ 2QF7A 2EIKH 4BBSJ 5E1ZB 1D0ZA 5DCMB 3IC7A 3W6KB 2CW0F 5AIQA 1SFOJ 3KEOA 3AL0B 3E5QA 3G71I 3RDIA 2O61A 1MNDA 3BR5A 2EK5A 4CH7A 1V55H 4YIFA 2WAEA 1B9NA 3E0JB 1IXCA 1JKRC 3I4PA 2F48A 2LY9A 4IL6C 2GA1A 3O3KA 5F0HA 2O9LA 3PIPF 2ZXHA 3JRFA 4IHYA 1F1ZA 4BDZA 1BA5A 3TW7A 1O4XA 2CW8A 1FBUA 3DPLC 5J8FA 1KQ8A 1KGSA 4P55A 5LLQA 2E2IJ 2FBHA 3F3XA 3GYHX 3C3WA 3FZVA 1A31A 2R7UA 2QQAA 2EBIA 4G7HF 2ID6A 3RPUA 3FXKA 2ZC2A 3S15J 1LFUP 3LAPA 1JT6A 1YIOA 5FKOA 4DYQA 2L7FP 2OTJI 3KZYA 1LVKA 4A0XA 3K1PA 1D8JA 1RI7A 1J9IA 3WU0A 1ZN2A 4IF4A 1H88C 1X19A 3S32A 1V3FA 3BG9A 2FA5A 3SEZA 1EV7A 1P4XA 4LLNA 3ABKH 3S3NA 3E6MA 2K9LA 1B4AA 3M07A 5DV5A 1FT9A 3GLXA 1FZPB 2OBPA 2ZJPF 3DV8A 4LLGF 4IPAA 3GXOA 5BS6A 4M71A 1K7AA 3U21A 3GTPJ 2A5YB 2RN7A 1ZG5A 2FD5A 5D6FA 5D8KB 4Q5SF 2JVHA 1FC3A 5HS9A 2WV0A 2CYYA 2OTLI 1R22A 4ESFA 2BXYA 2BGCA 1MKMA 1YHQI 4PGHA 3EETA 3NQOA 1X58A 2FXAA 2XIGA 3D1NI 4UHTA 3S14J 2JK3A 5EZGA 4AD9A 2X51A 2DA3A 3NWSA 1B59A 1TWGJ 3CDHA 2WAQN 1ONVA 2WAFA 3L9FA 3ZMDA 3S16J 3LA3A 2K5CA 4II3A 4AUXA 2KJBA 3QPSA 4IHSA 3ABTA 3Q9VA 2BBYA 2J5OA 1BBYA 2BE5F 1WJCA 1BOAA 1KU7A 1QQIA 2YPRA 3FKJA 3K10A 2XPUA 2AQEA 1S7AA 3EQLF 3CCSI 2PBIA 5ERIA 2W82A 1H9TA 4PJMA 1HKSA 3KETA 4A3BJ 2FNPA 1QVTA 5D5VB 1WJAA 3MZ8A 2Q2EA 5GTIC 4LB6B 3V7CA 2OA4A 1TC3C 4X6AJ 2IVMA 3D5SC 1Y0UA 3HTUA 4CXFA 2ZCWA 5JR3A 4RAZA 5F6FA 1ZG1A 1QPMA 4KITB 1FWZA 2OZUA 4ZTFA 2E1NA 4IRIA 1POGA 1JTXA 1SFEA 1XSXA 5LHHA 4KNYA 1F9NA 5IT9K 2IRFG 1S5LC 1IN5A 2E7XA 4A3IJ 2PEXA 4LG0A 3KP4A 4Y17A 4Y13A 2H8RA 2XAFA 2EINH 4RA2A 1U0JA 3OR2C 3CCVI 2CQQA 5GPCA 2XF7A 2A69F 2YX4A 1JGGA 3I71A 2XGDA 3SJMA 4A3KJ 2CFXA 3L00A 3U1DA 1HKTA 4YIIA 4EM1A 3FK6A 1BW6A 1R6RA 2DMUA 3CCQI 4UNOA 1U8BA 2STTA 1STZA 3T5XA 5B1AH 1ZTRA 2JUGA 4I09A 4ZJZA 1W7PD 1XCBA 5E18F 4M6VA 2VBWA 5FRMA 5LGNA 2F6CA 1Z9CA 3C1DA 4OIPF 4DZPA 2IS4A 1G3SA 2DT7B 3HDDA 5FRNA 2M1BA 4U0YA 1W7PB 4PSXA 3IWZA 1U3EM 1I3QJ 1TWAJ 3GWZA 2O3FA 4FISA 2KP6A 1FPQA 4F93B 5F64A 5K7HA 1KQ0A 2EIMH 1IDYA 2MC4A 4RGSA 3LMMA 4KN4X 4HSTA 2ESHA 3N4MA 4R1HA 1B6AA 1WGXA 2F4IA 3K1NA 1D1AA 3F8BA 5EEGA 2M7AA 2XKOA 1RZ4A 4RBOA 3E1SA 1HF0A 3KPHA 3GFIA 2GQQA 1P6RA 1VQOI 4E7SA 2HPMA 2XPWA 1G2HA 1MH3A 4IKFA 1FX7A 2BW3B 1REPC 4BYYA 4DJAA 1E2XA 4ESJA 1VQ4I 2M2EA 2KRFA 3T8RA 5E8IA 1R4NB 2E60A 1MBHA 4KYWA 3Q0VA 3BT9A 4ENNA 1XGMA 3GLLA 4FCYA 2HDWA 2DFHA 3VFZA 2ADUA 1XC5A 2FOKA 3H92A 1F36A 3JSOA 4ENKA 2LKXA 4XLAA 3MWMA 4B1RA 5C4XJ 2JSCA 5IP9J 3L2CA 3GTGJ 4ZC3A 3BG3A 1MMAA 1MGTA 4N9IA 5A2QZ 2LD5A 2EV5A 4AVPA 2A68F 1QGPA 2OQGA 2XUBA 3CMAI 4RLQA 4C3IJ 2BY1A 3MD2A 3F72A 4Y52J 2E35A 2A07F 1NG6A 4MEXF 3CUQB 2VKEA 5HLTA 1I50J 4F52A 2Y48A 2JN6A 3PIOF 2P5KA 4EGZA 1TL8A 1X1AA 5M3FJ 4BGDA 2DO7A 2V9KA 3L1PA 4BDYA 3DF8A 2L9VA 1J0RA 3FM3A 2TRTA 2DCEA 2G7UA 5CVJA 5CYVA 1TBXA 3JRBA 4RAYA 2DOFA 1AOYA 3OIOA 2VKDA 3D5LA 4UV9A 5E20A 2M7BA 4GXOA 2DFEA 2EV0A 2VKHA 4A93J 1WVRA 1EF4A 2OCCH 1IXSB 1XN7A 2M0MA 4XIDA 4BE2A 1FP1D 1HDPA 1ORKA 4M74A 1OCCH 1SD5A 1MSFC 3BPVA 4I0AA 4MIMA 4E7JA 1ZLKA 1B8IA 4E7ZA 2E1MB 2L2OA 4HSRA 1A35A 1WCMJ 3WGIA 2KIQA 2X6XA 1NK2P 4OU0A 5TGTA 3GZ5A 2HOSA 3A0HC 2R0QC 3V8JA 2P6TA 5FLMJ 1ZAOA 2ZFUA 1OPCA 2F5DA 1PYVA 2B7EA 2COMA 1PUEE 3TW6A 4KT5C 4HDVA 4RB2C 1PP7U 1W1WE 2LTPA 3ABLH 3E6BA 3IKTA 1FTZA 2A6HF 2FUG2 2O7OA 4L0ZB 3HOYJ 3RTRA 2VONA 3CP2A 1HXDA 1X1DA 4ABZA 2XB5A 3B6CA 1IC8A 1W4MA 1VQMI 5JVTA 1S9HA 3OYNA 2DODA 1LFPA 1Q1VA 3TL4X 1PUFA 2E34A 2VBXA 4XKCA 5IPAA 4L9JA 4RGRA 1I1SA 2IA1A 2V7FA 5ICGA 4II2A 1FJLA 2EFOA 1G3WA 1Z05A 3LAJA 3GTQJ 3ZQFA 1WI3A 3MKLA 1K78B 3RKWA 3HKZA 4PK4A 1IO2A 2UUZA 3WU1B 1FSHA 3OYDA 3WHBA 4XRSG 5GP9A 1RRJA 1ZHFA 3DPTA 2ZFWA 1WFXA 5HOOA 1U78A 4BEHA 1K4SA 4RB0A 4A3EJ 1S8NA 2X4HA 4CICA 1U9OA 1W5CC 1OR7C 2H6CA 2VQCA 2MBFA 3KP3A 2PFBA 3KZZA 2P5LC 4BXUA 5KAIC 2M34A 4MLOA 1DP3A 1AHDP 2ELKA 4HOBA 2M5WA 3OOUA 4AWXB 3T0YA 3LSHA 2HYJA 2WTEA 4G6DA 5DD8A 4PFPA 5EDNA 3FWEA 5ED4A 3A1YA 5DCMA 3R6SA 4C3HJ 3F22A 2LG4A 3QAHA 1UJ8A 3FF5A 5GAHJ 1X3UA 4XOPA 3K4KA 3OS1A 1Z91A 9ANTA 1YW7A 2A3SA 3ASNH 2ID3A 3HZJA 1D1CA 2Z99A 1OCZH 1BC8C 3AKZA 2JVGA 4LMYA 2CQNA 4FT8A 4LFUA 4HNTA 1I5ZA 3HHGA 5J6XA 2Q0OA 2R7TA 3E5UA 2L54A 3T8TA 1IRGA 4F55A 2BV6A 4A0ZA 1G3YA 3AFHA 3SZPA 2VQHA 4WF2A 1B72B 1BI1A 4HX4A 3JRDA 4BY7J 3TGNA 3J80Z 1LDJA 4ZDPA 3ZOBA 3WGGA 3OY9A 3T1BA 1OJLA 2QZ8A 5C3EJ 2M0CA 2E2JJ 2XAQA 3SQNA 1BI0A 1P4WA 1C0WA 1KU3A 3KLNA 4E4HA 2L01A 1VQKI 5KHDA 1USSA 1X1CA 3ZN0A 1EH8A 2A6EF 1JTYA 3AG2H 1PP8F 2OU2A 2MG4A 1G59A 2Y2ZA 3K4CA 1H9GA 2XVCA 3HRSA 3AG4H 1RKTA 3AG3H 2O03A 2HZTA 2K86A 4MO7A 1QA6A 4D7NA 3K4LA 4YIRX 3ISPA 3MFKA 1FIPA 5BPDA 3F21A 2YSRA 1B9MA 3WHCA 5CVRA 3VSKA 4ESBA 1Z21A 1HCRA 2LFBA 1MJBA 4QIWN 1WI9A 2VASA 1VQ8I 2CUFA 1W5SA 2LRDA 2R7SA 4WXDA 4JYKA 2X48A 3LSGA 4NDLA 4XICA 1KYWA 4A12A 2LK2A 1BR1A 3A0BC 3M3YJ 2EWNA 1ZRFA 2NAZA 4CZCA 3HPGA 4LD5A 2E1CA 2LF7A 2L9RA 5J40A 5DUKA 2QQ8A 2KL4A 3FXRA 2Z3YA 3VYUB 3TP3A 2DFFA 3BWGA 2DA5A 2NNNA 2V1XA 2WWYA 4QPOA 1GVJA 4YRVA 3OYLA 4XLNF 3L2QA 2VBYA 5D5WB 3L2RA 1YOVB 3CUOA 1IDZA 5CLSA 4EATA 3PFIA 4X1EA 3MVPA 5TRDA 1P2FA 3DWLE 2X9DA 4HQEA 4IRGA 5CPRB 3UR3C 5BNGA 2ISZA 1QRYA 2LSOA 4IHVA 5IOYA 1APLC 2K02A 1X2MA 3E5XA 5J3LA 1NHAA 1ODDA 3BCAA 5KCMA 3U9GA 3ECOA 1LKXA 2KZGA 4XSXF 3RQIA 4BJ5C 2LP0A 4HPQA 3CCLI 4BHBA 4AYBA 1GUUA 2MYSA 2DMNA 2M30A 1T08B 1MMNA 4BU2A 1IV6A 2R93J 3SDGA 1TQPA 2NVUB 3OYEA 3HM5A 2R7ZJ 2MD0A 1YITI 5L3FA 5B3SH 2HYFA 2QKMB 2QA4I 4M3GA 3IUOA 4XKVA 3TQNA 1J7KA 3JTGA 3HUGB 2K7LA 1XX5A 3H5AA 3F8NA 1F5TA 2KIUA 1WQ2A 2KDZA 1OCPA 3OYGA 1UG0A 2VUMJ 5D5XB 4V2GA 2YS9A 2E5NA 3S1QJ 1IRXA 1QNTA 2RDPA 4IXAA 3BZ6A 3VDXA 2I10A 5IP7J 4EVIA 1W5TA 2DA7A 5FO5A 3G73A 1G4DA 2L4MA 2IA0A 3IKVA 2LYCA 4FE4A 3K4MA 3SDBA 3GZ6A 2FEZA 4ZYGA 1ETQA 1HBXG 3QP6A 3WTYC 2Z33A 2VJJA 1GXQA 2IGMA 1VI0A 3HJEA 1AA7A 1R7JA 1YLFA 4B09A 1AKHB 1W7PA 2IP2A 1DPUA 3V4GA 2GXAA 1YFHA 1UCRA 2FRHA 2V1UA 2IA2A 2OD5A 3A02A 3ZCOA 1W36C 2VC0A 1X2NA 2OCEA 2VT3A 3DU5A 3Q3SA 4RM2A 2ZJRF 2ECBA 3CESA 4LIVA 1HKQA 2OPTA 1E3HA 3GZNB 4XOTA 1OQYA 2E2HJ 2H94A 2O8XA 1T33A 3KP2A 4WXCA 4IZZA 4A3GJ 4UVCA 2AQFA 1XTAA 2NYXA 3BJOA 3LQRA 1FIAA 2HOTA 3HOVJ 4M9XA 4V2FA 4A0YA 3H3VK 2BY3A 1BJZA 2LDUA 4W97A 3J81K 2BW3A 4IEJA 4HG2A 2R4GA 4XONA 2W24A 4HX8A 3G6EI 3R0JA 3JRIA 4FETA 1DU0A 2D5VA 3WODF 3P9CA 1DQUA 2QSHX 4XLFA 3MEXA 3BR2A 2DXIA 3Q0WA 2X1EA 3BJAA 3KEQA 2HQ5A 4UUVA 4E7IA 4KDPA 3P9KA 4M73A 4AVZA 3LSIA 3QYBA 1LQ1A 2R92J 4BE0A 4HBLA 6PAXA 5GADJ 5J4YA 2E19A 5J1RA 3BZCA 4NC6A 2K3PA 1UG2A 2JWTA 3S2HJ 3P7NA 2ECCA 4AIKA 3CF2A 3SFZA 4OMYA 1WJDA 2CUJA 5J1UA 5L3EA 4XRMA 4CO8A 2EJRA 1LEBA 1N25A 4P1WA 2O8KA 1D0YA 1LE8B 5AIPA 1R49A 4U87A 2IGNA 3R61A 4LJZF 1SD7A 4H4KC 4QLCU 3C2GA 5CJ9A 1VQ6I 1TT0A 1WPKA 2W00A 3OYHA 3CUQA 2PMHA 4A5MA 2FQ3A 4CCJA 2A6TA 1VFCA 4EEFG 2IGOA 3JSPA 2CRGA 3GTJJ 4XKWA 4S04A 2K3FA 1VTNC 1VQ7I 1JI8A 2BHZA 2ZSHB 1YIJI 4XORA 5FKNA 2X6OA 3G3ZA 3ZRGA 3HOWJ 4C2UA 4IO9F 2GOMA 2LF8A 3NRVA 2FU4A 1HW5A 1P7IA 5JHFA 1BR2A 1ZKGA 3D0SA 2JSPA 3TO7A 4FHTA 2QEXI 4A6DA 1XG1A 1WJ5A 4OINF 3OYIA 2R7FA 1RIOH 2E7WA 3PNVA 3DEEA 2F5VA 4KISA 3MQ0A 2VE9A 1BW5A 4R79A 4B8XA 2X0LA 1FY7A 2BEOA 1EA3A 3W6VA 5CVIA 4FX0A 5LGUA 5TISC 2EB7A 2HNHA 4Y33A 1CQTA 3K1MA 3HGGA 3M9AA 5LHGA 2K9MA 2K9NA 3QU6A 3HOUJ 1KQ9A 1R5HA 2VXZA 5DTDA 3VODA 3W2VA 3CJTB 5A2QK 1KYZA 2HS5A 4NC7A 1MH4A 2QENA 5FKMA 1H8AC 2JRTA 2VKVA 4P5OA 4A69C 2K4JA 1FMVA 4BHPA 5CQGA 1HSJA 3GFLA 1R1VA 3OR1C 1FTTA 1XGOA 5FD5A 5EEAA 1MSEC 4BACA 1T0FC 5EG0B 2DDAA 2TCTA 2WV1A 1FP2A 3FXOA 5E1WA 2ZJ2A 4P9FA 1ETYA 3PO3J 2M4KA 4FQGA 2RREA 2CW7A 5LGTA 3DKXA 1R1UA 3DP7A 2ACJA 1IG7A 3ABMH 3KYCB 3FMSA 1W0TA 2B0LA 1OCTC 1D1BA 1P9QC 2HGCA 2Y0SN 3BR1A 2NNYA 1YYVA 1K78A 1UFMA 4LITA 4FE7A 3ZMUA 5LRSA 3MKYB 1UHSA 2GWRA 1N78A 3WU2C 4E6KG 2HEOA 3BOQA 3TDUC 2DA2A 3H3ZA 2NVYJ 2DJIA 4RM3A 5D6EA 1KA8A 1XSVA 2KISA 4LK1F 5CVUA 5K5QA 2JA6J 1TT5B 2HQNA 3GF2A 1MD0A 4A3DJ 3E7LA 1SFXA 1EJ9A 2MD5A 2PMZA 3MCZA 1T6SA 5B5EC 4G12A 4S05A 3M8EA 4L5EA 5E3NA 3DTEA 4Q4ZF 3OMYA 1MW7A 4KN7X 2MW8A 3EPZA 1MNMC 2EFNA 1J09A 2VBZA 5F04A 4BL0B 3FXUA 2BVLA 4JX5A 3FHZA 2FNAA 3DBLB 4WK8F 4EJOA 2P7CB 2CUZA 3DEWA 3K4NA 2HDCA 1ZK8A 1ETWA 1IUYA 2LBFB 2RNJA 4F92B 1KU9A 2IXSA 1KZHA 3MN2A 3SZGA 2LLKA 2A05A 2QSFX 1ENHA 1PVEA 3G4SI 3V8KA 1R9TJ 3IAM2 3W6JB 1USTA 1YJ9I 1JT0A 2XKPA 3ZMTA 2X6WA 1BR4A 3IH4A 3JW4A 3PQJA 1I27A 2WC2A 3IH2A 2IGKA 1BJAA 1WWXA 4CHUA 1B72A 4IRHA 2JPCA 2ME0A 2Y30A 3ERMA 1X1BA 4BJTA 3RSNA 4GGGA 1ZRDA 2EIJH 2KT0A 5FROA 1ZARA 5J8CA 3L2UA 2NRAC 4GYIA 1U5TC 4JP0A 4P96A 4HDUA 3IRQA 5DUIA 1V54H 4OAZA 4RGXA 1NK3P 2VT2A 1O7FA 4KMFA 1IJWC 2XAUA 3G1MA 4JX6A 5IP6A 1O3TA 3ULQB 1IRFA 4RAFA 3HOXJ 5K7FA 4I76A 4OMZA 2EFQA 2B9SA 1D5YA 3WTVC 1VQPI 3AL0C 3K70D 5FD6A 2BVMA 1CF7B 1LUJB 1MDMB 4E7HA 1YRNB 2VOOA 4KMUX 4L9VA 3ERED 2NS8A 1MBJA 2HWVA 1R5GA 4EM0B 1T2KA 4C3JJ 2H09A 3BJ6A 3WTZA 3CCUI 1LDKB 2CQXA 2WADA 4UVBA 4HRIA 5GPAA 3W2WA 1S6LA 2QYOA 1U6GA 1PDNC 2BY0A 1W0UA 4IOAF 1Y0NA 3BROA 1JJ6C 2Z5UA 1R23A 1LB2A 4EJVA 1WJFA 3JAMZ 5C4JJ 2CGPA 3M1EA 2R7WA 2ELJA 3CO7C 5L3DA 4ZTJA 2KDOA 4UV8A 2PMUA 3CJRB 5EEHA 3NAUA 4BH9A 1UAAA 1XDUA 1IXRC 1X4PA 2WB1A 3H35A 3BTIA 5FGMA 3J80K 3BR0A 2XC7A 2Z9OA 1P92A 4DW6A 1X3ZB 3F6VA 1ZGJA 5F1JA 4M9SA 3BR3A 4DGWB 3JRGA 1ERDA 1VQNI 2ZB9A 3EYYA 2YU9J 1MIJA 1GLNA 2GIVA 4ZYHA 3CO6C 2DN0A 3BG7A 1FBSA 1G3TA 3PFYA 2FQ4A 2IS2A 4Q48A 3Q5FA 2AS5F 1LDDA 2CO5A 3RZDJ 1JHHA 1BOBA 2JMWA 2X1CA 2FJ1A 3QODA 5K7ZA 2ZJQF 3G1LA 3BCBA 2HTJA 2V6CA 2AXLA 1WRJA 3EUAA 1U9NA 4BXFA 2BZTA 5F08A 4CA0A 3FK7A 2K27A 2G0EA 1XDSA 3LSTA 3ABUA 4BUPA 3S1NJ 5EF6A 4AIJA 5F27A 2CQKA 2XAJA 2LR8A 2DU9A 4I6ZA 4XBFA 1Y8QB 2CH0A 1XGNA 4A6EA 1BI3A 3OSFA 3RI4A 2LY2A 5FJ8J 3I4MJ 1J2XA 4JBAA 1IF1A 5LRRA 3N05A 5D4SA 4I99C 3DFGA 3B02A 1QZYA 2D1HA 2ZMEC 4YG2F 5HDNA 1HC8A 3MZHA 2VE8A 4CUGA 3LOCA 3A4CA 3GO5A 2MFZA 2M8GX 1Z3XA 4HV5A 3HUGA 4M3BA 2VC1A 3C2BA 1OCOH 1Y56A 2UXNA 2LNBA 4YFKF 3LQQA 3PNTA 3F8MA 3A03A 1I6XA 3HGYA 3HB9A 4HX7A 2CJJA 2ETHA 4YEJA 1OFCX 2R7OA 4CCLA 1FYLA 5L3CA 2NVQJ 3DTIA 1TNTA 2FF4A 3S17J 3W3CA 4E70A 1BIBA 1I1GA 1MBEA 2EZIA 2HOEA 5C44J 2G7HA 3IH3A 1YX5A 2ZBKA 1SVOA 3A01B 4O3MA 4OOIA 3GBGA 5JVGF 2VJIA 4WX9A 3D5RC 3LA2A 2B63J 1SC7A 1IUFA 4BE1A 3HOTA 1LJ9A 1AKHA 1Z6RA 3X2QH 4J00A 1VNDA 5CKTA 2YUSA 4QTRA 1F43A 2MLKA 2HDDA 3LSMA 4GFBA 2XGCA 1DPRA 1P4AA 3HRMA 5DYMA 3DBRB 2KHMA 3JRAA 2PI0A 5HLIA 3ZP5A 4IOCF 1O7LA 4FX4A 2M4GA 1JKOC 2IBDA 3FXQA 3NWTA 2KMUA 4XNFA 4EMSA 3ZQCA 2FMYA 4UY8I 3M1CA 3BZKA 1ETOA 1UB9A 1TW3A 2VJ5A 2AO9A 1EH7A 4HYEA 4KIBA 4N0BA 1FMWA 1L3LA 1J59A 2X85A 4G7ZF 5L3BA 3F6OA 4HLXA 4ASNA 3I59B 4XKBA 3VB2A 2V26A 3G2BA 5J4VA 3OIPA 5DM7F 3EUHC 1QHGA 2WAQA 2P81A 2OZ6A 4F7ZA 2HYGD 1RNLA 3TOBA 3GFMA 3RJPA 4ENMA 4E7LA 4HW0A 2UWMA 3F8FA 1X4OA 1IV8A 3EDPA 3TDZC 2E36A 1H89C 5E17F 2HOAA 2ICWG 2RQPA 3WTWC 3K4JA 1QBJA 3LSJA 2LH9A 3ZQHA 4XLHA 4R8HA 4A3LJ 4A5NA 5K5RA 3ELKA 1ETXA 3FM5A 3R4KA 4C9YA 1Z7UA 2HR3A 3BQYA 4G6TB 1JKPC 1LE8A 4XRSA 1HDDC 4AIDA 3LFUA 1Z1DA 5H2FC 3QU3A 1JGSA 1Y1VJ 3TKYA 2H6BA 1QZZA 2V4JC 2MSYA 3P9IA 4GDFA 4RMNA 4GRIA 2F2EA 3QRFF 3HIFA 2DMTA 2W84A 3RKXA 2P8TA 2WY8Q 4KFCA 5E3LA 5HDGA 4U88A 1DU6A 4H0EA 2XDVA 1MMGA 4WCGA 5FFXA 3SFIA 2EV6A 4E7KA 2L9NA 3J7AO 4PJLA 3CDLA 3AAFA 3CC4I 4XM3A 2CSOA 2UV1A 5E8GA 3OYMA 4ZH4F 5EGOB 1MJAA 1TQIA 4TV7A 3WTSC 3DKWA 4EQQA
chains in the Genus database with same CATH topology
2M45A 1J5YA 1XGSA 5KK1A 2QBYA 3IWFA 3C7JA 2MH2A 4ZZLA 3HTSB 3MAJA 1R00A 5JHUA 1IN6A 1SMTA 1IW7F 4M72A 1DUXC 4OIOF 4EV0A 2RGVA 3CUQC 2IPQX 1K6OA 4ON0A 2GAUA 5DCFA 1FYKA 1UHWA 4O6JA 3ECHA 2DTRA 2HQRA 4LLLA 1YO5C 2QLZA 5HS7A 4HF2A 3WTUC 4L18B 1BI2A 3CJNA 2XROA 3JTHA 3O6BB 2MA3A 1OR7A 1TTYA 4L5IA 5ICCA 2P7VB 4KUMA 5BMZA 1EH6A 3M8FA 1YG2A 2DQRA 2RVCA 3BP8A 2UZKA 2FBKA 4KIGA 4M6YA 5BOXA 4BHCA 2XAGA 1R1TA 4U0VA 4L9NA 4RGUA 1JXSA 3WGHA 4AIHA 3GUDA 2Y75A 1UHMA 2P6SA 1GXPA 2YR2A 4A2UA 3L09A 3GVAA 3MZYA 1DP7P 3F23A 2ZNZA 1V4RA 4BQAA 2EA2A 1HW2A 2DBBA 3ZQ7A 5KVRA 2ZNYA 5D8LB 2PLYA 4G7OF 1ZYRF 1O57A 3M7GA 2F5CA 5ICFA 1HQCA 2CG4A 3FX3A 2GZWA 5FB2A 2R3SA 4K2EA 1AWCA 1U5TB 4DNCA 4LB5A 4EGYA 2XASA 3TOAA 1BM9A 2L02A 3TO9A 3RYRA 5FLXZ 4LGWA 1SFUA 1TW2A 3IL2A 4ZYEA 2TDXA 2HFHA 1QO0D 4L9TA 1CF7A 1MDMA 4P9UA 3CTAA 2KJCA 3BPXA 4U0WA 3QPTA 4G8XA 1R58A 2D1VA 4CGZA 1FLIA 2Q8KA 2MC3A 1S29A 2MLGA 2OQRA 5H6QA 1R36A 1ON1A 3I58A 5F1RA 1XD7A 1WSUA 1FYMA 2OAZA 2M8EA 3NEUA 1D5VA 2GA2A 2Y0MA 2G9WA 1MZBA 2JT1A 4DQ2A 2ESNA 3HOSA 4HF1A 1OKRA 4ETSA 1S3JA 2QBYB 3K2ZA 4MGRA 2XHKA 1MJ9A 2FE3A 2DT5A 3QP5A 4BNCA 1O3SA 3GEZA 5HDKA 5AONA 3O2PE 2ZMEB 1RUOA 4EM2A 3WTXC 4RB1A 2ELHA 3LWFA 4G94A 4OIQF 3KP7A 3JAMK 3HSEA 3DQVC 4L5JA 3E6CC 1E17A 3BY6A 4ZZDA 4YFNF 2V1DA 4I01A 3KP6A 2P5VA 4I2OA 3K0LA 1IN7A 4NHJA 1T39A 1J75A 3WE2A 2F5EA 4YFXF 1Z6TA 4UXNA 4RS8A 5LHIA 2PN6A 1F4KA 1T98A 3IHUA 3RPQA 1G6NA 3WE3A 2FBIA 2EFWA 3LA7A 2VOPA 4M9ZA 4Y15A 4JQFA 4GYGA 3J81Z 2MH9A 4JK1X 4NB5A 2L3DA 2H27A 5DEQA 5ILUA 4IJAA 3ROUA 4I98B 5ILVA 4GO1A 5DDGA 2W25A 1XMKA 2JTVA 3QPHA 5ILSA 3F8CA 1JE8A 3L7WA 1OYIA 2JPBA 2VN2A 2XV4S 2L4AA 3I59A 1YQAA 1YS7A 1IZ1A 1D3YA 4Z2YA 1FOKA 1YS6A 5JFRA 4HF0A 3ZMSA 5BPIA 3VOEA 2O6GE 5BQTA 3OV8A 4OIRF 2QUFA 4CZZA 5D5UB 1LVAA 4BAYA 5LEKA 2HKXA 2ZKZA 2A61A 3N97A 4XSZF 4HAMA 5H20A 3TO6A 2V79A 1T38A 2QQ9A 5ICEA 1BN5A 1WKMA 3R0AA 4IVNA 5IT3A 2DLLA 2W85A 4U7BA 4G6QA 4MTDA 2QVOA 3DXJF 5HLGA 1HSTA 1T0FA 5HS8A 3V8LA 3WG9A 2GXGA 5IT9Z 1OYWA 5D4RA 2PG4A 1ON2A 1TLHB 3IRRA 1JHFA 4ENJA 3ML6A 2NS0A 1IAWA 4XLPF 3HSFA 1L0OC 2PQ8A 3RKYA 2W57A 1KU2A 4MTEA 2P4WA 3V7SA 3V7RA 3BDDA 3B73A 1BC7C 3U2RA 1SD6A 5K5OA 2XAHA 5FFZA 3LFKA 2IJLA 1IN8A 1LNWA 3KE2A 4MHGA 5DD4A 5TJJA 2QM3A 1FSEA 3HSRA 2DQLA 1SD4A 4PDKA 4LK0F 3SHFA 4QWQA 5H6RA 1ZG3A 3PQKA 2FSWA 3RIRA 1U2WA 5LEJA 1GHCA 1XMAA 5L3GA 4MEYF 1ZRCA 4LG0B 3REOA 3WTTC 4I02A 2BYVE 4G9YA 2JZYA 2DK8A 1FBQA 1K79A 4WXHA 4O5VA 3HRTA 2ZXJA 1CGPA 2C6YA 3ZPLA 4EJUA 3SXYA 1Q1HA 1ZLJA 1LEAA 2K4BA 2HKOA 1DDNA 1U5TA 1TQMA 4Q47A 2DK5A 2LKPA 4U7DA 2CWEA 1O3RA 4NQWA 1YW8A 3H3UA 4I0BA 3COAC 2KIMA 3SZTA 2EFPA 4RB3C 4GCVA 3I54A 4D0PA 4L0YB 4MNUA 5HVQC 2QWWA 4CDGA 1ZGAA 4KIFA 2RV8A 3I64A 2F5FA 2DW4A 1ULYA 3ZN1A 1OMIA 2VODA 2YU3A 2DFIA 4I7HA 1B1BA 1RUNA 1A04A 1SMYF 2YX7A 1O3QA 2ISYA 4UVAA 1SAXA 2IW5A 5FLXK 4CYDA 2UXXA 4M6XA 2KKOA 3RYPA 2STWA 3K9TA 3R60A 3EYIA 3I0TA 2D2WA 3HYIA 3DEUA 1YTYA 1D8KA 3OOPA 2XGXA 5E1XA 2XRNA 3S2WA 3E97A 4HZFA 3C18A 1IN4A 3FMQA 1S7OA 3GFJA 1U8RA 1ZREA 4EJTA 2DI3A 2ZMEA 4WWCA 1ZH5A 2V9VA 3KLOA 3GX4X 1OYYA 2R7DA 4KICA 1XCVA 2KIFA 3E6DA 4PGGA 1YW9A 2M87A 3QOPA 2DAOA 4HA8A 2J5PA 2HTSA 5HLHA 2GXBA 2DPUA 3VEPA 4ZYDA 4HQMA 3FMRA 2D45A 2IT0A 3HHHA 3KFWX 4IHTA 4XRFA 4MQVA 1XSDA 2PJPA 4PCQA 2FMLA 1XB4A 3KP5A 3CLOA 2RC4A 3I5UA 1H0MA 1TNSA 4HV6A 4MQ9F 3I53A 5LBQA 2O0YA 2EA4A 1FNNA 1BIAA 2RKHA 3HRUA 3ZMVA 5JI6A 4KA4A 4HLYA 4PZJA 3GW2A 5CVVA 4N9HA 2QQBA 3Q9SA 4EJWA 3EUHA 3E3VA 2ZO4A 2DPDA 5K1YA 3KCCA 1HW1A 3ZMZA 3K69A 5E1ZB 5DCMB 3IC7A 3W6KB 2CW0F 5AIQA 3KEOA 3E5QA 3RDIA 2O61A 2EK5A 4YIFA 1B9NA 1IXCA 3I4PA 2GA1A 3O3KA 1F1ZA 1FBUA 3DPLC 5J8FA 1KQ8A 1KGSA 4P55A 5LLQA 2FBHA 3F3XA 3GYHX 3C3WA 3FZVA 2QQAA 4G7HF 3RPUA 3LAPA 1YIOA 3KZYA 4A0XA 3K1PA 1D8JA 1RI7A 1J9IA 3WU0A 1ZN2A 4IF4A 1V3FA 2FA5A 1EV7A 1P4XA 4LLNA 3E6MA 1B4AA 5DV5A 1FT9A 3GLXA 1FZPB 2OBPA 3DV8A 4LLGF 4IPAA 3GXOA 5BS6A 4M71A 1K7AA 2A5YB 2RN7A 1ZG5A 5D8KB 5D6FA 4Q5SF 1FC3A 5HS9A 2WV0A 2CYYA 1R22A 4ESFA 2BGCA 1MKMA 4PGHA 3EETA 3NQOA 2FXAA 2XIGA 4UHTA 4AD9A 1B59A 3CDHA 1ONVA 3L9FA 3ZMDA 3LA3A 2KJBA 4IHSA 3ABTA 3Q9VA 2BBYA 2J5OA 1BBYA 2BE5F 1BOAA 1KU7A 1QQIA 2YPRA 1S7AA 3EQLF 2PBIA 5ERIA 1H9TA 1HKSA 3KETA 2FNPA 5D5VB 2Q2EA 4LB6B 3V7CA 2OA4A 2IVMA 3HTUA 1Y0UA 4CXFA 2ZCWA 5JR3A 4RAZA 5F6FA 1ZG1A 1QPMA 1FWZA 2OZUA 2E1NA 4IRIA 1SFEA 1XSXA 5LHHA 4KNYA 1F9NA 5IT9K 2IRFG 1IN5A 2E7XA 2PEXA 4LG0A 3KP4A 4Y17A 4Y13A 2XAFA 2A69F 2YX4A 3I71A 2CFXA 3L00A 3U1DA 1HKTA 4YIIA 4EM1A 4UNOA 2STTA 1STZA 3T5XA 4I09A 1W7PD 1XCBA 5E18F 2VBWA 5LGNA 1Z9CA 3C1DA 4OIPF 1G3SA 2M1BA 4U0YA 1W7PB 3IWZA 1U3EM 3GWZA 2O3FA 1FPQA 5F64A 1KQ0A 4RGSA 4KN4X 2ESHA 3N4MA 4R1HA 1B6AA 3K1NA 3F8BA 5EEGA 2XKOA 1RZ4A 3GFIA 2GQQA 1P6RA 1FX7A 1REPC 4BYYA 1E2XA 4ESJA 2KRFA 3T8RA 5E8IA 4KYWA 4ENNA 1XGMA 3VFZA 2ADUA 2FOKA 3H92A 3JSOA 4ENKA 3MWMA 2JSCA 3L2CA 1MGTA 4N9IA 5A2QZ 2EV5A 4AVPA 2A68F 1QGPA 2OQGA 2XUBA 3F72A 2A07F 4MEXF 3CUQB 2Y48A 2P5KA 4EGZA 2DO7A 3DF8A 1J0RA 3FM3A 2G7UA 5CVJA 5CYVA 1TBXA 4RAYA 1AOYA 3D5LA 4UV9A 5E20A 4GXOA 2EV0A 1IXSB 1XN7A 1FP1D 4M74A 1SD5A 3BPVA 4I0AA 1ZLKA 3WGIA 4OU0A 3GZ5A 3V8JA 2P6TA 1ZAOA 1OPCA 2F5DA 2COMA 1PUEE 4KT5C 4HDVA 4RB2C 1PP7U 3E6BA 3IKTA 2A6HF 4L0ZB 3RTRA 2VONA 1HXDA 1W4MA 5JVTA 2VBXA 4L9JA 4RGRA 1I1SA 2IA1A 5ICGA 2EFOA 1G3WA 1Z05A 3LAJA 1K78B 3RKWA 3WU1B 1FSHA 1ZHFA 3DPTA 2ZFWA 5HOOA 1U78A 4RB0A 1S8NA 2X4HA 4CICA 2H6CA 2MBFA 3KP3A 2PFBA 2P5LC 3KZZA 4BXUA 4HOBA 2M5WA 4AWXB 3T0YA 2WTEA 4G6DA 5DD8A 3FWEA 5ED4A 5DCMA 3R6SA 3F22A 3QAHA 3FF5A 1X3UA 1Z91A 1YW7A 2A3SA 2Z99A 1BC8C 4LMYA 4FT8A 4LFUA 1I5ZA 3HHGA 5J6XA 2Q0OA 3E5UA 2L54A 3T8TA 1IRGA 2BV6A 4A0ZA 1G3YA 3SZPA 4WF2A 1BI1A 4HX4A 3TGNA 3J80Z 1LDJA 3WGGA 3T1BA 2QZ8A 2XAQA 3SQNA 1BI0A 1P4WA 1C0WA 1KU3A 3KLNA 2L01A 1USSA 3ZN0A 1EH8A 2A6EF 1PP8F 2OU2A 1H9GA 2XVCA 3HRSA 2O03A 2HZTA 2K86A 3ISPA 3MFKA 5BPDA 3F21A 2YSRA 1B9MA 5CVRA 4ESBA 1MJBA 1WI9A 1W5SA 4WXDA 1KYWA 4A12A 2EWNA 1ZRFA 2NAZA 4LD5A 2E1CA 2LF7A 5DUKA 3FXRA 2Z3YA 3BWGA 2NNNA 2V1XA 2WWYA 1GVJA 4XLNF 2VBYA 5D5WB 3CUOA 5CLSA 3PFIA 5TRDA 1P2FA 4HQEA 4IRGA 2ISZA 2LSOA 2K02A 3E5XA 1NHAA 1ODDA 3U9GA 3ECOA 4XSXF 4BHBA 2M30A 1TQPA 5L3FA 2HYFA 3TQNA 1J7KA 3JTGA 2K7LA 3F8NA 1F5TA 2KIUA 1WQ2A 5D5XB 1QNTA 2RDPA 4IXAA 3BZ6A 4EVIA 1W5TA 5FO5A 3G73A 1G4DA 2L4MA 2IA0A 3IKVA 3GZ6A 2FEZA 4ZYGA 1HBXG 3QP6A 3WTYC 2Z33A 1GXQA 1R7JA 1YLFA 4B09A 1W7PA 2IP2A 1DPUA 3V4GA 1YFHA 1UCRA 2FRHA 2V1UA 2IA2A 2OD5A 2VC0A 2VT3A 1HKQA 2H94A 2O8XA 3KP2A 4WXCA 4UVCA 2NYXA 3BJOA 3LQRA 4M9XA 4A0YA 2LDUA 3J81K 2W24A 4HX8A 3R0JA 3WODF 3P9CA 3MEXA 3BJAA 3KEQA 4UUVA 4KDPA 3P9KA 4M73A 1LQ1A 4HBLA 6PAXA 3P7NA 4AIKA 4OMYA 3SFZA 5L3EA 4CO8A 2EJRA 1LEBA 5AIPA 3R61A 4LJZF 1SD7A 4QLCU 5CJ9A 3CUQA 2PMHA 4A5MA 2FQ3A 3JSPA 4S04A 1VTNC 3G3ZA 2LF8A 3NRVA 2FU4A 1HW5A 3D0SA 3TO7A 4FHTA 4A6DA 4OINF 2R7FA 1RIOH 2E7WA 3MQ0A 2VE9A 4R79A 4B8XA 2X0LA 1FY7A 2BEOA 5CVIA 4FX0A 5LGUA 2EB7A 3K1MA 3M9AA 5LHGA 3QU6A 1KQ9A 1R5HA 2VXZA 5A2QK 3VODA 1KYZA 2HS5A 2QENA 2JRTA 4P5OA 2K4JA 4BHPA 1HSJA 3GFLA 1R1VA 1XGOA 5FD5A 1FP2A 5E1WA 2ZJ2A 4P9FA 5LGTA 1R1UA 3DP7A 2ACJA 3FMSA 2B0LA 2HGCA 2NNYA 1YYVA 1K78A 1UFMA 3ZMUA 5LRSA 2GWRA 2HEOA 3BOQA 3TDUC 3H3ZA 5D6EA 1KA8A 1XSVA 4LK1F 5CVUA 5K5QA 2HQNA 3GF2A 1MD0A 1SFXA 2MD5A 3MCZA 1T6SA 4S05A 3M8EA 4Q4ZF 4KN7X 2EFNA 2VBZA 3FXUA 3FHZA 2FNAA 4WK8F 4EJOA 2P7CB 2HDCA 1IUYA 2RNJA 1KU9A 3V8KA 3W6JB 1USTA 2XKPA 3ZMTA 3JW4A 3PQJA 1I27A 2WC2A 1BJAA 1WWXA 4CHUA 4IRHA 2JPCA 4GGGA 1ZRDA 1ZARA 5J8CA 2NRAC 4GYIA 1U5TC 4P96A 4HDUA 3IRQA 5DUIA 4RGXA 2VT2A 1O7FA 4KMFA 1O3TA 3ULQB 1IRFA 4OMZA 2EFQA 3WTVC 5FD6A 1CF7B 1MDMB 2VOOA 4KMUX 4L9VA 3ERED 2HWVA 1R5GA 4EM0B 1T2KA 2H09A 3BJ6A 3WTZA 1LDKB 4UVBA 1S6LA 2QYOA 1U6GA 1PDNC 3BROA 2Z5UA 1R23A 1LB2A 4EJVA 3JAMZ 2CGPA 3M1EA 3CO7C 5L3DA 4UV8A 2PMUA 5EEHA 4BH9A 1XDUA 1IXRC 5FGMA 3J80K 2Z9OA 1P92A 3F6VA 1ZGJA 4M9SA 3EYYA 2GIVA 4ZYHA 3CO6C 1FBSA 1G3TA 4Q48A 3Q5FA 2AS5F 1LDDA 2CO5A 1JHHA 2HTJA 2V6CA 2AXLA 1WRJA 2K27A 1XDSA 3LSTA 3ABUA 4AIJA 2CQKA 2XAJA 2DU9A 4XBFA 1XGNA 4A6EA 1BI3A 3RI4A 1J2XA 4JBAA 1IF1A 5LRRA 5D4SA 3DFGA 3B02A 1QZYA 2D1HA 4YG2F 5HDNA 3MZHA 2VE8A 3GO5A 4HV5A 3HUGA 2VC1A 2UXNA 2LNBA 4YFKF 3LQQA 3F8MA 1I6XA 4HX7A 2ETHA 1FYLA 5L3CA 1TNTA 2FF4A 4E70A 1BIBA 1I1GA 2HOEA 2G7HA 2ZBKA 4O3MA 4OOIA 4WX9A 3LA2A 3HOTA 1LJ9A 1Z6RA 2MLKA 1DPRA 1P4AA 3HRMA 5DYMA 2PI0A 5HLIA 3ZP5A 1O7LA 4FX4A 3FXQA 4EMSA 2FMYA 1UB9A 1TW3A 1EH7A 4HYEA 4KIBA 4N0BA 1L3LA 1J59A 4G7ZF 5L3BA 3F6OA 4HLXA 4ASNA 3I59B 3VB2A 4F7ZA 2OZ6A 2HYGD 1RNLA 3TOBA 3GFMA 3RJPA 4ENMA 4HW0A 2UWMA 3F8FA 3EDPA 3TDZC 5E17F 2RQPA 3WTWC 1QBJA 4R8HA 4A5NA 5K5RA 3ELKA 3FM5A 3R4KA 1Z7UA 2HR3A 1Z1DA 3QU3A 1JGSA 3TKYA 2H6BA 1QZZA 3P9IA 2F2EA 3QRFF 3HIFA 2W84A 3RKXA 2P8TA 4KFCA 5HDGA 4U88A 4H0EA 4WCGA 5FFXA 2EV6A 3J7AO 3AAFA 2CSOA 5E8GA 4ZH4F 1MJAA 1TQIA 3WTSC 4TV7A 3DKWA 4EQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M45 A;  1J5Y A;  1XGS A;  5KK1 A;  2QBY A;  3IWF A;  3C7J A;  2MH2 A;  4ZZL A;  3HTS B;  3MAJ A;  1R00 A;  5JHU A;  1IN6 A;  1SMT A;  1IW7 F;  4M72 A;  1DUX C;  4OIO F;  4EV0 A;  2RGV A;  3CUQ C;  2IPQ X;  1K6O A;  4ON0 A;  2GAU A;  5DCF A;  1FYK A;  1UHW A;  4O6J A;  3ECH A;  2DTR A;  2HQR A;  4LLL A;  1YO5 C;  2QLZ A;  5HS7 A;  4HF2 A;  3WTU C;  4L18 B;  1BI2 A;  3CJN A;  2XRO A;  3JTH A;  3O6B B;  2MA3 A;  1OR7 A;  1TTY A;  4L5I A;  5ICC A;  2P7V B;  4KUM A;  5BMZ A;  1EH6 A;  3M8F A;  1YG2 A;  2DQR A;  2RVC A;  3BP8 A;  2UZK A;  2FBK A;  4KIG A;  4M6Y A;  5BOX A;  4BHC A;  2XAG A;  1R1T A;  4U0V A;  4L9N A;  4RGU A;  1JXS A;  3WGH A;  4AIH A;  3GUD A;  2Y75 A;  1UHM A;  2P6S A;  1GXP A;  2YR2 A;  4A2U A;  3L09 A;  3GVA A;  3MZY A;  1DP7 P;  3F23 A;  2ZNZ A;  1V4R A;  4BQA A;  2EA2 A;  1HW2 A;  2DBB A;  3ZQ7 A;  5KVR A;  2ZNY A;  5D8L B;  2PLY A;  4G7O F;  1ZYR F;  1O57 A;  3M7G A;  2F5C A;  5ICF A;  1HQC A;  2CG4 A;  3FX3 A;  2GZW A;  5FB2 A;  2R3S A;  4K2E A;  1AWC A;  1U5T B;  4DNC A;  4LB5 A;  4EGY A;  2XAS A;  3TOA A;  1BM9 A;  2L02 A;  3TO9 A;  3RYR A;  5FLX Z;  4LGW A;  1SFU A;  1TW2 A;  3IL2 A;  4ZYE A;  2TDX A;  2HFH A;  1QO0 D;  4L9T A;  1CF7 A;  1MDM A;  4P9U A;  3CTA A;  2KJC A;  3BPX A;  4U0W A;  3QPT A;  4G8X A;  1R58 A;  2D1V A;  4CGZ A;  1FLI A;  2Q8K A;  2MC3 A;  1S29 A;  2MLG A;  2OQR A;  5H6Q A;  1R36 A;  1ON1 A;  3I58 A;  5F1R A;  1XD7 A;  1WSU A;  1FYM A;  2OAZ A;  2M8E A;  3NEU A;  1D5V A;  2GA2 A;  2Y0M A;  2G9W A;  1MZB A;  2JT1 A;  4DQ2 A;  2ESN A;  3HOS A;  4HF1 A;  1OKR A;  4ETS A;  1S3J A;  2QBY B;  3K2Z A;  4MGR A;  2XHK A;  1MJ9 A;  2FE3 A;  2DT5 A;  3QP5 A;  4BNC A;  1O3S A;  3GEZ A;  5HDK A;  5AON A;  3O2P E;  2ZME B;  1RUO A;  4EM2 A;  3WTX C;  4RB1 A;  2ELH A;  3LWF A;  4G94 A;  4OIQ F;  3KP7 A;  3JAM K;  3HSE A;  3DQV C;  4L5J A;  3E6C C;  1E17 A;  3BY6 A;  4ZZD A;  4YFN F;  2V1D A;  4I01 A;  3KP6 A;  2P5V A;  4I2O A;  3K0L A;  1IN7 A;  4NHJ A;  1T39 A;  1J75 A;  3WE2 A;  2F5E A;  4YFX F;  1Z6T A;  4UXN A;  4RS8 A;  5LHI A;  2PN6 A;  1F4K A;  1T98 A;  3IHU A;  3RPQ A;  1G6N A;  3WE3 A;  2FBI A;  2EFW A;  3LA7 A;  2VOP A;  4M9Z A;  4Y15 A;  4JQF A;  4GYG A;  3J81 Z;  2MH9 A;  4JK1 X;  4NB5 A;  2L3D A;  2H27 A;  5DEQ A;  5ILU A;  4IJA A;  3ROU A;  4I98 B;  5ILV A;  4GO1 A;  5DDG A;  2W25 A;  1XMK A;  2JTV A;  3QPH A;  5ILS A;  3F8C A;  1JE8 A;  3L7W A;  1OYI A;  2JPB A;  2VN2 A;  2XV4 S;  2L4A A;  3I59 A;  1YQA A;  1YS7 A;  1IZ1 A;  1D3Y A;  4Z2Y A;  1FOK A;  1YS6 A;  5JFR A;  4HF0 A;  3ZMS A;  5BPI A;  3VOE A;  2O6G E;  5BQT A;  3OV8 A;  4OIR F;  2QUF A;  4CZZ A;  5D5U B;  1LVA A;  4BAY A;  5LEK A;  2HKX A;  2ZKZ A;  2A61 A;  3N97 A;  4XSZ F;  4HAM A;  5H20 A;  3TO6 A;  2V79 A;  1T38 A;  2QQ9 A;  5ICE A;  1BN5 A;  1WKM A;  3R0A A;  4IVN A;  5IT3 A;  2DLL A;  2W85 A;  4U7B A;  4G6Q A;  4MTD A;  2QVO A;  3DXJ F;  5HLG A;  1HST A;  1T0F A;  5HS8 A;  3V8L A;  3WG9 A;  2GXG A;  5IT9 Z;  1OYW A;  5D4R A;  2PG4 A;  1ON2 A;  1TLH B;  3IRR A;  1JHF A;  4ENJ A;  3ML6 A;  2NS0 A;  1IAW A;  4XLP F;  3HSF A;  1L0O C;  2PQ8 A;  3RKY A;  2W57 A;  1KU2 A;  4MTE A;  2P4W A;  3V7S A;  3V7R A;  3BDD A;  3B73 A;  1BC7 C;  3U2R A;  1SD6 A;  5K5O A;  2XAH A;  5FFZ A;  3LFK A;  2IJL A;  1IN8 A;  1LNW A;  3KE2 A;  4MHG A;  5DD4 A;  5TJJ A;  2QM3 A;  1FSE A;  3HSR A;  2DQL A;  1SD4 A;  4PDK A;  4LK0 F;  3SHF A;  4QWQ A;  5H6R A;  1ZG3 A;  3PQK A;  2FSW A;  3RIR A;  1U2W A;  5LEJ A;  1GHC A;  1XMA A;  5L3G A;  4MEY F;  1ZRC A;  4LG0 B;  3REO A;  3WTT C;  4I02 A;  2BYV E;  4G9Y A;  2JZY A;  2DK8 A;  1FBQ A;  1K79 A;  4WXH A;  4O5V A;  3HRT A;  2ZXJ A;  1CGP A;  2C6Y A;  3ZPL A;  4EJU A;  3SXY A;  1Q1H A;  1ZLJ A;  1LEA A;  2K4B A;  2HKO A;  1DDN A;  1U5T A;  1TQM A;  4Q47 A;  2DK5 A;  2LKP A;  4U7D A;  2CWE A;  1O3R A;  4NQW A;  1YW8 A;  3H3U A;  4I0B A;  3COA C;  2KIM A;  3SZT A;  2EFP A;  4RB3 C;  4GCV A;  3I54 A;  4D0P A;  4L0Y B;  4MNU A;  5HVQ C;  2QWW A;  4CDG A;  1ZGA A;  4KIF A;  2RV8 A;  3I64 A;  2F5F A;  2DW4 A;  1ULY A;  3ZN1 A;  1OMI A;  2VOD A;  2YU3 A;  2DFI A;  4I7H A;  1B1B A;  1RUN A;  1A04 A;  1SMY F;  2YX7 A;  1O3Q A;  2ISY A;  4UVA A;  1SAX A;  2IW5 A;  5FLX K;  4CYD A;  2UXX A;  4M6X A;  2KKO A;  3RYP A;  2STW A;  3K9T A;  3R60 A;  3EYI A;  3I0T A;  2D2W A;  3HYI A;  3DEU A;  1YTY A;  1D8K A;  3OOP A;  2XGX A;  5E1X A;  2XRN A;  3S2W A;  3E97 A;  4HZF A;  3C18 A;  1IN4 A;  3FMQ A;  1S7O A;  3GFJ A;  1U8R A;  1ZRE A;  4EJT A;  2DI3 A;  2ZME A;  4WWC A;  1ZH5 A;  2V9V A;  3KLO A;  3GX4 X;  1OYY A;  2R7D A;  4KIC A;  1XCV A;  2KIF A;  3E6D A;  4PGG A;  1YW9 A;  2M87 A;  3QOP A;  2DAO A;  4HA8 A;  2J5P A;  2HTS A;  5HLH A;  2GXB A;  2DPU A;  3VEP A;  4ZYD A;  4HQM A;  3FMR A;  2D45 A;  2IT0 A;  3HHH A;  3KFW X;  4IHT A;  4XRF A;  4MQV A;  1XSD A;  2PJP A;  4PCQ A;  2FML A;  1XB4 A;  3KP5 A;  3CLO A;  2RC4 A;  3I5U A;  1H0M A;  1TNS A;  4HV6 A;  4MQ9 F;  3I53 A;  5LBQ A;  2O0Y A;  2EA4 A;  1FNN A;  1BIA A;  2RKH A;  3HRU A;  3ZMV A;  5JI6 A;  4KA4 A;  4HLY A;  4PZJ A;  3GW2 A;  5CVV A;  4N9H A;  2QQB A;  3Q9S A;  4EJW A;  3EUH A;  3E3V A;  2ZO4 A;  2DPD A;  5K1Y A;  3KCC A;  1HW1 A;  3ZMZ A;  3K69 A;  5E1Z B;  5DCM B;  3IC7 A;  3W6K B;  2CW0 F;  5AIQ A;  3KEO A;  3E5Q A;  3RDI A;  2O61 A;  2EK5 A;  4YIF A;  1B9N A;  1IXC A;  3I4P A;  2GA1 A;  3O3K A;  1F1Z A;  1FBU A;  3DPL C;  5J8F A;  1KQ8 A;  1KGS A;  4P55 A;  5LLQ A;  2FBH A;  3F3X A;  3GYH X;  3C3W A;  3FZV A;  2QQA A;  4G7H F;  3RPU A;  3LAP A;  1YIO A;  3KZY A;  4A0X A;  3K1P A;  1D8J A;  1RI7 A;  1J9I A;  3WU0 A;  1ZN2 A;  4IF4 A;  1V3F A;  2FA5 A;  1EV7 A;  1P4X A;  4LLN A;  3E6M A;  1B4A A;  5DV5 A;  1FT9 A;  3GLX A;  1FZP B;  2OBP A;  3DV8 A;  4LLG F;  4IPA A;  3GXO A;  5BS6 A;  4M71 A;  1K7A A;  2A5Y B;  2RN7 A;  1ZG5 A;  5D8K B;  5D6F A;  4Q5S F;  1FC3 A;  5HS9 A;  2WV0 A;  2CYY A;  1R22 A;  4ESF A;  2BGC A;  1MKM A;  4PGH A;  3EET A;  3NQO A;  2FXA A;  2XIG A;  4UHT A;  4AD9 A;  1B59 A;  3CDH A;  1ONV A;  3L9F A;  3ZMD A;  3LA3 A;  2KJB A;  4IHS A;  3ABT A;  3Q9V A;  2BBY A;  2J5O A;  1BBY A;  2BE5 F;  1BOA A;  1KU7 A;  1QQI A;  2YPR A;  1S7A A;  3EQL F;  2PBI A;  5ERI A;  1H9T A;  1HKS A;  3KET A;  2FNP A;  5D5V B;  2Q2E A;  4LB6 B;  3V7C A;  2OA4 A;  2IVM A;  3HTU A;  1Y0U A;  4CXF A;  2ZCW A;  5JR3 A;  4RAZ A;  5F6F A;  1ZG1 A;  1QPM A;  1FWZ A;  2OZU A;  2E1N A;  4IRI A;  1SFE A;  1XSX A;  5LHH A;  4KNY A;  1F9N A;  5IT9 K;  2IRF G;  1IN5 A;  2E7X A;  2PEX A;  4LG0 A;  3KP4 A;  4Y17 A;  4Y13 A;  2XAF A;  2A69 F;  2YX4 A;  3I71 A;  2CFX A;  3L00 A;  3U1D A;  1HKT A;  4YII A;  4EM1 A;  4UNO A;  2STT A;  1STZ A;  3T5X A;  4I09 A;  1W7P D;  1XCB A;  5E18 F;  2VBW A;  5LGN A;  1Z9C A;  3C1D A;  4OIP F;  1G3S A;  2M1B A;  4U0Y A;  1W7P B;  3IWZ A;  1U3E M;  3GWZ A;  2O3F A;  1FPQ A;  5F64 A;  1KQ0 A;  4RGS A;  4KN4 X;  2ESH A;  3N4M A;  4R1H A;  1B6A A;  3K1N A;  3F8B A;  5EEG A;  2XKO A;  1RZ4 A;  3GFI A;  2GQQ A;  1P6R A;  1FX7 A;  1REP C;  4BYY A;  1E2X A;  4ESJ A;  2KRF A;  3T8R A;  5E8I A;  4KYW A;  4ENN A;  1XGM A;  3VFZ A;  2ADU A;  2FOK A;  3H92 A;  3JSO A;  4ENK A;  3MWM A;  2JSC A;  3L2C A;  1MGT A;  4N9I A;  5A2Q Z;  2EV5 A;  4AVP A;  2A68 F;  1QGP A;  2OQG A;  2XUB A;  3F72 A;  2A07 F;  4MEX F;  3CUQ B;  2Y48 A;  2P5K A;  4EGZ A;  2DO7 A;  3DF8 A;  1J0R A;  3FM3 A;  2G7U A;  5CVJ A;  5CYV A;  1TBX A;  4RAY A;  1AOY A;  3D5L A;  4UV9 A;  5E20 A;  4GXO A;  2EV0 A;  1IXS B;  1XN7 A;  1FP1 D;  4M74 A;  1SD5 A;  3BPV A;  4I0A A;  1ZLK A;  3WGI A;  4OU0 A;  3GZ5 A;  3V8J A;  2P6T A;  1ZAO A;  1OPC A;  2F5D A;  2COM A;  1PUE E;  4KT5 C;  4HDV A;  4RB2 C;  1PP7 U;  3E6B A;  3IKT A;  2A6H F;  4L0Z B;  3RTR A;  2VON A;  1HXD A;  1W4M A;  5JVT A;  2VBX A;  4L9J A;  4RGR A;  1I1S A;  2IA1 A;  5ICG A;  2EFO A;  1G3W A;  1Z05 A;  3LAJ A;  1K78 B;  3RKW A;  3WU1 B;  1FSH A;  1ZHF A;  3DPT A;  2ZFW A;  5HOO A;  1U78 A;  4RB0 A;  1S8N A;  2X4H A;  4CIC A;  2H6C A;  2MBF A;  3KP3 A;  2PFB A;  2P5L C;  3KZZ A;  4BXU A;  4HOB A;  2M5W A;  4AWX B;  3T0Y A;  2WTE A;  4G6D A;  5DD8 A;  3FWE A;  5ED4 A;  5DCM A;  3R6S A;  3F22 A;  3QAH A;  3FF5 A;  1X3U A;  1Z91 A;  1YW7 A;  2A3S A;  2Z99 A;  1BC8 C;  4LMY A;  4FT8 A;  4LFU A;  1I5Z A;  3HHG A;  5J6X A;  2Q0O A;  3E5U A;  2L54 A;  3T8T A;  1IRG A;  2BV6 A;  4A0Z A;  1G3Y A;  3SZP A;  4WF2 A;  1BI1 A;  4HX4 A;  3TGN A;  3J80 Z;  1LDJ A;  3WGG A;  3T1B A;  2QZ8 A;  2XAQ A;  3SQN A;  1BI0 A;  1P4W A;  1C0W A;  1KU3 A;  3KLN A;  2L01 A;  1USS A;  3ZN0 A;  1EH8 A;  2A6E F;  1PP8 F;  2OU2 A;  1H9G A;  2XVC A;  3HRS A;  2O03 A;  2HZT A;  2K86 A;  3ISP A;  3MFK A;  5BPD A;  3F21 A;  2YSR A;  1B9M A;  5CVR A;  4ESB A;  1MJB A;  1WI9 A;  1W5S A;  4WXD A;  1KYW A;  4A12 A;  2EWN A;  1ZRF A;  2NAZ A;  4LD5 A;  2E1C A;  2LF7 A;  5DUK A;  3FXR A;  2Z3Y A;  3BWG A;  2NNN A;  2V1X A;  2WWY A;  1GVJ A;  4XLN F;  2VBY A;  5D5W B;  3CUO A;  5CLS A;  3PFI A;  5TRD A;  1P2F A;  4HQE A;  4IRG A;  2ISZ A;  2LSO A;  2K02 A;  3E5X A;  1NHA A;  1ODD A;  3U9G A;  3ECO A;  4XSX F;  4BHB A;  2M30 A;  1TQP A;  5L3F A;  2HYF A;  3TQN A;  1J7K A;  3JTG A;  2K7L A;  3F8N A;  1F5T A;  2KIU A;  1WQ2 A;  5D5X B;  1QNT A;  2RDP A;  4IXA A;  3BZ6 A;  4EVI A;  1W5T A;  5FO5 A;  3G73 A;  1G4D A;  2L4M A;  2IA0 A;  3IKV A;  3GZ6 A;  2FEZ A;  4ZYG A;  1HBX G;  3QP6 A;  3WTY C;  2Z33 A;  1GXQ A;  1R7J A;  1YLF A;  4B09 A;  1W7P A;  2IP2 A;  1DPU A;  3V4G A;  1YFH A;  1UCR A;  2FRH A;  2V1U A;  2IA2 A;  2OD5 A;  2VC0 A;  2VT3 A;  1HKQ A;  2H94 A;  2O8X A;  3KP2 A;  4WXC A;  4UVC A;  2NYX A;  3BJO A;  3LQR A;  4M9X A;  4A0Y A;  2LDU A;  3J81 K;  2W24 A;  4HX8 A;  3R0J A;  3WOD F;  3P9C A;  3MEX A;  3BJA A;  3KEQ A;  4UUV A;  4KDP A;  3P9K A;  4M73 A;  1LQ1 A;  4HBL A;  6PAX A;  3P7N A;  4AIK A;  4OMY A;  3SFZ A;  5L3E A;  4CO8 A;  2EJR A;  1LEB A;  5AIP A;  3R61 A;  4LJZ F;  1SD7 A;  4QLC U;  5CJ9 A;  3CUQ A;  2PMH A;  4A5M A;  2FQ3 A;  3JSP A;  4S04 A;  1VTN C;  3G3Z A;  2LF8 A;  3NRV A;  2FU4 A;  1HW5 A;  3D0S A;  3TO7 A;  4FHT A;  4A6D A;  4OIN F;  2R7F A;  1RIO H;  2E7W A;  3MQ0 A;  2VE9 A;  4R79 A;  4B8X A;  2X0L A;  1FY7 A;  2BEO A;  5CVI A;  4FX0 A;  5LGU A;  2EB7 A;  3K1M A;  3M9A A;  5LHG A;  3QU6 A;  1KQ9 A;  1R5H A;  2VXZ A;  5A2Q K;  3VOD A;  1KYZ A;  2HS5 A;  2QEN A;  2JRT A;  4P5O A;  2K4J A;  4BHP A;  1HSJ A;  3GFL A;  1R1V A;  1XGO A;  5FD5 A;  1FP2 A;  5E1W A;  2ZJ2 A;  4P9F A;  5LGT A;  1R1U A;  3DP7 A;  2ACJ A;  3FMS A;  2B0L A;  2HGC A;  2NNY A;  1YYV A;  1K78 A;  1UFM A;  3ZMU A;  5LRS A;  2GWR A;  2HEO A;  3BOQ A;  3TDU C;  3H3Z A;  5D6E A;  1KA8 A;  1XSV A;  4LK1 F;  5CVU A;  5K5Q A;  2HQN A;  3GF2 A;  1MD0 A;  1SFX A;  2MD5 A;  3MCZ A;  1T6S A;  4S05 A;  3M8E A;  4Q4Z F;  4KN7 X;  2EFN A;  2VBZ A;  3FXU A;  3FHZ A;  2FNA A;  4WK8 F;  4EJO A;  2P7C B;  2HDC A;  1IUY A;  2RNJ A;  1KU9 A;  3V8K A;  3W6J B;  1UST A;  2XKP A;  3ZMT A;  3JW4 A;  3PQJ A;  1I27 A;  2WC2 A;  1BJA A;  1WWX A;  4CHU A;  4IRH A;  2JPC A;  4GGG A;  1ZRD A;  1ZAR A;  5J8C A;  2NRA C;  4GYI A;  1U5T C;  4P96 A;  4HDU A;  3IRQ A;  5DUI A;  4RGX A;  2VT2 A;  1O7F A;  4KMF A;  1O3T A;  3ULQ B;  1IRF A;  4OMZ A;  2EFQ A;  3WTV C;  5FD6 A;  1CF7 B;  1MDM B;  2VOO A;  4KMU X;  4L9V A;  3ERE D;  2HWV A;  1R5G A;  4EM0 B;  1T2K A;  2H09 A;  3BJ6 A;  3WTZ A;  1LDK B;  4UVB A;  1S6L A;  2QYO A;  1U6G A;  1PDN C;  3BRO A;  2Z5U A;  1R23 A;  1LB2 A;  4EJV A;  3JAM Z;  2CGP A;  3M1E A;  3CO7 C;  5L3D A;  4UV8 A;  2PMU A;  5EEH A;  4BH9 A;  1XDU A;  1IXR C;  5FGM A;  3J80 K;  2Z9O A;  1P92 A;  3F6V A;  1ZGJ A;  4M9S A;  3EYY A;  2GIV A;  4ZYH A;  3CO6 C;  1FBS A;  1G3T A;  4Q48 A;  3Q5F A;  2AS5 F;  1LDD A;  2CO5 A;  1JHH A;  2HTJ A;  2V6C A;  2AXL A;  1WRJ A;  2K27 A;  1XDS A;  3LST A;  3ABU A;  4AIJ A;  2CQK A;  2XAJ A;  2DU9 A;  4XBF A;  1XGN A;  4A6E A;  1BI3 A;  3RI4 A;  1J2X A;  4JBA A;  1IF1 A;  5LRR A;  5D4S A;  3DFG A;  3B02 A;  1QZY A;  2D1H A;  4YG2 F;  5HDN A;  3MZH A;  2VE8 A;  3GO5 A;  4HV5 A;  3HUG A;  2VC1 A;  2UXN A;  2LNB A;  4YFK F;  3LQQ A;  3F8M A;  1I6X A;  4HX7 A;  2ETH A;  1FYL A;  5L3C A;  1TNT A;  2FF4 A;  4E70 A;  1BIB A;  1I1G A;  2HOE A;  2G7H A;  2ZBK A;  4O3M A;  4OOI A;  4WX9 A;  3LA2 A;  3HOT A;  1LJ9 A;  1Z6R A;  2MLK A;  1DPR A;  1P4A A;  3HRM A;  5DYM A;  2PI0 A;  5HLI A;  3ZP5 A;  1O7L A;  4FX4 A;  3FXQ A;  4EMS A;  2FMY A;  1UB9 A;  1TW3 A;  1EH7 A;  4HYE A;  4KIB A;  4N0B A;  1L3L A;  1J59 A;  4G7Z F;  5L3B A;  3F6O A;  4HLX A;  4ASN A;  3I59 B;  3VB2 A;  4F7Z A;  2OZ6 A;  2HYG D;  1RNL A;  3TOB A;  3GFM A;  3RJP A;  4ENM A;  4HW0 A;  2UWM A;  3F8F A;  3EDP A;  3TDZ C;  5E17 F;  2RQP A;  3WTW C;  1QBJ A;  4R8H A;  4A5N A;  5K5R A;  3ELK A;  3FM5 A;  3R4K A;  1Z7U A;  2HR3 A;  1Z1D A;  3QU3 A;  1JGS A;  3TKY A;  2H6B A;  1QZZ A;  3P9I A;  2F2E A;  3QRF F;  3HIF A;  2W84 A;  3RKX A;  2P8T A;  4KFC A;  5HDG A;  4U88 A;  4H0E A;  4WCG A;  5FFX A;  2EV6 A;  3J7A O;  3AAF A;  2CSO A;  5E8G A;  4ZH4 F;  1MJA A;  1TQI A;  3WTS C;  4TV7 A;  3DKW A;  4EQQ A; 
#chains in the Genus database with same CATH topology
 2M45 A;  3K4B A;  1J5Y A;  3MKZ A;  1XGS A;  5KK1 A;  2QBY A;  3GTK J;  2L9S A;  3IWF A;  3CC7 I;  3C7J A;  2F4O B;  2MH2 A;  3KIO A;  2KZV A;  4ZZL A;  3HTS B;  3LSR A;  3MAJ A;  1R00 A;  4LIU A;  5JHU A;  1IN6 A;  4BXX J;  1SMT A;  1IW7 F;  3J7A Y;  4M72 A;  2NOJ B;  1DUX C;  4OIO F;  4A3J J;  4EV0 A;  2RGV A;  3QQA A;  1GT0 C;  3CUQ C;  4QPQ A;  5EYR A;  2IPQ X;  1K6O A;  1XS9 A;  4ON0 A;  2GAU A;  3PUF A;  5DCF A;  3H9Q A;  2BY2 A;  1FYK A;  1UHW A;  4O6J A;  2IAI A;  3ECH A;  5EG0 A;  3S1M J;  2DTR A;  2HQR A;  4LLL A;  1YO5 C;  2QLZ A;  5HS7 A;  4HF2 A;  5HNH A;  3FBI B;  3WTU C;  3LSP A;  4L18 B;  1YE9 A;  1SVL A;  2DOA A;  4XK4 A;  1GV2 A;  2X6Y A;  1BI2 A;  3CJN A;  2XRO A;  3JTH A;  3O6B B;  2MA3 A;  1BL0 A;  2H1K A;  2WA0 A;  1OR7 A;  1TTY A;  3BC8 A;  4JOM A;  4L5I A;  2GM4 A;  5ICC A;  1A6Q A;  2NVT J;  4KT6 A;  5E79 C;  2P7V B;  4KUM A;  2HU9 A;  5BMZ A;  1EH6 A;  3M8F A;  3GTL J;  1YG2 A;  2DQR A;  2RVC A;  3BP8 A;  3FHN A;  2UZK A;  2FBK A;  4KIG A;  4KJZ A;  4M6Y A;  5BOX A;  1IRZ A;  1WZ2 A;  2COB A;  4BHC A;  3GTM J;  2XAG A;  1R1T A;  4U0V A;  1ZR4 A;  3I9V 2;  4L9N A;  4XL9 A;  2WY7 Q;  3F9K A;  4RGU A;  1JXS A;  3WGH A;  3ZQI A;  5J1Y A;  3ZXS A;  4AIH A;  2KRH A;  3QWL A;  3H1C A;  3GUD A;  1GV5 A;  2IEK A;  3CC2 I;  1Z7L A;  2DA1 A;  3HL2 A;  2Y75 A;  3M4O J;  3PSI A;  1UHM A;  2P6S A;  1GXP A;  1RR7 A;  3JRH A;  2YR2 A;  2HVQ A;  4B4C A;  2JQ7 A;  1R5I D;  4A2U A;  2N8G A;  3L09 A;  3H5N A;  3S8P A;  4HNV A;  3GVA A;  4B43 A;  4CYC B;  3MZY A;  1DP7 P;  3F23 A;  4F91 B;  2ZNZ A;  1V4R A;  3OL3 A;  1Y1W J;  4BQA A;  2EA2 A;  1HW2 A;  2DBB A;  3ZQ7 A;  5KVR A;  2ZNY A;  5D8L B;  2R7X A;  2PLY A;  4G7O F;  2LBF A;  4IHW A;  1ZYR F;  1O57 A;  3M7G A;  1RES A;  2F5C A;  5ICF A;  3VWB A;  4UB6 C;  4AM3 A;  1HQC A;  2CG4 A;  2EQR A;  3ESW B;  2H8W A;  2GZW A;  3FX3 A;  5JLX A;  2R3S A;  4BKX A;  5FB2 A;  4V19 K;  4K2E A;  1AWC A;  1U5T B;  2VPR A;  4DNC A;  4ZDO A;  4LB5 A;  4EGY A;  2XAS A;  3K7A J;  4NNJ A;  3S3O A;  3H9G A;  4FAS D;  3TOA A;  2ZSI B;  1K83 J;  4NQW B;  5EJC A;  3PL8 A;  2V1N A;  3CZ6 A;  3CCJ I;  1BM9 A;  2L02 A;  1I39 A;  3TO9 A;  3K6G A;  3RYR A;  3H0D A;  5FLX Z;  5LFA A;  1GVD A;  4LGW A;  3KEY A;  1SFU A;  2DT6 A;  1TW2 A;  5IYB J;  1DGW Y;  2VJ4 A;  1A5J A;  3IL2 A;  2HI3 A;  3ZR8 X;  4ZYE A;  4PJ0 C;  2TDX A;  3S1R J;  2HFH A;  3HKZ N;  4CCK A;  2RQQ A;  1QO0 D;  2HXO A;  3RZO J;  4A3C J;  4L9T A;  1JJ8 C;  2CV2 A;  2EZL A;  1CF7 A;  4JX4 A;  1MDM A;  2R5Z B;  1YRN A;  4P9U A;  3CTA A;  2KJC A;  3BPX A;  3KZI C;  4U0W A;  4DOZ A;  1UZC A;  4Y3O A;  2X1D A;  3S93 A;  3JR9 A;  1WH7 A;  3GME A;  2W1O A;  3DLL F;  2VLA A;  2IS1 A;  3QPT A;  1UMQ A;  4YEL A;  4G8X A;  1R58 A;  3S2D J;  3ZQG A;  2D1V A;  5GAE J;  4CGZ A;  2JJ7 A;  1FLI A;  2LMD A;  2Q8K A;  2MC3 A;  4XLE A;  1JKQ C;  1S29 A;  2MLG A;  2OQR A;  3H0G J;  2EH3 A;  4UUS B;  2GLO A;  1ZR2 A;  1V5G A;  2E71 A;  3O8H A;  5M5W J;  3A2K A;  3CD6 I;  3K2A A;  3QPL A;  5FLV A;  5H6Q A;  1R36 A;  2L0K A;  4IX7 A;  3CCY A;  3CDI A;  3HC7 A;  3HBL A;  2JA5 J;  1M1E B;  1ON1 A;  2JA8 J;  3I58 A;  2FX0 A;  4NC8 A;  1I3A A;  4DBQ A;  5F1R A;  1XD7 A;  3UKG A;  1WSU A;  2Q1Z B;  2PX9 A;  5HNF A;  1FYM A;  1Z3Y A;  2OAZ A;  2M8E A;  1ETK A;  4J01 A;  4D9J A;  3NEU A;  4B48 A;  1D5V A;  2AHQ A;  2GA2 A;  1VQ5 I;  2Y0M A;  2G9W A;  3I3L A;  1MZB A;  2DJN A;  2JT1 A;  1JUM A;  4DQ2 A;  2ESN A;  1MMD A;  3MKW B;  3HOS A;  3CMY A;  2VPL A;  3H5R A;  1OCR H;  4HF1 A;  1OKR A;  3BG5 A;  4ETS A;  1S3J A;  2QBY B;  3K2Z A;  4MGR A;  4PFO A;  4MFD A;  1QPI A;  1TWF J;  2XHK A;  1MJ9 A;  2FE3 A;  2DT5 A;  2XSJ C;  3QP5 A;  4BNC A;  5M3M J;  3I4N J;  4XMY A;  1O3S A;  3GEZ A;  5HDK A;  4ZDL A;  5AON A;  3EUK L;  3O2P E;  1N77 A;  1WJB A;  2GOX B;  5LD2 C;  2ZME B;  1TP4 A;  4EM2 A;  1RUO A;  3WTX C;  4RB1 A;  3OYF A;  3JRC A;  2ELH A;  1MBG A;  1D0X A;  1T8I A;  3LWF A;  2RAE A;  4G94 A;  4OIQ F;  3DCF A;  3KP7 A;  3DU6 A;  1Y6I A;  3OYA A;  3JAM K;  3HSE A;  2L7M P;  3DQV C;  4L5J A;  3KYL A;  3IAS 2;  3E6C C;  4UUT A;  1E17 A;  3BY6 A;  2DMP A;  1K6Y A;  4YFN F;  2V1D A;  4ZZD A;  4I01 A;  3KP6 A;  1QZE A;  2DOE A;  4DBR A;  3CCR I;  2P5V A;  2I8D A;  3FXL A;  3KYD B;  4OAY A;  4I2O A;  4PJJ A;  5GAG J;  3QOE A;  3K0L A;  1IN7 A;  5IY5 H;  4NHJ A;  1T39 A;  1J75 A;  3WE2 A;  3OS2 A;  2Z2S B;  2F5E A;  4YFX F;  1Z6T A;  4HEA 2;  4M3D A;  4UXN A;  4RS8 A;  5LHI A;  2PN6 A;  5B66 C;  3NAR A;  1F4K A;  2CV1 A;  1T98 A;  4CCO A;  2HQA A;  3IHU A;  3RPQ A;  3SEQ A;  3BG6 A;  1G6N A;  2M9H A;  3QYF A;  3WE3 A;  4PJN A;  3CQZ J;  1TZL A;  2QKL B;  3A01 A;  2FBI A;  1OLT A;  3OYJ A;  2EFW A;  3LA7 A;  2VOP A;  4M9Z A;  1Z0X A;  2CFO A;  4Y15 A;  3TP0 A;  2PJR B;  5CQE A;  3OS0 A;  2Z16 A;  4JQF A;  4M3E A;  1FOW A;  4GYG A;  1EKE A;  3J81 Z;  2QCO A;  2MH9 A;  4JK1 X;  4NB5 A;  3OYC A;  2L3D A;  2H27 A;  2EZK A;  3O8G A;  5DEQ A;  3BTJ A;  5ILU A;  3B6A A;  3OL4 A;  3MMY B;  4IQJ A;  2K9S A;  2H1L A;  4IJA A;  1ZGW A;  2L5Q A;  3ROU A;  1HLV A;  4I98 B;  1LFB A;  4B3A A;  5ILV A;  2L7K A;  3AG1 H;  1TWH J;  4GO1 A;  5DDG A;  3OWT A;  5IYC J;  3ONQ A;  3CJQ B;  2W25 A;  1XMK A;  1ETV A;  2BHY A;  5KNL A;  3W2A A;  1A6I A;  2JTV A;  4Y4R A;  3DPU A;  4NUB A;  3QPH A;  5ILS A;  2E1O A;  3RCO A;  3F8C A;  4DYC A;  1JE8 A;  4MFE A;  5F0F A;  3L7W A;  2R5Y B;  1YI2 I;  1OYI A;  2JPB A;  2VN2 A;  2CMP A;  2XV4 S;  2L4A A;  3I59 A;  1YQA A;  1YS7 A;  1ACI A;  1FOX A;  1Y8R B;  1IZ1 A;  3VYT B;  4AYB N;  4XLC A;  1D3Y A;  2K9Q A;  1Z67 A;  4Z2Y A;  2LKS A;  1FOK A;  1YS6 A;  1MBK A;  2NVX J;  5JFR A;  2GIZ A;  3PSF A;  4HF0 A;  3ZMS A;  5BPI A;  4XR6 A;  4C2M J;  3VOE A;  4BBR J;  4PSW A;  1YX3 A;  2O6G E;  4AU7 A;  1GDT A;  5BQT A;  3OV8 A;  4OIR F;  2QUF A;  1VF9 A;  4CZZ A;  1LPQ A;  5HOD A;  1SAU A;  3HG9 A;  2OUM A;  3RPU D;  1UEL B;  2W4S A;  5D5U B;  1LVA A;  3VYS B;  4BAY A;  3FIS A;  5LEK A;  1VQL I;  4N4N B;  2HKX A;  2OC6 A;  2ZKZ A;  2A61 A;  1A36 A;  1RPW A;  3F0C A;  3N97 A;  4XSZ F;  4LG3 A;  2V6E A;  4HAM A;  1ZQ3 P;  3SYT A;  5H20 A;  3KX2 A;  1FOY A;  3TO6 A;  2V79 A;  1T95 A;  1T38 A;  2QQ9 A;  1JUP A;  5ICE A;  2EIL H;  1BN5 A;  5EGO A;  3HEF A;  1RC9 A;  1WKM A;  2NXN B;  3H9J A;  2DDB A;  3R0A A;  2XF6 A;  4IVN A;  1WJE A;  5IT3 A;  3OYB A;  2DLL A;  2W85 A;  3FXJ A;  1I6H J;  2MAB A;  4N4O B;  2NS7 A;  4U7B A;  4G6Q A;  4MTD A;  2QVO A;  2VB6 A;  3DXJ F;  2LRE A;  5HLG A;  1HST A;  1T0F A;  4ZYA A;  5HS8 A;  3V8L A;  3Q0U A;  3WG9 A;  2GXG A;  2M3A A;  5IT9 Z;  4LOC A;  1OYW A;  5D4R A;  1SFK A;  2PG4 A;  1ON2 A;  2HPI A;  1TLH B;  3IRR A;  3LNQ A;  1JHF A;  4ENJ A;  1FEX A;  2Y9Y A;  3ML6 A;  5E3O A;  2ZXI A;  1R71 A;  2NS0 A;  1IAW A;  2R7V A;  4B3X A;  4XLP F;  2FOW A;  1VQ9 I;  5GTH C;  3HSF A;  1L0O C;  2PQ8 A;  1IGN A;  2Y69 H;  2A5W A;  5FKL A;  3RKY A;  2W57 A;  1KU2 A;  3H36 A;  4MTE A;  1RKW A;  2P4W A;  3PO2 J;  2CU7 A;  3V7S A;  2XPV A;  5EZH A;  3V7R A;  3TMO A;  3BDD A;  3B73 A;  2DA6 A;  4HNU A;  1BC7 C;  3OIQ A;  3U2R A;  1SD6 A;  2OV7 A;  4D5C A;  4J19 A;  4IQ4 A;  5K5O A;  2XAH A;  1YJN I;  5FFZ A;  3LFK A;  4XQF A;  2IJL A;  1IN8 A;  1LNW A;  3KE2 A;  1ZEL A;  5KAF C;  2Q2E B;  4MHG A;  5DD4 A;  2OF7 A;  5TJJ A;  2QM3 A;  1FSE A;  3CF5 F;  2VI6 A;  5B1B H;  2Y9Z A;  3HSR A;  2DQL A;  4CCN A;  1SD4 A;  2JA7 J;  4PDK A;  3JCU C;  2BXZ A;  4LK0 F;  3SHF A;  4QWQ A;  5H6R A;  1ZG3 A;  3PQK A;  2FSW A;  3RIR A;  1W36 D;  4C2T A;  1U2W A;  4W1U A;  3CMM A;  5LEJ A;  1NH3 A;  2HXI A;  1GHC A;  2DA4 A;  1Z77 A;  2VIX A;  2LOO A;  2W7N A;  4QSH A;  1HA8 A;  1XMA A;  5L3G A;  4MEY F;  1ZRC A;  2DYS H;  5JLW A;  4LG0 B;  5DS9 A;  2CS3 A;  3REO A;  4BJ6 C;  3WTT C;  1K4T A;  3CP8 A;  4A3F J;  4I02 A;  2CUE A;  2BYV E;  3CME I;  3OSG A;  4G9Y A;  1MBF A;  1DGR M;  2JZY A;  2DK8 A;  1FBQ A;  2BOL A;  1XPX A;  1K79 A;  3LSK A;  4WXH A;  3L2W A;  4O5V A;  4CYC A;  3HRT A;  2ZXJ A;  1K61 A;  5IYD J;  1CGP A;  3M8J A;  5E3M A;  2C6Y A;  4DZJ A;  3ZPL A;  3HPH A;  4EJU A;  3SXY A;  1G8X A;  2EZH A;  2JRM A;  1Q1H A;  1ZLJ A;  2HVS A;  4RDU A;  4F3Q A;  1LEA A;  2K4B A;  2HKO A;  1Y39 A;  1DDN A;  1T56 A;  3DTK A;  1U5T A;  1SVM A;  1TQM A;  3G1O A;  3CCE I;  2LY1 A;  4Q47 A;  2DK5 A;  2LKP A;  4U7D A;  1NTC A;  2DYR H;  2CWE A;  1O3R A;  4NQW A;  4D5F A;  4C30 A;  1YW8 A;  3H3U A;  4XN0 A;  5IOZ A;  4I0B A;  3COA C;  1S72 I;  2KIM A;  2JUC A;  3SZT A;  2KFD A;  5F0C A;  2EFP A;  2XF5 A;  4RB3 C;  4B44 A;  2XB0 X;  3PM1 A;  1YJW I;  3TED A;  3GTO J;  5FKK A;  4GCV A;  3BTL A;  3I54 A;  4D7M A;  4D0P A;  2JA2 A;  3QYE A;  4BS9 A;  4L0Y B;  4MNU A;  1HOM A;  2GBY A;  1SEU A;  1V5F A;  5HVQ C;  2MGQ A;  2AXT C;  2VQG A;  2QWW A;  1S7E A;  2LVS A;  4AC0 A;  4CDG A;  1ZGA A;  4KIF A;  2RV8 A;  4B47 A;  2R5Z A;  3I64 A;  1VZ0 A;  2R7Q A;  2OJE D;  2F5F A;  2DW4 A;  4CCM A;  1ULY A;  3ZN1 A;  2O5R A;  3FDY A;  2V9P A;  5M5X J;  1OMI A;  3ZGK A;  1ITY A;  2PMZ N;  1RET A;  3C2H A;  2HZD A;  3RKQ A;  2VOD A;  3V42 A;  1MMS A;  4UUS A;  2YU3 A;  3FIW A;  1P7J A;  2NOG A;  3UNG C;  1RR8 C;  2DFI A;  4I7H A;  4S0H B;  1B1B A;  2KLO A;  3RQ4 A;  1RUN A;  1A04 A;  4M3F A;  1SMY F;  2CV0 A;  2Y0S A;  2YX7 A;  1O3Q A;  2ISY A;  4UVA A;  1R4M B;  2IW5 A;  1SAX A;  5FLX K;  4CYD A;  2UXX A;  4M6X A;  2KKO A;  3RYP A;  2K40 A;  2KPM A;  3BTC A;  2STW A;  3K9T A;  3R60 A;  3EYI A;  2Y31 A;  3I0T A;  2D2W A;  3HYI A;  3DEU A;  1YTY A;  1D8K A;  1XMX A;  3OOP A;  2DMQ A;  1X3W B;  2XGX A;  1N75 A;  2XRN A;  5E1X A;  3S2W A;  3K70 C;  3E97 A;  4HZF A;  3C18 A;  3LL7 A;  5J47 A;  1IN4 A;  3FMQ A;  1S7O A;  3GFJ A;  1U8R A;  3WG7 H;  4DYR A;  3J7Y J;  1QU3 A;  3TBI A;  1ZRE A;  4NBQ A;  4BY1 J;  4EJT A;  1E0E A;  3J7Z I;  2P0W A;  5M5Y J;  2DI3 A;  2ME6 A;  3PNY A;  3L2V A;  2ZME A;  4WWC A;  2CQ7 A;  3JRE A;  2R7R A;  4FTH A;  1V5E A;  1ZH5 A;  2EPF A;  3VSL A;  4BQN A;  1E3P A;  2V9V A;  3KLO A;  3GX4 X;  1WHU A;  3FXM A;  1KON A;  2DTZ A;  3U1K A;  1OYY A;  2R7D A;  1B8I B;  3ASO H;  2E5Z A;  2VL8 A;  3BR6 A;  3DKY A;  4KIC A;  2L7Z A;  3DBH B;  1PJR A;  1XCV A;  2KIF A;  3E6D A;  4PGG A;  3OYK A;  1YW9 A;  2M87 A;  3QOP A;  2DAO A;  4HA8 A;  2J5P A;  2HTS A;  5HLH A;  2GXB A;  2I5U A;  2DPU A;  1X1P A;  3VEP A;  3I56 I;  4Z6Y A;  4ZYD A;  3CCM I;  2ZXW H;  4HQM A;  3FMR A;  2D45 A;  2IT0 A;  3HHH A;  3P5J A;  4OWR B;  1QVU A;  5DM6 F;  3VPR A;  3CLQ A;  2E1M C;  3KFW X;  2WBM A;  3ZQQ A;  4IHT A;  1TWC J;  4XRF A;  4MQV A;  1XSD A;  1E3O C;  2PJP A;  4PCQ A;  3IP4 B;  2FML A;  1XB4 A;  2F4M B;  4DIQ A;  3KP5 A;  3S3M A;  1QHH D;  3CLO A;  1SAN A;  2K85 A;  2RC4 A;  3FBN B;  1PUF B;  2RNG A;  4A3M J;  3FKI J;  3PUB A;  2KQR A;  4ITV A;  3I5U A;  1H0M A;  1TNS A;  4CSW A;  2PJR A;  2W48 A;  3BQZ A;  4HV6 A;  4MQ9 F;  3I53 A;  2WB1 N;  5LBQ A;  2O0Y A;  4D1Q A;  2EA4 A;  1FNN A;  4RLF A;  1JUS A;  4PUS A;  1BIA A;  2RKH A;  3HRU A;  3ZMV A;  5JI6 A;  4UB8 C;  4KA4 A;  4HLY A;  2XGE A;  1MNE A;  4PZJ A;  2XSD C;  4BEH B;  2QSG X;  3GW2 A;  5CVV A;  3VYR B;  4N9H A;  2XRL A;  2QQB A;  3DLA A;  3PJR A;  2LC2 A;  3Q9S A;  2VQL A;  3EUH A;  4RAG A;  4BQQ A;  2Z1D A;  4EJW A;  4Y7N J;  4X0G A;  1AU7 A;  4XN3 A;  3HXL A;  3E3V A;  1OIS A;  2KRC A;  3ZQL A;  3BLY A;  2ZO4 A;  3GCM A;  1NG7 A;  2DPD A;  2IS6 A;  3I55 I;  4ANJ A;  2VXD A;  2QGU A;  2R5Y A;  4IHX A;  5K1Y A;  3IV5 A;  3KCC A;  1WH5 A;  2HVR A;  1HW1 A;  3ZMZ A;  3K69 A;  4BQO A;  3HOZ J;  2QF7 A;  2EIK H;  4BBS J;  5E1Z B;  1D0Z A;  5DCM B;  3IC7 A;  3W6K B;  2CW0 F;  5AIQ A;  1SFO J;  3KEO A;  3AL0 B;  3E5Q A;  3G71 I;  3RDI A;  2O61 A;  1MND A;  3BR5 A;  2EK5 A;  4CH7 A;  1V55 H;  4YIF A;  2WAE A;  1B9N A;  3E0J B;  1IXC A;  1JKR C;  3I4P A;  2F48 A;  2LY9 A;  4IL6 C;  2GA1 A;  3O3K A;  5F0H A;  2O9L A;  3PIP F;  2ZXH A;  3JRF A;  4IHY A;  1F1Z A;  4BDZ A;  1BA5 A;  3TW7 A;  1O4X A;  2CW8 A;  1FBU A;  3DPL C;  5J8F A;  1KQ8 A;  1KGS A;  4P55 A;  5LLQ A;  2E2I J;  2FBH A;  3F3X A;  3GYH X;  3C3W A;  3FZV A;  1A31 A;  2R7U A;  2QQA A;  2EBI A;  4G7H F;  2ID6 A;  3RPU A;  3FXK A;  2ZC2 A;  3S15 J;  1LFU P;  3LAP A;  1JT6 A;  1YIO A;  5FKO A;  4DYQ A;  2L7F P;  2OTJ I;  3KZY A;  1LVK A;  4A0X A;  3K1P A;  1D8J A;  1RI7 A;  1J9I A;  3WU0 A;  1ZN2 A;  4IF4 A;  1H88 C;  1X19 A;  3S32 A;  1V3F A;  3BG9 A;  2FA5 A;  3SEZ A;  1EV7 A;  1P4X A;  4LLN A;  3ABK H;  3S3N A;  3E6M A;  2K9L A;  1B4A A;  3M07 A;  5DV5 A;  1FT9 A;  3GLX A;  1FZP B;  2OBP A;  2ZJP F;  3DV8 A;  4LLG F;  4IPA A;  3GXO A;  5BS6 A;  4M71 A;  1K7A A;  3U21 A;  3GTP J;  2A5Y B;  2RN7 A;  1ZG5 A;  2FD5 A;  5D6F A;  5D8K B;  4Q5S F;  2JVH A;  1FC3 A;  5HS9 A;  2WV0 A;  2CYY A;  2OTL I;  1R22 A;  4ESF A;  2BXY A;  2BGC A;  1MKM A;  1YHQ I;  4PGH A;  3EET A;  3NQO A;  1X58 A;  2FXA A;  2XIG A;  3D1N I;  4UHT A;  3S14 J;  2JK3 A;  5EZG A;  4AD9 A;  2X51 A;  2DA3 A;  3NWS A;  1B59 A;  1TWG J;  3CDH A;  2WAQ N;  1ONV A;  2WAF A;  3L9F A;  3ZMD A;  3S16 J;  3LA3 A;  2K5C A;  4II3 A;  4AUX A;  2KJB A;  3QPS A;  4IHS A;  3ABT A;  3Q9V A;  2BBY A;  2J5O A;  1BBY A;  2BE5 F;  1WJC A;  1BOA A;  1KU7 A;  1QQI A;  2YPR A;  3FKJ A;  3K10 A;  2XPU A;  2AQE A;  1S7A A;  3EQL F;  3CCS I;  2PBI A;  5ERI A;  2W82 A;  1H9T A;  4PJM A;  1HKS A;  3KET A;  4A3B J;  2FNP A;  1QVT A;  5D5V B;  1WJA A;  3MZ8 A;  2Q2E A;  5GTI C;  4LB6 B;  3V7C A;  2OA4 A;  1TC3 C;  4X6A J;  2IVM A;  3D5S C;  1Y0U A;  3HTU A;  4CXF A;  2ZCW A;  5JR3 A;  4RAZ A;  5F6F A;  1ZG1 A;  1QPM A;  4KIT B;  1FWZ A;  2OZU A;  4ZTF A;  2E1N A;  4IRI A;  1POG A;  1JTX A;  1SFE A;  1XSX A;  5LHH A;  4KNY A;  1F9N A;  5IT9 K;  2IRF G;  1S5L C;  1IN5 A;  2E7X A;  4A3I J;  2PEX A;  4LG0 A;  3KP4 A;  4Y17 A;  4Y13 A;  2H8R A;  2XAF A;  2EIN H;  4RA2 A;  1U0J A;  3OR2 C;  3CCV I;  2CQQ A;  5GPC A;  2XF7 A;  2A69 F;  2YX4 A;  1JGG A;  3I71 A;  2XGD A;  3SJM A;  4A3K J;  2CFX A;  3L00 A;  3U1D A;  1HKT A;  4YII A;  4EM1 A;  3FK6 A;  1BW6 A;  1R6R A;  2DMU A;  3CCQ I;  4UNO A;  1U8B A;  2STT A;  1STZ A;  3T5X A;  5B1A H;  1ZTR A;  2JUG A;  4I09 A;  4ZJZ A;  1W7P D;  1XCB A;  5E18 F;  4M6V A;  2VBW A;  5FRM A;  5LGN A;  2F6C A;  1Z9C A;  3C1D A;  4OIP F;  4DZP A;  2IS4 A;  1G3S A;  2DT7 B;  3HDD A;  5FRN A;  2M1B A;  4U0Y A;  1W7P B;  4PSX A;  3IWZ A;  1U3E M;  1I3Q J;  1TWA J;  3GWZ A;  2O3F A;  4FIS A;  2KP6 A;  1FPQ A;  4F93 B;  5F64 A;  5K7H A;  1KQ0 A;  2EIM H;  1IDY A;  2MC4 A;  4RGS A;  3LMM A;  4KN4 X;  4HST A;  2ESH A;  3N4M A;  4R1H A;  1B6A A;  1WGX A;  2F4I A;  3K1N A;  1D1A A;  3F8B A;  5EEG A;  2M7A A;  2XKO A;  1RZ4 A;  4RBO A;  3E1S A;  1HF0 A;  3KPH A;  3GFI A;  2GQQ A;  1P6R A;  1VQO I;  4E7S A;  2HPM A;  2XPW A;  1G2H A;  1MH3 A;  4IKF A;  1FX7 A;  2BW3 B;  1REP C;  4BYY A;  4DJA A;  1E2X A;  4ESJ A;  1VQ4 I;  2M2E A;  2KRF A;  3T8R A;  5E8I A;  1R4N B;  2E60 A;  1MBH A;  4KYW A;  3Q0V A;  3BT9 A;  4ENN A;  1XGM A;  3GLL A;  4FCY A;  2HDW A;  2DFH A;  3VFZ A;  2ADU A;  1XC5 A;  2FOK A;  3H92 A;  1F36 A;  3JSO A;  4ENK A;  2LKX A;  4XLA A;  3MWM A;  4B1R A;  5C4X J;  2JSC A;  5IP9 J;  3L2C A;  3GTG J;  4ZC3 A;  3BG3 A;  1MMA A;  1MGT A;  4N9I A;  5A2Q Z;  2LD5 A;  2EV5 A;  4AVP A;  2A68 F;  1QGP A;  2OQG A;  2XUB A;  3CMA I;  4RLQ A;  4C3I J;  2BY1 A;  3MD2 A;  3F72 A;  4Y52 J;  2E35 A;  2A07 F;  1NG6 A;  4MEX F;  3CUQ B;  2VKE A;  5HLT A;  1I50 J;  4F52 A;  2Y48 A;  2JN6 A;  3PIO F;  2P5K A;  4EGZ A;  1TL8 A;  1X1A A;  5M3F J;  4BGD A;  2DO7 A;  2V9K A;  3L1P A;  4BDY A;  3DF8 A;  2L9V A;  1J0R A;  3FM3 A;  2TRT A;  2DCE A;  2G7U A;  5CVJ A;  5CYV A;  1TBX A;  3JRB A;  4RAY A;  2DOF A;  1AOY A;  3OIO A;  2VKD A;  3D5L A;  4UV9 A;  5E20 A;  2M7B A;  4GXO A;  2DFE A;  2EV0 A;  2VKH A;  4A93 J;  1WVR A;  1EF4 A;  2OCC H;  1IXS B;  1XN7 A;  2M0M A;  4XID A;  4BE2 A;  1FP1 D;  1HDP A;  1ORK A;  4M74 A;  1OCC H;  1SD5 A;  1MSF C;  3BPV A;  4I0A A;  4MIM A;  4E7J A;  1ZLK A;  1B8I A;  4E7Z A;  2E1M B;  2L2O A;  4HSR A;  1A35 A;  1WCM J;  3WGI A;  2KIQ A;  2X6X A;  1NK2 P;  4OU0 A;  5TGT A;  3GZ5 A;  2HOS A;  3A0H C;  2R0Q C;  3V8J A;  2P6T A;  5FLM J;  1ZAO A;  2ZFU A;  1OPC A;  2F5D A;  1PYV A;  2B7E A;  2COM A;  1PUE E;  3TW6 A;  4KT5 C;  4HDV A;  4RB2 C;  1PP7 U;  1W1W E;  2LTP A;  3ABL H;  3E6B A;  3IKT A;  1FTZ A;  2A6H F;  2FUG 2;  2O7O A;  4L0Z B;  3HOY J;  3RTR A;  2VON A;  3CP2 A;  1HXD A;  1X1D A;  4ABZ A;  2XB5 A;  3B6C A;  1IC8 A;  1W4M A;  1VQM I;  5JVT A;  1S9H A;  3OYN A;  2DOD A;  1LFP A;  1Q1V A;  3TL4 X;  1PUF A;  2E34 A;  2VBX A;  4XKC A;  5IPA A;  4L9J A;  4RGR A;  1I1S A;  2IA1 A;  2V7F A;  5ICG A;  4II2 A;  1FJL A;  2EFO A;  1G3W A;  1Z05 A;  3LAJ A;  3GTQ J;  3ZQF A;  1WI3 A;  3MKL A;  1K78 B;  3RKW A;  3HKZ A;  4PK4 A;  1IO2 A;  2UUZ A;  3WU1 B;  1FSH A;  3OYD A;  3WHB A;  4XRS G;  5GP9 A;  1RRJ A;  1ZHF A;  3DPT A;  2ZFW A;  1WFX A;  5HOO A;  1U78 A;  4BEH A;  1K4S A;  4RB0 A;  4A3E J;  1S8N A;  2X4H A;  4CIC A;  1U9O A;  1W5C C;  1OR7 C;  2H6C A;  2VQC A;  2MBF A;  3KP3 A;  2PFB A;  3KZZ A;  2P5L C;  4BXU A;  5KAI C;  2M34 A;  4MLO A;  1DP3 A;  1AHD P;  2ELK A;  4HOB A;  2M5W A;  3OOU A;  4AWX B;  3T0Y A;  3LSH A;  2HYJ A;  2WTE A;  4G6D A;  5DD8 A;  4PFP A;  5EDN A;  3FWE A;  5ED4 A;  3A1Y A;  5DCM A;  3R6S A;  4C3H J;  3F22 A;  2LG4 A;  3QAH A;  1UJ8 A;  3FF5 A;  5GAH J;  1X3U A;  4XOP A;  3K4K A;  3OS1 A;  1Z91 A;  9ANT A;  1YW7 A;  2A3S A;  3ASN H;  2ID3 A;  3HZJ A;  1D1C A;  2Z99 A;  1OCZ H;  1BC8 C;  3AKZ A;  2JVG A;  4LMY A;  2CQN A;  4FT8 A;  4LFU A;  4HNT A;  1I5Z A;  3HHG A;  5J6X A;  2Q0O A;  2R7T A;  3E5U A;  2L54 A;  3T8T A;  1IRG A;  4F55 A;  2BV6 A;  4A0Z A;  1G3Y A;  3AFH A;  3SZP A;  2VQH A;  4WF2 A;  1B72 B;  1BI1 A;  4HX4 A;  3JRD A;  4BY7 J;  3TGN A;  3J80 Z;  1LDJ A;  4ZDP A;  3ZOB A;  3WGG A;  3OY9 A;  3T1B A;  1OJL A;  2QZ8 A;  5C3E J;  2M0C A;  2E2J J;  2XAQ A;  3SQN A;  1BI0 A;  1P4W A;  1C0W A;  1KU3 A;  3KLN A;  4E4H A;  2L01 A;  1VQK I;  5KHD A;  1USS A;  1X1C A;  3ZN0 A;  1EH8 A;  2A6E F;  1JTY A;  3AG2 H;  1PP8 F;  2OU2 A;  2MG4 A;  1G59 A;  2Y2Z A;  3K4C A;  1H9G A;  2XVC A;  3HRS A;  3AG4 H;  1RKT A;  3AG3 H;  2O03 A;  2HZT A;  2K86 A;  4MO7 A;  1QA6 A;  4D7N A;  3K4L A;  4YIR X;  3ISP A;  3MFK A;  1FIP A;  5BPD A;  3F21 A;  2YSR A;  1B9M A;  3WHC A;  5CVR A;  3VSK A;  4ESB A;  1Z21 A;  1HCR A;  2LFB A;  1MJB A;  4QIW N;  1WI9 A;  2VAS A;  1VQ8 I;  2CUF A;  1W5S A;  2LRD A;  2R7S A;  4WXD A;  4JYK A;  2X48 A;  3LSG A;  4NDL A;  4XIC A;  1KYW A;  4A12 A;  2LK2 A;  1BR1 A;  3A0B C;  3M3Y J;  2EWN A;  1ZRF A;  2NAZ A;  4CZC A;  3HPG A;  4LD5 A;  2E1C A;  2LF7 A;  2L9R A;  5J40 A;  5DUK A;  2QQ8 A;  2KL4 A;  3FXR A;  2Z3Y A;  3VYU B;  3TP3 A;  2DFF A;  3BWG A;  2DA5 A;  2NNN A;  2V1X A;  2WWY A;  4QPO A;  1GVJ A;  4YRV A;  3OYL A;  4XLN F;  3L2Q A;  2VBY A;  5D5W B;  3L2R A;  1YOV B;  3CUO A;  1IDZ A;  5CLS A;  4EAT A;  3PFI A;  4X1E A;  3MVP A;  5TRD A;  1P2F A;  3DWL E;  2X9D A;  4HQE A;  4IRG A;  5CPR B;  3UR3 C;  5BNG A;  2ISZ A;  1QRY A;  2LSO A;  4IHV A;  5IOY A;  1APL C;  2K02 A;  1X2M A;  3E5X A;  5J3L A;  1NHA A;  1ODD A;  3BCA A;  5KCM A;  3U9G A;  3ECO A;  1LKX A;  2KZG A;  4XSX F;  3RQI A;  4BJ5 C;  2LP0 A;  4HPQ A;  3CCL I;  4BHB A;  4AYB A;  1GUU A;  2MYS A;  2DMN A;  2M30 A;  1T08 B;  1MMN A;  4BU2 A;  1IV6 A;  2R93 J;  3SDG A;  1TQP A;  2NVU B;  3OYE A;  3HM5 A;  2R7Z J;  2MD0 A;  1YIT I;  5L3F A;  5B3S H;  2HYF A;  2QKM B;  2QA4 I;  4M3G A;  3IUO A;  4XKV A;  3TQN A;  1J7K A;  3JTG A;  3HUG B;  2K7L A;  1XX5 A;  3H5A A;  3F8N A;  1F5T A;  2KIU A;  1WQ2 A;  2KDZ A;  1OCP A;  3OYG A;  1UG0 A;  2VUM J;  5D5X B;  4V2G A;  2YS9 A;  2E5N A;  3S1Q J;  1IRX A;  1QNT A;  2RDP A;  4IXA A;  3BZ6 A;  3VDX A;  2I10 A;  5IP7 J;  4EVI A;  1W5T A;  2DA7 A;  5FO5 A;  3G73 A;  1G4D A;  2L4M A;  2IA0 A;  3IKV A;  2LYC A;  4FE4 A;  3K4M A;  3SDB A;  3GZ6 A;  2FEZ A;  4ZYG A;  1ETQ A;  1HBX G;  3QP6 A;  3WTY C;  2Z33 A;  2VJJ A;  1GXQ A;  2IGM A;  1VI0 A;  3HJE A;  1AA7 A;  1R7J A;  1YLF A;  4B09 A;  1AKH B;  1W7P A;  2IP2 A;  1DPU A;  3V4G A;  2GXA A;  1YFH A;  1UCR A;  2FRH A;  2V1U A;  2IA2 A;  2OD5 A;  3A02 A;  3ZCO A;  1W36 C;  2VC0 A;  1X2N A;  2OCE A;  2VT3 A;  3DU5 A;  3Q3S A;  4RM2 A;  2ZJR F;  2ECB A;  3CES A;  4LIV A;  1HKQ A;  2OPT A;  1E3H A;  3GZN B;  4XOT A;  1OQY A;  2E2H J;  2H94 A;  2O8X A;  1T33 A;  3KP2 A;  4WXC A;  4IZZ A;  4A3G J;  4UVC A;  2AQF A;  1XTA A;  2NYX A;  3BJO A;  3LQR A;  1FIA A;  2HOT A;  3HOV J;  4M9X A;  4V2F A;  4A0Y A;  3H3V K;  2BY3 A;  1BJZ A;  2LDU A;  4W97 A;  3J81 K;  2BW3 A;  4IEJ A;  4HG2 A;  2R4G A;  4XON A;  2W24 A;  4HX8 A;  3G6E I;  3R0J A;  3JRI A;  4FET A;  1DU0 A;  2D5V A;  3WOD F;  3P9C A;  1DQU A;  2QSH X;  4XLF A;  3MEX A;  3BR2 A;  2DXI A;  3Q0W A;  2X1E A;  3BJA A;  3KEQ A;  2HQ5 A;  4UUV A;  4E7I A;  4KDP A;  3P9K A;  4M73 A;  4AVZ A;  3LSI A;  3QYB A;  1LQ1 A;  2R92 J;  4BE0 A;  4HBL A;  6PAX A;  5GAD J;  5J4Y A;  2E19 A;  5J1R A;  3BZC A;  4NC6 A;  2K3P A;  1UG2 A;  2JWT A;  3S2H J;  3P7N A;  2ECC A;  4AIK A;  3CF2 A;  3SFZ A;  4OMY A;  1WJD A;  2CUJ A;  5J1U A;  5L3E A;  4XRM A;  4CO8 A;  2EJR A;  1LEB A;  1N25 A;  4P1W A;  2O8K A;  1D0Y A;  1LE8 B;  5AIP A;  1R49 A;  4U87 A;  2IGN A;  3R61 A;  4LJZ F;  1SD7 A;  4H4K C;  4QLC U;  3C2G A;  5CJ9 A;  1VQ6 I;  1TT0 A;  1WPK A;  2W00 A;  3OYH A;  3CUQ A;  2PMH A;  4A5M A;  2FQ3 A;  4CCJ A;  2A6T A;  1VFC A;  4EEF G;  2IGO A;  3JSP A;  2CRG A;  3GTJ J;  4XKW A;  4S04 A;  2K3F A;  1VTN C;  1VQ7 I;  1JI8 A;  2BHZ A;  2ZSH B;  1YIJ I;  4XOR A;  5FKN A;  2X6O A;  3G3Z A;  3ZRG A;  3HOW J;  4C2U A;  4IO9 F;  2GOM A;  2LF8 A;  3NRV A;  2FU4 A;  1HW5 A;  1P7I A;  5JHF A;  1BR2 A;  1ZKG A;  3D0S A;  2JSP A;  3TO7 A;  4FHT A;  2QEX I;  4A6D A;  1XG1 A;  1WJ5 A;  4OIN F;  3OYI A;  2R7F A;  1RIO H;  2E7W A;  3PNV A;  3DEE A;  2F5V A;  4KIS A;  3MQ0 A;  2VE9 A;  1BW5 A;  4R79 A;  4B8X A;  2X0L A;  1FY7 A;  2BEO A;  1EA3 A;  3W6V A;  5CVI A;  4FX0 A;  5LGU A;  5TIS C;  2EB7 A;  2HNH A;  4Y33 A;  1CQT A;  3K1M A;  3HGG A;  3M9A A;  5LHG A;  2K9M A;  2K9N A;  3QU6 A;  3HOU J;  1KQ9 A;  1R5H A;  2VXZ A;  5DTD A;  3VOD A;  3W2V A;  3CJT B;  5A2Q K;  1KYZ A;  2HS5 A;  4NC7 A;  1MH4 A;  2QEN A;  5FKM A;  1H8A C;  2JRT A;  2VKV A;  4P5O A;  4A69 C;  2K4J A;  1FMV A;  4BHP A;  5CQG A;  1HSJ A;  3GFL A;  1R1V A;  3OR1 C;  1FTT A;  1XGO A;  5FD5 A;  5EEA A;  1MSE C;  4BAC A;  1T0F C;  5EG0 B;  2DDA A;  2TCT A;  2WV1 A;  1FP2 A;  3FXO A;  5E1W A;  2ZJ2 A;  4P9F A;  1ETY A;  3PO3 J;  2M4K A;  4FQG A;  2RRE A;  2CW7 A;  5LGT A;  3DKX A;  1R1U A;  3DP7 A;  2ACJ A;  1IG7 A;  3ABM H;  3KYC B;  3FMS A;  1W0T A;  2B0L A;  1OCT C;  1D1B A;  1P9Q C;  2HGC A;  2Y0S N;  3BR1 A;  2NNY A;  1YYV A;  1K78 A;  1UFM A;  4LIT A;  4FE7 A;  3ZMU A;  5LRS A;  3MKY B;  1UHS A;  2GWR A;  1N78 A;  3WU2 C;  4E6K G;  2HEO A;  3BOQ A;  3TDU C;  2DA2 A;  3H3Z A;  2NVY J;  2DJI A;  4RM3 A;  5D6E A;  1KA8 A;  1XSV A;  2KIS A;  4LK1 F;  5CVU A;  5K5Q A;  2JA6 J;  1TT5 B;  2HQN A;  3GF2 A;  1MD0 A;  4A3D J;  3E7L A;  1SFX A;  1EJ9 A;  2MD5 A;  2PMZ A;  3MCZ A;  1T6S A;  5B5E C;  4G12 A;  4S05 A;  3M8E A;  4L5E A;  5E3N A;  3DTE A;  4Q4Z F;  3OMY A;  1MW7 A;  4KN7 X;  2MW8 A;  3EPZ A;  1MNM C;  2EFN A;  1J09 A;  2VBZ A;  5F04 A;  4BL0 B;  3FXU A;  2BVL A;  4JX5 A;  3FHZ A;  2FNA A;  3DBL B;  4WK8 F;  4EJO A;  2P7C B;  2CUZ A;  3DEW A;  3K4N A;  2HDC A;  1ZK8 A;  1ETW A;  1IUY A;  2LBF B;  2RNJ A;  4F92 B;  1KU9 A;  2IXS A;  1KZH A;  3MN2 A;  3SZG A;  2LLK A;  2A05 A;  2QSF X;  1ENH A;  1PVE A;  3G4S I;  3V8K A;  1R9T J;  3IAM 2;  3W6J B;  1UST A;  1YJ9 I;  1JT0 A;  2XKP A;  3ZMT A;  2X6W A;  1BR4 A;  3IH4 A;  3JW4 A;  3PQJ A;  1I27 A;  2WC2 A;  3IH2 A;  2IGK A;  1BJA A;  1WWX A;  4CHU A;  1B72 A;  4IRH A;  2JPC A;  2ME0 A;  2Y30 A;  3ERM A;  1X1B A;  4BJT A;  3RSN A;  4GGG A;  1ZRD A;  2EIJ H;  2KT0 A;  5FRO A;  1ZAR A;  5J8C A;  3L2U A;  2NRA C;  4GYI A;  1U5T C;  4JP0 A;  4P96 A;  4HDU A;  3IRQ A;  5DUI A;  1V54 H;  4OAZ A;  4RGX A;  1NK3 P;  2VT2 A;  1O7F A;  4KMF A;  1IJW C;  2XAU A;  3G1M A;  4JX6 A;  5IP6 A;  1O3T A;  3ULQ B;  1IRF A;  4RAF A;  3HOX J;  5K7F A;  4I76 A;  4OMZ A;  2EFQ A;  2B9S A;  1D5Y A;  3WTV C;  1VQP I;  3AL0 C;  3K70 D;  5FD6 A;  2BVM A;  1CF7 B;  1LUJ B;  1MDM B;  4E7H A;  1YRN B;  2VOO A;  4KMU X;  4L9V A;  3ERE D;  2NS8 A;  1MBJ A;  2HWV A;  1R5G A;  4EM0 B;  1T2K A;  4C3J J;  2H09 A;  3BJ6 A;  3WTZ A;  3CCU I;  1LDK B;  2CQX A;  2WAD A;  4UVB A;  4HRI A;  5GPA A;  3W2W A;  1S6L A;  2QYO A;  1U6G A;  1PDN C;  2BY0 A;  1W0U A;  4IOA F;  1Y0N A;  3BRO A;  1JJ6 C;  2Z5U A;  1R23 A;  1LB2 A;  4EJV A;  1WJF A;  3JAM Z;  5C4J J;  2CGP A;  3M1E A;  2R7W A;  2ELJ A;  3CO7 C;  5L3D A;  4ZTJ A;  2KDO A;  4UV8 A;  2PMU A;  3CJR B;  5EEH A;  3NAU A;  4BH9 A;  1UAA A;  1XDU A;  1IXR C;  1X4P A;  2WB1 A;  3H35 A;  3BTI A;  5FGM A;  3J80 K;  3BR0 A;  2XC7 A;  2Z9O A;  1P92 A;  4DW6 A;  1X3Z B;  3F6V A;  1ZGJ A;  5F1J A;  4M9S A;  3BR3 A;  4DGW B;  3JRG A;  1ERD A;  1VQN I;  2ZB9 A;  3EYY A;  2YU9 J;  1MIJ A;  1GLN A;  2GIV A;  4ZYH A;  3CO6 C;  2DN0 A;  3BG7 A;  1FBS A;  1G3T A;  3PFY A;  2FQ4 A;  2IS2 A;  4Q48 A;  3Q5F A;  2AS5 F;  1LDD A;  2CO5 A;  3RZD J;  1JHH A;  1BOB A;  2JMW A;  2X1C A;  2FJ1 A;  3QOD A;  5K7Z A;  2ZJQ F;  3G1L A;  3BCB A;  2HTJ A;  2V6C A;  2AXL A;  1WRJ A;  3EUA A;  1U9N A;  4BXF A;  2BZT A;  5F08 A;  4CA0 A;  3FK7 A;  2K27 A;  2G0E A;  1XDS A;  3LST A;  3ABU A;  4BUP A;  3S1N J;  5EF6 A;  4AIJ A;  5F27 A;  2CQK A;  2XAJ A;  2LR8 A;  2DU9 A;  4I6Z A;  4XBF A;  1Y8Q B;  2CH0 A;  1XGN A;  4A6E A;  1BI3 A;  3OSF A;  3RI4 A;  2LY2 A;  5FJ8 J;  3I4M J;  1J2X A;  4JBA A;  1IF1 A;  5LRR A;  3N05 A;  5D4S A;  4I99 C;  3DFG A;  3B02 A;  1QZY A;  2D1H A;  2ZME C;  4YG2 F;  5HDN A;  1HC8 A;  3MZH A;  2VE8 A;  4CUG A;  3LOC A;  3A4C A;  3GO5 A;  2MFZ A;  2M8G X;  1Z3X A;  4HV5 A;  3HUG A;  4M3B A;  2VC1 A;  3C2B A;  1OCO H;  1Y56 A;  2UXN A;  2LNB A;  4YFK F;  3LQQ A;  3PNT A;  3F8M A;  3A03 A;  1I6X A;  3HGY A;  3HB9 A;  4HX7 A;  2CJJ A;  2ETH A;  4YEJ A;  1OFC X;  2R7O A;  4CCL A;  1FYL A;  5L3C A;  2NVQ J;  3DTI A;  1TNT A;  2FF4 A;  3S17 J;  3W3C A;  4E70 A;  1BIB A;  1I1G A;  1MBE A;  2EZI A;  2HOE A;  5C44 J;  2G7H A;  3IH3 A;  1YX5 A;  2ZBK A;  1SVO A;  3A01 B;  4O3M A;  4OOI A;  3GBG A;  5JVG F;  2VJI A;  4WX9 A;  3D5R C;  3LA2 A;  2B63 J;  1SC7 A;  1IUF A;  4BE1 A;  3HOT A;  1LJ9 A;  1AKH A;  1Z6R A;  3X2Q H;  4J00 A;  1VND A;  5CKT A;  2YUS A;  4QTR A;  1F43 A;  2MLK A;  2HDD A;  3LSM A;  4GFB A;  2XGC A;  1DPR A;  1P4A A;  3HRM A;  5DYM A;  3DBR B;  2KHM A;  3JRA A;  2PI0 A;  5HLI A;  3ZP5 A;  4IOC F;  1O7L A;  4FX4 A;  2M4G A;  1JKO C;  2IBD A;  3FXQ A;  3NWT A;  2KMU A;  4XNF A;  4EMS A;  3ZQC A;  2FMY A;  4UY8 I;  3M1C A;  3BZK A;  1ETO A;  1UB9 A;  1TW3 A;  2VJ5 A;  2AO9 A;  1EH7 A;  4HYE A;  4KIB A;  4N0B A;  1FMW A;  1L3L A;  1J59 A;  2X85 A;  4G7Z F;  5L3B A;  3F6O A;  4HLX A;  4ASN A;  3I59 B;  4XKB A;  3VB2 A;  2V26 A;  3G2B A;  5J4V A;  3OIP A;  5DM7 F;  3EUH C;  1QHG A;  2WAQ A;  2P81 A;  2OZ6 A;  4F7Z A;  2HYG D;  1RNL A;  3TOB A;  3GFM A;  3RJP A;  4ENM A;  4E7L A;  4HW0 A;  2UWM A;  3F8F A;  1X4O A;  1IV8 A;  3EDP A;  3TDZ C;  2E36 A;  1H89 C;  5E17 F;  2HOA A;  2ICW G;  2RQP A;  3WTW C;  3K4J A;  1QBJ A;  3LSJ A;  2LH9 A;  3ZQH A;  4XLH A;  4R8H A;  4A3L J;  4A5N A;  5K5R A;  3ELK A;  1ETX A;  3FM5 A;  3R4K A;  4C9Y A;  1Z7U A;  2HR3 A;  3BQY A;  4G6T B;  1JKP C;  1LE8 A;  4XRS A;  1HDD C;  4AID A;  3LFU A;  1Z1D A;  5H2F C;  3QU3 A;  1JGS A;  1Y1V J;  3TKY A;  2H6B A;  1QZZ A;  2V4J C;  2MSY A;  3P9I A;  4GDF A;  4RMN A;  4GRI A;  2F2E A;  3QRF F;  3HIF A;  2DMT A;  2W84 A;  3RKX A;  2P8T A;  2WY8 Q;  4KFC A;  5E3L A;  5HDG A;  4U88 A;  1DU6 A;  4H0E A;  2XDV A;  1MMG A;  4WCG A;  5FFX A;  3SFI A;  2EV6 A;  4E7K A;  2L9N A;  3J7A O;  4PJL A;  3CDL A;  3AAF A;  3CC4 I;  4XM3 A;  2CSO A;  2UV1 A;  5E8G A;  3OYM A;  4ZH4 F;  5EGO B;  1MJA A;  1TQI A;  4TV7 A;  3WTS C;  3DKW A;  4EQQ A; 
#chains in the Genus database with same CATH homology
 2M45 A;  1J5Y A;  1XGS A;  5KK1 A;  2QBY A;  3IWF A;  3C7J A;  2MH2 A;  4ZZL A;  3HTS B;  3MAJ A;  1R00 A;  5JHU A;  1IN6 A;  1SMT A;  1IW7 F;  4M72 A;  1DUX C;  4OIO F;  4EV0 A;  2RGV A;  3CUQ C;  2IPQ X;  1K6O A;  4ON0 A;  2GAU A;  5DCF A;  1FYK A;  1UHW A;  4O6J A;  3ECH A;  2DTR A;  2HQR A;  4LLL A;  1YO5 C;  2QLZ A;  5HS7 A;  4HF2 A;  3WTU C;  4L18 B;  1BI2 A;  3CJN A;  2XRO A;  3JTH A;  3O6B B;  2MA3 A;  1OR7 A;  1TTY A;  4L5I A;  5ICC A;  2P7V B;  4KUM A;  5BMZ A;  1EH6 A;  3M8F A;  1YG2 A;  2DQR A;  2RVC A;  3BP8 A;  2UZK A;  2FBK A;  4KIG A;  4M6Y A;  5BOX A;  4BHC A;  2XAG A;  1R1T A;  4U0V A;  4L9N A;  4RGU A;  1JXS A;  3WGH A;  4AIH A;  3GUD A;  2Y75 A;  1UHM A;  2P6S A;  1GXP A;  2YR2 A;  4A2U A;  3L09 A;  3GVA A;  3MZY A;  1DP7 P;  3F23 A;  2ZNZ A;  1V4R A;  4BQA A;  2EA2 A;  1HW2 A;  2DBB A;  3ZQ7 A;  5KVR A;  2ZNY A;  5D8L B;  2PLY A;  4G7O F;  1ZYR F;  1O57 A;  3M7G A;  2F5C A;  5ICF A;  1HQC A;  2CG4 A;  3FX3 A;  2GZW A;  5FB2 A;  2R3S A;  4K2E A;  1AWC A;  1U5T B;  4DNC A;  4LB5 A;  4EGY A;  2XAS A;  3TOA A;  1BM9 A;  2L02 A;  3TO9 A;  3RYR A;  5FLX Z;  4LGW A;  1SFU A;  1TW2 A;  3IL2 A;  4ZYE A;  2TDX A;  2HFH A;  1QO0 D;  4L9T A;  1CF7 A;  1MDM A;  4P9U A;  3CTA A;  2KJC A;  3BPX A;  4U0W A;  3QPT A;  4G8X A;  1R58 A;  2D1V A;  4CGZ A;  1FLI A;  2Q8K A;  2MC3 A;  1S29 A;  2MLG A;  2OQR A;  5H6Q A;  1R36 A;  1ON1 A;  3I58 A;  5F1R A;  1XD7 A;  1WSU A;  1FYM A;  2OAZ A;  2M8E A;  3NEU A;  1D5V A;  2GA2 A;  2Y0M A;  2G9W A;  1MZB A;  2JT1 A;  4DQ2 A;  2ESN A;  3HOS A;  4HF1 A;  1OKR A;  4ETS A;  1S3J A;  2QBY B;  3K2Z A;  4MGR A;  2XHK A;  1MJ9 A;  2FE3 A;  2DT5 A;  3QP5 A;  4BNC A;  1O3S A;  3GEZ A;  5HDK A;  5AON A;  3O2P E;  2ZME B;  1RUO A;  4EM2 A;  3WTX C;  4RB1 A;  2ELH A;  3LWF A;  4G94 A;  4OIQ F;  3KP7 A;  3JAM K;  3HSE A;  3DQV C;  4L5J A;  3E6C C;  1E17 A;  3BY6 A;  4ZZD A;  4YFN F;  2V1D A;  4I01 A;  3KP6 A;  2P5V A;  4I2O A;  3K0L A;  1IN7 A;  4NHJ A;  1T39 A;  1J75 A;  3WE2 A;  2F5E A;  4YFX F;  1Z6T A;  4UXN A;  4RS8 A;  5LHI A;  2PN6 A;  1F4K A;  1T98 A;  3IHU A;  3RPQ A;  1G6N A;  3WE3 A;  2FBI A;  2EFW A;  3LA7 A;  2VOP A;  4M9Z A;  4Y15 A;  4JQF A;  4GYG A;  3J81 Z;  2MH9 A;  4JK1 X;  4NB5 A;  2L3D A;  2H27 A;  5DEQ A;  5ILU A;  4IJA A;  3ROU A;  4I98 B;  5ILV A;  4GO1 A;  5DDG A;  2W25 A;  1XMK A;  2JTV A;  3QPH A;  5ILS A;  3F8C A;  1JE8 A;  3L7W A;  1OYI A;  2JPB A;  2VN2 A;  2XV4 S;  2L4A A;  3I59 A;  1YQA A;  1YS7 A;  1IZ1 A;  1D3Y A;  4Z2Y A;  1FOK A;  1YS6 A;  5JFR A;  4HF0 A;  3ZMS A;  5BPI A;  3VOE A;  2O6G E;  5BQT A;  3OV8 A;  4OIR F;  2QUF A;  4CZZ A;  5D5U B;  1LVA A;  4BAY A;  5LEK A;  2HKX A;  2ZKZ A;  2A61 A;  3N97 A;  4XSZ F;  4HAM A;  5H20 A;  3TO6 A;  2V79 A;  1T38 A;  2QQ9 A;  5ICE A;  1BN5 A;  1WKM A;  3R0A A;  4IVN A;  5IT3 A;  2DLL A;  2W85 A;  4U7B A;  4G6Q A;  4MTD A;  2QVO A;  3DXJ F;  5HLG A;  1HST A;  1T0F A;  5HS8 A;  3V8L A;  3WG9 A;  2GXG A;  5IT9 Z;  1OYW A;  5D4R A;  2PG4 A;  1ON2 A;  1TLH B;  3IRR A;  1JHF A;  4ENJ A;  3ML6 A;  2NS0 A;  1IAW A;  4XLP F;  3HSF A;  1L0O C;  2PQ8 A;  3RKY A;  2W57 A;  1KU2 A;  4MTE A;  2P4W A;  3V7S A;  3V7R A;  3BDD A;  3B73 A;  1BC7 C;  3U2R A;  1SD6 A;  5K5O A;  2XAH A;  5FFZ A;  3LFK A;  2IJL A;  1IN8 A;  1LNW A;  3KE2 A;  4MHG A;  5DD4 A;  5TJJ A;  2QM3 A;  1FSE A;  3HSR A;  2DQL A;  1SD4 A;  4PDK A;  4LK0 F;  3SHF A;  4QWQ A;  5H6R A;  1ZG3 A;  3PQK A;  2FSW A;  3RIR A;  1U2W A;  5LEJ A;  1GHC A;  1XMA A;  5L3G A;  4MEY F;  1ZRC A;  4LG0 B;  3REO A;  3WTT C;  4I02 A;  2BYV E;  4G9Y A;  2JZY A;  2DK8 A;  1FBQ A;  1K79 A;  4WXH A;  4O5V A;  3HRT A;  2ZXJ A;  1CGP A;  2C6Y A;  3ZPL A;  4EJU A;  3SXY A;  1Q1H A;  1ZLJ A;  1LEA A;  2K4B A;  2HKO A;  1DDN A;  1U5T A;  1TQM A;  4Q47 A;  2DK5 A;  2LKP A;  4U7D A;  2CWE A;  1O3R A;  4NQW A;  1YW8 A;  3H3U A;  4I0B A;  3COA C;  2KIM A;  3SZT A;  2EFP A;  4RB3 C;  4GCV A;  3I54 A;  4D0P A;  4L0Y B;  4MNU A;  5HVQ C;  2QWW A;  4CDG A;  1ZGA A;  4KIF A;  2RV8 A;  3I64 A;  2F5F A;  2DW4 A;  1ULY A;  3ZN1 A;  1OMI A;  2VOD A;  2YU3 A;  2DFI A;  4I7H A;  1B1B A;  1RUN A;  1A04 A;  1SMY F;  2YX7 A;  1O3Q A;  2ISY A;  4UVA A;  1SAX A;  2IW5 A;  5FLX K;  4CYD A;  2UXX A;  4M6X A;  2KKO A;  3RYP A;  2STW A;  3K9T A;  3R60 A;  3EYI A;  3I0T A;  2D2W A;  3HYI A;  3DEU A;  1YTY A;  1D8K A;  3OOP A;  2XGX A;  5E1X A;  2XRN A;  3S2W A;  3E97 A;  4HZF A;  3C18 A;  1IN4 A;  3FMQ A;  1S7O A;  3GFJ A;  1U8R A;  1ZRE A;  4EJT A;  2DI3 A;  2ZME A;  4WWC A;  1ZH5 A;  2V9V A;  3KLO A;  3GX4 X;  1OYY A;  2R7D A;  4KIC A;  1XCV A;  2KIF A;  3E6D A;  4PGG A;  1YW9 A;  2M87 A;  3QOP A;  2DAO A;  4HA8 A;  2J5P A;  2HTS A;  5HLH A;  2GXB A;  2DPU A;  3VEP A;  4ZYD A;  4HQM A;  3FMR A;  2D45 A;  2IT0 A;  3HHH A;  3KFW X;  4IHT A;  4XRF A;  4MQV A;  1XSD A;  2PJP A;  4PCQ A;  2FML A;  1XB4 A;  3KP5 A;  3CLO A;  2RC4 A;  3I5U A;  1H0M A;  1TNS A;  4HV6 A;  4MQ9 F;  3I53 A;  5LBQ A;  2O0Y A;  2EA4 A;  1FNN A;  1BIA A;  2RKH A;  3HRU A;  3ZMV A;  5JI6 A;  4KA4 A;  4HLY A;  4PZJ A;  3GW2 A;  5CVV A;  4N9H A;  2QQB A;  3Q9S A;  4EJW A;  3EUH A;  3E3V A;  2ZO4 A;  2DPD A;  5K1Y A;  3KCC A;  1HW1 A;  3ZMZ A;  3K69 A;  5E1Z B;  5DCM B;  3IC7 A;  3W6K B;  2CW0 F;  5AIQ A;  3KEO A;  3E5Q A;  3RDI A;  2O61 A;  2EK5 A;  4YIF A;  1B9N A;  1IXC A;  3I4P A;  2GA1 A;  3O3K A;  1F1Z A;  1FBU A;  3DPL C;  5J8F A;  1KQ8 A;  1KGS A;  4P55 A;  5LLQ A;  2FBH A;  3F3X A;  3GYH X;  3C3W A;  3FZV A;  2QQA A;  4G7H F;  3RPU A;  3LAP A;  1YIO A;  3KZY A;  4A0X A;  3K1P A;  1D8J A;  1RI7 A;  1J9I A;  3WU0 A;  1ZN2 A;  4IF4 A;  1V3F A;  2FA5 A;  1EV7 A;  1P4X A;  4LLN A;  3E6M A;  1B4A A;  5DV5 A;  1FT9 A;  3GLX A;  1FZP B;  2OBP A;  3DV8 A;  4LLG F;  4IPA A;  3GXO A;  5BS6 A;  4M71 A;  1K7A A;  2A5Y B;  2RN7 A;  1ZG5 A;  5D8K B;  5D6F A;  4Q5S F;  1FC3 A;  5HS9 A;  2WV0 A;  2CYY A;  1R22 A;  4ESF A;  2BGC A;  1MKM A;  4PGH A;  3EET A;  3NQO A;  2FXA A;  2XIG A;  4UHT A;  4AD9 A;  1B59 A;  3CDH A;  1ONV A;  3L9F A;  3ZMD A;  3LA3 A;  2KJB A;  4IHS A;  3ABT A;  3Q9V A;  2BBY A;  2J5O A;  1BBY A;  2BE5 F;  1BOA A;  1KU7 A;  1QQI A;  2YPR A;  1S7A A;  3EQL F;  2PBI A;  5ERI A;  1H9T A;  1HKS A;  3KET A;  2FNP A;  5D5V B;  2Q2E A;  4LB6 B;  3V7C A;  2OA4 A;  2IVM A;  3HTU A;  1Y0U A;  4CXF A;  2ZCW A;  5JR3 A;  4RAZ A;  5F6F A;  1ZG1 A;  1QPM A;  1FWZ A;  2OZU A;  2E1N A;  4IRI A;  1SFE A;  1XSX A;  5LHH A;  4KNY A;  1F9N A;  5IT9 K;  2IRF G;  1IN5 A;  2E7X A;  2PEX A;  4LG0 A;  3KP4 A;  4Y17 A;  4Y13 A;  2XAF A;  2A69 F;  2YX4 A;  3I71 A;  2CFX A;  3L00 A;  3U1D A;  1HKT A;  4YII A;  4EM1 A;  4UNO A;  2STT A;  1STZ A;  3T5X A;  4I09 A;  1W7P D;  1XCB A;  5E18 F;  2VBW A;  5LGN A;  1Z9C A;  3C1D A;  4OIP F;  1G3S A;  2M1B A;  4U0Y A;  1W7P B;  3IWZ A;  1U3E M;  3GWZ A;  2O3F A;  1FPQ A;  5F64 A;  1KQ0 A;  4RGS A;  4KN4 X;  2ESH A;  3N4M A;  4R1H A;  1B6A A;  3K1N A;  3F8B A;  5EEG A;  2XKO A;  1RZ4 A;  3GFI A;  2GQQ A;  1P6R A;  1FX7 A;  1REP C;  4BYY A;  1E2X A;  4ESJ A;  2KRF A;  3T8R A;  5E8I A;  4KYW A;  4ENN A;  1XGM A;  3VFZ A;  2ADU A;  2FOK A;  3H92 A;  3JSO A;  4ENK A;  3MWM A;  2JSC A;  3L2C A;  1MGT A;  4N9I A;  5A2Q Z;  2EV5 A;  4AVP A;  2A68 F;  1QGP A;  2OQG A;  2XUB A;  3F72 A;  2A07 F;  4MEX F;  3CUQ B;  2Y48 A;  2P5K A;  4EGZ A;  2DO7 A;  3DF8 A;  1J0R A;  3FM3 A;  2G7U A;  5CVJ A;  5CYV A;  1TBX A;  4RAY A;  1AOY A;  3D5L A;  4UV9 A;  5E20 A;  4GXO A;  2EV0 A;  1IXS B;  1XN7 A;  1FP1 D;  4M74 A;  1SD5 A;  3BPV A;  4I0A A;  1ZLK A;  3WGI A;  4OU0 A;  3GZ5 A;  3V8J A;  2P6T A;  1ZAO A;  1OPC A;  2F5D A;  2COM A;  1PUE E;  4KT5 C;  4HDV A;  4RB2 C;  1PP7 U;  3E6B A;  3IKT A;  2A6H F;  4L0Z B;  3RTR A;  2VON A;  1HXD A;  1W4M A;  5JVT A;  2VBX A;  4L9J A;  4RGR A;  1I1S A;  2IA1 A;  5ICG A;  2EFO A;  1G3W A;  1Z05 A;  3LAJ A;  1K78 B;  3RKW A;  3WU1 B;  1FSH A;  1ZHF A;  3DPT A;  2ZFW A;  5HOO A;  1U78 A;  4RB0 A;  1S8N A;  2X4H A;  4CIC A;  2H6C A;  2MBF A;  3KP3 A;  2PFB A;  2P5L C;  3KZZ A;  4BXU A;  4HOB A;  2M5W A;  4AWX B;  3T0Y A;  2WTE A;  4G6D A;  5DD8 A;  3FWE A;  5ED4 A;  5DCM A;  3R6S A;  3F22 A;  3QAH A;  3FF5 A;  1X3U A;  1Z91 A;  1YW7 A;  2A3S A;  2Z99 A;  1BC8 C;  4LMY A;  4FT8 A;  4LFU A;  1I5Z A;  3HHG A;  5J6X A;  2Q0O A;  3E5U A;  2L54 A;  3T8T A;  1IRG A;  2BV6 A;  4A0Z A;  1G3Y A;  3SZP A;  4WF2 A;  1BI1 A;  4HX4 A;  3TGN A;  3J80 Z;  1LDJ A;  3WGG A;  3T1B A;  2QZ8 A;  2XAQ A;  3SQN A;  1BI0 A;  1P4W A;  1C0W A;  1KU3 A;  3KLN A;  2L01 A;  1USS A;  3ZN0 A;  1EH8 A;  2A6E F;  1PP8 F;  2OU2 A;  1H9G A;  2XVC A;  3HRS A;  2O03 A;  2HZT A;  2K86 A;  3ISP A;  3MFK A;  5BPD A;  3F21 A;  2YSR A;  1B9M A;  5CVR A;  4ESB A;  1MJB A;  1WI9 A;  1W5S A;  4WXD A;  1KYW A;  4A12 A;  2EWN A;  1ZRF A;  2NAZ A;  4LD5 A;  2E1C A;  2LF7 A;  5DUK A;  3FXR A;  2Z3Y A;  3BWG A;  2NNN A;  2V1X A;  2WWY A;  1GVJ A;  4XLN F;  2VBY A;  5D5W B;  3CUO A;  5CLS A;  3PFI A;  5TRD A;  1P2F A;  4HQE A;  4IRG A;  2ISZ A;  2LSO A;  2K02 A;  3E5X A;  1NHA A;  1ODD A;  3U9G A;  3ECO A;  4XSX F;  4BHB A;  2M30 A;  1TQP A;  5L3F A;  2HYF A;  3TQN A;  1J7K A;  3JTG A;  2K7L A;  3F8N A;  1F5T A;  2KIU A;  1WQ2 A;  5D5X B;  1QNT A;  2RDP A;  4IXA A;  3BZ6 A;  4EVI A;  1W5T A;  5FO5 A;  3G73 A;  1G4D A;  2L4M A;  2IA0 A;  3IKV A;  3GZ6 A;  2FEZ A;  4ZYG A;  1HBX G;  3QP6 A;  3WTY C;  2Z33 A;  1GXQ A;  1R7J A;  1YLF A;  4B09 A;  1W7P A;  2IP2 A;  1DPU A;  3V4G A;  1YFH A;  1UCR A;  2FRH A;  2V1U A;  2IA2 A;  2OD5 A;  2VC0 A;  2VT3 A;  1HKQ A;  2H94 A;  2O8X A;  3KP2 A;  4WXC A;  4UVC A;  2NYX A;  3BJO A;  3LQR A;  4M9X A;  4A0Y A;  2LDU A;  3J81 K;  2W24 A;  4HX8 A;  3R0J A;  3WOD F;  3P9C A;  3MEX A;  3BJA A;  3KEQ A;  4UUV A;  4KDP A;  3P9K A;  4M73 A;  1LQ1 A;  4HBL A;  6PAX A;  3P7N A;  4AIK A;  4OMY A;  3SFZ A;  5L3E A;  4CO8 A;  2EJR A;  1LEB A;  5AIP A;  3R61 A;  4LJZ F;  1SD7 A;  4QLC U;  5CJ9 A;  3CUQ A;  2PMH A;  4A5M A;  2FQ3 A;  3JSP A;  4S04 A;  1VTN C;  3G3Z A;  2LF8 A;  3NRV A;  2FU4 A;  1HW5 A;  3D0S A;  3TO7 A;  4FHT A;  4A6D A;  4OIN F;  2R7F A;  1RIO H;  2E7W A;  3MQ0 A;  2VE9 A;  4R79 A;  4B8X A;  2X0L A;  1FY7 A;  2BEO A;  5CVI A;  4FX0 A;  5LGU A;  2EB7 A;  3K1M A;  3M9A A;  5LHG A;  3QU6 A;  1KQ9 A;  1R5H A;  2VXZ A;  5A2Q K;  3VOD A;  1KYZ A;  2HS5 A;  2QEN A;  2JRT A;  4P5O A;  2K4J A;  4BHP A;  1HSJ A;  3GFL A;  1R1V A;  1XGO A;  5FD5 A;  1FP2 A;  5E1W A;  2ZJ2 A;  4P9F A;  5LGT A;  1R1U A;  3DP7 A;  2ACJ A;  3FMS A;  2B0L A;  2HGC A;  2NNY A;  1YYV A;  1K78 A;  1UFM A;  3ZMU A;  5LRS A;  2GWR A;  2HEO A;  3BOQ A;  3TDU C;  3H3Z A;  5D6E A;  1KA8 A;  1XSV A;  4LK1 F;  5CVU A;  5K5Q A;  2HQN A;  3GF2 A;  1MD0 A;  1SFX A;  2MD5 A;  3MCZ A;  1T6S A;  4S05 A;  3M8E A;  4Q4Z F;  4KN7 X;  2EFN A;  2VBZ A;  3FXU A;  3FHZ A;  2FNA A;  4WK8 F;  4EJO A;  2P7C B;  2HDC A;  1IUY A;  2RNJ A;  1KU9 A;  3V8K A;  3W6J B;  1UST A;  2XKP A;  3ZMT A;  3JW4 A;  3PQJ A;  1I27 A;  2WC2 A;  1BJA A;  1WWX A;  4CHU A;  4IRH A;  2JPC A;  4GGG A;  1ZRD A;  1ZAR A;  5J8C A;  2NRA C;  4GYI A;  1U5T C;  4P96 A;  4HDU A;  3IRQ A;  5DUI A;  4RGX A;  2VT2 A;  1O7F A;  4KMF A;  1O3T A;  3ULQ B;  1IRF A;  4OMZ A;  2EFQ A;  3WTV C;  5FD6 A;  1CF7 B;  1MDM B;  2VOO A;  4KMU X;  4L9V A;  3ERE D;  2HWV A;  1R5G A;  4EM0 B;  1T2K A;  2H09 A;  3BJ6 A;  3WTZ A;  1LDK B;  4UVB A;  1S6L A;  2QYO A;  1U6G A;  1PDN C;  3BRO A;  2Z5U A;  1R23 A;  1LB2 A;  4EJV A;  3JAM Z;  2CGP A;  3M1E A;  3CO7 C;  5L3D A;  4UV8 A;  2PMU A;  5EEH A;  4BH9 A;  1XDU A;  1IXR C;  5FGM A;  3J80 K;  2Z9O A;  1P92 A;  3F6V A;  1ZGJ A;  4M9S A;  3EYY A;  2GIV A;  4ZYH A;  3CO6 C;  1FBS A;  1G3T A;  4Q48 A;  3Q5F A;  2AS5 F;  1LDD A;  2CO5 A;  1JHH A;  2HTJ A;  2V6C A;  2AXL A;  1WRJ A;  2K27 A;  1XDS A;  3LST A;  3ABU A;  4AIJ A;  2CQK A;  2XAJ A;  2DU9 A;  4XBF A;  1XGN A;  4A6E A;  1BI3 A;  3RI4 A;  1J2X A;  4JBA A;  1IF1 A;  5LRR A;  5D4S A;  3DFG A;  3B02 A;  1QZY A;  2D1H A;  4YG2 F;  5HDN A;  3MZH A;  2VE8 A;  3GO5 A;  4HV5 A;  3HUG A;  2VC1 A;  2UXN A;  2LNB A;  4YFK F;  3LQQ A;  3F8M A;  1I6X A;  4HX7 A;  2ETH A;  1FYL A;  5L3C A;  1TNT A;  2FF4 A;  4E70 A;  1BIB A;  1I1G A;  2HOE A;  2G7H A;  2ZBK A;  4O3M A;  4OOI A;  4WX9 A;  3LA2 A;  3HOT A;  1LJ9 A;  1Z6R A;  2MLK A;  1DPR A;  1P4A A;  3HRM A;  5DYM A;  2PI0 A;  5HLI A;  3ZP5 A;  1O7L A;  4FX4 A;  3FXQ A;  4EMS A;  2FMY A;  1UB9 A;  1TW3 A;  1EH7 A;  4HYE A;  4KIB A;  4N0B A;  1L3L A;  1J59 A;  4G7Z F;  5L3B A;  3F6O A;  4HLX A;  4ASN A;  3I59 B;  3VB2 A;  4F7Z A;  2OZ6 A;  2HYG D;  1RNL A;  3TOB A;  3GFM A;  3RJP A;  4ENM A;  4HW0 A;  2UWM A;  3F8F A;  3EDP A;  3TDZ C;  5E17 F;  2RQP A;  3WTW C;  1QBJ A;  4R8H A;  4A5N A;  5K5R A;  3ELK A;  3FM5 A;  3R4K A;  1Z7U A;  2HR3 A;  1Z1D A;  3QU3 A;  1JGS A;  3TKY A;  2H6B A;  1QZZ A;  3P9I A;  2F2E A;  3QRF F;  3HIF A;  2W84 A;  3RKX A;  2P8T A;  4KFC A;  5HDG A;  4U88 A;  4H0E A;  4WCG A;  5FFX A;  2EV6 A;  3J7A O;  3AAF A;  2CSO A;  5E8G A;  4ZH4 F;  1MJA A;  1TQI A;  3WTS C;  4TV7 A;  3DKW A;  4EQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...