4PZJA

1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
69
Chain Sequence
MLDFRVETFLTVRTMNYTRAAEELNITQPAVSQHIAHLERDYGVPLFAYRNKKLQLTDAGALLRDALST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LysR family
publication title 1.60 Angstrom resolution crystal structure of a transcriptional regulator of the LysR family from Eggerthella lenta DSM 2243
rcsb
source organism Eggerthella lenta
molecule tags Transcription
total genus 22
structure length 69
sequence length 70
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pzjA00
2RV8A 4GCVA 3T8RA 4BAYA 4HV5A 2IT0A 2ISYA 1OPCA 3E3VA 4XLNF 1GVJA 4R1HA 2HYGD 2P6TA 4I09A 3I59A 5ICGA 1STZA 2JSCA 1ON1A 3GZ5A 3BJOA 5JFRA 1W7PA 4EJVA 3J80K 3WODF 1MJ9A 1DDNA 4FHTA 3F3XA 1RIOH 5ICEA 3JAMZ 3JSPA 1ZYRF 5FD6A 3EQLF 1MDMA 2PFBA 3M1EA 4OMZA 2XIGA 3V7RA 3RKWA 5LRRA 5F64A 4LMYA 3HRSA 4JQFA 2AXLA 2VODA 1G3WA 2KJCA 2Z5UA 4A6EA 4L0ZB 2O8XA 2VN2A 2H94A 1TBXA 2XROA 4RGSA 4Y15A 1DP7P 1IXCA 5L3BA 2EFWA 1FP2A 2FXAA 1R1VA 1BIBA 2CFXA 5ERIA 4RB0A 2VE8A 1YTYA 1K79A 2JRTA 1L0OC 3HRUA 1YG2A 5DCFA 3GYHX 3BWGA 4TV7A 2DU9A 5AIPA 2NNYA 1LB2A 3I58A 1QZZA 1TQIA 1Q1HA 2W24A 3SFZA 2EFOA 4U88A 2Z99A 2J5OA 5JI6A 4XBFA 3TQNA 3WTZA 3ERED 3K0LA 2F5EA 1TW2A 3TOAA 4LK1F 3O6BB 2QENA 4MGRA 1D8JA 3ABUA 3WTTC 1SFEA 3KP7A 2KJBA 3QAHA 3WU1B 1IXSB 2A69F 3CUQC 1B59A 1XMKA 4M6YA 1WI9A 2XKPA 3RI4A 2F2EA 4Y17A 3KP5A 5D6EA 2IA0A 2K27A 2FMYA 2FMLA 1PP8F 3B73A 3P9CA 2YX4A 2AS5F 1EH8A 3V8KA 1J2XA 1ZN2A 3HSRA 1TW3A 4BYYA 5A2QZ 3QP6A 3M8FA 5L3FA 2OAZA 3S2WA 5FFZA 3FXQA 1O57A 2XAQA 5JR3A 1W4MA 3DEUA 2Z33A 3QU6A 4AIJA 2Y48A 3O3KA 3FX3A 3F72A 1ZARA 4HF1A 3H3UA 3V4GA 2DW4A 1P4XA 2NAZA 1FBSA 2UZKA 4G7ZF 4IPAA 4BNCA 1NHAA 1P4WA 4OINF 3QRFF 2G7HA 4LLLA 3DV8A 2FBKA 1SD4A 3ML6A 2HFHA 2EJRA 3BDDA 1TNSA 2P5VA 4G6QA 1D5VA 5IT9Z 3DKWA 4IHSA 2EWNA 4XSZF 2ZCWA 2MBFA 1YIOA 1I6XA 2ETHA 1FYMA 2H27A 5IT3A 1AWCA 3KFWX 2O03A 1R5HA 5E20A 4L9TA 2KIMA 4FX0A 5BOXA 3FHZA 2PEXA 3KZYA 3GO5A 1OMIA 4QLCU 3WE2A 1FC3A 3IKVA 4Q5SF 4IRGA 1C0WA 3FXRA 4GYIA 2HR3A 2VBYA 2XAFA 3I71A 4CICA 4DQ2A 2RDPA 3KLOA 2K4BA 5D6FA 3FZVA 1E2XA 3ZP5A 2DT5A 3EUHA 1JGSA 1T98A 4MHGA 5F6FA 1LEBA 2BV6A 1MJBA 2IA1A 3E6CC 2KIFA 3DFGA 2O0YA 1R36A 1R22A 3CTAA 3K9TA 2HTSA 2OZUA 5LGUA 2W84A 1I5ZA 3PQKA 3R6SA 1KQ9A 3FM3A 4RAYA 2FU4A 1ON2A 3N97A 3HSFA 2DFIA 5CLSA 1LDJA 2XGXA 5ICFA 1EV7A 4UUVA 4KN7X 2E7XA 4HLXA 1YFHA 1UB9A 1SD7A 2PN6A 1R5GA 3E5QA 5FLXZ 1YW7A 2MA3A 5ICCA 3ZN0A 1J7KA 4K2EA 2VT3A 3ZMVA 1SMTA 2M8EA 3V7SA 3WGHA 2XV4S 2Q0OA 1FNNA 1ZRCA 5HVQC 1YYVA 3AAFA 4ESBA 1KA8A 3BP8A 4ZZDA 2PQ8A 4A12A 3HRTA 1S7AA 2BE5F 3QPTA 1FYLA 3F22A 5HLGA 3F6OA 1UHWA 2QLZA 4EQQA 1FOKA 2V1DA 4N9HA 1I1SA 4A0YA 3FMRA 3F8FA 3K69A 1F1ZA 5E1WA 4YFNF 1JXSA 4G7OF 2LF8A 3SHFA 5H6RA 1IRGA 2L4AA 3CO6C 3J81K 5E18F 5D8LB 5KK1A 4OMYA 4HX7A 3CDHA 3L9FA 3C7JA 4M72A 3ZMTA 2RC4A 2EA4A 4BHBA 3D5LA 1IN7A 3GXOA 2V1UA 5TRDA 4P9FA 2XRNA 5AONA 1K7AA 2QWWA 2V79A 2RN7A 2IRFG 3HIFA 2EV0A 2X4HA 1I27A 1J9IA 1U6GA 5ILSA 2GXGA 3CUQA 2VC1A 4OIOF 4N0BA 2A61A 4UHTA 4KUMA 6PAXA 1U5TC 4WCGA 4RB2C 2PBIA 2VOOA 3REOA 4BXUA 2JT1A 5HDNA 4MQ9F 1W7PD 5TJJA 2WWYA 4P9UA 2OZ6A 2JPCA 1P92A 2P7VB 4RAZA 1DUXC 2YSRA 2DTRA 2HYFA 4KMUX 1ZLJA 3DQVC 3IWFA 1HSTA 1FWZA 3LSTA 3ELKA 1BI2A 1HSJA 1HKSA 3MCZA 2A6HF 2VXZA 4MEXF 4ESJA 3IRRA 4KNYA 5DEQA 1BN5A 4ENNA 4P96A 3EDPA 1R58A 1W5SA 4EJOA 4ZYEA 2OU2A 4WF2A 4KIGA 2XAJA 2P6SA 3KETA 2HGCA 1FT9A 4IXAA 2Q2EA 1BC8C 2FSWA 1OR7A 3I0TA 1KU3A 1PDNC 2COMA 4BH9A 1F9NA 2ZMEA 1KGSA 4U7BA 3WTYC 4BQAA 2IJLA 4LG0B 3BJAA 4KMFA 1SMYF 1XCVA 4DNCA 3FMSA 3RPUA 1IN8A 3RTRA 1BI3A 5E1ZB 5HLIA 4B8XA 4YG2F 2MH9A 1XN7A 3MFKA 4U0VA 1HQCA 1LVAA 4A5NA 2DQRA 3VODA 3KE2A 4M9XA 2QM3A 5BS6A 3E5UA 5LLQA 1W5TA 2EA2A 2P7CB 4S04A 2GA1A 5BQTA 5LEKA 1GHCA 4KA4A 5BPIA 2RNJA 3MZHA 3B02A 1R7JA 2O3FA 3N4MA 1UCRA 1HW1A 2QZ8A 2QBYA 4A2UA 1MKMA 4ZYHA 4ZZLA 3J81Z 2MC3A 5FO5A 4WWCA 4AD9A 1Z1DA 1SFXA 4AWXB 5HDKA 2VE9A 1V4RA 4MQVA 4EJTA 1BJAA 2ISZA 2MH2A 3LAPA 4M9SA 5E1XA 2K02A 4IJAA 5L3DA 3R60A 3KEOA 3F23A 4IHTA 1RI7A 3ECOA 2R7FA 3K2ZA 2JPBA 3O2PE 2PI0A 4WK8F 1K78B 3VFZA 3R0JA 2RGVA 1B9NA 2GA2A 4KIFA 3COAC 4ESFA 1UFMA 3T8TA 1XB4A 3JTHA 4KFCA 2IVMA 4KYWA 1MJAA 1YS7A 2XHKA 3OOPA 2PG4A 2DQLA 3F6VA 2HKXA 2P5KA 3L2CA 4CDGA 5D5UB 3GFLA 5JVTA 1SAXA 4I7HA 2OBPA 2CWEA 5HDGA 1RUOA 4PGGA 4OOIA 5K1YA 1XDUA 1F5TA 4BHPA 1CF7A 1O3RA 2KRFA 1P2FA 3R4KA 1HKTA 3Q9VA 2HTJA 3SZPA 1IF1A 1WWXA 2OQRA 2A68F 5L3GA 1LDKB 4HDVA 4ON0A 3ABTA 3I59B 4I0AA 4ASNA 1FSEA 3TO6A 3ULQB 3JTGA 2IPQX 1O7FA 1W7PB 4UVAA 3W6JB 3K1MA 1R1UA 1Z7UA 2KIUA 4HX8A 4ZYDA 4Q4ZF 4Q48A 5DCMA 4M9ZA 5LHGA 1MDMB 2WV0A 3KP2A 4O3MA 3M7GA 3HRMA 4Z2YA 3T0YA 2GZWA 3LA2A 3BROA 3GFJA 3KEQA 3PQJA 4H0EA 2XASA 1WQ2A 3BY6A 2PMUA 2CYYA 3HTSB 1ZGAA 5HS9A 4RS8A 2L02A 1S8NA 4HOBA 3K1NA 4L5IA 1TNTA 2IP2A 1PUEE 2HDCA 3J80Z 2EK5A 3IWZA 4G6DA 2MLKA 5F1RA 1WKMA 4LB5A 4ZH4F 5CVUA 4L5JA 2STTA 1IN6A 1P4AA 2PLYA 2UWMA 1U5TA 5H20A 1ZRFA 2HS5A 1HW5A 3WE3A 2GWRA 4EM2A 3EYYA 4HDUA 2D45A 2L54A 3GX4X 5JHUA 2ZBKA 3ROUA 2GXBA 5J8FA 2P5LC 3H3ZA 2E1NA 3LA7A 1WSUA 2XKOA 3RYPA 5KVRA 2QQAA 1BI0A 4CZZA 1XGOA 3MAJA 3TO7A 3GUDA 2G7UA 2M1BA 2FBIA 5J6XA 3ZMSA 1QNTA 3CLOA 4IF4A 1XDSA 4L9NA 2VC0A 2J5PA 1SD6A 3TKYA 2F5FA 3WGIA 4YFXF 4YFKF 1REPC 4AIHA 2GQQA 4WXHA 3U9GA 3DPLC 1XGNA 2RQPA 1FLIA 4OIPF 2HWVA 1U3EM 1XCBA 5DCMB 5D4SA 1KYZA 2C6YA 1BIAA 1HBXG 3KCCA 2ZJ2A 2L4MA 2DO7A 1L3LA 1J5YA 2F5DA 1S6LA 4GXOA 1BI1A 1VTNC 2A6EF 4HLYA 1TQPA 1LEAA 5CJ9A 4EGYA 5E17F 3HTUA 2V1XA 4OIRF 3V7CA 2CO5A 5DD8A 1XGSA 4ENMA 3MQ0A 5K5OA 2H6CA 3ZQ7A 4XLPF 3TOBA 2FBHA 2O61A 5HS8A 2DBBA 4YIFA 3JAMK 2HZTA 1G3TA 2EV6A 1FBUA 1ULYA 3KP6A 4EGZA 2DI3A 4MTDA 1ZG5A 3CJNA 1FYKA 1YO5C 3RKYA 2CQKA 2MD5A 2FNPA 1RNLA 1S29A 4HF0A 4M74A 5K5RA 2HKOA 1ZGJA 3MZYA 1FSHA 5DUKA 1ZAOA 3GFMA 4AIKA 3GZ6A 4FT8A 4G7HF 4N9IA 5L3EA 5LRSA 1RZ4A 3VB2A 4U0YA 2DK8A 1J59A 2QYOA 4UVBA 1JHFA 2NYXA 3HHHA 4PCQA 1Z91A 4XRFA 4KN4X 3J7AO 1EH6A 1YLFA 5D5XB 2G9WA 3LFKA 5ED4A 1X3UA 3EYIA 3FWEA 4KDPA 3GFIA 3TDZC 3C3WA 3VEPA 3GEZA 1IAWA 4L18B 5DDGA 1YQAA 2R7DA 2P8TA 1ZLKA 4CHUA 5CVJA 1KU7A 3P9IA 1KU9A 4I98B 3SQNA 2BBYA 1GXQA 1BC7C 2DPDA 2YPRA 4A6DA 4UV8A 4PZJA 4KIBA 2CG4A 5A2QK 2D1HA 2Y75A 2DPUA 4CXFA 1USSA 2FQ3A 1ZRDA 4IRHA 3U2RA 4I0BA 3I64A 5FFXA 2P4WA 4ZYGA 5DUIA 2B0LA 3IRQA 4XSXF 5CVRA 3ZMDA 2L01A 3IKTA 1HXDA 4CYDA 1G4DA 3BPVA 2LKPA 2VT2A 1IXRC 2X0LA 2JTVA 3LQQA 2PJPA 4M71A 4WXDA 3NRVA 3K1PA 3DF8A 4A0XA 4CGZA 4U7DA 4LLGF 5CYVA 3SZTA 3NEUA 4HA8A 1F4KA 5LGNA 4UVCA 3CO7C 1QZYA 2BGCA 4L9JA 4LJZF 1YW8A 2KKOA 5EEHA 2HEOA 2ELHA 4HW0A 4HQMA 1SD5A 1IZ1A 5D4RA 3IC7A 3E97A 3I53A 2M5WA 2A3SA 5IT9K 4ENKA 3R61A 2EV5A 4EJWA 1T2KA 1HW2A 1ZHFA 4EV0A 1YS6A 1MGTA 3D0SA 3R0AA 4LD5A 3WTSC 5D5WB 3I54A 2VOPA 4G9YA 2JZYA 5LEJA 4HQEA 3RYRA 4IVNA 2VBZA 4GYGA 2E1CA 1ZG1A 2XVCA 1T6SA 2QQBA 3F21A 2XAHA 1LDDA 3MWMA 1LJ9A 1UHMA 5LHHA 3L7WA 3CUQB 3ISPA 4Q47A 4S05A 4GO1A 4LFUA 4ETSA 1XSDA 2FNAA 1XSVA 3Q5FA 4WXCA 3PFIA 2BEOA 5E8IA 1QQIA 2W57A 4JK1X 5ILUA 4NQWA 1IRFA 3V8LA 1QPMA 2L3DA 2OA4A 4HBLA 3EETA 3FF5A 4RB3C 3WTVC 3GWZA 4R79A 2CW0F 3RKXA 2LSOA 5K5QA 3SXYA 2FE3A 1KU2A 1IUYA 2QQ9A 1TLHB 3GW2A 4KT5C 3V8JA 3ZMZA 2ZO4A 1J75A 4P5OA 2FF4A 3HHGA 4R8HA 4AVPA 1XD7A 1G6NA 3P9KA 1U2WA 1OYWA 5E8GA 2NS0A 4JBAA 3QPHA 3QU3A 1Z05A 5FLXK 1H0MA 2YR2A 3VOEA 2ZKZA 2NNNA 4U0WA 3KP3A 5ILVA 1B4AA 5CVIA 2ZMEB 5D8KB 3FMQA 3HSEA 3L00A 4G8XA 2M30A 2V9VA 1KYWA 4WX9A 4HV6A 2A5YB 3HUGA 1S3JA 1R1TA 2Z9OA 3DP7A 3BJ6A 4RGUA 2M87A 5CVVA 1G3SA 1R00A 1H9GA 1IW7F 2W85A 4NB5A 5HS7A 3ECHA 1J0RA 1QO0D 1LQ1A 1O3TA 3HOSA 3HYIA 4CO8A 2EFNA 1MZBA 1OYYA 1V3FA 2XUBA 3WTWC 2QBYB 3ZN1A 1BM9A 3E5XA 1GXPA 2O6GE 1B9MA 2RVCA 3LAJA 5DV5A 2F5CA 2YX7A 3LQRA 4IRIA 4I01A 2EFPA 1T0FA 3KP4A 2TDXA 1FP1D 2GAUA 1DPRA 3JW4A 2MLGA 1ZH5A 2YU3A 2UXXA 3GF2A 4MTEA 1FBQA 2ESNA 3FM5A 2DAOA 3I4PA 4NHJA 5D5VB 2D2WA 3BPXA 3F8CA 4PDKA 5AIQA 3JSOA 1O3QA 3QOPA 4MNUA 1P6RA 3WTXC 4L9VA 3W6KB 1O3SA 3L09A 1K6OA 2BYVE 4Y13A 1ONVA 3U1DA 4MEYF 3F8BA 1CF7B 2FA5A 2Z3YA 3WG9A 4OIQF 1HKQA 3NQOA 1T39A 2QUFA 2K7LA 2QVOA 4UNOA 2EB7A 2D1VA 3DPTA 3M8EA 3GVAA 4B09A 4L0YB 4RGRA 1D3YA 2DK5A 1IN5A 3G73A 1G3YA 5BMZA 1FPQA 2K86A 2OD5A 1EH7A 4OU0A 4P55A 4EM1A 2RKHA 3TGNA 1PP7U 3IHUA 1ZREA 3CUOA 1Z6TA 2VBWA 5HOOA 5LHIA 3WTUC 4E70A 1H9TA 4RGXA 5DD4A 2IA2A 4GGGA 4HZFA 1CGPA 1Z9CA 4LK0F 1D8KA 3WU0A 1RUNA 2HOEA 5FB2A 2LDUA 2M45A 1JE8A 2Q8KA 2HQNA 2LNBA 1XMAA 4KICA 3F8NA 1ODDA 1ZG3A 3BOQA 1AOYA 4PGHA 1WRJA 3E6BA 5FD5A 3FXUA 2FEZA 5LGTA 3OV8A 1TQMA 4LLNA 4HYEA 5FGMA 4RB1A 1QGPA 4EVIA 3TO9A 4LGWA 3GLXA 1XSXA 3C1DA 2XAGA 1T38A 3I5UA 4M73A 4UV9A 2OQGA 1E17A 2WTEA 2ADUA 1U5TB 2K4JA 4HX4A 1I1GA 2ZNZA 1DPUA 3M9AA 5L3CA 4M6XA 3RIRA 4F7ZA 2DLLA 2VBXA 1Z6RA 3T1BA 4YIIA 2STWA 4A0ZA 1B6AA 3E6DA 4LG0A 4O6JA 2IW5A 4EMSA 2CGPA 1BBYA 1USTA 3KLNA 2W25A 2EFQA 1OKRA 3ZPLA 3T5XA 3G3ZA 2R3SA 5EEGA 1TTYA 2PMHA 5J8CA 2H09A 3ZMUA 5LBQA 4HF2A 1U78A 1R23A 1SFUA 2HQRA 2E7WA 4EM0B 3LWFA 3KZZA 5DYMA 2ACJA 1YW9A 1A04A 1XGMA 2GIVA 4HAMA 2LF7A 2NRAC 3LA3A 2WC2A 3RDIA 1U8RA 2H6BA 5BPDA 3RPQA 4A5MA 1MD0A 1JHHA 3WGGA 2ZFWA 5H6QA 4I02A 1O7LA 2UXNA 2FOKA 1KQ0A 1IN4A 3MEXA 4O5VA 4ENJA 2ESHA 3C18A 1LNWA 3H92A 1S7OA 3IL2A 5HLHA 1FY7A 1K78A 1BOAA 3P7NA 2V6CA 1FX7A 1B1BA 3BZ6A 2CSOA 4EJUA 3F8MA 3DXJF 2VONA 1FZPB 3E6MA 4BHCA 2FRHA 1QBJA 3RJPA 1OYIA 2ZNYA 1Y0UA 3Q9SA 4D0PA 4I2OA 2A07F 4QWQA 2Y0MA 4LB6B 4UXNA 4G94A 3TDUC 2ZXJA 3HOTA 3QP5A 1KQ8A 4FX4A
chains in the Genus database with same CATH superfamily
2RV8A 3BZKA 2ZJQF 4GCVA 3T8RA 3X2QH 1JJ8C 2HXOA 4XLEA 4BAYA 1RESA 3WHCA 5EZHA 4HV5A 1SVMA 2IT0A 5JLXA 3SZGA 2ISYA 1MBEA 1OPCA 3E3VA 1FOYA 4PJ0C 2XB5A 4XLNF 4BXXJ 1GVJA 4R1HA 2HYGD 2P6TA 4I09A 3I59A 5ICGA 2CUZA 3ZQCA 3GMEA 1STZA 4HNVA 1BJZA 2JSCA 1ON1A 3TP0A 1YITI 1DGRM 1YRNA 3GZ5A 3BJOA 5JFRA 4BDZA 3HOVJ 1W7PA 1PUFA 4EJVA 3J80K 3WODF 1MJ9A 4PK4A 5F0CA 1DDNA 4FHTA 2M8GX 3F3XA 4C2MJ 2Q1ZB 1RIOH 2MC4A 3LSKA 1U0JA 2R4GA 5ICEA 3GTMJ 3JAMZ 3JSPA 2HVRA 5B1BH 1ZYRF 4NC7A 5FD6A 1EF4A 2DFHA 3EQLF 2AO9A 2EINH 2PFBA 3M1EA 1UHSA 2CW7A 2XIGA 4OMZA 1MDMA 3TEDA 3W3CA 3V7RA 2DT6A 3HOUJ 3RKWA 5LRRA 5F64A 2DT7B 2WBMA 4LMYA 3HRSA 1X3ZB 3M3YJ 2A5WA 4JQFA 2O8KA 2AXLA 1QHHD 2IBDA 2VODA 1G3WA 2KJCA 2Z5UA 4A6EA 4L0ZB 2O8XA 3UKGA 2VN2A 3LFUA 2H94A 1TBXA 2XROA 3ZQHA 3BTJA 4RGSA 5M5WJ 1SANA 4Y15A 3OS0A 1DP7P 1IXCA 5L3BA 2EFWA 3FIWA 1FP2A 1WZ2A 2FXAA 1R1VA 1BIBA 4RA2A 4C3JJ 1W1WE 4A3EJ 2ECBA 2CFXA 3AG1H 5ERIA 2A6TA 1VFCA 4RB0A 3LL7A 2VE8A 1XMXA 1YTYA 1K79A 2JRTA 1VF9A 1L0OC 4ZDLA 4IO9F 3HRUA 1YG2A 5DCFA 3GYHX 3BWGA 4TV7A 2DU9A 5AIPA 4ZDPA 2NNYA 1LB2A 3I58A 1QZZA 2M7BA 5IYDJ 1TQIA 1BL0A 1Q1HA 3JRBA 3QOEA 2W24A 2QF7A 3SFZA 2EFOA 4U88A 2Z99A 2J5OA 5GTIC 3UNGC 2BY0A 4F93B 5JI6A 4XBFA 1BW6A 3TQNA 4F55A 3WTZA 2KMUA 3ERED 2B9SA 3K0LA 4FE7A 2F5EA 1TW2A 3TOAA 5F0FA 3BR0A 4LK1F 2B7EA 3O6BB 2QENA 4MGRA 1D8JA 3ABUA 3WTTC 4BEHB 2HZDA 1SFEA 5FKLA 3KP7A 2KJBA 3K7AJ 2MGQA 3QAHA 5B1AH 4JX6A 3WU1B 1NG6A 1IXSB 1V55H 2A69F 1B59A 3CUQC 4EATA 1XMKA 2HVQA 1WI9A 3LOCA 4M6YA 4CZCA 2XKPA 3RI4A 3DLAA 2F2EA 2AQFA 3KP5A 4Y17A 3K70D 5D6EA 2BZTA 3CF2A 2VPLA 2IA0A 4A69C 2K27A 3AG4H 4YEJA 2FMYA 2FMLA 1PP8F 3B73A 1SEUA 2ME0A 3P9CA 2YX4A 2AS5F 4RMNA 1EH8A 3V8KA 1J2XA 1ZN2A 3E7LA 3HSRA 1TW3A 4BYYA 5A2QZ 5E3LA 3QP6A 3M8FA 3KYCB 2ZSHB 1JT6A 3MZ8A 5B5EC 5F04A 3BR2A 5L3FA 2OAZA 1U8BA 3JREA 2E34A 3S2WA 4C3HJ 2VQCA 5FFZA 2VXDA 3FXQA 1HCRA 5GADJ 1O57A 4ITVA 4Y7NJ 3JRIA 2XAQA 5JR3A 1W4MA 3OYDA 1UZCA 3DEUA 3DU6A 3OS1A 3QU6A 2Z33A 2Y48A 4AIJA 3CC4I 3O3KA 2R7QA 3B6AA 1E3HA 2I8DA 1YJNI 2DMPA 3FX3A 4F52A 3F72A 1ZARA 2BXZA 2HQAA 3L2UA 3H3UA 2QSGX 4HF1A 4D7NA 4XN0A 3V4GA 2L7KA 2DW4A 5IY5H 1P4XA 2NAZA 3IH2A 3IAM2 3PM1A 1FBSA 5J1YA 2UZKA 4G7ZF 4PJNA 2Y2ZA 4IPAA 3QYBA 4BNCA 3FXOA 1NHAA 4IEJA 1P4WA 4OINF 3QRFF 2G7HA 4LLLA 1TC3C 3ERMA 5GPAA 1WJFA 5FRMA 3DV8A 2FBKA 1SD4A 5J47A 5LD2C 3ML6A 3OS2A 2HFHA 2EJRA 3BQYA 3LSRA 4XIDA 1GLNA 4E7JA 1OR7C 2EH3A 1IV6A 3BDDA 2HOTA 3H9QA 2ECCA 4NQWB 1TNSA 3PIOF 4RAGA 3IV5A 4DJAA 2P5VA 4G6QA 1D5VA 5IT9Z 2ZMEC 4BQQA 3KIOA 3DKWA 3FKJA 5IP9J 2EWNA 5E3MA 4IHSA 4A3CJ 4XSZF 2FJ1A 2X6XA 2ZCWA 3MN2A 2EZIA 2MBFA 1YIOA 1I6XA 2EQRA 2ETHA 1FYMA 2ME6A 2H27A 1HOMA 3LMMA 5IT3A 1AWCA 3KFWX 1WPKA 3MKYB 2O03A 1MMSA 3G1OA 1TP4A 1R5HA 2V4JC 4RM2A 1Z77A 3CCRI 5E20A 3HZJA 4L9TA 2KIMA 4FX0A 5BOXA 2LFBA 2KRHA 5F27A 2CQ7A 1LFPA 3SDBA 5GTHC 3FHZA 2DDAA 2PEXA 4A93J 3KZYA 3GO5A 5IYBJ 1AKHA 2GM4A 1OMIA 4IOAF 4QLCU 3WE2A 1FC3A 3BT9A 3IKVA 4D9JA 4Q5SF 4IRGA 1C0WA 2R92J 3ZCOA 3FXRA 2QKMB 4GYIA 2ZXHA 2JA2A 1Y1WJ 1TT5B 1GV2A 2CUJA 2HR3A 1Z3YA 2R5ZA 2HU9A 2VBYA 4CYCA 2XAFA 3I71A 1VQ8I 3I4NJ 2L9RA 4CICA 4I6ZA 4DQ2A 1QVUA 2RDPA 3KLOA 2K4BA 3HKZA 1R4NB 4XLHA 5D6FA 3FZVA 1E2XA 5E3OA 2IGOA 2DT5A 3EUHA 3A01A 3ZP5A 1JGSA 1OFCX 2TCTA 5IOZA 4XN3A 3CMYA 2HOAA 1T98A 4MHGA 1X1PA 2FOWA 3KX2A 3HG9A 5F6FA 1X1BA 1WJDA 1LEBA 2EZLA 2BV6A 1MJBA 3HXLA 2E1MC 2IA1A 4DYRA 3E6CC 4IQ4A 2KIFA 4YIRX 3G71I 3DFGA 2JA5J 2QA4I 2O0YA 2XF7A 1R36A 1MIJA 4A3DJ 1R22A 2M34A 3Q0UA 3CTAA 3K9TA 5KNLA 2HTSA 2OZUA 3SDGA 5LGUA 3HDDA 2W84A 1I5ZA 3PQKA 3R6SA 1KQ9A 1MMDA 3FM3A 3E0JB 4RAYA 3OYCA 2FU4A 1ON2A 1GDTA 3N97A 1LUJB 1IGNA 2DFEA 5DM7F 3HSFA 5F1JA 4FASD 2R7SA 2K9SA 2NOGA 4MFEA 1JTYA 4DBRA 2DFIA 5CLSA 1LDJA 2XGXA 2XGCA 5ICFA 1EV7A 4A3KJ 2BY3A 5M3MJ 4UUVA 2UV1A 4KN7X 2E7XA 4HLXA 1YFHA 1UB9A 1SD7A 2PN6A 1R5GA 2X6WA 2XGEA 1IDZA 3E5QA 5FLXZ 1UG0A 1YW7A 2MA3A 5ICCA 3ZN0A 1J7KA 2FD5A 2PMZN 4IZZA 4K2EA 3FK7A 4QPOA 2VT3A 4G12A 3ZMVA 1LE8A 4HRIA 1IUFA 2KP6A 1SMTA 3NARA 5E79C 2M8EA 3V7SA 3WGHA 4PUSA 3OL3A 2XV4S 2Q0OA 1FNNA 1ZRCA 5HVQC 1YYVA 4XOTA 2E71A 2LKSA 5DS9A 4A3GJ 1ZKGA 2JWTA 3AAFA 1WJ5A 4ESBA 4GRIA 1KA8A 1W5CC 1W0UA 3BP8A 4CCLA 5J4YA 3OR2C 4ZZDA 2PQ8A 4A12A 3HRTA 1S7AA 2BE5F 3ESWB 3QPTA 3LSIA 1FYLA 1B8IB 4EEFG 3F22A 1YX5A 3HPHA 5HLGA 1ETYA 3F6OA 2LC2A 4IQJA 1UHWA 3K4JA 3PUFA 2QLZA 3HJEA 3S1NJ 4EQQA 1FOKA 2BY2A 2EILH 2V1DA 3Q3SA 4N9HA 2OTJI 1I1SA 4A0YA 2BVLA 3FMRA 1VQ9I 3F8FA 4PSXA 3K69A 3Q0WA 1D5YA 4UUSB 1RKTA 2VIXA 5KAFC 3DCFA 1RR8C 3S1QJ 5FKNA 1F1ZA 5E1WA 4YFNF 2LKXA 3S15J 1JXSA 4G7OF 2LF8A 3SHFA 2VASA 5H6RA 1IRGA 2HPIA 1ZTRA 2L4AA 4B3AA 2E2IJ 3CO6C 3J81K 5E18F 3VYUB 5D8LB 5KK1A 1ORKA 3F9KA 2VKHA 2VQLA 4OMYA 2V1NA 4DYQA 4D5CA 5EF6A 4HX7A 3CDHA 2CUEA 3I9V2 2DMQA 3NWTA 3OYJA 3ZOBA 3L9FA 2GBYA 1UJ8A 1WGXA 4XKBA 2PJRB 3C7JA 2ZJRF 1BW5A 4M72A 2DA1A 3LSMA 2M2EA 1OCCH 3ZMTA 2R7UA 2RC4A 3DTEA 2LLKA 2EA4A 4Z6YA 4BHBA 2JA6J 3D5LA 3VSLA 1IN7A 3GXOA 2XGDA 1E0EA 1LFUP 3OYBA 2H1LA 2V1UA 2XSDC 1X4PA 3EPZA 5TRDA 2VPRA 2CH0A 4AIDA 2CQNA 2BXYA 1JGGA 1POGA 4P9FA 2XRNA 5AONA 1K7AA 1VQPI 2HVSA 1ETOA 2QWWA 2V79A 2RN7A 2IRFG 3HIFA 3VYTB 1XX5A 3OYGA 2GLOA 4MFDA 4GFBA 3K70C 2MABA 2EV0A 4UY8I 2X4HA 2K5CA 4ANJA 1I27A 4HNTA 1J9IA 1U6GA 5ILSA 2GXGA 5KCMA 1Q1VA 1H88C 1AA7A 3CUQA 2VC1A 4OIOF 4N0BA 2A61A 4ZJZA 3DTIA 2O9LA 4UHTA 4IHVA 4KUMA 6PAXA 1U5TC 3SEZA 3FISA 4WCGA 4RB2C 2PBIA 2VOOA 1NK3P 3REOA 4FISA 4S0HB 4XKWA 5J4VA 4BQOA 3QPSA 4BXUA 3O8HA 2JUCA 2QKLB 5FKKA 4BUPA 1MBHA 2JT1A 2GIZA 4LG3A 1N25A 5GAEJ 5HDNA 4MQ9F 2L0KA 2KDZA 2E2JJ 1W7PD 2WAQN 2LP0A 5TJJA 2WWYA 4P9UA 2OZ6A 2XF6A 3OSFA 2JPCA 4ZC3A 1P92A 2P7VB 4RAZA 3JRCA 3CP2A 4PFOA 1DUXC 4F91B 3LSJA 2YSRA 2DTRA 2XC7A 1TWAJ 1TWHJ 2HYFA 4KMUX 1ZLJA 3H0DA 4J00A 2KPMA 4JP0A 4B48A 4BBRJ 3JRFA 3DQVC 1TWCJ 3IWFA 1HSTA 2X48A 2ID3A 3C2GA 3BC8A 1FWZA 3LSTA 3ELKA 2ELJA 1HSJA 1BI2A 1HKSA 2Y9YA 4U87A 2OCCH 2CS3A 3MCZA 2A6HF 2VXZA 3CJRB 2MD0A 4MEXF 4ESJA 3IRRA 1HF0A 4KNYA 1FJLA 5DEQA 3LSGA 1BN5A 4Y52J 4ENNA 4P96A 3EDPA 5LFAA 1R58A 1W5SA 1Y6IA 2BW3B 2OU2A 4WF2A 4EJOA 4ZYEA 1G59A 4IOCF 4KIGA 2JUGA 1X19A 2XAJA 3ZQIA 3P5JA 2DDBA 2P6SA 3KETA 3S3MA 1UAAA 2HGCA 4II2A 1FT9A 4MLOA 4IXAA 2Q2EA 1BC8C 2FSWA 3VPRA 1IC8A 1OR7A 3I0TA 3I56I 1G2HA 1KU3A 3OIOA 1PDNC 1EJ9A 2CW8A 4YELA 3VSKA 2COMA 1CQTA 1XTAA 1A6IA 4BH9A 1F9NA 2ZMEA 1KGSA 4U7BA 2ZC2A 3WTYC 1P7JA 4BQAA 3CMAI 2IJLA 4LG0B 3H3VK 3BJAA 3KPHA 3K4NA 2V9PA 4KMFA 1M1EB 1SMYF 1Z0XA 1XCVA 3A03A 5J3LA 2R5YA 4DNCA 1ZK8A 1A6QA 3FMSA 3VYSB 3PSFA 3RPUA 1IN8A 3RTRA 1B72A 1BI3A 2LBFB 2VJ5A 5E1ZB 5HLIA 2R0QC 4B8XA 4YG2F 3KYLA 2MH9A 3BR1A 2EIJH 3GTGJ 1XN7A 3HM5A 3MFKA 4U0VA 1HQCA 1LVAA 3DWLE 4A5NA 3GTJJ 2DQRA 3VODA 3KE2A 3JR9A 4M9XA 2DA2A 1WJCA 2LG4A 1NG7A 5EJCA 2QM3A 5BS6A 3E5UA 3I4MJ 2R7VA 5LLQA 1W5TA 2EA2A 4RBOA 2P7CB 4CH7A 2GA1A 4S04A 5BQTA 5LEKA 2JVGA 4C2TA 4AUXA 2DMTA 3FXJA 2MFZA 1GHCA 2Y0SN 4KA4A 3S93A 5BPIA 4AC0A 4DOZA 2K9QA 2MYSA 1I3AA 2K85A 5DM6F 3LSPA 1E3OC 2RNJA 2WA0A 4E7ZA 3MZHA 3B02A 2QCOA 2LREA 3DBHB 3WU2C 1R7JA 2O3FA 3N4MA 2ELKA 1UCRA 1HW1A 2QZ8A 1ENHA 2QBYA 4A2UA 4CA0A 1MKMA 4ZYHA 4ZZLA 1DQUA 3J81Z 2MC3A 5FO5A 4WWCA 2GXAA 4AD9A 1Z1DA 1UG2A 2Y31A 1SFXA 3W2WA 4AWXB 5HDKA 2VE9A 1V4RA 2JSPA 4MQVA 4EJTA 2VUMJ 1BJAA 3DKYA 2MH2A 3LAPA 2ISZA 4M9SA 5E1XA 2K02A 2ZFUA 4IJAA 5L3DA 3R60A 4A3MJ 3ABLH 3K4LA 3HBLA 2CQXA 3OL4A 4II3A 3KEOA 4W1UA 2N8GA 3F23A 5H2FC 4IHTA 3TP3A 1RI7A 3CCYA 3ECOA 2R7FA 3CC2I 3K2ZA 3HB9A 2JPBA 1RR7A 3O2PE 4XORA 1JKRC 4WK8F 1K78B 2BHYA 3VFZA 2PI0A 4OAYA 4Y3OA 3R0JA 5B3SH 2HI3A 2RGVA 3G2BA 4X1EA 3SFIA 2O7OA 1B9NA 2GA2A 2K9MA 4KIFA 1WH5A 3COAC 3ASNH 2ICWG 4ESFA 2IS2A 1UFMA 2E5ZA 3T8TA 1XB4A 3JTHA 5KAIC 4DZPA 3ABKH 3G4SI 4KFCA 2IVMA 4KYWA 1MJAA 1YS7A 3PNVA 2XHKA 1Y0NA 4NBQA 2ZXIA 3OOPA 2PG4A 2DQLA 1FIAA 2HKXA 2P5KA 3F6VA 3K6GA 3L2CA 4L5EA 4CDGA 1Z67A 5D5UB 2VJ4A 3GFLA 4A3LJ 5JVTA 1SAXA 4I7HA 2OBPA 3ZGKA 5C4JJ 3TW7A 2CWEA 4FQGA 5HDGA 1RUOA 4PGGA 3PSIA 4OOIA 3G6EI 5K1YA 1VQ5I 2QSHX 2KQRA 1XDUA 3CQZJ 4BGDA 1MBJA 4XKVA 1F5TA 2XPUA 3BG9A 4BHPA 1YJWI 1CF7A 2A05A 2KRFA 1O3RA 3A0HC 1P2FA 2AXTC 3R4KA 3BR3A 3Q9VA 4J19A 1HKTA 2HTJA 3SZPA 1OCTC 2RREA 1IF1A 1WWXA 1MNDA 2A68F 2OQRA 3QQAA 5L3GA 1S72I 2F4OB 2WAFA 1LDKB 4HDVA 4J01A 5HLTA 4ON0A 3ABTA 3I59B 2L7ZA 3RCOA 4E7HA 4I0AA 2R5YB 4ASNA 4PJLA 1FSEA 5EYRA 3GCMA 3TO6A 1YRNB 3ULQB 3LSHA 2K3PA 3JTGA 1MNMC 1B72B 2IPQX 1O7FA 1W7PB 1PUFB 3GTKJ 3FHNA 4UVAA 3W6JB 5CQEA 1VQKI 1HDPA 2I5UA 3K1MA 1R1UA 3M8JA 2ZB9A 4XR6A 1Z7UA 2KIUA 1I3QJ 2KDOA 3AG3H 1S7EA 4HX8A 4ZYDA 4Q4ZF 4XM3A 4Q48A 3PO2J 3FK6A 5DCMA 4M9ZA 1JJ6C 5LHGA 3MKZA 1IG7A 4M6VA 1MDMB 4AM3A 2WV0A 2CQQA 1VQ4I 5IOYA 5HODA 3JRHA 3KP2A 4O3MA 1J09A 3M7GA 4ZTFA 3HRMA 4Z2YA 3T0YA 3SJMA 2F4IA 2GZWA 3LA2A 3BROA 4OAZA 4V2GA 1OISA 1X1AA 3GFJA 2E60A 1TL8A 2DA6A 3KEQA 3PQJA 3CP8A 3RKQA 3BCBA 4H0EA 2KZVA 2DN0A 5HNFA 3J7YJ 1X2MA 4DZJA 2XASA 1WQ2A 3S8PA 3BY6A 2PMUA 1GT0C 2CYYA 3HTSB 1ZGAA 5HS9A 3NAUA 3NWSA 3WG7H 4BS9A 4RS8A 2L02A 2NVXJ 4D5FA 1S8NA 1VQOI 4HOBA 3EUAA 4BBSJ 3O8GA 3K1NA 3OYHA 1HLVA 2HDDA 4L5IA 1TNTA 2IP2A 2Z16A 1PUEE 4B3XA 4AYBN 1HA8A 1FMVA 4C9YA 3U1KA 2HDCA 3J80Z 3FBNB 1SFOJ 3I3LA 2EK5A 2ZSIB 3IWZA 1PJRA 4G6DA 1K83J 2MLKA 5F1RA 5BNGA 1WKMA 2L7MP 4LB5A 2O5RA 3ONQA 3DBLB 2LVSA 2MSYA 4ZH4F 3RQIA 2X51A 5CVUA 4CCJA 4V2FA 4L5JA 4XRMA 2STTA 1IN6A 4DYCA 1P4AA 2PLYA 5DTDA 2UWMA 1U5TA 5H20A 1ZRFA 2HS5A 1HW5A 4HG2A 1JKPC 2L9SA 1XS9A 3WE3A 2R7ZJ 2GWRA 4EM2A 3EYYA 2XSJC 3CCMI 4HDUA 2D45A 2COBA 2M4GA 2L54A 5EEAA 3BZCA 1MW7A 3GX4X 5JHUA 2V6EA 2NVTJ 2ZBKA 1QHGA 4LIUA 3ROUA 2GXBA 1GVDA 3CJQB 5J8FA 2P5LC 3H3ZA 2E1NA 3LA7A 1WSUA 1TT0A 3BLYA 2XKOA 2JA7J 3D5SC 3RYPA 1JTXA 5KVRA 2QQAA 3K4BA 1BI0A 4M3BA 1XGOA 3OIQA 4CZZA 1QZEA 4XLAA 3MAJA 3TO7A 3GUDA 2G7UA 2M1BA 2FBIA 1V54H 5J6XA 3ZMSA 3S3OA 3S1MJ 1QNTA 3H9GA 4AVZA 3CMMA 3CLOA 4IF4A 1XDSA 4L9NA 3J7AO 2PMZA 2M3AA 2VC0A 1MSEC 2J5PA 3OYKA 5EGOA 1SD6A 3TKYA 1WVRA 2F5FA 3WGIA 1K4TA 4YFXF 2Y30A 1D1BA 4YFKF 1T08B 4B1RA 3ZQLA 3HOZJ 2HXIA 1REPC 4AIHA 2GQQA 4WXHA 4E7IA 4CCOA 1BA5A 3U9GA 1OCZH 2EZHA 3DPLC 1XGNA 2LY9A 2RQPA 1FLIA 4XLFA 1X1DA 2L2OA 1GV5A 3IH3A 4OIPF 2QEXI 4C3IJ 2DOFA 4NNJA 2HWVA 1X3WB 4XQFA 1V5GA 1U3EM 2L5QA 1XCBA 5DCMB 4W97A 2LOOA 1YI2I 3ZQFA 5D4SA 1BR4A 1ETKA 1KYZA 1Y1VJ 2C6YA 1BIAA 2HQ5A 1HBXG 3KCCA 2ZJ2A 1UMQA 1YX3A 2DO7A 2L4MA 1L3LA 1JKOC 1J5YA 2F5DA 1IDYA 1S6LA 3H5RA 4GXOA 5EG0A 1BI1A 2M4KA 2EZKA 1VTNC 5C4XJ 4HNUA 2KIQA 9ANTA 3J7ZI 2VI6A 2A6EF 4HLYA 4NDLA 1VQMI 5FRNA 1RPWA 4CCNA 1P7IA 1TQPA 4E7LA 3BTCA 1LEAA 5CJ9A 2L7FP 4EGYA 4IX7A 5E17F 3W6VA 3HTUA 4ZDOA 2V1XA 3HGGA 1YOVB 4OIRF 3V7CA 4QIWN 2CO5A 5DD8A 2DOEA 1XGSA 4ENMA 1FOXA 3MQ0A 4N4NB 2DXIA 5K5OA 1T56A 2H6CA 3BG6A 3ZQ7A 4XLPF 2W48A 2XF5A 3TOBA 2FBHA 2O61A 5HS8A 2KT0A 2DBBA 4YIFA 3JAMK 4KITB 1I6HJ 4IHYA 4PFPA 2HZTA 4IHXA 1S5LC 1G3TA 2EV6A 3L1PA 1AKHB 2FX0A 1WH7A 1FBUA 2EBIA 4RLFA 1ULYA 3KP6A 2JRMA 4EGZA 1U9OA 2DI3A 2DMNA 2OUMA 3S2HJ 4MTDA 3UR3C 1ZG5A 3CJNA 5GAGJ 1FYKA 1YO5C 3IH4A 2HDWA 2X9DA 3QWLA 3RKYA 4V19K 2CQKA 5F0HA 2MD5A 4RAFA 2FNPA 2R5ZB 3A1YA 1RNLA 1S29A 5M5YJ 4CYCB 2F4MB 4HF0A 1VI0A 3H9JA 4M74A 5K5RA 3HOWJ 2HKOA 3GBGA 1D0YA 1ZGJA 2P0WA 2PX9A 1DGWY 3A01B 1DU0A 1ETXA 3MZYA 5CQGA 1HC8A 1ITYA 1FSHA 5DUKA 1ZAOA 2UUZA 3GFMA 4AIKA 2F6CA 3L2VA 3C2HA 2KISA 3GZ6A 4PSWA 4FT8A 4RDUA 2LMDA 1Y56A 1YJ9I 2YS9A 4G7HF 2XDVA 4N9IA 5L3EA 5LRSA 1LPQA 1RZ4A 2LR8A 3VB2A 4BJ5C 4U0YA 1ZQ3P 3AL0B 2DK8A 3PL8A 2RNGA 5J40A 3DBRB 4ZYAA 1J59A 2OV7A 2QYOA 2TRTA 3CJTB 1MMAA 2WAQA 4B44A 3K4MA 3CF5F 1TWGJ 4UVBA 1JHFA 2NYXA 1T0FC 3HHHA 4QPQA 2H1KA 4PCQA 2E35A 4XRSA 1Z91A 4XRFA 4FCYA 4KN4X 2JN6A 3AG2H 1EH6A 1YLFA 5D5XB 2G9WA 3G1LA 3LFKA 4BDYA 1R9TJ 1JT0A 3D1NI 3CZ6A 5ED4A 5EDNA 1QA6A 4QSHA 4RM3A 3DU5A 1X3UA 4BE2A 3EYIA 2K3FA 2E1OA 1V5EA 3S16J 1R4MB 3FWEA 4KDPA 3GFIA 1IO2A 3TDZC 3C3WA 4BE1A 1W0TA 3VEPA 2KZGA 3GEZA 2CFOA 2LY1A 1IAWA 4L18B 5DDGA 2IS4A 4F92B 1YQAA 2G0EA 2R7DA 5IP7J 1D0XA 2CMPA 2P8TA 3OMYA 1HDDC 2NVQJ 1ZLKA 4CHUA 1OCOH 5CVJA 1KU7A 3P9IA 1KU9A 4I98B 3SQNA 2BBYA 1GXQA 1LE8B 1BC7C 4MIMA 3M1CA 2B63J 2DPDA 2YPRA 4MO7A 5C3EJ 1ZR4A 2X1EA 2R7TA 4A6DA 4UV8A 4PZJA 3CC7I 3ZQGA 4KIBA 2KHMA 1FEXA 2CG4A 5A2QK 1D1AA 2NVYJ 2D1HA 2R7WA 2Y75A 1X58A 2DPUA 4CXFA 2DYRH 2BY1A 2VQGA 1MBKA 1USSA 1AHDP 1WJAA 2FQ3A 1ZRDA 4IRHA 3U2RA 4I0BA 3I64A 5FFXA 2P4WA 4ZYGA 5DUIA 2B0LA 4XRSG 3IRQA 4FTHA 1N75A 4XSXF 5CVRA 3ZMDA 4BE0A 2L01A 2M9HA 3IKTA 3JRAA 2EIMH 1WJEA 3H0GJ 1HXDA 4CYDA 3PUBA 3BPVA 1NH3A 1G4DA 2LKPA 2VT2A 1IXRC 5B66C 1K6YA 1FOWA 2X0LA 2JTVA 4E4HA 3CCQI 4ZTJA 2R7XA 3LQQA 2PJPA 4M71A 4WXDA 5K7FA 3NRVA 3K1PA 3DF8A 2Y0SA 3BR5A 4M3DA 4A0XA 3ZR8X 4CGZA 4U7DA 2V26A 3OY9A 4LLGF 5CYVA 3SZTA 3CLQA 3NEUA 1E3PA 4HA8A 4JYKA 2LY2A 1F4KA 4I76A 5LGNA 4UVCA 3CO7C 2OTLI 5GPCA 1QZYA 3HEFA 2BGCA 1BR1A 1TWFJ 2YUSA 4L9JA 2KLOA 4LJZF 1YW8A 2KKOA 5EEHA 2HEOA 2ELHA 4HW0A 2IGMA 4HQMA 1SD5A 1IZ1A 5D4RA 4IHWA 3IC7A 3E97A 2IAIA 2M5WA 2A3SA 3I53A 2ZJPF 4ENKA 5IT9K 3R61A 2EV5A 4YRVA 2K40A 2XB0X 4EJWA 3OYMA 3JRDA 1OQYA 1T2KA 1HW2A 1ZHFA 1D0ZA 1YS6A 4EV0A 1NK2P 3EUKL 1MGTA 3D0SA 3R0AA 4LD5A 3HOYJ 1LKXA 3OYAA 4H4KC 2E36A 3WTSC 5D5WB 1RETA 3K4KA 4X6AJ 3I54A 2VOPA 4CUGA 2AQEA 4G9YA 4XNFA 1PVEA 2JZYA 4ABZA 1OLTA 5LEJA 4HQEA 3RYRA 3I55I 4IVNA 2VBZA 1VQ7I 4GYGA 2QSFX 2E1CA 1ZG1A 4X0GA 2KRCA 4E7SA 2E5NA 2XVCA 2WY8Q 1T6SA 4LIVA 3VDXA 2L9NA 2QQBA 1OCRH 3F21A 2XAHA 1LDDA 2XPVA 3MWMA 1WI3A 1LJ9A 1UHMA 2DJIA 2NS8A 5LHHA 3H5AA 2R7RA 3KZIC 3L7WA 3CUQB 3ISPA 3OIPA 4Q47A 5GP9A 4S05A 3V42A 4NC6A 2CUFA 3FXKA 2DCEA 4GO1A 4LFUA 2HOSA 3PNTA 4ETSA 1MNEA 4C30A 1XSDA 3OSGA 2FNAA 1XSVA 2X1DA 3WHBA 4BKXA 3Q5FA 4WXCA 3PFIA 2BEOA 5E8IA 4CCKA 2V7FA 2Z2SB 2HYJA 2WB1A 3IUOA 4D7MA 3MD2A 3GLLA 1QQIA 2W57A 2OJED 4JK1X 3S17J 4XOPA 5ILUA 1ERDA 4NQWA 1EA3A 1IRFA 1LVKA 3BG7A 3V8LA 1ACIA 1QPMA 2L3DA 2OA4A 4HBLA 3EETA 3DLLF 1Y8QB 3FF5A 4AU7A 3ZRGA 4RB3C 1PYVA 3WTVC 3GWZA 4DGWB 4R79A 1MSFC 3RSNA 4JOMA 3A2KA 2DYSH 2CW0F 4XK4A 3RKXA 2LSOA 1APLC 5K5QA 3SXYA 3JRGA 5CKTA 2CRGA 2BOLA 2FE3A 1KU2A 1IUYA 2QQ9A 1TLHB 3GW2A 4KT5C 3V8JA 4XKCA 2DTZA 2CV0A 5F08A 3ZMZA 2KFDA 1FMWA 2FUG2 2ZO4A 4UUTA 1J75A 3PIPF 1U9NA 1DU6A 4P5OA 2FF4A 1G8XA 3HHGA 2WB1N 3BG3A 4R8HA 4AVPA 1XD7A 1G6NA 3SYTA 2WY7Q 3P9KA 1U2WA 1OYWA 1X2NA 5E8GA 2X6OA 2NS0A 3DPUA 4JBAA 3FKIJ 3QPHA 2Y9ZA 3QYFA 3QU3A 1Z05A 2BHZA 5FLXK 1D1CA 1H0MA 2YR2A 2Q2EB 2ZKZA 1UELB 2NNNA 3VOEA 4U0WA 3KP3A 5ILVA 1IRXA 2GOXB 1B4AA 3L2QA 3VYRB 2CV1A 1Z3XA 5CVIA 1JI8A 2VL8A 2ZMEB 1FTZA 4JX5A 5D8KB 3FMQA 1WJBA 2IGKA 3HSEA 3L00A 1SAUA 5HNHA 5KHDA 4G8XA 2M30A 3CCVI 1RKWA 2V9VA 5FLVA 1KYWA 4WX9A 2DA3A 3PFYA 2EPFA 3OOUA 2DFFA 1VNDA 4HSRA 1IJWC 4HV6A 4PJJA 2Z1DA 2RQQA 2A5YB 3HUGA 1BOBA 1S3JA 1VQNI 2NVUB 5FJ8J 1R1TA 5IYCJ 2Z9OA 3DP7A 3L2WA 3BJ6A 1ZGWA 2OF7A 4RGUA 2JMWA 2M87A 5CVVA 3A4CA 3K10A 3U21A 4BY1J 2R93J 1DP3A 1G3SA 2LTPA 1T33A 2DODA 4AYBA 1R00A 2JQ7A 3HOXJ 1IV8A 1H9GA 1IW7F 2W85A 4NB5A 2W4SA 1QPIA 4A3JJ 3KEYA 4BU2A 5HS7A 3M4OJ 5E3NA 3ECHA 2LYCA 3CCLI 1YE9A 2OPTA 1J0RA 1QO0D 5GAHJ 1LQ1A 3G1MA 1O3TA 3HOSA 5CPRB 1N77A 3HYIA 4CO8A 2EFNA 3HC7A 4BJ6C 1TZLA 1MH4A 1MZBA 1OYYA 2DA7A 1W36D 1V3FA 2JA8J 3E1SA 2XUBA 3WTWC 2QBYB 3ZN1A 1BM9A 4B4CA 3E5XA 1QRYA 1GXPA 2O6GE 2E1MB 3N05A 2JK3A 1K4SA 1B9MA 2OC6A 2RVCA 4BQNA 3MVPA 5FKMA 3LAJA 5DV5A 3ASOH 2F5CA 4P1WA 2YX7A 3HL2A 2E19A 3LQRA 2VB6A 4IRIA 4I01A 5TISC 2EFPA 2E2HJ 1T0FA 3KP4A 2LK2A 2TDXA 1FP1D 2GAUA 1DPRA 2H8WA 3JW4A 2MLGA 1QVTA 1ZH5A 2YU3A 2UXXA 3ZXSA 1GUUA 1B8IA 3GF2A 1NTCA 1MBFA 4A3BJ 4FE4A 4MTEA 1FBQA 3CD6I 2F48A 2ESNA 3MKWB 3FM5A 1QU3A 2DAOA 3I4PA 5K7ZA 4NHJA 3S1RJ 5TGTA 5D5VB 1A5JA 1JUSA 2VQHA 3H1CA 4NUBA 3CDLA 3DTKA 2D2WA 1KONA 3BPXA 3F8CA 1O4XA 4UB6C 4PDKA 5AIQA 4UUSA 3JSOA 1O3QA 3TMOA 4DW6A 2DOAA 3QOPA 2RAEA 3PO3J 4MNUA 5IP6A 1P6RA 5FROA 2EIKH 2H8RA 3BTIA 3D5RC 4B47A 3WTXC 1X4OA 3CMEI 4L9VA 1YIJI 3W6KB 3BG5A 2BVMA 1O3SA 4IKFA 3L09A 1K6OA 3CCEI 4GDFA 3HGYA 2BYVE 4Y13A 3RQ4A 1ONVA 3U1DA 2PJRA 3AFHA 3S32A 2VJJA 4MEYF 3F8BA 1CF7B 2FA5A 5JLWA 2Z3YA 3WG9A 2R7OA 4OIQF 1HKQA 3NQOA 1H8AC 1T39A 2AHQA 1XG1A 2QUFA 2NOJB 1JUMA 2K7LA 4M3EA 2ID6A 4KISA 2WADA 2LH9A 2QVOA 4UNOA 2EB7A 1XC5A 2D1VA 5EZGA 3RZOJ 1SFKA 3DPTA 4E6KG 1ETQA 5FKOA 3M8EA 3GVAA 4B09A 1JUPA 4L0YB 2VKDA 4RGRA 4LITA 1D3YA 3OYIA 1ETWA 2DK5A 2VJIA 3BTLA 1IN5A 3G73A 1G3YA 3HUGB 1MMNA 3JCUC 2LRDA 5BMZA 1FPQA 2K86A 3HPGA 3FBIB 2OD5A 4CCMA 5J1RA 1EH7A 4OU0A 3Q0VA 4P55A 4BXFA 3OR1C 4EM1A 2RKHA 4DBQA 2HNHA 4Y4RA 5K7HA 2CJJA 3TGNA 1PP7U 1K61A 1X1CA 3HKZN 3A0BC 4LOCA 3IHUA 1ZREA 3GTPJ 3CUOA 3L2RA 1Z6TA 1V5FA 2VBWA 5HOOA 5LHIA 1EKEA 4XL9A 4RLQA 3WTUC 4E70A 3CCUI 1H9TA 2VKEA 4RGXA 5DD4A 2IA2A 1OJLA 4GGGA 2K9LA 4HZFA 1KZHA 2LD5A 1CGPA 1Z9CA 3DKXA 4LK0F 2K9NA 1D8KA 2IS1A 4G6TB 3WU0A 1RUNA 1Z7LA 2HOEA 5FB2A 2LDUA 1F36A 4HEA2 2M45A 1ZR2A 3J7AY 2IS6A 4F3QA 1JE8A 2Q8KA 2GOMA 1RRJA 3VWBA 2HQNA 2LNBA 1MMGA 1XMAA 3F8NA 4KICA 3GTQJ 1LFBA 2HPMA 1ODDA 3H35A 1ZG3A 3BOQA 1AOYA 2QGUA 3A02A 4PGHA 3ZQQA 1WRJA 3E6BA 5FD5A 3H36A 3OYEA 3FXUA 2FEZA 5LGTA 5JHFA 3OV8A 3S3NA 1I50J 1TQMA 3S14J 4LLNA 1YHQI 2DMUA 4HYEA 2IGNA 5FGMA 4RB1A 2DJNA 1FIPA 1BR2A 3CESA 1QGPA 3TO9A 4EVIA 4LGWA 4CSWA 3GLXA 4DIQA 1XSXA 3C1DA 1S9HA 4BJTA 2XAGA 2W82A 2XAUA 1A36A 1T38A 3IP4B 1H89C 3I5UA 4M73A 4UV9A 2OQGA 2FQ4A 4D1QA 1E17A 4B43A 2QQ8A 2WTEA 2ADUA 2BW3A 3TBIA 1U5TB 2K4JA 5M3FJ 4HX4A 1T8IA 3PJRA 1I1GA 3GZNB 2JVHA 2ZNZA 2V9KA 5FLMJ 4E7KA 4OWRB 2IXSA 1DPUA 4KJZA 3M9AA 5L3CA 3MMYB 3MKLA 1R6RA 2MW8A 4M6XA 1R5ID 3RIRA 5IPAA 4F7ZA 2DLLA 2VBXA 4Y33A 1JKQC 4XONA 1Z6RA 4UB8C 1SVOA 3T1BA 1R71A 4YIIA 2DA4A 3RZDJ 2STWA 4A0ZA 2M0CA 1B6AA 3E6DA 4M3GA 4LG0A 4O6JA 2IW5A 3IAS2 4EMSA 2CGPA 3SEQA 1BBYA 1USTA 4XLCA 2X1CA 3TL4X 3KLNA 3CCSI 2W25A 1MH3A 1SC7A 2EFQA 1OKRA 2LBFA 3QPLA 3ZPLA 3T5XA 2ZXWH 5EGOB 3BQZA 3G3ZA 2R3SA 5EEGA 4A3FJ 1TTYA 2PMHA 4XICA 4KT6A 3BCAA 2Y69H 5J8CA 2H09A 1ZELA 3FXLA 3H5NA 3ZMUA 2CV2A 5LBQA 4HF2A 3C2BA 3DEWA 3OYFA 1U78A 1R23A 4IL6C 3OYLA 1SFUA 3M07A 3GTLJ 2HQRA 2E7WA 2VLAA 4PJMA 3BR6A 3TW6A 3GTOJ 4EM0B 3LWFA 3KZZA 5DYMA 1VZ0A 4M3FA 1WHUA 3CCJI 2ACJA 3OYNA 4A3IJ 1YW9A 1A04A 1XGMA 3LNQA 2GIVA 1SVLA 4HAMA 2LF7A 1WCMJ 2NRAC 2W00A 3LA3A 3RPUD 3ABMH 2WC2A 1N78A 2M7AA 2XPWA 3RDIA 1U8RA 2H6BA 4JX4A 5BPDA 2L9VA 1FTTA 1T95A 5M5XJ 3RPQA 2X85A 2X6YA 3F0CA 4A5MA 1MD0A 5C44J 3B6CA 4N4OB 1JHHA 2MG4A 3WGGA 2ZFWA 3QODA 5H6QA 4I02A 1O7LA 4QTRA 2NS7A 3EUHC 5EG0B 3DEEA 5J1UA 2CU7A 2UXNA 1VQLI 1A35A 1Y39A 2FOKA 1F43A 2W1OA 1KQ0A 3PNYA 1IN4A 3MEXA 3W2VA 2P81A 2JJ7A 3CDIA 3K2AA 2ESHA 4O5VA 4ENJA 3C18A 3K4CA 1LNWA 4BY7J 3H92A 1S7OA 3IL2A 2D5VA 5HLHA 1FY7A 3KYDB 3OWTA 1K78A 1BOAA 3P7NA 3AL0C 1OCPA 4BL0B 2V6CA 4C2UA 2WAEA 1FX7A 1B1BA 3BZ6A 2KL4A 2CSOA 4EJUA 3F8MA 1W36C 3AKZA 4HSTA 2F5VA 2M0MA 1XPXA 4NC8A 1AU7A 3W2AA 3DXJF 4HPQA 2NXNB 1RC9A 4XMYA 1FZPB 2VONA 3FDYA 2IEKA 2YU9J 3E6MA 1IRZA 2XRLA 4BHCA 2FRHA 1QBJA 3S2DJ 4BACA 3RJPA 1P9QC 2VKVA 1VQ6I 1OYIA 4BEHA 2I10A 2ZNYA 5JVGF 1Y0UA 2OCEA 3QYEA 3Q9SA 4D0PA 1I39A 1Y8RB 4I2OA 3FXMA 2A07F 4I99C 1WFXA 2Y0MA 4QWQA 4LB6B 2WV1A 2DA5A 1Z21A 4UXNA 4G94A 3TDUC 1ETVA 2ZXJA 4FETA 1R49A 3HOTA 3QP5A 2W7NA 1MBGA 1KQ8A 1A31A 4FX4A
chains in the Genus database with same CATH topology
2RV8A 4GCVA 3T8RA 4BAYA 4HV5A 2IT0A 2ISYA 1OPCA 3E3VA 4XLNF 1GVJA 4R1HA 2HYGD 2P6TA 4I09A 3I59A 5ICGA 1STZA 2JSCA 1ON1A 3GZ5A 3BJOA 5JFRA 1W7PA 4EJVA 3J80K 3WODF 1MJ9A 1DDNA 4FHTA 3F3XA 1RIOH 5ICEA 3JAMZ 3JSPA 1ZYRF 5FD6A 3EQLF 1MDMA 2PFBA 3M1EA 4OMZA 2XIGA 3V7RA 3RKWA 5LRRA 5F64A 4LMYA 3HRSA 4JQFA 2AXLA 2VODA 1G3WA 2KJCA 2Z5UA 4A6EA 4L0ZB 2O8XA 2VN2A 2H94A 1TBXA 2XROA 4RGSA 4Y15A 1DP7P 1IXCA 5L3BA 2EFWA 1FP2A 2FXAA 1R1VA 1BIBA 2CFXA 5ERIA 4RB0A 2VE8A 1YTYA 1K79A 2JRTA 1L0OC 3HRUA 1YG2A 5DCFA 3GYHX 3BWGA 4TV7A 2DU9A 5AIPA 2NNYA 1LB2A 3I58A 1QZZA 1TQIA 1Q1HA 2W24A 3SFZA 2EFOA 4U88A 2Z99A 2J5OA 5JI6A 4XBFA 3TQNA 3WTZA 3ERED 3K0LA 2F5EA 1TW2A 3TOAA 4LK1F 3O6BB 2QENA 4MGRA 1D8JA 3ABUA 3WTTC 1SFEA 3KP7A 2KJBA 3QAHA 3WU1B 1IXSB 2A69F 3CUQC 1B59A 1XMKA 4M6YA 1WI9A 2XKPA 3RI4A 2F2EA 4Y17A 3KP5A 5D6EA 2IA0A 2K27A 2FMYA 2FMLA 1PP8F 3B73A 3P9CA 2YX4A 2AS5F 1EH8A 3V8KA 1J2XA 1ZN2A 3HSRA 1TW3A 4BYYA 5A2QZ 3QP6A 3M8FA 5L3FA 2OAZA 3S2WA 5FFZA 3FXQA 1O57A 2XAQA 5JR3A 1W4MA 3DEUA 2Z33A 3QU6A 4AIJA 2Y48A 3O3KA 3FX3A 3F72A 1ZARA 4HF1A 3H3UA 3V4GA 2DW4A 1P4XA 2NAZA 1FBSA 2UZKA 4G7ZF 4IPAA 4BNCA 1NHAA 1P4WA 4OINF 3QRFF 2G7HA 4LLLA 3DV8A 2FBKA 1SD4A 3ML6A 2HFHA 2EJRA 3BDDA 1TNSA 2P5VA 4G6QA 1D5VA 5IT9Z 3DKWA 4IHSA 2EWNA 4XSZF 2ZCWA 2MBFA 1YIOA 1I6XA 2ETHA 1FYMA 2H27A 5IT3A 1AWCA 3KFWX 2O03A 1R5HA 5E20A 4L9TA 2KIMA 4FX0A 5BOXA 3FHZA 2PEXA 3KZYA 3GO5A 1OMIA 4QLCU 3WE2A 1FC3A 3IKVA 4Q5SF 4IRGA 1C0WA 3FXRA 4GYIA 2HR3A 2VBYA 2XAFA 3I71A 4CICA 4DQ2A 2RDPA 3KLOA 2K4BA 5D6FA 3FZVA 1E2XA 3ZP5A 2DT5A 3EUHA 1JGSA 1T98A 4MHGA 5F6FA 1LEBA 2BV6A 1MJBA 2IA1A 3E6CC 2KIFA 3DFGA 2O0YA 1R36A 1R22A 3CTAA 3K9TA 2HTSA 2OZUA 5LGUA 2W84A 1I5ZA 3PQKA 3R6SA 1KQ9A 3FM3A 4RAYA 2FU4A 1ON2A 3N97A 3HSFA 2DFIA 5CLSA 1LDJA 2XGXA 5ICFA 1EV7A 4UUVA 4KN7X 2E7XA 4HLXA 1YFHA 1UB9A 1SD7A 2PN6A 1R5GA 3E5QA 5FLXZ 1YW7A 2MA3A 5ICCA 3ZN0A 1J7KA 4K2EA 2VT3A 3ZMVA 1SMTA 2M8EA 3V7SA 3WGHA 2XV4S 2Q0OA 1FNNA 1ZRCA 5HVQC 1YYVA 3AAFA 4ESBA 1KA8A 3BP8A 4ZZDA 2PQ8A 4A12A 3HRTA 1S7AA 2BE5F 3QPTA 1FYLA 3F22A 5HLGA 3F6OA 1UHWA 2QLZA 4EQQA 1FOKA 2V1DA 4N9HA 1I1SA 4A0YA 3FMRA 3F8FA 3K69A 1F1ZA 5E1WA 4YFNF 1JXSA 4G7OF 2LF8A 3SHFA 5H6RA 1IRGA 2L4AA 3CO6C 3J81K 5E18F 5D8LB 5KK1A 4OMYA 4HX7A 3CDHA 3L9FA 3C7JA 4M72A 3ZMTA 2RC4A 2EA4A 4BHBA 3D5LA 1IN7A 3GXOA 2V1UA 5TRDA 4P9FA 2XRNA 5AONA 1K7AA 2QWWA 2V79A 2RN7A 2IRFG 3HIFA 2EV0A 2X4HA 1I27A 1J9IA 1U6GA 5ILSA 2GXGA 3CUQA 2VC1A 4OIOF 4N0BA 2A61A 4UHTA 4KUMA 6PAXA 1U5TC 4WCGA 4RB2C 2PBIA 2VOOA 3REOA 4BXUA 2JT1A 5HDNA 4MQ9F 1W7PD 5TJJA 2WWYA 4P9UA 2OZ6A 2JPCA 1P92A 2P7VB 4RAZA 1DUXC 2YSRA 2DTRA 2HYFA 4KMUX 1ZLJA 3DQVC 3IWFA 1HSTA 1FWZA 3LSTA 3ELKA 1BI2A 1HSJA 1HKSA 3MCZA 2A6HF 2VXZA 4MEXF 4ESJA 3IRRA 4KNYA 5DEQA 1BN5A 4ENNA 4P96A 3EDPA 1R58A 1W5SA 4EJOA 4ZYEA 2OU2A 4WF2A 4KIGA 2XAJA 2P6SA 3KETA 2HGCA 1FT9A 4IXAA 2Q2EA 1BC8C 2FSWA 1OR7A 3I0TA 1KU3A 1PDNC 2COMA 4BH9A 1F9NA 2ZMEA 1KGSA 4U7BA 3WTYC 4BQAA 2IJLA 4LG0B 3BJAA 4KMFA 1SMYF 1XCVA 4DNCA 3FMSA 3RPUA 1IN8A 3RTRA 1BI3A 5E1ZB 5HLIA 4B8XA 4YG2F 2MH9A 1XN7A 3MFKA 4U0VA 1HQCA 1LVAA 4A5NA 2DQRA 3VODA 3KE2A 4M9XA 2QM3A 5BS6A 3E5UA 5LLQA 1W5TA 2EA2A 2P7CB 4S04A 2GA1A 5BQTA 5LEKA 1GHCA 4KA4A 5BPIA 2RNJA 3MZHA 3B02A 1R7JA 2O3FA 3N4MA 1UCRA 1HW1A 2QZ8A 2QBYA 4A2UA 1MKMA 4ZYHA 4ZZLA 3J81Z 2MC3A 5FO5A 4WWCA 4AD9A 1Z1DA 1SFXA 4AWXB 5HDKA 2VE9A 1V4RA 4MQVA 4EJTA 1BJAA 2ISZA 2MH2A 3LAPA 4M9SA 5E1XA 2K02A 4IJAA 5L3DA 3R60A 3KEOA 3F23A 4IHTA 1RI7A 3ECOA 2R7FA 3K2ZA 2JPBA 3O2PE 2PI0A 4WK8F 1K78B 3VFZA 3R0JA 2RGVA 1B9NA 2GA2A 4KIFA 3COAC 4ESFA 1UFMA 3T8TA 1XB4A 3JTHA 4KFCA 2IVMA 4KYWA 1MJAA 1YS7A 2XHKA 3OOPA 2PG4A 2DQLA 3F6VA 2HKXA 2P5KA 3L2CA 4CDGA 5D5UB 3GFLA 5JVTA 1SAXA 4I7HA 2OBPA 2CWEA 5HDGA 1RUOA 4PGGA 4OOIA 5K1YA 1XDUA 1F5TA 4BHPA 1CF7A 1O3RA 2KRFA 1P2FA 3R4KA 1HKTA 3Q9VA 2HTJA 3SZPA 1IF1A 1WWXA 2OQRA 2A68F 5L3GA 1LDKB 4HDVA 4ON0A 3ABTA 3I59B 4I0AA 4ASNA 1FSEA 3TO6A 3ULQB 3JTGA 2IPQX 1O7FA 1W7PB 4UVAA 3W6JB 3K1MA 1R1UA 1Z7UA 2KIUA 4HX8A 4ZYDA 4Q4ZF 4Q48A 5DCMA 4M9ZA 5LHGA 1MDMB 2WV0A 3KP2A 4O3MA 3M7GA 3HRMA 4Z2YA 3T0YA 2GZWA 3LA2A 3BROA 3GFJA 3KEQA 3PQJA 4H0EA 2XASA 1WQ2A 3BY6A 2PMUA 2CYYA 3HTSB 1ZGAA 5HS9A 4RS8A 2L02A 1S8NA 4HOBA 3K1NA 4L5IA 1TNTA 2IP2A 1PUEE 2HDCA 3J80Z 2EK5A 3IWZA 4G6DA 2MLKA 5F1RA 1WKMA 4LB5A 4ZH4F 5CVUA 4L5JA 2STTA 1IN6A 1P4AA 2PLYA 2UWMA 1U5TA 5H20A 1ZRFA 2HS5A 1HW5A 3WE3A 2GWRA 4EM2A 3EYYA 4HDUA 2D45A 2L54A 3GX4X 5JHUA 2ZBKA 3ROUA 2GXBA 5J8FA 2P5LC 3H3ZA 2E1NA 3LA7A 1WSUA 2XKOA 3RYPA 5KVRA 2QQAA 1BI0A 4CZZA 1XGOA 3MAJA 3TO7A 3GUDA 2G7UA 2M1BA 2FBIA 5J6XA 3ZMSA 1QNTA 3CLOA 4IF4A 1XDSA 4L9NA 2VC0A 2J5PA 1SD6A 3TKYA 2F5FA 3WGIA 4YFXF 4YFKF 1REPC 4AIHA 2GQQA 4WXHA 3U9GA 3DPLC 1XGNA 2RQPA 1FLIA 4OIPF 2HWVA 1U3EM 1XCBA 5DCMB 5D4SA 1KYZA 2C6YA 1BIAA 1HBXG 3KCCA 2ZJ2A 2L4MA 2DO7A 1L3LA 1J5YA 2F5DA 1S6LA 4GXOA 1BI1A 1VTNC 2A6EF 4HLYA 1TQPA 1LEAA 5CJ9A 4EGYA 5E17F 3HTUA 2V1XA 4OIRF 3V7CA 2CO5A 5DD8A 1XGSA 4ENMA 3MQ0A 5K5OA 2H6CA 3ZQ7A 4XLPF 3TOBA 2FBHA 2O61A 5HS8A 2DBBA 4YIFA 3JAMK 2HZTA 1G3TA 2EV6A 1FBUA 1ULYA 3KP6A 4EGZA 2DI3A 4MTDA 1ZG5A 3CJNA 1FYKA 1YO5C 3RKYA 2CQKA 2MD5A 2FNPA 1RNLA 1S29A 4HF0A 4M74A 5K5RA 2HKOA 1ZGJA 3MZYA 1FSHA 5DUKA 1ZAOA 3GFMA 4AIKA 3GZ6A 4FT8A 4G7HF 4N9IA 5L3EA 5LRSA 1RZ4A 3VB2A 4U0YA 2DK8A 1J59A 2QYOA 4UVBA 1JHFA 2NYXA 3HHHA 4PCQA 1Z91A 4XRFA 4KN4X 3J7AO 1EH6A 1YLFA 5D5XB 2G9WA 3LFKA 5ED4A 1X3UA 3EYIA 3FWEA 4KDPA 3GFIA 3TDZC 3C3WA 3VEPA 3GEZA 1IAWA 4L18B 5DDGA 1YQAA 2R7DA 2P8TA 1ZLKA 4CHUA 5CVJA 1KU7A 3P9IA 1KU9A 4I98B 3SQNA 2BBYA 1GXQA 1BC7C 2DPDA 2YPRA 4A6DA 4UV8A 4PZJA 4KIBA 2CG4A 5A2QK 2D1HA 2Y75A 2DPUA 4CXFA 1USSA 2FQ3A 1ZRDA 4IRHA 3U2RA 4I0BA 3I64A 5FFXA 2P4WA 4ZYGA 5DUIA 2B0LA 3IRQA 4XSXF 5CVRA 3ZMDA 2L01A 3IKTA 1HXDA 4CYDA 1G4DA 3BPVA 2LKPA 2VT2A 1IXRC 2X0LA 2JTVA 3LQQA 2PJPA 4M71A 4WXDA 3NRVA 3K1PA 3DF8A 4A0XA 4CGZA 4U7DA 4LLGF 5CYVA 3SZTA 3NEUA 4HA8A 1F4KA 5LGNA 4UVCA 3CO7C 1QZYA 2BGCA 4L9JA 4LJZF 1YW8A 2KKOA 5EEHA 2HEOA 2ELHA 4HW0A 4HQMA 1SD5A 1IZ1A 5D4RA 3IC7A 3E97A 3I53A 2M5WA 2A3SA 5IT9K 4ENKA 3R61A 2EV5A 4EJWA 1T2KA 1HW2A 1ZHFA 4EV0A 1YS6A 1MGTA 3D0SA 3R0AA 4LD5A 3WTSC 5D5WB 3I54A 2VOPA 4G9YA 2JZYA 5LEJA 4HQEA 3RYRA 4IVNA 2VBZA 4GYGA 2E1CA 1ZG1A 2XVCA 1T6SA 2QQBA 3F21A 2XAHA 1LDDA 3MWMA 1LJ9A 1UHMA 5LHHA 3L7WA 3CUQB 3ISPA 4Q47A 4S05A 4GO1A 4LFUA 4ETSA 1XSDA 2FNAA 1XSVA 3Q5FA 4WXCA 3PFIA 2BEOA 5E8IA 1QQIA 2W57A 4JK1X 5ILUA 4NQWA 1IRFA 3V8LA 1QPMA 2L3DA 2OA4A 4HBLA 3EETA 3FF5A 4RB3C 3WTVC 3GWZA 4R79A 2CW0F 3RKXA 2LSOA 5K5QA 3SXYA 2FE3A 1KU2A 1IUYA 2QQ9A 1TLHB 3GW2A 4KT5C 3V8JA 3ZMZA 2ZO4A 1J75A 4P5OA 2FF4A 3HHGA 4R8HA 4AVPA 1XD7A 1G6NA 3P9KA 1U2WA 1OYWA 5E8GA 2NS0A 4JBAA 3QPHA 3QU3A 1Z05A 5FLXK 1H0MA 2YR2A 3VOEA 2ZKZA 2NNNA 4U0WA 3KP3A 5ILVA 1B4AA 5CVIA 2ZMEB 5D8KB 3FMQA 3HSEA 3L00A 4G8XA 2M30A 2V9VA 1KYWA 4WX9A 4HV6A 2A5YB 3HUGA 1S3JA 1R1TA 2Z9OA 3DP7A 3BJ6A 4RGUA 2M87A 5CVVA 1G3SA 1R00A 1H9GA 1IW7F 2W85A 4NB5A 5HS7A 3ECHA 1J0RA 1QO0D 1LQ1A 1O3TA 3HOSA 3HYIA 4CO8A 2EFNA 1MZBA 1OYYA 1V3FA 2XUBA 3WTWC 2QBYB 3ZN1A 1BM9A 3E5XA 1GXPA 2O6GE 1B9MA 2RVCA 3LAJA 5DV5A 2F5CA 2YX7A 3LQRA 4IRIA 4I01A 2EFPA 1T0FA 3KP4A 2TDXA 1FP1D 2GAUA 1DPRA 3JW4A 2MLGA 1ZH5A 2YU3A 2UXXA 3GF2A 4MTEA 1FBQA 2ESNA 3FM5A 2DAOA 3I4PA 4NHJA 5D5VB 2D2WA 3BPXA 3F8CA 4PDKA 5AIQA 3JSOA 1O3QA 3QOPA 4MNUA 1P6RA 3WTXC 4L9VA 3W6KB 1O3SA 3L09A 1K6OA 2BYVE 4Y13A 1ONVA 3U1DA 4MEYF 3F8BA 1CF7B 2FA5A 2Z3YA 3WG9A 4OIQF 1HKQA 3NQOA 1T39A 2QUFA 2K7LA 2QVOA 4UNOA 2EB7A 2D1VA 3DPTA 3M8EA 3GVAA 4B09A 4L0YB 4RGRA 1D3YA 2DK5A 1IN5A 3G73A 1G3YA 5BMZA 1FPQA 2K86A 2OD5A 1EH7A 4OU0A 4P55A 4EM1A 2RKHA 3TGNA 1PP7U 3IHUA 1ZREA 3CUOA 1Z6TA 2VBWA 5HOOA 5LHIA 3WTUC 4E70A 1H9TA 4RGXA 5DD4A 2IA2A 4GGGA 4HZFA 1CGPA 1Z9CA 4LK0F 1D8KA 3WU0A 1RUNA 2HOEA 5FB2A 2LDUA 2M45A 1JE8A 2Q8KA 2HQNA 2LNBA 1XMAA 4KICA 3F8NA 1ODDA 1ZG3A 3BOQA 1AOYA 4PGHA 1WRJA 3E6BA 5FD5A 3FXUA 2FEZA 5LGTA 3OV8A 1TQMA 4LLNA 4HYEA 5FGMA 4RB1A 1QGPA 4EVIA 3TO9A 4LGWA 3GLXA 1XSXA 3C1DA 2XAGA 1T38A 3I5UA 4M73A 4UV9A 2OQGA 1E17A 2WTEA 2ADUA 1U5TB 2K4JA 4HX4A 1I1GA 2ZNZA 1DPUA 3M9AA 5L3CA 4M6XA 3RIRA 4F7ZA 2DLLA 2VBXA 1Z6RA 3T1BA 4YIIA 2STWA 4A0ZA 1B6AA 3E6DA 4LG0A 4O6JA 2IW5A 4EMSA 2CGPA 1BBYA 1USTA 3KLNA 2W25A 2EFQA 1OKRA 3ZPLA 3T5XA 3G3ZA 2R3SA 5EEGA 1TTYA 2PMHA 5J8CA 2H09A 3ZMUA 5LBQA 4HF2A 1U78A 1R23A 1SFUA 2HQRA 2E7WA 4EM0B 3LWFA 3KZZA 5DYMA 2ACJA 1YW9A 1A04A 1XGMA 2GIVA 4HAMA 2LF7A 2NRAC 3LA3A 2WC2A 3RDIA 1U8RA 2H6BA 5BPDA 3RPQA 4A5MA 1MD0A 1JHHA 3WGGA 2ZFWA 5H6QA 4I02A 1O7LA 2UXNA 2FOKA 1KQ0A 1IN4A 3MEXA 4O5VA 4ENJA 2ESHA 3C18A 1LNWA 3H92A 1S7OA 3IL2A 5HLHA 1FY7A 1K78A 1BOAA 3P7NA 2V6CA 1FX7A 1B1BA 3BZ6A 2CSOA 4EJUA 3F8MA 3DXJF 2VONA 1FZPB 3E6MA 4BHCA 2FRHA 1QBJA 3RJPA 1OYIA 2ZNYA 1Y0UA 3Q9SA 4D0PA 4I2OA 2A07F 4QWQA 2Y0MA 4LB6B 4UXNA 4G94A 3TDUC 2ZXJA 3HOTA 3QP5A 1KQ8A 4FX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RV8 A;  4GCV A;  3T8R A;  4BAY A;  4HV5 A;  2IT0 A;  2ISY A;  1OPC A;  3E3V A;  4XLN F;  1GVJ A;  4R1H A;  2HYG D;  2P6T A;  4I09 A;  3I59 A;  5ICG A;  1STZ A;  2JSC A;  1ON1 A;  3GZ5 A;  3BJO A;  5JFR A;  1W7P A;  4EJV A;  3J80 K;  3WOD F;  1MJ9 A;  1DDN A;  4FHT A;  3F3X A;  1RIO H;  5ICE A;  3JAM Z;  3JSP A;  1ZYR F;  5FD6 A;  3EQL F;  1MDM A;  2PFB A;  3M1E A;  4OMZ A;  2XIG A;  3V7R A;  3RKW A;  5LRR A;  5F64 A;  4LMY A;  3HRS A;  4JQF A;  2AXL A;  2VOD A;  1G3W A;  2KJC A;  2Z5U A;  4A6E A;  4L0Z B;  2O8X A;  2VN2 A;  2H94 A;  1TBX A;  2XRO A;  4RGS A;  4Y15 A;  1DP7 P;  1IXC A;  5L3B A;  2EFW A;  1FP2 A;  2FXA A;  1R1V A;  1BIB A;  2CFX A;  5ERI A;  4RB0 A;  2VE8 A;  1YTY A;  1K79 A;  2JRT A;  1L0O C;  3HRU A;  1YG2 A;  5DCF A;  3GYH X;  3BWG A;  4TV7 A;  2DU9 A;  5AIP A;  2NNY A;  1LB2 A;  3I58 A;  1QZZ A;  1TQI A;  1Q1H A;  2W24 A;  3SFZ A;  2EFO A;  4U88 A;  2Z99 A;  2J5O A;  5JI6 A;  4XBF A;  3TQN A;  3WTZ A;  3ERE D;  3K0L A;  2F5E A;  1TW2 A;  3TOA A;  4LK1 F;  3O6B B;  2QEN A;  4MGR A;  1D8J A;  3ABU A;  3WTT C;  1SFE A;  3KP7 A;  2KJB A;  3QAH A;  3WU1 B;  1IXS B;  2A69 F;  3CUQ C;  1B59 A;  1XMK A;  4M6Y A;  1WI9 A;  2XKP A;  3RI4 A;  2F2E A;  4Y17 A;  3KP5 A;  5D6E A;  2IA0 A;  2K27 A;  2FMY A;  2FML A;  1PP8 F;  3B73 A;  3P9C A;  2YX4 A;  2AS5 F;  1EH8 A;  3V8K A;  1J2X A;  1ZN2 A;  3HSR A;  1TW3 A;  4BYY A;  5A2Q Z;  3QP6 A;  3M8F A;  5L3F A;  2OAZ A;  3S2W A;  5FFZ A;  3FXQ A;  1O57 A;  2XAQ A;  5JR3 A;  1W4M A;  3DEU A;  2Z33 A;  3QU6 A;  4AIJ A;  2Y48 A;  3O3K A;  3FX3 A;  3F72 A;  1ZAR A;  4HF1 A;  3H3U A;  3V4G A;  2DW4 A;  1P4X A;  2NAZ A;  1FBS A;  2UZK A;  4G7Z F;  4IPA A;  4BNC A;  1NHA A;  1P4W A;  4OIN F;  3QRF F;  2G7H A;  4LLL A;  3DV8 A;  2FBK A;  1SD4 A;  3ML6 A;  2HFH A;  2EJR A;  3BDD A;  1TNS A;  2P5V A;  4G6Q A;  1D5V A;  5IT9 Z;  3DKW A;  4IHS A;  2EWN A;  4XSZ F;  2ZCW A;  2MBF A;  1YIO A;  1I6X A;  2ETH A;  1FYM A;  2H27 A;  5IT3 A;  1AWC A;  3KFW X;  2O03 A;  1R5H A;  5E20 A;  4L9T A;  2KIM A;  4FX0 A;  5BOX A;  3FHZ A;  2PEX A;  3KZY A;  3GO5 A;  1OMI A;  4QLC U;  3WE2 A;  1FC3 A;  3IKV A;  4Q5S F;  4IRG A;  1C0W A;  3FXR A;  4GYI A;  2HR3 A;  2VBY A;  2XAF A;  3I71 A;  4CIC A;  4DQ2 A;  2RDP A;  3KLO A;  2K4B A;  5D6F A;  3FZV A;  1E2X A;  3ZP5 A;  2DT5 A;  3EUH A;  1JGS A;  1T98 A;  4MHG A;  5F6F A;  1LEB A;  2BV6 A;  1MJB A;  2IA1 A;  3E6C C;  2KIF A;  3DFG A;  2O0Y A;  1R36 A;  1R22 A;  3CTA A;  3K9T A;  2HTS A;  2OZU A;  5LGU A;  2W84 A;  1I5Z A;  3PQK A;  3R6S A;  1KQ9 A;  3FM3 A;  4RAY A;  2FU4 A;  1ON2 A;  3N97 A;  3HSF A;  2DFI A;  5CLS A;  1LDJ A;  2XGX A;  5ICF A;  1EV7 A;  4UUV A;  4KN7 X;  2E7X A;  4HLX A;  1YFH A;  1UB9 A;  1SD7 A;  2PN6 A;  1R5G A;  3E5Q A;  5FLX Z;  1YW7 A;  2MA3 A;  5ICC A;  3ZN0 A;  1J7K A;  4K2E A;  2VT3 A;  3ZMV A;  1SMT A;  2M8E A;  3V7S A;  3WGH A;  2XV4 S;  2Q0O A;  1FNN A;  1ZRC A;  5HVQ C;  1YYV A;  3AAF A;  4ESB A;  1KA8 A;  3BP8 A;  4ZZD A;  2PQ8 A;  4A12 A;  3HRT A;  1S7A A;  2BE5 F;  3QPT A;  1FYL A;  3F22 A;  5HLG A;  3F6O A;  1UHW A;  2QLZ A;  4EQQ A;  1FOK A;  2V1D A;  4N9H A;  1I1S A;  4A0Y A;  3FMR A;  3F8F A;  3K69 A;  1F1Z A;  5E1W A;  4YFN F;  1JXS A;  4G7O F;  2LF8 A;  3SHF A;  5H6R A;  1IRG A;  2L4A A;  3CO6 C;  3J81 K;  5E18 F;  5D8L B;  5KK1 A;  4OMY A;  4HX7 A;  3CDH A;  3L9F A;  3C7J A;  4M72 A;  3ZMT A;  2RC4 A;  2EA4 A;  4BHB A;  3D5L A;  1IN7 A;  3GXO A;  2V1U A;  5TRD A;  4P9F A;  2XRN A;  5AON A;  1K7A A;  2QWW A;  2V79 A;  2RN7 A;  2IRF G;  3HIF A;  2EV0 A;  2X4H A;  1I27 A;  1J9I A;  1U6G A;  5ILS A;  2GXG A;  3CUQ A;  2VC1 A;  4OIO F;  4N0B A;  2A61 A;  4UHT A;  4KUM A;  6PAX A;  1U5T C;  4WCG A;  4RB2 C;  2PBI A;  2VOO A;  3REO A;  4BXU A;  2JT1 A;  5HDN A;  4MQ9 F;  1W7P D;  5TJJ A;  2WWY A;  4P9U A;  2OZ6 A;  2JPC A;  1P92 A;  2P7V B;  4RAZ A;  1DUX C;  2YSR A;  2DTR A;  2HYF A;  4KMU X;  1ZLJ A;  3DQV C;  3IWF A;  1HST A;  1FWZ A;  3LST A;  3ELK A;  1BI2 A;  1HSJ A;  1HKS A;  3MCZ A;  2A6H F;  2VXZ A;  4MEX F;  4ESJ A;  3IRR A;  4KNY A;  5DEQ A;  1BN5 A;  4ENN A;  4P96 A;  3EDP A;  1R58 A;  1W5S A;  4EJO A;  4ZYE A;  2OU2 A;  4WF2 A;  4KIG A;  2XAJ A;  2P6S A;  3KET A;  2HGC A;  1FT9 A;  4IXA A;  2Q2E A;  1BC8 C;  2FSW A;  1OR7 A;  3I0T A;  1KU3 A;  1PDN C;  2COM A;  4BH9 A;  1F9N A;  2ZME A;  1KGS A;  4U7B A;  3WTY C;  4BQA A;  2IJL A;  4LG0 B;  3BJA A;  4KMF A;  1SMY F;  1XCV A;  4DNC A;  3FMS A;  3RPU A;  1IN8 A;  3RTR A;  1BI3 A;  5E1Z B;  5HLI A;  4B8X A;  4YG2 F;  2MH9 A;  1XN7 A;  3MFK A;  4U0V A;  1HQC A;  1LVA A;  4A5N A;  2DQR A;  3VOD A;  3KE2 A;  4M9X A;  2QM3 A;  5BS6 A;  3E5U A;  5LLQ A;  1W5T A;  2EA2 A;  2P7C B;  4S04 A;  2GA1 A;  5BQT A;  5LEK A;  1GHC A;  4KA4 A;  5BPI A;  2RNJ A;  3MZH A;  3B02 A;  1R7J A;  2O3F A;  3N4M A;  1UCR A;  1HW1 A;  2QZ8 A;  2QBY A;  4A2U A;  1MKM A;  4ZYH A;  4ZZL A;  3J81 Z;  2MC3 A;  5FO5 A;  4WWC A;  4AD9 A;  1Z1D A;  1SFX A;  4AWX B;  5HDK A;  2VE9 A;  1V4R A;  4MQV A;  4EJT A;  1BJA A;  2ISZ A;  2MH2 A;  3LAP A;  4M9S A;  5E1X A;  2K02 A;  4IJA A;  5L3D A;  3R60 A;  3KEO A;  3F23 A;  4IHT A;  1RI7 A;  3ECO A;  2R7F A;  3K2Z A;  2JPB A;  3O2P E;  2PI0 A;  4WK8 F;  1K78 B;  3VFZ A;  3R0J A;  2RGV A;  1B9N A;  2GA2 A;  4KIF A;  3COA C;  4ESF A;  1UFM A;  3T8T A;  1XB4 A;  3JTH A;  4KFC A;  2IVM A;  4KYW A;  1MJA A;  1YS7 A;  2XHK A;  3OOP A;  2PG4 A;  2DQL A;  3F6V A;  2HKX A;  2P5K A;  3L2C A;  4CDG A;  5D5U B;  3GFL A;  5JVT A;  1SAX A;  4I7H A;  2OBP A;  2CWE A;  5HDG A;  1RUO A;  4PGG A;  4OOI A;  5K1Y A;  1XDU A;  1F5T A;  4BHP A;  1CF7 A;  1O3R A;  2KRF A;  1P2F A;  3R4K A;  1HKT A;  3Q9V A;  2HTJ A;  3SZP A;  1IF1 A;  1WWX A;  2OQR A;  2A68 F;  5L3G A;  1LDK B;  4HDV A;  4ON0 A;  3ABT A;  3I59 B;  4I0A A;  4ASN A;  1FSE A;  3TO6 A;  3ULQ B;  3JTG A;  2IPQ X;  1O7F A;  1W7P B;  4UVA A;  3W6J B;  3K1M A;  1R1U A;  1Z7U A;  2KIU A;  4HX8 A;  4ZYD A;  4Q4Z F;  4Q48 A;  5DCM A;  4M9Z A;  5LHG A;  1MDM B;  2WV0 A;  3KP2 A;  4O3M A;  3M7G A;  3HRM A;  4Z2Y A;  3T0Y A;  2GZW A;  3LA2 A;  3BRO A;  3GFJ A;  3KEQ A;  3PQJ A;  4H0E A;  2XAS A;  1WQ2 A;  3BY6 A;  2PMU A;  2CYY A;  3HTS B;  1ZGA A;  5HS9 A;  4RS8 A;  2L02 A;  1S8N A;  4HOB A;  3K1N A;  4L5I A;  1TNT A;  2IP2 A;  1PUE E;  2HDC A;  3J80 Z;  2EK5 A;  3IWZ A;  4G6D A;  2MLK A;  5F1R A;  1WKM A;  4LB5 A;  4ZH4 F;  5CVU A;  4L5J A;  2STT A;  1IN6 A;  1P4A A;  2PLY A;  2UWM A;  1U5T A;  5H20 A;  1ZRF A;  2HS5 A;  1HW5 A;  3WE3 A;  2GWR A;  4EM2 A;  3EYY A;  4HDU A;  2D45 A;  2L54 A;  3GX4 X;  5JHU A;  2ZBK A;  3ROU A;  2GXB A;  5J8F A;  2P5L C;  3H3Z A;  2E1N A;  3LA7 A;  1WSU A;  2XKO A;  3RYP A;  5KVR A;  2QQA A;  1BI0 A;  4CZZ A;  1XGO A;  3MAJ A;  3TO7 A;  3GUD A;  2G7U A;  2M1B A;  2FBI A;  5J6X A;  3ZMS A;  1QNT A;  3CLO A;  4IF4 A;  1XDS A;  4L9N A;  2VC0 A;  2J5P A;  1SD6 A;  3TKY A;  2F5F A;  3WGI A;  4YFX F;  4YFK F;  1REP C;  4AIH A;  2GQQ A;  4WXH A;  3U9G A;  3DPL C;  1XGN A;  2RQP A;  1FLI A;  4OIP F;  2HWV A;  1U3E M;  1XCB A;  5DCM B;  5D4S A;  1KYZ A;  2C6Y A;  1BIA A;  1HBX G;  3KCC A;  2ZJ2 A;  2L4M A;  2DO7 A;  1L3L A;  1J5Y A;  2F5D A;  1S6L A;  4GXO A;  1BI1 A;  1VTN C;  2A6E F;  4HLY A;  1TQP A;  1LEA A;  5CJ9 A;  4EGY A;  5E17 F;  3HTU A;  2V1X A;  4OIR F;  3V7C A;  2CO5 A;  5DD8 A;  1XGS A;  4ENM A;  3MQ0 A;  5K5O A;  2H6C A;  3ZQ7 A;  4XLP F;  3TOB A;  2FBH A;  2O61 A;  5HS8 A;  2DBB A;  4YIF A;  3JAM K;  2HZT A;  1G3T A;  2EV6 A;  1FBU A;  1ULY A;  3KP6 A;  4EGZ A;  2DI3 A;  4MTD A;  1ZG5 A;  3CJN A;  1FYK A;  1YO5 C;  3RKY A;  2CQK A;  2MD5 A;  2FNP A;  1RNL A;  1S29 A;  4HF0 A;  4M74 A;  5K5R A;  2HKO A;  1ZGJ A;  3MZY A;  1FSH A;  5DUK A;  1ZAO A;  3GFM A;  4AIK A;  3GZ6 A;  4FT8 A;  4G7H F;  4N9I A;  5L3E A;  5LRS A;  1RZ4 A;  3VB2 A;  4U0Y A;  2DK8 A;  1J59 A;  2QYO A;  4UVB A;  1JHF A;  2NYX A;  3HHH A;  4PCQ A;  1Z91 A;  4XRF A;  4KN4 X;  3J7A O;  1EH6 A;  1YLF A;  5D5X B;  2G9W A;  3LFK A;  5ED4 A;  1X3U A;  3EYI A;  3FWE A;  4KDP A;  3GFI A;  3TDZ C;  3C3W A;  3VEP A;  3GEZ A;  1IAW A;  4L18 B;  5DDG A;  1YQA A;  2R7D A;  2P8T A;  1ZLK A;  4CHU A;  5CVJ A;  1KU7 A;  3P9I A;  1KU9 A;  4I98 B;  3SQN A;  2BBY A;  1GXQ A;  1BC7 C;  2DPD A;  2YPR A;  4A6D A;  4UV8 A;  4PZJ A;  4KIB A;  2CG4 A;  5A2Q K;  2D1H A;  2Y75 A;  2DPU A;  4CXF A;  1USS A;  2FQ3 A;  1ZRD A;  4IRH A;  3U2R A;  4I0B A;  3I64 A;  5FFX A;  2P4W A;  4ZYG A;  5DUI A;  2B0L A;  3IRQ A;  4XSX F;  5CVR A;  3ZMD A;  2L01 A;  3IKT A;  1HXD A;  4CYD A;  1G4D A;  3BPV A;  2LKP A;  2VT2 A;  1IXR C;  2X0L A;  2JTV A;  3LQQ A;  2PJP A;  4M71 A;  4WXD A;  3NRV A;  3K1P A;  3DF8 A;  4A0X A;  4CGZ A;  4U7D A;  4LLG F;  5CYV A;  3SZT A;  3NEU A;  4HA8 A;  1F4K A;  5LGN A;  4UVC A;  3CO7 C;  1QZY A;  2BGC A;  4L9J A;  4LJZ F;  1YW8 A;  2KKO A;  5EEH A;  2HEO A;  2ELH A;  4HW0 A;  4HQM A;  1SD5 A;  1IZ1 A;  5D4R A;  3IC7 A;  3E97 A;  3I53 A;  2M5W A;  2A3S A;  5IT9 K;  4ENK A;  3R61 A;  2EV5 A;  4EJW A;  1T2K A;  1HW2 A;  1ZHF A;  4EV0 A;  1YS6 A;  1MGT A;  3D0S A;  3R0A A;  4LD5 A;  3WTS C;  5D5W B;  3I54 A;  2VOP A;  4G9Y A;  2JZY A;  5LEJ A;  4HQE A;  3RYR A;  4IVN A;  2VBZ A;  4GYG A;  2E1C A;  1ZG1 A;  2XVC A;  1T6S A;  2QQB A;  3F21 A;  2XAH A;  1LDD A;  3MWM A;  1LJ9 A;  1UHM A;  5LHH A;  3L7W A;  3CUQ B;  3ISP A;  4Q47 A;  4S05 A;  4GO1 A;  4LFU A;  4ETS A;  1XSD A;  2FNA A;  1XSV A;  3Q5F A;  4WXC A;  3PFI A;  2BEO A;  5E8I A;  1QQI A;  2W57 A;  4JK1 X;  5ILU A;  4NQW A;  1IRF A;  3V8L A;  1QPM A;  2L3D A;  2OA4 A;  4HBL A;  3EET A;  3FF5 A;  4RB3 C;  3WTV C;  3GWZ A;  4R79 A;  2CW0 F;  3RKX A;  2LSO A;  5K5Q A;  3SXY A;  2FE3 A;  1KU2 A;  1IUY A;  2QQ9 A;  1TLH B;  3GW2 A;  4KT5 C;  3V8J A;  3ZMZ A;  2ZO4 A;  1J75 A;  4P5O A;  2FF4 A;  3HHG A;  4R8H A;  4AVP A;  1XD7 A;  1G6N A;  3P9K A;  1U2W A;  1OYW A;  5E8G A;  2NS0 A;  4JBA A;  3QPH A;  3QU3 A;  1Z05 A;  5FLX K;  1H0M A;  2YR2 A;  3VOE A;  2ZKZ A;  2NNN A;  4U0W A;  3KP3 A;  5ILV A;  1B4A A;  5CVI A;  2ZME B;  5D8K B;  3FMQ A;  3HSE A;  3L00 A;  4G8X A;  2M30 A;  2V9V A;  1KYW A;  4WX9 A;  4HV6 A;  2A5Y B;  3HUG A;  1S3J A;  1R1T A;  2Z9O A;  3DP7 A;  3BJ6 A;  4RGU A;  2M87 A;  5CVV A;  1G3S A;  1R00 A;  1H9G A;  1IW7 F;  2W85 A;  4NB5 A;  5HS7 A;  3ECH A;  1J0R A;  1QO0 D;  1LQ1 A;  1O3T A;  3HOS A;  3HYI A;  4CO8 A;  2EFN A;  1MZB A;  1OYY A;  1V3F A;  2XUB A;  3WTW C;  2QBY B;  3ZN1 A;  1BM9 A;  3E5X A;  1GXP A;  2O6G E;  1B9M A;  2RVC A;  3LAJ A;  5DV5 A;  2F5C A;  2YX7 A;  3LQR A;  4IRI A;  4I01 A;  2EFP A;  1T0F A;  3KP4 A;  2TDX A;  1FP1 D;  2GAU A;  1DPR A;  3JW4 A;  2MLG A;  1ZH5 A;  2YU3 A;  2UXX A;  3GF2 A;  4MTE A;  1FBQ A;  2ESN A;  3FM5 A;  2DAO A;  3I4P A;  4NHJ A;  5D5V B;  2D2W A;  3BPX A;  3F8C A;  4PDK A;  5AIQ A;  3JSO A;  1O3Q A;  3QOP A;  4MNU A;  1P6R A;  3WTX C;  4L9V A;  3W6K B;  1O3S A;  3L09 A;  1K6O A;  2BYV E;  4Y13 A;  1ONV A;  3U1D A;  4MEY F;  3F8B A;  1CF7 B;  2FA5 A;  2Z3Y A;  3WG9 A;  4OIQ F;  1HKQ A;  3NQO A;  1T39 A;  2QUF A;  2K7L A;  2QVO A;  4UNO A;  2EB7 A;  2D1V A;  3DPT A;  3M8E A;  3GVA A;  4B09 A;  4L0Y B;  4RGR A;  1D3Y A;  2DK5 A;  1IN5 A;  3G73 A;  1G3Y A;  5BMZ A;  1FPQ A;  2K86 A;  2OD5 A;  1EH7 A;  4OU0 A;  4P55 A;  4EM1 A;  2RKH A;  3TGN A;  1PP7 U;  3IHU A;  1ZRE A;  3CUO A;  1Z6T A;  2VBW A;  5HOO A;  5LHI A;  3WTU C;  4E70 A;  1H9T A;  4RGX A;  5DD4 A;  2IA2 A;  4GGG A;  4HZF A;  1CGP A;  1Z9C A;  4LK0 F;  1D8K A;  3WU0 A;  1RUN A;  2HOE A;  5FB2 A;  2LDU A;  2M45 A;  1JE8 A;  2Q8K A;  2HQN A;  2LNB A;  1XMA A;  4KIC A;  3F8N A;  1ODD A;  1ZG3 A;  3BOQ A;  1AOY A;  4PGH A;  1WRJ A;  3E6B A;  5FD5 A;  3FXU A;  2FEZ A;  5LGT A;  3OV8 A;  1TQM A;  4LLN A;  4HYE A;  5FGM A;  4RB1 A;  1QGP A;  4EVI A;  3TO9 A;  4LGW A;  3GLX A;  1XSX A;  3C1D A;  2XAG A;  1T38 A;  3I5U A;  4M73 A;  4UV9 A;  2OQG A;  1E17 A;  2WTE A;  2ADU A;  1U5T B;  2K4J A;  4HX4 A;  1I1G A;  2ZNZ A;  1DPU A;  3M9A A;  5L3C A;  4M6X A;  3RIR A;  4F7Z A;  2DLL A;  2VBX A;  1Z6R A;  3T1B A;  4YII A;  2STW A;  4A0Z A;  1B6A A;  3E6D A;  4LG0 A;  4O6J A;  2IW5 A;  4EMS A;  2CGP A;  1BBY A;  1UST A;  3KLN A;  2W25 A;  2EFQ A;  1OKR A;  3ZPL A;  3T5X A;  3G3Z A;  2R3S A;  5EEG A;  1TTY A;  2PMH A;  5J8C A;  2H09 A;  3ZMU A;  5LBQ A;  4HF2 A;  1U78 A;  1R23 A;  1SFU A;  2HQR A;  2E7W A;  4EM0 B;  3LWF A;  3KZZ A;  5DYM A;  2ACJ A;  1YW9 A;  1A04 A;  1XGM A;  2GIV A;  4HAM A;  2LF7 A;  2NRA C;  3LA3 A;  2WC2 A;  3RDI A;  1U8R A;  2H6B A;  5BPD A;  3RPQ A;  4A5M A;  1MD0 A;  1JHH A;  3WGG A;  2ZFW A;  5H6Q A;  4I02 A;  1O7L A;  2UXN A;  2FOK A;  1KQ0 A;  1IN4 A;  3MEX A;  4O5V A;  4ENJ A;  2ESH A;  3C18 A;  1LNW A;  3H92 A;  1S7O A;  3IL2 A;  5HLH A;  1FY7 A;  1K78 A;  1BOA A;  3P7N A;  2V6C A;  1FX7 A;  1B1B A;  3BZ6 A;  2CSO A;  4EJU A;  3F8M A;  3DXJ F;  2VON A;  1FZP B;  3E6M A;  4BHC A;  2FRH A;  1QBJ A;  3RJP A;  1OYI A;  2ZNY A;  1Y0U A;  3Q9S A;  4D0P A;  4I2O A;  2A07 F;  4QWQ A;  2Y0M A;  4LB6 B;  4UXN A;  4G94 A;  3TDU C;  2ZXJ A;  3HOT A;  3QP5 A;  1KQ8 A;  4FX4 A; 
#chains in the Genus database with same CATH topology
 2RV8 A;  3BZK A;  2ZJQ F;  4GCV A;  3T8R A;  3X2Q H;  1JJ8 C;  2HXO A;  4XLE A;  4BAY A;  1RES A;  3WHC A;  5EZH A;  4HV5 A;  1SVM A;  2IT0 A;  5JLX A;  3SZG A;  2ISY A;  1MBE A;  1OPC A;  3E3V A;  1FOY A;  4PJ0 C;  2XB5 A;  4XLN F;  4BXX J;  1GVJ A;  4R1H A;  2HYG D;  2P6T A;  4I09 A;  3I59 A;  5ICG A;  2CUZ A;  3ZQC A;  3GME A;  1STZ A;  4HNV A;  1BJZ A;  2JSC A;  1ON1 A;  3TP0 A;  1YIT I;  1DGR M;  1YRN A;  3GZ5 A;  3BJO A;  5JFR A;  4BDZ A;  3HOV J;  1W7P A;  1PUF A;  4EJV A;  3J80 K;  3WOD F;  1MJ9 A;  4PK4 A;  5F0C A;  1DDN A;  4FHT A;  2M8G X;  3F3X A;  4C2M J;  2Q1Z B;  1RIO H;  2MC4 A;  3LSK A;  1U0J A;  2R4G A;  5ICE A;  3GTM J;  3JAM Z;  3JSP A;  2HVR A;  5B1B H;  1ZYR F;  4NC7 A;  5FD6 A;  1EF4 A;  2DFH A;  3EQL F;  2AO9 A;  2EIN H;  2PFB A;  3M1E A;  1UHS A;  2CW7 A;  2XIG A;  4OMZ A;  1MDM A;  3TED A;  3W3C A;  3V7R A;  2DT6 A;  3HOU J;  3RKW A;  5LRR A;  5F64 A;  2DT7 B;  2WBM A;  4LMY A;  3HRS A;  1X3Z B;  3M3Y J;  2A5W A;  4JQF A;  2O8K A;  2AXL A;  1QHH D;  2IBD A;  2VOD A;  1G3W A;  2KJC A;  2Z5U A;  4A6E A;  4L0Z B;  2O8X A;  3UKG A;  2VN2 A;  3LFU A;  2H94 A;  1TBX A;  2XRO A;  3ZQH A;  3BTJ A;  4RGS A;  5M5W J;  1SAN A;  4Y15 A;  3OS0 A;  1DP7 P;  1IXC A;  5L3B A;  2EFW A;  3FIW A;  1FP2 A;  1WZ2 A;  2FXA A;  1R1V A;  1BIB A;  4RA2 A;  4C3J J;  1W1W E;  4A3E J;  2ECB A;  2CFX A;  3AG1 H;  5ERI A;  2A6T A;  1VFC A;  4RB0 A;  3LL7 A;  2VE8 A;  1XMX A;  1YTY A;  1K79 A;  2JRT A;  1VF9 A;  1L0O C;  4ZDL A;  4IO9 F;  3HRU A;  1YG2 A;  5DCF A;  3GYH X;  3BWG A;  4TV7 A;  2DU9 A;  5AIP A;  4ZDP A;  2NNY A;  1LB2 A;  3I58 A;  1QZZ A;  2M7B A;  5IYD J;  1TQI A;  1BL0 A;  1Q1H A;  3JRB A;  3QOE A;  2W24 A;  2QF7 A;  3SFZ A;  2EFO A;  4U88 A;  2Z99 A;  2J5O A;  5GTI C;  3UNG C;  2BY0 A;  4F93 B;  5JI6 A;  4XBF A;  1BW6 A;  3TQN A;  4F55 A;  3WTZ A;  2KMU A;  3ERE D;  2B9S A;  3K0L A;  4FE7 A;  2F5E A;  1TW2 A;  3TOA A;  5F0F A;  3BR0 A;  4LK1 F;  2B7E A;  3O6B B;  2QEN A;  4MGR A;  1D8J A;  3ABU A;  3WTT C;  4BEH B;  2HZD A;  1SFE A;  5FKL A;  3KP7 A;  2KJB A;  3K7A J;  2MGQ A;  3QAH A;  5B1A H;  4JX6 A;  3WU1 B;  1NG6 A;  1IXS B;  1V55 H;  2A69 F;  1B59 A;  3CUQ C;  4EAT A;  1XMK A;  2HVQ A;  1WI9 A;  3LOC A;  4M6Y A;  4CZC A;  2XKP A;  3RI4 A;  3DLA A;  2F2E A;  2AQF A;  3KP5 A;  4Y17 A;  3K70 D;  5D6E A;  2BZT A;  3CF2 A;  2VPL A;  2IA0 A;  4A69 C;  2K27 A;  3AG4 H;  4YEJ A;  2FMY A;  2FML A;  1PP8 F;  3B73 A;  1SEU A;  2ME0 A;  3P9C A;  2YX4 A;  2AS5 F;  4RMN A;  1EH8 A;  3V8K A;  1J2X A;  1ZN2 A;  3E7L A;  3HSR A;  1TW3 A;  4BYY A;  5A2Q Z;  5E3L A;  3QP6 A;  3M8F A;  3KYC B;  2ZSH B;  1JT6 A;  3MZ8 A;  5B5E C;  5F04 A;  3BR2 A;  5L3F A;  2OAZ A;  1U8B A;  3JRE A;  2E34 A;  3S2W A;  4C3H J;  2VQC A;  5FFZ A;  2VXD A;  3FXQ A;  1HCR A;  5GAD J;  1O57 A;  4ITV A;  4Y7N J;  3JRI A;  2XAQ A;  5JR3 A;  1W4M A;  3OYD A;  1UZC A;  3DEU A;  3DU6 A;  3OS1 A;  3QU6 A;  2Z33 A;  2Y48 A;  4AIJ A;  3CC4 I;  3O3K A;  2R7Q A;  3B6A A;  1E3H A;  2I8D A;  1YJN I;  2DMP A;  3FX3 A;  4F52 A;  3F72 A;  1ZAR A;  2BXZ A;  2HQA A;  3L2U A;  3H3U A;  2QSG X;  4HF1 A;  4D7N A;  4XN0 A;  3V4G A;  2L7K A;  2DW4 A;  5IY5 H;  1P4X A;  2NAZ A;  3IH2 A;  3IAM 2;  3PM1 A;  1FBS A;  5J1Y A;  2UZK A;  4G7Z F;  4PJN A;  2Y2Z A;  4IPA A;  3QYB A;  4BNC A;  3FXO A;  1NHA A;  4IEJ A;  1P4W A;  4OIN F;  3QRF F;  2G7H A;  4LLL A;  1TC3 C;  3ERM A;  5GPA A;  1WJF A;  5FRM A;  3DV8 A;  2FBK A;  1SD4 A;  5J47 A;  5LD2 C;  3ML6 A;  3OS2 A;  2HFH A;  2EJR A;  3BQY A;  3LSR A;  4XID A;  1GLN A;  4E7J A;  1OR7 C;  2EH3 A;  1IV6 A;  3BDD A;  2HOT A;  3H9Q A;  2ECC A;  4NQW B;  1TNS A;  3PIO F;  4RAG A;  3IV5 A;  4DJA A;  2P5V A;  4G6Q A;  1D5V A;  5IT9 Z;  2ZME C;  4BQQ A;  3KIO A;  3DKW A;  3FKJ A;  5IP9 J;  2EWN A;  5E3M A;  4IHS A;  4A3C J;  4XSZ F;  2FJ1 A;  2X6X A;  2ZCW A;  3MN2 A;  2EZI A;  2MBF A;  1YIO A;  1I6X A;  2EQR A;  2ETH A;  1FYM A;  2ME6 A;  2H27 A;  1HOM A;  3LMM A;  5IT3 A;  1AWC A;  3KFW X;  1WPK A;  3MKY B;  2O03 A;  1MMS A;  3G1O A;  1TP4 A;  1R5H A;  2V4J C;  4RM2 A;  1Z77 A;  3CCR I;  5E20 A;  3HZJ A;  4L9T A;  2KIM A;  4FX0 A;  5BOX A;  2LFB A;  2KRH A;  5F27 A;  2CQ7 A;  1LFP A;  3SDB A;  5GTH C;  3FHZ A;  2DDA A;  2PEX A;  4A93 J;  3KZY A;  3GO5 A;  5IYB J;  1AKH A;  2GM4 A;  1OMI A;  4IOA F;  4QLC U;  3WE2 A;  1FC3 A;  3BT9 A;  3IKV A;  4D9J A;  4Q5S F;  4IRG A;  1C0W A;  2R92 J;  3ZCO A;  3FXR A;  2QKM B;  4GYI A;  2ZXH A;  2JA2 A;  1Y1W J;  1TT5 B;  1GV2 A;  2CUJ A;  2HR3 A;  1Z3Y A;  2R5Z A;  2HU9 A;  2VBY A;  4CYC A;  2XAF A;  3I71 A;  1VQ8 I;  3I4N J;  2L9R A;  4CIC A;  4I6Z A;  4DQ2 A;  1QVU A;  2RDP A;  3KLO A;  2K4B A;  3HKZ A;  1R4N B;  4XLH A;  5D6F A;  3FZV A;  1E2X A;  5E3O A;  2IGO A;  2DT5 A;  3EUH A;  3A01 A;  3ZP5 A;  1JGS A;  1OFC X;  2TCT A;  5IOZ A;  4XN3 A;  3CMY A;  2HOA A;  1T98 A;  4MHG A;  1X1P A;  2FOW A;  3KX2 A;  3HG9 A;  5F6F A;  1X1B A;  1WJD A;  1LEB A;  2EZL A;  2BV6 A;  1MJB A;  3HXL A;  2E1M C;  2IA1 A;  4DYR A;  3E6C C;  4IQ4 A;  2KIF A;  4YIR X;  3G71 I;  3DFG A;  2JA5 J;  2QA4 I;  2O0Y A;  2XF7 A;  1R36 A;  1MIJ A;  4A3D J;  1R22 A;  2M34 A;  3Q0U A;  3CTA A;  3K9T A;  5KNL A;  2HTS A;  2OZU A;  3SDG A;  5LGU A;  3HDD A;  2W84 A;  1I5Z A;  3PQK A;  3R6S A;  1KQ9 A;  1MMD A;  3FM3 A;  3E0J B;  4RAY A;  3OYC A;  2FU4 A;  1ON2 A;  1GDT A;  3N97 A;  1LUJ B;  1IGN A;  2DFE A;  5DM7 F;  3HSF A;  5F1J A;  4FAS D;  2R7S A;  2K9S A;  2NOG A;  4MFE A;  1JTY A;  4DBR A;  2DFI A;  5CLS A;  1LDJ A;  2XGX A;  2XGC A;  5ICF A;  1EV7 A;  4A3K J;  2BY3 A;  5M3M J;  4UUV A;  2UV1 A;  4KN7 X;  2E7X A;  4HLX A;  1YFH A;  1UB9 A;  1SD7 A;  2PN6 A;  1R5G A;  2X6W A;  2XGE A;  1IDZ A;  3E5Q A;  5FLX Z;  1UG0 A;  1YW7 A;  2MA3 A;  5ICC A;  3ZN0 A;  1J7K A;  2FD5 A;  2PMZ N;  4IZZ A;  4K2E A;  3FK7 A;  4QPO A;  2VT3 A;  4G12 A;  3ZMV A;  1LE8 A;  4HRI A;  1IUF A;  2KP6 A;  1SMT A;  3NAR A;  5E79 C;  2M8E A;  3V7S A;  3WGH A;  4PUS A;  3OL3 A;  2XV4 S;  2Q0O A;  1FNN A;  1ZRC A;  5HVQ C;  1YYV A;  4XOT A;  2E71 A;  2LKS A;  5DS9 A;  4A3G J;  1ZKG A;  2JWT A;  3AAF A;  1WJ5 A;  4ESB A;  4GRI A;  1KA8 A;  1W5C C;  1W0U A;  3BP8 A;  4CCL A;  5J4Y A;  3OR2 C;  4ZZD A;  2PQ8 A;  4A12 A;  3HRT A;  1S7A A;  2BE5 F;  3ESW B;  3QPT A;  3LSI A;  1FYL A;  1B8I B;  4EEF G;  3F22 A;  1YX5 A;  3HPH A;  5HLG A;  1ETY A;  3F6O A;  2LC2 A;  4IQJ A;  1UHW A;  3K4J A;  3PUF A;  2QLZ A;  3HJE A;  3S1N J;  4EQQ A;  1FOK A;  2BY2 A;  2EIL H;  2V1D A;  3Q3S A;  4N9H A;  2OTJ I;  1I1S A;  4A0Y A;  2BVL A;  3FMR A;  1VQ9 I;  3F8F A;  4PSX A;  3K69 A;  3Q0W A;  1D5Y A;  4UUS B;  1RKT A;  2VIX A;  5KAF C;  3DCF A;  1RR8 C;  3S1Q J;  5FKN A;  1F1Z A;  5E1W A;  4YFN F;  2LKX A;  3S15 J;  1JXS A;  4G7O F;  2LF8 A;  3SHF A;  2VAS A;  5H6R A;  1IRG A;  2HPI A;  1ZTR A;  2L4A A;  4B3A A;  2E2I J;  3CO6 C;  3J81 K;  5E18 F;  3VYU B;  5D8L B;  5KK1 A;  1ORK A;  3F9K A;  2VKH A;  2VQL A;  4OMY A;  2V1N A;  4DYQ A;  4D5C A;  5EF6 A;  4HX7 A;  3CDH A;  2CUE A;  3I9V 2;  2DMQ A;  3NWT A;  3OYJ A;  3ZOB A;  3L9F A;  2GBY A;  1UJ8 A;  1WGX A;  4XKB A;  2PJR B;  3C7J A;  2ZJR F;  1BW5 A;  4M72 A;  2DA1 A;  3LSM A;  2M2E A;  1OCC H;  3ZMT A;  2R7U A;  2RC4 A;  3DTE A;  2LLK A;  2EA4 A;  4Z6Y A;  4BHB A;  2JA6 J;  3D5L A;  3VSL A;  1IN7 A;  3GXO A;  2XGD A;  1E0E A;  1LFU P;  3OYB A;  2H1L A;  2V1U A;  2XSD C;  1X4P A;  3EPZ A;  5TRD A;  2VPR A;  2CH0 A;  4AID A;  2CQN A;  2BXY A;  1JGG A;  1POG A;  4P9F A;  2XRN A;  5AON A;  1K7A A;  1VQP I;  2HVS A;  1ETO A;  2QWW A;  2V79 A;  2RN7 A;  2IRF G;  3HIF A;  3VYT B;  1XX5 A;  3OYG A;  2GLO A;  4MFD A;  4GFB A;  3K70 C;  2MAB A;  2EV0 A;  4UY8 I;  2X4H A;  2K5C A;  4ANJ A;  1I27 A;  4HNT A;  1J9I A;  1U6G A;  5ILS A;  2GXG A;  5KCM A;  1Q1V A;  1H88 C;  1AA7 A;  3CUQ A;  2VC1 A;  4OIO F;  4N0B A;  2A61 A;  4ZJZ A;  3DTI A;  2O9L A;  4UHT A;  4IHV A;  4KUM A;  6PAX A;  1U5T C;  3SEZ A;  3FIS A;  4WCG A;  4RB2 C;  2PBI A;  2VOO A;  1NK3 P;  3REO A;  4FIS A;  4S0H B;  4XKW A;  5J4V A;  4BQO A;  3QPS A;  4BXU A;  3O8H A;  2JUC A;  2QKL B;  5FKK A;  4BUP A;  1MBH A;  2JT1 A;  2GIZ A;  4LG3 A;  1N25 A;  5GAE J;  5HDN A;  4MQ9 F;  2L0K A;  2KDZ A;  2E2J J;  1W7P D;  2WAQ N;  2LP0 A;  5TJJ A;  2WWY A;  4P9U A;  2OZ6 A;  2XF6 A;  3OSF A;  2JPC A;  4ZC3 A;  1P92 A;  2P7V B;  4RAZ A;  3JRC A;  3CP2 A;  4PFO A;  1DUX C;  4F91 B;  3LSJ A;  2YSR A;  2DTR A;  2XC7 A;  1TWA J;  1TWH J;  2HYF A;  4KMU X;  1ZLJ A;  3H0D A;  4J00 A;  2KPM A;  4JP0 A;  4B48 A;  4BBR J;  3JRF A;  3DQV C;  1TWC J;  3IWF A;  1HST A;  2X48 A;  2ID3 A;  3C2G A;  3BC8 A;  1FWZ A;  3LST A;  3ELK A;  2ELJ A;  1HSJ A;  1BI2 A;  1HKS A;  2Y9Y A;  4U87 A;  2OCC H;  2CS3 A;  3MCZ A;  2A6H F;  2VXZ A;  3CJR B;  2MD0 A;  4MEX F;  4ESJ A;  3IRR A;  1HF0 A;  4KNY A;  1FJL A;  5DEQ A;  3LSG A;  1BN5 A;  4Y52 J;  4ENN A;  4P96 A;  3EDP A;  5LFA A;  1R58 A;  1W5S A;  1Y6I A;  2BW3 B;  2OU2 A;  4WF2 A;  4EJO A;  4ZYE A;  1G59 A;  4IOC F;  4KIG A;  2JUG A;  1X19 A;  2XAJ A;  3ZQI A;  3P5J A;  2DDB A;  2P6S A;  3KET A;  3S3M A;  1UAA A;  2HGC A;  4II2 A;  1FT9 A;  4MLO A;  4IXA A;  2Q2E A;  1BC8 C;  2FSW A;  3VPR A;  1IC8 A;  1OR7 A;  3I0T A;  3I56 I;  1G2H A;  1KU3 A;  3OIO A;  1PDN C;  1EJ9 A;  2CW8 A;  4YEL A;  3VSK A;  2COM A;  1CQT A;  1XTA A;  1A6I A;  4BH9 A;  1F9N A;  2ZME A;  1KGS A;  4U7B A;  2ZC2 A;  3WTY C;  1P7J A;  4BQA A;  3CMA I;  2IJL A;  4LG0 B;  3H3V K;  3BJA A;  3KPH A;  3K4N A;  2V9P A;  4KMF A;  1M1E B;  1SMY F;  1Z0X A;  1XCV A;  3A03 A;  5J3L A;  2R5Y A;  4DNC A;  1ZK8 A;  1A6Q A;  3FMS A;  3VYS B;  3PSF A;  3RPU A;  1IN8 A;  3RTR A;  1B72 A;  1BI3 A;  2LBF B;  2VJ5 A;  5E1Z B;  5HLI A;  2R0Q C;  4B8X A;  4YG2 F;  3KYL A;  2MH9 A;  3BR1 A;  2EIJ H;  3GTG J;  1XN7 A;  3HM5 A;  3MFK A;  4U0V A;  1HQC A;  1LVA A;  3DWL E;  4A5N A;  3GTJ J;  2DQR A;  3VOD A;  3KE2 A;  3JR9 A;  4M9X A;  2DA2 A;  1WJC A;  2LG4 A;  1NG7 A;  5EJC A;  2QM3 A;  5BS6 A;  3E5U A;  3I4M J;  2R7V A;  5LLQ A;  1W5T A;  2EA2 A;  4RBO A;  2P7C B;  4CH7 A;  2GA1 A;  4S04 A;  5BQT A;  5LEK A;  2JVG A;  4C2T A;  4AUX A;  2DMT A;  3FXJ A;  2MFZ A;  1GHC A;  2Y0S N;  4KA4 A;  3S93 A;  5BPI A;  4AC0 A;  4DOZ A;  2K9Q A;  2MYS A;  1I3A A;  2K85 A;  5DM6 F;  3LSP A;  1E3O C;  2RNJ A;  2WA0 A;  4E7Z A;  3MZH A;  3B02 A;  2QCO A;  2LRE A;  3DBH B;  3WU2 C;  1R7J A;  2O3F A;  3N4M A;  2ELK A;  1UCR A;  1HW1 A;  2QZ8 A;  1ENH A;  2QBY A;  4A2U A;  4CA0 A;  1MKM A;  4ZYH A;  4ZZL A;  1DQU A;  3J81 Z;  2MC3 A;  5FO5 A;  4WWC A;  2GXA A;  4AD9 A;  1Z1D A;  1UG2 A;  2Y31 A;  1SFX A;  3W2W A;  4AWX B;  5HDK A;  2VE9 A;  1V4R A;  2JSP A;  4MQV A;  4EJT A;  2VUM J;  1BJA A;  3DKY A;  2MH2 A;  3LAP A;  2ISZ A;  4M9S A;  5E1X A;  2K02 A;  2ZFU A;  4IJA A;  5L3D A;  3R60 A;  4A3M J;  3ABL H;  3K4L A;  3HBL A;  2CQX A;  3OL4 A;  4II3 A;  3KEO A;  4W1U A;  2N8G A;  3F23 A;  5H2F C;  4IHT A;  3TP3 A;  1RI7 A;  3CCY A;  3ECO A;  2R7F A;  3CC2 I;  3K2Z A;  3HB9 A;  2JPB A;  1RR7 A;  3O2P E;  4XOR A;  1JKR C;  4WK8 F;  1K78 B;  2BHY A;  3VFZ A;  2PI0 A;  4OAY A;  4Y3O A;  3R0J A;  5B3S H;  2HI3 A;  2RGV A;  3G2B A;  4X1E A;  3SFI A;  2O7O A;  1B9N A;  2GA2 A;  2K9M A;  4KIF A;  1WH5 A;  3COA C;  3ASN H;  2ICW G;  4ESF A;  2IS2 A;  1UFM A;  2E5Z A;  3T8T A;  1XB4 A;  3JTH A;  5KAI C;  4DZP A;  3ABK H;  3G4S I;  4KFC A;  2IVM A;  4KYW A;  1MJA A;  1YS7 A;  3PNV A;  2XHK A;  1Y0N A;  4NBQ A;  2ZXI A;  3OOP A;  2PG4 A;  2DQL A;  1FIA A;  2HKX A;  2P5K A;  3F6V A;  3K6G A;  3L2C A;  4L5E A;  4CDG A;  1Z67 A;  5D5U B;  2VJ4 A;  3GFL A;  4A3L J;  5JVT A;  1SAX A;  4I7H A;  2OBP A;  3ZGK A;  5C4J J;  3TW7 A;  2CWE A;  4FQG A;  5HDG A;  1RUO A;  4PGG A;  3PSI A;  4OOI A;  3G6E I;  5K1Y A;  1VQ5 I;  2QSH X;  2KQR A;  1XDU A;  3CQZ J;  4BGD A;  1MBJ A;  4XKV A;  1F5T A;  2XPU A;  3BG9 A;  4BHP A;  1YJW I;  1CF7 A;  2A05 A;  2KRF A;  1O3R A;  3A0H C;  1P2F A;  2AXT C;  3R4K A;  3BR3 A;  3Q9V A;  4J19 A;  1HKT A;  2HTJ A;  3SZP A;  1OCT C;  2RRE A;  1IF1 A;  1WWX A;  1MND A;  2A68 F;  2OQR A;  3QQA A;  5L3G A;  1S72 I;  2F4O B;  2WAF A;  1LDK B;  4HDV A;  4J01 A;  5HLT A;  4ON0 A;  3ABT A;  3I59 B;  2L7Z A;  3RCO A;  4E7H A;  4I0A A;  2R5Y B;  4ASN A;  4PJL A;  1FSE A;  5EYR A;  3GCM A;  3TO6 A;  1YRN B;  3ULQ B;  3LSH A;  2K3P A;  3JTG A;  1MNM C;  1B72 B;  2IPQ X;  1O7F A;  1W7P B;  1PUF B;  3GTK J;  3FHN A;  4UVA A;  3W6J B;  5CQE A;  1VQK I;  1HDP A;  2I5U A;  3K1M A;  1R1U A;  3M8J A;  2ZB9 A;  4XR6 A;  1Z7U A;  2KIU A;  1I3Q J;  2KDO A;  3AG3 H;  1S7E A;  4HX8 A;  4ZYD A;  4Q4Z F;  4XM3 A;  4Q48 A;  3PO2 J;  3FK6 A;  5DCM A;  4M9Z A;  1JJ6 C;  5LHG A;  3MKZ A;  1IG7 A;  4M6V A;  1MDM B;  4AM3 A;  2WV0 A;  2CQQ A;  1VQ4 I;  5IOY A;  5HOD A;  3JRH A;  3KP2 A;  4O3M A;  1J09 A;  3M7G A;  4ZTF A;  3HRM A;  4Z2Y A;  3T0Y A;  3SJM A;  2F4I A;  2GZW A;  3LA2 A;  3BRO A;  4OAZ A;  4V2G A;  1OIS A;  1X1A A;  3GFJ A;  2E60 A;  1TL8 A;  2DA6 A;  3KEQ A;  3PQJ A;  3CP8 A;  3RKQ A;  3BCB A;  4H0E A;  2KZV A;  2DN0 A;  5HNF A;  3J7Y J;  1X2M A;  4DZJ A;  2XAS A;  1WQ2 A;  3S8P A;  3BY6 A;  2PMU A;  1GT0 C;  2CYY A;  3HTS B;  1ZGA A;  5HS9 A;  3NAU A;  3NWS A;  3WG7 H;  4BS9 A;  4RS8 A;  2L02 A;  2NVX J;  4D5F A;  1S8N A;  1VQO I;  4HOB A;  3EUA A;  4BBS J;  3O8G A;  3K1N A;  3OYH A;  1HLV A;  2HDD A;  4L5I A;  1TNT A;  2IP2 A;  2Z16 A;  1PUE E;  4B3X A;  4AYB N;  1HA8 A;  1FMV A;  4C9Y A;  3U1K A;  2HDC A;  3J80 Z;  3FBN B;  1SFO J;  3I3L A;  2EK5 A;  2ZSI B;  3IWZ A;  1PJR A;  4G6D A;  1K83 J;  2MLK A;  5F1R A;  5BNG A;  1WKM A;  2L7M P;  4LB5 A;  2O5R A;  3ONQ A;  3DBL B;  2LVS A;  2MSY A;  4ZH4 F;  3RQI A;  2X51 A;  5CVU A;  4CCJ A;  4V2F A;  4L5J A;  4XRM A;  2STT A;  1IN6 A;  4DYC A;  1P4A A;  2PLY A;  5DTD A;  2UWM A;  1U5T A;  5H20 A;  1ZRF A;  2HS5 A;  1HW5 A;  4HG2 A;  1JKP C;  2L9S A;  1XS9 A;  3WE3 A;  2R7Z J;  2GWR A;  4EM2 A;  3EYY A;  2XSJ C;  3CCM I;  4HDU A;  2D45 A;  2COB A;  2M4G A;  2L54 A;  5EEA A;  3BZC A;  1MW7 A;  3GX4 X;  5JHU A;  2V6E A;  2NVT J;  2ZBK A;  1QHG A;  4LIU A;  3ROU A;  2GXB A;  1GVD A;  3CJQ B;  5J8F A;  2P5L C;  3H3Z A;  2E1N A;  3LA7 A;  1WSU A;  1TT0 A;  3BLY A;  2XKO A;  2JA7 J;  3D5S C;  3RYP A;  1JTX A;  5KVR A;  2QQA A;  3K4B A;  1BI0 A;  4M3B A;  1XGO A;  3OIQ A;  4CZZ A;  1QZE A;  4XLA A;  3MAJ A;  3TO7 A;  3GUD A;  2G7U A;  2M1B A;  2FBI A;  1V54 H;  5J6X A;  3ZMS A;  3S3O A;  3S1M J;  1QNT A;  3H9G A;  4AVZ A;  3CMM A;  3CLO A;  4IF4 A;  1XDS A;  4L9N A;  3J7A O;  2PMZ A;  2M3A A;  2VC0 A;  1MSE C;  2J5P A;  3OYK A;  5EGO A;  1SD6 A;  3TKY A;  1WVR A;  2F5F A;  3WGI A;  1K4T A;  4YFX F;  2Y30 A;  1D1B A;  4YFK F;  1T08 B;  4B1R A;  3ZQL A;  3HOZ J;  2HXI A;  1REP C;  4AIH A;  2GQQ A;  4WXH A;  4E7I A;  4CCO A;  1BA5 A;  3U9G A;  1OCZ H;  2EZH A;  3DPL C;  1XGN A;  2LY9 A;  2RQP A;  1FLI A;  4XLF A;  1X1D A;  2L2O A;  1GV5 A;  3IH3 A;  4OIP F;  2QEX I;  4C3I J;  2DOF A;  4NNJ A;  2HWV A;  1X3W B;  4XQF A;  1V5G A;  1U3E M;  2L5Q A;  1XCB A;  5DCM B;  4W97 A;  2LOO A;  1YI2 I;  3ZQF A;  5D4S A;  1BR4 A;  1ETK A;  1KYZ A;  1Y1V J;  2C6Y A;  1BIA A;  2HQ5 A;  1HBX G;  3KCC A;  2ZJ2 A;  1UMQ A;  1YX3 A;  2DO7 A;  2L4M A;  1L3L A;  1JKO C;  1J5Y A;  2F5D A;  1IDY A;  1S6L A;  3H5R A;  4GXO A;  5EG0 A;  1BI1 A;  2M4K A;  2EZK A;  1VTN C;  5C4X J;  4HNU A;  2KIQ A;  9ANT A;  3J7Z I;  2VI6 A;  2A6E F;  4HLY A;  4NDL A;  1VQM I;  5FRN A;  1RPW A;  4CCN A;  1P7I A;  1TQP A;  4E7L A;  3BTC A;  1LEA A;  5CJ9 A;  2L7F P;  4EGY A;  4IX7 A;  5E17 F;  3W6V A;  3HTU A;  4ZDO A;  2V1X A;  3HGG A;  1YOV B;  4OIR F;  3V7C A;  4QIW N;  2CO5 A;  5DD8 A;  2DOE A;  1XGS A;  4ENM A;  1FOX A;  3MQ0 A;  4N4N B;  2DXI A;  5K5O A;  1T56 A;  2H6C A;  3BG6 A;  3ZQ7 A;  4XLP F;  2W48 A;  2XF5 A;  3TOB A;  2FBH A;  2O61 A;  5HS8 A;  2KT0 A;  2DBB A;  4YIF A;  3JAM K;  4KIT B;  1I6H J;  4IHY A;  4PFP A;  2HZT A;  4IHX A;  1S5L C;  1G3T A;  2EV6 A;  3L1P A;  1AKH B;  2FX0 A;  1WH7 A;  1FBU A;  2EBI A;  4RLF A;  1ULY A;  3KP6 A;  2JRM A;  4EGZ A;  1U9O A;  2DI3 A;  2DMN A;  2OUM A;  3S2H J;  4MTD A;  3UR3 C;  1ZG5 A;  3CJN A;  5GAG J;  1FYK A;  1YO5 C;  3IH4 A;  2HDW A;  2X9D A;  3QWL A;  3RKY A;  4V19 K;  2CQK A;  5F0H A;  2MD5 A;  4RAF A;  2FNP A;  2R5Z B;  3A1Y A;  1RNL A;  1S29 A;  5M5Y J;  4CYC B;  2F4M B;  4HF0 A;  1VI0 A;  3H9J A;  4M74 A;  5K5R A;  3HOW J;  2HKO A;  3GBG A;  1D0Y A;  1ZGJ A;  2P0W A;  2PX9 A;  1DGW Y;  3A01 B;  1DU0 A;  1ETX A;  3MZY A;  5CQG A;  1HC8 A;  1ITY A;  1FSH A;  5DUK A;  1ZAO A;  2UUZ A;  3GFM A;  4AIK A;  2F6C A;  3L2V A;  3C2H A;  2KIS A;  3GZ6 A;  4PSW A;  4FT8 A;  4RDU A;  2LMD A;  1Y56 A;  1YJ9 I;  2YS9 A;  4G7H F;  2XDV A;  4N9I A;  5L3E A;  5LRS A;  1LPQ A;  1RZ4 A;  2LR8 A;  3VB2 A;  4BJ5 C;  4U0Y A;  1ZQ3 P;  3AL0 B;  2DK8 A;  3PL8 A;  2RNG A;  5J40 A;  3DBR B;  4ZYA A;  1J59 A;  2OV7 A;  2QYO A;  2TRT A;  3CJT B;  1MMA A;  2WAQ A;  4B44 A;  3K4M A;  3CF5 F;  1TWG J;  4UVB A;  1JHF A;  2NYX A;  1T0F C;  3HHH A;  4QPQ A;  2H1K A;  4PCQ A;  2E35 A;  4XRS A;  1Z91 A;  4XRF A;  4FCY A;  4KN4 X;  2JN6 A;  3AG2 H;  1EH6 A;  1YLF A;  5D5X B;  2G9W A;  3G1L A;  3LFK A;  4BDY A;  1R9T J;  1JT0 A;  3D1N I;  3CZ6 A;  5ED4 A;  5EDN A;  1QA6 A;  4QSH A;  4RM3 A;  3DU5 A;  1X3U A;  4BE2 A;  3EYI A;  2K3F A;  2E1O A;  1V5E A;  3S16 J;  1R4M B;  3FWE A;  4KDP A;  3GFI A;  1IO2 A;  3TDZ C;  3C3W A;  4BE1 A;  1W0T A;  3VEP A;  2KZG A;  3GEZ A;  2CFO A;  2LY1 A;  1IAW A;  4L18 B;  5DDG A;  2IS4 A;  4F92 B;  1YQA A;  2G0E A;  2R7D A;  5IP7 J;  1D0X A;  2CMP A;  2P8T A;  3OMY A;  1HDD C;  2NVQ J;  1ZLK A;  4CHU A;  1OCO H;  5CVJ A;  1KU7 A;  3P9I A;  1KU9 A;  4I98 B;  3SQN A;  2BBY A;  1GXQ A;  1LE8 B;  1BC7 C;  4MIM A;  3M1C A;  2B63 J;  2DPD A;  2YPR A;  4MO7 A;  5C3E J;  1ZR4 A;  2X1E A;  2R7T A;  4A6D A;  4UV8 A;  4PZJ A;  3CC7 I;  3ZQG A;  4KIB A;  2KHM A;  1FEX A;  2CG4 A;  5A2Q K;  1D1A A;  2NVY J;  2D1H A;  2R7W A;  2Y75 A;  1X58 A;  2DPU A;  4CXF A;  2DYR H;  2BY1 A;  2VQG A;  1MBK A;  1USS A;  1AHD P;  1WJA A;  2FQ3 A;  1ZRD A;  4IRH A;  3U2R A;  4I0B A;  3I64 A;  5FFX A;  2P4W A;  4ZYG A;  5DUI A;  2B0L A;  4XRS G;  3IRQ A;  4FTH A;  1N75 A;  4XSX F;  5CVR A;  3ZMD A;  4BE0 A;  2L01 A;  2M9H A;  3IKT A;  3JRA A;  2EIM H;  1WJE A;  3H0G J;  1HXD A;  4CYD A;  3PUB A;  3BPV A;  1NH3 A;  1G4D A;  2LKP A;  2VT2 A;  1IXR C;  5B66 C;  1K6Y A;  1FOW A;  2X0L A;  2JTV A;  4E4H A;  3CCQ I;  4ZTJ A;  2R7X A;  3LQQ A;  2PJP A;  4M71 A;  4WXD A;  5K7F A;  3NRV A;  3K1P A;  3DF8 A;  2Y0S A;  3BR5 A;  4M3D A;  4A0X A;  3ZR8 X;  4CGZ A;  4U7D A;  2V26 A;  3OY9 A;  4LLG F;  5CYV A;  3SZT A;  3CLQ A;  3NEU A;  1E3P A;  4HA8 A;  4JYK A;  2LY2 A;  1F4K A;  4I76 A;  5LGN A;  4UVC A;  3CO7 C;  2OTL I;  5GPC A;  1QZY A;  3HEF A;  2BGC A;  1BR1 A;  1TWF J;  2YUS A;  4L9J A;  2KLO A;  4LJZ F;  1YW8 A;  2KKO A;  5EEH A;  2HEO A;  2ELH A;  4HW0 A;  2IGM A;  4HQM A;  1SD5 A;  1IZ1 A;  5D4R A;  4IHW A;  3IC7 A;  3E97 A;  2IAI A;  2M5W A;  2A3S A;  3I53 A;  2ZJP F;  4ENK A;  5IT9 K;  3R61 A;  2EV5 A;  4YRV A;  2K40 A;  2XB0 X;  4EJW A;  3OYM A;  3JRD A;  1OQY A;  1T2K A;  1HW2 A;  1ZHF A;  1D0Z A;  1YS6 A;  4EV0 A;  1NK2 P;  3EUK L;  1MGT A;  3D0S A;  3R0A A;  4LD5 A;  3HOY J;  1LKX A;  3OYA A;  4H4K C;  2E36 A;  3WTS C;  5D5W B;  1RET A;  3K4K A;  4X6A J;  3I54 A;  2VOP A;  4CUG A;  2AQE A;  4G9Y A;  4XNF A;  1PVE A;  2JZY A;  4ABZ A;  1OLT A;  5LEJ A;  4HQE A;  3RYR A;  3I55 I;  4IVN A;  2VBZ A;  1VQ7 I;  4GYG A;  2QSF X;  2E1C A;  1ZG1 A;  4X0G A;  2KRC A;  4E7S A;  2E5N A;  2XVC A;  2WY8 Q;  1T6S A;  4LIV A;  3VDX A;  2L9N A;  2QQB A;  1OCR H;  3F21 A;  2XAH A;  1LDD A;  2XPV A;  3MWM A;  1WI3 A;  1LJ9 A;  1UHM A;  2DJI A;  2NS8 A;  5LHH A;  3H5A A;  2R7R A;  3KZI C;  3L7W A;  3CUQ B;  3ISP A;  3OIP A;  4Q47 A;  5GP9 A;  4S05 A;  3V42 A;  4NC6 A;  2CUF A;  3FXK A;  2DCE A;  4GO1 A;  4LFU A;  2HOS A;  3PNT A;  4ETS A;  1MNE A;  4C30 A;  1XSD A;  3OSG A;  2FNA A;  1XSV A;  2X1D A;  3WHB A;  4BKX A;  3Q5F A;  4WXC A;  3PFI A;  2BEO A;  5E8I A;  4CCK A;  2V7F A;  2Z2S B;  2HYJ A;  2WB1 A;  3IUO A;  4D7M A;  3MD2 A;  3GLL A;  1QQI A;  2W57 A;  2OJE D;  4JK1 X;  3S17 J;  4XOP A;  5ILU A;  1ERD A;  4NQW A;  1EA3 A;  1IRF A;  1LVK A;  3BG7 A;  3V8L A;  1ACI A;  1QPM A;  2L3D A;  2OA4 A;  4HBL A;  3EET A;  3DLL F;  1Y8Q B;  3FF5 A;  4AU7 A;  3ZRG A;  4RB3 C;  1PYV A;  3WTV C;  3GWZ A;  4DGW B;  4R79 A;  1MSF C;  3RSN A;  4JOM A;  3A2K A;  2DYS H;  2CW0 F;  4XK4 A;  3RKX A;  2LSO A;  1APL C;  5K5Q A;  3SXY A;  3JRG A;  5CKT A;  2CRG A;  2BOL A;  2FE3 A;  1KU2 A;  1IUY A;  2QQ9 A;  1TLH B;  3GW2 A;  4KT5 C;  3V8J A;  4XKC A;  2DTZ A;  2CV0 A;  5F08 A;  3ZMZ A;  2KFD A;  1FMW A;  2FUG 2;  2ZO4 A;  4UUT A;  1J75 A;  3PIP F;  1U9N A;  1DU6 A;  4P5O A;  2FF4 A;  1G8X A;  3HHG A;  2WB1 N;  3BG3 A;  4R8H A;  4AVP A;  1XD7 A;  1G6N A;  3SYT A;  2WY7 Q;  3P9K A;  1U2W A;  1OYW A;  1X2N A;  5E8G A;  2X6O A;  2NS0 A;  3DPU A;  4JBA A;  3FKI J;  3QPH A;  2Y9Z A;  3QYF A;  3QU3 A;  1Z05 A;  2BHZ A;  5FLX K;  1D1C A;  1H0M A;  2YR2 A;  2Q2E B;  2ZKZ A;  1UEL B;  2NNN A;  3VOE A;  4U0W A;  3KP3 A;  5ILV A;  1IRX A;  2GOX B;  1B4A A;  3L2Q A;  3VYR B;  2CV1 A;  1Z3X A;  5CVI A;  1JI8 A;  2VL8 A;  2ZME B;  1FTZ A;  4JX5 A;  5D8K B;  3FMQ A;  1WJB A;  2IGK A;  3HSE A;  3L00 A;  1SAU A;  5HNH A;  5KHD A;  4G8X A;  2M30 A;  3CCV I;  1RKW A;  2V9V A;  5FLV A;  1KYW A;  4WX9 A;  2DA3 A;  3PFY A;  2EPF A;  3OOU A;  2DFF A;  1VND A;  4HSR A;  1IJW C;  4HV6 A;  4PJJ A;  2Z1D A;  2RQQ A;  2A5Y B;  3HUG A;  1BOB A;  1S3J A;  1VQN I;  2NVU B;  5FJ8 J;  1R1T A;  5IYC J;  2Z9O A;  3DP7 A;  3L2W A;  3BJ6 A;  1ZGW A;  2OF7 A;  4RGU A;  2JMW A;  2M87 A;  5CVV A;  3A4C A;  3K10 A;  3U21 A;  4BY1 J;  2R93 J;  1DP3 A;  1G3S A;  2LTP A;  1T33 A;  2DOD A;  4AYB A;  1R00 A;  2JQ7 A;  3HOX J;  1IV8 A;  1H9G A;  1IW7 F;  2W85 A;  4NB5 A;  2W4S A;  1QPI A;  4A3J J;  3KEY A;  4BU2 A;  5HS7 A;  3M4O J;  5E3N A;  3ECH A;  2LYC A;  3CCL I;  1YE9 A;  2OPT A;  1J0R A;  1QO0 D;  5GAH J;  1LQ1 A;  3G1M A;  1O3T A;  3HOS A;  5CPR B;  1N77 A;  3HYI A;  4CO8 A;  2EFN A;  3HC7 A;  4BJ6 C;  1TZL A;  1MH4 A;  1MZB A;  1OYY A;  2DA7 A;  1W36 D;  1V3F A;  2JA8 J;  3E1S A;  2XUB A;  3WTW C;  2QBY B;  3ZN1 A;  1BM9 A;  4B4C A;  3E5X A;  1QRY A;  1GXP A;  2O6G E;  2E1M B;  3N05 A;  2JK3 A;  1K4S A;  1B9M A;  2OC6 A;  2RVC A;  4BQN A;  3MVP A;  5FKM A;  3LAJ A;  5DV5 A;  3ASO H;  2F5C A;  4P1W A;  2YX7 A;  3HL2 A;  2E19 A;  3LQR A;  2VB6 A;  4IRI A;  4I01 A;  5TIS C;  2EFP A;  2E2H J;  1T0F A;  3KP4 A;  2LK2 A;  2TDX A;  1FP1 D;  2GAU A;  1DPR A;  2H8W A;  3JW4 A;  2MLG A;  1QVT A;  1ZH5 A;  2YU3 A;  2UXX A;  3ZXS A;  1GUU A;  1B8I A;  3GF2 A;  1NTC A;  1MBF A;  4A3B J;  4FE4 A;  4MTE A;  1FBQ A;  3CD6 I;  2F48 A;  2ESN A;  3MKW B;  3FM5 A;  1QU3 A;  2DAO A;  3I4P A;  5K7Z A;  4NHJ A;  3S1R J;  5TGT A;  5D5V B;  1A5J A;  1JUS A;  2VQH A;  3H1C A;  4NUB A;  3CDL A;  3DTK A;  2D2W A;  1KON A;  3BPX A;  3F8C A;  1O4X A;  4UB6 C;  4PDK A;  5AIQ A;  4UUS A;  3JSO A;  1O3Q A;  3TMO A;  4DW6 A;  2DOA A;  3QOP A;  2RAE A;  3PO3 J;  4MNU A;  5IP6 A;  1P6R A;  5FRO A;  2EIK H;  2H8R A;  3BTI A;  3D5R C;  4B47 A;  3WTX C;  1X4O A;  3CME I;  4L9V A;  1YIJ I;  3W6K B;  3BG5 A;  2BVM A;  1O3S A;  4IKF A;  3L09 A;  1K6O A;  3CCE I;  4GDF A;  3HGY A;  2BYV E;  4Y13 A;  3RQ4 A;  1ONV A;  3U1D A;  2PJR A;  3AFH A;  3S32 A;  2VJJ A;  4MEY F;  3F8B A;  1CF7 B;  2FA5 A;  5JLW A;  2Z3Y A;  3WG9 A;  2R7O A;  4OIQ F;  1HKQ A;  3NQO A;  1H8A C;  1T39 A;  2AHQ A;  1XG1 A;  2QUF A;  2NOJ B;  1JUM A;  2K7L A;  4M3E A;  2ID6 A;  4KIS A;  2WAD A;  2LH9 A;  2QVO A;  4UNO A;  2EB7 A;  1XC5 A;  2D1V A;  5EZG A;  3RZO J;  1SFK A;  3DPT A;  4E6K G;  1ETQ A;  5FKO A;  3M8E A;  3GVA A;  4B09 A;  1JUP A;  4L0Y B;  2VKD A;  4RGR A;  4LIT A;  1D3Y A;  3OYI A;  1ETW A;  2DK5 A;  2VJI A;  3BTL A;  1IN5 A;  3G73 A;  1G3Y A;  3HUG B;  1MMN A;  3JCU C;  2LRD A;  5BMZ A;  1FPQ A;  2K86 A;  3HPG A;  3FBI B;  2OD5 A;  4CCM A;  5J1R A;  1EH7 A;  4OU0 A;  3Q0V A;  4P55 A;  4BXF A;  3OR1 C;  4EM1 A;  2RKH A;  4DBQ A;  2HNH A;  4Y4R A;  5K7H A;  2CJJ A;  3TGN A;  1PP7 U;  1K61 A;  1X1C A;  3HKZ N;  3A0B C;  4LOC A;  3IHU A;  1ZRE A;  3GTP J;  3CUO A;  3L2R A;  1Z6T A;  1V5F A;  2VBW A;  5HOO A;  5LHI A;  1EKE A;  4XL9 A;  4RLQ A;  3WTU C;  4E70 A;  3CCU I;  1H9T A;  2VKE A;  4RGX A;  5DD4 A;  2IA2 A;  1OJL A;  4GGG A;  2K9L A;  4HZF A;  1KZH A;  2LD5 A;  1CGP A;  1Z9C A;  3DKX A;  4LK0 F;  2K9N A;  1D8K A;  2IS1 A;  4G6T B;  3WU0 A;  1RUN A;  1Z7L A;  2HOE A;  5FB2 A;  2LDU A;  1F36 A;  4HEA 2;  2M45 A;  1ZR2 A;  3J7A Y;  2IS6 A;  4F3Q A;  1JE8 A;  2Q8K A;  2GOM A;  1RRJ A;  3VWB A;  2HQN A;  2LNB A;  1MMG A;  1XMA A;  3F8N A;  4KIC A;  3GTQ J;  1LFB A;  2HPM A;  1ODD A;  3H35 A;  1ZG3 A;  3BOQ A;  1AOY A;  2QGU A;  3A02 A;  4PGH A;  3ZQQ A;  1WRJ A;  3E6B A;  5FD5 A;  3H36 A;  3OYE A;  3FXU A;  2FEZ A;  5LGT A;  5JHF A;  3OV8 A;  3S3N A;  1I50 J;  1TQM A;  3S14 J;  4LLN A;  1YHQ I;  2DMU A;  4HYE A;  2IGN A;  5FGM A;  4RB1 A;  2DJN A;  1FIP A;  1BR2 A;  3CES A;  1QGP A;  3TO9 A;  4EVI A;  4LGW A;  4CSW A;  3GLX A;  4DIQ A;  1XSX A;  3C1D A;  1S9H A;  4BJT A;  2XAG A;  2W82 A;  2XAU A;  1A36 A;  1T38 A;  3IP4 B;  1H89 C;  3I5U A;  4M73 A;  4UV9 A;  2OQG A;  2FQ4 A;  4D1Q A;  1E17 A;  4B43 A;  2QQ8 A;  2WTE A;  2ADU A;  2BW3 A;  3TBI A;  1U5T B;  2K4J A;  5M3F J;  4HX4 A;  1T8I A;  3PJR A;  1I1G A;  3GZN B;  2JVH A;  2ZNZ A;  2V9K A;  5FLM J;  4E7K A;  4OWR B;  2IXS A;  1DPU A;  4KJZ A;  3M9A A;  5L3C A;  3MMY B;  3MKL A;  1R6R A;  2MW8 A;  4M6X A;  1R5I D;  3RIR A;  5IPA A;  4F7Z A;  2DLL A;  2VBX A;  4Y33 A;  1JKQ C;  4XON A;  1Z6R A;  4UB8 C;  1SVO A;  3T1B A;  1R71 A;  4YII A;  2DA4 A;  3RZD J;  2STW A;  4A0Z A;  2M0C A;  1B6A A;  3E6D A;  4M3G A;  4LG0 A;  4O6J A;  2IW5 A;  3IAS 2;  4EMS A;  2CGP A;  3SEQ A;  1BBY A;  1UST A;  4XLC A;  2X1C A;  3TL4 X;  3KLN A;  3CCS I;  2W25 A;  1MH3 A;  1SC7 A;  2EFQ A;  1OKR A;  2LBF A;  3QPL A;  3ZPL A;  3T5X A;  2ZXW H;  5EGO B;  3BQZ A;  3G3Z A;  2R3S A;  5EEG A;  4A3F J;  1TTY A;  2PMH A;  4XIC A;  4KT6 A;  3BCA A;  2Y69 H;  5J8C A;  2H09 A;  1ZEL A;  3FXL A;  3H5N A;  3ZMU A;  2CV2 A;  5LBQ A;  4HF2 A;  3C2B A;  3DEW A;  3OYF A;  1U78 A;  1R23 A;  4IL6 C;  3OYL A;  1SFU A;  3M07 A;  3GTL J;  2HQR A;  2E7W A;  2VLA A;  4PJM A;  3BR6 A;  3TW6 A;  3GTO J;  4EM0 B;  3LWF A;  3KZZ A;  5DYM A;  1VZ0 A;  4M3F A;  1WHU A;  3CCJ I;  2ACJ A;  3OYN A;  4A3I J;  1YW9 A;  1A04 A;  1XGM A;  3LNQ A;  2GIV A;  1SVL A;  4HAM A;  2LF7 A;  1WCM J;  2NRA C;  2W00 A;  3LA3 A;  3RPU D;  3ABM H;  2WC2 A;  1N78 A;  2M7A A;  2XPW A;  3RDI A;  1U8R A;  2H6B A;  4JX4 A;  5BPD A;  2L9V A;  1FTT A;  1T95 A;  5M5X J;  3RPQ A;  2X85 A;  2X6Y A;  3F0C A;  4A5M A;  1MD0 A;  5C44 J;  3B6C A;  4N4O B;  1JHH A;  2MG4 A;  3WGG A;  2ZFW A;  3QOD A;  5H6Q A;  4I02 A;  1O7L A;  4QTR A;  2NS7 A;  3EUH C;  5EG0 B;  3DEE A;  5J1U A;  2CU7 A;  2UXN A;  1VQL I;  1A35 A;  1Y39 A;  2FOK A;  1F43 A;  2W1O A;  1KQ0 A;  3PNY A;  1IN4 A;  3MEX A;  3W2V A;  2P81 A;  2JJ7 A;  3CDI A;  3K2A A;  2ESH A;  4O5V A;  4ENJ A;  3C18 A;  3K4C A;  1LNW A;  4BY7 J;  3H92 A;  1S7O A;  3IL2 A;  2D5V A;  5HLH A;  1FY7 A;  3KYD B;  3OWT A;  1K78 A;  1BOA A;  3P7N A;  3AL0 C;  1OCP A;  4BL0 B;  2V6C A;  4C2U A;  2WAE A;  1FX7 A;  1B1B A;  3BZ6 A;  2KL4 A;  2CSO A;  4EJU A;  3F8M A;  1W36 C;  3AKZ A;  4HST A;  2F5V A;  2M0M A;  1XPX A;  4NC8 A;  1AU7 A;  3W2A A;  3DXJ F;  4HPQ A;  2NXN B;  1RC9 A;  4XMY A;  1FZP B;  2VON A;  3FDY A;  2IEK A;  2YU9 J;  3E6M A;  1IRZ A;  2XRL A;  4BHC A;  2FRH A;  1QBJ A;  3S2D J;  4BAC A;  3RJP A;  1P9Q C;  2VKV A;  1VQ6 I;  1OYI A;  4BEH A;  2I10 A;  2ZNY A;  5JVG F;  1Y0U A;  2OCE A;  3QYE A;  3Q9S A;  4D0P A;  1I39 A;  1Y8R B;  4I2O A;  3FXM A;  2A07 F;  4I99 C;  1WFX A;  2Y0M A;  4QWQ A;  4LB6 B;  2WV1 A;  2DA5 A;  1Z21 A;  4UXN A;  4G94 A;  3TDU C;  1ETV A;  2ZXJ A;  4FET A;  1R49 A;  3HOT A;  3QP5 A;  2W7N A;  1MBG A;  1KQ8 A;  1A31 A;  4FX4 A; 
#chains in the Genus database with same CATH homology
 2RV8 A;  4GCV A;  3T8R A;  4BAY A;  4HV5 A;  2IT0 A;  2ISY A;  1OPC A;  3E3V A;  4XLN F;  1GVJ A;  4R1H A;  2HYG D;  2P6T A;  4I09 A;  3I59 A;  5ICG A;  1STZ A;  2JSC A;  1ON1 A;  3GZ5 A;  3BJO A;  5JFR A;  1W7P A;  4EJV A;  3J80 K;  3WOD F;  1MJ9 A;  1DDN A;  4FHT A;  3F3X A;  1RIO H;  5ICE A;  3JAM Z;  3JSP A;  1ZYR F;  5FD6 A;  3EQL F;  1MDM A;  2PFB A;  3M1E A;  4OMZ A;  2XIG A;  3V7R A;  3RKW A;  5LRR A;  5F64 A;  4LMY A;  3HRS A;  4JQF A;  2AXL A;  2VOD A;  1G3W A;  2KJC A;  2Z5U A;  4A6E A;  4L0Z B;  2O8X A;  2VN2 A;  2H94 A;  1TBX A;  2XRO A;  4RGS A;  4Y15 A;  1DP7 P;  1IXC A;  5L3B A;  2EFW A;  1FP2 A;  2FXA A;  1R1V A;  1BIB A;  2CFX A;  5ERI A;  4RB0 A;  2VE8 A;  1YTY A;  1K79 A;  2JRT A;  1L0O C;  3HRU A;  1YG2 A;  5DCF A;  3GYH X;  3BWG A;  4TV7 A;  2DU9 A;  5AIP A;  2NNY A;  1LB2 A;  3I58 A;  1QZZ A;  1TQI A;  1Q1H A;  2W24 A;  3SFZ A;  2EFO A;  4U88 A;  2Z99 A;  2J5O A;  5JI6 A;  4XBF A;  3TQN A;  3WTZ A;  3ERE D;  3K0L A;  2F5E A;  1TW2 A;  3TOA A;  4LK1 F;  3O6B B;  2QEN A;  4MGR A;  1D8J A;  3ABU A;  3WTT C;  1SFE A;  3KP7 A;  2KJB A;  3QAH A;  3WU1 B;  1IXS B;  2A69 F;  3CUQ C;  1B59 A;  1XMK A;  4M6Y A;  1WI9 A;  2XKP A;  3RI4 A;  2F2E A;  4Y17 A;  3KP5 A;  5D6E A;  2IA0 A;  2K27 A;  2FMY A;  2FML A;  1PP8 F;  3B73 A;  3P9C A;  2YX4 A;  2AS5 F;  1EH8 A;  3V8K A;  1J2X A;  1ZN2 A;  3HSR A;  1TW3 A;  4BYY A;  5A2Q Z;  3QP6 A;  3M8F A;  5L3F A;  2OAZ A;  3S2W A;  5FFZ A;  3FXQ A;  1O57 A;  2XAQ A;  5JR3 A;  1W4M A;  3DEU A;  2Z33 A;  3QU6 A;  4AIJ A;  2Y48 A;  3O3K A;  3FX3 A;  3F72 A;  1ZAR A;  4HF1 A;  3H3U A;  3V4G A;  2DW4 A;  1P4X A;  2NAZ A;  1FBS A;  2UZK A;  4G7Z F;  4IPA A;  4BNC A;  1NHA A;  1P4W A;  4OIN F;  3QRF F;  2G7H A;  4LLL A;  3DV8 A;  2FBK A;  1SD4 A;  3ML6 A;  2HFH A;  2EJR A;  3BDD A;  1TNS A;  2P5V A;  4G6Q A;  1D5V A;  5IT9 Z;  3DKW A;  4IHS A;  2EWN A;  4XSZ F;  2ZCW A;  2MBF A;  1YIO A;  1I6X A;  2ETH A;  1FYM A;  2H27 A;  5IT3 A;  1AWC A;  3KFW X;  2O03 A;  1R5H A;  5E20 A;  4L9T A;  2KIM A;  4FX0 A;  5BOX A;  3FHZ A;  2PEX A;  3KZY A;  3GO5 A;  1OMI A;  4QLC U;  3WE2 A;  1FC3 A;  3IKV A;  4Q5S F;  4IRG A;  1C0W A;  3FXR A;  4GYI A;  2HR3 A;  2VBY A;  2XAF A;  3I71 A;  4CIC A;  4DQ2 A;  2RDP A;  3KLO A;  2K4B A;  5D6F A;  3FZV A;  1E2X A;  3ZP5 A;  2DT5 A;  3EUH A;  1JGS A;  1T98 A;  4MHG A;  5F6F A;  1LEB A;  2BV6 A;  1MJB A;  2IA1 A;  3E6C C;  2KIF A;  3DFG A;  2O0Y A;  1R36 A;  1R22 A;  3CTA A;  3K9T A;  2HTS A;  2OZU A;  5LGU A;  2W84 A;  1I5Z A;  3PQK A;  3R6S A;  1KQ9 A;  3FM3 A;  4RAY A;  2FU4 A;  1ON2 A;  3N97 A;  3HSF A;  2DFI A;  5CLS A;  1LDJ A;  2XGX A;  5ICF A;  1EV7 A;  4UUV A;  4KN7 X;  2E7X A;  4HLX A;  1YFH A;  1UB9 A;  1SD7 A;  2PN6 A;  1R5G A;  3E5Q A;  5FLX Z;  1YW7 A;  2MA3 A;  5ICC A;  3ZN0 A;  1J7K A;  4K2E A;  2VT3 A;  3ZMV A;  1SMT A;  2M8E A;  3V7S A;  3WGH A;  2XV4 S;  2Q0O A;  1FNN A;  1ZRC A;  5HVQ C;  1YYV A;  3AAF A;  4ESB A;  1KA8 A;  3BP8 A;  4ZZD A;  2PQ8 A;  4A12 A;  3HRT A;  1S7A A;  2BE5 F;  3QPT A;  1FYL A;  3F22 A;  5HLG A;  3F6O A;  1UHW A;  2QLZ A;  4EQQ A;  1FOK A;  2V1D A;  4N9H A;  1I1S A;  4A0Y A;  3FMR A;  3F8F A;  3K69 A;  1F1Z A;  5E1W A;  4YFN F;  1JXS A;  4G7O F;  2LF8 A;  3SHF A;  5H6R A;  1IRG A;  2L4A A;  3CO6 C;  3J81 K;  5E18 F;  5D8L B;  5KK1 A;  4OMY A;  4HX7 A;  3CDH A;  3L9F A;  3C7J A;  4M72 A;  3ZMT A;  2RC4 A;  2EA4 A;  4BHB A;  3D5L A;  1IN7 A;  3GXO A;  2V1U A;  5TRD A;  4P9F A;  2XRN A;  5AON A;  1K7A A;  2QWW A;  2V79 A;  2RN7 A;  2IRF G;  3HIF A;  2EV0 A;  2X4H A;  1I27 A;  1J9I A;  1U6G A;  5ILS A;  2GXG A;  3CUQ A;  2VC1 A;  4OIO F;  4N0B A;  2A61 A;  4UHT A;  4KUM A;  6PAX A;  1U5T C;  4WCG A;  4RB2 C;  2PBI A;  2VOO A;  3REO A;  4BXU A;  2JT1 A;  5HDN A;  4MQ9 F;  1W7P D;  5TJJ A;  2WWY A;  4P9U A;  2OZ6 A;  2JPC A;  1P92 A;  2P7V B;  4RAZ A;  1DUX C;  2YSR A;  2DTR A;  2HYF A;  4KMU X;  1ZLJ A;  3DQV C;  3IWF A;  1HST A;  1FWZ A;  3LST A;  3ELK A;  1BI2 A;  1HSJ A;  1HKS A;  3MCZ A;  2A6H F;  2VXZ A;  4MEX F;  4ESJ A;  3IRR A;  4KNY A;  5DEQ A;  1BN5 A;  4ENN A;  4P96 A;  3EDP A;  1R58 A;  1W5S A;  4EJO A;  4ZYE A;  2OU2 A;  4WF2 A;  4KIG A;  2XAJ A;  2P6S A;  3KET A;  2HGC A;  1FT9 A;  4IXA A;  2Q2E A;  1BC8 C;  2FSW A;  1OR7 A;  3I0T A;  1KU3 A;  1PDN C;  2COM A;  4BH9 A;  1F9N A;  2ZME A;  1KGS A;  4U7B A;  3WTY C;  4BQA A;  2IJL A;  4LG0 B;  3BJA A;  4KMF A;  1SMY F;  1XCV A;  4DNC A;  3FMS A;  3RPU A;  1IN8 A;  3RTR A;  1BI3 A;  5E1Z B;  5HLI A;  4B8X A;  4YG2 F;  2MH9 A;  1XN7 A;  3MFK A;  4U0V A;  1HQC A;  1LVA A;  4A5N A;  2DQR A;  3VOD A;  3KE2 A;  4M9X A;  2QM3 A;  5BS6 A;  3E5U A;  5LLQ A;  1W5T A;  2EA2 A;  2P7C B;  4S04 A;  2GA1 A;  5BQT A;  5LEK A;  1GHC A;  4KA4 A;  5BPI A;  2RNJ A;  3MZH A;  3B02 A;  1R7J A;  2O3F A;  3N4M A;  1UCR A;  1HW1 A;  2QZ8 A;  2QBY A;  4A2U A;  1MKM A;  4ZYH A;  4ZZL A;  3J81 Z;  2MC3 A;  5FO5 A;  4WWC A;  4AD9 A;  1Z1D A;  1SFX A;  4AWX B;  5HDK A;  2VE9 A;  1V4R A;  4MQV A;  4EJT A;  1BJA A;  2ISZ A;  2MH2 A;  3LAP A;  4M9S A;  5E1X A;  2K02 A;  4IJA A;  5L3D A;  3R60 A;  3KEO A;  3F23 A;  4IHT A;  1RI7 A;  3ECO A;  2R7F A;  3K2Z A;  2JPB A;  3O2P E;  2PI0 A;  4WK8 F;  1K78 B;  3VFZ A;  3R0J A;  2RGV A;  1B9N A;  2GA2 A;  4KIF A;  3COA C;  4ESF A;  1UFM A;  3T8T A;  1XB4 A;  3JTH A;  4KFC A;  2IVM A;  4KYW A;  1MJA A;  1YS7 A;  2XHK A;  3OOP A;  2PG4 A;  2DQL A;  3F6V A;  2HKX A;  2P5K A;  3L2C A;  4CDG A;  5D5U B;  3GFL A;  5JVT A;  1SAX A;  4I7H A;  2OBP A;  2CWE A;  5HDG A;  1RUO A;  4PGG A;  4OOI A;  5K1Y A;  1XDU A;  1F5T A;  4BHP A;  1CF7 A;  1O3R A;  2KRF A;  1P2F A;  3R4K A;  1HKT A;  3Q9V A;  2HTJ A;  3SZP A;  1IF1 A;  1WWX A;  2OQR A;  2A68 F;  5L3G A;  1LDK B;  4HDV A;  4ON0 A;  3ABT A;  3I59 B;  4I0A A;  4ASN A;  1FSE A;  3TO6 A;  3ULQ B;  3JTG A;  2IPQ X;  1O7F A;  1W7P B;  4UVA A;  3W6J B;  3K1M A;  1R1U A;  1Z7U A;  2KIU A;  4HX8 A;  4ZYD A;  4Q4Z F;  4Q48 A;  5DCM A;  4M9Z A;  5LHG A;  1MDM B;  2WV0 A;  3KP2 A;  4O3M A;  3M7G A;  3HRM A;  4Z2Y A;  3T0Y A;  2GZW A;  3LA2 A;  3BRO A;  3GFJ A;  3KEQ A;  3PQJ A;  4H0E A;  2XAS A;  1WQ2 A;  3BY6 A;  2PMU A;  2CYY A;  3HTS B;  1ZGA A;  5HS9 A;  4RS8 A;  2L02 A;  1S8N A;  4HOB A;  3K1N A;  4L5I A;  1TNT A;  2IP2 A;  1PUE E;  2HDC A;  3J80 Z;  2EK5 A;  3IWZ A;  4G6D A;  2MLK A;  5F1R A;  1WKM A;  4LB5 A;  4ZH4 F;  5CVU A;  4L5J A;  2STT A;  1IN6 A;  1P4A A;  2PLY A;  2UWM A;  1U5T A;  5H20 A;  1ZRF A;  2HS5 A;  1HW5 A;  3WE3 A;  2GWR A;  4EM2 A;  3EYY A;  4HDU A;  2D45 A;  2L54 A;  3GX4 X;  5JHU A;  2ZBK A;  3ROU A;  2GXB A;  5J8F A;  2P5L C;  3H3Z A;  2E1N A;  3LA7 A;  1WSU A;  2XKO A;  3RYP A;  5KVR A;  2QQA A;  1BI0 A;  4CZZ A;  1XGO A;  3MAJ A;  3TO7 A;  3GUD A;  2G7U A;  2M1B A;  2FBI A;  5J6X A;  3ZMS A;  1QNT A;  3CLO A;  4IF4 A;  1XDS A;  4L9N A;  2VC0 A;  2J5P A;  1SD6 A;  3TKY A;  2F5F A;  3WGI A;  4YFX F;  4YFK F;  1REP C;  4AIH A;  2GQQ A;  4WXH A;  3U9G A;  3DPL C;  1XGN A;  2RQP A;  1FLI A;  4OIP F;  2HWV A;  1U3E M;  1XCB A;  5DCM B;  5D4S A;  1KYZ A;  2C6Y A;  1BIA A;  1HBX G;  3KCC A;  2ZJ2 A;  2L4M A;  2DO7 A;  1L3L A;  1J5Y A;  2F5D A;  1S6L A;  4GXO A;  1BI1 A;  1VTN C;  2A6E F;  4HLY A;  1TQP A;  1LEA A;  5CJ9 A;  4EGY A;  5E17 F;  3HTU A;  2V1X A;  4OIR F;  3V7C A;  2CO5 A;  5DD8 A;  1XGS A;  4ENM A;  3MQ0 A;  5K5O A;  2H6C A;  3ZQ7 A;  4XLP F;  3TOB A;  2FBH A;  2O61 A;  5HS8 A;  2DBB A;  4YIF A;  3JAM K;  2HZT A;  1G3T A;  2EV6 A;  1FBU A;  1ULY A;  3KP6 A;  4EGZ A;  2DI3 A;  4MTD A;  1ZG5 A;  3CJN A;  1FYK A;  1YO5 C;  3RKY A;  2CQK A;  2MD5 A;  2FNP A;  1RNL A;  1S29 A;  4HF0 A;  4M74 A;  5K5R A;  2HKO A;  1ZGJ A;  3MZY A;  1FSH A;  5DUK A;  1ZAO A;  3GFM A;  4AIK A;  3GZ6 A;  4FT8 A;  4G7H F;  4N9I A;  5L3E A;  5LRS A;  1RZ4 A;  3VB2 A;  4U0Y A;  2DK8 A;  1J59 A;  2QYO A;  4UVB A;  1JHF A;  2NYX A;  3HHH A;  4PCQ A;  1Z91 A;  4XRF A;  4KN4 X;  3J7A O;  1EH6 A;  1YLF A;  5D5X B;  2G9W A;  3LFK A;  5ED4 A;  1X3U A;  3EYI A;  3FWE A;  4KDP A;  3GFI A;  3TDZ C;  3C3W A;  3VEP A;  3GEZ A;  1IAW A;  4L18 B;  5DDG A;  1YQA A;  2R7D A;  2P8T A;  1ZLK A;  4CHU A;  5CVJ A;  1KU7 A;  3P9I A;  1KU9 A;  4I98 B;  3SQN A;  2BBY A;  1GXQ A;  1BC7 C;  2DPD A;  2YPR A;  4A6D A;  4UV8 A;  4PZJ A;  4KIB A;  2CG4 A;  5A2Q K;  2D1H A;  2Y75 A;  2DPU A;  4CXF A;  1USS A;  2FQ3 A;  1ZRD A;  4IRH A;  3U2R A;  4I0B A;  3I64 A;  5FFX A;  2P4W A;  4ZYG A;  5DUI A;  2B0L A;  3IRQ A;  4XSX F;  5CVR A;  3ZMD A;  2L01 A;  3IKT A;  1HXD A;  4CYD A;  1G4D A;  3BPV A;  2LKP A;  2VT2 A;  1IXR C;  2X0L A;  2JTV A;  3LQQ A;  2PJP A;  4M71 A;  4WXD A;  3NRV A;  3K1P A;  3DF8 A;  4A0X A;  4CGZ A;  4U7D A;  4LLG F;  5CYV A;  3SZT A;  3NEU A;  4HA8 A;  1F4K A;  5LGN A;  4UVC A;  3CO7 C;  1QZY A;  2BGC A;  4L9J A;  4LJZ F;  1YW8 A;  2KKO A;  5EEH A;  2HEO A;  2ELH A;  4HW0 A;  4HQM A;  1SD5 A;  1IZ1 A;  5D4R A;  3IC7 A;  3E97 A;  3I53 A;  2M5W A;  2A3S A;  5IT9 K;  4ENK A;  3R61 A;  2EV5 A;  4EJW A;  1T2K A;  1HW2 A;  1ZHF A;  4EV0 A;  1YS6 A;  1MGT A;  3D0S A;  3R0A A;  4LD5 A;  3WTS C;  5D5W B;  3I54 A;  2VOP A;  4G9Y A;  2JZY A;  5LEJ A;  4HQE A;  3RYR A;  4IVN A;  2VBZ A;  4GYG A;  2E1C A;  1ZG1 A;  2XVC A;  1T6S A;  2QQB A;  3F21 A;  2XAH A;  1LDD A;  3MWM A;  1LJ9 A;  1UHM A;  5LHH A;  3L7W A;  3CUQ B;  3ISP A;  4Q47 A;  4S05 A;  4GO1 A;  4LFU A;  4ETS A;  1XSD A;  2FNA A;  1XSV A;  3Q5F A;  4WXC A;  3PFI A;  2BEO A;  5E8I A;  1QQI A;  2W57 A;  4JK1 X;  5ILU A;  4NQW A;  1IRF A;  3V8L A;  1QPM A;  2L3D A;  2OA4 A;  4HBL A;  3EET A;  3FF5 A;  4RB3 C;  3WTV C;  3GWZ A;  4R79 A;  2CW0 F;  3RKX A;  2LSO A;  5K5Q A;  3SXY A;  2FE3 A;  1KU2 A;  1IUY A;  2QQ9 A;  1TLH B;  3GW2 A;  4KT5 C;  3V8J A;  3ZMZ A;  2ZO4 A;  1J75 A;  4P5O A;  2FF4 A;  3HHG A;  4R8H A;  4AVP A;  1XD7 A;  1G6N A;  3P9K A;  1U2W A;  1OYW A;  5E8G A;  2NS0 A;  4JBA A;  3QPH A;  3QU3 A;  1Z05 A;  5FLX K;  1H0M A;  2YR2 A;  3VOE A;  2ZKZ A;  2NNN A;  4U0W A;  3KP3 A;  5ILV A;  1B4A A;  5CVI A;  2ZME B;  5D8K B;  3FMQ A;  3HSE A;  3L00 A;  4G8X A;  2M30 A;  2V9V A;  1KYW A;  4WX9 A;  4HV6 A;  2A5Y B;  3HUG A;  1S3J A;  1R1T A;  2Z9O A;  3DP7 A;  3BJ6 A;  4RGU A;  2M87 A;  5CVV A;  1G3S A;  1R00 A;  1H9G A;  1IW7 F;  2W85 A;  4NB5 A;  5HS7 A;  3ECH A;  1J0R A;  1QO0 D;  1LQ1 A;  1O3T A;  3HOS A;  3HYI A;  4CO8 A;  2EFN A;  1MZB A;  1OYY A;  1V3F A;  2XUB A;  3WTW C;  2QBY B;  3ZN1 A;  1BM9 A;  3E5X A;  1GXP A;  2O6G E;  1B9M A;  2RVC A;  3LAJ A;  5DV5 A;  2F5C A;  2YX7 A;  3LQR A;  4IRI A;  4I01 A;  2EFP A;  1T0F A;  3KP4 A;  2TDX A;  1FP1 D;  2GAU A;  1DPR A;  3JW4 A;  2MLG A;  1ZH5 A;  2YU3 A;  2UXX A;  3GF2 A;  4MTE A;  1FBQ A;  2ESN A;  3FM5 A;  2DAO A;  3I4P A;  4NHJ A;  5D5V B;  2D2W A;  3BPX A;  3F8C A;  4PDK A;  5AIQ A;  3JSO A;  1O3Q A;  3QOP A;  4MNU A;  1P6R A;  3WTX C;  4L9V A;  3W6K B;  1O3S A;  3L09 A;  1K6O A;  2BYV E;  4Y13 A;  1ONV A;  3U1D A;  4MEY F;  3F8B A;  1CF7 B;  2FA5 A;  2Z3Y A;  3WG9 A;  4OIQ F;  1HKQ A;  3NQO A;  1T39 A;  2QUF A;  2K7L A;  2QVO A;  4UNO A;  2EB7 A;  2D1V A;  3DPT A;  3M8E A;  3GVA A;  4B09 A;  4L0Y B;  4RGR A;  1D3Y A;  2DK5 A;  1IN5 A;  3G73 A;  1G3Y A;  5BMZ A;  1FPQ A;  2K86 A;  2OD5 A;  1EH7 A;  4OU0 A;  4P55 A;  4EM1 A;  2RKH A;  3TGN A;  1PP7 U;  3IHU A;  1ZRE A;  3CUO A;  1Z6T A;  2VBW A;  5HOO A;  5LHI A;  3WTU C;  4E70 A;  1H9T A;  4RGX A;  5DD4 A;  2IA2 A;  4GGG A;  4HZF A;  1CGP A;  1Z9C A;  4LK0 F;  1D8K A;  3WU0 A;  1RUN A;  2HOE A;  5FB2 A;  2LDU A;  2M45 A;  1JE8 A;  2Q8K A;  2HQN A;  2LNB A;  1XMA A;  4KIC A;  3F8N A;  1ODD A;  1ZG3 A;  3BOQ A;  1AOY A;  4PGH A;  1WRJ A;  3E6B A;  5FD5 A;  3FXU A;  2FEZ A;  5LGT A;  3OV8 A;  1TQM A;  4LLN A;  4HYE A;  5FGM A;  4RB1 A;  1QGP A;  4EVI A;  3TO9 A;  4LGW A;  3GLX A;  1XSX A;  3C1D A;  2XAG A;  1T38 A;  3I5U A;  4M73 A;  4UV9 A;  2OQG A;  1E17 A;  2WTE A;  2ADU A;  1U5T B;  2K4J A;  4HX4 A;  1I1G A;  2ZNZ A;  1DPU A;  3M9A A;  5L3C A;  4M6X A;  3RIR A;  4F7Z A;  2DLL A;  2VBX A;  1Z6R A;  3T1B A;  4YII A;  2STW A;  4A0Z A;  1B6A A;  3E6D A;  4LG0 A;  4O6J A;  2IW5 A;  4EMS A;  2CGP A;  1BBY A;  1UST A;  3KLN A;  2W25 A;  2EFQ A;  1OKR A;  3ZPL A;  3T5X A;  3G3Z A;  2R3S A;  5EEG A;  1TTY A;  2PMH A;  5J8C A;  2H09 A;  3ZMU A;  5LBQ A;  4HF2 A;  1U78 A;  1R23 A;  1SFU A;  2HQR A;  2E7W A;  4EM0 B;  3LWF A;  3KZZ A;  5DYM A;  2ACJ A;  1YW9 A;  1A04 A;  1XGM A;  2GIV A;  4HAM A;  2LF7 A;  2NRA C;  3LA3 A;  2WC2 A;  3RDI A;  1U8R A;  2H6B A;  5BPD A;  3RPQ A;  4A5M A;  1MD0 A;  1JHH A;  3WGG A;  2ZFW A;  5H6Q A;  4I02 A;  1O7L A;  2UXN A;  2FOK A;  1KQ0 A;  1IN4 A;  3MEX A;  4O5V A;  4ENJ A;  2ESH A;  3C18 A;  1LNW A;  3H92 A;  1S7O A;  3IL2 A;  5HLH A;  1FY7 A;  1K78 A;  1BOA A;  3P7N A;  2V6C A;  1FX7 A;  1B1B A;  3BZ6 A;  2CSO A;  4EJU A;  3F8M A;  3DXJ F;  2VON A;  1FZP B;  3E6M A;  4BHC A;  2FRH A;  1QBJ A;  3RJP A;  1OYI A;  2ZNY A;  1Y0U A;  3Q9S A;  4D0P A;  4I2O A;  2A07 F;  4QWQ A;  2Y0M A;  4LB6 B;  4UXN A;  4G94 A;  3TDU C;  2ZXJ A;  3HOT A;  3QP5 A;  1KQ8 A;  4FX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...