4PZJA

1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
69
Chain Sequence
MLDFRVETFLTVRTMNYTRAAEELNITQPAVSQHIAHLERDYGVPLFAYRNKKLQLTDAGALLRDALST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
publication title 1.60 Angstrom resolution crystal structure of a transcriptional regulator of the LysR family from Eggerthella lenta DSM 2243
rcsb
source organism Eggerthella lenta
total genus 22
structure length 69
sequence length 70
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pzjA00
2EJRA 1IXCA 4WF2A 4A12A 2OBPA 1F9NA 1FYKA 3ULQB 5H20A 4N9IA 4K2EA 2RC4A 1H9TA 2PFBA 2JT1A 2KKOA 4Q47A 3T8TA 5TRDA 1H9GA 2HQNA 2VC1A 4IHTA 3REOA 4RB0A 1SFXA 1FP1D 2P5KA 4IJAA 1K78A 2MLKA 2FXAA 5ICGA 3F8BA 3QRFF 3KCCA 1YS7A 3U1DA 4MEXF 4HLXA 3WGGA 1BIAA 3R60A 2Y0MA 2O61A 4CICA 3LWFA 4IPAA 1MDMB 2EFWA 2HR3A 3MZYA 5JHUA 3CTAA 4ZYDA 2XUBA 4KICA 4QLCU 2D1VA 4PGGA 5K5OA 5DDGA 2ESHA 2FSWA 5DYMA 4Q4ZF 2G7UA 2E1NA 4MEYF 2RQPA 3I4PA 3K9TA 5EEHA 1JXSA 5FO5A 2P8TA 2KJBA 5D6FA 1HKQA 4GO1A 4HX8A 5DCFA 3CUOA 2MD5A 4Q48A 1EH8A 2WV0A 1A04A 2IA0A 2K86A 2D2WA 1YW7A 5BQTA 2DLLA 4EJWA 2Q2EA 2FOKA 1HW2A 3K1PA 2FRHA 4I98B 4WXHA 2P5LC 4Y17A 4CGZA 1BI3A 3RPQA 1U3EM 1R5GA 2L4MA 2F5CA 2J5OA 3W6JB 2HYFA 4P5OA 2Z33A 5KK1A 5FD6A 4Q5SF 1HSTA 5ICFA 1JGSA 4KN4X 4MNUA 2QBYA 3C18A 4I0BA 3G73A 2E7WA 4UNOA 3RYRA 1XSXA 1BJAA 3I71A 4UVAA 3J81K 2LKPA 4HX7A 1LEAA 1K78B 3I59A 2NS0A 1QQIA 2BGCA 1T98A 5D8KB 1DPRA 3OV8A 2DPDA 2ZNYA 4TV7A 1KU9A 1BI1A 3WTTC 2M8EA 2V1UA 2FQ3A 5DV5A 5E1WA 1O3RA 5L3CA 2FNAA 1J75A 4MQVA 3VOEA 2A07F 4P9FA 2OQRA 3GLXA 4U0YA 3T0YA 5J8FA 2H6CA 2K7LA 3K1NA 1D8JA 3NRVA 3FM3A 2H27A 1O3TA 4KUMA 5L3BA 1FLIA 3C1DA 2LF8A 4AIHA 1TQMA 1O3QA 2O3FA 2OU2A 5D5WB 3TQNA 1PUEE 4UVCA 3RKWA 2VC0A 1ZLJA 3VB2A 3L00A 2XAJA 4YFNF 2W84A 3K1MA 4R1HA 1FSHA 1V4RA 2XIGA 2RVCA 1QNTA 4I2OA 2MC3A 3KFWX 2CG4A 3GEZA 1T0FA 4RGUA 3F21A 3SQNA 1TW2A 4ESBA 2MBFA 2EB7A 3NEUA 3F6VA 1T38A 1FYLA 3ZMTA 2R3SA 1OR7A 4MTDA 3ZPLA 4GGGA 1YW9A 2IW5A 2MLGA 2PEXA 4RGSA 5E8GA 4G7ZF 4B09A 4A6EA 1K7AA 5J6XA 1IRFA 2QQAA 1DP7P 4IXAA 4NHJA 1J0RA 3F23A 3R0JA 1E2XA 3LQQA 1I1SA 3TO9A 3SFZA 4A2UA 4G7OF 3WTXC 3KP4A 3FMSA 5BOXA 2EK5A 1O57A 3EYIA 4OU0A 3IL2A 4LMYA 5AIPA 4UVBA 2W25A 1O3SA 3E3VA 3IHUA 3D0SA 5H6RA 1XCVA 2VBWA 4HF1A 1USTA 4KA4A 2D1HA 3V8JA 5DD8A 1EV7A 1V3FA 2FEZA 1REPC 2QQ9A 5LHHA 3HRSA 1FZPB 1UB9A 1TNTA 3TKYA 3B02A 2PBIA 3WGHA 4M73A 1LDJA 2FBIA 3Q9VA 2JRTA 3HSFA 1AOYA 4Y13A 3R61A 3E6DA 4P96A 4HDVA 2H6BA 2M87A 4BHPA 2F2EA 1ULYA 3RKXA 2VOOA 1JHFA 3WE3A 1QZZA 1BI2A 1GVJA 4EMSA 2VT2A 2YX7A 2VE9A 3GYHX 3QOPA 1HXDA 5ILUA 3N4MA 3VFZA 3IRRA 1SD5A 4KIBA 1W5SA 5HS8A 2CSOA 4WWCA 1I5ZA 1FX7A 4HQMA 2UWMA 1KU7A 4RAYA 2RKHA 4ENKA 1FT9A 1FY7A 3QAHA 1IZ1A 2RDPA 1SAXA 1PP8F 2RN7A 3M7GA 3EQLF 2ZJ2A 4OIPF 2L02A 3DV8A 3VODA 1T39A 1F4KA 2VE8A 3V8LA 2DT5A 1P6RA 4EM1A 3QP6A 2VODA 2WC2A 4O3MA 5ED4A 5LBQA 1JHHA 3O2PE 5D4SA 1W7PB 1ZREA 4LFUA 3HRTA 3I64A 3FX3A 1FPQA 2GAUA 2JTVA 1XN7A 1PDNC 5LLQA 1MDMA 1U5TA 4EV0A 3ROUA 2CWEA 3L09A 4UV9A 2OD5A 5IT9K 1XMKA 5D6EA 3I53A 3P9CA 1LB2A 1I27A 2X0LA 4ZYGA 1TBXA 1YW8A 3M8EA 2PI0A 4OMZA 1U78A 4ZZDA 2GA1A 4KNYA 1U5TC 5FFXA 1J9IA 2G7HA 3JTHA 4G9YA 1GHCA 4GCVA 1K79A 4HQEA 4HF2A 1ZYRF 2Q0OA 3RYPA 5E1XA 1ZARA 2UXXA 3JAMZ 1PP7U 1J2XA 2XHKA 1KYZA 2C6YA 2AS5F 4HDUA 3GXOA 5D4RA 1Z05A 1Q1HA 2DPUA 2NRAC 2QVOA 1HW5A 2XAGA 3BJOA 1FBQA 4UV8A 2MA3A 1ON2A 3H3UA 3QU3A 1Z9CA 1UHMA 3ZMZA 3TGNA 4BHBA 2OZ6A 3TO6A 2EA2A 2RV8A 2XVCA 2K02A 4M72A 2H94A 1FBUA 1FBSA 1P92A 1TW3A 2EV5A 3B73A 3ZQ7A 5DCMA 3COAC 1R36A 4BQAA 2PQ8A 2DQLA 2CFXA 3PQJA 5HS9A 4CHUA 3WU0A 1IRGA 3U2RA 1GXPA 2KIFA 3BP8A 1R22A 1DUXC 3BJAA 2ZBKA 1ZGJA 2DK8A 2L3DA 2L4AA 1U5TB 2AXLA 3MZHA 4ASNA 2O0YA 3MWMA 1HQCA 3DKWA 1C0WA 4ENMA 4L9JA 1HSJA 3I0TA 5FD5A 4G8XA 1IN4A 3IC7A 1H0MA 1HW1A 1YIOA 1KU3A 3ZMDA 4NB5A 4I09A 3ZN0A 1OYWA 3I5UA 3IKVA 5E1ZB 5E18F 2EFOA 2NYXA 2DQRA 3F8CA 2ZKZA 2V79A 1WWXA 1X3UA 2M30A 2YR2A 1IN8A 5L3EA 4QWQA 4EM2A 5DEQA 1ZN2A 5L3FA 3JTGA 5JVTA 1R5HA 2L54A 3K0LA 4PGHA 5F6FA 3WTZA 3FXUA 3RIRA 3J80K 4WX9A 3BROA 3ZP5A 2QQBA 1W5TA 4RGRA 2ESNA 2ELHA 3EYYA 1R1TA 3DPTA 1NHAA 3TDUC 2VN2A 2XKOA 1KQ8A 2STTA 4RB3C 1U2WA 3ELKA 1ODDA 2WTEA 1LDDA 4N0BA 4E70A 2ZCWA 3F8NA 3M9AA 3OOPA 2DAOA 4LG0A 2FMYA 3HRMA 1F1ZA 3DQVC 5DCMB 2KRFA 1ZG3A 1TQPA 5HS7A 2QUFA 3RDIA 3FMQA 4U7BA 3HTSB 4IRGA 1RUOA 4LD5A 5FLXZ 2XGXA 4LLNA 1WRJA 2W85A 3BJ6A 5ILSA 4XRFA 3TOAA 4M71A 3IWFA 4M6XA 2HTJA 5HLGA 1D8KA 3Q9SA 1MGTA 1FP2A 1XDUA 4FT8A 2ZNZA 1G3SA 2LF7A 1YO5C 4U88A 1KYWA 3GW2A 2YU3A 4LB6B 3N97A 2XV4S 2BBYA 3L9FA 5LRSA 2M5WA 4AD9A 3QPTA 4CZZA 1HBXG 2J5PA 3V7RA 2VBXA 4WXCA 2MH2A 4LLLA 1OKRA 4P9UA 3RJPA 1BM9A 4L9NA 1FNNA 3EETA 2PLYA 3LA7A 4PDKA 4M9XA 4M9SA 3H92A 3DEUA 3GWZA 2QLZA 4HZFA 3ZMSA 4N9HA 5LHIA 2GXGA 4Y15A 4WK8F 2IVMA 4HV5A 3P7NA 2HZTA 5CVIA 4L18B 2UXNA 1TLHB 3V4GA 3ABUA 4MHGA 4IF4A 2OAZA 3KP5A 3CO7C 1BN5A 3T5XA 4ENNA 1MJ9A 4M74A 2CQKA 4ETSA 1FWZA 1UFMA 5A2QK 4HX4A 4L0ZB 2VT3A 4G6QA 4U7DA 4HV6A 2M1BA 1BI0A 1R7JA 2D45A 3GVAA 4LG0B 3FXQA 3ABTA 5BPDA 5LEKA 4LK1F 4OIRF 4R79A 1I1GA 3MFKA 4AVPA 3R4KA 3T1BA 5HDNA 3KEOA 5DD4A 4BAYA 1SFUA 3RTRA 5D8LB 3P9KA 3WGIA 2Q8KA 1MZBA 5LRRA 3NQOA 5ERIA 3E97A 3D5LA 1J5YA 3E6BA 5D5VB 1YS6A 3CUQC 1R1UA 2YSRA 2HEOA 5BS6A 3HHHA 2DU9A 1W7PA 2CO5A 2EFQA 2W57A 2HWVA 4EVIA 2QWWA 5ILVA 1ZG1A 3FZVA 3MEXA 4AWXB 1Z1DA 3IWZA 5J8CA 1G3YA 3E6MA 1OMIA 2O03A 1EH7A 4RGXA 2DTRA 5LHGA 1XGOA 4IRHA 4LK0F 1QBJA 1XGSA 2VONA 2K27A 5K5QA 1BIBA 1S29A 2Z9OA 1XD7A 2FBKA 1L0OC 2KIMA 2A5YB 4I02A 1U8RA 2TDXA 5K1YA 3O6BB 3SXYA 4EJTA 2DI3A 3BOQA 5DUIA 4UHTA 2COMA 1IUYA 2B0LA 1OPCA 2A68F 1LDKB 1GXQA 3I54A 4ESJA 4RB2C 3DP7A 1K6OA 3U9GA 2IA2A 2FU4A 2JPCA 4WCGA 4KFCA 1DDNA 3K69A 2R7FA 3CUQB 2KIUA 3HOSA 1RNLA 3CO6C 2CYYA 2HDCA 3WTSC 1P4WA 1O7FA 3BPXA 3HRUA 3V8KA 2FA5A 1BOAA 1ONVA 3L7WA 4KIFA 1LQ1A 1EH6A 4BYYA 5AONA 2RNJA 2YPRA 3JW4A 5HDGA 3ZN1A 3HIFA 2P4WA 1IN6A 2PN6A 4FX4A 4YG2F 2HFHA 1YTYA 1KU2A 2EFPA 3J81Z 1XSDA 2G9WA 4AIKA 2FMLA 4A5MA 4I01A 4OINF 1R1VA 3J7AO 1G3TA 5JR3A 4JBAA 1JE8A 2ZMEB 2LNBA 2XRNA 2ADUA 4A5NA 2HTSA 3GFMA 5HDKA 1E17A 3CDHA 1IXRC 2CW0F 1XCBA 2DK5A 2PMHA 4A0ZA 2Y48A 1VTNC 2F5DA 3WTUC 4DNCA 1OYYA 3GX4X 4JK1X 1ZGAA 3GUDA 3JSPA 4EJOA 5TJJA 4G7HF 4KMFA 1USSA 3MQ0A 2P5VA 5ICEA 1SMYF 2M45A 3KP2A 3M1EA 2NAZA 4HAMA 2GXBA 2P7CB 4CXFA 1RUNA 3LA3A 1TNSA 3FF5A 1IN5A 2R7DA 2ZXJA 3GFIA 4KYWA 1QO0D 5FFZA 5LEJA 1B4AA 2A6HF 4CO8A 1UHWA 4G6DA 1YLFA 4ZYHA 3E5XA 4M9ZA 4EQQA 1MJAA 4O6JA 3FM5A 3FWEA 4LLGF 3R6SA 5AIQA 1YFHA 4M6YA 1R23A 5K5RA 2F5FA 4G94A 4XSZF 2ZFWA 2IRFG 4BH9A 4MTEA 2XAQA 4XLNF 2GWRA 3WG9A 2P6TA 4B8XA 1Z6RA 2EWNA 1MD0A 2STWA 2F5EA 3LAPA 1B1BA 2ZO4A 3IKTA 3HSRA 4UUVA 3KLNA 2Z5UA 2EV0A 2DBBA 2EA4A 2IP2A 2HQRA 3HUGA 3KP7A 1S7AA 1D3YA 2ISYA 3PQKA 4KDPA 3PFIA 1LEBA 1W7PD 2OQGA 3RI4A 3W6KB 1XGNA 4ENJA 2VOPA 2PG4A 4YFKF 1B9NA 2A6EF 5HLIA 3TOBA 1DPUA 1L3LA 3MCZA 3F72A 4HA8A 4O5VA 3GFLA 4BNCA 1IF1A 2FF4A 2BV6A 1AWCA 1QGPA 1P2FA 3RPUA 1BC8C 2QM3A 2VBZA 2FE3A 3DF8A 3C7JA 4A6DA 3KZZA 4HLYA 3RKYA 2DFIA 2L01A 4Z2YA 4XLPF 3EUHA 4ZYEA 3DFGA 3LAJA 1IW7F 2K4JA 3BZ6A 2GQQA 2A61A 1MJBA 2A69F 1SD7A 3H3ZA 2H09A 3R0AA 1Z91A 1SMTA 3SZTA 1TQIA 1BC7C 3KZYA 3QU6A 1WI9A 3L2CA 4S04A 2V1DA 1BBYA 4HW0A 3KETA 2HOEA 5DUKA 4LB5A 2Y75A 2JSCA 5CVRA 4H0EA 5BMZA 1HKTA 3VEPA 3WE2A 3HHGA 3HSEA 1RIOH 1QZYA 3SHFA 2GIVA 4L0YB 3I58A 2IJLA 5BPIA 4AIJA 3GFJA 3DXJF 1ON1A 5D5XB 2Z99A 1LNWA 5CVJA 3T8RA 3GO5A 4BHCA 4HYEA 4ZH4F 5CVUA 3O3KA 3ECHA 3ISPA 4FHTA 1O7LA 1CF7A 3BPVA 2LDUA 3ZMUA 5E8IA 2WWYA 1B6AA 1KQ9A 4HF0A 5EEGA 3ML6A 1HKSA 2FNPA 4RB1A 5L3GA 3E5UA 4YFXF 2E1CA 3HOTA 4PZJA 1P4XA 4F7ZA 2HKOA 3JAMK 3C3WA 5IT9Z 4OIQF 3GZ5A 1T6SA 5E20A 4U0VA 2HYGD 3AAFA 2IA1A 1XDSA 2QYOA 4EJUA 3BWGA 2QZ8A 2P6SA 2XASA 3GF2A 2V9VA 4RAZA 2HKXA 1G6NA 3SZPA 1SD6A 1SFEA 2CGPA 5FB2A 4NQWA 3F8FA 1FSEA 3F6OA 3KE2A 2O6GE 1FYMA 5D5UB 5CYVA 4KMUX 1J59A 4ON0A 3MAJA 3E5QA 1WQ2A 3FMRA 3IRQA 2JZYA 2XKPA 2OA4A 2QBYB 1SD4A 1QPMA 2XAFA 4YIFA 1B59A 3CUQA 2E7XA 4OIOF 4OMYA 4EGZA 2LSOA 4FX0A 1G4DA 5HOOA 2O8XA 1B9MA 1WKMA 3I59B 3WU1B 4EJVA 3HYIA 4PCQA 3K2ZA 3ERED 3V7CA 1ZAOA 4GYGA 4IVNA 1TTYA 2HGCA 1LVAA 3FHZA 1XGMA 3LFKA 3LQRA 1G3WA 3DPLC 3CLOA 1UCRA 2ISZA 1CF7B 1I6XA 2P7VB 2RGVA 5FGMA 2ZMEA 4JQFA 5JFRA 3ECOA 4BXUA 5F64A 3Q5FA 3TDZC 1RI7A 5CJ9A 2NNYA 1KA8A 3KLOA 1XMAA 1XSVA 3WTWC 2MH9A 4R8HA 5LGTA 4L5IA 1S8NA 4I0AA 4S05A 4MQ9F 4A0XA 5IT3A 2EV6A 1ZRFA 4GYIA 2JPBA 2DO7A 1P4AA 2IT0A 1WSUA 1ZHFA 2NNNA 1ZG5A 5HVQC 2VXZA 2GZWA 4IRIA 3LA2A 4KIGA 1KQ0A 1Z6TA 2V1XA 2K4BA 1ZRCA 3J80Z 2KJCA 2A3SA 3QP5A 4LGWA 1LJ9A 4I7HA 1FC3A 3ZMVA 4L5JA 3GZ6A 5FLXK 3KEQA 1F5TA 4CDGA 1S3JA 3WODF 2FBHA 1IAWA 2HS5A 4UXNA 4ESFA 4KN7X 3F3XA 4WXDA 3M8FA 1KGSA 2W24A 1XB4A 2VBYA 2Z3YA 5CLSA 5ICCA 1MKMA 1U6GA 6PAXA 2X4HA 3EDPA 5LGNA 1RZ4A 1J7KA 1Z7UA 3JSOA 3QPHA 3TO7A 3F8MA 4ZZLA 1IN7A 3G3ZA 4GXOA 4OOIA 1R00A 1YQAA 3V7SA 1T2KA 5E17F 2IPQX 3WTYC 3FXRA 4EM0B 2UZKA 4KT5C 2GA2A 2BYVE 2XAHA 3CJNA 5F1RA 2V6CA 2OZUA 5CVVA 4RS8A 4XSXF 1OYIA 4HOBA 1FOKA 1Y0UA 2PJPA 5H6QA 4IHSA 3KP3A 1ZRDA 1CGPA 1ZH5A 2XROA 4L9TA 2BEOA 3KP6A 2ACJA 2PMUA 2QENA 3BDDA 4EGYA 1YG2A 3BY6A 4P55A 3F22A 1R58A 2YX4A 2DW4A 1ZLKA 5LGUA 1STZA 5HLHA 3WTVC 4MGRA 1IXSB 1S6LA 4DQ2A 2ETHA 4LJZF 3P9IA 3HTUA 4D0PA 1YYVA 2EFNA 2BE5F 4U0WA 3E6CC 4HBLA 4L9VA 4CYDA 3S2WA 1W4MA 1S7OA 4A0YA 5L3DA 5KVRA 4YIIA 5A2QZ 5JI6A 1D5VA 3LSTA 4XBFA
chains in the Genus database with same CATH superfamily
2EJRA 2LP0A 1IXCA 4WF2A 3L2RA 4A12A 2OBPA 5F0CA 1F9NA 1FYKA 3SDBA 1MBEA 3ULQB 5H20A 4N9IA 4NNJA 2JA8J 2IS1A 4K2EA 4F3QA 1SVMA 2RC4A 1YITI 5EZHA 1H9TA 2PFBA 1BA5A 4D1QA 2JT1A 2KKOA 3N05A 4Q47A 3T8TA 5TRDA 1GLNA 1SAUA 3ASNH 2FQ4A 1X1BA 1H9GA 2HQNA 3FKIJ 4E7SA 4V2GA 2GOMA 1NH3A 1BR1A 2VC1A 4IHTA 1I3AA 2CFOA 1BL0A 1Y39A 2WAQN 4BQNA 3NAUA 3OYHA 2R0QC 3REOA 2G0EA 3FKJA 4RB0A 1S9HA 4PSWA 1OFCX 1SFXA 1LFPA 3J7AY 1FP1D 2O8KA 2QF7A 2P5KA 4IJAA 1K78A 4E7KA 3S1MJ 2MLKA 4BXFA 2FXAA 5ICGA 3F8BA 1OCCH 3QRFF 3KCCA 1YS7A 3A0HC 3U1DA 4A3JJ 4MEXF 4BY1J 4HLXA 1VFCA 3JCUC 1BIAA 3WGGA 3R60A 5F04A 1DU0A 2M3AA 2Y0MA 2O61A 4CICA 3LWFA 2H1LA 4IPAA 2DCEA 1MDMB 3Q0UA 3MKYB 2EFWA 2HR3A 3MZYA 5JHUA 3W3CA 3CTAA 4ZYDA 4D9JA 2XSJC 2XUBA 2UUZA 2D1VA 4KICA 4QLCU 2KDZA 4A69C 4PGGA 3WU2C 5K5OA 1X1PA 2E19A 3C2GA 2BY1A 2OCEA 5DDGA 5C44J 2ESHA 2FSWA 1IV6A 2E1MC 5DYMA 4Q4ZF 1UG2A 2DT7B 2E1NA 2VPRA 2G7UA 1N75A 4DYQA 1V54H 4MEYF 1V5EA 2RQPA 2XRLA 3I4PA 2QSFX 3K9TA 2GXAA 3GTQJ 5EEHA 3PM1A 1JXSA 2DMUA 4IQJA 5FO5A 2P8TA 3TEDA 1VZ0A 2KJBA 5D6FA 1HKQA 5C3EJ 4GO1A 3K10A 4HX8A 5DCFA 2DXIA 4ZDPA 3CUOA 2MD5A 3GTGJ 2RNGA 3PIOF 3RZOJ 1Y56A 1CQTA 4Q48A 1EH8A 2WV0A 2NVTJ 1A04A 1Q1VA 1OCTC 1VI0A 2IA0A 2DA5A 4B1RA 2K86A 4DBQA 2D2WA 1YW7A 2LKXA 5BQTA 1R6RA 4DYCA 1W0UA 2DMTA 3LFUA 2JSPA 2DOFA 2DLLA 4EJWA 1JTYA 1VQLI 4L5EA 2L7KA 1MBHA 4XRSA 1MMGA 3CZ6A 2Q2EA 2FOKA 1HW2A 3K1PA 3VSKA 1GT0C 3I9V2 2FRHA 2Y2ZA 4I98B 1SFOJ 4WXHA 4W1UA 4Y17A 3CCVI 2P5LC 4CGZA 1BI3A 1FTZA 4A3BJ 4V2FA 3RPQA 5J1RA 1U3EM 1R5GA 2L4MA 2F5CA 1X2MA 2J5OA 3W6JB 2HYFA 2EINH 4P5OA 2Z33A 2VKEA 5KK1A 5FD6A 2LOOA 3OS0A 4Q5SF 1HSTA 5ICFA 4DYRA 1SEUA 4ZC3A 1JGSA 4KN4X 5EDNA 4MNUA 1I3QJ 2QBYA 4BE0A 1AA7A 3C18A 3FXLA 2CUEA 1B72B 3CMEI 4I0BA 3G73A 2E7WA 4UNOA 3RYRA 1A6QA 1XSXA 1BJAA 2V9PA 2L0KA 3I71A 4N4OB 4UVAA 5JLXA 3J81K 2M7BA 2R7WA 2LKPA 4HX7A 2BXYA 1ZR4A 1LEAA 5CKTA 1K78B 2DFEA 3I59A 2NS0A 1QQIA 2PMZN 3HL2A 2BGCA 1XC5A 1T98A 2K40A 2NOGA 1DPRA 2ZB9A 1WJFA 5D8KB 2QSGX 3BR2A 3OV8A 2E1MB 2DPDA 2XGCA 2ZNYA 4B4CA 3RQIA 4TV7A 4HG2A 1I50J 4DIQA 2IGNA 3QYFA 4HRIA 1KU9A 3AKZA 1BI1A 3WTTC 2M8EA 3OYFA 1ZELA 2V1UA 2M4GA 2M4KA 1H89C 1UZCA 2FQ3A 5DV5A 2QSHX 1NG7A 5E1WA 1O3RA 5L3CA 2HQAA 2FNAA 1J75A 4MQVA 3VOEA 1XS9A 1S5LC 3VYTB 1XX5A 1QZEA 4P9FA 2A07F 2OQRA 3GLXA 4U0YA 3T0YA 5J8FA 1G59A 2H6CA 2NS7A 2VQHA 2X6YA 2K7LA 4ITVA 1WFXA 2LR8A 2WAEA 3K1NA 1D8JA 3SYTA 1WJBA 3NRVA 3FM3A 4IOCF 2H27A 1POGA 3OR1C 1O3TA 4KUMA 5L3BA 4XKWA 2M0CA 2ZXWH 1FLIA 2XDVA 3C1DA 2PX9A 2E1OA 3TP0A 2LF8A 3OYBA 4AIHA 3PL8A 1TQMA 1O3QA 2O3FA 3OIPA 2OU2A 5D5WB 3TQNA 3CJTB 1PUEE 4A3CJ 2VKHA 4UVCA 4IHVA 2NVQJ 3K4LA 1IRXA 4M3DA 3RKWA 3BTJA 2KRCA 2VC0A 1ZLJA 3VB2A 3I4NJ 3H0GJ 3L00A 4N4NB 2WAFA 4KT6A 2ME0A 2XAJA 4NDLA 4YFNF 2W84A 4JYKA 2B7EA 3K1MA 4R1HA 1FSHA 1IUFA 1V4RA 3C2HA 2XIGA 2Q1ZB 2RVCA 1QNTA 3S8PA 4I2OA 2DYSH 2R7XA 2MC3A 3KFWX 2CG4A 3GEZA 1T0FA 1ORKA 3H35A 3CCRI 1X1DA 5J3LA 4RGUA 1HOMA 3F21A 3SQNA 1TW2A 4NBQA 4ESBA 3FBNB 3OY9A 2MBFA 4CSWA 2EB7A 1F43A 4HPQA 3DLLF 2EZIA 3A1YA 3NEUA 5BNGA 1RPWA 3F6VA 4XN3A 2QA4I 1T38A 2LK2A 1FYLA 3ZMTA 2R3SA 2VJIA 1OR7A 4QTRA 4MTDA 1VQ4I 1T0FC 3Q0WA 2CUZA 3HEFA 3HM5A 3QOEA 3ZQFA 3ZPLA 4GGGA 1YW9A 2IW5A 2MLGA 3FK6A 4II3A 2HXOA 2PEXA 4RGSA 4BXXJ 4LIVA 5E8GA 3RCOA 3X2QH 4G7ZF 4B09A 4A6EA 3OS1A 1FIAA 4RM2A 1K7AA 2FJ1A 5J6XA 5IP9J 1IRFA 1E3HA 2QQAA 1DP7P 5KCMA 3GZNB 4IXAA 5LFAA 3CCJI 3FBIB 3A2KA 2LVSA 4NHJA 2KPMA 1J0RA 2ZSHB 4PK4A 2XF5A 1AU7A 2IXSA 3F23A 2X1DA 3R0JA 1RRJA 1E2XA 3LQQA 1TC3C 3G2BA 1I1SA 3TO9A 2XSDC 3SFZA 4A2UA 3DLAA 4G7OF 3WTXC 3KP4A 4A3FJ 3FMSA 2MSYA 5BOXA 2EK5A 2F48A 1O57A 3EYIA 4OU0A 3IL2A 4F93B 5DS9A 2Z2SB 4LMYA 5AIPA 1XPXA 3A03A 2PJRA 1XMXA 4HSTA 1ETVA 3AG3H 4G6TB 3PNYA 4BS9A 2CV1A 3DTIA 3FK7A 4UVBA 4E7LA 2W25A 2X6OA 1O3SA 2DFHA 3W2WA 1X19A 2KL4A 4M3GA 2I5UA 3E3VA 2KIQA 1PVEA 2JK3A 3IHUA 3D0SA 3K70C 2ZJQF 2EH3A 2WY7Q 5H6RA 2HVRA 1XCVA 2VBWA 4P1WA 4HF1A 1USTA 4AYBA 4KA4A 1YJ9I 5C4JJ 4D7NA 2D1HA 2BVMA 2ECBA 3V8JA 4F52A 4XN0A 2XPUA 1MSEC 2BY2A 5DD8A 1EV7A 5GTIC 1Y1VJ 1V3FA 2FEZA 1REPC 2QQ9A 2HNHA 4A3LJ 5LHHA 3MKWB 2X1CA 3HRSA 2OV7A 1FZPB 3H3VK 1UB9A 1TNTA 3TKYA 3B02A 4BU2A 3DEWA 1FMVA 3CMMA 4UB6C 4XR6A 5JLWA 1T56A 2PBIA 4XK4A 3WGHA 4FCYA 4M73A 1LDJA 5E3OA 2R5YB 2FBIA 3Q9VA 2JRTA 5E79C 3HSFA 3ZGKA 1AOYA 3ZOBA 4Y13A 1WZ2A 2VI6A 3R61A 2HI3A 3SDGA 3E6DA 4XONA 4P96A 4HDVA 2H6BA 2M87A 4BHPA 2F2EA 3S32A 1ULYA 4BE2A 3CD6I 3RKXA 5FLVA 2VOOA 1JHFA 3WE3A 1QZZA 3QYBA 3GTMJ 1BI2A 2DMPA 1GVJA 4EMSA 2VT2A 2YX7A 2QEXI 2VE9A 3ASOH 3M3YJ 3GYHX 2RQQA 3QOPA 2VASA 1HXDA 3PNTA 5ILUA 1A35A 3N4MA 2L9VA 2W48A 1MBKA 3G1MA 3VFZA 3IRRA 4I6ZA 4I76A 2OCCH 3SZGA 2CMPA 1SD5A 4KIBA 1W5SA 3BCBA 2L5QA 1VQMI 3GBGA 1W0TA 5HS8A 2CSOA 2RREA 4WWCA 2R7ZJ 1JKRC 2CV0A 1I5ZA 1FX7A 5CPRB 3HOZJ 4HQMA 2UWMA 3EUAA 3MD2A 3RSNA 1KU7A 4RAYA 2RKHA 3IAS2 4A3MJ 3CCYA 4ENKA 1FT9A 1FY7A 1OLTA 2HU9A 2DA3A 3QAHA 1IZ1A 2RDPA 1SAXA 1PP8F 2RN7A 3M7GA 4RBOA 3EQLF 3VDXA 4CCOA 2ZJ2A 3RKQA 4OIPF 2L02A 1JJ6C 3DV8A 4W97A 3VODA 2EZHA 3ZCOA 1QVTA 1T39A 1W36D 1F4KA 2VE8A 3V8LA 2MG4A 2PJRB 4LG3A 4KISA 2DT5A 2LBFA 1P6RA 4EM1A 3QP6A 4PSXA 4C3IJ 2W82A 2VODA 1YE9A 2WC2A 1B8IB 4O3MA 5ED4A 1D1CA 4IX7A 4ZDLA 4GDFA 3BG6A 5LBQA 4IHWA 3GTOJ 1JHHA 2F4MB 4MIMA 3NWSA 3O2PE 5D4SA 1W7PB 4XLHA 5IOZA 3PUFA 1OCOH 4M3EA 2DA2A 4D5FA 3JRBA 1ZREA 4LFUA 3GMEA 3HRTA 3I64A 3FX3A 1FPQA 1MMSA 2GAUA 3TW6A 2QQ8A 2JTVA 1XN7A 1PDNC 9ANTA 5LLQA 2F5VA 1MDMA 1U5TA 3RQ4A 2NVXJ 1I6HJ 4EV0A 3JRIA 3H5NA 3PO2J 4F55A 3ROUA 3K2AA 4Y52J 2H8WA 2CWEA 3L09A 4UV9A 2OD5A 5IT9K 1MMAA 1XMKA 5D6EA 3IUOA 3I53A 3P9CA 3A02A 3OIQA 1I27A 3LSRA 1LB2A 4B44A 2X0LA 4ZYGA 1TBXA 3DU6A 1YW8A 3M8EA 2PI0A 3AG1H 4OMZA 1U78A 1F36A 2VLAA 1NK2P 4ZZDA 2GA1A 2ZSIB 4KNYA 1U5TC 5FFXA 5EG0A 4B47A 1RESA 2BHYA 3M07A 2ELKA 2V26A 1J9IA 3K4BA 4XIDA 1PYVA 1D1BA 2G7HA 2W4SA 3JTHA 4CA0A 2R93J 1JUMA 1T33A 2VJ5A 1U0JA 4YRVA 4G9YA 1GHCA 4GCVA 1K79A 4HQEA 1ZR2A 2DOAA 4JX4A 4HF2A 1ZYRF 2JUCA 2X6WA 2Q0OA 3CLQA 4KJZA 3RYPA 2KDOA 1NK3P 3J7ZI 1VQ5I 5E1XA 1ZARA 4BE1A 2UXXA 1FOXA 3OIOA 3JAMZ 1PP7U 1J2XA 3DTEA 2XHKA 2CJJA 4QPQA 3OYNA 1KYZA 5HLTA 1WJEA 4G12A 2C6YA 2HVQA 1A5JA 2JWTA 2AS5F 1VQ6I 1RR7A 4XM3A 2R7VA 1FOWA 4HDUA 2JUGA 3BTIA 4AYBN 1P7IA 3CDIA 3GXOA 5D4RA 1Z05A 4BUPA 3WHBA 1Q1HA 2DPUA 2NRAC 1TWHJ 2DMNA 2QVOA 1HW5A 2XAGA 2JRMA 2ID3A 3BJOA 3LMMA 5IYDJ 1FBQA 4UV8A 2W7NA 2EZKA 3K4JA 2MA3A 2AXTC 1ON2A 3H3UA 2V7FA 3S3OA 3QU3A 4X1EA 1Z9CA 1UHMA 3KYLA 4NC8A 2L9NA 1S7EA 2O7OA 3TGNA 3ZMZA 4BHBA 2OZ6A 2HPIA 2XPVA 3TO6A 4AU7A 2YUSA 2EA2A 2RV8A 2XVCA 2K02A 1TL8A 4C3HJ 4M72A 2H94A 1FBUA 1FBSA 1P92A 1TW3A 1ETKA 4U87A 2EV5A 4PJ0C 3DWLE 3B73A 2LBFB 5TGTA 3ZQ7A 4BL0B 5DCMA 3COAC 2ELJA 1R36A 4BQAA 3FDYA 3H9GA 3A01B 1B72A 2PQ8A 2TCTA 2DQLA 2CFXA 3PQJA 5HS9A 1IG7A 3CMYA 5B5EC 1OISA 4CHUA 4XNFA 1MH4A 3WU0A 3H5AA 1IRGA 3K4MA 3U2RA 2E71A 3UR3C 1GXPA 2GIZA 2KIFA 4NC7A 1Z3XA 3ZQLA 2EIKH 5GADJ 3IV5A 2VQLA 3BP8A 1R22A 1DUXC 1QPIA 3BJAA 2LD5A 2Y0SN 1X1AA 2ZBKA 1ZGJA 3JRAA 2DK8A 2L3DA 2IEKA 4JX6A 2L4AA 1FOYA 1U5TB 2AXLA 3ZQQA 1Z21A 3MZHA 4ASNA 4XL9A 1Y8RB 2O0YA 3MWMA 1HQCA 3DKWA 4CYCA 3DPUA 5LD2C 3G1LA 5IYCJ 1C0WA 4ENMA 4L9JA 1HSJA 3I0TA 5FD5A 2LY9A 1JJ8C 4G8XA 1IN4A 3IC7A 1H0MA 1HW1A 1YIOA 2Z16A 1KU3A 3ZMDA 4NB5A 4I09A 3ZN0A 1OYWA 4EATA 4PJJA 3L1PA 3I5UA 5EG0B 3BZCA 3IKVA 5E1ZB 5E18F 2EFOA 2NYXA 3O8GA 2DQRA 4PFPA 3F8CA 2ZKZA 1U9OA 2V79A 1WWXA 1X3UA 2M30A 2MABA 4FE4A 2YR2A 4AM3A 3VYRB 1IN8A 5L3EA 4QWQA 1I39A 4EM2A 1YIJI 5DEQA 1ZN2A 5L3FA 3JTGA 4Y33A 5JVTA 2R7RA 1R5HA 2L54A 3K0LA 5J40A 3U1KA 4PGHA 2FOWA 5F6FA 1HDPA 3WTZA 3OOUA 3FXUA 3RIRA 3J80K 4WX9A 3BROA 2VL8A 1WCMJ 1SVOA 3ZP5A 2QQBA 1W5TA 2VKVA 4RGRA 3HB9A 2VJ4A 2ESNA 2ELHA 3EYYA 1R1TA 3DPTA 4BEHB 4JOMA 1NHAA 3TDUC 2VN2A 2P0WA 1TT5B 2XKOA 1KQ8A 2STTA 4RB3C 1U2WA 3J7YJ 1LUJB 3ELKA 1ODDA 4I99C 2E2HJ 4IL6C 3VYSB 2AQFA 2WTEA 1LDDA 4N0BA 4E70A 5CQEA 2ZCWA 3E0JB 3F8NA 3OYKA 3AG2H 3HZJA 4OAZA 4XICA 3M9AA 1XG1A 3OOPA 2DAOA 4LG0A 2FMYA 3HRMA 1F1ZA 3DQVC 2HPMA 5DCMB 2KRFA 3IP4B 1Z7LA 1ZG3A 3FISA 1TQPA 3MZ8A 5HS7A 1MNMC 2QUFA 3RDIA 3FMQA 4U7BA 4X6AJ 3HTSB 4IRGA 5DM7F 1GUUA 3BG7A 1RUOA 4LD5A 5FLXZ 2XGXA 4XLEA 3CCUI 2LMDA 4LLNA 1BR2A 2IGOA 2NVYJ 1WRJA 2W85A 3BJ6A 5ILSA 5C4XJ 4XRFA 2X51A 2DFFA 3TOAA 4M71A 3IWFA 5FKMA 2DA7A 1FTTA 4M6XA 2HTJA 5HLGA 1D8KA 3Q9SA 3KEYA 3OYAA 2NVUB 2DJIA 1MGTA 1FP2A 1XDUA 4FT8A 1TP4A 2Y69H 2ZNZA 1G3SA 3EUKL 4CYCB 3QYEA 1OQYA 1K4TA 4IHXA 2LF7A 1YO5C 4U88A 2L7FP 1KYWA 3GW2A 1MNDA 2EPFA 2YU3A 3JRHA 4LB6B 1X3ZB 3HJEA 3N97A 2XV4S 5HODA 2BBYA 3L9FA 2XAUA 4YEJA 2M5WA 5LRSA 2NXNB 4AD9A 4QSHA 3QPTA 2EIMH 4CZZA 1K61A 3W6VA 1JKPC 1HBXG 1IDZA 2J5PA 3V7RA 2VBXA 1RR8C 2A05A 3HUGB 4WXCA 4BJ6C 3DU5A 2OUMA 2MH2A 4LLLA 5M3FJ 4C2UA 1OKRA 4P9UA 2MD0A 3RJPA 4IHYA 1BM9A 2R92J 3BCAA 4L9NA 3GTKJ 1FNNA 4Y7NJ 3EETA 2PLYA 3DKXA 3LA7A 4PDKA 4M9XA 4M9SA 4UUSB 3QPSA 3H92A 3DEUA 1VF9A 2FX0A 3GWZA 5K7FA 2QLZA 2WA0A 4DJAA 1EJ9A 4HZFA 3ZMSA 4N9HA 5LHIA 2GXGA 1MMDA 4BJ5C 4Y15A 4WK8F 2IVMA 4UY8I 4HV5A 3P7NA 2KZVA 2OF7A 4BY7J 3HPHA 4NUBA 2HZTA 3BR0A 4XOTA 5CVIA 4A3KJ 4JX5A 3D1NI 5F27A 4IQ4A 1Z67A 4L18B 2UXNA 2CU7A 4C2MJ 3IAM2 1TLHB 1W1WE 2JMWA 2R5YA 3V4GA 3ABUA 1RC9A 2K3PA 1RKWA 4MHGA 4IF4A 3LSHA 2OAZA 3KP5A 3CO7C 3KX2A 1BN5A 3T5XA 1MJ9A 4ENNA 4M74A 2VQGA 2CQKA 1X3WB 1IV8A 1FWZA 1UFMA 1WPKA 4ETSA 5A2QK 4HX4A 4L0ZB 4XMYA 2VT3A 3HKZA 1IDYA 2LG4A 4G6QA 2JA5J 4NC6A 4U7DA 4HV6A 2M1BA 2JA6J 1BI0A 1R7JA 2D45A 3GVAA 1JUPA 1DGRM 4LG0B 3KIOA 3FXQA 3ABTA 2A5WA 5BPDA 5LEKA 1R71A 1UJ8A 2CUFA 2LFBA 2YS9A 4LK1F 1Y0NA 1ERDA 4OIRF 1QU3A 4R79A 1BR4A 5J1UA 1I1GA 2DDBA 3MFKA 1MSFC 4C2TA 4AVPA 3R4KA 3CF5F 2WB1A 3T1BA 5HDNA 3KEOA 4DGWB 5KAIC 3TMOA 1UG0A 5DD4A 4BAYA 1YRNB 2NOJB 2EILH 1LE8A 3PJRA 1JKOC 1N77A 5F0FA 1SFUA 4CZCA 3RTRA 5D8LB 4QPOA 3P9KA 3WGIA 4B3XA 1UELB 1IJWC 3BR3A 3ONQA 2Q8KA 1MBJA 1MZBA 1ACIA 5LRRA 3S3NA 2LLKA 2LTPA 3NQOA 5ERIA 3QODA 3E97A 3FHNA 3IH4A 3D5LA 1O4XA 1J5YA 1VQ8I 1FMWA 3E6BA 5DM6F 3OL3A 5D5VB 3B6AA 1YS6A 3CUQC 2Y31A 5B1BH 1R1UA 1B8IA 3JRDA 2YSRA 3DBRB 2HEOA 5BS6A 3OL4A 4BGDA 4FETA 3HHHA 2CQNA 3HGGA 2DU9A 3TP3A 3JRGA 1W7PA 2CO5A 1ZGWA 4BQQA 5M3MJ 2EFQA 2W57A 4XRSG 2HWVA 2HYJA 2K3FA 2XPWA 4EVIA 2QGUA 2QWWA 4XKCA 5ILVA 1ZG1A 3FZVA 3MEXA 4AWXB 5J4VA 1Z1DA 3IH2A 3IWZA 5J47A 5J8CA 5GAHJ 2VIXA 1G3YA 3E6MA 1OMIA 2O03A 1EH7A 3FXKA 3S2DJ 3QQAA 4RGXA 2DTRA 3U21A 1WJDA 5LHGA 1XGOA 4IRHA 4LK0F 2VPLA 1QBJA 2IS2A 1XGSA 2VONA 3OWTA 2K27A 1QVUA 5K5QA 1S29A 1BIBA 3CCSI 2Z9OA 4PJLA 1XD7A 2FBKA 3CJRB 1L0OC 2XGDA 1U9NA 2KIMA 2A5YB 2GLOA 2ZMEC 3CP8A 3ZQGA 4I02A 2MFZA 1U8RA 1X1CA 2X9DA 1JTXA 2B9SA 1ZTRA 2TDXA 5K1YA 3O6BB 2XF6A 3CMAI 1J09A 3JR9A 4XKBA 3SXYA 2IS6A 2DT6A 3F0CA 4EJTA 2DI3A 3BC8A 2HOSA 1W5CC 1MH3A 4CUGA 1LFBA 1YJWI 3BOQA 5DUIA 4UHTA 4II2A 2COMA 5HNHA 2HOTA 3CC2I 4IZZA 1IUYA 2AQEA 2IS4A 4OWRB 2B0LA 5KNLA 3HGYA 1OPCA 3I55I 2A68F 2V6EA 1EA3A 2RAEA 1LDKB 5EGOA 4GFBA 3CQZJ 3B6CA 2WAQA 3GCMA 3CCMI 1GXQA 3I54A 4ESJA 3BQZA 4RB2C 1T08B 3G1OA 3MKZA 3DP7A 1MNEA 1TT0A 2K85A 1K6OA 1M1EB 3U9GA 1WH7A 2IA2A 2JQ7A 4ZYAA 3DBLB 3TW7A 2FU4A 2JPCA 4WCGA 4KFCA 1DDNA 2MYSA 3VPRA 2MC4A 4XORA 2L7ZA 4Y4RA 5B1AH 3K69A 4AC0A 4M3BA 3BG9A 2JA7J 1LE8B 2R7FA 3L2QA 1A6IA 3CUQB 2KIUA 3HOSA 1YJNI 2OTLI 1RNLA 3CJQB 4ZTJA 1X4PA 3CO6C 2CYYA 1QA6A 3OSGA 1K83J 2DA4A 2HDCA 3LSGA 2R7TA 4J19A 2DJNA 3WTSC 1P4WA 3KYCB 3CESA 4D5CA 1Z3YA 1O7FA 3BPXA 3DTKA 2CQQA 3HRUA 4DZPA 3DEEA 2FA5A 3V8KA 3LSPA 1BOAA 1ONVA 2ZJRF 3A0BC 3L7WA 1T8IA 2CV2A 1TZLA 1WGXA 4FASD 1V5FA 3WG7H 1QRYA 4KIFA 2WADA 4UB8C 2LH9A 1LQ1A 1VQKI 3ZR8X 3A01A 1EH6A 3OR2C 4BYYA 5AONA 2YPRA 2RNJA 3JW4A 5HDGA 1V5GA 1PUFA 3HC7A 4PFOA 3ZN1A 1T95A 3HIFA 1BOBA 2P4WA 1IN6A 2PN6A 3D5SC 4YG2F 2HFHA 4FX4A 1YTYA 2ID6A 1KU2A 1SC7A 4HNVA 1MMNA 2ZXHA 2EFPA 3J81Z 1XSDA 3M8JA 2G9WA 4AIKA 2FMLA 4KITB 4A5MA 4I01A 2VQCA 4OINF 2OC6A 2O5RA 1H88C 2YU9J 1R1VA 3J7AO 1G3TA 1R5ID 1SFKA 3PNVA 5JR3A 4J00A 4JBAA 1JE8A 2KHMA 2LNBA 2JVHA 2XRNA 2ZMEB 3K4NA 3H36A 2OJED 2ADUA 4HSRA 4A5NA 2HTSA 3GFMA 5HDKA 1E17A 3CDHA 1IXRC 4F92B 4BDZA 2CW0F 3MMYB 1XCBA 2DK5A 1TWFJ 1A36A 3KPHA 2PMHA 1K6YA 4BACA 4A0ZA 2Y48A 1VTNC 1LPQA 1R9TJ 2TRTA 2F5DA 2X48A 4DNCA 3WTUC 4DW6A 1OYYA 3GX4X 1OCPA 3BQYA 1R4NB 2L9SA 3W2AA 4JK1X 1ZGAA 3O8HA 3BG5A 3GUDA 2XB0X 2BW3B 3OS2A 3JSPA 4EJOA 4E7JA 5TJJA 4G7HF 3S14J 2ZFUA 4KMFA 1USSA 2MW8A 2P5VA 3K7AJ 3MQ0A 5IYBJ 5ICEA 1VQPI 1SMYF 1JT0A 2ZC2A 3QPLA 1D0ZA 2KISA 2M45A 4CCLA 2H1KA 3HOWJ 3KP2A 3M1EA 2NAZA 4HAMA 1VQ7I 2DMQA 2DTZA 2GXBA 5EGOB 4PJMA 5KHDA 4CXFA 4HNUA 2P7CB 3DCFA 2XC7A 1RUNA 1YX3A 3LA3A 5EZGA 1TNSA 2CW8A 3FF5A 1Y1WJ 2ZXJA 1IN5A 2R7DA 4H4KC 1XTAA 3GFIA 4BEHA 4KYWA 1DU6A 3OYDA 2H8RA 1DGWY 1QO0D 5FFZA 4IKFA 5LEJA 1P9QC 2R5ZA 1B4AA 4C3JJ 5M5WJ 2A6HF 3AG4H 4CO8A 1UHWA 1V55H 1WI3A 3G6EI 4M6VA 4B43A 4ANJA 3KYDB 2DA6A 4G6DA 1YLFA 4ZYHA 3E5XA 1LKXA 1GV5A 5FRNA 4M9ZA 3S15J 4EQQA 1TWAJ 1WVRA 1MJAA 3E1SA 3OYIA 3MVPA 4O6JA 3S1NJ 3HOUJ 2XB5A 5CQGA 3FM5A 1UMQA 1AHDP 4A3GJ 3FWEA 4LLGF 4A3EJ 2HXIA 3R6SA 3FXOA 1MBFA 5AIQA 3BT9A 1YFHA 1PUFB 1YI2I 4M6YA 1R23A 1ZQ3P 5K5RA 2F5FA 5K7HA 4G94A 1D5YA 2L9RA 2KZGA 3ZQIA 4XSZF 3OYLA 2ZFWA 1RKTA 2IRFG 3VSLA 4BH9A 4MTEA 2XAQA 4RMNA 2IAIA 4XLNF 3UKGA 1S72I 5GP9A 2GWRA 2KT0A 3WG9A 2P6TA 4B8XA 3JRFA 1EKEA 1Z6RA 2M8GX 2EWNA 1MD0A 2CW7A 2STWA 3HBLA 2F5EA 3LAPA 5IP6A 1B1BA 2ZO4A 3IKTA 4PJNA 2GOXB 3HSRA 1BW5A 4UUVA 3KLNA 2Z5UA 2EV0A 5IOYA 3CCLI 2DBBA 2EA4A 3H5RA 2B63J 4M3FA 3K70D 1EF4A 2BY3A 2IP2A 2LC2A 2HQRA 3HUGA 3KP7A 1ETQA 2E5NA 3V42A 3D5RC 1S7AA 1D3YA 2ISYA 3PQKA 4KDPA 4S0HB 4CH7A 3PFIA 1LEBA 1MW7A 1W7PD 3ZQHA 2OQGA 5E3MA 3RI4A 1X2NA 2IGMA 2KRHA 3W6KB 1XGNA 2BVLA 4ENJA 2HVSA 2VOPA 2F4OB 1GDTA 3OSFA 2PG4A 4YFKF 2WBMA 5EF6A 4UUSA 4E7HA 5GPCA 5HNFA 1B9NA 2A6EF 5HLIA 3TOBA 2K9MA 2UV1A 3LSJA 1DPUA 1APLC 1L3LA 3MCZA 3F72A 4MFEA 4HA8A 4O5VA 1GV2A 4RLFA 2EBIA 4XLFA 3GFLA 4BNCA 1IF1A 2FF4A 4ZJZA 1YOVB 2BV6A 1AWCA 1NTCA 1QGPA 1P2FA 3RPUA 1BC8C 2QM3A 2VBZA 3DBHB 2FE3A 5GPAA 3DF8A 3C7JA 4A6DA 2P81A 3L2VA 2F6CA 2K9QA 3KZZA 3P5JA 2EIJH 3NWTA 4HLYA 4E6KG 3RKYA 1A31A 2DFIA 2L2OA 2L01A 2QKMB 4Z2YA 4XLPF 4F91B 3EUHA 3SJMA 4ZYEA 3DFGA 2R5ZB 4J01A 1ZKGA 1YX5A 1PJRA 3AFHA 3LSMA 5B66C 2HZDA 2Y9YA 4Z6YA 5FLMJ 3LAJA 1IW7F 1N25A 2K4JA 3A4CA 3I3LA 3BZ6A 4CCMA 3CDLA 3UNGC 1NG6A 2GQQA 2BXZA 2A61A 1K4SA 3EUHC 2W00A 4XQFA 1JI8A 1MJBA 2A69F 4RAGA 1SD7A 4B3AA 3M4OJ 2H09A 3H3ZA 3R0AA 2M2EA 1SANA 3G4SI 2E2JJ 1Z91A 1SMTA 3SZTA 3PFYA 1TQIA 1BC7C 3KZYA 4B48A 3QU6A 1WI9A 3L2CA 2M0MA 4S04A 3JREA 2V1DA 1BBYA 2E5ZA 3KZIC 4HW0A 3KETA 2HOEA 5DUKA 3ESWB 5FKLA 1ENHA 5K7ZA 4FISA 1YRNA 4LB5A 5J4YA 5M5XJ 2ZJPF 2MGQA 3K4CA 2IGKA 2Y75A 2JSCA 5CVRA 2R4GA 5F1JA 2FUG2 4H0EA 1W36C 5BMZA 1HKTA 2COBA 1FJLA 3VEPA 3WE2A 3HHGA 3PSFA 3FIWA 3ZQCA 3HSEA 1RIOH 1QZYA 4RA2A 1GVDA 3SHFA 2XGEA 2GIVA 1WJAA 4L0YB 1UAAA 3I58A 2IJLA 2Z1DA 4MO7A 5BPIA 3S2HJ 2JN6A 4AIJA 3GFJA 3CCEI 3DXJF 4LITA 2L7MP 1WHUA 1ON1A 5D5XB 2Z99A 1LNWA 2ICWG 5M5YJ 1ZK8A 3ABMH 4CCNA 5CVJA 4E7IA 3EPZA 3RZDJ 1G2HA 3T8RA 3HOXJ 3GO5A 4BHCA 5E3LA 2CQXA 4HYEA 4ZH4F 5CVUA 3O3KA 3H0DA 2M34A 3S3MA 2KFDA 2DDAA 3ECHA 3ISPA 1FIPA 2W1OA 1IO2A 4FHTA 3HOVJ 1O7LA 4BBRJ 1CF7A 3BPVA 2LDUA 3ZMUA 5E8IA 1N78A 2DN0A 2WWYA 1B6AA 1KQ9A 2VKDA 2OPTA 4HF0A 3BZKA 4MLOA 3ML6A 5EEGA 1HKSA 2DA1A 2FNPA 4CCJA 5GAEJ 4RB1A 4HNTA 5L3GA 3BR6A 3E5UA 5F08A 4YFXF 2E1CA 5JHFA 3HOTA 3K4KA 4PZJA 1P4XA 3CCQI 4F7ZA 2HKOA 5IP7J 1HF0A 4IEJA 3JAMK 3C3WA 5IT9Z 4OIQF 3GZ5A 1JUSA 1QHHD 2K9SA 1T6SA 4IO9F 5E20A 3SEQA 4YIRX 3OYGA 4U0VA 2HYGD 3AAFA 2IA1A 1XDSA 1BJZA 3Q0VA 4XLCA 3ZRGA 1Z0XA 1IRZA 2QYOA 4BQOA 3PSIA 3S16J 4EJUA 3BWGA 2AHQA 2QZ8A 2P6SA 4A93J 2CQ7A 2XF7A 3MN2A 2DODA 2XASA 3GF2A 3AL0C 2Q2EB 2V9VA 1KONA 4RAFA 2HDDA 4RAZA 2HKXA 1G6NA 4LIUA 3GLLA 1SD6A 3SZPA 2O9LA 1SFEA 1UHSA 4OAYA 2CGPA 2KMUA 5FB2A 1YHQI 1TWCJ 1Y6IA 4NQWA 3PO3J 3G71I 3F8FA 3HG9A 1FSEA 4HEA2 3F6OA 3KE2A 2O6GE 2LY1A 4DZJA 1FYMA 5D5UB 5CYVA 4KMUX 1J59A 4ON0A 4PUSA 3MAJA 1RETA 5IY5H 3E5QA 4FE7A 3GTPJ 1WQ2A 3FMRA 2BY0A 2DYRH 3IRQA 2JZYA 2XKPA 2OA4A 5H2FC 2QBYB 1SD4A 1ETOA 3M1CA 1QPMA 1E0EA 3SFIA 3Q3SA 4AVZA 2V1NA 2XAFA 1OCZH 4YIFA 1B59A 3ABLH 3ERMA 3CUQA 3LSKA 2E7XA 4OIOF 3TBIA 3HOYJ 4OMYA 4EGZA 2AO9A 3H9QA 2LSOA 4FX0A 1G4DA 2QCOA 1WJ5A 2O8XA 5HOOA 3PIPF 1OR7C 1SVLA 3CC7I 1B9MA 1WKMA 4EEFG 2IBDA 1AKHA 1D0YA 3I59B 4E7ZA 3WU1B 3LOCA 4EJVA 2Y30A 3HYIA 4XKVA 4PCQA 2E35A 3NARA 3CF2A 2BOLA 3K2ZA 1DP3A 3ERED 2DOEA 3V7CA 1ZAOA 5FRMA 2EZLA 4GYGA 4IVNA 3LSIA 1TTYA 3S1RJ 2HGCA 1LVAA 2F4IA 1HA8A 3FHZA 1XGMA 4FTHA 2R7OA 2ZXIA 3LFKA 2X6XA 3LQRA 1BW6A 4CCKA 1R4MB 1G3WA 3DPLC 3CLOA 1UCRA 2NS8A 2ISZA 1CF7B 4BKXA 1I6XA 2P7VB 3W2VA 4XOPA 3H1CA 4LOCA 4E4HA 2RGVA 5FGMA 4RDUA 2D5VA 2ZMEA 4JQFA 5JFRA 3ECOA 4BXUA 2JVGA 5F64A 3Q5FA 3TDZC 1IGNA 1RI7A 5CJ9A 4ABZA 3GTJJ 2NNYA 1KA8A 4QIWN 3KLOA 1XMAA 1XSVA 3WTWC 2MH9A 1VQ9I 2ECCA 2WY8Q 4R8HA 5GAGJ 5LGTA 3AL0B 1OCRH 5FKOA 4L5IA 1S8NA 4I0AA 4S05A 1FEXA 4MQ9F 5E3NA 1TWGJ 3VYUB 4A0XA 2LREA 5IT3A 2EV6A 1ZRFA 4GYIA 1HDDC 2HDWA 2JPBA 2DO7A 5IPAA 4BJTA 2E36A 2BW3A 2WV1A 1P4AA 2IT0A 1WSUA 3FXMA 3S1QJ 1ZHFA 3BG3A 3C2BA 3CC4I 2NNNA 2V9KA 1ZG5A 2R7UA 2FD5A 5HVQC 2VXZA 4NQWB 4Y3OA 2GZWA 4IRIA 3LA2A 4KIGA 2LRDA 3K6GA 5KAFC 2M9HA 1KQ0A 1Z6TA 2EQRA 2K4BA 2V1XA 1ZRCA 1P7JA 1ITYA 3J80Z 2X85A 3BLYA 1HCRA 2E60A 2KJCA 4ZDOA 5JVGF 4XLAA 4ZTFA 1R49A 2A3SA 3QP5A 5J1YA 4LGWA 1LJ9A 1E3PA 2QKLB 2K9NA 3RPUD 3CP2A 2HOAA 3S17J 3LL7A 2LYCA 4XRMA 3HPGA 4I7HA 1JGGA 5FKKA 1FC3A 1OJLA 4YELA 5FJ8J 2Y0SA 4X0GA 1G8XA 3ZMVA 2GBYA 4L5JA 3GZ6A 5FLXK 3KEQA 1F5TA 4AUXA 2A6TA 4BBSJ 3ZXSA 4CDGA 3OYEA 1QHGA 1S3JA 3WODF 2FBHA 1U8BA 3OYJA 1IAWA 2HS5A 4UXNA 1VQOI 1AKHB 5FROA 4ESFA 1D1AA 1KZHA 4KN7X 2K5CA 2CUJA 3F3XA 3PUBA 3TL4X 4WXDA 3M8FA 1KGSA 2VJJA 2W24A 1XB4A 2VBYA 2Z3YA 5CLSA 5ICCA 2V4JC 3DKYA 1MKMA 3QWLA 3L2WA 1HLVA 1U6GA 3HKZN 3F9KA 6PAXA 2X4HA 3EDPA 3BR5A 4IOAF 5LGNA 2VUMJ 3OMYA 3IH3A 4JP0A 4RLQA 3BR1A 1RZ4A 1J7KA 4A3IJ 1WJCA 1Z7UA 3JSOA 3QPHA 3TO7A 2VXDA 3F8MA 2LY2A 4ZZLA 1IN7A 3WHCA 3G3ZA 5GTHC 4GXOA 4OOIA 4AIDA 4RM3A 2JA2A 4C9YA 3VWBA 1R00A 1YQAA 2R7QA 3V7SA 1T2KA 2I10A 5E17F 2R7SA 3OYMA 2IPQX 1VQNI 5FKNA 3WTYC 3FXRA 4EM0B 2UZKA 2CRGA 4KT5C 2GA2A 4A3DJ 2BYVE 2XAHA 3CJNA 5F1RA 5DTDA 3OYCA 3ABKH 5TISC 2WB1N 2E34A 1DQUA 2BHZA 2V6CA 4C30A 2OZUA 5CVVA 2JJ7A 5EYRA 2HQ5A 4RS8A 2I8DA 4XSXF 3L2UA 1OYIA 2E2IJ 5EJCA 4HOBA 2LKSA 2X1EA 3I56I 1FOKA 1Y0UA 2PJPA 1ETXA 1JT6A 5H6QA 4IHSA 3KP3A 1ZRDA 2N8GA 1CGPA 1ZH5A 4MFDA 2XROA 4L9TA 2BEOA 3BTCA 3FXJA 3KP6A 2KLOA 2ACJA 2PMUA 2QENA 3BDDA 4EGYA 1YG2A 4BDYA 2BZTA 2KP6A 3LNQA 1X4OA 2VB6A 4DOZA 5B3SH 3BY6A 3JRCA 4P55A 5EEAA 3HXLA 3F22A 3MKLA 1R58A 2YX4A 2DW4A 1LFUP 1ZLKA 5LGUA 1STZA 5HLHA 2ME6A 3HDDA 1MIJA 3WTVC 4MGRA 1IXSB 1X58A 2Y9ZA 3S93A 4UUTA 1VNDA 3BTLA 1JKQC 5F0HA 2M7AA 2PMZA 1S6LA 4V19K 4DQ2A 1ETYA 2ETHA 2K9LA 4LJZF 1HC8A 1LVKA 1MBGA 3HTUA 3P9IA 1YYVA 4GRIA 4D0PA 4DBRA 1H8AC 2GM4A 1WH5A 2EFNA 1D0XA 1E3OC 2BE5F 4U0WA 3E6CC 3H9JA 1Y8QB 2CS3A 2CH0A 4HBLA 1IC8A 4L9VA 2OTJI 3SEZA 4CYDA 3I4MJ 1ETWA 2KQRA 3S2WA 4FQGA 1W4MA 4D7MA 1S7OA 4A0YA 5L3DA 1Z77A 5KVRA 4YIIA 5A2QZ 5JI6A 1D5VA 3LSTA 4XBFA 3GTLJ 3E7LA
chains in the Genus database with same CATH topology
2EJRA 1IXCA 4WF2A 4A12A 2OBPA 1F9NA 1FYKA 3ULQB 5H20A 4N9IA 4K2EA 2RC4A 1H9TA 2PFBA 2JT1A 2KKOA 4Q47A 3T8TA 5TRDA 1H9GA 2HQNA 2VC1A 4IHTA 3REOA 4RB0A 1SFXA 1FP1D 2P5KA 4IJAA 1K78A 2MLKA 2FXAA 5ICGA 3F8BA 3QRFF 3KCCA 1YS7A 3U1DA 4MEXF 4HLXA 3WGGA 1BIAA 3R60A 2Y0MA 2O61A 4CICA 3LWFA 4IPAA 1MDMB 2EFWA 2HR3A 3MZYA 5JHUA 3CTAA 4ZYDA 2XUBA 4KICA 4QLCU 2D1VA 4PGGA 5K5OA 5DDGA 2ESHA 2FSWA 5DYMA 4Q4ZF 2G7UA 2E1NA 4MEYF 2RQPA 3I4PA 3K9TA 5EEHA 1JXSA 5FO5A 2P8TA 2KJBA 5D6FA 1HKQA 4GO1A 4HX8A 5DCFA 3CUOA 2MD5A 4Q48A 1EH8A 2WV0A 1A04A 2IA0A 2K86A 2D2WA 1YW7A 5BQTA 2DLLA 4EJWA 2Q2EA 2FOKA 1HW2A 3K1PA 2FRHA 4I98B 4WXHA 2P5LC 4Y17A 4CGZA 1BI3A 3RPQA 1U3EM 1R5GA 2L4MA 2F5CA 2J5OA 3W6JB 2HYFA 4P5OA 2Z33A 5KK1A 5FD6A 4Q5SF 1HSTA 5ICFA 1JGSA 4KN4X 4MNUA 2QBYA 3C18A 4I0BA 3G73A 2E7WA 4UNOA 3RYRA 1XSXA 1BJAA 3I71A 4UVAA 3J81K 2LKPA 4HX7A 1LEAA 1K78B 3I59A 2NS0A 1QQIA 2BGCA 1T98A 5D8KB 1DPRA 3OV8A 2DPDA 2ZNYA 4TV7A 1KU9A 1BI1A 3WTTC 2M8EA 2V1UA 2FQ3A 5DV5A 5E1WA 1O3RA 5L3CA 2FNAA 1J75A 4MQVA 3VOEA 2A07F 4P9FA 2OQRA 3GLXA 4U0YA 3T0YA 5J8FA 2H6CA 2K7LA 3K1NA 1D8JA 3NRVA 3FM3A 2H27A 1O3TA 4KUMA 5L3BA 1FLIA 3C1DA 2LF8A 4AIHA 1TQMA 1O3QA 2O3FA 2OU2A 5D5WB 3TQNA 1PUEE 4UVCA 3RKWA 2VC0A 1ZLJA 3VB2A 3L00A 2XAJA 4YFNF 2W84A 3K1MA 4R1HA 1FSHA 1V4RA 2XIGA 2RVCA 1QNTA 4I2OA 2MC3A 3KFWX 2CG4A 3GEZA 1T0FA 4RGUA 3F21A 3SQNA 1TW2A 4ESBA 2MBFA 2EB7A 3NEUA 3F6VA 1T38A 1FYLA 3ZMTA 2R3SA 1OR7A 4MTDA 3ZPLA 4GGGA 1YW9A 2IW5A 2MLGA 2PEXA 4RGSA 5E8GA 4G7ZF 4B09A 4A6EA 1K7AA 5J6XA 1IRFA 2QQAA 1DP7P 4IXAA 4NHJA 1J0RA 3F23A 3R0JA 1E2XA 3LQQA 1I1SA 3TO9A 3SFZA 4A2UA 4G7OF 3WTXC 3KP4A 3FMSA 5BOXA 2EK5A 1O57A 3EYIA 4OU0A 3IL2A 4LMYA 5AIPA 4UVBA 2W25A 1O3SA 3E3VA 3IHUA 3D0SA 5H6RA 1XCVA 2VBWA 4HF1A 1USTA 4KA4A 2D1HA 3V8JA 5DD8A 1EV7A 1V3FA 2FEZA 1REPC 2QQ9A 5LHHA 3HRSA 1FZPB 1UB9A 1TNTA 3TKYA 3B02A 2PBIA 3WGHA 4M73A 1LDJA 2FBIA 3Q9VA 2JRTA 3HSFA 1AOYA 4Y13A 3R61A 3E6DA 4P96A 4HDVA 2H6BA 2M87A 4BHPA 2F2EA 1ULYA 3RKXA 2VOOA 1JHFA 3WE3A 1QZZA 1BI2A 1GVJA 4EMSA 2VT2A 2YX7A 2VE9A 3GYHX 3QOPA 1HXDA 5ILUA 3N4MA 3VFZA 3IRRA 1SD5A 4KIBA 1W5SA 5HS8A 2CSOA 4WWCA 1I5ZA 1FX7A 4HQMA 2UWMA 1KU7A 4RAYA 2RKHA 4ENKA 1FT9A 1FY7A 3QAHA 1IZ1A 2RDPA 1SAXA 1PP8F 2RN7A 3M7GA 3EQLF 2ZJ2A 4OIPF 2L02A 3DV8A 3VODA 1T39A 1F4KA 2VE8A 3V8LA 2DT5A 1P6RA 4EM1A 3QP6A 2VODA 2WC2A 4O3MA 5ED4A 5LBQA 1JHHA 3O2PE 5D4SA 1W7PB 1ZREA 4LFUA 3HRTA 3I64A 3FX3A 1FPQA 2GAUA 2JTVA 1XN7A 1PDNC 5LLQA 1MDMA 1U5TA 4EV0A 3ROUA 2CWEA 3L09A 4UV9A 2OD5A 5IT9K 1XMKA 5D6EA 3I53A 3P9CA 1LB2A 1I27A 2X0LA 4ZYGA 1TBXA 1YW8A 3M8EA 2PI0A 4OMZA 1U78A 4ZZDA 2GA1A 4KNYA 1U5TC 5FFXA 1J9IA 2G7HA 3JTHA 4G9YA 1GHCA 4GCVA 1K79A 4HQEA 4HF2A 1ZYRF 2Q0OA 3RYPA 5E1XA 1ZARA 2UXXA 3JAMZ 1PP7U 1J2XA 2XHKA 1KYZA 2C6YA 2AS5F 4HDUA 3GXOA 5D4RA 1Z05A 1Q1HA 2DPUA 2NRAC 2QVOA 1HW5A 2XAGA 3BJOA 1FBQA 4UV8A 2MA3A 1ON2A 3H3UA 3QU3A 1Z9CA 1UHMA 3ZMZA 3TGNA 4BHBA 2OZ6A 3TO6A 2EA2A 2RV8A 2XVCA 2K02A 4M72A 2H94A 1FBUA 1FBSA 1P92A 1TW3A 2EV5A 3B73A 3ZQ7A 5DCMA 3COAC 1R36A 4BQAA 2PQ8A 2DQLA 2CFXA 3PQJA 5HS9A 4CHUA 3WU0A 1IRGA 3U2RA 1GXPA 2KIFA 3BP8A 1R22A 1DUXC 3BJAA 2ZBKA 1ZGJA 2DK8A 2L3DA 2L4AA 1U5TB 2AXLA 3MZHA 4ASNA 2O0YA 3MWMA 1HQCA 3DKWA 1C0WA 4ENMA 4L9JA 1HSJA 3I0TA 5FD5A 4G8XA 1IN4A 3IC7A 1H0MA 1HW1A 1YIOA 1KU3A 3ZMDA 4NB5A 4I09A 3ZN0A 1OYWA 3I5UA 3IKVA 5E1ZB 5E18F 2EFOA 2NYXA 2DQRA 3F8CA 2ZKZA 2V79A 1WWXA 1X3UA 2M30A 2YR2A 1IN8A 5L3EA 4QWQA 4EM2A 5DEQA 1ZN2A 5L3FA 3JTGA 5JVTA 1R5HA 2L54A 3K0LA 4PGHA 5F6FA 3WTZA 3FXUA 3RIRA 3J80K 4WX9A 3BROA 3ZP5A 2QQBA 1W5TA 4RGRA 2ESNA 2ELHA 3EYYA 1R1TA 3DPTA 1NHAA 3TDUC 2VN2A 2XKOA 1KQ8A 2STTA 4RB3C 1U2WA 3ELKA 1ODDA 2WTEA 1LDDA 4N0BA 4E70A 2ZCWA 3F8NA 3M9AA 3OOPA 2DAOA 4LG0A 2FMYA 3HRMA 1F1ZA 3DQVC 5DCMB 2KRFA 1ZG3A 1TQPA 5HS7A 2QUFA 3RDIA 3FMQA 4U7BA 3HTSB 4IRGA 1RUOA 4LD5A 5FLXZ 2XGXA 4LLNA 1WRJA 2W85A 3BJ6A 5ILSA 4XRFA 3TOAA 4M71A 3IWFA 4M6XA 2HTJA 5HLGA 1D8KA 3Q9SA 1MGTA 1FP2A 1XDUA 4FT8A 2ZNZA 1G3SA 2LF7A 1YO5C 4U88A 1KYWA 3GW2A 2YU3A 4LB6B 3N97A 2XV4S 2BBYA 3L9FA 5LRSA 2M5WA 4AD9A 3QPTA 4CZZA 1HBXG 2J5PA 3V7RA 2VBXA 4WXCA 2MH2A 4LLLA 1OKRA 4P9UA 3RJPA 1BM9A 4L9NA 1FNNA 3EETA 2PLYA 3LA7A 4PDKA 4M9XA 4M9SA 3H92A 3DEUA 3GWZA 2QLZA 4HZFA 3ZMSA 4N9HA 5LHIA 2GXGA 4Y15A 4WK8F 2IVMA 4HV5A 3P7NA 2HZTA 5CVIA 4L18B 2UXNA 1TLHB 3V4GA 3ABUA 4MHGA 4IF4A 2OAZA 3KP5A 3CO7C 1BN5A 3T5XA 4ENNA 1MJ9A 4M74A 2CQKA 4ETSA 1FWZA 1UFMA 5A2QK 4HX4A 4L0ZB 2VT3A 4G6QA 4U7DA 4HV6A 2M1BA 1BI0A 1R7JA 2D45A 3GVAA 4LG0B 3FXQA 3ABTA 5BPDA 5LEKA 4LK1F 4OIRF 4R79A 1I1GA 3MFKA 4AVPA 3R4KA 3T1BA 5HDNA 3KEOA 5DD4A 4BAYA 1SFUA 3RTRA 5D8LB 3P9KA 3WGIA 2Q8KA 1MZBA 5LRRA 3NQOA 5ERIA 3E97A 3D5LA 1J5YA 3E6BA 5D5VB 1YS6A 3CUQC 1R1UA 2YSRA 2HEOA 5BS6A 3HHHA 2DU9A 1W7PA 2CO5A 2EFQA 2W57A 2HWVA 4EVIA 2QWWA 5ILVA 1ZG1A 3FZVA 3MEXA 4AWXB 1Z1DA 3IWZA 5J8CA 1G3YA 3E6MA 1OMIA 2O03A 1EH7A 4RGXA 2DTRA 5LHGA 1XGOA 4IRHA 4LK0F 1QBJA 1XGSA 2VONA 2K27A 5K5QA 1BIBA 1S29A 2Z9OA 1XD7A 2FBKA 1L0OC 2KIMA 2A5YB 4I02A 1U8RA 2TDXA 5K1YA 3O6BB 3SXYA 4EJTA 2DI3A 3BOQA 5DUIA 4UHTA 2COMA 1IUYA 2B0LA 1OPCA 2A68F 1LDKB 1GXQA 3I54A 4ESJA 4RB2C 3DP7A 1K6OA 3U9GA 2IA2A 2FU4A 2JPCA 4WCGA 4KFCA 1DDNA 3K69A 2R7FA 3CUQB 2KIUA 3HOSA 1RNLA 3CO6C 2CYYA 2HDCA 3WTSC 1P4WA 1O7FA 3BPXA 3HRUA 3V8KA 2FA5A 1BOAA 1ONVA 3L7WA 4KIFA 1LQ1A 1EH6A 4BYYA 5AONA 2RNJA 2YPRA 3JW4A 5HDGA 3ZN1A 3HIFA 2P4WA 1IN6A 2PN6A 4FX4A 4YG2F 2HFHA 1YTYA 1KU2A 2EFPA 3J81Z 1XSDA 2G9WA 4AIKA 2FMLA 4A5MA 4I01A 4OINF 1R1VA 3J7AO 1G3TA 5JR3A 4JBAA 1JE8A 2ZMEB 2LNBA 2XRNA 2ADUA 4A5NA 2HTSA 3GFMA 5HDKA 1E17A 3CDHA 1IXRC 2CW0F 1XCBA 2DK5A 2PMHA 4A0ZA 2Y48A 1VTNC 2F5DA 3WTUC 4DNCA 1OYYA 3GX4X 4JK1X 1ZGAA 3GUDA 3JSPA 4EJOA 5TJJA 4G7HF 4KMFA 1USSA 3MQ0A 2P5VA 5ICEA 1SMYF 2M45A 3KP2A 3M1EA 2NAZA 4HAMA 2GXBA 2P7CB 4CXFA 1RUNA 3LA3A 1TNSA 3FF5A 1IN5A 2R7DA 2ZXJA 3GFIA 4KYWA 1QO0D 5FFZA 5LEJA 1B4AA 2A6HF 4CO8A 1UHWA 4G6DA 1YLFA 4ZYHA 3E5XA 4M9ZA 4EQQA 1MJAA 4O6JA 3FM5A 3FWEA 4LLGF 3R6SA 5AIQA 1YFHA 4M6YA 1R23A 5K5RA 2F5FA 4G94A 4XSZF 2ZFWA 2IRFG 4BH9A 4MTEA 2XAQA 4XLNF 2GWRA 3WG9A 2P6TA 4B8XA 1Z6RA 2EWNA 1MD0A 2STWA 2F5EA 3LAPA 1B1BA 2ZO4A 3IKTA 3HSRA 4UUVA 3KLNA 2Z5UA 2EV0A 2DBBA 2EA4A 2IP2A 2HQRA 3HUGA 3KP7A 1S7AA 1D3YA 2ISYA 3PQKA 4KDPA 3PFIA 1LEBA 1W7PD 2OQGA 3RI4A 3W6KB 1XGNA 4ENJA 2VOPA 2PG4A 4YFKF 1B9NA 2A6EF 5HLIA 3TOBA 1DPUA 1L3LA 3MCZA 3F72A 4HA8A 4O5VA 3GFLA 4BNCA 1IF1A 2FF4A 2BV6A 1AWCA 1QGPA 1P2FA 3RPUA 1BC8C 2QM3A 2VBZA 2FE3A 3DF8A 3C7JA 4A6DA 3KZZA 4HLYA 3RKYA 2DFIA 2L01A 4Z2YA 4XLPF 3EUHA 4ZYEA 3DFGA 3LAJA 1IW7F 2K4JA 3BZ6A 2GQQA 2A61A 1MJBA 2A69F 1SD7A 3H3ZA 2H09A 3R0AA 1Z91A 1SMTA 3SZTA 1TQIA 1BC7C 3KZYA 3QU6A 1WI9A 3L2CA 4S04A 2V1DA 1BBYA 4HW0A 3KETA 2HOEA 5DUKA 4LB5A 2Y75A 2JSCA 5CVRA 4H0EA 5BMZA 1HKTA 3VEPA 3WE2A 3HHGA 3HSEA 1RIOH 1QZYA 3SHFA 2GIVA 4L0YB 3I58A 2IJLA 5BPIA 4AIJA 3GFJA 3DXJF 1ON1A 5D5XB 2Z99A 1LNWA 5CVJA 3T8RA 3GO5A 4BHCA 4HYEA 4ZH4F 5CVUA 3O3KA 3ECHA 3ISPA 4FHTA 1O7LA 1CF7A 3BPVA 2LDUA 3ZMUA 5E8IA 2WWYA 1B6AA 1KQ9A 4HF0A 5EEGA 3ML6A 1HKSA 2FNPA 4RB1A 5L3GA 3E5UA 4YFXF 2E1CA 3HOTA 4PZJA 1P4XA 4F7ZA 2HKOA 3JAMK 3C3WA 5IT9Z 4OIQF 3GZ5A 1T6SA 5E20A 4U0VA 2HYGD 3AAFA 2IA1A 1XDSA 2QYOA 4EJUA 3BWGA 2QZ8A 2P6SA 2XASA 3GF2A 2V9VA 4RAZA 2HKXA 1G6NA 3SZPA 1SD6A 1SFEA 2CGPA 5FB2A 4NQWA 3F8FA 1FSEA 3F6OA 3KE2A 2O6GE 1FYMA 5D5UB 5CYVA 4KMUX 1J59A 4ON0A 3MAJA 3E5QA 1WQ2A 3FMRA 3IRQA 2JZYA 2XKPA 2OA4A 2QBYB 1SD4A 1QPMA 2XAFA 4YIFA 1B59A 3CUQA 2E7XA 4OIOF 4OMYA 4EGZA 2LSOA 4FX0A 1G4DA 5HOOA 2O8XA 1B9MA 1WKMA 3I59B 3WU1B 4EJVA 3HYIA 4PCQA 3K2ZA 3ERED 3V7CA 1ZAOA 4GYGA 4IVNA 1TTYA 2HGCA 1LVAA 3FHZA 1XGMA 3LFKA 3LQRA 1G3WA 3DPLC 3CLOA 1UCRA 2ISZA 1CF7B 1I6XA 2P7VB 2RGVA 5FGMA 2ZMEA 4JQFA 5JFRA 3ECOA 4BXUA 5F64A 3Q5FA 3TDZC 1RI7A 5CJ9A 2NNYA 1KA8A 3KLOA 1XMAA 1XSVA 3WTWC 2MH9A 4R8HA 5LGTA 4L5IA 1S8NA 4I0AA 4S05A 4MQ9F 4A0XA 5IT3A 2EV6A 1ZRFA 4GYIA 2JPBA 2DO7A 1P4AA 2IT0A 1WSUA 1ZHFA 2NNNA 1ZG5A 5HVQC 2VXZA 2GZWA 4IRIA 3LA2A 4KIGA 1KQ0A 1Z6TA 2V1XA 2K4BA 1ZRCA 3J80Z 2KJCA 2A3SA 3QP5A 4LGWA 1LJ9A 4I7HA 1FC3A 3ZMVA 4L5JA 3GZ6A 5FLXK 3KEQA 1F5TA 4CDGA 1S3JA 3WODF 2FBHA 1IAWA 2HS5A 4UXNA 4ESFA 4KN7X 3F3XA 4WXDA 3M8FA 1KGSA 2W24A 1XB4A 2VBYA 2Z3YA 5CLSA 5ICCA 1MKMA 1U6GA 6PAXA 2X4HA 3EDPA 5LGNA 1RZ4A 1J7KA 1Z7UA 3JSOA 3QPHA 3TO7A 3F8MA 4ZZLA 1IN7A 3G3ZA 4GXOA 4OOIA 1R00A 1YQAA 3V7SA 1T2KA 5E17F 2IPQX 3WTYC 3FXRA 4EM0B 2UZKA 4KT5C 2GA2A 2BYVE 2XAHA 3CJNA 5F1RA 2V6CA 2OZUA 5CVVA 4RS8A 4XSXF 1OYIA 4HOBA 1FOKA 1Y0UA 2PJPA 5H6QA 4IHSA 3KP3A 1ZRDA 1CGPA 1ZH5A 2XROA 4L9TA 2BEOA 3KP6A 2ACJA 2PMUA 2QENA 3BDDA 4EGYA 1YG2A 3BY6A 4P55A 3F22A 1R58A 2YX4A 2DW4A 1ZLKA 5LGUA 1STZA 5HLHA 3WTVC 4MGRA 1IXSB 1S6LA 4DQ2A 2ETHA 4LJZF 3P9IA 3HTUA 4D0PA 1YYVA 2EFNA 2BE5F 4U0WA 3E6CC 4HBLA 4L9VA 4CYDA 3S2WA 1W4MA 1S7OA 4A0YA 5L3DA 5KVRA 4YIIA 5A2QZ 5JI6A 1D5VA 3LSTA 4XBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJR A;  1IXC A;  4WF2 A;  4A12 A;  2OBP A;  1F9N A;  1FYK A;  3ULQ B;  5H20 A;  4N9I A;  4K2E A;  2RC4 A;  1H9T A;  2PFB A;  2JT1 A;  2KKO A;  4Q47 A;  3T8T A;  5TRD A;  1H9G A;  2HQN A;  2VC1 A;  4IHT A;  3REO A;  4RB0 A;  1SFX A;  1FP1 D;  2P5K A;  4IJA A;  1K78 A;  2MLK A;  2FXA A;  5ICG A;  3F8B A;  3QRF F;  3KCC A;  1YS7 A;  3U1D A;  4MEX F;  4HLX A;  3WGG A;  1BIA A;  3R60 A;  2Y0M A;  2O61 A;  4CIC A;  3LWF A;  4IPA A;  1MDM B;  2EFW A;  2HR3 A;  3MZY A;  5JHU A;  3CTA A;  4ZYD A;  2XUB A;  4KIC A;  4QLC U;  2D1V A;  4PGG A;  5K5O A;  5DDG A;  2ESH A;  2FSW A;  5DYM A;  4Q4Z F;  2G7U A;  2E1N A;  4MEY F;  2RQP A;  3I4P A;  3K9T A;  5EEH A;  1JXS A;  5FO5 A;  2P8T A;  2KJB A;  5D6F A;  1HKQ A;  4GO1 A;  4HX8 A;  5DCF A;  3CUO A;  2MD5 A;  4Q48 A;  1EH8 A;  2WV0 A;  1A04 A;  2IA0 A;  2K86 A;  2D2W A;  1YW7 A;  5BQT A;  2DLL A;  4EJW A;  2Q2E A;  2FOK A;  1HW2 A;  3K1P A;  2FRH A;  4I98 B;  4WXH A;  2P5L C;  4Y17 A;  4CGZ A;  1BI3 A;  3RPQ A;  1U3E M;  1R5G A;  2L4M A;  2F5C A;  2J5O A;  3W6J B;  2HYF A;  4P5O A;  2Z33 A;  5KK1 A;  5FD6 A;  4Q5S F;  1HST A;  5ICF A;  1JGS A;  4KN4 X;  4MNU A;  2QBY A;  3C18 A;  4I0B A;  3G73 A;  2E7W A;  4UNO A;  3RYR A;  1XSX A;  1BJA A;  3I71 A;  4UVA A;  3J81 K;  2LKP A;  4HX7 A;  1LEA A;  1K78 B;  3I59 A;  2NS0 A;  1QQI A;  2BGC A;  1T98 A;  5D8K B;  1DPR A;  3OV8 A;  2DPD A;  2ZNY A;  4TV7 A;  1KU9 A;  1BI1 A;  3WTT C;  2M8E A;  2V1U A;  2FQ3 A;  5DV5 A;  5E1W A;  1O3R A;  5L3C A;  2FNA A;  1J75 A;  4MQV A;  3VOE A;  2A07 F;  4P9F A;  2OQR A;  3GLX A;  4U0Y A;  3T0Y A;  5J8F A;  2H6C A;  2K7L A;  3K1N A;  1D8J A;  3NRV A;  3FM3 A;  2H27 A;  1O3T A;  4KUM A;  5L3B A;  1FLI A;  3C1D A;  2LF8 A;  4AIH A;  1TQM A;  1O3Q A;  2O3F A;  2OU2 A;  5D5W B;  3TQN A;  1PUE E;  4UVC A;  3RKW A;  2VC0 A;  1ZLJ A;  3VB2 A;  3L00 A;  2XAJ A;  4YFN F;  2W84 A;  3K1M A;  4R1H A;  1FSH A;  1V4R A;  2XIG A;  2RVC A;  1QNT A;  4I2O A;  2MC3 A;  3KFW X;  2CG4 A;  3GEZ A;  1T0F A;  4RGU A;  3F21 A;  3SQN A;  1TW2 A;  4ESB A;  2MBF A;  2EB7 A;  3NEU A;  3F6V A;  1T38 A;  1FYL A;  3ZMT A;  2R3S A;  1OR7 A;  4MTD A;  3ZPL A;  4GGG A;  1YW9 A;  2IW5 A;  2MLG A;  2PEX A;  4RGS A;  5E8G A;  4G7Z F;  4B09 A;  4A6E A;  1K7A A;  5J6X A;  1IRF A;  2QQA A;  1DP7 P;  4IXA A;  4NHJ A;  1J0R A;  3F23 A;  3R0J A;  1E2X A;  3LQQ A;  1I1S A;  3TO9 A;  3SFZ A;  4A2U A;  4G7O F;  3WTX C;  3KP4 A;  3FMS A;  5BOX A;  2EK5 A;  1O57 A;  3EYI A;  4OU0 A;  3IL2 A;  4LMY A;  5AIP A;  4UVB A;  2W25 A;  1O3S A;  3E3V A;  3IHU A;  3D0S A;  5H6R A;  1XCV A;  2VBW A;  4HF1 A;  1UST A;  4KA4 A;  2D1H A;  3V8J A;  5DD8 A;  1EV7 A;  1V3F A;  2FEZ A;  1REP C;  2QQ9 A;  5LHH A;  3HRS A;  1FZP B;  1UB9 A;  1TNT A;  3TKY A;  3B02 A;  2PBI A;  3WGH A;  4M73 A;  1LDJ A;  2FBI A;  3Q9V A;  2JRT A;  3HSF A;  1AOY A;  4Y13 A;  3R61 A;  3E6D A;  4P96 A;  4HDV A;  2H6B A;  2M87 A;  4BHP A;  2F2E A;  1ULY A;  3RKX A;  2VOO A;  1JHF A;  3WE3 A;  1QZZ A;  1BI2 A;  1GVJ A;  4EMS A;  2VT2 A;  2YX7 A;  2VE9 A;  3GYH X;  3QOP A;  1HXD A;  5ILU A;  3N4M A;  3VFZ A;  3IRR A;  1SD5 A;  4KIB A;  1W5S A;  5HS8 A;  2CSO A;  4WWC A;  1I5Z A;  1FX7 A;  4HQM A;  2UWM A;  1KU7 A;  4RAY A;  2RKH A;  4ENK A;  1FT9 A;  1FY7 A;  3QAH A;  1IZ1 A;  2RDP A;  1SAX A;  1PP8 F;  2RN7 A;  3M7G A;  3EQL F;  2ZJ2 A;  4OIP F;  2L02 A;  3DV8 A;  3VOD A;  1T39 A;  1F4K A;  2VE8 A;  3V8L A;  2DT5 A;  1P6R A;  4EM1 A;  3QP6 A;  2VOD A;  2WC2 A;  4O3M A;  5ED4 A;  5LBQ A;  1JHH A;  3O2P E;  5D4S A;  1W7P B;  1ZRE A;  4LFU A;  3HRT A;  3I64 A;  3FX3 A;  1FPQ A;  2GAU A;  2JTV A;  1XN7 A;  1PDN C;  5LLQ A;  1MDM A;  1U5T A;  4EV0 A;  3ROU A;  2CWE A;  3L09 A;  4UV9 A;  2OD5 A;  5IT9 K;  1XMK A;  5D6E A;  3I53 A;  3P9C A;  1LB2 A;  1I27 A;  2X0L A;  4ZYG A;  1TBX A;  1YW8 A;  3M8E A;  2PI0 A;  4OMZ A;  1U78 A;  4ZZD A;  2GA1 A;  4KNY A;  1U5T C;  5FFX A;  1J9I A;  2G7H A;  3JTH A;  4G9Y A;  1GHC A;  4GCV A;  1K79 A;  4HQE A;  4HF2 A;  1ZYR F;  2Q0O A;  3RYP A;  5E1X A;  1ZAR A;  2UXX A;  3JAM Z;  1PP7 U;  1J2X A;  2XHK A;  1KYZ A;  2C6Y A;  2AS5 F;  4HDU A;  3GXO A;  5D4R A;  1Z05 A;  1Q1H A;  2DPU A;  2NRA C;  2QVO A;  1HW5 A;  2XAG A;  3BJO A;  1FBQ A;  4UV8 A;  2MA3 A;  1ON2 A;  3H3U A;  3QU3 A;  1Z9C A;  1UHM A;  3ZMZ A;  3TGN A;  4BHB A;  2OZ6 A;  3TO6 A;  2EA2 A;  2RV8 A;  2XVC A;  2K02 A;  4M72 A;  2H94 A;  1FBU A;  1FBS A;  1P92 A;  1TW3 A;  2EV5 A;  3B73 A;  3ZQ7 A;  5DCM A;  3COA C;  1R36 A;  4BQA A;  2PQ8 A;  2DQL A;  2CFX A;  3PQJ A;  5HS9 A;  4CHU A;  3WU0 A;  1IRG A;  3U2R A;  1GXP A;  2KIF A;  3BP8 A;  1R22 A;  1DUX C;  3BJA A;  2ZBK A;  1ZGJ A;  2DK8 A;  2L3D A;  2L4A A;  1U5T B;  2AXL A;  3MZH A;  4ASN A;  2O0Y A;  3MWM A;  1HQC A;  3DKW A;  1C0W A;  4ENM A;  4L9J A;  1HSJ A;  3I0T A;  5FD5 A;  4G8X A;  1IN4 A;  3IC7 A;  1H0M A;  1HW1 A;  1YIO A;  1KU3 A;  3ZMD A;  4NB5 A;  4I09 A;  3ZN0 A;  1OYW A;  3I5U A;  3IKV A;  5E1Z B;  5E18 F;  2EFO A;  2NYX A;  2DQR A;  3F8C A;  2ZKZ A;  2V79 A;  1WWX A;  1X3U A;  2M30 A;  2YR2 A;  1IN8 A;  5L3E A;  4QWQ A;  4EM2 A;  5DEQ A;  1ZN2 A;  5L3F A;  3JTG A;  5JVT A;  1R5H A;  2L54 A;  3K0L A;  4PGH A;  5F6F A;  3WTZ A;  3FXU A;  3RIR A;  3J80 K;  4WX9 A;  3BRO A;  3ZP5 A;  2QQB A;  1W5T A;  4RGR A;  2ESN A;  2ELH A;  3EYY A;  1R1T A;  3DPT A;  1NHA A;  3TDU C;  2VN2 A;  2XKO A;  1KQ8 A;  2STT A;  4RB3 C;  1U2W A;  3ELK A;  1ODD A;  2WTE A;  1LDD A;  4N0B A;  4E70 A;  2ZCW A;  3F8N A;  3M9A A;  3OOP A;  2DAO A;  4LG0 A;  2FMY A;  3HRM A;  1F1Z A;  3DQV C;  5DCM B;  2KRF A;  1ZG3 A;  1TQP A;  5HS7 A;  2QUF A;  3RDI A;  3FMQ A;  4U7B A;  3HTS B;  4IRG A;  1RUO A;  4LD5 A;  5FLX Z;  2XGX A;  4LLN A;  1WRJ A;  2W85 A;  3BJ6 A;  5ILS A;  4XRF A;  3TOA A;  4M71 A;  3IWF A;  4M6X A;  2HTJ A;  5HLG A;  1D8K A;  3Q9S A;  1MGT A;  1FP2 A;  1XDU A;  4FT8 A;  2ZNZ A;  1G3S A;  2LF7 A;  1YO5 C;  4U88 A;  1KYW A;  3GW2 A;  2YU3 A;  4LB6 B;  3N97 A;  2XV4 S;  2BBY A;  3L9F A;  5LRS A;  2M5W A;  4AD9 A;  3QPT A;  4CZZ A;  1HBX G;  2J5P A;  3V7R A;  2VBX A;  4WXC A;  2MH2 A;  4LLL A;  1OKR A;  4P9U A;  3RJP A;  1BM9 A;  4L9N A;  1FNN A;  3EET A;  2PLY A;  3LA7 A;  4PDK A;  4M9X A;  4M9S A;  3H92 A;  3DEU A;  3GWZ A;  2QLZ A;  4HZF A;  3ZMS A;  4N9H A;  5LHI A;  2GXG A;  4Y15 A;  4WK8 F;  2IVM A;  4HV5 A;  3P7N A;  2HZT A;  5CVI A;  4L18 B;  2UXN A;  1TLH B;  3V4G A;  3ABU A;  4MHG A;  4IF4 A;  2OAZ A;  3KP5 A;  3CO7 C;  1BN5 A;  3T5X A;  4ENN A;  1MJ9 A;  4M74 A;  2CQK A;  4ETS A;  1FWZ A;  1UFM A;  5A2Q K;  4HX4 A;  4L0Z B;  2VT3 A;  4G6Q A;  4U7D A;  4HV6 A;  2M1B A;  1BI0 A;  1R7J A;  2D45 A;  3GVA A;  4LG0 B;  3FXQ A;  3ABT A;  5BPD A;  5LEK A;  4LK1 F;  4OIR F;  4R79 A;  1I1G A;  3MFK A;  4AVP A;  3R4K A;  3T1B A;  5HDN A;  3KEO A;  5DD4 A;  4BAY A;  1SFU A;  3RTR A;  5D8L B;  3P9K A;  3WGI A;  2Q8K A;  1MZB A;  5LRR A;  3NQO A;  5ERI A;  3E97 A;  3D5L A;  1J5Y A;  3E6B A;  5D5V B;  1YS6 A;  3CUQ C;  1R1U A;  2YSR A;  2HEO A;  5BS6 A;  3HHH A;  2DU9 A;  1W7P A;  2CO5 A;  2EFQ A;  2W57 A;  2HWV A;  4EVI A;  2QWW A;  5ILV A;  1ZG1 A;  3FZV A;  3MEX A;  4AWX B;  1Z1D A;  3IWZ A;  5J8C A;  1G3Y A;  3E6M A;  1OMI A;  2O03 A;  1EH7 A;  4RGX A;  2DTR A;  5LHG A;  1XGO A;  4IRH A;  4LK0 F;  1QBJ A;  1XGS A;  2VON A;  2K27 A;  5K5Q A;  1BIB A;  1S29 A;  2Z9O A;  1XD7 A;  2FBK A;  1L0O C;  2KIM A;  2A5Y B;  4I02 A;  1U8R A;  2TDX A;  5K1Y A;  3O6B B;  3SXY A;  4EJT A;  2DI3 A;  3BOQ A;  5DUI A;  4UHT A;  2COM A;  1IUY A;  2B0L A;  1OPC A;  2A68 F;  1LDK B;  1GXQ A;  3I54 A;  4ESJ A;  4RB2 C;  3DP7 A;  1K6O A;  3U9G A;  2IA2 A;  2FU4 A;  2JPC A;  4WCG A;  4KFC A;  1DDN A;  3K69 A;  2R7F A;  3CUQ B;  2KIU A;  3HOS A;  1RNL A;  3CO6 C;  2CYY A;  2HDC A;  3WTS C;  1P4W A;  1O7F A;  3BPX A;  3HRU A;  3V8K A;  2FA5 A;  1BOA A;  1ONV A;  3L7W A;  4KIF A;  1LQ1 A;  1EH6 A;  4BYY A;  5AON A;  2RNJ A;  2YPR A;  3JW4 A;  5HDG A;  3ZN1 A;  3HIF A;  2P4W A;  1IN6 A;  2PN6 A;  4FX4 A;  4YG2 F;  2HFH A;  1YTY A;  1KU2 A;  2EFP A;  3J81 Z;  1XSD A;  2G9W A;  4AIK A;  2FML A;  4A5M A;  4I01 A;  4OIN F;  1R1V A;  3J7A O;  1G3T A;  5JR3 A;  4JBA A;  1JE8 A;  2ZME B;  2LNB A;  2XRN A;  2ADU A;  4A5N A;  2HTS A;  3GFM A;  5HDK A;  1E17 A;  3CDH A;  1IXR C;  2CW0 F;  1XCB A;  2DK5 A;  2PMH A;  4A0Z A;  2Y48 A;  1VTN C;  2F5D A;  3WTU C;  4DNC A;  1OYY A;  3GX4 X;  4JK1 X;  1ZGA A;  3GUD A;  3JSP A;  4EJO A;  5TJJ A;  4G7H F;  4KMF A;  1USS A;  3MQ0 A;  2P5V A;  5ICE A;  1SMY F;  2M45 A;  3KP2 A;  3M1E A;  2NAZ A;  4HAM A;  2GXB A;  2P7C B;  4CXF A;  1RUN A;  3LA3 A;  1TNS A;  3FF5 A;  1IN5 A;  2R7D A;  2ZXJ A;  3GFI A;  4KYW A;  1QO0 D;  5FFZ A;  5LEJ A;  1B4A A;  2A6H F;  4CO8 A;  1UHW A;  4G6D A;  1YLF A;  4ZYH A;  3E5X A;  4M9Z A;  4EQQ A;  1MJA A;  4O6J A;  3FM5 A;  3FWE A;  4LLG F;  3R6S A;  5AIQ A;  1YFH A;  4M6Y A;  1R23 A;  5K5R A;  2F5F A;  4G94 A;  4XSZ F;  2ZFW A;  2IRF G;  4BH9 A;  4MTE A;  2XAQ A;  4XLN F;  2GWR A;  3WG9 A;  2P6T A;  4B8X A;  1Z6R A;  2EWN A;  1MD0 A;  2STW A;  2F5E A;  3LAP A;  1B1B A;  2ZO4 A;  3IKT A;  3HSR A;  4UUV A;  3KLN A;  2Z5U A;  2EV0 A;  2DBB A;  2EA4 A;  2IP2 A;  2HQR A;  3HUG A;  3KP7 A;  1S7A A;  1D3Y A;  2ISY A;  3PQK A;  4KDP A;  3PFI A;  1LEB A;  1W7P D;  2OQG A;  3RI4 A;  3W6K B;  1XGN A;  4ENJ A;  2VOP A;  2PG4 A;  4YFK F;  1B9N A;  2A6E F;  5HLI A;  3TOB A;  1DPU A;  1L3L A;  3MCZ A;  3F72 A;  4HA8 A;  4O5V A;  3GFL A;  4BNC A;  1IF1 A;  2FF4 A;  2BV6 A;  1AWC A;  1QGP A;  1P2F A;  3RPU A;  1BC8 C;  2QM3 A;  2VBZ A;  2FE3 A;  3DF8 A;  3C7J A;  4A6D A;  3KZZ A;  4HLY A;  3RKY A;  2DFI A;  2L01 A;  4Z2Y A;  4XLP F;  3EUH A;  4ZYE A;  3DFG A;  3LAJ A;  1IW7 F;  2K4J A;  3BZ6 A;  2GQQ A;  2A61 A;  1MJB A;  2A69 F;  1SD7 A;  3H3Z A;  2H09 A;  3R0A A;  1Z91 A;  1SMT A;  3SZT A;  1TQI A;  1BC7 C;  3KZY A;  3QU6 A;  1WI9 A;  3L2C A;  4S04 A;  2V1D A;  1BBY A;  4HW0 A;  3KET A;  2HOE A;  5DUK A;  4LB5 A;  2Y75 A;  2JSC A;  5CVR A;  4H0E A;  5BMZ A;  1HKT A;  3VEP A;  3WE2 A;  3HHG A;  3HSE A;  1RIO H;  1QZY A;  3SHF A;  2GIV A;  4L0Y B;  3I58 A;  2IJL A;  5BPI A;  4AIJ A;  3GFJ A;  3DXJ F;  1ON1 A;  5D5X B;  2Z99 A;  1LNW A;  5CVJ A;  3T8R A;  3GO5 A;  4BHC A;  4HYE A;  4ZH4 F;  5CVU A;  3O3K A;  3ECH A;  3ISP A;  4FHT A;  1O7L A;  1CF7 A;  3BPV A;  2LDU A;  3ZMU A;  5E8I A;  2WWY A;  1B6A A;  1KQ9 A;  4HF0 A;  5EEG A;  3ML6 A;  1HKS A;  2FNP A;  4RB1 A;  5L3G A;  3E5U A;  4YFX F;  2E1C A;  3HOT A;  4PZJ A;  1P4X A;  4F7Z A;  2HKO A;  3JAM K;  3C3W A;  5IT9 Z;  4OIQ F;  3GZ5 A;  1T6S A;  5E20 A;  4U0V A;  2HYG D;  3AAF A;  2IA1 A;  1XDS A;  2QYO A;  4EJU A;  3BWG A;  2QZ8 A;  2P6S A;  2XAS A;  3GF2 A;  2V9V A;  4RAZ A;  2HKX A;  1G6N A;  3SZP A;  1SD6 A;  1SFE A;  2CGP A;  5FB2 A;  4NQW A;  3F8F A;  1FSE A;  3F6O A;  3KE2 A;  2O6G E;  1FYM A;  5D5U B;  5CYV A;  4KMU X;  1J59 A;  4ON0 A;  3MAJ A;  3E5Q A;  1WQ2 A;  3FMR A;  3IRQ A;  2JZY A;  2XKP A;  2OA4 A;  2QBY B;  1SD4 A;  1QPM A;  2XAF A;  4YIF A;  1B59 A;  3CUQ A;  2E7X A;  4OIO F;  4OMY A;  4EGZ A;  2LSO A;  4FX0 A;  1G4D A;  5HOO A;  2O8X A;  1B9M A;  1WKM A;  3I59 B;  3WU1 B;  4EJV A;  3HYI A;  4PCQ A;  3K2Z A;  3ERE D;  3V7C A;  1ZAO A;  4GYG A;  4IVN A;  1TTY A;  2HGC A;  1LVA A;  3FHZ A;  1XGM A;  3LFK A;  3LQR A;  1G3W A;  3DPL C;  3CLO A;  1UCR A;  2ISZ A;  1CF7 B;  1I6X A;  2P7V B;  2RGV A;  5FGM A;  2ZME A;  4JQF A;  5JFR A;  3ECO A;  4BXU A;  5F64 A;  3Q5F A;  3TDZ C;  1RI7 A;  5CJ9 A;  2NNY A;  1KA8 A;  3KLO A;  1XMA A;  1XSV A;  3WTW C;  2MH9 A;  4R8H A;  5LGT A;  4L5I A;  1S8N A;  4I0A A;  4S05 A;  4MQ9 F;  4A0X A;  5IT3 A;  2EV6 A;  1ZRF A;  4GYI A;  2JPB A;  2DO7 A;  1P4A A;  2IT0 A;  1WSU A;  1ZHF A;  2NNN A;  1ZG5 A;  5HVQ C;  2VXZ A;  2GZW A;  4IRI A;  3LA2 A;  4KIG A;  1KQ0 A;  1Z6T A;  2V1X A;  2K4B A;  1ZRC A;  3J80 Z;  2KJC A;  2A3S A;  3QP5 A;  4LGW A;  1LJ9 A;  4I7H A;  1FC3 A;  3ZMV A;  4L5J A;  3GZ6 A;  5FLX K;  3KEQ A;  1F5T A;  4CDG A;  1S3J A;  3WOD F;  2FBH A;  1IAW A;  2HS5 A;  4UXN A;  4ESF A;  4KN7 X;  3F3X A;  4WXD A;  3M8F A;  1KGS A;  2W24 A;  1XB4 A;  2VBY A;  2Z3Y A;  5CLS A;  5ICC A;  1MKM A;  1U6G A;  6PAX A;  2X4H A;  3EDP A;  5LGN A;  1RZ4 A;  1J7K A;  1Z7U A;  3JSO A;  3QPH A;  3TO7 A;  3F8M A;  4ZZL A;  1IN7 A;  3G3Z A;  4GXO A;  4OOI A;  1R00 A;  1YQA A;  3V7S A;  1T2K A;  5E17 F;  2IPQ X;  3WTY C;  3FXR A;  4EM0 B;  2UZK A;  4KT5 C;  2GA2 A;  2BYV E;  2XAH A;  3CJN A;  5F1R A;  2V6C A;  2OZU A;  5CVV A;  4RS8 A;  4XSX F;  1OYI A;  4HOB A;  1FOK A;  1Y0U A;  2PJP A;  5H6Q A;  4IHS A;  3KP3 A;  1ZRD A;  1CGP A;  1ZH5 A;  2XRO A;  4L9T A;  2BEO A;  3KP6 A;  2ACJ A;  2PMU A;  2QEN A;  3BDD A;  4EGY A;  1YG2 A;  3BY6 A;  4P55 A;  3F22 A;  1R58 A;  2YX4 A;  2DW4 A;  1ZLK A;  5LGU A;  1STZ A;  5HLH A;  3WTV C;  4MGR A;  1IXS B;  1S6L A;  4DQ2 A;  2ETH A;  4LJZ F;  3P9I A;  3HTU A;  4D0P A;  1YYV A;  2EFN A;  2BE5 F;  4U0W A;  3E6C C;  4HBL A;  4L9V A;  4CYD A;  3S2W A;  1W4M A;  1S7O A;  4A0Y A;  5L3D A;  5KVR A;  4YII A;  5A2Q Z;  5JI6 A;  1D5V A;  3LST A;  4XBF A; 
#chains in the Genus database with same CATH topology
 2EJR A;  2LP0 A;  1IXC A;  4WF2 A;  3L2R A;  4A12 A;  2OBP A;  5F0C A;  1F9N A;  1FYK A;  3SDB A;  1MBE A;  3ULQ B;  5H20 A;  4N9I A;  4NNJ A;  2JA8 J;  2IS1 A;  4K2E A;  4F3Q A;  1SVM A;  2RC4 A;  1YIT I;  5EZH A;  1H9T A;  2PFB A;  1BA5 A;  4D1Q A;  2JT1 A;  2KKO A;  3N05 A;  4Q47 A;  3T8T A;  5TRD A;  1GLN A;  1SAU A;  3ASN H;  2FQ4 A;  1X1B A;  1H9G A;  2HQN A;  3FKI J;  4E7S A;  4V2G A;  2GOM A;  1NH3 A;  1BR1 A;  2VC1 A;  4IHT A;  1I3A A;  2CFO A;  1BL0 A;  1Y39 A;  2WAQ N;  4BQN A;  3NAU A;  3OYH A;  2R0Q C;  3REO A;  2G0E A;  3FKJ A;  4RB0 A;  1S9H A;  4PSW A;  1OFC X;  1SFX A;  1LFP A;  3J7A Y;  1FP1 D;  2O8K A;  2QF7 A;  2P5K A;  4IJA A;  1K78 A;  4E7K A;  3S1M J;  2MLK A;  4BXF A;  2FXA A;  5ICG A;  3F8B A;  1OCC H;  3QRF F;  3KCC A;  1YS7 A;  3A0H C;  3U1D A;  4A3J J;  4MEX F;  4BY1 J;  4HLX A;  1VFC A;  3JCU C;  1BIA A;  3WGG A;  3R60 A;  5F04 A;  1DU0 A;  2M3A A;  2Y0M A;  2O61 A;  4CIC A;  3LWF A;  2H1L A;  4IPA A;  2DCE A;  1MDM B;  3Q0U A;  3MKY B;  2EFW A;  2HR3 A;  3MZY A;  5JHU A;  3W3C A;  3CTA A;  4ZYD A;  4D9J A;  2XSJ C;  2XUB A;  2UUZ A;  2D1V A;  4KIC A;  4QLC U;  2KDZ A;  4A69 C;  4PGG A;  3WU2 C;  5K5O A;  1X1P A;  2E19 A;  3C2G A;  2BY1 A;  2OCE A;  5DDG A;  5C44 J;  2ESH A;  2FSW A;  1IV6 A;  2E1M C;  5DYM A;  4Q4Z F;  1UG2 A;  2DT7 B;  2E1N A;  2VPR A;  2G7U A;  1N75 A;  4DYQ A;  1V54 H;  4MEY F;  1V5E A;  2RQP A;  2XRL A;  3I4P A;  2QSF X;  3K9T A;  2GXA A;  3GTQ J;  5EEH A;  3PM1 A;  1JXS A;  2DMU A;  4IQJ A;  5FO5 A;  2P8T A;  3TED A;  1VZ0 A;  2KJB A;  5D6F A;  1HKQ A;  5C3E J;  4GO1 A;  3K10 A;  4HX8 A;  5DCF A;  2DXI A;  4ZDP A;  3CUO A;  2MD5 A;  3GTG J;  2RNG A;  3PIO F;  3RZO J;  1Y56 A;  1CQT A;  4Q48 A;  1EH8 A;  2WV0 A;  2NVT J;  1A04 A;  1Q1V A;  1OCT C;  1VI0 A;  2IA0 A;  2DA5 A;  4B1R A;  2K86 A;  4DBQ A;  2D2W A;  1YW7 A;  2LKX A;  5BQT A;  1R6R A;  4DYC A;  1W0U A;  2DMT A;  3LFU A;  2JSP A;  2DOF A;  2DLL A;  4EJW A;  1JTY A;  1VQL I;  4L5E A;  2L7K A;  1MBH A;  4XRS A;  1MMG A;  3CZ6 A;  2Q2E A;  2FOK A;  1HW2 A;  3K1P A;  3VSK A;  1GT0 C;  3I9V 2;  2FRH A;  2Y2Z A;  4I98 B;  1SFO J;  4WXH A;  4W1U A;  4Y17 A;  3CCV I;  2P5L C;  4CGZ A;  1BI3 A;  1FTZ A;  4A3B J;  4V2F A;  3RPQ A;  5J1R A;  1U3E M;  1R5G A;  2L4M A;  2F5C A;  1X2M A;  2J5O A;  3W6J B;  2HYF A;  2EIN H;  4P5O A;  2Z33 A;  2VKE A;  5KK1 A;  5FD6 A;  2LOO A;  3OS0 A;  4Q5S F;  1HST A;  5ICF A;  4DYR A;  1SEU A;  4ZC3 A;  1JGS A;  4KN4 X;  5EDN A;  4MNU A;  1I3Q J;  2QBY A;  4BE0 A;  1AA7 A;  3C18 A;  3FXL A;  2CUE A;  1B72 B;  3CME I;  4I0B A;  3G73 A;  2E7W A;  4UNO A;  3RYR A;  1A6Q A;  1XSX A;  1BJA A;  2V9P A;  2L0K A;  3I71 A;  4N4O B;  4UVA A;  5JLX A;  3J81 K;  2M7B A;  2R7W A;  2LKP A;  4HX7 A;  2BXY A;  1ZR4 A;  1LEA A;  5CKT A;  1K78 B;  2DFE A;  3I59 A;  2NS0 A;  1QQI A;  2PMZ N;  3HL2 A;  2BGC A;  1XC5 A;  1T98 A;  2K40 A;  2NOG A;  1DPR A;  2ZB9 A;  1WJF A;  5D8K B;  2QSG X;  3BR2 A;  3OV8 A;  2E1M B;  2DPD A;  2XGC A;  2ZNY A;  4B4C A;  3RQI A;  4TV7 A;  4HG2 A;  1I50 J;  4DIQ A;  2IGN A;  3QYF A;  4HRI A;  1KU9 A;  3AKZ A;  1BI1 A;  3WTT C;  2M8E A;  3OYF A;  1ZEL A;  2V1U A;  2M4G A;  2M4K A;  1H89 C;  1UZC A;  2FQ3 A;  5DV5 A;  2QSH X;  1NG7 A;  5E1W A;  1O3R A;  5L3C A;  2HQA A;  2FNA A;  1J75 A;  4MQV A;  3VOE A;  1XS9 A;  1S5L C;  3VYT B;  1XX5 A;  1QZE A;  4P9F A;  2A07 F;  2OQR A;  3GLX A;  4U0Y A;  3T0Y A;  5J8F A;  1G59 A;  2H6C A;  2NS7 A;  2VQH A;  2X6Y A;  2K7L A;  4ITV A;  1WFX A;  2LR8 A;  2WAE A;  3K1N A;  1D8J A;  3SYT A;  1WJB A;  3NRV A;  3FM3 A;  4IOC F;  2H27 A;  1POG A;  3OR1 C;  1O3T A;  4KUM A;  5L3B A;  4XKW A;  2M0C A;  2ZXW H;  1FLI A;  2XDV A;  3C1D A;  2PX9 A;  2E1O A;  3TP0 A;  2LF8 A;  3OYB A;  4AIH A;  3PL8 A;  1TQM A;  1O3Q A;  2O3F A;  3OIP A;  2OU2 A;  5D5W B;  3TQN A;  3CJT B;  1PUE E;  4A3C J;  2VKH A;  4UVC A;  4IHV A;  2NVQ J;  3K4L A;  1IRX A;  4M3D A;  3RKW A;  3BTJ A;  2KRC A;  2VC0 A;  1ZLJ A;  3VB2 A;  3I4N J;  3H0G J;  3L00 A;  4N4N B;  2WAF A;  4KT6 A;  2ME0 A;  2XAJ A;  4NDL A;  4YFN F;  2W84 A;  4JYK A;  2B7E A;  3K1M A;  4R1H A;  1FSH A;  1IUF A;  1V4R A;  3C2H A;  2XIG A;  2Q1Z B;  2RVC A;  1QNT A;  3S8P A;  4I2O A;  2DYS H;  2R7X A;  2MC3 A;  3KFW X;  2CG4 A;  3GEZ A;  1T0F A;  1ORK A;  3H35 A;  3CCR I;  1X1D A;  5J3L A;  4RGU A;  1HOM A;  3F21 A;  3SQN A;  1TW2 A;  4NBQ A;  4ESB A;  3FBN B;  3OY9 A;  2MBF A;  4CSW A;  2EB7 A;  1F43 A;  4HPQ A;  3DLL F;  2EZI A;  3A1Y A;  3NEU A;  5BNG A;  1RPW A;  3F6V A;  4XN3 A;  2QA4 I;  1T38 A;  2LK2 A;  1FYL A;  3ZMT A;  2R3S A;  2VJI A;  1OR7 A;  4QTR A;  4MTD A;  1VQ4 I;  1T0F C;  3Q0W A;  2CUZ A;  3HEF A;  3HM5 A;  3QOE A;  3ZQF A;  3ZPL A;  4GGG A;  1YW9 A;  2IW5 A;  2MLG A;  3FK6 A;  4II3 A;  2HXO A;  2PEX A;  4RGS A;  4BXX J;  4LIV A;  5E8G A;  3RCO A;  3X2Q H;  4G7Z F;  4B09 A;  4A6E A;  3OS1 A;  1FIA A;  4RM2 A;  1K7A A;  2FJ1 A;  5J6X A;  5IP9 J;  1IRF A;  1E3H A;  2QQA A;  1DP7 P;  5KCM A;  3GZN B;  4IXA A;  5LFA A;  3CCJ I;  3FBI B;  3A2K A;  2LVS A;  4NHJ A;  2KPM A;  1J0R A;  2ZSH B;  4PK4 A;  2XF5 A;  1AU7 A;  2IXS A;  3F23 A;  2X1D A;  3R0J A;  1RRJ A;  1E2X A;  3LQQ A;  1TC3 C;  3G2B A;  1I1S A;  3TO9 A;  2XSD C;  3SFZ A;  4A2U A;  3DLA A;  4G7O F;  3WTX C;  3KP4 A;  4A3F J;  3FMS A;  2MSY A;  5BOX A;  2EK5 A;  2F48 A;  1O57 A;  3EYI A;  4OU0 A;  3IL2 A;  4F93 B;  5DS9 A;  2Z2S B;  4LMY A;  5AIP A;  1XPX A;  3A03 A;  2PJR A;  1XMX A;  4HST A;  1ETV A;  3AG3 H;  4G6T B;  3PNY A;  4BS9 A;  2CV1 A;  3DTI A;  3FK7 A;  4UVB A;  4E7L A;  2W25 A;  2X6O A;  1O3S A;  2DFH A;  3W2W A;  1X19 A;  2KL4 A;  4M3G A;  2I5U A;  3E3V A;  2KIQ A;  1PVE A;  2JK3 A;  3IHU A;  3D0S A;  3K70 C;  2ZJQ F;  2EH3 A;  2WY7 Q;  5H6R A;  2HVR A;  1XCV A;  2VBW A;  4P1W A;  4HF1 A;  1UST A;  4AYB A;  4KA4 A;  1YJ9 I;  5C4J J;  4D7N A;  2D1H A;  2BVM A;  2ECB A;  3V8J A;  4F52 A;  4XN0 A;  2XPU A;  1MSE C;  2BY2 A;  5DD8 A;  1EV7 A;  5GTI C;  1Y1V J;  1V3F A;  2FEZ A;  1REP C;  2QQ9 A;  2HNH A;  4A3L J;  5LHH A;  3MKW B;  2X1C A;  3HRS A;  2OV7 A;  1FZP B;  3H3V K;  1UB9 A;  1TNT A;  3TKY A;  3B02 A;  4BU2 A;  3DEW A;  1FMV A;  3CMM A;  4UB6 C;  4XR6 A;  5JLW A;  1T56 A;  2PBI A;  4XK4 A;  3WGH A;  4FCY A;  4M73 A;  1LDJ A;  5E3O A;  2R5Y B;  2FBI A;  3Q9V A;  2JRT A;  5E79 C;  3HSF A;  3ZGK A;  1AOY A;  3ZOB A;  4Y13 A;  1WZ2 A;  2VI6 A;  3R61 A;  2HI3 A;  3SDG A;  3E6D A;  4XON A;  4P96 A;  4HDV A;  2H6B A;  2M87 A;  4BHP A;  2F2E A;  3S32 A;  1ULY A;  4BE2 A;  3CD6 I;  3RKX A;  5FLV A;  2VOO A;  1JHF A;  3WE3 A;  1QZZ A;  3QYB A;  3GTM J;  1BI2 A;  2DMP A;  1GVJ A;  4EMS A;  2VT2 A;  2YX7 A;  2QEX I;  2VE9 A;  3ASO H;  3M3Y J;  3GYH X;  2RQQ A;  3QOP A;  2VAS A;  1HXD A;  3PNT A;  5ILU A;  1A35 A;  3N4M A;  2L9V A;  2W48 A;  1MBK A;  3G1M A;  3VFZ A;  3IRR A;  4I6Z A;  4I76 A;  2OCC H;  3SZG A;  2CMP A;  1SD5 A;  4KIB A;  1W5S A;  3BCB A;  2L5Q A;  1VQM I;  3GBG A;  1W0T A;  5HS8 A;  2CSO A;  2RRE A;  4WWC A;  2R7Z J;  1JKR C;  2CV0 A;  1I5Z A;  1FX7 A;  5CPR B;  3HOZ J;  4HQM A;  2UWM A;  3EUA A;  3MD2 A;  3RSN A;  1KU7 A;  4RAY A;  2RKH A;  3IAS 2;  4A3M J;  3CCY A;  4ENK A;  1FT9 A;  1FY7 A;  1OLT A;  2HU9 A;  2DA3 A;  3QAH A;  1IZ1 A;  2RDP A;  1SAX A;  1PP8 F;  2RN7 A;  3M7G A;  4RBO A;  3EQL F;  3VDX A;  4CCO A;  2ZJ2 A;  3RKQ A;  4OIP F;  2L02 A;  1JJ6 C;  3DV8 A;  4W97 A;  3VOD A;  2EZH A;  3ZCO A;  1QVT A;  1T39 A;  1W36 D;  1F4K A;  2VE8 A;  3V8L A;  2MG4 A;  2PJR B;  4LG3 A;  4KIS A;  2DT5 A;  2LBF A;  1P6R A;  4EM1 A;  3QP6 A;  4PSX A;  4C3I J;  2W82 A;  2VOD A;  1YE9 A;  2WC2 A;  1B8I B;  4O3M A;  5ED4 A;  1D1C A;  4IX7 A;  4ZDL A;  4GDF A;  3BG6 A;  5LBQ A;  4IHW A;  3GTO J;  1JHH A;  2F4M B;  4MIM A;  3NWS A;  3O2P E;  5D4S A;  1W7P B;  4XLH A;  5IOZ A;  3PUF A;  1OCO H;  4M3E A;  2DA2 A;  4D5F A;  3JRB A;  1ZRE A;  4LFU A;  3GME A;  3HRT A;  3I64 A;  3FX3 A;  1FPQ A;  1MMS A;  2GAU A;  3TW6 A;  2QQ8 A;  2JTV A;  1XN7 A;  1PDN C;  9ANT A;  5LLQ A;  2F5V A;  1MDM A;  1U5T A;  3RQ4 A;  2NVX J;  1I6H J;  4EV0 A;  3JRI A;  3H5N A;  3PO2 J;  4F55 A;  3ROU A;  3K2A A;  4Y52 J;  2H8W A;  2CWE A;  3L09 A;  4UV9 A;  2OD5 A;  5IT9 K;  1MMA A;  1XMK A;  5D6E A;  3IUO A;  3I53 A;  3P9C A;  3A02 A;  3OIQ A;  1I27 A;  3LSR A;  1LB2 A;  4B44 A;  2X0L A;  4ZYG A;  1TBX A;  3DU6 A;  1YW8 A;  3M8E A;  2PI0 A;  3AG1 H;  4OMZ A;  1U78 A;  1F36 A;  2VLA A;  1NK2 P;  4ZZD A;  2GA1 A;  2ZSI B;  4KNY A;  1U5T C;  5FFX A;  5EG0 A;  4B47 A;  1RES A;  2BHY A;  3M07 A;  2ELK A;  2V26 A;  1J9I A;  3K4B A;  4XID A;  1PYV A;  1D1B A;  2G7H A;  2W4S A;  3JTH A;  4CA0 A;  2R93 J;  1JUM A;  1T33 A;  2VJ5 A;  1U0J A;  4YRV A;  4G9Y A;  1GHC A;  4GCV A;  1K79 A;  4HQE A;  1ZR2 A;  2DOA A;  4JX4 A;  4HF2 A;  1ZYR F;  2JUC A;  2X6W A;  2Q0O A;  3CLQ A;  4KJZ A;  3RYP A;  2KDO A;  1NK3 P;  3J7Z I;  1VQ5 I;  5E1X A;  1ZAR A;  4BE1 A;  2UXX A;  1FOX A;  3OIO A;  3JAM Z;  1PP7 U;  1J2X A;  3DTE A;  2XHK A;  2CJJ A;  4QPQ A;  3OYN A;  1KYZ A;  5HLT A;  1WJE A;  4G12 A;  2C6Y A;  2HVQ A;  1A5J A;  2JWT A;  2AS5 F;  1VQ6 I;  1RR7 A;  4XM3 A;  2R7V A;  1FOW A;  4HDU A;  2JUG A;  3BTI A;  4AYB N;  1P7I A;  3CDI A;  3GXO A;  5D4R A;  1Z05 A;  4BUP A;  3WHB A;  1Q1H A;  2DPU A;  2NRA C;  1TWH J;  2DMN A;  2QVO A;  1HW5 A;  2XAG A;  2JRM A;  2ID3 A;  3BJO A;  3LMM A;  5IYD J;  1FBQ A;  4UV8 A;  2W7N A;  2EZK A;  3K4J A;  2MA3 A;  2AXT C;  1ON2 A;  3H3U A;  2V7F A;  3S3O A;  3QU3 A;  4X1E A;  1Z9C A;  1UHM A;  3KYL A;  4NC8 A;  2L9N A;  1S7E A;  2O7O A;  3TGN A;  3ZMZ A;  4BHB A;  2OZ6 A;  2HPI A;  2XPV A;  3TO6 A;  4AU7 A;  2YUS A;  2EA2 A;  2RV8 A;  2XVC A;  2K02 A;  1TL8 A;  4C3H J;  4M72 A;  2H94 A;  1FBU A;  1FBS A;  1P92 A;  1TW3 A;  1ETK A;  4U87 A;  2EV5 A;  4PJ0 C;  3DWL E;  3B73 A;  2LBF B;  5TGT A;  3ZQ7 A;  4BL0 B;  5DCM A;  3COA C;  2ELJ A;  1R36 A;  4BQA A;  3FDY A;  3H9G A;  3A01 B;  1B72 A;  2PQ8 A;  2TCT A;  2DQL A;  2CFX A;  3PQJ A;  5HS9 A;  1IG7 A;  3CMY A;  5B5E C;  1OIS A;  4CHU A;  4XNF A;  1MH4 A;  3WU0 A;  3H5A A;  1IRG A;  3K4M A;  3U2R A;  2E71 A;  3UR3 C;  1GXP A;  2GIZ A;  2KIF A;  4NC7 A;  1Z3X A;  3ZQL A;  2EIK H;  5GAD J;  3IV5 A;  2VQL A;  3BP8 A;  1R22 A;  1DUX C;  1QPI A;  3BJA A;  2LD5 A;  2Y0S N;  1X1A A;  2ZBK A;  1ZGJ A;  3JRA A;  2DK8 A;  2L3D A;  2IEK A;  4JX6 A;  2L4A A;  1FOY A;  1U5T B;  2AXL A;  3ZQQ A;  1Z21 A;  3MZH A;  4ASN A;  4XL9 A;  1Y8R B;  2O0Y A;  3MWM A;  1HQC A;  3DKW A;  4CYC A;  3DPU A;  5LD2 C;  3G1L A;  5IYC J;  1C0W A;  4ENM A;  4L9J A;  1HSJ A;  3I0T A;  5FD5 A;  2LY9 A;  1JJ8 C;  4G8X A;  1IN4 A;  3IC7 A;  1H0M A;  1HW1 A;  1YIO A;  2Z16 A;  1KU3 A;  3ZMD A;  4NB5 A;  4I09 A;  3ZN0 A;  1OYW A;  4EAT A;  4PJJ A;  3L1P A;  3I5U A;  5EG0 B;  3BZC A;  3IKV A;  5E1Z B;  5E18 F;  2EFO A;  2NYX A;  3O8G A;  2DQR A;  4PFP A;  3F8C A;  2ZKZ A;  1U9O A;  2V79 A;  1WWX A;  1X3U A;  2M30 A;  2MAB A;  4FE4 A;  2YR2 A;  4AM3 A;  3VYR B;  1IN8 A;  5L3E A;  4QWQ A;  1I39 A;  4EM2 A;  1YIJ I;  5DEQ A;  1ZN2 A;  5L3F A;  3JTG A;  4Y33 A;  5JVT A;  2R7R A;  1R5H A;  2L54 A;  3K0L A;  5J40 A;  3U1K A;  4PGH A;  2FOW A;  5F6F A;  1HDP A;  3WTZ A;  3OOU A;  3FXU A;  3RIR A;  3J80 K;  4WX9 A;  3BRO A;  2VL8 A;  1WCM J;  1SVO A;  3ZP5 A;  2QQB A;  1W5T A;  2VKV A;  4RGR A;  3HB9 A;  2VJ4 A;  2ESN A;  2ELH A;  3EYY A;  1R1T A;  3DPT A;  4BEH B;  4JOM A;  1NHA A;  3TDU C;  2VN2 A;  2P0W A;  1TT5 B;  2XKO A;  1KQ8 A;  2STT A;  4RB3 C;  1U2W A;  3J7Y J;  1LUJ B;  3ELK A;  1ODD A;  4I99 C;  2E2H J;  4IL6 C;  3VYS B;  2AQF A;  2WTE A;  1LDD A;  4N0B A;  4E70 A;  5CQE A;  2ZCW A;  3E0J B;  3F8N A;  3OYK A;  3AG2 H;  3HZJ A;  4OAZ A;  4XIC A;  3M9A A;  1XG1 A;  3OOP A;  2DAO A;  4LG0 A;  2FMY A;  3HRM A;  1F1Z A;  3DQV C;  2HPM A;  5DCM B;  2KRF A;  3IP4 B;  1Z7L A;  1ZG3 A;  3FIS A;  1TQP A;  3MZ8 A;  5HS7 A;  1MNM C;  2QUF A;  3RDI A;  3FMQ A;  4U7B A;  4X6A J;  3HTS B;  4IRG A;  5DM7 F;  1GUU A;  3BG7 A;  1RUO A;  4LD5 A;  5FLX Z;  2XGX A;  4XLE A;  3CCU I;  2LMD A;  4LLN A;  1BR2 A;  2IGO A;  2NVY J;  1WRJ A;  2W85 A;  3BJ6 A;  5ILS A;  5C4X J;  4XRF A;  2X51 A;  2DFF A;  3TOA A;  4M71 A;  3IWF A;  5FKM A;  2DA7 A;  1FTT A;  4M6X A;  2HTJ A;  5HLG A;  1D8K A;  3Q9S A;  3KEY A;  3OYA A;  2NVU B;  2DJI A;  1MGT A;  1FP2 A;  1XDU A;  4FT8 A;  1TP4 A;  2Y69 H;  2ZNZ A;  1G3S A;  3EUK L;  4CYC B;  3QYE A;  1OQY A;  1K4T A;  4IHX A;  2LF7 A;  1YO5 C;  4U88 A;  2L7F P;  1KYW A;  3GW2 A;  1MND A;  2EPF A;  2YU3 A;  3JRH A;  4LB6 B;  1X3Z B;  3HJE A;  3N97 A;  2XV4 S;  5HOD A;  2BBY A;  3L9F A;  2XAU A;  4YEJ A;  2M5W A;  5LRS A;  2NXN B;  4AD9 A;  4QSH A;  3QPT A;  2EIM H;  4CZZ A;  1K61 A;  3W6V A;  1JKP C;  1HBX G;  1IDZ A;  2J5P A;  3V7R A;  2VBX A;  1RR8 C;  2A05 A;  3HUG B;  4WXC A;  4BJ6 C;  3DU5 A;  2OUM A;  2MH2 A;  4LLL A;  5M3F J;  4C2U A;  1OKR A;  4P9U A;  2MD0 A;  3RJP A;  4IHY A;  1BM9 A;  2R92 J;  3BCA A;  4L9N A;  3GTK J;  1FNN A;  4Y7N J;  3EET A;  2PLY A;  3DKX A;  3LA7 A;  4PDK A;  4M9X A;  4M9S A;  4UUS B;  3QPS A;  3H92 A;  3DEU A;  1VF9 A;  2FX0 A;  3GWZ A;  5K7F A;  2QLZ A;  2WA0 A;  4DJA A;  1EJ9 A;  4HZF A;  3ZMS A;  4N9H A;  5LHI A;  2GXG A;  1MMD A;  4BJ5 C;  4Y15 A;  4WK8 F;  2IVM A;  4UY8 I;  4HV5 A;  3P7N A;  2KZV A;  2OF7 A;  4BY7 J;  3HPH A;  4NUB A;  2HZT A;  3BR0 A;  4XOT A;  5CVI A;  4A3K J;  4JX5 A;  3D1N I;  5F27 A;  4IQ4 A;  1Z67 A;  4L18 B;  2UXN A;  2CU7 A;  4C2M J;  3IAM 2;  1TLH B;  1W1W E;  2JMW A;  2R5Y A;  3V4G A;  3ABU A;  1RC9 A;  2K3P A;  1RKW A;  4MHG A;  4IF4 A;  3LSH A;  2OAZ A;  3KP5 A;  3CO7 C;  3KX2 A;  1BN5 A;  3T5X A;  1MJ9 A;  4ENN A;  4M74 A;  2VQG A;  2CQK A;  1X3W B;  1IV8 A;  1FWZ A;  1UFM A;  1WPK A;  4ETS A;  5A2Q K;  4HX4 A;  4L0Z B;  4XMY A;  2VT3 A;  3HKZ A;  1IDY A;  2LG4 A;  4G6Q A;  2JA5 J;  4NC6 A;  4U7D A;  4HV6 A;  2M1B A;  2JA6 J;  1BI0 A;  1R7J A;  2D45 A;  3GVA A;  1JUP A;  1DGR M;  4LG0 B;  3KIO A;  3FXQ A;  3ABT A;  2A5W A;  5BPD A;  5LEK A;  1R71 A;  1UJ8 A;  2CUF A;  2LFB A;  2YS9 A;  4LK1 F;  1Y0N A;  1ERD A;  4OIR F;  1QU3 A;  4R79 A;  1BR4 A;  5J1U A;  1I1G A;  2DDB A;  3MFK A;  1MSF C;  4C2T A;  4AVP A;  3R4K A;  3CF5 F;  2WB1 A;  3T1B A;  5HDN A;  3KEO A;  4DGW B;  5KAI C;  3TMO A;  1UG0 A;  5DD4 A;  4BAY A;  1YRN B;  2NOJ B;  2EIL H;  1LE8 A;  3PJR A;  1JKO C;  1N77 A;  5F0F A;  1SFU A;  4CZC A;  3RTR A;  5D8L B;  4QPO A;  3P9K A;  3WGI A;  4B3X A;  1UEL B;  1IJW C;  3BR3 A;  3ONQ A;  2Q8K A;  1MBJ A;  1MZB A;  1ACI A;  5LRR A;  3S3N A;  2LLK A;  2LTP A;  3NQO A;  5ERI A;  3QOD A;  3E97 A;  3FHN A;  3IH4 A;  3D5L A;  1O4X A;  1J5Y A;  1VQ8 I;  1FMW A;  3E6B A;  5DM6 F;  3OL3 A;  5D5V B;  3B6A A;  1YS6 A;  3CUQ C;  2Y31 A;  5B1B H;  1R1U A;  1B8I A;  3JRD A;  2YSR A;  3DBR B;  2HEO A;  5BS6 A;  3OL4 A;  4BGD A;  4FET A;  3HHH A;  2CQN A;  3HGG A;  2DU9 A;  3TP3 A;  3JRG A;  1W7P A;  2CO5 A;  1ZGW A;  4BQQ A;  5M3M J;  2EFQ A;  2W57 A;  4XRS G;  2HWV A;  2HYJ A;  2K3F A;  2XPW A;  4EVI A;  2QGU A;  2QWW A;  4XKC A;  5ILV A;  1ZG1 A;  3FZV A;  3MEX A;  4AWX B;  5J4V A;  1Z1D A;  3IH2 A;  3IWZ A;  5J47 A;  5J8C A;  5GAH J;  2VIX A;  1G3Y A;  3E6M A;  1OMI A;  2O03 A;  1EH7 A;  3FXK A;  3S2D J;  3QQA A;  4RGX A;  2DTR A;  3U21 A;  1WJD A;  5LHG A;  1XGO A;  4IRH A;  4LK0 F;  2VPL A;  1QBJ A;  2IS2 A;  1XGS A;  2VON A;  3OWT A;  2K27 A;  1QVU A;  5K5Q A;  1S29 A;  1BIB A;  3CCS I;  2Z9O A;  4PJL A;  1XD7 A;  2FBK A;  3CJR B;  1L0O C;  2XGD A;  1U9N A;  2KIM A;  2A5Y B;  2GLO A;  2ZME C;  3CP8 A;  3ZQG A;  4I02 A;  2MFZ A;  1U8R A;  1X1C A;  2X9D A;  1JTX A;  2B9S A;  1ZTR A;  2TDX A;  5K1Y A;  3O6B B;  2XF6 A;  3CMA I;  1J09 A;  3JR9 A;  4XKB A;  3SXY A;  2IS6 A;  2DT6 A;  3F0C A;  4EJT A;  2DI3 A;  3BC8 A;  2HOS A;  1W5C C;  1MH3 A;  4CUG A;  1LFB A;  1YJW I;  3BOQ A;  5DUI A;  4UHT A;  4II2 A;  2COM A;  5HNH A;  2HOT A;  3CC2 I;  4IZZ A;  1IUY A;  2AQE A;  2IS4 A;  4OWR B;  2B0L A;  5KNL A;  3HGY A;  1OPC A;  3I55 I;  2A68 F;  2V6E A;  1EA3 A;  2RAE A;  1LDK B;  5EGO A;  4GFB A;  3CQZ J;  3B6C A;  2WAQ A;  3GCM A;  3CCM I;  1GXQ A;  3I54 A;  4ESJ A;  3BQZ A;  4RB2 C;  1T08 B;  3G1O A;  3MKZ A;  3DP7 A;  1MNE A;  1TT0 A;  2K85 A;  1K6O A;  1M1E B;  3U9G A;  1WH7 A;  2IA2 A;  2JQ7 A;  4ZYA A;  3DBL B;  3TW7 A;  2FU4 A;  2JPC A;  4WCG A;  4KFC A;  1DDN A;  2MYS A;  3VPR A;  2MC4 A;  4XOR A;  2L7Z A;  4Y4R A;  5B1A H;  3K69 A;  4AC0 A;  4M3B A;  3BG9 A;  2JA7 J;  1LE8 B;  2R7F A;  3L2Q A;  1A6I A;  3CUQ B;  2KIU A;  3HOS A;  1YJN I;  2OTL I;  1RNL A;  3CJQ B;  4ZTJ A;  1X4P A;  3CO6 C;  2CYY A;  1QA6 A;  3OSG A;  1K83 J;  2DA4 A;  2HDC A;  3LSG A;  2R7T A;  4J19 A;  2DJN A;  3WTS C;  1P4W A;  3KYC B;  3CES A;  4D5C A;  1Z3Y A;  1O7F A;  3BPX A;  3DTK A;  2CQQ A;  3HRU A;  4DZP A;  3DEE A;  2FA5 A;  3V8K A;  3LSP A;  1BOA A;  1ONV A;  2ZJR F;  3A0B C;  3L7W A;  1T8I A;  2CV2 A;  1TZL A;  1WGX A;  4FAS D;  1V5F A;  3WG7 H;  1QRY A;  4KIF A;  2WAD A;  4UB8 C;  2LH9 A;  1LQ1 A;  1VQK I;  3ZR8 X;  3A01 A;  1EH6 A;  3OR2 C;  4BYY A;  5AON A;  2YPR A;  2RNJ A;  3JW4 A;  5HDG A;  1V5G A;  1PUF A;  3HC7 A;  4PFO A;  3ZN1 A;  1T95 A;  3HIF A;  1BOB A;  2P4W A;  1IN6 A;  2PN6 A;  3D5S C;  4YG2 F;  2HFH A;  4FX4 A;  1YTY A;  2ID6 A;  1KU2 A;  1SC7 A;  4HNV A;  1MMN A;  2ZXH A;  2EFP A;  3J81 Z;  1XSD A;  3M8J A;  2G9W A;  4AIK A;  2FML A;  4KIT B;  4A5M A;  4I01 A;  2VQC A;  4OIN F;  2OC6 A;  2O5R A;  1H88 C;  2YU9 J;  1R1V A;  3J7A O;  1G3T A;  1R5I D;  1SFK A;  3PNV A;  5JR3 A;  4J00 A;  4JBA A;  1JE8 A;  2KHM A;  2LNB A;  2JVH A;  2XRN A;  2ZME B;  3K4N A;  3H36 A;  2OJE D;  2ADU A;  4HSR A;  4A5N A;  2HTS A;  3GFM A;  5HDK A;  1E17 A;  3CDH A;  1IXR C;  4F92 B;  4BDZ A;  2CW0 F;  3MMY B;  1XCB A;  2DK5 A;  1TWF J;  1A36 A;  3KPH A;  2PMH A;  1K6Y A;  4BAC A;  4A0Z A;  2Y48 A;  1VTN C;  1LPQ A;  1R9T J;  2TRT A;  2F5D A;  2X48 A;  4DNC A;  3WTU C;  4DW6 A;  1OYY A;  3GX4 X;  1OCP A;  3BQY A;  1R4N B;  2L9S A;  3W2A A;  4JK1 X;  1ZGA A;  3O8H A;  3BG5 A;  3GUD A;  2XB0 X;  2BW3 B;  3OS2 A;  3JSP A;  4EJO A;  4E7J A;  5TJJ A;  4G7H F;  3S14 J;  2ZFU A;  4KMF A;  1USS A;  2MW8 A;  2P5V A;  3K7A J;  3MQ0 A;  5IYB J;  5ICE A;  1VQP I;  1SMY F;  1JT0 A;  2ZC2 A;  3QPL A;  1D0Z A;  2KIS A;  2M45 A;  4CCL A;  2H1K A;  3HOW J;  3KP2 A;  3M1E A;  2NAZ A;  4HAM A;  1VQ7 I;  2DMQ A;  2DTZ A;  2GXB A;  5EGO B;  4PJM A;  5KHD A;  4CXF A;  4HNU A;  2P7C B;  3DCF A;  2XC7 A;  1RUN A;  1YX3 A;  3LA3 A;  5EZG A;  1TNS A;  2CW8 A;  3FF5 A;  1Y1W J;  2ZXJ A;  1IN5 A;  2R7D A;  4H4K C;  1XTA A;  3GFI A;  4BEH A;  4KYW A;  1DU6 A;  3OYD A;  2H8R A;  1DGW Y;  1QO0 D;  5FFZ A;  4IKF A;  5LEJ A;  1P9Q C;  2R5Z A;  1B4A A;  4C3J J;  5M5W J;  2A6H F;  3AG4 H;  4CO8 A;  1UHW A;  1V55 H;  1WI3 A;  3G6E I;  4M6V A;  4B43 A;  4ANJ A;  3KYD B;  2DA6 A;  4G6D A;  1YLF A;  4ZYH A;  3E5X A;  1LKX A;  1GV5 A;  5FRN A;  4M9Z A;  3S15 J;  4EQQ A;  1TWA J;  1WVR A;  1MJA A;  3E1S A;  3OYI A;  3MVP A;  4O6J A;  3S1N J;  3HOU J;  2XB5 A;  5CQG A;  3FM5 A;  1UMQ A;  1AHD P;  4A3G J;  3FWE A;  4LLG F;  4A3E J;  2HXI A;  3R6S A;  3FXO A;  1MBF A;  5AIQ A;  3BT9 A;  1YFH A;  1PUF B;  1YI2 I;  4M6Y A;  1R23 A;  1ZQ3 P;  5K5R A;  2F5F A;  5K7H A;  4G94 A;  1D5Y A;  2L9R A;  2KZG A;  3ZQI A;  4XSZ F;  3OYL A;  2ZFW A;  1RKT A;  2IRF G;  3VSL A;  4BH9 A;  4MTE A;  2XAQ A;  4RMN A;  2IAI A;  4XLN F;  3UKG A;  1S72 I;  5GP9 A;  2GWR A;  2KT0 A;  3WG9 A;  2P6T A;  4B8X A;  3JRF A;  1EKE A;  1Z6R A;  2M8G X;  2EWN A;  1MD0 A;  2CW7 A;  2STW A;  3HBL A;  2F5E A;  3LAP A;  5IP6 A;  1B1B A;  2ZO4 A;  3IKT A;  4PJN A;  2GOX B;  3HSR A;  1BW5 A;  4UUV A;  3KLN A;  2Z5U A;  2EV0 A;  5IOY A;  3CCL I;  2DBB A;  2EA4 A;  3H5R A;  2B63 J;  4M3F A;  3K70 D;  1EF4 A;  2BY3 A;  2IP2 A;  2LC2 A;  2HQR A;  3HUG A;  3KP7 A;  1ETQ A;  2E5N A;  3V42 A;  3D5R C;  1S7A A;  1D3Y A;  2ISY A;  3PQK A;  4KDP A;  4S0H B;  4CH7 A;  3PFI A;  1LEB A;  1MW7 A;  1W7P D;  3ZQH A;  2OQG A;  5E3M A;  3RI4 A;  1X2N A;  2IGM A;  2KRH A;  3W6K B;  1XGN A;  2BVL A;  4ENJ A;  2HVS A;  2VOP A;  2F4O B;  1GDT A;  3OSF A;  2PG4 A;  4YFK F;  2WBM A;  5EF6 A;  4UUS A;  4E7H A;  5GPC A;  5HNF A;  1B9N A;  2A6E F;  5HLI A;  3TOB A;  2K9M A;  2UV1 A;  3LSJ A;  1DPU A;  1APL C;  1L3L A;  3MCZ A;  3F72 A;  4MFE A;  4HA8 A;  4O5V A;  1GV2 A;  4RLF A;  2EBI A;  4XLF A;  3GFL A;  4BNC A;  1IF1 A;  2FF4 A;  4ZJZ A;  1YOV B;  2BV6 A;  1AWC A;  1NTC A;  1QGP A;  1P2F A;  3RPU A;  1BC8 C;  2QM3 A;  2VBZ A;  3DBH B;  2FE3 A;  5GPA A;  3DF8 A;  3C7J A;  4A6D A;  2P81 A;  3L2V A;  2F6C A;  2K9Q A;  3KZZ A;  3P5J A;  2EIJ H;  3NWT A;  4HLY A;  4E6K G;  3RKY A;  1A31 A;  2DFI A;  2L2O A;  2L01 A;  2QKM B;  4Z2Y A;  4XLP F;  4F91 B;  3EUH A;  3SJM A;  4ZYE A;  3DFG A;  2R5Z B;  4J01 A;  1ZKG A;  1YX5 A;  1PJR A;  3AFH A;  3LSM A;  5B66 C;  2HZD A;  2Y9Y A;  4Z6Y A;  5FLM J;  3LAJ A;  1IW7 F;  1N25 A;  2K4J A;  3A4C A;  3I3L A;  3BZ6 A;  4CCM A;  3CDL A;  3UNG C;  1NG6 A;  2GQQ A;  2BXZ A;  2A61 A;  1K4S A;  3EUH C;  2W00 A;  4XQF A;  1JI8 A;  1MJB A;  2A69 F;  4RAG A;  1SD7 A;  4B3A A;  3M4O J;  2H09 A;  3H3Z A;  3R0A A;  2M2E A;  1SAN A;  3G4S I;  2E2J J;  1Z91 A;  1SMT A;  3SZT A;  3PFY A;  1TQI A;  1BC7 C;  3KZY A;  4B48 A;  3QU6 A;  1WI9 A;  3L2C A;  2M0M A;  4S04 A;  3JRE A;  2V1D A;  1BBY A;  2E5Z A;  3KZI C;  4HW0 A;  3KET A;  2HOE A;  5DUK A;  3ESW B;  5FKL A;  1ENH A;  5K7Z A;  4FIS A;  1YRN A;  4LB5 A;  5J4Y A;  5M5X J;  2ZJP F;  2MGQ A;  3K4C A;  2IGK A;  2Y75 A;  2JSC A;  5CVR A;  2R4G A;  5F1J A;  2FUG 2;  4H0E A;  1W36 C;  5BMZ A;  1HKT A;  2COB A;  1FJL A;  3VEP A;  3WE2 A;  3HHG A;  3PSF A;  3FIW A;  3ZQC A;  3HSE A;  1RIO H;  1QZY A;  4RA2 A;  1GVD A;  3SHF A;  2XGE A;  2GIV A;  1WJA A;  4L0Y B;  1UAA A;  3I58 A;  2IJL A;  2Z1D A;  4MO7 A;  5BPI A;  3S2H J;  2JN6 A;  4AIJ A;  3GFJ A;  3CCE I;  3DXJ F;  4LIT A;  2L7M P;  1WHU A;  1ON1 A;  5D5X B;  2Z99 A;  1LNW A;  2ICW G;  5M5Y J;  1ZK8 A;  3ABM H;  4CCN A;  5CVJ A;  4E7I A;  3EPZ A;  3RZD J;  1G2H A;  3T8R A;  3HOX J;  3GO5 A;  4BHC A;  5E3L A;  2CQX A;  4HYE A;  4ZH4 F;  5CVU A;  3O3K A;  3H0D A;  2M34 A;  3S3M A;  2KFD A;  2DDA A;  3ECH A;  3ISP A;  1FIP A;  2W1O A;  1IO2 A;  4FHT A;  3HOV J;  1O7L A;  4BBR J;  1CF7 A;  3BPV A;  2LDU A;  3ZMU A;  5E8I A;  1N78 A;  2DN0 A;  2WWY A;  1B6A A;  1KQ9 A;  2VKD A;  2OPT A;  4HF0 A;  3BZK A;  4MLO A;  3ML6 A;  5EEG A;  1HKS A;  2DA1 A;  2FNP A;  4CCJ A;  5GAE J;  4RB1 A;  4HNT A;  5L3G A;  3BR6 A;  3E5U A;  5F08 A;  4YFX F;  2E1C A;  5JHF A;  3HOT A;  3K4K A;  4PZJ A;  1P4X A;  3CCQ I;  4F7Z A;  2HKO A;  5IP7 J;  1HF0 A;  4IEJ A;  3JAM K;  3C3W A;  5IT9 Z;  4OIQ F;  3GZ5 A;  1JUS A;  1QHH D;  2K9S A;  1T6S A;  4IO9 F;  5E20 A;  3SEQ A;  4YIR X;  3OYG A;  4U0V A;  2HYG D;  3AAF A;  2IA1 A;  1XDS A;  1BJZ A;  3Q0V A;  4XLC A;  3ZRG A;  1Z0X A;  1IRZ A;  2QYO A;  4BQO A;  3PSI A;  3S16 J;  4EJU A;  3BWG A;  2AHQ A;  2QZ8 A;  2P6S A;  4A93 J;  2CQ7 A;  2XF7 A;  3MN2 A;  2DOD A;  2XAS A;  3GF2 A;  3AL0 C;  2Q2E B;  2V9V A;  1KON A;  4RAF A;  2HDD A;  4RAZ A;  2HKX A;  1G6N A;  4LIU A;  3GLL A;  1SD6 A;  3SZP A;  2O9L A;  1SFE A;  1UHS A;  4OAY A;  2CGP A;  2KMU A;  5FB2 A;  1YHQ I;  1TWC J;  1Y6I A;  4NQW A;  3PO3 J;  3G71 I;  3F8F A;  3HG9 A;  1FSE A;  4HEA 2;  3F6O A;  3KE2 A;  2O6G E;  2LY1 A;  4DZJ A;  1FYM A;  5D5U B;  5CYV A;  4KMU X;  1J59 A;  4ON0 A;  4PUS A;  3MAJ A;  1RET A;  5IY5 H;  3E5Q A;  4FE7 A;  3GTP J;  1WQ2 A;  3FMR A;  2BY0 A;  2DYR H;  3IRQ A;  2JZY A;  2XKP A;  2OA4 A;  5H2F C;  2QBY B;  1SD4 A;  1ETO A;  3M1C A;  1QPM A;  1E0E A;  3SFI A;  3Q3S A;  4AVZ A;  2V1N A;  2XAF A;  1OCZ H;  4YIF A;  1B59 A;  3ABL H;  3ERM A;  3CUQ A;  3LSK A;  2E7X A;  4OIO F;  3TBI A;  3HOY J;  4OMY A;  4EGZ A;  2AO9 A;  3H9Q A;  2LSO A;  4FX0 A;  1G4D A;  2QCO A;  1WJ5 A;  2O8X A;  5HOO A;  3PIP F;  1OR7 C;  1SVL A;  3CC7 I;  1B9M A;  1WKM A;  4EEF G;  2IBD A;  1AKH A;  1D0Y A;  3I59 B;  4E7Z A;  3WU1 B;  3LOC A;  4EJV A;  2Y30 A;  3HYI A;  4XKV A;  4PCQ A;  2E35 A;  3NAR A;  3CF2 A;  2BOL A;  3K2Z A;  1DP3 A;  3ERE D;  2DOE A;  3V7C A;  1ZAO A;  5FRM A;  2EZL A;  4GYG A;  4IVN A;  3LSI A;  1TTY A;  3S1R J;  2HGC A;  1LVA A;  2F4I A;  1HA8 A;  3FHZ A;  1XGM A;  4FTH A;  2R7O A;  2ZXI A;  3LFK A;  2X6X A;  3LQR A;  1BW6 A;  4CCK A;  1R4M B;  1G3W A;  3DPL C;  3CLO A;  1UCR A;  2NS8 A;  2ISZ A;  1CF7 B;  4BKX A;  1I6X A;  2P7V B;  3W2V A;  4XOP A;  3H1C A;  4LOC A;  4E4H A;  2RGV A;  5FGM A;  4RDU A;  2D5V A;  2ZME A;  4JQF A;  5JFR A;  3ECO A;  4BXU A;  2JVG A;  5F64 A;  3Q5F A;  3TDZ C;  1IGN A;  1RI7 A;  5CJ9 A;  4ABZ A;  3GTJ J;  2NNY A;  1KA8 A;  4QIW N;  3KLO A;  1XMA A;  1XSV A;  3WTW C;  2MH9 A;  1VQ9 I;  2ECC A;  2WY8 Q;  4R8H A;  5GAG J;  5LGT A;  3AL0 B;  1OCR H;  5FKO A;  4L5I A;  1S8N A;  4I0A A;  4S05 A;  1FEX A;  4MQ9 F;  5E3N A;  1TWG J;  3VYU B;  4A0X A;  2LRE A;  5IT3 A;  2EV6 A;  1ZRF A;  4GYI A;  1HDD C;  2HDW A;  2JPB A;  2DO7 A;  5IPA A;  4BJT A;  2E36 A;  2BW3 A;  2WV1 A;  1P4A A;  2IT0 A;  1WSU A;  3FXM A;  3S1Q J;  1ZHF A;  3BG3 A;  3C2B A;  3CC4 I;  2NNN A;  2V9K A;  1ZG5 A;  2R7U A;  2FD5 A;  5HVQ C;  2VXZ A;  4NQW B;  4Y3O A;  2GZW A;  4IRI A;  3LA2 A;  4KIG A;  2LRD A;  3K6G A;  5KAF C;  2M9H A;  1KQ0 A;  1Z6T A;  2EQR A;  2K4B A;  2V1X A;  1ZRC A;  1P7J A;  1ITY A;  3J80 Z;  2X85 A;  3BLY A;  1HCR A;  2E60 A;  2KJC A;  4ZDO A;  5JVG F;  4XLA A;  4ZTF A;  1R49 A;  2A3S A;  3QP5 A;  5J1Y A;  4LGW A;  1LJ9 A;  1E3P A;  2QKL B;  2K9N A;  3RPU D;  3CP2 A;  2HOA A;  3S17 J;  3LL7 A;  2LYC A;  4XRM A;  3HPG A;  4I7H A;  1JGG A;  5FKK A;  1FC3 A;  1OJL A;  4YEL A;  5FJ8 J;  2Y0S A;  4X0G A;  1G8X A;  3ZMV A;  2GBY A;  4L5J A;  3GZ6 A;  5FLX K;  3KEQ A;  1F5T A;  4AUX A;  2A6T A;  4BBS J;  3ZXS A;  4CDG A;  3OYE A;  1QHG A;  1S3J A;  3WOD F;  2FBH A;  1U8B A;  3OYJ A;  1IAW A;  2HS5 A;  4UXN A;  1VQO I;  1AKH B;  5FRO A;  4ESF A;  1D1A A;  1KZH A;  4KN7 X;  2K5C A;  2CUJ A;  3F3X A;  3PUB A;  3TL4 X;  4WXD A;  3M8F A;  1KGS A;  2VJJ A;  2W24 A;  1XB4 A;  2VBY A;  2Z3Y A;  5CLS A;  5ICC A;  2V4J C;  3DKY A;  1MKM A;  3QWL A;  3L2W A;  1HLV A;  1U6G A;  3HKZ N;  3F9K A;  6PAX A;  2X4H A;  3EDP A;  3BR5 A;  4IOA F;  5LGN A;  2VUM J;  3OMY A;  3IH3 A;  4JP0 A;  4RLQ A;  3BR1 A;  1RZ4 A;  1J7K A;  4A3I J;  1WJC A;  1Z7U A;  3JSO A;  3QPH A;  3TO7 A;  2VXD A;  3F8M A;  2LY2 A;  4ZZL A;  1IN7 A;  3WHC A;  3G3Z A;  5GTH C;  4GXO A;  4OOI A;  4AID A;  4RM3 A;  2JA2 A;  4C9Y A;  3VWB A;  1R00 A;  1YQA A;  2R7Q A;  3V7S A;  1T2K A;  2I10 A;  5E17 F;  2R7S A;  3OYM A;  2IPQ X;  1VQN I;  5FKN A;  3WTY C;  3FXR A;  4EM0 B;  2UZK A;  2CRG A;  4KT5 C;  2GA2 A;  4A3D J;  2BYV E;  2XAH A;  3CJN A;  5F1R A;  5DTD A;  3OYC A;  3ABK H;  5TIS C;  2WB1 N;  2E34 A;  1DQU A;  2BHZ A;  2V6C A;  4C30 A;  2OZU A;  5CVV A;  2JJ7 A;  5EYR A;  2HQ5 A;  4RS8 A;  2I8D A;  4XSX F;  3L2U A;  1OYI A;  2E2I J;  5EJC A;  4HOB A;  2LKS A;  2X1E A;  3I56 I;  1FOK A;  1Y0U A;  2PJP A;  1ETX A;  1JT6 A;  5H6Q A;  4IHS A;  3KP3 A;  1ZRD A;  2N8G A;  1CGP A;  1ZH5 A;  4MFD A;  2XRO A;  4L9T A;  2BEO A;  3BTC A;  3FXJ A;  3KP6 A;  2KLO A;  2ACJ A;  2PMU A;  2QEN A;  3BDD A;  4EGY A;  1YG2 A;  4BDY A;  2BZT A;  2KP6 A;  3LNQ A;  1X4O A;  2VB6 A;  4DOZ A;  5B3S H;  3BY6 A;  3JRC A;  4P55 A;  5EEA A;  3HXL A;  3F22 A;  3MKL A;  1R58 A;  2YX4 A;  2DW4 A;  1LFU P;  1ZLK A;  5LGU A;  1STZ A;  5HLH A;  2ME6 A;  3HDD A;  1MIJ A;  3WTV C;  4MGR A;  1IXS B;  1X58 A;  2Y9Z A;  3S93 A;  4UUT A;  1VND A;  3BTL A;  1JKQ C;  5F0H A;  2M7A A;  2PMZ A;  1S6L A;  4V19 K;  4DQ2 A;  1ETY A;  2ETH A;  2K9L A;  4LJZ F;  1HC8 A;  1LVK A;  1MBG A;  3HTU A;  3P9I A;  1YYV A;  4GRI A;  4D0P A;  4DBR A;  1H8A C;  2GM4 A;  1WH5 A;  2EFN A;  1D0X A;  1E3O C;  2BE5 F;  4U0W A;  3E6C C;  3H9J A;  1Y8Q B;  2CS3 A;  2CH0 A;  4HBL A;  1IC8 A;  4L9V A;  2OTJ I;  3SEZ A;  4CYD A;  3I4M J;  1ETW A;  2KQR A;  3S2W A;  4FQG A;  1W4M A;  4D7M A;  1S7O A;  4A0Y A;  5L3D A;  1Z77 A;  5KVR A;  4YII A;  5A2Q Z;  5JI6 A;  1D5V A;  3LST A;  4XBF A;  3GTL J;  3E7L A; 
#chains in the Genus database with same CATH homology
 2EJR A;  1IXC A;  4WF2 A;  4A12 A;  2OBP A;  1F9N A;  1FYK A;  3ULQ B;  5H20 A;  4N9I A;  4K2E A;  2RC4 A;  1H9T A;  2PFB A;  2JT1 A;  2KKO A;  4Q47 A;  3T8T A;  5TRD A;  1H9G A;  2HQN A;  2VC1 A;  4IHT A;  3REO A;  4RB0 A;  1SFX A;  1FP1 D;  2P5K A;  4IJA A;  1K78 A;  2MLK A;  2FXA A;  5ICG A;  3F8B A;  3QRF F;  3KCC A;  1YS7 A;  3U1D A;  4MEX F;  4HLX A;  3WGG A;  1BIA A;  3R60 A;  2Y0M A;  2O61 A;  4CIC A;  3LWF A;  4IPA A;  1MDM B;  2EFW A;  2HR3 A;  3MZY A;  5JHU A;  3CTA A;  4ZYD A;  2XUB A;  4KIC A;  4QLC U;  2D1V A;  4PGG A;  5K5O A;  5DDG A;  2ESH A;  2FSW A;  5DYM A;  4Q4Z F;  2G7U A;  2E1N A;  4MEY F;  2RQP A;  3I4P A;  3K9T A;  5EEH A;  1JXS A;  5FO5 A;  2P8T A;  2KJB A;  5D6F A;  1HKQ A;  4GO1 A;  4HX8 A;  5DCF A;  3CUO A;  2MD5 A;  4Q48 A;  1EH8 A;  2WV0 A;  1A04 A;  2IA0 A;  2K86 A;  2D2W A;  1YW7 A;  5BQT A;  2DLL A;  4EJW A;  2Q2E A;  2FOK A;  1HW2 A;  3K1P A;  2FRH A;  4I98 B;  4WXH A;  2P5L C;  4Y17 A;  4CGZ A;  1BI3 A;  3RPQ A;  1U3E M;  1R5G A;  2L4M A;  2F5C A;  2J5O A;  3W6J B;  2HYF A;  4P5O A;  2Z33 A;  5KK1 A;  5FD6 A;  4Q5S F;  1HST A;  5ICF A;  1JGS A;  4KN4 X;  4MNU A;  2QBY A;  3C18 A;  4I0B A;  3G73 A;  2E7W A;  4UNO A;  3RYR A;  1XSX A;  1BJA A;  3I71 A;  4UVA A;  3J81 K;  2LKP A;  4HX7 A;  1LEA A;  1K78 B;  3I59 A;  2NS0 A;  1QQI A;  2BGC A;  1T98 A;  5D8K B;  1DPR A;  3OV8 A;  2DPD A;  2ZNY A;  4TV7 A;  1KU9 A;  1BI1 A;  3WTT C;  2M8E A;  2V1U A;  2FQ3 A;  5DV5 A;  5E1W A;  1O3R A;  5L3C A;  2FNA A;  1J75 A;  4MQV A;  3VOE A;  2A07 F;  4P9F A;  2OQR A;  3GLX A;  4U0Y A;  3T0Y A;  5J8F A;  2H6C A;  2K7L A;  3K1N A;  1D8J A;  3NRV A;  3FM3 A;  2H27 A;  1O3T A;  4KUM A;  5L3B A;  1FLI A;  3C1D A;  2LF8 A;  4AIH A;  1TQM A;  1O3Q A;  2O3F A;  2OU2 A;  5D5W B;  3TQN A;  1PUE E;  4UVC A;  3RKW A;  2VC0 A;  1ZLJ A;  3VB2 A;  3L00 A;  2XAJ A;  4YFN F;  2W84 A;  3K1M A;  4R1H A;  1FSH A;  1V4R A;  2XIG A;  2RVC A;  1QNT A;  4I2O A;  2MC3 A;  3KFW X;  2CG4 A;  3GEZ A;  1T0F A;  4RGU A;  3F21 A;  3SQN A;  1TW2 A;  4ESB A;  2MBF A;  2EB7 A;  3NEU A;  3F6V A;  1T38 A;  1FYL A;  3ZMT A;  2R3S A;  1OR7 A;  4MTD A;  3ZPL A;  4GGG A;  1YW9 A;  2IW5 A;  2MLG A;  2PEX A;  4RGS A;  5E8G A;  4G7Z F;  4B09 A;  4A6E A;  1K7A A;  5J6X A;  1IRF A;  2QQA A;  1DP7 P;  4IXA A;  4NHJ A;  1J0R A;  3F23 A;  3R0J A;  1E2X A;  3LQQ A;  1I1S A;  3TO9 A;  3SFZ A;  4A2U A;  4G7O F;  3WTX C;  3KP4 A;  3FMS A;  5BOX A;  2EK5 A;  1O57 A;  3EYI A;  4OU0 A;  3IL2 A;  4LMY A;  5AIP A;  4UVB A;  2W25 A;  1O3S A;  3E3V A;  3IHU A;  3D0S A;  5H6R A;  1XCV A;  2VBW A;  4HF1 A;  1UST A;  4KA4 A;  2D1H A;  3V8J A;  5DD8 A;  1EV7 A;  1V3F A;  2FEZ A;  1REP C;  2QQ9 A;  5LHH A;  3HRS A;  1FZP B;  1UB9 A;  1TNT A;  3TKY A;  3B02 A;  2PBI A;  3WGH A;  4M73 A;  1LDJ A;  2FBI A;  3Q9V A;  2JRT A;  3HSF A;  1AOY A;  4Y13 A;  3R61 A;  3E6D A;  4P96 A;  4HDV A;  2H6B A;  2M87 A;  4BHP A;  2F2E A;  1ULY A;  3RKX A;  2VOO A;  1JHF A;  3WE3 A;  1QZZ A;  1BI2 A;  1GVJ A;  4EMS A;  2VT2 A;  2YX7 A;  2VE9 A;  3GYH X;  3QOP A;  1HXD A;  5ILU A;  3N4M A;  3VFZ A;  3IRR A;  1SD5 A;  4KIB A;  1W5S A;  5HS8 A;  2CSO A;  4WWC A;  1I5Z A;  1FX7 A;  4HQM A;  2UWM A;  1KU7 A;  4RAY A;  2RKH A;  4ENK A;  1FT9 A;  1FY7 A;  3QAH A;  1IZ1 A;  2RDP A;  1SAX A;  1PP8 F;  2RN7 A;  3M7G A;  3EQL F;  2ZJ2 A;  4OIP F;  2L02 A;  3DV8 A;  3VOD A;  1T39 A;  1F4K A;  2VE8 A;  3V8L A;  2DT5 A;  1P6R A;  4EM1 A;  3QP6 A;  2VOD A;  2WC2 A;  4O3M A;  5ED4 A;  5LBQ A;  1JHH A;  3O2P E;  5D4S A;  1W7P B;  1ZRE A;  4LFU A;  3HRT A;  3I64 A;  3FX3 A;  1FPQ A;  2GAU A;  2JTV A;  1XN7 A;  1PDN C;  5LLQ A;  1MDM A;  1U5T A;  4EV0 A;  3ROU A;  2CWE A;  3L09 A;  4UV9 A;  2OD5 A;  5IT9 K;  1XMK A;  5D6E A;  3I53 A;  3P9C A;  1LB2 A;  1I27 A;  2X0L A;  4ZYG A;  1TBX A;  1YW8 A;  3M8E A;  2PI0 A;  4OMZ A;  1U78 A;  4ZZD A;  2GA1 A;  4KNY A;  1U5T C;  5FFX A;  1J9I A;  2G7H A;  3JTH A;  4G9Y A;  1GHC A;  4GCV A;  1K79 A;  4HQE A;  4HF2 A;  1ZYR F;  2Q0O A;  3RYP A;  5E1X A;  1ZAR A;  2UXX A;  3JAM Z;  1PP7 U;  1J2X A;  2XHK A;  1KYZ A;  2C6Y A;  2AS5 F;  4HDU A;  3GXO A;  5D4R A;  1Z05 A;  1Q1H A;  2DPU A;  2NRA C;  2QVO A;  1HW5 A;  2XAG A;  3BJO A;  1FBQ A;  4UV8 A;  2MA3 A;  1ON2 A;  3H3U A;  3QU3 A;  1Z9C A;  1UHM A;  3ZMZ A;  3TGN A;  4BHB A;  2OZ6 A;  3TO6 A;  2EA2 A;  2RV8 A;  2XVC A;  2K02 A;  4M72 A;  2H94 A;  1FBU A;  1FBS A;  1P92 A;  1TW3 A;  2EV5 A;  3B73 A;  3ZQ7 A;  5DCM A;  3COA C;  1R36 A;  4BQA A;  2PQ8 A;  2DQL A;  2CFX A;  3PQJ A;  5HS9 A;  4CHU A;  3WU0 A;  1IRG A;  3U2R A;  1GXP A;  2KIF A;  3BP8 A;  1R22 A;  1DUX C;  3BJA A;  2ZBK A;  1ZGJ A;  2DK8 A;  2L3D A;  2L4A A;  1U5T B;  2AXL A;  3MZH A;  4ASN A;  2O0Y A;  3MWM A;  1HQC A;  3DKW A;  1C0W A;  4ENM A;  4L9J A;  1HSJ A;  3I0T A;  5FD5 A;  4G8X A;  1IN4 A;  3IC7 A;  1H0M A;  1HW1 A;  1YIO A;  1KU3 A;  3ZMD A;  4NB5 A;  4I09 A;  3ZN0 A;  1OYW A;  3I5U A;  3IKV A;  5E1Z B;  5E18 F;  2EFO A;  2NYX A;  2DQR A;  3F8C A;  2ZKZ A;  2V79 A;  1WWX A;  1X3U A;  2M30 A;  2YR2 A;  1IN8 A;  5L3E A;  4QWQ A;  4EM2 A;  5DEQ A;  1ZN2 A;  5L3F A;  3JTG A;  5JVT A;  1R5H A;  2L54 A;  3K0L A;  4PGH A;  5F6F A;  3WTZ A;  3FXU A;  3RIR A;  3J80 K;  4WX9 A;  3BRO A;  3ZP5 A;  2QQB A;  1W5T A;  4RGR A;  2ESN A;  2ELH A;  3EYY A;  1R1T A;  3DPT A;  1NHA A;  3TDU C;  2VN2 A;  2XKO A;  1KQ8 A;  2STT A;  4RB3 C;  1U2W A;  3ELK A;  1ODD A;  2WTE A;  1LDD A;  4N0B A;  4E70 A;  2ZCW A;  3F8N A;  3M9A A;  3OOP A;  2DAO A;  4LG0 A;  2FMY A;  3HRM A;  1F1Z A;  3DQV C;  5DCM B;  2KRF A;  1ZG3 A;  1TQP A;  5HS7 A;  2QUF A;  3RDI A;  3FMQ A;  4U7B A;  3HTS B;  4IRG A;  1RUO A;  4LD5 A;  5FLX Z;  2XGX A;  4LLN A;  1WRJ A;  2W85 A;  3BJ6 A;  5ILS A;  4XRF A;  3TOA A;  4M71 A;  3IWF A;  4M6X A;  2HTJ A;  5HLG A;  1D8K A;  3Q9S A;  1MGT A;  1FP2 A;  1XDU A;  4FT8 A;  2ZNZ A;  1G3S A;  2LF7 A;  1YO5 C;  4U88 A;  1KYW A;  3GW2 A;  2YU3 A;  4LB6 B;  3N97 A;  2XV4 S;  2BBY A;  3L9F A;  5LRS A;  2M5W A;  4AD9 A;  3QPT A;  4CZZ A;  1HBX G;  2J5P A;  3V7R A;  2VBX A;  4WXC A;  2MH2 A;  4LLL A;  1OKR A;  4P9U A;  3RJP A;  1BM9 A;  4L9N A;  1FNN A;  3EET A;  2PLY A;  3LA7 A;  4PDK A;  4M9X A;  4M9S A;  3H92 A;  3DEU A;  3GWZ A;  2QLZ A;  4HZF A;  3ZMS A;  4N9H A;  5LHI A;  2GXG A;  4Y15 A;  4WK8 F;  2IVM A;  4HV5 A;  3P7N A;  2HZT A;  5CVI A;  4L18 B;  2UXN A;  1TLH B;  3V4G A;  3ABU A;  4MHG A;  4IF4 A;  2OAZ A;  3KP5 A;  3CO7 C;  1BN5 A;  3T5X A;  4ENN A;  1MJ9 A;  4M74 A;  2CQK A;  4ETS A;  1FWZ A;  1UFM A;  5A2Q K;  4HX4 A;  4L0Z B;  2VT3 A;  4G6Q A;  4U7D A;  4HV6 A;  2M1B A;  1BI0 A;  1R7J A;  2D45 A;  3GVA A;  4LG0 B;  3FXQ A;  3ABT A;  5BPD A;  5LEK A;  4LK1 F;  4OIR F;  4R79 A;  1I1G A;  3MFK A;  4AVP A;  3R4K A;  3T1B A;  5HDN A;  3KEO A;  5DD4 A;  4BAY A;  1SFU A;  3RTR A;  5D8L B;  3P9K A;  3WGI A;  2Q8K A;  1MZB A;  5LRR A;  3NQO A;  5ERI A;  3E97 A;  3D5L A;  1J5Y A;  3E6B A;  5D5V B;  1YS6 A;  3CUQ C;  1R1U A;  2YSR A;  2HEO A;  5BS6 A;  3HHH A;  2DU9 A;  1W7P A;  2CO5 A;  2EFQ A;  2W57 A;  2HWV A;  4EVI A;  2QWW A;  5ILV A;  1ZG1 A;  3FZV A;  3MEX A;  4AWX B;  1Z1D A;  3IWZ A;  5J8C A;  1G3Y A;  3E6M A;  1OMI A;  2O03 A;  1EH7 A;  4RGX A;  2DTR A;  5LHG A;  1XGO A;  4IRH A;  4LK0 F;  1QBJ A;  1XGS A;  2VON A;  2K27 A;  5K5Q A;  1BIB A;  1S29 A;  2Z9O A;  1XD7 A;  2FBK A;  1L0O C;  2KIM A;  2A5Y B;  4I02 A;  1U8R A;  2TDX A;  5K1Y A;  3O6B B;  3SXY A;  4EJT A;  2DI3 A;  3BOQ A;  5DUI A;  4UHT A;  2COM A;  1IUY A;  2B0L A;  1OPC A;  2A68 F;  1LDK B;  1GXQ A;  3I54 A;  4ESJ A;  4RB2 C;  3DP7 A;  1K6O A;  3U9G A;  2IA2 A;  2FU4 A;  2JPC A;  4WCG A;  4KFC A;  1DDN A;  3K69 A;  2R7F A;  3CUQ B;  2KIU A;  3HOS A;  1RNL A;  3CO6 C;  2CYY A;  2HDC A;  3WTS C;  1P4W A;  1O7F A;  3BPX A;  3HRU A;  3V8K A;  2FA5 A;  1BOA A;  1ONV A;  3L7W A;  4KIF A;  1LQ1 A;  1EH6 A;  4BYY A;  5AON A;  2RNJ A;  2YPR A;  3JW4 A;  5HDG A;  3ZN1 A;  3HIF A;  2P4W A;  1IN6 A;  2PN6 A;  4FX4 A;  4YG2 F;  2HFH A;  1YTY A;  1KU2 A;  2EFP A;  3J81 Z;  1XSD A;  2G9W A;  4AIK A;  2FML A;  4A5M A;  4I01 A;  4OIN F;  1R1V A;  3J7A O;  1G3T A;  5JR3 A;  4JBA A;  1JE8 A;  2ZME B;  2LNB A;  2XRN A;  2ADU A;  4A5N A;  2HTS A;  3GFM A;  5HDK A;  1E17 A;  3CDH A;  1IXR C;  2CW0 F;  1XCB A;  2DK5 A;  2PMH A;  4A0Z A;  2Y48 A;  1VTN C;  2F5D A;  3WTU C;  4DNC A;  1OYY A;  3GX4 X;  4JK1 X;  1ZGA A;  3GUD A;  3JSP A;  4EJO A;  5TJJ A;  4G7H F;  4KMF A;  1USS A;  3MQ0 A;  2P5V A;  5ICE A;  1SMY F;  2M45 A;  3KP2 A;  3M1E A;  2NAZ A;  4HAM A;  2GXB A;  2P7C B;  4CXF A;  1RUN A;  3LA3 A;  1TNS A;  3FF5 A;  1IN5 A;  2R7D A;  2ZXJ A;  3GFI A;  4KYW A;  1QO0 D;  5FFZ A;  5LEJ A;  1B4A A;  2A6H F;  4CO8 A;  1UHW A;  4G6D A;  1YLF A;  4ZYH A;  3E5X A;  4M9Z A;  4EQQ A;  1MJA A;  4O6J A;  3FM5 A;  3FWE A;  4LLG F;  3R6S A;  5AIQ A;  1YFH A;  4M6Y A;  1R23 A;  5K5R A;  2F5F A;  4G94 A;  4XSZ F;  2ZFW A;  2IRF G;  4BH9 A;  4MTE A;  2XAQ A;  4XLN F;  2GWR A;  3WG9 A;  2P6T A;  4B8X A;  1Z6R A;  2EWN A;  1MD0 A;  2STW A;  2F5E A;  3LAP A;  1B1B A;  2ZO4 A;  3IKT A;  3HSR A;  4UUV A;  3KLN A;  2Z5U A;  2EV0 A;  2DBB A;  2EA4 A;  2IP2 A;  2HQR A;  3HUG A;  3KP7 A;  1S7A A;  1D3Y A;  2ISY A;  3PQK A;  4KDP A;  3PFI A;  1LEB A;  1W7P D;  2OQG A;  3RI4 A;  3W6K B;  1XGN A;  4ENJ A;  2VOP A;  2PG4 A;  4YFK F;  1B9N A;  2A6E F;  5HLI A;  3TOB A;  1DPU A;  1L3L A;  3MCZ A;  3F72 A;  4HA8 A;  4O5V A;  3GFL A;  4BNC A;  1IF1 A;  2FF4 A;  2BV6 A;  1AWC A;  1QGP A;  1P2F A;  3RPU A;  1BC8 C;  2QM3 A;  2VBZ A;  2FE3 A;  3DF8 A;  3C7J A;  4A6D A;  3KZZ A;  4HLY A;  3RKY A;  2DFI A;  2L01 A;  4Z2Y A;  4XLP F;  3EUH A;  4ZYE A;  3DFG A;  3LAJ A;  1IW7 F;  2K4J A;  3BZ6 A;  2GQQ A;  2A61 A;  1MJB A;  2A69 F;  1SD7 A;  3H3Z A;  2H09 A;  3R0A A;  1Z91 A;  1SMT A;  3SZT A;  1TQI A;  1BC7 C;  3KZY A;  3QU6 A;  1WI9 A;  3L2C A;  4S04 A;  2V1D A;  1BBY A;  4HW0 A;  3KET A;  2HOE A;  5DUK A;  4LB5 A;  2Y75 A;  2JSC A;  5CVR A;  4H0E A;  5BMZ A;  1HKT A;  3VEP A;  3WE2 A;  3HHG A;  3HSE A;  1RIO H;  1QZY A;  3SHF A;  2GIV A;  4L0Y B;  3I58 A;  2IJL A;  5BPI A;  4AIJ A;  3GFJ A;  3DXJ F;  1ON1 A;  5D5X B;  2Z99 A;  1LNW A;  5CVJ A;  3T8R A;  3GO5 A;  4BHC A;  4HYE A;  4ZH4 F;  5CVU A;  3O3K A;  3ECH A;  3ISP A;  4FHT A;  1O7L A;  1CF7 A;  3BPV A;  2LDU A;  3ZMU A;  5E8I A;  2WWY A;  1B6A A;  1KQ9 A;  4HF0 A;  5EEG A;  3ML6 A;  1HKS A;  2FNP A;  4RB1 A;  5L3G A;  3E5U A;  4YFX F;  2E1C A;  3HOT A;  4PZJ A;  1P4X A;  4F7Z A;  2HKO A;  3JAM K;  3C3W A;  5IT9 Z;  4OIQ F;  3GZ5 A;  1T6S A;  5E20 A;  4U0V A;  2HYG D;  3AAF A;  2IA1 A;  1XDS A;  2QYO A;  4EJU A;  3BWG A;  2QZ8 A;  2P6S A;  2XAS A;  3GF2 A;  2V9V A;  4RAZ A;  2HKX A;  1G6N A;  3SZP A;  1SD6 A;  1SFE A;  2CGP A;  5FB2 A;  4NQW A;  3F8F A;  1FSE A;  3F6O A;  3KE2 A;  2O6G E;  1FYM A;  5D5U B;  5CYV A;  4KMU X;  1J59 A;  4ON0 A;  3MAJ A;  3E5Q A;  1WQ2 A;  3FMR A;  3IRQ A;  2JZY A;  2XKP A;  2OA4 A;  2QBY B;  1SD4 A;  1QPM A;  2XAF A;  4YIF A;  1B59 A;  3CUQ A;  2E7X A;  4OIO F;  4OMY A;  4EGZ A;  2LSO A;  4FX0 A;  1G4D A;  5HOO A;  2O8X A;  1B9M A;  1WKM A;  3I59 B;  3WU1 B;  4EJV A;  3HYI A;  4PCQ A;  3K2Z A;  3ERE D;  3V7C A;  1ZAO A;  4GYG A;  4IVN A;  1TTY A;  2HGC A;  1LVA A;  3FHZ A;  1XGM A;  3LFK A;  3LQR A;  1G3W A;  3DPL C;  3CLO A;  1UCR A;  2ISZ A;  1CF7 B;  1I6X A;  2P7V B;  2RGV A;  5FGM A;  2ZME A;  4JQF A;  5JFR A;  3ECO A;  4BXU A;  5F64 A;  3Q5F A;  3TDZ C;  1RI7 A;  5CJ9 A;  2NNY A;  1KA8 A;  3KLO A;  1XMA A;  1XSV A;  3WTW C;  2MH9 A;  4R8H A;  5LGT A;  4L5I A;  1S8N A;  4I0A A;  4S05 A;  4MQ9 F;  4A0X A;  5IT3 A;  2EV6 A;  1ZRF A;  4GYI A;  2JPB A;  2DO7 A;  1P4A A;  2IT0 A;  1WSU A;  1ZHF A;  2NNN A;  1ZG5 A;  5HVQ C;  2VXZ A;  2GZW A;  4IRI A;  3LA2 A;  4KIG A;  1KQ0 A;  1Z6T A;  2V1X A;  2K4B A;  1ZRC A;  3J80 Z;  2KJC A;  2A3S A;  3QP5 A;  4LGW A;  1LJ9 A;  4I7H A;  1FC3 A;  3ZMV A;  4L5J A;  3GZ6 A;  5FLX K;  3KEQ A;  1F5T A;  4CDG A;  1S3J A;  3WOD F;  2FBH A;  1IAW A;  2HS5 A;  4UXN A;  4ESF A;  4KN7 X;  3F3X A;  4WXD A;  3M8F A;  1KGS A;  2W24 A;  1XB4 A;  2VBY A;  2Z3Y A;  5CLS A;  5ICC A;  1MKM A;  1U6G A;  6PAX A;  2X4H A;  3EDP A;  5LGN A;  1RZ4 A;  1J7K A;  1Z7U A;  3JSO A;  3QPH A;  3TO7 A;  3F8M A;  4ZZL A;  1IN7 A;  3G3Z A;  4GXO A;  4OOI A;  1R00 A;  1YQA A;  3V7S A;  1T2K A;  5E17 F;  2IPQ X;  3WTY C;  3FXR A;  4EM0 B;  2UZK A;  4KT5 C;  2GA2 A;  2BYV E;  2XAH A;  3CJN A;  5F1R A;  2V6C A;  2OZU A;  5CVV A;  4RS8 A;  4XSX F;  1OYI A;  4HOB A;  1FOK A;  1Y0U A;  2PJP A;  5H6Q A;  4IHS A;  3KP3 A;  1ZRD A;  1CGP A;  1ZH5 A;  2XRO A;  4L9T A;  2BEO A;  3KP6 A;  2ACJ A;  2PMU A;  2QEN A;  3BDD A;  4EGY A;  1YG2 A;  3BY6 A;  4P55 A;  3F22 A;  1R58 A;  2YX4 A;  2DW4 A;  1ZLK A;  5LGU A;  1STZ A;  5HLH A;  3WTV C;  4MGR A;  1IXS B;  1S6L A;  4DQ2 A;  2ETH A;  4LJZ F;  3P9I A;  3HTU A;  4D0P A;  1YYV A;  2EFN A;  2BE5 F;  4U0W A;  3E6C C;  4HBL A;  4L9V A;  4CYD A;  3S2W A;  1W4M A;  1S7O A;  4A0Y A;  5L3D A;  5KVR A;  4YII A;  5A2Q Z;  5JI6 A;  1D5V A;  3LST A;  4XBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...