4PZJA

1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
69
Chain Sequence
MLDFRVETFLTVRTMNYTRAAEELNITQPAVSQHIAHLERDYGVPLFAYRNKKLQLTDAGALLRDALST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.60 Angstrom resolution crystal structure of a transcriptional regulator of the LysR family from Eggerthella lenta DSM 2243
rcsb
source organism Eggerthella lenta
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
total genus 22
structure length 69
sequence length 70
ec nomenclature
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pzjA00
3K1PA 4L9TA 2BE5F 2VODA 3KEOA 1ZN2A 3K9TA 2VXZA 3WTTC 5LGTA 2HOEA 2RNJA 2ESNA 4RB3C 1Z6TA 5J8CA 3BY6A 2RVCA 4RGUA 5ICCA 1LDKB 3WE3A 3L2CA 1IXCA 3EETA 2QQBA 4NB5A 4I7HA 3CTAA 5BOXA 2LDUA 2O8XA 1IUYA 1TQPA 2V6CA 2H09A 5CLSA 1YQAA 1T2KA 1BI0A 4RGXA 4I01A 3V8JA 3M9AA 1U5TB 3V7CA 2ZXJA 1P6RA 3ISPA 2ZFWA 1GVJA 1Z91A 1R58A 2FE3A 4IF4A 2FQ3A 1R1VA 2HWVA 2PJPA 1FSHA 1ODDA 2IP2A 2KIMA 3TO7A 1YS6A 4MGRA 1XMKA 2DFIA 3KP7A 3GFLA 3MZHA 1S29A 4JK1X 1B9NA 4OIRF 5FD6A 3KP6A 5E8IA 5FO5A 3TGNA 2A69F 3CLOA 5HLIA 1YYVA 4A0XA 2NNNA 3QPTA 1ON1A 4BHBA 3F22A 2L02A 3HHHA 2PFBA 3R0JA 2OQRA 2VOOA 1D8KA 5D5XB 1TNSA 2VC1A 4BHCA 4QWQA 1BC7C 2PN6A 1R1UA 4O5VA 4LLLA 5ILSA 2VBWA 3GFMA 1BIBA 3C7JA 4OINF 1IN6A 4P55A 1USSA 2FU4A 3IC7A 4YIFA 4UVCA 4EQQA 3IKVA 3F3XA 4ASNA 3J81K 2VT2A 4HDVA 4YIIA 5L3GA 4P9FA 2F5EA 5LGNA 3LSTA 4TV7A 4IHSA 3BPVA 4CZZA 1HKSA 3ROUA 2QM3A 2HS5A 1XDUA 1U6GA 3CUQA 1O3SA 1G4DA 1J7KA 3VODA 4QLCU 4I0BA 2Q8KA 3EUHA 3NEUA 2HZTA 4HA8A 2QQAA 4KN7X 2FF4A 2QWWA 1L3LA 4CHUA 5H6QA 2Y48A 1Y0UA 4YG2F 2MA3A 2WWYA 2ESHA 3MCZA 1HW1A 2KIFA 2XHKA 3LAJA 2STTA 4RAZA 1U5TC 1XGNA 2EFOA 3KFWX 1S6LA 4ZZLA 1P92A 5KK1A 3ZQ7A 3MQ0A 2XAHA 4HZFA 3V8KA 3J80K 2O3FA 2H94A 3KP5A 3HTUA 1W5SA 3DKWA 3ZMVA 3F23A 1LDDA 4KT5C 2YSRA 3E97A 3O6BB 5LEKA 5H6RA 2L54A 4KUMA 3MFKA 3BJOA 2O6GE 3I71A 2A6HF 2A6EF 2ZMEA 1XSXA 3KP4A 1IRFA 4LK0F 4UV9A 2X0LA 3M8EA 4IRHA 2Y75A 3OV8A 3F6VA 5FFZA 1ZRDA 2EFPA 4EVIA 3SZPA 4EM0B 2DU9A 1S8NA 3C3WA 1HBXG 4YFKF 1YG2A 2L3DA 4P9UA 4M71A 2MLGA 2QBYA 4WCGA 1F1ZA 2FRHA 1TLHB 4CO8A 2IA1A 1JXSA 3E3VA 4Q4ZF 1DP7P 5IT9Z 4M9ZA 1STZA 2W84A 3BOQA 2D45A 2QLZA 2QQ9A 3HSRA 1W7PA 1FLIA 2IRFG 3FMQA 1KU9A 4FX4A 5CJ9A 1QGPA 1H9TA 1KYWA 4Y13A 3TOAA 1OYWA 2RKHA 1SFXA 2V79A 1IW7F 1OMIA 2P5VA 1RUOA 3DQVC 1FWZA 4JBAA 2GZWA 4JQFA 5E17F 2PMHA 3FXRA 3RYPA 2HGCA 3HUGA 5FLXZ 3SFZA 4EJWA 4AIJA 3F8MA 2F2EA 2XAGA 3RDIA 4I0AA 1K79A 1FYKA 4KIBA 4OU0A 1GXQA 2A07F 1PP7U 2ZNYA 2G9WA 2VBZA 3RI4A 3RKYA 2P6SA 2Z5UA 3TQNA 3VOEA 4L0ZB 1FNNA 1OPCA 1G6NA 1R7JA 1GHCA 2OU2A 4GCVA 5D8KB 2UXNA 3U9GA 4PZJA 1XSVA 2IPQX 1HSJA 1TW2A 1KU3A 1ZHFA 1TNTA 1LEBA 1XCBA 1MGTA 3FXUA 3LFKA 3HOSA 3CUQB 5TJJA 3FMSA 4MEYF 3HRTA 2L01A 2OD5A 2VC0A 1RIOH 1PP8F 3BPXA 2V9VA 1MDMA 1YLFA 3GZ6A 3KCCA 4XLPF 3M8FA 2CYYA 5E8GA 4ENNA 1J9IA 1K78A 5D5WB 4MQ9F 3I5UA 1B59A 1CGPA 5D6EA 3GX4X 3U1DA 1H0MA 1CF7B 3BZ6A 4LLNA 2DI3A 5CYVA 3FM3A 4G94A 3ERED 3JW4A 4GYGA 4MTEA 1IN7A 4Y17A 1SD5A 4IXAA 1R22A 5LHIA 2CW0F 3MEXA 4GXOA 1W7PB 3BP8A 4OIQF 2DLLA 2DQRA 4HX4A 4R1HA 2LF8A 2VT3A 1JGSA 3DP7A 4ETSA 2CSOA 1H9GA 3I53A 4LG0A 4KFCA 1TTYA 4ESFA 3V7SA 5LHGA 1XSDA 3K1NA 3ULQB 3O3KA 4KYWA 1BI1A 3PQKA 1F9NA 2ISYA 3QU3A 1V3FA 2EB7A 3H92A 2P7CB 2OAZA 3RKXA 2FBKA 2M5WA 3BJ6A 1I1SA 5ED4A 2P8TA 2C6YA 1QO0D 2DQLA 2STWA 3SXYA 2DTRA 1YW9A 4OIPF 1XCVA 4ENJA 4LG0B 1KQ0A 4LB5A 3FZVA 1IF1A 3WTYC 2DAOA 5ILVA 2MD5A 1SD6A 2ZBKA 3I54A 5DCFA 4RS8A 1UCRA 3ZPLA 5DCMB 2H6CA 3R0AA 1QZYA 3WTXC 2O03A 3E5QA 1WRJA 2HFHA 1D8JA 4ENKA 4HF0A 4BNCA 1U8RA 3L09A 3FX3A 5J8FA 1LVAA 1PUEE 1TBXA 2D2WA 2IA0A 1R36A 2TDXA 4A0YA 1XN7A 3JTHA 4ON0A 2A5YB 2MH9A 4N9HA 3E6MA 1Q1HA 1T0FA 3HOTA 2BGCA 3F8NA 4ESBA 1LDJA 2M30A 1PDNC 3VEPA 3JSOA 1YIOA 2D1VA 2ZNZA 1OYIA 1JHHA 3D5LA 5BS6A 1FYMA 2QUFA 2L4AA 4LJZF 4HV5A 3GWZA 1U78A 2ZMEB 3V8LA 5EEGA 4LD5A 1IAWA 4U88A 1ZGAA 3N97A 1FC3A 2CFXA 2WC2A 2VOPA 1FY7A 2IVMA 2R7FA 2EA2A 3DPTA 2PI0A 1EH8A 4AWXB 3QOPA 2HEOA 3M7GA 1QNTA 5IT3A 3HSFA 3RKWA 5A2QZ 2J5PA 4A2UA 4WF2A 3FMRA 4ZH4F 4IRGA 1J5YA 5HDKA 3I0TA 2GIVA 3SQNA 3PQJA 4KN4X 1K7AA 2OA4A 4KA4A 5K5RA 5IT9K 1Z6RA 4FX0A 1IN4A 3KLNA 1FP1D 2K02A 3FM5A 4EM1A 1I6XA 1OKRA 1R00A 3WTZA 1J0RA 2MC3A 3T8TA 3Q9SA 4HW0A 5CVVA 3F21A 1W7PD 4EJTA 5A2QK 3ZMTA 2X4HA 4N9IA 5F6FA 4AIHA 3LA3A 5E1XA 5HLGA 2KIUA 1REPC 1DDNA 3DFGA 3F72A 2GXGA 2FBHA 5FB2A 2JRTA 2HTSA 2EFWA 3CO7C 3LQQA 4WXDA 3I59A 5HOOA 4G7HF 4HF2A 1QQIA 5FLXK 4GO1A 1USTA 4BHPA 1WI9A 4RAYA 1O7LA 2PQ8A 5HDNA 2P4WA 3T8RA 3WTWC 4L9NA 5HS7A 3I58A 4ESJA 3T0YA 4HQMA 2JPBA 3ZN0A 2A61A 3HRSA 1ZLKA 4HOBA 1R5GA 1HW2A 1P4WA 3WTSC 3MWMA 3G3ZA 5D5VB 2EV5A 1FPQA 2AXLA 3M1EA 1SFEA 3L7WA 1FBUA 2FMYA 5E20A 3BDDA 1RNLA 4A5MA 3E6CC 1O3TA 1FBSA 2LNBA 4GYIA 2QYOA 1MJAA 1ON2A 3W6JB 1O3RA 2NRAC 3LQRA 3TDZC 2HQRA 3U2RA 1G3YA 5L3FA 3IHUA 4ZYEA 3LAPA 2DBBA 1LQ1A 1OYYA 3DV8A 2GXBA 1UFMA 1KQ9A 4H0EA 1AWCA 3E5XA 4KNYA 2ETHA 2JT1A 5TRDA 2XAQA 1SMYF 2XASA 3HSEA 2GAUA 2NNYA 4L9VA 5H20A 1BJAA 1KGSA 1E2XA 1LEAA 1BN5A 5ERIA 2VE9A 3LA7A 1BC8C 3F8CA 3WGIA 4UHTA 2G7UA 2E1CA 3AAFA 3N4MA 3HHGA 5DDGA 2YPRA 1TQMA 1FSEA 4U0VA 2RGVA 2YX7A 2A68F 1W5TA 1WWXA 5CVRA 3FHZA 3MAJA 3J7AO 4XRFA 1MJ9A 2K4JA 5LRSA 5ICEA 4BYYA 2QENA 2WTEA 2GWRA 4OMZA 4MHGA 5D5UB 2H6BA 4NQWA 1MD0A 2JSCA 3HTSB 1FT9A 3DEUA 4UV8A 1F4KA 1E17A 2W24A 4Q47A 4PGHA 1G3SA 3G73A 2V1DA 1J2XA 5L3CA 2ADUA 4R8HA 4KIGA 4HQEA 4OOIA 1ZRFA 4U0YA 3J81Z 5BPIA 2BEOA 1S7OA 4MNUA 5DUKA 3SHFA 1YW8A 4BQAA 2HKXA 4LB6B 3P9KA 2K4BA 5HS8A 1ZRCA 4HAMA 2LSOA 4AD9A 1ONVA 4EM2A 2GA2A 3QRFF 3PFIA 2EV6A 4P96A 2O0YA 3CUOA 4PCQA 2HDCA 2BV6A 1C0WA 2P5LC 2XAFA 4UUVA 2MBFA 4G7ZF 5LEJA 1YFHA 4EGYA 3LWFA 4M9SA 1F5TA 1ZYRF 1G3TA 3VFZA 2HYFA 2Z9OA 2ZKZA 4O6JA 5D8LB 3KLOA 2FMLA 3R6SA 1JHFA 1OR7A 1EH7A 4L5JA 5AONA 4A0ZA 1J59A 2COMA 1YW7A 2Z99A 3IRQA 2NAZA 4MTDA 4M6YA 3WTUC 1XB4A 4HLYA 4YFXF 3HRMA 1I1GA 2ZCWA 3GVAA 4U7BA 1T98A 3NQOA 5JI6A 3GO5A 2KRFA 4LFUA 3HYIA 3GUDA 4ZYDA 4Y15A 1J75A 2P7VB 3GLXA 1U5TA 2FNPA 4ENMA 1ZG5A 2DK5A 1RZ4A 5DV5A 1XMAA 4IJAA 2XRNA 3KETA 3T5XA 2MH2A 2FXAA 4CDGA 4HYEA 2NYXA 1QBJA 2VBXA 4KMUX 4ZYGA 4CGZA 3Q5FA 2XV4S 3RPUA 4EGZA 1R5HA 5DYMA 3ZMSA 1FP2A 4RB1A 2BYVE 2JZYA 2Z3YA 4S05A 2OQGA 1CF7A 4CICA 3EQLF 3K0LA 4XSXF 5BPDA 3H3ZA 3ABUA 1O57A 4B8XA 4M72A 1I27A 1UHMA 5F1RA 2FEZA 5DD4A 3EDPA 5K5QA 1KQ8A 1XGOA 3O2PE 5E1WA 4IVNA 2HYGD 3GFIA 3K69A 1MDMB 3BROA 1S3JA 4RGSA 3WGHA 2EWNA 3TOBA 2DO7A 1KA8A 4IPAA 4HDUA 3ZMDA 2UWMA 4L5IA 2NS0A 4N0BA 4Q48A 3WTVC 2W57A 3GEZA 3RTRA 1WQ2A 2XIGA 3RPQA 1T6SA 4KIFA 2XROA 4WX9A 1SD4A 4LGWA 2OBPA 4G9YA 4O3MA 5ICFA 2RN7A 1I5ZA 5E18F 2E1NA 3GFJA 3CUQC 2R7DA 4G6QA 3P9IA 2Z33A 3T1BA 4UXNA 4A5NA 2DW4A 3WG9A 2M87A 5ILUA 1R23A 5HDGA 2OZ6A 2GQQA 2DPDA 2W25A 4PDKA 4ZZDA 2F5CA 3D0SA 1ZREA 4OIOF 3QU6A 3OOPA 4LLGF 1U2WA 1VTNC 2VBYA 3CO6C 1FOKA 5LLQA 3TDUC 1HXDA 3WU0A 2HQNA 1JE8A 2EJRA 1P2FA 1SAXA 4BH9A 2HKOA 2K7LA 4WWCA 6PAXA 3P7NA 5JHUA 3JSPA 2RQPA 3ELKA 4E70A 4M74A 3C18A 5CVUA 1P4AA 3E6BA 2MLKA 2QBYB 1G3WA 1KU7A 2ZJ2A 3HRUA 1XGSA 4I2OA 4CYDA 4I98B 2ACJA 1FBQA 3F8FA 1IXSB 2FSWA 4KICA 1XGMA 2PMUA 4UNOA 3RIRA 4M73A 3RJPA 1DPUA 1U3EM 4GGGA 4EJUA 3DXJF 1FX7A 4HF1A 3JAMK 1BIAA 1FYLA 2IT0A 1S7AA 5BMZA 1IZ1A 4K2EA 1A04A 3L9FA 4EV0A 4G6DA 4G8XA 4WXCA 1MJBA 3GW2A 4FHTA 2IW5A 5BQTA 2YR2A 1D5VA 1WSUA 3ABTA 1XD7A 1IRGA 3COAC 3WE2A 2M1BA 5LRRA 2L4MA 1BI3A 2VN2A 2FBIA 2E7WA 4LMYA 1O3QA 5ICGA 2B0LA 2IJLA 2V1UA 3Q9VA 1HKQA 4XBFA 3GF2A 4EJVA 4R79A 1LB2A 1Z7UA 3KP2A 4DQ2A 1ZG3A 2CO5A 2BBYA 4UVBA 4F7ZA 2LKPA 2DK8A 4U7DA 3ML6A 2A3SA 1TW3A 3GZ5A 3P9CA 4P5OA 2WV0A 1HKTA 4Q5SF 3TKYA 3LA2A 3B73A 5FGMA 3TO9A 3ZN1A 3VB2A 2XUBA 2CQKA 2CWEA 2E7XA 5AIPA 4HLXA 4RB0A 1FZPB 1WKMA 5HLHA 4MEXF 3R61A 2GA1A 5F64A 4UVAA 4Z2YA 2UXXA 3F6OA 2V1XA 1ZH5A 4I09A 3GYHX 2XAJA 5D6FA 4A6EA 3QP6A 3HIFA 5CVIA 1B9MA 2Q0OA 4EJOA 3IRRA 1IN5A 1MKMA 1B6AA 1K6OA 3EYYA 2M45A 2DT5A 3FWEA 2Y0MA 2F5FA 1BBYA 3I4PA 1MZBA 1ULYA 2DPUA 5LHHA 4HX8A 1SFUA 2J5OA 2PLYA 4L18B 3FF5A 2PEXA 1K78B 1XDSA 5L3DA 1SMTA 1ZLJA 3DF8A 4YFNF 4PGGA 4CXFA 1IXRC 1YTYA 2IA2A 3ZP5A 5D4RA 1O7FA 4A12A 1KU2A 1QPMA 5CVJA 2O61A 4G7OF 3MZYA 2AS5F 3CDHA 3BJAA 3ECHA 1W4MA 2R3SA 4LK1F 2PG4A 2F5DA 5JR3A 1BOAA 1SD7A 2P6TA 2ZO4A 4U0WA 1UB9A 4IHTA 1B4AA 4A6DA 1V4RA 3QAHA 2EFQA 5D4SA 2FA5A 2KKOA 1UHWA 1GXPA 1P4XA 4XSZF 5DUIA 4BXUA 1BM9A 4AIKA 1X3UA 2G7HA 5HVQC 1Z05A 5J6XA 1BI2A 1Z9CA 1ZG1A 3L00A 3WODF 3KZZA 1HW5A 2W85A 1DPRA 4DNCA 1NHAA 3V4GA 4EMSA 4MQVA 3ZMZA 3EYIA 4HV6A 1ZGJA 4FT8A 2JTVA 5LGUA 4HBLA 5JFRA 2K86A 5FFXA 4S04A 4L9JA 1T39A 5E1ZB 3ZMUA 1RUNA 3JTGA 2RV8A 4L0YB 1T38A 3J80Z 1LJ9A 2JPCA 3E6DA 2KJCA 2QZ8A 2HTJA 2OZUA 3REOA 3S2WA 5JVTA 3C1DA 3WU1B 4ZYHA 1ZAOA 3R60A 3IKTA 5DD8A 5K1YA 3I64A 3DPLC 1ZARA 1KYZA 5HS9A 3TO6A 4I02A 3F8BA 3IWZA 2CGPA 3E5UA 2RC4A 1QZZA 4XLNF 1YS7A 2EK5A 2HR3A 3B02A 2Q2EA 2H27A 5L3BA 5EEHA 2UZKA 1YO5C 3QPHA 3K2ZA 1IN8A 2EV0A 2EFNA 1HSTA 4WK8F 3FXQA 4IRIA 1L0OC 2RDPA 3RYRA 4AVPA 2CG4A 5DCMA 3IL2A 2D1HA 5FD5A 5L3EA 3CJNA 4B09A 2PBIA 3KZYA 5AIQA 4BAYA 4D0PA 5K5OA 2QVOA 2XKOA 3QP5A 2YU3A 1B1BA 1TQIA 3KP3A 2ISZA 2VONA 3H3UA 4RGRA 2M8EA 2P5KA 1DUXC 2YX4A 2FOKA 3I59B 4OMYA 4M6XA 1Z1DA 2XGXA 3IWFA 4WXHA 1EV7A 1EH6A 4KMFA 3SZTA 3R4KA 3W6KB 2XKPA 3V7RA 3BWGA 2FNAA 4RB2C 3GXOA 4M9XA 1LNWA 3KEQA 5DEQA 5KVRA 4NHJA 5LBQA 4HX7A 1R1TA 2VE8A 3JAMZ 2LF7A 2EA4A 1RI7A 1D3YA 2ELHA 1HQCA 3KE2A 1AOYA 3NRVA 3WGGA 2KJBA 2XVCA 2K27A 4KDPA 3ECOA 3K1MA
chains in the Genus database with same CATH superfamily
1X2NA 1Z7LA 3KYDB 3CC7I 1A6QA 2OJED 4BS9A 3K70D 3K1PA 4L9TA 2BE5F 1UELB 2VODA 2XPUA 3KEOA 4IHVA 1ZN2A 4GDFA 2JA6J 4IHXA 3K9TA 2VXZA 3S1MJ 3GLLA 5M3FJ 4XOPA 4A3EJ 5FRMA 3WTTC 5LGTA 3IH2A 3HOZJ 3HOWJ 3S32A 1OJLA 2HOEA 1ETKA 2RNJA 3ABMH 3SEQA 1IDZA 4P1WA 2ESNA 4IQ4A 2VPLA 4RB3C 3I56I 1VQNI 1Y0NA 1GV2A 3UR3C 3PUBA 1Z6TA 5J8CA 2VASA 3BY6A 3PIPF 2RVCA 4RGUA 1TWFJ 4AIDA 2R5YB 2F4MB 1V5GA 3UNGC 2IEKA 3QWLA 5ICCA 1LDKB 4IEJA 3WE3A 1IXCA 3EETA 2QQBA 3L2CA 2BOLA 4W1UA 4NB5A 2L5QA 2HVSA 1T95A 3DLAA 3QYBA 3K10A 5FLVA 2IS2A 4XRMA 4I7HA 5IYBJ 3CTAA 3GMEA 1VQLI 5BOXA 1A5JA 2LDUA 2O8XA 3OYKA 3A4CA 2E1MC 1IUYA 1TQPA 2V6CA 1N75A 3IH4A 1Y1VJ 2H09A 2BXZA 3PJRA 5CLSA 1YQAA 2LLKA 1T2KA 1BI0A 1SFOJ 4RGXA 3HJEA 4I01A 3IV5A 3L2VA 3V8JA 3M9AA 4BXXJ 2EH3A 3BG7A 1U5TB 1VF9A 3ZXSA 3V7CA 3NAUA 2JVGA 1SVLA 2ZXJA 1P6RA 3ISPA 3ZQGA 2ZFWA 1GVJA 2R7VA 1Z91A 1X19A 2M4GA 4JX4A 1R58A 2FE3A 1JJ6C 4IF4A 2FQ3A 1R1VA 2HWVA 2QF7A 5E79C 3FHNA 2PJPA 1FSHA 3LSIA 1ODDA 2IP2A 2KIMA 3HM5A 3G4SI 4QIWN 1OR7C 3TO7A 4BQQA 2XF6A 1YS6A 4MGRA 1XMKA 4C30A 4F3QA 2DFIA 2K9MA 3KP7A 3GFLA 1EJ9A 3MZHA 1XS9A 3BQZA 1JGGA 1S29A 4JK1X 4FE7A 1B9NA 4JX6A 4OIRF 3S93A 5FD6A 1LFPA 2YUSA 2VQCA 3KP6A 5E8IA 4IL6C 5FO5A 3IP4B 3TGNA 3PM1A 2A69F 3CLOA 3DTEA 5HLIA 1YYVA 5M5YJ 4A0XA 1NK3P 1Y8RB 2NNNA 1QRYA 2PJRA 3QPTA 1ON1A 5GP9A 4BHBA 4C2TA 3FXKA 3HOYJ 3F22A 3PNYA 1LUJB 2CU7A 2L02A 3HHHA 2PFBA 3R0JA 4MO7A 1UZCA 2OQRA 4X0GA 2VOOA 1D8KA 5D5XB 5B5EC 1TNSA 3FXMA 2DMUA 1ZELA 2VC1A 4BHCA 2Q1ZB 5F27A 5IPAA 4QWQA 1BC7C 2EZHA 2PN6A 1R1UA 1X3WB 4O5VA 5B3SH 4LLLA 5ILSA 2VBWA 3GFMA 4QPOA 1BIBA 3C7JA 4I6ZA 4OINF 2HXIA 1IN6A 2ZMEC 3O8HA 4P55A 2NVTJ 2WAEA 1USSA 5F0FA 2FU4A 3ZQHA 3IC7A 1W36D 1ETXA 4YIFA 1MBKA 4XKWA 2LR8A 4UVCA 4A3KJ 2TRTA 1VQKI 2DMPA 4EQQA 4IHWA 2Y31A 3F3XA 3IKVA 4ASNA 4JP0A 2RREA 3CCUI 3GTQJ 3WHCA 3J81K 2VT2A 2IGKA 4HDVA 4YIIA 1A36A 1Z21A 4LIVA 5L3GA 2DJIA 2R7XA 2M7BA 2EILH 4P9FA 2O7OA 2F5EA 3QYEA 2DCEA 5IP7J 5LGNA 3LSTA 4TV7A 1YOVB 3OYJA 3FBNB 3VYTB 4IHSA 2UUZA 1VQ6I 3BPVA 4CZZA 1HKSA 3ROUA 3SDGA 4A69C 2QM3A 2X6YA 2HS5A 1GLNA 1BOBA 4YRVA 1XDUA 2LRDA 1K6YA 1X2MA 1U6GA 3CUQA 3GTMJ 3GTOJ 1O3SA 3DBRB 4IHYA 1G4DA 4A93J 2DA5A 1J7KA 3VODA 4QLCU 2DDBA 3FXLA 3FBIB 1T8IA 1DGRM 3BTLA 4I0BA 2IS1A 2Q8KA 2DN0A 3H9GA 3EUHA 3NEUA 2HYJA 2HZTA 4NUBA 4HA8A 2QQAA 4KN7X 2KP6A 2WB1A 1YJNI 3FKJA 2FF4A 2QWWA 1L3LA 2R7TA 4HNUA 4CHUA 5H6QA 1W0TA 2Y48A 4Y33A 1YITI 2ZSIB 1Y0UA 4YG2F 4A3JJ 1UAAA 2QSHX 1M1EB 2MA3A 2WWYA 2ESHA 3MCZA 4CZCA 1HW1A 2KIFA 2XHKA 3Q0VA 1D1AA 3LAJA 3LOCA 2DA6A 4RAZA 2STTA 1U5TC 1XGNA 1QHGA 2CFOA 2EFOA 3KFWX 1S6LA 3CESA 4RAGA 4ZZLA 1P92A 5KK1A 3VDXA 3ZQ7A 3MQ0A 4M6VA 2XAHA 4HZFA 3V8KA 3J80K 2O3FA 4Y3OA 3VSLA 2H8WA 2H94A 3KP5A 2JA5J 3HTUA 1W5SA 3DKWA 3ZMVA 2Y9YA 1P7JA 2KLOA 3F23A 1GVDA 2MD0A 2JUCA 2MC4A 3TL4X 2EZKA 1XX5A 1LDDA 1HF0A 4KT5C 2MG4A 1AKHB 2YSRA 3VWBA 3E97A 3O6BB 2R5ZA 5LEKA 5H6RA 2L54A 5M5WJ 4KUMA 3MFKA 3BJOA 5J4YA 2X9DA 4LG3A 2O6GE 4ZJZA 2H1KA 1RC9A 3I71A 2A6HF 2OC6A 4F91B 2A6EF 5EF6A 4HG2A 2A6TA 4D5CA 2MGQA 1XSXA 2ZMEA 1OCTC 3RSNA 3IUOA 3KP4A 4AVZA 1IRFA 4LK0F 1K83J 4UV9A 2X0LA 1ORKA 3M8EA 4X6AJ 4IRHA 3OYDA 3OWTA 2JWTA 2X51A 3HKZN 2Y75A 3OV8A 3F6VA 1WJFA 3N05A 5FFZA 4JYKA 2BY3A 1ZRDA 4XLCA 3TMOA 2EFPA 4EVIA 3SZPA 4EM0B 1WPKA 2ZJQF 1IV8A 3V42A 2XF7A 2L9RA 2DU9A 1S8NA 3C3WA 4BEHB 3OYIA 1HBXG 4YFKF 1MBHA 1YG2A 2L3DA 3BTIA 4P9UA 4M71A 2MLGA 2QBYA 2DT6A 2ID3A 3H0DA 5B1BH 4WCGA 4XLEA 1F1ZA 3CMYA 1YRNA 2FRHA 1U9NA 1TLHB 4CO8A 2IA1A 1JXSA 3E3VA 4FETA 1HDPA 2CRGA 4Q4ZF 1DP7P 5IT9Z 4M9ZA 2DODA 2LG4A 1ACIA 4BJ6C 2QA4I 3CCJI 2XAUA 1STZA 2K3FA 2W84A 3BOQA 2D45A 2ECBA 2QLZA 2QQ9A 3CC2I 2LBFB 2LY9A 4PFPA 3HSRA 1ZTRA 2XC7A 5FROA 1W7PA 2M0MA 2JA8J 2CW7A 2LOOA 1APLC 1S7EA 1FLIA 2IRFG 1Y39A 2FQ4A 5C44J 4BJ5C 3A0HC 1MW7A 3FMQA 1KU9A 4XL9A 3K4KA 4FX4A 3G1MA 4QPQA 5CJ9A 1QGPA 4QSHA 1H9TA 1KYWA 4Y13A 3LSKA 3TOAA 1OYWA 2HNHA 4XLHA 2RKHA 1SFXA 2V79A 1IW7F 1OMIA 2P5VA 1RUOA 3DQVC 1FWZA 4MFEA 5F0HA 4A3LJ 4JBAA 2GZWA 4JQFA 5E17F 2PMHA 3FXRA 3RYPA 2HGCA 3HUGA 5FLXZ 3OIPA 3SFZA 5B1AH 4EJWA 3BZKA 4AIJA 2Y9ZA 2DMQA 3F8MA 1QPIA 2F2EA 2XAGA 3JRIA 2WY8Q 3RDIA 4I0AA 4MLOA 4NC6A 1K79A 1FYKA 4KIBA 4OU0A 1GXQA 2ZXHA 2A07F 5C4XJ 3C2HA 1PP7U 2ZNYA 2G9WA 2KRCA 2VBZA 4G6TB 2CV1A 4BDYA 3RI4A 3RKYA 5JVGF 5LD2C 2P6SA 2Z5UA 2DA3A 3TQNA 3CJRB 5GADJ 4RDUA 3VOEA 3CCRI 3DEWA 4L0ZB 1FNNA 4D1QA 1OPCA 1G6NA 1R7JA 1GHCA 3W2WA 2OU2A 4GCVA 5D8KB 2UXNA 3U9GA 4PZJA 1XSVA 3QYFA 2IPQX 1HSJA 1K61A 3BTCA 1TW2A 1KU3A 1UHSA 4DYRA 1X1BA 1ZHFA 1TNTA 1LEBA 3M3YJ 1XCBA 1MGTA 3FXUA 1N25A 2K5CA 1GT0C 3LFKA 1XMXA 3HOSA 3CUQB 5TJJA 1MMNA 1FIPA 3FMSA 2L9NA 4DZJA 4MEYF 3HRTA 2L01A 2OD5A 2R5YA 2VC0A 3HGYA 1RIOH 1PP8F 3K70C 4V2GA 3BPXA 2V9VA 1MDMA 1YLFA 2L9SA 4J00A 2QCOA 2BY0A 1JKRC 3M4OJ 3GZ6A 1I6HJ 2M4KA 3KCCA 1GUUA 5J40A 3AG3H 4XLPF 3M8FA 3ZQIA 2CYYA 1Z67A 5KAFC 3LSMA 4PJMA 2LD5A 1J09A 5E8GA 4ENNA 4IOAF 2NS7A 4XORA 1J9IA 3G6EI 1K78A 1MH4A 1IDYA 4DBRA 5D5WB 3CF5F 3NWTA 2L7KA 3CP8A 4DJAA 5DS9A 4MQ9F 2NVXJ 3HUGB 3I5UA 1B59A 1CGPA 2F48A 5D6EA 3GX4X 2HOTA 3U1DA 5EDNA 2JUGA 1H0MA 3BZ6A 1CF7B 4LLNA 2CV0A 2DI3A 5CYVA 3FM3A 1R71A 1YJ9I 3S2DJ 4G94A 2CUFA 3ERED 3JW4A 3ZOBA 4GYGA 4MTEA 1FOWA 2ZC2A 1IN7A 1V5EA 1IGNA 4Y17A 2M8GX 1SD5A 4M3GA 4IXAA 1TWCJ 1R22A 2CH0A 5LHIA 2CW0F 3O8GA 3EUAA 1ZQ3P 2EZLA 3MEXA 4GXOA 1W7PB 3BP8A 3PNVA 4OIQF 2DLLA 2DQRA 4HX4A 4R1HA 5EEAA 5HNFA 4YIRX 2LF8A 3FK6A 3HKZA 5J1YA 3KX2A 4OWRB 3RQ4A 3L2WA 2VT3A 1JGSA 3DP7A 5J3LA 4ETSA 2CSOA 3BR6A 1H9GA 2NVYJ 3I53A 3J7YJ 4LG0A 4KFCA 1TTYA 4ESFA 3V7SA 5LHGA 1XSDA 3K1NA 3ULQB 2KQRA 2FX0A 3O3KA 4KYWA 1BI1A 3PQKA 3JRCA 3JR9A 1F9NA 2ISYA 3ZQLA 1R5ID 3QU3A 3TW6A 1V3FA 2EB7A 3H92A 3RKXA 2OAZA 1LPQA 2P7CB 2FBKA 4CYCB 3CLQA 2M5WA 3BJ6A 1I1SA 5ED4A 2P8TA 1XTAA 1BW6A 1QO0D 1UG2A 2MABA 2WV1A 3TEDA 1V55H 3PUFA 2C6YA 2XGDA 4RM3A 1MBGA 2DQLA 3S2HJ 2STWA 3OYMA 2MSYA 2ID6A 3CMMA 2W82A 3KYCB 3SXYA 1DQUA 2DTRA 1YW9A 5GAHJ 1XCVA 4OIPF 2LH9A 3GTGJ 4CUGA 4ENJA 4ZDPA 2W48A 4LG0B 1KQ0A 1UJ8A 3BCBA 3FZVA 3VYRB 4LB5A 1IF1A 3WTYC 2DAOA 3QQAA 4RAFA 4A3CJ 5ILVA 1WHUA 3EUKL 1OCZH 2MD5A 3I3LA 1SD6A 2ZBKA 2JN6A 2CMPA 3RZOJ 3I54A 1MMDA 5DCFA 1P9QC 4RS8A 1UCRA 3ZPLA 3ASOH 5DCMB 5F0CA 3ZCOA 5E3NA 4NC7A 5IOZA 3AKZA 2H6CA 3R0AA 4KT6A 2OTJI 2R7UA 1QZYA 3K2AA 3H0GJ 3WTXC 2AHQA 1WJDA 2O03A 3E0JB 2JMWA 3JRFA 3E5QA 2JA2A 2CJJA 4QTRA 1WRJA 2HFHA 4DW6A 1D8JA 1YX5A 1JUPA 3W2AA 4DIQA 4ENKA 4HF0A 4BNCA 1TWHJ 1U8RA 3L09A 3NARA 2KISA 3FX3A 4M3BA 5J8FA 4HNVA 2V9KA 1U0JA 1LVAA 1VZ0A 1PUEE 2X85A 1TBXA 2NOJB 1FJLA 2IS4A 1FOYA 4L5EA 2D2WA 5IP6A 3MMYB 4V2FA 2DDAA 2IA0A 5GPAA 4EATA 1R36A 3L2QA 3FXOA 3GBGA 1T33A 2TDXA 1NG7A 4A0YA 2B7EA 1XN7A 3JTHA 1YE9A 4ON0A 4M3EA 2A5YB 2MH9A 4LOCA 3E6MA 3I9V2 4N9HA 1Q1HA 3AL0B 1T0FA 4YEJA 2DA7A 3HOTA 2BGCA 3OIOA 3F8NA 4HSRA 1YJWI 2NOGA 4ESBA 1LDJA 2M30A 1PDNC 3VSKA 2VJ4A 3VEPA 3JSOA 1YIOA 3GTJJ 2D1VA 2ZNZA 1VQMI 1OYIA 4IO9F 1JHHA 3PO2J 3D5LA 1B8IA 2K3PA 2HPIA 5BS6A 2Z16A 3BQYA 4AC0A 1FYMA 2EBIA 2EIJH 2L4AA 2QUFA 4LJZF 1D0YA 4HV5A 1X1DA 2X6OA 2AO9A 3GWZA 1U78A 2L0KA 2I5UA 2ZMEB 5KAIC 3V8LA 3HOXJ 1WJBA 5EEGA 4LD5A 3SJMA 1IAWA 2BXYA 4U88A 1WJAA 1ZGAA 1BR2A 1I39A 2XRLA 1QVUA 1T0FC 3N97A 1FC3A 2CFXA 2WC2A 3HBLA 4ZC3A 2VOPA 1IJWC 3H35A 1FY7A 2IVMA 2R7FA 2Y69H 4Y4RA 1HA8A 2EA2A 3DPTA 3MVPA 3EPZA 2PI0A 1EH8A 1Z3XA 4AWXB 2LVSA 3QOPA 4CCLA 3M7GA 2BVMA 1QNTA 5IT3A 2F4IA 2HEOA 3HSFA 3RKWA 3S8PA 5A2QZ 1FTTA 4D9JA 2J5PA 4A2UA 4WF2A 3FMRA 4ZH4F 2VKHA 2XGCA 4IRGA 1J5YA 1XPXA 2F5VA 5HDKA 1UG0A 1WFXA 3I0TA 2GIVA 3QOEA 4XMYA 3SQNA 4AYBA 3PQJA 2AQFA 4KN4X 1K7AA 2OA4A 2VJJA 2KDZA 4KA4A 5K5RA 1WI3A 5IT9K 3S1RJ 3MKZA 1Z6RA 4FX0A 1IN4A 2DYRH 3DU6A 3KLNA 1FP1D 2VL8A 3BG6A 2K02A 3FM5A 4EM1A 1W36C 3GTPJ 4BBRJ 1IRZA 4I99C 1I6XA 1OKRA 1R00A 2N8GA 3WTZA 1J0RA 1XC5A 4C2UA 2MC3A 2DXIA 2GBYA 3OMYA 1OQYA 3T8TA 1SC7A 2E5NA 3Q9SA 4HW0A 5CVVA 2E2HJ 3F21A 1W7PD 4EJTA 2YS9A 4XM3A 2V7FA 5A2QK 3ZMTA 4UUSB 2B9SA 3OYAA 4RMNA 2X4HA 4BY1J 4N9IA 3RPUD 1TT5B 5F6FA 2XSDC 3K4CA 4AIHA 3HPHA 2R7OA 1UMQA 3LA3A 2O8KA 4II2A 3WU2C 5E1XA 5HLGA 2KIUA 2VKDA 1DDNA 1REPC 2QSGX 2XDVA 3BG5A 1POGA 3DFGA 3F72A 3SEZA 1E3HA 3E1SA 2GXGA 1BA5A 2FBHA 4RM2A 5FB2A 2OTLI 5DTDA 2JRTA 3ASNH 2HTSA 3OR2C 2EFWA 3P5JA 3CO7C 3LQQA 4WXDA 3I59A 5HOOA 4G7HF 4HF2A 4CYCA 1QQIA 3A0BC 5HLTA 5FLXK 2G0EA 1DU0A 3SDBA 1PUFB 2ECCA 5K7ZA 4GO1A 1TWAJ 1USTA 2O9LA 1QU3A 2LMDA 4BHPA 1WI9A 4PJJA 4ABZA 4RAYA 1O7LA 2PQ8A 5HDNA 2P4WA 3K4NA 3T8RA 3WTWC 4RLQA 2DFHA 2K9LA 4L9NA 1RPWA 3H9QA 3C2GA 1X1CA 2Y2ZA 5HS7A 2DA1A 3I58A 4XNFA 1BJZA 4XLAA 4ESJA 3T0YA 4HQMA 1EKEA 2JPBA 5E3OA 1I3QJ 3ZN0A 2A61A 3HRSA 1JTXA 5FKMA 5C3EJ 2OUMA 1PYVA 1MNEA 4XN0A 1FMWA 1ZLKA 4HOBA 5IYDJ 1R5GA 1HW2A 1P4WA 1Q1VA 3WTSC 3MWMA 4BUPA 4E7HA 3BG9A 3G3ZA 5D5VB 2EV5A 1X3ZB 1IUFA 1Y1WJ 4BXFA 5FJ8J 1FPQA 4X1EA 2AXLA 1T08B 3HC7A 3M1EA 3G1LA 1SFEA 4GFBA 2W1OA 3L7WA 3HEFA 4XR6A 2QQ8A 1FBUA 2FMYA 5E20A 1IC8A 3BDDA 1RNLA 2CQXA 2AQEA 5FKOA 4BL0B 1X58A 2HOSA 4A5MA 2ME0A 2GIZA 3E6CC 1O3TA 1OCOH 2H1LA 1FBSA 2LNBA 4E7ZA 4GYIA 5J47A 2QYOA 1MJAA 4NNJA 1ON2A 3W6JB 3D1NI 1O3RA 2CV2A 3H1CA 2NRAC 3OYFA 3LQRA 5TGTA 1H8AC 3TDZC 4XKBA 1S5LC 2HQRA 3U2RA 2OCEA 2D5VA 1G3YA 1WJEA 5L3FA 3IHUA 3HG9A 4ZYEA 5EJCA 5KNLA 1JJ8C 1WH5A 3LAPA 2DOFA 3CCQI 2X6WA 2DBBA 4UUSA 1LQ1A 1JKPC 4C2MJ 1HCRA 1OYYA 3DV8A 1TL8A 2GXBA 1UFMA 1WJCA 3OY9A 4NQWB 2WAQN 3LSJA 1KQ9A 3S3MA 4H0EA 1AWCA 3E5XA 4KNYA 2ETHA 2JT1A 3BC8A 1IV6A 1SANA 3BZCA 1JT0A 5TRDA 2XAQA 1SMYF 2XASA 3HSEA 2HDDA 3FKIJ 3OYGA 4XRSA 2GXAA 2GAUA 2NNYA 4L9VA 5H20A 1BJAA 3OS0A 3E7LA 4A3BJ 2AXTC 1KGSA 1MH3A 1HC8A 4HSTA 4B48A 3DLLF 3S3OA 1E2XA 1LEAA 1QZEA 1JUSA 2KRHA 2LC2A 4AYBN 5IOYA 1R49A 4N4NB 3B6AA 1BN5A 5ERIA 2EQRA 3KYLA 2VE9A 3LA7A 1BC8C 4UUTA 3HXLA 3ZGKA 1IO2A 3F8CA 3WGIA 3ESWB 4UHTA 2G7UA 4U87A 3DCFA 5C4JJ 1NG6A 1D1BA 4ZTJA 5FKKA 4UY8I 2WY7Q 2E1CA 3AAFA 1YIJI 3N4MA 2V26A 3HHGA 1ETYA 3F9KA 5DDGA 2YPRA 2DA4A 1RKWA 1TQMA 1FSEA 4U0VA 2L2OA 5KHDA 2RGVA 2YX7A 5JLXA 3PIOF 2ZJRF 3AG4H 2A68F 2OV7A 1W5TA 1X1PA 1WWXA 4PJ0C 1PJRA 5CVRA 1PVEA 4JOMA 4BU2A 3OSFA 3FHZA 1G2HA 1LE8B 3MAJA 3S15J 3J7AO 4XRFA 2EZIA 1MJ9A 2K4JA 3CCEI 5LRSA 1G8XA 3OYBA 5ICEA 4BYYA 2QENA 5F1JA 2WTEA 2VQLA 4MIMA 2GWRA 4OMZA 4MHGA 4CCNA 1NK2P 1SFKA 5D5UB 2H6BA 4NQWA 1F43A 1MD0A 5EYRA 1RR8C 2JSCA 3HTSB 1FT9A 3DEUA 4UV8A 1G59A 1F4KA 1F36A 1E17A 2W24A 1Y6IA 2COBA 4Q47A 4PGHA 1G3SA 3G73A 2V1DA 4BBSJ 4DZPA 3G1OA 1J2XA 4AU7A 1B72B 4BGDA 5L3CA 2ADUA 4R8HA 4KIGA 4HQEA 4OOIA 3TP3A 1ZRFA 5EG0B 2NVUB 4U0YA 3J81Z 5BPIA 1OCRH 3CCMI 1MMGA 2BEOA 4PJLA 1VFCA 1PUFA 1ETOA 1S7OA 4MNUA 3H3VK 5DUKA 2R7QA 2NS8A 2JSPA 2R7WA 3SHFA 5LFAA 1YW8A 5GPCA 4BQAA 2HKXA 4LB6B 3P9KA 3JREA 2K4BA 5HS8A 1OISA 1ZRCA 4HAMA 2LSOA 4AD9A 1ONVA 2X48A 4EM2A 4M3DA 3BG3A 2GA2A 2OPTA 3OYHA 4ZDOA 3QRFF 3PFIA 5IP9J 2EV6A 1U8BA 3FISA 1GV5A 2O0YA 4P96A 3CUOA 3DEEA 3K4MA 4PCQA 1A6IA 2M34A 1ZR2A 2HDCA 4I76A 2BV6A 1C0WA 1JI8A 1AHDP 2P5LC 2XAFA 4UUVA 2MBFA 4G7ZF 2FOWA 2P0WA 5LEJA 1YFHA 1DP3A 4EGYA 3PNTA 4BY7J 3LWFA 4IQJA 4M9SA 2HVQA 1F5TA 2GM4A 4XKVA 1ZYRF 2IGOA 1G3TA 3VFZA 2E71A 4ITVA 2HYFA 4LIUA 4PFOA 2ZKZA 4O6JA 2Z9OA 1LE8A 5D8LB 3KLOA 2FMLA 3R6SA 1JHFA 1OR7A 2ZJPF 1N77A 1EH7A 4L5JA 3ERMA 3H9JA 2DMNA 3LFUA 5AONA 4A0ZA 1J59A 4J19A 3H36A 2COMA 1YW7A 3BR5A 2VLAA 1WJ5A 2Z99A 3IRQA 2NAZA 4PJNA 4MTDA 4M6YA 3WTUC 1ENHA 1XB4A 4HLYA 4YFXF 5K7HA 2E35A 3HRMA 1LFBA 3GCMA 2Q2EB 1I1GA 1BR1A 3BCAA 4BE1A 1VQ7I 2I10A 4IZZA 2ZCWA 3GVAA 4U7BA 2E19A 1T98A 3NQOA 4II3A 4E4HA 2VPRA 2CQ7A 5JI6A 3H5RA 3GO5A 2MFZA 2LTPA 1ZKGA 1R6RA 3MZ8A 2KRFA 3D5SC 3HGGA 4LFUA 3HYIA 3GUDA 4ZYDA 4Y15A 1J75A 2P7VB 1FTZA 3GLXA 1U5TA 2FNPA 2VKEA 2F6CA 4ENMA 1ZG5A 1NH3A 3ZRGA 2HOAA 3ZQFA 1HLVA 2DK5A 1RZ4A 5DV5A 1XMAA 3DBLB 4IJAA 1KZHA 2DT7B 4DBQA 2DJNA 2XRNA 2ME6A 3KETA 3T5XA 3MKLA 2MH2A 4E7IA 5IYCJ 3LSHA 1Z77A 2FXAA 2ELKA 2VB6A 2KZGA 4GRIA 4CDGA 4HYEA 4F55A 2NYXA 1QBJA 2WB1N 2VBXA 4KMUX 4ZYGA 1LKXA 1MBEA 4CGZA 3OSGA 4CSWA 3Q5FA 2XV4S 2FJ1A 2L7MP 3RPUA 4EGZA 1R5HA 2LREA 1V5FA 5DYMA 3K7AJ 3A01A 3ZMSA 2E36A 1FP2A 3CDIA 4RB1A 2BYVE 2JZYA 2Z3YA 4S05A 1H89C 2OQGA 2W00A 1CF7A 3A2KA 4CICA 3EQLF 3K0LA 4XSXF 3LL7A 5BPDA 3H3ZA 5H2FC 2QKLB 3ABUA 2GOMA 1W5CC 3RCOA 2WA0A 4NC8A 1O57A 4B8XA 4M72A 1JKQC 1I27A 1UHMA 2PMZN 5F1RA 2FEZA 4KJZA 5HODA 5DD4A 3EDPA 2M7AA 5K5QA 4FCYA 1KQ8A 4AM3A 1XGOA 3O2PE 4NBQA 1Z3YA 1H88C 5E1WA 4IVNA 2HYGD 3GFIA 3CC4I 2FUG2 3MD2A 3K69A 1MDMB 3BROA 4FQGA 1S3JA 4RGSA 1BR4A 3WGHA 4W97A 3AG1H 5CQEA 2E34A 1N78A 2EWNA 4N4OB 3TOBA 3PFYA 3S14J 5TISC 3JRHA 2DO7A 1W1WE 1KA8A 4IPAA 4XRSG 4CA0A 4HDUA 3ZMDA 2UWMA 4L5IA 2Y30A 4E7SA 2NS0A 4N0BA 4Q48A 3WTVC 2W57A 1CQTA 3W6VA 3JCUC 3DU5A 1MIJA 3GEZA 3RTRA 1WQ2A 2BW3B 1P7IA 2XIGA 3RPQA 1T6SA 4KIFA 4XLFA 2XROA 4WX9A 1K4TA 1SD4A 2W4SA 3GTLJ 4LGWA 3TBIA 2OBPA 4DOZA 4G9YA 1ITYA 4O3MA 5ICFA 4E7JA 2RN7A 2E2IJ 1I5ZA 4BEHA 4RBOA 5E18F 3NWSA 2E1NA 3GFJA 2F4OB 2R7DA 3CUQC 3P9IA 4G6QA 2Z33A 3T1BA 1JKOC 2QEXI 3OYCA 4UXNA 2JQ7A 5CKTA 4A5NA 1LVKA 5GAGJ 2DW4A 3WG9A 4FASD 3FK7A 4XONA 2M87A 5ILUA 3EUHC 1R23A 2BZTA 5HDGA 2OZ6A 2ZXWH 2GQQA 2DPDA 3Q0WA 2W25A 3A02A 4PDKA 1I50J 4ZZDA 2F5CA 2E60A 3D0SA 2M9HA 4IX7A 1ZREA 4OIOF 3QU6A 3OOPA 4LLGF 3UKGA 1U2WA 1VTNC 1FOXA 2VBYA 4NDLA 3CO6C 1ETWA 1FOKA 5LLQA 3TDUC 2P81A 1HXDA 3WU0A 2HQNA 1JE8A 1S9HA 2EJRA 4RA2A 4A3IJ 1P2FA 1SAXA 4BH9A 2HKOA 2K7LA 2M3AA 2Y0SA 4OAYA 4PSXA 3W3CA 4WWCA 2CS3A 3BT9A 3CJTB 6PAXA 1GDTA 3TP0A 3P7NA 4ZDLA 3A03A 5JHUA 3JSPA 3K4JA 2RQPA 2DA2A 1Y56A 3HL2A 2JA7J 5K7FA 3ELKA 4E70A 1IG7A 4D7NA 1W0UA 4M74A 1YRNB 2QSFX 3C18A 5CVUA 1D5YA 1P4AA 3E6BA 1YHQI 2MLKA 2K9SA 2QBYB 1NTCA 1G3WA 1KU7A 5F04A 2ZJ2A 3HRUA 5E3LA 4EEFG 1XGSA 3G71I 4I2OA 1R4MB 2DOAA 3CDLA 3VPRA 4CYDA 4I98B 5JHFA 2HXOA 1X4OA 1O4XA 2VQGA 3BR1A 3FIWA 3CCVI 1RESA 1WH7A 2ACJA 2L9VA 5FKNA 1FBQA 3HOUJ 3F8FA 1IXSB 5EG0A 3BR3A 2FSWA 2KZVA 4KICA 3VYUB 1XGMA 2O5RA 4YELA 2PMUA 4UNOA 4B44A 3RIRA 1WCMJ 2IS6A 4M73A 4A3DJ 3RJPA 1DPUA 1U3EM 4GGGA 3OL4A 2MW8A 2E5ZA 4EJUA 3DXJF 1ETQA 4Y7NJ 3DKXA 1FX7A 4HF1A 2ICWG 3JAMK 1BIAA 3WG7H 3S17J 1FYLA 3PSIA 2IT0A 4F92B 3OOUA 3GZNB 4XQFA 1S7AA 5BMZA 1VQ5I 1IZ1A 4K2EA 3OYLA 3AFHA 1A04A 5E3MA 5HNHA 1IRXA 3KPHA 3GTKJ 3L9FA 4EV0A 2JVHA 2L7FP 4G6DA 4G8XA 2DMTA 3LNQA 4WXCA 1MJBA 5F08A 3GW2A 4FHTA 3ZQCA 2BHYA 2IW5A 5BQTA 2YR2A 3MN2A 1D5VA 1WSUA 3CZ6A 2ZB9A 3ABTA 4HEA2 1XD7A 1IRGA 3COAC 3WE2A 1QVTA 2M1BA 4BE2A 5LRRA 2L4MA 3S16J 1BI3A 2VN2A 2FBIA 2K9QA 2E7WA 3ZQQA 4LMYA 1O3QA 4PSWA 2XPWA 4DYQA 3HOVJ 5ICGA 5EGOB 1MMAA 2A05A 2B0LA 2IJLA 3WHBA 4H4KC 5IY5H 4XKCA 1A35A 2V1UA 4C3JJ 4D7MA 2X1DA 1YI2I 2IGMA 3SZGA 4FTHA 3Q9VA 3BLYA 1HKQA 2RQQA 4B3XA 5M5XJ 1RRJA 4XBFA 3GF2A 3A1YA 4EJVA 1D0ZA 4R79A 1WVRA 3Q0UA 3L1PA 1LB2A 4FE4A 1Z7UA 1VNDA 2LYCA 3KP2A 4DQ2A 5FRNA 1ZG3A 2TCTA 2CO5A 1OLTA 2BBYA 4UVBA 4F7ZA 3I4MJ 2LKPA 2ZFUA 2HVRA 3OYEA 1AA7A 2DK8A 3BR2A 3VYSB 2CQQA 4U7DA 2W7NA 4CCKA 5J4VA 1OFCX 2ZXIA 3U1KA 1ERDA 3ML6A 2GLOA 2A3SA 1TW3A 1HOMA 3F0CA 1WGXA 3GZ5A 2V1NA 3P9CA 4P5OA 2WV0A 1HKTA 2K40A 1E3PA 4Q5SF 2GOXB 3TKYA 2LK2A 2HDWA 5B66C 2VQHA 3DBHB 2LFBA 3I4NJ 1ZR4A 3LA2A 2LY2A 3B73A 5FGMA 3FDYA 3QPSA 3TO9A 3D5RC 2RNGA 3ZN1A 4E7KA 4CCOA 3VB2A 4JX5A 3LSRA 2XUBA 2CQKA 2X1CA 2OCCH 2CWEA 1U9OA 2KHMA 3DTIA 1A31A 1EA3A 2E7XA 3SFIA 1R9TJ 5AIPA 2QGUA 4HLXA 4RB0A 4A3GJ 2DOEA 1FZPB 1WKMA 5HLHA 1D0XA 1X1AA 2NXNB 4MEXF 3R61A 2HPMA 1RKTA 1BW5A 3QODA 2GA1A 2KDOA 5F64A 5GTHC 1SAUA 4UVAA 4Z2YA 3CQZJ 2UXXA 5KCMA 3OS1A 3F6OA 4XK4A 2V1XA 1ZH5A 4I09A 3GYHX 2XAJA 2NVQJ 2V4JC 5D6FA 4A6EA 1MSFC 2IGNA 3QPLA 3QP6A 3HIFA 2R7ZJ 4B1RA 5CVIA 3AL0C 1B9MA 2EIMH 2Q0OA 4EJOA 1QA6A 2I8DA 3IRRA 1IN5A 1MKMA 1B6AA 1K6OA 2CUZA 3EYYA 4ZYAA 3HPGA 2M45A 2DT5A 3FWEA 2VJIA 2Y0MA 2F5FA 3H5NA 1BBYA 3I4PA 2PMZA 1MZBA 1ULYA 5CQGA 2R4GA 3CCSI 3G2BA 2DPUA 2XSJC 5LHHA 1MBFA 4CCJA 4CH7A 3DKYA 1FIAA 4HX8A 1SFUA 2J5OA 2PLYA 2VJ5A 5EGOA 1SVOA 3FF5A 4L18B 2IXSA 2PEXA 2WAFA 3H5AA 1K78B 1XDSA 5L3DA 2DTZA 2M0CA 3ABKH 2BVLA 3Q3SA 3S3NA 2Z2SB 1SMTA 1ZLJA 3DF8A 4PUSA 2KPMA 4YFNF 3CD6I 3IH3A 4PGGA 4CXFA 1OCCH 1IXRC 1BL0A 3SYTA 2XB5A 3HB9A 4UB6C 3BTJA 4A3MJ 1YTYA 2IA2A 1X4PA 3PSFA 3ZP5A 3CCLI 5D4RA 1O7FA 3PL8A 3JRBA 4F93B 4A12A 1KU2A 4Z6YA 1QPMA 5CVJA 4BKXA 2LP0A 4G7OF 4ANJA 2O61A 3MZYA 4XN3A 3CDHA 4DYCA 2Y0SN 3OR1C 3BJAA 2AS5F 1DU6A 3ECHA 1W4MA 2R3SA 2FD5A 4LK1F 2PG4A 2F5DA 2JJ7A 5JR3A 2R93J 1BOAA 1SD7A 2P6TA 1DGWY 2ZO4A 4U0WA 1UB9A 2M2EA 1VQPI 3J7AY 2BY2A 5J1UA 4MFDA 4IHTA 1B4AA 2H8RA 3K4LA 4A6DA 4BDZA 1V4RA 3QAHA 5CPRB 3L2RA 1B8IB 2EFQA 2R7RA 3JRDA 2DFFA 5D4SA 2FA5A 2UV1A 5J1RA 1YX3A 2KKOA 1UHWA 1GXPA 3M8JA 1JT6A 2ZSHB 3OL3A 1P4XA 5FLMJ 4XSZF 5DUIA 2X1EA 2R5ZB 5EZHA 2LKSA 1AKHA 4BXUA 1BM9A 4AIKA 1TC3C 1VQ8I 4C3IJ 1X3UA 2G7HA 5HVQC 2OF7A 1Z05A 5J6XA 1BI2A 1Z9CA 1ZG1A 1MMSA 2CW8A 4V19K 3L00A 4BE0A 1OCPA 3WODF 3J7ZI 2X6XA 3KZZA 2E1MB 1HW5A 3OS2A 2W85A 2CQNA 1DPRA 4DNCA 1NHAA 3V4GA 2KT0A 4EMSA 4J01A 4MQVA 3JRAA 2V9PA 3MKYB 3ZMZA 1HDDC 5M3MJ 3JRGA 3EYIA 4C3HJ 1QHHD 4HV6A 1ZGJA 3KEYA 3ABLH 1TZLA 1MNDA 3CJQB 4FT8A 2JTVA 5LGUA 3B6CA 4HBLA 3IAM2 5JFRA 5FKLA 1MSEC 1RETA 2K86A 5FFXA 2XF5A 3LMMA 3RQIA 2E1OA 3AG2H 4L9JA 2VIXA 4S04A 1T39A 1Y8QB 2A5WA 1TWGJ 5E1ZB 1I3AA 2YU9J 3ZMUA 1RUNA 3S1QJ 2JK3A 4Y52J 1FMVA 3JTGA 4OAZA 2RV8A 3LSPA 2R0QC 4L0YB 5BNGA 1T38A 4AUXA 3J80Z 1LJ9A 2JPCA 3E6DA 2KJCA 2QZ8A 2HTJA 2OZUA 2LBFA 1ETVA 3REOA 3S2WA 2MYSA 2R92J 5JVTA 4IOCF 2WBMA 1V54H 1SVMA 1T56A 3C1DA 3C2BA 3WU1B 4ZYHA 3W2VA 2L7ZA 1ZAOA 3R60A 3IKTA 5DD8A 5K1YA 4XOTA 3I64A 3DPLC 3KZIC 1ZARA 1KYZA 5HS9A 3TO6A 2BHZA 1VQOI 2DFEA 1VI0A 1MBJA 4I02A 1D1CA 4F52A 3F8BA 3IWZA 2E2JJ 2EIKH 3FXJA 2CGPA 2KFDA 3E5UA 2R7SA 3HDDA 3I55I 2RC4A 4XICA 1QZZA 4XLNF 2DYSH 4IKFA 2CUEA 2ELJA 4DGWB 1YS7A 2EK5A 2XB0X 4B3AA 1MNMC 1K4SA 2BW3A 2CUJA 2HR3A 3B02A 2EPFA 2Q2EA 2H27A 5L3BA 2K85A 5EEHA 2UZKA 1SEUA 1WZ2A 1YO5C 1Z0XA 3CF2A 3QPHA 4CCMA 3K2ZA 1IN8A 2EV0A 4RLFA 4C9YA 4B47A 2EFNA 1AU7A 2WADA 4E6KG 3CP2A 1VQ9I 2B63J 1R4NB 1JTYA 2KMUA 4BJTA 1ZGWA 1JUMA 2XPVA 3K4BA 1HSTA 2IAIA 4WK8F 4G12A 3FXQA 2V6EA 5DM7F 2HQAA 3M07A 3X2QH 4BACA 4IRIA 1L0OC 2RDPA 3RYRA 3RZDJ 5EZGA 4AVPA 2CG4A 2VI6A 2WAQA 4M3FA 4S0HB 5DCMA 3IL2A 2VKVA 2D1HA 2XGEA 5FD5A 2HQ5A 5L3EA 3CJNA 4B09A 2PBIA 3KZYA 4D5FA 2PJRB 5AIQA 1XG1A 4BAYA 2Z1DA 4D0PA 5K5OA 2QVOA 4B4CA 1S72I 5GAEJ 2XKOA 2PX9A 2YU3A 3QP5A 4ZTFA 1B1BA 1FEXA 2KIQA 1TQIA 4HPQA 2QKMB 3KP3A 2ISZA 2VONA 3H3UA 3OYNA 1E0EA 3DPUA 4RGRA 3CMEI 2M8EA 2P5KA 1DUXC 1KONA 2YX4A 4LITA 3ONQA 2LY1A 2FOKA 1RR7A 3I59B 4FISA 4OMYA 3RKQA 3TW7A 3S1NJ 3ZR8X 4M6XA 3A01B 1Z1DA 2XGXA 3IWFA 4WXHA 1TT0A 1EV7A 1EH6A 3CCYA 1E3OC 1TP4A 3LSGA 3R4KA 3SZTA 4KMFA 2HI3A 3W6KB 3OIQA 5DM6F 2XKPA 3DTKA 1VQ4I 2IBDA 3V7RA 4A3FJ 3BWGA 5JLWA 1B72A 2JRMA 2FNAA 4RB2C 3GXOA 3CMAI 4M9XA 1LNWA 2LKXA 2K9NA 3KEQA 3L2UA 5DEQA 5KVRA 2HU9A 2BY1A 4HNTA 4NHJA 5LBQA 4KISA 3PO3J 4BQNA 2KL4A 1R1TA 1ZK8A 2VE8A 4HX7A 4BQOA 1EF4A 4UB8C 2HZDA 4HRIA 4XIDA 3IAS2 3U21A 3BR0A 3JAMZ 2VUMJ 2LF7A 2EA4A 3DWLE 1RI7A 1D3YA 2ELHA 1HQCA 4KITB 3KE2A 1AOYA 3NRVA 3WGGA 3MKWB 4E7LA 2KJBA 2XVCA 2K27A 2RAEA 3KIOA 4KDPA 2VXDA 4B43A 3M1CA 3ECOA 3K6GA 1LFUP 5GTIC 2EINH 9ANTA 4PK4A 3K1MA 3HZJA
chains in the Genus database with same CATH topology
3K1PA 4L9TA 2BE5F 2VODA 3KEOA 1ZN2A 3K9TA 2VXZA 3WTTC 5LGTA 2HOEA 2RNJA 2ESNA 4RB3C 1Z6TA 5J8CA 3BY6A 2RVCA 4RGUA 5ICCA 1LDKB 3WE3A 3L2CA 1IXCA 3EETA 2QQBA 4NB5A 4I7HA 3CTAA 5BOXA 2LDUA 2O8XA 1IUYA 1TQPA 2V6CA 2H09A 5CLSA 1YQAA 1T2KA 1BI0A 4RGXA 4I01A 3V8JA 3M9AA 1U5TB 3V7CA 2ZXJA 1P6RA 3ISPA 2ZFWA 1GVJA 1Z91A 1R58A 2FE3A 4IF4A 2FQ3A 1R1VA 2HWVA 2PJPA 1FSHA 1ODDA 2IP2A 2KIMA 3TO7A 1YS6A 4MGRA 1XMKA 2DFIA 3KP7A 3GFLA 3MZHA 1S29A 4JK1X 1B9NA 4OIRF 5FD6A 3KP6A 5E8IA 5FO5A 3TGNA 2A69F 3CLOA 5HLIA 1YYVA 4A0XA 2NNNA 3QPTA 1ON1A 4BHBA 3F22A 2L02A 3HHHA 2PFBA 3R0JA 2OQRA 2VOOA 1D8KA 5D5XB 1TNSA 2VC1A 4BHCA 4QWQA 1BC7C 2PN6A 1R1UA 4O5VA 4LLLA 5ILSA 2VBWA 3GFMA 1BIBA 3C7JA 4OINF 1IN6A 4P55A 1USSA 2FU4A 3IC7A 4YIFA 4UVCA 4EQQA 3IKVA 3F3XA 4ASNA 3J81K 2VT2A 4HDVA 4YIIA 5L3GA 4P9FA 2F5EA 5LGNA 3LSTA 4TV7A 4IHSA 3BPVA 4CZZA 1HKSA 3ROUA 2QM3A 2HS5A 1XDUA 1U6GA 3CUQA 1O3SA 1G4DA 1J7KA 3VODA 4QLCU 4I0BA 2Q8KA 3EUHA 3NEUA 2HZTA 4HA8A 2QQAA 4KN7X 2FF4A 2QWWA 1L3LA 4CHUA 5H6QA 2Y48A 1Y0UA 4YG2F 2MA3A 2WWYA 2ESHA 3MCZA 1HW1A 2KIFA 2XHKA 3LAJA 2STTA 4RAZA 1U5TC 1XGNA 2EFOA 3KFWX 1S6LA 4ZZLA 1P92A 5KK1A 3ZQ7A 3MQ0A 2XAHA 4HZFA 3V8KA 3J80K 2O3FA 2H94A 3KP5A 3HTUA 1W5SA 3DKWA 3ZMVA 3F23A 1LDDA 4KT5C 2YSRA 3E97A 3O6BB 5LEKA 5H6RA 2L54A 4KUMA 3MFKA 3BJOA 2O6GE 3I71A 2A6HF 2A6EF 2ZMEA 1XSXA 3KP4A 1IRFA 4LK0F 4UV9A 2X0LA 3M8EA 4IRHA 2Y75A 3OV8A 3F6VA 5FFZA 1ZRDA 2EFPA 4EVIA 3SZPA 4EM0B 2DU9A 1S8NA 3C3WA 1HBXG 4YFKF 1YG2A 2L3DA 4P9UA 4M71A 2MLGA 2QBYA 4WCGA 1F1ZA 2FRHA 1TLHB 4CO8A 2IA1A 1JXSA 3E3VA 4Q4ZF 1DP7P 5IT9Z 4M9ZA 1STZA 2W84A 3BOQA 2D45A 2QLZA 2QQ9A 3HSRA 1W7PA 1FLIA 2IRFG 3FMQA 1KU9A 4FX4A 5CJ9A 1QGPA 1H9TA 1KYWA 4Y13A 3TOAA 1OYWA 2RKHA 1SFXA 2V79A 1IW7F 1OMIA 2P5VA 1RUOA 3DQVC 1FWZA 4JBAA 2GZWA 4JQFA 5E17F 2PMHA 3FXRA 3RYPA 2HGCA 3HUGA 5FLXZ 3SFZA 4EJWA 4AIJA 3F8MA 2F2EA 2XAGA 3RDIA 4I0AA 1K79A 1FYKA 4KIBA 4OU0A 1GXQA 2A07F 1PP7U 2ZNYA 2G9WA 2VBZA 3RI4A 3RKYA 2P6SA 2Z5UA 3TQNA 3VOEA 4L0ZB 1FNNA 1OPCA 1G6NA 1R7JA 1GHCA 2OU2A 4GCVA 5D8KB 2UXNA 3U9GA 4PZJA 1XSVA 2IPQX 1HSJA 1TW2A 1KU3A 1ZHFA 1TNTA 1LEBA 1XCBA 1MGTA 3FXUA 3LFKA 3HOSA 3CUQB 5TJJA 3FMSA 4MEYF 3HRTA 2L01A 2OD5A 2VC0A 1RIOH 1PP8F 3BPXA 2V9VA 1MDMA 1YLFA 3GZ6A 3KCCA 4XLPF 3M8FA 2CYYA 5E8GA 4ENNA 1J9IA 1K78A 5D5WB 4MQ9F 3I5UA 1B59A 1CGPA 5D6EA 3GX4X 3U1DA 1H0MA 1CF7B 3BZ6A 4LLNA 2DI3A 5CYVA 3FM3A 4G94A 3ERED 3JW4A 4GYGA 4MTEA 1IN7A 4Y17A 1SD5A 4IXAA 1R22A 5LHIA 2CW0F 3MEXA 4GXOA 1W7PB 3BP8A 4OIQF 2DLLA 2DQRA 4HX4A 4R1HA 2LF8A 2VT3A 1JGSA 3DP7A 4ETSA 2CSOA 1H9GA 3I53A 4LG0A 4KFCA 1TTYA 4ESFA 3V7SA 5LHGA 1XSDA 3K1NA 3ULQB 3O3KA 4KYWA 1BI1A 3PQKA 1F9NA 2ISYA 3QU3A 1V3FA 2EB7A 3H92A 2P7CB 2OAZA 3RKXA 2FBKA 2M5WA 3BJ6A 1I1SA 5ED4A 2P8TA 2C6YA 1QO0D 2DQLA 2STWA 3SXYA 2DTRA 1YW9A 4OIPF 1XCVA 4ENJA 4LG0B 1KQ0A 4LB5A 3FZVA 1IF1A 3WTYC 2DAOA 5ILVA 2MD5A 1SD6A 2ZBKA 3I54A 5DCFA 4RS8A 1UCRA 3ZPLA 5DCMB 2H6CA 3R0AA 1QZYA 3WTXC 2O03A 3E5QA 1WRJA 2HFHA 1D8JA 4ENKA 4HF0A 4BNCA 1U8RA 3L09A 3FX3A 5J8FA 1LVAA 1PUEE 1TBXA 2D2WA 2IA0A 1R36A 2TDXA 4A0YA 1XN7A 3JTHA 4ON0A 2A5YB 2MH9A 4N9HA 3E6MA 1Q1HA 1T0FA 3HOTA 2BGCA 3F8NA 4ESBA 1LDJA 2M30A 1PDNC 3VEPA 3JSOA 1YIOA 2D1VA 2ZNZA 1OYIA 1JHHA 3D5LA 5BS6A 1FYMA 2QUFA 2L4AA 4LJZF 4HV5A 3GWZA 1U78A 2ZMEB 3V8LA 5EEGA 4LD5A 1IAWA 4U88A 1ZGAA 3N97A 1FC3A 2CFXA 2WC2A 2VOPA 1FY7A 2IVMA 2R7FA 2EA2A 3DPTA 2PI0A 1EH8A 4AWXB 3QOPA 2HEOA 3M7GA 1QNTA 5IT3A 3HSFA 3RKWA 5A2QZ 2J5PA 4A2UA 4WF2A 3FMRA 4ZH4F 4IRGA 1J5YA 5HDKA 3I0TA 2GIVA 3SQNA 3PQJA 4KN4X 1K7AA 2OA4A 4KA4A 5K5RA 5IT9K 1Z6RA 4FX0A 1IN4A 3KLNA 1FP1D 2K02A 3FM5A 4EM1A 1I6XA 1OKRA 1R00A 3WTZA 1J0RA 2MC3A 3T8TA 3Q9SA 4HW0A 5CVVA 3F21A 1W7PD 4EJTA 5A2QK 3ZMTA 2X4HA 4N9IA 5F6FA 4AIHA 3LA3A 5E1XA 5HLGA 2KIUA 1REPC 1DDNA 3DFGA 3F72A 2GXGA 2FBHA 5FB2A 2JRTA 2HTSA 2EFWA 3CO7C 3LQQA 4WXDA 3I59A 5HOOA 4G7HF 4HF2A 1QQIA 5FLXK 4GO1A 1USTA 4BHPA 1WI9A 4RAYA 1O7LA 2PQ8A 5HDNA 2P4WA 3T8RA 3WTWC 4L9NA 5HS7A 3I58A 4ESJA 3T0YA 4HQMA 2JPBA 3ZN0A 2A61A 3HRSA 1ZLKA 4HOBA 1R5GA 1HW2A 1P4WA 3WTSC 3MWMA 3G3ZA 5D5VB 2EV5A 1FPQA 2AXLA 3M1EA 1SFEA 3L7WA 1FBUA 2FMYA 5E20A 3BDDA 1RNLA 4A5MA 3E6CC 1O3TA 1FBSA 2LNBA 4GYIA 2QYOA 1MJAA 1ON2A 3W6JB 1O3RA 2NRAC 3LQRA 3TDZC 2HQRA 3U2RA 1G3YA 5L3FA 3IHUA 4ZYEA 3LAPA 2DBBA 1LQ1A 1OYYA 3DV8A 2GXBA 1UFMA 1KQ9A 4H0EA 1AWCA 3E5XA 4KNYA 2ETHA 2JT1A 5TRDA 2XAQA 1SMYF 2XASA 3HSEA 2GAUA 2NNYA 4L9VA 5H20A 1BJAA 1KGSA 1E2XA 1LEAA 1BN5A 5ERIA 2VE9A 3LA7A 1BC8C 3F8CA 3WGIA 4UHTA 2G7UA 2E1CA 3AAFA 3N4MA 3HHGA 5DDGA 2YPRA 1TQMA 1FSEA 4U0VA 2RGVA 2YX7A 2A68F 1W5TA 1WWXA 5CVRA 3FHZA 3MAJA 3J7AO 4XRFA 1MJ9A 2K4JA 5LRSA 5ICEA 4BYYA 2QENA 2WTEA 2GWRA 4OMZA 4MHGA 5D5UB 2H6BA 4NQWA 1MD0A 2JSCA 3HTSB 1FT9A 3DEUA 4UV8A 1F4KA 1E17A 2W24A 4Q47A 4PGHA 1G3SA 3G73A 2V1DA 1J2XA 5L3CA 2ADUA 4R8HA 4KIGA 4HQEA 4OOIA 1ZRFA 4U0YA 3J81Z 5BPIA 2BEOA 1S7OA 4MNUA 5DUKA 3SHFA 1YW8A 4BQAA 2HKXA 4LB6B 3P9KA 2K4BA 5HS8A 1ZRCA 4HAMA 2LSOA 4AD9A 1ONVA 4EM2A 2GA2A 3QRFF 3PFIA 2EV6A 4P96A 2O0YA 3CUOA 4PCQA 2HDCA 2BV6A 1C0WA 2P5LC 2XAFA 4UUVA 2MBFA 4G7ZF 5LEJA 1YFHA 4EGYA 3LWFA 4M9SA 1F5TA 1ZYRF 1G3TA 3VFZA 2HYFA 2Z9OA 2ZKZA 4O6JA 5D8LB 3KLOA 2FMLA 3R6SA 1JHFA 1OR7A 1EH7A 4L5JA 5AONA 4A0ZA 1J59A 2COMA 1YW7A 2Z99A 3IRQA 2NAZA 4MTDA 4M6YA 3WTUC 1XB4A 4HLYA 4YFXF 3HRMA 1I1GA 2ZCWA 3GVAA 4U7BA 1T98A 3NQOA 5JI6A 3GO5A 2KRFA 4LFUA 3HYIA 3GUDA 4ZYDA 4Y15A 1J75A 2P7VB 3GLXA 1U5TA 2FNPA 4ENMA 1ZG5A 2DK5A 1RZ4A 5DV5A 1XMAA 4IJAA 2XRNA 3KETA 3T5XA 2MH2A 2FXAA 4CDGA 4HYEA 2NYXA 1QBJA 2VBXA 4KMUX 4ZYGA 4CGZA 3Q5FA 2XV4S 3RPUA 4EGZA 1R5HA 5DYMA 3ZMSA 1FP2A 4RB1A 2BYVE 2JZYA 2Z3YA 4S05A 2OQGA 1CF7A 4CICA 3EQLF 3K0LA 4XSXF 5BPDA 3H3ZA 3ABUA 1O57A 4B8XA 4M72A 1I27A 1UHMA 5F1RA 2FEZA 5DD4A 3EDPA 5K5QA 1KQ8A 1XGOA 3O2PE 5E1WA 4IVNA 2HYGD 3GFIA 3K69A 1MDMB 3BROA 1S3JA 4RGSA 3WGHA 2EWNA 3TOBA 2DO7A 1KA8A 4IPAA 4HDUA 3ZMDA 2UWMA 4L5IA 2NS0A 4N0BA 4Q48A 3WTVC 2W57A 3GEZA 3RTRA 1WQ2A 2XIGA 3RPQA 1T6SA 4KIFA 2XROA 4WX9A 1SD4A 4LGWA 2OBPA 4G9YA 4O3MA 5ICFA 2RN7A 1I5ZA 5E18F 2E1NA 3GFJA 3CUQC 2R7DA 4G6QA 3P9IA 2Z33A 3T1BA 4UXNA 4A5NA 2DW4A 3WG9A 2M87A 5ILUA 1R23A 5HDGA 2OZ6A 2GQQA 2DPDA 2W25A 4PDKA 4ZZDA 2F5CA 3D0SA 1ZREA 4OIOF 3QU6A 3OOPA 4LLGF 1U2WA 1VTNC 2VBYA 3CO6C 1FOKA 5LLQA 3TDUC 1HXDA 3WU0A 2HQNA 1JE8A 2EJRA 1P2FA 1SAXA 4BH9A 2HKOA 2K7LA 4WWCA 6PAXA 3P7NA 5JHUA 3JSPA 2RQPA 3ELKA 4E70A 4M74A 3C18A 5CVUA 1P4AA 3E6BA 2MLKA 2QBYB 1G3WA 1KU7A 2ZJ2A 3HRUA 1XGSA 4I2OA 4CYDA 4I98B 2ACJA 1FBQA 3F8FA 1IXSB 2FSWA 4KICA 1XGMA 2PMUA 4UNOA 3RIRA 4M73A 3RJPA 1DPUA 1U3EM 4GGGA 4EJUA 3DXJF 1FX7A 4HF1A 3JAMK 1BIAA 1FYLA 2IT0A 1S7AA 5BMZA 1IZ1A 4K2EA 1A04A 3L9FA 4EV0A 4G6DA 4G8XA 4WXCA 1MJBA 3GW2A 4FHTA 2IW5A 5BQTA 2YR2A 1D5VA 1WSUA 3ABTA 1XD7A 1IRGA 3COAC 3WE2A 2M1BA 5LRRA 2L4MA 1BI3A 2VN2A 2FBIA 2E7WA 4LMYA 1O3QA 5ICGA 2B0LA 2IJLA 2V1UA 3Q9VA 1HKQA 4XBFA 3GF2A 4EJVA 4R79A 1LB2A 1Z7UA 3KP2A 4DQ2A 1ZG3A 2CO5A 2BBYA 4UVBA 4F7ZA 2LKPA 2DK8A 4U7DA 3ML6A 2A3SA 1TW3A 3GZ5A 3P9CA 4P5OA 2WV0A 1HKTA 4Q5SF 3TKYA 3LA2A 3B73A 5FGMA 3TO9A 3ZN1A 3VB2A 2XUBA 2CQKA 2CWEA 2E7XA 5AIPA 4HLXA 4RB0A 1FZPB 1WKMA 5HLHA 4MEXF 3R61A 2GA1A 5F64A 4UVAA 4Z2YA 2UXXA 3F6OA 2V1XA 1ZH5A 4I09A 3GYHX 2XAJA 5D6FA 4A6EA 3QP6A 3HIFA 5CVIA 1B9MA 2Q0OA 4EJOA 3IRRA 1IN5A 1MKMA 1B6AA 1K6OA 3EYYA 2M45A 2DT5A 3FWEA 2Y0MA 2F5FA 1BBYA 3I4PA 1MZBA 1ULYA 2DPUA 5LHHA 4HX8A 1SFUA 2J5OA 2PLYA 4L18B 3FF5A 2PEXA 1K78B 1XDSA 5L3DA 1SMTA 1ZLJA 3DF8A 4YFNF 4PGGA 4CXFA 1IXRC 1YTYA 2IA2A 3ZP5A 5D4RA 1O7FA 4A12A 1KU2A 1QPMA 5CVJA 2O61A 4G7OF 3MZYA 2AS5F 3CDHA 3BJAA 3ECHA 1W4MA 2R3SA 4LK1F 2PG4A 2F5DA 5JR3A 1BOAA 1SD7A 2P6TA 2ZO4A 4U0WA 1UB9A 4IHTA 1B4AA 4A6DA 1V4RA 3QAHA 2EFQA 5D4SA 2FA5A 2KKOA 1UHWA 1GXPA 1P4XA 4XSZF 5DUIA 4BXUA 1BM9A 4AIKA 1X3UA 2G7HA 5HVQC 1Z05A 5J6XA 1BI2A 1Z9CA 1ZG1A 3L00A 3WODF 3KZZA 1HW5A 2W85A 1DPRA 4DNCA 1NHAA 3V4GA 4EMSA 4MQVA 3ZMZA 3EYIA 4HV6A 1ZGJA 4FT8A 2JTVA 5LGUA 4HBLA 5JFRA 2K86A 5FFXA 4S04A 4L9JA 1T39A 5E1ZB 3ZMUA 1RUNA 3JTGA 2RV8A 4L0YB 1T38A 3J80Z 1LJ9A 2JPCA 3E6DA 2KJCA 2QZ8A 2HTJA 2OZUA 3REOA 3S2WA 5JVTA 3C1DA 3WU1B 4ZYHA 1ZAOA 3R60A 3IKTA 5DD8A 5K1YA 3I64A 3DPLC 1ZARA 1KYZA 5HS9A 3TO6A 4I02A 3F8BA 3IWZA 2CGPA 3E5UA 2RC4A 1QZZA 4XLNF 1YS7A 2EK5A 2HR3A 3B02A 2Q2EA 2H27A 5L3BA 5EEHA 2UZKA 1YO5C 3QPHA 3K2ZA 1IN8A 2EV0A 2EFNA 1HSTA 4WK8F 3FXQA 4IRIA 1L0OC 2RDPA 3RYRA 4AVPA 2CG4A 5DCMA 3IL2A 2D1HA 5FD5A 5L3EA 3CJNA 4B09A 2PBIA 3KZYA 5AIQA 4BAYA 4D0PA 5K5OA 2QVOA 2XKOA 3QP5A 2YU3A 1B1BA 1TQIA 3KP3A 2ISZA 2VONA 3H3UA 4RGRA 2M8EA 2P5KA 1DUXC 2YX4A 2FOKA 3I59B 4OMYA 4M6XA 1Z1DA 2XGXA 3IWFA 4WXHA 1EV7A 1EH6A 4KMFA 3SZTA 3R4KA 3W6KB 2XKPA 3V7RA 3BWGA 2FNAA 4RB2C 3GXOA 4M9XA 1LNWA 3KEQA 5DEQA 5KVRA 4NHJA 5LBQA 4HX7A 1R1TA 2VE8A 3JAMZ 2LF7A 2EA4A 1RI7A 1D3YA 2ELHA 1HQCA 3KE2A 1AOYA 3NRVA 3WGGA 2KJBA 2XVCA 2K27A 4KDPA 3ECOA 3K1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1P A;  4L9T A;  2BE5 F;  2VOD A;  3KEO A;  1ZN2 A;  3K9T A;  2VXZ A;  3WTT C;  5LGT A;  2HOE A;  2RNJ A;  2ESN A;  4RB3 C;  1Z6T A;  5J8C A;  3BY6 A;  2RVC A;  4RGU A;  5ICC A;  1LDK B;  3WE3 A;  3L2C A;  1IXC A;  3EET A;  2QQB A;  4NB5 A;  4I7H A;  3CTA A;  5BOX A;  2LDU A;  2O8X A;  1IUY A;  1TQP A;  2V6C A;  2H09 A;  5CLS A;  1YQA A;  1T2K A;  1BI0 A;  4RGX A;  4I01 A;  3V8J A;  3M9A A;  1U5T B;  3V7C A;  2ZXJ A;  1P6R A;  3ISP A;  2ZFW A;  1GVJ A;  1Z91 A;  1R58 A;  2FE3 A;  4IF4 A;  2FQ3 A;  1R1V A;  2HWV A;  2PJP A;  1FSH A;  1ODD A;  2IP2 A;  2KIM A;  3TO7 A;  1YS6 A;  4MGR A;  1XMK A;  2DFI A;  3KP7 A;  3GFL A;  3MZH A;  1S29 A;  4JK1 X;  1B9N A;  4OIR F;  5FD6 A;  3KP6 A;  5E8I A;  5FO5 A;  3TGN A;  2A69 F;  3CLO A;  5HLI A;  1YYV A;  4A0X A;  2NNN A;  3QPT A;  1ON1 A;  4BHB A;  3F22 A;  2L02 A;  3HHH A;  2PFB A;  3R0J A;  2OQR A;  2VOO A;  1D8K A;  5D5X B;  1TNS A;  2VC1 A;  4BHC A;  4QWQ A;  1BC7 C;  2PN6 A;  1R1U A;  4O5V A;  4LLL A;  5ILS A;  2VBW A;  3GFM A;  1BIB A;  3C7J A;  4OIN F;  1IN6 A;  4P55 A;  1USS A;  2FU4 A;  3IC7 A;  4YIF A;  4UVC A;  4EQQ A;  3IKV A;  3F3X A;  4ASN A;  3J81 K;  2VT2 A;  4HDV A;  4YII A;  5L3G A;  4P9F A;  2F5E A;  5LGN A;  3LST A;  4TV7 A;  4IHS A;  3BPV A;  4CZZ A;  1HKS A;  3ROU A;  2QM3 A;  2HS5 A;  1XDU A;  1U6G A;  3CUQ A;  1O3S A;  1G4D A;  1J7K A;  3VOD A;  4QLC U;  4I0B A;  2Q8K A;  3EUH A;  3NEU A;  2HZT A;  4HA8 A;  2QQA A;  4KN7 X;  2FF4 A;  2QWW A;  1L3L A;  4CHU A;  5H6Q A;  2Y48 A;  1Y0U A;  4YG2 F;  2MA3 A;  2WWY A;  2ESH A;  3MCZ A;  1HW1 A;  2KIF A;  2XHK A;  3LAJ A;  2STT A;  4RAZ A;  1U5T C;  1XGN A;  2EFO A;  3KFW X;  1S6L A;  4ZZL A;  1P92 A;  5KK1 A;  3ZQ7 A;  3MQ0 A;  2XAH A;  4HZF A;  3V8K A;  3J80 K;  2O3F A;  2H94 A;  3KP5 A;  3HTU A;  1W5S A;  3DKW A;  3ZMV A;  3F23 A;  1LDD A;  4KT5 C;  2YSR A;  3E97 A;  3O6B B;  5LEK A;  5H6R A;  2L54 A;  4KUM A;  3MFK A;  3BJO A;  2O6G E;  3I71 A;  2A6H F;  2A6E F;  2ZME A;  1XSX A;  3KP4 A;  1IRF A;  4LK0 F;  4UV9 A;  2X0L A;  3M8E A;  4IRH A;  2Y75 A;  3OV8 A;  3F6V A;  5FFZ A;  1ZRD A;  2EFP A;  4EVI A;  3SZP A;  4EM0 B;  2DU9 A;  1S8N A;  3C3W A;  1HBX G;  4YFK F;  1YG2 A;  2L3D A;  4P9U A;  4M71 A;  2MLG A;  2QBY A;  4WCG A;  1F1Z A;  2FRH A;  1TLH B;  4CO8 A;  2IA1 A;  1JXS A;  3E3V A;  4Q4Z F;  1DP7 P;  5IT9 Z;  4M9Z A;  1STZ A;  2W84 A;  3BOQ A;  2D45 A;  2QLZ A;  2QQ9 A;  3HSR A;  1W7P A;  1FLI A;  2IRF G;  3FMQ A;  1KU9 A;  4FX4 A;  5CJ9 A;  1QGP A;  1H9T A;  1KYW A;  4Y13 A;  3TOA A;  1OYW A;  2RKH A;  1SFX A;  2V79 A;  1IW7 F;  1OMI A;  2P5V A;  1RUO A;  3DQV C;  1FWZ A;  4JBA A;  2GZW A;  4JQF A;  5E17 F;  2PMH A;  3FXR A;  3RYP A;  2HGC A;  3HUG A;  5FLX Z;  3SFZ A;  4EJW A;  4AIJ A;  3F8M A;  2F2E A;  2XAG A;  3RDI A;  4I0A A;  1K79 A;  1FYK A;  4KIB A;  4OU0 A;  1GXQ A;  2A07 F;  1PP7 U;  2ZNY A;  2G9W A;  2VBZ A;  3RI4 A;  3RKY A;  2P6S A;  2Z5U A;  3TQN A;  3VOE A;  4L0Z B;  1FNN A;  1OPC A;  1G6N A;  1R7J A;  1GHC A;  2OU2 A;  4GCV A;  5D8K B;  2UXN A;  3U9G A;  4PZJ A;  1XSV A;  2IPQ X;  1HSJ A;  1TW2 A;  1KU3 A;  1ZHF A;  1TNT A;  1LEB A;  1XCB A;  1MGT A;  3FXU A;  3LFK A;  3HOS A;  3CUQ B;  5TJJ A;  3FMS A;  4MEY F;  3HRT A;  2L01 A;  2OD5 A;  2VC0 A;  1RIO H;  1PP8 F;  3BPX A;  2V9V A;  1MDM A;  1YLF A;  3GZ6 A;  3KCC A;  4XLP F;  3M8F A;  2CYY A;  5E8G A;  4ENN A;  1J9I A;  1K78 A;  5D5W B;  4MQ9 F;  3I5U A;  1B59 A;  1CGP A;  5D6E A;  3GX4 X;  3U1D A;  1H0M A;  1CF7 B;  3BZ6 A;  4LLN A;  2DI3 A;  5CYV A;  3FM3 A;  4G94 A;  3ERE D;  3JW4 A;  4GYG A;  4MTE A;  1IN7 A;  4Y17 A;  1SD5 A;  4IXA A;  1R22 A;  5LHI A;  2CW0 F;  3MEX A;  4GXO A;  1W7P B;  3BP8 A;  4OIQ F;  2DLL A;  2DQR A;  4HX4 A;  4R1H A;  2LF8 A;  2VT3 A;  1JGS A;  3DP7 A;  4ETS A;  2CSO A;  1H9G A;  3I53 A;  4LG0 A;  4KFC A;  1TTY A;  4ESF A;  3V7S A;  5LHG A;  1XSD A;  3K1N A;  3ULQ B;  3O3K A;  4KYW A;  1BI1 A;  3PQK A;  1F9N A;  2ISY A;  3QU3 A;  1V3F A;  2EB7 A;  3H92 A;  2P7C B;  2OAZ A;  3RKX A;  2FBK A;  2M5W A;  3BJ6 A;  1I1S A;  5ED4 A;  2P8T A;  2C6Y A;  1QO0 D;  2DQL A;  2STW A;  3SXY A;  2DTR A;  1YW9 A;  4OIP F;  1XCV A;  4ENJ A;  4LG0 B;  1KQ0 A;  4LB5 A;  3FZV A;  1IF1 A;  3WTY C;  2DAO A;  5ILV A;  2MD5 A;  1SD6 A;  2ZBK A;  3I54 A;  5DCF A;  4RS8 A;  1UCR A;  3ZPL A;  5DCM B;  2H6C A;  3R0A A;  1QZY A;  3WTX C;  2O03 A;  3E5Q A;  1WRJ A;  2HFH A;  1D8J A;  4ENK A;  4HF0 A;  4BNC A;  1U8R A;  3L09 A;  3FX3 A;  5J8F A;  1LVA A;  1PUE E;  1TBX A;  2D2W A;  2IA0 A;  1R36 A;  2TDX A;  4A0Y A;  1XN7 A;  3JTH A;  4ON0 A;  2A5Y B;  2MH9 A;  4N9H A;  3E6M A;  1Q1H A;  1T0F A;  3HOT A;  2BGC A;  3F8N A;  4ESB A;  1LDJ A;  2M30 A;  1PDN C;  3VEP A;  3JSO A;  1YIO A;  2D1V A;  2ZNZ A;  1OYI A;  1JHH A;  3D5L A;  5BS6 A;  1FYM A;  2QUF A;  2L4A A;  4LJZ F;  4HV5 A;  3GWZ A;  1U78 A;  2ZME B;  3V8L A;  5EEG A;  4LD5 A;  1IAW A;  4U88 A;  1ZGA A;  3N97 A;  1FC3 A;  2CFX A;  2WC2 A;  2VOP A;  1FY7 A;  2IVM A;  2R7F A;  2EA2 A;  3DPT A;  2PI0 A;  1EH8 A;  4AWX B;  3QOP A;  2HEO A;  3M7G A;  1QNT A;  5IT3 A;  3HSF A;  3RKW A;  5A2Q Z;  2J5P A;  4A2U A;  4WF2 A;  3FMR A;  4ZH4 F;  4IRG A;  1J5Y A;  5HDK A;  3I0T A;  2GIV A;  3SQN A;  3PQJ A;  4KN4 X;  1K7A A;  2OA4 A;  4KA4 A;  5K5R A;  5IT9 K;  1Z6R A;  4FX0 A;  1IN4 A;  3KLN A;  1FP1 D;  2K02 A;  3FM5 A;  4EM1 A;  1I6X A;  1OKR A;  1R00 A;  3WTZ A;  1J0R A;  2MC3 A;  3T8T A;  3Q9S A;  4HW0 A;  5CVV A;  3F21 A;  1W7P D;  4EJT A;  5A2Q K;  3ZMT A;  2X4H A;  4N9I A;  5F6F A;  4AIH A;  3LA3 A;  5E1X A;  5HLG A;  2KIU A;  1REP C;  1DDN A;  3DFG A;  3F72 A;  2GXG A;  2FBH A;  5FB2 A;  2JRT A;  2HTS A;  2EFW A;  3CO7 C;  3LQQ A;  4WXD A;  3I59 A;  5HOO A;  4G7H F;  4HF2 A;  1QQI A;  5FLX K;  4GO1 A;  1UST A;  4BHP A;  1WI9 A;  4RAY A;  1O7L A;  2PQ8 A;  5HDN A;  2P4W A;  3T8R A;  3WTW C;  4L9N A;  5HS7 A;  3I58 A;  4ESJ A;  3T0Y A;  4HQM A;  2JPB A;  3ZN0 A;  2A61 A;  3HRS A;  1ZLK A;  4HOB A;  1R5G A;  1HW2 A;  1P4W A;  3WTS C;  3MWM A;  3G3Z A;  5D5V B;  2EV5 A;  1FPQ A;  2AXL A;  3M1E A;  1SFE A;  3L7W A;  1FBU A;  2FMY A;  5E20 A;  3BDD A;  1RNL A;  4A5M A;  3E6C C;  1O3T A;  1FBS A;  2LNB A;  4GYI A;  2QYO A;  1MJA A;  1ON2 A;  3W6J B;  1O3R A;  2NRA C;  3LQR A;  3TDZ C;  2HQR A;  3U2R A;  1G3Y A;  5L3F A;  3IHU A;  4ZYE A;  3LAP A;  2DBB A;  1LQ1 A;  1OYY A;  3DV8 A;  2GXB A;  1UFM A;  1KQ9 A;  4H0E A;  1AWC A;  3E5X A;  4KNY A;  2ETH A;  2JT1 A;  5TRD A;  2XAQ A;  1SMY F;  2XAS A;  3HSE A;  2GAU A;  2NNY A;  4L9V A;  5H20 A;  1BJA A;  1KGS A;  1E2X A;  1LEA A;  1BN5 A;  5ERI A;  2VE9 A;  3LA7 A;  1BC8 C;  3F8C A;  3WGI A;  4UHT A;  2G7U A;  2E1C A;  3AAF A;  3N4M A;  3HHG A;  5DDG A;  2YPR A;  1TQM A;  1FSE A;  4U0V A;  2RGV A;  2YX7 A;  2A68 F;  1W5T A;  1WWX A;  5CVR A;  3FHZ A;  3MAJ A;  3J7A O;  4XRF A;  1MJ9 A;  2K4J A;  5LRS A;  5ICE A;  4BYY A;  2QEN A;  2WTE A;  2GWR A;  4OMZ A;  4MHG A;  5D5U B;  2H6B A;  4NQW A;  1MD0 A;  2JSC A;  3HTS B;  1FT9 A;  3DEU A;  4UV8 A;  1F4K A;  1E17 A;  2W24 A;  4Q47 A;  4PGH A;  1G3S A;  3G73 A;  2V1D A;  1J2X A;  5L3C A;  2ADU A;  4R8H A;  4KIG A;  4HQE A;  4OOI A;  1ZRF A;  4U0Y A;  3J81 Z;  5BPI A;  2BEO A;  1S7O A;  4MNU A;  5DUK A;  3SHF A;  1YW8 A;  4BQA A;  2HKX A;  4LB6 B;  3P9K A;  2K4B A;  5HS8 A;  1ZRC A;  4HAM A;  2LSO A;  4AD9 A;  1ONV A;  4EM2 A;  2GA2 A;  3QRF F;  3PFI A;  2EV6 A;  4P96 A;  2O0Y A;  3CUO A;  4PCQ A;  2HDC A;  2BV6 A;  1C0W A;  2P5L C;  2XAF A;  4UUV A;  2MBF A;  4G7Z F;  5LEJ A;  1YFH A;  4EGY A;  3LWF A;  4M9S A;  1F5T A;  1ZYR F;  1G3T A;  3VFZ A;  2HYF A;  2Z9O A;  2ZKZ A;  4O6J A;  5D8L B;  3KLO A;  2FML A;  3R6S A;  1JHF A;  1OR7 A;  1EH7 A;  4L5J A;  5AON A;  4A0Z A;  1J59 A;  2COM A;  1YW7 A;  2Z99 A;  3IRQ A;  2NAZ A;  4MTD A;  4M6Y A;  3WTU C;  1XB4 A;  4HLY A;  4YFX F;  3HRM A;  1I1G A;  2ZCW A;  3GVA A;  4U7B A;  1T98 A;  3NQO A;  5JI6 A;  3GO5 A;  2KRF A;  4LFU A;  3HYI A;  3GUD A;  4ZYD A;  4Y15 A;  1J75 A;  2P7V B;  3GLX A;  1U5T A;  2FNP A;  4ENM A;  1ZG5 A;  2DK5 A;  1RZ4 A;  5DV5 A;  1XMA A;  4IJA A;  2XRN A;  3KET A;  3T5X A;  2MH2 A;  2FXA A;  4CDG A;  4HYE A;  2NYX A;  1QBJ A;  2VBX A;  4KMU X;  4ZYG A;  4CGZ A;  3Q5F A;  2XV4 S;  3RPU A;  4EGZ A;  1R5H A;  5DYM A;  3ZMS A;  1FP2 A;  4RB1 A;  2BYV E;  2JZY A;  2Z3Y A;  4S05 A;  2OQG A;  1CF7 A;  4CIC A;  3EQL F;  3K0L A;  4XSX F;  5BPD A;  3H3Z A;  3ABU A;  1O57 A;  4B8X A;  4M72 A;  1I27 A;  1UHM A;  5F1R A;  2FEZ A;  5DD4 A;  3EDP A;  5K5Q A;  1KQ8 A;  1XGO A;  3O2P E;  5E1W A;  4IVN A;  2HYG D;  3GFI A;  3K69 A;  1MDM B;  3BRO A;  1S3J A;  4RGS A;  3WGH A;  2EWN A;  3TOB A;  2DO7 A;  1KA8 A;  4IPA A;  4HDU A;  3ZMD A;  2UWM A;  4L5I A;  2NS0 A;  4N0B A;  4Q48 A;  3WTV C;  2W57 A;  3GEZ A;  3RTR A;  1WQ2 A;  2XIG A;  3RPQ A;  1T6S A;  4KIF A;  2XRO A;  4WX9 A;  1SD4 A;  4LGW A;  2OBP A;  4G9Y A;  4O3M A;  5ICF A;  2RN7 A;  1I5Z A;  5E18 F;  2E1N A;  3GFJ A;  3CUQ C;  2R7D A;  4G6Q A;  3P9I A;  2Z33 A;  3T1B A;  4UXN A;  4A5N A;  2DW4 A;  3WG9 A;  2M87 A;  5ILU A;  1R23 A;  5HDG A;  2OZ6 A;  2GQQ A;  2DPD A;  2W25 A;  4PDK A;  4ZZD A;  2F5C A;  3D0S A;  1ZRE A;  4OIO F;  3QU6 A;  3OOP A;  4LLG F;  1U2W A;  1VTN C;  2VBY A;  3CO6 C;  1FOK A;  5LLQ A;  3TDU C;  1HXD A;  3WU0 A;  2HQN A;  1JE8 A;  2EJR A;  1P2F A;  1SAX A;  4BH9 A;  2HKO A;  2K7L A;  4WWC A;  6PAX A;  3P7N A;  5JHU A;  3JSP A;  2RQP A;  3ELK A;  4E70 A;  4M74 A;  3C18 A;  5CVU A;  1P4A A;  3E6B A;  2MLK A;  2QBY B;  1G3W A;  1KU7 A;  2ZJ2 A;  3HRU A;  1XGS A;  4I2O A;  4CYD A;  4I98 B;  2ACJ A;  1FBQ A;  3F8F A;  1IXS B;  2FSW A;  4KIC A;  1XGM A;  2PMU A;  4UNO A;  3RIR A;  4M73 A;  3RJP A;  1DPU A;  1U3E M;  4GGG A;  4EJU A;  3DXJ F;  1FX7 A;  4HF1 A;  3JAM K;  1BIA A;  1FYL A;  2IT0 A;  1S7A A;  5BMZ A;  1IZ1 A;  4K2E A;  1A04 A;  3L9F A;  4EV0 A;  4G6D A;  4G8X A;  4WXC A;  1MJB A;  3GW2 A;  4FHT A;  2IW5 A;  5BQT A;  2YR2 A;  1D5V A;  1WSU A;  3ABT A;  1XD7 A;  1IRG A;  3COA C;  3WE2 A;  2M1B A;  5LRR A;  2L4M A;  1BI3 A;  2VN2 A;  2FBI A;  2E7W A;  4LMY A;  1O3Q A;  5ICG A;  2B0L A;  2IJL A;  2V1U A;  3Q9V A;  1HKQ A;  4XBF A;  3GF2 A;  4EJV A;  4R79 A;  1LB2 A;  1Z7U A;  3KP2 A;  4DQ2 A;  1ZG3 A;  2CO5 A;  2BBY A;  4UVB A;  4F7Z A;  2LKP A;  2DK8 A;  4U7D A;  3ML6 A;  2A3S A;  1TW3 A;  3GZ5 A;  3P9C A;  4P5O A;  2WV0 A;  1HKT A;  4Q5S F;  3TKY A;  3LA2 A;  3B73 A;  5FGM A;  3TO9 A;  3ZN1 A;  3VB2 A;  2XUB A;  2CQK A;  2CWE A;  2E7X A;  5AIP A;  4HLX A;  4RB0 A;  1FZP B;  1WKM A;  5HLH A;  4MEX F;  3R61 A;  2GA1 A;  5F64 A;  4UVA A;  4Z2Y A;  2UXX A;  3F6O A;  2V1X A;  1ZH5 A;  4I09 A;  3GYH X;  2XAJ A;  5D6F A;  4A6E A;  3QP6 A;  3HIF A;  5CVI A;  1B9M A;  2Q0O A;  4EJO A;  3IRR A;  1IN5 A;  1MKM A;  1B6A A;  1K6O A;  3EYY A;  2M45 A;  2DT5 A;  3FWE A;  2Y0M A;  2F5F A;  1BBY A;  3I4P A;  1MZB A;  1ULY A;  2DPU A;  5LHH A;  4HX8 A;  1SFU A;  2J5O A;  2PLY A;  4L18 B;  3FF5 A;  2PEX A;  1K78 B;  1XDS A;  5L3D A;  1SMT A;  1ZLJ A;  3DF8 A;  4YFN F;  4PGG A;  4CXF A;  1IXR C;  1YTY A;  2IA2 A;  3ZP5 A;  5D4R A;  1O7F A;  4A12 A;  1KU2 A;  1QPM A;  5CVJ A;  2O61 A;  4G7O F;  3MZY A;  2AS5 F;  3CDH A;  3BJA A;  3ECH A;  1W4M A;  2R3S A;  4LK1 F;  2PG4 A;  2F5D A;  5JR3 A;  1BOA A;  1SD7 A;  2P6T A;  2ZO4 A;  4U0W A;  1UB9 A;  4IHT A;  1B4A A;  4A6D A;  1V4R A;  3QAH A;  2EFQ A;  5D4S A;  2FA5 A;  2KKO A;  1UHW A;  1GXP A;  1P4X A;  4XSZ F;  5DUI A;  4BXU A;  1BM9 A;  4AIK A;  1X3U A;  2G7H A;  5HVQ C;  1Z05 A;  5J6X A;  1BI2 A;  1Z9C A;  1ZG1 A;  3L00 A;  3WOD F;  3KZZ A;  1HW5 A;  2W85 A;  1DPR A;  4DNC A;  1NHA A;  3V4G A;  4EMS A;  4MQV A;  3ZMZ A;  3EYI A;  4HV6 A;  1ZGJ A;  4FT8 A;  2JTV A;  5LGU A;  4HBL A;  5JFR A;  2K86 A;  5FFX A;  4S04 A;  4L9J A;  1T39 A;  5E1Z B;  3ZMU A;  1RUN A;  3JTG A;  2RV8 A;  4L0Y B;  1T38 A;  3J80 Z;  1LJ9 A;  2JPC A;  3E6D A;  2KJC A;  2QZ8 A;  2HTJ A;  2OZU A;  3REO A;  3S2W A;  5JVT A;  3C1D A;  3WU1 B;  4ZYH A;  1ZAO A;  3R60 A;  3IKT A;  5DD8 A;  5K1Y A;  3I64 A;  3DPL C;  1ZAR A;  1KYZ A;  5HS9 A;  3TO6 A;  4I02 A;  3F8B A;  3IWZ A;  2CGP A;  3E5U A;  2RC4 A;  1QZZ A;  4XLN F;  1YS7 A;  2EK5 A;  2HR3 A;  3B02 A;  2Q2E A;  2H27 A;  5L3B A;  5EEH A;  2UZK A;  1YO5 C;  3QPH A;  3K2Z A;  1IN8 A;  2EV0 A;  2EFN A;  1HST A;  4WK8 F;  3FXQ A;  4IRI A;  1L0O C;  2RDP A;  3RYR A;  4AVP A;  2CG4 A;  5DCM A;  3IL2 A;  2D1H A;  5FD5 A;  5L3E A;  3CJN A;  4B09 A;  2PBI A;  3KZY A;  5AIQ A;  4BAY A;  4D0P A;  5K5O A;  2QVO A;  2XKO A;  3QP5 A;  2YU3 A;  1B1B A;  1TQI A;  3KP3 A;  2ISZ A;  2VON A;  3H3U A;  4RGR A;  2M8E A;  2P5K A;  1DUX C;  2YX4 A;  2FOK A;  3I59 B;  4OMY A;  4M6X A;  1Z1D A;  2XGX A;  3IWF A;  4WXH A;  1EV7 A;  1EH6 A;  4KMF A;  3SZT A;  3R4K A;  3W6K B;  2XKP A;  3V7R A;  3BWG A;  2FNA A;  4RB2 C;  3GXO A;  4M9X A;  1LNW A;  3KEQ A;  5DEQ A;  5KVR A;  4NHJ A;  5LBQ A;  4HX7 A;  1R1T A;  2VE8 A;  3JAM Z;  2LF7 A;  2EA4 A;  1RI7 A;  1D3Y A;  2ELH A;  1HQC A;  3KE2 A;  1AOY A;  3NRV A;  3WGG A;  2KJB A;  2XVC A;  2K27 A;  4KDP A;  3ECO A;  3K1M A; 
#chains in the Genus database with same CATH topology
 1X2N A;  1Z7L A;  3KYD B;  3CC7 I;  1A6Q A;  2OJE D;  4BS9 A;  3K70 D;  3K1P A;  4L9T A;  2BE5 F;  1UEL B;  2VOD A;  2XPU A;  3KEO A;  4IHV A;  1ZN2 A;  4GDF A;  2JA6 J;  4IHX A;  3K9T A;  2VXZ A;  3S1M J;  3GLL A;  5M3F J;  4XOP A;  4A3E J;  5FRM A;  3WTT C;  5LGT A;  3IH2 A;  3HOZ J;  3HOW J;  3S32 A;  1OJL A;  2HOE A;  1ETK A;  2RNJ A;  3ABM H;  3SEQ A;  1IDZ A;  4P1W A;  2ESN A;  4IQ4 A;  2VPL A;  4RB3 C;  3I56 I;  1VQN I;  1Y0N A;  1GV2 A;  3UR3 C;  3PUB A;  1Z6T A;  5J8C A;  2VAS A;  3BY6 A;  3PIP F;  2RVC A;  4RGU A;  1TWF J;  4AID A;  2R5Y B;  2F4M B;  1V5G A;  3UNG C;  2IEK A;  3QWL A;  5ICC A;  1LDK B;  4IEJ A;  3WE3 A;  1IXC A;  3EET A;  2QQB A;  3L2C A;  2BOL A;  4W1U A;  4NB5 A;  2L5Q A;  2HVS A;  1T95 A;  3DLA A;  3QYB A;  3K10 A;  5FLV A;  2IS2 A;  4XRM A;  4I7H A;  5IYB J;  3CTA A;  3GME A;  1VQL I;  5BOX A;  1A5J A;  2LDU A;  2O8X A;  3OYK A;  3A4C A;  2E1M C;  1IUY A;  1TQP A;  2V6C A;  1N75 A;  3IH4 A;  1Y1V J;  2H09 A;  2BXZ A;  3PJR A;  5CLS A;  1YQA A;  2LLK A;  1T2K A;  1BI0 A;  1SFO J;  4RGX A;  3HJE A;  4I01 A;  3IV5 A;  3L2V A;  3V8J A;  3M9A A;  4BXX J;  2EH3 A;  3BG7 A;  1U5T B;  1VF9 A;  3ZXS A;  3V7C A;  3NAU A;  2JVG A;  1SVL A;  2ZXJ A;  1P6R A;  3ISP A;  3ZQG A;  2ZFW A;  1GVJ A;  2R7V A;  1Z91 A;  1X19 A;  2M4G A;  4JX4 A;  1R58 A;  2FE3 A;  1JJ6 C;  4IF4 A;  2FQ3 A;  1R1V A;  2HWV A;  2QF7 A;  5E79 C;  3FHN A;  2PJP A;  1FSH A;  3LSI A;  1ODD A;  2IP2 A;  2KIM A;  3HM5 A;  3G4S I;  4QIW N;  1OR7 C;  3TO7 A;  4BQQ A;  2XF6 A;  1YS6 A;  4MGR A;  1XMK A;  4C30 A;  4F3Q A;  2DFI A;  2K9M A;  3KP7 A;  3GFL A;  1EJ9 A;  3MZH A;  1XS9 A;  3BQZ A;  1JGG A;  1S29 A;  4JK1 X;  4FE7 A;  1B9N A;  4JX6 A;  4OIR F;  3S93 A;  5FD6 A;  1LFP A;  2YUS A;  2VQC A;  3KP6 A;  5E8I A;  4IL6 C;  5FO5 A;  3IP4 B;  3TGN A;  3PM1 A;  2A69 F;  3CLO A;  3DTE A;  5HLI A;  1YYV A;  5M5Y J;  4A0X A;  1NK3 P;  1Y8R B;  2NNN A;  1QRY A;  2PJR A;  3QPT A;  1ON1 A;  5GP9 A;  4BHB A;  4C2T A;  3FXK A;  3HOY J;  3F22 A;  3PNY A;  1LUJ B;  2CU7 A;  2L02 A;  3HHH A;  2PFB A;  3R0J A;  4MO7 A;  1UZC A;  2OQR A;  4X0G A;  2VOO A;  1D8K A;  5D5X B;  5B5E C;  1TNS A;  3FXM A;  2DMU A;  1ZEL A;  2VC1 A;  4BHC A;  2Q1Z B;  5F27 A;  5IPA A;  4QWQ A;  1BC7 C;  2EZH A;  2PN6 A;  1R1U A;  1X3W B;  4O5V A;  5B3S H;  4LLL A;  5ILS A;  2VBW A;  3GFM A;  4QPO A;  1BIB A;  3C7J A;  4I6Z A;  4OIN F;  2HXI A;  1IN6 A;  2ZME C;  3O8H A;  4P55 A;  2NVT J;  2WAE A;  1USS A;  5F0F A;  2FU4 A;  3ZQH A;  3IC7 A;  1W36 D;  1ETX A;  4YIF A;  1MBK A;  4XKW A;  2LR8 A;  4UVC A;  4A3K J;  2TRT A;  1VQK I;  2DMP A;  4EQQ A;  4IHW A;  2Y31 A;  3F3X A;  3IKV A;  4ASN A;  4JP0 A;  2RRE A;  3CCU I;  3GTQ J;  3WHC A;  3J81 K;  2VT2 A;  2IGK A;  4HDV A;  4YII A;  1A36 A;  1Z21 A;  4LIV A;  5L3G A;  2DJI A;  2R7X A;  2M7B A;  2EIL H;  4P9F A;  2O7O A;  2F5E A;  3QYE A;  2DCE A;  5IP7 J;  5LGN A;  3LST A;  4TV7 A;  1YOV B;  3OYJ A;  3FBN B;  3VYT B;  4IHS A;  2UUZ A;  1VQ6 I;  3BPV A;  4CZZ A;  1HKS A;  3ROU A;  3SDG A;  4A69 C;  2QM3 A;  2X6Y A;  2HS5 A;  1GLN A;  1BOB A;  4YRV A;  1XDU A;  2LRD A;  1K6Y A;  1X2M A;  1U6G A;  3CUQ A;  3GTM J;  3GTO J;  1O3S A;  3DBR B;  4IHY A;  1G4D A;  4A93 J;  2DA5 A;  1J7K A;  3VOD A;  4QLC U;  2DDB A;  3FXL A;  3FBI B;  1T8I A;  1DGR M;  3BTL A;  4I0B A;  2IS1 A;  2Q8K A;  2DN0 A;  3H9G A;  3EUH A;  3NEU A;  2HYJ A;  2HZT A;  4NUB A;  4HA8 A;  2QQA A;  4KN7 X;  2KP6 A;  2WB1 A;  1YJN I;  3FKJ A;  2FF4 A;  2QWW A;  1L3L A;  2R7T A;  4HNU A;  4CHU A;  5H6Q A;  1W0T A;  2Y48 A;  4Y33 A;  1YIT I;  2ZSI B;  1Y0U A;  4YG2 F;  4A3J J;  1UAA A;  2QSH X;  1M1E B;  2MA3 A;  2WWY A;  2ESH A;  3MCZ A;  4CZC A;  1HW1 A;  2KIF A;  2XHK A;  3Q0V A;  1D1A A;  3LAJ A;  3LOC A;  2DA6 A;  4RAZ A;  2STT A;  1U5T C;  1XGN A;  1QHG A;  2CFO A;  2EFO A;  3KFW X;  1S6L A;  3CES A;  4RAG A;  4ZZL A;  1P92 A;  5KK1 A;  3VDX A;  3ZQ7 A;  3MQ0 A;  4M6V A;  2XAH A;  4HZF A;  3V8K A;  3J80 K;  2O3F A;  4Y3O A;  3VSL A;  2H8W A;  2H94 A;  3KP5 A;  2JA5 J;  3HTU A;  1W5S A;  3DKW A;  3ZMV A;  2Y9Y A;  1P7J A;  2KLO A;  3F23 A;  1GVD A;  2MD0 A;  2JUC A;  2MC4 A;  3TL4 X;  2EZK A;  1XX5 A;  1LDD A;  1HF0 A;  4KT5 C;  2MG4 A;  1AKH B;  2YSR A;  3VWB A;  3E97 A;  3O6B B;  2R5Z A;  5LEK A;  5H6R A;  2L54 A;  5M5W J;  4KUM A;  3MFK A;  3BJO A;  5J4Y A;  2X9D A;  4LG3 A;  2O6G E;  4ZJZ A;  2H1K A;  1RC9 A;  3I71 A;  2A6H F;  2OC6 A;  4F91 B;  2A6E F;  5EF6 A;  4HG2 A;  2A6T A;  4D5C A;  2MGQ A;  1XSX A;  2ZME A;  1OCT C;  3RSN A;  3IUO A;  3KP4 A;  4AVZ A;  1IRF A;  4LK0 F;  1K83 J;  4UV9 A;  2X0L A;  1ORK A;  3M8E A;  4X6A J;  4IRH A;  3OYD A;  3OWT A;  2JWT A;  2X51 A;  3HKZ N;  2Y75 A;  3OV8 A;  3F6V A;  1WJF A;  3N05 A;  5FFZ A;  4JYK A;  2BY3 A;  1ZRD A;  4XLC A;  3TMO A;  2EFP A;  4EVI A;  3SZP A;  4EM0 B;  1WPK A;  2ZJQ F;  1IV8 A;  3V42 A;  2XF7 A;  2L9R A;  2DU9 A;  1S8N A;  3C3W A;  4BEH B;  3OYI A;  1HBX G;  4YFK F;  1MBH A;  1YG2 A;  2L3D A;  3BTI A;  4P9U A;  4M71 A;  2MLG A;  2QBY A;  2DT6 A;  2ID3 A;  3H0D A;  5B1B H;  4WCG A;  4XLE A;  1F1Z A;  3CMY A;  1YRN A;  2FRH A;  1U9N A;  1TLH B;  4CO8 A;  2IA1 A;  1JXS A;  3E3V A;  4FET A;  1HDP A;  2CRG A;  4Q4Z F;  1DP7 P;  5IT9 Z;  4M9Z A;  2DOD A;  2LG4 A;  1ACI A;  4BJ6 C;  2QA4 I;  3CCJ I;  2XAU A;  1STZ A;  2K3F A;  2W84 A;  3BOQ A;  2D45 A;  2ECB A;  2QLZ A;  2QQ9 A;  3CC2 I;  2LBF B;  2LY9 A;  4PFP A;  3HSR A;  1ZTR A;  2XC7 A;  5FRO A;  1W7P A;  2M0M A;  2JA8 J;  2CW7 A;  2LOO A;  1APL C;  1S7E A;  1FLI A;  2IRF G;  1Y39 A;  2FQ4 A;  5C44 J;  4BJ5 C;  3A0H C;  1MW7 A;  3FMQ A;  1KU9 A;  4XL9 A;  3K4K A;  4FX4 A;  3G1M A;  4QPQ A;  5CJ9 A;  1QGP A;  4QSH A;  1H9T A;  1KYW A;  4Y13 A;  3LSK A;  3TOA A;  1OYW A;  2HNH A;  4XLH A;  2RKH A;  1SFX A;  2V79 A;  1IW7 F;  1OMI A;  2P5V A;  1RUO A;  3DQV C;  1FWZ A;  4MFE A;  5F0H A;  4A3L J;  4JBA A;  2GZW A;  4JQF A;  5E17 F;  2PMH A;  3FXR A;  3RYP A;  2HGC A;  3HUG A;  5FLX Z;  3OIP A;  3SFZ A;  5B1A H;  4EJW A;  3BZK A;  4AIJ A;  2Y9Z A;  2DMQ A;  3F8M A;  1QPI A;  2F2E A;  2XAG A;  3JRI A;  2WY8 Q;  3RDI A;  4I0A A;  4MLO A;  4NC6 A;  1K79 A;  1FYK A;  4KIB A;  4OU0 A;  1GXQ A;  2ZXH A;  2A07 F;  5C4X J;  3C2H A;  1PP7 U;  2ZNY A;  2G9W A;  2KRC A;  2VBZ A;  4G6T B;  2CV1 A;  4BDY A;  3RI4 A;  3RKY A;  5JVG F;  5LD2 C;  2P6S A;  2Z5U A;  2DA3 A;  3TQN A;  3CJR B;  5GAD J;  4RDU A;  3VOE A;  3CCR I;  3DEW A;  4L0Z B;  1FNN A;  4D1Q A;  1OPC A;  1G6N A;  1R7J A;  1GHC A;  3W2W A;  2OU2 A;  4GCV A;  5D8K B;  2UXN A;  3U9G A;  4PZJ A;  1XSV A;  3QYF A;  2IPQ X;  1HSJ A;  1K61 A;  3BTC A;  1TW2 A;  1KU3 A;  1UHS A;  4DYR A;  1X1B A;  1ZHF A;  1TNT A;  1LEB A;  3M3Y J;  1XCB A;  1MGT A;  3FXU A;  1N25 A;  2K5C A;  1GT0 C;  3LFK A;  1XMX A;  3HOS A;  3CUQ B;  5TJJ A;  1MMN A;  1FIP A;  3FMS A;  2L9N A;  4DZJ A;  4MEY F;  3HRT A;  2L01 A;  2OD5 A;  2R5Y A;  2VC0 A;  3HGY A;  1RIO H;  1PP8 F;  3K70 C;  4V2G A;  3BPX A;  2V9V A;  1MDM A;  1YLF A;  2L9S A;  4J00 A;  2QCO A;  2BY0 A;  1JKR C;  3M4O J;  3GZ6 A;  1I6H J;  2M4K A;  3KCC A;  1GUU A;  5J40 A;  3AG3 H;  4XLP F;  3M8F A;  3ZQI A;  2CYY A;  1Z67 A;  5KAF C;  3LSM A;  4PJM A;  2LD5 A;  1J09 A;  5E8G A;  4ENN A;  4IOA F;  2NS7 A;  4XOR A;  1J9I A;  3G6E I;  1K78 A;  1MH4 A;  1IDY A;  4DBR A;  5D5W B;  3CF5 F;  3NWT A;  2L7K A;  3CP8 A;  4DJA A;  5DS9 A;  4MQ9 F;  2NVX J;  3HUG B;  3I5U A;  1B59 A;  1CGP A;  2F48 A;  5D6E A;  3GX4 X;  2HOT A;  3U1D A;  5EDN A;  2JUG A;  1H0M A;  3BZ6 A;  1CF7 B;  4LLN A;  2CV0 A;  2DI3 A;  5CYV A;  3FM3 A;  1R71 A;  1YJ9 I;  3S2D J;  4G94 A;  2CUF A;  3ERE D;  3JW4 A;  3ZOB A;  4GYG A;  4MTE A;  1FOW A;  2ZC2 A;  1IN7 A;  1V5E A;  1IGN A;  4Y17 A;  2M8G X;  1SD5 A;  4M3G A;  4IXA A;  1TWC J;  1R22 A;  2CH0 A;  5LHI A;  2CW0 F;  3O8G A;  3EUA A;  1ZQ3 P;  2EZL A;  3MEX A;  4GXO A;  1W7P B;  3BP8 A;  3PNV A;  4OIQ F;  2DLL A;  2DQR A;  4HX4 A;  4R1H A;  5EEA A;  5HNF A;  4YIR X;  2LF8 A;  3FK6 A;  3HKZ A;  5J1Y A;  3KX2 A;  4OWR B;  3RQ4 A;  3L2W A;  2VT3 A;  1JGS A;  3DP7 A;  5J3L A;  4ETS A;  2CSO A;  3BR6 A;  1H9G A;  2NVY J;  3I53 A;  3J7Y J;  4LG0 A;  4KFC A;  1TTY A;  4ESF A;  3V7S A;  5LHG A;  1XSD A;  3K1N A;  3ULQ B;  2KQR A;  2FX0 A;  3O3K A;  4KYW A;  1BI1 A;  3PQK A;  3JRC A;  3JR9 A;  1F9N A;  2ISY A;  3ZQL A;  1R5I D;  3QU3 A;  3TW6 A;  1V3F A;  2EB7 A;  3H92 A;  3RKX A;  2OAZ A;  1LPQ A;  2P7C B;  2FBK A;  4CYC B;  3CLQ A;  2M5W A;  3BJ6 A;  1I1S A;  5ED4 A;  2P8T A;  1XTA A;  1BW6 A;  1QO0 D;  1UG2 A;  2MAB A;  2WV1 A;  3TED A;  1V55 H;  3PUF A;  2C6Y A;  2XGD A;  4RM3 A;  1MBG A;  2DQL A;  3S2H J;  2STW A;  3OYM A;  2MSY A;  2ID6 A;  3CMM A;  2W82 A;  3KYC B;  3SXY A;  1DQU A;  2DTR A;  1YW9 A;  5GAH J;  1XCV A;  4OIP F;  2LH9 A;  3GTG J;  4CUG A;  4ENJ A;  4ZDP A;  2W48 A;  4LG0 B;  1KQ0 A;  1UJ8 A;  3BCB A;  3FZV A;  3VYR B;  4LB5 A;  1IF1 A;  3WTY C;  2DAO A;  3QQA A;  4RAF A;  4A3C J;  5ILV A;  1WHU A;  3EUK L;  1OCZ H;  2MD5 A;  3I3L A;  1SD6 A;  2ZBK A;  2JN6 A;  2CMP A;  3RZO J;  3I54 A;  1MMD A;  5DCF A;  1P9Q C;  4RS8 A;  1UCR A;  3ZPL A;  3ASO H;  5DCM B;  5F0C A;  3ZCO A;  5E3N A;  4NC7 A;  5IOZ A;  3AKZ A;  2H6C A;  3R0A A;  4KT6 A;  2OTJ I;  2R7U A;  1QZY A;  3K2A A;  3H0G J;  3WTX C;  2AHQ A;  1WJD A;  2O03 A;  3E0J B;  2JMW A;  3JRF A;  3E5Q A;  2JA2 A;  2CJJ A;  4QTR A;  1WRJ A;  2HFH A;  4DW6 A;  1D8J A;  1YX5 A;  1JUP A;  3W2A A;  4DIQ A;  4ENK A;  4HF0 A;  4BNC A;  1TWH J;  1U8R A;  3L09 A;  3NAR A;  2KIS A;  3FX3 A;  4M3B A;  5J8F A;  4HNV A;  2V9K A;  1U0J A;  1LVA A;  1VZ0 A;  1PUE E;  2X85 A;  1TBX A;  2NOJ B;  1FJL A;  2IS4 A;  1FOY A;  4L5E A;  2D2W A;  5IP6 A;  3MMY B;  4V2F A;  2DDA A;  2IA0 A;  5GPA A;  4EAT A;  1R36 A;  3L2Q A;  3FXO A;  3GBG A;  1T33 A;  2TDX A;  1NG7 A;  4A0Y A;  2B7E A;  1XN7 A;  3JTH A;  1YE9 A;  4ON0 A;  4M3E A;  2A5Y B;  2MH9 A;  4LOC A;  3E6M A;  3I9V 2;  4N9H A;  1Q1H A;  3AL0 B;  1T0F A;  4YEJ A;  2DA7 A;  3HOT A;  2BGC A;  3OIO A;  3F8N A;  4HSR A;  1YJW I;  2NOG A;  4ESB A;  1LDJ A;  2M30 A;  1PDN C;  3VSK A;  2VJ4 A;  3VEP A;  3JSO A;  1YIO A;  3GTJ J;  2D1V A;  2ZNZ A;  1VQM I;  1OYI A;  4IO9 F;  1JHH A;  3PO2 J;  3D5L A;  1B8I A;  2K3P A;  2HPI A;  5BS6 A;  2Z16 A;  3BQY A;  4AC0 A;  1FYM A;  2EBI A;  2EIJ H;  2L4A A;  2QUF A;  4LJZ F;  1D0Y A;  4HV5 A;  1X1D A;  2X6O A;  2AO9 A;  3GWZ A;  1U78 A;  2L0K A;  2I5U A;  2ZME B;  5KAI C;  3V8L A;  3HOX J;  1WJB A;  5EEG A;  4LD5 A;  3SJM A;  1IAW A;  2BXY A;  4U88 A;  1WJA A;  1ZGA A;  1BR2 A;  1I39 A;  2XRL A;  1QVU A;  1T0F C;  3N97 A;  1FC3 A;  2CFX A;  2WC2 A;  3HBL A;  4ZC3 A;  2VOP A;  1IJW C;  3H35 A;  1FY7 A;  2IVM A;  2R7F A;  2Y69 H;  4Y4R A;  1HA8 A;  2EA2 A;  3DPT A;  3MVP A;  3EPZ A;  2PI0 A;  1EH8 A;  1Z3X A;  4AWX B;  2LVS A;  3QOP A;  4CCL A;  3M7G A;  2BVM A;  1QNT A;  5IT3 A;  2F4I A;  2HEO A;  3HSF A;  3RKW A;  3S8P A;  5A2Q Z;  1FTT A;  4D9J A;  2J5P A;  4A2U A;  4WF2 A;  3FMR A;  4ZH4 F;  2VKH A;  2XGC A;  4IRG A;  1J5Y A;  1XPX A;  2F5V A;  5HDK A;  1UG0 A;  1WFX A;  3I0T A;  2GIV A;  3QOE A;  4XMY A;  3SQN A;  4AYB A;  3PQJ A;  2AQF A;  4KN4 X;  1K7A A;  2OA4 A;  2VJJ A;  2KDZ A;  4KA4 A;  5K5R A;  1WI3 A;  5IT9 K;  3S1R J;  3MKZ A;  1Z6R A;  4FX0 A;  1IN4 A;  2DYR H;  3DU6 A;  3KLN A;  1FP1 D;  2VL8 A;  3BG6 A;  2K02 A;  3FM5 A;  4EM1 A;  1W36 C;  3GTP J;  4BBR J;  1IRZ A;  4I99 C;  1I6X A;  1OKR A;  1R00 A;  2N8G A;  3WTZ A;  1J0R A;  1XC5 A;  4C2U A;  2MC3 A;  2DXI A;  2GBY A;  3OMY A;  1OQY A;  3T8T A;  1SC7 A;  2E5N A;  3Q9S A;  4HW0 A;  5CVV A;  2E2H J;  3F21 A;  1W7P D;  4EJT A;  2YS9 A;  4XM3 A;  2V7F A;  5A2Q K;  3ZMT A;  4UUS B;  2B9S A;  3OYA A;  4RMN A;  2X4H A;  4BY1 J;  4N9I A;  3RPU D;  1TT5 B;  5F6F A;  2XSD C;  3K4C A;  4AIH A;  3HPH A;  2R7O A;  1UMQ A;  3LA3 A;  2O8K A;  4II2 A;  3WU2 C;  5E1X A;  5HLG A;  2KIU A;  2VKD A;  1DDN A;  1REP C;  2QSG X;  2XDV A;  3BG5 A;  1POG A;  3DFG A;  3F72 A;  3SEZ A;  1E3H A;  3E1S A;  2GXG A;  1BA5 A;  2FBH A;  4RM2 A;  5FB2 A;  2OTL I;  5DTD A;  2JRT A;  3ASN H;  2HTS A;  3OR2 C;  2EFW A;  3P5J A;  3CO7 C;  3LQQ A;  4WXD A;  3I59 A;  5HOO A;  4G7H F;  4HF2 A;  4CYC A;  1QQI A;  3A0B C;  5HLT A;  5FLX K;  2G0E A;  1DU0 A;  3SDB A;  1PUF B;  2ECC A;  5K7Z A;  4GO1 A;  1TWA J;  1UST A;  2O9L A;  1QU3 A;  2LMD A;  4BHP A;  1WI9 A;  4PJJ A;  4ABZ A;  4RAY A;  1O7L A;  2PQ8 A;  5HDN A;  2P4W A;  3K4N A;  3T8R A;  3WTW C;  4RLQ A;  2DFH A;  2K9L A;  4L9N A;  1RPW A;  3H9Q A;  3C2G A;  1X1C A;  2Y2Z A;  5HS7 A;  2DA1 A;  3I58 A;  4XNF A;  1BJZ A;  4XLA A;  4ESJ A;  3T0Y A;  4HQM A;  1EKE A;  2JPB A;  5E3O A;  1I3Q J;  3ZN0 A;  2A61 A;  3HRS A;  1JTX A;  5FKM A;  5C3E J;  2OUM A;  1PYV A;  1MNE A;  4XN0 A;  1FMW A;  1ZLK A;  4HOB A;  5IYD J;  1R5G A;  1HW2 A;  1P4W A;  1Q1V A;  3WTS C;  3MWM A;  4BUP A;  4E7H A;  3BG9 A;  3G3Z A;  5D5V B;  2EV5 A;  1X3Z B;  1IUF A;  1Y1W J;  4BXF A;  5FJ8 J;  1FPQ A;  4X1E A;  2AXL A;  1T08 B;  3HC7 A;  3M1E A;  3G1L A;  1SFE A;  4GFB A;  2W1O A;  3L7W A;  3HEF A;  4XR6 A;  2QQ8 A;  1FBU A;  2FMY A;  5E20 A;  1IC8 A;  3BDD A;  1RNL A;  2CQX A;  2AQE A;  5FKO A;  4BL0 B;  1X58 A;  2HOS A;  4A5M A;  2ME0 A;  2GIZ A;  3E6C C;  1O3T A;  1OCO H;  2H1L A;  1FBS A;  2LNB A;  4E7Z A;  4GYI A;  5J47 A;  2QYO A;  1MJA A;  4NNJ A;  1ON2 A;  3W6J B;  3D1N I;  1O3R A;  2CV2 A;  3H1C A;  2NRA C;  3OYF A;  3LQR A;  5TGT A;  1H8A C;  3TDZ C;  4XKB A;  1S5L C;  2HQR A;  3U2R A;  2OCE A;  2D5V A;  1G3Y A;  1WJE A;  5L3F A;  3IHU A;  3HG9 A;  4ZYE A;  5EJC A;  5KNL A;  1JJ8 C;  1WH5 A;  3LAP A;  2DOF A;  3CCQ I;  2X6W A;  2DBB A;  4UUS A;  1LQ1 A;  1JKP C;  4C2M J;  1HCR A;  1OYY A;  3DV8 A;  1TL8 A;  2GXB A;  1UFM A;  1WJC A;  3OY9 A;  4NQW B;  2WAQ N;  3LSJ A;  1KQ9 A;  3S3M A;  4H0E A;  1AWC A;  3E5X A;  4KNY A;  2ETH A;  2JT1 A;  3BC8 A;  1IV6 A;  1SAN A;  3BZC A;  1JT0 A;  5TRD A;  2XAQ A;  1SMY F;  2XAS A;  3HSE A;  2HDD A;  3FKI J;  3OYG A;  4XRS A;  2GXA A;  2GAU A;  2NNY A;  4L9V A;  5H20 A;  1BJA A;  3OS0 A;  3E7L A;  4A3B J;  2AXT C;  1KGS A;  1MH3 A;  1HC8 A;  4HST A;  4B48 A;  3DLL F;  3S3O A;  1E2X A;  1LEA A;  1QZE A;  1JUS A;  2KRH A;  2LC2 A;  4AYB N;  5IOY A;  1R49 A;  4N4N B;  3B6A A;  1BN5 A;  5ERI A;  2EQR A;  3KYL A;  2VE9 A;  3LA7 A;  1BC8 C;  4UUT A;  3HXL A;  3ZGK A;  1IO2 A;  3F8C A;  3WGI A;  3ESW B;  4UHT A;  2G7U A;  4U87 A;  3DCF A;  5C4J J;  1NG6 A;  1D1B A;  4ZTJ A;  5FKK A;  4UY8 I;  2WY7 Q;  2E1C A;  3AAF A;  1YIJ I;  3N4M A;  2V26 A;  3HHG A;  1ETY A;  3F9K A;  5DDG A;  2YPR A;  2DA4 A;  1RKW A;  1TQM A;  1FSE A;  4U0V A;  2L2O A;  5KHD A;  2RGV A;  2YX7 A;  5JLX A;  3PIO F;  2ZJR F;  3AG4 H;  2A68 F;  2OV7 A;  1W5T A;  1X1P A;  1WWX A;  4PJ0 C;  1PJR A;  5CVR A;  1PVE A;  4JOM A;  4BU2 A;  3OSF A;  3FHZ A;  1G2H A;  1LE8 B;  3MAJ A;  3S15 J;  3J7A O;  4XRF A;  2EZI A;  1MJ9 A;  2K4J A;  3CCE I;  5LRS A;  1G8X A;  3OYB A;  5ICE A;  4BYY A;  2QEN A;  5F1J A;  2WTE A;  2VQL A;  4MIM A;  2GWR A;  4OMZ A;  4MHG A;  4CCN A;  1NK2 P;  1SFK A;  5D5U B;  2H6B A;  4NQW A;  1F43 A;  1MD0 A;  5EYR A;  1RR8 C;  2JSC A;  3HTS B;  1FT9 A;  3DEU A;  4UV8 A;  1G59 A;  1F4K A;  1F36 A;  1E17 A;  2W24 A;  1Y6I A;  2COB A;  4Q47 A;  4PGH A;  1G3S A;  3G73 A;  2V1D A;  4BBS J;  4DZP A;  3G1O A;  1J2X A;  4AU7 A;  1B72 B;  4BGD A;  5L3C A;  2ADU A;  4R8H A;  4KIG A;  4HQE A;  4OOI A;  3TP3 A;  1ZRF A;  5EG0 B;  2NVU B;  4U0Y A;  3J81 Z;  5BPI A;  1OCR H;  3CCM I;  1MMG A;  2BEO A;  4PJL A;  1VFC A;  1PUF A;  1ETO A;  1S7O A;  4MNU A;  3H3V K;  5DUK A;  2R7Q A;  2NS8 A;  2JSP A;  2R7W A;  3SHF A;  5LFA A;  1YW8 A;  5GPC A;  4BQA A;  2HKX A;  4LB6 B;  3P9K A;  3JRE A;  2K4B A;  5HS8 A;  1OIS A;  1ZRC A;  4HAM A;  2LSO A;  4AD9 A;  1ONV A;  2X48 A;  4EM2 A;  4M3D A;  3BG3 A;  2GA2 A;  2OPT A;  3OYH A;  4ZDO A;  3QRF F;  3PFI A;  5IP9 J;  2EV6 A;  1U8B A;  3FIS A;  1GV5 A;  2O0Y A;  4P96 A;  3CUO A;  3DEE A;  3K4M A;  4PCQ A;  1A6I A;  2M34 A;  1ZR2 A;  2HDC A;  4I76 A;  2BV6 A;  1C0W A;  1JI8 A;  1AHD P;  2P5L C;  2XAF A;  4UUV A;  2MBF A;  4G7Z F;  2FOW A;  2P0W A;  5LEJ A;  1YFH A;  1DP3 A;  4EGY A;  3PNT A;  4BY7 J;  3LWF A;  4IQJ A;  4M9S A;  2HVQ A;  1F5T A;  2GM4 A;  4XKV A;  1ZYR F;  2IGO A;  1G3T A;  3VFZ A;  2E71 A;  4ITV A;  2HYF A;  4LIU A;  4PFO A;  2ZKZ A;  4O6J A;  2Z9O A;  1LE8 A;  5D8L B;  3KLO A;  2FML A;  3R6S A;  1JHF A;  1OR7 A;  2ZJP F;  1N77 A;  1EH7 A;  4L5J A;  3ERM A;  3H9J A;  2DMN A;  3LFU A;  5AON A;  4A0Z A;  1J59 A;  4J19 A;  3H36 A;  2COM A;  1YW7 A;  3BR5 A;  2VLA A;  1WJ5 A;  2Z99 A;  3IRQ A;  2NAZ A;  4PJN A;  4MTD A;  4M6Y A;  3WTU C;  1ENH A;  1XB4 A;  4HLY A;  4YFX F;  5K7H A;  2E35 A;  3HRM A;  1LFB A;  3GCM A;  2Q2E B;  1I1G A;  1BR1 A;  3BCA A;  4BE1 A;  1VQ7 I;  2I10 A;  4IZZ A;  2ZCW A;  3GVA A;  4U7B A;  2E19 A;  1T98 A;  3NQO A;  4II3 A;  4E4H A;  2VPR A;  2CQ7 A;  5JI6 A;  3H5R A;  3GO5 A;  2MFZ A;  2LTP A;  1ZKG A;  1R6R A;  3MZ8 A;  2KRF A;  3D5S C;  3HGG A;  4LFU A;  3HYI A;  3GUD A;  4ZYD A;  4Y15 A;  1J75 A;  2P7V B;  1FTZ A;  3GLX A;  1U5T A;  2FNP A;  2VKE A;  2F6C A;  4ENM A;  1ZG5 A;  1NH3 A;  3ZRG A;  2HOA A;  3ZQF A;  1HLV A;  2DK5 A;  1RZ4 A;  5DV5 A;  1XMA A;  3DBL B;  4IJA A;  1KZH A;  2DT7 B;  4DBQ A;  2DJN A;  2XRN A;  2ME6 A;  3KET A;  3T5X A;  3MKL A;  2MH2 A;  4E7I A;  5IYC J;  3LSH A;  1Z77 A;  2FXA A;  2ELK A;  2VB6 A;  2KZG A;  4GRI A;  4CDG A;  4HYE A;  4F55 A;  2NYX A;  1QBJ A;  2WB1 N;  2VBX A;  4KMU X;  4ZYG A;  1LKX A;  1MBE A;  4CGZ A;  3OSG A;  4CSW A;  3Q5F A;  2XV4 S;  2FJ1 A;  2L7M P;  3RPU A;  4EGZ A;  1R5H A;  2LRE A;  1V5F A;  5DYM A;  3K7A J;  3A01 A;  3ZMS A;  2E36 A;  1FP2 A;  3CDI A;  4RB1 A;  2BYV E;  2JZY A;  2Z3Y A;  4S05 A;  1H89 C;  2OQG A;  2W00 A;  1CF7 A;  3A2K A;  4CIC A;  3EQL F;  3K0L A;  4XSX F;  3LL7 A;  5BPD A;  3H3Z A;  5H2F C;  2QKL B;  3ABU A;  2GOM A;  1W5C C;  3RCO A;  2WA0 A;  4NC8 A;  1O57 A;  4B8X A;  4M72 A;  1JKQ C;  1I27 A;  1UHM A;  2PMZ N;  5F1R A;  2FEZ A;  4KJZ A;  5HOD A;  5DD4 A;  3EDP A;  2M7A A;  5K5Q A;  4FCY A;  1KQ8 A;  4AM3 A;  1XGO A;  3O2P E;  4NBQ A;  1Z3Y A;  1H88 C;  5E1W A;  4IVN A;  2HYG D;  3GFI A;  3CC4 I;  2FUG 2;  3MD2 A;  3K69 A;  1MDM B;  3BRO A;  4FQG A;  1S3J A;  4RGS A;  1BR4 A;  3WGH A;  4W97 A;  3AG1 H;  5CQE A;  2E34 A;  1N78 A;  2EWN A;  4N4O B;  3TOB A;  3PFY A;  3S14 J;  5TIS C;  3JRH A;  2DO7 A;  1W1W E;  1KA8 A;  4IPA A;  4XRS G;  4CA0 A;  4HDU A;  3ZMD A;  2UWM A;  4L5I A;  2Y30 A;  4E7S A;  2NS0 A;  4N0B A;  4Q48 A;  3WTV C;  2W57 A;  1CQT A;  3W6V A;  3JCU C;  3DU5 A;  1MIJ A;  3GEZ A;  3RTR A;  1WQ2 A;  2BW3 B;  1P7I A;  2XIG A;  3RPQ A;  1T6S A;  4KIF A;  4XLF A;  2XRO A;  4WX9 A;  1K4T A;  1SD4 A;  2W4S A;  3GTL J;  4LGW A;  3TBI A;  2OBP A;  4DOZ A;  4G9Y A;  1ITY A;  4O3M A;  5ICF A;  4E7J A;  2RN7 A;  2E2I J;  1I5Z A;  4BEH A;  4RBO A;  5E18 F;  3NWS A;  2E1N A;  3GFJ A;  2F4O B;  2R7D A;  3CUQ C;  3P9I A;  4G6Q A;  2Z33 A;  3T1B A;  1JKO C;  2QEX I;  3OYC A;  4UXN A;  2JQ7 A;  5CKT A;  4A5N A;  1LVK A;  5GAG J;  2DW4 A;  3WG9 A;  4FAS D;  3FK7 A;  4XON A;  2M87 A;  5ILU A;  3EUH C;  1R23 A;  2BZT A;  5HDG A;  2OZ6 A;  2ZXW H;  2GQQ A;  2DPD A;  3Q0W A;  2W25 A;  3A02 A;  4PDK A;  1I50 J;  4ZZD A;  2F5C A;  2E60 A;  3D0S A;  2M9H A;  4IX7 A;  1ZRE A;  4OIO F;  3QU6 A;  3OOP A;  4LLG F;  3UKG A;  1U2W A;  1VTN C;  1FOX A;  2VBY A;  4NDL A;  3CO6 C;  1ETW A;  1FOK A;  5LLQ A;  3TDU C;  2P81 A;  1HXD A;  3WU0 A;  2HQN A;  1JE8 A;  1S9H A;  2EJR A;  4RA2 A;  4A3I J;  1P2F A;  1SAX A;  4BH9 A;  2HKO A;  2K7L A;  2M3A A;  2Y0S A;  4OAY A;  4PSX A;  3W3C A;  4WWC A;  2CS3 A;  3BT9 A;  3CJT B;  6PAX A;  1GDT A;  3TP0 A;  3P7N A;  4ZDL A;  3A03 A;  5JHU A;  3JSP A;  3K4J A;  2RQP A;  2DA2 A;  1Y56 A;  3HL2 A;  2JA7 J;  5K7F A;  3ELK A;  4E70 A;  1IG7 A;  4D7N A;  1W0U A;  4M74 A;  1YRN B;  2QSF X;  3C18 A;  5CVU A;  1D5Y A;  1P4A A;  3E6B A;  1YHQ I;  2MLK A;  2K9S A;  2QBY B;  1NTC A;  1G3W A;  1KU7 A;  5F04 A;  2ZJ2 A;  3HRU A;  5E3L A;  4EEF G;  1XGS A;  3G71 I;  4I2O A;  1R4M B;  2DOA A;  3CDL A;  3VPR A;  4CYD A;  4I98 B;  5JHF A;  2HXO A;  1X4O A;  1O4X A;  2VQG A;  3BR1 A;  3FIW A;  3CCV I;  1RES A;  1WH7 A;  2ACJ A;  2L9V A;  5FKN A;  1FBQ A;  3HOU J;  3F8F A;  1IXS B;  5EG0 A;  3BR3 A;  2FSW A;  2KZV A;  4KIC A;  3VYU B;  1XGM A;  2O5R A;  4YEL A;  2PMU A;  4UNO A;  4B44 A;  3RIR A;  1WCM J;  2IS6 A;  4M73 A;  4A3D J;  3RJP A;  1DPU A;  1U3E M;  4GGG A;  3OL4 A;  2MW8 A;  2E5Z A;  4EJU A;  3DXJ F;  1ETQ A;  4Y7N J;  3DKX A;  1FX7 A;  4HF1 A;  2ICW G;  3JAM K;  1BIA A;  3WG7 H;  3S17 J;  1FYL A;  3PSI A;  2IT0 A;  4F92 B;  3OOU A;  3GZN B;  4XQF A;  1S7A A;  5BMZ A;  1VQ5 I;  1IZ1 A;  4K2E A;  3OYL A;  3AFH A;  1A04 A;  5E3M A;  5HNH A;  1IRX A;  3KPH A;  3GTK J;  3L9F A;  4EV0 A;  2JVH A;  2L7F P;  4G6D A;  4G8X A;  2DMT A;  3LNQ A;  4WXC A;  1MJB A;  5F08 A;  3GW2 A;  4FHT A;  3ZQC A;  2BHY A;  2IW5 A;  5BQT A;  2YR2 A;  3MN2 A;  1D5V A;  1WSU A;  3CZ6 A;  2ZB9 A;  3ABT A;  4HEA 2;  1XD7 A;  1IRG A;  3COA C;  3WE2 A;  1QVT A;  2M1B A;  4BE2 A;  5LRR A;  2L4M A;  3S16 J;  1BI3 A;  2VN2 A;  2FBI A;  2K9Q A;  2E7W A;  3ZQQ A;  4LMY A;  1O3Q A;  4PSW A;  2XPW A;  4DYQ A;  3HOV J;  5ICG A;  5EGO B;  1MMA A;  2A05 A;  2B0L A;  2IJL A;  3WHB A;  4H4K C;  5IY5 H;  4XKC A;  1A35 A;  2V1U A;  4C3J J;  4D7M A;  2X1D A;  1YI2 I;  2IGM A;  3SZG A;  4FTH A;  3Q9V A;  3BLY A;  1HKQ A;  2RQQ A;  4B3X A;  5M5X J;  1RRJ A;  4XBF A;  3GF2 A;  3A1Y A;  4EJV A;  1D0Z A;  4R79 A;  1WVR A;  3Q0U A;  3L1P A;  1LB2 A;  4FE4 A;  1Z7U A;  1VND A;  2LYC A;  3KP2 A;  4DQ2 A;  5FRN A;  1ZG3 A;  2TCT A;  2CO5 A;  1OLT A;  2BBY A;  4UVB A;  4F7Z A;  3I4M J;  2LKP A;  2ZFU A;  2HVR A;  3OYE A;  1AA7 A;  2DK8 A;  3BR2 A;  3VYS B;  2CQQ A;  4U7D A;  2W7N A;  4CCK A;  5J4V A;  1OFC X;  2ZXI A;  3U1K A;  1ERD A;  3ML6 A;  2GLO A;  2A3S A;  1TW3 A;  1HOM A;  3F0C A;  1WGX A;  3GZ5 A;  2V1N A;  3P9C A;  4P5O A;  2WV0 A;  1HKT A;  2K40 A;  1E3P A;  4Q5S F;  2GOX B;  3TKY A;  2LK2 A;  2HDW A;  5B66 C;  2VQH A;  3DBH B;  2LFB A;  3I4N J;  1ZR4 A;  3LA2 A;  2LY2 A;  3B73 A;  5FGM A;  3FDY A;  3QPS A;  3TO9 A;  3D5R C;  2RNG A;  3ZN1 A;  4E7K A;  4CCO A;  3VB2 A;  4JX5 A;  3LSR A;  2XUB A;  2CQK A;  2X1C A;  2OCC H;  2CWE A;  1U9O A;  2KHM A;  3DTI A;  1A31 A;  1EA3 A;  2E7X A;  3SFI A;  1R9T J;  5AIP A;  2QGU A;  4HLX A;  4RB0 A;  4A3G J;  2DOE A;  1FZP B;  1WKM A;  5HLH A;  1D0X A;  1X1A A;  2NXN B;  4MEX F;  3R61 A;  2HPM A;  1RKT A;  1BW5 A;  3QOD A;  2GA1 A;  2KDO A;  5F64 A;  5GTH C;  1SAU A;  4UVA A;  4Z2Y A;  3CQZ J;  2UXX A;  5KCM A;  3OS1 A;  3F6O A;  4XK4 A;  2V1X A;  1ZH5 A;  4I09 A;  3GYH X;  2XAJ A;  2NVQ J;  2V4J C;  5D6F A;  4A6E A;  1MSF C;  2IGN A;  3QPL A;  3QP6 A;  3HIF A;  2R7Z J;  4B1R A;  5CVI A;  3AL0 C;  1B9M A;  2EIM H;  2Q0O A;  4EJO A;  1QA6 A;  2I8D A;  3IRR A;  1IN5 A;  1MKM A;  1B6A A;  1K6O A;  2CUZ A;  3EYY A;  4ZYA A;  3HPG A;  2M45 A;  2DT5 A;  3FWE A;  2VJI A;  2Y0M A;  2F5F A;  3H5N A;  1BBY A;  3I4P A;  2PMZ A;  1MZB A;  1ULY A;  5CQG A;  2R4G A;  3CCS I;  3G2B A;  2DPU A;  2XSJ C;  5LHH A;  1MBF A;  4CCJ A;  4CH7 A;  3DKY A;  1FIA A;  4HX8 A;  1SFU A;  2J5O A;  2PLY A;  2VJ5 A;  5EGO A;  1SVO A;  3FF5 A;  4L18 B;  2IXS A;  2PEX A;  2WAF A;  3H5A A;  1K78 B;  1XDS A;  5L3D A;  2DTZ A;  2M0C A;  3ABK H;  2BVL A;  3Q3S A;  3S3N A;  2Z2S B;  1SMT A;  1ZLJ A;  3DF8 A;  4PUS A;  2KPM A;  4YFN F;  3CD6 I;  3IH3 A;  4PGG A;  4CXF A;  1OCC H;  1IXR C;  1BL0 A;  3SYT A;  2XB5 A;  3HB9 A;  4UB6 C;  3BTJ A;  4A3M J;  1YTY A;  2IA2 A;  1X4P A;  3PSF A;  3ZP5 A;  3CCL I;  5D4R A;  1O7F A;  3PL8 A;  3JRB A;  4F93 B;  4A12 A;  1KU2 A;  4Z6Y A;  1QPM A;  5CVJ A;  4BKX A;  2LP0 A;  4G7O F;  4ANJ A;  2O61 A;  3MZY A;  4XN3 A;  3CDH A;  4DYC A;  2Y0S N;  3OR1 C;  3BJA A;  2AS5 F;  1DU6 A;  3ECH A;  1W4M A;  2R3S A;  2FD5 A;  4LK1 F;  2PG4 A;  2F5D A;  2JJ7 A;  5JR3 A;  2R93 J;  1BOA A;  1SD7 A;  2P6T A;  1DGW Y;  2ZO4 A;  4U0W A;  1UB9 A;  2M2E A;  1VQP I;  3J7A Y;  2BY2 A;  5J1U A;  4MFD A;  4IHT A;  1B4A A;  2H8R A;  3K4L A;  4A6D A;  4BDZ A;  1V4R A;  3QAH A;  5CPR B;  3L2R A;  1B8I B;  2EFQ A;  2R7R A;  3JRD A;  2DFF A;  5D4S A;  2FA5 A;  2UV1 A;  5J1R A;  1YX3 A;  2KKO A;  1UHW A;  1GXP A;  3M8J A;  1JT6 A;  2ZSH B;  3OL3 A;  1P4X A;  5FLM J;  4XSZ F;  5DUI A;  2X1E A;  2R5Z B;  5EZH A;  2LKS A;  1AKH A;  4BXU A;  1BM9 A;  4AIK A;  1TC3 C;  1VQ8 I;  4C3I J;  1X3U A;  2G7H A;  5HVQ C;  2OF7 A;  1Z05 A;  5J6X A;  1BI2 A;  1Z9C A;  1ZG1 A;  1MMS A;  2CW8 A;  4V19 K;  3L00 A;  4BE0 A;  1OCP A;  3WOD F;  3J7Z I;  2X6X A;  3KZZ A;  2E1M B;  1HW5 A;  3OS2 A;  2W85 A;  2CQN A;  1DPR A;  4DNC A;  1NHA A;  3V4G A;  2KT0 A;  4EMS A;  4J01 A;  4MQV A;  3JRA A;  2V9P A;  3MKY B;  3ZMZ A;  1HDD C;  5M3M J;  3JRG A;  3EYI A;  4C3H J;  1QHH D;  4HV6 A;  1ZGJ A;  3KEY A;  3ABL H;  1TZL A;  1MND A;  3CJQ B;  4FT8 A;  2JTV A;  5LGU A;  3B6C A;  4HBL A;  3IAM 2;  5JFR A;  5FKL A;  1MSE C;  1RET A;  2K86 A;  5FFX A;  2XF5 A;  3LMM A;  3RQI A;  2E1O A;  3AG2 H;  4L9J A;  2VIX A;  4S04 A;  1T39 A;  1Y8Q B;  2A5W A;  1TWG J;  5E1Z B;  1I3A A;  2YU9 J;  3ZMU A;  1RUN A;  3S1Q J;  2JK3 A;  4Y52 J;  1FMV A;  3JTG A;  4OAZ A;  2RV8 A;  3LSP A;  2R0Q C;  4L0Y B;  5BNG A;  1T38 A;  4AUX A;  3J80 Z;  1LJ9 A;  2JPC A;  3E6D A;  2KJC A;  2QZ8 A;  2HTJ A;  2OZU A;  2LBF A;  1ETV A;  3REO A;  3S2W A;  2MYS A;  2R92 J;  5JVT A;  4IOC F;  2WBM A;  1V54 H;  1SVM A;  1T56 A;  3C1D A;  3C2B A;  3WU1 B;  4ZYH A;  3W2V A;  2L7Z A;  1ZAO A;  3R60 A;  3IKT A;  5DD8 A;  5K1Y A;  4XOT A;  3I64 A;  3DPL C;  3KZI C;  1ZAR A;  1KYZ A;  5HS9 A;  3TO6 A;  2BHZ A;  1VQO I;  2DFE A;  1VI0 A;  1MBJ A;  4I02 A;  1D1C A;  4F52 A;  3F8B A;  3IWZ A;  2E2J J;  2EIK H;  3FXJ A;  2CGP A;  2KFD A;  3E5U A;  2R7S A;  3HDD A;  3I55 I;  2RC4 A;  4XIC A;  1QZZ A;  4XLN F;  2DYS H;  4IKF A;  2CUE A;  2ELJ A;  4DGW B;  1YS7 A;  2EK5 A;  2XB0 X;  4B3A A;  1MNM C;  1K4S A;  2BW3 A;  2CUJ A;  2HR3 A;  3B02 A;  2EPF A;  2Q2E A;  2H27 A;  5L3B A;  2K85 A;  5EEH A;  2UZK A;  1SEU A;  1WZ2 A;  1YO5 C;  1Z0X A;  3CF2 A;  3QPH A;  4CCM A;  3K2Z A;  1IN8 A;  2EV0 A;  4RLF A;  4C9Y A;  4B47 A;  2EFN A;  1AU7 A;  2WAD A;  4E6K G;  3CP2 A;  1VQ9 I;  2B63 J;  1R4N B;  1JTY A;  2KMU A;  4BJT A;  1ZGW A;  1JUM A;  2XPV A;  3K4B A;  1HST A;  2IAI A;  4WK8 F;  4G12 A;  3FXQ A;  2V6E A;  5DM7 F;  2HQA A;  3M07 A;  3X2Q H;  4BAC A;  4IRI A;  1L0O C;  2RDP A;  3RYR A;  3RZD J;  5EZG A;  4AVP A;  2CG4 A;  2VI6 A;  2WAQ A;  4M3F A;  4S0H B;  5DCM A;  3IL2 A;  2VKV A;  2D1H A;  2XGE A;  5FD5 A;  2HQ5 A;  5L3E A;  3CJN A;  4B09 A;  2PBI A;  3KZY A;  4D5F A;  2PJR B;  5AIQ A;  1XG1 A;  4BAY A;  2Z1D A;  4D0P A;  5K5O A;  2QVO A;  4B4C A;  1S72 I;  5GAE J;  2XKO A;  2PX9 A;  2YU3 A;  3QP5 A;  4ZTF A;  1B1B A;  1FEX A;  2KIQ A;  1TQI A;  4HPQ A;  2QKM B;  3KP3 A;  2ISZ A;  2VON A;  3H3U A;  3OYN A;  1E0E A;  3DPU A;  4RGR A;  3CME I;  2M8E A;  2P5K A;  1DUX C;  1KON A;  2YX4 A;  4LIT A;  3ONQ A;  2LY1 A;  2FOK A;  1RR7 A;  3I59 B;  4FIS A;  4OMY A;  3RKQ A;  3TW7 A;  3S1N J;  3ZR8 X;  4M6X A;  3A01 B;  1Z1D A;  2XGX A;  3IWF A;  4WXH A;  1TT0 A;  1EV7 A;  1EH6 A;  3CCY A;  1E3O C;  1TP4 A;  3LSG A;  3R4K A;  3SZT A;  4KMF A;  2HI3 A;  3W6K B;  3OIQ A;  5DM6 F;  2XKP A;  3DTK A;  1VQ4 I;  2IBD A;  3V7R A;  4A3F J;  3BWG A;  5JLW A;  1B72 A;  2JRM A;  2FNA A;  4RB2 C;  3GXO A;  3CMA I;  4M9X A;  1LNW A;  2LKX A;  2K9N A;  3KEQ A;  3L2U A;  5DEQ A;  5KVR A;  2HU9 A;  2BY1 A;  4HNT A;  4NHJ A;  5LBQ A;  4KIS A;  3PO3 J;  4BQN A;  2KL4 A;  1R1T A;  1ZK8 A;  2VE8 A;  4HX7 A;  4BQO A;  1EF4 A;  4UB8 C;  2HZD A;  4HRI A;  4XID A;  3IAS 2;  3U21 A;  3BR0 A;  3JAM Z;  2VUM J;  2LF7 A;  2EA4 A;  3DWL E;  1RI7 A;  1D3Y A;  2ELH A;  1HQC A;  4KIT B;  3KE2 A;  1AOY A;  3NRV A;  3WGG A;  3MKW B;  4E7L A;  2KJB A;  2XVC A;  2K27 A;  2RAE A;  3KIO A;  4KDP A;  2VXD A;  4B43 A;  3M1C A;  3ECO A;  3K6G A;  1LFU P;  5GTI C;  2EIN H;  9ANT A;  4PK4 A;  3K1M A;  3HZJ A; 
#chains in the Genus database with same CATH homology
 3K1P A;  4L9T A;  2BE5 F;  2VOD A;  3KEO A;  1ZN2 A;  3K9T A;  2VXZ A;  3WTT C;  5LGT A;  2HOE A;  2RNJ A;  2ESN A;  4RB3 C;  1Z6T A;  5J8C A;  3BY6 A;  2RVC A;  4RGU A;  5ICC A;  1LDK B;  3WE3 A;  3L2C A;  1IXC A;  3EET A;  2QQB A;  4NB5 A;  4I7H A;  3CTA A;  5BOX A;  2LDU A;  2O8X A;  1IUY A;  1TQP A;  2V6C A;  2H09 A;  5CLS A;  1YQA A;  1T2K A;  1BI0 A;  4RGX A;  4I01 A;  3V8J A;  3M9A A;  1U5T B;  3V7C A;  2ZXJ A;  1P6R A;  3ISP A;  2ZFW A;  1GVJ A;  1Z91 A;  1R58 A;  2FE3 A;  4IF4 A;  2FQ3 A;  1R1V A;  2HWV A;  2PJP A;  1FSH A;  1ODD A;  2IP2 A;  2KIM A;  3TO7 A;  1YS6 A;  4MGR A;  1XMK A;  2DFI A;  3KP7 A;  3GFL A;  3MZH A;  1S29 A;  4JK1 X;  1B9N A;  4OIR F;  5FD6 A;  3KP6 A;  5E8I A;  5FO5 A;  3TGN A;  2A69 F;  3CLO A;  5HLI A;  1YYV A;  4A0X A;  2NNN A;  3QPT A;  1ON1 A;  4BHB A;  3F22 A;  2L02 A;  3HHH A;  2PFB A;  3R0J A;  2OQR A;  2VOO A;  1D8K A;  5D5X B;  1TNS A;  2VC1 A;  4BHC A;  4QWQ A;  1BC7 C;  2PN6 A;  1R1U A;  4O5V A;  4LLL A;  5ILS A;  2VBW A;  3GFM A;  1BIB A;  3C7J A;  4OIN F;  1IN6 A;  4P55 A;  1USS A;  2FU4 A;  3IC7 A;  4YIF A;  4UVC A;  4EQQ A;  3IKV A;  3F3X A;  4ASN A;  3J81 K;  2VT2 A;  4HDV A;  4YII A;  5L3G A;  4P9F A;  2F5E A;  5LGN A;  3LST A;  4TV7 A;  4IHS A;  3BPV A;  4CZZ A;  1HKS A;  3ROU A;  2QM3 A;  2HS5 A;  1XDU A;  1U6G A;  3CUQ A;  1O3S A;  1G4D A;  1J7K A;  3VOD A;  4QLC U;  4I0B A;  2Q8K A;  3EUH A;  3NEU A;  2HZT A;  4HA8 A;  2QQA A;  4KN7 X;  2FF4 A;  2QWW A;  1L3L A;  4CHU A;  5H6Q A;  2Y48 A;  1Y0U A;  4YG2 F;  2MA3 A;  2WWY A;  2ESH A;  3MCZ A;  1HW1 A;  2KIF A;  2XHK A;  3LAJ A;  2STT A;  4RAZ A;  1U5T C;  1XGN A;  2EFO A;  3KFW X;  1S6L A;  4ZZL A;  1P92 A;  5KK1 A;  3ZQ7 A;  3MQ0 A;  2XAH A;  4HZF A;  3V8K A;  3J80 K;  2O3F A;  2H94 A;  3KP5 A;  3HTU A;  1W5S A;  3DKW A;  3ZMV A;  3F23 A;  1LDD A;  4KT5 C;  2YSR A;  3E97 A;  3O6B B;  5LEK A;  5H6R A;  2L54 A;  4KUM A;  3MFK A;  3BJO A;  2O6G E;  3I71 A;  2A6H F;  2A6E F;  2ZME A;  1XSX A;  3KP4 A;  1IRF A;  4LK0 F;  4UV9 A;  2X0L A;  3M8E A;  4IRH A;  2Y75 A;  3OV8 A;  3F6V A;  5FFZ A;  1ZRD A;  2EFP A;  4EVI A;  3SZP A;  4EM0 B;  2DU9 A;  1S8N A;  3C3W A;  1HBX G;  4YFK F;  1YG2 A;  2L3D A;  4P9U A;  4M71 A;  2MLG A;  2QBY A;  4WCG A;  1F1Z A;  2FRH A;  1TLH B;  4CO8 A;  2IA1 A;  1JXS A;  3E3V A;  4Q4Z F;  1DP7 P;  5IT9 Z;  4M9Z A;  1STZ A;  2W84 A;  3BOQ A;  2D45 A;  2QLZ A;  2QQ9 A;  3HSR A;  1W7P A;  1FLI A;  2IRF G;  3FMQ A;  1KU9 A;  4FX4 A;  5CJ9 A;  1QGP A;  1H9T A;  1KYW A;  4Y13 A;  3TOA A;  1OYW A;  2RKH A;  1SFX A;  2V79 A;  1IW7 F;  1OMI A;  2P5V A;  1RUO A;  3DQV C;  1FWZ A;  4JBA A;  2GZW A;  4JQF A;  5E17 F;  2PMH A;  3FXR A;  3RYP A;  2HGC A;  3HUG A;  5FLX Z;  3SFZ A;  4EJW A;  4AIJ A;  3F8M A;  2F2E A;  2XAG A;  3RDI A;  4I0A A;  1K79 A;  1FYK A;  4KIB A;  4OU0 A;  1GXQ A;  2A07 F;  1PP7 U;  2ZNY A;  2G9W A;  2VBZ A;  3RI4 A;  3RKY A;  2P6S A;  2Z5U A;  3TQN A;  3VOE A;  4L0Z B;  1FNN A;  1OPC A;  1G6N A;  1R7J A;  1GHC A;  2OU2 A;  4GCV A;  5D8K B;  2UXN A;  3U9G A;  4PZJ A;  1XSV A;  2IPQ X;  1HSJ A;  1TW2 A;  1KU3 A;  1ZHF A;  1TNT A;  1LEB A;  1XCB A;  1MGT A;  3FXU A;  3LFK A;  3HOS A;  3CUQ B;  5TJJ A;  3FMS A;  4MEY F;  3HRT A;  2L01 A;  2OD5 A;  2VC0 A;  1RIO H;  1PP8 F;  3BPX A;  2V9V A;  1MDM A;  1YLF A;  3GZ6 A;  3KCC A;  4XLP F;  3M8F A;  2CYY A;  5E8G A;  4ENN A;  1J9I A;  1K78 A;  5D5W B;  4MQ9 F;  3I5U A;  1B59 A;  1CGP A;  5D6E A;  3GX4 X;  3U1D A;  1H0M A;  1CF7 B;  3BZ6 A;  4LLN A;  2DI3 A;  5CYV A;  3FM3 A;  4G94 A;  3ERE D;  3JW4 A;  4GYG A;  4MTE A;  1IN7 A;  4Y17 A;  1SD5 A;  4IXA A;  1R22 A;  5LHI A;  2CW0 F;  3MEX A;  4GXO A;  1W7P B;  3BP8 A;  4OIQ F;  2DLL A;  2DQR A;  4HX4 A;  4R1H A;  2LF8 A;  2VT3 A;  1JGS A;  3DP7 A;  4ETS A;  2CSO A;  1H9G A;  3I53 A;  4LG0 A;  4KFC A;  1TTY A;  4ESF A;  3V7S A;  5LHG A;  1XSD A;  3K1N A;  3ULQ B;  3O3K A;  4KYW A;  1BI1 A;  3PQK A;  1F9N A;  2ISY A;  3QU3 A;  1V3F A;  2EB7 A;  3H92 A;  2P7C B;  2OAZ A;  3RKX A;  2FBK A;  2M5W A;  3BJ6 A;  1I1S A;  5ED4 A;  2P8T A;  2C6Y A;  1QO0 D;  2DQL A;  2STW A;  3SXY A;  2DTR A;  1YW9 A;  4OIP F;  1XCV A;  4ENJ A;  4LG0 B;  1KQ0 A;  4LB5 A;  3FZV A;  1IF1 A;  3WTY C;  2DAO A;  5ILV A;  2MD5 A;  1SD6 A;  2ZBK A;  3I54 A;  5DCF A;  4RS8 A;  1UCR A;  3ZPL A;  5DCM B;  2H6C A;  3R0A A;  1QZY A;  3WTX C;  2O03 A;  3E5Q A;  1WRJ A;  2HFH A;  1D8J A;  4ENK A;  4HF0 A;  4BNC A;  1U8R A;  3L09 A;  3FX3 A;  5J8F A;  1LVA A;  1PUE E;  1TBX A;  2D2W A;  2IA0 A;  1R36 A;  2TDX A;  4A0Y A;  1XN7 A;  3JTH A;  4ON0 A;  2A5Y B;  2MH9 A;  4N9H A;  3E6M A;  1Q1H A;  1T0F A;  3HOT A;  2BGC A;  3F8N A;  4ESB A;  1LDJ A;  2M30 A;  1PDN C;  3VEP A;  3JSO A;  1YIO A;  2D1V A;  2ZNZ A;  1OYI A;  1JHH A;  3D5L A;  5BS6 A;  1FYM A;  2QUF A;  2L4A A;  4LJZ F;  4HV5 A;  3GWZ A;  1U78 A;  2ZME B;  3V8L A;  5EEG A;  4LD5 A;  1IAW A;  4U88 A;  1ZGA A;  3N97 A;  1FC3 A;  2CFX A;  2WC2 A;  2VOP A;  1FY7 A;  2IVM A;  2R7F A;  2EA2 A;  3DPT A;  2PI0 A;  1EH8 A;  4AWX B;  3QOP A;  2HEO A;  3M7G A;  1QNT A;  5IT3 A;  3HSF A;  3RKW A;  5A2Q Z;  2J5P A;  4A2U A;  4WF2 A;  3FMR A;  4ZH4 F;  4IRG A;  1J5Y A;  5HDK A;  3I0T A;  2GIV A;  3SQN A;  3PQJ A;  4KN4 X;  1K7A A;  2OA4 A;  4KA4 A;  5K5R A;  5IT9 K;  1Z6R A;  4FX0 A;  1IN4 A;  3KLN A;  1FP1 D;  2K02 A;  3FM5 A;  4EM1 A;  1I6X A;  1OKR A;  1R00 A;  3WTZ A;  1J0R A;  2MC3 A;  3T8T A;  3Q9S A;  4HW0 A;  5CVV A;  3F21 A;  1W7P D;  4EJT A;  5A2Q K;  3ZMT A;  2X4H A;  4N9I A;  5F6F A;  4AIH A;  3LA3 A;  5E1X A;  5HLG A;  2KIU A;  1REP C;  1DDN A;  3DFG A;  3F72 A;  2GXG A;  2FBH A;  5FB2 A;  2JRT A;  2HTS A;  2EFW A;  3CO7 C;  3LQQ A;  4WXD A;  3I59 A;  5HOO A;  4G7H F;  4HF2 A;  1QQI A;  5FLX K;  4GO1 A;  1UST A;  4BHP A;  1WI9 A;  4RAY A;  1O7L A;  2PQ8 A;  5HDN A;  2P4W A;  3T8R A;  3WTW C;  4L9N A;  5HS7 A;  3I58 A;  4ESJ A;  3T0Y A;  4HQM A;  2JPB A;  3ZN0 A;  2A61 A;  3HRS A;  1ZLK A;  4HOB A;  1R5G A;  1HW2 A;  1P4W A;  3WTS C;  3MWM A;  3G3Z A;  5D5V B;  2EV5 A;  1FPQ A;  2AXL A;  3M1E A;  1SFE A;  3L7W A;  1FBU A;  2FMY A;  5E20 A;  3BDD A;  1RNL A;  4A5M A;  3E6C C;  1O3T A;  1FBS A;  2LNB A;  4GYI A;  2QYO A;  1MJA A;  1ON2 A;  3W6J B;  1O3R A;  2NRA C;  3LQR A;  3TDZ C;  2HQR A;  3U2R A;  1G3Y A;  5L3F A;  3IHU A;  4ZYE A;  3LAP A;  2DBB A;  1LQ1 A;  1OYY A;  3DV8 A;  2GXB A;  1UFM A;  1KQ9 A;  4H0E A;  1AWC A;  3E5X A;  4KNY A;  2ETH A;  2JT1 A;  5TRD A;  2XAQ A;  1SMY F;  2XAS A;  3HSE A;  2GAU A;  2NNY A;  4L9V A;  5H20 A;  1BJA A;  1KGS A;  1E2X A;  1LEA A;  1BN5 A;  5ERI A;  2VE9 A;  3LA7 A;  1BC8 C;  3F8C A;  3WGI A;  4UHT A;  2G7U A;  2E1C A;  3AAF A;  3N4M A;  3HHG A;  5DDG A;  2YPR A;  1TQM A;  1FSE A;  4U0V A;  2RGV A;  2YX7 A;  2A68 F;  1W5T A;  1WWX A;  5CVR A;  3FHZ A;  3MAJ A;  3J7A O;  4XRF A;  1MJ9 A;  2K4J A;  5LRS A;  5ICE A;  4BYY A;  2QEN A;  2WTE A;  2GWR A;  4OMZ A;  4MHG A;  5D5U B;  2H6B A;  4NQW A;  1MD0 A;  2JSC A;  3HTS B;  1FT9 A;  3DEU A;  4UV8 A;  1F4K A;  1E17 A;  2W24 A;  4Q47 A;  4PGH A;  1G3S A;  3G73 A;  2V1D A;  1J2X A;  5L3C A;  2ADU A;  4R8H A;  4KIG A;  4HQE A;  4OOI A;  1ZRF A;  4U0Y A;  3J81 Z;  5BPI A;  2BEO A;  1S7O A;  4MNU A;  5DUK A;  3SHF A;  1YW8 A;  4BQA A;  2HKX A;  4LB6 B;  3P9K A;  2K4B A;  5HS8 A;  1ZRC A;  4HAM A;  2LSO A;  4AD9 A;  1ONV A;  4EM2 A;  2GA2 A;  3QRF F;  3PFI A;  2EV6 A;  4P96 A;  2O0Y A;  3CUO A;  4PCQ A;  2HDC A;  2BV6 A;  1C0W A;  2P5L C;  2XAF A;  4UUV A;  2MBF A;  4G7Z F;  5LEJ A;  1YFH A;  4EGY A;  3LWF A;  4M9S A;  1F5T A;  1ZYR F;  1G3T A;  3VFZ A;  2HYF A;  2Z9O A;  2ZKZ A;  4O6J A;  5D8L B;  3KLO A;  2FML A;  3R6S A;  1JHF A;  1OR7 A;  1EH7 A;  4L5J A;  5AON A;  4A0Z A;  1J59 A;  2COM A;  1YW7 A;  2Z99 A;  3IRQ A;  2NAZ A;  4MTD A;  4M6Y A;  3WTU C;  1XB4 A;  4HLY A;  4YFX F;  3HRM A;  1I1G A;  2ZCW A;  3GVA A;  4U7B A;  1T98 A;  3NQO A;  5JI6 A;  3GO5 A;  2KRF A;  4LFU A;  3HYI A;  3GUD A;  4ZYD A;  4Y15 A;  1J75 A;  2P7V B;  3GLX A;  1U5T A;  2FNP A;  4ENM A;  1ZG5 A;  2DK5 A;  1RZ4 A;  5DV5 A;  1XMA A;  4IJA A;  2XRN A;  3KET A;  3T5X A;  2MH2 A;  2FXA A;  4CDG A;  4HYE A;  2NYX A;  1QBJ A;  2VBX A;  4KMU X;  4ZYG A;  4CGZ A;  3Q5F A;  2XV4 S;  3RPU A;  4EGZ A;  1R5H A;  5DYM A;  3ZMS A;  1FP2 A;  4RB1 A;  2BYV E;  2JZY A;  2Z3Y A;  4S05 A;  2OQG A;  1CF7 A;  4CIC A;  3EQL F;  3K0L A;  4XSX F;  5BPD A;  3H3Z A;  3ABU A;  1O57 A;  4B8X A;  4M72 A;  1I27 A;  1UHM A;  5F1R A;  2FEZ A;  5DD4 A;  3EDP A;  5K5Q A;  1KQ8 A;  1XGO A;  3O2P E;  5E1W A;  4IVN A;  2HYG D;  3GFI A;  3K69 A;  1MDM B;  3BRO A;  1S3J A;  4RGS A;  3WGH A;  2EWN A;  3TOB A;  2DO7 A;  1KA8 A;  4IPA A;  4HDU A;  3ZMD A;  2UWM A;  4L5I A;  2NS0 A;  4N0B A;  4Q48 A;  3WTV C;  2W57 A;  3GEZ A;  3RTR A;  1WQ2 A;  2XIG A;  3RPQ A;  1T6S A;  4KIF A;  2XRO A;  4WX9 A;  1SD4 A;  4LGW A;  2OBP A;  4G9Y A;  4O3M A;  5ICF A;  2RN7 A;  1I5Z A;  5E18 F;  2E1N A;  3GFJ A;  3CUQ C;  2R7D A;  4G6Q A;  3P9I A;  2Z33 A;  3T1B A;  4UXN A;  4A5N A;  2DW4 A;  3WG9 A;  2M87 A;  5ILU A;  1R23 A;  5HDG A;  2OZ6 A;  2GQQ A;  2DPD A;  2W25 A;  4PDK A;  4ZZD A;  2F5C A;  3D0S A;  1ZRE A;  4OIO F;  3QU6 A;  3OOP A;  4LLG F;  1U2W A;  1VTN C;  2VBY A;  3CO6 C;  1FOK A;  5LLQ A;  3TDU C;  1HXD A;  3WU0 A;  2HQN A;  1JE8 A;  2EJR A;  1P2F A;  1SAX A;  4BH9 A;  2HKO A;  2K7L A;  4WWC A;  6PAX A;  3P7N A;  5JHU A;  3JSP A;  2RQP A;  3ELK A;  4E70 A;  4M74 A;  3C18 A;  5CVU A;  1P4A A;  3E6B A;  2MLK A;  2QBY B;  1G3W A;  1KU7 A;  2ZJ2 A;  3HRU A;  1XGS A;  4I2O A;  4CYD A;  4I98 B;  2ACJ A;  1FBQ A;  3F8F A;  1IXS B;  2FSW A;  4KIC A;  1XGM A;  2PMU A;  4UNO A;  3RIR A;  4M73 A;  3RJP A;  1DPU A;  1U3E M;  4GGG A;  4EJU A;  3DXJ F;  1FX7 A;  4HF1 A;  3JAM K;  1BIA A;  1FYL A;  2IT0 A;  1S7A A;  5BMZ A;  1IZ1 A;  4K2E A;  1A04 A;  3L9F A;  4EV0 A;  4G6D A;  4G8X A;  4WXC A;  1MJB A;  3GW2 A;  4FHT A;  2IW5 A;  5BQT A;  2YR2 A;  1D5V A;  1WSU A;  3ABT A;  1XD7 A;  1IRG A;  3COA C;  3WE2 A;  2M1B A;  5LRR A;  2L4M A;  1BI3 A;  2VN2 A;  2FBI A;  2E7W A;  4LMY A;  1O3Q A;  5ICG A;  2B0L A;  2IJL A;  2V1U A;  3Q9V A;  1HKQ A;  4XBF A;  3GF2 A;  4EJV A;  4R79 A;  1LB2 A;  1Z7U A;  3KP2 A;  4DQ2 A;  1ZG3 A;  2CO5 A;  2BBY A;  4UVB A;  4F7Z A;  2LKP A;  2DK8 A;  4U7D A;  3ML6 A;  2A3S A;  1TW3 A;  3GZ5 A;  3P9C A;  4P5O A;  2WV0 A;  1HKT A;  4Q5S F;  3TKY A;  3LA2 A;  3B73 A;  5FGM A;  3TO9 A;  3ZN1 A;  3VB2 A;  2XUB A;  2CQK A;  2CWE A;  2E7X A;  5AIP A;  4HLX A;  4RB0 A;  1FZP B;  1WKM A;  5HLH A;  4MEX F;  3R61 A;  2GA1 A;  5F64 A;  4UVA A;  4Z2Y A;  2UXX A;  3F6O A;  2V1X A;  1ZH5 A;  4I09 A;  3GYH X;  2XAJ A;  5D6F A;  4A6E A;  3QP6 A;  3HIF A;  5CVI A;  1B9M A;  2Q0O A;  4EJO A;  3IRR A;  1IN5 A;  1MKM A;  1B6A A;  1K6O A;  3EYY A;  2M45 A;  2DT5 A;  3FWE A;  2Y0M A;  2F5F A;  1BBY A;  3I4P A;  1MZB A;  1ULY A;  2DPU A;  5LHH A;  4HX8 A;  1SFU A;  2J5O A;  2PLY A;  4L18 B;  3FF5 A;  2PEX A;  1K78 B;  1XDS A;  5L3D A;  1SMT A;  1ZLJ A;  3DF8 A;  4YFN F;  4PGG A;  4CXF A;  1IXR C;  1YTY A;  2IA2 A;  3ZP5 A;  5D4R A;  1O7F A;  4A12 A;  1KU2 A;  1QPM A;  5CVJ A;  2O61 A;  4G7O F;  3MZY A;  2AS5 F;  3CDH A;  3BJA A;  3ECH A;  1W4M A;  2R3S A;  4LK1 F;  2PG4 A;  2F5D A;  5JR3 A;  1BOA A;  1SD7 A;  2P6T A;  2ZO4 A;  4U0W A;  1UB9 A;  4IHT A;  1B4A A;  4A6D A;  1V4R A;  3QAH A;  2EFQ A;  5D4S A;  2FA5 A;  2KKO A;  1UHW A;  1GXP A;  1P4X A;  4XSZ F;  5DUI A;  4BXU A;  1BM9 A;  4AIK A;  1X3U A;  2G7H A;  5HVQ C;  1Z05 A;  5J6X A;  1BI2 A;  1Z9C A;  1ZG1 A;  3L00 A;  3WOD F;  3KZZ A;  1HW5 A;  2W85 A;  1DPR A;  4DNC A;  1NHA A;  3V4G A;  4EMS A;  4MQV A;  3ZMZ A;  3EYI A;  4HV6 A;  1ZGJ A;  4FT8 A;  2JTV A;  5LGU A;  4HBL A;  5JFR A;  2K86 A;  5FFX A;  4S04 A;  4L9J A;  1T39 A;  5E1Z B;  3ZMU A;  1RUN A;  3JTG A;  2RV8 A;  4L0Y B;  1T38 A;  3J80 Z;  1LJ9 A;  2JPC A;  3E6D A;  2KJC A;  2QZ8 A;  2HTJ A;  2OZU A;  3REO A;  3S2W A;  5JVT A;  3C1D A;  3WU1 B;  4ZYH A;  1ZAO A;  3R60 A;  3IKT A;  5DD8 A;  5K1Y A;  3I64 A;  3DPL C;  1ZAR A;  1KYZ A;  5HS9 A;  3TO6 A;  4I02 A;  3F8B A;  3IWZ A;  2CGP A;  3E5U A;  2RC4 A;  1QZZ A;  4XLN F;  1YS7 A;  2EK5 A;  2HR3 A;  3B02 A;  2Q2E A;  2H27 A;  5L3B A;  5EEH A;  2UZK A;  1YO5 C;  3QPH A;  3K2Z A;  1IN8 A;  2EV0 A;  2EFN A;  1HST A;  4WK8 F;  3FXQ A;  4IRI A;  1L0O C;  2RDP A;  3RYR A;  4AVP A;  2CG4 A;  5DCM A;  3IL2 A;  2D1H A;  5FD5 A;  5L3E A;  3CJN A;  4B09 A;  2PBI A;  3KZY A;  5AIQ A;  4BAY A;  4D0P A;  5K5O A;  2QVO A;  2XKO A;  3QP5 A;  2YU3 A;  1B1B A;  1TQI A;  3KP3 A;  2ISZ A;  2VON A;  3H3U A;  4RGR A;  2M8E A;  2P5K A;  1DUX C;  2YX4 A;  2FOK A;  3I59 B;  4OMY A;  4M6X A;  1Z1D A;  2XGX A;  3IWF A;  4WXH A;  1EV7 A;  1EH6 A;  4KMF A;  3SZT A;  3R4K A;  3W6K B;  2XKP A;  3V7R A;  3BWG A;  2FNA A;  4RB2 C;  3GXO A;  4M9X A;  1LNW A;  3KEQ A;  5DEQ A;  5KVR A;  4NHJ A;  5LBQ A;  4HX7 A;  1R1T A;  2VE8 A;  3JAM Z;  2LF7 A;  2EA4 A;  1RI7 A;  1D3Y A;  2ELH A;  1HQC A;  3KE2 A;  1AOY A;  3NRV A;  3WGG A;  2KJB A;  2XVC A;  2K27 A;  4KDP A;  3ECO A;  3K1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...