2DA1A

Solution structure of the first homeobox domain of at-binding transcription factor 1 (atbf1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
GSSGSSGKRPRTRITDDQLRVLRQYFDINNSPSEEQIKEMADKSGLPQKVIKHWFRNTLFKERQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-fetoprotein enhancer binding protein
publication title Solution structure of the first homeobox domain of AT-binding transcription factor 1 (ATBF1)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da1A01
1MBKA 1TWAJ 1GDTA 3ZQFA 2CRGA 4AC0A 3S1NJ 1U9OA 2HOAA 3BR1A 2HI3A 3S1QJ 1NK2P 5DS9A 1H89C 3LOCA 1HLVA 2FD5A 4B1RA 2WV1A 2Y2ZA 3GTGJ 4CYCA 2EZIA 2NS8A 2ID3A 3BT9A 1B8IA 1GV5A 2O8KA 1T56A 4V2GA 1JJ8C 2LD5A 4M3FA 4G12A 3OSGA 1ZK8A 5JLXA 1GVDA 4IHXA 4W97A 5IYBJ 3UKGA 1VNDA 1ETKA 4FE7A 4UUTA 4GFBA 3Q0UA 3M3YJ 1IV6A 4A3KJ 4QSHA 3TW7A 5IP7J 5E3MA 3GTMJ 1DU6A 4DYQA 2Y30A 2M8GX 1YRNA 1VFCA 3BG9A 4JYKA 5F0HA 1XS9A 1APLC 2L0KA 3RQIA 3HOUJ 2P81A 1ZQ3P 2NVQJ 3PO3J 4M3GA 1ETOA 2XPVA 2LTPA 5K7HA 1HDDC 2R5YB 3G1OA 2Y9YA 1K61A 4DW6A 1F36A 4A3DJ 2DMNA 3BQZA 3JRBA 1JT6A 1QVUA 1I50J 2XRLA 1ZTRA 3JRHA 5EG0A 1X2NA 2R5ZA 3S16J 4UUSB 3A01B 2LKXA 3HDDA 3HB9A 5F0CA 3BR2A 4D7MA 2DA1A 2I10A 3Q0VA 4B4CA 3HM5A 4X6AJ 2XB5A 3HBLA 3TP0A 1MBJA 2EQRA 5GPAA 3JRAA 4A3EJ 2R7ZJ 1RESA 1FIPA 3JRFA 1X2MA 3FK6A 4D7NA 1RR7A 3QPSA 2Y31A 3BG5A 2L7ZA 1R9TJ 4JP0A 3SFIA 3BQYA 1F43A 3LSPA 5E3NA 3S15J 1IRZA 1FEXA 2X48A 5F08A 4RDUA 1ETWA 4A3IJ 4FE4A 3C2BA 3CMYA 2ME0A 4XK4A 1HF0A 2QCOA 1XC5A 4A3GJ 3MVPA 4C3HJ 9ANTA 4FTHA 3FK7A 2Y0SN 2VI6A 5M3FJ 1B72B 1WH7A 5FKOA 2EH3A 1MBGA 5F0FA 4NDLA 5M5WJ 3TP3A 2PMZN 3ZQCA 2N8GA 4I6ZA 3QPLA 1U9NA 4EEFG 4S0HB 2NOGA 2XGCA 3S1RJ 4C3JJ 5EYRA 2E2IJ 4IEJA 2TRTA 3S2HJ 4I76A 1OCTC 3JR9A 2DA4A 4A3JJ 1RETA 2K40A 4XRMA 2X6OA 2L7MP 1D5YA 2XPWA 1E3OC 2E2HJ 3RZOJ 1U78A 4MFEA 2B63J 4A93J 4B3AA 3FKIJ 5FKLA 1JJ6C 5HODA 2DMQA 3FIWA 4D5FA 2M2EA 2COBA 2DMTA 1UHSA 1TWCJ 3CDLA 1ETXA 2ID6A 4MFDA 4MLOA 1FTTA 3I4MJ 4IHYA 1QPIA 5IOYA 1PUFA 1H88C 2IBDA 3WHCA 5F04A 3F0CA 1A5JA 5GPCA 5IOZA 1MSEC 2XSDC 5IP6A 5FKMA 1FJLA 4M6VA 2DA2A 2JA6J 3OIOA 3HOWJ 5IP9J 1A6IA 1RPWA 3L1PA 2FQ4A 3CQZJ 4AUXA 5FKNA 1AKHB 1JKOC 1Q1VA 3E7LA 2NVXJ 2LK2A 2M0CA 4XRSA 1MBHA 4LOCA 3GTOJ 1Z0XA 5J1YA 3ZOBA 3ZQGA 4BKXA 1UMQA 4QTRA 3JREA 3GBGA 3GTLJ 2TCTA 2YUSA 3BTLA 3HGYA 1S7EA 5EGOA 1ZGWA 2HXIA 4A3LJ 2LR8A 3HOXJ 3OSFA 1LE8A 5J1UA 1WGXA 2Y9ZA 1ZR4A 4RBOA 3G1LA 1I6HJ 1IGNA 1HDPA 2NVYJ 4DYCA 1GUUA 1Y1VJ 3LNQA 1JUMA 3GTPJ 1NK3P 2ECBA 4A69C 4HNVA 3G1MA 3BR6A 3BR3A 2MW8A 3JRDA 4DZJA 2CUFA 3M4OJ 2XGEA 2ME6A 1XG1A 2CQQA 4CYCB 2G0EA 1K83J 3MN2A 1B8IB 1BW5A 1QRYA 4A3BJ 1JUSA 4AYBN 1JTXA 4DYRA 2AHQA 2R93J 3TEDA 1JKPC 1QVTA 1MH3A 4DZPA 3Q3SA 2DTZA 2AO9A 3GTQJ 3O8GA 2DMPA 4W1UA 1IG7A 1CQTA 3JRIA 2JMWA 4XIDA 1YRNB 2VKVA 3BTCA 1P7IA 5J3LA 4C3IJ 3LSJA 3B6AA 4M3EA 2HOSA 2DN0A 2LY9A 1O4XA 3IH2A 2NVTJ 5C44J 2M9HA 1RKWA 4IHVA 1WPKA 1ITYA 3Q0WA 3BG3A 1LFUP 1FTZA 5K7FA 5EG0B 2WB1N 2RAEA 2R5ZB 3QQAA 4QIWN 2CQXA 2DJNA 2EZHA 1Y1WJ 3RKQA 1SANA 3CCYA 3LSGA 1BJZA 1JUPA 4L5EA 3BTIA 5F1JA 1HCRA 3GTKJ 3D1NI 2JWTA 2CU7A 1AKHA 3HOZJ 1ENHA 3A02A 5EZGA 2L9RA 2YU9J 1JTYA 5EZHA 4BXXJ 3K2AA 3O8HA 3SJMA 3DCFA 3HGGA 5FJ8J 3JRCA 4BY7J 3K7AJ 2LVSA 2JN6A 5JLWA 2K9SA 1Z77A 2QF7A 3HEFA 2CUEA 1EF4A 2X9DA 1WCMJ 1MNMC 3LSRA 2OPTA 2H8RA 2W48A 1AHDP 2DA6A 2R5YA 2IAIA 1UG2A 1ETYA 1RKTA 2K9NA 3PM1A 4A3MJ 1U8BA 3PO2J 1AU7A 3TW6A 1BL0A 3HOVJ 3JRGA 5DTDA 4XRSG 1ZR2A 4UUSA 3A01A 5C4JJ 2JK3A 2MSYA 4BBRJ 2EBIA 2NS7A 1GT0C 3HKZN 1I3QJ 1WI3A 4FISA 1TWHJ 3ZQLA 1JKRC 4IHWA 5M5XJ 4A3CJ 1IDZA 2KT0A 2H1KA 3W6VA 1VI0A 2DA5A 3OOUA 1H8AC 1JT0A 4JX6A 4FCYA 1G2HA 3GTJJ 2FX0A 1ETVA 2MG4A 1IDYA 3I4NJ 4XICA 3S2DJ 3ZQHA 4D5CA 1W0TA 2D5VA 1MBFA 1B72A 3MKLA 3S1MJ 2IEKA 1PUFB 5J1RA 4X1EA 2M34A 2ECCA 1MH4A 1TWGJ 2K9QA 2LLKA 1TC3C 2JA8J 2ZB9A 2OF7A 2E2JJ 2WAQN 2HQ5A 2DMUA 2JJ7A 3S14J 4J19A 1MBEA 2R92J 5FKKA 4M3BA 4Y52J 1OJLA 1GV2A 1ORKA 4BBSJ 1TWFJ 5C4XJ 3ZQIA 2XPUA 3IH3A 5EF6A 5E3OA 1T33A 1IJWC 1ETQA 1JGGA 1ZKGA 2EZLA 3IH4A 2HDDA 2LFBA 1OCPA 2DA7A 2XGDA 2O9LA 5EGOB 2XB0X 2MGQA 4V2FA 1LE8B 2GLOA 3A03A 2YS9A 5FLMJ 5FLVA 2JA5J 1DU0A 2E19A 3VPRA 4JX5A 1LFBA 1WH5A 3WHBA 1POGA 2GBYA 4Y7NJ 5C3EJ 5IYDJ 2HXOA 3DEWA 1HOMA 5K7ZA 3B6CA 2L7FP 5M3MJ 5M5YJ 3BR0A 1MSFC 5EDNA 4M3DA 2VPRA 3IV5A 4ABZA 5E3LA 5GP9A 2R0QC 2HOTA 3NARA 5IPAA 1NTCA 2GM4A 5BNGA 1P7JA 2EZKA 4MIMA 2VKEA 1BW6A 1BA5A 2DA3A 2FJ1A 3NAUA 3BR5A 1SFOJ 1JKQC 3H3VK 2O7OA 2VUMJ 2CJJA 3FISA 5IYCJ 3BTJA 1IUFA 3HOYJ 3S17J 3RZDJ 2E1OA 2LP0A 1X58A 4JX4A 2JA7J 3SDGA 5EEAA 2KDZA 1W0UA 4BY1J 5F27A 3H0GJ 4MO7A 1VF9A 1OFCX 4A3FJ 1IC8A 4C2MJ 2ELKA 2HYJA 1FIAA
chains in the Genus database with same CATH superfamily
2VL8A 1MBKA 1X1DA 3VYSB 5FLXZ 2CRGA 3S1NJ 4BNCA 4IZZA 2HOAA 3QPTA 2HYFA 2CV1A 2XF5A 1MKMA 4F92B 2XAHA 2QM3A 4IO9F 2VIXA 1NK2P 1LDDA 4CSWA 4CCKA 2QQ9A 1H89C 4LIVA 4Y15A 1A04A 4B1RA 1OR7C 1TQPA 1FBQA 2L54A 3E3VA 1J7KA 1D0YA 2DI3A 4CYCA 2XKOA 1B8IA 1EH6A 2O8KA 1T56A 2A5YB 2KRFA 3CLOA 3RCOA 5FFZA 4AD9A 2LD5A 1RC9A 1D1AA 2EPFA 2VBZA 4G12A 4HG2A 5J8CA 3OSGA 1GVJA 1ZK8A 2FQ3A 2MFZA 2R3SA 3CF2A 3CMMA 4HPQA 4WX9A 1GVDA 2DPDA 3WTSC 4DOZA 3SHFA 1W5TA 1PUEE 3I71A 4UUTA 5KK1A 1P4WA 1ZHFA 4DIQA 2E5NA 1ZRCA 3DQVC 4G7HF 1FBUA 3GTMJ 3E6BA 2K7LA 1QNTA 1VFCA 3BG9A 4JYKA 1KU7A 2QSGX 2EJRA 2L0KA 3F9KA 3HHHA 4G9YA 1ZQ3P 5D5UB 1XGOA 5CQGA 5K7HA 3G1OA 3CUQC 4DW6A 2V7FA 2DYRH 3WODF 2AS5F 4A3DJ 2JVGA 3BQZA 1I6XA 3A0BC 1G8XA 2Y75A 5LRSA 5HS7A 2EFWA 3OYCA 2R5ZA 1RUOA 5EJCA 2KJBA 4UUSB 4EQQA 2IT0A 3A01B 2QQBA 3GZ5A 5DDGA 2Z99A 2F5VA 3Q0VA 2I10A 3OYDA 2IJLA 4BJ5C 3HM5A 4X6AJ 3HBLA 1KU9A 2M5WA 1VQOI 1K4SA 4BE1A 3I64A 1SAUA 5GPAA 2CG4A 4L9TA 2ZMEA 2E1NA 3IWFA 3JRFA 4UV9A 1KYWA 5FD5A 2MC3A 5GTHC 4CGZA 4G7OF 3U9GA 3QPSA 1KGSA 5LEKA 2Y31A 1S7OA 3SQNA 1YJNI 4XLAA 3BJ6A 5E3NA 1IRZA 5F08A 1REPC 1WVRA 4FE4A 3D5SC 4L9VA 4NQWB 2ME0A 4CA0A 4V19K 4D1QA 2RNGA 4AVPA 5AONA 2VI6A 3H9GA 2KZVA 1B72B 4RAZA 2CFXA 2OTLI 5CVJA 1MBGA 4G94A 3CO7C 5F0FA 2D1VA 4NDLA 3TP3A 3T8RA 1I1GA 1Z6TA 2N8GA 4GRIA 4M9ZA 3ESWB 4EJUA 1QBJA 2JZYA 3I59B 1U9NA 2JA2A 3BP8A 5DCMB 2PQ8A 4EEFG 2NOGA 4CYDA 4IEJA 2DK5A 1YE9A 3S3MA 4MTEA 3J7YJ 4LGWA 2HPMA 5HNFA 5JVGF 3V7RA 4WK8F 1Y6IA 2E2HJ 3I9V2 2E5ZA 2A61A 2F4MB 3FF5A 4ZYEA 3ABLH 2NS0A 3FKIJ 4E7HA 1JJ6C 2ZNYA 3ZMUA 4Q4ZF 5DCFA 4P9UA 2M2EA 3EUAA 1YS6A 1X4PA 2M87A 5HLTA 1ETXA 2LOOA 1XMAA 3FXRA 5D5WB 4RGRA 3DBRB 4IHYA 5IOYA 2MABA 1EA3A 1R5HA 1TBXA 2VASA 3WHCA 3JTHA 2E7WA 4U0YA 1A5JA 2E60A 2WC2A 3T5XA 3RYRA 1YX3A 4RAYA 3HIFA 5IP9J 1R23A 1RPWA 1V54H 2LY2A 3L1PA 5BPIA 1Z3XA 1YTYA 2W57A 1T08B 4M72A 5ILVA 2BBYA 3MAJA 3K4NA 4XORA 2FMYA 4XRSA 4LOCA 3GTOJ 2O8XA 3OYAA 3HC7A 2Q1ZB 5EEHA 4YIIA 4ON0A 2QENA 2NVUB 1ZGAA 2A3SA 1LPQA 3LAJA 2W24A 5CLSA 4DNCA 5BS6A 4QTRA 3JREA 3WTXC 2FBKA 2YUSA 3BTLA 1Q1HA 2VBYA 4I01A 4ZZLA 5EGOA 1ZGWA 2LR8A 2DLLA 1A31A 4G7ZF 5E79C 3G1LA 3R60A 3G2BA 1GLNA 4B44A 3BJOA 5LD2C 1LEAA 4DYCA 3FX3A 5HS9A 4GCVA 1Y1VJ 1JUMA 4A69C 1YFHA 4HNVA 2CUJA 3BR3A 3D5LA 4Q48A 2QKLB 3BPVA 4B8XA 2RVCA 2VOPA 4EMSA 2KRCA 1U5TC 2CUZA 2PI0A 4OIQF 1BI3A 4F93B 2CQQA 1N75A 2V4JC 3LAPA 3OR1C 1K83J 1WJDA 3M1EA 3H36A 3HTUA 4A3BJ 1XSXA 3FMSA 1JUSA 1LDKB 1LVKA 2DDAA 4AYBN 2KIQA 4DYRA 2AQFA 5DCMA 5JHFA 2R93J 1D0XA 3ELKA 5LHIA 1PP7U 3H9JA 3MD2A 5E1ZB 1U3EM 3Q3SA 4ENNA 2GA2A 4F55A 2DTZA 3VFZA 3K0LA 3MKWB 1FSHA 2O3FA 4W1UA 4UY8I 1Z91A 3HRUA 3FXMA 4HQEA 3L2VA 4XIDA 4ZZDA 4Y13A 1P2FA 1WJFA 1FC3A 3LSJA 3B6AA 4M3EA 2Z16A 2HOSA 3F6OA 3BROA 1IAWA 1LEBA 4P9FA 3OYBA 1RKWA 4IHVA 1XSDA 3GMEA 1RR8C 3AG1H 2VQCA 2GQQA 3X2QH 2Z9OA 3IHUA 5LGTA 5KNLA 5KAFC 1KZHA 2RAEA 3ZMSA 4XKVA 3QQAA 4QIWN 2CQXA 1LUJB 1EKEA 4KIFA 1FBSA 2FEZA 1ZH5A 3CTAA 3JAMZ 1SANA 2FUG2 3BOQA 3CCYA 4DBQA 4L5EA 3BTIA 1KU3A 1B9MA 4U7DA 2R7WA 3HOZJ 1A36A 1J9IA 4WXHA 1MDMB 4S04A 1T6SA 4CO8A 2PEXA 3C7JA 1JTYA 4WWCA 5E17F 2BOLA 1I27A 4UXNA 3K2AA 2V9PA 2A05A 3H5NA 3S2WA 3JRCA 5FO5A 2MBFA 2IW5A 2K9SA 2QF7A 3RJPA 1FZPB 3J7AY 1TL8A 4PJJA 2PX9A 1SD5A 2V26A 3ECOA 3EYIA 5FLXK 1BM9A 4Q47A 4PFPA 1PYVA 1U2WA 2DA6A 4CUGA 4GYGA 2F5CA 2GA1A 3JTGA 3CCRI 1XGNA 1U8BA 3PO2J 5D8KB 2DPUA 2CW8A 4ZDLA 3TW6A 3M1CA 2HVQA 2VB6A 4XRSG 4OAYA 5K5QA 2RNJA 4NC8A 2MSYA 1SD6A 1T0FA 1S8NA 4UB6C 3FM3A 4XSXF 1QPMA 1D8KA 2WTEA 3L2UA 4L18B 2P5LC 1I3QJ 3E6DA 2XAGA 2KFDA 2KLOA 2UV1A 1E2XA 4RGXA 3TO9A 4IHWA 1MMNA 2RREA 3KZIC 2UXXA 3RIRA 4CCMA 4AM3A 2IA0A 2VQHA 3M8JA 3T8TA 4M74A 4OIRF 4XLPF 3CCSI 5HDKA 2FX0A 3HTSB 1ZG1A 2MG4A 1KA8A 3EUKL 3V4GA 3MMYB 2MH2A 2JTVA 3DKXA 2XAQA 3S2DJ 1ERDA 3OL3A 1FWZA 2VONA 2P5VA 5TISC 3MKLA 4XONA 5J1RA 1UAAA 2XHKA 2ECCA 2NXNB 3P9KA 1TWGJ 3KCCA 3PSFA 4KISA 2BY2A 3KEYA 4EM2A 3P9CA 3QPHA 3I5UA 3WG7H 1VQ7I 2HQ5A 3E1SA 2DMUA 3TQNA 1VQ9I 1LQ1A 4CZCA 1D3YA 2GWRA 3CLQA 3S14J 2JUCA 2R92J 3TKYA 1EH7A 3SZGA 1MMGA 3ROUA 4Z6YA 5L3BA 5C4XJ 4A6EA 1IXRC 3J80Z 4AU7A 1DDNA 3S3NA 2M0MA 1R36A 2QGUA 4MQ9F 3VYUB 2HDDA 3MZHA 2XGDA 1AWCA 2XIGA 1LE8B 2O0YA 3A03A 2EFPA 1Y8RB 4BQOA 5IT9K 1WH5A 2QUFA 5H6RA 3WHBA 5D4SA 1OYIA 1POGA 2GBYA 4Y7NJ 5C3EJ 5E8IA 1BR1A 3IKVA 4C2UA 2BVMA 2PMHA 3QYEA 1E17A 5M3MJ 1MSFC 1FYLA 3G6EI 4M3DA 1KU2A 1IN4A 4NNJA 3IV5A 1STZA 4ABZA 2JQ7A 3HSFA 4LLNA 5TGTA 3PQKA 1V5FA 3ABUA 3WU2C 1SC7A 2GM4A 2EZKA 2VKEA 2LRDA 1SFOJ 5D6EA 1JKQC 3H3VK 3UR3C 2VUMJ 3FISA 2IS2A 4FHTA 2BHYA 4A0YA 1IUFA 3HOYJ 5J6XA 2E1OA 3A1YA 2ADUA 1R5GA 3SDGA 5EEAA 3J7ZI 5LBQA 3ZCOA 3T1BA 4MO7A 1QA6A 3EDPA 3QP6A 2HYJA 1BIAA 4B3XA 3BJAA 1A6QA 4ZDPA 1G3YA 1QZEA 3V8KA 4DGWB 4KITB 4E7KA 4GGGA 1MIJA 3DLLF 1V4RA 3GWZA 5JHUA 3F72A 1MJAA 1OLTA 1OYWA 3BY6A 2FOKA 1DPRA 6PAXA 3FDYA 4YIFA 2PN6A 2VJ4A 3E5UA 1W7PA 1QGPA 3PFYA 2FD5A 1OCOH 2Y2ZA 4BJTA 4IQ4A 1GV5A 3QWLA 4OWRB 3VDXA 2FOWA 3BWGA 2L3DA 1JJ8C 2L9VA 2EINH 5JLXA 5HLHA 3ZP5A 4I0AA 1MD0A 4IHXA 5IYBJ 3ULQB 3UKGA 1R22A 3LMMA 4BDYA 4XRFA 3KP6A 3M3YJ 2QZ8A 1QQIA 5IP7J 3DWLE 1SMYF 5E3MA 3S32A 1XB4A 4OMYA 1Z9CA 5F0HA 4AVZA 3ZRGA 1QU3A 2X51A 1APLC 2M45A 3K4LA 3RQIA 3U1KA 1YX5A 3D0SA 2P81A 2COMA 2IGOA 1QHHD 3MZ8A 3HOUJ 2KPMA 2NNNA 1HQCA 1ETOA 2XPVA 5B5EC 2ZJRF 2R5YB 2Y9YA 1YHQI 2DXIA 2KP6A 4U88A 3OYGA 3F21A 2DMNA 2H27A 3IRRA 3IAS2 1D8JA 3BCBA 2DT7B 2KHMA 5DUKA 5D5VB 4FX4A 3BPXA 2XRLA 2K02A 1ZTRA 1WJEA 2KZGA 2LKSA 2VXDA 5EG0A 4A12A 2HPIA 4KA4A 3NRVA 3HDDA 1EJ9A 2V79A 5ICCA 2QEXI 2B0LA 4LITA 1O3RA 3EYYA 2HDCA 4AIDA 3CJRB 2XB5A 4D0PA 1ZARA 2HKXA 3TP0A 2FF4A 3PSIA 4HX7A 3JRAA 4UV8A 4A3EJ 1J59A 4I09A 4LD5A 5CVIA 1RESA 2R7ZJ 2KL4A 2VXZA 1YIOA 2YX7A 3H1CA 3JCUC 1RR7A 3ASNH 3MCZA 3ZMZA 1Z6RA 2X85A 3BG5A 4PFOA 2BW3A 2HZTA 2FSWA 3LSPA 1ZELA 3TBIA 2KIUA 2BV6A 3K9TA 4QPQA 1DGRM 1RI7A 3C2BA 3CMYA 4YIRX 1AA7A 2QCOA 1RRJA 3QODA 1Y0UA 4HZFA 3GVAA 3FK7A 2Y0SN 1Z21A 2L4AA 2LC2A 2R7FA 1H0MA 1G59A 3LSIA 2A68F 4YRVA 2HVRA 2PJRA 2EH3A 1SEUA 1UHMA 2PMZN 2MLKA 5H2FC 2VQLA 4UHTA 1WJBA 3M9AA 2W85A 5KAIC 1LVAA 1TW3A 3GEZA 3S1RJ 1YITI 3CJNA 3I53A 3LSHA 4PUSA 1OCTC 3L7WA 1O3SA 3R61A 2ZXIA 2DA4A 3DTKA 3HYIA 3SYTA 1VTNC 4XRMA 2X6OA 1D5YA 2XPWA 3RZOJ 1FY7A 2VBXA 4Y17A 1U78A 1DPUA 4A93J 1YO5C 1K78A 1JHFA 1SVMA 3OYMA 5HVQC 2QA4I 5ICGA 5CVVA 1UHSA 2OQGA 2XDVA 2JRTA 1S72I 4N9IA 1WI9A 1ZLKA 3KE2A 4MLOA 2L02A 2DJIA 3I4MJ 4NBQA 2G7HA 4XN3A 2KISA 1PUFA 2IBDA 4QPOA 4I99C 2CGPA 4AYBA 1MSEC 3HZJA 1H9TA 1F4KA 1T2KA 1YJ9I 2XSDC 3LFUA 2OZ6A 4M6VA 2DA2A 2HQRA 3PQJA 3OIOA 4LMYA 3VSLA 1XN7A 3DU6A 3IKTA 3KP2A 4BE0A 3HOWJ 2FQ4A 4AUXA 4OINF 1SFKA 2R7DA 1ZGJA 3QOPA 5J40A 5HS8A 4F3QA 1JKOC 3E7LA 1AKHB 2LK2A 1I5ZA 1YLFA 5D4RA 1BN5A 1WRJA 2ELJA 2MLGA 1MBHA 5CVRA 3EPZA 3ABMH 1J09A 1WSUA 2LY1A 4NB5A 4KN7X 1D5VA 2WV0A 1BOAA 3CUQB 4G8XA 2VODA 2M3AA 4YG2F 3H92A 4HX8A 3VB2A 3HGYA 3DV8A 1JI8A 2HXIA 5HDNA 2LH9A 3EUHA 3OYFA 3HOXJ 4A3LJ 3OSFA 3TL4X 2VBWA 3QP5A 4KMUX 2H6BA 4EJOA 3KETA 1I6HJ 2B9SA 1HDPA 2QWWA 1IO2A 1T95A 2EK5A 4U0WA 3LNQA 1X3ZB 2VC0A 3GTPJ 1NK3P 3F23A 4LG3A 4XNFA 4QWQA 4L0ZB 3CP8A 1IUYA 2WY8Q 2XGEA 3L2CA 2HYGD 1E0EA 1TZLA 3GO5A 2F48A 3LA7A 3AAFA 1XG1A 5IY5H 1UHWA 2MC4A 2VOOA 2FBIA 1R00A 4PDKA 1C0WA 2FU4A 3K69A 2W00A 1MMAA 2Z2SB 3KP3A 4HBLA 2HU9A 4FQGA 3KIOA 5FFXA 3J80K 1JKPC 1QVTA 1MH3A 2W4SA 4BHPA 4DZPA 1ZRDA 3QOEA 1D0ZA 2LF7A 3OS2A 3OYLA 1R58A 2AO9A 4N4NB 1G3SA 1VQLI 3GTQJ 3AKZA 3DKYA 3C1DA 1IG7A 5E1WA 1CQTA 2JMWA 4HQMA 4B48A 1YRNB 1P7IA 5J3LA 4C3IJ 3DU5A 2BVLA 1T39A 1U0JA 2VT2A 2WBMA 1R71A 3LA3A 5C44J 2HNHA 3FBNB 4II2A 3TDUC 2F2EA 4E7SA 5HNHA 1XGMA 1IRFA 4ZYGA 1WPKA 2Q8KA 2XC7A 2R7SA 3BG3A 2CQ7A 2ISYA 5K7FA 2WB1N 2JSPA 1Y0NA 1Z3YA 1WJAA 2DJNA 1G6NA 3UNGC 2H94A 2LBFB 2EZHA 1Y1WJ 3WU1B 2IGMA 2RC4A 1T98A 5F1JA 1HCRA 2M7AA 1L3LA 3GTKJ 2CW0F 2JWTA 3F8NA 4NC7A 1AKHA 2E34A 2OZUA 5EZGA 4BS9A 2FMLA 1IF1A 4BQQA 2EV6A 5EZHA 1XDSA 2WY7Q 1G4DA 3O8HA 2H1LA 3GUDA 3K7AJ 2LVSA 3PL8A 4EM1A 3BZ6A 2H6CA 1EF4A 1JXSA 3LSRA 3RQ4A 5BQTA 1D1CA 1GXQA 3F8CA 3SXYA 1LDJA 2H8RA 2ESNA 4YFKF 1HSJA 2ELHA 3GFMA 2B7EA 4ZJZA 3OYNA 1F9NA 1SVOA 3JRGA 1N78A 4EJWA 4EM0B 4UUSA 2A6EF 3G3ZA 3A01A 5L3CA 3H0DA 2RKHA 2EFNA 3V8JA 1OPCA 5HOOA 4ESBA 1K79A 3CCEI 1GT0C 4NUBA 3HKZN 1SFXA 2JT1A 1WI3A 2VKDA 4IJAA 1SAXA 3KYDB 2DOAA 2OTJI 2Z33A 3E97A 3ZQLA 1JKRC 5DYMA 2OBPA 3DPTA 4WF2A 1VQPI 3W6VA 1VI0A 1ZG3A 1HSTA 3OOUA 4G6QA 1K6YA 4PGHA 3AG3H 2DAOA 3OL4A 2M1BA 1OCRH 2DU9A 3NEUA 1XCVA 4JX6A 1G2HA 3OWTA 1VZ0A 1U5TB 1ETVA 2OCCH 4IPAA 1IDYA 3OYKA 2OD5A 4NQWA 4MQVA 4HA8A 2UXNA 4HNTA 3GLLA 5AIQA 4HF2A 4MNUA 4D5CA 1W0TA 1IRGA 5FROA 4DBRA 1B72A 2IEKA 4BU2A 5B3SH 2M30A 2M34A 1ZRFA 1PJRA 3OS1A 3R4KA 3L09A 3I59A 4UNOA 4XKBA 2CMPA 2ZB9A 2PMUA 5DD8A 4MTDA 4CHUA 3HRTA 2JPCA 2WAQN 1GHCA 4H4KC 2JJ7A 1V3FA 2X6XA 1XCBA 2BY1A 2BYVE 3GXOA 2ISZA 2HQAA 4M9XA 2LBFA 5LHGA 1SD7A 2ZCWA 5FKKA 3G73A 1GV2A 1ORKA 4EJVA 1TWFJ 4XQFA 3WU0A 4KYWA 3AFHA 2XPUA 2EZLA 3IH4A 2LFBA 3PNTA 1YQAA 2J5PA 1ULYA 2O9LA 4R1HA 2XB0X 5ED4A 4V2FA 2GLOA 3VYTB 5FLMJ 4CICA 2E19A 4KIGA 2CQNA 5J4VA 1LFBA 1CF7B 2ZXJA 4A5NA 2V9VA 1WZ2A 1W1WE 3DEWA 3MEXA 5K7ZA 3B6CA 2L7FP 4HLYA 2IGKA 2XGXA 3H35A 4BHCA 5M5YJ 2IA2A 4KFCA 5EDNA 2Z1DA 2VPRA 3D5RC 3N97A 1RIOH 2W82A 3K4KA 5E3LA 2E36A 5CJ9A 5GP9A 3QU3A 2R0QC 3O2PE 1PP8F 3OYHA 3E5XA 1P7JA 5J47A 2TDXA 2A07F 1O3TA 1BW6A 1BA5A 2CW7A 4I98B 2UWMA 5LHHA 4MEYF 2CJJA 2XF6A 1B6AA 1KQ8A 2EV5A 3A4CA 2F4IA 2LP0A 1X58A 4JX4A 3GFIA 2JA7J 2X1DA 4RAFA 3DBLB 4BL0B 5F27A 2MD0A 2QKMB 2XROA 4QLCU 3U1DA 5DUIA 1FYKA 1HW1A 1TWAJ 1GDTA 1U5TA 2MD5A 4AC0A 1X1PA 4L5IA 3FMRA 5CYVA 5H6QA 2FNAA 2HI3A 2FA5A 3FHNA 3V7CA 3KYLA 5DS9A 2IGNA 2UZKA 2WWYA 1RZ4A 2G7UA 2WV1A 3GTGJ 2VKHA 4Y3OA 2NS8A 2ID3A 2K4JA 5EEGA 3GYHX 3COAC 2IPQX 3I54A 3ZN0A 4WXDA 2X0LA 2CH0A 3JSOA 4UB8C 2ESHA 5K5OA 2WADA 2L2OA 1ZYRF 1YJWI 3K1MA 4W97A 1VNDA 3PNYA 4FE7A 4GFBA 3Q0UA 4YELA 4HV6A 3CDIA 3RKWA 4QSHA 4A3KJ 1IV6A 3TW7A 3AL0B 2GIZA 2P5KA 2EIMH 2ACJA 1DU6A 2Y0SA 4XKCA 2M8GX 3I56I 2IA1A 5LFAA 4XLHA 1IRXA 1FOKA 4XSZF 3ERMA 3AL0C 3PO3J 2PMZA 2X6YA 2LTPA 1HDDC 3WTZA 2XAFA 1K61A 1CF7A 2DFEA 2D2WA 3DKWA 3JRBA 4UUVA 4IOCF 1QVUA 3V8LA 1I50J 4M6YA 2EB7A 5L3GA 2ZJPF 1X2NA 3S16J 4BXFA 4XR6A 2LKXA 3HOSA 3HB9A 2PFBA 3HRMA 1S9HA 1S29A 4B4CA 2EA4A 2K5CA 1DGWY 4XOPA 3DLAA 4RB2C 4FETA 3W2WA 1B1BA 3ZN1A 1BIBA 1UB9A 3I58A 3VWBA 1MBJA 2EQRA 3M8EA 3I55I 5DM6F 4UVBA 1MNEA 1MDMA 4CZZA 1E3HA 2CV2A 1UELB 2NNYA 1BI0A 2YU3A 1BR4A 2Q2EB 4F52A 3ERED 4A0ZA 4OOIA 1QHGA 4ZYHA 2L7ZA 1SD4A 5HLIA 4JP0A 4LG0B 3J7AO 1F43A 3L2QA 4BUPA 3S15J 4BACA 2X48A 1KONA 1ETWA 4RDUA 3HPHA 4FX0A 1LB2A 2DOEA 1FOYA 4A3IJ 1F5TA 2BE5F 3ISPA 3PNVA 3M07A 4A3GJ 1HKQA 1WKMA 4GXOA 3VOEA 3CDHA 2W25A 5B66C 3MFKA 2YPRA 1WH7A 5FKOA 4C9YA 3ZQ7A 4LJZF 3CMEI 5JR3A 5M5WJ 4HF1A 3ZQCA 1XGSA 3K4BA 5BMZA 2ETHA 2DFFA 3A0HC 4HV5A 1BJAA 4I6ZA 1IN7A 3WTVC 3FXUA 3RPQA 3DEEA 2HTSA 3KP4A 4C3JJ 2VQGA 2E2IJ 4DJAA 4L9NA 4E7ZA 2ZJQF 1OISA 4L9JA 5FB2A 1J2XA 2W84A 3SZTA 5J8FA 4RGSA 4HDUA 4A3JJ 1RETA 2EFQA 1I1SA 4P96A 1E3OC 2R7RA 1R5ID 2B63J 4G6DA 1OYYA 3CZ6A 3HXLA 3DEUA 4B3AA 2DO7A 4PJNA 2VJIA 5HODA 2CQKA 2DMQA 2E71A 3FIWA 3CP2A 2COBA 2DMTA 2X1CA 1TWCJ 4BEHB 2M4KA 3IAM2 3IP4B 4MFDA 4ZH4F 2GXGA 3C3WA 2P8TA 5FGMA 4BE2A 4M71A 2ZBKA 1R1UA 4JK1X 2VJ5A 1UCRA 1Z05A 5F04A 2NAZA 3S3OA 1H88C 2WAFA 4Q5SF 5IOZA 5ICEA 1FMWA 3KX2A 3HJEA 3KZYA 3DPLC 5FKMA 1HC8A 1MW7A 2JA6J 4I2OA 1OMIA 5FKNA 2NVXJ 2UUZA 2DW4A 2M0CA 4XLNF 2IS4A 3FM5A 4HSTA 4O5VA 3S93A 5J1YA 2Y69H 2IVMA 4BKXA 4RB1A 3F8BA 3GBGA 5HDGA 1FOXA 2R4GA 3J81Z 1S7EA 1G3TA 3BG6A 3ABTA 1XMKA 2Q2EA 3W3CA 1LE8A 5J1UA 1U6GA 3L2WA 2Y9ZA 1ZR4A 4ZDOA 2Q0OA 2X1EA 1YW8A 2DT6A 2V9KA 4RBOA 2DBBA 2V1XA 3BDDA 2ZKZA 4OIPF 5F1RA 4F7ZA 2WB1A 1GUUA 3ZXSA 1O57A 3FBIB 2ECBA 2MH9A 1XDUA 3GFJA 2HR3A 3BR6A 2P7VB 2VE8A 1YW9A 4DZJA 3M4OJ 3WGHA 4B47A 2AXLA 5FRMA 2V6CA 2ME6A 1PVEA 2KMUA 1SFUA 2HWVA 4XM3A 3EETA 1P4AA 3KYCB 1Y39A 3RKYA 2NOJB 2BXYA 1W4MA 4CYCB 2G0EA 1B8IB 3GW2A 2HZDA 2V1UA 2F6CA 3BZKA 4LK0F 3KEQA 2W1OA 2RV8A 3SFZA 4A5MA 1ODDA 1QZYA 3CJQB 3TEDA 4EJTA 3K2ZA 3CJTB 1ON1A 3OS0A 1TT0A 3K4JA 3ZQQA 4ENMA 2XRNA 3RTRA 2M7BA 3O8GA 1OQYA 3DP7A 2R7VA 2RDPA 2DMPA 5ILUA 4NHJA 3WTWC 5DM7F 3BTCA 3ZMTA 2WA0A 2LKPA 4KN4X 4KJZA 1RUNA 2BHZA 3IH2A 4UVAA 3CCUI 1T8IA 1IV8A 4HYEA 1USTA 3HKZA 3OV8A 3F8FA 3N4MA 3EUHC 3JAMK 3QAHA 1XSVA 1WHUA 2R5ZB 2KKOA 4L5JA 5KHDA 3HL2A 2BY3A 3DPUA 1YI2I 1R1VA 3LSGA 2IS6A 1BJZA 4CCOA 3VEPA 5L3EA 3DF8A 3WGGA 1WQ2A 2ZMEB 2E1MC 1ENHA 2QQAA 3IUOA 2L9RA 2YU9J 3GF2A 2GZWA 3RPUA 5AIPA 4BXXJ 3OYEA 1VQ8I 4XLFA 2K9LA 3HGGA 5FJ8J 4BY7J 1DP3A 1TLHB 2JN6A 3OIQA 1Z77A 3HEFA 2CUEA 2ZMEC 3OYJA 1W36D 2LDUA 1HKSA 1WCMJ 3O6BB 4PJLA 3KP5A 1SMTA 4IKFA 3MWMA 4J00A 3KEOA 2JRMA 1AHDP 2R5YA 4FT8A 1R4MB 1ETYA 3C2GA 1UG2A 1MMDA 3GFLA 3TGNA 4BQAA 3PM1A 2WAQA 3CCVI 3B02A 3HOVJ 4RAGA 5DTDA 4KICA 5FD6A 1Y56A 1X3WB 4XLEA 2O61A 5F64A 2JK3A 2EBIA 4AWXB 2KQRA 1W36C 2K85A 3CCMI 3LQRA 1ACIA 2X6WA 1B4AA 1X1AA 2YR2A 5F6FA 5M5XJ 3M8FA 1IDZA 2KT0A 2BY0A 2H1KA 1IN8A 2DA5A 4FASD 3G71I 2E1CA 2CO5A 4CCNA 1O7FA 5D6FA 4ETSA 2LREA 3L9FA 1DQUA 1WJCA 4FCYA 3KZZA 3GTJJ 3IC7A 4BQNA 4O3MA 2L5QA 2QSHX 1B59A 2JUGA 2AQEA 4XLCA 4PSWA 1TW2A 3CO6C 1QZZA 4LIUA 2OA4A 2P6TA 3TOBA 2D5VA 3FWEA 1IN6A 1X1BA 1BOBA 1Z7UA 4O6JA 2CWEA 3TDZC 2P4WA 3SEZA 3FZVA 3BC8A 1N25A 4A6DA 4ITVA 1A35A 3RYPA 4M73A 1TC3C 2JA8J 1IXSB 4IOAF 1K4TA 4YFNF 2V1DA 3BG7A 5L3DA 1OKRA 1N77A 3Q5FA 1BI2A 4X0GA 1MBEA 4J19A 3HG9A 3MZYA 1V5EA 1DUXC 1TQIA 3FHZA 4PZJA 2K3PA 3ZQIA 5E18F 5E3OA 1YS7A 1T33A 1IJWC 2R7XA 1ETQA 3ABKH 2PLYA 1OCPA 3N05A 5J4YA 3QRFF 1UZCA 2OQRA 5EGOB 2A5WA 3ONQA 2HDWA 3MQ0A 5B1AH 1YOVB 1OR7A 2OCEA 2XAJA 2YS9A 4UVCA 2JA5J 3PUBA 2FBHA 1DU0A 1FLIA 1EH8A 3VPRA 4DQ2A 3WG9A 4XL9A 3WTTC 1VQKI 2HXOA 1HOMA 3HRSA 4E7IA 1YIJI 3WGIA 2EILH 4WXCA 3BR0A 1JHHA 5IT9Z 2R7TA 1J5YA 3R0JA 1FNNA 3H5AA 5HLGA 2QYOA 2ZJ2A 1BBYA 2RN7A 2RQPA 2QBYB 4PJMA 3IL2A 2XVCA 3GCMA 2HOTA 3ZGKA 2DQLA 3LQQA 2GIVA 3NARA 3CMAI 1PDNC 3F3XA 3MKZA 2DQRA 3K6GA 2L4MA 1BR2A 2STTA 2DA3A 2YSRA 3NAUA 3BR5A 1R6RA 5K1YA 4L0YB 3IRQA 3RZDJ 3CUQA 4EVIA 3OR2C 4IF4A 2PBIA 2VE9A 2DCEA 2KDZA 1USSA 4BY1J 2CFOA 4IRGA 2EIJH 3H0GJ 4OU0A 1VF9A 1OFCX 5K5RA 4A3FJ 2MA3A 4WCGA 1NH3A 4GDFA 2WAEA 3P9IA 3KLNA 2EA2A 3ZQFA 3K1NA 4K2EA 2ZC2A 3Q9SA 1U9OA 3BR1A 3EQLF 4BXUA 4EGZA 1XD7A 3S1QJ 1FOWA 4I0BA 5TJJA 2HKOA 3H5RA 2K86A 3LOCA 5BOXA 1HLVA 3T0YA 2PG4A 1HW2A 2D45A 1VQ4I 2EZIA 2DOFA 2KIMA 2LMDA 3BT9A 4P1WA 4V2GA 1Z7LA 4RB3C 4M6XA 4M3FA 4LB5A 1Y8QB 2BXZA 1MJ9A 4ENKA 4YFXF 2ZNZA 2BEOA 1TP4A 3WE3A 2GXBA 3LL7A 3MKYB 4A2UA 3GX4X 1TTYA 1UFMA 1ETKA 2YX4A 3J81K 1CGPA 5E20A 2F5EA 2GXAA 5JI6A 1L0OC 2DYSH 5DD4A 1KQ9A 2M4GA 3OY9A 4DYQA 4Y33A 4E6KG 4PGGA 2Y30A 5GADJ 1YRNA 3CCLI 1XS9A 2NVQJ 5A2QZ 4M3GA 2V6EA 1NG6A 1IN5A 1U8RA 2O5RA 2LYCA 3LWFA 1F36A 2OU2A 3VODA 3PFIA 3HOTA 1JT6A 1SVLA 4LLGF 1QO0D 3HUGB 2HEOA 3JRHA 2LF8A 4MHGA 4IX7A 2GAUA 4HLXA 4A0XA 4BAYA 5F0CA 3BR2A 4D7MA 1WWXA 1Z67A 3JSPA 3K70D 2DA1A 2QBYA 2L9NA 1W5CC 3H9QA 5B1BH 3P7NA 4CDGA 4HEA2 5E1XA 5CPRB 4U7BA 2L7KA 3LA2A 1FIPA 1ZREA 1X2MA 1T0FC 4CXFA 3CF5F 5BPDA 2EIKH 3FK6A 1OCZH 4D7NA 1IXCA 4IHSA 1EV7A 1MNDA 1R9TJ 4Z2YA 1XMXA 4LK1F 1B9NA 3BQYA 3SFIA 1T38A 1UJ8A 2XV4S 1FEXA 2JPBA 2AXTC 3NQOA 4XK4A 4EGYA 1HF0A 1XC5A 4XBFA 3MVPA 1MGTA 3K70C 1VQMI 2FRHA 4C3HJ 1NG7A 1K6OA 2ZFWA 9ANTA 4FTHA 3RDIA 4B43A 3AG2H 4I7HA 5M3FJ 1E3PA 4EATA 2VJJA 1KYZA 3LSTA 5GAHJ 1MJBA 3ASOH 5IT3A 4HSRA 4G6TB 2FXAA 2ZSHB 5CQEA 3QPLA 4S0HB 2XGCA 3TOAA 5EYRA 4XKWA 1FP1D 1FSEA 2O03A 2TRTA 3S2HJ 4I76A 4R79A 3JR9A 3ZR8X 2K4BA 2DFIA 4ESJA 2K40A 1LNWA 2L7MP 3ZPLA 3AG4H 4MFEA 2CYYA 1BC7C 5LGUA 5FKLA 3K1PA 4N0BA 3C18A 4D5FA 3Q9VA 4R8HA 4AIHA 3FKJA 5LGNA 3CDLA 2DFHA 3KFWX 2FE3A 2ID6A 4ASNA 1K7AA 1LJ9A 1GXPA 2OV7A 1DP7P 2XKPA 3ML6A 1BI1A 1FTTA 3PIOF 3U21A 2DDBA 3E0JB 1TNSA 1QPIA 1IW7F 3R0AA 4H0EA 3F0CA 5JFRA 5GPCA 2OUMA 3CC4I 5CKTA 4XOTA 5IP6A 1X1CA 4RLFA 4RMNA 3QYFA 3SEQA 4S05A 1FJLA 2HS5A 1F1ZA 2X4HA 3HUGA 3ZMDA 1A6IA 3FXQA 4ZC3A 3CQZJ 1XTAA 1YW7A 1LFPA 1D1BA 4II3A 2E35A 1Q1VA 2A6TA 4ZYAA 4PJ0C 2VN2A 3LFKA 2L01A 4HOBA 1Z0XA 3FXLA 5H20A 2EFOA 3FXKA 3ZOBA 2NRAC 3M7GA 3BZCA 3ZQGA 4P55A 5TRDA 1UMQA 2W7NA 3PJRA 4E7LA 1RNLA 3GTLJ 2TCTA 4HF0A 1S5LC 4C30A 4KIBA 2QSFX 4ZTJA 3REOA 1WGXA 2IXSA 4HX4A 4U87A 1ONVA 4RM3A 1W7PD 5GTIC 5DV5A 1IGNA 2IRFG 2NVYJ 4JQFA 3GZ6A 1I3AA 4IRHA 4XN0A 3G1MA 4IQJA 1P9QC 5GAGJ 4KNYA 1MZBA 1FPQA 2MW8A 3JRDA 3L2RA 2CUFA 3OYIA 5L3FA 2VC1A 2O6GE 2P7CB 2KJCA 1W7PB 3C2HA 1VQ6I 5KCMA 3CD6I 3E6CC 3W2AA 4KDPA 1YG2A 2BGCA 3MN2A 1BW5A 1QRYA 2HTJA 1JTXA 5LLQA 2EWNA 3GZNB 2AHQA 2QVOA 1X4OA 4C2TA 2CV0A 3K4MA 3I4PA 1FYMA 2MYSA 2HOEA 1KQ0A 2H8WA 2K9MA 2J5OA 1WFXA 3CC7I 5LRRA 4ZTFA 4XMYA 3JRIA 4IRIA 3DTEA 2V1NA 2RQQA 1S7AA 2VKVA 3VSKA 4ANJA 1HXDA 2DK8A 2H09A 3OIPA 3QYBA 3PUFA 1P4XA 2DN0A 2LY9A 4RA2A 1O4XA 3R6SA 2QQ8A 1HBXG 2NVTJ 3FXJA 4Y4RA 4OMZA 3TO6A 3LSMA 2M9HA 1ZLJA 1X3UA 3IWZA 1ON2A 3F6VA 2KIFA 4E70A 2PJPA 1ITYA 3Q0WA 4F91B 3DBHB 1HA8A 2IS1A 2R7UA 1LFUP 3BLYA 2DTRA 4LLLA 3WE2A 1R7JA 1FTZA 3HPGA 5EG0B 1TNTA 2F5DA 3WTUC 2XF7A 3F22A 3P5JA 1JE8A 2KDOA 2Z3YA 3SZPA 2BZTA 2ZSIB 3VYRB 1H9GA 3RKQA 1MMSA 3CC2I 2HQNA 2C6YA 4LFUA 2DT5A 4IHTA 1BC8C 3W6KB 1JUPA 2Y48A 4CCJA 3D1NI 2CU7A 4BH9A 3WTYC 1FMVA 2IP2A 2R7OA 4OAZA 3A02A 4ESFA 1ZN2A 2EV0A 5D8LB 2HFHA 3DXJF 4HAMA 5JVTA 3E6MA 4KT5C 2XAUA 3SJMA 2BW3B 3DCFA 5JLWA 1XPXA 5ICFA 2X9DA 3JW4A 1MNMC 3HHGA 2JSCA 2OPTA 2W48A 1I39A 2JVHA 2IAIA 1TQMA 4BYYA 4JBAA 1RKTA 2K9NA 3KPHA 4A3MJ 4PCQA 3GLXA 4LB6B 3OMYA 2Y0MA 1AU7A 1BL0A 5FRNA 1R1TA 3U2RA 3I0TA 3KLOA 1ZR2A 2PJRB 3TO7A 1XX5A 2FNPA 3B73A 4P5OA 4AIKA 5C4JJ 1VQ5I 2M8EA 3W2VA 1OCCH 2ZXHA 1ZG5A 2VPLA 4GO1A 4BBRJ 2XSJC 2NS7A 1S3JA 2I5UA 1P6RA 5E8GA 1WJ5A 2I8DA 3RI4A 4HRIA 2GOXB 4FISA 2DODA 3RPUD 1FX7A 1S6LA 2RGVA 1SFEA 1TT5B 1TWHJ 5KVRA 3H3ZA 3TMOA 3SDBA 4JOMA 3OOPA 4NC6A 3CCJI 4A3CJ 3CUOA 1ZAOA 4M9SA 4B09A 3DFGA 1H8AC 2OJED 3NWTA 2ICWG 3S8PA 1JT0A 3RKXA 3K10A 4BGDA 3V7SA 4LG0A 3CCQI 1K78B 2G9WA 4PK4A 1FT9A 2K3FA 3LSKA 4BHBA 3I4NJ 3HSEA 2OC6A 3RSNA 4ENJA 2QLZA 4D9JA 4XICA 3NWSA 5A2QK 4KMFA 4RS8A 1FP2A 2VLAA 4EV0A 1O3QA 3L00A 1YYVA 3O3KA 3ZQHA 1W5SA 1MBFA 4BDZA 1HW5A 3S1MJ 5ILSA 1PUFB 5D5XB 3A2KA 4X1EA 4PSXA 1M1EB 1MH4A 1VQNI 2GOMA 2K9QA 2LLKA 4KT6A 4ZYDA 1IZ1A 3ECHA 3H3UA 4RM2A 2R7QA 3E5QA 5LEJA 2OF7A 4YEJA 2E2JJ 2LSOA 4E7JA 2NYXA 2A6HF 3V42A 4IL6C 2ZXWH 3F8MA 4CH7A 4BJ6C 1HKTA 1LKXA 4M3BA 4Y52J 1OJLA 4BBSJ 4KUMA 2ZO4A 2XUBA 4TV7A 3IH3A 4MGRA 2HGCA 3FMQA 2A69F 5EF6A 1JGGA 1ZKGA 2KRHA 4CCLA 4U0VA 2DA7A 4RB0A 1O7LA 4J01A 4RLQA 3ZMVA 2MGQA 2P0WA 1X19A 4RGUA 5FLVA 2P6SA 4MEXF 4BEHA 4N9HA 4JX5A 1P92A 4HW0A 3BCAA 2HVSA 5GAEJ 4HNUA 5IYDJ 3K4CA 1J75A 4IXAA 2F4OB 1JGSA 4IVNA 3W6JB 3DTIA 1V5GA 4GYIA 2E1MB 2F5FA 2E7XA 1AOYA 3HSRA 4I02A 2STWA 3QU6A 5CVUA 2OAZA 1R4NB 4AIJA 5IPAA 1NTCA 5BNGA 4MIMA 3CESA 2D1HA 2Z5UA 2CS3A 1R49A 2FJ1A 1UG0A 2O7OA 4E4HA 1J0RA 4OIOF 2LNBA 2L9SA 3PIPF 1NHAA 3BTJA 3KP7A 5IYCJ 3G4SI 3S17J 2CSOA 2K27A 5DEQA 1W0UA 4HDVA 1V55H 2VT3A 3I3LA 4N4OB 1IC8A 1Z1DA 2LG4A 1G3WA 4C2MJ 2ELKA 2XASA 3FXOA 1FIAA 5ERIA 2ZFUA
chains in the Genus database with same CATH topology
1MBKA 1TWAJ 1GDTA 3ZQFA 2CRGA 4AC0A 3S1NJ 1U9OA 2HOAA 3BR1A 2HI3A 3S1QJ 1NK2P 5DS9A 1H89C 3LOCA 1HLVA 2FD5A 4B1RA 2WV1A 2Y2ZA 3GTGJ 4CYCA 2EZIA 2NS8A 2ID3A 3BT9A 1B8IA 1GV5A 2O8KA 1T56A 4V2GA 1JJ8C 2LD5A 4M3FA 4G12A 3OSGA 1ZK8A 5JLXA 1GVDA 4IHXA 4W97A 5IYBJ 3UKGA 1VNDA 1ETKA 4FE7A 4UUTA 4GFBA 3Q0UA 3M3YJ 1IV6A 4A3KJ 4QSHA 3TW7A 5IP7J 5E3MA 3GTMJ 1DU6A 4DYQA 2Y30A 2M8GX 1YRNA 1VFCA 3BG9A 4JYKA 5F0HA 1XS9A 1APLC 2L0KA 3RQIA 3HOUJ 2P81A 1ZQ3P 2NVQJ 3PO3J 4M3GA 1ETOA 2XPVA 2LTPA 5K7HA 1HDDC 2R5YB 3G1OA 2Y9YA 1K61A 4DW6A 1F36A 4A3DJ 2DMNA 3BQZA 3JRBA 1JT6A 1QVUA 1I50J 2XRLA 1ZTRA 3JRHA 5EG0A 1X2NA 2R5ZA 3S16J 4UUSB 3A01B 2LKXA 3HDDA 3HB9A 5F0CA 3BR2A 4D7MA 2DA1A 2I10A 3Q0VA 4B4CA 3HM5A 4X6AJ 2XB5A 3HBLA 3TP0A 1MBJA 2EQRA 5GPAA 3JRAA 4A3EJ 2R7ZJ 1RESA 1FIPA 3JRFA 1X2MA 3FK6A 4D7NA 1RR7A 3QPSA 2Y31A 3BG5A 2L7ZA 1R9TJ 4JP0A 3SFIA 3BQYA 1F43A 3LSPA 5E3NA 3S15J 1IRZA 1FEXA 2X48A 5F08A 4RDUA 1ETWA 4A3IJ 4FE4A 3C2BA 3CMYA 2ME0A 4XK4A 1HF0A 2QCOA 1XC5A 4A3GJ 3MVPA 4C3HJ 9ANTA 4FTHA 3FK7A 2Y0SN 2VI6A 5M3FJ 1B72B 1WH7A 5FKOA 2EH3A 1MBGA 5F0FA 4NDLA 5M5WJ 3TP3A 2PMZN 3ZQCA 2N8GA 4I6ZA 3QPLA 1U9NA 4EEFG 4S0HB 2NOGA 2XGCA 3S1RJ 4C3JJ 5EYRA 2E2IJ 4IEJA 2TRTA 3S2HJ 4I76A 1OCTC 3JR9A 2DA4A 4A3JJ 1RETA 2K40A 4XRMA 2X6OA 2L7MP 1D5YA 2XPWA 1E3OC 2E2HJ 3RZOJ 1U78A 4MFEA 2B63J 4A93J 4B3AA 3FKIJ 5FKLA 1JJ6C 5HODA 2DMQA 3FIWA 4D5FA 2M2EA 2COBA 2DMTA 1UHSA 1TWCJ 3CDLA 1ETXA 2ID6A 4MFDA 4MLOA 1FTTA 3I4MJ 4IHYA 1QPIA 5IOYA 1PUFA 1H88C 2IBDA 3WHCA 5F04A 3F0CA 1A5JA 5GPCA 5IOZA 1MSEC 2XSDC 5IP6A 5FKMA 1FJLA 4M6VA 2DA2A 2JA6J 3OIOA 3HOWJ 5IP9J 1A6IA 1RPWA 3L1PA 2FQ4A 3CQZJ 4AUXA 5FKNA 1AKHB 1JKOC 1Q1VA 3E7LA 2NVXJ 2LK2A 2M0CA 4XRSA 1MBHA 4LOCA 3GTOJ 1Z0XA 5J1YA 3ZOBA 3ZQGA 4BKXA 1UMQA 4QTRA 3JREA 3GBGA 3GTLJ 2TCTA 2YUSA 3BTLA 3HGYA 1S7EA 5EGOA 1ZGWA 2HXIA 4A3LJ 2LR8A 3HOXJ 3OSFA 1LE8A 5J1UA 1WGXA 2Y9ZA 1ZR4A 4RBOA 3G1LA 1I6HJ 1IGNA 1HDPA 2NVYJ 4DYCA 1GUUA 1Y1VJ 3LNQA 1JUMA 3GTPJ 1NK3P 2ECBA 4A69C 4HNVA 3G1MA 3BR6A 3BR3A 2MW8A 3JRDA 4DZJA 2CUFA 3M4OJ 2XGEA 2ME6A 1XG1A 2CQQA 4CYCB 2G0EA 1K83J 3MN2A 1B8IB 1BW5A 1QRYA 4A3BJ 1JUSA 4AYBN 1JTXA 4DYRA 2AHQA 2R93J 3TEDA 1JKPC 1QVTA 1MH3A 4DZPA 3Q3SA 2DTZA 2AO9A 3GTQJ 3O8GA 2DMPA 4W1UA 1IG7A 1CQTA 3JRIA 2JMWA 4XIDA 1YRNB 2VKVA 3BTCA 1P7IA 5J3LA 4C3IJ 3LSJA 3B6AA 4M3EA 2HOSA 2DN0A 2LY9A 1O4XA 3IH2A 2NVTJ 5C44J 2M9HA 1RKWA 4IHVA 1WPKA 1ITYA 3Q0WA 3BG3A 1LFUP 1FTZA 5K7FA 5EG0B 2WB1N 2RAEA 2R5ZB 3QQAA 4QIWN 2CQXA 2DJNA 2EZHA 1Y1WJ 3RKQA 1SANA 3CCYA 3LSGA 1BJZA 1JUPA 4L5EA 3BTIA 5F1JA 1HCRA 3GTKJ 3D1NI 2JWTA 2CU7A 1AKHA 3HOZJ 1ENHA 3A02A 5EZGA 2L9RA 2YU9J 1JTYA 5EZHA 4BXXJ 3K2AA 3O8HA 3SJMA 3DCFA 3HGGA 5FJ8J 3JRCA 4BY7J 3K7AJ 2LVSA 2JN6A 5JLWA 2K9SA 1Z77A 2QF7A 3HEFA 2CUEA 1EF4A 2X9DA 1WCMJ 1MNMC 3LSRA 2OPTA 2H8RA 2W48A 1AHDP 2DA6A 2R5YA 2IAIA 1UG2A 1ETYA 1RKTA 2K9NA 3PM1A 4A3MJ 1U8BA 3PO2J 1AU7A 3TW6A 1BL0A 3HOVJ 3JRGA 5DTDA 4XRSG 1ZR2A 4UUSA 3A01A 5C4JJ 2JK3A 2MSYA 4BBRJ 2EBIA 2NS7A 1GT0C 3HKZN 1I3QJ 1WI3A 4FISA 1TWHJ 3ZQLA 1JKRC 4IHWA 5M5XJ 4A3CJ 1IDZA 2KT0A 2H1KA 3W6VA 1VI0A 2DA5A 3OOUA 1H8AC 1JT0A 4JX6A 4FCYA 1G2HA 3GTJJ 2FX0A 1ETVA 2MG4A 1IDYA 3I4NJ 4XICA 3S2DJ 3ZQHA 4D5CA 1W0TA 2D5VA 1MBFA 1B72A 3MKLA 3S1MJ 2IEKA 1PUFB 5J1RA 4X1EA 2M34A 2ECCA 1MH4A 1TWGJ 2K9QA 2LLKA 1TC3C 2JA8J 2ZB9A 2OF7A 2E2JJ 2WAQN 2HQ5A 2DMUA 2JJ7A 3S14J 4J19A 1MBEA 2R92J 5FKKA 4M3BA 4Y52J 1OJLA 1GV2A 1ORKA 4BBSJ 1TWFJ 5C4XJ 3ZQIA 2XPUA 3IH3A 5EF6A 5E3OA 1T33A 1IJWC 1ETQA 1JGGA 1ZKGA 2EZLA 3IH4A 2HDDA 2LFBA 1OCPA 2DA7A 2XGDA 2O9LA 5EGOB 2XB0X 2MGQA 4V2FA 1LE8B 2GLOA 3A03A 2YS9A 5FLMJ 5FLVA 2JA5J 1DU0A 2E19A 3VPRA 4JX5A 1LFBA 1WH5A 3WHBA 1POGA 2GBYA 4Y7NJ 5C3EJ 5IYDJ 2HXOA 3DEWA 1HOMA 5K7ZA 3B6CA 2L7FP 5M3MJ 5M5YJ 3BR0A 1MSFC 5EDNA 4M3DA 2VPRA 3IV5A 4ABZA 5E3LA 5GP9A 2R0QC 2HOTA 3NARA 5IPAA 1NTCA 2GM4A 5BNGA 1P7JA 2EZKA 4MIMA 2VKEA 1BW6A 1BA5A 2DA3A 2FJ1A 3NAUA 3BR5A 1SFOJ 1JKQC 3H3VK 2O7OA 2VUMJ 2CJJA 3FISA 5IYCJ 3BTJA 1IUFA 3HOYJ 3S17J 3RZDJ 2E1OA 2LP0A 1X58A 4JX4A 2JA7J 3SDGA 5EEAA 2KDZA 1W0UA 4BY1J 5F27A 3H0GJ 4MO7A 1VF9A 1OFCX 4A3FJ 1IC8A 4C2MJ 2ELKA 2HYJA 1FIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBK A;  1TWA J;  1GDT A;  3ZQF A;  2CRG A;  4AC0 A;  3S1N J;  1U9O A;  2HOA A;  3BR1 A;  2HI3 A;  3S1Q J;  1NK2 P;  5DS9 A;  1H89 C;  3LOC A;  1HLV A;  2FD5 A;  4B1R A;  2WV1 A;  2Y2Z A;  3GTG J;  4CYC A;  2EZI A;  2NS8 A;  2ID3 A;  3BT9 A;  1B8I A;  1GV5 A;  2O8K A;  1T56 A;  4V2G A;  1JJ8 C;  2LD5 A;  4M3F A;  4G12 A;  3OSG A;  1ZK8 A;  5JLX A;  1GVD A;  4IHX A;  4W97 A;  5IYB J;  3UKG A;  1VND A;  1ETK A;  4FE7 A;  4UUT A;  4GFB A;  3Q0U A;  3M3Y J;  1IV6 A;  4A3K J;  4QSH A;  3TW7 A;  5IP7 J;  5E3M A;  3GTM J;  1DU6 A;  4DYQ A;  2Y30 A;  2M8G X;  1YRN A;  1VFC A;  3BG9 A;  4JYK A;  5F0H A;  1XS9 A;  1APL C;  2L0K A;  3RQI A;  3HOU J;  2P81 A;  1ZQ3 P;  2NVQ J;  3PO3 J;  4M3G A;  1ETO A;  2XPV A;  2LTP A;  5K7H A;  1HDD C;  2R5Y B;  3G1O A;  2Y9Y A;  1K61 A;  4DW6 A;  1F36 A;  4A3D J;  2DMN A;  3BQZ A;  3JRB A;  1JT6 A;  1QVU A;  1I50 J;  2XRL A;  1ZTR A;  3JRH A;  5EG0 A;  1X2N A;  2R5Z A;  3S16 J;  4UUS B;  3A01 B;  2LKX A;  3HDD A;  3HB9 A;  5F0C A;  3BR2 A;  4D7M A;  2DA1 A;  2I10 A;  3Q0V A;  4B4C A;  3HM5 A;  4X6A J;  2XB5 A;  3HBL A;  3TP0 A;  1MBJ A;  2EQR A;  5GPA A;  3JRA A;  4A3E J;  2R7Z J;  1RES A;  1FIP A;  3JRF A;  1X2M A;  3FK6 A;  4D7N A;  1RR7 A;  3QPS A;  2Y31 A;  3BG5 A;  2L7Z A;  1R9T J;  4JP0 A;  3SFI A;  3BQY A;  1F43 A;  3LSP A;  5E3N A;  3S15 J;  1IRZ A;  1FEX A;  2X48 A;  5F08 A;  4RDU A;  1ETW A;  4A3I J;  4FE4 A;  3C2B A;  3CMY A;  2ME0 A;  4XK4 A;  1HF0 A;  2QCO A;  1XC5 A;  4A3G J;  3MVP A;  4C3H J;  9ANT A;  4FTH A;  3FK7 A;  2Y0S N;  2VI6 A;  5M3F J;  1B72 B;  1WH7 A;  5FKO A;  2EH3 A;  1MBG A;  5F0F A;  4NDL A;  5M5W J;  3TP3 A;  2PMZ N;  3ZQC A;  2N8G A;  4I6Z A;  3QPL A;  1U9N A;  4EEF G;  4S0H B;  2NOG A;  2XGC A;  3S1R J;  4C3J J;  5EYR A;  2E2I J;  4IEJ A;  2TRT A;  3S2H J;  4I76 A;  1OCT C;  3JR9 A;  2DA4 A;  4A3J J;  1RET A;  2K40 A;  4XRM A;  2X6O A;  2L7M P;  1D5Y A;  2XPW A;  1E3O C;  2E2H J;  3RZO J;  1U78 A;  4MFE A;  2B63 J;  4A93 J;  4B3A A;  3FKI J;  5FKL A;  1JJ6 C;  5HOD A;  2DMQ A;  3FIW A;  4D5F A;  2M2E A;  2COB A;  2DMT A;  1UHS A;  1TWC J;  3CDL A;  1ETX A;  2ID6 A;  4MFD A;  4MLO A;  1FTT A;  3I4M J;  4IHY A;  1QPI A;  5IOY A;  1PUF A;  1H88 C;  2IBD A;  3WHC A;  5F04 A;  3F0C A;  1A5J A;  5GPC A;  5IOZ A;  1MSE C;  2XSD C;  5IP6 A;  5FKM A;  1FJL A;  4M6V A;  2DA2 A;  2JA6 J;  3OIO A;  3HOW J;  5IP9 J;  1A6I A;  1RPW A;  3L1P A;  2FQ4 A;  3CQZ J;  4AUX A;  5FKN A;  1AKH B;  1JKO C;  1Q1V A;  3E7L A;  2NVX J;  2LK2 A;  2M0C A;  4XRS A;  1MBH A;  4LOC A;  3GTO J;  1Z0X A;  5J1Y A;  3ZOB A;  3ZQG A;  4BKX A;  1UMQ A;  4QTR A;  3JRE A;  3GBG A;  3GTL J;  2TCT A;  2YUS A;  3BTL A;  3HGY A;  1S7E A;  5EGO A;  1ZGW A;  2HXI A;  4A3L J;  2LR8 A;  3HOX J;  3OSF A;  1LE8 A;  5J1U A;  1WGX A;  2Y9Z A;  1ZR4 A;  4RBO A;  3G1L A;  1I6H J;  1IGN A;  1HDP A;  2NVY J;  4DYC A;  1GUU A;  1Y1V J;  3LNQ A;  1JUM A;  3GTP J;  1NK3 P;  2ECB A;  4A69 C;  4HNV A;  3G1M A;  3BR6 A;  3BR3 A;  2MW8 A;  3JRD A;  4DZJ A;  2CUF A;  3M4O J;  2XGE A;  2ME6 A;  1XG1 A;  2CQQ A;  4CYC B;  2G0E A;  1K83 J;  3MN2 A;  1B8I B;  1BW5 A;  1QRY A;  4A3B J;  1JUS A;  4AYB N;  1JTX A;  4DYR A;  2AHQ A;  2R93 J;  3TED A;  1JKP C;  1QVT A;  1MH3 A;  4DZP A;  3Q3S A;  2DTZ A;  2AO9 A;  3GTQ J;  3O8G A;  2DMP A;  4W1U A;  1IG7 A;  1CQT A;  3JRI A;  2JMW A;  4XID A;  1YRN B;  2VKV A;  3BTC A;  1P7I A;  5J3L A;  4C3I J;  3LSJ A;  3B6A A;  4M3E A;  2HOS A;  2DN0 A;  2LY9 A;  1O4X A;  3IH2 A;  2NVT J;  5C44 J;  2M9H A;  1RKW A;  4IHV A;  1WPK A;  1ITY A;  3Q0W A;  3BG3 A;  1LFU P;  1FTZ A;  5K7F A;  5EG0 B;  2WB1 N;  2RAE A;  2R5Z B;  3QQA A;  4QIW N;  2CQX A;  2DJN A;  2EZH A;  1Y1W J;  3RKQ A;  1SAN A;  3CCY A;  3LSG A;  1BJZ A;  1JUP A;  4L5E A;  3BTI A;  5F1J A;  1HCR A;  3GTK J;  3D1N I;  2JWT A;  2CU7 A;  1AKH A;  3HOZ J;  1ENH A;  3A02 A;  5EZG A;  2L9R A;  2YU9 J;  1JTY A;  5EZH A;  4BXX J;  3K2A A;  3O8H A;  3SJM A;  3DCF A;  3HGG A;  5FJ8 J;  3JRC A;  4BY7 J;  3K7A J;  2LVS A;  2JN6 A;  5JLW A;  2K9S A;  1Z77 A;  2QF7 A;  3HEF A;  2CUE A;  1EF4 A;  2X9D A;  1WCM J;  1MNM C;  3LSR A;  2OPT A;  2H8R A;  2W48 A;  1AHD P;  2DA6 A;  2R5Y A;  2IAI A;  1UG2 A;  1ETY A;  1RKT A;  2K9N A;  3PM1 A;  4A3M J;  1U8B A;  3PO2 J;  1AU7 A;  3TW6 A;  1BL0 A;  3HOV J;  3JRG A;  5DTD A;  4XRS G;  1ZR2 A;  4UUS A;  3A01 A;  5C4J J;  2JK3 A;  2MSY A;  4BBR J;  2EBI A;  2NS7 A;  1GT0 C;  3HKZ N;  1I3Q J;  1WI3 A;  4FIS A;  1TWH J;  3ZQL A;  1JKR C;  4IHW A;  5M5X J;  4A3C J;  1IDZ A;  2KT0 A;  2H1K A;  3W6V A;  1VI0 A;  2DA5 A;  3OOU A;  1H8A C;  1JT0 A;  4JX6 A;  4FCY A;  1G2H A;  3GTJ J;  2FX0 A;  1ETV A;  2MG4 A;  1IDY A;  3I4N J;  4XIC A;  3S2D J;  3ZQH A;  4D5C A;  1W0T A;  2D5V A;  1MBF A;  1B72 A;  3MKL A;  3S1M J;  2IEK A;  1PUF B;  5J1R A;  4X1E A;  2M34 A;  2ECC A;  1MH4 A;  1TWG J;  2K9Q A;  2LLK A;  1TC3 C;  2JA8 J;  2ZB9 A;  2OF7 A;  2E2J J;  2WAQ N;  2HQ5 A;  2DMU A;  2JJ7 A;  3S14 J;  4J19 A;  1MBE A;  2R92 J;  5FKK A;  4M3B A;  4Y52 J;  1OJL A;  1GV2 A;  1ORK A;  4BBS J;  1TWF J;  5C4X J;  3ZQI A;  2XPU A;  3IH3 A;  5EF6 A;  5E3O A;  1T33 A;  1IJW C;  1ETQ A;  1JGG A;  1ZKG A;  2EZL A;  3IH4 A;  2HDD A;  2LFB A;  1OCP A;  2DA7 A;  2XGD A;  2O9L A;  5EGO B;  2XB0 X;  2MGQ A;  4V2F A;  1LE8 B;  2GLO A;  3A03 A;  2YS9 A;  5FLM J;  5FLV A;  2JA5 J;  1DU0 A;  2E19 A;  3VPR A;  4JX5 A;  1LFB A;  1WH5 A;  3WHB A;  1POG A;  2GBY A;  4Y7N J;  5C3E J;  5IYD J;  2HXO A;  3DEW A;  1HOM A;  5K7Z A;  3B6C A;  2L7F P;  5M3M J;  5M5Y J;  3BR0 A;  1MSF C;  5EDN A;  4M3D A;  2VPR A;  3IV5 A;  4ABZ A;  5E3L A;  5GP9 A;  2R0Q C;  2HOT A;  3NAR A;  5IPA A;  1NTC A;  2GM4 A;  5BNG A;  1P7J A;  2EZK A;  4MIM A;  2VKE A;  1BW6 A;  1BA5 A;  2DA3 A;  2FJ1 A;  3NAU A;  3BR5 A;  1SFO J;  1JKQ C;  3H3V K;  2O7O A;  2VUM J;  2CJJ A;  3FIS A;  5IYC J;  3BTJ A;  1IUF A;  3HOY J;  3S17 J;  3RZD J;  2E1O A;  2LP0 A;  1X58 A;  4JX4 A;  2JA7 J;  3SDG A;  5EEA A;  2KDZ A;  1W0U A;  4BY1 J;  5F27 A;  3H0G J;  4MO7 A;  1VF9 A;  1OFC X;  4A3F J;  1IC8 A;  4C2M J;  2ELK A;  2HYJ A;  1FIA A; 
#chains in the Genus database with same CATH topology
 2VL8 A;  1MBK A;  1X1D A;  3VYS B;  5FLX Z;  2CRG A;  3S1N J;  4BNC A;  4IZZ A;  2HOA A;  3QPT A;  2HYF A;  2CV1 A;  2XF5 A;  1MKM A;  4F92 B;  2XAH A;  2QM3 A;  4IO9 F;  2VIX A;  1NK2 P;  1LDD A;  4CSW A;  4CCK A;  2QQ9 A;  1H89 C;  4LIV A;  4Y15 A;  1A04 A;  4B1R A;  1OR7 C;  1TQP A;  1FBQ A;  2L54 A;  3E3V A;  1J7K A;  1D0Y A;  2DI3 A;  4CYC A;  2XKO A;  1B8I A;  1EH6 A;  2O8K A;  1T56 A;  2A5Y B;  2KRF A;  3CLO A;  3RCO A;  5FFZ A;  4AD9 A;  2LD5 A;  1RC9 A;  1D1A A;  2EPF A;  2VBZ A;  4G12 A;  4HG2 A;  5J8C A;  3OSG A;  1GVJ A;  1ZK8 A;  2FQ3 A;  2MFZ A;  2R3S A;  3CF2 A;  3CMM A;  4HPQ A;  4WX9 A;  1GVD A;  2DPD A;  3WTS C;  4DOZ A;  3SHF A;  1W5T A;  1PUE E;  3I71 A;  4UUT A;  5KK1 A;  1P4W A;  1ZHF A;  4DIQ A;  2E5N A;  1ZRC A;  3DQV C;  4G7H F;  1FBU A;  3GTM J;  3E6B A;  2K7L A;  1QNT A;  1VFC A;  3BG9 A;  4JYK A;  1KU7 A;  2QSG X;  2EJR A;  2L0K A;  3F9K A;  3HHH A;  4G9Y A;  1ZQ3 P;  5D5U B;  1XGO A;  5CQG A;  5K7H A;  3G1O A;  3CUQ C;  4DW6 A;  2V7F A;  2DYR H;  3WOD F;  2AS5 F;  4A3D J;  2JVG A;  3BQZ A;  1I6X A;  3A0B C;  1G8X A;  2Y75 A;  5LRS A;  5HS7 A;  2EFW A;  3OYC A;  2R5Z A;  1RUO A;  5EJC A;  2KJB A;  4UUS B;  4EQQ A;  2IT0 A;  3A01 B;  2QQB A;  3GZ5 A;  5DDG A;  2Z99 A;  2F5V A;  3Q0V A;  2I10 A;  3OYD A;  2IJL A;  4BJ5 C;  3HM5 A;  4X6A J;  3HBL A;  1KU9 A;  2M5W A;  1VQO I;  1K4S A;  4BE1 A;  3I64 A;  1SAU A;  5GPA A;  2CG4 A;  4L9T A;  2ZME A;  2E1N A;  3IWF A;  3JRF A;  4UV9 A;  1KYW A;  5FD5 A;  2MC3 A;  5GTH C;  4CGZ A;  4G7O F;  3U9G A;  3QPS A;  1KGS A;  5LEK A;  2Y31 A;  1S7O A;  3SQN A;  1YJN I;  4XLA A;  3BJ6 A;  5E3N A;  1IRZ A;  5F08 A;  1REP C;  1WVR A;  4FE4 A;  3D5S C;  4L9V A;  4NQW B;  2ME0 A;  4CA0 A;  4V19 K;  4D1Q A;  2RNG A;  4AVP A;  5AON A;  2VI6 A;  3H9G A;  2KZV A;  1B72 B;  4RAZ A;  2CFX A;  2OTL I;  5CVJ A;  1MBG A;  4G94 A;  3CO7 C;  5F0F A;  2D1V A;  4NDL A;  3TP3 A;  3T8R A;  1I1G A;  1Z6T A;  2N8G A;  4GRI A;  4M9Z A;  3ESW B;  4EJU A;  1QBJ A;  2JZY A;  3I59 B;  1U9N A;  2JA2 A;  3BP8 A;  5DCM B;  2PQ8 A;  4EEF G;  2NOG A;  4CYD A;  4IEJ A;  2DK5 A;  1YE9 A;  3S3M A;  4MTE A;  3J7Y J;  4LGW A;  2HPM A;  5HNF A;  5JVG F;  3V7R A;  4WK8 F;  1Y6I A;  2E2H J;  3I9V 2;  2E5Z A;  2A61 A;  2F4M B;  3FF5 A;  4ZYE A;  3ABL H;  2NS0 A;  3FKI J;  4E7H A;  1JJ6 C;  2ZNY A;  3ZMU A;  4Q4Z F;  5DCF A;  4P9U A;  2M2E A;  3EUA A;  1YS6 A;  1X4P A;  2M87 A;  5HLT A;  1ETX A;  2LOO A;  1XMA A;  3FXR A;  5D5W B;  4RGR A;  3DBR B;  4IHY A;  5IOY A;  2MAB A;  1EA3 A;  1R5H A;  1TBX A;  2VAS A;  3WHC A;  3JTH A;  2E7W A;  4U0Y A;  1A5J A;  2E60 A;  2WC2 A;  3T5X A;  3RYR A;  1YX3 A;  4RAY A;  3HIF A;  5IP9 J;  1R23 A;  1RPW A;  1V54 H;  2LY2 A;  3L1P A;  5BPI A;  1Z3X A;  1YTY A;  2W57 A;  1T08 B;  4M72 A;  5ILV A;  2BBY A;  3MAJ A;  3K4N A;  4XOR A;  2FMY A;  4XRS A;  4LOC A;  3GTO J;  2O8X A;  3OYA A;  3HC7 A;  2Q1Z B;  5EEH A;  4YII A;  4ON0 A;  2QEN A;  2NVU B;  1ZGA A;  2A3S A;  1LPQ A;  3LAJ A;  2W24 A;  5CLS A;  4DNC A;  5BS6 A;  4QTR A;  3JRE A;  3WTX C;  2FBK A;  2YUS A;  3BTL A;  1Q1H A;  2VBY A;  4I01 A;  4ZZL A;  5EGO A;  1ZGW A;  2LR8 A;  2DLL A;  1A31 A;  4G7Z F;  5E79 C;  3G1L A;  3R60 A;  3G2B A;  1GLN A;  4B44 A;  3BJO A;  5LD2 C;  1LEA A;  4DYC A;  3FX3 A;  5HS9 A;  4GCV A;  1Y1V J;  1JUM A;  4A69 C;  1YFH A;  4HNV A;  2CUJ A;  3BR3 A;  3D5L A;  4Q48 A;  2QKL B;  3BPV A;  4B8X A;  2RVC A;  2VOP A;  4EMS A;  2KRC A;  1U5T C;  2CUZ A;  2PI0 A;  4OIQ F;  1BI3 A;  4F93 B;  2CQQ A;  1N75 A;  2V4J C;  3LAP A;  3OR1 C;  1K83 J;  1WJD A;  3M1E A;  3H36 A;  3HTU A;  4A3B J;  1XSX A;  3FMS A;  1JUS A;  1LDK B;  1LVK A;  2DDA A;  4AYB N;  2KIQ A;  4DYR A;  2AQF A;  5DCM A;  5JHF A;  2R93 J;  1D0X A;  3ELK A;  5LHI A;  1PP7 U;  3H9J A;  3MD2 A;  5E1Z B;  1U3E M;  3Q3S A;  4ENN A;  2GA2 A;  4F55 A;  2DTZ A;  3VFZ A;  3K0L A;  3MKW B;  1FSH A;  2O3F A;  4W1U A;  4UY8 I;  1Z91 A;  3HRU A;  3FXM A;  4HQE A;  3L2V A;  4XID A;  4ZZD A;  4Y13 A;  1P2F A;  1WJF A;  1FC3 A;  3LSJ A;  3B6A A;  4M3E A;  2Z16 A;  2HOS A;  3F6O A;  3BRO A;  1IAW A;  1LEB A;  4P9F A;  3OYB A;  1RKW A;  4IHV A;  1XSD A;  3GME A;  1RR8 C;  3AG1 H;  2VQC A;  2GQQ A;  3X2Q H;  2Z9O A;  3IHU A;  5LGT A;  5KNL A;  5KAF C;  1KZH A;  2RAE A;  3ZMS A;  4XKV A;  3QQA A;  4QIW N;  2CQX A;  1LUJ B;  1EKE A;  4KIF A;  1FBS A;  2FEZ A;  1ZH5 A;  3CTA A;  3JAM Z;  1SAN A;  2FUG 2;  3BOQ A;  3CCY A;  4DBQ A;  4L5E A;  3BTI A;  1KU3 A;  1B9M A;  4U7D A;  2R7W A;  3HOZ J;  1A36 A;  1J9I A;  4WXH A;  1MDM B;  4S04 A;  1T6S A;  4CO8 A;  2PEX A;  3C7J A;  1JTY A;  4WWC A;  5E17 F;  2BOL A;  1I27 A;  4UXN A;  3K2A A;  2V9P A;  2A05 A;  3H5N A;  3S2W A;  3JRC A;  5FO5 A;  2MBF A;  2IW5 A;  2K9S A;  2QF7 A;  3RJP A;  1FZP B;  3J7A Y;  1TL8 A;  4PJJ A;  2PX9 A;  1SD5 A;  2V26 A;  3ECO A;  3EYI A;  5FLX K;  1BM9 A;  4Q47 A;  4PFP A;  1PYV A;  1U2W A;  2DA6 A;  4CUG A;  4GYG A;  2F5C A;  2GA1 A;  3JTG A;  3CCR I;  1XGN A;  1U8B A;  3PO2 J;  5D8K B;  2DPU A;  2CW8 A;  4ZDL A;  3TW6 A;  3M1C A;  2HVQ A;  2VB6 A;  4XRS G;  4OAY A;  5K5Q A;  2RNJ A;  4NC8 A;  2MSY A;  1SD6 A;  1T0F A;  1S8N A;  4UB6 C;  3FM3 A;  4XSX F;  1QPM A;  1D8K A;  2WTE A;  3L2U A;  4L18 B;  2P5L C;  1I3Q J;  3E6D A;  2XAG A;  2KFD A;  2KLO A;  2UV1 A;  1E2X A;  4RGX A;  3TO9 A;  4IHW A;  1MMN A;  2RRE A;  3KZI C;  2UXX A;  3RIR A;  4CCM A;  4AM3 A;  2IA0 A;  2VQH A;  3M8J A;  3T8T A;  4M74 A;  4OIR F;  4XLP F;  3CCS I;  5HDK A;  2FX0 A;  3HTS B;  1ZG1 A;  2MG4 A;  1KA8 A;  3EUK L;  3V4G A;  3MMY B;  2MH2 A;  2JTV A;  3DKX A;  2XAQ A;  3S2D J;  1ERD A;  3OL3 A;  1FWZ A;  2VON A;  2P5V A;  5TIS C;  3MKL A;  4XON A;  5J1R A;  1UAA A;  2XHK A;  2ECC A;  2NXN B;  3P9K A;  1TWG J;  3KCC A;  3PSF A;  4KIS A;  2BY2 A;  3KEY A;  4EM2 A;  3P9C A;  3QPH A;  3I5U A;  3WG7 H;  1VQ7 I;  2HQ5 A;  3E1S A;  2DMU A;  3TQN A;  1VQ9 I;  1LQ1 A;  4CZC A;  1D3Y A;  2GWR A;  3CLQ A;  3S14 J;  2JUC A;  2R92 J;  3TKY A;  1EH7 A;  3SZG A;  1MMG A;  3ROU A;  4Z6Y A;  5L3B A;  5C4X J;  4A6E A;  1IXR C;  3J80 Z;  4AU7 A;  1DDN A;  3S3N A;  2M0M A;  1R36 A;  2QGU A;  4MQ9 F;  3VYU B;  2HDD A;  3MZH A;  2XGD A;  1AWC A;  2XIG A;  1LE8 B;  2O0Y A;  3A03 A;  2EFP A;  1Y8R B;  4BQO A;  5IT9 K;  1WH5 A;  2QUF A;  5H6R A;  3WHB A;  5D4S A;  1OYI A;  1POG A;  2GBY A;  4Y7N J;  5C3E J;  5E8I A;  1BR1 A;  3IKV A;  4C2U A;  2BVM A;  2PMH A;  3QYE A;  1E17 A;  5M3M J;  1MSF C;  1FYL A;  3G6E I;  4M3D A;  1KU2 A;  1IN4 A;  4NNJ A;  3IV5 A;  1STZ A;  4ABZ A;  2JQ7 A;  3HSF A;  4LLN A;  5TGT A;  3PQK A;  1V5F A;  3ABU A;  3WU2 C;  1SC7 A;  2GM4 A;  2EZK A;  2VKE A;  2LRD A;  1SFO J;  5D6E A;  1JKQ C;  3H3V K;  3UR3 C;  2VUM J;  3FIS A;  2IS2 A;  4FHT A;  2BHY A;  4A0Y A;  1IUF A;  3HOY J;  5J6X A;  2E1O A;  3A1Y A;  2ADU A;  1R5G A;  3SDG A;  5EEA A;  3J7Z I;  5LBQ A;  3ZCO A;  3T1B A;  4MO7 A;  1QA6 A;  3EDP A;  3QP6 A;  2HYJ A;  1BIA A;  4B3X A;  3BJA A;  1A6Q A;  4ZDP A;  1G3Y A;  1QZE A;  3V8K A;  4DGW B;  4KIT B;  4E7K A;  4GGG A;  1MIJ A;  3DLL F;  1V4R A;  3GWZ A;  5JHU A;  3F72 A;  1MJA A;  1OLT A;  1OYW A;  3BY6 A;  2FOK A;  1DPR A;  6PAX A;  3FDY A;  4YIF A;  2PN6 A;  2VJ4 A;  3E5U A;  1W7P A;  1QGP A;  3PFY A;  2FD5 A;  1OCO H;  2Y2Z A;  4BJT A;  4IQ4 A;  1GV5 A;  3QWL A;  4OWR B;  3VDX A;  2FOW A;  3BWG A;  2L3D A;  1JJ8 C;  2L9V A;  2EIN H;  5JLX A;  5HLH A;  3ZP5 A;  4I0A A;  1MD0 A;  4IHX A;  5IYB J;  3ULQ B;  3UKG A;  1R22 A;  3LMM A;  4BDY A;  4XRF A;  3KP6 A;  3M3Y J;  2QZ8 A;  1QQI A;  5IP7 J;  3DWL E;  1SMY F;  5E3M A;  3S32 A;  1XB4 A;  4OMY A;  1Z9C A;  5F0H A;  4AVZ A;  3ZRG A;  1QU3 A;  2X51 A;  1APL C;  2M45 A;  3K4L A;  3RQI A;  3U1K A;  1YX5 A;  3D0S A;  2P81 A;  2COM A;  2IGO A;  1QHH D;  3MZ8 A;  3HOU J;  2KPM A;  2NNN A;  1HQC A;  1ETO A;  2XPV A;  5B5E C;  2ZJR F;  2R5Y B;  2Y9Y A;  1YHQ I;  2DXI A;  2KP6 A;  4U88 A;  3OYG A;  3F21 A;  2DMN A;  2H27 A;  3IRR A;  3IAS 2;  1D8J A;  3BCB A;  2DT7 B;  2KHM A;  5DUK A;  5D5V B;  4FX4 A;  3BPX A;  2XRL A;  2K02 A;  1ZTR A;  1WJE A;  2KZG A;  2LKS A;  2VXD A;  5EG0 A;  4A12 A;  2HPI A;  4KA4 A;  3NRV A;  3HDD A;  1EJ9 A;  2V79 A;  5ICC A;  2QEX I;  2B0L A;  4LIT A;  1O3R A;  3EYY A;  2HDC A;  4AID A;  3CJR B;  2XB5 A;  4D0P A;  1ZAR A;  2HKX A;  3TP0 A;  2FF4 A;  3PSI A;  4HX7 A;  3JRA A;  4UV8 A;  4A3E J;  1J59 A;  4I09 A;  4LD5 A;  5CVI A;  1RES A;  2R7Z J;  2KL4 A;  2VXZ A;  1YIO A;  2YX7 A;  3H1C A;  3JCU C;  1RR7 A;  3ASN H;  3MCZ A;  3ZMZ A;  1Z6R A;  2X85 A;  3BG5 A;  4PFO A;  2BW3 A;  2HZT A;  2FSW A;  3LSP A;  1ZEL A;  3TBI A;  2KIU A;  2BV6 A;  3K9T A;  4QPQ A;  1DGR M;  1RI7 A;  3C2B A;  3CMY A;  4YIR X;  1AA7 A;  2QCO A;  1RRJ A;  3QOD A;  1Y0U A;  4HZF A;  3GVA A;  3FK7 A;  2Y0S N;  1Z21 A;  2L4A A;  2LC2 A;  2R7F A;  1H0M A;  1G59 A;  3LSI A;  2A68 F;  4YRV A;  2HVR A;  2PJR A;  2EH3 A;  1SEU A;  1UHM A;  2PMZ N;  2MLK A;  5H2F C;  2VQL A;  4UHT A;  1WJB A;  3M9A A;  2W85 A;  5KAI C;  1LVA A;  1TW3 A;  3GEZ A;  3S1R J;  1YIT I;  3CJN A;  3I53 A;  3LSH A;  4PUS A;  1OCT C;  3L7W A;  1O3S A;  3R61 A;  2ZXI A;  2DA4 A;  3DTK A;  3HYI A;  3SYT A;  1VTN C;  4XRM A;  2X6O A;  1D5Y A;  2XPW A;  3RZO J;  1FY7 A;  2VBX A;  4Y17 A;  1U78 A;  1DPU A;  4A93 J;  1YO5 C;  1K78 A;  1JHF A;  1SVM A;  3OYM A;  5HVQ C;  2QA4 I;  5ICG A;  5CVV A;  1UHS A;  2OQG A;  2XDV A;  2JRT A;  1S72 I;  4N9I A;  1WI9 A;  1ZLK A;  3KE2 A;  4MLO A;  2L02 A;  2DJI A;  3I4M J;  4NBQ A;  2G7H A;  4XN3 A;  2KIS A;  1PUF A;  2IBD A;  4QPO A;  4I99 C;  2CGP A;  4AYB A;  1MSE C;  3HZJ A;  1H9T A;  1F4K A;  1T2K A;  1YJ9 I;  2XSD C;  3LFU A;  2OZ6 A;  4M6V A;  2DA2 A;  2HQR A;  3PQJ A;  3OIO A;  4LMY A;  3VSL A;  1XN7 A;  3DU6 A;  3IKT A;  3KP2 A;  4BE0 A;  3HOW J;  2FQ4 A;  4AUX A;  4OIN F;  1SFK A;  2R7D A;  1ZGJ A;  3QOP A;  5J40 A;  5HS8 A;  4F3Q A;  1JKO C;  3E7L A;  1AKH B;  2LK2 A;  1I5Z A;  1YLF A;  5D4R A;  1BN5 A;  1WRJ A;  2ELJ A;  2MLG A;  1MBH A;  5CVR A;  3EPZ A;  3ABM H;  1J09 A;  1WSU A;  2LY1 A;  4NB5 A;  4KN7 X;  1D5V A;  2WV0 A;  1BOA A;  3CUQ B;  4G8X A;  2VOD A;  2M3A A;  4YG2 F;  3H92 A;  4HX8 A;  3VB2 A;  3HGY A;  3DV8 A;  1JI8 A;  2HXI A;  5HDN A;  2LH9 A;  3EUH A;  3OYF A;  3HOX J;  4A3L J;  3OSF A;  3TL4 X;  2VBW A;  3QP5 A;  4KMU X;  2H6B A;  4EJO A;  3KET A;  1I6H J;  2B9S A;  1HDP A;  2QWW A;  1IO2 A;  1T95 A;  2EK5 A;  4U0W A;  3LNQ A;  1X3Z B;  2VC0 A;  3GTP J;  1NK3 P;  3F23 A;  4LG3 A;  4XNF A;  4QWQ A;  4L0Z B;  3CP8 A;  1IUY A;  2WY8 Q;  2XGE A;  3L2C A;  2HYG D;  1E0E A;  1TZL A;  3GO5 A;  2F48 A;  3LA7 A;  3AAF A;  1XG1 A;  5IY5 H;  1UHW A;  2MC4 A;  2VOO A;  2FBI A;  1R00 A;  4PDK A;  1C0W A;  2FU4 A;  3K69 A;  2W00 A;  1MMA A;  2Z2S B;  3KP3 A;  4HBL A;  2HU9 A;  4FQG A;  3KIO A;  5FFX A;  3J80 K;  1JKP C;  1QVT A;  1MH3 A;  2W4S A;  4BHP A;  4DZP A;  1ZRD A;  3QOE A;  1D0Z A;  2LF7 A;  3OS2 A;  3OYL A;  1R58 A;  2AO9 A;  4N4N B;  1G3S A;  1VQL I;  3GTQ J;  3AKZ A;  3DKY A;  3C1D A;  1IG7 A;  5E1W A;  1CQT A;  2JMW A;  4HQM A;  4B48 A;  1YRN B;  1P7I A;  5J3L A;  4C3I J;  3DU5 A;  2BVL A;  1T39 A;  1U0J A;  2VT2 A;  2WBM A;  1R71 A;  3LA3 A;  5C44 J;  2HNH A;  3FBN B;  4II2 A;  3TDU C;  2F2E A;  4E7S A;  5HNH A;  1XGM A;  1IRF A;  4ZYG A;  1WPK A;  2Q8K A;  2XC7 A;  2R7S A;  3BG3 A;  2CQ7 A;  2ISY A;  5K7F A;  2WB1 N;  2JSP A;  1Y0N A;  1Z3Y A;  1WJA A;  2DJN A;  1G6N A;  3UNG C;  2H94 A;  2LBF B;  2EZH A;  1Y1W J;  3WU1 B;  2IGM A;  2RC4 A;  1T98 A;  5F1J A;  1HCR A;  2M7A A;  1L3L A;  3GTK J;  2CW0 F;  2JWT A;  3F8N A;  4NC7 A;  1AKH A;  2E34 A;  2OZU A;  5EZG A;  4BS9 A;  2FML A;  1IF1 A;  4BQQ A;  2EV6 A;  5EZH A;  1XDS A;  2WY7 Q;  1G4D A;  3O8H A;  2H1L A;  3GUD A;  3K7A J;  2LVS A;  3PL8 A;  4EM1 A;  3BZ6 A;  2H6C A;  1EF4 A;  1JXS A;  3LSR A;  3RQ4 A;  5BQT A;  1D1C A;  1GXQ A;  3F8C A;  3SXY A;  1LDJ A;  2H8R A;  2ESN A;  4YFK F;  1HSJ A;  2ELH A;  3GFM A;  2B7E A;  4ZJZ A;  3OYN A;  1F9N A;  1SVO A;  3JRG A;  1N78 A;  4EJW A;  4EM0 B;  4UUS A;  2A6E F;  3G3Z A;  3A01 A;  5L3C A;  3H0D A;  2RKH A;  2EFN A;  3V8J A;  1OPC A;  5HOO A;  4ESB A;  1K79 A;  3CCE I;  1GT0 C;  4NUB A;  3HKZ N;  1SFX A;  2JT1 A;  1WI3 A;  2VKD A;  4IJA A;  1SAX A;  3KYD B;  2DOA A;  2OTJ I;  2Z33 A;  3E97 A;  3ZQL A;  1JKR C;  5DYM A;  2OBP A;  3DPT A;  4WF2 A;  1VQP I;  3W6V A;  1VI0 A;  1ZG3 A;  1HST A;  3OOU A;  4G6Q A;  1K6Y A;  4PGH A;  3AG3 H;  2DAO A;  3OL4 A;  2M1B A;  1OCR H;  2DU9 A;  3NEU A;  1XCV A;  4JX6 A;  1G2H A;  3OWT A;  1VZ0 A;  1U5T B;  1ETV A;  2OCC H;  4IPA A;  1IDY A;  3OYK A;  2OD5 A;  4NQW A;  4MQV A;  4HA8 A;  2UXN A;  4HNT A;  3GLL A;  5AIQ A;  4HF2 A;  4MNU A;  4D5C A;  1W0T A;  1IRG A;  5FRO A;  4DBR A;  1B72 A;  2IEK A;  4BU2 A;  5B3S H;  2M30 A;  2M34 A;  1ZRF A;  1PJR A;  3OS1 A;  3R4K A;  3L09 A;  3I59 A;  4UNO A;  4XKB A;  2CMP A;  2ZB9 A;  2PMU A;  5DD8 A;  4MTD A;  4CHU A;  3HRT A;  2JPC A;  2WAQ N;  1GHC A;  4H4K C;  2JJ7 A;  1V3F A;  2X6X A;  1XCB A;  2BY1 A;  2BYV E;  3GXO A;  2ISZ A;  2HQA A;  4M9X A;  2LBF A;  5LHG A;  1SD7 A;  2ZCW A;  5FKK A;  3G73 A;  1GV2 A;  1ORK A;  4EJV A;  1TWF J;  4XQF A;  3WU0 A;  4KYW A;  3AFH A;  2XPU A;  2EZL A;  3IH4 A;  2LFB A;  3PNT A;  1YQA A;  2J5P A;  1ULY A;  2O9L A;  4R1H A;  2XB0 X;  5ED4 A;  4V2F A;  2GLO A;  3VYT B;  5FLM J;  4CIC A;  2E19 A;  4KIG A;  2CQN A;  5J4V A;  1LFB A;  1CF7 B;  2ZXJ A;  4A5N A;  2V9V A;  1WZ2 A;  1W1W E;  3DEW A;  3MEX A;  5K7Z A;  3B6C A;  2L7F P;  4HLY A;  2IGK A;  2XGX A;  3H35 A;  4BHC A;  5M5Y J;  2IA2 A;  4KFC A;  5EDN A;  2Z1D A;  2VPR A;  3D5R C;  3N97 A;  1RIO H;  2W82 A;  3K4K A;  5E3L A;  2E36 A;  5CJ9 A;  5GP9 A;  3QU3 A;  2R0Q C;  3O2P E;  1PP8 F;  3OYH A;  3E5X A;  1P7J A;  5J47 A;  2TDX A;  2A07 F;  1O3T A;  1BW6 A;  1BA5 A;  2CW7 A;  4I98 B;  2UWM A;  5LHH A;  4MEY F;  2CJJ A;  2XF6 A;  1B6A A;  1KQ8 A;  2EV5 A;  3A4C A;  2F4I A;  2LP0 A;  1X58 A;  4JX4 A;  3GFI A;  2JA7 J;  2X1D A;  4RAF A;  3DBL B;  4BL0 B;  5F27 A;  2MD0 A;  2QKM B;  2XRO A;  4QLC U;  3U1D A;  5DUI A;  1FYK A;  1HW1 A;  1TWA J;  1GDT A;  1U5T A;  2MD5 A;  4AC0 A;  1X1P A;  4L5I A;  3FMR A;  5CYV A;  5H6Q A;  2FNA A;  2HI3 A;  2FA5 A;  3FHN A;  3V7C A;  3KYL A;  5DS9 A;  2IGN A;  2UZK A;  2WWY A;  1RZ4 A;  2G7U A;  2WV1 A;  3GTG J;  2VKH A;  4Y3O A;  2NS8 A;  2ID3 A;  2K4J A;  5EEG A;  3GYH X;  3COA C;  2IPQ X;  3I54 A;  3ZN0 A;  4WXD A;  2X0L A;  2CH0 A;  3JSO A;  4UB8 C;  2ESH A;  5K5O A;  2WAD A;  2L2O A;  1ZYR F;  1YJW I;  3K1M A;  4W97 A;  1VND A;  3PNY A;  4FE7 A;  4GFB A;  3Q0U A;  4YEL A;  4HV6 A;  3CDI A;  3RKW A;  4QSH A;  4A3K J;  1IV6 A;  3TW7 A;  3AL0 B;  2GIZ A;  2P5K A;  2EIM H;  2ACJ A;  1DU6 A;  2Y0S A;  4XKC A;  2M8G X;  3I56 I;  2IA1 A;  5LFA A;  4XLH A;  1IRX A;  1FOK A;  4XSZ F;  3ERM A;  3AL0 C;  3PO3 J;  2PMZ A;  2X6Y A;  2LTP A;  1HDD C;  3WTZ A;  2XAF A;  1K61 A;  1CF7 A;  2DFE A;  2D2W A;  3DKW A;  3JRB A;  4UUV A;  4IOC F;  1QVU A;  3V8L A;  1I50 J;  4M6Y A;  2EB7 A;  5L3G A;  2ZJP F;  1X2N A;  3S16 J;  4BXF A;  4XR6 A;  2LKX A;  3HOS A;  3HB9 A;  2PFB A;  3HRM A;  1S9H A;  1S29 A;  4B4C A;  2EA4 A;  2K5C A;  1DGW Y;  4XOP A;  3DLA A;  4RB2 C;  4FET A;  3W2W A;  1B1B A;  3ZN1 A;  1BIB A;  1UB9 A;  3I58 A;  3VWB A;  1MBJ A;  2EQR A;  3M8E A;  3I55 I;  5DM6 F;  4UVB A;  1MNE A;  1MDM A;  4CZZ A;  1E3H A;  2CV2 A;  1UEL B;  2NNY A;  1BI0 A;  2YU3 A;  1BR4 A;  2Q2E B;  4F52 A;  3ERE D;  4A0Z A;  4OOI A;  1QHG A;  4ZYH A;  2L7Z A;  1SD4 A;  5HLI A;  4JP0 A;  4LG0 B;  3J7A O;  1F43 A;  3L2Q A;  4BUP A;  3S15 J;  4BAC A;  2X48 A;  1KON A;  1ETW A;  4RDU A;  3HPH A;  4FX0 A;  1LB2 A;  2DOE A;  1FOY A;  4A3I J;  1F5T A;  2BE5 F;  3ISP A;  3PNV A;  3M07 A;  4A3G J;  1HKQ A;  1WKM A;  4GXO A;  3VOE A;  3CDH A;  2W25 A;  5B66 C;  3MFK A;  2YPR A;  1WH7 A;  5FKO A;  4C9Y A;  3ZQ7 A;  4LJZ F;  3CME I;  5JR3 A;  5M5W J;  4HF1 A;  3ZQC A;  1XGS A;  3K4B A;  5BMZ A;  2ETH A;  2DFF A;  3A0H C;  4HV5 A;  1BJA A;  4I6Z A;  1IN7 A;  3WTV C;  3FXU A;  3RPQ A;  3DEE A;  2HTS A;  3KP4 A;  4C3J J;  2VQG A;  2E2I J;  4DJA A;  4L9N A;  4E7Z A;  2ZJQ F;  1OIS A;  4L9J A;  5FB2 A;  1J2X A;  2W84 A;  3SZT A;  5J8F A;  4RGS A;  4HDU A;  4A3J J;  1RET A;  2EFQ A;  1I1S A;  4P96 A;  1E3O C;  2R7R A;  1R5I D;  2B63 J;  4G6D A;  1OYY A;  3CZ6 A;  3HXL A;  3DEU A;  4B3A A;  2DO7 A;  4PJN A;  2VJI A;  5HOD A;  2CQK A;  2DMQ A;  2E71 A;  3FIW A;  3CP2 A;  2COB A;  2DMT A;  2X1C A;  1TWC J;  4BEH B;  2M4K A;  3IAM 2;  3IP4 B;  4MFD A;  4ZH4 F;  2GXG A;  3C3W A;  2P8T A;  5FGM A;  4BE2 A;  4M71 A;  2ZBK A;  1R1U A;  4JK1 X;  2VJ5 A;  1UCR A;  1Z05 A;  5F04 A;  2NAZ A;  3S3O A;  1H88 C;  2WAF A;  4Q5S F;  5IOZ A;  5ICE A;  1FMW A;  3KX2 A;  3HJE A;  3KZY A;  3DPL C;  5FKM A;  1HC8 A;  1MW7 A;  2JA6 J;  4I2O A;  1OMI A;  5FKN A;  2NVX J;  2UUZ A;  2DW4 A;  2M0C A;  4XLN F;  2IS4 A;  3FM5 A;  4HST A;  4O5V A;  3S93 A;  5J1Y A;  2Y69 H;  2IVM A;  4BKX A;  4RB1 A;  3F8B A;  3GBG A;  5HDG A;  1FOX A;  2R4G A;  3J81 Z;  1S7E A;  1G3T A;  3BG6 A;  3ABT A;  1XMK A;  2Q2E A;  3W3C A;  1LE8 A;  5J1U A;  1U6G A;  3L2W A;  2Y9Z A;  1ZR4 A;  4ZDO A;  2Q0O A;  2X1E A;  1YW8 A;  2DT6 A;  2V9K A;  4RBO A;  2DBB A;  2V1X A;  3BDD A;  2ZKZ A;  4OIP F;  5F1R A;  4F7Z A;  2WB1 A;  1GUU A;  3ZXS A;  1O57 A;  3FBI B;  2ECB A;  2MH9 A;  1XDU A;  3GFJ A;  2HR3 A;  3BR6 A;  2P7V B;  2VE8 A;  1YW9 A;  4DZJ A;  3M4O J;  3WGH A;  4B47 A;  2AXL A;  5FRM A;  2V6C A;  2ME6 A;  1PVE A;  2KMU A;  1SFU A;  2HWV A;  4XM3 A;  3EET A;  1P4A A;  3KYC B;  1Y39 A;  3RKY A;  2NOJ B;  2BXY A;  1W4M A;  4CYC B;  2G0E A;  1B8I B;  3GW2 A;  2HZD A;  2V1U A;  2F6C A;  3BZK A;  4LK0 F;  3KEQ A;  2W1O A;  2RV8 A;  3SFZ A;  4A5M A;  1ODD A;  1QZY A;  3CJQ B;  3TED A;  4EJT A;  3K2Z A;  3CJT B;  1ON1 A;  3OS0 A;  1TT0 A;  3K4J A;  3ZQQ A;  4ENM A;  2XRN A;  3RTR A;  2M7B A;  3O8G A;  1OQY A;  3DP7 A;  2R7V A;  2RDP A;  2DMP A;  5ILU A;  4NHJ A;  3WTW C;  5DM7 F;  3BTC A;  3ZMT A;  2WA0 A;  2LKP A;  4KN4 X;  4KJZ A;  1RUN A;  2BHZ A;  3IH2 A;  4UVA A;  3CCU I;  1T8I A;  1IV8 A;  4HYE A;  1UST A;  3HKZ A;  3OV8 A;  3F8F A;  3N4M A;  3EUH C;  3JAM K;  3QAH A;  1XSV A;  1WHU A;  2R5Z B;  2KKO A;  4L5J A;  5KHD A;  3HL2 A;  2BY3 A;  3DPU A;  1YI2 I;  1R1V A;  3LSG A;  2IS6 A;  1BJZ A;  4CCO A;  3VEP A;  5L3E A;  3DF8 A;  3WGG A;  1WQ2 A;  2ZME B;  2E1M C;  1ENH A;  2QQA A;  3IUO A;  2L9R A;  2YU9 J;  3GF2 A;  2GZW A;  3RPU A;  5AIP A;  4BXX J;  3OYE A;  1VQ8 I;  4XLF A;  2K9L A;  3HGG A;  5FJ8 J;  4BY7 J;  1DP3 A;  1TLH B;  2JN6 A;  3OIQ A;  1Z77 A;  3HEF A;  2CUE A;  2ZME C;  3OYJ A;  1W36 D;  2LDU A;  1HKS A;  1WCM J;  3O6B B;  4PJL A;  3KP5 A;  1SMT A;  4IKF A;  3MWM A;  4J00 A;  3KEO A;  2JRM A;  1AHD P;  2R5Y A;  4FT8 A;  1R4M B;  1ETY A;  3C2G A;  1UG2 A;  1MMD A;  3GFL A;  3TGN A;  4BQA A;  3PM1 A;  2WAQ A;  3CCV I;  3B02 A;  3HOV J;  4RAG A;  5DTD A;  4KIC A;  5FD6 A;  1Y56 A;  1X3W B;  4XLE A;  2O61 A;  5F64 A;  2JK3 A;  2EBI A;  4AWX B;  2KQR A;  1W36 C;  2K85 A;  3CCM I;  3LQR A;  1ACI A;  2X6W A;  1B4A A;  1X1A A;  2YR2 A;  5F6F A;  5M5X J;  3M8F A;  1IDZ A;  2KT0 A;  2BY0 A;  2H1K A;  1IN8 A;  2DA5 A;  4FAS D;  3G71 I;  2E1C A;  2CO5 A;  4CCN A;  1O7F A;  5D6F A;  4ETS A;  2LRE A;  3L9F A;  1DQU A;  1WJC A;  4FCY A;  3KZZ A;  3GTJ J;  3IC7 A;  4BQN A;  4O3M A;  2L5Q A;  2QSH X;  1B59 A;  2JUG A;  2AQE A;  4XLC A;  4PSW A;  1TW2 A;  3CO6 C;  1QZZ A;  4LIU A;  2OA4 A;  2P6T A;  3TOB A;  2D5V A;  3FWE A;  1IN6 A;  1X1B A;  1BOB A;  1Z7U A;  4O6J A;  2CWE A;  3TDZ C;  2P4W A;  3SEZ A;  3FZV A;  3BC8 A;  1N25 A;  4A6D A;  4ITV A;  1A35 A;  3RYP A;  4M73 A;  1TC3 C;  2JA8 J;  1IXS B;  4IOA F;  1K4T A;  4YFN F;  2V1D A;  3BG7 A;  5L3D A;  1OKR A;  1N77 A;  3Q5F A;  1BI2 A;  4X0G A;  1MBE A;  4J19 A;  3HG9 A;  3MZY A;  1V5E A;  1DUX C;  1TQI A;  3FHZ A;  4PZJ A;  2K3P A;  3ZQI A;  5E18 F;  5E3O A;  1YS7 A;  1T33 A;  1IJW C;  2R7X A;  1ETQ A;  3ABK H;  2PLY A;  1OCP A;  3N05 A;  5J4Y A;  3QRF F;  1UZC A;  2OQR A;  5EGO B;  2A5W A;  3ONQ A;  2HDW A;  3MQ0 A;  5B1A H;  1YOV B;  1OR7 A;  2OCE A;  2XAJ A;  2YS9 A;  4UVC A;  2JA5 J;  3PUB A;  2FBH A;  1DU0 A;  1FLI A;  1EH8 A;  3VPR A;  4DQ2 A;  3WG9 A;  4XL9 A;  3WTT C;  1VQK I;  2HXO A;  1HOM A;  3HRS A;  4E7I A;  1YIJ I;  3WGI A;  2EIL H;  4WXC A;  3BR0 A;  1JHH A;  5IT9 Z;  2R7T A;  1J5Y A;  3R0J A;  1FNN A;  3H5A A;  5HLG A;  2QYO A;  2ZJ2 A;  1BBY A;  2RN7 A;  2RQP A;  2QBY B;  4PJM A;  3IL2 A;  2XVC A;  3GCM A;  2HOT A;  3ZGK A;  2DQL A;  3LQQ A;  2GIV A;  3NAR A;  3CMA I;  1PDN C;  3F3X A;  3MKZ A;  2DQR A;  3K6G A;  2L4M A;  1BR2 A;  2STT A;  2DA3 A;  2YSR A;  3NAU A;  3BR5 A;  1R6R A;  5K1Y A;  4L0Y B;  3IRQ A;  3RZD J;  3CUQ A;  4EVI A;  3OR2 C;  4IF4 A;  2PBI A;  2VE9 A;  2DCE A;  2KDZ A;  1USS A;  4BY1 J;  2CFO A;  4IRG A;  2EIJ H;  3H0G J;  4OU0 A;  1VF9 A;  1OFC X;  5K5R A;  4A3F J;  2MA3 A;  4WCG A;  1NH3 A;  4GDF A;  2WAE A;  3P9I A;  3KLN A;  2EA2 A;  3ZQF A;  3K1N A;  4K2E A;  2ZC2 A;  3Q9S A;  1U9O A;  3BR1 A;  3EQL F;  4BXU A;  4EGZ A;  1XD7 A;  3S1Q J;  1FOW A;  4I0B A;  5TJJ A;  2HKO A;  3H5R A;  2K86 A;  3LOC A;  5BOX A;  1HLV A;  3T0Y A;  2PG4 A;  1HW2 A;  2D45 A;  1VQ4 I;  2EZI A;  2DOF A;  2KIM A;  2LMD A;  3BT9 A;  4P1W A;  4V2G A;  1Z7L A;  4RB3 C;  4M6X A;  4M3F A;  4LB5 A;  1Y8Q B;  2BXZ A;  1MJ9 A;  4ENK A;  4YFX F;  2ZNZ A;  2BEO A;  1TP4 A;  3WE3 A;  2GXB A;  3LL7 A;  3MKY B;  4A2U A;  3GX4 X;  1TTY A;  1UFM A;  1ETK A;  2YX4 A;  3J81 K;  1CGP A;  5E20 A;  2F5E A;  2GXA A;  5JI6 A;  1L0O C;  2DYS H;  5DD4 A;  1KQ9 A;  2M4G A;  3OY9 A;  4DYQ A;  4Y33 A;  4E6K G;  4PGG A;  2Y30 A;  5GAD J;  1YRN A;  3CCL I;  1XS9 A;  2NVQ J;  5A2Q Z;  4M3G A;  2V6E A;  1NG6 A;  1IN5 A;  1U8R A;  2O5R A;  2LYC A;  3LWF A;  1F36 A;  2OU2 A;  3VOD A;  3PFI A;  3HOT A;  1JT6 A;  1SVL A;  4LLG F;  1QO0 D;  3HUG B;  2HEO A;  3JRH A;  2LF8 A;  4MHG A;  4IX7 A;  2GAU A;  4HLX A;  4A0X A;  4BAY A;  5F0C A;  3BR2 A;  4D7M A;  1WWX A;  1Z67 A;  3JSP A;  3K70 D;  2DA1 A;  2QBY A;  2L9N A;  1W5C C;  3H9Q A;  5B1B H;  3P7N A;  4CDG A;  4HEA 2;  5E1X A;  5CPR B;  4U7B A;  2L7K A;  3LA2 A;  1FIP A;  1ZRE A;  1X2M A;  1T0F C;  4CXF A;  3CF5 F;  5BPD A;  2EIK H;  3FK6 A;  1OCZ H;  4D7N A;  1IXC A;  4IHS A;  1EV7 A;  1MND A;  1R9T J;  4Z2Y A;  1XMX A;  4LK1 F;  1B9N A;  3BQY A;  3SFI A;  1T38 A;  1UJ8 A;  2XV4 S;  1FEX A;  2JPB A;  2AXT C;  3NQO A;  4XK4 A;  4EGY A;  1HF0 A;  1XC5 A;  4XBF A;  3MVP A;  1MGT A;  3K70 C;  1VQM I;  2FRH A;  4C3H J;  1NG7 A;  1K6O A;  2ZFW A;  9ANT A;  4FTH A;  3RDI A;  4B43 A;  3AG2 H;  4I7H A;  5M3F J;  1E3P A;  4EAT A;  2VJJ A;  1KYZ A;  3LST A;  5GAH J;  1MJB A;  3ASO H;  5IT3 A;  4HSR A;  4G6T B;  2FXA A;  2ZSH B;  5CQE A;  3QPL A;  4S0H B;  2XGC A;  3TOA A;  5EYR A;  4XKW A;  1FP1 D;  1FSE A;  2O03 A;  2TRT A;  3S2H J;  4I76 A;  4R79 A;  3JR9 A;  3ZR8 X;  2K4B A;  2DFI A;  4ESJ A;  2K40 A;  1LNW A;  2L7M P;  3ZPL A;  3AG4 H;  4MFE A;  2CYY A;  1BC7 C;  5LGU A;  5FKL A;  3K1P A;  4N0B A;  3C18 A;  4D5F A;  3Q9V A;  4R8H A;  4AIH A;  3FKJ A;  5LGN A;  3CDL A;  2DFH A;  3KFW X;  2FE3 A;  2ID6 A;  4ASN A;  1K7A A;  1LJ9 A;  1GXP A;  2OV7 A;  1DP7 P;  2XKP A;  3ML6 A;  1BI1 A;  1FTT A;  3PIO F;  3U21 A;  2DDB A;  3E0J B;  1TNS A;  1QPI A;  1IW7 F;  3R0A A;  4H0E A;  3F0C A;  5JFR A;  5GPC A;  2OUM A;  3CC4 I;  5CKT A;  4XOT A;  5IP6 A;  1X1C A;  4RLF A;  4RMN A;  3QYF A;  3SEQ A;  4S05 A;  1FJL A;  2HS5 A;  1F1Z A;  2X4H A;  3HUG A;  3ZMD A;  1A6I A;  3FXQ A;  4ZC3 A;  3CQZ J;  1XTA A;  1YW7 A;  1LFP A;  1D1B A;  4II3 A;  2E35 A;  1Q1V A;  2A6T A;  4ZYA A;  4PJ0 C;  2VN2 A;  3LFK A;  2L01 A;  4HOB A;  1Z0X A;  3FXL A;  5H20 A;  2EFO A;  3FXK A;  3ZOB A;  2NRA C;  3M7G A;  3BZC A;  3ZQG A;  4P55 A;  5TRD A;  1UMQ A;  2W7N A;  3PJR A;  4E7L A;  1RNL A;  3GTL J;  2TCT A;  4HF0 A;  1S5L C;  4C30 A;  4KIB A;  2QSF X;  4ZTJ A;  3REO A;  1WGX A;  2IXS A;  4HX4 A;  4U87 A;  1ONV A;  4RM3 A;  1W7P D;  5GTI C;  5DV5 A;  1IGN A;  2IRF G;  2NVY J;  4JQF A;  3GZ6 A;  1I3A A;  4IRH A;  4XN0 A;  3G1M A;  4IQJ A;  1P9Q C;  5GAG J;  4KNY A;  1MZB A;  1FPQ A;  2MW8 A;  3JRD A;  3L2R A;  2CUF A;  3OYI A;  5L3F A;  2VC1 A;  2O6G E;  2P7C B;  2KJC A;  1W7P B;  3C2H A;  1VQ6 I;  5KCM A;  3CD6 I;  3E6C C;  3W2A A;  4KDP A;  1YG2 A;  2BGC A;  3MN2 A;  1BW5 A;  1QRY A;  2HTJ A;  1JTX A;  5LLQ A;  2EWN A;  3GZN B;  2AHQ A;  2QVO A;  1X4O A;  4C2T A;  2CV0 A;  3K4M A;  3I4P A;  1FYM A;  2MYS A;  2HOE A;  1KQ0 A;  2H8W A;  2K9M A;  2J5O A;  1WFX A;  3CC7 I;  5LRR A;  4ZTF A;  4XMY A;  3JRI A;  4IRI A;  3DTE A;  2V1N A;  2RQQ A;  1S7A A;  2VKV A;  3VSK A;  4ANJ A;  1HXD A;  2DK8 A;  2H09 A;  3OIP A;  3QYB A;  3PUF A;  1P4X A;  2DN0 A;  2LY9 A;  4RA2 A;  1O4X A;  3R6S A;  2QQ8 A;  1HBX G;  2NVT J;  3FXJ A;  4Y4R A;  4OMZ A;  3TO6 A;  3LSM A;  2M9H A;  1ZLJ A;  1X3U A;  3IWZ A;  1ON2 A;  3F6V A;  2KIF A;  4E70 A;  2PJP A;  1ITY A;  3Q0W A;  4F91 B;  3DBH B;  1HA8 A;  2IS1 A;  2R7U A;  1LFU P;  3BLY A;  2DTR A;  4LLL A;  3WE2 A;  1R7J A;  1FTZ A;  3HPG A;  5EG0 B;  1TNT A;  2F5D A;  3WTU C;  2XF7 A;  3F22 A;  3P5J A;  1JE8 A;  2KDO A;  2Z3Y A;  3SZP A;  2BZT A;  2ZSI B;  3VYR B;  1H9G A;  3RKQ A;  1MMS A;  3CC2 I;  2HQN A;  2C6Y A;  4LFU A;  2DT5 A;  4IHT A;  1BC8 C;  3W6K B;  1JUP A;  2Y48 A;  4CCJ A;  3D1N I;  2CU7 A;  4BH9 A;  3WTY C;  1FMV A;  2IP2 A;  2R7O A;  4OAZ A;  3A02 A;  4ESF A;  1ZN2 A;  2EV0 A;  5D8L B;  2HFH A;  3DXJ F;  4HAM A;  5JVT A;  3E6M A;  4KT5 C;  2XAU A;  3SJM A;  2BW3 B;  3DCF A;  5JLW A;  1XPX A;  5ICF A;  2X9D A;  3JW4 A;  1MNM C;  3HHG A;  2JSC A;  2OPT A;  2W48 A;  1I39 A;  2JVH A;  2IAI A;  1TQM A;  4BYY A;  4JBA A;  1RKT A;  2K9N A;  3KPH A;  4A3M J;  4PCQ A;  3GLX A;  4LB6 B;  3OMY A;  2Y0M A;  1AU7 A;  1BL0 A;  5FRN A;  1R1T A;  3U2R A;  3I0T A;  3KLO A;  1ZR2 A;  2PJR B;  3TO7 A;  1XX5 A;  2FNP A;  3B73 A;  4P5O A;  4AIK A;  5C4J J;  1VQ5 I;  2M8E A;  3W2V A;  1OCC H;  2ZXH A;  1ZG5 A;  2VPL A;  4GO1 A;  4BBR J;  2XSJ C;  2NS7 A;  1S3J A;  2I5U A;  1P6R A;  5E8G A;  1WJ5 A;  2I8D A;  3RI4 A;  4HRI A;  2GOX B;  4FIS A;  2DOD A;  3RPU D;  1FX7 A;  1S6L A;  2RGV A;  1SFE A;  1TT5 B;  1TWH J;  5KVR A;  3H3Z A;  3TMO A;  3SDB A;  4JOM A;  3OOP A;  4NC6 A;  3CCJ I;  4A3C J;  3CUO A;  1ZAO A;  4M9S A;  4B09 A;  3DFG A;  1H8A C;  2OJE D;  3NWT A;  2ICW G;  3S8P A;  1JT0 A;  3RKX A;  3K10 A;  4BGD A;  3V7S A;  4LG0 A;  3CCQ I;  1K78 B;  2G9W A;  4PK4 A;  1FT9 A;  2K3F A;  3LSK A;  4BHB A;  3I4N J;  3HSE A;  2OC6 A;  3RSN A;  4ENJ A;  2QLZ A;  4D9J A;  4XIC A;  3NWS A;  5A2Q K;  4KMF A;  4RS8 A;  1FP2 A;  2VLA A;  4EV0 A;  1O3Q A;  3L00 A;  1YYV A;  3O3K A;  3ZQH A;  1W5S A;  1MBF A;  4BDZ A;  1HW5 A;  3S1M J;  5ILS A;  1PUF B;  5D5X B;  3A2K A;  4X1E A;  4PSX A;  1M1E B;  1MH4 A;  1VQN I;  2GOM A;  2K9Q A;  2LLK A;  4KT6 A;  4ZYD A;  1IZ1 A;  3ECH A;  3H3U A;  4RM2 A;  2R7Q A;  3E5Q A;  5LEJ A;  2OF7 A;  4YEJ A;  2E2J J;  2LSO A;  4E7J A;  2NYX A;  2A6H F;  3V42 A;  4IL6 C;  2ZXW H;  3F8M A;  4CH7 A;  4BJ6 C;  1HKT A;  1LKX A;  4M3B A;  4Y52 J;  1OJL A;  4BBS J;  4KUM A;  2ZO4 A;  2XUB A;  4TV7 A;  3IH3 A;  4MGR A;  2HGC A;  3FMQ A;  2A69 F;  5EF6 A;  1JGG A;  1ZKG A;  2KRH A;  4CCL A;  4U0V A;  2DA7 A;  4RB0 A;  1O7L A;  4J01 A;  4RLQ A;  3ZMV A;  2MGQ A;  2P0W A;  1X19 A;  4RGU A;  5FLV A;  2P6S A;  4MEX F;  4BEH A;  4N9H A;  4JX5 A;  1P92 A;  4HW0 A;  3BCA A;  2HVS A;  5GAE J;  4HNU A;  5IYD J;  3K4C A;  1J75 A;  4IXA A;  2F4O B;  1JGS A;  4IVN A;  3W6J B;  3DTI A;  1V5G A;  4GYI A;  2E1M B;  2F5F A;  2E7X A;  1AOY A;  3HSR A;  4I02 A;  2STW A;  3QU6 A;  5CVU A;  2OAZ A;  1R4N B;  4AIJ A;  5IPA A;  1NTC A;  5BNG A;  4MIM A;  3CES A;  2D1H A;  2Z5U A;  2CS3 A;  1R49 A;  2FJ1 A;  1UG0 A;  2O7O A;  4E4H A;  1J0R A;  4OIO F;  2LNB A;  2L9S A;  3PIP F;  1NHA A;  3BTJ A;  3KP7 A;  5IYC J;  3G4S I;  3S17 J;  2CSO A;  2K27 A;  5DEQ A;  1W0U A;  4HDV A;  1V55 H;  2VT3 A;  3I3L A;  4N4O B;  1IC8 A;  1Z1D A;  2LG4 A;  1G3W A;  4C2M J;  2ELK A;  2XAS A;  3FXO A;  1FIA A;  5ERI A;  2ZFU A; 
#chains in the Genus database with same CATH homology
 1MBK A;  1TWA J;  1GDT A;  3ZQF A;  2CRG A;  4AC0 A;  3S1N J;  1U9O A;  2HOA A;  3BR1 A;  2HI3 A;  3S1Q J;  1NK2 P;  5DS9 A;  1H89 C;  3LOC A;  1HLV A;  2FD5 A;  4B1R A;  2WV1 A;  2Y2Z A;  3GTG J;  4CYC A;  2EZI A;  2NS8 A;  2ID3 A;  3BT9 A;  1B8I A;  1GV5 A;  2O8K A;  1T56 A;  4V2G A;  1JJ8 C;  2LD5 A;  4M3F A;  4G12 A;  3OSG A;  1ZK8 A;  5JLX A;  1GVD A;  4IHX A;  4W97 A;  5IYB J;  3UKG A;  1VND A;  1ETK A;  4FE7 A;  4UUT A;  4GFB A;  3Q0U A;  3M3Y J;  1IV6 A;  4A3K J;  4QSH A;  3TW7 A;  5IP7 J;  5E3M A;  3GTM J;  1DU6 A;  4DYQ A;  2Y30 A;  2M8G X;  1YRN A;  1VFC A;  3BG9 A;  4JYK A;  5F0H A;  1XS9 A;  1APL C;  2L0K A;  3RQI A;  3HOU J;  2P81 A;  1ZQ3 P;  2NVQ J;  3PO3 J;  4M3G A;  1ETO A;  2XPV A;  2LTP A;  5K7H A;  1HDD C;  2R5Y B;  3G1O A;  2Y9Y A;  1K61 A;  4DW6 A;  1F36 A;  4A3D J;  2DMN A;  3BQZ A;  3JRB A;  1JT6 A;  1QVU A;  1I50 J;  2XRL A;  1ZTR A;  3JRH A;  5EG0 A;  1X2N A;  2R5Z A;  3S16 J;  4UUS B;  3A01 B;  2LKX A;  3HDD A;  3HB9 A;  5F0C A;  3BR2 A;  4D7M A;  2DA1 A;  2I10 A;  3Q0V A;  4B4C A;  3HM5 A;  4X6A J;  2XB5 A;  3HBL A;  3TP0 A;  1MBJ A;  2EQR A;  5GPA A;  3JRA A;  4A3E J;  2R7Z J;  1RES A;  1FIP A;  3JRF A;  1X2M A;  3FK6 A;  4D7N A;  1RR7 A;  3QPS A;  2Y31 A;  3BG5 A;  2L7Z A;  1R9T J;  4JP0 A;  3SFI A;  3BQY A;  1F43 A;  3LSP A;  5E3N A;  3S15 J;  1IRZ A;  1FEX A;  2X48 A;  5F08 A;  4RDU A;  1ETW A;  4A3I J;  4FE4 A;  3C2B A;  3CMY A;  2ME0 A;  4XK4 A;  1HF0 A;  2QCO A;  1XC5 A;  4A3G J;  3MVP A;  4C3H J;  9ANT A;  4FTH A;  3FK7 A;  2Y0S N;  2VI6 A;  5M3F J;  1B72 B;  1WH7 A;  5FKO A;  2EH3 A;  1MBG A;  5F0F A;  4NDL A;  5M5W J;  3TP3 A;  2PMZ N;  3ZQC A;  2N8G A;  4I6Z A;  3QPL A;  1U9N A;  4EEF G;  4S0H B;  2NOG A;  2XGC A;  3S1R J;  4C3J J;  5EYR A;  2E2I J;  4IEJ A;  2TRT A;  3S2H J;  4I76 A;  1OCT C;  3JR9 A;  2DA4 A;  4A3J J;  1RET A;  2K40 A;  4XRM A;  2X6O A;  2L7M P;  1D5Y A;  2XPW A;  1E3O C;  2E2H J;  3RZO J;  1U78 A;  4MFE A;  2B63 J;  4A93 J;  4B3A A;  3FKI J;  5FKL A;  1JJ6 C;  5HOD A;  2DMQ A;  3FIW A;  4D5F A;  2M2E A;  2COB A;  2DMT A;  1UHS A;  1TWC J;  3CDL A;  1ETX A;  2ID6 A;  4MFD A;  4MLO A;  1FTT A;  3I4M J;  4IHY A;  1QPI A;  5IOY A;  1PUF A;  1H88 C;  2IBD A;  3WHC A;  5F04 A;  3F0C A;  1A5J A;  5GPC A;  5IOZ A;  1MSE C;  2XSD C;  5IP6 A;  5FKM A;  1FJL A;  4M6V A;  2DA2 A;  2JA6 J;  3OIO A;  3HOW J;  5IP9 J;  1A6I A;  1RPW A;  3L1P A;  2FQ4 A;  3CQZ J;  4AUX A;  5FKN A;  1AKH B;  1JKO C;  1Q1V A;  3E7L A;  2NVX J;  2LK2 A;  2M0C A;  4XRS A;  1MBH A;  4LOC A;  3GTO J;  1Z0X A;  5J1Y A;  3ZOB A;  3ZQG A;  4BKX A;  1UMQ A;  4QTR A;  3JRE A;  3GBG A;  3GTL J;  2TCT A;  2YUS A;  3BTL A;  3HGY A;  1S7E A;  5EGO A;  1ZGW A;  2HXI A;  4A3L J;  2LR8 A;  3HOX J;  3OSF A;  1LE8 A;  5J1U A;  1WGX A;  2Y9Z A;  1ZR4 A;  4RBO A;  3G1L A;  1I6H J;  1IGN A;  1HDP A;  2NVY J;  4DYC A;  1GUU A;  1Y1V J;  3LNQ A;  1JUM A;  3GTP J;  1NK3 P;  2ECB A;  4A69 C;  4HNV A;  3G1M A;  3BR6 A;  3BR3 A;  2MW8 A;  3JRD A;  4DZJ A;  2CUF A;  3M4O J;  2XGE A;  2ME6 A;  1XG1 A;  2CQQ A;  4CYC B;  2G0E A;  1K83 J;  3MN2 A;  1B8I B;  1BW5 A;  1QRY A;  4A3B J;  1JUS A;  4AYB N;  1JTX A;  4DYR A;  2AHQ A;  2R93 J;  3TED A;  1JKP C;  1QVT A;  1MH3 A;  4DZP A;  3Q3S A;  2DTZ A;  2AO9 A;  3GTQ J;  3O8G A;  2DMP A;  4W1U A;  1IG7 A;  1CQT A;  3JRI A;  2JMW A;  4XID A;  1YRN B;  2VKV A;  3BTC A;  1P7I A;  5J3L A;  4C3I J;  3LSJ A;  3B6A A;  4M3E A;  2HOS A;  2DN0 A;  2LY9 A;  1O4X A;  3IH2 A;  2NVT J;  5C44 J;  2M9H A;  1RKW A;  4IHV A;  1WPK A;  1ITY A;  3Q0W A;  3BG3 A;  1LFU P;  1FTZ A;  5K7F A;  5EG0 B;  2WB1 N;  2RAE A;  2R5Z B;  3QQA A;  4QIW N;  2CQX A;  2DJN A;  2EZH A;  1Y1W J;  3RKQ A;  1SAN A;  3CCY A;  3LSG A;  1BJZ A;  1JUP A;  4L5E A;  3BTI A;  5F1J A;  1HCR A;  3GTK J;  3D1N I;  2JWT A;  2CU7 A;  1AKH A;  3HOZ J;  1ENH A;  3A02 A;  5EZG A;  2L9R A;  2YU9 J;  1JTY A;  5EZH A;  4BXX J;  3K2A A;  3O8H A;  3SJM A;  3DCF A;  3HGG A;  5FJ8 J;  3JRC A;  4BY7 J;  3K7A J;  2LVS A;  2JN6 A;  5JLW A;  2K9S A;  1Z77 A;  2QF7 A;  3HEF A;  2CUE A;  1EF4 A;  2X9D A;  1WCM J;  1MNM C;  3LSR A;  2OPT A;  2H8R A;  2W48 A;  1AHD P;  2DA6 A;  2R5Y A;  2IAI A;  1UG2 A;  1ETY A;  1RKT A;  2K9N A;  3PM1 A;  4A3M J;  1U8B A;  3PO2 J;  1AU7 A;  3TW6 A;  1BL0 A;  3HOV J;  3JRG A;  5DTD A;  4XRS G;  1ZR2 A;  4UUS A;  3A01 A;  5C4J J;  2JK3 A;  2MSY A;  4BBR J;  2EBI A;  2NS7 A;  1GT0 C;  3HKZ N;  1I3Q J;  1WI3 A;  4FIS A;  1TWH J;  3ZQL A;  1JKR C;  4IHW A;  5M5X J;  4A3C J;  1IDZ A;  2KT0 A;  2H1K A;  3W6V A;  1VI0 A;  2DA5 A;  3OOU A;  1H8A C;  1JT0 A;  4JX6 A;  4FCY A;  1G2H A;  3GTJ J;  2FX0 A;  1ETV A;  2MG4 A;  1IDY A;  3I4N J;  4XIC A;  3S2D J;  3ZQH A;  4D5C A;  1W0T A;  2D5V A;  1MBF A;  1B72 A;  3MKL A;  3S1M J;  2IEK A;  1PUF B;  5J1R A;  4X1E A;  2M34 A;  2ECC A;  1MH4 A;  1TWG J;  2K9Q A;  2LLK A;  1TC3 C;  2JA8 J;  2ZB9 A;  2OF7 A;  2E2J J;  2WAQ N;  2HQ5 A;  2DMU A;  2JJ7 A;  3S14 J;  4J19 A;  1MBE A;  2R92 J;  5FKK A;  4M3B A;  4Y52 J;  1OJL A;  1GV2 A;  1ORK A;  4BBS J;  1TWF J;  5C4X J;  3ZQI A;  2XPU A;  3IH3 A;  5EF6 A;  5E3O A;  1T33 A;  1IJW C;  1ETQ A;  1JGG A;  1ZKG A;  2EZL A;  3IH4 A;  2HDD A;  2LFB A;  1OCP A;  2DA7 A;  2XGD A;  2O9L A;  5EGO B;  2XB0 X;  2MGQ A;  4V2F A;  1LE8 B;  2GLO A;  3A03 A;  2YS9 A;  5FLM J;  5FLV A;  2JA5 J;  1DU0 A;  2E19 A;  3VPR A;  4JX5 A;  1LFB A;  1WH5 A;  3WHB A;  1POG A;  2GBY A;  4Y7N J;  5C3E J;  5IYD J;  2HXO A;  3DEW A;  1HOM A;  5K7Z A;  3B6C A;  2L7F P;  5M3M J;  5M5Y J;  3BR0 A;  1MSF C;  5EDN A;  4M3D A;  2VPR A;  3IV5 A;  4ABZ A;  5E3L A;  5GP9 A;  2R0Q C;  2HOT A;  3NAR A;  5IPA A;  1NTC A;  2GM4 A;  5BNG A;  1P7J A;  2EZK A;  4MIM A;  2VKE A;  1BW6 A;  1BA5 A;  2DA3 A;  2FJ1 A;  3NAU A;  3BR5 A;  1SFO J;  1JKQ C;  3H3V K;  2O7O A;  2VUM J;  2CJJ A;  3FIS A;  5IYC J;  3BTJ A;  1IUF A;  3HOY J;  3S17 J;  3RZD J;  2E1O A;  2LP0 A;  1X58 A;  4JX4 A;  2JA7 J;  3SDG A;  5EEA A;  2KDZ A;  1W0U A;  4BY1 J;  5F27 A;  3H0G J;  4MO7 A;  1VF9 A;  1OFC X;  4A3F J;  1IC8 A;  4C2M J;  2ELK A;  2HYJ A;  1FIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...