2DA1A

Solution structure of the first homeobox domain of at-binding transcription factor 1 (atbf1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
b'GSSGSSGKRPRTRITDDQLRVLRQYFDINNSPSEEQIKEMADKSGLPQKVIKHWFRNTLFKERQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-fetoprotein enhancer binding protein
publication title Solution structure of the first homeobox domain of AT-binding transcription factor 1 (ATBF1)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da1A01
3S1NJ 3BR5A 3A03A 5JLWA 4C3IJ 2M34A 5J3LA 4RBOA 1S7EA 5F27A 3QPLA 2LR8A 3LSPA 2DMQA 4QIWN 4CYCA 1B72A 1K83J 3Q0WA 3L1PA 2P81A 1LE8A 1U78A 2H8RA 3MVPA 2EH3A 4CYCB 2XGCA 3OSGA 1IDZA 1B72B 2LP0A 2XB5A 3JRGA 1FIAA 2K40A 1LE8B 1WCMJ 1ZTRA 1VI0A 3BR2A 4A3EJ 2XSDC 1SFOJ 2YU9J 4I76A 4NDLA 3RZDJ 1W0UA 3S15J 1ETQA 5IYDJ 1CQTA 2I10A 4A3DJ 1QPIA 3FK6A 2CJJA 1I3QJ 4M3DA 3I4MJ 1O4XA 4FCYA 3ZQCA 3K7AJ 3ZOBA 2R92J 3M3YJ 3H0GJ 2EZLA 3GTJJ 1HDPA 2HXIA 5EDNA 2EQRA 2JA5J 1X2MA 3HM5A 4IHVA 5F04A 1IUFA 1TWAJ 3CDLA 5GPAA 4J19A 2HOAA 3NARA 4Y52J 1JJ6C 3H3VK 1MBEA 3NAUA 1F36A 3GTQJ 2E19A 1OFCX 2NS8A 2DMPA 4BY1J 3Q0UA 3BG5A 4XICA 3IH2A 1OCPA 2JMWA 4LOCA 2XPUA 4V2GA 1JTYA 1GV5A 1H89C 1R9TJ 2K9NA 3DCFA 3ZQHA 2CQXA 1IV6A 2VI6A 3TP3A 1HCRA 4QSHA 1ETWA 4MFEA 5JLXA 4IHXA 4M3GA 4G12A 3WHBA 3K2AA 2ZB9A 3HOYJ 5M3FJ 3S17J 1I50J 4W97A 1RKTA 2TCTA 4JP0A 1AU7A 3S1QJ 4M3FA 1DU0A 3B6CA 2HI3A 4MLOA 3BR0A 5K7HA 4A93J 3JRFA 4A3BJ 2FJ1A 2DMTA 3HOUJ 3BQZA 5F0FA 5FLVA 2K9SA 1ETOA 2XB0X 1JJ8C 2Y9YA 1MBKA 2DA1A 3F0CA 4MIMA 4BBRJ 3BQYA 2NVXJ 1UG2A 4D5FA 1G2HA 1P7JA 5C4JJ 2WV1A 5C44J 4A3IJ 3MN2A 1OCTC 2DA2A 3HDDA 3JRBA 2LKXA 3E7LA 1ZQ3P 4IHYA 5E3MA 2ECBA 4JX5A 1MNMC 1BA5A 3HOZJ 2ELKA 2O9LA 1WI3A 1GV2A 4DZJA 1ORKA 1X58A 1QVUA 3CCYA 2RAEA 2MSYA 3BTJA 1ETXA 2EZKA 2NVQJ 3LNQA 2EZHA 2IEKA 2VKVA 3BT9A 1QRYA 3OIOA 2JWTA 2LY9A 4XRSA 2EZIA 2XPVA 3IH3A 3A02A 5IOYA 5F1JA 4M3BA 1XS9A 2L7ZA 1U9OA 1T56A 2LFBA 2H1KA 2JJ7A 3UKGA 1MBGA 3GTKJ 3D1NI 1QVTA 3FISA 5FKOA 4L5EA 1ZGWA 3GBGA 1XC5A 3PO2J 5HODA 2L0KA 3BR1A 1FTTA 1Z77A 1HF0A 2AO9A 5EG0A 3PO3J 2KT0A 4V2FA 1A5JA 1NK3P 2L7FP 5EG0B 3GTLJ 4A3CJ 2LK2A 2CQQA 4C3JJ 5IYCJ 3HBLA 2ME6A 5GP9A 1IJWC 2FX0A 2LTPA 4M6VA 2TRTA 2M9HA 1H8AC 2R93J 5F08A 1WH7A 3ZQIA 1JKPC 1P7IA 3Q0VA 3IH4A 5EGOA 1JGGA 1TWCJ 5E3LA 3M4OJ 2XGEA 1FIPA 4A3LJ 1ITYA 5EGOB 2AHQA 1IC8A 2G0EA 2MG4A 1B8IA 1HLVA 1JUPA 2YS9A 1ZR2A 5M5YJ 1MSFC 1WPKA 1JTXA 2E2HJ 1EF4A 3S1RJ 3S2DJ 3S16J 2CUFA 3LSJA 1RETA 5FJ8J 5M5WJ 1AHDP 2Y0SN 3TW7A 4FTHA 1UMQA 3BG3A 4M3EA 3HGGA 4X6AJ 1RESA 5FKKA 2XGDA 2DA4A 4XRSG 1Y1VJ 4XK4A 5C3EJ 1K61A 2NS7A 2Y2ZA 4W1UA 3JRAA 3VPRA 5DTDA 3IV5A 3JRIA 4JX4A 1ZKGA 5IOZA 4B3AA 3ZQLA 1UHSA 3FKIJ 1RPWA 2FQ4A 4XIDA 1IRZA 2JA6J 2HYJA 1Y1WJ 9ANTA 2N8GA 4AUXA 4Y7NJ 3G1LA 1MBFA 4ABZA 4AYBN 2VUMJ 2DA3A 2B63J 3O8HA 3HOWJ 3Q3SA 2X48A 3JREA 3G1OA 5IP6A 1TWHJ 5F0CA 2WAQN 2LD5A 3LOCA 1ETYA 2W48A 2NOGA 3RQIA 1I6HJ 5FLMJ 1WGXA 2NVTJ 4JX6A 1VF9A 1MSEC 2R5YA 4BBSJ 2DMUA 2R5YB 1H88C 2E1OA 3DEWA 1ZK8A 2CU7A 2IAIA 3MKLA 3RZOJ 5E3OA 3C2BA 5E3NA 3ZQGA 3QQAA 5IPAA 2O7OA 1D5YA 3JRCA 4FISA 2OPTA 5J1RA 3S1MJ 4UUSA 1RKWA 4DZPA 5IP7J 4UUSB 1OJLA 3CQZJ 2DA6A 3QPSA 5M5XJ 4XRMA 1VFCA 2VPRA 1TC3C 1PUFA 2NVYJ 2O8KA 1YRNA 2DTZA 3CMYA 1VNDA 1PUFB 3BTCA 1YRNB 2VKEA 2WB1N 1TWFJ 3W6VA 1E3OC 2LVSA 3HKZN 2ID3A 2HOSA 1IDYA 3SDGA 1Q1VA 1FJLA 1ETVA 4A3KJ 2CUEA 1FTZA 3S2HJ 2JA8J 1XG1A 2X9DA 2GM4A 2ID6A 2QCOA 1JUMA 5J1UA 1JUSA 1T33A 2QF7A 3BR3A 5IP9J 4QTRA 5K7FA 3HEFA 2R5ZA 2XPWA 5F0HA 4UUTA 3SFIA 4D7NA 2R5ZB 4RDUA 2D5VA 2FD5A 4A3GJ 2XRLA 4MFDA 2MGQA 3GTMJ 1NTCA 1B8IB 2DN0A 2GBYA 1MH4A 4A3JJ 2JN6A 4BXXJ 5EYRA 1A6IA 3O8GA 1MBJA 4DYQA 2CRGA 2R0QC 2DJNA 4I6ZA 5J1YA 1ENHA 2ECCA 2MW8A 5FKMA 2PMZN 4C3HJ 3GTPJ 1RR7A 4BKXA 3TEDA 1GUUA 4IHWA 4GFBA 5EEAA 2EBIA 2M2EA 4FE4A 4X1EA 5EF6A 2M0CA 4FE7A 2HXOA 5C4XJ 1U9NA 1TWGJ 1LFBA 1W0TA 1SANA 1APLC 4C2MJ 3SJMA 1JT6A 1Z0XA 4A3FJ 2GLOA 1MBHA 2HOTA 3WHCA 4A69C 5EZGA 1JKOC 4HNVA 1FEXA 3BTLA 4IEJA 2DA7A 3LSGA 3OSFA 1NK2P 2Y9ZA 5K7ZA 3HGYA 2Y30A 2OF7A 3G1MA 1IG7A 3HB9A 3B6AA 1POGA 2L7MP 1JKRC 4DYCA 1ZR4A 1JT0A 5FKLA 1GDTA 3LSRA 4DW6A 1IGNA 3OOUA 3RKQA 2E2JJ 3FK7A 2COBA 4MO7A 1HOMA 1MH3A 2Y31A 3S14J 1HDDC 5BNGA 3TP0A 3BTIA 1X2NA 1ETKA 2R7ZJ 2IBDA 1BW6A 3HOVJ 3JRHA 4JYKA 3TW6A 4S0HB 4B1RA 2HQ5A 3GTGJ 2K9QA 2L9RA 4AC0A 1BL0A 1GVDA 4B4CA 5DS9A 2YUSA 1LFUP 4D7MA 2HDDA 1BW5A 3JRDA 2DA5A 1GT0C 3A01A 4BY7J 5M3MJ 2X6OA 3A01B 4A3MJ 1DU6A 5IYBJ 2JA7J 4DYRA 3BG9A 2DMNA 2JK3A 2KDZA 1U8BA 5EZHA 2M8GX 3PM1A 3I4NJ 5FKNA 1BJZA 4EEFG 3HOXJ 2LLKA 1AKHA 1JKQC 4D5CA 3GTOJ 3BR6A 1AKHB 3JR9A 2E2IJ 2ME0A 1WH5A 3FIWA 1F43A 5GPCA 3ZQFA
chains in the Genus database with same CATH superfamily
4QPQA 5JLWA 2F4OB 4C3IJ 5HDKA 5J3LA 3T1BA 3ONQA 3H3UA 4BDZA 1WQ2A 5FRNA 3D5LA 4R8HA 1B72A 1SFKA 2YPRA 5DUKA 1U78A 2H8RA 3F8FA 1J75A 2QSFX 4MEYF 1WCMJ 1YX5A 1ZTRA 3M9AA 1VI0A 4ZC3A 1YIJI 1RR8C 3QU3A 3AG3H 2F5EA 2K4JA 5L3CA 4A3EJ 4JOMA 1ON2A 1SMTA 5HOOA 1DP7P 4V19K 4B47A 1YS6A 5LRRA 1K7AA 2MLGA 1T8IA 1UZCA 4NDLA 3VOEA 1W0UA 2BHZA 2HS5A 4G6DA 4NHJA 2HQRA 3I53A 1FBQA 1O4XA 3ZQCA 1HW5A 3ZOBA 2AS5F 1WHUA 3FXLA 3H0GJ 2VT2A 1PP7U 1IAWA 3GTJJ 1HDPA 3K1PA 5FLXZ 1MNDA 1X2MA 4WXHA 3GEZA 3M7GA 5LBQA 1P4WA 5F04A 4IHVA 2BY0A 2HOAA 4CSWA 3NARA 4WWCA 4LG0A 4IJAA 3OYMA 3H3VK 5JVTA 4AVZA 3DBHB 2E19A 2NS8A 4AIDA 4E70A 2JPCA 3KP5A 5LFAA 4P55A 1OCPA 1JTYA 2IGOA 5FO5A 1H89C 2V6EA 4BJ5C 4S05A 1WJCA 3MQ0A 3LQQA 4H0EA 4BQQA 2VI6A 1JHFA 3SFZA 2KMUA 1Y39A 4OMZA 4QSHA 3WTTC 1ETWA 5JLXA 3C2GA 1J9IA 4B43A 4G12A 2PQ8A 3CUQA 5LGUA 2JPBA 3WHBA 1Z21A 3K2AA 2R3SA 4TV7A 4KISA 1TZLA 4M3FA 1D1BA 1K79A 5AIPA 1XSDA 4A93J 4YIFA 3C2HA 4NBQA 2FJ1A 5DUIA 3WODF 2LYCA 3LSTA 2RNGA 2Y9YA 1MBKA 1WVRA 2PJRB 3F0CA 1DUXC 4BBRJ 3DTKA 1UG2A 3NWSA 3FXKA 3S93A 1P7JA 3FXJA 4B09A 2LKSA 2WV1A 3R0JA 4IZZA 2F5DA 3MN2A 5J6XA 4ESBA 1OCTC 4UY8I 4J00A 5L3DA 5DCFA 2VKDA 2GAUA 4ENMA 1W5CC 1ZQ3P 4IHYA 3CJNA 4HYEA 3PJRA 2X1DA 5IT9Z 4JX5A 2OA4A 1WI3A 4IF4A 4DZJA 3K70C 2YR2A 1X58A 4MNUA 4PGHA 5D5UB 2VT3A 2CMPA 2KL4A 4BGDA 5ICGA 1VQKI 1VZ0A 2IEKA 1XSVA 5DM6F 1DPUA 1QRYA 2EV0A 2VJ5A 3A1YA 2JWTA 4XBFA 2Q8KA 4XRSA 1ZG5A 2P5VA 2XPVA 5E8IA 3S2WA 4DBQA 5IOYA 5CQEA 3E6CC 4BUPA 2FE3A 3L2WA 1FPQA 4M3BA 1U9OA 1LFPA 3OYLA 4RS8A 2ZJQF 4HPQA 3D1NI 2ZFUA 2RVCA 1QVTA 3CJQB 2A6TA 2JVGA 2Z3YA 2X1CA 2L01A 2ISZA 1HKTA 2A61A 1WRJA 4AIKA 2GOMA 5FLXK 1PUEE 4RGRA 4IX7A 4A2UA 4GDFA 3J7YJ 2ZFWA 4A3CJ 3CZ6A 3GYHX 4FASD 1IJWC 2FNPA 3KEQA 2LG4A 2LTPA 4M6VA 3FXOA 1PDNC 3GVAA 4D1QA 2D2WA 3ZQIA 1JKPC 4JQFA 1IRXA 1LEAA 2MH2A 5B3SH 3Q0VA 3IH4A 3J7AO 2XGEA 4A3LJ 2H27A 4WK8F 5EGOB 1IC8A 3OR2C 3M1EA 2ZXJA 2JRTA 5JI6A 1ZR2A 3AAFA 1HLVA 4KT6A 3HSFA 3KLOA 3OMYA 1FOKA 2PMUA 1ZG1A 2BGCA 4HDUA 2Z1DA 4CCJA 4QLCU 3CESA 1V54H 1J2XA 3U1KA 5FJ8J 4A0XA 3ZMVA 2QKMB 1AHDP 2KRFA 4ZDLA 2Y0SN 3OS2A 4OWRB 1UMQA 4HF2A 3HIFA 2GA2A 3SZPA 4A0ZA 1RESA 2ZSHB 4XRSG 3I5UA 1K61A 5CVUA 2P7VB 3ROUA 2ZJRF 5KK1A 3SDBA 3JRAA 3BCAA 1D1CA 3FHNA 4PFOA 3VPRA 5ILVA 2VQGA 3KCCA 1MD0A 4HNTA 5IOZA 1K6YA 2WAFA 4ZTFA 2E1NA 3H5NA 2CYYA 3JAMK 1UHSA 3DTEA 1OR7C 1RPWA 1LJ9A 4CICA 2WWYA 2CGPA 3L09A 3IWFA 2HQNA 2KISA 4GCVA 2MABA 4OINF 4F92B 3F3XA 3RI4A 1ZHFA 4Y7NJ 3WU2C 1KU9A 1YTYA 2B63J 2RKHA 2EA4A 4KICA 3C18A 1DDNA 3R61A 2ETHA 2K4BA 4HBLA 4XKBA 3G1OA 3LSKA 2XAHA 5DM7F 2BZTA 2OUMA 4G6TB 5F0CA 3CMMA 3F22A 1RNLA 4IPAA 3LOCA 3PNVA 3SHFA 1WJEA 3HUGB 2ZBKA 3RQIA 1BOBA 2FMYA 1SFXA 1WGXA 5LRSA 4KITB 1OMIA 1VF9A 1UELB 2DODA 2A5YB 5H2FC 4HEA2 1EV7A 4BBSJ 3GXOA 3ISPA 4O6JA 2VIXA 5L3FA 3WTVC 3MKZA 1LVKA 2RN7A 2BXZA 3ZQGA 5IPAA 2GIZA 3ABMH 2IS4A 1Y0NA 4AIJA 2W1OA 3W3CA 2HKOA 3CCMI 2OPTA 1R5GA 2VB6A 3U2RA 1T2KA 5J1RA 1BI0A 1RKWA 2STTA 4PDKA 4NB5A 2IP2A 2Q2EB 5CVIA 4CUGA 1OJLA 5IP7J 4U0YA 2BY2A 3L2VA 3V42A 4HLYA 3LFUA 1TC3C 3OYCA 2NVYJ 1Z1DA 1YRNA 3CD6I 3BP8A 1W7PD 4A6EA 1PUFB 2FUG2 2VKEA 2FBHA 5F1RA 1TWFJ 2VOOA 2QLZA 1BN5A 2CQKA 2LNBA 3QAHA 4XN3A 4ETSA 3HKZN 3KP4A 2ID3A 4UXNA 3K4CA 1IDYA 4AIHA 3SDGA 1P9QC 4ESFA 2IA2A 1SD4A 1HSJA 2CUEA 1TTYA 4N0BA 3OYEA 2R7WA 3BC8A 1X3WB 1XG1A 3E3VA 3DFGA 1IO2A 3NQOA 1JUMA 4HX7A 2DT6A 2QF7A 2VJIA 2JUGA 5DD4A 2R5ZA 1EH6A 4OAZA 3SFIA 2NYXA 3X2QH 4YG2F 4RDUA 2VPLA 2FD5A 4EVIA 1FZPB 2HYGD 2BW3B 3CC4I 1OQYA 5KVRA 4E7JA 3GWZA 1CF7B 1BIBA 1EKEA 1MH4A 2O61A 2K02A 1QQIA 4RB0A 3RYRA 4BXXJ 2QBYB 3ML6A 3DBLB 2AXTC 2DJNA 3ZR8X 4I6ZA 3F6OA 2FSWA 3OYHA 2B0LA 1YYVA 2QQBA 3K69A 2NOJB 2MW8A 5FKMA 2W7NA 4C3HJ 1U5TB 1OCOH 4BQOA 1FSHA 4EQQA 3CLQA 5EEAA 3J81K 1ZG3A 3ZGKA 2NS0A 3HRSA 3RPQA 1LFBA 1DQUA 3BCBA 1QZYA 1APLC 1Z0XA 3K4NA 4XKCA 2KZVA 3BZCA 4GGGA 1ZRCA 1J09A 1MNEA 2H8WA 2UXXA 4BE2A 1X19A 5LHGA 2Y9ZA 3UR3C 2DFFA 5H6QA 2IA1A 4BS9A 3IL2A 4O5VA 2MLKA 4XKVA 4DW6A 3HRTA 1IGNA 3GF2A 3EDPA 2E2JJ 1S8NA 3MEXA 4A0YA 3FZVA 1KQ8A 2Y31A 4L9TA 5ICFA 4CH7A 1DPRA 1SVLA 5BNGA 4I7HA 3N4MA 1X2NA 2LC2A 2M30A 4IOAF 1LKXA 3BG6A 3W2AA 4JYKA 4E4HA 5B5EC 4BXUA 3WG9A 1FP2A 4XRFA 1SD5A 2ZNYA 3GTGJ 3CF2A 1I1SA 1Q1HA 1O7LA 3H5AA 2L9RA 3OYFA 1FOYA 5HLTA 5JHFA 1O57A 3B02A 3MWMA 5DS9A 1LFUP 4D7MA 4UUVA 3BJOA 5KCMA 3RPUD 2L9VA 2DA5A 5K5QA 1V5EA 4M9SA 2F5VA 4BY7J 4L5JA 2X6OA 2ACJA 3A01B 5D8KB 3NRVA 3LA2A 3A0HC 3AG4H 5TRDA 4EJOA 5IYBJ 2JA7J 1QGPA 3BG9A 3H3ZA 2DMNA 2KDZA 1U8BA 2BXYA 2E71A 1KU3A 4BHPA 2HYFA 3HHGA 1USSA 5FRMA 1PJRA 3ZN1A 2L02A 3HYIA 2ME0A 5GPCA 2OD5A 5D5VB 1HSTA 2XAFA 3A03A 2A6EF 1BC7C 4L18B 3FMQA 3SZTA 1IN5A 4RBOA 3IC7A 4RLQA 3QPLA 2LR8A 1E3PA 1V3FA 5BPDA 3LSPA 1KU2A 4CYCA 1K83J 3KP6A 4U88A 3FM3A 3OSGA 1B72B 1NG6A 4CO8A 3O3KA 1FIAA 2K40A 3JRGA 1R58A 2XKPA 2F5FA 2CW8A 3IRQA 4M72A 2E60A 1R5HA 2MFZA 2ZC2A 2BVMA 2KIUA 4XKWA 4DJAA 3MCZA 4OIQF 4I76A 3QOEA 3RZDJ 3KEOA 3G2BA 1QA6A 2GIVA 5IYDJ 3KPHA 1CQTA 2I10A 4MGRA 3WTUC 1QPIA 2HQAA 5B66C 2G7HA 2FMLA 4Y3OA 5CVRA 2CJJA 2OJED 1ZLKA 2ZKZA 4M3DA 1YIOA 1F5TA 4NUBA 2GZWA 1J5YA 5TJJA 4KIGA 3M3YJ 3CDIA 3GMEA 1X1BA 2EQRA 1MKMA 2JA5J 3PIOF 1D8KA 3HM5A 4HNUA 2IGNA 2C6YA 1QZEA 3IKVA 3AL0C 2FRHA 1O3QA 3CDLA 1K4SA 2WC2A 5GPAA 2XAUA 1CGPA 1T0FA 3H9JA 2HZDA 4LG0B 3ULQB 4IHTA 4NC7A 4I09A 4IRHA 5FD6A 2DMPA 3Q0UA 4IRGA 2XKOA 1HXDA 1S9HA 3BG5A 4XICA 2JMWA 4CYDA 3PFIA 4LOCA 2EB7A 2RV8A 1GV5A 3DCFA 2CQXA 1IN7A 2QWWA 5AIQA 2KQRA 3QP5A 4EJVA 4IHXA 2K86A 4M3GA 1QU3A 3WTXC 2RDPA 3HOSA 3PNTA 5GADJ 4HG2A 2ZB9A 3CUQB 5M3FJ 3S17J 4RB2C 4OU0A 4ZYGA 4W97A 1RKTA 1GHCA 5BOXA 3LSIA 3S1QJ 2KHMA 4Q48A 1WJFA 2VBZA 3CUQC 3ABKH 3MZ8A 4CCOA 4DOZA 1ZH5A 2AXLA 2DMTA 2EJRA 3BQZA 1XX5A 5FLVA 2L5QA 2VBYA 1YS7A 5ICEA 1JJ8C 4PSXA 3I4PA 1OISA 3O6BB 4AWXB 3F8BA 2QUFA 4M9XA 2CWEA 3RDIA 2NVXJ 1FWZA 1G2HA 3WTZA 5DYMA 1K6OA 2HTSA 2PJPA 5C44J 4D9JA 5L3BA 1P92A 2DOFA 3D5SC 3TQNA 3U9GA 2KRHA 3A4CA 3K4MA 4BYYA 4E7ZA 4BDYA 3Q5FA 4Y13A 4CCKA 5E3MA 2ECBA 2EIMH 1MNMC 4WF2A 2ELKA 1GV2A 1ORKA 1WKMA 1BJAA 2A6HF 1HKSA 3DU5A 1O3RA 1XSXA 1QVUA 2WAQA 3BY6A 3NEUA 2P4WA 2MSYA 2F5CA 4CCNA 4S04A 1ETXA 4Z2YA 5E18F 2EZHA 5GTIC 2KLOA 1V4RA 2ESNA 2EZIA 1DGWY 3IH3A 2L4AA 2P0WA 3ZMDA 2CV1A 4ON0A 3F8CA 5CYVA 2VONA 2HVRA 3EETA 1K78A 3MD2A 2XUBA 1T56A 2LFBA 5LEKA 4HX4A 2H1KA 4CXFA 3UKGA 2I8DA 1MBGA 2W00A 3ZXSA 5J47A 2LH9A 4BJ6C 4F93B 1G59A 2BY1A 2HGCA 2VODA 2M5WA 4L5EA 5J40A 4EJUA 4NC8A 3GBGA 2JQ7A 3BR1A 3P7NA 1FTTA 1U3EM 1UAAA 1HF0A 2J5OA 4LMYA 2AO9A 2FQ3A 5EG0A 2KT0A 2LOOA 1NK3P 2ICWG 3LL7A 1RRJA 2DXIA 5DV5A 4C3JJ 5IYCJ 3OYAA 4LG3A 5E1ZB 2MC3A 2ME6A 1FSEA 2ZXWH 2KP6A 1R23A 3JTHA 2V9VA 4I2OA 1Z05A 2TRTA 2Z99A 3K4BA 2WB1A 3RKWA 3QYFA 1H8AC 4G6QA 3TO9A 1WZ2A 1WH7A 1Z91A 1E0EA 3DLAA 1P7IA 3MKYB 5A2QK 1I3AA 4ITVA 1JGGA 1RC9A 5E3LA 3QP6A 1ITYA 2KIFA 3GLLA 4BXFA 2MG4A 1VQOI 2VJJA 4XLAA 1B8IA 1JUPA 4RA2A 1XD7A 5H20A 1SAXA 1MSFC 2ELJA 2E2HJ 1J59A 3GFJA 3S2DJ 4BH9A 3E6BA 3S16J 2MD5A 1FY7A 2ZO4A 2D45A 2VE8A 2DYSH 5M5WJ 4MQVA 3DKXA 2LKPA 5JHUA 5HLGA 3TW7A 2ZXHA 3RJPA 2V1DA 1D3YA 5HS9A 1K4TA 2XGDA 4LK0F 5C3EJ 5EEGA 2A05A 2DOAA 1NG7A 1TQIA 3JRIA 2EIKH 3W2VA 2M7BA 3DXJF 1LUJB 5LD2C 3ZQLA 3BROA 3CF5F 4GRIA 2OV7A 1NHAA 2VE9A 4P1WA 1WSUA 4ENNA 1R22A 2PMZA 4F55A 3G1LA 3ERMA 5D6FA 2DA3A 1W7PA 3H35A 5DCMB 3VWBA 3VYSB 4XOPA 2DO7A 3LQRA 1DP3A 1LB2A 1P4XA 2QQ8A 3JREA 2UZKA 2EV5A 1FYLA 3HZJA 3CCVI 2K85A 4HV5A 2KKOA 3ZN0A 5JR3A 1LDDA 1XGSA 1D8JA 4FETA 2W48A 2MC4A 5HNFA 2E7WA 3FXMA 5DDGA 2Y75A 5FLMJ 2NVTJ 3ZQQA 3KEYA 2KZGA 1MSEC 1UCRA 3OYIA 3I55I 4XSXF 2R5YA 1KU7A 4EM2A 3C3WA 4XLCA 4HF0A 2K9MA 5J4VA 2PN6A 2E1OA 3QOPA 3DEWA 4HOBA 1R4MB 2CU7A 2IAIA 4K2EA 3RZOJ 2ZMEA 3FKJA 3PUFA 2Z16A 1XDUA 1PP8F 3IP4B 4YIIA 4Y33A 4FISA 5E20A 1R1UA 2VL8A 1KONA 1H0MA 2VC0A 1TNTA 3WU0A 4MHGA 3ZMZA 3VYUB 2EFWA 3CQZJ 3EYIA 2EFOA 1Y56A 3TBIA 1OKRA 1XN7A 2L2OA 1LPQA 4HQMA 2L4MA 3G73A 3LSMA 4PSWA 4PFPA 4UB8C 3G71I 2O8KA 2WTEA 3CMYA 1R36A 2ELHA 4PJNA 1U8RA 1YRNB 4NQWA 3W6VA 4L9JA 2FOWA 2JSCA 3QYBA 3ZQ7A 4E7SA 3OYKA 5E79C 1YW9A 4I99C 2DQRA 5D6EA 1Q1VA 3KIOA 1FJLA 1E2XA 3VODA 2KJCA 3S2HJ 4RB1A 1OLTA 3J80Z 1U0JA 2JA8J 1OYIA 4MEXF 4FQGA 3JTGA 5J1UA 3S32A 2NVUB 1JUSA 4QTRA 5IP9J 4PJ0C 1OCCH 2P6SA 2XPWA 4U87A 2R5ZB 4HDVA 4A3GJ 2QA4I 2GXAA 4GXOA 4OIRF 1YG2A 3ZRGA 2XHKA 4ZZDA 1I6XA 1Z7UA 3T5XA 3KYLA 1QO0D 1EH8A 3F8MA 1TNSA 1YOVB 4Q47A 1G3TA 2E1MC 3HRUA 1SVMA 1ZGAA 4UVCA 3H9GA 3ABTA 2CRGA 1W1WE 3CCUI 2ESHA 5BPIA 4XONA 1G3SA 4KIBA 4FX4A 1JXSA 2X51A 2KJBA 1GUUA 3RPUA 3TO7A 3AG2H 2EBIA 4FE7A 2HXOA 3JW4A 3QWLA 2F4MB 5C4XJ 1U9NA 2QVOA 4LLGF 4OMYA 2EILH 5K5RA 1BC8C 4C2UA 3SJMA 1JT6A 1S7OA 4N9IA 2ISYA 1T6SA 5HNHA 3GUDA 2VN2A 5LEJA 3ASOH 4XSZF 4EGYA 2XF6A 3CC2I 3HRMA 3MZYA 2P5LC 3BTLA 2DA7A 3LSGA 3WE3A 4WXCA 5K7ZA 3HGYA 1S29A 2Y30A 1MW7A 3KP2A 5IT9K 3HB9A 2Q1ZB 2VQLA 1ZR4A 1JT0A 5FKLA 4YFNF 2MA3A 3WGGA 3LSRA 1MMGA 3OR1C 3OOUA 1D0ZA 1TBXA 1ZAOA 2X6WA 3W6KB 5J8FA 3S14J 5KAIC 4IO9F 4CHUA 2Y0SA 3OV8A 1QHGA 3RSNA 1A36A 1Z3XA 4ENJA 4EM1A 4XORA 2PLYA 4WX9A 2R7ZJ 3OIQA 2IBDA 3V7CA 1T38A 3TW6A 3W2WA 2EPFA 2VQHA 3L2RA 2O6GE 5ILUA 1LDKB 5KHDA 2HEOA 4M9ZA 1QHHD 4B8XA 1W5TA 4A6DA 2DK8A 3Q9SA 4KNYA 1GVDA 2DI3A 5FB2A 4B4CA 2MYSA 4BHBA 3I9V2 4FT8A 4YEJA 4E7IA 3MMYB 1F4KA 3K6GA 1R00A 3IKTA 5KNLA 3KX2A 1J7KA 3I58A 3SQNA 4A3MJ 2HR3A 4PZJA 5KAFC 1DU6A 5JVGF 2CV0A 2DW4A 4IOCF 2VBXA 1JI8A 3L7WA 5EZHA 2M8GX 3KZIC 3J80K 2DPUA 2X85A 3PM1A 1BJZA 3BJAA 4EEFG 3HOXJ 3G4SI 4UHTA 2DCEA 1ZRFA 1IW7F 5D4SA 4JBAA 4D5CA 1BBYA 3BR6A 5DEQA 4BNCA 3S8PA 3FIWA 5BQTA 1FOWA 4ZTJA 2KDOA 3OS0A 3S1NJ 1VQLI 4II2A 3I56I 4PCQA 3H5RA 2XC7A 4G7OF 2P7CB 3KFWX 5F27A 4BQNA 3GZNB 3DU6A 4OOIA 4QIWN 4U7BA 3Q0WA 4P9FA 3L1PA 1LE8A 2E35A 3ZCOA 3MVPA 2EH3A 2DFIA 2XGCA 3U21A 4CYCB 1IDZA 2UXNA 4ZYHA 2LP0A 3HC7A 4DGWB 2OZUA 5LGNA 3BZKA 5IT3A 2Z33A 3BR2A 4J01A 2XSDC 3IRRA 3RKXA 3QPHA 3S15J 4UB6C 2XF5A 1ETQA 2YX7A 3OYJA 1S72I 2O8XA 2FA5A 2VQCA 4I0BA 1TL8A 4FX0A 1R49A 2K7LA 3FK6A 4NNJA 3I4MJ 1N75A 4FCYA 3K7AJ 4BAYA 3I0TA 2EA2A 1RI7A 1SEUA 1IUFA 1TWAJ 2WA0A 3GFMA 1YJ9I 1FX7A 2ADUA 1OCZH 1JJ6C 1XCVA 3NAUA 2DFEA 1F36A 2WBMA 4H4KC 3DPTA 1OFCX 2V9PA 1I39A 4U0WA 3PL8A 5B1AH 4KFCA 1E3HA 3IH2A 1T0FC 4Y17A 2XPUA 4V2GA 4BEHA 4XR6A 3CTAA 4NC6A 2VOPA 3D5RC 4L5IA 1IV6A 4CCLA 2J5PA 1HCRA 3L2CA 4MFEA 4Y4RA 1R71A 2DPDA 3DEEA 3J7ZI 3FMRA 2ZJ2A 3TDUC 4L0YB 1QZZA 2I5UA 3HOYJ 3BWGA 4RAYA 4RGUA 6PAXA 2TCTA 3CDHA 4JP0A 1TP4A 1FBSA 2OQRA 3DWLE 3CC7I 2ZJPF 4B48A 3HL2A 2HI3A 2TDXA 4UNOA 2W57A 3JRFA 1XB4A 2L54A 4A3BJ 2R7TA 3PUBA 2XVCA 4ZH4F 3OOPA 2K9SA 1ETOA 3DBRB 3M07A 4XLFA 1RUOA 2NRAC 2BHYA 4E7LA 2VJ4A 1I1GA 2QM3A 4MIMA 1ZLJA 3BQYA 4YRVA 3K4JA 5HVQC 3RCOA 2DU9A 2IGMA 2M4GA 1BI3A 4ZYEA 2XDVA 3IAS2 2QZ8A 3OWTA 4M73A 2UWMA 2R7DA 2QQAA 3SZGA 4AYBA 2R7XA 2DA2A 3I64A 2LKXA 3G3ZA 4BACA 4DBRA 2FEZA 1M1EB 3KYDB 2LSOA 5HS7A 3FBNB 2IS1A 4IHSA 3HOZJ 2O9LA 1N25A 5EEHA 1Y0UA 1TQPA 3FX3A 1FMWA 2YSRA 2RAEA 1O3TA 2IS6A 1P4AA 2HNHA 2EZKA 2ZXIA 3BT9A 3C1DA 3D0SA 3OIOA 4Z6YA 2HPMA 1REPC 1ACIA 3A02A 2Q2EA 3LA3A 1X4OA 1YITI 5F1JA 3IHUA 4KN4X 3WTWC 1IV8A 3DF8A 1XS9A 2L7ZA 4MQ9F 4IRIA 4HSTA 2GA1A 1K78B 2JJ7A 1C0WA 2EWNA 4EATA 1XMXA 4LK1F 2EV6A 1FMVA 3FISA 5FKOA 4I98B 1MJBA 1X1CA 3SEZA 3K1MA 3N05A 1G4DA 1XC5A 1Z77A 1R4NB 4KUMA 2LRDA 2O3FA 5HDGA 3PO3J 3ERED 4V2FA 1A5JA 2KPMA 2L7FP 5EG0B 1E17A 2CQQA 4GO1A 3WGHA 5GP9A 1H9GA 1VQ7I 1VQ9I 2BV6A 1SFEA 2FF4A 3WTYC 4KYWA 5F08A 2A07F 5CPRB 3AL0B 1Z6TA 2UUZA 5CLSA 4BE0A 1XMKA 2CSOA 4GYGA 1FIPA 5E8GA 2RNJA 2G0EA 4G9YA 2HWVA 1CF7A 1SVOA 1X1PA 3CO6C 4PJLA 1VQ5I 1EF4A 1WPKA 1JTXA 4U7DA 3S1RJ 3EQLF 3OS1A 1Z7LA 3F23A 3DQVC 4BL0B 3LSJA 2HVSA 1NH3A 3M1CA 1ERDA 3RIRA 2BE5F 3V8LA 2IW5A 4FTHA 1U5TA 3BG3A 4BQAA 3ASNH 3HGGA 1SD6A 4XNFA 1SD7A 2WADA 1G3WA 1A04A 5FKKA 4XK4A 2NS7A 4M6YA 4W1UA 5E1XA 5DTDA 2OC6A 5FROA 2B9SA 2V1NA 2BY3A 2OCEA 2Q0OA 4XOTA 4LLLA 1SAUA 2HVQA 2W84A 3I59A 3KLNA 3VFZA 5L3EA 3WGIA 1O3SA 4YFKF 1WJAA 5HLHA 2FQ4A 1IRZA 9ANTA 4Y15A 3DEUA 3VYRB 1HA8A 2N8GA 4A12A 4P9UA 1FNNA 5LHIA 2V1XA 2Z5UA 1D1AA 3MKWB 1MBFA 1VQ6I 2NNYA 1QPMA 2V9KA 4BJTA 1TQMA 2D1HA 3O8HA 1FBUA 3FDYA 1W7PB 2X48A 2YU3A 1BI1A 3ECHA 4M74A 3HXLA 5IP6A 1TWHJ 3BPVA 3NWTA 2WAQN 2LD5A 3OYDA 3A0BC 2NOGA 1S3JA 3EUHA 1I27A 1IXSB 1I6HJ 3E5UA 1MJAA 2XAQA 4JX6A 3TOAA 4WCGA 2L9SA 4G8XA 2JRMA 3KP7A 2E36A 2DMUA 3QYEA 3E0JB 1R1VA 1UJ8A 2R5YB 1H88C 1FLIA 3CJTB 4RMNA 3QODA 1ZK8A 1MDMA 3MKLA 4I0AA 5E3OA 3C2BA 5E3NA 4PJMA 3QQAA 2O7OA 1D5YA 2ZMEB 1BI2A 4F52A 3JRCA 2NXNB 2LF7A 4AD9A 2LREA 1RUNA 2ZMEC 2IA0A 3S1MJ 4UUSA 4N9HA 4DZPA 3H92A 1XDSA 5H6RA 2DA6A 3I54A 3E5XA 3L2UA 5M5XJ 3AFHA 4XRMA 1VFCA 1FC3A 1T08B 1OPCA 2HKXA 2VPRA 1R5ID 4O3MA 1MMAA 1VNDA 2DAOA 3SYTA 3BTCA 1KA8A 2RC4A 2WB1N 1JE8A 3HSEA 3SEQA 1KQ9A 3ABLH 1D0YA 4NQWB 3HPGA 2H6BA 3V8KA 3BJ6A 1WWXA 2COMA 4L9VA 1T95A 5LLQA 1ZELA 3CMAI 3TOBA 1FTZA 1VQMI 3V4GA 2RQQA 2XV4S 3GZ5A 2A3SA 2R7VA 2X9DA 2GM4A 2QSGX 4ENKA 1YW8A 2CV2A 2MBFA 1XGOA 2EINH 1QNTA 2QSHX 4G7ZF 4XLPF 3KYCB 2FNAA 4YFXF 3T8TA 2FOKA 1WI9A 1MMDA 3K10A 1HQCA 2EFQA 4UUTA 4D7NA 2FXAA 2PFBA 2MGQA 4JK1X 5E1WA 2XAJA 4G94A 4CGZA 1G6NA 3OY9A 1W4MA 3BDDA 2Y69H 4LIVA 2P8TA 3RKYA 3OL3A 2GQQA 4UV9A 2DN0A 4A3JJ 2JN6A 3PFYA 3RTRA 3KE2A 4C9YA 4RM2A 4M6XA 4DYQA 2JSPA 2CFXA 3R6SA 1AOYA 3IUOA 1W36D 5J1YA 1BOAA 1GXPA 2PMZN 3BZ6A 4ESJA 2X4HA 3MAJA 3C7JA 4XLHA 2F6CA 4IHWA 4GFBA 3CP8A 3E1SA 4F91B 2M0CA 4N4NB 4YELA 1TWGJ 2GOXB 3VB2A 3CCRI 1UB9A 2V1UA 4KA4A 1PVEA 1W5SA 2RGVA 5CVJA 3LA7A 4A3FJ 4HAMA 2GLOA 1MBHA 3WHCA 4C30A 3PSFA 4ANJA 1T39A 1JKOC 5F64A 1FEXA 4WXDA 2PX9A 1L0OC 1MMSA 3OSFA 1NK2P 1GVJA 2FBKA 2OF7A 1IG7A 1YFHA 1POGA 1J0RA 2R7RA 4HLXA 3T0YA 1JKRC 1UHWA 4DYCA 2W24A 3TGNA 2PI0A 3RKQA 3GCMA 3KZYA 1YO5C 4LJZF 1YLFA 4MO7A 1HOMA 1MH3A 5FD5A 4C2TA 1PYVA 2OU2A 3TP0A 3QU6A 1X3UA 4AU7A 4LD5A 1HKQA 3F6VA 5FFXA 3AG1H 2JZYA 3FWEA 3WG7H 1BW6A 1JGSA 3JRHA 3E5QA 4XQFA 4HX8A 1IN6A 5TISC 2LBFA 3OYGA 1AWCA 2E7XA 2K5CA 2DK5A 4IXAA 1VTNC 2K9QA 1YHQI 4AC0A 1BL0A 3O2PE 3JSOA 3JAMZ 2Z2SB 1X1AA 2OBPA 4PGGA 4LB6B 1ON1A 3K1NA 1EJ9A 4KT5C 2K3PA 2HDDA 1BW5A 4EMSA 2E34A 2V79A 1U2WA 1GT0C 1KYWA 5M3MJ 2RREA 2HU9A 3H36A 4EGZA 3L00A 3CLOA 1H9TA 1WJ5A 4ASNA 4UV8A 2H94A 4DYRA 3CCJI 2DLLA 4F3QA 2JK3A 2HDCA 3DTIA 1RIOH 2CUZA 2WY7Q 1IF1A 5FKNA 4L9NA 1AKHA 2D1VA 2IPQX 3OYNA 3V7SA 2E5NA 3GTOJ 4II3A 3CO7C 5HDNA 2E2IJ 1IN4A 1WH5A 1F43A 1YE9A 3ZQFA 4D0PA 2R4GA 3BR5A 4BE1A 1BR4A 2HPIA 4ZDOA 3DPUA 1B59A 2M34A 4LGWA 1S7EA 2P6TA 3QRFF 5BMZA 3CCEI 1VQPI 2DMQA 1MIJA 1BM9A 1OYYA 2P81A 1DGRM 2UV1A 1LE8B 2XB5A 2NNNA 1TT5B 4LITA 3L2QA 5IY5H 3TDZC 1SFOJ 2YU9J 2CW0F 4I02A 1ZREA 4HV6A 1S5LC 1TW3A 2DTRA 2E1MB 2ZNZA 5J8CA 3DPLC 1KZHA 3ZMTA 4A3DJ 1D0XA 1I3QJ 1IZ1A 4P96A 1FYKA 1B4AA 3V8JA 2JA2A 2R92J 2QGUA 1G3YA 3H1CA 3H0DA 2EZLA 2HXIA 5EDNA 2JUCA 4YIRX 3OYBA 3CCQI 3ZPLA 1FOXA 4U0VA 5F6FA 2DFHA 4J19A 2K27A 3FXRA 3K9TA 2GXGA 4Y52J 1IRFA 4XM3A 2QYOA 2VASA 1MBEA 2EK5A 3DV8A 3GTQJ 3REOA 4BY1J 1LNWA 1HC8A 3BLYA 1EA3A 3DKYA 4CZZA 3FXUA 2MD0A 4RAGA 2VBWA 5J4YA 1YQAA 3AKZA 4KMUX 1R9TJ 1ZGJA 2K9NA 4BEHB 1MZBA 3ZQHA 1UG0A 4ZJZA 2DYRH 2DT7B 3TP3A 5AONA 4ZZLA 2Y0MA 2Z9OA 1UFMA 2QQ9A 3ZP5A 3WE2A 1KYZA 1S7AA 3BOQA 4IQ4A 5D8LB 1UHMA 1P2FA 3T8RA 4XMYA 3HSRA 3S3NA 1TLHB 2HTJA 1I50J 1O7FA 1AU7A 5D4RA 2GWRA 2DDAA 1XGNA 1DU0A 3B6CA 4MLOA 5K7HA 3BR0A 5DCMA 3BPXA 3LWFA 3HOUJ 5F0FA 4CDGA 1T98A 2PJRA 2W82A 3J81Z 2XB0X 3PSIA 2DA1A 3LAPA 2IS2A 1LVAA 2M87A 3VDXA 1FT9A 4D5FA 3E6MA 2A68F 4EJTA 1AA7A 5C4JJ 3RQ4A 3LSHA 4A3IJ 4IVNA 5CJ9A 3QPTA 3HDDA 3JRBA 2B7EA 3E7LA 4RAFA 2BVLA 2STWA 2P5KA 2XASA 2LDUA 1V55H 1BA5A 4R1HA 2R7SA 3TKYA 2FU4A 2L9NA 2CQ7A 3HG9A 3CCYA 3BTJA 1A6QA 3M8JA 4L0ZB 2NVQJ 3LAJA 3LNQA 1Z9CA 2VKVA 3K2ZA 2LY9A 5D5XB 3GFIA 3CCSI 2CW7A 2V4JC 1ZRDA 1N78A 1VQ4I 1YJWI 1FYMA 2DBBA 3OL4A 5LGTA 3TMOA 4IKFA 2JT1A 2ZCWA 1HBXG 1LQ1A 4KJZA 1IRGA 3GTKJ 2G9WA 1W36C 3F9KA 4BU2A 2JVHA 5GAGJ 1EH7A 2E5ZA 2QKLB 2V7FA 1B1BA 4HRIA 2HOEA 1ZGWA 3PO2J 5HODA 2L0KA 2OAZA 2VC1A 2HZTA 2EFNA 1USTA 1Z67A 2PMHA 2R7OA 5EJCA 1D5VA 3WU1B 2QEXI 3GTLJ 3GFLA 2LK2A 5D5WB 2BOLA 2L3DA 3HBLA 1WJDA 2HFHA 4PJJA 2O0YA 4Q4ZF 3HPHA 2Y48A 4P5OA 1XGMA 2FX0A 2F4IA 2M4KA 1B9MA 4E7KA 2IGKA 3R4KA 2M9HA 2DT5A 1OYWA 4CZCA 2R93J 2XSJC 2X1EA 3K0LA 3COAC 4HZFA 3EUAA 3HKZA 3N97A 2DJIA 5EGOA 2KIQA 1TWCJ 3M4OJ 4OIOF 2NAZA 4UVAA 4OIPF 2AHQA 4BHCA 1XTAA 1B9NA 2OTJI 2YS9A 3FBIB 5M5YJ 2WV0A 2VLAA 2E1CA 3FF5A 2OTLI 4RLFA 3MZHA 2CUFA 1RETA 2IRFG 3DP7A 3CUOA 4EM0B 4M3EA 3GX4X 3JSPA 4X6AJ 3RYPA 1P6RA 3P9IA 2R7UA 2LY2A 2DA4A 4XLEA 1Y1VJ 3J7AY 1OR7A 3P9CA 2Y2ZA 1YX3A 4E6KG 3PIPF 3IV5A 1U5TC 4JX4A 4Q5SF 1ZKGA 2O03A 2OCCH 2XROA 4B3AA 2EIJH 4XL9A 1IN8A 3FKIJ 3DKWA 3I59B 4XIDA 2JA6J 2HYJA 1Y1WJ 3ZMUA 5ICCA 4AUXA 3FHZA 5K1YA 2W25A 2H1LA 2H09A 5HLIA 4EJWA 4XLNF 2IT0A 2IXSA 4ABZA 2VKHA 1V5FA 1MJ9A 4AYBN 2VUMJ 3HOWJ 1IXRC 1Z6RA 3Q3SA 1SMYF 1Y8RB 5FFZA 2XF7A 3PNYA 5E17F 3EPZA 1LEBA 2G7UA 2DDBA 3I71A 3HUGA 1ETYA 1HW1A 3MFKA 2LMDA 1B6AA 3G6EI 3VSLA 1FP1D 1X1DA 5CQGA 3CJRB 4DNCA 2KRCA 2W85A 4MTDA 2X6YA 1WJBA 3EUHC 2PBIA 3VSKA 2VXDA 2GXBA 3LFKA 2K9LA 2AQFA 2M0MA 3PQKA 4RAZA 5JFRA 3GZ6A 1MDMB 4ZYAA 1A35A 2CQNA 4IQJA 1KQ0A 2ZSIB 4GYIA 2RQPA 4RB3C 2DOEA 4KMFA 2F2EA 3JCUC 2MH9A 3LMMA 4F7ZA 1VQNI 2JTVA 4PUSA 4E7HA 4UUSB 4ZDPA 5ERIA 3P5JA 2L7KA 4OAYA 2LY1A 3WTSC 3QPSA 3ZMSA 1YJNI 5ILSA 1ZN2A 2A5WA 1PUFA 3VYTB 2DTZA 4DQ2A 4MTEA 1VQ8I 5B1BH 1R1TA 4KIFA 1TW2A 3KP3A 1IXCA 4EV0A 3VEPA 4B3XA 2XIGA 3EYYA 3L9FA 1E3OC 4IL6C 3Q9VA 2LVSA 3F72A 2CH0A 3IWZA 2HOSA 1STZA 2BBYA 4LFUA 2KIMA 3E6DA 4UVBA 1ETVA 2CG4A 4A3KJ 4HF1A 1QBJA 1G8XA 1N77A 4AM3A 1U6GA 3CCLI 2V26A 2HDWA 3GO5A 3FMSA 3K70D 4PK4A 2ID6A 2QCOA 1T33A 3BR3A 4LB5A 5K7FA 1ONVA 3E97A 3HEFA 3S3MA 3GW2A 5F0HA 1ULYA 3R0AA 2BEOA 2BW3A 3SXYA 2D5VA 1MMNA 2A69F 2XRLA 4MFDA 5HS8A 2V6CA 1BR2A 1GLNA 3GTMJ 1NTCA 1YW7A 5FGMA 1B8IB 1Y6IA 2GBYA 2XAGA 2QBYA 4M71A 1S6LA 3P9KA 1V5GA 3A2KA 5EYRA 1A6IA 1L3LA 4HW0A 4RM3A 2PEXA 3O8GA 1MBJA 4N4OB 3FXQA 2R0QC 3U1DA 3I3LA 4LIUA 1ENHA 2ECCA 2M45A 2EFPA 1YI2I 3GTPJ 2X0LA 1RR7A 5TGTA 4BKXA 3OIPA 3TEDA 1X3ZB 2YX4A 4AVPA 4X1EA 1GXQA 2FBIA 2M2EA 4FE4A 2LF8A 5EF6A 5ED4A 2DQLA 2QENA 4RGXA 4RGSA 1XPXA 1WFXA 4B44A 1ZARA 5K5OA 1W0TA 2R7QA 1SANA 2CO5A 4C2MJ 1ODDA 2HOTA 1Y8QB 3HTSB 4QWQA 5GAEJ 1OCRH 4A69C 5EZGA 4HNVA 4KN7X 4I01A 1KGSA 3K4KA 4IEJA 5CVVA 2CFOA 3EUKL 4HSRA 5A2QZ 2WY8Q 5CKTA 3TL4X 3F8NA 3G1MA 2PG4A 3KZZA 3B6AA 1BIAA 2L7MP 2M3AA 3ABUA 3DLLF 3FM5A 3H9QA 1GDTA 2H6CA 1HW2A 4HA8A 1TT0A 2OZ6A 3V7RA 3FK7A 3HTUA 2COBA 1R6RA 3ESWB 1IUYA 3HOTA 1ZYRF 1SC7A 5BS6A 3F21A 1HDDC 3M8FA 4LLNA 2XRNA 4HQEA 4G7HF 3BTIA 1X4PA 1ETKA 1XMAA 3HOVJ 4FHTA 2IJLA 3M8EA 5GAHJ 3B73A 3CP2A 4S0HB 4B1RA 2M1BA 3HJEA 3HHHA 2HQ5A 2X6XA 1BR1A 3CMEI 5LHHA 2K3FA 2LBFB 4XN0A 2CUJA 2VXZA 2BYVE 1F1ZA 4CA0A 2AQEA 5L3GA 2YUSA 1JHHA 1Z3YA 2R7FA 3R60A 3JRDA 3ECOA 2F48A 1A31A 2CS3A 1LDJA 2M7AA 2OQGA 4X0GA 1XCBA 1R7JA 3KETA 3A01A 2O5RA 4R79A 1F9NA 3TO6A 4ZYDA 4QPOA 4KDPA 3W6JB 4DIQA 2IVMA 2KFDA 3GLXA 4A5NA 1SFUA 2W4SA 1MGTA 3S3OA 3BG7A 3UNGC 3I4NJ 2XGXA 2LLKA 2M8EA 2WAEA 3IAM2 4A5MA 1JKQC 1I5ZA 1AKHB 3JR9A 3ELKA 3PQJA 1RZ4A 3K4LA 5GTHC 5DD8A 4CCMA
chains in the Genus database with same CATH topology
3S1NJ 3BR5A 3A03A 5JLWA 4C3IJ 2M34A 5J3LA 4RBOA 1S7EA 5F27A 3QPLA 2LR8A 3LSPA 2DMQA 4QIWN 4CYCA 1B72A 1K83J 3Q0WA 3L1PA 2P81A 1LE8A 1U78A 2H8RA 3MVPA 2EH3A 4CYCB 2XGCA 3OSGA 1IDZA 1B72B 2LP0A 2XB5A 3JRGA 1FIAA 2K40A 1LE8B 1WCMJ 1ZTRA 1VI0A 3BR2A 4A3EJ 2XSDC 1SFOJ 2YU9J 4I76A 4NDLA 3RZDJ 1W0UA 3S15J 1ETQA 5IYDJ 1CQTA 2I10A 4A3DJ 1QPIA 3FK6A 2CJJA 1I3QJ 4M3DA 3I4MJ 1O4XA 4FCYA 3ZQCA 3K7AJ 3ZOBA 2R92J 3M3YJ 3H0GJ 2EZLA 3GTJJ 1HDPA 2HXIA 5EDNA 2EQRA 2JA5J 1X2MA 3HM5A 4IHVA 5F04A 1IUFA 1TWAJ 3CDLA 5GPAA 4J19A 2HOAA 3NARA 4Y52J 1JJ6C 3H3VK 1MBEA 3NAUA 1F36A 3GTQJ 2E19A 1OFCX 2NS8A 2DMPA 4BY1J 3Q0UA 3BG5A 4XICA 3IH2A 1OCPA 2JMWA 4LOCA 2XPUA 4V2GA 1JTYA 1GV5A 1H89C 1R9TJ 2K9NA 3DCFA 3ZQHA 2CQXA 1IV6A 2VI6A 3TP3A 1HCRA 4QSHA 1ETWA 4MFEA 5JLXA 4IHXA 4M3GA 4G12A 3WHBA 3K2AA 2ZB9A 3HOYJ 5M3FJ 3S17J 1I50J 4W97A 1RKTA 2TCTA 4JP0A 1AU7A 3S1QJ 4M3FA 1DU0A 3B6CA 2HI3A 4MLOA 3BR0A 5K7HA 4A93J 3JRFA 4A3BJ 2FJ1A 2DMTA 3HOUJ 3BQZA 5F0FA 5FLVA 2K9SA 1ETOA 2XB0X 1JJ8C 2Y9YA 1MBKA 2DA1A 3F0CA 4MIMA 4BBRJ 3BQYA 2NVXJ 1UG2A 4D5FA 1G2HA 1P7JA 5C4JJ 2WV1A 5C44J 4A3IJ 3MN2A 1OCTC 2DA2A 3HDDA 3JRBA 2LKXA 3E7LA 1ZQ3P 4IHYA 5E3MA 2ECBA 4JX5A 1MNMC 1BA5A 3HOZJ 2ELKA 2O9LA 1WI3A 1GV2A 4DZJA 1ORKA 1X58A 1QVUA 3CCYA 2RAEA 2MSYA 3BTJA 1ETXA 2EZKA 2NVQJ 3LNQA 2EZHA 2IEKA 2VKVA 3BT9A 1QRYA 3OIOA 2JWTA 2LY9A 4XRSA 2EZIA 2XPVA 3IH3A 3A02A 5IOYA 5F1JA 4M3BA 1XS9A 2L7ZA 1U9OA 1T56A 2LFBA 2H1KA 2JJ7A 3UKGA 1MBGA 3GTKJ 3D1NI 1QVTA 3FISA 5FKOA 4L5EA 1ZGWA 3GBGA 1XC5A 3PO2J 5HODA 2L0KA 3BR1A 1FTTA 1Z77A 1HF0A 2AO9A 5EG0A 3PO3J 2KT0A 4V2FA 1A5JA 1NK3P 2L7FP 5EG0B 3GTLJ 4A3CJ 2LK2A 2CQQA 4C3JJ 5IYCJ 3HBLA 2ME6A 5GP9A 1IJWC 2FX0A 2LTPA 4M6VA 2TRTA 2M9HA 1H8AC 2R93J 5F08A 1WH7A 3ZQIA 1JKPC 1P7IA 3Q0VA 3IH4A 5EGOA 1JGGA 1TWCJ 5E3LA 3M4OJ 2XGEA 1FIPA 4A3LJ 1ITYA 5EGOB 2AHQA 1IC8A 2G0EA 2MG4A 1B8IA 1HLVA 1JUPA 2YS9A 1ZR2A 5M5YJ 1MSFC 1WPKA 1JTXA 2E2HJ 1EF4A 3S1RJ 3S2DJ 3S16J 2CUFA 3LSJA 1RETA 5FJ8J 5M5WJ 1AHDP 2Y0SN 3TW7A 4FTHA 1UMQA 3BG3A 4M3EA 3HGGA 4X6AJ 1RESA 5FKKA 2XGDA 2DA4A 4XRSG 1Y1VJ 4XK4A 5C3EJ 1K61A 2NS7A 2Y2ZA 4W1UA 3JRAA 3VPRA 5DTDA 3IV5A 3JRIA 4JX4A 1ZKGA 5IOZA 4B3AA 3ZQLA 1UHSA 3FKIJ 1RPWA 2FQ4A 4XIDA 1IRZA 2JA6J 2HYJA 1Y1WJ 9ANTA 2N8GA 4AUXA 4Y7NJ 3G1LA 1MBFA 4ABZA 4AYBN 2VUMJ 2DA3A 2B63J 3O8HA 3HOWJ 3Q3SA 2X48A 3JREA 3G1OA 5IP6A 1TWHJ 5F0CA 2WAQN 2LD5A 3LOCA 1ETYA 2W48A 2NOGA 3RQIA 1I6HJ 5FLMJ 1WGXA 2NVTJ 4JX6A 1VF9A 1MSEC 2R5YA 4BBSJ 2DMUA 2R5YB 1H88C 2E1OA 3DEWA 1ZK8A 2CU7A 2IAIA 3MKLA 3RZOJ 5E3OA 3C2BA 5E3NA 3ZQGA 3QQAA 5IPAA 2O7OA 1D5YA 3JRCA 4FISA 2OPTA 5J1RA 3S1MJ 4UUSA 1RKWA 4DZPA 5IP7J 4UUSB 1OJLA 3CQZJ 2DA6A 3QPSA 5M5XJ 4XRMA 1VFCA 2VPRA 1TC3C 1PUFA 2NVYJ 2O8KA 1YRNA 2DTZA 3CMYA 1VNDA 1PUFB 3BTCA 1YRNB 2VKEA 2WB1N 1TWFJ 3W6VA 1E3OC 2LVSA 3HKZN 2ID3A 2HOSA 1IDYA 3SDGA 1Q1VA 1FJLA 1ETVA 4A3KJ 2CUEA 1FTZA 3S2HJ 2JA8J 1XG1A 2X9DA 2GM4A 2ID6A 2QCOA 1JUMA 5J1UA 1JUSA 1T33A 2QF7A 3BR3A 5IP9J 4QTRA 5K7FA 3HEFA 2R5ZA 2XPWA 5F0HA 4UUTA 3SFIA 4D7NA 2R5ZB 4RDUA 2D5VA 2FD5A 4A3GJ 2XRLA 4MFDA 2MGQA 3GTMJ 1NTCA 1B8IB 2DN0A 2GBYA 1MH4A 4A3JJ 2JN6A 4BXXJ 5EYRA 1A6IA 3O8GA 1MBJA 4DYQA 2CRGA 2R0QC 2DJNA 4I6ZA 5J1YA 1ENHA 2ECCA 2MW8A 5FKMA 2PMZN 4C3HJ 3GTPJ 1RR7A 4BKXA 3TEDA 1GUUA 4IHWA 4GFBA 5EEAA 2EBIA 2M2EA 4FE4A 4X1EA 5EF6A 2M0CA 4FE7A 2HXOA 5C4XJ 1U9NA 1TWGJ 1LFBA 1W0TA 1SANA 1APLC 4C2MJ 3SJMA 1JT6A 1Z0XA 4A3FJ 2GLOA 1MBHA 2HOTA 3WHCA 4A69C 5EZGA 1JKOC 4HNVA 1FEXA 3BTLA 4IEJA 2DA7A 3LSGA 3OSFA 1NK2P 2Y9ZA 5K7ZA 3HGYA 2Y30A 2OF7A 3G1MA 1IG7A 3HB9A 3B6AA 1POGA 2L7MP 1JKRC 4DYCA 1ZR4A 1JT0A 5FKLA 1GDTA 3LSRA 4DW6A 1IGNA 3OOUA 3RKQA 2E2JJ 3FK7A 2COBA 4MO7A 1HOMA 1MH3A 2Y31A 3S14J 1HDDC 5BNGA 3TP0A 3BTIA 1X2NA 1ETKA 2R7ZJ 2IBDA 1BW6A 3HOVJ 3JRHA 4JYKA 3TW6A 4S0HB 4B1RA 2HQ5A 3GTGJ 2K9QA 2L9RA 4AC0A 1BL0A 1GVDA 4B4CA 5DS9A 2YUSA 1LFUP 4D7MA 2HDDA 1BW5A 3JRDA 2DA5A 1GT0C 3A01A 4BY7J 5M3MJ 2X6OA 3A01B 4A3MJ 1DU6A 5IYBJ 2JA7J 4DYRA 3BG9A 2DMNA 2JK3A 2KDZA 1U8BA 5EZHA 2M8GX 3PM1A 3I4NJ 5FKNA 1BJZA 4EEFG 3HOXJ 2LLKA 1AKHA 1JKQC 4D5CA 3GTOJ 3BR6A 1AKHB 3JR9A 2E2IJ 2ME0A 1WH5A 3FIWA 1F43A 5GPCA 3ZQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N J;  3BR5 A;  3A03 A;  5JLW A;  4C3I J;  2M34 A;  5J3L A;  4RBO A;  1S7E A;  5F27 A;  3QPL A;  2LR8 A;  3LSP A;  2DMQ A;  4QIW N;  4CYC A;  1B72 A;  1K83 J;  3Q0W A;  3L1P A;  2P81 A;  1LE8 A;  1U78 A;  2H8R A;  3MVP A;  2EH3 A;  4CYC B;  2XGC A;  3OSG A;  1IDZ A;  1B72 B;  2LP0 A;  2XB5 A;  3JRG A;  1FIA A;  2K40 A;  1LE8 B;  1WCM J;  1ZTR A;  1VI0 A;  3BR2 A;  4A3E J;  2XSD C;  1SFO J;  2YU9 J;  4I76 A;  4NDL A;  3RZD J;  1W0U A;  3S15 J;  1ETQ A;  5IYD J;  1CQT A;  2I10 A;  4A3D J;  1QPI A;  3FK6 A;  2CJJ A;  1I3Q J;  4M3D A;  3I4M J;  1O4X A;  4FCY A;  3ZQC A;  3K7A J;  3ZOB A;  2R92 J;  3M3Y J;  3H0G J;  2EZL A;  3GTJ J;  1HDP A;  2HXI A;  5EDN A;  2EQR A;  2JA5 J;  1X2M A;  3HM5 A;  4IHV A;  5F04 A;  1IUF A;  1TWA J;  3CDL A;  5GPA A;  4J19 A;  2HOA A;  3NAR A;  4Y52 J;  1JJ6 C;  3H3V K;  1MBE A;  3NAU A;  1F36 A;  3GTQ J;  2E19 A;  1OFC X;  2NS8 A;  2DMP A;  4BY1 J;  3Q0U A;  3BG5 A;  4XIC A;  3IH2 A;  1OCP A;  2JMW A;  4LOC A;  2XPU A;  4V2G A;  1JTY A;  1GV5 A;  1H89 C;  1R9T J;  2K9N A;  3DCF A;  3ZQH A;  2CQX A;  1IV6 A;  2VI6 A;  3TP3 A;  1HCR A;  4QSH A;  1ETW A;  4MFE A;  5JLX A;  4IHX A;  4M3G A;  4G12 A;  3WHB A;  3K2A A;  2ZB9 A;  3HOY J;  5M3F J;  3S17 J;  1I50 J;  4W97 A;  1RKT A;  2TCT A;  4JP0 A;  1AU7 A;  3S1Q J;  4M3F A;  1DU0 A;  3B6C A;  2HI3 A;  4MLO A;  3BR0 A;  5K7H A;  4A93 J;  3JRF A;  4A3B J;  2FJ1 A;  2DMT A;  3HOU J;  3BQZ A;  5F0F A;  5FLV A;  2K9S A;  1ETO A;  2XB0 X;  1JJ8 C;  2Y9Y A;  1MBK A;  2DA1 A;  3F0C A;  4MIM A;  4BBR J;  3BQY A;  2NVX J;  1UG2 A;  4D5F A;  1G2H A;  1P7J A;  5C4J J;  2WV1 A;  5C44 J;  4A3I J;  3MN2 A;  1OCT C;  2DA2 A;  3HDD A;  3JRB A;  2LKX A;  3E7L A;  1ZQ3 P;  4IHY A;  5E3M A;  2ECB A;  4JX5 A;  1MNM C;  1BA5 A;  3HOZ J;  2ELK A;  2O9L A;  1WI3 A;  1GV2 A;  4DZJ A;  1ORK A;  1X58 A;  1QVU A;  3CCY A;  2RAE A;  2MSY A;  3BTJ A;  1ETX A;  2EZK A;  2NVQ J;  3LNQ A;  2EZH A;  2IEK A;  2VKV A;  3BT9 A;  1QRY A;  3OIO A;  2JWT A;  2LY9 A;  4XRS A;  2EZI A;  2XPV A;  3IH3 A;  3A02 A;  5IOY A;  5F1J A;  4M3B A;  1XS9 A;  2L7Z A;  1U9O A;  1T56 A;  2LFB A;  2H1K A;  2JJ7 A;  3UKG A;  1MBG A;  3GTK J;  3D1N I;  1QVT A;  3FIS A;  5FKO A;  4L5E A;  1ZGW A;  3GBG A;  1XC5 A;  3PO2 J;  5HOD A;  2L0K A;  3BR1 A;  1FTT A;  1Z77 A;  1HF0 A;  2AO9 A;  5EG0 A;  3PO3 J;  2KT0 A;  4V2F A;  1A5J A;  1NK3 P;  2L7F P;  5EG0 B;  3GTL J;  4A3C J;  2LK2 A;  2CQQ A;  4C3J J;  5IYC J;  3HBL A;  2ME6 A;  5GP9 A;  1IJW C;  2FX0 A;  2LTP A;  4M6V A;  2TRT A;  2M9H A;  1H8A C;  2R93 J;  5F08 A;  1WH7 A;  3ZQI A;  1JKP C;  1P7I A;  3Q0V A;  3IH4 A;  5EGO A;  1JGG A;  1TWC J;  5E3L A;  3M4O J;  2XGE A;  1FIP A;  4A3L J;  1ITY A;  5EGO B;  2AHQ A;  1IC8 A;  2G0E A;  2MG4 A;  1B8I A;  1HLV A;  1JUP A;  2YS9 A;  1ZR2 A;  5M5Y J;  1MSF C;  1WPK A;  1JTX A;  2E2H J;  1EF4 A;  3S1R J;  3S2D J;  3S16 J;  2CUF A;  3LSJ A;  1RET A;  5FJ8 J;  5M5W J;  1AHD P;  2Y0S N;  3TW7 A;  4FTH A;  1UMQ A;  3BG3 A;  4M3E A;  3HGG A;  4X6A J;  1RES A;  5FKK A;  2XGD A;  2DA4 A;  4XRS G;  1Y1V J;  4XK4 A;  5C3E J;  1K61 A;  2NS7 A;  2Y2Z A;  4W1U A;  3JRA A;  3VPR A;  5DTD A;  3IV5 A;  3JRI A;  4JX4 A;  1ZKG A;  5IOZ A;  4B3A A;  3ZQL A;  1UHS A;  3FKI J;  1RPW A;  2FQ4 A;  4XID A;  1IRZ A;  2JA6 J;  2HYJ A;  1Y1W J;  9ANT A;  2N8G A;  4AUX A;  4Y7N J;  3G1L A;  1MBF A;  4ABZ A;  4AYB N;  2VUM J;  2DA3 A;  2B63 J;  3O8H A;  3HOW J;  3Q3S A;  2X48 A;  3JRE A;  3G1O A;  5IP6 A;  1TWH J;  5F0C A;  2WAQ N;  2LD5 A;  3LOC A;  1ETY A;  2W48 A;  2NOG A;  3RQI A;  1I6H J;  5FLM J;  1WGX A;  2NVT J;  4JX6 A;  1VF9 A;  1MSE C;  2R5Y A;  4BBS J;  2DMU A;  2R5Y B;  1H88 C;  2E1O A;  3DEW A;  1ZK8 A;  2CU7 A;  2IAI A;  3MKL A;  3RZO J;  5E3O A;  3C2B A;  5E3N A;  3ZQG A;  3QQA A;  5IPA A;  2O7O A;  1D5Y A;  3JRC A;  4FIS A;  2OPT A;  5J1R A;  3S1M J;  4UUS A;  1RKW A;  4DZP A;  5IP7 J;  4UUS B;  1OJL A;  3CQZ J;  2DA6 A;  3QPS A;  5M5X J;  4XRM A;  1VFC A;  2VPR A;  1TC3 C;  1PUF A;  2NVY J;  2O8K A;  1YRN A;  2DTZ A;  3CMY A;  1VND A;  1PUF B;  3BTC A;  1YRN B;  2VKE A;  2WB1 N;  1TWF J;  3W6V A;  1E3O C;  2LVS A;  3HKZ N;  2ID3 A;  2HOS A;  1IDY A;  3SDG A;  1Q1V A;  1FJL A;  1ETV A;  4A3K J;  2CUE A;  1FTZ A;  3S2H J;  2JA8 J;  1XG1 A;  2X9D A;  2GM4 A;  2ID6 A;  2QCO A;  1JUM A;  5J1U A;  1JUS A;  1T33 A;  2QF7 A;  3BR3 A;  5IP9 J;  4QTR A;  5K7F A;  3HEF A;  2R5Z A;  2XPW A;  5F0H A;  4UUT A;  3SFI A;  4D7N A;  2R5Z B;  4RDU A;  2D5V A;  2FD5 A;  4A3G J;  2XRL A;  4MFD A;  2MGQ A;  3GTM J;  1NTC A;  1B8I B;  2DN0 A;  2GBY A;  1MH4 A;  4A3J J;  2JN6 A;  4BXX J;  5EYR A;  1A6I A;  3O8G A;  1MBJ A;  4DYQ A;  2CRG A;  2R0Q C;  2DJN A;  4I6Z A;  5J1Y A;  1ENH A;  2ECC A;  2MW8 A;  5FKM A;  2PMZ N;  4C3H J;  3GTP J;  1RR7 A;  4BKX A;  3TED A;  1GUU A;  4IHW A;  4GFB A;  5EEA A;  2EBI A;  2M2E A;  4FE4 A;  4X1E A;  5EF6 A;  2M0C A;  4FE7 A;  2HXO A;  5C4X J;  1U9N A;  1TWG J;  1LFB A;  1W0T A;  1SAN A;  1APL C;  4C2M J;  3SJM A;  1JT6 A;  1Z0X A;  4A3F J;  2GLO A;  1MBH A;  2HOT A;  3WHC A;  4A69 C;  5EZG A;  1JKO C;  4HNV A;  1FEX A;  3BTL A;  4IEJ A;  2DA7 A;  3LSG A;  3OSF A;  1NK2 P;  2Y9Z A;  5K7Z A;  3HGY A;  2Y30 A;  2OF7 A;  3G1M A;  1IG7 A;  3HB9 A;  3B6A A;  1POG A;  2L7M P;  1JKR C;  4DYC A;  1ZR4 A;  1JT0 A;  5FKL A;  1GDT A;  3LSR A;  4DW6 A;  1IGN A;  3OOU A;  3RKQ A;  2E2J J;  3FK7 A;  2COB A;  4MO7 A;  1HOM A;  1MH3 A;  2Y31 A;  3S14 J;  1HDD C;  5BNG A;  3TP0 A;  3BTI A;  1X2N A;  1ETK A;  2R7Z J;  2IBD A;  1BW6 A;  3HOV J;  3JRH A;  4JYK A;  3TW6 A;  4S0H B;  4B1R A;  2HQ5 A;  3GTG J;  2K9Q A;  2L9R A;  4AC0 A;  1BL0 A;  1GVD A;  4B4C A;  5DS9 A;  2YUS A;  1LFU P;  4D7M A;  2HDD A;  1BW5 A;  3JRD A;  2DA5 A;  1GT0 C;  3A01 A;  4BY7 J;  5M3M J;  2X6O A;  3A01 B;  4A3M J;  1DU6 A;  5IYB J;  2JA7 J;  4DYR A;  3BG9 A;  2DMN A;  2JK3 A;  2KDZ A;  1U8B A;  5EZH A;  2M8G X;  3PM1 A;  3I4N J;  5FKN A;  1BJZ A;  4EEF G;  3HOX J;  2LLK A;  1AKH A;  1JKQ C;  4D5C A;  3GTO J;  3BR6 A;  1AKH B;  3JR9 A;  2E2I J;  2ME0 A;  1WH5 A;  3FIW A;  1F43 A;  5GPC A;  3ZQF A; 
#chains in the Genus database with same CATH topology
 4QPQ A;  5JLW A;  2F4O B;  4C3I J;  5HDK A;  5J3L A;  3T1B A;  3ONQ A;  3H3U A;  4BDZ A;  1WQ2 A;  5FRN A;  3D5L A;  4R8H A;  1B72 A;  1SFK A;  2YPR A;  5DUK A;  1U78 A;  2H8R A;  3F8F A;  1J75 A;  2QSF X;  4MEY F;  1WCM J;  1YX5 A;  1ZTR A;  3M9A A;  1VI0 A;  4ZC3 A;  1YIJ I;  1RR8 C;  3QU3 A;  3AG3 H;  2F5E A;  2K4J A;  5L3C A;  4A3E J;  4JOM A;  1ON2 A;  1SMT A;  5HOO A;  1DP7 P;  4V19 K;  4B47 A;  1YS6 A;  5LRR A;  1K7A A;  2MLG A;  1T8I A;  1UZC A;  4NDL A;  3VOE A;  1W0U A;  2BHZ A;  2HS5 A;  4G6D A;  4NHJ A;  2HQR A;  3I53 A;  1FBQ A;  1O4X A;  3ZQC A;  1HW5 A;  3ZOB A;  2AS5 F;  1WHU A;  3FXL A;  3H0G J;  2VT2 A;  1PP7 U;  1IAW A;  3GTJ J;  1HDP A;  3K1P A;  5FLX Z;  1MND A;  1X2M A;  4WXH A;  3GEZ A;  3M7G A;  5LBQ A;  1P4W A;  5F04 A;  4IHV A;  2BY0 A;  2HOA A;  4CSW A;  3NAR A;  4WWC A;  4LG0 A;  4IJA A;  3OYM A;  3H3V K;  5JVT A;  4AVZ A;  3DBH B;  2E19 A;  2NS8 A;  4AID A;  4E70 A;  2JPC A;  3KP5 A;  5LFA A;  4P55 A;  1OCP A;  1JTY A;  2IGO A;  5FO5 A;  1H89 C;  2V6E A;  4BJ5 C;  4S05 A;  1WJC A;  3MQ0 A;  3LQQ A;  4H0E A;  4BQQ A;  2VI6 A;  1JHF A;  3SFZ A;  2KMU A;  1Y39 A;  4OMZ A;  4QSH A;  3WTT C;  1ETW A;  5JLX A;  3C2G A;  1J9I A;  4B43 A;  4G12 A;  2PQ8 A;  3CUQ A;  5LGU A;  2JPB A;  3WHB A;  1Z21 A;  3K2A A;  2R3S A;  4TV7 A;  4KIS A;  1TZL A;  4M3F A;  1D1B A;  1K79 A;  5AIP A;  1XSD A;  4A93 J;  4YIF A;  3C2H A;  4NBQ A;  2FJ1 A;  5DUI A;  3WOD F;  2LYC A;  3LST A;  2RNG A;  2Y9Y A;  1MBK A;  1WVR A;  2PJR B;  3F0C A;  1DUX C;  4BBR J;  3DTK A;  1UG2 A;  3NWS A;  3FXK A;  3S93 A;  1P7J A;  3FXJ A;  4B09 A;  2LKS A;  2WV1 A;  3R0J A;  4IZZ A;  2F5D A;  3MN2 A;  5J6X A;  4ESB A;  1OCT C;  4UY8 I;  4J00 A;  5L3D A;  5DCF A;  2VKD A;  2GAU A;  4ENM A;  1W5C C;  1ZQ3 P;  4IHY A;  3CJN A;  4HYE A;  3PJR A;  2X1D A;  5IT9 Z;  4JX5 A;  2OA4 A;  1WI3 A;  4IF4 A;  4DZJ A;  3K70 C;  2YR2 A;  1X58 A;  4MNU A;  4PGH A;  5D5U B;  2VT3 A;  2CMP A;  2KL4 A;  4BGD A;  5ICG A;  1VQK I;  1VZ0 A;  2IEK A;  1XSV A;  5DM6 F;  1DPU A;  1QRY A;  2EV0 A;  2VJ5 A;  3A1Y A;  2JWT A;  4XBF A;  2Q8K A;  4XRS A;  1ZG5 A;  2P5V A;  2XPV A;  5E8I A;  3S2W A;  4DBQ A;  5IOY A;  5CQE A;  3E6C C;  4BUP A;  2FE3 A;  3L2W A;  1FPQ A;  4M3B A;  1U9O A;  1LFP A;  3OYL A;  4RS8 A;  2ZJQ F;  4HPQ A;  3D1N I;  2ZFU A;  2RVC A;  1QVT A;  3CJQ B;  2A6T A;  2JVG A;  2Z3Y A;  2X1C A;  2L01 A;  2ISZ A;  1HKT A;  2A61 A;  1WRJ A;  4AIK A;  2GOM A;  5FLX K;  1PUE E;  4RGR A;  4IX7 A;  4A2U A;  4GDF A;  3J7Y J;  2ZFW A;  4A3C J;  3CZ6 A;  3GYH X;  4FAS D;  1IJW C;  2FNP A;  3KEQ A;  2LG4 A;  2LTP A;  4M6V A;  3FXO A;  1PDN C;  3GVA A;  4D1Q A;  2D2W A;  3ZQI A;  1JKP C;  4JQF A;  1IRX A;  1LEA A;  2MH2 A;  5B3S H;  3Q0V A;  3IH4 A;  3J7A O;  2XGE A;  4A3L J;  2H27 A;  4WK8 F;  5EGO B;  1IC8 A;  3OR2 C;  3M1E A;  2ZXJ A;  2JRT A;  5JI6 A;  1ZR2 A;  3AAF A;  1HLV A;  4KT6 A;  3HSF A;  3KLO A;  3OMY A;  1FOK A;  2PMU A;  1ZG1 A;  2BGC A;  4HDU A;  2Z1D A;  4CCJ A;  4QLC U;  3CES A;  1V54 H;  1J2X A;  3U1K A;  5FJ8 J;  4A0X A;  3ZMV A;  2QKM B;  1AHD P;  2KRF A;  4ZDL A;  2Y0S N;  3OS2 A;  4OWR B;  1UMQ A;  4HF2 A;  3HIF A;  2GA2 A;  3SZP A;  4A0Z A;  1RES A;  2ZSH B;  4XRS G;  3I5U A;  1K61 A;  5CVU A;  2P7V B;  3ROU A;  2ZJR F;  5KK1 A;  3SDB A;  3JRA A;  3BCA A;  1D1C A;  3FHN A;  4PFO A;  3VPR A;  5ILV A;  2VQG A;  3KCC A;  1MD0 A;  4HNT A;  5IOZ A;  1K6Y A;  2WAF A;  4ZTF A;  2E1N A;  3H5N A;  2CYY A;  3JAM K;  1UHS A;  3DTE A;  1OR7 C;  1RPW A;  1LJ9 A;  4CIC A;  2WWY A;  2CGP A;  3L09 A;  3IWF A;  2HQN A;  2KIS A;  4GCV A;  2MAB A;  4OIN F;  4F92 B;  3F3X A;  3RI4 A;  1ZHF A;  4Y7N J;  3WU2 C;  1KU9 A;  1YTY A;  2B63 J;  2RKH A;  2EA4 A;  4KIC A;  3C18 A;  1DDN A;  3R61 A;  2ETH A;  2K4B A;  4HBL A;  4XKB A;  3G1O A;  3LSK A;  2XAH A;  5DM7 F;  2BZT A;  2OUM A;  4G6T B;  5F0C A;  3CMM A;  3F22 A;  1RNL A;  4IPA A;  3LOC A;  3PNV A;  3SHF A;  1WJE A;  3HUG B;  2ZBK A;  3RQI A;  1BOB A;  2FMY A;  1SFX A;  1WGX A;  5LRS A;  4KIT B;  1OMI A;  1VF9 A;  1UEL B;  2DOD A;  2A5Y B;  5H2F C;  4HEA 2;  1EV7 A;  4BBS J;  3GXO A;  3ISP A;  4O6J A;  2VIX A;  5L3F A;  3WTV C;  3MKZ A;  1LVK A;  2RN7 A;  2BXZ A;  3ZQG A;  5IPA A;  2GIZ A;  3ABM H;  2IS4 A;  1Y0N A;  4AIJ A;  2W1O A;  3W3C A;  2HKO A;  3CCM I;  2OPT A;  1R5G A;  2VB6 A;  3U2R A;  1T2K A;  5J1R A;  1BI0 A;  1RKW A;  2STT A;  4PDK A;  4NB5 A;  2IP2 A;  2Q2E B;  5CVI A;  4CUG A;  1OJL A;  5IP7 J;  4U0Y A;  2BY2 A;  3L2V A;  3V42 A;  4HLY A;  3LFU A;  1TC3 C;  3OYC A;  2NVY J;  1Z1D A;  1YRN A;  3CD6 I;  3BP8 A;  1W7P D;  4A6E A;  1PUF B;  2FUG 2;  2VKE A;  2FBH A;  5F1R A;  1TWF J;  2VOO A;  2QLZ A;  1BN5 A;  2CQK A;  2LNB A;  3QAH A;  4XN3 A;  4ETS A;  3HKZ N;  3KP4 A;  2ID3 A;  4UXN A;  3K4C A;  1IDY A;  4AIH A;  3SDG A;  1P9Q C;  4ESF A;  2IA2 A;  1SD4 A;  1HSJ A;  2CUE A;  1TTY A;  4N0B A;  3OYE A;  2R7W A;  3BC8 A;  1X3W B;  1XG1 A;  3E3V A;  3DFG A;  1IO2 A;  3NQO A;  1JUM A;  4HX7 A;  2DT6 A;  2QF7 A;  2VJI A;  2JUG A;  5DD4 A;  2R5Z A;  1EH6 A;  4OAZ A;  3SFI A;  2NYX A;  3X2Q H;  4YG2 F;  4RDU A;  2VPL A;  2FD5 A;  4EVI A;  1FZP B;  2HYG D;  2BW3 B;  3CC4 I;  1OQY A;  5KVR A;  4E7J A;  3GWZ A;  1CF7 B;  1BIB A;  1EKE A;  1MH4 A;  2O61 A;  2K02 A;  1QQI A;  4RB0 A;  3RYR A;  4BXX J;  2QBY B;  3ML6 A;  3DBL B;  2AXT C;  2DJN A;  3ZR8 X;  4I6Z A;  3F6O A;  2FSW A;  3OYH A;  2B0L A;  1YYV A;  2QQB A;  3K69 A;  2NOJ B;  2MW8 A;  5FKM A;  2W7N A;  4C3H J;  1U5T B;  1OCO H;  4BQO A;  1FSH A;  4EQQ A;  3CLQ A;  5EEA A;  3J81 K;  1ZG3 A;  3ZGK A;  2NS0 A;  3HRS A;  3RPQ A;  1LFB A;  1DQU A;  3BCB A;  1QZY A;  1APL C;  1Z0X A;  3K4N A;  4XKC A;  2KZV A;  3BZC A;  4GGG A;  1ZRC A;  1J09 A;  1MNE A;  2H8W A;  2UXX A;  4BE2 A;  1X19 A;  5LHG A;  2Y9Z A;  3UR3 C;  2DFF A;  5H6Q A;  2IA1 A;  4BS9 A;  3IL2 A;  4O5V A;  2MLK A;  4XKV A;  4DW6 A;  3HRT A;  1IGN A;  3GF2 A;  3EDP A;  2E2J J;  1S8N A;  3MEX A;  4A0Y A;  3FZV A;  1KQ8 A;  2Y31 A;  4L9T A;  5ICF A;  4CH7 A;  1DPR A;  1SVL A;  5BNG A;  4I7H A;  3N4M A;  1X2N A;  2LC2 A;  2M30 A;  4IOA F;  1LKX A;  3BG6 A;  3W2A A;  4JYK A;  4E4H A;  5B5E C;  4BXU A;  3WG9 A;  1FP2 A;  4XRF A;  1SD5 A;  2ZNY A;  3GTG J;  3CF2 A;  1I1S A;  1Q1H A;  1O7L A;  3H5A A;  2L9R A;  3OYF A;  1FOY A;  5HLT A;  5JHF A;  1O57 A;  3B02 A;  3MWM A;  5DS9 A;  1LFU P;  4D7M A;  4UUV A;  3BJO A;  5KCM A;  3RPU D;  2L9V A;  2DA5 A;  5K5Q A;  1V5E A;  4M9S A;  2F5V A;  4BY7 J;  4L5J A;  2X6O A;  2ACJ A;  3A01 B;  5D8K B;  3NRV A;  3LA2 A;  3A0H C;  3AG4 H;  5TRD A;  4EJO A;  5IYB J;  2JA7 J;  1QGP A;  3BG9 A;  3H3Z A;  2DMN A;  2KDZ A;  1U8B A;  2BXY A;  2E71 A;  1KU3 A;  4BHP A;  2HYF A;  3HHG A;  1USS A;  5FRM A;  1PJR A;  3ZN1 A;  2L02 A;  3HYI A;  2ME0 A;  5GPC A;  2OD5 A;  5D5V B;  1HST A;  2XAF A;  3A03 A;  2A6E F;  1BC7 C;  4L18 B;  3FMQ A;  3SZT A;  1IN5 A;  4RBO A;  3IC7 A;  4RLQ A;  3QPL A;  2LR8 A;  1E3P A;  1V3F A;  5BPD A;  3LSP A;  1KU2 A;  4CYC A;  1K83 J;  3KP6 A;  4U88 A;  3FM3 A;  3OSG A;  1B72 B;  1NG6 A;  4CO8 A;  3O3K A;  1FIA A;  2K40 A;  3JRG A;  1R58 A;  2XKP A;  2F5F A;  2CW8 A;  3IRQ A;  4M72 A;  2E60 A;  1R5H A;  2MFZ A;  2ZC2 A;  2BVM A;  2KIU A;  4XKW A;  4DJA A;  3MCZ A;  4OIQ F;  4I76 A;  3QOE A;  3RZD J;  3KEO A;  3G2B A;  1QA6 A;  2GIV A;  5IYD J;  3KPH A;  1CQT A;  2I10 A;  4MGR A;  3WTU C;  1QPI A;  2HQA A;  5B66 C;  2G7H A;  2FML A;  4Y3O A;  5CVR A;  2CJJ A;  2OJE D;  1ZLK A;  2ZKZ A;  4M3D A;  1YIO A;  1F5T A;  4NUB A;  2GZW A;  1J5Y A;  5TJJ A;  4KIG A;  3M3Y J;  3CDI A;  3GME A;  1X1B A;  2EQR A;  1MKM A;  2JA5 J;  3PIO F;  1D8K A;  3HM5 A;  4HNU A;  2IGN A;  2C6Y A;  1QZE A;  3IKV A;  3AL0 C;  2FRH A;  1O3Q A;  3CDL A;  1K4S A;  2WC2 A;  5GPA A;  2XAU A;  1CGP A;  1T0F A;  3H9J A;  2HZD A;  4LG0 B;  3ULQ B;  4IHT A;  4NC7 A;  4I09 A;  4IRH A;  5FD6 A;  2DMP A;  3Q0U A;  4IRG A;  2XKO A;  1HXD A;  1S9H A;  3BG5 A;  4XIC A;  2JMW A;  4CYD A;  3PFI A;  4LOC A;  2EB7 A;  2RV8 A;  1GV5 A;  3DCF A;  2CQX A;  1IN7 A;  2QWW A;  5AIQ A;  2KQR A;  3QP5 A;  4EJV A;  4IHX A;  2K86 A;  4M3G A;  1QU3 A;  3WTX C;  2RDP A;  3HOS A;  3PNT A;  5GAD J;  4HG2 A;  2ZB9 A;  3CUQ B;  5M3F J;  3S17 J;  4RB2 C;  4OU0 A;  4ZYG A;  4W97 A;  1RKT A;  1GHC A;  5BOX A;  3LSI A;  3S1Q J;  2KHM A;  4Q48 A;  1WJF A;  2VBZ A;  3CUQ C;  3ABK H;  3MZ8 A;  4CCO A;  4DOZ A;  1ZH5 A;  2AXL A;  2DMT A;  2EJR A;  3BQZ A;  1XX5 A;  5FLV A;  2L5Q A;  2VBY A;  1YS7 A;  5ICE A;  1JJ8 C;  4PSX A;  3I4P A;  1OIS A;  3O6B B;  4AWX B;  3F8B A;  2QUF A;  4M9X A;  2CWE A;  3RDI A;  2NVX J;  1FWZ A;  1G2H A;  3WTZ A;  5DYM A;  1K6O A;  2HTS A;  2PJP A;  5C44 J;  4D9J A;  5L3B A;  1P92 A;  2DOF A;  3D5S C;  3TQN A;  3U9G A;  2KRH A;  3A4C A;  3K4M A;  4BYY A;  4E7Z A;  4BDY A;  3Q5F A;  4Y13 A;  4CCK A;  5E3M A;  2ECB A;  2EIM H;  1MNM C;  4WF2 A;  2ELK A;  1GV2 A;  1ORK A;  1WKM A;  1BJA A;  2A6H F;  1HKS A;  3DU5 A;  1O3R A;  1XSX A;  1QVU A;  2WAQ A;  3BY6 A;  3NEU A;  2P4W A;  2MSY A;  2F5C A;  4CCN A;  4S04 A;  1ETX A;  4Z2Y A;  5E18 F;  2EZH A;  5GTI C;  2KLO A;  1V4R A;  2ESN A;  2EZI A;  1DGW Y;  3IH3 A;  2L4A A;  2P0W A;  3ZMD A;  2CV1 A;  4ON0 A;  3F8C A;  5CYV A;  2VON A;  2HVR A;  3EET A;  1K78 A;  3MD2 A;  2XUB A;  1T56 A;  2LFB A;  5LEK A;  4HX4 A;  2H1K A;  4CXF A;  3UKG A;  2I8D A;  1MBG A;  2W00 A;  3ZXS A;  5J47 A;  2LH9 A;  4BJ6 C;  4F93 B;  1G59 A;  2BY1 A;  2HGC A;  2VOD A;  2M5W A;  4L5E A;  5J40 A;  4EJU A;  4NC8 A;  3GBG A;  2JQ7 A;  3BR1 A;  3P7N A;  1FTT A;  1U3E M;  1UAA A;  1HF0 A;  2J5O A;  4LMY A;  2AO9 A;  2FQ3 A;  5EG0 A;  2KT0 A;  2LOO A;  1NK3 P;  2ICW G;  3LL7 A;  1RRJ A;  2DXI A;  5DV5 A;  4C3J J;  5IYC J;  3OYA A;  4LG3 A;  5E1Z B;  2MC3 A;  2ME6 A;  1FSE A;  2ZXW H;  2KP6 A;  1R23 A;  3JTH A;  2V9V A;  4I2O A;  1Z05 A;  2TRT A;  2Z99 A;  3K4B A;  2WB1 A;  3RKW A;  3QYF A;  1H8A C;  4G6Q A;  3TO9 A;  1WZ2 A;  1WH7 A;  1Z91 A;  1E0E A;  3DLA A;  1P7I A;  3MKY B;  5A2Q K;  1I3A A;  4ITV A;  1JGG A;  1RC9 A;  5E3L A;  3QP6 A;  1ITY A;  2KIF A;  3GLL A;  4BXF A;  2MG4 A;  1VQO I;  2VJJ A;  4XLA A;  1B8I A;  1JUP A;  4RA2 A;  1XD7 A;  5H20 A;  1SAX A;  1MSF C;  2ELJ A;  2E2H J;  1J59 A;  3GFJ A;  3S2D J;  4BH9 A;  3E6B A;  3S16 J;  2MD5 A;  1FY7 A;  2ZO4 A;  2D45 A;  2VE8 A;  2DYS H;  5M5W J;  4MQV A;  3DKX A;  2LKP A;  5JHU A;  5HLG A;  3TW7 A;  2ZXH A;  3RJP A;  2V1D A;  1D3Y A;  5HS9 A;  1K4T A;  2XGD A;  4LK0 F;  5C3E J;  5EEG A;  2A05 A;  2DOA A;  1NG7 A;  1TQI A;  3JRI A;  2EIK H;  3W2V A;  2M7B A;  3DXJ F;  1LUJ B;  5LD2 C;  3ZQL A;  3BRO A;  3CF5 F;  4GRI A;  2OV7 A;  1NHA A;  2VE9 A;  4P1W A;  1WSU A;  4ENN A;  1R22 A;  2PMZ A;  4F55 A;  3G1L A;  3ERM A;  5D6F A;  2DA3 A;  1W7P A;  3H35 A;  5DCM B;  3VWB A;  3VYS B;  4XOP A;  2DO7 A;  3LQR A;  1DP3 A;  1LB2 A;  1P4X A;  2QQ8 A;  3JRE A;  2UZK A;  2EV5 A;  1FYL A;  3HZJ A;  3CCV I;  2K85 A;  4HV5 A;  2KKO A;  3ZN0 A;  5JR3 A;  1LDD A;  1XGS A;  1D8J A;  4FET A;  2W48 A;  2MC4 A;  5HNF A;  2E7W A;  3FXM A;  5DDG A;  2Y75 A;  5FLM J;  2NVT J;  3ZQQ A;  3KEY A;  2KZG A;  1MSE C;  1UCR A;  3OYI A;  3I55 I;  4XSX F;  2R5Y A;  1KU7 A;  4EM2 A;  3C3W A;  4XLC A;  4HF0 A;  2K9M A;  5J4V A;  2PN6 A;  2E1O A;  3QOP A;  3DEW A;  4HOB A;  1R4M B;  2CU7 A;  2IAI A;  4K2E A;  3RZO J;  2ZME A;  3FKJ A;  3PUF A;  2Z16 A;  1XDU A;  1PP8 F;  3IP4 B;  4YII A;  4Y33 A;  4FIS A;  5E20 A;  1R1U A;  2VL8 A;  1KON A;  1H0M A;  2VC0 A;  1TNT A;  3WU0 A;  4MHG A;  3ZMZ A;  3VYU B;  2EFW A;  3CQZ J;  3EYI A;  2EFO A;  1Y56 A;  3TBI A;  1OKR A;  1XN7 A;  2L2O A;  1LPQ A;  4HQM A;  2L4M A;  3G73 A;  3LSM A;  4PSW A;  4PFP A;  4UB8 C;  3G71 I;  2O8K A;  2WTE A;  3CMY A;  1R36 A;  2ELH A;  4PJN A;  1U8R A;  1YRN B;  4NQW A;  3W6V A;  4L9J A;  2FOW A;  2JSC A;  3QYB A;  3ZQ7 A;  4E7S A;  3OYK A;  5E79 C;  1YW9 A;  4I99 C;  2DQR A;  5D6E A;  1Q1V A;  3KIO A;  1FJL A;  1E2X A;  3VOD A;  2KJC A;  3S2H J;  4RB1 A;  1OLT A;  3J80 Z;  1U0J A;  2JA8 J;  1OYI A;  4MEX F;  4FQG A;  3JTG A;  5J1U A;  3S32 A;  2NVU B;  1JUS A;  4QTR A;  5IP9 J;  4PJ0 C;  1OCC H;  2P6S A;  2XPW A;  4U87 A;  2R5Z B;  4HDV A;  4A3G J;  2QA4 I;  2GXA A;  4GXO A;  4OIR F;  1YG2 A;  3ZRG A;  2XHK A;  4ZZD A;  1I6X A;  1Z7U A;  3T5X A;  3KYL A;  1QO0 D;  1EH8 A;  3F8M A;  1TNS A;  1YOV B;  4Q47 A;  1G3T A;  2E1M C;  3HRU A;  1SVM A;  1ZGA A;  4UVC A;  3H9G A;  3ABT A;  2CRG A;  1W1W E;  3CCU I;  2ESH A;  5BPI A;  4XON A;  1G3S A;  4KIB A;  4FX4 A;  1JXS A;  2X51 A;  2KJB A;  1GUU A;  3RPU A;  3TO7 A;  3AG2 H;  2EBI A;  4FE7 A;  2HXO A;  3JW4 A;  3QWL A;  2F4M B;  5C4X J;  1U9N A;  2QVO A;  4LLG F;  4OMY A;  2EIL H;  5K5R A;  1BC8 C;  4C2U A;  3SJM A;  1JT6 A;  1S7O A;  4N9I A;  2ISY A;  1T6S A;  5HNH A;  3GUD A;  2VN2 A;  5LEJ A;  3ASO H;  4XSZ F;  4EGY A;  2XF6 A;  3CC2 I;  3HRM A;  3MZY A;  2P5L C;  3BTL A;  2DA7 A;  3LSG A;  3WE3 A;  4WXC A;  5K7Z A;  3HGY A;  1S29 A;  2Y30 A;  1MW7 A;  3KP2 A;  5IT9 K;  3HB9 A;  2Q1Z B;  2VQL A;  1ZR4 A;  1JT0 A;  5FKL A;  4YFN F;  2MA3 A;  3WGG A;  3LSR A;  1MMG A;  3OR1 C;  3OOU A;  1D0Z A;  1TBX A;  1ZAO A;  2X6W A;  3W6K B;  5J8F A;  3S14 J;  5KAI C;  4IO9 F;  4CHU A;  2Y0S A;  3OV8 A;  1QHG A;  3RSN A;  1A36 A;  1Z3X A;  4ENJ A;  4EM1 A;  4XOR A;  2PLY A;  4WX9 A;  2R7Z J;  3OIQ A;  2IBD A;  3V7C A;  1T38 A;  3TW6 A;  3W2W A;  2EPF A;  2VQH A;  3L2R A;  2O6G E;  5ILU A;  1LDK B;  5KHD A;  2HEO A;  4M9Z A;  1QHH D;  4B8X A;  1W5T A;  4A6D A;  2DK8 A;  3Q9S A;  4KNY A;  1GVD A;  2DI3 A;  5FB2 A;  4B4C A;  2MYS A;  4BHB A;  3I9V 2;  4FT8 A;  4YEJ A;  4E7I A;  3MMY B;  1F4K A;  3K6G A;  1R00 A;  3IKT A;  5KNL A;  3KX2 A;  1J7K A;  3I58 A;  3SQN A;  4A3M J;  2HR3 A;  4PZJ A;  5KAF C;  1DU6 A;  5JVG F;  2CV0 A;  2DW4 A;  4IOC F;  2VBX A;  1JI8 A;  3L7W A;  5EZH A;  2M8G X;  3KZI C;  3J80 K;  2DPU A;  2X85 A;  3PM1 A;  1BJZ A;  3BJA A;  4EEF G;  3HOX J;  3G4S I;  4UHT A;  2DCE A;  1ZRF A;  1IW7 F;  5D4S A;  4JBA A;  4D5C A;  1BBY A;  3BR6 A;  5DEQ A;  4BNC A;  3S8P A;  3FIW A;  5BQT A;  1FOW A;  4ZTJ A;  2KDO A;  3OS0 A;  3S1N J;  1VQL I;  4II2 A;  3I56 I;  4PCQ A;  3H5R A;  2XC7 A;  4G7O F;  2P7C B;  3KFW X;  5F27 A;  4BQN A;  3GZN B;  3DU6 A;  4OOI A;  4QIW N;  4U7B A;  3Q0W A;  4P9F A;  3L1P A;  1LE8 A;  2E35 A;  3ZCO A;  3MVP A;  2EH3 A;  2DFI A;  2XGC A;  3U21 A;  4CYC B;  1IDZ A;  2UXN A;  4ZYH A;  2LP0 A;  3HC7 A;  4DGW B;  2OZU A;  5LGN A;  3BZK A;  5IT3 A;  2Z33 A;  3BR2 A;  4J01 A;  2XSD C;  3IRR A;  3RKX A;  3QPH A;  3S15 J;  4UB6 C;  2XF5 A;  1ETQ A;  2YX7 A;  3OYJ A;  1S72 I;  2O8X A;  2FA5 A;  2VQC A;  4I0B A;  1TL8 A;  4FX0 A;  1R49 A;  2K7L A;  3FK6 A;  4NNJ A;  3I4M J;  1N75 A;  4FCY A;  3K7A J;  4BAY A;  3I0T A;  2EA2 A;  1RI7 A;  1SEU A;  1IUF A;  1TWA J;  2WA0 A;  3GFM A;  1YJ9 I;  1FX7 A;  2ADU A;  1OCZ H;  1JJ6 C;  1XCV A;  3NAU A;  2DFE A;  1F36 A;  2WBM A;  4H4K C;  3DPT A;  1OFC X;  2V9P A;  1I39 A;  4U0W A;  3PL8 A;  5B1A H;  4KFC A;  1E3H A;  3IH2 A;  1T0F C;  4Y17 A;  2XPU A;  4V2G A;  4BEH A;  4XR6 A;  3CTA A;  4NC6 A;  2VOP A;  3D5R C;  4L5I A;  1IV6 A;  4CCL A;  2J5P A;  1HCR A;  3L2C A;  4MFE A;  4Y4R A;  1R71 A;  2DPD A;  3DEE A;  3J7Z I;  3FMR A;  2ZJ2 A;  3TDU C;  4L0Y B;  1QZZ A;  2I5U A;  3HOY J;  3BWG A;  4RAY A;  4RGU A;  6PAX A;  2TCT A;  3CDH A;  4JP0 A;  1TP4 A;  1FBS A;  2OQR A;  3DWL E;  3CC7 I;  2ZJP F;  4B48 A;  3HL2 A;  2HI3 A;  2TDX A;  4UNO A;  2W57 A;  3JRF A;  1XB4 A;  2L54 A;  4A3B J;  2R7T A;  3PUB A;  2XVC A;  4ZH4 F;  3OOP A;  2K9S A;  1ETO A;  3DBR B;  3M07 A;  4XLF A;  1RUO A;  2NRA C;  2BHY A;  4E7L A;  2VJ4 A;  1I1G A;  2QM3 A;  4MIM A;  1ZLJ A;  3BQY A;  4YRV A;  3K4J A;  5HVQ C;  3RCO A;  2DU9 A;  2IGM A;  2M4G A;  1BI3 A;  4ZYE A;  2XDV A;  3IAS 2;  2QZ8 A;  3OWT A;  4M73 A;  2UWM A;  2R7D A;  2QQA A;  3SZG A;  4AYB A;  2R7X A;  2DA2 A;  3I64 A;  2LKX A;  3G3Z A;  4BAC A;  4DBR A;  2FEZ A;  1M1E B;  3KYD B;  2LSO A;  5HS7 A;  3FBN B;  2IS1 A;  4IHS A;  3HOZ J;  2O9L A;  1N25 A;  5EEH A;  1Y0U A;  1TQP A;  3FX3 A;  1FMW A;  2YSR A;  2RAE A;  1O3T A;  2IS6 A;  1P4A A;  2HNH A;  2EZK A;  2ZXI A;  3BT9 A;  3C1D A;  3D0S A;  3OIO A;  4Z6Y A;  2HPM A;  1REP C;  1ACI A;  3A02 A;  2Q2E A;  3LA3 A;  1X4O A;  1YIT I;  5F1J A;  3IHU A;  4KN4 X;  3WTW C;  1IV8 A;  3DF8 A;  1XS9 A;  2L7Z A;  4MQ9 F;  4IRI A;  4HST A;  2GA1 A;  1K78 B;  2JJ7 A;  1C0W A;  2EWN A;  4EAT A;  1XMX A;  4LK1 F;  2EV6 A;  1FMV A;  3FIS A;  5FKO A;  4I98 B;  1MJB A;  1X1C A;  3SEZ A;  3K1M A;  3N05 A;  1G4D A;  1XC5 A;  1Z77 A;  1R4N B;  4KUM A;  2LRD A;  2O3F A;  5HDG A;  3PO3 J;  3ERE D;  4V2F A;  1A5J A;  2KPM A;  2L7F P;  5EG0 B;  1E17 A;  2CQQ A;  4GO1 A;  3WGH A;  5GP9 A;  1H9G A;  1VQ7 I;  1VQ9 I;  2BV6 A;  1SFE A;  2FF4 A;  3WTY C;  4KYW A;  5F08 A;  2A07 F;  5CPR B;  3AL0 B;  1Z6T A;  2UUZ A;  5CLS A;  4BE0 A;  1XMK A;  2CSO A;  4GYG A;  1FIP A;  5E8G A;  2RNJ A;  2G0E A;  4G9Y A;  2HWV A;  1CF7 A;  1SVO A;  1X1P A;  3CO6 C;  4PJL A;  1VQ5 I;  1EF4 A;  1WPK A;  1JTX A;  4U7D A;  3S1R J;  3EQL F;  3OS1 A;  1Z7L A;  3F23 A;  3DQV C;  4BL0 B;  3LSJ A;  2HVS A;  1NH3 A;  3M1C A;  1ERD A;  3RIR A;  2BE5 F;  3V8L A;  2IW5 A;  4FTH A;  1U5T A;  3BG3 A;  4BQA A;  3ASN H;  3HGG A;  1SD6 A;  4XNF A;  1SD7 A;  2WAD A;  1G3W A;  1A04 A;  5FKK A;  4XK4 A;  2NS7 A;  4M6Y A;  4W1U A;  5E1X A;  5DTD A;  2OC6 A;  5FRO A;  2B9S A;  2V1N A;  2BY3 A;  2OCE A;  2Q0O A;  4XOT A;  4LLL A;  1SAU A;  2HVQ A;  2W84 A;  3I59 A;  3KLN A;  3VFZ A;  5L3E A;  3WGI A;  1O3S A;  4YFK F;  1WJA A;  5HLH A;  2FQ4 A;  1IRZ A;  9ANT A;  4Y15 A;  3DEU A;  3VYR B;  1HA8 A;  2N8G A;  4A12 A;  4P9U A;  1FNN A;  5LHI A;  2V1X A;  2Z5U A;  1D1A A;  3MKW B;  1MBF A;  1VQ6 I;  2NNY A;  1QPM A;  2V9K A;  4BJT A;  1TQM A;  2D1H A;  3O8H A;  1FBU A;  3FDY A;  1W7P B;  2X48 A;  2YU3 A;  1BI1 A;  3ECH A;  4M74 A;  3HXL A;  5IP6 A;  1TWH J;  3BPV A;  3NWT A;  2WAQ N;  2LD5 A;  3OYD A;  3A0B C;  2NOG A;  1S3J A;  3EUH A;  1I27 A;  1IXS B;  1I6H J;  3E5U A;  1MJA A;  2XAQ A;  4JX6 A;  3TOA A;  4WCG A;  2L9S A;  4G8X A;  2JRM A;  3KP7 A;  2E36 A;  2DMU A;  3QYE A;  3E0J B;  1R1V A;  1UJ8 A;  2R5Y B;  1H88 C;  1FLI A;  3CJT B;  4RMN A;  3QOD A;  1ZK8 A;  1MDM A;  3MKL A;  4I0A A;  5E3O A;  3C2B A;  5E3N A;  4PJM A;  3QQA A;  2O7O A;  1D5Y A;  2ZME B;  1BI2 A;  4F52 A;  3JRC A;  2NXN B;  2LF7 A;  4AD9 A;  2LRE A;  1RUN A;  2ZME C;  2IA0 A;  3S1M J;  4UUS A;  4N9H A;  4DZP A;  3H92 A;  1XDS A;  5H6R A;  2DA6 A;  3I54 A;  3E5X A;  3L2U A;  5M5X J;  3AFH A;  4XRM A;  1VFC A;  1FC3 A;  1T08 B;  1OPC A;  2HKX A;  2VPR A;  1R5I D;  4O3M A;  1MMA A;  1VND A;  2DAO A;  3SYT A;  3BTC A;  1KA8 A;  2RC4 A;  2WB1 N;  1JE8 A;  3HSE A;  3SEQ A;  1KQ9 A;  3ABL H;  1D0Y A;  4NQW B;  3HPG A;  2H6B A;  3V8K A;  3BJ6 A;  1WWX A;  2COM A;  4L9V A;  1T95 A;  5LLQ A;  1ZEL A;  3CMA I;  3TOB A;  1FTZ A;  1VQM I;  3V4G A;  2RQQ A;  2XV4 S;  3GZ5 A;  2A3S A;  2R7V A;  2X9D A;  2GM4 A;  2QSG X;  4ENK A;  1YW8 A;  2CV2 A;  2MBF A;  1XGO A;  2EIN H;  1QNT A;  2QSH X;  4G7Z F;  4XLP F;  3KYC B;  2FNA A;  4YFX F;  3T8T A;  2FOK A;  1WI9 A;  1MMD A;  3K10 A;  1HQC A;  2EFQ A;  4UUT A;  4D7N A;  2FXA A;  2PFB A;  2MGQ A;  4JK1 X;  5E1W A;  2XAJ A;  4G94 A;  4CGZ A;  1G6N A;  3OY9 A;  1W4M A;  3BDD A;  2Y69 H;  4LIV A;  2P8T A;  3RKY A;  3OL3 A;  2GQQ A;  4UV9 A;  2DN0 A;  4A3J J;  2JN6 A;  3PFY A;  3RTR A;  3KE2 A;  4C9Y A;  4RM2 A;  4M6X A;  4DYQ A;  2JSP A;  2CFX A;  3R6S A;  1AOY A;  3IUO A;  1W36 D;  5J1Y A;  1BOA A;  1GXP A;  2PMZ N;  3BZ6 A;  4ESJ A;  2X4H A;  3MAJ A;  3C7J A;  4XLH A;  2F6C A;  4IHW A;  4GFB A;  3CP8 A;  3E1S A;  4F91 B;  2M0C A;  4N4N B;  4YEL A;  1TWG J;  2GOX B;  3VB2 A;  3CCR I;  1UB9 A;  2V1U A;  4KA4 A;  1PVE A;  1W5S A;  2RGV A;  5CVJ A;  3LA7 A;  4A3F J;  4HAM A;  2GLO A;  1MBH A;  3WHC A;  4C30 A;  3PSF A;  4ANJ A;  1T39 A;  1JKO C;  5F64 A;  1FEX A;  4WXD A;  2PX9 A;  1L0O C;  1MMS A;  3OSF A;  1NK2 P;  1GVJ A;  2FBK A;  2OF7 A;  1IG7 A;  1YFH A;  1POG A;  1J0R A;  2R7R A;  4HLX A;  3T0Y A;  1JKR C;  1UHW A;  4DYC A;  2W24 A;  3TGN A;  2PI0 A;  3RKQ A;  3GCM A;  3KZY A;  1YO5 C;  4LJZ F;  1YLF A;  4MO7 A;  1HOM A;  1MH3 A;  5FD5 A;  4C2T A;  1PYV A;  2OU2 A;  3TP0 A;  3QU6 A;  1X3U A;  4AU7 A;  4LD5 A;  1HKQ A;  3F6V A;  5FFX A;  3AG1 H;  2JZY A;  3FWE A;  3WG7 H;  1BW6 A;  1JGS A;  3JRH A;  3E5Q A;  4XQF A;  4HX8 A;  1IN6 A;  5TIS C;  2LBF A;  3OYG A;  1AWC A;  2E7X A;  2K5C A;  2DK5 A;  4IXA A;  1VTN C;  2K9Q A;  1YHQ I;  4AC0 A;  1BL0 A;  3O2P E;  3JSO A;  3JAM Z;  2Z2S B;  1X1A A;  2OBP A;  4PGG A;  4LB6 B;  1ON1 A;  3K1N A;  1EJ9 A;  4KT5 C;  2K3P A;  2HDD A;  1BW5 A;  4EMS A;  2E34 A;  2V79 A;  1U2W A;  1GT0 C;  1KYW A;  5M3M J;  2RRE A;  2HU9 A;  3H36 A;  4EGZ A;  3L00 A;  3CLO A;  1H9T A;  1WJ5 A;  4ASN A;  4UV8 A;  2H94 A;  4DYR A;  3CCJ I;  2DLL A;  4F3Q A;  2JK3 A;  2HDC A;  3DTI A;  1RIO H;  2CUZ A;  2WY7 Q;  1IF1 A;  5FKN A;  4L9N A;  1AKH A;  2D1V A;  2IPQ X;  3OYN A;  3V7S A;  2E5N A;  3GTO J;  4II3 A;  3CO7 C;  5HDN A;  2E2I J;  1IN4 A;  1WH5 A;  1F43 A;  1YE9 A;  3ZQF A;  4D0P A;  2R4G A;  3BR5 A;  4BE1 A;  1BR4 A;  2HPI A;  4ZDO A;  3DPU A;  1B59 A;  2M34 A;  4LGW A;  1S7E A;  2P6T A;  3QRF F;  5BMZ A;  3CCE I;  1VQP I;  2DMQ A;  1MIJ A;  1BM9 A;  1OYY A;  2P81 A;  1DGR M;  2UV1 A;  1LE8 B;  2XB5 A;  2NNN A;  1TT5 B;  4LIT A;  3L2Q A;  5IY5 H;  3TDZ C;  1SFO J;  2YU9 J;  2CW0 F;  4I02 A;  1ZRE A;  4HV6 A;  1S5L C;  1TW3 A;  2DTR A;  2E1M B;  2ZNZ A;  5J8C A;  3DPL C;  1KZH A;  3ZMT A;  4A3D J;  1D0X A;  1I3Q J;  1IZ1 A;  4P96 A;  1FYK A;  1B4A A;  3V8J A;  2JA2 A;  2R92 J;  2QGU A;  1G3Y A;  3H1C A;  3H0D A;  2EZL A;  2HXI A;  5EDN A;  2JUC A;  4YIR X;  3OYB A;  3CCQ I;  3ZPL A;  1FOX A;  4U0V A;  5F6F A;  2DFH A;  4J19 A;  2K27 A;  3FXR A;  3K9T A;  2GXG A;  4Y52 J;  1IRF A;  4XM3 A;  2QYO A;  2VAS A;  1MBE A;  2EK5 A;  3DV8 A;  3GTQ J;  3REO A;  4BY1 J;  1LNW A;  1HC8 A;  3BLY A;  1EA3 A;  3DKY A;  4CZZ A;  3FXU A;  2MD0 A;  4RAG A;  2VBW A;  5J4Y A;  1YQA A;  3AKZ A;  4KMU X;  1R9T J;  1ZGJ A;  2K9N A;  4BEH B;  1MZB A;  3ZQH A;  1UG0 A;  4ZJZ A;  2DYR H;  2DT7 B;  3TP3 A;  5AON A;  4ZZL A;  2Y0M A;  2Z9O A;  1UFM A;  2QQ9 A;  3ZP5 A;  3WE2 A;  1KYZ A;  1S7A A;  3BOQ A;  4IQ4 A;  5D8L B;  1UHM A;  1P2F A;  3T8R A;  4XMY A;  3HSR A;  3S3N A;  1TLH B;  2HTJ A;  1I50 J;  1O7F A;  1AU7 A;  5D4R A;  2GWR A;  2DDA A;  1XGN A;  1DU0 A;  3B6C A;  4MLO A;  5K7H A;  3BR0 A;  5DCM A;  3BPX A;  3LWF A;  3HOU J;  5F0F A;  4CDG A;  1T98 A;  2PJR A;  2W82 A;  3J81 Z;  2XB0 X;  3PSI A;  2DA1 A;  3LAP A;  2IS2 A;  1LVA A;  2M87 A;  3VDX A;  1FT9 A;  4D5F A;  3E6M A;  2A68 F;  4EJT A;  1AA7 A;  5C4J J;  3RQ4 A;  3LSH A;  4A3I J;  4IVN A;  5CJ9 A;  3QPT A;  3HDD A;  3JRB A;  2B7E A;  3E7L A;  4RAF A;  2BVL A;  2STW A;  2P5K A;  2XAS A;  2LDU A;  1V55 H;  1BA5 A;  4R1H A;  2R7S A;  3TKY A;  2FU4 A;  2L9N A;  2CQ7 A;  3HG9 A;  3CCY A;  3BTJ A;  1A6Q A;  3M8J A;  4L0Z B;  2NVQ J;  3LAJ A;  3LNQ A;  1Z9C A;  2VKV A;  3K2Z A;  2LY9 A;  5D5X B;  3GFI A;  3CCS I;  2CW7 A;  2V4J C;  1ZRD A;  1N78 A;  1VQ4 I;  1YJW I;  1FYM A;  2DBB A;  3OL4 A;  5LGT A;  3TMO A;  4IKF A;  2JT1 A;  2ZCW A;  1HBX G;  1LQ1 A;  4KJZ A;  1IRG A;  3GTK J;  2G9W A;  1W36 C;  3F9K A;  4BU2 A;  2JVH A;  5GAG J;  1EH7 A;  2E5Z A;  2QKL B;  2V7F A;  1B1B A;  4HRI A;  2HOE A;  1ZGW A;  3PO2 J;  5HOD A;  2L0K A;  2OAZ A;  2VC1 A;  2HZT A;  2EFN A;  1UST A;  1Z67 A;  2PMH A;  2R7O A;  5EJC A;  1D5V A;  3WU1 B;  2QEX I;  3GTL J;  3GFL A;  2LK2 A;  5D5W B;  2BOL A;  2L3D A;  3HBL A;  1WJD A;  2HFH A;  4PJJ A;  2O0Y A;  4Q4Z F;  3HPH A;  2Y48 A;  4P5O A;  1XGM A;  2FX0 A;  2F4I A;  2M4K A;  1B9M A;  4E7K A;  2IGK A;  3R4K A;  2M9H A;  2DT5 A;  1OYW A;  4CZC A;  2R93 J;  2XSJ C;  2X1E A;  3K0L A;  3COA C;  4HZF A;  3EUA A;  3HKZ A;  3N97 A;  2DJI A;  5EGO A;  2KIQ A;  1TWC J;  3M4O J;  4OIO F;  2NAZ A;  4UVA A;  4OIP F;  2AHQ A;  4BHC A;  1XTA A;  1B9N A;  2OTJ I;  2YS9 A;  3FBI B;  5M5Y J;  2WV0 A;  2VLA A;  2E1C A;  3FF5 A;  2OTL I;  4RLF A;  3MZH A;  2CUF A;  1RET A;  2IRF G;  3DP7 A;  3CUO A;  4EM0 B;  4M3E A;  3GX4 X;  3JSP A;  4X6A J;  3RYP A;  1P6R A;  3P9I A;  2R7U A;  2LY2 A;  2DA4 A;  4XLE A;  1Y1V J;  3J7A Y;  1OR7 A;  3P9C A;  2Y2Z A;  1YX3 A;  4E6K G;  3PIP F;  3IV5 A;  1U5T C;  4JX4 A;  4Q5S F;  1ZKG A;  2O03 A;  2OCC H;  2XRO A;  4B3A A;  2EIJ H;  4XL9 A;  1IN8 A;  3FKI J;  3DKW A;  3I59 B;  4XID A;  2JA6 J;  2HYJ A;  1Y1W J;  3ZMU A;  5ICC A;  4AUX A;  3FHZ A;  5K1Y A;  2W25 A;  2H1L A;  2H09 A;  5HLI A;  4EJW A;  4XLN F;  2IT0 A;  2IXS A;  4ABZ A;  2VKH A;  1V5F A;  1MJ9 A;  4AYB N;  2VUM J;  3HOW J;  1IXR C;  1Z6R A;  3Q3S A;  1SMY F;  1Y8R B;  5FFZ A;  2XF7 A;  3PNY A;  5E17 F;  3EPZ A;  1LEB A;  2G7U A;  2DDB A;  3I71 A;  3HUG A;  1ETY A;  1HW1 A;  3MFK A;  2LMD A;  1B6A A;  3G6E I;  3VSL A;  1FP1 D;  1X1D A;  5CQG A;  3CJR B;  4DNC A;  2KRC A;  2W85 A;  4MTD A;  2X6Y A;  1WJB A;  3EUH C;  2PBI A;  3VSK A;  2VXD A;  2GXB A;  3LFK A;  2K9L A;  2AQF A;  2M0M A;  3PQK A;  4RAZ A;  5JFR A;  3GZ6 A;  1MDM B;  4ZYA A;  1A35 A;  2CQN A;  4IQJ A;  1KQ0 A;  2ZSI B;  4GYI A;  2RQP A;  4RB3 C;  2DOE A;  4KMF A;  2F2E A;  3JCU C;  2MH9 A;  3LMM A;  4F7Z A;  1VQN I;  2JTV A;  4PUS A;  4E7H A;  4UUS B;  4ZDP A;  5ERI A;  3P5J A;  2L7K A;  4OAY A;  2LY1 A;  3WTS C;  3QPS A;  3ZMS A;  1YJN I;  5ILS A;  1ZN2 A;  2A5W A;  1PUF A;  3VYT B;  2DTZ A;  4DQ2 A;  4MTE A;  1VQ8 I;  5B1B H;  1R1T A;  4KIF A;  1TW2 A;  3KP3 A;  1IXC A;  4EV0 A;  3VEP A;  4B3X A;  2XIG A;  3EYY A;  3L9F A;  1E3O C;  4IL6 C;  3Q9V A;  2LVS A;  3F72 A;  2CH0 A;  3IWZ A;  2HOS A;  1STZ A;  2BBY A;  4LFU A;  2KIM A;  3E6D A;  4UVB A;  1ETV A;  2CG4 A;  4A3K J;  4HF1 A;  1QBJ A;  1G8X A;  1N77 A;  4AM3 A;  1U6G A;  3CCL I;  2V26 A;  2HDW A;  3GO5 A;  3FMS A;  3K70 D;  4PK4 A;  2ID6 A;  2QCO A;  1T33 A;  3BR3 A;  4LB5 A;  5K7F A;  1ONV A;  3E97 A;  3HEF A;  3S3M A;  3GW2 A;  5F0H A;  1ULY A;  3R0A A;  2BEO A;  2BW3 A;  3SXY A;  2D5V A;  1MMN A;  2A69 F;  2XRL A;  4MFD A;  5HS8 A;  2V6C A;  1BR2 A;  1GLN A;  3GTM J;  1NTC A;  1YW7 A;  5FGM A;  1B8I B;  1Y6I A;  2GBY A;  2XAG A;  2QBY A;  4M71 A;  1S6L A;  3P9K A;  1V5G A;  3A2K A;  5EYR A;  1A6I A;  1L3L A;  4HW0 A;  4RM3 A;  2PEX A;  3O8G A;  1MBJ A;  4N4O B;  3FXQ A;  2R0Q C;  3U1D A;  3I3L A;  4LIU A;  1ENH A;  2ECC A;  2M45 A;  2EFP A;  1YI2 I;  3GTP J;  2X0L A;  1RR7 A;  5TGT A;  4BKX A;  3OIP A;  3TED A;  1X3Z B;  2YX4 A;  4AVP A;  4X1E A;  1GXQ A;  2FBI A;  2M2E A;  4FE4 A;  2LF8 A;  5EF6 A;  5ED4 A;  2DQL A;  2QEN A;  4RGX A;  4RGS A;  1XPX A;  1WFX A;  4B44 A;  1ZAR A;  5K5O A;  1W0T A;  2R7Q A;  1SAN A;  2CO5 A;  4C2M J;  1ODD A;  2HOT A;  1Y8Q B;  3HTS B;  4QWQ A;  5GAE J;  1OCR H;  4A69 C;  5EZG A;  4HNV A;  4KN7 X;  4I01 A;  1KGS A;  3K4K A;  4IEJ A;  5CVV A;  2CFO A;  3EUK L;  4HSR A;  5A2Q Z;  2WY8 Q;  5CKT A;  3TL4 X;  3F8N A;  3G1M A;  2PG4 A;  3KZZ A;  3B6A A;  1BIA A;  2L7M P;  2M3A A;  3ABU A;  3DLL F;  3FM5 A;  3H9Q A;  1GDT A;  2H6C A;  1HW2 A;  4HA8 A;  1TT0 A;  2OZ6 A;  3V7R A;  3FK7 A;  3HTU A;  2COB A;  1R6R A;  3ESW B;  1IUY A;  3HOT A;  1ZYR F;  1SC7 A;  5BS6 A;  3F21 A;  1HDD C;  3M8F A;  4LLN A;  2XRN A;  4HQE A;  4G7H F;  3BTI A;  1X4P A;  1ETK A;  1XMA A;  3HOV J;  4FHT A;  2IJL A;  3M8E A;  5GAH J;  3B73 A;  3CP2 A;  4S0H B;  4B1R A;  2M1B A;  3HJE A;  3HHH A;  2HQ5 A;  2X6X A;  1BR1 A;  3CME I;  5LHH A;  2K3F A;  2LBF B;  4XN0 A;  2CUJ A;  2VXZ A;  2BYV E;  1F1Z A;  4CA0 A;  2AQE A;  5L3G A;  2YUS A;  1JHH A;  1Z3Y A;  2R7F A;  3R60 A;  3JRD A;  3ECO A;  2F48 A;  1A31 A;  2CS3 A;  1LDJ A;  2M7A A;  2OQG A;  4X0G A;  1XCB A;  1R7J A;  3KET A;  3A01 A;  2O5R A;  4R79 A;  1F9N A;  3TO6 A;  4ZYD A;  4QPO A;  4KDP A;  3W6J B;  4DIQ A;  2IVM A;  2KFD A;  3GLX A;  4A5N A;  1SFU A;  2W4S A;  1MGT A;  3S3O A;  3BG7 A;  3UNG C;  3I4N J;  2XGX A;  2LLK A;  2M8E A;  2WAE A;  3IAM 2;  4A5M A;  1JKQ C;  1I5Z A;  1AKH B;  3JR9 A;  3ELK A;  3PQJ A;  1RZ4 A;  3K4L A;  5GTH C;  5DD8 A;  4CCM A; 
#chains in the Genus database with same CATH homology
 3S1N J;  3BR5 A;  3A03 A;  5JLW A;  4C3I J;  2M34 A;  5J3L A;  4RBO A;  1S7E A;  5F27 A;  3QPL A;  2LR8 A;  3LSP A;  2DMQ A;  4QIW N;  4CYC A;  1B72 A;  1K83 J;  3Q0W A;  3L1P A;  2P81 A;  1LE8 A;  1U78 A;  2H8R A;  3MVP A;  2EH3 A;  4CYC B;  2XGC A;  3OSG A;  1IDZ A;  1B72 B;  2LP0 A;  2XB5 A;  3JRG A;  1FIA A;  2K40 A;  1LE8 B;  1WCM J;  1ZTR A;  1VI0 A;  3BR2 A;  4A3E J;  2XSD C;  1SFO J;  2YU9 J;  4I76 A;  4NDL A;  3RZD J;  1W0U A;  3S15 J;  1ETQ A;  5IYD J;  1CQT A;  2I10 A;  4A3D J;  1QPI A;  3FK6 A;  2CJJ A;  1I3Q J;  4M3D A;  3I4M J;  1O4X A;  4FCY A;  3ZQC A;  3K7A J;  3ZOB A;  2R92 J;  3M3Y J;  3H0G J;  2EZL A;  3GTJ J;  1HDP A;  2HXI A;  5EDN A;  2EQR A;  2JA5 J;  1X2M A;  3HM5 A;  4IHV A;  5F04 A;  1IUF A;  1TWA J;  3CDL A;  5GPA A;  4J19 A;  2HOA A;  3NAR A;  4Y52 J;  1JJ6 C;  3H3V K;  1MBE A;  3NAU A;  1F36 A;  3GTQ J;  2E19 A;  1OFC X;  2NS8 A;  2DMP A;  4BY1 J;  3Q0U A;  3BG5 A;  4XIC A;  3IH2 A;  1OCP A;  2JMW A;  4LOC A;  2XPU A;  4V2G A;  1JTY A;  1GV5 A;  1H89 C;  1R9T J;  2K9N A;  3DCF A;  3ZQH A;  2CQX A;  1IV6 A;  2VI6 A;  3TP3 A;  1HCR A;  4QSH A;  1ETW A;  4MFE A;  5JLX A;  4IHX A;  4M3G A;  4G12 A;  3WHB A;  3K2A A;  2ZB9 A;  3HOY J;  5M3F J;  3S17 J;  1I50 J;  4W97 A;  1RKT A;  2TCT A;  4JP0 A;  1AU7 A;  3S1Q J;  4M3F A;  1DU0 A;  3B6C A;  2HI3 A;  4MLO A;  3BR0 A;  5K7H A;  4A93 J;  3JRF A;  4A3B J;  2FJ1 A;  2DMT A;  3HOU J;  3BQZ A;  5F0F A;  5FLV A;  2K9S A;  1ETO A;  2XB0 X;  1JJ8 C;  2Y9Y A;  1MBK A;  2DA1 A;  3F0C A;  4MIM A;  4BBR J;  3BQY A;  2NVX J;  1UG2 A;  4D5F A;  1G2H A;  1P7J A;  5C4J J;  2WV1 A;  5C44 J;  4A3I J;  3MN2 A;  1OCT C;  2DA2 A;  3HDD A;  3JRB A;  2LKX A;  3E7L A;  1ZQ3 P;  4IHY A;  5E3M A;  2ECB A;  4JX5 A;  1MNM C;  1BA5 A;  3HOZ J;  2ELK A;  2O9L A;  1WI3 A;  1GV2 A;  4DZJ A;  1ORK A;  1X58 A;  1QVU A;  3CCY A;  2RAE A;  2MSY A;  3BTJ A;  1ETX A;  2EZK A;  2NVQ J;  3LNQ A;  2EZH A;  2IEK A;  2VKV A;  3BT9 A;  1QRY A;  3OIO A;  2JWT A;  2LY9 A;  4XRS A;  2EZI A;  2XPV A;  3IH3 A;  3A02 A;  5IOY A;  5F1J A;  4M3B A;  1XS9 A;  2L7Z A;  1U9O A;  1T56 A;  2LFB A;  2H1K A;  2JJ7 A;  3UKG A;  1MBG A;  3GTK J;  3D1N I;  1QVT A;  3FIS A;  5FKO A;  4L5E A;  1ZGW A;  3GBG A;  1XC5 A;  3PO2 J;  5HOD A;  2L0K A;  3BR1 A;  1FTT A;  1Z77 A;  1HF0 A;  2AO9 A;  5EG0 A;  3PO3 J;  2KT0 A;  4V2F A;  1A5J A;  1NK3 P;  2L7F P;  5EG0 B;  3GTL J;  4A3C J;  2LK2 A;  2CQQ A;  4C3J J;  5IYC J;  3HBL A;  2ME6 A;  5GP9 A;  1IJW C;  2FX0 A;  2LTP A;  4M6V A;  2TRT A;  2M9H A;  1H8A C;  2R93 J;  5F08 A;  1WH7 A;  3ZQI A;  1JKP C;  1P7I A;  3Q0V A;  3IH4 A;  5EGO A;  1JGG A;  1TWC J;  5E3L A;  3M4O J;  2XGE A;  1FIP A;  4A3L J;  1ITY A;  5EGO B;  2AHQ A;  1IC8 A;  2G0E A;  2MG4 A;  1B8I A;  1HLV A;  1JUP A;  2YS9 A;  1ZR2 A;  5M5Y J;  1MSF C;  1WPK A;  1JTX A;  2E2H J;  1EF4 A;  3S1R J;  3S2D J;  3S16 J;  2CUF A;  3LSJ A;  1RET A;  5FJ8 J;  5M5W J;  1AHD P;  2Y0S N;  3TW7 A;  4FTH A;  1UMQ A;  3BG3 A;  4M3E A;  3HGG A;  4X6A J;  1RES A;  5FKK A;  2XGD A;  2DA4 A;  4XRS G;  1Y1V J;  4XK4 A;  5C3E J;  1K61 A;  2NS7 A;  2Y2Z A;  4W1U A;  3JRA A;  3VPR A;  5DTD A;  3IV5 A;  3JRI A;  4JX4 A;  1ZKG A;  5IOZ A;  4B3A A;  3ZQL A;  1UHS A;  3FKI J;  1RPW A;  2FQ4 A;  4XID A;  1IRZ A;  2JA6 J;  2HYJ A;  1Y1W J;  9ANT A;  2N8G A;  4AUX A;  4Y7N J;  3G1L A;  1MBF A;  4ABZ A;  4AYB N;  2VUM J;  2DA3 A;  2B63 J;  3O8H A;  3HOW J;  3Q3S A;  2X48 A;  3JRE A;  3G1O A;  5IP6 A;  1TWH J;  5F0C A;  2WAQ N;  2LD5 A;  3LOC A;  1ETY A;  2W48 A;  2NOG A;  3RQI A;  1I6H J;  5FLM J;  1WGX A;  2NVT J;  4JX6 A;  1VF9 A;  1MSE C;  2R5Y A;  4BBS J;  2DMU A;  2R5Y B;  1H88 C;  2E1O A;  3DEW A;  1ZK8 A;  2CU7 A;  2IAI A;  3MKL A;  3RZO J;  5E3O A;  3C2B A;  5E3N A;  3ZQG A;  3QQA A;  5IPA A;  2O7O A;  1D5Y A;  3JRC A;  4FIS A;  2OPT A;  5J1R A;  3S1M J;  4UUS A;  1RKW A;  4DZP A;  5IP7 J;  4UUS B;  1OJL A;  3CQZ J;  2DA6 A;  3QPS A;  5M5X J;  4XRM A;  1VFC A;  2VPR A;  1TC3 C;  1PUF A;  2NVY J;  2O8K A;  1YRN A;  2DTZ A;  3CMY A;  1VND A;  1PUF B;  3BTC A;  1YRN B;  2VKE A;  2WB1 N;  1TWF J;  3W6V A;  1E3O C;  2LVS A;  3HKZ N;  2ID3 A;  2HOS A;  1IDY A;  3SDG A;  1Q1V A;  1FJL A;  1ETV A;  4A3K J;  2CUE A;  1FTZ A;  3S2H J;  2JA8 J;  1XG1 A;  2X9D A;  2GM4 A;  2ID6 A;  2QCO A;  1JUM A;  5J1U A;  1JUS A;  1T33 A;  2QF7 A;  3BR3 A;  5IP9 J;  4QTR A;  5K7F A;  3HEF A;  2R5Z A;  2XPW A;  5F0H A;  4UUT A;  3SFI A;  4D7N A;  2R5Z B;  4RDU A;  2D5V A;  2FD5 A;  4A3G J;  2XRL A;  4MFD A;  2MGQ A;  3GTM J;  1NTC A;  1B8I B;  2DN0 A;  2GBY A;  1MH4 A;  4A3J J;  2JN6 A;  4BXX J;  5EYR A;  1A6I A;  3O8G A;  1MBJ A;  4DYQ A;  2CRG A;  2R0Q C;  2DJN A;  4I6Z A;  5J1Y A;  1ENH A;  2ECC A;  2MW8 A;  5FKM A;  2PMZ N;  4C3H J;  3GTP J;  1RR7 A;  4BKX A;  3TED A;  1GUU A;  4IHW A;  4GFB A;  5EEA A;  2EBI A;  2M2E A;  4FE4 A;  4X1E A;  5EF6 A;  2M0C A;  4FE7 A;  2HXO A;  5C4X J;  1U9N A;  1TWG J;  1LFB A;  1W0T A;  1SAN A;  1APL C;  4C2M J;  3SJM A;  1JT6 A;  1Z0X A;  4A3F J;  2GLO A;  1MBH A;  2HOT A;  3WHC A;  4A69 C;  5EZG A;  1JKO C;  4HNV A;  1FEX A;  3BTL A;  4IEJ A;  2DA7 A;  3LSG A;  3OSF A;  1NK2 P;  2Y9Z A;  5K7Z A;  3HGY A;  2Y30 A;  2OF7 A;  3G1M A;  1IG7 A;  3HB9 A;  3B6A A;  1POG A;  2L7M P;  1JKR C;  4DYC A;  1ZR4 A;  1JT0 A;  5FKL A;  1GDT A;  3LSR A;  4DW6 A;  1IGN A;  3OOU A;  3RKQ A;  2E2J J;  3FK7 A;  2COB A;  4MO7 A;  1HOM A;  1MH3 A;  2Y31 A;  3S14 J;  1HDD C;  5BNG A;  3TP0 A;  3BTI A;  1X2N A;  1ETK A;  2R7Z J;  2IBD A;  1BW6 A;  3HOV J;  3JRH A;  4JYK A;  3TW6 A;  4S0H B;  4B1R A;  2HQ5 A;  3GTG J;  2K9Q A;  2L9R A;  4AC0 A;  1BL0 A;  1GVD A;  4B4C A;  5DS9 A;  2YUS A;  1LFU P;  4D7M A;  2HDD A;  1BW5 A;  3JRD A;  2DA5 A;  1GT0 C;  3A01 A;  4BY7 J;  5M3M J;  2X6O A;  3A01 B;  4A3M J;  1DU6 A;  5IYB J;  2JA7 J;  4DYR A;  3BG9 A;  2DMN A;  2JK3 A;  2KDZ A;  1U8B A;  5EZH A;  2M8G X;  3PM1 A;  3I4N J;  5FKN A;  1BJZ A;  4EEF G;  3HOX J;  2LLK A;  1AKH A;  1JKQ C;  4D5C A;  3GTO J;  3BR6 A;  1AKH B;  3JR9 A;  2E2I J;  2ME0 A;  1WH5 A;  3FIW A;  1F43 A;  5GPC A;  3ZQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...