2LP0A

The solution structure of homeodomain-protein complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
60
structure length
60
Chain Sequence
TRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/cell cycle
molecule keywords Homeobox protein Hox-C9
publication title Structural basis for homeodomain recognition by the cell-cycle regulator Geminin
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2012-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lp0A00
5FKKA 1GVDA 2LK2A 3K7AJ 4C2MJ 2YUSA 3S16J 1P7IA 1W0TA 1APLC 1LE8B 3NARA 3BR5A 1UMQA 5DS9A 3JRGA 3HOUJ 3G1MA 3LSGA 4JP0A 4MFEA 1B8IB 3PO3J 5E3OA 5C3EJ 2GLOA 4S0HB 2HI3A 1ORKA 2AHQA 1U8BA 1XS9A 2CUEA 2VI6A 4A3BJ 1JTXA 1RPWA 1DU6A 3NAUA 4XRSG 1PUFB 4M3EA 4CYCA 1OCTC 3ZQLA 5E3LA 1JUMA 1ETOA 3RKQA 2DA7A 4QSHA 4I6ZA 3G1LA 4UUSB 4DYRA 3LSPA 3S1MJ 4M3BA 4UUTA 3FIWA 3JRDA 2O9LA 1ZR4A 2ECCA 5J1RA 2Y2ZA 3B6AA 3MN2A 4M3FA 1JKPC 2FQ4A 1HDPA 4D7MA 2MW8A 5GPCA 3HOZJ 4BBSJ 5F0CA 2COBA 4BY7J 2LD5A 3JRIA 1POGA 1GT0C 1TWAJ 2ME6A 2JMWA 3BG5A 3FKIJ 2O8KA 3HOYJ 4GFBA 4G12A 4IHWA 4C3JJ 1YRNB 3C2BA 3IH2A 3TW7A 4D5FA 1E3OC 1XC5A 5EZGA 1Z77A 1ITYA 2K9QA 2LY9A 2XGCA 3ZQHA 4M6VA 4J19A 5C44J 1DU0A 1JT0A 3IH3A 2DMNA 2JK3A 3ZQFA 1NK2P 2DMPA 4MLOA 5F04A 5IYBJ 3GTLJ 4Y52J 2L7ZA 1NTCA 2ELKA 4A69C 1JT6A 1IUFA 5F0FA 3A01B 1FEXA 3I4NJ 1VNDA 2LR8A 1FIPA 1GV2A 2TCTA 4D5CA 4V2FA 3H3VK 5M3FJ 5EF6A 1O4XA 3QPSA 4B4CA 2DA4A 1I6HJ 3JRFA 3GTJJ 2X48A 1BJZA 1T56A 1AKHA 4A3CJ 3BQYA 3JREA 4NDLA 3OSGA 2HYJA 1UHSA 2IEKA 3SJMA 2M8GX 1OFCX 1IC8A 3TP0A 5F0HA 1X58A 2JN6A 2P81A 1ETYA 2FD5A 5E3MA 3A03A 2XSDC 5F08A 4DZJA 2K9SA 3OOUA 4FTHA 3HGYA 2DA3A 3HGGA 3BT9A 3PM1A 1QVTA 5EEAA 3GTQJ 1X2MA 3BG3A 5EYRA 3LOCA 4B3AA 1HCRA 1S7EA 2M9HA 1Q1VA 4DZPA 4BY1J 1EF4A 4C3IJ 1HDDC 5M5WJ 3S17J 1WH5A 2DMTA 1K83J 1F36A 1MBJA 1R9TJ 1MBHA 2EZIA 4XK4A 2HDDA 2XPUA 2JJ7A 2DA5A 2CUFA 9ANTA 3FK7A 5M5YJ 2E1OA 1U9NA 2R5YB 1GUUA 4B1RA 1JKRC 5EZHA 2JA6J 2VPRA 3HBLA 3JR9A 3HKZN 4IEJA 2DTZA 3G1OA 2KT0A 5EGOB 3GTKJ 4XICA 4A93J 3FISA 3ZQCA 3HEFA 2EZKA 4A3IJ 4D7NA 1U78A 3WHCA 1GDTA 1K61A 1ZKGA 1AKHB 1T33A 3QQAA 3BTLA 2MG4A 5J3LA 1MSFC 1JKOC 5J1YA 3S1QJ 2LVSA 2XRLA 2LFBA 5FLMJ 1JTYA 3I4MJ 3GTPJ 5M3MJ 3BR0A 2RAEA 1ZK8A 4W1UA 2R0QC 3O8GA 5IOZA 3HDDA 1H88C 4M3GA 3LNQA 2NS8A 1FIAA 2XPWA 2QF7A 3MVPA 2CRGA 2H1KA 4V2GA 4A3EJ 1MH4A 5GP9A 3ZOBA 2X9DA 2M0CA 2HXOA 1I50J 1G2HA 1TWHJ 2EBIA 3JRHA 1IG7A 3BR2A 1VI0A 3W6VA 3RZOJ 5GPAA 3JRAA 4RDUA 2MSYA 3IH4A 3VPRA 5IPAA 3B6CA 2NVXJ 5FKNA 1WGXA 2K40A 1MBEA 2EZHA 5M5XJ 1IDZA 1QVUA 3RQIA 2EZLA 4JX5A 2R93J 2EH3A 2WB1N 2Y9YA 3RZDJ 5C4XJ 4DYCA 1WI3A 2L0KA 5IP7J 1TWGJ 1AU7A 1HLVA 3GTOJ 5EG0A 3MKLA 1BA5A 4CYCB 2KDZA 2E19A 5F27A 3BTJA 2TRTA 3S2DJ 5IP6A 5E3NA 3BR6A 2LKXA 1B8IA 2OF7A 4FE7A 2XGDA 4JX4A 1TC3C 4X6AJ 3Q0VA 1ZGWA 3S1RJ 1FTTA 1PUFA 2Y31A 2GBYA 4A3JJ 2XPVA 3L1PA 1B72A 4BXXJ 5FKLA 3BTCA 1JKQC 2XGEA 3ZQIA 2VUMJ 1ZR2A 3SDGA 2HXIA 1JJ8C 1A5JA 1MH3A 4UUSA 2DA2A 2DN0A 1JUPA 2MGQA 1ETKA 4A3GJ 4DYQA 1D5YA 1IRZA 3JRCA 2ECBA 2YS9A 2B63J 3E7LA 5F1JA 2QCOA 3CCYA 4FISA 4A3DJ 3UKGA 1W0UA 1JGGA 1IDYA 4L5EA 4EEFG 5IYCJ 4A3LJ 1RKTA 3M3YJ 3A02A 2K9NA 2NVQJ 1RR7A 3ZQGA 3TW6A 1JUSA 1HOMA 2Y0SN 2H8RA 3OIOA 2JA7J 3S1NJ 5DTDA 1MBGA 1WPKA 4MFDA 4QIWN 3S15J 1ETWA 5K7FA 2R7ZJ 2IAIA 5BNGA 1ENHA 3BR1A 3DEWA 1RKWA 1IGNA 3K2AA 1FTZA 1OJLA 2JA5J 2JA8J 3Q3SA 3HOWJ 5EG0B 2Y9ZA 3CDLA 1Y1WJ 1LFBA 2R5ZA 1F43A 2NS7A 3F0CA 2HOSA 3A01A 2CQXA 1LFUP 3FK6A 1X2NA 2EQRA 2Y30A 3GTMJ 1IV6A 1I3QJ 3Q0WA 3D1NI 5FKMA 2IBDA 5FKOA 3IV5A 4I76A 3O8HA 1HF0A 2G0EA 1ETXA 4X1EA 1OCPA 3CQZJ 5JLXA 2D5VA 1U9OA 2DA6A 4C3HJ 5K7ZA 1MBFA 1B72B 3PO2J 4FE4A 4XIDA 4ABZA 2ID6A 3LSJA 2WV1A 4A3FJ 1ZQ3P 1QPIA 4W97A 1VF9A 5IYDJ 4XRSA 1SANA 3TP3A 2NVYJ 5JLWA 3QPLA 2GM4A 2HOAA 4M3DA 1JJ6C 2LP0A 4A3KJ 2HQ5A 1BW5A 4AUXA 4AYBN 3HB9A 5IOYA 4MO7A 4LOCA 4QTRA 5K7HA 1BW6A 2AO9A 4IHXA 2FX0A 1ETVA 3HM5A 4RBOA 1RESA 1H89C 5C4JJ 3HOVJ 1TWCJ 1XG1A 2HOTA 1ZTRA 2ME0A 1P7JA 1AHDP 2VKVA 3DCFA 3CMYA 3BTIA 4BKXA 2E2IJ 1H8AC 4Y7NJ 2YU9J 1UG2A 2I10A 2X6OA 1LE8A 4MIMA 5FLVA 2E2HJ 2CJJA 2DMUA 2XB5A 2OPTA 1NK3P 3BR3A 3JRBA 2R5ZB 1Y1VJ 4IHYA 1RETA 5FJ8J 3GTGJ 3BQZA 2R92J 4JX6A 2L7FP 4DW6A 2R5YA 2NOGA 2L9RA 3Q0UA 4BBRJ 2VKEA 1SFOJ 4FCYA 3S14J 1A6IA 4AC0A 2XB0X 3LSRA 1MBKA 2O7OA 3H0GJ 3OSFA 2DJNA 1CQTA 2CU7A 5IP9J 1IJWC 3M4OJ 5EDNA 4JYKA 1VFCA 5EGOA 1MNMC 2LTPA 3SFIA 2JWTA 1Z0XA 3S2HJ 2M34A 1WH7A 1MSEC 4IHVA 2DA1A 3WHBA 2WAQN 2W48A 2ZB9A 1QRYA 2DMQA 3GBGA 1GV5A 2FJ1A 1WCMJ 2CQQA 1FJLA 2PMZN 2M2EA 1ETQA 4HNVA 1BL0A 4XRMA 2E2JJ 5J1UA 3BG9A 2ID3A 2N8GA 4A3MJ 3TEDA 2LLKA 3HOXJ 2L7MP 1YRNA 1TWFJ 2NVTJ 5HODA
chains in the Genus database with same CATH superfamily
2FBHA 4M9ZA 4PK4A 1WZ2A 2P8TA 4HV5A 2QYOA 4HF2A 3KFWX 3L2WA 3KP3A 1LJ9A 2IVMA 2MFZA 3OY9A 1F4KA 1G3SA 3S16J 1P7IA 5LRRA 1Z91A 3B02A 2F5DA 3BR5A 1EJ9A 2R7QA 2EA4A 5DS9A 3JRGA 1QU3A 2PN6A 2W00A 3CTAA 1B8IB 3PO3J 4G8XA 1UCRA 2W1OA 3GVAA 2GLOA 3K10A 4II2A 2HI3A 2AHQA 1U8BA 4M6YA 2W82A 1VTNC 2CUEA 3RKXA 2ZFUA 2IS4A 1P4XA 1DU6A 4A5MA 4M3EA 1S29A 2F48A 3HHHA 2QQ8A 2VQCA 1ETOA 2IA0A 4BQOA 1IRFA 1F1ZA 3RKQA 5JHFA 2WAEA 3KEYA 3LSPA 1R58A 4M3BA 3ESWB 2RQPA 1LVAA 3EETA 2PJRA 5HDNA 3FIWA 2O9LA 4RA2A 2M0MA 2EIJH 4Q47A 4RB3C 1C0WA 3S93A 4Y15A 1XGSA 2Y2ZA 1FMVA 2Q0OA 3MN2A 1WQ2A 2UV1A 1VQ9I 4OIQF 3ASNH 3CP8A 1F9NA 3OYHA 3ECOA 3M8FA 5DCMB 4D7MA 2MW8A 3CESA 5GPCA 4RM3A 2ZXJA 3DEEA 1D0XA 2CFOA 2LD5A 3VFZA 3JRIA 1S6LA 1X4PA 3L9FA 1T6SA 3BG5A 2ADUA 2IP2A 2HWVA 3F21A 3TO9A 1RIOH 2STWA 3CUQB 4GFBA 4G12A 4BU2A 4C3JJ 1YRNB 2K9MA 3C2BA 2PI0A 2B7EA 3HRMA 1XC5A 5ILSA 5EZGA 3TOBA 1Z3YA 2EK5A 2DI3A 2OC6A 2LY9A 4M6VA 5C44J 3IAS2 2DMPA 2K86A 4OIRF 4Y52J 1NTCA 1W4MA 2QKLB 2H8WA 5F0FA 1VNDA 2LG4A 5HS7A 3BLYA 3BOQA 4D5CA 2QWWA 1OCOH 5EEHA 4CYDA 3OYFA 2F4MB 2L9NA 2GXBA 4B4CA 1MNDA 2VKDA 2CMPA 3LSHA 4M74A 4UB8C 4LB6B 2DA4A 3FDYA 2KJCA 3JRFA 2VBXA 5CQEA 1KYWA 3IKTA 4HEA2 4G94A 5LEKA 4QLCU 2X48A 1NG7A 1T56A 2VT2A 2XF5A 3N05A 1FY7A 4NDLA 3OSGA 2HYJA 2M8GX 1FOXA 3M1CA 3ABLH 3TP0A 2WY8Q 1X58A 1Z3XA 3PFYA 2BZTA 3OR2C 3CCMI 1N25A 1KYZA 1WHUA 2FD5A 5JR3A 1CF7A 5F08A 4DZJA 3O6BB 3OOUA 4HLXA 2UWMA 3HGGA 2DA3A 3KYLA 5EEAA 1D8KA 4FHTA 3S2WA 1X2MA 4WWCA 1PDNC 1HCRA 4B3AA 2PX9A 3N4MA 4LD5A 2GA1A 1XTAA 1WH5A 3DV8A 4ITVA 3HC7A 1F36A 4BHPA 2OCCH 1MBJA 3TO6A 4OMYA 1X19A 5LLQA 2Z2SB 1BN5A 2E7XA 4E7IA 4R1HA 1W5TA 2VN2A 2O6GE 2CUFA 2C6YA 5FFZA 1IN8A 4XORA 1D5VA 1U9NA 1R36A 4I99C 3TGNA 4PCQA 4CA0A 1QPMA 2LBFA 2M4GA 2VPRA 3HBLA 3JR9A 1FOYA 5BPDA 3KP4A 4IEJA 3F8NA 3HL2A 5HVQC 1BBYA 4LLGF 3CCEI 2KT0A 2K4JA 1K4TA 3H0DA 3LSIA 3I58A 4C2UA 3CDIA 1BJAA 3H36A 3D5LA 1AKHB 3F6OA 1ZH5A 3BTLA 2MG4A 3LA3A 1JKOC 2LVSA 1D1AA 1DDNA 1T98A 1EH6A 5LD2C 1D3YA 4RS8A 3OIQA 5CVUA 2PMZA 3RIRA 3CCJI 1XMXA 3QPTA 3RTRA 2RAEA 1AOYA 2R0QC 3DLLF 3O8GA 4C2TA 3ZMSA 3F72A 1FIAA 3WTYC 2HEOA 2QF7A 3MVPA 2FBKA 2ZJPF 3BG6A 4V2GA 4J00A 4A3EJ 4HOBA 1YITI 1MH4A 5GP9A 3ZOBA 2M0CA 2EBIA 1OISA 3BR2A 1VI0A 5GPAA 2O3FA 3I53A 2MSYA 4L9JA 2PMHA 4NNJA 4OINF 4WXDA 4S05A 3RYRA 3OYEA 3VDXA 1MBEA 2LNBA 1IDZA 1QVUA 4HDVA 3RQIA 2BYVE 5E20A 4JX5A 1YO5C 5KK1A 1OQYA 3WTSC 2R93J 4KIBA 3RZDJ 3VSLA 5C4XJ 4L5IA 2LY2A 2CQNA 1TZLA 1WI3A 2IGKA 2JUGA 3I56I 4LG0A 1YE9A 3DKXA 1MNEA 4DBQA 2QENA 3MKLA 3NWSA 4CYCB 1BA5A 3ZN1A 3CUOA 4UUVA 2GXAA 3S2DJ 5E3NA 1XGMA 1VQPI 3IWFA 1R5ID 1X1BA 4BHBA 1XDUA 2A6EF 3QP6A 1PUEE 4S04A 1LB2A 4A0ZA 3J80Z 3KZZA 1MZBA 2D2WA 4BXUA 1PP8F 4PUSA 3KYCB 1WKMA 2ZNZA 2NS0A 3I59A 4BXXJ 2RC4A 4E6KG 1MJAA 3ZQIA 3JSPA 3BCAA 4LLNA 1MH3A 2F2EA 1W1WE 4UUSA 2A07F 4U88A 1H0MA 4P55A 4I09A 2YSRA 1BC8C 3SXYA 3BJ6A 4DYQA 2YU3A 1D5YA 4EJTA 2B63J 2XIGA 4BGDA 2FXAA 1FMWA 2QCOA 2UXNA 4FISA 1AA7A 2EFQA 1W36D 2E36A 2DW4A 3M8JA 2Q2EA 1JGGA 2BXZA 2QSFX 3K6GA 4IHSA 4EEFG 5IYCJ 1RKTA 2W25A 3KCCA 3M3YJ 4PSWA 3TBIA 5H6QA 2NVQJ 1RR7A 4PJMA 4N0BA 2H8RA 5KHDA 5DTDA 4E7KA 1ETWA 5K7FA 2R7ZJ 2VOOA 2NNNA 3KZIC 5BNGA 4ZDOA 2FRHA 3BR1A 1DGWY 4YIFA 2QSGX 3MKYB 2KKOA 1RKWA 1Z67A 1FTZA 4RLQA 3PNVA 4U7BA 2HYGD 1MDMB 5EG0B 1LVKA 1Z6TA 3KP5A 4ZDPA 2R5ZA 2HOSA 4RMNA 3A01A 2X6XA 1LFUP 2DXIA 1X2NA 5D4SA 2EFNA 2BW3B 4M71A 1YG2A 3Q0WA 3OV8A 1B9MA 4I2OA 2VPLA 3AG2H 3WTUC 5CVVA 2VODA 3H9JA 3KIOA 3RSNA 2E71A 1U5TA 3H35A 1HF0A 3GLLA 1OCPA 2G7UA 2P7CB 3PNTA 2V6EA 1IN4A 2D5VA 4JBAA 3GO5A 3OR1C 2DA6A 2DT6A 5K7ZA 1MBFA 3RPUD 4XLEA 5HOOA 1OMIA 4FE4A 3C18A 4XIDA 4LFUA 2L4AA 3LSJA 4LGWA 1MW7A 1QPIA 4W97A 2F6CA 1VF9A 3A4CA 1YIOA 3MFKA 5IYDJ 1X1PA 4FX0A 3TP3A 3QYBA 5HDKA 3U1KA 2F4IA 3K1MA 2ZNYA 2DK8A 5L3CA 3J7AY 2HVRA 4GYIA 2DQLA 2HQ5A 2IS2A 1UJ8A 5KVRA 3IRRA 1SFUA 1PJRA 2XASA 5IOYA 5DD4A 2Y0SA 4CDGA 2MBFA 5K7HA 1BW6A 2AO9A 4IHXA 1WFXA 4FASD 2ISZA 5A2QK 1RESA 3HOVJ 1TWCJ 2M8EA 5BS6A 2HOTA 1FBQA 1JI8A 1ZTRA 2D1VA 2ME0A 1P7JA 2KL4A 3K1NA 4IOCF 1XX5A 3CMYA 5DCFA 3JW4A 4HV6A 3HRTA 1OCZH 2E2IJ 1WJDA 4BACA 4E7ZA 3CMEI 2CJJA 2DMUA 2OPTA 3AL0C 5DV5A 1K6YA 3JRBA 1RETA 5LGTA 2V1DA 1BOAA 3N97A 2R92J 4XQFA 4JX6A 4MNUA 3V42A 4BBRJ 2L9RA 2M7BA 2X51A 5LGUA 4XOPA 3E6CC 3DU6A 3H3UA 1O3QA 4IX7A 5E1ZB 1OYIA 2E5NA 3WE2A 1IJWC 3M4OJ 3NWTA 2ZKZA 2XAGA 5JI6A 2VKHA 2GA2A 4YFXF 2Z33A 1VFCA 4UV9A 4EJWA 5EGOA 3W2AA 3SFIA 3KP6A 3LFUA 1Z0XA 4WXHA 4X0GA 2L9SA 4H0EA 4U7DA 2LKPA 2MH2A 1XPXA 3IL2A 5CJ9A 4CO8A 4RB2C 4HX8A 3DQVC 4F91B 1P92A 1GV5A 2H94A 1WCMJ 4XLCA 2OU2A 3V7RA 1FBSA 2M2EA 3DBHB 1IO2A 4P5OA 4XR6A 3TDUC 4EQQA 2E2JJ 3ZPLA 2R7UA 3BC8A 5E18F 2K9LA 4KMFA 2L7MP 1IV8A 1ON1A 4PZJA 5L3GA 5HODA 2M3AA 1UB9A 1Z6RA 2ZXWH 3WU0A 3CP2A 3QU6A 1JHFA 2LF7A 3ZRGA 2KMUA 2K02A 1GXQA 3FBNB 1Y6IA 1YX5A 4FX4A 2XVCA 3VYTB 4KN4X 3EUKL 1IXSB 1U8RA 3HOUJ 1UELB 4PJJA 4OIOF 2R7VA 2X6YA 5LGNA 2BXYA 4BYYA 4G7ZF 3H9GA 4UXNA 1I1SA 4CSWA 2G9WA 4A3BJ 1RPWA 3MWMA 4XRSG 3J81K 1T39A 4HPQA 1YW8A 1IRGA 3J7ZI 2PQ8A 5E3LA 1S7AA 4Q4ZF 2DO7A 4ANJA 2VONA 2L02A 2VE9A 2VOPA 2Y69H 1J5YA 4EV0A 5J1RA 3FWEA 5HLTA 4BDYA 4L9VA 3SEZA 3CCUI 1LUJB 5L3DA 3E5UA 2FOWA 2CV0A 3HOTA 1TNTA 3ROUA 1HDPA 3AFHA 2EJRA 5F0CA 2COBA 4A6EA 5FLXZ 4BY7J 3CCLI 3ZN0A 2M45A 3I5UA 4I0AA 1POGA 1TWAJ 2ME6A 3E6BA 1VQ6I 3QAHA 1SFKA 5B1AH 2VLAA 5H20A 3GWZA 4ZJZA 2AQEA 4RAGA 1T38A 4YIRX 4IHWA 3EYYA 4MQ9F 4UVCA 3WGGA 1E3OC 3MCZA 1FYKA 3LA7A 3ZMDA 1ITYA 2R7DA 4XKVA 2Y75A 4EGZA 1QA6A 1DU0A 1S3JA 3IH3A 4NUBA 1TQPA 3OYCA 1YI2I 4MLOA 1A6QA 1QZEA 3P9CA 3PUBA 4HG2A 4IF4A 4A69C 1IUFA 4PJNA 1SMYF 4BJTA 3BZ6A 3KP2A 3WTVC 3I4NJ 3BG7A 3REOA 1O3SA 4AM3A 2VXDA 1GV2A 2KIQA 2TCTA 1WI9A 4B3XA 4V2FA 5M3FJ 3DBRB 1O4XA 1YIJI 2CW7A 2PLYA 1TT0A 2F5EA 3LWFA 2DDAA 2KIMA 3FXLA 4G7OF 2W84A 2FF4A 2DOEA 1IW7F 4A3CJ 1FYMA 4IO9F 2IRFG 1SVLA 3SJMA 2MH9A 2JPCA 3ZGKA 1R1TA 2W57A 4BHCA 5F0HA 3DKWA 2HKXA 3E5QA 5JFRA 3K4JA 4LITA 1ETYA 3K70D 1ZGJA 2JVGA 3EUHA 2XSDC 1SD7A 1XMAA 3E1SA 1G3WA 4FTHA 2HQNA 3BT9A 4DJAA 1R1UA 3LOCA 3BZKA 3PFIA 1Q1VA 4F3QA 4L0YB 4KMUX 2IGMA 5D5WB 5BPIA 4TV7A 3S17J 4BDZA 3SEQA 2K3FA 1K83J 4E7LA 1SFEA 2P6TA 1ZLJA 5DUIA 3MZHA 1X3ZB 1XGNA 2MA3A 2EZIA 1DP7P 4M72A 1GLNA 4GO1A 1RRJA 1MD0A 4XK4A 2XPUA 2JJ7A 1LDKB 2A6TA 4E70A 2OJED 9ANTA 4D9JA 2E1OA 2L9VA 4KIFA 2G7HA 3AG1H 2XAHA 4IRIA 4HBLA 5EZHA 2JA6J 2A5YB 3D5RC 2ELJA 2ZFWA 3W2WA 1Q1HA 1H9GA 3CMAI 1TT5B 3GZ6A 4LB5A 1YYVA 1QHHD 3H92A 3VWBA 3DF8A 3T5XA 3HEFA 3CCSI 1ZELA 2WADA 2WAQA 4A3IJ 1GDTA 1D8JA 4AIKA 1T33A 2P5LC 3I4PA 2FU4A 2XUBA 2EFOA 5GTIC 1A35A 1ZAOA 2K85A 1N78A 2CUJA 1WSUA 2NYXA 2LFBA 3G6EI 5FLMJ 1KGSA 3TMOA 1J7KA 1R1VA 3OYNA 1JTYA 4XMYA 4I7HA 4N4NB 5EEGA 4CCLA 3IHUA 3BR0A 2XKPA 5IOZA 3OYGA 1SVMA 1H88C 2MD0A 2A68F 4M3GA 1MMNA 4CCKA 2NS8A 3O3KA 2CYYA 1WJAA 4DGWB 3CMMA 1U2WA 3U21A 2H1KA 2KDOA 2FNPA 5IT9Z 1TLHB 2HXOA 5ICGA 3H5RA 2QKMB 4DBRA 3T0YA 3E0JB 1DPUA 1X1AA 4B44A 1AWCA 3B6CA 3BCBA 5FKNA 3NEUA 3A1YA 2K40A 1KQ9A 2H6CA 3NRVA 2DODA 2EZLA 2WB1N 3ZMUA 2ZBKA 1XCBA 4OAYA 4DYCA 3LSTA 1RZ4A 2OZUA 1L3LA 3L7WA 3RI4A 3BJOA 5IP7J 1AU7A 2CH0A 1R00A 3GTOJ 5TJJA 1V5EA 2E19A 5F27A 3H5AA 3BTJA 2R7XA 3K4LA 3L2QA 2X1EA 1Z9CA 1B8IA 2XGDA 3KZYA 2LREA 4FQGA 4JX4A 5HLIA 3Q0VA 2IXSA 3ZMTA 1ZGWA 3S1RJ 1ACIA 4L18B 3E3VA 1K4SA 2VT3A 3U2RA 3FX3A 5ILUA 3OOPA 2XPVA 3H1CA 3L1PA 1B72A 3BTCA 1BR2A 2XGEA 2Q8KA 1JKQC 2R7FA 2OUMA 3HTUA 3VOEA 3K4NA 5DYMA 1L0OC 2BVLA 4G7HF 1VQ8I 2QVOA 1SD5A 2DN0A 2MGQA 1TP4A 4A3GJ 3T8TA 3I9V2 5ILVA 3M9AA 1IRZA 4IOAF 2YS9A 3E7LA 3K1PA 3W3CA 3LMMA 1FX7A 5DCMA 5GAHJ 3GLXA 3GXOA 4UB6C 1FYLA 2BY3A 3DPLC 2FQ3A 2AS5F 5B66C 1J9IA 1XD7A 4L5EA 4A3LJ 1D0ZA 3A02A 4I01A 2K9NA 3V8KA 2ZMEA 3DTKA 3ZQGA 3CUQA 1JUSA 3FMQA 2BHZA 3LQQA 5BQTA 5J47A 1HOMA 2QBYB 2JA7J 1WPKA 1BI0A 2RGVA 3S15J 3I0TA 3OYIA 1M1EB 2F5VA 2IAIA 2DK5A 1O57A 1WRJA 5L3EA 4UVAA 4PFOA 3K2AA 3R6SA 3HSFA 3CJNA 3Q3SA 1G8XA 2XSJC 2ZMEC 3G2BA 1F43A 1R5HA 4ZTFA 3CC7I 2CW8A 4G6DA 3FK6A 2R4GA 2EQRA 2Y30A 1IV6A 4WCGA 2ZSHB 1VQLI 3IV5A 3FMSA 3G71I 2DFHA 5F6FA 3DFGA 4UV8A 3CQZJ 1VZ0A 1U9OA 4AU7A 4ZZDA 3MKZA 2HVQA 4M9SA 1XMKA 3PO2J 3FF5A 2DQRA 4GYGA 4XL9A 2YX4A 2WV1A 4L0ZB 1YHQI 5DUKA 4B47A 4OAZA 4O5VA 2GIZA 4XRSA 5J4YA 1XSDA 1FNNA 3KETA 1FZPB 4ZYAA 2OQRA 1EH7A 3FBIB 2BGCA 2V26A 3LL7A 2HOAA 5F64A 4M3DA 3F8CA 3K4MA 2ESNA 2QUFA 1G3YA 5GADJ 5J40A 4CCNA 4LOCA 4ZYDA 2Q2EB 4OIPF 2CG4A 2KP6A 1Z7LA 2FX0A 3HM5A 5DM7F 2XRNA 2Z1DA 4HX7A 1H89C 4KISA 2HU9A 3I64A 4I0BA 4NC6A 1ZREA 1AHDP 1UHWA 2K4BA 3FXJA 3BTIA 2OTJI 2E7WA 5HDGA 1LEAA 1H8AC 2YU9J 2I10A 1G3TA 3KP7A 2XROA 3AG4H 1LE8A 1LEBA 3K2ZA 3C2HA 2R5ZB 1R22A 2LKSA 4A12A 2ELHA 4IHYA 5CVJA 1F5TA 1SD6A 3RKWA 4RB1A 3GCMA 4CCJA 3CF5F 2MABA 3PL8A 3Q0UA 4Y17A 1K78A 1X1CA 3JAMZ 1A6IA 4ZZLA 2L54A 1CQTA 1MBKA 3V7CA 2LOOA 3HUGA 5DM6F 3OYMA 2Z5UA 1A04A 1Z1DA 2JSCA 4BEHA 1REPC 3F23A 2UZKA 1MNMC 2LTPA 4M9XA 4CICA 4ENJA 3RPUA 1YOVB 3FM5A 2STTA 3S2HJ 2ZXIA 1WH7A 1P6RA 4ZC3A 1MSEC 4IHVA 2L3DA 1K79A 2HQAA 4XLHA 1I6XA 3PJRA 4NQWA 1A36A 2KRFA 2JZYA 3QYEA 2DMQA 3CF2A 1OCRH 2EIKH 1UZCA 3GBGA 5D5UB 4UY8I 2X0LA 2RDPA 2P7VB 5LHHA 2PMZN 4CZZA 3PNYA 2JVHA 4HNVA 1BL0A 5FD5A 3SZGA 4B8XA 5J1UA 3F6VA 1ZN2A 1FOKA 3TEDA 2KQRA 1YS6A 3AL0B 1TWFJ 1IN5A 5D8LB 2NVTJ 3OS2A 2VBYA 1GVDA 5LHIA 3H5NA 3K7AJ 4XONA 2H6BA 4C2MJ 4V19K 3JCUC 1Y56A 4PJLA 1BI3A 2JRMA 1W7PB 2VJ4A 2BEOA 2VL8A 1APLC 2FBIA 3NARA 1BIBA 3R61A 1LDDA 3KYDB 3G1MA 4NC7A 2AXTC 4JP0A 4MFEA 3DEUA 3R4KA 3I71A 1TQIA 2OV7A 3KEOA 2MD5A 5BMZA 2IT0A 4IXAA 3SDBA 4HSRA 1DQUA 1XS9A 2ZJQF 1PYVA 4Z2YA 3JSOA 1B1BA 1VQKI 1JTXA 4OMZA 4E7JA 2I8DA 2K5CA 3NAUA 1PUFB 2BY1A 2IA1A 4B48A 4CYCA 5CYVA 3ZQLA 1JUMA 2LMDA 5LRSA 2BOLA 2XAUA 2DPDA 2DA7A 2JRTA 4QSHA 3EYIA 1OKRA 2M7AA 4KUMA 2WAFA 3G1LA 1KZHA 1KU3A 2CS3A 4MTDA 4DYRA 1S5LC 2Q1ZB 1YX3A 3DTIA 4A0XA 3B73A 4BE0A 1U5TC 2EFWA 1HQCA 4YIIA 4HSTA 5DDGA 4XN0A 3B6AA 2BY0A 1E2XA 4A6DA 1Y39A 5HNFA 1BIAA 2BVMA 1HXDA 3AG3H 2QEXI 4BQNA 2FQ4A 2BHYA 4BBSJ 2LDUA 1QZYA 2DJIA 4AIDA 1IN7A 2P5KA 1X3UA 2RKHA 2JMWA 4XSXF 4Q48A 3HOYJ 2QLZA 1ZG1A 2E34A 1R71A 1OYWA 1XCVA 3I55I 1WJCA 3P7NA 3TW7A 1GVJA 5J8CA 4F93B 3PIPF 2K9QA 4IQ4A 1QBJA 4J19A 4CXFA 1QHGA 2DMNA 3ZQFA 1VQNI 1NK2P 2LSOA 4I98B 5F04A 3CCQI 1IAWA 4PGGA 1ZRCA 3GTLJ 1STZA 2L7ZA 2LH9A 2ELKA 2DTRA 2V7FA 5DD8A 3CCVI 1JT6A 2RN7A 1I5ZA 4YFKF 2X1DA 2E1MC 3TOAA 2CQKA 1NH3A 2ZXHA 2LR8A 2FMLA 1TBXA 5HNHA 1FIPA 2DBBA 3CDHA 5FO5A 3W2VA 1HSJA 3GZNB 3HPGA 5GAEJ 5EF6A 3CJQB 3ML6A 3QPSA 1MDMA 1VQOI 3HSEA 3MD2A 4O3MA 3SFZA 5CKTA 3WTXC 1I6HJ 4HRIA 5K5OA 3WTZA 2HZDA 3GTJJ 2HPIA 3HYIA 3ZP5A 3HTSB 2BW3A 2HFHA 3J7YJ 3PUFA 4F55A 2IEKA 4R8HA 3JTGA 3CLOA 4HX4A 4XKCA 1OFCX 4A5NA 1JE8A 1IC8A 3LSKA 3ZCOA 3KLNA 1IRXA 2GXGA 4HQMA 4P96A 2P0WA 3ELKA 4AYBA 2JN6A 1UAAA 1V4RA 2JTVA 2BBYA 3OWTA 2P81A 1BR1A 3DKYA 4U0WA 3Q9VA 4BJ6C 3A03A 2O03A 2QA4I 2FSWA 3PM1A 1RNLA 3GTQJ 1QVTA 1ZG3A 2FOKA 2PJPA 3BG3A 4LIVA 2W24A 5EYRA 2DFFA 1S7EA 2M9HA 1FT9A 2NOJB 5L3FA 4EGYA 4HF1A 4C3IJ 1G6NA 2FUG2 2P6SA 1FLIA 2WTEA 4J01A 1P4WA 3PQKA 1MMSA 2L5QA 5HS8A 1R9TJ 1JXSA 3JTHA 3HOSA 4UNOA 2JSPA 1MBHA 4ESJA 1ZLKA 3OIPA 3ECHA 4G6QA 2XF6A 2MC4A 2GOMA 5TISC 3LFKA 1BOBA 2R5YB 1GUUA 3IRQA 4OU0A 3TKYA 2R7SA 3HKZN 1O3TA 2VBZA 1W7PD 4MEYF 1MMAA 1HKTA 2KJBA 4HZFA 3DXJF 2OZ6A 3GTKJ 4OWRB 3FISA 4CCMA 5B5EC 4GGGA 2KRHA 2EZKA 2VXZA 4JK1X 4D7NA 2DOFA 1W5SA 3WHCA 1K61A 4AD9A 2K3PA 2V1UA 4ZYEA 2RNGA 2LF8A 1LKXA 4WXCA 1MSFC 3S1QJ 2XRLA 2KIFA 1E3HA 2Z16A 2V6CA 2ISYA 4KN7X 2RVCA 3GX4X 1WJ5A 3GTPJ 2IS6A 4BXFA 3J80K 2EV6A 4B09A 4W1UA 1MMDA 1HKQA 1DGRM 3HDDA 2H1LA 4LG3A 4EM1A 2VJ5A 3I3LA 3LNQA 4LIUA 3HRUA 1J0RA 1KU2A 2CW0F 2O0YA 3K0LA 1KU7A 1RUNA 2XPWA 3K9TA 1SD4A 4BUPA 2CRGA 2HNHA 4Y13A 4IJAA 4NHJA 1I1GA 3BWGA 5FFXA 5E1XA 4IZZA 1VQMI 3DLAA 1VQ4I 3VYRB 3EQLF 5FB2A 2LY1A 2KISA 1FP2A 3OL3A 3JRHA 3WG7H 1IG7A 3W6VA 3RZOJ 3JRAA 3P9KA 3W6KB 4RDUA 1J59A 3ABMH 3IH4A 3VPRA 5IPAA 3F3XA 1WGXA 4BQAA 2OCEA 4ESFA 1DUXC 5M5XJ 2PFBA 2EH3A 4MQVA 1YJWI 4DQ2A 2CQ7A 4L9TA 4KICA 4QPOA 1HC8A 2L0KA 1Y0UA 2VC0A 2KZGA 2CFXA 4EATA 1IUYA 1TWGJ 3WGHA 2HS5A 3FXRA 1U6GA 2KHMA 3FXOA 3EPZA 2TRTA 2KZVA 5IP6A 2LKXA 2OA4A 2EFPA 4IPAA 1B59A 2DFIA 4KDPA 2PJRB 5D6EA 3AAFA 1XDSA 3LAJA 1IN6A 3CZ6A 2GBYA 2PEXA 2R7TA 2XDVA 4A3JJ 2V9KA 4JQFA 5FROA 5FKLA 3CJRB 4GRIA 1E0EA 2M87A 2EV0A 4BS9A 1ZR2A 1A5JA 2HXIA 2DFEA 3HXLA 2KFDA 3FM3A 3KX2A 1ONVA 1HKSA 3A2KA 1JUPA 3UR3C 2E1NA 5H2FC 4ENKA 1R5GA 4XLAA 3M07A 1P4AA 5B3SH 3H3ZA 2YX7A 4YRVA 1YJNI 2RQQA 3EUHC 4U0VA 3CCYA 4A3DJ 5LHGA 3UKGA 5D5XB 5ICEA 1IDYA 4BE1A 1ZYRF 4PDKA 1IXCA 1NHAA 3TW6A 2VQGA 4K2EA 3QOPA 3VYUB 1BI1A 4QIWN 1MBGA 2IGOA 4BL0B 5LFAA 3FKJA 3ZXSA 4ZDLA 4HF0A 2PG4A 4BJ5C 1Y8QB 1ENHA 2IPQX 3F8BA 3DEWA 5D6FA 1T8IA 1FPQA 2GAUA 1W5CC 1V54H 2JA8J 3HOWJ 3CDLA 2DPUA 2ZJRF 4U87A 2CUZA 4AVZA 3T1BA 3RKYA 3F0CA 4DNCA 1KQ0A 4AVPA 3CC2I 3FXQA 1V5FA 2XGXA 2XAFA 3C3WA 3IC7A 3MAJA 1VQ7I 3GTMJ 1I3QJ 3D1NI 1ZRDA 4L5JA 3S32A 2X6WA 5FKOA 3G73A 3VODA 4KITB 1KA8A 3LAPA 4I76A 2DU9A 3O8HA 3QODA 2G0EA 1ETXA 1USSA 1KONA 4X1EA 2M5WA 1BR4A 2ZSIB 3G3ZA 4IRHA 3T8RA 2AQFA 2R3SA 2GZWA 2AXLA 2HYFA 5ICFA 1B72B 1PP7U 3GMEA 4ABZA 2ID6A 4A3FJ 1O7LA 1CF7B 2E60A 2XAQA 4AIJA 2H27A 2DLLA 1LFPA 1HSTA 3OYBA 3D5SC 3VYSB 5KNLA 2NVYJ 5JLWA 3F9KA 2GM4A 1S7OA 4YEJA 2RREA 1JJ6C 4A3KJ 2L4MA 3ZQ7A 3ZR8X 1KQ8A 2HGCA 4AUXA 5K5QA 1TNSA 2BE5F 2WA0A 3HB9A 4HQEA 2IW5A 3BP8A 3P5JA 4CUGA 3BPXA 3V4GA 3ERED 1SVOA 4IKFA 1ETVA 4P9UA 1OLTA 2ZMEB 1ZRFA 1WVRA 4GXOA 1XG1A 2P5VA 1YS7A 2D45A 2VKVA 4EVIA 5K5RA 3DCFA 1R49A 1K6OA 5J6XA 2CSOA 2LBFB 5J8FA 3GFJA 4Y7NJ 2F5CA 1UG2A 2X6OA 3GFIA 3OYLA 2XV4S 2QZ8A 2PBIA 2XB5A 4KJZA 3BR3A 5BOXA 1J09A 1EKEA 1Y1VJ 4KYWA 3NQOA 3S8PA 3RJPA 4ON0A 4FETA 4XLPF 3IWZA 4DIQA 1YJ9I 2Z9OA 3D0SA 4IL6C 1XGOA 4FCYA 3FXMA 1TW3A 3OSFA 2O7OA 2CU7A 3WU2C 2GWRA 2K7LA 4F7ZA 5IP9J 2B9SA 3V8LA 3AKZA 4JYKA 2IGNA 1FP1D 1TTYA 2Y0MA 3J7AO 2R7OA 3WTTC 2BY2A 2XAJA 2FA5A 1MMGA 1FC3A 3S3NA 4HNUA 2E5ZA 2E1CA 2NRAC 3KE2A 2IA2A 2DA1A 3F22A 2VBWA 2EIMH 3WHBA 2WAQN 4EMSA 1UHMA 4IHTA 1YFHA 1QRYA 4FT8A 3WE3A 4F92B 3E6MA 3ABTA 3MKWB 2FNAA 3GW2A 4Y3OA 3WU1B 4PFPA 4RAYA 3Q9SA 2WC2A 1FSHA 3F8MA 5A2QZ 2HR3A 2ACJA 1ETQA 3R60A 4WK8F 2DYSH 2ID3A 2CV2A 2NNYA 1HW5A 4N9IA 3S3OA 5FLXK 3HOXJ 1YRNA 1WWXA 2RV8A 3PSFA 5FKKA 2A3SA 3DPTA 4XLNF 2MLKA 3VEPA 5IY5H 4AIHA 2W4SA 1EV7A 1BI2A 2LK2A 2L7KA 4P9FA 4XNFA 2EA2A 1P9QC 3GFLA 1IZ1A 4LK1F 4LG0B 3L2UA 2YUSA 2JQ7A 1ERDA 1W0TA 3CUQC 1LE8B 1HW1A 1O7FA 5KCMA 3RYPA 1G4DA 2RNJA 4EJOA 3ABUA 4RAZA 1UMQA 4L9NA 3S3MA 2MC3A 3LSGA 4RGUA 3QP5A 5IT3A 5D4RA 2W7NA 1I27A 3BY6A 1R7JA 5E3OA 5C3EJ 1X1DA 1U3EM 3ULQB 4S0HB 1ORKA 4RB0A 1E17A 4CGZA 1A31A 1XSXA 1K78B 4D0PA 3QU3A 4CHUA 4LMYA 2VI6A 3HUGB 2YR2A 3IUOA 3MMYB 2J5PA 1YW9A 4IVNA 4NBQA 4BEHB 1OCTC 3CC4I 4WF2A 1DP3A 3U1DA 3I59B 1R6RA 1X4OA 2J5OA 3ZQQA 2CGPA 4CZCA 4I6ZA 2HDCA 3Q5FA 2O5RA 4UUSB 3S1MJ 4A2UA 4RM2A 4KNYA 3DU5A 4UUTA 3JRDA 1ZR4A 2ECCA 2OTLI 3FZVA 4GDFA 1N75A 4LLLA 4D1QA 1T0FA 2YPRA 5E17F 4M3FA 4NQWB 1JHHA 3OMYA 4QWQA 1YW7A 2WBMA 3CD6I 4MGRA 3ISPA 1JKPC 2FMYA 3HOZJ 1B9NA 4PSXA 2DAOA 3WODF 3CLQA 5FD6A 1GT0C 3U9GA 4RGSA 3FKIJ 1MJBA 2Z99A 2O8KA 4ZH4F 4KT5C 4IRGA 3QRFF 3CO7C 1T0FC 1WJEA 2M30A 3HIFA 3IH2A 4D5FA 1R4MB 4XBFA 1MJ9A 4HDUA 1Z77A 1W36C 4ETSA 3C2GA 2XGCA 3ZQHA 3CO6C 2VQLA 3K69A 2WV0A 1JT0A 2VE8A 1IXRC 2JK3A 3E97A 3VSKA 2XC7A 5IYBJ 2MLGA 3F8FA 2OQGA 4KIGA 3A01B 2QBYA 3SZPA 1FEXA 3GEZA 1EH8A 2X85A 3V7SA 3CJTB 1B4AA 5D8KB 4LK0F 5KAIC 1TQMA 4C30A 3L00A 3J81Z 4HAMA 3H3VK 3WG9A 1RR8C 4IQJA 1B6AA 1U5TB 4U0YA 5H6RA 1N77A 5CVRA 2VIXA 3VB2A 1JGSA 3E5XA 3IKVA 5CVIA 2E35A 4M6XA 1O3RA 1BJZA 4MTEA 1NG6A 5J4VA 3BQYA 3GUDA 2LYCA 1D1BA 3JREA 1AKHA 1UHSA 4A0YA 1V5GA 1ZHFA 3TO7A 4E7SA 4UVBA 4B43A 3OYKA 2DT7B 4BNCA 2I5UA 2W85A 3HJEA 4ZTJA 3QWLA 1V3FA 4OOIA 4G6TB 2QSHX 5E3MA 1IF1A 2HZTA 2K9SA 3HGYA 2PMUA 3WTWC 1U0JA 3MZYA 3GFMA 5ICCA 4BY1J 3KLOA 4DZPA 1EF4A 2IS1A 1HDDC 2UUZA 2Y48A 5GTHC 5M5WJ 2DMTA 2E1MB 3LQRA 4CH7A 1D1CA 2KLOA 3HZJA 5AONA 4M73A 5IT9K 2QM3A 4QPQA 3COAC 2OD5A 4ESBA 1LPQA 2HDDA 1OCCH 3BJAA 1P2FA 2F4OB 2HQRA 2DA5A 2EINH 3I54A 3FK7A 3P9IA 4BQQA 5M5YJ 3IAM2 1OPCA 2MYSA 3L2VA 4B1RA 1JKRC 1XN7A 2ZO4A 4BE2A 5E79C 2DTZA 3G1OA 2NXNB 5FRMA 2P4WA 5EGOB 5ERIA 3R0JA 4XICA 4A93J 4CCOA 2DDBA 5E8IA 1SC7A 1I3AA 5FGMA 3ZQCA 4MEXF 3IP4B 3ASOH 3K4CA 1WJFA 1U78A 2KIUA 1ZKGA 3FXKA 2VASA 3ABKH 3QQAA 4HLYA 5J3LA 4XM3A 2KPMA 5J1YA 3A0BC 2ZJ2A 5K1YA 3UNGC 1QNTA 4II3A 2NVUB 1X3WB 5L3BA 3I4MJ 1S8NA 2V9PA 2DYRH 3HG9A 5M3MJ 1RUOA 4ENNA 2B0LA 3TL4X 1S72I 1ZK8A 2HKOA 2L2OA 1HBXG 1OR7A 3QPHA 1LNWA 3DPUA 3FHNA 3ZMZA 5TRDA 2A05A 5HLGA 1USTA 2Z3YA 1G59A 2TDXA 4PJ0C 1ZARA 1I39A 3KPHA 4N9HA 2X9DA 1G2HA 1EA3A 1I50J 5JHUA 1YTYA 1TWHJ 3GF2A 2JPBA 1OR7C 1SAXA 2NVXJ 3DBLB 1V55H 3PIOF 4ZYGA 4E4HA 2EV5A 1ZGAA 4YFNF 2EZHA 3HPHA 2WWYA 3QOEA 2Y9YA 4XOTA 1R23A 2V4JC 3HKZA 1SMTA 4O6JA 2VQHA 3LA2A 4XRFA 2FE3A 3SQNA 1HLVA 2CWEA 2OBPA 3OL4A 3SHFA 3MZ8A 5EG0A 1W7PA 1Z05A 3MQ0A 2JA2A 1KU9A 2KDZA 2IJLA 1S9HA 2JUCA 3A0HC 3HSRA 4EJUA 3BR6A 2F5FA 2OF7A 4FE7A 2ETHA 4HA8A 2V9VA 3PSIA 4KT6A 3FHZA 1TC3C 4X6AJ 1HA8A 2V1NA 1R4NB 1SAUA 4NB5A 3TQNA 3RQ4A 3SYTA 1FTTA 1PUFA 2Y31A 3DTEA 5AIQA 3SZTA 5JVTA 1RI7A 4RAFA 2GQQA 3X2QH 2VUMJ 3SDGA 1JJ8C 2O8XA 4Y33A 4NC8A 2DA2A 5TGTA 2HTJA 1FBUA 3BROA 1H9TA 1T08B 1LQ1A 1ETKA 4KFCA 3OS0A 5CPRB 4XLFA 2V79A 1TW2A 4XKWA 2DOAA 3L2RA 3JRCA 1ON2A 2ECBA 5B1BH 2HVSA 4BH9A 5F1JA 1XSVA 3HHGA 2O61A 1T95A 1J2XA 1W0UA 4R79A 2QQ9A 3EDPA 4MHGA 4JOMA 2XHKA 3ERMA 1QZZA 1RC9A 2D1HA 4UHTA 4YELA 3RPQA 3G4SI 2Y0SN 1ZG5A 4E7HA 3OIOA 4EM0B 5HLHA 3S1NJ 4MFDA 4XSZF 1YLFA 2JT1A 2QQBA 4EJVA 3M7GA 5JVGF 1J75A 1IGNA 3HRSA 1OJLA 2X1CA 3DP7A 2JA5J 2K27A 2L01A 4HNTA 3BDDA 1DPRA 4P1WA 5E1WA 2Y9ZA 3LSMA 3DWLE 4DOZA 1Y1WJ 1LFBA 2NS7A 4Y4RA 2QGUA 3K4BA 2CQXA 3O2PE 2HPMA 5E8GA 4G9YA 2ESHA 1CGPA 2HDWA 5HS9A 3R0AA 3C7JA 1GXPA 5FKMA 2IBDA 3BPVA 1SFXA 3OYJA 1Z21A 4Z6YA 2HOEA 2M1BA 2GIVA 1YQAA 2ICWG 5JLXA 3CCRI 2UXXA 3FXUA 4H4KC 3PQJA 4EM2A 1FWZA 3JAMK 3GZ5A 1SEUA 3W6JB 4C3HJ 2A6HF 1Y0NA 2NAZA 4Q5SF 4ENMA 2EB7A 1T2KA 3RCOA 1ZQ3P 2VB6A 4HW0A 1ULYA 2LC2A 1BM9A 3H9QA 2VJJA 2R7WA 3OYDA 1SANA 2X4HA 6PAXA 3QPLA 2OAZA 5ED4A 2EPFA 1Z7UA 2LP0A 3WGIA 1UFMA 2HTSA 3L09A 3K70C 4AWXB 4ZYHA 5GAGJ 3RDIA 1BW5A 5FRNA 4AYBN 3E6DA 1OYYA 5LEJA 4LJZF 1TL8A 4MO7A 2R7RA 2XKOA 3ONQA 1GHCA 4QTRA 4PGHA 2V1XA 1QGPA 4RBOA 2CV1A 2DT5A 5C4JJ 2A69F 5LBQA 2XF7A 4ASNA 2EILH 2FEZA 4BKXA 5D5VB 5DEQA 2KRCA 1XB4A 2QQAA 3MEXA 3QYFA 4YG2F 4RGRA 4MIMA 5FLVA 2E2HJ 5KAFC 1VQ5I 1FSEA 1LDJA 3OS1A 3TDZC 3KEQA 1NK3P 2ZC2A 2COMA 4I02A 1MIJA 1D0YA 2LRDA 3C1DA 4F52A 5FJ8J 4HYEA 3GTGJ 3K4KA 2DCEA 1UG0A 3BQZA 2L7FP 4N4OB 4DW6A 2NOGA 2R5YA 3EUAA 3M8EA 5F1RA 2VKEA 1SFOJ 1K7AA 3S14J 4AC0A 3LSRA 2XB0X 4C9YA 1BC7C 3H0GJ 2DJNA 5EJCA 4BAYA 3L2CA 2GOXB 1FOWA 5EDNA 4GCVA 3GYHX 4WX9A 2VJIA 1MGTA 1PVEA 2JWTA 4KA4A 2M34A 2BV6A 2A5WA 3ZMVA 5AIPA 3FMRA 2H09A 5CQGA 5CLSA 4RLFA 2EWNA 1QO0D 2VC1A 2W48A 2ZB9A 1E3PA 1MKMA 3BZCA 2WY7Q 1ODDA 3V8JA 2FJ1A 2CQQA 1FJLA 1Y8RB 2A61A 1QQIA 4XKBA 4RGXA 3M1EA 4XN3A 4XRMA 1WJBA 3BG9A 3OYAA 2N8GA 4A3MJ 2WB1A 2ZCWA 2LLKA 2CO5A 1HW2A 2M4KA
chains in the Genus database with same CATH topology
5FKKA 1GVDA 2LK2A 3K7AJ 4C2MJ 2YUSA 3S16J 1P7IA 1W0TA 1APLC 1LE8B 3NARA 3BR5A 1UMQA 5DS9A 3JRGA 3HOUJ 3G1MA 3LSGA 4JP0A 4MFEA 1B8IB 3PO3J 5E3OA 5C3EJ 2GLOA 4S0HB 2HI3A 1ORKA 2AHQA 1U8BA 1XS9A 2CUEA 2VI6A 4A3BJ 1JTXA 1RPWA 1DU6A 3NAUA 4XRSG 1PUFB 4M3EA 4CYCA 1OCTC 3ZQLA 5E3LA 1JUMA 1ETOA 3RKQA 2DA7A 4QSHA 4I6ZA 3G1LA 4UUSB 4DYRA 3LSPA 3S1MJ 4M3BA 4UUTA 3FIWA 3JRDA 2O9LA 1ZR4A 2ECCA 5J1RA 2Y2ZA 3B6AA 3MN2A 4M3FA 1JKPC 2FQ4A 1HDPA 4D7MA 2MW8A 5GPCA 3HOZJ 4BBSJ 5F0CA 2COBA 4BY7J 2LD5A 3JRIA 1POGA 1GT0C 1TWAJ 2ME6A 2JMWA 3BG5A 3FKIJ 2O8KA 3HOYJ 4GFBA 4G12A 4IHWA 4C3JJ 1YRNB 3C2BA 3IH2A 3TW7A 4D5FA 1E3OC 1XC5A 5EZGA 1Z77A 1ITYA 2K9QA 2LY9A 2XGCA 3ZQHA 4M6VA 4J19A 5C44J 1DU0A 1JT0A 3IH3A 2DMNA 2JK3A 3ZQFA 1NK2P 2DMPA 4MLOA 5F04A 5IYBJ 3GTLJ 4Y52J 2L7ZA 1NTCA 2ELKA 4A69C 1JT6A 1IUFA 5F0FA 3A01B 1FEXA 3I4NJ 1VNDA 2LR8A 1FIPA 1GV2A 2TCTA 4D5CA 4V2FA 3H3VK 5M3FJ 5EF6A 1O4XA 3QPSA 4B4CA 2DA4A 1I6HJ 3JRFA 3GTJJ 2X48A 1BJZA 1T56A 1AKHA 4A3CJ 3BQYA 3JREA 4NDLA 3OSGA 2HYJA 1UHSA 2IEKA 3SJMA 2M8GX 1OFCX 1IC8A 3TP0A 5F0HA 1X58A 2JN6A 2P81A 1ETYA 2FD5A 5E3MA 3A03A 2XSDC 5F08A 4DZJA 2K9SA 3OOUA 4FTHA 3HGYA 2DA3A 3HGGA 3BT9A 3PM1A 1QVTA 5EEAA 3GTQJ 1X2MA 3BG3A 5EYRA 3LOCA 4B3AA 1HCRA 1S7EA 2M9HA 1Q1VA 4DZPA 4BY1J 1EF4A 4C3IJ 1HDDC 5M5WJ 3S17J 1WH5A 2DMTA 1K83J 1F36A 1MBJA 1R9TJ 1MBHA 2EZIA 4XK4A 2HDDA 2XPUA 2JJ7A 2DA5A 2CUFA 9ANTA 3FK7A 5M5YJ 2E1OA 1U9NA 2R5YB 1GUUA 4B1RA 1JKRC 5EZHA 2JA6J 2VPRA 3HBLA 3JR9A 3HKZN 4IEJA 2DTZA 3G1OA 2KT0A 5EGOB 3GTKJ 4XICA 4A93J 3FISA 3ZQCA 3HEFA 2EZKA 4A3IJ 4D7NA 1U78A 3WHCA 1GDTA 1K61A 1ZKGA 1AKHB 1T33A 3QQAA 3BTLA 2MG4A 5J3LA 1MSFC 1JKOC 5J1YA 3S1QJ 2LVSA 2XRLA 2LFBA 5FLMJ 1JTYA 3I4MJ 3GTPJ 5M3MJ 3BR0A 2RAEA 1ZK8A 4W1UA 2R0QC 3O8GA 5IOZA 3HDDA 1H88C 4M3GA 3LNQA 2NS8A 1FIAA 2XPWA 2QF7A 3MVPA 2CRGA 2H1KA 4V2GA 4A3EJ 1MH4A 5GP9A 3ZOBA 2X9DA 2M0CA 2HXOA 1I50J 1G2HA 1TWHJ 2EBIA 3JRHA 1IG7A 3BR2A 1VI0A 3W6VA 3RZOJ 5GPAA 3JRAA 4RDUA 2MSYA 3IH4A 3VPRA 5IPAA 3B6CA 2NVXJ 5FKNA 1WGXA 2K40A 1MBEA 2EZHA 5M5XJ 1IDZA 1QVUA 3RQIA 2EZLA 4JX5A 2R93J 2EH3A 2WB1N 2Y9YA 3RZDJ 5C4XJ 4DYCA 1WI3A 2L0KA 5IP7J 1TWGJ 1AU7A 1HLVA 3GTOJ 5EG0A 3MKLA 1BA5A 4CYCB 2KDZA 2E19A 5F27A 3BTJA 2TRTA 3S2DJ 5IP6A 5E3NA 3BR6A 2LKXA 1B8IA 2OF7A 4FE7A 2XGDA 4JX4A 1TC3C 4X6AJ 3Q0VA 1ZGWA 3S1RJ 1FTTA 1PUFA 2Y31A 2GBYA 4A3JJ 2XPVA 3L1PA 1B72A 4BXXJ 5FKLA 3BTCA 1JKQC 2XGEA 3ZQIA 2VUMJ 1ZR2A 3SDGA 2HXIA 1JJ8C 1A5JA 1MH3A 4UUSA 2DA2A 2DN0A 1JUPA 2MGQA 1ETKA 4A3GJ 4DYQA 1D5YA 1IRZA 3JRCA 2ECBA 2YS9A 2B63J 3E7LA 5F1JA 2QCOA 3CCYA 4FISA 4A3DJ 3UKGA 1W0UA 1JGGA 1IDYA 4L5EA 4EEFG 5IYCJ 4A3LJ 1RKTA 3M3YJ 3A02A 2K9NA 2NVQJ 1RR7A 3ZQGA 3TW6A 1JUSA 1HOMA 2Y0SN 2H8RA 3OIOA 2JA7J 3S1NJ 5DTDA 1MBGA 1WPKA 4MFDA 4QIWN 3S15J 1ETWA 5K7FA 2R7ZJ 2IAIA 5BNGA 1ENHA 3BR1A 3DEWA 1RKWA 1IGNA 3K2AA 1FTZA 1OJLA 2JA5J 2JA8J 3Q3SA 3HOWJ 5EG0B 2Y9ZA 3CDLA 1Y1WJ 1LFBA 2R5ZA 1F43A 2NS7A 3F0CA 2HOSA 3A01A 2CQXA 1LFUP 3FK6A 1X2NA 2EQRA 2Y30A 3GTMJ 1IV6A 1I3QJ 3Q0WA 3D1NI 5FKMA 2IBDA 5FKOA 3IV5A 4I76A 3O8HA 1HF0A 2G0EA 1ETXA 4X1EA 1OCPA 3CQZJ 5JLXA 2D5VA 1U9OA 2DA6A 4C3HJ 5K7ZA 1MBFA 1B72B 3PO2J 4FE4A 4XIDA 4ABZA 2ID6A 3LSJA 2WV1A 4A3FJ 1ZQ3P 1QPIA 4W97A 1VF9A 5IYDJ 4XRSA 1SANA 3TP3A 2NVYJ 5JLWA 3QPLA 2GM4A 2HOAA 4M3DA 1JJ6C 2LP0A 4A3KJ 2HQ5A 1BW5A 4AUXA 4AYBN 3HB9A 5IOYA 4MO7A 4LOCA 4QTRA 5K7HA 1BW6A 2AO9A 4IHXA 2FX0A 1ETVA 3HM5A 4RBOA 1RESA 1H89C 5C4JJ 3HOVJ 1TWCJ 1XG1A 2HOTA 1ZTRA 2ME0A 1P7JA 1AHDP 2VKVA 3DCFA 3CMYA 3BTIA 4BKXA 2E2IJ 1H8AC 4Y7NJ 2YU9J 1UG2A 2I10A 2X6OA 1LE8A 4MIMA 5FLVA 2E2HJ 2CJJA 2DMUA 2XB5A 2OPTA 1NK3P 3BR3A 3JRBA 2R5ZB 1Y1VJ 4IHYA 1RETA 5FJ8J 3GTGJ 3BQZA 2R92J 4JX6A 2L7FP 4DW6A 2R5YA 2NOGA 2L9RA 3Q0UA 4BBRJ 2VKEA 1SFOJ 4FCYA 3S14J 1A6IA 4AC0A 2XB0X 3LSRA 1MBKA 2O7OA 3H0GJ 3OSFA 2DJNA 1CQTA 2CU7A 5IP9J 1IJWC 3M4OJ 5EDNA 4JYKA 1VFCA 5EGOA 1MNMC 2LTPA 3SFIA 2JWTA 1Z0XA 3S2HJ 2M34A 1WH7A 1MSEC 4IHVA 2DA1A 3WHBA 2WAQN 2W48A 2ZB9A 1QRYA 2DMQA 3GBGA 1GV5A 2FJ1A 1WCMJ 2CQQA 1FJLA 2PMZN 2M2EA 1ETQA 4HNVA 1BL0A 4XRMA 2E2JJ 5J1UA 3BG9A 2ID3A 2N8GA 4A3MJ 3TEDA 2LLKA 3HOXJ 2L7MP 1YRNA 1TWFJ 2NVTJ 5HODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKK A;  1GVD A;  2LK2 A;  3K7A J;  4C2M J;  2YUS A;  3S16 J;  1P7I A;  1W0T A;  1APL C;  1LE8 B;  3NAR A;  3BR5 A;  1UMQ A;  5DS9 A;  3JRG A;  3HOU J;  3G1M A;  3LSG A;  4JP0 A;  4MFE A;  1B8I B;  3PO3 J;  5E3O A;  5C3E J;  2GLO A;  4S0H B;  2HI3 A;  1ORK A;  2AHQ A;  1U8B A;  1XS9 A;  2CUE A;  2VI6 A;  4A3B J;  1JTX A;  1RPW A;  1DU6 A;  3NAU A;  4XRS G;  1PUF B;  4M3E A;  4CYC A;  1OCT C;  3ZQL A;  5E3L A;  1JUM A;  1ETO A;  3RKQ A;  2DA7 A;  4QSH A;  4I6Z A;  3G1L A;  4UUS B;  4DYR A;  3LSP A;  3S1M J;  4M3B A;  4UUT A;  3FIW A;  3JRD A;  2O9L A;  1ZR4 A;  2ECC A;  5J1R A;  2Y2Z A;  3B6A A;  3MN2 A;  4M3F A;  1JKP C;  2FQ4 A;  1HDP A;  4D7M A;  2MW8 A;  5GPC A;  3HOZ J;  4BBS J;  5F0C A;  2COB A;  4BY7 J;  2LD5 A;  3JRI A;  1POG A;  1GT0 C;  1TWA J;  2ME6 A;  2JMW A;  3BG5 A;  3FKI J;  2O8K A;  3HOY J;  4GFB A;  4G12 A;  4IHW A;  4C3J J;  1YRN B;  3C2B A;  3IH2 A;  3TW7 A;  4D5F A;  1E3O C;  1XC5 A;  5EZG A;  1Z77 A;  1ITY A;  2K9Q A;  2LY9 A;  2XGC A;  3ZQH A;  4M6V A;  4J19 A;  5C44 J;  1DU0 A;  1JT0 A;  3IH3 A;  2DMN A;  2JK3 A;  3ZQF A;  1NK2 P;  2DMP A;  4MLO A;  5F04 A;  5IYB J;  3GTL J;  4Y52 J;  2L7Z A;  1NTC A;  2ELK A;  4A69 C;  1JT6 A;  1IUF A;  5F0F A;  3A01 B;  1FEX A;  3I4N J;  1VND A;  2LR8 A;  1FIP A;  1GV2 A;  2TCT A;  4D5C A;  4V2F A;  3H3V K;  5M3F J;  5EF6 A;  1O4X A;  3QPS A;  4B4C A;  2DA4 A;  1I6H J;  3JRF A;  3GTJ J;  2X48 A;  1BJZ A;  1T56 A;  1AKH A;  4A3C J;  3BQY A;  3JRE A;  4NDL A;  3OSG A;  2HYJ A;  1UHS A;  2IEK A;  3SJM A;  2M8G X;  1OFC X;  1IC8 A;  3TP0 A;  5F0H A;  1X58 A;  2JN6 A;  2P81 A;  1ETY A;  2FD5 A;  5E3M A;  3A03 A;  2XSD C;  5F08 A;  4DZJ A;  2K9S A;  3OOU A;  4FTH A;  3HGY A;  2DA3 A;  3HGG A;  3BT9 A;  3PM1 A;  1QVT A;  5EEA A;  3GTQ J;  1X2M A;  3BG3 A;  5EYR A;  3LOC A;  4B3A A;  1HCR A;  1S7E A;  2M9H A;  1Q1V A;  4DZP A;  4BY1 J;  1EF4 A;  4C3I J;  1HDD C;  5M5W J;  3S17 J;  1WH5 A;  2DMT A;  1K83 J;  1F36 A;  1MBJ A;  1R9T J;  1MBH A;  2EZI A;  4XK4 A;  2HDD A;  2XPU A;  2JJ7 A;  2DA5 A;  2CUF A;  9ANT A;  3FK7 A;  5M5Y J;  2E1O A;  1U9N A;  2R5Y B;  1GUU A;  4B1R A;  1JKR C;  5EZH A;  2JA6 J;  2VPR A;  3HBL A;  3JR9 A;  3HKZ N;  4IEJ A;  2DTZ A;  3G1O A;  2KT0 A;  5EGO B;  3GTK J;  4XIC A;  4A93 J;  3FIS A;  3ZQC A;  3HEF A;  2EZK A;  4A3I J;  4D7N A;  1U78 A;  3WHC A;  1GDT A;  1K61 A;  1ZKG A;  1AKH B;  1T33 A;  3QQA A;  3BTL A;  2MG4 A;  5J3L A;  1MSF C;  1JKO C;  5J1Y A;  3S1Q J;  2LVS A;  2XRL A;  2LFB A;  5FLM J;  1JTY A;  3I4M J;  3GTP J;  5M3M J;  3BR0 A;  2RAE A;  1ZK8 A;  4W1U A;  2R0Q C;  3O8G A;  5IOZ A;  3HDD A;  1H88 C;  4M3G A;  3LNQ A;  2NS8 A;  1FIA A;  2XPW A;  2QF7 A;  3MVP A;  2CRG A;  2H1K A;  4V2G A;  4A3E J;  1MH4 A;  5GP9 A;  3ZOB A;  2X9D A;  2M0C A;  2HXO A;  1I50 J;  1G2H A;  1TWH J;  2EBI A;  3JRH A;  1IG7 A;  3BR2 A;  1VI0 A;  3W6V A;  3RZO J;  5GPA A;  3JRA A;  4RDU A;  2MSY A;  3IH4 A;  3VPR A;  5IPA A;  3B6C A;  2NVX J;  5FKN A;  1WGX A;  2K40 A;  1MBE A;  2EZH A;  5M5X J;  1IDZ A;  1QVU A;  3RQI A;  2EZL A;  4JX5 A;  2R93 J;  2EH3 A;  2WB1 N;  2Y9Y A;  3RZD J;  5C4X J;  4DYC A;  1WI3 A;  2L0K A;  5IP7 J;  1TWG J;  1AU7 A;  1HLV A;  3GTO J;  5EG0 A;  3MKL A;  1BA5 A;  4CYC B;  2KDZ A;  2E19 A;  5F27 A;  3BTJ A;  2TRT A;  3S2D J;  5IP6 A;  5E3N A;  3BR6 A;  2LKX A;  1B8I A;  2OF7 A;  4FE7 A;  2XGD A;  4JX4 A;  1TC3 C;  4X6A J;  3Q0V A;  1ZGW A;  3S1R J;  1FTT A;  1PUF A;  2Y31 A;  2GBY A;  4A3J J;  2XPV A;  3L1P A;  1B72 A;  4BXX J;  5FKL A;  3BTC A;  1JKQ C;  2XGE A;  3ZQI A;  2VUM J;  1ZR2 A;  3SDG A;  2HXI A;  1JJ8 C;  1A5J A;  1MH3 A;  4UUS A;  2DA2 A;  2DN0 A;  1JUP A;  2MGQ A;  1ETK A;  4A3G J;  4DYQ A;  1D5Y A;  1IRZ A;  3JRC A;  2ECB A;  2YS9 A;  2B63 J;  3E7L A;  5F1J A;  2QCO A;  3CCY A;  4FIS A;  4A3D J;  3UKG A;  1W0U A;  1JGG A;  1IDY A;  4L5E A;  4EEF G;  5IYC J;  4A3L J;  1RKT A;  3M3Y J;  3A02 A;  2K9N A;  2NVQ J;  1RR7 A;  3ZQG A;  3TW6 A;  1JUS A;  1HOM A;  2Y0S N;  2H8R A;  3OIO A;  2JA7 J;  3S1N J;  5DTD A;  1MBG A;  1WPK A;  4MFD A;  4QIW N;  3S15 J;  1ETW A;  5K7F A;  2R7Z J;  2IAI A;  5BNG A;  1ENH A;  3BR1 A;  3DEW A;  1RKW A;  1IGN A;  3K2A A;  1FTZ A;  1OJL A;  2JA5 J;  2JA8 J;  3Q3S A;  3HOW J;  5EG0 B;  2Y9Z A;  3CDL A;  1Y1W J;  1LFB A;  2R5Z A;  1F43 A;  2NS7 A;  3F0C A;  2HOS A;  3A01 A;  2CQX A;  1LFU P;  3FK6 A;  1X2N A;  2EQR A;  2Y30 A;  3GTM J;  1IV6 A;  1I3Q J;  3Q0W A;  3D1N I;  5FKM A;  2IBD A;  5FKO A;  3IV5 A;  4I76 A;  3O8H A;  1HF0 A;  2G0E A;  1ETX A;  4X1E A;  1OCP A;  3CQZ J;  5JLX A;  2D5V A;  1U9O A;  2DA6 A;  4C3H J;  5K7Z A;  1MBF A;  1B72 B;  3PO2 J;  4FE4 A;  4XID A;  4ABZ A;  2ID6 A;  3LSJ A;  2WV1 A;  4A3F J;  1ZQ3 P;  1QPI A;  4W97 A;  1VF9 A;  5IYD J;  4XRS A;  1SAN A;  3TP3 A;  2NVY J;  5JLW A;  3QPL A;  2GM4 A;  2HOA A;  4M3D A;  1JJ6 C;  2LP0 A;  4A3K J;  2HQ5 A;  1BW5 A;  4AUX A;  4AYB N;  3HB9 A;  5IOY A;  4MO7 A;  4LOC A;  4QTR A;  5K7H A;  1BW6 A;  2AO9 A;  4IHX A;  2FX0 A;  1ETV A;  3HM5 A;  4RBO A;  1RES A;  1H89 C;  5C4J J;  3HOV J;  1TWC J;  1XG1 A;  2HOT A;  1ZTR A;  2ME0 A;  1P7J A;  1AHD P;  2VKV A;  3DCF A;  3CMY A;  3BTI A;  4BKX A;  2E2I J;  1H8A C;  4Y7N J;  2YU9 J;  1UG2 A;  2I10 A;  2X6O A;  1LE8 A;  4MIM A;  5FLV A;  2E2H J;  2CJJ A;  2DMU A;  2XB5 A;  2OPT A;  1NK3 P;  3BR3 A;  3JRB A;  2R5Z B;  1Y1V J;  4IHY A;  1RET A;  5FJ8 J;  3GTG J;  3BQZ A;  2R92 J;  4JX6 A;  2L7F P;  4DW6 A;  2R5Y A;  2NOG A;  2L9R A;  3Q0U A;  4BBR J;  2VKE A;  1SFO J;  4FCY A;  3S14 J;  1A6I A;  4AC0 A;  2XB0 X;  3LSR A;  1MBK A;  2O7O A;  3H0G J;  3OSF A;  2DJN A;  1CQT A;  2CU7 A;  5IP9 J;  1IJW C;  3M4O J;  5EDN A;  4JYK A;  1VFC A;  5EGO A;  1MNM C;  2LTP A;  3SFI A;  2JWT A;  1Z0X A;  3S2H J;  2M34 A;  1WH7 A;  1MSE C;  4IHV A;  2DA1 A;  3WHB A;  2WAQ N;  2W48 A;  2ZB9 A;  1QRY A;  2DMQ A;  3GBG A;  1GV5 A;  2FJ1 A;  1WCM J;  2CQQ A;  1FJL A;  2PMZ N;  2M2E A;  1ETQ A;  4HNV A;  1BL0 A;  4XRM A;  2E2J J;  5J1U A;  3BG9 A;  2ID3 A;  2N8G A;  4A3M J;  3TED A;  2LLK A;  3HOX J;  2L7M P;  1YRN A;  1TWF J;  2NVT J;  5HOD A; 
#chains in the Genus database with same CATH topology
 2FBH A;  4M9Z A;  4PK4 A;  1WZ2 A;  2P8T A;  4HV5 A;  2QYO A;  4HF2 A;  3KFW X;  3L2W A;  3KP3 A;  1LJ9 A;  2IVM A;  2MFZ A;  3OY9 A;  1F4K A;  1G3S A;  3S16 J;  1P7I A;  5LRR A;  1Z91 A;  3B02 A;  2F5D A;  3BR5 A;  1EJ9 A;  2R7Q A;  2EA4 A;  5DS9 A;  3JRG A;  1QU3 A;  2PN6 A;  2W00 A;  3CTA A;  1B8I B;  3PO3 J;  4G8X A;  1UCR A;  2W1O A;  3GVA A;  2GLO A;  3K10 A;  4II2 A;  2HI3 A;  2AHQ A;  1U8B A;  4M6Y A;  2W82 A;  1VTN C;  2CUE A;  3RKX A;  2ZFU A;  2IS4 A;  1P4X A;  1DU6 A;  4A5M A;  4M3E A;  1S29 A;  2F48 A;  3HHH A;  2QQ8 A;  2VQC A;  1ETO A;  2IA0 A;  4BQO A;  1IRF A;  1F1Z A;  3RKQ A;  5JHF A;  2WAE A;  3KEY A;  3LSP A;  1R58 A;  4M3B A;  3ESW B;  2RQP A;  1LVA A;  3EET A;  2PJR A;  5HDN A;  3FIW A;  2O9L A;  4RA2 A;  2M0M A;  2EIJ H;  4Q47 A;  4RB3 C;  1C0W A;  3S93 A;  4Y15 A;  1XGS A;  2Y2Z A;  1FMV A;  2Q0O A;  3MN2 A;  1WQ2 A;  2UV1 A;  1VQ9 I;  4OIQ F;  3ASN H;  3CP8 A;  1F9N A;  3OYH A;  3ECO A;  3M8F A;  5DCM B;  4D7M A;  2MW8 A;  3CES A;  5GPC A;  4RM3 A;  2ZXJ A;  3DEE A;  1D0X A;  2CFO A;  2LD5 A;  3VFZ A;  3JRI A;  1S6L A;  1X4P A;  3L9F A;  1T6S A;  3BG5 A;  2ADU A;  2IP2 A;  2HWV A;  3F21 A;  3TO9 A;  1RIO H;  2STW A;  3CUQ B;  4GFB A;  4G12 A;  4BU2 A;  4C3J J;  1YRN B;  2K9M A;  3C2B A;  2PI0 A;  2B7E A;  3HRM A;  1XC5 A;  5ILS A;  5EZG A;  3TOB A;  1Z3Y A;  2EK5 A;  2DI3 A;  2OC6 A;  2LY9 A;  4M6V A;  5C44 J;  3IAS 2;  2DMP A;  2K86 A;  4OIR F;  4Y52 J;  1NTC A;  1W4M A;  2QKL B;  2H8W A;  5F0F A;  1VND A;  2LG4 A;  5HS7 A;  3BLY A;  3BOQ A;  4D5C A;  2QWW A;  1OCO H;  5EEH A;  4CYD A;  3OYF A;  2F4M B;  2L9N A;  2GXB A;  4B4C A;  1MND A;  2VKD A;  2CMP A;  3LSH A;  4M74 A;  4UB8 C;  4LB6 B;  2DA4 A;  3FDY A;  2KJC A;  3JRF A;  2VBX A;  5CQE A;  1KYW A;  3IKT A;  4HEA 2;  4G94 A;  5LEK A;  4QLC U;  2X48 A;  1NG7 A;  1T56 A;  2VT2 A;  2XF5 A;  3N05 A;  1FY7 A;  4NDL A;  3OSG A;  2HYJ A;  2M8G X;  1FOX A;  3M1C A;  3ABL H;  3TP0 A;  2WY8 Q;  1X58 A;  1Z3X A;  3PFY A;  2BZT A;  3OR2 C;  3CCM I;  1N25 A;  1KYZ A;  1WHU A;  2FD5 A;  5JR3 A;  1CF7 A;  5F08 A;  4DZJ A;  3O6B B;  3OOU A;  4HLX A;  2UWM A;  3HGG A;  2DA3 A;  3KYL A;  5EEA A;  1D8K A;  4FHT A;  3S2W A;  1X2M A;  4WWC A;  1PDN C;  1HCR A;  4B3A A;  2PX9 A;  3N4M A;  4LD5 A;  2GA1 A;  1XTA A;  1WH5 A;  3DV8 A;  4ITV A;  3HC7 A;  1F36 A;  4BHP A;  2OCC H;  1MBJ A;  3TO6 A;  4OMY A;  1X19 A;  5LLQ A;  2Z2S B;  1BN5 A;  2E7X A;  4E7I A;  4R1H A;  1W5T A;  2VN2 A;  2O6G E;  2CUF A;  2C6Y A;  5FFZ A;  1IN8 A;  4XOR A;  1D5V A;  1U9N A;  1R36 A;  4I99 C;  3TGN A;  4PCQ A;  4CA0 A;  1QPM A;  2LBF A;  2M4G A;  2VPR A;  3HBL A;  3JR9 A;  1FOY A;  5BPD A;  3KP4 A;  4IEJ A;  3F8N A;  3HL2 A;  5HVQ C;  1BBY A;  4LLG F;  3CCE I;  2KT0 A;  2K4J A;  1K4T A;  3H0D A;  3LSI A;  3I58 A;  4C2U A;  3CDI A;  1BJA A;  3H36 A;  3D5L A;  1AKH B;  3F6O A;  1ZH5 A;  3BTL A;  2MG4 A;  3LA3 A;  1JKO C;  2LVS A;  1D1A A;  1DDN A;  1T98 A;  1EH6 A;  5LD2 C;  1D3Y A;  4RS8 A;  3OIQ A;  5CVU A;  2PMZ A;  3RIR A;  3CCJ I;  1XMX A;  3QPT A;  3RTR A;  2RAE A;  1AOY A;  2R0Q C;  3DLL F;  3O8G A;  4C2T A;  3ZMS A;  3F72 A;  1FIA A;  3WTY C;  2HEO A;  2QF7 A;  3MVP A;  2FBK A;  2ZJP F;  3BG6 A;  4V2G A;  4J00 A;  4A3E J;  4HOB A;  1YIT I;  1MH4 A;  5GP9 A;  3ZOB A;  2M0C A;  2EBI A;  1OIS A;  3BR2 A;  1VI0 A;  5GPA A;  2O3F A;  3I53 A;  2MSY A;  4L9J A;  2PMH A;  4NNJ A;  4OIN F;  4WXD A;  4S05 A;  3RYR A;  3OYE A;  3VDX A;  1MBE A;  2LNB A;  1IDZ A;  1QVU A;  4HDV A;  3RQI A;  2BYV E;  5E20 A;  4JX5 A;  1YO5 C;  5KK1 A;  1OQY A;  3WTS C;  2R93 J;  4KIB A;  3RZD J;  3VSL A;  5C4X J;  4L5I A;  2LY2 A;  2CQN A;  1TZL A;  1WI3 A;  2IGK A;  2JUG A;  3I56 I;  4LG0 A;  1YE9 A;  3DKX A;  1MNE A;  4DBQ A;  2QEN A;  3MKL A;  3NWS A;  4CYC B;  1BA5 A;  3ZN1 A;  3CUO A;  4UUV A;  2GXA A;  3S2D J;  5E3N A;  1XGM A;  1VQP I;  3IWF A;  1R5I D;  1X1B A;  4BHB A;  1XDU A;  2A6E F;  3QP6 A;  1PUE E;  4S04 A;  1LB2 A;  4A0Z A;  3J80 Z;  3KZZ A;  1MZB A;  2D2W A;  4BXU A;  1PP8 F;  4PUS A;  3KYC B;  1WKM A;  2ZNZ A;  2NS0 A;  3I59 A;  4BXX J;  2RC4 A;  4E6K G;  1MJA A;  3ZQI A;  3JSP A;  3BCA A;  4LLN A;  1MH3 A;  2F2E A;  1W1W E;  4UUS A;  2A07 F;  4U88 A;  1H0M A;  4P55 A;  4I09 A;  2YSR A;  1BC8 C;  3SXY A;  3BJ6 A;  4DYQ A;  2YU3 A;  1D5Y A;  4EJT A;  2B63 J;  2XIG A;  4BGD A;  2FXA A;  1FMW A;  2QCO A;  2UXN A;  4FIS A;  1AA7 A;  2EFQ A;  1W36 D;  2E36 A;  2DW4 A;  3M8J A;  2Q2E A;  1JGG A;  2BXZ A;  2QSF X;  3K6G A;  4IHS A;  4EEF G;  5IYC J;  1RKT A;  2W25 A;  3KCC A;  3M3Y J;  4PSW A;  3TBI A;  5H6Q A;  2NVQ J;  1RR7 A;  4PJM A;  4N0B A;  2H8R A;  5KHD A;  5DTD A;  4E7K A;  1ETW A;  5K7F A;  2R7Z J;  2VOO A;  2NNN A;  3KZI C;  5BNG A;  4ZDO A;  2FRH A;  3BR1 A;  1DGW Y;  4YIF A;  2QSG X;  3MKY B;  2KKO A;  1RKW A;  1Z67 A;  1FTZ A;  4RLQ A;  3PNV A;  4U7B A;  2HYG D;  1MDM B;  5EG0 B;  1LVK A;  1Z6T A;  3KP5 A;  4ZDP A;  2R5Z A;  2HOS A;  4RMN A;  3A01 A;  2X6X A;  1LFU P;  2DXI A;  1X2N A;  5D4S A;  2EFN A;  2BW3 B;  4M71 A;  1YG2 A;  3Q0W A;  3OV8 A;  1B9M A;  4I2O A;  2VPL A;  3AG2 H;  3WTU C;  5CVV A;  2VOD A;  3H9J A;  3KIO A;  3RSN A;  2E71 A;  1U5T A;  3H35 A;  1HF0 A;  3GLL A;  1OCP A;  2G7U A;  2P7C B;  3PNT A;  2V6E A;  1IN4 A;  2D5V A;  4JBA A;  3GO5 A;  3OR1 C;  2DA6 A;  2DT6 A;  5K7Z A;  1MBF A;  3RPU D;  4XLE A;  5HOO A;  1OMI A;  4FE4 A;  3C18 A;  4XID A;  4LFU A;  2L4A A;  3LSJ A;  4LGW A;  1MW7 A;  1QPI A;  4W97 A;  2F6C A;  1VF9 A;  3A4C A;  1YIO A;  3MFK A;  5IYD J;  1X1P A;  4FX0 A;  3TP3 A;  3QYB A;  5HDK A;  3U1K A;  2F4I A;  3K1M A;  2ZNY A;  2DK8 A;  5L3C A;  3J7A Y;  2HVR A;  4GYI A;  2DQL A;  2HQ5 A;  2IS2 A;  1UJ8 A;  5KVR A;  3IRR A;  1SFU A;  1PJR A;  2XAS A;  5IOY A;  5DD4 A;  2Y0S A;  4CDG A;  2MBF A;  5K7H A;  1BW6 A;  2AO9 A;  4IHX A;  1WFX A;  4FAS D;  2ISZ A;  5A2Q K;  1RES A;  3HOV J;  1TWC J;  2M8E A;  5BS6 A;  2HOT A;  1FBQ A;  1JI8 A;  1ZTR A;  2D1V A;  2ME0 A;  1P7J A;  2KL4 A;  3K1N A;  4IOC F;  1XX5 A;  3CMY A;  5DCF A;  3JW4 A;  4HV6 A;  3HRT A;  1OCZ H;  2E2I J;  1WJD A;  4BAC A;  4E7Z A;  3CME I;  2CJJ A;  2DMU A;  2OPT A;  3AL0 C;  5DV5 A;  1K6Y A;  3JRB A;  1RET A;  5LGT A;  2V1D A;  1BOA A;  3N97 A;  2R92 J;  4XQF A;  4JX6 A;  4MNU A;  3V42 A;  4BBR J;  2L9R A;  2M7B A;  2X51 A;  5LGU A;  4XOP A;  3E6C C;  3DU6 A;  3H3U A;  1O3Q A;  4IX7 A;  5E1Z B;  1OYI A;  2E5N A;  3WE2 A;  1IJW C;  3M4O J;  3NWT A;  2ZKZ A;  2XAG A;  5JI6 A;  2VKH A;  2GA2 A;  4YFX F;  2Z33 A;  1VFC A;  4UV9 A;  4EJW A;  5EGO A;  3W2A A;  3SFI A;  3KP6 A;  3LFU A;  1Z0X A;  4WXH A;  4X0G A;  2L9S A;  4H0E A;  4U7D A;  2LKP A;  2MH2 A;  1XPX A;  3IL2 A;  5CJ9 A;  4CO8 A;  4RB2 C;  4HX8 A;  3DQV C;  4F91 B;  1P92 A;  1GV5 A;  2H94 A;  1WCM J;  4XLC A;  2OU2 A;  3V7R A;  1FBS A;  2M2E A;  3DBH B;  1IO2 A;  4P5O A;  4XR6 A;  3TDU C;  4EQQ A;  2E2J J;  3ZPL A;  2R7U A;  3BC8 A;  5E18 F;  2K9L A;  4KMF A;  2L7M P;  1IV8 A;  1ON1 A;  4PZJ A;  5L3G A;  5HOD A;  2M3A A;  1UB9 A;  1Z6R A;  2ZXW H;  3WU0 A;  3CP2 A;  3QU6 A;  1JHF A;  2LF7 A;  3ZRG A;  2KMU A;  2K02 A;  1GXQ A;  3FBN B;  1Y6I A;  1YX5 A;  4FX4 A;  2XVC A;  3VYT B;  4KN4 X;  3EUK L;  1IXS B;  1U8R A;  3HOU J;  1UEL B;  4PJJ A;  4OIO F;  2R7V A;  2X6Y A;  5LGN A;  2BXY A;  4BYY A;  4G7Z F;  3H9G A;  4UXN A;  1I1S A;  4CSW A;  2G9W A;  4A3B J;  1RPW A;  3MWM A;  4XRS G;  3J81 K;  1T39 A;  4HPQ A;  1YW8 A;  1IRG A;  3J7Z I;  2PQ8 A;  5E3L A;  1S7A A;  4Q4Z F;  2DO7 A;  4ANJ A;  2VON A;  2L02 A;  2VE9 A;  2VOP A;  2Y69 H;  1J5Y A;  4EV0 A;  5J1R A;  3FWE A;  5HLT A;  4BDY A;  4L9V A;  3SEZ A;  3CCU I;  1LUJ B;  5L3D A;  3E5U A;  2FOW A;  2CV0 A;  3HOT A;  1TNT A;  3ROU A;  1HDP A;  3AFH A;  2EJR A;  5F0C A;  2COB A;  4A6E A;  5FLX Z;  4BY7 J;  3CCL I;  3ZN0 A;  2M45 A;  3I5U A;  4I0A A;  1POG A;  1TWA J;  2ME6 A;  3E6B A;  1VQ6 I;  3QAH A;  1SFK A;  5B1A H;  2VLA A;  5H20 A;  3GWZ A;  4ZJZ A;  2AQE A;  4RAG A;  1T38 A;  4YIR X;  4IHW A;  3EYY A;  4MQ9 F;  4UVC A;  3WGG A;  1E3O C;  3MCZ A;  1FYK A;  3LA7 A;  3ZMD A;  1ITY A;  2R7D A;  4XKV A;  2Y75 A;  4EGZ A;  1QA6 A;  1DU0 A;  1S3J A;  3IH3 A;  4NUB A;  1TQP A;  3OYC A;  1YI2 I;  4MLO A;  1A6Q A;  1QZE A;  3P9C A;  3PUB A;  4HG2 A;  4IF4 A;  4A69 C;  1IUF A;  4PJN A;  1SMY F;  4BJT A;  3BZ6 A;  3KP2 A;  3WTV C;  3I4N J;  3BG7 A;  3REO A;  1O3S A;  4AM3 A;  2VXD A;  1GV2 A;  2KIQ A;  2TCT A;  1WI9 A;  4B3X A;  4V2F A;  5M3F J;  3DBR B;  1O4X A;  1YIJ I;  2CW7 A;  2PLY A;  1TT0 A;  2F5E A;  3LWF A;  2DDA A;  2KIM A;  3FXL A;  4G7O F;  2W84 A;  2FF4 A;  2DOE A;  1IW7 F;  4A3C J;  1FYM A;  4IO9 F;  2IRF G;  1SVL A;  3SJM A;  2MH9 A;  2JPC A;  3ZGK A;  1R1T A;  2W57 A;  4BHC A;  5F0H A;  3DKW A;  2HKX A;  3E5Q A;  5JFR A;  3K4J A;  4LIT A;  1ETY A;  3K70 D;  1ZGJ A;  2JVG A;  3EUH A;  2XSD C;  1SD7 A;  1XMA A;  3E1S A;  1G3W A;  4FTH A;  2HQN A;  3BT9 A;  4DJA A;  1R1U A;  3LOC A;  3BZK A;  3PFI A;  1Q1V A;  4F3Q A;  4L0Y B;  4KMU X;  2IGM A;  5D5W B;  5BPI A;  4TV7 A;  3S17 J;  4BDZ A;  3SEQ A;  2K3F A;  1K83 J;  4E7L A;  1SFE A;  2P6T A;  1ZLJ A;  5DUI A;  3MZH A;  1X3Z B;  1XGN A;  2MA3 A;  2EZI A;  1DP7 P;  4M72 A;  1GLN A;  4GO1 A;  1RRJ A;  1MD0 A;  4XK4 A;  2XPU A;  2JJ7 A;  1LDK B;  2A6T A;  4E70 A;  2OJE D;  9ANT A;  4D9J A;  2E1O A;  2L9V A;  4KIF A;  2G7H A;  3AG1 H;  2XAH A;  4IRI A;  4HBL A;  5EZH A;  2JA6 J;  2A5Y B;  3D5R C;  2ELJ A;  2ZFW A;  3W2W A;  1Q1H A;  1H9G A;  3CMA I;  1TT5 B;  3GZ6 A;  4LB5 A;  1YYV A;  1QHH D;  3H92 A;  3VWB A;  3DF8 A;  3T5X A;  3HEF A;  3CCS I;  1ZEL A;  2WAD A;  2WAQ A;  4A3I J;  1GDT A;  1D8J A;  4AIK A;  1T33 A;  2P5L C;  3I4P A;  2FU4 A;  2XUB A;  2EFO A;  5GTI C;  1A35 A;  1ZAO A;  2K85 A;  1N78 A;  2CUJ A;  1WSU A;  2NYX A;  2LFB A;  3G6E I;  5FLM J;  1KGS A;  3TMO A;  1J7K A;  1R1V A;  3OYN A;  1JTY A;  4XMY A;  4I7H A;  4N4N B;  5EEG A;  4CCL A;  3IHU A;  3BR0 A;  2XKP A;  5IOZ A;  3OYG A;  1SVM A;  1H88 C;  2MD0 A;  2A68 F;  4M3G A;  1MMN A;  4CCK A;  2NS8 A;  3O3K A;  2CYY A;  1WJA A;  4DGW B;  3CMM A;  1U2W A;  3U21 A;  2H1K A;  2KDO A;  2FNP A;  5IT9 Z;  1TLH B;  2HXO A;  5ICG A;  3H5R A;  2QKM B;  4DBR A;  3T0Y A;  3E0J B;  1DPU A;  1X1A A;  4B44 A;  1AWC A;  3B6C A;  3BCB A;  5FKN A;  3NEU A;  3A1Y A;  2K40 A;  1KQ9 A;  2H6C A;  3NRV A;  2DOD A;  2EZL A;  2WB1 N;  3ZMU A;  2ZBK A;  1XCB A;  4OAY A;  4DYC A;  3LST A;  1RZ4 A;  2OZU A;  1L3L A;  3L7W A;  3RI4 A;  3BJO A;  5IP7 J;  1AU7 A;  2CH0 A;  1R00 A;  3GTO J;  5TJJ A;  1V5E A;  2E19 A;  5F27 A;  3H5A A;  3BTJ A;  2R7X A;  3K4L A;  3L2Q A;  2X1E A;  1Z9C A;  1B8I A;  2XGD A;  3KZY A;  2LRE A;  4FQG A;  4JX4 A;  5HLI A;  3Q0V A;  2IXS A;  3ZMT A;  1ZGW A;  3S1R J;  1ACI A;  4L18 B;  3E3V A;  1K4S A;  2VT3 A;  3U2R A;  3FX3 A;  5ILU A;  3OOP A;  2XPV A;  3H1C A;  3L1P A;  1B72 A;  3BTC A;  1BR2 A;  2XGE A;  2Q8K A;  1JKQ C;  2R7F A;  2OUM A;  3HTU A;  3VOE A;  3K4N A;  5DYM A;  1L0O C;  2BVL A;  4G7H F;  1VQ8 I;  2QVO A;  1SD5 A;  2DN0 A;  2MGQ A;  1TP4 A;  4A3G J;  3T8T A;  3I9V 2;  5ILV A;  3M9A A;  1IRZ A;  4IOA F;  2YS9 A;  3E7L A;  3K1P A;  3W3C A;  3LMM A;  1FX7 A;  5DCM A;  5GAH J;  3GLX A;  3GXO A;  4UB6 C;  1FYL A;  2BY3 A;  3DPL C;  2FQ3 A;  2AS5 F;  5B66 C;  1J9I A;  1XD7 A;  4L5E A;  4A3L J;  1D0Z A;  3A02 A;  4I01 A;  2K9N A;  3V8K A;  2ZME A;  3DTK A;  3ZQG A;  3CUQ A;  1JUS A;  3FMQ A;  2BHZ A;  3LQQ A;  5BQT A;  5J47 A;  1HOM A;  2QBY B;  2JA7 J;  1WPK A;  1BI0 A;  2RGV A;  3S15 J;  3I0T A;  3OYI A;  1M1E B;  2F5V A;  2IAI A;  2DK5 A;  1O57 A;  1WRJ A;  5L3E A;  4UVA A;  4PFO A;  3K2A A;  3R6S A;  3HSF A;  3CJN A;  3Q3S A;  1G8X A;  2XSJ C;  2ZME C;  3G2B A;  1F43 A;  1R5H A;  4ZTF A;  3CC7 I;  2CW8 A;  4G6D A;  3FK6 A;  2R4G A;  2EQR A;  2Y30 A;  1IV6 A;  4WCG A;  2ZSH B;  1VQL I;  3IV5 A;  3FMS A;  3G71 I;  2DFH A;  5F6F A;  3DFG A;  4UV8 A;  3CQZ J;  1VZ0 A;  1U9O A;  4AU7 A;  4ZZD A;  3MKZ A;  2HVQ A;  4M9S A;  1XMK A;  3PO2 J;  3FF5 A;  2DQR A;  4GYG A;  4XL9 A;  2YX4 A;  2WV1 A;  4L0Z B;  1YHQ I;  5DUK A;  4B47 A;  4OAZ A;  4O5V A;  2GIZ A;  4XRS A;  5J4Y A;  1XSD A;  1FNN A;  3KET A;  1FZP B;  4ZYA A;  2OQR A;  1EH7 A;  3FBI B;  2BGC A;  2V26 A;  3LL7 A;  2HOA A;  5F64 A;  4M3D A;  3F8C A;  3K4M A;  2ESN A;  2QUF A;  1G3Y A;  5GAD J;  5J40 A;  4CCN A;  4LOC A;  4ZYD A;  2Q2E B;  4OIP F;  2CG4 A;  2KP6 A;  1Z7L A;  2FX0 A;  3HM5 A;  5DM7 F;  2XRN A;  2Z1D A;  4HX7 A;  1H89 C;  4KIS A;  2HU9 A;  3I64 A;  4I0B A;  4NC6 A;  1ZRE A;  1AHD P;  1UHW A;  2K4B A;  3FXJ A;  3BTI A;  2OTJ I;  2E7W A;  5HDG A;  1LEA A;  1H8A C;  2YU9 J;  2I10 A;  1G3T A;  3KP7 A;  2XRO A;  3AG4 H;  1LE8 A;  1LEB A;  3K2Z A;  3C2H A;  2R5Z B;  1R22 A;  2LKS A;  4A12 A;  2ELH A;  4IHY A;  5CVJ A;  1F5T A;  1SD6 A;  3RKW A;  4RB1 A;  3GCM A;  4CCJ A;  3CF5 F;  2MAB A;  3PL8 A;  3Q0U A;  4Y17 A;  1K78 A;  1X1C A;  3JAM Z;  1A6I A;  4ZZL A;  2L54 A;  1CQT A;  1MBK A;  3V7C A;  2LOO A;  3HUG A;  5DM6 F;  3OYM A;  2Z5U A;  1A04 A;  1Z1D A;  2JSC A;  4BEH A;  1REP C;  3F23 A;  2UZK A;  1MNM C;  2LTP A;  4M9X A;  4CIC A;  4ENJ A;  3RPU A;  1YOV B;  3FM5 A;  2STT A;  3S2H J;  2ZXI A;  1WH7 A;  1P6R A;  4ZC3 A;  1MSE C;  4IHV A;  2L3D A;  1K79 A;  2HQA A;  4XLH A;  1I6X A;  3PJR A;  4NQW A;  1A36 A;  2KRF A;  2JZY A;  3QYE A;  2DMQ A;  3CF2 A;  1OCR H;  2EIK H;  1UZC A;  3GBG A;  5D5U B;  4UY8 I;  2X0L A;  2RDP A;  2P7V B;  5LHH A;  2PMZ N;  4CZZ A;  3PNY A;  2JVH A;  4HNV A;  1BL0 A;  5FD5 A;  3SZG A;  4B8X A;  5J1U A;  3F6V A;  1ZN2 A;  1FOK A;  3TED A;  2KQR A;  1YS6 A;  3AL0 B;  1TWF J;  1IN5 A;  5D8L B;  2NVT J;  3OS2 A;  2VBY A;  1GVD A;  5LHI A;  3H5N A;  3K7A J;  4XON A;  2H6B A;  4C2M J;  4V19 K;  3JCU C;  1Y56 A;  4PJL A;  1BI3 A;  2JRM A;  1W7P B;  2VJ4 A;  2BEO A;  2VL8 A;  1APL C;  2FBI A;  3NAR A;  1BIB A;  3R61 A;  1LDD A;  3KYD B;  3G1M A;  4NC7 A;  2AXT C;  4JP0 A;  4MFE A;  3DEU A;  3R4K A;  3I71 A;  1TQI A;  2OV7 A;  3KEO A;  2MD5 A;  5BMZ A;  2IT0 A;  4IXA A;  3SDB A;  4HSR A;  1DQU A;  1XS9 A;  2ZJQ F;  1PYV A;  4Z2Y A;  3JSO A;  1B1B A;  1VQK I;  1JTX A;  4OMZ A;  4E7J A;  2I8D A;  2K5C A;  3NAU A;  1PUF B;  2BY1 A;  2IA1 A;  4B48 A;  4CYC A;  5CYV A;  3ZQL A;  1JUM A;  2LMD A;  5LRS A;  2BOL A;  2XAU A;  2DPD A;  2DA7 A;  2JRT A;  4QSH A;  3EYI A;  1OKR A;  2M7A A;  4KUM A;  2WAF A;  3G1L A;  1KZH A;  1KU3 A;  2CS3 A;  4MTD A;  4DYR A;  1S5L C;  2Q1Z B;  1YX3 A;  3DTI A;  4A0X A;  3B73 A;  4BE0 A;  1U5T C;  2EFW A;  1HQC A;  4YII A;  4HST A;  5DDG A;  4XN0 A;  3B6A A;  2BY0 A;  1E2X A;  4A6D A;  1Y39 A;  5HNF A;  1BIA A;  2BVM A;  1HXD A;  3AG3 H;  2QEX I;  4BQN A;  2FQ4 A;  2BHY A;  4BBS J;  2LDU A;  1QZY A;  2DJI A;  4AID A;  1IN7 A;  2P5K A;  1X3U A;  2RKH A;  2JMW A;  4XSX F;  4Q48 A;  3HOY J;  2QLZ A;  1ZG1 A;  2E34 A;  1R71 A;  1OYW A;  1XCV A;  3I55 I;  1WJC A;  3P7N A;  3TW7 A;  1GVJ A;  5J8C A;  4F93 B;  3PIP F;  2K9Q A;  4IQ4 A;  1QBJ A;  4J19 A;  4CXF A;  1QHG A;  2DMN A;  3ZQF A;  1VQN I;  1NK2 P;  2LSO A;  4I98 B;  5F04 A;  3CCQ I;  1IAW A;  4PGG A;  1ZRC A;  3GTL J;  1STZ A;  2L7Z A;  2LH9 A;  2ELK A;  2DTR A;  2V7F A;  5DD8 A;  3CCV I;  1JT6 A;  2RN7 A;  1I5Z A;  4YFK F;  2X1D A;  2E1M C;  3TOA A;  2CQK A;  1NH3 A;  2ZXH A;  2LR8 A;  2FML A;  1TBX A;  5HNH A;  1FIP A;  2DBB A;  3CDH A;  5FO5 A;  3W2V A;  1HSJ A;  3GZN B;  3HPG A;  5GAE J;  5EF6 A;  3CJQ B;  3ML6 A;  3QPS A;  1MDM A;  1VQO I;  3HSE A;  3MD2 A;  4O3M A;  3SFZ A;  5CKT A;  3WTX C;  1I6H J;  4HRI A;  5K5O A;  3WTZ A;  2HZD A;  3GTJ J;  2HPI A;  3HYI A;  3ZP5 A;  3HTS B;  2BW3 A;  2HFH A;  3J7Y J;  3PUF A;  4F55 A;  2IEK A;  4R8H A;  3JTG A;  3CLO A;  4HX4 A;  4XKC A;  1OFC X;  4A5N A;  1JE8 A;  1IC8 A;  3LSK A;  3ZCO A;  3KLN A;  1IRX A;  2GXG A;  4HQM A;  4P96 A;  2P0W A;  3ELK A;  4AYB A;  2JN6 A;  1UAA A;  1V4R A;  2JTV A;  2BBY A;  3OWT A;  2P81 A;  1BR1 A;  3DKY A;  4U0W A;  3Q9V A;  4BJ6 C;  3A03 A;  2O03 A;  2QA4 I;  2FSW A;  3PM1 A;  1RNL A;  3GTQ J;  1QVT A;  1ZG3 A;  2FOK A;  2PJP A;  3BG3 A;  4LIV A;  2W24 A;  5EYR A;  2DFF A;  1S7E A;  2M9H A;  1FT9 A;  2NOJ B;  5L3F A;  4EGY A;  4HF1 A;  4C3I J;  1G6N A;  2FUG 2;  2P6S A;  1FLI A;  2WTE A;  4J01 A;  1P4W A;  3PQK A;  1MMS A;  2L5Q A;  5HS8 A;  1R9T J;  1JXS A;  3JTH A;  3HOS A;  4UNO A;  2JSP A;  1MBH A;  4ESJ A;  1ZLK A;  3OIP A;  3ECH A;  4G6Q A;  2XF6 A;  2MC4 A;  2GOM A;  5TIS C;  3LFK A;  1BOB A;  2R5Y B;  1GUU A;  3IRQ A;  4OU0 A;  3TKY A;  2R7S A;  3HKZ N;  1O3T A;  2VBZ A;  1W7P D;  4MEY F;  1MMA A;  1HKT A;  2KJB A;  4HZF A;  3DXJ F;  2OZ6 A;  3GTK J;  4OWR B;  3FIS A;  4CCM A;  5B5E C;  4GGG A;  2KRH A;  2EZK A;  2VXZ A;  4JK1 X;  4D7N A;  2DOF A;  1W5S A;  3WHC A;  1K61 A;  4AD9 A;  2K3P A;  2V1U A;  4ZYE A;  2RNG A;  2LF8 A;  1LKX A;  4WXC A;  1MSF C;  3S1Q J;  2XRL A;  2KIF A;  1E3H A;  2Z16 A;  2V6C A;  2ISY A;  4KN7 X;  2RVC A;  3GX4 X;  1WJ5 A;  3GTP J;  2IS6 A;  4BXF A;  3J80 K;  2EV6 A;  4B09 A;  4W1U A;  1MMD A;  1HKQ A;  1DGR M;  3HDD A;  2H1L A;  4LG3 A;  4EM1 A;  2VJ5 A;  3I3L A;  3LNQ A;  4LIU A;  3HRU A;  1J0R A;  1KU2 A;  2CW0 F;  2O0Y A;  3K0L A;  1KU7 A;  1RUN A;  2XPW A;  3K9T A;  1SD4 A;  4BUP A;  2CRG A;  2HNH A;  4Y13 A;  4IJA A;  4NHJ A;  1I1G A;  3BWG A;  5FFX A;  5E1X A;  4IZZ A;  1VQM I;  3DLA A;  1VQ4 I;  3VYR B;  3EQL F;  5FB2 A;  2LY1 A;  2KIS A;  1FP2 A;  3OL3 A;  3JRH A;  3WG7 H;  1IG7 A;  3W6V A;  3RZO J;  3JRA A;  3P9K A;  3W6K B;  4RDU A;  1J59 A;  3ABM H;  3IH4 A;  3VPR A;  5IPA A;  3F3X A;  1WGX A;  4BQA A;  2OCE A;  4ESF A;  1DUX C;  5M5X J;  2PFB A;  2EH3 A;  4MQV A;  1YJW I;  4DQ2 A;  2CQ7 A;  4L9T A;  4KIC A;  4QPO A;  1HC8 A;  2L0K A;  1Y0U A;  2VC0 A;  2KZG A;  2CFX A;  4EAT A;  1IUY A;  1TWG J;  3WGH A;  2HS5 A;  3FXR A;  1U6G A;  2KHM A;  3FXO A;  3EPZ A;  2TRT A;  2KZV A;  5IP6 A;  2LKX A;  2OA4 A;  2EFP A;  4IPA A;  1B59 A;  2DFI A;  4KDP A;  2PJR B;  5D6E A;  3AAF A;  1XDS A;  3LAJ A;  1IN6 A;  3CZ6 A;  2GBY A;  2PEX A;  2R7T A;  2XDV A;  4A3J J;  2V9K A;  4JQF A;  5FRO A;  5FKL A;  3CJR B;  4GRI A;  1E0E A;  2M87 A;  2EV0 A;  4BS9 A;  1ZR2 A;  1A5J A;  2HXI A;  2DFE A;  3HXL A;  2KFD A;  3FM3 A;  3KX2 A;  1ONV A;  1HKS A;  3A2K A;  1JUP A;  3UR3 C;  2E1N A;  5H2F C;  4ENK A;  1R5G A;  4XLA A;  3M07 A;  1P4A A;  5B3S H;  3H3Z A;  2YX7 A;  4YRV A;  1YJN I;  2RQQ A;  3EUH C;  4U0V A;  3CCY A;  4A3D J;  5LHG A;  3UKG A;  5D5X B;  5ICE A;  1IDY A;  4BE1 A;  1ZYR F;  4PDK A;  1IXC A;  1NHA A;  3TW6 A;  2VQG A;  4K2E A;  3QOP A;  3VYU B;  1BI1 A;  4QIW N;  1MBG A;  2IGO A;  4BL0 B;  5LFA A;  3FKJ A;  3ZXS A;  4ZDL A;  4HF0 A;  2PG4 A;  4BJ5 C;  1Y8Q B;  1ENH A;  2IPQ X;  3F8B A;  3DEW A;  5D6F A;  1T8I A;  1FPQ A;  2GAU A;  1W5C C;  1V54 H;  2JA8 J;  3HOW J;  3CDL A;  2DPU A;  2ZJR F;  4U87 A;  2CUZ A;  4AVZ A;  3T1B A;  3RKY A;  3F0C A;  4DNC A;  1KQ0 A;  4AVP A;  3CC2 I;  3FXQ A;  1V5F A;  2XGX A;  2XAF A;  3C3W A;  3IC7 A;  3MAJ A;  1VQ7 I;  3GTM J;  1I3Q J;  3D1N I;  1ZRD A;  4L5J A;  3S32 A;  2X6W A;  5FKO A;  3G73 A;  3VOD A;  4KIT B;  1KA8 A;  3LAP A;  4I76 A;  2DU9 A;  3O8H A;  3QOD A;  2G0E A;  1ETX A;  1USS A;  1KON A;  4X1E A;  2M5W A;  1BR4 A;  2ZSI B;  3G3Z A;  4IRH A;  3T8R A;  2AQF A;  2R3S A;  2GZW A;  2AXL A;  2HYF A;  5ICF A;  1B72 B;  1PP7 U;  3GME A;  4ABZ A;  2ID6 A;  4A3F J;  1O7L A;  1CF7 B;  2E60 A;  2XAQ A;  4AIJ A;  2H27 A;  2DLL A;  1LFP A;  1HST A;  3OYB A;  3D5S C;  3VYS B;  5KNL A;  2NVY J;  5JLW A;  3F9K A;  2GM4 A;  1S7O A;  4YEJ A;  2RRE A;  1JJ6 C;  4A3K J;  2L4M A;  3ZQ7 A;  3ZR8 X;  1KQ8 A;  2HGC A;  4AUX A;  5K5Q A;  1TNS A;  2BE5 F;  2WA0 A;  3HB9 A;  4HQE A;  2IW5 A;  3BP8 A;  3P5J A;  4CUG A;  3BPX A;  3V4G A;  3ERE D;  1SVO A;  4IKF A;  1ETV A;  4P9U A;  1OLT A;  2ZME B;  1ZRF A;  1WVR A;  4GXO A;  1XG1 A;  2P5V A;  1YS7 A;  2D45 A;  2VKV A;  4EVI A;  5K5R A;  3DCF A;  1R49 A;  1K6O A;  5J6X A;  2CSO A;  2LBF B;  5J8F A;  3GFJ A;  4Y7N J;  2F5C A;  1UG2 A;  2X6O A;  3GFI A;  3OYL A;  2XV4 S;  2QZ8 A;  2PBI A;  2XB5 A;  4KJZ A;  3BR3 A;  5BOX A;  1J09 A;  1EKE A;  1Y1V J;  4KYW A;  3NQO A;  3S8P A;  3RJP A;  4ON0 A;  4FET A;  4XLP F;  3IWZ A;  4DIQ A;  1YJ9 I;  2Z9O A;  3D0S A;  4IL6 C;  1XGO A;  4FCY A;  3FXM A;  1TW3 A;  3OSF A;  2O7O A;  2CU7 A;  3WU2 C;  2GWR A;  2K7L A;  4F7Z A;  5IP9 J;  2B9S A;  3V8L A;  3AKZ A;  4JYK A;  2IGN A;  1FP1 D;  1TTY A;  2Y0M A;  3J7A O;  2R7O A;  3WTT C;  2BY2 A;  2XAJ A;  2FA5 A;  1MMG A;  1FC3 A;  3S3N A;  4HNU A;  2E5Z A;  2E1C A;  2NRA C;  3KE2 A;  2IA2 A;  2DA1 A;  3F22 A;  2VBW A;  2EIM H;  3WHB A;  2WAQ N;  4EMS A;  1UHM A;  4IHT A;  1YFH A;  1QRY A;  4FT8 A;  3WE3 A;  4F92 B;  3E6M A;  3ABT A;  3MKW B;  2FNA A;  3GW2 A;  4Y3O A;  3WU1 B;  4PFP A;  4RAY A;  3Q9S A;  2WC2 A;  1FSH A;  3F8M A;  5A2Q Z;  2HR3 A;  2ACJ A;  1ETQ A;  3R60 A;  4WK8 F;  2DYS H;  2ID3 A;  2CV2 A;  2NNY A;  1HW5 A;  4N9I A;  3S3O A;  5FLX K;  3HOX J;  1YRN A;  1WWX A;  2RV8 A;  3PSF A;  5FKK A;  2A3S A;  3DPT A;  4XLN F;  2MLK A;  3VEP A;  5IY5 H;  4AIH A;  2W4S A;  1EV7 A;  1BI2 A;  2LK2 A;  2L7K A;  4P9F A;  4XNF A;  2EA2 A;  1P9Q C;  3GFL A;  1IZ1 A;  4LK1 F;  4LG0 B;  3L2U A;  2YUS A;  2JQ7 A;  1ERD A;  1W0T A;  3CUQ C;  1LE8 B;  1HW1 A;  1O7F A;  5KCM A;  3RYP A;  1G4D A;  2RNJ A;  4EJO A;  3ABU A;  4RAZ A;  1UMQ A;  4L9N A;  3S3M A;  2MC3 A;  3LSG A;  4RGU A;  3QP5 A;  5IT3 A;  5D4R A;  2W7N A;  1I27 A;  3BY6 A;  1R7J A;  5E3O A;  5C3E J;  1X1D A;  1U3E M;  3ULQ B;  4S0H B;  1ORK A;  4RB0 A;  1E17 A;  4CGZ A;  1A31 A;  1XSX A;  1K78 B;  4D0P A;  3QU3 A;  4CHU A;  4LMY A;  2VI6 A;  3HUG B;  2YR2 A;  3IUO A;  3MMY B;  2J5P A;  1YW9 A;  4IVN A;  4NBQ A;  4BEH B;  1OCT C;  3CC4 I;  4WF2 A;  1DP3 A;  3U1D A;  3I59 B;  1R6R A;  1X4O A;  2J5O A;  3ZQQ A;  2CGP A;  4CZC A;  4I6Z A;  2HDC A;  3Q5F A;  2O5R A;  4UUS B;  3S1M J;  4A2U A;  4RM2 A;  4KNY A;  3DU5 A;  4UUT A;  3JRD A;  1ZR4 A;  2ECC A;  2OTL I;  3FZV A;  4GDF A;  1N75 A;  4LLL A;  4D1Q A;  1T0F A;  2YPR A;  5E17 F;  4M3F A;  4NQW B;  1JHH A;  3OMY A;  4QWQ A;  1YW7 A;  2WBM A;  3CD6 I;  4MGR A;  3ISP A;  1JKP C;  2FMY A;  3HOZ J;  1B9N A;  4PSX A;  2DAO A;  3WOD F;  3CLQ A;  5FD6 A;  1GT0 C;  3U9G A;  4RGS A;  3FKI J;  1MJB A;  2Z99 A;  2O8K A;  4ZH4 F;  4KT5 C;  4IRG A;  3QRF F;  3CO7 C;  1T0F C;  1WJE A;  2M30 A;  3HIF A;  3IH2 A;  4D5F A;  1R4M B;  4XBF A;  1MJ9 A;  4HDU A;  1Z77 A;  1W36 C;  4ETS A;  3C2G A;  2XGC A;  3ZQH A;  3CO6 C;  2VQL A;  3K69 A;  2WV0 A;  1JT0 A;  2VE8 A;  1IXR C;  2JK3 A;  3E97 A;  3VSK A;  2XC7 A;  5IYB J;  2MLG A;  3F8F A;  2OQG A;  4KIG A;  3A01 B;  2QBY A;  3SZP A;  1FEX A;  3GEZ A;  1EH8 A;  2X85 A;  3V7S A;  3CJT B;  1B4A A;  5D8K B;  4LK0 F;  5KAI C;  1TQM A;  4C30 A;  3L00 A;  3J81 Z;  4HAM A;  3H3V K;  3WG9 A;  1RR8 C;  4IQJ A;  1B6A A;  1U5T B;  4U0Y A;  5H6R A;  1N77 A;  5CVR A;  2VIX A;  3VB2 A;  1JGS A;  3E5X A;  3IKV A;  5CVI A;  2E35 A;  4M6X A;  1O3R A;  1BJZ A;  4MTE A;  1NG6 A;  5J4V A;  3BQY A;  3GUD A;  2LYC A;  1D1B A;  3JRE A;  1AKH A;  1UHS A;  4A0Y A;  1V5G A;  1ZHF A;  3TO7 A;  4E7S A;  4UVB A;  4B43 A;  3OYK A;  2DT7 B;  4BNC A;  2I5U A;  2W85 A;  3HJE A;  4ZTJ A;  3QWL A;  1V3F A;  4OOI A;  4G6T B;  2QSH X;  5E3M A;  1IF1 A;  2HZT A;  2K9S A;  3HGY A;  2PMU A;  3WTW C;  1U0J A;  3MZY A;  3GFM A;  5ICC A;  4BY1 J;  3KLO A;  4DZP A;  1EF4 A;  2IS1 A;  1HDD C;  2UUZ A;  2Y48 A;  5GTH C;  5M5W J;  2DMT A;  2E1M B;  3LQR A;  4CH7 A;  1D1C A;  2KLO A;  3HZJ A;  5AON A;  4M73 A;  5IT9 K;  2QM3 A;  4QPQ A;  3COA C;  2OD5 A;  4ESB A;  1LPQ A;  2HDD A;  1OCC H;  3BJA A;  1P2F A;  2F4O B;  2HQR A;  2DA5 A;  2EIN H;  3I54 A;  3FK7 A;  3P9I A;  4BQQ A;  5M5Y J;  3IAM 2;  1OPC A;  2MYS A;  3L2V A;  4B1R A;  1JKR C;  1XN7 A;  2ZO4 A;  4BE2 A;  5E79 C;  2DTZ A;  3G1O A;  2NXN B;  5FRM A;  2P4W A;  5EGO B;  5ERI A;  3R0J A;  4XIC A;  4A93 J;  4CCO A;  2DDB A;  5E8I A;  1SC7 A;  1I3A A;  5FGM A;  3ZQC A;  4MEX F;  3IP4 B;  3ASO H;  3K4C A;  1WJF A;  1U78 A;  2KIU A;  1ZKG A;  3FXK A;  2VAS A;  3ABK H;  3QQA A;  4HLY A;  5J3L A;  4XM3 A;  2KPM A;  5J1Y A;  3A0B C;  2ZJ2 A;  5K1Y A;  3UNG C;  1QNT A;  4II3 A;  2NVU B;  1X3W B;  5L3B A;  3I4M J;  1S8N A;  2V9P A;  2DYR H;  3HG9 A;  5M3M J;  1RUO A;  4ENN A;  2B0L A;  3TL4 X;  1S72 I;  1ZK8 A;  2HKO A;  2L2O A;  1HBX G;  1OR7 A;  3QPH A;  1LNW A;  3DPU A;  3FHN A;  3ZMZ A;  5TRD A;  2A05 A;  5HLG A;  1UST A;  2Z3Y A;  1G59 A;  2TDX A;  4PJ0 C;  1ZAR A;  1I39 A;  3KPH A;  4N9H A;  2X9D A;  1G2H A;  1EA3 A;  1I50 J;  5JHU A;  1YTY A;  1TWH J;  3GF2 A;  2JPB A;  1OR7 C;  1SAX A;  2NVX J;  3DBL B;  1V55 H;  3PIO F;  4ZYG A;  4E4H A;  2EV5 A;  1ZGA A;  4YFN F;  2EZH A;  3HPH A;  2WWY A;  3QOE A;  2Y9Y A;  4XOT A;  1R23 A;  2V4J C;  3HKZ A;  1SMT A;  4O6J A;  2VQH A;  3LA2 A;  4XRF A;  2FE3 A;  3SQN A;  1HLV A;  2CWE A;  2OBP A;  3OL4 A;  3SHF A;  3MZ8 A;  5EG0 A;  1W7P A;  1Z05 A;  3MQ0 A;  2JA2 A;  1KU9 A;  2KDZ A;  2IJL A;  1S9H A;  2JUC A;  3A0H C;  3HSR A;  4EJU A;  3BR6 A;  2F5F A;  2OF7 A;  4FE7 A;  2ETH A;  4HA8 A;  2V9V A;  3PSI A;  4KT6 A;  3FHZ A;  1TC3 C;  4X6A J;  1HA8 A;  2V1N A;  1R4N B;  1SAU A;  4NB5 A;  3TQN A;  3RQ4 A;  3SYT A;  1FTT A;  1PUF A;  2Y31 A;  3DTE A;  5AIQ A;  3SZT A;  5JVT A;  1RI7 A;  4RAF A;  2GQQ A;  3X2Q H;  2VUM J;  3SDG A;  1JJ8 C;  2O8X A;  4Y33 A;  4NC8 A;  2DA2 A;  5TGT A;  2HTJ A;  1FBU A;  3BRO A;  1H9T A;  1T08 B;  1LQ1 A;  1ETK A;  4KFC A;  3OS0 A;  5CPR B;  4XLF A;  2V79 A;  1TW2 A;  4XKW A;  2DOA A;  3L2R A;  3JRC A;  1ON2 A;  2ECB A;  5B1B H;  2HVS A;  4BH9 A;  5F1J A;  1XSV A;  3HHG A;  2O61 A;  1T95 A;  1J2X A;  1W0U A;  4R79 A;  2QQ9 A;  3EDP A;  4MHG A;  4JOM A;  2XHK A;  3ERM A;  1QZZ A;  1RC9 A;  2D1H A;  4UHT A;  4YEL A;  3RPQ A;  3G4S I;  2Y0S N;  1ZG5 A;  4E7H A;  3OIO A;  4EM0 B;  5HLH A;  3S1N J;  4MFD A;  4XSZ F;  1YLF A;  2JT1 A;  2QQB A;  4EJV A;  3M7G A;  5JVG F;  1J75 A;  1IGN A;  3HRS A;  1OJL A;  2X1C A;  3DP7 A;  2JA5 J;  2K27 A;  2L01 A;  4HNT A;  3BDD A;  1DPR A;  4P1W A;  5E1W A;  2Y9Z A;  3LSM A;  3DWL E;  4DOZ A;  1Y1W J;  1LFB A;  2NS7 A;  4Y4R A;  2QGU A;  3K4B A;  2CQX A;  3O2P E;  2HPM A;  5E8G A;  4G9Y A;  2ESH A;  1CGP A;  2HDW A;  5HS9 A;  3R0A A;  3C7J A;  1GXP A;  5FKM A;  2IBD A;  3BPV A;  1SFX A;  3OYJ A;  1Z21 A;  4Z6Y A;  2HOE A;  2M1B A;  2GIV A;  1YQA A;  2ICW G;  5JLX A;  3CCR I;  2UXX A;  3FXU A;  4H4K C;  3PQJ A;  4EM2 A;  1FWZ A;  3JAM K;  3GZ5 A;  1SEU A;  3W6J B;  4C3H J;  2A6H F;  1Y0N A;  2NAZ A;  4Q5S F;  4ENM A;  2EB7 A;  1T2K A;  3RCO A;  1ZQ3 P;  2VB6 A;  4HW0 A;  1ULY A;  2LC2 A;  1BM9 A;  3H9Q A;  2VJJ A;  2R7W A;  3OYD A;  1SAN A;  2X4H A;  6PAX A;  3QPL A;  2OAZ A;  5ED4 A;  2EPF A;  1Z7U A;  2LP0 A;  3WGI A;  1UFM A;  2HTS A;  3L09 A;  3K70 C;  4AWX B;  4ZYH A;  5GAG J;  3RDI A;  1BW5 A;  5FRN A;  4AYB N;  3E6D A;  1OYY A;  5LEJ A;  4LJZ F;  1TL8 A;  4MO7 A;  2R7R A;  2XKO A;  3ONQ A;  1GHC A;  4QTR A;  4PGH A;  2V1X A;  1QGP A;  4RBO A;  2CV1 A;  2DT5 A;  5C4J J;  2A69 F;  5LBQ A;  2XF7 A;  4ASN A;  2EIL H;  2FEZ A;  4BKX A;  5D5V B;  5DEQ A;  2KRC A;  1XB4 A;  2QQA A;  3MEX A;  3QYF A;  4YG2 F;  4RGR A;  4MIM A;  5FLV A;  2E2H J;  5KAF C;  1VQ5 I;  1FSE A;  1LDJ A;  3OS1 A;  3TDZ C;  3KEQ A;  1NK3 P;  2ZC2 A;  2COM A;  4I02 A;  1MIJ A;  1D0Y A;  2LRD A;  3C1D A;  4F52 A;  5FJ8 J;  4HYE A;  3GTG J;  3K4K A;  2DCE A;  1UG0 A;  3BQZ A;  2L7F P;  4N4O B;  4DW6 A;  2NOG A;  2R5Y A;  3EUA A;  3M8E A;  5F1R A;  2VKE A;  1SFO J;  1K7A A;  3S14 J;  4AC0 A;  3LSR A;  2XB0 X;  4C9Y A;  1BC7 C;  3H0G J;  2DJN A;  5EJC A;  4BAY A;  3L2C A;  2GOX B;  1FOW A;  5EDN A;  4GCV A;  3GYH X;  4WX9 A;  2VJI A;  1MGT A;  1PVE A;  2JWT A;  4KA4 A;  2M34 A;  2BV6 A;  2A5W A;  3ZMV A;  5AIP A;  3FMR A;  2H09 A;  5CQG A;  5CLS A;  4RLF A;  2EWN A;  1QO0 D;  2VC1 A;  2W48 A;  2ZB9 A;  1E3P A;  1MKM A;  3BZC A;  2WY7 Q;  1ODD A;  3V8J A;  2FJ1 A;  2CQQ A;  1FJL A;  1Y8R B;  2A61 A;  1QQI A;  4XKB A;  4RGX A;  3M1E A;  4XN3 A;  4XRM A;  1WJB A;  3BG9 A;  3OYA A;  2N8G A;  4A3M J;  2WB1 A;  2ZCW A;  2LLK A;  2CO5 A;  1HW2 A;  2M4K A; 
#chains in the Genus database with same CATH homology
 5FKK A;  1GVD A;  2LK2 A;  3K7A J;  4C2M J;  2YUS A;  3S16 J;  1P7I A;  1W0T A;  1APL C;  1LE8 B;  3NAR A;  3BR5 A;  1UMQ A;  5DS9 A;  3JRG A;  3HOU J;  3G1M A;  3LSG A;  4JP0 A;  4MFE A;  1B8I B;  3PO3 J;  5E3O A;  5C3E J;  2GLO A;  4S0H B;  2HI3 A;  1ORK A;  2AHQ A;  1U8B A;  1XS9 A;  2CUE A;  2VI6 A;  4A3B J;  1JTX A;  1RPW A;  1DU6 A;  3NAU A;  4XRS G;  1PUF B;  4M3E A;  4CYC A;  1OCT C;  3ZQL A;  5E3L A;  1JUM A;  1ETO A;  3RKQ A;  2DA7 A;  4QSH A;  4I6Z A;  3G1L A;  4UUS B;  4DYR A;  3LSP A;  3S1M J;  4M3B A;  4UUT A;  3FIW A;  3JRD A;  2O9L A;  1ZR4 A;  2ECC A;  5J1R A;  2Y2Z A;  3B6A A;  3MN2 A;  4M3F A;  1JKP C;  2FQ4 A;  1HDP A;  4D7M A;  2MW8 A;  5GPC A;  3HOZ J;  4BBS J;  5F0C A;  2COB A;  4BY7 J;  2LD5 A;  3JRI A;  1POG A;  1GT0 C;  1TWA J;  2ME6 A;  2JMW A;  3BG5 A;  3FKI J;  2O8K A;  3HOY J;  4GFB A;  4G12 A;  4IHW A;  4C3J J;  1YRN B;  3C2B A;  3IH2 A;  3TW7 A;  4D5F A;  1E3O C;  1XC5 A;  5EZG A;  1Z77 A;  1ITY A;  2K9Q A;  2LY9 A;  2XGC A;  3ZQH A;  4M6V A;  4J19 A;  5C44 J;  1DU0 A;  1JT0 A;  3IH3 A;  2DMN A;  2JK3 A;  3ZQF A;  1NK2 P;  2DMP A;  4MLO A;  5F04 A;  5IYB J;  3GTL J;  4Y52 J;  2L7Z A;  1NTC A;  2ELK A;  4A69 C;  1JT6 A;  1IUF A;  5F0F A;  3A01 B;  1FEX A;  3I4N J;  1VND A;  2LR8 A;  1FIP A;  1GV2 A;  2TCT A;  4D5C A;  4V2F A;  3H3V K;  5M3F J;  5EF6 A;  1O4X A;  3QPS A;  4B4C A;  2DA4 A;  1I6H J;  3JRF A;  3GTJ J;  2X48 A;  1BJZ A;  1T56 A;  1AKH A;  4A3C J;  3BQY A;  3JRE A;  4NDL A;  3OSG A;  2HYJ A;  1UHS A;  2IEK A;  3SJM A;  2M8G X;  1OFC X;  1IC8 A;  3TP0 A;  5F0H A;  1X58 A;  2JN6 A;  2P81 A;  1ETY A;  2FD5 A;  5E3M A;  3A03 A;  2XSD C;  5F08 A;  4DZJ A;  2K9S A;  3OOU A;  4FTH A;  3HGY A;  2DA3 A;  3HGG A;  3BT9 A;  3PM1 A;  1QVT A;  5EEA A;  3GTQ J;  1X2M A;  3BG3 A;  5EYR A;  3LOC A;  4B3A A;  1HCR A;  1S7E A;  2M9H A;  1Q1V A;  4DZP A;  4BY1 J;  1EF4 A;  4C3I J;  1HDD C;  5M5W J;  3S17 J;  1WH5 A;  2DMT A;  1K83 J;  1F36 A;  1MBJ A;  1R9T J;  1MBH A;  2EZI A;  4XK4 A;  2HDD A;  2XPU A;  2JJ7 A;  2DA5 A;  2CUF A;  9ANT A;  3FK7 A;  5M5Y J;  2E1O A;  1U9N A;  2R5Y B;  1GUU A;  4B1R A;  1JKR C;  5EZH A;  2JA6 J;  2VPR A;  3HBL A;  3JR9 A;  3HKZ N;  4IEJ A;  2DTZ A;  3G1O A;  2KT0 A;  5EGO B;  3GTK J;  4XIC A;  4A93 J;  3FIS A;  3ZQC A;  3HEF A;  2EZK A;  4A3I J;  4D7N A;  1U78 A;  3WHC A;  1GDT A;  1K61 A;  1ZKG A;  1AKH B;  1T33 A;  3QQA A;  3BTL A;  2MG4 A;  5J3L A;  1MSF C;  1JKO C;  5J1Y A;  3S1Q J;  2LVS A;  2XRL A;  2LFB A;  5FLM J;  1JTY A;  3I4M J;  3GTP J;  5M3M J;  3BR0 A;  2RAE A;  1ZK8 A;  4W1U A;  2R0Q C;  3O8G A;  5IOZ A;  3HDD A;  1H88 C;  4M3G A;  3LNQ A;  2NS8 A;  1FIA A;  2XPW A;  2QF7 A;  3MVP A;  2CRG A;  2H1K A;  4V2G A;  4A3E J;  1MH4 A;  5GP9 A;  3ZOB A;  2X9D A;  2M0C A;  2HXO A;  1I50 J;  1G2H A;  1TWH J;  2EBI A;  3JRH A;  1IG7 A;  3BR2 A;  1VI0 A;  3W6V A;  3RZO J;  5GPA A;  3JRA A;  4RDU A;  2MSY A;  3IH4 A;  3VPR A;  5IPA A;  3B6C A;  2NVX J;  5FKN A;  1WGX A;  2K40 A;  1MBE A;  2EZH A;  5M5X J;  1IDZ A;  1QVU A;  3RQI A;  2EZL A;  4JX5 A;  2R93 J;  2EH3 A;  2WB1 N;  2Y9Y A;  3RZD J;  5C4X J;  4DYC A;  1WI3 A;  2L0K A;  5IP7 J;  1TWG J;  1AU7 A;  1HLV A;  3GTO J;  5EG0 A;  3MKL A;  1BA5 A;  4CYC B;  2KDZ A;  2E19 A;  5F27 A;  3BTJ A;  2TRT A;  3S2D J;  5IP6 A;  5E3N A;  3BR6 A;  2LKX A;  1B8I A;  2OF7 A;  4FE7 A;  2XGD A;  4JX4 A;  1TC3 C;  4X6A J;  3Q0V A;  1ZGW A;  3S1R J;  1FTT A;  1PUF A;  2Y31 A;  2GBY A;  4A3J J;  2XPV A;  3L1P A;  1B72 A;  4BXX J;  5FKL A;  3BTC A;  1JKQ C;  2XGE A;  3ZQI A;  2VUM J;  1ZR2 A;  3SDG A;  2HXI A;  1JJ8 C;  1A5J A;  1MH3 A;  4UUS A;  2DA2 A;  2DN0 A;  1JUP A;  2MGQ A;  1ETK A;  4A3G J;  4DYQ A;  1D5Y A;  1IRZ A;  3JRC A;  2ECB A;  2YS9 A;  2B63 J;  3E7L A;  5F1J A;  2QCO A;  3CCY A;  4FIS A;  4A3D J;  3UKG A;  1W0U A;  1JGG A;  1IDY A;  4L5E A;  4EEF G;  5IYC J;  4A3L J;  1RKT A;  3M3Y J;  3A02 A;  2K9N A;  2NVQ J;  1RR7 A;  3ZQG A;  3TW6 A;  1JUS A;  1HOM A;  2Y0S N;  2H8R A;  3OIO A;  2JA7 J;  3S1N J;  5DTD A;  1MBG A;  1WPK A;  4MFD A;  4QIW N;  3S15 J;  1ETW A;  5K7F A;  2R7Z J;  2IAI A;  5BNG A;  1ENH A;  3BR1 A;  3DEW A;  1RKW A;  1IGN A;  3K2A A;  1FTZ A;  1OJL A;  2JA5 J;  2JA8 J;  3Q3S A;  3HOW J;  5EG0 B;  2Y9Z A;  3CDL A;  1Y1W J;  1LFB A;  2R5Z A;  1F43 A;  2NS7 A;  3F0C A;  2HOS A;  3A01 A;  2CQX A;  1LFU P;  3FK6 A;  1X2N A;  2EQR A;  2Y30 A;  3GTM J;  1IV6 A;  1I3Q J;  3Q0W A;  3D1N I;  5FKM A;  2IBD A;  5FKO A;  3IV5 A;  4I76 A;  3O8H A;  1HF0 A;  2G0E A;  1ETX A;  4X1E A;  1OCP A;  3CQZ J;  5JLX A;  2D5V A;  1U9O A;  2DA6 A;  4C3H J;  5K7Z A;  1MBF A;  1B72 B;  3PO2 J;  4FE4 A;  4XID A;  4ABZ A;  2ID6 A;  3LSJ A;  2WV1 A;  4A3F J;  1ZQ3 P;  1QPI A;  4W97 A;  1VF9 A;  5IYD J;  4XRS A;  1SAN A;  3TP3 A;  2NVY J;  5JLW A;  3QPL A;  2GM4 A;  2HOA A;  4M3D A;  1JJ6 C;  2LP0 A;  4A3K J;  2HQ5 A;  1BW5 A;  4AUX A;  4AYB N;  3HB9 A;  5IOY A;  4MO7 A;  4LOC A;  4QTR A;  5K7H A;  1BW6 A;  2AO9 A;  4IHX A;  2FX0 A;  1ETV A;  3HM5 A;  4RBO A;  1RES A;  1H89 C;  5C4J J;  3HOV J;  1TWC J;  1XG1 A;  2HOT A;  1ZTR A;  2ME0 A;  1P7J A;  1AHD P;  2VKV A;  3DCF A;  3CMY A;  3BTI A;  4BKX A;  2E2I J;  1H8A C;  4Y7N J;  2YU9 J;  1UG2 A;  2I10 A;  2X6O A;  1LE8 A;  4MIM A;  5FLV A;  2E2H J;  2CJJ A;  2DMU A;  2XB5 A;  2OPT A;  1NK3 P;  3BR3 A;  3JRB A;  2R5Z B;  1Y1V J;  4IHY A;  1RET A;  5FJ8 J;  3GTG J;  3BQZ A;  2R92 J;  4JX6 A;  2L7F P;  4DW6 A;  2R5Y A;  2NOG A;  2L9R A;  3Q0U A;  4BBR J;  2VKE A;  1SFO J;  4FCY A;  3S14 J;  1A6I A;  4AC0 A;  2XB0 X;  3LSR A;  1MBK A;  2O7O A;  3H0G J;  3OSF A;  2DJN A;  1CQT A;  2CU7 A;  5IP9 J;  1IJW C;  3M4O J;  5EDN A;  4JYK A;  1VFC A;  5EGO A;  1MNM C;  2LTP A;  3SFI A;  2JWT A;  1Z0X A;  3S2H J;  2M34 A;  1WH7 A;  1MSE C;  4IHV A;  2DA1 A;  3WHB A;  2WAQ N;  2W48 A;  2ZB9 A;  1QRY A;  2DMQ A;  3GBG A;  1GV5 A;  2FJ1 A;  1WCM J;  2CQQ A;  1FJL A;  2PMZ N;  2M2E A;  1ETQ A;  4HNV A;  1BL0 A;  4XRM A;  2E2J J;  5J1U A;  3BG9 A;  2ID3 A;  2N8G A;  4A3M J;  3TED A;  2LLK A;  3HOX J;  2L7M P;  1YRN A;  1TWF J;  2NVT J;  5HOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...