2LP0A

The solution structure of homeodomain-protein complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
60
structure length
60
Chain Sequence
TRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein Hox-C9
publication title Structural basis for homeodomain recognition by the cell-cycle regulator Geminin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 19
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2012-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lp0A00
1ZGWA 2E19A 3S15J 3BQZA 4A3KJ 2CQQA 1YRNB 1AU7A 1FJLA 3HOWJ 2R7ZJ 1GVDA 5E3OA 1W0TA 3M4OJ 3FK7A 1HDDC 2DMQA 5F27A 3BTIA 2JA6J 3BG3A 2YUSA 2MG4A 3HKZN 5DS9A 1NK3P 1MSFC 2XPUA 5IYBJ 2EZLA 2NVQJ 1ETKA 2HXIA 5E3MA 3LSRA 3I4MJ 1MBGA 5IP9J 5IOZA 1GV2A 5FKLA 4A69C 1JUSA 1ZKGA 5M3MJ 5HODA 3C2BA 3HDDA 2R5ZA 5K7ZA 3H0GJ 3F0CA 2X48A 3BQYA 2VKEA 2ME6A 5J1RA 4BBRJ 4CYCA 1HDPA 4RBOA 5M5WJ 4HNVA 2YU9J 3Q0WA 3BR6A 2DA4A 4MIMA 4X1EA 1IV6A 1H88C 3GTGJ 3OSGA 1RR7A 3BR2A 3D1NI 3Q3SA 5GP9A 3G1LA 2LTPA 1ETWA 2R5YB 1Y1WJ 3S1QJ 1QRYA 4A3DJ 4MFEA 2P81A 2H8RA 1IC8A 4M3EA 2WV1A 4JX4A 5EG0A 1ZK8A 1U8BA 5JLWA 4I76A 1K83J 2FD5A 2E2HJ 2XPVA 4AC0A 3DEWA 1F36A 2ECBA 4C2MJ 3A01B 1BW5A 1JT6A 3LSJA 1ZR4A 1JJ8C 1MH3A 1IDYA 2PMZN 4ABZA 2WAQN 5F0FA 2R5ZB 2EZKA 1K61A 2GM4A 5IYCJ 2K9NA 1VFCA 2IAIA 5E3LA 3HGGA 3OOUA 1TWCJ 1ORKA 1WGXA 2R92J 2E1OA 5DTDA 2AO9A 4M3FA 1JTYA 2COBA 4AUXA 3MN2A 1HF0A 2GBYA 1CQTA 3DCFA 5K7FA 2RAEA 2O7OA 4XRSG 2QCOA 2FX0A 3O8GA 4RDUA 1WH5A 1JGGA 1Q1VA 3B6AA 4A3GJ 2D5VA 5C4XJ 2TRTA 2VI6A 2DA6A 5GPCA 2AHQA 4A3BJ 2M9HA 2JWTA 3RQIA 4BY1J 2CJJA 3K2AA 3CQZJ 3ZQHA 5EGOA 3BR5A 1FEXA 1JUPA 1QVTA 2NOGA 4A3MJ 2K9SA 4BKXA 3TP0A 1LFBA 3JRGA 1HOMA 4DYCA 4V2FA 1TWGJ 3HM5A 1A6IA 3LOCA 4D5CA 4A93J 1MBHA 3JRIA 5BNGA 3FK6A 3VPRA 3RZDJ 2KT0A 3GTLJ 4V2GA 3G1OA 3A02A 3TP3A 2NS7A 5JLXA 5IP6A 1FIPA 3M3YJ 3FISA 1X2MA 2O8KA 1ZR2A 2R5YA 4A3FJ 5EGOB 2DJNA 1MBEA 1TC3C 2Y31A 2R93J 1JUMA 2DA2A 5F0CA 3B6CA 2XGDA 4IHVA 4FE7A 3K7AJ 2EZHA 3IV5A 2Y30A 3JR9A 5IYDJ 2LFBA 2X9DA 4UUTA 3A01A 3GBGA 1BJZA 4A3LJ 3QPSA 2MW8A 4M6VA 2JJ7A 5C3EJ 3CMYA 2XB0X 5M3FJ 3ZQIA 1FIAA 2LVSA 2HYJA 3BTJA 5EZGA 3ZQLA 2GLOA 9ANTA 2EH3A 2ECCA 4DW6A 4DZPA 3PO2J 1VI0A 4IHYA 3RKQA 2JK3A 3QQAA 3MKLA 2ID6A 5FLMJ 2R0QC 2HXOA 2NVTJ 1Z0XA 2E2JJ 3BR1A 1JKQC 2DMTA 1MNMC 3W6VA 4MLOA 1U78A 1HLVA 1IRZA 5FKKA 5J1UA 1H89C 2XRLA 3HOYJ 1ENHA 1X2NA 1Z77A 1ETOA 3S1RJ 1G2HA 3O8HA 1NTCA 4X6AJ 1DU0A 1TWAJ 1ETVA 2M34A 3FKIJ 1RETA 5IPAA 5FKMA 2LK2A 1WH7A 3WHCA 5FJ8J 5F1JA 3OSFA 2JA8J 1I6HJ 1X58A 2Y9YA 1XS9A 4A3CJ 2K40A 2JA7J 1LFUP 4A3IJ 1ETXA 3TW6A 3GTPJ 1ZTRA 2EBIA 2DMUA 3NARA 4FE4A 5EYRA 1WCMJ 3LNQA 2VUMJ 4JX6A 3ZOBA 1MBFA 2MGQA 4S0HB 1QVUA 4W97A 3WHBA 3LSGA 1JT0A 2ME0A 5FKNA 2HOSA 2HOAA 3BTLA 3G1MA 4JX5A 4M3BA 4XRSA 1B72B 1OCTC 1U9NA 2IEKA 1RPWA 3S14J 2DMNA 1P7JA 4D7MA 3NAUA 1A5JA 1PUFA 5E3NA 2O9LA 1GDTA 4XICA 4C3IJ 4QTRA 3JRAA 4XRMA 1OFCX 5M5XJ 1ITYA 2E2IJ 3GTOJ 2CUEA 1BW6A 3BT9A 2I10A 1RESA 2G0EA 2LKXA 1JKOC 2NVYJ 2LR8A 3HBLA 3HOXJ 1TWFJ 1IJWC 3BG5A 3PM1A 4AYBN 4Y7NJ 1LE8B 3H3VK 2M8GX 2HQ5A 2HDDA 3Q0UA 4L5EA 1B8IB 5IP7J 4FCYA 2HOTA 5J3LA 2QF7A 3MVPA 4NDLA 2CU7A 2ID3A 3JRDA 4W1UA 4EEFG 1H8AC 2VPRA 4M3GA 3TW7A 3GTQJ 5C44J 3CCYA 2EQRA 1TWHJ 2B63J 4IEJA 4BXXJ 1PUFB 3SDGA 3SJMA 1WPKA 2L9RA 3GTMJ 1ETYA 2LY9A 4A3JJ 4FISA 3JRCA 1RKWA 3IH4A 1GT0C 1XG1A 4IHXA 2LP0A 3S2HJ 4A3EJ 2K9QA 2LLKA 2IBDA 3HOUJ 1AKHA 1Y1VJ 3BR3A 5K7HA 4FTHA 3UKGA 1S7EA 5F08A 2M2EA 5F0HA 1MBKA 3S1MJ 1IDZA 3JRBA 4B3AA 5F04A 4DYQA 3ZQFA 1IUFA 1JKRC 4XIDA 2XPWA 3S2DJ 2L7MP 3E7LA 1GV5A 3BTCA 2ZB9A 3FIWA 2EZIA 1MBJA 1QPIA 3I4NJ 3GTJJ 1O4XA 1NK2P 2JN6A 4J19A 4B4CA 2FJ1A 3HEFA 2XGEA 4G12A 4QSHA 4UUSB 1B72A 1UMQA 3JREA 3S1NJ 1FTTA 2W48A 3GTKJ 1JKPC 1JJ6C 1AKHB 2DA5A 4B1RA 1JTXA 2OF7A 5GPAA 1E3OC 1APLC 1T33A 4MO7A 1IG7A 4D7NA 2Y0SN 2JMWA 2MSYA 3HOVJ 1SANA 2M0CA 1BL0A 4C3HJ 4DZJA 1HCRA 2KDZA 1F43A 1LE8A 1I3QJ 3SFIA 2L7FP 1AHDP 1OJLA 3HB9A 1POGA 3HOZJ 1B8IA 2JA5J 1U9OA 4Y52J 4MFDA 1GUUA 5C4JJ 3JRFA 2Y9ZA 4CYCB 2H1KA 4GFBA 2DMPA 2DA7A 1ZQ3P 3BG9A 3BR0A 2CUFA 5J1YA 4BY7J 3PO3J 4JYKA 5FKOA 4M3DA 2Y2ZA 1R9TJ 2HI3A 2TCTA 4DYRA 4I6ZA 2DTZA 1VF9A 2L0KA 2XB5A 1MH4A 1UG2A 3OIOA 1MSEC 1I50J 4C3JJ 2CQXA 5EG0B 3CDLA 2NS8A 2FQ4A 5M5YJ 2DN0A 3Q0VA 3JRHA 1YRNA 3HGYA 2LD5A 4JP0A 1IGNA 3RZOJ 2OPTA 4QIWN 3L1PA 3S16J 1EF4A 1SFOJ 1DU6A 1UHSA 5EF6A 3A03A 3ZQGA 1ETQA 1RKTA 1VNDA 2YS9A 4BBSJ 2CRGA 2N8GA 1P7IA 5EZHA 2XSDC 5EDNA 2ELKA 1OCPA 3ZQCA 1WI3A 1XC5A 2DA1A 3IH3A 4LOCA 1W0UA 1FTZA 2WB1N 5EEAA 3LSPA 4IHWA 4XK4A 2X6OA 3S17J 5IOYA 5FLVA 3QPLA 3TEDA 2VKVA 3IH2A 1BA5A 2NVXJ 4D5FA 1D5YA 2XGCA 1T56A 2L7ZA 4UUSA 2DA3A
chains in the Genus database with same CATH superfamily
5H6RA 3WG9A 1TT5B 2CQQA 3D5LA 1R7JA 2VQGA 5HLIA 4NC6A 4EVIA 3HIFA 3J7ZI 3HHGA 2QUFA 2XAUA 2DQRA 5CVJA 5E3OA 1W0TA 1HDDC 2IT0A 2DMQA 4ZTFA 1WQ2A 3GZ6A 3LSIA 2VLAA 2XPUA 5B1BH 2QWWA 5IYBJ 3KCCA 3KLOA 2HEOA 1AA7A 1ETKA 4RB1A 1MMAA 1O57A 5E3MA 2XAQA 3BJAA 2V9VA 1GV2A 4R8HA 3HYIA 1JUSA 5GTHC 5M3MJ 4HDVA 4HQMA 2ZO4A 3QRFF 4IKFA 2VJ4A 4A6EA 2L4AA 3ZMTA 4LG0B 4CYCA 5M5WJ 5DD4A 2DPDA 3Q0WA 2UV1A 3OYIA 2DA4A 4L9JA 1GHCA 4H4KC 4MQ9F 4MIMA 1IV6A 3GTGJ 4MEYF 3IWFA 3Q3SA 2R5YB 1ETWA 5FFXA 3PNYA 3T5XA 3TGNA 3VYTB 4A3DJ 2KRFA 2C6YA 1IC8A 1T08B 4LMYA 3SHFA 2EV0A 2E71A 1K83J 2FD5A 3DTKA 4CCMA 4RB3C 2PMZA 4C2MJ 3LQQA 2L9NA 5KCMA 1TZLA 2WAQA 5KAIC 3L2WA 1QGPA 3QP6A 4IHSA 1TTYA 2HFHA 3GFIA 1K61A 2O03A 4HX7A 4IO9F 1JHFA 3K10A 3C3WA 5E3LA 3HTSB 1TWCJ 3AG4H 1WGXA 2K7LA 4JQFA 2ESNA 2ESHA 3JTHA 3RIRA 4AUXA 4BE2A 1MD0A 1XSVA 2FOWA 2QLZA 3FMSA 1Y39A 1WJEA 1QZZA 4RAYA 5HDGA 2R7WA 1ZELA 2A6TA 3L7WA 2A05A 2O7OA 1Y8RB 4DQ2A 1I3AA 1WH5A 2RKHA 2VT2A 4OU0A 5TGTA 2EWNA 2LREA 4OOIA 3RCOA 3IKVA 3RQIA 4BY1J 2R4GA 3S3MA 2VXDA 3K2AA 2CFXA 1DPUA 4HBLA 1V54H 2DXIA 5HLTA 1JUPA 4CH7A 2EINH 1V3FA 3CCMI 4ESBA 2BY3A 5JI6A 3OR1C 3VDXA 1XX5A 2OCEA 3F72A 4O3MA 2BXYA 2QENA 4ENMA 1B9MA 2HQRA 3HM5A 2AQEA 2V79A 3GLLA 1BI1A 5DM6F 3PNVA 3JRIA 3FK6A 5L3BA 2IA2A 1SEUA 2ZSIB 3W3CA 2GZWA 3A02A 1XTAA 4HLXA 1Z3YA 5JLXA 2L7KA 4IQJA 5IP6A 3HSRA 1PUEE 5GAGJ 3E3VA 1K78B 3ZN1A 4N0BA 1ON2A 1L0OC 1S9HA 4OAYA 3WTUC 1IN4A 2CO5A 1IAWA 1MNDA 2R5YA 2JUCA 2W84A 1XDUA 5DUKA 2HYFA 4KISA 3GWZA 1IV8A 3CJNA 3Q5FA 2GXBA 5F0CA 3B6CA 2HYGD 4IHVA 2ZXIA 2EZHA 1OLTA 1RZ4A 3OYNA 3PQJA 1UFMA 5ERIA 1BJZA 1B1BA 1Z05A 4PGGA 2DFHA 2MW8A 2F4MB 5CPRB 1QPMA 2JJ7A 1O3QA 4HNTA 1ERDA 2EFNA 3K9TA 4HV5A 5D4SA 2LC2A 3S8PA 2XB0X 5FRNA 5B5EC 1D0YA 2V1UA 2LVSA 2BW3A 1MJBA 3UR3C 5ICGA 4F92B 1S7AA 1SD7A 1E3PA 5HS8A 3ZMUA 1B59A 2DQLA 2YX7A 3A0BC 3RTRA 4DW6A 4DBQA 4IHYA 3RKQA 3WGIA 2H8WA 2QM3A 3QQAA 3LAPA 1YIJI 1E3HA 5LBQA 4CCKA 1S8NA 5FLMJ 1MMSA 2A69F 1Z0XA 2CWEA 4HF0A 3W6VA 1J0RA 3KP7A 4NB5A 2XAFA 2FNPA 5FKKA 2MD5A 2FU4A 4Y3OA 1H89C 1X4PA 3ELKA 2XRLA 1J59A 2R7VA 4LK0F 1W7PB 2E35A 1QQIA 2WBMA 5FD5A 2DT6A 2OC6A 4X6AJ 1VTNC 4E7IA 1TWAJ 3MFKA 1ETVA 1X1PA 2VL8A 1X3ZB 4A6DA 1YW9A 5IPAA 3HPHA 1SMTA 3WHCA 3PUBA 2CYYA 4KJZA 5FJ8J 5F1JA 2JA8J 4RAZA 2Y9YA 2CW0F 3CZ6A 3KYCB 4KDPA 2VBZA 1WVRA 2QGUA 2O6GE 4FE4A 2DMUA 3PSFA 1F4KA 4BXUA 2JUGA 2HWVA 3ZOBA 3BDDA 2YR2A 4WXCA 2L2OA 4FHTA 4S0HB 3I59B 1MDMA 1WHUA 3ULQB 1R1VA 5FO5A 3F8FA 1JT0A 3KPHA 2ME0A 1A35A 2E5NA 2HOAA 2BOLA 3BTLA 3G1MA 1G4DA 1K78A 2CV1A 2XKPA 4HYEA 1OCTC 1U9NA 3L00A 2HDCA 1K6YA 2GXAA 2DMNA 1P7JA 3VYUB 5LRRA 3OL4A 1T0FC 4D7MA 2ZCWA 2H1LA 4ZYDA 1N78A 1R5ID 1D0XA 2W85A 2IPQX 2OQRA 1R49A 3TMOA 3BT9A 4LB6B 4XKWA 3KIOA 2K85A 2G0EA 4B43A 3DBHB 5KVRA 2QA4I 2XGXA 2X1EA 1KONA 3W2AA 4E4HA 3CCVI 1VQLI 4R79A 4O5VA 1LE8B 1TWFJ 3BG5A 5F64A 3H3VK 2M0MA 3MCZA 4EMSA 2HQ5A 5E1ZB 4FCYA 5E1WA 2QF7A 3DF8A 3MVPA 3FBNB 4LITA 1SD6A 2K02A 3JRDA 4W1UA 4EEFG 1H8AC 2DCEA 3D0SA 2NNNA 3CMAI 3R4KA 2OCCH 2OQGA 4IEJA 3L2QA 3LL7A 4UVBA 1WPKA 2L9RA 2KQRA 2UZKA 1ETYA 4GDFA 4ZZDA 1IRFA 3V7SA 4A3JJ 2KJBA 2DFFA 5LEKA 4CSWA 2LRDA 3BJ6A 4IHXA 5D8KB 4LD5A 3ZCOA 3DWLE 4Y13A 3S2HJ 2DT5A 2LOOA 3AL0C 2F6CA 4KT5C 2DT7B 2G9WA 1AKHA 3K1NA 2HQNA 3F6VA 5K7HA 3SFZA 4AWXB 1S7EA 2M2EA 5BPIA 3P9CA 1MBKA 4I98B 5GAEJ 2PEXA 3JRBA 2L54A 4B3AA 4HV6A 5F04A 4F52A 5ICEA 1IUFA 4XIDA 2ZNZA 3CO7C 2HR3A 2P7CB 3CCEI 1Y0UA 2MLKA 2EK5A 4G6TB 3O3KA 1WJBA 2EZIA 3I4NJ 2LYCA 1C0WA 2ZSHB 1HW1A 2IS1A 1G3SA 2O3FA 3I59A 3KEYA 4Y4RA 2ZXWH 2OD5A 2ETHA 3ABMH 3HEFA 2X1CA 4BDYA 4QSHA 1Z9CA 3AAFA 4Q47A 4Q48A 1FTTA 4YFNF 1UAAA 2CQKA 1JJ6C 1I6XA 4B1RA 4U0WA 1EH8A 2IP2A 4A2UA 3SYTA 2BY2A 4C9YA 5BS6A 2O5RA 4O6JA 5E1XA 4DGWB 1UZCA 3I58A 2BBYA 4LJZF 4D7NA 3DKXA 1IF1A 3R0AA 1VQ6I 1TP4A 3O6BB 4EJUA 1MGTA 2M0CA 1D8KA 5EEHA 4CYDA 1QZEA 1LB2A 1LNWA 1FY7A 2VBWA 1LE8A 2FBKA 1I3QJ 2FOKA 4OIOF 2L7FP 1AHDP 5TRDA 1POGA 3HOZJ 1IXCA 4I09A 1LPQA 1LUJB 4C2TA 2XF5A 4RMNA 5LGNA 1T95A 4CCNA 3KE2A 4TV7A 3ZN0A 2DMPA 2DA7A 2EFWA 1ZQ3P 2WWYA 2CUFA 2PMHA 1FX7A 1UCRA 4A0ZA 2VT3A 3K4NA 4BY7J 3BWGA 2JQ7A 2QSGX 1PYVA 2A5YB 3L2CA 5HS9A 2PI0A 1FP1D 2XB5A 4UV8A 1WJFA 5J4YA 1YI2I 5ICFA 5LRSA 2CQXA 1CGPA 4BYYA 2MH2A 4B47A 2JZYA 4R1HA 1LDDA 5CYVA 4U87A 1XGOA 3G2BA 1IGNA 1W1WE 4E7HA 2HGCA 3MMYB 1SFOJ 1DU6A 1ETQA 1OYYA 1RKTA 4S04A 2CRGA 3QPTA 5KHDA 2WB1A 4N9HA 5EZHA 2FUG2 4KIFA 4HSRA 3GVAA 3ZQCA 2KISA 1WI3A 1XC5A 2DA1A 3BG6A 3IH3A 3RJPA 3M8JA 2B7EA 3JW4A 5EEAA 3DKWA 1FNNA 2F4OB 5FLVA 3BG7A 2ICWG 4HDUA 4YEJA 3IH2A 1U3EM 3BZ6A 3IRRA 2UUZA 5FGMA 1T56A 2W00A 1D3YA 2KZVA 3HRMA 1TL8A 3W2WA 1ZGWA 3BQZA 3FKJA 1YRNB 2LMDA 4HF1A 1V5GA 1AU7A 1FJLA 4WWCA 4BH9A 2R7ZJ 4BL0B 1GVDA 1EH6A 4L9NA 3BG3A 4XN0A 2QQ9A 3HKZN 1X4OA 4F7ZA 2Q2EB 5DS9A 1P2FA 3M1EA 3TOAA 2NVQJ 2HXIA 2VBYA 1SD4A 1YX5A 2FBIA 3FZVA 1QNTA 4JBAA 1KA8A 5IOZA 4DNCA 5ED4A 3I4MJ 4RM3A 3G71I 1X1BA 1ZKGA 1WJAA 4AIHA 3BCBA 5A2QK 5HS7A 1A31A 2R5ZA 1KU2A 3H0GJ 2NYXA 3BPXA 3G4SI 3F0CA 4ZDPA 2FMYA 4C2UA 3BQYA 3SZTA 5J1RA 1REPC 1SAXA 3FXQA 1UG0A 4M72A 4HNVA 2YU9J 3JSOA 1HW2A 3CCSI 1H88C 1MKMA 1O7FA 4LG3A 5AIPA 1RR7A 2JSCA 3D1NI 1EA3A 3ZP5A 3OSGA 2ZFWA 5GP9A 2Y0SA 1Y1WJ 4MFEA 3TBIA 4YIFA 2PLYA 2Z3YA 1U5TB 4M3EA 1R5HA 3K4MA 3LA2A 3FXRA 1ZK8A 2YU3A 4I76A 2E2HJ 4AC0A 4BHCA 1F36A 2K9MA 4YELA 3A01B 3K69A 1BW5A 3PFYA 1VQMI 4RM2A 2E36A 5E8GA 3WODF 5K5RA 4A12A 5IYCJ 3IUOA 2IAIA 2VN2A 3DQVC 5HNFA 3DEEA 4YRVA 2DK8A 1ORKA 4XR6A 1YO5C 3S2WA 1JGSA 1U8RA 3OMYA 4BQQA 1U2WA 1HF0A 2R7OA 2G7HA 2RAEA 4ZDLA 2DTRA 2FX0A 2H6CA 2JT1A 3CMMA 4ZC3A 1KQ9A 4EJWA 3O8GA 5H2FC 3LMMA 2VBXA 1PVEA 2IGKA 3B6AA 3FMQA 4ENNA 2F5FA 4I7HA 3DPLC 2TRTA 1CF7A 1X1DA 2VI6A 2HVSA 1DGWY 4IRIA 5GPCA 4IJAA 2AHQA 3TQNA 2CG4A 1R5GA 3FWEA 3ZXSA 4PJNA 2CV0A 3P5JA 3TO6A 3S93A 3VEPA 3ZQHA 4U7DA 5L3GA 5EGOA 1OPCA 4FQGA 2JPBA 3OYFA 2VODA 2Q2EA 4UXNA 1MIJA 3K1MA 4V2FA 3NWTA 2COMA 2GOMA 3W6JB 4RLQA 1FC3A 4EJTA 1S6LA 4D5CA 4A93J 1MBHA 1W7PD 5BNGA 3RZDJ 3GTLJ 2O0YA 2YSRA 3GYHX 1QHHD 1TQMA 2NS7A 5ILSA 1V5FA 2KMUA 4XLEA 1FIPA 3M3YJ 3KZYA 1WZ2A 3DLLF 1B6AA 4XL9A 2O8KA 2LH9A 3H3ZA 3C2HA 2DJNA 2ZKZA 1MBEA 3FM5A 1TC3C 3JTGA 4IX7A 4ITVA 1U5TA 4KNYA 4HQEA 2F4IA 2NRAC 3K7AJ 3N97A 5JVGF 1W5CC 2DK5A 2Y30A 1DP7P 3U2RA 2OUMA 4UUTA 3A01A 2L5QA 2ZJ2A 3LSTA 4A3LJ 5CVRA 1N25A 1YX3A 4M6VA 3J80Z 3KZZA 3E6DA 3A2KA 1BJAA 3KZIC 1XMKA 3TO7A 4BXFA 1MMDA 2MBFA 1YS6A 3OYGA 2JRTA 3BTJA 3ONQA 3EETA 3ZQLA 3BCAA 1S3JA 9ANTA 2FRHA 1ZRFA 1Y0NA 2BZTA 2Y69H 1QHGA 2HOEA 4DZPA 4KYWA 3PO2J 4IVNA 4XLHA 3QODA 2PX9A 2JK3A 2WY7Q 3MKLA 1R1UA 2PFBA 2RGVA 5ILUA 2XAGA 2R0QC 2HXOA 1FYLA 3E5QA 5KAFC 4M6YA 1HLVA 4II2A 4XLCA 3ZQQA 1P4WA 1FOYA 1LEBA 5KK1A 1ENHA 4YIIA 1X2NA 3I64A 2D1HA 1ETOA 2MABA 4BHPA 1R23A 2I5UA 3QPHA 5TISC 1G2HA 5LHHA 4UHTA 2FF4A 2M34A 4ENKA 4KIBA 1GLNA 1RETA 2NVUB 4X0GA 5FKMA 4CCLA 2BW3B 1YFHA 1YJNI 5JHFA 1J7KA 1EKEA 3CUQA 1OR7A 4RGRA 1ZRCA 1XPXA 4G7OF 3REOA 1VZ0A 2K40A 3FF5A 1LDJA 2KIMA 1ETXA 3E97A 4PDKA 3TW6A 4A3IJ 4BE1A 2DOEA 5EYRA 4BQOA 4YFXF 2VUMJ 4JX6A 2LY1A 2AS5F 3DBRB 2AXTC 1FMWA 1E17A 3I54A 3FXUA 3WHBA 3IAS2 3LSKA 4KMUX 2D45A 2HOSA 3VWBA 3ESWB 1X3UA 4ESFA 3KYDB 4L5IA 4M3BA 4ZYGA 1RUNA 1RPWA 1ZN2A 4C30A 3MZYA 3NAUA 1A5JA 2RNJA 1BR1A 1R22A 1BI3A 1HKSA 5E3NA 1OYWA 2X51A 2ZMEA 3K0LA 3K6GA 5TJJA 2Y75A 4XLPF 2A3SA 3SXYA 5M5XJ 2E2IJ 2RV8A 3WTTC 2VJ5A 3KP2A 1BR4A 4L9VA 1VQNI 1RESA 4PSWA 4UNOA 2LKXA 1YOVB 2YX4A 3FXJA 1KQ0A 3BZKA 1WRJA 2GQQA 1IJWC 3AG1H 3PM1A 3RYRA 2J5PA 2EPFA 4I02A 3Q9VA 2O8XA 4L5EA 2EV6A 1MDMB 5IP7J 2HOTA 2CGPA 4NDLA 2CU7A 3PFIA 2R3SA 3V7RA 3ABLH 4IPAA 3P7NA 5C44J 1H9GA 2HU9A 3JAMZ 1STZA 2EQRA 1ZG3A 3KX2A 2B63J 2A07F 4HA8A 1FBUA 2KDOA 3H5NA 4YFKF 1O3RA 4BXXJ 2CMPA 2VQCA 3F8BA 1MMGA 1YE9A 4BEHA 3FHZA 2OZUA 4BQAA 4M74A 3JRCA 2XASA 4JOMA 4PJ0C 1Z1DA 4U88A 3IH4A 4OIRF 2QKMB 1ONVA 1XG1A 4U0YA 3E6CC 4DJAA 1SVMA 4N9IA 2K9QA 2IBDA 3RKWA 3BR3A 1RRJA 1NHAA 4AIJA 3ERMA 5F08A 3T1BA 2QZ8A 2XROA 4BJTA 2V9PA 3GUDA 5HLHA 1G3TA 1P4XA 1QO0D 3S3NA 3OY9A 1JKRC 2XPWA 4FT8A 1QA6A 3BTCA 2M5WA 2PN6A 2ZB9A 1ZGJA 1J75A 3I9V2 1B9NA 3GTJJ 2MA3A 3HRTA 1EV7A 2R7XA 1VQKI 3WGHA 2FSWA 3ERED 2FJ1A 2XGEA 3A0HC 1UMQA 4XKBA 4CHUA 3HC7A 2ELJA 3WTYC 2XAJA 2W48A 4LIUA 3GXOA 1X1AA 3RSNA 1AKHB 2K3PA 2OF7A 4D1QA 4Q4ZF 1IG7A 1UJ8A 2EA2A 4NBQA 1SFUA 2WTEA 2BGCA 4MTEA 5DCFA 2YPRA 1VQ7I 4KFCA 1BR2A 4C3HJ 4DZJA 4S05A 3HSFA 1HKTA 4L0ZB 1HCRA 3EUHC 1G6NA 1Z7UA 1HSJA 2P8TA 3RPQA 5B1AH 2F5CA 3D5SC 3HB9A 4UY8I 6PAXA 1YLFA 4Q5SF 2F5DA 3HJEA 1IZ1A 2GAUA 2L9VA 5CVVA 3SEZA 4EM2A 5C4JJ 3V8JA 5DUIA 2Y9ZA 1HQCA 4XRFA 2VASA 4RGSA 4LB5A 2B0LA 3PO3J 2BHYA 3M8EA 2Y2ZA 5BMZA 2I8DA 2DTZA 1FMVA 1VF9A 4FASD 4I6ZA 2DAOA 5ICCA 4ZYAA 1RI7A 5GAHJ 2XDVA 4C3JJ 1T6SA 2KFDA 2R7SA 2RQPA 5EG0B 3CDLA 2EFQA 2EJRA 4FX0A 3BY6A 4AYBA 4U7BA 3HGYA 3GZ5A 3QAHA 2JSPA 4QIWN 3L1PA 1EF4A 2CUJA 3S16J 2P6SA 4N4NB 1IRGA 3EYYA 4MEXF 3DV8A 1TNSA 3A03A 4ENJA 2HKOA 3ZQGA 3C1DA 1R00A 4BBSJ 2IXSA 2WV0A 4DBRA 3F9KA 2ELKA 3VB2A 3DU6A 1OCPA 1KZHA 5JHUA 1EH7A 1A04A 1X19A 3LSPA 2ZFUA 4IHWA 2K4BA 2JVHA 5IOYA 3TDZC 3QPLA 1ON1A 4BDZA 1IN5A 1MMNA 3SZPA 1I39A 5KNLA 4I99C 2IVMA 2L7ZA 3DP7A 2HKXA 3W2VA 1RIOH 2E19A 2IS4A 5K1YA 4A3KJ 2BHZA 3X2QH 1MJAA 3CC4I 2JA2A 3KP3A 2HNHA 5F6FA 3M4OJ 5HVQC 2OBPA 4CZCA 5E8IA 2WA0A 3BTIA 2V6CA 4XN3A 2LBFB 3WG7H 2F5VA 2HPMA 1D5VA 1QBJA 4RB0A 5FROA 1MSFC 2OZ6A 2EZLA 1ZH5A 3DBLB 2VJJA 4HSTA 1MBGA 4ZH4F 5IP9J 5FFZA 2XSJC 1L3LA 2Y48A 1JHHA 5HODA 3C2BA 4Y17A 2BV6A 3F6OA 3HDDA 1KU7A 4PSXA 2Q1ZB 2VKEA 2RQQA 3FDYA 2ME6A 3PJRA 5HNHA 1SMYF 4BNCA 4MTDA 4RBOA 2ADUA 4IF4A 3BR6A 3MQ0A 2WC2A 4X1EA 4WX9A 1LVKA 3OYCA 1YG2A 3LSHA 3SDBA 2M4GA 1QRYA 2LNBA 2P81A 3TO9A 1H9TA 3CESA 1BC8C 5EG0A 1U8BA 5JLWA 3DLAA 5DDGA 1U5TC 2P5VA 1IN7A 3R0JA 1YJ9I 3BOQA 3DEWA 1JI8A 3ASNH 4QWQA 1Y6IA 4P5OA 3VYSB 1JJ8C 1MH3A 4XSXF 1IDYA 2LSOA 5B3SH 4ABZA 2E1CA 1RNLA 5F0FA 1ZG1A 2R5ZB 3GMEA 2GM4A 4RB2C 1HXDA 4UUVA 1VFCA 2MC4A 3GLXA 3HGGA 3SZGA 3OS2A 2XF7A 3KETA 2R92J 2BVMA 2XHKA 2E1OA 5DTDA 2AO9A 2IA1A 1JXSA 2J5OA 4M3FA 2COBA 3MN2A 4MHGA 3HSEA 2DBBA 3H1CA 1BIBA 1MW7A 2GBYA 2VQHA 4XBFA 5K7FA 2VB6A 4XRSG 2QCOA 3PL8A 2JVGA 3F8CA 4LGWA 5H6QA 4RDUA 1JGGA 1MNEA 1OCZH 1Q1VA 3OIPA 5D6EA 4A3GJ 5C4XJ 1W4MA 2NXNB 2D5VA 3I55I 4HEA2 1J9IA 2X6WA 2HTSA 2DA6A 4QPQA 2OAZA 3LSMA 4A3BJ 2JWTA 3JSPA 3KP5A 1HKQA 1FEXA 1XGNA 2JTVA 1QVTA 1IN8A 2LBFA 3RYPA 2H94A 2BY1A 2QSHX 4BKXA 4OWRB 3OYKA 1LFBA 3KEQA 3CJRB 2MH9A 3VFZA 2BVLA 3QYEA 4DYCA 2PJRB 1TWGJ 4OIPF 1N77A 4XSZF 5IT9Z 1Z91A 4AVZA 2DW4A 4A0XA 3K4KA 1A6IA 1BI0A 3LOCA 2VC1A 1IXSB 2VOOA 3U1DA 3GFLA 3VPRA 3A1YA 2KT0A 3K2ZA 4XKCA 1FPQA 3BJOA 3G1OA 2Y0MA 2Z5UA 1S29A 4JK1X 1ZHFA 3E0JB 1K7AA 3CDHA 1CF7B 4ZYEA 3FISA 5CQEA 1KYZA 1Z67A 1X2MA 2E1MB 3N05A 1ZR2A 2OTLI 2IS2A 1OKRA 4LLLA 4A3FJ 5DEQA 2VC0A 1MJ9A 5EGOB 2QEXI 3WU1B 4HX8A 2PJPA 4XOTA 3OYAA 2R93J 2DA2A 2Z16A 4FE7A 3IV5A 1K79A 4CCOA 3DXJF 5J6XA 1I27A 4KITB 2X9DA 1F1ZA 3QPSA 2X6YA 4ZDOA 4I0BA 3HUGA 3CMYA 4KT6A 2H09A 3HTUA 1W5SA 1R58A 3R60A 3OYBA 2V7FA 5M3FJ 3ZQIA 3IWZA 3OV8A 4RAGA 4NQWB 5EZGA 2GLOA 3LA3A 3CD6I 3MAJA 2EH3A 2ECCA 3TDUC 4XQFA 3RI4A 2KZGA 4G94A 4G6DA 4M6XA 1H0MA 4Z6YA 4IHTA 3JCUC 4ESJA 2E2JJ 2NVTJ 3BR1A 2XC7A 2DMTA 1MNMC 4MLOA 1Z3XA 2DOAA 2KHMA 4EATA 3IP4B 1IRZA 3SQNA 4H0EA 4WXHA 5J1UA 3M7GA 1T0FA 2RNGA 3HOYJ 4PCQA 2CUZA 3CLQA 2MC3A 5BPDA 1YTYA 3S1RJ 3ZGKA 2MFZA 2OJED 1DU0A 5FB2A 1VQ5I 2GWRA 4CDGA 4IOCF 3WU2C 3FX3A 2PJRA 2KIFA 1SFXA 2PQ8A 4KA4A 3OSFA 1I6HJ 1QU3A 4YIRX 2IW5A 2W57A 3BC8A 4HF2A 3U21A 3ZMVA 1LFUP 2JA7J 2QVOA 3GTPJ 1ZTRA 3NARA 1WCMJ 4UVCA 1T38A 5E17F 2DFIA 2HVQA 5ILVA 5GTIC 3G73A 2ACJA 1QVUA 5J40A 5HDNA 1YS7A 5FKNA 3T8RA 4DIQA 2EB7A 1SFEA 4XRSA 1B72B 1FOWA 5J8FA 1RC9A 2IEKA 1KQ8A 1VQ9I 4N4OB 4KN7X 3IL2A 3S14J 3IAM2 3VODA 1PUFA 5JR3A 3QYBA 2DYRH 1DDNA 1GDTA 1ULYA 3ML6A 4XICA 1WSUA 4NUBA 4QTRA 1D1CA 2DLLA 4XRMA 1OFCX 2M4KA 4AU7A 4NC7A 2VE8A 1ACIA 2QSFX 2CUEA 1ODDA 1BW6A 2KLOA 2EIJH 3CUQB 3RPUA 4IRGA 3GFMA 5FD6A 3CCQI 1GXPA 3K1PA 2X1DA 4U0VA 3CLOA 2X0LA 4PJMA 2DODA 2HDWA 3GZNB 1IRXA 3HOXJ 3HL2A 2EFOA 2HTJA 2A6EF 4V19K 2IJLA 2IGMA 2M8GX 1VQ4I 5L3CA 1B8IB 2HDDA 4BJ5C 1XD7A 2GA1A 4RLFA 4NQWA 3MKWB 1Z6TA 3WGGA 1XMXA 4I01A 2CW7A 5J47A 2VPRA 2IA0A 4M3GA 3UNGC 2VOPA 2VQLA 2E5ZA 1DP3A 1R71A 3NEUA 3SDGA 3ECOA 2ZNYA 1YITI 1QZYA 2ZMEB 2TDXA 3GTMJ 2LY9A 5IT3A 3MD2A 1JE8A 3S3OA 3C2GA 1BOBA 1K4SA 4XKVA 1GT0C 3NRVA 3KYLA 2LP0A 1XMAA 4GYGA 1BI2A 3M9AA 3K4BA 3NQOA 4BQNA 4A3EJ 2E1NA 1VQ8I 3WE2A 4P55A 3V4GA 1Y1VJ 3DEUA 4B8XA 2W4SA 2X6XA 2V1XA 3OS1A 3LAJA 4FTHA 3I5UA 3J80K 5F0HA 2WADA 4M71A 5LD2C 2K9LA 3RQ4A 4DYQA 5FLXZ 3NWSA 2VPLA 2L7MP 4J00A 3E7LA 4F55A 1Z21A 1GV5A 5FLXK 3FIWA 1MBJA 4MGRA 4M9XA 4L5JA 2MD0A 2EFPA 2RN7A 1NK2P 2WAEA 2JN6A 2KJCA 1BM9A 4BEHB 4BHBA 5DD8A 4GCVA 2ELHA 4K2EA 4B4CA 1YW8A 5BOXA 2QBYB 3ZPLA 1B72A 2IS6A 3JREA 1A36A 2DI3A 4UVAA 3S1NJ 3K4JA 4F3QA 2WAFA 1JKPC 2FA5A 2DA5A 2Q8KA 3U1KA 5HLGA 1JTXA 5GPAA 4B3XA 4F93B 3C7JA 4F91B 2HZDA 3L2VA 1T33A 3BZCA 4MO7A 1S5LC 1USTA 4OIQF 2Y0SN 1VQOI 4UV9A 3ZMZA 2W24A 2GIVA 3BPVA 3HOTA 4GRIA 2UXNA 2ZBKA 1DPRA 5CVUA 3AFHA 1BL0A 2AXLA 3V7CA 3ISPA 2RREA 1IW7F 1O3SA 4ZYHA 1FZPB 3OOPA 4NC8A 1T98A 5J4VA 1OJLA 1B8IA 3CP8A 1U9OA 2ZC2A 3CC7I 1YQAA 4MFDA 4L0YB 4NNJA 2ZJQF 2CV2A 1E2XA 1GUUA 4XORA 4XLNF 4IOAF 5E20A 2H1KA 4GFBA 3IHUA 2CQNA 3MKZA 1V55H 4GGGA 2A68F 2HZTA 1NG6A 1OQYA 3BR0A 2KIQA 3F8NA 4JYKA 1ZYRF 2D2WA 4UB8C 3CP2A 2HI3A 4ETSA 1R9TJ 2TCTA 2P5KA 2M87A 4P1WA 1T2KA 1MH4A 1OCOH 1WWXA 3OIOA 3H9JA 4WXDA 1FYMA 1MSEC 1V4RA 1Y8QB 1BIAA 4J01A 1BBYA 2FQ4A 3I71A 5M5YJ 2DN0A 3FMRA 3Q0VA 3JRHA 3CO6C 4HW0A 3IKTA 3V8LA 2LD5A 4JP0A 2DDBA 2CFOA 5L3FA 3HPGA 1WKMA 3F23A 3DU5A 4IRHA 4M9ZA 2KL4A 4B48A 1VNDA 2YS9A 3KP6A 1G8XA 3EPZA 4EJVA 1P7IA 3I56I 3PUFA 1G3WA 1P9QC 5EDNA 2R7TA 4NHJA 2E7XA 1FTZA 1G3YA 1UB9A 2KKOA 1ZLJA 2CH0A 1DUXC 4BS9A 4XK4A 1PJRA 3MZ8A 1LDKB 1XSDA 3P9IA 2R7RA 3S17J 2P6TA 2W1OA 4ON0A 3JAMK 2VKVA 4LLGF 3VOEA 2DJIA 2V6EA 1BA5A 2F48A 3MKYB 2NVXJ 3OYEA 4E7KA 1OCRH 2VKDA 4BAYA 1UELB 1XDSA 3GCMA 3T8TA 2FXAA 4LG0A 3GW2A 2QBYA 2E60A 2GIZA 3ROUA 3S15J 3LFKA 5LFAA 2MLGA 3CF2A 3HOWJ 4QLCU 3BROA 4PJJA 5EEGA 4D0PA 1ZGAA 4ZTJA 2BEOA 3FK7A 1HSTA 3CF5F 2X85A 5F27A 1ZREA 2OU2A 2JA6J 3AG2H 3I3LA 2YUSA 2MG4A 2A5WA 2B9SA 1NK3P 2F5EA 2QQAA 1YJWI 2Z9OA 2QKLB 1XB4A 1WJDA 2KP6A 5JFRA 3LSRA 2VXZA 4RGXA 3M1CA 3D5RC 5JVTA 1TNTA 1IO2A 1WFXA 5FKLA 4A69C 3V42A 5HDKA 2VJIA 5K7ZA 2LF7A 4IZZA 4I2OA 2X48A 2DO7A 2V1DA 3E6BA 4BBRJ 4FX4A 1ZLKA 1P4AA 4LLNA 1HDPA 4A5MA 2HS5A 2LDUA 2QQ8A 3B73A 1J09A 3OWTA 1WJCA 4WK8F 3DTIA 1T8IA 1XGMA 4AM3A 5E79C 4HG2A 1J2XA 3BR2A 3L9FA 4OMYA 2R7UA 2JPCA 3G1LA 2ZJPF 2LTPA 4BU2A 3S1QJ 3J7AO 1N75A 2M1BA 2H8RA 1ZAOA 1FT9A 4GYIA 2WV1A 2XRNA 4EM1A 4JX4A 3CCUI 2FE3A 1NH3A 1SD5A 4A5NA 2XPVA 3H5AA 4PK4A 3IC7A 2STWA 2ECBA 4HX4A 1TBXA 3DPUA 4EGYA 1JT6A 4Y33A 3LSJA 1ZR4A 1FP2A 4PGHA 4CGZA 4B44A 2UXXA 2PMZN 4GXOA 2WAQN 3EYIA 1KU3A 2D1VA 2EZKA 4PJLA 1O7LA 3WTVC 4ZJZA 2K9NA 3VYRB 3G6EI 1UHMA 3OOUA 1LQ1A 2K86A 2Z2SB 4EV0A 1JTYA 4ANJA 4EM0B 4WCGA 4FETA 2H6BA 3J7AY 3RPUD 4OAZA 1I1GA 1IUYA 1CQTA 5CVIA 3DCFA 2M45A 3RKYA 3PIOF 2M7BA 1G59A 4PZJA 5LGTA 2ZXJA 4XONA 1RUOA 3K4LA 5EJCA 3H92A 1I1SA 3CCRI 1D0ZA 4XLAA 4CUGA 3U9GA 2M8EA 4EGZA 1W5TA 1ZRDA 2M9HA 1TQIA 2EILH 2XKOA 4KMFA 4XMYA 1HW5A 4HAMA 3J7YJ 2CJJA 3CQZJ 2WY8Q 3ASOH 1LJ9A 1WJ5A 3BR5A 2IGOA 2NOGA 4A3MJ 4KUMA 2K9SA 4IXAA 2RC4A 4BACA 3KLNA 3TP0A 5B66C 4E70A 4PFOA 4HNUA 3CJQB 3JRGA 1HOMA 1SVOA 2BXZA 3WTWC 2L3DA 3E5UA 2DFEA 2V26A 2VIXA 1O3TA 3DKYA 3I0TA 3WE3A 1LEAA 1FSEA 3MWMA 3QOEA 1D1BA 4V2GA 1S7OA 1S72I 1YIOA 2CSOA 1F9NA 3TP3A 1U6GA 4L18B 2CS3A 4E7ZA 5H20A 4IL6C 3GF2A 3E5XA 1F5TA 4XM3A 1XCBA 4HLYA 1LKXA 3WTSC 2E1MC 5CJ9A 1FBQA 3HKZA 2DDAA 1DQUA 3L2RA 3H0DA 2Y31A 1JUMA 1U0JA 3ZRGA 2XGDA 3V8KA 4G6QA 3PIPF 3RKXA 3WU0A 1YYVA 3OR2C 1TW2A 3OL3A 3JR9A 5IYDJ 2LFBA 2NNYA 1Q1HA 3AG3H 3GBGA 1HBXG 3I53A 4G7HF 2XAHA 1X1CA 1W7PA 4OINF 1FOKA 4E7SA 2CW8A 3TL4X 3O2PE 5C3EJ 3H3UA 5K5QA 5CLSA 4HRIA 1YW7A 1X3WB 4P9UA 4RGUA 4ASNA 4Y15A 2Q0OA 1FIAA 3CJTB 2G7UA 3N4MA 1E0EA 2HYJA 2P0WA 2XIGA 3DPTA 3VSLA 1YHQI 2FBHA 1IXRC 3FHNA 3HOSA 1FYKA 3FXLA 3CC2I 2LG4A 1VI0A 3BP8A 4CCJA 2ID6A 4BJ6C 2L01A 3H35A 1JKQC 3LWFA 2MYSA 1MZBA 3HG9A 1U78A 4G7ZF 2RDPA 3HRSA 2K5CA 3W6KB 3L2UA 2BY0A 2VONA 5F1RA 2QYOA 1TLHB 1XN7A 2STTA 2EA4A 3WTXC 1Z77A 2KRCA 2ZJRF 3SEQA 3O8HA 3DTEA 3HUGB 5D5XB 1NTCA 3F21A 3B02A 1J5YA 1XCVA 3FKIJ 5IY5H 5D5VB 3EDPA 4LIVA 3WTZA 5CQGA 2FEZA 4II3A 1WH7A 2LK2A 3L09A 2L9SA 2LF8A 5D4RA 1X58A 1LFPA 1XS9A 3ABUA 1LVAA 4A3CJ 5LEJA 1OYIA 4YG2F 2V1NA 2EBIA 3EUKL 5DCMB 3LNQA 2OV7A 3MZHA 4M73A 1MBFA 2MGQA 3CMEI 2NAZA 2LKSA 2L02A 1D8JA 4W97A 3FXMA 3LSGA 1HC8A 3HZJA 2OA4A 1IN6A 3ZQ7A 3GFJA 5DYMA 4JX5A 1PP7U 2Z33A 3LFUA 4E6KG 3GEZA 5J8CA 1FBSA 2R7FA 2KPMA 2R7QA 3TKYA 2O9LA 5D6FA 4AIKA 4C3IJ 3CCJI 1UHWA 3JRAA 2ZXHA 2FMLA 4RAFA 1ZG5A 1PP8F 2RVCA 2NS0A 1ITYA 5FRMA 4PUSA 3A4CA 4GO1A 1D1AA 4B09A 5DM7F 3GTOJ 3K4CA 3ZMSA 4AIDA 2P5LC 5E18F 4CZZA 3GO5A 1VQPI 1RR8C 2I10A 4BE0A 1TQPA 2DYSH 2OTJI 3CUQC 1OR7C 4PFPA 2EIMH 3P9KA 1JKOC 5L3DA 1EJ9A 5IT9K 2NVYJ 2LR8A 3HBLA 2PBIA 5LLQA 4Y7NJ 2XUBA 1V5EA 4QPOA 4AYBN 4D9JA 1T39A 5AONA 1R1TA 3Q0UA 3FBIB 1R4MB 5J3LA 1OISA 1BC7C 4E7JA 2EV5A 3G3ZA 4EJOA 2P7VB 3LQRA 3Q9SA 2ID3A 4CO8A 2O61A 1DGRM 3E6MA 2EIKH 3OS0A 2P4WA 5D5UB 3KFWX 3TW7A 3GTQJ 2FQ3A 2E34A 4G8XA 4KICA 3CCYA 3GX4X 4ZZLA 4HPQA 1TWHJ 4CXFA 3R61A 1PUFB 5LHIA 2L4MA 3SJMA 2VKHA 4WF2A 1FSHA 4HOBA 1R4NB 5D8LB 1R36A 4FISA 2ZMEC 3J81Z 1RKWA 2HVRA 1R6RA 3CDIA 2KRHA 2HPIA 3QOPA 2F2EA 3IRQA 2K27A 3AL0B 3J81K 1FLIA 3F3XA 1TT0A 3OYLA 3CTAA 4CA0A 2PG4A 2LLKA 4KIGA 3HOUJ 4LFUA 1GVJA 1SC7A 2V9KA 3S32A 3H36A 3UKGA 3KEOA 4HZFA 1SAUA 3MEXA 3S1MJ 1BOAA 2K4JA 3QP5A 3T0YA 1IDZA 2HQAA 2X4HA 2FNAA 1M1EB 4LK1F 3ZQFA 2IGNA 3EUHA 1NG7A 4MQVA 3S2DJ 5AIQA 1TW3A 3M8FA 1KYWA 5DCMA 3OYHA 4I0AA 5A2QZ 2GXGA 1QPIA 3PNTA 4MNUA 1O4XA 2R7DA 3VSKA 1Z6RA 3DFGA 5HOOA 4J19A 4Z2YA 3CUOA 1HA8A 1OMIA 4G12A 5BQTA 4DOZA 4P96A 2NOJB 4UUSB 3H5RA 3K70D 4CICA 3M07A 2M3AA 1GXQA 4L9TA 3GTKJ 2JRMA 2XV4S 1I5ZA 4BGDA 3F22A 3OIQA 1AWCA 3PSIA 2UWMA 3I4PA 1E3OC 1P92A 4IQ4A 3ABKH 1APLC 1P6RA 1W36D 4M9SA 1KGSA 2ISYA 4UB6C 3ABTA 2Z99A 3PQKA 3TOBA 1FWZA 2LKPA 2JMWA 2MSYA 3HOVJ 5CKTA 1SANA 5LGUA 1XGSA 2CQ7A 2DOFA 2E7WA 3ZR8X 2KDZA 2VE9A 1F43A 2KIUA 2BYVE 3SFIA 4AD9A 5GADJ 3QU3A 1A6QA 2GA2A 2JA5J 3HHHA 3EQLF 3FXKA 5DV5A 1USSA 4Y52J 4AVPA 2Z1DA 1AOYA 4P9FA 3FXOA 4KN4X 3JRFA 4CYCB 3KP4A 2GOXB 4OMZA 3FM3A 4RS8A 3BG9A 2W25A 5LHGA 5J1YA 2DPUA 3HRUA 5FKOA 3ZMDA 4M3DA 3LA7A 1SVLA 4EQQA 1OCCH 3BLYA 3F8MA 4G9YA 3OYJA 3QU6A 4DYRA 2L0KA 1KU9A 1WI9A 2DU9A 2H27A 5D5WB 1UG2A 3QWLA 4A0YA 2ISZA 2K3FA 1BN5A 1I50J 2A6HF 1K6OA 4E7LA 2W7NA 2NS8A 1YRNA 4XNFA 3EUAA 5K5OA 1B4AA 2M30A 1PDNC 3E1SA 1SFKA 1Z7LA 2XVCA 3RZOJ 2OPTA 4XLFA 4RA2A 1UHSA 5EF6A 3OYMA 3R6SA 3H9QA 2BE5F 1XSXA 3QYFA 2N8GA 3RDIA 3AKZA 2QQBA 2IRFG 2LY2A 3HXLA 2XF6A 3OYDA 2XSDC 1Y56A 1ZARA 1FOXA 4LOCA 1W0UA 3COAC 2WB1N 3K70C 4XOPA 3C18A 3ECHA 4BUPA 2X6OA 2AQFA 3TEDA 4D5FA 2M7AA 1D5YA 5L3EA 3H9GA 1W36C 1K4TA 2W82A 2A61A 2XGCA 2PMUA 4UUSA 3CCLI 2V4JC 2DA3A
chains in the Genus database with same CATH topology
1ZGWA 2E19A 3S15J 3BQZA 4A3KJ 2CQQA 1YRNB 1AU7A 1FJLA 3HOWJ 2R7ZJ 1GVDA 5E3OA 1W0TA 3M4OJ 3FK7A 1HDDC 2DMQA 5F27A 3BTIA 2JA6J 3BG3A 2YUSA 2MG4A 3HKZN 5DS9A 1NK3P 1MSFC 2XPUA 5IYBJ 2EZLA 2NVQJ 1ETKA 2HXIA 5E3MA 3LSRA 3I4MJ 1MBGA 5IP9J 5IOZA 1GV2A 5FKLA 4A69C 1JUSA 1ZKGA 5M3MJ 5HODA 3C2BA 3HDDA 2R5ZA 5K7ZA 3H0GJ 3F0CA 2X48A 3BQYA 2VKEA 2ME6A 5J1RA 4BBRJ 4CYCA 1HDPA 4RBOA 5M5WJ 4HNVA 2YU9J 3Q0WA 3BR6A 2DA4A 4MIMA 4X1EA 1IV6A 1H88C 3GTGJ 3OSGA 1RR7A 3BR2A 3D1NI 3Q3SA 5GP9A 3G1LA 2LTPA 1ETWA 2R5YB 1Y1WJ 3S1QJ 1QRYA 4A3DJ 4MFEA 2P81A 2H8RA 1IC8A 4M3EA 2WV1A 4JX4A 5EG0A 1ZK8A 1U8BA 5JLWA 4I76A 1K83J 2FD5A 2E2HJ 2XPVA 4AC0A 3DEWA 1F36A 2ECBA 4C2MJ 3A01B 1BW5A 1JT6A 3LSJA 1ZR4A 1JJ8C 1MH3A 1IDYA 2PMZN 4ABZA 2WAQN 5F0FA 2R5ZB 2EZKA 1K61A 2GM4A 5IYCJ 2K9NA 1VFCA 2IAIA 5E3LA 3HGGA 3OOUA 1TWCJ 1ORKA 1WGXA 2R92J 2E1OA 5DTDA 2AO9A 4M3FA 1JTYA 2COBA 4AUXA 3MN2A 1HF0A 2GBYA 1CQTA 3DCFA 5K7FA 2RAEA 2O7OA 4XRSG 2QCOA 2FX0A 3O8GA 4RDUA 1WH5A 1JGGA 1Q1VA 3B6AA 4A3GJ 2D5VA 5C4XJ 2TRTA 2VI6A 2DA6A 5GPCA 2AHQA 4A3BJ 2M9HA 2JWTA 3RQIA 4BY1J 2CJJA 3K2AA 3CQZJ 3ZQHA 5EGOA 3BR5A 1FEXA 1JUPA 1QVTA 2NOGA 4A3MJ 2K9SA 4BKXA 3TP0A 1LFBA 3JRGA 1HOMA 4DYCA 4V2FA 1TWGJ 3HM5A 1A6IA 3LOCA 4D5CA 4A93J 1MBHA 3JRIA 5BNGA 3FK6A 3VPRA 3RZDJ 2KT0A 3GTLJ 4V2GA 3G1OA 3A02A 3TP3A 2NS7A 5JLXA 5IP6A 1FIPA 3M3YJ 3FISA 1X2MA 2O8KA 1ZR2A 2R5YA 4A3FJ 5EGOB 2DJNA 1MBEA 1TC3C 2Y31A 2R93J 1JUMA 2DA2A 5F0CA 3B6CA 2XGDA 4IHVA 4FE7A 3K7AJ 2EZHA 3IV5A 2Y30A 3JR9A 5IYDJ 2LFBA 2X9DA 4UUTA 3A01A 3GBGA 1BJZA 4A3LJ 3QPSA 2MW8A 4M6VA 2JJ7A 5C3EJ 3CMYA 2XB0X 5M3FJ 3ZQIA 1FIAA 2LVSA 2HYJA 3BTJA 5EZGA 3ZQLA 2GLOA 9ANTA 2EH3A 2ECCA 4DW6A 4DZPA 3PO2J 1VI0A 4IHYA 3RKQA 2JK3A 3QQAA 3MKLA 2ID6A 5FLMJ 2R0QC 2HXOA 2NVTJ 1Z0XA 2E2JJ 3BR1A 1JKQC 2DMTA 1MNMC 3W6VA 4MLOA 1U78A 1HLVA 1IRZA 5FKKA 5J1UA 1H89C 2XRLA 3HOYJ 1ENHA 1X2NA 1Z77A 1ETOA 3S1RJ 1G2HA 3O8HA 1NTCA 4X6AJ 1DU0A 1TWAJ 1ETVA 2M34A 3FKIJ 1RETA 5IPAA 5FKMA 2LK2A 1WH7A 3WHCA 5FJ8J 5F1JA 3OSFA 2JA8J 1I6HJ 1X58A 2Y9YA 1XS9A 4A3CJ 2K40A 2JA7J 1LFUP 4A3IJ 1ETXA 3TW6A 3GTPJ 1ZTRA 2EBIA 2DMUA 3NARA 4FE4A 5EYRA 1WCMJ 3LNQA 2VUMJ 4JX6A 3ZOBA 1MBFA 2MGQA 4S0HB 1QVUA 4W97A 3WHBA 3LSGA 1JT0A 2ME0A 5FKNA 2HOSA 2HOAA 3BTLA 3G1MA 4JX5A 4M3BA 4XRSA 1B72B 1OCTC 1U9NA 2IEKA 1RPWA 3S14J 2DMNA 1P7JA 4D7MA 3NAUA 1A5JA 1PUFA 5E3NA 2O9LA 1GDTA 4XICA 4C3IJ 4QTRA 3JRAA 4XRMA 1OFCX 5M5XJ 1ITYA 2E2IJ 3GTOJ 2CUEA 1BW6A 3BT9A 2I10A 1RESA 2G0EA 2LKXA 1JKOC 2NVYJ 2LR8A 3HBLA 3HOXJ 1TWFJ 1IJWC 3BG5A 3PM1A 4AYBN 4Y7NJ 1LE8B 3H3VK 2M8GX 2HQ5A 2HDDA 3Q0UA 4L5EA 1B8IB 5IP7J 4FCYA 2HOTA 5J3LA 2QF7A 3MVPA 4NDLA 2CU7A 2ID3A 3JRDA 4W1UA 4EEFG 1H8AC 2VPRA 4M3GA 3TW7A 3GTQJ 5C44J 3CCYA 2EQRA 1TWHJ 2B63J 4IEJA 4BXXJ 1PUFB 3SDGA 3SJMA 1WPKA 2L9RA 3GTMJ 1ETYA 2LY9A 4A3JJ 4FISA 3JRCA 1RKWA 3IH4A 1GT0C 1XG1A 4IHXA 2LP0A 3S2HJ 4A3EJ 2K9QA 2LLKA 2IBDA 3HOUJ 1AKHA 1Y1VJ 3BR3A 5K7HA 4FTHA 3UKGA 1S7EA 5F08A 2M2EA 5F0HA 1MBKA 3S1MJ 1IDZA 3JRBA 4B3AA 5F04A 4DYQA 3ZQFA 1IUFA 1JKRC 4XIDA 2XPWA 3S2DJ 2L7MP 3E7LA 1GV5A 3BTCA 2ZB9A 3FIWA 2EZIA 1MBJA 1QPIA 3I4NJ 3GTJJ 1O4XA 1NK2P 2JN6A 4J19A 4B4CA 2FJ1A 3HEFA 2XGEA 4G12A 4QSHA 4UUSB 1B72A 1UMQA 3JREA 3S1NJ 1FTTA 2W48A 3GTKJ 1JKPC 1JJ6C 1AKHB 2DA5A 4B1RA 1JTXA 2OF7A 5GPAA 1E3OC 1APLC 1T33A 4MO7A 1IG7A 4D7NA 2Y0SN 2JMWA 2MSYA 3HOVJ 1SANA 2M0CA 1BL0A 4C3HJ 4DZJA 1HCRA 2KDZA 1F43A 1LE8A 1I3QJ 3SFIA 2L7FP 1AHDP 1OJLA 3HB9A 1POGA 3HOZJ 1B8IA 2JA5J 1U9OA 4Y52J 4MFDA 1GUUA 5C4JJ 3JRFA 2Y9ZA 4CYCB 2H1KA 4GFBA 2DMPA 2DA7A 1ZQ3P 3BG9A 3BR0A 2CUFA 5J1YA 4BY7J 3PO3J 4JYKA 5FKOA 4M3DA 2Y2ZA 1R9TJ 2HI3A 2TCTA 4DYRA 4I6ZA 2DTZA 1VF9A 2L0KA 2XB5A 1MH4A 1UG2A 3OIOA 1MSEC 1I50J 4C3JJ 2CQXA 5EG0B 3CDLA 2NS8A 2FQ4A 5M5YJ 2DN0A 3Q0VA 3JRHA 1YRNA 3HGYA 2LD5A 4JP0A 1IGNA 3RZOJ 2OPTA 4QIWN 3L1PA 3S16J 1EF4A 1SFOJ 1DU6A 1UHSA 5EF6A 3A03A 3ZQGA 1ETQA 1RKTA 1VNDA 2YS9A 4BBSJ 2CRGA 2N8GA 1P7IA 5EZHA 2XSDC 5EDNA 2ELKA 1OCPA 3ZQCA 1WI3A 1XC5A 2DA1A 3IH3A 4LOCA 1W0UA 1FTZA 2WB1N 5EEAA 3LSPA 4IHWA 4XK4A 2X6OA 3S17J 5IOYA 5FLVA 3QPLA 3TEDA 2VKVA 3IH2A 1BA5A 2NVXJ 4D5FA 1D5YA 2XGCA 1T56A 2L7ZA 4UUSA 2DA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGW A;  2E19 A;  3S15 J;  3BQZ A;  4A3K J;  2CQQ A;  1YRN B;  1AU7 A;  1FJL A;  3HOW J;  2R7Z J;  1GVD A;  5E3O A;  1W0T A;  3M4O J;  3FK7 A;  1HDD C;  2DMQ A;  5F27 A;  3BTI A;  2JA6 J;  3BG3 A;  2YUS A;  2MG4 A;  3HKZ N;  5DS9 A;  1NK3 P;  1MSF C;  2XPU A;  5IYB J;  2EZL A;  2NVQ J;  1ETK A;  2HXI A;  5E3M A;  3LSR A;  3I4M J;  1MBG A;  5IP9 J;  5IOZ A;  1GV2 A;  5FKL A;  4A69 C;  1JUS A;  1ZKG A;  5M3M J;  5HOD A;  3C2B A;  3HDD A;  2R5Z A;  5K7Z A;  3H0G J;  3F0C A;  2X48 A;  3BQY A;  2VKE A;  2ME6 A;  5J1R A;  4BBR J;  4CYC A;  1HDP A;  4RBO A;  5M5W J;  4HNV A;  2YU9 J;  3Q0W A;  3BR6 A;  2DA4 A;  4MIM A;  4X1E A;  1IV6 A;  1H88 C;  3GTG J;  3OSG A;  1RR7 A;  3BR2 A;  3D1N I;  3Q3S A;  5GP9 A;  3G1L A;  2LTP A;  1ETW A;  2R5Y B;  1Y1W J;  3S1Q J;  1QRY A;  4A3D J;  4MFE A;  2P81 A;  2H8R A;  1IC8 A;  4M3E A;  2WV1 A;  4JX4 A;  5EG0 A;  1ZK8 A;  1U8B A;  5JLW A;  4I76 A;  1K83 J;  2FD5 A;  2E2H J;  2XPV A;  4AC0 A;  3DEW A;  1F36 A;  2ECB A;  4C2M J;  3A01 B;  1BW5 A;  1JT6 A;  3LSJ A;  1ZR4 A;  1JJ8 C;  1MH3 A;  1IDY A;  2PMZ N;  4ABZ A;  2WAQ N;  5F0F A;  2R5Z B;  2EZK A;  1K61 A;  2GM4 A;  5IYC J;  2K9N A;  1VFC A;  2IAI A;  5E3L A;  3HGG A;  3OOU A;  1TWC J;  1ORK A;  1WGX A;  2R92 J;  2E1O A;  5DTD A;  2AO9 A;  4M3F A;  1JTY A;  2COB A;  4AUX A;  3MN2 A;  1HF0 A;  2GBY A;  1CQT A;  3DCF A;  5K7F A;  2RAE A;  2O7O A;  4XRS G;  2QCO A;  2FX0 A;  3O8G A;  4RDU A;  1WH5 A;  1JGG A;  1Q1V A;  3B6A A;  4A3G J;  2D5V A;  5C4X J;  2TRT A;  2VI6 A;  2DA6 A;  5GPC A;  2AHQ A;  4A3B J;  2M9H A;  2JWT A;  3RQI A;  4BY1 J;  2CJJ A;  3K2A A;  3CQZ J;  3ZQH A;  5EGO A;  3BR5 A;  1FEX A;  1JUP A;  1QVT A;  2NOG A;  4A3M J;  2K9S A;  4BKX A;  3TP0 A;  1LFB A;  3JRG A;  1HOM A;  4DYC A;  4V2F A;  1TWG J;  3HM5 A;  1A6I A;  3LOC A;  4D5C A;  4A93 J;  1MBH A;  3JRI A;  5BNG A;  3FK6 A;  3VPR A;  3RZD J;  2KT0 A;  3GTL J;  4V2G A;  3G1O A;  3A02 A;  3TP3 A;  2NS7 A;  5JLX A;  5IP6 A;  1FIP A;  3M3Y J;  3FIS A;  1X2M A;  2O8K A;  1ZR2 A;  2R5Y A;  4A3F J;  5EGO B;  2DJN A;  1MBE A;  1TC3 C;  2Y31 A;  2R93 J;  1JUM A;  2DA2 A;  5F0C A;  3B6C A;  2XGD A;  4IHV A;  4FE7 A;  3K7A J;  2EZH A;  3IV5 A;  2Y30 A;  3JR9 A;  5IYD J;  2LFB A;  2X9D A;  4UUT A;  3A01 A;  3GBG A;  1BJZ A;  4A3L J;  3QPS A;  2MW8 A;  4M6V A;  2JJ7 A;  5C3E J;  3CMY A;  2XB0 X;  5M3F J;  3ZQI A;  1FIA A;  2LVS A;  2HYJ A;  3BTJ A;  5EZG A;  3ZQL A;  2GLO A;  9ANT A;  2EH3 A;  2ECC A;  4DW6 A;  4DZP A;  3PO2 J;  1VI0 A;  4IHY A;  3RKQ A;  2JK3 A;  3QQA A;  3MKL A;  2ID6 A;  5FLM J;  2R0Q C;  2HXO A;  2NVT J;  1Z0X A;  2E2J J;  3BR1 A;  1JKQ C;  2DMT A;  1MNM C;  3W6V A;  4MLO A;  1U78 A;  1HLV A;  1IRZ A;  5FKK A;  5J1U A;  1H89 C;  2XRL A;  3HOY J;  1ENH A;  1X2N A;  1Z77 A;  1ETO A;  3S1R J;  1G2H A;  3O8H A;  1NTC A;  4X6A J;  1DU0 A;  1TWA J;  1ETV A;  2M34 A;  3FKI J;  1RET A;  5IPA A;  5FKM A;  2LK2 A;  1WH7 A;  3WHC A;  5FJ8 J;  5F1J A;  3OSF A;  2JA8 J;  1I6H J;  1X58 A;  2Y9Y A;  1XS9 A;  4A3C J;  2K40 A;  2JA7 J;  1LFU P;  4A3I J;  1ETX A;  3TW6 A;  3GTP J;  1ZTR A;  2EBI A;  2DMU A;  3NAR A;  4FE4 A;  5EYR A;  1WCM J;  3LNQ A;  2VUM J;  4JX6 A;  3ZOB A;  1MBF A;  2MGQ A;  4S0H B;  1QVU A;  4W97 A;  3WHB A;  3LSG A;  1JT0 A;  2ME0 A;  5FKN A;  2HOS A;  2HOA A;  3BTL A;  3G1M A;  4JX5 A;  4M3B A;  4XRS A;  1B72 B;  1OCT C;  1U9N A;  2IEK A;  1RPW A;  3S14 J;  2DMN A;  1P7J A;  4D7M A;  3NAU A;  1A5J A;  1PUF A;  5E3N A;  2O9L A;  1GDT A;  4XIC A;  4C3I J;  4QTR A;  3JRA A;  4XRM A;  1OFC X;  5M5X J;  1ITY A;  2E2I J;  3GTO J;  2CUE A;  1BW6 A;  3BT9 A;  2I10 A;  1RES A;  2G0E A;  2LKX A;  1JKO C;  2NVY J;  2LR8 A;  3HBL A;  3HOX J;  1TWF J;  1IJW C;  3BG5 A;  3PM1 A;  4AYB N;  4Y7N J;  1LE8 B;  3H3V K;  2M8G X;  2HQ5 A;  2HDD A;  3Q0U A;  4L5E A;  1B8I B;  5IP7 J;  4FCY A;  2HOT A;  5J3L A;  2QF7 A;  3MVP A;  4NDL A;  2CU7 A;  2ID3 A;  3JRD A;  4W1U A;  4EEF G;  1H8A C;  2VPR A;  4M3G A;  3TW7 A;  3GTQ J;  5C44 J;  3CCY A;  2EQR A;  1TWH J;  2B63 J;  4IEJ A;  4BXX J;  1PUF B;  3SDG A;  3SJM A;  1WPK A;  2L9R A;  3GTM J;  1ETY A;  2LY9 A;  4A3J J;  4FIS A;  3JRC A;  1RKW A;  3IH4 A;  1GT0 C;  1XG1 A;  4IHX A;  2LP0 A;  3S2H J;  4A3E J;  2K9Q A;  2LLK A;  2IBD A;  3HOU J;  1AKH A;  1Y1V J;  3BR3 A;  5K7H A;  4FTH A;  3UKG A;  1S7E A;  5F08 A;  2M2E A;  5F0H A;  1MBK A;  3S1M J;  1IDZ A;  3JRB A;  4B3A A;  5F04 A;  4DYQ A;  3ZQF A;  1IUF A;  1JKR C;  4XID A;  2XPW A;  3S2D J;  2L7M P;  3E7L A;  1GV5 A;  3BTC A;  2ZB9 A;  3FIW A;  2EZI A;  1MBJ A;  1QPI A;  3I4N J;  3GTJ J;  1O4X A;  1NK2 P;  2JN6 A;  4J19 A;  4B4C A;  2FJ1 A;  3HEF A;  2XGE A;  4G12 A;  4QSH A;  4UUS B;  1B72 A;  1UMQ A;  3JRE A;  3S1N J;  1FTT A;  2W48 A;  3GTK J;  1JKP C;  1JJ6 C;  1AKH B;  2DA5 A;  4B1R A;  1JTX A;  2OF7 A;  5GPA A;  1E3O C;  1APL C;  1T33 A;  4MO7 A;  1IG7 A;  4D7N A;  2Y0S N;  2JMW A;  2MSY A;  3HOV J;  1SAN A;  2M0C A;  1BL0 A;  4C3H J;  4DZJ A;  1HCR A;  2KDZ A;  1F43 A;  1LE8 A;  1I3Q J;  3SFI A;  2L7F P;  1AHD P;  1OJL A;  3HB9 A;  1POG A;  3HOZ J;  1B8I A;  2JA5 J;  1U9O A;  4Y52 J;  4MFD A;  1GUU A;  5C4J J;  3JRF A;  2Y9Z A;  4CYC B;  2H1K A;  4GFB A;  2DMP A;  2DA7 A;  1ZQ3 P;  3BG9 A;  3BR0 A;  2CUF A;  5J1Y A;  4BY7 J;  3PO3 J;  4JYK A;  5FKO A;  4M3D A;  2Y2Z A;  1R9T J;  2HI3 A;  2TCT A;  4DYR A;  4I6Z A;  2DTZ A;  1VF9 A;  2L0K A;  2XB5 A;  1MH4 A;  1UG2 A;  3OIO A;  1MSE C;  1I50 J;  4C3J J;  2CQX A;  5EG0 B;  3CDL A;  2NS8 A;  2FQ4 A;  5M5Y J;  2DN0 A;  3Q0V A;  3JRH A;  1YRN A;  3HGY A;  2LD5 A;  4JP0 A;  1IGN A;  3RZO J;  2OPT A;  4QIW N;  3L1P A;  3S16 J;  1EF4 A;  1SFO J;  1DU6 A;  1UHS A;  5EF6 A;  3A03 A;  3ZQG A;  1ETQ A;  1RKT A;  1VND A;  2YS9 A;  4BBS J;  2CRG A;  2N8G A;  1P7I A;  5EZH A;  2XSD C;  5EDN A;  2ELK A;  1OCP A;  3ZQC A;  1WI3 A;  1XC5 A;  2DA1 A;  3IH3 A;  4LOC A;  1W0U A;  1FTZ A;  2WB1 N;  5EEA A;  3LSP A;  4IHW A;  4XK4 A;  2X6O A;  3S17 J;  5IOY A;  5FLV A;  3QPL A;  3TED A;  2VKV A;  3IH2 A;  1BA5 A;  2NVX J;  4D5F A;  1D5Y A;  2XGC A;  1T56 A;  2L7Z A;  4UUS A;  2DA3 A; 
#chains in the Genus database with same CATH topology
 5H6R A;  3WG9 A;  1TT5 B;  2CQQ A;  3D5L A;  1R7J A;  2VQG A;  5HLI A;  4NC6 A;  4EVI A;  3HIF A;  3J7Z I;  3HHG A;  2QUF A;  2XAU A;  2DQR A;  5CVJ A;  5E3O A;  1W0T A;  1HDD C;  2IT0 A;  2DMQ A;  4ZTF A;  1WQ2 A;  3GZ6 A;  3LSI A;  2VLA A;  2XPU A;  5B1B H;  2QWW A;  5IYB J;  3KCC A;  3KLO A;  2HEO A;  1AA7 A;  1ETK A;  4RB1 A;  1MMA A;  1O57 A;  5E3M A;  2XAQ A;  3BJA A;  2V9V A;  1GV2 A;  4R8H A;  3HYI A;  1JUS A;  5GTH C;  5M3M J;  4HDV A;  4HQM A;  2ZO4 A;  3QRF F;  4IKF A;  2VJ4 A;  4A6E A;  2L4A A;  3ZMT A;  4LG0 B;  4CYC A;  5M5W J;  5DD4 A;  2DPD A;  3Q0W A;  2UV1 A;  3OYI A;  2DA4 A;  4L9J A;  1GHC A;  4H4K C;  4MQ9 F;  4MIM A;  1IV6 A;  3GTG J;  4MEY F;  3IWF A;  3Q3S A;  2R5Y B;  1ETW A;  5FFX A;  3PNY A;  3T5X A;  3TGN A;  3VYT B;  4A3D J;  2KRF A;  2C6Y A;  1IC8 A;  1T08 B;  4LMY A;  3SHF A;  2EV0 A;  2E71 A;  1K83 J;  2FD5 A;  3DTK A;  4CCM A;  4RB3 C;  2PMZ A;  4C2M J;  3LQQ A;  2L9N A;  5KCM A;  1TZL A;  2WAQ A;  5KAI C;  3L2W A;  1QGP A;  3QP6 A;  4IHS A;  1TTY A;  2HFH A;  3GFI A;  1K61 A;  2O03 A;  4HX7 A;  4IO9 F;  1JHF A;  3K10 A;  3C3W A;  5E3L A;  3HTS B;  1TWC J;  3AG4 H;  1WGX A;  2K7L A;  4JQF A;  2ESN A;  2ESH A;  3JTH A;  3RIR A;  4AUX A;  4BE2 A;  1MD0 A;  1XSV A;  2FOW A;  2QLZ A;  3FMS A;  1Y39 A;  1WJE A;  1QZZ A;  4RAY A;  5HDG A;  2R7W A;  1ZEL A;  2A6T A;  3L7W A;  2A05 A;  2O7O A;  1Y8R B;  4DQ2 A;  1I3A A;  1WH5 A;  2RKH A;  2VT2 A;  4OU0 A;  5TGT A;  2EWN A;  2LRE A;  4OOI A;  3RCO A;  3IKV A;  3RQI A;  4BY1 J;  2R4G A;  3S3M A;  2VXD A;  3K2A A;  2CFX A;  1DPU A;  4HBL A;  1V54 H;  2DXI A;  5HLT A;  1JUP A;  4CH7 A;  2EIN H;  1V3F A;  3CCM I;  4ESB A;  2BY3 A;  5JI6 A;  3OR1 C;  3VDX A;  1XX5 A;  2OCE A;  3F72 A;  4O3M A;  2BXY A;  2QEN A;  4ENM A;  1B9M A;  2HQR A;  3HM5 A;  2AQE A;  2V79 A;  3GLL A;  1BI1 A;  5DM6 F;  3PNV A;  3JRI A;  3FK6 A;  5L3B A;  2IA2 A;  1SEU A;  2ZSI B;  3W3C A;  2GZW A;  3A02 A;  1XTA A;  4HLX A;  1Z3Y A;  5JLX A;  2L7K A;  4IQJ A;  5IP6 A;  3HSR A;  1PUE E;  5GAG J;  3E3V A;  1K78 B;  3ZN1 A;  4N0B A;  1ON2 A;  1L0O C;  1S9H A;  4OAY A;  3WTU C;  1IN4 A;  2CO5 A;  1IAW A;  1MND A;  2R5Y A;  2JUC A;  2W84 A;  1XDU A;  5DUK A;  2HYF A;  4KIS A;  3GWZ A;  1IV8 A;  3CJN A;  3Q5F A;  2GXB A;  5F0C A;  3B6C A;  2HYG D;  4IHV A;  2ZXI A;  2EZH A;  1OLT A;  1RZ4 A;  3OYN A;  3PQJ A;  1UFM A;  5ERI A;  1BJZ A;  1B1B A;  1Z05 A;  4PGG A;  2DFH A;  2MW8 A;  2F4M B;  5CPR B;  1QPM A;  2JJ7 A;  1O3Q A;  4HNT A;  1ERD A;  2EFN A;  3K9T A;  4HV5 A;  5D4S A;  2LC2 A;  3S8P A;  2XB0 X;  5FRN A;  5B5E C;  1D0Y A;  2V1U A;  2LVS A;  2BW3 A;  1MJB A;  3UR3 C;  5ICG A;  4F92 B;  1S7A A;  1SD7 A;  1E3P A;  5HS8 A;  3ZMU A;  1B59 A;  2DQL A;  2YX7 A;  3A0B C;  3RTR A;  4DW6 A;  4DBQ A;  4IHY A;  3RKQ A;  3WGI A;  2H8W A;  2QM3 A;  3QQA A;  3LAP A;  1YIJ I;  1E3H A;  5LBQ A;  4CCK A;  1S8N A;  5FLM J;  1MMS A;  2A69 F;  1Z0X A;  2CWE A;  4HF0 A;  3W6V A;  1J0R A;  3KP7 A;  4NB5 A;  2XAF A;  2FNP A;  5FKK A;  2MD5 A;  2FU4 A;  4Y3O A;  1H89 C;  1X4P A;  3ELK A;  2XRL A;  1J59 A;  2R7V A;  4LK0 F;  1W7P B;  2E35 A;  1QQI A;  2WBM A;  5FD5 A;  2DT6 A;  2OC6 A;  4X6A J;  1VTN C;  4E7I A;  1TWA J;  3MFK A;  1ETV A;  1X1P A;  2VL8 A;  1X3Z B;  4A6D A;  1YW9 A;  5IPA A;  3HPH A;  1SMT A;  3WHC A;  3PUB A;  2CYY A;  4KJZ A;  5FJ8 J;  5F1J A;  2JA8 J;  4RAZ A;  2Y9Y A;  2CW0 F;  3CZ6 A;  3KYC B;  4KDP A;  2VBZ A;  1WVR A;  2QGU A;  2O6G E;  4FE4 A;  2DMU A;  3PSF A;  1F4K A;  4BXU A;  2JUG A;  2HWV A;  3ZOB A;  3BDD A;  2YR2 A;  4WXC A;  2L2O A;  4FHT A;  4S0H B;  3I59 B;  1MDM A;  1WHU A;  3ULQ B;  1R1V A;  5FO5 A;  3F8F A;  1JT0 A;  3KPH A;  2ME0 A;  1A35 A;  2E5N A;  2HOA A;  2BOL A;  3BTL A;  3G1M A;  1G4D A;  1K78 A;  2CV1 A;  2XKP A;  4HYE A;  1OCT C;  1U9N A;  3L00 A;  2HDC A;  1K6Y A;  2GXA A;  2DMN A;  1P7J A;  3VYU B;  5LRR A;  3OL4 A;  1T0F C;  4D7M A;  2ZCW A;  2H1L A;  4ZYD A;  1N78 A;  1R5I D;  1D0X A;  2W85 A;  2IPQ X;  2OQR A;  1R49 A;  3TMO A;  3BT9 A;  4LB6 B;  4XKW A;  3KIO A;  2K85 A;  2G0E A;  4B43 A;  3DBH B;  5KVR A;  2QA4 I;  2XGX A;  2X1E A;  1KON A;  3W2A A;  4E4H A;  3CCV I;  1VQL I;  4R79 A;  4O5V A;  1LE8 B;  1TWF J;  3BG5 A;  5F64 A;  3H3V K;  2M0M A;  3MCZ A;  4EMS A;  2HQ5 A;  5E1Z B;  4FCY A;  5E1W A;  2QF7 A;  3DF8 A;  3MVP A;  3FBN B;  4LIT A;  1SD6 A;  2K02 A;  3JRD A;  4W1U A;  4EEF G;  1H8A C;  2DCE A;  3D0S A;  2NNN A;  3CMA I;  3R4K A;  2OCC H;  2OQG A;  4IEJ A;  3L2Q A;  3LL7 A;  4UVB A;  1WPK A;  2L9R A;  2KQR A;  2UZK A;  1ETY A;  4GDF A;  4ZZD A;  1IRF A;  3V7S A;  4A3J J;  2KJB A;  2DFF A;  5LEK A;  4CSW A;  2LRD A;  3BJ6 A;  4IHX A;  5D8K B;  4LD5 A;  3ZCO A;  3DWL E;  4Y13 A;  3S2H J;  2DT5 A;  2LOO A;  3AL0 C;  2F6C A;  4KT5 C;  2DT7 B;  2G9W A;  1AKH A;  3K1N A;  2HQN A;  3F6V A;  5K7H A;  3SFZ A;  4AWX B;  1S7E A;  2M2E A;  5BPI A;  3P9C A;  1MBK A;  4I98 B;  5GAE J;  2PEX A;  3JRB A;  2L54 A;  4B3A A;  4HV6 A;  5F04 A;  4F52 A;  5ICE A;  1IUF A;  4XID A;  2ZNZ A;  3CO7 C;  2HR3 A;  2P7C B;  3CCE I;  1Y0U A;  2MLK A;  2EK5 A;  4G6T B;  3O3K A;  1WJB A;  2EZI A;  3I4N J;  2LYC A;  1C0W A;  2ZSH B;  1HW1 A;  2IS1 A;  1G3S A;  2O3F A;  3I59 A;  3KEY A;  4Y4R A;  2ZXW H;  2OD5 A;  2ETH A;  3ABM H;  3HEF A;  2X1C A;  4BDY A;  4QSH A;  1Z9C A;  3AAF A;  4Q47 A;  4Q48 A;  1FTT A;  4YFN F;  1UAA A;  2CQK A;  1JJ6 C;  1I6X A;  4B1R A;  4U0W A;  1EH8 A;  2IP2 A;  4A2U A;  3SYT A;  2BY2 A;  4C9Y A;  5BS6 A;  2O5R A;  4O6J A;  5E1X A;  4DGW B;  1UZC A;  3I58 A;  2BBY A;  4LJZ F;  4D7N A;  3DKX A;  1IF1 A;  3R0A A;  1VQ6 I;  1TP4 A;  3O6B B;  4EJU A;  1MGT A;  2M0C A;  1D8K A;  5EEH A;  4CYD A;  1QZE A;  1LB2 A;  1LNW A;  1FY7 A;  2VBW A;  1LE8 A;  2FBK A;  1I3Q J;  2FOK A;  4OIO F;  2L7F P;  1AHD P;  5TRD A;  1POG A;  3HOZ J;  1IXC A;  4I09 A;  1LPQ A;  1LUJ B;  4C2T A;  2XF5 A;  4RMN A;  5LGN A;  1T95 A;  4CCN A;  3KE2 A;  4TV7 A;  3ZN0 A;  2DMP A;  2DA7 A;  2EFW A;  1ZQ3 P;  2WWY A;  2CUF A;  2PMH A;  1FX7 A;  1UCR A;  4A0Z A;  2VT3 A;  3K4N A;  4BY7 J;  3BWG A;  2JQ7 A;  2QSG X;  1PYV A;  2A5Y B;  3L2C A;  5HS9 A;  2PI0 A;  1FP1 D;  2XB5 A;  4UV8 A;  1WJF A;  5J4Y A;  1YI2 I;  5ICF A;  5LRS A;  2CQX A;  1CGP A;  4BYY A;  2MH2 A;  4B47 A;  2JZY A;  4R1H A;  1LDD A;  5CYV A;  4U87 A;  1XGO A;  3G2B A;  1IGN A;  1W1W E;  4E7H A;  2HGC A;  3MMY B;  1SFO J;  1DU6 A;  1ETQ A;  1OYY A;  1RKT A;  4S04 A;  2CRG A;  3QPT A;  5KHD A;  2WB1 A;  4N9H A;  5EZH A;  2FUG 2;  4KIF A;  4HSR A;  3GVA A;  3ZQC A;  2KIS A;  1WI3 A;  1XC5 A;  2DA1 A;  3BG6 A;  3IH3 A;  3RJP A;  3M8J A;  2B7E A;  3JW4 A;  5EEA A;  3DKW A;  1FNN A;  2F4O B;  5FLV A;  3BG7 A;  2ICW G;  4HDU A;  4YEJ A;  3IH2 A;  1U3E M;  3BZ6 A;  3IRR A;  2UUZ A;  5FGM A;  1T56 A;  2W00 A;  1D3Y A;  2KZV A;  3HRM A;  1TL8 A;  3W2W A;  1ZGW A;  3BQZ A;  3FKJ A;  1YRN B;  2LMD A;  4HF1 A;  1V5G A;  1AU7 A;  1FJL A;  4WWC A;  4BH9 A;  2R7Z J;  4BL0 B;  1GVD A;  1EH6 A;  4L9N A;  3BG3 A;  4XN0 A;  2QQ9 A;  3HKZ N;  1X4O A;  4F7Z A;  2Q2E B;  5DS9 A;  1P2F A;  3M1E A;  3TOA A;  2NVQ J;  2HXI A;  2VBY A;  1SD4 A;  1YX5 A;  2FBI A;  3FZV A;  1QNT A;  4JBA A;  1KA8 A;  5IOZ A;  4DNC A;  5ED4 A;  3I4M J;  4RM3 A;  3G71 I;  1X1B A;  1ZKG A;  1WJA A;  4AIH A;  3BCB A;  5A2Q K;  5HS7 A;  1A31 A;  2R5Z A;  1KU2 A;  3H0G J;  2NYX A;  3BPX A;  3G4S I;  3F0C A;  4ZDP A;  2FMY A;  4C2U A;  3BQY A;  3SZT A;  5J1R A;  1REP C;  1SAX A;  3FXQ A;  1UG0 A;  4M72 A;  4HNV A;  2YU9 J;  3JSO A;  1HW2 A;  3CCS I;  1H88 C;  1MKM A;  1O7F A;  4LG3 A;  5AIP A;  1RR7 A;  2JSC A;  3D1N I;  1EA3 A;  3ZP5 A;  3OSG A;  2ZFW A;  5GP9 A;  2Y0S A;  1Y1W J;  4MFE A;  3TBI A;  4YIF A;  2PLY A;  2Z3Y A;  1U5T B;  4M3E A;  1R5H A;  3K4M A;  3LA2 A;  3FXR A;  1ZK8 A;  2YU3 A;  4I76 A;  2E2H J;  4AC0 A;  4BHC A;  1F36 A;  2K9M A;  4YEL A;  3A01 B;  3K69 A;  1BW5 A;  3PFY A;  1VQM I;  4RM2 A;  2E36 A;  5E8G A;  3WOD F;  5K5R A;  4A12 A;  5IYC J;  3IUO A;  2IAI A;  2VN2 A;  3DQV C;  5HNF A;  3DEE A;  4YRV A;  2DK8 A;  1ORK A;  4XR6 A;  1YO5 C;  3S2W A;  1JGS A;  1U8R A;  3OMY A;  4BQQ A;  1U2W A;  1HF0 A;  2R7O A;  2G7H A;  2RAE A;  4ZDL A;  2DTR A;  2FX0 A;  2H6C A;  2JT1 A;  3CMM A;  4ZC3 A;  1KQ9 A;  4EJW A;  3O8G A;  5H2F C;  3LMM A;  2VBX A;  1PVE A;  2IGK A;  3B6A A;  3FMQ A;  4ENN A;  2F5F A;  4I7H A;  3DPL C;  2TRT A;  1CF7 A;  1X1D A;  2VI6 A;  2HVS A;  1DGW Y;  4IRI A;  5GPC A;  4IJA A;  2AHQ A;  3TQN A;  2CG4 A;  1R5G A;  3FWE A;  3ZXS A;  4PJN A;  2CV0 A;  3P5J A;  3TO6 A;  3S93 A;  3VEP A;  3ZQH A;  4U7D A;  5L3G A;  5EGO A;  1OPC A;  4FQG A;  2JPB A;  3OYF A;  2VOD A;  2Q2E A;  4UXN A;  1MIJ A;  3K1M A;  4V2F A;  3NWT A;  2COM A;  2GOM A;  3W6J B;  4RLQ A;  1FC3 A;  4EJT A;  1S6L A;  4D5C A;  4A93 J;  1MBH A;  1W7P D;  5BNG A;  3RZD J;  3GTL J;  2O0Y A;  2YSR A;  3GYH X;  1QHH D;  1TQM A;  2NS7 A;  5ILS A;  1V5F A;  2KMU A;  4XLE A;  1FIP A;  3M3Y J;  3KZY A;  1WZ2 A;  3DLL F;  1B6A A;  4XL9 A;  2O8K A;  2LH9 A;  3H3Z A;  3C2H A;  2DJN A;  2ZKZ A;  1MBE A;  3FM5 A;  1TC3 C;  3JTG A;  4IX7 A;  4ITV A;  1U5T A;  4KNY A;  4HQE A;  2F4I A;  2NRA C;  3K7A J;  3N97 A;  5JVG F;  1W5C C;  2DK5 A;  2Y30 A;  1DP7 P;  3U2R A;  2OUM A;  4UUT A;  3A01 A;  2L5Q A;  2ZJ2 A;  3LST A;  4A3L J;  5CVR A;  1N25 A;  1YX3 A;  4M6V A;  3J80 Z;  3KZZ A;  3E6D A;  3A2K A;  1BJA A;  3KZI C;  1XMK A;  3TO7 A;  4BXF A;  1MMD A;  2MBF A;  1YS6 A;  3OYG A;  2JRT A;  3BTJ A;  3ONQ A;  3EET A;  3ZQL A;  3BCA A;  1S3J A;  9ANT A;  2FRH A;  1ZRF A;  1Y0N A;  2BZT A;  2Y69 H;  1QHG A;  2HOE A;  4DZP A;  4KYW A;  3PO2 J;  4IVN A;  4XLH A;  3QOD A;  2PX9 A;  2JK3 A;  2WY7 Q;  3MKL A;  1R1U A;  2PFB A;  2RGV A;  5ILU A;  2XAG A;  2R0Q C;  2HXO A;  1FYL A;  3E5Q A;  5KAF C;  4M6Y A;  1HLV A;  4II2 A;  4XLC A;  3ZQQ A;  1P4W A;  1FOY A;  1LEB A;  5KK1 A;  1ENH A;  4YII A;  1X2N A;  3I64 A;  2D1H A;  1ETO A;  2MAB A;  4BHP A;  1R23 A;  2I5U A;  3QPH A;  5TIS C;  1G2H A;  5LHH A;  4UHT A;  2FF4 A;  2M34 A;  4ENK A;  4KIB A;  1GLN A;  1RET A;  2NVU B;  4X0G A;  5FKM A;  4CCL A;  2BW3 B;  1YFH A;  1YJN I;  5JHF A;  1J7K A;  1EKE A;  3CUQ A;  1OR7 A;  4RGR A;  1ZRC A;  1XPX A;  4G7O F;  3REO A;  1VZ0 A;  2K40 A;  3FF5 A;  1LDJ A;  2KIM A;  1ETX A;  3E97 A;  4PDK A;  3TW6 A;  4A3I J;  4BE1 A;  2DOE A;  5EYR A;  4BQO A;  4YFX F;  2VUM J;  4JX6 A;  2LY1 A;  2AS5 F;  3DBR B;  2AXT C;  1FMW A;  1E17 A;  3I54 A;  3FXU A;  3WHB A;  3IAS 2;  3LSK A;  4KMU X;  2D45 A;  2HOS A;  3VWB A;  3ESW B;  1X3U A;  4ESF A;  3KYD B;  4L5I A;  4M3B A;  4ZYG A;  1RUN A;  1RPW A;  1ZN2 A;  4C30 A;  3MZY A;  3NAU A;  1A5J A;  2RNJ A;  1BR1 A;  1R22 A;  1BI3 A;  1HKS A;  5E3N A;  1OYW A;  2X51 A;  2ZME A;  3K0L A;  3K6G A;  5TJJ A;  2Y75 A;  4XLP F;  2A3S A;  3SXY A;  5M5X J;  2E2I J;  2RV8 A;  3WTT C;  2VJ5 A;  3KP2 A;  1BR4 A;  4L9V A;  1VQN I;  1RES A;  4PSW A;  4UNO A;  2LKX A;  1YOV B;  2YX4 A;  3FXJ A;  1KQ0 A;  3BZK A;  1WRJ A;  2GQQ A;  1IJW C;  3AG1 H;  3PM1 A;  3RYR A;  2J5P A;  2EPF A;  4I02 A;  3Q9V A;  2O8X A;  4L5E A;  2EV6 A;  1MDM B;  5IP7 J;  2HOT A;  2CGP A;  4NDL A;  2CU7 A;  3PFI A;  2R3S A;  3V7R A;  3ABL H;  4IPA A;  3P7N A;  5C44 J;  1H9G A;  2HU9 A;  3JAM Z;  1STZ A;  2EQR A;  1ZG3 A;  3KX2 A;  2B63 J;  2A07 F;  4HA8 A;  1FBU A;  2KDO A;  3H5N A;  4YFK F;  1O3R A;  4BXX J;  2CMP A;  2VQC A;  3F8B A;  1MMG A;  1YE9 A;  4BEH A;  3FHZ A;  2OZU A;  4BQA A;  4M74 A;  3JRC A;  2XAS A;  4JOM A;  4PJ0 C;  1Z1D A;  4U88 A;  3IH4 A;  4OIR F;  2QKM B;  1ONV A;  1XG1 A;  4U0Y A;  3E6C C;  4DJA A;  1SVM A;  4N9I A;  2K9Q A;  2IBD A;  3RKW A;  3BR3 A;  1RRJ A;  1NHA A;  4AIJ A;  3ERM A;  5F08 A;  3T1B A;  2QZ8 A;  2XRO A;  4BJT A;  2V9P A;  3GUD A;  5HLH A;  1G3T A;  1P4X A;  1QO0 D;  3S3N A;  3OY9 A;  1JKR C;  2XPW A;  4FT8 A;  1QA6 A;  3BTC A;  2M5W A;  2PN6 A;  2ZB9 A;  1ZGJ A;  1J75 A;  3I9V 2;  1B9N A;  3GTJ J;  2MA3 A;  3HRT A;  1EV7 A;  2R7X A;  1VQK I;  3WGH A;  2FSW A;  3ERE D;  2FJ1 A;  2XGE A;  3A0H C;  1UMQ A;  4XKB A;  4CHU A;  3HC7 A;  2ELJ A;  3WTY C;  2XAJ A;  2W48 A;  4LIU A;  3GXO A;  1X1A A;  3RSN A;  1AKH B;  2K3P A;  2OF7 A;  4D1Q A;  4Q4Z F;  1IG7 A;  1UJ8 A;  2EA2 A;  4NBQ A;  1SFU A;  2WTE A;  2BGC A;  4MTE A;  5DCF A;  2YPR A;  1VQ7 I;  4KFC A;  1BR2 A;  4C3H J;  4DZJ A;  4S05 A;  3HSF A;  1HKT A;  4L0Z B;  1HCR A;  3EUH C;  1G6N A;  1Z7U A;  1HSJ A;  2P8T A;  3RPQ A;  5B1A H;  2F5C A;  3D5S C;  3HB9 A;  4UY8 I;  6PAX A;  1YLF A;  4Q5S F;  2F5D A;  3HJE A;  1IZ1 A;  2GAU A;  2L9V A;  5CVV A;  3SEZ A;  4EM2 A;  5C4J J;  3V8J A;  5DUI A;  2Y9Z A;  1HQC A;  4XRF A;  2VAS A;  4RGS A;  4LB5 A;  2B0L A;  3PO3 J;  2BHY A;  3M8E A;  2Y2Z A;  5BMZ A;  2I8D A;  2DTZ A;  1FMV A;  1VF9 A;  4FAS D;  4I6Z A;  2DAO A;  5ICC A;  4ZYA A;  1RI7 A;  5GAH J;  2XDV A;  4C3J J;  1T6S A;  2KFD A;  2R7S A;  2RQP A;  5EG0 B;  3CDL A;  2EFQ A;  2EJR A;  4FX0 A;  3BY6 A;  4AYB A;  4U7B A;  3HGY A;  3GZ5 A;  3QAH A;  2JSP A;  4QIW N;  3L1P A;  1EF4 A;  2CUJ A;  3S16 J;  2P6S A;  4N4N B;  1IRG A;  3EYY A;  4MEX F;  3DV8 A;  1TNS A;  3A03 A;  4ENJ A;  2HKO A;  3ZQG A;  3C1D A;  1R00 A;  4BBS J;  2IXS A;  2WV0 A;  4DBR A;  3F9K A;  2ELK A;  3VB2 A;  3DU6 A;  1OCP A;  1KZH A;  5JHU A;  1EH7 A;  1A04 A;  1X19 A;  3LSP A;  2ZFU A;  4IHW A;  2K4B A;  2JVH A;  5IOY A;  3TDZ C;  3QPL A;  1ON1 A;  4BDZ A;  1IN5 A;  1MMN A;  3SZP A;  1I39 A;  5KNL A;  4I99 C;  2IVM A;  2L7Z A;  3DP7 A;  2HKX A;  3W2V A;  1RIO H;  2E19 A;  2IS4 A;  5K1Y A;  4A3K J;  2BHZ A;  3X2Q H;  1MJA A;  3CC4 I;  2JA2 A;  3KP3 A;  2HNH A;  5F6F A;  3M4O J;  5HVQ C;  2OBP A;  4CZC A;  5E8I A;  2WA0 A;  3BTI A;  2V6C A;  4XN3 A;  2LBF B;  3WG7 H;  2F5V A;  2HPM A;  1D5V A;  1QBJ A;  4RB0 A;  5FRO A;  1MSF C;  2OZ6 A;  2EZL A;  1ZH5 A;  3DBL B;  2VJJ A;  4HST A;  1MBG A;  4ZH4 F;  5IP9 J;  5FFZ A;  2XSJ C;  1L3L A;  2Y48 A;  1JHH A;  5HOD A;  3C2B A;  4Y17 A;  2BV6 A;  3F6O A;  3HDD A;  1KU7 A;  4PSX A;  2Q1Z B;  2VKE A;  2RQQ A;  3FDY A;  2ME6 A;  3PJR A;  5HNH A;  1SMY F;  4BNC A;  4MTD A;  4RBO A;  2ADU A;  4IF4 A;  3BR6 A;  3MQ0 A;  2WC2 A;  4X1E A;  4WX9 A;  1LVK A;  3OYC A;  1YG2 A;  3LSH A;  3SDB A;  2M4G A;  1QRY A;  2LNB A;  2P81 A;  3TO9 A;  1H9T A;  3CES A;  1BC8 C;  5EG0 A;  1U8B A;  5JLW A;  3DLA A;  5DDG A;  1U5T C;  2P5V A;  1IN7 A;  3R0J A;  1YJ9 I;  3BOQ A;  3DEW A;  1JI8 A;  3ASN H;  4QWQ A;  1Y6I A;  4P5O A;  3VYS B;  1JJ8 C;  1MH3 A;  4XSX F;  1IDY A;  2LSO A;  5B3S H;  4ABZ A;  2E1C A;  1RNL A;  5F0F A;  1ZG1 A;  2R5Z B;  3GME A;  2GM4 A;  4RB2 C;  1HXD A;  4UUV A;  1VFC A;  2MC4 A;  3GLX A;  3HGG A;  3SZG A;  3OS2 A;  2XF7 A;  3KET A;  2R92 J;  2BVM A;  2XHK A;  2E1O A;  5DTD A;  2AO9 A;  2IA1 A;  1JXS A;  2J5O A;  4M3F A;  2COB A;  3MN2 A;  4MHG A;  3HSE A;  2DBB A;  3H1C A;  1BIB A;  1MW7 A;  2GBY A;  2VQH A;  4XBF A;  5K7F A;  2VB6 A;  4XRS G;  2QCO A;  3PL8 A;  2JVG A;  3F8C A;  4LGW A;  5H6Q A;  4RDU A;  1JGG A;  1MNE A;  1OCZ H;  1Q1V A;  3OIP A;  5D6E A;  4A3G J;  5C4X J;  1W4M A;  2NXN B;  2D5V A;  3I55 I;  4HEA 2;  1J9I A;  2X6W A;  2HTS A;  2DA6 A;  4QPQ A;  2OAZ A;  3LSM A;  4A3B J;  2JWT A;  3JSP A;  3KP5 A;  1HKQ A;  1FEX A;  1XGN A;  2JTV A;  1QVT A;  1IN8 A;  2LBF A;  3RYP A;  2H94 A;  2BY1 A;  2QSH X;  4BKX A;  4OWR B;  3OYK A;  1LFB A;  3KEQ A;  3CJR B;  2MH9 A;  3VFZ A;  2BVL A;  3QYE A;  4DYC A;  2PJR B;  1TWG J;  4OIP F;  1N77 A;  4XSZ F;  5IT9 Z;  1Z91 A;  4AVZ A;  2DW4 A;  4A0X A;  3K4K A;  1A6I A;  1BI0 A;  3LOC A;  2VC1 A;  1IXS B;  2VOO A;  3U1D A;  3GFL A;  3VPR A;  3A1Y A;  2KT0 A;  3K2Z A;  4XKC A;  1FPQ A;  3BJO A;  3G1O A;  2Y0M A;  2Z5U A;  1S29 A;  4JK1 X;  1ZHF A;  3E0J B;  1K7A A;  3CDH A;  1CF7 B;  4ZYE A;  3FIS A;  5CQE A;  1KYZ A;  1Z67 A;  1X2M A;  2E1M B;  3N05 A;  1ZR2 A;  2OTL I;  2IS2 A;  1OKR A;  4LLL A;  4A3F J;  5DEQ A;  2VC0 A;  1MJ9 A;  5EGO B;  2QEX I;  3WU1 B;  4HX8 A;  2PJP A;  4XOT A;  3OYA A;  2R93 J;  2DA2 A;  2Z16 A;  4FE7 A;  3IV5 A;  1K79 A;  4CCO A;  3DXJ F;  5J6X A;  1I27 A;  4KIT B;  2X9D A;  1F1Z A;  3QPS A;  2X6Y A;  4ZDO A;  4I0B A;  3HUG A;  3CMY A;  4KT6 A;  2H09 A;  3HTU A;  1W5S A;  1R58 A;  3R60 A;  3OYB A;  2V7F A;  5M3F J;  3ZQI A;  3IWZ A;  3OV8 A;  4RAG A;  4NQW B;  5EZG A;  2GLO A;  3LA3 A;  3CD6 I;  3MAJ A;  2EH3 A;  2ECC A;  3TDU C;  4XQF A;  3RI4 A;  2KZG A;  4G94 A;  4G6D A;  4M6X A;  1H0M A;  4Z6Y A;  4IHT A;  3JCU C;  4ESJ A;  2E2J J;  2NVT J;  3BR1 A;  2XC7 A;  2DMT A;  1MNM C;  4MLO A;  1Z3X A;  2DOA A;  2KHM A;  4EAT A;  3IP4 B;  1IRZ A;  3SQN A;  4H0E A;  4WXH A;  5J1U A;  3M7G A;  1T0F A;  2RNG A;  3HOY J;  4PCQ A;  2CUZ A;  3CLQ A;  2MC3 A;  5BPD A;  1YTY A;  3S1R J;  3ZGK A;  2MFZ A;  2OJE D;  1DU0 A;  5FB2 A;  1VQ5 I;  2GWR A;  4CDG A;  4IOC F;  3WU2 C;  3FX3 A;  2PJR A;  2KIF A;  1SFX A;  2PQ8 A;  4KA4 A;  3OSF A;  1I6H J;  1QU3 A;  4YIR X;  2IW5 A;  2W57 A;  3BC8 A;  4HF2 A;  3U21 A;  3ZMV A;  1LFU P;  2JA7 J;  2QVO A;  3GTP J;  1ZTR A;  3NAR A;  1WCM J;  4UVC A;  1T38 A;  5E17 F;  2DFI A;  2HVQ A;  5ILV A;  5GTI C;  3G73 A;  2ACJ A;  1QVU A;  5J40 A;  5HDN A;  1YS7 A;  5FKN A;  3T8R A;  4DIQ A;  2EB7 A;  1SFE A;  4XRS A;  1B72 B;  1FOW A;  5J8F A;  1RC9 A;  2IEK A;  1KQ8 A;  1VQ9 I;  4N4O B;  4KN7 X;  3IL2 A;  3S14 J;  3IAM 2;  3VOD A;  1PUF A;  5JR3 A;  3QYB A;  2DYR H;  1DDN A;  1GDT A;  1ULY A;  3ML6 A;  4XIC A;  1WSU A;  4NUB A;  4QTR A;  1D1C A;  2DLL A;  4XRM A;  1OFC X;  2M4K A;  4AU7 A;  4NC7 A;  2VE8 A;  1ACI A;  2QSF X;  2CUE A;  1ODD A;  1BW6 A;  2KLO A;  2EIJ H;  3CUQ B;  3RPU A;  4IRG A;  3GFM A;  5FD6 A;  3CCQ I;  1GXP A;  3K1P A;  2X1D A;  4U0V A;  3CLO A;  2X0L A;  4PJM A;  2DOD A;  2HDW A;  3GZN B;  1IRX A;  3HOX J;  3HL2 A;  2EFO A;  2HTJ A;  2A6E F;  4V19 K;  2IJL A;  2IGM A;  2M8G X;  1VQ4 I;  5L3C A;  1B8I B;  2HDD A;  4BJ5 C;  1XD7 A;  2GA1 A;  4RLF A;  4NQW A;  3MKW B;  1Z6T A;  3WGG A;  1XMX A;  4I01 A;  2CW7 A;  5J47 A;  2VPR A;  2IA0 A;  4M3G A;  3UNG C;  2VOP A;  2VQL A;  2E5Z A;  1DP3 A;  1R71 A;  3NEU A;  3SDG A;  3ECO A;  2ZNY A;  1YIT I;  1QZY A;  2ZME B;  2TDX A;  3GTM J;  2LY9 A;  5IT3 A;  3MD2 A;  1JE8 A;  3S3O A;  3C2G A;  1BOB A;  1K4S A;  4XKV A;  1GT0 C;  3NRV A;  3KYL A;  2LP0 A;  1XMA A;  4GYG A;  1BI2 A;  3M9A A;  3K4B A;  3NQO A;  4BQN A;  4A3E J;  2E1N A;  1VQ8 I;  3WE2 A;  4P55 A;  3V4G A;  1Y1V J;  3DEU A;  4B8X A;  2W4S A;  2X6X A;  2V1X A;  3OS1 A;  3LAJ A;  4FTH A;  3I5U A;  3J80 K;  5F0H A;  2WAD A;  4M71 A;  5LD2 C;  2K9L A;  3RQ4 A;  4DYQ A;  5FLX Z;  3NWS A;  2VPL A;  2L7M P;  4J00 A;  3E7L A;  4F55 A;  1Z21 A;  1GV5 A;  5FLX K;  3FIW A;  1MBJ A;  4MGR A;  4M9X A;  4L5J A;  2MD0 A;  2EFP A;  2RN7 A;  1NK2 P;  2WAE A;  2JN6 A;  2KJC A;  1BM9 A;  4BEH B;  4BHB A;  5DD8 A;  4GCV A;  2ELH A;  4K2E A;  4B4C A;  1YW8 A;  5BOX A;  2QBY B;  3ZPL A;  1B72 A;  2IS6 A;  3JRE A;  1A36 A;  2DI3 A;  4UVA A;  3S1N J;  3K4J A;  4F3Q A;  2WAF A;  1JKP C;  2FA5 A;  2DA5 A;  2Q8K A;  3U1K A;  5HLG A;  1JTX A;  5GPA A;  4B3X A;  4F93 B;  3C7J A;  4F91 B;  2HZD A;  3L2V A;  1T33 A;  3BZC A;  4MO7 A;  1S5L C;  1UST A;  4OIQ F;  2Y0S N;  1VQO I;  4UV9 A;  3ZMZ A;  2W24 A;  2GIV A;  3BPV A;  3HOT A;  4GRI A;  2UXN A;  2ZBK A;  1DPR A;  5CVU A;  3AFH A;  1BL0 A;  2AXL A;  3V7C A;  3ISP A;  2RRE A;  1IW7 F;  1O3S A;  4ZYH A;  1FZP B;  3OOP A;  4NC8 A;  1T98 A;  5J4V A;  1OJL A;  1B8I A;  3CP8 A;  1U9O A;  2ZC2 A;  3CC7 I;  1YQA A;  4MFD A;  4L0Y B;  4NNJ A;  2ZJQ F;  2CV2 A;  1E2X A;  1GUU A;  4XOR A;  4XLN F;  4IOA F;  5E20 A;  2H1K A;  4GFB A;  3IHU A;  2CQN A;  3MKZ A;  1V55 H;  4GGG A;  2A68 F;  2HZT A;  1NG6 A;  1OQY A;  3BR0 A;  2KIQ A;  3F8N A;  4JYK A;  1ZYR F;  2D2W A;  4UB8 C;  3CP2 A;  2HI3 A;  4ETS A;  1R9T J;  2TCT A;  2P5K A;  2M87 A;  4P1W A;  1T2K A;  1MH4 A;  1OCO H;  1WWX A;  3OIO A;  3H9J A;  4WXD A;  1FYM A;  1MSE C;  1V4R A;  1Y8Q B;  1BIA A;  4J01 A;  1BBY A;  2FQ4 A;  3I71 A;  5M5Y J;  2DN0 A;  3FMR A;  3Q0V A;  3JRH A;  3CO6 C;  4HW0 A;  3IKT A;  3V8L A;  2LD5 A;  4JP0 A;  2DDB A;  2CFO A;  5L3F A;  3HPG A;  1WKM A;  3F23 A;  3DU5 A;  4IRH A;  4M9Z A;  2KL4 A;  4B48 A;  1VND A;  2YS9 A;  3KP6 A;  1G8X A;  3EPZ A;  4EJV A;  1P7I A;  3I56 I;  3PUF A;  1G3W A;  1P9Q C;  5EDN A;  2R7T A;  4NHJ A;  2E7X A;  1FTZ A;  1G3Y A;  1UB9 A;  2KKO A;  1ZLJ A;  2CH0 A;  1DUX C;  4BS9 A;  4XK4 A;  1PJR A;  3MZ8 A;  1LDK B;  1XSD A;  3P9I A;  2R7R A;  3S17 J;  2P6T A;  2W1O A;  4ON0 A;  3JAM K;  2VKV A;  4LLG F;  3VOE A;  2DJI A;  2V6E A;  1BA5 A;  2F48 A;  3MKY B;  2NVX J;  3OYE A;  4E7K A;  1OCR H;  2VKD A;  4BAY A;  1UEL B;  1XDS A;  3GCM A;  3T8T A;  2FXA A;  4LG0 A;  3GW2 A;  2QBY A;  2E60 A;  2GIZ A;  3ROU A;  3S15 J;  3LFK A;  5LFA A;  2MLG A;  3CF2 A;  3HOW J;  4QLC U;  3BRO A;  4PJJ A;  5EEG A;  4D0P A;  1ZGA A;  4ZTJ A;  2BEO A;  3FK7 A;  1HST A;  3CF5 F;  2X85 A;  5F27 A;  1ZRE A;  2OU2 A;  2JA6 J;  3AG2 H;  3I3L A;  2YUS A;  2MG4 A;  2A5W A;  2B9S A;  1NK3 P;  2F5E A;  2QQA A;  1YJW I;  2Z9O A;  2QKL B;  1XB4 A;  1WJD A;  2KP6 A;  5JFR A;  3LSR A;  2VXZ A;  4RGX A;  3M1C A;  3D5R C;  5JVT A;  1TNT A;  1IO2 A;  1WFX A;  5FKL A;  4A69 C;  3V42 A;  5HDK A;  2VJI A;  5K7Z A;  2LF7 A;  4IZZ A;  4I2O A;  2X48 A;  2DO7 A;  2V1D A;  3E6B A;  4BBR J;  4FX4 A;  1ZLK A;  1P4A A;  4LLN A;  1HDP A;  4A5M A;  2HS5 A;  2LDU A;  2QQ8 A;  3B73 A;  1J09 A;  3OWT A;  1WJC A;  4WK8 F;  3DTI A;  1T8I A;  1XGM A;  4AM3 A;  5E79 C;  4HG2 A;  1J2X A;  3BR2 A;  3L9F A;  4OMY A;  2R7U A;  2JPC A;  3G1L A;  2ZJP F;  2LTP A;  4BU2 A;  3S1Q J;  3J7A O;  1N75 A;  2M1B A;  2H8R A;  1ZAO A;  1FT9 A;  4GYI A;  2WV1 A;  2XRN A;  4EM1 A;  4JX4 A;  3CCU I;  2FE3 A;  1NH3 A;  1SD5 A;  4A5N A;  2XPV A;  3H5A A;  4PK4 A;  3IC7 A;  2STW A;  2ECB A;  4HX4 A;  1TBX A;  3DPU A;  4EGY A;  1JT6 A;  4Y33 A;  3LSJ A;  1ZR4 A;  1FP2 A;  4PGH A;  4CGZ A;  4B44 A;  2UXX A;  2PMZ N;  4GXO A;  2WAQ N;  3EYI A;  1KU3 A;  2D1V A;  2EZK A;  4PJL A;  1O7L A;  3WTV C;  4ZJZ A;  2K9N A;  3VYR B;  3G6E I;  1UHM A;  3OOU A;  1LQ1 A;  2K86 A;  2Z2S B;  4EV0 A;  1JTY A;  4ANJ A;  4EM0 B;  4WCG A;  4FET A;  2H6B A;  3J7A Y;  3RPU D;  4OAZ A;  1I1G A;  1IUY A;  1CQT A;  5CVI A;  3DCF A;  2M45 A;  3RKY A;  3PIO F;  2M7B A;  1G59 A;  4PZJ A;  5LGT A;  2ZXJ A;  4XON A;  1RUO A;  3K4L A;  5EJC A;  3H92 A;  1I1S A;  3CCR I;  1D0Z A;  4XLA A;  4CUG A;  3U9G A;  2M8E A;  4EGZ A;  1W5T A;  1ZRD A;  2M9H A;  1TQI A;  2EIL H;  2XKO A;  4KMF A;  4XMY A;  1HW5 A;  4HAM A;  3J7Y J;  2CJJ A;  3CQZ J;  2WY8 Q;  3ASO H;  1LJ9 A;  1WJ5 A;  3BR5 A;  2IGO A;  2NOG A;  4A3M J;  4KUM A;  2K9S A;  4IXA A;  2RC4 A;  4BAC A;  3KLN A;  3TP0 A;  5B66 C;  4E70 A;  4PFO A;  4HNU A;  3CJQ B;  3JRG A;  1HOM A;  1SVO A;  2BXZ A;  3WTW C;  2L3D A;  3E5U A;  2DFE A;  2V26 A;  2VIX A;  1O3T A;  3DKY A;  3I0T A;  3WE3 A;  1LEA A;  1FSE A;  3MWM A;  3QOE A;  1D1B A;  4V2G A;  1S7O A;  1S72 I;  1YIO A;  2CSO A;  1F9N A;  3TP3 A;  1U6G A;  4L18 B;  2CS3 A;  4E7Z A;  5H20 A;  4IL6 C;  3GF2 A;  3E5X A;  1F5T A;  4XM3 A;  1XCB A;  4HLY A;  1LKX A;  3WTS C;  2E1M C;  5CJ9 A;  1FBQ A;  3HKZ A;  2DDA A;  1DQU A;  3L2R A;  3H0D A;  2Y31 A;  1JUM A;  1U0J A;  3ZRG A;  2XGD A;  3V8K A;  4G6Q A;  3PIP F;  3RKX A;  3WU0 A;  1YYV A;  3OR2 C;  1TW2 A;  3OL3 A;  3JR9 A;  5IYD J;  2LFB A;  2NNY A;  1Q1H A;  3AG3 H;  3GBG A;  1HBX G;  3I53 A;  4G7H F;  2XAH A;  1X1C A;  1W7P A;  4OIN F;  1FOK A;  4E7S A;  2CW8 A;  3TL4 X;  3O2P E;  5C3E J;  3H3U A;  5K5Q A;  5CLS A;  4HRI A;  1YW7 A;  1X3W B;  4P9U A;  4RGU A;  4ASN A;  4Y15 A;  2Q0O A;  1FIA A;  3CJT B;  2G7U A;  3N4M A;  1E0E A;  2HYJ A;  2P0W A;  2XIG A;  3DPT A;  3VSL A;  1YHQ I;  2FBH A;  1IXR C;  3FHN A;  3HOS A;  1FYK A;  3FXL A;  3CC2 I;  2LG4 A;  1VI0 A;  3BP8 A;  4CCJ A;  2ID6 A;  4BJ6 C;  2L01 A;  3H35 A;  1JKQ C;  3LWF A;  2MYS A;  1MZB A;  3HG9 A;  1U78 A;  4G7Z F;  2RDP A;  3HRS A;  2K5C A;  3W6K B;  3L2U A;  2BY0 A;  2VON A;  5F1R A;  2QYO A;  1TLH B;  1XN7 A;  2STT A;  2EA4 A;  3WTX C;  1Z77 A;  2KRC A;  2ZJR F;  3SEQ A;  3O8H A;  3DTE A;  3HUG B;  5D5X B;  1NTC A;  3F21 A;  3B02 A;  1J5Y A;  1XCV A;  3FKI J;  5IY5 H;  5D5V B;  3EDP A;  4LIV A;  3WTZ A;  5CQG A;  2FEZ A;  4II3 A;  1WH7 A;  2LK2 A;  3L09 A;  2L9S A;  2LF8 A;  5D4R A;  1X58 A;  1LFP A;  1XS9 A;  3ABU A;  1LVA A;  4A3C J;  5LEJ A;  1OYI A;  4YG2 F;  2V1N A;  2EBI A;  3EUK L;  5DCM B;  3LNQ A;  2OV7 A;  3MZH A;  4M73 A;  1MBF A;  2MGQ A;  3CME I;  2NAZ A;  2LKS A;  2L02 A;  1D8J A;  4W97 A;  3FXM A;  3LSG A;  1HC8 A;  3HZJ A;  2OA4 A;  1IN6 A;  3ZQ7 A;  3GFJ A;  5DYM A;  4JX5 A;  1PP7 U;  2Z33 A;  3LFU A;  4E6K G;  3GEZ A;  5J8C A;  1FBS A;  2R7F A;  2KPM A;  2R7Q A;  3TKY A;  2O9L A;  5D6F A;  4AIK A;  4C3I J;  3CCJ I;  1UHW A;  3JRA A;  2ZXH A;  2FML A;  4RAF A;  1ZG5 A;  1PP8 F;  2RVC A;  2NS0 A;  1ITY A;  5FRM A;  4PUS A;  3A4C A;  4GO1 A;  1D1A A;  4B09 A;  5DM7 F;  3GTO J;  3K4C A;  3ZMS A;  4AID A;  2P5L C;  5E18 F;  4CZZ A;  3GO5 A;  1VQP I;  1RR8 C;  2I10 A;  4BE0 A;  1TQP A;  2DYS H;  2OTJ I;  3CUQ C;  1OR7 C;  4PFP A;  2EIM H;  3P9K A;  1JKO C;  5L3D A;  1EJ9 A;  5IT9 K;  2NVY J;  2LR8 A;  3HBL A;  2PBI A;  5LLQ A;  4Y7N J;  2XUB A;  1V5E A;  4QPO A;  4AYB N;  4D9J A;  1T39 A;  5AON A;  1R1T A;  3Q0U A;  3FBI B;  1R4M B;  5J3L A;  1OIS A;  1BC7 C;  4E7J A;  2EV5 A;  3G3Z A;  4EJO A;  2P7V B;  3LQR A;  3Q9S A;  2ID3 A;  4CO8 A;  2O61 A;  1DGR M;  3E6M A;  2EIK H;  3OS0 A;  2P4W A;  5D5U B;  3KFW X;  3TW7 A;  3GTQ J;  2FQ3 A;  2E34 A;  4G8X A;  4KIC A;  3CCY A;  3GX4 X;  4ZZL A;  4HPQ A;  1TWH J;  4CXF A;  3R61 A;  1PUF B;  5LHI A;  2L4M A;  3SJM A;  2VKH A;  4WF2 A;  1FSH A;  4HOB A;  1R4N B;  5D8L B;  1R36 A;  4FIS A;  2ZME C;  3J81 Z;  1RKW A;  2HVR A;  1R6R A;  3CDI A;  2KRH A;  2HPI A;  3QOP A;  2F2E A;  3IRQ A;  2K27 A;  3AL0 B;  3J81 K;  1FLI A;  3F3X A;  1TT0 A;  3OYL A;  3CTA A;  4CA0 A;  2PG4 A;  2LLK A;  4KIG A;  3HOU J;  4LFU A;  1GVJ A;  1SC7 A;  2V9K A;  3S32 A;  3H36 A;  3UKG A;  3KEO A;  4HZF A;  1SAU A;  3MEX A;  3S1M J;  1BOA A;  2K4J A;  3QP5 A;  3T0Y A;  1IDZ A;  2HQA A;  2X4H A;  2FNA A;  1M1E B;  4LK1 F;  3ZQF A;  2IGN A;  3EUH A;  1NG7 A;  4MQV A;  3S2D J;  5AIQ A;  1TW3 A;  3M8F A;  1KYW A;  5DCM A;  3OYH A;  4I0A A;  5A2Q Z;  2GXG A;  1QPI A;  3PNT A;  4MNU A;  1O4X A;  2R7D A;  3VSK A;  1Z6R A;  3DFG A;  5HOO A;  4J19 A;  4Z2Y A;  3CUO A;  1HA8 A;  1OMI A;  4G12 A;  5BQT A;  4DOZ A;  4P96 A;  2NOJ B;  4UUS B;  3H5R A;  3K70 D;  4CIC A;  3M07 A;  2M3A A;  1GXQ A;  4L9T A;  3GTK J;  2JRM A;  2XV4 S;  1I5Z A;  4BGD A;  3F22 A;  3OIQ A;  1AWC A;  3PSI A;  2UWM A;  3I4P A;  1E3O C;  1P92 A;  4IQ4 A;  3ABK H;  1APL C;  1P6R A;  1W36 D;  4M9S A;  1KGS A;  2ISY A;  4UB6 C;  3ABT A;  2Z99 A;  3PQK A;  3TOB A;  1FWZ A;  2LKP A;  2JMW A;  2MSY A;  3HOV J;  5CKT A;  1SAN A;  5LGU A;  1XGS A;  2CQ7 A;  2DOF A;  2E7W A;  3ZR8 X;  2KDZ A;  2VE9 A;  1F43 A;  2KIU A;  2BYV E;  3SFI A;  4AD9 A;  5GAD J;  3QU3 A;  1A6Q A;  2GA2 A;  2JA5 J;  3HHH A;  3EQL F;  3FXK A;  5DV5 A;  1USS A;  4Y52 J;  4AVP A;  2Z1D A;  1AOY A;  4P9F A;  3FXO A;  4KN4 X;  3JRF A;  4CYC B;  3KP4 A;  2GOX B;  4OMZ A;  3FM3 A;  4RS8 A;  3BG9 A;  2W25 A;  5LHG A;  5J1Y A;  2DPU A;  3HRU A;  5FKO A;  3ZMD A;  4M3D A;  3LA7 A;  1SVL A;  4EQQ A;  1OCC H;  3BLY A;  3F8M A;  4G9Y A;  3OYJ A;  3QU6 A;  4DYR A;  2L0K A;  1KU9 A;  1WI9 A;  2DU9 A;  2H27 A;  5D5W B;  1UG2 A;  3QWL A;  4A0Y A;  2ISZ A;  2K3F A;  1BN5 A;  1I50 J;  2A6H F;  1K6O A;  4E7L A;  2W7N A;  2NS8 A;  1YRN A;  4XNF A;  3EUA A;  5K5O A;  1B4A A;  2M30 A;  1PDN C;  3E1S A;  1SFK A;  1Z7L A;  2XVC A;  3RZO J;  2OPT A;  4XLF A;  4RA2 A;  1UHS A;  5EF6 A;  3OYM A;  3R6S A;  3H9Q A;  2BE5 F;  1XSX A;  3QYF A;  2N8G A;  3RDI A;  3AKZ A;  2QQB A;  2IRF G;  2LY2 A;  3HXL A;  2XF6 A;  3OYD A;  2XSD C;  1Y56 A;  1ZAR A;  1FOX A;  4LOC A;  1W0U A;  3COA C;  2WB1 N;  3K70 C;  4XOP A;  3C18 A;  3ECH A;  4BUP A;  2X6O A;  2AQF A;  3TED A;  4D5F A;  2M7A A;  1D5Y A;  5L3E A;  3H9G A;  1W36 C;  1K4T A;  2W82 A;  2A61 A;  2XGC A;  2PMU A;  4UUS A;  3CCL I;  2V4J C;  2DA3 A; 
#chains in the Genus database with same CATH homology
 1ZGW A;  2E19 A;  3S15 J;  3BQZ A;  4A3K J;  2CQQ A;  1YRN B;  1AU7 A;  1FJL A;  3HOW J;  2R7Z J;  1GVD A;  5E3O A;  1W0T A;  3M4O J;  3FK7 A;  1HDD C;  2DMQ A;  5F27 A;  3BTI A;  2JA6 J;  3BG3 A;  2YUS A;  2MG4 A;  3HKZ N;  5DS9 A;  1NK3 P;  1MSF C;  2XPU A;  5IYB J;  2EZL A;  2NVQ J;  1ETK A;  2HXI A;  5E3M A;  3LSR A;  3I4M J;  1MBG A;  5IP9 J;  5IOZ A;  1GV2 A;  5FKL A;  4A69 C;  1JUS A;  1ZKG A;  5M3M J;  5HOD A;  3C2B A;  3HDD A;  2R5Z A;  5K7Z A;  3H0G J;  3F0C A;  2X48 A;  3BQY A;  2VKE A;  2ME6 A;  5J1R A;  4BBR J;  4CYC A;  1HDP A;  4RBO A;  5M5W J;  4HNV A;  2YU9 J;  3Q0W A;  3BR6 A;  2DA4 A;  4MIM A;  4X1E A;  1IV6 A;  1H88 C;  3GTG J;  3OSG A;  1RR7 A;  3BR2 A;  3D1N I;  3Q3S A;  5GP9 A;  3G1L A;  2LTP A;  1ETW A;  2R5Y B;  1Y1W J;  3S1Q J;  1QRY A;  4A3D J;  4MFE A;  2P81 A;  2H8R A;  1IC8 A;  4M3E A;  2WV1 A;  4JX4 A;  5EG0 A;  1ZK8 A;  1U8B A;  5JLW A;  4I76 A;  1K83 J;  2FD5 A;  2E2H J;  2XPV A;  4AC0 A;  3DEW A;  1F36 A;  2ECB A;  4C2M J;  3A01 B;  1BW5 A;  1JT6 A;  3LSJ A;  1ZR4 A;  1JJ8 C;  1MH3 A;  1IDY A;  2PMZ N;  4ABZ A;  2WAQ N;  5F0F A;  2R5Z B;  2EZK A;  1K61 A;  2GM4 A;  5IYC J;  2K9N A;  1VFC A;  2IAI A;  5E3L A;  3HGG A;  3OOU A;  1TWC J;  1ORK A;  1WGX A;  2R92 J;  2E1O A;  5DTD A;  2AO9 A;  4M3F A;  1JTY A;  2COB A;  4AUX A;  3MN2 A;  1HF0 A;  2GBY A;  1CQT A;  3DCF A;  5K7F A;  2RAE A;  2O7O A;  4XRS G;  2QCO A;  2FX0 A;  3O8G A;  4RDU A;  1WH5 A;  1JGG A;  1Q1V A;  3B6A A;  4A3G J;  2D5V A;  5C4X J;  2TRT A;  2VI6 A;  2DA6 A;  5GPC A;  2AHQ A;  4A3B J;  2M9H A;  2JWT A;  3RQI A;  4BY1 J;  2CJJ A;  3K2A A;  3CQZ J;  3ZQH A;  5EGO A;  3BR5 A;  1FEX A;  1JUP A;  1QVT A;  2NOG A;  4A3M J;  2K9S A;  4BKX A;  3TP0 A;  1LFB A;  3JRG A;  1HOM A;  4DYC A;  4V2F A;  1TWG J;  3HM5 A;  1A6I A;  3LOC A;  4D5C A;  4A93 J;  1MBH A;  3JRI A;  5BNG A;  3FK6 A;  3VPR A;  3RZD J;  2KT0 A;  3GTL J;  4V2G A;  3G1O A;  3A02 A;  3TP3 A;  2NS7 A;  5JLX A;  5IP6 A;  1FIP A;  3M3Y J;  3FIS A;  1X2M A;  2O8K A;  1ZR2 A;  2R5Y A;  4A3F J;  5EGO B;  2DJN A;  1MBE A;  1TC3 C;  2Y31 A;  2R93 J;  1JUM A;  2DA2 A;  5F0C A;  3B6C A;  2XGD A;  4IHV A;  4FE7 A;  3K7A J;  2EZH A;  3IV5 A;  2Y30 A;  3JR9 A;  5IYD J;  2LFB A;  2X9D A;  4UUT A;  3A01 A;  3GBG A;  1BJZ A;  4A3L J;  3QPS A;  2MW8 A;  4M6V A;  2JJ7 A;  5C3E J;  3CMY A;  2XB0 X;  5M3F J;  3ZQI A;  1FIA A;  2LVS A;  2HYJ A;  3BTJ A;  5EZG A;  3ZQL A;  2GLO A;  9ANT A;  2EH3 A;  2ECC A;  4DW6 A;  4DZP A;  3PO2 J;  1VI0 A;  4IHY A;  3RKQ A;  2JK3 A;  3QQA A;  3MKL A;  2ID6 A;  5FLM J;  2R0Q C;  2HXO A;  2NVT J;  1Z0X A;  2E2J J;  3BR1 A;  1JKQ C;  2DMT A;  1MNM C;  3W6V A;  4MLO A;  1U78 A;  1HLV A;  1IRZ A;  5FKK A;  5J1U A;  1H89 C;  2XRL A;  3HOY J;  1ENH A;  1X2N A;  1Z77 A;  1ETO A;  3S1R J;  1G2H A;  3O8H A;  1NTC A;  4X6A J;  1DU0 A;  1TWA J;  1ETV A;  2M34 A;  3FKI J;  1RET A;  5IPA A;  5FKM A;  2LK2 A;  1WH7 A;  3WHC A;  5FJ8 J;  5F1J A;  3OSF A;  2JA8 J;  1I6H J;  1X58 A;  2Y9Y A;  1XS9 A;  4A3C J;  2K40 A;  2JA7 J;  1LFU P;  4A3I J;  1ETX A;  3TW6 A;  3GTP J;  1ZTR A;  2EBI A;  2DMU A;  3NAR A;  4FE4 A;  5EYR A;  1WCM J;  3LNQ A;  2VUM J;  4JX6 A;  3ZOB A;  1MBF A;  2MGQ A;  4S0H B;  1QVU A;  4W97 A;  3WHB A;  3LSG A;  1JT0 A;  2ME0 A;  5FKN A;  2HOS A;  2HOA A;  3BTL A;  3G1M A;  4JX5 A;  4M3B A;  4XRS A;  1B72 B;  1OCT C;  1U9N A;  2IEK A;  1RPW A;  3S14 J;  2DMN A;  1P7J A;  4D7M A;  3NAU A;  1A5J A;  1PUF A;  5E3N A;  2O9L A;  1GDT A;  4XIC A;  4C3I J;  4QTR A;  3JRA A;  4XRM A;  1OFC X;  5M5X J;  1ITY A;  2E2I J;  3GTO J;  2CUE A;  1BW6 A;  3BT9 A;  2I10 A;  1RES A;  2G0E A;  2LKX A;  1JKO C;  2NVY J;  2LR8 A;  3HBL A;  3HOX J;  1TWF J;  1IJW C;  3BG5 A;  3PM1 A;  4AYB N;  4Y7N J;  1LE8 B;  3H3V K;  2M8G X;  2HQ5 A;  2HDD A;  3Q0U A;  4L5E A;  1B8I B;  5IP7 J;  4FCY A;  2HOT A;  5J3L A;  2QF7 A;  3MVP A;  4NDL A;  2CU7 A;  2ID3 A;  3JRD A;  4W1U A;  4EEF G;  1H8A C;  2VPR A;  4M3G A;  3TW7 A;  3GTQ J;  5C44 J;  3CCY A;  2EQR A;  1TWH J;  2B63 J;  4IEJ A;  4BXX J;  1PUF B;  3SDG A;  3SJM A;  1WPK A;  2L9R A;  3GTM J;  1ETY A;  2LY9 A;  4A3J J;  4FIS A;  3JRC A;  1RKW A;  3IH4 A;  1GT0 C;  1XG1 A;  4IHX A;  2LP0 A;  3S2H J;  4A3E J;  2K9Q A;  2LLK A;  2IBD A;  3HOU J;  1AKH A;  1Y1V J;  3BR3 A;  5K7H A;  4FTH A;  3UKG A;  1S7E A;  5F08 A;  2M2E A;  5F0H A;  1MBK A;  3S1M J;  1IDZ A;  3JRB A;  4B3A A;  5F04 A;  4DYQ A;  3ZQF A;  1IUF A;  1JKR C;  4XID A;  2XPW A;  3S2D J;  2L7M P;  3E7L A;  1GV5 A;  3BTC A;  2ZB9 A;  3FIW A;  2EZI A;  1MBJ A;  1QPI A;  3I4N J;  3GTJ J;  1O4X A;  1NK2 P;  2JN6 A;  4J19 A;  4B4C A;  2FJ1 A;  3HEF A;  2XGE A;  4G12 A;  4QSH A;  4UUS B;  1B72 A;  1UMQ A;  3JRE A;  3S1N J;  1FTT A;  2W48 A;  3GTK J;  1JKP C;  1JJ6 C;  1AKH B;  2DA5 A;  4B1R A;  1JTX A;  2OF7 A;  5GPA A;  1E3O C;  1APL C;  1T33 A;  4MO7 A;  1IG7 A;  4D7N A;  2Y0S N;  2JMW A;  2MSY A;  3HOV J;  1SAN A;  2M0C A;  1BL0 A;  4C3H J;  4DZJ A;  1HCR A;  2KDZ A;  1F43 A;  1LE8 A;  1I3Q J;  3SFI A;  2L7F P;  1AHD P;  1OJL A;  3HB9 A;  1POG A;  3HOZ J;  1B8I A;  2JA5 J;  1U9O A;  4Y52 J;  4MFD A;  1GUU A;  5C4J J;  3JRF A;  2Y9Z A;  4CYC B;  2H1K A;  4GFB A;  2DMP A;  2DA7 A;  1ZQ3 P;  3BG9 A;  3BR0 A;  2CUF A;  5J1Y A;  4BY7 J;  3PO3 J;  4JYK A;  5FKO A;  4M3D A;  2Y2Z A;  1R9T J;  2HI3 A;  2TCT A;  4DYR A;  4I6Z A;  2DTZ A;  1VF9 A;  2L0K A;  2XB5 A;  1MH4 A;  1UG2 A;  3OIO A;  1MSE C;  1I50 J;  4C3J J;  2CQX A;  5EG0 B;  3CDL A;  2NS8 A;  2FQ4 A;  5M5Y J;  2DN0 A;  3Q0V A;  3JRH A;  1YRN A;  3HGY A;  2LD5 A;  4JP0 A;  1IGN A;  3RZO J;  2OPT A;  4QIW N;  3L1P A;  3S16 J;  1EF4 A;  1SFO J;  1DU6 A;  1UHS A;  5EF6 A;  3A03 A;  3ZQG A;  1ETQ A;  1RKT A;  1VND A;  2YS9 A;  4BBS J;  2CRG A;  2N8G A;  1P7I A;  5EZH A;  2XSD C;  5EDN A;  2ELK A;  1OCP A;  3ZQC A;  1WI3 A;  1XC5 A;  2DA1 A;  3IH3 A;  4LOC A;  1W0U A;  1FTZ A;  2WB1 N;  5EEA A;  3LSP A;  4IHW A;  4XK4 A;  2X6O A;  3S17 J;  5IOY A;  5FLV A;  3QPL A;  3TED A;  2VKV A;  3IH2 A;  1BA5 A;  2NVX J;  4D5F A;  1D5Y A;  2XGC A;  1T56 A;  2L7Z A;  4UUS A;  2DA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...