2DN0A

Solution structure of the second homeobox domain of human zinc fingers and homeoboxes protein 3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
GSSGSSGASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc fingers and homeoboxes protein 3
publication title Solution structure of the second homeobox domain of human zinc fingers and homeoboxes protein 3
rcsb
source organism Homo sapiens
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dn0A00
3WHBA 5IP6A 3LSGA 2HOSA 4XRMA 2EH3A 3G1MA 3JRBA 1H89C 5JLWA 3TW7A 5EG0B 1B8IB 2DA7A 1TWCJ 2CQQA 4MFDA 2IEKA 2LR8A 5K7ZA 2LD5A 1LFBA 3S17J 1IRZA 3WHCA 3B6AA 4M3EA 4CYCA 2NVQJ 3K2AA 2NVYJ 3JRAA 1ZK8A 2XB5A 5M3FJ 1VI0A 2FJ1A 2HOAA 1JGGA 2K40A 5C4JJ 1Y1VJ 4ABZA 3BTLA 4CYCB 2WAQN 5FKKA 2E1OA 3JRHA 2XGCA 5EYRA 1OJLA 3OSGA 4FE4A 9ANTA 4IHVA 1X2MA 4S0HB 4QSHA 1FTTA 5C3EJ 5IYDJ 4A3CJ 1WPKA 1IC8A 4JX6A 1TWHJ 4DW6A 5K7FA 2GLOA 2O8KA 3FK7A 1ZR2A 2JMWA 2YU9J 1I6HJ 1EF4A 2L7FP 3K7AJ 2GBYA 1BJZA 1P7IA 2K9SA 1E3OC 2JA5J 3BR2A 2H8RA 1WI3A 4A3DJ 2R93J 2EZLA 5J1YA 3RKQA 3M3YJ 5DTDA 1ZQ3P 3CDLA 5F08A 1XG1A 1R9TJ 1U9NA 1QRYA 4A3GJ 2COBA 2MGQA 2DMNA 3ZOBA 5FLMJ 2Y0SN 2LP0A 2KDZA 1RKTA 1PUFA 4JP0A 1Q1VA 4C3HJ 1DU6A 2DA1A 2VKVA 4RDUA 1MBEA 4BY1J 2E2JJ 3FK6A 2ID6A 1PUFB 2X6OA 2ECCA 5F1JA 1WH5A 1NK2P 2ME6A 4HNVA 1NK3P 3BR0A 2WB1N 4MO7A 1IDZA 1TWAJ 4B1RA 1RESA 2HYJA 1DU0A 2YUSA 3TW6A 4JYKA 1AU7A 4Y52J 3BG5A 4UUSA 2GM4A 1GV2A 2XPVA 3G1LA 2HXOA 4IHWA 4EEFG 5C4XJ 2HQ5A 5FKLA 1ITYA 1T33A 2L0KA 5FKOA 4UUSB 3JREA 3Q0WA 5F27A 2CJJA 4XRSA 3GTQJ 2Y31A 5DS9A 5EGOA 3A03A 1YRNA 4AYBN 3JR9A 1WGXA 3G1OA 2LKXA 3S2HJ 5IYBJ 4JX5A 2Y9YA 2VPRA 1HDPA 4X6AJ 1POGA 1VNDA 1MBGA 3PO2J 1B8IA 3BQYA 3ZQIA 4M3DA 3HOWJ 1OFCX 2TCTA 5BNGA 2JA7J 4A93J 5EGOB 1YRNB 1ZR4A 4M3FA 1AHDP 3L1PA 5FLVA 2CQXA 1JUMA 5K7HA 3HOYJ 4C3IJ 3FKIJ 3HGGA 2DMTA 3TP0A 2H1KA 2M0CA 2R0QC 1JTXA 1IUFA 1NTCA 4A3KJ 1OCTC 3BTCA 3GTKJ 3ZQGA 4M6VA 3GTMJ 2VKEA 2JK3A 5M5WJ 1B72A 2ME0A 4AUXA 5M5YJ 3GBGA 3NAUA 5E3NA 3S1QJ 2ECBA 2M8GX 4W97A 3NARA 1Z77A 3ZQHA 2P81A 1X58A 3B6CA 2K9QA 1JKRC 2TRTA 2MG4A 4V2GA 1VFCA 1JKOC 2XRLA 2AO9A 1B72B 4J19A 5EEAA 2G0EA 1FEXA 3GTPJ 2IBDA 2LFBA 3GTGJ 4BBSJ 3Q3SA 1HCRA 4XICA 4IHXA 3HB9A 1GT0C 2DN0A 5IP9J 1GDTA 1LE8A 4M3BA 2X48A 1ZKGA 1U9OA 2JA6J 2CUFA 1S7EA 1FIPA 1G2HA 1ETWA 2HXIA 2ELKA 3BQZA 3QPLA 2EZHA 2CUEA 2DTZA 1MNMC 1WCMJ 1GUUA 4DYRA 3SFIA 3E7LA 4JX4A 3CQZJ 3QQAA 1JKQC 1LE8B 3PO3J 4FTHA 1H8AC 4Y7NJ 1BW6A 4RBOA 3HKZN 3CCYA 2XGDA 1MBFA 3H3VK 3HGYA 1MBJA 3JRCA 1I50J 1BA5A 1WH7A 1MSEC 3VPRA 1I3QJ 2DMQA 1ETKA 3QPSA 4C3JJ 2L7MP 5F0FA 3GTOJ 1TWFJ 2LVSA 2XSDC 1IG7A 4DZJA 1Z0XA 2R5ZA 4A3MJ 1UMQA 1F43A 1BW5A 1A5JA 3ZQCA 2Y9ZA 2NVTJ 5M5XJ 1FTZA 1RKWA 1U8BA 2E2IJ 4DYCA 3S1NJ 2R5ZB 4D7NA 2DA6A 3IV5A 1QVUA 2N8GA 3A01A 3LOCA 3I4MJ 3MVPA 1P7JA 1SFOJ 1D5YA 3Q0UA 3BR5A 3RZOJ 1JT6A 1LFUP 2E19A 1Y1WJ 1GVDA 3O8GA 4L5EA 3I4NJ 4XRSG 1HF0A 1TWGJ 3A01B 2Y2ZA 3HM5A 1IV6A 3BR6A 3PM1A 2X9DA 1MH3A 3H0GJ 5J1UA 3C2BA 2E2HJ 4V2FA 3TP3A 2R7ZJ 1MH4A 3FISA 2QF7A 3HOUJ 1FIAA 4XK4A 5E3MA 1VF9A 3OOUA 3LSRA 1K61A 2JN6A 4LOCA 2HI3A 5JLXA 2W48A 4DYQA 3GTLJ 2EBIA 1ORKA 1TC3C 1IDYA 1ENHA 2VI6A 2XGEA 1JKPC 2LY9A 1HLVA 3F0CA 3D1NI 2DMUA 3LSPA 1ZTRA 3MN2A 4FCYA 5E3LA 2LK2A 1ZGWA 1QPIA 3BG9A 2O7OA 3RQIA 1IGNA 1MBKA 4IEJA 3ZQFA 2HOTA 3HBLA 2QCOA 1MBHA 2HDDA 1UHSA 3OIOA 2PMZN 2NS7A 3S1MJ 5IOYA 1W0UA 2M2EA 3TEDA 2XPWA 3JRIA 3O8HA 3UKGA 1UG2A 1RPWA 3HOXJ 4X1EA 3CMYA 5J3LA 5FKMA 2L7ZA 4G12A 1HDDC 3HEFA 1JTYA 2FD5A 4UUTA 3HDDA 4W1UA 2M34A 3MKLA 3M4OJ 5IYCJ 5M3MJ 4A3FJ 2Y30A 4IHYA 2EZKA 2ZB9A 5EF6A 4XIDA 4A3IJ 2IAIA 4MLOA 2B63J 2NOGA 5IP7J 1HOMA 5IOZA 3LSJA 4QIWN 5F0HA 1AKHA 5F04A 3SJMA 1T56A 3RZDJ 3S2DJ 4DZPA 1GV5A 3BG3A 1APLC 1XC5A 2NVXJ 1OCPA 5FJ8J 3LNQA 3JRGA 5FKNA 3GTJJ 1AKHB 1RETA 4A3LJ 2DMPA 2K9NA 2JJ7A 4BY7J 4I76A 2OF7A 3HOZJ 4D7MA 4FE7A 3DCFA 3S15J 5HODA 4D5CA 1F36A 2R92J 2R5YA 3JRFA 1K83J 2DJNA 1JT0A 4A3BJ 2CRGA 1JUSA 1SANA 2DA3A 1FJLA 1U78A 2LTPA 2D5VA 2YS9A 2AHQA 4B3AA 3BR3A 4M3GA 1QVTA 2KT0A 5EZGA 5F0CA 2R5YB 4NDLA 5IPAA 4A3JJ 3W6VA 2JA8J 2WV1A 3IH2A 4FISA 3HOVJ 4MFEA 4MIMA 2XPUA 3S14J 2L9RA 2M9HA 1RR7A 4A69C 2EQRA 3BTIA 3BTJA 5EDNA 4BKXA 3SDGA 2NS8A 5GPAA 1ETQA 1X2NA 2FQ4A 2ID3A 2CU7A 2O9LA 5EZHA 2FX0A 3Q0VA 5GPCA 3JRDA 2LLKA 3BR1A 3OSFA 3ZQLA 4QTRA 3A02A 4C2MJ 2DA4A 2RAEA 1ETOA 5C44J 2OPTA 3DEWA 4AC0A 3IH4A 1BL0A 2XB0X 2DA2A 1H88C 1ETXA 1JJ6C 4GFBA 1JJ8C 1XS9A 2MW8A 3FIWA 1ETVA 1MSFC 5E3OA 3BT9A 2JWTA 2I10A 4BBRJ 2DA5A 1W0TA 1A6IA 2MSYA 4D5FA 4B4CA 4BXXJ 5GP9A 1JUPA 5J1RA 4A3EJ 1ETYA 1CQTA 3S16J 1O4XA 4I6ZA 5EG0A 3S1RJ 3IH3A 2EZIA 1IJWC 2VUMJ
chains in the Genus database with same CATH superfamily
5IP6A 1QGPA 3LSGA 5E1ZB 4XRMA 1SVLA 4IO9F 1FBQA 2KPMA 2Q0OA 2F4OB 4RB2C 1MMNA 4A12A 2X6WA 3PQKA 2ZC2A 5EG0B 4S04A 2L4AA 2WTEA 1HKSA 2LR8A 2HZDA 1LFBA 3M7GA 2EILH 3LFUA 2F4IA 2DFEA 3WHCA 5HDNA 1HC8A 2RREA 3ABUA 1T8IA 4P55A 3S32A 1ON2A 1XCBA 4Y17A 1ZK8A 5M3FJ 2KJCA 4E7IA 2FJ1A 2VQLA 3HTUA 5C4JJ 1Y1VJ 4ABZA 2IA1A 2R7QA 4CYCB 2WAQN 1I27A 1ULYA 2VN2A 4PGHA 5CPRB 3BJOA 3K9TA 4G8XA 1FSEA 3HIFA 3HSRA 4G7HF 4L9JA 4S0HB 2GOXB 3W6JB 1AOYA 5C3EJ 5IYDJ 3E5QA 3HC7A 1G3TA 3K1NA 1WPKA 1FYLA 4A3CJ 4I7HA 1WJFA 5K7FA 4ZTJA 4CO8A 3C2GA 1ZR2A 1I6HJ 2YU9J 1OCOH 1K78B 1K6OA 3LA2A 3K7AJ 5KNLA 3KZIC 2JA5J 2EZLA 4RMNA 2VODA 2NRAC 4XLAA 4B8XA 2VQHA 5EEGA 2Z9OA 2HOEA 5LGTA 2VE9A 2F2EA 5H2FC 1WJDA 1E3HA 4F52A 3FXUA 3HJEA 3VWBA 2L5QA 1IN5A 3F8MA 2CYYA 3TKYA 5FLMJ 3DP7A 2KDZA 2GA1A 2XDVA 2VQCA 3CCQI 3OYDA 4C3HJ 1IN4A 1KA8A 5TGTA 1R4MB 3VYSB 1ZRDA 4RDUA 3T8RA 1MBEA 4HQEA 1O3QA 1TW2A 1MMSA 2Q8KA 4BY1J 3QPHA 3FK6A 1U5TB 1HW5A 2L9SA 5EEHA 2M5WA 4V19K 5E17F 2XAQA 4GXOA 2ECCA 5F1JA 1NK2P 2L54A 2VE8A 4IXAA 4HRIA 3PNVA 4HNVA 4CCJA 3MEXA 2WB1N 1STZA 1D5VA 3B02A 1FOXA 4B1RA 1RESA 1RRJA 4GGGA 1Z91A 2GA2A 2YUSA 1TTYA 3KEQA 4WXHA 2M8EA 3IRQA 2R4GA 1FPQA 1BR2A 5LGUA 4XKWA 1A36A 3TOAA 4M9ZA 5BPDA 3G2BA 3V7RA 2DPDA 2EWNA 2L0KA 2YX7A 3ABTA 3Q0WA 4ESJA 4IZZA 4IRGA 1MJAA 5DV5A 4BYYA 4FETA 1UG0A 2WAQA 3A03A 1E0EA 1WVRA 4JX5A 5LD2C 3CMAI 2VPRA 4F91B 1HDPA 2XRNA 1VQ8I 2XAFA 3V7SA 1TP4A 1R4NB 1B8IA 2BBYA 1SMTA 3CCMI 4A93J 4O5VA 5EGOB 1YRNB 1ZR4A 3HPHA 4NQWB 4UV9A 5JR3A 1AHDP 5FLVA 1JUMA 1TLHB 3LA7A 4WXCA 4LB5A 2E5NA 2PN6A 4PJJA 1GHCA 1T6SA 3F9KA 4I98B 2EIKH 2XUBA 3PNYA 4A3KJ 3GTKJ 3BTCA 1XSXA 4U7BA 2V1UA 3GTMJ 4M6VA 2DDBA 3HHHA 4B48A 2QBYA 4M9SA 2ME0A 2ZO4A 4Q5SF 4KJZA 3OS0A 2R7FA 3NWTA 3ISPA 3GBGA 3NAUA 2ECBA 2M8GX 1M1EB 4RB1A 1DGRM 2H6BA 2OBPA 4RAFA 3Q9VA 5D8KB 2B9SA 3ZQHA 2K9QA 1FWZA 1T08B 4U87A 3WG7H 2MG4A 4EJVA 1JKOC 2C6YA 4EMSA 1WKMA 3FKJA 4II2A 1FMVA 2ZKZA 5EEAA 3FZVA 1FEXA 3GTPJ 2L7KA 4NC8A 2X1EA 4XICA 1XD7A 3OYFA 1D0YA 5D6EA 1GT0C 5BS6A 3DXJF 2IRFG 3TDZC 2BVLA 4DOZA 2CUFA 4Y4RA 3CTAA 2MABA 2OTJI 1FNNA 1BR1A 2A5WA 2HXIA 2ELKA 3IUOA 1J09A 2WB1A 2QWWA 3CJTB 2LF8A 3GLLA 1IN8A 1WCMJ 3KLOA 3G73A 1REPC 4RLQA 2VLAA 3NEUA 3DPTA 3SFIA 1R1UA 2JSCA 2JRTA 3CQZJ 3E6MA 1JKQC 2BY1A 3F6VA 5CVUA 3K4KA 4BDYA 1W36D 1K7AA 2KIFA 2P5KA 2Z99A 4GCVA 4M73A 4P9FA 3R0AA 3KP6A 3CCYA 2XGDA 1MBFA 2DDAA 2ZSHB 5HVQC 1WH7A 4N9HA 3VYRB 2Z33A 1XDSA 2CQ7A 4LG0A 2HPMA 5GADJ 1VQ6I 2H6CA 2DMQA 1ETKA 2KRFA 3BOQA 5F0FA 3IRRA 2EFNA 2H27A 1Y0NA 2XSDC 4OMYA 2RNGA 1WJ5A 4A3MJ 1UMQA 2Q2EB 1F43A 1Z7LA 4PZJA 1LDJA 1YW7A 2HKXA 2Y9ZA 1Z1DA 5GTHC 3GZ6A 1VQ4I 2E34A 2WBMA 4XKCA 4P9UA 2EIJH 2UUZA 2HEOA 4BS9A 5FLXZ 4D7NA 4LMYA 2DA6A 3PJRA 2V9VA 5FO5A 5HNHA 1XSDA 4A0YA 3T0YA 1P7JA 1SFOJ 4RLFA 5HLIA 5B1BH 2BXYA 1BI0A 1OMIA 2E19A 2LBFA 1Y1WJ 2P6TA 1H9TA 4L5EA 3LL7A 2R7WA 4DJAA 2M3AA 1TWGJ 4NBQA 3A01B 2V1NA 1IV6A 1SC7A 1ZH5A 1Q1HA 3X2QH 1X4OA 2JVHA 4MTDA 4L9TA 1IRFA 2X1CA 4N4OB 1FOKA 2O0YA 3CJNA 2HTSA 1MH4A 3OYJA 1NHAA 4CZZA 3F8FA 2D1VA 5IT9K 3L7WA 4RAZA 3S2WA 1LPQA 1ON1A 2G9WA 1BOAA 3D5SC 3TMOA 3J7YJ 4E7JA 2W1OA 3PFYA 2ESNA 1K61A 3T1BA 3OIPA 5ICCA 2FQ3A 2W48A 4A0XA 2Y0MA 4BGDA 1XGSA 3GXOA 2D5VA 1ENHA 2XGEA 2GOMA 3OYGA 2FU4A 5KAIC 1D8KA 1SVOA 2E7WA 1BIAA 3F8NA 4FCYA 5L3CA 1WFXA 2LK2A 3KLNA 4PK4A 4BH9A 3OL3A 3BG9A 1X1CA 4UV8A 3O6BB 1IGNA 1MBKA 4IEJA 4LJZF 2BW3B 3JTGA 1RUNA 1MBHA 1UHSA 4FHTA 3SEZA 4L18B 3SZPA 4EM1A 5LHGA 1ERDA 2O3FA 5HS8A 2ZNYA 4EATA 3JRIA 3DTEA 4BQAA 3CMYA 2VXZA 3WU0A 3GMEA 2FBIA 3Q5FA 3CCEI 3FXJA 1XTAA 5ILUA 2DOFA 4UUTA 1ZRFA 3HDDA 1KU2A 1R5ID 4E4HA 5FB2A 4CXFA 2EZKA 3JCUC 4WX9A 1FC3A 5FD6A 4XORA 3WTVC 3OS1A 2LG4A 4MLOA 5HS9A 2JPBA 4JOMA 2QKMB 3F72A 3ZCOA 1MZBA 1HOMA 2ACJA 2XF7A 2QQ8A 4KMFA 5F0HA 3H92A 1HQCA 5LHHA 3S2DJ 5BMZA 2QQ9A 5F64A 1GV5A 2W85A 1Z67A 2NVXJ 1OCPA 4BXFA 3D5RC 2IW5A 4ZJZA 2MC3A 2MC4A 2PI0A 1YIOA 2DMPA 2K9NA 5E18F 1Y39A 2I8DA 2HQRA 4AVZA 1XMXA 1RUOA 1ZAOA 3CJRB 3JRFA 4ZH4F 4BQOA 4AYBA 4A3BJ 1WJCA 1FJLA 3FMQA 2XF6A 4LGWA 3OYBA 1X1DA 3ESWB 4ZYAA 2IS6A 2M4KA 5DDGA 1LDKB 1S5LC 6PAXA 1L0OC 2D2WA 4GO1A 2WV1A 3A0HC 1DP7P 2OZUA 1GVJA 3ZMSA 2WWYA 2QQBA 5BQTA 1VQKI 2F5EA 3HSFA 2XVCA 1MMGA 3S14J 1IF1A 4L9NA 2M9HA 3W6KB 2O61A 2E7XA 5AIQA 1MDMA 3BTJA 1BIBA 4HDVA 4XL9A 4BKXA 3SDGA 3J80Z 5FRMA 3BZCA 2GXGA 1OCCH 3QYFA 1ETQA 3OR2C 1X2NA 2VQGA 4KDPA 2J5PA 2HZTA 2RVCA 5H6RA 1WWXA 2CU7A 2L4MA 2O9LA 5EZHA 1LVAA 2FX0A 3PSFA 5HS7A 5GPCA 3OYKA 3JRDA 3WTSC 4LK1F 3ZQLA 2X51A 4RGXA 3HUGA 2BOLA 1U0JA 4GYGA 3IH4A 3TGNA 3EUAA 1TT0A 1ZHFA 2A6EF 2OD5A 2HR3A 1YG2A 4NUBA 1A31A 2DQRA 3RYRA 5E3OA 2ZJ2A 3BT9A 2JWTA 2F4MB 2WAEA 1ZN2A 4JK1X 2I10A 2VBXA 1G3YA 3Q9SA 1A6IA 3J7AY 3KX2A 2QSFX 3QYBA 2FOWA 2VT2A 4AVPA 1O4XA 1GXPA 2XKOA 3TO9A 3S1RJ 1HXDA 1P4XA 3IH3A 2DU9A 2CFOA 3RTRA 2AXTC 1ZLJA 2HOSA 2CW7A 4B44A 2OCCH 3FBNB 2A07F 4EQQA 1MNDA 2JT1A 4XLHA 3JRBA 2CWEA 1XCVA 1Z9CA 1B8IB 2P8TA 1TWCJ 4NB5A 3HOSA 3C3WA 2X1DA 3GWZA 2LD5A 3GF2A 4BDZA 1W36C 3S17J 3ZP5A 3W2VA 3RIRA 3B6AA 3R6SA 2E36A 3CP2A 4OIPF 3K2AA 2GIVA 3AAFA 1JI8A 2HQAA 2XB5A 1CGPA 1SFUA 2JUGA 4YELA 2HOAA 3S3OA 1JGGA 2YSRA 3M8EA 2K40A 2RDPA 3OYAA 3ELKA 2PJRA 2E1NA 2KL4A 3BTLA 3DKWA 2K5CA 1V4RA 5FKKA 5E79C 4FE4A 3KYCB 2WV0A 3OYMA 4A2UA 2LH9A 4FX0A 3TO7A 4RGSA 2AS5F 2RNJA 1YJWI 2CFXA 2DYSH 4JX6A 1RR8C 5GTIC 1IC8A 1IRXA 2GLOA 4OIOF 3BY6A 3HRMA 4BU2A 3FXLA 1EF4A 2L7FP 2GBYA 1S29A 1P7IA 2K9SA 3QWLA 2AQEA 3BR2A 3K4LA 2JUCA 4P1WA 3B73A 4HZFA 3RKYA 1TNTA 3VSLA 3RKQA 5D5UB 2X0LA 5DTDA 3M3YJ 2V79A 2K02A 4FX4A 1OCRH 1YLFA 2JVGA 1QRYA 1OCZH 2COBA 1MKMA 4HSRA 2M87A 3OS2A 2P7VB 4MTEA 3ZOBA 2LP0A 4D1QA 1RKTA 4XR6A 4CICA 1KYZA 1OYIA 3WTZA 2VKVA 4PGGA 4C30A 1TL8A 2DCEA 4HLYA 5E8IA 1PUFB 2BV6A 2PMHA 2MA3A 2O5RA 2OZ6A 3CZ6A 3KCCA 3MZYA 1NK3P 3BR0A 4P5OA 4MO7A 2QSHX 1W7PB 2GIZA 4G6DA 3SYTA 5JFRA 3CUQA 1DU0A 5J4VA 2XF5A 1ZGAA 4Y52J 3BG5A 4UUSA 2O6GE 2Y48A 1HA8A 3HTSB 1MNEA 3OYIA 1Z05A 3TOBA 2DO7A 2BHYA 1BI2A 5FKLA 2F5DA 2IP2A 4I01A 3KFWX 1DUXC 2KIUA 5LEJA 1NG6A 5F27A 3E6CC 4HX7A 2VBYA 3ZN1A 5GAGJ 2QA4I 1YFHA 4LLGF 4BEHB 1WGXA 2LKXA 5IYBJ 4NNJA 4PFOA 2KJBA 1BBYA 1QO0D 3CO6C 2GWRA 5ICFA 1POGA 2F6CA 4ESFA 4MEYF 1VNDA 1HW2A 3ASOH 3ZQIA 5GAEJ 2FA5A 4M3DA 1OFCX 2TCTA 2KRHA 1E2XA 1MW7A 1J2XA 4M74A 3MFKA 3L1PA 4IKFA 5K5RA 2CUZA 3HOYJ 1EH6A 3L2QA 1J9IA 4OAYA 5DCMA 4C3IJ 3FKIJ 4CA0A 1J59A 3NWSA 3CUQC 1D1CA 1U3EM 2H1KA 1DGWY 2K9LA 3BPVA 5AONA 2EV5A 3BDDA 4UVBA 5D8LB 1T38A 2F48A 1KQ8A 1FBUA 1MJBA 2WA0A 5FLXK 3L2VA 4UNOA 3ZQGA 3HRTA 3R4KA 2VKEA 3LQRA 4RS8A 3HL2A 1B72A 1G3SA 4AUXA 5M5YJ 4I0BA 2VJ5A 3S1QJ 4BXUA 5L3FA 1Z77A 3AKZA 3SEQA 3D0SA 1X58A 1PVEA 1XGNA 3E3VA 4BNCA 5H6QA 4WF2A 1VFCA 3QAHA 2AO9A 1QU3A 4RAGA 2ELJA 2DT5A 2IBDA 3A4CA 4KISA 2XC7A 1UCRA 4PFPA 4IHXA 2DN0A 1AA7A 4HDUA 1XGMA 4M3BA 1LE8A 2X48A 1R5HA 1U9OA 1ZKGA 3BZ6A 1S7EA 5H20A 1BR4A 3WTXC 3N97A 4EJWA 2F5VA 3CMEI 3BQZA 2E1MC 3ML6A 1OYWA 5J4YA 2CUEA 2FNPA 3E0JB 1D1AA 4Z6YA 3ZPLA 2ZFWA 4DYRA 4RB3C 3E7LA 1H9GA 2TDXA 2QYOA 3DEUA 3QQAA 4EGZA 2FBKA 3HKZN 3H36A 2UV1A 3ERED 5GAHJ 2HKOA 4PJ0C 2L01A 2H1LA 5JVTA 1MBJA 4KIFA 1YX5A 5CVVA 1I50J 2FOKA 5CVIA 5LLQA 1BA5A 2PQ8A 4FASD 2ZNZA 4XLEA 2NNYA 1PUEE 3K4MA 4QLCU 3OIQA 4C3JJ 2K9MA 2L7MP 2VL8A 2YX4A 4YFKF 1SFKA 2LVSA 2IA2A 3ZQQA 2EK5A 4AIJA 1MD0A 2R5ZA 4YG2F 2VOOA 1KZHA 1YS7A 3ZRGA 1N78A 4PDKA 4HNTA 4U0VA 2E2IJ 3PIPF 3OOPA 4Q48A 3S1NJ 4RAYA 3V8KA 2A68F 1R7JA 2CUJA 1VQMI 3A2KA 3WGIA 1QVUA 2N8GA 3LOCA 1DPRA 3ZQ7A 4E7LA 2M30A 4L5IA 1YITI 4U0YA 4Q47A 2NVUB 3Q0UA 3RZOJ 1LFUP 1VTNC 1Z6TA 1GVDA 3HPGA 1EJ9A 1HF0A 3W2AA 3HM5A 4UVCA 3BR6A 3L9FA 3PM1A 3BJ6A 3H0GJ 1TW3A 4CCKA 1J0RA 1MDMB 2E2HJ 5D4SA 2W57A 2L3DA 3T8TA 5ERIA 2IGNA 4G7ZF 1FMWA 4ZDOA 2QF7A 4GRIA 5LRRA 2DPUA 4ITVA 1SD6A 2ZCWA 3U2RA 2XKPA 3OMYA 5JLXA 4IRHA 4DYQA 3IHUA 1ORKA 4Z2YA 1IDYA 3K4CA 1JKPC 5KCMA 2Y69H 4RB0A 3F0CA 3GEZA 2CGPA 4IQJA 2O8XA 1CF7B 1ZGWA 3HKZA 1BN5A 2ZXHA 3BLYA 3OL4A 3DQVC 2OQRA 1BC7C 2ESHA 1USSA 2RN7A 1XMAA 3HBLA 4I99C 4LG3A 2QCOA 5LBQA 2HDDA 3WG9A 3MKZA 1B9NA 5IOYA 1L3LA 2VPLA 4Q4ZF 4OIQF 1BI1A 3ZXSA 2XPWA 3F23A 4AD9A 4A0ZA 1UG2A 1RPWA 3HOXJ 1LUJB 5K5QA 4X1EA 1IV8A 1R5GA 3NRVA 3J80K 2M7AA 1WRJA 4HEA2 4W1UA 4KN7X 3M4OJ 1IRGA 4HPQA 5IYCJ 5CKTA 2BXZA 3S3MA 4U88A 2ZXWH 2ZB9A 3DLLF 5EF6A 4XIDA 2EFQA 4H4KC 1J75A 2M1BA 4BL0B 2B63J 3IWFA 1QZYA 4BUPA 3LSJA 1O7FA 4B47A 2MH9A 3BJAA 3GFJA 2VONA 1OR7A 2A61A 4NC6A 3IP4B 4MEXF 1XC5A 1O3SA 4I2OA 3LNQA 1IZ1A 3AG1H 3DU6A 4UHTA 3JRGA 2W24A 1ZG1A 1AKHB 4YIFA 3LSMA 3ULQB 2JJ7A 3I59A 3P7NA 5L3DA 4D7MA 1IN6A 1IXSB 2XAJA 1F36A 2R92J 2R5YA 1X1BA 3ABLH 2YU3A 1JT0A 1FLIA 2I5UA 1U78A 2RQPA 1V3FA 2AHQA 1YYVA 1Y8QB 3AG2H 3BR3A 4M3GA 4R8HA 3M1EA 4B3AA 5IT3A 2UZKA 1QVTA 1SAXA 1KU9A 1KU7A 1Z6RA 5IPAA 2K4BA 3EUKL 1TZLA 1QNTA 3JSPA 3LAPA 3T5XA 4EJTA 3R60A 2A6HF 3RSNA 2EIMH 4YIIA 2VB6A 5DYMA 4E7SA 1G8XA 5BOXA 5FFXA 3BPXA 2XPUA 3FM5A 4ON0A 1OR7C 5LRSA 1RR7A 1K4SA 3IAS2 2EQRA 2HVQA 1Y6IA 2K3PA 4L0ZB 2BY2A 2E60A 3HXLA 4A5NA 3I56I 3I0TA 3I55I 2ZMEA 1TQPA 2FQ4A 4AIKA 3AG4H 2IS2A 3FXQA 2RC4A 3Q0VA 3GFLA 3L2WA 2LLKA 3BROA 2NXNB 3K70C 4IOAF 2DA4A 3P9IA 3H9GA 1YOVB 3FMRA 3CJQB 5C44J 1YO5C 4AC0A 1O3TA 4WXDA 2DA2A 3TQNA 4N4NB 3G6EI 2NS0A 3ZGKA 1JJ8C 3FDYA 4CYDA 2VOPA 2PBIA 3FIWA 2IGMA 3CUQB 2KHMA 4AIDA 4ANJA 2VJ4A 3DTIA 4LIVA 1IAWA 4BHCA 1T95A 2OUMA 1W0TA 4B4CA 3CCVI 4I02A 4RGUA 2Z3YA 4BXXJ 2W7NA 1JUPA 2LKPA 2PEXA 4A3EJ 2DFFA 5EG0A 2EFPA 2D45A 1ONVA 2M7BA 3OYLA 2ZMEC 1WSUA 3NQOA 4BQNA 4EGYA 1UAAA 3PO2J 4OIRF 2IVMA 1F1ZA 2EH3A 1H89C 3QU6A 2A69F 5JLWA 1VQ7I 3VEPA 4ZDPA 2ZFUA 2DA7A 3WE2A 1QZEA 1SEUA 4LLLA 2CV0A 2CQQA 4O3MA 4MFDA 2R7VA 2IEKA 5K7ZA 1OKRA 4BAYA 2EINH 1H0MA 4LK0F 3KP3A 1ZG3A 2PLYA 1D0XA 4DNCA 5DCMB 4CYCA 4C9YA 2NVQJ 1R58A 1XMKA 3RYPA 2L9VA 3JRAA 5JVGF 3E1SA 3P9CA 3SQNA 3CDHA 2R7RA 2Q1ZB 1WJBA 1O7LA 1U6GA 5EYRA 1D1BA 1YTYA 2IPQX 1OJLA 3VFZA 9ANTA 1E17A 5LGNA 4IHVA 3LMMA 1K78A 2KISA 5DM7F 4BACA 1FTTA 1C0WA 1JXSA 4UXNA 3WGHA 3DPUA 3FK7A 3F21A 1B59A 1V5GA 1UB9A 2NYXA 2JMWA 2VKHA 1J7KA 3RPQA 2ZJQF 1BJZA 1QPMA 2V9KA 4Y33A 1E3OC 4LLNA 4CUGA 5AIPA 1WI3A 3HYIA 3BG7A 2H8RA 2R93J 4DGWB 2AQFA 1ZQ3P 3WGGA 3MCZA 3CDLA 3GYHX 3BCBA 4KNYA 1U9NA 2DOAA 2LC2A 5JHFA 4A3GJ 2MGQA 2MD5A 5ICEA 2CV2A 3QP6A 2EA2A 1S9HA 2Z1DA 1ZLKA 2Y0SN 1U5TA 3CO7C 2HU9A 1Q1VA 3OY9A 3EDPA 2FXAA 1VQ9I 1TQMA 3GX4X 5HDGA 3PUBA 3AL0C 2Z2SB 4KT6A 3DWLE 4GYIA 4R1HA 1YIJI 2X6OA 3KETA 1WH5A 2ME6A 4ETSA 1JGSA 3W2WA 3GZNB 4ENJA 2M45A 1TWAJ 2KIQA 3ZMVA 4AU7A 4YEJA 3RPUD 1FY7A 4R79A 1AU7A 1B6AA 4HF1A 4PUSA 3LSTA 1GV2A 4DIQA 3EUHA 2XPVA 3G1LA 4CZCA 3VDXA 4IHWA 4EEFG 2HQ5A 3K1MA 1ITYA 1T33A 4IL6C 5B5EC 5FKOA 2LOOA 2HPIA 3LSHA 1OISA 4CCOA 2CJJA 1A6QA 4XRSA 3GTQJ 1U5TC 3R0JA 4JQFA 5EGOA 2FF4A 2X4HA 2DK5A 1YRNA 1J5YA 3G1OA 4NQWA 3S2HJ 2JQ7A 2OAZA 5D5VB 1I5ZA 3J7AO 2DTRA 2DK8A 2LREA 1YQAA 3K1PA 3CP8A 2L9NA 1MBGA 4G94A 2JA7J 2WY8Q 4DQ2A 4M3FA 1T39A 4MQ9F 2CQXA 2P5LC 1O3RA 5K7HA 2XSJC 5K5OA 4XSXF 2STTA 3UNGC 3ZN0A 5HLHA 2DMTA 2GAUA 4IVNA 2NAZA 2DJIA 2M0CA 4BE2A 1MIJA 2P0WA 1DP3A 4U7DA 1R36A 3DTKA 3VSKA 1NTCA 3FMSA 1OCTC 3F3XA 1VQ5I 3GW2A 3SDBA 4IPAA 5CVRA 2LSOA 5M5WJ 3EUHC 2E1CA 3O3KA 5E3NA 1WJAA 3PQJA 4ESBA 2XASA 3B6CA 1OYYA 3GZ5A 4YIRX 1LKXA 2QBYB 3CCJI 2XRLA 1T0FA 3H3ZA 4XOTA 4K2EA 3DEEA 4A6DA 4J19A 2A3SA 2G0EA 1LEBA 2R7SA 2ELHA 1XDUA 5DUIA 4BBSJ 2LFBA 2OU2A 2BVMA 3Q3SA 3DBHB 3SXYA 3HB9A 2QQAA 1GDTA 4PJNA 3CC7I 4ZZLA 3E5UA 3FM3A 1ZELA 2ISZA 4HOBA 2O03A 4G7OF 3LFKA 3VB2A 1LDDA 2EZHA 2L2OA 2R7XA 2DTZA 4PSWA 1SVMA 2M4GA 2STWA 4I0AA 4JBAA 3M1CA 3FXMA 1H8AC 2YR2A 1BW6A 1MJ9A 3TBIA 2UWMA 4HA8A 2W4SA 3K69A 2JTVA 1X3WB 2AXLA 2X6YA 5LFAA 4M6YA 3SFZA 1VZ0A 5DCFA 3K0LA 1T2KA 2VXDA 3VPRA 2K27A 4M71A 1KU3A 1T0FC 2LDUA 4F92B 2XAUA 1X4PA 2FE3A 4DZJA 1Z0XA 4XNFA 3H3UA 2R7UA 2K4JA 4ENNA 4LG0B 3PNTA 1BW5A 4XLNF 1S6LA 2NOJB 1D0ZA 1FYKA 2PMUA 1FTZA 1RKWA 1U8BA 5DEQA 4ZYDA 1FP2A 2P6SA 2UXNA 3IAM2 2W25A 3O2PE 1Z3YA 2MLGA 3FWEA 3IV5A 3QOPA 4KN4X 4OINF 1B1BA 3A01A 4XM3A 3IWZA 1D5YA 5J40A 2QUFA 1JT6A 2QGUA 4ASNA 3I4NJ 5D6FA 1IXCA 4XRSG 2KP6A 5IY5H 1Z7UA 3BCAA 1ZGJA 3M07A 2W00A 1WHUA 3CF2A 3LSIA 4DBRA 2VBZA 5J1UA 3C2BA 3KEYA 4B09A 2V6EA 2LBFB 2GXAA 3LWFA 2EA4A 2XROA 2R7ZJ 1UJ8A 2HDWA 4LIUA 1FIAA 4XK4A 2LF7A 3QP5A 4ENMA 1XGOA 3V8LA 2HI3A 1KQ9A 2OV7A 3GTLJ 2VKDA 4ZDLA 1W4MA 1TC3C 4HG2A 3OYEA 3C18A 2VI6A 2ICWG 2BW3A 2K3FA 2LY9A 1D3YA 1P2FA 1UELB 1KGSA 3K70D 1IN7A 3KYLA 3RKXA 3LSPA 2M0MA 1N77A 4BHPA 4HNUA 2JRMA 1I39A 2ADUA 4J00A 1XX5A 5E3LA 3DU5A 2FUG2 2YPRA 3SZGA 3DKYA 3MD2A 3RQIA 2KLOA 3F22A 2BHZA 3ZQFA 1RZ4A 2HOTA 3K4NA 1OQYA 4ENKA 2PMZN 4HSTA 2NS7A 4FQGA 2COMA 1W0UA 4OMZA 1SAUA 2M2EA 2HDCA 3C7JA 2CQKA 3E6BA 1HW1A 2E71A 1U2WA 4A5MA 3M8FA 4N9IA 2HVRA 4G12A 4LITA 1BI3A 3HEFA 3PSIA 2FD5A 2DOEA 2LMDA 4EJUA 5K1YA 1FZPB 3HRUA 5KAFC 2M34A 4PSXA 3RPUA 4EM2A 3D5LA 3DBRB 1W7PD 2WC2A 5M3MJ 1R23A 1YW8A 3K6GA 1R71A 2Y30A 4IHYA 2DT6A 3A1YA 2CG4A 1Y8RB 2QEXI 4N0BA 1FBSA 3R61A 3ZMTA 2BZTA 2HQNA 4X0GA 4KIGA 4II3A 4QPQA 5IOZA 3RKWA 1I3AA 2KDOA 3IKVA 5F04A 3CD6I 3S8PA 3RZDJ 1IUYA 2CQNA 4XLPF 4DZPA 1UZCA 3BG3A 3TDUC 3KYDB 3GCMA 4BHBA 2EFWA 5FJ8J 3GLXA 1Z3XA 2XHKA 2IS1A 1K4TA 1G4DA 3GTJJ 4D9JA 4A3LJ 5KK1A 2BYVE 1YJNI 1TT5B 3H5RA 4RGRA 3HOZJ 3ZMUA 4FE7A 2KIMA 2V9PA 5HODA 1X19A 2OCEA 4OU0A 2CH0A 4XKVA 4D5CA 4F3QA 2CSOA 1EKEA 2DJNA 5CVJA 4F55A 4IF4A 2DA3A 3JSOA 3AL0B 2B7EA 4E7ZA 2DW4A 4EJOA 5F1RA 1U8RA 2HNHA 5FROA 2KT0A 4Y15A 5EZGA 5F0CA 1QBJA 3VODA 3CUOA 4A3JJ 3W6VA 2JA8J 2XGXA 2DYRH 3ZR8X 2ZJRF 3M9AA 3CCLI 3HOVJ 4CCLA 3EYIA 5FRNA 2QSGX 1ZG5A 2V26A 2QKLB 2QLZA 5D5XB 4MIMA 1HSTA 2Y75A 1W5SA 2R7TA 4KYWA 2IJLA 3ROUA 3DFGA 4A69C 2P7CB 1SFXA 4HX4A 3BTIA 4MQVA 4F7ZA 1R00A 3LAJA 2DFIA 2PMZA 3L09A 1ZREA 2GXBA 4YRVA 5GPAA 3LSKA 4KMUX 4GDFA 4BJ6C 1VQLI 2ID3A 3J81K 5DD8A 2JZYA 3V8JA 3BR1A 3S93A 3OSFA 3A02A 1AWCA 5FFZA 4RM3A 1QA6A 3OR1C 2OPTA 4S05A 5F6FA 3QRFF 5L3EA 2XB0X 1UHWA 3L2CA 1ETXA 1GLNA 3CMMA 3K4BA 3HG9A 4GFBA 3PIOF 1XS9A 1ETVA 5ILVA 1MSFC 3U9GA 4KUMA 2P5VA 3HUGB 4O6JA 4F93B 3DPLC 3KE2A 1K6YA 4BBRJ 1LFPA 1MMAA 2MSYA 2PFBA 3F8BA 2LRDA 1BM9A 3WTTC 4WWCA 4J01A 5GP9A 5KVRA 3HSEA 5J1RA 3WE3A 1G3WA 3ECHA 3ZMDA 1CQTA 2V1DA 3S16J 2V1XA 5TRDA 1P92A 2EFOA 2B0LA 2EZIA 3I9V2 2VJJA 2HYGD 1QQIA 5D4RA 1E3PA 3WHBA 2WY7Q 5B3SH 5JI6A 3G1MA 5EJCA 3KP4A 3DLAA 1ODDA 3TW7A 4E6KG 1LJ9A 3HOTA 3JAMZ 1ZARA 1S7AA 2KQRA 1W5CC 1IRZA 1VQNI 5HLTA 1FOYA 2OA4A 5DUKA 1N25A 1DQUA 4M3EA 4YFNF 2NVYJ 4BJTA 1FOWA 1X1AA 3EQLF 2DI3A 2HVSA 4AWXB 1VI0A 3QPTA 2VC1A 1V5EA 2WADA 3AG3H 4RM2A 3FXRA 4ZTFA 3RDIA 3HHGA 1RNLA 3CF5F 1YI2I 3JRHA 2E1OA 2LY2A 4NC7A 2XGCA 2CMPA 3OSGA 3WU2C 1EV7A 3U21A 1X2MA 2FSWA 1ZRCA 4KICA 4WCGA 3QOEA 2MH2A 4QSHA 1PP8F 3F6OA 2HFHA 2J5OA 2PJRB 4CGZA 4BE1A 4HF2A 3MQ0A 1BOBA 2V7FA 2ZXJA 1NH3A 1TWHJ 2UXXA 5CJ9A 4DW6A 2O8KA 1SFEA 4IOCF 3DV8A 4Y13A 1I1GA 1WZ2A 2DAOA 4A3DJ 2HTJA 3CLOA 4EVIA 2IT0A 2ZJPF 5J1YA 4BE0A 3CC4I 1W5TA 3FHNA 2W82A 2DLLA 5F08A 1XG1A 3H1CA 1R9TJ 3WTUC 3BG6A 4HF0A 1F5TA 2EB7A 2DMNA 1X3ZB 3ABMH 5A2QK 3HRSA 3E5XA 2ZBKA 2F5FA 1PUFA 2IS4A 1DPUA 5J8CA 4JP0A 3J7ZI 3OYNA 2MYSA 3I4PA 3PFIA 3COAC 1DU6A 4HV5A 2DODA 2VT3A 1OLTA 2DA1A 5B1AH 4EV0A 1W7PA 2E2JJ 3OV8A 5E1XA 5HNFA 3FHZA 1W1WE 2ID6A 2VASA 3MZHA 3H0DA 3E97A 3MKYB 1I6XA 3G71I 2LKSA 1IDZA 4FT8A 3K4JA 5FGMA 2HYJA 4UY8I 3TW6A 3DF8A 4JYKA 5ILSA 3BWGA 1EA3A 4PCQA 2GM4A 1TQIA 4ZYGA 4D0PA 3I53A 2ZSIB 4TV7A 4BEHA 5E8GA 4XMYA 5L3BA 4IJAA 2HXOA 5C4XJ 3H9JA 1UFMA 4QPOA 4A6EA 2W84A 4IQ4A 4MNUA 4NHJA 4UUSB 3JREA 3OWTA 4KIBA 3RCOA 2OTLI 1PJRA 2CW8A 2K7LA 2Y31A 4BQQA 1LNWA 5DS9A 1FT9A 4AYBN 3JR9A 5J6XA 3VYTB 3CESA 4IHTA 3I64A 2Y9YA 2NNNA 4CSWA 4X6AJ 1JHHA 2PX9A 2VC0A 2OJED 1RC9A 2LNBA 3BQYA 2PJPA 4UB6C 3HOWJ 5BNGA 2PG4A 4XONA 3TO6A 3JTHA 2X85A 3BZKA 1RI7A 1WI9A 2GQQA 2IA0A 3ERMA 2CO5A 3HGGA 2HGCA 5J8FA 2KMUA 1EH8A 3I71A 2XAHA 3TP0A 3EYYA 3IL2A 2R0QC 1JTXA 2BY0A 3CLQA 4G9YA 4MHGA 5CQGA 1IUFA 2E1MB 5FD5A 1S3JA 2QZ8A 2JK3A 1VQPI 5TJJA 4G6QA 2E5ZA 2JA2A 2KZGA 3RQ4A 4W97A 3NARA 5ED4A 3ZMZA 2P81A 1JKRC 3S3NA 1OPCA 1XSVA 2TRTA 3E6DA 4V2GA 1TBXA 5BPIA 1PDNC 4KA4A 2IGOA 2IXSA 2V6CA 1B72B 1V55H 3J81Z 5HOOA 3M8JA 3GTGJ 4M6XA 2G7HA 1HCRA 4BJ5C 4B43A 1S7OA 1RIOH 4LB6B 5HDKA 4RA2A 5IP9J 1FSHA 1YE9A 4MGRA 2RV8A 2JA6J 3KP7A 5B66C 1FIPA 1G2HA 1ETWA 2DXIA 3N05A 3QPLA 4B3XA 1UHMA 1YS6A 1ZYRF 1MNMC 1GUUA 2R7DA 2XAGA 1QHGA 4JX4A 3U1KA 3PO3J 1LE8B 4FTHA 3MAJA 4Y7NJ 1SD7A 3N4MA 4RBOA 4XKBA 1FX7A 4I09A 3OYHA 3H5NA 5DM6F 2BGCA 1T98A 2A6TA 1Y56A 5LEKA 3HGYA 3CCSI 1R22A 3H3VK 5J47A 1P4WA 3JRCA 1MSEC 1I3QJ 2QM3A 3QPSA 4HW0A 3GTOJ 1TWFJ 2EJRA 1YW9A 1A35A 1SD4A 2KKOA 4UB8C 1V54H 3P9KA 1IG7A 4EM0B 3L2RA 1FP1D 3WU1B 1D8JA 3DBLB 2CW0F 3PUFA 1A5JA 3ZQCA 3IC7A 1QZZA 2K85A 4M9XA 5M5XJ 2NVTJ 3F8CA 5KHDA 2F5CA 1BJAA 4DYCA 4OWRB 4E7KA 1GXQA 2R5ZB 3IKTA 1WJEA 1B9MA 4UUVA 3CCUI 3I4MJ 3MVPA 4U0WA 3BR5A 2A05A 2KFDA 4LFUA 3LA3A 3LQQA 4QWQA 4XBFA 2FMYA 3O8GA 1LQ1A 3GFMA 3KIOA 2FRHA 2KZVA 3BP8A 2Y2ZA 2BE5F 3V42A 1LEAA 3EETA 4XLCA 4C2UA 3U1DA 2X9DA 3AFHA 3FXKA 1MH3A 4CCNA 4E70A 3H5AA 1LB2A 2L02A 4KITB 1XPXA 5E1WA 2RGVA 4V2FA 2DFHA 3TP3A 1X3UA 3FISA 1R1TA 3HOUJ 2XIGA 2FNAA 3VOEA 5E3MA 3G4SI 1A04A 1FYMA 1VF9A 3OOUA 3LSRA 2JN6A 4LOCA 4CDGA 3MMYB 4HLXA 3RI4A 2EBIA 1XB4A 1IXRC 1CF7A 4LD5A 4XQFA 4L9VA 5HLGA 4ZZDA 4HBLA 2JPCA 1HLVA 2EV0A 1USTA 2DMUA 4HQMA 3WTYC 3D1NI 1ZTRA 2Z5UA 2IGKA 2JSPA 3BC8A 3FX3A 3MN2A 3VYUB 1Y0UA 2D1HA 2ISYA 1F4KA 4PJMA 4XN3A 3V4GA 1QPIA 2P4WA 2O7OA 4Y3OA 5A2QZ 2Z16A 3DKXA 2WAFA 3FF5A 1ACIA 3OIOA 3UR3C 3S1MJ 2MD0A 1P6RA 3GUDA 5CQEA 4HAMA 3TEDA 3GO5A 3UKGA 3O8HA 3KZYA 4CHUA 1VQOI 3CCRI 5L3GA 5J3LA 5FKMA 2Y0SA 2DT7B 2L7ZA 2MFZA 1EH7A 3QU3A 4IHSA 2V4JC 1HDDC 1JTYA 1QHHD 2DBBA 3I5UA 2ZXIA 2VJIA 2G7UA 3HZJA 3MKLA 1WQ2A 2QVOA 3KP5A 1HKQA 3KEOA 4A3FJ 4ZYEA 4XRFA 2VIXA 2X6XA 1KQ0A 2H09A 4CH7A 4A3IJ 1IW7F 2IAIA 4IRIA 2CS3A 1R49A 2NOGA 5IP7J 4KT5C 4UVAA 1HSJA 1DDNA 4L5JA 1SD5A 4XSZF 2H94A 4QIWN 3KPHA 1AKHA 3SJMA 3MWMA 5CYVA 1T56A 3JW4A 4OOIA 1S8NA 3A0BC 3ONQA 2CV1A 1G6NA 1APLC 1YHQI 2RQQA 4G6TB 1R1VA 2RKHA 2XV4S 2BEOA 4XN0A 4H0EA 3K10A 5FKNA 1RETA 5IT9Z 1F9NA 4BY7J 4I76A 2OF7A 3REOA 1X1PA 4DBQA 2Q2EA 3DCFA 2ETHA 3S15J 2EPFA 3I58A 3GVAA 2FBHA 4ZC3A 1K83J 4WK8F 2CRGA 2BY3A 1JUSA 1SANA 1N75A 3GFIA 2OC6A 3MKWB 3QYEA 3I59B 2LTPA 4L0YB 2YS9A 1KYWA 1HBXG 2LY1A 3W3CA 3C2HA 4IX7A 2R3SA 4AIHA 3L00A 2R5YB 1PYVA 3H9QA 3I54A 2R7OA 3C1DA 4NDLA 3K2ZA 3IH2A 4FISA 4M72A 2MLKA 2GZWA 3MZ8A 1R6RA 2LYCA 3JAMK 3CC2I 4MFEA 1P9QC 4KFCA 5CLSA 1YJ9I 3ASNH 1S72I 1P4AA 2L9RA 2K86A 4HYEA 4PJLA 3WODF 4E7HA 1KONA 1BC8C 5DD4A 2EV6A 1YX3A 3EPZA 3P5JA 5EDNA 3H35A 3OYCA 2MBFA 1B4AA 1MMDA 2NS8A 3CDIA 1PP7U 2E35A 3WTWC 1SMYF 2DQLA 1TNSA 5D5WB 2VBWA 2HS5A 4AM3A 1Z21A 2FEZA 1I1SA 4CCMA 4P96A 3RJPA 3QODA 2QENA 2HYFA 3FXOA 5JHUA 1XN7A 5TISC 1NG7A 4QTRA 5E20A 4C2MJ 3L2UA 2RAEA 1ETOA 3FBIB 3TL4X 2H8WA 1IO2A 2ZMEB 4XOPA 3KZZA 3DEWA 1BL0A 1O57A 2A5YB 2FMLA 1H88C 5LHIA 4C2TA 1JJ6C 3V7CA 1JE8A 2MW8A 1MGTA 4YFXF 5ICGA 1LVKA 4ZYHA 3G3ZA 2KRCA 1G59A 2HWVA 3I3LA 4HV6A 3ABKH 3KP2A 4XLFA 2DA5A 1V5FA 4OAZA 4D5FA 1ETYA 3PL8A 4HX8A 4I6ZA 3ECOA 1JHFA 1K79A 1HKTA 3SHFA 1IJWC 2OQGA 2VUMJ 3SZTA
chains in the Genus database with same CATH topology
3WHBA 5IP6A 3LSGA 2HOSA 4XRMA 2EH3A 3G1MA 3JRBA 1H89C 5JLWA 3TW7A 5EG0B 1B8IB 2DA7A 1TWCJ 2CQQA 4MFDA 2IEKA 2LR8A 5K7ZA 2LD5A 1LFBA 3S17J 1IRZA 3WHCA 3B6AA 4M3EA 4CYCA 2NVQJ 3K2AA 2NVYJ 3JRAA 1ZK8A 2XB5A 5M3FJ 1VI0A 2FJ1A 2HOAA 1JGGA 2K40A 5C4JJ 1Y1VJ 4ABZA 3BTLA 4CYCB 2WAQN 5FKKA 2E1OA 3JRHA 2XGCA 5EYRA 1OJLA 3OSGA 4FE4A 9ANTA 4IHVA 1X2MA 4S0HB 4QSHA 1FTTA 5C3EJ 5IYDJ 4A3CJ 1WPKA 1IC8A 4JX6A 1TWHJ 4DW6A 5K7FA 2GLOA 2O8KA 3FK7A 1ZR2A 2JMWA 2YU9J 1I6HJ 1EF4A 2L7FP 3K7AJ 2GBYA 1BJZA 1P7IA 2K9SA 1E3OC 2JA5J 3BR2A 2H8RA 1WI3A 4A3DJ 2R93J 2EZLA 5J1YA 3RKQA 3M3YJ 5DTDA 1ZQ3P 3CDLA 5F08A 1XG1A 1R9TJ 1U9NA 1QRYA 4A3GJ 2COBA 2MGQA 2DMNA 3ZOBA 5FLMJ 2Y0SN 2LP0A 2KDZA 1RKTA 1PUFA 4JP0A 1Q1VA 4C3HJ 1DU6A 2DA1A 2VKVA 4RDUA 1MBEA 4BY1J 2E2JJ 3FK6A 2ID6A 1PUFB 2X6OA 2ECCA 5F1JA 1WH5A 1NK2P 2ME6A 4HNVA 1NK3P 3BR0A 2WB1N 4MO7A 1IDZA 1TWAJ 4B1RA 1RESA 2HYJA 1DU0A 2YUSA 3TW6A 4JYKA 1AU7A 4Y52J 3BG5A 4UUSA 2GM4A 1GV2A 2XPVA 3G1LA 2HXOA 4IHWA 4EEFG 5C4XJ 2HQ5A 5FKLA 1ITYA 1T33A 2L0KA 5FKOA 4UUSB 3JREA 3Q0WA 5F27A 2CJJA 4XRSA 3GTQJ 2Y31A 5DS9A 5EGOA 3A03A 1YRNA 4AYBN 3JR9A 1WGXA 3G1OA 2LKXA 3S2HJ 5IYBJ 4JX5A 2Y9YA 2VPRA 1HDPA 4X6AJ 1POGA 1VNDA 1MBGA 3PO2J 1B8IA 3BQYA 3ZQIA 4M3DA 3HOWJ 1OFCX 2TCTA 5BNGA 2JA7J 4A93J 5EGOB 1YRNB 1ZR4A 4M3FA 1AHDP 3L1PA 5FLVA 2CQXA 1JUMA 5K7HA 3HOYJ 4C3IJ 3FKIJ 3HGGA 2DMTA 3TP0A 2H1KA 2M0CA 2R0QC 1JTXA 1IUFA 1NTCA 4A3KJ 1OCTC 3BTCA 3GTKJ 3ZQGA 4M6VA 3GTMJ 2VKEA 2JK3A 5M5WJ 1B72A 2ME0A 4AUXA 5M5YJ 3GBGA 3NAUA 5E3NA 3S1QJ 2ECBA 2M8GX 4W97A 3NARA 1Z77A 3ZQHA 2P81A 1X58A 3B6CA 2K9QA 1JKRC 2TRTA 2MG4A 4V2GA 1VFCA 1JKOC 2XRLA 2AO9A 1B72B 4J19A 5EEAA 2G0EA 1FEXA 3GTPJ 2IBDA 2LFBA 3GTGJ 4BBSJ 3Q3SA 1HCRA 4XICA 4IHXA 3HB9A 1GT0C 2DN0A 5IP9J 1GDTA 1LE8A 4M3BA 2X48A 1ZKGA 1U9OA 2JA6J 2CUFA 1S7EA 1FIPA 1G2HA 1ETWA 2HXIA 2ELKA 3BQZA 3QPLA 2EZHA 2CUEA 2DTZA 1MNMC 1WCMJ 1GUUA 4DYRA 3SFIA 3E7LA 4JX4A 3CQZJ 3QQAA 1JKQC 1LE8B 3PO3J 4FTHA 1H8AC 4Y7NJ 1BW6A 4RBOA 3HKZN 3CCYA 2XGDA 1MBFA 3H3VK 3HGYA 1MBJA 3JRCA 1I50J 1BA5A 1WH7A 1MSEC 3VPRA 1I3QJ 2DMQA 1ETKA 3QPSA 4C3JJ 2L7MP 5F0FA 3GTOJ 1TWFJ 2LVSA 2XSDC 1IG7A 4DZJA 1Z0XA 2R5ZA 4A3MJ 1UMQA 1F43A 1BW5A 1A5JA 3ZQCA 2Y9ZA 2NVTJ 5M5XJ 1FTZA 1RKWA 1U8BA 2E2IJ 4DYCA 3S1NJ 2R5ZB 4D7NA 2DA6A 3IV5A 1QVUA 2N8GA 3A01A 3LOCA 3I4MJ 3MVPA 1P7JA 1SFOJ 1D5YA 3Q0UA 3BR5A 3RZOJ 1JT6A 1LFUP 2E19A 1Y1WJ 1GVDA 3O8GA 4L5EA 3I4NJ 4XRSG 1HF0A 1TWGJ 3A01B 2Y2ZA 3HM5A 1IV6A 3BR6A 3PM1A 2X9DA 1MH3A 3H0GJ 5J1UA 3C2BA 2E2HJ 4V2FA 3TP3A 2R7ZJ 1MH4A 3FISA 2QF7A 3HOUJ 1FIAA 4XK4A 5E3MA 1VF9A 3OOUA 3LSRA 1K61A 2JN6A 4LOCA 2HI3A 5JLXA 2W48A 4DYQA 3GTLJ 2EBIA 1ORKA 1TC3C 1IDYA 1ENHA 2VI6A 2XGEA 1JKPC 2LY9A 1HLVA 3F0CA 3D1NI 2DMUA 3LSPA 1ZTRA 3MN2A 4FCYA 5E3LA 2LK2A 1ZGWA 1QPIA 3BG9A 2O7OA 3RQIA 1IGNA 1MBKA 4IEJA 3ZQFA 2HOTA 3HBLA 2QCOA 1MBHA 2HDDA 1UHSA 3OIOA 2PMZN 2NS7A 3S1MJ 5IOYA 1W0UA 2M2EA 3TEDA 2XPWA 3JRIA 3O8HA 3UKGA 1UG2A 1RPWA 3HOXJ 4X1EA 3CMYA 5J3LA 5FKMA 2L7ZA 4G12A 1HDDC 3HEFA 1JTYA 2FD5A 4UUTA 3HDDA 4W1UA 2M34A 3MKLA 3M4OJ 5IYCJ 5M3MJ 4A3FJ 2Y30A 4IHYA 2EZKA 2ZB9A 5EF6A 4XIDA 4A3IJ 2IAIA 4MLOA 2B63J 2NOGA 5IP7J 1HOMA 5IOZA 3LSJA 4QIWN 5F0HA 1AKHA 5F04A 3SJMA 1T56A 3RZDJ 3S2DJ 4DZPA 1GV5A 3BG3A 1APLC 1XC5A 2NVXJ 1OCPA 5FJ8J 3LNQA 3JRGA 5FKNA 3GTJJ 1AKHB 1RETA 4A3LJ 2DMPA 2K9NA 2JJ7A 4BY7J 4I76A 2OF7A 3HOZJ 4D7MA 4FE7A 3DCFA 3S15J 5HODA 4D5CA 1F36A 2R92J 2R5YA 3JRFA 1K83J 2DJNA 1JT0A 4A3BJ 2CRGA 1JUSA 1SANA 2DA3A 1FJLA 1U78A 2LTPA 2D5VA 2YS9A 2AHQA 4B3AA 3BR3A 4M3GA 1QVTA 2KT0A 5EZGA 5F0CA 2R5YB 4NDLA 5IPAA 4A3JJ 3W6VA 2JA8J 2WV1A 3IH2A 4FISA 3HOVJ 4MFEA 4MIMA 2XPUA 3S14J 2L9RA 2M9HA 1RR7A 4A69C 2EQRA 3BTIA 3BTJA 5EDNA 4BKXA 3SDGA 2NS8A 5GPAA 1ETQA 1X2NA 2FQ4A 2ID3A 2CU7A 2O9LA 5EZHA 2FX0A 3Q0VA 5GPCA 3JRDA 2LLKA 3BR1A 3OSFA 3ZQLA 4QTRA 3A02A 4C2MJ 2DA4A 2RAEA 1ETOA 5C44J 2OPTA 3DEWA 4AC0A 3IH4A 1BL0A 2XB0X 2DA2A 1H88C 1ETXA 1JJ6C 4GFBA 1JJ8C 1XS9A 2MW8A 3FIWA 1ETVA 1MSFC 5E3OA 3BT9A 2JWTA 2I10A 4BBRJ 2DA5A 1W0TA 1A6IA 2MSYA 4D5FA 4B4CA 4BXXJ 5GP9A 1JUPA 5J1RA 4A3EJ 1ETYA 1CQTA 3S16J 1O4XA 4I6ZA 5EG0A 3S1RJ 3IH3A 2EZIA 1IJWC 2VUMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHB A;  5IP6 A;  3LSG A;  2HOS A;  4XRM A;  2EH3 A;  3G1M A;  3JRB A;  1H89 C;  5JLW A;  3TW7 A;  5EG0 B;  1B8I B;  2DA7 A;  1TWC J;  2CQQ A;  4MFD A;  2IEK A;  2LR8 A;  5K7Z A;  2LD5 A;  1LFB A;  3S17 J;  1IRZ A;  3WHC A;  3B6A A;  4M3E A;  4CYC A;  2NVQ J;  3K2A A;  2NVY J;  3JRA A;  1ZK8 A;  2XB5 A;  5M3F J;  1VI0 A;  2FJ1 A;  2HOA A;  1JGG A;  2K40 A;  5C4J J;  1Y1V J;  4ABZ A;  3BTL A;  4CYC B;  2WAQ N;  5FKK A;  2E1O A;  3JRH A;  2XGC A;  5EYR A;  1OJL A;  3OSG A;  4FE4 A;  9ANT A;  4IHV A;  1X2M A;  4S0H B;  4QSH A;  1FTT A;  5C3E J;  5IYD J;  4A3C J;  1WPK A;  1IC8 A;  4JX6 A;  1TWH J;  4DW6 A;  5K7F A;  2GLO A;  2O8K A;  3FK7 A;  1ZR2 A;  2JMW A;  2YU9 J;  1I6H J;  1EF4 A;  2L7F P;  3K7A J;  2GBY A;  1BJZ A;  1P7I A;  2K9S A;  1E3O C;  2JA5 J;  3BR2 A;  2H8R A;  1WI3 A;  4A3D J;  2R93 J;  2EZL A;  5J1Y A;  3RKQ A;  3M3Y J;  5DTD A;  1ZQ3 P;  3CDL A;  5F08 A;  1XG1 A;  1R9T J;  1U9N A;  1QRY A;  4A3G J;  2COB A;  2MGQ A;  2DMN A;  3ZOB A;  5FLM J;  2Y0S N;  2LP0 A;  2KDZ A;  1RKT A;  1PUF A;  4JP0 A;  1Q1V A;  4C3H J;  1DU6 A;  2DA1 A;  2VKV A;  4RDU A;  1MBE A;  4BY1 J;  2E2J J;  3FK6 A;  2ID6 A;  1PUF B;  2X6O A;  2ECC A;  5F1J A;  1WH5 A;  1NK2 P;  2ME6 A;  4HNV A;  1NK3 P;  3BR0 A;  2WB1 N;  4MO7 A;  1IDZ A;  1TWA J;  4B1R A;  1RES A;  2HYJ A;  1DU0 A;  2YUS A;  3TW6 A;  4JYK A;  1AU7 A;  4Y52 J;  3BG5 A;  4UUS A;  2GM4 A;  1GV2 A;  2XPV A;  3G1L A;  2HXO A;  4IHW A;  4EEF G;  5C4X J;  2HQ5 A;  5FKL A;  1ITY A;  1T33 A;  2L0K A;  5FKO A;  4UUS B;  3JRE A;  3Q0W A;  5F27 A;  2CJJ A;  4XRS A;  3GTQ J;  2Y31 A;  5DS9 A;  5EGO A;  3A03 A;  1YRN A;  4AYB N;  3JR9 A;  1WGX A;  3G1O A;  2LKX A;  3S2H J;  5IYB J;  4JX5 A;  2Y9Y A;  2VPR A;  1HDP A;  4X6A J;  1POG A;  1VND A;  1MBG A;  3PO2 J;  1B8I A;  3BQY A;  3ZQI A;  4M3D A;  3HOW J;  1OFC X;  2TCT A;  5BNG A;  2JA7 J;  4A93 J;  5EGO B;  1YRN B;  1ZR4 A;  4M3F A;  1AHD P;  3L1P A;  5FLV A;  2CQX A;  1JUM A;  5K7H A;  3HOY J;  4C3I J;  3FKI J;  3HGG A;  2DMT A;  3TP0 A;  2H1K A;  2M0C A;  2R0Q C;  1JTX A;  1IUF A;  1NTC A;  4A3K J;  1OCT C;  3BTC A;  3GTK J;  3ZQG A;  4M6V A;  3GTM J;  2VKE A;  2JK3 A;  5M5W J;  1B72 A;  2ME0 A;  4AUX A;  5M5Y J;  3GBG A;  3NAU A;  5E3N A;  3S1Q J;  2ECB A;  2M8G X;  4W97 A;  3NAR A;  1Z77 A;  3ZQH A;  2P81 A;  1X58 A;  3B6C A;  2K9Q A;  1JKR C;  2TRT A;  2MG4 A;  4V2G A;  1VFC A;  1JKO C;  2XRL A;  2AO9 A;  1B72 B;  4J19 A;  5EEA A;  2G0E A;  1FEX A;  3GTP J;  2IBD A;  2LFB A;  3GTG J;  4BBS J;  3Q3S A;  1HCR A;  4XIC A;  4IHX A;  3HB9 A;  1GT0 C;  2DN0 A;  5IP9 J;  1GDT A;  1LE8 A;  4M3B A;  2X48 A;  1ZKG A;  1U9O A;  2JA6 J;  2CUF A;  1S7E A;  1FIP A;  1G2H A;  1ETW A;  2HXI A;  2ELK A;  3BQZ A;  3QPL A;  2EZH A;  2CUE A;  2DTZ A;  1MNM C;  1WCM J;  1GUU A;  4DYR A;  3SFI A;  3E7L A;  4JX4 A;  3CQZ J;  3QQA A;  1JKQ C;  1LE8 B;  3PO3 J;  4FTH A;  1H8A C;  4Y7N J;  1BW6 A;  4RBO A;  3HKZ N;  3CCY A;  2XGD A;  1MBF A;  3H3V K;  3HGY A;  1MBJ A;  3JRC A;  1I50 J;  1BA5 A;  1WH7 A;  1MSE C;  3VPR A;  1I3Q J;  2DMQ A;  1ETK A;  3QPS A;  4C3J J;  2L7M P;  5F0F A;  3GTO J;  1TWF J;  2LVS A;  2XSD C;  1IG7 A;  4DZJ A;  1Z0X A;  2R5Z A;  4A3M J;  1UMQ A;  1F43 A;  1BW5 A;  1A5J A;  3ZQC A;  2Y9Z A;  2NVT J;  5M5X J;  1FTZ A;  1RKW A;  1U8B A;  2E2I J;  4DYC A;  3S1N J;  2R5Z B;  4D7N A;  2DA6 A;  3IV5 A;  1QVU A;  2N8G A;  3A01 A;  3LOC A;  3I4M J;  3MVP A;  1P7J A;  1SFO J;  1D5Y A;  3Q0U A;  3BR5 A;  3RZO J;  1JT6 A;  1LFU P;  2E19 A;  1Y1W J;  1GVD A;  3O8G A;  4L5E A;  3I4N J;  4XRS G;  1HF0 A;  1TWG J;  3A01 B;  2Y2Z A;  3HM5 A;  1IV6 A;  3BR6 A;  3PM1 A;  2X9D A;  1MH3 A;  3H0G J;  5J1U A;  3C2B A;  2E2H J;  4V2F A;  3TP3 A;  2R7Z J;  1MH4 A;  3FIS A;  2QF7 A;  3HOU J;  1FIA A;  4XK4 A;  5E3M A;  1VF9 A;  3OOU A;  3LSR A;  1K61 A;  2JN6 A;  4LOC A;  2HI3 A;  5JLX A;  2W48 A;  4DYQ A;  3GTL J;  2EBI A;  1ORK A;  1TC3 C;  1IDY A;  1ENH A;  2VI6 A;  2XGE A;  1JKP C;  2LY9 A;  1HLV A;  3F0C A;  3D1N I;  2DMU A;  3LSP A;  1ZTR A;  3MN2 A;  4FCY A;  5E3L A;  2LK2 A;  1ZGW A;  1QPI A;  3BG9 A;  2O7O A;  3RQI A;  1IGN A;  1MBK A;  4IEJ A;  3ZQF A;  2HOT A;  3HBL A;  2QCO A;  1MBH A;  2HDD A;  1UHS A;  3OIO A;  2PMZ N;  2NS7 A;  3S1M J;  5IOY A;  1W0U A;  2M2E A;  3TED A;  2XPW A;  3JRI A;  3O8H A;  3UKG A;  1UG2 A;  1RPW A;  3HOX J;  4X1E A;  3CMY A;  5J3L A;  5FKM A;  2L7Z A;  4G12 A;  1HDD C;  3HEF A;  1JTY A;  2FD5 A;  4UUT A;  3HDD A;  4W1U A;  2M34 A;  3MKL A;  3M4O J;  5IYC J;  5M3M J;  4A3F J;  2Y30 A;  4IHY A;  2EZK A;  2ZB9 A;  5EF6 A;  4XID A;  4A3I J;  2IAI A;  4MLO A;  2B63 J;  2NOG A;  5IP7 J;  1HOM A;  5IOZ A;  3LSJ A;  4QIW N;  5F0H A;  1AKH A;  5F04 A;  3SJM A;  1T56 A;  3RZD J;  3S2D J;  4DZP A;  1GV5 A;  3BG3 A;  1APL C;  1XC5 A;  2NVX J;  1OCP A;  5FJ8 J;  3LNQ A;  3JRG A;  5FKN A;  3GTJ J;  1AKH B;  1RET A;  4A3L J;  2DMP A;  2K9N A;  2JJ7 A;  4BY7 J;  4I76 A;  2OF7 A;  3HOZ J;  4D7M A;  4FE7 A;  3DCF A;  3S15 J;  5HOD A;  4D5C A;  1F36 A;  2R92 J;  2R5Y A;  3JRF A;  1K83 J;  2DJN A;  1JT0 A;  4A3B J;  2CRG A;  1JUS A;  1SAN A;  2DA3 A;  1FJL A;  1U78 A;  2LTP A;  2D5V A;  2YS9 A;  2AHQ A;  4B3A A;  3BR3 A;  4M3G A;  1QVT A;  2KT0 A;  5EZG A;  5F0C A;  2R5Y B;  4NDL A;  5IPA A;  4A3J J;  3W6V A;  2JA8 J;  2WV1 A;  3IH2 A;  4FIS A;  3HOV J;  4MFE A;  4MIM A;  2XPU A;  3S14 J;  2L9R A;  2M9H A;  1RR7 A;  4A69 C;  2EQR A;  3BTI A;  3BTJ A;  5EDN A;  4BKX A;  3SDG A;  2NS8 A;  5GPA A;  1ETQ A;  1X2N A;  2FQ4 A;  2ID3 A;  2CU7 A;  2O9L A;  5EZH A;  2FX0 A;  3Q0V A;  5GPC A;  3JRD A;  2LLK A;  3BR1 A;  3OSF A;  3ZQL A;  4QTR A;  3A02 A;  4C2M J;  2DA4 A;  2RAE A;  1ETO A;  5C44 J;  2OPT A;  3DEW A;  4AC0 A;  3IH4 A;  1BL0 A;  2XB0 X;  2DA2 A;  1H88 C;  1ETX A;  1JJ6 C;  4GFB A;  1JJ8 C;  1XS9 A;  2MW8 A;  3FIW A;  1ETV A;  1MSF C;  5E3O A;  3BT9 A;  2JWT A;  2I10 A;  4BBR J;  2DA5 A;  1W0T A;  1A6I A;  2MSY A;  4D5F A;  4B4C A;  4BXX J;  5GP9 A;  1JUP A;  5J1R A;  4A3E J;  1ETY A;  1CQT A;  3S16 J;  1O4X A;  4I6Z A;  5EG0 A;  3S1R J;  3IH3 A;  2EZI A;  1IJW C;  2VUM J; 
#chains in the Genus database with same CATH topology
 5IP6 A;  1QGP A;  3LSG A;  5E1Z B;  4XRM A;  1SVL A;  4IO9 F;  1FBQ A;  2KPM A;  2Q0O A;  2F4O B;  4RB2 C;  1MMN A;  4A12 A;  2X6W A;  3PQK A;  2ZC2 A;  5EG0 B;  4S04 A;  2L4A A;  2WTE A;  1HKS A;  2LR8 A;  2HZD A;  1LFB A;  3M7G A;  2EIL H;  3LFU A;  2F4I A;  2DFE A;  3WHC A;  5HDN A;  1HC8 A;  2RRE A;  3ABU A;  1T8I A;  4P55 A;  3S32 A;  1ON2 A;  1XCB A;  4Y17 A;  1ZK8 A;  5M3F J;  2KJC A;  4E7I A;  2FJ1 A;  2VQL A;  3HTU A;  5C4J J;  1Y1V J;  4ABZ A;  2IA1 A;  2R7Q A;  4CYC B;  2WAQ N;  1I27 A;  1ULY A;  2VN2 A;  4PGH A;  5CPR B;  3BJO A;  3K9T A;  4G8X A;  1FSE A;  3HIF A;  3HSR A;  4G7H F;  4L9J A;  4S0H B;  2GOX B;  3W6J B;  1AOY A;  5C3E J;  5IYD J;  3E5Q A;  3HC7 A;  1G3T A;  3K1N A;  1WPK A;  1FYL A;  4A3C J;  4I7H A;  1WJF A;  5K7F A;  4ZTJ A;  4CO8 A;  3C2G A;  1ZR2 A;  1I6H J;  2YU9 J;  1OCO H;  1K78 B;  1K6O A;  3LA2 A;  3K7A J;  5KNL A;  3KZI C;  2JA5 J;  2EZL A;  4RMN A;  2VOD A;  2NRA C;  4XLA A;  4B8X A;  2VQH A;  5EEG A;  2Z9O A;  2HOE A;  5LGT A;  2VE9 A;  2F2E A;  5H2F C;  1WJD A;  1E3H A;  4F52 A;  3FXU A;  3HJE A;  3VWB A;  2L5Q A;  1IN5 A;  3F8M A;  2CYY A;  3TKY A;  5FLM J;  3DP7 A;  2KDZ A;  2GA1 A;  2XDV A;  2VQC A;  3CCQ I;  3OYD A;  4C3H J;  1IN4 A;  1KA8 A;  5TGT A;  1R4M B;  3VYS B;  1ZRD A;  4RDU A;  3T8R A;  1MBE A;  4HQE A;  1O3Q A;  1TW2 A;  1MMS A;  2Q8K A;  4BY1 J;  3QPH A;  3FK6 A;  1U5T B;  1HW5 A;  2L9S A;  5EEH A;  2M5W A;  4V19 K;  5E17 F;  2XAQ A;  4GXO A;  2ECC A;  5F1J A;  1NK2 P;  2L54 A;  2VE8 A;  4IXA A;  4HRI A;  3PNV A;  4HNV A;  4CCJ A;  3MEX A;  2WB1 N;  1STZ A;  1D5V A;  3B02 A;  1FOX A;  4B1R A;  1RES A;  1RRJ A;  4GGG A;  1Z91 A;  2GA2 A;  2YUS A;  1TTY A;  3KEQ A;  4WXH A;  2M8E A;  3IRQ A;  2R4G A;  1FPQ A;  1BR2 A;  5LGU A;  4XKW A;  1A36 A;  3TOA A;  4M9Z A;  5BPD A;  3G2B A;  3V7R A;  2DPD A;  2EWN A;  2L0K A;  2YX7 A;  3ABT A;  3Q0W A;  4ESJ A;  4IZZ A;  4IRG A;  1MJA A;  5DV5 A;  4BYY A;  4FET A;  1UG0 A;  2WAQ A;  3A03 A;  1E0E A;  1WVR A;  4JX5 A;  5LD2 C;  3CMA I;  2VPR A;  4F91 B;  1HDP A;  2XRN A;  1VQ8 I;  2XAF A;  3V7S A;  1TP4 A;  1R4N B;  1B8I A;  2BBY A;  1SMT A;  3CCM I;  4A93 J;  4O5V A;  5EGO B;  1YRN B;  1ZR4 A;  3HPH A;  4NQW B;  4UV9 A;  5JR3 A;  1AHD P;  5FLV A;  1JUM A;  1TLH B;  3LA7 A;  4WXC A;  4LB5 A;  2E5N A;  2PN6 A;  4PJJ A;  1GHC A;  1T6S A;  3F9K A;  4I98 B;  2EIK H;  2XUB A;  3PNY A;  4A3K J;  3GTK J;  3BTC A;  1XSX A;  4U7B A;  2V1U A;  3GTM J;  4M6V A;  2DDB A;  3HHH A;  4B48 A;  2QBY A;  4M9S A;  2ME0 A;  2ZO4 A;  4Q5S F;  4KJZ A;  3OS0 A;  2R7F A;  3NWT A;  3ISP A;  3GBG A;  3NAU A;  2ECB A;  2M8G X;  1M1E B;  4RB1 A;  1DGR M;  2H6B A;  2OBP A;  4RAF A;  3Q9V A;  5D8K B;  2B9S A;  3ZQH A;  2K9Q A;  1FWZ A;  1T08 B;  4U87 A;  3WG7 H;  2MG4 A;  4EJV A;  1JKO C;  2C6Y A;  4EMS A;  1WKM A;  3FKJ A;  4II2 A;  1FMV A;  2ZKZ A;  5EEA A;  3FZV A;  1FEX A;  3GTP J;  2L7K A;  4NC8 A;  2X1E A;  4XIC A;  1XD7 A;  3OYF A;  1D0Y A;  5D6E A;  1GT0 C;  5BS6 A;  3DXJ F;  2IRF G;  3TDZ C;  2BVL A;  4DOZ A;  2CUF A;  4Y4R A;  3CTA A;  2MAB A;  2OTJ I;  1FNN A;  1BR1 A;  2A5W A;  2HXI A;  2ELK A;  3IUO A;  1J09 A;  2WB1 A;  2QWW A;  3CJT B;  2LF8 A;  3GLL A;  1IN8 A;  1WCM J;  3KLO A;  3G73 A;  1REP C;  4RLQ A;  2VLA A;  3NEU A;  3DPT A;  3SFI A;  1R1U A;  2JSC A;  2JRT A;  3CQZ J;  3E6M A;  1JKQ C;  2BY1 A;  3F6V A;  5CVU A;  3K4K A;  4BDY A;  1W36 D;  1K7A A;  2KIF A;  2P5K A;  2Z99 A;  4GCV A;  4M73 A;  4P9F A;  3R0A A;  3KP6 A;  3CCY A;  2XGD A;  1MBF A;  2DDA A;  2ZSH B;  5HVQ C;  1WH7 A;  4N9H A;  3VYR B;  2Z33 A;  1XDS A;  2CQ7 A;  4LG0 A;  2HPM A;  5GAD J;  1VQ6 I;  2H6C A;  2DMQ A;  1ETK A;  2KRF A;  3BOQ A;  5F0F A;  3IRR A;  2EFN A;  2H27 A;  1Y0N A;  2XSD C;  4OMY A;  2RNG A;  1WJ5 A;  4A3M J;  1UMQ A;  2Q2E B;  1F43 A;  1Z7L A;  4PZJ A;  1LDJ A;  1YW7 A;  2HKX A;  2Y9Z A;  1Z1D A;  5GTH C;  3GZ6 A;  1VQ4 I;  2E34 A;  2WBM A;  4XKC A;  4P9U A;  2EIJ H;  2UUZ A;  2HEO A;  4BS9 A;  5FLX Z;  4D7N A;  4LMY A;  2DA6 A;  3PJR A;  2V9V A;  5FO5 A;  5HNH A;  1XSD A;  4A0Y A;  3T0Y A;  1P7J A;  1SFO J;  4RLF A;  5HLI A;  5B1B H;  2BXY A;  1BI0 A;  1OMI A;  2E19 A;  2LBF A;  1Y1W J;  2P6T A;  1H9T A;  4L5E A;  3LL7 A;  2R7W A;  4DJA A;  2M3A A;  1TWG J;  4NBQ A;  3A01 B;  2V1N A;  1IV6 A;  1SC7 A;  1ZH5 A;  1Q1H A;  3X2Q H;  1X4O A;  2JVH A;  4MTD A;  4L9T A;  1IRF A;  2X1C A;  4N4O B;  1FOK A;  2O0Y A;  3CJN A;  2HTS A;  1MH4 A;  3OYJ A;  1NHA A;  4CZZ A;  3F8F A;  2D1V A;  5IT9 K;  3L7W A;  4RAZ A;  3S2W A;  1LPQ A;  1ON1 A;  2G9W A;  1BOA A;  3D5S C;  3TMO A;  3J7Y J;  4E7J A;  2W1O A;  3PFY A;  2ESN A;  1K61 A;  3T1B A;  3OIP A;  5ICC A;  2FQ3 A;  2W48 A;  4A0X A;  2Y0M A;  4BGD A;  1XGS A;  3GXO A;  2D5V A;  1ENH A;  2XGE A;  2GOM A;  3OYG A;  2FU4 A;  5KAI C;  1D8K A;  1SVO A;  2E7W A;  1BIA A;  3F8N A;  4FCY A;  5L3C A;  1WFX A;  2LK2 A;  3KLN A;  4PK4 A;  4BH9 A;  3OL3 A;  3BG9 A;  1X1C A;  4UV8 A;  3O6B B;  1IGN A;  1MBK A;  4IEJ A;  4LJZ F;  2BW3 B;  3JTG A;  1RUN A;  1MBH A;  1UHS A;  4FHT A;  3SEZ A;  4L18 B;  3SZP A;  4EM1 A;  5LHG A;  1ERD A;  2O3F A;  5HS8 A;  2ZNY A;  4EAT A;  3JRI A;  3DTE A;  4BQA A;  3CMY A;  2VXZ A;  3WU0 A;  3GME A;  2FBI A;  3Q5F A;  3CCE I;  3FXJ A;  1XTA A;  5ILU A;  2DOF A;  4UUT A;  1ZRF A;  3HDD A;  1KU2 A;  1R5I D;  4E4H A;  5FB2 A;  4CXF A;  2EZK A;  3JCU C;  4WX9 A;  1FC3 A;  5FD6 A;  4XOR A;  3WTV C;  3OS1 A;  2LG4 A;  4MLO A;  5HS9 A;  2JPB A;  4JOM A;  2QKM B;  3F72 A;  3ZCO A;  1MZB A;  1HOM A;  2ACJ A;  2XF7 A;  2QQ8 A;  4KMF A;  5F0H A;  3H92 A;  1HQC A;  5LHH A;  3S2D J;  5BMZ A;  2QQ9 A;  5F64 A;  1GV5 A;  2W85 A;  1Z67 A;  2NVX J;  1OCP A;  4BXF A;  3D5R C;  2IW5 A;  4ZJZ A;  2MC3 A;  2MC4 A;  2PI0 A;  1YIO A;  2DMP A;  2K9N A;  5E18 F;  1Y39 A;  2I8D A;  2HQR A;  4AVZ A;  1XMX A;  1RUO A;  1ZAO A;  3CJR B;  3JRF A;  4ZH4 F;  4BQO A;  4AYB A;  4A3B J;  1WJC A;  1FJL A;  3FMQ A;  2XF6 A;  4LGW A;  3OYB A;  1X1D A;  3ESW B;  4ZYA A;  2IS6 A;  2M4K A;  5DDG A;  1LDK B;  1S5L C;  6PAX A;  1L0O C;  2D2W A;  4GO1 A;  2WV1 A;  3A0H C;  1DP7 P;  2OZU A;  1GVJ A;  3ZMS A;  2WWY A;  2QQB A;  5BQT A;  1VQK I;  2F5E A;  3HSF A;  2XVC A;  1MMG A;  3S14 J;  1IF1 A;  4L9N A;  2M9H A;  3W6K B;  2O61 A;  2E7X A;  5AIQ A;  1MDM A;  3BTJ A;  1BIB A;  4HDV A;  4XL9 A;  4BKX A;  3SDG A;  3J80 Z;  5FRM A;  3BZC A;  2GXG A;  1OCC H;  3QYF A;  1ETQ A;  3OR2 C;  1X2N A;  2VQG A;  4KDP A;  2J5P A;  2HZT A;  2RVC A;  5H6R A;  1WWX A;  2CU7 A;  2L4M A;  2O9L A;  5EZH A;  1LVA A;  2FX0 A;  3PSF A;  5HS7 A;  5GPC A;  3OYK A;  3JRD A;  3WTS C;  4LK1 F;  3ZQL A;  2X51 A;  4RGX A;  3HUG A;  2BOL A;  1U0J A;  4GYG A;  3IH4 A;  3TGN A;  3EUA A;  1TT0 A;  1ZHF A;  2A6E F;  2OD5 A;  2HR3 A;  1YG2 A;  4NUB A;  1A31 A;  2DQR A;  3RYR A;  5E3O A;  2ZJ2 A;  3BT9 A;  2JWT A;  2F4M B;  2WAE A;  1ZN2 A;  4JK1 X;  2I10 A;  2VBX A;  1G3Y A;  3Q9S A;  1A6I A;  3J7A Y;  3KX2 A;  2QSF X;  3QYB A;  2FOW A;  2VT2 A;  4AVP A;  1O4X A;  1GXP A;  2XKO A;  3TO9 A;  3S1R J;  1HXD A;  1P4X A;  3IH3 A;  2DU9 A;  2CFO A;  3RTR A;  2AXT C;  1ZLJ A;  2HOS A;  2CW7 A;  4B44 A;  2OCC H;  3FBN B;  2A07 F;  4EQQ A;  1MND A;  2JT1 A;  4XLH A;  3JRB A;  2CWE A;  1XCV A;  1Z9C A;  1B8I B;  2P8T A;  1TWC J;  4NB5 A;  3HOS A;  3C3W A;  2X1D A;  3GWZ A;  2LD5 A;  3GF2 A;  4BDZ A;  1W36 C;  3S17 J;  3ZP5 A;  3W2V A;  3RIR A;  3B6A A;  3R6S A;  2E36 A;  3CP2 A;  4OIP F;  3K2A A;  2GIV A;  3AAF A;  1JI8 A;  2HQA A;  2XB5 A;  1CGP A;  1SFU A;  2JUG A;  4YEL A;  2HOA A;  3S3O A;  1JGG A;  2YSR A;  3M8E A;  2K40 A;  2RDP A;  3OYA A;  3ELK A;  2PJR A;  2E1N A;  2KL4 A;  3BTL A;  3DKW A;  2K5C A;  1V4R A;  5FKK A;  5E79 C;  4FE4 A;  3KYC B;  2WV0 A;  3OYM A;  4A2U A;  2LH9 A;  4FX0 A;  3TO7 A;  4RGS A;  2AS5 F;  2RNJ A;  1YJW I;  2CFX A;  2DYS H;  4JX6 A;  1RR8 C;  5GTI C;  1IC8 A;  1IRX A;  2GLO A;  4OIO F;  3BY6 A;  3HRM A;  4BU2 A;  3FXL A;  1EF4 A;  2L7F P;  2GBY A;  1S29 A;  1P7I A;  2K9S A;  3QWL A;  2AQE A;  3BR2 A;  3K4L A;  2JUC A;  4P1W A;  3B73 A;  4HZF A;  3RKY A;  1TNT A;  3VSL A;  3RKQ A;  5D5U B;  2X0L A;  5DTD A;  3M3Y J;  2V79 A;  2K02 A;  4FX4 A;  1OCR H;  1YLF A;  2JVG A;  1QRY A;  1OCZ H;  2COB A;  1MKM A;  4HSR A;  2M87 A;  3OS2 A;  2P7V B;  4MTE A;  3ZOB A;  2LP0 A;  4D1Q A;  1RKT A;  4XR6 A;  4CIC A;  1KYZ A;  1OYI A;  3WTZ A;  2VKV A;  4PGG A;  4C30 A;  1TL8 A;  2DCE A;  4HLY A;  5E8I A;  1PUF B;  2BV6 A;  2PMH A;  2MA3 A;  2O5R A;  2OZ6 A;  3CZ6 A;  3KCC A;  3MZY A;  1NK3 P;  3BR0 A;  4P5O A;  4MO7 A;  2QSH X;  1W7P B;  2GIZ A;  4G6D A;  3SYT A;  5JFR A;  3CUQ A;  1DU0 A;  5J4V A;  2XF5 A;  1ZGA A;  4Y52 J;  3BG5 A;  4UUS A;  2O6G E;  2Y48 A;  1HA8 A;  3HTS B;  1MNE A;  3OYI A;  1Z05 A;  3TOB A;  2DO7 A;  2BHY A;  1BI2 A;  5FKL A;  2F5D A;  2IP2 A;  4I01 A;  3KFW X;  1DUX C;  2KIU A;  5LEJ A;  1NG6 A;  5F27 A;  3E6C C;  4HX7 A;  2VBY A;  3ZN1 A;  5GAG J;  2QA4 I;  1YFH A;  4LLG F;  4BEH B;  1WGX A;  2LKX A;  5IYB J;  4NNJ A;  4PFO A;  2KJB A;  1BBY A;  1QO0 D;  3CO6 C;  2GWR A;  5ICF A;  1POG A;  2F6C A;  4ESF A;  4MEY F;  1VND A;  1HW2 A;  3ASO H;  3ZQI A;  5GAE J;  2FA5 A;  4M3D A;  1OFC X;  2TCT A;  2KRH A;  1E2X A;  1MW7 A;  1J2X A;  4M74 A;  3MFK A;  3L1P A;  4IKF A;  5K5R A;  2CUZ A;  3HOY J;  1EH6 A;  3L2Q A;  1J9I A;  4OAY A;  5DCM A;  4C3I J;  3FKI J;  4CA0 A;  1J59 A;  3NWS A;  3CUQ C;  1D1C A;  1U3E M;  2H1K A;  1DGW Y;  2K9L A;  3BPV A;  5AON A;  2EV5 A;  3BDD A;  4UVB A;  5D8L B;  1T38 A;  2F48 A;  1KQ8 A;  1FBU A;  1MJB A;  2WA0 A;  5FLX K;  3L2V A;  4UNO A;  3ZQG A;  3HRT A;  3R4K A;  2VKE A;  3LQR A;  4RS8 A;  3HL2 A;  1B72 A;  1G3S A;  4AUX A;  5M5Y J;  4I0B A;  2VJ5 A;  3S1Q J;  4BXU A;  5L3F A;  1Z77 A;  3AKZ A;  3SEQ A;  3D0S A;  1X58 A;  1PVE A;  1XGN A;  3E3V A;  4BNC A;  5H6Q A;  4WF2 A;  1VFC A;  3QAH A;  2AO9 A;  1QU3 A;  4RAG A;  2ELJ A;  2DT5 A;  2IBD A;  3A4C A;  4KIS A;  2XC7 A;  1UCR A;  4PFP A;  4IHX A;  2DN0 A;  1AA7 A;  4HDU A;  1XGM A;  4M3B A;  1LE8 A;  2X48 A;  1R5H A;  1U9O A;  1ZKG A;  3BZ6 A;  1S7E A;  5H20 A;  1BR4 A;  3WTX C;  3N97 A;  4EJW A;  2F5V A;  3CME I;  3BQZ A;  2E1M C;  3ML6 A;  1OYW A;  5J4Y A;  2CUE A;  2FNP A;  3E0J B;  1D1A A;  4Z6Y A;  3ZPL A;  2ZFW A;  4DYR A;  4RB3 C;  3E7L A;  1H9G A;  2TDX A;  2QYO A;  3DEU A;  3QQA A;  4EGZ A;  2FBK A;  3HKZ N;  3H36 A;  2UV1 A;  3ERE D;  5GAH J;  2HKO A;  4PJ0 C;  2L01 A;  2H1L A;  5JVT A;  1MBJ A;  4KIF A;  1YX5 A;  5CVV A;  1I50 J;  2FOK A;  5CVI A;  5LLQ A;  1BA5 A;  2PQ8 A;  4FAS D;  2ZNZ A;  4XLE A;  2NNY A;  1PUE E;  3K4M A;  4QLC U;  3OIQ A;  4C3J J;  2K9M A;  2L7M P;  2VL8 A;  2YX4 A;  4YFK F;  1SFK A;  2LVS A;  2IA2 A;  3ZQQ A;  2EK5 A;  4AIJ A;  1MD0 A;  2R5Z A;  4YG2 F;  2VOO A;  1KZH A;  1YS7 A;  3ZRG A;  1N78 A;  4PDK A;  4HNT A;  4U0V A;  2E2I J;  3PIP F;  3OOP A;  4Q48 A;  3S1N J;  4RAY A;  3V8K A;  2A68 F;  1R7J A;  2CUJ A;  1VQM I;  3A2K A;  3WGI A;  1QVU A;  2N8G A;  3LOC A;  1DPR A;  3ZQ7 A;  4E7L A;  2M30 A;  4L5I A;  1YIT I;  4U0Y A;  4Q47 A;  2NVU B;  3Q0U A;  3RZO J;  1LFU P;  1VTN C;  1Z6T A;  1GVD A;  3HPG A;  1EJ9 A;  1HF0 A;  3W2A A;  3HM5 A;  4UVC A;  3BR6 A;  3L9F A;  3PM1 A;  3BJ6 A;  3H0G J;  1TW3 A;  4CCK A;  1J0R A;  1MDM B;  2E2H J;  5D4S A;  2W57 A;  2L3D A;  3T8T A;  5ERI A;  2IGN A;  4G7Z F;  1FMW A;  4ZDO A;  2QF7 A;  4GRI A;  5LRR A;  2DPU A;  4ITV A;  1SD6 A;  2ZCW A;  3U2R A;  2XKP A;  3OMY A;  5JLX A;  4IRH A;  4DYQ A;  3IHU A;  1ORK A;  4Z2Y A;  1IDY A;  3K4C A;  1JKP C;  5KCM A;  2Y69 H;  4RB0 A;  3F0C A;  3GEZ A;  2CGP A;  4IQJ A;  2O8X A;  1CF7 B;  1ZGW A;  3HKZ A;  1BN5 A;  2ZXH A;  3BLY A;  3OL4 A;  3DQV C;  2OQR A;  1BC7 C;  2ESH A;  1USS A;  2RN7 A;  1XMA A;  3HBL A;  4I99 C;  4LG3 A;  2QCO A;  5LBQ A;  2HDD A;  3WG9 A;  3MKZ A;  1B9N A;  5IOY A;  1L3L A;  2VPL A;  4Q4Z F;  4OIQ F;  1BI1 A;  3ZXS A;  2XPW A;  3F23 A;  4AD9 A;  4A0Z A;  1UG2 A;  1RPW A;  3HOX J;  1LUJ B;  5K5Q A;  4X1E A;  1IV8 A;  1R5G A;  3NRV A;  3J80 K;  2M7A A;  1WRJ A;  4HEA 2;  4W1U A;  4KN7 X;  3M4O J;  1IRG A;  4HPQ A;  5IYC J;  5CKT A;  2BXZ A;  3S3M A;  4U88 A;  2ZXW H;  2ZB9 A;  3DLL F;  5EF6 A;  4XID A;  2EFQ A;  4H4K C;  1J75 A;  2M1B A;  4BL0 B;  2B63 J;  3IWF A;  1QZY A;  4BUP A;  3LSJ A;  1O7F A;  4B47 A;  2MH9 A;  3BJA A;  3GFJ A;  2VON A;  1OR7 A;  2A61 A;  4NC6 A;  3IP4 B;  4MEX F;  1XC5 A;  1O3S A;  4I2O A;  3LNQ A;  1IZ1 A;  3AG1 H;  3DU6 A;  4UHT A;  3JRG A;  2W24 A;  1ZG1 A;  1AKH B;  4YIF A;  3LSM A;  3ULQ B;  2JJ7 A;  3I59 A;  3P7N A;  5L3D A;  4D7M A;  1IN6 A;  1IXS B;  2XAJ A;  1F36 A;  2R92 J;  2R5Y A;  1X1B A;  3ABL H;  2YU3 A;  1JT0 A;  1FLI A;  2I5U A;  1U78 A;  2RQP A;  1V3F A;  2AHQ A;  1YYV A;  1Y8Q B;  3AG2 H;  3BR3 A;  4M3G A;  4R8H A;  3M1E A;  4B3A A;  5IT3 A;  2UZK A;  1QVT A;  1SAX A;  1KU9 A;  1KU7 A;  1Z6R A;  5IPA A;  2K4B A;  3EUK L;  1TZL A;  1QNT A;  3JSP A;  3LAP A;  3T5X A;  4EJT A;  3R60 A;  2A6H F;  3RSN A;  2EIM H;  4YII A;  2VB6 A;  5DYM A;  4E7S A;  1G8X A;  5BOX A;  5FFX A;  3BPX A;  2XPU A;  3FM5 A;  4ON0 A;  1OR7 C;  5LRS A;  1RR7 A;  1K4S A;  3IAS 2;  2EQR A;  2HVQ A;  1Y6I A;  2K3P A;  4L0Z B;  2BY2 A;  2E60 A;  3HXL A;  4A5N A;  3I56 I;  3I0T A;  3I55 I;  2ZME A;  1TQP A;  2FQ4 A;  4AIK A;  3AG4 H;  2IS2 A;  3FXQ A;  2RC4 A;  3Q0V A;  3GFL A;  3L2W A;  2LLK A;  3BRO A;  2NXN B;  3K70 C;  4IOA F;  2DA4 A;  3P9I A;  3H9G A;  1YOV B;  3FMR A;  3CJQ B;  5C44 J;  1YO5 C;  4AC0 A;  1O3T A;  4WXD A;  2DA2 A;  3TQN A;  4N4N B;  3G6E I;  2NS0 A;  3ZGK A;  1JJ8 C;  3FDY A;  4CYD A;  2VOP A;  2PBI A;  3FIW A;  2IGM A;  3CUQ B;  2KHM A;  4AID A;  4ANJ A;  2VJ4 A;  3DTI A;  4LIV A;  1IAW A;  4BHC A;  1T95 A;  2OUM A;  1W0T A;  4B4C A;  3CCV I;  4I02 A;  4RGU A;  2Z3Y A;  4BXX J;  2W7N A;  1JUP A;  2LKP A;  2PEX A;  4A3E J;  2DFF A;  5EG0 A;  2EFP A;  2D45 A;  1ONV A;  2M7B A;  3OYL A;  2ZME C;  1WSU A;  3NQO A;  4BQN A;  4EGY A;  1UAA A;  3PO2 J;  4OIR F;  2IVM A;  1F1Z A;  2EH3 A;  1H89 C;  3QU6 A;  2A69 F;  5JLW A;  1VQ7 I;  3VEP A;  4ZDP A;  2ZFU A;  2DA7 A;  3WE2 A;  1QZE A;  1SEU A;  4LLL A;  2CV0 A;  2CQQ A;  4O3M A;  4MFD A;  2R7V A;  2IEK A;  5K7Z A;  1OKR A;  4BAY A;  2EIN H;  1H0M A;  4LK0 F;  3KP3 A;  1ZG3 A;  2PLY A;  1D0X A;  4DNC A;  5DCM B;  4CYC A;  4C9Y A;  2NVQ J;  1R58 A;  1XMK A;  3RYP A;  2L9V A;  3JRA A;  5JVG F;  3E1S A;  3P9C A;  3SQN A;  3CDH A;  2R7R A;  2Q1Z B;  1WJB A;  1O7L A;  1U6G A;  5EYR A;  1D1B A;  1YTY A;  2IPQ X;  1OJL A;  3VFZ A;  9ANT A;  1E17 A;  5LGN A;  4IHV A;  3LMM A;  1K78 A;  2KIS A;  5DM7 F;  4BAC A;  1FTT A;  1C0W A;  1JXS A;  4UXN A;  3WGH A;  3DPU A;  3FK7 A;  3F21 A;  1B59 A;  1V5G A;  1UB9 A;  2NYX A;  2JMW A;  2VKH A;  1J7K A;  3RPQ A;  2ZJQ F;  1BJZ A;  1QPM A;  2V9K A;  4Y33 A;  1E3O C;  4LLN A;  4CUG A;  5AIP A;  1WI3 A;  3HYI A;  3BG7 A;  2H8R A;  2R93 J;  4DGW B;  2AQF A;  1ZQ3 P;  3WGG A;  3MCZ A;  3CDL A;  3GYH X;  3BCB A;  4KNY A;  1U9N A;  2DOA A;  2LC2 A;  5JHF A;  4A3G J;  2MGQ A;  2MD5 A;  5ICE A;  2CV2 A;  3QP6 A;  2EA2 A;  1S9H A;  2Z1D A;  1ZLK A;  2Y0S N;  1U5T A;  3CO7 C;  2HU9 A;  1Q1V A;  3OY9 A;  3EDP A;  2FXA A;  1VQ9 I;  1TQM A;  3GX4 X;  5HDG A;  3PUB A;  3AL0 C;  2Z2S B;  4KT6 A;  3DWL E;  4GYI A;  4R1H A;  1YIJ I;  2X6O A;  3KET A;  1WH5 A;  2ME6 A;  4ETS A;  1JGS A;  3W2W A;  3GZN B;  4ENJ A;  2M45 A;  1TWA J;  2KIQ A;  3ZMV A;  4AU7 A;  4YEJ A;  3RPU D;  1FY7 A;  4R79 A;  1AU7 A;  1B6A A;  4HF1 A;  4PUS A;  3LST A;  1GV2 A;  4DIQ A;  3EUH A;  2XPV A;  3G1L A;  4CZC A;  3VDX A;  4IHW A;  4EEF G;  2HQ5 A;  3K1M A;  1ITY A;  1T33 A;  4IL6 C;  5B5E C;  5FKO A;  2LOO A;  2HPI A;  3LSH A;  1OIS A;  4CCO A;  2CJJ A;  1A6Q A;  4XRS A;  3GTQ J;  1U5T C;  3R0J A;  4JQF A;  5EGO A;  2FF4 A;  2X4H A;  2DK5 A;  1YRN A;  1J5Y A;  3G1O A;  4NQW A;  3S2H J;  2JQ7 A;  2OAZ A;  5D5V B;  1I5Z A;  3J7A O;  2DTR A;  2DK8 A;  2LRE A;  1YQA A;  3K1P A;  3CP8 A;  2L9N A;  1MBG A;  4G94 A;  2JA7 J;  2WY8 Q;  4DQ2 A;  4M3F A;  1T39 A;  4MQ9 F;  2CQX A;  2P5L C;  1O3R A;  5K7H A;  2XSJ C;  5K5O A;  4XSX F;  2STT A;  3UNG C;  3ZN0 A;  5HLH A;  2DMT A;  2GAU A;  4IVN A;  2NAZ A;  2DJI A;  2M0C A;  4BE2 A;  1MIJ A;  2P0W A;  1DP3 A;  4U7D A;  1R36 A;  3DTK A;  3VSK A;  1NTC A;  3FMS A;  1OCT C;  3F3X A;  1VQ5 I;  3GW2 A;  3SDB A;  4IPA A;  5CVR A;  2LSO A;  5M5W J;  3EUH C;  2E1C A;  3O3K A;  5E3N A;  1WJA A;  3PQJ A;  4ESB A;  2XAS A;  3B6C A;  1OYY A;  3GZ5 A;  4YIR X;  1LKX A;  2QBY B;  3CCJ I;  2XRL A;  1T0F A;  3H3Z A;  4XOT A;  4K2E A;  3DEE A;  4A6D A;  4J19 A;  2A3S A;  2G0E A;  1LEB A;  2R7S A;  2ELH A;  1XDU A;  5DUI A;  4BBS J;  2LFB A;  2OU2 A;  2BVM A;  3Q3S A;  3DBH B;  3SXY A;  3HB9 A;  2QQA A;  1GDT A;  4PJN A;  3CC7 I;  4ZZL A;  3E5U A;  3FM3 A;  1ZEL A;  2ISZ A;  4HOB A;  2O03 A;  4G7O F;  3LFK A;  3VB2 A;  1LDD A;  2EZH A;  2L2O A;  2R7X A;  2DTZ A;  4PSW A;  1SVM A;  2M4G A;  2STW A;  4I0A A;  4JBA A;  3M1C A;  3FXM A;  1H8A C;  2YR2 A;  1BW6 A;  1MJ9 A;  3TBI A;  2UWM A;  4HA8 A;  2W4S A;  3K69 A;  2JTV A;  1X3W B;  2AXL A;  2X6Y A;  5LFA A;  4M6Y A;  3SFZ A;  1VZ0 A;  5DCF A;  3K0L A;  1T2K A;  2VXD A;  3VPR A;  2K27 A;  4M71 A;  1KU3 A;  1T0F C;  2LDU A;  4F92 B;  2XAU A;  1X4P A;  2FE3 A;  4DZJ A;  1Z0X A;  4XNF A;  3H3U A;  2R7U A;  2K4J A;  4ENN A;  4LG0 B;  3PNT A;  1BW5 A;  4XLN F;  1S6L A;  2NOJ B;  1D0Z A;  1FYK A;  2PMU A;  1FTZ A;  1RKW A;  1U8B A;  5DEQ A;  4ZYD A;  1FP2 A;  2P6S A;  2UXN A;  3IAM 2;  2W25 A;  3O2P E;  1Z3Y A;  2MLG A;  3FWE A;  3IV5 A;  3QOP A;  4KN4 X;  4OIN F;  1B1B A;  3A01 A;  4XM3 A;  3IWZ A;  1D5Y A;  5J40 A;  2QUF A;  1JT6 A;  2QGU A;  4ASN A;  3I4N J;  5D6F A;  1IXC A;  4XRS G;  2KP6 A;  5IY5 H;  1Z7U A;  3BCA A;  1ZGJ A;  3M07 A;  2W00 A;  1WHU A;  3CF2 A;  3LSI A;  4DBR A;  2VBZ A;  5J1U A;  3C2B A;  3KEY A;  4B09 A;  2V6E A;  2LBF B;  2GXA A;  3LWF A;  2EA4 A;  2XRO A;  2R7Z J;  1UJ8 A;  2HDW A;  4LIU A;  1FIA A;  4XK4 A;  2LF7 A;  3QP5 A;  4ENM A;  1XGO A;  3V8L A;  2HI3 A;  1KQ9 A;  2OV7 A;  3GTL J;  2VKD A;  4ZDL A;  1W4M A;  1TC3 C;  4HG2 A;  3OYE A;  3C18 A;  2VI6 A;  2ICW G;  2BW3 A;  2K3F A;  2LY9 A;  1D3Y A;  1P2F A;  1UEL B;  1KGS A;  3K70 D;  1IN7 A;  3KYL A;  3RKX A;  3LSP A;  2M0M A;  1N77 A;  4BHP A;  4HNU A;  2JRM A;  1I39 A;  2ADU A;  4J00 A;  1XX5 A;  5E3L A;  3DU5 A;  2FUG 2;  2YPR A;  3SZG A;  3DKY A;  3MD2 A;  3RQI A;  2KLO A;  3F22 A;  2BHZ A;  3ZQF A;  1RZ4 A;  2HOT A;  3K4N A;  1OQY A;  4ENK A;  2PMZ N;  4HST A;  2NS7 A;  4FQG A;  2COM A;  1W0U A;  4OMZ A;  1SAU A;  2M2E A;  2HDC A;  3C7J A;  2CQK A;  3E6B A;  1HW1 A;  2E71 A;  1U2W A;  4A5M A;  3M8F A;  4N9I A;  2HVR A;  4G12 A;  4LIT A;  1BI3 A;  3HEF A;  3PSI A;  2FD5 A;  2DOE A;  2LMD A;  4EJU A;  5K1Y A;  1FZP B;  3HRU A;  5KAF C;  2M34 A;  4PSX A;  3RPU A;  4EM2 A;  3D5L A;  3DBR B;  1W7P D;  2WC2 A;  5M3M J;  1R23 A;  1YW8 A;  3K6G A;  1R71 A;  2Y30 A;  4IHY A;  2DT6 A;  3A1Y A;  2CG4 A;  1Y8R B;  2QEX I;  4N0B A;  1FBS A;  3R61 A;  3ZMT A;  2BZT A;  2HQN A;  4X0G A;  4KIG A;  4II3 A;  4QPQ A;  5IOZ A;  3RKW A;  1I3A A;  2KDO A;  3IKV A;  5F04 A;  3CD6 I;  3S8P A;  3RZD J;  1IUY A;  2CQN A;  4XLP F;  4DZP A;  1UZC A;  3BG3 A;  3TDU C;  3KYD B;  3GCM A;  4BHB A;  2EFW A;  5FJ8 J;  3GLX A;  1Z3X A;  2XHK A;  2IS1 A;  1K4T A;  1G4D A;  3GTJ J;  4D9J A;  4A3L J;  5KK1 A;  2BYV E;  1YJN I;  1TT5 B;  3H5R A;  4RGR A;  3HOZ J;  3ZMU A;  4FE7 A;  2KIM A;  2V9P A;  5HOD A;  1X19 A;  2OCE A;  4OU0 A;  2CH0 A;  4XKV A;  4D5C A;  4F3Q A;  2CSO A;  1EKE A;  2DJN A;  5CVJ A;  4F55 A;  4IF4 A;  2DA3 A;  3JSO A;  3AL0 B;  2B7E A;  4E7Z A;  2DW4 A;  4EJO A;  5F1R A;  1U8R A;  2HNH A;  5FRO A;  2KT0 A;  4Y15 A;  5EZG A;  5F0C A;  1QBJ A;  3VOD A;  3CUO A;  4A3J J;  3W6V A;  2JA8 J;  2XGX A;  2DYR H;  3ZR8 X;  2ZJR F;  3M9A A;  3CCL I;  3HOV J;  4CCL A;  3EYI A;  5FRN A;  2QSG X;  1ZG5 A;  2V26 A;  2QKL B;  2QLZ A;  5D5X B;  4MIM A;  1HST A;  2Y75 A;  1W5S A;  2R7T A;  4KYW A;  2IJL A;  3ROU A;  3DFG A;  4A69 C;  2P7C B;  1SFX A;  4HX4 A;  3BTI A;  4MQV A;  4F7Z A;  1R00 A;  3LAJ A;  2DFI A;  2PMZ A;  3L09 A;  1ZRE A;  2GXB A;  4YRV A;  5GPA A;  3LSK A;  4KMU X;  4GDF A;  4BJ6 C;  1VQL I;  2ID3 A;  3J81 K;  5DD8 A;  2JZY A;  3V8J A;  3BR1 A;  3S93 A;  3OSF A;  3A02 A;  1AWC A;  5FFZ A;  4RM3 A;  1QA6 A;  3OR1 C;  2OPT A;  4S05 A;  5F6F A;  3QRF F;  5L3E A;  2XB0 X;  1UHW A;  3L2C A;  1ETX A;  1GLN A;  3CMM A;  3K4B A;  3HG9 A;  4GFB A;  3PIO F;  1XS9 A;  1ETV A;  5ILV A;  1MSF C;  3U9G A;  4KUM A;  2P5V A;  3HUG B;  4O6J A;  4F93 B;  3DPL C;  3KE2 A;  1K6Y A;  4BBR J;  1LFP A;  1MMA A;  2MSY A;  2PFB A;  3F8B A;  2LRD A;  1BM9 A;  3WTT C;  4WWC A;  4J01 A;  5GP9 A;  5KVR A;  3HSE A;  5J1R A;  3WE3 A;  1G3W A;  3ECH A;  3ZMD A;  1CQT A;  2V1D A;  3S16 J;  2V1X A;  5TRD A;  1P92 A;  2EFO A;  2B0L A;  2EZI A;  3I9V 2;  2VJJ A;  2HYG D;  1QQI A;  5D4R A;  1E3P A;  3WHB A;  2WY7 Q;  5B3S H;  5JI6 A;  3G1M A;  5EJC A;  3KP4 A;  3DLA A;  1ODD A;  3TW7 A;  4E6K G;  1LJ9 A;  3HOT A;  3JAM Z;  1ZAR A;  1S7A A;  2KQR A;  1W5C C;  1IRZ A;  1VQN I;  5HLT A;  1FOY A;  2OA4 A;  5DUK A;  1N25 A;  1DQU A;  4M3E A;  4YFN F;  2NVY J;  4BJT A;  1FOW A;  1X1A A;  3EQL F;  2DI3 A;  2HVS A;  4AWX B;  1VI0 A;  3QPT A;  2VC1 A;  1V5E A;  2WAD A;  3AG3 H;  4RM2 A;  3FXR A;  4ZTF A;  3RDI A;  3HHG A;  1RNL A;  3CF5 F;  1YI2 I;  3JRH A;  2E1O A;  2LY2 A;  4NC7 A;  2XGC A;  2CMP A;  3OSG A;  3WU2 C;  1EV7 A;  3U21 A;  1X2M A;  2FSW A;  1ZRC A;  4KIC A;  4WCG A;  3QOE A;  2MH2 A;  4QSH A;  1PP8 F;  3F6O A;  2HFH A;  2J5O A;  2PJR B;  4CGZ A;  4BE1 A;  4HF2 A;  3MQ0 A;  1BOB A;  2V7F A;  2ZXJ A;  1NH3 A;  1TWH J;  2UXX A;  5CJ9 A;  4DW6 A;  2O8K A;  1SFE A;  4IOC F;  3DV8 A;  4Y13 A;  1I1G A;  1WZ2 A;  2DAO A;  4A3D J;  2HTJ A;  3CLO A;  4EVI A;  2IT0 A;  2ZJP F;  5J1Y A;  4BE0 A;  3CC4 I;  1W5T A;  3FHN A;  2W82 A;  2DLL A;  5F08 A;  1XG1 A;  3H1C A;  1R9T J;  3WTU C;  3BG6 A;  4HF0 A;  1F5T A;  2EB7 A;  2DMN A;  1X3Z B;  3ABM H;  5A2Q K;  3HRS A;  3E5X A;  2ZBK A;  2F5F A;  1PUF A;  2IS4 A;  1DPU A;  5J8C A;  4JP0 A;  3J7Z I;  3OYN A;  2MYS A;  3I4P A;  3PFI A;  3COA C;  1DU6 A;  4HV5 A;  2DOD A;  2VT3 A;  1OLT A;  2DA1 A;  5B1A H;  4EV0 A;  1W7P A;  2E2J J;  3OV8 A;  5E1X A;  5HNF A;  3FHZ A;  1W1W E;  2ID6 A;  2VAS A;  3MZH A;  3H0D A;  3E97 A;  3MKY B;  1I6X A;  3G71 I;  2LKS A;  1IDZ A;  4FT8 A;  3K4J A;  5FGM A;  2HYJ A;  4UY8 I;  3TW6 A;  3DF8 A;  4JYK A;  5ILS A;  3BWG A;  1EA3 A;  4PCQ A;  2GM4 A;  1TQI A;  4ZYG A;  4D0P A;  3I53 A;  2ZSI B;  4TV7 A;  4BEH A;  5E8G A;  4XMY A;  5L3B A;  4IJA A;  2HXO A;  5C4X J;  3H9J A;  1UFM A;  4QPO A;  4A6E A;  2W84 A;  4IQ4 A;  4MNU A;  4NHJ A;  4UUS B;  3JRE A;  3OWT A;  4KIB A;  3RCO A;  2OTL I;  1PJR A;  2CW8 A;  2K7L A;  2Y31 A;  4BQQ A;  1LNW A;  5DS9 A;  1FT9 A;  4AYB N;  3JR9 A;  5J6X A;  3VYT B;  3CES A;  4IHT A;  3I64 A;  2Y9Y A;  2NNN A;  4CSW A;  4X6A J;  1JHH A;  2PX9 A;  2VC0 A;  2OJE D;  1RC9 A;  2LNB A;  3BQY A;  2PJP A;  4UB6 C;  3HOW J;  5BNG A;  2PG4 A;  4XON A;  3TO6 A;  3JTH A;  2X85 A;  3BZK A;  1RI7 A;  1WI9 A;  2GQQ A;  2IA0 A;  3ERM A;  2CO5 A;  3HGG A;  2HGC A;  5J8F A;  2KMU A;  1EH8 A;  3I71 A;  2XAH A;  3TP0 A;  3EYY A;  3IL2 A;  2R0Q C;  1JTX A;  2BY0 A;  3CLQ A;  4G9Y A;  4MHG A;  5CQG A;  1IUF A;  2E1M B;  5FD5 A;  1S3J A;  2QZ8 A;  2JK3 A;  1VQP I;  5TJJ A;  4G6Q A;  2E5Z A;  2JA2 A;  2KZG A;  3RQ4 A;  4W97 A;  3NAR A;  5ED4 A;  3ZMZ A;  2P81 A;  1JKR C;  3S3N A;  1OPC A;  1XSV A;  2TRT A;  3E6D A;  4V2G A;  1TBX A;  5BPI A;  1PDN C;  4KA4 A;  2IGO A;  2IXS A;  2V6C A;  1B72 B;  1V55 H;  3J81 Z;  5HOO A;  3M8J A;  3GTG J;  4M6X A;  2G7H A;  1HCR A;  4BJ5 C;  4B43 A;  1S7O A;  1RIO H;  4LB6 B;  5HDK A;  4RA2 A;  5IP9 J;  1FSH A;  1YE9 A;  4MGR A;  2RV8 A;  2JA6 J;  3KP7 A;  5B66 C;  1FIP A;  1G2H A;  1ETW A;  2DXI A;  3N05 A;  3QPL A;  4B3X A;  1UHM A;  1YS6 A;  1ZYR F;  1MNM C;  1GUU A;  2R7D A;  2XAG A;  1QHG A;  4JX4 A;  3U1K A;  3PO3 J;  1LE8 B;  4FTH A;  3MAJ A;  4Y7N J;  1SD7 A;  3N4M A;  4RBO A;  4XKB A;  1FX7 A;  4I09 A;  3OYH A;  3H5N A;  5DM6 F;  2BGC A;  1T98 A;  2A6T A;  1Y56 A;  5LEK A;  3HGY A;  3CCS I;  1R22 A;  3H3V K;  5J47 A;  1P4W A;  3JRC A;  1MSE C;  1I3Q J;  2QM3 A;  3QPS A;  4HW0 A;  3GTO J;  1TWF J;  2EJR A;  1YW9 A;  1A35 A;  1SD4 A;  2KKO A;  4UB8 C;  1V54 H;  3P9K A;  1IG7 A;  4EM0 B;  3L2R A;  1FP1 D;  3WU1 B;  1D8J A;  3DBL B;  2CW0 F;  3PUF A;  1A5J A;  3ZQC A;  3IC7 A;  1QZZ A;  2K85 A;  4M9X A;  5M5X J;  2NVT J;  3F8C A;  5KHD A;  2F5C A;  1BJA A;  4DYC A;  4OWR B;  4E7K A;  1GXQ A;  2R5Z B;  3IKT A;  1WJE A;  1B9M A;  4UUV A;  3CCU I;  3I4M J;  3MVP A;  4U0W A;  3BR5 A;  2A05 A;  2KFD A;  4LFU A;  3LA3 A;  3LQQ A;  4QWQ A;  4XBF A;  2FMY A;  3O8G A;  1LQ1 A;  3GFM A;  3KIO A;  2FRH A;  2KZV A;  3BP8 A;  2Y2Z A;  2BE5 F;  3V42 A;  1LEA A;  3EET A;  4XLC A;  4C2U A;  3U1D A;  2X9D A;  3AFH A;  3FXK A;  1MH3 A;  4CCN A;  4E70 A;  3H5A A;  1LB2 A;  2L02 A;  4KIT B;  1XPX A;  5E1W A;  2RGV A;  4V2F A;  2DFH A;  3TP3 A;  1X3U A;  3FIS A;  1R1T A;  3HOU J;  2XIG A;  2FNA A;  3VOE A;  5E3M A;  3G4S I;  1A04 A;  1FYM A;  1VF9 A;  3OOU A;  3LSR A;  2JN6 A;  4LOC A;  4CDG A;  3MMY B;  4HLX A;  3RI4 A;  2EBI A;  1XB4 A;  1IXR C;  1CF7 A;  4LD5 A;  4XQF A;  4L9V A;  5HLG A;  4ZZD A;  4HBL A;  2JPC A;  1HLV A;  2EV0 A;  1UST A;  2DMU A;  4HQM A;  3WTY C;  3D1N I;  1ZTR A;  2Z5U A;  2IGK A;  2JSP A;  3BC8 A;  3FX3 A;  3MN2 A;  3VYU B;  1Y0U A;  2D1H A;  2ISY A;  1F4K A;  4PJM A;  4XN3 A;  3V4G A;  1QPI A;  2P4W A;  2O7O A;  4Y3O A;  5A2Q Z;  2Z16 A;  3DKX A;  2WAF A;  3FF5 A;  1ACI A;  3OIO A;  3UR3 C;  3S1M J;  2MD0 A;  1P6R A;  3GUD A;  5CQE A;  4HAM A;  3TED A;  3GO5 A;  3UKG A;  3O8H A;  3KZY A;  4CHU A;  1VQO I;  3CCR I;  5L3G A;  5J3L A;  5FKM A;  2Y0S A;  2DT7 B;  2L7Z A;  2MFZ A;  1EH7 A;  3QU3 A;  4IHS A;  2V4J C;  1HDD C;  1JTY A;  1QHH D;  2DBB A;  3I5U A;  2ZXI A;  2VJI A;  2G7U A;  3HZJ A;  3MKL A;  1WQ2 A;  2QVO A;  3KP5 A;  1HKQ A;  3KEO A;  4A3F J;  4ZYE A;  4XRF A;  2VIX A;  2X6X A;  1KQ0 A;  2H09 A;  4CH7 A;  4A3I J;  1IW7 F;  2IAI A;  4IRI A;  2CS3 A;  1R49 A;  2NOG A;  5IP7 J;  4KT5 C;  4UVA A;  1HSJ A;  1DDN A;  4L5J A;  1SD5 A;  4XSZ F;  2H94 A;  4QIW N;  3KPH A;  1AKH A;  3SJM A;  3MWM A;  5CYV A;  1T56 A;  3JW4 A;  4OOI A;  1S8N A;  3A0B C;  3ONQ A;  2CV1 A;  1G6N A;  1APL C;  1YHQ I;  2RQQ A;  4G6T B;  1R1V A;  2RKH A;  2XV4 S;  2BEO A;  4XN0 A;  4H0E A;  3K10 A;  5FKN A;  1RET A;  5IT9 Z;  1F9N A;  4BY7 J;  4I76 A;  2OF7 A;  3REO A;  1X1P A;  4DBQ A;  2Q2E A;  3DCF A;  2ETH A;  3S15 J;  2EPF A;  3I58 A;  3GVA A;  2FBH A;  4ZC3 A;  1K83 J;  4WK8 F;  2CRG A;  2BY3 A;  1JUS A;  1SAN A;  1N75 A;  3GFI A;  2OC6 A;  3MKW B;  3QYE A;  3I59 B;  2LTP A;  4L0Y B;  2YS9 A;  1KYW A;  1HBX G;  2LY1 A;  3W3C A;  3C2H A;  4IX7 A;  2R3S A;  4AIH A;  3L00 A;  2R5Y B;  1PYV A;  3H9Q A;  3I54 A;  2R7O A;  3C1D A;  4NDL A;  3K2Z A;  3IH2 A;  4FIS A;  4M72 A;  2MLK A;  2GZW A;  3MZ8 A;  1R6R A;  2LYC A;  3JAM K;  3CC2 I;  4MFE A;  1P9Q C;  4KFC A;  5CLS A;  1YJ9 I;  3ASN H;  1S72 I;  1P4A A;  2L9R A;  2K86 A;  4HYE A;  4PJL A;  3WOD F;  4E7H A;  1KON A;  1BC8 C;  5DD4 A;  2EV6 A;  1YX3 A;  3EPZ A;  3P5J A;  5EDN A;  3H35 A;  3OYC A;  2MBF A;  1B4A A;  1MMD A;  2NS8 A;  3CDI A;  1PP7 U;  2E35 A;  3WTW C;  1SMY F;  2DQL A;  1TNS A;  5D5W B;  2VBW A;  2HS5 A;  4AM3 A;  1Z21 A;  2FEZ A;  1I1S A;  4CCM A;  4P96 A;  3RJP A;  3QOD A;  2QEN A;  2HYF A;  3FXO A;  5JHU A;  1XN7 A;  5TIS C;  1NG7 A;  4QTR A;  5E20 A;  4C2M J;  3L2U A;  2RAE A;  1ETO A;  3FBI B;  3TL4 X;  2H8W A;  1IO2 A;  2ZME B;  4XOP A;  3KZZ A;  3DEW A;  1BL0 A;  1O57 A;  2A5Y B;  2FML A;  1H88 C;  5LHI A;  4C2T A;  1JJ6 C;  3V7C A;  1JE8 A;  2MW8 A;  1MGT A;  4YFX F;  5ICG A;  1LVK A;  4ZYH A;  3G3Z A;  2KRC A;  1G59 A;  2HWV A;  3I3L A;  4HV6 A;  3ABK H;  3KP2 A;  4XLF A;  2DA5 A;  1V5F A;  4OAZ A;  4D5F A;  1ETY A;  3PL8 A;  4HX8 A;  4I6Z A;  3ECO A;  1JHF A;  1K79 A;  1HKT A;  3SHF A;  1IJW C;  2OQG A;  2VUM J;  3SZT A; 
#chains in the Genus database with same CATH homology
 3WHB A;  5IP6 A;  3LSG A;  2HOS A;  4XRM A;  2EH3 A;  3G1M A;  3JRB A;  1H89 C;  5JLW A;  3TW7 A;  5EG0 B;  1B8I B;  2DA7 A;  1TWC J;  2CQQ A;  4MFD A;  2IEK A;  2LR8 A;  5K7Z A;  2LD5 A;  1LFB A;  3S17 J;  1IRZ A;  3WHC A;  3B6A A;  4M3E A;  4CYC A;  2NVQ J;  3K2A A;  2NVY J;  3JRA A;  1ZK8 A;  2XB5 A;  5M3F J;  1VI0 A;  2FJ1 A;  2HOA A;  1JGG A;  2K40 A;  5C4J J;  1Y1V J;  4ABZ A;  3BTL A;  4CYC B;  2WAQ N;  5FKK A;  2E1O A;  3JRH A;  2XGC A;  5EYR A;  1OJL A;  3OSG A;  4FE4 A;  9ANT A;  4IHV A;  1X2M A;  4S0H B;  4QSH A;  1FTT A;  5C3E J;  5IYD J;  4A3C J;  1WPK A;  1IC8 A;  4JX6 A;  1TWH J;  4DW6 A;  5K7F A;  2GLO A;  2O8K A;  3FK7 A;  1ZR2 A;  2JMW A;  2YU9 J;  1I6H J;  1EF4 A;  2L7F P;  3K7A J;  2GBY A;  1BJZ A;  1P7I A;  2K9S A;  1E3O C;  2JA5 J;  3BR2 A;  2H8R A;  1WI3 A;  4A3D J;  2R93 J;  2EZL A;  5J1Y A;  3RKQ A;  3M3Y J;  5DTD A;  1ZQ3 P;  3CDL A;  5F08 A;  1XG1 A;  1R9T J;  1U9N A;  1QRY A;  4A3G J;  2COB A;  2MGQ A;  2DMN A;  3ZOB A;  5FLM J;  2Y0S N;  2LP0 A;  2KDZ A;  1RKT A;  1PUF A;  4JP0 A;  1Q1V A;  4C3H J;  1DU6 A;  2DA1 A;  2VKV A;  4RDU A;  1MBE A;  4BY1 J;  2E2J J;  3FK6 A;  2ID6 A;  1PUF B;  2X6O A;  2ECC A;  5F1J A;  1WH5 A;  1NK2 P;  2ME6 A;  4HNV A;  1NK3 P;  3BR0 A;  2WB1 N;  4MO7 A;  1IDZ A;  1TWA J;  4B1R A;  1RES A;  2HYJ A;  1DU0 A;  2YUS A;  3TW6 A;  4JYK A;  1AU7 A;  4Y52 J;  3BG5 A;  4UUS A;  2GM4 A;  1GV2 A;  2XPV A;  3G1L A;  2HXO A;  4IHW A;  4EEF G;  5C4X J;  2HQ5 A;  5FKL A;  1ITY A;  1T33 A;  2L0K A;  5FKO A;  4UUS B;  3JRE A;  3Q0W A;  5F27 A;  2CJJ A;  4XRS A;  3GTQ J;  2Y31 A;  5DS9 A;  5EGO A;  3A03 A;  1YRN A;  4AYB N;  3JR9 A;  1WGX A;  3G1O A;  2LKX A;  3S2H J;  5IYB J;  4JX5 A;  2Y9Y A;  2VPR A;  1HDP A;  4X6A J;  1POG A;  1VND A;  1MBG A;  3PO2 J;  1B8I A;  3BQY A;  3ZQI A;  4M3D A;  3HOW J;  1OFC X;  2TCT A;  5BNG A;  2JA7 J;  4A93 J;  5EGO B;  1YRN B;  1ZR4 A;  4M3F A;  1AHD P;  3L1P A;  5FLV A;  2CQX A;  1JUM A;  5K7H A;  3HOY J;  4C3I J;  3FKI J;  3HGG A;  2DMT A;  3TP0 A;  2H1K A;  2M0C A;  2R0Q C;  1JTX A;  1IUF A;  1NTC A;  4A3K J;  1OCT C;  3BTC A;  3GTK J;  3ZQG A;  4M6V A;  3GTM J;  2VKE A;  2JK3 A;  5M5W J;  1B72 A;  2ME0 A;  4AUX A;  5M5Y J;  3GBG A;  3NAU A;  5E3N A;  3S1Q J;  2ECB A;  2M8G X;  4W97 A;  3NAR A;  1Z77 A;  3ZQH A;  2P81 A;  1X58 A;  3B6C A;  2K9Q A;  1JKR C;  2TRT A;  2MG4 A;  4V2G A;  1VFC A;  1JKO C;  2XRL A;  2AO9 A;  1B72 B;  4J19 A;  5EEA A;  2G0E A;  1FEX A;  3GTP J;  2IBD A;  2LFB A;  3GTG J;  4BBS J;  3Q3S A;  1HCR A;  4XIC A;  4IHX A;  3HB9 A;  1GT0 C;  2DN0 A;  5IP9 J;  1GDT A;  1LE8 A;  4M3B A;  2X48 A;  1ZKG A;  1U9O A;  2JA6 J;  2CUF A;  1S7E A;  1FIP A;  1G2H A;  1ETW A;  2HXI A;  2ELK A;  3BQZ A;  3QPL A;  2EZH A;  2CUE A;  2DTZ A;  1MNM C;  1WCM J;  1GUU A;  4DYR A;  3SFI A;  3E7L A;  4JX4 A;  3CQZ J;  3QQA A;  1JKQ C;  1LE8 B;  3PO3 J;  4FTH A;  1H8A C;  4Y7N J;  1BW6 A;  4RBO A;  3HKZ N;  3CCY A;  2XGD A;  1MBF A;  3H3V K;  3HGY A;  1MBJ A;  3JRC A;  1I50 J;  1BA5 A;  1WH7 A;  1MSE C;  3VPR A;  1I3Q J;  2DMQ A;  1ETK A;  3QPS A;  4C3J J;  2L7M P;  5F0F A;  3GTO J;  1TWF J;  2LVS A;  2XSD C;  1IG7 A;  4DZJ A;  1Z0X A;  2R5Z A;  4A3M J;  1UMQ A;  1F43 A;  1BW5 A;  1A5J A;  3ZQC A;  2Y9Z A;  2NVT J;  5M5X J;  1FTZ A;  1RKW A;  1U8B A;  2E2I J;  4DYC A;  3S1N J;  2R5Z B;  4D7N A;  2DA6 A;  3IV5 A;  1QVU A;  2N8G A;  3A01 A;  3LOC A;  3I4M J;  3MVP A;  1P7J A;  1SFO J;  1D5Y A;  3Q0U A;  3BR5 A;  3RZO J;  1JT6 A;  1LFU P;  2E19 A;  1Y1W J;  1GVD A;  3O8G A;  4L5E A;  3I4N J;  4XRS G;  1HF0 A;  1TWG J;  3A01 B;  2Y2Z A;  3HM5 A;  1IV6 A;  3BR6 A;  3PM1 A;  2X9D A;  1MH3 A;  3H0G J;  5J1U A;  3C2B A;  2E2H J;  4V2F A;  3TP3 A;  2R7Z J;  1MH4 A;  3FIS A;  2QF7 A;  3HOU J;  1FIA A;  4XK4 A;  5E3M A;  1VF9 A;  3OOU A;  3LSR A;  1K61 A;  2JN6 A;  4LOC A;  2HI3 A;  5JLX A;  2W48 A;  4DYQ A;  3GTL J;  2EBI A;  1ORK A;  1TC3 C;  1IDY A;  1ENH A;  2VI6 A;  2XGE A;  1JKP C;  2LY9 A;  1HLV A;  3F0C A;  3D1N I;  2DMU A;  3LSP A;  1ZTR A;  3MN2 A;  4FCY A;  5E3L A;  2LK2 A;  1ZGW A;  1QPI A;  3BG9 A;  2O7O A;  3RQI A;  1IGN A;  1MBK A;  4IEJ A;  3ZQF A;  2HOT A;  3HBL A;  2QCO A;  1MBH A;  2HDD A;  1UHS A;  3OIO A;  2PMZ N;  2NS7 A;  3S1M J;  5IOY A;  1W0U A;  2M2E A;  3TED A;  2XPW A;  3JRI A;  3O8H A;  3UKG A;  1UG2 A;  1RPW A;  3HOX J;  4X1E A;  3CMY A;  5J3L A;  5FKM A;  2L7Z A;  4G12 A;  1HDD C;  3HEF A;  1JTY A;  2FD5 A;  4UUT A;  3HDD A;  4W1U A;  2M34 A;  3MKL A;  3M4O J;  5IYC J;  5M3M J;  4A3F J;  2Y30 A;  4IHY A;  2EZK A;  2ZB9 A;  5EF6 A;  4XID A;  4A3I J;  2IAI A;  4MLO A;  2B63 J;  2NOG A;  5IP7 J;  1HOM A;  5IOZ A;  3LSJ A;  4QIW N;  5F0H A;  1AKH A;  5F04 A;  3SJM A;  1T56 A;  3RZD J;  3S2D J;  4DZP A;  1GV5 A;  3BG3 A;  1APL C;  1XC5 A;  2NVX J;  1OCP A;  5FJ8 J;  3LNQ A;  3JRG A;  5FKN A;  3GTJ J;  1AKH B;  1RET A;  4A3L J;  2DMP A;  2K9N A;  2JJ7 A;  4BY7 J;  4I76 A;  2OF7 A;  3HOZ J;  4D7M A;  4FE7 A;  3DCF A;  3S15 J;  5HOD A;  4D5C A;  1F36 A;  2R92 J;  2R5Y A;  3JRF A;  1K83 J;  2DJN A;  1JT0 A;  4A3B J;  2CRG A;  1JUS A;  1SAN A;  2DA3 A;  1FJL A;  1U78 A;  2LTP A;  2D5V A;  2YS9 A;  2AHQ A;  4B3A A;  3BR3 A;  4M3G A;  1QVT A;  2KT0 A;  5EZG A;  5F0C A;  2R5Y B;  4NDL A;  5IPA A;  4A3J J;  3W6V A;  2JA8 J;  2WV1 A;  3IH2 A;  4FIS A;  3HOV J;  4MFE A;  4MIM A;  2XPU A;  3S14 J;  2L9R A;  2M9H A;  1RR7 A;  4A69 C;  2EQR A;  3BTI A;  3BTJ A;  5EDN A;  4BKX A;  3SDG A;  2NS8 A;  5GPA A;  1ETQ A;  1X2N A;  2FQ4 A;  2ID3 A;  2CU7 A;  2O9L A;  5EZH A;  2FX0 A;  3Q0V A;  5GPC A;  3JRD A;  2LLK A;  3BR1 A;  3OSF A;  3ZQL A;  4QTR A;  3A02 A;  4C2M J;  2DA4 A;  2RAE A;  1ETO A;  5C44 J;  2OPT A;  3DEW A;  4AC0 A;  3IH4 A;  1BL0 A;  2XB0 X;  2DA2 A;  1H88 C;  1ETX A;  1JJ6 C;  4GFB A;  1JJ8 C;  1XS9 A;  2MW8 A;  3FIW A;  1ETV A;  1MSF C;  5E3O A;  3BT9 A;  2JWT A;  2I10 A;  4BBR J;  2DA5 A;  1W0T A;  1A6I A;  2MSY A;  4D5F A;  4B4C A;  4BXX J;  5GP9 A;  1JUP A;  5J1R A;  4A3E J;  1ETY A;  1CQT A;  3S16 J;  1O4X A;  4I6Z A;  5EG0 A;  3S1R J;  3IH3 A;  2EZI A;  1IJW C;  2VUM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...