2DN0A

Solution structure of the second homeobox domain of human zinc fingers and homeoboxes protein 3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
GSSGSSGASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 3
publication title Solution structure of the second homeobox domain of human zinc fingers and homeoboxes protein 3
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dn0A00
3BTIA 1T33A 4DYCA 2M8GX 2LR8A 5FKKA 4EEFG 3NAUA 3TP0A 5HODA 4FE7A 3H3VK 4QTRA 2DMQA 3TW7A 2B63J 1BW5A 1QVUA 1OCTC 1TC3C 1WH5A 5C44J 2DA2A 2Y9YA 1X2MA 3SFIA 3UKGA 3QQAA 3PO3J 2CUFA 2VI6A 1ETVA 5FKOA 1LE8A 2EBIA 3HGGA 3HDDA 5K7FA 3S1QJ 1IGNA 1MSEC 2VKVA 3DEWA 2R93J 3BTJA 2MW8A 4IHYA 3TEDA 1FIPA 2XGCA 1X2NA 5BNGA 4D7MA 2E2HJ 2O7OA 2DMTA 3FKIJ 4G12A 4I6ZA 3S2HJ 1MH4A 1AHDP 1BW6A 1ITYA 1JKRC 1ZTRA 4ABZA 1RKWA 2DTZA 1E3OC 5EGOB 3JRGA 1AKHA 1TWHJ 2H1KA 2DA1A 3F0CA 2CQXA 3G1OA 2KDZA 1X58A 2NVQJ 3PO2J 3LSGA 2JN6A 3HOVJ 4LOCA 1Z77A 1IJWC 1P7JA 3RZDJ 2HXIA 4AUXA 1JKPC 1WI3A 3CQZJ 1IDZA 3HBLA 2EZHA 1Y1VJ 4XIDA 4HNVA 1GDTA 1MSFC 5F27A 3JREA 4X6AJ 1YRNA 4A3KJ 2O9LA 5IYCJ 1IUFA 5EDNA 1MBKA 1JTYA 2E2IJ 5EF6A 5F0HA 4X1EA 4FE4A 1NTCA 2K9SA 3K7AJ 5EZGA 1U8BA 5IYDJ 1UG2A 2K9NA 4MFEA 2NS8A 4AC0A 3LOCA 1JT6A 4JX4A 1ETQA 2P81A 3BQYA 5EG0B 1I3QJ 1GT0C 3IV5A 3I4MJ 4W97A 4NDLA 3LNQA 2NOGA 3WHBA 4DW6A 4UUTA 3S15J 1W0TA 1RESA 2K9QA 2K40A 2L9RA 2MGQA 2Y2ZA 4GFBA 2ECCA 3HB9A 1D5YA 2ZB9A 1U9NA 5FLMJ 4C2MJ 5M3MJ 2HYJA 4FCYA 1Q1VA 4BKXA 3O8HA 3CMYA 4S0HB 5IP9J 2H8RA 2L0KA 3A01B 2ECBA 4IEJA 3HEFA 4UUSA 3BR1A 3HKZN 2ELKA 4RBOA 1WPKA 1A5JA 5EEAA 5C3EJ 5EZHA 2LK2A 2Y9ZA 5F0FA 4J19A 1I50J 4JP0A 4M3GA 1WCMJ 1ETOA 3HOWJ 2LD5A 2DA3A 1I6HJ 1S7EA 4A3GJ 3E7LA 5C4XJ 2R5YB 1SANA 3PM1A 3RQIA 2QCOA 4W1UA 1SFOJ 1H88C 3B6AA 3M3YJ 1T56A 2G0EA 1RPWA 3LSRA 1B8IB 4MO7A 4V2FA 1UHSA 4IHVA 2JJ7A 2M9HA 1EF4A 3GTLJ 3G1MA 2GM4A 3OSFA 4IHWA 4A3BJ 2HQ5A 1IG7A 4JYKA 1XG1A 5E3MA 1DU0A 1FTZA 4DZPA 3JRAA 2NVTJ 4A3EJ 2XPUA 2IAIA 5GP9A 3HGYA 2R0QC 3HM5A 5M5XJ 2EZLA 1ZR4A 3BR0A 5E3NA 4A3LJ 1ORKA 3FISA 2VPRA 3A01A 3A03A 3SJMA 2L7FP 2EH3A 3QPSA 2R92J 3BTCA 2L7MP 3IH2A 3RZOJ 3CDLA 2Y30A 4Y52J 5M5WJ 4B4CA 1PUFB 2JMWA 1ETKA 2JWTA 2M2EA 2XRLA 3JRFA 1GUUA 3S17J 3BTLA 4A69C 4C3HJ 4DYRA 5FKLA 3QPLA 5J1YA 2NVXJ 1RKTA 2TRTA 1ZQ3P 2LKXA 2N8GA 3TP3A 4A3IJ 1JKQC 5M5YJ 2LVSA 2W48A 3Q0WA 3GTJJ 1MBEA 4CYCB 3A02A 2YU9J 2NVYJ 2LTPA 3ZQLA 2OPTA 2AO9A 4A93J 2YS9A 3JRHA 5J1UA 2HOTA 1H89C 1MH3A 1GV2A 1U9OA 3BR5A 4MFDA 5F1JA 5IOYA 4BXXJ 1F43A 1MNMC 1Z0XA 1FEXA 2WV1A 3BG5A 1QPIA 1ZK8A 1JTXA 3TW6A 4BY7J 4JX6A 2E19A 4Y7NJ 2HOSA 3S16J 2IBDA 4D5FA 1K83J 3MN2A 2XSDC 5GPCA 1JJ6C 5JLWA 5FLVA 3MVPA 1ZKGA 3HOUJ 3Q3SA 3FK7A 4XRSG 4IHXA 3Q0UA 3ZQGA 1H8AC 3RKQA 1IC8A 1FJLA 2TCTA 1HOMA 3JRBA 5EGOA 5E3OA 1OFCX 2R5ZB 5J3LA 1QVTA 1G2HA 3G1LA 4M3FA 4A3JJ 3GTMJ 1BL0A 3D1NI 1ZGWA 2CU7A 1XS9A 2AHQA 1RR7A 2OF7A 2JA5J 2X9DA 4I76A 1GV5A 1OJLA 3GTOJ 3W6VA 1JT0A 2XPWA 1TWAJ 4V2GA 2X48A 1NK2P 5J1RA 1VFCA 3K2AA 2FQ4A 2Y31A 4AYBN 5IP7J 1LE8B 2XGEA 4A3MJ 1XC5A 2O8KA 3GTGJ 2R7ZJ 5EG0A 2LLKA 4MIMA 1JJ8C 1JUMA 2QF7A 4M3EA 5F08A 3LSPA 3M4OJ 2ID6A 1HF0A 5DTDA 2LFBA 5EYRA 1ETYA 3GTQJ 2DA4A 1HLVA 3S1MJ 2LY9A 3JRCA 2GBYA 2R5ZA 3VPRA 1IDYA 3ZQIA 2VUMJ 1MBGA 4A3CJ 1AKHB 1ENHA 2RAEA 4C3JJ 1WH7A 1ZR2A 2DMPA 3OIOA 1FIAA 3HOYJ 4BBRJ 2HDDA 3HOZJ 4MLOA 2KT0A 1U78A 4M3BA 2DMUA 2GLOA 4QIWN 2L7ZA 1LFUP 1UMQA 2FD5A 1JGGA 1TWCJ 2WB1N 5FKMA 3S1RJ 3H0GJ 1APLC 1YRNB 5E3LA 4DYQA 5IP6A 1RETA 2DN0A 2ID3A 2EZIA 3ZOBA 1AU7A 4M3DA 2HXOA 3O8GA 3DCFA 1JUSA 5FKNA 4XICA 2YUSA 2NS7A 1HDPA 2CRGA 2IEKA 3BR3A 2WAQN 3LSJA 4QSHA 5C4JJ 5IOZA 1P7IA 5K7HA 2R5YA 1HDDC 2CUEA 4A3DJ 4DZJA 1TWFJ 1VI0A 4L5EA 3BR6A 1ETWA 4B1RA 3HOXJ 1O4XA 3MKLA 2JA8J 4M6VA 2M0CA 3S1NJ 1B8IA 3S2DJ 3ZQCA 2MSYA 2JA7J 3I4NJ 4FISA 2PMZN 3GTPJ 4XK4A 2LP0A 1TWGJ 5F04A 5GPAA 1GVDA 2MG4A 3CCYA 1R9TJ 1F36A 4XRSA 4B3AA 1B72B 2DMNA 3BQZA 3OSGA 3ZQFA 3Q0VA 3GBGA 1HCRA 2CQQA 2DA6A 5F0CA 4RDUA 1WGXA 2XB0X 4UUSB 1IV6A 4BBSJ 1PUFA 1POGA 1JUPA 1VF9A 2DA7A 3OOUA 3B6CA 2XPVA 3JRDA 1LFBA 9ANTA 1K61A 2I10A 1JKOC 3IH4A 4C3IJ 5IYBJ 2XB5A 3BG3A 2E2JJ 1OCPA 2ME0A 1DU6A 3S14J 3FK6A 4CYCA 3JR9A 1CQTA 2DJNA 1Y1WJ 2HI3A 1ETXA 2FJ1A 1A6IA 1MBHA 1QRYA 3BR2A 3WHCA 3JRIA 1MBFA 1W0UA 2D5VA 3FIWA 3C2BA 4D5CA 2JA6J 2FX0A 4BY1J 3L1PA 1VNDA 2XGDA 3BG9A 2EQRA 1IRZA 3SDGA 2CJJA 2DA5A 1B72A 4XRMA 4A3FJ 2COBA 2E1OA 1MBJA 3IH3A 5JLXA 2JK3A 2VKEA 1NK3P 2X6OA 5DS9A 2HOAA 5IPAA 2EZKA 3GTKJ 3ZQHA 2Y0SN 5K7ZA 1FTTA 2ME6A 3BT9A 5FJ8J 1BJZA 2M34A 4FTHA 4JX5A 4D7NA 5M3FJ 3NARA 1BA5A
chains in the Genus database with same CATH superfamily
1T95A 3JSPA 1T33A 4ANJA 4DYCA 4E7SA 1V55H 2LR8A 4Q4ZF 3SZGA 2E36A 4L0ZB 3GWZA 1V5EA 4N9HA 4DGWB 1T2KA 2PMUA 3FF5A 4IJAA 3KYLA 1Z7LA 1D1CA 3RJPA 3RPQA 3ISPA 1G3WA 3TW7A 1G3SA 2NXNB 2EV5A 2M0MA 5CJ9A 5K5RA 2LY1A 2VT2A 3W2VA 3PO3J 3IRQA 1IN8A 3ERMA 2VN2A 2R3SA 4EJVA 1FP2A 1UJ8A 2UUZA 1BBYA 3HGGA 3JAMK 5K7FA 3S1QJ 5HOOA 3WGGA 4WCGA 1IGNA 3DEWA 2MC3A 5HLTA 1XX5A 4NC8A 3WE3A 4GYIA 4MQ9F 2XGCA 5L3CA 4D7MA 2VKHA 4I01A 2E2HJ 4IRIA 4ZTJA 2FNAA 2G7UA 2LMDA 4A6EA 3WODF 3K0LA 1RKWA 3DXJF 3K4LA 2A69F 4LJZF 4IRGA 3CUOA 5EGOB 1AKHA 4MQVA 3DKYA 2CQXA 2K4BA 2VQGA 3G1OA 3CCMI 2Z9OA 4HDVA 2R7XA 3GF2A 4LD5A 3ZMSA 2JN6A 3CCRI 2VXZA 4ZTFA 4Q48A 1WI3A 2L4MA 3CQZJ 3KYDB 3K70C 1IDZA 2EZHA 1Y1VJ 1GDTA 2VE8A 1TL8A 5IYCJ 1IUFA 5LLQA 2L4AA 3K4CA 3PQKA 4HQMA 3TQNA 1S5LC 5E1ZB 2CMPA 1JHFA 4X1EA 1HKQA 5LBQA 1PDNC 1NTCA 2V6CA 1ZRFA 3PNYA 1P6RA 1X3UA 1U8BA 5FROA 1UG2A 2K9NA 3OOPA 2F4MB 3K6GA 1ETQA 2P81A 2BXZA 4I02A 4A0ZA 1P92A 1K78A 1I3QJ 1KU9A 4HF0A 5J8CA 1HW2A 2JUGA 2IVMA 2F5CA 2BEOA 2F48A 2GA1A 4OOIA 2QQ9A 3DLAA 3K1MA 4DW6A 4C30A 1W0TA 2L9RA 5JVGF 1HKSA 3FXLA 1A36A 2F5VA 1D5YA 2ZB9A 1IUYA 3F8NA 4I0AA 1VQOI 2DCEA 1YX3A 4BKXA 3KP3A 3O8HA 5GAGJ 4G6QA 3PIPF 1J0RA 2KMUA 3CUQC 1YIJI 3W2AA 4BHBA 5IP9J 2H8RA 1QGPA 4BHCA 2HPIA 2QA4I 3GZ5A 4IEJA 1YHQI 4UUSA 3HKZN 3QYEA 1R1UA 2IS4A 1WPKA 2PFBA 2KIMA 2DYSH 3KYCB 1A5JA 3ONQA 4ITVA 5LRRA 4ZH4F 4D0PA 2R7SA 2Y9ZA 5F0FA 4J19A 4PFOA 1WCMJ 2HZDA 4KN4X 2D45A 2DA3A 1I6HJ 2HYFA 2E7XA 3DEUA 5C4XJ 5DD4A 5DEQA 1SFUA 4MGRA 2QCOA 1G59A 3M07A 3F6VA 3RQ4A 3KEYA 1H88C 1B59A 1ZYRF 3B6AA 5B1AH 3J7AO 3LSRA 1B8IB 4MO7A 4IHVA 4BEHB 2JJ7A 4KT5C 3G1MA 2GM4A 4IHWA 3E5XA 4ETSA 4OMZA 4RB1A 1IG7A 2V4JC 2OCCH 3A1YA 2HKOA 3ABUA 3K1NA 2NVTJ 2ZFWA 2XPUA 2DFEA 1Z1DA 2MABA 1WSUA 1O3SA 1GVJA 4XN0A 3HRTA 3BR0A 4HF2A 2VPRA 3HG9A 3A03A 1T39A 3T0YA 4ZYGA 1W5CC 1S3JA 2EIMH 4F92B 4KISA 4FASD 3RZOJ 4CDGA 4Y52J 4AIHA 2EK5A 3PQJA 5M5WJ 4XKVA 2EIKH 4N4OB 1ZAOA 1D0ZA 2KIQA 1FPQA 2CS3A 2IGOA 2LC2A 1W4MA 4C3HJ 4I0BA 4II2A 5FKLA 1DDNA 1ZRDA 3IKVA 4UUVA 1W7PA 3ZMUA 1YOVB 2FA5A 4KMUX 5JHUA 2TRTA 2LY2A 3OYFA 1UG0A 1FOKA 3K9TA 2LVSA 3K4KA 3QP5A 1O3RA 3GZ6A 4CYCB 4KNYA 3DQVC 5KCMA 4ESFA 2E71A 4EATA 3A02A 1TQPA 1UELB 1D0YA 3OYBA 1D1AA 2LTPA 2VBZA 2OPTA 2AO9A 3HRSA 1SMTA 3BZKA 2YS9A 1U5TA 4M74A 2HR3A 4OU0A 3CP2A 4HYEA 1X1AA 1F43A 5CPRB 4IXAA 4KIGA 3DF8A 4HNUA 1FEXA 1NH3A 5EEGA 4OMYA 2H94A 2EV0A 3BG5A 4LITA 1QPIA 3TW6A 4BY7J 1EH6A 3SXYA 3IWFA 3V8LA 4Y7NJ 3OWTA 3FX3A 3HKZA 1K83J 2W82A 1XDSA 2HGCA 3AG3H 2KZVA 3AG1H 5JLWA 3LQQA 4HEA2 3Q3SA 4HRIA 2Q2EB 2EB7A 3RPUA 3RKQA 1Z6RA 1Z21A 1IC8A 5H6RA 2C6YA 4B3XA 1HSTA 4ASNA 3D5SC 2A5WA 4OIQF 1QPMA 2IA0A 2O3FA 3R60A 4U0VA 1S72I 3CESA 1QVTA 1G3TA 2PBIA 3G1LA 3KE2A 2DFHA 1FOXA 3KETA 1K6OA 2V9KA 2ZNYA 3NEUA 3WU0A 1OYIA 2STWA 2HOEA 2MC4A 4A0XA 3A0BC 2OF7A 2JA5J 2JPBA 2E34A 3RIRA 1HQCA 4RA2A 3ELKA 2OD5A 1WJCA 3W6VA 2E1NA 2EFWA 1TWAJ 4KIFA 4V2GA 4L9NA 3GX4X 5L3FA 1VFCA 1YW8A 3K2AA 2FQ4A 3AG2H 3U1KA 3HXLA 1OYWA 1WHUA 2I8DA 5F1RA 5FB2A 1LE8B 2IS1A 2XGEA 4A12A 4NB5A 2W85A 2F4IA 3I54A 2P8TA 3BLYA 4IOCF 3A0HC 3V8KA 2J5OA 2X85A 2R7RA 4G7HF 2GXBA 4P1WA 5F08A 3QOEA 1WVRA 1X4OA 3VEPA 2NAZA 5AIPA 3FBIB 3CCEI 1DP3A 4PJMA 2WADA 1HLVA 1P9QC 3JTGA 1KYWA 3JRCA 2YPRA 1LKXA 4MNUA 3F6OA 2VUMJ 1VQ6I 1VQNI 4P55A 2DODA 2D1HA 1ODDA 4C3JJ 4HSTA 5IY5H 3QODA 2H6CA 3IAS2 4ZYDA 1FIAA 3HOYJ 1S7OA 3OS2A 4MLOA 1GXPA 3WGIA 1LEBA 3LSTA 2M3AA 4CZCA 3K4BA 1UHMA 2DMUA 2P5KA 3QYFA 2PJPA 1SVLA 1LFUP 1JGGA 1TWCJ 3HTUA 1EH7A 1ZG1A 4II3A 4B8XA 1BC8C 2Z33A 1YRNB 5CVUA 4LLNA 1R4MB 1F9NA 1XMKA 5E79C 2E35A 4GXOA 2DN0A 2EZIA 1XMAA 3BJAA 4RAFA 1IAWA 3WU1B 4M3DA 3M8JA 4N0BA 5FKNA 4XICA 2O5RA 2Z99A 2IEKA 1QHHD 3LSJA 2WAQN 4QSHA 2YSRA 3UNGC 5C4JJ 1ZH5A 1P7IA 2LYCA 3QPHA 2R5YA 2CUEA 3OIPA 1TWFJ 4B1RA 1P4WA 1Y39A 1MNEA 3H3UA 2BY0A 3MKLA 4PSXA 4M6VA 3ZMDA 1A35A 2JA8J 3R6SA 3FXOA 2DTRA 1BIBA 4XLFA 3MQ0A 4YFNF 2RV8A 2MSYA 2JA7J 1TNTA 3DV8A 3L9FA 4XSXF 3RKXA 3HC7A 3KEOA 4NC6A 2XC7A 3GTPJ 4XK4A 3HRUA 3CZ6A 5FLXK 2MG4A 2IA2A 3MKYB 3HPHA 1QZZA 1VQLI 3BJ6A 1XSXA 2QBYB 4PJLA 1Y56A 2A5YB 5LHIA 2BOLA 4NQWA 3I3LA 5F0CA 4RDUA 1ON1A 1IV6A 1KONA 2CYYA 2K4JA 2MYSA 1J75A 1JUPA 2CUJA 4AD9A 2QWWA 3BROA 1FBSA 2QYOA 4F93B 3M9AA 2M4KA 4XRFA 1CF7B 4IZZA 2ZJ2A 1JKOC 3IUOA 3BG7A 4I2OA 1R5ID 4OIOF 1G8XA 5E8IA 2XB5A 1MJ9A 4ZZLA 4AVPA 2XSJC 2DFIA 2DDBA 4C2TA 4QPOA 3HL2A 2HI3A 2UWMA 1YO5C 3EUHA 3F8CA 3M1CA 1LPQA 5HNHA 3DTIA 3RKWA 3PL8A 3CCJI 3BR2A 3WHCA 1B9NA 3S2WA 1TBXA 2RQPA 1OCRH 1T0FC 2XIGA 4ZDPA 2A3SA 4ZYAA 3K1PA 1VNDA 4R1HA 4RGSA 1G4DA 1QQIA 5KK1A 1WWXA 2GQQA 4RGUA 1LFPA 5BPIA 1YQAA 1X1BA 3DTKA 5GAEJ 1VQ9I 3I64A 4E6KG 1E0EA 3E5QA 2FOKA 2CG4A 2VKEA 3HOSA 1BOBA 2EZKA 1FTTA 2Y0SN 4GGGA 3VFZA 1V5FA 3BP8A 5FJ8J 3FXQA 2OZUA 3LAPA 2IJLA 1CGPA 5TISC 5F6FA 2QQAA 4CHUA 4K2EA 5M3FJ 1IN6A 1BA5A 1H9TA 3BTIA 5L3EA 1V4RA 4XMYA 3RCOA 3TDZC 1TZLA 4EEFG 3NAUA 3P7NA 4Z2YA 3TP0A 5HODA 4FE7A 4EV0A 4QTRA 3OV8A 5AIQA 1I1SA 2DMQA 4O3MA 3CUQA 3HSEA 3J80K 1QVUA 3ZR8X 1OCTC 1R6RA 4PK4A 3KP6A 3L09A 1D1BA 5C44J 3F9KA 1X2MA 2OJED 3HUGA 3K2ZA 5CVJA 2VI6A 2B7EA 3VDXA 2XASA 2JRTA 3HJEA 4LGWA 1XN7A 4EM1A 3E1SA 5D6FA 1QZYA 4EJUA 5ICGA 1YTYA 2XKOA 2BE5F 4UV8A 1FIPA 1FP1D 5D8KB 5BNGA 2JVGA 2HQRA 1H9GA 1DGWY 4G12A 3H36A 3S2HJ 1MH4A 1KZHA 1FY7A 1Z67A 5B3SH 1ITYA 1JKRC 3ERED 3E5UA 1ZTRA 5D4RA 5FRMA 1E3OC 4CYDA 2Z3YA 3JRGA 2CW7A 4TV7A 4UB6C 1X3ZB 2K9LA 2DA1A 3F0CA 3MD2A 1MNDA 5HNFA 2NVQJ 2KHMA 3CDIA 4KYWA 1KQ9A 2VIXA 3ECHA 3LSGA 4GYGA 1BN5A 3I53A 5DCMB 4ZYEA 1IJWC 3R4KA 4RGXA 2XF7A 2OQRA 1ONVA 1XGOA 3E6BA 1H0MA 4X6AJ 4A3KJ 2O9LA 4MEXF 4XLAA 4DOZA 3X2QH 3CC7I 2X1DA 4XKCA 4XBFA 2VODA 5GAHJ 4FE4A 1DPUA 2LG4A 3GLLA 3KP5A 1EKEA 4MFEA 4RLFA 4FHTA 3L2UA 2NS8A 1U2WA 4EM0B 3BQYA 1VQ4I 4HLXA 1R5GA 2ZNZA 3SZTA 2LF8A 2Y0SA 4MTEA 5LD2C 3IV5A 1N77A 3I4MJ 4V19K 3GLXA 4QWQA 4S04A 3LNQA 3QU3A 4BE0A 5CQEA 3WHBA 1FWZA 2A6EF 3DP7A 1USTA 4HDUA 3VYRB 2K40A 1XSVA 2CO5A 2MGQA 3F21A 4GFBA 1GHCA 2W4SA 4C2MJ 4RM2A 3QWLA 3PNTA 2JQ7A 5ERIA 2X4HA 3LSKA 3ZRGA 2Y69H 3G6EI 3FMSA 5FFZA 3ZPLA 2L0KA 3AKZA 1R22A 2HFHA 2OC6A 2FBKA 2ZJPF 2ELKA 2R4GA 1OCZH 3R61A 3KCCA 2L3DA 3IAM2 4BE1A 3CP8A 5EZHA 2LK2A 1ZLJA 3B02A 3HOTA 5L3GA 1TT5B 1FBUA 1I50J 1L3LA 4M3GA 4HOBA 4JQFA 3DBLB 1WQ2A 3HOWJ 2DK5A 3FKJA 1S7EA 3WTTC 5JHFA 3ZP5A 3E7LA 4F91B 4U88A 1GLNA 2VC1A 3H9GA 2ISZA 3W2WA 4W1UA 5JFRA 2WY8Q 4FX0A 1R5HA 2G0EA 1RPWA 3AG4H 4L5JA 4V2FA 1FLIA 3QU6A 4Y15A 3C7JA 5LRSA 5A2QZ 2QSGX 4IX7A 3BPVA 3F8BA 4A3BJ 1IW7F 2HQ5A 2V6EA 5FLXZ 2F4OB 1R7JA 3SQNA 1OISA 4Y3OA 4RB2C 2PJRB 4A3EJ 5GP9A 1RRJA 3HGYA 5J8FA 2W25A 2NVUB 1ZR4A 1WJBA 1M1EB 1WI9A 5E3NA 4KT6A 2I5UA 3TO9A 3SJMA 4A3LJ 2JTVA 3VYUB 4P9FA 2VJ4A 4BXFA 4BJ5C 1YI2I 3QPSA 1T98A 2XF6A 2L7MP 3VSLA 2M5WA 3BJOA 4AWXB 1FT9A 1PUFB 3CF5F 3FDYA 1LJ9A 5CVVA 2JWTA 2CH0A 1QNTA 4L5IA 3C1DA 2L02A 4I09A 4OIPF 4DYRA 5LEKA 1W5SA 3GXOA 4GRIA 4M6YA 4CCMA 5J1YA 1RKTA 3F8MA 1TQIA 2WBMA 1JKQC 5M5YJ 1SFEA 3ASNH 3UR3C 3Q0WA 4CICA 3GTJJ 1MBEA 3OS1A 2HTJA 2KQRA 3D5RC 4RGRA 1SMYF 4G6TB 4J01A 5IT9K 1T6SA 3JRHA 2M4GA 3IRRA 2HOTA 3VWBA 1H89C 2CW8A 1MH3A 2Y48A 4MFDA 2BVMA 2GOMA 5IOYA 3WTVC 4BXXJ 1MNMC 4HSRA 1VTNC 2H27A 1ZK8A 2BXYA 2P7VB 3BOQA 2QENA 2CUZA 3TMOA 2E19A 4P96A 4D5FA 1OMIA 2XSDC 2WV0A 5GPCA 4CCLA 1W1WE 2WAFA 5B66C 2QEXI 2DOEA 2HQNA 3DFGA 5FLVA 1ZKGA 4RB0A 3HOUJ 3SHFA 2ZC2A 2VJ5A 2Z1DA 2NRAC 1H8AC 1ZLKA 5CVIA 1RIOH 1N75A 2OBPA 3M8EA 4ZDLA 1FJLA 2TCTA 2CGPA 2RQQA 5D5XB 4XLCA 3OMYA 5EGOA 3AL0C 2V26A 1OFCX 1BR4A 2R5ZB 1QO0D 2KP6A 1W36D 4XORA 1G2HA 4DBQA 3KX2A 2X1CA 1FMVA 3BY6A 4M73A 1XS9A 1XGNA 4RB3C 2JRMA 4OAZA 3EUKL 3GW2A 3VSKA 1A31A 1NK2P 2ICWG 3CO6C 4WXDA 1TTYA 2LDUA 4AIDA 3TO7A 3NWTA 2DOAA 5E1XA 3M1EA 2R7ZJ 2K3PA 4D1QA 2LLKA 4XL9A 2WB1A 4RMNA 1DPRA 4YRVA 1Z3YA 3G2BA 4BDZA 2BYVE 2XF5A 1R36A 3TL4X 4DJAA 4B43A 3LSPA 3C2HA 3PUFA 1S8NA 4H4KC 5DTDA 1VQKI 2LFBA 2RC4A 1ETYA 2LOOA 2DA4A 3GTQJ 4KN7X 4UV9A 3CF2A 2GBYA 3HPGA 3O2PE 3VPRA 2R5ZA 4EGZA 1OCOH 3KLOA 2IGNA 3MZYA 1KGSA 5KNLA 4ZC3A 4LLLA 3NQOA 1RUNA 1WH7A 2VC0A 1ZR2A 2DMPA 1IRXA 2X1EA 2HDDA 3LA7A 1S29A 2PG4A 2R7QA 4P5OA 3ECOA 2X6YA 1XTAA 2LKSA 3ZQQA 3I58A 4QIWN 1J7KA 4I98B 4XSZF 2ZO4A 2FMLA 1JE8A 2YX4A 1HSJA 3S3MA 4BU2A 2RNJA 3RPUD 3RSNA 2H6BA 5IP6A 2QKMB 2ID3A 1WJDA 3E6MA 4JOMA 1R00A 2FOWA 2V1NA 2V9VA 3O8GA 2RDPA 2L01A 3G4SI 2CRGA 4AU7A 4PJ0C 1B4AA 3F8FA 2ZMEC 4L5EA 3F3XA 2BZTA 3HOXJ 1U6GA 4CUGA 3PFIA 3KZYA 1UFMA 3SEZA 4LG0B 3LSHA 3S1NJ 1S9HA 3QAHA 2OZ6A 1XB4A 1B8IA 4BEHA 4HPQA 2GXGA 5CKTA 1WJAA 2PMZN 5EEHA 4UHTA 3LAJA 3C3WA 2IS6A 5JVTA 2JA2A 4A5MA 3E6DA 4NUBA 1IF1A 1GVDA 5J6XA 5BMZA 4XOTA 3CCYA 1EH8A 2CV1A 2FNPA 4XRSA 4B3AA 2LREA 2DMNA 5DD8A 1FX7A 1A6QA 2ZFUA 1TW2A 1O7LA 2MA3A 3WG9A 2ZJRF 4IHSA 5JR3A 3ZQFA 3Q0VA 3TGNA 1WGXA 3K4JA 4EGYA 2HZTA 2L9VA 2CV2A 4MEYF 2A05A 3S93A 3CJQB 2KPMA 1LFBA 1Z3XA 4IOAF 1O7FA 4HX7A 1HA8A 1NHAA 4ENJA 3T1BA 2E2JJ 5E17F 4XLNF 1LDJA 3FK6A 3S14J 4CYCA 3JR9A 1R71A 5DUIA 1YJWI 1CQTA 1ZHFA 2OAZA 1OR7C 4F52A 3J81K 4RAYA 2VL8A 4YIIA 4CCJA 1I5ZA 4G94A 3KIOA 1PVEA 4N9IA 3CDHA 2EPFA 1WJ5A 2R7DA 2UXXA 3FIWA 3C2BA 4KIBA 1LVKA 3JAMZ 4E7LA 2E5ZA 3LFKA 3NWSA 4UVBA 4XOPA 4YFKF 3L1PA 1MJBA 2V9PA 3BZCA 4IHTA 2UXNA 4AM3A 4O5VA 1MW7A 1OYYA 3PNVA 4M9XA 3S32A 5AONA 5JLXA 3R0JA 5FGMA 3BCBA 4IPAA 4Q5SF 5HDNA 4RAZA 1ZRCA 1B1BA 2Q2EA 2FBHA 5HS8A 1BJAA 2XAJA 3MWMA 2FU4A 3BT9A 2XAFA 3KP2A 5CVRA 3DPLC 3HYIA 2W84A 1G6NA 4FTHA 4IKFA 2ELJA 2Q8KA 3QPTA 4BH9A 4E7JA 2LKPA 2M8GX 5L3DA 3E3VA 3DBRB 4YG2F 3J7YJ 1P4XA 3GVAA 2CQKA 2P0WA 1BR2A 3I59B 1MDMB 1I1GA 2IGMA 1F5TA 2B63J 2OA4A 3IL2A 3L2WA 2JT1A 5IT9Z 2PMZA 2X6WA 1J59A 1TC3C 1BI2A 2KIUA 5E20A 4CCOA 2XAQA 2DA2A 4U7DA 2Y9YA 3UKGA 1SAUA 2CV0A 3QQAA 4DNCA 4BS9A 4BGDA 3IWZA 1LE8A 5E8GA 3ZQ7A 3E6CC 2RVCA 1X1CA 2HDWA 3EYIA 2RGVA 4PZJA 1S7AA 2VKVA 4F55A 2FF4A 1SC7A 1WKMA 3BTJA 3VODA 4IHYA 3QOPA 3PJRA 1X2NA 4IF4A 2O7OA 1ZREA 2DMTA 1DQUA 1QBJA 3HIFA 1AHDP 2VQHA 3V7RA 3LQRA 4YEJA 2LNBA 2L9SA 5BPDA 1VQMI 3L00A 2GZWA 4Y4RA 1TWHJ 1MMAA 3TOBA 2W1OA 3TKYA 2KDZA 2UZKA 2HVRA 4EVIA 2HEOA 1T08B 1I39A 5LGNA 2FMYA 2V79A 4XNFA 3HOVJ 3FWEA 4LOCA 1Z77A 3FM3A 3RZDJ 1JKPC 3J7ZI 4GDFA 5CQGA 4KMFA 4XIDA 5F27A 2XKPA 1YRNA 5EDNA 1JTYA 2E2IJ 1AWCA 2J5PA 3F72A 1YX5A 1BC7C 5EF6A 1F4KA 2F5FA 4ENMA 3K7AJ 3OR2C 1Y8RB 1UB9A 1VQPI 1D8JA 3ASOH 5IYDJ 5FD5A 2PLYA 3LOCA 4JX4A 3AL0B 4CA0A 4EM2A 2MH9A 2RKHA 5EG0B 2FQ3A 5BS6A 1X1PA 1YW9A 2IP2A 3EETA 1XCVA 4E7ZA 2PQ8A 4UY8I 1SD4A 1TP4A 4HW0A 2WAEA 4DQ2A 4UUTA 3S15J 2K9QA 1J5YA 5DV5A 1U3EM 2Y2ZA 5ILUA 3HB9A 4L0YB 5M3MJ 3FMRA 2OCEA 1Q1VA 4IVNA 2QBYA 2RREA 4KUMA 3WTWC 3FM5A 2BY2A 3A01B 2IT0A 2DK8A 4KICA 4UVAA 2VT3A 3LSIA 2O6GE 4RBOA 3MKZA 1W36C 4B09A 1MMDA 3CLQA 1HKTA 1BOAA 3FMQA 1OKRA 1YIOA 1BR1A 2LBFB 1CF7A 1ETOA 3ROUA 5LHHA 3MZHA 4EMSA 2PI0A 4A3GJ 3GFJA 2QVOA 3I56I 1SANA 4F3QA 3CD6I 3RQIA 3H1CA 1JI8A 2XAGA 2VOOA 1LVAA 3KZZA 1SFOJ 3Q5FA 2YR2A 1P2FA 3RYPA 1T56A 3G3ZA 2XDVA 3H5AA 5KAIC 2ZXIA 3GTLJ 3H92A 3OSFA 2KRCA 5K5QA 2XRNA 4LFUA 4E7IA 3WTZA 4P9UA 1X4PA 1YW7A 4YIRX 3ABTA 2Z2SB 1FTZA 4DZPA 3JRAA 3P9CA 5F64A 2DO7A 3N97A 3DEEA 3B73A 3HM5A 4ZYHA 2BW3B 3HTSB 3L2QA 5EJCA 4OWRB 2M87A 3OS0A 3EUAA 1IV8A 1ORKA 4YFXF 3A01A 5FD6A 3CJTB 2XGXA 1U5TC 2KISA 2D2WA 2EH3A 1Z05A 4OIRF 2R92J 3IH2A 2CFOA 3CDLA 2ZMEB 1LNWA 4B4CA 4FX4A 3H9QA 4BQQA 1ETKA 2M2EA 2VBWA 3S17J 4BJ6C 4A69C 2OUMA 4CCKA 3OR1C 3LL7A 2QSFX 2L54A 2DQRA 1RC9A 5D6EA 4E4HA 2DYRH 2NVXJ 1ZQ3P 2N8GA 3J81Z 2FBIA 2W48A 2DLLA 3JCUC 3CCSI 4XLPF 3Q9SA 3ESWB 3DBHB 2YU9J 2DFFA 2NVYJ 1FYMA 2KLOA 1D3YA 4YIFA 3NRVA 4NNJA 2DPUA 1FSHA 2MLKA 2W57A 3ZMZA 2E60A 3BR5A 1Y0NA 3FXJA 3WTXC 1Z0XA 3SEQA 2WV1A 3IP4B 4Z6YA 2BBYA 3RTRA 1T38A 2VB6A 4O6JA 1N25A 4JX6A 1IN5A 5HS7A 3W3CA 2HOSA 4ESJA 1ERDA 3EQLF 4U87A 4KA4A 3MN2A 2KL4A 5ICCA 2AXLA 2ISYA 4LG3A 2XHKA 1JJ6C 4M9SA 4ON0A 4XRSG 4IHXA 2KFDA 3Q0UA 3V8JA 3ZQGA 3ZMVA 4RLQA 3FHNA 1I27A 1R4NB 2M8EA 2IXSA 2W00A 1HOMA 3U21A 3T5XA 5HDGA 2K27A 5J3LA 3Q9VA 2E7WA 1B6AA 4E7KA 3GYHX 1TLHB 4A6DA 3HHGA 5HLHA 3AFHA 5H2FC 1BL0A 2Z16A 5DCMA 3D1NI 2CU7A 3RDIA 1SD7A 2AHQA 1RR7A 3ABKH 4BJTA 2X9DA 4FT8A 3FXMA 2V7FA 1PP8F 2WWYA 4PJNA 4DIQA 2L5QA 4HV5A 1XDUA 2FSWA 3OL3A 4M9ZA 3N05A 4GCVA 4NBQA 1SAXA 5J1RA 3JW4A 2Y31A 1FC3A 2KKOA 5FFXA 4AYBN 3ULQB 2WC2A 5IP7J 2DU9A 2G7HA 1AOYA 4QPQA 3T8TA 1MZBA 3P5JA 1YE9A 1E3HA 3GEZA 4FQGA 4BYYA 4A3MJ 2OU2A 2PEXA 2ACJA 2O8KA 1O3QA 1BM9A 5GADJ 1JXSA 3L2VA 4S05A 3OL4A 1JJ8C 1JUMA 4M3EA 1YITI 2IRFG 2WY7Q 1UHWA 2UV1A 2ZBKA 4Y33A 1XGMA 1P4AA 3S1MJ 1JGSA 4KJZA 3ZGKA 1WJEA 4PFPA 1FYLA 3CMEI 2HDCA 1O57A 1MBGA 3FXKA 1AKHB 2E1CA 1HW1A 4A3CJ 4HX8A 5GTHC 2VBYA 3TDUC 2DW4A 2CQ7A 5K5OA 2VBXA 3VOEA 3CMMA 4YELA 2ZSIB 1U78A 3L7WA 2GLOA 2GIZA 3KPHA 5ILSA 2L7ZA 1VQ7I 2FD5A 1ZARA 2K85A 2WB1N 4A0YA 1YYVA 2EA2A 3H0GJ 3AAFA 1C0WA 3PSFA 2ZXJA 4PDKA 2VXDA 1YG2A 2ETHA 3GFLA 1QU3A 1RETA 1I3AA 5L3BA 3I9V2 4PSWA 4PUSA 1E2XA 2NS7A 1HDPA 2M45A 3BR3A 2EILH 5IOZA 4ZDOA 5K7HA 1ZN2A 5K1YA 4A3DJ 3DU5A 4DZJA 3CJRB 3COAC 1K78B 3BR6A 1ETWA 1IXRC 1RNLA 1O4XA 5DCFA 2M30A 4L18B 4BNCA 2P6TA 3H35A 3S3NA 1WZ2A 3VB2A 2VPLA 4E7HA 4FISA 4KDPA 4LK0F 1E17A 1D8KA 3SYTA 3GUDA 2HTSA 1KQ8A 2WA0A 1TWGJ 2EFNA 1Y0UA 5F04A 5B5EC 2PJRA 4RS8A 3W6JB 1Y8QB 1TW3A 3DPUA 4WWCA 2QLZA 1AA7A 1F36A 1SVMA 2ESNA 1KU3A 3EUHC 5B1BH 1U8RA 1J9IA 2DBBA 2HNHA 3K4MA 5TJJA 3GBGA 5D4SA 1RI7A 4UUSB 3MEXA 1PUFA 1TNSA 3LA2A 1ZELA 4AYBA 4BXUA 2XUBA 3JRDA 2KRFA 3M8FA 2Y75A 9ANTA 3KP7A 5TGTA 2FXAA 4WXCA 4HBLA 2I10A 3CCQI 2LRDA 3IH4A 2A6TA 5IYBJ 3BG3A 3P9IA 3T8RA 4E70A 1OCPA 2ME0A 4OINF 3J80Z 2DJNA 1Y1WJ 3OY9A 2JVHA 2A07F 2O61A 2A68F 4OAYA 4U7BA 2E1MC 1MIJA 2VONA 4Y13A 5CLSA 1W0UA 4XLEA 1LDDA 2D5VA 2K7LA 3OYHA 4D5CA 2R7UA 2K02A 3GFMA 3KZIC 1KQ0A 2B0LA 4HNTA 3WGHA 1IRZA 1ZG3A 4IRHA 5HLIA 5CYVA 3MCZA 1ZGJA 3RKYA 2DA5A 4XRMA 1W7PD 3IH3A 4M6XA 1UCRA 2F6CA 2L2OA 1YJNI 1IXCA 3BC8A 1ON2A 2EFPA 2HOAA 3OYEA 5KHDA 2ME6A 3LSMA 2TDXA 4CXFA 1BJZA 3LMMA 3PUBA 3R0AA 3OYCA 4LB6B 1BI0A 3CCLI 3KLNA 2GA2A 4CCNA 2HWVA 2P4WA 3RI4A 1FNNA 4Y17A 1K79A 5FO5A 3ZN0A 3CCUI 4C9YA 1T0FA 1W7PB 2VLAA 2MD0A 4JBAA 5FKKA 3SZPA 3H3VK 2DJIA 1EV7A 3OYMA 3MFKA 1MD0A 2YU3A 4IQJA 4QLCU 1BW5A 3V42A 4A2UA 4BHPA 3WTUC 1HW5A 3DWLE 1WH5A 3SFIA 1U5TB 2HQAA 4RM3A 2CUFA 3EYYA 1ETVA 5FKOA 1EA3A 3K10A 4GO1A 2QKLB 2EBIA 2CSOA 1DP7P 2FEZA 2NNNA 3HDDA 4ZZDA 3KEQA 3U1DA 2E5NA 1HC8A 5H6QA 2EIJH 4XN3A 1KYZA 1MSEC 2R93J 2V1UA 2ZJQF 2MW8A 1YS7A 2ZXWH 2EJRA 2JZYA 3TEDA 1MGTA 2ZKZA 4LIUA 2F2EA 2L7KA 2MFZA 3FKIJ 3QYBA 1S6LA 4I6ZA 1MMSA 1BW6A 4CO8A 2ZSHB 4ABZA 3G71I 1VQ8I 2A61A 2DTZA 4HAMA 4HV6A 4M72A 3KP4A 1EJ9A 3QP6A 2H1KA 3H5RA 4R8HA 1OLTA 2KDOA 1X58A 3H0DA 1TT0A 4XKBA 5HDKA 4XM3A 4CH7A 2IPQX 3FZVA 4IQ4A 3PO2J 4BDYA 1GXQA 5D5VB 3CO7C 4BE2A 2Z5UA 3ZCOA 2P5LC 2BVLA 1P7JA 2AQEA 2HXIA 3CJNA 4AUXA 3VYSB 4DBRA 3V4GA 3F22A 3HBLA 4PGHA 5BQTA 1BI1A 4HNVA 1MSFC 3JREA 1MBKA 1YLFA 2BHZA 3I55I 3OYKA 4NHJA 1V3FA 3ABLH 5E1WA 2VASA 3WU2C 2HVQA 3BPXA 1Z91A 5F0HA 3D0SA 2NNYA 1KU7A 5JI6A 2YX7A 2EFOA 2K9SA 5EZGA 5ED4A 1R49A 3IKTA 3TBIA 4AC0A 1JT6A 2QM3A 1LB2A 4F7ZA 1RR8C 1Z6TA 4LG0A 1XCBA 3TOAA 3HSFA 1KA8A 3V7SA 4PGGA 2DPDA 2IW5A 1GT0C 1QZEA 2O8XA 3OYJA 4W97A 4NDLA 3WE2A 3LA3A 4EJOA 2NOGA 1W5TA 5LEJA 2IS2A 4IO9F 1ACIA 4HLYA 1NG7A 1RESA 5E18F 2Q0OA 1RZ4A 1R1VA 1Q1HA 3W6KB 2ECCA 3HSRA 3U2RA 3LFUA 3OIQA 1U9NA 4M71A 5FLMJ 4FCYA 2HYJA 1D5VA 2GAUA 1SD5A 4H0EA 4HA8A 3CMYA 4S0HB 3U9GA 3DTEA 1L0OC 2DT6A 4WXHA 2IA1A 1X3WB 2R7VA 2ECBA 2QQBA 3HEFA 1OPCA 3BR1A 4WF2A 3I71A 5EEAA 3BG6A 4HX4A 5C3EJ 1WFXA 1K4TA 4ENNA 4BAYA 4B48A 1STZA 3LWFA 4JP0A 3QRFF 3WG7H 2GWRA 2FE3A 2LD5A 3BZ6A 4LMYA 2W7NA 1IRFA 2PMHA 2R5YB 4G8XA 3N4MA 3PM1A 4EJWA 2F5EA 2M7BA 2FRHA 4CGZA 3M3YJ 1BIAA 1J09A 3PFYA 2KJCA 4B47A 4LIVA 1UHSA 1K7AA 3TO6A 1EF4A 2M9HA 2HPMA 2HVSA 2ADUA 1FSEA 1REPC 5DM6F 1IRGA 1ZG5A 4JYKA 1XG1A 1G3YA 3CC2I 1FOYA 5E3MA 1DU0A 4IL6C 1MMNA 3DKWA 2R7FA 3E97A 3HRMA 2IAIA 3O6BB 3E0JB 4ESBA 2R7WA 2R0QC 5M5XJ 4X0GA 2LH9A 3GZNB 2EZLA 1X1DA 3D5LA 3JSOA 1OQYA 2MH2A 3FISA 4XR6A 2L7FP 3VYTB 2HU9A 2B9SA 4BACA 4XKWA 3OYGA 4NQWB 5FRNA 3BTCA 1HBXG 2CW0F 2Y30A 3O3KA 3CCVI 4AIJA 1BI3A 2EA4A 2IGKA 5GTIC 5D8LB 2JMWA 3DKXA 2XRLA 3JRFA 1QA6A 1GUUA 3BTLA 3K70D 3QPLA 4HF1A 2XVCA 4L9JA 1IN4A 2O0YA 2D1VA 1IXSB 1XGSA 2QSHX 2OTJI 1DGRM 3H9JA 4EQQA 2LKXA 1SFXA 3TP3A 4A3IJ 1MDMA 3I59A 1PYVA 3I0TA 3GO5A 3MAJA 1RUOA 3IC7A 1MJAA 3ZQLA 2KRHA 2M1BA 2P7CB 4A93J 3WTSC 1PUEE 2DAOA 3S8PA 1USSA 5J1UA 5A2QK 2X6XA 4WX9A 1GV2A 1U9OA 2R7TA 5F1JA 2OQGA 5IT3A 1VQ5I 2EWNA 1N78A 1JTXA 3OYIA 1FMWA 3J7AY 1YFHA 1R23A 4UVCA 3A4CA 3S16J 2IBDA 4J00A 1R58A 2PN6A 4UNOA 4UXNA 3M7GA 1IO2A 2DQLA 2V1DA 3MVPA 1FOWA 3A2KA 2VE9A 3FK7A 2P5VA 2ESHA 2MD5A 2MBFA 4G7ZF 3JRBA 1NG6A 1K6YA 1V54H 3H5NA 2AXTC 2E1MB 5E3OA 1Y6IA 3H3ZA 4RAGA 4I7HA 3FBNB 4M3FA 4A3JJ 3GTMJ 4WK8F 2NYXA 4MTDA 2K5CA 5DDGA 2X51A 1ZGWA 4B44A 2RN7A 2ZXHA 1XSDA 2CQNA 4AVZA 4I76A 1QHGA 1GV5A 2BY1A 3CUQB 1OJLA 4U0YA 3KFWX 3GTOJ 1JT0A 2CFXA 2XPWA 5LFAA 2Y0MA 5ICEA 2MLGA 2X48A 4XLHA 4LB5A 3HUGB 2V1XA 4BUPA 4JK1X 5ICFA 1OCCH 1LUJB 3DLLF 1XPXA 1UAAA 4L9VA 1YS6A 3C2GA 1XD7A 2XAUA 1XC5A 5KAFC 1T8IA 5J4YA 1A04A 2H1LA 3GTGJ 1D0XA 5EG0A 3I4PA 4MIMA 4CSWA 2LF7A 2QF7A 2DXIA 5LHGA 3PSIA 1ZGAA 2KZGA 4MHGA 3M4OJ 2ID6A 1HF0A 3IHUA 5HVQC 5EYRA 1YJ9I 5D5WB 3SFZA 1SD6A 2QUFA 2LY9A 1SVOA 5ILVA 1IZ1A 4BQAA 3GCMA 1IDYA 3ZQIA 1JHHA 1V5GA 2WAQA 5HLGA 3ZN1A 2DOFA 4HG2A 2G9WA 3OYDA 1ENHA 2RAEA 5J4VA 2VQLA 3FXRA 2R7OA 3OIOA 1FYKA 4BBRJ 1WRJA 3S3OA 2GXAA 3HOZJ 1MMGA 2KT0A 2L9NA 4CZZA 4R79A 1LQ1A 1U0JA 4M3BA 4G7OF 3ZMTA 2OTLI 2ELHA 1UMQA 4A5NA 2VKDA 5FKMA 3S1RJ 2VJJA 4UB8C 4KFCA 2K86A 1APLC 4LK1F 2LSOA 1LEAA 2NS0A 2KIFA 5E3LA 4DYQA 1B9MA 1IN7A 2BHYA 3HHHA 5J40A 3ZOBA 1X19A 1AU7A 2LBFA 2K3FA 2XAHA 2HXOA 3ABMH 5LGTA 3DCFA 1JUSA 2YUSA 4G6DA 3OYLA 2HKXA 3BWGA 3C18A 5H20A 5DYMA 2JSCA 1HDDC 1Z7UA 1VI0A 2VQCA 3K4NA 2BGCA 2XROA 4KITB 3FHZA 3L2RA 2M0CA 4LLGF 3CTAA 1DUXC 2JSPA 2XV4S 5TRDA 4EJTA 3ZQCA 3S2DJ 1KU2A 3I4NJ 1TQMA 3ZXSA 2A6HF 3CC4I 2AQFA 4ENKA 1PP7U 2LP0A 4D9JA 3MMYB 3BCAA 1K4SA 5GPAA 2DT7B 2VOPA 4FETA 1ULYA 2BW3A 2NOJB 3HZJA 1MKMA 2X0LA 1R9TJ 3MKWB 2Q1ZB 2DI3A 3EPZA 1B72B 3BQZA 1XMXA 2O03A 1HXDA 3V7CA 5DM7F 3OSGA 5KVRA 3L2CA 1HCRA 2CQQA 2DA6A 2DDAA 4BL0B 3CMAI 2JPCA 2HYGD 2XB0X 4Q47A 2GOXB 2ZMEA 4C2UA 2P6SA 3EDPA 4XONA 2KJBA 4HQEA 2BV6A 1POGA 1R1TA 2EINH 4BBSJ 1VF9A 2H09A 2ZCWA 2DA7A 3OOUA 4N4NB 4BQNA 3B6CA 2XPVA 3ML6A 2DT5A 4ZJZA 2CWEA 3I5UA 3BDDA 1K61A 2QQ8A 2M7AA 3WTYC 1SEUA 2HS5A 2AS5F 2F5DA 4C3IJ 2PX9A 3MZ8A 1J2XA 3JTHA 4G9YA 2GIVA 2FUG2 1WJFA 1DU6A 1FZPB 1I6XA 4HZFA 4PJJA 6PAXA 4L9TA 5DUKA 5BOXA 1ETXA 3DPTA 3OYAA 1LDKB 3PIOF 1PJRA 2K9MA 2FJ1A 1A6IA 1MBHA 1SFKA 1F1ZA 3OYNA 1QRYA 2H8WA 1MBFA 3JRIA 4NC7A 3RYRA 2VJIA 3GFIA 3G73A 4BQOA 2JA6J 4XQFA 2FX0A 3F23A 4AIKA 4BY1J 3CLOA 2XGDA 3BG9A 2RNGA 2EQRA 2WTEA 5LGUA 4PCQA 3SDGA 2CJJA 1FBQA 3K69A 1B72A 3FXUA 5HS9A 4A3FJ 2W24A 2COBA 2E1OA 1MBJA 2EFQA 2JK3A 1Z9CA 2JUCA 3SDBA 2OV7A 1VZ0A 1UZCA 2QZ8A 1O3TA 2STTA 1NK3P 2X6OA 5DS9A 3GTKJ 5IPAA 3ZQHA 5J47A 5K7ZA 2COMA 3GMEA 1E3PA 4I99C 2EV6A 2M34A 5D5UB 2QGUA 2BY3A 1OR7A 3DU6A 4U0WA 3P9KA 4JX5A 4D7NA 3REOA 3NARA
chains in the Genus database with same CATH topology
3BTIA 1T33A 4DYCA 2M8GX 2LR8A 5FKKA 4EEFG 3NAUA 3TP0A 5HODA 4FE7A 3H3VK 4QTRA 2DMQA 3TW7A 2B63J 1BW5A 1QVUA 1OCTC 1TC3C 1WH5A 5C44J 2DA2A 2Y9YA 1X2MA 3SFIA 3UKGA 3QQAA 3PO3J 2CUFA 2VI6A 1ETVA 5FKOA 1LE8A 2EBIA 3HGGA 3HDDA 5K7FA 3S1QJ 1IGNA 1MSEC 2VKVA 3DEWA 2R93J 3BTJA 2MW8A 4IHYA 3TEDA 1FIPA 2XGCA 1X2NA 5BNGA 4D7MA 2E2HJ 2O7OA 2DMTA 3FKIJ 4G12A 4I6ZA 3S2HJ 1MH4A 1AHDP 1BW6A 1ITYA 1JKRC 1ZTRA 4ABZA 1RKWA 2DTZA 1E3OC 5EGOB 3JRGA 1AKHA 1TWHJ 2H1KA 2DA1A 3F0CA 2CQXA 3G1OA 2KDZA 1X58A 2NVQJ 3PO2J 3LSGA 2JN6A 3HOVJ 4LOCA 1Z77A 1IJWC 1P7JA 3RZDJ 2HXIA 4AUXA 1JKPC 1WI3A 3CQZJ 1IDZA 3HBLA 2EZHA 1Y1VJ 4XIDA 4HNVA 1GDTA 1MSFC 5F27A 3JREA 4X6AJ 1YRNA 4A3KJ 2O9LA 5IYCJ 1IUFA 5EDNA 1MBKA 1JTYA 2E2IJ 5EF6A 5F0HA 4X1EA 4FE4A 1NTCA 2K9SA 3K7AJ 5EZGA 1U8BA 5IYDJ 1UG2A 2K9NA 4MFEA 2NS8A 4AC0A 3LOCA 1JT6A 4JX4A 1ETQA 2P81A 3BQYA 5EG0B 1I3QJ 1GT0C 3IV5A 3I4MJ 4W97A 4NDLA 3LNQA 2NOGA 3WHBA 4DW6A 4UUTA 3S15J 1W0TA 1RESA 2K9QA 2K40A 2L9RA 2MGQA 2Y2ZA 4GFBA 2ECCA 3HB9A 1D5YA 2ZB9A 1U9NA 5FLMJ 4C2MJ 5M3MJ 2HYJA 4FCYA 1Q1VA 4BKXA 3O8HA 3CMYA 4S0HB 5IP9J 2H8RA 2L0KA 3A01B 2ECBA 4IEJA 3HEFA 4UUSA 3BR1A 3HKZN 2ELKA 4RBOA 1WPKA 1A5JA 5EEAA 5C3EJ 5EZHA 2LK2A 2Y9ZA 5F0FA 4J19A 1I50J 4JP0A 4M3GA 1WCMJ 1ETOA 3HOWJ 2LD5A 2DA3A 1I6HJ 1S7EA 4A3GJ 3E7LA 5C4XJ 2R5YB 1SANA 3PM1A 3RQIA 2QCOA 4W1UA 1SFOJ 1H88C 3B6AA 3M3YJ 1T56A 2G0EA 1RPWA 3LSRA 1B8IB 4MO7A 4V2FA 1UHSA 4IHVA 2JJ7A 2M9HA 1EF4A 3GTLJ 3G1MA 2GM4A 3OSFA 4IHWA 4A3BJ 2HQ5A 1IG7A 4JYKA 1XG1A 5E3MA 1DU0A 1FTZA 4DZPA 3JRAA 2NVTJ 4A3EJ 2XPUA 2IAIA 5GP9A 3HGYA 2R0QC 3HM5A 5M5XJ 2EZLA 1ZR4A 3BR0A 5E3NA 4A3LJ 1ORKA 3FISA 2VPRA 3A01A 3A03A 3SJMA 2L7FP 2EH3A 3QPSA 2R92J 3BTCA 2L7MP 3IH2A 3RZOJ 3CDLA 2Y30A 4Y52J 5M5WJ 4B4CA 1PUFB 2JMWA 1ETKA 2JWTA 2M2EA 2XRLA 3JRFA 1GUUA 3S17J 3BTLA 4A69C 4C3HJ 4DYRA 5FKLA 3QPLA 5J1YA 2NVXJ 1RKTA 2TRTA 1ZQ3P 2LKXA 2N8GA 3TP3A 4A3IJ 1JKQC 5M5YJ 2LVSA 2W48A 3Q0WA 3GTJJ 1MBEA 4CYCB 3A02A 2YU9J 2NVYJ 2LTPA 3ZQLA 2OPTA 2AO9A 4A93J 2YS9A 3JRHA 5J1UA 2HOTA 1H89C 1MH3A 1GV2A 1U9OA 3BR5A 4MFDA 5F1JA 5IOYA 4BXXJ 1F43A 1MNMC 1Z0XA 1FEXA 2WV1A 3BG5A 1QPIA 1ZK8A 1JTXA 3TW6A 4BY7J 4JX6A 2E19A 4Y7NJ 2HOSA 3S16J 2IBDA 4D5FA 1K83J 3MN2A 2XSDC 5GPCA 1JJ6C 5JLWA 5FLVA 3MVPA 1ZKGA 3HOUJ 3Q3SA 3FK7A 4XRSG 4IHXA 3Q0UA 3ZQGA 1H8AC 3RKQA 1IC8A 1FJLA 2TCTA 1HOMA 3JRBA 5EGOA 5E3OA 1OFCX 2R5ZB 5J3LA 1QVTA 1G2HA 3G1LA 4M3FA 4A3JJ 3GTMJ 1BL0A 3D1NI 1ZGWA 2CU7A 1XS9A 2AHQA 1RR7A 2OF7A 2JA5J 2X9DA 4I76A 1GV5A 1OJLA 3GTOJ 3W6VA 1JT0A 2XPWA 1TWAJ 4V2GA 2X48A 1NK2P 5J1RA 1VFCA 3K2AA 2FQ4A 2Y31A 4AYBN 5IP7J 1LE8B 2XGEA 4A3MJ 1XC5A 2O8KA 3GTGJ 2R7ZJ 5EG0A 2LLKA 4MIMA 1JJ8C 1JUMA 2QF7A 4M3EA 5F08A 3LSPA 3M4OJ 2ID6A 1HF0A 5DTDA 2LFBA 5EYRA 1ETYA 3GTQJ 2DA4A 1HLVA 3S1MJ 2LY9A 3JRCA 2GBYA 2R5ZA 3VPRA 1IDYA 3ZQIA 2VUMJ 1MBGA 4A3CJ 1AKHB 1ENHA 2RAEA 4C3JJ 1WH7A 1ZR2A 2DMPA 3OIOA 1FIAA 3HOYJ 4BBRJ 2HDDA 3HOZJ 4MLOA 2KT0A 1U78A 4M3BA 2DMUA 2GLOA 4QIWN 2L7ZA 1LFUP 1UMQA 2FD5A 1JGGA 1TWCJ 2WB1N 5FKMA 3S1RJ 3H0GJ 1APLC 1YRNB 5E3LA 4DYQA 5IP6A 1RETA 2DN0A 2ID3A 2EZIA 3ZOBA 1AU7A 4M3DA 2HXOA 3O8GA 3DCFA 1JUSA 5FKNA 4XICA 2YUSA 2NS7A 1HDPA 2CRGA 2IEKA 3BR3A 2WAQN 3LSJA 4QSHA 5C4JJ 5IOZA 1P7IA 5K7HA 2R5YA 1HDDC 2CUEA 4A3DJ 4DZJA 1TWFJ 1VI0A 4L5EA 3BR6A 1ETWA 4B1RA 3HOXJ 1O4XA 3MKLA 2JA8J 4M6VA 2M0CA 3S1NJ 1B8IA 3S2DJ 3ZQCA 2MSYA 2JA7J 3I4NJ 4FISA 2PMZN 3GTPJ 4XK4A 2LP0A 1TWGJ 5F04A 5GPAA 1GVDA 2MG4A 3CCYA 1R9TJ 1F36A 4XRSA 4B3AA 1B72B 2DMNA 3BQZA 3OSGA 3ZQFA 3Q0VA 3GBGA 1HCRA 2CQQA 2DA6A 5F0CA 4RDUA 1WGXA 2XB0X 4UUSB 1IV6A 4BBSJ 1PUFA 1POGA 1JUPA 1VF9A 2DA7A 3OOUA 3B6CA 2XPVA 3JRDA 1LFBA 9ANTA 1K61A 2I10A 1JKOC 3IH4A 4C3IJ 5IYBJ 2XB5A 3BG3A 2E2JJ 1OCPA 2ME0A 1DU6A 3S14J 3FK6A 4CYCA 3JR9A 1CQTA 2DJNA 1Y1WJ 2HI3A 1ETXA 2FJ1A 1A6IA 1MBHA 1QRYA 3BR2A 3WHCA 3JRIA 1MBFA 1W0UA 2D5VA 3FIWA 3C2BA 4D5CA 2JA6J 2FX0A 4BY1J 3L1PA 1VNDA 2XGDA 3BG9A 2EQRA 1IRZA 3SDGA 2CJJA 2DA5A 1B72A 4XRMA 4A3FJ 2COBA 2E1OA 1MBJA 3IH3A 5JLXA 2JK3A 2VKEA 1NK3P 2X6OA 5DS9A 2HOAA 5IPAA 2EZKA 3GTKJ 3ZQHA 2Y0SN 5K7ZA 1FTTA 2ME6A 3BT9A 5FJ8J 1BJZA 2M34A 4FTHA 4JX5A 4D7NA 5M3FJ 3NARA 1BA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTI A;  1T33 A;  4DYC A;  2M8G X;  2LR8 A;  5FKK A;  4EEF G;  3NAU A;  3TP0 A;  5HOD A;  4FE7 A;  3H3V K;  4QTR A;  2DMQ A;  3TW7 A;  2B63 J;  1BW5 A;  1QVU A;  1OCT C;  1TC3 C;  1WH5 A;  5C44 J;  2DA2 A;  2Y9Y A;  1X2M A;  3SFI A;  3UKG A;  3QQA A;  3PO3 J;  2CUF A;  2VI6 A;  1ETV A;  5FKO A;  1LE8 A;  2EBI A;  3HGG A;  3HDD A;  5K7F A;  3S1Q J;  1IGN A;  1MSE C;  2VKV A;  3DEW A;  2R93 J;  3BTJ A;  2MW8 A;  4IHY A;  3TED A;  1FIP A;  2XGC A;  1X2N A;  5BNG A;  4D7M A;  2E2H J;  2O7O A;  2DMT A;  3FKI J;  4G12 A;  4I6Z A;  3S2H J;  1MH4 A;  1AHD P;  1BW6 A;  1ITY A;  1JKR C;  1ZTR A;  4ABZ A;  1RKW A;  2DTZ A;  1E3O C;  5EGO B;  3JRG A;  1AKH A;  1TWH J;  2H1K A;  2DA1 A;  3F0C A;  2CQX A;  3G1O A;  2KDZ A;  1X58 A;  2NVQ J;  3PO2 J;  3LSG A;  2JN6 A;  3HOV J;  4LOC A;  1Z77 A;  1IJW C;  1P7J A;  3RZD J;  2HXI A;  4AUX A;  1JKP C;  1WI3 A;  3CQZ J;  1IDZ A;  3HBL A;  2EZH A;  1Y1V J;  4XID A;  4HNV A;  1GDT A;  1MSF C;  5F27 A;  3JRE A;  4X6A J;  1YRN A;  4A3K J;  2O9L A;  5IYC J;  1IUF A;  5EDN A;  1MBK A;  1JTY A;  2E2I J;  5EF6 A;  5F0H A;  4X1E A;  4FE4 A;  1NTC A;  2K9S A;  3K7A J;  5EZG A;  1U8B A;  5IYD J;  1UG2 A;  2K9N A;  4MFE A;  2NS8 A;  4AC0 A;  3LOC A;  1JT6 A;  4JX4 A;  1ETQ A;  2P81 A;  3BQY A;  5EG0 B;  1I3Q J;  1GT0 C;  3IV5 A;  3I4M J;  4W97 A;  4NDL A;  3LNQ A;  2NOG A;  3WHB A;  4DW6 A;  4UUT A;  3S15 J;  1W0T A;  1RES A;  2K9Q A;  2K40 A;  2L9R A;  2MGQ A;  2Y2Z A;  4GFB A;  2ECC A;  3HB9 A;  1D5Y A;  2ZB9 A;  1U9N A;  5FLM J;  4C2M J;  5M3M J;  2HYJ A;  4FCY A;  1Q1V A;  4BKX A;  3O8H A;  3CMY A;  4S0H B;  5IP9 J;  2H8R A;  2L0K A;  3A01 B;  2ECB A;  4IEJ A;  3HEF A;  4UUS A;  3BR1 A;  3HKZ N;  2ELK A;  4RBO A;  1WPK A;  1A5J A;  5EEA A;  5C3E J;  5EZH A;  2LK2 A;  2Y9Z A;  5F0F A;  4J19 A;  1I50 J;  4JP0 A;  4M3G A;  1WCM J;  1ETO A;  3HOW J;  2LD5 A;  2DA3 A;  1I6H J;  1S7E A;  4A3G J;  3E7L A;  5C4X J;  2R5Y B;  1SAN A;  3PM1 A;  3RQI A;  2QCO A;  4W1U A;  1SFO J;  1H88 C;  3B6A A;  3M3Y J;  1T56 A;  2G0E A;  1RPW A;  3LSR A;  1B8I B;  4MO7 A;  4V2F A;  1UHS A;  4IHV A;  2JJ7 A;  2M9H A;  1EF4 A;  3GTL J;  3G1M A;  2GM4 A;  3OSF A;  4IHW A;  4A3B J;  2HQ5 A;  1IG7 A;  4JYK A;  1XG1 A;  5E3M A;  1DU0 A;  1FTZ A;  4DZP A;  3JRA A;  2NVT J;  4A3E J;  2XPU A;  2IAI A;  5GP9 A;  3HGY A;  2R0Q C;  3HM5 A;  5M5X J;  2EZL A;  1ZR4 A;  3BR0 A;  5E3N A;  4A3L J;  1ORK A;  3FIS A;  2VPR A;  3A01 A;  3A03 A;  3SJM A;  2L7F P;  2EH3 A;  3QPS A;  2R92 J;  3BTC A;  2L7M P;  3IH2 A;  3RZO J;  3CDL A;  2Y30 A;  4Y52 J;  5M5W J;  4B4C A;  1PUF B;  2JMW A;  1ETK A;  2JWT A;  2M2E A;  2XRL A;  3JRF A;  1GUU A;  3S17 J;  3BTL A;  4A69 C;  4C3H J;  4DYR A;  5FKL A;  3QPL A;  5J1Y A;  2NVX J;  1RKT A;  2TRT A;  1ZQ3 P;  2LKX A;  2N8G A;  3TP3 A;  4A3I J;  1JKQ C;  5M5Y J;  2LVS A;  2W48 A;  3Q0W A;  3GTJ J;  1MBE A;  4CYC B;  3A02 A;  2YU9 J;  2NVY J;  2LTP A;  3ZQL A;  2OPT A;  2AO9 A;  4A93 J;  2YS9 A;  3JRH A;  5J1U A;  2HOT A;  1H89 C;  1MH3 A;  1GV2 A;  1U9O A;  3BR5 A;  4MFD A;  5F1J A;  5IOY A;  4BXX J;  1F43 A;  1MNM C;  1Z0X A;  1FEX A;  2WV1 A;  3BG5 A;  1QPI A;  1ZK8 A;  1JTX A;  3TW6 A;  4BY7 J;  4JX6 A;  2E19 A;  4Y7N J;  2HOS A;  3S16 J;  2IBD A;  4D5F A;  1K83 J;  3MN2 A;  2XSD C;  5GPC A;  1JJ6 C;  5JLW A;  5FLV A;  3MVP A;  1ZKG A;  3HOU J;  3Q3S A;  3FK7 A;  4XRS G;  4IHX A;  3Q0U A;  3ZQG A;  1H8A C;  3RKQ A;  1IC8 A;  1FJL A;  2TCT A;  1HOM A;  3JRB A;  5EGO A;  5E3O A;  1OFC X;  2R5Z B;  5J3L A;  1QVT A;  1G2H A;  3G1L A;  4M3F A;  4A3J J;  3GTM J;  1BL0 A;  3D1N I;  1ZGW A;  2CU7 A;  1XS9 A;  2AHQ A;  1RR7 A;  2OF7 A;  2JA5 J;  2X9D A;  4I76 A;  1GV5 A;  1OJL A;  3GTO J;  3W6V A;  1JT0 A;  2XPW A;  1TWA J;  4V2G A;  2X48 A;  1NK2 P;  5J1R A;  1VFC A;  3K2A A;  2FQ4 A;  2Y31 A;  4AYB N;  5IP7 J;  1LE8 B;  2XGE A;  4A3M J;  1XC5 A;  2O8K A;  3GTG J;  2R7Z J;  5EG0 A;  2LLK A;  4MIM A;  1JJ8 C;  1JUM A;  2QF7 A;  4M3E A;  5F08 A;  3LSP A;  3M4O J;  2ID6 A;  1HF0 A;  5DTD A;  2LFB A;  5EYR A;  1ETY A;  3GTQ J;  2DA4 A;  1HLV A;  3S1M J;  2LY9 A;  3JRC A;  2GBY A;  2R5Z A;  3VPR A;  1IDY A;  3ZQI A;  2VUM J;  1MBG A;  4A3C J;  1AKH B;  1ENH A;  2RAE A;  4C3J J;  1WH7 A;  1ZR2 A;  2DMP A;  3OIO A;  1FIA A;  3HOY J;  4BBR J;  2HDD A;  3HOZ J;  4MLO A;  2KT0 A;  1U78 A;  4M3B A;  2DMU A;  2GLO A;  4QIW N;  2L7Z A;  1LFU P;  1UMQ A;  2FD5 A;  1JGG A;  1TWC J;  2WB1 N;  5FKM A;  3S1R J;  3H0G J;  1APL C;  1YRN B;  5E3L A;  4DYQ A;  5IP6 A;  1RET A;  2DN0 A;  2ID3 A;  2EZI A;  3ZOB A;  1AU7 A;  4M3D A;  2HXO A;  3O8G A;  3DCF A;  1JUS A;  5FKN A;  4XIC A;  2YUS A;  2NS7 A;  1HDP A;  2CRG A;  2IEK A;  3BR3 A;  2WAQ N;  3LSJ A;  4QSH A;  5C4J J;  5IOZ A;  1P7I A;  5K7H A;  2R5Y A;  1HDD C;  2CUE A;  4A3D J;  4DZJ A;  1TWF J;  1VI0 A;  4L5E A;  3BR6 A;  1ETW A;  4B1R A;  3HOX J;  1O4X A;  3MKL A;  2JA8 J;  4M6V A;  2M0C A;  3S1N J;  1B8I A;  3S2D J;  3ZQC A;  2MSY A;  2JA7 J;  3I4N J;  4FIS A;  2PMZ N;  3GTP J;  4XK4 A;  2LP0 A;  1TWG J;  5F04 A;  5GPA A;  1GVD A;  2MG4 A;  3CCY A;  1R9T J;  1F36 A;  4XRS A;  4B3A A;  1B72 B;  2DMN A;  3BQZ A;  3OSG A;  3ZQF A;  3Q0V A;  3GBG A;  1HCR A;  2CQQ A;  2DA6 A;  5F0C A;  4RDU A;  1WGX A;  2XB0 X;  4UUS B;  1IV6 A;  4BBS J;  1PUF A;  1POG A;  1JUP A;  1VF9 A;  2DA7 A;  3OOU A;  3B6C A;  2XPV A;  3JRD A;  1LFB A;  9ANT A;  1K61 A;  2I10 A;  1JKO C;  3IH4 A;  4C3I J;  5IYB J;  2XB5 A;  3BG3 A;  2E2J J;  1OCP A;  2ME0 A;  1DU6 A;  3S14 J;  3FK6 A;  4CYC A;  3JR9 A;  1CQT A;  2DJN A;  1Y1W J;  2HI3 A;  1ETX A;  2FJ1 A;  1A6I A;  1MBH A;  1QRY A;  3BR2 A;  3WHC A;  3JRI A;  1MBF A;  1W0U A;  2D5V A;  3FIW A;  3C2B A;  4D5C A;  2JA6 J;  2FX0 A;  4BY1 J;  3L1P A;  1VND A;  2XGD A;  3BG9 A;  2EQR A;  1IRZ A;  3SDG A;  2CJJ A;  2DA5 A;  1B72 A;  4XRM A;  4A3F J;  2COB A;  2E1O A;  1MBJ A;  3IH3 A;  5JLX A;  2JK3 A;  2VKE A;  1NK3 P;  2X6O A;  5DS9 A;  2HOA A;  5IPA A;  2EZK A;  3GTK J;  3ZQH A;  2Y0S N;  5K7Z A;  1FTT A;  2ME6 A;  3BT9 A;  5FJ8 J;  1BJZ A;  2M34 A;  4FTH A;  4JX5 A;  4D7N A;  5M3F J;  3NAR A;  1BA5 A; 
#chains in the Genus database with same CATH topology
 1T95 A;  3JSP A;  1T33 A;  4ANJ A;  4DYC A;  4E7S A;  1V55 H;  2LR8 A;  4Q4Z F;  3SZG A;  2E36 A;  4L0Z B;  3GWZ A;  1V5E A;  4N9H A;  4DGW B;  1T2K A;  2PMU A;  3FF5 A;  4IJA A;  3KYL A;  1Z7L A;  1D1C A;  3RJP A;  3RPQ A;  3ISP A;  1G3W A;  3TW7 A;  1G3S A;  2NXN B;  2EV5 A;  2M0M A;  5CJ9 A;  5K5R A;  2LY1 A;  2VT2 A;  3W2V A;  3PO3 J;  3IRQ A;  1IN8 A;  3ERM A;  2VN2 A;  2R3S A;  4EJV A;  1FP2 A;  1UJ8 A;  2UUZ A;  1BBY A;  3HGG A;  3JAM K;  5K7F A;  3S1Q J;  5HOO A;  3WGG A;  4WCG A;  1IGN A;  3DEW A;  2MC3 A;  5HLT A;  1XX5 A;  4NC8 A;  3WE3 A;  4GYI A;  4MQ9 F;  2XGC A;  5L3C A;  4D7M A;  2VKH A;  4I01 A;  2E2H J;  4IRI A;  4ZTJ A;  2FNA A;  2G7U A;  2LMD A;  4A6E A;  3WOD F;  3K0L A;  1RKW A;  3DXJ F;  3K4L A;  2A69 F;  4LJZ F;  4IRG A;  3CUO A;  5EGO B;  1AKH A;  4MQV A;  3DKY A;  2CQX A;  2K4B A;  2VQG A;  3G1O A;  3CCM I;  2Z9O A;  4HDV A;  2R7X A;  3GF2 A;  4LD5 A;  3ZMS A;  2JN6 A;  3CCR I;  2VXZ A;  4ZTF A;  4Q48 A;  1WI3 A;  2L4M A;  3CQZ J;  3KYD B;  3K70 C;  1IDZ A;  2EZH A;  1Y1V J;  1GDT A;  2VE8 A;  1TL8 A;  5IYC J;  1IUF A;  5LLQ A;  2L4A A;  3K4C A;  3PQK A;  4HQM A;  3TQN A;  1S5L C;  5E1Z B;  2CMP A;  1JHF A;  4X1E A;  1HKQ A;  5LBQ A;  1PDN C;  1NTC A;  2V6C A;  1ZRF A;  3PNY A;  1P6R A;  1X3U A;  1U8B A;  5FRO A;  1UG2 A;  2K9N A;  3OOP A;  2F4M B;  3K6G A;  1ETQ A;  2P81 A;  2BXZ A;  4I02 A;  4A0Z A;  1P92 A;  1K78 A;  1I3Q J;  1KU9 A;  4HF0 A;  5J8C A;  1HW2 A;  2JUG A;  2IVM A;  2F5C A;  2BEO A;  2F48 A;  2GA1 A;  4OOI A;  2QQ9 A;  3DLA A;  3K1M A;  4DW6 A;  4C30 A;  1W0T A;  2L9R A;  5JVG F;  1HKS A;  3FXL A;  1A36 A;  2F5V A;  1D5Y A;  2ZB9 A;  1IUY A;  3F8N A;  4I0A A;  1VQO I;  2DCE A;  1YX3 A;  4BKX A;  3KP3 A;  3O8H A;  5GAG J;  4G6Q A;  3PIP F;  1J0R A;  2KMU A;  3CUQ C;  1YIJ I;  3W2A A;  4BHB A;  5IP9 J;  2H8R A;  1QGP A;  4BHC A;  2HPI A;  2QA4 I;  3GZ5 A;  4IEJ A;  1YHQ I;  4UUS A;  3HKZ N;  3QYE A;  1R1U A;  2IS4 A;  1WPK A;  2PFB A;  2KIM A;  2DYS H;  3KYC B;  1A5J A;  3ONQ A;  4ITV A;  5LRR A;  4ZH4 F;  4D0P A;  2R7S A;  2Y9Z A;  5F0F A;  4J19 A;  4PFO A;  1WCM J;  2HZD A;  4KN4 X;  2D45 A;  2DA3 A;  1I6H J;  2HYF A;  2E7X A;  3DEU A;  5C4X J;  5DD4 A;  5DEQ A;  1SFU A;  4MGR A;  2QCO A;  1G59 A;  3M07 A;  3F6V A;  3RQ4 A;  3KEY A;  1H88 C;  1B59 A;  1ZYR F;  3B6A A;  5B1A H;  3J7A O;  3LSR A;  1B8I B;  4MO7 A;  4IHV A;  4BEH B;  2JJ7 A;  4KT5 C;  3G1M A;  2GM4 A;  4IHW A;  3E5X A;  4ETS A;  4OMZ A;  4RB1 A;  1IG7 A;  2V4J C;  2OCC H;  3A1Y A;  2HKO A;  3ABU A;  3K1N A;  2NVT J;  2ZFW A;  2XPU A;  2DFE A;  1Z1D A;  2MAB A;  1WSU A;  1O3S A;  1GVJ A;  4XN0 A;  3HRT A;  3BR0 A;  4HF2 A;  2VPR A;  3HG9 A;  3A03 A;  1T39 A;  3T0Y A;  4ZYG A;  1W5C C;  1S3J A;  2EIM H;  4F92 B;  4KIS A;  4FAS D;  3RZO J;  4CDG A;  4Y52 J;  4AIH A;  2EK5 A;  3PQJ A;  5M5W J;  4XKV A;  2EIK H;  4N4O B;  1ZAO A;  1D0Z A;  2KIQ A;  1FPQ A;  2CS3 A;  2IGO A;  2LC2 A;  1W4M A;  4C3H J;  4I0B A;  4II2 A;  5FKL A;  1DDN A;  1ZRD A;  3IKV A;  4UUV A;  1W7P A;  3ZMU A;  1YOV B;  2FA5 A;  4KMU X;  5JHU A;  2TRT A;  2LY2 A;  3OYF A;  1UG0 A;  1FOK A;  3K9T A;  2LVS A;  3K4K A;  3QP5 A;  1O3R A;  3GZ6 A;  4CYC B;  4KNY A;  3DQV C;  5KCM A;  4ESF A;  2E71 A;  4EAT A;  3A02 A;  1TQP A;  1UEL B;  1D0Y A;  3OYB A;  1D1A A;  2LTP A;  2VBZ A;  2OPT A;  2AO9 A;  3HRS A;  1SMT A;  3BZK A;  2YS9 A;  1U5T A;  4M74 A;  2HR3 A;  4OU0 A;  3CP2 A;  4HYE A;  1X1A A;  1F43 A;  5CPR B;  4IXA A;  4KIG A;  3DF8 A;  4HNU A;  1FEX A;  1NH3 A;  5EEG A;  4OMY A;  2H94 A;  2EV0 A;  3BG5 A;  4LIT A;  1QPI A;  3TW6 A;  4BY7 J;  1EH6 A;  3SXY A;  3IWF A;  3V8L A;  4Y7N J;  3OWT A;  3FX3 A;  3HKZ A;  1K83 J;  2W82 A;  1XDS A;  2HGC A;  3AG3 H;  2KZV A;  3AG1 H;  5JLW A;  3LQQ A;  4HEA 2;  3Q3S A;  4HRI A;  2Q2E B;  2EB7 A;  3RPU A;  3RKQ A;  1Z6R A;  1Z21 A;  1IC8 A;  5H6R A;  2C6Y A;  4B3X A;  1HST A;  4ASN A;  3D5S C;  2A5W A;  4OIQ F;  1QPM A;  2IA0 A;  2O3F A;  3R60 A;  4U0V A;  1S72 I;  3CES A;  1QVT A;  1G3T A;  2PBI A;  3G1L A;  3KE2 A;  2DFH A;  1FOX A;  3KET A;  1K6O A;  2V9K A;  2ZNY A;  3NEU A;  3WU0 A;  1OYI A;  2STW A;  2HOE A;  2MC4 A;  4A0X A;  3A0B C;  2OF7 A;  2JA5 J;  2JPB A;  2E34 A;  3RIR A;  1HQC A;  4RA2 A;  3ELK A;  2OD5 A;  1WJC A;  3W6V A;  2E1N A;  2EFW A;  1TWA J;  4KIF A;  4V2G A;  4L9N A;  3GX4 X;  5L3F A;  1VFC A;  1YW8 A;  3K2A A;  2FQ4 A;  3AG2 H;  3U1K A;  3HXL A;  1OYW A;  1WHU A;  2I8D A;  5F1R A;  5FB2 A;  1LE8 B;  2IS1 A;  2XGE A;  4A12 A;  4NB5 A;  2W85 A;  2F4I A;  3I54 A;  2P8T A;  3BLY A;  4IOC F;  3A0H C;  3V8K A;  2J5O A;  2X85 A;  2R7R A;  4G7H F;  2GXB A;  4P1W A;  5F08 A;  3QOE A;  1WVR A;  1X4O A;  3VEP A;  2NAZ A;  5AIP A;  3FBI B;  3CCE I;  1DP3 A;  4PJM A;  2WAD A;  1HLV A;  1P9Q C;  3JTG A;  1KYW A;  3JRC A;  2YPR A;  1LKX A;  4MNU A;  3F6O A;  2VUM J;  1VQ6 I;  1VQN I;  4P55 A;  2DOD A;  2D1H A;  1ODD A;  4C3J J;  4HST A;  5IY5 H;  3QOD A;  2H6C A;  3IAS 2;  4ZYD A;  1FIA A;  3HOY J;  1S7O A;  3OS2 A;  4MLO A;  1GXP A;  3WGI A;  1LEB A;  3LST A;  2M3A A;  4CZC A;  3K4B A;  1UHM A;  2DMU A;  2P5K A;  3QYF A;  2PJP A;  1SVL A;  1LFU P;  1JGG A;  1TWC J;  3HTU A;  1EH7 A;  1ZG1 A;  4II3 A;  4B8X A;  1BC8 C;  2Z33 A;  1YRN B;  5CVU A;  4LLN A;  1R4M B;  1F9N A;  1XMK A;  5E79 C;  2E35 A;  4GXO A;  2DN0 A;  2EZI A;  1XMA A;  3BJA A;  4RAF A;  1IAW A;  3WU1 B;  4M3D A;  3M8J A;  4N0B A;  5FKN A;  4XIC A;  2O5R A;  2Z99 A;  2IEK A;  1QHH D;  3LSJ A;  2WAQ N;  4QSH A;  2YSR A;  3UNG C;  5C4J J;  1ZH5 A;  1P7I A;  2LYC A;  3QPH A;  2R5Y A;  2CUE A;  3OIP A;  1TWF J;  4B1R A;  1P4W A;  1Y39 A;  1MNE A;  3H3U A;  2BY0 A;  3MKL A;  4PSX A;  4M6V A;  3ZMD A;  1A35 A;  2JA8 J;  3R6S A;  3FXO A;  2DTR A;  1BIB A;  4XLF A;  3MQ0 A;  4YFN F;  2RV8 A;  2MSY A;  2JA7 J;  1TNT A;  3DV8 A;  3L9F A;  4XSX F;  3RKX A;  3HC7 A;  3KEO A;  4NC6 A;  2XC7 A;  3GTP J;  4XK4 A;  3HRU A;  3CZ6 A;  5FLX K;  2MG4 A;  2IA2 A;  3MKY B;  3HPH A;  1QZZ A;  1VQL I;  3BJ6 A;  1XSX A;  2QBY B;  4PJL A;  1Y56 A;  2A5Y B;  5LHI A;  2BOL A;  4NQW A;  3I3L A;  5F0C A;  4RDU A;  1ON1 A;  1IV6 A;  1KON A;  2CYY A;  2K4J A;  2MYS A;  1J75 A;  1JUP A;  2CUJ A;  4AD9 A;  2QWW A;  3BRO A;  1FBS A;  2QYO A;  4F93 B;  3M9A A;  2M4K A;  4XRF A;  1CF7 B;  4IZZ A;  2ZJ2 A;  1JKO C;  3IUO A;  3BG7 A;  4I2O A;  1R5I D;  4OIO F;  1G8X A;  5E8I A;  2XB5 A;  1MJ9 A;  4ZZL A;  4AVP A;  2XSJ C;  2DFI A;  2DDB A;  4C2T A;  4QPO A;  3HL2 A;  2HI3 A;  2UWM A;  1YO5 C;  3EUH A;  3F8C A;  3M1C A;  1LPQ A;  5HNH A;  3DTI A;  3RKW A;  3PL8 A;  3CCJ I;  3BR2 A;  3WHC A;  1B9N A;  3S2W A;  1TBX A;  2RQP A;  1OCR H;  1T0F C;  2XIG A;  4ZDP A;  2A3S A;  4ZYA A;  3K1P A;  1VND A;  4R1H A;  4RGS A;  1G4D A;  1QQI A;  5KK1 A;  1WWX A;  2GQQ A;  4RGU A;  1LFP A;  5BPI A;  1YQA A;  1X1B A;  3DTK A;  5GAE J;  1VQ9 I;  3I64 A;  4E6K G;  1E0E A;  3E5Q A;  2FOK A;  2CG4 A;  2VKE A;  3HOS A;  1BOB A;  2EZK A;  1FTT A;  2Y0S N;  4GGG A;  3VFZ A;  1V5F A;  3BP8 A;  5FJ8 J;  3FXQ A;  2OZU A;  3LAP A;  2IJL A;  1CGP A;  5TIS C;  5F6F A;  2QQA A;  4CHU A;  4K2E A;  5M3F J;  1IN6 A;  1BA5 A;  1H9T A;  3BTI A;  5L3E A;  1V4R A;  4XMY A;  3RCO A;  3TDZ C;  1TZL A;  4EEF G;  3NAU A;  3P7N A;  4Z2Y A;  3TP0 A;  5HOD A;  4FE7 A;  4EV0 A;  4QTR A;  3OV8 A;  5AIQ A;  1I1S A;  2DMQ A;  4O3M A;  3CUQ A;  3HSE A;  3J80 K;  1QVU A;  3ZR8 X;  1OCT C;  1R6R A;  4PK4 A;  3KP6 A;  3L09 A;  1D1B A;  5C44 J;  3F9K A;  1X2M A;  2OJE D;  3HUG A;  3K2Z A;  5CVJ A;  2VI6 A;  2B7E A;  3VDX A;  2XAS A;  2JRT A;  3HJE A;  4LGW A;  1XN7 A;  4EM1 A;  3E1S A;  5D6F A;  1QZY A;  4EJU A;  5ICG A;  1YTY A;  2XKO A;  2BE5 F;  4UV8 A;  1FIP A;  1FP1 D;  5D8K B;  5BNG A;  2JVG A;  2HQR A;  1H9G A;  1DGW Y;  4G12 A;  3H36 A;  3S2H J;  1MH4 A;  1KZH A;  1FY7 A;  1Z67 A;  5B3S H;  1ITY A;  1JKR C;  3ERE D;  3E5U A;  1ZTR A;  5D4R A;  5FRM A;  1E3O C;  4CYD A;  2Z3Y A;  3JRG A;  2CW7 A;  4TV7 A;  4UB6 C;  1X3Z B;  2K9L A;  2DA1 A;  3F0C A;  3MD2 A;  1MND A;  5HNF A;  2NVQ J;  2KHM A;  3CDI A;  4KYW A;  1KQ9 A;  2VIX A;  3ECH A;  3LSG A;  4GYG A;  1BN5 A;  3I53 A;  5DCM B;  4ZYE A;  1IJW C;  3R4K A;  4RGX A;  2XF7 A;  2OQR A;  1ONV A;  1XGO A;  3E6B A;  1H0M A;  4X6A J;  4A3K J;  2O9L A;  4MEX F;  4XLA A;  4DOZ A;  3X2Q H;  3CC7 I;  2X1D A;  4XKC A;  4XBF A;  2VOD A;  5GAH J;  4FE4 A;  1DPU A;  2LG4 A;  3GLL A;  3KP5 A;  1EKE A;  4MFE A;  4RLF A;  4FHT A;  3L2U A;  2NS8 A;  1U2W A;  4EM0 B;  3BQY A;  1VQ4 I;  4HLX A;  1R5G A;  2ZNZ A;  3SZT A;  2LF8 A;  2Y0S A;  4MTE A;  5LD2 C;  3IV5 A;  1N77 A;  3I4M J;  4V19 K;  3GLX A;  4QWQ A;  4S04 A;  3LNQ A;  3QU3 A;  4BE0 A;  5CQE A;  3WHB A;  1FWZ A;  2A6E F;  3DP7 A;  1UST A;  4HDU A;  3VYR B;  2K40 A;  1XSV A;  2CO5 A;  2MGQ A;  3F21 A;  4GFB A;  1GHC A;  2W4S A;  4C2M J;  4RM2 A;  3QWL A;  3PNT A;  2JQ7 A;  5ERI A;  2X4H A;  3LSK A;  3ZRG A;  2Y69 H;  3G6E I;  3FMS A;  5FFZ A;  3ZPL A;  2L0K A;  3AKZ A;  1R22 A;  2HFH A;  2OC6 A;  2FBK A;  2ZJP F;  2ELK A;  2R4G A;  1OCZ H;  3R61 A;  3KCC A;  2L3D A;  3IAM 2;  4BE1 A;  3CP8 A;  5EZH A;  2LK2 A;  1ZLJ A;  3B02 A;  3HOT A;  5L3G A;  1TT5 B;  1FBU A;  1I50 J;  1L3L A;  4M3G A;  4HOB A;  4JQF A;  3DBL B;  1WQ2 A;  3HOW J;  2DK5 A;  3FKJ A;  1S7E A;  3WTT C;  5JHF A;  3ZP5 A;  3E7L A;  4F91 B;  4U88 A;  1GLN A;  2VC1 A;  3H9G A;  2ISZ A;  3W2W A;  4W1U A;  5JFR A;  2WY8 Q;  4FX0 A;  1R5H A;  2G0E A;  1RPW A;  3AG4 H;  4L5J A;  4V2F A;  1FLI A;  3QU6 A;  4Y15 A;  3C7J A;  5LRS A;  5A2Q Z;  2QSG X;  4IX7 A;  3BPV A;  3F8B A;  4A3B J;  1IW7 F;  2HQ5 A;  2V6E A;  5FLX Z;  2F4O B;  1R7J A;  3SQN A;  1OIS A;  4Y3O A;  4RB2 C;  2PJR B;  4A3E J;  5GP9 A;  1RRJ A;  3HGY A;  5J8F A;  2W25 A;  2NVU B;  1ZR4 A;  1WJB A;  1M1E B;  1WI9 A;  5E3N A;  4KT6 A;  2I5U A;  3TO9 A;  3SJM A;  4A3L J;  2JTV A;  3VYU B;  4P9F A;  2VJ4 A;  4BXF A;  4BJ5 C;  1YI2 I;  3QPS A;  1T98 A;  2XF6 A;  2L7M P;  3VSL A;  2M5W A;  3BJO A;  4AWX B;  1FT9 A;  1PUF B;  3CF5 F;  3FDY A;  1LJ9 A;  5CVV A;  2JWT A;  2CH0 A;  1QNT A;  4L5I A;  3C1D A;  2L02 A;  4I09 A;  4OIP F;  4DYR A;  5LEK A;  1W5S A;  3GXO A;  4GRI A;  4M6Y A;  4CCM A;  5J1Y A;  1RKT A;  3F8M A;  1TQI A;  2WBM A;  1JKQ C;  5M5Y J;  1SFE A;  3ASN H;  3UR3 C;  3Q0W A;  4CIC A;  3GTJ J;  1MBE A;  3OS1 A;  2HTJ A;  2KQR A;  3D5R C;  4RGR A;  1SMY F;  4G6T B;  4J01 A;  5IT9 K;  1T6S A;  3JRH A;  2M4G A;  3IRR A;  2HOT A;  3VWB A;  1H89 C;  2CW8 A;  1MH3 A;  2Y48 A;  4MFD A;  2BVM A;  2GOM A;  5IOY A;  3WTV C;  4BXX J;  1MNM C;  4HSR A;  1VTN C;  2H27 A;  1ZK8 A;  2BXY A;  2P7V B;  3BOQ A;  2QEN A;  2CUZ A;  3TMO A;  2E19 A;  4P96 A;  4D5F A;  1OMI A;  2XSD C;  2WV0 A;  5GPC A;  4CCL A;  1W1W E;  2WAF A;  5B66 C;  2QEX I;  2DOE A;  2HQN A;  3DFG A;  5FLV A;  1ZKG A;  4RB0 A;  3HOU J;  3SHF A;  2ZC2 A;  2VJ5 A;  2Z1D A;  2NRA C;  1H8A C;  1ZLK A;  5CVI A;  1RIO H;  1N75 A;  2OBP A;  3M8E A;  4ZDL A;  1FJL A;  2TCT A;  2CGP A;  2RQQ A;  5D5X B;  4XLC A;  3OMY A;  5EGO A;  3AL0 C;  2V26 A;  1OFC X;  1BR4 A;  2R5Z B;  1QO0 D;  2KP6 A;  1W36 D;  4XOR A;  1G2H A;  4DBQ A;  3KX2 A;  2X1C A;  1FMV A;  3BY6 A;  4M73 A;  1XS9 A;  1XGN A;  4RB3 C;  2JRM A;  4OAZ A;  3EUK L;  3GW2 A;  3VSK A;  1A31 A;  1NK2 P;  2ICW G;  3CO6 C;  4WXD A;  1TTY A;  2LDU A;  4AID A;  3TO7 A;  3NWT A;  2DOA A;  5E1X A;  3M1E A;  2R7Z J;  2K3P A;  4D1Q A;  2LLK A;  4XL9 A;  2WB1 A;  4RMN A;  1DPR A;  4YRV A;  1Z3Y A;  3G2B A;  4BDZ A;  2BYV E;  2XF5 A;  1R36 A;  3TL4 X;  4DJA A;  4B43 A;  3LSP A;  3C2H A;  3PUF A;  1S8N A;  4H4K C;  5DTD A;  1VQK I;  2LFB A;  2RC4 A;  1ETY A;  2LOO A;  2DA4 A;  3GTQ J;  4KN7 X;  4UV9 A;  3CF2 A;  2GBY A;  3HPG A;  3O2P E;  3VPR A;  2R5Z A;  4EGZ A;  1OCO H;  3KLO A;  2IGN A;  3MZY A;  1KGS A;  5KNL A;  4ZC3 A;  4LLL A;  3NQO A;  1RUN A;  1WH7 A;  2VC0 A;  1ZR2 A;  2DMP A;  1IRX A;  2X1E A;  2HDD A;  3LA7 A;  1S29 A;  2PG4 A;  2R7Q A;  4P5O A;  3ECO A;  2X6Y A;  1XTA A;  2LKS A;  3ZQQ A;  3I58 A;  4QIW N;  1J7K A;  4I98 B;  4XSZ F;  2ZO4 A;  2FML A;  1JE8 A;  2YX4 A;  1HSJ A;  3S3M A;  4BU2 A;  2RNJ A;  3RPU D;  3RSN A;  2H6B A;  5IP6 A;  2QKM B;  2ID3 A;  1WJD A;  3E6M A;  4JOM A;  1R00 A;  2FOW A;  2V1N A;  2V9V A;  3O8G A;  2RDP A;  2L01 A;  3G4S I;  2CRG A;  4AU7 A;  4PJ0 C;  1B4A A;  3F8F A;  2ZME C;  4L5E A;  3F3X A;  2BZT A;  3HOX J;  1U6G A;  4CUG A;  3PFI A;  3KZY A;  1UFM A;  3SEZ A;  4LG0 B;  3LSH A;  3S1N J;  1S9H A;  3QAH A;  2OZ6 A;  1XB4 A;  1B8I A;  4BEH A;  4HPQ A;  2GXG A;  5CKT A;  1WJA A;  2PMZ N;  5EEH A;  4UHT A;  3LAJ A;  3C3W A;  2IS6 A;  5JVT A;  2JA2 A;  4A5M A;  3E6D A;  4NUB A;  1IF1 A;  1GVD A;  5J6X A;  5BMZ A;  4XOT A;  3CCY A;  1EH8 A;  2CV1 A;  2FNP A;  4XRS A;  4B3A A;  2LRE A;  2DMN A;  5DD8 A;  1FX7 A;  1A6Q A;  2ZFU A;  1TW2 A;  1O7L A;  2MA3 A;  3WG9 A;  2ZJR F;  4IHS A;  5JR3 A;  3ZQF A;  3Q0V A;  3TGN A;  1WGX A;  3K4J A;  4EGY A;  2HZT A;  2L9V A;  2CV2 A;  4MEY F;  2A05 A;  3S93 A;  3CJQ B;  2KPM A;  1LFB A;  1Z3X A;  4IOA F;  1O7F A;  4HX7 A;  1HA8 A;  1NHA A;  4ENJ A;  3T1B A;  2E2J J;  5E17 F;  4XLN F;  1LDJ A;  3FK6 A;  3S14 J;  4CYC A;  3JR9 A;  1R71 A;  5DUI A;  1YJW I;  1CQT A;  1ZHF A;  2OAZ A;  1OR7 C;  4F52 A;  3J81 K;  4RAY A;  2VL8 A;  4YII A;  4CCJ A;  1I5Z A;  4G94 A;  3KIO A;  1PVE A;  4N9I A;  3CDH A;  2EPF A;  1WJ5 A;  2R7D A;  2UXX A;  3FIW A;  3C2B A;  4KIB A;  1LVK A;  3JAM Z;  4E7L A;  2E5Z A;  3LFK A;  3NWS A;  4UVB A;  4XOP A;  4YFK F;  3L1P A;  1MJB A;  2V9P A;  3BZC A;  4IHT A;  2UXN A;  4AM3 A;  4O5V A;  1MW7 A;  1OYY A;  3PNV A;  4M9X A;  3S32 A;  5AON A;  5JLX A;  3R0J A;  5FGM A;  3BCB A;  4IPA A;  4Q5S F;  5HDN A;  4RAZ A;  1ZRC A;  1B1B A;  2Q2E A;  2FBH A;  5HS8 A;  1BJA A;  2XAJ A;  3MWM A;  2FU4 A;  3BT9 A;  2XAF A;  3KP2 A;  5CVR A;  3DPL C;  3HYI A;  2W84 A;  1G6N A;  4FTH A;  4IKF A;  2ELJ A;  2Q8K A;  3QPT A;  4BH9 A;  4E7J A;  2LKP A;  2M8G X;  5L3D A;  3E3V A;  3DBR B;  4YG2 F;  3J7Y J;  1P4X A;  3GVA A;  2CQK A;  2P0W A;  1BR2 A;  3I59 B;  1MDM B;  1I1G A;  2IGM A;  1F5T A;  2B63 J;  2OA4 A;  3IL2 A;  3L2W A;  2JT1 A;  5IT9 Z;  2PMZ A;  2X6W A;  1J59 A;  1TC3 C;  1BI2 A;  2KIU A;  5E20 A;  4CCO A;  2XAQ A;  2DA2 A;  4U7D A;  2Y9Y A;  3UKG A;  1SAU A;  2CV0 A;  3QQA A;  4DNC A;  4BS9 A;  4BGD A;  3IWZ A;  1LE8 A;  5E8G A;  3ZQ7 A;  3E6C C;  2RVC A;  1X1C A;  2HDW A;  3EYI A;  2RGV A;  4PZJ A;  1S7A A;  2VKV A;  4F55 A;  2FF4 A;  1SC7 A;  1WKM A;  3BTJ A;  3VOD A;  4IHY A;  3QOP A;  3PJR A;  1X2N A;  4IF4 A;  2O7O A;  1ZRE A;  2DMT A;  1DQU A;  1QBJ A;  3HIF A;  1AHD P;  2VQH A;  3V7R A;  3LQR A;  4YEJ A;  2LNB A;  2L9S A;  5BPD A;  1VQM I;  3L00 A;  2GZW A;  4Y4R A;  1TWH J;  1MMA A;  3TOB A;  2W1O A;  3TKY A;  2KDZ A;  2UZK A;  2HVR A;  4EVI A;  2HEO A;  1T08 B;  1I39 A;  5LGN A;  2FMY A;  2V79 A;  4XNF A;  3HOV J;  3FWE A;  4LOC A;  1Z77 A;  3FM3 A;  3RZD J;  1JKP C;  3J7Z I;  4GDF A;  5CQG A;  4KMF A;  4XID A;  5F27 A;  2XKP A;  1YRN A;  5EDN A;  1JTY A;  2E2I J;  1AWC A;  2J5P A;  3F72 A;  1YX5 A;  1BC7 C;  5EF6 A;  1F4K A;  2F5F A;  4ENM A;  3K7A J;  3OR2 C;  1Y8R B;  1UB9 A;  1VQP I;  1D8J A;  3ASO H;  5IYD J;  5FD5 A;  2PLY A;  3LOC A;  4JX4 A;  3AL0 B;  4CA0 A;  4EM2 A;  2MH9 A;  2RKH A;  5EG0 B;  2FQ3 A;  5BS6 A;  1X1P A;  1YW9 A;  2IP2 A;  3EET A;  1XCV A;  4E7Z A;  2PQ8 A;  4UY8 I;  1SD4 A;  1TP4 A;  4HW0 A;  2WAE A;  4DQ2 A;  4UUT A;  3S15 J;  2K9Q A;  1J5Y A;  5DV5 A;  1U3E M;  2Y2Z A;  5ILU A;  3HB9 A;  4L0Y B;  5M3M J;  3FMR A;  2OCE A;  1Q1V A;  4IVN A;  2QBY A;  2RRE A;  4KUM A;  3WTW C;  3FM5 A;  2BY2 A;  3A01 B;  2IT0 A;  2DK8 A;  4KIC A;  4UVA A;  2VT3 A;  3LSI A;  2O6G E;  4RBO A;  3MKZ A;  1W36 C;  4B09 A;  1MMD A;  3CLQ A;  1HKT A;  1BOA A;  3FMQ A;  1OKR A;  1YIO A;  1BR1 A;  2LBF B;  1CF7 A;  1ETO A;  3ROU A;  5LHH A;  3MZH A;  4EMS A;  2PI0 A;  4A3G J;  3GFJ A;  2QVO A;  3I56 I;  1SAN A;  4F3Q A;  3CD6 I;  3RQI A;  3H1C A;  1JI8 A;  2XAG A;  2VOO A;  1LVA A;  3KZZ A;  1SFO J;  3Q5F A;  2YR2 A;  1P2F A;  3RYP A;  1T56 A;  3G3Z A;  2XDV A;  3H5A A;  5KAI C;  2ZXI A;  3GTL J;  3H92 A;  3OSF A;  2KRC A;  5K5Q A;  2XRN A;  4LFU A;  4E7I A;  3WTZ A;  4P9U A;  1X4P A;  1YW7 A;  4YIR X;  3ABT A;  2Z2S B;  1FTZ A;  4DZP A;  3JRA A;  3P9C A;  5F64 A;  2DO7 A;  3N97 A;  3DEE A;  3B73 A;  3HM5 A;  4ZYH A;  2BW3 B;  3HTS B;  3L2Q A;  5EJC A;  4OWR B;  2M87 A;  3OS0 A;  3EUA A;  1IV8 A;  1ORK A;  4YFX F;  3A01 A;  5FD6 A;  3CJT B;  2XGX A;  1U5T C;  2KIS A;  2D2W A;  2EH3 A;  1Z05 A;  4OIR F;  2R92 J;  3IH2 A;  2CFO A;  3CDL A;  2ZME B;  1LNW A;  4B4C A;  4FX4 A;  3H9Q A;  4BQQ A;  1ETK A;  2M2E A;  2VBW A;  3S17 J;  4BJ6 C;  4A69 C;  2OUM A;  4CCK A;  3OR1 C;  3LL7 A;  2QSF X;  2L54 A;  2DQR A;  1RC9 A;  5D6E A;  4E4H A;  2DYR H;  2NVX J;  1ZQ3 P;  2N8G A;  3J81 Z;  2FBI A;  2W48 A;  2DLL A;  3JCU C;  3CCS I;  4XLP F;  3Q9S A;  3ESW B;  3DBH B;  2YU9 J;  2DFF A;  2NVY J;  1FYM A;  2KLO A;  1D3Y A;  4YIF A;  3NRV A;  4NNJ A;  2DPU A;  1FSH A;  2MLK A;  2W57 A;  3ZMZ A;  2E60 A;  3BR5 A;  1Y0N A;  3FXJ A;  3WTX C;  1Z0X A;  3SEQ A;  2WV1 A;  3IP4 B;  4Z6Y A;  2BBY A;  3RTR A;  1T38 A;  2VB6 A;  4O6J A;  1N25 A;  4JX6 A;  1IN5 A;  5HS7 A;  3W3C A;  2HOS A;  4ESJ A;  1ERD A;  3EQL F;  4U87 A;  4KA4 A;  3MN2 A;  2KL4 A;  5ICC A;  2AXL A;  2ISY A;  4LG3 A;  2XHK A;  1JJ6 C;  4M9S A;  4ON0 A;  4XRS G;  4IHX A;  2KFD A;  3Q0U A;  3V8J A;  3ZQG A;  3ZMV A;  4RLQ A;  3FHN A;  1I27 A;  1R4N B;  2M8E A;  2IXS A;  2W00 A;  1HOM A;  3U21 A;  3T5X A;  5HDG A;  2K27 A;  5J3L A;  3Q9V A;  2E7W A;  1B6A A;  4E7K A;  3GYH X;  1TLH B;  4A6D A;  3HHG A;  5HLH A;  3AFH A;  5H2F C;  1BL0 A;  2Z16 A;  5DCM A;  3D1N I;  2CU7 A;  3RDI A;  1SD7 A;  2AHQ A;  1RR7 A;  3ABK H;  4BJT A;  2X9D A;  4FT8 A;  3FXM A;  2V7F A;  1PP8 F;  2WWY A;  4PJN A;  4DIQ A;  2L5Q A;  4HV5 A;  1XDU A;  2FSW A;  3OL3 A;  4M9Z A;  3N05 A;  4GCV A;  4NBQ A;  1SAX A;  5J1R A;  3JW4 A;  2Y31 A;  1FC3 A;  2KKO A;  5FFX A;  4AYB N;  3ULQ B;  2WC2 A;  5IP7 J;  2DU9 A;  2G7H A;  1AOY A;  4QPQ A;  3T8T A;  1MZB A;  3P5J A;  1YE9 A;  1E3H A;  3GEZ A;  4FQG A;  4BYY A;  4A3M J;  2OU2 A;  2PEX A;  2ACJ A;  2O8K A;  1O3Q A;  1BM9 A;  5GAD J;  1JXS A;  3L2V A;  4S05 A;  3OL4 A;  1JJ8 C;  1JUM A;  4M3E A;  1YIT I;  2IRF G;  2WY7 Q;  1UHW A;  2UV1 A;  2ZBK A;  4Y33 A;  1XGM A;  1P4A A;  3S1M J;  1JGS A;  4KJZ A;  3ZGK A;  1WJE A;  4PFP A;  1FYL A;  3CME I;  2HDC A;  1O57 A;  1MBG A;  3FXK A;  1AKH B;  2E1C A;  1HW1 A;  4A3C J;  4HX8 A;  5GTH C;  2VBY A;  3TDU C;  2DW4 A;  2CQ7 A;  5K5O A;  2VBX A;  3VOE A;  3CMM A;  4YEL A;  2ZSI B;  1U78 A;  3L7W A;  2GLO A;  2GIZ A;  3KPH A;  5ILS A;  2L7Z A;  1VQ7 I;  2FD5 A;  1ZAR A;  2K85 A;  2WB1 N;  4A0Y A;  1YYV A;  2EA2 A;  3H0G J;  3AAF A;  1C0W A;  3PSF A;  2ZXJ A;  4PDK A;  2VXD A;  1YG2 A;  2ETH A;  3GFL A;  1QU3 A;  1RET A;  1I3A A;  5L3B A;  3I9V 2;  4PSW A;  4PUS A;  1E2X A;  2NS7 A;  1HDP A;  2M45 A;  3BR3 A;  2EIL H;  5IOZ A;  4ZDO A;  5K7H A;  1ZN2 A;  5K1Y A;  4A3D J;  3DU5 A;  4DZJ A;  3CJR B;  3COA C;  1K78 B;  3BR6 A;  1ETW A;  1IXR C;  1RNL A;  1O4X A;  5DCF A;  2M30 A;  4L18 B;  4BNC A;  2P6T A;  3H35 A;  3S3N A;  1WZ2 A;  3VB2 A;  2VPL A;  4E7H A;  4FIS A;  4KDP A;  4LK0 F;  1E17 A;  1D8K A;  3SYT A;  3GUD A;  2HTS A;  1KQ8 A;  2WA0 A;  1TWG J;  2EFN A;  1Y0U A;  5F04 A;  5B5E C;  2PJR A;  4RS8 A;  3W6J B;  1Y8Q B;  1TW3 A;  3DPU A;  4WWC A;  2QLZ A;  1AA7 A;  1F36 A;  1SVM A;  2ESN A;  1KU3 A;  3EUH C;  5B1B H;  1U8R A;  1J9I A;  2DBB A;  2HNH A;  3K4M A;  5TJJ A;  3GBG A;  5D4S A;  1RI7 A;  4UUS B;  3MEX A;  1PUF A;  1TNS A;  3LA2 A;  1ZEL A;  4AYB A;  4BXU A;  2XUB A;  3JRD A;  2KRF A;  3M8F A;  2Y75 A;  9ANT A;  3KP7 A;  5TGT A;  2FXA A;  4WXC A;  4HBL A;  2I10 A;  3CCQ I;  2LRD A;  3IH4 A;  2A6T A;  5IYB J;  3BG3 A;  3P9I A;  3T8R A;  4E70 A;  1OCP A;  2ME0 A;  4OIN F;  3J80 Z;  2DJN A;  1Y1W J;  3OY9 A;  2JVH A;  2A07 F;  2O61 A;  2A68 F;  4OAY A;  4U7B A;  2E1M C;  1MIJ A;  2VON A;  4Y13 A;  5CLS A;  1W0U A;  4XLE A;  1LDD A;  2D5V A;  2K7L A;  3OYH A;  4D5C A;  2R7U A;  2K02 A;  3GFM A;  3KZI C;  1KQ0 A;  2B0L A;  4HNT A;  3WGH A;  1IRZ A;  1ZG3 A;  4IRH A;  5HLI A;  5CYV A;  3MCZ A;  1ZGJ A;  3RKY A;  2DA5 A;  4XRM A;  1W7P D;  3IH3 A;  4M6X A;  1UCR A;  2F6C A;  2L2O A;  1YJN I;  1IXC A;  3BC8 A;  1ON2 A;  2EFP A;  2HOA A;  3OYE A;  5KHD A;  2ME6 A;  3LSM A;  2TDX A;  4CXF A;  1BJZ A;  3LMM A;  3PUB A;  3R0A A;  3OYC A;  4LB6 B;  1BI0 A;  3CCL I;  3KLN A;  2GA2 A;  4CCN A;  2HWV A;  2P4W A;  3RI4 A;  1FNN A;  4Y17 A;  1K79 A;  5FO5 A;  3ZN0 A;  3CCU I;  4C9Y A;  1T0F A;  1W7P B;  2VLA A;  2MD0 A;  4JBA A;  5FKK A;  3SZP A;  3H3V K;  2DJI A;  1EV7 A;  3OYM A;  3MFK A;  1MD0 A;  2YU3 A;  4IQJ A;  4QLC U;  1BW5 A;  3V42 A;  4A2U A;  4BHP A;  3WTU C;  1HW5 A;  3DWL E;  1WH5 A;  3SFI A;  1U5T B;  2HQA A;  4RM3 A;  2CUF A;  3EYY A;  1ETV A;  5FKO A;  1EA3 A;  3K10 A;  4GO1 A;  2QKL B;  2EBI A;  2CSO A;  1DP7 P;  2FEZ A;  2NNN A;  3HDD A;  4ZZD A;  3KEQ A;  3U1D A;  2E5N A;  1HC8 A;  5H6Q A;  2EIJ H;  4XN3 A;  1KYZ A;  1MSE C;  2R93 J;  2V1U A;  2ZJQ F;  2MW8 A;  1YS7 A;  2ZXW H;  2EJR A;  2JZY A;  3TED A;  1MGT A;  2ZKZ A;  4LIU A;  2F2E A;  2L7K A;  2MFZ A;  3FKI J;  3QYB A;  1S6L A;  4I6Z A;  1MMS A;  1BW6 A;  4CO8 A;  2ZSH B;  4ABZ A;  3G71 I;  1VQ8 I;  2A61 A;  2DTZ A;  4HAM A;  4HV6 A;  4M72 A;  3KP4 A;  1EJ9 A;  3QP6 A;  2H1K A;  3H5R A;  4R8H A;  1OLT A;  2KDO A;  1X58 A;  3H0D A;  1TT0 A;  4XKB A;  5HDK A;  4XM3 A;  4CH7 A;  2IPQ X;  3FZV A;  4IQ4 A;  3PO2 J;  4BDY A;  1GXQ A;  5D5V B;  3CO7 C;  4BE2 A;  2Z5U A;  3ZCO A;  2P5L C;  2BVL A;  1P7J A;  2AQE A;  2HXI A;  3CJN A;  4AUX A;  3VYS B;  4DBR A;  3V4G A;  3F22 A;  3HBL A;  4PGH A;  5BQT A;  1BI1 A;  4HNV A;  1MSF C;  3JRE A;  1MBK A;  1YLF A;  2BHZ A;  3I55 I;  3OYK A;  4NHJ A;  1V3F A;  3ABL H;  5E1W A;  2VAS A;  3WU2 C;  2HVQ A;  3BPX A;  1Z91 A;  5F0H A;  3D0S A;  2NNY A;  1KU7 A;  5JI6 A;  2YX7 A;  2EFO A;  2K9S A;  5EZG A;  5ED4 A;  1R49 A;  3IKT A;  3TBI A;  4AC0 A;  1JT6 A;  2QM3 A;  1LB2 A;  4F7Z A;  1RR8 C;  1Z6T A;  4LG0 A;  1XCB A;  3TOA A;  3HSF A;  1KA8 A;  3V7S A;  4PGG A;  2DPD A;  2IW5 A;  1GT0 C;  1QZE A;  2O8X A;  3OYJ A;  4W97 A;  4NDL A;  3WE2 A;  3LA3 A;  4EJO A;  2NOG A;  1W5T A;  5LEJ A;  2IS2 A;  4IO9 F;  1ACI A;  4HLY A;  1NG7 A;  1RES A;  5E18 F;  2Q0O A;  1RZ4 A;  1R1V A;  1Q1H A;  3W6K B;  2ECC A;  3HSR A;  3U2R A;  3LFU A;  3OIQ A;  1U9N A;  4M71 A;  5FLM J;  4FCY A;  2HYJ A;  1D5V A;  2GAU A;  1SD5 A;  4H0E A;  4HA8 A;  3CMY A;  4S0H B;  3U9G A;  3DTE A;  1L0O C;  2DT6 A;  4WXH A;  2IA1 A;  1X3W B;  2R7V A;  2ECB A;  2QQB A;  3HEF A;  1OPC A;  3BR1 A;  4WF2 A;  3I71 A;  5EEA A;  3BG6 A;  4HX4 A;  5C3E J;  1WFX A;  1K4T A;  4ENN A;  4BAY A;  4B48 A;  1STZ A;  3LWF A;  4JP0 A;  3QRF F;  3WG7 H;  2GWR A;  2FE3 A;  2LD5 A;  3BZ6 A;  4LMY A;  2W7N A;  1IRF A;  2PMH A;  2R5Y B;  4G8X A;  3N4M A;  3PM1 A;  4EJW A;  2F5E A;  2M7B A;  2FRH A;  4CGZ A;  3M3Y J;  1BIA A;  1J09 A;  3PFY A;  2KJC A;  4B47 A;  4LIV A;  1UHS A;  1K7A A;  3TO6 A;  1EF4 A;  2M9H A;  2HPM A;  2HVS A;  2ADU A;  1FSE A;  1REP C;  5DM6 F;  1IRG A;  1ZG5 A;  4JYK A;  1XG1 A;  1G3Y A;  3CC2 I;  1FOY A;  5E3M A;  1DU0 A;  4IL6 C;  1MMN A;  3DKW A;  2R7F A;  3E97 A;  3HRM A;  2IAI A;  3O6B B;  3E0J B;  4ESB A;  2R7W A;  2R0Q C;  5M5X J;  4X0G A;  2LH9 A;  3GZN B;  2EZL A;  1X1D A;  3D5L A;  3JSO A;  1OQY A;  2MH2 A;  3FIS A;  4XR6 A;  2L7F P;  3VYT B;  2HU9 A;  2B9S A;  4BAC A;  4XKW A;  3OYG A;  4NQW B;  5FRN A;  3BTC A;  1HBX G;  2CW0 F;  2Y30 A;  3O3K A;  3CCV I;  4AIJ A;  1BI3 A;  2EA4 A;  2IGK A;  5GTI C;  5D8L B;  2JMW A;  3DKX A;  2XRL A;  3JRF A;  1QA6 A;  1GUU A;  3BTL A;  3K70 D;  3QPL A;  4HF1 A;  2XVC A;  4L9J A;  1IN4 A;  2O0Y A;  2D1V A;  1IXS B;  1XGS A;  2QSH X;  2OTJ I;  1DGR M;  3H9J A;  4EQQ A;  2LKX A;  1SFX A;  3TP3 A;  4A3I J;  1MDM A;  3I59 A;  1PYV A;  3I0T A;  3GO5 A;  3MAJ A;  1RUO A;  3IC7 A;  1MJA A;  3ZQL A;  2KRH A;  2M1B A;  2P7C B;  4A93 J;  3WTS C;  1PUE E;  2DAO A;  3S8P A;  1USS A;  5J1U A;  5A2Q K;  2X6X A;  4WX9 A;  1GV2 A;  1U9O A;  2R7T A;  5F1J A;  2OQG A;  5IT3 A;  1VQ5 I;  2EWN A;  1N78 A;  1JTX A;  3OYI A;  1FMW A;  3J7A Y;  1YFH A;  1R23 A;  4UVC A;  3A4C A;  3S16 J;  2IBD A;  4J00 A;  1R58 A;  2PN6 A;  4UNO A;  4UXN A;  3M7G A;  1IO2 A;  2DQL A;  2V1D A;  3MVP A;  1FOW A;  3A2K A;  2VE9 A;  3FK7 A;  2P5V A;  2ESH A;  2MD5 A;  2MBF A;  4G7Z F;  3JRB A;  1NG6 A;  1K6Y A;  1V54 H;  3H5N A;  2AXT C;  2E1M B;  5E3O A;  1Y6I A;  3H3Z A;  4RAG A;  4I7H A;  3FBN B;  4M3F A;  4A3J J;  3GTM J;  4WK8 F;  2NYX A;  4MTD A;  2K5C A;  5DDG A;  2X51 A;  1ZGW A;  4B44 A;  2RN7 A;  2ZXH A;  1XSD A;  2CQN A;  4AVZ A;  4I76 A;  1QHG A;  1GV5 A;  2BY1 A;  3CUQ B;  1OJL A;  4U0Y A;  3KFW X;  3GTO J;  1JT0 A;  2CFX A;  2XPW A;  5LFA A;  2Y0M A;  5ICE A;  2MLG A;  2X48 A;  4XLH A;  4LB5 A;  3HUG B;  2V1X A;  4BUP A;  4JK1 X;  5ICF A;  1OCC H;  1LUJ B;  3DLL F;  1XPX A;  1UAA A;  4L9V A;  1YS6 A;  3C2G A;  1XD7 A;  2XAU A;  1XC5 A;  5KAF C;  1T8I A;  5J4Y A;  1A04 A;  2H1L A;  3GTG J;  1D0X A;  5EG0 A;  3I4P A;  4MIM A;  4CSW A;  2LF7 A;  2QF7 A;  2DXI A;  5LHG A;  3PSI A;  1ZGA A;  2KZG A;  4MHG A;  3M4O J;  2ID6 A;  1HF0 A;  3IHU A;  5HVQ C;  5EYR A;  1YJ9 I;  5D5W B;  3SFZ A;  1SD6 A;  2QUF A;  2LY9 A;  1SVO A;  5ILV A;  1IZ1 A;  4BQA A;  3GCM A;  1IDY A;  3ZQI A;  1JHH A;  1V5G A;  2WAQ A;  5HLG A;  3ZN1 A;  2DOF A;  4HG2 A;  2G9W A;  3OYD A;  1ENH A;  2RAE A;  5J4V A;  2VQL A;  3FXR A;  2R7O A;  3OIO A;  1FYK A;  4BBR J;  1WRJ A;  3S3O A;  2GXA A;  3HOZ J;  1MMG A;  2KT0 A;  2L9N A;  4CZZ A;  4R79 A;  1LQ1 A;  1U0J A;  4M3B A;  4G7O F;  3ZMT A;  2OTL I;  2ELH A;  1UMQ A;  4A5N A;  2VKD A;  5FKM A;  3S1R J;  2VJJ A;  4UB8 C;  4KFC A;  2K86 A;  1APL C;  4LK1 F;  2LSO A;  1LEA A;  2NS0 A;  2KIF A;  5E3L A;  4DYQ A;  1B9M A;  1IN7 A;  2BHY A;  3HHH A;  5J40 A;  3ZOB A;  1X19 A;  1AU7 A;  2LBF A;  2K3F A;  2XAH A;  2HXO A;  3ABM H;  5LGT A;  3DCF A;  1JUS A;  2YUS A;  4G6D A;  3OYL A;  2HKX A;  3BWG A;  3C18 A;  5H20 A;  5DYM A;  2JSC A;  1HDD C;  1Z7U A;  1VI0 A;  2VQC A;  3K4N A;  2BGC A;  2XRO A;  4KIT B;  3FHZ A;  3L2R A;  2M0C A;  4LLG F;  3CTA A;  1DUX C;  2JSP A;  2XV4 S;  5TRD A;  4EJT A;  3ZQC A;  3S2D J;  1KU2 A;  3I4N J;  1TQM A;  3ZXS A;  2A6H F;  3CC4 I;  2AQF A;  4ENK A;  1PP7 U;  2LP0 A;  4D9J A;  3MMY B;  3BCA A;  1K4S A;  5GPA A;  2DT7 B;  2VOP A;  4FET A;  1ULY A;  2BW3 A;  2NOJ B;  3HZJ A;  1MKM A;  2X0L A;  1R9T J;  3MKW B;  2Q1Z B;  2DI3 A;  3EPZ A;  1B72 B;  3BQZ A;  1XMX A;  2O03 A;  1HXD A;  3V7C A;  5DM7 F;  3OSG A;  5KVR A;  3L2C A;  1HCR A;  2CQQ A;  2DA6 A;  2DDA A;  4BL0 B;  3CMA I;  2JPC A;  2HYG D;  2XB0 X;  4Q47 A;  2GOX B;  2ZME A;  4C2U A;  2P6S A;  3EDP A;  4XON A;  2KJB A;  4HQE A;  2BV6 A;  1POG A;  1R1T A;  2EIN H;  4BBS J;  1VF9 A;  2H09 A;  2ZCW A;  2DA7 A;  3OOU A;  4N4N B;  4BQN A;  3B6C A;  2XPV A;  3ML6 A;  2DT5 A;  4ZJZ A;  2CWE A;  3I5U A;  3BDD A;  1K61 A;  2QQ8 A;  2M7A A;  3WTY C;  1SEU A;  2HS5 A;  2AS5 F;  2F5D A;  4C3I J;  2PX9 A;  3MZ8 A;  1J2X A;  3JTH A;  4G9Y A;  2GIV A;  2FUG 2;  1WJF A;  1DU6 A;  1FZP B;  1I6X A;  4HZF A;  4PJJ A;  6PAX A;  4L9T A;  5DUK A;  5BOX A;  1ETX A;  3DPT A;  3OYA A;  1LDK B;  3PIO F;  1PJR A;  2K9M A;  2FJ1 A;  1A6I A;  1MBH A;  1SFK A;  1F1Z A;  3OYN A;  1QRY A;  2H8W A;  1MBF A;  3JRI A;  4NC7 A;  3RYR A;  2VJI A;  3GFI A;  3G73 A;  4BQO A;  2JA6 J;  4XQF A;  2FX0 A;  3F23 A;  4AIK A;  4BY1 J;  3CLO A;  2XGD A;  3BG9 A;  2RNG A;  2EQR A;  2WTE A;  5LGU A;  4PCQ A;  3SDG A;  2CJJ A;  1FBQ A;  3K69 A;  1B72 A;  3FXU A;  5HS9 A;  4A3F J;  2W24 A;  2COB A;  2E1O A;  1MBJ A;  2EFQ A;  2JK3 A;  1Z9C A;  2JUC A;  3SDB A;  2OV7 A;  1VZ0 A;  1UZC A;  2QZ8 A;  1O3T A;  2STT A;  1NK3 P;  2X6O A;  5DS9 A;  3GTK J;  5IPA A;  3ZQH A;  5J47 A;  5K7Z A;  2COM A;  3GME A;  1E3P A;  4I99 C;  2EV6 A;  2M34 A;  5D5U B;  2QGU A;  2BY3 A;  1OR7 A;  3DU6 A;  4U0W A;  3P9K A;  4JX5 A;  4D7N A;  3REO A;  3NAR A; 
#chains in the Genus database with same CATH homology
 3BTI A;  1T33 A;  4DYC A;  2M8G X;  2LR8 A;  5FKK A;  4EEF G;  3NAU A;  3TP0 A;  5HOD A;  4FE7 A;  3H3V K;  4QTR A;  2DMQ A;  3TW7 A;  2B63 J;  1BW5 A;  1QVU A;  1OCT C;  1TC3 C;  1WH5 A;  5C44 J;  2DA2 A;  2Y9Y A;  1X2M A;  3SFI A;  3UKG A;  3QQA A;  3PO3 J;  2CUF A;  2VI6 A;  1ETV A;  5FKO A;  1LE8 A;  2EBI A;  3HGG A;  3HDD A;  5K7F A;  3S1Q J;  1IGN A;  1MSE C;  2VKV A;  3DEW A;  2R93 J;  3BTJ A;  2MW8 A;  4IHY A;  3TED A;  1FIP A;  2XGC A;  1X2N A;  5BNG A;  4D7M A;  2E2H J;  2O7O A;  2DMT A;  3FKI J;  4G12 A;  4I6Z A;  3S2H J;  1MH4 A;  1AHD P;  1BW6 A;  1ITY A;  1JKR C;  1ZTR A;  4ABZ A;  1RKW A;  2DTZ A;  1E3O C;  5EGO B;  3JRG A;  1AKH A;  1TWH J;  2H1K A;  2DA1 A;  3F0C A;  2CQX A;  3G1O A;  2KDZ A;  1X58 A;  2NVQ J;  3PO2 J;  3LSG A;  2JN6 A;  3HOV J;  4LOC A;  1Z77 A;  1IJW C;  1P7J A;  3RZD J;  2HXI A;  4AUX A;  1JKP C;  1WI3 A;  3CQZ J;  1IDZ A;  3HBL A;  2EZH A;  1Y1V J;  4XID A;  4HNV A;  1GDT A;  1MSF C;  5F27 A;  3JRE A;  4X6A J;  1YRN A;  4A3K J;  2O9L A;  5IYC J;  1IUF A;  5EDN A;  1MBK A;  1JTY A;  2E2I J;  5EF6 A;  5F0H A;  4X1E A;  4FE4 A;  1NTC A;  2K9S A;  3K7A J;  5EZG A;  1U8B A;  5IYD J;  1UG2 A;  2K9N A;  4MFE A;  2NS8 A;  4AC0 A;  3LOC A;  1JT6 A;  4JX4 A;  1ETQ A;  2P81 A;  3BQY A;  5EG0 B;  1I3Q J;  1GT0 C;  3IV5 A;  3I4M J;  4W97 A;  4NDL A;  3LNQ A;  2NOG A;  3WHB A;  4DW6 A;  4UUT A;  3S15 J;  1W0T A;  1RES A;  2K9Q A;  2K40 A;  2L9R A;  2MGQ A;  2Y2Z A;  4GFB A;  2ECC A;  3HB9 A;  1D5Y A;  2ZB9 A;  1U9N A;  5FLM J;  4C2M J;  5M3M J;  2HYJ A;  4FCY A;  1Q1V A;  4BKX A;  3O8H A;  3CMY A;  4S0H B;  5IP9 J;  2H8R A;  2L0K A;  3A01 B;  2ECB A;  4IEJ A;  3HEF A;  4UUS A;  3BR1 A;  3HKZ N;  2ELK A;  4RBO A;  1WPK A;  1A5J A;  5EEA A;  5C3E J;  5EZH A;  2LK2 A;  2Y9Z A;  5F0F A;  4J19 A;  1I50 J;  4JP0 A;  4M3G A;  1WCM J;  1ETO A;  3HOW J;  2LD5 A;  2DA3 A;  1I6H J;  1S7E A;  4A3G J;  3E7L A;  5C4X J;  2R5Y B;  1SAN A;  3PM1 A;  3RQI A;  2QCO A;  4W1U A;  1SFO J;  1H88 C;  3B6A A;  3M3Y J;  1T56 A;  2G0E A;  1RPW A;  3LSR A;  1B8I B;  4MO7 A;  4V2F A;  1UHS A;  4IHV A;  2JJ7 A;  2M9H A;  1EF4 A;  3GTL J;  3G1M A;  2GM4 A;  3OSF A;  4IHW A;  4A3B J;  2HQ5 A;  1IG7 A;  4JYK A;  1XG1 A;  5E3M A;  1DU0 A;  1FTZ A;  4DZP A;  3JRA A;  2NVT J;  4A3E J;  2XPU A;  2IAI A;  5GP9 A;  3HGY A;  2R0Q C;  3HM5 A;  5M5X J;  2EZL A;  1ZR4 A;  3BR0 A;  5E3N A;  4A3L J;  1ORK A;  3FIS A;  2VPR A;  3A01 A;  3A03 A;  3SJM A;  2L7F P;  2EH3 A;  3QPS A;  2R92 J;  3BTC A;  2L7M P;  3IH2 A;  3RZO J;  3CDL A;  2Y30 A;  4Y52 J;  5M5W J;  4B4C A;  1PUF B;  2JMW A;  1ETK A;  2JWT A;  2M2E A;  2XRL A;  3JRF A;  1GUU A;  3S17 J;  3BTL A;  4A69 C;  4C3H J;  4DYR A;  5FKL A;  3QPL A;  5J1Y A;  2NVX J;  1RKT A;  2TRT A;  1ZQ3 P;  2LKX A;  2N8G A;  3TP3 A;  4A3I J;  1JKQ C;  5M5Y J;  2LVS A;  2W48 A;  3Q0W A;  3GTJ J;  1MBE A;  4CYC B;  3A02 A;  2YU9 J;  2NVY J;  2LTP A;  3ZQL A;  2OPT A;  2AO9 A;  4A93 J;  2YS9 A;  3JRH A;  5J1U A;  2HOT A;  1H89 C;  1MH3 A;  1GV2 A;  1U9O A;  3BR5 A;  4MFD A;  5F1J A;  5IOY A;  4BXX J;  1F43 A;  1MNM C;  1Z0X A;  1FEX A;  2WV1 A;  3BG5 A;  1QPI A;  1ZK8 A;  1JTX A;  3TW6 A;  4BY7 J;  4JX6 A;  2E19 A;  4Y7N J;  2HOS A;  3S16 J;  2IBD A;  4D5F A;  1K83 J;  3MN2 A;  2XSD C;  5GPC A;  1JJ6 C;  5JLW A;  5FLV A;  3MVP A;  1ZKG A;  3HOU J;  3Q3S A;  3FK7 A;  4XRS G;  4IHX A;  3Q0U A;  3ZQG A;  1H8A C;  3RKQ A;  1IC8 A;  1FJL A;  2TCT A;  1HOM A;  3JRB A;  5EGO A;  5E3O A;  1OFC X;  2R5Z B;  5J3L A;  1QVT A;  1G2H A;  3G1L A;  4M3F A;  4A3J J;  3GTM J;  1BL0 A;  3D1N I;  1ZGW A;  2CU7 A;  1XS9 A;  2AHQ A;  1RR7 A;  2OF7 A;  2JA5 J;  2X9D A;  4I76 A;  1GV5 A;  1OJL A;  3GTO J;  3W6V A;  1JT0 A;  2XPW A;  1TWA J;  4V2G A;  2X48 A;  1NK2 P;  5J1R A;  1VFC A;  3K2A A;  2FQ4 A;  2Y31 A;  4AYB N;  5IP7 J;  1LE8 B;  2XGE A;  4A3M J;  1XC5 A;  2O8K A;  3GTG J;  2R7Z J;  5EG0 A;  2LLK A;  4MIM A;  1JJ8 C;  1JUM A;  2QF7 A;  4M3E A;  5F08 A;  3LSP A;  3M4O J;  2ID6 A;  1HF0 A;  5DTD A;  2LFB A;  5EYR A;  1ETY A;  3GTQ J;  2DA4 A;  1HLV A;  3S1M J;  2LY9 A;  3JRC A;  2GBY A;  2R5Z A;  3VPR A;  1IDY A;  3ZQI A;  2VUM J;  1MBG A;  4A3C J;  1AKH B;  1ENH A;  2RAE A;  4C3J J;  1WH7 A;  1ZR2 A;  2DMP A;  3OIO A;  1FIA A;  3HOY J;  4BBR J;  2HDD A;  3HOZ J;  4MLO A;  2KT0 A;  1U78 A;  4M3B A;  2DMU A;  2GLO A;  4QIW N;  2L7Z A;  1LFU P;  1UMQ A;  2FD5 A;  1JGG A;  1TWC J;  2WB1 N;  5FKM A;  3S1R J;  3H0G J;  1APL C;  1YRN B;  5E3L A;  4DYQ A;  5IP6 A;  1RET A;  2DN0 A;  2ID3 A;  2EZI A;  3ZOB A;  1AU7 A;  4M3D A;  2HXO A;  3O8G A;  3DCF A;  1JUS A;  5FKN A;  4XIC A;  2YUS A;  2NS7 A;  1HDP A;  2CRG A;  2IEK A;  3BR3 A;  2WAQ N;  3LSJ A;  4QSH A;  5C4J J;  5IOZ A;  1P7I A;  5K7H A;  2R5Y A;  1HDD C;  2CUE A;  4A3D J;  4DZJ A;  1TWF J;  1VI0 A;  4L5E A;  3BR6 A;  1ETW A;  4B1R A;  3HOX J;  1O4X A;  3MKL A;  2JA8 J;  4M6V A;  2M0C A;  3S1N J;  1B8I A;  3S2D J;  3ZQC A;  2MSY A;  2JA7 J;  3I4N J;  4FIS A;  2PMZ N;  3GTP J;  4XK4 A;  2LP0 A;  1TWG J;  5F04 A;  5GPA A;  1GVD A;  2MG4 A;  3CCY A;  1R9T J;  1F36 A;  4XRS A;  4B3A A;  1B72 B;  2DMN A;  3BQZ A;  3OSG A;  3ZQF A;  3Q0V A;  3GBG A;  1HCR A;  2CQQ A;  2DA6 A;  5F0C A;  4RDU A;  1WGX A;  2XB0 X;  4UUS B;  1IV6 A;  4BBS J;  1PUF A;  1POG A;  1JUP A;  1VF9 A;  2DA7 A;  3OOU A;  3B6C A;  2XPV A;  3JRD A;  1LFB A;  9ANT A;  1K61 A;  2I10 A;  1JKO C;  3IH4 A;  4C3I J;  5IYB J;  2XB5 A;  3BG3 A;  2E2J J;  1OCP A;  2ME0 A;  1DU6 A;  3S14 J;  3FK6 A;  4CYC A;  3JR9 A;  1CQT A;  2DJN A;  1Y1W J;  2HI3 A;  1ETX A;  2FJ1 A;  1A6I A;  1MBH A;  1QRY A;  3BR2 A;  3WHC A;  3JRI A;  1MBF A;  1W0U A;  2D5V A;  3FIW A;  3C2B A;  4D5C A;  2JA6 J;  2FX0 A;  4BY1 J;  3L1P A;  1VND A;  2XGD A;  3BG9 A;  2EQR A;  1IRZ A;  3SDG A;  2CJJ A;  2DA5 A;  1B72 A;  4XRM A;  4A3F J;  2COB A;  2E1O A;  1MBJ A;  3IH3 A;  5JLX A;  2JK3 A;  2VKE A;  1NK3 P;  2X6O A;  5DS9 A;  2HOA A;  5IPA A;  2EZK A;  3GTK J;  3ZQH A;  2Y0S N;  5K7Z A;  1FTT A;  2ME6 A;  3BT9 A;  5FJ8 J;  1BJZ A;  2M34 A;  4FTH A;  4JX5 A;  4D7N A;  5M3F J;  3NAR A;  1BA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...