1GV2A

Crystal structure of c-myb r2r3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
102
Chain Sequence
b'ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Crystal Structure of C-Myb DNA-Binding Domain: Specific Na+ Binding and Correlation with NMR Structure
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 32
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv2A01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv2A02
4IHVA 2X6OA 3BR1A 1IC8A 1Y1WJ 1U78A 1E3OC 1FTTA 5EEAA 2O7OA 3K7AJ 5GPCA 2H1KA 5E3NA 1R9TJ 2QF7A 5E3OA 4X6AJ 4BY1J 5FKNA 3LNQA 3O8GA 1XG1A 1IDYA 1PUFA 2NVQJ 3DCFA 2DJNA 2MW8A 4BBSJ 3G1MA 2LFBA 2W48A 4A3EJ 2DA5A 1BW5A 4AC0A 3TP3A 3CDLA 3BR0A 1H88C 3HOZJ 1B8IB 1HF0A 2L9RA 4RBOA 4XRSG 2DMUA 3ZQGA 1AHDP 2CUFA 1CQTA 1FJLA 3JRIA 4ABZA 1LE8A 5M3MJ 4S0HB 1RR7A 1MBGA 1APLC 3S1MJ 1GDTA 1TWAJ 2JA8J 5C4XJ 1JT0A 1JUPA 3JR9A 1JT6A 2X48A 4A3JJ 3MKLA 1ETWA 3OSFA 1W0UA 1OCTC 3E7LA 1NK2P 2ECBA 1JKRC 5F08A 2NVTJ 3BTCA 3SDGA 2VKEA 4LOCA 1TWHJ 3S14J 1YRNB 3Q0UA 3JRBA 1AKHA 4GFBA 2VPRA 3S1RJ 2GM4A 3S15J 2TRTA 4XIDA 1OJLA 3FISA 1ZQ3P 3TEDA 1IGNA 1MBHA 1U9OA 5K7HA 4FCYA 1T56A 4DYCA 5EGOB 3L1PA 3A01B 1HDDC 2MGQA 1A5JA 4C2MJ 5IPAA 1DU6A 1ORKA 2L7ZA 4A3BJ 3GBGA 1Z77A 1F43A 1TWCJ 2DA7A 2VI6A 4A3LJ 2JA5J 4D7NA 1XC5A 5EDNA 2VKVA 1JUMA 3RQIA 1HDPA 2Y9ZA 4FE7A 3GTGJ 4XRSA 1ETYA 4FISA 2JA7J 2YS9A 4JX5A 1I50J 5E3LA 5EZGA 4UUSB 2WB1N 1MBFA 4JX4A 3S16J 3A02A 4Y7NJ 2R5ZA 3IH3A 3ZQLA 2LLKA 3CMYA 2ME6A 1MBEA 1OCPA 5IYBJ 1JTXA 5BNGA 3K2AA 3CCYA 3QPSA 3GTJJ 1ETOA 1POGA 4BXXJ 2LR8A 2LY9A 2IBDA 2IAIA 1ZK8A 2EZKA 4I76A 4MO7A 4D5FA 2Y9YA 2ECCA 2HDDA 1RPWA 3LSJA 1WH7A 2EZHA 2DTZA 3HOXJ 2MG4A 1T33A 1IV6A 4X1EA 2DMPA 4A93J 5F0CA 1UMQA 2R7ZJ 1X2MA 2ME0A 5FJ8J 4W97A 3BG5A 1I6HJ 2NVYJ 4RDUA 3ZQHA 5IOZA 1HOMA 3QPLA 1BJZA 2XPVA 2LK2A 2EZLA 3MVPA 5C4JJ 1SFOJ 1G2HA 2XB5A 2HXIA 2Y30A 2COBA 4A3GJ 1HCRA 4MLOA 3B6AA 2CQXA 2WAQN 2I10A 2HI3A 1QVTA 4BBRJ 5M5XJ 5EZHA 1ZKGA 2OF7A 5HODA 3JRHA 3HDDA 1QRYA 1WGXA 4MFDA 1ZTRA 2HOTA 4FTHA 4A3KJ 1JTYA 1O4XA 5FKLA 2M8GX 2GLOA 5IP7J 3A03A 2LD5A 2JJ7A 5IOYA 3H0GJ 1VNDA 1K83J 1QVUA 1WPKA 2X9DA 2HXOA 2HYJA 2FJ1A 4A3FJ 2LP0A 5C44J 2RAEA 2WV1A 5EG0B 5F04A 2XPUA 2B63J 3C2BA 2XB0X 5FKOA 5K7FA 3LSPA 1RKWA 1BW6A 2DMQA 2M0CA 2DN0A 5F27A 2DA1A 4JYKA 5M5WJ 4IHXA 5GPAA 1PUFB 4V2GA 2FQ4A 2P81A 5M3FJ 4A3IJ 4QTRA 3FK7A 2LKXA 1IJWC 1WH5A 3HGYA 2E2JJ 5FLVA 1UG2A 1JKQC 1K61A 1Q1VA 3Q0WA 4QIWN 5M5YJ 2AO9A 3WHCA 3JREA 2VUMJ 2Y0SN 2Y31A 2K40A 5IYCJ 2EQRA 2ELKA 3ZQIA 1B72A 2L7MP 3LSRA 1LE8B 1D5YA 2ZB9A 1LFUP 3G1OA 2TCTA 4D7MA 4J19A 2K9QA 5E3MA 2E1OA 4AUXA 1NTCA 2DA2A 3GTMJ 4IHYA 2CU7A 3OIOA 1JJ8C 3ZQCA 2JA6J 3M4OJ 1X2NA 1JGGA 2AHQA 2R5YA 1ETQA 2YUSA 4C3IJ 5JLWA 5F0FA 1IRZA 3IH4A 5DTDA 3S2DJ 1BA5A 3FK6A 4CYCA 3PM1A 4V2FA 1ZR2A 1AKHB 4QSHA 3HOUJ 1QPIA 2QCOA 2R93J 1GV2A 3BQZA 3O8HA 1MH3A 3BQYA 3TW7A 2XGDA 2XGCA 1MSEC 3LSGA 2DA4A 4FE4A 2KT0A 1EF4A 3VPRA 3HOVJ 1FIPA 1VF9A 1IG7A 3B6CA 2E2HJ 4M3DA 2R92J 4IEJA 2XRLA 5J3LA 3PO2J 3S2HJ 1I3QJ 3JRGA 3HOWJ 1ZGWA 2D5VA 5JLXA 5J1RA 3S17J 1A6IA 5FKMA 2O9LA 3BR5A 5IP9J 2K9NA 5K7ZA 1OFCX 4JP0A 3HGGA 3FKIJ 2R0QC 2XGEA 1HLVA 1MH4A 4DYRA 3IV5A 2R5ZB 2ID3A 5F0HA 3JRAA 4M3GA 3WHBA 2NVXJ 1UHSA 4AYBN 1Y1VJ 3HOYJ 5FKKA 2FX0A 4B4CA 1FIAA 3GTLJ 2YU9J 1P7JA 1IUFA 5FLMJ 2LVSA 1VFCA 4M3EA 2DA3A 3MN2A 1XS9A 3LOCA 5J1YA 1YRNA 4C3HJ 2EBIA 2NS8A 5IP6A 3DEWA 4B3AA 5C3EJ 4C3JJ 2G0EA 2OPTA 2CRGA 3BG3A 5DS9A 1TWGJ 3IH2A 4MIMA 5EGOA 3A01A 1ENHA 3RZDJ 2MSYA 2O8KA 2IEKA 4L5EA 4DZPA 2XSDC 3GTOJ 3OSGA 3UKGA 4A3DJ 2LTPA 4BKXA 4XICA 5EF6A 4MFEA 3TW6A 1VI0A 4M3BA 2CUEA 1TC3C 2EZIA 1U8BA 9ANTA 3SJMA 3JRFA 1WCMJ 2E2IJ 4I6ZA 4M3FA 4D5CA 3CQZJ 1MBJA 5EYRA 4DW6A 3BR6A 1ETVA 2H8RA 1LFBA 3FIWA 3GTKJ 2K9SA 3HB9A 5J1UA 3I4MJ 3TP0A 1H89C 3BR3A 2KDZA 1Z0XA 4UUSA 1WI3A 4A3CJ 4A3MJ 1ITYA 2E19A 1W0TA 3OOUA 2M34A 1RKTA 1BL0A 2L0KA 2XPWA 3F0CA 4UUTA 4M6VA 1IDZA 2FD5A 2GBYA 2JMWA 4HNVA 3HBLA 1ETKA 2NOGA 3H3VK 2CQQA 1TWFJ 1SANA 2CJJA 2Y2ZA 1F36A 3HEFA 4G12A 2HQ5A 3GTPJ 3RZOJ 2JWTA 5GP9A 2JK3A 1FEXA 4DZJA 1S7EA 2HOAA 1FTZA 4EEFG 3QQAA 3ZOBA 2DMNA 3BR2A 2L7FP 3M3YJ 2M2EA 4B1RA 5F1JA 1GT0C 3JRDA 3Q0VA 3ZQFA 3JRCA 1GVDA 1MBKA 4W1UA 4DYQA 1MSFC 1H8AC 3HKZN 3Q3SA 4XK4A 3BT9A 4NDLA 3I4NJ 3RKQA 3HM5A 4XRMA 1B72B 3W6VA 2NS7A 4A69C 1DU0A 4JX6A 3BG9A 3NARA 3PO3J 2PMZN 4BY7J 1JUSA 1GUUA 2DMTA 3BTIA 1B8IA 5IYDJ 2M9HA 2R5YB 1ETXA 1P7IA 1U9NA 3SFIA 1ZR4A 4Y52J 3BTLA 3GTQJ 2HOSA 3S1NJ 1MNMC 1JKOC 4CYCB 1RESA 1JKPC 3D1NI 4IHWA 1GV5A 1RETA 2ID6A 1X58A 1NK3P 3S1QJ 2DA6A 1JJ6C 2JN6A 2EH3A 2N8GA 3BTJA 3NAUA 5EG0A 1AU7A 3G1LA
chains in the Genus database with same CATH superfamily
3P7NA 2VC0A 3KYDB 4RMNA 3AG2H 2VLAA 1U78A 4XMYA 5FFXA 4L5JA 3LFKA 5ICFA 3Q5FA 5E3OA 2OBPA 1V55H 4PK4A 5FKNA 4BY1J 4X6AJ 1ZG5A 4IXAA 1XG1A 3BCAA 2P8TA 2NVQJ 2LBFA 3QP5A 3BJAA 5E17F 1YS6A 3LSIA 2KIQA 2ZXIA 3BG7A 4BNCA 5AIQA 2H6BA 1B6AA 1I5ZA 3G1MA 3ZRGA 4J00A 3DKYA 1MMSA 4A3EJ 1R5ID 2DA5A 1BW5A 3S93A 3CO7C 4OAZA 5BPIA 1RRJA 1H88C 1HF0A 4KIGA 3GZNB 4XRSG 1AHDP 2CUFA 4U0WA 1FJLA 2IS1A 3FXKA 3X2QH 3M9AA 4U0YA 1S7OA 4S0HB 3DKWA 1OQYA 2F5EA 3GFLA 1MBGA 1PP7U 1APLC 5FD5A 1GDTA 1TWAJ 3K9TA 1DUXC 2RN7A 1JT6A 1OMIA 3BJOA 1SFEA 4KT6A 5H6RA 3COAC 2A5WA 2KKOA 1OCTC 3CUQB 2VKDA 5DUKA 3CCVI 1QGPA 1E3PA 5F08A 4KA4A 1TWHJ 1T38A 3MKWB 3S32A 5GTIC 4N4NB 3KP3A 1AA7A 4C2TA 3JRBA 3CCJI 1AKHA 3S15J 1EH8A 3L2QA 4ZTFA 2GXBA 2TRTA 3OL3A 3V7CA 4XIDA 2GQQA 1LQ1A 3F23A 2HPMA 1QPMA 3DWLE 3FISA 3HXLA 4P96A 4IHTA 5K7HA 1P92A 5ED4A 5IT9K 1T56A 3A01B 3L1PA 4D0PA 1HDDC 4YIFA 4C2MJ 3DPTA 1KU9A 2XF7A 4IVNA 2M7BA 1I39A 2Q1ZB 1ORKA 4A3BJ 3IKTA 1Z77A 3ZQ7A 1S6LA 2KRHA 1DPRA 1TWCJ 2DA7A 2GXGA 3JTHA 3T8RA 3KFWX 1IXCA 3RQIA 4AD9A 2D1VA 3AG4H 4XRSA 5DEQA 2VJIA 1ETYA 4AIDA 2JA7J 3ZMTA 1YJ9I 2FQ3A 4LIUA 1CGPA 1I50J 5E3LA 2M0MA 1IXRC 5EZGA 1ZYRF 4JBAA 5H2FC 3HUGA 2FBHA 2VE9A 3S16J 2WWYA 1Z91A 3GMEA 1QHGA 4ESFA 1IN4A 1A31A 1ERDA 2CO5A 2E5ZA 3BOQA 1FSEA 3ZN0A 1B1BA 5IYBJ 1OPCA 1XMAA 1BJAA 3UNGC 2DQLA 1LFPA 3F72A 2NNNA 2IAIA 3F8FA 1Z6RA 4B44A 1U5TB 4MO7A 2KJCA 4XONA 5F64A 1IZ1A 3H9GA 2L4AA 3LSJA 1WH7A 1UG0A 2DTZA 2FA5A 4HX7A 3TL4X 3H1CA 4HEA2 3E6CC 1R4NB 3VSKA 1WKMA 1UMQA 2R7FA 2R7ZJ 2YR2A 5K5RA 4V19K 2IRFG 4L9VA 2BXZA 2D45A 1S9HA 3CC7I 3HSRA 5E79C 3KEOA 3ZQHA 1HOMA 2MC4A 1RNLA 1XMKA 2NS0A 1TQPA 2KMUA 1REPC 2BGCA 1YOVB 1BBYA 2RNGA 1SFOJ 1T0FA 1Z6TA 2OU2A 2XIGA 2Y30A 4MLOA 1ZRDA 4F7ZA 4EM2A 2KIFA 3VYTB 2LF8A 5HODA 3JRHA 4Z2YA 1QRYA 2PI0A 1T0FC 1ZTRA 3S8PA 1N25A 5CYVA 1S3JA 3FXUA 5FKLA 1P4XA 4CICA 2WC2A 2GLOA 1IRXA 2COMA 1TTYA 1VNDA 3A2KA 1WPKA 4XM3A 1TT5B 2E1MB 2O5RA 2K86A 2V6CA 2BBYA 2FJ1A 3VYRB 1J7KA 4A3FJ 2LP0A 4CYDA 1LVKA 3G3ZA 5C44J 2RAEA 3TO7A 1VQ9I 5F04A 2HEOA 3P5JA 2B63J 2PEXA 2EPFA 2BXYA 1O7FA 2A61A 1BW6A 1XSXA 2DN0A 3ZMUA 3ULQB 4ZYAA 5BS6A 4BE2A 2VONA 2QSGX 1K7AA 2K85A 2DT7B 2GOXB 3BZCA 4A3IJ 2K3PA 2P5VA 4OIOF 5EJCA 4AU7A 2J5OA 1IXSB 3B02A 4XLHA 5FRMA 1UG2A 3QPTA 2MLKA 3ZMZA 1HKQA 1Q1VA 3WODF 5M5YJ 2YX7A 5K5OA 3CTAA 1QZEA 2X1DA 4BGDA 2RQPA 1D5YA 2BE5F 4XSZF 2ZB9A 1V5FA 2E1NA 3SEZA 3L9FA 4J19A 5CPRB 4U7DA 3L2UA 3K4CA 1UCRA 2PJRA 4XLPF 2IXSA 3LSTA 3A1YA 4IHYA 2JA6J 1F9NA 4ZZLA 2AHQA 5A2QZ 3K4KA 4WF2A 3DQVC 2F6CA 2A6EF 1K6YA 2LMDA 3FK6A 1KGSA 3QWLA 4QWQA 1FC3A 4QSHA 2QGUA 4LLGF 4HSRA 5LRSA 1P4AA 3O8HA 4RAGA 2FOWA 4KJZA 1USSA 1MJ9A 3DLAA 2HVQA 3DPLC 3PNTA 2CW8A 3WU2C 1ACIA 5FROA 3V7RA 2KT0A 3IRRA 1ZN2A 4G6DA 4HDVA 2OZ6A 4KMFA 2XRLA 1D0YA 4MQVA 3JSOA 3PO2J 3K4BA 2DCEA 1ZLJA 3JRGA 4KFCA 3FBNB 3RYPA 5D5WB 1OISA 2P5LC 2ZJQF 5CJ9A 1BI3A 5CLSA 4XLCA 3HOWJ 1MDMB 3A4CA 5FKMA 2FNAA 1QNTA 5BPDA 1LKXA 2DFFA 2PJPA 2Z3YA 1WJEA 3ERMA 4BHCA 1VQKI 1PVEA 3VWBA 1TBXA 2RKHA 3JRAA 1A36A 1FX7A 1U0JA 2HTSA 4M3GA 5GAGJ 1W5CC 2JQ7A 5KK1A 2NVXJ 1Y1VJ 1X1DA 3HOYJ 5FKKA 3EETA 2H8WA 3K10A 3RQ4A 4OIPF 4UV8A 2BY0A 2YU9J 3CUQA 4LG3A 3G73A 5GADJ 1LUJB 2LVSA 3QOEA 1BN5A 1YLFA 3SYTA 4HBLA 1XSDA 2L01A 2P4WA 3LOCA 5J1YA 3TDUC 3P9CA 4C3HJ 3DBLB 3DKXA 2XAUA 1QQIA 4ENNA 4ZYEA 3CUQC 4C3JJ 4U7BA 2QBYB 1UB9A 4U87A 4G8XA 3LA2A 1R5HA 2G7HA 2PQ8A 2CRGA 4G6QA 2UXXA 3PNYA 4KICA 4XLAA 1BR1A 1XSVA 4BHBA 4N0BA 3A01A 1ENHA 3RZDJ 2VE8A 2MSYA 5GTHC 1SMYF 2HYFA 4RB2C 3GTOJ 1YO5C 4F52A 2ADUA 3FMSA 4NBQA 3RKXA 4IO9F 3OSGA 4A3DJ 2HDWA 3K1NA 4C9YA 3WTTC 2NRAC 5LHHA 3SJMA 3PL8A 1E2XA 2CUZA 3ECHA 2IA1A 1MBJA 2F2EA 4XOTA 1J75A 2HGCA 2KDOA 2MYSA 3I53A 1R22A 2GAUA 1H89C 4AYBA 3BR3A 2VBZA 4EATA 1HQCA 2DXIA 4XL9A 2V79A 3OR1C 2M34A 1T6SA 3EYIA 5KHDA 1Z05A 1LJ9A 3WE3A 4M6VA 3DP7A 4FQGA 2FD5A 3QYEA 1VQ8I 1ETKA 1SVMA 3U21A 3J81K 1TLHB 2R7SA 3GUDA 4CUGA 3TMOA 1X4PA 4O3MA 3RZOJ 1XDUA 5L3BA 2MD0A 5HS9A 2A3SA 2HOAA 3IWFA 1FTZA 2ZXWH 3QAHA 1FLIA 2HS5A 5TISC 5ICEA 3BR2A 3RPQA 3UR3C 5DM7F 3IHUA 3F3XA 4B1RA 2CS3A 5GAHJ 3CMEI 1U5TC 4H4KC 1ZH5A 4L0YB 2JVGA 3WE2A 5L3FA 1K4TA 4DYQA 1FT9A 2EFQA 2BHZA 3HJEA 3HKZN 1H8AC 3ELKA 4XK4A 3BT9A 3MQ0A 5DCMB 3I4NJ 1BI2A 2RDPA 3TDZC 4A2UA 2VQCA 2H27A 4F3QA 1OCCH 2DI3A 4A0YA 2CQNA 3K4MA 4PGGA 3W6VA 1QZYA 4G6TB 2Z33A 2MC3A 3FXLA 3HRSA 2F4IA 3HIFA 3KCCA 5J8CA 2FUG2 3NARA 1B8IA 3BTIA 1SD4A 4WXDA 1MJAA 1K78B 3SFIA 4G7OF 1BR2A 1I1GA 3GTQJ 4DNCA 2AQFA 1IAWA 1ZLKA 4DGWB 3HYIA 3D1NI 3OMYA 2IPQX 1NK3P 3K4LA 1SC7A 2N8GA 2GZWA 4Q4ZF 4HYEA 2VQGA 2VJ4A 3IRQA 2XAGA 2LOOA 2P0WA 5D4RA 4UHTA 1DP7P 2VODA 1FTTA 3ZQQA 5EEAA 2O7OA 4XNFA 2E1MC 3K7AJ 5GPCA 2RC4A 4I0BA 5E3NA 2ZJPF 4BEHB 2RREA 1UAAA 4ESJA 4UB6C 2DDBA 4KMUX 4Y17A 2QENA 2DJNA 5D4SA 2IS6A 5DD8A 1KU3A 2LFBA 2W48A 1ZG3A 3TP3A 4IX7A 1HBXG 3GFJA 4Y4RA 3KYLA 2BYVE 4RBOA 3G2BA 3ZPLA 3E1SA 3V42A 3OYMA 4P9UA 1YJNI 1VQ4I 2NXNB 3BCBA 2PMZA 1XN7A 3DXJF 5ERIA 2WBMA 3ZMVA 1RR7A 1NG7A 3BDDA 1R6RA 4E7LA 2OC6A 1J59A 3LWFA 2JA8J 1JT0A 1J0RA 3I55I 2P5KA 4A3JJ 5ICCA 1W0UA 1D0XA 5B3SH 4XR6A 4Y15A 1T08B 4PSXA 3GX4X 1LDJA 1NK2P 2ECBA 2NVTJ 4GDFA 4CCOA 3S14J 2JT1A 3TOBA 3WU1B 4GFBA 3S2WA 2CYYA 3O3KA 2I8DA 2CW7A 1VQLI 2HU9A 1OJLA 4CZCA 1H9GA 1GVJA 2K02A 1XCVA 2XAHA 1W4MA 3TEDA 3I9V2 1IGNA 1ZQ3P 1MBHA 2GOMA 2IS4A 1BM9A 2VKHA 2RVCA 4L9NA 4JOMA 1X3WB 1X1PA 1Z21A 1CF7B 4EGYA 1A5JA 1VZ0A 2OTJI 3CMMA 3RJPA 2EV0A 2WAEA 3R60A 4KIBA 3GBGA 5LFAA 5HS8A 2VIXA 3FMQA 3LQQA 1J09A 1F43A 3OIQA 2DT6A 3LL7A 4A3LJ 3D5LA 1MMAA 5EDNA 2VKVA 1JUMA 1HDPA 2X6YA 2A5YB 1NH3A 3FXJA 3FZVA 4RS8A 4EV0A 2BVMA 4E7HA 1WFXA 1MDMA 4YEJA 1XGSA 4UXNA 3LA7A 4UUSB 4N9HA 2V9PA 1ZARA 3A02A 4MHGA 3C2HA 2GA2A 3QPHA 4QPQA 3S3OA 3OWTA 4HPQA 1OCPA 1MNDA 5H6QA 1JTXA 1UFMA 1RI7A 2VB6A 3OR2C 3FKJA 3CCYA 3HHHA 3RPUA 3GTJJ 1POGA 4M74A 2LR8A 4KYWA 2DODA 1YG2A 2GWRA 2LY9A 4NC8A 1SFKA 1F1ZA 1HSTA 4I76A 4D5FA 1V5GA 3HRMA 3ZCOA 2ECCA 4XKCA 3I5UA 2M1BA 2HDDA 3MAJA 1RZ4A 4HRIA 4AIHA 3BROA 1X1CA 1BI0A 2EZHA 5HLGA 2CGPA 2QBYA 1IV6A 4X1EA 4GGGA 3K1PA 3BG6A 5HNHA 3W6KB 1UJ8A 1XB4A 2F5VA 3DTEA 1Y0NA 1QZZA 4L0ZB 3HPGA 4AIKA 2YPRA 3I71A 2R7OA 3OIPA 4RDUA 1I6HJ 3JSPA 5HDGA 4XKBA 3TKYA 3CD6I 2IJLA 1BJZA 2EZLA 4HG2A 1G2HA 5DUIA 4YIIA 2XB5A 3HTSB 3SZTA 5FD6A 4C30A 4KN7X 4A5NA 1OCOH 2COBA 3B6AA 1WHUA 4QLCU 4PDKA 3Q9SA 1QVTA 4BBRJ 1V5EA 3T0YA 3V8KA 3PSIA 4HLXA 2OF7A 1F4KA 2NAZA 4MFDA 3KEYA 4P5OA 4BU2A 4MQ9F 5TGTA 2LD5A 3A03A 2JJ7A 2ZJ2A 3H0GJ 4IRGA 5B5EC 2A07F 2HYGD 1K83J 2XVCA 3N97A 2XDVA 2HXOA 3F22A 4IJAA 3OYLA 3CJTB 1A04A 1J9IA 4ZC3A 2WV1A 5EG0B 2EIJH 3RI4A 3PUBA 3C2BA 3QOPA 3QU3A 1FYMA 1RKWA 4M9ZA 3GYHX 1O57A 2L7KA 2OQRA 3I56I 3W2AA 3VYSB 4HLYA 4AM3A 3CMAI 1SAXA 5FLXK 2EFPA 4YELA 2DA1A 4RB0A 2CV0A 4LG0B 1MIJA 1XGMA 1Z3YA 2P81A 2X1CA 2R7TA 2LKXA 2J5PA 1TZLA 4NB5A 2KRCA 3A0BC 1EV7A 1K61A 5FB2A 2ETHA 3V4GA 5D5XB 2M4KA 3OS1A 2OTLI 3FM5A 1J5YA 3GCMA 3JREA 1O3TA 2Y31A 1IN5A 3KLNA 3WGHA 1JHFA 2ELKA 2EQRA 2V9KA 1LEBA 1G3SA 2L7MP 3WTUC 1R49A 2IA0A 3MKZA 4G7HF 3ZR8X 3PQJA 4DIQA 3LAJA 2ZO4A 5E3MA 4BDYA 2E1OA 4RA2A 1NTCA 2Y69H 3GTMJ 3V7SA 3OIOA 1JJ8C 1IRFA 2UZKA 3CLOA 2KIUA 1XGOA 1S5LC 2CV1A 1FZPB 5DYMA 1K78A 3R0AA 4HQEA 2ICWG 2YU3A 2QA4I 2QVOA 1GXPA 1A6QA 4V2FA 1MJBA 1ZR2A 2LDUA 2QCOA 3PQKA 1GV2A 2VQLA 1D8KA 1ZHFA 3SZPA 3JTGA 1HW2A 2CQ7A 3BQYA 3TW7A 2EILH 2XGDA 2XGCA 1O7LA 3LSGA 2IA2A 4BEHA 1O3QA 4HOBA 4KUMA 1YE9A 4J01A 4PZJA 3MKYB 5J3LA 1I3QJ 4CA0A 4YG2F 3WGGA 2P6TA 2F5DA 4UB8C 2KFDA 1ZGWA 2PLYA 3I54A 3RPUD 3ERED 1YTYA 3O6BB 2FXAA 1MGTA 2XHKA 2P7CB 5J1RA 3S17J 2HVRA 2O9LA 4P9FA 2XROA 5IP9J 1OYYA 1KONA 5H20A 1OFCX 5K7ZA 2QEXI 1QHHD 2O0YA 3J80Z 1GXQA 2LKPA 2BVLA 3FHNA 1U2WA 3FKIJ 4EQQA 1T95A 1FOXA 3K4JA 1Z9CA 2LRDA 3IV5A 2ID3A 3MEXA 3AL0B 3WHBA 2K5CA 2FMLA 3DU5A 2STTA 2FBIA 3T8TA 4HQMA 3TGNA 1XGNA 2WA0A 2VPLA 4BJ6C 3IWZA 1JXSA 4QPOA 4YFNF 4B4CA 4A0XA 3JAMK 2R7XA 1P7JA 2GA1A 4XORA 3CJQB 1IUFA 2HDCA 5D5UB 4XLFA 2DA3A 2PN6A 1MW7A 4NQWB 1VQMI 4YIRX 1G3TA 2JRTA 5TJJA 2EBIA 1I1SA 5IP6A 4RGXA 1ODDA 5CKTA 3M8FA 2ZKZA 5J6XA 3K70C 5C3EJ 4ENMA 1G3YA 4I09A 1FMVA 1ZRFA 1ULYA 4FX4A 1OYWA 3BG3A 5DS9A 1TWGJ 2BZTA 2BY3A 3IH2A 4E4HA 1R71A 2ZSIB 4IRIA 2O8KA 2KZVA 3L2RA 2IEKA 2ZC2A 3HSFA 2MD5A 3H5NA 3CC4I 1SVOA 5JHUA 5EF6A 5HOOA 4M3BA 2EZIA 9ANTA 5CVJA 2WV0A 3JRFA 1G6NA 1ZREA 4Q47A 2CWEA 2DPDA 5HVQC 1S7AA 2V6EA 4M3FA 1V54H 5EYRA 2H8RA 1LFBA 2DO7A 3FIWA 3WU0A 3HB9A 3ROUA 2DYRH 3I4MJ 1STZA 5CVRA 2ZNYA 1T2KA 2KDZA 4UUSA 3FXMA 2P7VB 4A3CJ 3KEQA 2E19A 4FETA 2CFOA 1BL0A 5LEJA 3R4KA 1W5TA 2IS2A 4LD5A 4CCNA 1IDZA 2GBYA 2IGNA 1PP8F 1AOYA 5B1AH 3SXYA 1BC8C 2CQQA 2DFEA 2Y2ZA 4UVAA 2X85A 3B73A 4HAMA 4B48A 3GTPJ 2RGVA 2V26A 2JWTA 5JR3A 2JK3A 4UY8I 2HPIA 1FEXA 3I59B 1RR8C 1FOWA 1RUNA 4E7KA 2ZFUA 4EM1A 3GO5A 1N75A 3MZ8A 3D0SA 1DP3A 2Y0MA 4LMYA 5E1WA 2DMNA 2L7FP 5HDNA 4CSWA 5BQTA 1UHMA 3JRDA 1GT0C 1J2XA 4OMZA 2O8XA 3FXRA 1GVDA 2DFHA 1B59A 3CF5F 3WG9A 5HDKA 5HNFA 3ESWB 1YX3A 2QKLB 1G3WA 2Y75A 3R61A 1X1AA 2QSHX 2JA2A 2W24A 2NOJB 3M8JA 1EH7A 2HKXA 4BUPA 2EFNA 5ILVA 2V1DA 2ZMEB 2FRHA 4Y3OA 3G4SI 1BC7C 4MTEA 3L2VA 3OYDA 2D1HA 3GFMA 3HG9A 2MABA 3RYRA 4DBRA 4RGUA 2HKOA 2K4JA 2WY7Q 3BG9A 3PO3J 1X4OA 4BY7J 5D8LB 1JUSA 1GUUA 2DMTA 3HPHA 4L9TA 2M30A 3HZJA 5AIPA 2M9HA 4OWRB 3GVAA 5DCFA 2LY2A 3K0LA 4MEXF 4E6KG 1XPXA 1ZAOA 2FNPA 3W3CA 3VODA 1R7JA 3IP4B 4WWCA 2ID6A 1X58A 3NWSA 3QRFF 2STWA 2DA6A 3HC7A 2EIKH 4AWXB 5EG0A 1AU7A 3CCMI 2JTVA 1Y1WJ 4BXFA 1E3OC 1KA8A 3GLXA 1DDNA 3M1EA 1FYLA 1YFHA 2QF7A 4XBFA 4PCQA 3ABTA 4LG0A 2E34A 1IDYA 1W1WE 3HKZA 3F8MA 2HZDA 4IQJA 3A0HC 5IT9Z 1L3LA 3Q9VA 3HRTA 1VQ7I 2HQNA 4AC0A 3K70D 4CCLA 3CDLA 3BR0A 2HR3A 1B4AA 2E60A 3ZMDA 1S29A 3JRIA 4ABZA 5M3MJ 2PX9A 2VJ5A 4BHPA 4BXUA 5FRNA 1XD7A 2GIZA 4E7ZA 3C1DA 5LRRA 3LSMA 4XKWA 5C4XJ 2K9MA 4NUBA 3CUOA 4IOCF 3OSFA 3M7GA 3E7LA 5KAIC 2OD5A 3H5AA 4I01A 3SDGA 3KZYA 4LOCA 1R5GA 3WGIA 3LQRA 1WJDA 3E3VA 1E17A 3BPXA 1NHAA 1YRNB 3FHZA 3D5SC 3KP2A 1B9NA 3S1RJ 2V1UA 2A6HF 4HV6A 2FOKA 3LFUA 2ESHA 2W85A 2OA4A 2BY1A 3T5XA 3SQNA 4FCYA 5D6EA 4ZZDA 2ISYA 4FASD 3E6DA 3F8CA 2MGQA 1U5TA 2DU9A 2QUFA 3PNVA 5E8GA 4CCJA 2KISA 3P9IA 3LSKA 2QKMB 4CDGA 4PJ0C 5J8FA 5LLQA 2YX4A 2VI6A 3CDIA 1KQ8A 2K9LA 4FE7A 1RUOA 1R1VA 1WRJA 1QU3A 4PUSA 6PAXA 2QQBA 4FISA 2YS9A 4JX5A 3ZXSA 1FYKA 2Q2EB 4EJVA 4BL0B 3OYGA 4WK8F 2HTJA 2LYCA 4WX9A 2L5QA 2WB1N 4JX4A 1QA6A 1FOKA 2BEOA 2EINH 4I2OA 2CMPA 4JK1X 4I7HA 4BQQA 3JAMZ 2DAOA 3IH3A 1FBUA 2MH2A 2XKOA 1Q1HA 1MBEA 3CESA 4GCVA 2EK5A 5CVIA 2R7VA 3CCLI 2R4GA 1ETOA 3N4MA 2LKSA 4BXXJ 2X0LA 5KNLA 3RSNA 4HNUA 3DF8A 2EV5A 4LK1F 1IN7A 3AL0C 1FWZA 3KZIC 4NQWA 3I64A 3H3UA 3VYUB 3CCUI 3AG1H 1TL8A 3QYBA 1MMNA 1Y39A 2R3SA 3FMRA 2MG4A 2PMHA 3HOXJ 3J7AY 2L3DA 4KITB 1PYVA 4A93J 5F0CA 2XAFA 4RM3A 1LPQA 1X2MA 1S72I 4EJTA 5FJ8J 5J40A 1JGSA 2QSFX 3VSLA 2ZXHA 4ZJZA 1FBSA 3DEUA 1PDNC 1DPUA 4M9XA 3LMMA 4R79A 2NNYA 4KDPA 3QPLA 3ZMSA 3IAS2 1IO2A 3HUGB 3PFYA 1WJ5A 4GYGA 4Z6YA 2UV1A 2V7FA 1H0MA 2K27A 2HXIA 1WJBA 3CDHA 2XAQA 5BMZA 4UV9A 5DM6F 3L2WA 3H9QA 1FP2A 2L02A 2CG4A 1QBJA 2HQRA 1WGXA 2HOTA 2IP2A 3EYYA 4FTHA 3OYEA 1O4XA 2FEZA 3CCEI 2NYXA 1YITI 3NWTA 3ABKH 3IUOA 2ZSHB 5ILUA 2LREA 1JHHA 2IGMA 1QVUA 2X9DA 4CGZA 3R0JA 1SMTA 1BOAA 4LLNA 3WTYC 5K1YA 1TQMA 2LG4A 1Y56A 4HDUA 4R1HA 3OL4A 1D8JA 5FKOA 2FSWA 5K7FA 3ABLH 3MD2A 3LSPA 4BE1A 2HNHA 2VT3A 2M0CA 2DMQA 3I59A 2OCEA 2UUZA 4KN4X 2B9SA 2Z9OA 3HTUA 4RAYA 2L4MA 3SZGA 3BZ6A 1PUFB 3ONQA 1VTNC 1H9TA 5M3FJ 4A12A 5HS7A 4A0ZA 4QTRA 3FK7A 3HRUA 4WXHA 1WH5A 1ZGAA 1IJWC 3KE2A 3DBHB 4LK0F 2KPMA 4DJAA 1LNWA 5E8IA 1JKQC 1KQ0A 5DDGA 2W82A 1I3AA 4QIWN 3E5QA 2AO9A 2M4GA 5DV5A 5L3GA 2VUMJ 3KP5A 4PFPA 2Y0SN 1VQPI 3DFGA 1K79A 2DBBA 3SHFA 1YHQI 2ZCWA 1LE8B 3LSRA 1SD7A 3CP8A 2KHMA 3G1OA 4D7MA 3VEPA 5J47A 4G94A 3AG3H 2K9QA 3EUAA 1XCBA 5CVUA 2DA2A 3RKYA 2EB7A 3OY9A 2H09A 2CU7A 5LEKA 3ZQCA 3M4OJ 4ZDPA 4XOPA 1KYWA 4C3IJ 4CZZA 4PJNA 3VOEA 3BC8A 5DTDA 1OKRA 1IN6A 3M07A 1KQ9A 1WSUA 4I0AA 4MEYF 4OMYA 2ELJA 2VBYA 3O2PE 5D8KB 4PJLA 2F5FA 3PIOF 1QPIA 3EUHC 1O3RA 4ZDLA 1SFXA 4IOAF 2BV6A 2A68F 3C2GA 3F8NA 5F1RA 2V1XA 1G8XA 1XTAA 3K2ZA 1IN8A 3C18A 4FE4A 1EF4A 2V9VA 3VPRA 3MZHA 3L7WA 4LLLA 1FIPA 1VF9A 1IG7A 3B6CA 4NHJA 2NVUB 2M3AA 2E1CA 2KP6A 2R92J 4IEJA 4N9IA 3ZGKA 4RAFA 1LDKB 1YW8A 2ZBKA 3TBIA 5B66C 1WJCA 3BZKA 3FDYA 3F21A 2FF4A 2ZJRF 4MNUA 3WTXC 2D5VA 1S8NA 4RLQA 5JLXA 3OYHA 4EJWA 3MMYB 4I02A 3W2WA 3OS2A 4B09A 4EGZA 4D9JA 4II3A 5J4VA 3BR5A 1P4WA 1ZGJA 2ELHA 1V4RA 3E97A 3MZYA 4IF4A 4JP0A 4RGRA 1WJAA 5IY5H 4R8HA 2QWWA 2XGEA 4K2EA 2R0QC 1MH4A 5L3EA 5L3DA 2R5ZB 2WAFA 3F6VA 1ON1A 2X4HA 2ACJA 3TOAA 4CH7A 2X6XA 4XLEA 3GTLJ 3K1MA 3OYBA 5LBQA 3EQLF 2IGOA 4E7SA 4BS9A 4M3EA 1VFCA 3GZ5A 4LFUA 2X51A 3J81Z 4HW0A 1XS9A 4AIJA 1YRNA 4LJZF 4ON0A 2BW3B 2VOOA 3ABUA 2NS8A 4ENKA 1DGRM 3DEWA 1C0WA 1W7PB 5JI6A 3QYFA 2ISZA 2O3FA 1FBQA 1MZBA 2BY2A 3DTIA 4A5MA 3P9KA 1X3ZB 4LB5A 2OAZA 5GAEJ 3HSEA 4U88A 1O3SA 2E7WA 2IVMA 1P6RA 3E6MA 3EDPA 4IQ4A 3HL2A 3BY6A 4FX0A 4RLFA 5LD2C 2I5UA 1Z7LA 4OU0A 4DZPA 2XSDC 4UNOA 1D3YA 3UKGA 2DK5A 1R1TA 4BKXA 3ZN1A 2WY8Q 4XICA 2E71A 1FPQA 2R7WA 4BQOA 2JPBA 2CUEA 2DK8A 2XKPA 2E2IJ 1TQIA 2CQKA 1RC9A 2QQ8A 5DD4A 3ASOH 3CQZJ 3MWMA 4D5CA 4BQAA 4DW6A 1MMGA 4HF0A 4XN0A 4PFOA 1HKTA 4IKFA 1LVAA 2K9SA 4DOZA 2Q2EA 3TP0A 1Y8RB 3FWEA 5DCMA 4A3MJ 3W6JB 5IT3A 1ITYA 1W0TA 4BE0A 5E20A 3F8BA 1RKTA 3WTVC 1AWCA 3GFIA 3F0CA 4PJJA 4EJUA 3V8JA 4DBQA 2JMWA 4HNVA 3HBLA 3GZ6A 1Z3XA 2NOGA 4WCGA 2VQHA 2R7UA 2CJJA 1F36A 4G12A 2DLLA 1IV8A 1U3EM 2HQ5A 1E0EA 4JQFA 3KP4A 2MBFA 3NEUA 4GYIA 4DZJA 4HSTA 4BYYA 2OQGA 2O6GE 1T98A 1Y0UA 4LB6B 2E5NA 2MLGA 3OYKA 4EEFG 1D1BA 2M2EA 3Q0VA 3ZQFA 2FU4A 3JRCA 3GWZA 1DGWY 3U1KA 3BJ6A 4BH9A 4CCKA 3FXOA 2CV2A 3QU6A 3CF2A 1MSFC 3I0TA 3NQOA 1D1AA 3Q3SA 3E5UA 4ZYDA 1MMDA 2DQRA 1SVLA 2GXAA 4MTDA 1IF1A 1B72B 3ISPA 4IZZA 2Z2SB 2PBIA 3DV8A 4KIFA 2K4BA 1R4MB 4A69C 4OOIA 2W4SA 3IKVA 4BACA 1DU0A 1YI2I 2F5CA 5LGUA 3G71I 3H5RA 4XLNF 3HOTA 3QODA 3OYNA 1OLTA 3H36A 5IYDJ 2R5YB 1MNEA 1R58A 1P7IA 3K6GA 2ESNA 4Y52J 4Y13A 1ZRCA 1YW7A 2WTEA 3RTRA 2DTRA 2RQQA 4OIRF 4CYCB 2G9WA 1JKPC 1JKOC 1F5TA 1Y6IA 3CLQA 4U0VA 1GV5A 1RETA 3PJRA 1JJ6C 1RIOH 2EH3A 3BTJA 4F92B 4UUVA 1MD0A 4IHVA 2Q0OA 4G7ZF 2X6OA 2FE3A 2KJBA 3BR1A 2Q8KA 3RDIA 1IC8A 4OIQF 2VOPA 2XAJA 2Y48A 4M71A 3I3LA 2OCCH 3PIPF 3JCUC 2H1KA 5LHIA 1R9TJ 3IC7A 5LGNA 3E0JB 5D6FA 3LNQA 2E7XA 3L2CA 3O8GA 1PUFA 1IUYA 3RIRA 3DCFA 1YS7A 4F93B 2HVSA 4B43A 2MW8A 1SD5A 2W57A 4BBSJ 3HOSA 2JRMA 3ZP5A 1LB2A 2IGKA 4PSWA 3HOZJ 2E35A 1B8IB 2L9SA 1CF7A 2L9RA 1FSHA 2EV6A 2DMUA 3ZQGA 2XC7A 2DOAA 1CQTA 1TP4A 4ANJA 1LE8A 2ZNZA 4I99C 1GLNA 2M45A 4EVIA 3WTWC 3L00A 3S1MJ 1JUPA 1FP1D 3C3WA 3JR9A 1D1CA 3IL2A 1LDDA 2X48A 2M8EA 4ASNA 3MKLA 1ETWA 4M9SA 1JKRC 4S05A 3BTCA 4BQNA 2VKEA 4KNYA 4E7JA 2MFZA 1HA8A 1TNTA 1Y8QB 3Q0UA 4ZTJA 1WVRA 3GF2A 2VPRA 2GM4A 1VQOI 4HNTA 4NC7A 3AKZA 2EA2A 3DLLF 2JSPA 2B7EA 4B47A 3DU6A 1U9OA 3PUFA 1W5SA 2ZFWA 3N05A 1FMWA 3H3ZA 4A6EA 4DQ2A 5EGOB 2WAQA 2QM3A 4DYCA 1IRGA 2UXNA 5IPAA 2UWMA 2CH0A 4IL6C 1DU6A 1YQAA 2P6SA 4E70A 3D5RC 4RAZA 2MH9A 2L7ZA 3LA3A 2H94A 4ZH4F 1X19A 1EH6A 2KZGA 1K4SA 2JPCA 4GXOA 3OV8A 4D7NA 2JA5J 1XC5A 2Y9ZA 2XUBA 3FM3A 3KLOA 3QP6A 3GTGJ 2R7DA 4XKVA 2QYOA 2V4JC 4ZYHA 3VDXA 1ON2A 3WG7H 1W36C 2F48A 1YX5A 1N78A 3SFZA 4ZDOA 1FOYA 2DT5A 2DOEA 1WI9A 2W25A 3H9JA 3OS0A 1MBFA 2XASA 1EA3A 3CJRB 3SDBA 3F6OA 4Y7NJ 1BIBA 2R5ZA 4IHSA 3CCRI 4HX8A 5KCMA 3CP2A 3ZQLA 4KISA 2LLKA 3KP6A 3CMYA 2ME6A 2Z5UA 2XF5A 5BNGA 3K2AA 2L2OA 2GIVA 3K4NA 3QPSA 1D5VA 4HA8A 2XRNA 2HOEA 2IBDA 4PGHA 1ZK8A 2EZKA 2Y9YA 2BW3A 2QQ9A 1KZHA 4ENJA 3I4PA 1RPWA 1YW9A 1W7PA 5FFZA 3F9KA 1T33A 2DMPA 1ZELA 3E5XA 3U2RA 1HXDA 1SFUA 3CO6C 5J4YA 5FLXZ 2ME0A 2L9VA 5LGTA 4W97A 1R1UA 3REOA 3BG5A 3MCZA 3J7AO 2NVYJ 4XQFA 2HZTA 5KVRA 5IOZA 5FGMA 5E1XA 2XPVA 1Z67A 2LK2A 1OCZH 3MVPA 3U9GA 1VQ5I 5C4JJ 1U8RA 2EFWA 2BOLA 3AFHA 3TO6A 3DEEA 2YSRA 1BR4A 5CQEA 4LIVA 1EJ9A 4A3GJ 1HCRA 1D0ZA 4HZFA 5BOXA 2CQXA 2WAQN 2WB1A 1YIJI 1P2FA 2I10A 4BDZA 4M73A 2HI3A 5M5XJ 1U6GA 2L54A 5EZHA 3NRVA 1ZKGA 4BJTA 3HDDA 4A3KJ 1JTYA 2CFXA 1DQUA 2EJRA 2VN2A 2M8GX 3V8LA 5IP7J 2L9NA 5IOYA 2CUJA 1R36A 2C6YA 3CZ6A 2DJIA 2QLZA 1KYZA 1BOBA 3H0DA 2HYJA 4O5VA 3DPUA 2VXZA 4O6JA 1ZG1A 1SEUA 1R00A 1I27A 3OYAA 2XPUA 2MA3A 5E1ZB 1WQ2A 2XB0X 5HLIA 2OJED 1L0OC 4RGSA 3VB2A 2D2WA 2LNBA 3TO9A 1Z1DA 4BJ5C 3KZZA 3HHGA 4RB1A 1OR7A 4NC6A 5F27A 3J7ZI 3FF5A 4JYKA 5M5WJ 4IHXA 3T1BA 4C2UA 5GPAA 5D5VB 3S3NA 2VASA 4V2GA 4B3XA 2FQ4A 1BIAA 1V3FA 2LBFB 1R23A 2KRFA 4TV7A 1YJWI 3HGYA 2E2JJ 5FLVA 2KQRA 4F55A 1EKEA 4CHUA 2X6WA 1OR7C 3FXQA 2LH9A 2O61A 2AQEA 2IW5A 2W1OA 4CCMA 1YIOA 3Q0WA 1WZ2A 3KETA 2AXLA 3WHCA 4I98B 2K40A 1B9MA 5IYCJ 2WADA 3ZQIA 1B72A 4FHTA 3KX2A 1X3UA 2HFHA 1LFUP 2DYSH 2TCTA 2OV7A 2PMUA 2JUCA 1UHWA 2DPUA 2M7AA 4AUXA 3KP7A 1P9QC 3SEQA 4L9JA 2W7NA 1X2NA 1JGGA 2F4OB 2R5YA 3BP8A 1ETQA 2YUSA 3ABMH 2EFOA 5JLWA 3BLYA 5F0FA 3WTSC 1IRZA 2A69F 3IH4A 4P55A 3KPHA 1YYVA 5K5QA 4OINF 3S2DJ 2H1LA 1BA5A 4X0GA 3H35A 5L3CA 3PM1A 4CYCA 1W36D 4HF2A 2O03A 2Z1DA 1AKHB 2R7RA 2JSCA 3HOUJ 2EA4A 1E3HA 1GHCA 2R93J 3BQZA 1HW1A 4XSXF 2OZUA 1WJFA 2B0LA 3GEZA 1MH3A 5JFRA 4GRIA 2K3FA 3G6EI 3AAFA 1KU7A 2VBWA 4YFKF 2W00A 3CCQI 1MSEC 2KL4A 3ASNH 3RCOA 3CC2I 2DA4A 5KAFC 3JW4A 1OCRH 3K69A 3HOVJ 2KLOA 2VL8A 4ETSA 4S04A 2E2HJ 2JZYA 4M3DA 5JVGF 2Y0SA 2HWVA 4NNJA 3S2HJ 2X1EA 4LGWA 3L09A 1HSJA 1X1BA 3S3MA 1XMXA 2LY1A 4MGRA 2PFBA 1KU2A 1A6IA 4EMSA 2AXTC 3C7JA 2K9NA 1BI1A 1N77A 1G59A 3HGGA 5HLHA 1HLVA 5JVTA 5AONA 1M1EB 1XX5A 1W7PD 4DYRA 5F0HA 4HV5A 1WWXA 2CW0F 2XF6A 1MKMA 4B8XA 3CJNA 1UHSA 4AYBN 4ZYGA 2FX0A 4YFXF 3LSHA 1TNSA 3OYCA 1FIAA 4UVCA 4PJMA 2VXDA 5FLMJ 3I58A 2FBKA 2G7UA 2HQAA 5CQGA 3MN2A 2KIMA 4P1WA 1QO0D 3H92A 4EJOA 1TW3A 1Z7UA 2M5WA 4XRFA 1T8IA 4Q48A 4B3AA 3OYFA 2H6CA 2G0EA 2LC2A 2OPTA 4KT5C 1G4DA 3J7YJ 4HX4A 2LF7A 5HLTA 4G9YA 3MFKA 4MIMA 5EGOA 4F91B 1JI8A 5CVVA 4L5EA 1T39A 2TDXA 2ZXJA 1VQ6I 2LTPA 1SD6A 1TW2A 1USTA 2F4MB 2K7LA 4AVPA 4Q5SF 4AVZA 4MFEA 3GW2A 2W84A 3TW6A 1VI0A 1FNNA 1TC3C 1U8BA 1WCMJ 4OAYA 3ECOA 4I6ZA 3LAPA 2M87A 3J80K 3BR6A 4IPAA 4CXFA 1ETVA 3GTKJ 3GLLA 2VT2A 5J1UA 2E36A 2DOFA 2IT0A 4D1QA 2XSJC 3DBRB 3BPVA 1Z0XA 2FMYA 5TRDA 1WI3A 3M1CA 5LHGA 3OOUA 4XN3A 3IAM2 2L0KA 2RNJA 2XPWA 4UUTA 2ZMEA 1A35A 4IRHA 2VJJA 2AS5F 1HW5A 4UVBA 3H3VK 1TWFJ 3DTKA 1SANA 4RB3C 3HEFA 1HC8A 1OYIA 4YRVA 2JVHA 3FBIB 5GP9A 1SAUA 3EUHA 2ZMEC 1XDSA 3OYJA 2OUMA 1HKSA 4FT8A 1S7EA 2BHYA 1UELB 3QQAA 3W2VA 3ZOBA 2Z16A 3EPZA 1IW7F 5B1BH 3M3YJ 1FY7A 5F1JA 4WXCA 1PJRA 3CCSI 2LSOA 2CSOA 3PFIA 2XGXA 1MBKA 5JHFA 3M8EA 2PG4A 4W1UA 4ITVA 4CO8A 2R7QA 1NG6A 3BWGA 4EM0B 4LITA 3OYIA 4H0EA 4RM2A 3EUKL 4NDLA 3E6BA 1UZCA 2QZ8A 3RKQA 3HM5A 5FO5A 4XRMA 2A6TA 4L5IA 4II2A 2EIMH 2QQAA 2VBXA 3KYCB 4M72A 4A6DA 3R6SA 1LEAA 2V1NA 3RKWA 2EWNA 5EEGA 5ILSA 2NS7A 3GXOA 4ESBA 2DW4A 4M6YA 2DFIA 3KIOA 4HF1A 1K6OA 2PJRB 4JX6A 2DDAA 2PMZN 2VC1A 2JUGA 1TT0A 2RV8A 1JE8A 3VFZA 5E18F 1ETXA 1U9NA 1ZR4A 4GO1A 5EEHA 3OOPA 3BTLA 3FX3A 2HOSA 3WTZA 5F6FA 1ONVA 3S1NJ 3TQNA 1VQNI 4M6XA 1MNMC 5ICGA 1RESA 2A05A 4E7IA 4IHWA 5A2QK 4BAYA 3U1DA 3S1QJ 3PSFA 4L18B 3ML6A 2Z99A 2JN6A 2XV4S 3NAUA 4N4OB 1I6XA 4Y33A 3G1LA 1PUEE
chains in the Genus database with same CATH topology
4IHVA 2X6OA 3BR1A 1IC8A 1Y1WJ 1U78A 1E3OC 1FTTA 5EEAA 2O7OA 3K7AJ 5GPCA 2H1KA 5E3NA 1R9TJ 2QF7A 5E3OA 4X6AJ 4BY1J 5FKNA 3LNQA 3O8GA 1XG1A 1IDYA 1PUFA 2NVQJ 3DCFA 2DJNA 2MW8A 4BBSJ 3G1MA 2LFBA 2W48A 4A3EJ 2DA5A 1BW5A 4AC0A 3TP3A 3CDLA 3BR0A 1H88C 3HOZJ 1B8IB 1HF0A 2L9RA 4RBOA 4XRSG 2DMUA 3ZQGA 1AHDP 2CUFA 1CQTA 1FJLA 3JRIA 4ABZA 1LE8A 5M3MJ 4S0HB 1RR7A 1MBGA 1APLC 3S1MJ 1GDTA 1TWAJ 2JA8J 5C4XJ 1JT0A 1JUPA 3JR9A 1JT6A 2X48A 4A3JJ 3MKLA 1ETWA 3OSFA 1W0UA 1OCTC 3E7LA 1NK2P 2ECBA 1JKRC 5F08A 2NVTJ 3BTCA 3SDGA 2VKEA 4LOCA 1TWHJ 3S14J 1YRNB 3Q0UA 3JRBA 1AKHA 4GFBA 2VPRA 3S1RJ 2GM4A 3S15J 2TRTA 4XIDA 1OJLA 3FISA 1ZQ3P 3TEDA 1IGNA 1MBHA 1U9OA 5K7HA 4FCYA 1T56A 4DYCA 5EGOB 3L1PA 3A01B 1HDDC 2MGQA 1A5JA 4C2MJ 5IPAA 1DU6A 1ORKA 2L7ZA 4A3BJ 3GBGA 1Z77A 1F43A 1TWCJ 2DA7A 2VI6A 4A3LJ 2JA5J 4D7NA 1XC5A 5EDNA 2VKVA 1JUMA 3RQIA 1HDPA 2Y9ZA 4FE7A 3GTGJ 4XRSA 1ETYA 4FISA 2JA7J 2YS9A 4JX5A 1I50J 5E3LA 5EZGA 4UUSB 2WB1N 1MBFA 4JX4A 3S16J 3A02A 4Y7NJ 2R5ZA 3IH3A 3ZQLA 2LLKA 3CMYA 2ME6A 1MBEA 1OCPA 5IYBJ 1JTXA 5BNGA 3K2AA 3CCYA 3QPSA 3GTJJ 1ETOA 1POGA 4BXXJ 2LR8A 2LY9A 2IBDA 2IAIA 1ZK8A 2EZKA 4I76A 4MO7A 4D5FA 2Y9YA 2ECCA 2HDDA 1RPWA 3LSJA 1WH7A 2EZHA 2DTZA 3HOXJ 2MG4A 1T33A 1IV6A 4X1EA 2DMPA 4A93J 5F0CA 1UMQA 2R7ZJ 1X2MA 2ME0A 5FJ8J 4W97A 3BG5A 1I6HJ 2NVYJ 4RDUA 3ZQHA 5IOZA 1HOMA 3QPLA 1BJZA 2XPVA 2LK2A 2EZLA 3MVPA 5C4JJ 1SFOJ 1G2HA 2XB5A 2HXIA 2Y30A 2COBA 4A3GJ 1HCRA 4MLOA 3B6AA 2CQXA 2WAQN 2I10A 2HI3A 1QVTA 4BBRJ 5M5XJ 5EZHA 1ZKGA 2OF7A 5HODA 3JRHA 3HDDA 1QRYA 1WGXA 4MFDA 1ZTRA 2HOTA 4FTHA 4A3KJ 1JTYA 1O4XA 5FKLA 2M8GX 2GLOA 5IP7J 3A03A 2LD5A 2JJ7A 5IOYA 3H0GJ 1VNDA 1K83J 1QVUA 1WPKA 2X9DA 2HXOA 2HYJA 2FJ1A 4A3FJ 2LP0A 5C44J 2RAEA 2WV1A 5EG0B 5F04A 2XPUA 2B63J 3C2BA 2XB0X 5FKOA 5K7FA 3LSPA 1RKWA 1BW6A 2DMQA 2M0CA 2DN0A 5F27A 2DA1A 4JYKA 5M5WJ 4IHXA 5GPAA 1PUFB 4V2GA 2FQ4A 2P81A 5M3FJ 4A3IJ 4QTRA 3FK7A 2LKXA 1IJWC 1WH5A 3HGYA 2E2JJ 5FLVA 1UG2A 1JKQC 1K61A 1Q1VA 3Q0WA 4QIWN 5M5YJ 2AO9A 3WHCA 3JREA 2VUMJ 2Y0SN 2Y31A 2K40A 5IYCJ 2EQRA 2ELKA 3ZQIA 1B72A 2L7MP 3LSRA 1LE8B 1D5YA 2ZB9A 1LFUP 3G1OA 2TCTA 4D7MA 4J19A 2K9QA 5E3MA 2E1OA 4AUXA 1NTCA 2DA2A 3GTMJ 4IHYA 2CU7A 3OIOA 1JJ8C 3ZQCA 2JA6J 3M4OJ 1X2NA 1JGGA 2AHQA 2R5YA 1ETQA 2YUSA 4C3IJ 5JLWA 5F0FA 1IRZA 3IH4A 5DTDA 3S2DJ 1BA5A 3FK6A 4CYCA 3PM1A 4V2FA 1ZR2A 1AKHB 4QSHA 3HOUJ 1QPIA 2QCOA 2R93J 1GV2A 3BQZA 3O8HA 1MH3A 3BQYA 3TW7A 2XGDA 2XGCA 1MSEC 3LSGA 2DA4A 4FE4A 2KT0A 1EF4A 3VPRA 3HOVJ 1FIPA 1VF9A 1IG7A 3B6CA 2E2HJ 4M3DA 2R92J 4IEJA 2XRLA 5J3LA 3PO2J 3S2HJ 1I3QJ 3JRGA 3HOWJ 1ZGWA 2D5VA 5JLXA 5J1RA 3S17J 1A6IA 5FKMA 2O9LA 3BR5A 5IP9J 2K9NA 5K7ZA 1OFCX 4JP0A 3HGGA 3FKIJ 2R0QC 2XGEA 1HLVA 1MH4A 4DYRA 3IV5A 2R5ZB 2ID3A 5F0HA 3JRAA 4M3GA 3WHBA 2NVXJ 1UHSA 4AYBN 1Y1VJ 3HOYJ 5FKKA 2FX0A 4B4CA 1FIAA 3GTLJ 2YU9J 1P7JA 1IUFA 5FLMJ 2LVSA 1VFCA 4M3EA 2DA3A 3MN2A 1XS9A 3LOCA 5J1YA 1YRNA 4C3HJ 2EBIA 2NS8A 5IP6A 3DEWA 4B3AA 5C3EJ 4C3JJ 2G0EA 2OPTA 2CRGA 3BG3A 5DS9A 1TWGJ 3IH2A 4MIMA 5EGOA 3A01A 1ENHA 3RZDJ 2MSYA 2O8KA 2IEKA 4L5EA 4DZPA 2XSDC 3GTOJ 3OSGA 3UKGA 4A3DJ 2LTPA 4BKXA 4XICA 5EF6A 4MFEA 3TW6A 1VI0A 4M3BA 2CUEA 1TC3C 2EZIA 1U8BA 9ANTA 3SJMA 3JRFA 1WCMJ 2E2IJ 4I6ZA 4M3FA 4D5CA 3CQZJ 1MBJA 5EYRA 4DW6A 3BR6A 1ETVA 2H8RA 1LFBA 3FIWA 3GTKJ 2K9SA 3HB9A 5J1UA 3I4MJ 3TP0A 1H89C 3BR3A 2KDZA 1Z0XA 4UUSA 1WI3A 4A3CJ 4A3MJ 1ITYA 2E19A 1W0TA 3OOUA 2M34A 1RKTA 1BL0A 2L0KA 2XPWA 3F0CA 4UUTA 4M6VA 1IDZA 2FD5A 2GBYA 2JMWA 4HNVA 3HBLA 1ETKA 2NOGA 3H3VK 2CQQA 1TWFJ 1SANA 2CJJA 2Y2ZA 1F36A 3HEFA 4G12A 2HQ5A 3GTPJ 3RZOJ 2JWTA 5GP9A 2JK3A 1FEXA 4DZJA 1S7EA 2HOAA 1FTZA 4EEFG 3QQAA 3ZOBA 2DMNA 3BR2A 2L7FP 3M3YJ 2M2EA 4B1RA 5F1JA 1GT0C 3JRDA 3Q0VA 3ZQFA 3JRCA 1GVDA 1MBKA 4W1UA 4DYQA 1MSFC 1H8AC 3HKZN 3Q3SA 4XK4A 3BT9A 4NDLA 3I4NJ 3RKQA 3HM5A 4XRMA 1B72B 3W6VA 2NS7A 4A69C 1DU0A 4JX6A 3BG9A 3NARA 3PO3J 2PMZN 4BY7J 1JUSA 1GUUA 2DMTA 3BTIA 1B8IA 5IYDJ 2M9HA 2R5YB 1ETXA 1P7IA 1U9NA 3SFIA 1ZR4A 4Y52J 3BTLA 3GTQJ 2HOSA 3S1NJ 1MNMC 1JKOC 4CYCB 1RESA 1JKPC 3D1NI 4IHWA 1GV5A 1RETA 2ID6A 1X58A 1NK3P 3S1QJ 2DA6A 1JJ6C 2JN6A 2EH3A 2N8GA 3BTJA 3NAUA 5EG0A 1AU7A 3G1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHV A;  2X6O A;  3BR1 A;  1IC8 A;  1Y1W J;  1U78 A;  1E3O C;  1FTT A;  5EEA A;  2O7O A;  3K7A J;  5GPC A;  2H1K A;  5E3N A;  1R9T J;  2QF7 A;  5E3O A;  4X6A J;  4BY1 J;  5FKN A;  3LNQ A;  3O8G A;  1XG1 A;  1IDY A;  1PUF A;  2NVQ J;  3DCF A;  2DJN A;  2MW8 A;  4BBS J;  3G1M A;  2LFB A;  2W48 A;  4A3E J;  2DA5 A;  1BW5 A;  4AC0 A;  3TP3 A;  3CDL A;  3BR0 A;  1H88 C;  3HOZ J;  1B8I B;  1HF0 A;  2L9R A;  4RBO A;  4XRS G;  2DMU A;  3ZQG A;  1AHD P;  2CUF A;  1CQT A;  1FJL A;  3JRI A;  4ABZ A;  1LE8 A;  5M3M J;  4S0H B;  1RR7 A;  1MBG A;  1APL C;  3S1M J;  1GDT A;  1TWA J;  2JA8 J;  5C4X J;  1JT0 A;  1JUP A;  3JR9 A;  1JT6 A;  2X48 A;  4A3J J;  3MKL A;  1ETW A;  3OSF A;  1W0U A;  1OCT C;  3E7L A;  1NK2 P;  2ECB A;  1JKR C;  5F08 A;  2NVT J;  3BTC A;  3SDG A;  2VKE A;  4LOC A;  1TWH J;  3S14 J;  1YRN B;  3Q0U A;  3JRB A;  1AKH A;  4GFB A;  2VPR A;  3S1R J;  2GM4 A;  3S15 J;  2TRT A;  4XID A;  1OJL A;  3FIS A;  1ZQ3 P;  3TED A;  1IGN A;  1MBH A;  1U9O A;  5K7H A;  4FCY A;  1T56 A;  4DYC A;  5EGO B;  3L1P A;  3A01 B;  1HDD C;  2MGQ A;  1A5J A;  4C2M J;  5IPA A;  1DU6 A;  1ORK A;  2L7Z A;  4A3B J;  3GBG A;  1Z77 A;  1F43 A;  1TWC J;  2DA7 A;  2VI6 A;  4A3L J;  2JA5 J;  4D7N A;  1XC5 A;  5EDN A;  2VKV A;  1JUM A;  3RQI A;  1HDP A;  2Y9Z A;  4FE7 A;  3GTG J;  4XRS A;  1ETY A;  4FIS A;  2JA7 J;  2YS9 A;  4JX5 A;  1I50 J;  5E3L A;  5EZG A;  4UUS B;  2WB1 N;  1MBF A;  4JX4 A;  3S16 J;  3A02 A;  4Y7N J;  2R5Z A;  3IH3 A;  3ZQL A;  2LLK A;  3CMY A;  2ME6 A;  1MBE A;  1OCP A;  5IYB J;  1JTX A;  5BNG A;  3K2A A;  3CCY A;  3QPS A;  3GTJ J;  1ETO A;  1POG A;  4BXX J;  2LR8 A;  2LY9 A;  2IBD A;  2IAI A;  1ZK8 A;  2EZK A;  4I76 A;  4MO7 A;  4D5F A;  2Y9Y A;  2ECC A;  2HDD A;  1RPW A;  3LSJ A;  1WH7 A;  2EZH A;  2DTZ A;  3HOX J;  2MG4 A;  1T33 A;  1IV6 A;  4X1E A;  2DMP A;  4A93 J;  5F0C A;  1UMQ A;  2R7Z J;  1X2M A;  2ME0 A;  5FJ8 J;  4W97 A;  3BG5 A;  1I6H J;  2NVY J;  4RDU A;  3ZQH A;  5IOZ A;  1HOM A;  3QPL A;  1BJZ A;  2XPV A;  2LK2 A;  2EZL A;  3MVP A;  5C4J J;  1SFO J;  1G2H A;  2XB5 A;  2HXI A;  2Y30 A;  2COB A;  4A3G J;  1HCR A;  4MLO A;  3B6A A;  2CQX A;  2WAQ N;  2I10 A;  2HI3 A;  1QVT A;  4BBR J;  5M5X J;  5EZH A;  1ZKG A;  2OF7 A;  5HOD A;  3JRH A;  3HDD A;  1QRY A;  1WGX A;  4MFD A;  1ZTR A;  2HOT A;  4FTH A;  4A3K J;  1JTY A;  1O4X A;  5FKL A;  2M8G X;  2GLO A;  5IP7 J;  3A03 A;  2LD5 A;  2JJ7 A;  5IOY A;  3H0G J;  1VND A;  1K83 J;  1QVU A;  1WPK A;  2X9D A;  2HXO A;  2HYJ A;  2FJ1 A;  4A3F J;  2LP0 A;  5C44 J;  2RAE A;  2WV1 A;  5EG0 B;  5F04 A;  2XPU A;  2B63 J;  3C2B A;  2XB0 X;  5FKO A;  5K7F A;  3LSP A;  1RKW A;  1BW6 A;  2DMQ A;  2M0C A;  2DN0 A;  5F27 A;  2DA1 A;  4JYK A;  5M5W J;  4IHX A;  5GPA A;  1PUF B;  4V2G A;  2FQ4 A;  2P81 A;  5M3F J;  4A3I J;  4QTR A;  3FK7 A;  2LKX A;  1IJW C;  1WH5 A;  3HGY A;  2E2J J;  5FLV A;  1UG2 A;  1JKQ C;  1K61 A;  1Q1V A;  3Q0W A;  4QIW N;  5M5Y J;  2AO9 A;  3WHC A;  3JRE A;  2VUM J;  2Y0S N;  2Y31 A;  2K40 A;  5IYC J;  2EQR A;  2ELK A;  3ZQI A;  1B72 A;  2L7M P;  3LSR A;  1LE8 B;  1D5Y A;  2ZB9 A;  1LFU P;  3G1O A;  2TCT A;  4D7M A;  4J19 A;  2K9Q A;  5E3M A;  2E1O A;  4AUX A;  1NTC A;  2DA2 A;  3GTM J;  4IHY A;  2CU7 A;  3OIO A;  1JJ8 C;  3ZQC A;  2JA6 J;  3M4O J;  1X2N A;  1JGG A;  2AHQ A;  2R5Y A;  1ETQ A;  2YUS A;  4C3I J;  5JLW A;  5F0F A;  1IRZ A;  3IH4 A;  5DTD A;  3S2D J;  1BA5 A;  3FK6 A;  4CYC A;  3PM1 A;  4V2F A;  1ZR2 A;  1AKH B;  4QSH A;  3HOU J;  1QPI A;  2QCO A;  2R93 J;  1GV2 A;  3BQZ A;  3O8H A;  1MH3 A;  3BQY A;  3TW7 A;  2XGD A;  2XGC A;  1MSE C;  3LSG A;  2DA4 A;  4FE4 A;  2KT0 A;  1EF4 A;  3VPR A;  3HOV J;  1FIP A;  1VF9 A;  1IG7 A;  3B6C A;  2E2H J;  4M3D A;  2R92 J;  4IEJ A;  2XRL A;  5J3L A;  3PO2 J;  3S2H J;  1I3Q J;  3JRG A;  3HOW J;  1ZGW A;  2D5V A;  5JLX A;  5J1R A;  3S17 J;  1A6I A;  5FKM A;  2O9L A;  3BR5 A;  5IP9 J;  2K9N A;  5K7Z A;  1OFC X;  4JP0 A;  3HGG A;  3FKI J;  2R0Q C;  2XGE A;  1HLV A;  1MH4 A;  4DYR A;  3IV5 A;  2R5Z B;  2ID3 A;  5F0H A;  3JRA A;  4M3G A;  3WHB A;  2NVX J;  1UHS A;  4AYB N;  1Y1V J;  3HOY J;  5FKK A;  2FX0 A;  4B4C A;  1FIA A;  3GTL J;  2YU9 J;  1P7J A;  1IUF A;  5FLM J;  2LVS A;  1VFC A;  4M3E A;  2DA3 A;  3MN2 A;  1XS9 A;  3LOC A;  5J1Y A;  1YRN A;  4C3H J;  2EBI A;  2NS8 A;  5IP6 A;  3DEW A;  4B3A A;  5C3E J;  4C3J J;  2G0E A;  2OPT A;  2CRG A;  3BG3 A;  5DS9 A;  1TWG J;  3IH2 A;  4MIM A;  5EGO A;  3A01 A;  1ENH A;  3RZD J;  2MSY A;  2O8K A;  2IEK A;  4L5E A;  4DZP A;  2XSD C;  3GTO J;  3OSG A;  3UKG A;  4A3D J;  2LTP A;  4BKX A;  4XIC A;  5EF6 A;  4MFE A;  3TW6 A;  1VI0 A;  4M3B A;  2CUE A;  1TC3 C;  2EZI A;  1U8B A;  9ANT A;  3SJM A;  3JRF A;  1WCM J;  2E2I J;  4I6Z A;  4M3F A;  4D5C A;  3CQZ J;  1MBJ A;  5EYR A;  4DW6 A;  3BR6 A;  1ETV A;  2H8R A;  1LFB A;  3FIW A;  3GTK J;  2K9S A;  3HB9 A;  5J1U A;  3I4M J;  3TP0 A;  1H89 C;  3BR3 A;  2KDZ A;  1Z0X A;  4UUS A;  1WI3 A;  4A3C J;  4A3M J;  1ITY A;  2E19 A;  1W0T A;  3OOU A;  2M34 A;  1RKT A;  1BL0 A;  2L0K A;  2XPW A;  3F0C A;  4UUT A;  4M6V A;  1IDZ A;  2FD5 A;  2GBY A;  2JMW A;  4HNV A;  3HBL A;  1ETK A;  2NOG A;  3H3V K;  2CQQ A;  1TWF J;  1SAN A;  2CJJ A;  2Y2Z A;  1F36 A;  3HEF A;  4G12 A;  2HQ5 A;  3GTP J;  3RZO J;  2JWT A;  5GP9 A;  2JK3 A;  1FEX A;  4DZJ A;  1S7E A;  2HOA A;  1FTZ A;  4EEF G;  3QQA A;  3ZOB A;  2DMN A;  3BR2 A;  2L7F P;  3M3Y J;  2M2E A;  4B1R A;  5F1J A;  1GT0 C;  3JRD A;  3Q0V A;  3ZQF A;  3JRC A;  1GVD A;  1MBK A;  4W1U A;  4DYQ A;  1MSF C;  1H8A C;  3HKZ N;  3Q3S A;  4XK4 A;  3BT9 A;  4NDL A;  3I4N J;  3RKQ A;  3HM5 A;  4XRM A;  1B72 B;  3W6V A;  2NS7 A;  4A69 C;  1DU0 A;  4JX6 A;  3BG9 A;  3NAR A;  3PO3 J;  2PMZ N;  4BY7 J;  1JUS A;  1GUU A;  2DMT A;  3BTI A;  1B8I A;  5IYD J;  2M9H A;  2R5Y B;  1ETX A;  1P7I A;  1U9N A;  3SFI A;  1ZR4 A;  4Y52 J;  3BTL A;  3GTQ J;  2HOS A;  3S1N J;  1MNM C;  1JKO C;  4CYC B;  1RES A;  1JKP C;  3D1N I;  4IHW A;  1GV5 A;  1RET A;  2ID6 A;  1X58 A;  1NK3 P;  3S1Q J;  2DA6 A;  1JJ6 C;  2JN6 A;  2EH3 A;  2N8G A;  3BTJ A;  3NAU A;  5EG0 A;  1AU7 A;  3G1L A; 
#chains in the Genus database with same CATH topology
 3P7N A;  2VC0 A;  3KYD B;  4RMN A;  3AG2 H;  2VLA A;  1U78 A;  4XMY A;  5FFX A;  4L5J A;  3LFK A;  5ICF A;  3Q5F A;  5E3O A;  2OBP A;  1V55 H;  4PK4 A;  5FKN A;  4BY1 J;  4X6A J;  1ZG5 A;  4IXA A;  1XG1 A;  3BCA A;  2P8T A;  2NVQ J;  2LBF A;  3QP5 A;  3BJA A;  5E17 F;  1YS6 A;  3LSI A;  2KIQ A;  2ZXI A;  3BG7 A;  4BNC A;  5AIQ A;  2H6B A;  1B6A A;  1I5Z A;  3G1M A;  3ZRG A;  4J00 A;  3DKY A;  1MMS A;  4A3E J;  1R5I D;  2DA5 A;  1BW5 A;  3S93 A;  3CO7 C;  4OAZ A;  5BPI A;  1RRJ A;  1H88 C;  1HF0 A;  4KIG A;  3GZN B;  4XRS G;  1AHD P;  2CUF A;  4U0W A;  1FJL A;  2IS1 A;  3FXK A;  3X2Q H;  3M9A A;  4U0Y A;  1S7O A;  4S0H B;  3DKW A;  1OQY A;  2F5E A;  3GFL A;  1MBG A;  1PP7 U;  1APL C;  5FD5 A;  1GDT A;  1TWA J;  3K9T A;  1DUX C;  2RN7 A;  1JT6 A;  1OMI A;  3BJO A;  1SFE A;  4KT6 A;  5H6R A;  3COA C;  2A5W A;  2KKO A;  1OCT C;  3CUQ B;  2VKD A;  5DUK A;  3CCV I;  1QGP A;  1E3P A;  5F08 A;  4KA4 A;  1TWH J;  1T38 A;  3MKW B;  3S32 A;  5GTI C;  4N4N B;  3KP3 A;  1AA7 A;  4C2T A;  3JRB A;  3CCJ I;  1AKH A;  3S15 J;  1EH8 A;  3L2Q A;  4ZTF A;  2GXB A;  2TRT A;  3OL3 A;  3V7C A;  4XID A;  2GQQ A;  1LQ1 A;  3F23 A;  2HPM A;  1QPM A;  3DWL E;  3FIS A;  3HXL A;  4P96 A;  4IHT A;  5K7H A;  1P92 A;  5ED4 A;  5IT9 K;  1T56 A;  3A01 B;  3L1P A;  4D0P A;  1HDD C;  4YIF A;  4C2M J;  3DPT A;  1KU9 A;  2XF7 A;  4IVN A;  2M7B A;  1I39 A;  2Q1Z B;  1ORK A;  4A3B J;  3IKT A;  1Z77 A;  3ZQ7 A;  1S6L A;  2KRH A;  1DPR A;  1TWC J;  2DA7 A;  2GXG A;  3JTH A;  3T8R A;  3KFW X;  1IXC A;  3RQI A;  4AD9 A;  2D1V A;  3AG4 H;  4XRS A;  5DEQ A;  2VJI A;  1ETY A;  4AID A;  2JA7 J;  3ZMT A;  1YJ9 I;  2FQ3 A;  4LIU A;  1CGP A;  1I50 J;  5E3L A;  2M0M A;  1IXR C;  5EZG A;  1ZYR F;  4JBA A;  5H2F C;  3HUG A;  2FBH A;  2VE9 A;  3S16 J;  2WWY A;  1Z91 A;  3GME A;  1QHG A;  4ESF A;  1IN4 A;  1A31 A;  1ERD A;  2CO5 A;  2E5Z A;  3BOQ A;  1FSE A;  3ZN0 A;  1B1B A;  5IYB J;  1OPC A;  1XMA A;  1BJA A;  3UNG C;  2DQL A;  1LFP A;  3F72 A;  2NNN A;  2IAI A;  3F8F A;  1Z6R A;  4B44 A;  1U5T B;  4MO7 A;  2KJC A;  4XON A;  5F64 A;  1IZ1 A;  3H9G A;  2L4A A;  3LSJ A;  1WH7 A;  1UG0 A;  2DTZ A;  2FA5 A;  4HX7 A;  3TL4 X;  3H1C A;  4HEA 2;  3E6C C;  1R4N B;  3VSK A;  1WKM A;  1UMQ A;  2R7F A;  2R7Z J;  2YR2 A;  5K5R A;  4V19 K;  2IRF G;  4L9V A;  2BXZ A;  2D45 A;  1S9H A;  3CC7 I;  3HSR A;  5E79 C;  3KEO A;  3ZQH A;  1HOM A;  2MC4 A;  1RNL A;  1XMK A;  2NS0 A;  1TQP A;  2KMU A;  1REP C;  2BGC A;  1YOV B;  1BBY A;  2RNG A;  1SFO J;  1T0F A;  1Z6T A;  2OU2 A;  2XIG A;  2Y30 A;  4MLO A;  1ZRD A;  4F7Z A;  4EM2 A;  2KIF A;  3VYT B;  2LF8 A;  5HOD A;  3JRH A;  4Z2Y A;  1QRY A;  2PI0 A;  1T0F C;  1ZTR A;  3S8P A;  1N25 A;  5CYV A;  1S3J A;  3FXU A;  5FKL A;  1P4X A;  4CIC A;  2WC2 A;  2GLO A;  1IRX A;  2COM A;  1TTY A;  1VND A;  3A2K A;  1WPK A;  4XM3 A;  1TT5 B;  2E1M B;  2O5R A;  2K86 A;  2V6C A;  2BBY A;  2FJ1 A;  3VYR B;  1J7K A;  4A3F J;  2LP0 A;  4CYD A;  1LVK A;  3G3Z A;  5C44 J;  2RAE A;  3TO7 A;  1VQ9 I;  5F04 A;  2HEO A;  3P5J A;  2B63 J;  2PEX A;  2EPF A;  2BXY A;  1O7F A;  2A61 A;  1BW6 A;  1XSX A;  2DN0 A;  3ZMU A;  3ULQ B;  4ZYA A;  5BS6 A;  4BE2 A;  2VON A;  2QSG X;  1K7A A;  2K85 A;  2DT7 B;  2GOX B;  3BZC A;  4A3I J;  2K3P A;  2P5V A;  4OIO F;  5EJC A;  4AU7 A;  2J5O A;  1IXS B;  3B02 A;  4XLH A;  5FRM A;  1UG2 A;  3QPT A;  2MLK A;  3ZMZ A;  1HKQ A;  1Q1V A;  3WOD F;  5M5Y J;  2YX7 A;  5K5O A;  3CTA A;  1QZE A;  2X1D A;  4BGD A;  2RQP A;  1D5Y A;  2BE5 F;  4XSZ F;  2ZB9 A;  1V5F A;  2E1N A;  3SEZ A;  3L9F A;  4J19 A;  5CPR B;  4U7D A;  3L2U A;  3K4C A;  1UCR A;  2PJR A;  4XLP F;  2IXS A;  3LST A;  3A1Y A;  4IHY A;  2JA6 J;  1F9N A;  4ZZL A;  2AHQ A;  5A2Q Z;  3K4K A;  4WF2 A;  3DQV C;  2F6C A;  2A6E F;  1K6Y A;  2LMD A;  3FK6 A;  1KGS A;  3QWL A;  4QWQ A;  1FC3 A;  4QSH A;  2QGU A;  4LLG F;  4HSR A;  5LRS A;  1P4A A;  3O8H A;  4RAG A;  2FOW A;  4KJZ A;  1USS A;  1MJ9 A;  3DLA A;  2HVQ A;  3DPL C;  3PNT A;  2CW8 A;  3WU2 C;  1ACI A;  5FRO A;  3V7R A;  2KT0 A;  3IRR A;  1ZN2 A;  4G6D A;  4HDV A;  2OZ6 A;  4KMF A;  2XRL A;  1D0Y A;  4MQV A;  3JSO A;  3PO2 J;  3K4B A;  2DCE A;  1ZLJ A;  3JRG A;  4KFC A;  3FBN B;  3RYP A;  5D5W B;  1OIS A;  2P5L C;  2ZJQ F;  5CJ9 A;  1BI3 A;  5CLS A;  4XLC A;  3HOW J;  1MDM B;  3A4C A;  5FKM A;  2FNA A;  1QNT A;  5BPD A;  1LKX A;  2DFF A;  2PJP A;  2Z3Y A;  1WJE A;  3ERM A;  4BHC A;  1VQK I;  1PVE A;  3VWB A;  1TBX A;  2RKH A;  3JRA A;  1A36 A;  1FX7 A;  1U0J A;  2HTS A;  4M3G A;  5GAG J;  1W5C C;  2JQ7 A;  5KK1 A;  2NVX J;  1Y1V J;  1X1D A;  3HOY J;  5FKK A;  3EET A;  2H8W A;  3K10 A;  3RQ4 A;  4OIP F;  4UV8 A;  2BY0 A;  2YU9 J;  3CUQ A;  4LG3 A;  3G73 A;  5GAD J;  1LUJ B;  2LVS A;  3QOE A;  1BN5 A;  1YLF A;  3SYT A;  4HBL A;  1XSD A;  2L01 A;  2P4W A;  3LOC A;  5J1Y A;  3TDU C;  3P9C A;  4C3H J;  3DBL B;  3DKX A;  2XAU A;  1QQI A;  4ENN A;  4ZYE A;  3CUQ C;  4C3J J;  4U7B A;  2QBY B;  1UB9 A;  4U87 A;  4G8X A;  3LA2 A;  1R5H A;  2G7H A;  2PQ8 A;  2CRG A;  4G6Q A;  2UXX A;  3PNY A;  4KIC A;  4XLA A;  1BR1 A;  1XSV A;  4BHB A;  4N0B A;  3A01 A;  1ENH A;  3RZD J;  2VE8 A;  2MSY A;  5GTH C;  1SMY F;  2HYF A;  4RB2 C;  3GTO J;  1YO5 C;  4F52 A;  2ADU A;  3FMS A;  4NBQ A;  3RKX A;  4IO9 F;  3OSG A;  4A3D J;  2HDW A;  3K1N A;  4C9Y A;  3WTT C;  2NRA C;  5LHH A;  3SJM A;  3PL8 A;  1E2X A;  2CUZ A;  3ECH A;  2IA1 A;  1MBJ A;  2F2E A;  4XOT A;  1J75 A;  2HGC A;  2KDO A;  2MYS A;  3I53 A;  1R22 A;  2GAU A;  1H89 C;  4AYB A;  3BR3 A;  2VBZ A;  4EAT A;  1HQC A;  2DXI A;  4XL9 A;  2V79 A;  3OR1 C;  2M34 A;  1T6S A;  3EYI A;  5KHD A;  1Z05 A;  1LJ9 A;  3WE3 A;  4M6V A;  3DP7 A;  4FQG A;  2FD5 A;  3QYE A;  1VQ8 I;  1ETK A;  1SVM A;  3U21 A;  3J81 K;  1TLH B;  2R7S A;  3GUD A;  4CUG A;  3TMO A;  1X4P A;  4O3M A;  3RZO J;  1XDU A;  5L3B A;  2MD0 A;  5HS9 A;  2A3S A;  2HOA A;  3IWF A;  1FTZ A;  2ZXW H;  3QAH A;  1FLI A;  2HS5 A;  5TIS C;  5ICE A;  3BR2 A;  3RPQ A;  3UR3 C;  5DM7 F;  3IHU A;  3F3X A;  4B1R A;  2CS3 A;  5GAH J;  3CME I;  1U5T C;  4H4K C;  1ZH5 A;  4L0Y B;  2JVG A;  3WE2 A;  5L3F A;  1K4T A;  4DYQ A;  1FT9 A;  2EFQ A;  2BHZ A;  3HJE A;  3HKZ N;  1H8A C;  3ELK A;  4XK4 A;  3BT9 A;  3MQ0 A;  5DCM B;  3I4N J;  1BI2 A;  2RDP A;  3TDZ C;  4A2U A;  2VQC A;  2H27 A;  4F3Q A;  1OCC H;  2DI3 A;  4A0Y A;  2CQN A;  3K4M A;  4PGG A;  3W6V A;  1QZY A;  4G6T B;  2Z33 A;  2MC3 A;  3FXL A;  3HRS A;  2F4I A;  3HIF A;  3KCC A;  5J8C A;  2FUG 2;  3NAR A;  1B8I A;  3BTI A;  1SD4 A;  4WXD A;  1MJA A;  1K78 B;  3SFI A;  4G7O F;  1BR2 A;  1I1G A;  3GTQ J;  4DNC A;  2AQF A;  1IAW A;  1ZLK A;  4DGW B;  3HYI A;  3D1N I;  3OMY A;  2IPQ X;  1NK3 P;  3K4L A;  1SC7 A;  2N8G A;  2GZW A;  4Q4Z F;  4HYE A;  2VQG A;  2VJ4 A;  3IRQ A;  2XAG A;  2LOO A;  2P0W A;  5D4R A;  4UHT A;  1DP7 P;  2VOD A;  1FTT A;  3ZQQ A;  5EEA A;  2O7O A;  4XNF A;  2E1M C;  3K7A J;  5GPC A;  2RC4 A;  4I0B A;  5E3N A;  2ZJP F;  4BEH B;  2RRE A;  1UAA A;  4ESJ A;  4UB6 C;  2DDB A;  4KMU X;  4Y17 A;  2QEN A;  2DJN A;  5D4S A;  2IS6 A;  5DD8 A;  1KU3 A;  2LFB A;  2W48 A;  1ZG3 A;  3TP3 A;  4IX7 A;  1HBX G;  3GFJ A;  4Y4R A;  3KYL A;  2BYV E;  4RBO A;  3G2B A;  3ZPL A;  3E1S A;  3V42 A;  3OYM A;  4P9U A;  1YJN I;  1VQ4 I;  2NXN B;  3BCB A;  2PMZ A;  1XN7 A;  3DXJ F;  5ERI A;  2WBM A;  3ZMV A;  1RR7 A;  1NG7 A;  3BDD A;  1R6R A;  4E7L A;  2OC6 A;  1J59 A;  3LWF A;  2JA8 J;  1JT0 A;  1J0R A;  3I55 I;  2P5K A;  4A3J J;  5ICC A;  1W0U A;  1D0X A;  5B3S H;  4XR6 A;  4Y15 A;  1T08 B;  4PSX A;  3GX4 X;  1LDJ A;  1NK2 P;  2ECB A;  2NVT J;  4GDF A;  4CCO A;  3S14 J;  2JT1 A;  3TOB A;  3WU1 B;  4GFB A;  3S2W A;  2CYY A;  3O3K A;  2I8D A;  2CW7 A;  1VQL I;  2HU9 A;  1OJL A;  4CZC A;  1H9G A;  1GVJ A;  2K02 A;  1XCV A;  2XAH A;  1W4M A;  3TED A;  3I9V 2;  1IGN A;  1ZQ3 P;  1MBH A;  2GOM A;  2IS4 A;  1BM9 A;  2VKH A;  2RVC A;  4L9N A;  4JOM A;  1X3W B;  1X1P A;  1Z21 A;  1CF7 B;  4EGY A;  1A5J A;  1VZ0 A;  2OTJ I;  3CMM A;  3RJP A;  2EV0 A;  2WAE A;  3R60 A;  4KIB A;  3GBG A;  5LFA A;  5HS8 A;  2VIX A;  3FMQ A;  3LQQ A;  1J09 A;  1F43 A;  3OIQ A;  2DT6 A;  3LL7 A;  4A3L J;  3D5L A;  1MMA A;  5EDN A;  2VKV A;  1JUM A;  1HDP A;  2X6Y A;  2A5Y B;  1NH3 A;  3FXJ A;  3FZV A;  4RS8 A;  4EV0 A;  2BVM A;  4E7H A;  1WFX A;  1MDM A;  4YEJ A;  1XGS A;  4UXN A;  3LA7 A;  4UUS B;  4N9H A;  2V9P A;  1ZAR A;  3A02 A;  4MHG A;  3C2H A;  2GA2 A;  3QPH A;  4QPQ A;  3S3O A;  3OWT A;  4HPQ A;  1OCP A;  1MND A;  5H6Q A;  1JTX A;  1UFM A;  1RI7 A;  2VB6 A;  3OR2 C;  3FKJ A;  3CCY A;  3HHH A;  3RPU A;  3GTJ J;  1POG A;  4M74 A;  2LR8 A;  4KYW A;  2DOD A;  1YG2 A;  2GWR A;  2LY9 A;  4NC8 A;  1SFK A;  1F1Z A;  1HST A;  4I76 A;  4D5F A;  1V5G A;  3HRM A;  3ZCO A;  2ECC A;  4XKC A;  3I5U A;  2M1B A;  2HDD A;  3MAJ A;  1RZ4 A;  4HRI A;  4AIH A;  3BRO A;  1X1C A;  1BI0 A;  2EZH A;  5HLG A;  2CGP A;  2QBY A;  1IV6 A;  4X1E A;  4GGG A;  3K1P A;  3BG6 A;  5HNH A;  3W6K B;  1UJ8 A;  1XB4 A;  2F5V A;  3DTE A;  1Y0N A;  1QZZ A;  4L0Z B;  3HPG A;  4AIK A;  2YPR A;  3I71 A;  2R7O A;  3OIP A;  4RDU A;  1I6H J;  3JSP A;  5HDG A;  4XKB A;  3TKY A;  3CD6 I;  2IJL A;  1BJZ A;  2EZL A;  4HG2 A;  1G2H A;  5DUI A;  4YII A;  2XB5 A;  3HTS B;  3SZT A;  5FD6 A;  4C30 A;  4KN7 X;  4A5N A;  1OCO H;  2COB A;  3B6A A;  1WHU A;  4QLC U;  4PDK A;  3Q9S A;  1QVT A;  4BBR J;  1V5E A;  3T0Y A;  3V8K A;  3PSI A;  4HLX A;  2OF7 A;  1F4K A;  2NAZ A;  4MFD A;  3KEY A;  4P5O A;  4BU2 A;  4MQ9 F;  5TGT A;  2LD5 A;  3A03 A;  2JJ7 A;  2ZJ2 A;  3H0G J;  4IRG A;  5B5E C;  2A07 F;  2HYG D;  1K83 J;  2XVC A;  3N97 A;  2XDV A;  2HXO A;  3F22 A;  4IJA A;  3OYL A;  3CJT B;  1A04 A;  1J9I A;  4ZC3 A;  2WV1 A;  5EG0 B;  2EIJ H;  3RI4 A;  3PUB A;  3C2B A;  3QOP A;  3QU3 A;  1FYM A;  1RKW A;  4M9Z A;  3GYH X;  1O57 A;  2L7K A;  2OQR A;  3I56 I;  3W2A A;  3VYS B;  4HLY A;  4AM3 A;  3CMA I;  1SAX A;  5FLX K;  2EFP A;  4YEL A;  2DA1 A;  4RB0 A;  2CV0 A;  4LG0 B;  1MIJ A;  1XGM A;  1Z3Y A;  2P81 A;  2X1C A;  2R7T A;  2LKX A;  2J5P A;  1TZL A;  4NB5 A;  2KRC A;  3A0B C;  1EV7 A;  1K61 A;  5FB2 A;  2ETH A;  3V4G A;  5D5X B;  2M4K A;  3OS1 A;  2OTL I;  3FM5 A;  1J5Y A;  3GCM A;  3JRE A;  1O3T A;  2Y31 A;  1IN5 A;  3KLN A;  3WGH A;  1JHF A;  2ELK A;  2EQR A;  2V9K A;  1LEB A;  1G3S A;  2L7M P;  3WTU C;  1R49 A;  2IA0 A;  3MKZ A;  4G7H F;  3ZR8 X;  3PQJ A;  4DIQ A;  3LAJ A;  2ZO4 A;  5E3M A;  4BDY A;  2E1O A;  4RA2 A;  1NTC A;  2Y69 H;  3GTM J;  3V7S A;  3OIO A;  1JJ8 C;  1IRF A;  2UZK A;  3CLO A;  2KIU A;  1XGO A;  1S5L C;  2CV1 A;  1FZP B;  5DYM A;  1K78 A;  3R0A A;  4HQE A;  2ICW G;  2YU3 A;  2QA4 I;  2QVO A;  1GXP A;  1A6Q A;  4V2F A;  1MJB A;  1ZR2 A;  2LDU A;  2QCO A;  3PQK A;  1GV2 A;  2VQL A;  1D8K A;  1ZHF A;  3SZP A;  3JTG A;  1HW2 A;  2CQ7 A;  3BQY A;  3TW7 A;  2EIL H;  2XGD A;  2XGC A;  1O7L A;  3LSG A;  2IA2 A;  4BEH A;  1O3Q A;  4HOB A;  4KUM A;  1YE9 A;  4J01 A;  4PZJ A;  3MKY B;  5J3L A;  1I3Q J;  4CA0 A;  4YG2 F;  3WGG A;  2P6T A;  2F5D A;  4UB8 C;  2KFD A;  1ZGW A;  2PLY A;  3I54 A;  3RPU D;  3ERE D;  1YTY A;  3O6B B;  2FXA A;  1MGT A;  2XHK A;  2P7C B;  5J1R A;  3S17 J;  2HVR A;  2O9L A;  4P9F A;  2XRO A;  5IP9 J;  1OYY A;  1KON A;  5H20 A;  1OFC X;  5K7Z A;  2QEX I;  1QHH D;  2O0Y A;  3J80 Z;  1GXQ A;  2LKP A;  2BVL A;  3FHN A;  1U2W A;  3FKI J;  4EQQ A;  1T95 A;  1FOX A;  3K4J A;  1Z9C A;  2LRD A;  3IV5 A;  2ID3 A;  3MEX A;  3AL0 B;  3WHB A;  2K5C A;  2FML A;  3DU5 A;  2STT A;  2FBI A;  3T8T A;  4HQM A;  3TGN A;  1XGN A;  2WA0 A;  2VPL A;  4BJ6 C;  3IWZ A;  1JXS A;  4QPO A;  4YFN F;  4B4C A;  4A0X A;  3JAM K;  2R7X A;  1P7J A;  2GA1 A;  4XOR A;  3CJQ B;  1IUF A;  2HDC A;  5D5U B;  4XLF A;  2DA3 A;  2PN6 A;  1MW7 A;  4NQW B;  1VQM I;  4YIR X;  1G3T A;  2JRT A;  5TJJ A;  2EBI A;  1I1S A;  5IP6 A;  4RGX A;  1ODD A;  5CKT A;  3M8F A;  2ZKZ A;  5J6X A;  3K70 C;  5C3E J;  4ENM A;  1G3Y A;  4I09 A;  1FMV A;  1ZRF A;  1ULY A;  4FX4 A;  1OYW A;  3BG3 A;  5DS9 A;  1TWG J;  2BZT A;  2BY3 A;  3IH2 A;  4E4H A;  1R71 A;  2ZSI B;  4IRI A;  2O8K A;  2KZV A;  3L2R A;  2IEK A;  2ZC2 A;  3HSF A;  2MD5 A;  3H5N A;  3CC4 I;  1SVO A;  5JHU A;  5EF6 A;  5HOO A;  4M3B A;  2EZI A;  9ANT A;  5CVJ A;  2WV0 A;  3JRF A;  1G6N A;  1ZRE A;  4Q47 A;  2CWE A;  2DPD A;  5HVQ C;  1S7A A;  2V6E A;  4M3F A;  1V54 H;  5EYR A;  2H8R A;  1LFB A;  2DO7 A;  3FIW A;  3WU0 A;  3HB9 A;  3ROU A;  2DYR H;  3I4M J;  1STZ A;  5CVR A;  2ZNY A;  1T2K A;  2KDZ A;  4UUS A;  3FXM A;  2P7V B;  4A3C J;  3KEQ A;  2E19 A;  4FET A;  2CFO A;  1BL0 A;  5LEJ A;  3R4K A;  1W5T A;  2IS2 A;  4LD5 A;  4CCN A;  1IDZ A;  2GBY A;  2IGN A;  1PP8 F;  1AOY A;  5B1A H;  3SXY A;  1BC8 C;  2CQQ A;  2DFE A;  2Y2Z A;  4UVA A;  2X85 A;  3B73 A;  4HAM A;  4B48 A;  3GTP J;  2RGV A;  2V26 A;  2JWT A;  5JR3 A;  2JK3 A;  4UY8 I;  2HPI A;  1FEX A;  3I59 B;  1RR8 C;  1FOW A;  1RUN A;  4E7K A;  2ZFU A;  4EM1 A;  3GO5 A;  1N75 A;  3MZ8 A;  3D0S A;  1DP3 A;  2Y0M A;  4LMY A;  5E1W A;  2DMN A;  2L7F P;  5HDN A;  4CSW A;  5BQT A;  1UHM A;  3JRD A;  1GT0 C;  1J2X A;  4OMZ A;  2O8X A;  3FXR A;  1GVD A;  2DFH A;  1B59 A;  3CF5 F;  3WG9 A;  5HDK A;  5HNF A;  3ESW B;  1YX3 A;  2QKL B;  1G3W A;  2Y75 A;  3R61 A;  1X1A A;  2QSH X;  2JA2 A;  2W24 A;  2NOJ B;  3M8J A;  1EH7 A;  2HKX A;  4BUP A;  2EFN A;  5ILV A;  2V1D A;  2ZME B;  2FRH A;  4Y3O A;  3G4S I;  1BC7 C;  4MTE A;  3L2V A;  3OYD A;  2D1H A;  3GFM A;  3HG9 A;  2MAB A;  3RYR A;  4DBR A;  4RGU A;  2HKO A;  2K4J A;  2WY7 Q;  3BG9 A;  3PO3 J;  1X4O A;  4BY7 J;  5D8L B;  1JUS A;  1GUU A;  2DMT A;  3HPH A;  4L9T A;  2M30 A;  3HZJ A;  5AIP A;  2M9H A;  4OWR B;  3GVA A;  5DCF A;  2LY2 A;  3K0L A;  4MEX F;  4E6K G;  1XPX A;  1ZAO A;  2FNP A;  3W3C A;  3VOD A;  1R7J A;  3IP4 B;  4WWC A;  2ID6 A;  1X58 A;  3NWS A;  3QRF F;  2STW A;  2DA6 A;  3HC7 A;  2EIK H;  4AWX B;  5EG0 A;  1AU7 A;  3CCM I;  2JTV A;  1Y1W J;  4BXF A;  1E3O C;  1KA8 A;  3GLX A;  1DDN A;  3M1E A;  1FYL A;  1YFH A;  2QF7 A;  4XBF A;  4PCQ A;  3ABT A;  4LG0 A;  2E34 A;  1IDY A;  1W1W E;  3HKZ A;  3F8M A;  2HZD A;  4IQJ A;  3A0H C;  5IT9 Z;  1L3L A;  3Q9V A;  3HRT A;  1VQ7 I;  2HQN A;  4AC0 A;  3K70 D;  4CCL A;  3CDL A;  3BR0 A;  2HR3 A;  1B4A A;  2E60 A;  3ZMD A;  1S29 A;  3JRI A;  4ABZ A;  5M3M J;  2PX9 A;  2VJ5 A;  4BHP A;  4BXU A;  5FRN A;  1XD7 A;  2GIZ A;  4E7Z A;  3C1D A;  5LRR A;  3LSM A;  4XKW A;  5C4X J;  2K9M A;  4NUB A;  3CUO A;  4IOC F;  3OSF A;  3M7G A;  3E7L A;  5KAI C;  2OD5 A;  3H5A A;  4I01 A;  3SDG A;  3KZY A;  4LOC A;  1R5G A;  3WGI A;  3LQR A;  1WJD A;  3E3V A;  1E17 A;  3BPX A;  1NHA A;  1YRN B;  3FHZ A;  3D5S C;  3KP2 A;  1B9N A;  3S1R J;  2V1U A;  2A6H F;  4HV6 A;  2FOK A;  3LFU A;  2ESH A;  2W85 A;  2OA4 A;  2BY1 A;  3T5X A;  3SQN A;  4FCY A;  5D6E A;  4ZZD A;  2ISY A;  4FAS D;  3E6D A;  3F8C A;  2MGQ A;  1U5T A;  2DU9 A;  2QUF A;  3PNV A;  5E8G A;  4CCJ A;  2KIS A;  3P9I A;  3LSK A;  2QKM B;  4CDG A;  4PJ0 C;  5J8F A;  5LLQ A;  2YX4 A;  2VI6 A;  3CDI A;  1KQ8 A;  2K9L A;  4FE7 A;  1RUO A;  1R1V A;  1WRJ A;  1QU3 A;  4PUS A;  6PAX A;  2QQB A;  4FIS A;  2YS9 A;  4JX5 A;  3ZXS A;  1FYK A;  2Q2E B;  4EJV A;  4BL0 B;  3OYG A;  4WK8 F;  2HTJ A;  2LYC A;  4WX9 A;  2L5Q A;  2WB1 N;  4JX4 A;  1QA6 A;  1FOK A;  2BEO A;  2EIN H;  4I2O A;  2CMP A;  4JK1 X;  4I7H A;  4BQQ A;  3JAM Z;  2DAO A;  3IH3 A;  1FBU A;  2MH2 A;  2XKO A;  1Q1H A;  1MBE A;  3CES A;  4GCV A;  2EK5 A;  5CVI A;  2R7V A;  3CCL I;  2R4G A;  1ETO A;  3N4M A;  2LKS A;  4BXX J;  2X0L A;  5KNL A;  3RSN A;  4HNU A;  3DF8 A;  2EV5 A;  4LK1 F;  1IN7 A;  3AL0 C;  1FWZ A;  3KZI C;  4NQW A;  3I64 A;  3H3U A;  3VYU B;  3CCU I;  3AG1 H;  1TL8 A;  3QYB A;  1MMN A;  1Y39 A;  2R3S A;  3FMR A;  2MG4 A;  2PMH A;  3HOX J;  3J7A Y;  2L3D A;  4KIT B;  1PYV A;  4A93 J;  5F0C A;  2XAF A;  4RM3 A;  1LPQ A;  1X2M A;  1S72 I;  4EJT A;  5FJ8 J;  5J40 A;  1JGS A;  2QSF X;  3VSL A;  2ZXH A;  4ZJZ A;  1FBS A;  3DEU A;  1PDN C;  1DPU A;  4M9X A;  3LMM A;  4R79 A;  2NNY A;  4KDP A;  3QPL A;  3ZMS A;  3IAS 2;  1IO2 A;  3HUG B;  3PFY A;  1WJ5 A;  4GYG A;  4Z6Y A;  2UV1 A;  2V7F A;  1H0M A;  2K27 A;  2HXI A;  1WJB A;  3CDH A;  2XAQ A;  5BMZ A;  4UV9 A;  5DM6 F;  3L2W A;  3H9Q A;  1FP2 A;  2L02 A;  2CG4 A;  1QBJ A;  2HQR A;  1WGX A;  2HOT A;  2IP2 A;  3EYY A;  4FTH A;  3OYE A;  1O4X A;  2FEZ A;  3CCE I;  2NYX A;  1YIT I;  3NWT A;  3ABK H;  3IUO A;  2ZSH B;  5ILU A;  2LRE A;  1JHH A;  2IGM A;  1QVU A;  2X9D A;  4CGZ A;  3R0J A;  1SMT A;  1BOA A;  4LLN A;  3WTY C;  5K1Y A;  1TQM A;  2LG4 A;  1Y56 A;  4HDU A;  4R1H A;  3OL4 A;  1D8J A;  5FKO A;  2FSW A;  5K7F A;  3ABL H;  3MD2 A;  3LSP A;  4BE1 A;  2HNH A;  2VT3 A;  2M0C A;  2DMQ A;  3I59 A;  2OCE A;  2UUZ A;  4KN4 X;  2B9S A;  2Z9O A;  3HTU A;  4RAY A;  2L4M A;  3SZG A;  3BZ6 A;  1PUF B;  3ONQ A;  1VTN C;  1H9T A;  5M3F J;  4A12 A;  5HS7 A;  4A0Z A;  4QTR A;  3FK7 A;  3HRU A;  4WXH A;  1WH5 A;  1ZGA A;  1IJW C;  3KE2 A;  3DBH B;  4LK0 F;  2KPM A;  4DJA A;  1LNW A;  5E8I A;  1JKQ C;  1KQ0 A;  5DDG A;  2W82 A;  1I3A A;  4QIW N;  3E5Q A;  2AO9 A;  2M4G A;  5DV5 A;  5L3G A;  2VUM J;  3KP5 A;  4PFP A;  2Y0S N;  1VQP I;  3DFG A;  1K79 A;  2DBB A;  3SHF A;  1YHQ I;  2ZCW A;  1LE8 B;  3LSR A;  1SD7 A;  3CP8 A;  2KHM A;  3G1O A;  4D7M A;  3VEP A;  5J47 A;  4G94 A;  3AG3 H;  2K9Q A;  3EUA A;  1XCB A;  5CVU A;  2DA2 A;  3RKY A;  2EB7 A;  3OY9 A;  2H09 A;  2CU7 A;  5LEK A;  3ZQC A;  3M4O J;  4ZDP A;  4XOP A;  1KYW A;  4C3I J;  4CZZ A;  4PJN A;  3VOE A;  3BC8 A;  5DTD A;  1OKR A;  1IN6 A;  3M07 A;  1KQ9 A;  1WSU A;  4I0A A;  4MEY F;  4OMY A;  2ELJ A;  2VBY A;  3O2P E;  5D8K B;  4PJL A;  2F5F A;  3PIO F;  1QPI A;  3EUH C;  1O3R A;  4ZDL A;  1SFX A;  4IOA F;  2BV6 A;  2A68 F;  3C2G A;  3F8N A;  5F1R A;  2V1X A;  1G8X A;  1XTA A;  3K2Z A;  1IN8 A;  3C18 A;  4FE4 A;  1EF4 A;  2V9V A;  3VPR A;  3MZH A;  3L7W A;  4LLL A;  1FIP A;  1VF9 A;  1IG7 A;  3B6C A;  4NHJ A;  2NVU B;  2M3A A;  2E1C A;  2KP6 A;  2R92 J;  4IEJ A;  4N9I A;  3ZGK A;  4RAF A;  1LDK B;  1YW8 A;  2ZBK A;  3TBI A;  5B66 C;  1WJC A;  3BZK A;  3FDY A;  3F21 A;  2FF4 A;  2ZJR F;  4MNU A;  3WTX C;  2D5V A;  1S8N A;  4RLQ A;  5JLX A;  3OYH A;  4EJW A;  3MMY B;  4I02 A;  3W2W A;  3OS2 A;  4B09 A;  4EGZ A;  4D9J A;  4II3 A;  5J4V A;  3BR5 A;  1P4W A;  1ZGJ A;  2ELH A;  1V4R A;  3E97 A;  3MZY A;  4IF4 A;  4JP0 A;  4RGR A;  1WJA A;  5IY5 H;  4R8H A;  2QWW A;  2XGE A;  4K2E A;  2R0Q C;  1MH4 A;  5L3E A;  5L3D A;  2R5Z B;  2WAF A;  3F6V A;  1ON1 A;  2X4H A;  2ACJ A;  3TOA A;  4CH7 A;  2X6X A;  4XLE A;  3GTL J;  3K1M A;  3OYB A;  5LBQ A;  3EQL F;  2IGO A;  4E7S A;  4BS9 A;  4M3E A;  1VFC A;  3GZ5 A;  4LFU A;  2X51 A;  3J81 Z;  4HW0 A;  1XS9 A;  4AIJ A;  1YRN A;  4LJZ F;  4ON0 A;  2BW3 B;  2VOO A;  3ABU A;  2NS8 A;  4ENK A;  1DGR M;  3DEW A;  1C0W A;  1W7P B;  5JI6 A;  3QYF A;  2ISZ A;  2O3F A;  1FBQ A;  1MZB A;  2BY2 A;  3DTI A;  4A5M A;  3P9K A;  1X3Z B;  4LB5 A;  2OAZ A;  5GAE J;  3HSE A;  4U88 A;  1O3S A;  2E7W A;  2IVM A;  1P6R A;  3E6M A;  3EDP A;  4IQ4 A;  3HL2 A;  3BY6 A;  4FX0 A;  4RLF A;  5LD2 C;  2I5U A;  1Z7L A;  4OU0 A;  4DZP A;  2XSD C;  4UNO A;  1D3Y A;  3UKG A;  2DK5 A;  1R1T A;  4BKX A;  3ZN1 A;  2WY8 Q;  4XIC A;  2E71 A;  1FPQ A;  2R7W A;  4BQO A;  2JPB A;  2CUE A;  2DK8 A;  2XKP A;  2E2I J;  1TQI A;  2CQK A;  1RC9 A;  2QQ8 A;  5DD4 A;  3ASO H;  3CQZ J;  3MWM A;  4D5C A;  4BQA A;  4DW6 A;  1MMG A;  4HF0 A;  4XN0 A;  4PFO A;  1HKT A;  4IKF A;  1LVA A;  2K9S A;  4DOZ A;  2Q2E A;  3TP0 A;  1Y8R B;  3FWE A;  5DCM A;  4A3M J;  3W6J B;  5IT3 A;  1ITY A;  1W0T A;  4BE0 A;  5E20 A;  3F8B A;  1RKT A;  3WTV C;  1AWC A;  3GFI A;  3F0C A;  4PJJ A;  4EJU A;  3V8J A;  4DBQ A;  2JMW A;  4HNV A;  3HBL A;  3GZ6 A;  1Z3X A;  2NOG A;  4WCG A;  2VQH A;  2R7U A;  2CJJ A;  1F36 A;  4G12 A;  2DLL A;  1IV8 A;  1U3E M;  2HQ5 A;  1E0E A;  4JQF A;  3KP4 A;  2MBF A;  3NEU A;  4GYI A;  4DZJ A;  4HST A;  4BYY A;  2OQG A;  2O6G E;  1T98 A;  1Y0U A;  4LB6 B;  2E5N A;  2MLG A;  3OYK A;  4EEF G;  1D1B A;  2M2E A;  3Q0V A;  3ZQF A;  2FU4 A;  3JRC A;  3GWZ A;  1DGW Y;  3U1K A;  3BJ6 A;  4BH9 A;  4CCK A;  3FXO A;  2CV2 A;  3QU6 A;  3CF2 A;  1MSF C;  3I0T A;  3NQO A;  1D1A A;  3Q3S A;  3E5U A;  4ZYD A;  1MMD A;  2DQR A;  1SVL A;  2GXA A;  4MTD A;  1IF1 A;  1B72 B;  3ISP A;  4IZZ A;  2Z2S B;  2PBI A;  3DV8 A;  4KIF A;  2K4B A;  1R4M B;  4A69 C;  4OOI A;  2W4S A;  3IKV A;  4BAC A;  1DU0 A;  1YI2 I;  2F5C A;  5LGU A;  3G71 I;  3H5R A;  4XLN F;  3HOT A;  3QOD A;  3OYN A;  1OLT A;  3H36 A;  5IYD J;  2R5Y B;  1MNE A;  1R58 A;  1P7I A;  3K6G A;  2ESN A;  4Y52 J;  4Y13 A;  1ZRC A;  1YW7 A;  2WTE A;  3RTR A;  2DTR A;  2RQQ A;  4OIR F;  4CYC B;  2G9W A;  1JKP C;  1JKO C;  1F5T A;  1Y6I A;  3CLQ A;  4U0V A;  1GV5 A;  1RET A;  3PJR A;  1JJ6 C;  1RIO H;  2EH3 A;  3BTJ A;  4F92 B;  4UUV A;  1MD0 A;  4IHV A;  2Q0O A;  4G7Z F;  2X6O A;  2FE3 A;  2KJB A;  3BR1 A;  2Q8K A;  3RDI A;  1IC8 A;  4OIQ F;  2VOP A;  2XAJ A;  2Y48 A;  4M71 A;  3I3L A;  2OCC H;  3PIP F;  3JCU C;  2H1K A;  5LHI A;  1R9T J;  3IC7 A;  5LGN A;  3E0J B;  5D6F A;  3LNQ A;  2E7X A;  3L2C A;  3O8G A;  1PUF A;  1IUY A;  3RIR A;  3DCF A;  1YS7 A;  4F93 B;  2HVS A;  4B43 A;  2MW8 A;  1SD5 A;  2W57 A;  4BBS J;  3HOS A;  2JRM A;  3ZP5 A;  1LB2 A;  2IGK A;  4PSW A;  3HOZ J;  2E35 A;  1B8I B;  2L9S A;  1CF7 A;  2L9R A;  1FSH A;  2EV6 A;  2DMU A;  3ZQG A;  2XC7 A;  2DOA A;  1CQT A;  1TP4 A;  4ANJ A;  1LE8 A;  2ZNZ A;  4I99 C;  1GLN A;  2M45 A;  4EVI A;  3WTW C;  3L00 A;  3S1M J;  1JUP A;  1FP1 D;  3C3W A;  3JR9 A;  1D1C A;  3IL2 A;  1LDD A;  2X48 A;  2M8E A;  4ASN A;  3MKL A;  1ETW A;  4M9S A;  1JKR C;  4S05 A;  3BTC A;  4BQN A;  2VKE A;  4KNY A;  4E7J A;  2MFZ A;  1HA8 A;  1TNT A;  1Y8Q B;  3Q0U A;  4ZTJ A;  1WVR A;  3GF2 A;  2VPR A;  2GM4 A;  1VQO I;  4HNT A;  4NC7 A;  3AKZ A;  2EA2 A;  3DLL F;  2JSP A;  2B7E A;  4B47 A;  3DU6 A;  1U9O A;  3PUF A;  1W5S A;  2ZFW A;  3N05 A;  1FMW A;  3H3Z A;  4A6E A;  4DQ2 A;  5EGO B;  2WAQ A;  2QM3 A;  4DYC A;  1IRG A;  2UXN A;  5IPA A;  2UWM A;  2CH0 A;  4IL6 C;  1DU6 A;  1YQA A;  2P6S A;  4E70 A;  3D5R C;  4RAZ A;  2MH9 A;  2L7Z A;  3LA3 A;  2H94 A;  4ZH4 F;  1X19 A;  1EH6 A;  2KZG A;  1K4S A;  2JPC A;  4GXO A;  3OV8 A;  4D7N A;  2JA5 J;  1XC5 A;  2Y9Z A;  2XUB A;  3FM3 A;  3KLO A;  3QP6 A;  3GTG J;  2R7D A;  4XKV A;  2QYO A;  2V4J C;  4ZYH A;  3VDX A;  1ON2 A;  3WG7 H;  1W36 C;  2F48 A;  1YX5 A;  1N78 A;  3SFZ A;  4ZDO A;  1FOY A;  2DT5 A;  2DOE A;  1WI9 A;  2W25 A;  3H9J A;  3OS0 A;  1MBF A;  2XAS A;  1EA3 A;  3CJR B;  3SDB A;  3F6O A;  4Y7N J;  1BIB A;  2R5Z A;  4IHS A;  3CCR I;  4HX8 A;  5KCM A;  3CP2 A;  3ZQL A;  4KIS A;  2LLK A;  3KP6 A;  3CMY A;  2ME6 A;  2Z5U A;  2XF5 A;  5BNG A;  3K2A A;  2L2O A;  2GIV A;  3K4N A;  3QPS A;  1D5V A;  4HA8 A;  2XRN A;  2HOE A;  2IBD A;  4PGH A;  1ZK8 A;  2EZK A;  2Y9Y A;  2BW3 A;  2QQ9 A;  1KZH A;  4ENJ A;  3I4P A;  1RPW A;  1YW9 A;  1W7P A;  5FFZ A;  3F9K A;  1T33 A;  2DMP A;  1ZEL A;  3E5X A;  3U2R A;  1HXD A;  1SFU A;  3CO6 C;  5J4Y A;  5FLX Z;  2ME0 A;  2L9V A;  5LGT A;  4W97 A;  1R1U A;  3REO A;  3BG5 A;  3MCZ A;  3J7A O;  2NVY J;  4XQF A;  2HZT A;  5KVR A;  5IOZ A;  5FGM A;  5E1X A;  2XPV A;  1Z67 A;  2LK2 A;  1OCZ H;  3MVP A;  3U9G A;  1VQ5 I;  5C4J J;  1U8R A;  2EFW A;  2BOL A;  3AFH A;  3TO6 A;  3DEE A;  2YSR A;  1BR4 A;  5CQE A;  4LIV A;  1EJ9 A;  4A3G J;  1HCR A;  1D0Z A;  4HZF A;  5BOX A;  2CQX A;  2WAQ N;  2WB1 A;  1YIJ I;  1P2F A;  2I10 A;  4BDZ A;  4M73 A;  2HI3 A;  5M5X J;  1U6G A;  2L54 A;  5EZH A;  3NRV A;  1ZKG A;  4BJT A;  3HDD A;  4A3K J;  1JTY A;  2CFX A;  1DQU A;  2EJR A;  2VN2 A;  2M8G X;  3V8L A;  5IP7 J;  2L9N A;  5IOY A;  2CUJ A;  1R36 A;  2C6Y A;  3CZ6 A;  2DJI A;  2QLZ A;  1KYZ A;  1BOB A;  3H0D A;  2HYJ A;  4O5V A;  3DPU A;  2VXZ A;  4O6J A;  1ZG1 A;  1SEU A;  1R00 A;  1I27 A;  3OYA A;  2XPU A;  2MA3 A;  5E1Z B;  1WQ2 A;  2XB0 X;  5HLI A;  2OJE D;  1L0O C;  4RGS A;  3VB2 A;  2D2W A;  2LNB A;  3TO9 A;  1Z1D A;  4BJ5 C;  3KZZ A;  3HHG A;  4RB1 A;  1OR7 A;  4NC6 A;  5F27 A;  3J7Z I;  3FF5 A;  4JYK A;  5M5W J;  4IHX A;  3T1B A;  4C2U A;  5GPA A;  5D5V B;  3S3N A;  2VAS A;  4V2G A;  4B3X A;  2FQ4 A;  1BIA A;  1V3F A;  2LBF B;  1R23 A;  2KRF A;  4TV7 A;  1YJW I;  3HGY A;  2E2J J;  5FLV A;  2KQR A;  4F55 A;  1EKE A;  4CHU A;  2X6W A;  1OR7 C;  3FXQ A;  2LH9 A;  2O61 A;  2AQE A;  2IW5 A;  2W1O A;  4CCM A;  1YIO A;  3Q0W A;  1WZ2 A;  3KET A;  2AXL A;  3WHC A;  4I98 B;  2K40 A;  1B9M A;  5IYC J;  2WAD A;  3ZQI A;  1B72 A;  4FHT A;  3KX2 A;  1X3U A;  2HFH A;  1LFU P;  2DYS H;  2TCT A;  2OV7 A;  2PMU A;  2JUC A;  1UHW A;  2DPU A;  2M7A A;  4AUX A;  3KP7 A;  1P9Q C;  3SEQ A;  4L9J A;  2W7N A;  1X2N A;  1JGG A;  2F4O B;  2R5Y A;  3BP8 A;  1ETQ A;  2YUS A;  3ABM H;  2EFO A;  5JLW A;  3BLY A;  5F0F A;  3WTS C;  1IRZ A;  2A69 F;  3IH4 A;  4P55 A;  3KPH A;  1YYV A;  5K5Q A;  4OIN F;  3S2D J;  2H1L A;  1BA5 A;  4X0G A;  3H35 A;  5L3C A;  3PM1 A;  4CYC A;  1W36 D;  4HF2 A;  2O03 A;  2Z1D A;  1AKH B;  2R7R A;  2JSC A;  3HOU J;  2EA4 A;  1E3H A;  1GHC A;  2R93 J;  3BQZ A;  1HW1 A;  4XSX F;  2OZU A;  1WJF A;  2B0L A;  3GEZ A;  1MH3 A;  5JFR A;  4GRI A;  2K3F A;  3G6E I;  3AAF A;  1KU7 A;  2VBW A;  4YFK F;  2W00 A;  3CCQ I;  1MSE C;  2KL4 A;  3ASN H;  3RCO A;  3CC2 I;  2DA4 A;  5KAF C;  3JW4 A;  1OCR H;  3K69 A;  3HOV J;  2KLO A;  2VL8 A;  4ETS A;  4S04 A;  2E2H J;  2JZY A;  4M3D A;  5JVG F;  2Y0S A;  2HWV A;  4NNJ A;  3S2H J;  2X1E A;  4LGW A;  3L09 A;  1HSJ A;  1X1B A;  3S3M A;  1XMX A;  2LY1 A;  4MGR A;  2PFB A;  1KU2 A;  1A6I A;  4EMS A;  2AXT C;  3C7J A;  2K9N A;  1BI1 A;  1N77 A;  1G59 A;  3HGG A;  5HLH A;  1HLV A;  5JVT A;  5AON A;  1M1E B;  1XX5 A;  1W7P D;  4DYR A;  5F0H A;  4HV5 A;  1WWX A;  2CW0 F;  2XF6 A;  1MKM A;  4B8X A;  3CJN A;  1UHS A;  4AYB N;  4ZYG A;  2FX0 A;  4YFX F;  3LSH A;  1TNS A;  3OYC A;  1FIA A;  4UVC A;  4PJM A;  2VXD A;  5FLM J;  3I58 A;  2FBK A;  2G7U A;  2HQA A;  5CQG A;  3MN2 A;  2KIM A;  4P1W A;  1QO0 D;  3H92 A;  4EJO A;  1TW3 A;  1Z7U A;  2M5W A;  4XRF A;  1T8I A;  4Q48 A;  4B3A A;  3OYF A;  2H6C A;  2G0E A;  2LC2 A;  2OPT A;  4KT5 C;  1G4D A;  3J7Y J;  4HX4 A;  2LF7 A;  5HLT A;  4G9Y A;  3MFK A;  4MIM A;  5EGO A;  4F91 B;  1JI8 A;  5CVV A;  4L5E A;  1T39 A;  2TDX A;  2ZXJ A;  1VQ6 I;  2LTP A;  1SD6 A;  1TW2 A;  1UST A;  2F4M B;  2K7L A;  4AVP A;  4Q5S F;  4AVZ A;  4MFE A;  3GW2 A;  2W84 A;  3TW6 A;  1VI0 A;  1FNN A;  1TC3 C;  1U8B A;  1WCM J;  4OAY A;  3ECO A;  4I6Z A;  3LAP A;  2M87 A;  3J80 K;  3BR6 A;  4IPA A;  4CXF A;  1ETV A;  3GTK J;  3GLL A;  2VT2 A;  5J1U A;  2E36 A;  2DOF A;  2IT0 A;  4D1Q A;  2XSJ C;  3DBR B;  3BPV A;  1Z0X A;  2FMY A;  5TRD A;  1WI3 A;  3M1C A;  5LHG A;  3OOU A;  4XN3 A;  3IAM 2;  2L0K A;  2RNJ A;  2XPW A;  4UUT A;  2ZME A;  1A35 A;  4IRH A;  2VJJ A;  2AS5 F;  1HW5 A;  4UVB A;  3H3V K;  1TWF J;  3DTK A;  1SAN A;  4RB3 C;  3HEF A;  1HC8 A;  1OYI A;  4YRV A;  2JVH A;  3FBI B;  5GP9 A;  1SAU A;  3EUH A;  2ZME C;  1XDS A;  3OYJ A;  2OUM A;  1HKS A;  4FT8 A;  1S7E A;  2BHY A;  1UEL B;  3QQA A;  3W2V A;  3ZOB A;  2Z16 A;  3EPZ A;  1IW7 F;  5B1B H;  3M3Y J;  1FY7 A;  5F1J A;  4WXC A;  1PJR A;  3CCS I;  2LSO A;  2CSO A;  3PFI A;  2XGX A;  1MBK A;  5JHF A;  3M8E A;  2PG4 A;  4W1U A;  4ITV A;  4CO8 A;  2R7Q A;  1NG6 A;  3BWG A;  4EM0 B;  4LIT A;  3OYI A;  4H0E A;  4RM2 A;  3EUK L;  4NDL A;  3E6B A;  1UZC A;  2QZ8 A;  3RKQ A;  3HM5 A;  5FO5 A;  4XRM A;  2A6T A;  4L5I A;  4II2 A;  2EIM H;  2QQA A;  2VBX A;  3KYC B;  4M72 A;  4A6D A;  3R6S A;  1LEA A;  2V1N A;  3RKW A;  2EWN A;  5EEG A;  5ILS A;  2NS7 A;  3GXO A;  4ESB A;  2DW4 A;  4M6Y A;  2DFI A;  3KIO A;  4HF1 A;  1K6O A;  2PJR B;  4JX6 A;  2DDA A;  2PMZ N;  2VC1 A;  2JUG A;  1TT0 A;  2RV8 A;  1JE8 A;  3VFZ A;  5E18 F;  1ETX A;  1U9N A;  1ZR4 A;  4GO1 A;  5EEH A;  3OOP A;  3BTL A;  3FX3 A;  2HOS A;  3WTZ A;  5F6F A;  1ONV A;  3S1N J;  3TQN A;  1VQN I;  4M6X A;  1MNM C;  5ICG A;  1RES A;  2A05 A;  4E7I A;  4IHW A;  5A2Q K;  4BAY A;  3U1D A;  3S1Q J;  3PSF A;  4L18 B;  3ML6 A;  2Z99 A;  2JN6 A;  2XV4 S;  3NAU A;  4N4O B;  1I6X A;  4Y33 A;  3G1L A;  1PUE E; 
#chains in the Genus database with same CATH homology
 4IHV A;  2X6O A;  3BR1 A;  1IC8 A;  1Y1W J;  1U78 A;  1E3O C;  1FTT A;  5EEA A;  2O7O A;  3K7A J;  5GPC A;  2H1K A;  5E3N A;  1R9T J;  2QF7 A;  5E3O A;  4X6A J;  4BY1 J;  5FKN A;  3LNQ A;  3O8G A;  1XG1 A;  1IDY A;  1PUF A;  2NVQ J;  3DCF A;  2DJN A;  2MW8 A;  4BBS J;  3G1M A;  2LFB A;  2W48 A;  4A3E J;  2DA5 A;  1BW5 A;  4AC0 A;  3TP3 A;  3CDL A;  3BR0 A;  1H88 C;  3HOZ J;  1B8I B;  1HF0 A;  2L9R A;  4RBO A;  4XRS G;  2DMU A;  3ZQG A;  1AHD P;  2CUF A;  1CQT A;  1FJL A;  3JRI A;  4ABZ A;  1LE8 A;  5M3M J;  4S0H B;  1RR7 A;  1MBG A;  1APL C;  3S1M J;  1GDT A;  1TWA J;  2JA8 J;  5C4X J;  1JT0 A;  1JUP A;  3JR9 A;  1JT6 A;  2X48 A;  4A3J J;  3MKL A;  1ETW A;  3OSF A;  1W0U A;  1OCT C;  3E7L A;  1NK2 P;  2ECB A;  1JKR C;  5F08 A;  2NVT J;  3BTC A;  3SDG A;  2VKE A;  4LOC A;  1TWH J;  3S14 J;  1YRN B;  3Q0U A;  3JRB A;  1AKH A;  4GFB A;  2VPR A;  3S1R J;  2GM4 A;  3S15 J;  2TRT A;  4XID A;  1OJL A;  3FIS A;  1ZQ3 P;  3TED A;  1IGN A;  1MBH A;  1U9O A;  5K7H A;  4FCY A;  1T56 A;  4DYC A;  5EGO B;  3L1P A;  3A01 B;  1HDD C;  2MGQ A;  1A5J A;  4C2M J;  5IPA A;  1DU6 A;  1ORK A;  2L7Z A;  4A3B J;  3GBG A;  1Z77 A;  1F43 A;  1TWC J;  2DA7 A;  2VI6 A;  4A3L J;  2JA5 J;  4D7N A;  1XC5 A;  5EDN A;  2VKV A;  1JUM A;  3RQI A;  1HDP A;  2Y9Z A;  4FE7 A;  3GTG J;  4XRS A;  1ETY A;  4FIS A;  2JA7 J;  2YS9 A;  4JX5 A;  1I50 J;  5E3L A;  5EZG A;  4UUS B;  2WB1 N;  1MBF A;  4JX4 A;  3S16 J;  3A02 A;  4Y7N J;  2R5Z A;  3IH3 A;  3ZQL A;  2LLK A;  3CMY A;  2ME6 A;  1MBE A;  1OCP A;  5IYB J;  1JTX A;  5BNG A;  3K2A A;  3CCY A;  3QPS A;  3GTJ J;  1ETO A;  1POG A;  4BXX J;  2LR8 A;  2LY9 A;  2IBD A;  2IAI A;  1ZK8 A;  2EZK A;  4I76 A;  4MO7 A;  4D5F A;  2Y9Y A;  2ECC A;  2HDD A;  1RPW A;  3LSJ A;  1WH7 A;  2EZH A;  2DTZ A;  3HOX J;  2MG4 A;  1T33 A;  1IV6 A;  4X1E A;  2DMP A;  4A93 J;  5F0C A;  1UMQ A;  2R7Z J;  1X2M A;  2ME0 A;  5FJ8 J;  4W97 A;  3BG5 A;  1I6H J;  2NVY J;  4RDU A;  3ZQH A;  5IOZ A;  1HOM A;  3QPL A;  1BJZ A;  2XPV A;  2LK2 A;  2EZL A;  3MVP A;  5C4J J;  1SFO J;  1G2H A;  2XB5 A;  2HXI A;  2Y30 A;  2COB A;  4A3G J;  1HCR A;  4MLO A;  3B6A A;  2CQX A;  2WAQ N;  2I10 A;  2HI3 A;  1QVT A;  4BBR J;  5M5X J;  5EZH A;  1ZKG A;  2OF7 A;  5HOD A;  3JRH A;  3HDD A;  1QRY A;  1WGX A;  4MFD A;  1ZTR A;  2HOT A;  4FTH A;  4A3K J;  1JTY A;  1O4X A;  5FKL A;  2M8G X;  2GLO A;  5IP7 J;  3A03 A;  2LD5 A;  2JJ7 A;  5IOY A;  3H0G J;  1VND A;  1K83 J;  1QVU A;  1WPK A;  2X9D A;  2HXO A;  2HYJ A;  2FJ1 A;  4A3F J;  2LP0 A;  5C44 J;  2RAE A;  2WV1 A;  5EG0 B;  5F04 A;  2XPU A;  2B63 J;  3C2B A;  2XB0 X;  5FKO A;  5K7F A;  3LSP A;  1RKW A;  1BW6 A;  2DMQ A;  2M0C A;  2DN0 A;  5F27 A;  2DA1 A;  4JYK A;  5M5W J;  4IHX A;  5GPA A;  1PUF B;  4V2G A;  2FQ4 A;  2P81 A;  5M3F J;  4A3I J;  4QTR A;  3FK7 A;  2LKX A;  1IJW C;  1WH5 A;  3HGY A;  2E2J J;  5FLV A;  1UG2 A;  1JKQ C;  1K61 A;  1Q1V A;  3Q0W A;  4QIW N;  5M5Y J;  2AO9 A;  3WHC A;  3JRE A;  2VUM J;  2Y0S N;  2Y31 A;  2K40 A;  5IYC J;  2EQR A;  2ELK A;  3ZQI A;  1B72 A;  2L7M P;  3LSR A;  1LE8 B;  1D5Y A;  2ZB9 A;  1LFU P;  3G1O A;  2TCT A;  4D7M A;  4J19 A;  2K9Q A;  5E3M A;  2E1O A;  4AUX A;  1NTC A;  2DA2 A;  3GTM J;  4IHY A;  2CU7 A;  3OIO A;  1JJ8 C;  3ZQC A;  2JA6 J;  3M4O J;  1X2N A;  1JGG A;  2AHQ A;  2R5Y A;  1ETQ A;  2YUS A;  4C3I J;  5JLW A;  5F0F A;  1IRZ A;  3IH4 A;  5DTD A;  3S2D J;  1BA5 A;  3FK6 A;  4CYC A;  3PM1 A;  4V2F A;  1ZR2 A;  1AKH B;  4QSH A;  3HOU J;  1QPI A;  2QCO A;  2R93 J;  1GV2 A;  3BQZ A;  3O8H A;  1MH3 A;  3BQY A;  3TW7 A;  2XGD A;  2XGC A;  1MSE C;  3LSG A;  2DA4 A;  4FE4 A;  2KT0 A;  1EF4 A;  3VPR A;  3HOV J;  1FIP A;  1VF9 A;  1IG7 A;  3B6C A;  2E2H J;  4M3D A;  2R92 J;  4IEJ A;  2XRL A;  5J3L A;  3PO2 J;  3S2H J;  1I3Q J;  3JRG A;  3HOW J;  1ZGW A;  2D5V A;  5JLX A;  5J1R A;  3S17 J;  1A6I A;  5FKM A;  2O9L A;  3BR5 A;  5IP9 J;  2K9N A;  5K7Z A;  1OFC X;  4JP0 A;  3HGG A;  3FKI J;  2R0Q C;  2XGE A;  1HLV A;  1MH4 A;  4DYR A;  3IV5 A;  2R5Z B;  2ID3 A;  5F0H A;  3JRA A;  4M3G A;  3WHB A;  2NVX J;  1UHS A;  4AYB N;  1Y1V J;  3HOY J;  5FKK A;  2FX0 A;  4B4C A;  1FIA A;  3GTL J;  2YU9 J;  1P7J A;  1IUF A;  5FLM J;  2LVS A;  1VFC A;  4M3E A;  2DA3 A;  3MN2 A;  1XS9 A;  3LOC A;  5J1Y A;  1YRN A;  4C3H J;  2EBI A;  2NS8 A;  5IP6 A;  3DEW A;  4B3A A;  5C3E J;  4C3J J;  2G0E A;  2OPT A;  2CRG A;  3BG3 A;  5DS9 A;  1TWG J;  3IH2 A;  4MIM A;  5EGO A;  3A01 A;  1ENH A;  3RZD J;  2MSY A;  2O8K A;  2IEK A;  4L5E A;  4DZP A;  2XSD C;  3GTO J;  3OSG A;  3UKG A;  4A3D J;  2LTP A;  4BKX A;  4XIC A;  5EF6 A;  4MFE A;  3TW6 A;  1VI0 A;  4M3B A;  2CUE A;  1TC3 C;  2EZI A;  1U8B A;  9ANT A;  3SJM A;  3JRF A;  1WCM J;  2E2I J;  4I6Z A;  4M3F A;  4D5C A;  3CQZ J;  1MBJ A;  5EYR A;  4DW6 A;  3BR6 A;  1ETV A;  2H8R A;  1LFB A;  3FIW A;  3GTK J;  2K9S A;  3HB9 A;  5J1U A;  3I4M J;  3TP0 A;  1H89 C;  3BR3 A;  2KDZ A;  1Z0X A;  4UUS A;  1WI3 A;  4A3C J;  4A3M J;  1ITY A;  2E19 A;  1W0T A;  3OOU A;  2M34 A;  1RKT A;  1BL0 A;  2L0K A;  2XPW A;  3F0C A;  4UUT A;  4M6V A;  1IDZ A;  2FD5 A;  2GBY A;  2JMW A;  4HNV A;  3HBL A;  1ETK A;  2NOG A;  3H3V K;  2CQQ A;  1TWF J;  1SAN A;  2CJJ A;  2Y2Z A;  1F36 A;  3HEF A;  4G12 A;  2HQ5 A;  3GTP J;  3RZO J;  2JWT A;  5GP9 A;  2JK3 A;  1FEX A;  4DZJ A;  1S7E A;  2HOA A;  1FTZ A;  4EEF G;  3QQA A;  3ZOB A;  2DMN A;  3BR2 A;  2L7F P;  3M3Y J;  2M2E A;  4B1R A;  5F1J A;  1GT0 C;  3JRD A;  3Q0V A;  3ZQF A;  3JRC A;  1GVD A;  1MBK A;  4W1U A;  4DYQ A;  1MSF C;  1H8A C;  3HKZ N;  3Q3S A;  4XK4 A;  3BT9 A;  4NDL A;  3I4N J;  3RKQ A;  3HM5 A;  4XRM A;  1B72 B;  3W6V A;  2NS7 A;  4A69 C;  1DU0 A;  4JX6 A;  3BG9 A;  3NAR A;  3PO3 J;  2PMZ N;  4BY7 J;  1JUS A;  1GUU A;  2DMT A;  3BTI A;  1B8I A;  5IYD J;  2M9H A;  2R5Y B;  1ETX A;  1P7I A;  1U9N A;  3SFI A;  1ZR4 A;  4Y52 J;  3BTL A;  3GTQ J;  2HOS A;  3S1N J;  1MNM C;  1JKO C;  4CYC B;  1RES A;  1JKP C;  3D1N I;  4IHW A;  1GV5 A;  1RET A;  2ID6 A;  1X58 A;  1NK3 P;  3S1Q J;  2DA6 A;  1JJ6 C;  2JN6 A;  2EH3 A;  2N8G A;  3BTJ A;  3NAU A;  5EG0 A;  1AU7 A;  3G1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...