1GV2A

Crystal structure of c-myb r2r3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
102
Chain Sequence
ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Crystal Structure of C-Myb DNA-Binding Domain: Specific Na+ Binding and Correlation with NMR Structure
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 32
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv2A01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv2A02
2K40A 4DZPA 2DMUA 1NK3P 1ETYA 3S16J 2ME6A 2NVQJ 2ELKA 3IH3A 4FTHA 4W1UA 1JJ8C 5C44J 3FKIJ 2H1KA 3JRIA 5M3FJ 3TW7A 2NVXJ 5IP7J 3E7LA 5F27A 2OF7A 4FCYA 1QRYA 5J1RA 4QTRA 1IGNA 2XB0X 2DTZA 1RESA 3S1NJ 5FKLA 3CQZJ 4XIDA 2LK2A 2HXOA 2TRTA 2Y9YA 2DMTA 2Y30A 3TP0A 1ZGWA 1FJLA 2GM4A 4GFBA 1Z77A 4FE4A 1H88C 1VFCA 3H3VK 5GP9A 3JRBA 5E3OA 2G0EA 3TW6A 3A01A 1GVDA 1QVUA 2VPRA 1X58A 3GTGJ 3SDGA 4A3MJ 2EZKA 3QPSA 5K7ZA 3ZQCA 1AKHA 3GTKJ 1Y1VJ 1RETA 2OPTA 4CYCA 3A01B 5J1YA 2NVTJ 2X48A 1UHSA 2XGEA 2R93J 1IRZA 5IYDJ 4A3FJ 1H8AC 4C3JJ 1MBKA 1AKHB 3FISA 4ABZA 2DMPA 3B6CA 4A3DJ 3LNQA 4CYCB 4B3AA 3MKLA 2EZHA 2EZIA 5EGOA 1JT6A 1I50J 2DA5A 4A3CJ 3B6AA 2LP0A 1BJZA 1JTYA 2JJ7A 3HOYJ 2NVYJ 3OSGA 1YRNB 1ETWA 3ZQHA 3FK7A 3MVPA 4M6VA 5EGOB 4W97A 3BQZA 5FLMJ 1ETXA 2HOAA 2Y31A 1TC3C 4BY7J 5F08A 2DJNA 1W0UA 5IOZA 5IP9J 3PO2J 2JN6A 2L0KA 1U9OA 3HGYA 4Y7NJ 1MBHA 4J19A 5M5WJ 2ECBA 1XC5A 1H89C 1T56A 4DZJA 2DA4A 2JK3A 2P81A 3D1NI 1WI3A 2K9NA 1GV5A 2L7MP 2HYJA 5FKOA 2XPWA 1JTXA 4BXXJ 2EZLA 2O8KA 5FKNA 2R5ZA 2HDDA 1AHDP 3RZDJ 2JA7J 5M5XJ 5IYCJ 4C3IJ 5FJ8J 5EF6A 4A3JJ 2R92J 5HODA 1TWHJ 3WHBA 2YU9J 1K61A 1FIPA 2IBDA 4D5FA 2R5ZB 1WGXA 5C4XJ 1AU7A 2VI6A 5E3LA 1ZKGA 1U78A 2CUEA 2AHQA 1BA5A 1WPKA 4JP0A 5F0HA 4Y52J 2KDZA 3GTMJ 3HBLA 1MH3A 2XPVA 2E2IJ 5IOYA 5FKKA 1GT0C 3G1MA 3M3YJ 4X6AJ 1E3OC 5EYRA 1RKWA 2R7ZJ 5J3LA 2L7ZA 3HOWJ 1JKOC 1DU6A 3Q0VA 4IHXA 2R5YA 3I4MJ 3LSGA 2IAIA 3BTIA 3JRCA 3A02A 2GLOA 3HDDA 1OCPA 1U9NA 1HLVA 1OFCX 2R5YB 1FTTA 1JKRC 2HQ5A 5IYBJ 2B63J 4RBOA 4L5EA 2DA3A 2M8GX 1TWAJ 4M3DA 4MO7A 3GTJJ 1IDZA 1GUUA 2RAEA 5IP6A 5F1JA 1F43A 3VPRA 1A5JA 3GTLJ 2JA5J 5E3MA 4BKXA 2Y2ZA 4A93J 2GBYA 1JT0A 1VF9A 3GTPJ 5K7HA 4XRSA 4JX6A 3O8HA 1NK2P 1ZR2A 3HGGA 2ID3A 4FE7A 1MBEA 5E3NA 1A6IA 2QF7A 2E2HJ 2L7FP 5DTDA 4QSHA 2K9QA 1HDDC 4B1RA 4IHYA 3K2AA 1LFUP 4A3GJ 3BR6A 3QQAA 2FX0A 5K7FA 5F0CA 2FQ4A 1B8IA 5DS9A 3GBGA 2E2JJ 1D5YA 1P7IA 1T33A 3RZOJ 4NDLA 2XPUA 4IHWA 3CDLA 3WHCA 2PMZN 3ZQIA 2E1OA 1IUFA 1JUSA 3NAUA 3HOXJ 2O7OA 5JLXA 3Q0WA 4MLOA 4UUSA 1POGA 1XG1A 5J1UA 3JRGA 1B8IB 1JUMA 2WV1A 2WB1N 2CQQA 3F0CA 3S2HJ 2HI3A 3Q0UA 2ZB9A 1B72A 5EZHA 2KT0A 4BBRJ 2L9RA 2TCTA 3S17J 4JX5A 1MNMC 4UUSB 5BNGA 3OSFA 1JKPC 1MH4A 3ZQLA 4EEFG 4HNVA 1B72B 5JLWA 2VUMJ 1OCTC 4A3LJ 1HOMA 2Y9ZA 1QPIA 3HB9A 2MW8A 2YUSA 1ZTRA 1S7EA 4DYRA 3BG3A 1VI0A 2N8GA 4RDUA 3S1RJ 3HKZN 4AUXA 2LY9A 4V2GA 1MBFA 3BR3A 1JKQC 5M3MJ 3BTCA 2DMNA 4C2MJ 1IJWC 3BG5A 1RR7A 2E19A 2ME0A 2XB5A 4XRSG 1RPWA 5C4JJ 5EZGA 3JRHA 3IH4A 4FISA 2ECCA 1CQTA 3JR9A 3IV5A 1XS9A 4S0HB 5F04A 1ETVA 2XSDC 2X9DA 1ORKA 3G1LA 1ETQA 3LSRA 1BL0A 3BR1A 3BTJA 3JRAA 3BR2A 3SFIA 3OOUA 1HF0A 2X6OA 3S1MJ 1RKTA 4BY1J 3GTQJ 3PM1A 1Q1VA 3BQYA 2JA6J 4UUTA 1MBJA 3MN2A 2QCOA 5FKMA 3HM5A 3HEFA 3G1OA 2XRLA 1X2NA 3BG9A 3RKQA 1HDPA 5GPCA 2HOSA 2O9LA 2ID6A 3GTOJ 1LFBA 3BR0A 3ZQFA 4D7MA 1QVTA 4M3EA 1IDYA 3Q3SA 2JMWA 3HOUJ 3ZOBA 3M4OJ 2CU7A 2DMQA 2IEKA 2NOGA 1ZR4A 3RQIA 4XICA 2LLKA 2XGCA 4DW6A 4IEJA 1OJLA 4AYBN 2JWTA 3S2DJ 1IV6A 3HOZJ 1ENHA 2NS7A 1ZK8A 4XK4A 1HCRA 3I4NJ 1IC8A 4IHVA 2CQXA 3DCFA 2CRGA 3OIOA 4A3BJ 1FEXA 4QIWN 4I6ZA 1U8BA 4AC0A 2LVSA 2FD5A 2WAQN 2M0CA 2NS8A 4JYKA 1Y1WJ 2VKVA 1I6HJ 2LTPA 4D7NA 1BW5A 3W6VA 1X2MA 4XRMA 3BT9A 2W48A 3C2BA 1ETKA 1WH5A 3LOCA 2XGDA 1MSFC 5GPAA 3CMYA 1NTCA 4LOCA 1GDTA 3S14J 2LD5A 3PO3J 4DYCA 2YS9A 3HOVJ 2FJ1A 3JRDA 2CJJA 1UG2A 2DA7A 2R0QC 1EF4A 2DA6A 4V2FA 3IH2A 1MSEC 3QPLA 9ANTA 4M3BA 4A3EJ 1LE8A 1WH7A 2EBIA 4M3GA 3CCYA 1JUPA 2EH3A 2I10A 1YRNA 2DN0A 3DEWA 3SJMA 2D5VA 2EQRA 1DU0A 1SFOJ 1VNDA 2MGQA 5C3EJ 2JA8J 5EEAA 1LE8B 2Y0SN 2K9SA 3NARA 2LFBA 3LSJA 1PUFA 2DA1A 2LR8A 1ITYA 5EG0A 3FIWA 1R9TJ 2VKEA 5IPAA 2CUFA 1F36A 1MBGA 1K83J 4D5CA 4G12A 1I3QJ 1PUFB 1UMQA 1WCMJ 2COBA 3H0GJ 5EG0B 3BR5A 1TWCJ 2M34A 2M9HA 2HXIA 1APLC 4MIMA 1SANA 1G2HA 5F0FA 4MFDA 1ETOA 4A69C 3LSPA 4M3FA 4I76A 1FIAA 2LKXA 4MFEA 2MG4A 1IG7A 3TP3A 3S1QJ 1P7JA 3S15J 3BTLA 1BW6A 2AO9A 4A3KJ 3FK6A 2HOTA 5FLVA 4DYQA 1FTZA 3L1PA 3ZQGA 2H8RA 2DA2A 2MSYA 3K7AJ 3JREA 4A3IJ 4JX4A 1GV2A 3TEDA 2M2EA 3JRFA 1JGGA 5EDNA 1Z0XA 4BBSJ 1TWFJ 4X1EA 1JJ6C 5M5YJ 1O4XA 1W0TA 3O8GA 3A03A 4C3HJ 4B4CA 3UKGA 1ZQ3P 1TWGJ
chains in the Genus database with same CATH superfamily
5JHUA 2K40A 4DZPA 3OYMA 1YIJI 1NK3P 5HS7A 1ETYA 2VT2A 3IKVA 3K4KA 3S16J 5JFRA 2AQEA 2ELKA 1IO2A 2GIVA 1X3UA 3WU2C 3KEQA 2E34A 4NBQA 5M3FJ 3TW7A 5BS6A 5F27A 4HX8A 4A12A 2W1OA 4PJ0C 2XB0X 1MGTA 3S1NJ 4WXCA 5IT9Z 3CCQI 2Y30A 2A61A 1ZGWA 2VJ5A 5A2QK 2HDWA 2B9SA 4RB2C 1R1VA 2G0EA 2JUGA 3A01A 4K2EA 2W85A 3CP2A 3L00A 1VQPI 3SDGA 2XGXA 1BIAA 1U0JA 2O61A 3E5XA 2IA2A 1GLNA 3DQVC 3QPHA 1QZEA 3MZYA 3V7SA 1ZRCA 2NVTJ 2VJIA 1UHSA 2XGEA 1FOKA 2NXNB 3PFIA 3KEOA 3HHGA 3I4PA 1H8AC 1AKHB 3GYHX 1VQ6I 3IRQA 3OWTA 2DMPA 2QLZA 1LPQA 4JBAA 4CYCB 1VQ7I 1T8IA 2W84A 1XX5A 2HZDA 2PBIA 2KMUA 2EZHA 3L2WA 2EZIA 3CDHA 4UB6C 1RI7A 2F48A 3LA2A 5L3GA 1CF7B 2PI0A 4N9HA 4ESBA 1ZG5A 4B3XA 4C9YA 4PSXA 2JJ7A 2JUCA 2VC1A 3RJPA 2OBPA 5JVGF 2K3PA 4E7SA 5JHFA 3K2ZA 1ETWA 3F9KA 4XM3A 3OS1A 3ZQHA 3ABLH 4RMNA 2BYVE 1HKQA 4W97A 1D8JA 3BZCA 4XONA 5K1YA 2LREA 3DU5A 3CJRB 5FB2A 5F08A 2Y48A 2DJNA 2A68F 1BOBA 1KONA 1Y0NA 3O3KA 3GVAA 4U88A 2EFPA 2Z3YA 5HOOA 3HGYA 5LLQA 1MMAA 3ECHA 3T8RA 4PZJA 3DPUA 4N4OB 4LG0B 1MBHA 2EILH 4II3A 3ZN1A 4PK4A 2ZJRF 2V26A 1Y0UA 3DBRB 5J4VA 3G73A 3L9FA 5M5WJ 2ECBA 2D1VA 1H89C 2UXXA 1QZZA 1X1BA 3TDUC 4BJTA 4LD5A 1WI3A 2K9NA 2L7MP 4ON0A 1PUEE 4BXXJ 5FKNA 2HDDA 2JA7J 2KPMA 5M5XJ 5IYCJ 1E17A 1KQ9A 2DU9A 3GF2A 4Q4ZF 3H9GA 2R92J 2HYFA 2VOOA 4F92B 3PNVA 4G94A 3WHBA 2YU9J 4D5FA 1X1DA 3CUQB 3KYCB 1WGXA 3NWSA 4NHJA 5E1ZB 3LL7A 3RPUD 2A5YB 5E3LA 2M4KA 1R22A 2MLGA 2XV4S 1WPKA 3HSRA 4JP0A 3JAMZ 2Z5UA 3FXUA 3X2QH 1N77A 3IL2A 3GTMJ 3HBLA 2XPVA 5DYMA 3U1KA 3M3YJ 1E3OC 3MKWB 4OIRF 2L3DA 3LSMA 2XSJC 4I02A 3WODF 4PJLA 1K6OA 2ZMEC 4RLFA 3L2RA 2Q0OA 4Y33A 2R4GA 3ABMH 3F72A 3I4MJ 2XF5A 3KYLA 3IAM2 3ZGKA 4U0YA 4F52A 3ZQ7A 2PN6A 2IAIA 4G6QA 3MZHA 1I5ZA 5CVRA 3JRCA 2ETHA 3HHHA 2QKMB 1EH8A 1W36C 2FQ3A 1OCPA 1YTYA 2XF7A 1HLVA 2F5EA 2D2WA 3J80Z 3EYYA 1JKRC 3DF8A 2B63J 2L5QA 4RBOA 1TWAJ 5E1WA 3GTJJ 5HDGA 4HNUA 2OCCH 2O5RA 3W6KB 1QO0D 3FMSA 1XMXA 2IGMA 1YS6A 1OCOH 2K7LA 4DQ2A 2L02A 1WFXA 1MNDA 1IF1A 4CCLA 2JA5J 4A93J 3RPUA 1IW7F 2UV1A 1XPXA 1SFEA 1YW8A 4FASD 2KIMA 1OCZH 1U5TC 3U21A 1NK2P 3ML6A 3PFYA 2ID3A 3KP5A 1MMNA 2CW0F 1TT5B 1P4XA 1YJNI 1HW2A 2PEXA 4Y17A 3WTWC 3CTAA 5DTDA 4U0VA 3DP7A 1OISA 1D5VA 4EQQA 3P5JA 1HDDC 4B1RA 3IAS2 4IHYA 4Y13A 4A3GJ 1WQ2A 5D5VB 4F93B 3LMMA 3FXKA 4HOBA 2A6HF 3LA7A 5F0CA 2FQ4A 2P5VA 1A6QA 1Z21A 3GBGA 4RM3A 4NUBA 2EA2A 4NDLA 4Q47A 5BQTA 3BWGA 3TO6A 2DFHA 3ZQIA 4BEHB 3IC7A 1NHAA 3PUFA 1O3TA 2QYOA 2MYSA 5DV5A 5J1UA 1RIOH 3OL3A 1YW7A 4CXFA 4ZDOA 2BE5F 3F0CA 2IS6A 4WXDA 1B72A 1TNTA 5EZHA 4I2OA 3I9V2 3PIOF 2L9RA 3GZ5A 2OD5A 1T08B 1W5TA 2JPBA 1OR7A 3S17J 1W7PA 1JKPC 1XMAA 2RQQA 4A0XA 4HNVA 4P9UA 3F23A 3EQLF 1S6LA 2A5WA 4D0PA 5JLWA 2VUMJ 1OCTC 3KZYA 2Y9ZA 4DGWB 4YFNF 4NQWB 3ERED 1S7EA 2LOOA 4G9YA 4HX4A 4WWCA 4HW0A 2FU4A 3S1RJ 3OYAA 1FOXA 3OR1C 4HPQA 3OV8A 1WJEA 3CCRI 2I8DA 3BTCA 3V8LA 2A69F 4ESJA 4D9JA 3BG5A 1SMTA 4HBLA 2KHMA 1QBJA 3A0BC 5B5EC 5C4JJ 4KNYA 3CZ6A 4OIPF 3BY6A 4FISA 4A6DA 5J6XA 5HNFA 3H5RA 3K1NA 1FT9A 3OYGA 5HS9A 4BHCA 1IV8A 2KIFA 1A31A 2L01A 1ETQA 1OCRH 5H20A 3K1PA 3KEYA 3M8FA 2W24A 2LBFB 3BTJA 3JRAA 1U8RA 2YSRA 2VC0A 2KJBA 2X6OA 3ZXSA 2E1MC 1GXQA 3C1DA 4HEA2 2OU2A 2LMDA 3LQQA 2UWMA 1B59A 4CCOA 4OINF 1WJ5A 4LG3A 3G71I 3PSFA 4AIDA 3H3ZA 4UUTA 1E0EA 4RAGA 2M7BA 2JQ7A 3EUKL 2DBBA 4CUGA 3IKTA 2O3FA 2FNAA 1VTNC 1HDPA 1LDJA 4KN4X 2OTLI 3CJNA 1WJAA 2V9VA 3D0SA 3S3MA 2R7FA 2R3SA 4D7MA 1NG6A 2BY2A 2V6EA 4M3EA 1IDYA 3Q3SA 2ZCWA 3BC8A 2WTEA 4KA4A 2HPMA 1ZAOA 3HOUJ 2QSFX 1SD7A 3ZOBA 3M4OJ 2CU7A 2NOGA 3WTSC 2K5CA 4MNUA 3RQIA 3K0LA 4XICA 2E7XA 1S7OA 2WAFA 4LFUA 3L09A 3V4GA 4BJ6C 3L2VA 1D8KA 3ELKA 6PAXA 2JWTA 3WTXC 1X4PA 2NS7A 4XLNF 1FWZA 4XK4A 2IGKA 1RNLA 2CQXA 5CVUA 3OIOA 5IT3A 2BGCA 3OYKA 4IQ4A 2JRTA 4IO9F 3MQ0A 3L2UA 1U8BA 2EV0A 1KYZA 2NS8A 2DPUA 3DTKA 3FM3A 2QQBA 4JYKA 2FOWA 1Y1WJ 2DT7B 2VQGA 1WWXA 4XSZF 4EJOA 4O6JA 1ZQ3P 1FOWA 2KISA 1I6HJ 2XDVA 1LJ9A 3WU1B 4OU0A 1HBXG 4XRMA 3BT9A 1ETKA 4P1WA 2XGDA 4B48A 2E36A 1MMGA 1GDTA 1BIBA 4E7IA 3VDXA 3FXOA 2DCEA 2WAEA 3QYEA 3KP3A 4F91B 1R49A 1WZ2A 1EJ9A 3HRUA 2R0QC 1EF4A 2CH0A 4GGGA 4XNFA 1BC7C 2L2OA 1CF7A 4U87A 1V3FA 3WTZA 3KETA 1WH7A 1ZG3A 2ZFUA 3CCYA 1JUPA 2X85A 3VYUB 1YYVA 3A4CA 1YE9A 5L3DA 4AWXB 2XASA 3UNGC 2D5VA 2A05A 4NC8A 3CDIA 3HYIA 4I99C 4CCNA 3DKWA 2P6SA 3PIPF 5C3EJ 3RI4A 2ZMEB 1SAXA 3S3OA 5EEAA 1LE8B 5LHGA 2ZJPF 1S3JA 2YR2A 2CFXA 3FX3A 3NQOA 2IS2A 2OCEA 3K4JA 2LR8A 2IJLA 4GO1A 4L0ZB 2L54A 5EG0A 3M07A 4ZYAA 4P55A 2VKEA 1R1TA 2FEZA 1XN7A 1Z3XA 2WY7Q 3AL0C 2DXIA 4LIVA 2ICWG 2DLLA 3W2AA 4LK0F 4AVPA 3OYHA 3FM5A 3DWLE 4G7HF 1UCRA 2XHKA 4EJWA 1P6RA 2BY3A 2HKOA 2M9HA 1S29A 2VKDA 2M45A 4BGDA 1HQCA 4MIMA 5DM6F 5GTIC 4IQJA 1U5TB 4A69C 4XQFA 4PSWA 3LSPA 1F4KA 1BR4A 3SEZA 4I76A 3EUHC 4Y15A 1XMKA 2QUFA 2V1NA 3RIRA 2VB6A 3RKYA 5FGMA 1W4MA 1TL8A 1KYWA 4NNJA 1FSHA 3Q9VA 4XLFA 4HV5A 4HZFA 3U1DA 5J8CA 3FK6A 4IRHA 4IRIA 4UVAA 3W2WA 1UZCA 4YIRX 5FRMA 3ZQGA 2H8RA 1J9IA 5KHDA 3ULQB 4BE2A 4A3IJ 3GX4X 1VQLI 4OMYA 4EM2A 3TEDA 3TDZC 2L7KA 3KLNA 1Z0XA 4IJAA 3FMQA 4GYGA 5EDNA 1J75A 1TNSA 5L3CA 4Z6YA 3BDDA 2DFIA 5M5YJ 2LNBA 5L3BA 2A6TA 2IXSA 2R7OA 3ABTA 1VQ5I 2AQFA 1TWGJ 1V55H 3O6BB 4XKWA 1BI3A 3BPVA 2VE9A 3OYIA 1JHHA 4AIKA 3S32A 2ME6A 4IL6C 2HNHA 2CYYA 3DTIA 1R1UA 2BBYA 5C44J 4MQ9F 4XR6A 1XSVA 4V19K 3JW4A 1IRXA 4P9FA 1TW3A 3CJQB 4PGGA 2GAUA 2QENA 4BU2A 1IGNA 3SHFA 2DDAA 2Y9YA 1ERDA 1O7FA 3DLAA 3NRVA 3CJTB 2DMTA 4Z2YA 1Z77A 2KRCA 1VFCA 5GP9A 3JRBA 5E3OA 4KT6A 3TW6A 4IZZA 1QVUA 3OMYA 3E6BA 2HKXA 2VLAA 3GTGJ 3GLLA 2DW4A 2EZKA 4A3MJ 4HG2A 5JVTA 3I5UA 1MW7A 2XAUA 3OYDA 4LB6B 2OQRA 3HC7A 3WE2A 2HQNA 5ICCA 4RB1A 4Y3OA 4A3FJ 1Z91A 1UJ8A 3E5UA 5IT9K 5E8IA 2D1HA 2JA2A 4ABZA 3B6CA 4EJTA 2PMHA 3CUOA 4B3AA 3EETA 5IY5H 3DPLC 2PMUA 2Y0MA 1TQPA 4XLHA 1R4MB 1BN5A 3K4LA 2HU9A 1BJZA 1JTYA 4FETA 2G7UA 4E7ZA 1S9HA 5LGUA 1YRNB 1BI0A 2MC4A 3FK7A 3MWMA 5EGOB 1I27A 2ZXIA 2LRDA 3R6SA 4KT5C 1TC3C 4O5VA 2HDCA 1FP2A 2CV0A 5CVIA 4EM0B 1P4AA 2CW8A 2HQRA 3FXJA 5IP9J 5HNHA 3PO2J 1YW9A 1U9OA 2L0KA 2PG4A 2OC6A 2LSOA 4Y7NJ 4J19A 3WTUC 1E2XA 3E6MA 3WGIA 1MJAA 1TBXA 2P4WA 4DZJA 1L3LA 2F6CA 1DGWY 1XGMA 1OYIA 3KYDB 4EV0A 3A1YA 5FKOA 2XPWA 1JTXA 2O8KA 2R5ZA 3MEXA 2Q8KA 2HGCA 3RZDJ 2LBFA 1AHDP 5GTHC 1RZ4A 2V7FA 5EF6A 2RDPA 3I0TA 3KX2A 3S93A 3W6JB 5HLGA 4XSXF 4IF4A 2IBDA 4LITA 2CQKA 4KMUX 3ESWB 3OYJA 3HL2A 4BE1A 1AU7A 4KITB 2QGUA 2DDBA 2W25A 2HS5A 4A0ZA 2YX7A 3DKXA 4I7HA 2VT3A 5LHHA 2R7VA 4HNTA 1G8XA 1GT0C 3F8NA 1U3EM 4RGXA 2GA2A 2M87A 1YI2I 3IRRA 2CGPA 1ZLJA 3D5SC 1D0XA 3I59B 5J3LA 4CGZA 3HOWJ 1JKOC 3ABKH 2X1DA 2R5YA 3RTRA 4OAYA 4BJ5C 4XKBA 1SAUA 4UVCA 1YQAA 3DEEA 2K85A 3HG9A 1TQIA 2W4SA 2RGVA 5K5QA 2GLOA 3MKYB 5E8GA 2HQAA 3T8TA 1OFCX 1FTTA 2E1CA 1SFUA 2VIXA 4M6YA 2DA3A 2M8GX 4M3DA 4XOTA 3K9TA 3JAMK 2VJJA 3FXMA 2RAEA 5IP6A 4YELA 2P7CB 1TLHB 3IP4B 2MA3A 1A5JA 3CP8A 3ZPLA 3TKYA 4A2UA 4BKXA 2Y2ZA 3H3UA 1JE8A 1JT0A 1VF9A 3AL0B 3CLQA 4ZZLA 4XRSA 3O8HA 1ZRDA 1ZR2A 3BZ6A 3LAJA 2LF8A 1MBEA 2X51A 3BJ6A 1W36D 4O3MA 3ABUA 2ZNYA 2PJRA 4ASNA 4FQGA 1IRFA 4QSHA 4F3QA 5ED4A 3SDBA 4QWQA 3K2AA 4HF1A 3J80K 3BR6A 3FWEA 1Y8RB 3KP2A 3LFUA 4G7OF 2G7HA 5K7FA 4YG2F 2KQRA 4MEXF 1Z3YA 3HRTA 1SD6A 2NNNA 2FUG2 2O0YA 5EJCA 2PMZA 5KNLA 2BW3B 4AIJA 2EFQA 1T98A 2BOLA 2PMZN 2WADA 1JUSA 2FF4A 5KAIC 1QGPA 5JLXA 2OJED 3Q5FA 2KRHA 1B8IB 1JUMA 2QKLB 2WV1A 3SZGA 4HX7A 5ICEA 1O3SA 3GFMA 4AD9A 3F8CA 4ZDLA 4BBRJ 2DPDA 2ZMEA 1IN8A 3RKWA 2FMLA 4UUSB 1D0ZA 2VBXA 4CSWA 3HPGA 4PUSA 2P7VB 4EGYA 2VOPA 1QPIA 2M1BA 2VPLA 2V4JC 3R0JA 5L3FA 1ZTRA 3H35A 2BY0A 4DYRA 1FYKA 2IA0A 2MBFA 1R5HA 5GADJ 4RDUA 4JOMA 4E4HA 4V2GA 5L3EA 2R7XA 2P5LC 5KAFC 1YFHA 4ZTJA 2KKOA 3TOAA 2K02A 2QZ8A 1IJWC 4IRGA 2ME0A 1RPWA 5CPRB 1T95A 2R7WA 3CC4I 4BNCA 5HLIA 1U5TA 3H9JA 4S0HB 4UUVA 2DO7A 2X9DA 1Y6IA 3OYFA 1ORKA 4CZZA 4RAZA 3D5LA 1BL0A 1Z7LA 2STWA 1XSDA 5LGNA 3G2BA 1N25A 1Y8QB 5CVVA 3K69A 1RKTA 4ZYGA 3MAJA 2JSPA 1PP8F 3GTQJ 4XLCA 1WJFA 3CO7C 3M8EA 3N05A 2FA5A 3C18A 5TISC 5FKMA 2E71A 1X2NA 1BM9A 1WKMA 2M0MA 2ID6A 3HSFA 2IA1A 5F64A 1LFBA 2O9LA 4M72A 2ZXHA 3WTYC 2R7UA 3ZQFA 3S2WA 3FXQA 4CO8A 2Y69H 1LNWA 3COAC 3FHNA 2NS0A 2DQLA 3GW2A 1O57A 1OLTA 1D1CA 2DODA 4DW6A 2BZTA 4ENKA 1IV6A 2X0LA 4PJNA 2XVCA 4A0YA 4D1QA 4HDVA 5LD2C 1HCRA 2EV6A 2AXLA 4BYYA 3DCFA 2CRGA 3HIFA 1B4AA 4FX0A 1RUOA 4A3BJ 1V5EA 3BCAA 3UR3C 1ZG1A 4Q48A 1WRJA 2LVSA 4QPQA 2WAQN 3OYNA 4FX4A 5DUKA 3JCUC 4E7HA 1LDKB 2NOJB 5HDNA 3QU3A 1WSUA 1GHCA 1UFMA 2JVGA 2XKPA 2Z9OA 1B1BA 4M74A 1J59A 1X1AA 1BW5A 1SFKA 3PUBA 3CESA 5GPAA 5LGTA 2W82A 3BCBA 4LOCA 2OQGA 4ENMA 3S14J 1VQMI 2YS9A 1T0FC 3LWFA 4NC7A 2DA7A 1QNTA 2KP6A 2FMYA 2KZVA 2DA6A 1I1SA 4A6EA 5BPIA 4L9NA 1MSEC 1ONVA 3BZKA 2RVCA 4M3BA 4EM1A 1Z05A 1UHMA 3CCJI 1AWCA 1G3YA 3KLOA 1OMIA 4S05A 1YRNA 1I1GA 2DN0A 3VSLA 2JRMA 4C30A 2RQPA 3DPTA 1SMYF 1KGSA 1VNDA 3L2QA 1K6YA 2Y0SA 3F6OA 2HVSA 3NWTA 2JA8J 2J5PA 4UY8I 2L9NA 5DCMA 2GXBA 2Y0SN 1JGSA 3AG1H 2LFBA 3LSJA 1PUFA 1ZARA 1VQ4I 2DA1A 4WK8F 3DBLB 2DK5A 1R9TJ 1D3YA 4YIFA 5IPAA 2CUFA 3OS0A 2VQHA 2Z16A 4A5MA 3HUGA 3E1SA 1NG7A 1K78B 1UMQA 4CICA 2FBKA 1RRJA 3CF5F 3MCZA 5ILVA 3FMRA 2VONA 3SQNA 2HXIA 3FBNB 3PNTA 1V4RA 2XRNA 3H9QA 3WGGA 4F7ZA 2DT6A 5F0FA 2VODA 2FNPA 4EATA 4EGZA 4II2A 2WA0A 1EKEA 4ZYDA 1ZYRF 3JSOA 5J8FA 1IN5A 1IG7A 4KISA 3V7RA 2KIQA 3ZP5A 1PYVA 2X6XA 3CCSI 3OS2A 2VBYA 1B6AA 3MD2A 4IX7A 2MSYA 2QSGX 2IVMA 1LQ1A 3K7AJ 3I59A 4ZYEA 4UVBA 2TDXA 4G6TB 4JX4A 2M2EA 3JRFA 2CV2A 1JGGA 2CUJA 1WJCA 1TWFJ 1XCVA 2MFZA 4X1EA 1JJ6C 1P2FA 3N4MA 5FROA 2JSCA 2LF7A 3BP8A 4AU7A 1W0TA 4IHTA 3VFZA 4B4CA 5LEKA 4KIFA 3G6EI 2DMUA 1SEUA 5J40A 3RCOA 2QBYB 3F6VA 2NVQJ 1QU3A 4FTHA 4W1UA 4YEJA 4WCGA 2H1KA 2MLKA 3GLXA 1ZREA 2NVXJ 2EJRA 2I5UA 2O8XA 2OF7A 2OZUA 4ZTFA 4QTRA 1AA7A 1RESA 2X1CA 5FKLA 1IN4A 4XIDA 2LK2A 4BQQA 2TRTA 2CQ7A 3IUOA 2GM4A 3TP0A 3HRMA 2CO5A 3F8MA 3R60A 4CDGA 4B44A 1X1PA 2VBWA 3I64A 4FE4A 1H88C 4RA2A 3ROUA 3H3VK 1CGPA 2VQCA 3ASOH 2ZSIB 1MDMB 4CZCA 1X58A 1YJWI 2MD5A 1LEBA 3IWZA 1OYWA 3M7GA 1R5GA 3GFLA 5D5WB 3QPSA 5K7ZA 4R79A 3AFHA 3GFIA 1AKHA 4AVZA 1H0MA 3EUHA 3PSIA 3C3WA 4XMYA 1A36A 2OPTA 1IRGA 4CYCA 3A01B 2X48A 1IRZA 1Y56A 2IP2A 2R93J 2ELJA 3NEUA 2GOXB 2PFBA 4I0AA 2C6YA 3TL4X 5KCMA 4H0EA 2M8EA 4HQEA 1MBKA 3FISA 4A3DJ 2CQNA 3QWLA 3O2PE 3MKLA 1JT6A 3ONQA 1I50J 4BH9A 5DDGA 4A3CJ 2LP0A 1EV7A 5LHIA 1XDSA 4RGUA 4UXNA 1W5SA 2NVYJ 1IN6A 3CCEI 5D6FA 1YHQI 3MVPA 5FLXK 4M6VA 4JQFA 3E6CC 2V9PA 1FLIA 4MTEA 2Y31A 4LG0A 2CFOA 2ELHA 4HF2A 1X19A 3H5NA 3GWZA 2UXNA 2HEOA 1P9QC 4LB5A 2M3AA 2ISYA 3BJOA 3HXLA 3LAPA 1O3RA 1OYYA 5D5UB 1DGRM 1YJ9I 2W7NA 4ZH4F 3RDIA 4RB0A 5FRNA 2WBMA 1XC5A 5EEGA 1Z7UA 4EJVA 2CUZA 2FE3A 4PGHA 4AIHA 3ZMSA 3K4BA 2P81A 4XN0A 3D1NI 5HLHA 1GV5A 3QOEA 3DU6A 3CD6I 2ISZA 5K5OA 2D45A 2EZLA 3CUQA 3OOPA 3GFJA 4HRIA 4C3IJ 1LVAA 1DPUA 1FZPB 5BOXA 1DUXC 5B1BH 1T2KA 2RNJA 2QQ8A 2ZBKA 3MKZA 2YX4A 3ISPA 5HODA 1TWHJ 2JVHA 5HLTA 1FIPA 4DIQA 2PX9A 5FD6A 4WX9A 3WGHA 4WF2A 3W2VA 3E6DA 2P5KA 3E97A 1EH7A 1ULYA 1Z67A 2OV7A 3ZRGA 1BA5A 1B9MA 4L9TA 2ZKZA 2KDZA 2V79A 1MH3A 3WE3A 3HTUA 3Q9SA 5FKKA 3K6GA 5H6QA 3AG2H 4I0BA 2K86A 5CQGA 1ACIA 3SFZA 3WU0A 3K70C 1DU6A 3J81Z 3Q0VA 2E5NA 2KIUA 4IHXA 3LSIA 5B1AH 3OIQA 1U6GA 2B0LA 4GDFA 1UG0A 3CC7I 3I3LA 2BVLA 1BI1A 3BG7A 3AG4H 3BTIA 3M1EA 3AAFA 1Z6TA 2LC2A 2M5WA 3GZNB 4OOIA 1R23A 1U9NA 3RQ4A 1MMDA 2F5FA 2FRHA 2XAHA 4HF0A 2WWYA 1MJBA 2FSWA 1GUUA 1O3QA 2Z99A 3AKZA 1DQUA 3JSPA 4UV9A 1FYLA 3GTLJ 4XBFA 3ZMZA 4I01A 3WTVC 1TTYA 4G8XA 5GAEJ 4XL9A 3PQKA 1QHGA 3QOPA 3B73A 2GQQA 4JX6A 5DM7F 3OYEA 4XKVA 4LGWA 3V8JA 5E3NA 1FX7A 1A6IA 2QF7A 2E2HJ 3OYBA 5HS8A 4I09A 3LSKA 5FLXZ 5DCFA 2K9QA 4NB5A 3PL8A 2VXZA 4BEHA 2G9WA 2WV0A 1JHFA 3QQAA 1WJDA 2FX0A 3S8PA 2MC3A 2BVMA 1USTA 2DFEA 2BXZA 2K9MA 5GAHJ 5DS9A 3HOSA 1D5YA 1P7IA 1T33A 2E2JJ 5ICGA 3RZOJ 4U7BA 2XPUA 3I71A 2IPQX 3VEPA 4IHWA 5HDKA 1KQ8A 3E0JB 2P8TA 1IXRC 2HTSA 1R6RA 2L9VA 2E1OA 2DAOA 3NAUA 3HOXJ 2M4GA 1MMSA 1E3HA 2KFDA 4LMYA 3N97A 2WB1A 3Q0WA 2ZJQF 1XCBA 2PLYA 1XDUA 4BACA 2XROA 2WB1N 3S2HJ 2HI3A 2ZB9A 1FOYA 2XAQA 1S8NA 2KT0A 5D4RA 2JT1A 4NQWA 3ZQQA 2GA1A 1MNMC 1I6XA 5BNGA 4HDUA 2QM3A 3BJAA 5D6EA 3OR2C 4CCKA 4EEFG 1B72B 4A3LJ 2BV6A 2DJIA 1XSXA 1J09A 3HB9A 4CYDA 4M71A 1W7PB 3EPZA 3HKZA 2KZGA 3BG3A 2QQ9A 1VI0A 4ZYHA 4BS9A 1PP7U 1VQNI 2IT0A 3HKZN 4AUXA 2LY9A 5FFXA 3I58A 3V7CA 4BQAA 1XGSA 5M3MJ 3HRSA 1QQIA 4P5OA 1K4TA 3VYTB 2DMNA 4C2MJ 4M6XA 2AS5F 3QAHA 1FC3A 1FPQA 4B47A 5B66C 1FP1D 3SEQA 4G7ZF 3REOA 4KICA 2XB5A 2E1NA 4LIUA 4ZZDA 5EZGA 3TQNA 3IH4A 1CQTA 2H94A 1XS9A 1ETVA 2XSDC 4N9IA 3CMAI 3G1LA 4IXAA 3RYPA 3LSRA 1ZHFA 1XB4A 2EWNA 2F4IA 2X4HA 3B02A 3F21A 3BR2A 3SFIA 4UB8C 4X0GA 2V6CA 5FO5A 1XGOA 2RC4A 5JI6A 3E5QA 1M1EB 3H5AA 5LRRA 2VKHA 2OA4A 2A3SA 4BY1J 2Y75A 2OZ6A 4HA8A 1Q1VA 2ZXWH 3FHZA 2K4BA 2JA6J 3ZR8X 1MBJA 1XD7A 1YX3A 2QCOA 2CWEA 4HQMA 1IAWA 3HEFA 2QWWA 3CMMA 4LLGF 1WI9A 1T39A 3G1OA 1HKTA 3T5XA 3BG9A 3RKQA 2HOSA 2DYRH 3T0YA 3K1MA 4CH7A 1QVTA 2E5ZA 1SFXA 3VWBA 4YRVA 1K7AA 2STTA 2JMWA 1J0RA 2VBZA 3P9CA 1R58A 3CO6C 2IEKA 2LY2A 2DT5A 4AYBA 1KA8A 2EFWA 1NH3A 3L2CA 5F1RA 2J5OA 4AYBN 1PVEA 1ZELA 3HTSB 2CSOA 1TW2A 3I4NJ 3TOBA 1U2WA 4BL0B 1IC8A 1FNNA 4IHVA 1FEXA 3LQRA 4QIWN 1ZLKA 2PJPA 1QA6A 4UHTA 3EYIA 2IGOA 2DFFA 2QVOA 1QZYA 3K10A 1MDMA 4KFCA 1LFPA 1OKRA 3V8KA 1G6NA 3P7NA 3LSHA 1K4SA 2KRFA 4RM2A 2ESHA 4A5NA 1TT0A 1BC8C 2EINH 2AXTC 3W6VA 1X2MA 2W48A 2K9LA 3C2BA 2O6GE 1WH5A 4R1HA 3A2KA 4PCQA 2M30A 3CMYA 2GWRA 5LFAA 1KQ0A 2DOFA 1NTCA 3I55I 1FSEA 4XRFA 2LD5A 2XAGA 2ZFWA 2IW5A 4DNCA 1VZ0A 4DYCA 1EH6A 5BMZA 3HOVJ 2E35A 4HAMA 1UG2A 4PJMA 2EFOA 4V2FA 5ILUA 4F55A 3KZZA 2EIMH 1D1AA 2ZC2A 1BJAA 3QPLA 5KVRA 9ANTA 5ICFA 2M7AA 1LE8A 4M3GA 2EBIA 3DFGA 4OIOF 3RYRA 1MJ9A 2HVQA 4FT8A 2R7DA 3DEWA 3KZIC 4RS8A 2EQRA 2W57A 1G3SA 1DU0A 1H9GA 1ZH5A 2V1DA 2YPRA 2COMA 3P9IA 1YITI 2A07F 2VASA 2YU3A 2Q2EB 5HVQC 3CF2A 1ITYA 4RAFA 2NYXA 3JTHA 3WG7H 3FIWA 4E70A 1YX5A 1H9TA 2IS4A 2FXAA 4RGRA 1SVOA 5D4SA 1F36A 4D5CA 1V54H 5K5RA 1YIOA 1KU9A 3E3VA 4AM3A 2COBA 2PQ8A 3H0GJ 5EG0B 4IHSA 1DPRA 2VE8A 4EJUA 2L4AA 2M34A 5CQEA 1F1ZA 2BY1A 2MABA 3LSTA 3LA3A 3VSKA 1UELB 1G2HA 4UV8A 4L5IA 3ZMDA 3CMEI 4KIBA 3M1CA 1YG2A 3GZ6A 2B7EA 1IUYA 1FIAA 1SC7A 2BHZA 3L7WA 3CC2I 2MG4A 2WC2A 3GEZA 2WY8Q 1P7JA 2MD0A 2V1XA 2DI3A 1HA8A 3S15J 3BTLA 5DEQA 1BW6A 5AONA 5LBQA 4IPAA 2LKSA 1ON1A 1T0FA 4KJZA 4PFOA 3S3NA 2VQLA 3KP7A 2XAJA 4YIIA 4M73A 2H1LA 3MFKA 1VQ9I 1VQ8I 2HOTA 5FLVA 1Q1HA 4DYQA 1FBQA 2DA2A 4BHPA 3I54A 3ASNH 3JREA 2DOEA 1KU7A 3SXYA 2ADUA 4KMFA 1S72I 1W5CC 1Z6RA 1MIJA 5LEJA 5CKTA 2ZO4A 3RPQA 5A2QZ 4HSRA 3A03A 4TV7A 1USSA 1TZLA 2R7QA 5H6RA 3LFKA 1BOAA 3GTKJ 5D5XB 5CJ9A 4S04A 1LDDA 2VJ4A 2XAFA 2K27A 3IH3A 1JJ8C 3G3ZA 3FKIJ 2X6YA 3JRIA 2WAQA 5IP7J 3E7LA 2E7WA 4FCYA 1N75A 1QRYA 5J1RA 4U0WA 4BXUA 1WVRA 2DTRA 2DTZA 1PDNC 2V1UA 3CQZJ 4KYWA 2HXOA 3H92A 3KCCA 1TQMA 5E18F 1FJLA 4GFBA 4BQOA 1MKMA 4B09A 1FBSA 1I3AA 2KJCA 1GVDA 1W7PD 2ZSHB 3AG3H 4J01A 2VPRA 1P4WA 4GXOA 2QQAA 3F8BA 2F2EA 1OQYA 2KLOA 2NVUB 3VOEA 3ZQCA 1Y1VJ 1RETA 3PQJA 5JR3A 2MH2A 2EIKH 5J1YA 4LK1F 1PJRA 2ACJA 1ZN2A 1YOVB 3CCLI 5IYDJ 5E79C 1REPC 4OMZA 4C2UA 4C3JJ 1J2XA 5E17F 2EFNA 3ZN0A 1X3WB 5E20A 3K4CA 3LNQA 1SVMA 3SYTA 4BXFA 1W1WE 2EIJH 4CCJA 5EGOA 3HJEA 2DA5A 5D8KB 3B6AA 2UZKA 2HVRA 2RKHA 1HW1A 2BHYA 1D0YA 3HOYJ 4E7KA 3OSGA 4XKCA 4XORA 2ESNA 3BQZA 4CHUA 5ILSA 1ETXA 2HOAA 5FLMJ 4BY7J 2NRAC 3EDPA 4L9VA 1W0UA 5IOZA 1D1BA 5LRSA 1LUJB 2JN6A 3DXJF 3PJRA 1BBYA 3HPHA 2FBIA 2Q1ZB 3JTGA 4ZDPA 2DK8A 1VQKI 3R4KA 3DTEA 2R7RA 2HYGD 4OWRB 3C2HA 3RSNA 1YO5C 2CS3A 4MEYF 3WTTC 3QU6A 2RREA 1T56A 1T6SA 2DA4A 3P9KA 1FY7A 1R4NB 1VQOI 2KDOA 4DBRA 4E7LA 2JK3A 1QHHD 5F6FA 2H27A 4R8HA 2HYJA 4RLQA 4KIGA 2CV1A 1S5LC 5FJ8J 2H6BA 3GO5A 2IRFG 4DOZA 1R00A 2LDUA 4EVIA 3F22A 1F9NA 4A3JJ 2A6EF 3GCMA 3TO7A 1K61A 3ECOA 2R5ZB 4MTDA 5C4XJ 2X1EA 2VI6A 5CLSA 1ZKGA 1U78A 2CUEA 4BQNA 2AHQA 5F0HA 5J47A 4Y52J 3QYBA 2E2IJ 1WHUA 1GXPA 1OPCA 5IOYA 1IN7A 2HOEA 3G1MA 4BDZA 2RNGA 3R61A 4X6AJ 5EYRA 1RKWA 3EUAA 2R7ZJ 4OAZA 2L7ZA 1OR7C 3D5RC 3FBIB 4ITVA 2OTJI 1SVLA 1EA3A 1S7AA 3RKXA 3GXOA 4KDPA 1BR2A 2EK5A 3LSGA 1GVJA 1XTAA 3A02A 3I53A 3HDDA 2MH9A 1X1CA 4BUPA 2R5YB 2HR3A 2HQ5A 5IYBJ 4LJZF 1RR8C 4L5EA 4GRIA 2NAZA 3DBHB 4MO7A 1IDZA 3BG6A 3KFWX 4GYIA 4N0BA 1KZHA 3SZTA 5F1JA 1F43A 3VPRA 1KU2A 1R5ID 3TO9A 1DP3A 3HSEA 3K70D 4U7DA 5E3MA 2GBYA 3CCVI 3J81K 3GTPJ 4L9JA 2DOAA 5K7HA 5EEHA 3WG9A 3HGGA 4FE7A 5CYVA 3F3XA 1JXSA 2L7FP 3QODA 1ZGAA 2FOKA 2BW3A 2ZNZA 1N78A 2GZWA 3BROA 4KN7X 4MHGA 4HLYA 3R0AA 1LFUP 4L18B 4HYEA 1ZRFA 3BPXA 5TRDA 1ON2A 1LB2A 3ERMA 3M9AA 3J7ZI 5ERIA 4EMSA 1MZBA 3H1CA 1B8IA 2EPFA 1F5TA 2PJRB 3J7YJ 4NC6A 4ETSA 3K4NA 4IKFA 3QPTA 3ZMTA 2XKOA 3QRFF 3CDLA 3WHCA 3PNYA 2H8WA 1IUFA 4PFPA 2O7OA 4LLNA 4MLOA 1A04A 4QLCU 4UUSA 1POGA 1XG1A 2CG4A 2EV5A 2V9KA 3JRGA 4OIQF 1DDNA 2CQQA 3Q0UA 5J4YA 4MGRA 5DD8A 2TCTA 4ESFA 4G6DA 2JTVA 3BOQA 4JX5A 2QA4I 1QPMA 3OSFA 2L9SA 2Q2EA 2VN2A 1MH4A 4BHBA 3ZQLA 2E60A 2OAZA 2NNYA 2L4MA 4ENNA 1HOMA 1UB9A 3CCMI 2QEXI 2MW8A 2YUSA 3J7AY 1WJBA 2RN7A 3IHUA 2N8GA 1RUNA 4E7JA 3J7AO 2R7TA 1MBFA 3BR3A 1UAAA 1JKQC 4Q5SF 2H09A 3C7JA 4HLXA 2DYSH 2K4JA 4UNOA 1RR7A 2E19A 2CW7A 4H4KC 1ZGJA 2LYCA 4XRSG 3JRHA 3HZJA 4Y4RA 4M9ZA 2ECCA 3JR9A 3IV5A 1UHWA 3K4MA 5F04A 4YFXF 1MD0A 2W00A 2Z1DA 4DJAA 1HSJA 5DD4A 1R7JA 1X3ZB 5D8LB 1R36A 3BR1A 2UUZA 2HWVA 3M8JA 4WXHA 2P6TA 4GCVA 3HOTA 2X6WA 4RAYA 3OOUA 2OUMA 3QP5A 1HF0A 1JI8A 2LKPA 1DP7P 3S1MJ 1SD4A 1O7LA 4HV6A 3VB2A 1E3PA 4JK1X 1LKXA 2JPCA 2VXDA 3PM1A 4BE0A 1Y39A 1FMVA 3IWFA 3BQYA 3VYSB 3FZVA 2GIZA 1J5YA 3MN2A 4L0YB 2GXGA 3HM5A 1IXCA 2XRLA 5DUIA 5GPCA 2Z33A 3GTOJ 1C0WA 3BR0A 4BDYA 2LH9A 3MZ8A 1ODDA 4MQVA 1P92A 1LVKA 3G4SI 2ZJ2A 1FYMA 4M9SA 3DEUA 2DMQA 4XLEA 1ZR4A 3ZCOA 1G3WA 2EA4A 4B43A 1G3TA 1FMWA 4CCMA 3FF5A 2DQRA 2LLKA 2XGCA 3KIOA 1B9NA 4IEJA 1OJLA 3GUDA 3S2DJ 3HOZJ 2VL8A 1X4OA 1ENHA 3TMOA 1ZK8A 5TGTA 3OY9A 3GMEA 2XIGA 1SD5A 2XC7A 2CMPA 3VODA 4P96A 1IZ1A 3I56I 4I6ZA 3FDYA 1STZA 4AC0A 2FD5A 2HFHA 2M0CA 3FXRA 5KK1A 5GAGJ 4CA0A 5FFZA 1G59A 2VKVA 3DKYA 1OCCH 1FBUA 2LTPA 4D7NA 2FBHA 2IGNA 3CUQC 2P0WA 3LOCA 1MSFC 1HKSA 3H0DA 3DLLF 3PO3J 5H2FC 1G4DA 2IS1A 2LG4A 4PDKA 4XN3A 2O03A 2FJ1A 3JRDA 3QYFA 2CJJA 4N4NB 2BXYA 4XLAA 1V5GA 2F5DA 1I39A 1HC8A 1J7KA 2HZTA 3IH2A 4YFKF 2F4MB 2E1MB 1YS7A 4A3EJ 2HPIA 4IOCF 2R7SA 3H36A 4BAYA 2EH3A 2I10A 3U9GA 3SJMA 2XUBA 1KU3A 5E1XA 1Z9CA 1AOYA 3OL4A 1SFOJ 3W3CA 4L5JA 2MGQA 2RV8A 5FD5A 4IOAF 2JZYA 4ANJA 3CLOA 3V42A 2K9SA 3NARA 1HXDA 4J00A 2HTJA 1K78A 1A35A 5AIQA 2F4OB 1V5FA 3VYRB 2XF6A 5DCMB 1MBGA 1K83J 1HW5A 4G12A 1I3QJ 5TJJA 1PUFB 1IXSB 3BLYA 3KPHA 1WCMJ 2K3FA 3T1BA 3CCUI 5BPDA 3BR5A 1TWCJ 3TGNA 2H6CA 2F5VA 2ZXJA 1YLFA 4ZJZA 5CVJA 3A0HC 1APLC 3HUGB 4I98B 1SANA 3FKJA 1LEAA 4XLPF 1BI2A 3TBIA 4XOPA 3FXLA 4MFDA 1RC9A 3KE2A 1ETOA 4M3FA 2LY1A 3F8FA 1K79A 2LKXA 4MFEA 3OIPA 3ZMVA 1L0OC 3TP3A 2GXAA 3S1QJ 3QP6A 3U2RA 4E6KG 3KP6A 3OYCA 1TP4A 3KP4A 4LLLA 4C2TA 1R71A 2AO9A 1T38A 1Z1DA 3OYLA 4A3KJ 3C2GA 4RGSA 4FHTA 4QPOA 1HSTA 4ENJA 1FTZA 4B8XA 3L1PA 1BR1A 1XGNA 4M9XA 4IVNA 2KL4A 2F5CA 4PJJA 4KUMA 5B3SH 4RB3C 3ZMUA 1GV2A 3SZPA 3DV8A 2GOMA 4BBSJ 2QBYA 2QSHX 4DBQA 4HSTA 1O4XA 4ZC3A 3O8GA 4C3HJ 2EB7A 3MMYB 3UKGA 1MNEA 2Z2SB 2BEOA 5AIPA
chains in the Genus database with same CATH topology
2K40A 4DZPA 2DMUA 1NK3P 1ETYA 3S16J 2ME6A 2NVQJ 2ELKA 3IH3A 4FTHA 4W1UA 1JJ8C 5C44J 3FKIJ 2H1KA 3JRIA 5M3FJ 3TW7A 2NVXJ 5IP7J 3E7LA 5F27A 2OF7A 4FCYA 1QRYA 5J1RA 4QTRA 1IGNA 2XB0X 2DTZA 1RESA 3S1NJ 5FKLA 3CQZJ 4XIDA 2LK2A 2HXOA 2TRTA 2Y9YA 2DMTA 2Y30A 3TP0A 1ZGWA 1FJLA 2GM4A 4GFBA 1Z77A 4FE4A 1H88C 1VFCA 3H3VK 5GP9A 3JRBA 5E3OA 2G0EA 3TW6A 3A01A 1GVDA 1QVUA 2VPRA 1X58A 3GTGJ 3SDGA 4A3MJ 2EZKA 3QPSA 5K7ZA 3ZQCA 1AKHA 3GTKJ 1Y1VJ 1RETA 2OPTA 4CYCA 3A01B 5J1YA 2NVTJ 2X48A 1UHSA 2XGEA 2R93J 1IRZA 5IYDJ 4A3FJ 1H8AC 4C3JJ 1MBKA 1AKHB 3FISA 4ABZA 2DMPA 3B6CA 4A3DJ 3LNQA 4CYCB 4B3AA 3MKLA 2EZHA 2EZIA 5EGOA 1JT6A 1I50J 2DA5A 4A3CJ 3B6AA 2LP0A 1BJZA 1JTYA 2JJ7A 3HOYJ 2NVYJ 3OSGA 1YRNB 1ETWA 3ZQHA 3FK7A 3MVPA 4M6VA 5EGOB 4W97A 3BQZA 5FLMJ 1ETXA 2HOAA 2Y31A 1TC3C 4BY7J 5F08A 2DJNA 1W0UA 5IOZA 5IP9J 3PO2J 2JN6A 2L0KA 1U9OA 3HGYA 4Y7NJ 1MBHA 4J19A 5M5WJ 2ECBA 1XC5A 1H89C 1T56A 4DZJA 2DA4A 2JK3A 2P81A 3D1NI 1WI3A 2K9NA 1GV5A 2L7MP 2HYJA 5FKOA 2XPWA 1JTXA 4BXXJ 2EZLA 2O8KA 5FKNA 2R5ZA 2HDDA 1AHDP 3RZDJ 2JA7J 5M5XJ 5IYCJ 4C3IJ 5FJ8J 5EF6A 4A3JJ 2R92J 5HODA 1TWHJ 3WHBA 2YU9J 1K61A 1FIPA 2IBDA 4D5FA 2R5ZB 1WGXA 5C4XJ 1AU7A 2VI6A 5E3LA 1ZKGA 1U78A 2CUEA 2AHQA 1BA5A 1WPKA 4JP0A 5F0HA 4Y52J 2KDZA 3GTMJ 3HBLA 1MH3A 2XPVA 2E2IJ 5IOYA 5FKKA 1GT0C 3G1MA 3M3YJ 4X6AJ 1E3OC 5EYRA 1RKWA 2R7ZJ 5J3LA 2L7ZA 3HOWJ 1JKOC 1DU6A 3Q0VA 4IHXA 2R5YA 3I4MJ 3LSGA 2IAIA 3BTIA 3JRCA 3A02A 2GLOA 3HDDA 1OCPA 1U9NA 1HLVA 1OFCX 2R5YB 1FTTA 1JKRC 2HQ5A 5IYBJ 2B63J 4RBOA 4L5EA 2DA3A 2M8GX 1TWAJ 4M3DA 4MO7A 3GTJJ 1IDZA 1GUUA 2RAEA 5IP6A 5F1JA 1F43A 3VPRA 1A5JA 3GTLJ 2JA5J 5E3MA 4BKXA 2Y2ZA 4A93J 2GBYA 1JT0A 1VF9A 3GTPJ 5K7HA 4XRSA 4JX6A 3O8HA 1NK2P 1ZR2A 3HGGA 2ID3A 4FE7A 1MBEA 5E3NA 1A6IA 2QF7A 2E2HJ 2L7FP 5DTDA 4QSHA 2K9QA 1HDDC 4B1RA 4IHYA 3K2AA 1LFUP 4A3GJ 3BR6A 3QQAA 2FX0A 5K7FA 5F0CA 2FQ4A 1B8IA 5DS9A 3GBGA 2E2JJ 1D5YA 1P7IA 1T33A 3RZOJ 4NDLA 2XPUA 4IHWA 3CDLA 3WHCA 2PMZN 3ZQIA 2E1OA 1IUFA 1JUSA 3NAUA 3HOXJ 2O7OA 5JLXA 3Q0WA 4MLOA 4UUSA 1POGA 1XG1A 5J1UA 3JRGA 1B8IB 1JUMA 2WV1A 2WB1N 2CQQA 3F0CA 3S2HJ 2HI3A 3Q0UA 2ZB9A 1B72A 5EZHA 2KT0A 4BBRJ 2L9RA 2TCTA 3S17J 4JX5A 1MNMC 4UUSB 5BNGA 3OSFA 1JKPC 1MH4A 3ZQLA 4EEFG 4HNVA 1B72B 5JLWA 2VUMJ 1OCTC 4A3LJ 1HOMA 2Y9ZA 1QPIA 3HB9A 2MW8A 2YUSA 1ZTRA 1S7EA 4DYRA 3BG3A 1VI0A 2N8GA 4RDUA 3S1RJ 3HKZN 4AUXA 2LY9A 4V2GA 1MBFA 3BR3A 1JKQC 5M3MJ 3BTCA 2DMNA 4C2MJ 1IJWC 3BG5A 1RR7A 2E19A 2ME0A 2XB5A 4XRSG 1RPWA 5C4JJ 5EZGA 3JRHA 3IH4A 4FISA 2ECCA 1CQTA 3JR9A 3IV5A 1XS9A 4S0HB 5F04A 1ETVA 2XSDC 2X9DA 1ORKA 3G1LA 1ETQA 3LSRA 1BL0A 3BR1A 3BTJA 3JRAA 3BR2A 3SFIA 3OOUA 1HF0A 2X6OA 3S1MJ 1RKTA 4BY1J 3GTQJ 3PM1A 1Q1VA 3BQYA 2JA6J 4UUTA 1MBJA 3MN2A 2QCOA 5FKMA 3HM5A 3HEFA 3G1OA 2XRLA 1X2NA 3BG9A 3RKQA 1HDPA 5GPCA 2HOSA 2O9LA 2ID6A 3GTOJ 1LFBA 3BR0A 3ZQFA 4D7MA 1QVTA 4M3EA 1IDYA 3Q3SA 2JMWA 3HOUJ 3ZOBA 3M4OJ 2CU7A 2DMQA 2IEKA 2NOGA 1ZR4A 3RQIA 4XICA 2LLKA 2XGCA 4DW6A 4IEJA 1OJLA 4AYBN 2JWTA 3S2DJ 1IV6A 3HOZJ 1ENHA 2NS7A 1ZK8A 4XK4A 1HCRA 3I4NJ 1IC8A 4IHVA 2CQXA 3DCFA 2CRGA 3OIOA 4A3BJ 1FEXA 4QIWN 4I6ZA 1U8BA 4AC0A 2LVSA 2FD5A 2WAQN 2M0CA 2NS8A 4JYKA 1Y1WJ 2VKVA 1I6HJ 2LTPA 4D7NA 1BW5A 3W6VA 1X2MA 4XRMA 3BT9A 2W48A 3C2BA 1ETKA 1WH5A 3LOCA 2XGDA 1MSFC 5GPAA 3CMYA 1NTCA 4LOCA 1GDTA 3S14J 2LD5A 3PO3J 4DYCA 2YS9A 3HOVJ 2FJ1A 3JRDA 2CJJA 1UG2A 2DA7A 2R0QC 1EF4A 2DA6A 4V2FA 3IH2A 1MSEC 3QPLA 9ANTA 4M3BA 4A3EJ 1LE8A 1WH7A 2EBIA 4M3GA 3CCYA 1JUPA 2EH3A 2I10A 1YRNA 2DN0A 3DEWA 3SJMA 2D5VA 2EQRA 1DU0A 1SFOJ 1VNDA 2MGQA 5C3EJ 2JA8J 5EEAA 1LE8B 2Y0SN 2K9SA 3NARA 2LFBA 3LSJA 1PUFA 2DA1A 2LR8A 1ITYA 5EG0A 3FIWA 1R9TJ 2VKEA 5IPAA 2CUFA 1F36A 1MBGA 1K83J 4D5CA 4G12A 1I3QJ 1PUFB 1UMQA 1WCMJ 2COBA 3H0GJ 5EG0B 3BR5A 1TWCJ 2M34A 2M9HA 2HXIA 1APLC 4MIMA 1SANA 1G2HA 5F0FA 4MFDA 1ETOA 4A69C 3LSPA 4M3FA 4I76A 1FIAA 2LKXA 4MFEA 2MG4A 1IG7A 3TP3A 3S1QJ 1P7JA 3S15J 3BTLA 1BW6A 2AO9A 4A3KJ 3FK6A 2HOTA 5FLVA 4DYQA 1FTZA 3L1PA 3ZQGA 2H8RA 2DA2A 2MSYA 3K7AJ 3JREA 4A3IJ 4JX4A 1GV2A 3TEDA 2M2EA 3JRFA 1JGGA 5EDNA 1Z0XA 4BBSJ 1TWFJ 4X1EA 1JJ6C 5M5YJ 1O4XA 1W0TA 3O8GA 3A03A 4C3HJ 4B4CA 3UKGA 1ZQ3P 1TWGJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K40 A;  4DZP A;  2DMU A;  1NK3 P;  1ETY A;  3S16 J;  2ME6 A;  2NVQ J;  2ELK A;  3IH3 A;  4FTH A;  4W1U A;  1JJ8 C;  5C44 J;  3FKI J;  2H1K A;  3JRI A;  5M3F J;  3TW7 A;  2NVX J;  5IP7 J;  3E7L A;  5F27 A;  2OF7 A;  4FCY A;  1QRY A;  5J1R A;  4QTR A;  1IGN A;  2XB0 X;  2DTZ A;  1RES A;  3S1N J;  5FKL A;  3CQZ J;  4XID A;  2LK2 A;  2HXO A;  2TRT A;  2Y9Y A;  2DMT A;  2Y30 A;  3TP0 A;  1ZGW A;  1FJL A;  2GM4 A;  4GFB A;  1Z77 A;  4FE4 A;  1H88 C;  1VFC A;  3H3V K;  5GP9 A;  3JRB A;  5E3O A;  2G0E A;  3TW6 A;  3A01 A;  1GVD A;  1QVU A;  2VPR A;  1X58 A;  3GTG J;  3SDG A;  4A3M J;  2EZK A;  3QPS A;  5K7Z A;  3ZQC A;  1AKH A;  3GTK J;  1Y1V J;  1RET A;  2OPT A;  4CYC A;  3A01 B;  5J1Y A;  2NVT J;  2X48 A;  1UHS A;  2XGE A;  2R93 J;  1IRZ A;  5IYD J;  4A3F J;  1H8A C;  4C3J J;  1MBK A;  1AKH B;  3FIS A;  4ABZ A;  2DMP A;  3B6C A;  4A3D J;  3LNQ A;  4CYC B;  4B3A A;  3MKL A;  2EZH A;  2EZI A;  5EGO A;  1JT6 A;  1I50 J;  2DA5 A;  4A3C J;  3B6A A;  2LP0 A;  1BJZ A;  1JTY A;  2JJ7 A;  3HOY J;  2NVY J;  3OSG A;  1YRN B;  1ETW A;  3ZQH A;  3FK7 A;  3MVP A;  4M6V A;  5EGO B;  4W97 A;  3BQZ A;  5FLM J;  1ETX A;  2HOA A;  2Y31 A;  1TC3 C;  4BY7 J;  5F08 A;  2DJN A;  1W0U A;  5IOZ A;  5IP9 J;  3PO2 J;  2JN6 A;  2L0K A;  1U9O A;  3HGY A;  4Y7N J;  1MBH A;  4J19 A;  5M5W J;  2ECB A;  1XC5 A;  1H89 C;  1T56 A;  4DZJ A;  2DA4 A;  2JK3 A;  2P81 A;  3D1N I;  1WI3 A;  2K9N A;  1GV5 A;  2L7M P;  2HYJ A;  5FKO A;  2XPW A;  1JTX A;  4BXX J;  2EZL A;  2O8K A;  5FKN A;  2R5Z A;  2HDD A;  1AHD P;  3RZD J;  2JA7 J;  5M5X J;  5IYC J;  4C3I J;  5FJ8 J;  5EF6 A;  4A3J J;  2R92 J;  5HOD A;  1TWH J;  3WHB A;  2YU9 J;  1K61 A;  1FIP A;  2IBD A;  4D5F A;  2R5Z B;  1WGX A;  5C4X J;  1AU7 A;  2VI6 A;  5E3L A;  1ZKG A;  1U78 A;  2CUE A;  2AHQ A;  1BA5 A;  1WPK A;  4JP0 A;  5F0H A;  4Y52 J;  2KDZ A;  3GTM J;  3HBL A;  1MH3 A;  2XPV A;  2E2I J;  5IOY A;  5FKK A;  1GT0 C;  3G1M A;  3M3Y J;  4X6A J;  1E3O C;  5EYR A;  1RKW A;  2R7Z J;  5J3L A;  2L7Z A;  3HOW J;  1JKO C;  1DU6 A;  3Q0V A;  4IHX A;  2R5Y A;  3I4M J;  3LSG A;  2IAI A;  3BTI A;  3JRC A;  3A02 A;  2GLO A;  3HDD A;  1OCP A;  1U9N A;  1HLV A;  1OFC X;  2R5Y B;  1FTT A;  1JKR C;  2HQ5 A;  5IYB J;  2B63 J;  4RBO A;  4L5E A;  2DA3 A;  2M8G X;  1TWA J;  4M3D A;  4MO7 A;  3GTJ J;  1IDZ A;  1GUU A;  2RAE A;  5IP6 A;  5F1J A;  1F43 A;  3VPR A;  1A5J A;  3GTL J;  2JA5 J;  5E3M A;  4BKX A;  2Y2Z A;  4A93 J;  2GBY A;  1JT0 A;  1VF9 A;  3GTP J;  5K7H A;  4XRS A;  4JX6 A;  3O8H A;  1NK2 P;  1ZR2 A;  3HGG A;  2ID3 A;  4FE7 A;  1MBE A;  5E3N A;  1A6I A;  2QF7 A;  2E2H J;  2L7F P;  5DTD A;  4QSH A;  2K9Q A;  1HDD C;  4B1R A;  4IHY A;  3K2A A;  1LFU P;  4A3G J;  3BR6 A;  3QQA A;  2FX0 A;  5K7F A;  5F0C A;  2FQ4 A;  1B8I A;  5DS9 A;  3GBG A;  2E2J J;  1D5Y A;  1P7I A;  1T33 A;  3RZO J;  4NDL A;  2XPU A;  4IHW A;  3CDL A;  3WHC A;  2PMZ N;  3ZQI A;  2E1O A;  1IUF A;  1JUS A;  3NAU A;  3HOX J;  2O7O A;  5JLX A;  3Q0W A;  4MLO A;  4UUS A;  1POG A;  1XG1 A;  5J1U A;  3JRG A;  1B8I B;  1JUM A;  2WV1 A;  2WB1 N;  2CQQ A;  3F0C A;  3S2H J;  2HI3 A;  3Q0U A;  2ZB9 A;  1B72 A;  5EZH A;  2KT0 A;  4BBR J;  2L9R A;  2TCT A;  3S17 J;  4JX5 A;  1MNM C;  4UUS B;  5BNG A;  3OSF A;  1JKP C;  1MH4 A;  3ZQL A;  4EEF G;  4HNV A;  1B72 B;  5JLW A;  2VUM J;  1OCT C;  4A3L J;  1HOM A;  2Y9Z A;  1QPI A;  3HB9 A;  2MW8 A;  2YUS A;  1ZTR A;  1S7E A;  4DYR A;  3BG3 A;  1VI0 A;  2N8G A;  4RDU A;  3S1R J;  3HKZ N;  4AUX A;  2LY9 A;  4V2G A;  1MBF A;  3BR3 A;  1JKQ C;  5M3M J;  3BTC A;  2DMN A;  4C2M J;  1IJW C;  3BG5 A;  1RR7 A;  2E19 A;  2ME0 A;  2XB5 A;  4XRS G;  1RPW A;  5C4J J;  5EZG A;  3JRH A;  3IH4 A;  4FIS A;  2ECC A;  1CQT A;  3JR9 A;  3IV5 A;  1XS9 A;  4S0H B;  5F04 A;  1ETV A;  2XSD C;  2X9D A;  1ORK A;  3G1L A;  1ETQ A;  3LSR A;  1BL0 A;  3BR1 A;  3BTJ A;  3JRA A;  3BR2 A;  3SFI A;  3OOU A;  1HF0 A;  2X6O A;  3S1M J;  1RKT A;  4BY1 J;  3GTQ J;  3PM1 A;  1Q1V A;  3BQY A;  2JA6 J;  4UUT A;  1MBJ A;  3MN2 A;  2QCO A;  5FKM A;  3HM5 A;  3HEF A;  3G1O A;  2XRL A;  1X2N A;  3BG9 A;  3RKQ A;  1HDP A;  5GPC A;  2HOS A;  2O9L A;  2ID6 A;  3GTO J;  1LFB A;  3BR0 A;  3ZQF A;  4D7M A;  1QVT A;  4M3E A;  1IDY A;  3Q3S A;  2JMW A;  3HOU J;  3ZOB A;  3M4O J;  2CU7 A;  2DMQ A;  2IEK A;  2NOG A;  1ZR4 A;  3RQI A;  4XIC A;  2LLK A;  2XGC A;  4DW6 A;  4IEJ A;  1OJL A;  4AYB N;  2JWT A;  3S2D J;  1IV6 A;  3HOZ J;  1ENH A;  2NS7 A;  1ZK8 A;  4XK4 A;  1HCR A;  3I4N J;  1IC8 A;  4IHV A;  2CQX A;  3DCF A;  2CRG A;  3OIO A;  4A3B J;  1FEX A;  4QIW N;  4I6Z A;  1U8B A;  4AC0 A;  2LVS A;  2FD5 A;  2WAQ N;  2M0C A;  2NS8 A;  4JYK A;  1Y1W J;  2VKV A;  1I6H J;  2LTP A;  4D7N A;  1BW5 A;  3W6V A;  1X2M A;  4XRM A;  3BT9 A;  2W48 A;  3C2B A;  1ETK A;  1WH5 A;  3LOC A;  2XGD A;  1MSF C;  5GPA A;  3CMY A;  1NTC A;  4LOC A;  1GDT A;  3S14 J;  2LD5 A;  3PO3 J;  4DYC A;  2YS9 A;  3HOV J;  2FJ1 A;  3JRD A;  2CJJ A;  1UG2 A;  2DA7 A;  2R0Q C;  1EF4 A;  2DA6 A;  4V2F A;  3IH2 A;  1MSE C;  3QPL A;  9ANT A;  4M3B A;  4A3E J;  1LE8 A;  1WH7 A;  2EBI A;  4M3G A;  3CCY A;  1JUP A;  2EH3 A;  2I10 A;  1YRN A;  2DN0 A;  3DEW A;  3SJM A;  2D5V A;  2EQR A;  1DU0 A;  1SFO J;  1VND A;  2MGQ A;  5C3E J;  2JA8 J;  5EEA A;  1LE8 B;  2Y0S N;  2K9S A;  3NAR A;  2LFB A;  3LSJ A;  1PUF A;  2DA1 A;  2LR8 A;  1ITY A;  5EG0 A;  3FIW A;  1R9T J;  2VKE A;  5IPA A;  2CUF A;  1F36 A;  1MBG A;  1K83 J;  4D5C A;  4G12 A;  1I3Q J;  1PUF B;  1UMQ A;  1WCM J;  2COB A;  3H0G J;  5EG0 B;  3BR5 A;  1TWC J;  2M34 A;  2M9H A;  2HXI A;  1APL C;  4MIM A;  1SAN A;  1G2H A;  5F0F A;  4MFD A;  1ETO A;  4A69 C;  3LSP A;  4M3F A;  4I76 A;  1FIA A;  2LKX A;  4MFE A;  2MG4 A;  1IG7 A;  3TP3 A;  3S1Q J;  1P7J A;  3S15 J;  3BTL A;  1BW6 A;  2AO9 A;  4A3K J;  3FK6 A;  2HOT A;  5FLV A;  4DYQ A;  1FTZ A;  3L1P A;  3ZQG A;  2H8R A;  2DA2 A;  2MSY A;  3K7A J;  3JRE A;  4A3I J;  4JX4 A;  1GV2 A;  3TED A;  2M2E A;  3JRF A;  1JGG A;  5EDN A;  1Z0X A;  4BBS J;  1TWF J;  4X1E A;  1JJ6 C;  5M5Y J;  1O4X A;  1W0T A;  3O8G A;  3A03 A;  4C3H J;  4B4C A;  3UKG A;  1ZQ3 P;  1TWG J; 
#chains in the Genus database with same CATH topology
 5JHU A;  2K40 A;  4DZP A;  3OYM A;  1YIJ I;  1NK3 P;  5HS7 A;  1ETY A;  2VT2 A;  3IKV A;  3K4K A;  3S16 J;  5JFR A;  2AQE A;  2ELK A;  1IO2 A;  2GIV A;  1X3U A;  3WU2 C;  3KEQ A;  2E34 A;  4NBQ A;  5M3F J;  3TW7 A;  5BS6 A;  5F27 A;  4HX8 A;  4A12 A;  2W1O A;  4PJ0 C;  2XB0 X;  1MGT A;  3S1N J;  4WXC A;  5IT9 Z;  3CCQ I;  2Y30 A;  2A61 A;  1ZGW A;  2VJ5 A;  5A2Q K;  2HDW A;  2B9S A;  4RB2 C;  1R1V A;  2G0E A;  2JUG A;  3A01 A;  4K2E A;  2W85 A;  3CP2 A;  3L00 A;  1VQP I;  3SDG A;  2XGX A;  1BIA A;  1U0J A;  2O61 A;  3E5X A;  2IA2 A;  1GLN A;  3DQV C;  3QPH A;  1QZE A;  3MZY A;  3V7S A;  1ZRC A;  2NVT J;  2VJI A;  1UHS A;  2XGE A;  1FOK A;  2NXN B;  3PFI A;  3KEO A;  3HHG A;  3I4P A;  1H8A C;  1AKH B;  3GYH X;  1VQ6 I;  3IRQ A;  3OWT A;  2DMP A;  2QLZ A;  1LPQ A;  4JBA A;  4CYC B;  1VQ7 I;  1T8I A;  2W84 A;  1XX5 A;  2HZD A;  2PBI A;  2KMU A;  2EZH A;  3L2W A;  2EZI A;  3CDH A;  4UB6 C;  1RI7 A;  2F48 A;  3LA2 A;  5L3G A;  1CF7 B;  2PI0 A;  4N9H A;  4ESB A;  1ZG5 A;  4B3X A;  4C9Y A;  4PSX A;  2JJ7 A;  2JUC A;  2VC1 A;  3RJP A;  2OBP A;  5JVG F;  2K3P A;  4E7S A;  5JHF A;  3K2Z A;  1ETW A;  3F9K A;  4XM3 A;  3OS1 A;  3ZQH A;  3ABL H;  4RMN A;  2BYV E;  1HKQ A;  4W97 A;  1D8J A;  3BZC A;  4XON A;  5K1Y A;  2LRE A;  3DU5 A;  3CJR B;  5FB2 A;  5F08 A;  2Y48 A;  2DJN A;  2A68 F;  1BOB A;  1KON A;  1Y0N A;  3O3K A;  3GVA A;  4U88 A;  2EFP A;  2Z3Y A;  5HOO A;  3HGY A;  5LLQ A;  1MMA A;  3ECH A;  3T8R A;  4PZJ A;  3DPU A;  4N4O B;  4LG0 B;  1MBH A;  2EIL H;  4II3 A;  3ZN1 A;  4PK4 A;  2ZJR F;  2V26 A;  1Y0U A;  3DBR B;  5J4V A;  3G73 A;  3L9F A;  5M5W J;  2ECB A;  2D1V A;  1H89 C;  2UXX A;  1QZZ A;  1X1B A;  3TDU C;  4BJT A;  4LD5 A;  1WI3 A;  2K9N A;  2L7M P;  4ON0 A;  1PUE E;  4BXX J;  5FKN A;  2HDD A;  2JA7 J;  2KPM A;  5M5X J;  5IYC J;  1E17 A;  1KQ9 A;  2DU9 A;  3GF2 A;  4Q4Z F;  3H9G A;  2R92 J;  2HYF A;  2VOO A;  4F92 B;  3PNV A;  4G94 A;  3WHB A;  2YU9 J;  4D5F A;  1X1D A;  3CUQ B;  3KYC B;  1WGX A;  3NWS A;  4NHJ A;  5E1Z B;  3LL7 A;  3RPU D;  2A5Y B;  5E3L A;  2M4K A;  1R22 A;  2MLG A;  2XV4 S;  1WPK A;  3HSR A;  4JP0 A;  3JAM Z;  2Z5U A;  3FXU A;  3X2Q H;  1N77 A;  3IL2 A;  3GTM J;  3HBL A;  2XPV A;  5DYM A;  3U1K A;  3M3Y J;  1E3O C;  3MKW B;  4OIR F;  2L3D A;  3LSM A;  2XSJ C;  4I02 A;  3WOD F;  4PJL A;  1K6O A;  2ZME C;  4RLF A;  3L2R A;  2Q0O A;  4Y33 A;  2R4G A;  3ABM H;  3F72 A;  3I4M J;  2XF5 A;  3KYL A;  3IAM 2;  3ZGK A;  4U0Y A;  4F52 A;  3ZQ7 A;  2PN6 A;  2IAI A;  4G6Q A;  3MZH A;  1I5Z A;  5CVR A;  3JRC A;  2ETH A;  3HHH A;  2QKM B;  1EH8 A;  1W36 C;  2FQ3 A;  1OCP A;  1YTY A;  2XF7 A;  1HLV A;  2F5E A;  2D2W A;  3J80 Z;  3EYY A;  1JKR C;  3DF8 A;  2B63 J;  2L5Q A;  4RBO A;  1TWA J;  5E1W A;  3GTJ J;  5HDG A;  4HNU A;  2OCC H;  2O5R A;  3W6K B;  1QO0 D;  3FMS A;  1XMX A;  2IGM A;  1YS6 A;  1OCO H;  2K7L A;  4DQ2 A;  2L02 A;  1WFX A;  1MND A;  1IF1 A;  4CCL A;  2JA5 J;  4A93 J;  3RPU A;  1IW7 F;  2UV1 A;  1XPX A;  1SFE A;  1YW8 A;  4FAS D;  2KIM A;  1OCZ H;  1U5T C;  3U21 A;  1NK2 P;  3ML6 A;  3PFY A;  2ID3 A;  3KP5 A;  1MMN A;  2CW0 F;  1TT5 B;  1P4X A;  1YJN I;  1HW2 A;  2PEX A;  4Y17 A;  3WTW C;  3CTA A;  5DTD A;  4U0V A;  3DP7 A;  1OIS A;  1D5V A;  4EQQ A;  3P5J A;  1HDD C;  4B1R A;  3IAS 2;  4IHY A;  4Y13 A;  4A3G J;  1WQ2 A;  5D5V B;  4F93 B;  3LMM A;  3FXK A;  4HOB A;  2A6H F;  3LA7 A;  5F0C A;  2FQ4 A;  2P5V A;  1A6Q A;  1Z21 A;  3GBG A;  4RM3 A;  4NUB A;  2EA2 A;  4NDL A;  4Q47 A;  5BQT A;  3BWG A;  3TO6 A;  2DFH A;  3ZQI A;  4BEH B;  3IC7 A;  1NHA A;  3PUF A;  1O3T A;  2QYO A;  2MYS A;  5DV5 A;  5J1U A;  1RIO H;  3OL3 A;  1YW7 A;  4CXF A;  4ZDO A;  2BE5 F;  3F0C A;  2IS6 A;  4WXD A;  1B72 A;  1TNT A;  5EZH A;  4I2O A;  3I9V 2;  3PIO F;  2L9R A;  3GZ5 A;  2OD5 A;  1T08 B;  1W5T A;  2JPB A;  1OR7 A;  3S17 J;  1W7P A;  1JKP C;  1XMA A;  2RQQ A;  4A0X A;  4HNV A;  4P9U A;  3F23 A;  3EQL F;  1S6L A;  2A5W A;  4D0P A;  5JLW A;  2VUM J;  1OCT C;  3KZY A;  2Y9Z A;  4DGW B;  4YFN F;  4NQW B;  3ERE D;  1S7E A;  2LOO A;  4G9Y A;  4HX4 A;  4WWC A;  4HW0 A;  2FU4 A;  3S1R J;  3OYA A;  1FOX A;  3OR1 C;  4HPQ A;  3OV8 A;  1WJE A;  3CCR I;  2I8D A;  3BTC A;  3V8L A;  2A69 F;  4ESJ A;  4D9J A;  3BG5 A;  1SMT A;  4HBL A;  2KHM A;  1QBJ A;  3A0B C;  5B5E C;  5C4J J;  4KNY A;  3CZ6 A;  4OIP F;  3BY6 A;  4FIS A;  4A6D A;  5J6X A;  5HNF A;  3H5R A;  3K1N A;  1FT9 A;  3OYG A;  5HS9 A;  4BHC A;  1IV8 A;  2KIF A;  1A31 A;  2L01 A;  1ETQ A;  1OCR H;  5H20 A;  3K1P A;  3KEY A;  3M8F A;  2W24 A;  2LBF B;  3BTJ A;  3JRA A;  1U8R A;  2YSR A;  2VC0 A;  2KJB A;  2X6O A;  3ZXS A;  2E1M C;  1GXQ A;  3C1D A;  4HEA 2;  2OU2 A;  2LMD A;  3LQQ A;  2UWM A;  1B59 A;  4CCO A;  4OIN F;  1WJ5 A;  4LG3 A;  3G71 I;  3PSF A;  4AID A;  3H3Z A;  4UUT A;  1E0E A;  4RAG A;  2M7B A;  2JQ7 A;  3EUK L;  2DBB A;  4CUG A;  3IKT A;  2O3F A;  2FNA A;  1VTN C;  1HDP A;  1LDJ A;  4KN4 X;  2OTL I;  3CJN A;  1WJA A;  2V9V A;  3D0S A;  3S3M A;  2R7F A;  2R3S A;  4D7M A;  1NG6 A;  2BY2 A;  2V6E A;  4M3E A;  1IDY A;  3Q3S A;  2ZCW A;  3BC8 A;  2WTE A;  4KA4 A;  2HPM A;  1ZAO A;  3HOU J;  2QSF X;  1SD7 A;  3ZOB A;  3M4O J;  2CU7 A;  2NOG A;  3WTS C;  2K5C A;  4MNU A;  3RQI A;  3K0L A;  4XIC A;  2E7X A;  1S7O A;  2WAF A;  4LFU A;  3L09 A;  3V4G A;  4BJ6 C;  3L2V A;  1D8K A;  3ELK A;  6PAX A;  2JWT A;  3WTX C;  1X4P A;  2NS7 A;  4XLN F;  1FWZ A;  4XK4 A;  2IGK A;  1RNL A;  2CQX A;  5CVU A;  3OIO A;  5IT3 A;  2BGC A;  3OYK A;  4IQ4 A;  2JRT A;  4IO9 F;  3MQ0 A;  3L2U A;  1U8B A;  2EV0 A;  1KYZ A;  2NS8 A;  2DPU A;  3DTK A;  3FM3 A;  2QQB A;  4JYK A;  2FOW A;  1Y1W J;  2DT7 B;  2VQG A;  1WWX A;  4XSZ F;  4EJO A;  4O6J A;  1ZQ3 P;  1FOW A;  2KIS A;  1I6H J;  2XDV A;  1LJ9 A;  3WU1 B;  4OU0 A;  1HBX G;  4XRM A;  3BT9 A;  1ETK A;  4P1W A;  2XGD A;  4B48 A;  2E36 A;  1MMG A;  1GDT A;  1BIB A;  4E7I A;  3VDX A;  3FXO A;  2DCE A;  2WAE A;  3QYE A;  3KP3 A;  4F91 B;  1R49 A;  1WZ2 A;  1EJ9 A;  3HRU A;  2R0Q C;  1EF4 A;  2CH0 A;  4GGG A;  4XNF A;  1BC7 C;  2L2O A;  1CF7 A;  4U87 A;  1V3F A;  3WTZ A;  3KET A;  1WH7 A;  1ZG3 A;  2ZFU A;  3CCY A;  1JUP A;  2X85 A;  3VYU B;  1YYV A;  3A4C A;  1YE9 A;  5L3D A;  4AWX B;  2XAS A;  3UNG C;  2D5V A;  2A05 A;  4NC8 A;  3CDI A;  3HYI A;  4I99 C;  4CCN A;  3DKW A;  2P6S A;  3PIP F;  5C3E J;  3RI4 A;  2ZME B;  1SAX A;  3S3O A;  5EEA A;  1LE8 B;  5LHG A;  2ZJP F;  1S3J A;  2YR2 A;  2CFX A;  3FX3 A;  3NQO A;  2IS2 A;  2OCE A;  3K4J A;  2LR8 A;  2IJL A;  4GO1 A;  4L0Z B;  2L54 A;  5EG0 A;  3M07 A;  4ZYA A;  4P55 A;  2VKE A;  1R1T A;  2FEZ A;  1XN7 A;  1Z3X A;  2WY7 Q;  3AL0 C;  2DXI A;  4LIV A;  2ICW G;  2DLL A;  3W2A A;  4LK0 F;  4AVP A;  3OYH A;  3FM5 A;  3DWL E;  4G7H F;  1UCR A;  2XHK A;  4EJW A;  1P6R A;  2BY3 A;  2HKO A;  2M9H A;  1S29 A;  2VKD A;  2M45 A;  4BGD A;  1HQC A;  4MIM A;  5DM6 F;  5GTI C;  4IQJ A;  1U5T B;  4A69 C;  4XQF A;  4PSW A;  3LSP A;  1F4K A;  1BR4 A;  3SEZ A;  4I76 A;  3EUH C;  4Y15 A;  1XMK A;  2QUF A;  2V1N A;  3RIR A;  2VB6 A;  3RKY A;  5FGM A;  1W4M A;  1TL8 A;  1KYW A;  4NNJ A;  1FSH A;  3Q9V A;  4XLF A;  4HV5 A;  4HZF A;  3U1D A;  5J8C A;  3FK6 A;  4IRH A;  4IRI A;  4UVA A;  3W2W A;  1UZC A;  4YIR X;  5FRM A;  3ZQG A;  2H8R A;  1J9I A;  5KHD A;  3ULQ B;  4BE2 A;  4A3I J;  3GX4 X;  1VQL I;  4OMY A;  4EM2 A;  3TED A;  3TDZ C;  2L7K A;  3KLN A;  1Z0X A;  4IJA A;  3FMQ A;  4GYG A;  5EDN A;  1J75 A;  1TNS A;  5L3C A;  4Z6Y A;  3BDD A;  2DFI A;  5M5Y J;  2LNB A;  5L3B A;  2A6T A;  2IXS A;  2R7O A;  3ABT A;  1VQ5 I;  2AQF A;  1TWG J;  1V55 H;  3O6B B;  4XKW A;  1BI3 A;  3BPV A;  2VE9 A;  3OYI A;  1JHH A;  4AIK A;  3S32 A;  2ME6 A;  4IL6 C;  2HNH A;  2CYY A;  3DTI A;  1R1U A;  2BBY A;  5C44 J;  4MQ9 F;  4XR6 A;  1XSV A;  4V19 K;  3JW4 A;  1IRX A;  4P9F A;  1TW3 A;  3CJQ B;  4PGG A;  2GAU A;  2QEN A;  4BU2 A;  1IGN A;  3SHF A;  2DDA A;  2Y9Y A;  1ERD A;  1O7F A;  3DLA A;  3NRV A;  3CJT B;  2DMT A;  4Z2Y A;  1Z77 A;  2KRC A;  1VFC A;  5GP9 A;  3JRB A;  5E3O A;  4KT6 A;  3TW6 A;  4IZZ A;  1QVU A;  3OMY A;  3E6B A;  2HKX A;  2VLA A;  3GTG J;  3GLL A;  2DW4 A;  2EZK A;  4A3M J;  4HG2 A;  5JVT A;  3I5U A;  1MW7 A;  2XAU A;  3OYD A;  4LB6 B;  2OQR A;  3HC7 A;  3WE2 A;  2HQN A;  5ICC A;  4RB1 A;  4Y3O A;  4A3F J;  1Z91 A;  1UJ8 A;  3E5U A;  5IT9 K;  5E8I A;  2D1H A;  2JA2 A;  4ABZ A;  3B6C A;  4EJT A;  2PMH A;  3CUO A;  4B3A A;  3EET A;  5IY5 H;  3DPL C;  2PMU A;  2Y0M A;  1TQP A;  4XLH A;  1R4M B;  1BN5 A;  3K4L A;  2HU9 A;  1BJZ A;  1JTY A;  4FET A;  2G7U A;  4E7Z A;  1S9H A;  5LGU A;  1YRN B;  1BI0 A;  2MC4 A;  3FK7 A;  3MWM A;  5EGO B;  1I27 A;  2ZXI A;  2LRD A;  3R6S A;  4KT5 C;  1TC3 C;  4O5V A;  2HDC A;  1FP2 A;  2CV0 A;  5CVI A;  4EM0 B;  1P4A A;  2CW8 A;  2HQR A;  3FXJ A;  5IP9 J;  5HNH A;  3PO2 J;  1YW9 A;  1U9O A;  2L0K A;  2PG4 A;  2OC6 A;  2LSO A;  4Y7N J;  4J19 A;  3WTU C;  1E2X A;  3E6M A;  3WGI A;  1MJA A;  1TBX A;  2P4W A;  4DZJ A;  1L3L A;  2F6C A;  1DGW Y;  1XGM A;  1OYI A;  3KYD B;  4EV0 A;  3A1Y A;  5FKO A;  2XPW A;  1JTX A;  2O8K A;  2R5Z A;  3MEX A;  2Q8K A;  2HGC A;  3RZD J;  2LBF A;  1AHD P;  5GTH C;  1RZ4 A;  2V7F A;  5EF6 A;  2RDP A;  3I0T A;  3KX2 A;  3S93 A;  3W6J B;  5HLG A;  4XSX F;  4IF4 A;  2IBD A;  4LIT A;  2CQK A;  4KMU X;  3ESW B;  3OYJ A;  3HL2 A;  4BE1 A;  1AU7 A;  4KIT B;  2QGU A;  2DDB A;  2W25 A;  2HS5 A;  4A0Z A;  2YX7 A;  3DKX A;  4I7H A;  2VT3 A;  5LHH A;  2R7V A;  4HNT A;  1G8X A;  1GT0 C;  3F8N A;  1U3E M;  4RGX A;  2GA2 A;  2M87 A;  1YI2 I;  3IRR A;  2CGP A;  1ZLJ A;  3D5S C;  1D0X A;  3I59 B;  5J3L A;  4CGZ A;  3HOW J;  1JKO C;  3ABK H;  2X1D A;  2R5Y A;  3RTR A;  4OAY A;  4BJ5 C;  4XKB A;  1SAU A;  4UVC A;  1YQA A;  3DEE A;  2K85 A;  3HG9 A;  1TQI A;  2W4S A;  2RGV A;  5K5Q A;  2GLO A;  3MKY B;  5E8G A;  2HQA A;  3T8T A;  1OFC X;  1FTT A;  2E1C A;  1SFU A;  2VIX A;  4M6Y A;  2DA3 A;  2M8G X;  4M3D A;  4XOT A;  3K9T A;  3JAM K;  2VJJ A;  3FXM A;  2RAE A;  5IP6 A;  4YEL A;  2P7C B;  1TLH B;  3IP4 B;  2MA3 A;  1A5J A;  3CP8 A;  3ZPL A;  3TKY A;  4A2U A;  4BKX A;  2Y2Z A;  3H3U A;  1JE8 A;  1JT0 A;  1VF9 A;  3AL0 B;  3CLQ A;  4ZZL A;  4XRS A;  3O8H A;  1ZRD A;  1ZR2 A;  3BZ6 A;  3LAJ A;  2LF8 A;  1MBE A;  2X51 A;  3BJ6 A;  1W36 D;  4O3M A;  3ABU A;  2ZNY A;  2PJR A;  4ASN A;  4FQG A;  1IRF A;  4QSH A;  4F3Q A;  5ED4 A;  3SDB A;  4QWQ A;  3K2A A;  4HF1 A;  3J80 K;  3BR6 A;  3FWE A;  1Y8R B;  3KP2 A;  3LFU A;  4G7O F;  2G7H A;  5K7F A;  4YG2 F;  2KQR A;  4MEX F;  1Z3Y A;  3HRT A;  1SD6 A;  2NNN A;  2FUG 2;  2O0Y A;  5EJC A;  2PMZ A;  5KNL A;  2BW3 B;  4AIJ A;  2EFQ A;  1T98 A;  2BOL A;  2PMZ N;  2WAD A;  1JUS A;  2FF4 A;  5KAI C;  1QGP A;  5JLX A;  2OJE D;  3Q5F A;  2KRH A;  1B8I B;  1JUM A;  2QKL B;  2WV1 A;  3SZG A;  4HX7 A;  5ICE A;  1O3S A;  3GFM A;  4AD9 A;  3F8C A;  4ZDL A;  4BBR J;  2DPD A;  2ZME A;  1IN8 A;  3RKW A;  2FML A;  4UUS B;  1D0Z A;  2VBX A;  4CSW A;  3HPG A;  4PUS A;  2P7V B;  4EGY A;  2VOP A;  1QPI A;  2M1B A;  2VPL A;  2V4J C;  3R0J A;  5L3F A;  1ZTR A;  3H35 A;  2BY0 A;  4DYR A;  1FYK A;  2IA0 A;  2MBF A;  1R5H A;  5GAD J;  4RDU A;  4JOM A;  4E4H A;  4V2G A;  5L3E A;  2R7X A;  2P5L C;  5KAF C;  1YFH A;  4ZTJ A;  2KKO A;  3TOA A;  2K02 A;  2QZ8 A;  1IJW C;  4IRG A;  2ME0 A;  1RPW A;  5CPR B;  1T95 A;  2R7W A;  3CC4 I;  4BNC A;  5HLI A;  1U5T A;  3H9J A;  4S0H B;  4UUV A;  2DO7 A;  2X9D A;  1Y6I A;  3OYF A;  1ORK A;  4CZZ A;  4RAZ A;  3D5L A;  1BL0 A;  1Z7L A;  2STW A;  1XSD A;  5LGN A;  3G2B A;  1N25 A;  1Y8Q B;  5CVV A;  3K69 A;  1RKT A;  4ZYG A;  3MAJ A;  2JSP A;  1PP8 F;  3GTQ J;  4XLC A;  1WJF A;  3CO7 C;  3M8E A;  3N05 A;  2FA5 A;  3C18 A;  5TIS C;  5FKM A;  2E71 A;  1X2N A;  1BM9 A;  1WKM A;  2M0M A;  2ID6 A;  3HSF A;  2IA1 A;  5F64 A;  1LFB A;  2O9L A;  4M72 A;  2ZXH A;  3WTY C;  2R7U A;  3ZQF A;  3S2W A;  3FXQ A;  4CO8 A;  2Y69 H;  1LNW A;  3COA C;  3FHN A;  2NS0 A;  2DQL A;  3GW2 A;  1O57 A;  1OLT A;  1D1C A;  2DOD A;  4DW6 A;  2BZT A;  4ENK A;  1IV6 A;  2X0L A;  4PJN A;  2XVC A;  4A0Y A;  4D1Q A;  4HDV A;  5LD2 C;  1HCR A;  2EV6 A;  2AXL A;  4BYY A;  3DCF A;  2CRG A;  3HIF A;  1B4A A;  4FX0 A;  1RUO A;  4A3B J;  1V5E A;  3BCA A;  3UR3 C;  1ZG1 A;  4Q48 A;  1WRJ A;  2LVS A;  4QPQ A;  2WAQ N;  3OYN A;  4FX4 A;  5DUK A;  3JCU C;  4E7H A;  1LDK B;  2NOJ B;  5HDN A;  3QU3 A;  1WSU A;  1GHC A;  1UFM A;  2JVG A;  2XKP A;  2Z9O A;  1B1B A;  4M74 A;  1J59 A;  1X1A A;  1BW5 A;  1SFK A;  3PUB A;  3CES A;  5GPA A;  5LGT A;  2W82 A;  3BCB A;  4LOC A;  2OQG A;  4ENM A;  3S14 J;  1VQM I;  2YS9 A;  1T0F C;  3LWF A;  4NC7 A;  2DA7 A;  1QNT A;  2KP6 A;  2FMY A;  2KZV A;  2DA6 A;  1I1S A;  4A6E A;  5BPI A;  4L9N A;  1MSE C;  1ONV A;  3BZK A;  2RVC A;  4M3B A;  4EM1 A;  1Z05 A;  1UHM A;  3CCJ I;  1AWC A;  1G3Y A;  3KLO A;  1OMI A;  4S05 A;  1YRN A;  1I1G A;  2DN0 A;  3VSL A;  2JRM A;  4C30 A;  2RQP A;  3DPT A;  1SMY F;  1KGS A;  1VND A;  3L2Q A;  1K6Y A;  2Y0S A;  3F6O A;  2HVS A;  3NWT A;  2JA8 J;  2J5P A;  4UY8 I;  2L9N A;  5DCM A;  2GXB A;  2Y0S N;  1JGS A;  3AG1 H;  2LFB A;  3LSJ A;  1PUF A;  1ZAR A;  1VQ4 I;  2DA1 A;  4WK8 F;  3DBL B;  2DK5 A;  1R9T J;  1D3Y A;  4YIF A;  5IPA A;  2CUF A;  3OS0 A;  2VQH A;  2Z16 A;  4A5M A;  3HUG A;  3E1S A;  1NG7 A;  1K78 B;  1UMQ A;  4CIC A;  2FBK A;  1RRJ A;  3CF5 F;  3MCZ A;  5ILV A;  3FMR A;  2VON A;  3SQN A;  2HXI A;  3FBN B;  3PNT A;  1V4R A;  2XRN A;  3H9Q A;  3WGG A;  4F7Z A;  2DT6 A;  5F0F A;  2VOD A;  2FNP A;  4EAT A;  4EGZ A;  4II2 A;  2WA0 A;  1EKE A;  4ZYD A;  1ZYR F;  3JSO A;  5J8F A;  1IN5 A;  1IG7 A;  4KIS A;  3V7R A;  2KIQ A;  3ZP5 A;  1PYV A;  2X6X A;  3CCS I;  3OS2 A;  2VBY A;  1B6A A;  3MD2 A;  4IX7 A;  2MSY A;  2QSG X;  2IVM A;  1LQ1 A;  3K7A J;  3I59 A;  4ZYE A;  4UVB A;  2TDX A;  4G6T B;  4JX4 A;  2M2E A;  3JRF A;  2CV2 A;  1JGG A;  2CUJ A;  1WJC A;  1TWF J;  1XCV A;  2MFZ A;  4X1E A;  1JJ6 C;  1P2F A;  3N4M A;  5FRO A;  2JSC A;  2LF7 A;  3BP8 A;  4AU7 A;  1W0T A;  4IHT A;  3VFZ A;  4B4C A;  5LEK A;  4KIF A;  3G6E I;  2DMU A;  1SEU A;  5J40 A;  3RCO A;  2QBY B;  3F6V A;  2NVQ J;  1QU3 A;  4FTH A;  4W1U A;  4YEJ A;  4WCG A;  2H1K A;  2MLK A;  3GLX A;  1ZRE A;  2NVX J;  2EJR A;  2I5U A;  2O8X A;  2OF7 A;  2OZU A;  4ZTF A;  4QTR A;  1AA7 A;  1RES A;  2X1C A;  5FKL A;  1IN4 A;  4XID A;  2LK2 A;  4BQQ A;  2TRT A;  2CQ7 A;  3IUO A;  2GM4 A;  3TP0 A;  3HRM A;  2CO5 A;  3F8M A;  3R60 A;  4CDG A;  4B44 A;  1X1P A;  2VBW A;  3I64 A;  4FE4 A;  1H88 C;  4RA2 A;  3ROU A;  3H3V K;  1CGP A;  2VQC A;  3ASO H;  2ZSI B;  1MDM B;  4CZC A;  1X58 A;  1YJW I;  2MD5 A;  1LEB A;  3IWZ A;  1OYW A;  3M7G A;  1R5G A;  3GFL A;  5D5W B;  3QPS A;  5K7Z A;  4R79 A;  3AFH A;  3GFI A;  1AKH A;  4AVZ A;  1H0M A;  3EUH A;  3PSI A;  3C3W A;  4XMY A;  1A36 A;  2OPT A;  1IRG A;  4CYC A;  3A01 B;  2X48 A;  1IRZ A;  1Y56 A;  2IP2 A;  2R93 J;  2ELJ A;  3NEU A;  2GOX B;  2PFB A;  4I0A A;  2C6Y A;  3TL4 X;  5KCM A;  4H0E A;  2M8E A;  4HQE A;  1MBK A;  3FIS A;  4A3D J;  2CQN A;  3QWL A;  3O2P E;  3MKL A;  1JT6 A;  3ONQ A;  1I50 J;  4BH9 A;  5DDG A;  4A3C J;  2LP0 A;  1EV7 A;  5LHI A;  1XDS A;  4RGU A;  4UXN A;  1W5S A;  2NVY J;  1IN6 A;  3CCE I;  5D6F A;  1YHQ I;  3MVP A;  5FLX K;  4M6V A;  4JQF A;  3E6C C;  2V9P A;  1FLI A;  4MTE A;  2Y31 A;  4LG0 A;  2CFO A;  2ELH A;  4HF2 A;  1X19 A;  3H5N A;  3GWZ A;  2UXN A;  2HEO A;  1P9Q C;  4LB5 A;  2M3A A;  2ISY A;  3BJO A;  3HXL A;  3LAP A;  1O3R A;  1OYY A;  5D5U B;  1DGR M;  1YJ9 I;  2W7N A;  4ZH4 F;  3RDI A;  4RB0 A;  5FRN A;  2WBM A;  1XC5 A;  5EEG A;  1Z7U A;  4EJV A;  2CUZ A;  2FE3 A;  4PGH A;  4AIH A;  3ZMS A;  3K4B A;  2P81 A;  4XN0 A;  3D1N I;  5HLH A;  1GV5 A;  3QOE A;  3DU6 A;  3CD6 I;  2ISZ A;  5K5O A;  2D45 A;  2EZL A;  3CUQ A;  3OOP A;  3GFJ A;  4HRI A;  4C3I J;  1LVA A;  1DPU A;  1FZP B;  5BOX A;  1DUX C;  5B1B H;  1T2K A;  2RNJ A;  2QQ8 A;  2ZBK A;  3MKZ A;  2YX4 A;  3ISP A;  5HOD A;  1TWH J;  2JVH A;  5HLT A;  1FIP A;  4DIQ A;  2PX9 A;  5FD6 A;  4WX9 A;  3WGH A;  4WF2 A;  3W2V A;  3E6D A;  2P5K A;  3E97 A;  1EH7 A;  1ULY A;  1Z67 A;  2OV7 A;  3ZRG A;  1BA5 A;  1B9M A;  4L9T A;  2ZKZ A;  2KDZ A;  2V79 A;  1MH3 A;  3WE3 A;  3HTU A;  3Q9S A;  5FKK A;  3K6G A;  5H6Q A;  3AG2 H;  4I0B A;  2K86 A;  5CQG A;  1ACI A;  3SFZ A;  3WU0 A;  3K70 C;  1DU6 A;  3J81 Z;  3Q0V A;  2E5N A;  2KIU A;  4IHX A;  3LSI A;  5B1A H;  3OIQ A;  1U6G A;  2B0L A;  4GDF A;  1UG0 A;  3CC7 I;  3I3L A;  2BVL A;  1BI1 A;  3BG7 A;  3AG4 H;  3BTI A;  3M1E A;  3AAF A;  1Z6T A;  2LC2 A;  2M5W A;  3GZN B;  4OOI A;  1R23 A;  1U9N A;  3RQ4 A;  1MMD A;  2F5F A;  2FRH A;  2XAH A;  4HF0 A;  2WWY A;  1MJB A;  2FSW A;  1GUU A;  1O3Q A;  2Z99 A;  3AKZ A;  1DQU A;  3JSP A;  4UV9 A;  1FYL A;  3GTL J;  4XBF A;  3ZMZ A;  4I01 A;  3WTV C;  1TTY A;  4G8X A;  5GAE J;  4XL9 A;  3PQK A;  1QHG A;  3QOP A;  3B73 A;  2GQQ A;  4JX6 A;  5DM7 F;  3OYE A;  4XKV A;  4LGW A;  3V8J A;  5E3N A;  1FX7 A;  1A6I A;  2QF7 A;  2E2H J;  3OYB A;  5HS8 A;  4I09 A;  3LSK A;  5FLX Z;  5DCF A;  2K9Q A;  4NB5 A;  3PL8 A;  2VXZ A;  4BEH A;  2G9W A;  2WV0 A;  1JHF A;  3QQA A;  1WJD A;  2FX0 A;  3S8P A;  2MC3 A;  2BVM A;  1UST A;  2DFE A;  2BXZ A;  2K9M A;  5GAH J;  5DS9 A;  3HOS A;  1D5Y A;  1P7I A;  1T33 A;  2E2J J;  5ICG A;  3RZO J;  4U7B A;  2XPU A;  3I71 A;  2IPQ X;  3VEP A;  4IHW A;  5HDK A;  1KQ8 A;  3E0J B;  2P8T A;  1IXR C;  2HTS A;  1R6R A;  2L9V A;  2E1O A;  2DAO A;  3NAU A;  3HOX J;  2M4G A;  1MMS A;  1E3H A;  2KFD A;  4LMY A;  3N97 A;  2WB1 A;  3Q0W A;  2ZJQ F;  1XCB A;  2PLY A;  1XDU A;  4BAC A;  2XRO A;  2WB1 N;  3S2H J;  2HI3 A;  2ZB9 A;  1FOY A;  2XAQ A;  1S8N A;  2KT0 A;  5D4R A;  2JT1 A;  4NQW A;  3ZQQ A;  2GA1 A;  1MNM C;  1I6X A;  5BNG A;  4HDU A;  2QM3 A;  3BJA A;  5D6E A;  3OR2 C;  4CCK A;  4EEF G;  1B72 B;  4A3L J;  2BV6 A;  2DJI A;  1XSX A;  1J09 A;  3HB9 A;  4CYD A;  4M71 A;  1W7P B;  3EPZ A;  3HKZ A;  2KZG A;  3BG3 A;  2QQ9 A;  1VI0 A;  4ZYH A;  4BS9 A;  1PP7 U;  1VQN I;  2IT0 A;  3HKZ N;  4AUX A;  2LY9 A;  5FFX A;  3I58 A;  3V7C A;  4BQA A;  1XGS A;  5M3M J;  3HRS A;  1QQI A;  4P5O A;  1K4T A;  3VYT B;  2DMN A;  4C2M J;  4M6X A;  2AS5 F;  3QAH A;  1FC3 A;  1FPQ A;  4B47 A;  5B66 C;  1FP1 D;  3SEQ A;  4G7Z F;  3REO A;  4KIC A;  2XB5 A;  2E1N A;  4LIU A;  4ZZD A;  5EZG A;  3TQN A;  3IH4 A;  1CQT A;  2H94 A;  1XS9 A;  1ETV A;  2XSD C;  4N9I A;  3CMA I;  3G1L A;  4IXA A;  3RYP A;  3LSR A;  1ZHF A;  1XB4 A;  2EWN A;  2F4I A;  2X4H A;  3B02 A;  3F21 A;  3BR2 A;  3SFI A;  4UB8 C;  4X0G A;  2V6C A;  5FO5 A;  1XGO A;  2RC4 A;  5JI6 A;  3E5Q A;  1M1E B;  3H5A A;  5LRR A;  2VKH A;  2OA4 A;  2A3S A;  4BY1 J;  2Y75 A;  2OZ6 A;  4HA8 A;  1Q1V A;  2ZXW H;  3FHZ A;  2K4B A;  2JA6 J;  3ZR8 X;  1MBJ A;  1XD7 A;  1YX3 A;  2QCO A;  2CWE A;  4HQM A;  1IAW A;  3HEF A;  2QWW A;  3CMM A;  4LLG F;  1WI9 A;  1T39 A;  3G1O A;  1HKT A;  3T5X A;  3BG9 A;  3RKQ A;  2HOS A;  2DYR H;  3T0Y A;  3K1M A;  4CH7 A;  1QVT A;  2E5Z A;  1SFX A;  3VWB A;  4YRV A;  1K7A A;  2STT A;  2JMW A;  1J0R A;  2VBZ A;  3P9C A;  1R58 A;  3CO6 C;  2IEK A;  2LY2 A;  2DT5 A;  4AYB A;  1KA8 A;  2EFW A;  1NH3 A;  3L2C A;  5F1R A;  2J5O A;  4AYB N;  1PVE A;  1ZEL A;  3HTS B;  2CSO A;  1TW2 A;  3I4N J;  3TOB A;  1U2W A;  4BL0 B;  1IC8 A;  1FNN A;  4IHV A;  1FEX A;  3LQR A;  4QIW N;  1ZLK A;  2PJP A;  1QA6 A;  4UHT A;  3EYI A;  2IGO A;  2DFF A;  2QVO A;  1QZY A;  3K10 A;  1MDM A;  4KFC A;  1LFP A;  1OKR A;  3V8K A;  1G6N A;  3P7N A;  3LSH A;  1K4S A;  2KRF A;  4RM2 A;  2ESH A;  4A5N A;  1TT0 A;  1BC8 C;  2EIN H;  2AXT C;  3W6V A;  1X2M A;  2W48 A;  2K9L A;  3C2B A;  2O6G E;  1WH5 A;  4R1H A;  3A2K A;  4PCQ A;  2M30 A;  3CMY A;  2GWR A;  5LFA A;  1KQ0 A;  2DOF A;  1NTC A;  3I55 I;  1FSE A;  4XRF A;  2LD5 A;  2XAG A;  2ZFW A;  2IW5 A;  4DNC A;  1VZ0 A;  4DYC A;  1EH6 A;  5BMZ A;  3HOV J;  2E35 A;  4HAM A;  1UG2 A;  4PJM A;  2EFO A;  4V2F A;  5ILU A;  4F55 A;  3KZZ A;  2EIM H;  1D1A A;  2ZC2 A;  1BJA A;  3QPL A;  5KVR A;  9ANT A;  5ICF A;  2M7A A;  1LE8 A;  4M3G A;  2EBI A;  3DFG A;  4OIO F;  3RYR A;  1MJ9 A;  2HVQ A;  4FT8 A;  2R7D A;  3DEW A;  3KZI C;  4RS8 A;  2EQR A;  2W57 A;  1G3S A;  1DU0 A;  1H9G A;  1ZH5 A;  2V1D A;  2YPR A;  2COM A;  3P9I A;  1YIT I;  2A07 F;  2VAS A;  2YU3 A;  2Q2E B;  5HVQ C;  3CF2 A;  1ITY A;  4RAF A;  2NYX A;  3JTH A;  3WG7 H;  3FIW A;  4E70 A;  1YX5 A;  1H9T A;  2IS4 A;  2FXA A;  4RGR A;  1SVO A;  5D4S A;  1F36 A;  4D5C A;  1V54 H;  5K5R A;  1YIO A;  1KU9 A;  3E3V A;  4AM3 A;  2COB A;  2PQ8 A;  3H0G J;  5EG0 B;  4IHS A;  1DPR A;  2VE8 A;  4EJU A;  2L4A A;  2M34 A;  5CQE A;  1F1Z A;  2BY1 A;  2MAB A;  3LST A;  3LA3 A;  3VSK A;  1UEL B;  1G2H A;  4UV8 A;  4L5I A;  3ZMD A;  3CME I;  4KIB A;  3M1C A;  1YG2 A;  3GZ6 A;  2B7E A;  1IUY A;  1FIA A;  1SC7 A;  2BHZ A;  3L7W A;  3CC2 I;  2MG4 A;  2WC2 A;  3GEZ A;  2WY8 Q;  1P7J A;  2MD0 A;  2V1X A;  2DI3 A;  1HA8 A;  3S15 J;  3BTL A;  5DEQ A;  1BW6 A;  5AON A;  5LBQ A;  4IPA A;  2LKS A;  1ON1 A;  1T0F A;  4KJZ A;  4PFO A;  3S3N A;  2VQL A;  3KP7 A;  2XAJ A;  4YII A;  4M73 A;  2H1L A;  3MFK A;  1VQ9 I;  1VQ8 I;  2HOT A;  5FLV A;  1Q1H A;  4DYQ A;  1FBQ A;  2DA2 A;  4BHP A;  3I54 A;  3ASN H;  3JRE A;  2DOE A;  1KU7 A;  3SXY A;  2ADU A;  4KMF A;  1S72 I;  1W5C C;  1Z6R A;  1MIJ A;  5LEJ A;  5CKT A;  2ZO4 A;  3RPQ A;  5A2Q Z;  4HSR A;  3A03 A;  4TV7 A;  1USS A;  1TZL A;  2R7Q A;  5H6R A;  3LFK A;  1BOA A;  3GTK J;  5D5X B;  5CJ9 A;  4S04 A;  1LDD A;  2VJ4 A;  2XAF A;  2K27 A;  3IH3 A;  1JJ8 C;  3G3Z A;  3FKI J;  2X6Y A;  3JRI A;  2WAQ A;  5IP7 J;  3E7L A;  2E7W A;  4FCY A;  1N75 A;  1QRY A;  5J1R A;  4U0W A;  4BXU A;  1WVR A;  2DTR A;  2DTZ A;  1PDN C;  2V1U A;  3CQZ J;  4KYW A;  2HXO A;  3H92 A;  3KCC A;  1TQM A;  5E18 F;  1FJL A;  4GFB A;  4BQO A;  1MKM A;  4B09 A;  1FBS A;  1I3A A;  2KJC A;  1GVD A;  1W7P D;  2ZSH B;  3AG3 H;  4J01 A;  2VPR A;  1P4W A;  4GXO A;  2QQA A;  3F8B A;  2F2E A;  1OQY A;  2KLO A;  2NVU B;  3VOE A;  3ZQC A;  1Y1V J;  1RET A;  3PQJ A;  5JR3 A;  2MH2 A;  2EIK H;  5J1Y A;  4LK1 F;  1PJR A;  2ACJ A;  1ZN2 A;  1YOV B;  3CCL I;  5IYD J;  5E79 C;  1REP C;  4OMZ A;  4C2U A;  4C3J J;  1J2X A;  5E17 F;  2EFN A;  3ZN0 A;  1X3W B;  5E20 A;  3K4C A;  3LNQ A;  1SVM A;  3SYT A;  4BXF A;  1W1W E;  2EIJ H;  4CCJ A;  5EGO A;  3HJE A;  2DA5 A;  5D8K B;  3B6A A;  2UZK A;  2HVR A;  2RKH A;  1HW1 A;  2BHY A;  1D0Y A;  3HOY J;  4E7K A;  3OSG A;  4XKC A;  4XOR A;  2ESN A;  3BQZ A;  4CHU A;  5ILS A;  1ETX A;  2HOA A;  5FLM J;  4BY7 J;  2NRA C;  3EDP A;  4L9V A;  1W0U A;  5IOZ A;  1D1B A;  5LRS A;  1LUJ B;  2JN6 A;  3DXJ F;  3PJR A;  1BBY A;  3HPH A;  2FBI A;  2Q1Z B;  3JTG A;  4ZDP A;  2DK8 A;  1VQK I;  3R4K A;  3DTE A;  2R7R A;  2HYG D;  4OWR B;  3C2H A;  3RSN A;  1YO5 C;  2CS3 A;  4MEY F;  3WTT C;  3QU6 A;  2RRE A;  1T56 A;  1T6S A;  2DA4 A;  3P9K A;  1FY7 A;  1R4N B;  1VQO I;  2KDO A;  4DBR A;  4E7L A;  2JK3 A;  1QHH D;  5F6F A;  2H27 A;  4R8H A;  2HYJ A;  4RLQ A;  4KIG A;  2CV1 A;  1S5L C;  5FJ8 J;  2H6B A;  3GO5 A;  2IRF G;  4DOZ A;  1R00 A;  2LDU A;  4EVI A;  3F22 A;  1F9N A;  4A3J J;  2A6E F;  3GCM A;  3TO7 A;  1K61 A;  3ECO A;  2R5Z B;  4MTD A;  5C4X J;  2X1E A;  2VI6 A;  5CLS A;  1ZKG A;  1U78 A;  2CUE A;  4BQN A;  2AHQ A;  5F0H A;  5J47 A;  4Y52 J;  3QYB A;  2E2I J;  1WHU A;  1GXP A;  1OPC A;  5IOY A;  1IN7 A;  2HOE A;  3G1M A;  4BDZ A;  2RNG A;  3R61 A;  4X6A J;  5EYR A;  1RKW A;  3EUA A;  2R7Z J;  4OAZ A;  2L7Z A;  1OR7 C;  3D5R C;  3FBI B;  4ITV A;  2OTJ I;  1SVL A;  1EA3 A;  1S7A A;  3RKX A;  3GXO A;  4KDP A;  1BR2 A;  2EK5 A;  3LSG A;  1GVJ A;  1XTA A;  3A02 A;  3I53 A;  3HDD A;  2MH9 A;  1X1C A;  4BUP A;  2R5Y B;  2HR3 A;  2HQ5 A;  5IYB J;  4LJZ F;  1RR8 C;  4L5E A;  4GRI A;  2NAZ A;  3DBH B;  4MO7 A;  1IDZ A;  3BG6 A;  3KFW X;  4GYI A;  4N0B A;  1KZH A;  3SZT A;  5F1J A;  1F43 A;  3VPR A;  1KU2 A;  1R5I D;  3TO9 A;  1DP3 A;  3HSE A;  3K70 D;  4U7D A;  5E3M A;  2GBY A;  3CCV I;  3J81 K;  3GTP J;  4L9J A;  2DOA A;  5K7H A;  5EEH A;  3WG9 A;  3HGG A;  4FE7 A;  5CYV A;  3F3X A;  1JXS A;  2L7F P;  3QOD A;  1ZGA A;  2FOK A;  2BW3 A;  2ZNZ A;  1N78 A;  2GZW A;  3BRO A;  4KN7 X;  4MHG A;  4HLY A;  3R0A A;  1LFU P;  4L18 B;  4HYE A;  1ZRF A;  3BPX A;  5TRD A;  1ON2 A;  1LB2 A;  3ERM A;  3M9A A;  3J7Z I;  5ERI A;  4EMS A;  1MZB A;  3H1C A;  1B8I A;  2EPF A;  1F5T A;  2PJR B;  3J7Y J;  4NC6 A;  4ETS A;  3K4N A;  4IKF A;  3QPT A;  3ZMT A;  2XKO A;  3QRF F;  3CDL A;  3WHC A;  3PNY A;  2H8W A;  1IUF A;  4PFP A;  2O7O A;  4LLN A;  4MLO A;  1A04 A;  4QLC U;  4UUS A;  1POG A;  1XG1 A;  2CG4 A;  2EV5 A;  2V9K A;  3JRG A;  4OIQ F;  1DDN A;  2CQQ A;  3Q0U A;  5J4Y A;  4MGR A;  5DD8 A;  2TCT A;  4ESF A;  4G6D A;  2JTV A;  3BOQ A;  4JX5 A;  2QA4 I;  1QPM A;  3OSF A;  2L9S A;  2Q2E A;  2VN2 A;  1MH4 A;  4BHB A;  3ZQL A;  2E60 A;  2OAZ A;  2NNY A;  2L4M A;  4ENN A;  1HOM A;  1UB9 A;  3CCM I;  2QEX I;  2MW8 A;  2YUS A;  3J7A Y;  1WJB A;  2RN7 A;  3IHU A;  2N8G A;  1RUN A;  4E7J A;  3J7A O;  2R7T A;  1MBF A;  3BR3 A;  1UAA A;  1JKQ C;  4Q5S F;  2H09 A;  3C7J A;  4HLX A;  2DYS H;  2K4J A;  4UNO A;  1RR7 A;  2E19 A;  2CW7 A;  4H4K C;  1ZGJ A;  2LYC A;  4XRS G;  3JRH A;  3HZJ A;  4Y4R A;  4M9Z A;  2ECC A;  3JR9 A;  3IV5 A;  1UHW A;  3K4M A;  5F04 A;  4YFX F;  1MD0 A;  2W00 A;  2Z1D A;  4DJA A;  1HSJ A;  5DD4 A;  1R7J A;  1X3Z B;  5D8L B;  1R36 A;  3BR1 A;  2UUZ A;  2HWV A;  3M8J A;  4WXH A;  2P6T A;  4GCV A;  3HOT A;  2X6W A;  4RAY A;  3OOU A;  2OUM A;  3QP5 A;  1HF0 A;  1JI8 A;  2LKP A;  1DP7 P;  3S1M J;  1SD4 A;  1O7L A;  4HV6 A;  3VB2 A;  1E3P A;  4JK1 X;  1LKX A;  2JPC A;  2VXD A;  3PM1 A;  4BE0 A;  1Y39 A;  1FMV A;  3IWF A;  3BQY A;  3VYS B;  3FZV A;  2GIZ A;  1J5Y A;  3MN2 A;  4L0Y B;  2GXG A;  3HM5 A;  1IXC A;  2XRL A;  5DUI A;  5GPC A;  2Z33 A;  3GTO J;  1C0W A;  3BR0 A;  4BDY A;  2LH9 A;  3MZ8 A;  1ODD A;  4MQV A;  1P92 A;  1LVK A;  3G4S I;  2ZJ2 A;  1FYM A;  4M9S A;  3DEU A;  2DMQ A;  4XLE A;  1ZR4 A;  3ZCO A;  1G3W A;  2EA4 A;  4B43 A;  1G3T A;  1FMW A;  4CCM A;  3FF5 A;  2DQR A;  2LLK A;  2XGC A;  3KIO A;  1B9N A;  4IEJ A;  1OJL A;  3GUD A;  3S2D J;  3HOZ J;  2VL8 A;  1X4O A;  1ENH A;  3TMO A;  1ZK8 A;  5TGT A;  3OY9 A;  3GME A;  2XIG A;  1SD5 A;  2XC7 A;  2CMP A;  3VOD A;  4P96 A;  1IZ1 A;  3I56 I;  4I6Z A;  3FDY A;  1STZ A;  4AC0 A;  2FD5 A;  2HFH A;  2M0C A;  3FXR A;  5KK1 A;  5GAG J;  4CA0 A;  5FFZ A;  1G59 A;  2VKV A;  3DKY A;  1OCC H;  1FBU A;  2LTP A;  4D7N A;  2FBH A;  2IGN A;  3CUQ C;  2P0W A;  3LOC A;  1MSF C;  1HKS A;  3H0D A;  3DLL F;  3PO3 J;  5H2F C;  1G4D A;  2IS1 A;  2LG4 A;  4PDK A;  4XN3 A;  2O03 A;  2FJ1 A;  3JRD A;  3QYF A;  2CJJ A;  4N4N B;  2BXY A;  4XLA A;  1V5G A;  2F5D A;  1I39 A;  1HC8 A;  1J7K A;  2HZT A;  3IH2 A;  4YFK F;  2F4M B;  2E1M B;  1YS7 A;  4A3E J;  2HPI A;  4IOC F;  2R7S A;  3H36 A;  4BAY A;  2EH3 A;  2I10 A;  3U9G A;  3SJM A;  2XUB A;  1KU3 A;  5E1X A;  1Z9C A;  1AOY A;  3OL4 A;  1SFO J;  3W3C A;  4L5J A;  2MGQ A;  2RV8 A;  5FD5 A;  4IOA F;  2JZY A;  4ANJ A;  3CLO A;  3V42 A;  2K9S A;  3NAR A;  1HXD A;  4J00 A;  2HTJ A;  1K78 A;  1A35 A;  5AIQ A;  2F4O B;  1V5F A;  3VYR B;  2XF6 A;  5DCM B;  1MBG A;  1K83 J;  1HW5 A;  4G12 A;  1I3Q J;  5TJJ A;  1PUF B;  1IXS B;  3BLY A;  3KPH A;  1WCM J;  2K3F A;  3T1B A;  3CCU I;  5BPD A;  3BR5 A;  1TWC J;  3TGN A;  2H6C A;  2F5V A;  2ZXJ A;  1YLF A;  4ZJZ A;  5CVJ A;  3A0H C;  1APL C;  3HUG B;  4I98 B;  1SAN A;  3FKJ A;  1LEA A;  4XLP F;  1BI2 A;  3TBI A;  4XOP A;  3FXL A;  4MFD A;  1RC9 A;  3KE2 A;  1ETO A;  4M3F A;  2LY1 A;  3F8F A;  1K79 A;  2LKX A;  4MFE A;  3OIP A;  3ZMV A;  1L0O C;  3TP3 A;  2GXA A;  3S1Q J;  3QP6 A;  3U2R A;  4E6K G;  3KP6 A;  3OYC A;  1TP4 A;  3KP4 A;  4LLL A;  4C2T A;  1R71 A;  2AO9 A;  1T38 A;  1Z1D A;  3OYL A;  4A3K J;  3C2G A;  4RGS A;  4FHT A;  4QPO A;  1HST A;  4ENJ A;  1FTZ A;  4B8X A;  3L1P A;  1BR1 A;  1XGN A;  4M9X A;  4IVN A;  2KL4 A;  2F5C A;  4PJJ A;  4KUM A;  5B3S H;  4RB3 C;  3ZMU A;  1GV2 A;  3SZP A;  3DV8 A;  2GOM A;  4BBS J;  2QBY A;  2QSH X;  4DBQ A;  4HST A;  1O4X A;  4ZC3 A;  3O8G A;  4C3H J;  2EB7 A;  3MMY B;  3UKG A;  1MNE A;  2Z2S B;  2BEO A;  5AIP A; 
#chains in the Genus database with same CATH homology
 2K40 A;  4DZP A;  2DMU A;  1NK3 P;  1ETY A;  3S16 J;  2ME6 A;  2NVQ J;  2ELK A;  3IH3 A;  4FTH A;  4W1U A;  1JJ8 C;  5C44 J;  3FKI J;  2H1K A;  3JRI A;  5M3F J;  3TW7 A;  2NVX J;  5IP7 J;  3E7L A;  5F27 A;  2OF7 A;  4FCY A;  1QRY A;  5J1R A;  4QTR A;  1IGN A;  2XB0 X;  2DTZ A;  1RES A;  3S1N J;  5FKL A;  3CQZ J;  4XID A;  2LK2 A;  2HXO A;  2TRT A;  2Y9Y A;  2DMT A;  2Y30 A;  3TP0 A;  1ZGW A;  1FJL A;  2GM4 A;  4GFB A;  1Z77 A;  4FE4 A;  1H88 C;  1VFC A;  3H3V K;  5GP9 A;  3JRB A;  5E3O A;  2G0E A;  3TW6 A;  3A01 A;  1GVD A;  1QVU A;  2VPR A;  1X58 A;  3GTG J;  3SDG A;  4A3M J;  2EZK A;  3QPS A;  5K7Z A;  3ZQC A;  1AKH A;  3GTK J;  1Y1V J;  1RET A;  2OPT A;  4CYC A;  3A01 B;  5J1Y A;  2NVT J;  2X48 A;  1UHS A;  2XGE A;  2R93 J;  1IRZ A;  5IYD J;  4A3F J;  1H8A C;  4C3J J;  1MBK A;  1AKH B;  3FIS A;  4ABZ A;  2DMP A;  3B6C A;  4A3D J;  3LNQ A;  4CYC B;  4B3A A;  3MKL A;  2EZH A;  2EZI A;  5EGO A;  1JT6 A;  1I50 J;  2DA5 A;  4A3C J;  3B6A A;  2LP0 A;  1BJZ A;  1JTY A;  2JJ7 A;  3HOY J;  2NVY J;  3OSG A;  1YRN B;  1ETW A;  3ZQH A;  3FK7 A;  3MVP A;  4M6V A;  5EGO B;  4W97 A;  3BQZ A;  5FLM J;  1ETX A;  2HOA A;  2Y31 A;  1TC3 C;  4BY7 J;  5F08 A;  2DJN A;  1W0U A;  5IOZ A;  5IP9 J;  3PO2 J;  2JN6 A;  2L0K A;  1U9O A;  3HGY A;  4Y7N J;  1MBH A;  4J19 A;  5M5W J;  2ECB A;  1XC5 A;  1H89 C;  1T56 A;  4DZJ A;  2DA4 A;  2JK3 A;  2P81 A;  3D1N I;  1WI3 A;  2K9N A;  1GV5 A;  2L7M P;  2HYJ A;  5FKO A;  2XPW A;  1JTX A;  4BXX J;  2EZL A;  2O8K A;  5FKN A;  2R5Z A;  2HDD A;  1AHD P;  3RZD J;  2JA7 J;  5M5X J;  5IYC J;  4C3I J;  5FJ8 J;  5EF6 A;  4A3J J;  2R92 J;  5HOD A;  1TWH J;  3WHB A;  2YU9 J;  1K61 A;  1FIP A;  2IBD A;  4D5F A;  2R5Z B;  1WGX A;  5C4X J;  1AU7 A;  2VI6 A;  5E3L A;  1ZKG A;  1U78 A;  2CUE A;  2AHQ A;  1BA5 A;  1WPK A;  4JP0 A;  5F0H A;  4Y52 J;  2KDZ A;  3GTM J;  3HBL A;  1MH3 A;  2XPV A;  2E2I J;  5IOY A;  5FKK A;  1GT0 C;  3G1M A;  3M3Y J;  4X6A J;  1E3O C;  5EYR A;  1RKW A;  2R7Z J;  5J3L A;  2L7Z A;  3HOW J;  1JKO C;  1DU6 A;  3Q0V A;  4IHX A;  2R5Y A;  3I4M J;  3LSG A;  2IAI A;  3BTI A;  3JRC A;  3A02 A;  2GLO A;  3HDD A;  1OCP A;  1U9N A;  1HLV A;  1OFC X;  2R5Y B;  1FTT A;  1JKR C;  2HQ5 A;  5IYB J;  2B63 J;  4RBO A;  4L5E A;  2DA3 A;  2M8G X;  1TWA J;  4M3D A;  4MO7 A;  3GTJ J;  1IDZ A;  1GUU A;  2RAE A;  5IP6 A;  5F1J A;  1F43 A;  3VPR A;  1A5J A;  3GTL J;  2JA5 J;  5E3M A;  4BKX A;  2Y2Z A;  4A93 J;  2GBY A;  1JT0 A;  1VF9 A;  3GTP J;  5K7H A;  4XRS A;  4JX6 A;  3O8H A;  1NK2 P;  1ZR2 A;  3HGG A;  2ID3 A;  4FE7 A;  1MBE A;  5E3N A;  1A6I A;  2QF7 A;  2E2H J;  2L7F P;  5DTD A;  4QSH A;  2K9Q A;  1HDD C;  4B1R A;  4IHY A;  3K2A A;  1LFU P;  4A3G J;  3BR6 A;  3QQA A;  2FX0 A;  5K7F A;  5F0C A;  2FQ4 A;  1B8I A;  5DS9 A;  3GBG A;  2E2J J;  1D5Y A;  1P7I A;  1T33 A;  3RZO J;  4NDL A;  2XPU A;  4IHW A;  3CDL A;  3WHC A;  2PMZ N;  3ZQI A;  2E1O A;  1IUF A;  1JUS A;  3NAU A;  3HOX J;  2O7O A;  5JLX A;  3Q0W A;  4MLO A;  4UUS A;  1POG A;  1XG1 A;  5J1U A;  3JRG A;  1B8I B;  1JUM A;  2WV1 A;  2WB1 N;  2CQQ A;  3F0C A;  3S2H J;  2HI3 A;  3Q0U A;  2ZB9 A;  1B72 A;  5EZH A;  2KT0 A;  4BBR J;  2L9R A;  2TCT A;  3S17 J;  4JX5 A;  1MNM C;  4UUS B;  5BNG A;  3OSF A;  1JKP C;  1MH4 A;  3ZQL A;  4EEF G;  4HNV A;  1B72 B;  5JLW A;  2VUM J;  1OCT C;  4A3L J;  1HOM A;  2Y9Z A;  1QPI A;  3HB9 A;  2MW8 A;  2YUS A;  1ZTR A;  1S7E A;  4DYR A;  3BG3 A;  1VI0 A;  2N8G A;  4RDU A;  3S1R J;  3HKZ N;  4AUX A;  2LY9 A;  4V2G A;  1MBF A;  3BR3 A;  1JKQ C;  5M3M J;  3BTC A;  2DMN A;  4C2M J;  1IJW C;  3BG5 A;  1RR7 A;  2E19 A;  2ME0 A;  2XB5 A;  4XRS G;  1RPW A;  5C4J J;  5EZG A;  3JRH A;  3IH4 A;  4FIS A;  2ECC A;  1CQT A;  3JR9 A;  3IV5 A;  1XS9 A;  4S0H B;  5F04 A;  1ETV A;  2XSD C;  2X9D A;  1ORK A;  3G1L A;  1ETQ A;  3LSR A;  1BL0 A;  3BR1 A;  3BTJ A;  3JRA A;  3BR2 A;  3SFI A;  3OOU A;  1HF0 A;  2X6O A;  3S1M J;  1RKT A;  4BY1 J;  3GTQ J;  3PM1 A;  1Q1V A;  3BQY A;  2JA6 J;  4UUT A;  1MBJ A;  3MN2 A;  2QCO A;  5FKM A;  3HM5 A;  3HEF A;  3G1O A;  2XRL A;  1X2N A;  3BG9 A;  3RKQ A;  1HDP A;  5GPC A;  2HOS A;  2O9L A;  2ID6 A;  3GTO J;  1LFB A;  3BR0 A;  3ZQF A;  4D7M A;  1QVT A;  4M3E A;  1IDY A;  3Q3S A;  2JMW A;  3HOU J;  3ZOB A;  3M4O J;  2CU7 A;  2DMQ A;  2IEK A;  2NOG A;  1ZR4 A;  3RQI A;  4XIC A;  2LLK A;  2XGC A;  4DW6 A;  4IEJ A;  1OJL A;  4AYB N;  2JWT A;  3S2D J;  1IV6 A;  3HOZ J;  1ENH A;  2NS7 A;  1ZK8 A;  4XK4 A;  1HCR A;  3I4N J;  1IC8 A;  4IHV A;  2CQX A;  3DCF A;  2CRG A;  3OIO A;  4A3B J;  1FEX A;  4QIW N;  4I6Z A;  1U8B A;  4AC0 A;  2LVS A;  2FD5 A;  2WAQ N;  2M0C A;  2NS8 A;  4JYK A;  1Y1W J;  2VKV A;  1I6H J;  2LTP A;  4D7N A;  1BW5 A;  3W6V A;  1X2M A;  4XRM A;  3BT9 A;  2W48 A;  3C2B A;  1ETK A;  1WH5 A;  3LOC A;  2XGD A;  1MSF C;  5GPA A;  3CMY A;  1NTC A;  4LOC A;  1GDT A;  3S14 J;  2LD5 A;  3PO3 J;  4DYC A;  2YS9 A;  3HOV J;  2FJ1 A;  3JRD A;  2CJJ A;  1UG2 A;  2DA7 A;  2R0Q C;  1EF4 A;  2DA6 A;  4V2F A;  3IH2 A;  1MSE C;  3QPL A;  9ANT A;  4M3B A;  4A3E J;  1LE8 A;  1WH7 A;  2EBI A;  4M3G A;  3CCY A;  1JUP A;  2EH3 A;  2I10 A;  1YRN A;  2DN0 A;  3DEW A;  3SJM A;  2D5V A;  2EQR A;  1DU0 A;  1SFO J;  1VND A;  2MGQ A;  5C3E J;  2JA8 J;  5EEA A;  1LE8 B;  2Y0S N;  2K9S A;  3NAR A;  2LFB A;  3LSJ A;  1PUF A;  2DA1 A;  2LR8 A;  1ITY A;  5EG0 A;  3FIW A;  1R9T J;  2VKE A;  5IPA A;  2CUF A;  1F36 A;  1MBG A;  1K83 J;  4D5C A;  4G12 A;  1I3Q J;  1PUF B;  1UMQ A;  1WCM J;  2COB A;  3H0G J;  5EG0 B;  3BR5 A;  1TWC J;  2M34 A;  2M9H A;  2HXI A;  1APL C;  4MIM A;  1SAN A;  1G2H A;  5F0F A;  4MFD A;  1ETO A;  4A69 C;  3LSP A;  4M3F A;  4I76 A;  1FIA A;  2LKX A;  4MFE A;  2MG4 A;  1IG7 A;  3TP3 A;  3S1Q J;  1P7J A;  3S15 J;  3BTL A;  1BW6 A;  2AO9 A;  4A3K J;  3FK6 A;  2HOT A;  5FLV A;  4DYQ A;  1FTZ A;  3L1P A;  3ZQG A;  2H8R A;  2DA2 A;  2MSY A;  3K7A J;  3JRE A;  4A3I J;  4JX4 A;  1GV2 A;  3TED A;  2M2E A;  3JRF A;  1JGG A;  5EDN A;  1Z0X A;  4BBS J;  1TWF J;  4X1E A;  1JJ6 C;  5M5Y J;  1O4X A;  1W0T A;  3O8G A;  3A03 A;  4C3H J;  4B4C A;  3UKG A;  1ZQ3 P;  1TWG J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...