1GV2A

Crystal structure of c-myb r2r3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
102
Chain Sequence
ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Crystal Structure of C-Myb DNA-Binding Domain: Specific Na+ Binding and Correlation with NMR Structure
rcsb
source organism Mus musculus
total genus 32
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv2A01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv2A02
4A3LJ 1NTCA 1BL0A 1ZTRA 4A69C 1JT0A 2NVTJ 3GTLJ 2EBIA 4D7NA 2NVYJ 4XRSA 3HOXJ 2LR8A 4C3IJ 1OCTC 3DCFA 1MH3A 5E3LA 5EYRA 3I4NJ 3IH4A 4MO7A 3BR6A 5GP9A 2XPVA 3S2HJ 9ANTA 4A3KJ 4M6VA 2NS7A 2JWTA 1X2NA 2E1OA 1ZKGA 3H0GJ 2Y9ZA 1JJ8C 5EGOA 4BKXA 1ZK8A 3MKLA 1H88C 1TWGJ 3S16J 2HYJA 3IV5A 2OPTA 1RR7A 2CUEA 3GTKJ 3LOCA 3E7LA 2WB1N 1UG2A 2M8GX 3TW6A 3S14J 2M34A 5F27A 5JLXA 4A3MJ 5EZHA 1B8IA 2M9HA 3HGYA 1DU0A 3S15J 3ZQCA 5FKNA 3WHBA 5M5XJ 1Y1VJ 2CUFA 4AUXA 1VFCA 2ME0A 3FK7A 3JRHA 2N8GA 3Q3SA 2XB5A 2M0CA 5IP9J 2EZLA 3C2BA 3HGGA 1OJLA 4RDUA 5HODA 2Y30A 3ZOBA 4XRSG 1B72B 3BTIA 1JTXA 2JA7J 4MLOA 3Q0VA 2KDZA 3ZQHA 5IPAA 1FEXA 1GV2A 2LKXA 3OSFA 2XPWA 1RETA 4V2FA 2VPRA 2X6OA 5JLWA 1IDZA 1HDDC 4DZJA 2DTZA 2E2HJ 2K9SA 3F0CA 3LSJA 1HDPA 1ETVA 2Y2ZA 1LE8B 3HM5A 2IAIA 3NARA 1JUMA 2JA6J 1WH7A 3O8GA 4QSHA 1MH4A 5FKMA 2AHQA 2DMPA 1JKOC 1Q1VA 1BJZA 4J19A 1ZR4A 4UUSB 5F0CA 4M3GA 4A3FJ 1TWFJ 4C3HJ 5J3LA 1X2MA 2MGQA 3BTLA 2FD5A 2LD5A 4M3DA 2JJ7A 5FKKA 1RESA 1XC5A 2YU9J 1AU7A 4BY1J 5DTDA 2CRGA 4LOCA 1CQTA 2XPUA 5F0FA 2VKVA 3HBLA 3A03A 4XICA 5J1UA 5EG0A 3S1MJ 1F43A 1MBGA 1EF4A 3K7AJ 1MNMC 4IHYA 3CMYA 1BW6A 3BTCA 1U9NA 1TWAJ 3TP0A 4DYRA 1WPKA 1HOMA 2X48A 3FKIJ 5K7FA 1PUFB 2HOTA 1MSEC 1OCPA 4FE4A 5K7ZA 5FLMJ 5IOYA 2DA6A 5K7HA 5BNGA 2FJ1A 5DS9A 3HOVJ 4BBSJ 4JX5A 2RAEA 1ETOA 4NDLA 3RZDJ 2O7OA 3HOYJ 2CU7A 4A3JJ 3WHCA 4JX6A 3GTQJ 4X6AJ 4CYCB 2ECBA 1YRNA 3W6VA 2DA2A 1ZGWA 2O9LA 2ECCA 4MIMA 5IYCJ 3G1LA 3LNQA 1I50J 4GFBA 3HOWJ 4QIWN 4FCYA 3PM1A 2XGDA 3SJMA 1JKQC 1I6HJ 3BR3A 4MFEA 2I10A 1WI3A 3TW7A 2VUMJ 1ETKA 2E2JJ 5IP7J 2FQ4A 1SFOJ 4FTHA 5EGOB 3BQZA 1RPWA 4A3DJ 2JN6A 1G2HA 1IJWC 2GBYA 3SDGA 3LSPA 2XB0X 3JREA 2OF7A 2EQRA 3JRAA 4S0HB 4D7MA 2ID3A 4BY7J 4M3FA 4X1EA 1APLC 1IGNA 1IC8A 2P81A 1B8IB 2L0KA 2JA5J 2NVQJ 1GDTA 5M3MJ 4JP0A 3ZQGA 2O8KA 3QPLA 5M5WJ 4BXXJ 5F04A 1K83J 3CCYA 3FISA 2L7FP 5IYDJ 3SFIA 4FE7A 5J1YA 3VPRA 1H8AC 4IHVA 2K40A 1F36A 2R5YB 2D5VA 1MBFA 2LFBA 4A3BJ 4Y7NJ 4DZPA 3CQZJ 5E3OA 3BR0A 1DU6A 1GV5A 2XGCA 3OOUA 3BR5A 1UMQA 2DN0A 3BQYA 2WAQN 4C2MJ 1FTTA 2DMNA 5EZGA 1T56A 1ITYA 3Q0UA 2COBA 2CQQA 1W0TA 4UUTA 2IEKA 4V2GA 1NK2P 1IUFA 2GLOA 3CDLA 2EH3A 2Y31A 2VI6A 2KT0A 4W97A 5EDNA 2QF7A 1U78A 1FIAA 3LSRA 1TWHJ 3TP3A 4RBOA 1GVDA 4M3BA 1ETXA 3S2DJ 2ME6A 2R7ZJ 1QPIA 5C4XJ 3BR1A 4A3IJ 4Y52J 1Z77A 1AKHA 2GM4A 1ETWA 2ELKA 1P7JA 2Y9YA 3UKGA 1XG1A 3S1RJ 1FJLA 2H8RA 5F1JA 3S17J 1UHSA 1ZQ3P 2HOAA 1XS9A 3BG3A 2CQXA 5GPCA 3D1NI 3GTGJ 1JJ6C 4D5FA 3BR2A 5E3NA 2R92J 4FISA 2LY9A 1E3OC 2R5ZA 1BW5A 2NS8A 2DMTA 3HOUJ 5M3FJ 2R93J 1P7IA 5FKOA 2MG4A 2B63J 5M5YJ 3A02A 4A3EJ 2EZIA 5C3EJ 1IG7A 4UUSA 2HXOA 1JKPC 2QCOA 2W48A 3HB9A 5FKLA 1ETYA 1MBJA 3PO2J 1GUUA 2HOSA 3JRCA 1JKRC 5C44J 2YUSA 1K61A 1VI0A 4IEJA 4IHWA 2E2IJ 1FIPA 2E19A 2R0QC 4AYBN 4B3AA 5F0HA 2HI3A 1YRNB 2HDDA 1U9OA 1ZR2A 3A01A 3QQAA 2PMZN 1VNDA 1IRZA 1O4XA 1A6IA 1MSFC 3JR9A 1WGXA 3OSGA 2DJNA 2YS9A 1W0UA 1TWCJ 5EEAA 4D5CA 1JGGA 2L7ZA 3HDDA 3ZQLA 2X9DA 2XGEA 4XIDA 5EF6A 2WV1A 4A3CJ 5IOZA 3L1PA 4A93J 3ZQIA 2L7MP 4B4CA 1MBHA 4CYCA 1JUPA 4I76A 4IHXA 1A5JA 1WCMJ 1RKTA 2FX0A 3K2AA 1IDYA 1POGA 1IV6A 1WH5A 4JX4A 2JA8J 2NOGA 3GBGA 2Y0SN 2EZHA 4ABZA 1ETQA 3BT9A 1VF9A 1QVTA 2K9QA 1HLVA 3G1MA 3RKQA 5FLVA 3RZOJ 1HF0A 2MW8A 2DMUA 4B1RA 5FJ8J 2M2EA 2JK3A 4BBRJ 1D5YA 2DA3A 3G1OA 1Z0XA 4I6ZA 1H89C 3JRGA 3HKZN 1RKWA 2ZB9A 4G12A 3GTPJ 3OIOA 2MSYA 2AO9A 3RQIA 2DA5A 5C4JJ 2HQ5A 2R5YA 1MBKA 2JMWA 2LLKA 1S7EA 2EZKA 3PO3J 1B72A 3JRFA 1AHDP 2DA7A 1U8BA 2DA4A 3LSGA 1JT6A 1AKHB 1BA5A 5F08A 2G0EA 2TRTA 3FIWA 1X58A 3M3YJ 1R9TJ 1TC3C 3FK6A 3B6CA 1GT0C 1JTYA 3I4MJ 1QVUA 3ZQFA 4C3JJ 4A3GJ 2LVSA 3MN2A 1FTZA 4DYQA 1QRYA 2L9RA 1Y1WJ 2R5ZB 3M4OJ 3IH2A 4AC0A 4DYCA 3JRIA 3S1QJ 1LE8A 1JUSA 1MBEA 4MFDA 5EG0B 5GPAA 4JYKA 4XK4A 1OFCX 4M3EA 3BG9A 2LTPA 2TCTA 2LP0A 3BG5A 2H1KA 1NK3P 2K9NA 3JRDA 2DA1A 1SANA 2LK2A 5IP6A 3S1NJ 2DMQA 1LFUP 1T33A 3O8HA 3DEWA 1ORKA 2CJJA 2XRLA 3B6AA 5IYBJ 3H3VK 4HNVA 1ENHA 3NAUA 4W1UA 5E3MA 3GTMJ 1I3QJ 3HOZJ 4QTRA 3A01B 4EEFG 3IH3A 3MVPA 2IBDA 3HEFA 5J1RA 3TEDA 2VKEA 3GTJJ 3Q0WA 2ID6A 4DW6A 1HCRA 3BTJA 4L5EA 2XSDC 1PUFA 3QPSA 2NVXJ 1LFBA 3JRBA 2HXIA 3GTOJ 4XRMA
chains in the Genus database with same CATH superfamily
1SD7A 4A3LJ 1IN5A 4HNTA 3TDZC 2ZMEA 4N4NB 2X4HA 4U0YA 2NVTJ 2YX4A 2EBIA 2LKSA 2NVYJ 2GXGA 2V7FA 3GO5A 4Y13A 4XRSA 5E3LA 5EYRA 4B8XA 1BIAA 5GP9A 3PUFA 2E35A 2NS7A 1QA6A 3HOSA 3KLNA 1Z6RA 1X2NA 4CCKA 5ILUA 1UG0A 4OINF 3I56I 3HRUA 2Y9ZA 5EGOA 4EGZA 3I4PA 1H88C 2K7LA 3MKLA 1TWGJ 2JQ7A 1EV7A 2OPTA 5B66C 2CUEA 2ZJPF 2WB1N 3H5RA 1UG2A 3K4KA 4UHTA 4NB5A 4HX7A 5J8CA 3ASNH 2MH2A 2XHKA 4KITB 2W00A 3AL0C 3S14J 1GVJA 5HVQC 1B8IA 1RC9A 3M8EA 1TLHB 2A5YB 2O61A 1FOKA 2FU4A 1A04A 3WHBA 2QKLB 1VFCA 3H9QA 2ME0A 2F5CA 1VQ6I 3K1MA 3JRHA 1UELB 3QP6A 3MKYB 3C2BA 3A0HC 2BZTA 1FSEA 1R1TA 3SFZA 1A36A 3BG6A 1UZCA 3FM5A 2MLGA 2V79A 3S3OA 1DDNA 1V3FA 3BTIA 2Y75A 2JA7J 2R3SA 1DPUA 2VE8A 2EIKH 3Q0VA 1YJNI 5IPAA 1EA3A 1GV2A 1SVMA 3KCCA 1YG2A 2HS5A 3AG1H 3BCAA 4A6EA 2HR3A 5KNLA 1D1AA 1RETA 3F23A 1VQ8I 1KA8A 4Z2YA 2HDCA 3F0CA 2QM3A 2Y2ZA 1DP3A 1LE8B 3NARA 2JVHA 4F93B 1U0JA 1ZH5A 1JI8A 4XSXF 1WH7A 3I5UA 2MBFA 4MGRA 2IW5A 2DMPA 5BQTA 1Q1VA 1ZR4A 3CP2A 1I5ZA 2D1VA 3K70C 1X2MA 3ABUA 1ZREA 5CVIA 1FMWA 1J5YA 3SYTA 4KNYA 5LFAA 1QGPA 3F6VA 1Y56A 2KIUA 2XUBA 4EGYA 4B48A 1DGWY 1F43A 3R6SA 1BC7C 2KZVA 3OR2C 1BW6A 3FHNA 3K10A 1TWAJ 4HV6A 1WPKA 3DPTA 5K7FA 1WJ5A 5H6RA 5IOYA 4CXFA 2FJ1A 5DS9A 4IVNA 2XDVA 1EKEA 3PIPF 1YW7A 4BBSJ 4JX5A 1ETOA 2YSRA 2BHYA 2KRFA 4G8XA 3CCEI 3OYJA 1YYVA 2RREA 2ESNA 4X6AJ 5CVVA 4CYCB 4XKBA 1YRNA 2DA2A 1R36A 2OD5A 2FSWA 2O9LA 3MAJA 4MIMA 5IYCJ 4E7IA 4QIWN 3RCOA 2XGDA 3CCLI 3TW7A 4XQFA 3HL2A 3F8FA 4FTHA 1I27A 2OZ6A 1S6LA 4I98B 2ADUA 2JN6A 3V8KA 2HNHA 3U9GA 2GBYA 2PEXA 3LSPA 2EFOA 3M9AA 2QWWA 4BHPA 1YS6A 2EINH 2OF7A 4LITA 1E3PA 4LLLA 1KYZA 4DNCA 4G94A 1W36D 5J4YA 4BEHB 2GOMA 1K78B 1VQ4I 1ZRFA 3E6BA 4IHTA 2VQCA 4NUBA 1IGNA 1AOYA 4PZJA 1F1ZA 2XKOA 3MEXA 5D6FA 2O8KA 2DYSH 3ZQGA 3CUQA 3RKXA 3DP7A 5M5WJ 2HYFA 1K83J 1RRJA 1MJBA 3KZYA 4FE7A 2E36A 3SFIA 4HPQA 3PQKA 5J1YA 1SMTA 3G2BA 2J5OA 4IF4A 2D5VA 2AS5F 4NC6A 1BI3A 2LFBA 5LEJA 4A3BJ 2EPFA 2L4AA 1ZGAA 2EILH 4Y7NJ 2K9MA 3CQZJ 2LBFB 5E3OA 2FE3A 4XLFA 3ZMZA 2V9VA 1Y8QB 1XSDA 2ETHA 2PBIA 3GX4X 4EM0B 3H5NA 2CV0A 2WAQN 2A61A 5DEQA 4BXUA 2RVCA 3CLQA 1FTTA 2IXSA 2FOWA 2JZYA 5FGMA 3Q0UA 2CQQA 1YS7A 2EA4A 3PSIA 2IEKA 4UUTA 4V2GA 5IT9K 4M9XA 4AWXB 3K2ZA 4WCGA 5J4VA 2NNYA 5DV5A 4KMUX 2PJRB 3BPXA 3WTZA 2EV5A 3P7NA 4N4OB 1HSJA 1TWHJ 4LLNA 3U2RA 5LGNA 3RDIA 1GVDA 5DM6F 4M3BA 1FT9A 2HEOA 3IC7A 2R7ZJ 3BR1A 5LHGA 1AKHA 1MMSA 2GM4A 2L7KA 3VWBA 1BJAA 3S1RJ 1G3YA 3UNGC 3RYPA 5HNHA 5FD5A 3S17J 3RPUD 5GPCA 5DCFA 3D1NI 4D5FA 3H35A 4ZDOA 4E7LA 3QRFF 4O6JA 2I5UA 2DT5A 4BQNA 1VTNC 4I09A 3I55I 2R93J 2P8TA 2MG4A 2B63J 5CVJA 2QUFA 4XKCA 1VQLI 2HXOA 2F5FA 2VT3A 2B7EA 5CLSA 5AIPA 1X4OA 3HB9A 3G6EI 1GXPA 2HU9A 5HLIA 1T8IA 1PP7U 2KDOA 2NRAC 4BQOA 4HSTA 2FA5A 3Q5FA 2I8DA 4I02A 2BY2A 2M30A 4A0YA 2KIQA 4PUSA 1JGSA 1YI2I 2JSCA 1LUJB 2FBKA 2ZMEB 1XMXA 2E2IJ 1QBJA 3CMMA 3GUDA 2R0QC 2GXBA 3F21A 1SD5A 2KMUA 2HWVA 3M8FA 5F0HA 5DM7F 5J8FA 2UUZA 1QNTA 1R7JA 3C7JA 3CJQB 3N05A 2HDDA 3F8MA 1ONVA 2VBYA 3OYDA 5E8IA 3M7GA 1XCBA 4G9YA 3R60A 1SFEA 2ICWG 2M1BA 1A6IA 2XROA 1O4XA 1MSFC 2FQ3A 3LFUA 1S3JA 4A2UA 5EEAA 1JGGA 2E7WA 3HDDA 5ICEA 4S05A 2BW3B 2RQPA 4RLQA 5IOZA 1YQAA 4HQMA 2M0MA 1W7PA 2M8EA 3F8BA 2DQRA 3P9IA 1OPCA 3TO9A 4IHXA 4I01A 3F22A 2DK5A 3K2AA 3K4LA 3FXOA 1KU3A 2CWEA 3WG7H 5IT9Z 2L5QA 2AQFA 4FETA 1OYWA 2XAGA 1JXSA 2G9WA 2NOGA 2GA2A 4AYBA 3GBGA 4KN7X 3DKYA 3TOBA 1BOAA 4J00A 2Z1DA 2PMZA 2K9QA 3G1MA 3RKQA 5FLVA 2M7BA 3OYCA 2LF7A 2MW8A 1HF0A 1MNEA 3REOA 5ILVA 1YW8A 1IN7A 3VODA 2WC2A 3GW2A 4II3A 1D5YA 5HDKA 3V7RA 1H89C 2JSPA 3MWMA 3F8NA 3ABLH 4KISA 1XX5A 4ZYGA 1IRXA 3PNVA 4XLCA 4EV0A 1D3YA 2F6CA 1I1SA 1CF7A 3G73A 4XKVA 2V6CA 4LLGF 1MBKA 2J5PA 2JMWA 3ESWB 3PSFA 5DUKA 3PO3J 3JRFA 2WV0A 4GYGA 4PJNA 2UWMA 3J81K 1FWZA 1QQIA 3B02A 2YX7A 1BA5A 4EQQA 3CC2I 1R9TJ 3ECOA 3EUAA 3VDXA 2XF7A 2FEZA 3QYFA 1A6QA 1GT0C 3ZP5A 1ZHFA 2E60A 3P5JA 4A3GJ 5HS9A 2LVSA 3MN2A 2LRDA 1JE8A 2L9RA 2AXLA 3WE3A 3ERMA 3IH2A 3S1QJ 2VL8A 1EH8A 2QEXI 1LE8A 4RS8A 1ZRDA 1T6SA 5KAIC 3J7AY 2ZFUA 4RB1A 3WGHA 1MBEA 4BS9A 2FUG2 1HW2A 2OCCH 3A1YA 1XSVA 4M3EA 5L3GA 2BGCA 1YIOA 1FLIA 4F3QA 4MEYF 4BYYA 3JRDA 3ZQQA 1P9QC 1SANA 3KYLA 3KP5A 1FYLA 1T33A 1BIBA 2P7VB 3DEWA 2V6EA 1SC7A 3SEQA 1VZ0A 5GTHC 2PMHA 3IP4B 4XOTA 1E2XA 5IYBJ 4D1QA 1ENHA 3LSHA 3NAUA 2DK8A 2R7WA 3DPUA 1S8NA 1YX3A 4LMYA 5FROA 2OAZA 3LWFA 1WJEA 3HOZJ 2R7XA 1ZG3A 2O8XA 1STZA 4EEFG 3IH3A 1FSHA 4A12A 5E8GA 3HEFA 5J1RA 1K6OA 4UUVA 2O5RA 2XSJC 5K5OA 3GTJJ 5HDGA 4DW6A 1X1PA 3FXUA 1HCRA 4F52A 1IRGA 3ELKA 2XSDC 1RNLA 4D9JA 3LSIA 3QPSA 3TOAA 3T0YA 3KP6A 4HDVA 1QHHD 4A0ZA 4XRMA 2OBPA 1OKRA 4CCMA 2KP6A 4N9IA 3CCVI 2CW7A 3IAM2 4EJUA 3CZ6A 1XDUA 5J47A 3GCMA 5KHDA 1MH3A 1OR7C 2QBYB 3I71A 2XF5A 4HYEA 2HKOA 4IX7A 4GXOA 2NNNA 3BR6A 3QAHA 5H20A 4OIQF 4I0AA 3J7YJ 3S2HJ 2JA2A 2XV4S 2CQKA 4A3KJ 2XAHA 4WWCA 4ZYAA 2JWTA 2PI0A 1ACIA 4KMFA 3CUQB 3S93A 2AQEA 3DU6A 2JRMA 3CMAI 1JJ8C 2DYRH 1BI0A 3U1DA 4BKXA 1J09A 3K70D 3TDUC 4E7SA 2HYJA 5LHIA 4CZCA 2A05A 3BP8A 2VQGA 3LOCA 3TL4X 1J0RA 1R00A 2M8GX 3PUBA 3J81Z 1AA7A 1K78A 4QPOA 5B3SH 5F27A 5JLXA 4CHUA 5EZHA 5GAGJ 4B44A 5FKNA 5M5XJ 1Y1VJ 1KGSA 2CUFA 2JTVA 3QPTA 4AUXA 2TDXA 2YU3A 1XGSA 4UV9A 2CW0F 2EA2A 4QLCU 2XB5A 5FFZA 1OJLA 2F4MB 4RDUA 3DKXA 2WY7Q 3ZOBA 3SEZA 3FXJA 1R71A 2GQQA 4I2OA 2P4WA 3FMSA 3EQLF 2DBBA 4LIUA 2VT2A 2KDZA 2QQ8A 1N75A 3I59B 1PJRA 1FEXA 3H92A 4KICA 3CCUI 2LKXA 3OSFA 2XPWA 3K1PA 2X6OA 1FP1D 2RQQA 3FX3A 4J01A 3QOPA 1E0EA 4WF2A 4H4KC 3O6BB 1Y0UA 2H1LA 2K9SA 4FX4A 2E1MC 3EDPA 2VASA 1HDPA 1ETVA 2X85A 2PJRA 1FP2A 2IAIA 1O3QA 1VQPI 1JUMA 3KYDB 4ZH4F 3LL7A 5BPDA 1KU2A 4QSHA 1MH4A 4HF0A 2R7UA 1O3RA 4BJTA 3OOPA 2CH0A 5E18F 4F91B 2W1OA 2XKPA 1S7OA 3QODA 3BJOA 1IO2A 2Z9OA 1HSTA 1OMIA 1TWFJ 3LQRA 1MKMA 4AIHA 4C3HJ 3EUKL 3DTEA 1T39A 2MGQA 4AVPA 2LD5A 2LY1A 2E5NA 1SVLA 3TBIA 2JJ7A 1RESA 2O03A 4BY1J 5FFXA 4ENJA 2KZGA 4LOCA 4RM2A 1CQTA 2XPUA 2BVMA 1IZ1A 3FMRA 4XICA 4RB3C 1XB4A 2Z5UA 3ZMTA 2XAUA 1MNMC 2YR2A 3CMYA 5KCMA 3H1CA 2DPDA 1S29A 2VJ5A 4CZZA 3EUHA 3F9KA 4GYIA 1FOYA 2HDWA 2HVQA 3FKIJ 2IGOA 4I7HA 1MSEC 1OCPA 4A5MA 5K7ZA 5ICFA 2X6WA 2DA6A 5K7HA 3KEYA 3O2PE 5BNGA 1SD4A 2XC7A 1EH7A 2PN6A 1KQ8A 3MZYA 4NDLA 5LHHA 3OYKA 3FXRA 4WX9A 3E0JB 2O7OA 4IO9F 4M6YA 2CU7A 3HOYJ 2O0YA 1OYIA 2V1XA 4LGWA 3WHCA 3GTQJ 2H27A 2ECBA 1W7PB 4XMYA 2VODA 5KVRA 2BHZA 3LNQA 1I50J 3F6OA 4GFBA 3IAS2 3LA3A 2XF6A 2A6HF 4MEXF 2QSGX 2I10A 1WI3A 2EFPA 3DEEA 4BJ6C 2IVMA 2E2JJ 2XAFA 5IP7J 3BROA 3RPQA 4XN3A 3GF2A 5GAEJ 5F6FA 1FY7A 1G2HA 3ZGKA 3SDGA 3OS1A 2BW3A 1R4MB 3E97A 4KJZA 4S0HB 1P4XA 4D7MA 4E7ZA 3HXLA 3LAJA 4YIIA 1DP7P 1TZLA 2VBWA 2BY0A 1IC8A 4ZYHA 1B9MA 4E7HA 2FMLA 1T0FA 2NVQJ 2K02A 1GDTA 3J7AO 4N9HA 2VBXA 5M3MJ 2E71A 4PSXA 3CMEI 3QPLA 4BE1A 2UV1A 2O6GE 1MMAA 3CCYA 3FISA 4KIGA 3WU2C 1IF1A 1TW2A 2QQBA 3WTSC 4ESFA 3CD6I 1CF7B 1X3ZB 1H8AC 1QO0D 2K40A 4G6QA 3T8RA 1E3HA 4AM3A 2VQHA 1H9TA 1S9HA 3RKYA 4MHGA 1WRJA 3HTUA 3RSNA 3AKZA 2CV2A 4C2MJ 1Z3YA 3CUQC 2BV6A 3V7CA 1SD6A 4NQWB 1T56A 5E17F 5JVTA 4P1WA 3HJEA 1NK2P 3HRSA 2GA1A 3CDLA 2EJRA 4B3XA 4AIKA 2VI6A 3FXQA 2KT0A 3GMEA 2BBYA 4WXHA 4AIDA 2H09A 5LLQA 2ZCWA 1U78A 4H0EA 1WZ2A 1X1DA 2BXYA 1FIAA 4ENMA 3DF8A 3LFKA 1RUOA 5FB2A 2D2WA 4I99C 3C3WA 2BOLA 3CCRI 2HQRA 1QPIA 4CGZA 4Y52J 3IKVA 5DD8A 3KETA 2V26A 1ZLJA 2Y9YA 4PFOA 4YFKF 3FBIB 1Y39A 5E79C 3ROUA 2H8RA 4BH9A 2VE9A 2HZTA 5F1JA 5LBQA 4B43A 1UHSA 3PFIA 3IRQA 3BG3A 5F64A 3OYHA 2F5VA 1JJ6C 3EYIA 4EJTA 4Q48A 4M74A 3EETA 4UY8I 2NS8A 1BW5A 3HSFA 5FKOA 3A02A 5KK1A 1ULYA 1JHHA 3OYIA 4G7ZF 1IG7A 2V1UA 4UUSA 1U5TB 4PJMA 2E1NA 3JTHA 4RM3A 3DWLE 2IGNA 1R5ID 4HA8A 4HBLA 3KEOA 4L9JA 1ZRCA 1T08B 3ZPLA 1MIJA 4Y17A 2KQRA 3WU0A 2HOSA 3TO6A 3OIPA 5LGUA 1JKRC 2LC2A 2WBMA 2YUSA 1FYKA 2Q2EB 1N25A 1WJAA 2MC4A 2VJJA 4CICA 3I0TA 1G3SA 4U87A 2DJIA 2QSFX 4AYBN 2R7OA 2CO5A 2LG4A 3P9KA 5E1XA 5HLTA 3JAMZ 1T2KA 3ULQB 4HQEA 1U9OA 2NXNB 2DT7B 3NQOA 2PMZN 1Z91A 1VNDA 3CCSI 2P6SA 2JUCA 2DJNA 2YS9A 1VQ5I 3DTKA 3OYMA 4L9TA 2W84A 4BGDA 3H9GA 2L9NA 4NC7A 4CCNA 4D5CA 1VQ7I 4KA4A 4IOCF 1OCZH 2KFDA 2XGEA 2NOJB 2NVUB 1VQOI 4A3CJ 2DTRA 3FMQA 1MBHA 4FHTA 4RMNA 1JUPA 2QBYA 2CW8A 3GFJA 4JQFA 3HRTA 3WGGA 5ICCA 1RKTA 1FBQA 1IDYA 3E6MA 2JA8J 1NHAA 1BR2A 2E7XA 4E6KG 4Y15A 2EZHA 5TISC 3G71I 3V8LA 4HV5A 1QVTA 3OYFA 5FO5A 4OU0A 3BWGA 5CKTA 4S04A 3KP2A 1ON1A 3FDYA 3JSPA 2M2EA 2JK3A 4BBRJ 2KJBA 3SQNA 2DT6A 1PP8F 1L0OC 3BZ6A 4L9VA 5LRSA 1YJ9I 3JRGA 1NG6A 1RKWA 3HKZN 1WJFA 3KX2A 2GXAA 5FD6A 2BY1A 2W7NA 3NWSA 4PK4A 2JVGA 3X2QH 5D8LB 4G7HF 1VQ9I 3GTPJ 4HG2A 1G3TA 3T1BA 1BI1A 2Z99A 3K4BA 3KZIC 3WTUC 3DKWA 2B9SA 1UJ8A 4Q5SF 1SFKA 3RQIA 1J2XA 2HQ5A 5IY5H 1UCRA 1S7EA 1LNWA 3T5XA 3ERED 1YE9A 2DA7A 2LNBA 5H2FC 3L2UA 1U8BA 1X4PA 2V1NA 4II2A 3HSRA 1J75A 4F92B 1FMVA 1JT6A 1BR4A 3I59A 5F08A 4ZTJA 2TRTA 3FIWA 4EVIA 2Y0SA 1X58A 2GAUA 3PJRA 1WKMA 3I64A 2Z2SB 3JSOA 2IGMA 3FK6A 4EM1A 3FZVA 3VYUB 3B6CA 1Y0NA 1YLFA 4B09A 1JTYA 5D5UB 4YRVA 1FOXA 3IL2A 4C3JJ 2WA0A 1XCVA 1PUEE 3S3MA 1V54H 4NC8A 1QRYA 4EJOA 3ZN0A 4L18B 2R5ZB 1LEAA 4DYCA 3JRIA 3ABKH 4UVAA 4MFDA 1K79A 2VJIA 5GPAA 3SDBA 1OFCX 3S3NA 3BG9A 2TCTA 2H1KA 2K9NA 3C1DA 5GAHJ 5HS7A 3RJPA 4XBFA 3HTSB 2CFXA 3FM3A 5AONA 1LFUP 1G4DA 2CUZA 2FNAA 2ZXHA 3BZCA 4HLXA 2CJJA 2XRLA 3QWLA 3H5AA 2A6TA 5L3EA 2DQLA 3ZXSA 4W1UA 2K27A 5K5RA 4PJLA 2DODA 1O7FA 4M9ZA 1VQKI 3A01B 2IJLA 2P5VA 3MVPA 3TEDA 1D8JA 2ID6A 3J7ZI 3SZTA 1F5TA 1Y8RB 5EEHA 4PFPA 1LFBA 2HXIA 3L2VA 3BLYA 3ML6A 4OIRF 3HYIA 3WG9A 2VN2A 4P9UA 2ZC2A 4DJAA 3IRRA 2HOEA 4LK1F 1JT0A 2MH9A 3GTLJ 4D7NA 3SHFA 1EH6A 3HOXJ 3IWZA 4C3IJ 4ESJA 3DCFA 4HRIA 1TL8A 3I4NJ 3CF2A 5HLHA 1OISA 2H6BA 2NS0A 2XPVA 4M6VA 1EJ9A 4K2EA 1SMYF 3BPVA 4AVZA 2VKHA 3RI4A 2P6TA 4UB8C 3IV5A 1YW9A 1RR7A 1I39A 2OQRA 3HUGA 5JVGF 3H3ZA 3LQQA 3TMOA 2L3DA 2H8WA 4OIPF 1ZN2A 3K4MA 4QWQA 3DU5A 2ZJRF 3LAPA 2X0LA 3HGYA 3QP5A 3PFYA 2DLLA 3S15J 1DPRA 3ZQCA 2HVRA 3V7SA 2M4GA 4R1HA 2UXXA 4EATA 3A2KA 1WJCA 2OJED 2M0CA 5IP9J 3R0AA 3PL8A 1VQNI 2LREA 2F2EA 2WAEA 3G4SI 4XLAA 2DXIA 2QVOA 2DFIA 1J7KA 3R61A 1HW5A 3K69A 1JTXA 2VPLA 1P6RA 1TW3A 4MLOA 3SZGA 1FC3A 1W1WE 1D5VA 5L3FA 3OYEA 1LJ9A 3PIOF 3FBNB 4O5VA 4KIFA 1D0YA 1XGNA 4A6DA 4ZTFA 3D5LA 4NQWA 3W2AA 4V2FA 2IPQX 2VPRA 2W4SA 4U7BA 1HDDC 1HKSA 4DZJA 1U8RA 3F8CA 4C2TA 1QZYA 2XAJA 2E2HJ 1MDMA 3RIRA 3TGNA 3HM5A 2IA2A 2JPBA 3M8JA 2JA6J 1YITI 5ED4A 3HKZA 3O8GA 5FKMA 1W5CC 2AHQA 4BL0B 1MD0A 1SAXA 1JKOC 2VOPA 2LH9A 4U7DA 4KUMA 4WK8F 4UVCA 4UUSB 1BOBA 5F0CA 1IW7F 4XONA 4XN0A 3CC4I 1B59A 2FD5A 2K85A 2K9LA 2W25A 3I54A 5CQEA 3B73A 3ZR8X 2ZJQF 5FKKA 5DDGA 1C0WA 1WWXA 1UAAA 2B0LA 2ELJA 3FXKA 5F1RA 3KZZA 2PX9A 5DTDA 2KL4A 4HX8A 3OYGA 2FRHA 2L9SA 4OOIA 1MZBA 5F0FA 3HBLA 2Y0MA 4XR6A 1Z9CA 1K4TA 2ISZA 2LY2A 4R8HA 5J1UA 2P7CB 1KU9A 1Z21A 3ECHA 1FPQA 2MD5A 2V9KA 3K9TA 4IKFA 4L9NA 2R7SA 3BTCA 1U9NA 1BC8C 1U5TA 3AG3H 4DYRA 1CGPA 2HVSA 1WFXA 4LJZF 1SFUA 2NYXA 1LVKA 2X48A 3L2RA 2F4OB 1WQ2A 1R58A 3DEUA 1OCCH 3GZ6A 2CV1A 3H3UA 4FE4A 1TBXA 4C2UA 4ANJA 4AIJA 4IRIA 2H94A 3JTGA 2UZKA 2Q2EA 4EJWA 2QQAA 5JHUA 1D0XA 4ESBA 1YHQI 1QZEA 4XL9A 2OU2A 4A3JJ 4O3MA 1MGTA 4YFXF 3W6VA 4MQ9F 2QGUA 3AL0B 2QYOA 2JRTA 3E6DA 5EEGA 4FCYA 1BN5A 3HOTA 4ITVA 5L3BA 3EUHC 3BJ6A 2AXTC 3BR3A 4MFEA 4QPQA 3ZQ7A 4HX4A 2NAZA 2EFQA 3H0DA 3J80K 2VOOA 1HW1A 2FQ4A 1GLNA 4P5OA 1V4RA 4PDKA 2IS1A 2Z16A 1ERDA 3QPHA 1IJWC 2R7FA 2ZMEC 3C18A 2XB0X 1Z05A 4LIVA 4D0PA 5D5VB 5CVRA 3JRAA 2ESHA 1UHWA 3VYTB 3PNYA 4M3FA 2RC4A 3LA7A 2P81A 1AWCA 2JA5J 3HIFA 1TNSA 3GLXA 4JP0A 1XSXA 2UXNA 4BACA 3N97A 1N77A 2M4KA 4C9YA 1RR8C 2EFWA 5F04A 2MC3A 1H0MA 2L7FP 1WI9A 5IYDJ 3E5QA 2IA1A 4ZC3A 2BY3A 4RB0A 2VIXA 3VPRA 2QA4I 1MBFA 3VOEA 4DBRA 3DLLF 2P0WA 4DZPA 1W4MA 3C2HA 4MQVA 1KZHA 4Q47A 1DU6A 2XGCA 2DCEA 3W2VA 2OZUA 1T0FC 3CUOA 3BR5A 2DN0A 3BQYA 2FBIA 2KISA 4I0BA 4JBAA 5B5EC 3GXOA 3DLAA 4BJ5C 2DMNA 2GOXB 3BOQA 4B47A 4DQ2A 2XASA 1GXQA 1W0TA 5TJJA 3ASOH 3LSMA 1IUFA 2DI3A 4M73A 1W5TA 2EH3A 1K6YA 1LDKB 2Y31A 4LK0F 2ELHA 2H6CA 4L5IA 4W97A 5EDNA 2K86A 3WTXC 2KIMA 2HQNA 1BI2A 4GGGA 3SZPA 1XMAA 3TP3A 2RNGA 3MQ0A 4RBOA 4CSWA 3LMMA 4BNCA 4PCQA 4Z6YA 1BM9A 6PAXA 3S2DJ 3HC7A 2ZNYA 4YEJA 4UB6C 1TP4A 1Z77A 4GDFA 2M87A 3UKGA 3DXJF 1XG1A 2MD0A 4HF1A 2EIMH 2F48A 1Z7UA 3F72A 3OMYA 2HOAA 1XS9A 4N0BA 2CQXA 3DPLC 1YIJI 1OLTA 3JW4A 2R92J 1IN6A 4OAYA 5GADJ 3BZKA 1E3OC 2R5ZA 1QPMA 1LDDA 3CC7I 3HZJA 3I53A 1W5SA 3HOUJ 5M3FJ 3HSEA 1P7IA 4F7ZA 1U3EM 4KT5C 3DV8A 3M1EA 5M5YJ 4A3EJ 1B4AA 5FRNA 3J80Z 2EZIA 5C3EJ 1W7PD 1I6XA 3CDIA 5DYMA 1JKPC 4YELA 2EB7A 2W48A 2Y69H 1HKTA 2ZSHB 4UNOA 1SVOA 3PO2J 2KRHA 2CQNA 1GUUA 3ZMUA 2IA0A 4OMZA 3JRCA 2DFEA 2JT1A 4IHSA 3FWEA 1NG7A 5C44J 5EJCA 2KKOA 4YIRX 3L2QA 2FBHA 5D6EA 2E19A 5L3DA 5K1YA 2IT0A 4B3AA 2HI3A 4RGRA 1T38A 2JPCA 4YIFA 3A01A 3HRMA 4FQGA 4A5NA 5TRDA 2W82A 2CUJA 5ERIA 3S2WA 3OSGA 1X3UA 1R1VA 4ENKA 2X1CA 1IXCA 3RPUA 2KJCA 1TWCJ 3E5UA 5D4RA 4ZDPA 1IV8A 2L7ZA 1JHFA 3ZQLA 2X9DA 4RAYA 2BXZA 5EF6A 5CPRB 2LOOA 3HUGB 2R4GA 5B1AH 1E17A 1R6RA 3L1PA 3H36A 3KPHA 3ZQIA 2L7MP 4B4CA 5L3CA 4I76A 3I3LA 3K4JA 4M72A 3WTVC 1R49A 3I9V2 1A5JA 3NWTA 4L5JA 1VQMI 1YX5A 1POGA 2CQ7A 1IV6A 1WH5A 4ZYEA 3JAMK 3KLOA 4ZZDA 5LRRA 1O57A 2ZKZA 5B1BH 1R5HA 3I58A 3DQVC 4M9SA 2Y0SN 2WWYA 4ZDLA 4PSWA 1OCRH 1G59A 3MZHA 2CG4A 4KFCA 4CDGA 4L0YB 2L01A 3RZOJ 2Q1ZB 2X6YA 1T98A 2DMUA 4B1RA 4DOZA 2ZXIA 3R4KA 5FJ8J 3D5SC 3DBHB 4IQ4A 2DA3A 4I6ZA 1Z0XA 4EM2A 2VBZA 2VB6A 2ZB9A 4XKWA 2F5EA 2OQGA 3OIOA 1X1BA 3Q9SA 2BVLA 3DBLB 4AU7A 3HPHA 3BCBA 1USTA 5C4JJ 1MDMB 2K3FA 3CJNA 3OL4A 3VFZA 2R5YA 4OAZA 5DD4A 4HNUA 2LLKA 4BUPA 2EZKA 1KQ0A 2L02A 2L9VA 2DA4A 4XLNF 4UXNA 3NRVA 4BE0A 1YOVB 4HDUA 1SEUA 3OWTA 1S5LC 2G0EA 5LGTA 2L4MA 4XRFA 3KIOA 2ACJA 4KIBA 2BEOA 3FKJA 3W6JB 3CLOA 5DCMB 1QVUA 3ZQFA 1NH3A 3FF5A 3C2GA 2M45A 1FTZA 2HGCA 5FLXK 4DYQA 5BMZA 2V4JC 2RKHA 1Y1WJ 3QU3A 3M4OJ 1TQPA 4U88A 2OV7A 2JUGA 4KDPA 1LKXA 4U0WA 2CMPA 1X1AA 3OL3A 2VJ4A 3WODF 3D0SA 2LTPA 4DGWB 3KP3A 4F55A 2LKPA 2HZDA 2DMQA 3O8HA 3KE2A 4MTDA 2OCEA 1MMDA 3GLLA 4G7OF 2A68F 2F5DA 3A4CA 1MNDA 3H3VK 2OUMA 2DFHA 1UB9A 1SAUA 3QYBA 5HLGA 3EPZA 5E3MA 3GTMJ 1V5EA 5CJ9A 2DPUA 1I3QJ 2CSOA 2YPRA 4IL6C 3S8PA 4QTRA 1YO5C 3CJRB 2IBDA 2DFFA 2XIGA 4IRHA 1QU3A 3WTTC 1MW7A 2VXDA 4IPAA 3BTJA 4L5EA 1UFMA 3JRBA 4KN4X 2QSHX 3GTOJ 3QYEA 3AAFA 3CESA 1LVAA 2X1DA 2Y48A 3ZN1A 1NTCA 4IXAA 2LMDA 1BL0A 1ZTRA 3F3XA 4A69C 1ZELA 2LR8A 1OCTC 4LD5A 4AD9A 2IS4A 2LDUA 2HYGD 3IH4A 2IS6A 2ZFWA 4MO7A 1IAWA 3GZ5A 2O3FA 5ICGA 4IOAF 9ANTA 2LF8A 2PJPA 2WTEA 2E1OA 1ZKGA 3ZRGA 3H0GJ 3LA2A 5CQGA 2R7QA 4HAMA 5HOOA 1K4SA 4BQAA 2Z33A 2FOKA 1ZK8A 3S16J 3M07A 1UHMA 1LFPA 2PG4A 3DFGA 2E34A 1IN4A 4G6DA 1TQIA 4ASNA 5E1ZB 3GTKJ 2DOAA 2ZO4A 1ZARA 1FYMA 2E5ZA 3E7LA 3L09A 3A0BC 2Q8KA 1TNTA 2K3PA 2K4BA 1WHUA 3TW6A 4XNFA 2G7UA 3VEPA 2M34A 3L7WA 3LSTA 4A3MJ 1XTAA 2RDPA 2C6YA 1FNNA 2M9HA 1DU0A 4IJAA 1Q1HA 2WADA 2HKXA 5FLXZ 3PNTA 1XN7A 2W85A 3CO6C 3U21A 3FK7A 2N8GA 1TQMA 3RQ4A 3Q3SA 2EZLA 3HGGA 4UVBA 3R0JA 3KFWX 5HODA 4XSZF 2Y30A 4XRSG 1R1UA 3IUOA 1QHGA 1B72B 2R7RA 4CO8A 3OYBA 1IN8A 3CTAA 3K1NA 4FT8A 5JR3A 4MTEA 2P5LC 3RKWA 3ZQHA 2V9PA 1RZ4A 4Q4ZF 1FOWA 2CYYA 1OYYA 5K5QA 5HS8A 4E70A 1S7AA 2WB1A 3H9JA 5JLWA 2OA4A 1IDZA 1U2WA 1GHCA 4U0VA 4PGHA 2IS2A 1FBSA 4HZFA 4CCOA 4Y3OA 2DTZA 4X0GA 4FX0A 5GTIC 5BS6A 2HPIA 3LSJA 2VC1A 4Y4RA 3WTYC 2MA3A 1FBUA 5CVUA 2L2OA 1BJZA 4J19A 5A2QK 3DTIA 3RTRA 3K0LA 5FRMA 2OC6A 2STTA 4GRIA 4M3GA 4A3FJ 2ZJ2A 3HG9A 4BDZA 5J3LA 1XMKA 2XGXA 3BTLA 4LG0B 2A07F 1J9IA 2XVCA 3K6GA 4RLFA 5ILSA 4M3DA 4P55A 1XC5A 4NBQA 4E7JA 4LFUA 2YU9J 2LYCA 1MMGA 4A0XA 1AU7A 2CRGA 5DUIA 1F4KA 4HSRA 1IXRC 4CCLA 2VKVA 2QZ8A 3A03A 4NNJA 4EJVA 3L2WA 1G8XA 1R5GA 4BE2A 5EG0A 3S1MJ 4XORA 2DDBA 1MBGA 3MKZA 3DBRB 1LEBA 1EF4A 2W24A 3K7AJ 4IHYA 3TP0A 1HOMA 4IRGA 1RIOH 1PUFB 2M7AA 5BOXA 2HOTA 1M1EB 1X1CA 4ETSA 5FLMJ 2QENA 3HHHA 1HKQA 1HBXG 1LQ1A 3HOVJ 2COMA 2IGKA 3PQJA 4HEA2 3MKWB 2RAEA 3CCMI 4CYDA 4E4HA 5E20A 4BU2A 3RZDJ 2HTJA 3S32A 1Z1DA 4JX6A 3SXYA 3KEQA 2VXZA 2X51A 3OYLA 5LD2C 1ZGWA 2ECCA 3HOWJ 3G1LA 1RUNA 3IWFA 2A69F 1LB2A 1U5TC 3PM1A 2IP2A 4YG2F 2P5KA 4PGGA 4XM3A 1TTYA 5AIQA 3CJTB 3SJMA 1JKQC 2VONA 1I6HJ 2GWRA 3QOEA 2VUMJ 1ETKA 1D1BA 1SFOJ 5EGOB 3W3CA 3BQZA 1RPWA 2M5WA 1KU7A 1MMNA 4GO1A 4A3DJ 4V19K 2RGVA 3OV8A 3GYHX 1XPXA 3KYCB 3JREA 1Z7LA 1F9NA 3KP4A 3G3ZA 4LG3A 2EQRA 2VLAA 1ZG5A 1LDJA 2ID3A 4BY7J 4DBQA 2DDAA 2XAQA 4X1EA 2PFBA 1REPC 1APLC 5HDNA 2MABA 3BC8A 1Z6TA 5KAFC 1B8IB 2L0KA 1ZAOA 3L9FA 4WXCA 1A35A 2HTSA 2OTLI 4HF2A 3OYNA 3L00A 1WSUA 2HPMA 1X19A 1ZLKA 2STWA 2X6XA 1KONA 4GCVA 1HA8A 4BXXJ 1ON2A 2QKMB 1PYVA 5J40A 2A6EF 5TGTA 1B1BA 1DQUA 1L3LA 2DOEA 2IRFG 4Y33A 4P9FA 2F4IA 4IHVA 2E1MB 4XOPA 1F36A 2R5YB 5A2QZ 2ZNZA 1ZG1A 3V8JA 4HW0A 4RA2A 2K5CA 3VYRB 3BR0A 3E3VA 1GV5A 3ABMH 1B9NA 3AG4H 3OOUA 1UMQA 1XGMA 2FXAA 2KIFA 3FXMA 1G3WA 1P92A 4XLPF 5EZGA 5H6QA 1ITYA 2COBA 3JCUC 3LSKA 1BR1A 2K4JA 3CF5F 3IHUA 4IQJA 3HPGA 2GLOA 2HQAA 1G6NA 2KLOA 2QF7A 3WGIA 1P4WA 1P4AA 2EFNA 3LSRA 5D5WB 3VSKA 3BY6A 3NEUA 2RV8A 2EK5A 1ETXA 3BDDA 2ME6A 5C4XJ 4A3IJ 3ZMVA 3TO7A 2FF4A 1ETWA 4BXFA 2ELKA 1P7JA 1RI7A 1OCOH 3MFKA 1FJLA 1P2FA 5E1WA 2GIZA 3ZMDA 1ZQ3P 2VQLA 5JFRA 3MZ8A 5DCMA 4FASD 4R79A 3GTGJ 3BR2A 2PQ8A 5E3NA 4FISA 3D5RC 1W36C 2LY9A 1O3SA 1V5GA 4E7KA 2R7VA 3VSLA 4ENNA 1SFXA 1ODDA 2DMTA 2WAQA 2GIVA 1WVRA 4BAYA 4OWRB 2A5WA 1WJDA 1MJ9A 1OQYA 3BG7A 2QCOA 1HC8A 2M3AA 1ETYA 2MLKA 5FKLA 1MBJA 4KT6A 1PVEA 3CP8A 3AG2H 3KP7A 4XLEA 1R22A 2OTJI 1ZYRF 4DIQA 4RAGA 3M1CA 1K61A 1VI0A 4M6XA 3WE2A 4IEJA 4WXDA 4ZYDA 3COAC 4IHWA 1FIPA 2XRNA 4CCJA 1IUYA 3MCZA 4P96A 4M71A 1ZGJA 2FMYA 1YRNB 2X1EA 3K4CA 1IRFA 1ZR2A 1J59A 3FXLA 3W2WA 4EMSA 3GFMA 3K4NA 3QQAA 5BPIA 1KQ9A 3E1SA 2MFZA 4ZZLA 3MMYB 1IRZA 1O7LA 1V5FA 3JR9A 1WGXA 4XLHA 3CO7C 3WU1B 3OY9A 1W0UA 5HNFA 3CDHA 3O3KA 2D1HA 3TQNA 1XDSA 3OR1C 4G6TB 4HLYA 1IXSB 3ZCOA 4XIDA 2DO7A 2KHMA 1S72I 2WV1A 3EYYA 4LB5A 2KRCA 4A93J 4ON0A 2WAFA 4RGSA 4CYCA 1D1CA 1N78A 3U1KA 1WCMJ 2CS3A 1MJAA 2FX0A 1XGOA 2EV0A 1X3WB 3GZNB 1YJWI 1D0ZA 2VKDA 2PLYA 4JX4A 4BQQA 3GFIA 4RB2C 2EIJH 3FHZA 4L0ZB 2Q0OA 4HOBA 1V55H 1Z3XA 1YTYA 2V1DA 1TT5B 3OS0A 1LPQA 4ABZA 1ETQA 3BT9A 3VYSB 1VF9A 4IZZA 3W6KB 1I1GA 1TT0A 2GZWA 3VB2A 1HLVA 4BEHA 3E6CC 4OMYA 3ABTA 3WTWC 3HHGA 1R4NB 5JI6A 5D8KB 3CCJI 2RN7A 4PJJA 2A3SA 1A31A 3G1OA 2CFOA 3T8TA 2Z3YA 4G12A 3P9CA 2VC0A 1DGRM 4OIOF 5LEKA 1D8KA 3Q9VA 2MSYA 4TV7A 5CYVA 3IKTA 2AO9A 1I3AA 3V42A 3GWZA 1USSA 2EWNA 5J6XA 2DA5A 2LSOA 4C30A 3MD2A 2WY8Q 2ISYA 3ONQA 1R23A 3V4GA 3ZMSA 1XD7A 4NHJA 1B72A 2QQ9A 1U6GA 3N4MA 4JOMA 1AHDP 2LBFA 1PDNC 5JHFA 5IT3A 3LSGA 3GEZA 3L2CA 1AKHB 1KYWA 3OS2A 2KPMA 1K7AA 3M3YJ 3OYAA 1WJBA 1TC3C 2ZSIB 2DU9A 1YFHA 1O3TA 3I4MJ 1QZZA 3ISPA 1H9GA 1HQCA 2BE5F 2L54A 5D4SA 2PMUA 3BJAA 1BBYA 1Z67A 4AC0A 4BHCA 2W57A 1JUSA 2DOFA 2ZXWH 5EG0B 4CUGA 4JYKA 4XK4A 2R7DA 2LP0A 3BG5A 4UV8A 2ZBKA 1NK3P 1Y6IA 1B6AA 4CH7A 2EV6A 4MNUA 2DA1A 4PJ0C 3CCQI 2LK2A 3UR3C 3QU6A 5IP6A 3E5XA 3S1NJ 2G7HA 1T95A 4ZJZA 4LG0A 1FX7A 1FZPB 1ORKA 2R7TA 4RGXA 2ZXJA 2D45A 4JK1X 3B6AA 2E1CA 4HNVA 2QLZA 2DW4A 2HFHA 2FNPA 2CGPA 4BDYA 4RGUA 1DUXC 3TKYA 4RAZA 4LB6B 1OR7A 3RYRA 3OIQA 2MYSA 3AFHA 4BHBA 4YFNF 2VKEA 2BYVE 3Q0WA 4CA0A 1PUFA 2NVXJ 4KYWA 4RAFA 3GFLA 2RNJA 2DAOA 5D5XB 1HXDA 3GVAA
chains in the Genus database with same CATH topology
4A3LJ 1NTCA 1BL0A 1ZTRA 4A69C 1JT0A 2NVTJ 3GTLJ 2EBIA 4D7NA 2NVYJ 4XRSA 3HOXJ 2LR8A 4C3IJ 1OCTC 3DCFA 1MH3A 5E3LA 5EYRA 3I4NJ 3IH4A 4MO7A 3BR6A 5GP9A 2XPVA 3S2HJ 9ANTA 4A3KJ 4M6VA 2NS7A 2JWTA 1X2NA 2E1OA 1ZKGA 3H0GJ 2Y9ZA 1JJ8C 5EGOA 4BKXA 1ZK8A 3MKLA 1H88C 1TWGJ 3S16J 2HYJA 3IV5A 2OPTA 1RR7A 2CUEA 3GTKJ 3LOCA 3E7LA 2WB1N 1UG2A 2M8GX 3TW6A 3S14J 2M34A 5F27A 5JLXA 4A3MJ 5EZHA 1B8IA 2M9HA 3HGYA 1DU0A 3S15J 3ZQCA 5FKNA 3WHBA 5M5XJ 1Y1VJ 2CUFA 4AUXA 1VFCA 2ME0A 3FK7A 3JRHA 2N8GA 3Q3SA 2XB5A 2M0CA 5IP9J 2EZLA 3C2BA 3HGGA 1OJLA 4RDUA 5HODA 2Y30A 3ZOBA 4XRSG 1B72B 3BTIA 1JTXA 2JA7J 4MLOA 3Q0VA 2KDZA 3ZQHA 5IPAA 1FEXA 1GV2A 2LKXA 3OSFA 2XPWA 1RETA 4V2FA 2VPRA 2X6OA 5JLWA 1IDZA 1HDDC 4DZJA 2DTZA 2E2HJ 2K9SA 3F0CA 3LSJA 1HDPA 1ETVA 2Y2ZA 1LE8B 3HM5A 2IAIA 3NARA 1JUMA 2JA6J 1WH7A 3O8GA 4QSHA 1MH4A 5FKMA 2AHQA 2DMPA 1JKOC 1Q1VA 1BJZA 4J19A 1ZR4A 4UUSB 5F0CA 4M3GA 4A3FJ 1TWFJ 4C3HJ 5J3LA 1X2MA 2MGQA 3BTLA 2FD5A 2LD5A 4M3DA 2JJ7A 5FKKA 1RESA 1XC5A 2YU9J 1AU7A 4BY1J 5DTDA 2CRGA 4LOCA 1CQTA 2XPUA 5F0FA 2VKVA 3HBLA 3A03A 4XICA 5J1UA 5EG0A 3S1MJ 1F43A 1MBGA 1EF4A 3K7AJ 1MNMC 4IHYA 3CMYA 1BW6A 3BTCA 1U9NA 1TWAJ 3TP0A 4DYRA 1WPKA 1HOMA 2X48A 3FKIJ 5K7FA 1PUFB 2HOTA 1MSEC 1OCPA 4FE4A 5K7ZA 5FLMJ 5IOYA 2DA6A 5K7HA 5BNGA 2FJ1A 5DS9A 3HOVJ 4BBSJ 4JX5A 2RAEA 1ETOA 4NDLA 3RZDJ 2O7OA 3HOYJ 2CU7A 4A3JJ 3WHCA 4JX6A 3GTQJ 4X6AJ 4CYCB 2ECBA 1YRNA 3W6VA 2DA2A 1ZGWA 2O9LA 2ECCA 4MIMA 5IYCJ 3G1LA 3LNQA 1I50J 4GFBA 3HOWJ 4QIWN 4FCYA 3PM1A 2XGDA 3SJMA 1JKQC 1I6HJ 3BR3A 4MFEA 2I10A 1WI3A 3TW7A 2VUMJ 1ETKA 2E2JJ 5IP7J 2FQ4A 1SFOJ 4FTHA 5EGOB 3BQZA 1RPWA 4A3DJ 2JN6A 1G2HA 1IJWC 2GBYA 3SDGA 3LSPA 2XB0X 3JREA 2OF7A 2EQRA 3JRAA 4S0HB 4D7MA 2ID3A 4BY7J 4M3FA 4X1EA 1APLC 1IGNA 1IC8A 2P81A 1B8IB 2L0KA 2JA5J 2NVQJ 1GDTA 5M3MJ 4JP0A 3ZQGA 2O8KA 3QPLA 5M5WJ 4BXXJ 5F04A 1K83J 3CCYA 3FISA 2L7FP 5IYDJ 3SFIA 4FE7A 5J1YA 3VPRA 1H8AC 4IHVA 2K40A 1F36A 2R5YB 2D5VA 1MBFA 2LFBA 4A3BJ 4Y7NJ 4DZPA 3CQZJ 5E3OA 3BR0A 1DU6A 1GV5A 2XGCA 3OOUA 3BR5A 1UMQA 2DN0A 3BQYA 2WAQN 4C2MJ 1FTTA 2DMNA 5EZGA 1T56A 1ITYA 3Q0UA 2COBA 2CQQA 1W0TA 4UUTA 2IEKA 4V2GA 1NK2P 1IUFA 2GLOA 3CDLA 2EH3A 2Y31A 2VI6A 2KT0A 4W97A 5EDNA 2QF7A 1U78A 1FIAA 3LSRA 1TWHJ 3TP3A 4RBOA 1GVDA 4M3BA 1ETXA 3S2DJ 2ME6A 2R7ZJ 1QPIA 5C4XJ 3BR1A 4A3IJ 4Y52J 1Z77A 1AKHA 2GM4A 1ETWA 2ELKA 1P7JA 2Y9YA 3UKGA 1XG1A 3S1RJ 1FJLA 2H8RA 5F1JA 3S17J 1UHSA 1ZQ3P 2HOAA 1XS9A 3BG3A 2CQXA 5GPCA 3D1NI 3GTGJ 1JJ6C 4D5FA 3BR2A 5E3NA 2R92J 4FISA 2LY9A 1E3OC 2R5ZA 1BW5A 2NS8A 2DMTA 3HOUJ 5M3FJ 2R93J 1P7IA 5FKOA 2MG4A 2B63J 5M5YJ 3A02A 4A3EJ 2EZIA 5C3EJ 1IG7A 4UUSA 2HXOA 1JKPC 2QCOA 2W48A 3HB9A 5FKLA 1ETYA 1MBJA 3PO2J 1GUUA 2HOSA 3JRCA 1JKRC 5C44J 2YUSA 1K61A 1VI0A 4IEJA 4IHWA 2E2IJ 1FIPA 2E19A 2R0QC 4AYBN 4B3AA 5F0HA 2HI3A 1YRNB 2HDDA 1U9OA 1ZR2A 3A01A 3QQAA 2PMZN 1VNDA 1IRZA 1O4XA 1A6IA 1MSFC 3JR9A 1WGXA 3OSGA 2DJNA 2YS9A 1W0UA 1TWCJ 5EEAA 4D5CA 1JGGA 2L7ZA 3HDDA 3ZQLA 2X9DA 2XGEA 4XIDA 5EF6A 2WV1A 4A3CJ 5IOZA 3L1PA 4A93J 3ZQIA 2L7MP 4B4CA 1MBHA 4CYCA 1JUPA 4I76A 4IHXA 1A5JA 1WCMJ 1RKTA 2FX0A 3K2AA 1IDYA 1POGA 1IV6A 1WH5A 4JX4A 2JA8J 2NOGA 3GBGA 2Y0SN 2EZHA 4ABZA 1ETQA 3BT9A 1VF9A 1QVTA 2K9QA 1HLVA 3G1MA 3RKQA 5FLVA 3RZOJ 1HF0A 2MW8A 2DMUA 4B1RA 5FJ8J 2M2EA 2JK3A 4BBRJ 1D5YA 2DA3A 3G1OA 1Z0XA 4I6ZA 1H89C 3JRGA 3HKZN 1RKWA 2ZB9A 4G12A 3GTPJ 3OIOA 2MSYA 2AO9A 3RQIA 2DA5A 5C4JJ 2HQ5A 2R5YA 1MBKA 2JMWA 2LLKA 1S7EA 2EZKA 3PO3J 1B72A 3JRFA 1AHDP 2DA7A 1U8BA 2DA4A 3LSGA 1JT6A 1AKHB 1BA5A 5F08A 2G0EA 2TRTA 3FIWA 1X58A 3M3YJ 1R9TJ 1TC3C 3FK6A 3B6CA 1GT0C 1JTYA 3I4MJ 1QVUA 3ZQFA 4C3JJ 4A3GJ 2LVSA 3MN2A 1FTZA 4DYQA 1QRYA 2L9RA 1Y1WJ 2R5ZB 3M4OJ 3IH2A 4AC0A 4DYCA 3JRIA 3S1QJ 1LE8A 1JUSA 1MBEA 4MFDA 5EG0B 5GPAA 4JYKA 4XK4A 1OFCX 4M3EA 3BG9A 2LTPA 2TCTA 2LP0A 3BG5A 2H1KA 1NK3P 2K9NA 3JRDA 2DA1A 1SANA 2LK2A 5IP6A 3S1NJ 2DMQA 1LFUP 1T33A 3O8HA 3DEWA 1ORKA 2CJJA 2XRLA 3B6AA 5IYBJ 3H3VK 4HNVA 1ENHA 3NAUA 4W1UA 5E3MA 3GTMJ 1I3QJ 3HOZJ 4QTRA 3A01B 4EEFG 3IH3A 3MVPA 2IBDA 3HEFA 5J1RA 3TEDA 2VKEA 3GTJJ 3Q0WA 2ID6A 4DW6A 1HCRA 3BTJA 4L5EA 2XSDC 1PUFA 3QPSA 2NVXJ 1LFBA 3JRBA 2HXIA 3GTOJ 4XRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L J;  1NTC A;  1BL0 A;  1ZTR A;  4A69 C;  1JT0 A;  2NVT J;  3GTL J;  2EBI A;  4D7N A;  2NVY J;  4XRS A;  3HOX J;  2LR8 A;  4C3I J;  1OCT C;  3DCF A;  1MH3 A;  5E3L A;  5EYR A;  3I4N J;  3IH4 A;  4MO7 A;  3BR6 A;  5GP9 A;  2XPV A;  3S2H J;  9ANT A;  4A3K J;  4M6V A;  2NS7 A;  2JWT A;  1X2N A;  2E1O A;  1ZKG A;  3H0G J;  2Y9Z A;  1JJ8 C;  5EGO A;  4BKX A;  1ZK8 A;  3MKL A;  1H88 C;  1TWG J;  3S16 J;  2HYJ A;  3IV5 A;  2OPT A;  1RR7 A;  2CUE A;  3GTK J;  3LOC A;  3E7L A;  2WB1 N;  1UG2 A;  2M8G X;  3TW6 A;  3S14 J;  2M34 A;  5F27 A;  5JLX A;  4A3M J;  5EZH A;  1B8I A;  2M9H A;  3HGY A;  1DU0 A;  3S15 J;  3ZQC A;  5FKN A;  3WHB A;  5M5X J;  1Y1V J;  2CUF A;  4AUX A;  1VFC A;  2ME0 A;  3FK7 A;  3JRH A;  2N8G A;  3Q3S A;  2XB5 A;  2M0C A;  5IP9 J;  2EZL A;  3C2B A;  3HGG A;  1OJL A;  4RDU A;  5HOD A;  2Y30 A;  3ZOB A;  4XRS G;  1B72 B;  3BTI A;  1JTX A;  2JA7 J;  4MLO A;  3Q0V A;  2KDZ A;  3ZQH A;  5IPA A;  1FEX A;  1GV2 A;  2LKX A;  3OSF A;  2XPW A;  1RET A;  4V2F A;  2VPR A;  2X6O A;  5JLW A;  1IDZ A;  1HDD C;  4DZJ A;  2DTZ A;  2E2H J;  2K9S A;  3F0C A;  3LSJ A;  1HDP A;  1ETV A;  2Y2Z A;  1LE8 B;  3HM5 A;  2IAI A;  3NAR A;  1JUM A;  2JA6 J;  1WH7 A;  3O8G A;  4QSH A;  1MH4 A;  5FKM A;  2AHQ A;  2DMP A;  1JKO C;  1Q1V A;  1BJZ A;  4J19 A;  1ZR4 A;  4UUS B;  5F0C A;  4M3G A;  4A3F J;  1TWF J;  4C3H J;  5J3L A;  1X2M A;  2MGQ A;  3BTL A;  2FD5 A;  2LD5 A;  4M3D A;  2JJ7 A;  5FKK A;  1RES A;  1XC5 A;  2YU9 J;  1AU7 A;  4BY1 J;  5DTD A;  2CRG A;  4LOC A;  1CQT A;  2XPU A;  5F0F A;  2VKV A;  3HBL A;  3A03 A;  4XIC A;  5J1U A;  5EG0 A;  3S1M J;  1F43 A;  1MBG A;  1EF4 A;  3K7A J;  1MNM C;  4IHY A;  3CMY A;  1BW6 A;  3BTC A;  1U9N A;  1TWA J;  3TP0 A;  4DYR A;  1WPK A;  1HOM A;  2X48 A;  3FKI J;  5K7F A;  1PUF B;  2HOT A;  1MSE C;  1OCP A;  4FE4 A;  5K7Z A;  5FLM J;  5IOY A;  2DA6 A;  5K7H A;  5BNG A;  2FJ1 A;  5DS9 A;  3HOV J;  4BBS J;  4JX5 A;  2RAE A;  1ETO A;  4NDL A;  3RZD J;  2O7O A;  3HOY J;  2CU7 A;  4A3J J;  3WHC A;  4JX6 A;  3GTQ J;  4X6A J;  4CYC B;  2ECB A;  1YRN A;  3W6V A;  2DA2 A;  1ZGW A;  2O9L A;  2ECC A;  4MIM A;  5IYC J;  3G1L A;  3LNQ A;  1I50 J;  4GFB A;  3HOW J;  4QIW N;  4FCY A;  3PM1 A;  2XGD A;  3SJM A;  1JKQ C;  1I6H J;  3BR3 A;  4MFE A;  2I10 A;  1WI3 A;  3TW7 A;  2VUM J;  1ETK A;  2E2J J;  5IP7 J;  2FQ4 A;  1SFO J;  4FTH A;  5EGO B;  3BQZ A;  1RPW A;  4A3D J;  2JN6 A;  1G2H A;  1IJW C;  2GBY A;  3SDG A;  3LSP A;  2XB0 X;  3JRE A;  2OF7 A;  2EQR A;  3JRA A;  4S0H B;  4D7M A;  2ID3 A;  4BY7 J;  4M3F A;  4X1E A;  1APL C;  1IGN A;  1IC8 A;  2P81 A;  1B8I B;  2L0K A;  2JA5 J;  2NVQ J;  1GDT A;  5M3M J;  4JP0 A;  3ZQG A;  2O8K A;  3QPL A;  5M5W J;  4BXX J;  5F04 A;  1K83 J;  3CCY A;  3FIS A;  2L7F P;  5IYD J;  3SFI A;  4FE7 A;  5J1Y A;  3VPR A;  1H8A C;  4IHV A;  2K40 A;  1F36 A;  2R5Y B;  2D5V A;  1MBF A;  2LFB A;  4A3B J;  4Y7N J;  4DZP A;  3CQZ J;  5E3O A;  3BR0 A;  1DU6 A;  1GV5 A;  2XGC A;  3OOU A;  3BR5 A;  1UMQ A;  2DN0 A;  3BQY A;  2WAQ N;  4C2M J;  1FTT A;  2DMN A;  5EZG A;  1T56 A;  1ITY A;  3Q0U A;  2COB A;  2CQQ A;  1W0T A;  4UUT A;  2IEK A;  4V2G A;  1NK2 P;  1IUF A;  2GLO A;  3CDL A;  2EH3 A;  2Y31 A;  2VI6 A;  2KT0 A;  4W97 A;  5EDN A;  2QF7 A;  1U78 A;  1FIA A;  3LSR A;  1TWH J;  3TP3 A;  4RBO A;  1GVD A;  4M3B A;  1ETX A;  3S2D J;  2ME6 A;  2R7Z J;  1QPI A;  5C4X J;  3BR1 A;  4A3I J;  4Y52 J;  1Z77 A;  1AKH A;  2GM4 A;  1ETW A;  2ELK A;  1P7J A;  2Y9Y A;  3UKG A;  1XG1 A;  3S1R J;  1FJL A;  2H8R A;  5F1J A;  3S17 J;  1UHS A;  1ZQ3 P;  2HOA A;  1XS9 A;  3BG3 A;  2CQX A;  5GPC A;  3D1N I;  3GTG J;  1JJ6 C;  4D5F A;  3BR2 A;  5E3N A;  2R92 J;  4FIS A;  2LY9 A;  1E3O C;  2R5Z A;  1BW5 A;  2NS8 A;  2DMT A;  3HOU J;  5M3F J;  2R93 J;  1P7I A;  5FKO A;  2MG4 A;  2B63 J;  5M5Y J;  3A02 A;  4A3E J;  2EZI A;  5C3E J;  1IG7 A;  4UUS A;  2HXO A;  1JKP C;  2QCO A;  2W48 A;  3HB9 A;  5FKL A;  1ETY A;  1MBJ A;  3PO2 J;  1GUU A;  2HOS A;  3JRC A;  1JKR C;  5C44 J;  2YUS A;  1K61 A;  1VI0 A;  4IEJ A;  4IHW A;  2E2I J;  1FIP A;  2E19 A;  2R0Q C;  4AYB N;  4B3A A;  5F0H A;  2HI3 A;  1YRN B;  2HDD A;  1U9O A;  1ZR2 A;  3A01 A;  3QQA A;  2PMZ N;  1VND A;  1IRZ A;  1O4X A;  1A6I A;  1MSF C;  3JR9 A;  1WGX A;  3OSG A;  2DJN A;  2YS9 A;  1W0U A;  1TWC J;  5EEA A;  4D5C A;  1JGG A;  2L7Z A;  3HDD A;  3ZQL A;  2X9D A;  2XGE A;  4XID A;  5EF6 A;  2WV1 A;  4A3C J;  5IOZ A;  3L1P A;  4A93 J;  3ZQI A;  2L7M P;  4B4C A;  1MBH A;  4CYC A;  1JUP A;  4I76 A;  4IHX A;  1A5J A;  1WCM J;  1RKT A;  2FX0 A;  3K2A A;  1IDY A;  1POG A;  1IV6 A;  1WH5 A;  4JX4 A;  2JA8 J;  2NOG A;  3GBG A;  2Y0S N;  2EZH A;  4ABZ A;  1ETQ A;  3BT9 A;  1VF9 A;  1QVT A;  2K9Q A;  1HLV A;  3G1M A;  3RKQ A;  5FLV A;  3RZO J;  1HF0 A;  2MW8 A;  2DMU A;  4B1R A;  5FJ8 J;  2M2E A;  2JK3 A;  4BBR J;  1D5Y A;  2DA3 A;  3G1O A;  1Z0X A;  4I6Z A;  1H89 C;  3JRG A;  3HKZ N;  1RKW A;  2ZB9 A;  4G12 A;  3GTP J;  3OIO A;  2MSY A;  2AO9 A;  3RQI A;  2DA5 A;  5C4J J;  2HQ5 A;  2R5Y A;  1MBK A;  2JMW A;  2LLK A;  1S7E A;  2EZK A;  3PO3 J;  1B72 A;  3JRF A;  1AHD P;  2DA7 A;  1U8B A;  2DA4 A;  3LSG A;  1JT6 A;  1AKH B;  1BA5 A;  5F08 A;  2G0E A;  2TRT A;  3FIW A;  1X58 A;  3M3Y J;  1R9T J;  1TC3 C;  3FK6 A;  3B6C A;  1GT0 C;  1JTY A;  3I4M J;  1QVU A;  3ZQF A;  4C3J J;  4A3G J;  2LVS A;  3MN2 A;  1FTZ A;  4DYQ A;  1QRY A;  2L9R A;  1Y1W J;  2R5Z B;  3M4O J;  3IH2 A;  4AC0 A;  4DYC A;  3JRI A;  3S1Q J;  1LE8 A;  1JUS A;  1MBE A;  4MFD A;  5EG0 B;  5GPA A;  4JYK A;  4XK4 A;  1OFC X;  4M3E A;  3BG9 A;  2LTP A;  2TCT A;  2LP0 A;  3BG5 A;  2H1K A;  1NK3 P;  2K9N A;  3JRD A;  2DA1 A;  1SAN A;  2LK2 A;  5IP6 A;  3S1N J;  2DMQ A;  1LFU P;  1T33 A;  3O8H A;  3DEW A;  1ORK A;  2CJJ A;  2XRL A;  3B6A A;  5IYB J;  3H3V K;  4HNV A;  1ENH A;  3NAU A;  4W1U A;  5E3M A;  3GTM J;  1I3Q J;  3HOZ J;  4QTR A;  3A01 B;  4EEF G;  3IH3 A;  3MVP A;  2IBD A;  3HEF A;  5J1R A;  3TED A;  2VKE A;  3GTJ J;  3Q0W A;  2ID6 A;  4DW6 A;  1HCR A;  3BTJ A;  4L5E A;  2XSD C;  1PUF A;  3QPS A;  2NVX J;  1LFB A;  3JRB A;  2HXI A;  3GTO J;  4XRM A; 
#chains in the Genus database with same CATH topology
 1SD7 A;  4A3L J;  1IN5 A;  4HNT A;  3TDZ C;  2ZME A;  4N4N B;  2X4H A;  4U0Y A;  2NVT J;  2YX4 A;  2EBI A;  2LKS A;  2NVY J;  2GXG A;  2V7F A;  3GO5 A;  4Y13 A;  4XRS A;  5E3L A;  5EYR A;  4B8X A;  1BIA A;  5GP9 A;  3PUF A;  2E35 A;  2NS7 A;  1QA6 A;  3HOS A;  3KLN A;  1Z6R A;  1X2N A;  4CCK A;  5ILU A;  1UG0 A;  4OIN F;  3I56 I;  3HRU A;  2Y9Z A;  5EGO A;  4EGZ A;  3I4P A;  1H88 C;  2K7L A;  3MKL A;  1TWG J;  2JQ7 A;  1EV7 A;  2OPT A;  5B66 C;  2CUE A;  2ZJP F;  2WB1 N;  3H5R A;  1UG2 A;  3K4K A;  4UHT A;  4NB5 A;  4HX7 A;  5J8C A;  3ASN H;  2MH2 A;  2XHK A;  4KIT B;  2W00 A;  3AL0 C;  3S14 J;  1GVJ A;  5HVQ C;  1B8I A;  1RC9 A;  3M8E A;  1TLH B;  2A5Y B;  2O61 A;  1FOK A;  2FU4 A;  1A04 A;  3WHB A;  2QKL B;  1VFC A;  3H9Q A;  2ME0 A;  2F5C A;  1VQ6 I;  3K1M A;  3JRH A;  1UEL B;  3QP6 A;  3MKY B;  3C2B A;  3A0H C;  2BZT A;  1FSE A;  1R1T A;  3SFZ A;  1A36 A;  3BG6 A;  1UZC A;  3FM5 A;  2MLG A;  2V79 A;  3S3O A;  1DDN A;  1V3F A;  3BTI A;  2Y75 A;  2JA7 J;  2R3S A;  1DPU A;  2VE8 A;  2EIK H;  3Q0V A;  1YJN I;  5IPA A;  1EA3 A;  1GV2 A;  1SVM A;  3KCC A;  1YG2 A;  2HS5 A;  3AG1 H;  3BCA A;  4A6E A;  2HR3 A;  5KNL A;  1D1A A;  1RET A;  3F23 A;  1VQ8 I;  1KA8 A;  4Z2Y A;  2HDC A;  3F0C A;  2QM3 A;  2Y2Z A;  1DP3 A;  1LE8 B;  3NAR A;  2JVH A;  4F93 B;  1U0J A;  1ZH5 A;  1JI8 A;  4XSX F;  1WH7 A;  3I5U A;  2MBF A;  4MGR A;  2IW5 A;  2DMP A;  5BQT A;  1Q1V A;  1ZR4 A;  3CP2 A;  1I5Z A;  2D1V A;  3K70 C;  1X2M A;  3ABU A;  1ZRE A;  5CVI A;  1FMW A;  1J5Y A;  3SYT A;  4KNY A;  5LFA A;  1QGP A;  3F6V A;  1Y56 A;  2KIU A;  2XUB A;  4EGY A;  4B48 A;  1DGW Y;  1F43 A;  3R6S A;  1BC7 C;  2KZV A;  3OR2 C;  1BW6 A;  3FHN A;  3K10 A;  1TWA J;  4HV6 A;  1WPK A;  3DPT A;  5K7F A;  1WJ5 A;  5H6R A;  5IOY A;  4CXF A;  2FJ1 A;  5DS9 A;  4IVN A;  2XDV A;  1EKE A;  3PIP F;  1YW7 A;  4BBS J;  4JX5 A;  1ETO A;  2YSR A;  2BHY A;  2KRF A;  4G8X A;  3CCE I;  3OYJ A;  1YYV A;  2RRE A;  2ESN A;  4X6A J;  5CVV A;  4CYC B;  4XKB A;  1YRN A;  2DA2 A;  1R36 A;  2OD5 A;  2FSW A;  2O9L A;  3MAJ A;  4MIM A;  5IYC J;  4E7I A;  4QIW N;  3RCO A;  2XGD A;  3CCL I;  3TW7 A;  4XQF A;  3HL2 A;  3F8F A;  4FTH A;  1I27 A;  2OZ6 A;  1S6L A;  4I98 B;  2ADU A;  2JN6 A;  3V8K A;  2HNH A;  3U9G A;  2GBY A;  2PEX A;  3LSP A;  2EFO A;  3M9A A;  2QWW A;  4BHP A;  1YS6 A;  2EIN H;  2OF7 A;  4LIT A;  1E3P A;  4LLL A;  1KYZ A;  4DNC A;  4G94 A;  1W36 D;  5J4Y A;  4BEH B;  2GOM A;  1K78 B;  1VQ4 I;  1ZRF A;  3E6B A;  4IHT A;  2VQC A;  4NUB A;  1IGN A;  1AOY A;  4PZJ A;  1F1Z A;  2XKO A;  3MEX A;  5D6F A;  2O8K A;  2DYS H;  3ZQG A;  3CUQ A;  3RKX A;  3DP7 A;  5M5W J;  2HYF A;  1K83 J;  1RRJ A;  1MJB A;  3KZY A;  4FE7 A;  2E36 A;  3SFI A;  4HPQ A;  3PQK A;  5J1Y A;  1SMT A;  3G2B A;  2J5O A;  4IF4 A;  2D5V A;  2AS5 F;  4NC6 A;  1BI3 A;  2LFB A;  5LEJ A;  4A3B J;  2EPF A;  2L4A A;  1ZGA A;  2EIL H;  4Y7N J;  2K9M A;  3CQZ J;  2LBF B;  5E3O A;  2FE3 A;  4XLF A;  3ZMZ A;  2V9V A;  1Y8Q B;  1XSD A;  2ETH A;  2PBI A;  3GX4 X;  4EM0 B;  3H5N A;  2CV0 A;  2WAQ N;  2A61 A;  5DEQ A;  4BXU A;  2RVC A;  3CLQ A;  1FTT A;  2IXS A;  2FOW A;  2JZY A;  5FGM A;  3Q0U A;  2CQQ A;  1YS7 A;  2EA4 A;  3PSI A;  2IEK A;  4UUT A;  4V2G A;  5IT9 K;  4M9X A;  4AWX B;  3K2Z A;  4WCG A;  5J4V A;  2NNY A;  5DV5 A;  4KMU X;  2PJR B;  3BPX A;  3WTZ A;  2EV5 A;  3P7N A;  4N4O B;  1HSJ A;  1TWH J;  4LLN A;  3U2R A;  5LGN A;  3RDI A;  1GVD A;  5DM6 F;  4M3B A;  1FT9 A;  2HEO A;  3IC7 A;  2R7Z J;  3BR1 A;  5LHG A;  1AKH A;  1MMS A;  2GM4 A;  2L7K A;  3VWB A;  1BJA A;  3S1R J;  1G3Y A;  3UNG C;  3RYP A;  5HNH A;  5FD5 A;  3S17 J;  3RPU D;  5GPC A;  5DCF A;  3D1N I;  4D5F A;  3H35 A;  4ZDO A;  4E7L A;  3QRF F;  4O6J A;  2I5U A;  2DT5 A;  4BQN A;  1VTN C;  4I09 A;  3I55 I;  2R93 J;  2P8T A;  2MG4 A;  2B63 J;  5CVJ A;  2QUF A;  4XKC A;  1VQL I;  2HXO A;  2F5F A;  2VT3 A;  2B7E A;  5CLS A;  5AIP A;  1X4O A;  3HB9 A;  3G6E I;  1GXP A;  2HU9 A;  5HLI A;  1T8I A;  1PP7 U;  2KDO A;  2NRA C;  4BQO A;  4HST A;  2FA5 A;  3Q5F A;  2I8D A;  4I02 A;  2BY2 A;  2M30 A;  4A0Y A;  2KIQ A;  4PUS A;  1JGS A;  1YI2 I;  2JSC A;  1LUJ B;  2FBK A;  2ZME B;  1XMX A;  2E2I J;  1QBJ A;  3CMM A;  3GUD A;  2R0Q C;  2GXB A;  3F21 A;  1SD5 A;  2KMU A;  2HWV A;  3M8F A;  5F0H A;  5DM7 F;  5J8F A;  2UUZ A;  1QNT A;  1R7J A;  3C7J A;  3CJQ B;  3N05 A;  2HDD A;  3F8M A;  1ONV A;  2VBY A;  3OYD A;  5E8I A;  3M7G A;  1XCB A;  4G9Y A;  3R60 A;  1SFE A;  2ICW G;  2M1B A;  1A6I A;  2XRO A;  1O4X A;  1MSF C;  2FQ3 A;  3LFU A;  1S3J A;  4A2U A;  5EEA A;  1JGG A;  2E7W A;  3HDD A;  5ICE A;  4S05 A;  2BW3 B;  2RQP A;  4RLQ A;  5IOZ A;  1YQA A;  4HQM A;  2M0M A;  1W7P A;  2M8E A;  3F8B A;  2DQR A;  3P9I A;  1OPC A;  3TO9 A;  4IHX A;  4I01 A;  3F22 A;  2DK5 A;  3K2A A;  3K4L A;  3FXO A;  1KU3 A;  2CWE A;  3WG7 H;  5IT9 Z;  2L5Q A;  2AQF A;  4FET A;  1OYW A;  2XAG A;  1JXS A;  2G9W A;  2NOG A;  2GA2 A;  4AYB A;  3GBG A;  4KN7 X;  3DKY A;  3TOB A;  1BOA A;  4J00 A;  2Z1D A;  2PMZ A;  2K9Q A;  3G1M A;  3RKQ A;  5FLV A;  2M7B A;  3OYC A;  2LF7 A;  2MW8 A;  1HF0 A;  1MNE A;  3REO A;  5ILV A;  1YW8 A;  1IN7 A;  3VOD A;  2WC2 A;  3GW2 A;  4II3 A;  1D5Y A;  5HDK A;  3V7R A;  1H89 C;  2JSP A;  3MWM A;  3F8N A;  3ABL H;  4KIS A;  1XX5 A;  4ZYG A;  1IRX A;  3PNV A;  4XLC A;  4EV0 A;  1D3Y A;  2F6C A;  1I1S A;  1CF7 A;  3G73 A;  4XKV A;  2V6C A;  4LLG F;  1MBK A;  2J5P A;  2JMW A;  3ESW B;  3PSF A;  5DUK A;  3PO3 J;  3JRF A;  2WV0 A;  4GYG A;  4PJN A;  2UWM A;  3J81 K;  1FWZ A;  1QQI A;  3B02 A;  2YX7 A;  1BA5 A;  4EQQ A;  3CC2 I;  1R9T J;  3ECO A;  3EUA A;  3VDX A;  2XF7 A;  2FEZ A;  3QYF A;  1A6Q A;  1GT0 C;  3ZP5 A;  1ZHF A;  2E60 A;  3P5J A;  4A3G J;  5HS9 A;  2LVS A;  3MN2 A;  2LRD A;  1JE8 A;  2L9R A;  2AXL A;  3WE3 A;  3ERM A;  3IH2 A;  3S1Q J;  2VL8 A;  1EH8 A;  2QEX I;  1LE8 A;  4RS8 A;  1ZRD A;  1T6S A;  5KAI C;  3J7A Y;  2ZFU A;  4RB1 A;  3WGH A;  1MBE A;  4BS9 A;  2FUG 2;  1HW2 A;  2OCC H;  3A1Y A;  1XSV A;  4M3E A;  5L3G A;  2BGC A;  1YIO A;  1FLI A;  4F3Q A;  4MEY F;  4BYY A;  3JRD A;  3ZQQ A;  1P9Q C;  1SAN A;  3KYL A;  3KP5 A;  1FYL A;  1T33 A;  1BIB A;  2P7V B;  3DEW A;  2V6E A;  1SC7 A;  3SEQ A;  1VZ0 A;  5GTH C;  2PMH A;  3IP4 B;  4XOT A;  1E2X A;  5IYB J;  4D1Q A;  1ENH A;  3LSH A;  3NAU A;  2DK8 A;  2R7W A;  3DPU A;  1S8N A;  1YX3 A;  4LMY A;  5FRO A;  2OAZ A;  3LWF A;  1WJE A;  3HOZ J;  2R7X A;  1ZG3 A;  2O8X A;  1STZ A;  4EEF G;  3IH3 A;  1FSH A;  4A12 A;  5E8G A;  3HEF A;  5J1R A;  1K6O A;  4UUV A;  2O5R A;  2XSJ C;  5K5O A;  3GTJ J;  5HDG A;  4DW6 A;  1X1P A;  3FXU A;  1HCR A;  4F52 A;  1IRG A;  3ELK A;  2XSD C;  1RNL A;  4D9J A;  3LSI A;  3QPS A;  3TOA A;  3T0Y A;  3KP6 A;  4HDV A;  1QHH D;  4A0Z A;  4XRM A;  2OBP A;  1OKR A;  4CCM A;  2KP6 A;  4N9I A;  3CCV I;  2CW7 A;  3IAM 2;  4EJU A;  3CZ6 A;  1XDU A;  5J47 A;  3GCM A;  5KHD A;  1MH3 A;  1OR7 C;  2QBY B;  3I71 A;  2XF5 A;  4HYE A;  2HKO A;  4IX7 A;  4GXO A;  2NNN A;  3BR6 A;  3QAH A;  5H20 A;  4OIQ F;  4I0A A;  3J7Y J;  3S2H J;  2JA2 A;  2XV4 S;  2CQK A;  4A3K J;  2XAH A;  4WWC A;  4ZYA A;  2JWT A;  2PI0 A;  1ACI A;  4KMF A;  3CUQ B;  3S93 A;  2AQE A;  3DU6 A;  2JRM A;  3CMA I;  1JJ8 C;  2DYR H;  1BI0 A;  3U1D A;  4BKX A;  1J09 A;  3K70 D;  3TDU C;  4E7S A;  2HYJ A;  5LHI A;  4CZC A;  2A05 A;  3BP8 A;  2VQG A;  3LOC A;  3TL4 X;  1J0R A;  1R00 A;  2M8G X;  3PUB A;  3J81 Z;  1AA7 A;  1K78 A;  4QPO A;  5B3S H;  5F27 A;  5JLX A;  4CHU A;  5EZH A;  5GAG J;  4B44 A;  5FKN A;  5M5X J;  1Y1V J;  1KGS A;  2CUF A;  2JTV A;  3QPT A;  4AUX A;  2TDX A;  2YU3 A;  1XGS A;  4UV9 A;  2CW0 F;  2EA2 A;  4QLC U;  2XB5 A;  5FFZ A;  1OJL A;  2F4M B;  4RDU A;  3DKX A;  2WY7 Q;  3ZOB A;  3SEZ A;  3FXJ A;  1R71 A;  2GQQ A;  4I2O A;  2P4W A;  3FMS A;  3EQL F;  2DBB A;  4LIU A;  2VT2 A;  2KDZ A;  2QQ8 A;  1N75 A;  3I59 B;  1PJR A;  1FEX A;  3H92 A;  4KIC A;  3CCU I;  2LKX A;  3OSF A;  2XPW A;  3K1P A;  2X6O A;  1FP1 D;  2RQQ A;  3FX3 A;  4J01 A;  3QOP A;  1E0E A;  4WF2 A;  4H4K C;  3O6B B;  1Y0U A;  2H1L A;  2K9S A;  4FX4 A;  2E1M C;  3EDP A;  2VAS A;  1HDP A;  1ETV A;  2X85 A;  2PJR A;  1FP2 A;  2IAI A;  1O3Q A;  1VQP I;  1JUM A;  3KYD B;  4ZH4 F;  3LL7 A;  5BPD A;  1KU2 A;  4QSH A;  1MH4 A;  4HF0 A;  2R7U A;  1O3R A;  4BJT A;  3OOP A;  2CH0 A;  5E18 F;  4F91 B;  2W1O A;  2XKP A;  1S7O A;  3QOD A;  3BJO A;  1IO2 A;  2Z9O A;  1HST A;  1OMI A;  1TWF J;  3LQR A;  1MKM A;  4AIH A;  4C3H J;  3EUK L;  3DTE A;  1T39 A;  2MGQ A;  4AVP A;  2LD5 A;  2LY1 A;  2E5N A;  1SVL A;  3TBI A;  2JJ7 A;  1RES A;  2O03 A;  4BY1 J;  5FFX A;  4ENJ A;  2KZG A;  4LOC A;  4RM2 A;  1CQT A;  2XPU A;  2BVM A;  1IZ1 A;  3FMR A;  4XIC A;  4RB3 C;  1XB4 A;  2Z5U A;  3ZMT A;  2XAU A;  1MNM C;  2YR2 A;  3CMY A;  5KCM A;  3H1C A;  2DPD A;  1S29 A;  2VJ5 A;  4CZZ A;  3EUH A;  3F9K A;  4GYI A;  1FOY A;  2HDW A;  2HVQ A;  3FKI J;  2IGO A;  4I7H A;  1MSE C;  1OCP A;  4A5M A;  5K7Z A;  5ICF A;  2X6W A;  2DA6 A;  5K7H A;  3KEY A;  3O2P E;  5BNG A;  1SD4 A;  2XC7 A;  1EH7 A;  2PN6 A;  1KQ8 A;  3MZY A;  4NDL A;  5LHH A;  3OYK A;  3FXR A;  4WX9 A;  3E0J B;  2O7O A;  4IO9 F;  4M6Y A;  2CU7 A;  3HOY J;  2O0Y A;  1OYI A;  2V1X A;  4LGW A;  3WHC A;  3GTQ J;  2H27 A;  2ECB A;  1W7P B;  4XMY A;  2VOD A;  5KVR A;  2BHZ A;  3LNQ A;  1I50 J;  3F6O A;  4GFB A;  3IAS 2;  3LA3 A;  2XF6 A;  2A6H F;  4MEX F;  2QSG X;  2I10 A;  1WI3 A;  2EFP A;  3DEE A;  4BJ6 C;  2IVM A;  2E2J J;  2XAF A;  5IP7 J;  3BRO A;  3RPQ A;  4XN3 A;  3GF2 A;  5GAE J;  5F6F A;  1FY7 A;  1G2H A;  3ZGK A;  3SDG A;  3OS1 A;  2BW3 A;  1R4M B;  3E97 A;  4KJZ A;  4S0H B;  1P4X A;  4D7M A;  4E7Z A;  3HXL A;  3LAJ A;  4YII A;  1DP7 P;  1TZL A;  2VBW A;  2BY0 A;  1IC8 A;  4ZYH A;  1B9M A;  4E7H A;  2FML A;  1T0F A;  2NVQ J;  2K02 A;  1GDT A;  3J7A O;  4N9H A;  2VBX A;  5M3M J;  2E71 A;  4PSX A;  3CME I;  3QPL A;  4BE1 A;  2UV1 A;  2O6G E;  1MMA A;  3CCY A;  3FIS A;  4KIG A;  3WU2 C;  1IF1 A;  1TW2 A;  2QQB A;  3WTS C;  4ESF A;  3CD6 I;  1CF7 B;  1X3Z B;  1H8A C;  1QO0 D;  2K40 A;  4G6Q A;  3T8R A;  1E3H A;  4AM3 A;  2VQH A;  1H9T A;  1S9H A;  3RKY A;  4MHG A;  1WRJ A;  3HTU A;  3RSN A;  3AKZ A;  2CV2 A;  4C2M J;  1Z3Y A;  3CUQ C;  2BV6 A;  3V7C A;  1SD6 A;  4NQW B;  1T56 A;  5E17 F;  5JVT A;  4P1W A;  3HJE A;  1NK2 P;  3HRS A;  2GA1 A;  3CDL A;  2EJR A;  4B3X A;  4AIK A;  2VI6 A;  3FXQ A;  2KT0 A;  3GME A;  2BBY A;  4WXH A;  4AID A;  2H09 A;  5LLQ A;  2ZCW A;  1U78 A;  4H0E A;  1WZ2 A;  1X1D A;  2BXY A;  1FIA A;  4ENM A;  3DF8 A;  3LFK A;  1RUO A;  5FB2 A;  2D2W A;  4I99 C;  3C3W A;  2BOL A;  3CCR I;  2HQR A;  1QPI A;  4CGZ A;  4Y52 J;  3IKV A;  5DD8 A;  3KET A;  2V26 A;  1ZLJ A;  2Y9Y A;  4PFO A;  4YFK F;  3FBI B;  1Y39 A;  5E79 C;  3ROU A;  2H8R A;  4BH9 A;  2VE9 A;  2HZT A;  5F1J A;  5LBQ A;  4B43 A;  1UHS A;  3PFI A;  3IRQ A;  3BG3 A;  5F64 A;  3OYH A;  2F5V A;  1JJ6 C;  3EYI A;  4EJT A;  4Q48 A;  4M74 A;  3EET A;  4UY8 I;  2NS8 A;  1BW5 A;  3HSF A;  5FKO A;  3A02 A;  5KK1 A;  1ULY A;  1JHH A;  3OYI A;  4G7Z F;  1IG7 A;  2V1U A;  4UUS A;  1U5T B;  4PJM A;  2E1N A;  3JTH A;  4RM3 A;  3DWL E;  2IGN A;  1R5I D;  4HA8 A;  4HBL A;  3KEO A;  4L9J A;  1ZRC A;  1T08 B;  3ZPL A;  1MIJ A;  4Y17 A;  2KQR A;  3WU0 A;  2HOS A;  3TO6 A;  3OIP A;  5LGU A;  1JKR C;  2LC2 A;  2WBM A;  2YUS A;  1FYK A;  2Q2E B;  1N25 A;  1WJA A;  2MC4 A;  2VJJ A;  4CIC A;  3I0T A;  1G3S A;  4U87 A;  2DJI A;  2QSF X;  4AYB N;  2R7O A;  2CO5 A;  2LG4 A;  3P9K A;  5E1X A;  5HLT A;  3JAM Z;  1T2K A;  3ULQ B;  4HQE A;  1U9O A;  2NXN B;  2DT7 B;  3NQO A;  2PMZ N;  1Z91 A;  1VND A;  3CCS I;  2P6S A;  2JUC A;  2DJN A;  2YS9 A;  1VQ5 I;  3DTK A;  3OYM A;  4L9T A;  2W84 A;  4BGD A;  3H9G A;  2L9N A;  4NC7 A;  4CCN A;  4D5C A;  1VQ7 I;  4KA4 A;  4IOC F;  1OCZ H;  2KFD A;  2XGE A;  2NOJ B;  2NVU B;  1VQO I;  4A3C J;  2DTR A;  3FMQ A;  1MBH A;  4FHT A;  4RMN A;  1JUP A;  2QBY A;  2CW8 A;  3GFJ A;  4JQF A;  3HRT A;  3WGG A;  5ICC A;  1RKT A;  1FBQ A;  1IDY A;  3E6M A;  2JA8 J;  1NHA A;  1BR2 A;  2E7X A;  4E6K G;  4Y15 A;  2EZH A;  5TIS C;  3G71 I;  3V8L A;  4HV5 A;  1QVT A;  3OYF A;  5FO5 A;  4OU0 A;  3BWG A;  5CKT A;  4S04 A;  3KP2 A;  1ON1 A;  3FDY A;  3JSP A;  2M2E A;  2JK3 A;  4BBR J;  2KJB A;  3SQN A;  2DT6 A;  1PP8 F;  1L0O C;  3BZ6 A;  4L9V A;  5LRS A;  1YJ9 I;  3JRG A;  1NG6 A;  1RKW A;  3HKZ N;  1WJF A;  3KX2 A;  2GXA A;  5FD6 A;  2BY1 A;  2W7N A;  3NWS A;  4PK4 A;  2JVG A;  3X2Q H;  5D8L B;  4G7H F;  1VQ9 I;  3GTP J;  4HG2 A;  1G3T A;  3T1B A;  1BI1 A;  2Z99 A;  3K4B A;  3KZI C;  3WTU C;  3DKW A;  2B9S A;  1UJ8 A;  4Q5S F;  1SFK A;  3RQI A;  1J2X A;  2HQ5 A;  5IY5 H;  1UCR A;  1S7E A;  1LNW A;  3T5X A;  3ERE D;  1YE9 A;  2DA7 A;  2LNB A;  5H2F C;  3L2U A;  1U8B A;  1X4P A;  2V1N A;  4II2 A;  3HSR A;  1J75 A;  4F92 B;  1FMV A;  1JT6 A;  1BR4 A;  3I59 A;  5F08 A;  4ZTJ A;  2TRT A;  3FIW A;  4EVI A;  2Y0S A;  1X58 A;  2GAU A;  3PJR A;  1WKM A;  3I64 A;  2Z2S B;  3JSO A;  2IGM A;  3FK6 A;  4EM1 A;  3FZV A;  3VYU B;  3B6C A;  1Y0N A;  1YLF A;  4B09 A;  1JTY A;  5D5U B;  4YRV A;  1FOX A;  3IL2 A;  4C3J J;  2WA0 A;  1XCV A;  1PUE E;  3S3M A;  1V54 H;  4NC8 A;  1QRY A;  4EJO A;  3ZN0 A;  4L18 B;  2R5Z B;  1LEA A;  4DYC A;  3JRI A;  3ABK H;  4UVA A;  4MFD A;  1K79 A;  2VJI A;  5GPA A;  3SDB A;  1OFC X;  3S3N A;  3BG9 A;  2TCT A;  2H1K A;  2K9N A;  3C1D A;  5GAH J;  5HS7 A;  3RJP A;  4XBF A;  3HTS B;  2CFX A;  3FM3 A;  5AON A;  1LFU P;  1G4D A;  2CUZ A;  2FNA A;  2ZXH A;  3BZC A;  4HLX A;  2CJJ A;  2XRL A;  3QWL A;  3H5A A;  2A6T A;  5L3E A;  2DQL A;  3ZXS A;  4W1U A;  2K27 A;  5K5R A;  4PJL A;  2DOD A;  1O7F A;  4M9Z A;  1VQK I;  3A01 B;  2IJL A;  2P5V A;  3MVP A;  3TED A;  1D8J A;  2ID6 A;  3J7Z I;  3SZT A;  1F5T A;  1Y8R B;  5EEH A;  4PFP A;  1LFB A;  2HXI A;  3L2V A;  3BLY A;  3ML6 A;  4OIR F;  3HYI A;  3WG9 A;  2VN2 A;  4P9U A;  2ZC2 A;  4DJA A;  3IRR A;  2HOE A;  4LK1 F;  1JT0 A;  2MH9 A;  3GTL J;  4D7N A;  3SHF A;  1EH6 A;  3HOX J;  3IWZ A;  4C3I J;  4ESJ A;  3DCF A;  4HRI A;  1TL8 A;  3I4N J;  3CF2 A;  5HLH A;  1OIS A;  2H6B A;  2NS0 A;  2XPV A;  4M6V A;  1EJ9 A;  4K2E A;  1SMY F;  3BPV A;  4AVZ A;  2VKH A;  3RI4 A;  2P6T A;  4UB8 C;  3IV5 A;  1YW9 A;  1RR7 A;  1I39 A;  2OQR A;  3HUG A;  5JVG F;  3H3Z A;  3LQQ A;  3TMO A;  2L3D A;  2H8W A;  4OIP F;  1ZN2 A;  3K4M A;  4QWQ A;  3DU5 A;  2ZJR F;  3LAP A;  2X0L A;  3HGY A;  3QP5 A;  3PFY A;  2DLL A;  3S15 J;  1DPR A;  3ZQC A;  2HVR A;  3V7S A;  2M4G A;  4R1H A;  2UXX A;  4EAT A;  3A2K A;  1WJC A;  2OJE D;  2M0C A;  5IP9 J;  3R0A A;  3PL8 A;  1VQN I;  2LRE A;  2F2E A;  2WAE A;  3G4S I;  4XLA A;  2DXI A;  2QVO A;  2DFI A;  1J7K A;  3R61 A;  1HW5 A;  3K69 A;  1JTX A;  2VPL A;  1P6R A;  1TW3 A;  4MLO A;  3SZG A;  1FC3 A;  1W1W E;  1D5V A;  5L3F A;  3OYE A;  1LJ9 A;  3PIO F;  3FBN B;  4O5V A;  4KIF A;  1D0Y A;  1XGN A;  4A6D A;  4ZTF A;  3D5L A;  4NQW A;  3W2A A;  4V2F A;  2IPQ X;  2VPR A;  2W4S A;  4U7B A;  1HDD C;  1HKS A;  4DZJ A;  1U8R A;  3F8C A;  4C2T A;  1QZY A;  2XAJ A;  2E2H J;  1MDM A;  3RIR A;  3TGN A;  3HM5 A;  2IA2 A;  2JPB A;  3M8J A;  2JA6 J;  1YIT I;  5ED4 A;  3HKZ A;  3O8G A;  5FKM A;  1W5C C;  2AHQ A;  4BL0 B;  1MD0 A;  1SAX A;  1JKO C;  2VOP A;  2LH9 A;  4U7D A;  4KUM A;  4WK8 F;  4UVC A;  4UUS B;  1BOB A;  5F0C A;  1IW7 F;  4XON A;  4XN0 A;  3CC4 I;  1B59 A;  2FD5 A;  2K85 A;  2K9L A;  2W25 A;  3I54 A;  5CQE A;  3B73 A;  3ZR8 X;  2ZJQ F;  5FKK A;  5DDG A;  1C0W A;  1WWX A;  1UAA A;  2B0L A;  2ELJ A;  3FXK A;  5F1R A;  3KZZ A;  2PX9 A;  5DTD A;  2KL4 A;  4HX8 A;  3OYG A;  2FRH A;  2L9S A;  4OOI A;  1MZB A;  5F0F A;  3HBL A;  2Y0M A;  4XR6 A;  1Z9C A;  1K4T A;  2ISZ A;  2LY2 A;  4R8H A;  5J1U A;  2P7C B;  1KU9 A;  1Z21 A;  3ECH A;  1FPQ A;  2MD5 A;  2V9K A;  3K9T A;  4IKF A;  4L9N A;  2R7S A;  3BTC A;  1U9N A;  1BC8 C;  1U5T A;  3AG3 H;  4DYR A;  1CGP A;  2HVS A;  1WFX A;  4LJZ F;  1SFU A;  2NYX A;  1LVK A;  2X48 A;  3L2R A;  2F4O B;  1WQ2 A;  1R58 A;  3DEU A;  1OCC H;  3GZ6 A;  2CV1 A;  3H3U A;  4FE4 A;  1TBX A;  4C2U A;  4ANJ A;  4AIJ A;  4IRI A;  2H94 A;  3JTG A;  2UZK A;  2Q2E A;  4EJW A;  2QQA A;  5JHU A;  1D0X A;  4ESB A;  1YHQ I;  1QZE A;  4XL9 A;  2OU2 A;  4A3J J;  4O3M A;  1MGT A;  4YFX F;  3W6V A;  4MQ9 F;  2QGU A;  3AL0 B;  2QYO A;  2JRT A;  3E6D A;  5EEG A;  4FCY A;  1BN5 A;  3HOT A;  4ITV A;  5L3B A;  3EUH C;  3BJ6 A;  2AXT C;  3BR3 A;  4MFE A;  4QPQ A;  3ZQ7 A;  4HX4 A;  2NAZ A;  2EFQ A;  3H0D A;  3J80 K;  2VOO A;  1HW1 A;  2FQ4 A;  1GLN A;  4P5O A;  1V4R A;  4PDK A;  2IS1 A;  2Z16 A;  1ERD A;  3QPH A;  1IJW C;  2R7F A;  2ZME C;  3C18 A;  2XB0 X;  1Z05 A;  4LIV A;  4D0P A;  5D5V B;  5CVR A;  3JRA A;  2ESH A;  1UHW A;  3VYT B;  3PNY A;  4M3F A;  2RC4 A;  3LA7 A;  2P81 A;  1AWC A;  2JA5 J;  3HIF A;  1TNS A;  3GLX A;  4JP0 A;  1XSX A;  2UXN A;  4BAC A;  3N97 A;  1N77 A;  2M4K A;  4C9Y A;  1RR8 C;  2EFW A;  5F04 A;  2MC3 A;  1H0M A;  2L7F P;  1WI9 A;  5IYD J;  3E5Q A;  2IA1 A;  4ZC3 A;  2BY3 A;  4RB0 A;  2VIX A;  3VPR A;  2QA4 I;  1MBF A;  3VOE A;  4DBR A;  3DLL F;  2P0W A;  4DZP A;  1W4M A;  3C2H A;  4MQV A;  1KZH A;  4Q47 A;  1DU6 A;  2XGC A;  2DCE A;  3W2V A;  2OZU A;  1T0F C;  3CUO A;  3BR5 A;  2DN0 A;  3BQY A;  2FBI A;  2KIS A;  4I0B A;  4JBA A;  5B5E C;  3GXO A;  3DLA A;  4BJ5 C;  2DMN A;  2GOX B;  3BOQ A;  4B47 A;  4DQ2 A;  2XAS A;  1GXQ A;  1W0T A;  5TJJ A;  3ASO H;  3LSM A;  1IUF A;  2DI3 A;  4M73 A;  1W5T A;  2EH3 A;  1K6Y A;  1LDK B;  2Y31 A;  4LK0 F;  2ELH A;  2H6C A;  4L5I A;  4W97 A;  5EDN A;  2K86 A;  3WTX C;  2KIM A;  2HQN A;  1BI2 A;  4GGG A;  3SZP A;  1XMA A;  3TP3 A;  2RNG A;  3MQ0 A;  4RBO A;  4CSW A;  3LMM A;  4BNC A;  4PCQ A;  4Z6Y A;  1BM9 A;  6PAX A;  3S2D J;  3HC7 A;  2ZNY A;  4YEJ A;  4UB6 C;  1TP4 A;  1Z77 A;  4GDF A;  2M87 A;  3UKG A;  3DXJ F;  1XG1 A;  2MD0 A;  4HF1 A;  2EIM H;  2F48 A;  1Z7U A;  3F72 A;  3OMY A;  2HOA A;  1XS9 A;  4N0B A;  2CQX A;  3DPL C;  1YIJ I;  1OLT A;  3JW4 A;  2R92 J;  1IN6 A;  4OAY A;  5GAD J;  3BZK A;  1E3O C;  2R5Z A;  1QPM A;  1LDD A;  3CC7 I;  3HZJ A;  3I53 A;  1W5S A;  3HOU J;  5M3F J;  3HSE A;  1P7I A;  4F7Z A;  1U3E M;  4KT5 C;  3DV8 A;  3M1E A;  5M5Y J;  4A3E J;  1B4A A;  5FRN A;  3J80 Z;  2EZI A;  5C3E J;  1W7P D;  1I6X A;  3CDI A;  5DYM A;  1JKP C;  4YEL A;  2EB7 A;  2W48 A;  2Y69 H;  1HKT A;  2ZSH B;  4UNO A;  1SVO A;  3PO2 J;  2KRH A;  2CQN A;  1GUU A;  3ZMU A;  2IA0 A;  4OMZ A;  3JRC A;  2DFE A;  2JT1 A;  4IHS A;  3FWE A;  1NG7 A;  5C44 J;  5EJC A;  2KKO A;  4YIR X;  3L2Q A;  2FBH A;  5D6E A;  2E19 A;  5L3D A;  5K1Y A;  2IT0 A;  4B3A A;  2HI3 A;  4RGR A;  1T38 A;  2JPC A;  4YIF A;  3A01 A;  3HRM A;  4FQG A;  4A5N A;  5TRD A;  2W82 A;  2CUJ A;  5ERI A;  3S2W A;  3OSG A;  1X3U A;  1R1V A;  4ENK A;  2X1C A;  1IXC A;  3RPU A;  2KJC A;  1TWC J;  3E5U A;  5D4R A;  4ZDP A;  1IV8 A;  2L7Z A;  1JHF A;  3ZQL A;  2X9D A;  4RAY A;  2BXZ A;  5EF6 A;  5CPR B;  2LOO A;  3HUG B;  2R4G A;  5B1A H;  1E17 A;  1R6R A;  3L1P A;  3H36 A;  3KPH A;  3ZQI A;  2L7M P;  4B4C A;  5L3C A;  4I76 A;  3I3L A;  3K4J A;  4M72 A;  3WTV C;  1R49 A;  3I9V 2;  1A5J A;  3NWT A;  4L5J A;  1VQM I;  1YX5 A;  1POG A;  2CQ7 A;  1IV6 A;  1WH5 A;  4ZYE A;  3JAM K;  3KLO A;  4ZZD A;  5LRR A;  1O57 A;  2ZKZ A;  5B1B H;  1R5H A;  3I58 A;  3DQV C;  4M9S A;  2Y0S N;  2WWY A;  4ZDL A;  4PSW A;  1OCR H;  1G59 A;  3MZH A;  2CG4 A;  4KFC A;  4CDG A;  4L0Y B;  2L01 A;  3RZO J;  2Q1Z B;  2X6Y A;  1T98 A;  2DMU A;  4B1R A;  4DOZ A;  2ZXI A;  3R4K A;  5FJ8 J;  3D5S C;  3DBH B;  4IQ4 A;  2DA3 A;  4I6Z A;  1Z0X A;  4EM2 A;  2VBZ A;  2VB6 A;  2ZB9 A;  4XKW A;  2F5E A;  2OQG A;  3OIO A;  1X1B A;  3Q9S A;  2BVL A;  3DBL B;  4AU7 A;  3HPH A;  3BCB A;  1UST A;  5C4J J;  1MDM B;  2K3F A;  3CJN A;  3OL4 A;  3VFZ A;  2R5Y A;  4OAZ A;  5DD4 A;  4HNU A;  2LLK A;  4BUP A;  2EZK A;  1KQ0 A;  2L02 A;  2L9V A;  2DA4 A;  4XLN F;  4UXN A;  3NRV A;  4BE0 A;  1YOV B;  4HDU A;  1SEU A;  3OWT A;  1S5L C;  2G0E A;  5LGT A;  2L4M A;  4XRF A;  3KIO A;  2ACJ A;  4KIB A;  2BEO A;  3FKJ A;  3W6J B;  3CLO A;  5DCM B;  1QVU A;  3ZQF A;  1NH3 A;  3FF5 A;  3C2G A;  2M45 A;  1FTZ A;  2HGC A;  5FLX K;  4DYQ A;  5BMZ A;  2V4J C;  2RKH A;  1Y1W J;  3QU3 A;  3M4O J;  1TQP A;  4U88 A;  2OV7 A;  2JUG A;  4KDP A;  1LKX A;  4U0W A;  2CMP A;  1X1A A;  3OL3 A;  2VJ4 A;  3WOD F;  3D0S A;  2LTP A;  4DGW B;  3KP3 A;  4F55 A;  2LKP A;  2HZD A;  2DMQ A;  3O8H A;  3KE2 A;  4MTD A;  2OCE A;  1MMD A;  3GLL A;  4G7O F;  2A68 F;  2F5D A;  3A4C A;  1MND A;  3H3V K;  2OUM A;  2DFH A;  1UB9 A;  1SAU A;  3QYB A;  5HLG A;  3EPZ A;  5E3M A;  3GTM J;  1V5E A;  5CJ9 A;  2DPU A;  1I3Q J;  2CSO A;  2YPR A;  4IL6 C;  3S8P A;  4QTR A;  1YO5 C;  3CJR B;  2IBD A;  2DFF A;  2XIG A;  4IRH A;  1QU3 A;  3WTT C;  1MW7 A;  2VXD A;  4IPA A;  3BTJ A;  4L5E A;  1UFM A;  3JRB A;  4KN4 X;  2QSH X;  3GTO J;  3QYE A;  3AAF A;  3CES A;  1LVA A;  2X1D A;  2Y48 A;  3ZN1 A;  1NTC A;  4IXA A;  2LMD A;  1BL0 A;  1ZTR A;  3F3X A;  4A69 C;  1ZEL A;  2LR8 A;  1OCT C;  4LD5 A;  4AD9 A;  2IS4 A;  2LDU A;  2HYG D;  3IH4 A;  2IS6 A;  2ZFW A;  4MO7 A;  1IAW A;  3GZ5 A;  2O3F A;  5ICG A;  4IOA F;  9ANT A;  2LF8 A;  2PJP A;  2WTE A;  2E1O A;  1ZKG A;  3ZRG A;  3H0G J;  3LA2 A;  5CQG A;  2R7Q A;  4HAM A;  5HOO A;  1K4S A;  4BQA A;  2Z33 A;  2FOK A;  1ZK8 A;  3S16 J;  3M07 A;  1UHM A;  1LFP A;  2PG4 A;  3DFG A;  2E34 A;  1IN4 A;  4G6D A;  1TQI A;  4ASN A;  5E1Z B;  3GTK J;  2DOA A;  2ZO4 A;  1ZAR A;  1FYM A;  2E5Z A;  3E7L A;  3L09 A;  3A0B C;  2Q8K A;  1TNT A;  2K3P A;  2K4B A;  1WHU A;  3TW6 A;  4XNF A;  2G7U A;  3VEP A;  2M34 A;  3L7W A;  3LST A;  4A3M J;  1XTA A;  2RDP A;  2C6Y A;  1FNN A;  2M9H A;  1DU0 A;  4IJA A;  1Q1H A;  2WAD A;  2HKX A;  5FLX Z;  3PNT A;  1XN7 A;  2W85 A;  3CO6 C;  3U21 A;  3FK7 A;  2N8G A;  1TQM A;  3RQ4 A;  3Q3S A;  2EZL A;  3HGG A;  4UVB A;  3R0J A;  3KFW X;  5HOD A;  4XSZ F;  2Y30 A;  4XRS G;  1R1U A;  3IUO A;  1QHG A;  1B72 B;  2R7R A;  4CO8 A;  3OYB A;  1IN8 A;  3CTA A;  3K1N A;  4FT8 A;  5JR3 A;  4MTE A;  2P5L C;  3RKW A;  3ZQH A;  2V9P A;  1RZ4 A;  4Q4Z F;  1FOW A;  2CYY A;  1OYY A;  5K5Q A;  5HS8 A;  4E70 A;  1S7A A;  2WB1 A;  3H9J A;  5JLW A;  2OA4 A;  1IDZ A;  1U2W A;  1GHC A;  4U0V A;  4PGH A;  2IS2 A;  1FBS A;  4HZF A;  4CCO A;  4Y3O A;  2DTZ A;  4X0G A;  4FX0 A;  5GTI C;  5BS6 A;  2HPI A;  3LSJ A;  2VC1 A;  4Y4R A;  3WTY C;  2MA3 A;  1FBU A;  5CVU A;  2L2O A;  1BJZ A;  4J19 A;  5A2Q K;  3DTI A;  3RTR A;  3K0L A;  5FRM A;  2OC6 A;  2STT A;  4GRI A;  4M3G A;  4A3F J;  2ZJ2 A;  3HG9 A;  4BDZ A;  5J3L A;  1XMK A;  2XGX A;  3BTL A;  4LG0 B;  2A07 F;  1J9I A;  2XVC A;  3K6G A;  4RLF A;  5ILS A;  4M3D A;  4P55 A;  1XC5 A;  4NBQ A;  4E7J A;  4LFU A;  2YU9 J;  2LYC A;  1MMG A;  4A0X A;  1AU7 A;  2CRG A;  5DUI A;  1F4K A;  4HSR A;  1IXR C;  4CCL A;  2VKV A;  2QZ8 A;  3A03 A;  4NNJ A;  4EJV A;  3L2W A;  1G8X A;  1R5G A;  4BE2 A;  5EG0 A;  3S1M J;  4XOR A;  2DDB A;  1MBG A;  3MKZ A;  3DBR B;  1LEB A;  1EF4 A;  2W24 A;  3K7A J;  4IHY A;  3TP0 A;  1HOM A;  4IRG A;  1RIO H;  1PUF B;  2M7A A;  5BOX A;  2HOT A;  1M1E B;  1X1C A;  4ETS A;  5FLM J;  2QEN A;  3HHH A;  1HKQ A;  1HBX G;  1LQ1 A;  3HOV J;  2COM A;  2IGK A;  3PQJ A;  4HEA 2;  3MKW B;  2RAE A;  3CCM I;  4CYD A;  4E4H A;  5E20 A;  4BU2 A;  3RZD J;  2HTJ A;  3S32 A;  1Z1D A;  4JX6 A;  3SXY A;  3KEQ A;  2VXZ A;  2X51 A;  3OYL A;  5LD2 C;  1ZGW A;  2ECC A;  3HOW J;  3G1L A;  1RUN A;  3IWF A;  2A69 F;  1LB2 A;  1U5T C;  3PM1 A;  2IP2 A;  4YG2 F;  2P5K A;  4PGG A;  4XM3 A;  1TTY A;  5AIQ A;  3CJT B;  3SJM A;  1JKQ C;  2VON A;  1I6H J;  2GWR A;  3QOE A;  2VUM J;  1ETK A;  1D1B A;  1SFO J;  5EGO B;  3W3C A;  3BQZ A;  1RPW A;  2M5W A;  1KU7 A;  1MMN A;  4GO1 A;  4A3D J;  4V19 K;  2RGV A;  3OV8 A;  3GYH X;  1XPX A;  3KYC B;  3JRE A;  1Z7L A;  1F9N A;  3KP4 A;  3G3Z A;  4LG3 A;  2EQR A;  2VLA A;  1ZG5 A;  1LDJ A;  2ID3 A;  4BY7 J;  4DBQ A;  2DDA A;  2XAQ A;  4X1E A;  2PFB A;  1REP C;  1APL C;  5HDN A;  2MAB A;  3BC8 A;  1Z6T A;  5KAF C;  1B8I B;  2L0K A;  1ZAO A;  3L9F A;  4WXC A;  1A35 A;  2HTS A;  2OTL I;  4HF2 A;  3OYN A;  3L00 A;  1WSU A;  2HPM A;  1X19 A;  1ZLK A;  2STW A;  2X6X A;  1KON A;  4GCV A;  1HA8 A;  4BXX J;  1ON2 A;  2QKM B;  1PYV A;  5J40 A;  2A6E F;  5TGT A;  1B1B A;  1DQU A;  1L3L A;  2DOE A;  2IRF G;  4Y33 A;  4P9F A;  2F4I A;  4IHV A;  2E1M B;  4XOP A;  1F36 A;  2R5Y B;  5A2Q Z;  2ZNZ A;  1ZG1 A;  3V8J A;  4HW0 A;  4RA2 A;  2K5C A;  3VYR B;  3BR0 A;  3E3V A;  1GV5 A;  3ABM H;  1B9N A;  3AG4 H;  3OOU A;  1UMQ A;  1XGM A;  2FXA A;  2KIF A;  3FXM A;  1G3W A;  1P92 A;  4XLP F;  5EZG A;  5H6Q A;  1ITY A;  2COB A;  3JCU C;  3LSK A;  1BR1 A;  2K4J A;  3CF5 F;  3IHU A;  4IQJ A;  3HPG A;  2GLO A;  2HQA A;  1G6N A;  2KLO A;  2QF7 A;  3WGI A;  1P4W A;  1P4A A;  2EFN A;  3LSR A;  5D5W B;  3VSK A;  3BY6 A;  3NEU A;  2RV8 A;  2EK5 A;  1ETX A;  3BDD A;  2ME6 A;  5C4X J;  4A3I J;  3ZMV A;  3TO7 A;  2FF4 A;  1ETW A;  4BXF A;  2ELK A;  1P7J A;  1RI7 A;  1OCO H;  3MFK A;  1FJL A;  1P2F A;  5E1W A;  2GIZ A;  3ZMD A;  1ZQ3 P;  2VQL A;  5JFR A;  3MZ8 A;  5DCM A;  4FAS D;  4R79 A;  3GTG J;  3BR2 A;  2PQ8 A;  5E3N A;  4FIS A;  3D5R C;  1W36 C;  2LY9 A;  1O3S A;  1V5G A;  4E7K A;  2R7V A;  3VSL A;  4ENN A;  1SFX A;  1ODD A;  2DMT A;  2WAQ A;  2GIV A;  1WVR A;  4BAY A;  4OWR B;  2A5W A;  1WJD A;  1MJ9 A;  1OQY A;  3BG7 A;  2QCO A;  1HC8 A;  2M3A A;  1ETY A;  2MLK A;  5FKL A;  1MBJ A;  4KT6 A;  1PVE A;  3CP8 A;  3AG2 H;  3KP7 A;  4XLE A;  1R22 A;  2OTJ I;  1ZYR F;  4DIQ A;  4RAG A;  3M1C A;  1K61 A;  1VI0 A;  4M6X A;  3WE2 A;  4IEJ A;  4WXD A;  4ZYD A;  3COA C;  4IHW A;  1FIP A;  2XRN A;  4CCJ A;  1IUY A;  3MCZ A;  4P96 A;  4M71 A;  1ZGJ A;  2FMY A;  1YRN B;  2X1E A;  3K4C A;  1IRF A;  1ZR2 A;  1J59 A;  3FXL A;  3W2W A;  4EMS A;  3GFM A;  3K4N A;  3QQA A;  5BPI A;  1KQ9 A;  3E1S A;  2MFZ A;  4ZZL A;  3MMY B;  1IRZ A;  1O7L A;  1V5F A;  3JR9 A;  1WGX A;  4XLH A;  3CO7 C;  3WU1 B;  3OY9 A;  1W0U A;  5HNF A;  3CDH A;  3O3K A;  2D1H A;  3TQN A;  1XDS A;  3OR1 C;  4G6T B;  4HLY A;  1IXS B;  3ZCO A;  4XID A;  2DO7 A;  2KHM A;  1S72 I;  2WV1 A;  3EYY A;  4LB5 A;  2KRC A;  4A93 J;  4ON0 A;  2WAF A;  4RGS A;  4CYC A;  1D1C A;  1N78 A;  3U1K A;  1WCM J;  2CS3 A;  1MJA A;  2FX0 A;  1XGO A;  2EV0 A;  1X3W B;  3GZN B;  1YJW I;  1D0Z A;  2VKD A;  2PLY A;  4JX4 A;  4BQQ A;  3GFI A;  4RB2 C;  2EIJ H;  3FHZ A;  4L0Z B;  2Q0O A;  4HOB A;  1V55 H;  1Z3X A;  1YTY A;  2V1D A;  1TT5 B;  3OS0 A;  1LPQ A;  4ABZ A;  1ETQ A;  3BT9 A;  3VYS B;  1VF9 A;  4IZZ A;  3W6K B;  1I1G A;  1TT0 A;  2GZW A;  3VB2 A;  1HLV A;  4BEH A;  3E6C C;  4OMY A;  3ABT A;  3WTW C;  3HHG A;  1R4N B;  5JI6 A;  5D8K B;  3CCJ I;  2RN7 A;  4PJJ A;  2A3S A;  1A31 A;  3G1O A;  2CFO A;  3T8T A;  2Z3Y A;  4G12 A;  3P9C A;  2VC0 A;  1DGR M;  4OIO F;  5LEK A;  1D8K A;  3Q9V A;  2MSY A;  4TV7 A;  5CYV A;  3IKT A;  2AO9 A;  1I3A A;  3V42 A;  3GWZ A;  1USS A;  2EWN A;  5J6X A;  2DA5 A;  2LSO A;  4C30 A;  3MD2 A;  2WY8 Q;  2ISY A;  3ONQ A;  1R23 A;  3V4G A;  3ZMS A;  1XD7 A;  4NHJ A;  1B72 A;  2QQ9 A;  1U6G A;  3N4M A;  4JOM A;  1AHD P;  2LBF A;  1PDN C;  5JHF A;  5IT3 A;  3LSG A;  3GEZ A;  3L2C A;  1AKH B;  1KYW A;  3OS2 A;  2KPM A;  1K7A A;  3M3Y J;  3OYA A;  1WJB A;  1TC3 C;  2ZSI B;  2DU9 A;  1YFH A;  1O3T A;  3I4M J;  1QZZ A;  3ISP A;  1H9G A;  1HQC A;  2BE5 F;  2L54 A;  5D4S A;  2PMU A;  3BJA A;  1BBY A;  1Z67 A;  4AC0 A;  4BHC A;  2W57 A;  1JUS A;  2DOF A;  2ZXW H;  5EG0 B;  4CUG A;  4JYK A;  4XK4 A;  2R7D A;  2LP0 A;  3BG5 A;  4UV8 A;  2ZBK A;  1NK3 P;  1Y6I A;  1B6A A;  4CH7 A;  2EV6 A;  4MNU A;  2DA1 A;  4PJ0 C;  3CCQ I;  2LK2 A;  3UR3 C;  3QU6 A;  5IP6 A;  3E5X A;  3S1N J;  2G7H A;  1T95 A;  4ZJZ A;  4LG0 A;  1FX7 A;  1FZP B;  1ORK A;  2R7T A;  4RGX A;  2ZXJ A;  2D45 A;  4JK1 X;  3B6A A;  2E1C A;  4HNV A;  2QLZ A;  2DW4 A;  2HFH A;  2FNP A;  2CGP A;  4BDY A;  4RGU A;  1DUX C;  3TKY A;  4RAZ A;  4LB6 B;  1OR7 A;  3RYR A;  3OIQ A;  2MYS A;  3AFH A;  4BHB A;  4YFN F;  2VKE A;  2BYV E;  3Q0W A;  4CA0 A;  1PUF A;  2NVX J;  4KYW A;  4RAF A;  3GFL A;  2RNJ A;  2DAO A;  5D5X B;  1HXD A;  3GVA A; 
#chains in the Genus database with same CATH homology
 4A3L J;  1NTC A;  1BL0 A;  1ZTR A;  4A69 C;  1JT0 A;  2NVT J;  3GTL J;  2EBI A;  4D7N A;  2NVY J;  4XRS A;  3HOX J;  2LR8 A;  4C3I J;  1OCT C;  3DCF A;  1MH3 A;  5E3L A;  5EYR A;  3I4N J;  3IH4 A;  4MO7 A;  3BR6 A;  5GP9 A;  2XPV A;  3S2H J;  9ANT A;  4A3K J;  4M6V A;  2NS7 A;  2JWT A;  1X2N A;  2E1O A;  1ZKG A;  3H0G J;  2Y9Z A;  1JJ8 C;  5EGO A;  4BKX A;  1ZK8 A;  3MKL A;  1H88 C;  1TWG J;  3S16 J;  2HYJ A;  3IV5 A;  2OPT A;  1RR7 A;  2CUE A;  3GTK J;  3LOC A;  3E7L A;  2WB1 N;  1UG2 A;  2M8G X;  3TW6 A;  3S14 J;  2M34 A;  5F27 A;  5JLX A;  4A3M J;  5EZH A;  1B8I A;  2M9H A;  3HGY A;  1DU0 A;  3S15 J;  3ZQC A;  5FKN A;  3WHB A;  5M5X J;  1Y1V J;  2CUF A;  4AUX A;  1VFC A;  2ME0 A;  3FK7 A;  3JRH A;  2N8G A;  3Q3S A;  2XB5 A;  2M0C A;  5IP9 J;  2EZL A;  3C2B A;  3HGG A;  1OJL A;  4RDU A;  5HOD A;  2Y30 A;  3ZOB A;  4XRS G;  1B72 B;  3BTI A;  1JTX A;  2JA7 J;  4MLO A;  3Q0V A;  2KDZ A;  3ZQH A;  5IPA A;  1FEX A;  1GV2 A;  2LKX A;  3OSF A;  2XPW A;  1RET A;  4V2F A;  2VPR A;  2X6O A;  5JLW A;  1IDZ A;  1HDD C;  4DZJ A;  2DTZ A;  2E2H J;  2K9S A;  3F0C A;  3LSJ A;  1HDP A;  1ETV A;  2Y2Z A;  1LE8 B;  3HM5 A;  2IAI A;  3NAR A;  1JUM A;  2JA6 J;  1WH7 A;  3O8G A;  4QSH A;  1MH4 A;  5FKM A;  2AHQ A;  2DMP A;  1JKO C;  1Q1V A;  1BJZ A;  4J19 A;  1ZR4 A;  4UUS B;  5F0C A;  4M3G A;  4A3F J;  1TWF J;  4C3H J;  5J3L A;  1X2M A;  2MGQ A;  3BTL A;  2FD5 A;  2LD5 A;  4M3D A;  2JJ7 A;  5FKK A;  1RES A;  1XC5 A;  2YU9 J;  1AU7 A;  4BY1 J;  5DTD A;  2CRG A;  4LOC A;  1CQT A;  2XPU A;  5F0F A;  2VKV A;  3HBL A;  3A03 A;  4XIC A;  5J1U A;  5EG0 A;  3S1M J;  1F43 A;  1MBG A;  1EF4 A;  3K7A J;  1MNM C;  4IHY A;  3CMY A;  1BW6 A;  3BTC A;  1U9N A;  1TWA J;  3TP0 A;  4DYR A;  1WPK A;  1HOM A;  2X48 A;  3FKI J;  5K7F A;  1PUF B;  2HOT A;  1MSE C;  1OCP A;  4FE4 A;  5K7Z A;  5FLM J;  5IOY A;  2DA6 A;  5K7H A;  5BNG A;  2FJ1 A;  5DS9 A;  3HOV J;  4BBS J;  4JX5 A;  2RAE A;  1ETO A;  4NDL A;  3RZD J;  2O7O A;  3HOY J;  2CU7 A;  4A3J J;  3WHC A;  4JX6 A;  3GTQ J;  4X6A J;  4CYC B;  2ECB A;  1YRN A;  3W6V A;  2DA2 A;  1ZGW A;  2O9L A;  2ECC A;  4MIM A;  5IYC J;  3G1L A;  3LNQ A;  1I50 J;  4GFB A;  3HOW J;  4QIW N;  4FCY A;  3PM1 A;  2XGD A;  3SJM A;  1JKQ C;  1I6H J;  3BR3 A;  4MFE A;  2I10 A;  1WI3 A;  3TW7 A;  2VUM J;  1ETK A;  2E2J J;  5IP7 J;  2FQ4 A;  1SFO J;  4FTH A;  5EGO B;  3BQZ A;  1RPW A;  4A3D J;  2JN6 A;  1G2H A;  1IJW C;  2GBY A;  3SDG A;  3LSP A;  2XB0 X;  3JRE A;  2OF7 A;  2EQR A;  3JRA A;  4S0H B;  4D7M A;  2ID3 A;  4BY7 J;  4M3F A;  4X1E A;  1APL C;  1IGN A;  1IC8 A;  2P81 A;  1B8I B;  2L0K A;  2JA5 J;  2NVQ J;  1GDT A;  5M3M J;  4JP0 A;  3ZQG A;  2O8K A;  3QPL A;  5M5W J;  4BXX J;  5F04 A;  1K83 J;  3CCY A;  3FIS A;  2L7F P;  5IYD J;  3SFI A;  4FE7 A;  5J1Y A;  3VPR A;  1H8A C;  4IHV A;  2K40 A;  1F36 A;  2R5Y B;  2D5V A;  1MBF A;  2LFB A;  4A3B J;  4Y7N J;  4DZP A;  3CQZ J;  5E3O A;  3BR0 A;  1DU6 A;  1GV5 A;  2XGC A;  3OOU A;  3BR5 A;  1UMQ A;  2DN0 A;  3BQY A;  2WAQ N;  4C2M J;  1FTT A;  2DMN A;  5EZG A;  1T56 A;  1ITY A;  3Q0U A;  2COB A;  2CQQ A;  1W0T A;  4UUT A;  2IEK A;  4V2G A;  1NK2 P;  1IUF A;  2GLO A;  3CDL A;  2EH3 A;  2Y31 A;  2VI6 A;  2KT0 A;  4W97 A;  5EDN A;  2QF7 A;  1U78 A;  1FIA A;  3LSR A;  1TWH J;  3TP3 A;  4RBO A;  1GVD A;  4M3B A;  1ETX A;  3S2D J;  2ME6 A;  2R7Z J;  1QPI A;  5C4X J;  3BR1 A;  4A3I J;  4Y52 J;  1Z77 A;  1AKH A;  2GM4 A;  1ETW A;  2ELK A;  1P7J A;  2Y9Y A;  3UKG A;  1XG1 A;  3S1R J;  1FJL A;  2H8R A;  5F1J A;  3S17 J;  1UHS A;  1ZQ3 P;  2HOA A;  1XS9 A;  3BG3 A;  2CQX A;  5GPC A;  3D1N I;  3GTG J;  1JJ6 C;  4D5F A;  3BR2 A;  5E3N A;  2R92 J;  4FIS A;  2LY9 A;  1E3O C;  2R5Z A;  1BW5 A;  2NS8 A;  2DMT A;  3HOU J;  5M3F J;  2R93 J;  1P7I A;  5FKO A;  2MG4 A;  2B63 J;  5M5Y J;  3A02 A;  4A3E J;  2EZI A;  5C3E J;  1IG7 A;  4UUS A;  2HXO A;  1JKP C;  2QCO A;  2W48 A;  3HB9 A;  5FKL A;  1ETY A;  1MBJ A;  3PO2 J;  1GUU A;  2HOS A;  3JRC A;  1JKR C;  5C44 J;  2YUS A;  1K61 A;  1VI0 A;  4IEJ A;  4IHW A;  2E2I J;  1FIP A;  2E19 A;  2R0Q C;  4AYB N;  4B3A A;  5F0H A;  2HI3 A;  1YRN B;  2HDD A;  1U9O A;  1ZR2 A;  3A01 A;  3QQA A;  2PMZ N;  1VND A;  1IRZ A;  1O4X A;  1A6I A;  1MSF C;  3JR9 A;  1WGX A;  3OSG A;  2DJN A;  2YS9 A;  1W0U A;  1TWC J;  5EEA A;  4D5C A;  1JGG A;  2L7Z A;  3HDD A;  3ZQL A;  2X9D A;  2XGE A;  4XID A;  5EF6 A;  2WV1 A;  4A3C J;  5IOZ A;  3L1P A;  4A93 J;  3ZQI A;  2L7M P;  4B4C A;  1MBH A;  4CYC A;  1JUP A;  4I76 A;  4IHX A;  1A5J A;  1WCM J;  1RKT A;  2FX0 A;  3K2A A;  1IDY A;  1POG A;  1IV6 A;  1WH5 A;  4JX4 A;  2JA8 J;  2NOG A;  3GBG A;  2Y0S N;  2EZH A;  4ABZ A;  1ETQ A;  3BT9 A;  1VF9 A;  1QVT A;  2K9Q A;  1HLV A;  3G1M A;  3RKQ A;  5FLV A;  3RZO J;  1HF0 A;  2MW8 A;  2DMU A;  4B1R A;  5FJ8 J;  2M2E A;  2JK3 A;  4BBR J;  1D5Y A;  2DA3 A;  3G1O A;  1Z0X A;  4I6Z A;  1H89 C;  3JRG A;  3HKZ N;  1RKW A;  2ZB9 A;  4G12 A;  3GTP J;  3OIO A;  2MSY A;  2AO9 A;  3RQI A;  2DA5 A;  5C4J J;  2HQ5 A;  2R5Y A;  1MBK A;  2JMW A;  2LLK A;  1S7E A;  2EZK A;  3PO3 J;  1B72 A;  3JRF A;  1AHD P;  2DA7 A;  1U8B A;  2DA4 A;  3LSG A;  1JT6 A;  1AKH B;  1BA5 A;  5F08 A;  2G0E A;  2TRT A;  3FIW A;  1X58 A;  3M3Y J;  1R9T J;  1TC3 C;  3FK6 A;  3B6C A;  1GT0 C;  1JTY A;  3I4M J;  1QVU A;  3ZQF A;  4C3J J;  4A3G J;  2LVS A;  3MN2 A;  1FTZ A;  4DYQ A;  1QRY A;  2L9R A;  1Y1W J;  2R5Z B;  3M4O J;  3IH2 A;  4AC0 A;  4DYC A;  3JRI A;  3S1Q J;  1LE8 A;  1JUS A;  1MBE A;  4MFD A;  5EG0 B;  5GPA A;  4JYK A;  4XK4 A;  1OFC X;  4M3E A;  3BG9 A;  2LTP A;  2TCT A;  2LP0 A;  3BG5 A;  2H1K A;  1NK3 P;  2K9N A;  3JRD A;  2DA1 A;  1SAN A;  2LK2 A;  5IP6 A;  3S1N J;  2DMQ A;  1LFU P;  1T33 A;  3O8H A;  3DEW A;  1ORK A;  2CJJ A;  2XRL A;  3B6A A;  5IYB J;  3H3V K;  4HNV A;  1ENH A;  3NAU A;  4W1U A;  5E3M A;  3GTM J;  1I3Q J;  3HOZ J;  4QTR A;  3A01 B;  4EEF G;  3IH3 A;  3MVP A;  2IBD A;  3HEF A;  5J1R A;  3TED A;  2VKE A;  3GTJ J;  3Q0W A;  2ID6 A;  4DW6 A;  1HCR A;  3BTJ A;  4L5E A;  2XSD C;  1PUF A;  3QPS A;  2NVX J;  1LFB A;  3JRB A;  2HXI A;  3GTO J;  4XRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...