4M6YA

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
335
structure length
335
Chain Sequence
b'TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHLFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 114
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m6yA01
1S8NA 2PEXA 3WE3A 2F2EA 4N0BA 1MZBA 3KP2A 2FRHA 4U0VA 3BJ6A 5IT9K 2VN2A 3ELKA 3MQ0A 1IAWA 1AOYA 3J7AO 2HEOA 1MJBA 2EFNA 2ZCWA 1B9NA 1HBXG 1WI9A 3H3ZA 2GA2A 1W5SA 3IWZA 1PUEE 3IRQA 2Z99A 4WCGA 1WWXA 2OQRA 3B73A 1LJ9A 1RZ4A 1WKMA 4U88A 2VXZA 2VC0A 3VOEA 5HS7A 1E17A 2Q8KA 3BPVA 3V7CA 2XAHA 3DP7A 2EB7A 3NRVA 4Q4ZF 2W85A 4MTDA 2YPRA 1OR7A 3JAMZ 1CF7A 3ABUA 5D8KB 1KQ9A 5DV5A 5LEKA 1J5YA 4EMSA 2MLKA 1IRGA 1BJAA 2VBYA 4HLYA 2F5DA 5TJJA 5E20A 2VE8A 1CGPA 5JHUA 4KFCA 2D2WA 4HX7A 1SFEA 3QP5A 1TW3A 4PZJA 4XLNF 2P6SA 1FOKA 3E6DA 4G6QA 1JE8A 2FBIA 4CDGA 1FYKA 1W7PD 1P4AA 1IF1A 2F5CA 4HQEA 4HDVA 2XKOA 2V1XA 1UB9A 2QM3A 2L4MA 1LVAA 5J8CA 2COMA 3ECHA 4U0YA 4LMYA 1GXPA 5KK1A 4MEYF 3F8CA 2GIVA 2OU2A 4OMZA 5CVVA 4UV8A 3V7SA 2WTEA 3CLOA 3R6SA 2OQGA 1IUYA 1FNNA 2VBXA 1L0OC 1FYLA 1Z6RA 5K5QA 3L9FA 4MQ9F 4ON0A 1ZG5A 1R58A 2OAZA 5FGMA 1SD7A 3JTGA 3JW4A 2NYXA 5DEQA 3IKVA 1ZARA 3Q9SA 3SZTA 3R0AA 2IPQX 3PQJA 2HWVA 4BHBA 1XN7A 2PBIA 3I53A 3ULQB 3EUHA 1OMIA 3WTXC 4LGWA 2VT2A 1D8KA 4R1HA 2G7UA 3V8JA 2ZFWA 4L9NA 4CHUA 4EJUA 1ZG1A 2DPDA 3KFWX 2AS5F 2RQPA 3SZPA 4KMUX 2QQBA 4KN4X 1ZLKA 5DCMB 3EDPA 3KZZA 2VOOA 4HAMA 1O7LA 2KJBA 3FMQA 4DQ2A 2XIGA 3LA2A 3V7RA 3KETA 3RYPA 1ZRDA 1BOAA 3O6BB 2A6HF 5FFXA 4HLXA 3U9GA 3HUGA 4Q48A 3WG9A 1WQ2A 2MBFA 2GAUA 1B1BA 5H6QA 4RGSA 5KVRA 2MC3A 2W25A 2Y75A 2D45A 1GXQA 3TO7A 1DPRA 2EV6A 5H6RA 3LSTA 4UVAA 3OOPA 4RGRA 3DF8A 3HSRA 4RGUA 4HOBA 3WODF 3M7GA 1FX7A 4BYYA 2HYGD 4M74A 3MAJA 2O3FA 4ETSA 4WX9A 1ODDA 1KQ8A 1U5TA 5H20A 1ZGJA 1YFHA 1YW8A 3GF2A 1LEAA 4BQAA 3LA7A 1DP7P 3CDHA 1XDUA 5LHIA 4U0WA 2FXAA 1KU2A 1P4XA 5L3GA 2ETHA 4NQWA 1G3YA 1P4WA 1JXSA 2MLGA 2DLLA 5BPIA 3R61A 5FFZA 3E5UA 1RI7A 1ON1A 2DQLA 3TKYA 1YQAA 1GHCA 1P6RA 1T6SA 1KYZA 1SFXA 3MWMA 1IN8A 2UXXA 3I5UA 1V3FA 3TDUC 2A61A 5E1XA 3HOTA 4EM0B 3TGNA 3WE2A 3L00A 3GW2A 3K69A 3M1EA 1BIBA 1KA8A 4ENKA 2P5LC 4EQQA 4CYDA 3L7WA 2XASA 1QZYA 3P9KA 4P96A 1O57A 4MQVA 2CGPA 1I5ZA 2JSCA 1AWCA 1U5TB 5CVUA 4IPAA 2XRNA 2BE5F 1RNLA 1EH8A 3FMSA 3GZ5A 4MNUA 4ZYHA 1PP7U 2DAOA 1XGOA 2XGXA 1KU9A 5K1YA 3KP3A 4M71A 4EM2A 2G9WA 3GO5A 4WXDA 2XVCA 3ZMDA 5HLHA 1FP2A 2ISYA 1W4MA 2YSRA 1J7KA 1QGPA 4FX4A 3ZPLA 4L18B 3KEQA 3F72A 1HSTA 1EH6A 1OYYA 1K6OA 2W24A 3TO6A 2QQ9A 1HW1A 4OIRF 1KU7A 1KGSA 2L54A 3I0TA 4LB5A 4EGYA 4LG0A 4I01A 4BNCA 1HSJA 1B9MA 3V8LA 4EV0A 3E3VA 2ZXJA 2KIUA 5LHHA 3ZN1A 1ZHFA 1MGTA 3CUQC 1FSEA 4HF2A 2VONA 2JZYA 2Z5UA 3QU6A 1W7PA 2BGCA 2D1VA 1FY7A 2F5EA 2A5YB 3BY6A 2HYFA 3DXJF 6PAXA 2EFWA 5L3FA 2HZTA 4D0PA 4KNYA 1F5TA 1R36A 4HX4A 1U8RA 2W84A 4HF0A 3J80K 1JGSA 3ZMUA 3G73A 1Z9CA 4B09A 4I0BA 3K1PA 4RGXA 3F8NA 2RGVA 2ESHA 5JI6A 5TRDA 4YFKF 2JRTA 2L4AA 4G8XA 4I02A 3BPXA 4WK8F 4M9XA 4H0EA 2ACJA 4M73A 4BHPA 1ZN2A 4K2EA 4ENMA 1Y0UA 1QZZA 4CO8A 1XGSA 4IXAA 3KP5A 4CZZA 3ROUA 2VODA 4OU0A 2RN7A 4L9JA 4RB2C 1HKTA 1K79A 1C0WA 1B4AA 3GFJA 4BAYA 1L3LA 5E8GA 3DPTA 2C6YA 1IW7F 2EA4A 2MH9A 5DYMA 1LDDA 5FLXZ 2QYOA 3J81Z 1ZLJA 3RKXA 5BPDA 3O3KA 4LK1F 4WWCA 3OV8A 2DQRA 3I58A 2CFXA 2O03A 4A0XA 2LF7A 4R79A 3RYRA 4OOIA 3ABTA 2IW5A 3E6MA 3PQKA 1H9TA 5LGNA 2R3SA 2VOPA 4G7OF 3R4KA 1G3WA 3REOA 2A6EF 5K5OA 2E7XA 5ED4A 2KJCA 4QWQA 1FLIA 5K5RA 3JTHA 4AIJA 1SD5A 5DCFA 3VEPA 2IP2A 3F21A 2XAFA 1LQ1A 2HKOA 1FYMA 4IF4A 2IT0A 1KQ0A 2M8EA 1K78A 1BI0A 1TQMA 3VB2A 1TTYA 2D1HA 3F6VA 4O5VA 1YLFA 1BI1A 3ERED 4L9TA 4EJTA 5JVTA 2FSWA 2WV0A 1J0RA 2HTSA 3HRUA 3L09A 1BC7C 1LEBA 2VC1A 3MFKA 4HBLA 3U1DA 3ZN0A 2VE9A 1USSA 1PDNC 2LDUA 3GZ6A 5DD4A 4UV9A 2PG4A 3TQNA 2MD5A 1RUNA 2O6GE 1RUOA 4UVBA 4JK1X 4Y17A 2EV0A 1BBYA 3HSEA 4LFUA 4N9IA 2EJRA 1CF7B 2PMHA 1HQCA 1B59A 5BOXA 4YIIA 3BDDA 4I7HA 3M8FA 1O3QA 2H94A 4IJAA 2M5WA 1D8JA 4XLPF 3LQQA 4L0ZB 3QPTA 3BJAA 2FNAA 4FT8A 3I64A 5HLIA 5L3DA 2ZKZA 3QOPA 2J5OA 2FBKA 3GFMA 1XCVA 2ZNZA 2H6BA 4OIPF 5ILUA 1K78B 3GVAA 1YO5C 5CVIA 3I4PA 2QZ8A 2UZKA 4L0YB 1R23A 5FB2A 1V4RA 4M72A 3FM5A 5L3EA 3WTSC 1WRJA 3CUQA 3R60A 2CSOA 5HDKA 5DD8A 4LB6B 2GQQA 5A2QZ 2X4HA 4O3MA 1OKRA 5D4RA 5F1RA 1S3JA 4EJWA 5HLGA 4IRGA 4JBAA 2XKPA 4WXCA 5FO5A 5JR3A 4ENJA 5LRSA 1TNTA 2RC4A 1SD4A 4ZYGA 4Y15A 3WGIA 3QRFF 4LLLA 2H09A 1YIOA 4RB1A 3HRMA 1R00A 3HSFA 3HTSB 5AIPA 1G6NA 2DK5A 3F3XA 1Z91A 3GXOA 3TOBA 1K7AA 2QUFA 5J8FA 3NEUA 2R7DA 1EV7A 3V8KA 2YX7A 3LQRA 1R5GA 5DUKA 2E1NA 1U2WA 1LNWA 2FOKA 2PFBA 3QAHA 1XD7A 3EYIA 4PGHA 2RNJA 2J5PA 3LA3A 4GO1A 1BM9A 1MJ9A 4EJVA 4OIOF 4G6DA 5ILSA 1D5VA 5LGTA 3JSPA 3N97A 1SAXA 3RPUA 2UXNA 5DDGA 4HYEA 1O7FA 2YR2A 3W6KB 5D5XB 4G94A 3CUQB 4KMFA 1ZH5A 1XB4A 4IRIA 3HHGA 4UXNA 5ICFA 2Z9OA 1G3SA 3JAMK 3I54A 2CYYA 5JFRA 1G3TA 4R8HA 2QENA 3HOSA 2DFIA 4A12A 5HS9A 1EH7A 3MEXA 1RIOH 2GA1A 5IT9Z 4EJOA 1BI2A 2H6CA 3S2WA 2HS5A 3WTTC 3ZMVA 2GZWA 2KKOA 3RTRA 2RVCA 2DK8A 4WXHA 5LGUA 4IRHA 2LNBA 2STTA 3F8FA 3BROA 3D0SA 1DUXC 2BEOA 1NHAA 5HDGA 3F22A 4IVNA 4L9VA 3IRRA 3CUOA 4G9YA 3FXUA 1ZREA 1I6XA 3P7NA 5FD5A 1Z6TA 1YG2A 2A07F 2DBBA 2XROA 5D6FA 2ZJ2A 2YU3A 1R1TA 3ZQ7A 1SD6A 3KP7A 4AVPA 3M8EA 3WGGA 3G3ZA 3ZMTA 1R22A 2P5KA 1I27A 2TDXA 5LLQA 4RAYA 4A6DA 2AXLA 1R1VA 4A5NA 4ENNA 3F6OA 1IXRC 5D8LB 3RPQA 1XMAA 1H0MA 3FX3A 2PMUA 2QQAA 3P9CA 4LD5A 3NQOA 5HS8A 2WWYA 3E6BA 3GLXA 3C3WA 2FBHA 2FE3A 4M9ZA 1ZGAA 5BMZA 1S29A 2M45A 4U7DA 3KP4A 2GXGA 4I0AA 1TLHB 1R1UA 2G7HA 5D5WB 3GYHX 1YTYA 4A2UA 4M6XA 2RV8A 4HF1A 3QPHA 4ESFA 4LLGF 3F23A 1UFMA 5AONA 4GYGA 3MZHA 2KIFA 3IL2A 2DTRA 3K9TA 3LFKA 1XSXA 1T39A 5J6XA 2NNNA 4A5MA 1SMTA 1J9IA 2FNPA 4MTEA 5HVQC 5E8IA 2CWEA 3DQVC 4UHTA 2VT3A 3V4GA 2FQ3A 2Y48A 1S6LA 5LEJA 3SHFA 1Z1DA 5LBQA 2MH2A 4UNOA 3ECOA 2F5FA 1SMYF 4AD9A 2EFPA 2ADUA 3BOQA 4OIQF 1UCRA 3RKYA 3U2RA 3HYIA 4P9UA 4OMYA 1T98A 3PFIA 5BQTA 1HKQA 2LKPA 4Q5SF 3BZ6A 3LAPA 3N4MA 5ICCA 4S04A 4ZH4F 2JT1A 4RB3C 2BBYA 4LG0B 1PP8F 4DNCA 3FHZA 4MEXF 4UUVA 2DI3A 3TOAA 4M6YA 5E17F 1FC3A 2NRAC 4G7HF 2OD5A 1JHFA 4EM1A 2V79A 2K27A 1REPC 2P5VA 2Y0MA 4GYIA 2IRFG 4I09A 3P9IA 4KA4A 2WC2A 4RS8A 3SFZA 4FX0A 3LAJA 5EEGA 3F8BA 4YG2F 2EV5A 2ZBKA 2ESNA 5DUIA 5D5UB 1FP1D 1W7PB 4ZZLA 4ESJA 4PCQA 5L3CA 3GEZA 1T0FA 1KU3A 3DEUA 3JSOA 1U78A 2X0LA 1X3UA 2JPBA 4EGZA 3DFGA 4P55A 1T38A 2M1BA 3H92A 5HOOA 1XGNA 1BIAA 2CG4A 3DKWA 1F9NA 2LSOA 2K4JA 1IXSB 5D4SA 3E6CC 3FM3A 4TV7A 4UVCA 4IHTA 5D6EA 1QPMA 2A3SA 5ICEA 3HRTA 1STZA 4U7BA 3GFIA 2PN6A 2K7LA 2EFOA 2OZ6A 2Z33A 4ESBA 5ERIA 4PDKA 5LRRA 4HQMA 4Z2YA 1UHMA 1G4DA 1QO0D 5CVRA 1S7OA 3O2PE 1D3YA 4XSXF 4GGGA 3K0LA 5CJ9A 4HX8A 1FWZA 3T5XA 2ZO4A 4ZZDA 2KRFA 2BYVE 1YYVA 4KIBA 2O61A 1LB2A 4YFNF 1Q1HA 2K4BA 1KYWA 4ZYDA 3M9AA 1ZG3A 2UWMA 2FMLA 3C1DA 5ILVA 1F1ZA 1IN5A 2HQNA 4L5IA 2HQRA 2RKHA 3CJNA 4A0YA 1YS6A 2IA2A 5DCMA 2ZMEA 3FF5A 3WTWC 3HTUA 3Q9VA 4FHTA 3BWGA 1MDMA 4MGRA 2HDCA 1YW7A 3GUDA 3EETA 2HKXA 1S7AA 1BI3A 2DW4A 2DPUA 4A0ZA 3ISPA 3LWFA 2OZUA 5E1WA 4E70A 3I59A 1MJAA 2A69F 2L01A 2M30A 3KP6A 3WU0A 1HW5A 4JQFA 4B8XA 4HZFA 2HR3A 2NAZA 3FWEA 3WTUC 2P8TA 2PLYA 4HA8A 1O3TA 3MZYA 2STWA 3K1MA 1OYIA 2YX4A 3ZMSA 4WF2A 2M87A 3C18A 1HW2A 3ZP5A 1P2FA 3WTZA 2XAQA 3WTYC 2R7FA 1DDNA 2EWNA 1A04A 2PI0A 4HW0A 2XUBA 1T2KA 1FT9A 3KZYA 2Q2EA 5LHGA 4ZYEA 4KDPA 1E2XA 3F8MA 4KT5C 1B6AA 2ZMEB 2FEZA 2K02A 1R5HA 3KLOA 2L3DA 2JPCA 1OPCA 2A68F 1FBSA 1VTNC 1MDMB 2O8XA 3MCZA 4LJZF 3WGHA 4BHCA 3RI4A 4KIFA 3I59B 4HV5A 5BS6A 4LLNA 2L02A 1J2XA 2DU9A 1SFUA 5FLXK 3J81K 2PQ8A 4GXOA 2XHKA 1ONVA 3J80Z 4RAZA 1XSDA 2QWWA 4KYWA 1J59A 1YS7A 2DT5A 5CYVA 3TO9A 3D5LA 1I1GA 4AIKA 2OBPA 2CO5A 1QBJA 1ZRCA 2QLZA 4YIFA 2HFHA 2V6CA 3I71A 2ZNYA 3WTVC 4P9FA 3CO6C 3HHHA 1F4KA 3COAC 2RDPA 1USTA 3FZVA 1R7JA 1Z05A 2GXBA 2QBYA 1TBXA 5AIQA 2FMYA 4CGZA 2VBZA 2IA1A 3EQLF 2LF8A 1ZRFA 3K1NA 5EEHA 3T8RA 4G7ZF 4LK0F 1YW9A 3VODA 3IKTA 3QU3A 2EFQA 5CLSA 2EK5A 4KICA 4KN7X 3T8TA 4XSZF 1IZ1A 2IVMA 4XRFA 1QNTA 3QP6A 2ISZA 1XGMA 3KCCA 1W5TA 3DPLC 4IHSA 4F7ZA 2P6TA 3SQNA 2KIMA 2V1DA 1HXDA 2P7VB 4RB0A 2E7WA 3CO7C 3W6JB 3TDZC 1ULYA 3K2ZA 1IN7A 3HIFA 5L3BA 2FF4A 2XV4S 3GWZA 4Y13A 4S05A 2QVOA 2FA5A 5HDNA 4N9HA 3SXYA 1QQIA 4O6JA 2IJLA 1JHHA 1ZAOA 2DO7A 2NS0A 3GX4X 2FU4A 2PJPA 2IA0A 3E97A 2JTVA 3AAFA 1TW2A 5E1ZB 1WSUA 2CW0F 2OA4A 4A6EA 4EVIA 4I2OA 1MKMA 3KE2A 2QBYB 3T1BA 1U3EM 3DV8A 1FSHA 1LDJA 4XBFA 3R0JA 4MHGA 1I1SA 2EA2A 2HGCA 3E5XA 4I98B 1FBQA 2H27A 3BP8A 1IRFA 3IC7A 3FMRA 3RIRA 1XMKA 2Z3YA 3WU1B 2HOEA 2V1UA 5F64A 4PGGA 3BJOA 2ELHA 4CICA 4OINF 3RJPA 3E5QA 5CVJA 3ZMZA 2P4WA 5ICGA 5E18F 1Z7UA 1HKSA 1FPQA 3B02A 2P7CB 2VBWA 2HTJA 3FXRA 3FXQA 4NB5A 2MA3A 5A2QK 4BH9A 4NHJA 4KUMA 4QLCU 4YFXF 1MD0A 3L2CA 1H9GA 3IWFA 2CQKA 3HRSA 4KIGA 5FD6A 3H3UA 1LDKB 1IN6A 3T0YA 1IXCA 4GCVA 2GWRA 4BXUA 2B0LA 2Q0OA 2XAJA 3CTAA 2BV6A 2O0YA 2K86A 1BN5A 1XSVA 1BC8C 3KLNA 4HDUA 1OYWA 4L5JA 3ML6A 3Q5FA 3VFZA 5IT3A 1J75A 4P5OA 4AWXB 1U6GA 3IHUA 1FZPB 3C7JA 3EYYA 1O3RA 1XCBA 5F6FA 1O3SA 1TQIA 4Q47A 3RKWA 1FBUA 1IN4A 4M9SA 1UHWA 3KEOA 4ASNA 1XDSA 2W57A 4AIHA 1GVJA 2XAGA 2E1CA 1P92A 1TQPA 1U5TC 5D5VB 1ZYRF 1TNSA 3GFLA 4HV6A 2V9VA 4CXFA 1DPUA 2NNYA 1ON2A 3RDIA
chains in the Genus database with same CATH superfamily
2P81A 3BTJA 4C3JJ 1S8NA 2PEXA 3WE3A 2F2EA 4N0BA 1MZBA 2KZGA 3KP2A 2FRHA 4DW6A 2HI3A 2JA7J 4U0VA 3BJ6A 5IT9K 1TWCJ 2VN2A 3L1PA 1VQ9I 3ELKA 3MQ0A 1IAWA 1SC7A 1AOYA 5H2FC 3J7AO 2V9KA 2CV0A 2HEOA 1MJBA 2CH0A 3PL8A 2KDZA 2EFNA 4W1UA 3CLQA 2ZCWA 3K70D 1BA5A 1B9NA 4G6TB 1HBXG 1WI9A 2IGKA 1FIPA 3L2QA 1UG2A 5F27A 3H3ZA 2NS7A 1VFCA 2GA2A 1W5SA 3IWZA 1ZR2A 1PUEE 1JUSA 3IRQA 2GOXB 2Z99A 4WCGA 1WWXA 2OTJI 1HCRA 2OQRA 2D5VA 3HGGA 4RM3A 3H9GA 2EILH 3B73A 3ZQHA 4IQ4A 1LJ9A 3E7LA 1RZ4A 2RQQA 5J4VA 1WKMA 4XICA 4U88A 4CYCB 2VXZA 4V19K 5KCMA 1OCZH 2VC0A 3VOEA 2LH9A 2VKVA 4D7NA 5HS7A 1E17A 4M3DA 4XORA 2Q8KA 3S15J 5KHDA 3BPVA 4BEHB 1PUFA 3V7CA 3AG1H 2XAHA 3DP7A 2XGEA 2R7OA 3HKZA 1EF4A 2WAQN 2EB7A 3NRVA 4Q4ZF 2W85A 4MTDA 3HL2A 4A3FJ 2YPRA 1OR7A 3JAMZ 4I76A 2LKXA 1CF7A 3ABUA 3BG5A 5D8KB 4XOTA 1KQ9A 3IUOA 5DV5A 5LEKA 1J5YA 4EMSA 2HQ5A 1IV8A 3ZQQA 4DBQA 2MLKA 1IRGA 1BJAA 3BR2A 2VBYA 4HLYA 2F5DA 4AIDA 5TJJA 2H1LA 5E20A 2VE8A 5E3LA 2BXZA 5JHUA 3CCUI 1CGPA 4KFCA 1WGXA 3BC8A 2LLKA 2D2WA 1QVUA 4HX7A 1SFEA 1UAAA 3QP5A 1TW3A 4PZJA 4XLNF 3FXOA 2P6SA 1FOKA 2JRMA 1ZR4A 4BACA 2B9SA 3E6DA 3OSFA 4G6QA 1JE8A 2FBIA 4CDGA 1FYKA 4DOZA 1W7PD 5C4JJ 1P4AA 1IF1A 2F5CA 2VJ4A 4B1RA 1T56A 4HQEA 4HDVA 2XKOA 1LUJB 3AG3H 2V1XA 3QPSA 1UB9A 2IS1A 3AFHA 2QM3A 3BG9A 3K6GA 2W1OA 3MN2A 2XPVA 4HNVA 2L4MA 3GTQJ 3I56I 1LVAA 1X19A 2ZC2A 3MZ8A 5F0FA 1F36A 5J8CA 1MMSA 2COMA 5IYBJ 1JT6A 3GMEA 3K70C 2HDWA 1QU3A 2LG4A 5DM7F 1IC8A 4E7KA 3ECHA 1VF9A 3JRBA 2F4MB 4U0YA 2KQRA 4B43A 4LMYA 1GXPA 4JX5A 5KK1A 1VQMI 2BXYA 4RLQA 1VQKI 4MEYF 4YEJA 3F8CA 2X1CA 2X1EA 4N4OB 1A6QA 2CV2A 2GIVA 1SFKA 2OU2A 4OMZA 5CVVA 2LBFA 4UV8A 3V7SA 5F0CA 2LC2A 2PMZN 4MIMA 2WTEA 1UELB 4LIUA 1JKOC 1YOVB 2L9VA 3CLOA 3R6SA 3ERMA 3CMYA 1OISA 2OQGA 1POGA 1BOBA 1FNNA 1W1WE 2VBXA 1IUYA 1VQ4I 2VUMJ 1L0OC 3S16J 2Y30A 3AL0C 5HLTA 3OR1C 3S1QJ 4E7JA 4BY7J 1FYLA 3LSIA 1Z6RA 5K5QA 4MFDA 3L9FA 4NC8A 3S93A 4MQ9F 2IS6A 1T08B 4ON0A 1ZG5A 1R58A 5IYDJ 2OAZA 5FGMA 1SD7A 3JTGA 3JW4A 2NYXA 5DEQA 2K9MA 2HNHA 4HSTA 4BXFA 3IKVA 1ZARA 3Q9SA 3SZTA 3R0AA 2IPQX 3PQJA 1UJ8A 2DMTA 2HWVA 2L9NA 3MKLA 1TWAJ 2KZVA 3CF2A 4BHBA 1FTTA 2VASA 1UZCA 1XN7A 3S2DJ 2PBIA 3I53A 3ULQB 3EUHA 2COBA 1OMIA 3WTXC 2AO9A 4LGWA 1IDZA 3H0GJ 3K4JA 4XM3A 2VT2A 4HSRA 3HC7A 1D8KA 4R1HA 2G7UA 1ZELA 3I4NJ 3UR3C 3V8JA 4XKVA 4XR6A 4XLCA 5EDNA 2ZFWA 3ASOH 4AYBN 3HDDA 4A3MJ 1WJDA 2HVRA 4L9NA 3RZOJ 4IOCF 4CHUA 3SDBA 4EJUA 1ZG1A 1B72B 3KFWX 4BDYA 1LE8A 2L7FP 2RQPA 2AS5F 2DPDA 3SZPA 3WHBA 2G0EA 1LPQA 4KMUX 2M0CA 1DU6A 3TP3A 3FK6A 2QQBA 4KN4X 1ZLKA 2R7SA 5DCMB 3EDPA 2E1MC 3KZZA 3OYCA 1NK3P 2VOOA 4HAMA 1IGNA 4JX4A 1O7LA 2KJBA 3FMQA 4DQ2A 2XIGA 1VQ5I 3LA2A 3V7RA 3KETA 3RYPA 1LFUP 1NG6A 1ZRDA 3KZIC 1BOAA 2DDBA 3O6BB 2A6HF 5FFXA 2Y2ZA 4HLXA 1HDPA 3U9GA 2H8RA 3HUGA 4FE7A 4Q48A 2LBFB 3HG9A 4PJJA 3WG9A 3PO2J 1V5GA 1WQ2A 3DKYA 3OS0A 5FKLA 2MBFA 2GAUA 3EUKL 1B1BA 1AU7A 5H6QA 4RGSA 4XLHA 5KVRA 2MC3A 2W25A 2PJRA 1TC3C 2Y75A 2D45A 1GXQA 3TO7A 4XRMA 1QRYA 1DPRA 2EV6A 1T95A 5H6RA 2K5CA 3FKIJ 3LSTA 3JR9A 4UVAA 3OOPA 2M9HA 4RGRA 1R49A 3DF8A 2HQAA 3HSRA 4DJAA 5GTHC 4RGUA 5FLMJ 2DODA 3WU2C 2A5WA 2DYSH 3LL7A 4HOBA 3WODF 3M7GA 1FX7A 4BYYA 2OV7A 1R71A 1TZLA 2V7FA 3GLLA 3M1CA 4Y4RA 2CFOA 1PVEA 2XPWA 5CQEA 1WHUA 3RQIA 1ENHA 2HYGD 4M74A 3MAJA 2NVTJ 2O3FA 4ETSA 2XF5A 1MNDA 4WX9A 2DA5A 3DTIA 1ODDA 1KQ8A 5J47A 1U5TA 1BR1A 3D5RC 5H20A 4XNFA 3H9JA 5GP9A 5HNFA 3C2HA 1ZGJA 2MYSA 1YW8A 1YFHA 3GF2A 1LE8B 2AXTC 1LEAA 1N77A 2Q2EB 1SVOA 4BQAA 1DQUA 1TT5B 1GLNA 3G1OA 2ELJA 3LA7A 4DYCA 1DP7P 3CDHA 1XDUA 2QCOA 5GPCA 5LHIA 4U0WA 2FXAA 2RREA 1KU2A 1P4XA 5CKTA 5L3GA 4F92B 2ETHA 3OS2A 4NQWA 3ZQGA 1G3YA 1P4WA 1JXSA 1JI8A 4ZC3A 2GXAA 2MLGA 2MW8A 4M6VA 1B8IB 1WI3A 2DXIA 1ETOA 2DLLA 3S1RJ 2ZJQF 1ACIA 3HZJA 4BE0A 4B4CA 5BPIA 3QOEA 2E1OA 2XB5A 3RZDJ 1YI2I 4XMYA 1PYVA 2VB6A 3R61A 5FFZA 3E5UA 1RI7A 1H89C 1ON1A 2DQLA 2ZXWH 3C2BA 3FXMA 3OIOA 3TKYA 1YQAA 1GHCA 1P6RA 1T6SA 1KYZA 1SFXA 2K9NA 3MWMA 3VYUB 1IN8A 3OYDA 3HOUJ 3JRCA 2UXXA 3I5UA 1V3FA 4YIRX 3TDUC 2A61A 3K4KA 4OWRB 1YIJI 5E1XA 1S9HA 3G1LA 2ZXIA 5GTIC 3HOTA 4BJ5C 4EM0B 2K9LA 3OYHA 4Z6YA 3TGNA 3WE2A 4XONA 3L00A 4IOAF 3GW2A 3G4SI 1I50J 3K69A 3M1EA 1BIBA 3ZOBA 1KA8A 4XOPA 1OFCX 4ENKA 2P5LC 2R5YB 4EQQA 3Q0UA 4CYDA 3L7WA 1AA7A 1WVRA 1A36A 5IOZA 4RAFA 4Y7NJ 2OCCH 2XASA 1QZYA 2LYCA 3RCOA 1FOYA 3P9KA 4P96A 1O57A 4MQVA 5EEAA 2CGPA 2JA2A 1I5ZA 2LP0A 2JSCA 1AWCA 1X3ZB 4D5CA 1X2MA 1U5TB 5F1JA 3FBIB 2ECBA 5CVUA 4IPAA 1X2NA 3IV5A 4CCKA 2XRNA 2BE5F 1RNLA 1EH8A 3FMSA 1OJLA 1A5JA 3GZ5A 4L5EA 4MNUA 4ZYHA 1PP7U 2XSDC 2DAOA 1XGOA 3NWTA 3CESA 2XGXA 1KU9A 2F6CA 3DU5A 2CUJA 3KP3A 5K1YA 4M71A 4EM2A 3ZQCA 2G9WA 3LSGA 4BJTA 3GO5A 4GRIA 2XVCA 4WXDA 3ZMDA 1P7IA 3M8JA 5HLHA 1FP2A 4NQWB 4M3BA 2XAUA 4FE4A 2ISYA 2HPMA 2DMNA 1W4MA 2OPTA 1WJBA 3V42A 2YSRA 1J7KA 1QGPA 2LK2A 4FX4A 2LD5A 1R4MB 3ZPLA 4L18B 3KEQA 3FIWA 3F72A 1HSTA 1EH6A 1OYYA 4XKBA 3A0HC 5TGTA 3ABLH 1K6OA 2ZJRF 5IYCJ 2W24A 3TO6A 3S14J 2QQ9A 4BY1J 2IEKA 2MFZA 1HW1A 1Y6IA 2CRGA 3UNGC 4OIRF 1KU7A 2DA7A 3WHCA 2XGCA 1KGSA 2L54A 4FQGA 3I0TA 4LB5A 4EGYA 4X0GA 4LG0A 2CW8A 4I01A 2GLOA 3K4CA 1XX5A 3FISA 3U1KA 4BNCA 5E3MA 1HSJA 1B9MA 2HU9A 3V8LA 4XLEA 4UB8C 4AVZA 1VQ8I 4EV0A 3E3VA 2ZXJA 1YE9A 3A4CA 2R7UA 2KIUA 2L5QA 1ZKGA 2FJ1A 3FXKA 3RPUD 5LHHA 3ZN1A 5HODA 1ZHFA 3W2VA 1MGTA 3S32A 3CUQC 1FSEA 4BQNA 2GBYA 4HF2A 1TWGJ 4HNTA 2IS2A 2CW7A 2RNGA 4GFBA 3S3NA 1X3WB 4ZDOA 2VONA 3GBGA 1WCMJ 1WJ5A 2JZYA 3B6AA 5B1AH 2QKLB 2Z5UA 4PK4A 1OLTA 1LFBA 3QU6A 4E7ZA 1W7PA 2BGCA 2VXDA 1P9QC 2D1VA 4CCOA 1FY7A 3HPGA 2DDAA 2V26A 2F5EA 2DA4A 1GDTA 1W0UA 2XC7A 3GTOJ 3TMOA 4JOMA 1MSEC 2A5YB 3BY6A 3ZGKA 2HYFA 1TL8A 4BQOA 4UUSB 1OQYA 3DXJF 6PAXA 2EFWA 5L3FA 1W36D 2HZTA 4D0PA 4KNYA 3Q0WA 4C30A 1F5TA 1R36A 4J00A 4HX4A 1U8RA 2W84A 4HF0A 3CCQI 4OAYA 3SEZA 1JGSA 3ZMUA 3J80K 3G73A 2NVYJ 1Z9CA 4B09A 4I0BA 4D7MA 4DZPA 4B3XA 5EG0A 1XTAA 3K1PA 2K85A 2KL4A 4RGXA 3RSNA 3PIPF 2X85A 3F8NA 2RGVA 1PJRA 4FASD 3WG7H 4AUXA 4KISA 2ESHA 1K4SA 5JI6A 5TRDA 4PUSA 3OYAA 4YFKF 2JRTA 2L4AA 4G8XA 2MC4A 3LSMA 4I02A 1U8BA 3BPXA 4WK8F 4M9XA 3FXLA 1Y0NA 4JX6A 5J40A 1WFXA 3VYSB 1J09A 2Q1ZB 2VKEA 4H0EA 2ACJA 4CSWA 4M73A 4B47A 4BHPA 1ZN2A 1D0XA 4K2EA 4ENMA 1VQOI 3AL0B 4DGWB 4HPQA 1Y0UA 1QZZA 4CO8A 1XGSA 4IXAA 2VQGA 3KP5A 4CZZA 1YHQI 1QA6A 3ROUA 2VODA 4OU0A 1BR2A 3ZR8X 1U9NA 2RN7A 4L9JA 3TEDA 4RB2C 1DGRM 1HKTA 3VSKA 2KRHA 2V9PA 1K79A 1TWFJ 4XQFA 3HOZJ 4ZTFA 1TP4A 1B4AA 1C0WA 1E0EA 3GFJA 4FETA 1WH7A 1TWHJ 3H5AA 4BAYA 1L3LA 3ABKH 4MO7A 5E8GA 3DPTA 2C6YA 1IW7F 2DCEA 2EA4A 2MH9A 5DYMA 1LDDA 4B48A 3JREA 3DLLF 5E3NA 4RA2A 4E6KG 2V6EA 4PFPA 5FLXZ 2QYOA 3J81Z 4PJLA 1ZLJA 3RKXA 2VIXA 1JJ6C 5BPDA 2QA4I 3O3KA 3N05A 4II2A 3BTCA 4LK1F 4WWCA 2I5UA 3OMYA 3OV8A 3L2UA 5EYRA 2GOMA 4FCYA 2DQRA 4C2MJ 2EIJH 3I58A 3CP8A 4LITA 2CFXA 2K9SA 2OJED 2O03A 3A0BC 4A0XA 2LF7A 1X1BA 3VDXA 2ECCA 2EBIA 4R79A 3RYRA 2N8GA 4OOIA 3PM1A 3ABTA 2IW5A 5EGOB 3QYBA 2X9DA 3E6MA 3PQKA 2E1MB 1H9TA 5LGNA 3GZNB 3QQAA 2R3SA 2VOPA 4G7OF 4M3FA 3R4KA 4BQQA 1G3WA 5KAFC 2JK3A 3REOA 2DJIA 2A6EF 3P5JA 1ORKA 2E60A 5K5OA 2E7XA 3HJEA 2H1KA 5ED4A 2KJCA 4A3GJ 2Z1DA 1MSFC 1ZTRA 1ZQ3P 5F04A 1DU0A 2OC6A 3DTEA 4C2TA 4QWQA 1FLIA 5EZHA 2X6OA 3HPHA 5K5RA 3JTHA 4AIJA 4XRSA 5GAGJ 3KEYA 2R92J 5LD2C 1R9TJ 3OL3A 2EH3A 1SD5A 2HXIA 5DCFA 1WJCA 3OYEA 3VEPA 4A3EJ 4H4KC 2IP2A 3SDGA 3F21A 2XAFA 1LQ1A 4BBSJ 3BG7A 2HKOA 1IJWC 4DZJA 3MKYB 1FYMA 4IF4A 2O8KA 2IT0A 1FJLA 1KQ0A 1RC9A 2M8EA 2A05A 1K78A 5FKKA 1BI0A 1TQMA 3VB2A 5M3MJ 2PX9A 2DYRH 2K3FA 2VI6A 1TTYA 3OYIA 2D1HA 3F6VA 4EATA 3CCJI 1FTZA 1UMQA 4O5VA 1YLFA 1BI1A 4CZCA 3OYJA 3ERED 3S3OA 2IAIA 4L9TA 3SFIA 4EJTA 5JVTA 4P1WA 2WAQA 2AHQA 3W3CA 2FSWA 1HF0A 2WV0A 1J0RA 4BS9A 2HTSA 5E79C 3HRUA 3OYKA 2L7MP 3L09A 1BC7C 1LEBA 1JUMA 2E2JJ 1Z0XA 2BHYA 1IRXA 3A01A 2VC1A 1QZEA 1I3QJ 3MFKA 1M1EB 2AQFA 4HBLA 3G6EI 2UV1A 1G8XA 3U1DA 3ZN0A 2VE9A 1P7JA 4A93J 1USSA 4HRIA 2TRTA 1PDNC 2LDUA 4ZDPA 3GZ6A 3H3VK 5DD4A 3M3YJ 3IH3A 1K61A 4RBOA 2W4SA 2DMUA 4UV9A 2PG4A 3TQNA 2MD5A 1GUUA 1PUFB 5LFAA 1RUNA 4AC0A 2O6GE 1RUOA 4UVBA 4CUGA 4JK1X 2JA6J 5IOYA 4Y17A 2EV0A 1BBYA 3HSEA 2I8DA 4LFUA 4N9IA 4NC6A 2XF6A 2EJRA 1IV6A 1CF7B 3DEWA 2DA6A 2PMHA 1HQCA 1ETQA 1B59A 5BOXA 4YIIA 4BU2A 3PIOF 3BDDA 4I7HA 3M8FA 1O3QA 2H94A 3I55I 4IJAA 2M5WA 2MGQA 3CP2A 2NVUB 2X6YA 1D8JA 2AQEA 4XLPF 5KAIC 4F91B 3DU6A 3LQQA 2LTPA 4L0ZB 3QPTA 3BJAA 2FNAA 2NOGA 4FT8A 3VYTB 2EQRA 3I64A 3A03A 5HLIA 2ME6A 4B44A 5L3DA 3MKZA 2EIKH 2ZKZA 2ELKA 2J5OA 3QOPA 2FBKA 3W2WA 2O9LA 3GFMA 4DYRA 1XCVA 2ZNZA 2H6BA 1AKHA 4OIPF 1MBFA 5ILUA 2PMZA 2KMUA 1K78B 4CCLA 3GVAA 4HEA2 2VQCA 1YO5C 2HYJA 5CVIA 3I4PA 2QZ8A 2UZKA 4F55A 1JTYA 1W5CC 4L0YB 1R23A 5FB2A 1V4RA 4UUTA 4M72A 3FM5A 5L3EA 3WTSC 3G1MA 1WRJA 3L2WA 3SJMA 3CUQA 2LKSA 1JJ8C 3R60A 2CSOA 5HDKA 3I9V2 1Y56A 5DD8A 4LB6B 4RDUA 5JLXA 4AU7A 2GQQA 2M0MA 2X4HA 5A2QZ 4O3MA 3G71I 1OKRA 4I6ZA 4XKCA 5D4RA 2YU9J 5F1RA 1LFPA 3A01B 1S3JA 3K4BA 4EJWA 2NVXJ 2LMDA 4IRGA 4JBAA 5HLGA 1QHHD 1ZGWA 4J01A 4RAGA 2XKPA 4WXCA 5FO5A 5JR3A 2E2HJ 4ENJA 5LRSA 1TNTA 5EF6A 2RC4A 1SD4A 3L2RA 4BGDA 4ZYGA 4Y15A 3WGIA 3QRFF 4LLLA 2H09A 1H8AC 2IGOA 1YIOA 4RB1A 3HRMA 4PSXA 2RAEA 1R00A 4IQJA 1MMAA 1Y1WJ 3HSFA 1VNDA 1FOWA 3HTSB 3FK7A 5AIPA 1G6NA 2DK5A 3F3XA 4YELA 5FJ8J 1Z91A 1N78A 3GXOA 3TOBA 2E71A 2Z2SB 1VZ0A 1K7AA 2QUFA 5J8FA 3NEUA 2R7DA 3K7AJ 4QTRA 1VQNI 4F52A 3W6VA 1EV7A 3B6CA 2DA1A 5F0HA 3V8KA 2YX7A 3GTJJ 3LQRA 1UHSA 2WB1N 3CZ6A 2CMPA 3PO3J 1R5GA 5DUKA 1GV2A 2E1NA 3CMEI 5FKMA 1U2WA 2BY1A 1LNWA 2FOKA 2PFBA 2F4IA 3CMAI 2CQ7A 3QAHA 1XD7A 2EIMH 3EYIA 4PGHA 1F43A 4CCJA 2RNJA 2JA5J 2J5PA 3LA3A 1R6RA 2L9SA 3GTKJ 2R7TA 4GO1A 1BM9A 1MJ9A 3KYDB 2DOEA 4EJVA 1AKHB 3A2KA 2YS9A 4OIOF 2DA3A 4HNUA 1T0FC 3JRAA 3VWBA 3DEEA 2WAFA 3HGYA 4G6DA 4N4NB 5ILSA 1D5VA 2KISA 1YJWI 3E0JB 5LGTA 5B1BH 1G2HA 3JSPA 3N97A 1SAXA 2QSFX 3RPUA 5B66C 2UXNA 5DDGA 3OYNA 4HYEA 1O7FA 2BZTA 2YR2A 3W6KB 5D5XB 4G94A 1DGWY 3PNVA 3CUQB 1Y8RB 2JVHA 3LSPA 4KMFA 3ZQFA 1QHGA 1ZH5A 1NTCA 3H35A 1MMNA 2QKMB 1LKXA 1XB4A 3FXJA 4IRIA 1ITYA 2JWTA 3HHGA 1X1DA 4C3HJ 4XK4A 3CF5F 4UXNA 3ASNH 2H8WA 2WBMA 5ICFA 2BW3A 1XMXA 2Z9OA 1G3SA 3S1MJ 1LVKA 4XLAA 3JAMK 3I54A 2KP6A 2CYYA 3HUGB 1G3TA 1MMDA 3FHNA 5JFRA 4BKXA 4R8HA 2QENA 1RRJA 3HOSA 2DFIA 3CCMI 2NOJB 5HS9A 4A12A 1Z21A 2FOWA 1EH7A 3MEXA 1RIOH 2GA1A 3LSRA 1A31A 2VPRA 5IT9Z 4EJOA 1BI2A 4UY8I 2H6CA 3H36A 3S2WA 2W7NA 3HB9A 2HS5A 3WTTC 3ZMVA 2GZWA 3O8GA 2KKOA 2PJRB 3RTRA 3OR2C 2RVCA 2DK8A 2LY9A 5CPRB 2LVSA 4WXHA 5LGUA 4A3BJ 1I3AA 1EJ9A 4IRHA 2LNBA 2STTA 3F8FA 1ETWA 3BROA 3D0SA 3EUAA 3GCMA 1DUXC 2BEOA 2E19A 2QEXI 1NHAA 5HDGA 3U21A 3LNQA 3PSIA 2BVMA 2WADA 1WH5A 3F22A 4IVNA 4L9VA 4IX7A 4I99C 3IRRA 3CUOA 4G9YA 1MH4A 2MG4A 3FXUA 1GT0C 1ZREA 1FIAA 1I6XA 3P7NA 3DBHB 5FD5A 3CDIA 1Z6TA 2Y0SN 1YG2A 4II3A 2A07F 2DBBA 2XROA 5D6FA 2ZJ2A 2NVQJ 2YU3A 4A3IJ 1R1TA 3ZQ7A 1SD6A 3KP7A 4AVPA 4MFEA 4NC7A 3BCBA 3M8EA 3WGGA 2O7OA 3G3ZA 3ZMTA 2ZMEC 1K83J 3UKGA 2W48A 1R22A 4LG3A 2P5KA 1I27A 2Z16A 2TDXA 3SZGA 5LLQA 4RAYA 4A6DA 2AXLA 3BR1A 3C2GA 1R1VA 4G12A 4XIDA 4A5NA 5C4XJ 1X1AA 3BQYA 4ENNA 3F6OA 3JRHA 2XRLA 1IXRC 5D8LB 3RPQA 1XMAA 1H0MA 1SAUA 3JRIA 4LOCA 3HM5A 3MD2A 3FX3A 3I4MJ 3DTKA 4BUPA 2PMUA 1RR8C 2CQXA 2QQAA 3P9CA 4LD5A 2HVSA 3NQOA 5HS8A 2WWYA 2MSYA 3E6BA 3GLXA 3C3WA 2FBHA 2FE3A 1RETA 3LSKA 4M9ZA 1ZGAA 5BMZA 1S29A 2M45A 4U7DA 1RKWA 2GXGA 3KP4A 4I0AA 1TLHB 2KHMA 1R1UA 2VKHA 2VPLA 2DMQA 1HLVA 2G7HA 5D5WB 4GDFA 3GYHX 3LOCA 5GAEJ 4A2UA 1YTYA 3ZQIA 4M6XA 2RV8A 3O8HA 4IO9F 4HF1A 3QPHA 4ESFA 4LLGF 3F23A 1UFMA 2BY0A 1NG7A 3CCVI 3PFYA 1CQTA 5AONA 2E5ZA 4GYGA 3MZHA 4NBQA 4BL0B 2WV1A 2KIFA 5DTDA 4J19A 1BR4A 2R7ZJ 1E3PA 4UB6C 3IL2A 2R7WA 3DWLE 1RKTA 2DTRA 3K9TA 3LFKA 1XSXA 1T39A 1HC8A 1MW7A 5J6XA 2NNNA 4A5MA 2E34A 1SMTA 3J7AY 5K7ZA 1J9IA 2FNPA 4IL6C 4MTEA 5HVQC 5E8IA 4AM3A 4PJMA 2CWEA 3DQVC 4UHTA 2VT3A 3V4GA 2CS3A 3LFUA 2FQ3A 2LRDA 2Y48A 1S6LA 2Y31A 5LEJA 3SHFA 3H0DA 4YRVA 1RESA 1Z1DA 1Y39A 4HG2A 5LBQA 2MH2A 4UNOA 1Z3XA 3ECOA 2F5FA 3OWTA 2ID3A 1D1CA 1SMYF 2Y69H 4AD9A 2EFPA 2ADUA 3BOQA 4OIQF 3CC4I 4IZZA 2HVQA 1UCRA 3RKYA 3TL4X 3TP0A 1ZK8A 3U2RA 4XKWA 4E4HA 3HYIA 4P9UA 4OMYA 1T98A 3PFIA 1OCOH 2OUMA 2F4OB 5BQTA 2K3PA 5IP6A 2L2OA 1HKQA 2LKPA 4Q5SF 3BZ6A 5TISC 3LAPA 3N4MA 5ICCA 4S04A 4A3LJ 4ZH4F 2JT1A 4RB3C 2BBYA 3CJTB 4BEHA 2R4GA 4LG0B 1PP8F 2CUZA 1UG0A 4DNCA 2VKDA 3FHZA 4PJNA 2JUCA 4QIWN 3HOWJ 4MEXF 1VQLI 3OS1A 4CH7A 4UUVA 2KLOA 3S3MA 2DI3A 1Y1VJ 3HEFA 4XN0A 3HOYJ 3TOAA 1X58A 3BG3A 4M6YA 3ONQA 1D1AA 5E17F 1WJFA 1FC3A 2NRAC 3EPZA 4G7HF 2OD5A 1JHFA 4PSWA 4EM1A 2V79A 2XB0X 3G2BA 3HOXJ 2K27A 1REPC 2R7VA 5DS9A 2P5VA 4B3AA 2R93J 1YX3A 1IG7A 2Y0MA 1MIJA 3OYBA 1X4OA 4GYIA 1YRNA 1D0YA 2IRFG 3A1YA 2DTZA 2BHZA 3P9IA 4I09A 4KA4A 2WC2A 4RS8A 3SFZA 2EZHA 4FX0A 3LAJA 5EEGA 2V1NA 3F8BA 4YG2F 2EV5A 2ZBKA 2ESNA 1I6HJ 5DUIA 2M7BA 4M3GA 3GTGJ 1A6IA 3HKZN 3LSHA 3QODA 2DT6A 4ZYAA 1FP1D 4QSHA 5D5UB 2E2IJ 1W7PB 4ZZLA 1FEXA 4ESJA 4PCQA 5L3CA 3GEZA 1T0FA 1KU3A 4X1EA 3DEUA 2WY8Q 3CCLI 3JSOA 2M4KA 1U78A 1SEUA 2X0LA 1W36C 1X3UA 2JPBA 4XL9A 4EGZA 1D0ZA 4A3DJ 3DFGA 4P55A 1T38A 2M1BA 3H92A 5HOOA 1XGNA 1NK2P 1BIAA 2CG4A 4M3EA 1Y8QB 3DKWA 1F9NA 5IY5H 2LSOA 2R5ZA 2K4JA 5J1UA 2CU7A 5EG0B 4A3KJ 1IDYA 1IXSB 5D4SA 1N25A 4KT6A 2QSHX 2MD0A 3E6CC 1V5FA 3FM3A 4IHWA 4TV7A 4UVCA 3NAUA 3DLAA 4IHTA 4BXXJ 5D6EA 2BVLA 1QPMA 2A3SA 5ICEA 3HRTA 1STZA 1ETKA 1EKEA 4U7BA 3GFIA 1QVTA 2K7LA 2EFOA 2PN6A 4C3IJ 1W0TA 3BTLA 1KZHA 3OL4A 2OZ6A 5JLWA 2Z33A 2X1DA 3BR3A 1VQ7I 4ESBA 5ERIA 4PDKA 5LRRA 2KRCA 4DIQA 4HQMA 4Z2YA 1XG1A 5GAHJ 1UHMA 4DYQA 4E7LA 1QO0D 1G4DA 5IPAA 4E7SA 2IGNA 2DFHA 5CVRA 1S7OA 1G59A 2VQHA 3O2PE 3RKQA 1D3YA 4XSXF 2CQQA 4S0HB 2K40A 2K9QA 2CUFA 1OCCH 4GGGA 3K0LA 4NUBA 1YRNB 5CJ9A 3L2VA 2VL8A 4HX8A 5EZGA 1FWZA 3T5XA 2ZO4A 4ZZDA 2HDDA 2KRFA 5KNLA 2BYVE 2HOSA 1YYVA 4KIBA 4BBRJ 2O61A 1LB2A 1ETXA 4JYKA 4YFNF 1Q1HA 2M7AA 2K4BA 1KYWA 3PNYA 2EINH 5FRMA 4ZYDA 3E1SA 3M9AA 1ZG3A 3OOUA 1B72A 3BCAA 2FMLA 3C1DA 2UWMA 4D1QA 5ILVA 1F1ZA 1GVDA 1IN5A 2OTLI 2HQNA 5IP9J 4L5IA 2HQRA 3AG2H 1IRZA 4QPOA 2RKHA 3CJNA 3X2QH 4A0YA 1YS6A 4A3JJ 2IA2A 2IBDA 5DCMA 2ZMEA 1RPWA 4PJ0C 3ZCOA 3J7ZI 3FF5A 3DCFA 1MNEA 3WTWC 3HTUA 3IH4A 3Q9VA 2CJJA 2FD5A 4FHTA 5E3OA 1QPIA 3BWGA 2FX0A 4MGRA 2R5ZB 2WAEA 1MDMA 3IH2A 1MNMC 2HDCA 2DMPA 1YW7A 3GUDA 1RR7A 5BNGA 3EETA 2HKXA 2HPIA 1S7AA 2LY2A 1BI3A 2DW4A 2DPUA 4A0ZA 3VPRA 3ISPA 3LWFA 2OZUA 1XPXA 1HA8A 1D5YA 5E1WA 4E70A 1S72I 3I59A 1MJAA 2A69F 2NS8A 2L01A 1DP3A 2M30A 3OYGA 4KJZA 2LR8A 3KP6A 3WU0A 1HW5A 3H1CA 4JQFA 4B8XA 3TBIA 4HZFA 1TT0A 5FLVA 2HR3A 2NAZA 4ZDLA 4KITB 4NNJA 5J1RA 1U0JA 3FWEA 3WTUC 2P8TA 1JGGA 3IAS2 2PLYA 3FBNB 1V54H 1BJZA 4HA8A 1O3TA 1E3HA 3K10A 3MZYA 4V2GA 2STWA 1Z77A 1OYIA 3K1MA 3FDYA 2YX4A 3BTIA 3ZMSA 4WF2A 3D1NI 3PNTA 3VYRB 2ZSIB 3AG4H 2M87A 3C18A 1HW2A 3ZP5A 5HNHA 1P2FA 1MH3A 3WTZA 3QYEA 5C44J 2L7KA 2ID6A 2MABA 3CC7I 2XAQA 2FUG2 2JJ7A 5B5EC 3WTYC 2R7FA 3BT9A 5FKOA 1DDNA 3CCYA 2EWNA 1A04A 2PI0A 3H9QA 4W97A 3CCSI 1O4XA 4HW0A 2ZSHB 1T8IA 2XUBA 4CA0A 3DPUA 1NH3A 1T2KA 3F9KA 1FT9A 3KZYA 4LIVA 2Q2EA 3PJRA 5LHGA 1MBJA 5GPAA 4ZYEA 4KDPA 4RM2A 3IP4B 1E2XA 2JVGA 3F8MA 4KT5C 2M4GA 2P0WA 1BW6A 2OF7A 2ZFUA 1BW5A 3CQZJ 4BDZA 1B6AA 2ZMEB 2FEZA 1MBEA 2K02A 2L7ZA 1R5HA 3KLOA 2L3DA 3S17J 3KYCB 2JPCA 1OPCA 2A68F 1FBSA 4ITVA 1VTNC 1MDMB 1B8IA 3JCUC 4E7IA 2O8XA 3W2AA 4CCNA 3MCZA 3NWSA 4AYBA 4ZTJA 3H5NA 4LJZF 5CQGA 3WGHA 4BHCA 1APLC 2QSGX 3NARA 2KDOA 3RI4A 5J1YA 2JSPA 4KIFA 1YX5A 2CUEA 3I59B 4HV5A 3S8PA 4A69C 5BS6A 2EZLA 4X6AJ 4LLNA 1A35A 2L02A 1J2XA 3QYFA 4C9YA 2DU9A 1SFUA 1FMWA 5FLXK 3K4LA 3J81K 2Y9YA 2PQ8A 4GXOA 1Z3YA 4IKFA 2XHKA 1ONVA 2CV1A 3J80Z 4RAZA 1OCPA 5FKNA 4A3CJ 1XSDA 2QWWA 4KYWA 2BY3A 2FQ4A 2ZXHA 1Z67A 3CJRB 4IHYA 1J59A 1MBGA 3Q0VA 2JQ7A 2XDVA 1YS7A 2M3AA 2DT5A 5CYVA 2R5YA 3TO9A 5DM6F 3TW7A 2X6XA 3GTLJ 3D5LA 1I1GA 2LREA 3PUBA 3CMMA 4AIKA 2OBPA 2CO5A 1KONA 1QBJA 4XN3A 2JMWA 2LFBA 4FISA 2B7EA 1VQ6I 1V5EA 2QLZA 1ZRCA 2EPFA 4YIFA 3Q3SA 2HFHA 2V6CA 2ZJPF 2OCEA 3I71A 2ZNYA 3WTVC 4P9FA 3CO6C 3HHHA 4E7HA 1F4KA 3BZCA 3COAC 2RDPA 1USTA 1SVMA 2KFDA 2M8GX 3FZVA 4ZJZA 2VQLA 1R7JA 4BE2A 1Z05A 2GXBA 2QBYA 5J3LA 3OIQA 3AKZA 2Y9ZA 2WB1A 3DBRB 1MBKA 1TBXA 5IP7J 5AIQA 2FMYA 1X4PA 1R4NB 2DFEA 2KPMA 4CGZA 2R7QA 2VBZA 3OYLA 2IA1A 4JP0A 3CJQB 3EQLF 2LF8A 3H5RA 3K1NA 1ZRFA 5EEHA 1VQPI 4NDLA 3T8RA 2VLAA 4LK0F 4G7ZF 1JTXA 1E3OC 1YW9A 3VODA 3IKTA 3K4NA 1X1CA 3QU3A 3ZRGA 2EFQA 3BR5A 5CLSA 3SYTA 5M3FJ 2LY1A 2EK5A 2DA2A 3JRDA 4MLOA 1OR7C 4KICA 3CCRI 4KN7X 3T8TA 1R5ID 4XSZF 4C2UA 1IZ1A 2X51A 3OIPA 2IVMA 4XRFA 1WJAA 1EA3A 2UUZA 4F3QA 1QNTA 3QP6A 2ISZA 1XGMA 4D9JA 3KCCA 1W5TA 3DPLC 4IHSA 4F7ZA 1HDDC 2P6TA 2DOAA 3SQNA 2KIMA 2V1DA 1HXDA 2P7VB 4RB0A 3ZXSA 2E7WA 1WPKA 3BZKA 3CO7C 1SVLA 2GM4A 2EZIA 3W6JB 3JRFA 3TDZC 1ULYA 3K2ZA 5J4YA 5FRNA 1IN7A 3ESWB 3HIFA 5L3BA 4F93B 2FF4A 2XV4S 2A6TA 4CCMA 3BG6A 3GWZA 4Y13A 3I3LA 4S05A 2QVOA 2FA5A 3KYLA 5HDNA 4N9HA 3SXYA 1QQIA 1Q1VA 4O6JA 3DKXA 3IAM2 2IJLA 4ABZA 1JHHA 1ZAOA 2DO7A 2NS0A 3GX4X 2FU4A 2L0KA 2PJPA 2IA0A 3F0CA 2E35A 3E97A 2QGUA 2JTVA 3HXLA 3AAFA 1MBHA 1TW2A 3RQ4A 2X6WA 2WA0A 5E1ZB 1V55H 1WSUA 2CW0F 2KT0A 2R0QC 1S7EA 2OA4A 4BE1A 2NXNB 4A6EA 5K7HA 4EVIA 5JVGF 1YITI 4I2OA 2VJIA 1AHDP 3M4OJ 1MKMA 3OY9A 3BR6A 4U87A 3HOVJ 3KE2A 2BW3B 5FROA 4XLFA 2QBYB 3OYFA 3T1BA 2XSJC 2QF7A 1U3EM 4IHVA 2IS4A 3QWLA 3DV8A 2V4JC 2EZKA 2HOTA 2DN0A 1IUFA 3LMMA 1FSHA 1LDJA 2HOAA 5GADJ 4XBFA 4UUSA 2ZB9A 3R0JA 4MHGA 1XS9A 2CQNA 1I1SA 2EA2A 2HGCA 3E5XA 4I98B 3MKWB 2R7XA 1FBQA 2H27A 3BP8A 1IRFA 3FKJA 3IC7A 2R7RA 2Y0SA 3DBLB 3FMRA 3RIRA 2W82A 5JHFA 3JRGA 1BL0A 1XMKA 2Z3YA 3WU1B 2HOEA 1SFOJ 5F64A 2V1UA 4RMNA 1D1BA 2DFFA 4PGGA 1HOMA 3KIOA 3BJOA 3J7YJ 2W00A 3KPHA 2JUGA 3S1NJ 3BLYA 2ELHA 4CICA 4OINF 3RJPA 1JT0A 3E5QA 3ZQLA 4DBRA 4RLFA 5CVJA 3M07A 1K4TA 3ZMZA 2F48A 1SANA 2P4WA 5ICGA 5E18F 5C3EJ 1JKPC 1Z7UA 3EUHC 2ME0A 2WY7Q 1HKSA 1JKRC 1FPQA 1OCTC 1ERDA 2TCTA 3BR0A 3B02A 5M5WJ 2P7CB 2GIZA 2VBWA 4Y33A 3KX2A 2HTJA 3FXRA 1ETYA 3FXQA 4NB5A 1I39A 4FTHA 1JUPA 2ICWG 2MA3A 3TW6A 5A2QK 2QQ8A 4BH9A 2O5RA 4NHJA 4KUMA 4QLCU 4YFXF 1MD0A 5M5YJ 2VJ5A 3PSFA 3L2CA 1H9GA 2KIQA 1GV5A 2CQKA 2IGMA 3HRSA 3IWFA 4BJ6C 3D5SC 2IXSA 3MMYB 4KIGA 3A02A 5FD6A 3H3UA 1LDKB 3K2AA 4V2FA 3S2HJ 1IN6A 3K4MA 3T0YA 1H88C 5M5XJ 2VJJA 5K7FA 1FMVA 3OSGA 4IEJA 1IXCA 4GCVA 2GWRA 1N75A 4BXUA 2YUSA 4ANJA 1OCRH 2B0LA 2Q0OA 2XAJA 3CTAA 2BV6A 2O0YA 3MVPA 2K86A 3CCEI 4EEFG 3OYMA 1BN5A 1ETVA 1XSVA 2L9RA 1BC8C 2JA8J 3CD6I 3KLNA 3GTPJ 4Y3OA 4HDUA 1OYWA 2E5NA 1IO2A 4L5JA 3HBLA 3ML6A 3Q5FA 2F5VA 2I10A 5F08A 3SEQA 3QPLA 5EJCA 3VFZA 5IT3A 4CYCA 1J75A 1YJNI 4P5OA 5EGOA 3CDLA 2DJNA 1U9OA 2M34A 3GTMJ 4QPQA 1WZ2A 4AWXB 3ABMH 2HXOA 3CC2I 2XF7A 1MMGA 1U6GA 3IHUA 1FZPB 1X1PA 1Z7LA 3C7JA 3EYYA 1O3RA 2HZDA 1XCBA 3BQZA 5F6FA 1O3SA 1TQIA 3VSLA 4Q47A 1YJ9I 3RKWA 1FBUA 2B63J 1IN4A 4M9SA 1UHWA 3KEOA 3PUFA 4ASNA 1XDSA 2BOLA 2DOFA 2X48A 2W57A 1JKQC 2LOOA 2BY2A 1FOXA 1XC5A 4XRSG 4AIHA 1GVJA 2E36A 2XAGA 4OAZA 2E1CA 1P92A 4Y52J 1TQPA 1VI0A 1U5TC 5B3SH 5D5VB 1ZYRF 1S5LC 1TNSA 1WJEA 2DT7B 1K6YA 2JN6A 3GFLA 4HV6A 3LSJA 2M2EA 2V9VA 2XPUA 1T33A 9ANTA 4D5FA 4CXFA 2XGDA 1DPUA 2NNYA 1ON2A 3RDIA 4PFOA 4IHXA
chains in the Genus database with same CATH topology
1S8NA 2PEXA 3WE3A 2F2EA 4N0BA 1MZBA 3KP2A 2FRHA 4U0VA 3BJ6A 5IT9K 2VN2A 3ELKA 3MQ0A 1IAWA 1AOYA 3J7AO 2HEOA 1MJBA 2EFNA 2ZCWA 1B9NA 1HBXG 1WI9A 3H3ZA 2GA2A 1W5SA 3IWZA 1PUEE 3IRQA 2Z99A 4WCGA 1WWXA 2OQRA 3B73A 1LJ9A 1RZ4A 1WKMA 4U88A 2VXZA 2VC0A 3VOEA 5HS7A 1E17A 2Q8KA 3BPVA 3V7CA 2XAHA 3DP7A 2EB7A 3NRVA 4Q4ZF 2W85A 4MTDA 2YPRA 1OR7A 3JAMZ 1CF7A 3ABUA 5D8KB 1KQ9A 5DV5A 5LEKA 1J5YA 4EMSA 2MLKA 1IRGA 1BJAA 2VBYA 4HLYA 2F5DA 5TJJA 5E20A 2VE8A 1CGPA 5JHUA 4KFCA 2D2WA 4HX7A 1SFEA 3QP5A 1TW3A 4PZJA 4XLNF 2P6SA 1FOKA 3E6DA 4G6QA 1JE8A 2FBIA 4CDGA 1FYKA 1W7PD 1P4AA 1IF1A 2F5CA 4HQEA 4HDVA 2XKOA 2V1XA 1UB9A 2QM3A 2L4MA 1LVAA 5J8CA 2COMA 3ECHA 4U0YA 4LMYA 1GXPA 5KK1A 4MEYF 3F8CA 2GIVA 2OU2A 4OMZA 5CVVA 4UV8A 3V7SA 2WTEA 3CLOA 3R6SA 2OQGA 1IUYA 1FNNA 2VBXA 1L0OC 1FYLA 1Z6RA 5K5QA 3L9FA 4MQ9F 4ON0A 1ZG5A 1R58A 2OAZA 5FGMA 1SD7A 3JTGA 3JW4A 2NYXA 5DEQA 3IKVA 1ZARA 3Q9SA 3SZTA 3R0AA 2IPQX 3PQJA 2HWVA 4BHBA 1XN7A 2PBIA 3I53A 3ULQB 3EUHA 1OMIA 3WTXC 4LGWA 2VT2A 1D8KA 4R1HA 2G7UA 3V8JA 2ZFWA 4L9NA 4CHUA 4EJUA 1ZG1A 2DPDA 3KFWX 2AS5F 2RQPA 3SZPA 4KMUX 2QQBA 4KN4X 1ZLKA 5DCMB 3EDPA 3KZZA 2VOOA 4HAMA 1O7LA 2KJBA 3FMQA 4DQ2A 2XIGA 3LA2A 3V7RA 3KETA 3RYPA 1ZRDA 1BOAA 3O6BB 2A6HF 5FFXA 4HLXA 3U9GA 3HUGA 4Q48A 3WG9A 1WQ2A 2MBFA 2GAUA 1B1BA 5H6QA 4RGSA 5KVRA 2MC3A 2W25A 2Y75A 2D45A 1GXQA 3TO7A 1DPRA 2EV6A 5H6RA 3LSTA 4UVAA 3OOPA 4RGRA 3DF8A 3HSRA 4RGUA 4HOBA 3WODF 3M7GA 1FX7A 4BYYA 2HYGD 4M74A 3MAJA 2O3FA 4ETSA 4WX9A 1ODDA 1KQ8A 1U5TA 5H20A 1ZGJA 1YFHA 1YW8A 3GF2A 1LEAA 4BQAA 3LA7A 1DP7P 3CDHA 1XDUA 5LHIA 4U0WA 2FXAA 1KU2A 1P4XA 5L3GA 2ETHA 4NQWA 1G3YA 1P4WA 1JXSA 2MLGA 2DLLA 5BPIA 3R61A 5FFZA 3E5UA 1RI7A 1ON1A 2DQLA 3TKYA 1YQAA 1GHCA 1P6RA 1T6SA 1KYZA 1SFXA 3MWMA 1IN8A 2UXXA 3I5UA 1V3FA 3TDUC 2A61A 5E1XA 3HOTA 4EM0B 3TGNA 3WE2A 3L00A 3GW2A 3K69A 3M1EA 1BIBA 1KA8A 4ENKA 2P5LC 4EQQA 4CYDA 3L7WA 2XASA 1QZYA 3P9KA 4P96A 1O57A 4MQVA 2CGPA 1I5ZA 2JSCA 1AWCA 1U5TB 5CVUA 4IPAA 2XRNA 2BE5F 1RNLA 1EH8A 3FMSA 3GZ5A 4MNUA 4ZYHA 1PP7U 2DAOA 1XGOA 2XGXA 1KU9A 5K1YA 3KP3A 4M71A 4EM2A 2G9WA 3GO5A 4WXDA 2XVCA 3ZMDA 5HLHA 1FP2A 2ISYA 1W4MA 2YSRA 1J7KA 1QGPA 4FX4A 3ZPLA 4L18B 3KEQA 3F72A 1HSTA 1EH6A 1OYYA 1K6OA 2W24A 3TO6A 2QQ9A 1HW1A 4OIRF 1KU7A 1KGSA 2L54A 3I0TA 4LB5A 4EGYA 4LG0A 4I01A 4BNCA 1HSJA 1B9MA 3V8LA 4EV0A 3E3VA 2ZXJA 2KIUA 5LHHA 3ZN1A 1ZHFA 1MGTA 3CUQC 1FSEA 4HF2A 2VONA 2JZYA 2Z5UA 3QU6A 1W7PA 2BGCA 2D1VA 1FY7A 2F5EA 2A5YB 3BY6A 2HYFA 3DXJF 6PAXA 2EFWA 5L3FA 2HZTA 4D0PA 4KNYA 1F5TA 1R36A 4HX4A 1U8RA 2W84A 4HF0A 3J80K 1JGSA 3ZMUA 3G73A 1Z9CA 4B09A 4I0BA 3K1PA 4RGXA 3F8NA 2RGVA 2ESHA 5JI6A 5TRDA 4YFKF 2JRTA 2L4AA 4G8XA 4I02A 3BPXA 4WK8F 4M9XA 4H0EA 2ACJA 4M73A 4BHPA 1ZN2A 4K2EA 4ENMA 1Y0UA 1QZZA 4CO8A 1XGSA 4IXAA 3KP5A 4CZZA 3ROUA 2VODA 4OU0A 2RN7A 4L9JA 4RB2C 1HKTA 1K79A 1C0WA 1B4AA 3GFJA 4BAYA 1L3LA 5E8GA 3DPTA 2C6YA 1IW7F 2EA4A 2MH9A 5DYMA 1LDDA 5FLXZ 2QYOA 3J81Z 1ZLJA 3RKXA 5BPDA 3O3KA 4LK1F 4WWCA 3OV8A 2DQRA 3I58A 2CFXA 2O03A 4A0XA 2LF7A 4R79A 3RYRA 4OOIA 3ABTA 2IW5A 3E6MA 3PQKA 1H9TA 5LGNA 2R3SA 2VOPA 4G7OF 3R4KA 1G3WA 3REOA 2A6EF 5K5OA 2E7XA 5ED4A 2KJCA 4QWQA 1FLIA 5K5RA 3JTHA 4AIJA 1SD5A 5DCFA 3VEPA 2IP2A 3F21A 2XAFA 1LQ1A 2HKOA 1FYMA 4IF4A 2IT0A 1KQ0A 2M8EA 1K78A 1BI0A 1TQMA 3VB2A 1TTYA 2D1HA 3F6VA 4O5VA 1YLFA 1BI1A 3ERED 4L9TA 4EJTA 5JVTA 2FSWA 2WV0A 1J0RA 2HTSA 3HRUA 3L09A 1BC7C 1LEBA 2VC1A 3MFKA 4HBLA 3U1DA 3ZN0A 2VE9A 1USSA 1PDNC 2LDUA 3GZ6A 5DD4A 4UV9A 2PG4A 3TQNA 2MD5A 1RUNA 2O6GE 1RUOA 4UVBA 4JK1X 4Y17A 2EV0A 1BBYA 3HSEA 4LFUA 4N9IA 2EJRA 1CF7B 2PMHA 1HQCA 1B59A 5BOXA 4YIIA 3BDDA 4I7HA 3M8FA 1O3QA 2H94A 4IJAA 2M5WA 1D8JA 4XLPF 3LQQA 4L0ZB 3QPTA 3BJAA 2FNAA 4FT8A 3I64A 5HLIA 5L3DA 2ZKZA 3QOPA 2J5OA 2FBKA 3GFMA 1XCVA 2ZNZA 2H6BA 4OIPF 5ILUA 1K78B 3GVAA 1YO5C 5CVIA 3I4PA 2QZ8A 2UZKA 4L0YB 1R23A 5FB2A 1V4RA 4M72A 3FM5A 5L3EA 3WTSC 1WRJA 3CUQA 3R60A 2CSOA 5HDKA 5DD8A 4LB6B 2GQQA 5A2QZ 2X4HA 4O3MA 1OKRA 5D4RA 5F1RA 1S3JA 4EJWA 5HLGA 4IRGA 4JBAA 2XKPA 4WXCA 5FO5A 5JR3A 4ENJA 5LRSA 1TNTA 2RC4A 1SD4A 4ZYGA 4Y15A 3WGIA 3QRFF 4LLLA 2H09A 1YIOA 4RB1A 3HRMA 1R00A 3HSFA 3HTSB 5AIPA 1G6NA 2DK5A 3F3XA 1Z91A 3GXOA 3TOBA 1K7AA 2QUFA 5J8FA 3NEUA 2R7DA 1EV7A 3V8KA 2YX7A 3LQRA 1R5GA 5DUKA 2E1NA 1U2WA 1LNWA 2FOKA 2PFBA 3QAHA 1XD7A 3EYIA 4PGHA 2RNJA 2J5PA 3LA3A 4GO1A 1BM9A 1MJ9A 4EJVA 4OIOF 4G6DA 5ILSA 1D5VA 5LGTA 3JSPA 3N97A 1SAXA 3RPUA 2UXNA 5DDGA 4HYEA 1O7FA 2YR2A 3W6KB 5D5XB 4G94A 3CUQB 4KMFA 1ZH5A 1XB4A 4IRIA 3HHGA 4UXNA 5ICFA 2Z9OA 1G3SA 3JAMK 3I54A 2CYYA 5JFRA 1G3TA 4R8HA 2QENA 3HOSA 2DFIA 4A12A 5HS9A 1EH7A 3MEXA 1RIOH 2GA1A 5IT9Z 4EJOA 1BI2A 2H6CA 3S2WA 2HS5A 3WTTC 3ZMVA 2GZWA 2KKOA 3RTRA 2RVCA 2DK8A 4WXHA 5LGUA 4IRHA 2LNBA 2STTA 3F8FA 3BROA 3D0SA 1DUXC 2BEOA 1NHAA 5HDGA 3F22A 4IVNA 4L9VA 3IRRA 3CUOA 4G9YA 3FXUA 1ZREA 1I6XA 3P7NA 5FD5A 1Z6TA 1YG2A 2A07F 2DBBA 2XROA 5D6FA 2ZJ2A 2YU3A 1R1TA 3ZQ7A 1SD6A 3KP7A 4AVPA 3M8EA 3WGGA 3G3ZA 3ZMTA 1R22A 2P5KA 1I27A 2TDXA 5LLQA 4RAYA 4A6DA 2AXLA 1R1VA 4A5NA 4ENNA 3F6OA 1IXRC 5D8LB 3RPQA 1XMAA 1H0MA 3FX3A 2PMUA 2QQAA 3P9CA 4LD5A 3NQOA 5HS8A 2WWYA 3E6BA 3GLXA 3C3WA 2FBHA 2FE3A 4M9ZA 1ZGAA 5BMZA 1S29A 2M45A 4U7DA 3KP4A 2GXGA 4I0AA 1TLHB 1R1UA 2G7HA 5D5WB 3GYHX 1YTYA 4A2UA 4M6XA 2RV8A 4HF1A 3QPHA 4ESFA 4LLGF 3F23A 1UFMA 5AONA 4GYGA 3MZHA 2KIFA 3IL2A 2DTRA 3K9TA 3LFKA 1XSXA 1T39A 5J6XA 2NNNA 4A5MA 1SMTA 1J9IA 2FNPA 4MTEA 5HVQC 5E8IA 2CWEA 3DQVC 4UHTA 2VT3A 3V4GA 2FQ3A 2Y48A 1S6LA 5LEJA 3SHFA 1Z1DA 5LBQA 2MH2A 4UNOA 3ECOA 2F5FA 1SMYF 4AD9A 2EFPA 2ADUA 3BOQA 4OIQF 1UCRA 3RKYA 3U2RA 3HYIA 4P9UA 4OMYA 1T98A 3PFIA 5BQTA 1HKQA 2LKPA 4Q5SF 3BZ6A 3LAPA 3N4MA 5ICCA 4S04A 4ZH4F 2JT1A 4RB3C 2BBYA 4LG0B 1PP8F 4DNCA 3FHZA 4MEXF 4UUVA 2DI3A 3TOAA 4M6YA 5E17F 1FC3A 2NRAC 4G7HF 2OD5A 1JHFA 4EM1A 2V79A 2K27A 1REPC 2P5VA 2Y0MA 4GYIA 2IRFG 4I09A 3P9IA 4KA4A 2WC2A 4RS8A 3SFZA 4FX0A 3LAJA 5EEGA 3F8BA 4YG2F 2EV5A 2ZBKA 2ESNA 5DUIA 5D5UB 1FP1D 1W7PB 4ZZLA 4ESJA 4PCQA 5L3CA 3GEZA 1T0FA 1KU3A 3DEUA 3JSOA 1U78A 2X0LA 1X3UA 2JPBA 4EGZA 3DFGA 4P55A 1T38A 2M1BA 3H92A 5HOOA 1XGNA 1BIAA 2CG4A 3DKWA 1F9NA 2LSOA 2K4JA 1IXSB 5D4SA 3E6CC 3FM3A 4TV7A 4UVCA 4IHTA 5D6EA 1QPMA 2A3SA 5ICEA 3HRTA 1STZA 4U7BA 3GFIA 2PN6A 2K7LA 2EFOA 2OZ6A 2Z33A 4ESBA 5ERIA 4PDKA 5LRRA 4HQMA 4Z2YA 1UHMA 1G4DA 1QO0D 5CVRA 1S7OA 3O2PE 1D3YA 4XSXF 4GGGA 3K0LA 5CJ9A 4HX8A 1FWZA 3T5XA 2ZO4A 4ZZDA 2KRFA 2BYVE 1YYVA 4KIBA 2O61A 1LB2A 4YFNF 1Q1HA 2K4BA 1KYWA 4ZYDA 3M9AA 1ZG3A 2UWMA 2FMLA 3C1DA 5ILVA 1F1ZA 1IN5A 2HQNA 4L5IA 2HQRA 2RKHA 3CJNA 4A0YA 1YS6A 2IA2A 5DCMA 2ZMEA 3FF5A 3WTWC 3HTUA 3Q9VA 4FHTA 3BWGA 1MDMA 4MGRA 2HDCA 1YW7A 3GUDA 3EETA 2HKXA 1S7AA 1BI3A 2DW4A 2DPUA 4A0ZA 3ISPA 3LWFA 2OZUA 5E1WA 4E70A 3I59A 1MJAA 2A69F 2L01A 2M30A 3KP6A 3WU0A 1HW5A 4JQFA 4B8XA 4HZFA 2HR3A 2NAZA 3FWEA 3WTUC 2P8TA 2PLYA 4HA8A 1O3TA 3MZYA 2STWA 3K1MA 1OYIA 2YX4A 3ZMSA 4WF2A 2M87A 3C18A 1HW2A 3ZP5A 1P2FA 3WTZA 2XAQA 3WTYC 2R7FA 1DDNA 2EWNA 1A04A 2PI0A 4HW0A 2XUBA 1T2KA 1FT9A 3KZYA 2Q2EA 5LHGA 4ZYEA 4KDPA 1E2XA 3F8MA 4KT5C 1B6AA 2ZMEB 2FEZA 2K02A 1R5HA 3KLOA 2L3DA 2JPCA 1OPCA 2A68F 1FBSA 1VTNC 1MDMB 2O8XA 3MCZA 4LJZF 3WGHA 4BHCA 3RI4A 4KIFA 3I59B 4HV5A 5BS6A 4LLNA 2L02A 1J2XA 2DU9A 1SFUA 5FLXK 3J81K 2PQ8A 4GXOA 2XHKA 1ONVA 3J80Z 4RAZA 1XSDA 2QWWA 4KYWA 1J59A 1YS7A 2DT5A 5CYVA 3TO9A 3D5LA 1I1GA 4AIKA 2OBPA 2CO5A 1QBJA 1ZRCA 2QLZA 4YIFA 2HFHA 2V6CA 3I71A 2ZNYA 3WTVC 4P9FA 3CO6C 3HHHA 1F4KA 3COAC 2RDPA 1USTA 3FZVA 1R7JA 1Z05A 2GXBA 2QBYA 1TBXA 5AIQA 2FMYA 4CGZA 2VBZA 2IA1A 3EQLF 2LF8A 1ZRFA 3K1NA 5EEHA 3T8RA 4G7ZF 4LK0F 1YW9A 3VODA 3IKTA 3QU3A 2EFQA 5CLSA 2EK5A 4KICA 4KN7X 3T8TA 4XSZF 1IZ1A 2IVMA 4XRFA 1QNTA 3QP6A 2ISZA 1XGMA 3KCCA 1W5TA 3DPLC 4IHSA 4F7ZA 2P6TA 3SQNA 2KIMA 2V1DA 1HXDA 2P7VB 4RB0A 2E7WA 3CO7C 3W6JB 3TDZC 1ULYA 3K2ZA 1IN7A 3HIFA 5L3BA 2FF4A 2XV4S 3GWZA 4Y13A 4S05A 2QVOA 2FA5A 5HDNA 4N9HA 3SXYA 1QQIA 4O6JA 2IJLA 1JHHA 1ZAOA 2DO7A 2NS0A 3GX4X 2FU4A 2PJPA 2IA0A 3E97A 2JTVA 3AAFA 1TW2A 5E1ZB 1WSUA 2CW0F 2OA4A 4A6EA 4EVIA 4I2OA 1MKMA 3KE2A 2QBYB 3T1BA 1U3EM 3DV8A 1FSHA 1LDJA 4XBFA 3R0JA 4MHGA 1I1SA 2EA2A 2HGCA 3E5XA 4I98B 1FBQA 2H27A 3BP8A 1IRFA 3IC7A 3FMRA 3RIRA 1XMKA 2Z3YA 3WU1B 2HOEA 2V1UA 5F64A 4PGGA 3BJOA 2ELHA 4CICA 4OINF 3RJPA 3E5QA 5CVJA 3ZMZA 2P4WA 5ICGA 5E18F 1Z7UA 1HKSA 1FPQA 3B02A 2P7CB 2VBWA 2HTJA 3FXRA 3FXQA 4NB5A 2MA3A 5A2QK 4BH9A 4NHJA 4KUMA 4QLCU 4YFXF 1MD0A 3L2CA 1H9GA 3IWFA 2CQKA 3HRSA 4KIGA 5FD6A 3H3UA 1LDKB 1IN6A 3T0YA 1IXCA 4GCVA 2GWRA 4BXUA 2B0LA 2Q0OA 2XAJA 3CTAA 2BV6A 2O0YA 2K86A 1BN5A 1XSVA 1BC8C 3KLNA 4HDUA 1OYWA 4L5JA 3ML6A 3Q5FA 3VFZA 5IT3A 1J75A 4P5OA 4AWXB 1U6GA 3IHUA 1FZPB 3C7JA 3EYYA 1O3RA 1XCBA 5F6FA 1O3SA 1TQIA 4Q47A 3RKWA 1FBUA 1IN4A 4M9SA 1UHWA 3KEOA 4ASNA 1XDSA 2W57A 4AIHA 1GVJA 2XAGA 2E1CA 1P92A 1TQPA 1U5TC 5D5VB 1ZYRF 1TNSA 3GFLA 4HV6A 2V9VA 4CXFA 1DPUA 2NNYA 1ON2A 3RDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S8N A;  2PEX A;  3WE3 A;  2F2E A;  4N0B A;  1MZB A;  3KP2 A;  2FRH A;  4U0V A;  3BJ6 A;  5IT9 K;  2VN2 A;  3ELK A;  3MQ0 A;  1IAW A;  1AOY A;  3J7A O;  2HEO A;  1MJB A;  2EFN A;  2ZCW A;  1B9N A;  1HBX G;  1WI9 A;  3H3Z A;  2GA2 A;  1W5S A;  3IWZ A;  1PUE E;  3IRQ A;  2Z99 A;  4WCG A;  1WWX A;  2OQR A;  3B73 A;  1LJ9 A;  1RZ4 A;  1WKM A;  4U88 A;  2VXZ A;  2VC0 A;  3VOE A;  5HS7 A;  1E17 A;  2Q8K A;  3BPV A;  3V7C A;  2XAH A;  3DP7 A;  2EB7 A;  3NRV A;  4Q4Z F;  2W85 A;  4MTD A;  2YPR A;  1OR7 A;  3JAM Z;  1CF7 A;  3ABU A;  5D8K B;  1KQ9 A;  5DV5 A;  5LEK A;  1J5Y A;  4EMS A;  2MLK A;  1IRG A;  1BJA A;  2VBY A;  4HLY A;  2F5D A;  5TJJ A;  5E20 A;  2VE8 A;  1CGP A;  5JHU A;  4KFC A;  2D2W A;  4HX7 A;  1SFE A;  3QP5 A;  1TW3 A;  4PZJ A;  4XLN F;  2P6S A;  1FOK A;  3E6D A;  4G6Q A;  1JE8 A;  2FBI A;  4CDG A;  1FYK A;  1W7P D;  1P4A A;  1IF1 A;  2F5C A;  4HQE A;  4HDV A;  2XKO A;  2V1X A;  1UB9 A;  2QM3 A;  2L4M A;  1LVA A;  5J8C A;  2COM A;  3ECH A;  4U0Y A;  4LMY A;  1GXP A;  5KK1 A;  4MEY F;  3F8C A;  2GIV A;  2OU2 A;  4OMZ A;  5CVV A;  4UV8 A;  3V7S A;  2WTE A;  3CLO A;  3R6S A;  2OQG A;  1IUY A;  1FNN A;  2VBX A;  1L0O C;  1FYL A;  1Z6R A;  5K5Q A;  3L9F A;  4MQ9 F;  4ON0 A;  1ZG5 A;  1R58 A;  2OAZ A;  5FGM A;  1SD7 A;  3JTG A;  3JW4 A;  2NYX A;  5DEQ A;  3IKV A;  1ZAR A;  3Q9S A;  3SZT A;  3R0A A;  2IPQ X;  3PQJ A;  2HWV A;  4BHB A;  1XN7 A;  2PBI A;  3I53 A;  3ULQ B;  3EUH A;  1OMI A;  3WTX C;  4LGW A;  2VT2 A;  1D8K A;  4R1H A;  2G7U A;  3V8J A;  2ZFW A;  4L9N A;  4CHU A;  4EJU A;  1ZG1 A;  2DPD A;  3KFW X;  2AS5 F;  2RQP A;  3SZP A;  4KMU X;  2QQB A;  4KN4 X;  1ZLK A;  5DCM B;  3EDP A;  3KZZ A;  2VOO A;  4HAM A;  1O7L A;  2KJB A;  3FMQ A;  4DQ2 A;  2XIG A;  3LA2 A;  3V7R A;  3KET A;  3RYP A;  1ZRD A;  1BOA A;  3O6B B;  2A6H F;  5FFX A;  4HLX A;  3U9G A;  3HUG A;  4Q48 A;  3WG9 A;  1WQ2 A;  2MBF A;  2GAU A;  1B1B A;  5H6Q A;  4RGS A;  5KVR A;  2MC3 A;  2W25 A;  2Y75 A;  2D45 A;  1GXQ A;  3TO7 A;  1DPR A;  2EV6 A;  5H6R A;  3LST A;  4UVA A;  3OOP A;  4RGR A;  3DF8 A;  3HSR A;  4RGU A;  4HOB A;  3WOD F;  3M7G A;  1FX7 A;  4BYY A;  2HYG D;  4M74 A;  3MAJ A;  2O3F A;  4ETS A;  4WX9 A;  1ODD A;  1KQ8 A;  1U5T A;  5H20 A;  1ZGJ A;  1YFH A;  1YW8 A;  3GF2 A;  1LEA A;  4BQA A;  3LA7 A;  1DP7 P;  3CDH A;  1XDU A;  5LHI A;  4U0W A;  2FXA A;  1KU2 A;  1P4X A;  5L3G A;  2ETH A;  4NQW A;  1G3Y A;  1P4W A;  1JXS A;  2MLG A;  2DLL A;  5BPI A;  3R61 A;  5FFZ A;  3E5U A;  1RI7 A;  1ON1 A;  2DQL A;  3TKY A;  1YQA A;  1GHC A;  1P6R A;  1T6S A;  1KYZ A;  1SFX A;  3MWM A;  1IN8 A;  2UXX A;  3I5U A;  1V3F A;  3TDU C;  2A61 A;  5E1X A;  3HOT A;  4EM0 B;  3TGN A;  3WE2 A;  3L00 A;  3GW2 A;  3K69 A;  3M1E A;  1BIB A;  1KA8 A;  4ENK A;  2P5L C;  4EQQ A;  4CYD A;  3L7W A;  2XAS A;  1QZY A;  3P9K A;  4P96 A;  1O57 A;  4MQV A;  2CGP A;  1I5Z A;  2JSC A;  1AWC A;  1U5T B;  5CVU A;  4IPA A;  2XRN A;  2BE5 F;  1RNL A;  1EH8 A;  3FMS A;  3GZ5 A;  4MNU A;  4ZYH A;  1PP7 U;  2DAO A;  1XGO A;  2XGX A;  1KU9 A;  5K1Y A;  3KP3 A;  4M71 A;  4EM2 A;  2G9W A;  3GO5 A;  4WXD A;  2XVC A;  3ZMD A;  5HLH A;  1FP2 A;  2ISY A;  1W4M A;  2YSR A;  1J7K A;  1QGP A;  4FX4 A;  3ZPL A;  4L18 B;  3KEQ A;  3F72 A;  1HST A;  1EH6 A;  1OYY A;  1K6O A;  2W24 A;  3TO6 A;  2QQ9 A;  1HW1 A;  4OIR F;  1KU7 A;  1KGS A;  2L54 A;  3I0T A;  4LB5 A;  4EGY A;  4LG0 A;  4I01 A;  4BNC A;  1HSJ A;  1B9M A;  3V8L A;  4EV0 A;  3E3V A;  2ZXJ A;  2KIU A;  5LHH A;  3ZN1 A;  1ZHF A;  1MGT A;  3CUQ C;  1FSE A;  4HF2 A;  2VON A;  2JZY A;  2Z5U A;  3QU6 A;  1W7P A;  2BGC A;  2D1V A;  1FY7 A;  2F5E A;  2A5Y B;  3BY6 A;  2HYF A;  3DXJ F;  6PAX A;  2EFW A;  5L3F A;  2HZT A;  4D0P A;  4KNY A;  1F5T A;  1R36 A;  4HX4 A;  1U8R A;  2W84 A;  4HF0 A;  3J80 K;  1JGS A;  3ZMU A;  3G73 A;  1Z9C A;  4B09 A;  4I0B A;  3K1P A;  4RGX A;  3F8N A;  2RGV A;  2ESH A;  5JI6 A;  5TRD A;  4YFK F;  2JRT A;  2L4A A;  4G8X A;  4I02 A;  3BPX A;  4WK8 F;  4M9X A;  4H0E A;  2ACJ A;  4M73 A;  4BHP A;  1ZN2 A;  4K2E A;  4ENM A;  1Y0U A;  1QZZ A;  4CO8 A;  1XGS A;  4IXA A;  3KP5 A;  4CZZ A;  3ROU A;  2VOD A;  4OU0 A;  2RN7 A;  4L9J A;  4RB2 C;  1HKT A;  1K79 A;  1C0W A;  1B4A A;  3GFJ A;  4BAY A;  1L3L A;  5E8G A;  3DPT A;  2C6Y A;  1IW7 F;  2EA4 A;  2MH9 A;  5DYM A;  1LDD A;  5FLX Z;  2QYO A;  3J81 Z;  1ZLJ A;  3RKX A;  5BPD A;  3O3K A;  4LK1 F;  4WWC A;  3OV8 A;  2DQR A;  3I58 A;  2CFX A;  2O03 A;  4A0X A;  2LF7 A;  4R79 A;  3RYR A;  4OOI A;  3ABT A;  2IW5 A;  3E6M A;  3PQK A;  1H9T A;  5LGN A;  2R3S A;  2VOP A;  4G7O F;  3R4K A;  1G3W A;  3REO A;  2A6E F;  5K5O A;  2E7X A;  5ED4 A;  2KJC A;  4QWQ A;  1FLI A;  5K5R A;  3JTH A;  4AIJ A;  1SD5 A;  5DCF A;  3VEP A;  2IP2 A;  3F21 A;  2XAF A;  1LQ1 A;  2HKO A;  1FYM A;  4IF4 A;  2IT0 A;  1KQ0 A;  2M8E A;  1K78 A;  1BI0 A;  1TQM A;  3VB2 A;  1TTY A;  2D1H A;  3F6V A;  4O5V A;  1YLF A;  1BI1 A;  3ERE D;  4L9T A;  4EJT A;  5JVT A;  2FSW A;  2WV0 A;  1J0R A;  2HTS A;  3HRU A;  3L09 A;  1BC7 C;  1LEB A;  2VC1 A;  3MFK A;  4HBL A;  3U1D A;  3ZN0 A;  2VE9 A;  1USS A;  1PDN C;  2LDU A;  3GZ6 A;  5DD4 A;  4UV9 A;  2PG4 A;  3TQN A;  2MD5 A;  1RUN A;  2O6G E;  1RUO A;  4UVB A;  4JK1 X;  4Y17 A;  2EV0 A;  1BBY A;  3HSE A;  4LFU A;  4N9I A;  2EJR A;  1CF7 B;  2PMH A;  1HQC A;  1B59 A;  5BOX A;  4YII A;  3BDD A;  4I7H A;  3M8F A;  1O3Q A;  2H94 A;  4IJA A;  2M5W A;  1D8J A;  4XLP F;  3LQQ A;  4L0Z B;  3QPT A;  3BJA A;  2FNA A;  4FT8 A;  3I64 A;  5HLI A;  5L3D A;  2ZKZ A;  3QOP A;  2J5O A;  2FBK A;  3GFM A;  1XCV A;  2ZNZ A;  2H6B A;  4OIP F;  5ILU A;  1K78 B;  3GVA A;  1YO5 C;  5CVI A;  3I4P A;  2QZ8 A;  2UZK A;  4L0Y B;  1R23 A;  5FB2 A;  1V4R A;  4M72 A;  3FM5 A;  5L3E A;  3WTS C;  1WRJ A;  3CUQ A;  3R60 A;  2CSO A;  5HDK A;  5DD8 A;  4LB6 B;  2GQQ A;  5A2Q Z;  2X4H A;  4O3M A;  1OKR A;  5D4R A;  5F1R A;  1S3J A;  4EJW A;  5HLG A;  4IRG A;  4JBA A;  2XKP A;  4WXC A;  5FO5 A;  5JR3 A;  4ENJ A;  5LRS A;  1TNT A;  2RC4 A;  1SD4 A;  4ZYG A;  4Y15 A;  3WGI A;  3QRF F;  4LLL A;  2H09 A;  1YIO A;  4RB1 A;  3HRM A;  1R00 A;  3HSF A;  3HTS B;  5AIP A;  1G6N A;  2DK5 A;  3F3X A;  1Z91 A;  3GXO A;  3TOB A;  1K7A A;  2QUF A;  5J8F A;  3NEU A;  2R7D A;  1EV7 A;  3V8K A;  2YX7 A;  3LQR A;  1R5G A;  5DUK A;  2E1N A;  1U2W A;  1LNW A;  2FOK A;  2PFB A;  3QAH A;  1XD7 A;  3EYI A;  4PGH A;  2RNJ A;  2J5P A;  3LA3 A;  4GO1 A;  1BM9 A;  1MJ9 A;  4EJV A;  4OIO F;  4G6D A;  5ILS A;  1D5V A;  5LGT A;  3JSP A;  3N97 A;  1SAX A;  3RPU A;  2UXN A;  5DDG A;  4HYE A;  1O7F A;  2YR2 A;  3W6K B;  5D5X B;  4G94 A;  3CUQ B;  4KMF A;  1ZH5 A;  1XB4 A;  4IRI A;  3HHG A;  4UXN A;  5ICF A;  2Z9O A;  1G3S A;  3JAM K;  3I54 A;  2CYY A;  5JFR A;  1G3T A;  4R8H A;  2QEN A;  3HOS A;  2DFI A;  4A12 A;  5HS9 A;  1EH7 A;  3MEX A;  1RIO H;  2GA1 A;  5IT9 Z;  4EJO A;  1BI2 A;  2H6C A;  3S2W A;  2HS5 A;  3WTT C;  3ZMV A;  2GZW A;  2KKO A;  3RTR A;  2RVC A;  2DK8 A;  4WXH A;  5LGU A;  4IRH A;  2LNB A;  2STT A;  3F8F A;  3BRO A;  3D0S A;  1DUX C;  2BEO A;  1NHA A;  5HDG A;  3F22 A;  4IVN A;  4L9V A;  3IRR A;  3CUO A;  4G9Y A;  3FXU A;  1ZRE A;  1I6X A;  3P7N A;  5FD5 A;  1Z6T A;  1YG2 A;  2A07 F;  2DBB A;  2XRO A;  5D6F A;  2ZJ2 A;  2YU3 A;  1R1T A;  3ZQ7 A;  1SD6 A;  3KP7 A;  4AVP A;  3M8E A;  3WGG A;  3G3Z A;  3ZMT A;  1R22 A;  2P5K A;  1I27 A;  2TDX A;  5LLQ A;  4RAY A;  4A6D A;  2AXL A;  1R1V A;  4A5N A;  4ENN A;  3F6O A;  1IXR C;  5D8L B;  3RPQ A;  1XMA A;  1H0M A;  3FX3 A;  2PMU A;  2QQA A;  3P9C A;  4LD5 A;  3NQO A;  5HS8 A;  2WWY A;  3E6B A;  3GLX A;  3C3W A;  2FBH A;  2FE3 A;  4M9Z A;  1ZGA A;  5BMZ A;  1S29 A;  2M45 A;  4U7D A;  3KP4 A;  2GXG A;  4I0A A;  1TLH B;  1R1U A;  2G7H A;  5D5W B;  3GYH X;  1YTY A;  4A2U A;  4M6X A;  2RV8 A;  4HF1 A;  3QPH A;  4ESF A;  4LLG F;  3F23 A;  1UFM A;  5AON A;  4GYG A;  3MZH A;  2KIF A;  3IL2 A;  2DTR A;  3K9T A;  3LFK A;  1XSX A;  1T39 A;  5J6X A;  2NNN A;  4A5M A;  1SMT A;  1J9I A;  2FNP A;  4MTE A;  5HVQ C;  5E8I A;  2CWE A;  3DQV C;  4UHT A;  2VT3 A;  3V4G A;  2FQ3 A;  2Y48 A;  1S6L A;  5LEJ A;  3SHF A;  1Z1D A;  5LBQ A;  2MH2 A;  4UNO A;  3ECO A;  2F5F A;  1SMY F;  4AD9 A;  2EFP A;  2ADU A;  3BOQ A;  4OIQ F;  1UCR A;  3RKY A;  3U2R A;  3HYI A;  4P9U A;  4OMY A;  1T98 A;  3PFI A;  5BQT A;  1HKQ A;  2LKP A;  4Q5S F;  3BZ6 A;  3LAP A;  3N4M A;  5ICC A;  4S04 A;  4ZH4 F;  2JT1 A;  4RB3 C;  2BBY A;  4LG0 B;  1PP8 F;  4DNC A;  3FHZ A;  4MEX F;  4UUV A;  2DI3 A;  3TOA A;  4M6Y A;  5E17 F;  1FC3 A;  2NRA C;  4G7H F;  2OD5 A;  1JHF A;  4EM1 A;  2V79 A;  2K27 A;  1REP C;  2P5V A;  2Y0M A;  4GYI A;  2IRF G;  4I09 A;  3P9I A;  4KA4 A;  2WC2 A;  4RS8 A;  3SFZ A;  4FX0 A;  3LAJ A;  5EEG A;  3F8B A;  4YG2 F;  2EV5 A;  2ZBK A;  2ESN A;  5DUI A;  5D5U B;  1FP1 D;  1W7P B;  4ZZL A;  4ESJ A;  4PCQ A;  5L3C A;  3GEZ A;  1T0F A;  1KU3 A;  3DEU A;  3JSO A;  1U78 A;  2X0L A;  1X3U A;  2JPB A;  4EGZ A;  3DFG A;  4P55 A;  1T38 A;  2M1B A;  3H92 A;  5HOO A;  1XGN A;  1BIA A;  2CG4 A;  3DKW A;  1F9N A;  2LSO A;  2K4J A;  1IXS B;  5D4S A;  3E6C C;  3FM3 A;  4TV7 A;  4UVC A;  4IHT A;  5D6E A;  1QPM A;  2A3S A;  5ICE A;  3HRT A;  1STZ A;  4U7B A;  3GFI A;  2PN6 A;  2K7L A;  2EFO A;  2OZ6 A;  2Z33 A;  4ESB A;  5ERI A;  4PDK A;  5LRR A;  4HQM A;  4Z2Y A;  1UHM A;  1G4D A;  1QO0 D;  5CVR A;  1S7O A;  3O2P E;  1D3Y A;  4XSX F;  4GGG A;  3K0L A;  5CJ9 A;  4HX8 A;  1FWZ A;  3T5X A;  2ZO4 A;  4ZZD A;  2KRF A;  2BYV E;  1YYV A;  4KIB A;  2O61 A;  1LB2 A;  4YFN F;  1Q1H A;  2K4B A;  1KYW A;  4ZYD A;  3M9A A;  1ZG3 A;  2UWM A;  2FML A;  3C1D A;  5ILV A;  1F1Z A;  1IN5 A;  2HQN A;  4L5I A;  2HQR A;  2RKH A;  3CJN A;  4A0Y A;  1YS6 A;  2IA2 A;  5DCM A;  2ZME A;  3FF5 A;  3WTW C;  3HTU A;  3Q9V A;  4FHT A;  3BWG A;  1MDM A;  4MGR A;  2HDC A;  1YW7 A;  3GUD A;  3EET A;  2HKX A;  1S7A A;  1BI3 A;  2DW4 A;  2DPU A;  4A0Z A;  3ISP A;  3LWF A;  2OZU A;  5E1W A;  4E70 A;  3I59 A;  1MJA A;  2A69 F;  2L01 A;  2M30 A;  3KP6 A;  3WU0 A;  1HW5 A;  4JQF A;  4B8X A;  4HZF A;  2HR3 A;  2NAZ A;  3FWE A;  3WTU C;  2P8T A;  2PLY A;  4HA8 A;  1O3T A;  3MZY A;  2STW A;  3K1M A;  1OYI A;  2YX4 A;  3ZMS A;  4WF2 A;  2M87 A;  3C18 A;  1HW2 A;  3ZP5 A;  1P2F A;  3WTZ A;  2XAQ A;  3WTY C;  2R7F A;  1DDN A;  2EWN A;  1A04 A;  2PI0 A;  4HW0 A;  2XUB A;  1T2K A;  1FT9 A;  3KZY A;  2Q2E A;  5LHG A;  4ZYE A;  4KDP A;  1E2X A;  3F8M A;  4KT5 C;  1B6A A;  2ZME B;  2FEZ A;  2K02 A;  1R5H A;  3KLO A;  2L3D A;  2JPC A;  1OPC A;  2A68 F;  1FBS A;  1VTN C;  1MDM B;  2O8X A;  3MCZ A;  4LJZ F;  3WGH A;  4BHC A;  3RI4 A;  4KIF A;  3I59 B;  4HV5 A;  5BS6 A;  4LLN A;  2L02 A;  1J2X A;  2DU9 A;  1SFU A;  5FLX K;  3J81 K;  2PQ8 A;  4GXO A;  2XHK A;  1ONV A;  3J80 Z;  4RAZ A;  1XSD A;  2QWW A;  4KYW A;  1J59 A;  1YS7 A;  2DT5 A;  5CYV A;  3TO9 A;  3D5L A;  1I1G A;  4AIK A;  2OBP A;  2CO5 A;  1QBJ A;  1ZRC A;  2QLZ A;  4YIF A;  2HFH A;  2V6C A;  3I71 A;  2ZNY A;  3WTV C;  4P9F A;  3CO6 C;  3HHH A;  1F4K A;  3COA C;  2RDP A;  1UST A;  3FZV A;  1R7J A;  1Z05 A;  2GXB A;  2QBY A;  1TBX A;  5AIQ A;  2FMY A;  4CGZ A;  2VBZ A;  2IA1 A;  3EQL F;  2LF8 A;  1ZRF A;  3K1N A;  5EEH A;  3T8R A;  4G7Z F;  4LK0 F;  1YW9 A;  3VOD A;  3IKT A;  3QU3 A;  2EFQ A;  5CLS A;  2EK5 A;  4KIC A;  4KN7 X;  3T8T A;  4XSZ F;  1IZ1 A;  2IVM A;  4XRF A;  1QNT A;  3QP6 A;  2ISZ A;  1XGM A;  3KCC A;  1W5T A;  3DPL C;  4IHS A;  4F7Z A;  2P6T A;  3SQN A;  2KIM A;  2V1D A;  1HXD A;  2P7V B;  4RB0 A;  2E7W A;  3CO7 C;  3W6J B;  3TDZ C;  1ULY A;  3K2Z A;  1IN7 A;  3HIF A;  5L3B A;  2FF4 A;  2XV4 S;  3GWZ A;  4Y13 A;  4S05 A;  2QVO A;  2FA5 A;  5HDN A;  4N9H A;  3SXY A;  1QQI A;  4O6J A;  2IJL A;  1JHH A;  1ZAO A;  2DO7 A;  2NS0 A;  3GX4 X;  2FU4 A;  2PJP A;  2IA0 A;  3E97 A;  2JTV A;  3AAF A;  1TW2 A;  5E1Z B;  1WSU A;  2CW0 F;  2OA4 A;  4A6E A;  4EVI A;  4I2O A;  1MKM A;  3KE2 A;  2QBY B;  3T1B A;  1U3E M;  3DV8 A;  1FSH A;  1LDJ A;  4XBF A;  3R0J A;  4MHG A;  1I1S A;  2EA2 A;  2HGC A;  3E5X A;  4I98 B;  1FBQ A;  2H27 A;  3BP8 A;  1IRF A;  3IC7 A;  3FMR A;  3RIR A;  1XMK A;  2Z3Y A;  3WU1 B;  2HOE A;  2V1U A;  5F64 A;  4PGG A;  3BJO A;  2ELH A;  4CIC A;  4OIN F;  3RJP A;  3E5Q A;  5CVJ A;  3ZMZ A;  2P4W A;  5ICG A;  5E18 F;  1Z7U A;  1HKS A;  1FPQ A;  3B02 A;  2P7C B;  2VBW A;  2HTJ A;  3FXR A;  3FXQ A;  4NB5 A;  2MA3 A;  5A2Q K;  4BH9 A;  4NHJ A;  4KUM A;  4QLC U;  4YFX F;  1MD0 A;  3L2C A;  1H9G A;  3IWF A;  2CQK A;  3HRS A;  4KIG A;  5FD6 A;  3H3U A;  1LDK B;  1IN6 A;  3T0Y A;  1IXC A;  4GCV A;  2GWR A;  4BXU A;  2B0L A;  2Q0O A;  2XAJ A;  3CTA A;  2BV6 A;  2O0Y A;  2K86 A;  1BN5 A;  1XSV A;  1BC8 C;  3KLN A;  4HDU A;  1OYW A;  4L5J A;  3ML6 A;  3Q5F A;  3VFZ A;  5IT3 A;  1J75 A;  4P5O A;  4AWX B;  1U6G A;  3IHU A;  1FZP B;  3C7J A;  3EYY A;  1O3R A;  1XCB A;  5F6F A;  1O3S A;  1TQI A;  4Q47 A;  3RKW A;  1FBU A;  1IN4 A;  4M9S A;  1UHW A;  3KEO A;  4ASN A;  1XDS A;  2W57 A;  4AIH A;  1GVJ A;  2XAG A;  2E1C A;  1P92 A;  1TQP A;  1U5T C;  5D5V B;  1ZYR F;  1TNS A;  3GFL A;  4HV6 A;  2V9V A;  4CXF A;  1DPU A;  2NNY A;  1ON2 A;  3RDI A; 
#chains in the Genus database with same CATH topology
 2P81 A;  3BTJ A;  4C3J J;  1S8N A;  2PEX A;  3WE3 A;  2F2E A;  4N0B A;  1MZB A;  2KZG A;  3KP2 A;  2FRH A;  4DW6 A;  2HI3 A;  2JA7 J;  4U0V A;  3BJ6 A;  5IT9 K;  1TWC J;  2VN2 A;  3L1P A;  1VQ9 I;  3ELK A;  3MQ0 A;  1IAW A;  1SC7 A;  1AOY A;  5H2F C;  3J7A O;  2V9K A;  2CV0 A;  2HEO A;  1MJB A;  2CH0 A;  3PL8 A;  2KDZ A;  2EFN A;  4W1U A;  3CLQ A;  2ZCW A;  3K70 D;  1BA5 A;  1B9N A;  4G6T B;  1HBX G;  1WI9 A;  2IGK A;  1FIP A;  3L2Q A;  1UG2 A;  5F27 A;  3H3Z A;  2NS7 A;  1VFC A;  2GA2 A;  1W5S A;  3IWZ A;  1ZR2 A;  1PUE E;  1JUS A;  3IRQ A;  2GOX B;  2Z99 A;  4WCG A;  1WWX A;  2OTJ I;  1HCR A;  2OQR A;  2D5V A;  3HGG A;  4RM3 A;  3H9G A;  2EIL H;  3B73 A;  3ZQH A;  4IQ4 A;  1LJ9 A;  3E7L A;  1RZ4 A;  2RQQ A;  5J4V A;  1WKM A;  4XIC A;  4U88 A;  4CYC B;  2VXZ A;  4V19 K;  5KCM A;  1OCZ H;  2VC0 A;  3VOE A;  2LH9 A;  2VKV A;  4D7N A;  5HS7 A;  1E17 A;  4M3D A;  4XOR A;  2Q8K A;  3S15 J;  5KHD A;  3BPV A;  4BEH B;  1PUF A;  3V7C A;  3AG1 H;  2XAH A;  3DP7 A;  2XGE A;  2R7O A;  3HKZ A;  1EF4 A;  2WAQ N;  2EB7 A;  3NRV A;  4Q4Z F;  2W85 A;  4MTD A;  3HL2 A;  4A3F J;  2YPR A;  1OR7 A;  3JAM Z;  4I76 A;  2LKX A;  1CF7 A;  3ABU A;  3BG5 A;  5D8K B;  4XOT A;  1KQ9 A;  3IUO A;  5DV5 A;  5LEK A;  1J5Y A;  4EMS A;  2HQ5 A;  1IV8 A;  3ZQQ A;  4DBQ A;  2MLK A;  1IRG A;  1BJA A;  3BR2 A;  2VBY A;  4HLY A;  2F5D A;  4AID A;  5TJJ A;  2H1L A;  5E20 A;  2VE8 A;  5E3L A;  2BXZ A;  5JHU A;  3CCU I;  1CGP A;  4KFC A;  1WGX A;  3BC8 A;  2LLK A;  2D2W A;  1QVU A;  4HX7 A;  1SFE A;  1UAA A;  3QP5 A;  1TW3 A;  4PZJ A;  4XLN F;  3FXO A;  2P6S A;  1FOK A;  2JRM A;  1ZR4 A;  4BAC A;  2B9S A;  3E6D A;  3OSF A;  4G6Q A;  1JE8 A;  2FBI A;  4CDG A;  1FYK A;  4DOZ A;  1W7P D;  5C4J J;  1P4A A;  1IF1 A;  2F5C A;  2VJ4 A;  4B1R A;  1T56 A;  4HQE A;  4HDV A;  2XKO A;  1LUJ B;  3AG3 H;  2V1X A;  3QPS A;  1UB9 A;  2IS1 A;  3AFH A;  2QM3 A;  3BG9 A;  3K6G A;  2W1O A;  3MN2 A;  2XPV A;  4HNV A;  2L4M A;  3GTQ J;  3I56 I;  1LVA A;  1X19 A;  2ZC2 A;  3MZ8 A;  5F0F A;  1F36 A;  5J8C A;  1MMS A;  2COM A;  5IYB J;  1JT6 A;  3GME A;  3K70 C;  2HDW A;  1QU3 A;  2LG4 A;  5DM7 F;  1IC8 A;  4E7K A;  3ECH A;  1VF9 A;  3JRB A;  2F4M B;  4U0Y A;  2KQR A;  4B43 A;  4LMY A;  1GXP A;  4JX5 A;  5KK1 A;  1VQM I;  2BXY A;  4RLQ A;  1VQK I;  4MEY F;  4YEJ A;  3F8C A;  2X1C A;  2X1E A;  4N4O B;  1A6Q A;  2CV2 A;  2GIV A;  1SFK A;  2OU2 A;  4OMZ A;  5CVV A;  2LBF A;  4UV8 A;  3V7S A;  5F0C A;  2LC2 A;  2PMZ N;  4MIM A;  2WTE A;  1UEL B;  4LIU A;  1JKO C;  1YOV B;  2L9V A;  3CLO A;  3R6S A;  3ERM A;  3CMY A;  1OIS A;  2OQG A;  1POG A;  1BOB A;  1FNN A;  1W1W E;  2VBX A;  1IUY A;  1VQ4 I;  2VUM J;  1L0O C;  3S16 J;  2Y30 A;  3AL0 C;  5HLT A;  3OR1 C;  3S1Q J;  4E7J A;  4BY7 J;  1FYL A;  3LSI A;  1Z6R A;  5K5Q A;  4MFD A;  3L9F A;  4NC8 A;  3S93 A;  4MQ9 F;  2IS6 A;  1T08 B;  4ON0 A;  1ZG5 A;  1R58 A;  5IYD J;  2OAZ A;  5FGM A;  1SD7 A;  3JTG A;  3JW4 A;  2NYX A;  5DEQ A;  2K9M A;  2HNH A;  4HST A;  4BXF A;  3IKV A;  1ZAR A;  3Q9S A;  3SZT A;  3R0A A;  2IPQ X;  3PQJ A;  1UJ8 A;  2DMT A;  2HWV A;  2L9N A;  3MKL A;  1TWA J;  2KZV A;  3CF2 A;  4BHB A;  1FTT A;  2VAS A;  1UZC A;  1XN7 A;  3S2D J;  2PBI A;  3I53 A;  3ULQ B;  3EUH A;  2COB A;  1OMI A;  3WTX C;  2AO9 A;  4LGW A;  1IDZ A;  3H0G J;  3K4J A;  4XM3 A;  2VT2 A;  4HSR A;  3HC7 A;  1D8K A;  4R1H A;  2G7U A;  1ZEL A;  3I4N J;  3UR3 C;  3V8J A;  4XKV A;  4XR6 A;  4XLC A;  5EDN A;  2ZFW A;  3ASO H;  4AYB N;  3HDD A;  4A3M J;  1WJD A;  2HVR A;  4L9N A;  3RZO J;  4IOC F;  4CHU A;  3SDB A;  4EJU A;  1ZG1 A;  1B72 B;  3KFW X;  4BDY A;  1LE8 A;  2L7F P;  2RQP A;  2AS5 F;  2DPD A;  3SZP A;  3WHB A;  2G0E A;  1LPQ A;  4KMU X;  2M0C A;  1DU6 A;  3TP3 A;  3FK6 A;  2QQB A;  4KN4 X;  1ZLK A;  2R7S A;  5DCM B;  3EDP A;  2E1M C;  3KZZ A;  3OYC A;  1NK3 P;  2VOO A;  4HAM A;  1IGN A;  4JX4 A;  1O7L A;  2KJB A;  3FMQ A;  4DQ2 A;  2XIG A;  1VQ5 I;  3LA2 A;  3V7R A;  3KET A;  3RYP A;  1LFU P;  1NG6 A;  1ZRD A;  3KZI C;  1BOA A;  2DDB A;  3O6B B;  2A6H F;  5FFX A;  2Y2Z A;  4HLX A;  1HDP A;  3U9G A;  2H8R A;  3HUG A;  4FE7 A;  4Q48 A;  2LBF B;  3HG9 A;  4PJJ A;  3WG9 A;  3PO2 J;  1V5G A;  1WQ2 A;  3DKY A;  3OS0 A;  5FKL A;  2MBF A;  2GAU A;  3EUK L;  1B1B A;  1AU7 A;  5H6Q A;  4RGS A;  4XLH A;  5KVR A;  2MC3 A;  2W25 A;  2PJR A;  1TC3 C;  2Y75 A;  2D45 A;  1GXQ A;  3TO7 A;  4XRM A;  1QRY A;  1DPR A;  2EV6 A;  1T95 A;  5H6R A;  2K5C A;  3FKI J;  3LST A;  3JR9 A;  4UVA A;  3OOP A;  2M9H A;  4RGR A;  1R49 A;  3DF8 A;  2HQA A;  3HSR A;  4DJA A;  5GTH C;  4RGU A;  5FLM J;  2DOD A;  3WU2 C;  2A5W A;  2DYS H;  3LL7 A;  4HOB A;  3WOD F;  3M7G A;  1FX7 A;  4BYY A;  2OV7 A;  1R71 A;  1TZL A;  2V7F A;  3GLL A;  3M1C A;  4Y4R A;  2CFO A;  1PVE A;  2XPW A;  5CQE A;  1WHU A;  3RQI A;  1ENH A;  2HYG D;  4M74 A;  3MAJ A;  2NVT J;  2O3F A;  4ETS A;  2XF5 A;  1MND A;  4WX9 A;  2DA5 A;  3DTI A;  1ODD A;  1KQ8 A;  5J47 A;  1U5T A;  1BR1 A;  3D5R C;  5H20 A;  4XNF A;  3H9J A;  5GP9 A;  5HNF A;  3C2H A;  1ZGJ A;  2MYS A;  1YW8 A;  1YFH A;  3GF2 A;  1LE8 B;  2AXT C;  1LEA A;  1N77 A;  2Q2E B;  1SVO A;  4BQA A;  1DQU A;  1TT5 B;  1GLN A;  3G1O A;  2ELJ A;  3LA7 A;  4DYC A;  1DP7 P;  3CDH A;  1XDU A;  2QCO A;  5GPC A;  5LHI A;  4U0W A;  2FXA A;  2RRE A;  1KU2 A;  1P4X A;  5CKT A;  5L3G A;  4F92 B;  2ETH A;  3OS2 A;  4NQW A;  3ZQG A;  1G3Y A;  1P4W A;  1JXS A;  1JI8 A;  4ZC3 A;  2GXA A;  2MLG A;  2MW8 A;  4M6V A;  1B8I B;  1WI3 A;  2DXI A;  1ETO A;  2DLL A;  3S1R J;  2ZJQ F;  1ACI A;  3HZJ A;  4BE0 A;  4B4C A;  5BPI A;  3QOE A;  2E1O A;  2XB5 A;  3RZD J;  1YI2 I;  4XMY A;  1PYV A;  2VB6 A;  3R61 A;  5FFZ A;  3E5U A;  1RI7 A;  1H89 C;  1ON1 A;  2DQL A;  2ZXW H;  3C2B A;  3FXM A;  3OIO A;  3TKY A;  1YQA A;  1GHC A;  1P6R A;  1T6S A;  1KYZ A;  1SFX A;  2K9N A;  3MWM A;  3VYU B;  1IN8 A;  3OYD A;  3HOU J;  3JRC A;  2UXX A;  3I5U A;  1V3F A;  4YIR X;  3TDU C;  2A61 A;  3K4K A;  4OWR B;  1YIJ I;  5E1X A;  1S9H A;  3G1L A;  2ZXI A;  5GTI C;  3HOT A;  4BJ5 C;  4EM0 B;  2K9L A;  3OYH A;  4Z6Y A;  3TGN A;  3WE2 A;  4XON A;  3L00 A;  4IOA F;  3GW2 A;  3G4S I;  1I50 J;  3K69 A;  3M1E A;  1BIB A;  3ZOB A;  1KA8 A;  4XOP A;  1OFC X;  4ENK A;  2P5L C;  2R5Y B;  4EQQ A;  3Q0U A;  4CYD A;  3L7W A;  1AA7 A;  1WVR A;  1A36 A;  5IOZ A;  4RAF A;  4Y7N J;  2OCC H;  2XAS A;  1QZY A;  2LYC A;  3RCO A;  1FOY A;  3P9K A;  4P96 A;  1O57 A;  4MQV A;  5EEA A;  2CGP A;  2JA2 A;  1I5Z A;  2LP0 A;  2JSC A;  1AWC A;  1X3Z B;  4D5C A;  1X2M A;  1U5T B;  5F1J A;  3FBI B;  2ECB A;  5CVU A;  4IPA A;  1X2N A;  3IV5 A;  4CCK A;  2XRN A;  2BE5 F;  1RNL A;  1EH8 A;  3FMS A;  1OJL A;  1A5J A;  3GZ5 A;  4L5E A;  4MNU A;  4ZYH A;  1PP7 U;  2XSD C;  2DAO A;  1XGO A;  3NWT A;  3CES A;  2XGX A;  1KU9 A;  2F6C A;  3DU5 A;  2CUJ A;  3KP3 A;  5K1Y A;  4M71 A;  4EM2 A;  3ZQC A;  2G9W A;  3LSG A;  4BJT A;  3GO5 A;  4GRI A;  2XVC A;  4WXD A;  3ZMD A;  1P7I A;  3M8J A;  5HLH A;  1FP2 A;  4NQW B;  4M3B A;  2XAU A;  4FE4 A;  2ISY A;  2HPM A;  2DMN A;  1W4M A;  2OPT A;  1WJB A;  3V42 A;  2YSR A;  1J7K A;  1QGP A;  2LK2 A;  4FX4 A;  2LD5 A;  1R4M B;  3ZPL A;  4L18 B;  3KEQ A;  3FIW A;  3F72 A;  1HST A;  1EH6 A;  1OYY A;  4XKB A;  3A0H C;  5TGT A;  3ABL H;  1K6O A;  2ZJR F;  5IYC J;  2W24 A;  3TO6 A;  3S14 J;  2QQ9 A;  4BY1 J;  2IEK A;  2MFZ A;  1HW1 A;  1Y6I A;  2CRG A;  3UNG C;  4OIR F;  1KU7 A;  2DA7 A;  3WHC A;  2XGC A;  1KGS A;  2L54 A;  4FQG A;  3I0T A;  4LB5 A;  4EGY A;  4X0G A;  4LG0 A;  2CW8 A;  4I01 A;  2GLO A;  3K4C A;  1XX5 A;  3FIS A;  3U1K A;  4BNC A;  5E3M A;  1HSJ A;  1B9M A;  2HU9 A;  3V8L A;  4XLE A;  4UB8 C;  4AVZ A;  1VQ8 I;  4EV0 A;  3E3V A;  2ZXJ A;  1YE9 A;  3A4C A;  2R7U A;  2KIU A;  2L5Q A;  1ZKG A;  2FJ1 A;  3FXK A;  3RPU D;  5LHH A;  3ZN1 A;  5HOD A;  1ZHF A;  3W2V A;  1MGT A;  3S32 A;  3CUQ C;  1FSE A;  4BQN A;  2GBY A;  4HF2 A;  1TWG J;  4HNT A;  2IS2 A;  2CW7 A;  2RNG A;  4GFB A;  3S3N A;  1X3W B;  4ZDO A;  2VON A;  3GBG A;  1WCM J;  1WJ5 A;  2JZY A;  3B6A A;  5B1A H;  2QKL B;  2Z5U A;  4PK4 A;  1OLT A;  1LFB A;  3QU6 A;  4E7Z A;  1W7P A;  2BGC A;  2VXD A;  1P9Q C;  2D1V A;  4CCO A;  1FY7 A;  3HPG A;  2DDA A;  2V26 A;  2F5E A;  2DA4 A;  1GDT A;  1W0U A;  2XC7 A;  3GTO J;  3TMO A;  4JOM A;  1MSE C;  2A5Y B;  3BY6 A;  3ZGK A;  2HYF A;  1TL8 A;  4BQO A;  4UUS B;  1OQY A;  3DXJ F;  6PAX A;  2EFW A;  5L3F A;  1W36 D;  2HZT A;  4D0P A;  4KNY A;  3Q0W A;  4C30 A;  1F5T A;  1R36 A;  4J00 A;  4HX4 A;  1U8R A;  2W84 A;  4HF0 A;  3CCQ I;  4OAY A;  3SEZ A;  1JGS A;  3ZMU A;  3J80 K;  3G73 A;  2NVY J;  1Z9C A;  4B09 A;  4I0B A;  4D7M A;  4DZP A;  4B3X A;  5EG0 A;  1XTA A;  3K1P A;  2K85 A;  2KL4 A;  4RGX A;  3RSN A;  3PIP F;  2X85 A;  3F8N A;  2RGV A;  1PJR A;  4FAS D;  3WG7 H;  4AUX A;  4KIS A;  2ESH A;  1K4S A;  5JI6 A;  5TRD A;  4PUS A;  3OYA A;  4YFK F;  2JRT A;  2L4A A;  4G8X A;  2MC4 A;  3LSM A;  4I02 A;  1U8B A;  3BPX A;  4WK8 F;  4M9X A;  3FXL A;  1Y0N A;  4JX6 A;  5J40 A;  1WFX A;  3VYS B;  1J09 A;  2Q1Z B;  2VKE A;  4H0E A;  2ACJ A;  4CSW A;  4M73 A;  4B47 A;  4BHP A;  1ZN2 A;  1D0X A;  4K2E A;  4ENM A;  1VQO I;  3AL0 B;  4DGW B;  4HPQ A;  1Y0U A;  1QZZ A;  4CO8 A;  1XGS A;  4IXA A;  2VQG A;  3KP5 A;  4CZZ A;  1YHQ I;  1QA6 A;  3ROU A;  2VOD A;  4OU0 A;  1BR2 A;  3ZR8 X;  1U9N A;  2RN7 A;  4L9J A;  3TED A;  4RB2 C;  1DGR M;  1HKT A;  3VSK A;  2KRH A;  2V9P A;  1K79 A;  1TWF J;  4XQF A;  3HOZ J;  4ZTF A;  1TP4 A;  1B4A A;  1C0W A;  1E0E A;  3GFJ A;  4FET A;  1WH7 A;  1TWH J;  3H5A A;  4BAY A;  1L3L A;  3ABK H;  4MO7 A;  5E8G A;  3DPT A;  2C6Y A;  1IW7 F;  2DCE A;  2EA4 A;  2MH9 A;  5DYM A;  1LDD A;  4B48 A;  3JRE A;  3DLL F;  5E3N A;  4RA2 A;  4E6K G;  2V6E A;  4PFP A;  5FLX Z;  2QYO A;  3J81 Z;  4PJL A;  1ZLJ A;  3RKX A;  2VIX A;  1JJ6 C;  5BPD A;  2QA4 I;  3O3K A;  3N05 A;  4II2 A;  3BTC A;  4LK1 F;  4WWC A;  2I5U A;  3OMY A;  3OV8 A;  3L2U A;  5EYR A;  2GOM A;  4FCY A;  2DQR A;  4C2M J;  2EIJ H;  3I58 A;  3CP8 A;  4LIT A;  2CFX A;  2K9S A;  2OJE D;  2O03 A;  3A0B C;  4A0X A;  2LF7 A;  1X1B A;  3VDX A;  2ECC A;  2EBI A;  4R79 A;  3RYR A;  2N8G A;  4OOI A;  3PM1 A;  3ABT A;  2IW5 A;  5EGO B;  3QYB A;  2X9D A;  3E6M A;  3PQK A;  2E1M B;  1H9T A;  5LGN A;  3GZN B;  3QQA A;  2R3S A;  2VOP A;  4G7O F;  4M3F A;  3R4K A;  4BQQ A;  1G3W A;  5KAF C;  2JK3 A;  3REO A;  2DJI A;  2A6E F;  3P5J A;  1ORK A;  2E60 A;  5K5O A;  2E7X A;  3HJE A;  2H1K A;  5ED4 A;  2KJC A;  4A3G J;  2Z1D A;  1MSF C;  1ZTR A;  1ZQ3 P;  5F04 A;  1DU0 A;  2OC6 A;  3DTE A;  4C2T A;  4QWQ A;  1FLI A;  5EZH A;  2X6O A;  3HPH A;  5K5R A;  3JTH A;  4AIJ A;  4XRS A;  5GAG J;  3KEY A;  2R92 J;  5LD2 C;  1R9T J;  3OL3 A;  2EH3 A;  1SD5 A;  2HXI A;  5DCF A;  1WJC A;  3OYE A;  3VEP A;  4A3E J;  4H4K C;  2IP2 A;  3SDG A;  3F21 A;  2XAF A;  1LQ1 A;  4BBS J;  3BG7 A;  2HKO A;  1IJW C;  4DZJ A;  3MKY B;  1FYM A;  4IF4 A;  2O8K A;  2IT0 A;  1FJL A;  1KQ0 A;  1RC9 A;  2M8E A;  2A05 A;  1K78 A;  5FKK A;  1BI0 A;  1TQM A;  3VB2 A;  5M3M J;  2PX9 A;  2DYR H;  2K3F A;  2VI6 A;  1TTY A;  3OYI A;  2D1H A;  3F6V A;  4EAT A;  3CCJ I;  1FTZ A;  1UMQ A;  4O5V A;  1YLF A;  1BI1 A;  4CZC A;  3OYJ A;  3ERE D;  3S3O A;  2IAI A;  4L9T A;  3SFI A;  4EJT A;  5JVT A;  4P1W A;  2WAQ A;  2AHQ A;  3W3C A;  2FSW A;  1HF0 A;  2WV0 A;  1J0R A;  4BS9 A;  2HTS A;  5E79 C;  3HRU A;  3OYK A;  2L7M P;  3L09 A;  1BC7 C;  1LEB A;  1JUM A;  2E2J J;  1Z0X A;  2BHY A;  1IRX A;  3A01 A;  2VC1 A;  1QZE A;  1I3Q J;  3MFK A;  1M1E B;  2AQF A;  4HBL A;  3G6E I;  2UV1 A;  1G8X A;  3U1D A;  3ZN0 A;  2VE9 A;  1P7J A;  4A93 J;  1USS A;  4HRI A;  2TRT A;  1PDN C;  2LDU A;  4ZDP A;  3GZ6 A;  3H3V K;  5DD4 A;  3M3Y J;  3IH3 A;  1K61 A;  4RBO A;  2W4S A;  2DMU A;  4UV9 A;  2PG4 A;  3TQN A;  2MD5 A;  1GUU A;  1PUF B;  5LFA A;  1RUN A;  4AC0 A;  2O6G E;  1RUO A;  4UVB A;  4CUG A;  4JK1 X;  2JA6 J;  5IOY A;  4Y17 A;  2EV0 A;  1BBY A;  3HSE A;  2I8D A;  4LFU A;  4N9I A;  4NC6 A;  2XF6 A;  2EJR A;  1IV6 A;  1CF7 B;  3DEW A;  2DA6 A;  2PMH A;  1HQC A;  1ETQ A;  1B59 A;  5BOX A;  4YII A;  4BU2 A;  3PIO F;  3BDD A;  4I7H A;  3M8F A;  1O3Q A;  2H94 A;  3I55 I;  4IJA A;  2M5W A;  2MGQ A;  3CP2 A;  2NVU B;  2X6Y A;  1D8J A;  2AQE A;  4XLP F;  5KAI C;  4F91 B;  3DU6 A;  3LQQ A;  2LTP A;  4L0Z B;  3QPT A;  3BJA A;  2FNA A;  2NOG A;  4FT8 A;  3VYT B;  2EQR A;  3I64 A;  3A03 A;  5HLI A;  2ME6 A;  4B44 A;  5L3D A;  3MKZ A;  2EIK H;  2ZKZ A;  2ELK A;  2J5O A;  3QOP A;  2FBK A;  3W2W A;  2O9L A;  3GFM A;  4DYR A;  1XCV A;  2ZNZ A;  2H6B A;  1AKH A;  4OIP F;  1MBF A;  5ILU A;  2PMZ A;  2KMU A;  1K78 B;  4CCL A;  3GVA A;  4HEA 2;  2VQC A;  1YO5 C;  2HYJ A;  5CVI A;  3I4P A;  2QZ8 A;  2UZK A;  4F55 A;  1JTY A;  1W5C C;  4L0Y B;  1R23 A;  5FB2 A;  1V4R A;  4UUT A;  4M72 A;  3FM5 A;  5L3E A;  3WTS C;  3G1M A;  1WRJ A;  3L2W A;  3SJM A;  3CUQ A;  2LKS A;  1JJ8 C;  3R60 A;  2CSO A;  5HDK A;  3I9V 2;  1Y56 A;  5DD8 A;  4LB6 B;  4RDU A;  5JLX A;  4AU7 A;  2GQQ A;  2M0M A;  2X4H A;  5A2Q Z;  4O3M A;  3G71 I;  1OKR A;  4I6Z A;  4XKC A;  5D4R A;  2YU9 J;  5F1R A;  1LFP A;  3A01 B;  1S3J A;  3K4B A;  4EJW A;  2NVX J;  2LMD A;  4IRG A;  4JBA A;  5HLG A;  1QHH D;  1ZGW A;  4J01 A;  4RAG A;  2XKP A;  4WXC A;  5FO5 A;  5JR3 A;  2E2H J;  4ENJ A;  5LRS A;  1TNT A;  5EF6 A;  2RC4 A;  1SD4 A;  3L2R A;  4BGD A;  4ZYG A;  4Y15 A;  3WGI A;  3QRF F;  4LLL A;  2H09 A;  1H8A C;  2IGO A;  1YIO A;  4RB1 A;  3HRM A;  4PSX A;  2RAE A;  1R00 A;  4IQJ A;  1MMA A;  1Y1W J;  3HSF A;  1VND A;  1FOW A;  3HTS B;  3FK7 A;  5AIP A;  1G6N A;  2DK5 A;  3F3X A;  4YEL A;  5FJ8 J;  1Z91 A;  1N78 A;  3GXO A;  3TOB A;  2E71 A;  2Z2S B;  1VZ0 A;  1K7A A;  2QUF A;  5J8F A;  3NEU A;  2R7D A;  3K7A J;  4QTR A;  1VQN I;  4F52 A;  3W6V A;  1EV7 A;  3B6C A;  2DA1 A;  5F0H A;  3V8K A;  2YX7 A;  3GTJ J;  3LQR A;  1UHS A;  2WB1 N;  3CZ6 A;  2CMP A;  3PO3 J;  1R5G A;  5DUK A;  1GV2 A;  2E1N A;  3CME I;  5FKM A;  1U2W A;  2BY1 A;  1LNW A;  2FOK A;  2PFB A;  2F4I A;  3CMA I;  2CQ7 A;  3QAH A;  1XD7 A;  2EIM H;  3EYI A;  4PGH A;  1F43 A;  4CCJ A;  2RNJ A;  2JA5 J;  2J5P A;  3LA3 A;  1R6R A;  2L9S A;  3GTK J;  2R7T A;  4GO1 A;  1BM9 A;  1MJ9 A;  3KYD B;  2DOE A;  4EJV A;  1AKH B;  3A2K A;  2YS9 A;  4OIO F;  2DA3 A;  4HNU A;  1T0F C;  3JRA A;  3VWB A;  3DEE A;  2WAF A;  3HGY A;  4G6D A;  4N4N B;  5ILS A;  1D5V A;  2KIS A;  1YJW I;  3E0J B;  5LGT A;  5B1B H;  1G2H A;  3JSP A;  3N97 A;  1SAX A;  2QSF X;  3RPU A;  5B66 C;  2UXN A;  5DDG A;  3OYN A;  4HYE A;  1O7F A;  2BZT A;  2YR2 A;  3W6K B;  5D5X B;  4G94 A;  1DGW Y;  3PNV A;  3CUQ B;  1Y8R B;  2JVH A;  3LSP A;  4KMF A;  3ZQF A;  1QHG A;  1ZH5 A;  1NTC A;  3H35 A;  1MMN A;  2QKM B;  1LKX A;  1XB4 A;  3FXJ A;  4IRI A;  1ITY A;  2JWT A;  3HHG A;  1X1D A;  4C3H J;  4XK4 A;  3CF5 F;  4UXN A;  3ASN H;  2H8W A;  2WBM A;  5ICF A;  2BW3 A;  1XMX A;  2Z9O A;  1G3S A;  3S1M J;  1LVK A;  4XLA A;  3JAM K;  3I54 A;  2KP6 A;  2CYY A;  3HUG B;  1G3T A;  1MMD A;  3FHN A;  5JFR A;  4BKX A;  4R8H A;  2QEN A;  1RRJ A;  3HOS A;  2DFI A;  3CCM I;  2NOJ B;  5HS9 A;  4A12 A;  1Z21 A;  2FOW A;  1EH7 A;  3MEX A;  1RIO H;  2GA1 A;  3LSR A;  1A31 A;  2VPR A;  5IT9 Z;  4EJO A;  1BI2 A;  4UY8 I;  2H6C A;  3H36 A;  3S2W A;  2W7N A;  3HB9 A;  2HS5 A;  3WTT C;  3ZMV A;  2GZW A;  3O8G A;  2KKO A;  2PJR B;  3RTR A;  3OR2 C;  2RVC A;  2DK8 A;  2LY9 A;  5CPR B;  2LVS A;  4WXH A;  5LGU A;  4A3B J;  1I3A A;  1EJ9 A;  4IRH A;  2LNB A;  2STT A;  3F8F A;  1ETW A;  3BRO A;  3D0S A;  3EUA A;  3GCM A;  1DUX C;  2BEO A;  2E19 A;  2QEX I;  1NHA A;  5HDG A;  3U21 A;  3LNQ A;  3PSI A;  2BVM A;  2WAD A;  1WH5 A;  3F22 A;  4IVN A;  4L9V A;  4IX7 A;  4I99 C;  3IRR A;  3CUO A;  4G9Y A;  1MH4 A;  2MG4 A;  3FXU A;  1GT0 C;  1ZRE A;  1FIA A;  1I6X A;  3P7N A;  3DBH B;  5FD5 A;  3CDI A;  1Z6T A;  2Y0S N;  1YG2 A;  4II3 A;  2A07 F;  2DBB A;  2XRO A;  5D6F A;  2ZJ2 A;  2NVQ J;  2YU3 A;  4A3I J;  1R1T A;  3ZQ7 A;  1SD6 A;  3KP7 A;  4AVP A;  4MFE A;  4NC7 A;  3BCB A;  3M8E A;  3WGG A;  2O7O A;  3G3Z A;  3ZMT A;  2ZME C;  1K83 J;  3UKG A;  2W48 A;  1R22 A;  4LG3 A;  2P5K A;  1I27 A;  2Z16 A;  2TDX A;  3SZG A;  5LLQ A;  4RAY A;  4A6D A;  2AXL A;  3BR1 A;  3C2G A;  1R1V A;  4G12 A;  4XID A;  4A5N A;  5C4X J;  1X1A A;  3BQY A;  4ENN A;  3F6O A;  3JRH A;  2XRL A;  1IXR C;  5D8L B;  3RPQ A;  1XMA A;  1H0M A;  1SAU A;  3JRI A;  4LOC A;  3HM5 A;  3MD2 A;  3FX3 A;  3I4M J;  3DTK A;  4BUP A;  2PMU A;  1RR8 C;  2CQX A;  2QQA A;  3P9C A;  4LD5 A;  2HVS A;  3NQO A;  5HS8 A;  2WWY A;  2MSY A;  3E6B A;  3GLX A;  3C3W A;  2FBH A;  2FE3 A;  1RET A;  3LSK A;  4M9Z A;  1ZGA A;  5BMZ A;  1S29 A;  2M45 A;  4U7D A;  1RKW A;  2GXG A;  3KP4 A;  4I0A A;  1TLH B;  2KHM A;  1R1U A;  2VKH A;  2VPL A;  2DMQ A;  1HLV A;  2G7H A;  5D5W B;  4GDF A;  3GYH X;  3LOC A;  5GAE J;  4A2U A;  1YTY A;  3ZQI A;  4M6X A;  2RV8 A;  3O8H A;  4IO9 F;  4HF1 A;  3QPH A;  4ESF A;  4LLG F;  3F23 A;  1UFM A;  2BY0 A;  1NG7 A;  3CCV I;  3PFY A;  1CQT A;  5AON A;  2E5Z A;  4GYG A;  3MZH A;  4NBQ A;  4BL0 B;  2WV1 A;  2KIF A;  5DTD A;  4J19 A;  1BR4 A;  2R7Z J;  1E3P A;  4UB6 C;  3IL2 A;  2R7W A;  3DWL E;  1RKT A;  2DTR A;  3K9T A;  3LFK A;  1XSX A;  1T39 A;  1HC8 A;  1MW7 A;  5J6X A;  2NNN A;  4A5M A;  2E34 A;  1SMT A;  3J7A Y;  5K7Z A;  1J9I A;  2FNP A;  4IL6 C;  4MTE A;  5HVQ C;  5E8I A;  4AM3 A;  4PJM A;  2CWE A;  3DQV C;  4UHT A;  2VT3 A;  3V4G A;  2CS3 A;  3LFU A;  2FQ3 A;  2LRD A;  2Y48 A;  1S6L A;  2Y31 A;  5LEJ A;  3SHF A;  3H0D A;  4YRV A;  1RES A;  1Z1D A;  1Y39 A;  4HG2 A;  5LBQ A;  2MH2 A;  4UNO A;  1Z3X A;  3ECO A;  2F5F A;  3OWT A;  2ID3 A;  1D1C A;  1SMY F;  2Y69 H;  4AD9 A;  2EFP A;  2ADU A;  3BOQ A;  4OIQ F;  3CC4 I;  4IZZ A;  2HVQ A;  1UCR A;  3RKY A;  3TL4 X;  3TP0 A;  1ZK8 A;  3U2R A;  4XKW A;  4E4H A;  3HYI A;  4P9U A;  4OMY A;  1T98 A;  3PFI A;  1OCO H;  2OUM A;  2F4O B;  5BQT A;  2K3P A;  5IP6 A;  2L2O A;  1HKQ A;  2LKP A;  4Q5S F;  3BZ6 A;  5TIS C;  3LAP A;  3N4M A;  5ICC A;  4S04 A;  4A3L J;  4ZH4 F;  2JT1 A;  4RB3 C;  2BBY A;  3CJT B;  4BEH A;  2R4G A;  4LG0 B;  1PP8 F;  2CUZ A;  1UG0 A;  4DNC A;  2VKD A;  3FHZ A;  4PJN A;  2JUC A;  4QIW N;  3HOW J;  4MEX F;  1VQL I;  3OS1 A;  4CH7 A;  4UUV A;  2KLO A;  3S3M A;  2DI3 A;  1Y1V J;  3HEF A;  4XN0 A;  3HOY J;  3TOA A;  1X58 A;  3BG3 A;  4M6Y A;  3ONQ A;  1D1A A;  5E17 F;  1WJF A;  1FC3 A;  2NRA C;  3EPZ A;  4G7H F;  2OD5 A;  1JHF A;  4PSW A;  4EM1 A;  2V79 A;  2XB0 X;  3G2B A;  3HOX J;  2K27 A;  1REP C;  2R7V A;  5DS9 A;  2P5V A;  4B3A A;  2R93 J;  1YX3 A;  1IG7 A;  2Y0M A;  1MIJ A;  3OYB A;  1X4O A;  4GYI A;  1YRN A;  1D0Y A;  2IRF G;  3A1Y A;  2DTZ A;  2BHZ A;  3P9I A;  4I09 A;  4KA4 A;  2WC2 A;  4RS8 A;  3SFZ A;  2EZH A;  4FX0 A;  3LAJ A;  5EEG A;  2V1N A;  3F8B A;  4YG2 F;  2EV5 A;  2ZBK A;  2ESN A;  1I6H J;  5DUI A;  2M7B A;  4M3G A;  3GTG J;  1A6I A;  3HKZ N;  3LSH A;  3QOD A;  2DT6 A;  4ZYA A;  1FP1 D;  4QSH A;  5D5U B;  2E2I J;  1W7P B;  4ZZL A;  1FEX A;  4ESJ A;  4PCQ A;  5L3C A;  3GEZ A;  1T0F A;  1KU3 A;  4X1E A;  3DEU A;  2WY8 Q;  3CCL I;  3JSO A;  2M4K A;  1U78 A;  1SEU A;  2X0L A;  1W36 C;  1X3U A;  2JPB A;  4XL9 A;  4EGZ A;  1D0Z A;  4A3D J;  3DFG A;  4P55 A;  1T38 A;  2M1B A;  3H92 A;  5HOO A;  1XGN A;  1NK2 P;  1BIA A;  2CG4 A;  4M3E A;  1Y8Q B;  3DKW A;  1F9N A;  5IY5 H;  2LSO A;  2R5Z A;  2K4J A;  5J1U A;  2CU7 A;  5EG0 B;  4A3K J;  1IDY A;  1IXS B;  5D4S A;  1N25 A;  4KT6 A;  2QSH X;  2MD0 A;  3E6C C;  1V5F A;  3FM3 A;  4IHW A;  4TV7 A;  4UVC A;  3NAU A;  3DLA A;  4IHT A;  4BXX J;  5D6E A;  2BVL A;  1QPM A;  2A3S A;  5ICE A;  3HRT A;  1STZ A;  1ETK A;  1EKE A;  4U7B A;  3GFI A;  1QVT A;  2K7L A;  2EFO A;  2PN6 A;  4C3I J;  1W0T A;  3BTL A;  1KZH A;  3OL4 A;  2OZ6 A;  5JLW A;  2Z33 A;  2X1D A;  3BR3 A;  1VQ7 I;  4ESB A;  5ERI A;  4PDK A;  5LRR A;  2KRC A;  4DIQ A;  4HQM A;  4Z2Y A;  1XG1 A;  5GAH J;  1UHM A;  4DYQ A;  4E7L A;  1QO0 D;  1G4D A;  5IPA A;  4E7S A;  2IGN A;  2DFH A;  5CVR A;  1S7O A;  1G59 A;  2VQH A;  3O2P E;  3RKQ A;  1D3Y A;  4XSX F;  2CQQ A;  4S0H B;  2K40 A;  2K9Q A;  2CUF A;  1OCC H;  4GGG A;  3K0L A;  4NUB A;  1YRN B;  5CJ9 A;  3L2V A;  2VL8 A;  4HX8 A;  5EZG A;  1FWZ A;  3T5X A;  2ZO4 A;  4ZZD A;  2HDD A;  2KRF A;  5KNL A;  2BYV E;  2HOS A;  1YYV A;  4KIB A;  4BBR J;  2O61 A;  1LB2 A;  1ETX A;  4JYK A;  4YFN F;  1Q1H A;  2M7A A;  2K4B A;  1KYW A;  3PNY A;  2EIN H;  5FRM A;  4ZYD A;  3E1S A;  3M9A A;  1ZG3 A;  3OOU A;  1B72 A;  3BCA A;  2FML A;  3C1D A;  2UWM A;  4D1Q A;  5ILV A;  1F1Z A;  1GVD A;  1IN5 A;  2OTL I;  2HQN A;  5IP9 J;  4L5I A;  2HQR A;  3AG2 H;  1IRZ A;  4QPO A;  2RKH A;  3CJN A;  3X2Q H;  4A0Y A;  1YS6 A;  4A3J J;  2IA2 A;  2IBD A;  5DCM A;  2ZME A;  1RPW A;  4PJ0 C;  3ZCO A;  3J7Z I;  3FF5 A;  3DCF A;  1MNE A;  3WTW C;  3HTU A;  3IH4 A;  3Q9V A;  2CJJ A;  2FD5 A;  4FHT A;  5E3O A;  1QPI A;  3BWG A;  2FX0 A;  4MGR A;  2R5Z B;  2WAE A;  1MDM A;  3IH2 A;  1MNM C;  2HDC A;  2DMP A;  1YW7 A;  3GUD A;  1RR7 A;  5BNG A;  3EET A;  2HKX A;  2HPI A;  1S7A A;  2LY2 A;  1BI3 A;  2DW4 A;  2DPU A;  4A0Z A;  3VPR A;  3ISP A;  3LWF A;  2OZU A;  1XPX A;  1HA8 A;  1D5Y A;  5E1W A;  4E70 A;  1S72 I;  3I59 A;  1MJA A;  2A69 F;  2NS8 A;  2L01 A;  1DP3 A;  2M30 A;  3OYG A;  4KJZ A;  2LR8 A;  3KP6 A;  3WU0 A;  1HW5 A;  3H1C A;  4JQF A;  4B8X A;  3TBI A;  4HZF A;  1TT0 A;  5FLV A;  2HR3 A;  2NAZ A;  4ZDL A;  4KIT B;  4NNJ A;  5J1R A;  1U0J A;  3FWE A;  3WTU C;  2P8T A;  1JGG A;  3IAS 2;  2PLY A;  3FBN B;  1V54 H;  1BJZ A;  4HA8 A;  1O3T A;  1E3H A;  3K10 A;  3MZY A;  4V2G A;  2STW A;  1Z77 A;  1OYI A;  3K1M A;  3FDY A;  2YX4 A;  3BTI A;  3ZMS A;  4WF2 A;  3D1N I;  3PNT A;  3VYR B;  2ZSI B;  3AG4 H;  2M87 A;  3C18 A;  1HW2 A;  3ZP5 A;  5HNH A;  1P2F A;  1MH3 A;  3WTZ A;  3QYE A;  5C44 J;  2L7K A;  2ID6 A;  2MAB A;  3CC7 I;  2XAQ A;  2FUG 2;  2JJ7 A;  5B5E C;  3WTY C;  2R7F A;  3BT9 A;  5FKO A;  1DDN A;  3CCY A;  2EWN A;  1A04 A;  2PI0 A;  3H9Q A;  4W97 A;  3CCS I;  1O4X A;  4HW0 A;  2ZSH B;  1T8I A;  2XUB A;  4CA0 A;  3DPU A;  1NH3 A;  1T2K A;  3F9K A;  1FT9 A;  3KZY A;  4LIV A;  2Q2E A;  3PJR A;  5LHG A;  1MBJ A;  5GPA A;  4ZYE A;  4KDP A;  4RM2 A;  3IP4 B;  1E2X A;  2JVG A;  3F8M A;  4KT5 C;  2M4G A;  2P0W A;  1BW6 A;  2OF7 A;  2ZFU A;  1BW5 A;  3CQZ J;  4BDZ A;  1B6A A;  2ZME B;  2FEZ A;  1MBE A;  2K02 A;  2L7Z A;  1R5H A;  3KLO A;  2L3D A;  3S17 J;  3KYC B;  2JPC A;  1OPC A;  2A68 F;  1FBS A;  4ITV A;  1VTN C;  1MDM B;  1B8I A;  3JCU C;  4E7I A;  2O8X A;  3W2A A;  4CCN A;  3MCZ A;  3NWS A;  4AYB A;  4ZTJ A;  3H5N A;  4LJZ F;  5CQG A;  3WGH A;  4BHC A;  1APL C;  2QSG X;  3NAR A;  2KDO A;  3RI4 A;  5J1Y A;  2JSP A;  4KIF A;  1YX5 A;  2CUE A;  3I59 B;  4HV5 A;  3S8P A;  4A69 C;  5BS6 A;  2EZL A;  4X6A J;  4LLN A;  1A35 A;  2L02 A;  1J2X A;  3QYF A;  4C9Y A;  2DU9 A;  1SFU A;  1FMW A;  5FLX K;  3K4L A;  3J81 K;  2Y9Y A;  2PQ8 A;  4GXO A;  1Z3Y A;  4IKF A;  2XHK A;  1ONV A;  2CV1 A;  3J80 Z;  4RAZ A;  1OCP A;  5FKN A;  4A3C J;  1XSD A;  2QWW A;  4KYW A;  2BY3 A;  2FQ4 A;  2ZXH A;  1Z67 A;  3CJR B;  4IHY A;  1J59 A;  1MBG A;  3Q0V A;  2JQ7 A;  2XDV A;  1YS7 A;  2M3A A;  2DT5 A;  5CYV A;  2R5Y A;  3TO9 A;  5DM6 F;  3TW7 A;  2X6X A;  3GTL J;  3D5L A;  1I1G A;  2LRE A;  3PUB A;  3CMM A;  4AIK A;  2OBP A;  2CO5 A;  1KON A;  1QBJ A;  4XN3 A;  2JMW A;  2LFB A;  4FIS A;  2B7E A;  1VQ6 I;  1V5E A;  2QLZ A;  1ZRC A;  2EPF A;  4YIF A;  3Q3S A;  2HFH A;  2V6C A;  2ZJP F;  2OCE A;  3I71 A;  2ZNY A;  3WTV C;  4P9F A;  3CO6 C;  3HHH A;  4E7H A;  1F4K A;  3BZC A;  3COA C;  2RDP A;  1UST A;  1SVM A;  2KFD A;  2M8G X;  3FZV A;  4ZJZ A;  2VQL A;  1R7J A;  4BE2 A;  1Z05 A;  2GXB A;  2QBY A;  5J3L A;  3OIQ A;  3AKZ A;  2Y9Z A;  2WB1 A;  3DBR B;  1MBK A;  1TBX A;  5IP7 J;  5AIQ A;  2FMY A;  1X4P A;  1R4N B;  2DFE A;  2KPM A;  4CGZ A;  2R7Q A;  2VBZ A;  3OYL A;  2IA1 A;  4JP0 A;  3CJQ B;  3EQL F;  2LF8 A;  3H5R A;  3K1N A;  1ZRF A;  5EEH A;  1VQP I;  4NDL A;  3T8R A;  2VLA A;  4LK0 F;  4G7Z F;  1JTX A;  1E3O C;  1YW9 A;  3VOD A;  3IKT A;  3K4N A;  1X1C A;  3QU3 A;  3ZRG A;  2EFQ A;  3BR5 A;  5CLS A;  3SYT A;  5M3F J;  2LY1 A;  2EK5 A;  2DA2 A;  3JRD A;  4MLO A;  1OR7 C;  4KIC A;  3CCR I;  4KN7 X;  3T8T A;  1R5I D;  4XSZ F;  4C2U A;  1IZ1 A;  2X51 A;  3OIP A;  2IVM A;  4XRF A;  1WJA A;  1EA3 A;  2UUZ A;  4F3Q A;  1QNT A;  3QP6 A;  2ISZ A;  1XGM A;  4D9J A;  3KCC A;  1W5T A;  3DPL C;  4IHS A;  4F7Z A;  1HDD C;  2P6T A;  2DOA A;  3SQN A;  2KIM A;  2V1D A;  1HXD A;  2P7V B;  4RB0 A;  3ZXS A;  2E7W A;  1WPK A;  3BZK A;  3CO7 C;  1SVL A;  2GM4 A;  2EZI A;  3W6J B;  3JRF A;  3TDZ C;  1ULY A;  3K2Z A;  5J4Y A;  5FRN A;  1IN7 A;  3ESW B;  3HIF A;  5L3B A;  4F93 B;  2FF4 A;  2XV4 S;  2A6T A;  4CCM A;  3BG6 A;  3GWZ A;  4Y13 A;  3I3L A;  4S05 A;  2QVO A;  2FA5 A;  3KYL A;  5HDN A;  4N9H A;  3SXY A;  1QQI A;  1Q1V A;  4O6J A;  3DKX A;  3IAM 2;  2IJL A;  4ABZ A;  1JHH A;  1ZAO A;  2DO7 A;  2NS0 A;  3GX4 X;  2FU4 A;  2L0K A;  2PJP A;  2IA0 A;  3F0C A;  2E35 A;  3E97 A;  2QGU A;  2JTV A;  3HXL A;  3AAF A;  1MBH A;  1TW2 A;  3RQ4 A;  2X6W A;  2WA0 A;  5E1Z B;  1V55 H;  1WSU A;  2CW0 F;  2KT0 A;  2R0Q C;  1S7E A;  2OA4 A;  4BE1 A;  2NXN B;  4A6E A;  5K7H A;  4EVI A;  5JVG F;  1YIT I;  4I2O A;  2VJI A;  1AHD P;  3M4O J;  1MKM A;  3OY9 A;  3BR6 A;  4U87 A;  3HOV J;  3KE2 A;  2BW3 B;  5FRO A;  4XLF A;  2QBY B;  3OYF A;  3T1B A;  2XSJ C;  2QF7 A;  1U3E M;  4IHV A;  2IS4 A;  3QWL A;  3DV8 A;  2V4J C;  2EZK A;  2HOT A;  2DN0 A;  1IUF A;  3LMM A;  1FSH A;  1LDJ A;  2HOA A;  5GAD J;  4XBF A;  4UUS A;  2ZB9 A;  3R0J A;  4MHG A;  1XS9 A;  2CQN A;  1I1S A;  2EA2 A;  2HGC A;  3E5X A;  4I98 B;  3MKW B;  2R7X A;  1FBQ A;  2H27 A;  3BP8 A;  1IRF A;  3FKJ A;  3IC7 A;  2R7R A;  2Y0S A;  3DBL B;  3FMR A;  3RIR A;  2W82 A;  5JHF A;  3JRG A;  1BL0 A;  1XMK A;  2Z3Y A;  3WU1 B;  2HOE A;  1SFO J;  5F64 A;  2V1U A;  4RMN A;  1D1B A;  2DFF A;  4PGG A;  1HOM A;  3KIO A;  3BJO A;  3J7Y J;  2W00 A;  3KPH A;  2JUG A;  3S1N J;  3BLY A;  2ELH A;  4CIC A;  4OIN F;  3RJP A;  1JT0 A;  3E5Q A;  3ZQL A;  4DBR A;  4RLF A;  5CVJ A;  3M07 A;  1K4T A;  3ZMZ A;  2F48 A;  1SAN A;  2P4W A;  5ICG A;  5E18 F;  5C3E J;  1JKP C;  1Z7U A;  3EUH C;  2ME0 A;  2WY7 Q;  1HKS A;  1JKR C;  1FPQ A;  1OCT C;  1ERD A;  2TCT A;  3BR0 A;  3B02 A;  5M5W J;  2P7C B;  2GIZ A;  2VBW A;  4Y33 A;  3KX2 A;  2HTJ A;  3FXR A;  1ETY A;  3FXQ A;  4NB5 A;  1I39 A;  4FTH A;  1JUP A;  2ICW G;  2MA3 A;  3TW6 A;  5A2Q K;  2QQ8 A;  4BH9 A;  2O5R A;  4NHJ A;  4KUM A;  4QLC U;  4YFX F;  1MD0 A;  5M5Y J;  2VJ5 A;  3PSF A;  3L2C A;  1H9G A;  2KIQ A;  1GV5 A;  2CQK A;  2IGM A;  3HRS A;  3IWF A;  4BJ6 C;  3D5S C;  2IXS A;  3MMY B;  4KIG A;  3A02 A;  5FD6 A;  3H3U A;  1LDK B;  3K2A A;  4V2F A;  3S2H J;  1IN6 A;  3K4M A;  3T0Y A;  1H88 C;  5M5X J;  2VJJ A;  5K7F A;  1FMV A;  3OSG A;  4IEJ A;  1IXC A;  4GCV A;  2GWR A;  1N75 A;  4BXU A;  2YUS A;  4ANJ A;  1OCR H;  2B0L A;  2Q0O A;  2XAJ A;  3CTA A;  2BV6 A;  2O0Y A;  3MVP A;  2K86 A;  3CCE I;  4EEF G;  3OYM A;  1BN5 A;  1ETV A;  1XSV A;  2L9R A;  1BC8 C;  2JA8 J;  3CD6 I;  3KLN A;  3GTP J;  4Y3O A;  4HDU A;  1OYW A;  2E5N A;  1IO2 A;  4L5J A;  3HBL A;  3ML6 A;  3Q5F A;  2F5V A;  2I10 A;  5F08 A;  3SEQ A;  3QPL A;  5EJC A;  3VFZ A;  5IT3 A;  4CYC A;  1J75 A;  1YJN I;  4P5O A;  5EGO A;  3CDL A;  2DJN A;  1U9O A;  2M34 A;  3GTM J;  4QPQ A;  1WZ2 A;  4AWX B;  3ABM H;  2HXO A;  3CC2 I;  2XF7 A;  1MMG A;  1U6G A;  3IHU A;  1FZP B;  1X1P A;  1Z7L A;  3C7J A;  3EYY A;  1O3R A;  2HZD A;  1XCB A;  3BQZ A;  5F6F A;  1O3S A;  1TQI A;  3VSL A;  4Q47 A;  1YJ9 I;  3RKW A;  1FBU A;  2B63 J;  1IN4 A;  4M9S A;  1UHW A;  3KEO A;  3PUF A;  4ASN A;  1XDS A;  2BOL A;  2DOF A;  2X48 A;  2W57 A;  1JKQ C;  2LOO A;  2BY2 A;  1FOX A;  1XC5 A;  4XRS G;  4AIH A;  1GVJ A;  2E36 A;  2XAG A;  4OAZ A;  2E1C A;  1P92 A;  4Y52 J;  1TQP A;  1VI0 A;  1U5T C;  5B3S H;  5D5V B;  1ZYR F;  1S5L C;  1TNS A;  1WJE A;  2DT7 B;  1K6Y A;  2JN6 A;  3GFL A;  4HV6 A;  3LSJ A;  2M2E A;  2V9V A;  2XPU A;  1T33 A;  9ANT A;  4D5F A;  4CXF A;  2XGD A;  1DPU A;  2NNY A;  1ON2 A;  3RDI A;  4PFO A;  4IHX A; 
#chains in the Genus database with same CATH homology
 1S8N A;  2PEX A;  3WE3 A;  2F2E A;  4N0B A;  1MZB A;  3KP2 A;  2FRH A;  4U0V A;  3BJ6 A;  5IT9 K;  2VN2 A;  3ELK A;  3MQ0 A;  1IAW A;  1AOY A;  3J7A O;  2HEO A;  1MJB A;  2EFN A;  2ZCW A;  1B9N A;  1HBX G;  1WI9 A;  3H3Z A;  2GA2 A;  1W5S A;  3IWZ A;  1PUE E;  3IRQ A;  2Z99 A;  4WCG A;  1WWX A;  2OQR A;  3B73 A;  1LJ9 A;  1RZ4 A;  1WKM A;  4U88 A;  2VXZ A;  2VC0 A;  3VOE A;  5HS7 A;  1E17 A;  2Q8K A;  3BPV A;  3V7C A;  2XAH A;  3DP7 A;  2EB7 A;  3NRV A;  4Q4Z F;  2W85 A;  4MTD A;  2YPR A;  1OR7 A;  3JAM Z;  1CF7 A;  3ABU A;  5D8K B;  1KQ9 A;  5DV5 A;  5LEK A;  1J5Y A;  4EMS A;  2MLK A;  1IRG A;  1BJA A;  2VBY A;  4HLY A;  2F5D A;  5TJJ A;  5E20 A;  2VE8 A;  1CGP A;  5JHU A;  4KFC A;  2D2W A;  4HX7 A;  1SFE A;  3QP5 A;  1TW3 A;  4PZJ A;  4XLN F;  2P6S A;  1FOK A;  3E6D A;  4G6Q A;  1JE8 A;  2FBI A;  4CDG A;  1FYK A;  1W7P D;  1P4A A;  1IF1 A;  2F5C A;  4HQE A;  4HDV A;  2XKO A;  2V1X A;  1UB9 A;  2QM3 A;  2L4M A;  1LVA A;  5J8C A;  2COM A;  3ECH A;  4U0Y A;  4LMY A;  1GXP A;  5KK1 A;  4MEY F;  3F8C A;  2GIV A;  2OU2 A;  4OMZ A;  5CVV A;  4UV8 A;  3V7S A;  2WTE A;  3CLO A;  3R6S A;  2OQG A;  1IUY A;  1FNN A;  2VBX A;  1L0O C;  1FYL A;  1Z6R A;  5K5Q A;  3L9F A;  4MQ9 F;  4ON0 A;  1ZG5 A;  1R58 A;  2OAZ A;  5FGM A;  1SD7 A;  3JTG A;  3JW4 A;  2NYX A;  5DEQ A;  3IKV A;  1ZAR A;  3Q9S A;  3SZT A;  3R0A A;  2IPQ X;  3PQJ A;  2HWV A;  4BHB A;  1XN7 A;  2PBI A;  3I53 A;  3ULQ B;  3EUH A;  1OMI A;  3WTX C;  4LGW A;  2VT2 A;  1D8K A;  4R1H A;  2G7U A;  3V8J A;  2ZFW A;  4L9N A;  4CHU A;  4EJU A;  1ZG1 A;  2DPD A;  3KFW X;  2AS5 F;  2RQP A;  3SZP A;  4KMU X;  2QQB A;  4KN4 X;  1ZLK A;  5DCM B;  3EDP A;  3KZZ A;  2VOO A;  4HAM A;  1O7L A;  2KJB A;  3FMQ A;  4DQ2 A;  2XIG A;  3LA2 A;  3V7R A;  3KET A;  3RYP A;  1ZRD A;  1BOA A;  3O6B B;  2A6H F;  5FFX A;  4HLX A;  3U9G A;  3HUG A;  4Q48 A;  3WG9 A;  1WQ2 A;  2MBF A;  2GAU A;  1B1B A;  5H6Q A;  4RGS A;  5KVR A;  2MC3 A;  2W25 A;  2Y75 A;  2D45 A;  1GXQ A;  3TO7 A;  1DPR A;  2EV6 A;  5H6R A;  3LST A;  4UVA A;  3OOP A;  4RGR A;  3DF8 A;  3HSR A;  4RGU A;  4HOB A;  3WOD F;  3M7G A;  1FX7 A;  4BYY A;  2HYG D;  4M74 A;  3MAJ A;  2O3F A;  4ETS A;  4WX9 A;  1ODD A;  1KQ8 A;  1U5T A;  5H20 A;  1ZGJ A;  1YFH A;  1YW8 A;  3GF2 A;  1LEA A;  4BQA A;  3LA7 A;  1DP7 P;  3CDH A;  1XDU A;  5LHI A;  4U0W A;  2FXA A;  1KU2 A;  1P4X A;  5L3G A;  2ETH A;  4NQW A;  1G3Y A;  1P4W A;  1JXS A;  2MLG A;  2DLL A;  5BPI A;  3R61 A;  5FFZ A;  3E5U A;  1RI7 A;  1ON1 A;  2DQL A;  3TKY A;  1YQA A;  1GHC A;  1P6R A;  1T6S A;  1KYZ A;  1SFX A;  3MWM A;  1IN8 A;  2UXX A;  3I5U A;  1V3F A;  3TDU C;  2A61 A;  5E1X A;  3HOT A;  4EM0 B;  3TGN A;  3WE2 A;  3L00 A;  3GW2 A;  3K69 A;  3M1E A;  1BIB A;  1KA8 A;  4ENK A;  2P5L C;  4EQQ A;  4CYD A;  3L7W A;  2XAS A;  1QZY A;  3P9K A;  4P96 A;  1O57 A;  4MQV A;  2CGP A;  1I5Z A;  2JSC A;  1AWC A;  1U5T B;  5CVU A;  4IPA A;  2XRN A;  2BE5 F;  1RNL A;  1EH8 A;  3FMS A;  3GZ5 A;  4MNU A;  4ZYH A;  1PP7 U;  2DAO A;  1XGO A;  2XGX A;  1KU9 A;  5K1Y A;  3KP3 A;  4M71 A;  4EM2 A;  2G9W A;  3GO5 A;  4WXD A;  2XVC A;  3ZMD A;  5HLH A;  1FP2 A;  2ISY A;  1W4M A;  2YSR A;  1J7K A;  1QGP A;  4FX4 A;  3ZPL A;  4L18 B;  3KEQ A;  3F72 A;  1HST A;  1EH6 A;  1OYY A;  1K6O A;  2W24 A;  3TO6 A;  2QQ9 A;  1HW1 A;  4OIR F;  1KU7 A;  1KGS A;  2L54 A;  3I0T A;  4LB5 A;  4EGY A;  4LG0 A;  4I01 A;  4BNC A;  1HSJ A;  1B9M A;  3V8L A;  4EV0 A;  3E3V A;  2ZXJ A;  2KIU A;  5LHH A;  3ZN1 A;  1ZHF A;  1MGT A;  3CUQ C;  1FSE A;  4HF2 A;  2VON A;  2JZY A;  2Z5U A;  3QU6 A;  1W7P A;  2BGC A;  2D1V A;  1FY7 A;  2F5E A;  2A5Y B;  3BY6 A;  2HYF A;  3DXJ F;  6PAX A;  2EFW A;  5L3F A;  2HZT A;  4D0P A;  4KNY A;  1F5T A;  1R36 A;  4HX4 A;  1U8R A;  2W84 A;  4HF0 A;  3J80 K;  1JGS A;  3ZMU A;  3G73 A;  1Z9C A;  4B09 A;  4I0B A;  3K1P A;  4RGX A;  3F8N A;  2RGV A;  2ESH A;  5JI6 A;  5TRD A;  4YFK F;  2JRT A;  2L4A A;  4G8X A;  4I02 A;  3BPX A;  4WK8 F;  4M9X A;  4H0E A;  2ACJ A;  4M73 A;  4BHP A;  1ZN2 A;  4K2E A;  4ENM A;  1Y0U A;  1QZZ A;  4CO8 A;  1XGS A;  4IXA A;  3KP5 A;  4CZZ A;  3ROU A;  2VOD A;  4OU0 A;  2RN7 A;  4L9J A;  4RB2 C;  1HKT A;  1K79 A;  1C0W A;  1B4A A;  3GFJ A;  4BAY A;  1L3L A;  5E8G A;  3DPT A;  2C6Y A;  1IW7 F;  2EA4 A;  2MH9 A;  5DYM A;  1LDD A;  5FLX Z;  2QYO A;  3J81 Z;  1ZLJ A;  3RKX A;  5BPD A;  3O3K A;  4LK1 F;  4WWC A;  3OV8 A;  2DQR A;  3I58 A;  2CFX A;  2O03 A;  4A0X A;  2LF7 A;  4R79 A;  3RYR A;  4OOI A;  3ABT A;  2IW5 A;  3E6M A;  3PQK A;  1H9T A;  5LGN A;  2R3S A;  2VOP A;  4G7O F;  3R4K A;  1G3W A;  3REO A;  2A6E F;  5K5O A;  2E7X A;  5ED4 A;  2KJC A;  4QWQ A;  1FLI A;  5K5R A;  3JTH A;  4AIJ A;  1SD5 A;  5DCF A;  3VEP A;  2IP2 A;  3F21 A;  2XAF A;  1LQ1 A;  2HKO A;  1FYM A;  4IF4 A;  2IT0 A;  1KQ0 A;  2M8E A;  1K78 A;  1BI0 A;  1TQM A;  3VB2 A;  1TTY A;  2D1H A;  3F6V A;  4O5V A;  1YLF A;  1BI1 A;  3ERE D;  4L9T A;  4EJT A;  5JVT A;  2FSW A;  2WV0 A;  1J0R A;  2HTS A;  3HRU A;  3L09 A;  1BC7 C;  1LEB A;  2VC1 A;  3MFK A;  4HBL A;  3U1D A;  3ZN0 A;  2VE9 A;  1USS A;  1PDN C;  2LDU A;  3GZ6 A;  5DD4 A;  4UV9 A;  2PG4 A;  3TQN A;  2MD5 A;  1RUN A;  2O6G E;  1RUO A;  4UVB A;  4JK1 X;  4Y17 A;  2EV0 A;  1BBY A;  3HSE A;  4LFU A;  4N9I A;  2EJR A;  1CF7 B;  2PMH A;  1HQC A;  1B59 A;  5BOX A;  4YII A;  3BDD A;  4I7H A;  3M8F A;  1O3Q A;  2H94 A;  4IJA A;  2M5W A;  1D8J A;  4XLP F;  3LQQ A;  4L0Z B;  3QPT A;  3BJA A;  2FNA A;  4FT8 A;  3I64 A;  5HLI A;  5L3D A;  2ZKZ A;  3QOP A;  2J5O A;  2FBK A;  3GFM A;  1XCV A;  2ZNZ A;  2H6B A;  4OIP F;  5ILU A;  1K78 B;  3GVA A;  1YO5 C;  5CVI A;  3I4P A;  2QZ8 A;  2UZK A;  4L0Y B;  1R23 A;  5FB2 A;  1V4R A;  4M72 A;  3FM5 A;  5L3E A;  3WTS C;  1WRJ A;  3CUQ A;  3R60 A;  2CSO A;  5HDK A;  5DD8 A;  4LB6 B;  2GQQ A;  5A2Q Z;  2X4H A;  4O3M A;  1OKR A;  5D4R A;  5F1R A;  1S3J A;  4EJW A;  5HLG A;  4IRG A;  4JBA A;  2XKP A;  4WXC A;  5FO5 A;  5JR3 A;  4ENJ A;  5LRS A;  1TNT A;  2RC4 A;  1SD4 A;  4ZYG A;  4Y15 A;  3WGI A;  3QRF F;  4LLL A;  2H09 A;  1YIO A;  4RB1 A;  3HRM A;  1R00 A;  3HSF A;  3HTS B;  5AIP A;  1G6N A;  2DK5 A;  3F3X A;  1Z91 A;  3GXO A;  3TOB A;  1K7A A;  2QUF A;  5J8F A;  3NEU A;  2R7D A;  1EV7 A;  3V8K A;  2YX7 A;  3LQR A;  1R5G A;  5DUK A;  2E1N A;  1U2W A;  1LNW A;  2FOK A;  2PFB A;  3QAH A;  1XD7 A;  3EYI A;  4PGH A;  2RNJ A;  2J5P A;  3LA3 A;  4GO1 A;  1BM9 A;  1MJ9 A;  4EJV A;  4OIO F;  4G6D A;  5ILS A;  1D5V A;  5LGT A;  3JSP A;  3N97 A;  1SAX A;  3RPU A;  2UXN A;  5DDG A;  4HYE A;  1O7F A;  2YR2 A;  3W6K B;  5D5X B;  4G94 A;  3CUQ B;  4KMF A;  1ZH5 A;  1XB4 A;  4IRI A;  3HHG A;  4UXN A;  5ICF A;  2Z9O A;  1G3S A;  3JAM K;  3I54 A;  2CYY A;  5JFR A;  1G3T A;  4R8H A;  2QEN A;  3HOS A;  2DFI A;  4A12 A;  5HS9 A;  1EH7 A;  3MEX A;  1RIO H;  2GA1 A;  5IT9 Z;  4EJO A;  1BI2 A;  2H6C A;  3S2W A;  2HS5 A;  3WTT C;  3ZMV A;  2GZW A;  2KKO A;  3RTR A;  2RVC A;  2DK8 A;  4WXH A;  5LGU A;  4IRH A;  2LNB A;  2STT A;  3F8F A;  3BRO A;  3D0S A;  1DUX C;  2BEO A;  1NHA A;  5HDG A;  3F22 A;  4IVN A;  4L9V A;  3IRR A;  3CUO A;  4G9Y A;  3FXU A;  1ZRE A;  1I6X A;  3P7N A;  5FD5 A;  1Z6T A;  1YG2 A;  2A07 F;  2DBB A;  2XRO A;  5D6F A;  2ZJ2 A;  2YU3 A;  1R1T A;  3ZQ7 A;  1SD6 A;  3KP7 A;  4AVP A;  3M8E A;  3WGG A;  3G3Z A;  3ZMT A;  1R22 A;  2P5K A;  1I27 A;  2TDX A;  5LLQ A;  4RAY A;  4A6D A;  2AXL A;  1R1V A;  4A5N A;  4ENN A;  3F6O A;  1IXR C;  5D8L B;  3RPQ A;  1XMA A;  1H0M A;  3FX3 A;  2PMU A;  2QQA A;  3P9C A;  4LD5 A;  3NQO A;  5HS8 A;  2WWY A;  3E6B A;  3GLX A;  3C3W A;  2FBH A;  2FE3 A;  4M9Z A;  1ZGA A;  5BMZ A;  1S29 A;  2M45 A;  4U7D A;  3KP4 A;  2GXG A;  4I0A A;  1TLH B;  1R1U A;  2G7H A;  5D5W B;  3GYH X;  1YTY A;  4A2U A;  4M6X A;  2RV8 A;  4HF1 A;  3QPH A;  4ESF A;  4LLG F;  3F23 A;  1UFM A;  5AON A;  4GYG A;  3MZH A;  2KIF A;  3IL2 A;  2DTR A;  3K9T A;  3LFK A;  1XSX A;  1T39 A;  5J6X A;  2NNN A;  4A5M A;  1SMT A;  1J9I A;  2FNP A;  4MTE A;  5HVQ C;  5E8I A;  2CWE A;  3DQV C;  4UHT A;  2VT3 A;  3V4G A;  2FQ3 A;  2Y48 A;  1S6L A;  5LEJ A;  3SHF A;  1Z1D A;  5LBQ A;  2MH2 A;  4UNO A;  3ECO A;  2F5F A;  1SMY F;  4AD9 A;  2EFP A;  2ADU A;  3BOQ A;  4OIQ F;  1UCR A;  3RKY A;  3U2R A;  3HYI A;  4P9U A;  4OMY A;  1T98 A;  3PFI A;  5BQT A;  1HKQ A;  2LKP A;  4Q5S F;  3BZ6 A;  3LAP A;  3N4M A;  5ICC A;  4S04 A;  4ZH4 F;  2JT1 A;  4RB3 C;  2BBY A;  4LG0 B;  1PP8 F;  4DNC A;  3FHZ A;  4MEX F;  4UUV A;  2DI3 A;  3TOA A;  4M6Y A;  5E17 F;  1FC3 A;  2NRA C;  4G7H F;  2OD5 A;  1JHF A;  4EM1 A;  2V79 A;  2K27 A;  1REP C;  2P5V A;  2Y0M A;  4GYI A;  2IRF G;  4I09 A;  3P9I A;  4KA4 A;  2WC2 A;  4RS8 A;  3SFZ A;  4FX0 A;  3LAJ A;  5EEG A;  3F8B A;  4YG2 F;  2EV5 A;  2ZBK A;  2ESN A;  5DUI A;  5D5U B;  1FP1 D;  1W7P B;  4ZZL A;  4ESJ A;  4PCQ A;  5L3C A;  3GEZ A;  1T0F A;  1KU3 A;  3DEU A;  3JSO A;  1U78 A;  2X0L A;  1X3U A;  2JPB A;  4EGZ A;  3DFG A;  4P55 A;  1T38 A;  2M1B A;  3H92 A;  5HOO A;  1XGN A;  1BIA A;  2CG4 A;  3DKW A;  1F9N A;  2LSO A;  2K4J A;  1IXS B;  5D4S A;  3E6C C;  3FM3 A;  4TV7 A;  4UVC A;  4IHT A;  5D6E A;  1QPM A;  2A3S A;  5ICE A;  3HRT A;  1STZ A;  4U7B A;  3GFI A;  2PN6 A;  2K7L A;  2EFO A;  2OZ6 A;  2Z33 A;  4ESB A;  5ERI A;  4PDK A;  5LRR A;  4HQM A;  4Z2Y A;  1UHM A;  1G4D A;  1QO0 D;  5CVR A;  1S7O A;  3O2P E;  1D3Y A;  4XSX F;  4GGG A;  3K0L A;  5CJ9 A;  4HX8 A;  1FWZ A;  3T5X A;  2ZO4 A;  4ZZD A;  2KRF A;  2BYV E;  1YYV A;  4KIB A;  2O61 A;  1LB2 A;  4YFN F;  1Q1H A;  2K4B A;  1KYW A;  4ZYD A;  3M9A A;  1ZG3 A;  2UWM A;  2FML A;  3C1D A;  5ILV A;  1F1Z A;  1IN5 A;  2HQN A;  4L5I A;  2HQR A;  2RKH A;  3CJN A;  4A0Y A;  1YS6 A;  2IA2 A;  5DCM A;  2ZME A;  3FF5 A;  3WTW C;  3HTU A;  3Q9V A;  4FHT A;  3BWG A;  1MDM A;  4MGR A;  2HDC A;  1YW7 A;  3GUD A;  3EET A;  2HKX A;  1S7A A;  1BI3 A;  2DW4 A;  2DPU A;  4A0Z A;  3ISP A;  3LWF A;  2OZU A;  5E1W A;  4E70 A;  3I59 A;  1MJA A;  2A69 F;  2L01 A;  2M30 A;  3KP6 A;  3WU0 A;  1HW5 A;  4JQF A;  4B8X A;  4HZF A;  2HR3 A;  2NAZ A;  3FWE A;  3WTU C;  2P8T A;  2PLY A;  4HA8 A;  1O3T A;  3MZY A;  2STW A;  3K1M A;  1OYI A;  2YX4 A;  3ZMS A;  4WF2 A;  2M87 A;  3C18 A;  1HW2 A;  3ZP5 A;  1P2F A;  3WTZ A;  2XAQ A;  3WTY C;  2R7F A;  1DDN A;  2EWN A;  1A04 A;  2PI0 A;  4HW0 A;  2XUB A;  1T2K A;  1FT9 A;  3KZY A;  2Q2E A;  5LHG A;  4ZYE A;  4KDP A;  1E2X A;  3F8M A;  4KT5 C;  1B6A A;  2ZME B;  2FEZ A;  2K02 A;  1R5H A;  3KLO A;  2L3D A;  2JPC A;  1OPC A;  2A68 F;  1FBS A;  1VTN C;  1MDM B;  2O8X A;  3MCZ A;  4LJZ F;  3WGH A;  4BHC A;  3RI4 A;  4KIF A;  3I59 B;  4HV5 A;  5BS6 A;  4LLN A;  2L02 A;  1J2X A;  2DU9 A;  1SFU A;  5FLX K;  3J81 K;  2PQ8 A;  4GXO A;  2XHK A;  1ONV A;  3J80 Z;  4RAZ A;  1XSD A;  2QWW A;  4KYW A;  1J59 A;  1YS7 A;  2DT5 A;  5CYV A;  3TO9 A;  3D5L A;  1I1G A;  4AIK A;  2OBP A;  2CO5 A;  1QBJ A;  1ZRC A;  2QLZ A;  4YIF A;  2HFH A;  2V6C A;  3I71 A;  2ZNY A;  3WTV C;  4P9F A;  3CO6 C;  3HHH A;  1F4K A;  3COA C;  2RDP A;  1UST A;  3FZV A;  1R7J A;  1Z05 A;  2GXB A;  2QBY A;  1TBX A;  5AIQ A;  2FMY A;  4CGZ A;  2VBZ A;  2IA1 A;  3EQL F;  2LF8 A;  1ZRF A;  3K1N A;  5EEH A;  3T8R A;  4G7Z F;  4LK0 F;  1YW9 A;  3VOD A;  3IKT A;  3QU3 A;  2EFQ A;  5CLS A;  2EK5 A;  4KIC A;  4KN7 X;  3T8T A;  4XSZ F;  1IZ1 A;  2IVM A;  4XRF A;  1QNT A;  3QP6 A;  2ISZ A;  1XGM A;  3KCC A;  1W5T A;  3DPL C;  4IHS A;  4F7Z A;  2P6T A;  3SQN A;  2KIM A;  2V1D A;  1HXD A;  2P7V B;  4RB0 A;  2E7W A;  3CO7 C;  3W6J B;  3TDZ C;  1ULY A;  3K2Z A;  1IN7 A;  3HIF A;  5L3B A;  2FF4 A;  2XV4 S;  3GWZ A;  4Y13 A;  4S05 A;  2QVO A;  2FA5 A;  5HDN A;  4N9H A;  3SXY A;  1QQI A;  4O6J A;  2IJL A;  1JHH A;  1ZAO A;  2DO7 A;  2NS0 A;  3GX4 X;  2FU4 A;  2PJP A;  2IA0 A;  3E97 A;  2JTV A;  3AAF A;  1TW2 A;  5E1Z B;  1WSU A;  2CW0 F;  2OA4 A;  4A6E A;  4EVI A;  4I2O A;  1MKM A;  3KE2 A;  2QBY B;  3T1B A;  1U3E M;  3DV8 A;  1FSH A;  1LDJ A;  4XBF A;  3R0J A;  4MHG A;  1I1S A;  2EA2 A;  2HGC A;  3E5X A;  4I98 B;  1FBQ A;  2H27 A;  3BP8 A;  1IRF A;  3IC7 A;  3FMR A;  3RIR A;  1XMK A;  2Z3Y A;  3WU1 B;  2HOE A;  2V1U A;  5F64 A;  4PGG A;  3BJO A;  2ELH A;  4CIC A;  4OIN F;  3RJP A;  3E5Q A;  5CVJ A;  3ZMZ A;  2P4W A;  5ICG A;  5E18 F;  1Z7U A;  1HKS A;  1FPQ A;  3B02 A;  2P7C B;  2VBW A;  2HTJ A;  3FXR A;  3FXQ A;  4NB5 A;  2MA3 A;  5A2Q K;  4BH9 A;  4NHJ A;  4KUM A;  4QLC U;  4YFX F;  1MD0 A;  3L2C A;  1H9G A;  3IWF A;  2CQK A;  3HRS A;  4KIG A;  5FD6 A;  3H3U A;  1LDK B;  1IN6 A;  3T0Y A;  1IXC A;  4GCV A;  2GWR A;  4BXU A;  2B0L A;  2Q0O A;  2XAJ A;  3CTA A;  2BV6 A;  2O0Y A;  2K86 A;  1BN5 A;  1XSV A;  1BC8 C;  3KLN A;  4HDU A;  1OYW A;  4L5J A;  3ML6 A;  3Q5F A;  3VFZ A;  5IT3 A;  1J75 A;  4P5O A;  4AWX B;  1U6G A;  3IHU A;  1FZP B;  3C7J A;  3EYY A;  1O3R A;  1XCB A;  5F6F A;  1O3S A;  1TQI A;  4Q47 A;  3RKW A;  1FBU A;  1IN4 A;  4M9S A;  1UHW A;  3KEO A;  4ASN A;  1XDS A;  2W57 A;  4AIH A;  1GVJ A;  2XAG A;  2E1C A;  1P92 A;  1TQP A;  1U5T C;  5D5V B;  1ZYR F;  1TNS A;  3GFL A;  4HV6 A;  2V9V A;  4CXF A;  1DPU A;  2NNY A;  1ON2 A;  3RDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...