4M6YA

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
335
structure length
335
Chain Sequence
TEVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHLFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
total genus 114
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m6yA01
4M73A 1Z7UA 2NNNA 2XKOA 4OIPF 4U0VA 1W7PB 1E17A 2ELHA 1YQAA 2HS5A 3NEUA 4MTEA 4EV0A 5TRDA 3ISPA 1H0MA 5L3GA 5CVUA 5JVTA 5D6FA 3FM5A 1HXDA 3TGNA 2ZFWA 2PLYA 1FSEA 4L5JA 2P5KA 4EM0B 4I98B 1MJAA 3BJ6A 3V7SA 3BOQA 3AAFA 2EFPA 5FLXK 3L09A 4Q47A 5CJ9A 3LAPA 3IRQA 3F21A 1SD5A 1SMYF 3KLNA 2VODA 4L9NA 1ON2A 3E6DA 1RNLA 5HDGA 5J8CA 3DP7A 3KP2A 3GFJA 4LGWA 3T5XA 4CHUA 3E3VA 1FWZA 1TNTA 1LDJA 4KMUX 3IKVA 1R7JA 1O3SA 2VT3A 2H6CA 2FXAA 3GXOA 3E6BA 1TLHB 2Z9OA 1WKMA 3B73A 4U7BA 5LEJA 1IRGA 4LG0B 2QUFA 2NS0A 5LEKA 3QP6A 4U7DA 4RAYA 2ZO4A 2ESHA 1SD4A 5ILVA 2HQNA 2QM3A 4FT8A 1FP2A 5TJJA 1KU2A 2F2EA 3S2WA 1ZRDA 2DQRA 1R22A 5ICCA 3VOEA 3TOBA 3CDHA 1Z6RA 1Q1HA 2EA4A 5HLGA 4RB2C 5LLQA 3LFKA 3I59B 2E1NA 2STTA 2LKPA 1ZLKA 3RPUA 4YFXF 4RGRA 1PP7U 2DAOA 2DTRA 4M72A 3WU0A 4PGHA 3ZN0A 1MJBA 2DFIA 3T8RA 2Q8KA 4EJTA 2EV6A 2VBYA 3NRVA 1L0OC 2UXXA 5A2QZ 2D1HA 2DI3A 4CICA 4UHTA 1ZREA 1ZG5A 3KP7A 2FRHA 4MEYF 3WE2A 3SXYA 4CGZA 2X0LA 3CJNA 5KVRA 5K5QA 2V79A 4JBAA 3GZ6A 2O61A 2FBHA 2YSRA 3FZVA 2MH2A 2YR2A 1K78A 4ZH4F 4KIGA 1I27A 4PZJA 4BHPA 2A6HF 2HQRA 5L3CA 3P9CA 1K79A 4ASNA 2ZXJA 3NQOA 1TW3A 3BPVA 2XASA 1ZRCA 3E5XA 1O7LA 3QAHA 4ENMA 5CVJA 5CVIA 5ED4A 4NB5A 1XB4A 3QPTA 3TQNA 1O3TA 2VC1A 3MCZA 1FYKA 4RAZA 5LGTA 2P5LC 5J6XA 5FLXZ 4RB3C 2QBYA 3WTWC 2EFWA 2ZJ2A 3ABUA 4LJZF 2OZ6A 3J80K 3R0AA 5E18F 2CQKA 2A6EF 1YG2A 4M6XA 1TBXA 2GAUA 2PBIA 4GO1A 2MBFA 2X4HA 3K69A 3MZYA 1R00A 1I1GA 2RGVA 2WTEA 4M6YA 1CF7A 1IXSB 2ZKZA 1LEAA 2VXZA 3M1EA 4G6DA 4LFUA 3LA3A 1FBSA 1J75A 5E8GA 4G7ZF 4MNUA 3BJAA 4L9VA 3V8KA 4HDUA 1KA8A 2L54A 5D6EA 3D5LA 4L5IA 5BPDA 1S7AA 3ECHA 1F9NA 2F5CA 3I4PA 3JTGA 2L02A 3GEZA 1SFXA 4I7HA 2E7XA 2KJBA 3ELKA 3BJOA 2MD5A 1FY7A 3WTXC 1T2KA 1JGSA 5D5WB 1UFMA 3GUDA 1Z9CA 4WXHA 3K1PA 3P7NA 2MH9A 4BHBA 3KP5A 5L3BA 1O3RA 3PQJA 3ERED 2PN6A 4PCQA 3FM3A 1BC7C 1ZG3A 2EV5A 4AIKA 1U5TA 1YW7A 4UVBA 2TDXA 2FF4A 2J5OA 2HWVA 3U9GA 5AIQA 3KLOA 3WTSC 1O3QA 2F5DA 1USTA 5HS7A 2RN7A 3F72A 4MQVA 2ETHA 5CLSA 3HRTA 3T0YA 1DDNA 1LDKB 4KDPA 1UB9A 4P96A 1O57A 1BJAA 1MKMA 2GWRA 3LAJA 4ENKA 4GCVA 4BNCA 4XLNF 4N0BA 4WWCA 1JHHA 3I71A 1ODDA 3REOA 3I53A 4KICA 1YTYA 3ZMTA 3W6KB 4H0EA 2EJRA 4LLGF 1FT9A 2XUBA 3MFKA 2GXGA 4IVNA 1STZA 5FD6A 4P9UA 4ZYDA 1G3TA 4JQFA 3V8LA 2FE3A 2LF8A 3HSRA 1OMIA 2OBPA 2W57A 3J81K 3C18A 4EVIA 4NHJA 1PP8F 4ESFA 2JPCA 3J80Z 5LGUA 2VOOA 5K5OA 1GXQA 1CGPA 4A5NA 3RKXA 5EEHA 4ZYHA 3EQLF 1FYLA 1BI3A 2IRFG 2VONA 4XBFA 2CFXA 4ZYGA 1FX7A 1OYWA 1YIOA 3WGIA 5DEQA 5BS6A 1ZLJA 1HKTA 2W25A 1BN5A 4AWXB 5HDNA 1IZ1A 4EM2A 4M9ZA 1QNTA 1W5SA 5BQTA 3ECOA 4OIOF 4BXUA 3TDZC 1T38A 1OPCA 4G8XA 2FBIA 2DT5A 4I0AA 4G6QA 1KYWA 4EJOA 3EETA 5K1YA 4LK1F 2JPBA 3MWMA 1IXRC 2H09A 5E1XA 5LRSA 1DPRA 5DD8A 1GVJA 3WTZA 2JTVA 3LA7A 4ON0A 3HRSA 1B59A 4IRHA 3HHHA 5JR3A 1O7FA 2FQ3A 1HW2A 1U5TC 3L7WA 3CUOA 3FXQA 1QBJA 1TTYA 2XAFA 4LG0A 5D8KB 2L4MA 2VE9A 4G9YA 2KKOA 3WE3A 3R0JA 4QLCU 4CDGA 2OA4A 1IRFA 3PQKA 1G4DA 5FGMA 1UCRA 1XN7A 1P6RA 1P2FA 2YU3A 2VT2A 2D2WA 1LVAA 1TQIA 5F6FA 4RB1A 5FB2A 3ZQ7A 4LMYA 1BOAA 2EWNA 4BH9A 1DP7P 2P6SA 3HHGA 2XRNA 1Y0UA 1IN4A 4Y17A 1HBXG 4HLYA 4KT5C 1WSUA 2EB7A 1G6NA 2OQGA 4HDVA 4JK1X 2OD5A 1LEBA 4A5MA 4HW0A 3RKWA 1P4AA 4IHSA 5D8LB 3HRMA 4IHTA 1BIAA 3ZMZA 4HF2A 4B8XA 1UHWA 5JI6A 2DW4A 2PQ8A 3IC7A 4I2OA 1F1ZA 3O6BB 2HZTA 2HTJA 2P8TA 5HVQC 3ROUA 1XSDA 1E2XA 4TV7A 4R8HA 4D0PA 5H6QA 2AS5F 3BDDA 1J0RA 1KQ8A 3RI4A 4MTDA 2HOEA 1QPMA 1V3FA 1XGSA 1FOKA 2JRTA 2QQ9A 2Q2EA 2ADUA 2RNJA 4EJUA 4MQ9F 3VODA 2ISYA 2PMHA 3FMSA 5CVVA 2DPDA 5K5RA 3I64A 1JXSA 4L9TA 1HKSA 2M8EA 4RS8A 4LLLA 1ZYRF 2IA2A 5LBQA 2J5PA 4XSXF 3LWFA 3FXRA 4UV9A 3KP6A 3G73A 1RZ4A 3EYYA 1AWCA 2O0YA 3U2RA 4ZZDA 2UZKA 2FBKA 1J5YA 5FFZA 5DCMB 3R6SA 1LDDA 3JSOA 3H92A 3BROA 2XROA 2PJPA 6PAXA 4ENNA 2IPQX 4ZZLA 2CW0F 2V1DA 2K4JA 2QVOA 4N9HA 1R23A 4CZZA 4EJVA 2GA1A 3WTTC 1W5TA 4PDKA 4IRIA 4EQQA 2CO5A 3CUQC 3J7AO 1YO5C 2ZNYA 3K2ZA 3GF2A 4Q5SF 3EYIA 1YS6A 3ABTA 1MJ9A 3GVAA 2YPRA 4YFNF 2IA0A 2NNYA 3F8BA 4UVAA 5H6RA 1W7PD 4A6EA 2KIFA 4A6DA 4HV5A 1XSXA 5LHGA 3KE2A 1FBUA 2IW5A 5L3EA 1K7AA 2P5VA 3ZMUA 2NAZA 4O3MA 1XCBA 2XIGA 4AIHA 1DUXC 4M71A 2K27A 1KYZA 4IF4A 2O8XA 2QLZA 2WV0A 2G7HA 1ZGAA 4KA4A 3KCCA 1EH7A 2PG4A 2M1BA 3ZMSA 4CYDA 1OYIA 3DF8A 3F8CA 1SD6A 3WGGA 2LDUA 3LQRA 4YG2F 1SFUA 1MZBA 2JSCA 4Z2YA 2E1CA 1LNWA 1WRJA 3WTYC 2KRFA 2ISZA 2QQBA 4IPAA 4CXFA 2IVMA 2B0LA 2Y48A 2PEXA 1XCVA 3G3ZA 2UWMA 3PFIA 1FPQA 2G9WA 1XGOA 4Q4ZF 5HLIA 2XV4S 2FA5A 4G7OF 3CO7C 2CG4A 2NYXA 1GXPA 4MEXF 3MZHA 1R1VA 3K1NA 2EK5A 3T1BA 2OU2A 2GXBA 1A04A 3B02A 3GFMA 3HIFA 1T6SA 1ZAOA 3P9KA 1IN6A 1IXCA 4O6JA 3QRFF 3TO6A 2P4WA 2O03A 4P9FA 2R7DA 1GHCA 1FZPB 1S29A 3U1DA 2DU9A 1FC3A 1S7OA 3GW2A 1D3YA 1TNSA 2M5WA 2MLKA 2D45A 4XLPF 1B6AA 2HFHA 3WTUC 4YIFA 1MDMB 4Y15A 3K9TA 2CGPA 1B1BA 4HA8A 5IT9K 4BAYA 2FOKA 4DNCA 3RDIA 2Q0OA 1QZYA 5E17F 4CO8A 1Z05A 1C0WA 2Z33A 3RJPA 3I5UA 1U78A 4U88A 2MC3A 4OMYA 4L18B 1LB2A 5ILSA 2QBYB 5DCFA 3QOPA 2MA3A 1BI2A 1IF1A 3VB2A 2KJCA 2ZCWA 5HS9A 3N97A 1ZGJA 4RGXA 2XAGA 3E6MA 1JHFA 2FNPA 3BZ6A 4OIQF 4KIFA 1YW9A 4M74A 1RI7A 4HOBA 3H3UA 3FXUA 4YFKF 2GQQA 3L00A 1T39A 2OZUA 5F64A 5DDGA 1K6OA 1U8RA 1CF7B 1DPUA 2FU4A 4KFCA 3R4KA 4GGGA 1U6GA 1HW1A 2Z3YA 1SFEA 4HF1A 1IAWA 2JT1A 2XAQA 1W7PA 3SQNA 4OOIA 3DFGA 1SD7A 3C1DA 4U0WA 4A0ZA 4FX0A 5LGNA 3LSTA 2L01A 1J9IA 4AD9A 1T0FA 4MHGA 5AIPA 2RDPA 2HKOA 5FD5A 4A0YA 3KZZA 1R1UA 2EFQA 2E7WA 3SZPA 2IA1A 3ZMDA 3F6OA 4EGZA 3KEQA 1I6XA 2EV0A 5D5UB 1W4MA 3EDPA 4AVPA 5ICGA 2WC2A 2DK8A 1J7KA 3CLOA 3GO5A 2XHKA 5BPIA 2KIMA 2QENA 3Q9SA 4HLXA 2HEOA 4MGRA 1TQPA 1L3LA 3CO6C 4GXOA 3ZN1A 3M7GA 3FHZA 4UUVA 3QPHA 1KU3A 3F22A 2H6BA 3E5QA 2F5EA 1QO0D 3TO7A 1YW8A 2W84A 3VEPA 3FMRA 1BBYA 3TKYA 2ACJA 3KP4A 2CSOA 2BYVE 1YS7A 2K4BA 4OINF 2ZBKA 3I0TA 3OOPA 1H9TA 4EM1A 3T8TA 1IW7F 1EV7A 3R61A 1RIOH 1U2WA 5IT9Z 1J2XA 2GIVA 2DK5A 2IJLA 5DUIA 3O2PE 4WCGA 5FFXA 2PI0A 5D4RA 4XSZF 5HS8A 1KGSA 2STWA 2QYOA 3KP3A 4YIIA 1XMKA 4K2EA 3WODF 3DPLC 2DLLA 5DCMA 1F5TA 2ZMEB 3I59A 2BGCA 2COMA 4HX4A 4KMFA 3FWEA 3GX4X 4HX8A 3IL2A 1YFHA 2FMLA 3GYHX 5AONA 3KETA 1RUNA 2F5FA 1B9MA 4A2UA 4WXDA 4DQ2A 3H3ZA 2GA2A 2R7FA 4I09A 2P7CB 3IKTA 1P4WA 2DPUA 3O3KA 4HQMA 1XMAA 1XGMA 1XDUA 3V4GA 4P5OA 3J81Z 1REPC 1MD0A 1G3SA 2IP2A 4F7ZA 5E20A 1OKRA 4O5VA 3WGHA 4IXAA 3HYIA 2A5YB 2BE5F 4LK0F 2FMYA 1USSA 3RYPA 1KU9A 4GYIA 2GZWA 2HTSA 5BOXA 4U0YA 3C3WA 3L9FA 3DV8A 3QP5A 4L0ZB 2JZYA 4E70A 1HQCA 3LQQA 3TDUC 3JW4A 3L2CA 3Q9VA 2M30A 4IJAA 1FYMA 4FX4A 2HYFA 4ETSA 4KYWA 3F8MA 1IN8A 2OQRA 2VC0A 1BI1A 1FP1D 4EMSA 3E5UA 3DPTA 3CUQB 4N9IA 5BMZA 3I54A 3M8EA 1IN7A 2ESNA 4HV6A 3RPQA 1XDSA 1HSJA 2HKXA 4QWQA 4UVCA 3FF5A 2CWEA 3SHFA 3HOSA 1ZARA 5ERIA 1QZZA 2G7UA 1LJ9A 2CYYA 1FNNA 1FBQA 1ULYA 4S05A 3N4MA 2XAHA 4PGGA 1XD7A 1HSTA 2HGCA 5IT3A 1WWXA 4ZYEA 4KN7X 3RIRA 3JSPA 2DBBA 5L3DA 4I0BA 5H20A 2RC4A 3OV8A 4WX9A 1U3EM 3GFIA 5LHHA 4KN4X 3FMQA 2Z5UA 3WTVC 3M9AA 3QU6A 2A3SA 2FNAA 3TO9A 3GZ5A 4IRGA 3SFZA 3JAMK 3E97A 3RYRA 2Y75A 5ILUA 3ZMVA 5CYVA 1KQ9A 2EA2A 3WU1B 3K1MA 3LA2A 1D5VA 4B09A 2QZ8A 5FO5A 2P7VB 2LNBA 4R79A 4AIJA 4RGUA 3COAC 3GWZA 3Q5FA 2QWWA 3M8FA 3RTRA 2RVCA 3F6VA 1MDMA 2OAZA 3DKWA 2XGXA 1ZRFA 4S04A 1P92A 1Z6TA 2IT0A 2BV6A 1I5ZA 3E6CC 5HOOA 2DQLA 3HRUA 1KQ0A 3ZP5A 2NRAC 4ESJA 3IWZA 3EUHA 3JTHA 2O6GE 2K86A 1Z1DA 3HTUA 2A07F 4Y13A 2DO7A 2RKHA 5DYMA 1PUEE 2HDCA 1FSHA 4OIRF 1TW2A 2A69F 3V8JA 1TQMA 3F23A 4OU0A 4KIBA 2Y0MA 1Z91A 3TOAA 2HR3A 3R60A 1OYYA 1SAXA 1G3YA 1P4XA 4XRFA 3IRRA 1JE8A 3GLXA 4HYEA 4BQAA 1I1SA 1PDNC 1LQ1A 3HSEA 2L3DA 3SZTA 3K0LA 5ICFA 1HKQA 5CVRA 3KZYA 1SMTA 3BPXA 3MQ0A 1V4RA 4ENJA 2LSOA 1BI0A 2YX4A 4I02A 1VTNC 5E1ZB 4Q48A 4BYYA 5DV5A 5LRRA 1R5GA 3V7CA 1KU7A 2AXLA 1WI9A 3ULQB 4UV8A 3F8NA 1K78B 3BY6A 1RUOA 1B9NA 3RKYA 3F8FA 5JHUA 4LD5A 1AOYA 5D4SA 2Z99A 4HZFA 1S3JA 3F3XA 3GFLA 4NQWA 2C6YA 4OMZA 2P6TA 3KEOA 4HQEA 5L3FA 3BP8A 3V7RA 2FSWA 3BWGA 5LHIA 2XVCA 1ZHFA 4FHTA 2ZNZA 2VOPA 1WQ2A 5E8IA 1B4AA 3QU3A 2PFBA 1ZN2A 2EFNA 4R1HA 2VE8A 4M9SA 1MGTA 1BC8C 2KIUA 1ON1A 4HF0A 3JAMZ 2V1XA 3MAJA 2WWYA 1XGNA 1YYVA 1ONVA 3WG9A 1ZG1A 4RGSA 1R36A 4P55A 3FX3A 2D1VA 4GYGA 2VBWA 4LB5A 3I58A 1J59A 1IUYA 1R58A 4RB0A 3ML6A 2VBZA 3IWFA 1S8NA 4EGYA 4WK8F 2O3FA 1ZH5A 4WF2A 1EH8A 2QQAA 2H27A 2L4AA 5HLHA 1HW5A 1BIBA 2EFOA 2H94A 4L0YB 1D8JA 2MLGA 4BHCA 3VFZA 1EH6A 5JFRA 5DUKA 2LF7A 1G3WA 5HDKA 5KK1A 2YX7A 4HX7A 4KUMA 4LLNA 2ZMEA 1FLIA 4EJWA 1BM9A 5D5VB 2R3SA 3HSFA 2HYGD 1NHAA 2RQPA 1S6LA 3HTSB 2M87A 1X3UA 4UNOA 3DQVC 3P9IA 3ZPLA 1XSVA 2UXNA 4L9JA 1OR7A 2XKPA 2K02A 1H9GA 5D5XB 2W85A 1R1TA 1IN5A 2BBYA 4HBLA 3C7JA 1U5TB 1YLFA 4G94A 4G7HF 2XAJA 2W24A 2RV8A 2V6CA 3IHUA 3CTAA 1T98A 4A0XA 3DEUA 4M9XA 2FEZA 5J8FA 3W6JB 2M45A 5E1WA 5DD4A 3MEXA 3HUGA 5EEGA 2VBXA 4KNYA 4I01A 3D0SA 4UXNA 1QQIA 2K7LA 3DXJF 4HAMA 2V1UA 5F1RA 2VN2A 5A2QK 2V9VA 4LB6B 1UHMA 1F4KA 1QGPA 3HOTA 2A68F 1R5HA 5ICEA 3KFWX 1D8KA 2BEOA 4WXCA 4ESBA 2PMUA 3CUQA 2A61A 4A12A
chains in the Genus database with same CATH superfamily
5H2FC 4M73A 1Z7UA 2NNNA 1R4NB 2XKOA 3S16J 3CCEI 4OIPF 3CCJI 4U0VA 1H89C 1W7PB 5IP7J 5E3LA 4LOCA 1E17A 2ELHA 2LY9A 1YQAA 4NBQA 3W2AA 2HS5A 3NEUA 1AKHA 2VJ5A 4MTEA 4EV0A 3RZDJ 5LD2C 3LMMA 5TRDA 1X1CA 2HXOA 3ISPA 4NC6A 1H0MA 5L3GA 1WCMJ 5CVUA 4BQQA 5JVTA 3DKYA 2KPMA 4BE1A 5D6FA 2E2IJ 3FM5A 1HXDA 3TGNA 2ZFWA 2PLYA 1ETKA 4LIUA 4LIVA 1Y56A 1FSEA 3G1LA 3BR1A 2KQRA 4L5JA 2P5KA 2CUJA 5F04A 4EM0B 1LFBA 2BHZA 3HEFA 3FXLA 4I98B 3DCFA 5FKOA 3FXOA 1MJAA 3BJ6A 3V7SA 3TW6A 3BOQA 3AAFA 3U21A 1T08B 2MG4A 3CP8A 1RR7A 2EFPA 5FLXK 3L09A 4Q47A 5CJ9A 3LAPA 1MMNA 2E71A 3IRQA 3F21A 1T0FC 2R4GA 1JTXA 1SD5A 1SMYF 1MBKA 3KLNA 3IH2A 2DCEA 4L9NA 2MC4A 4C2TA 1ON2A 2VODA 3E6DA 1RNLA 5HDGA 3S3NA 5J8CA 1VNDA 2E60A 3DP7A 3KP2A 3S1RJ 3EUAA 4BJ6C 5M5WJ 3GFJA 4LGWA 2BXYA 2Y2ZA 1P7IA 3CCVI 3T5XA 4CHUA 3E3VA 1FWZA 1OR7C 5M5XJ 1TNTA 1LDJA 3F9KA 4KMUX 2K9NA 3IKVA 5J3LA 1R7JA 1O3SA 2Z16A 2VT3A 3OYNA 2H6CA 2FXAA 3GXOA 1OCOH 3E6BA 1TLHB 1QHGA 2ME6A 2Z9OA 3DPUA 3CJRB 1X2NA 3AL0C 3TW7A 1WJ5A 2L0KA 1WKMA 4Y4RA 3D5RC 1OISA 3B73A 3TBIA 2KZGA 2NVUB 3Q0VA 2JQ7A 1WHUA 4U7BA 1QRYA 5LEJA 1IRGA 4W1UA 1AA7A 2GOXB 2QUFA 4LG0B 3ABMH 2NS0A 2R7QA 5LEKA 3QP6A 4U7DA 2EZLA 4RAYA 3ZQCA 2W48A 2ZO4A 2R7SA 4MLOA 2ESHA 1SD4A 5ILVA 2HQNA 2QM3A 4FT8A 1FP2A 5TJJA 1KU2A 3QPSA 2F2EA 4Y3OA 5TGTA 4FE4A 2E2HJ 3S2WA 1ZRDA 5JLWA 2EIJH 2R5YA 2DQRA 1R22A 5ICCA 3VOEA 2NOGA 2CW7A 1AHDP 3TOBA 3CDHA 3G4SI 1VQLI 5FLVA 2DODA 1Z6RA 1Q1HA 2EA4A 5HLGA 2GBYA 1W36D 4RB2C 3QQAA 3FXJA 5LLQA 3PNTA 3LFKA 4BJ5C 3I59B 4A3BJ 4IEJA 2E1NA 2STTA 2LKPA 1ZLKA 3RPUA 5KHDA 1YHQI 5E79C 3HG9A 4YFXF 4RGRA 1PP7U 4IOCF 2DAOA 2DTRA 4M72A 1WJAA 4PGHA 3WU0A 3ZN0A 1Z3YA 4JX4A 1MJBA 2DFIA 3SFIA 3T8RA 2Q8KA 4EJTA 2M7AA 2EV6A 2VBYA 1YI2I 3NRVA 2NVXJ 1L0OC 2UXXA 5IOYA 5A2QZ 5FRNA 4XIDA 2D1HA 2DI3A 1ETXA 2EZKA 4CICA 4UHTA 1YJ9I 1ZREA 2CW8A 1ZG5A 3PIPF 3KP7A 2FRHA 3U1KA 2LC2A 1MW7A 4MEYF 4AYBA 1MMGA 1Z0XA 3WE2A 3SXYA 3FIWA 2XPVA 4PJ0C 3A03A 2L9NA 4CGZA 5C44J 2X0LA 2JJ7A 2DTZA 3CJNA 5KVRA 5K5QA 3OYIA 3FKIJ 5M3FJ 1U8BA 3C2GA 4HNUA 2V79A 3DU6A 3Q0UA 4JBAA 2EILH 4A3KJ 3GZ6A 2O61A 3FK7A 1Q1VA 1Y0NA 4F3QA 2FBHA 2HDWA 3BZCA 2YSRA 3FZVA 2MH2A 2YR2A 2R7VA 2DJNA 1K78A 3BG5A 4ZH4F 4KIGA 1I27A 1NK2P 2VPLA 2HVQA 2MYSA 3GZNB 3GTOJ 1YIJI 2ELJA 4NC7A 1ZQ3P 4PZJA 4BHPA 2A6HF 2OJED 4MFDA 2HQRA 4DZPA 4UB6C 5L3CA 3HOVJ 3OSGA 3P9CA 1K79A 4ASNA 3JRIA 4G12A 2ZXJA 3NQOA 1TW3A 3BPVA 1K4SA 1JKRC 2XASA 1ZRCA 1NH3A 3E5XA 1IJWC 1O7LA 3QAHA 2F4IA 4B3XA 2BZTA 2CUFA 2OC6A 5CVJA 5CVIA 4ENMA 1UELB 4NB5A 1XB4A 2M34A 5ED4A 3QPTA 3BR3A 4XM3A 3TQNA 1O3TA 2VC1A 3MCZA 3FBIB 3FBNB 1FYKA 4P1WA 4AC0A 2LG4A 4RAZA 5LGTA 2P5LC 5J6XA 2CQNA 5FLXZ 4RB3C 1JKOC 2QBYA 2EIKH 3WTWC 3QYBA 4HNVA 1IV8A 4ZC3A 4ZDOA 2EFWA 5B1AH 2ZJ2A 5EGOA 2K5CA 3ABUA 4LJZF 2OZ6A 3J80K 5KCMA 4MO7A 3R0AA 2E1MB 1TC3C 5E18F 2CQKA 1U9NA 2A6EF 3HOWJ 1YG2A 4M6XA 1TBXA 2GAUA 4Z6YA 5K7ZA 2PBIA 3L2VA 4GO1A 1LKXA 3OS1A 3H0GJ 1IDZA 2MBFA 2RAEA 2X4HA 3K6GA 2RQQA 3K69A 5F0FA 3MZYA 3GTGJ 1R00A 3H3VK 1I1GA 2VKVA 2RGVA 2L5QA 2KP6A 4OAYA 2AQEA 2WTEA 4M6YA 1X1PA 1CF7A 1IXSB 2ZKZA 1HA8A 1LEAA 2HNHA 3DBHB 2VXZA 1Z7LA 3M1EA 4G6DA 4LFUA 3LA3A 4RM2A 3ZQIA 1FBSA 1JT6A 1E0EA 4FTHA 4BACA 4QPQA 1J75A 5E8GA 3OYHA 4G7ZF 2L9SA 2FUG2 4MNUA 2CFOA 3BJAA 4DIQA 4L9VA 3V8KA 4HDUA 3SDGA 1KA8A 1JJ8C 2L54A 3CESA 5D6EA 3D5LA 4L5IA 1JGGA 3OOUA 1S7AA 5BPDA 1V55H 2XRLA 3ECHA 1F9NA 5GADJ 3TEDA 2F5CA 2V9KA 2M2EA 2W1OA 2YS9A 3I4PA 5DM7F 3JTGA 3CCUI 3PNYA 2L02A 4RM3A 5GPAA 4GFBA 3GEZA 1SFXA 1BJZA 4I7HA 2R7OA 2E7XA 2KJBA 1N25A 3ELKA 3IAS2 3BJOA 1XS9A 2MD5A 4IHXA 1FY7A 5TISC 2PX9A 3WTXC 3OYCA 1T2KA 1VQKI 1JGSA 5D5WB 1UFMA 3GUDA 1Z9CA 1VQ4I 2HDDA 3QYFA 3OSFA 4WXHA 3CLQA 3GTPJ 3K1PA 3NARA 3P7NA 3VDXA 4D1QA 4XN3A 2Q1ZB 2MH9A 4BHBA 3KP5A 4E7LA 1HDPA 5L3BA 1VZ0A 4AU7A 1O3RA 3PQJA 3ERED 2PN6A 2R7RA 4PCQA 2M3AA 2LR8A 2DT7B 3FM3A 3K2AA 1BC7C 1ZG3A 4A93J 2YU9J 1B72A 3H35A 2EV5A 3A01B 4AIKA 1U5TA 2L7KA 1YW7A 4UVBA 1N75A 2FF4A 2L9VA 2TDXA 2J5OA 4AUXA 1FOYA 4BDYA 3FKJA 2HWVA 3GTKJ 3U9GA 2LYCA 2E19A 5AIQA 2DOAA 2VJJA 4PJNA 1ZR2A 1IG7A 3BG6A 2JA8J 3KLOA 3WTSC 3Q0WA 1HC8A 1VQ9I 1O3QA 2F5DA 1X2MA 3VSLA 2B63J 1USTA 4RDUA 2Y0SA 2FOWA 1S72I 3W2WA 1GV2A 4FISA 5HS7A 2RN7A 3F72A 3KPHA 4MQVA 2MW8A 2VL8A 3OYEA 1FTZA 2ETHA 5CLSA 3HRTA 3T0YA 1DDNA 2HPMA 1LDKB 4F55A 4KDPA 1UB9A 1MMDA 2M4KA 3BG3A 2F6CA 4XN0A 3ERMA 4P96A 1O57A 2LBFA 2BW3B 3F0CA 1BJAA 1SC7A 1MKMA 3ZQGA 2ZSHB 3ZQQA 4IZZA 2GWRA 3LAJA 4ENKA 3DTIA 4GCVA 3PIOF 4BNCA 4XLNF 4N0BA 1IV6A 4WWCA 1JHHA 3I71A 1ODDA 3REOA 3I53A 4KICA 1YTYA 1H8AC 2Y31A 2FD5A 4FETA 3ZMTA 3W6KB 1UG2A 4H0EA 4NUBA 4BBRJ 5EG0A 2O9LA 4NDLA 1T95A 2EJRA 4RA2A 2D5VA 2KRHA 2EZIA 4LLGF 2EPFA 1FT9A 2XUBA 2MGQA 4BY7J 3MFKA 2GXGA 3G1MA 4IVNA 1STZA 1FIPA 5FD6A 3JR9A 1QZEA 4P9UA 4ZYDA 2HQ5A 2HZDA 1G3TA 4JQFA 3V8LA 2EH3A 1T56A 2KDOA 4CCJA 2VI6A 2FE3A 2LF8A 1KONA 2P81A 3HSRA 2WAFA 1OMIA 2F4OB 3BTCA 2OBPA 2W57A 3DEEA 3HKZA 3J81K 3C18A 4EVIA 4FASD 4V2GA 2LY2A 1IUFA 3JRAA 4NHJA 5EZGA 3AKZA 1PP8F 4ESFA 4D7MA 2JPCA 3UR3C 1EJ9A 3J80Z 5LGUA 3G1OA 2VOOA 5K5OA 1GXQA 5GAHJ 3C2BA 4BU2A 1CGPA 4A5NA 1IRZA 1VQ7I 3RKXA 5EEHA 4ZYHA 3EQLF 3A0HC 3B6AA 3SJMA 1FYLA 1BI3A 2IRFG 4XLAA 2VONA 3D1NI 3MVPA 4XBFA 2CFXA 2O7OA 1X4OA 4ZYGA 2X48A 1OYWA 1FX7A 1GUUA 1YIOA 3WGIA 1TZLA 5DEQA 3PL8A 3CDLA 3RQ4A 5BS6A 1ZLJA 1HKTA 3HXLA 2M9HA 3H0DA 2W25A 1IRXA 1BN5A 4AWXB 1WJBA 3KYCB 1IZ1A 4DYCA 5HDNA 3BTJA 4XKWA 4EM2A 4M9ZA 3DBLB 1QNTA 1W5SA 2LOOA 4RAFA 2VJIA 1JUPA 5BQTA 3W6VA 3ECOA 4OIOF 3WHCA 4E7IA 1DGWY 5IP9J 4BXUA 2VKEA 3TDZC 4B44A 2HVRA 1T38A 1OPCA 2AQFA 3CCRI 1ZTRA 4G8XA 2FBIA 2DT5A 3BCBA 3Q3SA 4I0AA 4IL6C 2CQXA 4G6QA 1KYWA 3OL3A 4RBOA 3JREA 4C2UA 4HSTA 3ZCOA 4EJOA 3EETA 5K1YA 4ABZA 3JRBA 4ANJA 2PJRA 4LK1F 1JUSA 5IY5H 3K10A 2JPBA 3MWMA 1IXRC 4RLQA 1LPQA 2H09A 5E1XA 5LRSA 2IGOA 3S14J 1EA3A 4OAZA 1DPRA 5DD8A 1GVJA 3LOCA 3WTZA 5J1YA 1FMVA 2JTVA 3LA7A 1FOXA 4ON0A 1E3HA 3HRSA 1B59A 4XKVA 4IRHA 3HHHA 5LFAA 5JR3A 1O7FA 2FQ3A 1I3AA 3ESWB 1HW2A 4KISA 1U5TC 3L7WA 3CUOA 1BW5A 3HGGA 3FXQA 1MBJA 1BR1A 1QBJA 4B1RA 1POGA 3H5NA 1TTYA 2XAFA 5FRMA 2IS1A 4LG0A 1Y6IA 5D8KB 1HDDC 3SZGA 1Z77A 2KHMA 1TT5B 3PUFA 2L4MA 2VE9A 1V5EA 4AYBN 3PNVA 4G9YA 2KKOA 3WE3A 1RKWA 3R0JA 4MFEA 4QLCU 4IOAF 3BR2A 1W36C 4CDGA 2OA4A 4E7JA 1IRFA 3PQKA 2KDZA 1G4DA 5FGMA 1UCRA 1XG1A 1XN7A 2HI3A 1P6RA 4UY8I 1P2FA 2YU3A 4HSRA 1D0YA 2VT2A 2D2WA 5EZHA 1LVAA 1TQIA 4KJZA 5F6FA 2XAUA 4RB1A 2CS3A 5FB2A 3ZQ7A 2HU9A 4G6TB 4LMYA 3CMYA 1BOAA 2EWNA 4BH9A 1DP7P 2P6SA 4AVZA 1DU0A 3HHGA 4M3GA 2XRNA 1Y0UA 1IN4A 4Y17A 1HBXG 4HLYA 2LKSA 4QPOA 4KT5C 3HL2A 4CCMA 2JWTA 1WSUA 5J47A 2EB7A 1G6NA 2JVGA 2OQGA 4HDVA 4I6ZA 2QSGX 2JRMA 5B1BH 4AIDA 3O8HA 4JK1X 2OD5A 3DLAA 2N8GA 3DBRB 2CH0A 1DGRM 4E6KG 1LEBA 1TWFJ 2I8DA 3VWBA 4A5MA 4HW0A 1N78A 1A6IA 3RKWA 1P4AA 4IHSA 5D8LB 4A3IJ 3ONQA 3HRMA 2XPUA 4IHTA 1BIAA 3ZMZA 4HF2A 2ZMEC 2LTPA 2X1DA 1IO2A 4B8XA 3BCAA 3SEZA 1UHWA 3BR6A 5JI6A 2DW4A 2PQ8A 5IPAA 3IC7A 2W7NA 4I2OA 3KYLA 1F1ZA 1YX5A 3O6BB 3ZXSA 1MSEC 2KMUA 1WJFA 2HZTA 4RLFA 2HTJA 2VPRA 4HRIA 3AL0B 2P8TA 5HVQC 4BEHB 3ROUA 4BUPA 3I55I 3LL7A 4Y33A 5K7HA 2XGDA 5F27A 1XSDA 2IGNA 1E2XA 4TV7A 1PVEA 3PFYA 4R8HA 4D0PA 5H6QA 2AS5F 1Z67A 3BDDA 1J0RA 2CV2A 1VQ6I 1KQ8A 4GDFA 3RI4A 2DFHA 3PUBA 4DBQA 2VJ4A 5J1UA 2GIZA 2HOAA 4MTDA 3BG9A 4XNFA 2HOEA 1QPMA 1T8IA 4IHVA 4UB8C 1V3FA 1N77A 4V19K 1X58A 1XGSA 1FOKA 2JRTA 1X3ZB 2ECBA 2QQ9A 3NAUA 2Q2EA 2ADUA 2RNJA 3HUGB 4MQ9F 3VODA 4EJUA 2ISYA 2PMHA 3FMSA 4DYQA 5CVVA 2DPDA 5K5RA 1TWCJ 2M7BA 2CMPA 3PO2J 3I64A 1JXSA 1Z21A 4L9TA 1HKSA 2M8EA 2XSDC 2PMZA 4RS8A 2FQ4A 1MH4A 3CCMI 4ZJZA 4LLLA 2A6TA 4B48A 1A35A 3RSNA 4UUSA 1ZYRF 2IA2A 2V9PA 5LBQA 2J5PA 4XSXF 5BNGA 4YRVA 2L7FP 2ZXWH 2CU7A 3CC7I 1MNDA 3LWFA 2JN6A 3FXRA 4IX7A 4UV9A 4E4HA 2DOEA 3KP6A 3G73A 1RZ4A 3MMYB 3H36A 3EYYA 1AWCA 2O0YA 3U2RA 4ZZDA 2UZKA 2FBKA 2WV1A 2E5ZA 4E7SA 1J5YA 5FFZA 5DCMB 3IH4A 3R6SA 1LDDA 3HOYJ 3JSOA 3TP3A 3H92A 3FISA 2VQLA 3BROA 2WAEA 2XROA 2PJPA 2X6WA 1XC5A 6PAXA 4BGDA 4ENNA 2IPQX 4ZZLA 3I56I 3K4CA 2CW0F 2YUSA 1AKHB 2BVMA 2W00A 5GPCA 5M5YJ 2V1DA 4A3CJ 2A5WA 1V5GA 2K4JA 2QVOA 4EEFG 4N9HA 1R23A 4CZZA 1TWAJ 2GA1A 1UMQA 1MIJA 1I50J 4EJVA 3VYRB 3WTTC 1YRNA 4XOTA 4D5CA 1W5TA 4PDKA 4IRIA 4EQQA 2MSYA 2CO5A 3HDDA 2Y69H 2K9QA 1D1BA 3CUQC 1YO5C 3J7AO 2ZNYA 3K2ZA 4ZDLA 5CQEA 3GF2A 3EPZA 2K9MA 4CCKA 4Q5SF 3HM5A 3EYIA 1YS6A 4E7KA 3ABTA 3CC4I 1MJ9A 3MKYB 3HB9A 1TWGJ 5J4YA 3GVAA 2YPRA 1D0XA 2K9SA 3LFUA 2HVSA 4YFNF 3S17J 2IA0A 5DTDA 4NC8A 2NNYA 1V5FA 5J4VA 1MBEA 3MKWB 3F8BA 4UVAA 2VKHA 5H6RA 4E7ZA 1HCRA 1W7PD 2DMTA 4A6EA 2KIFA 1E3PA 4A6DA 2Y0SN 3CJQB 4HV5A 1D0ZA 4II3A 1XSXA 5LHGA 2NVQJ 1WH7A 2KIQA 3KE2A 1FBUA 2IW5A 3LSIA 4C9YA 5L3EA 1K7AA 1NK3P 2P5VA 4BQOA 2XC7A 3IAM2 3OS2A 3ZMUA 2NAZA 3AG3H 3CP2A 1VF9A 4O3MA 3S1MJ 1XCBA 3ABLH 3AG4H 3TP0A 3I4NJ 2XIGA 1Y8RB 4AIHA 3K4LA 4B47A 3D5SC 1DUXC 4JOMA 4M71A 2K27A 1KYZA 1ETOA 4IF4A 2O8XA 1VQMI 1X1BA 2QLZA 2WV0A 3OYDA 1K6YA 4DZJA 5EJCA 1K61A 3KX2A 3M07A 2DDAA 2G7HA 1ZGAA 4XLCA 4KA4A 1FTTA 3KCCA 2LP0A 1EH7A 2OF7A 2PG4A 2M1BA 3ZMSA 4CYDA 3H1CA 3ZRGA 3LNQA 1OYIA 3DF8A 4J00A 3F8CA 1SD6A 3WGGA 1YJWI 2COBA 2LDUA 3LQRA 2FJ1A 4I99C 4YG2F 1SFUA 2R92J 2LLKA 1MZBA 1PYVA 2JSCA 2K3PA 2ZXIA 2X1CA 4Z2YA 2E1CA 2R5ZA 3L2QA 1LNWA 3BTLA 2VKDA 1WRJA 3H5AA 3WTYC 4BXXJ 1XX5A 2DA4A 3HKZN 2IS6A 2KRFA 5FKLA 3JRFA 2H8RA 2ISZA 3OY9A 2QQBA 1MBFA 2R5YB 4IPAA 2LH9A 4CXFA 2IVMA 2B0LA 4M3BA 1VFCA 2Y48A 1I39A 2ID3A 2MABA 2QKMB 1ZGWA 2PEXA 3TMOA 5GAGJ 1XCVA 1BOBA 1UHSA 2BW3A 3G3ZA 2UWMA 3IP4B 1UAAA 3PFIA 1APLC 1FPQA 2G9WA 4II2A 4IHWA 4YELA 1XGOA 3CCYA 1GV5A 2CRGA 4Q4ZF 2OCCH 5HLIA 2DA5A 1SVLA 2XV4S 2FA5A 4G7OF 3CO7C 2CG4A 2NYXA 5JHFA 4JX6A 1RETA 1GXPA 4MEXF 3QPLA 3MZHA 1J09A 1R1VA 3OYGA 4BBSJ 4FQGA 4L5EA 1HF0A 3K1NA 4XOPA 2KZVA 3ZGKA 2EK5A 3T1BA 2OUMA 3CMAI 4A3DJ 1ETVA 2E35A 1IDYA 2OU2A 2GXBA 3O8GA 1A04A 3B02A 3GFMA 1I3QJ 1ETWA 1T6SA 3HIFA 3JCUC 3RCOA 4CZCA 1ZAOA 3GBGA 3P9KA 1IN6A 1IXCA 3LSKA 4O6JA 3QRFF 3TO6A 3BR5A 2P4WA 2O03A 4P9FA 2R7DA 1GHCA 1FZPB 1S29A 3U1DA 2DU9A 1FC3A 1ZK8A 3BG7A 2ZB9A 1S7OA 3LSGA 2V7FA 2LVSA 1E3OC 3GW2A 1D3YA 1SVMA 1TNSA 2M5WA 2MLKA 2HOTA 3KZIC 2D45A 1TWHJ 4XLPF 1B6AA 1XPXA 1U0JA 2HFHA 3WTUC 1LVKA 2L7ZA 4YIFA 1MDMB 4Y15A 3K9TA 3ZQHA 5F0CA 3QODA 3E0JB 2CGPA 3DLLF 5E3MA 3J7AY 1B1BA 4HA8A 5IT9K 4BAYA 2FOKA 2L9RA 4DNCA 1VQ8I 3RDIA 2Q0OA 1QZYA 5KAFC 5E17F 4CO8A 2DXIA 4CYCB 3CMEI 1Z05A 3G6EI 2QKLB 3QWLA 4XRMA 2DFFA 1C0WA 3BTIA 3HOZJ 2Z33A 3OYBA 4RMNA 4UUTA 3RJPA 3I5UA 1U78A 4U88A 2UUZA 3FXKA 3K70C 5K7FA 2MC3A 2CV0A 1DU6A 1ERDA 4OMYA 4L18B 1LB2A 5ILSA 2QBYB 5DCFA 1RRJA 1LE8B 1MSFC 2WBMA 3QOPA 2LMDA 2MA3A 1QVTA 3OS0A 2JUGA 2JVHA 3OR1C 4J01A 1BI2A 1GT0C 3VB2A 1IF1A 2KJCA 5EGOB 1K4TA 3GLLA 5IP6A 2ZCWA 4QTRA 2FX0A 1ZELA 3K4MA 5HS9A 1UJ8A 3RKQA 3ZOBA 3N97A 2LY1A 1ZGJA 4RGXA 1MMAA 5JVGF 2XAGA 3E6MA 1JHFA 2FNPA 3BZ6A 4BDZA 1O4XA 1VQ5I 2NS7A 4OIQF 3FDYA 4KIFA 2IS4A 1YW9A 4M74A 5B5EC 1RI7A 4HOBA 3H3UA 3FXUA 4HG2A 4YFKF 2GQQA 3L00A 1T39A 2OZUA 5F64A 5FLMJ 2DN0A 5DDGA 1K6OA 5EDNA 3KEYA 1U8RA 5GTIC 1CF7B 1DPUA 2FU4A 5FKNA 3VSKA 3I9V2 4KFCA 3R4KA 3B6CA 4GGGA 3ZQFA 1X19A 3HOXJ 1U6GA 4XRSA 4CA0A 1HW1A 2Z3YA 1SFEA 4HPQA 3LSRA 4HF1A 3HPHA 1IAWA 2JT1A 2XAQA 1W7PA 3SQNA 4F91B 4OOIA 3DFGA 1SD7A 1FEXA 3C1DA 4BE2A 2E34A 2Z2SB 4U0WA 4A0ZA 3G71I 4ZTFA 2GOMA 2P0WA 4FX0A 2CV1A 5LGNA 3KIOA 2I5UA 4ITVA 3LSTA 2L01A 4XLEA 2VLAA 3VPRA 2ZJPF 1J9IA 2BXZA 1YX3A 2DT6A 4AD9A 1VQOI 1T0FA 4MHGA 3WG7H 2XF6A 1PUFB 5AIPA 2RDPA 2HKOA 5FD5A 4A0YA 3WU2C 3KZZA 1R1UA 2EFQA 3HOUJ 2E7WA 4XR6A 2DDBA 3SZPA 2IA1A 2ZXHA 3ZMDA 3F6OA 3P5JA 2HQAA 4NQWB 1R6RA 3K4BA 5GAEJ 2HPIA 5FKMA 3OYAA 4EGZA 3KEQA 1I6XA 1X3WB 2RREA 2WADA 2EV0A 5D5UB 2VQHA 1W4MA 1OFCX 3S2HJ 3EDPA 2AXTC 1FJLA 1H88C 2PMZN 1SFOJ 4AVPA 2ZFUA 2K85A 5ICGA 2WC2A 2EIMH 4PJJA 2DK8A 1J7KA 3CLOA 1FIAA 1OCRH 3EUKL 2QSHX 2OTJI 3GO5A 3S93A 2XHKA 5BPIA 1X1DA 4BEHA 2IAIA 2KIMA 2QENA 3Q9SA 2VIXA 4HLXA 4C30A 2IBDA 2JA5J 2HEOA 2NVTJ 4MGRA 2WY8Q 1OLTA 1TQPA 3W3CA 3CO6C 3S3MA 4IO9F 1L3LA 2JA6J 4GXOA 3ZN1A 3M7GA 3FHZA 4UUVA 3QPHA 1KU3A 3F22A 2H6BA 2CUEA 1I6HJ 3E5QA 2F5EA 1QU3A 1SVOA 1QO0D 1ZKGA 3TO7A 3VYTB 1YW8A 4X1EA 2W84A 4PSWA 3VEPA 4S0HB 3FMRA 3H5RA 3FK6A 5KAIC 1BBYA 3TKYA 1IC8A 2ACJA 3M1CA 3KP4A 2CSOA 2BYVE 1YS7A 2K4BA 2V26A 4OINF 2ZBKA 2GXAA 3I0TA 3OOPA 1H9TA 4EM1A 4IQ4A 3T8TA 2E36A 5CKTA 1IW7F 1ENHA 1G8XA 1EV7A 3R61A 4N4NB 1RIOH 4M3EA 2WAQA 1NG6A 1U2WA 5IT9Z 1J2XA 2W4SA 2GIVA 2DK5A 2IJLA 3LSMA 5DUIA 5EG0B 3OYMA 3O2PE 4WCGA 2QGUA 3AG1H 5FFXA 2PI0A 5D4RA 2DMQA 4XSZF 5HS8A 2IXSA 1KGSA 2STWA 2QYOA 3KP3A 1QVUA 4YIIA 3OYJA 5IYDJ 3N05A 1XMKA 4K2EA 1BA5A 1U9OA 4BXFA 1P9QC 3WODF 4F92B 3DPLC 2DLLA 2HXIA 5DCMA 2ZMEB 1WH5A 3DTEA 3I59A 1R9TJ 1F5TA 2BGCA 3MZ8A 2JSPA 2COMA 4HX4A 1QA6A 1WJCA 4C3HJ 4KMFA 3FWEA 2E2JJ 4CCNA 3CD6I 1TP4A 3GX4X 3OYLA 4HX8A 3TL4X 3IL2A 1YFHA 3CCSI 2FMLA 5FROA 3PSIA 3UNGC 2NOJB 4PSXA 1R71A 3GYHX 2JK3A 1DQUA 2BVLA 2GLOA 5AONA 3KETA 1OCCH 1RUNA 3CCQI 1MBHA 3DEWA 3OIQA 2F5FA 1S5LC 1B9MA 4A2UA 4WXDA 4DQ2A 3H3ZA 2GA2A 3S1NJ 2R7FA 1BL0A 3MN2A 2VQCA 4I09A 2B9SA 1MNEA 4J19A 2BY2A 2ID6A 4BQNA 2P7CB 3CQZJ 4YIRX 3IKTA 1P4WA 4XKCA 2DPUA 5HNFA 3O3KA 4HQMA 1B8IB 1XMAA 2ELKA 2DJIA 1VI0A 1A36A 2QEXI 4DBRA 1XGMA 1XDUA 2JMWA 3V4GA 3JRGA 1WZ2A 4P5OA 4C3JJ 2R7UA 3J81Z 1YOVB 1REPC 1MD0A 3OR2C 4M3DA 5DS9A 1G3SA 3VYUB 2IP2A 5C4JJ 2X85A 4F7ZA 3OIPA 1HLVA 2XDVA 4U87A 5E20A 1OKRA 4O5VA 3AFHA 3WGHA 1MMSA 4X6AJ 4IXAA 4M6VA 3HYIA 2A5YB 2BE5F 2X6XA 4LK0F 2PJRB 2FMYA 1USSA 3RYPA 1M1EB 1KU9A 4GYIA 4QSHA 1W5CC 1EF4A 2Y9YA 2GZWA 2HTSA 5BOXA 4U0YA 3C3WA 3L9FA 2I10A 3DV8A 3QP5A 4XL9A 4L0ZB 2JZYA 2IGKA 4E70A 1HQCA 3LQQA 3M4OJ 3PM1A 5FJ8J 3FHNA 3TDUC 4IKFA 4LITA 3JW4A 1UG0A 3L2CA 4D9JA 1AU7A 3Q9VA 2M30A 4IJAA 2R7WA 2A05A 2V6EA 2QCOA 1FYMA 4FX4A 3GTLJ 2HYFA 4ETSA 3L1PA 4KYWA 4JP0A 2JUCA 3F8MA 3RZOJ 1IN8A 2OQRA 3CDIA 3GTMJ 2DFEA 3HBLA 3S8PA 1X1AA 2VC0A 2H8WA 1BI1A 3CMMA 1FP1D 4EMSA 2WB1A 3E5UA 2ZC2A 3DPTA 2DA1A 1Y39A 1WGXA 3CUQB 4N9IA 5BMZA 3CCLI 3I54A 3M8EA 2LKXA 1IN7A 2ESNA 4HV6A 3RPQA 1XDSA 1HSJA 3SYTA 1JTYA 3OWTA 2HKXA 4I76A 4QWQA 4UVCA 3FF5A 5GTHC 3PSFA 4JYKA 2CWEA 3SHFA 1XTAA 3HOSA 1ZARA 5ERIA 4A3GJ 1QZZA 2G7UA 2BHYA 5EYRA 2EBIA 1LJ9A 1SFKA 2DA3A 4PUSA 3G2BA 2CYYA 1T33A 1FNNA 1FBQA 1ULYA 4S05A 3N4MA 1LFPA 2XAHA 4A3FJ 4PGGA 1XD7A 1TL8A 3RQIA 1HSTA 2HGCA 5IT3A 2R93J 2R7ZJ 4MIMA 1WWXA 4BKXA 4PFOA 3CC2I 2E1OA 4ZYEA 2KISA 1UZCA 2DOFA 4KN7X 4N4OB 3S1QJ 3RIRA 3DWLE 3JRCA 3JSPA 1S7EA 5HLTA 2EZHA 2DBBA 2IS2A 5L3DA 4I0BA 4XORA 2DMPA 4ZDPA 4CCOA 2DA2A 5H20A 2RC4A 1RPWA 1W0TA 3OV8A 4WX9A 1U3EM 2X51A 3OYKA 1QHHD 3GFIA 5LHHA 4KN4X 3FMQA 2Z5UA 3WTVC 3M9AA 3QU6A 4BS9A 2A3SA 2FNAA 2H1LA 4DYRA 3TO9A 1XMXA 2EQRA 3GZ5A 4XKBA 2R0QC 4A3LJ 1D1AA 2ZJRF 4IRGA 2XB0X 3SFZA 3JAMK 3E97A 4PJMA 4YEJA 3RYRA 2Y75A 5ILUA 3BQZA 3ZMVA 5CYVA 1YJNI 2DYSH 4B43A 1KQ9A 2EA2A 3WU1B 1PJRA 3K1MA 2CQ7A 3H9JA 3LA2A 4BE0A 2K3FA 2LK2A 5F08A 1D5VA 4B3AA 4W97A 2B7EA 2Y30A 4B09A 2QZ8A 5FO5A 2P7VB 2LNBA 4PK4A 2KFDA 2V4JC 4R79A 4AIJA 3GTQJ 4RGUA 3COAC 3GWZA 3Q5FA 1R49A 2QWWA 3M8FA 3RTRA 3A2KA 2RVCA 3F6VA 1MDMA 4XQFA 2OAZA 2X6OA 1FMWA 3DKWA 2XGXA 1ZRFA 4EATA 3IH3A 2DYRH 2LD5A 1D1CA 3A01A 4S04A 1P92A 2Q2EB 1Z6TA 2IT0A 1ACIA 2BV6A 1I5ZA 3E6CC 2BY1A 1WPKA 5HOOA 2DQLA 2XB5A 4DGWB 3KYDB 3FXMA 1F36A 3HRUA 3H9GA 1KQ0A 1Y1VJ 3ZP5A 4CYCA 2NRAC 4NNJA 2L7MP 4ESJA 3IWZA 4ZYAA 3EUHA 3JTHA 3CZ6A 3JRDA 2O6GE 2R7XA 2K86A 3NWTA 4LG3A 1A31A 2VQGA 1Z1DA 2G0EA 3HTUA 4UUSB 2A07F 3PO3J 2AHQA 3HC7A 4Y13A 2DO7A 2X9DA 2RKHA 5DYMA 1MH3A 4IQJA 1PUEE 5DM6F 2HDCA 5KNLA 1FSHA 1LE8A 4OIRF 1F43A 1TW2A 3CJTB 2A69F 3V8JA 1TQMA 3F23A 1Z3XA 2MD0A 1QPIA 2XF7A 4OU0A 2TCTA 2IGMA 1OQYA 4A3MJ 1VQNI 4KIBA 4A69C 4F52A 2OV7A 3CF5F 3ASNH 2BY3A 2Y0MA 1Z91A 3TOAA 3IV5A 2HR3A 4XONA 3R60A 4RAGA 1OYYA 2RNGA 2UV1A 1G3YA 1SAXA 3DKXA 5E3NA 1BR2A 1G2HA 2Z1DA 1P4XA 4XRFA 4GRIA 2OTLI 3IRRA 1JE8A 3GLXA 4HYEA 3GMEA 4BQAA 1I1SA 1PDNC 3I3LA 2NXNB 2L3DA 3HSEA 3OIOA 1LQ1A 3SZTA 4M3FA 4C2MJ 1BW6A 3K0LA 2WA0A 5ICFA 1WJDA 1YRNB 1HKQA 5CVRA 4KT6A 2KRCA 3KZYA 5F0HA 2HYJA 1SMTA 3BPXA 3MQ0A 1V4RA 4ENJA 2E1MC 3HZJA 2LSOA 1A6QA 3QOEA 1BI0A 2YX4A 2ZSIB 1GDTA 3A0BC 3A1YA 4I02A 1W1WE 3M3YJ 1D5YA 1VTNC 2BY0A 3ABKH 1DP3A 2K40A 2OPTA 5E1ZB 3L2RA 1ETQA 1JKQC 3J7ZI 4Q48A 4JX5A 4BYYA 5DV5A 5LRRA 1R5GA 2QSFX 2XGCA 3V7CA 1JI8A 2QA4I 1JT0A 1KU7A 2VB6A 4CCLA 3E7LA 2AXLA 1WI9A 1MBGA 2CQQA 4V2FA 4UV8A 3ULQB 1JJ6C 2Y9ZA 1SANA 3F8NA 1K78B 2LFBA 3ZR8X 3BY6A 5CQGA 1PUFA 4FCYA 1HOMA 1RUOA 4BJTA 1NG7A 1WI3A 1S9HA 5E3OA 1B9NA 3RKYA 3F8FA 5JHUA 4LD5A 1AOYA 3OYFA 5D4SA 3MKZA 3LSJA 5M3MJ 2Z99A 4HZFA 1S3JA 3L2WA 3F3XA 3GFLA 2NS8A 3K7AJ 1ZR4A 4NQWA 2C6YA 4OMZA 2P6TA 5EF6A 2DMUA 3KEOA 4HQEA 4AM3A 3K4NA 3DU5A 1SEUA 5L3FA 3BP8A 3V7RA 2FSWA 3BWGA 1JUMA 5LHIA 3HGYA 2LREA 2VXDA 2QQ8A 2XVCA 3BZKA 1GLNA 1ZHFA 4HNTA 2WAQN 4FHTA 4XLFA 4CH7A 4XLHA 2ZNZA 4DJAA 1CQTA 2VOPA 2IEKA 1WQ2A 2X6YA 5E8IA 1B4AA 2F4MB 3MKLA 3QU3A 2O8KA 4XMYA 2PFBA 1ZN2A 2EFNA 4R1HA 2VE8A 4M9SA 1MGTA 1BC8C 2OCEA 2KIUA 1ON1A 4HF0A 2EINH 1G59A 3AG2H 3JAMZ 2V1XA 3MAJA 3HPGA 2WWYA 4ZTJA 1ITYA 1XGNA 2HOSA 1YYVA 2R5ZB 2JA2A 3BT9A 4DW6A 1ONVA 3WG9A 4BL0B 1ZG1A 4RGSA 3S32A 1RESA 2E5NA 5IYBJ 1LFUP 1ETYA 4Y52J 3OL4A 2XSJC 3MD2A 5B3SH 4PFPA 2KL4A 1R36A 4P55A 1Y1WJ 2ZJQF 2LRDA 3X2QH 2JA7J 3FX3A 2D1VA 4GYGA 2VBWA 5C3EJ 2O5RA 2XGEA 3J7YJ 4LB5A 3I58A 1J59A 5GP9A 1IUYA 1R58A 3EUHC 4RB0A 3BLYA 2VBZA 3DTKA 1S8NA 3IWFA 3ML6A 3QYEA 4HEA2 4EGYA 2H1KA 3VYSB 4WK8F 2O3FA 4CUGA 3ZQLA 5CPRB 1R5ID 4XICA 1ZH5A 4WF2A 1LUJB 2F48A 1EH8A 5IYCJ 2QQAA 2H27A 2L4AA 2ICWG 2WY7Q 5HLHA 1YE9A 2M4GA 5J1RA 1HW5A 3LSPA 4BY1J 1BIBA 2EFOA 2CUZA 1OCZH 2H94A 4L0YB 1D8JA 2MLGA 4BHCA 4XK4A 1K83J 3GTJJ 3VFZA 1EH6A 5JFRA 5DUKA 2TRTA 2LF7A 2DA7A 3BC8A 4KITB 1WVRA 1RKTA 1G3WA 5HDKA 2L2OA 3A02A 5C4XJ 5KK1A 2M8GX 2YX7A 4HX7A 4KUMA 4LLNA 1Y8QB 2ZMEA 1FLIA 4EJWA 5JLXA 1BM9A 2KT0A 3W2VA 2R3SA 3HSFA 1TT0A 4H4KC 4CSWA 5D5VB 2HYGD 1VQPI 1NHAA 2F5VA 4Y7NJ 2RQPA 1S6LA 5IOZA 3SDBA 5B66C 1IGNA 1EKEA 3HTSB 1OJLA 4PJLA 1NTCA 3I4MJ 2M87A 1X3UA 4D7NA 4UNOA 2CJJA 2R7TA 3DQVC 3IUOA 2VASA 3P9IA 4OWRB 3C2HA 3ZPLA 1XSVA 2UXNA 3RPUD 1ORKA 3K4KA 4L9JA 1OR7A 1RR8C 2XKPA 2K02A 1H9GA 2W82A 1P7JA 3OMYA 5D5XB 3S3OA 2V1NA 4F93B 2W85A 2GM4A 1R1TA 4XRSG 1IN5A 2BBYA 2M0CA 2AO9A 1B72B 4E7HA 2KLOA 4HBLA 1JKPC 1MNMC 3C7JA 3L2UA 4FE7A 1U5TB 5F1JA 2XPWA 2X1EA 4DOZA 5HNHA 1YLFA 4G94A 2DMNA 4G7HF 1A5JA 1OCPA 1YITI 9ANTA 1R4MB 2XAJA 1B8IA 2W24A 2RV8A 2V6CA 1OCTC 3IHUA 3A4CA 3CTAA 1T98A 1KZHA 3UKGA 3S15J 4A0XA 4C3IJ 3PJRA 2WB1N 2BOLA 3DEUA 4M9XA 5FKKA 2QF7A 2NVYJ 2FEZA 5J8FA 1RC9A 3W6JB 5EEAA 2M45A 5E1WA 2MFZA 3H9QA 4D5FA 3WHBA 3ASOH 2ECCA 1FOWA 5DD4A 1BR4A 3M8JA 2K9LA 3MEXA 1W0UA 3HUGA 5EEGA 3BQYA 2VBXA 3E1SA 3K4JA 4KNYA 4I01A 1X4PA 3D0SA 4UXNA 1QQIA 2LBFB 3BR0A 3K70D 2K7LA 3DXJF 3NWSA 1SAUA 4HAMA 2V1UA 5F1RA 2ME0A 2VN2A 5J40A 5A2QK 1WJEA 2V9VA 3HJEA 3SEQA 4LB6B 1UHMA 1F4KA 2XF5A 2M0MA 1QGPA 2VUMJ 3HOTA 3LSHA 3GCMA 3V42A 2DA6A 2A68F 3S2DJ 1R5HA 1V54H 5ICEA 4X0GA 3KFWX 4IHYA 1D8KA 2BEOA 3CF2A 4WXCA 1WFXA 4ESBA 3JRHA 4QIWN 4B4CA 4A3JJ 2PMUA 5HODA 4A3EJ 3CUQA 2A61A 1GVDA 4A12A
chains in the Genus database with same CATH topology
4M73A 1Z7UA 2NNNA 2XKOA 4OIPF 4U0VA 1W7PB 1E17A 2ELHA 1YQAA 2HS5A 3NEUA 4MTEA 4EV0A 5TRDA 3ISPA 1H0MA 5L3GA 5CVUA 5JVTA 5D6FA 3FM5A 1HXDA 3TGNA 2ZFWA 2PLYA 1FSEA 4L5JA 2P5KA 4EM0B 4I98B 1MJAA 3BJ6A 3V7SA 3BOQA 3AAFA 2EFPA 5FLXK 3L09A 4Q47A 5CJ9A 3LAPA 3IRQA 3F21A 1SD5A 1SMYF 3KLNA 2VODA 4L9NA 1ON2A 3E6DA 1RNLA 5HDGA 5J8CA 3DP7A 3KP2A 3GFJA 4LGWA 3T5XA 4CHUA 3E3VA 1FWZA 1TNTA 1LDJA 4KMUX 3IKVA 1R7JA 1O3SA 2VT3A 2H6CA 2FXAA 3GXOA 3E6BA 1TLHB 2Z9OA 1WKMA 3B73A 4U7BA 5LEJA 1IRGA 4LG0B 2QUFA 2NS0A 5LEKA 3QP6A 4U7DA 4RAYA 2ZO4A 2ESHA 1SD4A 5ILVA 2HQNA 2QM3A 4FT8A 1FP2A 5TJJA 1KU2A 2F2EA 3S2WA 1ZRDA 2DQRA 1R22A 5ICCA 3VOEA 3TOBA 3CDHA 1Z6RA 1Q1HA 2EA4A 5HLGA 4RB2C 5LLQA 3LFKA 3I59B 2E1NA 2STTA 2LKPA 1ZLKA 3RPUA 4YFXF 4RGRA 1PP7U 2DAOA 2DTRA 4M72A 3WU0A 4PGHA 3ZN0A 1MJBA 2DFIA 3T8RA 2Q8KA 4EJTA 2EV6A 2VBYA 3NRVA 1L0OC 2UXXA 5A2QZ 2D1HA 2DI3A 4CICA 4UHTA 1ZREA 1ZG5A 3KP7A 2FRHA 4MEYF 3WE2A 3SXYA 4CGZA 2X0LA 3CJNA 5KVRA 5K5QA 2V79A 4JBAA 3GZ6A 2O61A 2FBHA 2YSRA 3FZVA 2MH2A 2YR2A 1K78A 4ZH4F 4KIGA 1I27A 4PZJA 4BHPA 2A6HF 2HQRA 5L3CA 3P9CA 1K79A 4ASNA 2ZXJA 3NQOA 1TW3A 3BPVA 2XASA 1ZRCA 3E5XA 1O7LA 3QAHA 4ENMA 5CVJA 5CVIA 5ED4A 4NB5A 1XB4A 3QPTA 3TQNA 1O3TA 2VC1A 3MCZA 1FYKA 4RAZA 5LGTA 2P5LC 5J6XA 5FLXZ 4RB3C 2QBYA 3WTWC 2EFWA 2ZJ2A 3ABUA 4LJZF 2OZ6A 3J80K 3R0AA 5E18F 2CQKA 2A6EF 1YG2A 4M6XA 1TBXA 2GAUA 2PBIA 4GO1A 2MBFA 2X4HA 3K69A 3MZYA 1R00A 1I1GA 2RGVA 2WTEA 4M6YA 1CF7A 1IXSB 2ZKZA 1LEAA 2VXZA 3M1EA 4G6DA 4LFUA 3LA3A 1FBSA 1J75A 5E8GA 4G7ZF 4MNUA 3BJAA 4L9VA 3V8KA 4HDUA 1KA8A 2L54A 5D6EA 3D5LA 4L5IA 5BPDA 1S7AA 3ECHA 1F9NA 2F5CA 3I4PA 3JTGA 2L02A 3GEZA 1SFXA 4I7HA 2E7XA 2KJBA 3ELKA 3BJOA 2MD5A 1FY7A 3WTXC 1T2KA 1JGSA 5D5WB 1UFMA 3GUDA 1Z9CA 4WXHA 3K1PA 3P7NA 2MH9A 4BHBA 3KP5A 5L3BA 1O3RA 3PQJA 3ERED 2PN6A 4PCQA 3FM3A 1BC7C 1ZG3A 2EV5A 4AIKA 1U5TA 1YW7A 4UVBA 2TDXA 2FF4A 2J5OA 2HWVA 3U9GA 5AIQA 3KLOA 3WTSC 1O3QA 2F5DA 1USTA 5HS7A 2RN7A 3F72A 4MQVA 2ETHA 5CLSA 3HRTA 3T0YA 1DDNA 1LDKB 4KDPA 1UB9A 4P96A 1O57A 1BJAA 1MKMA 2GWRA 3LAJA 4ENKA 4GCVA 4BNCA 4XLNF 4N0BA 4WWCA 1JHHA 3I71A 1ODDA 3REOA 3I53A 4KICA 1YTYA 3ZMTA 3W6KB 4H0EA 2EJRA 4LLGF 1FT9A 2XUBA 3MFKA 2GXGA 4IVNA 1STZA 5FD6A 4P9UA 4ZYDA 1G3TA 4JQFA 3V8LA 2FE3A 2LF8A 3HSRA 1OMIA 2OBPA 2W57A 3J81K 3C18A 4EVIA 4NHJA 1PP8F 4ESFA 2JPCA 3J80Z 5LGUA 2VOOA 5K5OA 1GXQA 1CGPA 4A5NA 3RKXA 5EEHA 4ZYHA 3EQLF 1FYLA 1BI3A 2IRFG 2VONA 4XBFA 2CFXA 4ZYGA 1FX7A 1OYWA 1YIOA 3WGIA 5DEQA 5BS6A 1ZLJA 1HKTA 2W25A 1BN5A 4AWXB 5HDNA 1IZ1A 4EM2A 4M9ZA 1QNTA 1W5SA 5BQTA 3ECOA 4OIOF 4BXUA 3TDZC 1T38A 1OPCA 4G8XA 2FBIA 2DT5A 4I0AA 4G6QA 1KYWA 4EJOA 3EETA 5K1YA 4LK1F 2JPBA 3MWMA 1IXRC 2H09A 5E1XA 5LRSA 1DPRA 5DD8A 1GVJA 3WTZA 2JTVA 3LA7A 4ON0A 3HRSA 1B59A 4IRHA 3HHHA 5JR3A 1O7FA 2FQ3A 1HW2A 1U5TC 3L7WA 3CUOA 3FXQA 1QBJA 1TTYA 2XAFA 4LG0A 5D8KB 2L4MA 2VE9A 4G9YA 2KKOA 3WE3A 3R0JA 4QLCU 4CDGA 2OA4A 1IRFA 3PQKA 1G4DA 5FGMA 1UCRA 1XN7A 1P6RA 1P2FA 2YU3A 2VT2A 2D2WA 1LVAA 1TQIA 5F6FA 4RB1A 5FB2A 3ZQ7A 4LMYA 1BOAA 2EWNA 4BH9A 1DP7P 2P6SA 3HHGA 2XRNA 1Y0UA 1IN4A 4Y17A 1HBXG 4HLYA 4KT5C 1WSUA 2EB7A 1G6NA 2OQGA 4HDVA 4JK1X 2OD5A 1LEBA 4A5MA 4HW0A 3RKWA 1P4AA 4IHSA 5D8LB 3HRMA 4IHTA 1BIAA 3ZMZA 4HF2A 4B8XA 1UHWA 5JI6A 2DW4A 2PQ8A 3IC7A 4I2OA 1F1ZA 3O6BB 2HZTA 2HTJA 2P8TA 5HVQC 3ROUA 1XSDA 1E2XA 4TV7A 4R8HA 4D0PA 5H6QA 2AS5F 3BDDA 1J0RA 1KQ8A 3RI4A 4MTDA 2HOEA 1QPMA 1V3FA 1XGSA 1FOKA 2JRTA 2QQ9A 2Q2EA 2ADUA 2RNJA 4EJUA 4MQ9F 3VODA 2ISYA 2PMHA 3FMSA 5CVVA 2DPDA 5K5RA 3I64A 1JXSA 4L9TA 1HKSA 2M8EA 4RS8A 4LLLA 1ZYRF 2IA2A 5LBQA 2J5PA 4XSXF 3LWFA 3FXRA 4UV9A 3KP6A 3G73A 1RZ4A 3EYYA 1AWCA 2O0YA 3U2RA 4ZZDA 2UZKA 2FBKA 1J5YA 5FFZA 5DCMB 3R6SA 1LDDA 3JSOA 3H92A 3BROA 2XROA 2PJPA 6PAXA 4ENNA 2IPQX 4ZZLA 2CW0F 2V1DA 2K4JA 2QVOA 4N9HA 1R23A 4CZZA 4EJVA 2GA1A 3WTTC 1W5TA 4PDKA 4IRIA 4EQQA 2CO5A 3CUQC 3J7AO 1YO5C 2ZNYA 3K2ZA 3GF2A 4Q5SF 3EYIA 1YS6A 3ABTA 1MJ9A 3GVAA 2YPRA 4YFNF 2IA0A 2NNYA 3F8BA 4UVAA 5H6RA 1W7PD 4A6EA 2KIFA 4A6DA 4HV5A 1XSXA 5LHGA 3KE2A 1FBUA 2IW5A 5L3EA 1K7AA 2P5VA 3ZMUA 2NAZA 4O3MA 1XCBA 2XIGA 4AIHA 1DUXC 4M71A 2K27A 1KYZA 4IF4A 2O8XA 2QLZA 2WV0A 2G7HA 1ZGAA 4KA4A 3KCCA 1EH7A 2PG4A 2M1BA 3ZMSA 4CYDA 1OYIA 3DF8A 3F8CA 1SD6A 3WGGA 2LDUA 3LQRA 4YG2F 1SFUA 1MZBA 2JSCA 4Z2YA 2E1CA 1LNWA 1WRJA 3WTYC 2KRFA 2ISZA 2QQBA 4IPAA 4CXFA 2IVMA 2B0LA 2Y48A 2PEXA 1XCVA 3G3ZA 2UWMA 3PFIA 1FPQA 2G9WA 1XGOA 4Q4ZF 5HLIA 2XV4S 2FA5A 4G7OF 3CO7C 2CG4A 2NYXA 1GXPA 4MEXF 3MZHA 1R1VA 3K1NA 2EK5A 3T1BA 2OU2A 2GXBA 1A04A 3B02A 3GFMA 3HIFA 1T6SA 1ZAOA 3P9KA 1IN6A 1IXCA 4O6JA 3QRFF 3TO6A 2P4WA 2O03A 4P9FA 2R7DA 1GHCA 1FZPB 1S29A 3U1DA 2DU9A 1FC3A 1S7OA 3GW2A 1D3YA 1TNSA 2M5WA 2MLKA 2D45A 4XLPF 1B6AA 2HFHA 3WTUC 4YIFA 1MDMB 4Y15A 3K9TA 2CGPA 1B1BA 4HA8A 5IT9K 4BAYA 2FOKA 4DNCA 3RDIA 2Q0OA 1QZYA 5E17F 4CO8A 1Z05A 1C0WA 2Z33A 3RJPA 3I5UA 1U78A 4U88A 2MC3A 4OMYA 4L18B 1LB2A 5ILSA 2QBYB 5DCFA 3QOPA 2MA3A 1BI2A 1IF1A 3VB2A 2KJCA 2ZCWA 5HS9A 3N97A 1ZGJA 4RGXA 2XAGA 3E6MA 1JHFA 2FNPA 3BZ6A 4OIQF 4KIFA 1YW9A 4M74A 1RI7A 4HOBA 3H3UA 3FXUA 4YFKF 2GQQA 3L00A 1T39A 2OZUA 5F64A 5DDGA 1K6OA 1U8RA 1CF7B 1DPUA 2FU4A 4KFCA 3R4KA 4GGGA 1U6GA 1HW1A 2Z3YA 1SFEA 4HF1A 1IAWA 2JT1A 2XAQA 1W7PA 3SQNA 4OOIA 3DFGA 1SD7A 3C1DA 4U0WA 4A0ZA 4FX0A 5LGNA 3LSTA 2L01A 1J9IA 4AD9A 1T0FA 4MHGA 5AIPA 2RDPA 2HKOA 5FD5A 4A0YA 3KZZA 1R1UA 2EFQA 2E7WA 3SZPA 2IA1A 3ZMDA 3F6OA 4EGZA 3KEQA 1I6XA 2EV0A 5D5UB 1W4MA 3EDPA 4AVPA 5ICGA 2WC2A 2DK8A 1J7KA 3CLOA 3GO5A 2XHKA 5BPIA 2KIMA 2QENA 3Q9SA 4HLXA 2HEOA 4MGRA 1TQPA 1L3LA 3CO6C 4GXOA 3ZN1A 3M7GA 3FHZA 4UUVA 3QPHA 1KU3A 3F22A 2H6BA 3E5QA 2F5EA 1QO0D 3TO7A 1YW8A 2W84A 3VEPA 3FMRA 1BBYA 3TKYA 2ACJA 3KP4A 2CSOA 2BYVE 1YS7A 2K4BA 4OINF 2ZBKA 3I0TA 3OOPA 1H9TA 4EM1A 3T8TA 1IW7F 1EV7A 3R61A 1RIOH 1U2WA 5IT9Z 1J2XA 2GIVA 2DK5A 2IJLA 5DUIA 3O2PE 4WCGA 5FFXA 2PI0A 5D4RA 4XSZF 5HS8A 1KGSA 2STWA 2QYOA 3KP3A 4YIIA 1XMKA 4K2EA 3WODF 3DPLC 2DLLA 5DCMA 1F5TA 2ZMEB 3I59A 2BGCA 2COMA 4HX4A 4KMFA 3FWEA 3GX4X 4HX8A 3IL2A 1YFHA 2FMLA 3GYHX 5AONA 3KETA 1RUNA 2F5FA 1B9MA 4A2UA 4WXDA 4DQ2A 3H3ZA 2GA2A 2R7FA 4I09A 2P7CB 3IKTA 1P4WA 2DPUA 3O3KA 4HQMA 1XMAA 1XGMA 1XDUA 3V4GA 4P5OA 3J81Z 1REPC 1MD0A 1G3SA 2IP2A 4F7ZA 5E20A 1OKRA 4O5VA 3WGHA 4IXAA 3HYIA 2A5YB 2BE5F 4LK0F 2FMYA 1USSA 3RYPA 1KU9A 4GYIA 2GZWA 2HTSA 5BOXA 4U0YA 3C3WA 3L9FA 3DV8A 3QP5A 4L0ZB 2JZYA 4E70A 1HQCA 3LQQA 3TDUC 3JW4A 3L2CA 3Q9VA 2M30A 4IJAA 1FYMA 4FX4A 2HYFA 4ETSA 4KYWA 3F8MA 1IN8A 2OQRA 2VC0A 1BI1A 1FP1D 4EMSA 3E5UA 3DPTA 3CUQB 4N9IA 5BMZA 3I54A 3M8EA 1IN7A 2ESNA 4HV6A 3RPQA 1XDSA 1HSJA 2HKXA 4QWQA 4UVCA 3FF5A 2CWEA 3SHFA 3HOSA 1ZARA 5ERIA 1QZZA 2G7UA 1LJ9A 2CYYA 1FNNA 1FBQA 1ULYA 4S05A 3N4MA 2XAHA 4PGGA 1XD7A 1HSTA 2HGCA 5IT3A 1WWXA 4ZYEA 4KN7X 3RIRA 3JSPA 2DBBA 5L3DA 4I0BA 5H20A 2RC4A 3OV8A 4WX9A 1U3EM 3GFIA 5LHHA 4KN4X 3FMQA 2Z5UA 3WTVC 3M9AA 3QU6A 2A3SA 2FNAA 3TO9A 3GZ5A 4IRGA 3SFZA 3JAMK 3E97A 3RYRA 2Y75A 5ILUA 3ZMVA 5CYVA 1KQ9A 2EA2A 3WU1B 3K1MA 3LA2A 1D5VA 4B09A 2QZ8A 5FO5A 2P7VB 2LNBA 4R79A 4AIJA 4RGUA 3COAC 3GWZA 3Q5FA 2QWWA 3M8FA 3RTRA 2RVCA 3F6VA 1MDMA 2OAZA 3DKWA 2XGXA 1ZRFA 4S04A 1P92A 1Z6TA 2IT0A 2BV6A 1I5ZA 3E6CC 5HOOA 2DQLA 3HRUA 1KQ0A 3ZP5A 2NRAC 4ESJA 3IWZA 3EUHA 3JTHA 2O6GE 2K86A 1Z1DA 3HTUA 2A07F 4Y13A 2DO7A 2RKHA 5DYMA 1PUEE 2HDCA 1FSHA 4OIRF 1TW2A 2A69F 3V8JA 1TQMA 3F23A 4OU0A 4KIBA 2Y0MA 1Z91A 3TOAA 2HR3A 3R60A 1OYYA 1SAXA 1G3YA 1P4XA 4XRFA 3IRRA 1JE8A 3GLXA 4HYEA 4BQAA 1I1SA 1PDNC 1LQ1A 3HSEA 2L3DA 3SZTA 3K0LA 5ICFA 1HKQA 5CVRA 3KZYA 1SMTA 3BPXA 3MQ0A 1V4RA 4ENJA 2LSOA 1BI0A 2YX4A 4I02A 1VTNC 5E1ZB 4Q48A 4BYYA 5DV5A 5LRRA 1R5GA 3V7CA 1KU7A 2AXLA 1WI9A 3ULQB 4UV8A 3F8NA 1K78B 3BY6A 1RUOA 1B9NA 3RKYA 3F8FA 5JHUA 4LD5A 1AOYA 5D4SA 2Z99A 4HZFA 1S3JA 3F3XA 3GFLA 4NQWA 2C6YA 4OMZA 2P6TA 3KEOA 4HQEA 5L3FA 3BP8A 3V7RA 2FSWA 3BWGA 5LHIA 2XVCA 1ZHFA 4FHTA 2ZNZA 2VOPA 1WQ2A 5E8IA 1B4AA 3QU3A 2PFBA 1ZN2A 2EFNA 4R1HA 2VE8A 4M9SA 1MGTA 1BC8C 2KIUA 1ON1A 4HF0A 3JAMZ 2V1XA 3MAJA 2WWYA 1XGNA 1YYVA 1ONVA 3WG9A 1ZG1A 4RGSA 1R36A 4P55A 3FX3A 2D1VA 4GYGA 2VBWA 4LB5A 3I58A 1J59A 1IUYA 1R58A 4RB0A 3ML6A 2VBZA 3IWFA 1S8NA 4EGYA 4WK8F 2O3FA 1ZH5A 4WF2A 1EH8A 2QQAA 2H27A 2L4AA 5HLHA 1HW5A 1BIBA 2EFOA 2H94A 4L0YB 1D8JA 2MLGA 4BHCA 3VFZA 1EH6A 5JFRA 5DUKA 2LF7A 1G3WA 5HDKA 5KK1A 2YX7A 4HX7A 4KUMA 4LLNA 2ZMEA 1FLIA 4EJWA 1BM9A 5D5VB 2R3SA 3HSFA 2HYGD 1NHAA 2RQPA 1S6LA 3HTSB 2M87A 1X3UA 4UNOA 3DQVC 3P9IA 3ZPLA 1XSVA 2UXNA 4L9JA 1OR7A 2XKPA 2K02A 1H9GA 5D5XB 2W85A 1R1TA 1IN5A 2BBYA 4HBLA 3C7JA 1U5TB 1YLFA 4G94A 4G7HF 2XAJA 2W24A 2RV8A 2V6CA 3IHUA 3CTAA 1T98A 4A0XA 3DEUA 4M9XA 2FEZA 5J8FA 3W6JB 2M45A 5E1WA 5DD4A 3MEXA 3HUGA 5EEGA 2VBXA 4KNYA 4I01A 3D0SA 4UXNA 1QQIA 2K7LA 3DXJF 4HAMA 2V1UA 5F1RA 2VN2A 5A2QK 2V9VA 4LB6B 1UHMA 1F4KA 1QGPA 3HOTA 2A68F 1R5HA 5ICEA 3KFWX 1D8KA 2BEOA 4WXCA 4ESBA 2PMUA 3CUQA 2A61A 4A12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M73 A;  1Z7U A;  2NNN A;  2XKO A;  4OIP F;  4U0V A;  1W7P B;  1E17 A;  2ELH A;  1YQA A;  2HS5 A;  3NEU A;  4MTE A;  4EV0 A;  5TRD A;  3ISP A;  1H0M A;  5L3G A;  5CVU A;  5JVT A;  5D6F A;  3FM5 A;  1HXD A;  3TGN A;  2ZFW A;  2PLY A;  1FSE A;  4L5J A;  2P5K A;  4EM0 B;  4I98 B;  1MJA A;  3BJ6 A;  3V7S A;  3BOQ A;  3AAF A;  2EFP A;  5FLX K;  3L09 A;  4Q47 A;  5CJ9 A;  3LAP A;  3IRQ A;  3F21 A;  1SD5 A;  1SMY F;  3KLN A;  2VOD A;  4L9N A;  1ON2 A;  3E6D A;  1RNL A;  5HDG A;  5J8C A;  3DP7 A;  3KP2 A;  3GFJ A;  4LGW A;  3T5X A;  4CHU A;  3E3V A;  1FWZ A;  1TNT A;  1LDJ A;  4KMU X;  3IKV A;  1R7J A;  1O3S A;  2VT3 A;  2H6C A;  2FXA A;  3GXO A;  3E6B A;  1TLH B;  2Z9O A;  1WKM A;  3B73 A;  4U7B A;  5LEJ A;  1IRG A;  4LG0 B;  2QUF A;  2NS0 A;  5LEK A;  3QP6 A;  4U7D A;  4RAY A;  2ZO4 A;  2ESH A;  1SD4 A;  5ILV A;  2HQN A;  2QM3 A;  4FT8 A;  1FP2 A;  5TJJ A;  1KU2 A;  2F2E A;  3S2W A;  1ZRD A;  2DQR A;  1R22 A;  5ICC A;  3VOE A;  3TOB A;  3CDH A;  1Z6R A;  1Q1H A;  2EA4 A;  5HLG A;  4RB2 C;  5LLQ A;  3LFK A;  3I59 B;  2E1N A;  2STT A;  2LKP A;  1ZLK A;  3RPU A;  4YFX F;  4RGR A;  1PP7 U;  2DAO A;  2DTR A;  4M72 A;  3WU0 A;  4PGH A;  3ZN0 A;  1MJB A;  2DFI A;  3T8R A;  2Q8K A;  4EJT A;  2EV6 A;  2VBY A;  3NRV A;  1L0O C;  2UXX A;  5A2Q Z;  2D1H A;  2DI3 A;  4CIC A;  4UHT A;  1ZRE A;  1ZG5 A;  3KP7 A;  2FRH A;  4MEY F;  3WE2 A;  3SXY A;  4CGZ A;  2X0L A;  3CJN A;  5KVR A;  5K5Q A;  2V79 A;  4JBA A;  3GZ6 A;  2O61 A;  2FBH A;  2YSR A;  3FZV A;  2MH2 A;  2YR2 A;  1K78 A;  4ZH4 F;  4KIG A;  1I27 A;  4PZJ A;  4BHP A;  2A6H F;  2HQR A;  5L3C A;  3P9C A;  1K79 A;  4ASN A;  2ZXJ A;  3NQO A;  1TW3 A;  3BPV A;  2XAS A;  1ZRC A;  3E5X A;  1O7L A;  3QAH A;  4ENM A;  5CVJ A;  5CVI A;  5ED4 A;  4NB5 A;  1XB4 A;  3QPT A;  3TQN A;  1O3T A;  2VC1 A;  3MCZ A;  1FYK A;  4RAZ A;  5LGT A;  2P5L C;  5J6X A;  5FLX Z;  4RB3 C;  2QBY A;  3WTW C;  2EFW A;  2ZJ2 A;  3ABU A;  4LJZ F;  2OZ6 A;  3J80 K;  3R0A A;  5E18 F;  2CQK A;  2A6E F;  1YG2 A;  4M6X A;  1TBX A;  2GAU A;  2PBI A;  4GO1 A;  2MBF A;  2X4H A;  3K69 A;  3MZY A;  1R00 A;  1I1G A;  2RGV A;  2WTE A;  4M6Y A;  1CF7 A;  1IXS B;  2ZKZ A;  1LEA A;  2VXZ A;  3M1E A;  4G6D A;  4LFU A;  3LA3 A;  1FBS A;  1J75 A;  5E8G A;  4G7Z F;  4MNU A;  3BJA A;  4L9V A;  3V8K A;  4HDU A;  1KA8 A;  2L54 A;  5D6E A;  3D5L A;  4L5I A;  5BPD A;  1S7A A;  3ECH A;  1F9N A;  2F5C A;  3I4P A;  3JTG A;  2L02 A;  3GEZ A;  1SFX A;  4I7H A;  2E7X A;  2KJB A;  3ELK A;  3BJO A;  2MD5 A;  1FY7 A;  3WTX C;  1T2K A;  1JGS A;  5D5W B;  1UFM A;  3GUD A;  1Z9C A;  4WXH A;  3K1P A;  3P7N A;  2MH9 A;  4BHB A;  3KP5 A;  5L3B A;  1O3R A;  3PQJ A;  3ERE D;  2PN6 A;  4PCQ A;  3FM3 A;  1BC7 C;  1ZG3 A;  2EV5 A;  4AIK A;  1U5T A;  1YW7 A;  4UVB A;  2TDX A;  2FF4 A;  2J5O A;  2HWV A;  3U9G A;  5AIQ A;  3KLO A;  3WTS C;  1O3Q A;  2F5D A;  1UST A;  5HS7 A;  2RN7 A;  3F72 A;  4MQV A;  2ETH A;  5CLS A;  3HRT A;  3T0Y A;  1DDN A;  1LDK B;  4KDP A;  1UB9 A;  4P96 A;  1O57 A;  1BJA A;  1MKM A;  2GWR A;  3LAJ A;  4ENK A;  4GCV A;  4BNC A;  4XLN F;  4N0B A;  4WWC A;  1JHH A;  3I71 A;  1ODD A;  3REO A;  3I53 A;  4KIC A;  1YTY A;  3ZMT A;  3W6K B;  4H0E A;  2EJR A;  4LLG F;  1FT9 A;  2XUB A;  3MFK A;  2GXG A;  4IVN A;  1STZ A;  5FD6 A;  4P9U A;  4ZYD A;  1G3T A;  4JQF A;  3V8L A;  2FE3 A;  2LF8 A;  3HSR A;  1OMI A;  2OBP A;  2W57 A;  3J81 K;  3C18 A;  4EVI A;  4NHJ A;  1PP8 F;  4ESF A;  2JPC A;  3J80 Z;  5LGU A;  2VOO A;  5K5O A;  1GXQ A;  1CGP A;  4A5N A;  3RKX A;  5EEH A;  4ZYH A;  3EQL F;  1FYL A;  1BI3 A;  2IRF G;  2VON A;  4XBF A;  2CFX A;  4ZYG A;  1FX7 A;  1OYW A;  1YIO A;  3WGI A;  5DEQ A;  5BS6 A;  1ZLJ A;  1HKT A;  2W25 A;  1BN5 A;  4AWX B;  5HDN A;  1IZ1 A;  4EM2 A;  4M9Z A;  1QNT A;  1W5S A;  5BQT A;  3ECO A;  4OIO F;  4BXU A;  3TDZ C;  1T38 A;  1OPC A;  4G8X A;  2FBI A;  2DT5 A;  4I0A A;  4G6Q A;  1KYW A;  4EJO A;  3EET A;  5K1Y A;  4LK1 F;  2JPB A;  3MWM A;  1IXR C;  2H09 A;  5E1X A;  5LRS A;  1DPR A;  5DD8 A;  1GVJ A;  3WTZ A;  2JTV A;  3LA7 A;  4ON0 A;  3HRS A;  1B59 A;  4IRH A;  3HHH A;  5JR3 A;  1O7F A;  2FQ3 A;  1HW2 A;  1U5T C;  3L7W A;  3CUO A;  3FXQ A;  1QBJ A;  1TTY A;  2XAF A;  4LG0 A;  5D8K B;  2L4M A;  2VE9 A;  4G9Y A;  2KKO A;  3WE3 A;  3R0J A;  4QLC U;  4CDG A;  2OA4 A;  1IRF A;  3PQK A;  1G4D A;  5FGM A;  1UCR A;  1XN7 A;  1P6R A;  1P2F A;  2YU3 A;  2VT2 A;  2D2W A;  1LVA A;  1TQI A;  5F6F A;  4RB1 A;  5FB2 A;  3ZQ7 A;  4LMY A;  1BOA A;  2EWN A;  4BH9 A;  1DP7 P;  2P6S A;  3HHG A;  2XRN A;  1Y0U A;  1IN4 A;  4Y17 A;  1HBX G;  4HLY A;  4KT5 C;  1WSU A;  2EB7 A;  1G6N A;  2OQG A;  4HDV A;  4JK1 X;  2OD5 A;  1LEB A;  4A5M A;  4HW0 A;  3RKW A;  1P4A A;  4IHS A;  5D8L B;  3HRM A;  4IHT A;  1BIA A;  3ZMZ A;  4HF2 A;  4B8X A;  1UHW A;  5JI6 A;  2DW4 A;  2PQ8 A;  3IC7 A;  4I2O A;  1F1Z A;  3O6B B;  2HZT A;  2HTJ A;  2P8T A;  5HVQ C;  3ROU A;  1XSD A;  1E2X A;  4TV7 A;  4R8H A;  4D0P A;  5H6Q A;  2AS5 F;  3BDD A;  1J0R A;  1KQ8 A;  3RI4 A;  4MTD A;  2HOE A;  1QPM A;  1V3F A;  1XGS A;  1FOK A;  2JRT A;  2QQ9 A;  2Q2E A;  2ADU A;  2RNJ A;  4EJU A;  4MQ9 F;  3VOD A;  2ISY A;  2PMH A;  3FMS A;  5CVV A;  2DPD A;  5K5R A;  3I64 A;  1JXS A;  4L9T A;  1HKS A;  2M8E A;  4RS8 A;  4LLL A;  1ZYR F;  2IA2 A;  5LBQ A;  2J5P A;  4XSX F;  3LWF A;  3FXR A;  4UV9 A;  3KP6 A;  3G73 A;  1RZ4 A;  3EYY A;  1AWC A;  2O0Y A;  3U2R A;  4ZZD A;  2UZK A;  2FBK A;  1J5Y A;  5FFZ A;  5DCM B;  3R6S A;  1LDD A;  3JSO A;  3H92 A;  3BRO A;  2XRO A;  2PJP A;  6PAX A;  4ENN A;  2IPQ X;  4ZZL A;  2CW0 F;  2V1D A;  2K4J A;  2QVO A;  4N9H A;  1R23 A;  4CZZ A;  4EJV A;  2GA1 A;  3WTT C;  1W5T A;  4PDK A;  4IRI A;  4EQQ A;  2CO5 A;  3CUQ C;  3J7A O;  1YO5 C;  2ZNY A;  3K2Z A;  3GF2 A;  4Q5S F;  3EYI A;  1YS6 A;  3ABT A;  1MJ9 A;  3GVA A;  2YPR A;  4YFN F;  2IA0 A;  2NNY A;  3F8B A;  4UVA A;  5H6R A;  1W7P D;  4A6E A;  2KIF A;  4A6D A;  4HV5 A;  1XSX A;  5LHG A;  3KE2 A;  1FBU A;  2IW5 A;  5L3E A;  1K7A A;  2P5V A;  3ZMU A;  2NAZ A;  4O3M A;  1XCB A;  2XIG A;  4AIH A;  1DUX C;  4M71 A;  2K27 A;  1KYZ A;  4IF4 A;  2O8X A;  2QLZ A;  2WV0 A;  2G7H A;  1ZGA A;  4KA4 A;  3KCC A;  1EH7 A;  2PG4 A;  2M1B A;  3ZMS A;  4CYD A;  1OYI A;  3DF8 A;  3F8C A;  1SD6 A;  3WGG A;  2LDU A;  3LQR A;  4YG2 F;  1SFU A;  1MZB A;  2JSC A;  4Z2Y A;  2E1C A;  1LNW A;  1WRJ A;  3WTY C;  2KRF A;  2ISZ A;  2QQB A;  4IPA A;  4CXF A;  2IVM A;  2B0L A;  2Y48 A;  2PEX A;  1XCV A;  3G3Z A;  2UWM A;  3PFI A;  1FPQ A;  2G9W A;  1XGO A;  4Q4Z F;  5HLI A;  2XV4 S;  2FA5 A;  4G7O F;  3CO7 C;  2CG4 A;  2NYX A;  1GXP A;  4MEX F;  3MZH A;  1R1V A;  3K1N A;  2EK5 A;  3T1B A;  2OU2 A;  2GXB A;  1A04 A;  3B02 A;  3GFM A;  3HIF A;  1T6S A;  1ZAO A;  3P9K A;  1IN6 A;  1IXC A;  4O6J A;  3QRF F;  3TO6 A;  2P4W A;  2O03 A;  4P9F A;  2R7D A;  1GHC A;  1FZP B;  1S29 A;  3U1D A;  2DU9 A;  1FC3 A;  1S7O A;  3GW2 A;  1D3Y A;  1TNS A;  2M5W A;  2MLK A;  2D45 A;  4XLP F;  1B6A A;  2HFH A;  3WTU C;  4YIF A;  1MDM B;  4Y15 A;  3K9T A;  2CGP A;  1B1B A;  4HA8 A;  5IT9 K;  4BAY A;  2FOK A;  4DNC A;  3RDI A;  2Q0O A;  1QZY A;  5E17 F;  4CO8 A;  1Z05 A;  1C0W A;  2Z33 A;  3RJP A;  3I5U A;  1U78 A;  4U88 A;  2MC3 A;  4OMY A;  4L18 B;  1LB2 A;  5ILS A;  2QBY B;  5DCF A;  3QOP A;  2MA3 A;  1BI2 A;  1IF1 A;  3VB2 A;  2KJC A;  2ZCW A;  5HS9 A;  3N97 A;  1ZGJ A;  4RGX A;  2XAG A;  3E6M A;  1JHF A;  2FNP A;  3BZ6 A;  4OIQ F;  4KIF A;  1YW9 A;  4M74 A;  1RI7 A;  4HOB A;  3H3U A;  3FXU A;  4YFK F;  2GQQ A;  3L00 A;  1T39 A;  2OZU A;  5F64 A;  5DDG A;  1K6O A;  1U8R A;  1CF7 B;  1DPU A;  2FU4 A;  4KFC A;  3R4K A;  4GGG A;  1U6G A;  1HW1 A;  2Z3Y A;  1SFE A;  4HF1 A;  1IAW A;  2JT1 A;  2XAQ A;  1W7P A;  3SQN A;  4OOI A;  3DFG A;  1SD7 A;  3C1D A;  4U0W A;  4A0Z A;  4FX0 A;  5LGN A;  3LST A;  2L01 A;  1J9I A;  4AD9 A;  1T0F A;  4MHG A;  5AIP A;  2RDP A;  2HKO A;  5FD5 A;  4A0Y A;  3KZZ A;  1R1U A;  2EFQ A;  2E7W A;  3SZP A;  2IA1 A;  3ZMD A;  3F6O A;  4EGZ A;  3KEQ A;  1I6X A;  2EV0 A;  5D5U B;  1W4M A;  3EDP A;  4AVP A;  5ICG A;  2WC2 A;  2DK8 A;  1J7K A;  3CLO A;  3GO5 A;  2XHK A;  5BPI A;  2KIM A;  2QEN A;  3Q9S A;  4HLX A;  2HEO A;  4MGR A;  1TQP A;  1L3L A;  3CO6 C;  4GXO A;  3ZN1 A;  3M7G A;  3FHZ A;  4UUV A;  3QPH A;  1KU3 A;  3F22 A;  2H6B A;  3E5Q A;  2F5E A;  1QO0 D;  3TO7 A;  1YW8 A;  2W84 A;  3VEP A;  3FMR A;  1BBY A;  3TKY A;  2ACJ A;  3KP4 A;  2CSO A;  2BYV E;  1YS7 A;  2K4B A;  4OIN F;  2ZBK A;  3I0T A;  3OOP A;  1H9T A;  4EM1 A;  3T8T A;  1IW7 F;  1EV7 A;  3R61 A;  1RIO H;  1U2W A;  5IT9 Z;  1J2X A;  2GIV A;  2DK5 A;  2IJL A;  5DUI A;  3O2P E;  4WCG A;  5FFX A;  2PI0 A;  5D4R A;  4XSZ F;  5HS8 A;  1KGS A;  2STW A;  2QYO A;  3KP3 A;  4YII A;  1XMK A;  4K2E A;  3WOD F;  3DPL C;  2DLL A;  5DCM A;  1F5T A;  2ZME B;  3I59 A;  2BGC A;  2COM A;  4HX4 A;  4KMF A;  3FWE A;  3GX4 X;  4HX8 A;  3IL2 A;  1YFH A;  2FML A;  3GYH X;  5AON A;  3KET A;  1RUN A;  2F5F A;  1B9M A;  4A2U A;  4WXD A;  4DQ2 A;  3H3Z A;  2GA2 A;  2R7F A;  4I09 A;  2P7C B;  3IKT A;  1P4W A;  2DPU A;  3O3K A;  4HQM A;  1XMA A;  1XGM A;  1XDU A;  3V4G A;  4P5O A;  3J81 Z;  1REP C;  1MD0 A;  1G3S A;  2IP2 A;  4F7Z A;  5E20 A;  1OKR A;  4O5V A;  3WGH A;  4IXA A;  3HYI A;  2A5Y B;  2BE5 F;  4LK0 F;  2FMY A;  1USS A;  3RYP A;  1KU9 A;  4GYI A;  2GZW A;  2HTS A;  5BOX A;  4U0Y A;  3C3W A;  3L9F A;  3DV8 A;  3QP5 A;  4L0Z B;  2JZY A;  4E70 A;  1HQC A;  3LQQ A;  3TDU C;  3JW4 A;  3L2C A;  3Q9V A;  2M30 A;  4IJA A;  1FYM A;  4FX4 A;  2HYF A;  4ETS A;  4KYW A;  3F8M A;  1IN8 A;  2OQR A;  2VC0 A;  1BI1 A;  1FP1 D;  4EMS A;  3E5U A;  3DPT A;  3CUQ B;  4N9I A;  5BMZ A;  3I54 A;  3M8E A;  1IN7 A;  2ESN A;  4HV6 A;  3RPQ A;  1XDS A;  1HSJ A;  2HKX A;  4QWQ A;  4UVC A;  3FF5 A;  2CWE A;  3SHF A;  3HOS A;  1ZAR A;  5ERI A;  1QZZ A;  2G7U A;  1LJ9 A;  2CYY A;  1FNN A;  1FBQ A;  1ULY A;  4S05 A;  3N4M A;  2XAH A;  4PGG A;  1XD7 A;  1HST A;  2HGC A;  5IT3 A;  1WWX A;  4ZYE A;  4KN7 X;  3RIR A;  3JSP A;  2DBB A;  5L3D A;  4I0B A;  5H20 A;  2RC4 A;  3OV8 A;  4WX9 A;  1U3E M;  3GFI A;  5LHH A;  4KN4 X;  3FMQ A;  2Z5U A;  3WTV C;  3M9A A;  3QU6 A;  2A3S A;  2FNA A;  3TO9 A;  3GZ5 A;  4IRG A;  3SFZ A;  3JAM K;  3E97 A;  3RYR A;  2Y75 A;  5ILU A;  3ZMV A;  5CYV A;  1KQ9 A;  2EA2 A;  3WU1 B;  3K1M A;  3LA2 A;  1D5V A;  4B09 A;  2QZ8 A;  5FO5 A;  2P7V B;  2LNB A;  4R79 A;  4AIJ A;  4RGU A;  3COA C;  3GWZ A;  3Q5F A;  2QWW A;  3M8F A;  3RTR A;  2RVC A;  3F6V A;  1MDM A;  2OAZ A;  3DKW A;  2XGX A;  1ZRF A;  4S04 A;  1P92 A;  1Z6T A;  2IT0 A;  2BV6 A;  1I5Z A;  3E6C C;  5HOO A;  2DQL A;  3HRU A;  1KQ0 A;  3ZP5 A;  2NRA C;  4ESJ A;  3IWZ A;  3EUH A;  3JTH A;  2O6G E;  2K86 A;  1Z1D A;  3HTU A;  2A07 F;  4Y13 A;  2DO7 A;  2RKH A;  5DYM A;  1PUE E;  2HDC A;  1FSH A;  4OIR F;  1TW2 A;  2A69 F;  3V8J A;  1TQM A;  3F23 A;  4OU0 A;  4KIB A;  2Y0M A;  1Z91 A;  3TOA A;  2HR3 A;  3R60 A;  1OYY A;  1SAX A;  1G3Y A;  1P4X A;  4XRF A;  3IRR A;  1JE8 A;  3GLX A;  4HYE A;  4BQA A;  1I1S A;  1PDN C;  1LQ1 A;  3HSE A;  2L3D A;  3SZT A;  3K0L A;  5ICF A;  1HKQ A;  5CVR A;  3KZY A;  1SMT A;  3BPX A;  3MQ0 A;  1V4R A;  4ENJ A;  2LSO A;  1BI0 A;  2YX4 A;  4I02 A;  1VTN C;  5E1Z B;  4Q48 A;  4BYY A;  5DV5 A;  5LRR A;  1R5G A;  3V7C A;  1KU7 A;  2AXL A;  1WI9 A;  3ULQ B;  4UV8 A;  3F8N A;  1K78 B;  3BY6 A;  1RUO A;  1B9N A;  3RKY A;  3F8F A;  5JHU A;  4LD5 A;  1AOY A;  5D4S A;  2Z99 A;  4HZF A;  1S3J A;  3F3X A;  3GFL A;  4NQW A;  2C6Y A;  4OMZ A;  2P6T A;  3KEO A;  4HQE A;  5L3F A;  3BP8 A;  3V7R A;  2FSW A;  3BWG A;  5LHI A;  2XVC A;  1ZHF A;  4FHT A;  2ZNZ A;  2VOP A;  1WQ2 A;  5E8I A;  1B4A A;  3QU3 A;  2PFB A;  1ZN2 A;  2EFN A;  4R1H A;  2VE8 A;  4M9S A;  1MGT A;  1BC8 C;  2KIU A;  1ON1 A;  4HF0 A;  3JAM Z;  2V1X A;  3MAJ A;  2WWY A;  1XGN A;  1YYV A;  1ONV A;  3WG9 A;  1ZG1 A;  4RGS A;  1R36 A;  4P55 A;  3FX3 A;  2D1V A;  4GYG A;  2VBW A;  4LB5 A;  3I58 A;  1J59 A;  1IUY A;  1R58 A;  4RB0 A;  3ML6 A;  2VBZ A;  3IWF A;  1S8N A;  4EGY A;  4WK8 F;  2O3F A;  1ZH5 A;  4WF2 A;  1EH8 A;  2QQA A;  2H27 A;  2L4A A;  5HLH A;  1HW5 A;  1BIB A;  2EFO A;  2H94 A;  4L0Y B;  1D8J A;  2MLG A;  4BHC A;  3VFZ A;  1EH6 A;  5JFR A;  5DUK A;  2LF7 A;  1G3W A;  5HDK A;  5KK1 A;  2YX7 A;  4HX7 A;  4KUM A;  4LLN A;  2ZME A;  1FLI A;  4EJW A;  1BM9 A;  5D5V B;  2R3S A;  3HSF A;  2HYG D;  1NHA A;  2RQP A;  1S6L A;  3HTS B;  2M87 A;  1X3U A;  4UNO A;  3DQV C;  3P9I A;  3ZPL A;  1XSV A;  2UXN A;  4L9J A;  1OR7 A;  2XKP A;  2K02 A;  1H9G A;  5D5X B;  2W85 A;  1R1T A;  1IN5 A;  2BBY A;  4HBL A;  3C7J A;  1U5T B;  1YLF A;  4G94 A;  4G7H F;  2XAJ A;  2W24 A;  2RV8 A;  2V6C A;  3IHU A;  3CTA A;  1T98 A;  4A0X A;  3DEU A;  4M9X A;  2FEZ A;  5J8F A;  3W6J B;  2M45 A;  5E1W A;  5DD4 A;  3MEX A;  3HUG A;  5EEG A;  2VBX A;  4KNY A;  4I01 A;  3D0S A;  4UXN A;  1QQI A;  2K7L A;  3DXJ F;  4HAM A;  2V1U A;  5F1R A;  2VN2 A;  5A2Q K;  2V9V A;  4LB6 B;  1UHM A;  1F4K A;  1QGP A;  3HOT A;  2A68 F;  1R5H A;  5ICE A;  3KFW X;  1D8K A;  2BEO A;  4WXC A;  4ESB A;  2PMU A;  3CUQ A;  2A61 A;  4A12 A; 
#chains in the Genus database with same CATH topology
 5H2F C;  4M73 A;  1Z7U A;  2NNN A;  1R4N B;  2XKO A;  3S16 J;  3CCE I;  4OIP F;  3CCJ I;  4U0V A;  1H89 C;  1W7P B;  5IP7 J;  5E3L A;  4LOC A;  1E17 A;  2ELH A;  2LY9 A;  1YQA A;  4NBQ A;  3W2A A;  2HS5 A;  3NEU A;  1AKH A;  2VJ5 A;  4MTE A;  4EV0 A;  3RZD J;  5LD2 C;  3LMM A;  5TRD A;  1X1C A;  2HXO A;  3ISP A;  4NC6 A;  1H0M A;  5L3G A;  1WCM J;  5CVU A;  4BQQ A;  5JVT A;  3DKY A;  2KPM A;  4BE1 A;  5D6F A;  2E2I J;  3FM5 A;  1HXD A;  3TGN A;  2ZFW A;  2PLY A;  1ETK A;  4LIU A;  4LIV A;  1Y56 A;  1FSE A;  3G1L A;  3BR1 A;  2KQR A;  4L5J A;  2P5K A;  2CUJ A;  5F04 A;  4EM0 B;  1LFB A;  2BHZ A;  3HEF A;  3FXL A;  4I98 B;  3DCF A;  5FKO A;  3FXO A;  1MJA A;  3BJ6 A;  3V7S A;  3TW6 A;  3BOQ A;  3AAF A;  3U21 A;  1T08 B;  2MG4 A;  3CP8 A;  1RR7 A;  2EFP A;  5FLX K;  3L09 A;  4Q47 A;  5CJ9 A;  3LAP A;  1MMN A;  2E71 A;  3IRQ A;  3F21 A;  1T0F C;  2R4G A;  1JTX A;  1SD5 A;  1SMY F;  1MBK A;  3KLN A;  3IH2 A;  2DCE A;  4L9N A;  2MC4 A;  4C2T A;  1ON2 A;  2VOD A;  3E6D A;  1RNL A;  5HDG A;  3S3N A;  5J8C A;  1VND A;  2E60 A;  3DP7 A;  3KP2 A;  3S1R J;  3EUA A;  4BJ6 C;  5M5W J;  3GFJ A;  4LGW A;  2BXY A;  2Y2Z A;  1P7I A;  3CCV I;  3T5X A;  4CHU A;  3E3V A;  1FWZ A;  1OR7 C;  5M5X J;  1TNT A;  1LDJ A;  3F9K A;  4KMU X;  2K9N A;  3IKV A;  5J3L A;  1R7J A;  1O3S A;  2Z16 A;  2VT3 A;  3OYN A;  2H6C A;  2FXA A;  3GXO A;  1OCO H;  3E6B A;  1TLH B;  1QHG A;  2ME6 A;  2Z9O A;  3DPU A;  3CJR B;  1X2N A;  3AL0 C;  3TW7 A;  1WJ5 A;  2L0K A;  1WKM A;  4Y4R A;  3D5R C;  1OIS A;  3B73 A;  3TBI A;  2KZG A;  2NVU B;  3Q0V A;  2JQ7 A;  1WHU A;  4U7B A;  1QRY A;  5LEJ A;  1IRG A;  4W1U A;  1AA7 A;  2GOX B;  2QUF A;  4LG0 B;  3ABM H;  2NS0 A;  2R7Q A;  5LEK A;  3QP6 A;  4U7D A;  2EZL A;  4RAY A;  3ZQC A;  2W48 A;  2ZO4 A;  2R7S A;  4MLO A;  2ESH A;  1SD4 A;  5ILV A;  2HQN A;  2QM3 A;  4FT8 A;  1FP2 A;  5TJJ A;  1KU2 A;  3QPS A;  2F2E A;  4Y3O A;  5TGT A;  4FE4 A;  2E2H J;  3S2W A;  1ZRD A;  5JLW A;  2EIJ H;  2R5Y A;  2DQR A;  1R22 A;  5ICC A;  3VOE A;  2NOG A;  2CW7 A;  1AHD P;  3TOB A;  3CDH A;  3G4S I;  1VQL I;  5FLV A;  2DOD A;  1Z6R A;  1Q1H A;  2EA4 A;  5HLG A;  2GBY A;  1W36 D;  4RB2 C;  3QQA A;  3FXJ A;  5LLQ A;  3PNT A;  3LFK A;  4BJ5 C;  3I59 B;  4A3B J;  4IEJ A;  2E1N A;  2STT A;  2LKP A;  1ZLK A;  3RPU A;  5KHD A;  1YHQ I;  5E79 C;  3HG9 A;  4YFX F;  4RGR A;  1PP7 U;  4IOC F;  2DAO A;  2DTR A;  4M72 A;  1WJA A;  4PGH A;  3WU0 A;  3ZN0 A;  1Z3Y A;  4JX4 A;  1MJB A;  2DFI A;  3SFI A;  3T8R A;  2Q8K A;  4EJT A;  2M7A A;  2EV6 A;  2VBY A;  1YI2 I;  3NRV A;  2NVX J;  1L0O C;  2UXX A;  5IOY A;  5A2Q Z;  5FRN A;  4XID A;  2D1H A;  2DI3 A;  1ETX A;  2EZK A;  4CIC A;  4UHT A;  1YJ9 I;  1ZRE A;  2CW8 A;  1ZG5 A;  3PIP F;  3KP7 A;  2FRH A;  3U1K A;  2LC2 A;  1MW7 A;  4MEY F;  4AYB A;  1MMG A;  1Z0X A;  3WE2 A;  3SXY A;  3FIW A;  2XPV A;  4PJ0 C;  3A03 A;  2L9N A;  4CGZ A;  5C44 J;  2X0L A;  2JJ7 A;  2DTZ A;  3CJN A;  5KVR A;  5K5Q A;  3OYI A;  3FKI J;  5M3F J;  1U8B A;  3C2G A;  4HNU A;  2V79 A;  3DU6 A;  3Q0U A;  4JBA A;  2EIL H;  4A3K J;  3GZ6 A;  2O61 A;  3FK7 A;  1Q1V A;  1Y0N A;  4F3Q A;  2FBH A;  2HDW A;  3BZC A;  2YSR A;  3FZV A;  2MH2 A;  2YR2 A;  2R7V A;  2DJN A;  1K78 A;  3BG5 A;  4ZH4 F;  4KIG A;  1I27 A;  1NK2 P;  2VPL A;  2HVQ A;  2MYS A;  3GZN B;  3GTO J;  1YIJ I;  2ELJ A;  4NC7 A;  1ZQ3 P;  4PZJ A;  4BHP A;  2A6H F;  2OJE D;  4MFD A;  2HQR A;  4DZP A;  4UB6 C;  5L3C A;  3HOV J;  3OSG A;  3P9C A;  1K79 A;  4ASN A;  3JRI A;  4G12 A;  2ZXJ A;  3NQO A;  1TW3 A;  3BPV A;  1K4S A;  1JKR C;  2XAS A;  1ZRC A;  1NH3 A;  3E5X A;  1IJW C;  1O7L A;  3QAH A;  2F4I A;  4B3X A;  2BZT A;  2CUF A;  2OC6 A;  5CVJ A;  5CVI A;  4ENM A;  1UEL B;  4NB5 A;  1XB4 A;  2M34 A;  5ED4 A;  3QPT A;  3BR3 A;  4XM3 A;  3TQN A;  1O3T A;  2VC1 A;  3MCZ A;  3FBI B;  3FBN B;  1FYK A;  4P1W A;  4AC0 A;  2LG4 A;  4RAZ A;  5LGT A;  2P5L C;  5J6X A;  2CQN A;  5FLX Z;  4RB3 C;  1JKO C;  2QBY A;  2EIK H;  3WTW C;  3QYB A;  4HNV A;  1IV8 A;  4ZC3 A;  4ZDO A;  2EFW A;  5B1A H;  2ZJ2 A;  5EGO A;  2K5C A;  3ABU A;  4LJZ F;  2OZ6 A;  3J80 K;  5KCM A;  4MO7 A;  3R0A A;  2E1M B;  1TC3 C;  5E18 F;  2CQK A;  1U9N A;  2A6E F;  3HOW J;  1YG2 A;  4M6X A;  1TBX A;  2GAU A;  4Z6Y A;  5K7Z A;  2PBI A;  3L2V A;  4GO1 A;  1LKX A;  3OS1 A;  3H0G J;  1IDZ A;  2MBF A;  2RAE A;  2X4H A;  3K6G A;  2RQQ A;  3K69 A;  5F0F A;  3MZY A;  3GTG J;  1R00 A;  3H3V K;  1I1G A;  2VKV A;  2RGV A;  2L5Q A;  2KP6 A;  4OAY A;  2AQE A;  2WTE A;  4M6Y A;  1X1P A;  1CF7 A;  1IXS B;  2ZKZ A;  1HA8 A;  1LEA A;  2HNH A;  3DBH B;  2VXZ A;  1Z7L A;  3M1E A;  4G6D A;  4LFU A;  3LA3 A;  4RM2 A;  3ZQI A;  1FBS A;  1JT6 A;  1E0E A;  4FTH A;  4BAC A;  4QPQ A;  1J75 A;  5E8G A;  3OYH A;  4G7Z F;  2L9S A;  2FUG 2;  4MNU A;  2CFO A;  3BJA A;  4DIQ A;  4L9V A;  3V8K A;  4HDU A;  3SDG A;  1KA8 A;  1JJ8 C;  2L54 A;  3CES A;  5D6E A;  3D5L A;  4L5I A;  1JGG A;  3OOU A;  1S7A A;  5BPD A;  1V55 H;  2XRL A;  3ECH A;  1F9N A;  5GAD J;  3TED A;  2F5C A;  2V9K A;  2M2E A;  2W1O A;  2YS9 A;  3I4P A;  5DM7 F;  3JTG A;  3CCU I;  3PNY A;  2L02 A;  4RM3 A;  5GPA A;  4GFB A;  3GEZ A;  1SFX A;  1BJZ A;  4I7H A;  2R7O A;  2E7X A;  2KJB A;  1N25 A;  3ELK A;  3IAS 2;  3BJO A;  1XS9 A;  2MD5 A;  4IHX A;  1FY7 A;  5TIS C;  2PX9 A;  3WTX C;  3OYC A;  1T2K A;  1VQK I;  1JGS A;  5D5W B;  1UFM A;  3GUD A;  1Z9C A;  1VQ4 I;  2HDD A;  3QYF A;  3OSF A;  4WXH A;  3CLQ A;  3GTP J;  3K1P A;  3NAR A;  3P7N A;  3VDX A;  4D1Q A;  4XN3 A;  2Q1Z B;  2MH9 A;  4BHB A;  3KP5 A;  4E7L A;  1HDP A;  5L3B A;  1VZ0 A;  4AU7 A;  1O3R A;  3PQJ A;  3ERE D;  2PN6 A;  2R7R A;  4PCQ A;  2M3A A;  2LR8 A;  2DT7 B;  3FM3 A;  3K2A A;  1BC7 C;  1ZG3 A;  4A93 J;  2YU9 J;  1B72 A;  3H35 A;  2EV5 A;  3A01 B;  4AIK A;  1U5T A;  2L7K A;  1YW7 A;  4UVB A;  1N75 A;  2FF4 A;  2L9V A;  2TDX A;  2J5O A;  4AUX A;  1FOY A;  4BDY A;  3FKJ A;  2HWV A;  3GTK J;  3U9G A;  2LYC A;  2E19 A;  5AIQ A;  2DOA A;  2VJJ A;  4PJN A;  1ZR2 A;  1IG7 A;  3BG6 A;  2JA8 J;  3KLO A;  3WTS C;  3Q0W A;  1HC8 A;  1VQ9 I;  1O3Q A;  2F5D A;  1X2M A;  3VSL A;  2B63 J;  1UST A;  4RDU A;  2Y0S A;  2FOW A;  1S72 I;  3W2W A;  1GV2 A;  4FIS A;  5HS7 A;  2RN7 A;  3F72 A;  3KPH A;  4MQV A;  2MW8 A;  2VL8 A;  3OYE A;  1FTZ A;  2ETH A;  5CLS A;  3HRT A;  3T0Y A;  1DDN A;  2HPM A;  1LDK B;  4F55 A;  4KDP A;  1UB9 A;  1MMD A;  2M4K A;  3BG3 A;  2F6C A;  4XN0 A;  3ERM A;  4P96 A;  1O57 A;  2LBF A;  2BW3 B;  3F0C A;  1BJA A;  1SC7 A;  1MKM A;  3ZQG A;  2ZSH B;  3ZQQ A;  4IZZ A;  2GWR A;  3LAJ A;  4ENK A;  3DTI A;  4GCV A;  3PIO F;  4BNC A;  4XLN F;  4N0B A;  1IV6 A;  4WWC A;  1JHH A;  3I71 A;  1ODD A;  3REO A;  3I53 A;  4KIC A;  1YTY A;  1H8A C;  2Y31 A;  2FD5 A;  4FET A;  3ZMT A;  3W6K B;  1UG2 A;  4H0E A;  4NUB A;  4BBR J;  5EG0 A;  2O9L A;  4NDL A;  1T95 A;  2EJR A;  4RA2 A;  2D5V A;  2KRH A;  2EZI A;  4LLG F;  2EPF A;  1FT9 A;  2XUB A;  2MGQ A;  4BY7 J;  3MFK A;  2GXG A;  3G1M A;  4IVN A;  1STZ A;  1FIP A;  5FD6 A;  3JR9 A;  1QZE A;  4P9U A;  4ZYD A;  2HQ5 A;  2HZD A;  1G3T A;  4JQF A;  3V8L A;  2EH3 A;  1T56 A;  2KDO A;  4CCJ A;  2VI6 A;  2FE3 A;  2LF8 A;  1KON A;  2P81 A;  3HSR A;  2WAF A;  1OMI A;  2F4O B;  3BTC A;  2OBP A;  2W57 A;  3DEE A;  3HKZ A;  3J81 K;  3C18 A;  4EVI A;  4FAS D;  4V2G A;  2LY2 A;  1IUF A;  3JRA A;  4NHJ A;  5EZG A;  3AKZ A;  1PP8 F;  4ESF A;  4D7M A;  2JPC A;  3UR3 C;  1EJ9 A;  3J80 Z;  5LGU A;  3G1O A;  2VOO A;  5K5O A;  1GXQ A;  5GAH J;  3C2B A;  4BU2 A;  1CGP A;  4A5N A;  1IRZ A;  1VQ7 I;  3RKX A;  5EEH A;  4ZYH A;  3EQL F;  3A0H C;  3B6A A;  3SJM A;  1FYL A;  1BI3 A;  2IRF G;  4XLA A;  2VON A;  3D1N I;  3MVP A;  4XBF A;  2CFX A;  2O7O A;  1X4O A;  4ZYG A;  2X48 A;  1OYW A;  1FX7 A;  1GUU A;  1YIO A;  3WGI A;  1TZL A;  5DEQ A;  3PL8 A;  3CDL A;  3RQ4 A;  5BS6 A;  1ZLJ A;  1HKT A;  3HXL A;  2M9H A;  3H0D A;  2W25 A;  1IRX A;  1BN5 A;  4AWX B;  1WJB A;  3KYC B;  1IZ1 A;  4DYC A;  5HDN A;  3BTJ A;  4XKW A;  4EM2 A;  4M9Z A;  3DBL B;  1QNT A;  1W5S A;  2LOO A;  4RAF A;  2VJI A;  1JUP A;  5BQT A;  3W6V A;  3ECO A;  4OIO F;  3WHC A;  4E7I A;  1DGW Y;  5IP9 J;  4BXU A;  2VKE A;  3TDZ C;  4B44 A;  2HVR A;  1T38 A;  1OPC A;  2AQF A;  3CCR I;  1ZTR A;  4G8X A;  2FBI A;  2DT5 A;  3BCB A;  3Q3S A;  4I0A A;  4IL6 C;  2CQX A;  4G6Q A;  1KYW A;  3OL3 A;  4RBO A;  3JRE A;  4C2U A;  4HST A;  3ZCO A;  4EJO A;  3EET A;  5K1Y A;  4ABZ A;  3JRB A;  4ANJ A;  2PJR A;  4LK1 F;  1JUS A;  5IY5 H;  3K10 A;  2JPB A;  3MWM A;  1IXR C;  4RLQ A;  1LPQ A;  2H09 A;  5E1X A;  5LRS A;  2IGO A;  3S14 J;  1EA3 A;  4OAZ A;  1DPR A;  5DD8 A;  1GVJ A;  3LOC A;  3WTZ A;  5J1Y A;  1FMV A;  2JTV A;  3LA7 A;  1FOX A;  4ON0 A;  1E3H A;  3HRS A;  1B59 A;  4XKV A;  4IRH A;  3HHH A;  5LFA A;  5JR3 A;  1O7F A;  2FQ3 A;  1I3A A;  3ESW B;  1HW2 A;  4KIS A;  1U5T C;  3L7W A;  3CUO A;  1BW5 A;  3HGG A;  3FXQ A;  1MBJ A;  1BR1 A;  1QBJ A;  4B1R A;  1POG A;  3H5N A;  1TTY A;  2XAF A;  5FRM A;  2IS1 A;  4LG0 A;  1Y6I A;  5D8K B;  1HDD C;  3SZG A;  1Z77 A;  2KHM A;  1TT5 B;  3PUF A;  2L4M A;  2VE9 A;  1V5E A;  4AYB N;  3PNV A;  4G9Y A;  2KKO A;  3WE3 A;  1RKW A;  3R0J A;  4MFE A;  4QLC U;  4IOA F;  3BR2 A;  1W36 C;  4CDG A;  2OA4 A;  4E7J A;  1IRF A;  3PQK A;  2KDZ A;  1G4D A;  5FGM A;  1UCR A;  1XG1 A;  1XN7 A;  2HI3 A;  1P6R A;  4UY8 I;  1P2F A;  2YU3 A;  4HSR A;  1D0Y A;  2VT2 A;  2D2W A;  5EZH A;  1LVA A;  1TQI A;  4KJZ A;  5F6F A;  2XAU A;  4RB1 A;  2CS3 A;  5FB2 A;  3ZQ7 A;  2HU9 A;  4G6T B;  4LMY A;  3CMY A;  1BOA A;  2EWN A;  4BH9 A;  1DP7 P;  2P6S A;  4AVZ A;  1DU0 A;  3HHG A;  4M3G A;  2XRN A;  1Y0U A;  1IN4 A;  4Y17 A;  1HBX G;  4HLY A;  2LKS A;  4QPO A;  4KT5 C;  3HL2 A;  4CCM A;  2JWT A;  1WSU A;  5J47 A;  2EB7 A;  1G6N A;  2JVG A;  2OQG A;  4HDV A;  4I6Z A;  2QSG X;  2JRM A;  5B1B H;  4AID A;  3O8H A;  4JK1 X;  2OD5 A;  3DLA A;  2N8G A;  3DBR B;  2CH0 A;  1DGR M;  4E6K G;  1LEB A;  1TWF J;  2I8D A;  3VWB A;  4A5M A;  4HW0 A;  1N78 A;  1A6I A;  3RKW A;  1P4A A;  4IHS A;  5D8L B;  4A3I J;  3ONQ A;  3HRM A;  2XPU A;  4IHT A;  1BIA A;  3ZMZ A;  4HF2 A;  2ZME C;  2LTP A;  2X1D A;  1IO2 A;  4B8X A;  3BCA A;  3SEZ A;  1UHW A;  3BR6 A;  5JI6 A;  2DW4 A;  2PQ8 A;  5IPA A;  3IC7 A;  2W7N A;  4I2O A;  3KYL A;  1F1Z A;  1YX5 A;  3O6B B;  3ZXS A;  1MSE C;  2KMU A;  1WJF A;  2HZT A;  4RLF A;  2HTJ A;  2VPR A;  4HRI A;  3AL0 B;  2P8T A;  5HVQ C;  4BEH B;  3ROU A;  4BUP A;  3I55 I;  3LL7 A;  4Y33 A;  5K7H A;  2XGD A;  5F27 A;  1XSD A;  2IGN A;  1E2X A;  4TV7 A;  1PVE A;  3PFY A;  4R8H A;  4D0P A;  5H6Q A;  2AS5 F;  1Z67 A;  3BDD A;  1J0R A;  2CV2 A;  1VQ6 I;  1KQ8 A;  4GDF A;  3RI4 A;  2DFH A;  3PUB A;  4DBQ A;  2VJ4 A;  5J1U A;  2GIZ A;  2HOA A;  4MTD A;  3BG9 A;  4XNF A;  2HOE A;  1QPM A;  1T8I A;  4IHV A;  4UB8 C;  1V3F A;  1N77 A;  4V19 K;  1X58 A;  1XGS A;  1FOK A;  2JRT A;  1X3Z B;  2ECB A;  2QQ9 A;  3NAU A;  2Q2E A;  2ADU A;  2RNJ A;  3HUG B;  4MQ9 F;  3VOD A;  4EJU A;  2ISY A;  2PMH A;  3FMS A;  4DYQ A;  5CVV A;  2DPD A;  5K5R A;  1TWC J;  2M7B A;  2CMP A;  3PO2 J;  3I64 A;  1JXS A;  1Z21 A;  4L9T A;  1HKS A;  2M8E A;  2XSD C;  2PMZ A;  4RS8 A;  2FQ4 A;  1MH4 A;  3CCM I;  4ZJZ A;  4LLL A;  2A6T A;  4B48 A;  1A35 A;  3RSN A;  4UUS A;  1ZYR F;  2IA2 A;  2V9P A;  5LBQ A;  2J5P A;  4XSX F;  5BNG A;  4YRV A;  2L7F P;  2ZXW H;  2CU7 A;  3CC7 I;  1MND A;  3LWF A;  2JN6 A;  3FXR A;  4IX7 A;  4UV9 A;  4E4H A;  2DOE A;  3KP6 A;  3G73 A;  1RZ4 A;  3MMY B;  3H36 A;  3EYY A;  1AWC A;  2O0Y A;  3U2R A;  4ZZD A;  2UZK A;  2FBK A;  2WV1 A;  2E5Z A;  4E7S A;  1J5Y A;  5FFZ A;  5DCM B;  3IH4 A;  3R6S A;  1LDD A;  3HOY J;  3JSO A;  3TP3 A;  3H92 A;  3FIS A;  2VQL A;  3BRO A;  2WAE A;  2XRO A;  2PJP A;  2X6W A;  1XC5 A;  6PAX A;  4BGD A;  4ENN A;  2IPQ X;  4ZZL A;  3I56 I;  3K4C A;  2CW0 F;  2YUS A;  1AKH B;  2BVM A;  2W00 A;  5GPC A;  5M5Y J;  2V1D A;  4A3C J;  2A5W A;  1V5G A;  2K4J A;  2QVO A;  4EEF G;  4N9H A;  1R23 A;  4CZZ A;  1TWA J;  2GA1 A;  1UMQ A;  1MIJ A;  1I50 J;  4EJV A;  3VYR B;  3WTT C;  1YRN A;  4XOT A;  4D5C A;  1W5T A;  4PDK A;  4IRI A;  4EQQ A;  2MSY A;  2CO5 A;  3HDD A;  2Y69 H;  2K9Q A;  1D1B A;  3CUQ C;  1YO5 C;  3J7A O;  2ZNY A;  3K2Z A;  4ZDL A;  5CQE A;  3GF2 A;  3EPZ A;  2K9M A;  4CCK A;  4Q5S F;  3HM5 A;  3EYI A;  1YS6 A;  4E7K A;  3ABT A;  3CC4 I;  1MJ9 A;  3MKY B;  3HB9 A;  1TWG J;  5J4Y A;  3GVA A;  2YPR A;  1D0X A;  2K9S A;  3LFU A;  2HVS A;  4YFN F;  3S17 J;  2IA0 A;  5DTD A;  4NC8 A;  2NNY A;  1V5F A;  5J4V A;  1MBE A;  3MKW B;  3F8B A;  4UVA A;  2VKH A;  5H6R A;  4E7Z A;  1HCR A;  1W7P D;  2DMT A;  4A6E A;  2KIF A;  1E3P A;  4A6D A;  2Y0S N;  3CJQ B;  4HV5 A;  1D0Z A;  4II3 A;  1XSX A;  5LHG A;  2NVQ J;  1WH7 A;  2KIQ A;  3KE2 A;  1FBU A;  2IW5 A;  3LSI A;  4C9Y A;  5L3E A;  1K7A A;  1NK3 P;  2P5V A;  4BQO A;  2XC7 A;  3IAM 2;  3OS2 A;  3ZMU A;  2NAZ A;  3AG3 H;  3CP2 A;  1VF9 A;  4O3M A;  3S1M J;  1XCB A;  3ABL H;  3AG4 H;  3TP0 A;  3I4N J;  2XIG A;  1Y8R B;  4AIH A;  3K4L A;  4B47 A;  3D5S C;  1DUX C;  4JOM A;  4M71 A;  2K27 A;  1KYZ A;  1ETO A;  4IF4 A;  2O8X A;  1VQM I;  1X1B A;  2QLZ A;  2WV0 A;  3OYD A;  1K6Y A;  4DZJ A;  5EJC A;  1K61 A;  3KX2 A;  3M07 A;  2DDA A;  2G7H A;  1ZGA A;  4XLC A;  4KA4 A;  1FTT A;  3KCC A;  2LP0 A;  1EH7 A;  2OF7 A;  2PG4 A;  2M1B A;  3ZMS A;  4CYD A;  3H1C A;  3ZRG A;  3LNQ A;  1OYI A;  3DF8 A;  4J00 A;  3F8C A;  1SD6 A;  3WGG A;  1YJW I;  2COB A;  2LDU A;  3LQR A;  2FJ1 A;  4I99 C;  4YG2 F;  1SFU A;  2R92 J;  2LLK A;  1MZB A;  1PYV A;  2JSC A;  2K3P A;  2ZXI A;  2X1C A;  4Z2Y A;  2E1C A;  2R5Z A;  3L2Q A;  1LNW A;  3BTL A;  2VKD A;  1WRJ A;  3H5A A;  3WTY C;  4BXX J;  1XX5 A;  2DA4 A;  3HKZ N;  2IS6 A;  2KRF A;  5FKL A;  3JRF A;  2H8R A;  2ISZ A;  3OY9 A;  2QQB A;  1MBF A;  2R5Y B;  4IPA A;  2LH9 A;  4CXF A;  2IVM A;  2B0L A;  4M3B A;  1VFC A;  2Y48 A;  1I39 A;  2ID3 A;  2MAB A;  2QKM B;  1ZGW A;  2PEX A;  3TMO A;  5GAG J;  1XCV A;  1BOB A;  1UHS A;  2BW3 A;  3G3Z A;  2UWM A;  3IP4 B;  1UAA A;  3PFI A;  1APL C;  1FPQ A;  2G9W A;  4II2 A;  4IHW A;  4YEL A;  1XGO A;  3CCY A;  1GV5 A;  2CRG A;  4Q4Z F;  2OCC H;  5HLI A;  2DA5 A;  1SVL A;  2XV4 S;  2FA5 A;  4G7O F;  3CO7 C;  2CG4 A;  2NYX A;  5JHF A;  4JX6 A;  1RET A;  1GXP A;  4MEX F;  3QPL A;  3MZH A;  1J09 A;  1R1V A;  3OYG A;  4BBS J;  4FQG A;  4L5E A;  1HF0 A;  3K1N A;  4XOP A;  2KZV A;  3ZGK A;  2EK5 A;  3T1B A;  2OUM A;  3CMA I;  4A3D J;  1ETV A;  2E35 A;  1IDY A;  2OU2 A;  2GXB A;  3O8G A;  1A04 A;  3B02 A;  3GFM A;  1I3Q J;  1ETW A;  1T6S A;  3HIF A;  3JCU C;  3RCO A;  4CZC A;  1ZAO A;  3GBG A;  3P9K A;  1IN6 A;  1IXC A;  3LSK A;  4O6J A;  3QRF F;  3TO6 A;  3BR5 A;  2P4W A;  2O03 A;  4P9F A;  2R7D A;  1GHC A;  1FZP B;  1S29 A;  3U1D A;  2DU9 A;  1FC3 A;  1ZK8 A;  3BG7 A;  2ZB9 A;  1S7O A;  3LSG A;  2V7F A;  2LVS A;  1E3O C;  3GW2 A;  1D3Y A;  1SVM A;  1TNS A;  2M5W A;  2MLK A;  2HOT A;  3KZI C;  2D45 A;  1TWH J;  4XLP F;  1B6A A;  1XPX A;  1U0J A;  2HFH A;  3WTU C;  1LVK A;  2L7Z A;  4YIF A;  1MDM B;  4Y15 A;  3K9T A;  3ZQH A;  5F0C A;  3QOD A;  3E0J B;  2CGP A;  3DLL F;  5E3M A;  3J7A Y;  1B1B A;  4HA8 A;  5IT9 K;  4BAY A;  2FOK A;  2L9R A;  4DNC A;  1VQ8 I;  3RDI A;  2Q0O A;  1QZY A;  5KAF C;  5E17 F;  4CO8 A;  2DXI A;  4CYC B;  3CME I;  1Z05 A;  3G6E I;  2QKL B;  3QWL A;  4XRM A;  2DFF A;  1C0W A;  3BTI A;  3HOZ J;  2Z33 A;  3OYB A;  4RMN A;  4UUT A;  3RJP A;  3I5U A;  1U78 A;  4U88 A;  2UUZ A;  3FXK A;  3K70 C;  5K7F A;  2MC3 A;  2CV0 A;  1DU6 A;  1ERD A;  4OMY A;  4L18 B;  1LB2 A;  5ILS A;  2QBY B;  5DCF A;  1RRJ A;  1LE8 B;  1MSF C;  2WBM A;  3QOP A;  2LMD A;  2MA3 A;  1QVT A;  3OS0 A;  2JUG A;  2JVH A;  3OR1 C;  4J01 A;  1BI2 A;  1GT0 C;  3VB2 A;  1IF1 A;  2KJC A;  5EGO B;  1K4T A;  3GLL A;  5IP6 A;  2ZCW A;  4QTR A;  2FX0 A;  1ZEL A;  3K4M A;  5HS9 A;  1UJ8 A;  3RKQ A;  3ZOB A;  3N97 A;  2LY1 A;  1ZGJ A;  4RGX A;  1MMA A;  5JVG F;  2XAG A;  3E6M A;  1JHF A;  2FNP A;  3BZ6 A;  4BDZ A;  1O4X A;  1VQ5 I;  2NS7 A;  4OIQ F;  3FDY A;  4KIF A;  2IS4 A;  1YW9 A;  4M74 A;  5B5E C;  1RI7 A;  4HOB A;  3H3U A;  3FXU A;  4HG2 A;  4YFK F;  2GQQ A;  3L00 A;  1T39 A;  2OZU A;  5F64 A;  5FLM J;  2DN0 A;  5DDG A;  1K6O A;  5EDN A;  3KEY A;  1U8R A;  5GTI C;  1CF7 B;  1DPU A;  2FU4 A;  5FKN A;  3VSK A;  3I9V 2;  4KFC A;  3R4K A;  3B6C A;  4GGG A;  3ZQF A;  1X19 A;  3HOX J;  1U6G A;  4XRS A;  4CA0 A;  1HW1 A;  2Z3Y A;  1SFE A;  4HPQ A;  3LSR A;  4HF1 A;  3HPH A;  1IAW A;  2JT1 A;  2XAQ A;  1W7P A;  3SQN A;  4F91 B;  4OOI A;  3DFG A;  1SD7 A;  1FEX A;  3C1D A;  4BE2 A;  2E34 A;  2Z2S B;  4U0W A;  4A0Z A;  3G71 I;  4ZTF A;  2GOM A;  2P0W A;  4FX0 A;  2CV1 A;  5LGN A;  3KIO A;  2I5U A;  4ITV A;  3LST A;  2L01 A;  4XLE A;  2VLA A;  3VPR A;  2ZJP F;  1J9I A;  2BXZ A;  1YX3 A;  2DT6 A;  4AD9 A;  1VQO I;  1T0F A;  4MHG A;  3WG7 H;  2XF6 A;  1PUF B;  5AIP A;  2RDP A;  2HKO A;  5FD5 A;  4A0Y A;  3WU2 C;  3KZZ A;  1R1U A;  2EFQ A;  3HOU J;  2E7W A;  4XR6 A;  2DDB A;  3SZP A;  2IA1 A;  2ZXH A;  3ZMD A;  3F6O A;  3P5J A;  2HQA A;  4NQW B;  1R6R A;  3K4B A;  5GAE J;  2HPI A;  5FKM A;  3OYA A;  4EGZ A;  3KEQ A;  1I6X A;  1X3W B;  2RRE A;  2WAD A;  2EV0 A;  5D5U B;  2VQH A;  1W4M A;  1OFC X;  3S2H J;  3EDP A;  2AXT C;  1FJL A;  1H88 C;  2PMZ N;  1SFO J;  4AVP A;  2ZFU A;  2K85 A;  5ICG A;  2WC2 A;  2EIM H;  4PJJ A;  2DK8 A;  1J7K A;  3CLO A;  1FIA A;  1OCR H;  3EUK L;  2QSH X;  2OTJ I;  3GO5 A;  3S93 A;  2XHK A;  5BPI A;  1X1D A;  4BEH A;  2IAI A;  2KIM A;  2QEN A;  3Q9S A;  2VIX A;  4HLX A;  4C30 A;  2IBD A;  2JA5 J;  2HEO A;  2NVT J;  4MGR A;  2WY8 Q;  1OLT A;  1TQP A;  3W3C A;  3CO6 C;  3S3M A;  4IO9 F;  1L3L A;  2JA6 J;  4GXO A;  3ZN1 A;  3M7G A;  3FHZ A;  4UUV A;  3QPH A;  1KU3 A;  3F22 A;  2H6B A;  2CUE A;  1I6H J;  3E5Q A;  2F5E A;  1QU3 A;  1SVO A;  1QO0 D;  1ZKG A;  3TO7 A;  3VYT B;  1YW8 A;  4X1E A;  2W84 A;  4PSW A;  3VEP A;  4S0H B;  3FMR A;  3H5R A;  3FK6 A;  5KAI C;  1BBY A;  3TKY A;  1IC8 A;  2ACJ A;  3M1C A;  3KP4 A;  2CSO A;  2BYV E;  1YS7 A;  2K4B A;  2V26 A;  4OIN F;  2ZBK A;  2GXA A;  3I0T A;  3OOP A;  1H9T A;  4EM1 A;  4IQ4 A;  3T8T A;  2E36 A;  5CKT A;  1IW7 F;  1ENH A;  1G8X A;  1EV7 A;  3R61 A;  4N4N B;  1RIO H;  4M3E A;  2WAQ A;  1NG6 A;  1U2W A;  5IT9 Z;  1J2X A;  2W4S A;  2GIV A;  2DK5 A;  2IJL A;  3LSM A;  5DUI A;  5EG0 B;  3OYM A;  3O2P E;  4WCG A;  2QGU A;  3AG1 H;  5FFX A;  2PI0 A;  5D4R A;  2DMQ A;  4XSZ F;  5HS8 A;  2IXS A;  1KGS A;  2STW A;  2QYO A;  3KP3 A;  1QVU A;  4YII A;  3OYJ A;  5IYD J;  3N05 A;  1XMK A;  4K2E A;  1BA5 A;  1U9O A;  4BXF A;  1P9Q C;  3WOD F;  4F92 B;  3DPL C;  2DLL A;  2HXI A;  5DCM A;  2ZME B;  1WH5 A;  3DTE A;  3I59 A;  1R9T J;  1F5T A;  2BGC A;  3MZ8 A;  2JSP A;  2COM A;  4HX4 A;  1QA6 A;  1WJC A;  4C3H J;  4KMF A;  3FWE A;  2E2J J;  4CCN A;  3CD6 I;  1TP4 A;  3GX4 X;  3OYL A;  4HX8 A;  3TL4 X;  3IL2 A;  1YFH A;  3CCS I;  2FML A;  5FRO A;  3PSI A;  3UNG C;  2NOJ B;  4PSX A;  1R71 A;  3GYH X;  2JK3 A;  1DQU A;  2BVL A;  2GLO A;  5AON A;  3KET A;  1OCC H;  1RUN A;  3CCQ I;  1MBH A;  3DEW A;  3OIQ A;  2F5F A;  1S5L C;  1B9M A;  4A2U A;  4WXD A;  4DQ2 A;  3H3Z A;  2GA2 A;  3S1N J;  2R7F A;  1BL0 A;  3MN2 A;  2VQC A;  4I09 A;  2B9S A;  1MNE A;  4J19 A;  2BY2 A;  2ID6 A;  4BQN A;  2P7C B;  3CQZ J;  4YIR X;  3IKT A;  1P4W A;  4XKC A;  2DPU A;  5HNF A;  3O3K A;  4HQM A;  1B8I B;  1XMA A;  2ELK A;  2DJI A;  1VI0 A;  1A36 A;  2QEX I;  4DBR A;  1XGM A;  1XDU A;  2JMW A;  3V4G A;  3JRG A;  1WZ2 A;  4P5O A;  4C3J J;  2R7U A;  3J81 Z;  1YOV B;  1REP C;  1MD0 A;  3OR2 C;  4M3D A;  5DS9 A;  1G3S A;  3VYU B;  2IP2 A;  5C4J J;  2X85 A;  4F7Z A;  3OIP A;  1HLV A;  2XDV A;  4U87 A;  5E20 A;  1OKR A;  4O5V A;  3AFH A;  3WGH A;  1MMS A;  4X6A J;  4IXA A;  4M6V A;  3HYI A;  2A5Y B;  2BE5 F;  2X6X A;  4LK0 F;  2PJR B;  2FMY A;  1USS A;  3RYP A;  1M1E B;  1KU9 A;  4GYI A;  4QSH A;  1W5C C;  1EF4 A;  2Y9Y A;  2GZW A;  2HTS A;  5BOX A;  4U0Y A;  3C3W A;  3L9F A;  2I10 A;  3DV8 A;  3QP5 A;  4XL9 A;  4L0Z B;  2JZY A;  2IGK A;  4E70 A;  1HQC A;  3LQQ A;  3M4O J;  3PM1 A;  5FJ8 J;  3FHN A;  3TDU C;  4IKF A;  4LIT A;  3JW4 A;  1UG0 A;  3L2C A;  4D9J A;  1AU7 A;  3Q9V A;  2M30 A;  4IJA A;  2R7W A;  2A05 A;  2V6E A;  2QCO A;  1FYM A;  4FX4 A;  3GTL J;  2HYF A;  4ETS A;  3L1P A;  4KYW A;  4JP0 A;  2JUC A;  3F8M A;  3RZO J;  1IN8 A;  2OQR A;  3CDI A;  3GTM J;  2DFE A;  3HBL A;  3S8P A;  1X1A A;  2VC0 A;  2H8W A;  1BI1 A;  3CMM A;  1FP1 D;  4EMS A;  2WB1 A;  3E5U A;  2ZC2 A;  3DPT A;  2DA1 A;  1Y39 A;  1WGX A;  3CUQ B;  4N9I A;  5BMZ A;  3CCL I;  3I54 A;  3M8E A;  2LKX A;  1IN7 A;  2ESN A;  4HV6 A;  3RPQ A;  1XDS A;  1HSJ A;  3SYT A;  1JTY A;  3OWT A;  2HKX A;  4I76 A;  4QWQ A;  4UVC A;  3FF5 A;  5GTH C;  3PSF A;  4JYK A;  2CWE A;  3SHF A;  1XTA A;  3HOS A;  1ZAR A;  5ERI A;  4A3G J;  1QZZ A;  2G7U A;  2BHY A;  5EYR A;  2EBI A;  1LJ9 A;  1SFK A;  2DA3 A;  4PUS A;  3G2B A;  2CYY A;  1T33 A;  1FNN A;  1FBQ A;  1ULY A;  4S05 A;  3N4M A;  1LFP A;  2XAH A;  4A3F J;  4PGG A;  1XD7 A;  1TL8 A;  3RQI A;  1HST A;  2HGC A;  5IT3 A;  2R93 J;  2R7Z J;  4MIM A;  1WWX A;  4BKX A;  4PFO A;  3CC2 I;  2E1O A;  4ZYE A;  2KIS A;  1UZC A;  2DOF A;  4KN7 X;  4N4O B;  3S1Q J;  3RIR A;  3DWL E;  3JRC A;  3JSP A;  1S7E A;  5HLT A;  2EZH A;  2DBB A;  2IS2 A;  5L3D A;  4I0B A;  4XOR A;  2DMP A;  4ZDP A;  4CCO A;  2DA2 A;  5H20 A;  2RC4 A;  1RPW A;  1W0T A;  3OV8 A;  4WX9 A;  1U3E M;  2X51 A;  3OYK A;  1QHH D;  3GFI A;  5LHH A;  4KN4 X;  3FMQ A;  2Z5U A;  3WTV C;  3M9A A;  3QU6 A;  4BS9 A;  2A3S A;  2FNA A;  2H1L A;  4DYR A;  3TO9 A;  1XMX A;  2EQR A;  3GZ5 A;  4XKB A;  2R0Q C;  4A3L J;  1D1A A;  2ZJR F;  4IRG A;  2XB0 X;  3SFZ A;  3JAM K;  3E97 A;  4PJM A;  4YEJ A;  3RYR A;  2Y75 A;  5ILU A;  3BQZ A;  3ZMV A;  5CYV A;  1YJN I;  2DYS H;  4B43 A;  1KQ9 A;  2EA2 A;  3WU1 B;  1PJR A;  3K1M A;  2CQ7 A;  3H9J A;  3LA2 A;  4BE0 A;  2K3F A;  2LK2 A;  5F08 A;  1D5V A;  4B3A A;  4W97 A;  2B7E A;  2Y30 A;  4B09 A;  2QZ8 A;  5FO5 A;  2P7V B;  2LNB A;  4PK4 A;  2KFD A;  2V4J C;  4R79 A;  4AIJ A;  3GTQ J;  4RGU A;  3COA C;  3GWZ A;  3Q5F A;  1R49 A;  2QWW A;  3M8F A;  3RTR A;  3A2K A;  2RVC A;  3F6V A;  1MDM A;  4XQF A;  2OAZ A;  2X6O A;  1FMW A;  3DKW A;  2XGX A;  1ZRF A;  4EAT A;  3IH3 A;  2DYR H;  2LD5 A;  1D1C A;  3A01 A;  4S04 A;  1P92 A;  2Q2E B;  1Z6T A;  2IT0 A;  1ACI A;  2BV6 A;  1I5Z A;  3E6C C;  2BY1 A;  1WPK A;  5HOO A;  2DQL A;  2XB5 A;  4DGW B;  3KYD B;  3FXM A;  1F36 A;  3HRU A;  3H9G A;  1KQ0 A;  1Y1V J;  3ZP5 A;  4CYC A;  2NRA C;  4NNJ A;  2L7M P;  4ESJ A;  3IWZ A;  4ZYA A;  3EUH A;  3JTH A;  3CZ6 A;  3JRD A;  2O6G E;  2R7X A;  2K86 A;  3NWT A;  4LG3 A;  1A31 A;  2VQG A;  1Z1D A;  2G0E A;  3HTU A;  4UUS B;  2A07 F;  3PO3 J;  2AHQ A;  3HC7 A;  4Y13 A;  2DO7 A;  2X9D A;  2RKH A;  5DYM A;  1MH3 A;  4IQJ A;  1PUE E;  5DM6 F;  2HDC A;  5KNL A;  1FSH A;  1LE8 A;  4OIR F;  1F43 A;  1TW2 A;  3CJT B;  2A69 F;  3V8J A;  1TQM A;  3F23 A;  1Z3X A;  2MD0 A;  1QPI A;  2XF7 A;  4OU0 A;  2TCT A;  2IGM A;  1OQY A;  4A3M J;  1VQN I;  4KIB A;  4A69 C;  4F52 A;  2OV7 A;  3CF5 F;  3ASN H;  2BY3 A;  2Y0M A;  1Z91 A;  3TOA A;  3IV5 A;  2HR3 A;  4XON A;  3R60 A;  4RAG A;  1OYY A;  2RNG A;  2UV1 A;  1G3Y A;  1SAX A;  3DKX A;  5E3N A;  1BR2 A;  1G2H A;  2Z1D A;  1P4X A;  4XRF A;  4GRI A;  2OTL I;  3IRR A;  1JE8 A;  3GLX A;  4HYE A;  3GME A;  4BQA A;  1I1S A;  1PDN C;  3I3L A;  2NXN B;  2L3D A;  3HSE A;  3OIO A;  1LQ1 A;  3SZT A;  4M3F A;  4C2M J;  1BW6 A;  3K0L A;  2WA0 A;  5ICF A;  1WJD A;  1YRN B;  1HKQ A;  5CVR A;  4KT6 A;  2KRC A;  3KZY A;  5F0H A;  2HYJ A;  1SMT A;  3BPX A;  3MQ0 A;  1V4R A;  4ENJ A;  2E1M C;  3HZJ A;  2LSO A;  1A6Q A;  3QOE A;  1BI0 A;  2YX4 A;  2ZSI B;  1GDT A;  3A0B C;  3A1Y A;  4I02 A;  1W1W E;  3M3Y J;  1D5Y A;  1VTN C;  2BY0 A;  3ABK H;  1DP3 A;  2K40 A;  2OPT A;  5E1Z B;  3L2R A;  1ETQ A;  1JKQ C;  3J7Z I;  4Q48 A;  4JX5 A;  4BYY A;  5DV5 A;  5LRR A;  1R5G A;  2QSF X;  2XGC A;  3V7C A;  1JI8 A;  2QA4 I;  1JT0 A;  1KU7 A;  2VB6 A;  4CCL A;  3E7L A;  2AXL A;  1WI9 A;  1MBG A;  2CQQ A;  4V2F A;  4UV8 A;  3ULQ B;  1JJ6 C;  2Y9Z A;  1SAN A;  3F8N A;  1K78 B;  2LFB A;  3ZR8 X;  3BY6 A;  5CQG A;  1PUF A;  4FCY A;  1HOM A;  1RUO A;  4BJT A;  1NG7 A;  1WI3 A;  1S9H A;  5E3O A;  1B9N A;  3RKY A;  3F8F A;  5JHU A;  4LD5 A;  1AOY A;  3OYF A;  5D4S A;  3MKZ A;  3LSJ A;  5M3M J;  2Z99 A;  4HZF A;  1S3J A;  3L2W A;  3F3X A;  3GFL A;  2NS8 A;  3K7A J;  1ZR4 A;  4NQW A;  2C6Y A;  4OMZ A;  2P6T A;  5EF6 A;  2DMU A;  3KEO A;  4HQE A;  4AM3 A;  3K4N A;  3DU5 A;  1SEU A;  5L3F A;  3BP8 A;  3V7R A;  2FSW A;  3BWG A;  1JUM A;  5LHI A;  3HGY A;  2LRE A;  2VXD A;  2QQ8 A;  2XVC A;  3BZK A;  1GLN A;  1ZHF A;  4HNT A;  2WAQ N;  4FHT A;  4XLF A;  4CH7 A;  4XLH A;  2ZNZ A;  4DJA A;  1CQT A;  2VOP A;  2IEK A;  1WQ2 A;  2X6Y A;  5E8I A;  1B4A A;  2F4M B;  3MKL A;  3QU3 A;  2O8K A;  4XMY A;  2PFB A;  1ZN2 A;  2EFN A;  4R1H A;  2VE8 A;  4M9S A;  1MGT A;  1BC8 C;  2OCE A;  2KIU A;  1ON1 A;  4HF0 A;  2EIN H;  1G59 A;  3AG2 H;  3JAM Z;  2V1X A;  3MAJ A;  3HPG A;  2WWY A;  4ZTJ A;  1ITY A;  1XGN A;  2HOS A;  1YYV A;  2R5Z B;  2JA2 A;  3BT9 A;  4DW6 A;  1ONV A;  3WG9 A;  4BL0 B;  1ZG1 A;  4RGS A;  3S32 A;  1RES A;  2E5N A;  5IYB J;  1LFU P;  1ETY A;  4Y52 J;  3OL4 A;  2XSJ C;  3MD2 A;  5B3S H;  4PFP A;  2KL4 A;  1R36 A;  4P55 A;  1Y1W J;  2ZJQ F;  2LRD A;  3X2Q H;  2JA7 J;  3FX3 A;  2D1V A;  4GYG A;  2VBW A;  5C3E J;  2O5R A;  2XGE A;  3J7Y J;  4LB5 A;  3I58 A;  1J59 A;  5GP9 A;  1IUY A;  1R58 A;  3EUH C;  4RB0 A;  3BLY A;  2VBZ A;  3DTK A;  1S8N A;  3IWF A;  3ML6 A;  3QYE A;  4HEA 2;  4EGY A;  2H1K A;  3VYS B;  4WK8 F;  2O3F A;  4CUG A;  3ZQL A;  5CPR B;  1R5I D;  4XIC A;  1ZH5 A;  4WF2 A;  1LUJ B;  2F48 A;  1EH8 A;  5IYC J;  2QQA A;  2H27 A;  2L4A A;  2ICW G;  2WY7 Q;  5HLH A;  1YE9 A;  2M4G A;  5J1R A;  1HW5 A;  3LSP A;  4BY1 J;  1BIB A;  2EFO A;  2CUZ A;  1OCZ H;  2H94 A;  4L0Y B;  1D8J A;  2MLG A;  4BHC A;  4XK4 A;  1K83 J;  3GTJ J;  3VFZ A;  1EH6 A;  5JFR A;  5DUK A;  2TRT A;  2LF7 A;  2DA7 A;  3BC8 A;  4KIT B;  1WVR A;  1RKT A;  1G3W A;  5HDK A;  2L2O A;  3A02 A;  5C4X J;  5KK1 A;  2M8G X;  2YX7 A;  4HX7 A;  4KUM A;  4LLN A;  1Y8Q B;  2ZME A;  1FLI A;  4EJW A;  5JLX A;  1BM9 A;  2KT0 A;  3W2V A;  2R3S A;  3HSF A;  1TT0 A;  4H4K C;  4CSW A;  5D5V B;  2HYG D;  1VQP I;  1NHA A;  2F5V A;  4Y7N J;  2RQP A;  1S6L A;  5IOZ A;  3SDB A;  5B66 C;  1IGN A;  1EKE A;  3HTS B;  1OJL A;  4PJL A;  1NTC A;  3I4M J;  2M87 A;  1X3U A;  4D7N A;  4UNO A;  2CJJ A;  2R7T A;  3DQV C;  3IUO A;  2VAS A;  3P9I A;  4OWR B;  3C2H A;  3ZPL A;  1XSV A;  2UXN A;  3RPU D;  1ORK A;  3K4K A;  4L9J A;  1OR7 A;  1RR8 C;  2XKP A;  2K02 A;  1H9G A;  2W82 A;  1P7J A;  3OMY A;  5D5X B;  3S3O A;  2V1N A;  4F93 B;  2W85 A;  2GM4 A;  1R1T A;  4XRS G;  1IN5 A;  2BBY A;  2M0C A;  2AO9 A;  1B72 B;  4E7H A;  2KLO A;  4HBL A;  1JKP C;  1MNM C;  3C7J A;  3L2U A;  4FE7 A;  1U5T B;  5F1J A;  2XPW A;  2X1E A;  4DOZ A;  5HNH A;  1YLF A;  4G94 A;  2DMN A;  4G7H F;  1A5J A;  1OCP A;  1YIT I;  9ANT A;  1R4M B;  2XAJ A;  1B8I A;  2W24 A;  2RV8 A;  2V6C A;  1OCT C;  3IHU A;  3A4C A;  3CTA A;  1T98 A;  1KZH A;  3UKG A;  3S15 J;  4A0X A;  4C3I J;  3PJR A;  2WB1 N;  2BOL A;  3DEU A;  4M9X A;  5FKK A;  2QF7 A;  2NVY J;  2FEZ A;  5J8F A;  1RC9 A;  3W6J B;  5EEA A;  2M45 A;  5E1W A;  2MFZ A;  3H9Q A;  4D5F A;  3WHB A;  3ASO H;  2ECC A;  1FOW A;  5DD4 A;  1BR4 A;  3M8J A;  2K9L A;  3MEX A;  1W0U A;  3HUG A;  5EEG A;  3BQY A;  2VBX A;  3E1S A;  3K4J A;  4KNY A;  4I01 A;  1X4P A;  3D0S A;  4UXN A;  1QQI A;  2LBF B;  3BR0 A;  3K70 D;  2K7L A;  3DXJ F;  3NWS A;  1SAU A;  4HAM A;  2V1U A;  5F1R A;  2ME0 A;  2VN2 A;  5J40 A;  5A2Q K;  1WJE A;  2V9V A;  3HJE A;  3SEQ A;  4LB6 B;  1UHM A;  1F4K A;  2XF5 A;  2M0M A;  1QGP A;  2VUM J;  3HOT A;  3LSH A;  3GCM A;  3V42 A;  2DA6 A;  2A68 F;  3S2D J;  1R5H A;  1V54 H;  5ICE A;  4X0G A;  3KFW X;  4IHY A;  1D8K A;  2BEO A;  3CF2 A;  4WXC A;  1WFX A;  4ESB A;  3JRH A;  4QIW N;  4B4C A;  4A3J J;  2PMU A;  5HOD A;  4A3E J;  3CUQ A;  2A61 A;  1GVD A;  4A12 A; 
#chains in the Genus database with same CATH homology
 4M73 A;  1Z7U A;  2NNN A;  2XKO A;  4OIP F;  4U0V A;  1W7P B;  1E17 A;  2ELH A;  1YQA A;  2HS5 A;  3NEU A;  4MTE A;  4EV0 A;  5TRD A;  3ISP A;  1H0M A;  5L3G A;  5CVU A;  5JVT A;  5D6F A;  3FM5 A;  1HXD A;  3TGN A;  2ZFW A;  2PLY A;  1FSE A;  4L5J A;  2P5K A;  4EM0 B;  4I98 B;  1MJA A;  3BJ6 A;  3V7S A;  3BOQ A;  3AAF A;  2EFP A;  5FLX K;  3L09 A;  4Q47 A;  5CJ9 A;  3LAP A;  3IRQ A;  3F21 A;  1SD5 A;  1SMY F;  3KLN A;  2VOD A;  4L9N A;  1ON2 A;  3E6D A;  1RNL A;  5HDG A;  5J8C A;  3DP7 A;  3KP2 A;  3GFJ A;  4LGW A;  3T5X A;  4CHU A;  3E3V A;  1FWZ A;  1TNT A;  1LDJ A;  4KMU X;  3IKV A;  1R7J A;  1O3S A;  2VT3 A;  2H6C A;  2FXA A;  3GXO A;  3E6B A;  1TLH B;  2Z9O A;  1WKM A;  3B73 A;  4U7B A;  5LEJ A;  1IRG A;  4LG0 B;  2QUF A;  2NS0 A;  5LEK A;  3QP6 A;  4U7D A;  4RAY A;  2ZO4 A;  2ESH A;  1SD4 A;  5ILV A;  2HQN A;  2QM3 A;  4FT8 A;  1FP2 A;  5TJJ A;  1KU2 A;  2F2E A;  3S2W A;  1ZRD A;  2DQR A;  1R22 A;  5ICC A;  3VOE A;  3TOB A;  3CDH A;  1Z6R A;  1Q1H A;  2EA4 A;  5HLG A;  4RB2 C;  5LLQ A;  3LFK A;  3I59 B;  2E1N A;  2STT A;  2LKP A;  1ZLK A;  3RPU A;  4YFX F;  4RGR A;  1PP7 U;  2DAO A;  2DTR A;  4M72 A;  3WU0 A;  4PGH A;  3ZN0 A;  1MJB A;  2DFI A;  3T8R A;  2Q8K A;  4EJT A;  2EV6 A;  2VBY A;  3NRV A;  1L0O C;  2UXX A;  5A2Q Z;  2D1H A;  2DI3 A;  4CIC A;  4UHT A;  1ZRE A;  1ZG5 A;  3KP7 A;  2FRH A;  4MEY F;  3WE2 A;  3SXY A;  4CGZ A;  2X0L A;  3CJN A;  5KVR A;  5K5Q A;  2V79 A;  4JBA A;  3GZ6 A;  2O61 A;  2FBH A;  2YSR A;  3FZV A;  2MH2 A;  2YR2 A;  1K78 A;  4ZH4 F;  4KIG A;  1I27 A;  4PZJ A;  4BHP A;  2A6H F;  2HQR A;  5L3C A;  3P9C A;  1K79 A;  4ASN A;  2ZXJ A;  3NQO A;  1TW3 A;  3BPV A;  2XAS A;  1ZRC A;  3E5X A;  1O7L A;  3QAH A;  4ENM A;  5CVJ A;  5CVI A;  5ED4 A;  4NB5 A;  1XB4 A;  3QPT A;  3TQN A;  1O3T A;  2VC1 A;  3MCZ A;  1FYK A;  4RAZ A;  5LGT A;  2P5L C;  5J6X A;  5FLX Z;  4RB3 C;  2QBY A;  3WTW C;  2EFW A;  2ZJ2 A;  3ABU A;  4LJZ F;  2OZ6 A;  3J80 K;  3R0A A;  5E18 F;  2CQK A;  2A6E F;  1YG2 A;  4M6X A;  1TBX A;  2GAU A;  2PBI A;  4GO1 A;  2MBF A;  2X4H A;  3K69 A;  3MZY A;  1R00 A;  1I1G A;  2RGV A;  2WTE A;  4M6Y A;  1CF7 A;  1IXS B;  2ZKZ A;  1LEA A;  2VXZ A;  3M1E A;  4G6D A;  4LFU A;  3LA3 A;  1FBS A;  1J75 A;  5E8G A;  4G7Z F;  4MNU A;  3BJA A;  4L9V A;  3V8K A;  4HDU A;  1KA8 A;  2L54 A;  5D6E A;  3D5L A;  4L5I A;  5BPD A;  1S7A A;  3ECH A;  1F9N A;  2F5C A;  3I4P A;  3JTG A;  2L02 A;  3GEZ A;  1SFX A;  4I7H A;  2E7X A;  2KJB A;  3ELK A;  3BJO A;  2MD5 A;  1FY7 A;  3WTX C;  1T2K A;  1JGS A;  5D5W B;  1UFM A;  3GUD A;  1Z9C A;  4WXH A;  3K1P A;  3P7N A;  2MH9 A;  4BHB A;  3KP5 A;  5L3B A;  1O3R A;  3PQJ A;  3ERE D;  2PN6 A;  4PCQ A;  3FM3 A;  1BC7 C;  1ZG3 A;  2EV5 A;  4AIK A;  1U5T A;  1YW7 A;  4UVB A;  2TDX A;  2FF4 A;  2J5O A;  2HWV A;  3U9G A;  5AIQ A;  3KLO A;  3WTS C;  1O3Q A;  2F5D A;  1UST A;  5HS7 A;  2RN7 A;  3F72 A;  4MQV A;  2ETH A;  5CLS A;  3HRT A;  3T0Y A;  1DDN A;  1LDK B;  4KDP A;  1UB9 A;  4P96 A;  1O57 A;  1BJA A;  1MKM A;  2GWR A;  3LAJ A;  4ENK A;  4GCV A;  4BNC A;  4XLN F;  4N0B A;  4WWC A;  1JHH A;  3I71 A;  1ODD A;  3REO A;  3I53 A;  4KIC A;  1YTY A;  3ZMT A;  3W6K B;  4H0E A;  2EJR A;  4LLG F;  1FT9 A;  2XUB A;  3MFK A;  2GXG A;  4IVN A;  1STZ A;  5FD6 A;  4P9U A;  4ZYD A;  1G3T A;  4JQF A;  3V8L A;  2FE3 A;  2LF8 A;  3HSR A;  1OMI A;  2OBP A;  2W57 A;  3J81 K;  3C18 A;  4EVI A;  4NHJ A;  1PP8 F;  4ESF A;  2JPC A;  3J80 Z;  5LGU A;  2VOO A;  5K5O A;  1GXQ A;  1CGP A;  4A5N A;  3RKX A;  5EEH A;  4ZYH A;  3EQL F;  1FYL A;  1BI3 A;  2IRF G;  2VON A;  4XBF A;  2CFX A;  4ZYG A;  1FX7 A;  1OYW A;  1YIO A;  3WGI A;  5DEQ A;  5BS6 A;  1ZLJ A;  1HKT A;  2W25 A;  1BN5 A;  4AWX B;  5HDN A;  1IZ1 A;  4EM2 A;  4M9Z A;  1QNT A;  1W5S A;  5BQT A;  3ECO A;  4OIO F;  4BXU A;  3TDZ C;  1T38 A;  1OPC A;  4G8X A;  2FBI A;  2DT5 A;  4I0A A;  4G6Q A;  1KYW A;  4EJO A;  3EET A;  5K1Y A;  4LK1 F;  2JPB A;  3MWM A;  1IXR C;  2H09 A;  5E1X A;  5LRS A;  1DPR A;  5DD8 A;  1GVJ A;  3WTZ A;  2JTV A;  3LA7 A;  4ON0 A;  3HRS A;  1B59 A;  4IRH A;  3HHH A;  5JR3 A;  1O7F A;  2FQ3 A;  1HW2 A;  1U5T C;  3L7W A;  3CUO A;  3FXQ A;  1QBJ A;  1TTY A;  2XAF A;  4LG0 A;  5D8K B;  2L4M A;  2VE9 A;  4G9Y A;  2KKO A;  3WE3 A;  3R0J A;  4QLC U;  4CDG A;  2OA4 A;  1IRF A;  3PQK A;  1G4D A;  5FGM A;  1UCR A;  1XN7 A;  1P6R A;  1P2F A;  2YU3 A;  2VT2 A;  2D2W A;  1LVA A;  1TQI A;  5F6F A;  4RB1 A;  5FB2 A;  3ZQ7 A;  4LMY A;  1BOA A;  2EWN A;  4BH9 A;  1DP7 P;  2P6S A;  3HHG A;  2XRN A;  1Y0U A;  1IN4 A;  4Y17 A;  1HBX G;  4HLY A;  4KT5 C;  1WSU A;  2EB7 A;  1G6N A;  2OQG A;  4HDV A;  4JK1 X;  2OD5 A;  1LEB A;  4A5M A;  4HW0 A;  3RKW A;  1P4A A;  4IHS A;  5D8L B;  3HRM A;  4IHT A;  1BIA A;  3ZMZ A;  4HF2 A;  4B8X A;  1UHW A;  5JI6 A;  2DW4 A;  2PQ8 A;  3IC7 A;  4I2O A;  1F1Z A;  3O6B B;  2HZT A;  2HTJ A;  2P8T A;  5HVQ C;  3ROU A;  1XSD A;  1E2X A;  4TV7 A;  4R8H A;  4D0P A;  5H6Q A;  2AS5 F;  3BDD A;  1J0R A;  1KQ8 A;  3RI4 A;  4MTD A;  2HOE A;  1QPM A;  1V3F A;  1XGS A;  1FOK A;  2JRT A;  2QQ9 A;  2Q2E A;  2ADU A;  2RNJ A;  4EJU A;  4MQ9 F;  3VOD A;  2ISY A;  2PMH A;  3FMS A;  5CVV A;  2DPD A;  5K5R A;  3I64 A;  1JXS A;  4L9T A;  1HKS A;  2M8E A;  4RS8 A;  4LLL A;  1ZYR F;  2IA2 A;  5LBQ A;  2J5P A;  4XSX F;  3LWF A;  3FXR A;  4UV9 A;  3KP6 A;  3G73 A;  1RZ4 A;  3EYY A;  1AWC A;  2O0Y A;  3U2R A;  4ZZD A;  2UZK A;  2FBK A;  1J5Y A;  5FFZ A;  5DCM B;  3R6S A;  1LDD A;  3JSO A;  3H92 A;  3BRO A;  2XRO A;  2PJP A;  6PAX A;  4ENN A;  2IPQ X;  4ZZL A;  2CW0 F;  2V1D A;  2K4J A;  2QVO A;  4N9H A;  1R23 A;  4CZZ A;  4EJV A;  2GA1 A;  3WTT C;  1W5T A;  4PDK A;  4IRI A;  4EQQ A;  2CO5 A;  3CUQ C;  3J7A O;  1YO5 C;  2ZNY A;  3K2Z A;  3GF2 A;  4Q5S F;  3EYI A;  1YS6 A;  3ABT A;  1MJ9 A;  3GVA A;  2YPR A;  4YFN F;  2IA0 A;  2NNY A;  3F8B A;  4UVA A;  5H6R A;  1W7P D;  4A6E A;  2KIF A;  4A6D A;  4HV5 A;  1XSX A;  5LHG A;  3KE2 A;  1FBU A;  2IW5 A;  5L3E A;  1K7A A;  2P5V A;  3ZMU A;  2NAZ A;  4O3M A;  1XCB A;  2XIG A;  4AIH A;  1DUX C;  4M71 A;  2K27 A;  1KYZ A;  4IF4 A;  2O8X A;  2QLZ A;  2WV0 A;  2G7H A;  1ZGA A;  4KA4 A;  3KCC A;  1EH7 A;  2PG4 A;  2M1B A;  3ZMS A;  4CYD A;  1OYI A;  3DF8 A;  3F8C A;  1SD6 A;  3WGG A;  2LDU A;  3LQR A;  4YG2 F;  1SFU A;  1MZB A;  2JSC A;  4Z2Y A;  2E1C A;  1LNW A;  1WRJ A;  3WTY C;  2KRF A;  2ISZ A;  2QQB A;  4IPA A;  4CXF A;  2IVM A;  2B0L A;  2Y48 A;  2PEX A;  1XCV A;  3G3Z A;  2UWM A;  3PFI A;  1FPQ A;  2G9W A;  1XGO A;  4Q4Z F;  5HLI A;  2XV4 S;  2FA5 A;  4G7O F;  3CO7 C;  2CG4 A;  2NYX A;  1GXP A;  4MEX F;  3MZH A;  1R1V A;  3K1N A;  2EK5 A;  3T1B A;  2OU2 A;  2GXB A;  1A04 A;  3B02 A;  3GFM A;  3HIF A;  1T6S A;  1ZAO A;  3P9K A;  1IN6 A;  1IXC A;  4O6J A;  3QRF F;  3TO6 A;  2P4W A;  2O03 A;  4P9F A;  2R7D A;  1GHC A;  1FZP B;  1S29 A;  3U1D A;  2DU9 A;  1FC3 A;  1S7O A;  3GW2 A;  1D3Y A;  1TNS A;  2M5W A;  2MLK A;  2D45 A;  4XLP F;  1B6A A;  2HFH A;  3WTU C;  4YIF A;  1MDM B;  4Y15 A;  3K9T A;  2CGP A;  1B1B A;  4HA8 A;  5IT9 K;  4BAY A;  2FOK A;  4DNC A;  3RDI A;  2Q0O A;  1QZY A;  5E17 F;  4CO8 A;  1Z05 A;  1C0W A;  2Z33 A;  3RJP A;  3I5U A;  1U78 A;  4U88 A;  2MC3 A;  4OMY A;  4L18 B;  1LB2 A;  5ILS A;  2QBY B;  5DCF A;  3QOP A;  2MA3 A;  1BI2 A;  1IF1 A;  3VB2 A;  2KJC A;  2ZCW A;  5HS9 A;  3N97 A;  1ZGJ A;  4RGX A;  2XAG A;  3E6M A;  1JHF A;  2FNP A;  3BZ6 A;  4OIQ F;  4KIF A;  1YW9 A;  4M74 A;  1RI7 A;  4HOB A;  3H3U A;  3FXU A;  4YFK F;  2GQQ A;  3L00 A;  1T39 A;  2OZU A;  5F64 A;  5DDG A;  1K6O A;  1U8R A;  1CF7 B;  1DPU A;  2FU4 A;  4KFC A;  3R4K A;  4GGG A;  1U6G A;  1HW1 A;  2Z3Y A;  1SFE A;  4HF1 A;  1IAW A;  2JT1 A;  2XAQ A;  1W7P A;  3SQN A;  4OOI A;  3DFG A;  1SD7 A;  3C1D A;  4U0W A;  4A0Z A;  4FX0 A;  5LGN A;  3LST A;  2L01 A;  1J9I A;  4AD9 A;  1T0F A;  4MHG A;  5AIP A;  2RDP A;  2HKO A;  5FD5 A;  4A0Y A;  3KZZ A;  1R1U A;  2EFQ A;  2E7W A;  3SZP A;  2IA1 A;  3ZMD A;  3F6O A;  4EGZ A;  3KEQ A;  1I6X A;  2EV0 A;  5D5U B;  1W4M A;  3EDP A;  4AVP A;  5ICG A;  2WC2 A;  2DK8 A;  1J7K A;  3CLO A;  3GO5 A;  2XHK A;  5BPI A;  2KIM A;  2QEN A;  3Q9S A;  4HLX A;  2HEO A;  4MGR A;  1TQP A;  1L3L A;  3CO6 C;  4GXO A;  3ZN1 A;  3M7G A;  3FHZ A;  4UUV A;  3QPH A;  1KU3 A;  3F22 A;  2H6B A;  3E5Q A;  2F5E A;  1QO0 D;  3TO7 A;  1YW8 A;  2W84 A;  3VEP A;  3FMR A;  1BBY A;  3TKY A;  2ACJ A;  3KP4 A;  2CSO A;  2BYV E;  1YS7 A;  2K4B A;  4OIN F;  2ZBK A;  3I0T A;  3OOP A;  1H9T A;  4EM1 A;  3T8T A;  1IW7 F;  1EV7 A;  3R61 A;  1RIO H;  1U2W A;  5IT9 Z;  1J2X A;  2GIV A;  2DK5 A;  2IJL A;  5DUI A;  3O2P E;  4WCG A;  5FFX A;  2PI0 A;  5D4R A;  4XSZ F;  5HS8 A;  1KGS A;  2STW A;  2QYO A;  3KP3 A;  4YII A;  1XMK A;  4K2E A;  3WOD F;  3DPL C;  2DLL A;  5DCM A;  1F5T A;  2ZME B;  3I59 A;  2BGC A;  2COM A;  4HX4 A;  4KMF A;  3FWE A;  3GX4 X;  4HX8 A;  3IL2 A;  1YFH A;  2FML A;  3GYH X;  5AON A;  3KET A;  1RUN A;  2F5F A;  1B9M A;  4A2U A;  4WXD A;  4DQ2 A;  3H3Z A;  2GA2 A;  2R7F A;  4I09 A;  2P7C B;  3IKT A;  1P4W A;  2DPU A;  3O3K A;  4HQM A;  1XMA A;  1XGM A;  1XDU A;  3V4G A;  4P5O A;  3J81 Z;  1REP C;  1MD0 A;  1G3S A;  2IP2 A;  4F7Z A;  5E20 A;  1OKR A;  4O5V A;  3WGH A;  4IXA A;  3HYI A;  2A5Y B;  2BE5 F;  4LK0 F;  2FMY A;  1USS A;  3RYP A;  1KU9 A;  4GYI A;  2GZW A;  2HTS A;  5BOX A;  4U0Y A;  3C3W A;  3L9F A;  3DV8 A;  3QP5 A;  4L0Z B;  2JZY A;  4E70 A;  1HQC A;  3LQQ A;  3TDU C;  3JW4 A;  3L2C A;  3Q9V A;  2M30 A;  4IJA A;  1FYM A;  4FX4 A;  2HYF A;  4ETS A;  4KYW A;  3F8M A;  1IN8 A;  2OQR A;  2VC0 A;  1BI1 A;  1FP1 D;  4EMS A;  3E5U A;  3DPT A;  3CUQ B;  4N9I A;  5BMZ A;  3I54 A;  3M8E A;  1IN7 A;  2ESN A;  4HV6 A;  3RPQ A;  1XDS A;  1HSJ A;  2HKX A;  4QWQ A;  4UVC A;  3FF5 A;  2CWE A;  3SHF A;  3HOS A;  1ZAR A;  5ERI A;  1QZZ A;  2G7U A;  1LJ9 A;  2CYY A;  1FNN A;  1FBQ A;  1ULY A;  4S05 A;  3N4M A;  2XAH A;  4PGG A;  1XD7 A;  1HST A;  2HGC A;  5IT3 A;  1WWX A;  4ZYE A;  4KN7 X;  3RIR A;  3JSP A;  2DBB A;  5L3D A;  4I0B A;  5H20 A;  2RC4 A;  3OV8 A;  4WX9 A;  1U3E M;  3GFI A;  5LHH A;  4KN4 X;  3FMQ A;  2Z5U A;  3WTV C;  3M9A A;  3QU6 A;  2A3S A;  2FNA A;  3TO9 A;  3GZ5 A;  4IRG A;  3SFZ A;  3JAM K;  3E97 A;  3RYR A;  2Y75 A;  5ILU A;  3ZMV A;  5CYV A;  1KQ9 A;  2EA2 A;  3WU1 B;  3K1M A;  3LA2 A;  1D5V A;  4B09 A;  2QZ8 A;  5FO5 A;  2P7V B;  2LNB A;  4R79 A;  4AIJ A;  4RGU A;  3COA C;  3GWZ A;  3Q5F A;  2QWW A;  3M8F A;  3RTR A;  2RVC A;  3F6V A;  1MDM A;  2OAZ A;  3DKW A;  2XGX A;  1ZRF A;  4S04 A;  1P92 A;  1Z6T A;  2IT0 A;  2BV6 A;  1I5Z A;  3E6C C;  5HOO A;  2DQL A;  3HRU A;  1KQ0 A;  3ZP5 A;  2NRA C;  4ESJ A;  3IWZ A;  3EUH A;  3JTH A;  2O6G E;  2K86 A;  1Z1D A;  3HTU A;  2A07 F;  4Y13 A;  2DO7 A;  2RKH A;  5DYM A;  1PUE E;  2HDC A;  1FSH A;  4OIR F;  1TW2 A;  2A69 F;  3V8J A;  1TQM A;  3F23 A;  4OU0 A;  4KIB A;  2Y0M A;  1Z91 A;  3TOA A;  2HR3 A;  3R60 A;  1OYY A;  1SAX A;  1G3Y A;  1P4X A;  4XRF A;  3IRR A;  1JE8 A;  3GLX A;  4HYE A;  4BQA A;  1I1S A;  1PDN C;  1LQ1 A;  3HSE A;  2L3D A;  3SZT A;  3K0L A;  5ICF A;  1HKQ A;  5CVR A;  3KZY A;  1SMT A;  3BPX A;  3MQ0 A;  1V4R A;  4ENJ A;  2LSO A;  1BI0 A;  2YX4 A;  4I02 A;  1VTN C;  5E1Z B;  4Q48 A;  4BYY A;  5DV5 A;  5LRR A;  1R5G A;  3V7C A;  1KU7 A;  2AXL A;  1WI9 A;  3ULQ B;  4UV8 A;  3F8N A;  1K78 B;  3BY6 A;  1RUO A;  1B9N A;  3RKY A;  3F8F A;  5JHU A;  4LD5 A;  1AOY A;  5D4S A;  2Z99 A;  4HZF A;  1S3J A;  3F3X A;  3GFL A;  4NQW A;  2C6Y A;  4OMZ A;  2P6T A;  3KEO A;  4HQE A;  5L3F A;  3BP8 A;  3V7R A;  2FSW A;  3BWG A;  5LHI A;  2XVC A;  1ZHF A;  4FHT A;  2ZNZ A;  2VOP A;  1WQ2 A;  5E8I A;  1B4A A;  3QU3 A;  2PFB A;  1ZN2 A;  2EFN A;  4R1H A;  2VE8 A;  4M9S A;  1MGT A;  1BC8 C;  2KIU A;  1ON1 A;  4HF0 A;  3JAM Z;  2V1X A;  3MAJ A;  2WWY A;  1XGN A;  1YYV A;  1ONV A;  3WG9 A;  1ZG1 A;  4RGS A;  1R36 A;  4P55 A;  3FX3 A;  2D1V A;  4GYG A;  2VBW A;  4LB5 A;  3I58 A;  1J59 A;  1IUY A;  1R58 A;  4RB0 A;  3ML6 A;  2VBZ A;  3IWF A;  1S8N A;  4EGY A;  4WK8 F;  2O3F A;  1ZH5 A;  4WF2 A;  1EH8 A;  2QQA A;  2H27 A;  2L4A A;  5HLH A;  1HW5 A;  1BIB A;  2EFO A;  2H94 A;  4L0Y B;  1D8J A;  2MLG A;  4BHC A;  3VFZ A;  1EH6 A;  5JFR A;  5DUK A;  2LF7 A;  1G3W A;  5HDK A;  5KK1 A;  2YX7 A;  4HX7 A;  4KUM A;  4LLN A;  2ZME A;  1FLI A;  4EJW A;  1BM9 A;  5D5V B;  2R3S A;  3HSF A;  2HYG D;  1NHA A;  2RQP A;  1S6L A;  3HTS B;  2M87 A;  1X3U A;  4UNO A;  3DQV C;  3P9I A;  3ZPL A;  1XSV A;  2UXN A;  4L9J A;  1OR7 A;  2XKP A;  2K02 A;  1H9G A;  5D5X B;  2W85 A;  1R1T A;  1IN5 A;  2BBY A;  4HBL A;  3C7J A;  1U5T B;  1YLF A;  4G94 A;  4G7H F;  2XAJ A;  2W24 A;  2RV8 A;  2V6C A;  3IHU A;  3CTA A;  1T98 A;  4A0X A;  3DEU A;  4M9X A;  2FEZ A;  5J8F A;  3W6J B;  2M45 A;  5E1W A;  5DD4 A;  3MEX A;  3HUG A;  5EEG A;  2VBX A;  4KNY A;  4I01 A;  3D0S A;  4UXN A;  1QQI A;  2K7L A;  3DXJ F;  4HAM A;  2V1U A;  5F1R A;  2VN2 A;  5A2Q K;  2V9V A;  4LB6 B;  1UHM A;  1F4K A;  1QGP A;  3HOT A;  2A68 F;  1R5H A;  5ICE A;  3KFW X;  1D8K A;  2BEO A;  4WXC A;  4ESB A;  2PMU A;  3CUQ A;  2A61 A;  4A12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...