3WTYC

Crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSPPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtyC00
1L0OC 1LEBA 1S6LA 2HTSA 1XB4A 3HSRA 5DCMA 5FGMA 2BBYA 3FWEA 3BJ6A 5K5RA 3QPHA 2X4HA 2YX4A 1TBXA 2Z3YA 3QOPA 3V8JA 2ADUA 4I98B 3C3WA 2CW0F 1KQ9A 3GEZA 1BIBA 1R7JA 4HF1A 4EJTA 4YG2F 2ZFWA 2PLYA 2EJRA 2AXLA 4D0PA 2RDPA 5E1XA 3DKWA 4UV8A 2IA0A 3DPTA 3GFLA 2HQNA 2HGCA 2RGVA 5L3BA 1LDKB 1SD7A 5LHIA 1B59A 1P2FA 3BJOA 1PP8F 2BGCA 5LBQA 2STTA 2PMHA 2XAGA 4KN7X 3U9GA 2KJCA 3T8TA 3KP7A 5CVJA 1OMIA 3FMRA 3FXRA 1G3SA 1Z1DA 4G7HF 4HDUA 3MEXA 4HAMA 1R23A 1J59A 1W5SA 2Z33A 2O03A 3PQKA 2V1DA 1YIOA 4IVNA 4KNYA 1IN8A 4CICA 5DYMA 5BMZA 2H27A 3GO5A 2QQBA 4I09A 2QQ9A 2P6TA 3GW2A 3JTGA 4EGYA 1BOAA 3F8MA 4MGRA 1EH8A 2O0YA 3L00A 4A2UA 5J8CA 4GGGA 4KIFA 1QQIA 5D8LB 2Q2EA 2GIVA 1T98A 3F3XA 3GXOA 1Z91A 4BQAA 1I1SA 2P4WA 1XSDA 2WC2A 1MJ9A 5IT9Z 4CDGA 4UVAA 5CVVA 2CYYA 1P4XA 4IF4A 2J5OA 4L9JA 2VOOA 1GVJA 2CQKA 3LA7A 4KMUX 2F5CA 3ERED 3BROA 4KUMA 1XDSA 2FE3A 1ZGAA 3HRSA 4BH9A 1J5YA 2W85A 1C0WA 5H6RA 4LK0F 2H6CA 1EH6A 5AIQA 3TGNA 2FQ3A 1FLIA 2P7VB 1YW9A 4BAYA 2L4AA 2ESHA 3TKYA 4L0YB 4HX7A 2DPUA 5E1ZB 2DTRA 1UCRA 3TQNA 1G6NA 3ZMVA 2VC1A 4UHTA 1FOKA 4Q48A 3ROUA 2YR2A 2XRNA 5J6XA 1XMAA 4M9SA 3KEQA 2XIGA 3HRUA 3D0SA 4GXOA 5K5OA 1ZRFA 2CFXA 3KLNA 2BE5F 2BV6A 3SZTA 4AIHA 1FX7A 5HDGA 5FFZA 2DFIA 2HR3A 3HYIA 1JXSA 4IXAA 2XKPA 2FXAA 4A5NA 2MBFA 4U0WA 5K1YA 2JTVA 3K1PA 3TOBA 3I5UA 3I58A 4YFXF 4P55A 3ELKA 2EV5A 3ABTA 5L3GA 3SZPA 3DP7A 3F72A 2LSOA 4CO8A 2RN7A 1JHFA 3WTSC 4KIBA 3E6BA 1YYVA 1IUYA 3R4KA 5D4RA 1FYMA 2QYOA 2M30A 4BHPA 2CGPA 3ZMZA 2ZNYA 2LF8A 3WTVC 3KE2A 1USTA 3G3ZA 2W57A 3VFZA 3WE2A 4YIIA 1R5HA 4ESBA 3CUQC 2ZJ2A 1UFMA 3KCCA 4HLXA 1WKMA 4CZZA 1KU2A 2L4MA 2VBWA 3LAJA 3IWFA 2Z5UA 2O8XA 3FX3A 1XN7A 2K4JA 2Y75A 3AAFA 3E3VA 2P5KA 2XAJA 4B09A 1KYWA 2FA5A 5F64A 2XHKA 1RNLA 2XASA 3RPUA 5CLSA 5HLGA 2EB7A 3IHUA 5D5XB 4NB5A 4HZFA 3U2RA 1FPQA 5HDNA 2PBIA 3V4GA 2KIFA 2RNJA 3M1EA 2D1VA 2NS0A 4HA8A 4JBAA 4K2EA 2Z99A 1O3SA 5AONA 4G7OF 1KA8A 3GLXA 5ICFA 2PMUA 1D3YA 1R36A 4ZH4F 1MJAA 1JGSA 1HW1A 4PGHA 1ZH5A 1YW7A 3L2CA 1ZREA 1ZG5A 1J0RA 3M7GA 1UB9A 3CUQB 1LQ1A 1IF1A 1G3YA 5BPDA 4OIOF 4BHBA 3FM3A 2D45A 1RUNA 1YO5C 4OMZA 3HOSA 4KT5C 1P6RA 2M5WA 2QLZA 1F1ZA 3BP8A 4Y13A 2CG4A 3ZMTA 4L9NA 4M72A 2ZMEA 5ILUA 3JSPA 4KFCA 5HS9A 1TTYA 3E6CC 2UZKA 3QU6A 1SD6A 2HOEA 1S7AA 1L3LA 1XD7A 2ZMEB 3N4MA 1HKSA 2M1BA 3TOAA 4PZJA 1IRGA 1KU9A 4N0BA 3WTXC 4CYDA 1FSHA 3HSEA 3KP5A 3EDPA 2R3SA 2IVMA 2JPBA 4RAYA 4BYYA 1G3TA 2QENA 1YW8A 3OV8A 2MA3A 2ACJA 3GF2A 2PJPA 2DBBA 2XAQA 2CWEA 2YPRA 1Q1HA 5D5UB 2L54A 2G9WA 4IRGA 4MQ9F 4XLPF 1XCVA 3O6BB 2RC4A 4BXUA 4IHTA 4R1HA 2DK5A 1MGTA 2GXGA 3LFKA 1MKMA 3E6MA 1U2WA 3KP2A 3LQQA 4P96A 2Q0OA 1R5GA 2WWYA 3RTRA 2A61A 2P5LC 4KDPA 2XGXA 2FOKA 2K4BA 4ZYHA 3J80K 3WU1B 1HXDA 3V7SA 3GYHX 1QPMA 4LFUA 4O3MA 3WTTC 3BY6A 3N97A 1Z7UA 1ODDA 1ON1A 2FEZA 2Q8KA 2KIUA 3WG9A 2XVCA 4AD9A 5F1RA 1RI7A 5H20A 2ESNA 2V9VA 2IJLA 3B02A 4L18B 2JPCA 3MCZA 1F5TA 4ETSA 1TNTA 3FXUA 3I64A 1ON2A 2DQRA 1ZARA 4HV6A 1OKRA 2DO7A 2EFOA 1P4AA 2HKXA 3F8NA 1BI1A 1S7OA 2HYGD 2BEOA 4P9FA 2VXZA 1FBSA 4RGUA 4HQMA 2L02A 1KYZA 4EM0B 5L3EA 4G6DA 3SHFA 4M73A 1BM9A 5FB2A 3V7CA 4A0YA 5EEGA 2E1CA 3PQJA 1PUEE 1OYWA 3DXJF 1J75A 4JQFA 4XRFA 4M71A 5DEQA 2K27A 1HW2A 5JI6A 3J7AO 4DQ2A 2VC0A 3WTWC 1IW7F 3ZMSA 1G3WA 1T2KA 2F2EA 3K2ZA 1TQPA 3ZQ7A 3REOA 4I2OA 4LGWA 1XGMA 1EH7A 3QRFF 1USSA 1I27A 1KU3A 3E97A 3I54A 3ABUA 1LJ9A 1YQAA 1Z6RA 2BYVE 4HX8A 3SFZA 1T6SA 4M6YA 2OD5A 1ZYRF 3OOPA 1B1BA 2DT5A 5E18F 3G73A 4HLYA 1T0FA 4U88A 2KIMA 2G7UA 1OR7A 4BHCA 5KVRA 2UXXA 1MZBA 1R22A 4EMSA 1P92A 1IN5A 2YX7A 2GWRA 4ZYGA 2EFPA 3GFJA 1IXSB 3KETA 3BPVA 2HKOA 2IT0A 3F22A 3RYPA 2PG4A 2EA2A 1GXQA 3COAC 2LF7A 3D5LA 4AVPA 4M9XA 2O3FA 1QGPA 3WE3A 2VBYA 2FMLA 2QQAA 5FD5A 2IW5A 2M8EA 1WSUA 1JE8A 3I0TA 4OOIA 3WTUC 4IJAA 4GCVA 2EWNA 3LA2A 1DP7P 3NEUA 2VODA 3O2PE 4RB0A 4LB5A 2FNAA 2L3DA 4OIQF 1YLFA 2OQRA 2Y0MA 3J81Z 5H6QA 1X3UA 4ENJA 5JR3A 3P9IA 3MAJA 5A2QK 4EQQA 4MHGA 2MD5A 2QM3A 1K6OA 1U8RA 4EJUA 4I01A 4HYEA 3E5QA 3BDDA 3T5XA 4OIRF 2V6CA 4GO1A 3GZ5A 4G94A 4MTDA 2HFHA 3H3ZA 1U6GA 1U78A 2NAZA 2DI3A 1W5TA 3F8BA 1UHWA 2QWWA 2A3SA 4R79A 5F6FA 1XGSA 1S29A 3KZZA 3IKVA 3J81K 3RPQA 3R61A 2DAOA 5KK1A 2NRAC 4U7DA 4GYGA 3ZPLA 4U7BA 3FHZA 1Z9CA 1KQ0A 2K86A 2LDUA 5ILSA 5LGUA 5DUKA 2QZ8A 4LLLA 2LKPA 5LGNA 2GAUA 2ZBKA 4UVCA 1GHCA 5AIPA 4EGZA 1O3QA 3KP4A 1I1GA 4IRHA 1O7LA 1RIOH 4L5IA 1Z6TA 2J5PA 1IN4A 1HW5A 3TO7A 2YSRA 4Q5SF 3SXYA 1LVAA 1O7FA 1HBXG 4LG0A 2D2WA 4G6QA 4L0ZB 3F8FA 3T8RA 4RB3C 2OU2A 1P4WA 2HQRA 3DQVC 4HQEA 1ZHFA 4OMYA 2K02A 4LG0B 1H9GA 3ML6A 1B4AA 1STZA 3HSFA 2W84A 4GYIA 5CVUA 3VEPA 5ICCA 2QBYB 1BIAA 2ZCWA 2EFQA 2XROA 3LQRA 4I02A 1PDNC 1D8JA 3U1DA 3MFKA 2Z9OA 2F5DA 3WGIA 5FLXK 3L09A 5ICGA 1BI0A 2JRTA 3K9TA 3RYRA 4EVIA 2F5EA 5ILVA 3EYYA 4PDKA 2MC3A 1ZGJA 1J2XA 4WX9A 5CJ9A 1ZLKA 1BC7C 5HVQC 4G8XA 2XAHA 4ASNA 5DV5A 5LGTA 4S05A 3LAPA 2HZTA 4EV0A 3HTUA 1YTYA 1QNTA 4OINF 1F4KA 1EV7A 1J7KA 5CYVA 4KMFA 4JK1X 4NHJA 3M9AA 3VOEA 3CUQA 1ONVA 1WQ2A 1FP2A 3JTHA 2XAFA 2XUBA 3IRQA 2A6EF 1U5TC 4ESFA 4MEYF 3ISPA 4LK1F 1R1TA 1LDDA 3P9CA 2HWVA 2WTEA 3LA3A 4EJOA 3R60A 2O61A 2V1XA 6PAXA 5CVRA 3PFIA 4P5OA 4HF2A 4XLNF 4YFKF 2RV8A 3L9FA 5L3CA 3I53A 4MEXF 1OPCA 2RKHA 5E20A 4YFNF 5HLHA 3ZMDA 3MWMA 2FRHA 2KKOA 3K0LA 3J80Z 3DPLC 1KQ8A 1QZYA 2HTJA 3HHHA 5E1WA 3SQNA 1XDUA 4OIPF 5L3FA 2EV6A 3TDZC 2H6BA 1SD4A 3MQ0A 3FXQA 4LJZF 1R58A 5TRDA 2IPQX 5DUIA 2A6HF 3FMQA 3GX4X 3K1NA 2OBPA 3FF5A 1FBUA 2IA1A 4WWCA 3RKWA 1AWCA 2STWA 4Z2YA 1ZAOA 4RB2C 1DDNA 4A0ZA 4EM2A 3K1MA 2A07F 2ZNZA 1QO0D 3GZ6A 2M87A 4ZYEA 2MH9A 5DD4A 4CHUA 4M6XA 1TW2A 2MH2A 1OYIA 3W6JB 1LNWA 3IRRA 1CGPA 1BJAA 2VOPA 5ERIA 3BJAA 1UHMA 1I6XA 2QVOA 5DCFA 3KP6A 1MD0A 3V8KA 3HTSB 5HOOA 4L5JA 2ISYA 1SAXA 4WK8F 1WWXA 4Y15A 1FSEA 4RGXA 1S8NA 3CTAA 3VB2A 2GXBA 3BWGA 5CVIA 2DU9A 5HS7A 4IRIA 4UNOA 3KP3A 3IL2A 4LLGF 5J8FA 3E6DA 4HBLA 2E7XA 5BS6A 5FO5A 4FX4A 1O3RA 3QP5A 2HEOA 3KEOA 3FM5A 1KGSA 1WRJA 1LEAA 2XKOA 4FX0A 3R6SA 3HRTA 2GA2A 1MJBA 1TQMA 4HW0A 4WCGA 3ECHA 3C7JA 3EYIA 4CGZA 5LEJA 4U0YA 3TO9A 3ZN1A 2IA2A 4AWXB 3MZYA 3I59A 5DCMB 4ZZDA 4A6DA 3HHGA 2VT3A 3VODA 1SMTA 3Q5FA 4A6EA 2WV0A 1IAWA 2FU4A 4MQVA 3HUGA 4N9HA 1R1UA 4HF0A 3I59B 1T39A 1YG2A 1BI2A 2P8TA 5JHUA 1F9NA 2OZ6A 2KRFA 1QBJA 2O6GE 3R0JA 5D8KB 3H3UA 3JW4A 4G7ZF 4FHTA 3KFWX 2YU3A 4IPAA 1IRFA 2V79A 3GFMA 2MLGA 3WTYC 3W6KB 5D4SA 5D5VB 3WTZA 1KU7A 1HSTA 3CJNA 3P9KA 3LSTA 2E1NA 1ZG3A 5LRSA 2VONA 4MTEA 2RQPA 2DQLA 3L7WA 1NHAA 4A12A 4I0AA 3GUDA 3BZ6A 2H94A 2RVCA 2X0LA 3QP6A 3V8LA 1FZPB 1TLHB 1K78A 1Y0UA 4LD5A 1RUOA 1XSVA 3HRMA 3CLOA 5LLQA 5HDKA 1JHHA 4FT8A 4OU0A 5JFRA 3F21A 1FP1D 3WGGA 5A2QZ 1K78B 1D8KA 1DPRA 4ON0A 1K7AA 5FD6A 3IKTA 3E5UA 2JZYA 5D6EA 1DPUA 2W24A 2TDXA 1LB2A 2DLLA 2XV4S 2VBXA 1W7PD 4KICA 2R7DA 2PEXA 3Q9SA 2NNYA 4HOBA 4YIFA 2H09A 4RS8A 2PFBA 2VE9A 5K5QA 5IT3A 1SD5A 1YS6A 4ZZLA 3B73A 3K69A 1SFUA 4L9TA 4O5VA 3O3KA 1B6AA 2ISZA 1LDJA 4KN4X 4G9YA 3JSOA 1R00A 1K79A 1Z05A 1XGOA 2PI0A 4S04A 2D1HA 4M9ZA 1V3FA 2W25A 2K7LA 4RGRA 3GVAA 3CO7C 4RB1A 2GQQA 1HQCA 1O57A 1ZN2A 2FSWA 2EA4A 1GXPA 5IT9K 4AIKA 1PP7U 1W7PA 1T38A 4L9VA 2GA1A 2NNNA 2QUFA 2UWMA 1B9NA 1HSJA 4TV7A 4A0XA 3RIRA 4PGGA 4P9UA 1XSXA 5LHHA 2A69F 1ULYA 1W7PB 2ELHA 3MZHA 4I7HA 2F5FA 2P5VA 5L3DA 2ETHA 2COMA 4EM1A 1WI9A 3T1BA 1TNSA 5ICEA 3HOTA 3Q9VA 2AS5F 2FF4A 1FBQA 3M8EA 4LMYA 3ULQB 2VN2A 3ZN0A 1FC3A 2LNBA 4R8HA 3M8FA 3CDHA 5DD8A 2JT1A 4UUVA 5FLXZ 2M45A 4NQWA 2G7HA 1YFHA 1VTNC 3WGHA 1FNNA 3F6VA 1E17A 3V7RA 4U0VA 4EJVA 5TJJA 5BQTA 4DNCA 4KYWA 2IRFG 1V4RA 3QAHA 1BI3A 2CO5A 2VE8A 3WODF 1CF7A 2IP2A 3NRVA 4ZYDA 2MLKA 3RI4A 1R1VA 2QBYA 3H92A 1XCBA 3R0AA 1D5VA 1W4MA 1ZG1A 5D6FA 4HDVA 1O3TA 4F7ZA 4HX4A 2JSCA 2VT2A 3P7NA 3CUOA 1CF7B 2NYXA 2FBIA 2FMYA 3E5XA 1H0MA 2HYFA 5HS8A 3F8CA 1J9IA 2GZWA 5FFXA 3BPXA 3ZP5A 3FZVA 2KJBA 3EETA 4O6JA 3EUHA 1HKQA 2A68F 4RGSA 3CO6C 2ZO4A 4Y17A 3C1DA 3IC7A 1XGNA 2P6SA 1HKTA 1FYLA 4UVBA 5HLIA 5E8GA 2Y48A 5JVTA 1ZRCA 2VBZA 4XSZF 1FY7A 1QZZA 1ZLJA 2OAZA 2B0LA 2E7WA 3JAMZ 3DV8A 1SFXA 4AIJA 1FYKA 3F6OA 1SMYF 5BPIA 3RDIA 4N9IA 1YS7A 1U3EM 3EQLF 4EJWA 1REPC 3DFGA 5E17F 5BOXA 1I5ZA 2PN6A 4UXNA 3T0YA 3TDUC 2CSOA 3GWZA 4WF2A 3QPTA 1BC8C 1B9MA 3RKYA 1IN6A 2FNPA 1H9TA 4ENKA 2C6YA 1DUXC 5LHGA 1IXRC 3KZYA 3QU3A 1SFEA 2L01A 3LWFA 3I71A 4M74A 5LEKA 2P7CB 5LRRA 1U5TA 4PCQA 4E70A 4B8XA 2UXNA 2DPDA 5EEHA 3C18A 3JAMK 2OQGA 3S2WA 4Q4ZF 2EFWA 2V1UA 1BN5A 1U5TB 2ZKZA 3DEUA 3I4PA 3GFIA 2HS5A 2R7FA 2PQ8A 1BBYA 3DF8A 4XBFA 4MNUA 1TQIA 1FWZA 4QLCU 4RAZA 3BOQA 2OZUA 2FBHA 1ZRDA 2FBKA 1IXCA 5DDGA 3KLOA 3F23A 1OYYA 4IHSA 3ZMUA 4BNCA 4WXHA 1XMKA 1TW3A 4LLNA 3RJPA 5D5WB 1RZ4A 4CXFA 1AOYA 3TO6A 4XSXF 4WXDA 5ED4A 2DK8A 2EK5A 5E8IA 4ENMA 3RKXA 4HV5A 4I0BA 2EFNA 4A5MA 1G4DA 3FMSA 4LB6B 1IZ1A 2A5YB 4UV9A 1E2XA 2ZXJA 1A04A 3IWZA 1IN7A 1MDMA 2HDCA 1S3JA 4Q47A 4ESJA 2DW4A 4QWQA 3WU0A 4KA4A 4ENNA 3ECOA 4WXCA 3HIFA 4H0EA 2EV0A 4KIGA 1MDMB 3NQOA 2OA4A 1FT9A
chains in the Genus database with same CATH superfamily
2LR8A 1L0OC 3IAS2 1LEBA 2CUEA 1VQNI 1TWGJ 1S6LA 2HTSA 1XB4A 3HSRA 1WJ5A 5DCMA 5FGMA 4B44A 2BXYA 2BBYA 3FWEA 1T95A 5LFAA 4UB8C 2NVTJ 3BJ6A 3VYUB 2YU9J 5K5RA 3QPHA 2X4HA 2YX4A 1UG0A 3G1LA 4XICA 2XGEA 4DYRA 1TBXA 2Z3YA 3NWSA 1BL0A 1T33A 4NDLA 3QOPA 4IOAF 3A02A 3V8JA 2NOGA 4A3GJ 5IYBJ 3BG9A 2ADUA 2DJNA 2YS9A 4I98B 4MIMA 3C3WA 5M3MJ 1AHDP 1N78A 2I8DA 2CW0F 1KQ9A 3GEZA 3V42A 1BIBA 2V7FA 1R7JA 2FX0A 4HF1A 4EJTA 1KONA 4YG2F 2ZFWA 2PLYA 5FRNA 2EJRA 2AXLA 4D0PA 2XC7A 3MKYB 2RDPA 4EEFG 5E1XA 3DKWA 4UV8A 3Q3SA 2IA0A 2PMZA 3DPTA 3GFLA 1WJBA 2HQNA 4V2FA 5EGOA 2HGCA 4CH7A 2RGVA 2DCEA 1TWHJ 5L3BA 1VZ0A 1LDKB 3ABKH 3KEYA 1SD7A 5LHIA 1B59A 2KMUA 3OYEA 3HJEA 1P2FA 1Y1VJ 5GTIC 3BJOA 4IHXA 1PP8F 2BGCA 5LBQA 5EGOB 2STTA 2PMHA 2CW8A 2X1CA 2XAGA 3D1NI 1A6QA 2BY0A 4KN7X 3U9GA 2KJCA 2L0KA 3T8TA 1OR7C 2BHZA 2R5YB 1MMAA 2K9MA 3KP7A 5CVJA 1WJFA 4AIDA 1OMIA 3FMRA 3FXRA 4XKBA 3RSNA 3GTPJ 1G3SA 1Z1DA 4G7HF 4J00A 1MIJA 4HDUA 3MEXA 4QSHA 3A2KA 3K4JA 4HAMA 5DM7F 1R23A 3OS1A 4BJ5C 1E0EA 5HNFA 1J59A 4KT6A 1W5SA 2K40A 2Z33A 1MBKA 2O03A 3PQKA 3OYKA 2V1DA 4M6VA 3CMEI 2JA7J 1R9TJ 2B9SA 1YIOA 2CU7A 3OL3A 1OQYA 2DOFA 4IVNA 3PFYA 2VIXA 5M5YJ 4IHVA 2LY2A 4KNYA 1IN8A 4CICA 2DFHA 5DYMA 1A36A 5BMZA 3I3LA 2H27A 5GAGJ 3GO5A 2QQBA 4I09A 2QQ9A 2P6TA 3GW2A 3JTGA 4EGYA 4E7KA 1BOAA 5E3OA 3EUAA 3JRIA 3F8MA 1D0XA 4MGRA 1EH8A 4A93J 2O0YA 3L00A 4A2UA 5J8CA 3GTGJ 4GGGA 3BG3A 2M4GA 4KIFA 1W0UA 4C30A 1QQIA 5D8LB 1JUPA 2Q2EA 2GIVA 1T98A 3F3XA 2F48A 3GXOA 1Z91A 4BQAA 1I1SA 2HZDA 3HPGA 2P4WA 1O4XA 1QU3A 1XSDA 2WC2A 4JX6A 1MJ9A 2Z16A 3BQZA 5IT9Z 4B1RA 4CDGA 4UVAA 2W4SA 2A05A 5CVVA 5J1RA 2CYYA 2LTPA 1P4XA 4IF4A 2J5OA 2Q2EB 4L9JA 5HODA 1HOMA 1D1CA 1QVTA 2VOOA 1GVJA 2CQKA 2E34A 3LA7A 2XGCA 3O8GA 2F5CA 4KMUX 2VKDA 3ERED 3BROA 4KUMA 2IAIA 1OCOH 1XDSA 1LKXA 2FE3A 1ZGAA 3HRSA 3ZRGA 2KL4A 4M3GA 4BH9A 2IGOA 1J5YA 2W85A 1C0WA 1IO2A 3DKXA 3AG4H 2JK3A 4W97A 1UJ8A 2F5VA 5H6RA 4LK0F 1Y8RB 2H6CA 2EZHA 2FQ4A 4HG2A 3TL4X 1EH6A 2X85A 4V2GA 5AIQA 4XKWA 3TGNA 1HCRA 1QVUA 2FQ3A 1FLIA 2P7VB 1YW9A 2HOAA 2BY3A 3OIQA 4BAYA 2L4AA 1ERDA 2DMUA 3KYLA 1WFXA 1RRJA 2ESHA 2NOJB 3TKYA 4L0YB 4HX7A 4AYBA 2DPUA 1ACIA 5E1ZB 2BW3A 2DTRA 1UCRA 3M07A 2O5RA 3TQNA 1G6NA 2P0WA 2Z2SB 4Y4RA 3ZMVA 1DGRM 2VC1A 4N4OB 4UHTA 4F91B 3H9QA 1WJAA 3HKZA 3DEEA 1FOKA 4JYKA 4XKCA 1SVLA 2EIJH 4F52A 4Q48A 3BR6A 3ROUA 2YR2A 2P81A 2XRNA 4BS9A 4F55A 1W36D 1PYVA 2BW3B 3FHNA 3L2WA 1IG7A 2DOEA 3CZ6A 5J6XA 3J7AY 1XMAA 2F4MB 3CCLI 4C2TA 1VQ8I 1NH3A 4M9SA 5E3MA 1WPKA 3KEQA 3GTOJ 2HDWA 1YJWI 1W36C 1YX5A 2XIGA 4J01A 3HRUA 3D0SA 4GXOA 3TW6A 5K5OA 1ZRFA 1Q1VA 2CFXA 3KLNA 5B66C 2BE5F 3HB9A 4HPQA 1LPQA 3HBLA 2BV6A 2KRHA 3SZTA 1JJ8C 4AIHA 1FX7A 1HF0A 5HDGA 3K4MA 5FFZA 3TMOA 2DFIA 2HR3A 3HYIA 5EJCA 1JXSA 4IXAA 2XKPA 3AKZA 2FXAA 4A5NA 3VSKA 3BG6A 2MBFA 4U0WA 5K1YA 2JTVA 3K1PA 3TOBA 3I5UA 4ZDPA 3I58A 2R7SA 4YFXF 2I5UA 4P55A 3ELKA 2ZSIB 2EV5A 3ABTA 5L3GA 3SZPA 3DP7A 3F72A 2LSOA 2K5CA 2IBDA 4C2MJ 4CO8A 3DTEA 1OCPA 2RN7A 1JHFA 4YIRX 4KIBA 3E6BA 1YYVA 3IUOA 3WTSC 1H89C 1B8IB 1IUYA 3A4CA 5JHFA 2TRTA 2KP6A 3R4KA 3FXMA 5D4RA 1FYMA 2QYOA 2OJED 4AU7A 3CC2I 2M30A 4BHPA 2CGPA 3ZMZA 3CMMA 4RM2A 2CV1A 2ZNYA 3MVPA 3GTLJ 2LF8A 2LY1A 3JRCA 1JGGA 3WTVC 3KE2A 1USTA 3KX2A 3ASOH 3G3ZA 3IAM2 4XLEA 3K7AJ 2W57A 2HOTA 1M1EB 3W2AA 3VFZA 4A3MJ 2R7RA 5CQGA 4JP0A 3RZOJ 3BTLA 4C3IJ 5HNHA 3WE2A 2EILH 4YIIA 1XPXA 1R5HA 3F9KA 4ESBA 4UY8I 4PFPA 1Z67A 3CUQC 4RLQA 1BR1A 2ZJ2A 2R0QC 4RAGA 1UFMA 2XSJC 3JR9A 3KCCA 4HLXA 3ABLH 1WKMA 4HNUA 3MKZA 2HVRA 2HYJA 4CZZA 3BG5A 1KU2A 1W5CC 2L4MA 2VBWA 2M2EA 3HEFA 3LAJA 3IWFA 2Z5UA 2O8XA 3FX3A 2G0EA 4ANJA 1XN7A 2K4JA 5IY5H 2Y75A 3OYDA 4RA2A 3AAFA 3E3VA 5J1UA 2P5KA 1JT6A 5E79C 2VKHA 3HOUJ 3MN2A 2XAJA 3UR3C 4B09A 2R7ZJ 2K3FA 3BCBA 1KYWA 2JRMA 2FA5A 5F64A 1FEXA 2DMPA 2XHKA 4XMYA 2QSFX 1NK3P 1RNLA 2XASA 3A1YA 2MG4A 3RPUA 3CCVI 4MFEA 2ZMEC 5CLSA 4AUXA 4QTRA 5HLGA 2EB7A 3IHUA 4BE0A 5D5XB 4NB5A 3OYBA 4HZFA 2E1OA 3U2RA 2GXAA 1FPQA 3OWTA 5HDNA 2DTZA 1X4PA 2PBIA 2KIFA 2RNJA 3NARA 4XN3A 3V4GA 3M1EA 2HOSA 2JQ7A 2D1VA 2NS0A 2V9PA 4DGWB 1KZHA 4HA8A 4JBAA 4K2EA 2Z99A 1O3SA 5AONA 4G7OF 1KA8A 1FMWA 3GLXA 5ICFA 5FKOA 2PMUA 4BJ6C 1D3YA 1IC8A 2R5ZA 1R36A 3DU5A 4ZH4F 1MJAA 1JGSA 1HW1A 4PGHA 1ZH5A 1IGNA 1YW7A 3L2CA 2DYRH 3AG2H 1ZREA 1ZG5A 4F93B 2RNGA 4BQQA 1GV5A 4ZJZA 4XQFA 2L9VA 4PSXA 1J0RA 3M7GA 3BLYA 1UB9A 3H9GA 2LBFB 2LG4A 3CUQB 3J7YJ 3K2AA 1LQ1A 2QQ8A 1IF1A 1G3YA 5BPDA 4OIOF 4BHBA 2R5ZB 2O9LA 3S93A 3FM3A 4PSWA 2D45A 1RUNA 2VPLA 2VASA 1YO5C 4OMZA 3HOSA 4KT5C 1P6RA 2NVUB 1GVDA 2M5WA 2QLZA 1F1ZA 1OCRH 3BP8A 2DT7B 4Y13A 1X1PA 2CG4A 2Y69H 2B7EA 3ZMTA 4L9NA 4M72A 2ZMEA 5ILUA 3EUKL 3JSPA 4A3JJ 4MFDA 1MH3A 4KFCA 2X48A 1OCZH 1TTYA 5HS9A 5K7HA 3E6CC 1Y39A 2LC2A 2CFOA 2UZKA 1R6RA 3QU6A 3ESWB 4A3IJ 1SD6A 1BOBA 5FKNA 2HOEA 2QKLB 1S7AA 1L3LA 1XD7A 2ZMEB 3N4MA 4A3LJ 1HKSA 2M1BA 4PFOA 3TOAA 4PZJA 1IRGA 1KU9A 4II2A 4BQNA 3G71I 1BR4A 1JTXA 2BY2A 4N0BA 3WTXC 3IH2A 3UKGA 4CYDA 3OIOA 1FSHA 3HSEA 3OYGA 3J7ZI 3KP5A 4DIQA 3FXOA 3WHCA 4CUGA 2DA1A 1E3HA 2ELJA 1JI8A 2COBA 1Y56A 2PX9A 2M7BA 1VQ6I 3TEDA 3EDPA 2E36A 2R3SA 2IVMA 2JPBA 4RAYA 2NVYJ 2WBMA 1FTTA 4XOTA 4KISA 2DFFA 2VJ5A 4BYYA 3BZKA 1G3TA 3DWLE 1PUFB 1QHGA 2QENA 1YW8A 3OV8A 2MA3A 4ZTFA 2ACJA 2V6EA 2X6WA 3GF2A 4A69C 2PJPA 2DBBA 2W1OA 2XAQA 2CWEA 3ZQCA 2Y0SA 2YPRA 1Q1HA 3ZQGA 1RKWA 5D5UB 2L54A 2G9WA 4IRGA 4MQ9F 4DJAA 1LFUP 1FOWA 4XLPF 1XCVA 3O6BB 2Q1ZB 2RC4A 3CMYA 4G12A 4BXUA 1X2NA 3HGGA 4IHTA 2GIZA 2E60A 1Y0NA 2DJIA 4R1HA 4OWRB 2DK5A 1X1CA 2EPFA 3I55I 4ZYAA 2KDOA 1XMXA 2D5VA 1MGTA 2ID3A 1JKQC 1JUMA 2GXGA 3LFKA 4X1EA 1MKMA 3OSFA 3E6MA 1U2WA 1RR8C 2DA5A 3KP2A 3LQQA 4P96A 5IP7J 2BVMA 1TWFJ 2Q0OA 2RREA 4M3DA 1R5GA 2WWYA 3RTRA 2A61A 2HI3A 3HPHA 2P5LC 3OYHA 3F0CA 4KDPA 2XGXA 1XG1A 3OMYA 2FOKA 2K4BA 4ZYHA 3J80K 3WU1B 1HXDA 1WJEA 3AL0C 3V7SA 4BEHA 3GYHX 2B63J 1QPMA 3DTIA 4LFUA 4O3MA 3LMMA 4IZZA 2BVLA 1TL8A 3WTTC 3BY6A 3N97A 1Z7UA 1P7IA 1VQLI 1ODDA 3Q0UA 3LSPA 3W6VA 1ON1A 2FEZA 1JKRC 2Q8KA 1VQOI 2KIUA 2HXOA 3WG9A 4BEHB 2XVCA 3GLLA 4AD9A 2WB1A 4E7HA 5F1RA 1RI7A 3SJMA 5H20A 4H4KC 3FKJA 3JRHA 1A31A 3ASNH 2M34A 2ESNA 2V9VA 4DYCA 4G6TB 2IJLA 3B02A 4L18B 2JPCA 2BZTA 5F04A 3MCZA 3WU2C 1F5TA 4BUPA 3RKQA 4ETSA 3BZCA 1R4MB 1TNTA 4A3FJ 3FXUA 3CC7I 1AKHA 3I64A 1T56A 3S17J 4XOPA 1ON2A 2DQRA 3E1SA 4A3KJ 2E2HJ 1ZARA 4HV6A 4D9JA 3PO3J 1OKRA 2DO7A 2EFOA 1P4AA 3JCUC 5FROA 2HKXA 3F8NA 4HNTA 1SEUA 1QA6A 2WAFA 1BI1A 3BTCA 4RBOA 1S7OA 2HYGD 4XKVA 1AKHB 5EDNA 1YOVB 5FJ8J 2BEOA 2F6CA 4P9FA 2VXZA 1FBSA 4RGUA 5F0FA 3CCSI 5CPRB 2LLKA 4HQMA 2L02A 2ZC2A 4F92B 1KYZA 3AL0B 4RM3A 3K6GA 3KIOA 4EM0B 1ETKA 3DBLB 3SFIA 5L3EA 4G6DA 4KJZA 5FKKA 3SHFA 4M73A 1BM9A 3BTJA 3L1PA 1U9OA 3V7CA 5FB2A 3JRDA 4A0YA 1X1DA 5EEGA 2R5YA 2E1CA 3PQJA 3S2DJ 2F4OB 1PUEE 3A0HC 3S2HJ 1OYWA 3DXJF 1J75A 1IDYA 4X0GA 4JQFA 2W48A 1I50J 4XRFA 4M71A 5DEQA 1VQPI 2OCEA 2K27A 1T0FC 1HW2A 3H36A 5JI6A 3J7AO 4DQ2A 2VC0A 3WTWC 1IW7F 4U87A 3TBIA 4BKXA 1WH5A 1GT0C 2DA3A 3CD6I 2O7OA 3N05A 5B3SH 2EZLA 5K7FA 3BR0A 4CCLA 2ELKA 1VI0A 3QYFA 3HUGB 4PJNA 3ZMSA 3CP8A 4PJLA 5GPAA 1G3WA 3S8PA 1T2KA 3S1QJ 2F2EA 3AG3H 3K2ZA 1SC7A 3ZQLA 2LVSA 1TQPA 3ZQ7A 3GCMA 2MSYA 3REOA 4QIWN 4I2OA 4LGWA 5JVGF 4D7NA 1XGMA 1EH7A 3QRFF 1USSA 4AC0A 1I27A 1KU3A 1HA8A 3E97A 3I54A 1P9QC 1R4NB 1LJ9A 1YQAA 3ABUA 1Z6RA 3CCQI 2BYVE 5B5EC 4HX8A 3SFZA 2XF5A 4PUSA 3CCJI 1AA7A 1T6SA 4M6YA 2XF6A 3CJQB 2OD5A 2GOMA 1ZYRF 2HU9A 2MABA 3OOPA 5TGTA 1B1BA 2DT5A 5E18F 3G73A 4A3BJ 4HLYA 1T0FA 4U88A 2DXIA 2KIMA 1ZQ3P 3OS0A 1BA5A 2G7UA 3U1KA 1N77A 1OR7A 2V1NA 4QPOA 5GP9A 4BHCA 5KVRA 4PK4A 3GMEA 2UXXA 4A3CJ 3ZCOA 1MZBA 2K9NA 1R22A 3I9V2 4EMSA 1P92A 1TZLA 1IN5A 2YX7A 2GWRA 4ZYGA 1MBFA 2EFPA 3GFJA 5J4YA 4ITVA 1IXSB 2CQNA 5IYCJ 1ETVA 3BPVA 3KETA 2HKOA 2IT0A 3F22A 3RYPA 1U0JA 2PG4A 1GV2A 2JVHA 2EA2A 4XLAA 5J47A 1GXQA 3COAC 2LF7A 3D5LA 3LSRA 1Z77A 4AVPA 1ZK8A 3CP2A 3K4CA 4M9XA 3DCFA 2O3FA 1MSFC 1QGPA 2IS6A 3WE3A 2L9NA 1MMDA 2VBYA 2CQQA 2FMLA 2QQAA 5FD5A 2IW5A 2M8EA 1T08B 2W00A 1K4SA 1BJZA 1WSUA 4CCOA 1I6HJ 1JE8A 3I0TA 1X3ZB 1K83J 4LIVA 4OOIA 1ZGWA 1EKEA 4XLCA 3PL8A 3WTUC 4IJAA 4GCVA 2EWNA 3SYTA 2DDAA 3LA2A 1DP7P 3NEUA 2VODA 2UV1A 3O2PE 3VSLA 4RB0A 4LB5A 2FNAA 2L3DA 4OIQF 1YLFA 2OQRA 2Y0MA 3J81Z 3M3YJ 2EH3A 5H6QA 1X3UA 4LOCA 1IUFA 4ENJA 5JR3A 3P9IA 3MAJA 2EINH 5A2QK 4EQQA 4MHGA 2MD5A 2RAEA 2VQCA 2E35A 2QM3A 1K6OA 1U8RA 4EJUA 3VDXA 4I01A 4HYEA 1Z3XA 2X1DA 4A3EJ 3E5QA 4Y3OA 1S5LC 3BDDA 3T5XA 2HPMA 4OIRF 1QPIA 1ITYA 4E7ZA 2V6CA 2VJIA 1MW7A 1VQ9I 4GO1A 3IV5A 3G1MA 2XB5A 4BU2A 3GZ5A 4IHYA 3OYNA 4G94A 4MTDA 3OYFA 2HFHA 3DU6A 3H3ZA 1U6GA 1VQ5I 2PJRA 4IL6C 1FOYA 2VB6A 1U78A 2OTJI 2NAZA 2JA8J 3W2WA 2DI3A 1W5TA 3F8BA 3A01A 2JUGA 1UHWA 2QWWA 3I4MJ 2A3SA 4R79A 2PJRB 5F6FA 2QCOA 2ZXWH 1XGSA 1S29A 2XSDC 3K4KA 3G1OA 1Y8QB 3KZZA 1OLTA 3A01B 2JWTA 3IKVA 3J81K 3RPQA 3R61A 1B8IA 2DAOA 3G2BA 4RLFA 5KK1A 2NRAC 5GADJ 4U7DA 2KIQA 2R7WA 4GYGA 5C44J 1J09A 4MO7A 3ZPLA 4U7BA 3FHZA 1Z9CA 1KQ0A 2K86A 2LDUA 5ILSA 5IP9J 5LGUA 4XR6A 5DUKA 1TC3C 3HOYJ 1MBEA 2QZ8A 2OV7A 3FDYA 2CJJA 2I10A 3H9JA 4LLLA 2LKPA 3DBHB 4LITA 5LGNA 2GAUA 3GTKJ 2ZBKA 4UVCA 1GHCA 4Y33A 3HKZN 5AIPA 2OC6A 4EGZA 1O3QA 3KP4A 1I1GA 4PJ0C 4IRHA 4XLFA 1O7LA 1RIOH 4L5IA 1Z6TA 2E5NA 2J5PA 1IN4A 1HW5A 2ZSHB 2YUSA 3L2QA 4FCYA 1V54H 3TO7A 3EUHC 2YSRA 4Q5SF 4NC6A 3SXYA 4XL9A 2L5QA 1LVAA 2QSGX 1O7FA 2KPMA 1HBXG 2VQLA 3DPUA 4LG0A 1X3WB 3GTQJ 2CMPA 3BR5A 3KYCB 2D2WA 3OYMA 3BQYA 4G6QA 4J19A 4E7IA 4L0ZB 3F8FA 4IX7A 3T8RA 2EZKA 1D0ZA 1ZR4A 1R49A 4RB3C 1PJRA 3MKLA 2OU2A 1P4WA 2HQRA 3DQVC 4HQEA 5FLVA 5FKLA 5DM6F 1ZHFA 4OMYA 2K02A 2QGUA 4LG0B 1H9GA 5J4VA 3H35A 1MSEC 5CKTA 3TP3A 2JMWA 4X6AJ 3MD2A 3EPZA 3VYSB 3ML6A 1B4AA 4ZDLA 1STZA 3HSFA 2XPUA 2W84A 4GYIA 5CVUA 3VEPA 5ICCA 2QBYB 2LD5A 1X1BA 1BIAA 2ZCWA 2EFQA 3E7LA 4YELA 4XRSA 2LOOA 3LFUA 2VI6A 3LQRA 4I02A 5F08A 2XROA 1PDNC 2LMDA 1D8JA 3U1DA 3MFKA 5GAHJ 2Z9OA 2F5DA 3WGIA 1UAAA 3L09A 5FLXK 5ICGA 1BI0A 5F27A 2JRTA 3HXLA 3K9TA 3RYRA 4EVIA 2H8WA 2F5EA 3JRAA 2VQHA 1E3OC 3H5RA 4BY1J 5ILVA 2KHMA 3EYYA 3H0GJ 4PDKA 2MC3A 1ZGJA 1J2XA 4WX9A 4B3AA 5CJ9A 3QOEA 2DT6A 4BGDA 1VQ4I 1ZLKA 2L2OA 3K70D 3U21A 1BC7C 3LSHA 5HVQC 4G8XA 3DEWA 2XAHA 4RAFA 3CJTB 4I6ZA 2XRLA 4ASNA 5DV5A 3C2HA 5LGTA 4V19K 4S05A 3LAPA 2HZTA 1RETA 4EV0A 3HTUA 1YTYA 1QNTA 4OINF 1F4KA 1EV7A 1J7KA 5CYVA 3PM1A 2VXDA 3SEQA 4KMFA 4JK1X 4M3FA 3K70C 5C4XJ 1ETXA 4NHJA 3M9AA 2L9RA 1LFBA 2EZIA 2LBFA 5K7ZA 3VOEA 3CUQA 1ONVA 3S3MA 1WQ2A 2FOWA 1IJWC 1FP2A 3JTHA 2XAFA 2XUBA 3HC7A 1G2HA 3IRQA 3S15J 5EG0A 2HNHA 2A6EF 1VF9A 1IV6A 1U5TC 1QZEA 3H5AA 4ESFA 4MEYF 4C3HJ 3BG7A 4XORA 3ISPA 4LK1F 4E7SA 4PJMA 3A0BC 1R1TA 5KAFC 4M3BA 1LDDA 4FISA 3P9CA 3CDLA 3BTIA 5EG0B 2HWVA 2WTEA 2IEKA 2E71A 3LA3A 4EJOA 1P7JA 3R60A 2X1EA 2CV2A 1TWAJ 1X19A 3ONQA 2DA6A 3IH4A 4D7MA 5IOYA 3DLLF 2O61A 2V1XA 1A5JA 4IQJA 1G59A 1WI3A 4HNVA 1Z0XA 4ZC3A 5J1YA 2VKVA 3SZGA 6PAXA 5CVRA 4JX5A 5TISC 3PFIA 4P5OA 4HF2A 1UHSA 4XLNF 4YFKF 2RV8A 2WAQN 3L2VA 1Y1WJ 3L9FA 3PNYA 5L3CA 3I53A 1R71A 3FXLA 1RKTA 4MEXF 1OPCA 4B43A 1RESA 3JREA 2RKHA 1WJDA 1PUFA 5E20A 4YFNF 5HLHA 1SAUA 2JVGA 3IP4B 3FISA 3ZMDA 2R4GA 3MWMA 2FRHA 2KKOA 1H8AC 3K0LA 3J80Z 3DPLC 2H8RA 1KQ8A 1ORKA 1QZYA 2HTJA 5EEAA 2Y2ZA 4UUTA 3CC4I 2E5ZA 3HHHA 2QF7A 5E1WA 3SQNA 3ZR8X 1XDUA 4XRMA 4OIPF 3FBIB 5L3FA 2EV6A 1LVKA 3TDZC 3ZQFA 5FRMA 2H6BA 4LG3A 1SD4A 3L2UA 3MQ0A 1MBJA 3FXQA 3HOWJ 2VQGA 4DZJA 4LJZF 2IS4A 1R58A 3GZNB 5TRDA 2IPQX 5DUIA 4E7JA 3X2QH 3CJRB 1IRXA 1BR2A 2OTLI 1AU7A 2LYCA 2A6HF 1D1AA 2Y9YA 3FMQA 1FTZA 3WG7H 2RQQA 3GX4X 3WHBA 3K1NA 2IGKA 2OBPA 4IHWA 3FF5A 1FBUA 2IA1A 4WWCA 3RKWA 1AWCA 1T8IA 1HLVA 1JUSA 3PNTA 2STWA 1UG2A 4IEJA 4Z2YA 1ZAOA 1HDPA 2DYSH 2ZFUA 4RB2C 3OSGA 1DDNA 3PSIA 2LP0A 1IDZA 4A0ZA 4OAZA 4EM2A 3K1MA 3KYDB 2E1MC 4S0HB 2A07F 4BQOA 1GLNA 2CRGA 2ZNZA 1QO0D 3GZ6A 2M87A 4ZYEA 2MH9A 1GUUA 5DD4A 4XN0A 4QPQA 3OYAA 4CHUA 2E2JJ 4HSTA 4M6XA 5DTDA 3CMAI 4E4HA 2A6TA 4Y7NJ 1WJCA 1TW2A 2MH2A 3PUFA 1YHQI 1OYIA 3W6JB 1LNWA 3IRRA 5FKMA 2ZB9A 4BDZA 1CGPA 2K9QA 1BJAA 1JT0A 2VOPA 5EYRA 5ERIA 3BJAA 1UHMA 4ZTJA 1I6XA 1SFOJ 2QVOA 3BCAA 3HZJA 5DCFA 2O8KA 3KP6A 1MD0A 3V8KA 1F36A 3HTSB 4BDYA 5HOOA 2Y0SN 2CS3A 3LSMA 4L5JA 2ISYA 2HQ5A 4YEJA 1TT0A 3OIPA 3S16J 1SAXA 4WK8F 1WWXA 1WGXA 1DGWY 3CF2A 2ZXHA 4Y15A 1FSEA 4RGXA 2TCTA 3JRFA 1XC5A 1S8NA 2GM4A 3CTAA 3VB2A 2GXBA 3BWGA 1YRNB 5CVIA 2DU9A 4IQ4A 5HS7A 4IRIA 2JA5J 2XPWA 1B72B 4UNOA 2CUJA 3KP3A 3IL2A 4LLGF 5J8FA 3K4NA 3E6DA 3LOCA 3CDIA 3K10A 4HBLA 1W1WE 2E7XA 5BS6A 5FO5A 5DS9A 2E1MB 4FX4A 1O3RA 4YRVA 3QP5A 2HEOA 3KEOA 3FM5A 1KGSA 3UNGC 3ZQQA 3M8JA 1WRJA 1APLC 2CW7A 4Y52J 1LEAA 2DA4A 2XKOA 2JSPA 3E0JB 4FX0A 3R6SA 1E3PA 3HRTA 2KT0A 1A35A 1YIJI 2GA2A 1MJBA 1TQMA 4HW0A 4WCGA 2CQ7A 3ECHA 3LL7A 3C7JA 4D5CA 3BR1A 3EYIA 2MW8A 4CGZA 1OCCH 5LEJA 4U0YA 3FK6A 3TO9A 3ZN1A 2IA2A 5IP6A 1POGA 4AWXB 3MZYA 3I59A 2WY8Q 2X9DA 5DCMB 3B6CA 4ZZDA 4A6DA 2DN0A 3HHGA 2R7VA 3IH3A 3VWBA 2VT3A 1MBGA 2EBIA 3VODA 1K61A 2DFEA 1SMTA 2FJ1A 3Q0WA 3Q5FA 4A6EA 5C3EJ 2DMTA 2WB1N 1VFCA 3S1NJ 1ETWA 3PIPF 1GDTA 2R7UA 2WV0A 2VLAA 1IAWA 2FU4A 5CQEA 5KHDA 3RZDJ 2GBYA 4BACA 4MQVA 3HUGA 4N9HA 1R1UA 4HF0A 3I59B 1T39A 1YG2A 4DBQA 1BI2A 2MFZA 2P8TA 5JHUA 1F9NA 2OZ6A 2KRFA 3OY9A 1QBJA 2O6GE 1MMNA 2KLOA 3G4SI 2UUZA 5F0HA 3R0JA 5D8KB 3OR2C 3H3UA 2E19A 3JW4A 4DW6A 4G7ZF 4FHTA 2KZGA 3KFWX 2YU3A 2IS1A 2K85A 4IPAA 1IRFA 2V79A 3GFMA 4C3JJ 1VQKI 2MLGA 1XTAA 3WTYC 3RCOA 3W6KB 1I3QJ 5D4SA 3HGYA 5D5VB 3WTZA 1KU7A 3KZIC 1HSTA 3CJNA 1D1BA 3P9KA 4FETA 3LSTA 4JX4A 2E1NA 1ZG3A 2X6YA 5EZHA 5LRSA 5IPAA 1K4TA 2VONA 3RQIA 3DTKA 4MTEA 2RQPA 2DQLA 2R93J 3L7WA 3GBGA 1NHAA 4A12A 4I0AA 3GUDA 3L2RA 1BW5A 3BZ6A 2H94A 2CUFA 2RVCA 2X0LA 3QP6A 1TT5B 2ECCA 1VNDA 3V8LA 4FE4A 2PMZN 1TLHB 1K78A 1FZPB 2LKXA 1Y0UA 4LD5A 1RUOA 1XSVA 4ABZA 3HRMA 3QQAA 2A5WA 3CLOA 4A3DJ 5LLQA 5HDKA 3OYLA 3B6AA 1JHHA 2MD0A 2CH0A 2VPRA 1LFPA 4FT8A 1FOXA 4OU0A 5JFRA 1S72I 3CESA 3PSFA 3OYJA 2JN6A 2KQRA 3F21A 1LUJB 3TW7A 1JKPC 2DOAA 1FP1D 3WGGA 1YITI 5A2QZ 1K78B 1RPWA 4W1UA 2CQXA 1ETYA 3LSJA 1D8KA 1DPRA 4ON0A 5HLTA 1K7AA 2EIKH 5FD6A 3HL2A 3IKTA 1SVOA 4CCJA 4NUBA 2EQRA 3E5UA 4XRSG 2JZYA 3JRBA 5D6EA 1DPUA 1ZKGA 3A03A 4CCMA 2W24A 4C9YA 3P5JA 2TDXA 3BT9A 4CYCA 3ABMH 5GTHC 2R7XA 1BW6A 1LB2A 2DLLA 2XV4S 2K3PA 2VBXA 1W7PD 4KICA 2JA2A 2R7DA 2PEXA 3Q9SA 2NNYA 1MH4A 4HOBA 1V5EA 3FBNB 1HDDC 2NS7A 4YIFA 5GPCA 2LH9A 2QSHX 5GAEJ 2H09A 4CYCB 1I3AA 4BY7J 3KPHA 4RS8A 2PFBA 2VL8A 3FXJA 1EA3A 2VE9A 1OJLA 1DU6A 3GTMJ 5K5QA 5KNLA 5IT3A 1SD5A 1YS6A 3DBRB 2BY1A 1K6YA 3K4LA 5H2FC 3HOZJ 4ZZLA 2R7OA 2Z1DA 1MNEA 3B73A 2Y31A 1A6IA 3K69A 1SFUA 2FUG2 4L9TA 3BR3A 3O3KA 4O5VA 1B6AA 3ZQIA 2ISZA 1XX5A 3FKIJ 2ZJPF 3LSGA 1LDJA 4KN4X 4G9YA 3QPLA 4NBQA 4CA0A 1X4OA 2V4JC 1S7EA 3JSOA 1TP4A 1I39A 1R00A 3BC8A 1R5ID 1K79A 1Z05A 2BXZA 2M8GX 2M3AA 3PNVA 1VQMI 1XGOA 2PI0A 1OFCX 4S04A 2CV0A 2JA6J 4GDFA 3BR2A 2D1HA 4M9ZA 2Y9ZA 1V3FA 2DA7A 2W25A 2K7LA 2F4IA 4RGRA 1Z21A 3GVAA 3CO7C 2ZJRF 1SVMA 4RB1A 2NVXJ 4CZCA 3HDDA 2GQQA 1HQCA 3VYTB 1O57A 1ZN2A 2JJ7A 2XF7A 5M5XJ 3C2GA 3H1CA 2FSWA 3CCRI 2EA4A 1ETOA 1GXPA 2LY9A 5IT9K 3HM5A 4AIKA 1PP7U 2AXTC 3CQZJ 3NWTA 4M3EA 1W7PA 1T38A 1V55H 4L9VA 2GA1A 2NNNA 2QUFA 3RQ4A 5IYDJ 2UWMA 1B9NA 1HSJA 4TV7A 5KAIC 4A0XA 4CSWA 3RIRA 1X2MA 2R7QA 4PGGA 4P9UA 1XSXA 1WVRA 5LHHA 4BXXJ 2A69F 1H88C 1OCTC 1ULYA 2BOLA 4ZDOA 1MNMC 1W7PB 2ELHA 5B1AH 3MZHA 4I7HA 2F5FA 2P5VA 4DOZA 1PVEA 3O8HA 5L3DA 2ETHA 1D0YA 2LRDA 2GLOA 2COMA 4EM1A 1WI9A 3VYRB 3T1BA 1TNSA 3H5NA 5ICEA 3HOTA 2WY7Q 4B47A 3Q9VA 2AQFA 2AS5F 2FF4A 3CCUI 1FBQA 4AYBN 1RC9A 3QWLA 4FE7A 2GOXB 2OF7A 3M8EA 4LMYA 3ULQB 4XLHA 2HQAA 2VN2A 3OR1C 3ZN0A 1FC3A 1F43A 2LNBA 4R8HA 1VQ7I 3M8FA 2LKSA 3CDHA 5DD8A 2JT1A 2QEXI 4UUVA 2DMQA 5FLXZ 2M45A 1SFKA 4EATA 4NQWA 2G7HA 3Q0VA 9ANTA 1WCMJ 1YFHA 2HVQA 3OYIA 1VTNC 3WGHA 4PJJA 5BNGA 1FNNA 3CCEI 3F6VA 1E17A 1NG6A 4U0VA 3V7RA 4EJVA 5F0CA 1IV8A 4I76A 2V9KA 5TJJA 5JLWA 4GFBA 5BQTA 3OL4A 4DNCA 2XPVA 1TWCJ 4NQWB 4KYWA 2KRCA 3MZ8A 2IRFG 1V4RA 3QAHA 3RPUD 1BI3A 2QKMB 2E2IJ 2CO5A 1ZELA 2VE8A 3WODF 3S1MJ 1CF7A 2IP2A 3NRVA 2OPTA 4ZYDA 2MLKA 3RI4A 2KFDA 1Z3YA 1R1VA 2QBYA 4BBSJ 3H92A 1XCBA 5B1BH 2NVQJ 2M0MA 3R0AA 1D5VA 2DODA 2KZVA 4BXFA 1W4MA 4B4CA 5D6FA 1ZG1A 4HDVA 1O3TA 4F7ZA 4HX4A 2ZXIA 2JSCA 1WZ2A 3S14J 3I4NJ 2VT2A 3P7NA 3CUOA 1CF7B 2BHYA 3DLAA 1ETQA 2NYXA 2FBIA 1QRYA 2FMYA 4UUSA 1V5FA 2DA2A 1X1AA 3E5XA 3AG1H 2AQEA 1H0MA 2HYFA 5HS8A 3F8CA 1J9IA 2GZWA 4LIUA 5FFXA 3BPXA 3ZP5A 3FZVA 3ZQHA 1ENHA 2KJBA 4C2UA 4AM3A 3EETA 4O6JA 2JUCA 4UUSB 1CQTA 3EUHA 4HSRA 2XDVA 2MGQA 4P1WA 2L7ZA 2IGNA 1HKQA 2KISA 2A68F 4JOMA 1N25A 3CLQA 4D5FA 1EJ9A 2M9HA 4RDUA 2HVSA 2K9LA 4RGSA 3CO6C 2ZO4A 4Y17A 2LK2A 3C1DA 5J3LA 2OCCH 3IC7A 1XGNA 2P6SA 2M0CA 4L5EA 1HKTA 3D5RC 1RR7A 1FYLA 4E7LA 1WH7A 3M1CA 4UVBA 5HLIA 3S3OA 5E8GA 1V5GA 2NXNB 2Y48A 1Y6IA 1NK2P 4IO9F 1JJ6C 2OUMA 3VPRA 5JVTA 1ZRCA 3DKYA 2WAQA 2VBZA 1SANA 4XSZF 1FY7A 4XONA 3LNQA 3MKWB 2QA4I 3W2VA 5E3LA 1XS9A 1QZZA 1ZLJA 4RMNA 2HDDA 2OAZA 2IXSA 2B0LA 2Y30A 4BE1A 2VKEA 2E7WA 3D5SC 3JAMZ 3DV8A 1SFXA 4AIJA 1FYKA 3G6EI 2L9SA 4N4NB 2ME6A 3F6OA 3QPSA 5M3FJ 3CCYA 1SMYF 5BPIA 3RDIA 1ZTRA 2CUZA 4F3QA 1U8BA 2ECBA 2WADA 1DU0A 4II3A 4N9IA 1G8XA 1YS7A 1FIAA 2DDBA 2DMNA 1U3EM 3EQLF 4EJWA 3GTJJ 1REPC 3DFGA 2K9SA 4B48A 5E17F 1LE8A 3QODA 5BOXA 2LREA 3ZGKA 1I5ZA 2PN6A 4UXNA 1DQUA 3T0YA 3TDUC 4XIDA 1YI2I 2HPIA 2CSOA 3GWZA 4WF2A 4DYQA 3QPTA 5EZGA 2VJ4A 1BC8C 1B9MA 3RKYA 1IN6A 2FNPA 2AO9A 3M4OJ 1H9TA 1UELB 1IRZA 4ENKA 2VJJA 2C6YA 3ERMA 1DUXC 2H1KA 2X6OA 4BJTA 1LE8B 2AHQA 5LHGA 3HOXJ 2FD5A 1NTCA 5M5WJ 1IXRC 3KZYA 3QU3A 1SFEA 2L01A 3S3NA 3LWFA 3I71A 4M74A 2WV1A 5LEKA 2P7CB 2MYSA 5LRRA 3JRGA 5KCMA 1U5TA 4PCQA 4E70A 3PIOF 3PUBA 4B8XA 3MMYB 4DZPA 2UXNA 2WAEA 1WHUA 2DPDA 5EEHA 3C18A 1YJ9I 3NAUA 2OQGA 3JAMK 3S2WA 1UZCA 3OYCA 4Q4ZF 2KDZA 2EFWA 4HRIA 1W0TA 4XK4A 2R92J 2W82A 2V1UA 4BL0B 3SDBA 1ZR2A 4CCNA 1BN5A 1U5TB 3LSIA 2ZKZA 3DEUA 2NS8A 3TP0A 3H3VK 3I4PA 3ZOBA 3W3CA 3GFIA 2HS5A 3SDGA 2M7AA 2ZJQF 4HEA2 2R7FA 4CCKA 1QHHD 1S9HA 2PQ8A 4FQGA 4UB6C 1BBYA 3DF8A 4XBFA 4DBRA 4MNUA 4I99C 1TQIA 5F1JA 3OS2A 1FWZA 2XB0X 4QLCU 4RAZA 1MNDA 2WA0A 3BOQA 2OZUA 2X6XA 2FBHA 4AVZA 1ZRDA 2FBKA 1IXCA 4NC7A 3C2BA 5DDGA 5EF6A 1MBHA 1YE9A 3KLOA 3F23A 4KITB 1YJNI 1OYYA 2L7KA 4NC8A 4IHSA 3CCMI 3PO2J 1YX3A 3ZMUA 4WXHA 4BNCA 2VUMJ 2XAUA 1XMKA 1MMGA 1JTYA 4OAYA 5IOZA 3HOVJ 2IGMA 1X58A 1TW3A 1NG7A 4LLNA 2XGDA 3RJPA 1OISA 5D5WB 1RZ4A 2R7TA 4CXFA 3FIWA 1AOYA 5FLMJ 1FJLA 2ID6A 3TO6A 3H0DA 4IKFA 4NNJA 2L7MP 4XSXF 4BBRJ 1HC8A 4WXDA 2DK8A 2X51A 2EK5A 5E8IA 1UMQA 4Z6YA 5ED4A 1JKOC 4ENMA 2LFBA 3QYBA 3I56I 5E3NA 1DP3A 2M4KA 3RKXA 4HV5A 4I0BA 3OOUA 2L7FP 4B3XA 4MLOA 4XM3A 2EFNA 4A5MA 1G4DA 3CF5F 3FMSA 4LB6B 1IZ1A 2A5YB 2H1LA 1EF4A 2N8GA 2EIMH 1D5YA 1U9NA 4XNFA 4UV9A 1E2XA 2V26A 3FK7A 2ZXJA 2ICWG 2IS2A 1A04A 3QYEA 1YRNA 3IWZA 1IN7A 3HG9A 2ME0A 3PJRA 4GRIA 4E6KG 1B72A 1MDMA 1FIPA 3S1RJ 2HDCA 1S3JA 5LD2C 4Q47A 1N75A 2HXIA 4ESJA 1MMSA 3LSKA 2DW4A 3S32A 4D1QA 5JLXA 4QWQA 5J40A 3SEZA 3WU0A 4KA4A 3K4BA 4ENNA 2MC4A 3ECOA 3HIFA 4WXCA 4FASD 4H0EA 2EV0A 4KIGA 1MDMB 1FMVA 3AFHA 4BE2A 3FXKA 3NQOA 2W7NA 4FTHA 1Z7LA 2OA4A 3ZXSA 4IOCF 1FT9A 5C4JJ
chains in the Genus database with same CATH topology
1L0OC 1LEBA 1S6LA 2HTSA 1XB4A 3HSRA 5DCMA 5FGMA 2BBYA 3FWEA 3BJ6A 5K5RA 3QPHA 2X4HA 2YX4A 1TBXA 2Z3YA 3QOPA 3V8JA 2ADUA 4I98B 3C3WA 2CW0F 1KQ9A 3GEZA 1BIBA 1R7JA 4HF1A 4EJTA 4YG2F 2ZFWA 2PLYA 2EJRA 2AXLA 4D0PA 2RDPA 5E1XA 3DKWA 4UV8A 2IA0A 3DPTA 3GFLA 2HQNA 2HGCA 2RGVA 5L3BA 1LDKB 1SD7A 5LHIA 1B59A 1P2FA 3BJOA 1PP8F 2BGCA 5LBQA 2STTA 2PMHA 2XAGA 4KN7X 3U9GA 2KJCA 3T8TA 3KP7A 5CVJA 1OMIA 3FMRA 3FXRA 1G3SA 1Z1DA 4G7HF 4HDUA 3MEXA 4HAMA 1R23A 1J59A 1W5SA 2Z33A 2O03A 3PQKA 2V1DA 1YIOA 4IVNA 4KNYA 1IN8A 4CICA 5DYMA 5BMZA 2H27A 3GO5A 2QQBA 4I09A 2QQ9A 2P6TA 3GW2A 3JTGA 4EGYA 1BOAA 3F8MA 4MGRA 1EH8A 2O0YA 3L00A 4A2UA 5J8CA 4GGGA 4KIFA 1QQIA 5D8LB 2Q2EA 2GIVA 1T98A 3F3XA 3GXOA 1Z91A 4BQAA 1I1SA 2P4WA 1XSDA 2WC2A 1MJ9A 5IT9Z 4CDGA 4UVAA 5CVVA 2CYYA 1P4XA 4IF4A 2J5OA 4L9JA 2VOOA 1GVJA 2CQKA 3LA7A 4KMUX 2F5CA 3ERED 3BROA 4KUMA 1XDSA 2FE3A 1ZGAA 3HRSA 4BH9A 1J5YA 2W85A 1C0WA 5H6RA 4LK0F 2H6CA 1EH6A 5AIQA 3TGNA 2FQ3A 1FLIA 2P7VB 1YW9A 4BAYA 2L4AA 2ESHA 3TKYA 4L0YB 4HX7A 2DPUA 5E1ZB 2DTRA 1UCRA 3TQNA 1G6NA 3ZMVA 2VC1A 4UHTA 1FOKA 4Q48A 3ROUA 2YR2A 2XRNA 5J6XA 1XMAA 4M9SA 3KEQA 2XIGA 3HRUA 3D0SA 4GXOA 5K5OA 1ZRFA 2CFXA 3KLNA 2BE5F 2BV6A 3SZTA 4AIHA 1FX7A 5HDGA 5FFZA 2DFIA 2HR3A 3HYIA 1JXSA 4IXAA 2XKPA 2FXAA 4A5NA 2MBFA 4U0WA 5K1YA 2JTVA 3K1PA 3TOBA 3I5UA 3I58A 4YFXF 4P55A 3ELKA 2EV5A 3ABTA 5L3GA 3SZPA 3DP7A 3F72A 2LSOA 4CO8A 2RN7A 1JHFA 3WTSC 4KIBA 3E6BA 1YYVA 1IUYA 3R4KA 5D4RA 1FYMA 2QYOA 2M30A 4BHPA 2CGPA 3ZMZA 2ZNYA 2LF8A 3WTVC 3KE2A 1USTA 3G3ZA 2W57A 3VFZA 3WE2A 4YIIA 1R5HA 4ESBA 3CUQC 2ZJ2A 1UFMA 3KCCA 4HLXA 1WKMA 4CZZA 1KU2A 2L4MA 2VBWA 3LAJA 3IWFA 2Z5UA 2O8XA 3FX3A 1XN7A 2K4JA 2Y75A 3AAFA 3E3VA 2P5KA 2XAJA 4B09A 1KYWA 2FA5A 5F64A 2XHKA 1RNLA 2XASA 3RPUA 5CLSA 5HLGA 2EB7A 3IHUA 5D5XB 4NB5A 4HZFA 3U2RA 1FPQA 5HDNA 2PBIA 3V4GA 2KIFA 2RNJA 3M1EA 2D1VA 2NS0A 4HA8A 4JBAA 4K2EA 2Z99A 1O3SA 5AONA 4G7OF 1KA8A 3GLXA 5ICFA 2PMUA 1D3YA 1R36A 4ZH4F 1MJAA 1JGSA 1HW1A 4PGHA 1ZH5A 1YW7A 3L2CA 1ZREA 1ZG5A 1J0RA 3M7GA 1UB9A 3CUQB 1LQ1A 1IF1A 1G3YA 5BPDA 4OIOF 4BHBA 3FM3A 2D45A 1RUNA 1YO5C 4OMZA 3HOSA 4KT5C 1P6RA 2M5WA 2QLZA 1F1ZA 3BP8A 4Y13A 2CG4A 3ZMTA 4L9NA 4M72A 2ZMEA 5ILUA 3JSPA 4KFCA 5HS9A 1TTYA 3E6CC 2UZKA 3QU6A 1SD6A 2HOEA 1S7AA 1L3LA 1XD7A 2ZMEB 3N4MA 1HKSA 2M1BA 3TOAA 4PZJA 1IRGA 1KU9A 4N0BA 3WTXC 4CYDA 1FSHA 3HSEA 3KP5A 3EDPA 2R3SA 2IVMA 2JPBA 4RAYA 4BYYA 1G3TA 2QENA 1YW8A 3OV8A 2MA3A 2ACJA 3GF2A 2PJPA 2DBBA 2XAQA 2CWEA 2YPRA 1Q1HA 5D5UB 2L54A 2G9WA 4IRGA 4MQ9F 4XLPF 1XCVA 3O6BB 2RC4A 4BXUA 4IHTA 4R1HA 2DK5A 1MGTA 2GXGA 3LFKA 1MKMA 3E6MA 1U2WA 3KP2A 3LQQA 4P96A 2Q0OA 1R5GA 2WWYA 3RTRA 2A61A 2P5LC 4KDPA 2XGXA 2FOKA 2K4BA 4ZYHA 3J80K 3WU1B 1HXDA 3V7SA 3GYHX 1QPMA 4LFUA 4O3MA 3WTTC 3BY6A 3N97A 1Z7UA 1ODDA 1ON1A 2FEZA 2Q8KA 2KIUA 3WG9A 2XVCA 4AD9A 5F1RA 1RI7A 5H20A 2ESNA 2V9VA 2IJLA 3B02A 4L18B 2JPCA 3MCZA 1F5TA 4ETSA 1TNTA 3FXUA 3I64A 1ON2A 2DQRA 1ZARA 4HV6A 1OKRA 2DO7A 2EFOA 1P4AA 2HKXA 3F8NA 1BI1A 1S7OA 2HYGD 2BEOA 4P9FA 2VXZA 1FBSA 4RGUA 4HQMA 2L02A 1KYZA 4EM0B 5L3EA 4G6DA 3SHFA 4M73A 1BM9A 5FB2A 3V7CA 4A0YA 5EEGA 2E1CA 3PQJA 1PUEE 1OYWA 3DXJF 1J75A 4JQFA 4XRFA 4M71A 5DEQA 2K27A 1HW2A 5JI6A 3J7AO 4DQ2A 2VC0A 3WTWC 1IW7F 3ZMSA 1G3WA 1T2KA 2F2EA 3K2ZA 1TQPA 3ZQ7A 3REOA 4I2OA 4LGWA 1XGMA 1EH7A 3QRFF 1USSA 1I27A 1KU3A 3E97A 3I54A 3ABUA 1LJ9A 1YQAA 1Z6RA 2BYVE 4HX8A 3SFZA 1T6SA 4M6YA 2OD5A 1ZYRF 3OOPA 1B1BA 2DT5A 5E18F 3G73A 4HLYA 1T0FA 4U88A 2KIMA 2G7UA 1OR7A 4BHCA 5KVRA 2UXXA 1MZBA 1R22A 4EMSA 1P92A 1IN5A 2YX7A 2GWRA 4ZYGA 2EFPA 3GFJA 1IXSB 3KETA 3BPVA 2HKOA 2IT0A 3F22A 3RYPA 2PG4A 2EA2A 1GXQA 3COAC 2LF7A 3D5LA 4AVPA 4M9XA 2O3FA 1QGPA 3WE3A 2VBYA 2FMLA 2QQAA 5FD5A 2IW5A 2M8EA 1WSUA 1JE8A 3I0TA 4OOIA 3WTUC 4IJAA 4GCVA 2EWNA 3LA2A 1DP7P 3NEUA 2VODA 3O2PE 4RB0A 4LB5A 2FNAA 2L3DA 4OIQF 1YLFA 2OQRA 2Y0MA 3J81Z 5H6QA 1X3UA 4ENJA 5JR3A 3P9IA 3MAJA 5A2QK 4EQQA 4MHGA 2MD5A 2QM3A 1K6OA 1U8RA 4EJUA 4I01A 4HYEA 3E5QA 3BDDA 3T5XA 4OIRF 2V6CA 4GO1A 3GZ5A 4G94A 4MTDA 2HFHA 3H3ZA 1U6GA 1U78A 2NAZA 2DI3A 1W5TA 3F8BA 1UHWA 2QWWA 2A3SA 4R79A 5F6FA 1XGSA 1S29A 3KZZA 3IKVA 3J81K 3RPQA 3R61A 2DAOA 5KK1A 2NRAC 4U7DA 4GYGA 3ZPLA 4U7BA 3FHZA 1Z9CA 1KQ0A 2K86A 2LDUA 5ILSA 5LGUA 5DUKA 2QZ8A 4LLLA 2LKPA 5LGNA 2GAUA 2ZBKA 4UVCA 1GHCA 5AIPA 4EGZA 1O3QA 3KP4A 1I1GA 4IRHA 1O7LA 1RIOH 4L5IA 1Z6TA 2J5PA 1IN4A 1HW5A 3TO7A 2YSRA 4Q5SF 3SXYA 1LVAA 1O7FA 1HBXG 4LG0A 2D2WA 4G6QA 4L0ZB 3F8FA 3T8RA 4RB3C 2OU2A 1P4WA 2HQRA 3DQVC 4HQEA 1ZHFA 4OMYA 2K02A 4LG0B 1H9GA 3ML6A 1B4AA 1STZA 3HSFA 2W84A 4GYIA 5CVUA 3VEPA 5ICCA 2QBYB 1BIAA 2ZCWA 2EFQA 2XROA 3LQRA 4I02A 1PDNC 1D8JA 3U1DA 3MFKA 2Z9OA 2F5DA 3WGIA 5FLXK 3L09A 5ICGA 1BI0A 2JRTA 3K9TA 3RYRA 4EVIA 2F5EA 5ILVA 3EYYA 4PDKA 2MC3A 1ZGJA 1J2XA 4WX9A 5CJ9A 1ZLKA 1BC7C 5HVQC 4G8XA 2XAHA 4ASNA 5DV5A 5LGTA 4S05A 3LAPA 2HZTA 4EV0A 3HTUA 1YTYA 1QNTA 4OINF 1F4KA 1EV7A 1J7KA 5CYVA 4KMFA 4JK1X 4NHJA 3M9AA 3VOEA 3CUQA 1ONVA 1WQ2A 1FP2A 3JTHA 2XAFA 2XUBA 3IRQA 2A6EF 1U5TC 4ESFA 4MEYF 3ISPA 4LK1F 1R1TA 1LDDA 3P9CA 2HWVA 2WTEA 3LA3A 4EJOA 3R60A 2O61A 2V1XA 6PAXA 5CVRA 3PFIA 4P5OA 4HF2A 4XLNF 4YFKF 2RV8A 3L9FA 5L3CA 3I53A 4MEXF 1OPCA 2RKHA 5E20A 4YFNF 5HLHA 3ZMDA 3MWMA 2FRHA 2KKOA 3K0LA 3J80Z 3DPLC 1KQ8A 1QZYA 2HTJA 3HHHA 5E1WA 3SQNA 1XDUA 4OIPF 5L3FA 2EV6A 3TDZC 2H6BA 1SD4A 3MQ0A 3FXQA 4LJZF 1R58A 5TRDA 2IPQX 5DUIA 2A6HF 3FMQA 3GX4X 3K1NA 2OBPA 3FF5A 1FBUA 2IA1A 4WWCA 3RKWA 1AWCA 2STWA 4Z2YA 1ZAOA 4RB2C 1DDNA 4A0ZA 4EM2A 3K1MA 2A07F 2ZNZA 1QO0D 3GZ6A 2M87A 4ZYEA 2MH9A 5DD4A 4CHUA 4M6XA 1TW2A 2MH2A 1OYIA 3W6JB 1LNWA 3IRRA 1CGPA 1BJAA 2VOPA 5ERIA 3BJAA 1UHMA 1I6XA 2QVOA 5DCFA 3KP6A 1MD0A 3V8KA 3HTSB 5HOOA 4L5JA 2ISYA 1SAXA 4WK8F 1WWXA 4Y15A 1FSEA 4RGXA 1S8NA 3CTAA 3VB2A 2GXBA 3BWGA 5CVIA 2DU9A 5HS7A 4IRIA 4UNOA 3KP3A 3IL2A 4LLGF 5J8FA 3E6DA 4HBLA 2E7XA 5BS6A 5FO5A 4FX4A 1O3RA 3QP5A 2HEOA 3KEOA 3FM5A 1KGSA 1WRJA 1LEAA 2XKOA 4FX0A 3R6SA 3HRTA 2GA2A 1MJBA 1TQMA 4HW0A 4WCGA 3ECHA 3C7JA 3EYIA 4CGZA 5LEJA 4U0YA 3TO9A 3ZN1A 2IA2A 4AWXB 3MZYA 3I59A 5DCMB 4ZZDA 4A6DA 3HHGA 2VT3A 3VODA 1SMTA 3Q5FA 4A6EA 2WV0A 1IAWA 2FU4A 4MQVA 3HUGA 4N9HA 1R1UA 4HF0A 3I59B 1T39A 1YG2A 1BI2A 2P8TA 5JHUA 1F9NA 2OZ6A 2KRFA 1QBJA 2O6GE 3R0JA 5D8KB 3H3UA 3JW4A 4G7ZF 4FHTA 3KFWX 2YU3A 4IPAA 1IRFA 2V79A 3GFMA 2MLGA 3WTYC 3W6KB 5D4SA 5D5VB 3WTZA 1KU7A 1HSTA 3CJNA 3P9KA 3LSTA 2E1NA 1ZG3A 5LRSA 2VONA 4MTEA 2RQPA 2DQLA 3L7WA 1NHAA 4A12A 4I0AA 3GUDA 3BZ6A 2H94A 2RVCA 2X0LA 3QP6A 3V8LA 1FZPB 1TLHB 1K78A 1Y0UA 4LD5A 1RUOA 1XSVA 3HRMA 3CLOA 5LLQA 5HDKA 1JHHA 4FT8A 4OU0A 5JFRA 3F21A 1FP1D 3WGGA 5A2QZ 1K78B 1D8KA 1DPRA 4ON0A 1K7AA 5FD6A 3IKTA 3E5UA 2JZYA 5D6EA 1DPUA 2W24A 2TDXA 1LB2A 2DLLA 2XV4S 2VBXA 1W7PD 4KICA 2R7DA 2PEXA 3Q9SA 2NNYA 4HOBA 4YIFA 2H09A 4RS8A 2PFBA 2VE9A 5K5QA 5IT3A 1SD5A 1YS6A 4ZZLA 3B73A 3K69A 1SFUA 4L9TA 4O5VA 3O3KA 1B6AA 2ISZA 1LDJA 4KN4X 4G9YA 3JSOA 1R00A 1K79A 1Z05A 1XGOA 2PI0A 4S04A 2D1HA 4M9ZA 1V3FA 2W25A 2K7LA 4RGRA 3GVAA 3CO7C 4RB1A 2GQQA 1HQCA 1O57A 1ZN2A 2FSWA 2EA4A 1GXPA 5IT9K 4AIKA 1PP7U 1W7PA 1T38A 4L9VA 2GA1A 2NNNA 2QUFA 2UWMA 1B9NA 1HSJA 4TV7A 4A0XA 3RIRA 4PGGA 4P9UA 1XSXA 5LHHA 2A69F 1ULYA 1W7PB 2ELHA 3MZHA 4I7HA 2F5FA 2P5VA 5L3DA 2ETHA 2COMA 4EM1A 1WI9A 3T1BA 1TNSA 5ICEA 3HOTA 3Q9VA 2AS5F 2FF4A 1FBQA 3M8EA 4LMYA 3ULQB 2VN2A 3ZN0A 1FC3A 2LNBA 4R8HA 3M8FA 3CDHA 5DD8A 2JT1A 4UUVA 5FLXZ 2M45A 4NQWA 2G7HA 1YFHA 1VTNC 3WGHA 1FNNA 3F6VA 1E17A 3V7RA 4U0VA 4EJVA 5TJJA 5BQTA 4DNCA 4KYWA 2IRFG 1V4RA 3QAHA 1BI3A 2CO5A 2VE8A 3WODF 1CF7A 2IP2A 3NRVA 4ZYDA 2MLKA 3RI4A 1R1VA 2QBYA 3H92A 1XCBA 3R0AA 1D5VA 1W4MA 1ZG1A 5D6FA 4HDVA 1O3TA 4F7ZA 4HX4A 2JSCA 2VT2A 3P7NA 3CUOA 1CF7B 2NYXA 2FBIA 2FMYA 3E5XA 1H0MA 2HYFA 5HS8A 3F8CA 1J9IA 2GZWA 5FFXA 3BPXA 3ZP5A 3FZVA 2KJBA 3EETA 4O6JA 3EUHA 1HKQA 2A68F 4RGSA 3CO6C 2ZO4A 4Y17A 3C1DA 3IC7A 1XGNA 2P6SA 1HKTA 1FYLA 4UVBA 5HLIA 5E8GA 2Y48A 5JVTA 1ZRCA 2VBZA 4XSZF 1FY7A 1QZZA 1ZLJA 2OAZA 2B0LA 2E7WA 3JAMZ 3DV8A 1SFXA 4AIJA 1FYKA 3F6OA 1SMYF 5BPIA 3RDIA 4N9IA 1YS7A 1U3EM 3EQLF 4EJWA 1REPC 3DFGA 5E17F 5BOXA 1I5ZA 2PN6A 4UXNA 3T0YA 3TDUC 2CSOA 3GWZA 4WF2A 3QPTA 1BC8C 1B9MA 3RKYA 1IN6A 2FNPA 1H9TA 4ENKA 2C6YA 1DUXC 5LHGA 1IXRC 3KZYA 3QU3A 1SFEA 2L01A 3LWFA 3I71A 4M74A 5LEKA 2P7CB 5LRRA 1U5TA 4PCQA 4E70A 4B8XA 2UXNA 2DPDA 5EEHA 3C18A 3JAMK 2OQGA 3S2WA 4Q4ZF 2EFWA 2V1UA 1BN5A 1U5TB 2ZKZA 3DEUA 3I4PA 3GFIA 2HS5A 2R7FA 2PQ8A 1BBYA 3DF8A 4XBFA 4MNUA 1TQIA 1FWZA 4QLCU 4RAZA 3BOQA 2OZUA 2FBHA 1ZRDA 2FBKA 1IXCA 5DDGA 3KLOA 3F23A 1OYYA 4IHSA 3ZMUA 4BNCA 4WXHA 1XMKA 1TW3A 4LLNA 3RJPA 5D5WB 1RZ4A 4CXFA 1AOYA 3TO6A 4XSXF 4WXDA 5ED4A 2DK8A 2EK5A 5E8IA 4ENMA 3RKXA 4HV5A 4I0BA 2EFNA 4A5MA 1G4DA 3FMSA 4LB6B 1IZ1A 2A5YB 4UV9A 1E2XA 2ZXJA 1A04A 3IWZA 1IN7A 1MDMA 2HDCA 1S3JA 4Q47A 4ESJA 2DW4A 4QWQA 3WU0A 4KA4A 4ENNA 3ECOA 4WXCA 3HIFA 4H0EA 2EV0A 4KIGA 1MDMB 3NQOA 2OA4A 1FT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0O C;  1LEB A;  1S6L A;  2HTS A;  1XB4 A;  3HSR A;  5DCM A;  5FGM A;  2BBY A;  3FWE A;  3BJ6 A;  5K5R A;  3QPH A;  2X4H A;  2YX4 A;  1TBX A;  2Z3Y A;  3QOP A;  3V8J A;  2ADU A;  4I98 B;  3C3W A;  2CW0 F;  1KQ9 A;  3GEZ A;  1BIB A;  1R7J A;  4HF1 A;  4EJT A;  4YG2 F;  2ZFW A;  2PLY A;  2EJR A;  2AXL A;  4D0P A;  2RDP A;  5E1X A;  3DKW A;  4UV8 A;  2IA0 A;  3DPT A;  3GFL A;  2HQN A;  2HGC A;  2RGV A;  5L3B A;  1LDK B;  1SD7 A;  5LHI A;  1B59 A;  1P2F A;  3BJO A;  1PP8 F;  2BGC A;  5LBQ A;  2STT A;  2PMH A;  2XAG A;  4KN7 X;  3U9G A;  2KJC A;  3T8T A;  3KP7 A;  5CVJ A;  1OMI A;  3FMR A;  3FXR A;  1G3S A;  1Z1D A;  4G7H F;  4HDU A;  3MEX A;  4HAM A;  1R23 A;  1J59 A;  1W5S A;  2Z33 A;  2O03 A;  3PQK A;  2V1D A;  1YIO A;  4IVN A;  4KNY A;  1IN8 A;  4CIC A;  5DYM A;  5BMZ A;  2H27 A;  3GO5 A;  2QQB A;  4I09 A;  2QQ9 A;  2P6T A;  3GW2 A;  3JTG A;  4EGY A;  1BOA A;  3F8M A;  4MGR A;  1EH8 A;  2O0Y A;  3L00 A;  4A2U A;  5J8C A;  4GGG A;  4KIF A;  1QQI A;  5D8L B;  2Q2E A;  2GIV A;  1T98 A;  3F3X A;  3GXO A;  1Z91 A;  4BQA A;  1I1S A;  2P4W A;  1XSD A;  2WC2 A;  1MJ9 A;  5IT9 Z;  4CDG A;  4UVA A;  5CVV A;  2CYY A;  1P4X A;  4IF4 A;  2J5O A;  4L9J A;  2VOO A;  1GVJ A;  2CQK A;  3LA7 A;  4KMU X;  2F5C A;  3ERE D;  3BRO A;  4KUM A;  1XDS A;  2FE3 A;  1ZGA A;  3HRS A;  4BH9 A;  1J5Y A;  2W85 A;  1C0W A;  5H6R A;  4LK0 F;  2H6C A;  1EH6 A;  5AIQ A;  3TGN A;  2FQ3 A;  1FLI A;  2P7V B;  1YW9 A;  4BAY A;  2L4A A;  2ESH A;  3TKY A;  4L0Y B;  4HX7 A;  2DPU A;  5E1Z B;  2DTR A;  1UCR A;  3TQN A;  1G6N A;  3ZMV A;  2VC1 A;  4UHT A;  1FOK A;  4Q48 A;  3ROU A;  2YR2 A;  2XRN A;  5J6X A;  1XMA A;  4M9S A;  3KEQ A;  2XIG A;  3HRU A;  3D0S A;  4GXO A;  5K5O A;  1ZRF A;  2CFX A;  3KLN A;  2BE5 F;  2BV6 A;  3SZT A;  4AIH A;  1FX7 A;  5HDG A;  5FFZ A;  2DFI A;  2HR3 A;  3HYI A;  1JXS A;  4IXA A;  2XKP A;  2FXA A;  4A5N A;  2MBF A;  4U0W A;  5K1Y A;  2JTV A;  3K1P A;  3TOB A;  3I5U A;  3I58 A;  4YFX F;  4P55 A;  3ELK A;  2EV5 A;  3ABT A;  5L3G A;  3SZP A;  3DP7 A;  3F72 A;  2LSO A;  4CO8 A;  2RN7 A;  1JHF A;  3WTS C;  4KIB A;  3E6B A;  1YYV A;  1IUY A;  3R4K A;  5D4R A;  1FYM A;  2QYO A;  2M30 A;  4BHP A;  2CGP A;  3ZMZ A;  2ZNY A;  2LF8 A;  3WTV C;  3KE2 A;  1UST A;  3G3Z A;  2W57 A;  3VFZ A;  3WE2 A;  4YII A;  1R5H A;  4ESB A;  3CUQ C;  2ZJ2 A;  1UFM A;  3KCC A;  4HLX A;  1WKM A;  4CZZ A;  1KU2 A;  2L4M A;  2VBW A;  3LAJ A;  3IWF A;  2Z5U A;  2O8X A;  3FX3 A;  1XN7 A;  2K4J A;  2Y75 A;  3AAF A;  3E3V A;  2P5K A;  2XAJ A;  4B09 A;  1KYW A;  2FA5 A;  5F64 A;  2XHK A;  1RNL A;  2XAS A;  3RPU A;  5CLS A;  5HLG A;  2EB7 A;  3IHU A;  5D5X B;  4NB5 A;  4HZF A;  3U2R A;  1FPQ A;  5HDN A;  2PBI A;  3V4G A;  2KIF A;  2RNJ A;  3M1E A;  2D1V A;  2NS0 A;  4HA8 A;  4JBA A;  4K2E A;  2Z99 A;  1O3S A;  5AON A;  4G7O F;  1KA8 A;  3GLX A;  5ICF A;  2PMU A;  1D3Y A;  1R36 A;  4ZH4 F;  1MJA A;  1JGS A;  1HW1 A;  4PGH A;  1ZH5 A;  1YW7 A;  3L2C A;  1ZRE A;  1ZG5 A;  1J0R A;  3M7G A;  1UB9 A;  3CUQ B;  1LQ1 A;  1IF1 A;  1G3Y A;  5BPD A;  4OIO F;  4BHB A;  3FM3 A;  2D45 A;  1RUN A;  1YO5 C;  4OMZ A;  3HOS A;  4KT5 C;  1P6R A;  2M5W A;  2QLZ A;  1F1Z A;  3BP8 A;  4Y13 A;  2CG4 A;  3ZMT A;  4L9N A;  4M72 A;  2ZME A;  5ILU A;  3JSP A;  4KFC A;  5HS9 A;  1TTY A;  3E6C C;  2UZK A;  3QU6 A;  1SD6 A;  2HOE A;  1S7A A;  1L3L A;  1XD7 A;  2ZME B;  3N4M A;  1HKS A;  2M1B A;  3TOA A;  4PZJ A;  1IRG A;  1KU9 A;  4N0B A;  3WTX C;  4CYD A;  1FSH A;  3HSE A;  3KP5 A;  3EDP A;  2R3S A;  2IVM A;  2JPB A;  4RAY A;  4BYY A;  1G3T A;  2QEN A;  1YW8 A;  3OV8 A;  2MA3 A;  2ACJ A;  3GF2 A;  2PJP A;  2DBB A;  2XAQ A;  2CWE A;  2YPR A;  1Q1H A;  5D5U B;  2L54 A;  2G9W A;  4IRG A;  4MQ9 F;  4XLP F;  1XCV A;  3O6B B;  2RC4 A;  4BXU A;  4IHT A;  4R1H A;  2DK5 A;  1MGT A;  2GXG A;  3LFK A;  1MKM A;  3E6M A;  1U2W A;  3KP2 A;  3LQQ A;  4P96 A;  2Q0O A;  1R5G A;  2WWY A;  3RTR A;  2A61 A;  2P5L C;  4KDP A;  2XGX A;  2FOK A;  2K4B A;  4ZYH A;  3J80 K;  3WU1 B;  1HXD A;  3V7S A;  3GYH X;  1QPM A;  4LFU A;  4O3M A;  3WTT C;  3BY6 A;  3N97 A;  1Z7U A;  1ODD A;  1ON1 A;  2FEZ A;  2Q8K A;  2KIU A;  3WG9 A;  2XVC A;  4AD9 A;  5F1R A;  1RI7 A;  5H20 A;  2ESN A;  2V9V A;  2IJL A;  3B02 A;  4L18 B;  2JPC A;  3MCZ A;  1F5T A;  4ETS A;  1TNT A;  3FXU A;  3I64 A;  1ON2 A;  2DQR A;  1ZAR A;  4HV6 A;  1OKR A;  2DO7 A;  2EFO A;  1P4A A;  2HKX A;  3F8N A;  1BI1 A;  1S7O A;  2HYG D;  2BEO A;  4P9F A;  2VXZ A;  1FBS A;  4RGU A;  4HQM A;  2L02 A;  1KYZ A;  4EM0 B;  5L3E A;  4G6D A;  3SHF A;  4M73 A;  1BM9 A;  5FB2 A;  3V7C A;  4A0Y A;  5EEG A;  2E1C A;  3PQJ A;  1PUE E;  1OYW A;  3DXJ F;  1J75 A;  4JQF A;  4XRF A;  4M71 A;  5DEQ A;  2K27 A;  1HW2 A;  5JI6 A;  3J7A O;  4DQ2 A;  2VC0 A;  3WTW C;  1IW7 F;  3ZMS A;  1G3W A;  1T2K A;  2F2E A;  3K2Z A;  1TQP A;  3ZQ7 A;  3REO A;  4I2O A;  4LGW A;  1XGM A;  1EH7 A;  3QRF F;  1USS A;  1I27 A;  1KU3 A;  3E97 A;  3I54 A;  3ABU A;  1LJ9 A;  1YQA A;  1Z6R A;  2BYV E;  4HX8 A;  3SFZ A;  1T6S A;  4M6Y A;  2OD5 A;  1ZYR F;  3OOP A;  1B1B A;  2DT5 A;  5E18 F;  3G73 A;  4HLY A;  1T0F A;  4U88 A;  2KIM A;  2G7U A;  1OR7 A;  4BHC A;  5KVR A;  2UXX A;  1MZB A;  1R22 A;  4EMS A;  1P92 A;  1IN5 A;  2YX7 A;  2GWR A;  4ZYG A;  2EFP A;  3GFJ A;  1IXS B;  3KET A;  3BPV A;  2HKO A;  2IT0 A;  3F22 A;  3RYP A;  2PG4 A;  2EA2 A;  1GXQ A;  3COA C;  2LF7 A;  3D5L A;  4AVP A;  4M9X A;  2O3F A;  1QGP A;  3WE3 A;  2VBY A;  2FML A;  2QQA A;  5FD5 A;  2IW5 A;  2M8E A;  1WSU A;  1JE8 A;  3I0T A;  4OOI A;  3WTU C;  4IJA A;  4GCV A;  2EWN A;  3LA2 A;  1DP7 P;  3NEU A;  2VOD A;  3O2P E;  4RB0 A;  4LB5 A;  2FNA A;  2L3D A;  4OIQ F;  1YLF A;  2OQR A;  2Y0M A;  3J81 Z;  5H6Q A;  1X3U A;  4ENJ A;  5JR3 A;  3P9I A;  3MAJ A;  5A2Q K;  4EQQ A;  4MHG A;  2MD5 A;  2QM3 A;  1K6O A;  1U8R A;  4EJU A;  4I01 A;  4HYE A;  3E5Q A;  3BDD A;  3T5X A;  4OIR F;  2V6C A;  4GO1 A;  3GZ5 A;  4G94 A;  4MTD A;  2HFH A;  3H3Z A;  1U6G A;  1U78 A;  2NAZ A;  2DI3 A;  1W5T A;  3F8B A;  1UHW A;  2QWW A;  2A3S A;  4R79 A;  5F6F A;  1XGS A;  1S29 A;  3KZZ A;  3IKV A;  3J81 K;  3RPQ A;  3R61 A;  2DAO A;  5KK1 A;  2NRA C;  4U7D A;  4GYG A;  3ZPL A;  4U7B A;  3FHZ A;  1Z9C A;  1KQ0 A;  2K86 A;  2LDU A;  5ILS A;  5LGU A;  5DUK A;  2QZ8 A;  4LLL A;  2LKP A;  5LGN A;  2GAU A;  2ZBK A;  4UVC A;  1GHC A;  5AIP A;  4EGZ A;  1O3Q A;  3KP4 A;  1I1G A;  4IRH A;  1O7L A;  1RIO H;  4L5I A;  1Z6T A;  2J5P A;  1IN4 A;  1HW5 A;  3TO7 A;  2YSR A;  4Q5S F;  3SXY A;  1LVA A;  1O7F A;  1HBX G;  4LG0 A;  2D2W A;  4G6Q A;  4L0Z B;  3F8F A;  3T8R A;  4RB3 C;  2OU2 A;  1P4W A;  2HQR A;  3DQV C;  4HQE A;  1ZHF A;  4OMY A;  2K02 A;  4LG0 B;  1H9G A;  3ML6 A;  1B4A A;  1STZ A;  3HSF A;  2W84 A;  4GYI A;  5CVU A;  3VEP A;  5ICC A;  2QBY B;  1BIA A;  2ZCW A;  2EFQ A;  2XRO A;  3LQR A;  4I02 A;  1PDN C;  1D8J A;  3U1D A;  3MFK A;  2Z9O A;  2F5D A;  3WGI A;  5FLX K;  3L09 A;  5ICG A;  1BI0 A;  2JRT A;  3K9T A;  3RYR A;  4EVI A;  2F5E A;  5ILV A;  3EYY A;  4PDK A;  2MC3 A;  1ZGJ A;  1J2X A;  4WX9 A;  5CJ9 A;  1ZLK A;  1BC7 C;  5HVQ C;  4G8X A;  2XAH A;  4ASN A;  5DV5 A;  5LGT A;  4S05 A;  3LAP A;  2HZT A;  4EV0 A;  3HTU A;  1YTY A;  1QNT A;  4OIN F;  1F4K A;  1EV7 A;  1J7K A;  5CYV A;  4KMF A;  4JK1 X;  4NHJ A;  3M9A A;  3VOE A;  3CUQ A;  1ONV A;  1WQ2 A;  1FP2 A;  3JTH A;  2XAF A;  2XUB A;  3IRQ A;  2A6E F;  1U5T C;  4ESF A;  4MEY F;  3ISP A;  4LK1 F;  1R1T A;  1LDD A;  3P9C A;  2HWV A;  2WTE A;  3LA3 A;  4EJO A;  3R60 A;  2O61 A;  2V1X A;  6PAX A;  5CVR A;  3PFI A;  4P5O A;  4HF2 A;  4XLN F;  4YFK F;  2RV8 A;  3L9F A;  5L3C A;  3I53 A;  4MEX F;  1OPC A;  2RKH A;  5E20 A;  4YFN F;  5HLH A;  3ZMD A;  3MWM A;  2FRH A;  2KKO A;  3K0L A;  3J80 Z;  3DPL C;  1KQ8 A;  1QZY A;  2HTJ A;  3HHH A;  5E1W A;  3SQN A;  1XDU A;  4OIP F;  5L3F A;  2EV6 A;  3TDZ C;  2H6B A;  1SD4 A;  3MQ0 A;  3FXQ A;  4LJZ F;  1R58 A;  5TRD A;  2IPQ X;  5DUI A;  2A6H F;  3FMQ A;  3GX4 X;  3K1N A;  2OBP A;  3FF5 A;  1FBU A;  2IA1 A;  4WWC A;  3RKW A;  1AWC A;  2STW A;  4Z2Y A;  1ZAO A;  4RB2 C;  1DDN A;  4A0Z A;  4EM2 A;  3K1M A;  2A07 F;  2ZNZ A;  1QO0 D;  3GZ6 A;  2M87 A;  4ZYE A;  2MH9 A;  5DD4 A;  4CHU A;  4M6X A;  1TW2 A;  2MH2 A;  1OYI A;  3W6J B;  1LNW A;  3IRR A;  1CGP A;  1BJA A;  2VOP A;  5ERI A;  3BJA A;  1UHM A;  1I6X A;  2QVO A;  5DCF A;  3KP6 A;  1MD0 A;  3V8K A;  3HTS B;  5HOO A;  4L5J A;  2ISY A;  1SAX A;  4WK8 F;  1WWX A;  4Y15 A;  1FSE A;  4RGX A;  1S8N A;  3CTA A;  3VB2 A;  2GXB A;  3BWG A;  5CVI A;  2DU9 A;  5HS7 A;  4IRI A;  4UNO A;  3KP3 A;  3IL2 A;  4LLG F;  5J8F A;  3E6D A;  4HBL A;  2E7X A;  5BS6 A;  5FO5 A;  4FX4 A;  1O3R A;  3QP5 A;  2HEO A;  3KEO A;  3FM5 A;  1KGS A;  1WRJ A;  1LEA A;  2XKO A;  4FX0 A;  3R6S A;  3HRT A;  2GA2 A;  1MJB A;  1TQM A;  4HW0 A;  4WCG A;  3ECH A;  3C7J A;  3EYI A;  4CGZ A;  5LEJ A;  4U0Y A;  3TO9 A;  3ZN1 A;  2IA2 A;  4AWX B;  3MZY A;  3I59 A;  5DCM B;  4ZZD A;  4A6D A;  3HHG A;  2VT3 A;  3VOD A;  1SMT A;  3Q5F A;  4A6E A;  2WV0 A;  1IAW A;  2FU4 A;  4MQV A;  3HUG A;  4N9H A;  1R1U A;  4HF0 A;  3I59 B;  1T39 A;  1YG2 A;  1BI2 A;  2P8T A;  5JHU A;  1F9N A;  2OZ6 A;  2KRF A;  1QBJ A;  2O6G E;  3R0J A;  5D8K B;  3H3U A;  3JW4 A;  4G7Z F;  4FHT A;  3KFW X;  2YU3 A;  4IPA A;  1IRF A;  2V79 A;  3GFM A;  2MLG A;  3WTY C;  3W6K B;  5D4S A;  5D5V B;  3WTZ A;  1KU7 A;  1HST A;  3CJN A;  3P9K A;  3LST A;  2E1N A;  1ZG3 A;  5LRS A;  2VON A;  4MTE A;  2RQP A;  2DQL A;  3L7W A;  1NHA A;  4A12 A;  4I0A A;  3GUD A;  3BZ6 A;  2H94 A;  2RVC A;  2X0L A;  3QP6 A;  3V8L A;  1FZP B;  1TLH B;  1K78 A;  1Y0U A;  4LD5 A;  1RUO A;  1XSV A;  3HRM A;  3CLO A;  5LLQ A;  5HDK A;  1JHH A;  4FT8 A;  4OU0 A;  5JFR A;  3F21 A;  1FP1 D;  3WGG A;  5A2Q Z;  1K78 B;  1D8K A;  1DPR A;  4ON0 A;  1K7A A;  5FD6 A;  3IKT A;  3E5U A;  2JZY A;  5D6E A;  1DPU A;  2W24 A;  2TDX A;  1LB2 A;  2DLL A;  2XV4 S;  2VBX A;  1W7P D;  4KIC A;  2R7D A;  2PEX A;  3Q9S A;  2NNY A;  4HOB A;  4YIF A;  2H09 A;  4RS8 A;  2PFB A;  2VE9 A;  5K5Q A;  5IT3 A;  1SD5 A;  1YS6 A;  4ZZL A;  3B73 A;  3K69 A;  1SFU A;  4L9T A;  4O5V A;  3O3K A;  1B6A A;  2ISZ A;  1LDJ A;  4KN4 X;  4G9Y A;  3JSO A;  1R00 A;  1K79 A;  1Z05 A;  1XGO A;  2PI0 A;  4S04 A;  2D1H A;  4M9Z A;  1V3F A;  2W25 A;  2K7L A;  4RGR A;  3GVA A;  3CO7 C;  4RB1 A;  2GQQ A;  1HQC A;  1O57 A;  1ZN2 A;  2FSW A;  2EA4 A;  1GXP A;  5IT9 K;  4AIK A;  1PP7 U;  1W7P A;  1T38 A;  4L9V A;  2GA1 A;  2NNN A;  2QUF A;  2UWM A;  1B9N A;  1HSJ A;  4TV7 A;  4A0X A;  3RIR A;  4PGG A;  4P9U A;  1XSX A;  5LHH A;  2A69 F;  1ULY A;  1W7P B;  2ELH A;  3MZH A;  4I7H A;  2F5F A;  2P5V A;  5L3D A;  2ETH A;  2COM A;  4EM1 A;  1WI9 A;  3T1B A;  1TNS A;  5ICE A;  3HOT A;  3Q9V A;  2AS5 F;  2FF4 A;  1FBQ A;  3M8E A;  4LMY A;  3ULQ B;  2VN2 A;  3ZN0 A;  1FC3 A;  2LNB A;  4R8H A;  3M8F A;  3CDH A;  5DD8 A;  2JT1 A;  4UUV A;  5FLX Z;  2M45 A;  4NQW A;  2G7H A;  1YFH A;  1VTN C;  3WGH A;  1FNN A;  3F6V A;  1E17 A;  3V7R A;  4U0V A;  4EJV A;  5TJJ A;  5BQT A;  4DNC A;  4KYW A;  2IRF G;  1V4R A;  3QAH A;  1BI3 A;  2CO5 A;  2VE8 A;  3WOD F;  1CF7 A;  2IP2 A;  3NRV A;  4ZYD A;  2MLK A;  3RI4 A;  1R1V A;  2QBY A;  3H92 A;  1XCB A;  3R0A A;  1D5V A;  1W4M A;  1ZG1 A;  5D6F A;  4HDV A;  1O3T A;  4F7Z A;  4HX4 A;  2JSC A;  2VT2 A;  3P7N A;  3CUO A;  1CF7 B;  2NYX A;  2FBI A;  2FMY A;  3E5X A;  1H0M A;  2HYF A;  5HS8 A;  3F8C A;  1J9I A;  2GZW A;  5FFX A;  3BPX A;  3ZP5 A;  3FZV A;  2KJB A;  3EET A;  4O6J A;  3EUH A;  1HKQ A;  2A68 F;  4RGS A;  3CO6 C;  2ZO4 A;  4Y17 A;  3C1D A;  3IC7 A;  1XGN A;  2P6S A;  1HKT A;  1FYL A;  4UVB A;  5HLI A;  5E8G A;  2Y48 A;  5JVT A;  1ZRC A;  2VBZ A;  4XSZ F;  1FY7 A;  1QZZ A;  1ZLJ A;  2OAZ A;  2B0L A;  2E7W A;  3JAM Z;  3DV8 A;  1SFX A;  4AIJ A;  1FYK A;  3F6O A;  1SMY F;  5BPI A;  3RDI A;  4N9I A;  1YS7 A;  1U3E M;  3EQL F;  4EJW A;  1REP C;  3DFG A;  5E17 F;  5BOX A;  1I5Z A;  2PN6 A;  4UXN A;  3T0Y A;  3TDU C;  2CSO A;  3GWZ A;  4WF2 A;  3QPT A;  1BC8 C;  1B9M A;  3RKY A;  1IN6 A;  2FNP A;  1H9T A;  4ENK A;  2C6Y A;  1DUX C;  5LHG A;  1IXR C;  3KZY A;  3QU3 A;  1SFE A;  2L01 A;  3LWF A;  3I71 A;  4M74 A;  5LEK A;  2P7C B;  5LRR A;  1U5T A;  4PCQ A;  4E70 A;  4B8X A;  2UXN A;  2DPD A;  5EEH A;  3C18 A;  3JAM K;  2OQG A;  3S2W A;  4Q4Z F;  2EFW A;  2V1U A;  1BN5 A;  1U5T B;  2ZKZ A;  3DEU A;  3I4P A;  3GFI A;  2HS5 A;  2R7F A;  2PQ8 A;  1BBY A;  3DF8 A;  4XBF A;  4MNU A;  1TQI A;  1FWZ A;  4QLC U;  4RAZ A;  3BOQ A;  2OZU A;  2FBH A;  1ZRD A;  2FBK A;  1IXC A;  5DDG A;  3KLO A;  3F23 A;  1OYY A;  4IHS A;  3ZMU A;  4BNC A;  4WXH A;  1XMK A;  1TW3 A;  4LLN A;  3RJP A;  5D5W B;  1RZ4 A;  4CXF A;  1AOY A;  3TO6 A;  4XSX F;  4WXD A;  5ED4 A;  2DK8 A;  2EK5 A;  5E8I A;  4ENM A;  3RKX A;  4HV5 A;  4I0B A;  2EFN A;  4A5M A;  1G4D A;  3FMS A;  4LB6 B;  1IZ1 A;  2A5Y B;  4UV9 A;  1E2X A;  2ZXJ A;  1A04 A;  3IWZ A;  1IN7 A;  1MDM A;  2HDC A;  1S3J A;  4Q47 A;  4ESJ A;  2DW4 A;  4QWQ A;  3WU0 A;  4KA4 A;  4ENN A;  3ECO A;  4WXC A;  3HIF A;  4H0E A;  2EV0 A;  4KIG A;  1MDM B;  3NQO A;  2OA4 A;  1FT9 A; 
#chains in the Genus database with same CATH topology
 2LR8 A;  1L0O C;  3IAS 2;  1LEB A;  2CUE A;  1VQN I;  1TWG J;  1S6L A;  2HTS A;  1XB4 A;  3HSR A;  1WJ5 A;  5DCM A;  5FGM A;  4B44 A;  2BXY A;  2BBY A;  3FWE A;  1T95 A;  5LFA A;  4UB8 C;  2NVT J;  3BJ6 A;  3VYU B;  2YU9 J;  5K5R A;  3QPH A;  2X4H A;  2YX4 A;  1UG0 A;  3G1L A;  4XIC A;  2XGE A;  4DYR A;  1TBX A;  2Z3Y A;  3NWS A;  1BL0 A;  1T33 A;  4NDL A;  3QOP A;  4IOA F;  3A02 A;  3V8J A;  2NOG A;  4A3G J;  5IYB J;  3BG9 A;  2ADU A;  2DJN A;  2YS9 A;  4I98 B;  4MIM A;  3C3W A;  5M3M J;  1AHD P;  1N78 A;  2I8D A;  2CW0 F;  1KQ9 A;  3GEZ A;  3V42 A;  1BIB A;  2V7F A;  1R7J A;  2FX0 A;  4HF1 A;  4EJT A;  1KON A;  4YG2 F;  2ZFW A;  2PLY A;  5FRN A;  2EJR A;  2AXL A;  4D0P A;  2XC7 A;  3MKY B;  2RDP A;  4EEF G;  5E1X A;  3DKW A;  4UV8 A;  3Q3S A;  2IA0 A;  2PMZ A;  3DPT A;  3GFL A;  1WJB A;  2HQN A;  4V2F A;  5EGO A;  2HGC A;  4CH7 A;  2RGV A;  2DCE A;  1TWH J;  5L3B A;  1VZ0 A;  1LDK B;  3ABK H;  3KEY A;  1SD7 A;  5LHI A;  1B59 A;  2KMU A;  3OYE A;  3HJE A;  1P2F A;  1Y1V J;  5GTI C;  3BJO A;  4IHX A;  1PP8 F;  2BGC A;  5LBQ A;  5EGO B;  2STT A;  2PMH A;  2CW8 A;  2X1C A;  2XAG A;  3D1N I;  1A6Q A;  2BY0 A;  4KN7 X;  3U9G A;  2KJC A;  2L0K A;  3T8T A;  1OR7 C;  2BHZ A;  2R5Y B;  1MMA A;  2K9M A;  3KP7 A;  5CVJ A;  1WJF A;  4AID A;  1OMI A;  3FMR A;  3FXR A;  4XKB A;  3RSN A;  3GTP J;  1G3S A;  1Z1D A;  4G7H F;  4J00 A;  1MIJ A;  4HDU A;  3MEX A;  4QSH A;  3A2K A;  3K4J A;  4HAM A;  5DM7 F;  1R23 A;  3OS1 A;  4BJ5 C;  1E0E A;  5HNF A;  1J59 A;  4KT6 A;  1W5S A;  2K40 A;  2Z33 A;  1MBK A;  2O03 A;  3PQK A;  3OYK A;  2V1D A;  4M6V A;  3CME I;  2JA7 J;  1R9T J;  2B9S A;  1YIO A;  2CU7 A;  3OL3 A;  1OQY A;  2DOF A;  4IVN A;  3PFY A;  2VIX A;  5M5Y J;  4IHV A;  2LY2 A;  4KNY A;  1IN8 A;  4CIC A;  2DFH A;  5DYM A;  1A36 A;  5BMZ A;  3I3L A;  2H27 A;  5GAG J;  3GO5 A;  2QQB A;  4I09 A;  2QQ9 A;  2P6T A;  3GW2 A;  3JTG A;  4EGY A;  4E7K A;  1BOA A;  5E3O A;  3EUA A;  3JRI A;  3F8M A;  1D0X A;  4MGR A;  1EH8 A;  4A93 J;  2O0Y A;  3L00 A;  4A2U A;  5J8C A;  3GTG J;  4GGG A;  3BG3 A;  2M4G A;  4KIF A;  1W0U A;  4C30 A;  1QQI A;  5D8L B;  1JUP A;  2Q2E A;  2GIV A;  1T98 A;  3F3X A;  2F48 A;  3GXO A;  1Z91 A;  4BQA A;  1I1S A;  2HZD A;  3HPG A;  2P4W A;  1O4X A;  1QU3 A;  1XSD A;  2WC2 A;  4JX6 A;  1MJ9 A;  2Z16 A;  3BQZ A;  5IT9 Z;  4B1R A;  4CDG A;  4UVA A;  2W4S A;  2A05 A;  5CVV A;  5J1R A;  2CYY A;  2LTP A;  1P4X A;  4IF4 A;  2J5O A;  2Q2E B;  4L9J A;  5HOD A;  1HOM A;  1D1C A;  1QVT A;  2VOO A;  1GVJ A;  2CQK A;  2E34 A;  3LA7 A;  2XGC A;  3O8G A;  2F5C A;  4KMU X;  2VKD A;  3ERE D;  3BRO A;  4KUM A;  2IAI A;  1OCO H;  1XDS A;  1LKX A;  2FE3 A;  1ZGA A;  3HRS A;  3ZRG A;  2KL4 A;  4M3G A;  4BH9 A;  2IGO A;  1J5Y A;  2W85 A;  1C0W A;  1IO2 A;  3DKX A;  3AG4 H;  2JK3 A;  4W97 A;  1UJ8 A;  2F5V A;  5H6R A;  4LK0 F;  1Y8R B;  2H6C A;  2EZH A;  2FQ4 A;  4HG2 A;  3TL4 X;  1EH6 A;  2X85 A;  4V2G A;  5AIQ A;  4XKW A;  3TGN A;  1HCR A;  1QVU A;  2FQ3 A;  1FLI A;  2P7V B;  1YW9 A;  2HOA A;  2BY3 A;  3OIQ A;  4BAY A;  2L4A A;  1ERD A;  2DMU A;  3KYL A;  1WFX A;  1RRJ A;  2ESH A;  2NOJ B;  3TKY A;  4L0Y B;  4HX7 A;  4AYB A;  2DPU A;  1ACI A;  5E1Z B;  2BW3 A;  2DTR A;  1UCR A;  3M07 A;  2O5R A;  3TQN A;  1G6N A;  2P0W A;  2Z2S B;  4Y4R A;  3ZMV A;  1DGR M;  2VC1 A;  4N4O B;  4UHT A;  4F91 B;  3H9Q A;  1WJA A;  3HKZ A;  3DEE A;  1FOK A;  4JYK A;  4XKC A;  1SVL A;  2EIJ H;  4F52 A;  4Q48 A;  3BR6 A;  3ROU A;  2YR2 A;  2P81 A;  2XRN A;  4BS9 A;  4F55 A;  1W36 D;  1PYV A;  2BW3 B;  3FHN A;  3L2W A;  1IG7 A;  2DOE A;  3CZ6 A;  5J6X A;  3J7A Y;  1XMA A;  2F4M B;  3CCL I;  4C2T A;  1VQ8 I;  1NH3 A;  4M9S A;  5E3M A;  1WPK A;  3KEQ A;  3GTO J;  2HDW A;  1YJW I;  1W36 C;  1YX5 A;  2XIG A;  4J01 A;  3HRU A;  3D0S A;  4GXO A;  3TW6 A;  5K5O A;  1ZRF A;  1Q1V A;  2CFX A;  3KLN A;  5B66 C;  2BE5 F;  3HB9 A;  4HPQ A;  1LPQ A;  3HBL A;  2BV6 A;  2KRH A;  3SZT A;  1JJ8 C;  4AIH A;  1FX7 A;  1HF0 A;  5HDG A;  3K4M A;  5FFZ A;  3TMO A;  2DFI A;  2HR3 A;  3HYI A;  5EJC A;  1JXS A;  4IXA A;  2XKP A;  3AKZ A;  2FXA A;  4A5N A;  3VSK A;  3BG6 A;  2MBF A;  4U0W A;  5K1Y A;  2JTV A;  3K1P A;  3TOB A;  3I5U A;  4ZDP A;  3I58 A;  2R7S A;  4YFX F;  2I5U A;  4P55 A;  3ELK A;  2ZSI B;  2EV5 A;  3ABT A;  5L3G A;  3SZP A;  3DP7 A;  3F72 A;  2LSO A;  2K5C A;  2IBD A;  4C2M J;  4CO8 A;  3DTE A;  1OCP A;  2RN7 A;  1JHF A;  4YIR X;  4KIB A;  3E6B A;  1YYV A;  3IUO A;  3WTS C;  1H89 C;  1B8I B;  1IUY A;  3A4C A;  5JHF A;  2TRT A;  2KP6 A;  3R4K A;  3FXM A;  5D4R A;  1FYM A;  2QYO A;  2OJE D;  4AU7 A;  3CC2 I;  2M30 A;  4BHP A;  2CGP A;  3ZMZ A;  3CMM A;  4RM2 A;  2CV1 A;  2ZNY A;  3MVP A;  3GTL J;  2LF8 A;  2LY1 A;  3JRC A;  1JGG A;  3WTV C;  3KE2 A;  1UST A;  3KX2 A;  3ASO H;  3G3Z A;  3IAM 2;  4XLE A;  3K7A J;  2W57 A;  2HOT A;  1M1E B;  3W2A A;  3VFZ A;  4A3M J;  2R7R A;  5CQG A;  4JP0 A;  3RZO J;  3BTL A;  4C3I J;  5HNH A;  3WE2 A;  2EIL H;  4YII A;  1XPX A;  1R5H A;  3F9K A;  4ESB A;  4UY8 I;  4PFP A;  1Z67 A;  3CUQ C;  4RLQ A;  1BR1 A;  2ZJ2 A;  2R0Q C;  4RAG A;  1UFM A;  2XSJ C;  3JR9 A;  3KCC A;  4HLX A;  3ABL H;  1WKM A;  4HNU A;  3MKZ A;  2HVR A;  2HYJ A;  4CZZ A;  3BG5 A;  1KU2 A;  1W5C C;  2L4M A;  2VBW A;  2M2E A;  3HEF A;  3LAJ A;  3IWF A;  2Z5U A;  2O8X A;  3FX3 A;  2G0E A;  4ANJ A;  1XN7 A;  2K4J A;  5IY5 H;  2Y75 A;  3OYD A;  4RA2 A;  3AAF A;  3E3V A;  5J1U A;  2P5K A;  1JT6 A;  5E79 C;  2VKH A;  3HOU J;  3MN2 A;  2XAJ A;  3UR3 C;  4B09 A;  2R7Z J;  2K3F A;  3BCB A;  1KYW A;  2JRM A;  2FA5 A;  5F64 A;  1FEX A;  2DMP A;  2XHK A;  4XMY A;  2QSF X;  1NK3 P;  1RNL A;  2XAS A;  3A1Y A;  2MG4 A;  3RPU A;  3CCV I;  4MFE A;  2ZME C;  5CLS A;  4AUX A;  4QTR A;  5HLG A;  2EB7 A;  3IHU A;  4BE0 A;  5D5X B;  4NB5 A;  3OYB A;  4HZF A;  2E1O A;  3U2R A;  2GXA A;  1FPQ A;  3OWT A;  5HDN A;  2DTZ A;  1X4P A;  2PBI A;  2KIF A;  2RNJ A;  3NAR A;  4XN3 A;  3V4G A;  3M1E A;  2HOS A;  2JQ7 A;  2D1V A;  2NS0 A;  2V9P A;  4DGW B;  1KZH A;  4HA8 A;  4JBA A;  4K2E A;  2Z99 A;  1O3S A;  5AON A;  4G7O F;  1KA8 A;  1FMW A;  3GLX A;  5ICF A;  5FKO A;  2PMU A;  4BJ6 C;  1D3Y A;  1IC8 A;  2R5Z A;  1R36 A;  3DU5 A;  4ZH4 F;  1MJA A;  1JGS A;  1HW1 A;  4PGH A;  1ZH5 A;  1IGN A;  1YW7 A;  3L2C A;  2DYR H;  3AG2 H;  1ZRE A;  1ZG5 A;  4F93 B;  2RNG A;  4BQQ A;  1GV5 A;  4ZJZ A;  4XQF A;  2L9V A;  4PSX A;  1J0R A;  3M7G A;  3BLY A;  1UB9 A;  3H9G A;  2LBF B;  2LG4 A;  3CUQ B;  3J7Y J;  3K2A A;  1LQ1 A;  2QQ8 A;  1IF1 A;  1G3Y A;  5BPD A;  4OIO F;  4BHB A;  2R5Z B;  2O9L A;  3S93 A;  3FM3 A;  4PSW A;  2D45 A;  1RUN A;  2VPL A;  2VAS A;  1YO5 C;  4OMZ A;  3HOS A;  4KT5 C;  1P6R A;  2NVU B;  1GVD A;  2M5W A;  2QLZ A;  1F1Z A;  1OCR H;  3BP8 A;  2DT7 B;  4Y13 A;  1X1P A;  2CG4 A;  2Y69 H;  2B7E A;  3ZMT A;  4L9N A;  4M72 A;  2ZME A;  5ILU A;  3EUK L;  3JSP A;  4A3J J;  4MFD A;  1MH3 A;  4KFC A;  2X48 A;  1OCZ H;  1TTY A;  5HS9 A;  5K7H A;  3E6C C;  1Y39 A;  2LC2 A;  2CFO A;  2UZK A;  1R6R A;  3QU6 A;  3ESW B;  4A3I J;  1SD6 A;  1BOB A;  5FKN A;  2HOE A;  2QKL B;  1S7A A;  1L3L A;  1XD7 A;  2ZME B;  3N4M A;  4A3L J;  1HKS A;  2M1B A;  4PFO A;  3TOA A;  4PZJ A;  1IRG A;  1KU9 A;  4II2 A;  4BQN A;  3G71 I;  1BR4 A;  1JTX A;  2BY2 A;  4N0B A;  3WTX C;  3IH2 A;  3UKG A;  4CYD A;  3OIO A;  1FSH A;  3HSE A;  3OYG A;  3J7Z I;  3KP5 A;  4DIQ A;  3FXO A;  3WHC A;  4CUG A;  2DA1 A;  1E3H A;  2ELJ A;  1JI8 A;  2COB A;  1Y56 A;  2PX9 A;  2M7B A;  1VQ6 I;  3TED A;  3EDP A;  2E36 A;  2R3S A;  2IVM A;  2JPB A;  4RAY A;  2NVY J;  2WBM A;  1FTT A;  4XOT A;  4KIS A;  2DFF A;  2VJ5 A;  4BYY A;  3BZK A;  1G3T A;  3DWL E;  1PUF B;  1QHG A;  2QEN A;  1YW8 A;  3OV8 A;  2MA3 A;  4ZTF A;  2ACJ A;  2V6E A;  2X6W A;  3GF2 A;  4A69 C;  2PJP A;  2DBB A;  2W1O A;  2XAQ A;  2CWE A;  3ZQC A;  2Y0S A;  2YPR A;  1Q1H A;  3ZQG A;  1RKW A;  5D5U B;  2L54 A;  2G9W A;  4IRG A;  4MQ9 F;  4DJA A;  1LFU P;  1FOW A;  4XLP F;  1XCV A;  3O6B B;  2Q1Z B;  2RC4 A;  3CMY A;  4G12 A;  4BXU A;  1X2N A;  3HGG A;  4IHT A;  2GIZ A;  2E60 A;  1Y0N A;  2DJI A;  4R1H A;  4OWR B;  2DK5 A;  1X1C A;  2EPF A;  3I55 I;  4ZYA A;  2KDO A;  1XMX A;  2D5V A;  1MGT A;  2ID3 A;  1JKQ C;  1JUM A;  2GXG A;  3LFK A;  4X1E A;  1MKM A;  3OSF A;  3E6M A;  1U2W A;  1RR8 C;  2DA5 A;  3KP2 A;  3LQQ A;  4P96 A;  5IP7 J;  2BVM A;  1TWF J;  2Q0O A;  2RRE A;  4M3D A;  1R5G A;  2WWY A;  3RTR A;  2A61 A;  2HI3 A;  3HPH A;  2P5L C;  3OYH A;  3F0C A;  4KDP A;  2XGX A;  1XG1 A;  3OMY A;  2FOK A;  2K4B A;  4ZYH A;  3J80 K;  3WU1 B;  1HXD A;  1WJE A;  3AL0 C;  3V7S A;  4BEH A;  3GYH X;  2B63 J;  1QPM A;  3DTI A;  4LFU A;  4O3M A;  3LMM A;  4IZZ A;  2BVL A;  1TL8 A;  3WTT C;  3BY6 A;  3N97 A;  1Z7U A;  1P7I A;  1VQL I;  1ODD A;  3Q0U A;  3LSP A;  3W6V A;  1ON1 A;  2FEZ A;  1JKR C;  2Q8K A;  1VQO I;  2KIU A;  2HXO A;  3WG9 A;  4BEH B;  2XVC A;  3GLL A;  4AD9 A;  2WB1 A;  4E7H A;  5F1R A;  1RI7 A;  3SJM A;  5H20 A;  4H4K C;  3FKJ A;  3JRH A;  1A31 A;  3ASN H;  2M34 A;  2ESN A;  2V9V A;  4DYC A;  4G6T B;  2IJL A;  3B02 A;  4L18 B;  2JPC A;  2BZT A;  5F04 A;  3MCZ A;  3WU2 C;  1F5T A;  4BUP A;  3RKQ A;  4ETS A;  3BZC A;  1R4M B;  1TNT A;  4A3F J;  3FXU A;  3CC7 I;  1AKH A;  3I64 A;  1T56 A;  3S17 J;  4XOP A;  1ON2 A;  2DQR A;  3E1S A;  4A3K J;  2E2H J;  1ZAR A;  4HV6 A;  4D9J A;  3PO3 J;  1OKR A;  2DO7 A;  2EFO A;  1P4A A;  3JCU C;  5FRO A;  2HKX A;  3F8N A;  4HNT A;  1SEU A;  1QA6 A;  2WAF A;  1BI1 A;  3BTC A;  4RBO A;  1S7O A;  2HYG D;  4XKV A;  1AKH B;  5EDN A;  1YOV B;  5FJ8 J;  2BEO A;  2F6C A;  4P9F A;  2VXZ A;  1FBS A;  4RGU A;  5F0F A;  3CCS I;  5CPR B;  2LLK A;  4HQM A;  2L02 A;  2ZC2 A;  4F92 B;  1KYZ A;  3AL0 B;  4RM3 A;  3K6G A;  3KIO A;  4EM0 B;  1ETK A;  3DBL B;  3SFI A;  5L3E A;  4G6D A;  4KJZ A;  5FKK A;  3SHF A;  4M73 A;  1BM9 A;  3BTJ A;  3L1P A;  1U9O A;  3V7C A;  5FB2 A;  3JRD A;  4A0Y A;  1X1D A;  5EEG A;  2R5Y A;  2E1C A;  3PQJ A;  3S2D J;  2F4O B;  1PUE E;  3A0H C;  3S2H J;  1OYW A;  3DXJ F;  1J75 A;  1IDY A;  4X0G A;  4JQF A;  2W48 A;  1I50 J;  4XRF A;  4M71 A;  5DEQ A;  1VQP I;  2OCE A;  2K27 A;  1T0F C;  1HW2 A;  3H36 A;  5JI6 A;  3J7A O;  4DQ2 A;  2VC0 A;  3WTW C;  1IW7 F;  4U87 A;  3TBI A;  4BKX A;  1WH5 A;  1GT0 C;  2DA3 A;  3CD6 I;  2O7O A;  3N05 A;  5B3S H;  2EZL A;  5K7F A;  3BR0 A;  4CCL A;  2ELK A;  1VI0 A;  3QYF A;  3HUG B;  4PJN A;  3ZMS A;  3CP8 A;  4PJL A;  5GPA A;  1G3W A;  3S8P A;  1T2K A;  3S1Q J;  2F2E A;  3AG3 H;  3K2Z A;  1SC7 A;  3ZQL A;  2LVS A;  1TQP A;  3ZQ7 A;  3GCM A;  2MSY A;  3REO A;  4QIW N;  4I2O A;  4LGW A;  5JVG F;  4D7N A;  1XGM A;  1EH7 A;  3QRF F;  1USS A;  4AC0 A;  1I27 A;  1KU3 A;  1HA8 A;  3E97 A;  3I54 A;  1P9Q C;  1R4N B;  1LJ9 A;  1YQA A;  3ABU A;  1Z6R A;  3CCQ I;  2BYV E;  5B5E C;  4HX8 A;  3SFZ A;  2XF5 A;  4PUS A;  3CCJ I;  1AA7 A;  1T6S A;  4M6Y A;  2XF6 A;  3CJQ B;  2OD5 A;  2GOM A;  1ZYR F;  2HU9 A;  2MAB A;  3OOP A;  5TGT A;  1B1B A;  2DT5 A;  5E18 F;  3G73 A;  4A3B J;  4HLY A;  1T0F A;  4U88 A;  2DXI A;  2KIM A;  1ZQ3 P;  3OS0 A;  1BA5 A;  2G7U A;  3U1K A;  1N77 A;  1OR7 A;  2V1N A;  4QPO A;  5GP9 A;  4BHC A;  5KVR A;  4PK4 A;  3GME A;  2UXX A;  4A3C J;  3ZCO A;  1MZB A;  2K9N A;  1R22 A;  3I9V 2;  4EMS A;  1P92 A;  1TZL A;  1IN5 A;  2YX7 A;  2GWR A;  4ZYG A;  1MBF A;  2EFP A;  3GFJ A;  5J4Y A;  4ITV A;  1IXS B;  2CQN A;  5IYC J;  1ETV A;  3BPV A;  3KET A;  2HKO A;  2IT0 A;  3F22 A;  3RYP A;  1U0J A;  2PG4 A;  1GV2 A;  2JVH A;  2EA2 A;  4XLA A;  5J47 A;  1GXQ A;  3COA C;  2LF7 A;  3D5L A;  3LSR A;  1Z77 A;  4AVP A;  1ZK8 A;  3CP2 A;  3K4C A;  4M9X A;  3DCF A;  2O3F A;  1MSF C;  1QGP A;  2IS6 A;  3WE3 A;  2L9N A;  1MMD A;  2VBY A;  2CQQ A;  2FML A;  2QQA A;  5FD5 A;  2IW5 A;  2M8E A;  1T08 B;  2W00 A;  1K4S A;  1BJZ A;  1WSU A;  4CCO A;  1I6H J;  1JE8 A;  3I0T A;  1X3Z B;  1K83 J;  4LIV A;  4OOI A;  1ZGW A;  1EKE A;  4XLC A;  3PL8 A;  3WTU C;  4IJA A;  4GCV A;  2EWN A;  3SYT A;  2DDA A;  3LA2 A;  1DP7 P;  3NEU A;  2VOD A;  2UV1 A;  3O2P E;  3VSL A;  4RB0 A;  4LB5 A;  2FNA A;  2L3D A;  4OIQ F;  1YLF A;  2OQR A;  2Y0M A;  3J81 Z;  3M3Y J;  2EH3 A;  5H6Q A;  1X3U A;  4LOC A;  1IUF A;  4ENJ A;  5JR3 A;  3P9I A;  3MAJ A;  2EIN H;  5A2Q K;  4EQQ A;  4MHG A;  2MD5 A;  2RAE A;  2VQC A;  2E35 A;  2QM3 A;  1K6O A;  1U8R A;  4EJU A;  3VDX A;  4I01 A;  4HYE A;  1Z3X A;  2X1D A;  4A3E J;  3E5Q A;  4Y3O A;  1S5L C;  3BDD A;  3T5X A;  2HPM A;  4OIR F;  1QPI A;  1ITY A;  4E7Z A;  2V6C A;  2VJI A;  1MW7 A;  1VQ9 I;  4GO1 A;  3IV5 A;  3G1M A;  2XB5 A;  4BU2 A;  3GZ5 A;  4IHY A;  3OYN A;  4G94 A;  4MTD A;  3OYF A;  2HFH A;  3DU6 A;  3H3Z A;  1U6G A;  1VQ5 I;  2PJR A;  4IL6 C;  1FOY A;  2VB6 A;  1U78 A;  2OTJ I;  2NAZ A;  2JA8 J;  3W2W A;  2DI3 A;  1W5T A;  3F8B A;  3A01 A;  2JUG A;  1UHW A;  2QWW A;  3I4M J;  2A3S A;  4R79 A;  2PJR B;  5F6F A;  2QCO A;  2ZXW H;  1XGS A;  1S29 A;  2XSD C;  3K4K A;  3G1O A;  1Y8Q B;  3KZZ A;  1OLT A;  3A01 B;  2JWT A;  3IKV A;  3J81 K;  3RPQ A;  3R61 A;  1B8I A;  2DAO A;  3G2B A;  4RLF A;  5KK1 A;  2NRA C;  5GAD J;  4U7D A;  2KIQ A;  2R7W A;  4GYG A;  5C44 J;  1J09 A;  4MO7 A;  3ZPL A;  4U7B A;  3FHZ A;  1Z9C A;  1KQ0 A;  2K86 A;  2LDU A;  5ILS A;  5IP9 J;  5LGU A;  4XR6 A;  5DUK A;  1TC3 C;  3HOY J;  1MBE A;  2QZ8 A;  2OV7 A;  3FDY A;  2CJJ A;  2I10 A;  3H9J A;  4LLL A;  2LKP A;  3DBH B;  4LIT A;  5LGN A;  2GAU A;  3GTK J;  2ZBK A;  4UVC A;  1GHC A;  4Y33 A;  3HKZ N;  5AIP A;  2OC6 A;  4EGZ A;  1O3Q A;  3KP4 A;  1I1G A;  4PJ0 C;  4IRH A;  4XLF A;  1O7L A;  1RIO H;  4L5I A;  1Z6T A;  2E5N A;  2J5P A;  1IN4 A;  1HW5 A;  2ZSH B;  2YUS A;  3L2Q A;  4FCY A;  1V54 H;  3TO7 A;  3EUH C;  2YSR A;  4Q5S F;  4NC6 A;  3SXY A;  4XL9 A;  2L5Q A;  1LVA A;  2QSG X;  1O7F A;  2KPM A;  1HBX G;  2VQL A;  3DPU A;  4LG0 A;  1X3W B;  3GTQ J;  2CMP A;  3BR5 A;  3KYC B;  2D2W A;  3OYM A;  3BQY A;  4G6Q A;  4J19 A;  4E7I A;  4L0Z B;  3F8F A;  4IX7 A;  3T8R A;  2EZK A;  1D0Z A;  1ZR4 A;  1R49 A;  4RB3 C;  1PJR A;  3MKL A;  2OU2 A;  1P4W A;  2HQR A;  3DQV C;  4HQE A;  5FLV A;  5FKL A;  5DM6 F;  1ZHF A;  4OMY A;  2K02 A;  2QGU A;  4LG0 B;  1H9G A;  5J4V A;  3H35 A;  1MSE C;  5CKT A;  3TP3 A;  2JMW A;  4X6A J;  3MD2 A;  3EPZ A;  3VYS B;  3ML6 A;  1B4A A;  4ZDL A;  1STZ A;  3HSF A;  2XPU A;  2W84 A;  4GYI A;  5CVU A;  3VEP A;  5ICC A;  2QBY B;  2LD5 A;  1X1B A;  1BIA A;  2ZCW A;  2EFQ A;  3E7L A;  4YEL A;  4XRS A;  2LOO A;  3LFU A;  2VI6 A;  3LQR A;  4I02 A;  5F08 A;  2XRO A;  1PDN C;  2LMD A;  1D8J A;  3U1D A;  3MFK A;  5GAH J;  2Z9O A;  2F5D A;  3WGI A;  1UAA A;  3L09 A;  5FLX K;  5ICG A;  1BI0 A;  5F27 A;  2JRT A;  3HXL A;  3K9T A;  3RYR A;  4EVI A;  2H8W A;  2F5E A;  3JRA A;  2VQH A;  1E3O C;  3H5R A;  4BY1 J;  5ILV A;  2KHM A;  3EYY A;  3H0G J;  4PDK A;  2MC3 A;  1ZGJ A;  1J2X A;  4WX9 A;  4B3A A;  5CJ9 A;  3QOE A;  2DT6 A;  4BGD A;  1VQ4 I;  1ZLK A;  2L2O A;  3K70 D;  3U21 A;  1BC7 C;  3LSH A;  5HVQ C;  4G8X A;  3DEW A;  2XAH A;  4RAF A;  3CJT B;  4I6Z A;  2XRL A;  4ASN A;  5DV5 A;  3C2H A;  5LGT A;  4V19 K;  4S05 A;  3LAP A;  2HZT A;  1RET A;  4EV0 A;  3HTU A;  1YTY A;  1QNT A;  4OIN F;  1F4K A;  1EV7 A;  1J7K A;  5CYV A;  3PM1 A;  2VXD A;  3SEQ A;  4KMF A;  4JK1 X;  4M3F A;  3K70 C;  5C4X J;  1ETX A;  4NHJ A;  3M9A A;  2L9R A;  1LFB A;  2EZI A;  2LBF A;  5K7Z A;  3VOE A;  3CUQ A;  1ONV A;  3S3M A;  1WQ2 A;  2FOW A;  1IJW C;  1FP2 A;  3JTH A;  2XAF A;  2XUB A;  3HC7 A;  1G2H A;  3IRQ A;  3S15 J;  5EG0 A;  2HNH A;  2A6E F;  1VF9 A;  1IV6 A;  1U5T C;  1QZE A;  3H5A A;  4ESF A;  4MEY F;  4C3H J;  3BG7 A;  4XOR A;  3ISP A;  4LK1 F;  4E7S A;  4PJM A;  3A0B C;  1R1T A;  5KAF C;  4M3B A;  1LDD A;  4FIS A;  3P9C A;  3CDL A;  3BTI A;  5EG0 B;  2HWV A;  2WTE A;  2IEK A;  2E71 A;  3LA3 A;  4EJO A;  1P7J A;  3R60 A;  2X1E A;  2CV2 A;  1TWA J;  1X19 A;  3ONQ A;  2DA6 A;  3IH4 A;  4D7M A;  5IOY A;  3DLL F;  2O61 A;  2V1X A;  1A5J A;  4IQJ A;  1G59 A;  1WI3 A;  4HNV A;  1Z0X A;  4ZC3 A;  5J1Y A;  2VKV A;  3SZG A;  6PAX A;  5CVR A;  4JX5 A;  5TIS C;  3PFI A;  4P5O A;  4HF2 A;  1UHS A;  4XLN F;  4YFK F;  2RV8 A;  2WAQ N;  3L2V A;  1Y1W J;  3L9F A;  3PNY A;  5L3C A;  3I53 A;  1R71 A;  3FXL A;  1RKT A;  4MEX F;  1OPC A;  4B43 A;  1RES A;  3JRE A;  2RKH A;  1WJD A;  1PUF A;  5E20 A;  4YFN F;  5HLH A;  1SAU A;  2JVG A;  3IP4 B;  3FIS A;  3ZMD A;  2R4G A;  3MWM A;  2FRH A;  2KKO A;  1H8A C;  3K0L A;  3J80 Z;  3DPL C;  2H8R A;  1KQ8 A;  1ORK A;  1QZY A;  2HTJ A;  5EEA A;  2Y2Z A;  4UUT A;  3CC4 I;  2E5Z A;  3HHH A;  2QF7 A;  5E1W A;  3SQN A;  3ZR8 X;  1XDU A;  4XRM A;  4OIP F;  3FBI B;  5L3F A;  2EV6 A;  1LVK A;  3TDZ C;  3ZQF A;  5FRM A;  2H6B A;  4LG3 A;  1SD4 A;  3L2U A;  3MQ0 A;  1MBJ A;  3FXQ A;  3HOW J;  2VQG A;  4DZJ A;  4LJZ F;  2IS4 A;  1R58 A;  3GZN B;  5TRD A;  2IPQ X;  5DUI A;  4E7J A;  3X2Q H;  3CJR B;  1IRX A;  1BR2 A;  2OTL I;  1AU7 A;  2LYC A;  2A6H F;  1D1A A;  2Y9Y A;  3FMQ A;  1FTZ A;  3WG7 H;  2RQQ A;  3GX4 X;  3WHB A;  3K1N A;  2IGK A;  2OBP A;  4IHW A;  3FF5 A;  1FBU A;  2IA1 A;  4WWC A;  3RKW A;  1AWC A;  1T8I A;  1HLV A;  1JUS A;  3PNT A;  2STW A;  1UG2 A;  4IEJ A;  4Z2Y A;  1ZAO A;  1HDP A;  2DYS H;  2ZFU A;  4RB2 C;  3OSG A;  1DDN A;  3PSI A;  2LP0 A;  1IDZ A;  4A0Z A;  4OAZ A;  4EM2 A;  3K1M A;  3KYD B;  2E1M C;  4S0H B;  2A07 F;  4BQO A;  1GLN A;  2CRG A;  2ZNZ A;  1QO0 D;  3GZ6 A;  2M87 A;  4ZYE A;  2MH9 A;  1GUU A;  5DD4 A;  4XN0 A;  4QPQ A;  3OYA A;  4CHU A;  2E2J J;  4HST A;  4M6X A;  5DTD A;  3CMA I;  4E4H A;  2A6T A;  4Y7N J;  1WJC A;  1TW2 A;  2MH2 A;  3PUF A;  1YHQ I;  1OYI A;  3W6J B;  1LNW A;  3IRR A;  5FKM A;  2ZB9 A;  4BDZ A;  1CGP A;  2K9Q A;  1BJA A;  1JT0 A;  2VOP A;  5EYR A;  5ERI A;  3BJA A;  1UHM A;  4ZTJ A;  1I6X A;  1SFO J;  2QVO A;  3BCA A;  3HZJ A;  5DCF A;  2O8K A;  3KP6 A;  1MD0 A;  3V8K A;  1F36 A;  3HTS B;  4BDY A;  5HOO A;  2Y0S N;  2CS3 A;  3LSM A;  4L5J A;  2ISY A;  2HQ5 A;  4YEJ A;  1TT0 A;  3OIP A;  3S16 J;  1SAX A;  4WK8 F;  1WWX A;  1WGX A;  1DGW Y;  3CF2 A;  2ZXH A;  4Y15 A;  1FSE A;  4RGX A;  2TCT A;  3JRF A;  1XC5 A;  1S8N A;  2GM4 A;  3CTA A;  3VB2 A;  2GXB A;  3BWG A;  1YRN B;  5CVI A;  2DU9 A;  4IQ4 A;  5HS7 A;  4IRI A;  2JA5 J;  2XPW A;  1B72 B;  4UNO A;  2CUJ A;  3KP3 A;  3IL2 A;  4LLG F;  5J8F A;  3K4N A;  3E6D A;  3LOC A;  3CDI A;  3K10 A;  4HBL A;  1W1W E;  2E7X A;  5BS6 A;  5FO5 A;  5DS9 A;  2E1M B;  4FX4 A;  1O3R A;  4YRV A;  3QP5 A;  2HEO A;  3KEO A;  3FM5 A;  1KGS A;  3UNG C;  3ZQQ A;  3M8J A;  1WRJ A;  1APL C;  2CW7 A;  4Y52 J;  1LEA A;  2DA4 A;  2XKO A;  2JSP A;  3E0J B;  4FX0 A;  3R6S A;  1E3P A;  3HRT A;  2KT0 A;  1A35 A;  1YIJ I;  2GA2 A;  1MJB A;  1TQM A;  4HW0 A;  4WCG A;  2CQ7 A;  3ECH A;  3LL7 A;  3C7J A;  4D5C A;  3BR1 A;  3EYI A;  2MW8 A;  4CGZ A;  1OCC H;  5LEJ A;  4U0Y A;  3FK6 A;  3TO9 A;  3ZN1 A;  2IA2 A;  5IP6 A;  1POG A;  4AWX B;  3MZY A;  3I59 A;  2WY8 Q;  2X9D A;  5DCM B;  3B6C A;  4ZZD A;  4A6D A;  2DN0 A;  3HHG A;  2R7V A;  3IH3 A;  3VWB A;  2VT3 A;  1MBG A;  2EBI A;  3VOD A;  1K61 A;  2DFE A;  1SMT A;  2FJ1 A;  3Q0W A;  3Q5F A;  4A6E A;  5C3E J;  2DMT A;  2WB1 N;  1VFC A;  3S1N J;  1ETW A;  3PIP F;  1GDT A;  2R7U A;  2WV0 A;  2VLA A;  1IAW A;  2FU4 A;  5CQE A;  5KHD A;  3RZD J;  2GBY A;  4BAC A;  4MQV A;  3HUG A;  4N9H A;  1R1U A;  4HF0 A;  3I59 B;  1T39 A;  1YG2 A;  4DBQ A;  1BI2 A;  2MFZ A;  2P8T A;  5JHU A;  1F9N A;  2OZ6 A;  2KRF A;  3OY9 A;  1QBJ A;  2O6G E;  1MMN A;  2KLO A;  3G4S I;  2UUZ A;  5F0H A;  3R0J A;  5D8K B;  3OR2 C;  3H3U A;  2E19 A;  3JW4 A;  4DW6 A;  4G7Z F;  4FHT A;  2KZG A;  3KFW X;  2YU3 A;  2IS1 A;  2K85 A;  4IPA A;  1IRF A;  2V79 A;  3GFM A;  4C3J J;  1VQK I;  2MLG A;  1XTA A;  3WTY C;  3RCO A;  3W6K B;  1I3Q J;  5D4S A;  3HGY A;  5D5V B;  3WTZ A;  1KU7 A;  3KZI C;  1HST A;  3CJN A;  1D1B A;  3P9K A;  4FET A;  3LST A;  4JX4 A;  2E1N A;  1ZG3 A;  2X6Y A;  5EZH A;  5LRS A;  5IPA A;  1K4T A;  2VON A;  3RQI A;  3DTK A;  4MTE A;  2RQP A;  2DQL A;  2R93 J;  3L7W A;  3GBG A;  1NHA A;  4A12 A;  4I0A A;  3GUD A;  3L2R A;  1BW5 A;  3BZ6 A;  2H94 A;  2CUF A;  2RVC A;  2X0L A;  3QP6 A;  1TT5 B;  2ECC A;  1VND A;  3V8L A;  4FE4 A;  2PMZ N;  1TLH B;  1K78 A;  1FZP B;  2LKX A;  1Y0U A;  4LD5 A;  1RUO A;  1XSV A;  4ABZ A;  3HRM A;  3QQA A;  2A5W A;  3CLO A;  4A3D J;  5LLQ A;  5HDK A;  3OYL A;  3B6A A;  1JHH A;  2MD0 A;  2CH0 A;  2VPR A;  1LFP A;  4FT8 A;  1FOX A;  4OU0 A;  5JFR A;  1S72 I;  3CES A;  3PSF A;  3OYJ A;  2JN6 A;  2KQR A;  3F21 A;  1LUJ B;  3TW7 A;  1JKP C;  2DOA A;  1FP1 D;  3WGG A;  1YIT I;  5A2Q Z;  1K78 B;  1RPW A;  4W1U A;  2CQX A;  1ETY A;  3LSJ A;  1D8K A;  1DPR A;  4ON0 A;  5HLT A;  1K7A A;  2EIK H;  5FD6 A;  3HL2 A;  3IKT A;  1SVO A;  4CCJ A;  4NUB A;  2EQR A;  3E5U A;  4XRS G;  2JZY A;  3JRB A;  5D6E A;  1DPU A;  1ZKG A;  3A03 A;  4CCM A;  2W24 A;  4C9Y A;  3P5J A;  2TDX A;  3BT9 A;  4CYC A;  3ABM H;  5GTH C;  2R7X A;  1BW6 A;  1LB2 A;  2DLL A;  2XV4 S;  2K3P A;  2VBX A;  1W7P D;  4KIC A;  2JA2 A;  2R7D A;  2PEX A;  3Q9S A;  2NNY A;  1MH4 A;  4HOB A;  1V5E A;  3FBN B;  1HDD C;  2NS7 A;  4YIF A;  5GPC A;  2LH9 A;  2QSH X;  5GAE J;  2H09 A;  4CYC B;  1I3A A;  4BY7 J;  3KPH A;  4RS8 A;  2PFB A;  2VL8 A;  3FXJ A;  1EA3 A;  2VE9 A;  1OJL A;  1DU6 A;  3GTM J;  5K5Q A;  5KNL A;  5IT3 A;  1SD5 A;  1YS6 A;  3DBR B;  2BY1 A;  1K6Y A;  3K4L A;  5H2F C;  3HOZ J;  4ZZL A;  2R7O A;  2Z1D A;  1MNE A;  3B73 A;  2Y31 A;  1A6I A;  3K69 A;  1SFU A;  2FUG 2;  4L9T A;  3BR3 A;  3O3K A;  4O5V A;  1B6A A;  3ZQI A;  2ISZ A;  1XX5 A;  3FKI J;  2ZJP F;  3LSG A;  1LDJ A;  4KN4 X;  4G9Y A;  3QPL A;  4NBQ A;  4CA0 A;  1X4O A;  2V4J C;  1S7E A;  3JSO A;  1TP4 A;  1I39 A;  1R00 A;  3BC8 A;  1R5I D;  1K79 A;  1Z05 A;  2BXZ A;  2M8G X;  2M3A A;  3PNV A;  1VQM I;  1XGO A;  2PI0 A;  1OFC X;  4S04 A;  2CV0 A;  2JA6 J;  4GDF A;  3BR2 A;  2D1H A;  4M9Z A;  2Y9Z A;  1V3F A;  2DA7 A;  2W25 A;  2K7L A;  2F4I A;  4RGR A;  1Z21 A;  3GVA A;  3CO7 C;  2ZJR F;  1SVM A;  4RB1 A;  2NVX J;  4CZC A;  3HDD A;  2GQQ A;  1HQC A;  3VYT B;  1O57 A;  1ZN2 A;  2JJ7 A;  2XF7 A;  5M5X J;  3C2G A;  3H1C A;  2FSW A;  3CCR I;  2EA4 A;  1ETO A;  1GXP A;  2LY9 A;  5IT9 K;  3HM5 A;  4AIK A;  1PP7 U;  2AXT C;  3CQZ J;  3NWT A;  4M3E A;  1W7P A;  1T38 A;  1V55 H;  4L9V A;  2GA1 A;  2NNN A;  2QUF A;  3RQ4 A;  5IYD J;  2UWM A;  1B9N A;  1HSJ A;  4TV7 A;  5KAI C;  4A0X A;  4CSW A;  3RIR A;  1X2M A;  2R7Q A;  4PGG A;  4P9U A;  1XSX A;  1WVR A;  5LHH A;  4BXX J;  2A69 F;  1H88 C;  1OCT C;  1ULY A;  2BOL A;  4ZDO A;  1MNM C;  1W7P B;  2ELH A;  5B1A H;  3MZH A;  4I7H A;  2F5F A;  2P5V A;  4DOZ A;  1PVE A;  3O8H A;  5L3D A;  2ETH A;  1D0Y A;  2LRD A;  2GLO A;  2COM A;  4EM1 A;  1WI9 A;  3VYR B;  3T1B A;  1TNS A;  3H5N A;  5ICE A;  3HOT A;  2WY7 Q;  4B47 A;  3Q9V A;  2AQF A;  2AS5 F;  2FF4 A;  3CCU I;  1FBQ A;  4AYB N;  1RC9 A;  3QWL A;  4FE7 A;  2GOX B;  2OF7 A;  3M8E A;  4LMY A;  3ULQ B;  4XLH A;  2HQA A;  2VN2 A;  3OR1 C;  3ZN0 A;  1FC3 A;  1F43 A;  2LNB A;  4R8H A;  1VQ7 I;  3M8F A;  2LKS A;  3CDH A;  5DD8 A;  2JT1 A;  2QEX I;  4UUV A;  2DMQ A;  5FLX Z;  2M45 A;  1SFK A;  4EAT A;  4NQW A;  2G7H A;  3Q0V A;  9ANT A;  1WCM J;  1YFH A;  2HVQ A;  3OYI A;  1VTN C;  3WGH A;  4PJJ A;  5BNG A;  1FNN A;  3CCE I;  3F6V A;  1E17 A;  1NG6 A;  4U0V A;  3V7R A;  4EJV A;  5F0C A;  1IV8 A;  4I76 A;  2V9K A;  5TJJ A;  5JLW A;  4GFB A;  5BQT A;  3OL4 A;  4DNC A;  2XPV A;  1TWC J;  4NQW B;  4KYW A;  2KRC A;  3MZ8 A;  2IRF G;  1V4R A;  3QAH A;  3RPU D;  1BI3 A;  2QKM B;  2E2I J;  2CO5 A;  1ZEL A;  2VE8 A;  3WOD F;  3S1M J;  1CF7 A;  2IP2 A;  3NRV A;  2OPT A;  4ZYD A;  2MLK A;  3RI4 A;  2KFD A;  1Z3Y A;  1R1V A;  2QBY A;  4BBS J;  3H92 A;  1XCB A;  5B1B H;  2NVQ J;  2M0M A;  3R0A A;  1D5V A;  2DOD A;  2KZV A;  4BXF A;  1W4M A;  4B4C A;  5D6F A;  1ZG1 A;  4HDV A;  1O3T A;  4F7Z A;  4HX4 A;  2ZXI A;  2JSC A;  1WZ2 A;  3S14 J;  3I4N J;  2VT2 A;  3P7N A;  3CUO A;  1CF7 B;  2BHY A;  3DLA A;  1ETQ A;  2NYX A;  2FBI A;  1QRY A;  2FMY A;  4UUS A;  1V5F A;  2DA2 A;  1X1A A;  3E5X A;  3AG1 H;  2AQE A;  1H0M A;  2HYF A;  5HS8 A;  3F8C A;  1J9I A;  2GZW A;  4LIU A;  5FFX A;  3BPX A;  3ZP5 A;  3FZV A;  3ZQH A;  1ENH A;  2KJB A;  4C2U A;  4AM3 A;  3EET A;  4O6J A;  2JUC A;  4UUS B;  1CQT A;  3EUH A;  4HSR A;  2XDV A;  2MGQ A;  4P1W A;  2L7Z A;  2IGN A;  1HKQ A;  2KIS A;  2A68 F;  4JOM A;  1N25 A;  3CLQ A;  4D5F A;  1EJ9 A;  2M9H A;  4RDU A;  2HVS A;  2K9L A;  4RGS A;  3CO6 C;  2ZO4 A;  4Y17 A;  2LK2 A;  3C1D A;  5J3L A;  2OCC H;  3IC7 A;  1XGN A;  2P6S A;  2M0C A;  4L5E A;  1HKT A;  3D5R C;  1RR7 A;  1FYL A;  4E7L A;  1WH7 A;  3M1C A;  4UVB A;  5HLI A;  3S3O A;  5E8G A;  1V5G A;  2NXN B;  2Y48 A;  1Y6I A;  1NK2 P;  4IO9 F;  1JJ6 C;  2OUM A;  3VPR A;  5JVT A;  1ZRC A;  3DKY A;  2WAQ A;  2VBZ A;  1SAN A;  4XSZ F;  1FY7 A;  4XON A;  3LNQ A;  3MKW B;  2QA4 I;  3W2V A;  5E3L A;  1XS9 A;  1QZZ A;  1ZLJ A;  4RMN A;  2HDD A;  2OAZ A;  2IXS A;  2B0L A;  2Y30 A;  4BE1 A;  2VKE A;  2E7W A;  3D5S C;  3JAM Z;  3DV8 A;  1SFX A;  4AIJ A;  1FYK A;  3G6E I;  2L9S A;  4N4N B;  2ME6 A;  3F6O A;  3QPS A;  5M3F J;  3CCY A;  1SMY F;  5BPI A;  3RDI A;  1ZTR A;  2CUZ A;  4F3Q A;  1U8B A;  2ECB A;  2WAD A;  1DU0 A;  4II3 A;  4N9I A;  1G8X A;  1YS7 A;  1FIA A;  2DDB A;  2DMN A;  1U3E M;  3EQL F;  4EJW A;  3GTJ J;  1REP C;  3DFG A;  2K9S A;  4B48 A;  5E17 F;  1LE8 A;  3QOD A;  5BOX A;  2LRE A;  3ZGK A;  1I5Z A;  2PN6 A;  4UXN A;  1DQU A;  3T0Y A;  3TDU C;  4XID A;  1YI2 I;  2HPI A;  2CSO A;  3GWZ A;  4WF2 A;  4DYQ A;  3QPT A;  5EZG A;  2VJ4 A;  1BC8 C;  1B9M A;  3RKY A;  1IN6 A;  2FNP A;  2AO9 A;  3M4O J;  1H9T A;  1UEL B;  1IRZ A;  4ENK A;  2VJJ A;  2C6Y A;  3ERM A;  1DUX C;  2H1K A;  2X6O A;  4BJT A;  1LE8 B;  2AHQ A;  5LHG A;  3HOX J;  2FD5 A;  1NTC A;  5M5W J;  1IXR C;  3KZY A;  3QU3 A;  1SFE A;  2L01 A;  3S3N A;  3LWF A;  3I71 A;  4M74 A;  2WV1 A;  5LEK A;  2P7C B;  2MYS A;  5LRR A;  3JRG A;  5KCM A;  1U5T A;  4PCQ A;  4E70 A;  3PIO F;  3PUB A;  4B8X A;  3MMY B;  4DZP A;  2UXN A;  2WAE A;  1WHU A;  2DPD A;  5EEH A;  3C18 A;  1YJ9 I;  3NAU A;  2OQG A;  3JAM K;  3S2W A;  1UZC A;  3OYC A;  4Q4Z F;  2KDZ A;  2EFW A;  4HRI A;  1W0T A;  4XK4 A;  2R92 J;  2W82 A;  2V1U A;  4BL0 B;  3SDB A;  1ZR2 A;  4CCN A;  1BN5 A;  1U5T B;  3LSI A;  2ZKZ A;  3DEU A;  2NS8 A;  3TP0 A;  3H3V K;  3I4P A;  3ZOB A;  3W3C A;  3GFI A;  2HS5 A;  3SDG A;  2M7A A;  2ZJQ F;  4HEA 2;  2R7F A;  4CCK A;  1QHH D;  1S9H A;  2PQ8 A;  4FQG A;  4UB6 C;  1BBY A;  3DF8 A;  4XBF A;  4DBR A;  4MNU A;  4I99 C;  1TQI A;  5F1J A;  3OS2 A;  1FWZ A;  2XB0 X;  4QLC U;  4RAZ A;  1MND A;  2WA0 A;  3BOQ A;  2OZU A;  2X6X A;  2FBH A;  4AVZ A;  1ZRD A;  2FBK A;  1IXC A;  4NC7 A;  3C2B A;  5DDG A;  5EF6 A;  1MBH A;  1YE9 A;  3KLO A;  3F23 A;  4KIT B;  1YJN I;  1OYY A;  2L7K A;  4NC8 A;  4IHS A;  3CCM I;  3PO2 J;  1YX3 A;  3ZMU A;  4WXH A;  4BNC A;  2VUM J;  2XAU A;  1XMK A;  1MMG A;  1JTY A;  4OAY A;  5IOZ A;  3HOV J;  2IGM A;  1X58 A;  1TW3 A;  1NG7 A;  4LLN A;  2XGD A;  3RJP A;  1OIS A;  5D5W B;  1RZ4 A;  2R7T A;  4CXF A;  3FIW A;  1AOY A;  5FLM J;  1FJL A;  2ID6 A;  3TO6 A;  3H0D A;  4IKF A;  4NNJ A;  2L7M P;  4XSX F;  4BBR J;  1HC8 A;  4WXD A;  2DK8 A;  2X51 A;  2EK5 A;  5E8I A;  1UMQ A;  4Z6Y A;  5ED4 A;  1JKO C;  4ENM A;  2LFB A;  3QYB A;  3I56 I;  5E3N A;  1DP3 A;  2M4K A;  3RKX A;  4HV5 A;  4I0B A;  3OOU A;  2L7F P;  4B3X A;  4MLO A;  4XM3 A;  2EFN A;  4A5M A;  1G4D A;  3CF5 F;  3FMS A;  4LB6 B;  1IZ1 A;  2A5Y B;  2H1L A;  1EF4 A;  2N8G A;  2EIM H;  1D5Y A;  1U9N A;  4XNF A;  4UV9 A;  1E2X A;  2V26 A;  3FK7 A;  2ZXJ A;  2ICW G;  2IS2 A;  1A04 A;  3QYE A;  1YRN A;  3IWZ A;  1IN7 A;  3HG9 A;  2ME0 A;  3PJR A;  4GRI A;  4E6K G;  1B72 A;  1MDM A;  1FIP A;  3S1R J;  2HDC A;  1S3J A;  5LD2 C;  4Q47 A;  1N75 A;  2HXI A;  4ESJ A;  1MMS A;  3LSK A;  2DW4 A;  3S32 A;  4D1Q A;  5JLX A;  4QWQ A;  5J40 A;  3SEZ A;  3WU0 A;  4KA4 A;  3K4B A;  4ENN A;  2MC4 A;  3ECO A;  3HIF A;  4WXC A;  4FAS D;  4H0E A;  2EV0 A;  4KIG A;  1MDM B;  1FMV A;  3AFH A;  4BE2 A;  3FXK A;  3NQO A;  2W7N A;  4FTH A;  1Z7L A;  2OA4 A;  3ZXS A;  4IOC F;  1FT9 A;  5C4J J; 
#chains in the Genus database with same CATH homology
 1L0O C;  1LEB A;  1S6L A;  2HTS A;  1XB4 A;  3HSR A;  5DCM A;  5FGM A;  2BBY A;  3FWE A;  3BJ6 A;  5K5R A;  3QPH A;  2X4H A;  2YX4 A;  1TBX A;  2Z3Y A;  3QOP A;  3V8J A;  2ADU A;  4I98 B;  3C3W A;  2CW0 F;  1KQ9 A;  3GEZ A;  1BIB A;  1R7J A;  4HF1 A;  4EJT A;  4YG2 F;  2ZFW A;  2PLY A;  2EJR A;  2AXL A;  4D0P A;  2RDP A;  5E1X A;  3DKW A;  4UV8 A;  2IA0 A;  3DPT A;  3GFL A;  2HQN A;  2HGC A;  2RGV A;  5L3B A;  1LDK B;  1SD7 A;  5LHI A;  1B59 A;  1P2F A;  3BJO A;  1PP8 F;  2BGC A;  5LBQ A;  2STT A;  2PMH A;  2XAG A;  4KN7 X;  3U9G A;  2KJC A;  3T8T A;  3KP7 A;  5CVJ A;  1OMI A;  3FMR A;  3FXR A;  1G3S A;  1Z1D A;  4G7H F;  4HDU A;  3MEX A;  4HAM A;  1R23 A;  1J59 A;  1W5S A;  2Z33 A;  2O03 A;  3PQK A;  2V1D A;  1YIO A;  4IVN A;  4KNY A;  1IN8 A;  4CIC A;  5DYM A;  5BMZ A;  2H27 A;  3GO5 A;  2QQB A;  4I09 A;  2QQ9 A;  2P6T A;  3GW2 A;  3JTG A;  4EGY A;  1BOA A;  3F8M A;  4MGR A;  1EH8 A;  2O0Y A;  3L00 A;  4A2U A;  5J8C A;  4GGG A;  4KIF A;  1QQI A;  5D8L B;  2Q2E A;  2GIV A;  1T98 A;  3F3X A;  3GXO A;  1Z91 A;  4BQA A;  1I1S A;  2P4W A;  1XSD A;  2WC2 A;  1MJ9 A;  5IT9 Z;  4CDG A;  4UVA A;  5CVV A;  2CYY A;  1P4X A;  4IF4 A;  2J5O A;  4L9J A;  2VOO A;  1GVJ A;  2CQK A;  3LA7 A;  4KMU X;  2F5C A;  3ERE D;  3BRO A;  4KUM A;  1XDS A;  2FE3 A;  1ZGA A;  3HRS A;  4BH9 A;  1J5Y A;  2W85 A;  1C0W A;  5H6R A;  4LK0 F;  2H6C A;  1EH6 A;  5AIQ A;  3TGN A;  2FQ3 A;  1FLI A;  2P7V B;  1YW9 A;  4BAY A;  2L4A A;  2ESH A;  3TKY A;  4L0Y B;  4HX7 A;  2DPU A;  5E1Z B;  2DTR A;  1UCR A;  3TQN A;  1G6N A;  3ZMV A;  2VC1 A;  4UHT A;  1FOK A;  4Q48 A;  3ROU A;  2YR2 A;  2XRN A;  5J6X A;  1XMA A;  4M9S A;  3KEQ A;  2XIG A;  3HRU A;  3D0S A;  4GXO A;  5K5O A;  1ZRF A;  2CFX A;  3KLN A;  2BE5 F;  2BV6 A;  3SZT A;  4AIH A;  1FX7 A;  5HDG A;  5FFZ A;  2DFI A;  2HR3 A;  3HYI A;  1JXS A;  4IXA A;  2XKP A;  2FXA A;  4A5N A;  2MBF A;  4U0W A;  5K1Y A;  2JTV A;  3K1P A;  3TOB A;  3I5U A;  3I58 A;  4YFX F;  4P55 A;  3ELK A;  2EV5 A;  3ABT A;  5L3G A;  3SZP A;  3DP7 A;  3F72 A;  2LSO A;  4CO8 A;  2RN7 A;  1JHF A;  3WTS C;  4KIB A;  3E6B A;  1YYV A;  1IUY A;  3R4K A;  5D4R A;  1FYM A;  2QYO A;  2M30 A;  4BHP A;  2CGP A;  3ZMZ A;  2ZNY A;  2LF8 A;  3WTV C;  3KE2 A;  1UST A;  3G3Z A;  2W57 A;  3VFZ A;  3WE2 A;  4YII A;  1R5H A;  4ESB A;  3CUQ C;  2ZJ2 A;  1UFM A;  3KCC A;  4HLX A;  1WKM A;  4CZZ A;  1KU2 A;  2L4M A;  2VBW A;  3LAJ A;  3IWF A;  2Z5U A;  2O8X A;  3FX3 A;  1XN7 A;  2K4J A;  2Y75 A;  3AAF A;  3E3V A;  2P5K A;  2XAJ A;  4B09 A;  1KYW A;  2FA5 A;  5F64 A;  2XHK A;  1RNL A;  2XAS A;  3RPU A;  5CLS A;  5HLG A;  2EB7 A;  3IHU A;  5D5X B;  4NB5 A;  4HZF A;  3U2R A;  1FPQ A;  5HDN A;  2PBI A;  3V4G A;  2KIF A;  2RNJ A;  3M1E A;  2D1V A;  2NS0 A;  4HA8 A;  4JBA A;  4K2E A;  2Z99 A;  1O3S A;  5AON A;  4G7O F;  1KA8 A;  3GLX A;  5ICF A;  2PMU A;  1D3Y A;  1R36 A;  4ZH4 F;  1MJA A;  1JGS A;  1HW1 A;  4PGH A;  1ZH5 A;  1YW7 A;  3L2C A;  1ZRE A;  1ZG5 A;  1J0R A;  3M7G A;  1UB9 A;  3CUQ B;  1LQ1 A;  1IF1 A;  1G3Y A;  5BPD A;  4OIO F;  4BHB A;  3FM3 A;  2D45 A;  1RUN A;  1YO5 C;  4OMZ A;  3HOS A;  4KT5 C;  1P6R A;  2M5W A;  2QLZ A;  1F1Z A;  3BP8 A;  4Y13 A;  2CG4 A;  3ZMT A;  4L9N A;  4M72 A;  2ZME A;  5ILU A;  3JSP A;  4KFC A;  5HS9 A;  1TTY A;  3E6C C;  2UZK A;  3QU6 A;  1SD6 A;  2HOE A;  1S7A A;  1L3L A;  1XD7 A;  2ZME B;  3N4M A;  1HKS A;  2M1B A;  3TOA A;  4PZJ A;  1IRG A;  1KU9 A;  4N0B A;  3WTX C;  4CYD A;  1FSH A;  3HSE A;  3KP5 A;  3EDP A;  2R3S A;  2IVM A;  2JPB A;  4RAY A;  4BYY A;  1G3T A;  2QEN A;  1YW8 A;  3OV8 A;  2MA3 A;  2ACJ A;  3GF2 A;  2PJP A;  2DBB A;  2XAQ A;  2CWE A;  2YPR A;  1Q1H A;  5D5U B;  2L54 A;  2G9W A;  4IRG A;  4MQ9 F;  4XLP F;  1XCV A;  3O6B B;  2RC4 A;  4BXU A;  4IHT A;  4R1H A;  2DK5 A;  1MGT A;  2GXG A;  3LFK A;  1MKM A;  3E6M A;  1U2W A;  3KP2 A;  3LQQ A;  4P96 A;  2Q0O A;  1R5G A;  2WWY A;  3RTR A;  2A61 A;  2P5L C;  4KDP A;  2XGX A;  2FOK A;  2K4B A;  4ZYH A;  3J80 K;  3WU1 B;  1HXD A;  3V7S A;  3GYH X;  1QPM A;  4LFU A;  4O3M A;  3WTT C;  3BY6 A;  3N97 A;  1Z7U A;  1ODD A;  1ON1 A;  2FEZ A;  2Q8K A;  2KIU A;  3WG9 A;  2XVC A;  4AD9 A;  5F1R A;  1RI7 A;  5H20 A;  2ESN A;  2V9V A;  2IJL A;  3B02 A;  4L18 B;  2JPC A;  3MCZ A;  1F5T A;  4ETS A;  1TNT A;  3FXU A;  3I64 A;  1ON2 A;  2DQR A;  1ZAR A;  4HV6 A;  1OKR A;  2DO7 A;  2EFO A;  1P4A A;  2HKX A;  3F8N A;  1BI1 A;  1S7O A;  2HYG D;  2BEO A;  4P9F A;  2VXZ A;  1FBS A;  4RGU A;  4HQM A;  2L02 A;  1KYZ A;  4EM0 B;  5L3E A;  4G6D A;  3SHF A;  4M73 A;  1BM9 A;  5FB2 A;  3V7C A;  4A0Y A;  5EEG A;  2E1C A;  3PQJ A;  1PUE E;  1OYW A;  3DXJ F;  1J75 A;  4JQF A;  4XRF A;  4M71 A;  5DEQ A;  2K27 A;  1HW2 A;  5JI6 A;  3J7A O;  4DQ2 A;  2VC0 A;  3WTW C;  1IW7 F;  3ZMS A;  1G3W A;  1T2K A;  2F2E A;  3K2Z A;  1TQP A;  3ZQ7 A;  3REO A;  4I2O A;  4LGW A;  1XGM A;  1EH7 A;  3QRF F;  1USS A;  1I27 A;  1KU3 A;  3E97 A;  3I54 A;  3ABU A;  1LJ9 A;  1YQA A;  1Z6R A;  2BYV E;  4HX8 A;  3SFZ A;  1T6S A;  4M6Y A;  2OD5 A;  1ZYR F;  3OOP A;  1B1B A;  2DT5 A;  5E18 F;  3G73 A;  4HLY A;  1T0F A;  4U88 A;  2KIM A;  2G7U A;  1OR7 A;  4BHC A;  5KVR A;  2UXX A;  1MZB A;  1R22 A;  4EMS A;  1P92 A;  1IN5 A;  2YX7 A;  2GWR A;  4ZYG A;  2EFP A;  3GFJ A;  1IXS B;  3KET A;  3BPV A;  2HKO A;  2IT0 A;  3F22 A;  3RYP A;  2PG4 A;  2EA2 A;  1GXQ A;  3COA C;  2LF7 A;  3D5L A;  4AVP A;  4M9X A;  2O3F A;  1QGP A;  3WE3 A;  2VBY A;  2FML A;  2QQA A;  5FD5 A;  2IW5 A;  2M8E A;  1WSU A;  1JE8 A;  3I0T A;  4OOI A;  3WTU C;  4IJA A;  4GCV A;  2EWN A;  3LA2 A;  1DP7 P;  3NEU A;  2VOD A;  3O2P E;  4RB0 A;  4LB5 A;  2FNA A;  2L3D A;  4OIQ F;  1YLF A;  2OQR A;  2Y0M A;  3J81 Z;  5H6Q A;  1X3U A;  4ENJ A;  5JR3 A;  3P9I A;  3MAJ A;  5A2Q K;  4EQQ A;  4MHG A;  2MD5 A;  2QM3 A;  1K6O A;  1U8R A;  4EJU A;  4I01 A;  4HYE A;  3E5Q A;  3BDD A;  3T5X A;  4OIR F;  2V6C A;  4GO1 A;  3GZ5 A;  4G94 A;  4MTD A;  2HFH A;  3H3Z A;  1U6G A;  1U78 A;  2NAZ A;  2DI3 A;  1W5T A;  3F8B A;  1UHW A;  2QWW A;  2A3S A;  4R79 A;  5F6F A;  1XGS A;  1S29 A;  3KZZ A;  3IKV A;  3J81 K;  3RPQ A;  3R61 A;  2DAO A;  5KK1 A;  2NRA C;  4U7D A;  4GYG A;  3ZPL A;  4U7B A;  3FHZ A;  1Z9C A;  1KQ0 A;  2K86 A;  2LDU A;  5ILS A;  5LGU A;  5DUK A;  2QZ8 A;  4LLL A;  2LKP A;  5LGN A;  2GAU A;  2ZBK A;  4UVC A;  1GHC A;  5AIP A;  4EGZ A;  1O3Q A;  3KP4 A;  1I1G A;  4IRH A;  1O7L A;  1RIO H;  4L5I A;  1Z6T A;  2J5P A;  1IN4 A;  1HW5 A;  3TO7 A;  2YSR A;  4Q5S F;  3SXY A;  1LVA A;  1O7F A;  1HBX G;  4LG0 A;  2D2W A;  4G6Q A;  4L0Z B;  3F8F A;  3T8R A;  4RB3 C;  2OU2 A;  1P4W A;  2HQR A;  3DQV C;  4HQE A;  1ZHF A;  4OMY A;  2K02 A;  4LG0 B;  1H9G A;  3ML6 A;  1B4A A;  1STZ A;  3HSF A;  2W84 A;  4GYI A;  5CVU A;  3VEP A;  5ICC A;  2QBY B;  1BIA A;  2ZCW A;  2EFQ A;  2XRO A;  3LQR A;  4I02 A;  1PDN C;  1D8J A;  3U1D A;  3MFK A;  2Z9O A;  2F5D A;  3WGI A;  5FLX K;  3L09 A;  5ICG A;  1BI0 A;  2JRT A;  3K9T A;  3RYR A;  4EVI A;  2F5E A;  5ILV A;  3EYY A;  4PDK A;  2MC3 A;  1ZGJ A;  1J2X A;  4WX9 A;  5CJ9 A;  1ZLK A;  1BC7 C;  5HVQ C;  4G8X A;  2XAH A;  4ASN A;  5DV5 A;  5LGT A;  4S05 A;  3LAP A;  2HZT A;  4EV0 A;  3HTU A;  1YTY A;  1QNT A;  4OIN F;  1F4K A;  1EV7 A;  1J7K A;  5CYV A;  4KMF A;  4JK1 X;  4NHJ A;  3M9A A;  3VOE A;  3CUQ A;  1ONV A;  1WQ2 A;  1FP2 A;  3JTH A;  2XAF A;  2XUB A;  3IRQ A;  2A6E F;  1U5T C;  4ESF A;  4MEY F;  3ISP A;  4LK1 F;  1R1T A;  1LDD A;  3P9C A;  2HWV A;  2WTE A;  3LA3 A;  4EJO A;  3R60 A;  2O61 A;  2V1X A;  6PAX A;  5CVR A;  3PFI A;  4P5O A;  4HF2 A;  4XLN F;  4YFK F;  2RV8 A;  3L9F A;  5L3C A;  3I53 A;  4MEX F;  1OPC A;  2RKH A;  5E20 A;  4YFN F;  5HLH A;  3ZMD A;  3MWM A;  2FRH A;  2KKO A;  3K0L A;  3J80 Z;  3DPL C;  1KQ8 A;  1QZY A;  2HTJ A;  3HHH A;  5E1W A;  3SQN A;  1XDU A;  4OIP F;  5L3F A;  2EV6 A;  3TDZ C;  2H6B A;  1SD4 A;  3MQ0 A;  3FXQ A;  4LJZ F;  1R58 A;  5TRD A;  2IPQ X;  5DUI A;  2A6H F;  3FMQ A;  3GX4 X;  3K1N A;  2OBP A;  3FF5 A;  1FBU A;  2IA1 A;  4WWC A;  3RKW A;  1AWC A;  2STW A;  4Z2Y A;  1ZAO A;  4RB2 C;  1DDN A;  4A0Z A;  4EM2 A;  3K1M A;  2A07 F;  2ZNZ A;  1QO0 D;  3GZ6 A;  2M87 A;  4ZYE A;  2MH9 A;  5DD4 A;  4CHU A;  4M6X A;  1TW2 A;  2MH2 A;  1OYI A;  3W6J B;  1LNW A;  3IRR A;  1CGP A;  1BJA A;  2VOP A;  5ERI A;  3BJA A;  1UHM A;  1I6X A;  2QVO A;  5DCF A;  3KP6 A;  1MD0 A;  3V8K A;  3HTS B;  5HOO A;  4L5J A;  2ISY A;  1SAX A;  4WK8 F;  1WWX A;  4Y15 A;  1FSE A;  4RGX A;  1S8N A;  3CTA A;  3VB2 A;  2GXB A;  3BWG A;  5CVI A;  2DU9 A;  5HS7 A;  4IRI A;  4UNO A;  3KP3 A;  3IL2 A;  4LLG F;  5J8F A;  3E6D A;  4HBL A;  2E7X A;  5BS6 A;  5FO5 A;  4FX4 A;  1O3R A;  3QP5 A;  2HEO A;  3KEO A;  3FM5 A;  1KGS A;  1WRJ A;  1LEA A;  2XKO A;  4FX0 A;  3R6S A;  3HRT A;  2GA2 A;  1MJB A;  1TQM A;  4HW0 A;  4WCG A;  3ECH A;  3C7J A;  3EYI A;  4CGZ A;  5LEJ A;  4U0Y A;  3TO9 A;  3ZN1 A;  2IA2 A;  4AWX B;  3MZY A;  3I59 A;  5DCM B;  4ZZD A;  4A6D A;  3HHG A;  2VT3 A;  3VOD A;  1SMT A;  3Q5F A;  4A6E A;  2WV0 A;  1IAW A;  2FU4 A;  4MQV A;  3HUG A;  4N9H A;  1R1U A;  4HF0 A;  3I59 B;  1T39 A;  1YG2 A;  1BI2 A;  2P8T A;  5JHU A;  1F9N A;  2OZ6 A;  2KRF A;  1QBJ A;  2O6G E;  3R0J A;  5D8K B;  3H3U A;  3JW4 A;  4G7Z F;  4FHT A;  3KFW X;  2YU3 A;  4IPA A;  1IRF A;  2V79 A;  3GFM A;  2MLG A;  3WTY C;  3W6K B;  5D4S A;  5D5V B;  3WTZ A;  1KU7 A;  1HST A;  3CJN A;  3P9K A;  3LST A;  2E1N A;  1ZG3 A;  5LRS A;  2VON A;  4MTE A;  2RQP A;  2DQL A;  3L7W A;  1NHA A;  4A12 A;  4I0A A;  3GUD A;  3BZ6 A;  2H94 A;  2RVC A;  2X0L A;  3QP6 A;  3V8L A;  1FZP B;  1TLH B;  1K78 A;  1Y0U A;  4LD5 A;  1RUO A;  1XSV A;  3HRM A;  3CLO A;  5LLQ A;  5HDK A;  1JHH A;  4FT8 A;  4OU0 A;  5JFR A;  3F21 A;  1FP1 D;  3WGG A;  5A2Q Z;  1K78 B;  1D8K A;  1DPR A;  4ON0 A;  1K7A A;  5FD6 A;  3IKT A;  3E5U A;  2JZY A;  5D6E A;  1DPU A;  2W24 A;  2TDX A;  1LB2 A;  2DLL A;  2XV4 S;  2VBX A;  1W7P D;  4KIC A;  2R7D A;  2PEX A;  3Q9S A;  2NNY A;  4HOB A;  4YIF A;  2H09 A;  4RS8 A;  2PFB A;  2VE9 A;  5K5Q A;  5IT3 A;  1SD5 A;  1YS6 A;  4ZZL A;  3B73 A;  3K69 A;  1SFU A;  4L9T A;  4O5V A;  3O3K A;  1B6A A;  2ISZ A;  1LDJ A;  4KN4 X;  4G9Y A;  3JSO A;  1R00 A;  1K79 A;  1Z05 A;  1XGO A;  2PI0 A;  4S04 A;  2D1H A;  4M9Z A;  1V3F A;  2W25 A;  2K7L A;  4RGR A;  3GVA A;  3CO7 C;  4RB1 A;  2GQQ A;  1HQC A;  1O57 A;  1ZN2 A;  2FSW A;  2EA4 A;  1GXP A;  5IT9 K;  4AIK A;  1PP7 U;  1W7P A;  1T38 A;  4L9V A;  2GA1 A;  2NNN A;  2QUF A;  2UWM A;  1B9N A;  1HSJ A;  4TV7 A;  4A0X A;  3RIR A;  4PGG A;  4P9U A;  1XSX A;  5LHH A;  2A69 F;  1ULY A;  1W7P B;  2ELH A;  3MZH A;  4I7H A;  2F5F A;  2P5V A;  5L3D A;  2ETH A;  2COM A;  4EM1 A;  1WI9 A;  3T1B A;  1TNS A;  5ICE A;  3HOT A;  3Q9V A;  2AS5 F;  2FF4 A;  1FBQ A;  3M8E A;  4LMY A;  3ULQ B;  2VN2 A;  3ZN0 A;  1FC3 A;  2LNB A;  4R8H A;  3M8F A;  3CDH A;  5DD8 A;  2JT1 A;  4UUV A;  5FLX Z;  2M45 A;  4NQW A;  2G7H A;  1YFH A;  1VTN C;  3WGH A;  1FNN A;  3F6V A;  1E17 A;  3V7R A;  4U0V A;  4EJV A;  5TJJ A;  5BQT A;  4DNC A;  4KYW A;  2IRF G;  1V4R A;  3QAH A;  1BI3 A;  2CO5 A;  2VE8 A;  3WOD F;  1CF7 A;  2IP2 A;  3NRV A;  4ZYD A;  2MLK A;  3RI4 A;  1R1V A;  2QBY A;  3H92 A;  1XCB A;  3R0A A;  1D5V A;  1W4M A;  1ZG1 A;  5D6F A;  4HDV A;  1O3T A;  4F7Z A;  4HX4 A;  2JSC A;  2VT2 A;  3P7N A;  3CUO A;  1CF7 B;  2NYX A;  2FBI A;  2FMY A;  3E5X A;  1H0M A;  2HYF A;  5HS8 A;  3F8C A;  1J9I A;  2GZW A;  5FFX A;  3BPX A;  3ZP5 A;  3FZV A;  2KJB A;  3EET A;  4O6J A;  3EUH A;  1HKQ A;  2A68 F;  4RGS A;  3CO6 C;  2ZO4 A;  4Y17 A;  3C1D A;  3IC7 A;  1XGN A;  2P6S A;  1HKT A;  1FYL A;  4UVB A;  5HLI A;  5E8G A;  2Y48 A;  5JVT A;  1ZRC A;  2VBZ A;  4XSZ F;  1FY7 A;  1QZZ A;  1ZLJ A;  2OAZ A;  2B0L A;  2E7W A;  3JAM Z;  3DV8 A;  1SFX A;  4AIJ A;  1FYK A;  3F6O A;  1SMY F;  5BPI A;  3RDI A;  4N9I A;  1YS7 A;  1U3E M;  3EQL F;  4EJW A;  1REP C;  3DFG A;  5E17 F;  5BOX A;  1I5Z A;  2PN6 A;  4UXN A;  3T0Y A;  3TDU C;  2CSO A;  3GWZ A;  4WF2 A;  3QPT A;  1BC8 C;  1B9M A;  3RKY A;  1IN6 A;  2FNP A;  1H9T A;  4ENK A;  2C6Y A;  1DUX C;  5LHG A;  1IXR C;  3KZY A;  3QU3 A;  1SFE A;  2L01 A;  3LWF A;  3I71 A;  4M74 A;  5LEK A;  2P7C B;  5LRR A;  1U5T A;  4PCQ A;  4E70 A;  4B8X A;  2UXN A;  2DPD A;  5EEH A;  3C18 A;  3JAM K;  2OQG A;  3S2W A;  4Q4Z F;  2EFW A;  2V1U A;  1BN5 A;  1U5T B;  2ZKZ A;  3DEU A;  3I4P A;  3GFI A;  2HS5 A;  2R7F A;  2PQ8 A;  1BBY A;  3DF8 A;  4XBF A;  4MNU A;  1TQI A;  1FWZ A;  4QLC U;  4RAZ A;  3BOQ A;  2OZU A;  2FBH A;  1ZRD A;  2FBK A;  1IXC A;  5DDG A;  3KLO A;  3F23 A;  1OYY A;  4IHS A;  3ZMU A;  4BNC A;  4WXH A;  1XMK A;  1TW3 A;  4LLN A;  3RJP A;  5D5W B;  1RZ4 A;  4CXF A;  1AOY A;  3TO6 A;  4XSX F;  4WXD A;  5ED4 A;  2DK8 A;  2EK5 A;  5E8I A;  4ENM A;  3RKX A;  4HV5 A;  4I0B A;  2EFN A;  4A5M A;  1G4D A;  3FMS A;  4LB6 B;  1IZ1 A;  2A5Y B;  4UV9 A;  1E2X A;  2ZXJ A;  1A04 A;  3IWZ A;  1IN7 A;  1MDM A;  2HDC A;  1S3J A;  4Q47 A;  4ESJ A;  2DW4 A;  4QWQ A;  3WU0 A;  4KA4 A;  4ENN A;  3ECO A;  4WXC A;  3HIF A;  4H0E A;  2EV0 A;  4KIG A;  1MDM B;  3NQO A;  2OA4 A;  1FT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...