3WTYC

Crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSPPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 41
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtyC00
1MJBA 3LAJA 2CFXA 1T98A 1D3YA 4HDVA 1FC3A 3FMRA 4KMUX 3I59B 4ENNA 5ERIA 3F8FA 4KYWA 1ZREA 1SFEA 3FM3A 1DPRA 2XKOA 2YX7A 2P5VA 3GWZA 4P96A 2R7FA 1TW3A 5CYVA 1R1VA 2H09A 4PGGA 1ZARA 4R1HA 5LEJA 3H3UA 2FOKA 5J8CA 2V1XA 1FZPB 4IRHA 1XCBA 3HHGA 4G94A 4OIRF 3V8KA 1BM9A 2KJCA 2IJLA 4HA8A 4LMYA 2ESHA 2DK5A 4BHBA 5ED4A 2JTVA 1B1BA 3TKYA 4B09A 2K27A 1I6XA 1FBSA 2EWNA 4UV8A 2F5EA 2GIVA 4EGZA 3LWFA 2DT5A 4MQVA 2O03A 4HQMA 4CGZA 1OR7A 1GXPA 2QVOA 4DQ2A 2QBYA 2UXXA 1U2WA 2HWVA 2MH2A 1GVJA 2Y75A 4U88A 2WC2A 3IWFA 1BBYA 1F1ZA 2D1HA 3JAMK 4RAYA 1SFXA 2RV8A 2K86A 1FLIA 3FMQA 3DV8A 1FX7A 4LB5A 4CDGA 2K4BA 2A5YB 5FB2A 1XSDA 5DUKA 2RDPA 4A0YA 3DEUA 4GYIA 3ECOA 4IRIA 3ZMDA 3QPTA 3V4GA 3GFIA 4WXHA 5KVRA 4G7OF 5FLXK 1WRJA 1BJAA 5D5XB 2DAOA 2QYOA 3HSFA 4N0BA 2PI0A 2ZCWA 4H0EA 4OMZA 3DKWA 4RGXA 1MKMA 2ELHA 3HUGA 4M6YA 3ML6A 1ODDA 3I0TA 2LSOA 1MDMA 1U8RA 4DNCA 3IC7A 4Q47A 2A69F 2LF7A 2GA2A 1RNLA 5CJ9A 1YG2A 3GFJA 1ON2A 5HDKA 1XN7A 3R0JA 3C3WA 4AVPA 4L9JA 5DCFA 3J81Z 2R7DA 2QQBA 3F21A 1MGTA 4Q48A 2GQQA 4HAMA 2DPUA 1CF7A 5DYMA 2IA2A 3PFIA 3R61A 2F5CA 2KIUA 3BZ6A 3GUDA 3LA7A 1UCRA 1XGOA 2Q0OA 3FF5A 1TNTA 4Y17A 3GZ5A 2A6HF 4RB3C 4JQFA 1R23A 1W7PD 3CUQC 4LLGF 4EJOA 1BI3A 1TLHB 4QLCU 4BH9A 3ZMUA 4IRGA 5A2QZ 3P9CA 4LK1F 3KEQA 2PMHA 2ZKZA 2OU2A 3NQOA 4ASNA 4ESFA 2Y0MA 5DUIA 2OZUA 3GF2A 1HKQA 1SD5A 3LFKA 2W84A 4D0PA 2H27A 3K69A 3ULQB 5FLXZ 4YG2F 1S7OA 2HR3A 2NNYA 2GXGA 5DCMB 1QZZA 1QO0D 3CO6C 3WG9A 4U0YA 3F22A 4UVAA 5L3CA 1CF7B 4YFNF 2Y48A 4HW0A 4LG0A 3JTGA 3F23A 1K78A 1YYVA 2YU3A 3SHFA 4L9NA 2VBZA 3HRUA 1ZRDA 2PFBA 1I5ZA 4WF2A 3HRMA 2DTRA 5IT9Z 1MD0A 2ACJA 1IXRC 3F6VA 1P4WA 1ZYRF 3WE3A 4B8XA 5E20A 4WX9A 1D5VA 3HSEA 3T0YA 4IVNA 2XGXA 2VBWA 2P5LC 1U6GA 3WODF 1O7LA 4UXNA 3I4PA 2MLKA 3FX3A 1KU3A 5D8KB 3K1MA 2V79A 3VB2A 5D6EA 1Z91A 2G7UA 1DP7P 5IT3A 3MZHA 3CLOA 2IA0A 2XVCA 3MAJA 1BIAA 2CGPA 1T39A 3IRRA 1HSJA 1T6SA 2VOOA 1P4AA 1IN4A 2ZO4A 2JPCA 3VODA 1Z05A 4WXCA 5CVUA 3ZMZA 4IPAA 1Z7UA 4HV5A 5IT9K 4MEXF 1W7PA 2AXLA 5FFZA 4MGRA 1U5TA 1T2KA 4CYDA 1YLFA 2V6CA 3EETA 5K1YA 4BXUA 3L00A 1XCVA 4HBLA 4HF2A 1R22A 2MLGA 1YW7A 5JHUA 2DQRA 2FMLA 5AIQA 3ROUA 1W5TA 3SQNA 2L54A 2O8XA 4BAYA 4ENMA 1R7JA 1UB9A 1WSUA 3QOPA 3V8JA 4HYEA 1Z6RA 3DPLC 2NS0A 3U2RA 2STTA 3K0LA 4IHSA 2A6EF 4Y13A 3QRFF 5J6XA 2E1CA 3TOAA 2WWYA 4U0WA 3I59A 3RKYA 3GO5A 1SD7A 3QU6A 3GEZA 3GLXA 2CG4A 2EA4A 4XLPF 2NYXA 2IA1A 4RB0A 1G3YA 1R1TA 2JRTA 3I54A 3WTUC 3BOQA 1K7AA 4U7DA 2VONA 1BIBA 2VBXA 4EM1A 4KN4X 3GW2A 4OINF 2E1NA 3WU0A 2OA4A 3CUQB 1PP8F 4I01A 1DUXC 1PDNC 1K6OA 1Z6TA 1YO5C 4AWXB 4LB6B 4UVCA 5H20A 3EYYA 3F8CA 2E7WA 4EJWA 1FNNA 1J75A 1UHWA 3R6SA 1YS6A 1REPC 4QWQA 5K5OA 2XRNA 4YIFA 4OOIA 3VFZA 5D5UB 3HOTA 2WV0A 2JPBA 2DW4A 1U78A 3JSOA 1FP2A 5LRRA 4IHTA 5F6FA 2HZTA 4UHTA 1AWCA 2W85A 4Z2YA 2L4MA 2HGCA 4BHPA 1H9GA 3BJ6A 5FO5A 1LVAA 3GZ6A 1MJ9A 1G6NA 2PQ8A 3K2ZA 3HIFA 4R79A 3IL2A 3GXOA 2Z33A 1MZBA 1FBQA 2FEZA 2OBPA 3J80K 3KP6A 5LGUA 4M74A 1JHFA 3E6DA 3PQJA 4I0AA 2J5OA 3M8EA 1HXDA 3IWZA 3E5XA 3TDUC 5ICGA 3N4MA 1FYKA 1XD7A 3HRSA 2NAZA 1IXSB 1TBXA 4G7ZF 1ZHFA 3RYRA 5AONA 3SXYA 3TO7A 2D1VA 3C1DA 3IKVA 3T1BA 4A0XA 3E6BA 3RPQA 4L9TA 2VC0A 5HLHA 4ZYGA 2P7CB 3CDHA 2O61A 4EJTA 1FBUA 4KDPA 3DPTA 1J5YA 5LHHA 1TW2A 4HF1A 1NHAA 2EFPA 1SMYF 1BI2A 2EJRA 5CVVA 2M45A 5D5WB 5DCMA 3DF8A 5HS8A 2ISYA 3J80Z 5BPDA 1B6AA 2TDXA 5F64A 3RIRA 3KE2A 2KIMA 4G6DA 5CVIA 1CGPA 2QBYB 3LA2A 1ZAOA 2CO5A 3T8RA 4EJUA 2RKHA 4M72A 1YTYA 2AS5F 3KP5A 4L9VA 2EV0A 2F2EA 4HX8A 3WGGA 2LNBA 4FT8A 5L3BA 1U5TC 5E1ZB 3TDZC 2VE9A 4GCVA 4CICA 4A12A 3WTYC 3E6CC 3L09A 4KFCA 4KA4A 4G7HF 3BY6A 3BJOA 3ELKA 3S2WA 1XMAA 4M71A 4AD9A 1R1UA 1FPQA 3WTSC 3I53A 5K5RA 1I1GA 3G3ZA 2KRFA 4M9XA 2PMUA 3EYIA 1FYLA 3V7SA 3VEPA 4E70A 3ECHA 1EV7A 4HQEA 1G3SA 2UZKA 5CVJA 4IJAA 1UHMA 4CXFA 3BDDA 1HSTA 4FX4A 5TJJA 2L3DA 1USSA 2ZMEA 3PQKA 3WTXC 3TQNA 3C18A 1B4AA 1IAWA 1TQIA 5HS9A 1X3UA 2K02A 2BYVE 5LHIA 2DLLA 2GZWA 1ZG1A 1BC7C 2W57A 4IXAA 3U1DA 3ZQ7A 3CJNA 3I71A 4IF4A 2VC1A 4R8HA 4N9IA 2O6GE 3M8FA 1RZ4A 1I27A 3WGIA 3FXUA 4BHCA 2EFNA 1H9TA 4TV7A 1YIOA 2R3SA 4Y15A 4MTEA 1V4RA 4I09A 1SAXA 2HEOA 4A5NA 3COAC 3WU1B 1R5HA 4K2EA 4RB2C 2FQ3A 5HLIA 1ZLKA 4WK8F 2B0LA 1P92A 4I98B 3QAHA 4P5OA 2PJPA 2ETHA 5HS7A 1ON1A 1XMKA 2XASA 5HDGA 2NRAC 2IT0A 1OYWA 2RGVA 4KMFA 2QWWA 1IRFA 2YPRA 1KU7A 2GA1A 2OD5A 2GXBA 3TGNA 5LRSA 3HHHA 2EV5A 4KIGA 1SD6A 3DXJF 4ON0A 4MHGA 2D2WA 3IHUA 4RS8A 4MNUA 2O3FA 3O3KA 2FSWA 4L0ZB 2QQ9A 3MEXA 1OYYA 4YFXF 3WE2A 3MCZA 4UNOA 2CYYA 2V9VA 1S8NA 2HQNA 3KZYA 1B59A 2XUBA 1YQAA 2VODA 3E5QA 3I58A 4JBAA 2XAQA 1LDKB 2ZNZA 3TO9A 1RUNA 2HOEA 1XSVA 3ZPLA 3WTVC 2ZJ2A 1I1SA 2HQRA 2G9WA 4ENKA 1UFMA 1G3TA 3G73A 5BS6A 1D8KA 1RI7A 5D6FA 3NRVA 1J7KA 3K9TA 3RDIA 4WWCA 2DO7A 4LLNA 2JSCA 2A07F 5FFXA 3ZP5A 2OQGA 2OQRA 1ZN2A 2PLYA 1EH7A 2FA5A 1C0WA 2EFOA 2DK8A 1LB2A 1Y0UA 1BOAA 2V1UA 1KU9A 2J5PA 5ILVA 2BGCA 2MBFA 2CWEA 4EVIA 1ZG3A 5L3GA 4BYYA 2P6SA 4XSXF 4U7BA 3DQVC 2JT1A 3BPVA 4OIOF 1IXCA 3WTWC 3N97A 1JHHA 1J9IA 3GVAA 5HDNA 2F5FA 3FXQA 4XSZF 1D8JA 2BE5F 4KUMA 3ZMVA 2L02A 4OMYA 3GFMA 1MJAA 5E1WA 5BOXA 4KNYA 3I64A 4HZFA 2G7HA 4MQ9F 5ILUA 1WI9A 4I2OA 2MA3A 2RNJA 3TO6A 2FBKA 2ZXJA 3KP7A 3FM5A 4OU0A 4A6DA 2HDCA 4M6XA 4FX0A 4EV0A 2CW0F 1XDSA 1PUEE 1XDUA 1T0FA 3H92A 1U3EM 4P55A 1O57A 4RAZA 4M9SA 4NHJA 1P6RA 3M1EA 1B9NA 3FMSA 1EH8A 1STZA 4CO8A 1R36A 5LLQA 2YSRA 4LFUA 1XGMA 2FRHA 3M7GA 3SZTA 2XAGA 3B73A 4XBFA 5E8GA 2A68F 5LEKA 3IRQA 1RUOA 3BPXA 4RGUA 5JVTA 1IN8A 3R0AA 4XLNF 3EUHA 1IRGA 4PGHA 1TTYA 3F8NA 4HLXA 2FF4A 1QBJA 2FU4A 4I0BA 2STWA 5FGMA 3HYIA 3Q9SA 1LEAA 3CTAA 3ERED 3D5LA 4N9HA 4KT5C 1O3SA 2RQPA 1R58A 1HKSA 3EDPA 2ISZA 2EB7A 2L01A 2DU9A 3GFLA 1TQMA 4P9UA 3ZN1A 5DDGA 4AIJA 2F5DA 2HTSA 5FD6A 3MZYA 3L2CA 1GXQA 3T8TA 2VBYA 2FBHA 1SMTA 3KETA 1G3WA 4ENJA 4GO1A 2P8TA 1HQCA 3WTZA 2OZ6A 1IUYA 2BV6A 1ZGJA 5DD8A 2XAHA 4LD5A 1VTNC 1QNTA 2M8EA 3GX4X 1O3TA 1V3FA 1LJ9A 2DI3A 3R4KA 4HF0A 3W6KB 5LHGA 5ILSA 5BQTA 1OPCA 1KGSA 4YIIA 5LGNA 2IVMA 2L4AA 1IF1A 1YW8A 4JK1X 4ZYDA 1ZRCA 2VOPA 5HVQC 2QUFA 2XAFA 1QPMA 5ICCA 3FWEA 3J81K 1SD4A 1GHCA 4O6JA 1KYWA 3KP4A 2EA2A 1T38A 2EV6A 1PP7U 3P9KA 4EGYA 5JFRA 2ZFWA 1P2FA 1KA8A 5EEHA 2DPDA 3L7WA 3KFWX 4PZJA 4HOBA 1LDDA 1FWZA 2VT2A 1W4MA 2QZ8A 4LJZF 4LLLA 4LK0F 1E2XA 1BI1A 2FNPA 2Z3YA 3MWMA 4FHTA 3P9IA 2OAZA 2WTEA 2A61A 3F8MA 2DQLA 4HDUA 2EFQA 1DDNA 1FYMA 2FXAA 2Z99A 3R60A 4M73A 4CZZA 2IP2A 4A5MA 3MQ0A 5E18F 4HX7A 4L0YB 2P5KA 5FD5A 3CO7C 1XSXA 4OIQF 4A0ZA 2KIFA 4BQAA 1A04A 4RGRA 3KEOA 2QLZA 4PDKA 3ISPA 3KCCA 1R00A 3CUQA 2W24A 2XAJA 3FZVA 2Z9OA 1OYIA 2CQKA 4ZZDA 5D8LB 1MDMB 1K78B 3F72A 2E7XA 3V7CA 2EFWA 2DFIA 1F9NA 3B02A 1XGSA 2M87A 3M9AA 3HTUA 3D0SA 4RB1A 2D45A 1HW2A 2RC4A 1LEBA 1HW1A 2W25A 4S04A 3H3ZA 5F1RA 1J0RA 3DP7A 2YR2A 2PN6A 2FE3A 1IW7F 3REOA 1TNSA 3RKXA 1KYZA 4M9ZA 3KP2A 4AIHA 2MD5A 3QP5A 3ABUA 3JW4A 2BEOA 1G4DA 5D5VB 4EM0B 1YS7A 3HTSB 1F5TA 1XGNA 2XIGA 1YW9A 1DPUA 2EK5A 5LBQA 1S3JA 1B9MA 4ESBA 5TRDA 1ZGAA 5L3DA 4ZYEA 3E6MA 3BP8A 4G8XA 3V7RA 1W7PB 4L5IA 4KICA 3ABTA 4KIFA 2PEXA 1KQ0A 1OMIA 3FXRA 1LQ1A 2QQAA 3MFKA 3L9FA 3LSTA 5K5QA 1ZH5A 5HOOA 3QU3A 1J59A 3GYHX 1ZG5A 1P4XA 4ZZLA 3AAFA 4LG0B 1EH6A 2VE8A 1HBXG 1FP1D 4BNCA 2QM3A 5E8IA 3OV8A 2GWRA 4L18B 4CHUA 4G6QA 4I7HA 3SFZA 4MEYF 4XRFA 3ZMSA 2DBBA 2MC3A 4WCGA 4ETSA 6PAXA 5D4SA 4EMSA 2Q8KA 5AIPA 4GGGA 4A2UA 4ZYHA 4ZH4F 1AOYA 3KP3A 5JI6A 3Q5FA 1ULYA 1BN5A 1Z9CA 1HKTA 2FMYA 5ICFA 1W5SA 2C6YA 3QPHA 3T5XA 1KU2A 5J8FA 3O6BB 4PCQA 4EQQA 4A6EA 1J2XA 2XROA 2X4HA 5L3EA 3JSPA 3P7NA 2HFHA 2K7LA 2HYFA 5KK1A 1IN7A 3LA3A 1H0MA 1L3LA 1IN6A 4UUVA 2Z5UA 3F3XA 5H6RA 1ZRFA 2IPQX 1OKRA 3IKTA 4O3MA 4P9FA 4AIKA 1IN5A 3F6OA 1O7FA 3BWGA 3W6JB 2VXZA 4HX4A 2KJBA 2BBYA 2XKPA 1R5GA 2LKPA 2XV4S 3F8BA 4L5JA 5E1XA 2ZMEB 1RIOH 2XHKA 2X0LA 2LDUA 4LGWA 4YFKF 3QP6A 3HSRA 2M1BA 2K4JA 3KLNA 1LDJA 2H6CA 1BI0A 1YFHA 3O2PE 1Q1HA 2P4WA 1SFUA 5A2QK 1S7AA 4NB5A 3Q9VA 1WQ2A 1ZLJA 1USTA 3NEUA 3ZMTA 3RYPA 3J7AO 3HOSA 1QQIA 3LQRA 5DEQA 4G9YA 2Q2EA 5DV5A 3E5UA 3RI4A 2PG4A 3KZZA 4ESJA 2H6BA 2YX4A 3TOBA 4O5VA 5E17F 3K1PA 5ICEA 2QENA 3VOEA 2M30A 4MTDA 3FHZA 2IRFG 2H94A 2IW5A 2HYGD 1L0OC 3U9GA 3ZN0A 3RJPA 4EM2A 1BC8C 4RGSA 3WTTC 5CVRA 2A3SA 1FOKA 1IZ1A 5HLGA 2ZBKA 2UXNA 1FT9A 2MH9A 3I5UA 3RPUA 4UV9A 1O3QA 4UVBA 4Q5SF 1S29A 1FSEA 1ONVA 3E97A 1FSHA 1JXSA 5EEGA 5DD4A 2RVCA 2JZYA 3C7JA 2KKOA 5L3FA 2RN7A 2PBIA 5D4RA 1O3RA 3KLOA 2ESNA 4EJVA 4HLYA 3EQLF 3JTHA 2COMA 2VT3A 1LNWA 5BMZA 2P7VB 4KIBA 3V8LA 2M5WA 4F7ZA 2O0YA 4HV6A 3CUOA 1WWXA 1KQ8A 1QZYA 1HW5A 2LF8A 1TQPA 3SZPA 2HKOA 3K1NA 3RTRA 4Q4ZF 1Z1DA 3DFGA 1QGPA 3WGHA 1F4KA 2GAUA 2CSOA 3BROA 2HS5A 4GXOA 1E17A 1JGSA 1WKMA 5H6QA 2ADUA 1K79A 1S6LA 4U0VA 5BPIA 3E3VA 5CLSA 2VN2A 2UWMA 2P6TA 3HRTA 3BJAA 1XB4A 3JAMZ 4NQWA 4GYGA 4WXDA 1KQ9A 5LGTA 2FNAA 2V1DA 3RKWA 2FBIA 2HTJA 3LQQA 2HKXA 3OOPA 4KN7X 1JE8A 4I02A 1U5TB 1FY7A 4OIPF 4S05A 2NNNA 2ZNYA 5JR3A 3LAPA
chains in the Genus database with same CATH superfamily
1MJBA 3LAJA 2CFXA 2MD0A 4E7JA 1T98A 1UG0A 2AO9A 1D3YA 4HDVA 1FC3A 3FMRA 5F08A 2HOTA 4KMUX 3A01A 3I59B 3L2UA 4A3DJ 1JT6A 4ENNA 5ERIA 3F8FA 4KYWA 1ZREA 2NVUB 1VQMI 1SFEA 2K3PA 3FM3A 1DPRA 3JRIA 2XF7A 2XKOA 2YX7A 2P5VA 1VQLI 3GWZA 4P96A 2CUZA 3RQIA 3HM5A 3CCSI 2R7FA 1TW3A 5CYVA 1XTAA 4XL9A 1R1VA 2H09A 4PGGA 4KISA 1QHGA 1ZARA 4R1HA 1ZKGA 1SVMA 3CCUI 3I55I 5LEJA 3H3UA 4AU7A 1WZ2A 2FOKA 3HOZJ 2ZXHA 5J8CA 2CQNA 3LSRA 3CC4I 1UMQA 2V1XA 1FZPB 1FOWA 4IRHA 1XCBA 3HHGA 4JX4A 4G94A 1Z3XA 4XR6A 4OIRF 4DYQA 2X6YA 3V8KA 1BM9A 2KJCA 1KZHA 2IJLA 4HA8A 4LMYA 2ESHA 2DK5A 4BHBA 5ED4A 2JTVA 1B1BA 2X1DA 3TKYA 4B09A 3JRFA 2GOXB 3SDBA 1B72B 2EPFA 1K6YA 5CQGA 2K27A 3FK6A 1I6XA 3H9JA 2W7NA 2K9QA 4BUPA 2Q2EB 3OYCA 2CU7A 5EJCA 1FBSA 1JUMA 1OLTA 4BE1A 2EWNA 4UV8A 5E3LA 1H89C 2P0WA 2M8GX 3LNQA 1TP4A 1X2MA 2F48A 1V54H 2F5EA 1MNMC 4B43A 2GIVA 2RQQA 4EGZA 2L7KA 3LWFA 1DQUA 2DT5A 4MQVA 1XG1A 2O03A 3LSHA 1T8IA 4HQMA 4CGZA 1OR7A 3VYUB 4Y52J 1GXPA 2QVOA 4DQ2A 2QBYA 2CV1A 4E7ZA 2UXXA 3MD2A 4F3QA 1U2WA 2HWVA 2GOMA 2MH2A 1GVJA 1NK2P 2Y75A 4XLEA 1NG6A 4U88A 2OC6A 2EIMH 3PL8A 2WC2A 3IWFA 1BBYA 2MW8A 1F1ZA 2D1HA 2K5CA 3JAMK 3GZNB 4RAYA 1SFXA 2VIXA 3SFIA 4CCMA 2RV8A 2K86A 4RLQA 4BQOA 1GT0C 1FLIA 3FMQA 3VDXA 3DV8A 1FX7A 4LB5A 4CDGA 2K4BA 2A5YB 5FB2A 1XSDA 5DUKA 4ZTJA 2RDPA 3S17J 4AUXA 4A0YA 3KYLA 3DEUA 3OIOA 4XLFA 4GYIA 3ECOA 2O8KA 2LMDA 4IRIA 3ZMDA 2I5UA 3QPTA 3V4GA 3GFIA 4WXHA 1W0TA 1MBEA 1Z7LA 5KVRA 4G7OF 5FLXK 3L1PA 1WRJA 2CUJA 4F91B 1BJAA 3SEZA 2BHZA 4CH7A 3G4SI 3KIOA 5D5XB 5BNGA 2DAOA 2ZB9A 5TISC 1I3QJ 1OISA 1VI0A 1RESA 5B1AH 1X1PA 2QYOA 3HDDA 1BR2A 4CYCA 4XLCA 3J7ZI 3HSFA 4N0BA 3QYEA 2PI0A 3CCQI 2FJ1A 2LR8A 2ZCWA 4H0EA 4OMZA 3DKWA 3LOCA 4RGXA 3FKJA 4DOZA 4Y7NJ 2EZLA 1IJWC 1MKMA 4BDZA 4C2UA 2ELHA 2QKLB 1JI8A 3NARA 3A02A 3HUGA 4M6YA 1MMGA 1WJEA 5FRMA 2R7VA 3ML6A 1DP3A 1ODDA 1M1EB 5FRNA 4L5EA 1JKRC 3I0TA 2IS4A 3FBIB 1ERDA 3JRCA 2LSOA 3OYJA 2VASA 4XKCA 1W1WE 2QEXI 4D5CA 1MDMA 1U8RA 2KZVA 1I39A 3WHBA 4DNCA 3PIOF 2H8WA 1YX3A 3IC7A 4Q47A 2A69F 1S72I 2LF7A 2GA2A 1RNLA 5CJ9A 3QWLA 1W5CC 3OIQA 2M0MA 2BW3A 3HOVJ 4C9YA 1YG2A 3S8PA 3GFJA 1ON2A 2EZKA 2W82A 5KAIC 5HDKA 1XN7A 3B6AA 3CD6I 3R0JA 4XOTA 1D0XA 3C3WA 4AVPA 4PK4A 2M0CA 4L9JA 5J3LA 2X1EA 5DCFA 3J81Z 2R7DA 2R7UA 2QQBA 3F21A 1MGTA 4Q48A 2GQQA 4HAMA 2WBMA 2DPUA 1CF7A 5DYMA 2IA2A 3PFIA 3VWBA 2LH9A 2F5CA 2F4OB 3R61A 3HJEA 3GTJJ 3OYDA 2KIUA 3RQ4A 3BZ6A 4PSWA 3GUDA 2ID6A 3CDIA 3LA7A 1UCRA 1XGOA 3HGGA 2Q0OA 3FF5A 5E3MA 1ETXA 1TNTA 1QVUA 5M5XJ 1VQ8I 3DCFA 4Y17A 4IO9F 3GZ5A 2A6HF 4RB3C 4JQFA 3VYRB 1R49A 1R23A 1LFPA 1W7PD 3CCMI 4V19K 2R7SA 3W2VA 3CUQC 4LLGF 3ZQCA 2R7OA 1FJLA 3A2KA 3DLAA 4RBOA 4EJOA 1D0ZA 2M7BA 4RAGA 4M3EA 1BI3A 1TLHB 4QLCU 5JHFA 5GTIC 4BH9A 1MBFA 2ZXWH 3ZMUA 2QSHX 4IRGA 2EIKH 4W1UA 4LOCA 5A2QZ 3P9CA 1FIAA 4LK1F 1UG2A 3KEQA 3BR0A 2PMHA 2ZKZA 4UB8C 2OU2A 3NQOA 4ASNA 4ESFA 1WCMJ 3OS1A 2L9VA 1U9OA 2Y0MA 4F93B 1HOMA 5DUIA 5C3EJ 2OZUA 4BGDA 3GF2A 2LK2A 1AKHA 3CZ6A 2VJ4A 1HKQA 1SD5A 3LFKA 2W84A 4D0PA 2H27A 3K69A 1MIJA 3ULQB 4BL0B 5FKKA 4FISA 5FLXZ 4YG2F 1S7OA 4NDLA 5GADJ 1YE9A 3JRAA 3D1NI 5LD2C 2HR3A 2NNYA 2WY8Q 2L9SA 2GXGA 3NAUA 1Z3YA 3ZQLA 5DCMB 1QZZA 3M3YJ 1QO0D 3CO6C 4BE0A 4JYKA 3WG9A 4U0YA 1JUSA 3F22A 1JKQC 1YITI 4UVAA 2VKVA 2HPMA 1DGWY 5L3CA 1CF7B 4YFNF 5B3SH 5F27A 3BCAA 4A69C 5DM7F 3S93A 1X1AA 1ENHA 4MO7A 2OJED 4BDYA 3K4CA 3MKYB 3CCLI 1MBHA 2Y48A 4HW0A 4LG0A 3JTGA 4DZJA 3F23A 3TEDA 2DA7A 1K78A 1YYVA 1T95A 2CQQA 2Y69H 2Y31A 2YU3A 1DU6A 2Y2ZA 3SHFA 3OYMA 4L9NA 3W2AA 2VBZA 3HRUA 3BG5A 1ZRDA 2E1MB 2PFBA 1I5ZA 4WF2A 3HRMA 4GFBA 2DTRA 3QPSA 1LE8A 4NC8A 5IT9Z 1MD0A 1IRZA 2ACJA 1IXRC 3F6VA 1P4WA 1ZYRF 5J1RA 2DTZA 3WE3A 4CSWA 4UUTA 5E20A 4B8XA 2Y30A 4PFOA 3HPHA 4WX9A 1RC9A 1D5VA 3HSEA 1OCRH 3T0YA 2CQ7A 1RKTA 4IVNA 5EYRA 1ETQA 2XGXA 3L2QA 2R5YB 1F43A 2VBWA 1WJFA 2P5LC 3OMYA 3ZXSA 1U6GA 3HZJA 3WODF 2LY9A 4EATA 3KYDB 1O7LA 3DTKA 4UXNA 3SZGA 3I4PA 3KYCB 3PNTA 1D1CA 2MLKA 3FX3A 1FOYA 1KU3A 4BBRJ 5D8KB 1IDYA 2V79A 3K1MA 3VB2A 5D6EA 3PNVA 4KITB 1UAAA 1Z91A 3MVPA 4HNVA 3GTQJ 2G7UA 1VF9A 1DP7P 5IT3A 3MZHA 3ONQA 5K7ZA 3ZRGA 3BG6A 4OWRB 1ZR4A 2XRLA 3CLOA 2IA0A 2XVCA 3MAJA 1BIAA 2CGPA 1T39A 1IV8A 3IRRA 1ZELA 2BXZA 4X0GA 1GUUA 1HSJA 5GAGJ 4I99C 2DYSH 1T6SA 2VOOA 1P4AA 1MBJA 1IN4A 3IH2A 2ZO4A 2JPCA 3VODA 1Z05A 4WXCA 2E2HJ 5CVUA 2WAQN 3ZMZA 4IPAA 1Z7UA 3GTPJ 4HV5A 5IT9K 4MEXF 1W7PA 2CV0A 2OCCH 3DTIA 2AXLA 3Q3SA 2IGNA 2JSPA 1JTYA 5FFZA 2R7WA 1JTXA 4BJ5C 2QCOA 3S1QJ 5J40A 4MGRA 1U5TA 1T2KA 1WJDA 3GTOJ 4DJAA 4CYDA 1YLFA 2V6CA 1QVTA 1ZQ3P 3EETA 5K1YA 3H1CA 1WJAA 3FK7A 4BXUA 3L00A 4HNUA 1XCVA 3GTGJ 4HBLA 1YJNI 3H5AA 2L9RA 2VJ5A 4HF2A 1B8IA 2DXIA 5GP9A 1R22A 2MLGA 2IS2A 3KPHA 1YW7A 3CJQB 5JHUA 2BY3A 2DQRA 2FMLA 5AIQA 1BL0A 3ABKH 2E35A 3ROUA 4FASD 1H88C 1W5TA 1ZTRA 2NS8A 3SQNA 2HOAA 3S1RJ 1OCCH 3OSFA 2L54A 2O8XA 3WHCA 4MFEA 4BAYA 1R7JA 4FETA 4ENMA 3WU2C 3CMMA 5F0FA 1RETA 1UB9A 2WB1A 1WSUA 3QOPA 2EQRA 1JUPA 3DKXA 1Z0XA 4RAFA 3V8JA 4B3AA 4HYEA 1Z6RA 1WH5A 3DPLC 2NS0A 2D5VA 2BZTA 3U2RA 2STTA 5J4YA 3K0LA 4D7NA 4IHSA 1XMXA 4GRIA 2A6EF 2JVGA 4E6KG 4Y13A 3QRFF 5J6XA 4NC6A 2E1CA 5GAHJ 3TOAA 2WWYA 4B48A 3DBHB 2K9MA 4U0WA 3I59A 1IRXA 3RKYA 3GO5A 1SD7A 4XLHA 3QU6A 1ZK8A 1V55H 2PJRB 1UZCA 3ERMA 2W4SA 3GEZA 2DMNA 3GLXA 2CG4A 3BG9A 2EA4A 1IV6A 4BY1J 3HL2A 2E1MC 4XLPF 1LUJB 2NYXA 1E3HA 1PJRA 4Y3OA 1QHHD 2IA1A 1A31A 4IHXA 4RB0A 4MIMA 1G3YA 3CCEI 1R1TA 2JRTA 3LSJA 3UR3C 3CLQA 4BJTA 3I54A 3WTUC 3BOQA 1K7AA 1LKXA 4U7DA 2VONA 1BIBA 5B66C 2VBXA 4EM1A 4KN4X 3GW2A 4MFDA 1AKHB 4OINF 2E1NA 3WU0A 2OA4A 4HNTA 3CUQB 2WB1N 1PP8F 1ZGWA 4I01A 3FDYA 2DA1A 1X3ZB 1DUXC 1PDNC 2R7QA 1ETVA 3Q0WA 2VKHA 3JCUC 1K6OA 4ANJA 1JKPC 2Z1DA 1Z6TA 1YO5C 4LIUA 4AWXB 3CF5F 4LB6B 4UVCA 3H9GA 5H20A 3EYYA 1Y56A 3F8CA 3VSLA 1YX5A 2CW8A 2E7WA 4EJWA 1FNNA 1J75A 1UHWA 3R6SA 1YS6A 2EZIA 4QTRA 2A05A 1PUFB 1REPC 1QRYA 4QWQA 5F1JA 3MZ8A 5K5OA 2XRNA 1MMSA 4YIFA 4OOIA 1N75A 3VFZA 5D5UB 3JRBA 3HOTA 2WV0A 2JPBA 2DW4A 3C2HA 1U78A 3JSOA 3H0GJ 4PJ0C 4Z6YA 2FUG2 1LFBA 1FP2A 3FKIJ 3DWLE 2R0QC 2JA8J 5LRRA 1Z77A 4IHTA 2F5VA 1A6QA 5F6FA 2HZTA 2BVLA 2ID3A 2IBDA 4UHTA 1AWCA 2W85A 3S32A 4Z2YA 3N05A 2L4MA 2HGCA 4BHPA 3OYHA 3SJMA 1H9GA 3C2GA 4A3GJ 2VXDA 2GIZA 2LLKA 3BJ6A 4ZTFA 5FO5A 2YS9A 1LVAA 3LSPA 3Q0UA 3LL7A 3OR2C 4PJMA 1OR7C 4ABZA 3GZ6A 1MJ9A 1G6NA 2PQ8A 3K2ZA 3HIFA 4R79A 3IL2A 3GXOA 4IEJA 2Z33A 1MZBA 4E7KA 3G1LA 1FBQA 5FKMA 5EDNA 2BW3B 2FEZA 2LG4A 2IEKA 2R5ZA 3PJRA 2OCEA 1AHDP 3FIWA 2OBPA 1HLVA 3J80K 3KP6A 3CMAI 2IS1A 5LGUA 4M74A 1JHFA 3E6DA 1RKWA 3PQJA 1WI3A 4I0AA 2J5OA 1OQYA 1TT5B 3M8EA 1HXDA 5FLMJ 2IGOA 2VLAA 3L2WA 3IWZA 3E5XA 3TDUC 5ICGA 3N4MA 1FYKA 2ME6A 1XD7A 3HRSA 2NAZA 1IXSB 1TBXA 2EH3A 4G7ZF 1ZHFA 4IQ4A 2M3AA 3RYRA 3CESA 5AONA 3SXYA 4F55A 3TO7A 5JLWA 3AL0C 1HC8A 2D1VA 3U1KA 2HQAA 1BR4A 3C1DA 1EJ9A 2V9KA 2XB0X 3IKVA 3T1BA 2HPIA 4A0XA 1SAUA 3E6BA 3RPQA 4L9TA 2LD5A 2VC0A 2X51A 2V1NA 2AQEA 4V2FA 5HLHA 2CQXA 4ZYGA 4XICA 1MMNA 1HDPA 2MFZA 3PM1A 2PMZN 2XB5A 3ASOH 2P7CB 3CDHA 3ABMH 2O61A 4EJTA 2XGCA 1FBUA 3RZDJ 3OIPA 4IX7A 4X6AJ 4KDPA 3OWTA 3DPTA 2HXIA 2BHYA 2M4KA 3IP4B 3MKWB 4CA0A 1R4NB 1J5YA 2LFBA 5LHHA 1TW2A 3CCRI 4HF1A 1NHAA 2XF5A 3G6EI 4JOMA 2EFPA 1SMYF 3ZCOA 1JJ6C 3KZIC 1BI2A 4HEA2 2EJRA 5CVVA 3H9QA 4CCKA 5EEAA 2EIJH 2M45A 1TWAJ 2BOLA 4F92B 5D5WB 5EZHA 5DCMA 4OAZA 3DF8A 2LKXA 5HS8A 2ISYA 1ETWA 1YRNA 3IAM2 1I6HJ 3F9KA 3J80Z 5BPDA 1B6AA 2TDXA 5F64A 3RIRA 4A3CJ 3KE2A 1QZEA 1Y1WJ 2KIMA 4G6DA 4XM3A 2DFHA 2LY2A 3C2BA 4A3BJ 2NXNB 2R7XA 5CVIA 1CGPA 2MC4A 4BBSJ 2QBYB 5M5YJ 1DU0A 3LA2A 4S0HB 2M4GA 2PJRA 1ZAOA 2CO5A 3T8RA 3BTJA 4EJUA 2RKHA 3D5RC 2O7OA 4J01A 2UUZA 2PMZA 3O8GA 4M72A 1YTYA 3ZR8X 2X9DA 3G2BA 2DDBA 4XONA 2AS5F 3KP5A 4CCOA 3J7AY 4L9VA 4PFPA 1LE8B 4BKXA 4C2TA 2EV0A 2JK3A 2F2EA 4HX8A 2E2JJ 2XPUA 1R5ID 4CCLA 3WGGA 2LNBA 4FT8A 4LIVA 3O8HA 5L3BA 2DA4A 1T0FC 1U5TC 3A0HC 5E1ZB 3DKYA 3TDZC 2VE9A 4GCVA 4CICA 3A4CA 4A12A 2JJ7A 2NS7A 3WTYC 3BZCA 3E6CC 3L09A 4KFCA 1YJ9I 4KA4A 3VPRA 4G7HF 3BY6A 3ELKA 3BJOA 3S2WA 1YJWI 4FQGA 1G59A 1XMAA 4M71A 4A3JJ 2FOWA 1R1UA 5E79C 4AD9A 2GBYA 4CCNA 1FPQA 3WTSC 4X1EA 3I53A 2JA7J 5K5RA 1I1GA 3G3ZA 1D5YA 4B3XA 5E3NA 2KRFA 4M9XA 2PMUA 3EYIA 3HOYJ 1FYLA 2H1LA 2WV1A 3V7SA 3VEPA 4E70A 4J00A 3ECHA 1EV7A 4HQEA 1G3SA 2UZKA 2K9NA 5GTHC 5EGOA 5CVJA 4IJAA 3RKQA 2K3FA 1UHMA 4CXFA 2LYCA 3G1OA 4CYCB 3BDDA 1HSTA 4FX4A 5TJJA 2L3DA 1USSA 2ZMEA 1TZLA 2MSYA 3PQKA 3WTXC 1VFCA 9ANTA 3TQNA 3S3NA 4M3GA 3C18A 1B4AA 1T33A 4HSRA 1IAWA 1G2HA 1TQIA 3CJRB 5HS9A 1X3UA 3S14J 2E1OA 2K02A 3OOUA 2ICWG 2BYVE 3BG7A 5LHIA 2KZGA 2DLLA 2GZWA 3VSKA 1ZG1A 1ORKA 1BC7C 2W57A 3K70C 5C4XJ 2ZJRF 2ME0A 3AG2H 4IXAA 3U1DA 1Y39A 1H8AC 2ZMEC 3ZQ7A 3CJNA 3I71A 4IF4A 4LG3A 2VC1A 4R8HA 4B4CA 4N9IA 2F4IA 1TWFJ 2O6GE 3KEYA 3AKZA 4YIRX 3M8FA 5F04A 4AVZA 1RZ4A 1I27A 4N4OB 3WGIA 3FXUA 4BHCA 2LC2A 2EFNA 1H9TA 2B7EA 4BEHA 4TV7A 4QPOA 1FOXA 1YIOA 2R3SA 4Y15A 4MTEA 2KFDA 1V4RA 1TL8A 4F52A 4I09A 1I3AA 1SAXA 4PJNA 1UJ8A 2HEOA 2W00A 5B1BH 3ZQFA 1RPWA 4A5NA 3COAC 1TWHJ 3HKZA 1R5HA 2K9LA 3WU1B 1SFOJ 4K2EA 4RB2C 2FQ3A 5HLIA 4I6ZA 1ZLKA 4WK8F 2B0LA 1HA8A 1VZ0A 1P92A 4I98B 3QAHA 4P5OA 1JKOC 2W1OA 4QPQA 3H5NA 2PJPA 3LSGA 4EEFG 2ETHA 3FXMA 5HS7A 5IOZA 1ON1A 4C2MJ 1R4MB 1XMKA 2XASA 5HDGA 2EZHA 2K40A 2VUMJ 2NRAC 2ZC2A 2GXAA 3IUOA 2IT0A 3SDGA 1OYWA 1T08B 2RGVA 1YHQI 2ZSIB 3CCJI 5LFAA 1WJCA 4KMFA 4C30A 4A3LJ 2QWWA 3BTIA 1IRFA 1HDDC 1U8BA 2YPRA 2E36A 2O9LA 1KU7A 3M4OJ 2DODA 1BW6A 3F0CA 2L7MP 2GA1A 2OD5A 2NVXJ 2E5NA 2GXBA 3TGNA 5LRSA 3GCMA 3HHHA 3V42A 3OYLA 2EV5A 4KIGA 1SD6A 3DXJF 4ON0A 4MHGA 2D2WA 3IHUA 4RS8A 4MNUA 2O3FA 3O3KA 3PUFA 2FSWA 2LREA 4L0ZB 1MNEA 1WJBA 3PSFA 1P7JA 2QQ9A 3MEXA 2XPVA 2LOOA 1OYYA 4BJ6C 4YFXF 3WE2A 3MCZA 3RCOA 4UNOA 2CYYA 3A01B 2V9VA 4DZPA 1S8NA 1WVRA 2VKDA 1IG7A 3TMOA 3CQZJ 3IAS2 3OYKA 2HQNA 2Z16A 3KZYA 1ZR2A 1B59A 1SEUA 2XUBA 5KAFC 2QF7A 2KLOA 1YQAA 2Y0SA 3E5QA 3I58A 4CZCA 2VODA 1GLNA 3DU5A 3DEEA 4IOCF 4JBAA 2XAQA 1LDKB 5IYBJ 4B44A 3FHNA 3H35A 1A36A 3PSIA 4NQWB 2ZNZA 2VQHA 5FROA 4UUSB 3LSMA 2O5RA 3TO9A 1RUNA 2HOEA 1XSVA 3ZPLA 3JR9A 2OPTA 3WTVC 3BZKA 2ZJ2A 3I4NJ 1I1SA 2HQRA 4XKBA 2LBFB 2G9WA 5HNHA 4ZDOA 4ENKA 1XS9A 1UFMA 1G3TA 4FE7A 3G73A 1X1CA 2KP6A 5BS6A 1TT0A 3BG3A 2BY2A 2JVHA 1D8KA 1RI7A 5D6FA 3NRVA 1J7KA 4XNFA 4FE4A 3K9TA 1GDTA 3RDIA 5J4VA 1D1AA 2R5YA 4WWCA 4ITVA 4W97A 2DO7A 3TW6A 2FX0A 4LLNA 3E1SA 1OFCX 4QIWN 3K4MA 3CMEI 2JSCA 4A3MJ 2A07F 2HXOA 5FFXA 3ZP5A 3KX2A 1OCOH 2OQGA 2EBIA 2HDDA 2OQRA 1ZN2A 2Y9YA 2PLYA 4HRIA 1EH7A 2FA5A 4UB6C 1C0WA 2EFOA 4MLOA 4XRSG 2DK8A 1LB2A 4A3IJ 1TC3C 1Y0UA 1BOAA 2V1UA 1KU9A 3ZGKA 2J5PA 5CQEA 5ILVA 2R4GA 2BGCA 2HZDA 3QQAA 1BJZA 1JGGA 2MBFA 2ECBA 2LRDA 2X85A 2CWEA 1A5JA 4EVIA 1ZG3A 1FMWA 2Y0SN 3FXOA 3W2WA 5L3GA 3MKZA 4H4KC 4BYYA 2P6SA 1FTTA 4XSXF 1O4XA 2X1CA 4U7BA 3DQVC 2JT1A 3BPVA 2NVQJ 4OIOF 1IXCA 1SANA 3WTWC 1JHHA 3N97A 1J9IA 4ZDLA 2CUEA 3GVAA 2KQRA 3QOEA 5HDNA 5HODA 1MW7A 2R7TA 1WGXA 2F5FA 3FXQA 2PX9A 2I10A 4XSZF 2R92J 4DBRA 1D8JA 4YRVA 4XRMA 2BE5F 4P1WA 1KONA 4DW6A 4KUMA 2XPWA 3ZMVA 1FMVA 3EUKL 4XRSA 3QYFA 4RM2A 2L02A 4OMYA 4D1QA 2VI6A 3GFMA 3CF2A 4DYCA 1MJAA 1WPKA 2EINH 5E1WA 3OYAA 5BOXA 2Z2SB 3H3VK 4KNYA 2HVRA 3I64A 3JREA 4NUBA 4JX6A 4XK4A 4HZFA 1V5GA 2G7HA 2RREA 3S3OA 4MQ9F 5ILUA 1WI9A 1R9TJ 4I2OA 2MA3A 2RNJA 3TO6A 2FBKA 2ZXJA 1YI2I 3KP7A 3FM5A 4OU0A 4A6DA 2M7AA 1N77A 2HDCA 4M6XA 4FX0A 4EV0A 5IP7J 2CW0F 1XDSA 1PUEE 1XDUA 1T0FA 3CP2A 2IXSA 2E60A 3H92A 1IDZA 1U3EM 1E3PA 4N4NB 4ZDPA 2HYJA 4M6VA 3HOUJ 4P55A 3PIPF 1FTZA 1O57A 4RAZA 4E7IA 4M9SA 4NHJA 1P6RA 3M1EA 3LSKA 4RLFA 1A35A 5FJ8J 1B9NA 3FMSA 4AC0A 1EH8A 1STZA 2KRCA 4CO8A 1R36A 3DU6A 5LLQA 2YSRA 2LP0A 3OSGA 4LFUA 1SVLA 1XGMA 5C44J 4FTHA 3OL4A 2FRHA 3NWSA 4LITA 1YRNB 3M7GA 2XGDA 3SZTA 2XAGA 3B73A 1W0UA 1IUFA 3ABLH 4XBFA 5E8GA 1RR7A 2A68F 2DA6A 5LEKA 1QA6A 3IRQA 1RUOA 3GBGA 3S1NJ 2EILH 3BPXA 4RGUA 5JVTA 1IN8A 3R0AA 4XLNF 3EUHA 1IRGA 4PGHA 1TTYA 3F8NA 4HLXA 2FF4A 1QBJA 2FU4A 2FQ4A 3CCYA 3BR1A 4BQQA 4I0BA 3P5JA 3I56I 2HNHA 4Y33A 2STWA 5FGMA 3HYIA 4B47A 3Q9SA 1LEAA 3CTAA 3DPUA 1YIJI 3ERED 3D5LA 4ZJZA 3OYNA 1MSFC 4N9HA 4KT5C 1K4TA 1O3SA 2RQPA 1R58A 4NC7A 1HKSA 3EDPA 5FKNA 2ISZA 1WH7A 2EB7A 2L01A 2DU9A 1SFKA 1TWGJ 3GFLA 4XORA 1TQMA 3X2QH 4P9UA 3SYTA 3ZN1A 5DDGA 3K4LA 3JRGA 1ACIA 4AIJA 5EG0B 2F5DA 2HTSA 4PJJA 3FXLA 3LFUA 5FD6A 3MZYA 2ZJPF 3L2CA 2HOSA 4BY7J 2XDVA 2ELJA 3BR6A 1GXQA 3QPLA 3T8TA 2VBYA 2QSFX 2FBHA 3S2HJ 1SMTA 3KETA 1G3WA 4ENJA 1S7EA 4GO1A 1K83J 2P8TA 4XN0A 1HQCA 3WTZA 5J1UA 2OZ6A 1IUYA 2VJIA 5DTDA 1VQOI 4RDUA 5IP9J 2BV6A 2X6XA 1ZGJA 5DD8A 2XAUA 3OYIA 3S16J 2XAHA 1MSEC 5DS9A 4LD5A 2X6WA 2IGKA 2BVMA 1VTNC 1QNTA 2E19A 2M8EA 3RSNA 3GX4X 4HSTA 3OYBA 3IV5A 1Y0NA 1O3TA 2A6TA 3CP8A 4C3IJ 1V3FA 2DT7B 2R7RA 1LJ9A 2DI3A 5J47A 3DBLB 3R4KA 4HF0A 1OCTC 1VQKI 3W6KB 5LHGA 2KDOA 2L9NA 5ILSA 5IOYA 2L0KA 5BQTA 1OPCA 3OYGA 1KGSA 4YIIA 2K85A 1U0JA 4PSXA 4II2A 5LGNA 3BQZA 2IVMA 2L4AA 1LVKA 1IF1A 2P81A 1YW8A 4JK1X 3G1MA 4ZYDA 1ZRCA 1BR1A 2CW7A 2VOPA 3PNYA 5HVQC 2QUFA 5GPAA 2XAFA 3DLLF 1QPMA 5ICCA 3H0DA 5F0HA 3FWEA 2ZFUA 1XX5A 2DA5A 3J81K 1SD4A 1SC7A 1GHCA 4O6JA 1D1BA 1J09A 1KYWA 2E34A 3CDLA 1F36A 3KP4A 5EG0A 2RNGA 2EA2A 1T38A 2IAIA 2EV6A 2V4JC 3NWTA 2KDZA 2R5ZB 1PP7U 3P9KA 3FBNB 4EGYA 5JFRA 2ZFWA 2KMUA 1P2FA 1KA8A 3K70D 3CC2I 2YU9J 5EEHA 2HVSA 3U21A 2KT0A 4BU2A 4FCYA 2DPDA 3L7WA 3KFWX 4PZJA 4HOBA 2RAEA 3AFHA 1LDDA 3MMYB 1FWZA 2VT2A 4BXFA 1ETYA 1WHUA 1W4MA 5KCMA 2QZ8A 4LJZF 3WG7H 4DBQA 4BE2A 4LLLA 5CPRB 4LK0F 1E2XA 3L2RA 1BI1A 2FNPA 1V5FA 2Z3YA 3MWMA 4FHTA 3P9IA 1NH3A 2DCEA 2DN0A 2M9HA 2OAZA 2WTEA 2A61A 3F8MA 2ELKA 2DQLA 4HDUA 2JA5J 2EFQA 1DDNA 2IGMA 1POGA 2CS3A 1FYMA 4I76A 2DA2A 2FXAA 1X4PA 3K7AJ 5K7FA 4XIDA 3I4MJ 2Z99A 3R60A 4M73A 4CZZA 2IP2A 4A5MA 3MQ0A 5E18F 4HX7A 5B5EC 2BY1A 2FD5A 2P5KA 4L0YB 2LTPA 5FD5A 3CO7C 2CH0A 1XSXA 1EF4A 4BS9A 2CFOA 3I3LA 3HBLA 2ZXIA 2KL4A 4OIQF 1UHSA 2R7ZJ 4A0ZA 2KIFA 2ZSHB 3HB9A 4PJLA 4BQAA 1A04A 1RR8C 2I8DA 4RGRA 3KEOA 2QLZA 4PDKA 3H36A 2XSJC 3ISPA 2XGEA 3H5RA 3KCCA 1R00A 2OTLI 3CUQA 2W24A 2XAJA 3FZVA 2ECCA 3ZQGA 3ESWB 3GMEA 2Z9OA 1OYIA 2CQKA 4ZZDA 5D8LB 1MDMB 2V6EA 5IYCJ 1EA3A 1K78B 1OCPA 2DYRH 3F72A 3CMYA 4A93J 2E7XA 3V7CA 2EFWA 3VYTB 3CC7I 2DFIA 3BTLA 1F9NA 3HKZN 3B02A 5F0CA 1MH4A 1XGSA 2M87A 3PFYA 3M9AA 5KNLA 3HTUA 1RRJA 3A0BC 4DYRA 1QU3A 3D0SA 4RB1A 1IC8A 2D45A 4E4HA 2K9SA 1HW2A 2RC4A 1LEBA 3PUBA 1A6IA 1HW1A 2W25A 4S04A 1PUFA 3H3ZA 5F1RA 1J0RA 3BR3A 3DP7A 3HPGA 2YR2A 3FXJA 4ZYAA 2PN6A 1W36D 5IYDJ 2FE3A 1R6RA 3HEFA 1IW7F 5M3FJ 3HXLA 3PO2J 3REOA 1TNSA 3RKXA 2R93J 1EKEA 1KYZA 3S3MA 4KJZA 2QQ8A 4M9ZA 2H1KA 3EUAA 4IHYA 2KHMA 3KP2A 1VNDA 2BY0A 4AIHA 2OV7A 1LFUP 3W6VA 2MD5A 2NVTJ 2JQ7A 4D9JA 3QP5A 1MBGA 3ABUA 3JW4A 5JVGF 2BEOA 2GLOA 4U87A 1G4DA 1I50J 5D5VB 4EM0B 1YS7A 3HTSB 3BR5A 3OS2A 1Z21A 3QODA 1F5TA 1XGNA 2V7FA 2XIGA 4JP0A 1YW9A 2V9PA 1DPUA 2EK5A 4G12A 5GAEJ 3D5SC 2AQFA 5LBQA 1S3JA 1B9MA 1T56A 2DMPA 4ESBA 1VQ9I 2JRMA 5TRDA 2M34A 1ZGAA 5L3DA 4ZYEA 2DOAA 1VQ7I 3E6MA 3BP8A 1VQNI 4G8XA 3V7RA 1W7PB 4L5IA 5J1YA 4KICA 3ABTA 4KIFA 5FKLA 2PEXA 1KQ0A 1APLC 3GLLA 1OMIA 4CUGA 3FXRA 1LQ1A 2QQAA 2MABA 3S1MJ 3MFKA 3L9FA 3LSTA 1ITYA 4AIDA 4C3JJ 4XN3A 3EPZA 3A03A 4Y4RA 4IHWA 5K5QA 1ZH5A 5HOOA 3TP0A 4E7SA 2B9SA 3QU3A 1NG7A 2YUSA 1J59A 3GYHX 1ZG5A 3E7LA 1P4XA 4ZZLA 3AAFA 4LG0B 1EH6A 1X19A 5EZGA 1B8IB 4AM3A 2TCTA 3HOWJ 2VE8A 3BQYA 1HBXG 3VYSB 2NVYJ 4A3KJ 1FP1D 4D7MA 4BNCA 5HLTA 2QM3A 1X4OA 3IH3A 1R71A 2JUGA 5E8IA 3OV8A 1FIPA 1GV5A 2GWRA 1NK3P 4L18B 2DOEA 4CHUA 4G6QA 2MGQA 4I7HA 3ASNH 3SFZA 4KT6A 4MEYF 4XRFA 2CRGA 3ZMSA 1Y1VJ 2DJIA 2DBBA 2MC3A 4WCGA 4ETSA 6PAXA 2MG4A 5D4SA 4EMSA 2Q8KA 4IOAF 4JX5A 5AIPA 2DDAA 4GGGA 4A2UA 4ZYHA 3K6GA 4ZH4F 2HI3A 2LKSA 2JWTA 1AOYA 3KP3A 4AYBA 5JI6A 2DFFA 1V5EA 1CQTA 3Q5FA 1W36C 4IHVA 1ULYA 2NOJB 5DM6F 1BN5A 2L5QA 1LPQA 1Z9CA 1HCRA 1MMAA 2HQ5A 1HKTA 3OL3A 2FMYA 4DIQA 1BA5A 2X6OA 5ICFA 1S9HA 1W5SA 2C6YA 1YOVB 3BC8A 3QPHA 3T5XA 1KU2A 5J8FA 3O6BB 3HOXJ 1X3WB 4PCQA 4EQQA 4A6EA 1J2XA 3AL0B 2CJJA 2XROA 2X4HA 5L3EA 3JSPA 1IGNA 4M3DA 4M3FA 5KHDA 3QYBA 4UY8I 1OCZH 3P7NA 2HU9A 2LVSA 3I9V2 2HFHA 3UKGA 4XOPA 2K7LA 2HYFA 3AG4H 5KK1A 2IS6A 2TRTA 1IN7A 3LA3A 1N25A 3B6CA 1H0MA 2COBA 1L3LA 2DMTA 1IN6A 4UUVA 1NTCA 2Z5UA 3F3XA 5H6RA 4A3EJ 1ZRFA 2ZJQF 4IZZA 2IPQX 1OKRA 2QA4I 2B63J 2XC7A 3IKTA 4O3MA 2QGUA 4P9FA 3HUGB 5HNFA 1WFXA 4AIKA 4XLAA 1IN5A 1MNDA 1O7FA 3F6OA 1VQ5I 3BWGA 5EGOB 1VQ4I 2OUMA 3W6JB 3K2AA 2A5WA 2CMPA 3K10A 2VXZA 1BW5A 4HX4A 3OS0A 2CUFA 1K61A 3CCVI 2KJBA 2BBYA 2XKPA 1R5GA 2KISA 2LKPA 2AXTC 2XV4S 4AYBN 3F8BA 1AU7A 4L5JA 3ZQQA 5E1XA 4II3A 3UNGC 2WY7Q 2ZMEB 4C3HJ 4J19A 1ETKA 2DT6A 1UELB 1RIOH 4BACA 2DJNA 4A3FJ 2E5ZA 2XHKA 1P9QC 2X0LA 2LDUA 4LGWA 2L7ZA 3QP6A 1X1BA 4YFKF 1HF0A 3HSRA 2M1BA 4IQJA 4XQFA 2K4JA 1ETOA 3KLNA 3OR1C 4PUSA 3MKLA 4XKVA 3RZOJ 3TBIA 5EF6A 1E3OC 2F4MB 1LDJA 2H6CA 1BI0A 3IH4A 2Q1ZB 1YFHA 3O2PE 1Q1HA 5IY5H 2P4WA 1SFUA 3M07A 3J7YJ 5A2QK 1S7AA 1AA7A 1FEXA 4NB5A 1QPIA 2JA2A 3Q9VA 2JUCA 4NBQA 2LBFA 1WQ2A 1ZLJA 3L2VA 3M8JA 1USTA 1G8XA 3NEUA 4OAYA 3ZMTA 3ZQIA 3RYPA 4ZC3A 3J7AO 3HOSA 3HG9A 3DEWA 3K4NA 3EUHC 2V26A 2DOFA 1XC5A 3SEQA 1QQIA 3LQRA 5DEQA 4G9YA 2Q2EA 3MN2A 3AG3H 5DV5A 3ZQHA 1JJ8C 3BTCA 1X58A 1OJLA 2E71A 3E5UA 1Q1VA 2DFEA 2HVQA 4RM3A 3RI4A 2OF7A 3AG1H 2PG4A 3KZZA 5E3OA 4ESJA 2H6BA 2YX4A 3TOBA 3PO3J 4O5VA 5E17F 4IL6C 3K1PA 5ICEA 2QENA 3VOEA 2VPLA 2M30A 4MTDA 3FHZA 1D0YA 2IRFG 2H94A 1VQPI 2JMWA 2VQCA 2IW5A 2L7FP 2HYGD 1L0OC 3U9GA 3ZN0A 5H2FC 1K4SA 4XMYA 4NNJA 3RJPA 4EM2A 2DMUA 1BC8C 3S15J 4BXXJ 1E0EA 4RGSA 3WTTC 2MYSA 4HPQA 5CVRA 2A3SA 1FOKA 3A1YA 4M3BA 1IZ1A 4E7HA 5HLGA 3BCBA 3OY9A 2H8RA 4BQNA 2X48A 3OYEA 2ZBKA 1SVOA 2UXNA 1FT9A 2MH9A 2W48A 3I5UA 4UV9A 3RPUA 3LMMA 1O3QA 4UVBA 4Q5SF 2VQGA 1GVDA 1TWCJ 3TW7A 1S29A 1FSEA 1Y8QB 3ZOBA 1ONVA 3E97A 1S5LC 1FSHA 2KPMA 2VL8A 1JXSA 4BEHB 5EEGA 3BR2A 5DD4A 2RVCA 2OTJI 2JZYA 4RA2A 3HC7A 4YEJA 3C7JA 3GTMJ 2WAFA 5FKOA 1P7IA 2KKOA 5L3FA 2WAEA 5FLVA 3DTEA 3DBRB 3TL4X 2RN7A 1Y8RB 4CCJA 2VJJA 5C4JJ 2GM4A 4IKFA 3JRDA 2VQLA 5JLXA 2PBIA 5GPCA 5D4RA 2BXYA 1O3RA 3KLOA 2ESNA 4EJVA 4B1RA 4HLYA 3K4KA 3EQLF 3JTHA 2COMA 1MH3A 2VT3A 1LNWA 5BMZA 2DMQA 4D5FA 2KIQA 2P7VB 1DGRM 3LSIA 4KIBA 1X1DA 2M5WA 2WAQA 3V8LA 4F7ZA 2O0YA 4HG2A 4HV6A 2NOGA 3CUOA 3K4BA 1WWXA 1KQ8A 1MMDA 1QZYA 2CV2A 1WJ5A 1HW5A 2LF8A 3GTLJ 1TQPA 3Q0VA 3M1CA 1JT0A 3RPUD 1N78A 5CKTA 2HKOA 2VB6A 3K1NA 2WA0A 3SZPA 3RTRA 3G71I 4G6TB 4Q4ZF 1Z1DA 2HDWA 1QGPA 3DFGA 3WGHA 2DA3A 1F4KA 2GAUA 2CSOA 3BROA 2HS5A 4GXOA 3OYFA 4YELA 3K4JA 1E17A 4RMNA 1JGSA 3BLYA 4XKWA 2QKMB 4QSHA 5TGTA 3S2DJ 1WKMA 5IPAA 5H6QA 2Y9ZA 2ADUA 3FXKA 1K79A 1S6LA 3W3CA 1VQ6I 4U0VA 2VKEA 2KRHA 5BPIA 3E0JB 3E3VA 1X2NA 5CLSA 2WADA 2VN2A 2UWMA 2M2EA 2G0EA 5IP6A 2P6TA 2L2OA 3HRTA 1PYVA 3BJAA 5M3MJ 2LY1A 1XB4A 5M5WJ 1IO2A 2F6CA 1Y6IA 5K7HA 4E7LA 1MBKA 3JAMZ 4NQWA 3TP3A 4GYGA 4UUSA 4WXDA 1KQ9A 1XPXA 1Z67A 3CJTB 5LGTA 2FNAA 1GV2A 2V1DA 3RKWA 2XSDC 2FBIA 2HTJA 3LQQA 2UV1A 2HKXA 3OOPA 1U9NA 3BT9A 4GDFA 4KN7X 1JE8A 4I02A 2XF6A 2JN6A 4DGWB 1U5TB 2VPRA 3FISA 3HGYA 3GTKJ 1FY7A 2E2IJ 1B72A 2JA6J 4V2GA 4S05A 4OIPF 2QSGX 2NNNA 2ZNYA 5JR3A 3LAPA 2N8GA 3JRHA 1BOBA 2AHQA 1PVEA
chains in the Genus database with same CATH topology
1MJBA 3LAJA 2CFXA 1T98A 1D3YA 4HDVA 1FC3A 3FMRA 4KMUX 3I59B 4ENNA 5ERIA 3F8FA 4KYWA 1ZREA 1SFEA 3FM3A 1DPRA 2XKOA 2YX7A 2P5VA 3GWZA 4P96A 2R7FA 1TW3A 5CYVA 1R1VA 2H09A 4PGGA 1ZARA 4R1HA 5LEJA 3H3UA 2FOKA 5J8CA 2V1XA 1FZPB 4IRHA 1XCBA 3HHGA 4G94A 4OIRF 3V8KA 1BM9A 2KJCA 2IJLA 4HA8A 4LMYA 2ESHA 2DK5A 4BHBA 5ED4A 2JTVA 1B1BA 3TKYA 4B09A 2K27A 1I6XA 1FBSA 2EWNA 4UV8A 2F5EA 2GIVA 4EGZA 3LWFA 2DT5A 4MQVA 2O03A 4HQMA 4CGZA 1OR7A 1GXPA 2QVOA 4DQ2A 2QBYA 2UXXA 1U2WA 2HWVA 2MH2A 1GVJA 2Y75A 4U88A 2WC2A 3IWFA 1BBYA 1F1ZA 2D1HA 3JAMK 4RAYA 1SFXA 2RV8A 2K86A 1FLIA 3FMQA 3DV8A 1FX7A 4LB5A 4CDGA 2K4BA 2A5YB 5FB2A 1XSDA 5DUKA 2RDPA 4A0YA 3DEUA 4GYIA 3ECOA 4IRIA 3ZMDA 3QPTA 3V4GA 3GFIA 4WXHA 5KVRA 4G7OF 5FLXK 1WRJA 1BJAA 5D5XB 2DAOA 2QYOA 3HSFA 4N0BA 2PI0A 2ZCWA 4H0EA 4OMZA 3DKWA 4RGXA 1MKMA 2ELHA 3HUGA 4M6YA 3ML6A 1ODDA 3I0TA 2LSOA 1MDMA 1U8RA 4DNCA 3IC7A 4Q47A 2A69F 2LF7A 2GA2A 1RNLA 5CJ9A 1YG2A 3GFJA 1ON2A 5HDKA 1XN7A 3R0JA 3C3WA 4AVPA 4L9JA 5DCFA 3J81Z 2R7DA 2QQBA 3F21A 1MGTA 4Q48A 2GQQA 4HAMA 2DPUA 1CF7A 5DYMA 2IA2A 3PFIA 3R61A 2F5CA 2KIUA 3BZ6A 3GUDA 3LA7A 1UCRA 1XGOA 2Q0OA 3FF5A 1TNTA 4Y17A 3GZ5A 2A6HF 4RB3C 4JQFA 1R23A 1W7PD 3CUQC 4LLGF 4EJOA 1BI3A 1TLHB 4QLCU 4BH9A 3ZMUA 4IRGA 5A2QZ 3P9CA 4LK1F 3KEQA 2PMHA 2ZKZA 2OU2A 3NQOA 4ASNA 4ESFA 2Y0MA 5DUIA 2OZUA 3GF2A 1HKQA 1SD5A 3LFKA 2W84A 4D0PA 2H27A 3K69A 3ULQB 5FLXZ 4YG2F 1S7OA 2HR3A 2NNYA 2GXGA 5DCMB 1QZZA 1QO0D 3CO6C 3WG9A 4U0YA 3F22A 4UVAA 5L3CA 1CF7B 4YFNF 2Y48A 4HW0A 4LG0A 3JTGA 3F23A 1K78A 1YYVA 2YU3A 3SHFA 4L9NA 2VBZA 3HRUA 1ZRDA 2PFBA 1I5ZA 4WF2A 3HRMA 2DTRA 5IT9Z 1MD0A 2ACJA 1IXRC 3F6VA 1P4WA 1ZYRF 3WE3A 4B8XA 5E20A 4WX9A 1D5VA 3HSEA 3T0YA 4IVNA 2XGXA 2VBWA 2P5LC 1U6GA 3WODF 1O7LA 4UXNA 3I4PA 2MLKA 3FX3A 1KU3A 5D8KB 3K1MA 2V79A 3VB2A 5D6EA 1Z91A 2G7UA 1DP7P 5IT3A 3MZHA 3CLOA 2IA0A 2XVCA 3MAJA 1BIAA 2CGPA 1T39A 3IRRA 1HSJA 1T6SA 2VOOA 1P4AA 1IN4A 2ZO4A 2JPCA 3VODA 1Z05A 4WXCA 5CVUA 3ZMZA 4IPAA 1Z7UA 4HV5A 5IT9K 4MEXF 1W7PA 2AXLA 5FFZA 4MGRA 1U5TA 1T2KA 4CYDA 1YLFA 2V6CA 3EETA 5K1YA 4BXUA 3L00A 1XCVA 4HBLA 4HF2A 1R22A 2MLGA 1YW7A 5JHUA 2DQRA 2FMLA 5AIQA 3ROUA 1W5TA 3SQNA 2L54A 2O8XA 4BAYA 4ENMA 1R7JA 1UB9A 1WSUA 3QOPA 3V8JA 4HYEA 1Z6RA 3DPLC 2NS0A 3U2RA 2STTA 3K0LA 4IHSA 2A6EF 4Y13A 3QRFF 5J6XA 2E1CA 3TOAA 2WWYA 4U0WA 3I59A 3RKYA 3GO5A 1SD7A 3QU6A 3GEZA 3GLXA 2CG4A 2EA4A 4XLPF 2NYXA 2IA1A 4RB0A 1G3YA 1R1TA 2JRTA 3I54A 3WTUC 3BOQA 1K7AA 4U7DA 2VONA 1BIBA 2VBXA 4EM1A 4KN4X 3GW2A 4OINF 2E1NA 3WU0A 2OA4A 3CUQB 1PP8F 4I01A 1DUXC 1PDNC 1K6OA 1Z6TA 1YO5C 4AWXB 4LB6B 4UVCA 5H20A 3EYYA 3F8CA 2E7WA 4EJWA 1FNNA 1J75A 1UHWA 3R6SA 1YS6A 1REPC 4QWQA 5K5OA 2XRNA 4YIFA 4OOIA 3VFZA 5D5UB 3HOTA 2WV0A 2JPBA 2DW4A 1U78A 3JSOA 1FP2A 5LRRA 4IHTA 5F6FA 2HZTA 4UHTA 1AWCA 2W85A 4Z2YA 2L4MA 2HGCA 4BHPA 1H9GA 3BJ6A 5FO5A 1LVAA 3GZ6A 1MJ9A 1G6NA 2PQ8A 3K2ZA 3HIFA 4R79A 3IL2A 3GXOA 2Z33A 1MZBA 1FBQA 2FEZA 2OBPA 3J80K 3KP6A 5LGUA 4M74A 1JHFA 3E6DA 3PQJA 4I0AA 2J5OA 3M8EA 1HXDA 3IWZA 3E5XA 3TDUC 5ICGA 3N4MA 1FYKA 1XD7A 3HRSA 2NAZA 1IXSB 1TBXA 4G7ZF 1ZHFA 3RYRA 5AONA 3SXYA 3TO7A 2D1VA 3C1DA 3IKVA 3T1BA 4A0XA 3E6BA 3RPQA 4L9TA 2VC0A 5HLHA 4ZYGA 2P7CB 3CDHA 2O61A 4EJTA 1FBUA 4KDPA 3DPTA 1J5YA 5LHHA 1TW2A 4HF1A 1NHAA 2EFPA 1SMYF 1BI2A 2EJRA 5CVVA 2M45A 5D5WB 5DCMA 3DF8A 5HS8A 2ISYA 3J80Z 5BPDA 1B6AA 2TDXA 5F64A 3RIRA 3KE2A 2KIMA 4G6DA 5CVIA 1CGPA 2QBYB 3LA2A 1ZAOA 2CO5A 3T8RA 4EJUA 2RKHA 4M72A 1YTYA 2AS5F 3KP5A 4L9VA 2EV0A 2F2EA 4HX8A 3WGGA 2LNBA 4FT8A 5L3BA 1U5TC 5E1ZB 3TDZC 2VE9A 4GCVA 4CICA 4A12A 3WTYC 3E6CC 3L09A 4KFCA 4KA4A 4G7HF 3BY6A 3BJOA 3ELKA 3S2WA 1XMAA 4M71A 4AD9A 1R1UA 1FPQA 3WTSC 3I53A 5K5RA 1I1GA 3G3ZA 2KRFA 4M9XA 2PMUA 3EYIA 1FYLA 3V7SA 3VEPA 4E70A 3ECHA 1EV7A 4HQEA 1G3SA 2UZKA 5CVJA 4IJAA 1UHMA 4CXFA 3BDDA 1HSTA 4FX4A 5TJJA 2L3DA 1USSA 2ZMEA 3PQKA 3WTXC 3TQNA 3C18A 1B4AA 1IAWA 1TQIA 5HS9A 1X3UA 2K02A 2BYVE 5LHIA 2DLLA 2GZWA 1ZG1A 1BC7C 2W57A 4IXAA 3U1DA 3ZQ7A 3CJNA 3I71A 4IF4A 2VC1A 4R8HA 4N9IA 2O6GE 3M8FA 1RZ4A 1I27A 3WGIA 3FXUA 4BHCA 2EFNA 1H9TA 4TV7A 1YIOA 2R3SA 4Y15A 4MTEA 1V4RA 4I09A 1SAXA 2HEOA 4A5NA 3COAC 3WU1B 1R5HA 4K2EA 4RB2C 2FQ3A 5HLIA 1ZLKA 4WK8F 2B0LA 1P92A 4I98B 3QAHA 4P5OA 2PJPA 2ETHA 5HS7A 1ON1A 1XMKA 2XASA 5HDGA 2NRAC 2IT0A 1OYWA 2RGVA 4KMFA 2QWWA 1IRFA 2YPRA 1KU7A 2GA1A 2OD5A 2GXBA 3TGNA 5LRSA 3HHHA 2EV5A 4KIGA 1SD6A 3DXJF 4ON0A 4MHGA 2D2WA 3IHUA 4RS8A 4MNUA 2O3FA 3O3KA 2FSWA 4L0ZB 2QQ9A 3MEXA 1OYYA 4YFXF 3WE2A 3MCZA 4UNOA 2CYYA 2V9VA 1S8NA 2HQNA 3KZYA 1B59A 2XUBA 1YQAA 2VODA 3E5QA 3I58A 4JBAA 2XAQA 1LDKB 2ZNZA 3TO9A 1RUNA 2HOEA 1XSVA 3ZPLA 3WTVC 2ZJ2A 1I1SA 2HQRA 2G9WA 4ENKA 1UFMA 1G3TA 3G73A 5BS6A 1D8KA 1RI7A 5D6FA 3NRVA 1J7KA 3K9TA 3RDIA 4WWCA 2DO7A 4LLNA 2JSCA 2A07F 5FFXA 3ZP5A 2OQGA 2OQRA 1ZN2A 2PLYA 1EH7A 2FA5A 1C0WA 2EFOA 2DK8A 1LB2A 1Y0UA 1BOAA 2V1UA 1KU9A 2J5PA 5ILVA 2BGCA 2MBFA 2CWEA 4EVIA 1ZG3A 5L3GA 4BYYA 2P6SA 4XSXF 4U7BA 3DQVC 2JT1A 3BPVA 4OIOF 1IXCA 3WTWC 3N97A 1JHHA 1J9IA 3GVAA 5HDNA 2F5FA 3FXQA 4XSZF 1D8JA 2BE5F 4KUMA 3ZMVA 2L02A 4OMYA 3GFMA 1MJAA 5E1WA 5BOXA 4KNYA 3I64A 4HZFA 2G7HA 4MQ9F 5ILUA 1WI9A 4I2OA 2MA3A 2RNJA 3TO6A 2FBKA 2ZXJA 3KP7A 3FM5A 4OU0A 4A6DA 2HDCA 4M6XA 4FX0A 4EV0A 2CW0F 1XDSA 1PUEE 1XDUA 1T0FA 3H92A 1U3EM 4P55A 1O57A 4RAZA 4M9SA 4NHJA 1P6RA 3M1EA 1B9NA 3FMSA 1EH8A 1STZA 4CO8A 1R36A 5LLQA 2YSRA 4LFUA 1XGMA 2FRHA 3M7GA 3SZTA 2XAGA 3B73A 4XBFA 5E8GA 2A68F 5LEKA 3IRQA 1RUOA 3BPXA 4RGUA 5JVTA 1IN8A 3R0AA 4XLNF 3EUHA 1IRGA 4PGHA 1TTYA 3F8NA 4HLXA 2FF4A 1QBJA 2FU4A 4I0BA 2STWA 5FGMA 3HYIA 3Q9SA 1LEAA 3CTAA 3ERED 3D5LA 4N9HA 4KT5C 1O3SA 2RQPA 1R58A 1HKSA 3EDPA 2ISZA 2EB7A 2L01A 2DU9A 3GFLA 1TQMA 4P9UA 3ZN1A 5DDGA 4AIJA 2F5DA 2HTSA 5FD6A 3MZYA 3L2CA 1GXQA 3T8TA 2VBYA 2FBHA 1SMTA 3KETA 1G3WA 4ENJA 4GO1A 2P8TA 1HQCA 3WTZA 2OZ6A 1IUYA 2BV6A 1ZGJA 5DD8A 2XAHA 4LD5A 1VTNC 1QNTA 2M8EA 3GX4X 1O3TA 1V3FA 1LJ9A 2DI3A 3R4KA 4HF0A 3W6KB 5LHGA 5ILSA 5BQTA 1OPCA 1KGSA 4YIIA 5LGNA 2IVMA 2L4AA 1IF1A 1YW8A 4JK1X 4ZYDA 1ZRCA 2VOPA 5HVQC 2QUFA 2XAFA 1QPMA 5ICCA 3FWEA 3J81K 1SD4A 1GHCA 4O6JA 1KYWA 3KP4A 2EA2A 1T38A 2EV6A 1PP7U 3P9KA 4EGYA 5JFRA 2ZFWA 1P2FA 1KA8A 5EEHA 2DPDA 3L7WA 3KFWX 4PZJA 4HOBA 1LDDA 1FWZA 2VT2A 1W4MA 2QZ8A 4LJZF 4LLLA 4LK0F 1E2XA 1BI1A 2FNPA 2Z3YA 3MWMA 4FHTA 3P9IA 2OAZA 2WTEA 2A61A 3F8MA 2DQLA 4HDUA 2EFQA 1DDNA 1FYMA 2FXAA 2Z99A 3R60A 4M73A 4CZZA 2IP2A 4A5MA 3MQ0A 5E18F 4HX7A 4L0YB 2P5KA 5FD5A 3CO7C 1XSXA 4OIQF 4A0ZA 2KIFA 4BQAA 1A04A 4RGRA 3KEOA 2QLZA 4PDKA 3ISPA 3KCCA 1R00A 3CUQA 2W24A 2XAJA 3FZVA 2Z9OA 1OYIA 2CQKA 4ZZDA 5D8LB 1MDMB 1K78B 3F72A 2E7XA 3V7CA 2EFWA 2DFIA 1F9NA 3B02A 1XGSA 2M87A 3M9AA 3HTUA 3D0SA 4RB1A 2D45A 1HW2A 2RC4A 1LEBA 1HW1A 2W25A 4S04A 3H3ZA 5F1RA 1J0RA 3DP7A 2YR2A 2PN6A 2FE3A 1IW7F 3REOA 1TNSA 3RKXA 1KYZA 4M9ZA 3KP2A 4AIHA 2MD5A 3QP5A 3ABUA 3JW4A 2BEOA 1G4DA 5D5VB 4EM0B 1YS7A 3HTSB 1F5TA 1XGNA 2XIGA 1YW9A 1DPUA 2EK5A 5LBQA 1S3JA 1B9MA 4ESBA 5TRDA 1ZGAA 5L3DA 4ZYEA 3E6MA 3BP8A 4G8XA 3V7RA 1W7PB 4L5IA 4KICA 3ABTA 4KIFA 2PEXA 1KQ0A 1OMIA 3FXRA 1LQ1A 2QQAA 3MFKA 3L9FA 3LSTA 5K5QA 1ZH5A 5HOOA 3QU3A 1J59A 3GYHX 1ZG5A 1P4XA 4ZZLA 3AAFA 4LG0B 1EH6A 2VE8A 1HBXG 1FP1D 4BNCA 2QM3A 5E8IA 3OV8A 2GWRA 4L18B 4CHUA 4G6QA 4I7HA 3SFZA 4MEYF 4XRFA 3ZMSA 2DBBA 2MC3A 4WCGA 4ETSA 6PAXA 5D4SA 4EMSA 2Q8KA 5AIPA 4GGGA 4A2UA 4ZYHA 4ZH4F 1AOYA 3KP3A 5JI6A 3Q5FA 1ULYA 1BN5A 1Z9CA 1HKTA 2FMYA 5ICFA 1W5SA 2C6YA 3QPHA 3T5XA 1KU2A 5J8FA 3O6BB 4PCQA 4EQQA 4A6EA 1J2XA 2XROA 2X4HA 5L3EA 3JSPA 3P7NA 2HFHA 2K7LA 2HYFA 5KK1A 1IN7A 3LA3A 1H0MA 1L3LA 1IN6A 4UUVA 2Z5UA 3F3XA 5H6RA 1ZRFA 2IPQX 1OKRA 3IKTA 4O3MA 4P9FA 4AIKA 1IN5A 3F6OA 1O7FA 3BWGA 3W6JB 2VXZA 4HX4A 2KJBA 2BBYA 2XKPA 1R5GA 2LKPA 2XV4S 3F8BA 4L5JA 5E1XA 2ZMEB 1RIOH 2XHKA 2X0LA 2LDUA 4LGWA 4YFKF 3QP6A 3HSRA 2M1BA 2K4JA 3KLNA 1LDJA 2H6CA 1BI0A 1YFHA 3O2PE 1Q1HA 2P4WA 1SFUA 5A2QK 1S7AA 4NB5A 3Q9VA 1WQ2A 1ZLJA 1USTA 3NEUA 3ZMTA 3RYPA 3J7AO 3HOSA 1QQIA 3LQRA 5DEQA 4G9YA 2Q2EA 5DV5A 3E5UA 3RI4A 2PG4A 3KZZA 4ESJA 2H6BA 2YX4A 3TOBA 4O5VA 5E17F 3K1PA 5ICEA 2QENA 3VOEA 2M30A 4MTDA 3FHZA 2IRFG 2H94A 2IW5A 2HYGD 1L0OC 3U9GA 3ZN0A 3RJPA 4EM2A 1BC8C 4RGSA 3WTTC 5CVRA 2A3SA 1FOKA 1IZ1A 5HLGA 2ZBKA 2UXNA 1FT9A 2MH9A 3I5UA 3RPUA 4UV9A 1O3QA 4UVBA 4Q5SF 1S29A 1FSEA 1ONVA 3E97A 1FSHA 1JXSA 5EEGA 5DD4A 2RVCA 2JZYA 3C7JA 2KKOA 5L3FA 2RN7A 2PBIA 5D4RA 1O3RA 3KLOA 2ESNA 4EJVA 4HLYA 3EQLF 3JTHA 2COMA 2VT3A 1LNWA 5BMZA 2P7VB 4KIBA 3V8LA 2M5WA 4F7ZA 2O0YA 4HV6A 3CUOA 1WWXA 1KQ8A 1QZYA 1HW5A 2LF8A 1TQPA 3SZPA 2HKOA 3K1NA 3RTRA 4Q4ZF 1Z1DA 3DFGA 1QGPA 3WGHA 1F4KA 2GAUA 2CSOA 3BROA 2HS5A 4GXOA 1E17A 1JGSA 1WKMA 5H6QA 2ADUA 1K79A 1S6LA 4U0VA 5BPIA 3E3VA 5CLSA 2VN2A 2UWMA 2P6TA 3HRTA 3BJAA 1XB4A 3JAMZ 4NQWA 4GYGA 4WXDA 1KQ9A 5LGTA 2FNAA 2V1DA 3RKWA 2FBIA 2HTJA 3LQQA 2HKXA 3OOPA 4KN7X 1JE8A 4I02A 1U5TB 1FY7A 4OIPF 4S05A 2NNNA 2ZNYA 5JR3A 3LAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJB A;  3LAJ A;  2CFX A;  1T98 A;  1D3Y A;  4HDV A;  1FC3 A;  3FMR A;  4KMU X;  3I59 B;  4ENN A;  5ERI A;  3F8F A;  4KYW A;  1ZRE A;  1SFE A;  3FM3 A;  1DPR A;  2XKO A;  2YX7 A;  2P5V A;  3GWZ A;  4P96 A;  2R7F A;  1TW3 A;  5CYV A;  1R1V A;  2H09 A;  4PGG A;  1ZAR A;  4R1H A;  5LEJ A;  3H3U A;  2FOK A;  5J8C A;  2V1X A;  1FZP B;  4IRH A;  1XCB A;  3HHG A;  4G94 A;  4OIR F;  3V8K A;  1BM9 A;  2KJC A;  2IJL A;  4HA8 A;  4LMY A;  2ESH A;  2DK5 A;  4BHB A;  5ED4 A;  2JTV A;  1B1B A;  3TKY A;  4B09 A;  2K27 A;  1I6X A;  1FBS A;  2EWN A;  4UV8 A;  2F5E A;  2GIV A;  4EGZ A;  3LWF A;  2DT5 A;  4MQV A;  2O03 A;  4HQM A;  4CGZ A;  1OR7 A;  1GXP A;  2QVO A;  4DQ2 A;  2QBY A;  2UXX A;  1U2W A;  2HWV A;  2MH2 A;  1GVJ A;  2Y75 A;  4U88 A;  2WC2 A;  3IWF A;  1BBY A;  1F1Z A;  2D1H A;  3JAM K;  4RAY A;  1SFX A;  2RV8 A;  2K86 A;  1FLI A;  3FMQ A;  3DV8 A;  1FX7 A;  4LB5 A;  4CDG A;  2K4B A;  2A5Y B;  5FB2 A;  1XSD A;  5DUK A;  2RDP A;  4A0Y A;  3DEU A;  4GYI A;  3ECO A;  4IRI A;  3ZMD A;  3QPT A;  3V4G A;  3GFI A;  4WXH A;  5KVR A;  4G7O F;  5FLX K;  1WRJ A;  1BJA A;  5D5X B;  2DAO A;  2QYO A;  3HSF A;  4N0B A;  2PI0 A;  2ZCW A;  4H0E A;  4OMZ A;  3DKW A;  4RGX A;  1MKM A;  2ELH A;  3HUG A;  4M6Y A;  3ML6 A;  1ODD A;  3I0T A;  2LSO A;  1MDM A;  1U8R A;  4DNC A;  3IC7 A;  4Q47 A;  2A69 F;  2LF7 A;  2GA2 A;  1RNL A;  5CJ9 A;  1YG2 A;  3GFJ A;  1ON2 A;  5HDK A;  1XN7 A;  3R0J A;  3C3W A;  4AVP A;  4L9J A;  5DCF A;  3J81 Z;  2R7D A;  2QQB A;  3F21 A;  1MGT A;  4Q48 A;  2GQQ A;  4HAM A;  2DPU A;  1CF7 A;  5DYM A;  2IA2 A;  3PFI A;  3R61 A;  2F5C A;  2KIU A;  3BZ6 A;  3GUD A;  3LA7 A;  1UCR A;  1XGO A;  2Q0O A;  3FF5 A;  1TNT A;  4Y17 A;  3GZ5 A;  2A6H F;  4RB3 C;  4JQF A;  1R23 A;  1W7P D;  3CUQ C;  4LLG F;  4EJO A;  1BI3 A;  1TLH B;  4QLC U;  4BH9 A;  3ZMU A;  4IRG A;  5A2Q Z;  3P9C A;  4LK1 F;  3KEQ A;  2PMH A;  2ZKZ A;  2OU2 A;  3NQO A;  4ASN A;  4ESF A;  2Y0M A;  5DUI A;  2OZU A;  3GF2 A;  1HKQ A;  1SD5 A;  3LFK A;  2W84 A;  4D0P A;  2H27 A;  3K69 A;  3ULQ B;  5FLX Z;  4YG2 F;  1S7O A;  2HR3 A;  2NNY A;  2GXG A;  5DCM B;  1QZZ A;  1QO0 D;  3CO6 C;  3WG9 A;  4U0Y A;  3F22 A;  4UVA A;  5L3C A;  1CF7 B;  4YFN F;  2Y48 A;  4HW0 A;  4LG0 A;  3JTG A;  3F23 A;  1K78 A;  1YYV A;  2YU3 A;  3SHF A;  4L9N A;  2VBZ A;  3HRU A;  1ZRD A;  2PFB A;  1I5Z A;  4WF2 A;  3HRM A;  2DTR A;  5IT9 Z;  1MD0 A;  2ACJ A;  1IXR C;  3F6V A;  1P4W A;  1ZYR F;  3WE3 A;  4B8X A;  5E20 A;  4WX9 A;  1D5V A;  3HSE A;  3T0Y A;  4IVN A;  2XGX A;  2VBW A;  2P5L C;  1U6G A;  3WOD F;  1O7L A;  4UXN A;  3I4P A;  2MLK A;  3FX3 A;  1KU3 A;  5D8K B;  3K1M A;  2V79 A;  3VB2 A;  5D6E A;  1Z91 A;  2G7U A;  1DP7 P;  5IT3 A;  3MZH A;  3CLO A;  2IA0 A;  2XVC A;  3MAJ A;  1BIA A;  2CGP A;  1T39 A;  3IRR A;  1HSJ A;  1T6S A;  2VOO A;  1P4A A;  1IN4 A;  2ZO4 A;  2JPC A;  3VOD A;  1Z05 A;  4WXC A;  5CVU A;  3ZMZ A;  4IPA A;  1Z7U A;  4HV5 A;  5IT9 K;  4MEX F;  1W7P A;  2AXL A;  5FFZ A;  4MGR A;  1U5T A;  1T2K A;  4CYD A;  1YLF A;  2V6C A;  3EET A;  5K1Y A;  4BXU A;  3L00 A;  1XCV A;  4HBL A;  4HF2 A;  1R22 A;  2MLG A;  1YW7 A;  5JHU A;  2DQR A;  2FML A;  5AIQ A;  3ROU A;  1W5T A;  3SQN A;  2L54 A;  2O8X A;  4BAY A;  4ENM A;  1R7J A;  1UB9 A;  1WSU A;  3QOP A;  3V8J A;  4HYE A;  1Z6R A;  3DPL C;  2NS0 A;  3U2R A;  2STT A;  3K0L A;  4IHS A;  2A6E F;  4Y13 A;  3QRF F;  5J6X A;  2E1C A;  3TOA A;  2WWY A;  4U0W A;  3I59 A;  3RKY A;  3GO5 A;  1SD7 A;  3QU6 A;  3GEZ A;  3GLX A;  2CG4 A;  2EA4 A;  4XLP F;  2NYX A;  2IA1 A;  4RB0 A;  1G3Y A;  1R1T A;  2JRT A;  3I54 A;  3WTU C;  3BOQ A;  1K7A A;  4U7D A;  2VON A;  1BIB A;  2VBX A;  4EM1 A;  4KN4 X;  3GW2 A;  4OIN F;  2E1N A;  3WU0 A;  2OA4 A;  3CUQ B;  1PP8 F;  4I01 A;  1DUX C;  1PDN C;  1K6O A;  1Z6T A;  1YO5 C;  4AWX B;  4LB6 B;  4UVC A;  5H20 A;  3EYY A;  3F8C A;  2E7W A;  4EJW A;  1FNN A;  1J75 A;  1UHW A;  3R6S A;  1YS6 A;  1REP C;  4QWQ A;  5K5O A;  2XRN A;  4YIF A;  4OOI A;  3VFZ A;  5D5U B;  3HOT A;  2WV0 A;  2JPB A;  2DW4 A;  1U78 A;  3JSO A;  1FP2 A;  5LRR A;  4IHT A;  5F6F A;  2HZT A;  4UHT A;  1AWC A;  2W85 A;  4Z2Y A;  2L4M A;  2HGC A;  4BHP A;  1H9G A;  3BJ6 A;  5FO5 A;  1LVA A;  3GZ6 A;  1MJ9 A;  1G6N A;  2PQ8 A;  3K2Z A;  3HIF A;  4R79 A;  3IL2 A;  3GXO A;  2Z33 A;  1MZB A;  1FBQ A;  2FEZ A;  2OBP A;  3J80 K;  3KP6 A;  5LGU A;  4M74 A;  1JHF A;  3E6D A;  3PQJ A;  4I0A A;  2J5O A;  3M8E A;  1HXD A;  3IWZ A;  3E5X A;  3TDU C;  5ICG A;  3N4M A;  1FYK A;  1XD7 A;  3HRS A;  2NAZ A;  1IXS B;  1TBX A;  4G7Z F;  1ZHF A;  3RYR A;  5AON A;  3SXY A;  3TO7 A;  2D1V A;  3C1D A;  3IKV A;  3T1B A;  4A0X A;  3E6B A;  3RPQ A;  4L9T A;  2VC0 A;  5HLH A;  4ZYG A;  2P7C B;  3CDH A;  2O61 A;  4EJT A;  1FBU A;  4KDP A;  3DPT A;  1J5Y A;  5LHH A;  1TW2 A;  4HF1 A;  1NHA A;  2EFP A;  1SMY F;  1BI2 A;  2EJR A;  5CVV A;  2M45 A;  5D5W B;  5DCM A;  3DF8 A;  5HS8 A;  2ISY A;  3J80 Z;  5BPD A;  1B6A A;  2TDX A;  5F64 A;  3RIR A;  3KE2 A;  2KIM A;  4G6D A;  5CVI A;  1CGP A;  2QBY B;  3LA2 A;  1ZAO A;  2CO5 A;  3T8R A;  4EJU A;  2RKH A;  4M72 A;  1YTY A;  2AS5 F;  3KP5 A;  4L9V A;  2EV0 A;  2F2E A;  4HX8 A;  3WGG A;  2LNB A;  4FT8 A;  5L3B A;  1U5T C;  5E1Z B;  3TDZ C;  2VE9 A;  4GCV A;  4CIC A;  4A12 A;  3WTY C;  3E6C C;  3L09 A;  4KFC A;  4KA4 A;  4G7H F;  3BY6 A;  3BJO A;  3ELK A;  3S2W A;  1XMA A;  4M71 A;  4AD9 A;  1R1U A;  1FPQ A;  3WTS C;  3I53 A;  5K5R A;  1I1G A;  3G3Z A;  2KRF A;  4M9X A;  2PMU A;  3EYI A;  1FYL A;  3V7S A;  3VEP A;  4E70 A;  3ECH A;  1EV7 A;  4HQE A;  1G3S A;  2UZK A;  5CVJ A;  4IJA A;  1UHM A;  4CXF A;  3BDD A;  1HST A;  4FX4 A;  5TJJ A;  2L3D A;  1USS A;  2ZME A;  3PQK A;  3WTX C;  3TQN A;  3C18 A;  1B4A A;  1IAW A;  1TQI A;  5HS9 A;  1X3U A;  2K02 A;  2BYV E;  5LHI A;  2DLL A;  2GZW A;  1ZG1 A;  1BC7 C;  2W57 A;  4IXA A;  3U1D A;  3ZQ7 A;  3CJN A;  3I71 A;  4IF4 A;  2VC1 A;  4R8H A;  4N9I A;  2O6G E;  3M8F A;  1RZ4 A;  1I27 A;  3WGI A;  3FXU A;  4BHC A;  2EFN A;  1H9T A;  4TV7 A;  1YIO A;  2R3S A;  4Y15 A;  4MTE A;  1V4R A;  4I09 A;  1SAX A;  2HEO A;  4A5N A;  3COA C;  3WU1 B;  1R5H A;  4K2E A;  4RB2 C;  2FQ3 A;  5HLI A;  1ZLK A;  4WK8 F;  2B0L A;  1P92 A;  4I98 B;  3QAH A;  4P5O A;  2PJP A;  2ETH A;  5HS7 A;  1ON1 A;  1XMK A;  2XAS A;  5HDG A;  2NRA C;  2IT0 A;  1OYW A;  2RGV A;  4KMF A;  2QWW A;  1IRF A;  2YPR A;  1KU7 A;  2GA1 A;  2OD5 A;  2GXB A;  3TGN A;  5LRS A;  3HHH A;  2EV5 A;  4KIG A;  1SD6 A;  3DXJ F;  4ON0 A;  4MHG A;  2D2W A;  3IHU A;  4RS8 A;  4MNU A;  2O3F A;  3O3K A;  2FSW A;  4L0Z B;  2QQ9 A;  3MEX A;  1OYY A;  4YFX F;  3WE2 A;  3MCZ A;  4UNO A;  2CYY A;  2V9V A;  1S8N A;  2HQN A;  3KZY A;  1B59 A;  2XUB A;  1YQA A;  2VOD A;  3E5Q A;  3I58 A;  4JBA A;  2XAQ A;  1LDK B;  2ZNZ A;  3TO9 A;  1RUN A;  2HOE A;  1XSV A;  3ZPL A;  3WTV C;  2ZJ2 A;  1I1S A;  2HQR A;  2G9W A;  4ENK A;  1UFM A;  1G3T A;  3G73 A;  5BS6 A;  1D8K A;  1RI7 A;  5D6F A;  3NRV A;  1J7K A;  3K9T A;  3RDI A;  4WWC A;  2DO7 A;  4LLN A;  2JSC A;  2A07 F;  5FFX A;  3ZP5 A;  2OQG A;  2OQR A;  1ZN2 A;  2PLY A;  1EH7 A;  2FA5 A;  1C0W A;  2EFO A;  2DK8 A;  1LB2 A;  1Y0U A;  1BOA A;  2V1U A;  1KU9 A;  2J5P A;  5ILV A;  2BGC A;  2MBF A;  2CWE A;  4EVI A;  1ZG3 A;  5L3G A;  4BYY A;  2P6S A;  4XSX F;  4U7B A;  3DQV C;  2JT1 A;  3BPV A;  4OIO F;  1IXC A;  3WTW C;  3N97 A;  1JHH A;  1J9I A;  3GVA A;  5HDN A;  2F5F A;  3FXQ A;  4XSZ F;  1D8J A;  2BE5 F;  4KUM A;  3ZMV A;  2L02 A;  4OMY A;  3GFM A;  1MJA A;  5E1W A;  5BOX A;  4KNY A;  3I64 A;  4HZF A;  2G7H A;  4MQ9 F;  5ILU A;  1WI9 A;  4I2O A;  2MA3 A;  2RNJ A;  3TO6 A;  2FBK A;  2ZXJ A;  3KP7 A;  3FM5 A;  4OU0 A;  4A6D A;  2HDC A;  4M6X A;  4FX0 A;  4EV0 A;  2CW0 F;  1XDS A;  1PUE E;  1XDU A;  1T0F A;  3H92 A;  1U3E M;  4P55 A;  1O57 A;  4RAZ A;  4M9S A;  4NHJ A;  1P6R A;  3M1E A;  1B9N A;  3FMS A;  1EH8 A;  1STZ A;  4CO8 A;  1R36 A;  5LLQ A;  2YSR A;  4LFU A;  1XGM A;  2FRH A;  3M7G A;  3SZT A;  2XAG A;  3B73 A;  4XBF A;  5E8G A;  2A68 F;  5LEK A;  3IRQ A;  1RUO A;  3BPX A;  4RGU A;  5JVT A;  1IN8 A;  3R0A A;  4XLN F;  3EUH A;  1IRG A;  4PGH A;  1TTY A;  3F8N A;  4HLX A;  2FF4 A;  1QBJ A;  2FU4 A;  4I0B A;  2STW A;  5FGM A;  3HYI A;  3Q9S A;  1LEA A;  3CTA A;  3ERE D;  3D5L A;  4N9H A;  4KT5 C;  1O3S A;  2RQP A;  1R58 A;  1HKS A;  3EDP A;  2ISZ A;  2EB7 A;  2L01 A;  2DU9 A;  3GFL A;  1TQM A;  4P9U A;  3ZN1 A;  5DDG A;  4AIJ A;  2F5D A;  2HTS A;  5FD6 A;  3MZY A;  3L2C A;  1GXQ A;  3T8T A;  2VBY A;  2FBH A;  1SMT A;  3KET A;  1G3W A;  4ENJ A;  4GO1 A;  2P8T A;  1HQC A;  3WTZ A;  2OZ6 A;  1IUY A;  2BV6 A;  1ZGJ A;  5DD8 A;  2XAH A;  4LD5 A;  1VTN C;  1QNT A;  2M8E A;  3GX4 X;  1O3T A;  1V3F A;  1LJ9 A;  2DI3 A;  3R4K A;  4HF0 A;  3W6K B;  5LHG A;  5ILS A;  5BQT A;  1OPC A;  1KGS A;  4YII A;  5LGN A;  2IVM A;  2L4A A;  1IF1 A;  1YW8 A;  4JK1 X;  4ZYD A;  1ZRC A;  2VOP A;  5HVQ C;  2QUF A;  2XAF A;  1QPM A;  5ICC A;  3FWE A;  3J81 K;  1SD4 A;  1GHC A;  4O6J A;  1KYW A;  3KP4 A;  2EA2 A;  1T38 A;  2EV6 A;  1PP7 U;  3P9K A;  4EGY A;  5JFR A;  2ZFW A;  1P2F A;  1KA8 A;  5EEH A;  2DPD A;  3L7W A;  3KFW X;  4PZJ A;  4HOB A;  1LDD A;  1FWZ A;  2VT2 A;  1W4M A;  2QZ8 A;  4LJZ F;  4LLL A;  4LK0 F;  1E2X A;  1BI1 A;  2FNP A;  2Z3Y A;  3MWM A;  4FHT A;  3P9I A;  2OAZ A;  2WTE A;  2A61 A;  3F8M A;  2DQL A;  4HDU A;  2EFQ A;  1DDN A;  1FYM A;  2FXA A;  2Z99 A;  3R60 A;  4M73 A;  4CZZ A;  2IP2 A;  4A5M A;  3MQ0 A;  5E18 F;  4HX7 A;  4L0Y B;  2P5K A;  5FD5 A;  3CO7 C;  1XSX A;  4OIQ F;  4A0Z A;  2KIF A;  4BQA A;  1A04 A;  4RGR A;  3KEO A;  2QLZ A;  4PDK A;  3ISP A;  3KCC A;  1R00 A;  3CUQ A;  2W24 A;  2XAJ A;  3FZV A;  2Z9O A;  1OYI A;  2CQK A;  4ZZD A;  5D8L B;  1MDM B;  1K78 B;  3F72 A;  2E7X A;  3V7C A;  2EFW A;  2DFI A;  1F9N A;  3B02 A;  1XGS A;  2M87 A;  3M9A A;  3HTU A;  3D0S A;  4RB1 A;  2D45 A;  1HW2 A;  2RC4 A;  1LEB A;  1HW1 A;  2W25 A;  4S04 A;  3H3Z A;  5F1R A;  1J0R A;  3DP7 A;  2YR2 A;  2PN6 A;  2FE3 A;  1IW7 F;  3REO A;  1TNS A;  3RKX A;  1KYZ A;  4M9Z A;  3KP2 A;  4AIH A;  2MD5 A;  3QP5 A;  3ABU A;  3JW4 A;  2BEO A;  1G4D A;  5D5V B;  4EM0 B;  1YS7 A;  3HTS B;  1F5T A;  1XGN A;  2XIG A;  1YW9 A;  1DPU A;  2EK5 A;  5LBQ A;  1S3J A;  1B9M A;  4ESB A;  5TRD A;  1ZGA A;  5L3D A;  4ZYE A;  3E6M A;  3BP8 A;  4G8X A;  3V7R A;  1W7P B;  4L5I A;  4KIC A;  3ABT A;  4KIF A;  2PEX A;  1KQ0 A;  1OMI A;  3FXR A;  1LQ1 A;  2QQA A;  3MFK A;  3L9F A;  3LST A;  5K5Q A;  1ZH5 A;  5HOO A;  3QU3 A;  1J59 A;  3GYH X;  1ZG5 A;  1P4X A;  4ZZL A;  3AAF A;  4LG0 B;  1EH6 A;  2VE8 A;  1HBX G;  1FP1 D;  4BNC A;  2QM3 A;  5E8I A;  3OV8 A;  2GWR A;  4L18 B;  4CHU A;  4G6Q A;  4I7H A;  3SFZ A;  4MEY F;  4XRF A;  3ZMS A;  2DBB A;  2MC3 A;  4WCG A;  4ETS A;  6PAX A;  5D4S A;  4EMS A;  2Q8K A;  5AIP A;  4GGG A;  4A2U A;  4ZYH A;  4ZH4 F;  1AOY A;  3KP3 A;  5JI6 A;  3Q5F A;  1ULY A;  1BN5 A;  1Z9C A;  1HKT A;  2FMY A;  5ICF A;  1W5S A;  2C6Y A;  3QPH A;  3T5X A;  1KU2 A;  5J8F A;  3O6B B;  4PCQ A;  4EQQ A;  4A6E A;  1J2X A;  2XRO A;  2X4H A;  5L3E A;  3JSP A;  3P7N A;  2HFH A;  2K7L A;  2HYF A;  5KK1 A;  1IN7 A;  3LA3 A;  1H0M A;  1L3L A;  1IN6 A;  4UUV A;  2Z5U A;  3F3X A;  5H6R A;  1ZRF A;  2IPQ X;  1OKR A;  3IKT A;  4O3M A;  4P9F A;  4AIK A;  1IN5 A;  3F6O A;  1O7F A;  3BWG A;  3W6J B;  2VXZ A;  4HX4 A;  2KJB A;  2BBY A;  2XKP A;  1R5G A;  2LKP A;  2XV4 S;  3F8B A;  4L5J A;  5E1X A;  2ZME B;  1RIO H;  2XHK A;  2X0L A;  2LDU A;  4LGW A;  4YFK F;  3QP6 A;  3HSR A;  2M1B A;  2K4J A;  3KLN A;  1LDJ A;  2H6C A;  1BI0 A;  1YFH A;  3O2P E;  1Q1H A;  2P4W A;  1SFU A;  5A2Q K;  1S7A A;  4NB5 A;  3Q9V A;  1WQ2 A;  1ZLJ A;  1UST A;  3NEU A;  3ZMT A;  3RYP A;  3J7A O;  3HOS A;  1QQI A;  3LQR A;  5DEQ A;  4G9Y A;  2Q2E A;  5DV5 A;  3E5U A;  3RI4 A;  2PG4 A;  3KZZ A;  4ESJ A;  2H6B A;  2YX4 A;  3TOB A;  4O5V A;  5E17 F;  3K1P A;  5ICE A;  2QEN A;  3VOE A;  2M30 A;  4MTD A;  3FHZ A;  2IRF G;  2H94 A;  2IW5 A;  2HYG D;  1L0O C;  3U9G A;  3ZN0 A;  3RJP A;  4EM2 A;  1BC8 C;  4RGS A;  3WTT C;  5CVR A;  2A3S A;  1FOK A;  1IZ1 A;  5HLG A;  2ZBK A;  2UXN A;  1FT9 A;  2MH9 A;  3I5U A;  3RPU A;  4UV9 A;  1O3Q A;  4UVB A;  4Q5S F;  1S29 A;  1FSE A;  1ONV A;  3E97 A;  1FSH A;  1JXS A;  5EEG A;  5DD4 A;  2RVC A;  2JZY A;  3C7J A;  2KKO A;  5L3F A;  2RN7 A;  2PBI A;  5D4R A;  1O3R A;  3KLO A;  2ESN A;  4EJV A;  4HLY A;  3EQL F;  3JTH A;  2COM A;  2VT3 A;  1LNW A;  5BMZ A;  2P7V B;  4KIB A;  3V8L A;  2M5W A;  4F7Z A;  2O0Y A;  4HV6 A;  3CUO A;  1WWX A;  1KQ8 A;  1QZY A;  1HW5 A;  2LF8 A;  1TQP A;  3SZP A;  2HKO A;  3K1N A;  3RTR A;  4Q4Z F;  1Z1D A;  3DFG A;  1QGP A;  3WGH A;  1F4K A;  2GAU A;  2CSO A;  3BRO A;  2HS5 A;  4GXO A;  1E17 A;  1JGS A;  1WKM A;  5H6Q A;  2ADU A;  1K79 A;  1S6L A;  4U0V A;  5BPI A;  3E3V A;  5CLS A;  2VN2 A;  2UWM A;  2P6T A;  3HRT A;  3BJA A;  1XB4 A;  3JAM Z;  4NQW A;  4GYG A;  4WXD A;  1KQ9 A;  5LGT A;  2FNA A;  2V1D A;  3RKW A;  2FBI A;  2HTJ A;  3LQQ A;  2HKX A;  3OOP A;  4KN7 X;  1JE8 A;  4I02 A;  1U5T B;  1FY7 A;  4OIP F;  4S05 A;  2NNN A;  2ZNY A;  5JR3 A;  3LAP A; 
#chains in the Genus database with same CATH topology
 1MJB A;  3LAJ A;  2CFX A;  2MD0 A;  4E7J A;  1T98 A;  1UG0 A;  2AO9 A;  1D3Y A;  4HDV A;  1FC3 A;  3FMR A;  5F08 A;  2HOT A;  4KMU X;  3A01 A;  3I59 B;  3L2U A;  4A3D J;  1JT6 A;  4ENN A;  5ERI A;  3F8F A;  4KYW A;  1ZRE A;  2NVU B;  1VQM I;  1SFE A;  2K3P A;  3FM3 A;  1DPR A;  3JRI A;  2XF7 A;  2XKO A;  2YX7 A;  2P5V A;  1VQL I;  3GWZ A;  4P96 A;  2CUZ A;  3RQI A;  3HM5 A;  3CCS I;  2R7F A;  1TW3 A;  5CYV A;  1XTA A;  4XL9 A;  1R1V A;  2H09 A;  4PGG A;  4KIS A;  1QHG A;  1ZAR A;  4R1H A;  1ZKG A;  1SVM A;  3CCU I;  3I55 I;  5LEJ A;  3H3U A;  4AU7 A;  1WZ2 A;  2FOK A;  3HOZ J;  2ZXH A;  5J8C A;  2CQN A;  3LSR A;  3CC4 I;  1UMQ A;  2V1X A;  1FZP B;  1FOW A;  4IRH A;  1XCB A;  3HHG A;  4JX4 A;  4G94 A;  1Z3X A;  4XR6 A;  4OIR F;  4DYQ A;  2X6Y A;  3V8K A;  1BM9 A;  2KJC A;  1KZH A;  2IJL A;  4HA8 A;  4LMY A;  2ESH A;  2DK5 A;  4BHB A;  5ED4 A;  2JTV A;  1B1B A;  2X1D A;  3TKY A;  4B09 A;  3JRF A;  2GOX B;  3SDB A;  1B72 B;  2EPF A;  1K6Y A;  5CQG A;  2K27 A;  3FK6 A;  1I6X A;  3H9J A;  2W7N A;  2K9Q A;  4BUP A;  2Q2E B;  3OYC A;  2CU7 A;  5EJC A;  1FBS A;  1JUM A;  1OLT A;  4BE1 A;  2EWN A;  4UV8 A;  5E3L A;  1H89 C;  2P0W A;  2M8G X;  3LNQ A;  1TP4 A;  1X2M A;  2F48 A;  1V54 H;  2F5E A;  1MNM C;  4B43 A;  2GIV A;  2RQQ A;  4EGZ A;  2L7K A;  3LWF A;  1DQU A;  2DT5 A;  4MQV A;  1XG1 A;  2O03 A;  3LSH A;  1T8I A;  4HQM A;  4CGZ A;  1OR7 A;  3VYU B;  4Y52 J;  1GXP A;  2QVO A;  4DQ2 A;  2QBY A;  2CV1 A;  4E7Z A;  2UXX A;  3MD2 A;  4F3Q A;  1U2W A;  2HWV A;  2GOM A;  2MH2 A;  1GVJ A;  1NK2 P;  2Y75 A;  4XLE A;  1NG6 A;  4U88 A;  2OC6 A;  2EIM H;  3PL8 A;  2WC2 A;  3IWF A;  1BBY A;  2MW8 A;  1F1Z A;  2D1H A;  2K5C A;  3JAM K;  3GZN B;  4RAY A;  1SFX A;  2VIX A;  3SFI A;  4CCM A;  2RV8 A;  2K86 A;  4RLQ A;  4BQO A;  1GT0 C;  1FLI A;  3FMQ A;  3VDX A;  3DV8 A;  1FX7 A;  4LB5 A;  4CDG A;  2K4B A;  2A5Y B;  5FB2 A;  1XSD A;  5DUK A;  4ZTJ A;  2RDP A;  3S17 J;  4AUX A;  4A0Y A;  3KYL A;  3DEU A;  3OIO A;  4XLF A;  4GYI A;  3ECO A;  2O8K A;  2LMD A;  4IRI A;  3ZMD A;  2I5U A;  3QPT A;  3V4G A;  3GFI A;  4WXH A;  1W0T A;  1MBE A;  1Z7L A;  5KVR A;  4G7O F;  5FLX K;  3L1P A;  1WRJ A;  2CUJ A;  4F91 B;  1BJA A;  3SEZ A;  2BHZ A;  4CH7 A;  3G4S I;  3KIO A;  5D5X B;  5BNG A;  2DAO A;  2ZB9 A;  5TIS C;  1I3Q J;  1OIS A;  1VI0 A;  1RES A;  5B1A H;  1X1P A;  2QYO A;  3HDD A;  1BR2 A;  4CYC A;  4XLC A;  3J7Z I;  3HSF A;  4N0B A;  3QYE A;  2PI0 A;  3CCQ I;  2FJ1 A;  2LR8 A;  2ZCW A;  4H0E A;  4OMZ A;  3DKW A;  3LOC A;  4RGX A;  3FKJ A;  4DOZ A;  4Y7N J;  2EZL A;  1IJW C;  1MKM A;  4BDZ A;  4C2U A;  2ELH A;  2QKL B;  1JI8 A;  3NAR A;  3A02 A;  3HUG A;  4M6Y A;  1MMG A;  1WJE A;  5FRM A;  2R7V A;  3ML6 A;  1DP3 A;  1ODD A;  1M1E B;  5FRN A;  4L5E A;  1JKR C;  3I0T A;  2IS4 A;  3FBI B;  1ERD A;  3JRC A;  2LSO A;  3OYJ A;  2VAS A;  4XKC A;  1W1W E;  2QEX I;  4D5C A;  1MDM A;  1U8R A;  2KZV A;  1I39 A;  3WHB A;  4DNC A;  3PIO F;  2H8W A;  1YX3 A;  3IC7 A;  4Q47 A;  2A69 F;  1S72 I;  2LF7 A;  2GA2 A;  1RNL A;  5CJ9 A;  3QWL A;  1W5C C;  3OIQ A;  2M0M A;  2BW3 A;  3HOV J;  4C9Y A;  1YG2 A;  3S8P A;  3GFJ A;  1ON2 A;  2EZK A;  2W82 A;  5KAI C;  5HDK A;  1XN7 A;  3B6A A;  3CD6 I;  3R0J A;  4XOT A;  1D0X A;  3C3W A;  4AVP A;  4PK4 A;  2M0C A;  4L9J A;  5J3L A;  2X1E A;  5DCF A;  3J81 Z;  2R7D A;  2R7U A;  2QQB A;  3F21 A;  1MGT A;  4Q48 A;  2GQQ A;  4HAM A;  2WBM A;  2DPU A;  1CF7 A;  5DYM A;  2IA2 A;  3PFI A;  3VWB A;  2LH9 A;  2F5C A;  2F4O B;  3R61 A;  3HJE A;  3GTJ J;  3OYD A;  2KIU A;  3RQ4 A;  3BZ6 A;  4PSW A;  3GUD A;  2ID6 A;  3CDI A;  3LA7 A;  1UCR A;  1XGO A;  3HGG A;  2Q0O A;  3FF5 A;  5E3M A;  1ETX A;  1TNT A;  1QVU A;  5M5X J;  1VQ8 I;  3DCF A;  4Y17 A;  4IO9 F;  3GZ5 A;  2A6H F;  4RB3 C;  4JQF A;  3VYR B;  1R49 A;  1R23 A;  1LFP A;  1W7P D;  3CCM I;  4V19 K;  2R7S A;  3W2V A;  3CUQ C;  4LLG F;  3ZQC A;  2R7O A;  1FJL A;  3A2K A;  3DLA A;  4RBO A;  4EJO A;  1D0Z A;  2M7B A;  4RAG A;  4M3E A;  1BI3 A;  1TLH B;  4QLC U;  5JHF A;  5GTI C;  4BH9 A;  1MBF A;  2ZXW H;  3ZMU A;  2QSH X;  4IRG A;  2EIK H;  4W1U A;  4LOC A;  5A2Q Z;  3P9C A;  1FIA A;  4LK1 F;  1UG2 A;  3KEQ A;  3BR0 A;  2PMH A;  2ZKZ A;  4UB8 C;  2OU2 A;  3NQO A;  4ASN A;  4ESF A;  1WCM J;  3OS1 A;  2L9V A;  1U9O A;  2Y0M A;  4F93 B;  1HOM A;  5DUI A;  5C3E J;  2OZU A;  4BGD A;  3GF2 A;  2LK2 A;  1AKH A;  3CZ6 A;  2VJ4 A;  1HKQ A;  1SD5 A;  3LFK A;  2W84 A;  4D0P A;  2H27 A;  3K69 A;  1MIJ A;  3ULQ B;  4BL0 B;  5FKK A;  4FIS A;  5FLX Z;  4YG2 F;  1S7O A;  4NDL A;  5GAD J;  1YE9 A;  3JRA A;  3D1N I;  5LD2 C;  2HR3 A;  2NNY A;  2WY8 Q;  2L9S A;  2GXG A;  3NAU A;  1Z3Y A;  3ZQL A;  5DCM B;  1QZZ A;  3M3Y J;  1QO0 D;  3CO6 C;  4BE0 A;  4JYK A;  3WG9 A;  4U0Y A;  1JUS A;  3F22 A;  1JKQ C;  1YIT I;  4UVA A;  2VKV A;  2HPM A;  1DGW Y;  5L3C A;  1CF7 B;  4YFN F;  5B3S H;  5F27 A;  3BCA A;  4A69 C;  5DM7 F;  3S93 A;  1X1A A;  1ENH A;  4MO7 A;  2OJE D;  4BDY A;  3K4C A;  3MKY B;  3CCL I;  1MBH A;  2Y48 A;  4HW0 A;  4LG0 A;  3JTG A;  4DZJ A;  3F23 A;  3TED A;  2DA7 A;  1K78 A;  1YYV A;  1T95 A;  2CQQ A;  2Y69 H;  2Y31 A;  2YU3 A;  1DU6 A;  2Y2Z A;  3SHF A;  3OYM A;  4L9N A;  3W2A A;  2VBZ A;  3HRU A;  3BG5 A;  1ZRD A;  2E1M B;  2PFB A;  1I5Z A;  4WF2 A;  3HRM A;  4GFB A;  2DTR A;  3QPS A;  1LE8 A;  4NC8 A;  5IT9 Z;  1MD0 A;  1IRZ A;  2ACJ A;  1IXR C;  3F6V A;  1P4W A;  1ZYR F;  5J1R A;  2DTZ A;  3WE3 A;  4CSW A;  4UUT A;  5E20 A;  4B8X A;  2Y30 A;  4PFO A;  3HPH A;  4WX9 A;  1RC9 A;  1D5V A;  3HSE A;  1OCR H;  3T0Y A;  2CQ7 A;  1RKT A;  4IVN A;  5EYR A;  1ETQ A;  2XGX A;  3L2Q A;  2R5Y B;  1F43 A;  2VBW A;  1WJF A;  2P5L C;  3OMY A;  3ZXS A;  1U6G A;  3HZJ A;  3WOD F;  2LY9 A;  4EAT A;  3KYD B;  1O7L A;  3DTK A;  4UXN A;  3SZG A;  3I4P A;  3KYC B;  3PNT A;  1D1C A;  2MLK A;  3FX3 A;  1FOY A;  1KU3 A;  4BBR J;  5D8K B;  1IDY A;  2V79 A;  3K1M A;  3VB2 A;  5D6E A;  3PNV A;  4KIT B;  1UAA A;  1Z91 A;  3MVP A;  4HNV A;  3GTQ J;  2G7U A;  1VF9 A;  1DP7 P;  5IT3 A;  3MZH A;  3ONQ A;  5K7Z A;  3ZRG A;  3BG6 A;  4OWR B;  1ZR4 A;  2XRL A;  3CLO A;  2IA0 A;  2XVC A;  3MAJ A;  1BIA A;  2CGP A;  1T39 A;  1IV8 A;  3IRR A;  1ZEL A;  2BXZ A;  4X0G A;  1GUU A;  1HSJ A;  5GAG J;  4I99 C;  2DYS H;  1T6S A;  2VOO A;  1P4A A;  1MBJ A;  1IN4 A;  3IH2 A;  2ZO4 A;  2JPC A;  3VOD A;  1Z05 A;  4WXC A;  2E2H J;  5CVU A;  2WAQ N;  3ZMZ A;  4IPA A;  1Z7U A;  3GTP J;  4HV5 A;  5IT9 K;  4MEX F;  1W7P A;  2CV0 A;  2OCC H;  3DTI A;  2AXL A;  3Q3S A;  2IGN A;  2JSP A;  1JTY A;  5FFZ A;  2R7W A;  1JTX A;  4BJ5 C;  2QCO A;  3S1Q J;  5J40 A;  4MGR A;  1U5T A;  1T2K A;  1WJD A;  3GTO J;  4DJA A;  4CYD A;  1YLF A;  2V6C A;  1QVT A;  1ZQ3 P;  3EET A;  5K1Y A;  3H1C A;  1WJA A;  3FK7 A;  4BXU A;  3L00 A;  4HNU A;  1XCV A;  3GTG J;  4HBL A;  1YJN I;  3H5A A;  2L9R A;  2VJ5 A;  4HF2 A;  1B8I A;  2DXI A;  5GP9 A;  1R22 A;  2MLG A;  2IS2 A;  3KPH A;  1YW7 A;  3CJQ B;  5JHU A;  2BY3 A;  2DQR A;  2FML A;  5AIQ A;  1BL0 A;  3ABK H;  2E35 A;  3ROU A;  4FAS D;  1H88 C;  1W5T A;  1ZTR A;  2NS8 A;  3SQN A;  2HOA A;  3S1R J;  1OCC H;  3OSF A;  2L54 A;  2O8X A;  3WHC A;  4MFE A;  4BAY A;  1R7J A;  4FET A;  4ENM A;  3WU2 C;  3CMM A;  5F0F A;  1RET A;  1UB9 A;  2WB1 A;  1WSU A;  3QOP A;  2EQR A;  1JUP A;  3DKX A;  1Z0X A;  4RAF A;  3V8J A;  4B3A A;  4HYE A;  1Z6R A;  1WH5 A;  3DPL C;  2NS0 A;  2D5V A;  2BZT A;  3U2R A;  2STT A;  5J4Y A;  3K0L A;  4D7N A;  4IHS A;  1XMX A;  4GRI A;  2A6E F;  2JVG A;  4E6K G;  4Y13 A;  3QRF F;  5J6X A;  4NC6 A;  2E1C A;  5GAH J;  3TOA A;  2WWY A;  4B48 A;  3DBH B;  2K9M A;  4U0W A;  3I59 A;  1IRX A;  3RKY A;  3GO5 A;  1SD7 A;  4XLH A;  3QU6 A;  1ZK8 A;  1V55 H;  2PJR B;  1UZC A;  3ERM A;  2W4S A;  3GEZ A;  2DMN A;  3GLX A;  2CG4 A;  3BG9 A;  2EA4 A;  1IV6 A;  4BY1 J;  3HL2 A;  2E1M C;  4XLP F;  1LUJ B;  2NYX A;  1E3H A;  1PJR A;  4Y3O A;  1QHH D;  2IA1 A;  1A31 A;  4IHX A;  4RB0 A;  4MIM A;  1G3Y A;  3CCE I;  1R1T A;  2JRT A;  3LSJ A;  3UR3 C;  3CLQ A;  4BJT A;  3I54 A;  3WTU C;  3BOQ A;  1K7A A;  1LKX A;  4U7D A;  2VON A;  1BIB A;  5B66 C;  2VBX A;  4EM1 A;  4KN4 X;  3GW2 A;  4MFD A;  1AKH B;  4OIN F;  2E1N A;  3WU0 A;  2OA4 A;  4HNT A;  3CUQ B;  2WB1 N;  1PP8 F;  1ZGW A;  4I01 A;  3FDY A;  2DA1 A;  1X3Z B;  1DUX C;  1PDN C;  2R7Q A;  1ETV A;  3Q0W A;  2VKH A;  3JCU C;  1K6O A;  4ANJ A;  1JKP C;  2Z1D A;  1Z6T A;  1YO5 C;  4LIU A;  4AWX B;  3CF5 F;  4LB6 B;  4UVC A;  3H9G A;  5H20 A;  3EYY A;  1Y56 A;  3F8C A;  3VSL A;  1YX5 A;  2CW8 A;  2E7W A;  4EJW A;  1FNN A;  1J75 A;  1UHW A;  3R6S A;  1YS6 A;  2EZI A;  4QTR A;  2A05 A;  1PUF B;  1REP C;  1QRY A;  4QWQ A;  5F1J A;  3MZ8 A;  5K5O A;  2XRN A;  1MMS A;  4YIF A;  4OOI A;  1N75 A;  3VFZ A;  5D5U B;  3JRB A;  3HOT A;  2WV0 A;  2JPB A;  2DW4 A;  3C2H A;  1U78 A;  3JSO A;  3H0G J;  4PJ0 C;  4Z6Y A;  2FUG 2;  1LFB A;  1FP2 A;  3FKI J;  3DWL E;  2R0Q C;  2JA8 J;  5LRR A;  1Z77 A;  4IHT A;  2F5V A;  1A6Q A;  5F6F A;  2HZT A;  2BVL A;  2ID3 A;  2IBD A;  4UHT A;  1AWC A;  2W85 A;  3S32 A;  4Z2Y A;  3N05 A;  2L4M A;  2HGC A;  4BHP A;  3OYH A;  3SJM A;  1H9G A;  3C2G A;  4A3G J;  2VXD A;  2GIZ A;  2LLK A;  3BJ6 A;  4ZTF A;  5FO5 A;  2YS9 A;  1LVA A;  3LSP A;  3Q0U A;  3LL7 A;  3OR2 C;  4PJM A;  1OR7 C;  4ABZ A;  3GZ6 A;  1MJ9 A;  1G6N A;  2PQ8 A;  3K2Z A;  3HIF A;  4R79 A;  3IL2 A;  3GXO A;  4IEJ A;  2Z33 A;  1MZB A;  4E7K A;  3G1L A;  1FBQ A;  5FKM A;  5EDN A;  2BW3 B;  2FEZ A;  2LG4 A;  2IEK A;  2R5Z A;  3PJR A;  2OCE A;  1AHD P;  3FIW A;  2OBP A;  1HLV A;  3J80 K;  3KP6 A;  3CMA I;  2IS1 A;  5LGU A;  4M74 A;  1JHF A;  3E6D A;  1RKW A;  3PQJ A;  1WI3 A;  4I0A A;  2J5O A;  1OQY A;  1TT5 B;  3M8E A;  1HXD A;  5FLM J;  2IGO A;  2VLA A;  3L2W A;  3IWZ A;  3E5X A;  3TDU C;  5ICG A;  3N4M A;  1FYK A;  2ME6 A;  1XD7 A;  3HRS A;  2NAZ A;  1IXS B;  1TBX A;  2EH3 A;  4G7Z F;  1ZHF A;  4IQ4 A;  2M3A A;  3RYR A;  3CES A;  5AON A;  3SXY A;  4F55 A;  3TO7 A;  5JLW A;  3AL0 C;  1HC8 A;  2D1V A;  3U1K A;  2HQA A;  1BR4 A;  3C1D A;  1EJ9 A;  2V9K A;  2XB0 X;  3IKV A;  3T1B A;  2HPI A;  4A0X A;  1SAU A;  3E6B A;  3RPQ A;  4L9T A;  2LD5 A;  2VC0 A;  2X51 A;  2V1N A;  2AQE A;  4V2F A;  5HLH A;  2CQX A;  4ZYG A;  4XIC A;  1MMN A;  1HDP A;  2MFZ A;  3PM1 A;  2PMZ N;  2XB5 A;  3ASO H;  2P7C B;  3CDH A;  3ABM H;  2O61 A;  4EJT A;  2XGC A;  1FBU A;  3RZD J;  3OIP A;  4IX7 A;  4X6A J;  4KDP A;  3OWT A;  3DPT A;  2HXI A;  2BHY A;  2M4K A;  3IP4 B;  3MKW B;  4CA0 A;  1R4N B;  1J5Y A;  2LFB A;  5LHH A;  1TW2 A;  3CCR I;  4HF1 A;  1NHA A;  2XF5 A;  3G6E I;  4JOM A;  2EFP A;  1SMY F;  3ZCO A;  1JJ6 C;  3KZI C;  1BI2 A;  4HEA 2;  2EJR A;  5CVV A;  3H9Q A;  4CCK A;  5EEA A;  2EIJ H;  2M45 A;  1TWA J;  2BOL A;  4F92 B;  5D5W B;  5EZH A;  5DCM A;  4OAZ A;  3DF8 A;  2LKX A;  5HS8 A;  2ISY A;  1ETW A;  1YRN A;  3IAM 2;  1I6H J;  3F9K A;  3J80 Z;  5BPD A;  1B6A A;  2TDX A;  5F64 A;  3RIR A;  4A3C J;  3KE2 A;  1QZE A;  1Y1W J;  2KIM A;  4G6D A;  4XM3 A;  2DFH A;  2LY2 A;  3C2B A;  4A3B J;  2NXN B;  2R7X A;  5CVI A;  1CGP A;  2MC4 A;  4BBS J;  2QBY B;  5M5Y J;  1DU0 A;  3LA2 A;  4S0H B;  2M4G A;  2PJR A;  1ZAO A;  2CO5 A;  3T8R A;  3BTJ A;  4EJU A;  2RKH A;  3D5R C;  2O7O A;  4J01 A;  2UUZ A;  2PMZ A;  3O8G A;  4M72 A;  1YTY A;  3ZR8 X;  2X9D A;  3G2B A;  2DDB A;  4XON A;  2AS5 F;  3KP5 A;  4CCO A;  3J7A Y;  4L9V A;  4PFP A;  1LE8 B;  4BKX A;  4C2T A;  2EV0 A;  2JK3 A;  2F2E A;  4HX8 A;  2E2J J;  2XPU A;  1R5I D;  4CCL A;  3WGG A;  2LNB A;  4FT8 A;  4LIV A;  3O8H A;  5L3B A;  2DA4 A;  1T0F C;  1U5T C;  3A0H C;  5E1Z B;  3DKY A;  3TDZ C;  2VE9 A;  4GCV A;  4CIC A;  3A4C A;  4A12 A;  2JJ7 A;  2NS7 A;  3WTY C;  3BZC A;  3E6C C;  3L09 A;  4KFC A;  1YJ9 I;  4KA4 A;  3VPR A;  4G7H F;  3BY6 A;  3ELK A;  3BJO A;  3S2W A;  1YJW I;  4FQG A;  1G59 A;  1XMA A;  4M71 A;  4A3J J;  2FOW A;  1R1U A;  5E79 C;  4AD9 A;  2GBY A;  4CCN A;  1FPQ A;  3WTS C;  4X1E A;  3I53 A;  2JA7 J;  5K5R A;  1I1G A;  3G3Z A;  1D5Y A;  4B3X A;  5E3N A;  2KRF A;  4M9X A;  2PMU A;  3EYI A;  3HOY J;  1FYL A;  2H1L A;  2WV1 A;  3V7S A;  3VEP A;  4E70 A;  4J00 A;  3ECH A;  1EV7 A;  4HQE A;  1G3S A;  2UZK A;  2K9N A;  5GTH C;  5EGO A;  5CVJ A;  4IJA A;  3RKQ A;  2K3F A;  1UHM A;  4CXF A;  2LYC A;  3G1O A;  4CYC B;  3BDD A;  1HST A;  4FX4 A;  5TJJ A;  2L3D A;  1USS A;  2ZME A;  1TZL A;  2MSY A;  3PQK A;  3WTX C;  1VFC A;  9ANT A;  3TQN A;  3S3N A;  4M3G A;  3C18 A;  1B4A A;  1T33 A;  4HSR A;  1IAW A;  1G2H A;  1TQI A;  3CJR B;  5HS9 A;  1X3U A;  3S14 J;  2E1O A;  2K02 A;  3OOU A;  2ICW G;  2BYV E;  3BG7 A;  5LHI A;  2KZG A;  2DLL A;  2GZW A;  3VSK A;  1ZG1 A;  1ORK A;  1BC7 C;  2W57 A;  3K70 C;  5C4X J;  2ZJR F;  2ME0 A;  3AG2 H;  4IXA A;  3U1D A;  1Y39 A;  1H8A C;  2ZME C;  3ZQ7 A;  3CJN A;  3I71 A;  4IF4 A;  4LG3 A;  2VC1 A;  4R8H A;  4B4C A;  4N9I A;  2F4I A;  1TWF J;  2O6G E;  3KEY A;  3AKZ A;  4YIR X;  3M8F A;  5F04 A;  4AVZ A;  1RZ4 A;  1I27 A;  4N4O B;  3WGI A;  3FXU A;  4BHC A;  2LC2 A;  2EFN A;  1H9T A;  2B7E A;  4BEH A;  4TV7 A;  4QPO A;  1FOX A;  1YIO A;  2R3S A;  4Y15 A;  4MTE A;  2KFD A;  1V4R A;  1TL8 A;  4F52 A;  4I09 A;  1I3A A;  1SAX A;  4PJN A;  1UJ8 A;  2HEO A;  2W00 A;  5B1B H;  3ZQF A;  1RPW A;  4A5N A;  3COA C;  1TWH J;  3HKZ A;  1R5H A;  2K9L A;  3WU1 B;  1SFO J;  4K2E A;  4RB2 C;  2FQ3 A;  5HLI A;  4I6Z A;  1ZLK A;  4WK8 F;  2B0L A;  1HA8 A;  1VZ0 A;  1P92 A;  4I98 B;  3QAH A;  4P5O A;  1JKO C;  2W1O A;  4QPQ A;  3H5N A;  2PJP A;  3LSG A;  4EEF G;  2ETH A;  3FXM A;  5HS7 A;  5IOZ A;  1ON1 A;  4C2M J;  1R4M B;  1XMK A;  2XAS A;  5HDG A;  2EZH A;  2K40 A;  2VUM J;  2NRA C;  2ZC2 A;  2GXA A;  3IUO A;  2IT0 A;  3SDG A;  1OYW A;  1T08 B;  2RGV A;  1YHQ I;  2ZSI B;  3CCJ I;  5LFA A;  1WJC A;  4KMF A;  4C30 A;  4A3L J;  2QWW A;  3BTI A;  1IRF A;  1HDD C;  1U8B A;  2YPR A;  2E36 A;  2O9L A;  1KU7 A;  3M4O J;  2DOD A;  1BW6 A;  3F0C A;  2L7M P;  2GA1 A;  2OD5 A;  2NVX J;  2E5N A;  2GXB A;  3TGN A;  5LRS A;  3GCM A;  3HHH A;  3V42 A;  3OYL A;  2EV5 A;  4KIG A;  1SD6 A;  3DXJ F;  4ON0 A;  4MHG A;  2D2W A;  3IHU A;  4RS8 A;  4MNU A;  2O3F A;  3O3K A;  3PUF A;  2FSW A;  2LRE A;  4L0Z B;  1MNE A;  1WJB A;  3PSF A;  1P7J A;  2QQ9 A;  3MEX A;  2XPV A;  2LOO A;  1OYY A;  4BJ6 C;  4YFX F;  3WE2 A;  3MCZ A;  3RCO A;  4UNO A;  2CYY A;  3A01 B;  2V9V A;  4DZP A;  1S8N A;  1WVR A;  2VKD A;  1IG7 A;  3TMO A;  3CQZ J;  3IAS 2;  3OYK A;  2HQN A;  2Z16 A;  3KZY A;  1ZR2 A;  1B59 A;  1SEU A;  2XUB A;  5KAF C;  2QF7 A;  2KLO A;  1YQA A;  2Y0S A;  3E5Q A;  3I58 A;  4CZC A;  2VOD A;  1GLN A;  3DU5 A;  3DEE A;  4IOC F;  4JBA A;  2XAQ A;  1LDK B;  5IYB J;  4B44 A;  3FHN A;  3H35 A;  1A36 A;  3PSI A;  4NQW B;  2ZNZ A;  2VQH A;  5FRO A;  4UUS B;  3LSM A;  2O5R A;  3TO9 A;  1RUN A;  2HOE A;  1XSV A;  3ZPL A;  3JR9 A;  2OPT A;  3WTV C;  3BZK A;  2ZJ2 A;  3I4N J;  1I1S A;  2HQR A;  4XKB A;  2LBF B;  2G9W A;  5HNH A;  4ZDO A;  4ENK A;  1XS9 A;  1UFM A;  1G3T A;  4FE7 A;  3G73 A;  1X1C A;  2KP6 A;  5BS6 A;  1TT0 A;  3BG3 A;  2BY2 A;  2JVH A;  1D8K A;  1RI7 A;  5D6F A;  3NRV A;  1J7K A;  4XNF A;  4FE4 A;  3K9T A;  1GDT A;  3RDI A;  5J4V A;  1D1A A;  2R5Y A;  4WWC A;  4ITV A;  4W97 A;  2DO7 A;  3TW6 A;  2FX0 A;  4LLN A;  3E1S A;  1OFC X;  4QIW N;  3K4M A;  3CME I;  2JSC A;  4A3M J;  2A07 F;  2HXO A;  5FFX A;  3ZP5 A;  3KX2 A;  1OCO H;  2OQG A;  2EBI A;  2HDD A;  2OQR A;  1ZN2 A;  2Y9Y A;  2PLY A;  4HRI A;  1EH7 A;  2FA5 A;  4UB6 C;  1C0W A;  2EFO A;  4MLO A;  4XRS G;  2DK8 A;  1LB2 A;  4A3I J;  1TC3 C;  1Y0U A;  1BOA A;  2V1U A;  1KU9 A;  3ZGK A;  2J5P A;  5CQE A;  5ILV A;  2R4G A;  2BGC A;  2HZD A;  3QQA A;  1BJZ A;  1JGG A;  2MBF A;  2ECB A;  2LRD A;  2X85 A;  2CWE A;  1A5J A;  4EVI A;  1ZG3 A;  1FMW A;  2Y0S N;  3FXO A;  3W2W A;  5L3G A;  3MKZ A;  4H4K C;  4BYY A;  2P6S A;  1FTT A;  4XSX F;  1O4X A;  2X1C A;  4U7B A;  3DQV C;  2JT1 A;  3BPV A;  2NVQ J;  4OIO F;  1IXC A;  1SAN A;  3WTW C;  1JHH A;  3N97 A;  1J9I A;  4ZDL A;  2CUE A;  3GVA A;  2KQR A;  3QOE A;  5HDN A;  5HOD A;  1MW7 A;  2R7T A;  1WGX A;  2F5F A;  3FXQ A;  2PX9 A;  2I10 A;  4XSZ F;  2R92 J;  4DBR A;  1D8J A;  4YRV A;  4XRM A;  2BE5 F;  4P1W A;  1KON A;  4DW6 A;  4KUM A;  2XPW A;  3ZMV A;  1FMV A;  3EUK L;  4XRS A;  3QYF A;  4RM2 A;  2L02 A;  4OMY A;  4D1Q A;  2VI6 A;  3GFM A;  3CF2 A;  4DYC A;  1MJA A;  1WPK A;  2EIN H;  5E1W A;  3OYA A;  5BOX A;  2Z2S B;  3H3V K;  4KNY A;  2HVR A;  3I64 A;  3JRE A;  4NUB A;  4JX6 A;  4XK4 A;  4HZF A;  1V5G A;  2G7H A;  2RRE A;  3S3O A;  4MQ9 F;  5ILU A;  1WI9 A;  1R9T J;  4I2O A;  2MA3 A;  2RNJ A;  3TO6 A;  2FBK A;  2ZXJ A;  1YI2 I;  3KP7 A;  3FM5 A;  4OU0 A;  4A6D A;  2M7A A;  1N77 A;  2HDC A;  4M6X A;  4FX0 A;  4EV0 A;  5IP7 J;  2CW0 F;  1XDS A;  1PUE E;  1XDU A;  1T0F A;  3CP2 A;  2IXS A;  2E60 A;  3H92 A;  1IDZ A;  1U3E M;  1E3P A;  4N4N B;  4ZDP A;  2HYJ A;  4M6V A;  3HOU J;  4P55 A;  3PIP F;  1FTZ A;  1O57 A;  4RAZ A;  4E7I A;  4M9S A;  4NHJ A;  1P6R A;  3M1E A;  3LSK A;  4RLF A;  1A35 A;  5FJ8 J;  1B9N A;  3FMS A;  4AC0 A;  1EH8 A;  1STZ A;  2KRC A;  4CO8 A;  1R36 A;  3DU6 A;  5LLQ A;  2YSR A;  2LP0 A;  3OSG A;  4LFU A;  1SVL A;  1XGM A;  5C44 J;  4FTH A;  3OL4 A;  2FRH A;  3NWS A;  4LIT A;  1YRN B;  3M7G A;  2XGD A;  3SZT A;  2XAG A;  3B73 A;  1W0U A;  1IUF A;  3ABL H;  4XBF A;  5E8G A;  1RR7 A;  2A68 F;  2DA6 A;  5LEK A;  1QA6 A;  3IRQ A;  1RUO A;  3GBG A;  3S1N J;  2EIL H;  3BPX A;  4RGU A;  5JVT A;  1IN8 A;  3R0A A;  4XLN F;  3EUH A;  1IRG A;  4PGH A;  1TTY A;  3F8N A;  4HLX A;  2FF4 A;  1QBJ A;  2FU4 A;  2FQ4 A;  3CCY A;  3BR1 A;  4BQQ A;  4I0B A;  3P5J A;  3I56 I;  2HNH A;  4Y33 A;  2STW A;  5FGM A;  3HYI A;  4B47 A;  3Q9S A;  1LEA A;  3CTA A;  3DPU A;  1YIJ I;  3ERE D;  3D5L A;  4ZJZ A;  3OYN A;  1MSF C;  4N9H A;  4KT5 C;  1K4T A;  1O3S A;  2RQP A;  1R58 A;  4NC7 A;  1HKS A;  3EDP A;  5FKN A;  2ISZ A;  1WH7 A;  2EB7 A;  2L01 A;  2DU9 A;  1SFK A;  1TWG J;  3GFL A;  4XOR A;  1TQM A;  3X2Q H;  4P9U A;  3SYT A;  3ZN1 A;  5DDG A;  3K4L A;  3JRG A;  1ACI A;  4AIJ A;  5EG0 B;  2F5D A;  2HTS A;  4PJJ A;  3FXL A;  3LFU A;  5FD6 A;  3MZY A;  2ZJP F;  3L2C A;  2HOS A;  4BY7 J;  2XDV A;  2ELJ A;  3BR6 A;  1GXQ A;  3QPL A;  3T8T A;  2VBY A;  2QSF X;  2FBH A;  3S2H J;  1SMT A;  3KET A;  1G3W A;  4ENJ A;  1S7E A;  4GO1 A;  1K83 J;  2P8T A;  4XN0 A;  1HQC A;  3WTZ A;  5J1U A;  2OZ6 A;  1IUY A;  2VJI A;  5DTD A;  1VQO I;  4RDU A;  5IP9 J;  2BV6 A;  2X6X A;  1ZGJ A;  5DD8 A;  2XAU A;  3OYI A;  3S16 J;  2XAH A;  1MSE C;  5DS9 A;  4LD5 A;  2X6W A;  2IGK A;  2BVM A;  1VTN C;  1QNT A;  2E19 A;  2M8E A;  3RSN A;  3GX4 X;  4HST A;  3OYB A;  3IV5 A;  1Y0N A;  1O3T A;  2A6T A;  3CP8 A;  4C3I J;  1V3F A;  2DT7 B;  2R7R A;  1LJ9 A;  2DI3 A;  5J47 A;  3DBL B;  3R4K A;  4HF0 A;  1OCT C;  1VQK I;  3W6K B;  5LHG A;  2KDO A;  2L9N A;  5ILS A;  5IOY A;  2L0K A;  5BQT A;  1OPC A;  3OYG A;  1KGS A;  4YII A;  2K85 A;  1U0J A;  4PSX A;  4II2 A;  5LGN A;  3BQZ A;  2IVM A;  2L4A A;  1LVK A;  1IF1 A;  2P81 A;  1YW8 A;  4JK1 X;  3G1M A;  4ZYD A;  1ZRC A;  1BR1 A;  2CW7 A;  2VOP A;  3PNY A;  5HVQ C;  2QUF A;  5GPA A;  2XAF A;  3DLL F;  1QPM A;  5ICC A;  3H0D A;  5F0H A;  3FWE A;  2ZFU A;  1XX5 A;  2DA5 A;  3J81 K;  1SD4 A;  1SC7 A;  1GHC A;  4O6J A;  1D1B A;  1J09 A;  1KYW A;  2E34 A;  3CDL A;  1F36 A;  3KP4 A;  5EG0 A;  2RNG A;  2EA2 A;  1T38 A;  2IAI A;  2EV6 A;  2V4J C;  3NWT A;  2KDZ A;  2R5Z B;  1PP7 U;  3P9K A;  3FBN B;  4EGY A;  5JFR A;  2ZFW A;  2KMU A;  1P2F A;  1KA8 A;  3K70 D;  3CC2 I;  2YU9 J;  5EEH A;  2HVS A;  3U21 A;  2KT0 A;  4BU2 A;  4FCY A;  2DPD A;  3L7W A;  3KFW X;  4PZJ A;  4HOB A;  2RAE A;  3AFH A;  1LDD A;  3MMY B;  1FWZ A;  2VT2 A;  4BXF A;  1ETY A;  1WHU A;  1W4M A;  5KCM A;  2QZ8 A;  4LJZ F;  3WG7 H;  4DBQ A;  4BE2 A;  4LLL A;  5CPR B;  4LK0 F;  1E2X A;  3L2R A;  1BI1 A;  2FNP A;  1V5F A;  2Z3Y A;  3MWM A;  4FHT A;  3P9I A;  1NH3 A;  2DCE A;  2DN0 A;  2M9H A;  2OAZ A;  2WTE A;  2A61 A;  3F8M A;  2ELK A;  2DQL A;  4HDU A;  2JA5 J;  2EFQ A;  1DDN A;  2IGM A;  1POG A;  2CS3 A;  1FYM A;  4I76 A;  2DA2 A;  2FXA A;  1X4P A;  3K7A J;  5K7F A;  4XID A;  3I4M J;  2Z99 A;  3R60 A;  4M73 A;  4CZZ A;  2IP2 A;  4A5M A;  3MQ0 A;  5E18 F;  4HX7 A;  5B5E C;  2BY1 A;  2FD5 A;  2P5K A;  4L0Y B;  2LTP A;  5FD5 A;  3CO7 C;  2CH0 A;  1XSX A;  1EF4 A;  4BS9 A;  2CFO A;  3I3L A;  3HBL A;  2ZXI A;  2KL4 A;  4OIQ F;  1UHS A;  2R7Z J;  4A0Z A;  2KIF A;  2ZSH B;  3HB9 A;  4PJL A;  4BQA A;  1A04 A;  1RR8 C;  2I8D A;  4RGR A;  3KEO A;  2QLZ A;  4PDK A;  3H36 A;  2XSJ C;  3ISP A;  2XGE A;  3H5R A;  3KCC A;  1R00 A;  2OTL I;  3CUQ A;  2W24 A;  2XAJ A;  3FZV A;  2ECC A;  3ZQG A;  3ESW B;  3GME A;  2Z9O A;  1OYI A;  2CQK A;  4ZZD A;  5D8L B;  1MDM B;  2V6E A;  5IYC J;  1EA3 A;  1K78 B;  1OCP A;  2DYR H;  3F72 A;  3CMY A;  4A93 J;  2E7X A;  3V7C A;  2EFW A;  3VYT B;  3CC7 I;  2DFI A;  3BTL A;  1F9N A;  3HKZ N;  3B02 A;  5F0C A;  1MH4 A;  1XGS A;  2M87 A;  3PFY A;  3M9A A;  5KNL A;  3HTU A;  1RRJ A;  3A0B C;  4DYR A;  1QU3 A;  3D0S A;  4RB1 A;  1IC8 A;  2D45 A;  4E4H A;  2K9S A;  1HW2 A;  2RC4 A;  1LEB A;  3PUB A;  1A6I A;  1HW1 A;  2W25 A;  4S04 A;  1PUF A;  3H3Z A;  5F1R A;  1J0R A;  3BR3 A;  3DP7 A;  3HPG A;  2YR2 A;  3FXJ A;  4ZYA A;  2PN6 A;  1W36 D;  5IYD J;  2FE3 A;  1R6R A;  3HEF A;  1IW7 F;  5M3F J;  3HXL A;  3PO2 J;  3REO A;  1TNS A;  3RKX A;  2R93 J;  1EKE A;  1KYZ A;  3S3M A;  4KJZ A;  2QQ8 A;  4M9Z A;  2H1K A;  3EUA A;  4IHY A;  2KHM A;  3KP2 A;  1VND A;  2BY0 A;  4AIH A;  2OV7 A;  1LFU P;  3W6V A;  2MD5 A;  2NVT J;  2JQ7 A;  4D9J A;  3QP5 A;  1MBG A;  3ABU A;  3JW4 A;  5JVG F;  2BEO A;  2GLO A;  4U87 A;  1G4D A;  1I50 J;  5D5V B;  4EM0 B;  1YS7 A;  3HTS B;  3BR5 A;  3OS2 A;  1Z21 A;  3QOD A;  1F5T A;  1XGN A;  2V7F A;  2XIG A;  4JP0 A;  1YW9 A;  2V9P A;  1DPU A;  2EK5 A;  4G12 A;  5GAE J;  3D5S C;  2AQF A;  5LBQ A;  1S3J A;  1B9M A;  1T56 A;  2DMP A;  4ESB A;  1VQ9 I;  2JRM A;  5TRD A;  2M34 A;  1ZGA A;  5L3D A;  4ZYE A;  2DOA A;  1VQ7 I;  3E6M A;  3BP8 A;  1VQN I;  4G8X A;  3V7R A;  1W7P B;  4L5I A;  5J1Y A;  4KIC A;  3ABT A;  4KIF A;  5FKL A;  2PEX A;  1KQ0 A;  1APL C;  3GLL A;  1OMI A;  4CUG A;  3FXR A;  1LQ1 A;  2QQA A;  2MAB A;  3S1M J;  3MFK A;  3L9F A;  3LST A;  1ITY A;  4AID A;  4C3J J;  4XN3 A;  3EPZ A;  3A03 A;  4Y4R A;  4IHW A;  5K5Q A;  1ZH5 A;  5HOO A;  3TP0 A;  4E7S A;  2B9S A;  3QU3 A;  1NG7 A;  2YUS A;  1J59 A;  3GYH X;  1ZG5 A;  3E7L A;  1P4X A;  4ZZL A;  3AAF A;  4LG0 B;  1EH6 A;  1X19 A;  5EZG A;  1B8I B;  4AM3 A;  2TCT A;  3HOW J;  2VE8 A;  3BQY A;  1HBX G;  3VYS B;  2NVY J;  4A3K J;  1FP1 D;  4D7M A;  4BNC A;  5HLT A;  2QM3 A;  1X4O A;  3IH3 A;  1R71 A;  2JUG A;  5E8I A;  3OV8 A;  1FIP A;  1GV5 A;  2GWR A;  1NK3 P;  4L18 B;  2DOE A;  4CHU A;  4G6Q A;  2MGQ A;  4I7H A;  3ASN H;  3SFZ A;  4KT6 A;  4MEY F;  4XRF A;  2CRG A;  3ZMS A;  1Y1V J;  2DJI A;  2DBB A;  2MC3 A;  4WCG A;  4ETS A;  6PAX A;  2MG4 A;  5D4S A;  4EMS A;  2Q8K A;  4IOA F;  4JX5 A;  5AIP A;  2DDA A;  4GGG A;  4A2U A;  4ZYH A;  3K6G A;  4ZH4 F;  2HI3 A;  2LKS A;  2JWT A;  1AOY A;  3KP3 A;  4AYB A;  5JI6 A;  2DFF A;  1V5E A;  1CQT A;  3Q5F A;  1W36 C;  4IHV A;  1ULY A;  2NOJ B;  5DM6 F;  1BN5 A;  2L5Q A;  1LPQ A;  1Z9C A;  1HCR A;  1MMA A;  2HQ5 A;  1HKT A;  3OL3 A;  2FMY A;  4DIQ A;  1BA5 A;  2X6O A;  5ICF A;  1S9H A;  1W5S A;  2C6Y A;  1YOV B;  3BC8 A;  3QPH A;  3T5X A;  1KU2 A;  5J8F A;  3O6B B;  3HOX J;  1X3W B;  4PCQ A;  4EQQ A;  4A6E A;  1J2X A;  3AL0 B;  2CJJ A;  2XRO A;  2X4H A;  5L3E A;  3JSP A;  1IGN A;  4M3D A;  4M3F A;  5KHD A;  3QYB A;  4UY8 I;  1OCZ H;  3P7N A;  2HU9 A;  2LVS A;  3I9V 2;  2HFH A;  3UKG A;  4XOP A;  2K7L A;  2HYF A;  3AG4 H;  5KK1 A;  2IS6 A;  2TRT A;  1IN7 A;  3LA3 A;  1N25 A;  3B6C A;  1H0M A;  2COB A;  1L3L A;  2DMT A;  1IN6 A;  4UUV A;  1NTC A;  2Z5U A;  3F3X A;  5H6R A;  4A3E J;  1ZRF A;  2ZJQ F;  4IZZ A;  2IPQ X;  1OKR A;  2QA4 I;  2B63 J;  2XC7 A;  3IKT A;  4O3M A;  2QGU A;  4P9F A;  3HUG B;  5HNF A;  1WFX A;  4AIK A;  4XLA A;  1IN5 A;  1MND A;  1O7F A;  3F6O A;  1VQ5 I;  3BWG A;  5EGO B;  1VQ4 I;  2OUM A;  3W6J B;  3K2A A;  2A5W A;  2CMP A;  3K10 A;  2VXZ A;  1BW5 A;  4HX4 A;  3OS0 A;  2CUF A;  1K61 A;  3CCV I;  2KJB A;  2BBY A;  2XKP A;  1R5G A;  2KIS A;  2LKP A;  2AXT C;  2XV4 S;  4AYB N;  3F8B A;  1AU7 A;  4L5J A;  3ZQQ A;  5E1X A;  4II3 A;  3UNG C;  2WY7 Q;  2ZME B;  4C3H J;  4J19 A;  1ETK A;  2DT6 A;  1UEL B;  1RIO H;  4BAC A;  2DJN A;  4A3F J;  2E5Z A;  2XHK A;  1P9Q C;  2X0L A;  2LDU A;  4LGW A;  2L7Z A;  3QP6 A;  1X1B A;  4YFK F;  1HF0 A;  3HSR A;  2M1B A;  4IQJ A;  4XQF A;  2K4J A;  1ETO A;  3KLN A;  3OR1 C;  4PUS A;  3MKL A;  4XKV A;  3RZO J;  3TBI A;  5EF6 A;  1E3O C;  2F4M B;  1LDJ A;  2H6C A;  1BI0 A;  3IH4 A;  2Q1Z B;  1YFH A;  3O2P E;  1Q1H A;  5IY5 H;  2P4W A;  1SFU A;  3M07 A;  3J7Y J;  5A2Q K;  1S7A A;  1AA7 A;  1FEX A;  4NB5 A;  1QPI A;  2JA2 A;  3Q9V A;  2JUC A;  4NBQ A;  2LBF A;  1WQ2 A;  1ZLJ A;  3L2V A;  3M8J A;  1UST A;  1G8X A;  3NEU A;  4OAY A;  3ZMT A;  3ZQI A;  3RYP A;  4ZC3 A;  3J7A O;  3HOS A;  3HG9 A;  3DEW A;  3K4N A;  3EUH C;  2V26 A;  2DOF A;  1XC5 A;  3SEQ A;  1QQI A;  3LQR A;  5DEQ A;  4G9Y A;  2Q2E A;  3MN2 A;  3AG3 H;  5DV5 A;  3ZQH A;  1JJ8 C;  3BTC A;  1X58 A;  1OJL A;  2E71 A;  3E5U A;  1Q1V A;  2DFE A;  2HVQ A;  4RM3 A;  3RI4 A;  2OF7 A;  3AG1 H;  2PG4 A;  3KZZ A;  5E3O A;  4ESJ A;  2H6B A;  2YX4 A;  3TOB A;  3PO3 J;  4O5V A;  5E17 F;  4IL6 C;  3K1P A;  5ICE A;  2QEN A;  3VOE A;  2VPL A;  2M30 A;  4MTD A;  3FHZ A;  1D0Y A;  2IRF G;  2H94 A;  1VQP I;  2JMW A;  2VQC A;  2IW5 A;  2L7F P;  2HYG D;  1L0O C;  3U9G A;  3ZN0 A;  5H2F C;  1K4S A;  4XMY A;  4NNJ A;  3RJP A;  4EM2 A;  2DMU A;  1BC8 C;  3S15 J;  4BXX J;  1E0E A;  4RGS A;  3WTT C;  2MYS A;  4HPQ A;  5CVR A;  2A3S A;  1FOK A;  3A1Y A;  4M3B A;  1IZ1 A;  4E7H A;  5HLG A;  3BCB A;  3OY9 A;  2H8R A;  4BQN A;  2X48 A;  3OYE A;  2ZBK A;  1SVO A;  2UXN A;  1FT9 A;  2MH9 A;  2W48 A;  3I5U A;  4UV9 A;  3RPU A;  3LMM A;  1O3Q A;  4UVB A;  4Q5S F;  2VQG A;  1GVD A;  1TWC J;  3TW7 A;  1S29 A;  1FSE A;  1Y8Q B;  3ZOB A;  1ONV A;  3E97 A;  1S5L C;  1FSH A;  2KPM A;  2VL8 A;  1JXS A;  4BEH B;  5EEG A;  3BR2 A;  5DD4 A;  2RVC A;  2OTJ I;  2JZY A;  4RA2 A;  3HC7 A;  4YEJ A;  3C7J A;  3GTM J;  2WAF A;  5FKO A;  1P7I A;  2KKO A;  5L3F A;  2WAE A;  5FLV A;  3DTE A;  3DBR B;  3TL4 X;  2RN7 A;  1Y8R B;  4CCJ A;  2VJJ A;  5C4J J;  2GM4 A;  4IKF A;  3JRD A;  2VQL A;  5JLX A;  2PBI A;  5GPC A;  5D4R A;  2BXY A;  1O3R A;  3KLO A;  2ESN A;  4EJV A;  4B1R A;  4HLY A;  3K4K A;  3EQL F;  3JTH A;  2COM A;  1MH3 A;  2VT3 A;  1LNW A;  5BMZ A;  2DMQ A;  4D5F A;  2KIQ A;  2P7V B;  1DGR M;  3LSI A;  4KIB A;  1X1D A;  2M5W A;  2WAQ A;  3V8L A;  4F7Z A;  2O0Y A;  4HG2 A;  4HV6 A;  2NOG A;  3CUO A;  3K4B A;  1WWX A;  1KQ8 A;  1MMD A;  1QZY A;  2CV2 A;  1WJ5 A;  1HW5 A;  2LF8 A;  3GTL J;  1TQP A;  3Q0V A;  3M1C A;  1JT0 A;  3RPU D;  1N78 A;  5CKT A;  2HKO A;  2VB6 A;  3K1N A;  2WA0 A;  3SZP A;  3RTR A;  3G71 I;  4G6T B;  4Q4Z F;  1Z1D A;  2HDW A;  1QGP A;  3DFG A;  3WGH A;  2DA3 A;  1F4K A;  2GAU A;  2CSO A;  3BRO A;  2HS5 A;  4GXO A;  3OYF A;  4YEL A;  3K4J A;  1E17 A;  4RMN A;  1JGS A;  3BLY A;  4XKW A;  2QKM B;  4QSH A;  5TGT A;  3S2D J;  1WKM A;  5IPA A;  5H6Q A;  2Y9Z A;  2ADU A;  3FXK A;  1K79 A;  1S6L A;  3W3C A;  1VQ6 I;  4U0V A;  2VKE A;  2KRH A;  5BPI A;  3E0J B;  3E3V A;  1X2N A;  5CLS A;  2WAD A;  2VN2 A;  2UWM A;  2M2E A;  2G0E A;  5IP6 A;  2P6T A;  2L2O A;  3HRT A;  1PYV A;  3BJA A;  5M3M J;  2LY1 A;  1XB4 A;  5M5W J;  1IO2 A;  2F6C A;  1Y6I A;  5K7H A;  4E7L A;  1MBK A;  3JAM Z;  4NQW A;  3TP3 A;  4GYG A;  4UUS A;  4WXD A;  1KQ9 A;  1XPX A;  1Z67 A;  3CJT B;  5LGT A;  2FNA A;  1GV2 A;  2V1D A;  3RKW A;  2XSD C;  2FBI A;  2HTJ A;  3LQQ A;  2UV1 A;  2HKX A;  3OOP A;  1U9N A;  3BT9 A;  4GDF A;  4KN7 X;  1JE8 A;  4I02 A;  2XF6 A;  2JN6 A;  4DGW B;  1U5T B;  2VPR A;  3FIS A;  3HGY A;  3GTK J;  1FY7 A;  2E2I J;  1B72 A;  2JA6 J;  4V2G A;  4S05 A;  4OIP F;  2QSG X;  2NNN A;  2ZNY A;  5JR3 A;  3LAP A;  2N8G A;  3JRH A;  1BOB A;  2AHQ A;  1PVE A; 
#chains in the Genus database with same CATH homology
 1MJB A;  3LAJ A;  2CFX A;  1T98 A;  1D3Y A;  4HDV A;  1FC3 A;  3FMR A;  4KMU X;  3I59 B;  4ENN A;  5ERI A;  3F8F A;  4KYW A;  1ZRE A;  1SFE A;  3FM3 A;  1DPR A;  2XKO A;  2YX7 A;  2P5V A;  3GWZ A;  4P96 A;  2R7F A;  1TW3 A;  5CYV A;  1R1V A;  2H09 A;  4PGG A;  1ZAR A;  4R1H A;  5LEJ A;  3H3U A;  2FOK A;  5J8C A;  2V1X A;  1FZP B;  4IRH A;  1XCB A;  3HHG A;  4G94 A;  4OIR F;  3V8K A;  1BM9 A;  2KJC A;  2IJL A;  4HA8 A;  4LMY A;  2ESH A;  2DK5 A;  4BHB A;  5ED4 A;  2JTV A;  1B1B A;  3TKY A;  4B09 A;  2K27 A;  1I6X A;  1FBS A;  2EWN A;  4UV8 A;  2F5E A;  2GIV A;  4EGZ A;  3LWF A;  2DT5 A;  4MQV A;  2O03 A;  4HQM A;  4CGZ A;  1OR7 A;  1GXP A;  2QVO A;  4DQ2 A;  2QBY A;  2UXX A;  1U2W A;  2HWV A;  2MH2 A;  1GVJ A;  2Y75 A;  4U88 A;  2WC2 A;  3IWF A;  1BBY A;  1F1Z A;  2D1H A;  3JAM K;  4RAY A;  1SFX A;  2RV8 A;  2K86 A;  1FLI A;  3FMQ A;  3DV8 A;  1FX7 A;  4LB5 A;  4CDG A;  2K4B A;  2A5Y B;  5FB2 A;  1XSD A;  5DUK A;  2RDP A;  4A0Y A;  3DEU A;  4GYI A;  3ECO A;  4IRI A;  3ZMD A;  3QPT A;  3V4G A;  3GFI A;  4WXH A;  5KVR A;  4G7O F;  5FLX K;  1WRJ A;  1BJA A;  5D5X B;  2DAO A;  2QYO A;  3HSF A;  4N0B A;  2PI0 A;  2ZCW A;  4H0E A;  4OMZ A;  3DKW A;  4RGX A;  1MKM A;  2ELH A;  3HUG A;  4M6Y A;  3ML6 A;  1ODD A;  3I0T A;  2LSO A;  1MDM A;  1U8R A;  4DNC A;  3IC7 A;  4Q47 A;  2A69 F;  2LF7 A;  2GA2 A;  1RNL A;  5CJ9 A;  1YG2 A;  3GFJ A;  1ON2 A;  5HDK A;  1XN7 A;  3R0J A;  3C3W A;  4AVP A;  4L9J A;  5DCF A;  3J81 Z;  2R7D A;  2QQB A;  3F21 A;  1MGT A;  4Q48 A;  2GQQ A;  4HAM A;  2DPU A;  1CF7 A;  5DYM A;  2IA2 A;  3PFI A;  3R61 A;  2F5C A;  2KIU A;  3BZ6 A;  3GUD A;  3LA7 A;  1UCR A;  1XGO A;  2Q0O A;  3FF5 A;  1TNT A;  4Y17 A;  3GZ5 A;  2A6H F;  4RB3 C;  4JQF A;  1R23 A;  1W7P D;  3CUQ C;  4LLG F;  4EJO A;  1BI3 A;  1TLH B;  4QLC U;  4BH9 A;  3ZMU A;  4IRG A;  5A2Q Z;  3P9C A;  4LK1 F;  3KEQ A;  2PMH A;  2ZKZ A;  2OU2 A;  3NQO A;  4ASN A;  4ESF A;  2Y0M A;  5DUI A;  2OZU A;  3GF2 A;  1HKQ A;  1SD5 A;  3LFK A;  2W84 A;  4D0P A;  2H27 A;  3K69 A;  3ULQ B;  5FLX Z;  4YG2 F;  1S7O A;  2HR3 A;  2NNY A;  2GXG A;  5DCM B;  1QZZ A;  1QO0 D;  3CO6 C;  3WG9 A;  4U0Y A;  3F22 A;  4UVA A;  5L3C A;  1CF7 B;  4YFN F;  2Y48 A;  4HW0 A;  4LG0 A;  3JTG A;  3F23 A;  1K78 A;  1YYV A;  2YU3 A;  3SHF A;  4L9N A;  2VBZ A;  3HRU A;  1ZRD A;  2PFB A;  1I5Z A;  4WF2 A;  3HRM A;  2DTR A;  5IT9 Z;  1MD0 A;  2ACJ A;  1IXR C;  3F6V A;  1P4W A;  1ZYR F;  3WE3 A;  4B8X A;  5E20 A;  4WX9 A;  1D5V A;  3HSE A;  3T0Y A;  4IVN A;  2XGX A;  2VBW A;  2P5L C;  1U6G A;  3WOD F;  1O7L A;  4UXN A;  3I4P A;  2MLK A;  3FX3 A;  1KU3 A;  5D8K B;  3K1M A;  2V79 A;  3VB2 A;  5D6E A;  1Z91 A;  2G7U A;  1DP7 P;  5IT3 A;  3MZH A;  3CLO A;  2IA0 A;  2XVC A;  3MAJ A;  1BIA A;  2CGP A;  1T39 A;  3IRR A;  1HSJ A;  1T6S A;  2VOO A;  1P4A A;  1IN4 A;  2ZO4 A;  2JPC A;  3VOD A;  1Z05 A;  4WXC A;  5CVU A;  3ZMZ A;  4IPA A;  1Z7U A;  4HV5 A;  5IT9 K;  4MEX F;  1W7P A;  2AXL A;  5FFZ A;  4MGR A;  1U5T A;  1T2K A;  4CYD A;  1YLF A;  2V6C A;  3EET A;  5K1Y A;  4BXU A;  3L00 A;  1XCV A;  4HBL A;  4HF2 A;  1R22 A;  2MLG A;  1YW7 A;  5JHU A;  2DQR A;  2FML A;  5AIQ A;  3ROU A;  1W5T A;  3SQN A;  2L54 A;  2O8X A;  4BAY A;  4ENM A;  1R7J A;  1UB9 A;  1WSU A;  3QOP A;  3V8J A;  4HYE A;  1Z6R A;  3DPL C;  2NS0 A;  3U2R A;  2STT A;  3K0L A;  4IHS A;  2A6E F;  4Y13 A;  3QRF F;  5J6X A;  2E1C A;  3TOA A;  2WWY A;  4U0W A;  3I59 A;  3RKY A;  3GO5 A;  1SD7 A;  3QU6 A;  3GEZ A;  3GLX A;  2CG4 A;  2EA4 A;  4XLP F;  2NYX A;  2IA1 A;  4RB0 A;  1G3Y A;  1R1T A;  2JRT A;  3I54 A;  3WTU C;  3BOQ A;  1K7A A;  4U7D A;  2VON A;  1BIB A;  2VBX A;  4EM1 A;  4KN4 X;  3GW2 A;  4OIN F;  2E1N A;  3WU0 A;  2OA4 A;  3CUQ B;  1PP8 F;  4I01 A;  1DUX C;  1PDN C;  1K6O A;  1Z6T A;  1YO5 C;  4AWX B;  4LB6 B;  4UVC A;  5H20 A;  3EYY A;  3F8C A;  2E7W A;  4EJW A;  1FNN A;  1J75 A;  1UHW A;  3R6S A;  1YS6 A;  1REP C;  4QWQ A;  5K5O A;  2XRN A;  4YIF A;  4OOI A;  3VFZ A;  5D5U B;  3HOT A;  2WV0 A;  2JPB A;  2DW4 A;  1U78 A;  3JSO A;  1FP2 A;  5LRR A;  4IHT A;  5F6F A;  2HZT A;  4UHT A;  1AWC A;  2W85 A;  4Z2Y A;  2L4M A;  2HGC A;  4BHP A;  1H9G A;  3BJ6 A;  5FO5 A;  1LVA A;  3GZ6 A;  1MJ9 A;  1G6N A;  2PQ8 A;  3K2Z A;  3HIF A;  4R79 A;  3IL2 A;  3GXO A;  2Z33 A;  1MZB A;  1FBQ A;  2FEZ A;  2OBP A;  3J80 K;  3KP6 A;  5LGU A;  4M74 A;  1JHF A;  3E6D A;  3PQJ A;  4I0A A;  2J5O A;  3M8E A;  1HXD A;  3IWZ A;  3E5X A;  3TDU C;  5ICG A;  3N4M A;  1FYK A;  1XD7 A;  3HRS A;  2NAZ A;  1IXS B;  1TBX A;  4G7Z F;  1ZHF A;  3RYR A;  5AON A;  3SXY A;  3TO7 A;  2D1V A;  3C1D A;  3IKV A;  3T1B A;  4A0X A;  3E6B A;  3RPQ A;  4L9T A;  2VC0 A;  5HLH A;  4ZYG A;  2P7C B;  3CDH A;  2O61 A;  4EJT A;  1FBU A;  4KDP A;  3DPT A;  1J5Y A;  5LHH A;  1TW2 A;  4HF1 A;  1NHA A;  2EFP A;  1SMY F;  1BI2 A;  2EJR A;  5CVV A;  2M45 A;  5D5W B;  5DCM A;  3DF8 A;  5HS8 A;  2ISY A;  3J80 Z;  5BPD A;  1B6A A;  2TDX A;  5F64 A;  3RIR A;  3KE2 A;  2KIM A;  4G6D A;  5CVI A;  1CGP A;  2QBY B;  3LA2 A;  1ZAO A;  2CO5 A;  3T8R A;  4EJU A;  2RKH A;  4M72 A;  1YTY A;  2AS5 F;  3KP5 A;  4L9V A;  2EV0 A;  2F2E A;  4HX8 A;  3WGG A;  2LNB A;  4FT8 A;  5L3B A;  1U5T C;  5E1Z B;  3TDZ C;  2VE9 A;  4GCV A;  4CIC A;  4A12 A;  3WTY C;  3E6C C;  3L09 A;  4KFC A;  4KA4 A;  4G7H F;  3BY6 A;  3BJO A;  3ELK A;  3S2W A;  1XMA A;  4M71 A;  4AD9 A;  1R1U A;  1FPQ A;  3WTS C;  3I53 A;  5K5R A;  1I1G A;  3G3Z A;  2KRF A;  4M9X A;  2PMU A;  3EYI A;  1FYL A;  3V7S A;  3VEP A;  4E70 A;  3ECH A;  1EV7 A;  4HQE A;  1G3S A;  2UZK A;  5CVJ A;  4IJA A;  1UHM A;  4CXF A;  3BDD A;  1HST A;  4FX4 A;  5TJJ A;  2L3D A;  1USS A;  2ZME A;  3PQK A;  3WTX C;  3TQN A;  3C18 A;  1B4A A;  1IAW A;  1TQI A;  5HS9 A;  1X3U A;  2K02 A;  2BYV E;  5LHI A;  2DLL A;  2GZW A;  1ZG1 A;  1BC7 C;  2W57 A;  4IXA A;  3U1D A;  3ZQ7 A;  3CJN A;  3I71 A;  4IF4 A;  2VC1 A;  4R8H A;  4N9I A;  2O6G E;  3M8F A;  1RZ4 A;  1I27 A;  3WGI A;  3FXU A;  4BHC A;  2EFN A;  1H9T A;  4TV7 A;  1YIO A;  2R3S A;  4Y15 A;  4MTE A;  1V4R A;  4I09 A;  1SAX A;  2HEO A;  4A5N A;  3COA C;  3WU1 B;  1R5H A;  4K2E A;  4RB2 C;  2FQ3 A;  5HLI A;  1ZLK A;  4WK8 F;  2B0L A;  1P92 A;  4I98 B;  3QAH A;  4P5O A;  2PJP A;  2ETH A;  5HS7 A;  1ON1 A;  1XMK A;  2XAS A;  5HDG A;  2NRA C;  2IT0 A;  1OYW A;  2RGV A;  4KMF A;  2QWW A;  1IRF A;  2YPR A;  1KU7 A;  2GA1 A;  2OD5 A;  2GXB A;  3TGN A;  5LRS A;  3HHH A;  2EV5 A;  4KIG A;  1SD6 A;  3DXJ F;  4ON0 A;  4MHG A;  2D2W A;  3IHU A;  4RS8 A;  4MNU A;  2O3F A;  3O3K A;  2FSW A;  4L0Z B;  2QQ9 A;  3MEX A;  1OYY A;  4YFX F;  3WE2 A;  3MCZ A;  4UNO A;  2CYY A;  2V9V A;  1S8N A;  2HQN A;  3KZY A;  1B59 A;  2XUB A;  1YQA A;  2VOD A;  3E5Q A;  3I58 A;  4JBA A;  2XAQ A;  1LDK B;  2ZNZ A;  3TO9 A;  1RUN A;  2HOE A;  1XSV A;  3ZPL A;  3WTV C;  2ZJ2 A;  1I1S A;  2HQR A;  2G9W A;  4ENK A;  1UFM A;  1G3T A;  3G73 A;  5BS6 A;  1D8K A;  1RI7 A;  5D6F A;  3NRV A;  1J7K A;  3K9T A;  3RDI A;  4WWC A;  2DO7 A;  4LLN A;  2JSC A;  2A07 F;  5FFX A;  3ZP5 A;  2OQG A;  2OQR A;  1ZN2 A;  2PLY A;  1EH7 A;  2FA5 A;  1C0W A;  2EFO A;  2DK8 A;  1LB2 A;  1Y0U A;  1BOA A;  2V1U A;  1KU9 A;  2J5P A;  5ILV A;  2BGC A;  2MBF A;  2CWE A;  4EVI A;  1ZG3 A;  5L3G A;  4BYY A;  2P6S A;  4XSX F;  4U7B A;  3DQV C;  2JT1 A;  3BPV A;  4OIO F;  1IXC A;  3WTW C;  3N97 A;  1JHH A;  1J9I A;  3GVA A;  5HDN A;  2F5F A;  3FXQ A;  4XSZ F;  1D8J A;  2BE5 F;  4KUM A;  3ZMV A;  2L02 A;  4OMY A;  3GFM A;  1MJA A;  5E1W A;  5BOX A;  4KNY A;  3I64 A;  4HZF A;  2G7H A;  4MQ9 F;  5ILU A;  1WI9 A;  4I2O A;  2MA3 A;  2RNJ A;  3TO6 A;  2FBK A;  2ZXJ A;  3KP7 A;  3FM5 A;  4OU0 A;  4A6D A;  2HDC A;  4M6X A;  4FX0 A;  4EV0 A;  2CW0 F;  1XDS A;  1PUE E;  1XDU A;  1T0F A;  3H92 A;  1U3E M;  4P55 A;  1O57 A;  4RAZ A;  4M9S A;  4NHJ A;  1P6R A;  3M1E A;  1B9N A;  3FMS A;  1EH8 A;  1STZ A;  4CO8 A;  1R36 A;  5LLQ A;  2YSR A;  4LFU A;  1XGM A;  2FRH A;  3M7G A;  3SZT A;  2XAG A;  3B73 A;  4XBF A;  5E8G A;  2A68 F;  5LEK A;  3IRQ A;  1RUO A;  3BPX A;  4RGU A;  5JVT A;  1IN8 A;  3R0A A;  4XLN F;  3EUH A;  1IRG A;  4PGH A;  1TTY A;  3F8N A;  4HLX A;  2FF4 A;  1QBJ A;  2FU4 A;  4I0B A;  2STW A;  5FGM A;  3HYI A;  3Q9S A;  1LEA A;  3CTA A;  3ERE D;  3D5L A;  4N9H A;  4KT5 C;  1O3S A;  2RQP A;  1R58 A;  1HKS A;  3EDP A;  2ISZ A;  2EB7 A;  2L01 A;  2DU9 A;  3GFL A;  1TQM A;  4P9U A;  3ZN1 A;  5DDG A;  4AIJ A;  2F5D A;  2HTS A;  5FD6 A;  3MZY A;  3L2C A;  1GXQ A;  3T8T A;  2VBY A;  2FBH A;  1SMT A;  3KET A;  1G3W A;  4ENJ A;  4GO1 A;  2P8T A;  1HQC A;  3WTZ A;  2OZ6 A;  1IUY A;  2BV6 A;  1ZGJ A;  5DD8 A;  2XAH A;  4LD5 A;  1VTN C;  1QNT A;  2M8E A;  3GX4 X;  1O3T A;  1V3F A;  1LJ9 A;  2DI3 A;  3R4K A;  4HF0 A;  3W6K B;  5LHG A;  5ILS A;  5BQT A;  1OPC A;  1KGS A;  4YII A;  5LGN A;  2IVM A;  2L4A A;  1IF1 A;  1YW8 A;  4JK1 X;  4ZYD A;  1ZRC A;  2VOP A;  5HVQ C;  2QUF A;  2XAF A;  1QPM A;  5ICC A;  3FWE A;  3J81 K;  1SD4 A;  1GHC A;  4O6J A;  1KYW A;  3KP4 A;  2EA2 A;  1T38 A;  2EV6 A;  1PP7 U;  3P9K A;  4EGY A;  5JFR A;  2ZFW A;  1P2F A;  1KA8 A;  5EEH A;  2DPD A;  3L7W A;  3KFW X;  4PZJ A;  4HOB A;  1LDD A;  1FWZ A;  2VT2 A;  1W4M A;  2QZ8 A;  4LJZ F;  4LLL A;  4LK0 F;  1E2X A;  1BI1 A;  2FNP A;  2Z3Y A;  3MWM A;  4FHT A;  3P9I A;  2OAZ A;  2WTE A;  2A61 A;  3F8M A;  2DQL A;  4HDU A;  2EFQ A;  1DDN A;  1FYM A;  2FXA A;  2Z99 A;  3R60 A;  4M73 A;  4CZZ A;  2IP2 A;  4A5M A;  3MQ0 A;  5E18 F;  4HX7 A;  4L0Y B;  2P5K A;  5FD5 A;  3CO7 C;  1XSX A;  4OIQ F;  4A0Z A;  2KIF A;  4BQA A;  1A04 A;  4RGR A;  3KEO A;  2QLZ A;  4PDK A;  3ISP A;  3KCC A;  1R00 A;  3CUQ A;  2W24 A;  2XAJ A;  3FZV A;  2Z9O A;  1OYI A;  2CQK A;  4ZZD A;  5D8L B;  1MDM B;  1K78 B;  3F72 A;  2E7X A;  3V7C A;  2EFW A;  2DFI A;  1F9N A;  3B02 A;  1XGS A;  2M87 A;  3M9A A;  3HTU A;  3D0S A;  4RB1 A;  2D45 A;  1HW2 A;  2RC4 A;  1LEB A;  1HW1 A;  2W25 A;  4S04 A;  3H3Z A;  5F1R A;  1J0R A;  3DP7 A;  2YR2 A;  2PN6 A;  2FE3 A;  1IW7 F;  3REO A;  1TNS A;  3RKX A;  1KYZ A;  4M9Z A;  3KP2 A;  4AIH A;  2MD5 A;  3QP5 A;  3ABU A;  3JW4 A;  2BEO A;  1G4D A;  5D5V B;  4EM0 B;  1YS7 A;  3HTS B;  1F5T A;  1XGN A;  2XIG A;  1YW9 A;  1DPU A;  2EK5 A;  5LBQ A;  1S3J A;  1B9M A;  4ESB A;  5TRD A;  1ZGA A;  5L3D A;  4ZYE A;  3E6M A;  3BP8 A;  4G8X A;  3V7R A;  1W7P B;  4L5I A;  4KIC A;  3ABT A;  4KIF A;  2PEX A;  1KQ0 A;  1OMI A;  3FXR A;  1LQ1 A;  2QQA A;  3MFK A;  3L9F A;  3LST A;  5K5Q A;  1ZH5 A;  5HOO A;  3QU3 A;  1J59 A;  3GYH X;  1ZG5 A;  1P4X A;  4ZZL A;  3AAF A;  4LG0 B;  1EH6 A;  2VE8 A;  1HBX G;  1FP1 D;  4BNC A;  2QM3 A;  5E8I A;  3OV8 A;  2GWR A;  4L18 B;  4CHU A;  4G6Q A;  4I7H A;  3SFZ A;  4MEY F;  4XRF A;  3ZMS A;  2DBB A;  2MC3 A;  4WCG A;  4ETS A;  6PAX A;  5D4S A;  4EMS A;  2Q8K A;  5AIP A;  4GGG A;  4A2U A;  4ZYH A;  4ZH4 F;  1AOY A;  3KP3 A;  5JI6 A;  3Q5F A;  1ULY A;  1BN5 A;  1Z9C A;  1HKT A;  2FMY A;  5ICF A;  1W5S A;  2C6Y A;  3QPH A;  3T5X A;  1KU2 A;  5J8F A;  3O6B B;  4PCQ A;  4EQQ A;  4A6E A;  1J2X A;  2XRO A;  2X4H A;  5L3E A;  3JSP A;  3P7N A;  2HFH A;  2K7L A;  2HYF A;  5KK1 A;  1IN7 A;  3LA3 A;  1H0M A;  1L3L A;  1IN6 A;  4UUV A;  2Z5U A;  3F3X A;  5H6R A;  1ZRF A;  2IPQ X;  1OKR A;  3IKT A;  4O3M A;  4P9F A;  4AIK A;  1IN5 A;  3F6O A;  1O7F A;  3BWG A;  3W6J B;  2VXZ A;  4HX4 A;  2KJB A;  2BBY A;  2XKP A;  1R5G A;  2LKP A;  2XV4 S;  3F8B A;  4L5J A;  5E1X A;  2ZME B;  1RIO H;  2XHK A;  2X0L A;  2LDU A;  4LGW A;  4YFK F;  3QP6 A;  3HSR A;  2M1B A;  2K4J A;  3KLN A;  1LDJ A;  2H6C A;  1BI0 A;  1YFH A;  3O2P E;  1Q1H A;  2P4W A;  1SFU A;  5A2Q K;  1S7A A;  4NB5 A;  3Q9V A;  1WQ2 A;  1ZLJ A;  1UST A;  3NEU A;  3ZMT A;  3RYP A;  3J7A O;  3HOS A;  1QQI A;  3LQR A;  5DEQ A;  4G9Y A;  2Q2E A;  5DV5 A;  3E5U A;  3RI4 A;  2PG4 A;  3KZZ A;  4ESJ A;  2H6B A;  2YX4 A;  3TOB A;  4O5V A;  5E17 F;  3K1P A;  5ICE A;  2QEN A;  3VOE A;  2M30 A;  4MTD A;  3FHZ A;  2IRF G;  2H94 A;  2IW5 A;  2HYG D;  1L0O C;  3U9G A;  3ZN0 A;  3RJP A;  4EM2 A;  1BC8 C;  4RGS A;  3WTT C;  5CVR A;  2A3S A;  1FOK A;  1IZ1 A;  5HLG A;  2ZBK A;  2UXN A;  1FT9 A;  2MH9 A;  3I5U A;  3RPU A;  4UV9 A;  1O3Q A;  4UVB A;  4Q5S F;  1S29 A;  1FSE A;  1ONV A;  3E97 A;  1FSH A;  1JXS A;  5EEG A;  5DD4 A;  2RVC A;  2JZY A;  3C7J A;  2KKO A;  5L3F A;  2RN7 A;  2PBI A;  5D4R A;  1O3R A;  3KLO A;  2ESN A;  4EJV A;  4HLY A;  3EQL F;  3JTH A;  2COM A;  2VT3 A;  1LNW A;  5BMZ A;  2P7V B;  4KIB A;  3V8L A;  2M5W A;  4F7Z A;  2O0Y A;  4HV6 A;  3CUO A;  1WWX A;  1KQ8 A;  1QZY A;  1HW5 A;  2LF8 A;  1TQP A;  3SZP A;  2HKO A;  3K1N A;  3RTR A;  4Q4Z F;  1Z1D A;  3DFG A;  1QGP A;  3WGH A;  1F4K A;  2GAU A;  2CSO A;  3BRO A;  2HS5 A;  4GXO A;  1E17 A;  1JGS A;  1WKM A;  5H6Q A;  2ADU A;  1K79 A;  1S6L A;  4U0V A;  5BPI A;  3E3V A;  5CLS A;  2VN2 A;  2UWM A;  2P6T A;  3HRT A;  3BJA A;  1XB4 A;  3JAM Z;  4NQW A;  4GYG A;  4WXD A;  1KQ9 A;  5LGT A;  2FNA A;  2V1D A;  3RKW A;  2FBI A;  2HTJ A;  3LQQ A;  2HKX A;  3OOP A;  4KN7 X;  1JE8 A;  4I02 A;  1U5T B;  1FY7 A;  4OIP F;  4S05 A;  2NNN A;  2ZNY A;  5JR3 A;  3LAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...