3WTYC

Crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSPPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 41
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wtyC00
3WU0A 5DCMA 1HSTA 5EEHA 4RGXA 4Y17A 3TDZC 1R00A 3L00A 2OQRA 3V8LA 2EB7A 4UXNA 3RTRA 2EV0A 2V1XA 1I1GA 4MEYF 1EV7A 5JHUA 3F72A 5LRRA 2XROA 2OU2A 1UCRA 5H20A 3V7CA 4EV0A 4Y13A 2IVMA 3P7NA 1XN7A 2W84A 3QAHA 3O6BB 4I98B 2CSOA 1G4DA 1ODDA 3L09A 3K0LA 3LA3A 5ILUA 1C0WA 3WG9A 3SQNA 5LHGA 4UNOA 2M1BA 5FFXA 2BV6A 3IKTA 2UXNA 1DPUA 5A2QK 3G73A 1TQPA 4U88A 3HSEA 2BYVE 4G7ZF 5E17F 1JGSA 3U2RA 3Q9VA 2FSWA 3JTHA 3D5LA 1HW1A 5J6XA 2M5WA 5BQTA 3F23A 2L02A 2E1CA 2RC4A 1R23A 5D8LB 3FM3A 3RI4A 2JRTA 2P7VB 3K2ZA 3ABTA 3NRVA 1YW8A 1TNTA 1SMYF 1FBSA 1XDUA 2JPCA 3NEUA 2NAZA 2YU3A 4EGZA 3FHZA 4EGYA 3WTXC 2DK8A 4HQMA 5HVQC 2FBIA 5CYVA 3E5XA 2ESHA 4GCVA 5F64A 1BIAA 1IXCA 3MEXA 4KICA 3IKVA 1BI1A 2PMUA 1U5TC 3KZZA 3GO5A 1YFHA 4HF1A 2PBIA 5CVJA 1X3UA 2ESNA 1S6LA 4DNCA 1SD4A 3F8BA 2OZUA 1BC8C 5E1WA 3I5UA 3RKYA 1P4XA 2F5EA 3V8KA 1UFMA 5D6FA 1ON2A 4FX4A 2FNPA 3LAPA 1Z7UA 1MJBA 2G9WA 2VC0A 2ADUA 1LQ1A 4S04A 4DQ2A 5FFZA 3KFWX 1BN5A 2CWEA 3QP6A 1XSVA 3GFLA 3KP7A 3W6KB 1KU7A 1LDKB 4MEXF 5HOOA 5ILSA 1TQMA 3CDHA 2L54A 3C18A 2A3SA 2P5VA 2P8TA 5EEGA 1B59A 3LFKA 4EJUA 3RDIA 4UVCA 4MQ9F 4AD9A 1MGTA 4LK0F 2VC1A 3CTAA 4LMYA 1SFXA 3KE2A 1R36A 1JHFA 2KIUA 1GVJA 4R79A 1IUYA 2GWRA 4P55A 5JVTA 4HV5A 1Z6TA 2FNAA 4Q47A 4LG0B 3HUGA 4I01A 4MQVA 3W6JB 4Y15A 4KA4A 2P4WA 2DBBA 2EV6A 2RKHA 3J80K 4IXAA 3FWEA 4IHTA 1XSDA 1T2KA 5HLHA 2HYFA 4CGZA 1J7KA 4GXOA 2DK5A 5LGTA 1K78A 2CQKA 1R58A 1IN7A 4UVBA 2VT3A 4XLNF 4RGRA 5LBQA 4RB3C 2ZMEB 4G7HF 2F5FA 4YIIA 4XSXF 4HA8A 3KEQA 2PJPA 2BEOA 2K4BA 2UZKA 4A0ZA 3ZMUA 3OV8A 5CVIA 2V1DA 2X4HA 2Z99A 2FQ3A 4U7DA 2HTSA 1W7PA 5LGNA 2PLYA 3MAJA 3VEPA 2C6YA 4HX8A 3ZMDA 3D0SA 4ESBA 3E5QA 3WTSC 3REOA 3SHFA 4EMSA 3QOPA 1EH6A 1ONVA 2IW5A 4G6DA 1FZPB 2W57A 2GXGA 5CVUA 4CYDA 2QUFA 1U5TB 5LLQA 3ZN1A 3BROA 1R1VA 5ICCA 3CO6C 5AONA 1AOYA 3IWZA 5FGMA 4KFCA 2ZJ2A 4XLPF 3R0JA 1HXDA 5CJ9A 2NRAC 2Y75A 3LA7A 1YYVA 4IF4A 3DFGA 5ERIA 3DP7A 5AIPA 2BGCA 2UWMA 1BI3A 1VTNC 2AXLA 4IRGA 1XGNA 1O3TA 3RYPA 2ZFWA 4E70A 1ZG3A 3FX3A 4MGRA 2EJRA 2NNYA 4D0PA 4HYEA 4LGWA 4U0WA 2PEXA 4ZH4F 4O3MA 1RNLA 3KP2A 3WTVC 2EK5A 2O8XA 2A07F 4YG2F 2DFIA 2MLGA 1V4RA 2DAOA 4G7OF 1XGOA 1ZG1A 1ZLJA 2MA3A 5HDKA 2O3FA 2Q2EA 4P5OA 4K2EA 5HDNA 1QGPA 1FNNA 4CHUA 2K02A 2JT1A 3KP4A 2V1UA 1IXSB 5E1XA 2STTA 1QNTA 3GX4X 5TRDA 4LJZF 1FP2A 4ENJA 4R8HA 3GZ6A 2D1HA 2JPBA 4BH9A 4LB6B 2XAQA 1IW7F 3HYIA 2IJLA 5D4SA 4M9ZA 2MBFA 4BHBA 1FSHA 3F6VA 1B4AA 4U7BA 5K1YA 1U2WA 3EUHA 4AVPA 1G6NA 3RYRA 2J5OA 1FY7A 3HTSB 5JR3A 3CUQA 1TBXA 2PQ8A 3F8CA 2VONA 3RJPA 4UV8A 1FC3A 4AIJA 3R6SA 1K6OA 3R61A 1KQ0A 1FP1D 2ZBKA 3JAMZ 5L3CA 3HOTA 2Y0MA 3HHGA 2XIGA 2GXBA 1USSA 5HLGA 4WWCA 3I64A 4OINF 1YQAA 3LQQA 4OIPF 1Z91A 1LNWA 2IT0A 4HZFA 2MC3A 5L3BA 3ZMVA 5FLXK 4Q5SF 5FD5A 2GQQA 3QU3A 4EM2A 3J80Z 5DYMA 3E6CC 2J5PA 4YIFA 2CG4A 1KU2A 1P4WA 1UHWA 2ACJA 3GYHX 2HDCA 1O3RA 5HS7A 4ON0A 3TOBA 1CGPA 3QPTA 1WI9A 1MJAA 1CF7B 1YS6A 5L3EA 1FBUA 1SFUA 3ML6A 1YG2A 4I0BA 1YLFA 4CZZA 3TO6A 2DPDA 3EQLF 2R7FA 3ZN0A 3ZQ7A 3E5UA 1T38A 3GF2A 2KKOA 1IF1A 1I5ZA 3HSFA 2V6CA 4G8XA 1V3FA 2W24A 1J59A 4ETSA 3H92A 4L5IA 5BOXA 1TW2A 1JXSA 3BP8A 2VBXA 2F5CA 1O3SA 3T0YA 3WGGA 3JW4A 2QBYB 4JQFA 3ROUA 1HBXG 3WE3A 2VT2A 2H94A 2CW0F 2VN2A 2FXAA 2DW4A 3WTUC 4A12A 1KYWA 3H3UA 2X0LA 4HDVA 4BHPA 5HDGA 1S29A 5H6RA 1F1ZA 1K79A 2HOEA 3MQ0A 3S2WA 3J7AO 4ZZLA 2FMLA 2FMYA 2R3SA 1UB9A 1W5TA 1TW3A 1Z9CA 2W85A 4M71A 4PZJA 3L2CA 2PFBA 2E7XA 1S7AA 2XKOA 1DUXC 1O57A 1IXRC 3I71A 2XHKA 2IA1A 5HS9A 3EETA 1LEAA 1ZAOA 4UHTA 4I09A 1OPCA 1W4MA 2K86A 4G6QA 4Q48A 1T6SA 3QRFF 1EH7A 4OIQF 2VOPA 1YW9A 1XDSA 4OIRF 3R60A 3GWZA 3TKYA 4XRFA 3HRSA 4HF0A 1BM9A 4LLGF 3BZ6A 4L9NA 5F1RA 2R7DA 3ZPLA 3GFIA 3B02A 4A6DA 3M9AA 3CUOA 3HRMA 3WODF 4M9XA 1FPQA 4A2UA 2PMHA 4YFNF 1T98A 2NYXA 3L9FA 2VBZA 5ICGA 3ERED 2LSOA 1IN6A 2ZMEA 3JSOA 2BE5F 3KEOA 4BNCA 1FWZA 2QZ8A 1OR7A 3TGNA 5DD8A 1D5VA 1GHCA 2DI3A 2ETHA 5FLXZ 3F8MA 1NHAA 4KNYA 2HR3A 4IRIA 2GIVA 3WTWC 3I59B 2L4MA 2DQLA 4EJTA 2COMA 2ZNYA 3ELKA 2P5KA 2DLLA 4XBFA 4PDKA 5FD6A 3T8RA 3TDUC 1OYYA 3KZYA 1PP8F 5L3FA 2KIFA 2QQ9A 1SFEA 2MLKA 5ED4A 2NS0A 4A0XA 2L4AA 4NHJA 4M9SA 2G7UA 1DDNA 1XB4A 5CVVA 5E8GA 1FYKA 5BS6A 1QZYA 3GXOA 3V8JA 3VOEA 1H9GA 3IHUA 2ELHA 1F5TA 2H27A 3R0AA 4XSZF 4L9TA 4NQWA 5K5RA 3M1EA 2M45A 2OZ6A 5HLIA 2QQBA 4G9YA 4PGHA 3P9KA 2QWWA 1HKTA 1SD7A 4FHTA 2VE8A 5A2QZ 4JK1X 3T1BA 2IP2A 3GZ5A 5BPDA 2QM3A 1R22A 4ENNA 2YSRA 3FMSA 1R1UA 2CO5A 2EFWA 1BI2A 4WCGA 3N97A 2HS5A 2ZKZA 4FX0A 2MH2A 2XASA 3F3XA 4LFUA 3HHHA 4M6YA 4S05A 1YIOA 2K4JA 3E97A 1GXQA 3T5XA 4B8XA 1O7FA 1TLHB 3RKXA 1B6AA 4IHSA 1WKMA 2HKOA 3C3WA 1R7JA 4N9IA 2FBHA 3E6MA 2P6SA 4M74A 4AIKA 1K7AA 5FB2A 3FZVA 1IN8A 4PGGA 4EM0B 2WTEA 3K1NA 1ZYRF 3WGHA 5K5OA 1MZBA 1Z1DA 3HSRA 3DKWA 4IRHA 1RZ4A 3K69A 1ZG5A 2D2WA 3M8EA 2QYOA 3FF5A 3ZMZA 4WX9A 3MCZA 3F8FA 1FX7A 5D5UB 1L3LA 2DQRA 3KP5A 2F2EA 1CF7A 3LQRA 4AIHA 2XAGA 1AWCA 3LA2A 4I7HA 4JBAA 2YPRA 4CO8A 2RNJA 2YR2A 1I27A 1KU9A 1B9NA 2BBYA 4N9HA 1W7PD 2LF8A 3JTGA 5AIQA 2STWA 3K1PA 2IPQX 3AAFA 3VODA 2PI0A 3FMRA 2XV4S 3FXQA 2KJBA 2YX4A 1S7OA 4H0EA 2A6EF 3CUQC 1UHMA 2D45A 3B73A 2Q0OA 2PN6A 1ZREA 2EFOA 3I54A 2OA4A 4WXDA 1J2XA 4RB1A 3LSTA 4WXCA 1BI0A 1F9NA 3G3ZA 3GUDA 5D5WB 1XCBA 2DO7A 3O3KA 1K78B 2IA0A 4CDGA 3NQOA 1KQ8A 4ESJA 1JHHA 2MH9A 1R5GA 5BPIA 4UV9A 3F21A 2VXZA 3VB2A 1HKQA 3FXRA 1PP7U 3BOQA 2D1VA 1YW7A 1WSUA 4OMYA 3ISPA 2IA2A 3K9TA 3O2PE 2CFXA 2OD5A 1RUOA 4A6EA 4Z2YA 3GEZA 5BMZA 2RN7A 4L18B 4ZYEA 4LB5A 2FA5A 3Q5FA 2EWNA 1W7PB 1A04A 3BWGA 4LLLA 1BC7C 2FU4A 2RVCA 2GAUA 5JFRA 2CYYA 3K1MA 2XVCA 3SZTA 3DPLC 4G94A 3WGIA 1ZRCA 5DUIA 4EVIA 1Y0UA 4TV7A 1QZZA 2NNNA 1HW5A 2LDUA 2HFHA 4RB0A 2OQGA 1U8RA 2ZCWA 1G3SA 1B1BA 4M73A 3QP5A 1QO0D 5CVRA 2ISZA 3R4KA 3F6OA 1G3TA 1O3QA 4HF2A 2YX7A 1OKRA 1H9TA 4HLYA 4ENMA 4GYIA 1Z05A 1WWXA 5FO5A 2EV5A 3BDDA 3I53A 3F22A 4P9FA 1IZ1A 5LHIA 5DDGA 4HW0A 3M7GA 4N0BA 5IT9K 1XGMA 5CLSA 3FXUA 1DPRA 1ZGJA 2G7HA 2A68F 1IN5A 1YTYA 4KIBA 2XAFA 4IJAA 1B9MA 2E7WA 5L3GA 3TOAA 2P6TA 5IT3A 1WRJA 2H09A 4A5NA 4EJVA 3PFIA 1MD0A 2Z3YA 1QQIA 1QPMA 1E2XA 3H3ZA 1D3YA 3RIRA 3KETA 1XD7A 5DEQA 1XSXA 2A5YB 1HKSA 4HX7A 3LWFA 3DV8A 1OYIA 1FOKA 5E1ZB 2L01A 3WU1B 1T0FA 1XGSA 4OU0A 5E8IA 1EH8A 3BJ6A 5DUKA 3SZPA 3ZMSA 1BOAA 3I59A 5LRSA 4UVAA 3LAJA 3U9GA 3DXJF 2FBKA 2CGPA 4KIGA 5J8CA 4L9VA 5L3DA 4ZYHA 2O6GE 3ZMTA 4RAZA 1SD5A 4RAYA 3WTTC 4YFKF 1R1TA 2LKPA 2OBPA 3CUQB 4HV6A 3C7JA 1P6RA 5KVRA 2OAZA 3FM5A 1LVAA 2FE3A 1TNSA 3EDPA 1I6XA 3JSPA 1XMAA 3KLNA 4KT5C 3J81K 4KUMA 4WF2A 4WXHA 3BJAA 4P9UA 1ZRFA 4OMZA 4LG0A 1MDMB 3CJNA 3PQJA 2GZWA 2JSCA 1KGSA 1ZGAA 1MJ9A 5D5XB 2GA2A 5H6QA 1GXPA 4RGUA 2VBWA 4A5MA 1BBYA 3IL2A 3QPHA 4KYWA 5F6FA 4GO1A 4AWXB 2O03A 1LEBA 1USTA 2O0YA 4EJWA 4F7ZA 5DCMB 3OOPA 3HRUA 2KJCA 1KQ9A 5D6EA 2HQNA 4OIOF 2B0LA 1IN4A 1ON1A 5D8KB 3GFMA 1FBQA 1FLIA 2RV8A 3CO7C 3C1DA 3V4GA 2V79A 4HQEA 3VFZA 3E6BA 2M30A 2UXXA 4L9JA 2F5DA 3RPQA 4PCQA 2QQAA 1OYWA 2XGXA 4EM1A 4O5VA 3L7WA 2FEZA 3GVAA 4IPAA 3E3VA 2IRFG 4MHGA 1U5TA 4HAMA 2WV0A 3SFZA 3HRTA 1H0MA 2KRFA 2EFNA 3I58A 2A61A 3P9IA 3ECHA 2TDXA 2A69F 3ECOA 3N4MA 5ICEA 2Z9OA 1HQCA 3MZHA 3PQKA 4OOIA 2DPUA 1SAXA 5IT9Z 1HSJA 3ULQB 4LK1F 2JTVA 4KN4X 3M8FA 1F4KA 5HS8A 3ZP5A 1ZARA 1TQIA 4HLXA 5LHHA 1G3WA 4RS8A 1JE8A 4I2OA 3JAMK 3IWFA 3F8NA 1U6GA 2V9VA 4BXUA 4M72A 3EYYA 3KP6A 4L0ZB 2WWYA 1IAWA 1J5YA 1FYMA 4CXFA 2O61A 1G3YA 5D4RA 1LDDA 2EFQA 4BYYA 4LLNA 2P5LC 1HW2A 4KMUX 3MWMA 1S8NA 4QLCU 3DF8A 2QENA 2QLZA 1R5HA 2HZTA 1PDNC 1KYZA 3WE2A 1XMKA 5J8FA 2HEOA 3DEUA 5K5QA 1KU3A 2VOOA 5ICFA 1J75A 1LDJA 2M87A 3BPVA 1TTYA 2MD5A 4I02A 2XKPA 1D8JA 4R1HA 5LEKA 4WK8F 2A6HF 3GLXA 3J81Z 3I4PA 3BY6A 5DD4A 1ZN2A 1DP7P 1ZRDA 3QU6A 4BQAA 1OMIA 3MFKA 3EYIA 2LNBA 1J0RA 2K7LA 1IRFA 4GGGA 1FYLA 1YO5C 4U0VA 2ZNZA 2DT5A 2H6BA 4O6JA 2VBYA 5E20A 2EA2A 1D8KA 2KIMA 2W25A 4IVNA 4QWQA 1LB2A 3WTZA 3V7SA 1L0OC 1U78A 1KA8A 4P96A 4KN7X 2PG4A 3I0TA 1I1SA 3E6DA 3GFJA 1J9IA 2GA1A 2ZXJA 3GW2A 1STZA 3DQVC 5LEJA 1FT9A 2XUBA 1SMTA 2VODA 2HQRA 3V7RA 1QBJA 1RI7A 2HKXA 3FMQA 3HTUA 1YS7A 4EQQA 4BHCA 5DV5A 1S3JA 2XAJA 4ZYGA 4BAYA 2Q8KA 3CLOA 1Z6RA 1ZHFA 2P7CB 4HOBA 1SD6A 4YFXF 3SXYA 3KLOA 4HDUA 4L5JA 3TO9A 2RDPA 2QBYA 1RIOH 2HWVA 2EFPA 4RGSA 2L3DA 2DU9A 4ENKA 3IRRA 4KMFA 1RUNA 1E17A 2XRNA 1REPC 4ZZDA 1PUEE 4ASNA 3RPUA 4L0YB 4B09A 1T39A 1ZLKA 3BJOA 1WQ2A 4ESFA 5E18F 4HX4A 3P9CA 1O7LA 2E1NA 4ZYDA 4KDPA 3IRQA 1Q1HA 5TJJA 5DCFA 4GYGA 4MNUA 3RKWA 1BIBA 1U3EM 6PAXA 2QVOA 5LGUA 4HBLA 2RQPA 3DPTA 2K27A 3ABUA 4I0AA 3MZYA 2JZYA 4A0YA 2Z5UA 2FF4A 2XAHA 2FRHA 4LD5A 4Q4ZF 2ISYA 1P4AA 3TO7A 4M6XA 2DTRA 4MTEA 1P92A 2Z33A 1MKMA 2Y48A 1P2FA 1ZH5A 2HGCA 1ULYA 2WC2A 2VE9A 3HIFA 1W5SA 3KP3A 1MDMA 4FT8A 5D5VB 3BPXA 1FSEA 3KCCA 2ZO4A 4CICA 1LJ9A 3HOSA 4RB2C 2AS5F 3COAC 3U1DA 2HYGD 3TQNA 2EA4A 3T8TA 1IRGA 5JI6A 4NB5A 2RGVA 2LF7A 5KK1A 4EJOA 4KIFA 2M8EA 4MTDA 2FOKA 3Q9SA 1XCVA 2H6CA 2HTJA 1BJAA 4U0YA 3IC7A 3WTYC 4UUVA 5ILVA
chains in the Genus database with same CATH superfamily
3S15J 4KJZA 3CCSI 3WU0A 2JUCA 4RLFA 5DCMA 3ZQCA 5FKMA 1HSTA 2E60A 5EEHA 3C2BA 4RGXA 4Y17A 3TDZC 5IP7J 3S17J 2Q2EB 1R00A 1QPIA 4A3GJ 3L00A 2JVGA 2OQRA 3V8LA 2EB7A 2BXZA 4UXNA 3RTRA 2DYRH 1JKPC 2EV0A 2V1XA 1I1GA 4MEYF 2JSPA 1AHDP 1EV7A 4DOZA 5M5XJ 5JHUA 4IQJA 1DU0A 3F72A 5LRRA 2XROA 2OU2A 1UCRA 2Y9ZA 4CZCA 5H20A 2R7RA 3V7CA 4CSWA 1S72I 4EV0A 4Y13A 2IVMA 2KIQA 4BE0A 3NWTA 5CQEA 3P7NA 3HM5A 1ZR2A 1TWCJ 1XN7A 2W84A 3QAHA 2JMWA 1QHGA 3O6BB 4I98B 1MH4A 3ZQFA 1UHSA 2CSOA 1SAUA 3BZKA 4J01A 1G4DA 3Q3SA 1ODDA 3L09A 2WAQA 3K0LA 3LA3A 5ILUA 1C0WA 3CDIA 3WG9A 3AG4H 3SQNA 5LHGA 4M3GA 3G71I 3BR6A 4BACA 4UNOA 2M1BA 4UY8I 1JKRC 5FFXA 2BV6A 4XMYA 2PJRA 4IEJA 3ASNH 3IKTA 2UXNA 1DPUA 5A2QK 3G73A 4BXFA 1R6RA 1TQPA 3PUFA 4U88A 3HSEA 4DBRA 3VYSB 3FXKA 2BYVE 4G7ZF 5E17F 1JGSA 3U2RA 1QHHD 4QSHA 3Q9VA 3A2KA 2ELJA 2KPMA 2FSWA 1YE9A 1T33A 3JTHA 3D5LA 1HW1A 5HNHA 3ZOBA 4B43A 5J6XA 2R5ZA 2M5WA 5BQTA 3F23A 2L02A 3E7LA 5M5WJ 1MMNA 3LSJA 3HOUJ 2DFFA 3RQIA 4BQNA 3GTQJ 1E3PA 2E1CA 3NARA 4FETA 2RC4A 1R23A 5D8LB 3FM3A 3RI4A 2JRTA 4BJ6C 1AA7A 4F3QA 2P7VB 3K2ZA 1ORKA 1RRJA 3ABTA 2M7AA 3JRAA 1SVLA 3NRVA 2CV2A 3HOWJ 1YW8A 3BR0A 4DBQA 2X6XA 1X58A 2HXOA 1TNTA 1A6QA 5CPRB 1SMYF 1JI8A 1FBSA 5F0CA 1XDUA 1E3OC 3GTJJ 1GT0C 4MFDA 1I3QJ 2JPCA 3NEUA 2NAZA 1JUMA 2KISA 2YU3A 3A0HC 3DLLF 4EGZA 3FHZA 2ZJQF 3WHBA 2HDDA 1K4SA 4PFPA 4EGYA 1HDPA 1RC9A 3FXLA 1MBEA 5GTIC 3WTXC 2DN0A 2X6WA 1P7JA 2DK8A 1JTXA 3FXOA 1ETVA 4HQMA 3PNYA 3CMAI 5HVQC 1VQLI 5BNGA 2FBIA 5CYVA 4CCJA 4HNTA 3E5XA 3OS2A 2IGMA 1W0TA 2ESHA 3HPGA 4GCVA 5F64A 3HDDA 1BIAA 1IXCA 3MEXA 2ELKA 1B8IA 4KICA 2CU7A 3IKVA 1BI1A 4M3FA 2CUFA 3SYTA 2E19A 2PMUA 1U5TC 3KZZA 1XS9A 3GO5A 1YFHA 2KFDA 4AM3A 4BBSJ 4HF1A 2K40A 1QA6A 3W2AA 2R4GA 2PBIA 5CVJA 2BXYA 4BUPA 3RKQA 1X3UA 4BBRJ 1IG7A 2ESNA 1S6LA 4DNCA 1SD4A 3F8BA 4UB8C 1AKHA 2HOSA 2OZUA 1BC8C 5E1WA 2F48A 4IL6C 3I5UA 3RKYA 3S1NJ 1P4XA 1RKWA 2XPUA 2F5EA 3V8KA 1UFMA 4D7NA 2Y2ZA 2R7UA 3KIOA 1VQ7I 3DCFA 5D6FA 3GTLJ 3AFHA 3MVPA 2XRLA 4XKBA 2ZSHB 1ON2A 4FX4A 2JA6J 2FNPA 4XLHA 3LAPA 1Z7UA 1MJBA 2WV1A 2W82A 3LSKA 5IY5H 2G9WA 3LSPA 2VC0A 2EIKH 2DCEA 3CF2A 2ADUA 2OTJI 1LQ1A 2GXAA 5E3LA 3L2WA 2HNHA 4S04A 3BG9A 3HKZN 3LFUA 2E1MC 4DQ2A 5FFZA 2OV7A 3OYLA 3KFWX 1BN5A 3CMYA 3RSNA 2CWEA 2JRMA 1FIPA 3CJRB 1HA8A 1GV2A 2GBYA 1XSVA 3QP6A 3GFLA 4XM3A 2DOFA 3KP7A 3CC4I 5DTDA 1MIJA 3CF5F 3HOVJ 3W6KB 1G8XA 1KU7A 1OLTA 1LDKB 1N75A 4IHVA 1Z7LA 4MEXF 5HOOA 5ILSA 5LD2C 4MIMA 1TWGJ 1TQMA 3CDHA 1QZEA 4LIUA 2L54A 1OCTC 3C18A 2A3SA 2P5VA 2P8TA 5EEGA 4UUSB 2L7FP 3TP3A 2IGKA 5GPCA 1B59A 1WJAA 3LFKA 2LK2A 3CCYA 4EJUA 3RDIA 2MSYA 4UVCA 4MQ9F 3CCRI 4AD9A 1MGTA 5F08A 4LK0F 4BY1J 2VC1A 4E7LA 1ZR4A 1JTYA 5GAGJ 2BHYA 2OJED 2CV0A 3CTAA 3OIPA 4LMYA 1SFXA 4ZC3A 2VL8A 2BW3B 3KE2A 3LMMA 2K3FA 1R36A 1JHFA 2KIUA 1GVJA 4R79A 5GAHJ 1LE8A 2X9DA 2EZLA 1VQ5I 1IUYA 4BQOA 2GWRA 4P55A 5JVTA 4HV5A 1ETYA 1Z6TA 2ZB9A 2FNAA 4Q47A 4LG0B 3HUGA 3OYJA 4I01A 2ECCA 1FEXA 2CW8A 4MQVA 3W6JB 3QPLA 3IUOA 4Y15A 4KA4A 2P4WA 5GTHC 1WH7A 5B5EC 2DBBA 2F4MB 3EUAA 2NVXJ 3F9KA 3QODA 2EV6A 2RKHA 3J80K 4IXAA 3VYRB 1X1DA 3FWEA 1JT6A 4IHTA 2W00A 2E2HJ 1XSDA 1OJLA 1T2KA 5HLHA 2HYFA 3QYEA 2M4GA 4CGZA 4ZJZA 1J7KA 4GXOA 3H0DA 2DK5A 1Y1VJ 3A01A 1FTTA 5LGTA 5EYRA 1K78A 2CQKA 1R58A 2ID6A 1YRNA 4GDFA 1IN7A 4RMNA 4UVBA 2VT3A 4XLNF 3RQ4A 2HI3A 4RGRA 2DT7B 5LBQA 3OYHA 3FKIJ 4RB3C 1QVTA 1Q1VA 5C3EJ 1YOVB 2ZMEB 2D5VA 4G7HF 2F5FA 4YIIA 1A36A 4XSXF 4C2TA 2QSFX 1IO2A 4HA8A 3KEQA 1Z67A 2PJPA 3CCQI 2KL4A 5J4VA 4M3DA 2W48A 4D1QA 2BEOA 2K4BA 2UZKA 2VIXA 3FBNB 4V19K 4X6AJ 4E7KA 3W2WA 4A0ZA 3ZMUA 4G12A 3OV8A 4JX6A 5CVIA 2V1DA 2TCTA 2X4HA 2Z99A 3BLYA 4RBOA 1JUPA 3OYNA 2FQ3A 3KX2A 3SDBA 1EF4A 4S0HB 4U7DA 2HTSA 3LSHA 1W7PA 4XN0A 3MZ8A 2CMPA 2L7MP 5LGNA 2KZVA 3HZJA 3MAJA 3VEPA 2PLYA 2C6YA 2LBFA 2BZTA 4HX8A 3ZMDA 1X1BA 3D0SA 4ESBA 3E5QA 3WTSC 3REOA 3SHFA 4EMSA 3QOPA 1EH6A 1ONVA 3Q0UA 4PJLA 3K4NA 2IW5A 4YEJA 1NK2P 2LLKA 2UUZA 4G6DA 1FZPB 2W57A 3KZIC 4RA2A 2GXGA 5CVUA 4AU7A 4CYDA 2EZKA 2QUFA 3CCMI 2WY8Q 3K4LA 3ZQLA 1U5TB 1XTAA 3I3LA 5LLQA 1U9NA 3JREA 3ZN1A 3BROA 4OWRB 1R1VA 5ICCA 3CO6C 5AONA 1TWFJ 3IWZA 5FGMA 3M3YJ 1AOYA 3P5JA 4KFCA 2ZJ2A 5B1AH 2XF5A 3KYCB 2PX9A 3OR2C 4XLPF 3R0JA 1HXDA 3CP2A 5CJ9A 2NRAC 2Y75A 3LA7A 2HPMA 1YYVA 3HGGA 4IF4A 2MD0A 3DFGA 2YU9J 5ERIA 3ZGKA 2DTZA 3DP7A 1W5CC 5AIPA 3H5NA 2BGCA 2X6YA 4NNJA 4C2UA 2M0CA 2UWMA 4OAZA 2DDBA 1BI3A 1VTNC 3PO2J 2AXLA 4IRGA 1XGNA 5FRMA 2JJ7A 2E2JJ 1O3TA 3RYPA 3HG9A 2ICWG 2ZFWA 4CUGA 2DA6A 1ZG3A 2E34A 4E70A 3FX3A 4MGRA 2OUMA 2EJRA 2NNYA 4D0PA 4HYEA 4LGWA 4U0WA 1BJZA 2PEXA 4ZH4F 3L2QA 4O3MA 2VPLA 1RNLA 3KP2A 4PSWA 1VQ6I 3WTVC 2E1MB 2EK5A 2O8XA 2A07F 4YG2F 2DFIA 1BOBA 2VQCA 2MLGA 1V4RA 2DAOA 4G7OF 1XGOA 1ZG1A 2OF7A 1ZLJA 2MA3A 1TP4A 4PK4A 5HDKA 3A4CA 3Q0WA 1D1CA 2L7ZA 2O3FA 2Q2EA 4BL0B 5EEAA 4P5OA 3JRBA 2EH3A 4K2EA 1BA5A 3W3CA 1QGPA 1FNNA 3C2GA 4CCLA 5HDNA 4CHUA 4IZZA 2K02A 3G4SI 1HC8A 5GADJ 2KZGA 3OSGA 3PM1A 2JT1A 1BR4A 2EZHA 2JUGA 3KP4A 3DTEA 2V1UA 1IXSB 3M07A 5E1XA 1NH3A 2STTA 1QNTA 2HQAA 4U87A 3GX4X 5TRDA 2LFBA 2VJ5A 4LJZF 1FP2A 4ENJA 3PNVA 4OAYA 3K2AA 2HXIA 3EUKL 4R8HA 3GZ6A 2D1HA 3CQZJ 2JPBA 4BH9A 3HB9A 4LB6B 2XAQA 3MN2A 1IW7F 3HYIA 2KP6A 4BEHA 3OYCA 2IJLA 5D4SA 2WB1N 4M9ZA 4M3BA 2MBFA 4NC8A 4BHBA 2JA8J 1I50J 2BY3A 2ZJPF 5M3FJ 1FSHA 2B7EA 3JCUC 3F6VA 1B4AA 4U7BA 2QKMB 5K1YA 1U2WA 1T56A 3EUHA 3ZQGA 3OYDA 3JR9A 3PSIA 4AVPA 3H36A 2K9NA 1G6NA 3RYRA 4ZDLA 3OYFA 2DA5A 2J5OA 1FY7A 3HTSB 5M3MJ 1R9TJ 1Y6IA 3A1YA 1B72A 5JR3A 2X48A 4XNFA 3CUQA 1TBXA 2PQ8A 3F8CA 2W7NA 2VONA 3RJPA 4UV8A 4DGWB 1FC3A 4AIJA 3X2QH 1OQYA 3R6SA 1K6OA 3R61A 1KQ0A 1FP1D 2ZBKA 3JAMZ 5L3CA 3HOTA 2Y0MA 3HHGA 5DM7F 2RQQA 2O5RA 1MMAA 2MYSA 2XIGA 1PJRA 2GXBA 3MMYB 1USSA 1WJDA 3S3MA 5HLGA 4WWCA 3I64A 4OINF 3OSFA 1YQAA 2CUEA 3LQQA 3KYDB 2LY2A 3VDXA 2DA3A 4OIPF 1Z91A 1LNWA 2Y30A 2IT0A 2B63J 1SVOA 3S1RJ 1LFPA 4HZFA 2MC3A 3OL4A 5L3BA 3CCEI 4XK4A 4I76A 1WJEA 3ZMVA 5IP9J 5FLXK 3N05A 4Q5SF 5FD5A 4E7JA 2LRDA 1RESA 3DU5A 2GQQA 2WY7Q 4A3KJ 2NOJB 3QU3A 1ETQA 2GOMA 4EM2A 3J80Z 5DYMA 3E6CC 2J5PA 4YIFA 4I6ZA 2CG4A 1KU2A 1P4WA 1UHWA 3ZXSA 3GTKJ 2ACJA 2WAQN 3GYHX 3RPUD 2HDCA 1O3RA 5HS7A 1ETXA 4ON0A 3TOBA 1V5EA 1CGPA 3QPTA 4YIRX 1IUFA 1WI9A 3L2RA 3MKLA 1MJAA 1CF7B 1YS6A 2DODA 5L3EA 4XIDA 2DDAA 3M1CA 1T0FC 1W1WE 1FBUA 1SFUA 3ML6A 1YG2A 4XRMA 4I0BA 1K6YA 1YLFA 1WFXA 2HZDA 4FQGA 2VKVA 2X6OA 2EQRA 2QSGX 2CRGA 4CZZA 3TO6A 2DPDA 1Z0XA 3EQLF 1YIJI 5J40A 2R7FA 3ZN0A 1N25A 3ZQ7A 1XX5A 5HLTA 4Y52J 4FCYA 3K10A 3E5UA 1GV5A 1R49A 1T38A 3GF2A 2BVMA 1ERDA 2KKOA 4A3JJ 5JVGF 1IF1A 2XGEA 1M1EB 1FOXA 1X4OA 1I3AA 1BL0A 3BR2A 1I5ZA 3HSFA 3HXLA 1POGA 3G6EI 2MABA 2V6CA 4G8XA 1V3FA 2W24A 1J59A 4AIDA 1VQ9I 3OYGA 4ETSA 1JT0A 3H92A 4L5IA 5BOXA 1TW2A 1WJ5A 5JLXA 1JXSA 3BP8A 2VBXA 1CQTA 2NVYJ 2W1OA 2F5CA 1MNEA 4CH7A 2DMTA 2L7KA 3D5RC 4E7SA 2XPVA 4QPOA 4IQ4A 1ETOA 1O3SA 1KONA 4A3DJ 3L2VA 3T0YA 3WGGA 4Y33A 2OCEA 3JW4A 5J1UA 4RLQA 2QBYB 2CW7A 2M2EA 4JQFA 4NC6A 4NBQA 1BR2A 4W97A 2VXDA 3TL4X 3ROUA 4B47A 1HBXG 1F36A 1ENHA 4B1RA 1Y1WJ 4A3MJ 4HSRA 1ACIA 3WE3A 2VT2A 2E5ZA 3IAS2 2H94A 2CW0F 1OFCX 2VN2A 2FXAA 2DW4A 3VYTB 4CA0A 3WTUC 4A12A 3DTKA 4XKWA 1KYWA 1VF9A 4BE1A 3H3UA 3V42A 2X0LA 3FISA 4UB6C 2LTPA 1DGRM 4HDVA 2H8RA 2DMQA 2DMPA 4AC0A 4BHPA 3PO3J 5HDGA 1S29A 2TRTA 5H6RA 4YRVA 1F1ZA 2JWTA 2OCCH 1K79A 3FBIB 3I55I 1NG7A 3ZCOA 3OMYA 2HOEA 3BG6A 3MQ0A 5IOYA 3S2WA 3J7AO 4ZZLA 2FMLA 1P9QC 2FMYA 4UUSA 4DZJA 2R3SA 1UB9A 2DOEA 1MW7A 3QOEA 3CC2I 5EZGA 1W5TA 1TW3A 1Z9CA 2W85A 3GMEA 5IYCJ 4M71A 4PZJA 3L2CA 2PFBA 5EG0A 1SFOJ 2IS6A 2E7XA 1S7AA 2XKOA 3MD2A 1DUXC 1O57A 2XSDC 1IXRC 4BDZA 2L9VA 2EILH 2P0WA 2R7OA 3I71A 3DEWA 2KMUA 2XHKA 2O7OA 2IA1A 2XDVA 4XKVA 5HS9A 3S1MJ 3EETA 1VQ8I 5B3SH 1LEAA 3W2VA 1ZAOA 2V4JC 3SEQA 4UHTA 4FTHA 4I09A 1OPCA 1W4MA 2K86A 3RZOJ 4G6QA 4Q48A 3HGYA 1T6SA 3BR5A 3QRFF 1EH7A 2WAEA 3G1LA 4OIQF 2VOPA 1YW9A 5FKOA 2R7VA 1XDSA 4OIRF 3R60A 4XLCA 3GWZA 5F27A 1XC5A 4XRFA 2JN6A 3TKYA 2VLAA 3HRSA 4HF0A 3OR1C 1BM9A 1K61A 4LLGF 3BZ6A 4L9NA 5F1RA 3J7ZI 4FISA 2W4SA 2R7DA 2EBIA 3PFYA 3ZPLA 3GFIA 2K9SA 1Y56A 1S5LC 4I99C 1A35A 3B02A 4XL9A 4A6DA 3M9AA 1KZHA 3CUOA 3HRMA 4PUSA 3WODF 4M9XA 4XKCA 1FPQA 4A2UA 1WVRA 4ZTFA 2PMHA 1YJWI 3AL0C 4ZDOA 1Z21A 3HL2A 2K3PA 1PYVA 4YFNF 1VQPI 2HOTA 2QGUA 1T98A 2NYXA 3FHNA 3LSRA 3L9FA 2VBZA 4C2MJ 1MMSA 5ICGA 3ERED 1VQOI 4XOPA 2LSOA 1IN6A 2ZMEA 4LIVA 4B44A 3QWLA 3JSOA 2BE5F 3KEOA 4BNCA 2YS9A 4DYRA 1FWZA 2N8GA 4X0GA 5FRNA 3U1KA 3K4MA 2QZ8A 2Y69H 1K4TA 1OR7A 4XOTA 3TGNA 5DD8A 2Z1DA 2WAFA 3SZGA 2H1KA 4A3BJ 1D5VA 2LMDA 2NXNB 1Z3XA 3J7AY 4D9JA 1GHCA 2DI3A 2ETHA 2M3AA 3LL7A 4MFEA 1IV8A 5JHFA 4RAFA 2NVQJ 5FLXZ 1UELB 3OYMA 2FD5A 3F8MA 4QPQA 5FLVA 2DT6A 3KYLA 3OOUA 2Y9YA 2R7ZJ 2FOWA 2R92J 1NHAA 4KNYA 5F1JA 3K4JA 2V9PA 2HR3A 2QKLB 1HOMA 3LSMA 4IRIA 2GIVA 3WTWC 3I59B 2L4MA 4M6VA 2DQLA 3CDLA 2V9KA 2KRHA 4EJTA 1DQUA 2COMA 2ZNYA 1ZQ3P 2IBDA 1FMVA 5KHDA 3ELKA 2P5KA 4XORA 2DLLA 4BE2A 2X1CA 3HJEA 2X85A 3SFIA 1UMQA 2NS7A 4XBFA 4PDKA 5FD6A 3T8RA 1I6HJ 1TC3C 3KEYA 3TDUC 1OYYA 3KZYA 2ZC2A 1PP8F 1LUJB 5L3FA 1X2MA 2KIFA 1X1AA 2QQ9A 1SFEA 1ZELA 2MLKA 2CH0A 5ED4A 3ASOH 5H2FC 2NS0A 4A0XA 2L4AA 4NHJA 4NC7A 4M9SA 2DXIA 2G7UA 3D5SC 1DDNA 3K4KA 1XB4A 2DA2A 5CVVA 5E8GA 5TISC 5IPAA 2I10A 1UG0A 1FYKA 2P81A 4JX4A 2V1NA 1LFUP 4C3IJ 5BS6A 4A69C 1ETWA 1QZYA 4DIQA 3GXOA 3V8JA 2NS8A 3VOEA 1H9GA 3IHUA 1GLNA 4IO9F 2ELHA 4XLEA 1YI2I 1F5TA 2H27A 2AXTC 3FK7A 3MKZA 1WJFA 1LPQA 1HDDC 3R0AA 4XSZF 1IRXA 4AVZA 4L9TA 4NQWA 5K5RA 3S14J 3KPHA 1HF0A 3M1EA 2QQ8A 2M45A 2OZ6A 2NOGA 2DA7A 5HLIA 4CCOA 2M7BA 2ME0A 2QQBA 4F92B 4G9YA 4PGHA 3P9KA 2QWWA 1HKTA 1SD7A 2E36A 1OISA 2BY1A 1MMDA 3A03A 2X51A 4FHTA 3DWLE 2VE8A 5A2QZ 4JK1X 4XLAA 1TT0A 3K4CA 3T1BA 2IP2A 3GZ5A 5BPDA 5EJCA 2VQLA 2QM3A 3CLQA 1JKQC 1R22A 4ENNA 2YSRA 2CV1A 3FMSA 3IH4A 1R1UA 3F0CA 2CO5A 2EFWA 1BI2A 4WCGA 3N97A 2HS5A 5J1YA 3FIWA 3SJMA 2ZSIB 2ZKZA 4JOMA 4FX0A 3IP4B 1T08B 2EIMH 2MH2A 2XASA 4HNUA 2JVHA 3F3XA 4UUTA 1AKHB 4LFUA 2F6CA 2Q1ZB 3DKYA 2EPFA 3HHHA 4M6YA 4S05A 5FROA 1YIOA 1GVDA 4CYCB 2K4JA 2KQRA 3E97A 3GLLA 4BJ5C 1GXQA 3T5XA 4B8XA 4C9YA 2DA4A 1O7FA 1TLHB 4N4NB 3RKXA 1B6AA 4IHSA 1WKMA 2V7FA 2HKOA 3C3WA 1ZGWA 1R7JA 3RCOA 9ANTA 4N9IA 2FBHA 2I8DA 3E6MA 1EJ9A 2P6SA 3PIPF 2DYSH 2IGOA 4V2GA 4M74A 4AIKA 1XPXA 1K7AA 5FB2A 2HYJA 2VJIA 2XSJC 3FZVA 3DBHB 1Y8QB 1IN8A 4B4CA 3H35A 2VJ4A 4PGGA 4EM0B 2WTEA 3S1QJ 4HG2A 1APLC 3K1NA 4HRIA 1ZYRF 3BTJA 1WJBA 3WGHA 3EPZA 5K5OA 1MZBA 1Z1DA 5C4XJ 3HSRA 3TBIA 4KT6A 2EIJH 5M5YJ 2QA4I 3DKWA 4IRHA 1RZ4A 2AO9A 4E4HA 2LY9A 4B3XA 3K69A 3W6VA 1SVMA 1RKTA 4Y7NJ 1HLVA 1ZG5A 4QTRA 3H1CA 1GUUA 2D2WA 2HPIA 3M8EA 2QYOA 3FF5A 3OS0A 3TMOA 3ZMZA 1P7IA 2OPTA 3BC8A 3PJRA 1X1CA 3LSIA 3MKYB 4WX9A 3OS1A 3DLAA 1D5YA 3MCZA 2KDZA 3F8FA 2R7WA 1FX7A 4A93J 5D5UB 1L3LA 2DQRA 3KP5A 2F2EA 1CF7A 3LQRA 2OC6A 2L9RA 4AIHA 1NK3P 2HOAA 1EA3A 2XAGA 1NTCA 1AWCA 1WZ2A 2XC7A 3LA2A 4D7MA 1VZ0A 3GTMJ 4I7HA 3BG5A 4JBAA 1LKXA 2YPRA 4CO8A 2RNJA 2YR2A 1I27A 1UZCA 5F0FA 1KU9A 1B9NA 2BBYA 2PMZA 2QCOA 1W7PD 4N9HA 2LF8A 1X4PA 2V26A 2E1OA 3JTGA 5AIQA 2STWA 4F93B 3K1PA 3EUHC 1QU3A 2IPQX 3AAFA 4DW6A 1WGXA 3VODA 4EATA 2PI0A 2RAEA 2OTLI 1V5FA 3FMRA 2XV4S 3FXQA 3BZCA 5E3OA 2IAIA 4IHXA 1OCCH 2KJBA 2YX4A 1NG6A 4E7HA 1S7OA 4H0EA 2A6EF 2YUSA 2HVSA 3CUQC 1UHMA 2D45A 3B73A 2CQXA 2Q0OA 2PN6A 4BJTA 4XQFA 3UKGA 4KISA 4H4KC 4LOCA 1ZREA 2EFOA 3B6AA 3I54A 1RETA 2OA4A 4WXDA 1J2XA 4RB1A 3LSTA 4WXCA 4IHWA 4A3CJ 1BI0A 1PUFB 1F9NA 3H0GJ 3G3ZA 3GUDA 2R5YB 4AYBN 3BQYA 5CKTA 3CCVI 1R4MB 2XB0X 5D5WB 2CJJA 1F43A 1XCBA 2DO7A 3A01B 2E2IJ 3O3KA 1K78B 2IA0A 3VYUB 1JJ8C 1YRNB 2A05A 4CDGA 4ITVA 1WPKA 1V55H 3NQOA 2E71A 1KQ8A 4ESJA 2O8KA 1JHHA 3UR3C 1N77A 2MH9A 1R5GA 1MBKA 4BU2A 5BPIA 4UV9A 2JA2A 3F21A 2VXZA 3VB2A 5IYBJ 1HKQA 3FXRA 4B3AA 2LYCA 1PP7U 3BOQA 1UJ8A 2M4KA 1ZK8A 3PNTA 3PSFA 2D1VA 1YW7A 4A3LJ 1RPWA 1OCRH 1WSUA 4OMYA 3ISPA 2IA2A 3K9TA 4N4OB 1IGNA 3O2PE 1PVEA 1D1BA 2UV1A 2X1EA 2CFXA 2OD5A 5B66C 2DA1A 1RUOA 1BW5A 4C3HJ 3JRHA 4A6EA 4Z2YA 3GEZA 1VQNI 2L0KA 2R93J 1X19A 4RM2A 5BMZA 2RN7A 2IS1A 4L18B 1O4XA 1BW6A 4ZYEA 1WH5A 4LB5A 2FA5A 3AG3H 4L5EA 1OCOH 3Q5FA 3DBRB 2EWNA 4JP0A 2CQQA 1W7PB 1A04A 3OYBA 3BWGA 4XLFA 4LLLA 3I4MJ 2MC4A 1BC7C 2FU4A 2RVCA 2GAUA 5JFRA 4CCNA 5E3NA 1MNMC 2CYYA 2DMNA 2QF7A 2XVCA 3K1MA 4YELA 4GFBA 3SZTA 2EINH 3DPLC 3FXMA 1TL8A 4G94A 3H9QA 3CMMA 3WGIA 1ZRCA 1S9HA 2MGQA 5DUIA 4EVIA 1Y0UA 3A0BC 1VFCA 2VKEA 4TV7A 3I9V2 1G2HA 2M9HA 2IGNA 1SANA 1QZZA 2K85A 2NNNA 3AG1H 4AYBA 4ANJA 1HW5A 3QPSA 2KDOA 2LDUA 2HFHA 2WBMA 4RB0A 2R7SA 2EZIA 3BG7A 2OQGA 1U8RA 2ZCWA 1G3SA 1B1BA 2ZXWH 4M73A 3QP5A 1QO0D 5CVRA 2ISZA 5FKNA 3QQAA 3R4KA 3F6OA 1G3TA 1O3QA 2IEKA 4HF2A 2YX7A 3FK6A 1OKRA 1H9TA 4HLYA 4ENMA 4GYIA 4E6KG 1Z05A 1WWXA 5FO5A 2EV5A 3BDDA 2L2OA 3AG2H 1TWAJ 3I53A 3F22A 4P9FA 1JKOC 2HQ5A 1HCRA 2O9LA 3BR1A 1IZ1A 5LHIA 5DDGA 4HW0A 3DBLB 1MBFA 1FTZA 3M7GA 4FE7A 4N0BA 5IT9K 3GZNB 2Y31A 1XGMA 4F52A 5CLSA 3FXUA 2BY0A 3OWTA 2JA5J 1DPRA 4F91B 1ZGJA 2K9MA 5HODA 2BY2A 2G7HA 2XF7A 1R5ID 2A68F 3S3OA 2XAUA 2JK3A 1IN5A 1YTYA 4KIBA 1D0YA 1SC7A 2LOOA 2XAFA 4IJAA 4ZTJA 1B9MA 4BDYA 2E7WA 5L3GA 3OYEA 3TOAA 2P6TA 4NUBA 1WRJA 2H09A 5IT3A 2DFEA 4A5NA 3JRDA 3BR3A 4EJVA 4RAGA 2AQFA 3PFIA 5F04A 5FKKA 1MH3A 3HBLA 1MD0A 2Z3YA 1QQIA 2KT0A 1QPMA 2VASA 1E2XA 5KAIC 1MSFC 3H3ZA 1D3YA 5DM6F 3NWSA 2MFZA 3RIRA 3KETA 1XD7A 5DEQA 1G59A 1XSXA 2A5YB 1HKSA 4HX7A 3FXJA 4LG3A 4LITA 3TP0A 3RZDJ 4W1UA 3LWFA 4XR6A 2COBA 3S3NA 2ZXIA 3DV8A 1OYIA 1EKEA 5E1ZB 3IH3A 2L01A 4GRIA 3WU1B 1FOKA 1T0FA 1XGSA 1IRZA 1FIAA 5EGOB 4OU0A 2ZFUA 4XN3A 3DTIA 5E8IA 4ABZA 1EH8A 3BJ6A 3G1MA 5DUKA 2E35A 4BEHB 4BS9A 5F0HA 1I39A 3ERMA 4E7ZA 2HVQA 2K9QA 3SZPA 3ZMSA 1BOAA 3I59A 1MBHA 5LRSA 4JX5A 4UVAA 3LAJA 3U9GA 1ZTRA 3DXJF 2L9NA 2FBKA 1E3HA 2X1DA 2CGPA 1BR1A 4KIGA 5DS9A 5J8CA 5LFAA 1LVKA 1IJWC 4L9VA 1R71A 5L3DA 4ZYHA 2IS4A 2O6GE 3ZMTA 4PFOA 4RAZA 1SD5A 4RAYA 3WTTC 4YFKF 1B72B 1JUSA 1YJ9I 1R1TA 1RR8C 4IHYA 2FQ4A 2LKPA 2OBPA 3CUQB 2QSHX 4F55A 2L9SA 4HV6A 1SEUA 2DOAA 2M0MA 1P6RA 3C7JA 3CJTB 2HDWA 5KVRA 3L1PA 2OAZA 2LKSA 3FM5A 5GPAA 3IAM2 1T95A 4BGDA 1LVAA 2FE3A 3JRCA 2BW3A 5TGTA 1TNSA 3BTIA 3EDPA 3GTGJ 1I6XA 3ZQQA 5GAEJ 1X1PA 2XGDA 3JSPA 1XMAA 1MBJA 1VI0A 2NVUB 1X3WB 3KLNA 3ZR8X 4KT5C 3TEDA 5IYDJ 3J81K 4KUMA 4WF2A 3UNGC 4WXHA 3BJAA 4P9UA 2R7XA 1Z77A 1ZKGA 3U21A 2CQ7A 2ZMEC 1ZRFA 4OMZA 4LG0A 4RM3A 1MDMB 2CUZA 3CJNA 3PQJA 2GZWA 3H3VK 4Y4RA 3IV5A 2JSCA 3LNQA 3ESWB 1IC8A 3J7YJ 1KGSA 1ZGAA 1MJ9A 3C2HA 5D5XB 4D5FA 2R0QC 3CD6I 1OR7C 1YX3A 1DGWY 2GA2A 5H6QA 3BG3A 1Y0NA 4DZPA 5K7HA 1GXPA 3IH2A 1U9OA 4IX7A 4RGUA 3CESA 3LOCA 2VBWA 3S32A 3K70C 4RDUA 3BTCA 1BBYA 2LG4A 4A5MA 3IL2A 2HU9A 3ABMH 5K7FA 1DU6A 3O8GA 3QPHA 3HOXJ 4II3A 5FJ8J 4KYWA 5F6FA 2DMUA 3VPRA 1D0ZA 1W0UA 4GO1A 4AWXB 2O03A 1LEBA 1USTA 2O0YA 3K6GA 2XPWA 4EJWA 4F7ZA 5GP9A 5KCMA 5DCMB 2LH9A 3OOPA 3HRUA 4NDLA 2KJCA 1KQ9A 5D6EA 1VQ4I 2HQNA 4OIOF 1OCZH 2B0LA 4HPQA 1IN4A 1ON1A 4PSXA 2GLOA 5D8KB 3GFMA 4PJJA 1FBQA 1IDYA 2IS2A 1FLIA 2RV8A 3CO7C 1QRYA 4FE4A 3C1DA 3V4GA 1FJLA 3OYKA 2V79A 4CYCA 4HQEA 3VFZA 3E6BA 2M30A 1MSEC 2UXXA 3GBGA 4L9JA 2F5DA 2VB6A 3LSGA 3RPQA 4PCQA 3E0JB 2QQAA 2B9SA 2VKDA 1OYWA 2VPRA 4BQQA 2LP0A 4DYCA 2XGXA 3BTLA 4EM1A 2CS3A 1N78A 4O5VA 1UAAA 4ZDPA 3L7WA 5JLWA 2CFOA 5IOZA 2FEZA 3GVAA 4IPAA 1TZLA 3E3VA 2IRFG 1J09A 4MHGA 4CCMA 5J47A 1U5TA 4HAMA 2FUG2 2WV0A 3SFZA 3HRTA 1H0MA 2KRFA 3PL8A 2EFNA 3WG7H 1TWHJ 3I58A 1IDZA 2A61A 2PJRB 3P9IA 4V2FA 4A3FJ 3FDYA 1T8IA 4JYKA 3ECHA 2TDXA 3S16J 2CUJA 2A69F 2KRCA 3ECOA 2KHMA 3N4MA 5ICEA 4E7IA 2Z9OA 1HQCA 1R4NB 3MZHA 3PQKA 2AQEA 2GIZA 4OOIA 2DPUA 2BOLA 4AUXA 1SAXA 1TT5B 5IT9Z 1HSJA 2R5ZB 1UG2A 2WA0A 3ULQB 3WU2C 5C4JJ 4LK1F 2JTVA 4ZYAA 4KN4X 5C44J 3M8FA 5FKLA 5EG0B 1F4KA 5HS8A 3ZP5A 4B48A 4C30A 2VI6A 2WADA 5J3LA 1ZARA 3K70D 1TQIA 3HOYJ 2A5WA 2KLOA 4HLXA 4KITB 5LHHA 1G3WA 4RS8A 2VJJA 1JE8A 4X1EA 4I2OA 3JAMK 2ID3A 3CMEI 1S7EA 2K5CA 1D0XA 2QEXI 4PJMA 4HEA2 1WHUA 3IWFA 3F8NA 1U6GA 2GOXB 3HOZJ 2V9VA 3O8HA 4BXUA 4M72A 2E5NA 3EYYA 3GTOJ 3KP6A 5B1BH 4L0ZB 4IKFA 2WWYA 1IAWA 2LREA 3HC7A 1J5YA 1FYMA 5EF6A 2VQHA 3HKZA 4CXFA 2O61A 3HPHA 1G3YA 5D4RA 1LDDA 2EFQA 1H89C 4BYYA 4LLNA 2XF6A 2P5LC 1PUFA 1HW2A 1AU7A 3CP8A 2R5YA 3H9GA 4KMUX 3JRIA 3MWMA 4FASD 1B8IB 1S8NA 4QLCU 3DF8A 2QENA 2QLZA 3K7AJ 3QYBA 1R5HA 1WJCA 3VSLA 3WHCA 1X3ZB 2IXSA 2M34A 3PIOF 2HZTA 1PDNC 1KYZA 1ETKA 3WE2A 1YHQI 1XMKA 3VWBA 5J8FA 3E1SA 2HEOA 3DEUA 5K5QA 2FJ1A 2VUMJ 1KU3A 2VOOA 2GM4A 3B6CA 2HVRA 5ICFA 2LVSA 1J75A 2ZJRF 1VNDA 2MW8A 1E0EA 3OYAA 1LDJA 3Q0VA 2M87A 3BPVA 1TTYA 2PMZN 3TW7A 4CCKA 2MD5A 4I02A 2XKPA 3M4OJ 2A6TA 3GTPJ 1D8JA 4R1HA 3S2HJ 5LEKA 3CCLI 1XG1A 3ONQA 4IOCF 3L2UA 4WK8F 2R7QA 4G6TB 2BVLA 2A6HF 3GLXA 3J81Z 2AHQA 3I4PA 3BY6A 3I56I 5DD4A 1ZN2A 2XB5A 1DP7P 3BCAA 3A02A 2V6EA 3H9JA 3GCMA 2G0EA 1ZRDA 3QU6A 4BQAA 1OMIA 3MFKA 3AL0B 3EYIA 2LNBA 1J0RA 2K7LA 1IRFA 4GGGA 1FYLA 4D5CA 3SEZA 1YO5C 4U0VA 2ZNZA 2DT5A 3I4NJ 2H6BA 4O6JA 2VBYA 4EEFG 5E20A 1Z3YA 3G1OA 2EA2A 1JJ6C 1D8KA 1Y8RB 2KIMA 4XONA 2W25A 4IVNA 2VKHA 4QWQA 1LB2A 1LFBA 3WTZA 3FKJA 3V7SA 1L0OC 3NAUA 4PJNA 1U78A 2LR8A 1KA8A 4P1WA 2LD5A 1Y39A 3DKXA 4DYQA 3DPUA 4IOAF 4P96A 4KN7X 2PG4A 3I0TA 5KAFC 2R7TA 1I1SA 4A3EJ 3E6DA 3ABKH 3GFJA 5KNLA 1J9IA 2GA1A 2ZXJA 4Z6YA 1RR7A 4II2A 3OIOA 3GW2A 1YITI 2JA7J 1STZA 4XRSG 3DQVC 1YJNI 5J1RA 5LEJA 3S93A 2Y0SN 1FT9A 2L5QA 2VQGA 2XUBA 1SMTA 1K83J 2VODA 2K9LA 5K7ZA 3S2DJ 2HQRA 1LE8B 1A6IA 3V7RA 1QBJA 1RI7A 3JRGA 2HKXA 3FMQA 2MG4A 3HTUA 1YS7A 4EQQA 3DU6A 4BHCA 2CQNA 1V54H 3CCUI 3HUGB 5DV5A 1S3JA 5E79C 1W36C 1U0JA 1GDTA 2XAJA 4ZYGA 3AKZA 5FLMJ 1FMWA 1DP3A 2F5VA 4BAYA 2Q8KA 3CLOA 1Z6RA 1ZHFA 3PUBA 2P7CB 4HOBA 4XICA 1SD6A 4YFXF 4NQWB 3SXYA 3KLOA 3BT9A 4BXXJ 1MNDA 4L5JA 4HDUA 3SDGA 3TO9A 3OIQA 2RDPA 2QBYA 1RIOH 3HEFA 3MKWB 2HWVA 2EFPA 4RGSA 1FOYA 2NVTJ 2L3DA 2DU9A 4BY7J 4ENKA 1IV6A 3IRRA 3CZ6A 3S8PA 2F4IA 4Y3OA 4KMFA 1RUNA 4MO7A 4XRSA 1H88C 2I5UA 1E17A 2XRNA 1REPC 3M8JA 1MBGA 2ME6A 4ZZDA 5EGOA 1PUEE 1H8AC 4ASNA 3OYIA 3RPUA 3OL3A 4L0YB 4B09A 1T39A 1ZLKA 3BJOA 4C3JJ 1ITYA 3QYFA 1WQ2A 4ESFA 5E18F 1WCMJ 1OCPA 3TW6A 4HX4A 3P9CA 1O7LA 2E1NA 4ZYDA 5IP6A 4KDPA 2Y0SA 4DJAA 2LY1A 5TJJA 1Q1HA 2DJIA 3IRQA 5DCFA 4GYGA 4MNUA 3RKWA 1BIBA 1U3EM 3K4BA 2QVOA 5LGUA 4HBLA 6PAXA 4PJ0C 2RQPA 2F4OB 3DPTA 1A31A 2K27A 3ABUA 4I0AA 3MZYA 2JZYA 4A0YA 5EDNA 2Z5UA 2FF4A 2JQ7A 1U8BA 4HNVA 3D1NI 3CCJI 2XGCA 2XAHA 2FRHA 2LBFB 4LD5A 4J19A 4Q4ZF 2ISYA 1P4AA 2DFHA 5EZHA 3ZRGA 5HNFA 3TO7A 4M6XA 2DTRA 4MTEA 1MMGA 3ZQHA 1P92A 2Z33A 2M8GX 1MKMA 3BCBA 2LKXA 2Y48A 1P2FA 4QIWN 5J4YA 1ZH5A 5E3MA 2HGCA 4J00A 1ULYA 2WC2A 3ZQIA 1JGGA 2VE9A 3HIFA 3OY9A 1VQMI 1D1AA 1W5SA 2BHZA 3KP3A 1XMXA 1MDMA 4FT8A 2FX0A 3VSKA 2LC2A 3BPXA 5D5VB 3ABLH 1FSEA 3KCCA 3JRFA 4HSTA 2ZO4A 4CICA 1LJ9A 2ZXHA 2H8WA 5CQGA 3HOSA 4BKXA 4RB2C 2AS5F 3COAC 3U1DA 1YX5A 2Z2SB 4MLOA 2HYGD 3TQNA 2EA4A 2H1LA 3CJQB 3T8TA 1IRGA 3G2BA 2Z16A 5JI6A 4NB5A 1FOWA 2RGVA 1X2NA 3H5RA 2LF7A 1SFKA 5KK1A 1W36D 2WB1A 4M3EA 4EJOA 4KIFA 2M8EA 4MTDA 1A5JA 2RREA 2FOKA 3Q9SA 1WI3A 3BQZA 1XCVA 2H6CA 2RNGA 3DEEA 1VQKI 2HTJA 2DJNA 1BJAA 4U0YA 3IC7A 3WTYC 2ECBA 1QVUA 4UUVA 1V5GA 4A3IJ 3H5AA 3CC7I 5ILVA
chains in the Genus database with same CATH topology
3WU0A 5DCMA 1HSTA 5EEHA 4RGXA 4Y17A 3TDZC 1R00A 3L00A 2OQRA 3V8LA 2EB7A 4UXNA 3RTRA 2EV0A 2V1XA 1I1GA 4MEYF 1EV7A 5JHUA 3F72A 5LRRA 2XROA 2OU2A 1UCRA 5H20A 3V7CA 4EV0A 4Y13A 2IVMA 3P7NA 1XN7A 2W84A 3QAHA 3O6BB 4I98B 2CSOA 1G4DA 1ODDA 3L09A 3K0LA 3LA3A 5ILUA 1C0WA 3WG9A 3SQNA 5LHGA 4UNOA 2M1BA 5FFXA 2BV6A 3IKTA 2UXNA 1DPUA 5A2QK 3G73A 1TQPA 4U88A 3HSEA 2BYVE 4G7ZF 5E17F 1JGSA 3U2RA 3Q9VA 2FSWA 3JTHA 3D5LA 1HW1A 5J6XA 2M5WA 5BQTA 3F23A 2L02A 2E1CA 2RC4A 1R23A 5D8LB 3FM3A 3RI4A 2JRTA 2P7VB 3K2ZA 3ABTA 3NRVA 1YW8A 1TNTA 1SMYF 1FBSA 1XDUA 2JPCA 3NEUA 2NAZA 2YU3A 4EGZA 3FHZA 4EGYA 3WTXC 2DK8A 4HQMA 5HVQC 2FBIA 5CYVA 3E5XA 2ESHA 4GCVA 5F64A 1BIAA 1IXCA 3MEXA 4KICA 3IKVA 1BI1A 2PMUA 1U5TC 3KZZA 3GO5A 1YFHA 4HF1A 2PBIA 5CVJA 1X3UA 2ESNA 1S6LA 4DNCA 1SD4A 3F8BA 2OZUA 1BC8C 5E1WA 3I5UA 3RKYA 1P4XA 2F5EA 3V8KA 1UFMA 5D6FA 1ON2A 4FX4A 2FNPA 3LAPA 1Z7UA 1MJBA 2G9WA 2VC0A 2ADUA 1LQ1A 4S04A 4DQ2A 5FFZA 3KFWX 1BN5A 2CWEA 3QP6A 1XSVA 3GFLA 3KP7A 3W6KB 1KU7A 1LDKB 4MEXF 5HOOA 5ILSA 1TQMA 3CDHA 2L54A 3C18A 2A3SA 2P5VA 2P8TA 5EEGA 1B59A 3LFKA 4EJUA 3RDIA 4UVCA 4MQ9F 4AD9A 1MGTA 4LK0F 2VC1A 3CTAA 4LMYA 1SFXA 3KE2A 1R36A 1JHFA 2KIUA 1GVJA 4R79A 1IUYA 2GWRA 4P55A 5JVTA 4HV5A 1Z6TA 2FNAA 4Q47A 4LG0B 3HUGA 4I01A 4MQVA 3W6JB 4Y15A 4KA4A 2P4WA 2DBBA 2EV6A 2RKHA 3J80K 4IXAA 3FWEA 4IHTA 1XSDA 1T2KA 5HLHA 2HYFA 4CGZA 1J7KA 4GXOA 2DK5A 5LGTA 1K78A 2CQKA 1R58A 1IN7A 4UVBA 2VT3A 4XLNF 4RGRA 5LBQA 4RB3C 2ZMEB 4G7HF 2F5FA 4YIIA 4XSXF 4HA8A 3KEQA 2PJPA 2BEOA 2K4BA 2UZKA 4A0ZA 3ZMUA 3OV8A 5CVIA 2V1DA 2X4HA 2Z99A 2FQ3A 4U7DA 2HTSA 1W7PA 5LGNA 2PLYA 3MAJA 3VEPA 2C6YA 4HX8A 3ZMDA 3D0SA 4ESBA 3E5QA 3WTSC 3REOA 3SHFA 4EMSA 3QOPA 1EH6A 1ONVA 2IW5A 4G6DA 1FZPB 2W57A 2GXGA 5CVUA 4CYDA 2QUFA 1U5TB 5LLQA 3ZN1A 3BROA 1R1VA 5ICCA 3CO6C 5AONA 1AOYA 3IWZA 5FGMA 4KFCA 2ZJ2A 4XLPF 3R0JA 1HXDA 5CJ9A 2NRAC 2Y75A 3LA7A 1YYVA 4IF4A 3DFGA 5ERIA 3DP7A 5AIPA 2BGCA 2UWMA 1BI3A 1VTNC 2AXLA 4IRGA 1XGNA 1O3TA 3RYPA 2ZFWA 4E70A 1ZG3A 3FX3A 4MGRA 2EJRA 2NNYA 4D0PA 4HYEA 4LGWA 4U0WA 2PEXA 4ZH4F 4O3MA 1RNLA 3KP2A 3WTVC 2EK5A 2O8XA 2A07F 4YG2F 2DFIA 2MLGA 1V4RA 2DAOA 4G7OF 1XGOA 1ZG1A 1ZLJA 2MA3A 5HDKA 2O3FA 2Q2EA 4P5OA 4K2EA 5HDNA 1QGPA 1FNNA 4CHUA 2K02A 2JT1A 3KP4A 2V1UA 1IXSB 5E1XA 2STTA 1QNTA 3GX4X 5TRDA 4LJZF 1FP2A 4ENJA 4R8HA 3GZ6A 2D1HA 2JPBA 4BH9A 4LB6B 2XAQA 1IW7F 3HYIA 2IJLA 5D4SA 4M9ZA 2MBFA 4BHBA 1FSHA 3F6VA 1B4AA 4U7BA 5K1YA 1U2WA 3EUHA 4AVPA 1G6NA 3RYRA 2J5OA 1FY7A 3HTSB 5JR3A 3CUQA 1TBXA 2PQ8A 3F8CA 2VONA 3RJPA 4UV8A 1FC3A 4AIJA 3R6SA 1K6OA 3R61A 1KQ0A 1FP1D 2ZBKA 3JAMZ 5L3CA 3HOTA 2Y0MA 3HHGA 2XIGA 2GXBA 1USSA 5HLGA 4WWCA 3I64A 4OINF 1YQAA 3LQQA 4OIPF 1Z91A 1LNWA 2IT0A 4HZFA 2MC3A 5L3BA 3ZMVA 5FLXK 4Q5SF 5FD5A 2GQQA 3QU3A 4EM2A 3J80Z 5DYMA 3E6CC 2J5PA 4YIFA 2CG4A 1KU2A 1P4WA 1UHWA 2ACJA 3GYHX 2HDCA 1O3RA 5HS7A 4ON0A 3TOBA 1CGPA 3QPTA 1WI9A 1MJAA 1CF7B 1YS6A 5L3EA 1FBUA 1SFUA 3ML6A 1YG2A 4I0BA 1YLFA 4CZZA 3TO6A 2DPDA 3EQLF 2R7FA 3ZN0A 3ZQ7A 3E5UA 1T38A 3GF2A 2KKOA 1IF1A 1I5ZA 3HSFA 2V6CA 4G8XA 1V3FA 2W24A 1J59A 4ETSA 3H92A 4L5IA 5BOXA 1TW2A 1JXSA 3BP8A 2VBXA 2F5CA 1O3SA 3T0YA 3WGGA 3JW4A 2QBYB 4JQFA 3ROUA 1HBXG 3WE3A 2VT2A 2H94A 2CW0F 2VN2A 2FXAA 2DW4A 3WTUC 4A12A 1KYWA 3H3UA 2X0LA 4HDVA 4BHPA 5HDGA 1S29A 5H6RA 1F1ZA 1K79A 2HOEA 3MQ0A 3S2WA 3J7AO 4ZZLA 2FMLA 2FMYA 2R3SA 1UB9A 1W5TA 1TW3A 1Z9CA 2W85A 4M71A 4PZJA 3L2CA 2PFBA 2E7XA 1S7AA 2XKOA 1DUXC 1O57A 1IXRC 3I71A 2XHKA 2IA1A 5HS9A 3EETA 1LEAA 1ZAOA 4UHTA 4I09A 1OPCA 1W4MA 2K86A 4G6QA 4Q48A 1T6SA 3QRFF 1EH7A 4OIQF 2VOPA 1YW9A 1XDSA 4OIRF 3R60A 3GWZA 3TKYA 4XRFA 3HRSA 4HF0A 1BM9A 4LLGF 3BZ6A 4L9NA 5F1RA 2R7DA 3ZPLA 3GFIA 3B02A 4A6DA 3M9AA 3CUOA 3HRMA 3WODF 4M9XA 1FPQA 4A2UA 2PMHA 4YFNF 1T98A 2NYXA 3L9FA 2VBZA 5ICGA 3ERED 2LSOA 1IN6A 2ZMEA 3JSOA 2BE5F 3KEOA 4BNCA 1FWZA 2QZ8A 1OR7A 3TGNA 5DD8A 1D5VA 1GHCA 2DI3A 2ETHA 5FLXZ 3F8MA 1NHAA 4KNYA 2HR3A 4IRIA 2GIVA 3WTWC 3I59B 2L4MA 2DQLA 4EJTA 2COMA 2ZNYA 3ELKA 2P5KA 2DLLA 4XBFA 4PDKA 5FD6A 3T8RA 3TDUC 1OYYA 3KZYA 1PP8F 5L3FA 2KIFA 2QQ9A 1SFEA 2MLKA 5ED4A 2NS0A 4A0XA 2L4AA 4NHJA 4M9SA 2G7UA 1DDNA 1XB4A 5CVVA 5E8GA 1FYKA 5BS6A 1QZYA 3GXOA 3V8JA 3VOEA 1H9GA 3IHUA 2ELHA 1F5TA 2H27A 3R0AA 4XSZF 4L9TA 4NQWA 5K5RA 3M1EA 2M45A 2OZ6A 5HLIA 2QQBA 4G9YA 4PGHA 3P9KA 2QWWA 1HKTA 1SD7A 4FHTA 2VE8A 5A2QZ 4JK1X 3T1BA 2IP2A 3GZ5A 5BPDA 2QM3A 1R22A 4ENNA 2YSRA 3FMSA 1R1UA 2CO5A 2EFWA 1BI2A 4WCGA 3N97A 2HS5A 2ZKZA 4FX0A 2MH2A 2XASA 3F3XA 4LFUA 3HHHA 4M6YA 4S05A 1YIOA 2K4JA 3E97A 1GXQA 3T5XA 4B8XA 1O7FA 1TLHB 3RKXA 1B6AA 4IHSA 1WKMA 2HKOA 3C3WA 1R7JA 4N9IA 2FBHA 3E6MA 2P6SA 4M74A 4AIKA 1K7AA 5FB2A 3FZVA 1IN8A 4PGGA 4EM0B 2WTEA 3K1NA 1ZYRF 3WGHA 5K5OA 1MZBA 1Z1DA 3HSRA 3DKWA 4IRHA 1RZ4A 3K69A 1ZG5A 2D2WA 3M8EA 2QYOA 3FF5A 3ZMZA 4WX9A 3MCZA 3F8FA 1FX7A 5D5UB 1L3LA 2DQRA 3KP5A 2F2EA 1CF7A 3LQRA 4AIHA 2XAGA 1AWCA 3LA2A 4I7HA 4JBAA 2YPRA 4CO8A 2RNJA 2YR2A 1I27A 1KU9A 1B9NA 2BBYA 4N9HA 1W7PD 2LF8A 3JTGA 5AIQA 2STWA 3K1PA 2IPQX 3AAFA 3VODA 2PI0A 3FMRA 2XV4S 3FXQA 2KJBA 2YX4A 1S7OA 4H0EA 2A6EF 3CUQC 1UHMA 2D45A 3B73A 2Q0OA 2PN6A 1ZREA 2EFOA 3I54A 2OA4A 4WXDA 1J2XA 4RB1A 3LSTA 4WXCA 1BI0A 1F9NA 3G3ZA 3GUDA 5D5WB 1XCBA 2DO7A 3O3KA 1K78B 2IA0A 4CDGA 3NQOA 1KQ8A 4ESJA 1JHHA 2MH9A 1R5GA 5BPIA 4UV9A 3F21A 2VXZA 3VB2A 1HKQA 3FXRA 1PP7U 3BOQA 2D1VA 1YW7A 1WSUA 4OMYA 3ISPA 2IA2A 3K9TA 3O2PE 2CFXA 2OD5A 1RUOA 4A6EA 4Z2YA 3GEZA 5BMZA 2RN7A 4L18B 4ZYEA 4LB5A 2FA5A 3Q5FA 2EWNA 1W7PB 1A04A 3BWGA 4LLLA 1BC7C 2FU4A 2RVCA 2GAUA 5JFRA 2CYYA 3K1MA 2XVCA 3SZTA 3DPLC 4G94A 3WGIA 1ZRCA 5DUIA 4EVIA 1Y0UA 4TV7A 1QZZA 2NNNA 1HW5A 2LDUA 2HFHA 4RB0A 2OQGA 1U8RA 2ZCWA 1G3SA 1B1BA 4M73A 3QP5A 1QO0D 5CVRA 2ISZA 3R4KA 3F6OA 1G3TA 1O3QA 4HF2A 2YX7A 1OKRA 1H9TA 4HLYA 4ENMA 4GYIA 1Z05A 1WWXA 5FO5A 2EV5A 3BDDA 3I53A 3F22A 4P9FA 1IZ1A 5LHIA 5DDGA 4HW0A 3M7GA 4N0BA 5IT9K 1XGMA 5CLSA 3FXUA 1DPRA 1ZGJA 2G7HA 2A68F 1IN5A 1YTYA 4KIBA 2XAFA 4IJAA 1B9MA 2E7WA 5L3GA 3TOAA 2P6TA 5IT3A 1WRJA 2H09A 4A5NA 4EJVA 3PFIA 1MD0A 2Z3YA 1QQIA 1QPMA 1E2XA 3H3ZA 1D3YA 3RIRA 3KETA 1XD7A 5DEQA 1XSXA 2A5YB 1HKSA 4HX7A 3LWFA 3DV8A 1OYIA 1FOKA 5E1ZB 2L01A 3WU1B 1T0FA 1XGSA 4OU0A 5E8IA 1EH8A 3BJ6A 5DUKA 3SZPA 3ZMSA 1BOAA 3I59A 5LRSA 4UVAA 3LAJA 3U9GA 3DXJF 2FBKA 2CGPA 4KIGA 5J8CA 4L9VA 5L3DA 4ZYHA 2O6GE 3ZMTA 4RAZA 1SD5A 4RAYA 3WTTC 4YFKF 1R1TA 2LKPA 2OBPA 3CUQB 4HV6A 3C7JA 1P6RA 5KVRA 2OAZA 3FM5A 1LVAA 2FE3A 1TNSA 3EDPA 1I6XA 3JSPA 1XMAA 3KLNA 4KT5C 3J81K 4KUMA 4WF2A 4WXHA 3BJAA 4P9UA 1ZRFA 4OMZA 4LG0A 1MDMB 3CJNA 3PQJA 2GZWA 2JSCA 1KGSA 1ZGAA 1MJ9A 5D5XB 2GA2A 5H6QA 1GXPA 4RGUA 2VBWA 4A5MA 1BBYA 3IL2A 3QPHA 4KYWA 5F6FA 4GO1A 4AWXB 2O03A 1LEBA 1USTA 2O0YA 4EJWA 4F7ZA 5DCMB 3OOPA 3HRUA 2KJCA 1KQ9A 5D6EA 2HQNA 4OIOF 2B0LA 1IN4A 1ON1A 5D8KB 3GFMA 1FBQA 1FLIA 2RV8A 3CO7C 3C1DA 3V4GA 2V79A 4HQEA 3VFZA 3E6BA 2M30A 2UXXA 4L9JA 2F5DA 3RPQA 4PCQA 2QQAA 1OYWA 2XGXA 4EM1A 4O5VA 3L7WA 2FEZA 3GVAA 4IPAA 3E3VA 2IRFG 4MHGA 1U5TA 4HAMA 2WV0A 3SFZA 3HRTA 1H0MA 2KRFA 2EFNA 3I58A 2A61A 3P9IA 3ECHA 2TDXA 2A69F 3ECOA 3N4MA 5ICEA 2Z9OA 1HQCA 3MZHA 3PQKA 4OOIA 2DPUA 1SAXA 5IT9Z 1HSJA 3ULQB 4LK1F 2JTVA 4KN4X 3M8FA 1F4KA 5HS8A 3ZP5A 1ZARA 1TQIA 4HLXA 5LHHA 1G3WA 4RS8A 1JE8A 4I2OA 3JAMK 3IWFA 3F8NA 1U6GA 2V9VA 4BXUA 4M72A 3EYYA 3KP6A 4L0ZB 2WWYA 1IAWA 1J5YA 1FYMA 4CXFA 2O61A 1G3YA 5D4RA 1LDDA 2EFQA 4BYYA 4LLNA 2P5LC 1HW2A 4KMUX 3MWMA 1S8NA 4QLCU 3DF8A 2QENA 2QLZA 1R5HA 2HZTA 1PDNC 1KYZA 3WE2A 1XMKA 5J8FA 2HEOA 3DEUA 5K5QA 1KU3A 2VOOA 5ICFA 1J75A 1LDJA 2M87A 3BPVA 1TTYA 2MD5A 4I02A 2XKPA 1D8JA 4R1HA 5LEKA 4WK8F 2A6HF 3GLXA 3J81Z 3I4PA 3BY6A 5DD4A 1ZN2A 1DP7P 1ZRDA 3QU6A 4BQAA 1OMIA 3MFKA 3EYIA 2LNBA 1J0RA 2K7LA 1IRFA 4GGGA 1FYLA 1YO5C 4U0VA 2ZNZA 2DT5A 2H6BA 4O6JA 2VBYA 5E20A 2EA2A 1D8KA 2KIMA 2W25A 4IVNA 4QWQA 1LB2A 3WTZA 3V7SA 1L0OC 1U78A 1KA8A 4P96A 4KN7X 2PG4A 3I0TA 1I1SA 3E6DA 3GFJA 1J9IA 2GA1A 2ZXJA 3GW2A 1STZA 3DQVC 5LEJA 1FT9A 2XUBA 1SMTA 2VODA 2HQRA 3V7RA 1QBJA 1RI7A 2HKXA 3FMQA 3HTUA 1YS7A 4EQQA 4BHCA 5DV5A 1S3JA 2XAJA 4ZYGA 4BAYA 2Q8KA 3CLOA 1Z6RA 1ZHFA 2P7CB 4HOBA 1SD6A 4YFXF 3SXYA 3KLOA 4HDUA 4L5JA 3TO9A 2RDPA 2QBYA 1RIOH 2HWVA 2EFPA 4RGSA 2L3DA 2DU9A 4ENKA 3IRRA 4KMFA 1RUNA 1E17A 2XRNA 1REPC 4ZZDA 1PUEE 4ASNA 3RPUA 4L0YB 4B09A 1T39A 1ZLKA 3BJOA 1WQ2A 4ESFA 5E18F 4HX4A 3P9CA 1O7LA 2E1NA 4ZYDA 4KDPA 3IRQA 1Q1HA 5TJJA 5DCFA 4GYGA 4MNUA 3RKWA 1BIBA 1U3EM 6PAXA 2QVOA 5LGUA 4HBLA 2RQPA 3DPTA 2K27A 3ABUA 4I0AA 3MZYA 2JZYA 4A0YA 2Z5UA 2FF4A 2XAHA 2FRHA 4LD5A 4Q4ZF 2ISYA 1P4AA 3TO7A 4M6XA 2DTRA 4MTEA 1P92A 2Z33A 1MKMA 2Y48A 1P2FA 1ZH5A 2HGCA 1ULYA 2WC2A 2VE9A 3HIFA 1W5SA 3KP3A 1MDMA 4FT8A 5D5VB 3BPXA 1FSEA 3KCCA 2ZO4A 4CICA 1LJ9A 3HOSA 4RB2C 2AS5F 3COAC 3U1DA 2HYGD 3TQNA 2EA4A 3T8TA 1IRGA 5JI6A 4NB5A 2RGVA 2LF7A 5KK1A 4EJOA 4KIFA 2M8EA 4MTDA 2FOKA 3Q9SA 1XCVA 2H6CA 2HTJA 1BJAA 4U0YA 3IC7A 3WTYC 4UUVA 5ILVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU0 A;  5DCM A;  1HST A;  5EEH A;  4RGX A;  4Y17 A;  3TDZ C;  1R00 A;  3L00 A;  2OQR A;  3V8L A;  2EB7 A;  4UXN A;  3RTR A;  2EV0 A;  2V1X A;  1I1G A;  4MEY F;  1EV7 A;  5JHU A;  3F72 A;  5LRR A;  2XRO A;  2OU2 A;  1UCR A;  5H20 A;  3V7C A;  4EV0 A;  4Y13 A;  2IVM A;  3P7N A;  1XN7 A;  2W84 A;  3QAH A;  3O6B B;  4I98 B;  2CSO A;  1G4D A;  1ODD A;  3L09 A;  3K0L A;  3LA3 A;  5ILU A;  1C0W A;  3WG9 A;  3SQN A;  5LHG A;  4UNO A;  2M1B A;  5FFX A;  2BV6 A;  3IKT A;  2UXN A;  1DPU A;  5A2Q K;  3G73 A;  1TQP A;  4U88 A;  3HSE A;  2BYV E;  4G7Z F;  5E17 F;  1JGS A;  3U2R A;  3Q9V A;  2FSW A;  3JTH A;  3D5L A;  1HW1 A;  5J6X A;  2M5W A;  5BQT A;  3F23 A;  2L02 A;  2E1C A;  2RC4 A;  1R23 A;  5D8L B;  3FM3 A;  3RI4 A;  2JRT A;  2P7V B;  3K2Z A;  3ABT A;  3NRV A;  1YW8 A;  1TNT A;  1SMY F;  1FBS A;  1XDU A;  2JPC A;  3NEU A;  2NAZ A;  2YU3 A;  4EGZ A;  3FHZ A;  4EGY A;  3WTX C;  2DK8 A;  4HQM A;  5HVQ C;  2FBI A;  5CYV A;  3E5X A;  2ESH A;  4GCV A;  5F64 A;  1BIA A;  1IXC A;  3MEX A;  4KIC A;  3IKV A;  1BI1 A;  2PMU A;  1U5T C;  3KZZ A;  3GO5 A;  1YFH A;  4HF1 A;  2PBI A;  5CVJ A;  1X3U A;  2ESN A;  1S6L A;  4DNC A;  1SD4 A;  3F8B A;  2OZU A;  1BC8 C;  5E1W A;  3I5U A;  3RKY A;  1P4X A;  2F5E A;  3V8K A;  1UFM A;  5D6F A;  1ON2 A;  4FX4 A;  2FNP A;  3LAP A;  1Z7U A;  1MJB A;  2G9W A;  2VC0 A;  2ADU A;  1LQ1 A;  4S04 A;  4DQ2 A;  5FFZ A;  3KFW X;  1BN5 A;  2CWE A;  3QP6 A;  1XSV A;  3GFL A;  3KP7 A;  3W6K B;  1KU7 A;  1LDK B;  4MEX F;  5HOO A;  5ILS A;  1TQM A;  3CDH A;  2L54 A;  3C18 A;  2A3S A;  2P5V A;  2P8T A;  5EEG A;  1B59 A;  3LFK A;  4EJU A;  3RDI A;  4UVC A;  4MQ9 F;  4AD9 A;  1MGT A;  4LK0 F;  2VC1 A;  3CTA A;  4LMY A;  1SFX A;  3KE2 A;  1R36 A;  1JHF A;  2KIU A;  1GVJ A;  4R79 A;  1IUY A;  2GWR A;  4P55 A;  5JVT A;  4HV5 A;  1Z6T A;  2FNA A;  4Q47 A;  4LG0 B;  3HUG A;  4I01 A;  4MQV A;  3W6J B;  4Y15 A;  4KA4 A;  2P4W A;  2DBB A;  2EV6 A;  2RKH A;  3J80 K;  4IXA A;  3FWE A;  4IHT A;  1XSD A;  1T2K A;  5HLH A;  2HYF A;  4CGZ A;  1J7K A;  4GXO A;  2DK5 A;  5LGT A;  1K78 A;  2CQK A;  1R58 A;  1IN7 A;  4UVB A;  2VT3 A;  4XLN F;  4RGR A;  5LBQ A;  4RB3 C;  2ZME B;  4G7H F;  2F5F A;  4YII A;  4XSX F;  4HA8 A;  3KEQ A;  2PJP A;  2BEO A;  2K4B A;  2UZK A;  4A0Z A;  3ZMU A;  3OV8 A;  5CVI A;  2V1D A;  2X4H A;  2Z99 A;  2FQ3 A;  4U7D A;  2HTS A;  1W7P A;  5LGN A;  2PLY A;  3MAJ A;  3VEP A;  2C6Y A;  4HX8 A;  3ZMD A;  3D0S A;  4ESB A;  3E5Q A;  3WTS C;  3REO A;  3SHF A;  4EMS A;  3QOP A;  1EH6 A;  1ONV A;  2IW5 A;  4G6D A;  1FZP B;  2W57 A;  2GXG A;  5CVU A;  4CYD A;  2QUF A;  1U5T B;  5LLQ A;  3ZN1 A;  3BRO A;  1R1V A;  5ICC A;  3CO6 C;  5AON A;  1AOY A;  3IWZ A;  5FGM A;  4KFC A;  2ZJ2 A;  4XLP F;  3R0J A;  1HXD A;  5CJ9 A;  2NRA C;  2Y75 A;  3LA7 A;  1YYV A;  4IF4 A;  3DFG A;  5ERI A;  3DP7 A;  5AIP A;  2BGC A;  2UWM A;  1BI3 A;  1VTN C;  2AXL A;  4IRG A;  1XGN A;  1O3T A;  3RYP A;  2ZFW A;  4E70 A;  1ZG3 A;  3FX3 A;  4MGR A;  2EJR A;  2NNY A;  4D0P A;  4HYE A;  4LGW A;  4U0W A;  2PEX A;  4ZH4 F;  4O3M A;  1RNL A;  3KP2 A;  3WTV C;  2EK5 A;  2O8X A;  2A07 F;  4YG2 F;  2DFI A;  2MLG A;  1V4R A;  2DAO A;  4G7O F;  1XGO A;  1ZG1 A;  1ZLJ A;  2MA3 A;  5HDK A;  2O3F A;  2Q2E A;  4P5O A;  4K2E A;  5HDN A;  1QGP A;  1FNN A;  4CHU A;  2K02 A;  2JT1 A;  3KP4 A;  2V1U A;  1IXS B;  5E1X A;  2STT A;  1QNT A;  3GX4 X;  5TRD A;  4LJZ F;  1FP2 A;  4ENJ A;  4R8H A;  3GZ6 A;  2D1H A;  2JPB A;  4BH9 A;  4LB6 B;  2XAQ A;  1IW7 F;  3HYI A;  2IJL A;  5D4S A;  4M9Z A;  2MBF A;  4BHB A;  1FSH A;  3F6V A;  1B4A A;  4U7B A;  5K1Y A;  1U2W A;  3EUH A;  4AVP A;  1G6N A;  3RYR A;  2J5O A;  1FY7 A;  3HTS B;  5JR3 A;  3CUQ A;  1TBX A;  2PQ8 A;  3F8C A;  2VON A;  3RJP A;  4UV8 A;  1FC3 A;  4AIJ A;  3R6S A;  1K6O A;  3R61 A;  1KQ0 A;  1FP1 D;  2ZBK A;  3JAM Z;  5L3C A;  3HOT A;  2Y0M A;  3HHG A;  2XIG A;  2GXB A;  1USS A;  5HLG A;  4WWC A;  3I64 A;  4OIN F;  1YQA A;  3LQQ A;  4OIP F;  1Z91 A;  1LNW A;  2IT0 A;  4HZF A;  2MC3 A;  5L3B A;  3ZMV A;  5FLX K;  4Q5S F;  5FD5 A;  2GQQ A;  3QU3 A;  4EM2 A;  3J80 Z;  5DYM A;  3E6C C;  2J5P A;  4YIF A;  2CG4 A;  1KU2 A;  1P4W A;  1UHW A;  2ACJ A;  3GYH X;  2HDC A;  1O3R A;  5HS7 A;  4ON0 A;  3TOB A;  1CGP A;  3QPT A;  1WI9 A;  1MJA A;  1CF7 B;  1YS6 A;  5L3E A;  1FBU A;  1SFU A;  3ML6 A;  1YG2 A;  4I0B A;  1YLF A;  4CZZ A;  3TO6 A;  2DPD A;  3EQL F;  2R7F A;  3ZN0 A;  3ZQ7 A;  3E5U A;  1T38 A;  3GF2 A;  2KKO A;  1IF1 A;  1I5Z A;  3HSF A;  2V6C A;  4G8X A;  1V3F A;  2W24 A;  1J59 A;  4ETS A;  3H92 A;  4L5I A;  5BOX A;  1TW2 A;  1JXS A;  3BP8 A;  2VBX A;  2F5C A;  1O3S A;  3T0Y A;  3WGG A;  3JW4 A;  2QBY B;  4JQF A;  3ROU A;  1HBX G;  3WE3 A;  2VT2 A;  2H94 A;  2CW0 F;  2VN2 A;  2FXA A;  2DW4 A;  3WTU C;  4A12 A;  1KYW A;  3H3U A;  2X0L A;  4HDV A;  4BHP A;  5HDG A;  1S29 A;  5H6R A;  1F1Z A;  1K79 A;  2HOE A;  3MQ0 A;  3S2W A;  3J7A O;  4ZZL A;  2FML A;  2FMY A;  2R3S A;  1UB9 A;  1W5T A;  1TW3 A;  1Z9C A;  2W85 A;  4M71 A;  4PZJ A;  3L2C A;  2PFB A;  2E7X A;  1S7A A;  2XKO A;  1DUX C;  1O57 A;  1IXR C;  3I71 A;  2XHK A;  2IA1 A;  5HS9 A;  3EET A;  1LEA A;  1ZAO A;  4UHT A;  4I09 A;  1OPC A;  1W4M A;  2K86 A;  4G6Q A;  4Q48 A;  1T6S A;  3QRF F;  1EH7 A;  4OIQ F;  2VOP A;  1YW9 A;  1XDS A;  4OIR F;  3R60 A;  3GWZ A;  3TKY A;  4XRF A;  3HRS A;  4HF0 A;  1BM9 A;  4LLG F;  3BZ6 A;  4L9N A;  5F1R A;  2R7D A;  3ZPL A;  3GFI A;  3B02 A;  4A6D A;  3M9A A;  3CUO A;  3HRM A;  3WOD F;  4M9X A;  1FPQ A;  4A2U A;  2PMH A;  4YFN F;  1T98 A;  2NYX A;  3L9F A;  2VBZ A;  5ICG A;  3ERE D;  2LSO A;  1IN6 A;  2ZME A;  3JSO A;  2BE5 F;  3KEO A;  4BNC A;  1FWZ A;  2QZ8 A;  1OR7 A;  3TGN A;  5DD8 A;  1D5V A;  1GHC A;  2DI3 A;  2ETH A;  5FLX Z;  3F8M A;  1NHA A;  4KNY A;  2HR3 A;  4IRI A;  2GIV A;  3WTW C;  3I59 B;  2L4M A;  2DQL A;  4EJT A;  2COM A;  2ZNY A;  3ELK A;  2P5K A;  2DLL A;  4XBF A;  4PDK A;  5FD6 A;  3T8R A;  3TDU C;  1OYY A;  3KZY A;  1PP8 F;  5L3F A;  2KIF A;  2QQ9 A;  1SFE A;  2MLK A;  5ED4 A;  2NS0 A;  4A0X A;  2L4A A;  4NHJ A;  4M9S A;  2G7U A;  1DDN A;  1XB4 A;  5CVV A;  5E8G A;  1FYK A;  5BS6 A;  1QZY A;  3GXO A;  3V8J A;  3VOE A;  1H9G A;  3IHU A;  2ELH A;  1F5T A;  2H27 A;  3R0A A;  4XSZ F;  4L9T A;  4NQW A;  5K5R A;  3M1E A;  2M45 A;  2OZ6 A;  5HLI A;  2QQB A;  4G9Y A;  4PGH A;  3P9K A;  2QWW A;  1HKT A;  1SD7 A;  4FHT A;  2VE8 A;  5A2Q Z;  4JK1 X;  3T1B A;  2IP2 A;  3GZ5 A;  5BPD A;  2QM3 A;  1R22 A;  4ENN A;  2YSR A;  3FMS A;  1R1U A;  2CO5 A;  2EFW A;  1BI2 A;  4WCG A;  3N97 A;  2HS5 A;  2ZKZ A;  4FX0 A;  2MH2 A;  2XAS A;  3F3X A;  4LFU A;  3HHH A;  4M6Y A;  4S05 A;  1YIO A;  2K4J A;  3E97 A;  1GXQ A;  3T5X A;  4B8X A;  1O7F A;  1TLH B;  3RKX A;  1B6A A;  4IHS A;  1WKM A;  2HKO A;  3C3W A;  1R7J A;  4N9I A;  2FBH A;  3E6M A;  2P6S A;  4M74 A;  4AIK A;  1K7A A;  5FB2 A;  3FZV A;  1IN8 A;  4PGG A;  4EM0 B;  2WTE A;  3K1N A;  1ZYR F;  3WGH A;  5K5O A;  1MZB A;  1Z1D A;  3HSR A;  3DKW A;  4IRH A;  1RZ4 A;  3K69 A;  1ZG5 A;  2D2W A;  3M8E A;  2QYO A;  3FF5 A;  3ZMZ A;  4WX9 A;  3MCZ A;  3F8F A;  1FX7 A;  5D5U B;  1L3L A;  2DQR A;  3KP5 A;  2F2E A;  1CF7 A;  3LQR A;  4AIH A;  2XAG A;  1AWC A;  3LA2 A;  4I7H A;  4JBA A;  2YPR A;  4CO8 A;  2RNJ A;  2YR2 A;  1I27 A;  1KU9 A;  1B9N A;  2BBY A;  4N9H A;  1W7P D;  2LF8 A;  3JTG A;  5AIQ A;  2STW A;  3K1P A;  2IPQ X;  3AAF A;  3VOD A;  2PI0 A;  3FMR A;  2XV4 S;  3FXQ A;  2KJB A;  2YX4 A;  1S7O A;  4H0E A;  2A6E F;  3CUQ C;  1UHM A;  2D45 A;  3B73 A;  2Q0O A;  2PN6 A;  1ZRE A;  2EFO A;  3I54 A;  2OA4 A;  4WXD A;  1J2X A;  4RB1 A;  3LST A;  4WXC A;  1BI0 A;  1F9N A;  3G3Z A;  3GUD A;  5D5W B;  1XCB A;  2DO7 A;  3O3K A;  1K78 B;  2IA0 A;  4CDG A;  3NQO A;  1KQ8 A;  4ESJ A;  1JHH A;  2MH9 A;  1R5G A;  5BPI A;  4UV9 A;  3F21 A;  2VXZ A;  3VB2 A;  1HKQ A;  3FXR A;  1PP7 U;  3BOQ A;  2D1V A;  1YW7 A;  1WSU A;  4OMY A;  3ISP A;  2IA2 A;  3K9T A;  3O2P E;  2CFX A;  2OD5 A;  1RUO A;  4A6E A;  4Z2Y A;  3GEZ A;  5BMZ A;  2RN7 A;  4L18 B;  4ZYE A;  4LB5 A;  2FA5 A;  3Q5F A;  2EWN A;  1W7P B;  1A04 A;  3BWG A;  4LLL A;  1BC7 C;  2FU4 A;  2RVC A;  2GAU A;  5JFR A;  2CYY A;  3K1M A;  2XVC A;  3SZT A;  3DPL C;  4G94 A;  3WGI A;  1ZRC A;  5DUI A;  4EVI A;  1Y0U A;  4TV7 A;  1QZZ A;  2NNN A;  1HW5 A;  2LDU A;  2HFH A;  4RB0 A;  2OQG A;  1U8R A;  2ZCW A;  1G3S A;  1B1B A;  4M73 A;  3QP5 A;  1QO0 D;  5CVR A;  2ISZ A;  3R4K A;  3F6O A;  1G3T A;  1O3Q A;  4HF2 A;  2YX7 A;  1OKR A;  1H9T A;  4HLY A;  4ENM A;  4GYI A;  1Z05 A;  1WWX A;  5FO5 A;  2EV5 A;  3BDD A;  3I53 A;  3F22 A;  4P9F A;  1IZ1 A;  5LHI A;  5DDG A;  4HW0 A;  3M7G A;  4N0B A;  5IT9 K;  1XGM A;  5CLS A;  3FXU A;  1DPR A;  1ZGJ A;  2G7H A;  2A68 F;  1IN5 A;  1YTY A;  4KIB A;  2XAF A;  4IJA A;  1B9M A;  2E7W A;  5L3G A;  3TOA A;  2P6T A;  5IT3 A;  1WRJ A;  2H09 A;  4A5N A;  4EJV A;  3PFI A;  1MD0 A;  2Z3Y A;  1QQI A;  1QPM A;  1E2X A;  3H3Z A;  1D3Y A;  3RIR A;  3KET A;  1XD7 A;  5DEQ A;  1XSX A;  2A5Y B;  1HKS A;  4HX7 A;  3LWF A;  3DV8 A;  1OYI A;  1FOK A;  5E1Z B;  2L01 A;  3WU1 B;  1T0F A;  1XGS A;  4OU0 A;  5E8I A;  1EH8 A;  3BJ6 A;  5DUK A;  3SZP A;  3ZMS A;  1BOA A;  3I59 A;  5LRS A;  4UVA A;  3LAJ A;  3U9G A;  3DXJ F;  2FBK A;  2CGP A;  4KIG A;  5J8C A;  4L9V A;  5L3D A;  4ZYH A;  2O6G E;  3ZMT A;  4RAZ A;  1SD5 A;  4RAY A;  3WTT C;  4YFK F;  1R1T A;  2LKP A;  2OBP A;  3CUQ B;  4HV6 A;  3C7J A;  1P6R A;  5KVR A;  2OAZ A;  3FM5 A;  1LVA A;  2FE3 A;  1TNS A;  3EDP A;  1I6X A;  3JSP A;  1XMA A;  3KLN A;  4KT5 C;  3J81 K;  4KUM A;  4WF2 A;  4WXH A;  3BJA A;  4P9U A;  1ZRF A;  4OMZ A;  4LG0 A;  1MDM B;  3CJN A;  3PQJ A;  2GZW A;  2JSC A;  1KGS A;  1ZGA A;  1MJ9 A;  5D5X B;  2GA2 A;  5H6Q A;  1GXP A;  4RGU A;  2VBW A;  4A5M A;  1BBY A;  3IL2 A;  3QPH A;  4KYW A;  5F6F A;  4GO1 A;  4AWX B;  2O03 A;  1LEB A;  1UST A;  2O0Y A;  4EJW A;  4F7Z A;  5DCM B;  3OOP A;  3HRU A;  2KJC A;  1KQ9 A;  5D6E A;  2HQN A;  4OIO F;  2B0L A;  1IN4 A;  1ON1 A;  5D8K B;  3GFM A;  1FBQ A;  1FLI A;  2RV8 A;  3CO7 C;  3C1D A;  3V4G A;  2V79 A;  4HQE A;  3VFZ A;  3E6B A;  2M30 A;  2UXX A;  4L9J A;  2F5D A;  3RPQ A;  4PCQ A;  2QQA A;  1OYW A;  2XGX A;  4EM1 A;  4O5V A;  3L7W A;  2FEZ A;  3GVA A;  4IPA A;  3E3V A;  2IRF G;  4MHG A;  1U5T A;  4HAM A;  2WV0 A;  3SFZ A;  3HRT A;  1H0M A;  2KRF A;  2EFN A;  3I58 A;  2A61 A;  3P9I A;  3ECH A;  2TDX A;  2A69 F;  3ECO A;  3N4M A;  5ICE A;  2Z9O A;  1HQC A;  3MZH A;  3PQK A;  4OOI A;  2DPU A;  1SAX A;  5IT9 Z;  1HSJ A;  3ULQ B;  4LK1 F;  2JTV A;  4KN4 X;  3M8F A;  1F4K A;  5HS8 A;  3ZP5 A;  1ZAR A;  1TQI A;  4HLX A;  5LHH A;  1G3W A;  4RS8 A;  1JE8 A;  4I2O A;  3JAM K;  3IWF A;  3F8N A;  1U6G A;  2V9V A;  4BXU A;  4M72 A;  3EYY A;  3KP6 A;  4L0Z B;  2WWY A;  1IAW A;  1J5Y A;  1FYM A;  4CXF A;  2O61 A;  1G3Y A;  5D4R A;  1LDD A;  2EFQ A;  4BYY A;  4LLN A;  2P5L C;  1HW2 A;  4KMU X;  3MWM A;  1S8N A;  4QLC U;  3DF8 A;  2QEN A;  2QLZ A;  1R5H A;  2HZT A;  1PDN C;  1KYZ A;  3WE2 A;  1XMK A;  5J8F A;  2HEO A;  3DEU A;  5K5Q A;  1KU3 A;  2VOO A;  5ICF A;  1J75 A;  1LDJ A;  2M87 A;  3BPV A;  1TTY A;  2MD5 A;  4I02 A;  2XKP A;  1D8J A;  4R1H A;  5LEK A;  4WK8 F;  2A6H F;  3GLX A;  3J81 Z;  3I4P A;  3BY6 A;  5DD4 A;  1ZN2 A;  1DP7 P;  1ZRD A;  3QU6 A;  4BQA A;  1OMI A;  3MFK A;  3EYI A;  2LNB A;  1J0R A;  2K7L A;  1IRF A;  4GGG A;  1FYL A;  1YO5 C;  4U0V A;  2ZNZ A;  2DT5 A;  2H6B A;  4O6J A;  2VBY A;  5E20 A;  2EA2 A;  1D8K A;  2KIM A;  2W25 A;  4IVN A;  4QWQ A;  1LB2 A;  3WTZ A;  3V7S A;  1L0O C;  1U78 A;  1KA8 A;  4P96 A;  4KN7 X;  2PG4 A;  3I0T A;  1I1S A;  3E6D A;  3GFJ A;  1J9I A;  2GA1 A;  2ZXJ A;  3GW2 A;  1STZ A;  3DQV C;  5LEJ A;  1FT9 A;  2XUB A;  1SMT A;  2VOD A;  2HQR A;  3V7R A;  1QBJ A;  1RI7 A;  2HKX A;  3FMQ A;  3HTU A;  1YS7 A;  4EQQ A;  4BHC A;  5DV5 A;  1S3J A;  2XAJ A;  4ZYG A;  4BAY A;  2Q8K A;  3CLO A;  1Z6R A;  1ZHF A;  2P7C B;  4HOB A;  1SD6 A;  4YFX F;  3SXY A;  3KLO A;  4HDU A;  4L5J A;  3TO9 A;  2RDP A;  2QBY A;  1RIO H;  2HWV A;  2EFP A;  4RGS A;  2L3D A;  2DU9 A;  4ENK A;  3IRR A;  4KMF A;  1RUN A;  1E17 A;  2XRN A;  1REP C;  4ZZD A;  1PUE E;  4ASN A;  3RPU A;  4L0Y B;  4B09 A;  1T39 A;  1ZLK A;  3BJO A;  1WQ2 A;  4ESF A;  5E18 F;  4HX4 A;  3P9C A;  1O7L A;  2E1N A;  4ZYD A;  4KDP A;  3IRQ A;  1Q1H A;  5TJJ A;  5DCF A;  4GYG A;  4MNU A;  3RKW A;  1BIB A;  1U3E M;  6PAX A;  2QVO A;  5LGU A;  4HBL A;  2RQP A;  3DPT A;  2K27 A;  3ABU A;  4I0A A;  3MZY A;  2JZY A;  4A0Y A;  2Z5U A;  2FF4 A;  2XAH A;  2FRH A;  4LD5 A;  4Q4Z F;  2ISY A;  1P4A A;  3TO7 A;  4M6X A;  2DTR A;  4MTE A;  1P92 A;  2Z33 A;  1MKM A;  2Y48 A;  1P2F A;  1ZH5 A;  2HGC A;  1ULY A;  2WC2 A;  2VE9 A;  3HIF A;  1W5S A;  3KP3 A;  1MDM A;  4FT8 A;  5D5V B;  3BPX A;  1FSE A;  3KCC A;  2ZO4 A;  4CIC A;  1LJ9 A;  3HOS A;  4RB2 C;  2AS5 F;  3COA C;  3U1D A;  2HYG D;  3TQN A;  2EA4 A;  3T8T A;  1IRG A;  5JI6 A;  4NB5 A;  2RGV A;  2LF7 A;  5KK1 A;  4EJO A;  4KIF A;  2M8E A;  4MTD A;  2FOK A;  3Q9S A;  1XCV A;  2H6C A;  2HTJ A;  1BJA A;  4U0Y A;  3IC7 A;  3WTY C;  4UUV A;  5ILV A; 
#chains in the Genus database with same CATH topology
 3S15 J;  4KJZ A;  3CCS I;  3WU0 A;  2JUC A;  4RLF A;  5DCM A;  3ZQC A;  5FKM A;  1HST A;  2E60 A;  5EEH A;  3C2B A;  4RGX A;  4Y17 A;  3TDZ C;  5IP7 J;  3S17 J;  2Q2E B;  1R00 A;  1QPI A;  4A3G J;  3L00 A;  2JVG A;  2OQR A;  3V8L A;  2EB7 A;  2BXZ A;  4UXN A;  3RTR A;  2DYR H;  1JKP C;  2EV0 A;  2V1X A;  1I1G A;  4MEY F;  2JSP A;  1AHD P;  1EV7 A;  4DOZ A;  5M5X J;  5JHU A;  4IQJ A;  1DU0 A;  3F72 A;  5LRR A;  2XRO A;  2OU2 A;  1UCR A;  2Y9Z A;  4CZC A;  5H20 A;  2R7R A;  3V7C A;  4CSW A;  1S72 I;  4EV0 A;  4Y13 A;  2IVM A;  2KIQ A;  4BE0 A;  3NWT A;  5CQE A;  3P7N A;  3HM5 A;  1ZR2 A;  1TWC J;  1XN7 A;  2W84 A;  3QAH A;  2JMW A;  1QHG A;  3O6B B;  4I98 B;  1MH4 A;  3ZQF A;  1UHS A;  2CSO A;  1SAU A;  3BZK A;  4J01 A;  1G4D A;  3Q3S A;  1ODD A;  3L09 A;  2WAQ A;  3K0L A;  3LA3 A;  5ILU A;  1C0W A;  3CDI A;  3WG9 A;  3AG4 H;  3SQN A;  5LHG A;  4M3G A;  3G71 I;  3BR6 A;  4BAC A;  4UNO A;  2M1B A;  4UY8 I;  1JKR C;  5FFX A;  2BV6 A;  4XMY A;  2PJR A;  4IEJ A;  3ASN H;  3IKT A;  2UXN A;  1DPU A;  5A2Q K;  3G73 A;  4BXF A;  1R6R A;  1TQP A;  3PUF A;  4U88 A;  3HSE A;  4DBR A;  3VYS B;  3FXK A;  2BYV E;  4G7Z F;  5E17 F;  1JGS A;  3U2R A;  1QHH D;  4QSH A;  3Q9V A;  3A2K A;  2ELJ A;  2KPM A;  2FSW A;  1YE9 A;  1T33 A;  3JTH A;  3D5L A;  1HW1 A;  5HNH A;  3ZOB A;  4B43 A;  5J6X A;  2R5Z A;  2M5W A;  5BQT A;  3F23 A;  2L02 A;  3E7L A;  5M5W J;  1MMN A;  3LSJ A;  3HOU J;  2DFF A;  3RQI A;  4BQN A;  3GTQ J;  1E3P A;  2E1C A;  3NAR A;  4FET A;  2RC4 A;  1R23 A;  5D8L B;  3FM3 A;  3RI4 A;  2JRT A;  4BJ6 C;  1AA7 A;  4F3Q A;  2P7V B;  3K2Z A;  1ORK A;  1RRJ A;  3ABT A;  2M7A A;  3JRA A;  1SVL A;  3NRV A;  2CV2 A;  3HOW J;  1YW8 A;  3BR0 A;  4DBQ A;  2X6X A;  1X58 A;  2HXO A;  1TNT A;  1A6Q A;  5CPR B;  1SMY F;  1JI8 A;  1FBS A;  5F0C A;  1XDU A;  1E3O C;  3GTJ J;  1GT0 C;  4MFD A;  1I3Q J;  2JPC A;  3NEU A;  2NAZ A;  1JUM A;  2KIS A;  2YU3 A;  3A0H C;  3DLL F;  4EGZ A;  3FHZ A;  2ZJQ F;  3WHB A;  2HDD A;  1K4S A;  4PFP A;  4EGY A;  1HDP A;  1RC9 A;  3FXL A;  1MBE A;  5GTI C;  3WTX C;  2DN0 A;  2X6W A;  1P7J A;  2DK8 A;  1JTX A;  3FXO A;  1ETV A;  4HQM A;  3PNY A;  3CMA I;  5HVQ C;  1VQL I;  5BNG A;  2FBI A;  5CYV A;  4CCJ A;  4HNT A;  3E5X A;  3OS2 A;  2IGM A;  1W0T A;  2ESH A;  3HPG A;  4GCV A;  5F64 A;  3HDD A;  1BIA A;  1IXC A;  3MEX A;  2ELK A;  1B8I A;  4KIC A;  2CU7 A;  3IKV A;  1BI1 A;  4M3F A;  2CUF A;  3SYT A;  2E19 A;  2PMU A;  1U5T C;  3KZZ A;  1XS9 A;  3GO5 A;  1YFH A;  2KFD A;  4AM3 A;  4BBS J;  4HF1 A;  2K40 A;  1QA6 A;  3W2A A;  2R4G A;  2PBI A;  5CVJ A;  2BXY A;  4BUP A;  3RKQ A;  1X3U A;  4BBR J;  1IG7 A;  2ESN A;  1S6L A;  4DNC A;  1SD4 A;  3F8B A;  4UB8 C;  1AKH A;  2HOS A;  2OZU A;  1BC8 C;  5E1W A;  2F48 A;  4IL6 C;  3I5U A;  3RKY A;  3S1N J;  1P4X A;  1RKW A;  2XPU A;  2F5E A;  3V8K A;  1UFM A;  4D7N A;  2Y2Z A;  2R7U A;  3KIO A;  1VQ7 I;  3DCF A;  5D6F A;  3GTL J;  3AFH A;  3MVP A;  2XRL A;  4XKB A;  2ZSH B;  1ON2 A;  4FX4 A;  2JA6 J;  2FNP A;  4XLH A;  3LAP A;  1Z7U A;  1MJB A;  2WV1 A;  2W82 A;  3LSK A;  5IY5 H;  2G9W A;  3LSP A;  2VC0 A;  2EIK H;  2DCE A;  3CF2 A;  2ADU A;  2OTJ I;  1LQ1 A;  2GXA A;  5E3L A;  3L2W A;  2HNH A;  4S04 A;  3BG9 A;  3HKZ N;  3LFU A;  2E1M C;  4DQ2 A;  5FFZ A;  2OV7 A;  3OYL A;  3KFW X;  1BN5 A;  3CMY A;  3RSN A;  2CWE A;  2JRM A;  1FIP A;  3CJR B;  1HA8 A;  1GV2 A;  2GBY A;  1XSV A;  3QP6 A;  3GFL A;  4XM3 A;  2DOF A;  3KP7 A;  3CC4 I;  5DTD A;  1MIJ A;  3CF5 F;  3HOV J;  3W6K B;  1G8X A;  1KU7 A;  1OLT A;  1LDK B;  1N75 A;  4IHV A;  1Z7L A;  4MEX F;  5HOO A;  5ILS A;  5LD2 C;  4MIM A;  1TWG J;  1TQM A;  3CDH A;  1QZE A;  4LIU A;  2L54 A;  1OCT C;  3C18 A;  2A3S A;  2P5V A;  2P8T A;  5EEG A;  4UUS B;  2L7F P;  3TP3 A;  2IGK A;  5GPC A;  1B59 A;  1WJA A;  3LFK A;  2LK2 A;  3CCY A;  4EJU A;  3RDI A;  2MSY A;  4UVC A;  4MQ9 F;  3CCR I;  4AD9 A;  1MGT A;  5F08 A;  4LK0 F;  4BY1 J;  2VC1 A;  4E7L A;  1ZR4 A;  1JTY A;  5GAG J;  2BHY A;  2OJE D;  2CV0 A;  3CTA A;  3OIP A;  4LMY A;  1SFX A;  4ZC3 A;  2VL8 A;  2BW3 B;  3KE2 A;  3LMM A;  2K3F A;  1R36 A;  1JHF A;  2KIU A;  1GVJ A;  4R79 A;  5GAH J;  1LE8 A;  2X9D A;  2EZL A;  1VQ5 I;  1IUY A;  4BQO A;  2GWR A;  4P55 A;  5JVT A;  4HV5 A;  1ETY A;  1Z6T A;  2ZB9 A;  2FNA A;  4Q47 A;  4LG0 B;  3HUG A;  3OYJ A;  4I01 A;  2ECC A;  1FEX A;  2CW8 A;  4MQV A;  3W6J B;  3QPL A;  3IUO A;  4Y15 A;  4KA4 A;  2P4W A;  5GTH C;  1WH7 A;  5B5E C;  2DBB A;  2F4M B;  3EUA A;  2NVX J;  3F9K A;  3QOD A;  2EV6 A;  2RKH A;  3J80 K;  4IXA A;  3VYR B;  1X1D A;  3FWE A;  1JT6 A;  4IHT A;  2W00 A;  2E2H J;  1XSD A;  1OJL A;  1T2K A;  5HLH A;  2HYF A;  3QYE A;  2M4G A;  4CGZ A;  4ZJZ A;  1J7K A;  4GXO A;  3H0D A;  2DK5 A;  1Y1V J;  3A01 A;  1FTT A;  5LGT A;  5EYR A;  1K78 A;  2CQK A;  1R58 A;  2ID6 A;  1YRN A;  4GDF A;  1IN7 A;  4RMN A;  4UVB A;  2VT3 A;  4XLN F;  3RQ4 A;  2HI3 A;  4RGR A;  2DT7 B;  5LBQ A;  3OYH A;  3FKI J;  4RB3 C;  1QVT A;  1Q1V A;  5C3E J;  1YOV B;  2ZME B;  2D5V A;  4G7H F;  2F5F A;  4YII A;  1A36 A;  4XSX F;  4C2T A;  2QSF X;  1IO2 A;  4HA8 A;  3KEQ A;  1Z67 A;  2PJP A;  3CCQ I;  2KL4 A;  5J4V A;  4M3D A;  2W48 A;  4D1Q A;  2BEO A;  2K4B A;  2UZK A;  2VIX A;  3FBN B;  4V19 K;  4X6A J;  4E7K A;  3W2W A;  4A0Z A;  3ZMU A;  4G12 A;  3OV8 A;  4JX6 A;  5CVI A;  2V1D A;  2TCT A;  2X4H A;  2Z99 A;  3BLY A;  4RBO A;  1JUP A;  3OYN A;  2FQ3 A;  3KX2 A;  3SDB A;  1EF4 A;  4S0H B;  4U7D A;  2HTS A;  3LSH A;  1W7P A;  4XN0 A;  3MZ8 A;  2CMP A;  2L7M P;  5LGN A;  2KZV A;  3HZJ A;  3MAJ A;  3VEP A;  2PLY A;  2C6Y A;  2LBF A;  2BZT A;  4HX8 A;  3ZMD A;  1X1B A;  3D0S A;  4ESB A;  3E5Q A;  3WTS C;  3REO A;  3SHF A;  4EMS A;  3QOP A;  1EH6 A;  1ONV A;  3Q0U A;  4PJL A;  3K4N A;  2IW5 A;  4YEJ A;  1NK2 P;  2LLK A;  2UUZ A;  4G6D A;  1FZP B;  2W57 A;  3KZI C;  4RA2 A;  2GXG A;  5CVU A;  4AU7 A;  4CYD A;  2EZK A;  2QUF A;  3CCM I;  2WY8 Q;  3K4L A;  3ZQL A;  1U5T B;  1XTA A;  3I3L A;  5LLQ A;  1U9N A;  3JRE A;  3ZN1 A;  3BRO A;  4OWR B;  1R1V A;  5ICC A;  3CO6 C;  5AON A;  1TWF J;  3IWZ A;  5FGM A;  3M3Y J;  1AOY A;  3P5J A;  4KFC A;  2ZJ2 A;  5B1A H;  2XF5 A;  3KYC B;  2PX9 A;  3OR2 C;  4XLP F;  3R0J A;  1HXD A;  3CP2 A;  5CJ9 A;  2NRA C;  2Y75 A;  3LA7 A;  2HPM A;  1YYV A;  3HGG A;  4IF4 A;  2MD0 A;  3DFG A;  2YU9 J;  5ERI A;  3ZGK A;  2DTZ A;  3DP7 A;  1W5C C;  5AIP A;  3H5N A;  2BGC A;  2X6Y A;  4NNJ A;  4C2U A;  2M0C A;  2UWM A;  4OAZ A;  2DDB A;  1BI3 A;  1VTN C;  3PO2 J;  2AXL A;  4IRG A;  1XGN A;  5FRM A;  2JJ7 A;  2E2J J;  1O3T A;  3RYP A;  3HG9 A;  2ICW G;  2ZFW A;  4CUG A;  2DA6 A;  1ZG3 A;  2E34 A;  4E70 A;  3FX3 A;  4MGR A;  2OUM A;  2EJR A;  2NNY A;  4D0P A;  4HYE A;  4LGW A;  4U0W A;  1BJZ A;  2PEX A;  4ZH4 F;  3L2Q A;  4O3M A;  2VPL A;  1RNL A;  3KP2 A;  4PSW A;  1VQ6 I;  3WTV C;  2E1M B;  2EK5 A;  2O8X A;  2A07 F;  4YG2 F;  2DFI A;  1BOB A;  2VQC A;  2MLG A;  1V4R A;  2DAO A;  4G7O F;  1XGO A;  1ZG1 A;  2OF7 A;  1ZLJ A;  2MA3 A;  1TP4 A;  4PK4 A;  5HDK A;  3A4C A;  3Q0W A;  1D1C A;  2L7Z A;  2O3F A;  2Q2E A;  4BL0 B;  5EEA A;  4P5O A;  3JRB A;  2EH3 A;  4K2E A;  1BA5 A;  3W3C A;  1QGP A;  1FNN A;  3C2G A;  4CCL A;  5HDN A;  4CHU A;  4IZZ A;  2K02 A;  3G4S I;  1HC8 A;  5GAD J;  2KZG A;  3OSG A;  3PM1 A;  2JT1 A;  1BR4 A;  2EZH A;  2JUG A;  3KP4 A;  3DTE A;  2V1U A;  1IXS B;  3M07 A;  5E1X A;  1NH3 A;  2STT A;  1QNT A;  2HQA A;  4U87 A;  3GX4 X;  5TRD A;  2LFB A;  2VJ5 A;  4LJZ F;  1FP2 A;  4ENJ A;  3PNV A;  4OAY A;  3K2A A;  2HXI A;  3EUK L;  4R8H A;  3GZ6 A;  2D1H A;  3CQZ J;  2JPB A;  4BH9 A;  3HB9 A;  4LB6 B;  2XAQ A;  3MN2 A;  1IW7 F;  3HYI A;  2KP6 A;  4BEH A;  3OYC A;  2IJL A;  5D4S A;  2WB1 N;  4M9Z A;  4M3B A;  2MBF A;  4NC8 A;  4BHB A;  2JA8 J;  1I50 J;  2BY3 A;  2ZJP F;  5M3F J;  1FSH A;  2B7E A;  3JCU C;  3F6V A;  1B4A A;  4U7B A;  2QKM B;  5K1Y A;  1U2W A;  1T56 A;  3EUH A;  3ZQG A;  3OYD A;  3JR9 A;  3PSI A;  4AVP A;  3H36 A;  2K9N A;  1G6N A;  3RYR A;  4ZDL A;  3OYF A;  2DA5 A;  2J5O A;  1FY7 A;  3HTS B;  5M3M J;  1R9T J;  1Y6I A;  3A1Y A;  1B72 A;  5JR3 A;  2X48 A;  4XNF A;  3CUQ A;  1TBX A;  2PQ8 A;  3F8C A;  2W7N A;  2VON A;  3RJP A;  4UV8 A;  4DGW B;  1FC3 A;  4AIJ A;  3X2Q H;  1OQY A;  3R6S A;  1K6O A;  3R61 A;  1KQ0 A;  1FP1 D;  2ZBK A;  3JAM Z;  5L3C A;  3HOT A;  2Y0M A;  3HHG A;  5DM7 F;  2RQQ A;  2O5R A;  1MMA A;  2MYS A;  2XIG A;  1PJR A;  2GXB A;  3MMY B;  1USS A;  1WJD A;  3S3M A;  5HLG A;  4WWC A;  3I64 A;  4OIN F;  3OSF A;  1YQA A;  2CUE A;  3LQQ A;  3KYD B;  2LY2 A;  3VDX A;  2DA3 A;  4OIP F;  1Z91 A;  1LNW A;  2Y30 A;  2IT0 A;  2B63 J;  1SVO A;  3S1R J;  1LFP A;  4HZF A;  2MC3 A;  3OL4 A;  5L3B A;  3CCE I;  4XK4 A;  4I76 A;  1WJE A;  3ZMV A;  5IP9 J;  5FLX K;  3N05 A;  4Q5S F;  5FD5 A;  4E7J A;  2LRD A;  1RES A;  3DU5 A;  2GQQ A;  2WY7 Q;  4A3K J;  2NOJ B;  3QU3 A;  1ETQ A;  2GOM A;  4EM2 A;  3J80 Z;  5DYM A;  3E6C C;  2J5P A;  4YIF A;  4I6Z A;  2CG4 A;  1KU2 A;  1P4W A;  1UHW A;  3ZXS A;  3GTK J;  2ACJ A;  2WAQ N;  3GYH X;  3RPU D;  2HDC A;  1O3R A;  5HS7 A;  1ETX A;  4ON0 A;  3TOB A;  1V5E A;  1CGP A;  3QPT A;  4YIR X;  1IUF A;  1WI9 A;  3L2R A;  3MKL A;  1MJA A;  1CF7 B;  1YS6 A;  2DOD A;  5L3E A;  4XID A;  2DDA A;  3M1C A;  1T0F C;  1W1W E;  1FBU A;  1SFU A;  3ML6 A;  1YG2 A;  4XRM A;  4I0B A;  1K6Y A;  1YLF A;  1WFX A;  2HZD A;  4FQG A;  2VKV A;  2X6O A;  2EQR A;  2QSG X;  2CRG A;  4CZZ A;  3TO6 A;  2DPD A;  1Z0X A;  3EQL F;  1YIJ I;  5J40 A;  2R7F A;  3ZN0 A;  1N25 A;  3ZQ7 A;  1XX5 A;  5HLT A;  4Y52 J;  4FCY A;  3K10 A;  3E5U A;  1GV5 A;  1R49 A;  1T38 A;  3GF2 A;  2BVM A;  1ERD A;  2KKO A;  4A3J J;  5JVG F;  1IF1 A;  2XGE A;  1M1E B;  1FOX A;  1X4O A;  1I3A A;  1BL0 A;  3BR2 A;  1I5Z A;  3HSF A;  3HXL A;  1POG A;  3G6E I;  2MAB A;  2V6C A;  4G8X A;  1V3F A;  2W24 A;  1J59 A;  4AID A;  1VQ9 I;  3OYG A;  4ETS A;  1JT0 A;  3H92 A;  4L5I A;  5BOX A;  1TW2 A;  1WJ5 A;  5JLX A;  1JXS A;  3BP8 A;  2VBX A;  1CQT A;  2NVY J;  2W1O A;  2F5C A;  1MNE A;  4CH7 A;  2DMT A;  2L7K A;  3D5R C;  4E7S A;  2XPV A;  4QPO A;  4IQ4 A;  1ETO A;  1O3S A;  1KON A;  4A3D J;  3L2V A;  3T0Y A;  3WGG A;  4Y33 A;  2OCE A;  3JW4 A;  5J1U A;  4RLQ A;  2QBY B;  2CW7 A;  2M2E A;  4JQF A;  4NC6 A;  4NBQ A;  1BR2 A;  4W97 A;  2VXD A;  3TL4 X;  3ROU A;  4B47 A;  1HBX G;  1F36 A;  1ENH A;  4B1R A;  1Y1W J;  4A3M J;  4HSR A;  1ACI A;  3WE3 A;  2VT2 A;  2E5Z A;  3IAS 2;  2H94 A;  2CW0 F;  1OFC X;  2VN2 A;  2FXA A;  2DW4 A;  3VYT B;  4CA0 A;  3WTU C;  4A12 A;  3DTK A;  4XKW A;  1KYW A;  1VF9 A;  4BE1 A;  3H3U A;  3V42 A;  2X0L A;  3FIS A;  4UB6 C;  2LTP A;  1DGR M;  4HDV A;  2H8R A;  2DMQ A;  2DMP A;  4AC0 A;  4BHP A;  3PO3 J;  5HDG A;  1S29 A;  2TRT A;  5H6R A;  4YRV A;  1F1Z A;  2JWT A;  2OCC H;  1K79 A;  3FBI B;  3I55 I;  1NG7 A;  3ZCO A;  3OMY A;  2HOE A;  3BG6 A;  3MQ0 A;  5IOY A;  3S2W A;  3J7A O;  4ZZL A;  2FML A;  1P9Q C;  2FMY A;  4UUS A;  4DZJ A;  2R3S A;  1UB9 A;  2DOE A;  1MW7 A;  3QOE A;  3CC2 I;  5EZG A;  1W5T A;  1TW3 A;  1Z9C A;  2W85 A;  3GME A;  5IYC J;  4M71 A;  4PZJ A;  3L2C A;  2PFB A;  5EG0 A;  1SFO J;  2IS6 A;  2E7X A;  1S7A A;  2XKO A;  3MD2 A;  1DUX C;  1O57 A;  2XSD C;  1IXR C;  4BDZ A;  2L9V A;  2EIL H;  2P0W A;  2R7O A;  3I71 A;  3DEW A;  2KMU A;  2XHK A;  2O7O A;  2IA1 A;  2XDV A;  4XKV A;  5HS9 A;  3S1M J;  3EET A;  1VQ8 I;  5B3S H;  1LEA A;  3W2V A;  1ZAO A;  2V4J C;  3SEQ A;  4UHT A;  4FTH A;  4I09 A;  1OPC A;  1W4M A;  2K86 A;  3RZO J;  4G6Q A;  4Q48 A;  3HGY A;  1T6S A;  3BR5 A;  3QRF F;  1EH7 A;  2WAE A;  3G1L A;  4OIQ F;  2VOP A;  1YW9 A;  5FKO A;  2R7V A;  1XDS A;  4OIR F;  3R60 A;  4XLC A;  3GWZ A;  5F27 A;  1XC5 A;  4XRF A;  2JN6 A;  3TKY A;  2VLA A;  3HRS A;  4HF0 A;  3OR1 C;  1BM9 A;  1K61 A;  4LLG F;  3BZ6 A;  4L9N A;  5F1R A;  3J7Z I;  4FIS A;  2W4S A;  2R7D A;  2EBI A;  3PFY A;  3ZPL A;  3GFI A;  2K9S A;  1Y56 A;  1S5L C;  4I99 C;  1A35 A;  3B02 A;  4XL9 A;  4A6D A;  3M9A A;  1KZH A;  3CUO A;  3HRM A;  4PUS A;  3WOD F;  4M9X A;  4XKC A;  1FPQ A;  4A2U A;  1WVR A;  4ZTF A;  2PMH A;  1YJW I;  3AL0 C;  4ZDO A;  1Z21 A;  3HL2 A;  2K3P A;  1PYV A;  4YFN F;  1VQP I;  2HOT A;  2QGU A;  1T98 A;  2NYX A;  3FHN A;  3LSR A;  3L9F A;  2VBZ A;  4C2M J;  1MMS A;  5ICG A;  3ERE D;  1VQO I;  4XOP A;  2LSO A;  1IN6 A;  2ZME A;  4LIV A;  4B44 A;  3QWL A;  3JSO A;  2BE5 F;  3KEO A;  4BNC A;  2YS9 A;  4DYR A;  1FWZ A;  2N8G A;  4X0G A;  5FRN A;  3U1K A;  3K4M A;  2QZ8 A;  2Y69 H;  1K4T A;  1OR7 A;  4XOT A;  3TGN A;  5DD8 A;  2Z1D A;  2WAF A;  3SZG A;  2H1K A;  4A3B J;  1D5V A;  2LMD A;  2NXN B;  1Z3X A;  3J7A Y;  4D9J A;  1GHC A;  2DI3 A;  2ETH A;  2M3A A;  3LL7 A;  4MFE A;  1IV8 A;  5JHF A;  4RAF A;  2NVQ J;  5FLX Z;  1UEL B;  3OYM A;  2FD5 A;  3F8M A;  4QPQ A;  5FLV A;  2DT6 A;  3KYL A;  3OOU A;  2Y9Y A;  2R7Z J;  2FOW A;  2R92 J;  1NHA A;  4KNY A;  5F1J A;  3K4J A;  2V9P A;  2HR3 A;  2QKL B;  1HOM A;  3LSM A;  4IRI A;  2GIV A;  3WTW C;  3I59 B;  2L4M A;  4M6V A;  2DQL A;  3CDL A;  2V9K A;  2KRH A;  4EJT A;  1DQU A;  2COM A;  2ZNY A;  1ZQ3 P;  2IBD A;  1FMV A;  5KHD A;  3ELK A;  2P5K A;  4XOR A;  2DLL A;  4BE2 A;  2X1C A;  3HJE A;  2X85 A;  3SFI A;  1UMQ A;  2NS7 A;  4XBF A;  4PDK A;  5FD6 A;  3T8R A;  1I6H J;  1TC3 C;  3KEY A;  3TDU C;  1OYY A;  3KZY A;  2ZC2 A;  1PP8 F;  1LUJ B;  5L3F A;  1X2M A;  2KIF A;  1X1A A;  2QQ9 A;  1SFE A;  1ZEL A;  2MLK A;  2CH0 A;  5ED4 A;  3ASO H;  5H2F C;  2NS0 A;  4A0X A;  2L4A A;  4NHJ A;  4NC7 A;  4M9S A;  2DXI A;  2G7U A;  3D5S C;  1DDN A;  3K4K A;  1XB4 A;  2DA2 A;  5CVV A;  5E8G A;  5TIS C;  5IPA A;  2I10 A;  1UG0 A;  1FYK A;  2P81 A;  4JX4 A;  2V1N A;  1LFU P;  4C3I J;  5BS6 A;  4A69 C;  1ETW A;  1QZY A;  4DIQ A;  3GXO A;  3V8J A;  2NS8 A;  3VOE A;  1H9G A;  3IHU A;  1GLN A;  4IO9 F;  2ELH A;  4XLE A;  1YI2 I;  1F5T A;  2H27 A;  2AXT C;  3FK7 A;  3MKZ A;  1WJF A;  1LPQ A;  1HDD C;  3R0A A;  4XSZ F;  1IRX A;  4AVZ A;  4L9T A;  4NQW A;  5K5R A;  3S14 J;  3KPH A;  1HF0 A;  3M1E A;  2QQ8 A;  2M45 A;  2OZ6 A;  2NOG A;  2DA7 A;  5HLI A;  4CCO A;  2M7B A;  2ME0 A;  2QQB A;  4F92 B;  4G9Y A;  4PGH A;  3P9K A;  2QWW A;  1HKT A;  1SD7 A;  2E36 A;  1OIS A;  2BY1 A;  1MMD A;  3A03 A;  2X51 A;  4FHT A;  3DWL E;  2VE8 A;  5A2Q Z;  4JK1 X;  4XLA A;  1TT0 A;  3K4C A;  3T1B A;  2IP2 A;  3GZ5 A;  5BPD A;  5EJC A;  2VQL A;  2QM3 A;  3CLQ A;  1JKQ C;  1R22 A;  4ENN A;  2YSR A;  2CV1 A;  3FMS A;  3IH4 A;  1R1U A;  3F0C A;  2CO5 A;  2EFW A;  1BI2 A;  4WCG A;  3N97 A;  2HS5 A;  5J1Y A;  3FIW A;  3SJM A;  2ZSI B;  2ZKZ A;  4JOM A;  4FX0 A;  3IP4 B;  1T08 B;  2EIM H;  2MH2 A;  2XAS A;  4HNU A;  2JVH A;  3F3X A;  4UUT A;  1AKH B;  4LFU A;  2F6C A;  2Q1Z B;  3DKY A;  2EPF A;  3HHH A;  4M6Y A;  4S05 A;  5FRO A;  1YIO A;  1GVD A;  4CYC B;  2K4J A;  2KQR A;  3E97 A;  3GLL A;  4BJ5 C;  1GXQ A;  3T5X A;  4B8X A;  4C9Y A;  2DA4 A;  1O7F A;  1TLH B;  4N4N B;  3RKX A;  1B6A A;  4IHS A;  1WKM A;  2V7F A;  2HKO A;  3C3W A;  1ZGW A;  1R7J A;  3RCO A;  9ANT A;  4N9I A;  2FBH A;  2I8D A;  3E6M A;  1EJ9 A;  2P6S A;  3PIP F;  2DYS H;  2IGO A;  4V2G A;  4M74 A;  4AIK A;  1XPX A;  1K7A A;  5FB2 A;  2HYJ A;  2VJI A;  2XSJ C;  3FZV A;  3DBH B;  1Y8Q B;  1IN8 A;  4B4C A;  3H35 A;  2VJ4 A;  4PGG A;  4EM0 B;  2WTE A;  3S1Q J;  4HG2 A;  1APL C;  3K1N A;  4HRI A;  1ZYR F;  3BTJ A;  1WJB A;  3WGH A;  3EPZ A;  5K5O A;  1MZB A;  1Z1D A;  5C4X J;  3HSR A;  3TBI A;  4KT6 A;  2EIJ H;  5M5Y J;  2QA4 I;  3DKW A;  4IRH A;  1RZ4 A;  2AO9 A;  4E4H A;  2LY9 A;  4B3X A;  3K69 A;  3W6V A;  1SVM A;  1RKT A;  4Y7N J;  1HLV A;  1ZG5 A;  4QTR A;  3H1C A;  1GUU A;  2D2W A;  2HPI A;  3M8E A;  2QYO A;  3FF5 A;  3OS0 A;  3TMO A;  3ZMZ A;  1P7I A;  2OPT A;  3BC8 A;  3PJR A;  1X1C A;  3LSI A;  3MKY B;  4WX9 A;  3OS1 A;  3DLA A;  1D5Y A;  3MCZ A;  2KDZ A;  3F8F A;  2R7W A;  1FX7 A;  4A93 J;  5D5U B;  1L3L A;  2DQR A;  3KP5 A;  2F2E A;  1CF7 A;  3LQR A;  2OC6 A;  2L9R A;  4AIH A;  1NK3 P;  2HOA A;  1EA3 A;  2XAG A;  1NTC A;  1AWC A;  1WZ2 A;  2XC7 A;  3LA2 A;  4D7M A;  1VZ0 A;  3GTM J;  4I7H A;  3BG5 A;  4JBA A;  1LKX A;  2YPR A;  4CO8 A;  2RNJ A;  2YR2 A;  1I27 A;  1UZC A;  5F0F A;  1KU9 A;  1B9N A;  2BBY A;  2PMZ A;  2QCO A;  1W7P D;  4N9H A;  2LF8 A;  1X4P A;  2V26 A;  2E1O A;  3JTG A;  5AIQ A;  2STW A;  4F93 B;  3K1P A;  3EUH C;  1QU3 A;  2IPQ X;  3AAF A;  4DW6 A;  1WGX A;  3VOD A;  4EAT A;  2PI0 A;  2RAE A;  2OTL I;  1V5F A;  3FMR A;  2XV4 S;  3FXQ A;  3BZC A;  5E3O A;  2IAI A;  4IHX A;  1OCC H;  2KJB A;  2YX4 A;  1NG6 A;  4E7H A;  1S7O A;  4H0E A;  2A6E F;  2YUS A;  2HVS A;  3CUQ C;  1UHM A;  2D45 A;  3B73 A;  2CQX A;  2Q0O A;  2PN6 A;  4BJT A;  4XQF A;  3UKG A;  4KIS A;  4H4K C;  4LOC A;  1ZRE A;  2EFO A;  3B6A A;  3I54 A;  1RET A;  2OA4 A;  4WXD A;  1J2X A;  4RB1 A;  3LST A;  4WXC A;  4IHW A;  4A3C J;  1BI0 A;  1PUF B;  1F9N A;  3H0G J;  3G3Z A;  3GUD A;  2R5Y B;  4AYB N;  3BQY A;  5CKT A;  3CCV I;  1R4M B;  2XB0 X;  5D5W B;  2CJJ A;  1F43 A;  1XCB A;  2DO7 A;  3A01 B;  2E2I J;  3O3K A;  1K78 B;  2IA0 A;  3VYU B;  1JJ8 C;  1YRN B;  2A05 A;  4CDG A;  4ITV A;  1WPK A;  1V55 H;  3NQO A;  2E71 A;  1KQ8 A;  4ESJ A;  2O8K A;  1JHH A;  3UR3 C;  1N77 A;  2MH9 A;  1R5G A;  1MBK A;  4BU2 A;  5BPI A;  4UV9 A;  2JA2 A;  3F21 A;  2VXZ A;  3VB2 A;  5IYB J;  1HKQ A;  3FXR A;  4B3A A;  2LYC A;  1PP7 U;  3BOQ A;  1UJ8 A;  2M4K A;  1ZK8 A;  3PNT A;  3PSF A;  2D1V A;  1YW7 A;  4A3L J;  1RPW A;  1OCR H;  1WSU A;  4OMY A;  3ISP A;  2IA2 A;  3K9T A;  4N4O B;  1IGN A;  3O2P E;  1PVE A;  1D1B A;  2UV1 A;  2X1E A;  2CFX A;  2OD5 A;  5B66 C;  2DA1 A;  1RUO A;  1BW5 A;  4C3H J;  3JRH A;  4A6E A;  4Z2Y A;  3GEZ A;  1VQN I;  2L0K A;  2R93 J;  1X19 A;  4RM2 A;  5BMZ A;  2RN7 A;  2IS1 A;  4L18 B;  1O4X A;  1BW6 A;  4ZYE A;  1WH5 A;  4LB5 A;  2FA5 A;  3AG3 H;  4L5E A;  1OCO H;  3Q5F A;  3DBR B;  2EWN A;  4JP0 A;  2CQQ A;  1W7P B;  1A04 A;  3OYB A;  3BWG A;  4XLF A;  4LLL A;  3I4M J;  2MC4 A;  1BC7 C;  2FU4 A;  2RVC A;  2GAU A;  5JFR A;  4CCN A;  5E3N A;  1MNM C;  2CYY A;  2DMN A;  2QF7 A;  2XVC A;  3K1M A;  4YEL A;  4GFB A;  3SZT A;  2EIN H;  3DPL C;  3FXM A;  1TL8 A;  4G94 A;  3H9Q A;  3CMM A;  3WGI A;  1ZRC A;  1S9H A;  2MGQ A;  5DUI A;  4EVI A;  1Y0U A;  3A0B C;  1VFC A;  2VKE A;  4TV7 A;  3I9V 2;  1G2H A;  2M9H A;  2IGN A;  1SAN A;  1QZZ A;  2K85 A;  2NNN A;  3AG1 H;  4AYB A;  4ANJ A;  1HW5 A;  3QPS A;  2KDO A;  2LDU A;  2HFH A;  2WBM A;  4RB0 A;  2R7S A;  2EZI A;  3BG7 A;  2OQG A;  1U8R A;  2ZCW A;  1G3S A;  1B1B A;  2ZXW H;  4M73 A;  3QP5 A;  1QO0 D;  5CVR A;  2ISZ A;  5FKN A;  3QQA A;  3R4K A;  3F6O A;  1G3T A;  1O3Q A;  2IEK A;  4HF2 A;  2YX7 A;  3FK6 A;  1OKR A;  1H9T A;  4HLY A;  4ENM A;  4GYI A;  4E6K G;  1Z05 A;  1WWX A;  5FO5 A;  2EV5 A;  3BDD A;  2L2O A;  3AG2 H;  1TWA J;  3I53 A;  3F22 A;  4P9F A;  1JKO C;  2HQ5 A;  1HCR A;  2O9L A;  3BR1 A;  1IZ1 A;  5LHI A;  5DDG A;  4HW0 A;  3DBL B;  1MBF A;  1FTZ A;  3M7G A;  4FE7 A;  4N0B A;  5IT9 K;  3GZN B;  2Y31 A;  1XGM A;  4F52 A;  5CLS A;  3FXU A;  2BY0 A;  3OWT A;  2JA5 J;  1DPR A;  4F91 B;  1ZGJ A;  2K9M A;  5HOD A;  2BY2 A;  2G7H A;  2XF7 A;  1R5I D;  2A68 F;  3S3O A;  2XAU A;  2JK3 A;  1IN5 A;  1YTY A;  4KIB A;  1D0Y A;  1SC7 A;  2LOO A;  2XAF A;  4IJA A;  4ZTJ A;  1B9M A;  4BDY A;  2E7W A;  5L3G A;  3OYE A;  3TOA A;  2P6T A;  4NUB A;  1WRJ A;  2H09 A;  5IT3 A;  2DFE A;  4A5N A;  3JRD A;  3BR3 A;  4EJV A;  4RAG A;  2AQF A;  3PFI A;  5F04 A;  5FKK A;  1MH3 A;  3HBL A;  1MD0 A;  2Z3Y A;  1QQI A;  2KT0 A;  1QPM A;  2VAS A;  1E2X A;  5KAI C;  1MSF C;  3H3Z A;  1D3Y A;  5DM6 F;  3NWS A;  2MFZ A;  3RIR A;  3KET A;  1XD7 A;  5DEQ A;  1G59 A;  1XSX A;  2A5Y B;  1HKS A;  4HX7 A;  3FXJ A;  4LG3 A;  4LIT A;  3TP0 A;  3RZD J;  4W1U A;  3LWF A;  4XR6 A;  2COB A;  3S3N A;  2ZXI A;  3DV8 A;  1OYI A;  1EKE A;  5E1Z B;  3IH3 A;  2L01 A;  4GRI A;  3WU1 B;  1FOK A;  1T0F A;  1XGS A;  1IRZ A;  1FIA A;  5EGO B;  4OU0 A;  2ZFU A;  4XN3 A;  3DTI A;  5E8I A;  4ABZ A;  1EH8 A;  3BJ6 A;  3G1M A;  5DUK A;  2E35 A;  4BEH B;  4BS9 A;  5F0H A;  1I39 A;  3ERM A;  4E7Z A;  2HVQ A;  2K9Q A;  3SZP A;  3ZMS A;  1BOA A;  3I59 A;  1MBH A;  5LRS A;  4JX5 A;  4UVA A;  3LAJ A;  3U9G A;  1ZTR A;  3DXJ F;  2L9N A;  2FBK A;  1E3H A;  2X1D A;  2CGP A;  1BR1 A;  4KIG A;  5DS9 A;  5J8C A;  5LFA A;  1LVK A;  1IJW C;  4L9V A;  1R71 A;  5L3D A;  4ZYH A;  2IS4 A;  2O6G E;  3ZMT A;  4PFO A;  4RAZ A;  1SD5 A;  4RAY A;  3WTT C;  4YFK F;  1B72 B;  1JUS A;  1YJ9 I;  1R1T A;  1RR8 C;  4IHY A;  2FQ4 A;  2LKP A;  2OBP A;  3CUQ B;  2QSH X;  4F55 A;  2L9S A;  4HV6 A;  1SEU A;  2DOA A;  2M0M A;  1P6R A;  3C7J A;  3CJT B;  2HDW A;  5KVR A;  3L1P A;  2OAZ A;  2LKS A;  3FM5 A;  5GPA A;  3IAM 2;  1T95 A;  4BGD A;  1LVA A;  2FE3 A;  3JRC A;  2BW3 A;  5TGT A;  1TNS A;  3BTI A;  3EDP A;  3GTG J;  1I6X A;  3ZQQ A;  5GAE J;  1X1P A;  2XGD A;  3JSP A;  1XMA A;  1MBJ A;  1VI0 A;  2NVU B;  1X3W B;  3KLN A;  3ZR8 X;  4KT5 C;  3TED A;  5IYD J;  3J81 K;  4KUM A;  4WF2 A;  3UNG C;  4WXH A;  3BJA A;  4P9U A;  2R7X A;  1Z77 A;  1ZKG A;  3U21 A;  2CQ7 A;  2ZME C;  1ZRF A;  4OMZ A;  4LG0 A;  4RM3 A;  1MDM B;  2CUZ A;  3CJN A;  3PQJ A;  2GZW A;  3H3V K;  4Y4R A;  3IV5 A;  2JSC A;  3LNQ A;  3ESW B;  1IC8 A;  3J7Y J;  1KGS A;  1ZGA A;  1MJ9 A;  3C2H A;  5D5X B;  4D5F A;  2R0Q C;  3CD6 I;  1OR7 C;  1YX3 A;  1DGW Y;  2GA2 A;  5H6Q A;  3BG3 A;  1Y0N A;  4DZP A;  5K7H A;  1GXP A;  3IH2 A;  1U9O A;  4IX7 A;  4RGU A;  3CES A;  3LOC A;  2VBW A;  3S32 A;  3K70 C;  4RDU A;  3BTC A;  1BBY A;  2LG4 A;  4A5M A;  3IL2 A;  2HU9 A;  3ABM H;  5K7F A;  1DU6 A;  3O8G A;  3QPH A;  3HOX J;  4II3 A;  5FJ8 J;  4KYW A;  5F6F A;  2DMU A;  3VPR A;  1D0Z A;  1W0U A;  4GO1 A;  4AWX B;  2O03 A;  1LEB A;  1UST A;  2O0Y A;  3K6G A;  2XPW A;  4EJW A;  4F7Z A;  5GP9 A;  5KCM A;  5DCM B;  2LH9 A;  3OOP A;  3HRU A;  4NDL A;  2KJC A;  1KQ9 A;  5D6E A;  1VQ4 I;  2HQN A;  4OIO F;  1OCZ H;  2B0L A;  4HPQ A;  1IN4 A;  1ON1 A;  4PSX A;  2GLO A;  5D8K B;  3GFM A;  4PJJ A;  1FBQ A;  1IDY A;  2IS2 A;  1FLI A;  2RV8 A;  3CO7 C;  1QRY A;  4FE4 A;  3C1D A;  3V4G A;  1FJL A;  3OYK A;  2V79 A;  4CYC A;  4HQE A;  3VFZ A;  3E6B A;  2M30 A;  1MSE C;  2UXX A;  3GBG A;  4L9J A;  2F5D A;  2VB6 A;  3LSG A;  3RPQ A;  4PCQ A;  3E0J B;  2QQA A;  2B9S A;  2VKD A;  1OYW A;  2VPR A;  4BQQ A;  2LP0 A;  4DYC A;  2XGX A;  3BTL A;  4EM1 A;  2CS3 A;  1N78 A;  4O5V A;  1UAA A;  4ZDP A;  3L7W A;  5JLW A;  2CFO A;  5IOZ A;  2FEZ A;  3GVA A;  4IPA A;  1TZL A;  3E3V A;  2IRF G;  1J09 A;  4MHG A;  4CCM A;  5J47 A;  1U5T A;  4HAM A;  2FUG 2;  2WV0 A;  3SFZ A;  3HRT A;  1H0M A;  2KRF A;  3PL8 A;  2EFN A;  3WG7 H;  1TWH J;  3I58 A;  1IDZ A;  2A61 A;  2PJR B;  3P9I A;  4V2F A;  4A3F J;  3FDY A;  1T8I A;  4JYK A;  3ECH A;  2TDX A;  3S16 J;  2CUJ A;  2A69 F;  2KRC A;  3ECO A;  2KHM A;  3N4M A;  5ICE A;  4E7I A;  2Z9O A;  1HQC A;  1R4N B;  3MZH A;  3PQK A;  2AQE A;  2GIZ A;  4OOI A;  2DPU A;  2BOL A;  4AUX A;  1SAX A;  1TT5 B;  5IT9 Z;  1HSJ A;  2R5Z B;  1UG2 A;  2WA0 A;  3ULQ B;  3WU2 C;  5C4J J;  4LK1 F;  2JTV A;  4ZYA A;  4KN4 X;  5C44 J;  3M8F A;  5FKL A;  5EG0 B;  1F4K A;  5HS8 A;  3ZP5 A;  4B48 A;  4C30 A;  2VI6 A;  2WAD A;  5J3L A;  1ZAR A;  3K70 D;  1TQI A;  3HOY J;  2A5W A;  2KLO A;  4HLX A;  4KIT B;  5LHH A;  1G3W A;  4RS8 A;  2VJJ A;  1JE8 A;  4X1E A;  4I2O A;  3JAM K;  2ID3 A;  3CME I;  1S7E A;  2K5C A;  1D0X A;  2QEX I;  4PJM A;  4HEA 2;  1WHU A;  3IWF A;  3F8N A;  1U6G A;  2GOX B;  3HOZ J;  2V9V A;  3O8H A;  4BXU A;  4M72 A;  2E5N A;  3EYY A;  3GTO J;  3KP6 A;  5B1B H;  4L0Z B;  4IKF A;  2WWY A;  1IAW A;  2LRE A;  3HC7 A;  1J5Y A;  1FYM A;  5EF6 A;  2VQH A;  3HKZ A;  4CXF A;  2O61 A;  3HPH A;  1G3Y A;  5D4R A;  1LDD A;  2EFQ A;  1H89 C;  4BYY A;  4LLN A;  2XF6 A;  2P5L C;  1PUF A;  1HW2 A;  1AU7 A;  3CP8 A;  2R5Y A;  3H9G A;  4KMU X;  3JRI A;  3MWM A;  4FAS D;  1B8I B;  1S8N A;  4QLC U;  3DF8 A;  2QEN A;  2QLZ A;  3K7A J;  3QYB A;  1R5H A;  1WJC A;  3VSL A;  3WHC A;  1X3Z B;  2IXS A;  2M34 A;  3PIO F;  2HZT A;  1PDN C;  1KYZ A;  1ETK A;  3WE2 A;  1YHQ I;  1XMK A;  3VWB A;  5J8F A;  3E1S A;  2HEO A;  3DEU A;  5K5Q A;  2FJ1 A;  2VUM J;  1KU3 A;  2VOO A;  2GM4 A;  3B6C A;  2HVR A;  5ICF A;  2LVS A;  1J75 A;  2ZJR F;  1VND A;  2MW8 A;  1E0E A;  3OYA A;  1LDJ A;  3Q0V A;  2M87 A;  3BPV A;  1TTY A;  2PMZ N;  3TW7 A;  4CCK A;  2MD5 A;  4I02 A;  2XKP A;  3M4O J;  2A6T A;  3GTP J;  1D8J A;  4R1H A;  3S2H J;  5LEK A;  3CCL I;  1XG1 A;  3ONQ A;  4IOC F;  3L2U A;  4WK8 F;  2R7Q A;  4G6T B;  2BVL A;  2A6H F;  3GLX A;  3J81 Z;  2AHQ A;  3I4P A;  3BY6 A;  3I56 I;  5DD4 A;  1ZN2 A;  2XB5 A;  1DP7 P;  3BCA A;  3A02 A;  2V6E A;  3H9J A;  3GCM A;  2G0E A;  1ZRD A;  3QU6 A;  4BQA A;  1OMI A;  3MFK A;  3AL0 B;  3EYI A;  2LNB A;  1J0R A;  2K7L A;  1IRF A;  4GGG A;  1FYL A;  4D5C A;  3SEZ A;  1YO5 C;  4U0V A;  2ZNZ A;  2DT5 A;  3I4N J;  2H6B A;  4O6J A;  2VBY A;  4EEF G;  5E20 A;  1Z3Y A;  3G1O A;  2EA2 A;  1JJ6 C;  1D8K A;  1Y8R B;  2KIM A;  4XON A;  2W25 A;  4IVN A;  2VKH A;  4QWQ A;  1LB2 A;  1LFB A;  3WTZ A;  3FKJ A;  3V7S A;  1L0O C;  3NAU A;  4PJN A;  1U78 A;  2LR8 A;  1KA8 A;  4P1W A;  2LD5 A;  1Y39 A;  3DKX A;  4DYQ A;  3DPU A;  4IOA F;  4P96 A;  4KN7 X;  2PG4 A;  3I0T A;  5KAF C;  2R7T A;  1I1S A;  4A3E J;  3E6D A;  3ABK H;  3GFJ A;  5KNL A;  1J9I A;  2GA1 A;  2ZXJ A;  4Z6Y A;  1RR7 A;  4II2 A;  3OIO A;  3GW2 A;  1YIT I;  2JA7 J;  1STZ A;  4XRS G;  3DQV C;  1YJN I;  5J1R A;  5LEJ A;  3S93 A;  2Y0S N;  1FT9 A;  2L5Q A;  2VQG A;  2XUB A;  1SMT A;  1K83 J;  2VOD A;  2K9L A;  5K7Z A;  3S2D J;  2HQR A;  1LE8 B;  1A6I A;  3V7R A;  1QBJ A;  1RI7 A;  3JRG A;  2HKX A;  3FMQ A;  2MG4 A;  3HTU A;  1YS7 A;  4EQQ A;  3DU6 A;  4BHC A;  2CQN A;  1V54 H;  3CCU I;  3HUG B;  5DV5 A;  1S3J A;  5E79 C;  1W36 C;  1U0J A;  1GDT A;  2XAJ A;  4ZYG A;  3AKZ A;  5FLM J;  1FMW A;  1DP3 A;  2F5V A;  4BAY A;  2Q8K A;  3CLO A;  1Z6R A;  1ZHF A;  3PUB A;  2P7C B;  4HOB A;  4XIC A;  1SD6 A;  4YFX F;  4NQW B;  3SXY A;  3KLO A;  3BT9 A;  4BXX J;  1MND A;  4L5J A;  4HDU A;  3SDG A;  3TO9 A;  3OIQ A;  2RDP A;  2QBY A;  1RIO H;  3HEF A;  3MKW B;  2HWV A;  2EFP A;  4RGS A;  1FOY A;  2NVT J;  2L3D A;  2DU9 A;  4BY7 J;  4ENK A;  1IV6 A;  3IRR A;  3CZ6 A;  3S8P A;  2F4I A;  4Y3O A;  4KMF A;  1RUN A;  4MO7 A;  4XRS A;  1H88 C;  2I5U A;  1E17 A;  2XRN A;  1REP C;  3M8J A;  1MBG A;  2ME6 A;  4ZZD A;  5EGO A;  1PUE E;  1H8A C;  4ASN A;  3OYI A;  3RPU A;  3OL3 A;  4L0Y B;  4B09 A;  1T39 A;  1ZLK A;  3BJO A;  4C3J J;  1ITY A;  3QYF A;  1WQ2 A;  4ESF A;  5E18 F;  1WCM J;  1OCP A;  3TW6 A;  4HX4 A;  3P9C A;  1O7L A;  2E1N A;  4ZYD A;  5IP6 A;  4KDP A;  2Y0S A;  4DJA A;  2LY1 A;  5TJJ A;  1Q1H A;  2DJI A;  3IRQ A;  5DCF A;  4GYG A;  4MNU A;  3RKW A;  1BIB A;  1U3E M;  3K4B A;  2QVO A;  5LGU A;  4HBL A;  6PAX A;  4PJ0 C;  2RQP A;  2F4O B;  3DPT A;  1A31 A;  2K27 A;  3ABU A;  4I0A A;  3MZY A;  2JZY A;  4A0Y A;  5EDN A;  2Z5U A;  2FF4 A;  2JQ7 A;  1U8B A;  4HNV A;  3D1N I;  3CCJ I;  2XGC A;  2XAH A;  2FRH A;  2LBF B;  4LD5 A;  4J19 A;  4Q4Z F;  2ISY A;  1P4A A;  2DFH A;  5EZH A;  3ZRG A;  5HNF A;  3TO7 A;  4M6X A;  2DTR A;  4MTE A;  1MMG A;  3ZQH A;  1P92 A;  2Z33 A;  2M8G X;  1MKM A;  3BCB A;  2LKX A;  2Y48 A;  1P2F A;  4QIW N;  5J4Y A;  1ZH5 A;  5E3M A;  2HGC A;  4J00 A;  1ULY A;  2WC2 A;  3ZQI A;  1JGG A;  2VE9 A;  3HIF A;  3OY9 A;  1VQM I;  1D1A A;  1W5S A;  2BHZ A;  3KP3 A;  1XMX A;  1MDM A;  4FT8 A;  2FX0 A;  3VSK A;  2LC2 A;  3BPX A;  5D5V B;  3ABL H;  1FSE A;  3KCC A;  3JRF A;  4HST A;  2ZO4 A;  4CIC A;  1LJ9 A;  2ZXH A;  2H8W A;  5CQG A;  3HOS A;  4BKX A;  4RB2 C;  2AS5 F;  3COA C;  3U1D A;  1YX5 A;  2Z2S B;  4MLO A;  2HYG D;  3TQN A;  2EA4 A;  2H1L A;  3CJQ B;  3T8T A;  1IRG A;  3G2B A;  2Z16 A;  5JI6 A;  4NB5 A;  1FOW A;  2RGV A;  1X2N A;  3H5R A;  2LF7 A;  1SFK A;  5KK1 A;  1W36 D;  2WB1 A;  4M3E A;  4EJO A;  4KIF A;  2M8E A;  4MTD A;  1A5J A;  2RRE A;  2FOK A;  3Q9S A;  1WI3 A;  3BQZ A;  1XCV A;  2H6C A;  2RNG A;  3DEE A;  1VQK I;  2HTJ A;  2DJN A;  1BJA A;  4U0Y A;  3IC7 A;  3WTY C;  2ECB A;  1QVU A;  4UUV A;  1V5G A;  4A3I J;  3H5A A;  3CC7 I;  5ILV A; 
#chains in the Genus database with same CATH homology
 3WU0 A;  5DCM A;  1HST A;  5EEH A;  4RGX A;  4Y17 A;  3TDZ C;  1R00 A;  3L00 A;  2OQR A;  3V8L A;  2EB7 A;  4UXN A;  3RTR A;  2EV0 A;  2V1X A;  1I1G A;  4MEY F;  1EV7 A;  5JHU A;  3F72 A;  5LRR A;  2XRO A;  2OU2 A;  1UCR A;  5H20 A;  3V7C A;  4EV0 A;  4Y13 A;  2IVM A;  3P7N A;  1XN7 A;  2W84 A;  3QAH A;  3O6B B;  4I98 B;  2CSO A;  1G4D A;  1ODD A;  3L09 A;  3K0L A;  3LA3 A;  5ILU A;  1C0W A;  3WG9 A;  3SQN A;  5LHG A;  4UNO A;  2M1B A;  5FFX A;  2BV6 A;  3IKT A;  2UXN A;  1DPU A;  5A2Q K;  3G73 A;  1TQP A;  4U88 A;  3HSE A;  2BYV E;  4G7Z F;  5E17 F;  1JGS A;  3U2R A;  3Q9V A;  2FSW A;  3JTH A;  3D5L A;  1HW1 A;  5J6X A;  2M5W A;  5BQT A;  3F23 A;  2L02 A;  2E1C A;  2RC4 A;  1R23 A;  5D8L B;  3FM3 A;  3RI4 A;  2JRT A;  2P7V B;  3K2Z A;  3ABT A;  3NRV A;  1YW8 A;  1TNT A;  1SMY F;  1FBS A;  1XDU A;  2JPC A;  3NEU A;  2NAZ A;  2YU3 A;  4EGZ A;  3FHZ A;  4EGY A;  3WTX C;  2DK8 A;  4HQM A;  5HVQ C;  2FBI A;  5CYV A;  3E5X A;  2ESH A;  4GCV A;  5F64 A;  1BIA A;  1IXC A;  3MEX A;  4KIC A;  3IKV A;  1BI1 A;  2PMU A;  1U5T C;  3KZZ A;  3GO5 A;  1YFH A;  4HF1 A;  2PBI A;  5CVJ A;  1X3U A;  2ESN A;  1S6L A;  4DNC A;  1SD4 A;  3F8B A;  2OZU A;  1BC8 C;  5E1W A;  3I5U A;  3RKY A;  1P4X A;  2F5E A;  3V8K A;  1UFM A;  5D6F A;  1ON2 A;  4FX4 A;  2FNP A;  3LAP A;  1Z7U A;  1MJB A;  2G9W A;  2VC0 A;  2ADU A;  1LQ1 A;  4S04 A;  4DQ2 A;  5FFZ A;  3KFW X;  1BN5 A;  2CWE A;  3QP6 A;  1XSV A;  3GFL A;  3KP7 A;  3W6K B;  1KU7 A;  1LDK B;  4MEX F;  5HOO A;  5ILS A;  1TQM A;  3CDH A;  2L54 A;  3C18 A;  2A3S A;  2P5V A;  2P8T A;  5EEG A;  1B59 A;  3LFK A;  4EJU A;  3RDI A;  4UVC A;  4MQ9 F;  4AD9 A;  1MGT A;  4LK0 F;  2VC1 A;  3CTA A;  4LMY A;  1SFX A;  3KE2 A;  1R36 A;  1JHF A;  2KIU A;  1GVJ A;  4R79 A;  1IUY A;  2GWR A;  4P55 A;  5JVT A;  4HV5 A;  1Z6T A;  2FNA A;  4Q47 A;  4LG0 B;  3HUG A;  4I01 A;  4MQV A;  3W6J B;  4Y15 A;  4KA4 A;  2P4W A;  2DBB A;  2EV6 A;  2RKH A;  3J80 K;  4IXA A;  3FWE A;  4IHT A;  1XSD A;  1T2K A;  5HLH A;  2HYF A;  4CGZ A;  1J7K A;  4GXO A;  2DK5 A;  5LGT A;  1K78 A;  2CQK A;  1R58 A;  1IN7 A;  4UVB A;  2VT3 A;  4XLN F;  4RGR A;  5LBQ A;  4RB3 C;  2ZME B;  4G7H F;  2F5F A;  4YII A;  4XSX F;  4HA8 A;  3KEQ A;  2PJP A;  2BEO A;  2K4B A;  2UZK A;  4A0Z A;  3ZMU A;  3OV8 A;  5CVI A;  2V1D A;  2X4H A;  2Z99 A;  2FQ3 A;  4U7D A;  2HTS A;  1W7P A;  5LGN A;  2PLY A;  3MAJ A;  3VEP A;  2C6Y A;  4HX8 A;  3ZMD A;  3D0S A;  4ESB A;  3E5Q A;  3WTS C;  3REO A;  3SHF A;  4EMS A;  3QOP A;  1EH6 A;  1ONV A;  2IW5 A;  4G6D A;  1FZP B;  2W57 A;  2GXG A;  5CVU A;  4CYD A;  2QUF A;  1U5T B;  5LLQ A;  3ZN1 A;  3BRO A;  1R1V A;  5ICC A;  3CO6 C;  5AON A;  1AOY A;  3IWZ A;  5FGM A;  4KFC A;  2ZJ2 A;  4XLP F;  3R0J A;  1HXD A;  5CJ9 A;  2NRA C;  2Y75 A;  3LA7 A;  1YYV A;  4IF4 A;  3DFG A;  5ERI A;  3DP7 A;  5AIP A;  2BGC A;  2UWM A;  1BI3 A;  1VTN C;  2AXL A;  4IRG A;  1XGN A;  1O3T A;  3RYP A;  2ZFW A;  4E70 A;  1ZG3 A;  3FX3 A;  4MGR A;  2EJR A;  2NNY A;  4D0P A;  4HYE A;  4LGW A;  4U0W A;  2PEX A;  4ZH4 F;  4O3M A;  1RNL A;  3KP2 A;  3WTV C;  2EK5 A;  2O8X A;  2A07 F;  4YG2 F;  2DFI A;  2MLG A;  1V4R A;  2DAO A;  4G7O F;  1XGO A;  1ZG1 A;  1ZLJ A;  2MA3 A;  5HDK A;  2O3F A;  2Q2E A;  4P5O A;  4K2E A;  5HDN A;  1QGP A;  1FNN A;  4CHU A;  2K02 A;  2JT1 A;  3KP4 A;  2V1U A;  1IXS B;  5E1X A;  2STT A;  1QNT A;  3GX4 X;  5TRD A;  4LJZ F;  1FP2 A;  4ENJ A;  4R8H A;  3GZ6 A;  2D1H A;  2JPB A;  4BH9 A;  4LB6 B;  2XAQ A;  1IW7 F;  3HYI A;  2IJL A;  5D4S A;  4M9Z A;  2MBF A;  4BHB A;  1FSH A;  3F6V A;  1B4A A;  4U7B A;  5K1Y A;  1U2W A;  3EUH A;  4AVP A;  1G6N A;  3RYR A;  2J5O A;  1FY7 A;  3HTS B;  5JR3 A;  3CUQ A;  1TBX A;  2PQ8 A;  3F8C A;  2VON A;  3RJP A;  4UV8 A;  1FC3 A;  4AIJ A;  3R6S A;  1K6O A;  3R61 A;  1KQ0 A;  1FP1 D;  2ZBK A;  3JAM Z;  5L3C A;  3HOT A;  2Y0M A;  3HHG A;  2XIG A;  2GXB A;  1USS A;  5HLG A;  4WWC A;  3I64 A;  4OIN F;  1YQA A;  3LQQ A;  4OIP F;  1Z91 A;  1LNW A;  2IT0 A;  4HZF A;  2MC3 A;  5L3B A;  3ZMV A;  5FLX K;  4Q5S F;  5FD5 A;  2GQQ A;  3QU3 A;  4EM2 A;  3J80 Z;  5DYM A;  3E6C C;  2J5P A;  4YIF A;  2CG4 A;  1KU2 A;  1P4W A;  1UHW A;  2ACJ A;  3GYH X;  2HDC A;  1O3R A;  5HS7 A;  4ON0 A;  3TOB A;  1CGP A;  3QPT A;  1WI9 A;  1MJA A;  1CF7 B;  1YS6 A;  5L3E A;  1FBU A;  1SFU A;  3ML6 A;  1YG2 A;  4I0B A;  1YLF A;  4CZZ A;  3TO6 A;  2DPD A;  3EQL F;  2R7F A;  3ZN0 A;  3ZQ7 A;  3E5U A;  1T38 A;  3GF2 A;  2KKO A;  1IF1 A;  1I5Z A;  3HSF A;  2V6C A;  4G8X A;  1V3F A;  2W24 A;  1J59 A;  4ETS A;  3H92 A;  4L5I A;  5BOX A;  1TW2 A;  1JXS A;  3BP8 A;  2VBX A;  2F5C A;  1O3S A;  3T0Y A;  3WGG A;  3JW4 A;  2QBY B;  4JQF A;  3ROU A;  1HBX G;  3WE3 A;  2VT2 A;  2H94 A;  2CW0 F;  2VN2 A;  2FXA A;  2DW4 A;  3WTU C;  4A12 A;  1KYW A;  3H3U A;  2X0L A;  4HDV A;  4BHP A;  5HDG A;  1S29 A;  5H6R A;  1F1Z A;  1K79 A;  2HOE A;  3MQ0 A;  3S2W A;  3J7A O;  4ZZL A;  2FML A;  2FMY A;  2R3S A;  1UB9 A;  1W5T A;  1TW3 A;  1Z9C A;  2W85 A;  4M71 A;  4PZJ A;  3L2C A;  2PFB A;  2E7X A;  1S7A A;  2XKO A;  1DUX C;  1O57 A;  1IXR C;  3I71 A;  2XHK A;  2IA1 A;  5HS9 A;  3EET A;  1LEA A;  1ZAO A;  4UHT A;  4I09 A;  1OPC A;  1W4M A;  2K86 A;  4G6Q A;  4Q48 A;  1T6S A;  3QRF F;  1EH7 A;  4OIQ F;  2VOP A;  1YW9 A;  1XDS A;  4OIR F;  3R60 A;  3GWZ A;  3TKY A;  4XRF A;  3HRS A;  4HF0 A;  1BM9 A;  4LLG F;  3BZ6 A;  4L9N A;  5F1R A;  2R7D A;  3ZPL A;  3GFI A;  3B02 A;  4A6D A;  3M9A A;  3CUO A;  3HRM A;  3WOD F;  4M9X A;  1FPQ A;  4A2U A;  2PMH A;  4YFN F;  1T98 A;  2NYX A;  3L9F A;  2VBZ A;  5ICG A;  3ERE D;  2LSO A;  1IN6 A;  2ZME A;  3JSO A;  2BE5 F;  3KEO A;  4BNC A;  1FWZ A;  2QZ8 A;  1OR7 A;  3TGN A;  5DD8 A;  1D5V A;  1GHC A;  2DI3 A;  2ETH A;  5FLX Z;  3F8M A;  1NHA A;  4KNY A;  2HR3 A;  4IRI A;  2GIV A;  3WTW C;  3I59 B;  2L4M A;  2DQL A;  4EJT A;  2COM A;  2ZNY A;  3ELK A;  2P5K A;  2DLL A;  4XBF A;  4PDK A;  5FD6 A;  3T8R A;  3TDU C;  1OYY A;  3KZY A;  1PP8 F;  5L3F A;  2KIF A;  2QQ9 A;  1SFE A;  2MLK A;  5ED4 A;  2NS0 A;  4A0X A;  2L4A A;  4NHJ A;  4M9S A;  2G7U A;  1DDN A;  1XB4 A;  5CVV A;  5E8G A;  1FYK A;  5BS6 A;  1QZY A;  3GXO A;  3V8J A;  3VOE A;  1H9G A;  3IHU A;  2ELH A;  1F5T A;  2H27 A;  3R0A A;  4XSZ F;  4L9T A;  4NQW A;  5K5R A;  3M1E A;  2M45 A;  2OZ6 A;  5HLI A;  2QQB A;  4G9Y A;  4PGH A;  3P9K A;  2QWW A;  1HKT A;  1SD7 A;  4FHT A;  2VE8 A;  5A2Q Z;  4JK1 X;  3T1B A;  2IP2 A;  3GZ5 A;  5BPD A;  2QM3 A;  1R22 A;  4ENN A;  2YSR A;  3FMS A;  1R1U A;  2CO5 A;  2EFW A;  1BI2 A;  4WCG A;  3N97 A;  2HS5 A;  2ZKZ A;  4FX0 A;  2MH2 A;  2XAS A;  3F3X A;  4LFU A;  3HHH A;  4M6Y A;  4S05 A;  1YIO A;  2K4J A;  3E97 A;  1GXQ A;  3T5X A;  4B8X A;  1O7F A;  1TLH B;  3RKX A;  1B6A A;  4IHS A;  1WKM A;  2HKO A;  3C3W A;  1R7J A;  4N9I A;  2FBH A;  3E6M A;  2P6S A;  4M74 A;  4AIK A;  1K7A A;  5FB2 A;  3FZV A;  1IN8 A;  4PGG A;  4EM0 B;  2WTE A;  3K1N A;  1ZYR F;  3WGH A;  5K5O A;  1MZB A;  1Z1D A;  3HSR A;  3DKW A;  4IRH A;  1RZ4 A;  3K69 A;  1ZG5 A;  2D2W A;  3M8E A;  2QYO A;  3FF5 A;  3ZMZ A;  4WX9 A;  3MCZ A;  3F8F A;  1FX7 A;  5D5U B;  1L3L A;  2DQR A;  3KP5 A;  2F2E A;  1CF7 A;  3LQR A;  4AIH A;  2XAG A;  1AWC A;  3LA2 A;  4I7H A;  4JBA A;  2YPR A;  4CO8 A;  2RNJ A;  2YR2 A;  1I27 A;  1KU9 A;  1B9N A;  2BBY A;  4N9H A;  1W7P D;  2LF8 A;  3JTG A;  5AIQ A;  2STW A;  3K1P A;  2IPQ X;  3AAF A;  3VOD A;  2PI0 A;  3FMR A;  2XV4 S;  3FXQ A;  2KJB A;  2YX4 A;  1S7O A;  4H0E A;  2A6E F;  3CUQ C;  1UHM A;  2D45 A;  3B73 A;  2Q0O A;  2PN6 A;  1ZRE A;  2EFO A;  3I54 A;  2OA4 A;  4WXD A;  1J2X A;  4RB1 A;  3LST A;  4WXC A;  1BI0 A;  1F9N A;  3G3Z A;  3GUD A;  5D5W B;  1XCB A;  2DO7 A;  3O3K A;  1K78 B;  2IA0 A;  4CDG A;  3NQO A;  1KQ8 A;  4ESJ A;  1JHH A;  2MH9 A;  1R5G A;  5BPI A;  4UV9 A;  3F21 A;  2VXZ A;  3VB2 A;  1HKQ A;  3FXR A;  1PP7 U;  3BOQ A;  2D1V A;  1YW7 A;  1WSU A;  4OMY A;  3ISP A;  2IA2 A;  3K9T A;  3O2P E;  2CFX A;  2OD5 A;  1RUO A;  4A6E A;  4Z2Y A;  3GEZ A;  5BMZ A;  2RN7 A;  4L18 B;  4ZYE A;  4LB5 A;  2FA5 A;  3Q5F A;  2EWN A;  1W7P B;  1A04 A;  3BWG A;  4LLL A;  1BC7 C;  2FU4 A;  2RVC A;  2GAU A;  5JFR A;  2CYY A;  3K1M A;  2XVC A;  3SZT A;  3DPL C;  4G94 A;  3WGI A;  1ZRC A;  5DUI A;  4EVI A;  1Y0U A;  4TV7 A;  1QZZ A;  2NNN A;  1HW5 A;  2LDU A;  2HFH A;  4RB0 A;  2OQG A;  1U8R A;  2ZCW A;  1G3S A;  1B1B A;  4M73 A;  3QP5 A;  1QO0 D;  5CVR A;  2ISZ A;  3R4K A;  3F6O A;  1G3T A;  1O3Q A;  4HF2 A;  2YX7 A;  1OKR A;  1H9T A;  4HLY A;  4ENM A;  4GYI A;  1Z05 A;  1WWX A;  5FO5 A;  2EV5 A;  3BDD A;  3I53 A;  3F22 A;  4P9F A;  1IZ1 A;  5LHI A;  5DDG A;  4HW0 A;  3M7G A;  4N0B A;  5IT9 K;  1XGM A;  5CLS A;  3FXU A;  1DPR A;  1ZGJ A;  2G7H A;  2A68 F;  1IN5 A;  1YTY A;  4KIB A;  2XAF A;  4IJA A;  1B9M A;  2E7W A;  5L3G A;  3TOA A;  2P6T A;  5IT3 A;  1WRJ A;  2H09 A;  4A5N A;  4EJV A;  3PFI A;  1MD0 A;  2Z3Y A;  1QQI A;  1QPM A;  1E2X A;  3H3Z A;  1D3Y A;  3RIR A;  3KET A;  1XD7 A;  5DEQ A;  1XSX A;  2A5Y B;  1HKS A;  4HX7 A;  3LWF A;  3DV8 A;  1OYI A;  1FOK A;  5E1Z B;  2L01 A;  3WU1 B;  1T0F A;  1XGS A;  4OU0 A;  5E8I A;  1EH8 A;  3BJ6 A;  5DUK A;  3SZP A;  3ZMS A;  1BOA A;  3I59 A;  5LRS A;  4UVA A;  3LAJ A;  3U9G A;  3DXJ F;  2FBK A;  2CGP A;  4KIG A;  5J8C A;  4L9V A;  5L3D A;  4ZYH A;  2O6G E;  3ZMT A;  4RAZ A;  1SD5 A;  4RAY A;  3WTT C;  4YFK F;  1R1T A;  2LKP A;  2OBP A;  3CUQ B;  4HV6 A;  3C7J A;  1P6R A;  5KVR A;  2OAZ A;  3FM5 A;  1LVA A;  2FE3 A;  1TNS A;  3EDP A;  1I6X A;  3JSP A;  1XMA A;  3KLN A;  4KT5 C;  3J81 K;  4KUM A;  4WF2 A;  4WXH A;  3BJA A;  4P9U A;  1ZRF A;  4OMZ A;  4LG0 A;  1MDM B;  3CJN A;  3PQJ A;  2GZW A;  2JSC A;  1KGS A;  1ZGA A;  1MJ9 A;  5D5X B;  2GA2 A;  5H6Q A;  1GXP A;  4RGU A;  2VBW A;  4A5M A;  1BBY A;  3IL2 A;  3QPH A;  4KYW A;  5F6F A;  4GO1 A;  4AWX B;  2O03 A;  1LEB A;  1UST A;  2O0Y A;  4EJW A;  4F7Z A;  5DCM B;  3OOP A;  3HRU A;  2KJC A;  1KQ9 A;  5D6E A;  2HQN A;  4OIO F;  2B0L A;  1IN4 A;  1ON1 A;  5D8K B;  3GFM A;  1FBQ A;  1FLI A;  2RV8 A;  3CO7 C;  3C1D A;  3V4G A;  2V79 A;  4HQE A;  3VFZ A;  3E6B A;  2M30 A;  2UXX A;  4L9J A;  2F5D A;  3RPQ A;  4PCQ A;  2QQA A;  1OYW A;  2XGX A;  4EM1 A;  4O5V A;  3L7W A;  2FEZ A;  3GVA A;  4IPA A;  3E3V A;  2IRF G;  4MHG A;  1U5T A;  4HAM A;  2WV0 A;  3SFZ A;  3HRT A;  1H0M A;  2KRF A;  2EFN A;  3I58 A;  2A61 A;  3P9I A;  3ECH A;  2TDX A;  2A69 F;  3ECO A;  3N4M A;  5ICE A;  2Z9O A;  1HQC A;  3MZH A;  3PQK A;  4OOI A;  2DPU A;  1SAX A;  5IT9 Z;  1HSJ A;  3ULQ B;  4LK1 F;  2JTV A;  4KN4 X;  3M8F A;  1F4K A;  5HS8 A;  3ZP5 A;  1ZAR A;  1TQI A;  4HLX A;  5LHH A;  1G3W A;  4RS8 A;  1JE8 A;  4I2O A;  3JAM K;  3IWF A;  3F8N A;  1U6G A;  2V9V A;  4BXU A;  4M72 A;  3EYY A;  3KP6 A;  4L0Z B;  2WWY A;  1IAW A;  1J5Y A;  1FYM A;  4CXF A;  2O61 A;  1G3Y A;  5D4R A;  1LDD A;  2EFQ A;  4BYY A;  4LLN A;  2P5L C;  1HW2 A;  4KMU X;  3MWM A;  1S8N A;  4QLC U;  3DF8 A;  2QEN A;  2QLZ A;  1R5H A;  2HZT A;  1PDN C;  1KYZ A;  3WE2 A;  1XMK A;  5J8F A;  2HEO A;  3DEU A;  5K5Q A;  1KU3 A;  2VOO A;  5ICF A;  1J75 A;  1LDJ A;  2M87 A;  3BPV A;  1TTY A;  2MD5 A;  4I02 A;  2XKP A;  1D8J A;  4R1H A;  5LEK A;  4WK8 F;  2A6H F;  3GLX A;  3J81 Z;  3I4P A;  3BY6 A;  5DD4 A;  1ZN2 A;  1DP7 P;  1ZRD A;  3QU6 A;  4BQA A;  1OMI A;  3MFK A;  3EYI A;  2LNB A;  1J0R A;  2K7L A;  1IRF A;  4GGG A;  1FYL A;  1YO5 C;  4U0V A;  2ZNZ A;  2DT5 A;  2H6B A;  4O6J A;  2VBY A;  5E20 A;  2EA2 A;  1D8K A;  2KIM A;  2W25 A;  4IVN A;  4QWQ A;  1LB2 A;  3WTZ A;  3V7S A;  1L0O C;  1U78 A;  1KA8 A;  4P96 A;  4KN7 X;  2PG4 A;  3I0T A;  1I1S A;  3E6D A;  3GFJ A;  1J9I A;  2GA1 A;  2ZXJ A;  3GW2 A;  1STZ A;  3DQV C;  5LEJ A;  1FT9 A;  2XUB A;  1SMT A;  2VOD A;  2HQR A;  3V7R A;  1QBJ A;  1RI7 A;  2HKX A;  3FMQ A;  3HTU A;  1YS7 A;  4EQQ A;  4BHC A;  5DV5 A;  1S3J A;  2XAJ A;  4ZYG A;  4BAY A;  2Q8K A;  3CLO A;  1Z6R A;  1ZHF A;  2P7C B;  4HOB A;  1SD6 A;  4YFX F;  3SXY A;  3KLO A;  4HDU A;  4L5J A;  3TO9 A;  2RDP A;  2QBY A;  1RIO H;  2HWV A;  2EFP A;  4RGS A;  2L3D A;  2DU9 A;  4ENK A;  3IRR A;  4KMF A;  1RUN A;  1E17 A;  2XRN A;  1REP C;  4ZZD A;  1PUE E;  4ASN A;  3RPU A;  4L0Y B;  4B09 A;  1T39 A;  1ZLK A;  3BJO A;  1WQ2 A;  4ESF A;  5E18 F;  4HX4 A;  3P9C A;  1O7L A;  2E1N A;  4ZYD A;  4KDP A;  3IRQ A;  1Q1H A;  5TJJ A;  5DCF A;  4GYG A;  4MNU A;  3RKW A;  1BIB A;  1U3E M;  6PAX A;  2QVO A;  5LGU A;  4HBL A;  2RQP A;  3DPT A;  2K27 A;  3ABU A;  4I0A A;  3MZY A;  2JZY A;  4A0Y A;  2Z5U A;  2FF4 A;  2XAH A;  2FRH A;  4LD5 A;  4Q4Z F;  2ISY A;  1P4A A;  3TO7 A;  4M6X A;  2DTR A;  4MTE A;  1P92 A;  2Z33 A;  1MKM A;  2Y48 A;  1P2F A;  1ZH5 A;  2HGC A;  1ULY A;  2WC2 A;  2VE9 A;  3HIF A;  1W5S A;  3KP3 A;  1MDM A;  4FT8 A;  5D5V B;  3BPX A;  1FSE A;  3KCC A;  2ZO4 A;  4CIC A;  1LJ9 A;  3HOS A;  4RB2 C;  2AS5 F;  3COA C;  3U1D A;  2HYG D;  3TQN A;  2EA4 A;  3T8T A;  1IRG A;  5JI6 A;  4NB5 A;  2RGV A;  2LF7 A;  5KK1 A;  4EJO A;  4KIF A;  2M8E A;  4MTD A;  2FOK A;  3Q9S A;  1XCV A;  2H6C A;  2HTJ A;  1BJA A;  4U0Y A;  3IC7 A;  3WTY C;  4UUV A;  5ILV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...