2L9SA

Solution structure of pf1 sid1-msin3a pah2 complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
SNADYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 12
publication title Solution Structure of the mSin3A PAH2-Pf1 SID1 Complex: A Mad1/Mxd1-Like Interaction Disrupted by MRG15 in the Rpd3S/Sin3S Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1860 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9sA00
2L9SA
chains in the Genus database with same CATH superfamily
1RR8C 2JMWA 3G1LA 3PL8A 5FB2A 3HBLA 4C9YA 3L2WA 3FF5A 3S93A 3CF2A 1JUSA 1H8AC 4GCVA 3KP3A 2ZJPF 1S72I 3ZQ7A 4D5FA 4L0ZB 1HW5A 5BPIA 5K7ZA 4XONA 2R7DA 3TDZC 4ESFA 2OF7A 2DPUA 3CUOA 2M3AA 3AFHA 2R7VA 2UXXA 4NDLA 5M5XJ 4PJ0C 1B6AA 5H6RA 3K6GA 5LFAA 2QEXI 1KONA 3DTEA 3BP8A 3LA7A 5BQTA 3OYNA 1RI7A 2HPIA 2PMZN 2UXNA 4ZYGA 1ETYA 2R7QA 3H9QA 4KT6A 2WAQA 5K7HA 2ESHA 5DCMA 4DBQA 2DTRA 3I54A 1QVTA 2PMZA 3CUQC 2ME6A 1JKRC 4L9TA 1ETXA 4YFNF 1A5JA 1ZR4A 1ENHA 3MEXA 2XROA 1IG7A 1W5TA 1X3WB 4ZTFA 1TWFJ 5EZHA 2IBDA 2VN2A 3C2BA 4U0WA 5E3NA 1B9NA 2CQ7A 4PZJA 1NH3A 2CUZA 5L3GA 3A02A 1MJBA 4BQOA 5CKTA 1ZQ3P 2DMQA 5FGMA 4L5EA 3GTOJ 4M9SA 3HOVJ 1WJDA 3COAC 1VQ9I 2JA7J 4PJLA 1WWXA 4W97A 2BW3A 3QWLA 2LYCA 1R71A 1U3EM 1BIBA 4D5CA 3WTTC 4E7SA 3MN2A 3DEEA 2KQRA 1IO2A 1FSEA 3VB2A 1JKOC 4ZZLA 1OQYA 2VC1A 1SFOJ 4MTDA 1T39A 4ZDOA 4U0YA 2LREA 3K70C 3S1RJ 2VE9A 3FKJA 1WH7A 4BE1A 1G3SA 4FQGA 4HRIA 2BHYA 4ON0A 4DJAA 2STWA 5JR3A 1FBUA 1ULYA 2M4GA 3Q9SA 5FKOA 5FLXZ 4Y15A 4II3A 2FQ3A 2HYGD 5BNGA 5J4YA 3G73A 1FTZA 2COBA 2L9VA 1KQ0A 3F6OA 1MDMB 4EM2A 5DS9A 4JX5A 2IA1A 2PMHA 2QQAA 4UNOA 4Q48A 2DMNA 1Z7UA 2TRTA 2OJED 1ZG1A 1TWHJ 1TW3A 4BYYA 4RMNA 2D45A 1XDUA 3HEFA 2ZXHA 3CUQB 5LHGA 2RREA 1Y1VJ 3L09A 2GOMA 5H2FC 4FX4A 2FJ1A 1VQLI 2HOSA 3VYUB 4A93J 3E6CC 3JR9A 2L02A 3V8JA 1OFCX 2KRFA 2RGVA 3D1NI 2QUFA 4KIFA 3RQIA 3SEQA 3H5AA 1PYVA 4OIPF 1EH6A 3DTKA 4AVZA 2O61A 2XAHA 5HDKA 2CMPA 3GTGJ 2VJ4A 5CJ9A 1U8RA 1WJAA 5FFZA 1IV8A 2OQRA 1WSUA 1MNEA 2LY1A 1OKRA 4NQWB 1AHDP 4LGWA 4U7DA 2RQQA 2HXIA 3D0SA 1JUPA 3TW7A 4FE4A 4BEHB 1E0EA 3V42A 3PIOF 4G7HF 2A61A 1SD6A 1TWGJ 1ZRCA 1JTXA 5IP6A 2A6HF 4XSXF 1N25A 1BC8C 2JJ7A 2QSGX 2OQGA 3R6SA 1MMAA 5KK1A 1EH7A 4HZFA 4P1WA 5L3CA 3TO9A 1BR2A 1JHHA 2LC2A 2LSOA 3OYJA 2PFBA 2ZSHB 2LK2A 4TV7A 2IS6A 3SZTA 5ILSA 2K9SA 3K69A 3WGIA 4AC0A 1QO0D 1I5ZA 3OYGA 4C2TA 2E5NA 3GEZA 5EYRA 4BE2A 2EIKH 1ZYRF 3G1OA 2H27A 5EEGA 3TP0A 4MQVA 4CCOA 4HNVA 1YJWI 3LSJA 1MDMA 4OIOF 1JHFA 3IL2A 1ZG5A 1F5TA 1YOVB 2FBIA 1ZKGA 4UB6C 3WG9A 1GUUA 2FU4A 2NOJB 1IN4A 1J75A 2RC4A 3BG6A 1GLNA 4LLLA 4B3AA 3CMEI 2VJ5A 3L1PA 5LBQA 3CUQA 1ITYA 2R92J 4XLCA 1MJ9A 2HEOA 1D0ZA 2GA1A 4FTHA 2KZVA 3R4KA 3OIPA 1O7FA 2AXTC 1JE8A 3MCZA 1LFPA 5HNHA 3F8BA 4OIRF 1VQ4I 2M0MA 1OPCA 5C3EJ 2WC2A 2O3FA 2XB5A 4H0EA 3KEQA 3W6JB 4CH7A 1MH3A 3TGNA 1YHQI 4BH9A 2I10A 5D5XB 1IC8A 1NG7A 2IXSA 1Z21A 3CMMA 3F72A 4L0YB 2HXOA 3HDDA 2HQAA 3DF8A 4NQWA 1XS9A 3EQLF 2CFXA 2CRGA 3GZ6A 1LQ1A 1ZREA 3FK6A 3HC7A 1FYMA 2JQ7A 2PI0A 4XBFA 5H6QA 4DW6A 4XRMA 4BEHA 2HQRA 4HYEA 5TGTA 3ZP5A 2YSRA 3UR3C 1ETWA 3IH4A 4O3MA 1J5YA 2FSWA 1SD5A 2EK5A 3OWTA 4C3JJ 3WTSC 3BPXA 1P92A 3S14J 2Q0OA 4L9VA 1I3QJ 4RAZA 4N9HA 3BTJA 5J1UA 4BNCA 3OYMA 4GXOA 1YX3A 3BR1A 4OINF 3FM3A 4ZTJA 1IRGA 3G71I 5F1RA 3L9FA 2OPTA 2Y30A 3NAUA 3OYKA 3CJQB 2DJIA 3C18A 4HQMA 4KN4X 3N4MA 2M5WA 3KPHA 1BJAA 2CQQA 4HEA2 3FXMA 1QZZA 3BG5A 2R5YB 1BI3A 2CJJA 3A2KA 1X19A 3CLQA 1WJCA 3ZMSA 1S8NA 2EFNA 3JRHA 1SVLA 1XMKA 1XSXA 2OA4A 3EUAA 5D8LB 2DTZA 1WHUA 2K4BA 5BPDA 2DPDA 4LJZF 4XN0A 2J5OA 2EH3A 2EIJH 4HX7A 1TC3C 3CJTB 5D5VB 5J47A 4XLAA 1HOMA 2O6GE 3W6VA 3GBGA 2NRAC 1RRJA 2IA2A 4HW0A 5HNFA 4W1UA 1WVRA 1D1AA 3ZMZA 5FJ8J 4IQJA 5A2QK 4CYCB 1AKHB 2P5VA 4IOCF 1W36D 2L4AA 2XGCA 5D4RA 1YLFA 2R0QC 2DK8A 2R7WA 4XKVA 3PFIA 4GYGA 3S17J 3GFJA 5CVJA 3OYLA 3T5XA 2X1EA 1HDPA 2VASA 4F3QA 3J7ZI 2JWTA 4HNUA 4ZDPA 2Y75A 3JW4A 3A01A 1KU2A 5FRNA 1YW9A 1HW2A 3GTMJ 3HSFA 2ZMEC 1ZRFA 1SVOA 4ASNA 3FBNB 1AA7A 5ILUA 2RN7A 5DCFA 1X1PA 4GFBA 2X51A 1JKPC 3FHZA 4A3LJ 3BTLA 3FBIB 1XN7A 3H5NA 2JA5J 4M73A 2LKXA 1GT0C 2F4OB 2M30A 1ZLJA 2NS8A 4I99C 2H09A 1W0TA 5FRMA 1D5YA 1E3HA 3TBIA 4G8XA 4FCYA 1U78A 4F52A 2VKVA 3GTLJ 2R7XA 1OYIA 4F55A 1HA8A 3ZMUA 2ZB9A 4M3DA 4M6VA 1T08B 2P4WA 2UZKA 2VBWA 3U2RA 1BA5A 2I8DA 3BZKA 2R5YA 2CFOA 4NBQA 3IH2A 3AAFA 3PO3J 1Z9CA 1G4DA 3GMEA 1SD7A 2ISYA 4PFPA 1MBJA 4V2FA 3CC2I 3M3YJ 4KISA 2M87A 3RKXA 3MKYB 2IGKA 2OCEA 1DU6A 5JHUA 2R7TA 1T0FC 5HS9A 4RS8A 5TJJA 4A3EJ 2H1KA 4HF1A 3HRSA 2L01A 1N78A 3JSOA 1H9TA 2A05A 3K1NA 2XIGA 3BQZA 4UV9A 3ERMA 4MFDA 1IUYA 4FISA 2IP2A 4BJ5C 3Q3SA 3M1EA 1AKHA 1E2XA 2W84A 3SDGA 2FMLA 2CV0A 4C3HJ 3M1CA 1WKMA 5CPRB 3OR1C 2VBXA 2KLOA 2VB6A 1CQTA 3FMRA 2VL8A 1R36A 3NWSA 2X0LA 2KJBA 5AIQA 1BN5A 3CJNA 5DTDA 2HKXA 1EA3A 4I76A 5KVRA 2IGOA 4YIFA 2G9WA 2DA4A 4R8HA 2X6WA 4D7NA 2IA0A 2OUMA 4IRHA 2LKSA 3WTVC 1QZEA 2FOKA 1RUNA 1ZGWA 2FQ4A 3CCMI 4QPQA 2P7VB 3OR2C 1VQMI 2PJRB 3AG4H 4LD5A 4MO7A 2GIVA 2KMUA 3I53A 3CCRI 2VJJA 4BGDA 1G3YA 5EZGA 1ZGJA 4HF2A 3QP6A 2ISZA 1Z77A 4WWCA 4N9IA 3DXJF 4A0XA 9ANTA 3KZIC 2JA8J 2F6CA 1Z6TA 1BBYA 4WXDA 1WQ2A 2DA2A 4GRIA 5FD5A 3ZQIA 3HRUA 4A3JJ 1D8KA 2MW8A 3P7NA 4RGSA 5M3MJ 2A69F 2XV4S 1HXDA 4X0GA 2KJCA 3OL4A 2ZCWA 3PNTA 1BI0A 4B3XA 2EBIA 3LSIA 1I6HJ 1K6OA 2Y9ZA 3I4MJ 2QZ8A 2LBFB 3FMQA 5F6FA 2Z1DA 1EJ9A 1MD0A 3A03A 3KZYA 4I6ZA 2OTJI 4HSTA 1P4XA 4NC8A 1ACIA 3I59B 2M7BA 3DTIA 3BLYA 3IKVA 5DEQA 5LGUA 2LFBA 2COMA 3P9IA 1Y0NA 1YS6A 2EA4A 3O3KA 1G8XA 2FUG2 2HDWA 3WTXC 3EDPA 3OYBA 4WX9A 4XLEA 4LG3A 4M3GA 3T8TA 2BXZA 2ZMEA 2AS5F 2IT0A 5B3SH 1RESA 5CQGA 1O3RA 1H0MA 3RPQA 4EEFG 3MD2A 2ADUA 1GHCA 4Z6YA 2GBYA 2HQNA 3BC8A 4ENNA 1SMYF 3DLAA 2HOAA 3NRVA 3OL3A 2L9RA 1VZ0A 3K4LA 2CS3A 2O0YA 4M3BA 2JRTA 5E79C 2QA4I 3OYHA 2XASA 4BS9A 3GTPJ 2EZHA 3LMMA 1ZHFA 4C3IJ 2K40A 3ZQHA 4IZZA 4P9UA 4II2A 3BQYA 3K4CA 2PJRA 2MD5A 4ZYHA 3TKYA 3CJRB 2LD5A 3EUKL 3CDIA 5IYBJ 1QRYA 2GAUA 5LRSA 3VEPA 1D1BA 1R1TA 1S6LA 3M07A 1K79A 1FPQA 2VE8A 2W57A 5GAHJ 5J6XA 1O3QA 2MD0A 1Y8RB 3RZOJ 2EZLA 1W5CC 3LWFA 2DI3A 5CVVA 3CTAA 3FM5A 5HLGA 1T0FA 5E3MA 3RQ4A 2DYRH 3D5RC 3EYYA 5FKKA 1XC5A 4CSWA 4G7ZF 1GXPA 3DPLC 5TISC 2LP0A 3GFLA 4RA2A 3FMSA 4Q47A 2R5ZB 3E6BA 3V7SA 1HQCA 1VNDA 3GX4X 1MBFA 3VPRA 1TNTA 2HVRA 2A3SA 2EQRA 4JQFA 4A0YA 1HKSA 4DIQA 2DBBA 2VBZA 2F5CA 3NEUA 1T95A 4AIJA 2XKOA 1ZELA 2LBFA 2ID6A 2R7SA 2DT6A 3O8HA 3K70D 1IAWA 3BJAA 3I59A 4JYKA 1VFCA 3ECHA 1B4AA 2TCTA 3PJRA 1UG2A 4J01A 4QLCU 1KQ9A 3AL0B 3WTWC 1ZN2A 2ZNZA 1D0YA 3LA2A 1IF1A 4D0PA 2NXNB 2DOEA 1Z7LA 3AG2H 3PM1A 2F4MB 2GQQA 4OIQF 2K4JA 3S2HJ 4BXXJ 2EINH 3HG9A 3E7LA 2JTVA 1YJ9I 4CCJA 1QGPA 1BI1A 4QPOA 3K1PA 4BHPA 1YIJI 4P5OA 2K9LA 4QIWN 3QYEA 4HA8A 4Y7NJ 3GFMA 2XGDA 2LG4A 1XGNA 2E7XA 4DNCA 1OCZH 3QAHA 3K4JA 2IRFG 4RLQA 2AQEA 1XMXA 2DQRA 1MMNA 2L9NA 5C4XJ 4O5VA 4RGXA 4K2EA 2F5EA 1G6NA 5FFXA 4YG2F 5FD6A 1BR4A 1L0OC 2IVMA 2F5VA 4EGZA 1FOYA 1Q1HA 4NNJA 3WGHA 4V19K 2GM4A 5HLIA 4ENJA 4ENKA 3GWZA 1MSEC 1DDNA 1ZLKA 3T8RA 3G3ZA 2B9SA 3KEOA 4ITVA 1OCCH 1QBJA 2LLKA 2W85A 3WTYC 4AUXA 2V9PA 3GTJJ 3A0BC 3BG7A 2YX7A 3HZJA 1XCVA 3H36A 5BS6A 1W7PA 4IHVA 1FOXA 3K1MA 3Q0UA 3BJ6A 2R5ZA 2ETHA 2F4IA 3L2RA 1IN7A 2XPVA 5K7FA 4Y3OA 2IS2A 1EKEA 1UJ8A 1IGNA 4AIHA 1DGWY 3GFIA 4XKCA 4XK4A 5CLSA 3CMYA 1MNDA 1YW8A 1QPMA 5B5EC 2Z9OA 5CVRA 2DK5A 3J80K 3ZQCA 1LDKB 3FXJA 4IEJA 2PX9A 2V6EA 3KE2A 3H9GA 2LMDA 1V5EA 3CCVI 1UB9A 2DT5A 3DBLB 1FMWA 2QWWA 2HPMA 1OYWA 4PUSA 1E3PA 1RIOH 3VSKA 1RNLA 2VI6A 1JI8A 1GV5A 2QSFX 4E7JA 1Y1WJ 3LSRA 3F8NA 4WXCA 5FROA 3DP7A 3S3MA 2ZXJA 3HGGA 1G3TA 1H88C 1IXSB 3H0DA 3M4OJ 4XORA 5DUKA 2JSCA 4IQ4A 2QQ8A 2DT7B 4I0AA 1ORKA 4HBLA 2HVSA 3LAJA 2VUMJ 3TQNA 3CP2A 5M3FJ 2E35A 3WODF 1ERDA 4LLGF 4LG0B 3H0GJ 3HSRA 2NNYA 1R9TJ 3ZPLA 1SAUA 2YS9A 1U6GA 1TQMA 2X1CA 3EPZA 1DP7P 1C0WA 3HOZJ 1UFMA 1LFBA 1HCRA 3S2DJ 2R7FA 5L3FA 1OYYA 1DU0A 3G1MA 3OS2A 2ZNYA 2E2JJ 4A2UA 3WGGA 3F8CA 3B73A 1I39A 3KETA 2HOEA 5D6EA 1Z67A 1V4RA 5BMZA 3IH3A 3LSTA 2PEXA 1R4MB 2KISA 2CQNA 3DEWA 4HV6A 2F5DA 5E8GA 5HS8A 1FT9A 5KHDA 2WA0A 2KL4A 2WV1A 4HAMA 1QHGA 3BDDA 4CCMA 3PQKA 1A6IA 5IYCJ 3I3LA 5HODA 2VXZA 5EEAA 1FP1D 2Y2ZA 4PGGA 1MBHA 2M7AA 2QBYB 4G6DA 4Y13A 5IP9J 1T38A 1HSTA 5ICEA 2HR3A 4PFOA 3I56I 4BDZA 2BY0A 1SD4A 1XB4A 2L5QA 4EQQA 5E18F 3BCBA 1XMAA 1S5LC 3QOEA 3S8PA 4ZYDA 3ABLH 2TDXA 4PJJA 1XGOA 3ZRGA 1W4MA 1DQUA 1QU3A 1O3TA 3WG7H 1WZ2A 2ZJQF 4AIKA 3F8FA 4U7BA 3RI4A 3I4PA 5ICGA 1A35A 1MW7A 1QQIA 2DFHA 3HM5A 3SZGA 4IOAF 4Y33A 2R7UA 2M8GX 3GLXA 4BL0B 4EVIA 2CH0A 4LB5A 3BROA 3PFYA 3SHFA 3ZR8X 3CCEI 4CCLA 1WPKA 2QKLB 1XPXA 1M1EB 4BDYA 2JSPA 3DPTA 1FTTA 1X4OA 3ZMVA 1N75A 1Z3YA 2B7EA 4LG0A 2MLKA 1ETVA 4KNYA 2IAIA 5IPAA 4B1RA 2WAEA 4XM3A 2RVCA 2Z2SB 3CO6C 2A07F 2ZXWH 3OIQA 1USTA 1IRFA 3IAS2 4DGWB 3HL2A 3PNVA 3AG3H 3E3VA 3ZQLA 2FX0A 2V79A 3HOTA 3KP2A 2GA2A 4PSWA 1J7KA 1E3OC 1RR7A 1JKQC 2HGCA 1QZYA 1S7EA 3KFWX 4KMUX 3KIOA 1F43A 4LB6B 1R1VA 4AD9A 5B1AH 5D5UB 2YU3A 2FBKA 4XKBA 1XD7A 4UVBA 4XRSG 2H6BA 2XF6A 1K78B 1QVUA 1BJZA 3K10A 2D1VA 1ZR2A 4ZYAA 2MGQA 4JBAA 3ZN0A 2DLLA 1R5ID 6PAXA 3MFKA 3FXUA 5M5YJ 4EM0B 2L7MP 4JP0A 2EFQA 2M2EA 4GDFA 3RSNA 3H35A 2HZDA 5EGOB 3JAMZ 2R7OA 2XAUA 4ESJA 3CQZJ 3CCUI 1FBSA 3B6CA 1P4WA 1OCRH 3K2AA 3QU6A 3QPTA 2OU2A 2P6SA 2ZC2A 2X85A 1PDNC 2CV2A 3L7WA 4BBSJ 4N0BA 2K02A 3I0TA 1ETKA 1TWCJ 2FE3A 3FIWA 1SFUA 2BXYA 4KIGA 3TO6A 1VQ6I 2C6YA 4RDUA 3F23A 2ZKZA 2PG4A 3BT9A 4EJVA 3KP5A 2W48A 2R93J 3MZYA 3DQVC 2K86A 4A3MJ 2JA6J 4RGUA 2Z33A 4M9XA 3TOAA 3HRTA 1RKTA 1ZRDA 2OZ6A 3BR5A 5E20A 2MC4A 4XICA 2W7NA 2Z16A 3QYBA 1K61A 2L9SA 4L5IA 1O3SA 1VTNC 3VYSB 4L18B 1B9MA 2A68F 2KRCA 3F6VA 1QPIA 4PK4A 3ZCOA 1FP2A 3QODA 1UMQA 4UUVA 3Q9VA 4LLNA 3CP8A 4YRVA 1IXRC 2H6CA 4I01A 5J1RA 3IUOA 1FX7A 2O03A 1T8IA 3ML6A 1IV6A 2KT0A 2KIMA 2ME0A 2R7RA 2V1XA 1PUFB 4A3DJ 2HFHA 4IL6C 1ONVA 5ICFA 3OY9A 1MMGA 5IT9K 2DDBA 1TL8A 1YIOA 1K78A 3W2WA 3HOYJ 3M7GA 2OBPA 4Y52J 2ZO4A 5D8KB 1FIPA 1S29A 4AU7A 3ERED 1PP8F 1P9QC 4R1HA 2MC3A 1HBXG 1A36A 4KJZA 1OLTA 4FX0A 2V1DA 1I27A 2JA2A 2X6OA 4XL9A 3MMYB 5EGOA 2MFZA 1XCBA 2ZFWA 2FEZA 2VT3A 2CUFA 3C7JA 1MBGA 2OCCH 2EJRA 1GVDA 2JN6A 5B66C 4P55A 3GUDA 4XMYA 1YX5A 3NQOA 3QOPA 3SXYA 3RDIA 3GYHX 2BE5F 2A5WA 2LOOA 4MHGA 3IHUA 4XOTA 2FRHA 2K3PA 3HGYA 1V5GA 3WE2A 5F27A 3ZQGA 2WY8Q 1W7PD 3GO5A 4P9FA 4B43A 5C44J 2CQXA 4CDGA 1HW1A 2IS4A 5LD2C 2DOAA 1YYVA 3CDLA 1BOBA 3FHNA 2HWVA 4PGHA 4XRFA 1JT0A 2CW0F 2FOWA 2JK3A 2XPWA 1EV7A 3P9CA 4XR6A 4CUGA 4E7LA 3U9GA 2LVSA 1FEXA 2X6XA 2F5FA 2QCOA 5L3DA 1YO5C 2E2IJ 3WHBA 1NG6A 4X1EA 1F36A 4M3EA 5E1WA 4CA0A 5E3OA 2KKOA 3A0HC 4NHJA 2ZJRF 2NS0A 3GF2A 1ZH5A 2VBYA 4YIIA 4ANJA 2VXDA 3WHCA 2XSDC 2W4SA 1ZTRA 5EJCA 3SQNA 3WE3A 1CGPA 2V9VA 2BGCA 3KP7A 3TEDA 2D1HA 1D3YA 1PUFA 2HI3A 2Z5UA 2NAZA 3FXOA 1ZARA 3WU1B 1VQPI 1KU3A 2CUJA 1QNTA 3E97A 3HYIA 1UELB 1NK3P 2EFWA 2CUEA 4MGRA 3AG1H 1BW6A 1IDYA 1G3WA 2ELHA 3FZVA 2VT2A 4CYCA 1R7JA 3JRCA 4I02A 5EEHA 1S7AA 4BQAA 1PJRA 2E1MC 1Z0XA 2D2WA 3E6DA 2XAFA 1MIJA 3IC7A 3ELKA 3S2WA 1Y56A 1VQKI 5IY5H 2QQ9A 2X1DA 3OV8A 1DGRM 4LIVA 1A6QA 3P9KA 1F4KA 3QPSA 1TQPA 5DYMA 1W0UA 3LA3A 5JVTA 4ESBA 4XLHA 3OSGA 2V4JC 3QYFA 1F9NA 2VPRA 1IRZA 2P8TA 2WB1N 1KU7A 2IEKA 2H8WA 4M6XA 1YE9A 2BY1A 5CVIA 3GZNB 1JJ8C 3QRFF 4A69C 1UHSA 1U8BA 2NVYJ 2BBYA 1YTYA 2EA2A 5E17F 4B48A 2DFIA 1TTYA 2VOOA 2DMUA 1A04A 3M8JA 1YRNB 2QVOA 4F93B 4FE7A 1T33A 2H8RA 3Q0WA 2P81A 1YS7A 3BR3A 3KYCB 5DD8A 4A3FJ 1TP4A 1NTCA 3RYRA 4IHTA 1SC7A 1ZGAA 4F91B 2PMUA 2FNPA 2HNHA 4E7HA 1Y6IA 2M34A 4QWQA 4B47A 2Y48A 4XLPF 2X48A 4IXAA 3O6BB 2ZFUA 1OJLA 3VYRB 1P2FA 2KIUA 3K2ZA 3I58A 4UVAA 5JI6A 5F04A 1R1UA 5FLXK 2LDUA 3PUFA 5J8CA 3IKTA 1X2MA 2M8EA 3OYCA 2BY3A 2K85A 5DV5A 2E1MB 4G9YA 2DA3A 1D5VA 5LRRA 4G7OF 1U2WA 5F0FA 3HTUA 1WJEA 2CV1A 4B44A 5DM6F 2Y0SN 1L3LA 1R4NB 1MH4A 1ON1A 3QP5A 4HNTA 4M71A 5DDGA 4AM3A 3DLLF 3RKWA 1TBXA 4FT8A 1X3UA 3Q0VA 3DCFA 3QPHA 2RNJA 3F21A 1W5SA 2Y0SA 2Z99A 5AIPA 4MEYF 4NC6A 2A6EF 3K0LA 2JUGA 2LNBA 2EB7A 3AL0C 2DA7A 4E6KG 2H94A 1KU9A 3U21A 4I0BA 1GVJA 2W25A 5F08A 2X6YA 3CMAI 1QHHD 2MLGA 2ELJA 3H9JA 2G7UA 3L2UA 1D1CA 1YQAA 2ELKA 4UUSB 2L7KA 1OCPA 1IJWC 2VQCA 4XOPA 5J4VA 2V26A 1TNSA 2EIMH 1YITI 2W82A 3ZMTA 2GIZA 3DKYA 3HXLA 1WI9A 4JK1X 3ULQB 4EATA 4CYDA 1SEUA 1RZ4A 4HDVA 1ODDA 4D7MA 1ZK8A 2YX4A 2VJIA 1HC8A 1Y39A 4BHBA 2OTLI 2FF4A 4AYBN 4RM3A 3CCLI 2F48A 3FXKA 4BY7J 4BJTA 2IGMA 5CYVA 2CU7A 5IYDJ 1YJNI 2PLYA 2BEOA 2WBMA 1XSDA 3S1MJ 4XRSA 1VQ7I 3LFKA 1IRXA 4CZZA 4I2OA 4XLNF 2XSJC 5A2QZ 3B02A 1JJ6C 2XF5A 1X1DA 1IN6A 3HSEA 3P5JA 4NB5A 2BYVE 3HOWJ 4Q5SF 1TT5B 1FMVA 4OMZA 4BQQA 2M0CA 2OAZA 3ZXSA 4CGZA 4DYRA 3UNGC 4EGYA 3PSIA 1X1BA 4XN3A 4Q4ZF 4A3CJ 2EV6A 1WFXA 2EZIA 4XLFA 3D5LA 3DU6A 5GTIC 2K3FA 2K9QA 4L9JA 4S05A 3W6KB 1D0XA 5KAIC 2VC0A 1T56A 3CDHA 1UHWA 2AQFA 4Y17A 1HKQA 1Z6RA 2WV0A 2VODA 5IP7J 2HDDA 2CYYA 1B8IB 2E2HJ 2NVXJ 1LDDA 2QLZA 4AWXB 4CHUA 1LE8B 3J81Z 2E5ZA 2LKPA 4S0HB 2FMYA 3BWGA 4F7ZA 2YPRA 1TT0A 4IVNA 2DMPA 1MGTA 4U0VA 3JAMK 1R5GA 2LF7A 1LPQA 1OCOH 2M4KA 2ZBKA 2X9DA 4V2GA 4UUSA 2O8KA 3LSHA 4XNFA 2FXAA 2G7HA 2XAJA 1R00A 4EMSA 1PVEA 2HU9A 2L3DA 4E70A 2XB0X 1J0RA 3L00A 5LEJA 3QU3A 2UUZA 2RQPA 2DQLA 4U87A 5E8IA 3RZDJ 4ZH4F 3OYFA 1R22A 3EYIA 5HLHA 1I3AA 4YEJA 1V5FA 4AVPA 2VOPA 1H89C 4YELA 5GTHC 4RB2C 1DPUA 4GYIA 3W2AA 3SZPA 2MA3A 2MH2A 4Z2YA 2E1CA 3L2CA 3T1BA 2KDOA 3IWZA 1NHAA 4A0ZA 1O7LA 3SDBA 4DOZA 3WTUC 1J9IA 1J09A 3CCSI 2LY2A 2VKEA 3ECOA 3HRMA 2CO5A 2XAGA 5JHFA 1R6RA 5K5RA 3CCQI 3BZ6A 5L3EA 4N4NB 3BCAA 4PCQA 1SFEA 4HG2A 1JXSA 4RAYA 3HOUJ 2EFOA 2WAQN 4JX4A 2KRHA 1ZG3A 4HSRA 3ONQA 3KYLA 1Z05A 1KA8A 3GVAA 1LUJB 3JRFA 2QQBA 5L3BA 2NVQJ 1BC7C 3FKIJ 3RPUA 4I09A 1UAAA 1R49A 3J7AY 2ID3A 5D5WB 3DEUA 1HF0A 2LTPA 1SAXA 2XPUA 1JUMA 2RV8A 3MQ0A 4XSZF 2HDCA 1K83J 1X3ZB 3VWBA 1I1SA 1U5TC 1IZ1A 1WJ5A 2H1LA 2L7ZA 3EUHC 1Z1DA 4EM1A 4WF2A 4DBRA 2FBHA 3LFUA 1STZA 4BXFA 4KT5C 4G94A 4KUMA 5B1BH 1J2XA 5KCMA 3DBHB 1B8IA 1E17A 5HLTA 1FNNA 4RGRA 2DA6A 3IRRA 3BJOA 4E7IA 1LE8A 5DD4A 3EETA 3G2BA 2V7FA 2IPQX 4MFEA 2GXBA 5HOOA 4IRIA 2EV0A 5JVGF 4RAGA 4WXHA 3TO7A 3RCOA 5J8FA 3BY6A 1FYKA 1MNMC 2QM3A 2KIFA 2JVHA 1LVKA 2EV5A 1LNWA 2HTJA 2ECCA 3V8LA 2CW7A 2PN6A 4RB1A 3SJMA 5LLQA 2NVTJ 1USSA 2WY7Q 3NWTA 3H1CA 4BQNA 4BY1J 2OD5A 2J5PA 2V9KA 2GZWA 1LKXA 2HYJA 1OR7C 2YR2A 4BUPA 3PUBA 2HS5A 1FWZA 3KZZA 4IF4A 1T2KA 3BZCA 2AXLA 3KLOA 1R23A 1S3JA 2BY2A 3CF5F 2QYOA 1Q1VA 3O8GA 5E1ZB 3IP4B 5JLWA 4KDPA 5KNLA 4OMYA 1FJLA 4BHCA 4HDUA 1FZPB 4UY8I 2LR8A 1GV2A 3DFGA 1RPWA 4HX4A 3C3WA 3W2VA 3TL4X 1H9GA 2QSHX 1U5TB 1IUFA 4RB0A 2E19A 4OWRB 4KA4A 2DODA 4NC7A 3WTZA 4IKFA 5F64A 1B1BA 2CSOA 2LY9A 3HTSB 2G0EA 1V3FA 2E71A 4CZCA 3JRDA 2NYXA 3VDXA 3LQQA 5HDNA 2VLAA 4MTEA 2DJNA 5IT3A 4S04A 1FBQA 3BTCA 4FETA 5ICCA 5IOZA 2D5VA 2BOLA 2DOFA 3I9V2 1AU7A 3KLNA 1DP3A 1VQ5I 4U88A 3ISPA 3JCUC 3IV5A 3H3ZA 4HLXA 1PUEE 2Y69H 2HZTA 4ETSA 4BAYA 3IAM2 4RAFA 1MBEA 4B09A 2MYSA 3CLOA 3C2GA 1XGSA 1B59A 3MWMA 3HIFA 4A3KJ 5LHIA 3LL7A 4CICA 4RLFA 3LSMA 1YW7A 4UHTA 3AKZA 4UVCA 2BHZA 4LITA 2KFDA 4DZPA 4RM2A 1V54H 2AHQA 3FISA 4MLOA 2XGXA 1FLIA 1Y0UA 3WU0A 1RC9A 2Y9YA 3S32A 3F0CA 2VQHA 3I55I 1CF7B 2NOGA 3OOUA 4UUTA 1OMIA 4P96A 2IJLA 3R0AA 2NVUB 1POGA 3LSPA 5M5WJ 3ABMH 3OSFA 1SMTA 3JRGA 1SANA 3MKLA 3H92A 3KEYA 1WGXA 1XSVA 3K9TA 3W3CA 2QBYA 3GTKJ 2XKPA 3KYDB 5LGNA 2KHMA 2ZXIA 1ON2A 2EFPA 3JSPA 3KCCA 3OS0A 1P7IA 2WAFA 2DFFA 4MNUA 3MKWB 3ZOBA 2K9NA 5F1JA 3REOA 2R7ZJ 4ZDLA 1U5TA 4CCKA 2VKDA 4LMYA 3EUHA 1P6RA 1WH5A 2W00A 3ABUA 3VYTB 2UV1A 3DPUA 3PIPF 4IHYA 3SFZA 1EH8A 3OMYA 5F0CA 1F1ZA 4IX7A 4J00A 1LJ9A 1SFKA 2Q1ZB 2KP6A 4J19A 2OV7A 5GP9A 3A01B 3I5UA 1DPRA 2QGUA 3LAPA 2DO7A 5EF6A 1R5HA 2B63J 1B72B 2BVLA 2NNNA 2LRDA 4QSHA 4E7ZA 4XIDA 2YUSA 3A4CA 4DYQA 4ZZDA 1SVMA 5F0HA 1X1CA 3N05A 1WRJA 3R60A 2EWNA 1K7AA 2DMTA 2DDAA 1TWAJ 3TOBA 3ZQQA 2MABA 2CG4A 5FLVA 3HOSA 3G4SI 3CCJI 2DW4A 5DUIA 4OOIA 3K7AJ 1LFUP 3OIOA 1OR7A 2DAOA 2XDVA 1HSJA 2MG4A 4D1QA 4R79A 3HPGA 3CO7C 4KYWA 5EDNA 3KX2A 1WJFA 1VF9A 4LFUA 3IRQA 1LB2A 3HHGA 1Y8QB 2MH9A 2GXGA 4PSXA 2Q2EB 3KP4A 4A6DA 1CF7A 3BR0A 1X4PA 2E36A 4UV8A 3K4MA 3ASOH 3O2PE 3JRBA 3TMOA 3JRAA 2LF8A 4D9JA 3TDUC 2IW5A 4E7KA 1XDSA 3FXLA 2IS1A 4DYCA 2GOXB 4BE0A 2UWMA 1MMDA 2DXIA 2W1OA 2V6CA 5K5QA 2XAQA 4C30A 4HX8A 1U9OA 5D6FA 1IN5A 1RKWA 3ZN1A 1OISA 3CCYA 4XQFA 4UB8C 5ERIA 1ETQA 2R4GA 3BR2A 3U1KA 3J80Z 4IJAA 3RJPA 2XRNA 3F22A 2FA5A 4HPQA 2E7WA 4EV0A 1UG0A 4CCNA 4EJUA 3D5SC 4N4OB 4CXFA 2ECBA 2RAEA 2X4HA 3S15J 4PJNA 4C2UA 2Q8KA 4PDKA 2HKOA 1MZBA 4I7HA 3H3VK 3PNYA 3H3UA 2JZYA 2Y31A 3HPHA 3MZHA 1HDDC 4OU0A 1EF4A 2DFEA 4BACA 3T0YA 2VPLA 3DBRB 2BZTA 2V1NA 2WTEA 4BU2A 1KGSA 3E5UA 4BJ6C 5K5OA 1BIAA 2E60A 1U9NA 3UKGA 1NK2P 1LDJA 5J40A 2M1BA 2VQGA 1B72A 3U1DA 4LK1F 4MEXF 3BTIA 4GO1A 2L0KA 3C2HA 2K27A 1IXCA 3I71A 2XUBA 3E1SA 2K7LA 3LNQA 4IHWA 2CWEA 1K4TA 3BOQA 3CESA 1YG2A 1VQ8I 3K4NA 1AWCA 2DN0A 1AOYA 4A5NA 1FOKA 1TZLA 2P0WA 3RIRA 4E4HA 1ETOA 1FOWA 3J81K 1K4SA 2L2OA 3RTRA 1JT6A 1O57A 2A6TA 1UZCA 3QPLA 3E5QA 5FKLA 4F92B 4G12A 5D4SA 5LGTA 2VONA 1BW5A 2DYSH 4OAZA 4IHSA 2GLOA 1T6SA 1REPC 5CVUA 2P5KA 2OZUA 3RPUD 2HYFA 1BL0A 4LIUA 2L4MA 2R3SA 3JTHA 4LOCA 2HVQA 3QQAA 2PBIA 4M3FA 4YFKF 2XC7A 5JLXA 1X2NA 1TQIA 3E6MA 4FASD 4A3IJ 2Q2EA 5J3LA 3GW2A 1DUXC 2Z3YA 4IRGA 1KYZA 1RUOA 2YU9J 2ZSIB 2VIXA 2JUCA 2BVMA 1Z91A 3FK7A 5J1YA 1I50J 5FLMJ 3Q5FA 3L2VA 2ICWG 5ED4A 2Y0MA 2RNGA 3J7YJ 2KIQA 3HB9A 1A31A 2EILH 2M45A 3S3OA 5LEKA 2VKHA 1IW7F 5FKNA 4IHXA 1GXQA 2XHKA 2XGEA 1XG1A 4JX6A 3V7CA 3C1DA 2EPFA 3PSFA 4KIBA 2FD5A 2O8XA 4EJTA 4ZYEA 3OYDA 5AONA 3GTQJ 1VI0A 2CQKA 2HTSA 2DA1A 3M9AA 3NARA 1XX5A 3ABKH 3VSLA 1FIAA 4A3GJ 1I6XA 4A3BJ 3FX3A 1Z3XA 2ZMEB 4B8XA 3CC7I 2RKHA 2JPBA 3HJEA 2O9LA 2BV6A 4ZJZA 3FXRA 2WB1A 4M72A 1YFHA 3VFZA 1UCRA 2ZJ2A 4XKWA 3LOCA 2XF7A 1LEBA 5GADJ 3K4BA 3GLLA 3MZ8A 4KFCA 1JGGA 1MBKA 4X6AJ 5HS7A 3ROUA 2P5LC 2ESNA 4M74A 1IN8A 1G59A 2NS7A 2IGNA 1MSFC 2P6TA 3DKWA 1X1AA 2OC6A 3LSGA 1ZAOA 1BM9A 2N8GA 1W36C 4O6JA 1TLHB 2VQLA 2HQ5A 3B6AA 5ILVA 4BXUA 3OYIA 1GDTA 3RKQA 3F8MA 5JFRA 3FXQA 2L7FP 2O7OA 3MAJA 3V7RA 1YI2I 3L2QA 4QTRA 4A12A 2WADA 4HV5A 1N77A 4UXNA 3ASNH 3I64A 1S9HA 3S16J 3DKXA 1SFXA 2DCEA 1LVAA 3HUGB 2KZGA 3V8KA 2STTA 4KMFA 4KITB 2P7CB 3FWEA 3PQJA 4RBOA 1FYLA 2XRLA 5GAEJ 5LHHA 4BBRJ 2V1UA 2PJPA 3DV8A 2F2EA 3H5RA 4IO9F 4EJOA 3OYEA 3RYPA 4L9NA 1HLVA 3FDYA 4Y4RA 5DM7F 4OAYA 1WI3A 5K1YA 4B4CA 3R0JA 5GPAA 4FHTA 3S3NA 1K6YA 1WCMJ 3HKZN 2DU9A 3I4NJ 1D8JA 2I5UA 3BG9A 3TP3A 1LEAA 4MIMA 4HF0A 5FO5A 1J59A 2GWRA 4PJMA 3LQRA 2K9MA 2HOTA 3K4KA 2LH9A 3HKZA 2L54A 3CD6I 4YIRX 3MVPA 5EG0B 1FSHA 3MKZA 4H4KC 4M6YA 2DA5A 4A5MA 2E1OA 4RB3C 3E5XA 5FKMA 2ACJA 1BI2A 1IDZA 3BPVA 3X2QH 4L5JA 3ZGKA 3ZQFA 2JVGA 4BKXA 3BR6A 3G6EI 3JREA 2WWYA 4LK0F 1YRNA 2FNAA 3ZMDA 5GAGJ 1BOAA 3SEZA 3HHHA 1JTYA 3ABTA 3GXOA 1MMSA 3GZ5A 4CO8A 2QKMB 3A1YA 4HQEA 5C4JJ 1APLC 1KYWA 4DZJA 3OS1A 2AO9A 3BG3A 3ESWB 3LSKA 5TRDA 1KZHA 4AYBA 4M9ZA 4HOBA 1FC3A 1QA6A 1V55H 3SFIA 1R58A 1P4AA 3M8EA 4ENMA 5IT9Z 2W24A 1X58A 1HKTA 3V4GA 3HOXJ 2JPCA 2CGPA 2KPMA 5HDGA 2KDZA 1WJBA 4DQ2A 2K5CA 1T98A 3F3XA 3RKYA 4A6EA 2QF7A 3DWLE 4KICA 3N97A 2MBFA 1W7PB 3VOEA 3HUGA 3CC4I 4I98B 3JTGA 1FY7A 3F9KA 4KN7X 1UHMA 5DCMB 1MKMA 1U0JA 2QENA 4G6TB 1KQ8A 1VQOI 1O4XA 2O5RA 2JT1A 3R61A 4YFXF 5H20A 1BR1A 2GXAA 2CW8A 4ZC3A 1S7OA 4ABZA 3E0JB 4NUBA 2JRMA 5HVQC 3GCMA 4WCGA 4HLYA 4IPAA 3IWFA 1JGSA 4AIDA 1XGMA 2B0LA 4EJWA 2MSYA 3S1NJ 4JOMA 2PQ8A 5IOYA 1P7JA 1I1GA 1VQNI 4GGGA 1RETA 3KP6A 3M8FA 5CQEA 2BW3B 5EG0A 5E1XA 3J7AO 3S1QJ 1PP7U 2XVCA 2E34A 3JRIA 5E3LA 1XTAA 3DU5A 3CZ6A 1MJAA 1W1WE 3OOPA 4WK8F 2RDPA 1G2HA 2A5YB 3SYTA 5KAFC 2E1NA 5BOXA 3PO2J 2M9HA 3OYAA 5GPCA 3WU2C 4G6QA 1OCTC 2EZKA 4MQ9F 1TW2A 3VODA 3TW6A 4C2MJ
chains in the Genus database with same CATH topology
3PL8A 4KJZA 4X0GA 1OLTA 3OL4A 4C9YA 3IAM2 3L2WA 2JA2A 2MYSA 3CF2A 3PNTA 3S93A 3C2GA 3LSIA 4XL9A 4B3XA 3MMYB 2MFZA 2LBFB 2Z1DA 3LL7A 4RLFA 3LSMA 4XONA 4HSTA 4NC8A 2M3AA 2M7BA 3AFHA 3DTIA 3BLYA 3AKZA 4XMYA 2R7VA 1YX5A 4LITA 4RM2A 2A5WA 2LOOA 3K6GA 4MLOA 5LFAA 4XOTA 1KONA 3DTEA 1G8XA 2FUG2 2HDWA 3S32A 2K3PA 3OYBA 3OYNA 1V5GA 2VQHA 2HPIA 4XLEA 4LG3A 3OOUA 2WY8Q 2R7QA 3H9QA 4B43A 4KT6A 5CQGA 2IS4A 2WAQA 5LD2C 2DOAA 1BOBA 3FHNA 4DBQA 2PMZA 3MD2A 4XR6A 4CUGA 3BC8A 4E7LA 3KEYA 3W3CA 2X6XA 3DLAA 4ZTFA 3OL3A 2KHMA 1VZ0A 3K4LA 2ZXIA 2CS3A 1NG6A 3OS0A 2WAFA 4CA0A 3OYHA 2CUZA 4BS9A 3LMMA 4BQOA 5CKTA 3MKWB 4IZZA 4ANJA 2VXDA 4II2A 4ZDLA 2W4SA 3K4CA 2PJRA 1WJDA 3CJRB 3EUKL 4CCKA 2VKDA 4PJLA 2BW3A 2LYCA 1D1BA 2W00A 3VYTB 2UV1A 2CUJA 3DPUA 1UELB 3OMYA 4E7SA 3DEEA 2KQRA 2MD0A 4IX7A 4J00A 1SFKA 2Q1ZB 2KP6A 2OV7A 4ZDOA 3RQ4A 1PJRA 2LREA 2E1MC 3D5RC 3K70C 3FKJA 4CSWA 3DPLC 4BE1A 1Y56A 4HRIA 2BVLA 4E7ZA 2LRDA 4DJAA 2X1DA 1DGRM 3A4CA 4LIVA 2M4GA 2HVRA 4II3A 4JQFA 4DIQA 1X1CA 3N05A 4XLHA 1T95A 2V4JC 3QYFA 1ZELA 2LBFA 3ZQQA 2MABA 2R7SA 3HOSA 2DT6A 3K70D 1YE9A 3PJRA 4J01A 2XDVA 3AL0B 4RMNA 4D1QA 4R79A 3HPGA 3KX2A 1WJFA 2ZXHA 4B48A 1D0YA 2RREA 4PSXA 2GOMA 2Q2EB 1Z7LA 3M8JA 1X4PA 4F93B 3K4MA 3VYUB 3TMOA 3HG9A 4D9JA 4CCJA 4E7KA 4QPOA 3SEQA 3H5AA 4P5OA 2K9LA 2IS1A 2UWMA 2GOXB 3QYEA 1PYVA 4F91B 4BE0A 3DTKA 1MMDA 2DXIA 4AVZA 2W1OA 2CMPA 2HNHA 2LG4A 2VJ4A 4C30A 3K4JA 1WJAA 4XQFA 4E7HA 1Y6IA 1MNEA 2LY1A 4RLQA 4B47A 4NQWB 2AQEA 2R4GA 2ZFUA 2RQQA 3VYRB 4BEHB 1E0EA 4HPQA 1MMNA 2L9NA 3V42A 1UG0A 4CCNA 3D5SC 4N4OB 3OYCA 4PJNA 4C2UA 2E1MB 1BR4A 3PNYA 2F5VA 3HPHA 4NNJA 1MMAA 1WJEA 2CV1A 4P1WA 4BACA 4B44A 1BR2A 2LC2A 3OYJA 2VPLA 2ZSHB 2V1NA 2IS6A 4ITVA 4BU2A 4BJ6C 4HNTA 3OYGA 4C2TA 2E5NA 2E60A 3BG7A 2VQGA 2Y0SA 4BE2A 2F4IA 2JUGA 3L2RA 3AL0C 3C2HA 3E1SA 3CESA 4Y3OA 4E6KG 4CCOA 2IS2A 3K4NA 3U21A 1TZLA 2P0WA 4E4HA 1DGWY 2L2OA 3RTRA 2A6TA 2X6YA 4XKCA 1QHHD 4F92B 2ELJA 3H9JA 4OAZA 3L2UA 1D1CA 1MNDA 2NOJB 2L7KA 3RPUD 2VQCA 4XOPA 4LIUA 2V26A 2HVQA 3BG6A 1GLNA 2XC7A 2VJ5A 2W82A 1LDKB 2V6EA 3H9GA 4XLCA 1V5EA 3DKYA 3HXLA 4FASD 1D0ZA 2KZVA 1FMWA 2HPMA 4PUSA 4EATA 3VSKA 3OIPA 1JI8A 4E7JA 2VJIA 2ZSIB 3S3MA 5FROA 2VIXA 1LFPA 5HNHA 2BVMA 2M0MA 4RM3A 3H0DA 4XORA 3L2VA 2RNGA 4IQ4A 2DT7B 4CH7A 4BJTA 2HVSA 2IGMA 3S3OA 3CP2A 2VKHA 1NG7A 2IXSA 1Z21A 2WBMA 3CMMA 1ERDA 2HQAA 3HC7A 3PSFA 1SAUA 3EPZA 2X1CA 1IRXA 4BEHA 5TGTA 2XSJC 3OYDA 1X1DA 2XF5A 3UR3C 3OS2A 3OWTA 1FMVA 3VSLA 4BQQA 3ZXSA 3UNGC 3PSIA 1X1BA 4XN3A 1Z3XA 3OYMA 1WFXA 4XLFA 3D5LA 4ZJZA 1YX3A 3DU6A 2WB1A 4ZTJA 5KHDA 2WA0A 4XKWA 3OYKA 3CJQB 2DJIA 2KL4A 2XF7A 1D0XA 1QHGA 4CCMA 3I3LA 4HEA2 2AQFA 2VXZA 3K4BA 2M7AA 3A2KA 1X19A 1WJCA 4PFOA 4BDZA 2L5QA 3BCBA 1G59A 3EUAA 2IGNA 3LSGA 1X1AA 2E5ZA 2OC6A 3QOEA 1W36C 3S8PA 1TT0A 4XN0A 2VQLA 4PJJA 3OYIA 3ZRGA 4XLAA 1DQUA 1QU3A 2M4KA 3GBGA 3LSHA 4XNFA 3L2QA 2HU9A 5HNFA 2WADA 1N77A 4U7BA 1D1AA 1S9HA 1MW7A 4IQJA 3DKXA 3SZGA 4Y33A 2UUZA 2DCEA 4U87A 1W36D 2R7UA 3OYFA 4BL0B 2CH0A 4YEJA 1V5FA 3HUGB 2R7WA 4XKVA 3PFYA 4YELA 4KITB 3ZR8X 3W2AA 3OYLA 4CCLA 2X1EA 2VASA 4F3QA 2QKLB 2KDOA 4HNUA 4BDYA 2JSPA 3DPTA 3H5RA 1X4OA 4ZDPA 3SDBA 4DOZA 1J09A 3OYEA 5FRNA 3FDYA 4Y4RA 2LY2A 1N75A 1Z3YA 4OAYA 3FBNB 1AA7A 5JHFA 1R6RA 3S3NA 1K6YA 2WAEA 2X51A 4XM3A 4N4NB 3BCAA 2Z2SB 4HG2A 3FBIB 3OIQA 3H5NA 3IAS2 3HL2A 4DGWB 3PNVA 2KRHA 3HOTA 4HSRA 4PSWA 4PJMA 3ONQA 2K9MA 3KYLA 3K4KA 2LH9A 3HKZA 5FRMA 3TBIA 1UAAA 3MKZA 4H4KC 4F52A 3J7AY 4XKBA 2R7XA 4F55A 3VWBA 1HA8A 2XF6A 3ZGKA 2JVGA 3K10A 1WJ5A 4ZYAA 3EUHC 4DBRA 3LFUA 2I8DA 3SEZA 4BXFA 2CFOA 5KCMA 4PFPA 5HLTA 2QKMB 3A1YA 4KISA 4E7IA 3MKYB 3RSNA 2IGKA 3H35A 3G2BA 2V7FA 2HZDA 2R7TA 5HOOA 2R7OA 1T0FC 2XAUA 3OS1A 3LSKA 4AYBA 3RCOA 1N78A 2JVHA 1LVKA 2X85A 2CV2A 4BJ5C 2KPMA 1WJBA 2CW7A 2K5CA 2WY7Q 3NWTA 4BQNA 2V9KA 3DWLE 2CV0A 1LKXA 1OR7C 3M1CA 4BUPA 3F9KA 3PUBA 3OR1C 5CPRB 2KLOA 2VB6A 1U0JA 3DQVC 4G6TB 2O5RA 2VL8A 1BR1A 3NWSA 2CW8A 4ZC3A 3E0JB 4NUBA 3IP4B 1EA3A 2MC4A 5KNLA 2W7NA 2Z16A 3QYBA 5HVQC 2IGOA 2L9SA 2X6WA 3VYSB 2KRCA 4PK4A 2OUMA 3ZCOA 3QODA 3W2VA 3TL4X 4JOMA 3CP8A 4QPQA 4YRVA 3OR2C 2PJRB 3IUOA 4OWRB 2KMUA 2VJJA 5CQEA 2BW3B 4NC7A 4IKFA 4BGDA 2R7RA 4CZCA 3DU5A 3VDXA 3CZ6A 3OY9A 2VLAA 1MMGA 4FETA 3SYTA 2BOLA 2F6CA 3I9V2 3W2WA 3OYAA 1DP3A 4AU7A 4GRIA 1P9QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9S A; 
#chains in the Genus database with same CATH topology
 1RR8 C;  2JMW A;  3G1L A;  3PL8 A;  5FB2 A;  3HBL A;  4C9Y A;  3L2W A;  3FF5 A;  3S93 A;  3CF2 A;  1JUS A;  1H8A C;  4GCV A;  3KP3 A;  2ZJP F;  1S72 I;  3ZQ7 A;  4D5F A;  4L0Z B;  1HW5 A;  5BPI A;  5K7Z A;  4XON A;  2R7D A;  3TDZ C;  4ESF A;  2OF7 A;  2DPU A;  3CUO A;  2M3A A;  3AFH A;  2R7V A;  2UXX A;  4NDL A;  5M5X J;  4PJ0 C;  1B6A A;  5H6R A;  3K6G A;  5LFA A;  2QEX I;  1KON A;  3DTE A;  3BP8 A;  3LA7 A;  5BQT A;  3OYN A;  1RI7 A;  2HPI A;  2PMZ N;  2UXN A;  4ZYG A;  1ETY A;  2R7Q A;  3H9Q A;  4KT6 A;  2WAQ A;  5K7H A;  2ESH A;  5DCM A;  4DBQ A;  2DTR A;  3I54 A;  1QVT A;  2PMZ A;  3CUQ C;  2ME6 A;  1JKR C;  4L9T A;  1ETX A;  4YFN F;  1A5J A;  1ZR4 A;  1ENH A;  3MEX A;  2XRO A;  1IG7 A;  1W5T A;  1X3W B;  4ZTF A;  1TWF J;  5EZH A;  2IBD A;  2VN2 A;  3C2B A;  4U0W A;  5E3N A;  1B9N A;  2CQ7 A;  4PZJ A;  1NH3 A;  2CUZ A;  5L3G A;  3A02 A;  1MJB A;  4BQO A;  5CKT A;  1ZQ3 P;  2DMQ A;  5FGM A;  4L5E A;  3GTO J;  4M9S A;  3HOV J;  1WJD A;  3COA C;  1VQ9 I;  2JA7 J;  4PJL A;  1WWX A;  4W97 A;  2BW3 A;  3QWL A;  2LYC A;  1R71 A;  1U3E M;  1BIB A;  4D5C A;  3WTT C;  4E7S A;  3MN2 A;  3DEE A;  2KQR A;  1IO2 A;  1FSE A;  3VB2 A;  1JKO C;  4ZZL A;  1OQY A;  2VC1 A;  1SFO J;  4MTD A;  1T39 A;  4ZDO A;  4U0Y A;  2LRE A;  3K70 C;  3S1R J;  2VE9 A;  3FKJ A;  1WH7 A;  4BE1 A;  1G3S A;  4FQG A;  4HRI A;  2BHY A;  4ON0 A;  4DJA A;  2STW A;  5JR3 A;  1FBU A;  1ULY A;  2M4G A;  3Q9S A;  5FKO A;  5FLX Z;  4Y15 A;  4II3 A;  2FQ3 A;  2HYG D;  5BNG A;  5J4Y A;  3G73 A;  1FTZ A;  2COB A;  2L9V A;  1KQ0 A;  3F6O A;  1MDM B;  4EM2 A;  5DS9 A;  4JX5 A;  2IA1 A;  2PMH A;  2QQA A;  4UNO A;  4Q48 A;  2DMN A;  1Z7U A;  2TRT A;  2OJE D;  1ZG1 A;  1TWH J;  1TW3 A;  4BYY A;  4RMN A;  2D45 A;  1XDU A;  3HEF A;  2ZXH A;  3CUQ B;  5LHG A;  2RRE A;  1Y1V J;  3L09 A;  2GOM A;  5H2F C;  4FX4 A;  2FJ1 A;  1VQL I;  2HOS A;  3VYU B;  4A93 J;  3E6C C;  3JR9 A;  2L02 A;  3V8J A;  1OFC X;  2KRF A;  2RGV A;  3D1N I;  2QUF A;  4KIF A;  3RQI A;  3SEQ A;  3H5A A;  1PYV A;  4OIP F;  1EH6 A;  3DTK A;  4AVZ A;  2O61 A;  2XAH A;  5HDK A;  2CMP A;  3GTG J;  2VJ4 A;  5CJ9 A;  1U8R A;  1WJA A;  5FFZ A;  1IV8 A;  2OQR A;  1WSU A;  1MNE A;  2LY1 A;  1OKR A;  4NQW B;  1AHD P;  4LGW A;  4U7D A;  2RQQ A;  2HXI A;  3D0S A;  1JUP A;  3TW7 A;  4FE4 A;  4BEH B;  1E0E A;  3V42 A;  3PIO F;  4G7H F;  2A61 A;  1SD6 A;  1TWG J;  1ZRC A;  1JTX A;  5IP6 A;  2A6H F;  4XSX F;  1N25 A;  1BC8 C;  2JJ7 A;  2QSG X;  2OQG A;  3R6S A;  1MMA A;  5KK1 A;  1EH7 A;  4HZF A;  4P1W A;  5L3C A;  3TO9 A;  1BR2 A;  1JHH A;  2LC2 A;  2LSO A;  3OYJ A;  2PFB A;  2ZSH B;  2LK2 A;  4TV7 A;  2IS6 A;  3SZT A;  5ILS A;  2K9S A;  3K69 A;  3WGI A;  4AC0 A;  1QO0 D;  1I5Z A;  3OYG A;  4C2T A;  2E5N A;  3GEZ A;  5EYR A;  4BE2 A;  2EIK H;  1ZYR F;  3G1O A;  2H27 A;  5EEG A;  3TP0 A;  4MQV A;  4CCO A;  4HNV A;  1YJW I;  3LSJ A;  1MDM A;  4OIO F;  1JHF A;  3IL2 A;  1ZG5 A;  1F5T A;  1YOV B;  2FBI A;  1ZKG A;  4UB6 C;  3WG9 A;  1GUU A;  2FU4 A;  2NOJ B;  1IN4 A;  1J75 A;  2RC4 A;  3BG6 A;  1GLN A;  4LLL A;  4B3A A;  3CME I;  2VJ5 A;  3L1P A;  5LBQ A;  3CUQ A;  1ITY A;  2R92 J;  4XLC A;  1MJ9 A;  2HEO A;  1D0Z A;  2GA1 A;  4FTH A;  2KZV A;  3R4K A;  3OIP A;  1O7F A;  2AXT C;  1JE8 A;  3MCZ A;  1LFP A;  5HNH A;  3F8B A;  4OIR F;  1VQ4 I;  2M0M A;  1OPC A;  5C3E J;  2WC2 A;  2O3F A;  2XB5 A;  4H0E A;  3KEQ A;  3W6J B;  4CH7 A;  1MH3 A;  3TGN A;  1YHQ I;  4BH9 A;  2I10 A;  5D5X B;  1IC8 A;  1NG7 A;  2IXS A;  1Z21 A;  3CMM A;  3F72 A;  4L0Y B;  2HXO A;  3HDD A;  2HQA A;  3DF8 A;  4NQW A;  1XS9 A;  3EQL F;  2CFX A;  2CRG A;  3GZ6 A;  1LQ1 A;  1ZRE A;  3FK6 A;  3HC7 A;  1FYM A;  2JQ7 A;  2PI0 A;  4XBF A;  5H6Q A;  4DW6 A;  4XRM A;  4BEH A;  2HQR A;  4HYE A;  5TGT A;  3ZP5 A;  2YSR A;  3UR3 C;  1ETW A;  3IH4 A;  4O3M A;  1J5Y A;  2FSW A;  1SD5 A;  2EK5 A;  3OWT A;  4C3J J;  3WTS C;  3BPX A;  1P92 A;  3S14 J;  2Q0O A;  4L9V A;  1I3Q J;  4RAZ A;  4N9H A;  3BTJ A;  5J1U A;  4BNC A;  3OYM A;  4GXO A;  1YX3 A;  3BR1 A;  4OIN F;  3FM3 A;  4ZTJ A;  1IRG A;  3G71 I;  5F1R A;  3L9F A;  2OPT A;  2Y30 A;  3NAU A;  3OYK A;  3CJQ B;  2DJI A;  3C18 A;  4HQM A;  4KN4 X;  3N4M A;  2M5W A;  3KPH A;  1BJA A;  2CQQ A;  4HEA 2;  3FXM A;  1QZZ A;  3BG5 A;  2R5Y B;  1BI3 A;  2CJJ A;  3A2K A;  1X19 A;  3CLQ A;  1WJC A;  3ZMS A;  1S8N A;  2EFN A;  3JRH A;  1SVL A;  1XMK A;  1XSX A;  2OA4 A;  3EUA A;  5D8L B;  2DTZ A;  1WHU A;  2K4B A;  5BPD A;  2DPD A;  4LJZ F;  4XN0 A;  2J5O A;  2EH3 A;  2EIJ H;  4HX7 A;  1TC3 C;  3CJT B;  5D5V B;  5J47 A;  4XLA A;  1HOM A;  2O6G E;  3W6V A;  3GBG A;  2NRA C;  1RRJ A;  2IA2 A;  4HW0 A;  5HNF A;  4W1U A;  1WVR A;  1D1A A;  3ZMZ A;  5FJ8 J;  4IQJ A;  5A2Q K;  4CYC B;  1AKH B;  2P5V A;  4IOC F;  1W36 D;  2L4A A;  2XGC A;  5D4R A;  1YLF A;  2R0Q C;  2DK8 A;  2R7W A;  4XKV A;  3PFI A;  4GYG A;  3S17 J;  3GFJ A;  5CVJ A;  3OYL A;  3T5X A;  2X1E A;  1HDP A;  2VAS A;  4F3Q A;  3J7Z I;  2JWT A;  4HNU A;  4ZDP A;  2Y75 A;  3JW4 A;  3A01 A;  1KU2 A;  5FRN A;  1YW9 A;  1HW2 A;  3GTM J;  3HSF A;  2ZME C;  1ZRF A;  1SVO A;  4ASN A;  3FBN B;  1AA7 A;  5ILU A;  2RN7 A;  5DCF A;  1X1P A;  4GFB A;  2X51 A;  1JKP C;  3FHZ A;  4A3L J;  3BTL A;  3FBI B;  1XN7 A;  3H5N A;  2JA5 J;  4M73 A;  2LKX A;  1GT0 C;  2F4O B;  2M30 A;  1ZLJ A;  2NS8 A;  4I99 C;  2H09 A;  1W0T A;  5FRM A;  1D5Y A;  1E3H A;  3TBI A;  4G8X A;  4FCY A;  1U78 A;  4F52 A;  2VKV A;  3GTL J;  2R7X A;  1OYI A;  4F55 A;  1HA8 A;  3ZMU A;  2ZB9 A;  4M3D A;  4M6V A;  1T08 B;  2P4W A;  2UZK A;  2VBW A;  3U2R A;  1BA5 A;  2I8D A;  3BZK A;  2R5Y A;  2CFO A;  4NBQ A;  3IH2 A;  3AAF A;  3PO3 J;  1Z9C A;  1G4D A;  3GME A;  1SD7 A;  2ISY A;  4PFP A;  1MBJ A;  4V2F A;  3CC2 I;  3M3Y J;  4KIS A;  2M87 A;  3RKX A;  3MKY B;  2IGK A;  2OCE A;  1DU6 A;  5JHU A;  2R7T A;  1T0F C;  5HS9 A;  4RS8 A;  5TJJ A;  4A3E J;  2H1K A;  4HF1 A;  3HRS A;  2L01 A;  1N78 A;  3JSO A;  1H9T A;  2A05 A;  3K1N A;  2XIG A;  3BQZ A;  4UV9 A;  3ERM A;  4MFD A;  1IUY A;  4FIS A;  2IP2 A;  4BJ5 C;  3Q3S A;  3M1E A;  1AKH A;  1E2X A;  2W84 A;  3SDG A;  2FML A;  2CV0 A;  4C3H J;  3M1C A;  1WKM A;  5CPR B;  3OR1 C;  2VBX A;  2KLO A;  2VB6 A;  1CQT A;  3FMR A;  2VL8 A;  1R36 A;  3NWS A;  2X0L A;  2KJB A;  5AIQ A;  1BN5 A;  3CJN A;  5DTD A;  2HKX A;  1EA3 A;  4I76 A;  5KVR A;  2IGO A;  4YIF A;  2G9W A;  2DA4 A;  4R8H A;  2X6W A;  4D7N A;  2IA0 A;  2OUM A;  4IRH A;  2LKS A;  3WTV C;  1QZE A;  2FOK A;  1RUN A;  1ZGW A;  2FQ4 A;  3CCM I;  4QPQ A;  2P7V B;  3OR2 C;  1VQM I;  2PJR B;  3AG4 H;  4LD5 A;  4MO7 A;  2GIV A;  2KMU A;  3I53 A;  3CCR I;  2VJJ A;  4BGD A;  1G3Y A;  5EZG A;  1ZGJ A;  4HF2 A;  3QP6 A;  2ISZ A;  1Z77 A;  4WWC A;  4N9I A;  3DXJ F;  4A0X A;  9ANT A;  3KZI C;  2JA8 J;  2F6C A;  1Z6T A;  1BBY A;  4WXD A;  1WQ2 A;  2DA2 A;  4GRI A;  5FD5 A;  3ZQI A;  3HRU A;  4A3J J;  1D8K A;  2MW8 A;  3P7N A;  4RGS A;  5M3M J;  2A69 F;  2XV4 S;  1HXD A;  4X0G A;  2KJC A;  3OL4 A;  2ZCW A;  3PNT A;  1BI0 A;  4B3X A;  2EBI A;  3LSI A;  1I6H J;  1K6O A;  2Y9Z A;  3I4M J;  2QZ8 A;  2LBF B;  3FMQ A;  5F6F A;  2Z1D A;  1EJ9 A;  1MD0 A;  3A03 A;  3KZY A;  4I6Z A;  2OTJ I;  4HST A;  1P4X A;  4NC8 A;  1ACI A;  3I59 B;  2M7B A;  3DTI A;  3BLY A;  3IKV A;  5DEQ A;  5LGU A;  2LFB A;  2COM A;  3P9I A;  1Y0N A;  1YS6 A;  2EA4 A;  3O3K A;  1G8X A;  2FUG 2;  2HDW A;  3WTX C;  3EDP A;  3OYB A;  4WX9 A;  4XLE A;  4LG3 A;  4M3G A;  3T8T A;  2BXZ A;  2ZME A;  2AS5 F;  2IT0 A;  5B3S H;  1RES A;  5CQG A;  1O3R A;  1H0M A;  3RPQ A;  4EEF G;  3MD2 A;  2ADU A;  1GHC A;  4Z6Y A;  2GBY A;  2HQN A;  3BC8 A;  4ENN A;  1SMY F;  3DLA A;  2HOA A;  3NRV A;  3OL3 A;  2L9R A;  1VZ0 A;  3K4L A;  2CS3 A;  2O0Y A;  4M3B A;  2JRT A;  5E79 C;  2QA4 I;  3OYH A;  2XAS A;  4BS9 A;  3GTP J;  2EZH A;  3LMM A;  1ZHF A;  4C3I J;  2K40 A;  3ZQH A;  4IZZ A;  4P9U A;  4II2 A;  3BQY A;  3K4C A;  2PJR A;  2MD5 A;  4ZYH A;  3TKY A;  3CJR B;  2LD5 A;  3EUK L;  3CDI A;  5IYB J;  1QRY A;  2GAU A;  5LRS A;  3VEP A;  1D1B A;  1R1T A;  1S6L A;  3M07 A;  1K79 A;  1FPQ A;  2VE8 A;  2W57 A;  5GAH J;  5J6X A;  1O3Q A;  2MD0 A;  1Y8R B;  3RZO J;  2EZL A;  1W5C C;  3LWF A;  2DI3 A;  5CVV A;  3CTA A;  3FM5 A;  5HLG A;  1T0F A;  5E3M A;  3RQ4 A;  2DYR H;  3D5R C;  3EYY A;  5FKK A;  1XC5 A;  4CSW A;  4G7Z F;  1GXP A;  3DPL C;  5TIS C;  2LP0 A;  3GFL A;  4RA2 A;  3FMS A;  4Q47 A;  2R5Z B;  3E6B A;  3V7S A;  1HQC A;  1VND A;  3GX4 X;  1MBF A;  3VPR A;  1TNT A;  2HVR A;  2A3S A;  2EQR A;  4JQF A;  4A0Y A;  1HKS A;  4DIQ A;  2DBB A;  2VBZ A;  2F5C A;  3NEU A;  1T95 A;  4AIJ A;  2XKO A;  1ZEL A;  2LBF A;  2ID6 A;  2R7S A;  2DT6 A;  3O8H A;  3K70 D;  1IAW A;  3BJA A;  3I59 A;  4JYK A;  1VFC A;  3ECH A;  1B4A A;  2TCT A;  3PJR A;  1UG2 A;  4J01 A;  4QLC U;  1KQ9 A;  3AL0 B;  3WTW C;  1ZN2 A;  2ZNZ A;  1D0Y A;  3LA2 A;  1IF1 A;  4D0P A;  2NXN B;  2DOE A;  1Z7L A;  3AG2 H;  3PM1 A;  2F4M B;  2GQQ A;  4OIQ F;  2K4J A;  3S2H J;  4BXX J;  2EIN H;  3HG9 A;  3E7L A;  2JTV A;  1YJ9 I;  4CCJ A;  1QGP A;  1BI1 A;  4QPO A;  3K1P A;  4BHP A;  1YIJ I;  4P5O A;  2K9L A;  4QIW N;  3QYE A;  4HA8 A;  4Y7N J;  3GFM A;  2XGD A;  2LG4 A;  1XGN A;  2E7X A;  4DNC A;  1OCZ H;  3QAH A;  3K4J A;  2IRF G;  4RLQ A;  2AQE A;  1XMX A;  2DQR A;  1MMN A;  2L9N A;  5C4X J;  4O5V A;  4RGX A;  4K2E A;  2F5E A;  1G6N A;  5FFX A;  4YG2 F;  5FD6 A;  1BR4 A;  1L0O C;  2IVM A;  2F5V A;  4EGZ A;  1FOY A;  1Q1H A;  4NNJ A;  3WGH A;  4V19 K;  2GM4 A;  5HLI A;  4ENJ A;  4ENK A;  3GWZ A;  1MSE C;  1DDN A;  1ZLK A;  3T8R A;  3G3Z A;  2B9S A;  3KEO A;  4ITV A;  1OCC H;  1QBJ A;  2LLK A;  2W85 A;  3WTY C;  4AUX A;  2V9P A;  3GTJ J;  3A0B C;  3BG7 A;  2YX7 A;  3HZJ A;  1XCV A;  3H36 A;  5BS6 A;  1W7P A;  4IHV A;  1FOX A;  3K1M A;  3Q0U A;  3BJ6 A;  2R5Z A;  2ETH A;  2F4I A;  3L2R A;  1IN7 A;  2XPV A;  5K7F A;  4Y3O A;  2IS2 A;  1EKE A;  1UJ8 A;  1IGN A;  4AIH A;  1DGW Y;  3GFI A;  4XKC A;  4XK4 A;  5CLS A;  3CMY A;  1MND A;  1YW8 A;  1QPM A;  5B5E C;  2Z9O A;  5CVR A;  2DK5 A;  3J80 K;  3ZQC A;  1LDK B;  3FXJ A;  4IEJ A;  2PX9 A;  2V6E A;  3KE2 A;  3H9G A;  2LMD A;  1V5E A;  3CCV I;  1UB9 A;  2DT5 A;  3DBL B;  1FMW A;  2QWW A;  2HPM A;  1OYW A;  4PUS A;  1E3P A;  1RIO H;  3VSK A;  1RNL A;  2VI6 A;  1JI8 A;  1GV5 A;  2QSF X;  4E7J A;  1Y1W J;  3LSR A;  3F8N A;  4WXC A;  5FRO A;  3DP7 A;  3S3M A;  2ZXJ A;  3HGG A;  1G3T A;  1H88 C;  1IXS B;  3H0D A;  3M4O J;  4XOR A;  5DUK A;  2JSC A;  4IQ4 A;  2QQ8 A;  2DT7 B;  4I0A A;  1ORK A;  4HBL A;  2HVS A;  3LAJ A;  2VUM J;  3TQN A;  3CP2 A;  5M3F J;  2E35 A;  3WOD F;  1ERD A;  4LLG F;  4LG0 B;  3H0G J;  3HSR A;  2NNY A;  1R9T J;  3ZPL A;  1SAU A;  2YS9 A;  1U6G A;  1TQM A;  2X1C A;  3EPZ A;  1DP7 P;  1C0W A;  3HOZ J;  1UFM A;  1LFB A;  1HCR A;  3S2D J;  2R7F A;  5L3F A;  1OYY A;  1DU0 A;  3G1M A;  3OS2 A;  2ZNY A;  2E2J J;  4A2U A;  3WGG A;  3F8C A;  3B73 A;  1I39 A;  3KET A;  2HOE A;  5D6E A;  1Z67 A;  1V4R A;  5BMZ A;  3IH3 A;  3LST A;  2PEX A;  1R4M B;  2KIS A;  2CQN A;  3DEW A;  4HV6 A;  2F5D A;  5E8G A;  5HS8 A;  1FT9 A;  5KHD A;  2WA0 A;  2KL4 A;  2WV1 A;  4HAM A;  1QHG A;  3BDD A;  4CCM A;  3PQK A;  1A6I A;  5IYC J;  3I3L A;  5HOD A;  2VXZ A;  5EEA A;  1FP1 D;  2Y2Z A;  4PGG A;  1MBH A;  2M7A A;  2QBY B;  4G6D A;  4Y13 A;  5IP9 J;  1T38 A;  1HST A;  5ICE A;  2HR3 A;  4PFO A;  3I56 I;  4BDZ A;  2BY0 A;  1SD4 A;  1XB4 A;  2L5Q A;  4EQQ A;  5E18 F;  3BCB A;  1XMA A;  1S5L C;  3QOE A;  3S8P A;  4ZYD A;  3ABL H;  2TDX A;  4PJJ A;  1XGO A;  3ZRG A;  1W4M A;  1DQU A;  1QU3 A;  1O3T A;  3WG7 H;  1WZ2 A;  2ZJQ F;  4AIK A;  3F8F A;  4U7B A;  3RI4 A;  3I4P A;  5ICG A;  1A35 A;  1MW7 A;  1QQI A;  2DFH A;  3HM5 A;  3SZG A;  4IOA F;  4Y33 A;  2R7U A;  2M8G X;  3GLX A;  4BL0 B;  4EVI A;  2CH0 A;  4LB5 A;  3BRO A;  3PFY A;  3SHF A;  3ZR8 X;  3CCE I;  4CCL A;  1WPK A;  2QKL B;  1XPX A;  1M1E B;  4BDY A;  2JSP A;  3DPT A;  1FTT A;  1X4O A;  3ZMV A;  1N75 A;  1Z3Y A;  2B7E A;  4LG0 A;  2MLK A;  1ETV A;  4KNY A;  2IAI A;  5IPA A;  4B1R A;  2WAE A;  4XM3 A;  2RVC A;  2Z2S B;  3CO6 C;  2A07 F;  2ZXW H;  3OIQ A;  1UST A;  1IRF A;  3IAS 2;  4DGW B;  3HL2 A;  3PNV A;  3AG3 H;  3E3V A;  3ZQL A;  2FX0 A;  2V79 A;  3HOT A;  3KP2 A;  2GA2 A;  4PSW A;  1J7K A;  1E3O C;  1RR7 A;  1JKQ C;  2HGC A;  1QZY A;  1S7E A;  3KFW X;  4KMU X;  3KIO A;  1F43 A;  4LB6 B;  1R1V A;  4AD9 A;  5B1A H;  5D5U B;  2YU3 A;  2FBK A;  4XKB A;  1XD7 A;  4UVB A;  4XRS G;  2H6B A;  2XF6 A;  1K78 B;  1QVU A;  1BJZ A;  3K10 A;  2D1V A;  1ZR2 A;  4ZYA A;  2MGQ A;  4JBA A;  3ZN0 A;  2DLL A;  1R5I D;  6PAX A;  3MFK A;  3FXU A;  5M5Y J;  4EM0 B;  2L7M P;  4JP0 A;  2EFQ A;  2M2E A;  4GDF A;  3RSN A;  3H35 A;  2HZD A;  5EGO B;  3JAM Z;  2R7O A;  2XAU A;  4ESJ A;  3CQZ J;  3CCU I;  1FBS A;  3B6C A;  1P4W A;  1OCR H;  3K2A A;  3QU6 A;  3QPT A;  2OU2 A;  2P6S A;  2ZC2 A;  2X85 A;  1PDN C;  2CV2 A;  3L7W A;  4BBS J;  4N0B A;  2K02 A;  3I0T A;  1ETK A;  1TWC J;  2FE3 A;  3FIW A;  1SFU A;  2BXY A;  4KIG A;  3TO6 A;  1VQ6 I;  2C6Y A;  4RDU A;  3F23 A;  2ZKZ A;  2PG4 A;  3BT9 A;  4EJV A;  3KP5 A;  2W48 A;  2R93 J;  3MZY A;  3DQV C;  2K86 A;  4A3M J;  2JA6 J;  4RGU A;  2Z33 A;  4M9X A;  3TOA A;  3HRT A;  1RKT A;  1ZRD A;  2OZ6 A;  3BR5 A;  5E20 A;  2MC4 A;  4XIC A;  2W7N A;  2Z16 A;  3QYB A;  1K61 A;  2L9S A;  4L5I A;  1O3S A;  1VTN C;  3VYS B;  4L18 B;  1B9M A;  2A68 F;  2KRC A;  3F6V A;  1QPI A;  4PK4 A;  3ZCO A;  1FP2 A;  3QOD A;  1UMQ A;  4UUV A;  3Q9V A;  4LLN A;  3CP8 A;  4YRV A;  1IXR C;  2H6C A;  4I01 A;  5J1R A;  3IUO A;  1FX7 A;  2O03 A;  1T8I A;  3ML6 A;  1IV6 A;  2KT0 A;  2KIM A;  2ME0 A;  2R7R A;  2V1X A;  1PUF B;  4A3D J;  2HFH A;  4IL6 C;  1ONV A;  5ICF A;  3OY9 A;  1MMG A;  5IT9 K;  2DDB A;  1TL8 A;  1YIO A;  1K78 A;  3W2W A;  3HOY J;  3M7G A;  2OBP A;  4Y52 J;  2ZO4 A;  5D8K B;  1FIP A;  1S29 A;  4AU7 A;  3ERE D;  1PP8 F;  1P9Q C;  4R1H A;  2MC3 A;  1HBX G;  1A36 A;  4KJZ A;  1OLT A;  4FX0 A;  2V1D A;  1I27 A;  2JA2 A;  2X6O A;  4XL9 A;  3MMY B;  5EGO A;  2MFZ A;  1XCB A;  2ZFW A;  2FEZ A;  2VT3 A;  2CUF A;  3C7J A;  1MBG A;  2OCC H;  2EJR A;  1GVD A;  2JN6 A;  5B66 C;  4P55 A;  3GUD A;  4XMY A;  1YX5 A;  3NQO A;  3QOP A;  3SXY A;  3RDI A;  3GYH X;  2BE5 F;  2A5W A;  2LOO A;  4MHG A;  3IHU A;  4XOT A;  2FRH A;  2K3P A;  3HGY A;  1V5G A;  3WE2 A;  5F27 A;  3ZQG A;  2WY8 Q;  1W7P D;  3GO5 A;  4P9F A;  4B43 A;  5C44 J;  2CQX A;  4CDG A;  1HW1 A;  2IS4 A;  5LD2 C;  2DOA A;  1YYV A;  3CDL A;  1BOB A;  3FHN A;  2HWV A;  4PGH A;  4XRF A;  1JT0 A;  2CW0 F;  2FOW A;  2JK3 A;  2XPW A;  1EV7 A;  3P9C A;  4XR6 A;  4CUG A;  4E7L A;  3U9G A;  2LVS A;  1FEX A;  2X6X A;  2F5F A;  2QCO A;  5L3D A;  1YO5 C;  2E2I J;  3WHB A;  1NG6 A;  4X1E A;  1F36 A;  4M3E A;  5E1W A;  4CA0 A;  5E3O A;  2KKO A;  3A0H C;  4NHJ A;  2ZJR F;  2NS0 A;  3GF2 A;  1ZH5 A;  2VBY A;  4YII A;  4ANJ A;  2VXD A;  3WHC A;  2XSD C;  2W4S A;  1ZTR A;  5EJC A;  3SQN A;  3WE3 A;  1CGP A;  2V9V A;  2BGC A;  3KP7 A;  3TED A;  2D1H A;  1D3Y A;  1PUF A;  2HI3 A;  2Z5U A;  2NAZ A;  3FXO A;  1ZAR A;  3WU1 B;  1VQP I;  1KU3 A;  2CUJ A;  1QNT A;  3E97 A;  3HYI A;  1UEL B;  1NK3 P;  2EFW A;  2CUE A;  4MGR A;  3AG1 H;  1BW6 A;  1IDY A;  1G3W A;  2ELH A;  3FZV A;  2VT2 A;  4CYC A;  1R7J A;  3JRC A;  4I02 A;  5EEH A;  1S7A A;  4BQA A;  1PJR A;  2E1M C;  1Z0X A;  2D2W A;  3E6D A;  2XAF A;  1MIJ A;  3IC7 A;  3ELK A;  3S2W A;  1Y56 A;  1VQK I;  5IY5 H;  2QQ9 A;  2X1D A;  3OV8 A;  1DGR M;  4LIV A;  1A6Q A;  3P9K A;  1F4K A;  3QPS A;  1TQP A;  5DYM A;  1W0U A;  3LA3 A;  5JVT A;  4ESB A;  4XLH A;  3OSG A;  2V4J C;  3QYF A;  1F9N A;  2VPR A;  1IRZ A;  2P8T A;  2WB1 N;  1KU7 A;  2IEK A;  2H8W A;  4M6X A;  1YE9 A;  2BY1 A;  5CVI A;  3GZN B;  1JJ8 C;  3QRF F;  4A69 C;  1UHS A;  1U8B A;  2NVY J;  2BBY A;  1YTY A;  2EA2 A;  5E17 F;  4B48 A;  2DFI A;  1TTY A;  2VOO A;  2DMU A;  1A04 A;  3M8J A;  1YRN B;  2QVO A;  4F93 B;  4FE7 A;  1T33 A;  2H8R A;  3Q0W A;  2P81 A;  1YS7 A;  3BR3 A;  3KYC B;  5DD8 A;  4A3F J;  1TP4 A;  1NTC A;  3RYR A;  4IHT A;  1SC7 A;  1ZGA A;  4F91 B;  2PMU A;  2FNP A;  2HNH A;  4E7H A;  1Y6I A;  2M34 A;  4QWQ A;  4B47 A;  2Y48 A;  4XLP F;  2X48 A;  4IXA A;  3O6B B;  2ZFU A;  1OJL A;  3VYR B;  1P2F A;  2KIU A;  3K2Z A;  3I58 A;  4UVA A;  5JI6 A;  5F04 A;  1R1U A;  5FLX K;  2LDU A;  3PUF A;  5J8C A;  3IKT A;  1X2M A;  2M8E A;  3OYC A;  2BY3 A;  2K85 A;  5DV5 A;  2E1M B;  4G9Y A;  2DA3 A;  1D5V A;  5LRR A;  4G7O F;  1U2W A;  5F0F A;  3HTU A;  1WJE A;  2CV1 A;  4B44 A;  5DM6 F;  2Y0S N;  1L3L A;  1R4N B;  1MH4 A;  1ON1 A;  3QP5 A;  4HNT A;  4M71 A;  5DDG A;  4AM3 A;  3DLL F;  3RKW A;  1TBX A;  4FT8 A;  1X3U A;  3Q0V A;  3DCF A;  3QPH A;  2RNJ A;  3F21 A;  1W5S A;  2Y0S A;  2Z99 A;  5AIP A;  4MEY F;  4NC6 A;  2A6E F;  3K0L A;  2JUG A;  2LNB A;  2EB7 A;  3AL0 C;  2DA7 A;  4E6K G;  2H94 A;  1KU9 A;  3U21 A;  4I0B A;  1GVJ A;  2W25 A;  5F08 A;  2X6Y A;  3CMA I;  1QHH D;  2MLG A;  2ELJ A;  3H9J A;  2G7U A;  3L2U A;  1D1C A;  1YQA A;  2ELK A;  4UUS B;  2L7K A;  1OCP A;  1IJW C;  2VQC A;  4XOP A;  5J4V A;  2V26 A;  1TNS A;  2EIM H;  1YIT I;  2W82 A;  3ZMT A;  2GIZ A;  3DKY A;  3HXL A;  1WI9 A;  4JK1 X;  3ULQ B;  4EAT A;  4CYD A;  1SEU A;  1RZ4 A;  4HDV A;  1ODD A;  4D7M A;  1ZK8 A;  2YX4 A;  2VJI A;  1HC8 A;  1Y39 A;  4BHB A;  2OTL I;  2FF4 A;  4AYB N;  4RM3 A;  3CCL I;  2F48 A;  3FXK A;  4BY7 J;  4BJT A;  2IGM A;  5CYV A;  2CU7 A;  5IYD J;  1YJN I;  2PLY A;  2BEO A;  2WBM A;  1XSD A;  3S1M J;  4XRS A;  1VQ7 I;  3LFK A;  1IRX A;  4CZZ A;  4I2O A;  4XLN F;  2XSJ C;  5A2Q Z;  3B02 A;  1JJ6 C;  2XF5 A;  1X1D A;  1IN6 A;  3HSE A;  3P5J A;  4NB5 A;  2BYV E;  3HOW J;  4Q5S F;  1TT5 B;  1FMV A;  4OMZ A;  4BQQ A;  2M0C A;  2OAZ A;  3ZXS A;  4CGZ A;  4DYR A;  3UNG C;  4EGY A;  3PSI A;  1X1B A;  4XN3 A;  4Q4Z F;  4A3C J;  2EV6 A;  1WFX A;  2EZI A;  4XLF A;  3D5L A;  3DU6 A;  5GTI C;  2K3F A;  2K9Q A;  4L9J A;  4S05 A;  3W6K B;  1D0X A;  5KAI C;  2VC0 A;  1T56 A;  3CDH A;  1UHW A;  2AQF A;  4Y17 A;  1HKQ A;  1Z6R A;  2WV0 A;  2VOD A;  5IP7 J;  2HDD A;  2CYY A;  1B8I B;  2E2H J;  2NVX J;  1LDD A;  2QLZ A;  4AWX B;  4CHU A;  1LE8 B;  3J81 Z;  2E5Z A;  2LKP A;  4S0H B;  2FMY A;  3BWG A;  4F7Z A;  2YPR A;  1TT0 A;  4IVN A;  2DMP A;  1MGT A;  4U0V A;  3JAM K;  1R5G A;  2LF7 A;  1LPQ A;  1OCO H;  2M4K A;  2ZBK A;  2X9D A;  4V2G A;  4UUS A;  2O8K A;  3LSH A;  4XNF A;  2FXA A;  2G7H A;  2XAJ A;  1R00 A;  4EMS A;  1PVE A;  2HU9 A;  2L3D A;  4E70 A;  2XB0 X;  1J0R A;  3L00 A;  5LEJ A;  3QU3 A;  2UUZ A;  2RQP A;  2DQL A;  4U87 A;  5E8I A;  3RZD J;  4ZH4 F;  3OYF A;  1R22 A;  3EYI A;  5HLH A;  1I3A A;  4YEJ A;  1V5F A;  4AVP A;  2VOP A;  1H89 C;  4YEL A;  5GTH C;  4RB2 C;  1DPU A;  4GYI A;  3W2A A;  3SZP A;  2MA3 A;  2MH2 A;  4Z2Y A;  2E1C A;  3L2C A;  3T1B A;  2KDO A;  3IWZ A;  1NHA A;  4A0Z A;  1O7L A;  3SDB A;  4DOZ A;  3WTU C;  1J9I A;  1J09 A;  3CCS I;  2LY2 A;  2VKE A;  3ECO A;  3HRM A;  2CO5 A;  2XAG A;  5JHF A;  1R6R A;  5K5R A;  3CCQ I;  3BZ6 A;  5L3E A;  4N4N B;  3BCA A;  4PCQ A;  1SFE A;  4HG2 A;  1JXS A;  4RAY A;  3HOU J;  2EFO A;  2WAQ N;  4JX4 A;  2KRH A;  1ZG3 A;  4HSR A;  3ONQ A;  3KYL A;  1Z05 A;  1KA8 A;  3GVA A;  1LUJ B;  3JRF A;  2QQB A;  5L3B A;  2NVQ J;  1BC7 C;  3FKI J;  3RPU A;  4I09 A;  1UAA A;  1R49 A;  3J7A Y;  2ID3 A;  5D5W B;  3DEU A;  1HF0 A;  2LTP A;  1SAX A;  2XPU A;  1JUM A;  2RV8 A;  3MQ0 A;  4XSZ F;  2HDC A;  1K83 J;  1X3Z B;  3VWB A;  1I1S A;  1U5T C;  1IZ1 A;  1WJ5 A;  2H1L A;  2L7Z A;  3EUH C;  1Z1D A;  4EM1 A;  4WF2 A;  4DBR A;  2FBH A;  3LFU A;  1STZ A;  4BXF A;  4KT5 C;  4G94 A;  4KUM A;  5B1B H;  1J2X A;  5KCM A;  3DBH B;  1B8I A;  1E17 A;  5HLT A;  1FNN A;  4RGR A;  2DA6 A;  3IRR A;  3BJO A;  4E7I A;  1LE8 A;  5DD4 A;  3EET A;  3G2B A;  2V7F A;  2IPQ X;  4MFE A;  2GXB A;  5HOO A;  4IRI A;  2EV0 A;  5JVG F;  4RAG A;  4WXH A;  3TO7 A;  3RCO A;  5J8F A;  3BY6 A;  1FYK A;  1MNM C;  2QM3 A;  2KIF A;  2JVH A;  1LVK A;  2EV5 A;  1LNW A;  2HTJ A;  2ECC A;  3V8L A;  2CW7 A;  2PN6 A;  4RB1 A;  3SJM A;  5LLQ A;  2NVT J;  1USS A;  2WY7 Q;  3NWT A;  3H1C A;  4BQN A;  4BY1 J;  2OD5 A;  2J5P A;  2V9K A;  2GZW A;  1LKX A;  2HYJ A;  1OR7 C;  2YR2 A;  4BUP A;  3PUB A;  2HS5 A;  1FWZ A;  3KZZ A;  4IF4 A;  1T2K A;  3BZC A;  2AXL A;  3KLO A;  1R23 A;  1S3J A;  2BY2 A;  3CF5 F;  2QYO A;  1Q1V A;  3O8G A;  5E1Z B;  3IP4 B;  5JLW A;  4KDP A;  5KNL A;  4OMY A;  1FJL A;  4BHC A;  4HDU A;  1FZP B;  4UY8 I;  2LR8 A;  1GV2 A;  3DFG A;  1RPW A;  4HX4 A;  3C3W A;  3W2V A;  3TL4 X;  1H9G A;  2QSH X;  1U5T B;  1IUF A;  4RB0 A;  2E19 A;  4OWR B;  4KA4 A;  2DOD A;  4NC7 A;  3WTZ A;  4IKF A;  5F64 A;  1B1B A;  2CSO A;  2LY9 A;  3HTS B;  2G0E A;  1V3F A;  2E71 A;  4CZC A;  3JRD A;  2NYX A;  3VDX A;  3LQQ A;  5HDN A;  2VLA A;  4MTE A;  2DJN A;  5IT3 A;  4S04 A;  1FBQ A;  3BTC A;  4FET A;  5ICC A;  5IOZ A;  2D5V A;  2BOL A;  2DOF A;  3I9V 2;  1AU7 A;  3KLN A;  1DP3 A;  1VQ5 I;  4U88 A;  3ISP A;  3JCU C;  3IV5 A;  3H3Z A;  4HLX A;  1PUE E;  2Y69 H;  2HZT A;  4ETS A;  4BAY A;  3IAM 2;  4RAF A;  1MBE A;  4B09 A;  2MYS A;  3CLO A;  3C2G A;  1XGS A;  1B59 A;  3MWM A;  3HIF A;  4A3K J;  5LHI A;  3LL7 A;  4CIC A;  4RLF A;  3LSM A;  1YW7 A;  4UHT A;  3AKZ A;  4UVC A;  2BHZ A;  4LIT A;  2KFD A;  4DZP A;  4RM2 A;  1V54 H;  2AHQ A;  3FIS A;  4MLO A;  2XGX A;  1FLI A;  1Y0U A;  3WU0 A;  1RC9 A;  2Y9Y A;  3S32 A;  3F0C A;  2VQH A;  3I55 I;  1CF7 B;  2NOG A;  3OOU A;  4UUT A;  1OMI A;  4P96 A;  2IJL A;  3R0A A;  2NVU B;  1POG A;  3LSP A;  5M5W J;  3ABM H;  3OSF A;  1SMT A;  3JRG A;  1SAN A;  3MKL A;  3H92 A;  3KEY A;  1WGX A;  1XSV A;  3K9T A;  3W3C A;  2QBY A;  3GTK J;  2XKP A;  3KYD B;  5LGN A;  2KHM A;  2ZXI A;  1ON2 A;  2EFP A;  3JSP A;  3KCC A;  3OS0 A;  1P7I A;  2WAF A;  2DFF A;  4MNU A;  3MKW B;  3ZOB A;  2K9N A;  5F1J A;  3REO A;  2R7Z J;  4ZDL A;  1U5T A;  4CCK A;  2VKD A;  4LMY A;  3EUH A;  1P6R A;  1WH5 A;  2W00 A;  3ABU A;  3VYT B;  2UV1 A;  3DPU A;  3PIP F;  4IHY A;  3SFZ A;  1EH8 A;  3OMY A;  5F0C A;  1F1Z A;  4IX7 A;  4J00 A;  1LJ9 A;  1SFK A;  2Q1Z B;  2KP6 A;  4J19 A;  2OV7 A;  5GP9 A;  3A01 B;  3I5U A;  1DPR A;  2QGU A;  3LAP A;  2DO7 A;  5EF6 A;  1R5H A;  2B63 J;  1B72 B;  2BVL A;  2NNN A;  2LRD A;  4QSH A;  4E7Z A;  4XID A;  2YUS A;  3A4C A;  4DYQ A;  4ZZD A;  1SVM A;  5F0H A;  1X1C A;  3N05 A;  1WRJ A;  3R60 A;  2EWN A;  1K7A A;  2DMT A;  2DDA A;  1TWA J;  3TOB A;  3ZQQ A;  2MAB A;  2CG4 A;  5FLV A;  3HOS A;  3G4S I;  3CCJ I;  2DW4 A;  5DUI A;  4OOI A;  3K7A J;  1LFU P;  3OIO A;  1OR7 A;  2DAO A;  2XDV A;  1HSJ A;  2MG4 A;  4D1Q A;  4R79 A;  3HPG A;  3CO7 C;  4KYW A;  5EDN A;  3KX2 A;  1WJF A;  1VF9 A;  4LFU A;  3IRQ A;  1LB2 A;  3HHG A;  1Y8Q B;  2MH9 A;  2GXG A;  4PSX A;  2Q2E B;  3KP4 A;  4A6D A;  1CF7 A;  3BR0 A;  1X4P A;  2E36 A;  4UV8 A;  3K4M A;  3ASO H;  3O2P E;  3JRB A;  3TMO A;  3JRA A;  2LF8 A;  4D9J A;  3TDU C;  2IW5 A;  4E7K A;  1XDS A;  3FXL A;  2IS1 A;  4DYC A;  2GOX B;  4BE0 A;  2UWM A;  1MMD A;  2DXI A;  2W1O A;  2V6C A;  5K5Q A;  2XAQ A;  4C30 A;  4HX8 A;  1U9O A;  5D6F A;  1IN5 A;  1RKW A;  3ZN1 A;  1OIS A;  3CCY A;  4XQF A;  4UB8 C;  5ERI A;  1ETQ A;  2R4G A;  3BR2 A;  3U1K A;  3J80 Z;  4IJA A;  3RJP A;  2XRN A;  3F22 A;  2FA5 A;  4HPQ A;  2E7W A;  4EV0 A;  1UG0 A;  4CCN A;  4EJU A;  3D5S C;  4N4O B;  4CXF A;  2ECB A;  2RAE A;  2X4H A;  3S15 J;  4PJN A;  4C2U A;  2Q8K A;  4PDK A;  2HKO A;  1MZB A;  4I7H A;  3H3V K;  3PNY A;  3H3U A;  2JZY A;  2Y31 A;  3HPH A;  3MZH A;  1HDD C;  4OU0 A;  1EF4 A;  2DFE A;  4BAC A;  3T0Y A;  2VPL A;  3DBR B;  2BZT A;  2V1N A;  2WTE A;  4BU2 A;  1KGS A;  3E5U A;  4BJ6 C;  5K5O A;  1BIA A;  2E60 A;  1U9N A;  3UKG A;  1NK2 P;  1LDJ A;  5J40 A;  2M1B A;  2VQG A;  1B72 A;  3U1D A;  4LK1 F;  4MEX F;  3BTI A;  4GO1 A;  2L0K A;  3C2H A;  2K27 A;  1IXC A;  3I71 A;  2XUB A;  3E1S A;  2K7L A;  3LNQ A;  4IHW A;  2CWE A;  1K4T A;  3BOQ A;  3CES A;  1YG2 A;  1VQ8 I;  3K4N A;  1AWC A;  2DN0 A;  1AOY A;  4A5N A;  1FOK A;  1TZL A;  2P0W A;  3RIR A;  4E4H A;  1ETO A;  1FOW A;  3J81 K;  1K4S A;  2L2O A;  3RTR A;  1JT6 A;  1O57 A;  2A6T A;  1UZC A;  3QPL A;  3E5Q A;  5FKL A;  4F92 B;  4G12 A;  5D4S A;  5LGT A;  2VON A;  1BW5 A;  2DYS H;  4OAZ A;  4IHS A;  2GLO A;  1T6S A;  1REP C;  5CVU A;  2P5K A;  2OZU A;  3RPU D;  2HYF A;  1BL0 A;  4LIU A;  2L4M A;  2R3S A;  3JTH A;  4LOC A;  2HVQ A;  3QQA A;  2PBI A;  4M3F A;  4YFK F;  2XC7 A;  5JLX A;  1X2N A;  1TQI A;  3E6M A;  4FAS D;  4A3I J;  2Q2E A;  5J3L A;  3GW2 A;  1DUX C;  2Z3Y A;  4IRG A;  1KYZ A;  1RUO A;  2YU9 J;  2ZSI B;  2VIX A;  2JUC A;  2BVM A;  1Z91 A;  3FK7 A;  5J1Y A;  1I50 J;  5FLM J;  3Q5F A;  3L2V A;  2ICW G;  5ED4 A;  2Y0M A;  2RNG A;  3J7Y J;  2KIQ A;  3HB9 A;  1A31 A;  2EIL H;  2M45 A;  3S3O A;  5LEK A;  2VKH A;  1IW7 F;  5FKN A;  4IHX A;  1GXQ A;  2XHK A;  2XGE A;  1XG1 A;  4JX6 A;  3V7C A;  3C1D A;  2EPF A;  3PSF A;  4KIB A;  2FD5 A;  2O8X A;  4EJT A;  4ZYE A;  3OYD A;  5AON A;  3GTQ J;  1VI0 A;  2CQK A;  2HTS A;  2DA1 A;  3M9A A;  3NAR A;  1XX5 A;  3ABK H;  3VSL A;  1FIA A;  4A3G J;  1I6X A;  4A3B J;  3FX3 A;  1Z3X A;  2ZME B;  4B8X A;  3CC7 I;  2RKH A;  2JPB A;  3HJE A;  2O9L A;  2BV6 A;  4ZJZ A;  3FXR A;  2WB1 A;  4M72 A;  1YFH A;  3VFZ A;  1UCR A;  2ZJ2 A;  4XKW A;  3LOC A;  2XF7 A;  1LEB A;  5GAD J;  3K4B A;  3GLL A;  3MZ8 A;  4KFC A;  1JGG A;  1MBK A;  4X6A J;  5HS7 A;  3ROU A;  2P5L C;  2ESN A;  4M74 A;  1IN8 A;  1G59 A;  2NS7 A;  2IGN A;  1MSF C;  2P6T A;  3DKW A;  1X1A A;  2OC6 A;  3LSG A;  1ZAO A;  1BM9 A;  2N8G A;  1W36 C;  4O6J A;  1TLH B;  2VQL A;  2HQ5 A;  3B6A A;  5ILV A;  4BXU A;  3OYI A;  1GDT A;  3RKQ A;  3F8M A;  5JFR A;  3FXQ A;  2L7F P;  2O7O A;  3MAJ A;  3V7R A;  1YI2 I;  3L2Q A;  4QTR A;  4A12 A;  2WAD A;  4HV5 A;  1N77 A;  4UXN A;  3ASN H;  3I64 A;  1S9H A;  3S16 J;  3DKX A;  1SFX A;  2DCE A;  1LVA A;  3HUG B;  2KZG A;  3V8K A;  2STT A;  4KMF A;  4KIT B;  2P7C B;  3FWE A;  3PQJ A;  4RBO A;  1FYL A;  2XRL A;  5GAE J;  5LHH A;  4BBR J;  2V1U A;  2PJP A;  3DV8 A;  2F2E A;  3H5R A;  4IO9 F;  4EJO A;  3OYE A;  3RYP A;  4L9N A;  1HLV A;  3FDY A;  4Y4R A;  5DM7 F;  4OAY A;  1WI3 A;  5K1Y A;  4B4C A;  3R0J A;  5GPA A;  4FHT A;  3S3N A;  1K6Y A;  1WCM J;  3HKZ N;  2DU9 A;  3I4N J;  1D8J A;  2I5U A;  3BG9 A;  3TP3 A;  1LEA A;  4MIM A;  4HF0 A;  5FO5 A;  1J59 A;  2GWR A;  4PJM A;  3LQR A;  2K9M A;  2HOT A;  3K4K A;  2LH9 A;  3HKZ A;  2L54 A;  3CD6 I;  4YIR X;  3MVP A;  5EG0 B;  1FSH A;  3MKZ A;  4H4K C;  4M6Y A;  2DA5 A;  4A5M A;  2E1O A;  4RB3 C;  3E5X A;  5FKM A;  2ACJ A;  1BI2 A;  1IDZ A;  3BPV A;  3X2Q H;  4L5J A;  3ZGK A;  3ZQF A;  2JVG A;  4BKX A;  3BR6 A;  3G6E I;  3JRE A;  2WWY A;  4LK0 F;  1YRN A;  2FNA A;  3ZMD A;  5GAG J;  1BOA A;  3SEZ A;  3HHH A;  1JTY A;  3ABT A;  3GXO A;  1MMS A;  3GZ5 A;  4CO8 A;  2QKM B;  3A1Y A;  4HQE A;  5C4J J;  1APL C;  1KYW A;  4DZJ A;  3OS1 A;  2AO9 A;  3BG3 A;  3ESW B;  3LSK A;  5TRD A;  1KZH A;  4AYB A;  4M9Z A;  4HOB A;  1FC3 A;  1QA6 A;  1V55 H;  3SFI A;  1R58 A;  1P4A A;  3M8E A;  4ENM A;  5IT9 Z;  2W24 A;  1X58 A;  1HKT A;  3V4G A;  3HOX J;  2JPC A;  2CGP A;  2KPM A;  5HDG A;  2KDZ A;  1WJB A;  4DQ2 A;  2K5C A;  1T98 A;  3F3X A;  3RKY A;  4A6E A;  2QF7 A;  3DWL E;  4KIC A;  3N97 A;  2MBF A;  1W7P B;  3VOE A;  3HUG A;  3CC4 I;  4I98 B;  3JTG A;  1FY7 A;  3F9K A;  4KN7 X;  1UHM A;  5DCM B;  1MKM A;  1U0J A;  2QEN A;  4G6T B;  1KQ8 A;  1VQO I;  1O4X A;  2O5R A;  2JT1 A;  3R61 A;  4YFX F;  5H20 A;  1BR1 A;  2GXA A;  2CW8 A;  4ZC3 A;  1S7O A;  4ABZ A;  3E0J B;  4NUB A;  2JRM A;  5HVQ C;  3GCM A;  4WCG A;  4HLY A;  4IPA A;  3IWF A;  1JGS A;  4AID A;  1XGM A;  2B0L A;  4EJW A;  2MSY A;  3S1N J;  4JOM A;  2PQ8 A;  5IOY A;  1P7J A;  1I1G A;  1VQN I;  4GGG A;  1RET A;  3KP6 A;  3M8F A;  5CQE A;  2BW3 B;  5EG0 A;  5E1X A;  3J7A O;  3S1Q J;  1PP7 U;  2XVC A;  2E34 A;  3JRI A;  5E3L A;  1XTA A;  3DU5 A;  3CZ6 A;  1MJA A;  1W1W E;  3OOP A;  4WK8 F;  2RDP A;  1G2H A;  2A5Y B;  3SYT A;  5KAF C;  2E1N A;  5BOX A;  3PO2 J;  2M9H A;  3OYA A;  5GPC A;  3WU2 C;  4G6Q A;  1OCT C;  2EZK A;  4MQ9 F;  1TW2 A;  3VOD A;  3TW6 A;  4C2M J; 
#chains in the Genus database with same CATH homology
 3PL8 A;  4KJZ A;  4X0G A;  1OLT A;  3OL4 A;  4C9Y A;  3IAM 2;  3L2W A;  2JA2 A;  2MYS A;  3CF2 A;  3PNT A;  3S93 A;  3C2G A;  3LSI A;  4XL9 A;  4B3X A;  3MMY B;  2MFZ A;  2LBF B;  2Z1D A;  3LL7 A;  4RLF A;  3LSM A;  4XON A;  4HST A;  4NC8 A;  2M3A A;  2M7B A;  3AFH A;  3DTI A;  3BLY A;  3AKZ A;  4XMY A;  2R7V A;  1YX5 A;  4LIT A;  4RM2 A;  2A5W A;  2LOO A;  3K6G A;  4MLO A;  5LFA A;  4XOT A;  1KON A;  3DTE A;  1G8X A;  2FUG 2;  2HDW A;  3S32 A;  2K3P A;  3OYB A;  3OYN A;  1V5G A;  2VQH A;  2HPI A;  4XLE A;  4LG3 A;  3OOU A;  2WY8 Q;  2R7Q A;  3H9Q A;  4B43 A;  4KT6 A;  5CQG A;  2IS4 A;  2WAQ A;  5LD2 C;  2DOA A;  1BOB A;  3FHN A;  4DBQ A;  2PMZ A;  3MD2 A;  4XR6 A;  4CUG A;  3BC8 A;  4E7L A;  3KEY A;  3W3C A;  2X6X A;  3DLA A;  4ZTF A;  3OL3 A;  2KHM A;  1VZ0 A;  3K4L A;  2ZXI A;  2CS3 A;  1NG6 A;  3OS0 A;  2WAF A;  4CA0 A;  3OYH A;  2CUZ A;  4BS9 A;  3LMM A;  4BQO A;  5CKT A;  3MKW B;  4IZZ A;  4ANJ A;  2VXD A;  4II2 A;  4ZDL A;  2W4S A;  3K4C A;  2PJR A;  1WJD A;  3CJR B;  3EUK L;  4CCK A;  2VKD A;  4PJL A;  2BW3 A;  2LYC A;  1D1B A;  2W00 A;  3VYT B;  2UV1 A;  2CUJ A;  3DPU A;  1UEL B;  3OMY A;  4E7S A;  3DEE A;  2KQR A;  2MD0 A;  4IX7 A;  4J00 A;  1SFK A;  2Q1Z B;  2KP6 A;  2OV7 A;  4ZDO A;  3RQ4 A;  1PJR A;  2LRE A;  2E1M C;  3D5R C;  3K70 C;  3FKJ A;  4CSW A;  3DPL C;  4BE1 A;  1Y56 A;  4HRI A;  2BVL A;  4E7Z A;  2LRD A;  4DJA A;  2X1D A;  1DGR M;  3A4C A;  4LIV A;  2M4G A;  2HVR A;  4II3 A;  4JQF A;  4DIQ A;  1X1C A;  3N05 A;  4XLH A;  1T95 A;  2V4J C;  3QYF A;  1ZEL A;  2LBF A;  3ZQQ A;  2MAB A;  2R7S A;  3HOS A;  2DT6 A;  3K70 D;  1YE9 A;  3PJR A;  4J01 A;  2XDV A;  3AL0 B;  4RMN A;  4D1Q A;  4R79 A;  3HPG A;  3KX2 A;  1WJF A;  2ZXH A;  4B48 A;  1D0Y A;  2RRE A;  4PSX A;  2GOM A;  2Q2E B;  1Z7L A;  3M8J A;  1X4P A;  4F93 B;  3K4M A;  3VYU B;  3TMO A;  3HG9 A;  4D9J A;  4CCJ A;  4E7K A;  4QPO A;  3SEQ A;  3H5A A;  4P5O A;  2K9L A;  2IS1 A;  2UWM A;  2GOX B;  3QYE A;  1PYV A;  4F91 B;  4BE0 A;  3DTK A;  1MMD A;  2DXI A;  4AVZ A;  2W1O A;  2CMP A;  2HNH A;  2LG4 A;  2VJ4 A;  4C30 A;  3K4J A;  1WJA A;  4XQF A;  4E7H A;  1Y6I A;  1MNE A;  2LY1 A;  4RLQ A;  4B47 A;  4NQW B;  2AQE A;  2R4G A;  2ZFU A;  2RQQ A;  3VYR B;  4BEH B;  1E0E A;  4HPQ A;  1MMN A;  2L9N A;  3V42 A;  1UG0 A;  4CCN A;  3D5S C;  4N4O B;  3OYC A;  4PJN A;  4C2U A;  2E1M B;  1BR4 A;  3PNY A;  2F5V A;  3HPH A;  4NNJ A;  1MMA A;  1WJE A;  2CV1 A;  4P1W A;  4BAC A;  4B44 A;  1BR2 A;  2LC2 A;  3OYJ A;  2VPL A;  2ZSH B;  2V1N A;  2IS6 A;  4ITV A;  4BU2 A;  4BJ6 C;  4HNT A;  3OYG A;  4C2T A;  2E5N A;  2E60 A;  3BG7 A;  2VQG A;  2Y0S A;  4BE2 A;  2F4I A;  2JUG A;  3L2R A;  3AL0 C;  3C2H A;  3E1S A;  3CES A;  4Y3O A;  4E6K G;  4CCO A;  2IS2 A;  3K4N A;  3U21 A;  1TZL A;  2P0W A;  4E4H A;  1DGW Y;  2L2O A;  3RTR A;  2A6T A;  2X6Y A;  4XKC A;  1QHH D;  4F92 B;  2ELJ A;  3H9J A;  4OAZ A;  3L2U A;  1D1C A;  1MND A;  2NOJ B;  2L7K A;  3RPU D;  2VQC A;  4XOP A;  4LIU A;  2V26 A;  2HVQ A;  3BG6 A;  1GLN A;  2XC7 A;  2VJ5 A;  2W82 A;  1LDK B;  2V6E A;  3H9G A;  4XLC A;  1V5E A;  3DKY A;  3HXL A;  4FAS D;  1D0Z A;  2KZV A;  1FMW A;  2HPM A;  4PUS A;  4EAT A;  3VSK A;  3OIP A;  1JI8 A;  4E7J A;  2VJI A;  2ZSI B;  3S3M A;  5FRO A;  2VIX A;  1LFP A;  5HNH A;  2BVM A;  2M0M A;  4RM3 A;  3H0D A;  4XOR A;  3L2V A;  2RNG A;  4IQ4 A;  2DT7 B;  4CH7 A;  4BJT A;  2HVS A;  2IGM A;  3S3O A;  3CP2 A;  2VKH A;  1NG7 A;  2IXS A;  1Z21 A;  2WBM A;  3CMM A;  1ERD A;  2HQA A;  3HC7 A;  3PSF A;  1SAU A;  3EPZ A;  2X1C A;  1IRX A;  4BEH A;  5TGT A;  2XSJ C;  3OYD A;  1X1D A;  2XF5 A;  3UR3 C;  3OS2 A;  3OWT A;  1FMV A;  3VSL A;  4BQQ A;  3ZXS A;  3UNG C;  3PSI A;  1X1B A;  4XN3 A;  1Z3X A;  3OYM A;  1WFX A;  4XLF A;  3D5L A;  4ZJZ A;  1YX3 A;  3DU6 A;  2WB1 A;  4ZTJ A;  5KHD A;  2WA0 A;  4XKW A;  3OYK A;  3CJQ B;  2DJI A;  2KL4 A;  2XF7 A;  1D0X A;  1QHG A;  4CCM A;  3I3L A;  4HEA 2;  2AQF A;  2VXZ A;  3K4B A;  2M7A A;  3A2K A;  1X19 A;  1WJC A;  4PFO A;  4BDZ A;  2L5Q A;  3BCB A;  1G59 A;  3EUA A;  2IGN A;  3LSG A;  1X1A A;  2E5Z A;  2OC6 A;  3QOE A;  1W36 C;  3S8P A;  1TT0 A;  4XN0 A;  2VQL A;  4PJJ A;  3OYI A;  3ZRG A;  4XLA A;  1DQU A;  1QU3 A;  2M4K A;  3GBG A;  3LSH A;  4XNF A;  3L2Q A;  2HU9 A;  5HNF A;  2WAD A;  1N77 A;  4U7B A;  1D1A A;  1S9H A;  1MW7 A;  4IQJ A;  3DKX A;  3SZG A;  4Y33 A;  2UUZ A;  2DCE A;  4U87 A;  1W36 D;  2R7U A;  3OYF A;  4BL0 B;  2CH0 A;  4YEJ A;  1V5F A;  3HUG B;  2R7W A;  4XKV A;  3PFY A;  4YEL A;  4KIT B;  3ZR8 X;  3W2A A;  3OYL A;  4CCL A;  2X1E A;  2VAS A;  4F3Q A;  2QKL B;  2KDO A;  4HNU A;  4BDY A;  2JSP A;  3DPT A;  3H5R A;  1X4O A;  4ZDP A;  3SDB A;  4DOZ A;  1J09 A;  3OYE A;  5FRN A;  3FDY A;  4Y4R A;  2LY2 A;  1N75 A;  1Z3Y A;  4OAY A;  3FBN B;  1AA7 A;  5JHF A;  1R6R A;  3S3N A;  1K6Y A;  2WAE A;  2X51 A;  4XM3 A;  4N4N B;  3BCA A;  2Z2S B;  4HG2 A;  3FBI B;  3OIQ A;  3H5N A;  3IAS 2;  3HL2 A;  4DGW B;  3PNV A;  2KRH A;  3HOT A;  4HSR A;  4PSW A;  4PJM A;  3ONQ A;  2K9M A;  3KYL A;  3K4K A;  2LH9 A;  3HKZ A;  5FRM A;  3TBI A;  1UAA A;  3MKZ A;  4H4K C;  4F52 A;  3J7A Y;  4XKB A;  2R7X A;  4F55 A;  3VWB A;  1HA8 A;  2XF6 A;  3ZGK A;  2JVG A;  3K10 A;  1WJ5 A;  4ZYA A;  3EUH C;  4DBR A;  3LFU A;  2I8D A;  3SEZ A;  4BXF A;  2CFO A;  5KCM A;  4PFP A;  5HLT A;  2QKM B;  3A1Y A;  4KIS A;  4E7I A;  3MKY B;  3RSN A;  2IGK A;  3H35 A;  3G2B A;  2V7F A;  2HZD A;  2R7T A;  5HOO A;  2R7O A;  1T0F C;  2XAU A;  3OS1 A;  3LSK A;  4AYB A;  3RCO A;  1N78 A;  2JVH A;  1LVK A;  2X85 A;  2CV2 A;  4BJ5 C;  2KPM A;  1WJB A;  2CW7 A;  2K5C A;  2WY7 Q;  3NWT A;  4BQN A;  2V9K A;  3DWL E;  2CV0 A;  1LKX A;  1OR7 C;  3M1C A;  4BUP A;  3F9K A;  3PUB A;  3OR1 C;  5CPR B;  2KLO A;  2VB6 A;  1U0J A;  3DQV C;  4G6T B;  2O5R A;  2VL8 A;  1BR1 A;  3NWS A;  2CW8 A;  4ZC3 A;  3E0J B;  4NUB A;  3IP4 B;  1EA3 A;  2MC4 A;  5KNL A;  2W7N A;  2Z16 A;  3QYB A;  5HVQ C;  2IGO A;  2L9S A;  2X6W A;  3VYS B;  2KRC A;  4PK4 A;  2OUM A;  3ZCO A;  3QOD A;  3W2V A;  3TL4 X;  4JOM A;  3CP8 A;  4QPQ A;  4YRV A;  3OR2 C;  2PJR B;  3IUO A;  4OWR B;  2KMU A;  2VJJ A;  5CQE A;  2BW3 B;  4NC7 A;  4IKF A;  4BGD A;  2R7R A;  4CZC A;  3DU5 A;  3VDX A;  3CZ6 A;  3OY9 A;  2VLA A;  1MMG A;  4FET A;  3SYT A;  2BOL A;  2F6C A;  3I9V 2;  3W2W A;  3OYA A;  1DP3 A;  4AU7 A;  4GRI A;  1P9Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...