2L9SA

Solution structure of pf1 sid1-msin3a pah2 complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
SNADYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the mSin3A PAH2-Pf1 SID1 Complex: A Mad1/Mxd1-Like Interaction Disrupted by MRG15 in the Rpd3S/Sin3S Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PHD finger protein 12
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1860 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9sA00
2L9SA
chains in the Genus database with same CATH superfamily
3K2AA 3LQQA 4ZZLA 3CMMA 2PX9A 1MBKA 4I6ZA 2VJ5A 3HYIA 1OYYA 3F23A 1ENHA 3KFWX 1FIAA 5E79C 3WTUC 2FMLA 1SFUA 3EYYA 2KHMA 2M5WA 1ETQA 3L2RA 3BOQA 2E1OA 2M87A 2Q2EA 3GO5A 3LFUA 3QPLA 5EZGA 1E2XA 3HGYA 2MSYA 2DU9A 5L3EA 1CGPA 5EDNA 5E18F 1J7KA 2EFQA 1U0JA 2MABA 3ECOA 1FC3A 4XQFA 1P4AA 3BCAA 2ZMEA 2XV4S 2BHYA 3H9QA 3HHHA 2DMUA 2Y0MA 4HX7A 3E5QA 5CJ9A 1ETYA 1QZZA 4LB6B 3OWTA 2BXYA 4QSHA 1OCCH 1FOYA 3VSLA 3QU3A 1IUYA 1XG1A 4BL0B 2RNJA 4PSWA 2A5WA 4AC0A 4B09A 2DOEA 2FBKA 2HOSA 1YRNA 3E5UA 3S2HJ 3VB2A 2BY1A 3LQRA 5FLMJ 3IKTA 3BR6A 2O3FA 4HAMA 4L9TA 2I10A 3E5XA 2DPUA 3ONQA 2HGCA 1JXSA 2CFXA 4O6JA 3T5XA 4B3AA 1X4PA 1VQMI 2MLKA 2M3AA 3CUOA 3PO3J 3FXLA 2H1LA 3WTXC 1IRZA 2ELHA 2XPUA 1KQ0A 1MBFA 1Z77A 2E36A 4QPQA 5E8GA 4LG0A 2G7UA 1UJ8A 3HKZA 1HKSA 2DA2A 3M4OJ 1PJRA 2KFDA 3ZQQA 4CICA 3LAJA 1YX3A 2XB5A 3KE2A 2VB6A 4EM2A 5E3OA 3HXLA 2E2IJ 1VQ7I 2LF8A 5HNHA 3BWGA 3W3CA 1PUFA 1JI8A 3EDPA 1ZRCA 3MFKA 3B6AA 1G2HA 1X1CA 3CUQB 1QVTA 5FD5A 3AG3H 3OIQA 2CUFA 4HV5A 3R0JA 3H36A 2HU9A 1XN7A 4AVPA 2FX0A 3NARA 1P4WA 5FD6A 3QP6A 3F8BA 1ULYA 2DODA 1RUNA 2JTVA 2DT7B 4HZFA 3M8JA 5F1RA 2GA2A 2VI6A 1TNTA 3NEUA 4HQMA 4PJ0C 1QVUA 3BG3A 3JRHA 2FNAA 2D45A 1Q1VA 4BDZA 3VPRA 1KU9A 1RPWA 3KZYA 2P6SA 2V26A 2Y9ZA 3SZGA 1MBGA 3SQNA 1BJAA 4J19A 4L18B 5IP7J 3K70D 3ZRGA 2CH0A 3MZHA 2VBZA 2ME0A 1PVEA 1QU3A 4A3DJ 2QKLB 2TRTA 4M6XA 2NAZA 3KP4A 4E4HA 4BY7J 3F9KA 1YOVB 3MVPA 1OPCA 4B1RA 1TP4A 2L9NA 1RRJA 4BQAA 4KDPA 2GQQA 3J7ZI 4KISA 4WWCA 1WFXA 5DCMB 1VQ6I 2HFHA 2QQBA 1MBHA 1X1DA 1O3SA 3C1DA 1ZTRA 2P5VA 3MKYB 2XPVA 4BQNA 1ETVA 1NK2P 3DLLF 1SD7A 3T8RA 4KYWA 5CVIA 2GWRA 1Z3XA 2R7TA 1TQPA 3ZN0A 2JSCA 1K6YA 2VE9A 1ON1A 4CYCA 3S14J 2CQQA 3MZYA 2O03A 2NS7A 2KIFA 4Y15A 1JGGA 1BN5A 4PGHA 2Q8KA 2ESNA 2ELKA 2IAIA 1ETKA 1J5YA 5IPAA 5F0FA 3WTVC 1LB2A 1OCTC 2OQGA 3C7JA 1JE8A 1ETWA 3WHBA 1XSVA 4ZTJA 3RKWA 3WTWC 3KETA 1G3WA 1DP3A 2FD5A 2IPQX 3WHCA 3OL4A 1Y1VJ 3QYEA 1SFOJ 2DOFA 1IRGA 1I3QJ 1IF1A 5TJJA 2M4GA 5FLXZ 3GFMA 3CJTB 5B1AH 3I5UA 5DCFA 3KYCB 3FMSA 4RB3C 1OJLA 3OYKA 4AM3A 2X4HA 2XSJC 1FLIA 2GIVA 4G6QA 3ERMA 4CGZA 2F6CA 3G1OA 3BR5A 3FMQA 3DWLE 4XICA 3AL0C 4BJ5C 1IN7A 2CO5A 2XAFA 2JN6A 3JRAA 2QBYB 1HLVA 2M8GX 3BR0A 5LHHA 4FTHA 2IGNA 3HSRA 4R79A 3MKWB 1XTAA 1BR2A 3ASNH 5CVRA 3BJ6A 1BR1A 4Q47A 4BXUA 3HPHA 2HPIA 2DTRA 2QQ9A 1S6LA 1L0OC 4QWQA 1LFBA 4M72A 3TEDA 3HDDA 4A0ZA 3LMMA 4L9JA 4XIDA 1R71A 5HS8A 1QBJA 1YYVA 3ABTA 4BQQA 2VPRA 5LGUA 4XRSA 5C3EJ 4EJTA 2EQRA 3HOZJ 3P9CA 1T2KA 1XDSA 4ZZDA 2LY9A 1MMNA 2CWEA 2BEOA 3WU2C 2L4AA 2BVMA 2E2HJ 1EH7A 4WXDA 5FRMA 4Y52J 5AONA 2V9PA 1O4XA 2XGEA 3EUHC 1U3EM 3OOUA 3LSMA 4L5EA 1E0EA 1D0XA 2JSPA 2GA1A 1XPXA 3DBRB 2XASA 1RR8C 1QRYA 3QPHA 3CCRI 4HLYA 4XONA 5F1JA 3PO2J 1MH3A 1VI0A 5D5WB 3BG7A 2Z33A 1IW7F 2NVUB 3R4KA 3OYNA 4A6DA 2PBIA 3DKYA 2CV1A 2OTJI 3RYRA 1JT0A 3LSIA 5HDGA 2DT6A 1BW6A 2KZVA 1W5TA 2KMUA 2NS8A 2IS6A 4LMYA 4E70A 2D5VA 1X58A 3COAC 2UUZA 4YRVA 1T08B 4HYEA 3QOEA 3S1RJ 3CESA 1YITI 1LDKB 4O3MA 1D5VA 4MIMA 4AIJA 3ESWB 1ZHFA 1BIBA 2DYSH 4ZTFA 4NDLA 4UNOA 1RR7A 1S7EA 2HYFA 2M0MA 3M8EA 4XK4A 1R22A 4RDUA 2MLGA 3BTCA 1TNSA 1O3RA 4E7KA 2E1MC 2RNGA 3ZOBA 3S3NA 2J5PA 2CUEA 3U1DA 3ZMZA 4I0BA 3I59B 1MBEA 1EF4A 3TOAA 1UG0A 3K10A 2JQ7A 5JFRA 1VQNI 4D5FA 1RIOH 1DGWY 2CFOA 2CQKA 3AG2H 1H88C 3FXQA 1MD0A 5FKNA 2H6CA 2PI0A 2L54A 1D1CA 5GPCA 3VFZA 3WTSC 2HYJA 1ZAOA 2KIQA 5JHUA 2K9QA 4CSWA 1BA5A 3HGGA 2LSOA 3BDDA 2B0LA 2R5ZB 1L3LA 2L9SA 1U78A 3V4GA 4HDUA 2WY8Q 4C2MJ 2FQ4A 3R60A 3EETA 1KU2A 3IL2A 3BJAA 2O5RA 3CDHA 3PNTA 4F91B 3WU1B 2KZGA 3I9V2 3L2WA 3CCQI 1V54H 3D5LA 1YW8A 5LHGA 2ZFWA 2O8KA 1USTA 2OJED 4DOZA 4IHYA 3T1BA 1G3TA 2FA5A 2DA4A 1BI3A 1RKWA 2ZNZA 5K7FA 4KNYA 3I3LA 4ANJA 5EF6A 2V6EA 4M3BA 1HOMA 1WZ2A 2QEXI 3JAMZ 3S17J 3RYPA 1YX5A 1ZELA 2HVSA 1A6IA 1IXRC 1EV7A 3FIWA 4XLPF 1MDMA 2DA3A 1HKQA 2K5CA 4IHSA 2FNPA 1ORKA 2B7EA 2JJ7A 4UVAA 5L3BA 4C3JJ 2DFEA 1J09A 3TDZC 2EV5A 4ZJZA 5D4RA 1I3AA 1D0ZA 1SFXA 5CVVA 4P5OA 1IDYA 3OYGA 3I4MJ 5GTHC 3K4MA 2AQEA 5D6FA 3QPSA 3DBHB 5GAGJ 1ODDA 4XOPA 1VNDA 4Y4RA 2HDWA 1OISA 3WE3A 3GUDA 2VQCA 3CLOA 5EJCA 2F5CA 4RM3A 5DTDA 2HWVA 3GBGA 3OYJA 4E6KG 1W7PA 2WADA 3E6BA 1RETA 1FY7A 1YJ9I 2PN6A 4LIVA 5DUKA 2R5ZA 1UMQA 3F8NA 2RKHA 2LREA 1SMTA 2O9LA 1HC8A 5TISC 3KP5A 1O3TA 2CV2A 2Q0OA 4M9SA 5GPAA 2BY0A 3I55I 4IPAA 5DUIA 5E3MA 4E7SA 1Z91A 1YO5C 5J6XA 3OYCA 4E7LA 5FB2A 2LTPA 3V8KA 5J3LA 2VPLA 2ZFUA 3CLQA 5M5YJ 3KYDB 1M1EB 2WBMA 2W1OA 3L2CA 1R5HA 4YIIA 1WJBA 5E1WA 3DQVC 3ZQLA 1UCRA 2DA6A 4HF1A 2IA1A 4LIUA 3HOVJ 3WTZA 2IGMA 2VXZA 1T0FC 3TOBA 2HZDA 4AD9A 1TWGJ 2KJCA 2XB0X 1I6XA 2R4GA 4DQ2A 5FRNA 2ACJA 2V9KA 1Y0NA 2HKOA 4I76A 4EJWA 4ESBA 2L02A 2BXZA 1T98A 3C2GA 5LGTA 5ICCA 2AQFA 1O7LA 5DM7F 3GZ6A 3HOYJ 1LVAA 4GYGA 2ZKZA 2GZWA 4LJZF 1IG7A 2KRFA 3E6MA 3K4NA 4WX9A 4XSXF 4CYDA 3VYTB 1MJAA 1WJEA 3S32A 3AFHA 2TDXA 1WKMA 2XDVA 4S05A 4S04A 1XSDA 1N75A 4JQFA 2QWWA 3HRTA 1KU3A 1SVLA 2QCOA 2XGDA 1XMXA 5CPRB 5LEJA 2LDUA 4M9ZA 5HS7A 4CXFA 1NTCA 3CJQB 1JTXA 4G7HF 1O7FA 4RAZA 1RUOA 5CKTA 2R5YA 3DV8A 4A3GJ 3LNQA 1OCPA 3RKQA 3R0AA 2CMPA 4AIHA 2ZXHA 4N0BA 3LSPA 1FP2A 1OFCX 3IAS2 1LE8A 4M71A 1Y1WJ 2O61A 1P6RA 1Y0UA 1OR7C 3BROA 4N4OB 3CMEI 2ZBKA 4P1WA 4ZH4F 4EEFG 4MFEA 4A0YA 3CC2I 4UVCA 2XKOA 2GM4A 2QSHX 3HM5A 5GAEJ 5EG0A 3IRQA 3G3ZA 5ED4A 3GZNB 5IT3A 1IZ1A 3IWFA 1XC5A 4I02A 1YIOA 2EFPA 3KZZA 2OPTA 2UV1A 3V7RA 3X2QH 2NXNB 5J8FA 3ZMUA 4G94A 1U2WA 4IRHA 3BTLA 2P6TA 3HOSA 2CUZA 1B59A 2EJRA 3G1MA 5BQTA 5LEKA 4ESJA 2VJIA 3W6JB 1DP7P 2FBHA 4BY1J 4BJTA 4CA0A 1JHHA 2CW8A 5LFAA 3K1PA 3SYTA 4CHUA 2D1VA 3LSJA 4N4NB 2EWNA 1ZLJA 1BW5A 2XGXA 1AU7A 3LSHA 3HIFA 1MKMA 2EPFA 6PAXA 2WAFA 3FKJA 3M7GA 1YFHA 2GLOA 4BXXJ 1BIAA 3ASOH 1HKTA 1FTZA 4RB1A 1TWFJ 2RGVA 4MTEA 4RBOA 2L01A 3GF2A 2XKPA 3QP5A 4ZDPA 2QQ8A 1W7PD 1RESA 3ECHA 2XAHA 2VT3A 3FM3A 3W2VA 4BUPA 4UUSB 3BC8A 3EUAA 5DYMA 5JVGF 3CP2A 2AS5F 1BM9A 2CQNA 2Y75A 2OC6A 5FGMA 1Z3YA 3W6VA 4RGRA 1B6AA 2WAEA 2ZB9A 4II3A 4V2GA 2WTEA 4UB8C 5CVJA 4CZZA 3BLYA 1ZN2A 2COBA 1T6SA 1FYKA 1X3ZB 1GUUA 4HPQA 4DBRA 1SAXA 1WRJA 1F43A 5ILUA 2YU9J 2JRTA 2X9DA 3AL0B 2EILH 4M3DA 2R7SA 2DK5A 3FX3A 5HDNA 2MYSA 2P81A 1E3OC 3K70C 5BNGA 3O8HA 1P92A 1UZCA 1YG2A 3ZMTA 1V55H 2WV1A 4LFUA 1AKHA 2KKOA 2FXAA 2BZTA 1ITYA 1SD5A 1I6HJ 3LSGA 1WJDA 2MC3A 5EZHA 1FOXA 3ZMVA 2OZ6A 2ECCA 4HNUA 2MW8A 1S3JA 5C4XJ 3V42A 2VC1A 3S16J 3KZIC 5J1YA 3WGIA 3SXYA 1FBSA 4EV0A 2L5QA 5B3SH 4PUSA 3J80K 3ROUA 2K3FA 4IRIA 2VKEA 1D8KA 1KYWA 1X2MA 1R49A 4ZDOA 3H1CA 1YJWI 1JTYA 3TMOA 4NB5A 4MQ9F 1FPQA 2JA5J 1OLTA 1FMWA 4ETSA 1PP8F 3CF2A 1V5EA 2V1DA 1R7JA 5ILSA 1Z0XA 4RLQA 1BJZA 2ZSIB 2ESHA 3LSTA 2Y0SN 3U9GA 1APLC 3GTOJ 5EEHA 4GO1A 4XLAA 3HKZN 4WF2A 4XM3A 3D1NI 3HRUA 1XSXA 4D1QA 2BOLA 2EZLA 2IJLA 2LR8A 2X51A 3REOA 4LGWA 4XL9A 1CF7A 2EV6A 2JUGA 2JZYA 2WV0A 2DT5A 4NQWB 3GWZA 3G73A 3KEQA 4AWXB 3TW6A 2OD5A 3MZ8A 2DOAA 5E1ZB 4BEHA 2CQXA 2FSWA 4JOMA 3OYMA 1U9NA 1VQ4I 3BTIA 2R7UA 1ZG3A 2K7LA 3TL4X 2EA2A 1WH5A 1ZYRF 3FWEA 3FXUA 3IKVA 4XBFA 2QSFX 5M3MJ 4XORA 2EFOA 3MMYB 3DFGA 4XKCA 2VOPA 2KDOA 3VODA 2FEZA 5IYCJ 3OYBA 1AKHB 3GVAA 5H2FC 4UUTA 3HZJA 1QPIA 4XKBA 4RS8A 3OIOA 2RQPA 3CZ6A 1KONA 5K5RA 2FBIA 2EZHA 3CCYA 1LFPA 3RQ4A 2BE5F 1Z7LA 3J7AY 5BS6A 1FZPB 3AKZA 3WE2A 3HG9A 2NS0A 2A5YB 1JKRC 2QF7A 2X85A 1OR7A 3WG7H 3GTQJ 4YELA 2KPMA 4CCOA 3ERED 1HCRA 3OS0A 2JA6J 1S29A 3B73A 4A5MA 4A5NA 1CF7B 4PJLA 5EEAA 1WPKA 3ZCOA 4ON0A 3U21A 3VYRB 1WCMJ 3CDIA 4ENKA 3CTAA 3JTGA 1RI7A 2XROA 3HTSB 5J4VA 2EIMH 2VL8A 1G4DA 3RZDJ 3QAHA 5JI6A 3T0YA 2DYRH 4RGUA 1J2XA 4MHGA 2OV7A 2HZTA 1U5TA 4BBRJ 3Q9SA 1F9NA 2V4JC 4A93J 4LD5A 3CC4I 3J81K 4NQWA 2ME6A 3FXMA 3K4CA 2K3PA 4MFDA 4PJNA 5DS9A 1XGNA 2GXAA 3H5RA 4BQOA 5HVQC 5FKOA 1MBJA 2YX7A 2PMUA 3FK6A 2XRNA 2EB7A 1TBXA 3PUFA 1XCBA 4XMYA 5FO5A 3DP7A 1X2NA 2L7FP 3S93A 5ICFA 2VLAA 3GFLA 2XF6A 1A31A 3O8GA 3SFIA 2Y69H 3K4LA 2QVOA 4X1EA 2H6BA 4NUBA 4A0XA 2R3SA 5ICGA 5BMZA 1ZRDA 1QHHD 1YW7A 3CQZJ 2LP0A 1D1BA 2EK5A 4DNCA 4MTDA 3QODA 4ZC3A 4EM1A 3K9TA 4ITVA 4A3FJ 4I09A 2VJJA 3BR3A 2QGUA 4ZDLA 3GEZA 1TZLA 2O0YA 5ILVA 1TT5B 2M1BA 1N25A 1HQCA 4LOCA 1ZKGA 4YEJA 3BPVA 1MMDA 4Y33A 2F5EA 4B48A 3W6KB 2DQRA 1SMYF 2LYCA 3CO7C 2IGKA 2KIUA 1TC3C 4KFCA 1IXSB 1ONVA 2HR3A 4QPOA 4ESFA 5K1YA 4UUVA 3PFIA 3BY6A 3TO6A 4FT8A 3AAFA 3PM1A 1GV2A 4G6TB 4DBQA 4G8XA 4CCJA 1IN5A 1IO2A 3KP6A 1GV5A 2VT2A 3NQOA 4E7IA 1W36D 3JRDA 1ZRFA 2ISZA 3QRFF 1LQ1A 2P7VB 2LG4A 2H09A 3BP8A 3QYFA 4DYRA 1MJ9A 4IZZA 2J5OA 1G6NA 1YS7A 2L0KA 1BI0A 2VOOA 3S2DJ 4NBQA 2WB1A 2LOOA 1BOAA 2K9NA 3CCJI 3LA7A 3SFZA 2YR2A 4BYYA 4IOAF 2GOXB 4R1HA 2CW7A 2NYXA 4W1UA 3BZCA 4GCVA 4IF4A 5A2QK 2RN7A 1W0TA 2QM3A 4LITA 4CCNA 2R7RA 1X4OA 1R1TA 3IP4B 1XX5A 5CVUA 1H9TA 2L7ZA 5GADJ 1B9MA 3BG6A 3ZQ7A 2DW4A 1K4SA 4DYCA 1X3WB 2HOEA 4U87A 1V5FA 1T33A 3BG5A 4A69C 4RGSA 4C9YA 2DBBA 4P9UA 5E3NA 5A2QZ 1HW2A 1I50J 3ZMSA 1DUXC 2EIJH 2W25A 2ZMEC 1Y8RB 5H6RA 3PJRA 2GXBA 2R7QA 4B47A 5IOZA 1BL0A 4HRIA 2MH9A 4CCMA 2X1EA 4E7HA 1MDMB 4A3EJ 4IHXA 3CUQC 3BT9A 4XLEA 1PDNC 5F0CA 4XLHA 3MKLA 4MEXF 3I4PA 2VUMJ 1EH6A 4W97A 1JUMA 1SVMA 5BOXA 1YIJI 4TV7A 3L2UA 5HNFA 3C3WA 3CD6I 1QQIA 2GBYA 3CMYA 1GLNA 1J0RA 2L4MA 4ENMA 1H89C 4IHWA 4BHPA 4UXNA 4Y7NJ 3CCMI 3V7SA 2QLZA 3F21A 4FE4A 3QYBA 4D0PA 3M3YJ 1G3YA 2HQRA 1B1BA 2IRFG 3JRFA 3DEEA 2K27A 2QZ8A 4DZJA 3H9JA 1EH8A 2PJRB 4KN7X 1QHGA 2KDZA 3ABMH 2HXOA 2XF7A 4NC6A 3OS1A 4D7NA 3HTUA 2E35A 2ZC2A 3LFKA 4CZCA 1MGTA 1ZGWA 2X6YA 5F08A 3F72A 1EKEA 1GXPA 3OR2C 1R58A 5FJ8J 4EGYA 1OMIA 2YU3A 3E3VA 4PCQA 1OCOH 3HEFA 1S7OA 1FIPA 2Y9YA 3FXRA 4F93B 2HQNA 1FOKA 4M73A 1TTYA 2JRMA 3W2AA 1D8JA 2K4JA 4OIPF 1ZREA 1SFEA 3O2PE 2ID3A 4BH9A 5L3CA 3DCFA 3L2VA 4XLFA 3CJNA 2VONA 2V9VA 3LL7A 2PEXA 2WB1N 4KT6A 4KIBA 2EIKH 1XMAA 3GTPJ 2RV8A 3ZP5A 2ZJQF 3GXOA 3GTLJ 4F7ZA 1SD6A 2ZMEB 3SJMA 2NVQJ 3GW2A 1REPC 1ZK8A 5LD2C 4Y13A 3JRCA 4PK4A 1J9IA 2V1NA 5KAFC 4DW6A 3KEYA 3C2HA 2KIMA 4MQVA 3CUQA 2QKMB 4BACA 1V3FA 4FX4A 2VKVA 4ENNA 1QNTA 1R36A 2QYOA 4DYQA 4UUSA 3NWSA 1TW3A 5J4YA 3QQAA 3DKXA 2IXSA 3OYLA 3NAUA 1SC7A 2BHZA 3HHGA 3DLAA 1B9NA 4A2UA 3J81Z 2HTSA 3M07A 5D8KB 1VFCA 2KLOA 2NNYA 1A5JA 4C2UA 3J7AO 1IAWA 4PFPA 1FP1D 4RGXA 4A3BJ 1WSUA 5IT9Z 1CQTA 1B4AA 1Z67A 2V6CA 3OYAA 2PQ8A 4PFOA 2WWYA 1E17A 2XVCA 2H8RA 1F36A 3KIOA 4XLNF 2P7CB 1SD4A 2X6OA 3GYHX 2UXXA 4QLCU 3GX4X 1VQKI 3HJEA 1UELB 4LG0B 2VODA 1A04A 4LB5A 2UWMA 4GDFA 4A3CJ 1BR4A 2ZXIA 3OYDA 2IGOA 1OYWA 4OAZA 5EGOA 2A69F 3OSGA 1HDPA 5DD4A 2HQAA 2VN2A 1LFUP 2LK2A 5K5OA 3FXKA 2OZUA 3CDLA 2VQGA 5KCMA 4I7HA 2XSDC 1IN4A 1JUPA 5BPIA 5M3FJ 1GT0C 3ZXSA 1WJ5A 2EZKA 3FMRA 3PFYA 4A3KJ 1ETXA 2HKXA 3CC7I 2HVQA 2OU2A 3WGHA 3LA3A 3H35A 4UV9A 3SDBA 2FJ1A 2A61A 2W82A 3VOEA 2L9VA 2ZXWH 1VQLI 2HTJA 4IQ4A 3PQJA 4AIDA 2ZJRF 4ZYEA 5LGNA 5K7ZA 1OYIA 2G9WA 2O6GE 2DCEA 1FT9A 2OTLI 2HPMA 1MZBA 2ADUA 2HYGD 5TRDA 2IS1A 2CU7A 2V1UA 3DTEA 3R61A 2XAUA 2HVRA 3I53A 3F0CA 4XRSG 4HNTA 1VQPI 3JCUC 2JVHA 1KU7A 3E1SA 3WG9A 5FFZA 2M45A 3JW4A 2ICWG 2RQQA 3ML6A 3TW7A 1FOWA 3QOPA 5DEQA 5HDKA 1YHQI 4M9XA 1ZG1A 4Q5SF 4G9YA 2AXLA 4KMFA 3JREA 3BG9A 1Y39A 2UZKA 2DTZA 2Y0SA 2F5FA 4QTRA 3W2WA 3CP8A 3OYIA 1BC8C 4LLNA 5B1BH 3FISA 3H92A 2Z16A 3RKYA 4IOCF 4XKVA 5J1RA 1ZLKA 3ABLH 1OCZH 5J1UA 2W48A 1TLHB 2F4IA 2MG4A 2KQRA 2PG4A 4AU7A 1WVRA 4KUMA 2LVSA 2R7VA 2DFIA 2WAQN 1JKOC 2QQAA 3D5SC 3PL8A 5D5UB 2E1CA 1BOBA 1AOYA 4UB6C 4JP0A 2WAQA 3OYHA 1FNNA 1JHFA 2HEOA 3GLLA 5AIPA 4BAYA 1U5TC 5K5QA 2H8WA 2ELJA 2XAQA 3DEWA 4WXCA 3JRIA 1HXDA 3EYIA 5IP6A 2FE3A 2R7ZJ 2STWA 1Z9CA 4E7JA 5JLWA 4M6VA 4Q48A 4B4CA 1KQ9A 3MN2A 4IHVA 1RZ4A 1VQ8I 2ISYA 1P2FA 3I71A 4IEJA 4H0EA 2RVCA 3VWBA 1KZHA 3TBIA 4E7ZA 1YRNB 1XGSA 3F22A 2STTA 3RPUD 3OIPA 2DXIA 4MO7A 2BYVE 4J01A 5CQGA 2R7WA 1PP7U 5D8LB 3F6VA 4MNUA 3K69A 4RLFA 1IC8A 3HOWJ 3D0SA 3VSKA 2VBYA 3BPXA 3I0TA 5IYDJ 1OCRH 2PJPA 2OUMA 5TGTA 2LD5A 4I0AA 5E1XA 2HDCA 5D6EA 4JX5A 1TT0A 1FTTA 2LC2A 3VEPA 5KAIC 2R7OA 3P7NA 4WXHA 4U0WA 2EA4A 1T39A 1LDDA 1AWCA 3OOPA 3CCVI 3U1KA 4IL6C 1Y56A 2QA4I 2HDDA 2XIGA 3JR9A 3UR3C 3J80Z 3L7WA 1BC7C 2K9MA 4XRMA 4HNVA 3Q5FA 2ECBA 1H8AC 1ZARA 3OL3A 2M0CA 4DJAA 1HSTA 3L2QA 1YLFA 1I5ZA 2M34A 1JJ6C 4D5CA 4CYCB 4AYBA 2MGQA 4BS9A 2L7MP 1W7PB 3HUGA 4XLCA 3HSFA 3S2WA 3RDIA 2NVXJ 2X0LA 2JA8J 3KLOA 1XMKA 4C2TA 4EJVA 3BZ6A 5H6QA 3OY9A 2XHKA 1HF0A 1UB9A 1VF9A 2EH3A 3FBNB 1W36C 2CV0A 3BJOA 3I54A 5E8IA 2KT0A 3TP0A 2KL4A 3FXJA 4JBAA 5FLVA 2K9SA 3O3KA 1I39A 1B8IA 1K83J 1D0YA 1KA8A 2LRDA 1HA8A 1SFKA 1LDJA 4U0YA 4IO9F 2F48A 4IHTA 4EMSA 5FKLA 3S3MA 1J59A 5M5XJ 2W4SA 4LK1F 1JT6A 3F6OA 5JVTA 3RCOA 4PGGA 1ZR4A 1HBXG 3K4KA 4XKWA 4M74A 2K86A 1TL8A 2QBYA 3OV8A 3KP2A 5F64A 4D9JA 2Y48A 3BR2A 5KNLA 1ZH5A 1K78A 1AHDP 1P9QC 2JUCA 3Q0VA 2M2EA 1WGXA 1IDZA 4PDKA 5DV5A 3HUGB 2DDBA 2GOMA 1DGRM 3S8PA 2NRAC 2ZO4A 4BXFA 2OBPA 2BGCA 1HSJA 4II2A 4Y3OA 2A05A 4G12A 4IKFA 4CDGA 2M4KA 5C44J 1A35A 3BZKA 3IC7A 4M3GA 4N9IA 5AIQA 3S1QJ 3A03A 1R1VA 2XAJA 1FEXA 2LBFB 1WI3A 3RZOJ 3D5RC 4RM2A 5F0HA 4Z2YA 1X1AA 2DMNA 2W84A 3FXOA 4DIQA 2B9SA 2P0WA 1WHUA 2DN0A 1W4MA 2MH2A 4BU2A 2KRHA 1F5TA 1NHAA 2OCEA 4P9FA 3JAMK 1WWXA 5HODA 3PSIA 1YE9A 1V4RA 2CJJA 3L09A 2IW5A 1DQUA 3ELKA 4RB0A 2BW3B 1O3QA 3KLNA 3C2BA 4L0ZB 2Z5UA 2E2JJ 3HOXJ 2LKPA 4B8XA 1GDTA 2CRGA 5CLSA 1Y8QB 3IHUA 2OQRA 1ZQ3P 3A4CA 1G3SA 2HOTA 1ZGAA 3U2RA 2MA3A 4R8HA 2IS4A 2COMA 1JJ8C 1H9GA 3JSOA 4N9HA 2DO7A 4HW0A 2E71A 2DI3A 3R6SA 3RKXA 3LOCA 1USSA 4BHCA 4HA8A 2YUSA 1G59A 2A6TA 4BNCA 2R0QC 2ZJPF 4C3IJ 3K4JA 3IH3A 5HLIA 2LKXA 2EZIA 2VJ4A 3SDGA 3ULQB 3V8LA 2LF7A 4KICA 4UY8I 1Z6RA 4A3MJ 1TQMA 2WA0A 3QU6A 5HOOA 3IAM2 1A6QA 2XAGA 4XNFA 3GTGJ 3GFIA 4EJUA 2E5ZA 2OAZA 4KITB 1K4TA 4BE2A 1TQIA 2KJBA 2A68F 3KP3A 5HS9A 1VZ0A 1DPUA 2PJRA 4GGGA 5IYBJ 4JX6A 3Q0UA 4HEA2 3DXJF 2P8TA 2H27A 3OYFA 4RAFA 5FLXK 1YI2I 3MEXA 3HBLA 2E7XA 4MLOA 4OU0A 2BV6A 5B66C 4ABZA 3FK7A 2LBFA 5J47A 2KISA 2AO9A 2XRLA 1WQ2A 1QZEA 4FISA 1HDDC 3TQNA 4PZJA 5KK1A 1R6RA 1TWAJ 2FOWA 3IV5A 3LSRA 4XRFA 4OAYA 1IRXA 3O6BB 2YPRA 2ZJ2A 2QSGX 5F04A 2ID6A 4AYBN 2DK8A 4Z6YA 3F8FA 5DDGA 3CCUI 5LBQA 1K7AA 1IN8A 2JK3A 1AA7A 1LPQA 3K7AJ 4FX0A 4CUGA 3HL2A 2RDPA 3UKGA 2CSOA 4ASNA 1K78B 2FMYA 2G0EA 1UHSA 3QWLA 4ZYAA 1RNLA 3M1EA 3BQYA 3PQKA 4Y17A 2C6YA 1UFMA 1R5GA 2A6EF 1JKPC 1XDUA 2FU4A 1H0MA 1EA3A 5JHFA 2XC7A 2VE8A 1K61A 2L2OA 1T0FA 2WC2A 2FF4A 4S0HB 3FZVA 1PYVA 2EINH 5ICEA 2JPCA 1XCVA 3FF5A 3RPQA 3PUBA 2LLKA 1JGSA 3CCSI 4U7DA 4EM0B 3DKWA 4C30A 3HB9A 4F52A 3ZQHA 3P5JA 3ZQFA 4KJZA 2M7BA 1ON2A 2VC0A 2CG4A 3K4BA 4GRIA 4OIOF 2R5YB 4BJ6C 1I1SA 1LUJB 4FASD 1P7JA 1R5ID 3B6CA 2P4WA 3MD2A 3HRSA 3V7CA 4OWRB 4Q4ZF 2Z1DA 3P9IA 2OA4A 1I27A 3G6EI 1W5SA 3M1CA 2VXDA 2JT1A 1R4MB 1TWHJ 2CQ7A 3FDYA 1XB4A 4YIRX 3DF8A 1MMAA 2E7WA 1VTNC 4KA4A 2F4OB 4PJMA 1S9HA 2Y2ZA 4A12A 2Z9OA 1UAAA 3DPUA 1IUFA 2IBDA 1TWCJ 1BBYA 3RIRA 1FWZA 4EVIA 1LVKA 2Y30A 2OCCH 2I5UA 4D7MA 3HPGA 3DEUA 1YQAA 2E34A 1LEAA 4YG2F 5L3GA 2QENA 4WCGA 2MD5A 3CJRB 2M8EA 4KIGA 2E60A 1YJNI 4BHBA 2BVLA 2FOKA 2CGPA 1IXCA 1NG6A 2PMHA 1FBQA 3Q0WA 3KP7A 2AXTC 2JMWA 1MSFC 3E0JB 3DTIA 3IRRA 1DU6A 4EATA 2CYYA 2G7HA 4O5VA 5FFXA 2HXIA 4CH7A 3OYEA 4J00A 2D1HA 5D5XB 1BI1A 4ZYGA 4I98B 2MBFA 3IWZA 5DM6F 2DAOA 3BQZA 4HF0A 4YIFA 2HOAA 3MAJA 4JX4A 2H94A 2M7AA 4XSZF 3RPUA 3ZMDA 4QIWN 1W5CC 2HQ5A 1R1UA 1STZA 3QPTA 3V8JA 4F55A 3H3ZA 1FYLA 1R23A 1X3UA 5EG0B 3JTHA 1IN6A 1WJAA 2GIZA 3GTMJ 3KPHA 2LFBA 1DDNA 1WI9A 2K40A 4H4KC 4MGRA 3H3UA 4V19K 3Q9VA 3G1LA 3OSFA 5BPDA 2LMDA 3OR1C 4HX8A 5M5WJ 1U5TB 2EBIA 4IX7A 3G4SI 2IA0A 3L00A 1T95A 2P5LC 3N4MA 1Z21A 3AG1H 3SEZA 4A3LJ 1SANA 2FRHA 5EGOB 4OINF 1FBUA 2LKSA 1U8BA 5DD8A 4OIQF 2RREA 4UV8A 3H5AA 4A6EA 4RAGA 5GTIC 1PUFB 1XD7A 2Z2SB 2F5VA 1BI2A 3GFJA 1S7AA 1MIJA 3M9AA 2R7FA 2VQLA 3EQLF 9ANTA 2GXGA 4GFBA 3S1NJ 5CYVA 5J40A 3OMYA 3DPLC 4LLGF 4EQQA 5HLHA 1OKRA 1R00A 3GLXA 1I1GA 1IGNA 3F3XA 4MEYF 5EYRA 1R9TJ 3BR1A 3KX2A 1HW5A 4P55A 4EJOA 4ZYHA 1T56A 3HC7A 2KRCA 3CF5F 2XF5A 3OS2A 2X6WA 1HW1A 3SZPA 4WK8F 2DJIA 2VKHA 2TCTA 2IP2A 3L1PA 1WH7A 4AUXA 1B8IB 4KT5C 1RC9A 3ISPA 1VQ9I 2R92J 1LE8B 2AHQA 3T8TA 1A36A 3FKIJ 3N97A 2W85A 1B72A 1T38A 2W57A 3IH2A 3J7YJ 1FSHA 1GVJA 2ZNYA 1R4NB 1NG7A 3K2ZA 3E97A 5DCMA 1NK3P 4NNJA 1G8XA 4A3IJ 4BEHB 3FHZA 2K9LA 3TO9A 1SAUA 1J75A 2K85A 2RAEA 3G71I 2I8DA 4BE0A 2LH9A 4U7BA 1X1PA 1LNWA 1W0UA 2L7KA 2JA2A 2X1DA 3H3VK 3ZQGA 3DTKA 3FM5A 3ZQIA 2V79A 1ZGJA 2NVYJ 2O8XA 3HRMA 2JWTA 4HQEA 2BY3A 3ZPLA 3WTTC 2BY2A 5JLXA 3SZTA 1F4KA 3DU5A 3JRGA 1S5LC 2DMQA 1NH3A 5IY5H 2VBXA 4NC7A 2QUFA 3G2BA 3ZQCA 3K1MA 4K2EA 4OMYA 4C3HJ 4IQJA 3S15J 2F2EA 1FYMA 2R7XA 5HLGA 2NNNA 2P5KA 4CCLA 1U9OA 5JR3A 3GTKJ 2VQHA 2YX4A 2MD0A 3A0BC 1IRFA 1GXQA 4M6YA 1Y6IA 4LK0F 3AG4H 4F92B 4RMNA 3TO7A 1MNDA 1P7IA 2YS9A 3TP3A 5CQEA 2DJNA 2D2WA 2IS2A 3WU0A 1X19A 4ZYDA 2O7OA 1QA6A 2R93J 5LHIA 2DA1A 3S3OA 1YW9A 4HSTA 2GAUA 1ERDA 2DMTA 2VBWA 3MQ0A 3CMAI 1OQYA 3ZN1A 2E5NA 1MMSA 4BGDA 1QO0D 2NOJB 1LEBA 2KP6A 1KQ8A 4U0VA 1ACIA 4P96A 4KN4X 5L3DA 1Z6TA 4X6AJ 4GYIA 1W1WE 3DPTA 3GMEA 4CO8A 1B72B 2YSRA 4EGZA 3H5NA 3SEQA 3MWMA 1JUSA 1Z05A 4HX4A 3HOTA 1Z1DA 1MNMC 4X0GA 4GXOA 2F5DA 1VQOI 5FKMA 2PMZA 4B44A 4FCYA 4IXAA 4BKXA 5GAHJ 3CCLI 5IT9K 2DQLA 1YTYA 3BCBA 1XGOA 3N05A 4UHTA 4RB2C 3ZR8X 4RA2A 4HG2A 2NOGA 2W7NA 4LG3A 2XUBA 1N77A 3A02A 3M8FA 2DFHA 1Z7UA 2MC4A 2Z99A 1MNEA 4I99C 3L9FA 4XOTA 1MW7A 3WGGA 1Q1HA 3WTYC 4I2OA 4JYKA 2MFZA 1C0WA 3PNYA 5F27A 1U6GA 3RSNA 4CCKA 1IV8A 4HOBA 3A1YA 1LKXA 2CS3A 4B43A 3CCEI 4UVBA 4JK1X 4HLXA 2N8GA 2A3SA 3DU6A 3BTJA 2X6XA 3K0LA 4FQGA 4RAYA 1S8NA 4L5IA 2F4MB 1KYZA 2JVGA 4L0YB 3B02A 3VYUB 1UHMA 1WJFA 1MH4A 1YS6A 5GP9A 2X1CA 2W24A 3PIOF 3JSPA 4AIKA 1PUEE 2IT0A 3JRBA 3KEOA 4OMZA 3I58A 4AVZA 1P4XA 4L9VA 4FHTA 3F8MA 1QGPA 4V2FA 1XS9A 3ZGKA 2DDAA 4OIRF 5EEGA 2HNHA 2M30A 2EFNA 2X48A 5FROA 4BDYA 1S72I 2VASA 1QZYA 3S1MJ 2FUG2 4NC8A 1FSEA 3PSFA 3RJPA 2M9HA 4ENJA 3EUKL 2R7DA 2UXNA 2JPBA 3WODF 5LLQA 3ABKH 3EUHA 4PSXA 4XN0A 1D3YA 2Z3YA 3LWFA 3I59A 2E1MB 4YFXF 3TGNA 2NVTJ 3IUOA 2A07F 4HBLA 2HS5A 2W00A 4XN3A 3E6DA 3IH4A 4DZPA 2HI3A 1TW2A 3NRVA 4HF2A 2E19A 2IA2A 4LLLA 3RQIA 5C4JJ 2H1KA 4G7ZF 1POGA 1UG2A 3NWTA 4IVNA 4BE1A 5E17F 3FHNA 1K6OA 3TKYA 2VIXA 1MMGA 5IP9J 3GCMA 3HSEA 2V7FA 4KIFA 1N78A 1X1BA 1ZR2A 2FQ3A 4NHJA 2PLYA 4HV6A 2DA7A 2WY7Q 1E3PA 2LNBA 5KVRA 3GZ5A 3A0HC 1FMVA 4HDVA 5D4SA 1T8IA 2DFFA 3TDUC 2ETHA 1D5YA 5LRRA 5F6FA 4IJAA 4G7OF 3SHFA 2ZSHB 4G6DA 2EFWA 3LAPA 3A2KA 1EJ9A 3K1NA 4DGWB 3DBLB 1JKQC 5KHDA 3ABUA 3MCZA 3VYSB 2PMZN 4L9NA 4XR6A 1U8RA 3I4NJ 3F8CA 5E20A 3A01A 2OF7A 3Q3SA 2LY1A 3PNVA 4YFNF 3A01B 1K79A 3KCCA 1D1AA 5H20A 2EV0A 2Q1ZB 3E7LA 5HLTA 3MKZA 4B3XA 4I01A 3I64A 3LA2A 4A3JJ 4M3EA 3E6CC 2DPDA 2Y31A 1FJLA 2CUJA 4U88A 5L3FA 3K6GA 1V5GA 2VKDA 5J8CA 1IJWC 5ERIA 5E3LA 2L9RA 2RC4A 3GTJJ 2CW0F 3RTRA 1O57A 1QPMA 4FETA 1RKTA 2BBYA 1GVDA 2DMPA 2Q2EB 2ZXJA 2XGCA 3PIPF 2IEKA 1GHCA 2DA5A 4PJJA 2DLLA 2A6HF 1VQ5I 2ZCWA 1F1ZA 1SVOA 1UHWA 2LY2A 3KYLA 4M3FA 2K4BA 4F3QA 4FE7A 2L3DA 3C18A 3H0GJ 3I56I 4HSRA 5FKKA 1DPRA 2V1XA 2B63J 4IRGA 4L5JA 2XPWA 3LSKA 1WJCA 3FBIB 4BBSJ 1FX7A 4OOIA 5IOYA 3EPZA 3RI4A 3HOUJ 1E3HA 1LJ9A 4YFKF 5D5VB 1SEUA 3P9KA 5K7HA 1XGMA 2JA7J 3H9GA 3VDXA 2K02A 5LRSA 1MJBA 4KMUX 2E1NA 3H0DA 5B5EC 3CO6C 1ETOA 2BW3A 2PFBA 1IV6A 1ZG5A 1DU0A 1MSEC 1KGSA 2IVMA 3UNGC
chains in the Genus database with same CATH topology
1EA3A 5JHFA 2XC7A 3OR2C 2L2OA 3CMMA 3K4NA 3VYTB 1WJEA 3S32A 2VJ5A 1PYVA 3AFHA 4F93B 2XDVA 3W2AA 3PUBA 1N75A 4JQFA 2KHMA 4C30A 5CPRB 3L2RA 4XLFA 3L2VA 4F52A 3LL7A 3LFUA 3CJQB 4KJZA 2M7BA 4GRIA 4KT6A 3K4BA 4BJ6C 5CKTA 4FASD 3MD2A 1U0JA 2CMPA 2MABA 4OWRB 2Z1DA 4XQFA 2ZXHA 5LD2C 3BCAA 3IAS2 3H9QA 4PK4A 2V1NA 3KEYA 1OR7C 3C2HA 3M1CA 2VXDA 4N4OB 3FDYA 4P1WA 3OWTA 1MMAA 2QKMB 4BACA 3VSLA 4PJMA 1S9HA 1UAAA 3DPUA 3NWSA 4BL0B 4PSWA 3DKXA 2IXSA 3OYLA 2A5WA 1LVKA 3DLAA 2UV1A 3HPGA 2KLOA 4C2UA 3HOSA 2CUZA 3ONQA 4PFPA 3CJRB 2VJIA 1X4PA 2E60A 2BVLA 2M3AA 4BJTA 2CW8A 4PFOA 4CA0A 5LFAA 3SYTA 3OYAA 1NG6A 4N4NB 3LSHA 3E0JB 3DTIA 2WAFA 1UELB 3FKJA 4EATA 4QPQA 2UWMA 4CH7A 1BR4A 2ZXIA 3OYEA 4J00A 3HKZA 3OYDA 2IGOA 1PJRA 4OAZA 3ZQQA 1YX3A 4ZDPA 2VB6A 2HQAA 3HXLA 5HNHA 3W2VA 4BUPA 3W3CA 2VQGA 3BC8A 1JI8A 3EUAA 2M7AA 5KCMA 3CP2A 1X1CA 2OC6A 1Z3YA 3ZXSA 4F55A 1WJ5A 3OIQA 3PFYA 2HU9A 2WAEA 4II3A 1WJAA 3BLYA 2HVQA 3H35A 4HPQA 3SDBA 4DBRA 4H4KC 2W82A 2DT7B 3M8JA 3AL0B 4IQ4A 2R7SA 2MYSA 3OR1C 2DCEA 3K70C 4IX7A 2HPMA 1T95A 2IS1A 4BDZA 1Z21A 3DTEA 2HVRA 2XAUA 2V26A 3SEZA 3SZGA 4HNTA 2JVHA 3E1SA 3LSGA 1WJDA 3K70D 3ZRGA 2CH0A 2RREA 2RQQA 3H5AA 1QU3A 2QKLB 4HNUA 2Z2SB 2F5VA 4E4HA 3F9KA 3V42A 2VQLA 2L9NA 4KISA 2Y0SA 3OYIA 3W2WA 1WFXA 3CP8A 2Z16A 3OMYA 2L5QA 3DPLC 4XKVA 4PUSA 1X1DA 4ZDOA 2F4IA 3MKYB 2KQRA 4AU7A 2R7VA 4BQNA 3TMOA 3KX2A 3D5SC 3PL8A 1OLTA 1FMWA 3HC7A 2KRCA 3CF2A 1Z3XA 2R7TA 1BOBA 1V5EA 2X6WA 2XF5A 3OS2A 4RLQA 1K6YA 2DJIA 2WAQA 2VKHA 3OYHA 2ZSIB 4XLAA 4XM3A 2ELJA 4D1QA 2BOLA 2X51A 4E7JA 4ZTJA 4XL9A 1NG7A 2JUGA 1DP3A 3OL4A 4NQWB 3QYEA 4NNJA 1G8XA 4BEHB 2M4GA 2K9LA 1SAUA 2DOAA 4BEHA 4JOMA 3OYMA 3OYKA 2XSJC 3VWBA 2I8DA 4E7ZA 3TBIA 2F6CA 4BE0A 2R7UA 2LH9A 4U7BA 3TL4X 3RPUD 3OIPA 2DXIA 3DWLE 3AL0C 2L7KA 2JA2A 2X1DA 4BJ5C 3DTKA 4J01A 5CQGA 4XORA 2R7WA 3MMYB 4XKCA 2KDOA 4RLFA 3DU5A 2IGNA 3OYBA 3VSKA 4R79A 3MKWB 1BR2A 4NC7A 4XKBA 3G2BA 2OUMA 5TGTA 3CZ6A 1KONA 4IQJA 1BR1A 3HPHA 1LFPA 2HPIA 1TT0A 2R7XA 2LC2A 3RQ4A 4CCLA 1Z7LA 3J7AY 2R7OA 2VQHA 2MD0A 3AKZA 3HG9A 1Y6IA 4F92B 1Y56A 2X85A 4RMNA 3LMMA 1MNDA 4YELA 2KPMA 4CCOA 3OS0A 3UR3C 5CQEA 4BQQA 2IS2A 1X19A 2K9MA 4PJLA 3ZCOA 3U21A 3VYRB 3S3OA 4HSTA 1ERDA 1MMNA 3OL3A 4DJAA 3L2QA 2BVMA 5FRMA 2E5NA 4AYBA 4BGDA 4BS9A 2VL8A 2NOJB 3EUHC 2KP6A 4XLCA 3OOUA 3LSMA 1E0EA 3DPTA 1D0XA 2JSPA 2OV7A 4C2TA 3H5NA 3SEQA 3OY9A 2CV0A 3FBNB 4XONA 1W36C 2V4JC 3HOTA 2KL4A 3BG7A 4X0GA 3OYNA 2CV1A 3DKYA 1D0YA 2LRDA 2PMZA 2K3PA 1SFKA 3K4CA 3LSIA 4B44A 1HA8A 4PJNA 2DT6A 2KZVA 2KMUA 3S3MA 3BCBA 3N05A 3H5RA 2W4SA 2IS6A 3ZR8X 4BQOA 4HG2A 3RCOA 5HVQC 2UUZA 4YRVA 4LG3A 2W7NA 1N77A 3QOEA 3K4KA 4XKWA 3CESA 1LDKB 2MC4A 4XMYA 1MNEA 4ZTFA 4XOTA 1MW7A 2M0MA 3S93A 2VLAA 2MFZA 4D9JA 2XF6A 3PNYA 5KNLA 3RSNA 4CCKA 3A1YA 3K4LA 1LKXA 2CS3A 4B43A 4E7KA 4NUBA 2E1MC 2RNGA 1QHHD 3S3NA 1P9QC 3DU6A 1D1BA 1UG0A 2X6XA 3K10A 3QODA 4ZC3A 2JVGA 1DGWY 2CFOA 4ITVA 3VYUB 1WJFA 2VJJA 2X1CA 3HUGB 4ZDLA 1D1CA 1TZLA 2GOMA 1DGRM 3S8PA 4BXFA 4AVZA 4CSWA 4II2A 4Y3OA 4YEJA 1MMDA 4Y33A 4IKFA 2M4KA 2L9SA 4B48A 3ZGKA 2LYCA 2WY8Q 2IGKA 2HNHA 5FROA 4BDYA 2LBFB 2VASA 3D5RC 2FUG2 4NC8A 4RM2A 3PSFA 2O5RA 3PNTA 3EUKL 1X1AA 4QPOA 3I9V2 4DIQA 4F91B 3L2WA 2P0WA 3D5LA 4PSXA 4BU2A 2KRHA 4DOZA 4XN0A 4G6TB 4DBQA 3PSIA 2E1MB 1YE9A 4CCJA 3IUOA 1W36D 4E7IA 2W00A 1DQUA 2BW3B 4XN3A 3I3LA 4ANJA 2LG4A 2V6EA 3QYFA 3A4CA 4IZZA 3NWTA 1YX5A 1ZELA 4BE1A 2HVSA 2IS4A 3FHNA 2VIXA 1MMGA 2V7FA 2WB1A 1N78A 2K5CA 1X1BA 2LOOA 2WY7Q 1G59A 1J09A 1FMVA 2A6TA 2GOXB 2CW7A 4ZJZA 3K4JA 1D0ZA 2VJ4A 2ZSHB 4P5OA 3A2KA 3OYGA 4DGWB 5KHDA 2WA0A 2AQEA 3K4MA 4LITA 3VYSB 4CCNA 1X4OA 3IAM2 4XNFA 4XR6A 5HOOA 3IP4B 2R7RA 2E5ZA 4XOPA 2LY1A 4Y4RA 2HDWA 3PNVA 4KITB 4BE2A 3BG6A 2VQCA 1D1AA 4RM3A 4U87A 1V5FA 2Q1ZB 3GBGA 4C9YA 5HLTA 1VZ0A 3MKZA 3OYJA 4B3XA 4E6KG 2PJRA 2WADA 3PJRA 2R7QA 4B47A 4HEA2 4LIVA 3OYFA 2CUJA 4HRIA 4MLOA 4CCMA 2LREA 3K6GA 1V5GA 2X1EA 4E7HA 2VKDA 2CV2A 2LBFA 4XLEA 3RTRA 4XLHA 4FETA 4E7SA 2Q2EB 3OYCA 4E7LA 2VPLA 4PJJA 1R6RA 2ZFUA 3L2UA 2LY2A 5HNFA 2WBMA 2W1OA 3KYLA 4OAYA 1WJBA 1IRXA 4F3QA 1GLNA 4HSRA 3DQVC 4LIUA 3LSKA 1WJCA 3FBIB 3QYBA 2IGMA 3EPZA 1AA7A 2VXZA 1T0FC 2HZDA 4CUGA 3HL2A 3DEEA 2R4GA 5FRNA 3H9JA 2V9KA 4ZYAA 2PJRB 3H9GA 3VDXA 1QHGA 2XF7A 3OS1A 3H0DA 2BW3A 3C2GA 4CZCA 2AQFA 2X6YA 3UNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9S A; 
#chains in the Genus database with same CATH topology
 3K2A A;  3LQQ A;  4ZZL A;  3CMM A;  2PX9 A;  1MBK A;  4I6Z A;  2VJ5 A;  3HYI A;  1OYY A;  3F23 A;  1ENH A;  3KFW X;  1FIA A;  5E79 C;  3WTU C;  2FML A;  1SFU A;  3EYY A;  2KHM A;  2M5W A;  1ETQ A;  3L2R A;  3BOQ A;  2E1O A;  2M87 A;  2Q2E A;  3GO5 A;  3LFU A;  3QPL A;  5EZG A;  1E2X A;  3HGY A;  2MSY A;  2DU9 A;  5L3E A;  1CGP A;  5EDN A;  5E18 F;  1J7K A;  2EFQ A;  1U0J A;  2MAB A;  3ECO A;  1FC3 A;  4XQF A;  1P4A A;  3BCA A;  2ZME A;  2XV4 S;  2BHY A;  3H9Q A;  3HHH A;  2DMU A;  2Y0M A;  4HX7 A;  3E5Q A;  5CJ9 A;  1ETY A;  1QZZ A;  4LB6 B;  3OWT A;  2BXY A;  4QSH A;  1OCC H;  1FOY A;  3VSL A;  3QU3 A;  1IUY A;  1XG1 A;  4BL0 B;  2RNJ A;  4PSW A;  2A5W A;  4AC0 A;  4B09 A;  2DOE A;  2FBK A;  2HOS A;  1YRN A;  3E5U A;  3S2H J;  3VB2 A;  2BY1 A;  3LQR A;  5FLM J;  3IKT A;  3BR6 A;  2O3F A;  4HAM A;  4L9T A;  2I10 A;  3E5X A;  2DPU A;  3ONQ A;  2HGC A;  1JXS A;  2CFX A;  4O6J A;  3T5X A;  4B3A A;  1X4P A;  1VQM I;  2MLK A;  2M3A A;  3CUO A;  3PO3 J;  3FXL A;  2H1L A;  3WTX C;  1IRZ A;  2ELH A;  2XPU A;  1KQ0 A;  1MBF A;  1Z77 A;  2E36 A;  4QPQ A;  5E8G A;  4LG0 A;  2G7U A;  1UJ8 A;  3HKZ A;  1HKS A;  2DA2 A;  3M4O J;  1PJR A;  2KFD A;  3ZQQ A;  4CIC A;  3LAJ A;  1YX3 A;  2XB5 A;  3KE2 A;  2VB6 A;  4EM2 A;  5E3O A;  3HXL A;  2E2I J;  1VQ7 I;  2LF8 A;  5HNH A;  3BWG A;  3W3C A;  1PUF A;  1JI8 A;  3EDP A;  1ZRC A;  3MFK A;  3B6A A;  1G2H A;  1X1C A;  3CUQ B;  1QVT A;  5FD5 A;  3AG3 H;  3OIQ A;  2CUF A;  4HV5 A;  3R0J A;  3H36 A;  2HU9 A;  1XN7 A;  4AVP A;  2FX0 A;  3NAR A;  1P4W A;  5FD6 A;  3QP6 A;  3F8B A;  1ULY A;  2DOD A;  1RUN A;  2JTV A;  2DT7 B;  4HZF A;  3M8J A;  5F1R A;  2GA2 A;  2VI6 A;  1TNT A;  3NEU A;  4HQM A;  4PJ0 C;  1QVU A;  3BG3 A;  3JRH A;  2FNA A;  2D45 A;  1Q1V A;  4BDZ A;  3VPR A;  1KU9 A;  1RPW A;  3KZY A;  2P6S A;  2V26 A;  2Y9Z A;  3SZG A;  1MBG A;  3SQN A;  1BJA A;  4J19 A;  4L18 B;  5IP7 J;  3K70 D;  3ZRG A;  2CH0 A;  3MZH A;  2VBZ A;  2ME0 A;  1PVE A;  1QU3 A;  4A3D J;  2QKL B;  2TRT A;  4M6X A;  2NAZ A;  3KP4 A;  4E4H A;  4BY7 J;  3F9K A;  1YOV B;  3MVP A;  1OPC A;  4B1R A;  1TP4 A;  2L9N A;  1RRJ A;  4BQA A;  4KDP A;  2GQQ A;  3J7Z I;  4KIS A;  4WWC A;  1WFX A;  5DCM B;  1VQ6 I;  2HFH A;  2QQB A;  1MBH A;  1X1D A;  1O3S A;  3C1D A;  1ZTR A;  2P5V A;  3MKY B;  2XPV A;  4BQN A;  1ETV A;  1NK2 P;  3DLL F;  1SD7 A;  3T8R A;  4KYW A;  5CVI A;  2GWR A;  1Z3X A;  2R7T A;  1TQP A;  3ZN0 A;  2JSC A;  1K6Y A;  2VE9 A;  1ON1 A;  4CYC A;  3S14 J;  2CQQ A;  3MZY A;  2O03 A;  2NS7 A;  2KIF A;  4Y15 A;  1JGG A;  1BN5 A;  4PGH A;  2Q8K A;  2ESN A;  2ELK A;  2IAI A;  1ETK A;  1J5Y A;  5IPA A;  5F0F A;  3WTV C;  1LB2 A;  1OCT C;  2OQG A;  3C7J A;  1JE8 A;  1ETW A;  3WHB A;  1XSV A;  4ZTJ A;  3RKW A;  3WTW C;  3KET A;  1G3W A;  1DP3 A;  2FD5 A;  2IPQ X;  3WHC A;  3OL4 A;  1Y1V J;  3QYE A;  1SFO J;  2DOF A;  1IRG A;  1I3Q J;  1IF1 A;  5TJJ A;  2M4G A;  5FLX Z;  3GFM A;  3CJT B;  5B1A H;  3I5U A;  5DCF A;  3KYC B;  3FMS A;  4RB3 C;  1OJL A;  3OYK A;  4AM3 A;  2X4H A;  2XSJ C;  1FLI A;  2GIV A;  4G6Q A;  3ERM A;  4CGZ A;  2F6C A;  3G1O A;  3BR5 A;  3FMQ A;  3DWL E;  4XIC A;  3AL0 C;  4BJ5 C;  1IN7 A;  2CO5 A;  2XAF A;  2JN6 A;  3JRA A;  2QBY B;  1HLV A;  2M8G X;  3BR0 A;  5LHH A;  4FTH A;  2IGN A;  3HSR A;  4R79 A;  3MKW B;  1XTA A;  1BR2 A;  3ASN H;  5CVR A;  3BJ6 A;  1BR1 A;  4Q47 A;  4BXU A;  3HPH A;  2HPI A;  2DTR A;  2QQ9 A;  1S6L A;  1L0O C;  4QWQ A;  1LFB A;  4M72 A;  3TED A;  3HDD A;  4A0Z A;  3LMM A;  4L9J A;  4XID A;  1R71 A;  5HS8 A;  1QBJ A;  1YYV A;  3ABT A;  4BQQ A;  2VPR A;  5LGU A;  4XRS A;  5C3E J;  4EJT A;  2EQR A;  3HOZ J;  3P9C A;  1T2K A;  1XDS A;  4ZZD A;  2LY9 A;  1MMN A;  2CWE A;  2BEO A;  3WU2 C;  2L4A A;  2BVM A;  2E2H J;  1EH7 A;  4WXD A;  5FRM A;  4Y52 J;  5AON A;  2V9P A;  1O4X A;  2XGE A;  3EUH C;  1U3E M;  3OOU A;  3LSM A;  4L5E A;  1E0E A;  1D0X A;  2JSP A;  2GA1 A;  1XPX A;  3DBR B;  2XAS A;  1RR8 C;  1QRY A;  3QPH A;  3CCR I;  4HLY A;  4XON A;  5F1J A;  3PO2 J;  1MH3 A;  1VI0 A;  5D5W B;  3BG7 A;  2Z33 A;  1IW7 F;  2NVU B;  3R4K A;  3OYN A;  4A6D A;  2PBI A;  3DKY A;  2CV1 A;  2OTJ I;  3RYR A;  1JT0 A;  3LSI A;  5HDG A;  2DT6 A;  1BW6 A;  2KZV A;  1W5T A;  2KMU A;  2NS8 A;  2IS6 A;  4LMY A;  4E70 A;  2D5V A;  1X58 A;  3COA C;  2UUZ A;  4YRV A;  1T08 B;  4HYE A;  3QOE A;  3S1R J;  3CES A;  1YIT I;  1LDK B;  4O3M A;  1D5V A;  4MIM A;  4AIJ A;  3ESW B;  1ZHF A;  1BIB A;  2DYS H;  4ZTF A;  4NDL A;  4UNO A;  1RR7 A;  1S7E A;  2HYF A;  2M0M A;  3M8E A;  4XK4 A;  1R22 A;  4RDU A;  2MLG A;  3BTC A;  1TNS A;  1O3R A;  4E7K A;  2E1M C;  2RNG A;  3ZOB A;  3S3N A;  2J5P A;  2CUE A;  3U1D A;  3ZMZ A;  4I0B A;  3I59 B;  1MBE A;  1EF4 A;  3TOA A;  1UG0 A;  3K10 A;  2JQ7 A;  5JFR A;  1VQN I;  4D5F A;  1RIO H;  1DGW Y;  2CFO A;  2CQK A;  3AG2 H;  1H88 C;  3FXQ A;  1MD0 A;  5FKN A;  2H6C A;  2PI0 A;  2L54 A;  1D1C A;  5GPC A;  3VFZ A;  3WTS C;  2HYJ A;  1ZAO A;  2KIQ A;  5JHU A;  2K9Q A;  4CSW A;  1BA5 A;  3HGG A;  2LSO A;  3BDD A;  2B0L A;  2R5Z B;  1L3L A;  2L9S A;  1U78 A;  3V4G A;  4HDU A;  2WY8 Q;  4C2M J;  2FQ4 A;  3R60 A;  3EET A;  1KU2 A;  3IL2 A;  3BJA A;  2O5R A;  3CDH A;  3PNT A;  4F91 B;  3WU1 B;  2KZG A;  3I9V 2;  3L2W A;  3CCQ I;  1V54 H;  3D5L A;  1YW8 A;  5LHG A;  2ZFW A;  2O8K A;  1UST A;  2OJE D;  4DOZ A;  4IHY A;  3T1B A;  1G3T A;  2FA5 A;  2DA4 A;  1BI3 A;  1RKW A;  2ZNZ A;  5K7F A;  4KNY A;  3I3L A;  4ANJ A;  5EF6 A;  2V6E A;  4M3B A;  1HOM A;  1WZ2 A;  2QEX I;  3JAM Z;  3S17 J;  3RYP A;  1YX5 A;  1ZEL A;  2HVS A;  1A6I A;  1IXR C;  1EV7 A;  3FIW A;  4XLP F;  1MDM A;  2DA3 A;  1HKQ A;  2K5C A;  4IHS A;  2FNP A;  1ORK A;  2B7E A;  2JJ7 A;  4UVA A;  5L3B A;  4C3J J;  2DFE A;  1J09 A;  3TDZ C;  2EV5 A;  4ZJZ A;  5D4R A;  1I3A A;  1D0Z A;  1SFX A;  5CVV A;  4P5O A;  1IDY A;  3OYG A;  3I4M J;  5GTH C;  3K4M A;  2AQE A;  5D6F A;  3QPS A;  3DBH B;  5GAG J;  1ODD A;  4XOP A;  1VND A;  4Y4R A;  2HDW A;  1OIS A;  3WE3 A;  3GUD A;  2VQC A;  3CLO A;  5EJC A;  2F5C A;  4RM3 A;  5DTD A;  2HWV A;  3GBG A;  3OYJ A;  4E6K G;  1W7P A;  2WAD A;  3E6B A;  1RET A;  1FY7 A;  1YJ9 I;  2PN6 A;  4LIV A;  5DUK A;  2R5Z A;  1UMQ A;  3F8N A;  2RKH A;  2LRE A;  1SMT A;  2O9L A;  1HC8 A;  5TIS C;  3KP5 A;  1O3T A;  2CV2 A;  2Q0O A;  4M9S A;  5GPA A;  2BY0 A;  3I55 I;  4IPA A;  5DUI A;  5E3M A;  4E7S A;  1Z91 A;  1YO5 C;  5J6X A;  3OYC A;  4E7L A;  5FB2 A;  2LTP A;  3V8K A;  5J3L A;  2VPL A;  2ZFU A;  3CLQ A;  5M5Y J;  3KYD B;  1M1E B;  2WBM A;  2W1O A;  3L2C A;  1R5H A;  4YII A;  1WJB A;  5E1W A;  3DQV C;  3ZQL A;  1UCR A;  2DA6 A;  4HF1 A;  2IA1 A;  4LIU A;  3HOV J;  3WTZ A;  2IGM A;  2VXZ A;  1T0F C;  3TOB A;  2HZD A;  4AD9 A;  1TWG J;  2KJC A;  2XB0 X;  1I6X A;  2R4G A;  4DQ2 A;  5FRN A;  2ACJ A;  2V9K A;  1Y0N A;  2HKO A;  4I76 A;  4EJW A;  4ESB A;  2L02 A;  2BXZ A;  1T98 A;  3C2G A;  5LGT A;  5ICC A;  2AQF A;  1O7L A;  5DM7 F;  3GZ6 A;  3HOY J;  1LVA A;  4GYG A;  2ZKZ A;  2GZW A;  4LJZ F;  1IG7 A;  2KRF A;  3E6M A;  3K4N A;  4WX9 A;  4XSX F;  4CYD A;  3VYT B;  1MJA A;  1WJE A;  3S32 A;  3AFH A;  2TDX A;  1WKM A;  2XDV A;  4S05 A;  4S04 A;  1XSD A;  1N75 A;  4JQF A;  2QWW A;  3HRT A;  1KU3 A;  1SVL A;  2QCO A;  2XGD A;  1XMX A;  5CPR B;  5LEJ A;  2LDU A;  4M9Z A;  5HS7 A;  4CXF A;  1NTC A;  3CJQ B;  1JTX A;  4G7H F;  1O7F A;  4RAZ A;  1RUO A;  5CKT A;  2R5Y A;  3DV8 A;  4A3G J;  3LNQ A;  1OCP A;  3RKQ A;  3R0A A;  2CMP A;  4AIH A;  2ZXH A;  4N0B A;  3LSP A;  1FP2 A;  1OFC X;  3IAS 2;  1LE8 A;  4M71 A;  1Y1W J;  2O61 A;  1P6R A;  1Y0U A;  1OR7 C;  3BRO A;  4N4O B;  3CME I;  2ZBK A;  4P1W A;  4ZH4 F;  4EEF G;  4MFE A;  4A0Y A;  3CC2 I;  4UVC A;  2XKO A;  2GM4 A;  2QSH X;  3HM5 A;  5GAE J;  5EG0 A;  3IRQ A;  3G3Z A;  5ED4 A;  3GZN B;  5IT3 A;  1IZ1 A;  3IWF A;  1XC5 A;  4I02 A;  1YIO A;  2EFP A;  3KZZ A;  2OPT A;  2UV1 A;  3V7R A;  3X2Q H;  2NXN B;  5J8F A;  3ZMU A;  4G94 A;  1U2W A;  4IRH A;  3BTL A;  2P6T A;  3HOS A;  2CUZ A;  1B59 A;  2EJR A;  3G1M A;  5BQT A;  5LEK A;  4ESJ A;  2VJI A;  3W6J B;  1DP7 P;  2FBH A;  4BY1 J;  4BJT A;  4CA0 A;  1JHH A;  2CW8 A;  5LFA A;  3K1P A;  3SYT A;  4CHU A;  2D1V A;  3LSJ A;  4N4N B;  2EWN A;  1ZLJ A;  1BW5 A;  2XGX A;  1AU7 A;  3LSH A;  3HIF A;  1MKM A;  2EPF A;  6PAX A;  2WAF A;  3FKJ A;  3M7G A;  1YFH A;  2GLO A;  4BXX J;  1BIA A;  3ASO H;  1HKT A;  1FTZ A;  4RB1 A;  1TWF J;  2RGV A;  4MTE A;  4RBO A;  2L01 A;  3GF2 A;  2XKP A;  3QP5 A;  4ZDP A;  2QQ8 A;  1W7P D;  1RES A;  3ECH A;  2XAH A;  2VT3 A;  3FM3 A;  3W2V A;  4BUP A;  4UUS B;  3BC8 A;  3EUA A;  5DYM A;  5JVG F;  3CP2 A;  2AS5 F;  1BM9 A;  2CQN A;  2Y75 A;  2OC6 A;  5FGM A;  1Z3Y A;  3W6V A;  4RGR A;  1B6A A;  2WAE A;  2ZB9 A;  4II3 A;  4V2G A;  2WTE A;  4UB8 C;  5CVJ A;  4CZZ A;  3BLY A;  1ZN2 A;  2COB A;  1T6S A;  1FYK A;  1X3Z B;  1GUU A;  4HPQ A;  4DBR A;  1SAX A;  1WRJ A;  1F43 A;  5ILU A;  2YU9 J;  2JRT A;  2X9D A;  3AL0 B;  2EIL H;  4M3D A;  2R7S A;  2DK5 A;  3FX3 A;  5HDN A;  2MYS A;  2P81 A;  1E3O C;  3K70 C;  5BNG A;  3O8H A;  1P92 A;  1UZC A;  1YG2 A;  3ZMT A;  1V55 H;  2WV1 A;  4LFU A;  1AKH A;  2KKO A;  2FXA A;  2BZT A;  1ITY A;  1SD5 A;  1I6H J;  3LSG A;  1WJD A;  2MC3 A;  5EZH A;  1FOX A;  3ZMV A;  2OZ6 A;  2ECC A;  4HNU A;  2MW8 A;  1S3J A;  5C4X J;  3V42 A;  2VC1 A;  3S16 J;  3KZI C;  5J1Y A;  3WGI A;  3SXY A;  1FBS A;  4EV0 A;  2L5Q A;  5B3S H;  4PUS A;  3J80 K;  3ROU A;  2K3F A;  4IRI A;  2VKE A;  1D8K A;  1KYW A;  1X2M A;  1R49 A;  4ZDO A;  3H1C A;  1YJW I;  1JTY A;  3TMO A;  4NB5 A;  4MQ9 F;  1FPQ A;  2JA5 J;  1OLT A;  1FMW A;  4ETS A;  1PP8 F;  3CF2 A;  1V5E A;  2V1D A;  1R7J A;  5ILS A;  1Z0X A;  4RLQ A;  1BJZ A;  2ZSI B;  2ESH A;  3LST A;  2Y0S N;  3U9G A;  1APL C;  3GTO J;  5EEH A;  4GO1 A;  4XLA A;  3HKZ N;  4WF2 A;  4XM3 A;  3D1N I;  3HRU A;  1XSX A;  4D1Q A;  2BOL A;  2EZL A;  2IJL A;  2LR8 A;  2X51 A;  3REO A;  4LGW A;  4XL9 A;  1CF7 A;  2EV6 A;  2JUG A;  2JZY A;  2WV0 A;  2DT5 A;  4NQW B;  3GWZ A;  3G73 A;  3KEQ A;  4AWX B;  3TW6 A;  2OD5 A;  3MZ8 A;  2DOA A;  5E1Z B;  4BEH A;  2CQX A;  2FSW A;  4JOM A;  3OYM A;  1U9N A;  1VQ4 I;  3BTI A;  2R7U A;  1ZG3 A;  2K7L A;  3TL4 X;  2EA2 A;  1WH5 A;  1ZYR F;  3FWE A;  3FXU A;  3IKV A;  4XBF A;  2QSF X;  5M3M J;  4XOR A;  2EFO A;  3MMY B;  3DFG A;  4XKC A;  2VOP A;  2KDO A;  3VOD A;  2FEZ A;  5IYC J;  3OYB A;  1AKH B;  3GVA A;  5H2F C;  4UUT A;  3HZJ A;  1QPI A;  4XKB A;  4RS8 A;  3OIO A;  2RQP A;  3CZ6 A;  1KON A;  5K5R A;  2FBI A;  2EZH A;  3CCY A;  1LFP A;  3RQ4 A;  2BE5 F;  1Z7L A;  3J7A Y;  5BS6 A;  1FZP B;  3AKZ A;  3WE2 A;  3HG9 A;  2NS0 A;  2A5Y B;  1JKR C;  2QF7 A;  2X85 A;  1OR7 A;  3WG7 H;  3GTQ J;  4YEL A;  2KPM A;  4CCO A;  3ERE D;  1HCR A;  3OS0 A;  2JA6 J;  1S29 A;  3B73 A;  4A5M A;  4A5N A;  1CF7 B;  4PJL A;  5EEA A;  1WPK A;  3ZCO A;  4ON0 A;  3U21 A;  3VYR B;  1WCM J;  3CDI A;  4ENK A;  3CTA A;  3JTG A;  1RI7 A;  2XRO A;  3HTS B;  5J4V A;  2EIM H;  2VL8 A;  1G4D A;  3RZD J;  3QAH A;  5JI6 A;  3T0Y A;  2DYR H;  4RGU A;  1J2X A;  4MHG A;  2OV7 A;  2HZT A;  1U5T A;  4BBR J;  3Q9S A;  1F9N A;  2V4J C;  4A93 J;  4LD5 A;  3CC4 I;  3J81 K;  4NQW A;  2ME6 A;  3FXM A;  3K4C A;  2K3P A;  4MFD A;  4PJN A;  5DS9 A;  1XGN A;  2GXA A;  3H5R A;  4BQO A;  5HVQ C;  5FKO A;  1MBJ A;  2YX7 A;  2PMU A;  3FK6 A;  2XRN A;  2EB7 A;  1TBX A;  3PUF A;  1XCB A;  4XMY A;  5FO5 A;  3DP7 A;  1X2N A;  2L7F P;  3S93 A;  5ICF A;  2VLA A;  3GFL A;  2XF6 A;  1A31 A;  3O8G A;  3SFI A;  2Y69 H;  3K4L A;  2QVO A;  4X1E A;  2H6B A;  4NUB A;  4A0X A;  2R3S A;  5ICG A;  5BMZ A;  1ZRD A;  1QHH D;  1YW7 A;  3CQZ J;  2LP0 A;  1D1B A;  2EK5 A;  4DNC A;  4MTD A;  3QOD A;  4ZC3 A;  4EM1 A;  3K9T A;  4ITV A;  4A3F J;  4I09 A;  2VJJ A;  3BR3 A;  2QGU A;  4ZDL A;  3GEZ A;  1TZL A;  2O0Y A;  5ILV A;  1TT5 B;  2M1B A;  1N25 A;  1HQC A;  4LOC A;  1ZKG A;  4YEJ A;  3BPV A;  1MMD A;  4Y33 A;  2F5E A;  4B48 A;  3W6K B;  2DQR A;  1SMY F;  2LYC A;  3CO7 C;  2IGK A;  2KIU A;  1TC3 C;  4KFC A;  1IXS B;  1ONV A;  2HR3 A;  4QPO A;  4ESF A;  5K1Y A;  4UUV A;  3PFI A;  3BY6 A;  3TO6 A;  4FT8 A;  3AAF A;  3PM1 A;  1GV2 A;  4G6T B;  4DBQ A;  4G8X A;  4CCJ A;  1IN5 A;  1IO2 A;  3KP6 A;  1GV5 A;  2VT2 A;  3NQO A;  4E7I A;  1W36 D;  3JRD A;  1ZRF A;  2ISZ A;  3QRF F;  1LQ1 A;  2P7V B;  2LG4 A;  2H09 A;  3BP8 A;  3QYF A;  4DYR A;  1MJ9 A;  4IZZ A;  2J5O A;  1G6N A;  1YS7 A;  2L0K A;  1BI0 A;  2VOO A;  3S2D J;  4NBQ A;  2WB1 A;  2LOO A;  1BOA A;  2K9N A;  3CCJ I;  3LA7 A;  3SFZ A;  2YR2 A;  4BYY A;  4IOA F;  2GOX B;  4R1H A;  2CW7 A;  2NYX A;  4W1U A;  3BZC A;  4GCV A;  4IF4 A;  5A2Q K;  2RN7 A;  1W0T A;  2QM3 A;  4LIT A;  4CCN A;  2R7R A;  1X4O A;  1R1T A;  3IP4 B;  1XX5 A;  5CVU A;  1H9T A;  2L7Z A;  5GAD J;  1B9M A;  3BG6 A;  3ZQ7 A;  2DW4 A;  1K4S A;  4DYC A;  1X3W B;  2HOE A;  4U87 A;  1V5F A;  1T33 A;  3BG5 A;  4A69 C;  4RGS A;  4C9Y A;  2DBB A;  4P9U A;  5E3N A;  5A2Q Z;  1HW2 A;  1I50 J;  3ZMS A;  1DUX C;  2EIJ H;  2W25 A;  2ZME C;  1Y8R B;  5H6R A;  3PJR A;  2GXB A;  2R7Q A;  4B47 A;  5IOZ A;  1BL0 A;  4HRI A;  2MH9 A;  4CCM A;  2X1E A;  4E7H A;  1MDM B;  4A3E J;  4IHX A;  3CUQ C;  3BT9 A;  4XLE A;  1PDN C;  5F0C A;  4XLH A;  3MKL A;  4MEX F;  3I4P A;  2VUM J;  1EH6 A;  4W97 A;  1JUM A;  1SVM A;  5BOX A;  1YIJ I;  4TV7 A;  3L2U A;  5HNF A;  3C3W A;  3CD6 I;  1QQI A;  2GBY A;  3CMY A;  1GLN A;  1J0R A;  2L4M A;  4ENM A;  1H89 C;  4IHW A;  4BHP A;  4UXN A;  4Y7N J;  3CCM I;  3V7S A;  2QLZ A;  3F21 A;  4FE4 A;  3QYB A;  4D0P A;  3M3Y J;  1G3Y A;  2HQR A;  1B1B A;  2IRF G;  3JRF A;  3DEE A;  2K27 A;  2QZ8 A;  4DZJ A;  3H9J A;  1EH8 A;  2PJR B;  4KN7 X;  1QHG A;  2KDZ A;  3ABM H;  2HXO A;  2XF7 A;  4NC6 A;  3OS1 A;  4D7N A;  3HTU A;  2E35 A;  2ZC2 A;  3LFK A;  4CZC A;  1MGT A;  1ZGW A;  2X6Y A;  5F08 A;  3F72 A;  1EKE A;  1GXP A;  3OR2 C;  1R58 A;  5FJ8 J;  4EGY A;  1OMI A;  2YU3 A;  3E3V A;  4PCQ A;  1OCO H;  3HEF A;  1S7O A;  1FIP A;  2Y9Y A;  3FXR A;  4F93 B;  2HQN A;  1FOK A;  4M73 A;  1TTY A;  2JRM A;  3W2A A;  1D8J A;  2K4J A;  4OIP F;  1ZRE A;  1SFE A;  3O2P E;  2ID3 A;  4BH9 A;  5L3C A;  3DCF A;  3L2V A;  4XLF A;  3CJN A;  2VON A;  2V9V A;  3LL7 A;  2PEX A;  2WB1 N;  4KT6 A;  4KIB A;  2EIK H;  1XMA A;  3GTP J;  2RV8 A;  3ZP5 A;  2ZJQ F;  3GXO A;  3GTL J;  4F7Z A;  1SD6 A;  2ZME B;  3SJM A;  2NVQ J;  3GW2 A;  1REP C;  1ZK8 A;  5LD2 C;  4Y13 A;  3JRC A;  4PK4 A;  1J9I A;  2V1N A;  5KAF C;  4DW6 A;  3KEY A;  3C2H A;  2KIM A;  4MQV A;  3CUQ A;  2QKM B;  4BAC A;  1V3F A;  4FX4 A;  2VKV A;  4ENN A;  1QNT A;  1R36 A;  2QYO A;  4DYQ A;  4UUS A;  3NWS A;  1TW3 A;  5J4Y A;  3QQA A;  3DKX A;  2IXS A;  3OYL A;  3NAU A;  1SC7 A;  2BHZ A;  3HHG A;  3DLA A;  1B9N A;  4A2U A;  3J81 Z;  2HTS A;  3M07 A;  5D8K B;  1VFC A;  2KLO A;  2NNY A;  1A5J A;  4C2U A;  3J7A O;  1IAW A;  4PFP A;  1FP1 D;  4RGX A;  4A3B J;  1WSU A;  5IT9 Z;  1CQT A;  1B4A A;  1Z67 A;  2V6C A;  3OYA A;  2PQ8 A;  4PFO A;  2WWY A;  1E17 A;  2XVC A;  2H8R A;  1F36 A;  3KIO A;  4XLN F;  2P7C B;  1SD4 A;  2X6O A;  3GYH X;  2UXX A;  4QLC U;  3GX4 X;  1VQK I;  3HJE A;  1UEL B;  4LG0 B;  2VOD A;  1A04 A;  4LB5 A;  2UWM A;  4GDF A;  4A3C J;  1BR4 A;  2ZXI A;  3OYD A;  2IGO A;  1OYW A;  4OAZ A;  5EGO A;  2A69 F;  3OSG A;  1HDP A;  5DD4 A;  2HQA A;  2VN2 A;  1LFU P;  2LK2 A;  5K5O A;  3FXK A;  2OZU A;  3CDL A;  2VQG A;  5KCM A;  4I7H A;  2XSD C;  1IN4 A;  1JUP A;  5BPI A;  5M3F J;  1GT0 C;  3ZXS A;  1WJ5 A;  2EZK A;  3FMR A;  3PFY A;  4A3K J;  1ETX A;  2HKX A;  3CC7 I;  2HVQ A;  2OU2 A;  3WGH A;  3LA3 A;  3H35 A;  4UV9 A;  3SDB A;  2FJ1 A;  2A61 A;  2W82 A;  3VOE A;  2L9V A;  2ZXW H;  1VQL I;  2HTJ A;  4IQ4 A;  3PQJ A;  4AID A;  2ZJR F;  4ZYE A;  5LGN A;  5K7Z A;  1OYI A;  2G9W A;  2O6G E;  2DCE A;  1FT9 A;  2OTL I;  2HPM A;  1MZB A;  2ADU A;  2HYG D;  5TRD A;  2IS1 A;  2CU7 A;  2V1U A;  3DTE A;  3R61 A;  2XAU A;  2HVR A;  3I53 A;  3F0C A;  4XRS G;  4HNT A;  1VQP I;  3JCU C;  2JVH A;  1KU7 A;  3E1S A;  3WG9 A;  5FFZ A;  2M45 A;  3JW4 A;  2ICW G;  2RQQ A;  3ML6 A;  3TW7 A;  1FOW A;  3QOP A;  5DEQ A;  5HDK A;  1YHQ I;  4M9X A;  1ZG1 A;  4Q5S F;  4G9Y A;  2AXL A;  4KMF A;  3JRE A;  3BG9 A;  1Y39 A;  2UZK A;  2DTZ A;  2Y0S A;  2F5F A;  4QTR A;  3W2W A;  3CP8 A;  3OYI A;  1BC8 C;  4LLN A;  5B1B H;  3FIS A;  3H92 A;  2Z16 A;  3RKY A;  4IOC F;  4XKV A;  5J1R A;  1ZLK A;  3ABL H;  1OCZ H;  5J1U A;  2W48 A;  1TLH B;  2F4I A;  2MG4 A;  2KQR A;  2PG4 A;  4AU7 A;  1WVR A;  4KUM A;  2LVS A;  2R7V A;  2DFI A;  2WAQ N;  1JKO C;  2QQA A;  3D5S C;  3PL8 A;  5D5U B;  2E1C A;  1BOB A;  1AOY A;  4UB6 C;  4JP0 A;  2WAQ A;  3OYH A;  1FNN A;  1JHF A;  2HEO A;  3GLL A;  5AIP A;  4BAY A;  1U5T C;  5K5Q A;  2H8W A;  2ELJ A;  2XAQ A;  3DEW A;  4WXC A;  3JRI A;  1HXD A;  3EYI A;  5IP6 A;  2FE3 A;  2R7Z J;  2STW A;  1Z9C A;  4E7J A;  5JLW A;  4M6V A;  4Q48 A;  4B4C A;  1KQ9 A;  3MN2 A;  4IHV A;  1RZ4 A;  1VQ8 I;  2ISY A;  1P2F A;  3I71 A;  4IEJ A;  4H0E A;  2RVC A;  3VWB A;  1KZH A;  3TBI A;  4E7Z A;  1YRN B;  1XGS A;  3F22 A;  2STT A;  3RPU D;  3OIP A;  2DXI A;  4MO7 A;  2BYV E;  4J01 A;  5CQG A;  2R7W A;  1PP7 U;  5D8L B;  3F6V A;  4MNU A;  3K69 A;  4RLF A;  1IC8 A;  3HOW J;  3D0S A;  3VSK A;  2VBY A;  3BPX A;  3I0T A;  5IYD J;  1OCR H;  2PJP A;  2OUM A;  5TGT A;  2LD5 A;  4I0A A;  5E1X A;  2HDC A;  5D6E A;  4JX5 A;  1TT0 A;  1FTT A;  2LC2 A;  3VEP A;  5KAI C;  2R7O A;  3P7N A;  4WXH A;  4U0W A;  2EA4 A;  1T39 A;  1LDD A;  1AWC A;  3OOP A;  3CCV I;  3U1K A;  4IL6 C;  1Y56 A;  2QA4 I;  2HDD A;  2XIG A;  3JR9 A;  3UR3 C;  3J80 Z;  3L7W A;  1BC7 C;  2K9M A;  4XRM A;  4HNV A;  3Q5F A;  2ECB A;  1H8A C;  1ZAR A;  3OL3 A;  2M0C A;  4DJA A;  1HST A;  3L2Q A;  1YLF A;  1I5Z A;  2M34 A;  1JJ6 C;  4D5C A;  4CYC B;  4AYB A;  2MGQ A;  4BS9 A;  2L7M P;  1W7P B;  3HUG A;  4XLC A;  3HSF A;  3S2W A;  3RDI A;  2NVX J;  2X0L A;  2JA8 J;  3KLO A;  1XMK A;  4C2T A;  4EJV A;  3BZ6 A;  5H6Q A;  3OY9 A;  2XHK A;  1HF0 A;  1UB9 A;  1VF9 A;  2EH3 A;  3FBN B;  1W36 C;  2CV0 A;  3BJO A;  3I54 A;  5E8I A;  2KT0 A;  3TP0 A;  2KL4 A;  3FXJ A;  4JBA A;  5FLV A;  2K9S A;  3O3K A;  1I39 A;  1B8I A;  1K83 J;  1D0Y A;  1KA8 A;  2LRD A;  1HA8 A;  1SFK A;  1LDJ A;  4U0Y A;  4IO9 F;  2F48 A;  4IHT A;  4EMS A;  5FKL A;  3S3M A;  1J59 A;  5M5X J;  2W4S A;  4LK1 F;  1JT6 A;  3F6O A;  5JVT A;  3RCO A;  4PGG A;  1ZR4 A;  1HBX G;  3K4K A;  4XKW A;  4M74 A;  2K86 A;  1TL8 A;  2QBY A;  3OV8 A;  3KP2 A;  5F64 A;  4D9J A;  2Y48 A;  3BR2 A;  5KNL A;  1ZH5 A;  1K78 A;  1AHD P;  1P9Q C;  2JUC A;  3Q0V A;  2M2E A;  1WGX A;  1IDZ A;  4PDK A;  5DV5 A;  3HUG B;  2DDB A;  2GOM A;  1DGR M;  3S8P A;  2NRA C;  2ZO4 A;  4BXF A;  2OBP A;  2BGC A;  1HSJ A;  4II2 A;  4Y3O A;  2A05 A;  4G12 A;  4IKF A;  4CDG A;  2M4K A;  5C44 J;  1A35 A;  3BZK A;  3IC7 A;  4M3G A;  4N9I A;  5AIQ A;  3S1Q J;  3A03 A;  1R1V A;  2XAJ A;  1FEX A;  2LBF B;  1WI3 A;  3RZO J;  3D5R C;  4RM2 A;  5F0H A;  4Z2Y A;  1X1A A;  2DMN A;  2W84 A;  3FXO A;  4DIQ A;  2B9S A;  2P0W A;  1WHU A;  2DN0 A;  1W4M A;  2MH2 A;  4BU2 A;  2KRH A;  1F5T A;  1NHA A;  2OCE A;  4P9F A;  3JAM K;  1WWX A;  5HOD A;  3PSI A;  1YE9 A;  1V4R A;  2CJJ A;  3L09 A;  2IW5 A;  1DQU A;  3ELK A;  4RB0 A;  2BW3 B;  1O3Q A;  3KLN A;  3C2B A;  4L0Z B;  2Z5U A;  2E2J J;  3HOX J;  2LKP A;  4B8X A;  1GDT A;  2CRG A;  5CLS A;  1Y8Q B;  3IHU A;  2OQR A;  1ZQ3 P;  3A4C A;  1G3S A;  2HOT A;  1ZGA A;  3U2R A;  2MA3 A;  4R8H A;  2IS4 A;  2COM A;  1JJ8 C;  1H9G A;  3JSO A;  4N9H A;  2DO7 A;  4HW0 A;  2E71 A;  2DI3 A;  3R6S A;  3RKX A;  3LOC A;  1USS A;  4BHC A;  4HA8 A;  2YUS A;  1G59 A;  2A6T A;  4BNC A;  2R0Q C;  2ZJP F;  4C3I J;  3K4J A;  3IH3 A;  5HLI A;  2LKX A;  2EZI A;  2VJ4 A;  3SDG A;  3ULQ B;  3V8L A;  2LF7 A;  4KIC A;  4UY8 I;  1Z6R A;  4A3M J;  1TQM A;  2WA0 A;  3QU6 A;  5HOO A;  3IAM 2;  1A6Q A;  2XAG A;  4XNF A;  3GTG J;  3GFI A;  4EJU A;  2E5Z A;  2OAZ A;  4KIT B;  1K4T A;  4BE2 A;  1TQI A;  2KJB A;  2A68 F;  3KP3 A;  5HS9 A;  1VZ0 A;  1DPU A;  2PJR A;  4GGG A;  5IYB J;  4JX6 A;  3Q0U A;  4HEA 2;  3DXJ F;  2P8T A;  2H27 A;  3OYF A;  4RAF A;  5FLX K;  1YI2 I;  3MEX A;  3HBL A;  2E7X A;  4MLO A;  4OU0 A;  2BV6 A;  5B66 C;  4ABZ A;  3FK7 A;  2LBF A;  5J47 A;  2KIS A;  2AO9 A;  2XRL A;  1WQ2 A;  1QZE A;  4FIS A;  1HDD C;  3TQN A;  4PZJ A;  5KK1 A;  1R6R A;  1TWA J;  2FOW A;  3IV5 A;  3LSR A;  4XRF A;  4OAY A;  1IRX A;  3O6B B;  2YPR A;  2ZJ2 A;  2QSG X;  5F04 A;  2ID6 A;  4AYB N;  2DK8 A;  4Z6Y A;  3F8F A;  5DDG A;  3CCU I;  5LBQ A;  1K7A A;  1IN8 A;  2JK3 A;  1AA7 A;  1LPQ A;  3K7A J;  4FX0 A;  4CUG A;  3HL2 A;  2RDP A;  3UKG A;  2CSO A;  4ASN A;  1K78 B;  2FMY A;  2G0E A;  1UHS A;  3QWL A;  4ZYA A;  1RNL A;  3M1E A;  3BQY A;  3PQK A;  4Y17 A;  2C6Y A;  1UFM A;  1R5G A;  2A6E F;  1JKP C;  1XDU A;  2FU4 A;  1H0M A;  1EA3 A;  5JHF A;  2XC7 A;  2VE8 A;  1K61 A;  2L2O A;  1T0F A;  2WC2 A;  2FF4 A;  4S0H B;  3FZV A;  1PYV A;  2EIN H;  5ICE A;  2JPC A;  1XCV A;  3FF5 A;  3RPQ A;  3PUB A;  2LLK A;  1JGS A;  3CCS I;  4U7D A;  4EM0 B;  3DKW A;  4C30 A;  3HB9 A;  4F52 A;  3ZQH A;  3P5J A;  3ZQF A;  4KJZ A;  2M7B A;  1ON2 A;  2VC0 A;  2CG4 A;  3K4B A;  4GRI A;  4OIO F;  2R5Y B;  4BJ6 C;  1I1S A;  1LUJ B;  4FAS D;  1P7J A;  1R5I D;  3B6C A;  2P4W A;  3MD2 A;  3HRS A;  3V7C A;  4OWR B;  4Q4Z F;  2Z1D A;  3P9I A;  2OA4 A;  1I27 A;  3G6E I;  1W5S A;  3M1C A;  2VXD A;  2JT1 A;  1R4M B;  1TWH J;  2CQ7 A;  3FDY A;  1XB4 A;  4YIR X;  3DF8 A;  1MMA A;  2E7W A;  1VTN C;  4KA4 A;  2F4O B;  4PJM A;  1S9H A;  2Y2Z A;  4A12 A;  2Z9O A;  1UAA A;  3DPU A;  1IUF A;  2IBD A;  1TWC J;  1BBY A;  3RIR A;  1FWZ A;  4EVI A;  1LVK A;  2Y30 A;  2OCC H;  2I5U A;  4D7M A;  3HPG A;  3DEU A;  1YQA A;  2E34 A;  1LEA A;  4YG2 F;  5L3G A;  2QEN A;  4WCG A;  2MD5 A;  3CJR B;  2M8E A;  4KIG A;  2E60 A;  1YJN I;  4BHB A;  2BVL A;  2FOK A;  2CGP A;  1IXC A;  1NG6 A;  2PMH A;  1FBQ A;  3Q0W A;  3KP7 A;  2AXT C;  2JMW A;  1MSF C;  3E0J B;  3DTI A;  3IRR A;  1DU6 A;  4EAT A;  2CYY A;  2G7H A;  4O5V A;  5FFX A;  2HXI A;  4CH7 A;  3OYE A;  4J00 A;  2D1H A;  5D5X B;  1BI1 A;  4ZYG A;  4I98 B;  2MBF A;  3IWZ A;  5DM6 F;  2DAO A;  3BQZ A;  4HF0 A;  4YIF A;  2HOA A;  3MAJ A;  4JX4 A;  2H94 A;  2M7A A;  4XSZ F;  3RPU A;  3ZMD A;  4QIW N;  1W5C C;  2HQ5 A;  1R1U A;  1STZ A;  3QPT A;  3V8J A;  4F55 A;  3H3Z A;  1FYL A;  1R23 A;  1X3U A;  5EG0 B;  3JTH A;  1IN6 A;  1WJA A;  2GIZ A;  3GTM J;  3KPH A;  2LFB A;  1DDN A;  1WI9 A;  2K40 A;  4H4K C;  4MGR A;  3H3U A;  4V19 K;  3Q9V A;  3G1L A;  3OSF A;  5BPD A;  2LMD A;  3OR1 C;  4HX8 A;  5M5W J;  1U5T B;  2EBI A;  4IX7 A;  3G4S I;  2IA0 A;  3L00 A;  1T95 A;  2P5L C;  3N4M A;  1Z21 A;  3AG1 H;  3SEZ A;  4A3L J;  1SAN A;  2FRH A;  5EGO B;  4OIN F;  1FBU A;  2LKS A;  1U8B A;  5DD8 A;  4OIQ F;  2RRE A;  4UV8 A;  3H5A A;  4A6E A;  4RAG A;  5GTI C;  1PUF B;  1XD7 A;  2Z2S B;  2F5V A;  1BI2 A;  3GFJ A;  1S7A A;  1MIJ A;  3M9A A;  2R7F A;  2VQL A;  3EQL F;  9ANT A;  2GXG A;  4GFB A;  3S1N J;  5CYV A;  5J40 A;  3OMY A;  3DPL C;  4LLG F;  4EQQ A;  5HLH A;  1OKR A;  1R00 A;  3GLX A;  1I1G A;  1IGN A;  3F3X A;  4MEY F;  5EYR A;  1R9T J;  3BR1 A;  3KX2 A;  1HW5 A;  4P55 A;  4EJO A;  4ZYH A;  1T56 A;  3HC7 A;  2KRC A;  3CF5 F;  2XF5 A;  3OS2 A;  2X6W A;  1HW1 A;  3SZP A;  4WK8 F;  2DJI A;  2VKH A;  2TCT A;  2IP2 A;  3L1P A;  1WH7 A;  4AUX A;  1B8I B;  4KT5 C;  1RC9 A;  3ISP A;  1VQ9 I;  2R92 J;  1LE8 B;  2AHQ A;  3T8T A;  1A36 A;  3FKI J;  3N97 A;  2W85 A;  1B72 A;  1T38 A;  2W57 A;  3IH2 A;  3J7Y J;  1FSH A;  1GVJ A;  2ZNY A;  1R4N B;  1NG7 A;  3K2Z A;  3E97 A;  5DCM A;  1NK3 P;  4NNJ A;  1G8X A;  4A3I J;  4BEH B;  3FHZ A;  2K9L A;  3TO9 A;  1SAU A;  1J75 A;  2K85 A;  2RAE A;  3G71 I;  2I8D A;  4BE0 A;  2LH9 A;  4U7B A;  1X1P A;  1LNW A;  1W0U A;  2L7K A;  2JA2 A;  2X1D A;  3H3V K;  3ZQG A;  3DTK A;  3FM5 A;  3ZQI A;  2V79 A;  1ZGJ A;  2NVY J;  2O8X A;  3HRM A;  2JWT A;  4HQE A;  2BY3 A;  3ZPL A;  3WTT C;  2BY2 A;  5JLX A;  3SZT A;  1F4K A;  3DU5 A;  3JRG A;  1S5L C;  2DMQ A;  1NH3 A;  5IY5 H;  2VBX A;  4NC7 A;  2QUF A;  3G2B A;  3ZQC A;  3K1M A;  4K2E A;  4OMY A;  4C3H J;  4IQJ A;  3S15 J;  2F2E A;  1FYM A;  2R7X A;  5HLG A;  2NNN A;  2P5K A;  4CCL A;  1U9O A;  5JR3 A;  3GTK J;  2VQH A;  2YX4 A;  2MD0 A;  3A0B C;  1IRF A;  1GXQ A;  4M6Y A;  1Y6I A;  4LK0 F;  3AG4 H;  4F92 B;  4RMN A;  3TO7 A;  1MND A;  1P7I A;  2YS9 A;  3TP3 A;  5CQE A;  2DJN A;  2D2W A;  2IS2 A;  3WU0 A;  1X19 A;  4ZYD A;  2O7O A;  1QA6 A;  2R93 J;  5LHI A;  2DA1 A;  3S3O A;  1YW9 A;  4HST A;  2GAU A;  1ERD A;  2DMT A;  2VBW A;  3MQ0 A;  3CMA I;  1OQY A;  3ZN1 A;  2E5N A;  1MMS A;  4BGD A;  1QO0 D;  2NOJ B;  1LEB A;  2KP6 A;  1KQ8 A;  4U0V A;  1ACI A;  4P96 A;  4KN4 X;  5L3D A;  1Z6T A;  4X6A J;  4GYI A;  1W1W E;  3DPT A;  3GME A;  4CO8 A;  1B72 B;  2YSR A;  4EGZ A;  3H5N A;  3SEQ A;  3MWM A;  1JUS A;  1Z05 A;  4HX4 A;  3HOT A;  1Z1D A;  1MNM C;  4X0G A;  4GXO A;  2F5D A;  1VQO I;  5FKM A;  2PMZ A;  4B44 A;  4FCY A;  4IXA A;  4BKX A;  5GAH J;  3CCL I;  5IT9 K;  2DQL A;  1YTY A;  3BCB A;  1XGO A;  3N05 A;  4UHT A;  4RB2 C;  3ZR8 X;  4RA2 A;  4HG2 A;  2NOG A;  2W7N A;  4LG3 A;  2XUB A;  1N77 A;  3A02 A;  3M8F A;  2DFH A;  1Z7U A;  2MC4 A;  2Z99 A;  1MNE A;  4I99 C;  3L9F A;  4XOT A;  1MW7 A;  3WGG A;  1Q1H A;  3WTY C;  4I2O A;  4JYK A;  2MFZ A;  1C0W A;  3PNY A;  5F27 A;  1U6G A;  3RSN A;  4CCK A;  1IV8 A;  4HOB A;  3A1Y A;  1LKX A;  2CS3 A;  4B43 A;  3CCE I;  4UVB A;  4JK1 X;  4HLX A;  2N8G A;  2A3S A;  3DU6 A;  3BTJ A;  2X6X A;  3K0L A;  4FQG A;  4RAY A;  1S8N A;  4L5I A;  2F4M B;  1KYZ A;  2JVG A;  4L0Y B;  3B02 A;  3VYU B;  1UHM A;  1WJF A;  1MH4 A;  1YS6 A;  5GP9 A;  2X1C A;  2W24 A;  3PIO F;  3JSP A;  4AIK A;  1PUE E;  2IT0 A;  3JRB A;  3KEO A;  4OMZ A;  3I58 A;  4AVZ A;  1P4X A;  4L9V A;  4FHT A;  3F8M A;  1QGP A;  4V2F A;  1XS9 A;  3ZGK A;  2DDA A;  4OIR F;  5EEG A;  2HNH A;  2M30 A;  2EFN A;  2X48 A;  5FRO A;  4BDY A;  1S72 I;  2VAS A;  1QZY A;  3S1M J;  2FUG 2;  4NC8 A;  1FSE A;  3PSF A;  3RJP A;  2M9H A;  4ENJ A;  3EUK L;  2R7D A;  2UXN A;  2JPB A;  3WOD F;  5LLQ A;  3ABK H;  3EUH A;  4PSX A;  4XN0 A;  1D3Y A;  2Z3Y A;  3LWF A;  3I59 A;  2E1M B;  4YFX F;  3TGN A;  2NVT J;  3IUO A;  2A07 F;  4HBL A;  2HS5 A;  2W00 A;  4XN3 A;  3E6D A;  3IH4 A;  4DZP A;  2HI3 A;  1TW2 A;  3NRV A;  4HF2 A;  2E19 A;  2IA2 A;  4LLL A;  3RQI A;  5C4J J;  2H1K A;  4G7Z F;  1POG A;  1UG2 A;  3NWT A;  4IVN A;  4BE1 A;  5E17 F;  3FHN A;  1K6O A;  3TKY A;  2VIX A;  1MMG A;  5IP9 J;  3GCM A;  3HSE A;  2V7F A;  4KIF A;  1N78 A;  1X1B A;  1ZR2 A;  2FQ3 A;  4NHJ A;  2PLY A;  4HV6 A;  2DA7 A;  2WY7 Q;  1E3P A;  2LNB A;  5KVR A;  3GZ5 A;  3A0H C;  1FMV A;  4HDV A;  5D4S A;  1T8I A;  2DFF A;  3TDU C;  2ETH A;  1D5Y A;  5LRR A;  5F6F A;  4IJA A;  4G7O F;  3SHF A;  2ZSH B;  4G6D A;  2EFW A;  3LAP A;  3A2K A;  1EJ9 A;  3K1N A;  4DGW B;  3DBL B;  1JKQ C;  5KHD A;  3ABU A;  3MCZ A;  3VYS B;  2PMZ N;  4L9N A;  4XR6 A;  1U8R A;  3I4N J;  3F8C A;  5E20 A;  3A01 A;  2OF7 A;  3Q3S A;  2LY1 A;  3PNV A;  4YFN F;  3A01 B;  1K79 A;  3KCC A;  1D1A A;  5H20 A;  2EV0 A;  2Q1Z B;  3E7L A;  5HLT A;  3MKZ A;  4B3X A;  4I01 A;  3I64 A;  3LA2 A;  4A3J J;  4M3E A;  3E6C C;  2DPD A;  2Y31 A;  1FJL A;  2CUJ A;  4U88 A;  5L3F A;  3K6G A;  1V5G A;  2VKD A;  5J8C A;  1IJW C;  5ERI A;  5E3L A;  2L9R A;  2RC4 A;  3GTJ J;  2CW0 F;  3RTR A;  1O57 A;  1QPM A;  4FET A;  1RKT A;  2BBY A;  1GVD A;  2DMP A;  2Q2E B;  2ZXJ A;  2XGC A;  3PIP F;  2IEK A;  1GHC A;  2DA5 A;  4PJJ A;  2DLL A;  2A6H F;  1VQ5 I;  2ZCW A;  1F1Z A;  1SVO A;  1UHW A;  2LY2 A;  3KYL A;  4M3F A;  2K4B A;  4F3Q A;  4FE7 A;  2L3D A;  3C18 A;  3H0G J;  3I56 I;  4HSR A;  5FKK A;  1DPR A;  2V1X A;  2B63 J;  4IRG A;  4L5J A;  2XPW A;  3LSK A;  1WJC A;  3FBI B;  4BBS J;  1FX7 A;  4OOI A;  5IOY A;  3EPZ A;  3RI4 A;  3HOU J;  1E3H A;  1LJ9 A;  4YFK F;  5D5V B;  1SEU A;  3P9K A;  5K7H A;  1XGM A;  2JA7 J;  3H9G A;  3VDX A;  2K02 A;  5LRS A;  1MJB A;  4KMU X;  2E1N A;  3H0D A;  5B5E C;  3CO6 C;  1ETO A;  2BW3 A;  2PFB A;  1IV6 A;  1ZG5 A;  1DU0 A;  1MSE C;  1KGS A;  2IVM A;  3UNG C; 
#chains in the Genus database with same CATH homology
 1EA3 A;  5JHF A;  2XC7 A;  3OR2 C;  2L2O A;  3CMM A;  3K4N A;  3VYT B;  1WJE A;  3S32 A;  2VJ5 A;  1PYV A;  3AFH A;  4F93 B;  2XDV A;  3W2A A;  3PUB A;  1N75 A;  4JQF A;  2KHM A;  4C30 A;  5CPR B;  3L2R A;  4XLF A;  3L2V A;  4F52 A;  3LL7 A;  3LFU A;  3CJQ B;  4KJZ A;  2M7B A;  4GRI A;  4KT6 A;  3K4B A;  4BJ6 C;  5CKT A;  4FAS D;  3MD2 A;  1U0J A;  2CMP A;  2MAB A;  4OWR B;  2Z1D A;  4XQF A;  2ZXH A;  5LD2 C;  3BCA A;  3IAS 2;  3H9Q A;  4PK4 A;  2V1N A;  3KEY A;  1OR7 C;  3C2H A;  3M1C A;  2VXD A;  4N4O B;  3FDY A;  4P1W A;  3OWT A;  1MMA A;  2QKM B;  4BAC A;  3VSL A;  4PJM A;  1S9H A;  1UAA A;  3DPU A;  3NWS A;  4BL0 B;  4PSW A;  3DKX A;  2IXS A;  3OYL A;  2A5W A;  1LVK A;  3DLA A;  2UV1 A;  3HPG A;  2KLO A;  4C2U A;  3HOS A;  2CUZ A;  3ONQ A;  4PFP A;  3CJR B;  2VJI A;  1X4P A;  2E60 A;  2BVL A;  2M3A A;  4BJT A;  2CW8 A;  4PFO A;  4CA0 A;  5LFA A;  3SYT A;  3OYA A;  1NG6 A;  4N4N B;  3LSH A;  3E0J B;  3DTI A;  2WAF A;  1UEL B;  3FKJ A;  4EAT A;  4QPQ A;  2UWM A;  4CH7 A;  1BR4 A;  2ZXI A;  3OYE A;  4J00 A;  3HKZ A;  3OYD A;  2IGO A;  1PJR A;  4OAZ A;  3ZQQ A;  1YX3 A;  4ZDP A;  2VB6 A;  2HQA A;  3HXL A;  5HNH A;  3W2V A;  4BUP A;  3W3C A;  2VQG A;  3BC8 A;  1JI8 A;  3EUA A;  2M7A A;  5KCM A;  3CP2 A;  1X1C A;  2OC6 A;  1Z3Y A;  3ZXS A;  4F55 A;  1WJ5 A;  3OIQ A;  3PFY A;  2HU9 A;  2WAE A;  4II3 A;  1WJA A;  3BLY A;  2HVQ A;  3H35 A;  4HPQ A;  3SDB A;  4DBR A;  4H4K C;  2W82 A;  2DT7 B;  3M8J A;  3AL0 B;  4IQ4 A;  2R7S A;  2MYS A;  3OR1 C;  2DCE A;  3K70 C;  4IX7 A;  2HPM A;  1T95 A;  2IS1 A;  4BDZ A;  1Z21 A;  3DTE A;  2HVR A;  2XAU A;  2V26 A;  3SEZ A;  3SZG A;  4HNT A;  2JVH A;  3E1S A;  3LSG A;  1WJD A;  3K70 D;  3ZRG A;  2CH0 A;  2RRE A;  2RQQ A;  3H5A A;  1QU3 A;  2QKL B;  4HNU A;  2Z2S B;  2F5V A;  4E4H A;  3F9K A;  3V42 A;  2VQL A;  2L9N A;  4KIS A;  2Y0S A;  3OYI A;  3W2W A;  1WFX A;  3CP8 A;  2Z16 A;  3OMY A;  2L5Q A;  3DPL C;  4XKV A;  4PUS A;  1X1D A;  4ZDO A;  2F4I A;  3MKY B;  2KQR A;  4AU7 A;  2R7V A;  4BQN A;  3TMO A;  3KX2 A;  3D5S C;  3PL8 A;  1OLT A;  1FMW A;  3HC7 A;  2KRC A;  3CF2 A;  1Z3X A;  2R7T A;  1BOB A;  1V5E A;  2X6W A;  2XF5 A;  3OS2 A;  4RLQ A;  1K6Y A;  2DJI A;  2WAQ A;  2VKH A;  3OYH A;  2ZSI B;  4XLA A;  4XM3 A;  2ELJ A;  4D1Q A;  2BOL A;  2X51 A;  4E7J A;  4ZTJ A;  4XL9 A;  1NG7 A;  2JUG A;  1DP3 A;  3OL4 A;  4NQW B;  3QYE A;  4NNJ A;  1G8X A;  4BEH B;  2M4G A;  2K9L A;  1SAU A;  2DOA A;  4BEH A;  4JOM A;  3OYM A;  3OYK A;  2XSJ C;  3VWB A;  2I8D A;  4E7Z A;  3TBI A;  2F6C A;  4BE0 A;  2R7U A;  2LH9 A;  4U7B A;  3TL4 X;  3RPU D;  3OIP A;  2DXI A;  3DWL E;  3AL0 C;  2L7K A;  2JA2 A;  2X1D A;  4BJ5 C;  3DTK A;  4J01 A;  5CQG A;  4XOR A;  2R7W A;  3MMY B;  4XKC A;  2KDO A;  4RLF A;  3DU5 A;  2IGN A;  3OYB A;  3VSK A;  4R79 A;  3MKW B;  1BR2 A;  4NC7 A;  4XKB A;  3G2B A;  2OUM A;  5TGT A;  3CZ6 A;  1KON A;  4IQJ A;  1BR1 A;  3HPH A;  1LFP A;  2HPI A;  1TT0 A;  2R7X A;  2LC2 A;  3RQ4 A;  4CCL A;  1Z7L A;  3J7A Y;  2R7O A;  2VQH A;  2MD0 A;  3AKZ A;  3HG9 A;  1Y6I A;  4F92 B;  1Y56 A;  2X85 A;  4RMN A;  3LMM A;  1MND A;  4YEL A;  2KPM A;  4CCO A;  3OS0 A;  3UR3 C;  5CQE A;  4BQQ A;  2IS2 A;  1X19 A;  2K9M A;  4PJL A;  3ZCO A;  3U21 A;  3VYR B;  3S3O A;  4HST A;  1ERD A;  1MMN A;  3OL3 A;  4DJA A;  3L2Q A;  2BVM A;  5FRM A;  2E5N A;  4AYB A;  4BGD A;  4BS9 A;  2VL8 A;  2NOJ B;  3EUH C;  2KP6 A;  4XLC A;  3OOU A;  3LSM A;  1E0E A;  3DPT A;  1D0X A;  2JSP A;  2OV7 A;  4C2T A;  3H5N A;  3SEQ A;  3OY9 A;  2CV0 A;  3FBN B;  4XON A;  1W36 C;  2V4J C;  3HOT A;  2KL4 A;  3BG7 A;  4X0G A;  3OYN A;  2CV1 A;  3DKY A;  1D0Y A;  2LRD A;  2PMZ A;  2K3P A;  1SFK A;  3K4C A;  3LSI A;  4B44 A;  1HA8 A;  4PJN A;  2DT6 A;  2KZV A;  2KMU A;  3S3M A;  3BCB A;  3N05 A;  3H5R A;  2W4S A;  2IS6 A;  3ZR8 X;  4BQO A;  4HG2 A;  3RCO A;  5HVQ C;  2UUZ A;  4YRV A;  4LG3 A;  2W7N A;  1N77 A;  3QOE A;  3K4K A;  4XKW A;  3CES A;  1LDK B;  2MC4 A;  4XMY A;  1MNE A;  4ZTF A;  4XOT A;  1MW7 A;  2M0M A;  3S93 A;  2VLA A;  2MFZ A;  4D9J A;  2XF6 A;  3PNY A;  5KNL A;  3RSN A;  4CCK A;  3A1Y A;  3K4L A;  1LKX A;  2CS3 A;  4B43 A;  4E7K A;  4NUB A;  2E1M C;  2RNG A;  1QHH D;  3S3N A;  1P9Q C;  3DU6 A;  1D1B A;  1UG0 A;  2X6X A;  3K10 A;  3QOD A;  4ZC3 A;  2JVG A;  1DGW Y;  2CFO A;  4ITV A;  3VYU B;  1WJF A;  2VJJ A;  2X1C A;  3HUG B;  4ZDL A;  1D1C A;  1TZL A;  2GOM A;  1DGR M;  3S8P A;  4BXF A;  4AVZ A;  4CSW A;  4II2 A;  4Y3O A;  4YEJ A;  1MMD A;  4Y33 A;  4IKF A;  2M4K A;  2L9S A;  4B48 A;  3ZGK A;  2LYC A;  2WY8 Q;  2IGK A;  2HNH A;  5FRO A;  4BDY A;  2LBF B;  2VAS A;  3D5R C;  2FUG 2;  4NC8 A;  4RM2 A;  3PSF A;  2O5R A;  3PNT A;  3EUK L;  1X1A A;  4QPO A;  3I9V 2;  4DIQ A;  4F91 B;  3L2W A;  2P0W A;  3D5L A;  4PSX A;  4BU2 A;  2KRH A;  4DOZ A;  4XN0 A;  4G6T B;  4DBQ A;  3PSI A;  2E1M B;  1YE9 A;  4CCJ A;  3IUO A;  1W36 D;  4E7I A;  2W00 A;  1DQU A;  2BW3 B;  4XN3 A;  3I3L A;  4ANJ A;  2LG4 A;  2V6E A;  3QYF A;  3A4C A;  4IZZ A;  3NWT A;  1YX5 A;  1ZEL A;  4BE1 A;  2HVS A;  2IS4 A;  3FHN A;  2VIX A;  1MMG A;  2V7F A;  2WB1 A;  1N78 A;  2K5C A;  1X1B A;  2LOO A;  2WY7 Q;  1G59 A;  1J09 A;  1FMV A;  2A6T A;  2GOX B;  2CW7 A;  4ZJZ A;  3K4J A;  1D0Z A;  2VJ4 A;  2ZSH B;  4P5O A;  3A2K A;  3OYG A;  4DGW B;  5KHD A;  2WA0 A;  2AQE A;  3K4M A;  4LIT A;  3VYS B;  4CCN A;  1X4O A;  3IAM 2;  4XNF A;  4XR6 A;  5HOO A;  3IP4 B;  2R7R A;  2E5Z A;  4XOP A;  2LY1 A;  4Y4R A;  2HDW A;  3PNV A;  4KIT B;  4BE2 A;  3BG6 A;  2VQC A;  1D1A A;  4RM3 A;  4U87 A;  1V5F A;  2Q1Z B;  3GBG A;  4C9Y A;  5HLT A;  1VZ0 A;  3MKZ A;  3OYJ A;  4B3X A;  4E6K G;  2PJR A;  2WAD A;  3PJR A;  2R7Q A;  4B47 A;  4HEA 2;  4LIV A;  3OYF A;  2CUJ A;  4HRI A;  4MLO A;  4CCM A;  2LRE A;  3K6G A;  1V5G A;  2X1E A;  4E7H A;  2VKD A;  2CV2 A;  2LBF A;  4XLE A;  3RTR A;  4XLH A;  4FET A;  4E7S A;  2Q2E B;  3OYC A;  4E7L A;  2VPL A;  4PJJ A;  1R6R A;  2ZFU A;  3L2U A;  2LY2 A;  5HNF A;  2WBM A;  2W1O A;  3KYL A;  4OAY A;  1WJB A;  1IRX A;  4F3Q A;  1GLN A;  4HSR A;  3DQV C;  4LIU A;  3LSK A;  1WJC A;  3FBI B;  3QYB A;  2IGM A;  3EPZ A;  1AA7 A;  2VXZ A;  1T0F C;  2HZD A;  4CUG A;  3HL2 A;  3DEE A;  2R4G A;  5FRN A;  3H9J A;  2V9K A;  4ZYA A;  2PJR B;  3H9G A;  3VDX A;  1QHG A;  2XF7 A;  3OS1 A;  3H0D A;  2BW3 A;  3C2G A;  4CZC A;  2AQF A;  2X6Y A;  3UNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...