2L9SA

Solution structure of pf1 sid1-msin3a pah2 complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
SNADYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the mSin3A PAH2-Pf1 SID1 Complex: A Mad1/Mxd1-Like Interaction Disrupted by MRG15 in the Rpd3S/Sin3S Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PHD finger protein 12
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1860 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9sA00
2L9SA
chains in the Genus database with same CATH superfamily
2KLOA 1S9HA 3BR5A 1IUYA 1ETYA 2H94A 4BH9A 4XLAA 1ZKGA 2V9VA 3HSRA 3VSKA 3FDYA 2OD5A 2HYFA 3HJEA 1F1ZA 4QPOA 4LG0A 4YRVA 3SZTA 3ECOA 3ERED 1KONA 4I6ZA 2AO9A 5ICFA 2ZXHA 3J80Z 3A02A 3QPTA 3MD2A 1K4SA 2ESNA 3TOBA 2CQNA 3OL4A 1BM9A 5ED4A 4AVZA 1B4AA 3GW2A 4IO9F 3I64A 2M7AA 2FXAA 2RN7A 4MTEA 1V3FA 2X1EA 1IC8A 1H88C 2LBFB 3TDUC 1W0UA 4MFEA 4LG0B 3K6GA 3JREA 2L4MA 2VBXA 5HLTA 4BE2A 1EA3A 4BHBA 4NUBA 1O3RA 2KJCA 4UHTA 2FMYA 2AXLA 2KKOA 4Y4RA 5CKTA 5HNHA 3V8KA 3ABKH 2STTA 3FXRA 1CGPA 5K7FA 2YUSA 4M9XA 1S5LC 3D5LA 3H35A 1USTA 3IV5A 2KP6A 3AG2H 4FQGA 3CMYA 1JKOC 1H9TA 3OSGA 3GEZA 3RJPA 1ZN2A 2VB6A 4A3KJ 1IXCA 1HDPA 4F55A 2K9SA 2QQ8A 4HF1A 3FHNA 3PNVA 1BOAA 1IW7F 2XRLA 4J01A 2EZIA 3ABUA 1HW1A 1BJAA 4H4KC 4Z2YA 4EV0A 1V5EA 1XD7A 4B47A 3ESWB 2XF6A 1Y0NA 2GIZA 2ACJA 3WTTC 2JN6A 2PEXA 4IHTA 2A3SA 3AG3H 2MABA 1SFKA 2Y48A 1YHQI 3ZMUA 2KPMA 4AIDA 3JRBA 3F22A 3OYAA 2MSYA 1HKQA 1JI8A 1HW5A 4D1QA 1K78B 1PYVA 1D8KA 3REOA 5FRMA 1BI3A 2M5WA 2UXNA 2WBMA 4G8XA 3K2AA 3K69A 1W7PA 1VNDA 3JSPA 2GLOA 1K6OA 4CYCA 4XLPF 2PG4A 3AKZA 4C2TA 1U5TA 5J4VA 4HBLA 4EM1A 2NVYJ 2VC0A 2XSJC 1R5GA 1DUXC 3GUDA 1OYIA 4UB8C 3C1DA 3GTPJ 1MBFA 4A3CJ 3T8TA 2CRGA 2QWWA 3C2GA 1Z91A 4UUTA 3LSGA 3BG5A 4RMNA 2M0MA 3OIPA 2GOMA 1H8AC 3WG7H 3K4MA 4I02A 2AXTC 3S93A 4L5JA 4PFPA 2JMWA 3H0GJ 3BZCA 1DQUA 3OWTA 1Z21A 2CQKA 1RR7A 4G7OF 1QA6A 2F48A 1P2FA 4F52A 5DEQA 2WWYA 2VKHA 4XN3A 4CICA 3BR6A 4BXUA 1ZARA 4RB3C 3B6AA 4E7SA 4I76A 5KAFC 4J19A 4G6DA 3GTKJ 1WJ5A 3RPUA 3RTRA 3EPZA 3ISPA 4GYIA 1TW2A 2W1OA 1IF1A 1XN7A 4AIJA 4A93J 3KP7A 4Q5SF 1RIOH 1BIBA 2IS2A 2BY3A 1X4OA 5LHGA 5EYRA 4AYBN 5IT3A 2QEXI 1X4PA 2ICWG 1FSEA 4OIQF 3OYBA 2LR8A 3KP6A 5FKMA 4GXOA 3GFIA 3SDGA 2RQQA 3NWSA 3JRAA 1X1AA 3PNTA 1SAUA 5EG0A 3F8NA 5E3LA 1RRJA 2DYSH 2Y0SN 2VQHA 4A3FJ 4D5CA 1FBSA 4C2UA 3Q0WA 1HC8A 1G3WA 3IKTA 1SFXA 1IO2A 3RZOJ 2EV0A 1LJ9A 2VONA 1TWAJ 2FE3A 3VFZA 4HNTA 2EINH 1N78A 1XDSA 3E1SA 4NC6A 1NTCA 1ZTRA 2HQAA 2IXSA 2HPIA 1O7LA 4LG3A 1ZRFA 1T38A 1UHMA 1SVOA 2XAHA 4IRGA 3A4CA 2NYXA 2VJIA 4P96A 3WU2C 3L2CA 1MBJA 2PMUA 2AQEA 4HPQA 4HW0A 2H09A 4RAGA 1FOWA 2BY1A 4ZZLA 1FYKA 3SDBA 1S7OA 2ELHA 4YEJA 2Q1ZB 3S2WA 5ERIA 1U9NA 1W4MA 4ETSA 2EA4A 1A6QA 4DOZA 1DPUA 1QVTA 3DV8A 2MLKA 1LFPA 4GO1A 5FFZA 1MJ9A 1XCVA 2KL4A 2M87A 2VT3A 1LEAA 4FTHA 4PCQA 2DQRA 2K40A 1I27A 4B8XA 4M72A 4EGZA 4IVNA 1XG1A 3RYRA 3CCVI 4M74A 2V26A 3WTUC 2LKXA 2DI3A 1B8IA 2DFFA 3I5UA 3V7CA 4U7DA 2K86A 3LMMA 1EH6A 4PFOA 2F6CA 5J1UA 2ZNYA 1MSEC 4JOMA 4DJAA 1Y8QB 3ZXSA 2FD5A 4EVIA 3R60A 2EIKH 3HG9A 2XRNA 3A0BC 3HYIA 2ZBKA 2XASA 3WG9A 4DZPA 4D0PA 2QSHX 1ZG1A 5E17F 1WJBA 1OR7C 2OPTA 3WU1B 2LRDA 1ZRCA 3W6KB 5FKKA 4XLEA 4CDGA 1U78A 3L7WA 4N4NB 2MD0A 4RGUA 3ZMVA 3TW7A 2IT0A 1R00A 2L01A 1HOMA 2WAQN 1DPRA 4AU7A 4BUPA 3VYRB 2EH3A 1YX5A 3KFWX 2AHQA 3FXJA 1CF7A 2Z16A 4R1HA 2HU9A 3U2RA 3OR1C 4ZYGA 3N4MA 1O4XA 2V9KA 2ZCWA 5LLQA 3TO6A 1K79A 2Q2EA 3WTVC 3KETA 4X1EA 1M1EB 2IA2A 3PL8A 1FEXA 3P5JA 1U2WA 3DBLB 2KT0A 3RKWA 5EDNA 1LFUP 2L02A 4IOAF 1A5JA 1GV5A 2DLLA 5GTIC 3DXJF 4M3GA 3DLAA 1K6YA 4C3IJ 3CLQA 2EFPA 2W7NA 3QPLA 1R4NB 2GM4A 2XC7A 3ZQLA 4MEYF 2VJ4A 5ILUA 5DYMA 3S15J 2XV4S 3PJRA 4RBOA 5HVQC 2CH0A 1U8BA 1QRYA 1R5HA 4M6YA 4ZZDA 1F9NA 5EEHA 3ZQIA 3BTJA 5J8FA 3P7NA 3FZVA 4AC0A 1X2MA 3K4LA 3VEPA 3QOPA 1FY7A 1FIAA 4RAYA 1YW9A 5HS7A 1IGNA 2Y69H 1E17A 4HNVA 3ZMTA 4L18B 5E8IA 2ELKA 1G3TA 4RA2A 1OCZH 2V1XA 4KUMA 3RSNA 2WC2A 3CZ6A 1ZR4A 5KVRA 3JR9A 1OR7A 1XMKA 1JHFA 2BYVE 2JWTA 3CF5F 4KFCA 5A2QZ 4LLGF 1F43A 1WQ2A 2RGVA 2OZ6A 1XPXA 1T39A 1T98A 5GPCA 3NQOA 4RAZA 3G2BA 2OCEA 3HHGA 3I0TA 3MKLA 5LHHA 1YTYA 4A3LJ 3FMRA 2OC6A 3LFUA 3W2AA 2IGNA 1YO5C 1RKTA 2Z33A 2A07F 4HF2A 3PUBA 3K1PA 1MBGA 3CDHA 2Y30A 2E19A 3FMQA 5ILSA 1BIAA 1ZREA 2VBZA 2HDCA 3COAC 1R1TA 3ASNH 3D0SA 5FO5A 2EJRA 3GZ5A 1ETKA 2XROA 2PMZA 1I3AA 3DU5A 3O8GA 1MZBA 5TGTA 1W7PB 1JT6A 4F93B 3IRRA 3TO9A 3H0DA 1B8IB 3FWEA 1IJWC 3OSFA 4HNUA 2OCCH 2HVQA 5DS9A 4XRSA 1UG0A 4P5OA 4ZYAA 4G94A 5FFXA 4CHUA 2L7FP 4KMUX 5KAIC 4UB6C 4KNYA 2XGDA 1REPC 1KQ9A 3TKYA 2ZJRF 1R36A 3HSEA 2VQCA 1RC9A 2WTEA 3SZPA 1I1GA 1EH8A 4DBQA 2R7RA 3H9GA 1B9NA 2XHKA 3OOUA 2MW8A 2CJJA 3HXLA 4L9JA 3OS1A 5BOXA 2EFQA 2CUFA 3LSMA 3K4CA 2O5RA 5F0FA 1OYYA 2FUG2 2ME6A 3MKZA 5IYCJ 2CQXA 3IAS2 3A01A 2NVTJ 2GBYA 4E6KG 2DT5A 2BHYA 3DKXA 3W3CA 3RQ4A 2ID3A 1SVMA 3I54A 3KEOA 1B1BA 3KPHA 1R4MB 3LQQA 4XR6A 4U87A 3T8RA 2XAQA 2LVSA 3FX3A 3RZDJ 2X1CA 3CJRB 5CVVA 4V2FA 3OYCA 3HGYA 1Y39A 2R4GA 4RGRA 1GXPA 2K5CA 1UJ8A 2KMUA 3W2WA 3OS0A 1QZZA 2WV0A 5LGTA 1ETOA 3JRCA 3V7RA 3BP8A 5IT9Z 3KLNA 3M1EA 1OJLA 4IXAA 4YFXF 4XSXF 4GDFA 2H1LA 2PFBA 3DPLC 1X58A 5JVGF 1D3YA 4A5NA 5E3NA 3ZQFA 2JA5J 1MBHA 3MEXA 4B44A 5HDNA 5GTHC 2CG4A 4A0XA 1B72B 3FBIB 3CCQI 4P1WA 2R7VA 1ODDA 3QPSA 1QZEA 2R7XA 4BY7J 1MW7A 5EGOA 3H92A 5D6FA 3JTGA 1MNEA 3WTZA 3LSJA 4AYBA 1IV8A 2ISYA 4BJ5C 1D1BA 4BE0A 1ZQ3P 2V6EA 1AKHA 3JCUC 4YIFA 2RNGA 4HDVA 4EJOA 3S1RJ 2Z3YA 3K4NA 2VBWA 2CW8A 1Z05A 2XPVA 4C3HJ 3GVAA 1J7KA 2MA3A 4E7KA 2JA7J 3CESA 3BTIA 4N4OB 2PI0A 3S2HJ 1Q1HA 1VZ0A 3KYCB 1ZRDA 1X1BA 4LIVA 2D1VA 4BQAA 2NOJB 1LPQA 5DM6F 3RI4A 3ROUA 2B0LA 3D5SC 3JAMK 2A69F 4BBRJ 1JE8A 1LDJA 2EFWA 1AWCA 2AS5F 3J81K 5DCMB 2FOKA 4L9NA 4RGXA 4E70A 5GPAA 1V5GA 2HVSA 1WVRA 3M9AA 1IDYA 5HS8A 1G6NA 2CQ7A 1VF9A 3GLXA 2BVLA 3HPGA 4I0AA 2LFBA 3Q9VA 4JX4A 3MZ8A 1WHUA 4HEA2 4XORA 5DD8A 3M4OJ 3PQJA 5LRSA 1TWFJ 3RCOA 4I01A 4PZJA 3ZQ7A 5ILVA 5CQGA 2QSFX 2CFOA 5F6FA 3LL7A 3LSTA 1YX3A 2VE8A 3I3LA 1PP8F 1OCOH 1SFOJ 1N75A 3HRMA 1TTYA 4BGDA 4ZYDA 1T0FA 2EFOA 3E5QA 4ZDOA 1POGA 2VLAA 5L3CA 1ZK8A 4ON0A 5FKOA 1Z7UA 2R7FA 4OIRF 1STZA 1X19A 3WE2A 1FNNA 1WH5A 4ITVA 3DWLE 3PIOF 3DPUA 3F72A 5F04A 3S17J 3BG9A 3CCMI 5F64A 4CYDA 4BEHB 1ETQA 2ZKZA 5M3MJ 3CLOA 1XTAA 3I56I 3MQ0A 3ZOBA 2STWA 4L0ZB 2X51A 3QYEA 2ETHA 3GO5A 1I6HJ 3BTLA 2JRMA 1MGTA 4PGGA 2XKOA 4J00A 2UUZA 2VI6A 5LRRA 4GFBA 4RS8A 3FXMA 1YE9A 3CJTB 2HQNA 2XF5A 1QBJA 1WRJA 3WU0A 4ENKA 1TP4A 4IPAA 2D45A 4R79A 1QQIA 2CS3A 2ELJA 3NRVA 1WJEA 1S7EA 3G3ZA 1MH3A 2M4KA 4HOBA 1O3QA 1LFBA 2HVRA 1K4TA 3ELKA 2OUMA 5CPRB 1QHHD 1T0FC 3DPTA 2QKMB 1WWXA 1RUNA 3I58A 1WFXA 2NVUB 2O3FA 2PLYA 3CMAI 2KDZA 4RGSA 2BVMA 1Z1DA 3IP4B 2GXAA 5DD4A 2M1BA 3EUHC 2IGOA 2CV1A 4BAYA 3CC2I 4AD9A 4JX5A 4RM2A 4I98B 3U1KA 3F3XA 2KZGA 3NWTA 4G6QA 4HA8A 3R4KA 4IHYA 1YS6A 2CQQA 5ICCA 2O9LA 1TWHJ 2E2JJ 1IV6A 2HKXA 1WI3A 3K2ZA 5M3FJ 2P0WA 2M4GA 4E7LA 4HX8A 3WGHA 3F9KA 4XL9A 3TBIA 3CO6C 1OCPA 3C7JA 3T1BA 1BR2A 2DMTA 1RPWA 1R1UA 2DA1A 1RUOA 1U3EM 4BNCA 4XN0A 2R7UA 4LGWA 2EA2A 1XC5A 3LA7A 2V1NA 4HG2A 1TQPA 2HTJA 4DYQA 4A3DJ 1LKXA 2DCEA 1D5YA 4V2GA 2EV6A 3BZ6A 4GCVA 1YOVB 2IAIA 2K3PA 4RLFA 1B6AA 3WODF 2BGCA 2DA3A 3IH4A 1IUFA 3HM5A 3KZYA 1D0XA 2GZWA 2YPRA 4AUXA 2P6SA 2R7TA 2DPDA 5JHUA 1FMVA 4B3AA 4XM3A 5J47A 1VQ7I 4A2UA 1ZH5A 4A6EA 4E7HA 1YS7A 1QU3A 5KCMA 1S29A 2JTVA 3TOAA 5DDGA 5D5XB 4CCOA 1R71A 2NXNB 3BPVA 3OV8A 5D5WB 2K85A 1IRZA 3BG7A 4CCMA 4CCNA 1OCCH 1XS9A 2L9SA 5J1YA 3GLLA 4HV5A 2F4OB 1VQNI 1G59A 1BOBA 4NBQA 2HWVA 3HRTA 2FBHA 3HIFA 1NK3P 3OYJA 2Y0MA 2IP2A 3SFIA 3V42A 4UV9A 4M9SA 4B43A 1Z6TA 1DGRM 2QF7A 3A1YA 4XKVA 5HLHA 2JT1A 3LQRA 2QBYA 2PMHA 4ANJA 2L9RA 2L9VA 5L3FA 3RQIA 3H1CA 3TMOA 3GF2A 3IH2A 3KE2A 1USSA 1ZG3A 3BCAA 3HEFA 4RAFA 2D5VA 2E36A 4Z6YA 4WXHA 3MZYA 2PMZN 1D0ZA 2F4MB 4R8HA 2DA7A 1BW6A 4XRSG 4F92B 4AVPA 2O6GE 2WADA 5CJ9A 3ZRGA 1TQIA 3BZKA 1CQTA 4BHPA 1VQ5I 2XAFA 1E3OC 2GAUA 1Y8RB 1I3QJ 2DJNA 3CP2A 1T08B 4A3IJ 2XAGA 2UZKA 3S16J 2BE5F 2NVXJ 2IVMA 5F0HA 3R0JA 5GAEJ 4KT6A 5IPAA 2LY2A 1VQKI 4LB6B 2EPFA 3OYHA 1BL0A 1J0RA 2ME0A 2KIQA 3OR2C 1DU6A 1AOYA 4L5EA 1EH7A 2IS1A 2O0YA 3GTQJ 2EV5A 5D5VB 3WTSC 3SYTA 1IZ1A 2NS0A 2KJBA 2XGEA 1FBQA 3WTXC 3PIPF 2M2EA 4C2MJ 3J80K 4EJUA 5IT9K 3G4SI 1ETWA 5D8KB 3DLLF 1RR8C 4N9IA 3TO7A 1I50J 2V4JC 5D4RA 3H5NA 1KA8A 5CYVA 1SEUA 1GXQA 3TP0A 2R7OA 5HLIA 1FOYA 2EBIA 5LD2C 2BY2A 4BY1J 2GA2A 5IYDJ 1T95A 2IPQX 2XUBA 4K2EA 4S04A 1SFEA 1MKMA 4M3EA 1OYWA 5TJJA 1AKHB 4X0GA 4QIWN 2LK2A 2XIGA 1I1SA 3Q3SA 2WY7Q 1SAXA 2DMPA 5L3GA 3H9QA 3F8MA 4PK4A 3RPQA 3CO7C 2CYYA 5AIQA 2DT6A 2P81A 2RDPA 3E6DA 3B02A 5IOYA 3ULQB 4ZDLA 3L2QA 1JGSA 5FB2A 4JK1X 4PUSA 5K5QA 3Q9SA 2IGKA 1P6RA 4O5VA 5IY5H 2R5ZA 2H8RA 3HSFA 4HAMA 2MC4A 2EIMH 2COMA 3CMMA 3I4MJ 5D6EA 2ISZA 2LD5A 2QBYB 2QENA 3DTIA 3LFKA 4KICA 3BWGA 2Y9ZA 2JPBA 4NNJA 2LREA 2LP0A 3OS2A 2FQ3A 3F23A 3MMYB 3OOPA 1AU7A 3A0HC 3GTOJ 2L5QA 1FYLA 1ZG5A 2KRFA 4C30A 3JW4A 2QQBA 1LE8B 2OV7A 4E7JA 2BBYA 4ESBA 2R7DA 2RQPA 5FD5A 2Q0OA 1VQPI 2CV2A 2BEOA 3FBNB 1H0MA 1OCTC 1XX5A 1ZGJA 3WE3A 3OYIA 2N8GA 5CVIA 1QNTA 2F5CA 5DV5A 3KYLA 1SD7A 5BPDA 3AG4H 5F0CA 2Y2ZA 4FASD 1OLTA 2HOAA 3F6VA 5K7HA 2H1KA 3P9KA 2MH2A 4Y33A 3JRIA 2ZXIA 4LIUA 4EM2A 4P9FA 3I59A 1Y0UA 2VASA 1DP7P 3WHCA 2XB5A 3IL2A 3D1NI 2F5DA 1YG2A 3FHZA 2HZTA 3GTGJ 3GMEA 1MJAA 1XMXA 4P55A 3ZN0A 4UY8I 1ENHA 2X6OA 3KP2A 1ZR2A 3FK7A 3SHFA 3X2QH 2E1MB 3CCRI 2L7KA 3IC7A 5K5RA 5M5XJ 1FX7A 4OINF 2E2IJ 2FBIA 3EUAA 2DJIA 4HRIA 1B9MA 4IQ4A 3CUOA 1G8XA 3QPHA 2CW0F 3HL2A 5C3EJ 2DMQA 3HUGB 3S1NJ 4A3BJ 4TV7A 3ABTA 2R7ZJ 3O8HA 1Z67A 3M1CA 2DTRA 5A2QK 1XGSA 3O3KA 2FNAA 4YIIA 4B3XA 2ZFWA 3JRFA 3OYMA 2K27A 1OCRH 2L54A 5IP9J 2LLKA 3I4NJ 2IRFG 4FE4A 4BXFA 3E6BA 1PUFA 1GHCA 5HS9A 3NEUA 5HODA 1XMAA 2ECBA 3ZMDA 4MIMA 1Z3YA 4C3JJ 3FXQA 3CJNA 4CCKA 1Z3XA 1MDMA 5M5YJ 3WTYC 2OQRA 3FXUA 4MGRA 1YQAA 3BG3A 2JJ7A 1FOXA 2L7ZA 1PVEA 1BR1A 3L1PA 1RZ4A 1XSDA 4XQFA 3EYIA 4S05A 2G7HA 1HCRA 3LWFA 4QLCU 2K9NA 3RDIA 3KZIC 5LGNA 4LK1F 4FX4A 2X4HA 2HNHA 1ERDA 2MFZA 3HKZA 3OYEA 1QVUA 2PX9A 2P4WA 3BOQA 2LDUA 2XVCA 4W1UA 4XICA 2R5ZB 2YS9A 2P5VA 3I53A 4EJVA 3ASOH 5EF6A 1A6IA 1J59A 5DUKA 4ENMA 2Z5UA 1JKQC 2H27A 2O8XA 1SVLA 2KIUA 3DF8A 1LUJB 2K4JA 3FMSA 1KYZA 2WAFA 3QP5A 4B48A 4XONA 4E7IA 4Y7NJ 2HEOA 3HOUJ 2F2EA 2VXDA 4KA4A 1B72A 3OY9A 2DFIA 3ZR8X 2VOPA 1ITYA 4XRFA 1EF4A 3E5XA 2ECCA 4L0YB 1U6GA 1UELB 2E1MC 4LK0F 1F4KA 3ZPLA 4OWRB 1P7JA 4XOPA 3K4BA 4JBAA 5E79C 5E8GA 4GYGA 3G73A 4OIOF 2GOXB 4CZZA 3E3VA 4XLCA 3LSKA 4ZC3A 1O57A 1LB2A 3Q5FA 2EWNA 1JKRC 1W5TA 2KRHA 3ZQHA 4ESJA 2EK5A 2P5KA 3HZJA 4L5IA 1APLC 4ABZA 1VQMI 1X3UA 4OOIA 3K7AJ 1UAAA 4MO7A 5JR3A 3VYUB 5D5UB 1T2KA 3KZZA 1FT9A 1A31A 4Q4ZF 5B1AH 3VYSB 1TW3A 2QLZA 3TEDA 2L3DA 3QRFF 5J8CA 4L9TA 1ETVA 5HNFA 4ZTFA 1IXSB 2CUJA 2RV8A 2X48A 1LNWA 2W25A 1OMIA 2QGUA 2P6TA 3BR0A 3MAJA 5LFAA 1BI2A 4ZYEA 4JYKA 2F5FA 1WSUA 2D1HA 1FYMA 1MSFC 4DNCA 4EMSA 4AM3A 5TISC 2TCTA 1HSJA 4NQWA 1BC7C 4RLQA 5F1RA 5F1JA 3L2WA 2HOSA 1U5TB 1VFCA 1DDNA 3IWFA 3QYFA 3UR3C 3HDDA 3M7GA 3RPUD 1R22A 4XKWA 5D8LB 4ESFA 1TNSA 1FP2A 1TZLA 3ML6A 1PP7U 4YFKF 1IAWA 1VQ6I 1KYWA 1WH7A 1MDMB 2LOOA 1FLIA 1IN6A 5D4SA 2DDAA 3F8BA 5ICGA 2CW7A 3BJ6A 2DODA 5IOZA 5IP6A 4WCGA 1MNDA 1TLHB 2YX7A 2VE9A 3AFHA 3J7AY 3QQAA 4M6VA 3CCJI 1OPCA 3O6BB 1S72I 5IP7J 3LOCA 3GZNB 1VQ8I 4XMYA 1SC7A 4BBSJ 3T0YA 3HOWJ 2HXIA 1VQ4I 2A6TA 5B66C 3DP7A 3F21A 1LVAA 4YFNF 3FXOA 2VC1A 3PQKA 1R23A 2L4AA 2K02A 2OAZA 5B5EC 3GYHX 2MC3A 3U21A 1MJBA 2Z9OA 5C44J 5J4YA 2H6CA 1FTTA 2R93J 1L0OC 4HQMA 2OJED 1P7IA 3BR2A 3H3ZA 4DIQA 5EJCA 2GXBA 1OISA 3E6MA 3V4GA 3GTJJ 4KT5C 2VUMJ 2ZO4A 1YRNA 3QAHA 2LTPA 2W57A 5J6XA 4F91B 4Y52J 2XB0X 2COBA 4IRHA 2ZNZA 1H89C 2OA4A 5B3SH 5EG0B 2Z1DA 2VKVA 4HX7A 2YU9J 3LSRA 4AIKA 1HF0A 5CVRA 3S14J 4IJAA 2XSDC 1YYVA 4UUSA 5BQTA 1FBUA 4CO8A 2ZJPF 1QO0D 2E1NA 1SMTA 2ZJQF 1X1CA 4HYEA 2Q2EB 3HTUA 1S3JA 1E2XA 2E35A 1UHSA 2HQ5A 1OQYA 1H9GA 2VJ5A 2FJ1A 3S3NA 3S2DJ 4G9YA 1JGGA 3IRQA 3TDZC 3RYPA 1ZLKA 3IKVA 2PQ8A 2FEZA 5F08A 4BXXJ 2HGCA 3VODA 1HA8A 5HLGA 3ZQCA 2FX0A 1I6XA 1IXRC 4G12A 4UUSB 2XPWA 4LLLA 2F4IA 2LMDA 2DK8A 1P4AA 2ZMEB 3ABLH 3BC8A 4ASNA 2JA8J 3DKWA 3A2KA 3BLYA 3VWBA 4NDLA 2Y0SA 1EV7A 3UNGC 2OU2A 2VOOA 1XB4A 2LNBA 1F36A 4FE7A 4PJMA 4QWQA 4CA0A 1Q1VA 2JUCA 2W48A 2HR3A 2M9HA 2VQGA 2CMPA 5BS6A 5L3BA 5CVUA 2DMNA 2X1DA 3OIQA 1A35A 4EJWA 4WK8F 2HOEA 5H20A 1IN8A 2DK5A 3CMEI 3DCFA 3TQNA 3LA3A 1R58A 3VOEA 4IKFA 3MN2A 3BR1A 3K1NA 3LSPA 5IYBJ 5GADJ 4D9JA 3G1OA 1XGNA 2ADUA 2FSWA 3OMYA 1WI9A 2JPCA 1YIJI 1NH3A 3ZCOA 3OL3A 5FRNA 3V7SA 4M3BA 2HYJA 2VBYA 3CTAA 3G71I 1MIJA 4KITB 2E1CA 3SEZA 3CCEI 1IRXA 2JK3A 2W85A 3K4KA 1R9TJ 1HLVA 2UV1A 3J7ZI 4UV8A 4W97A 1ORKA 5DUIA 1K78A 4A3EJ 3GFMA 2FBKA 3HUGA 2WAEA 1KZHA 1RNLA 4G7HF 2ZMEC 1WPKA 2CGPA 1FIPA 1O7FA 3SQNA 4S0HB 4EM0B 2O8KA 4OMZA 5FLXK 3S3MA 1OKRA 4WWCA 2DAOA 4IHVA 1I5ZA 3SEQA 1BN5A 3H36A 4HX4A 2E5NA 1WJDA 2Y9YA 3CUQA 1SD5A 2LF7A 4CYCB 2JQ7A 2ZSHB 1IN7A 1P9QC 4CH7A 3GX4X 2R7SA 2K9MA 4CCJA 5KNLA 4NC8A 1WCMJ 2X6YA 3PM1A 4EJTA 2EQRA 2VODA 4UVCA 1Y56A 1LQ1A 1T8IA 1LDKB 4I2OA 2LKPA 5JI6A 3BJAA 2Z99A 3I9V2 4LB5A 1W5CC 1ULYA 4BE1A 3W6JB 5L3DA 4F3QA 1HBXG 3FXLA 3BT9A 3TGNA 1NK2P 4HDUA 1JUPA 1VI0A 1I39A 2XDVA 3I4PA 5FKLA 3GTLJ 1BW5A 3C2BA 3EYYA 2BY0A 2DA6A 1MMSA 3CF2A 3E7LA 2E1OA 2WV1A 5E1WA 3SXYA 1YW7A 2BXYA 3S3OA 1FMWA 3GFLA 4UUVA 3OYLA 2IA1A 2V1UA 3KP5A 2RVCA 5BNGA 1MD0A 2DT7B 2JUGA 4QTRA 3PO2J 2DTZA 3EQLF 2X85A 5AONA 1FZPB 3PFIA 5AIPA 4Y13A 4DZJA 1R6RA 4KYWA 2V6CA 4BQQA 1P92A 1BC8C 3F8CA 1Z77A 5KK1A 2DFEA 4I0BA 1BI0A 1G4DA 4LD5A 4FISA 1KU7A 2LY9A 3ZQQA 4AIHA 3BDDA 2VKEA 3HOVJ 1TWCJ 3QYBA 3G1LA 3L00A 2DA4A 1FJLA 1R7JA 2ZXJA 3MWMA 3C2HA 1F5TA 3VSLA 1X1DA 5EGOB 4ENJA 5K5OA 4PDKA 2E7XA 5FKNA 4BS9A 4PJ0C 2IA0A 1BJZA 2E5ZA 2QA4I 2ZC2A 3MVPA 2DW4A 5H2FC 2VPLA 4MEXF 4DQ2A 3BY6A 1PUFB 3BG6A 3E97A 4N0BA 2GIVA 3DEUA 2G9WA 2NS8A 1SD6A 3FM3A 2JA6J 3CP8A 1DGWY 1MBEA 4IHSA 1JTXA 3IUOA 3HOTA 4MTDA 1FTZA 3DKYA 3QU6A 2NRAC 4WXCA 1ZGWA 3NARA 4HQEA 1KU2A 2RC4A 2IS6A 4MNUA 2PJPA 2DU9A 2IGMA 1CF7B 2HQRA 2CO5A 5DM7F 3U1DA 3I71A 5ICEA 2E2HJ 1ETXA 2K3FA 5JFRA 1R49A 1AHDP 1KQ8A 1IDZA 5GP9A 1ZAOA 2D2WA 2XAJA 4A6DA 1Z9CA 3OYDA 2PN6A 3Q0VA 3QOEA 4KIGA 3D5RC 4MQVA 3CUQC 2IW5A 4DBRA 4KISA 3K4JA 3H9JA 1DP3A 2KFDA 1E0EA 3B73A 3BJOA 2NNYA 3R6SA 3I55I 4C9YA 2DPUA 3AL0B 3S1QJ 2R0QC 1HDDC 1ZLJA 4U0VA 1K61A 4LOCA 3LAJA 5J1RA 1AA7A 4KDPA 3DQVC 2QQAA 3A01B 3VDXA 3S32A 2A5WA 5E1XA 1JXSA 1ONVA 1YJ9I 4HV6A 3GWZA 3QU3A 1S8NA 3GTMJ 4CXFA 2K7LA 1TC3C 2NOGA 2HI3A 4IEJA 1ZELA 2R92J 3KYDB 2WA0A 3HOXJ 1J09A 1X2NA 2XGCA 2W00A 4N9HA 1YIOA 3S8PA 2X6WA 2OQGA 1UG2A 3ZP5A 5TRDA 2MH9A 2B63J 2G0EA 1FWZA 2EZHA 4CUGA 1LE8A 4OAZA 4MHGA 3PO3J 4HSTA 1XDUA 4QSHA 4KIBA 1JKPC 4WX9A 3MFKA 1X3WB 4KN7X 5FD6A 5HDKA 4UVBA 2V7FA 2X0LA 1EJ9A 1BBYA 2KISA 4BYYA 3JTHA 2WY8Q 3A03A 1WZ2A 4XLHA 3V8JA 3FK6A 1JUSA 1YJWI 3HOYJ 4PGHA 1W1WE 3AL0C 2F5EA 3ABMH 4G6TB 1HKTA 5EEAA 3BQZA 1GV2A 2O03A 5E18F 3HB9A 2IJLA 4MLOA 2W84A 4LITA 2VJJA 5FLXZ 3AAFA 1WJCA 1TQMA 2E60A 1X1PA 2ZMEA 2DBBA 2P7VB 3TL4X 5K1YA 1TBXA 2WB1N 4D7MA 2B7EA 1WGXA 4HLXA 1Y6IA 1O3SA 2JVHA 2A6EF 2FNPA 1W36D 5J3LA 5BPIA 2NVQJ 4XLNF 3ZMZA 1P4WA 2LY1A 2XGXA 5FLMJ 3DBHB 2J5OA 4EEFG 1J5YA 3CCSI 1TNTA 3DEWA 3PSFA 1U9OA 3K0LA 3N05A 3HOZJ 2MBFA 4IHXA 4O3MA 4Y17A 3GCMA 1YFHA 4M3DA 4BHCA 3B6CA 1U5TC 1C0WA 1IRFA 2HPMA 1TT0A 4CGZA 1QPIA 1UMQA 3FKJA 1S7AA 4ZH4F 2L2OA 2ZSIB 2MG4A 2VPRA 3MKWB 1KGSA 2RREA 3KEQA 2LH9A 5BMZA 3BCBA 2Z2SB 2CV0A 2E71A 1FPQA 4KMFA 4II3A 4B4CA 2JRTA 4A3MJ 2R7QA 1VTNC 1W36C 4DW6A 1GVJA 4LLNA 5LEKA 2JZYA 1DU0A 2CUEA 3CC4I 4F7ZA 4YIRX 2H6BA 4A0YA 3ZGKA 4IZZA 2VIXA 2DA2A 4WF2A 1JJ6C 3G1MA 2KHMA 3KX2A 5EZHA 4A3JJ 2FRHA 4XKBA 4BU2A 1YJNI 2RNJA 4RM3A 2X6XA 3I59B 4HZFA 4BQOA 1LDDA 4XSZF 3IH3A 1JUMA 1G3YA 4YELA 2IS4A 2XAUA 4A3GJ 2KDOA 3J7YJ 1HQCA 1TL8A 3F8FA 2V1DA 1MMAA 3TP3A 1SMYF 1UB9A 4FT8A 4IOCF 1BI1A 3GZ6A 4XK4A 3EUKL 2UXXA 4ZTJA 2R3SA 2Q8KA 5FLVA 3LSHA 2BZTA 1VQLI 5CVJA 3FISA 4IRIA 2VN2A 1V5FA 3K70D 2DXIA 3DEEA 3ZMSA 4OMYA 1LEBA 3R0AA 4M73A 4D5FA 2DOAA 1SD4A 4A0ZA 4UNOA 3E6CC 3KLOA 1IG7A 3S1MJ 1IN5A 1BR4A 2QYOA 3J7AO 2JA2A 2M45A 3VYTB 2CUZA 4BJ6C 3EETA 1V54H 1J2XA 2NNNA 3HGGA 4XKCA 2M30A 3CDIA 1OFCX 2PBIA 3L2VA 4A5MA 1N25A 1YW8A 1Z7LA 1YI2I 1JJ8C 2E34A 4PJNA 1A36A 3VB2A 2IBDA 4A12A 4HSRA 4HLYA 2RKHA 3F0CA 3BPXA 4QPQA 1D1AA 4M9ZA 2HXOA 2I8DA 4UXNA 5FGMA 1WJAA 3HPHA 3R61A 3CCUI 4DGWB 4OIPF 1UHWA 2QZ8A 4RB2C 5JLWA 3F6OA 2EZLA 2M8GX 4JX6A 2LF8A 2R5YB 4MQ9F 4DYCA 2DYRH 3NAUA 2KQRA 3ERMA 3DTKA 3HC7A 2GXGA 1SFUA 2IEKA 4M3FA 3HRUA 3RKYA 2DFHA 4U0YA 3H5RA 4FETA 1R1VA 1HXDA 3J81Z 4Y3OA 4O6JA 3U9GA 3CQZJ 3FM5A 4XNFA 1IN4A 2K9QA 2I10A 5M5WJ 2DA5A 2RAEA 3K70C 4PJLA 3P9IA 5HDGA 2KIMA 2R5YA 4CSWA 3M8EA 1D5VA 1ON2A 1P4XA 3HKZN 3DTEA 4FHTA 2YU3A 4Q47A 4CZCA 5LGUA 5HOOA 3WGIA 1MMGA 2A61A 2DOEA 4ENNA 2B9SA 4UVAA 3MKYB 4I99C 3HRSA 4WXDA 1GLNA 3BROA 4EQQA 1NHAA 2TDXA 3JAMZ 3WTWC 5DCMA 2W82A 2C6YA 3G6EI 1E3HA 2V79A 3MCZA 4V19K 1JTYA 2VXZA 1EKEA 3BQYA 3HBLA 2DO7A 2GWRA 3MZHA 2CU7A 2X9DA 1GT0C 4IQJA 1BA5A 3EUHA 5E3OA 3PUFA 2QUFA 3IHUA 3T5XA 4FX0A 4RDUA 2PJRA 4OAYA 4LJZF 3VPRA 2EFNA 2YX4A 2WAQA 3KEYA 4JP0A 3WHBA 3WGGA 5DCFA 2QCOA 2EILH 5C4JJ 2V9PA 2LYCA 2QSGX 4GGGA 2MYSA 1YLFA 2DN0A 2BHZA 2KIFA 2WB1A 2ZB9A 1FP1D 4YG2F 3RIRA 4RB1A 4RB0A 4KJZA 4FCYA 2BV6A 2L9NA 2H8WA 2E7WA 5FROA 4AWXB 1T56A 1XSVA 5H6QA 1RETA 1QGPA 3W2VA 1FOKA 3PNYA 2VT2A 1J75A 3LAPA 2QKLB 1KU3A 2M8EA 3DBRB 4KN4X 4IX7A 1D8JA 4NB5A 4ZYHA 2XPUA 3GXOA 5E1ZB 2P5LC 3ZN1A 2P8TA 5KHDA 5CQEA 3O2PE 3QWLA 2A6HF 2M34A 3H3UA 1UZCA 1UCRA 2FMLA 4II2A 1KQ0A 4PSXA 3P9CA 3E5UA 5H6RA 4CCLA 4LMYA 2EIJH 3K9TA 4NHJA 1QPMA 4BL0B 5GAHJ 2OF7A 2HKOA 2EZKA 2DOFA 5DTDA 1HW2A 1TWGJ 1WKMA 2DMUA 2JSPA 2XF7A 1GUUA 2BXZA 5K7ZA 3SJMA 3CDLA 2LC2A 5F27A 3CUQB 6PAXA 2LG4A 3E0JB 2ZFUA 4BDYA 1W5SA 2HDWA 3JRDA 4XRMA 1XGMA 2MGQA 3W6VA 1GVDA 2BW3B 3KCCA 3L2RA 2K9LA 4XBFA 4ZDPA 4XLFA 2HZDA 3OYGA 3CD6I 1XGOA 3FF5A 2CWEA 1R5ID 1SANA 3GBGA 3L9FA 3M8JA 4A69C 4IHWA 5LBQA 3M3YJ 2FOWA 3RKQA 2A05A 1HSTA 2HS5A 4I09A 2OTLI 4EGYA 2YR2A 4GRIA 3LSIA 1FC3A 1MMNA 1VQ9I 3OIOA 2K4BA 2AQFA 2HYGD 4XOTA 1Z6RA 1ZYRF 1V4RA 4E7ZA 5C4XJ 4BACA 3HOSA 2M0CA 2HDDA 4I7HA 4U0WA 5J40A 1B59A 3HTSB 4NC7A 3ZQGA 4U7BA 2MLGA 2OZUA 1J9IA 3KP4A 3FXKA 3V8LA 3LA2A 2QVOA 3SZGA 3CJQB 2QM3A 2W24A 1QZYA 3IAM2 3L09A 1LVKA 4PSWA 4PJJA 2VKDA 1IRGA 3PSIA 3OYNA 1G2HA 2ZXWH 2P7CB 1TT5B 1JHHA 1GDTA 1YRNB 4P9UA 1QHGA 2CFXA 1T6SA 2L7MP 4E4HA 1PDNC 1MNMC 2R7WA 1S6LA 3K1MA 3UKGA 5LEJA 1L3LA 1MMDA 5LHIA 2L0KA 2OTJI 3BR3A 1MBKA 4EATA 1O3TA 5EZGA 3K10A 4M6XA 4Y15A 2XKPA 1PJRA 4KIFA 2A5YB 1V55H 3ECHA 2HOTA 3CCYA 3C18A 4X6AJ 2NAZA 1KU9A 4BJTA 2DQLA 3H5AA 4DYRA 2PJRB 4LFUA 4JQFA 4MFDA 3C3WA 3JSOA 3M07A 2FF4A 3FKIJ 3SFZA 1E3PA 2LKSA 4M71A 4BDZA 1MH4A 1ON1A 3RKXA 1K83J 2ZJ2A 2YSRA 4NQWB 4HF0A 2UWMA 1VQOI 1T33A 1RI7A 2M3AA 2OBPA 4BEHA 2M7BA 2J5PA 1RKWA 1XCBA 4XIDA 2W4SA 3OYKA 3QODA 4G7ZF 1W7PD 3PFYA 4OU0A 3ONQA 3M8FA 4D7NA 4IL6C 3GFJA 2O7OA 4IF4A 2O61A 3N97A 2LSOA 1D0YA 2KZVA 1WJFA 1FSHA 1G3SA 2HFHA 5B1BH 1PUEE 2NS7A 1K7AA 2QQ9A 2BOLA 4B09A 2KRCA 1NG7A 5E3MA 5JLXA 2EB7A 3AG1H 2DDBA 2ID6A 1W0TA 5E20A 2FQ4A 1X3ZB 3FIWA 3OYFA 2TRTA 4BKXA 3KIOA 3Q0UA 1Y1WJ 2A68F 2CSOA 4L9VA 3LNQA 1Z0XA 3TW6A 2ESHA 3EDPA 5JVTA 1A04A 2BW3A 1D1CA 3JRGA 1NG6A 5L3EA 3IWZA 1HKSA 4B1RA 2VL8A 4BQNA 1ACIA 5CLSA 5EEGA 3DU6A 2GQQA 1U8RA 2F5VA 3CC7I 2VQLA 2MD5A 4U88A 3KP3A 2I5UA 3CCLI 1ZGAA 2G7UA 1N77A 4ZJZA 3QP6A 4Q48A 1YITI 1U0JA 2GA1A 1RESA 2FU4A 1ZHFA 3H3VK 5JHFA 2JSCA 1XSXA 3L2UA 5FJ8J 2Y75A 1UFMA 4H0EA 1JT0A 5GAGJ 9ANTA 3BTCA 2LBFA 3JRHA 2HTSA 2JVGA 3HHHA 3DFGA 2FA5A 1Y1VJ 2Y31A
chains in the Genus database with same CATH topology
3FBIB 2KLOA 1S9HA 4P1WA 2R7VA 4CUGA 4OAZA 2R7XA 1MW7A 2HNHA 4HSTA 4XLAA 3VSKA 3FDYA 1MNEA 2MFZA 4QPOA 4YRVA 1ERDA 4AYBA 3HKZA 3OYEA 1KONA 2V7FA 1D1BA 4BJ5C 4BE0A 2ZXHA 2V6EA 3MD2A 2RNGA 3OL4A 2WY8Q 4XLHA 3K4NA 4AVZA 2CW8A 4E7KA 3CESA 3AL0C 2M7AA 4N4OB 4G6TB 1VZ0A 1X1BA 2X1EA 4LIVA 4MLOA 2NOJB 2LBFB 4LITA 2VJJA 1WJCA 3K6GA 2E60A 3D5SC 2WAFA 5HLTA 4B48A 4BE2A 4XONA 4E7IA 1EA3A 3TL4X 2VXDA 4NUBA 1Y6IA 3OY9A 2JVHA 1W36D 1V5GA 3ZR8X 2HVSA 4Y4RA 5CKTA 5HNHA 2LY1A 2E1MC 1UELB 4OWRB 3D5LA 4XOPA 3H35A 2BVLA 3PSFA 3K4BA 2KP6A 3HPGA 3N05A 4HEA2 4XORA 2GOXB 2VB6A 4F55A 3RCOA 4XLCA 3LSKA 4ZC3A 3FHNA 3PNVA 2HPMA 1TT0A 5CQGA 4J01A 2CFOA 3FKJA 2KRHA 3LL7A 2L2OA 2ZSIB 1YX3A 3MKWB 3I3LA 4H4KC 2RREA 1UAAA 1V5EA 1N75A 4B47A 4ZDOA 4BGDA 2LH9A 2XF6A 3VYUB 3BCBA 2Z2SB 2CV0A 2VLAA 4II3A 2R7QA 3VYSB 1W36C 2MABA 1SFKA 5HNFA 4ZTFA 1X19A 2KPMA 2CUJA 4ITVA 3DWLE 3OYAA 3DPUA 3ZGKA 4IZZA 2VIXA 1JI8A 4D1QA 1PYVA 5LFAA 2KHMA 3KX2A 5FRMA 4BU2A 4XKBA 4RM3A 2WBMA 4BEHB 2X6XA 4BQOA 4RLQA 3L2WA 4YELA 2X51A 3QYEA 3AKZA 2XAUA 4C2TA 2IS4A 2KDOA 3QYFA 3UR3C 2XSJC 1MMAA 3RPUD 4J00A 2UUZA 4XKWA 3C2GA 1TZLA 3EUKL 4ZTJA 1YE9A 2XF5A 3LSHA 3LSGA 4RMNA 2M0MA 3OIPA 2GOMA 1V5FA 3K70D 2LOOA 2DXIA 3DEEA 4R79A 2CS3A 2ELJA 3K4MA 3S93A 1WJEA 2DOAA 4PFPA 2CW7A 2M4KA 2HVRA 1MNDA 1DQUA 3OWTA 1Z21A 2OUMA 3AFHA 5CPRB 1QHHD 3J7AY 1BR4A 1T0FC 2JA2A 3VYTB 2CUZA 2QKMB 3DPTA 4BJ6C 4F52A 4XKCA 2VKHA 4XN3A 3L2VA 1WFXA 4XMYA 1Z7LA 4PJNA 4E7SA 2BVMA 3IP4B 4HSRA 2A6TA 3EUHC 2IGOA 2CV1A 4QPQA 1WJ5A 1D1AA 4RM2A 3RTRA 3EPZA 2I8DA 3NWTA 1WJAA 2W1OA 3U21A 3HPHA 4DGWB 4DIQA 2P0WA 2IS2A 2M4GA 1X4OA 4E7LA 3F9KA 4XL9A 3TBIA 1X4PA 1BR2A 3OYBA 2KQRA 3DTKA 3HC7A 4F91B 2RQQA 4XN0A 2R7UA 3NWSA 1X1AA 3PNTA 2V1NA 1SAUA 4HG2A 2Z1DA 3H5RA 4FETA 1LKXA 2DCEA 2VQHA 4Y3OA 4XNFA 4C2UA 2K3PA 4RLFA 1X1CA 3K70C 4PJLA 2Q2EB 1N78A 4HNTA 3E1SA 4CSWA 2VJ5A 1D0XA 3DTEA 3S3NA 2HQAA 2R7TA 2IXSA 2HPIA 4LG3A 1FMVA 4CZCA 4XM3A 5HOOA 1MMGA 3A4CA 4E7HA 2VJIA 1QU3A 1HA8A 5KCMA 3MKYB 2AQEA 1GLNA 4HPQA 4CCOA 2W82A 2F4IA 3BG7A 3SDBA 4CCMA 4CCNA 3BC8A 2L9SA 2VXZA 4YEJA 2Q1ZB 3A2KA 3BLYA 1G59A 3VWBA 4IQJA 1BOBA 2Y0SA 3UNGC 4DOZA 4PJMA 2PJRA 4OAYA 4CA0A 1LFPA 2WAQA 3KEYA 3OYJA 2KL4A 2VQGA 2CMPA 3V42A 2X1DA 3OIQA 2LYCA 4B43A 1DGRM 3A1YA 4XKVA 2MYSA 2WB1A 2V26A 4ANJA 4IKFA 4PFOA 3LMMA 2F6CA 4KJZA 4D9JA 2L9NA 4JOMA 3OMYA 5FROA 3TMOA 4DJAA 3BCAA 3ZXSA 3W2VA 3ZCOA 3OL3A 5FRNA 3PNYA 2QKLB 3HG9A 4KITB 4IX7A 1D0ZA 3SEZA 1IRXA 3K4KA 2UV1A 4F92B 5KHDA 2WADA 5CQEA 3ZRGA 2WAEA 4II2A 1WJBA 1OR7C 4PSXA 2LRDA 4CCLA 4XLEA 4N4NB 3CP2A 4BL0B 2MD0A 2JSPA 4KT6A 4AU7A 2LY2A 2XF7A 3VYRB 4BUPA 3S3MA 1YX5A 2LC2A 2LG4A 3OYHA 2Z16A 3E0JB 2HU9A 2ZFUA 3SEQA 4BDYA 2HDWA 2E5NA 3OR2C 1WJDA 3OR1C 2BW3B 2V9KA 3L2RA 2K9LA 2IS1A 4ZDPA 2ZSHB 2HZDA 4XLFA 3OYGA 1P9QC 4CH7A 2R7SA 2K9MA 4CCJA 3SYTA 5KNLA 3GBGA 3M8JA 4NC8A 3PL8A 2X6YA 1Y56A 1LDKB 3DLAA 1K6YA 4GRIA 3I9V2 2V4JC 3LSIA 2W7NA 1MMNA 4BE1A 4F3QA 4XOTA 2XC7A 2AQFA 3H5NA 4E7ZA 2VJ4A 4BACA 3HOSA 2R7OA 2XDVA 3PJRA 4NC7A 4U7BA 5LD2C 3CF2A 2CH0A 5HVQC 1T95A 3S3OA 3SZGA 3CJQB 1FMWA 3OYLA 3IAM2 4X0GA 1LVKA 3K4LA 4PSWA 2DT7B 4PJJA 2WY7Q 2VKDA 2JUGA 3PSIA 3H9QA 3OYNA 2X85A 4PK4A 1QHGA 1R6RA 2DT6A 4BQQA 4E4HA 4ZDLA 3L2QA 2R7WA 4PUSA 2IGKA 3RSNA 3CZ6A 2MC4A 1MMDA 3CMMA 3ZQQA 4EATA 3DTIA 3QYBA 3K10A 4NNJA 2LREA 3OS2A 3MMYB 3C2HA 3G2BA 2L5QA 1PJRA 3VSLA 1X1DA 2OC6A 4C30A 2OV7A 3LFUA 4BS9A 4E7JA 3W2AA 2E5ZA 2IGNA 4BJTA 3H5AA 2CV2A 3PUBA 2VPLA 2PJRB 3FBNB 4JQFA 3BG6A 3OYIA 3KYLA 3CP8A 1DGWY 4FASD 4BDZA 1OLTA 2PMZA 3DU5A 4NQWB 3IUOA 4Y33A 2UWMA 3HOTA 2ZXIA 5TGTA 4LIUA 2M3AA 3DKYA 4BEHA 2M7BA 4F93B 2VASA 3H0DA 2W4SA 3OYKA 3QODA 3PFYA 2IS6A 3ONQA 4HNUA 2HVQA 2IGMA 1UG0A 1D0YA 4P5OA 4ZYAA 2E1MB 2KZVA 1WJFA 2L7KA 3EUAA 2DJIA 4HRIA 4IQ4A 1G8XA 2VQCA 3OYDA 2BOLA 4DBQA 3HL2A 2R7RA 2KRCA 3H9GA 3HUGB 1NG7A 3QOEA 3OOUA 3D5RC 4DBRA 3HXLA 4KISA 3K4JA 3H9JA 3OS1A 1DP3A 3OYFA 3M1CA 3LSMA 3K4CA 2O5RA 1E0EA 2FUG2 3MKZA 3IAS2 4B3XA 4E6KG 4C9YA 3AL0B 2BW3A 1D1CA 3DKXA 3W3CA 3RQ4A 1NG6A 3OYMA 2VL8A 4U87A 4XR6A 4BQNA 1AA7A 2X1CA 3DQVC 3CJRB 3DU6A 3OYCA 2F5VA 4BXFA 3VDXA 2VQLA 3S32A 2A5WA 2R4GA 2K5CA 2KMUA 3W2WA 3OS0A 1N77A 4ZJZA 1U0JA 1Z3YA 1ZELA 4CCKA 1Z3XA 5JHFA 3L2UA 2WA0A 1J09A 3DPLC 2W00A 1BR1A 2LBFA 2JVGA 3S8PA 4B44A 4XQFA 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9S A; 
#chains in the Genus database with same CATH topology
 2KLO A;  1S9H A;  3BR5 A;  1IUY A;  1ETY A;  2H94 A;  4BH9 A;  4XLA A;  1ZKG A;  2V9V A;  3HSR A;  3VSK A;  3FDY A;  2OD5 A;  2HYF A;  3HJE A;  1F1Z A;  4QPO A;  4LG0 A;  4YRV A;  3SZT A;  3ECO A;  3ERE D;  1KON A;  4I6Z A;  2AO9 A;  5ICF A;  2ZXH A;  3J80 Z;  3A02 A;  3QPT A;  3MD2 A;  1K4S A;  2ESN A;  3TOB A;  2CQN A;  3OL4 A;  1BM9 A;  5ED4 A;  4AVZ A;  1B4A A;  3GW2 A;  4IO9 F;  3I64 A;  2M7A A;  2FXA A;  2RN7 A;  4MTE A;  1V3F A;  2X1E A;  1IC8 A;  1H88 C;  2LBF B;  3TDU C;  1W0U A;  4MFE A;  4LG0 B;  3K6G A;  3JRE A;  2L4M A;  2VBX A;  5HLT A;  4BE2 A;  1EA3 A;  4BHB A;  4NUB A;  1O3R A;  2KJC A;  4UHT A;  2FMY A;  2AXL A;  2KKO A;  4Y4R A;  5CKT A;  5HNH A;  3V8K A;  3ABK H;  2STT A;  3FXR A;  1CGP A;  5K7F A;  2YUS A;  4M9X A;  1S5L C;  3D5L A;  3H35 A;  1UST A;  3IV5 A;  2KP6 A;  3AG2 H;  4FQG A;  3CMY A;  1JKO C;  1H9T A;  3OSG A;  3GEZ A;  3RJP A;  1ZN2 A;  2VB6 A;  4A3K J;  1IXC A;  1HDP A;  4F55 A;  2K9S A;  2QQ8 A;  4HF1 A;  3FHN A;  3PNV A;  1BOA A;  1IW7 F;  2XRL A;  4J01 A;  2EZI A;  3ABU A;  1HW1 A;  1BJA A;  4H4K C;  4Z2Y A;  4EV0 A;  1V5E A;  1XD7 A;  4B47 A;  3ESW B;  2XF6 A;  1Y0N A;  2GIZ A;  2ACJ A;  3WTT C;  2JN6 A;  2PEX A;  4IHT A;  2A3S A;  3AG3 H;  2MAB A;  1SFK A;  2Y48 A;  1YHQ I;  3ZMU A;  2KPM A;  4AID A;  3JRB A;  3F22 A;  3OYA A;  2MSY A;  1HKQ A;  1JI8 A;  1HW5 A;  4D1Q A;  1K78 B;  1PYV A;  1D8K A;  3REO A;  5FRM A;  1BI3 A;  2M5W A;  2UXN A;  2WBM A;  4G8X A;  3K2A A;  3K69 A;  1W7P A;  1VND A;  3JSP A;  2GLO A;  1K6O A;  4CYC A;  4XLP F;  2PG4 A;  3AKZ A;  4C2T A;  1U5T A;  5J4V A;  4HBL A;  4EM1 A;  2NVY J;  2VC0 A;  2XSJ C;  1R5G A;  1DUX C;  3GUD A;  1OYI A;  4UB8 C;  3C1D A;  3GTP J;  1MBF A;  4A3C J;  3T8T A;  2CRG A;  2QWW A;  3C2G A;  1Z91 A;  4UUT A;  3LSG A;  3BG5 A;  4RMN A;  2M0M A;  3OIP A;  2GOM A;  1H8A C;  3WG7 H;  3K4M A;  4I02 A;  2AXT C;  3S93 A;  4L5J A;  4PFP A;  2JMW A;  3H0G J;  3BZC A;  1DQU A;  3OWT A;  1Z21 A;  2CQK A;  1RR7 A;  4G7O F;  1QA6 A;  2F48 A;  1P2F A;  4F52 A;  5DEQ A;  2WWY A;  2VKH A;  4XN3 A;  4CIC A;  3BR6 A;  4BXU A;  1ZAR A;  4RB3 C;  3B6A A;  4E7S A;  4I76 A;  5KAF C;  4J19 A;  4G6D A;  3GTK J;  1WJ5 A;  3RPU A;  3RTR A;  3EPZ A;  3ISP A;  4GYI A;  1TW2 A;  2W1O A;  1IF1 A;  1XN7 A;  4AIJ A;  4A93 J;  3KP7 A;  4Q5S F;  1RIO H;  1BIB A;  2IS2 A;  2BY3 A;  1X4O A;  5LHG A;  5EYR A;  4AYB N;  5IT3 A;  2QEX I;  1X4P A;  2ICW G;  1FSE A;  4OIQ F;  3OYB A;  2LR8 A;  3KP6 A;  5FKM A;  4GXO A;  3GFI A;  3SDG A;  2RQQ A;  3NWS A;  3JRA A;  1X1A A;  3PNT A;  1SAU A;  5EG0 A;  3F8N A;  5E3L A;  1RRJ A;  2DYS H;  2Y0S N;  2VQH A;  4A3F J;  4D5C A;  1FBS A;  4C2U A;  3Q0W A;  1HC8 A;  1G3W A;  3IKT A;  1SFX A;  1IO2 A;  3RZO J;  2EV0 A;  1LJ9 A;  2VON A;  1TWA J;  2FE3 A;  3VFZ A;  4HNT A;  2EIN H;  1N78 A;  1XDS A;  3E1S A;  4NC6 A;  1NTC A;  1ZTR A;  2HQA A;  2IXS A;  2HPI A;  1O7L A;  4LG3 A;  1ZRF A;  1T38 A;  1UHM A;  1SVO A;  2XAH A;  4IRG A;  3A4C A;  2NYX A;  2VJI A;  4P96 A;  3WU2 C;  3L2C A;  1MBJ A;  2PMU A;  2AQE A;  4HPQ A;  4HW0 A;  2H09 A;  4RAG A;  1FOW A;  2BY1 A;  4ZZL A;  1FYK A;  3SDB A;  1S7O A;  2ELH A;  4YEJ A;  2Q1Z B;  3S2W A;  5ERI A;  1U9N A;  1W4M A;  4ETS A;  2EA4 A;  1A6Q A;  4DOZ A;  1DPU A;  1QVT A;  3DV8 A;  2MLK A;  1LFP A;  4GO1 A;  5FFZ A;  1MJ9 A;  1XCV A;  2KL4 A;  2M87 A;  2VT3 A;  1LEA A;  4FTH A;  4PCQ A;  2DQR A;  2K40 A;  1I27 A;  4B8X A;  4M72 A;  4EGZ A;  4IVN A;  1XG1 A;  3RYR A;  3CCV I;  4M74 A;  2V26 A;  3WTU C;  2LKX A;  2DI3 A;  1B8I A;  2DFF A;  3I5U A;  3V7C A;  4U7D A;  2K86 A;  3LMM A;  1EH6 A;  4PFO A;  2F6C A;  5J1U A;  2ZNY A;  1MSE C;  4JOM A;  4DJA A;  1Y8Q B;  3ZXS A;  2FD5 A;  4EVI A;  3R60 A;  2EIK H;  3HG9 A;  2XRN A;  3A0B C;  3HYI A;  2ZBK A;  2XAS A;  3WG9 A;  4DZP A;  4D0P A;  2QSH X;  1ZG1 A;  5E17 F;  1WJB A;  1OR7 C;  2OPT A;  3WU1 B;  2LRD A;  1ZRC A;  3W6K B;  5FKK A;  4XLE A;  4CDG A;  1U78 A;  3L7W A;  4N4N B;  2MD0 A;  4RGU A;  3ZMV A;  3TW7 A;  2IT0 A;  1R00 A;  2L01 A;  1HOM A;  2WAQ N;  1DPR A;  4AU7 A;  4BUP A;  3VYR B;  2EH3 A;  1YX5 A;  3KFW X;  2AHQ A;  3FXJ A;  1CF7 A;  2Z16 A;  4R1H A;  2HU9 A;  3U2R A;  3OR1 C;  4ZYG A;  3N4M A;  1O4X A;  2V9K A;  2ZCW A;  5LLQ A;  3TO6 A;  1K79 A;  2Q2E A;  3WTV C;  3KET A;  4X1E A;  1M1E B;  2IA2 A;  3PL8 A;  1FEX A;  3P5J A;  1U2W A;  3DBL B;  2KT0 A;  3RKW A;  5EDN A;  1LFU P;  2L02 A;  4IOA F;  1A5J A;  1GV5 A;  2DLL A;  5GTI C;  3DXJ F;  4M3G A;  3DLA A;  1K6Y A;  4C3I J;  3CLQ A;  2EFP A;  2W7N A;  3QPL A;  1R4N B;  2GM4 A;  2XC7 A;  3ZQL A;  4MEY F;  2VJ4 A;  5ILU A;  5DYM A;  3S15 J;  2XV4 S;  3PJR A;  4RBO A;  5HVQ C;  2CH0 A;  1U8B A;  1QRY A;  1R5H A;  4M6Y A;  4ZZD A;  1F9N A;  5EEH A;  3ZQI A;  3BTJ A;  5J8F A;  3P7N A;  3FZV A;  4AC0 A;  1X2M A;  3K4L A;  3VEP A;  3QOP A;  1FY7 A;  1FIA A;  4RAY A;  1YW9 A;  5HS7 A;  1IGN A;  2Y69 H;  1E17 A;  4HNV A;  3ZMT A;  4L18 B;  5E8I A;  2ELK A;  1G3T A;  4RA2 A;  1OCZ H;  2V1X A;  4KUM A;  3RSN A;  2WC2 A;  3CZ6 A;  1ZR4 A;  5KVR A;  3JR9 A;  1OR7 A;  1XMK A;  1JHF A;  2BYV E;  2JWT A;  3CF5 F;  4KFC A;  5A2Q Z;  4LLG F;  1F43 A;  1WQ2 A;  2RGV A;  2OZ6 A;  1XPX A;  1T39 A;  1T98 A;  5GPC A;  3NQO A;  4RAZ A;  3G2B A;  2OCE A;  3HHG A;  3I0T A;  3MKL A;  5LHH A;  1YTY A;  4A3L J;  3FMR A;  2OC6 A;  3LFU A;  3W2A A;  2IGN A;  1YO5 C;  1RKT A;  2Z33 A;  2A07 F;  4HF2 A;  3PUB A;  3K1P A;  1MBG A;  3CDH A;  2Y30 A;  2E19 A;  3FMQ A;  5ILS A;  1BIA A;  1ZRE A;  2VBZ A;  2HDC A;  3COA C;  1R1T A;  3ASN H;  3D0S A;  5FO5 A;  2EJR A;  3GZ5 A;  1ETK A;  2XRO A;  2PMZ A;  1I3A A;  3DU5 A;  3O8G A;  1MZB A;  5TGT A;  1W7P B;  1JT6 A;  4F93 B;  3IRR A;  3TO9 A;  3H0D A;  1B8I B;  3FWE A;  1IJW C;  3OSF A;  4HNU A;  2OCC H;  2HVQ A;  5DS9 A;  4XRS A;  1UG0 A;  4P5O A;  4ZYA A;  4G94 A;  5FFX A;  4CHU A;  2L7F P;  4KMU X;  5KAI C;  4UB6 C;  4KNY A;  2XGD A;  1REP C;  1KQ9 A;  3TKY A;  2ZJR F;  1R36 A;  3HSE A;  2VQC A;  1RC9 A;  2WTE A;  3SZP A;  1I1G A;  1EH8 A;  4DBQ A;  2R7R A;  3H9G A;  1B9N A;  2XHK A;  3OOU A;  2MW8 A;  2CJJ A;  3HXL A;  4L9J A;  3OS1 A;  5BOX A;  2EFQ A;  2CUF A;  3LSM A;  3K4C A;  2O5R A;  5F0F A;  1OYY A;  2FUG 2;  2ME6 A;  3MKZ A;  5IYC J;  2CQX A;  3IAS 2;  3A01 A;  2NVT J;  2GBY A;  4E6K G;  2DT5 A;  2BHY A;  3DKX A;  3W3C A;  3RQ4 A;  2ID3 A;  1SVM A;  3I54 A;  3KEO A;  1B1B A;  3KPH A;  1R4M B;  3LQQ A;  4XR6 A;  4U87 A;  3T8R A;  2XAQ A;  2LVS A;  3FX3 A;  3RZD J;  2X1C A;  3CJR B;  5CVV A;  4V2F A;  3OYC A;  3HGY A;  1Y39 A;  2R4G A;  4RGR A;  1GXP A;  2K5C A;  1UJ8 A;  2KMU A;  3W2W A;  3OS0 A;  1QZZ A;  2WV0 A;  5LGT A;  1ETO A;  3JRC A;  3V7R A;  3BP8 A;  5IT9 Z;  3KLN A;  3M1E A;  1OJL A;  4IXA A;  4YFX F;  4XSX F;  4GDF A;  2H1L A;  2PFB A;  3DPL C;  1X58 A;  5JVG F;  1D3Y A;  4A5N A;  5E3N A;  3ZQF A;  2JA5 J;  1MBH A;  3MEX A;  4B44 A;  5HDN A;  5GTH C;  2CG4 A;  4A0X A;  1B72 B;  3FBI B;  3CCQ I;  4P1W A;  2R7V A;  1ODD A;  3QPS A;  1QZE A;  2R7X A;  4BY7 J;  1MW7 A;  5EGO A;  3H92 A;  5D6F A;  3JTG A;  1MNE A;  3WTZ A;  3LSJ A;  4AYB A;  1IV8 A;  2ISY A;  4BJ5 C;  1D1B A;  4BE0 A;  1ZQ3 P;  2V6E A;  1AKH A;  3JCU C;  4YIF A;  2RNG A;  4HDV A;  4EJO A;  3S1R J;  2Z3Y A;  3K4N A;  2VBW A;  2CW8 A;  1Z05 A;  2XPV A;  4C3H J;  3GVA A;  1J7K A;  2MA3 A;  4E7K A;  2JA7 J;  3CES A;  3BTI A;  4N4O B;  2PI0 A;  3S2H J;  1Q1H A;  1VZ0 A;  3KYC B;  1ZRD A;  1X1B A;  4LIV A;  2D1V A;  4BQA A;  2NOJ B;  1LPQ A;  5DM6 F;  3RI4 A;  3ROU A;  2B0L A;  3D5S C;  3JAM K;  2A69 F;  4BBR J;  1JE8 A;  1LDJ A;  2EFW A;  1AWC A;  2AS5 F;  3J81 K;  5DCM B;  2FOK A;  4L9N A;  4RGX A;  4E70 A;  5GPA A;  1V5G A;  2HVS A;  1WVR A;  3M9A A;  1IDY A;  5HS8 A;  1G6N A;  2CQ7 A;  1VF9 A;  3GLX A;  2BVL A;  3HPG A;  4I0A A;  2LFB A;  3Q9V A;  4JX4 A;  3MZ8 A;  1WHU A;  4HEA 2;  4XOR A;  5DD8 A;  3M4O J;  3PQJ A;  5LRS A;  1TWF J;  3RCO A;  4I01 A;  4PZJ A;  3ZQ7 A;  5ILV A;  5CQG A;  2QSF X;  2CFO A;  5F6F A;  3LL7 A;  3LST A;  1YX3 A;  2VE8 A;  3I3L A;  1PP8 F;  1OCO H;  1SFO J;  1N75 A;  3HRM A;  1TTY A;  4BGD A;  4ZYD A;  1T0F A;  2EFO A;  3E5Q A;  4ZDO A;  1POG A;  2VLA A;  5L3C A;  1ZK8 A;  4ON0 A;  5FKO A;  1Z7U A;  2R7F A;  4OIR F;  1STZ A;  1X19 A;  3WE2 A;  1FNN A;  1WH5 A;  4ITV A;  3DWL E;  3PIO F;  3DPU A;  3F72 A;  5F04 A;  3S17 J;  3BG9 A;  3CCM I;  5F64 A;  4CYD A;  4BEH B;  1ETQ A;  2ZKZ A;  5M3M J;  3CLO A;  1XTA A;  3I56 I;  3MQ0 A;  3ZOB A;  2STW A;  4L0Z B;  2X51 A;  3QYE A;  2ETH A;  3GO5 A;  1I6H J;  3BTL A;  2JRM A;  1MGT A;  4PGG A;  2XKO A;  4J00 A;  2UUZ A;  2VI6 A;  5LRR A;  4GFB A;  4RS8 A;  3FXM A;  1YE9 A;  3CJT B;  2HQN A;  2XF5 A;  1QBJ A;  1WRJ A;  3WU0 A;  4ENK A;  1TP4 A;  4IPA A;  2D45 A;  4R79 A;  1QQI A;  2CS3 A;  2ELJ A;  3NRV A;  1WJE A;  1S7E A;  3G3Z A;  1MH3 A;  2M4K A;  4HOB A;  1O3Q A;  1LFB A;  2HVR A;  1K4T A;  3ELK A;  2OUM A;  5CPR B;  1QHH D;  1T0F C;  3DPT A;  2QKM B;  1WWX A;  1RUN A;  3I58 A;  1WFX A;  2NVU B;  2O3F A;  2PLY A;  3CMA I;  2KDZ A;  4RGS A;  2BVM A;  1Z1D A;  3IP4 B;  2GXA A;  5DD4 A;  2M1B A;  3EUH C;  2IGO A;  2CV1 A;  4BAY A;  3CC2 I;  4AD9 A;  4JX5 A;  4RM2 A;  4I98 B;  3U1K A;  3F3X A;  2KZG A;  3NWT A;  4G6Q A;  4HA8 A;  3R4K A;  4IHY A;  1YS6 A;  2CQQ A;  5ICC A;  2O9L A;  1TWH J;  2E2J J;  1IV6 A;  2HKX A;  1WI3 A;  3K2Z A;  5M3F J;  2P0W A;  2M4G A;  4E7L A;  4HX8 A;  3WGH A;  3F9K A;  4XL9 A;  3TBI A;  3CO6 C;  1OCP A;  3C7J A;  3T1B A;  1BR2 A;  2DMT A;  1RPW A;  1R1U A;  2DA1 A;  1RUO A;  1U3E M;  4BNC A;  4XN0 A;  2R7U A;  4LGW A;  2EA2 A;  1XC5 A;  3LA7 A;  2V1N A;  4HG2 A;  1TQP A;  2HTJ A;  4DYQ A;  4A3D J;  1LKX A;  2DCE A;  1D5Y A;  4V2G A;  2EV6 A;  3BZ6 A;  4GCV A;  1YOV B;  2IAI A;  2K3P A;  4RLF A;  1B6A A;  3WOD F;  2BGC A;  2DA3 A;  3IH4 A;  1IUF A;  3HM5 A;  3KZY A;  1D0X A;  2GZW A;  2YPR A;  4AUX A;  2P6S A;  2R7T A;  2DPD A;  5JHU A;  1FMV A;  4B3A A;  4XM3 A;  5J47 A;  1VQ7 I;  4A2U A;  1ZH5 A;  4A6E A;  4E7H A;  1YS7 A;  1QU3 A;  5KCM A;  1S29 A;  2JTV A;  3TOA A;  5DDG A;  5D5X B;  4CCO A;  1R71 A;  2NXN B;  3BPV A;  3OV8 A;  5D5W B;  2K85 A;  1IRZ A;  3BG7 A;  4CCM A;  4CCN A;  1OCC H;  1XS9 A;  2L9S A;  5J1Y A;  3GLL A;  4HV5 A;  2F4O B;  1VQN I;  1G59 A;  1BOB A;  4NBQ A;  2HWV A;  3HRT A;  2FBH A;  3HIF A;  1NK3 P;  3OYJ A;  2Y0M A;  2IP2 A;  3SFI A;  3V42 A;  4UV9 A;  4M9S A;  4B43 A;  1Z6T A;  1DGR M;  2QF7 A;  3A1Y A;  4XKV A;  5HLH A;  2JT1 A;  3LQR A;  2QBY A;  2PMH A;  4ANJ A;  2L9R A;  2L9V A;  5L3F A;  3RQI A;  3H1C A;  3TMO A;  3GF2 A;  3IH2 A;  3KE2 A;  1USS A;  1ZG3 A;  3BCA A;  3HEF A;  4RAF A;  2D5V A;  2E36 A;  4Z6Y A;  4WXH A;  3MZY A;  2PMZ N;  1D0Z A;  2F4M B;  4R8H A;  2DA7 A;  1BW6 A;  4XRS G;  4F92 B;  4AVP A;  2O6G E;  2WAD A;  5CJ9 A;  3ZRG A;  1TQI A;  3BZK A;  1CQT A;  4BHP A;  1VQ5 I;  2XAF A;  1E3O C;  2GAU A;  1Y8R B;  1I3Q J;  2DJN A;  3CP2 A;  1T08 B;  4A3I J;  2XAG A;  2UZK A;  3S16 J;  2BE5 F;  2NVX J;  2IVM A;  5F0H A;  3R0J A;  5GAE J;  4KT6 A;  5IPA A;  2LY2 A;  1VQK I;  4LB6 B;  2EPF A;  3OYH A;  1BL0 A;  1J0R A;  2ME0 A;  2KIQ A;  3OR2 C;  1DU6 A;  1AOY A;  4L5E A;  1EH7 A;  2IS1 A;  2O0Y A;  3GTQ J;  2EV5 A;  5D5V B;  3WTS C;  3SYT A;  1IZ1 A;  2NS0 A;  2KJB A;  2XGE A;  1FBQ A;  3WTX C;  3PIP F;  2M2E A;  4C2M J;  3J80 K;  4EJU A;  5IT9 K;  3G4S I;  1ETW A;  5D8K B;  3DLL F;  1RR8 C;  4N9I A;  3TO7 A;  1I50 J;  2V4J C;  5D4R A;  3H5N A;  1KA8 A;  5CYV A;  1SEU A;  1GXQ A;  3TP0 A;  2R7O A;  5HLI A;  1FOY A;  2EBI A;  5LD2 C;  2BY2 A;  4BY1 J;  2GA2 A;  5IYD J;  1T95 A;  2IPQ X;  2XUB A;  4K2E A;  4S04 A;  1SFE A;  1MKM A;  4M3E A;  1OYW A;  5TJJ A;  1AKH B;  4X0G A;  4QIW N;  2LK2 A;  2XIG A;  1I1S A;  3Q3S A;  2WY7 Q;  1SAX A;  2DMP A;  5L3G A;  3H9Q A;  3F8M A;  4PK4 A;  3RPQ A;  3CO7 C;  2CYY A;  5AIQ A;  2DT6 A;  2P81 A;  2RDP A;  3E6D A;  3B02 A;  5IOY A;  3ULQ B;  4ZDL A;  3L2Q A;  1JGS A;  5FB2 A;  4JK1 X;  4PUS A;  5K5Q A;  3Q9S A;  2IGK A;  1P6R A;  4O5V A;  5IY5 H;  2R5Z A;  2H8R A;  3HSF A;  4HAM A;  2MC4 A;  2EIM H;  2COM A;  3CMM A;  3I4M J;  5D6E A;  2ISZ A;  2LD5 A;  2QBY B;  2QEN A;  3DTI A;  3LFK A;  4KIC A;  3BWG A;  2Y9Z A;  2JPB A;  4NNJ A;  2LRE A;  2LP0 A;  3OS2 A;  2FQ3 A;  3F23 A;  3MMY B;  3OOP A;  1AU7 A;  3A0H C;  3GTO J;  2L5Q A;  1FYL A;  1ZG5 A;  2KRF A;  4C30 A;  3JW4 A;  2QQB A;  1LE8 B;  2OV7 A;  4E7J A;  2BBY A;  4ESB A;  2R7D A;  2RQP A;  5FD5 A;  2Q0O A;  1VQP I;  2CV2 A;  2BEO A;  3FBN B;  1H0M A;  1OCT C;  1XX5 A;  1ZGJ A;  3WE3 A;  3OYI A;  2N8G A;  5CVI A;  1QNT A;  2F5C A;  5DV5 A;  3KYL A;  1SD7 A;  5BPD A;  3AG4 H;  5F0C A;  2Y2Z A;  4FAS D;  1OLT A;  2HOA A;  3F6V A;  5K7H A;  2H1K A;  3P9K A;  2MH2 A;  4Y33 A;  3JRI A;  2ZXI A;  4LIU A;  4EM2 A;  4P9F A;  3I59 A;  1Y0U A;  2VAS A;  1DP7 P;  3WHC A;  2XB5 A;  3IL2 A;  3D1N I;  2F5D A;  1YG2 A;  3FHZ A;  2HZT A;  3GTG J;  3GME A;  1MJA A;  1XMX A;  4P55 A;  3ZN0 A;  4UY8 I;  1ENH A;  2X6O A;  3KP2 A;  1ZR2 A;  3FK7 A;  3SHF A;  3X2Q H;  2E1M B;  3CCR I;  2L7K A;  3IC7 A;  5K5R A;  5M5X J;  1FX7 A;  4OIN F;  2E2I J;  2FBI A;  3EUA A;  2DJI A;  4HRI A;  1B9M A;  4IQ4 A;  3CUO A;  1G8X A;  3QPH A;  2CW0 F;  3HL2 A;  5C3E J;  2DMQ A;  3HUG B;  3S1N J;  4A3B J;  4TV7 A;  3ABT A;  2R7Z J;  3O8H A;  1Z67 A;  3M1C A;  2DTR A;  5A2Q K;  1XGS A;  3O3K A;  2FNA A;  4YII A;  4B3X A;  2ZFW A;  3JRF A;  3OYM A;  2K27 A;  1OCR H;  2L54 A;  5IP9 J;  2LLK A;  3I4N J;  2IRF G;  4FE4 A;  4BXF A;  3E6B A;  1PUF A;  1GHC A;  5HS9 A;  3NEU A;  5HOD A;  1XMA A;  2ECB A;  3ZMD A;  4MIM A;  1Z3Y A;  4C3J J;  3FXQ A;  3CJN A;  4CCK A;  1Z3X A;  1MDM A;  5M5Y J;  3WTY C;  2OQR A;  3FXU A;  4MGR A;  1YQA A;  3BG3 A;  2JJ7 A;  1FOX A;  2L7Z A;  1PVE A;  1BR1 A;  3L1P A;  1RZ4 A;  1XSD A;  4XQF A;  3EYI A;  4S05 A;  2G7H A;  1HCR A;  3LWF A;  4QLC U;  2K9N A;  3RDI A;  3KZI C;  5LGN A;  4LK1 F;  4FX4 A;  2X4H A;  2HNH A;  1ERD A;  2MFZ A;  3HKZ A;  3OYE A;  1QVU A;  2PX9 A;  2P4W A;  3BOQ A;  2LDU A;  2XVC A;  4W1U A;  4XIC A;  2R5Z B;  2YS9 A;  2P5V A;  3I53 A;  4EJV A;  3ASO H;  5EF6 A;  1A6I A;  1J59 A;  5DUK A;  4ENM A;  2Z5U A;  1JKQ C;  2H27 A;  2O8X A;  1SVL A;  2KIU A;  3DF8 A;  1LUJ B;  2K4J A;  3FMS A;  1KYZ A;  2WAF A;  3QP5 A;  4B48 A;  4XON A;  4E7I A;  4Y7N J;  2HEO A;  3HOU J;  2F2E A;  2VXD A;  4KA4 A;  1B72 A;  3OY9 A;  2DFI A;  3ZR8 X;  2VOP A;  1ITY A;  4XRF A;  1EF4 A;  3E5X A;  2ECC A;  4L0Y B;  1U6G A;  1UEL B;  2E1M C;  4LK0 F;  1F4K A;  3ZPL A;  4OWR B;  1P7J A;  4XOP A;  3K4B A;  4JBA A;  5E79 C;  5E8G A;  4GYG A;  3G73 A;  4OIO F;  2GOX B;  4CZZ A;  3E3V A;  4XLC A;  3LSK A;  4ZC3 A;  1O57 A;  1LB2 A;  3Q5F A;  2EWN A;  1JKR C;  1W5T A;  2KRH A;  3ZQH A;  4ESJ A;  2EK5 A;  2P5K A;  3HZJ A;  4L5I A;  1APL C;  4ABZ A;  1VQM I;  1X3U A;  4OOI A;  3K7A J;  1UAA A;  4MO7 A;  5JR3 A;  3VYU B;  5D5U B;  1T2K A;  3KZZ A;  1FT9 A;  1A31 A;  4Q4Z F;  5B1A H;  3VYS B;  1TW3 A;  2QLZ A;  3TED A;  2L3D A;  3QRF F;  5J8C A;  4L9T A;  1ETV A;  5HNF A;  4ZTF A;  1IXS B;  2CUJ A;  2RV8 A;  2X48 A;  1LNW A;  2W25 A;  1OMI A;  2QGU A;  2P6T A;  3BR0 A;  3MAJ A;  5LFA A;  1BI2 A;  4ZYE A;  4JYK A;  2F5F A;  1WSU A;  2D1H A;  1FYM A;  1MSF C;  4DNC A;  4EMS A;  4AM3 A;  5TIS C;  2TCT A;  1HSJ A;  4NQW A;  1BC7 C;  4RLQ A;  5F1R A;  5F1J A;  3L2W A;  2HOS A;  1U5T B;  1VFC A;  1DDN A;  3IWF A;  3QYF A;  3UR3 C;  3HDD A;  3M7G A;  3RPU D;  1R22 A;  4XKW A;  5D8L B;  4ESF A;  1TNS A;  1FP2 A;  1TZL A;  3ML6 A;  1PP7 U;  4YFK F;  1IAW A;  1VQ6 I;  1KYW A;  1WH7 A;  1MDM B;  2LOO A;  1FLI A;  1IN6 A;  5D4S A;  2DDA A;  3F8B A;  5ICG A;  2CW7 A;  3BJ6 A;  2DOD A;  5IOZ A;  5IP6 A;  4WCG A;  1MND A;  1TLH B;  2YX7 A;  2VE9 A;  3AFH A;  3J7A Y;  3QQA A;  4M6V A;  3CCJ I;  1OPC A;  3O6B B;  1S72 I;  5IP7 J;  3LOC A;  3GZN B;  1VQ8 I;  4XMY A;  1SC7 A;  4BBS J;  3T0Y A;  3HOW J;  2HXI A;  1VQ4 I;  2A6T A;  5B66 C;  3DP7 A;  3F21 A;  1LVA A;  4YFN F;  3FXO A;  2VC1 A;  3PQK A;  1R23 A;  2L4A A;  2K02 A;  2OAZ A;  5B5E C;  3GYH X;  2MC3 A;  3U21 A;  1MJB A;  2Z9O A;  5C44 J;  5J4Y A;  2H6C A;  1FTT A;  2R93 J;  1L0O C;  4HQM A;  2OJE D;  1P7I A;  3BR2 A;  3H3Z A;  4DIQ A;  5EJC A;  2GXB A;  1OIS A;  3E6M A;  3V4G A;  3GTJ J;  4KT5 C;  2VUM J;  2ZO4 A;  1YRN A;  3QAH A;  2LTP A;  2W57 A;  5J6X A;  4F91 B;  4Y52 J;  2XB0 X;  2COB A;  4IRH A;  2ZNZ A;  1H89 C;  2OA4 A;  5B3S H;  5EG0 B;  2Z1D A;  2VKV A;  4HX7 A;  2YU9 J;  3LSR A;  4AIK A;  1HF0 A;  5CVR A;  3S14 J;  4IJA A;  2XSD C;  1YYV A;  4UUS A;  5BQT A;  1FBU A;  4CO8 A;  2ZJP F;  1QO0 D;  2E1N A;  1SMT A;  2ZJQ F;  1X1C A;  4HYE A;  2Q2E B;  3HTU A;  1S3J A;  1E2X A;  2E35 A;  1UHS A;  2HQ5 A;  1OQY A;  1H9G A;  2VJ5 A;  2FJ1 A;  3S3N A;  3S2D J;  4G9Y A;  1JGG A;  3IRQ A;  3TDZ C;  3RYP A;  1ZLK A;  3IKV A;  2PQ8 A;  2FEZ A;  5F08 A;  4BXX J;  2HGC A;  3VOD A;  1HA8 A;  5HLG A;  3ZQC A;  2FX0 A;  1I6X A;  1IXR C;  4G12 A;  4UUS B;  2XPW A;  4LLL A;  2F4I A;  2LMD A;  2DK8 A;  1P4A A;  2ZME B;  3ABL H;  3BC8 A;  4ASN A;  2JA8 J;  3DKW A;  3A2K A;  3BLY A;  3VWB A;  4NDL A;  2Y0S A;  1EV7 A;  3UNG C;  2OU2 A;  2VOO A;  1XB4 A;  2LNB A;  1F36 A;  4FE7 A;  4PJM A;  4QWQ A;  4CA0 A;  1Q1V A;  2JUC A;  2W48 A;  2HR3 A;  2M9H A;  2VQG A;  2CMP A;  5BS6 A;  5L3B A;  5CVU A;  2DMN A;  2X1D A;  3OIQ A;  1A35 A;  4EJW A;  4WK8 F;  2HOE A;  5H20 A;  1IN8 A;  2DK5 A;  3CME I;  3DCF A;  3TQN A;  3LA3 A;  1R58 A;  3VOE A;  4IKF A;  3MN2 A;  3BR1 A;  3K1N A;  3LSP A;  5IYB J;  5GAD J;  4D9J A;  3G1O A;  1XGN A;  2ADU A;  2FSW A;  3OMY A;  1WI9 A;  2JPC A;  1YIJ I;  1NH3 A;  3ZCO A;  3OL3 A;  5FRN A;  3V7S A;  4M3B A;  2HYJ A;  2VBY A;  3CTA A;  3G71 I;  1MIJ A;  4KIT B;  2E1C A;  3SEZ A;  3CCE I;  1IRX A;  2JK3 A;  2W85 A;  3K4K A;  1R9T J;  1HLV A;  2UV1 A;  3J7Z I;  4UV8 A;  4W97 A;  1ORK A;  5DUI A;  1K78 A;  4A3E J;  3GFM A;  2FBK A;  3HUG A;  2WAE A;  1KZH A;  1RNL A;  4G7H F;  2ZME C;  1WPK A;  2CGP A;  1FIP A;  1O7F A;  3SQN A;  4S0H B;  4EM0 B;  2O8K A;  4OMZ A;  5FLX K;  3S3M A;  1OKR A;  4WWC A;  2DAO A;  4IHV A;  1I5Z A;  3SEQ A;  1BN5 A;  3H36 A;  4HX4 A;  2E5N A;  1WJD A;  2Y9Y A;  3CUQ A;  1SD5 A;  2LF7 A;  4CYC B;  2JQ7 A;  2ZSH B;  1IN7 A;  1P9Q C;  4CH7 A;  3GX4 X;  2R7S A;  2K9M A;  4CCJ A;  5KNL A;  4NC8 A;  1WCM J;  2X6Y A;  3PM1 A;  4EJT A;  2EQR A;  2VOD A;  4UVC A;  1Y56 A;  1LQ1 A;  1T8I A;  1LDK B;  4I2O A;  2LKP A;  5JI6 A;  3BJA A;  2Z99 A;  3I9V 2;  4LB5 A;  1W5C C;  1ULY A;  4BE1 A;  3W6J B;  5L3D A;  4F3Q A;  1HBX G;  3FXL A;  3BT9 A;  3TGN A;  1NK2 P;  4HDU A;  1JUP A;  1VI0 A;  1I39 A;  2XDV A;  3I4P A;  5FKL A;  3GTL J;  1BW5 A;  3C2B A;  3EYY A;  2BY0 A;  2DA6 A;  1MMS A;  3CF2 A;  3E7L A;  2E1O A;  2WV1 A;  5E1W A;  3SXY A;  1YW7 A;  2BXY A;  3S3O A;  1FMW A;  3GFL A;  4UUV A;  3OYL A;  2IA1 A;  2V1U A;  3KP5 A;  2RVC A;  5BNG A;  1MD0 A;  2DT7 B;  2JUG A;  4QTR A;  3PO2 J;  2DTZ A;  3EQL F;  2X85 A;  5AON A;  1FZP B;  3PFI A;  5AIP A;  4Y13 A;  4DZJ A;  1R6R A;  4KYW A;  2V6C A;  4BQQ A;  1P92 A;  1BC8 C;  3F8C A;  1Z77 A;  5KK1 A;  2DFE A;  4I0B A;  1BI0 A;  1G4D A;  4LD5 A;  4FIS A;  1KU7 A;  2LY9 A;  3ZQQ A;  4AIH A;  3BDD A;  2VKE A;  3HOV J;  1TWC J;  3QYB A;  3G1L A;  3L00 A;  2DA4 A;  1FJL A;  1R7J A;  2ZXJ A;  3MWM A;  3C2H A;  1F5T A;  3VSL A;  1X1D A;  5EGO B;  4ENJ A;  5K5O A;  4PDK A;  2E7X A;  5FKN A;  4BS9 A;  4PJ0 C;  2IA0 A;  1BJZ A;  2E5Z A;  2QA4 I;  2ZC2 A;  3MVP A;  2DW4 A;  5H2F C;  2VPL A;  4MEX F;  4DQ2 A;  3BY6 A;  1PUF B;  3BG6 A;  3E97 A;  4N0B A;  2GIV A;  3DEU A;  2G9W A;  2NS8 A;  1SD6 A;  3FM3 A;  2JA6 J;  3CP8 A;  1DGW Y;  1MBE A;  4IHS A;  1JTX A;  3IUO A;  3HOT A;  4MTD A;  1FTZ A;  3DKY A;  3QU6 A;  2NRA C;  4WXC A;  1ZGW A;  3NAR A;  4HQE A;  1KU2 A;  2RC4 A;  2IS6 A;  4MNU A;  2PJP A;  2DU9 A;  2IGM A;  1CF7 B;  2HQR A;  2CO5 A;  5DM7 F;  3U1D A;  3I71 A;  5ICE A;  2E2H J;  1ETX A;  2K3F A;  5JFR A;  1R49 A;  1AHD P;  1KQ8 A;  1IDZ A;  5GP9 A;  1ZAO A;  2D2W A;  2XAJ A;  4A6D A;  1Z9C A;  3OYD A;  2PN6 A;  3Q0V A;  3QOE A;  4KIG A;  3D5R C;  4MQV A;  3CUQ C;  2IW5 A;  4DBR A;  4KIS A;  3K4J A;  3H9J A;  1DP3 A;  2KFD A;  1E0E A;  3B73 A;  3BJO A;  2NNY A;  3R6S A;  3I55 I;  4C9Y A;  2DPU A;  3AL0 B;  3S1Q J;  2R0Q C;  1HDD C;  1ZLJ A;  4U0V A;  1K61 A;  4LOC A;  3LAJ A;  5J1R A;  1AA7 A;  4KDP A;  3DQV C;  2QQA A;  3A01 B;  3VDX A;  3S32 A;  2A5W A;  5E1X A;  1JXS A;  1ONV A;  1YJ9 I;  4HV6 A;  3GWZ A;  3QU3 A;  1S8N A;  3GTM J;  4CXF A;  2K7L A;  1TC3 C;  2NOG A;  2HI3 A;  4IEJ A;  1ZEL A;  2R92 J;  3KYD B;  2WA0 A;  3HOX J;  1J09 A;  1X2N A;  2XGC A;  2W00 A;  4N9H A;  1YIO A;  3S8P A;  2X6W A;  2OQG A;  1UG2 A;  3ZP5 A;  5TRD A;  2MH9 A;  2B63 J;  2G0E A;  1FWZ A;  2EZH A;  4CUG A;  1LE8 A;  4OAZ A;  4MHG A;  3PO3 J;  4HST A;  1XDU A;  4QSH A;  4KIB A;  1JKP C;  4WX9 A;  3MFK A;  1X3W B;  4KN7 X;  5FD6 A;  5HDK A;  4UVB A;  2V7F A;  2X0L A;  1EJ9 A;  1BBY A;  2KIS A;  4BYY A;  3JTH A;  2WY8 Q;  3A03 A;  1WZ2 A;  4XLH A;  3V8J A;  3FK6 A;  1JUS A;  1YJW I;  3HOY J;  4PGH A;  1W1W E;  3AL0 C;  2F5E A;  3ABM H;  4G6T B;  1HKT A;  5EEA A;  3BQZ A;  1GV2 A;  2O03 A;  5E18 F;  3HB9 A;  2IJL A;  4MLO A;  2W84 A;  4LIT A;  2VJJ A;  5FLX Z;  3AAF A;  1WJC A;  1TQM A;  2E60 A;  1X1P A;  2ZME A;  2DBB A;  2P7V B;  3TL4 X;  5K1Y A;  1TBX A;  2WB1 N;  4D7M A;  2B7E A;  1WGX A;  4HLX A;  1Y6I A;  1O3S A;  2JVH A;  2A6E F;  2FNP A;  1W36 D;  5J3L A;  5BPI A;  2NVQ J;  4XLN F;  3ZMZ A;  1P4W A;  2LY1 A;  2XGX A;  5FLM J;  3DBH B;  2J5O A;  4EEF G;  1J5Y A;  3CCS I;  1TNT A;  3DEW A;  3PSF A;  1U9O A;  3K0L A;  3N05 A;  3HOZ J;  2MBF A;  4IHX A;  4O3M A;  4Y17 A;  3GCM A;  1YFH A;  4M3D A;  4BHC A;  3B6C A;  1U5T C;  1C0W A;  1IRF A;  2HPM A;  1TT0 A;  4CGZ A;  1QPI A;  1UMQ A;  3FKJ A;  1S7A A;  4ZH4 F;  2L2O A;  2ZSI B;  2MG4 A;  2VPR A;  3MKW B;  1KGS A;  2RRE A;  3KEQ A;  2LH9 A;  5BMZ A;  3BCB A;  2Z2S B;  2CV0 A;  2E71 A;  1FPQ A;  4KMF A;  4II3 A;  4B4C A;  2JRT A;  4A3M J;  2R7Q A;  1VTN C;  1W36 C;  4DW6 A;  1GVJ A;  4LLN A;  5LEK A;  2JZY A;  1DU0 A;  2CUE A;  3CC4 I;  4F7Z A;  4YIR X;  2H6B A;  4A0Y A;  3ZGK A;  4IZZ A;  2VIX A;  2DA2 A;  4WF2 A;  1JJ6 C;  3G1M A;  2KHM A;  3KX2 A;  5EZH A;  4A3J J;  2FRH A;  4XKB A;  4BU2 A;  1YJN I;  2RNJ A;  4RM3 A;  2X6X A;  3I59 B;  4HZF A;  4BQO A;  1LDD A;  4XSZ F;  3IH3 A;  1JUM A;  1G3Y A;  4YEL A;  2IS4 A;  2XAU A;  4A3G J;  2KDO A;  3J7Y J;  1HQC A;  1TL8 A;  3F8F A;  2V1D A;  1MMA A;  3TP3 A;  1SMY F;  1UB9 A;  4FT8 A;  4IOC F;  1BI1 A;  3GZ6 A;  4XK4 A;  3EUK L;  2UXX A;  4ZTJ A;  2R3S A;  2Q8K A;  5FLV A;  3LSH A;  2BZT A;  1VQL I;  5CVJ A;  3FIS A;  4IRI A;  2VN2 A;  1V5F A;  3K70 D;  2DXI A;  3DEE A;  3ZMS A;  4OMY A;  1LEB A;  3R0A A;  4M73 A;  4D5F A;  2DOA A;  1SD4 A;  4A0Z A;  4UNO A;  3E6C C;  3KLO A;  1IG7 A;  3S1M J;  1IN5 A;  1BR4 A;  2QYO A;  3J7A O;  2JA2 A;  2M45 A;  3VYT B;  2CUZ A;  4BJ6 C;  3EET A;  1V54 H;  1J2X A;  2NNN A;  3HGG A;  4XKC A;  2M30 A;  3CDI A;  1OFC X;  2PBI A;  3L2V A;  4A5M A;  1N25 A;  1YW8 A;  1Z7L A;  1YI2 I;  1JJ8 C;  2E34 A;  4PJN A;  1A36 A;  3VB2 A;  2IBD A;  4A12 A;  4HSR A;  4HLY A;  2RKH A;  3F0C A;  3BPX A;  4QPQ A;  1D1A A;  4M9Z A;  2HXO A;  2I8D A;  4UXN A;  5FGM A;  1WJA A;  3HPH A;  3R61 A;  3CCU I;  4DGW B;  4OIP F;  1UHW A;  2QZ8 A;  4RB2 C;  5JLW A;  3F6O A;  2EZL A;  2M8G X;  4JX6 A;  2LF8 A;  2R5Y B;  4MQ9 F;  4DYC A;  2DYR H;  3NAU A;  2KQR A;  3ERM A;  3DTK A;  3HC7 A;  2GXG A;  1SFU A;  2IEK A;  4M3F A;  3HRU A;  3RKY A;  2DFH A;  4U0Y A;  3H5R A;  4FET A;  1R1V A;  1HXD A;  3J81 Z;  4Y3O A;  4O6J A;  3U9G A;  3CQZ J;  3FM5 A;  4XNF A;  1IN4 A;  2K9Q A;  2I10 A;  5M5W J;  2DA5 A;  2RAE A;  3K70 C;  4PJL A;  3P9I A;  5HDG A;  2KIM A;  2R5Y A;  4CSW A;  3M8E A;  1D5V A;  1ON2 A;  1P4X A;  3HKZ N;  3DTE A;  4FHT A;  2YU3 A;  4Q47 A;  4CZC A;  5LGU A;  5HOO A;  3WGI A;  1MMG A;  2A61 A;  2DOE A;  4ENN A;  2B9S A;  4UVA A;  3MKY B;  4I99 C;  3HRS A;  4WXD A;  1GLN A;  3BRO A;  4EQQ A;  1NHA A;  2TDX A;  3JAM Z;  3WTW C;  5DCM A;  2W82 A;  2C6Y A;  3G6E I;  1E3H A;  2V79 A;  3MCZ A;  4V19 K;  1JTY A;  2VXZ A;  1EKE A;  3BQY A;  3HBL A;  2DO7 A;  2GWR A;  3MZH A;  2CU7 A;  2X9D A;  1GT0 C;  4IQJ A;  1BA5 A;  3EUH A;  5E3O A;  3PUF A;  2QUF A;  3IHU A;  3T5X A;  4FX0 A;  4RDU A;  2PJR A;  4OAY A;  4LJZ F;  3VPR A;  2EFN A;  2YX4 A;  2WAQ A;  3KEY A;  4JP0 A;  3WHB A;  3WGG A;  5DCF A;  2QCO A;  2EIL H;  5C4J J;  2V9P A;  2LYC A;  2QSG X;  4GGG A;  2MYS A;  1YLF A;  2DN0 A;  2BHZ A;  2KIF A;  2WB1 A;  2ZB9 A;  1FP1 D;  4YG2 F;  3RIR A;  4RB1 A;  4RB0 A;  4KJZ A;  4FCY A;  2BV6 A;  2L9N A;  2H8W A;  2E7W A;  5FRO A;  4AWX B;  1T56 A;  1XSV A;  5H6Q A;  1RET A;  1QGP A;  3W2V A;  1FOK A;  3PNY A;  2VT2 A;  1J75 A;  3LAP A;  2QKL B;  1KU3 A;  2M8E A;  3DBR B;  4KN4 X;  4IX7 A;  1D8J A;  4NB5 A;  4ZYH A;  2XPU A;  3GXO A;  5E1Z B;  2P5L C;  3ZN1 A;  2P8T A;  5KHD A;  5CQE A;  3O2P E;  3QWL A;  2A6H F;  2M34 A;  3H3U A;  1UZC A;  1UCR A;  2FML A;  4II2 A;  1KQ0 A;  4PSX A;  3P9C A;  3E5U A;  5H6R A;  4CCL A;  4LMY A;  2EIJ H;  3K9T A;  4NHJ A;  1QPM A;  4BL0 B;  5GAH J;  2OF7 A;  2HKO A;  2EZK A;  2DOF A;  5DTD A;  1HW2 A;  1TWG J;  1WKM A;  2DMU A;  2JSP A;  2XF7 A;  1GUU A;  2BXZ A;  5K7Z A;  3SJM A;  3CDL A;  2LC2 A;  5F27 A;  3CUQ B;  6PAX A;  2LG4 A;  3E0J B;  2ZFU A;  4BDY A;  1W5S A;  2HDW A;  3JRD A;  4XRM A;  1XGM A;  2MGQ A;  3W6V A;  1GVD A;  2BW3 B;  3KCC A;  3L2R A;  2K9L A;  4XBF A;  4ZDP A;  4XLF A;  2HZD A;  3OYG A;  3CD6 I;  1XGO A;  3FF5 A;  2CWE A;  1R5I D;  1SAN A;  3GBG A;  3L9F A;  3M8J A;  4A69 C;  4IHW A;  5LBQ A;  3M3Y J;  2FOW A;  3RKQ A;  2A05 A;  1HST A;  2HS5 A;  4I09 A;  2OTL I;  4EGY A;  2YR2 A;  4GRI A;  3LSI A;  1FC3 A;  1MMN A;  1VQ9 I;  3OIO A;  2K4B A;  2AQF A;  2HYG D;  4XOT A;  1Z6R A;  1ZYR F;  1V4R A;  4E7Z A;  5C4X J;  4BAC A;  3HOS A;  2M0C A;  2HDD A;  4I7H A;  4U0W A;  5J40 A;  1B59 A;  3HTS B;  4NC7 A;  3ZQG A;  4U7B A;  2MLG A;  2OZU A;  1J9I A;  3KP4 A;  3FXK A;  3V8L A;  3LA2 A;  2QVO A;  3SZG A;  3CJQ B;  2QM3 A;  2W24 A;  1QZY A;  3IAM 2;  3L09 A;  1LVK A;  4PSW A;  4PJJ A;  2VKD A;  1IRG A;  3PSI A;  3OYN A;  1G2H A;  2ZXW H;  2P7C B;  1TT5 B;  1JHH A;  1GDT A;  1YRN B;  4P9U A;  1QHG A;  2CFX A;  1T6S A;  2L7M P;  4E4H A;  1PDN C;  1MNM C;  2R7W A;  1S6L A;  3K1M A;  3UKG A;  5LEJ A;  1L3L A;  1MMD A;  5LHI A;  2L0K A;  2OTJ I;  3BR3 A;  1MBK A;  4EAT A;  1O3T A;  5EZG A;  3K10 A;  4M6X A;  4Y15 A;  2XKP A;  1PJR A;  4KIF A;  2A5Y B;  1V55 H;  3ECH A;  2HOT A;  3CCY A;  3C18 A;  4X6A J;  2NAZ A;  1KU9 A;  4BJT A;  2DQL A;  3H5A A;  4DYR A;  2PJR B;  4LFU A;  4JQF A;  4MFD A;  3C3W A;  3JSO A;  3M07 A;  2FF4 A;  3FKI J;  3SFZ A;  1E3P A;  2LKS A;  4M71 A;  4BDZ A;  1MH4 A;  1ON1 A;  3RKX A;  1K83 J;  2ZJ2 A;  2YSR A;  4NQW B;  4HF0 A;  2UWM A;  1VQO I;  1T33 A;  1RI7 A;  2M3A A;  2OBP A;  4BEH A;  2M7B A;  2J5P A;  1RKW A;  1XCB A;  4XID A;  2W4S A;  3OYK A;  3QOD A;  4G7Z F;  1W7P D;  3PFY A;  4OU0 A;  3ONQ A;  3M8F A;  4D7N A;  4IL6 C;  3GFJ A;  2O7O A;  4IF4 A;  2O61 A;  3N97 A;  2LSO A;  1D0Y A;  2KZV A;  1WJF A;  1FSH A;  1G3S A;  2HFH A;  5B1B H;  1PUE E;  2NS7 A;  1K7A A;  2QQ9 A;  2BOL A;  4B09 A;  2KRC A;  1NG7 A;  5E3M A;  5JLX A;  2EB7 A;  3AG1 H;  2DDB A;  2ID6 A;  1W0T A;  5E20 A;  2FQ4 A;  1X3Z B;  3FIW A;  3OYF A;  2TRT A;  4BKX A;  3KIO A;  3Q0U A;  1Y1W J;  2A68 F;  2CSO A;  4L9V A;  3LNQ A;  1Z0X A;  3TW6 A;  2ESH A;  3EDP A;  5JVT A;  1A04 A;  2BW3 A;  1D1C A;  3JRG A;  1NG6 A;  5L3E A;  3IWZ A;  1HKS A;  4B1R A;  2VL8 A;  4BQN A;  1ACI A;  5CLS A;  5EEG A;  3DU6 A;  2GQQ A;  1U8R A;  2F5V A;  3CC7 I;  2VQL A;  2MD5 A;  4U88 A;  3KP3 A;  2I5U A;  3CCL I;  1ZGA A;  2G7U A;  1N77 A;  4ZJZ A;  3QP6 A;  4Q48 A;  1YIT I;  1U0J A;  2GA1 A;  1RES A;  2FU4 A;  1ZHF A;  3H3V K;  5JHF A;  2JSC A;  1XSX A;  3L2U A;  5FJ8 J;  2Y75 A;  1UFM A;  4H0E A;  1JT0 A;  5GAG J;  9ANT A;  3BTC A;  2LBF A;  3JRH A;  2HTS A;  2JVG A;  3HHH A;  3DFG A;  2FA5 A;  1Y1V J;  2Y31 A; 
#chains in the Genus database with same CATH homology
 3FBI B;  2KLO A;  1S9H A;  4P1W A;  2R7V A;  4CUG A;  4OAZ A;  2R7X A;  1MW7 A;  2HNH A;  4HST A;  4XLA A;  3VSK A;  3FDY A;  1MNE A;  2MFZ A;  4QPO A;  4YRV A;  1ERD A;  4AYB A;  3HKZ A;  3OYE A;  1KON A;  2V7F A;  1D1B A;  4BJ5 C;  4BE0 A;  2ZXH A;  2V6E A;  3MD2 A;  2RNG A;  3OL4 A;  2WY8 Q;  4XLH A;  3K4N A;  4AVZ A;  2CW8 A;  4E7K A;  3CES A;  3AL0 C;  2M7A A;  4N4O B;  4G6T B;  1VZ0 A;  1X1B A;  2X1E A;  4LIV A;  4MLO A;  2NOJ B;  2LBF B;  4LIT A;  2VJJ A;  1WJC A;  3K6G A;  2E60 A;  3D5S C;  2WAF A;  5HLT A;  4B48 A;  4BE2 A;  4XON A;  4E7I A;  1EA3 A;  3TL4 X;  2VXD A;  4NUB A;  1Y6I A;  3OY9 A;  2JVH A;  1W36 D;  1V5G A;  3ZR8 X;  2HVS A;  4Y4R A;  5CKT A;  5HNH A;  2LY1 A;  2E1M C;  1UEL B;  4OWR B;  3D5L A;  4XOP A;  3H35 A;  2BVL A;  3PSF A;  3K4B A;  2KP6 A;  3HPG A;  3N05 A;  4HEA 2;  4XOR A;  2GOX B;  2VB6 A;  4F55 A;  3RCO A;  4XLC A;  3LSK A;  4ZC3 A;  3FHN A;  3PNV A;  2HPM A;  1TT0 A;  5CQG A;  4J01 A;  2CFO A;  3FKJ A;  2KRH A;  3LL7 A;  2L2O A;  2ZSI B;  1YX3 A;  3MKW B;  3I3L A;  4H4K C;  2RRE A;  1UAA A;  1V5E A;  1N75 A;  4B47 A;  4ZDO A;  4BGD A;  2LH9 A;  2XF6 A;  3VYU B;  3BCB A;  2Z2S B;  2CV0 A;  2VLA A;  4II3 A;  2R7Q A;  3VYS B;  1W36 C;  2MAB A;  1SFK A;  5HNF A;  4ZTF A;  1X19 A;  2KPM A;  2CUJ A;  4ITV A;  3DWL E;  3OYA A;  3DPU A;  3ZGK A;  4IZZ A;  2VIX A;  1JI8 A;  4D1Q A;  1PYV A;  5LFA A;  2KHM A;  3KX2 A;  5FRM A;  4BU2 A;  4XKB A;  4RM3 A;  2WBM A;  4BEH B;  2X6X A;  4BQO A;  4RLQ A;  3L2W A;  4YEL A;  2X51 A;  3QYE A;  3AKZ A;  2XAU A;  4C2T A;  2IS4 A;  2KDO A;  3QYF A;  3UR3 C;  2XSJ C;  1MMA A;  3RPU D;  4J00 A;  2UUZ A;  4XKW A;  3C2G A;  1TZL A;  3EUK L;  4ZTJ A;  1YE9 A;  2XF5 A;  3LSH A;  3LSG A;  4RMN A;  2M0M A;  3OIP A;  2GOM A;  1V5F A;  3K70 D;  2LOO A;  2DXI A;  3DEE A;  4R79 A;  2CS3 A;  2ELJ A;  3K4M A;  3S93 A;  1WJE A;  2DOA A;  4PFP A;  2CW7 A;  2M4K A;  2HVR A;  1MND A;  1DQU A;  3OWT A;  1Z21 A;  2OUM A;  3AFH A;  5CPR B;  1QHH D;  3J7A Y;  1BR4 A;  1T0F C;  2JA2 A;  3VYT B;  2CUZ A;  2QKM B;  3DPT A;  4BJ6 C;  4F52 A;  4XKC A;  2VKH A;  4XN3 A;  3L2V A;  1WFX A;  4XMY A;  1Z7L A;  4PJN A;  4E7S A;  2BVM A;  3IP4 B;  4HSR A;  2A6T A;  3EUH C;  2IGO A;  2CV1 A;  4QPQ A;  1WJ5 A;  1D1A A;  4RM2 A;  3RTR A;  3EPZ A;  2I8D A;  3NWT A;  1WJA A;  2W1O A;  3U21 A;  3HPH A;  4DGW B;  4DIQ A;  2P0W A;  2IS2 A;  2M4G A;  1X4O A;  4E7L A;  3F9K A;  4XL9 A;  3TBI A;  1X4P A;  1BR2 A;  3OYB A;  2KQR A;  3DTK A;  3HC7 A;  4F91 B;  2RQQ A;  4XN0 A;  2R7U A;  3NWS A;  1X1A A;  3PNT A;  2V1N A;  1SAU A;  4HG2 A;  2Z1D A;  3H5R A;  4FET A;  1LKX A;  2DCE A;  2VQH A;  4Y3O A;  4XNF A;  4C2U A;  2K3P A;  4RLF A;  1X1C A;  3K70 C;  4PJL A;  2Q2E B;  1N78 A;  4HNT A;  3E1S A;  4CSW A;  2VJ5 A;  1D0X A;  3DTE A;  3S3N A;  2HQA A;  2R7T A;  2IXS A;  2HPI A;  4LG3 A;  1FMV A;  4CZC A;  4XM3 A;  5HOO A;  1MMG A;  3A4C A;  4E7H A;  2VJI A;  1QU3 A;  1HA8 A;  5KCM A;  3MKY B;  2AQE A;  1GLN A;  4HPQ A;  4CCO A;  2W82 A;  2F4I A;  3BG7 A;  3SDB A;  4CCM A;  4CCN A;  3BC8 A;  2L9S A;  2VXZ A;  4YEJ A;  2Q1Z B;  3A2K A;  3BLY A;  1G59 A;  3VWB A;  4IQJ A;  1BOB A;  2Y0S A;  3UNG C;  4DOZ A;  4PJM A;  2PJR A;  4OAY A;  4CA0 A;  1LFP A;  2WAQ A;  3KEY A;  3OYJ A;  2KL4 A;  2VQG A;  2CMP A;  3V42 A;  2X1D A;  3OIQ A;  2LYC A;  4B43 A;  1DGR M;  3A1Y A;  4XKV A;  2MYS A;  2WB1 A;  2V26 A;  4ANJ A;  4IKF A;  4PFO A;  3LMM A;  2F6C A;  4KJZ A;  4D9J A;  2L9N A;  4JOM A;  3OMY A;  5FRO A;  3TMO A;  4DJA A;  3BCA A;  3ZXS A;  3W2V A;  3ZCO A;  3OL3 A;  5FRN A;  3PNY A;  2QKL B;  3HG9 A;  4KIT B;  4IX7 A;  1D0Z A;  3SEZ A;  1IRX A;  3K4K A;  2UV1 A;  4F92 B;  5KHD A;  2WAD A;  5CQE A;  3ZRG A;  2WAE A;  4II2 A;  1WJB A;  1OR7 C;  4PSX A;  2LRD A;  4CCL A;  4XLE A;  4N4N B;  3CP2 A;  4BL0 B;  2MD0 A;  2JSP A;  4KT6 A;  4AU7 A;  2LY2 A;  2XF7 A;  3VYR B;  4BUP A;  3S3M A;  1YX5 A;  2LC2 A;  2LG4 A;  3OYH A;  2Z16 A;  3E0J B;  2HU9 A;  2ZFU A;  3SEQ A;  4BDY A;  2HDW A;  2E5N A;  3OR2 C;  1WJD A;  3OR1 C;  2BW3 B;  2V9K A;  3L2R A;  2K9L A;  2IS1 A;  4ZDP A;  2ZSH B;  2HZD A;  4XLF A;  3OYG A;  1P9Q C;  4CH7 A;  2R7S A;  2K9M A;  4CCJ A;  3SYT A;  5KNL A;  3GBG A;  3M8J A;  4NC8 A;  3PL8 A;  2X6Y A;  1Y56 A;  1LDK B;  3DLA A;  1K6Y A;  4GRI A;  3I9V 2;  2V4J C;  3LSI A;  2W7N A;  1MMN A;  4BE1 A;  4F3Q A;  4XOT A;  2XC7 A;  2AQF A;  3H5N A;  4E7Z A;  2VJ4 A;  4BAC A;  3HOS A;  2R7O A;  2XDV A;  3PJR A;  4NC7 A;  4U7B A;  5LD2 C;  3CF2 A;  2CH0 A;  5HVQ C;  1T95 A;  3S3O A;  3SZG A;  3CJQ B;  1FMW A;  3OYL A;  3IAM 2;  4X0G A;  1LVK A;  3K4L A;  4PSW A;  2DT7 B;  4PJJ A;  2WY7 Q;  2VKD A;  2JUG A;  3PSI A;  3H9Q A;  3OYN A;  2X85 A;  4PK4 A;  1QHG A;  1R6R A;  2DT6 A;  4BQQ A;  4E4H A;  4ZDL A;  3L2Q A;  2R7W A;  4PUS A;  2IGK A;  3RSN A;  3CZ6 A;  2MC4 A;  1MMD A;  3CMM A;  3ZQQ A;  4EAT A;  3DTI A;  3QYB A;  3K10 A;  4NNJ A;  2LRE A;  3OS2 A;  3MMY B;  3C2H A;  3G2B A;  2L5Q A;  1PJR A;  3VSL A;  1X1D A;  2OC6 A;  4C30 A;  2OV7 A;  3LFU A;  4BS9 A;  4E7J A;  3W2A A;  2E5Z A;  2IGN A;  4BJT A;  3H5A A;  2CV2 A;  3PUB A;  2VPL A;  2PJR B;  3FBN B;  4JQF A;  3BG6 A;  3OYI A;  3KYL A;  3CP8 A;  1DGW Y;  4FAS D;  4BDZ A;  1OLT A;  2PMZ A;  3DU5 A;  4NQW B;  3IUO A;  4Y33 A;  2UWM A;  3HOT A;  2ZXI A;  5TGT A;  4LIU A;  2M3A A;  3DKY A;  4BEH A;  2M7B A;  4F93 B;  2VAS A;  3H0D A;  2W4S A;  3OYK A;  3QOD A;  3PFY A;  2IS6 A;  3ONQ A;  4HNU A;  2HVQ A;  2IGM A;  1UG0 A;  1D0Y A;  4P5O A;  4ZYA A;  2E1M B;  2KZV A;  1WJF A;  2L7K A;  3EUA A;  2DJI A;  4HRI A;  4IQ4 A;  1G8X A;  2VQC A;  3OYD A;  2BOL A;  4DBQ A;  3HL2 A;  2R7R A;  2KRC A;  3H9G A;  3HUG B;  1NG7 A;  3QOE A;  3OOU A;  3D5R C;  4DBR A;  3HXL A;  4KIS A;  3K4J A;  3H9J A;  3OS1 A;  1DP3 A;  3OYF A;  3M1C A;  3LSM A;  3K4C A;  2O5R A;  1E0E A;  2FUG 2;  3MKZ A;  3IAS 2;  4B3X A;  4E6K G;  4C9Y A;  3AL0 B;  2BW3 A;  1D1C A;  3DKX A;  3W3C A;  3RQ4 A;  1NG6 A;  3OYM A;  2VL8 A;  4U87 A;  4XR6 A;  4BQN A;  1AA7 A;  2X1C A;  3DQV C;  3CJR B;  3DU6 A;  3OYC A;  2F5V A;  4BXF A;  3VDX A;  2VQL A;  3S32 A;  2A5W A;  2R4G A;  2K5C A;  2KMU A;  3W2W A;  3OS0 A;  1N77 A;  4ZJZ A;  1U0J A;  1Z3Y A;  1ZEL A;  4CCK A;  1Z3X A;  5JHF A;  3L2U A;  2WA0 A;  1J09 A;  3DPL C;  2W00 A;  1BR1 A;  2LBF A;  2JVG A;  3S8P A;  4B44 A;  4XQF A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...