2L9SA

Solution structure of pf1 sid1-msin3a pah2 complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
b'SNADYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 12
publication title Solution Structure of the mSin3A PAH2-Pf1 SID1 Complex: A Mad1/Mxd1-Like Interaction Disrupted by MRG15 in the Rpd3S/Sin3S Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1860 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9sA00
2L9SA
chains in the Genus database with same CATH superfamily
1IRXA 2VN2A 3ZR8X 2OA4A 1ZHFA 2XPVA 3ASOH 2OTLI 3I0TA 3PNVA 2BEOA 5J6XA 4XLEA 3KZIC 2CMPA 1RUNA 4B43A 3CCLI 3EETA 1B72B 3RJPA 4BE0A 2G7HA 1QPIA 5J4VA 4IHSA 3BR5A 4KDPA 2XAFA 2FXAA 1ZG1A 1ZYRF 2DTRA 1Y56A 1U5TC 4N0BA 2DQLA 1IF1A 5EGOB 3FXQA 1WHUA 2PMZN 3CD6I 4W1UA 1RKWA 1LQ1A 2XGDA 4MO7A 1GXQA 4ASNA 1MD0A 3WGHA 4F93B 1DP7P 1SVMA 2UXXA 2XF5A 3VSLA 3OYMA 2E60A 5FRMA 2QLZA 2WB1N 4ABZA 4IXAA 4KT5C 1ETQA 3CESA 3JTHA 3SFZA 5EG0B 5H20A 2LH9A 3AL0C 1STZA 4E7HA 2E2HJ 2LKXA 1TLHB 2F4OB 1ETWA 1WKMA 4HDVA 3QRFF 3TMOA 2NRAC 3IKTA 1TWFJ 4O3MA 3R6SA 5BPIA 5F6FA 4N9IA 5KHDA 4CICA 3WU2C 4PDKA 2LLKA 3JRDA 4ESFA 5JI6A 5FLMJ 3M8JA 2JPBA 4IX7A 2O03A 1D1BA 1N25A 3OYIA 1Z9CA 4XR6A 4W97A 2CQXA 3H9GA 4A5NA 5IOYA 1JHHA 3E6MA 3I71A 2ZXHA 4MFEA 2Z99A 3CJQB 5HLHA 2BVLA 4IRIA 3LQRA 1Z77A 4XLHA 3OS1A 5EEHA 1TQIA 3BTLA 2HR3A 1Y8RB 2IGNA 5HS9A 1KQ0A 3ZQHA 3BG9A 3AFHA 3JRIA 1IDYA 2CRGA 1VQPI 2FMLA 3ERMA 4YIIA 3GFIA 1E17A 1XC5A 3FWEA 3HSRA 1FYMA 3H36A 3BJAA 1W7PB 3CC4I 2X48A 3E1SA 3Q9VA 4CCKA 1OYIA 1B59A 2JPCA 1XMKA 1YHQI 3M8EA 2MH2A 2FOKA 4MQVA 2BV6A 3FKIJ 3K6GA 2QSGX 1A36A 4L5EA 2VC0A 4RAFA 3D0SA 3IRRA 2I8DA 2GLOA 2CUZA 2XF6A 1X3UA 3EQLF 4GYIA 4M74A 4HV5A 1V3FA 1D0YA 4PGHA 5DYMA 4JX6A 3W2VA 2ZJ2A 3WODF 5JLWA 5AONA 2EFOA 1FOXA 3GTLJ 1MNMC 3G4SI 4UNOA 1V4RA 3KP5A 3L2RA 1X2NA 4A3EJ 2CQQA 1SD4A 2DJNA 2CUEA 3HC7A 3KP2A 1XG1A 3HKZA 1NTCA 4YELA 2DCEA 2OD5A 4ANJA 1HKTA 1YYVA 4A3LJ 2EFNA 2X51A 4UUTA 4LG0A 2KDZA 2IA2A 1R6RA 3FMQA 1G6NA 2DA1A 3S1RJ 2JA7J 2R5ZB 2M7BA 4HZFA 5IT9K 2ZXJA 1BIAA 3BT9A 4MLOA 4K2EA 3S2WA 1X1DA 2E1MC 1HW2A 3F8CA 1IN4A 3HIFA 4A3DJ 3ONQA 4TV7A 2W48A 1TWGJ 2K85A 1V5EA 2QKMB 1B9NA 3MD2A 1ETYA 3CF2A 4QTRA 1FMVA 5DUIA 2H27A 1GHCA 4XONA 3K69A 1ZGAA 4U88A 1QPMA 4IZZA 4LIUA 1E3OC 4A93J 1WJ5A 1HC8A 2XGCA 4OWRB 2YX4A 2V1DA 4ENKA 1Z3XA 5F0CA 2Y31A 5FO5A 4Y52J 1YRNA 4ZYEA 3RZOJ 2PX9A 2RQPA 3RKWA 2ZKZA 1T38A 4U0VA 4HAMA 1OFCX 3BWGA 2DOEA 2DT7B 5DV5A 3CZ6A 3L2UA 2Q1ZB 2PFBA 3QPHA 1EH8A 2KPMA 1H89C 2DLLA 1K83J 1I50J 1EV7A 1NH3A 4R1HA 4XN3A 2TCTA 4DW6A 1ZR2A 2V1XA 3GW2A 3LSPA 1WJDA 1ZRCA 1X1BA 4PFOA 2VL8A 3QWLA 1Z91A 2DA2A 4MTDA 1Z21A 4B1RA 5C4XJ 3BTCA 3HJEA 4XKWA 2RDPA 3L09A 1LEBA 2KDOA 2VONA 2HVSA 3J7YJ 2CQ7A 1IC8A 4FISA 5FD6A 2CQKA 3O3KA 3WTXC 4MNUA 1HA8A 3TOBA 5LLQA 2YSRA 2OC6A 4XKCA 3F8FA 3T8TA 3ZXSA 2IVMA 2YR2A 4G8XA 4XK4A 5LBQA 4M71A 2IGKA 3BZKA 1ON1A 3DBLB 1XCBA 4YFNF 2FUG2 3HG9A 1GT0C 4KN4X 4XSXF 1ETXA 5J8FA 3A2KA 3T8RA 4JX4A 4M6XA 2V26A 3JCUC 1A6IA 4BH9A 2MFZA 4RS8A 3BR1A 3OL3A 3WHCA 3B73A 4BQAA 1XGSA 3CC2I 2WA0A 5C3EJ 4HSTA 5F08A 2XB0X 2VE8A 3K4JA 2A6TA 3TO9A 1I27A 4QIWN 4DZPA 3I9V2 4B3XA 5D5VB 2B63J 2L0KA 3F6OA 4BXUA 2ZB9A 2M0MA 5HS7A 3J80Z 1IDZA 4M3BA 4KJZA 3KCCA 3DKWA 3W6VA 3GBGA 2HFHA 3DPTA 1WI9A 1WI3A 4CSWA 1XMXA 2QENA 3GTQJ 3LWFA 4U7DA 1FP2A 1UJ8A 3ESWB 4NC7A 1G59A 3GWZA 4IQ4A 2RVCA 2K27A 1TL8A 4C3JJ 4C2TA 1GUUA 1KU7A 2DPUA 1C0WA 3DU6A 3DU5A 2GA2A 2KRHA 1YW8A 4V19K 2QQBA 2LY2A 3HOSA 2HWVA 5GPAA 5LHIA 3BPXA 1A31A 2MYSA 1VQLI 1MMGA 2HU9A 1P7JA 2L7MP 1VTNC 2BBYA 3WU1B 2GIZA 4P1WA 4L5IA 4RGSA 2OZ6A 3RYRA 4B8XA 2LDUA 2EFQA 5J4YA 4AIDA 1MMAA 5E20A 4P5OA 3TKYA 3FX3A 2IS4A 2LKSA 1BN5A 1O57A 2Y75A 4OAZA 1MJBA 4BQOA 3HB9A 2KLOA 3M8FA 1OYYA 2CV1A 2DFEA 1F4KA 2CUFA 2HVRA 2OCEA 1T6SA 3BG5A 4S05A 4M9ZA 5FFXA 4P9UA 4AVZA 3UKGA 3PJRA 1IV8A 3K4NA 3AG4H 3ABTA 3D5LA 1RIOH 3DFGA 2R5YB 2HOTA 3TDZC 3FMSA 2D45A 3BZCA 5DDGA 1YX5A 5JR3A 1BL0A 2XASA 2X6YA 2FQ3A 4F92B 5EZGA 4ON0A 2XIGA 5BS6A 5ICFA 2BHYA 2OAZA 2LYCA 2F5FA 4F55A 1T0FC 2E2IJ 3S17J 3SXYA 4BJTA 2ZFWA 1ZREA 5J47A 1ZN2A 3DTIA 4J01A 1D1CA 4G12A 3I3LA 4AIHA 2HS5A 3BCAA 3C1DA 1NG6A 1YIJI 4XRFA 1FEXA 2EZKA 3E5QA 3I55I 5HLGA 1TBXA 1YLFA 2JMWA 3O6BB 1ZG5A 2DN0A 2STWA 3OYNA 2NYXA 3I4NJ 5E3NA 1S9HA 1T95A 1SVLA 1Z3YA 3HOTA 1IN6A 3F6VA 3FXOA 3OYGA 3S2DJ 5CJ9A 5A2QZ 3PNTA 1W7PD 2NVYJ 4BEHA 4YIRX 2CGPA 2IA1A 4UY8I 4UVAA 1FNNA 2ESHA 2Y9YA 4DNCA 2NOGA 2HYFA 3C18A 3M9AA 3ZQ7A 1P2FA 5D8LB 2H1LA 1CQTA 3SEQA 4CYDA 4ZTJA 2IT0A 3E6DA 5HNHA 2BHZA 5HLIA 4HX8A 3WGGA 4A12A 4KFCA 2JVHA 1ENHA 4BBRJ 2EINH 2DK5A 4J19A 5M5YJ 2M3AA 1BI2A 4M3DA 3MKWB 2JRTA 5D5WB 3MAJA 1UG0A 3FISA 1LFPA 2FF4A 1D8JA 5B1BH 2W25A 4FCYA 3DP7A 2O6GE 1TWHJ 3K1MA 2PG4A 4HX4A 3PSFA 1IRFA 3TDUC 5K7ZA 2RNJA 2DA3A 1LE8A 3Q0VA 3RKYA 4MQ9F 2K4JA 4M73A 3ROUA 4CCNA 3GYHX 4UUSA 1X19A 2O8XA 4JQFA 1XS9A 1MDMB 3CTAA 2Y30A 2ZO4A 4CO8A 1WCMJ 1PP8F 3GEZA 3DLAA 2E1NA 4A3MJ 4XRSG 5LGUA 5D5UB 5KAFC 4MTEA 1RPWA 1RESA 2KRCA 3PO2J 3S93A 2HOAA 3OIOA 4BHBA 2YPRA 3BQZA 2ETHA 5DCFA 1TW3A 3HPHA 2Z16A 4IPAA 2R93J 4I0AA 2V6CA 2X1CA 2OF7A 3IL2A 3RPQA 4F91B 5BQTA 4DBRA 4QSHA 3HBLA 4PK4A 2AO9A 4C3IJ 2CH0A 4X1EA 3V42A 4HEA2 4XLFA 4CCJA 2QUFA 4D7MA 2M8GX 1D8KA 5GPCA 2QKLB 4MEXF 2X1EA 3K4BA 1IUYA 3GTOJ 2BXZA 2ZJPF 3LSIA 3GO5A 3R0JA 2JA2A 2DA5A 2R7DA 2QQ8A 3K4KA 1YITI 2HDDA 1ITYA 2V9VA 1J59A 1AHDP 4MGRA 1I1GA 4NDLA 3KLOA 1UHMA 4N4NB 5HDNA 2HPMA 4XORA 4L5JA 4DQ2A 3HM5A 2FOWA 5FKOA 4I2OA 3GFLA 1SD6A 3SQNA 3CP2A 3WTTC 4PJJA 2VBZA 2XPUA 2W1OA 1ZRDA 3CMMA 4OAYA 3TL4X 3S32A 1B9MA 3LSRA 2HXIA 1WJEA 5ILSA 1Y0NA 5ICGA 3AAFA 1YO5C 3TBIA 5LRSA 2QCOA 1LVAA 4D5FA 1D5VA 2QF7A 3CDHA 1VI0A 3KP4A 3CCJI 1PDNC 5IP6A 2BW3A 3CLOA 4A0ZA 2AXLA 5ED4A 1IG7A 1MBJA 1QVTA 3K10A 3I4MJ 1F1ZA 2LP0A 1R71A 1S7AA 4U87A 2LOOA 2EIJH 3DTEA 2GWRA 4BNCA 3P9CA 1BC8C 3RSNA 3K0LA 3DPUA 3C3WA 3WTVC 5D6EA 3I64A 3E0JB 1X3WB 3NARA 5M5WJ 4ESBA 2LBFA 4BKXA 1LJ9A 2XV4S 3G1MA 2A3SA 4IHWA 2HZTA 3OS0A 1LUJB 4E7LA 2HGCA 3LMMA 2K3PA 1QHHD 1QZYA 2ZSHB 4P96A 2ZMEA 4BXFA 3OYCA 4P55A 1R5HA 4IJAA 3RPUD 1W4MA 2BY1A 3IP4B 4UHTA 1D3YA 4ZC3A 4GXOA 3KP6A 2F5CA 2H8WA 3K7AJ 2XROA 1YTYA 3PQJA 3TGNA 1XDUA 3OIPA 4F7ZA 4HLXA 1SFOJ 2LR8A 1SD7A 3F9KA 2Y0SA 4FQGA 2XSDC 3ML6A 1W5CC 2LTPA 1V5GA 1ACIA 2EV6A 2FBIA 4RBOA 3MEXA 2YX7A 3FXUA 3G3ZA 1K78B 1AU7A 4Y17A 3RQ4A 4PJ0C 2J5OA 2GXBA 5HDGA 3H9QA 5E8GA 4FASD 1KU9A 1JTXA 2NXNB 3G71I 1E0EA 3LSMA 5K5QA 5HVQC 1ONVA 3H0GJ 4Y13A 1B8IA 1OCCH 4Q5SF 5K5RA 2KP6A 3TQNA 1X1CA 2DOAA 2XAQA 3RYPA 4EM1A 4S0HB 2AQEA 5LHGA 2X1DA 1VQ7I 4CHUA 4BBSJ 4NB5A 5F1RA 2L5QA 2YU3A 3ASNH 4PGGA 2DMPA 2M0CA 3DWLE 3W2WA 4DZJA 3JSOA 3JRAA 2R7WA 3QODA 2DDBA 2DFIA 3MVPA 2D1HA 1FIAA 2MH9A 1YFHA 3HRUA 3J7AY 1ULYA 2VASA 2X6OA 3SYTA 4HOBA 2CFXA 2JTVA 3RI4A 1WSUA 1WWXA 2E1OA 3HRSA 1G3SA 2O0YA 2JUCA 3I4PA 4RDUA 2L2OA 2DDAA 2Q0OA 3SZPA 4ZDLA 2PJPA 1EF4A 2H8RA 1YW7A 3BTJA 2VKHA 4BHPA 2RKHA 5J1UA 5LRRA 3BROA 2VUMJ 1ZAOA 3ULQB 3VYUB 4XLNF 4I7HA 2JN6A 3B6AA 1Z0XA 4AD9A 3TO7A 4A2UA 5ILUA 3DCFA 5GAGJ 1JJ8C 2YU9J 4YEJA 2KJBA 2R7XA 2BVMA 4Y15A 5A2QK 5D5XB 2EZIA 3T5XA 1IUFA 4XNFA 4ZYGA 3M07A 4ENMA 1UG2A 5CKTA 5EYRA 1BOBA 2R7OA 3HXLA 5L3BA 5CLSA 4QLCU 4II3A 4LOCA 4O5VA 5CVRA 1MSFC 1O3RA 2UV1A 5E1WA 1L0OC 1Z6TA 3L2QA 1XPXA 5LD2C 4WWCA 1WH5A 2DT5A 2VE9A 3JR9A 3V7CA 4GYGA 1JKPC 4IHYA 2QBYB 1MMSA 3DEWA 2WAEA 1RRJA 1IN7A 1VF9A 3E5UA 1RR8C 2BGCA 4MIMA 3CUQA 2EQRA 2Z1DA 3M7GA 3A0HC 5FLVA 1YX3A 4QWQA 2XC7A 1T2KA 3KYCB 1S7OA 4LFUA 1XN7A 5E8IA 1T08B 3DF8A 2EA2A 3V7RA 1ETKA 3S1MJ 1ZLKA 5ICCA 3LOCA 1J75A 5CQEA 1AA7A 2VPRA 2XSJC 4XLCA 2Z3YA 1LDJA 5FLXZ 1HKQA 3FMRA 2Z5UA 1SMTA 2RN7A 3IH3A 3O2PE 3HRMA 1G2HA 3C2GA 4DOZA 1MJAA 4UV9A 3SFIA 4HYEA 1CF7A 3QP5A 3CCSI 5LGNA 1WZ2A 3D5SC 4G94A 1VQNI 5E1XA 2Z9OA 3A1YA 2ZCWA 1BI3A 4AC0A 1NG7A 4C2UA 1TQMA 1NK3P 3KFWX 5K7FA 1BW5A 3MQ0A 5D8KB 3VEPA 2V6EA 1F36A 2K9MA 4M3FA 5L3EA 4Z6YA 2ACJA 2MG4A 4HLYA 5GP9A 3Q0WA 5HOOA 2JJ7A 2A6HF 3CUOA 5M3FJ 1K4TA 1RKTA 3A02A 3CLQA 1VQ6I 3M1CA 3K70C 2B9SA 1U2WA 2PI0A 1OISA 3PO3J 1GDTA 5EF6A 1VQ9I 1U5TA 4RM2A 3ZPLA 2DTZA 1WVRA 3AG3H 1V5FA 3LSJA 1W0TA 3N4MA 3G1OA 2BY2A 2EIKH 3HYIA 2CU7A 3PUBA 1BOAA 1XCVA 1S72I 2R7QA 5DEQA 3JREA 2R7VA 2BXYA 3Q0UA 4B48A 3OYJA 2L01A 4Q4ZF 2UWMA 4I6ZA 4BE2A 2A5WA 4JOMA 4HSRA 1RNLA 2YS9A 2VPLA 2VXDA 2VKEA 3ZMDA 2KJCA 1LNWA 1OCRH 3K1PA 4UB8C 3MWMA 3K70D 2R92J 2R7ZJ 3R4KA 2O5RA 4M6VA 3ZN0A 2FSWA 1W5SA 3OYDA 4E7KA 2CS3A 3IAS2 3KEQA 3IHUA 1DDNA 2NS0A 3F8NA 4BHCA 2G0EA 1FYLA 4HRIA 3ECHA 3QOPA 2K9LA 4OINF 4U7BA 3QU3A 3GVAA 1JT6A 2PJRA 3KX2A 3T0YA 2DMTA 3BP8A 4M3EA 1J9IA 2VQHA 5BNGA 4G7HF 4IF4A 4BY7J 1FOYA 3KYLA 2OU2A 4HNUA 3J81Z 4UVBA 3VODA 1A6QA 1S8NA 2LFBA 3ZQCA 1QVUA 4X0GA 1TTYA 3ABUA 4AYBN 1FMWA 5LGTA 1LVKA 1W0UA 2IJLA 1RC9A 4KICA 2E35A 2V1UA 4E70A 3MZ8A 4IHTA 4MFDA 1I6XA 3A01B 3GTKJ 1CGPA 3V7SA 2ZBKA 3ZQLA 3OOPA 2KISA 4IHXA 3K4LA 1P7IA 1P9QC 3HZJA 2ADUA 3CQZJ 4ZZDA 3LSTA 2F4IA 2R7FA 2K7LA 4L9JA 1YG2A 1DGRM 2DFFA 3HDDA 3I59B 2VXZA 3IH2A 2IW5A 2M5WA 2O3FA 1YJWI 4OOIA 4XLAA 3JRHA 1O3QA 3DV8A 2MD0A 1U9OA 2DAOA 4CYCB 1QHGA 2BE5F 5M3MJ 2OV7A 4PCQA 4EJUA 5FJ8J 1R5ID 3WE2A 3TP3A 1MBKA 1BJAA 3QYBA 4A69C 3WTSC 1Z1DA 4D7NA 3EUHC 4CXFA 3CCVI 3KPHA 2X0LA 4IOAF 3BR0A 5K1YA 4I01A 2ZJQF 2QYOA 5DTDA 3B02A 5IP9J 2L7KA 5JHUA 1TW2A 1KYWA 3I58A 2CO5A 1PUFA 1AKHB 5E3OA 4GRIA 2HEOA 3BCBA 2ZC2A 1RR7A 3QYEA 4HA8A 1MMNA 3FM5A 1SAXA 4AIJA 2EV5A 1WH7A 2WY7Q 2O61A 2DOFA 1EH6A 1XSXA 3U1DA 4YG2F 3C2BA 4M9XA 3A0BC 1N77A 3H5AA 1QNTA 2IEKA 4BDYA 2EIMH 4EVIA 3MCZA 2E1CA 3BZ6A 4FTHA 5L3DA 2IS6A 2NS7A 1DQUA 2K02A 4HF0A 4BUPA 2WTEA 3QQAA 4EJTA 4BJ5C 2EILH 2MBFA 2QEXI 1R23A 4BS9A 1OCTC 2NS8A 3KYDB 3G2BA 1I3AA 9ANTA 4M9SA 3OYFA 1OPCA 2JSPA 4I02A 5LHHA 2DPDA 3MKYB 2NVQJ 3RKXA 3E6CC 3BR3A 3F23A 1OCOH 4LLGF 1JGSA 1GLNA 5E79C 3PFYA 4LD5A 3WTUC 5E18F 2GAUA 2Y2ZA 2Q8KA 2M87A 3GTMJ 2HTSA 4XRMA 2CW7A 3LA7A 4RB1A 1U8RA 3RTRA 4HQMA 3BJ6A 1OKRA 5E17F 2W84A 3P9KA 4IRGA 2FBHA 2ZXIA 4IL6C 2R0QC 3KETA 2VIXA 1X2MA 3DBRB 2L02A 1S5LC 2UZKA 2M45A 4B3AA 3CO6C 5FLXK 3EUHA 4E7IA 4G9YA 4XN0A 3TP0A 4KT6A 3G6EI 1K61A 2HXOA 4CDGA 3SZGA 2OBPA 3J7ZI 1A35A 3I54A 1JTYA 1I1SA 1DU6A 1NHAA 4C3HJ 1Z67A 1T33A 2LF8A 4KYWA 4PSXA 1G8XA 3W3CA 2QQAA 3ZGKA 3DEEA 3ZCOA 2TRTA 3CMEI 3SZTA 2HQNA 5D4RA 3D1NI 1ZH5A 4YRVA 4I09A 1OMIA 4XKVA 4F52A 2VOOA 5D6FA 2W7NA 5L3FA 4OMYA 3MFKA 1S3JA 4YFXF 3I53A 2VODA 2HVQA 2ISYA 2V9PA 1B72A 1U8BA 4BAYA 5JFRA 2K9QA 5GTIC 2P5VA 3GLXA 2HI3A 2ICWG 3BOQA 4ZZLA 3VYTB 2BOLA 1SFXA 5BMZA 3HPGA 2VQCA 1R1UA 5EGOA 2L9VA 3JSPA 2P81A 4AUXA 1PVEA 2IPQX 4LGWA 3BPVA 3K2ZA 1ODDA 2KMUA 2HDCA 3DBHB 2XHKA 4LK0F 2D5VA 4CGZA 4C9YA 2Z33A 4BGDA 4A3KJ 3HKZN 3S3NA 3FXMA 5EG0A 3HOUJ 1HOMA 2CV2A 5DUKA 4EV0A 2PBIA 4WCGA 1E2XA 2Y48A 5CVUA 3FK6A 2RREA 4ZDPA 4ESJA 1YIOA 3S3MA 1L3LA 3GLLA 1QU3A 2HPIA 3F8BA 1OCPA 3MKLA 5IOZA 3LSGA 3JRBA 1SFKA 4DYCA 2IS2A 1I39A 4ENJA 3OIQA 5J1RA 3GFJA 4NC6A 4B4CA 5TISC 1JKRC 1KYZA 3V4GA 3J81K 2JK3A 2ZNZA 3HHGA 3FHNA 3FHZA 2P0WA 1MGTA 3F3XA 4BL0B 3OY9A 3F21A 5B1AH 3S16J 2EFPA 2VB6A 2XF7A 4UB6C 5FD5A 3ZMVA 1O4XA 5GAHJ 1F5TA 3MN2A 1MZBA 1WJAA 1TZLA 2MLKA 2BYVE 5FGMA 1MNEA 2VOPA 2V4JC 2VJIA 5F0HA 5FKLA 2ECCA 2GOXB 2IXSA 3NWTA 4PFPA 1KU2A 1JUMA 2QQ9A 4FETA 3DKYA 1S29A 1T0FA 3QYFA 2WAQA 3OV8A 4HPQA 1W7PA 2DODA 1H9GA 3AL0B 1SANA 4LG3A 1QZZA 5DD8A 3VYSB 1UHSA 3UR3C 5JHFA 2MC4A 4U0WA 2NNYA 3KE2A 4GO1A 2PMZA 1Z7LA 1B6AA 1R36A 3H0DA 4XL9A 1DU0A 4DYRA 4CUGA 2MGQA 5BOXA 1VQKI 3FXLA 2KRFA 4NUBA 1BR2A 4LG0B 1MJ9A 5B3SH 1FY7A 2JA8J 1G4DA 4D5CA 4L9TA 5L3CA 4CZZA 6PAXA 3X2QH 4AIKA 4PZJA 3NRVA 4KIFA 3OL4A 2J5PA 2FA5A 4KNYA 2VJJA 3R61A 2PQ8A 2JA5J 5DCMA 1FSHA 1DPRA 4EJWA 1U9NA 2A68F 3DLLF 2O9LA 1IRGA 3S1NJ 2DMUA 3L2VA 2R5ZA 2EZHA 1P4XA 3AG2H 2VT2A 3A4CA 1E3PA 4EM2A 4BDZA 4N9HA 3QPLA 1XDSA 1X1AA 1QGPA 1YRNB 3DEUA 4KMUX 2A6EF 4A6DA 2YUSA 2FE3A 4BY1J 4WXHA 3JRCA 2R7RA 2MABA 1IO2A 5FRNA 2M1BA 1FX7A 1IGNA 4Y7NJ 1KQ9A 3U1KA 2XAGA 4II2A 4DGWB 2WWYA 1YW9A 4CZCA 4HQEA 1IJWC 5B5EC 1JHFA 3KZYA 3J80K 2LY1A 3CMYA 2AHQA 1OLTA 3L7WA 1HCRA 1JJ6C 3ABMH 4UV8A 3OS2A 4EMSA 1MIJA 2DBBA 3HRTA 3I56I 2ZJRF 3LSKA 3RQIA 3OMYA 3RKQA 2GXAA 3E3VA 2N8GA 1HSTA 2KIQA 3H92A 2KZVA 5LEKA 2FQ4A 2MA3A 1ZLJA 2FNPA 1ZARA 1JKQC 2RQQA 2FX0A 2IS1A 3LQQA 1T8IA 2W24A 1YS6A 2WV0A 2ID3A 3ZQGA 2D1VA 2Y9ZA 1XD7A 3HOVJ 3E5XA 4RB3C 4H4KC 1J7KA 4A0XA 2VQLA 2LY9A 2RV8A 5D4SA 5FROA 2HQRA 2ECBA 2IAIA 2WAFA 4AU7A 5IT9Z 4KMFA 1I6HJ 3FBNB 4I0BA 5KVRA 3JAMZ 2F6CA 2LRDA 3LA2A 1U6GA 3L9FA 4DYQA 2E1MB 2HKOA 2IBDA 5AIPA 2FJ1A 2P7VB 3GXOA 4L0YB 3O8GA 1HF0A 2RGVA 2Y69H 4YIFA 3F8MA 3P7NA 1J09A 2KIUA 4V2GA 1H8AC 3ZQIA 2QSFX 3KLNA 1H88C 2HOSA 4RM3A 5KAIC 2LKPA 1F43A 3ELKA 1XGOA 4ZYHA 1J0RA 5GAEJ 2E36A 3EUKL 3FKJA 1QRYA 3CO7C 4A3FJ 1KGSA 3BR6A 1IV6A 4LK1F 1X1PA 4ETSA 1A5JA 1FBSA 4Y3OA 3M1EA 5E3MA 3DTKA 1O7FA 5DM7F 1QA6A 3RPUA 4XBFA 2X9DA 3GZNB 1R22A 1DP3A 4M72A 1Z7UA 2XVCA 3IV5A 2ELJA 1FWZA 2E34A 4LLLA 2VKDA 4KIBA 4IRHA 3TW6A 2E71A 2CW0F 3GTGJ 2L4MA 1LDKB 1TNSA 4EEFG 3CCUI 2MC3A 1BJZA 2XB5A 4XM3A 2AS5F 4JBAA 2L9RA 3CCEI 3OYAA 2VT3A 1SFEA 1FLIA 4JK1X 3EDPA 2K4BA 4M3GA 5FKKA 2H09A 3VB2A 1HLVA 1PUEE 3P5JA 5EJCA 5J1YA 2G7UA 1O3TA 4WX9A 2XAJA 2KKOA 2P4WA 1REPC 1WPKA 4ITVA 2L7FP 3RZDJ 1P6RA 3GTJJ 1KONA 1D0ZA 2ISZA 2COMA 2QM3A 2E5NA 2V1NA 3IWFA 4FE7A 1WGXA 4MHGA 2E2JJ 2NVTJ 5EEAA 3BLYA 1LPQA 2L3DA 3K2AA 2E7XA 4XQFA 4PJLA 3F72A 4BQNA 3OYKA 3H3UA 4M6YA 1KA8A 1GVDA 1HSJA 1G3TA 2L4AA 2ELHA 1QBJA 3WTWC 3HEFA 3ABLH 1UELB 2QSHX 4CA0A 3ZMTA 1MBEA 5HDKA 3HOZJ 2DJIA 1KU3A 2OTJI 2JRMA 2WAQN 3H35A 4A3BJ 3WHBA 2P5LC 2KT0A 3L2CA 5ERIA 2XRNA 1HBXG 4NQWA 4E7SA 4OU0A 4IO9F 2R5YA 2OUMA 2P6SA 1HKSA 4AM3A 2W57A 4F3QA 1XGNA 1RUOA 2K9SA 5ICEA 1VQ5I 2UUZA 2Q2EA 4LJZF 2ID6A 3F0CA 1FBUA 5GADJ 1IAWA 2HYJA 1VQ8I 1APLC 4HX7A 5KCMA 1UCRA 2Y0MA 3HOWJ 2FBKA 3VSKA 1K6YA 1V55H 2EH3A 4KIGA 4BEHB 4E6KG 1OCZH 2G9WA 2PMHA 1XSVA 3GUDA 4OIRF 1HQCA 3FZVA 3PM1A 5FKMA 4O6JA 4D1QA 2PMUA 3F22A 2DI3A 2C6YA 2CYYA 1W36C 2P8TA 3KP3A 3WG9A 2A61A 1K7AA 2R7SA 2QZ8A 4I98B 4HNTA 1K79A 4GFBA 2XKPA 1S7EA 4XLPF 3CJNA 4ZH4F 3BY6A 2EFWA 1Y8QB 3QP6A 4FX0A 4EJVA 2STTA 2EB7A 2RAEA 3U21A 2VQGA 2UXNA 2CJJA 1ZK8A 4L18B 2M30A 1JI8A 1GV5A 2DMQA 1FIPA 2F5DA 1ZRFA 2M8EA 2CW8A 3CDIA 1XGMA 1YQAA 1R4NB 2QVOA 1LE8B 1BIBA 5IPAA 3E97A 1OR7C 2LK2A 5KK1A 1W36D 3C2HA 1RETA 5K7HA 5LFAA 4UUSB 3CP8A 2WY8Q 3DQVC 3RDIA 5H2FC 3D5RC 1EA3A 1YJNI 2JVGA 4Q47A 2DA6A 3SDBA 3WU0A 3S2HJ 1Y0UA 4HNVA 1MSEC 2KQRA 3PSIA 2XPWA 4L9NA 4L9VA 3UNGC 3Q3SA 4EJOA 3NAUA 3LFUA 3HL2A 3W6JB 1MDMA 3JRGA 1FPQA 3CJTB 3H3ZA 4EATA 4IHVA 2VBXA 3H9JA 1NK2P 3TW7A 4LLNA 2V7FA 4A3IJ 2XUBA 3PNYA 3TO6A 3CCRI 4IVNA 1UFMA 1HDDC 1XSDA 2LG4A 2MW8A 2VBWA 1BI0A 2EWNA 2Y0SN 1YE9A 1FSEA 2IRFG 3KIOA 3PL8A 5JVGF 1UZCA 2LNBA 3FXKA 3H5NA 4JX5A 3WE3A 1Y1VJ 1P92A 1R4MB 1ZTRA 2M7AA 4D9JA 2K3FA 5DCMB 1SVOA 1I3QJ 3GMEA 3HTUA 3AKZA 3HOXJ 1BC7C 2M4GA 5J3LA 1B4AA 2R3SA 3LA3A 3LAJA 3BQYA 4NBQA 4AVPA 3W6KB 2R7TA 5F1JA 5FB2A 3QPTA 4G7ZF 3DKXA 1FOWA 4RAZA 2H94A 3HGYA 1EKEA 2W85A 2WADA 5TJJA 3V8LA 1MW7A 3JAMK 4R8HA 3HGGA 1UB9A 2B7EA 2JQ7A 3QU6A 1X4OA 3L2WA 4A3JJ 2IGOA 4UVCA 5B66C 2DMNA 2HZDA 1Q1HA 1VQOI 2XKOA 2O8KA 2CQNA 1Z6RA 5EEGA 4HBLA 2X6WA 3FXRA 5EDNA 2DYSH 1BA5A 1OR7A 2BW3B 2QA4I 2CSOA 3LNQA 2BY0A 3QAHA 1UMQA 2RC4A 2JWTA 2XGXA 1JXSA 4UUVA 1ZG3A 1ORKA 2KHMA 3KEOA 4X6AJ 1FOKA 2GIVA 2WV1A 4CH7A 2CV0A 5GTHC 1WFXA 3GF2A 1Y39A 2E7WA 1BR4A 4IEJA 2WC2A 4ZJZA 3KEYA 2LBFB 2IGMA 3QOEA 4E4HA 4RMNA 1IXRC 2M34A 1T39A 3LSHA 1JT0A 1X4PA 1TT0A 4XSZF 2ZMEB 1WJCA 2XGEA 4EQQA 4N4OB 5CYVA 2A69F 4LITA 4ZTFA 3VDXA 4WXDA 3CCMI 5CQGA 2GM4A 4OIOF 1TC3C 2HQAA 3ZN1A 3IUOA 1R1TA 2LF7A 3WG7H 5IY5H 4BACA 1LEAA 2F2EA 2L7ZA 2OJED 3G1LA 5KNLA 2QWWA 4ZYDA 5IT3A 2F4MB 2ZFUA 3DPLC 5E1ZB 2KL4A 4Y33A 2H6BA 2ELKA 4RB2C 3H3VK 1OJLA 3BR2A 3MKZA 1G3WA 4G6QA 1HW5A 3OSFA 3Q5FA 4V2FA 1TWAJ 4E7ZA 2VC1A 2W82A 4HDUA 3S15J 1B8IB 2NAZA 3NQOA 3M3YJ 5TGTA 1KQ8A 4I76A 3REOA 2L9SA 1XMAA 3GX4X 1K78A 1MNDA 2P6TA 1T98A 2IA0A 1GVJA 2F48A 1BR1A 2XAHA 5IYCJ 1HW1A 3FBIB 1P4WA 1PJRA 2D2WA 1BM9A 3BG6A 1W1WE 2EK5A 3BG7A 1K4SA 3V8JA 4LB5A 3ECOA 3BJOA 3ZMUA 4DIQA 2I10A 1VZ0A 5AIQA 3FF5A 1MBGA 3L1PA 2K86A 4RGXA 4NHJA 4RLFA 3M4OJ 2KFDA 2X85A 3IWZA 3GCMA 3ERED 1LB2A 2VI6A 2VJ5A 3K1NA 3I5UA 2DT6A 5ILVA 1AOYA 5CVIA 1UHWA 1SFUA 4GDFA 1P4AA 4BQQA 4XMYA 3N97A 3JW4A 3NWSA 1JUSA 5TRDA 3MZYA 3HUGA 2OQRA 4PJNA 1FJLA 5F04A 2GA1A 2LC2A 2NVXJ 2KZGA 3EYYA 1PP7U 4BYYA 3OR2C 2W4SA 1QO0D 3PIOF 4A5MA 1YI2I 1R49A 1LKXA 2A07F 2F5VA 3BG3A 4Y4RA 2JUGA 1LFUP 1AWCA 1RZ4A 3OYEA 4WK8F 2JA6J 3R0AA 3B6CA 2TDXA 3J7AO 2ME6A 2NOJB 3VOEA 1DGWY 2EV0A 2FD5A 4BE1A 1H0MA 2PLYA 4ZDOA 5LEJA 1USTA 2HNHA 4P9FA 3VFZA 4KA4A 5H6RA 2LD5A 1R9TJ 2HYGD 4A3GJ 1QZEA 3CUQB 4NQWB 4L0ZB 2DXIA 1QQIA 2BZTA 4I99C 4LMYA 4RA2A 3CMAI 1R58A 3IRQA 3CF5F 1W5TA 2RNGA 2DO7A 3CCYA 4J00A 1GXPA 3GZ5A 3IH4A 2E5ZA 3HSEA 4IQJA 2QBYA 2FU4A 1J5YA 2Q2EB 4R79A 3U2RA 2ZXWH 4BU2A 1TT5B 4FT8A 4XICA 4EM0B 1J2XA 3ZQFA 3R60A 2KIMA 4WXCA 2AQFA 3P9IA 4RLQA 1BBYA 3PUFA 1EJ9A 2K40A 2EJRA 1N75A 2E19A 3T1BA 1CF7B 4OIPF 2ESNA 1T56A 2DU9A 5DD4A 5E3LA 2H1KA 2R7UA 1A04A 3CJRB 4G6DA 2IP2A 1WRJA 3GTPJ 2GOMA 2MSYA 4KITB 3CDLA 1YJ9I 4OMZA 3C7JA 1TWCJ 5IP7J 2OPTA 4EGYA 2HDWA 4G7OF 3MZHA 3K4CA 3QPSA 2JSCA 3WTZA 5HNFA 4LIVA 2JT1A 4ENNA 5K5OA 3W2AA 2JZYA 1R7JA 3ISPA 3OYHA 1ETOA 1B1BA 2X4HA 5EZHA 2LMDA 1HDPA 4ZYAA 5J40A 1VFCA 4CCLA 4Z2YA 1IXCA 4FX4A 2DYRH 1SEUA 5F27A 3IAM2 4YFKF 1JE8A 1U5TB 2I5UA 5J8CA 1OYWA 4FE4A 3S8PA 1MH4A 1IN5A 2L9NA 1JGGA 2K5CA 2NNNA 3L00A 2COBA 4GCVA 2R4GA 3VWBA 1WJFA 3ABKH 4UXNA 3PFIA 4G6TB 3FDYA 3JRFA 1Z05A 3K4MA 1MH3A 3FM3A 3WTYC 5BPDA 2LVSA 2VBYA 1SC7A 1ZQ3P 4RGUA 2FNAA 3U9GA 2DQRA 5M5XJ 4HV6A 3BC8A 3HOYJ 2VJ4A 1O7LA 2FEZA 3CC7I 3OYLA 2KIFA 1D5YA 2CFOA 5JLXA 1KZHA 2WB1A 4KUMA 5JVTA 1R00A 1MMDA 1USSA 2DA4A 2GQQA 2F5EA 3LAPA 4PUSA 1VQMI 3V8KA 2FRHA 2CG4A 2PJRB 3OOUA 1FT9A 4RB0A 4B47A 2DA7A 2M9HA 2PEXA 4XRSA 2PN6A 1XTAA 1FYKA 2EZLA 4IOCF 3WGIA 3MMYB 2ZMEC 3Q9SA 3E6BA 4NC8A 3S14J 1BW6A 2M2EA 4PJMA 4C30A 3ZOBA 3GFMA 4XOPA 1MKMA 2FMYA 3ZQQA 2XDVA 3SEZA 4BJ6C 2ZNYA 2V9KA 1TQPA 3PIPF 1FZPB 2Z2SB 2W00A 2LSOA 2A5YB 2DW4A 5F64A 1ZR4A 4NNJA 1U3EM 4BXXJ 5HS8A 2K9NA 2O7OA 3HSFA 4DJAA 2HQ5A 3KP7A 3OR1C 3FIWA 2MLGA 3SDGA 3COAC 3OSGA 1DPUA 1SMYF 3A01A 3IKVA 2GBYA 5F0FA 1ZGJA 4HF2A 5FFZA 2CWEA 4HW0A 5C44J 3TOAA 1SD5A 3FK7A 5IYDJ 4D0PA 1POGA 2EPFA 3K9TA 4WF2A 4HF1A 1LFBA 2ZSIB 3TEDA 1GV2A 4MEYF 5CVJA 2V79A 1X3ZB 3ZRGA 1XB4A 1R5GA 4XOTA 1EH7A 2H6CA 3I59A 2LREA 3ZMZA 3ZMSA 3E7LA 1FBQA 2NVUB 1IXSB 2MD5A 3S1QJ 3IC7A 4GGGA 1Y6IA 1M1EB 3SHFA 4CYCA 2HOEA 2ME0A 2VKVA 2P5KA 1ZELA 3JTGA 1U78A 4CCMA 5HLTA 1JKOC 2OCCH 2CUJA 5CVVA 3BTIA 4AWXB 1IN8A 1ZGWA 3LL7A 1PUFB 2OZUA 3S3OA 2OQGA 1FC3A 4RAYA 3N05A 2WBMA 1IW7F 1XX5A 1TP4A 4C2MJ 5C4JJ 1HXDA 1ERDA 1ZKGA 1JUPA 1U0JA 1Y1WJ 4Q48A 1K6OA 2DK8A 3H1CA 3CCQI 1ON2A 1RI7A 3BDDA 4E7JA 3RIRA 2HTJA 1N78A 4H0EA 1IRZA 4OIQF 2B0LA 3ZP5A 1VNDA 1AKHA 3EYIA 2GXGA 4A3CJ 2HKXA 1VQ4I 1UAAA 1PYVA 2XRLA 3G73A 4EGZA 3LFKA 1D0XA 3VYRB 1H9TA 1S6LA 2AXTC 1FP1D 4QPOA 2A05A 3RCOA 2GZWA 5FKNA 3HTSB 3OWTA 5L3GA 1ETVA 4B09A 4AYBA 4A6EA 1E3HA 3AG1H 4QPQA 1WQ2A 3H5RA 2EA4A 4FHTA 4JP0A 1D1AA 4XIDA 1X58A 3EUAA 3GZ6A 1MBHA 4XKBA 4KISA 4KN7X 1R1VA 5CPRB 2DFHA 5IYBJ 3KZZA 2L54A 3CUQC 3A03A 4RAGA 4U0YA 2M4KA 1G3YA 2X6XA 2XAUA 1SAUA 5H6QA 5HODA 1OQYA 4B44A 1MBFA 1BI1A 4A0YA 3PQKA 3SJMA 1LDDA 1Q1VA 3OYBA 1WJBA 2BY3A 1O3SA 4LB6B 3O8HA 4S04A 3HUGB 1IZ1A 3VPRA 3FXJA 4JYKA 4RGRA 1F9NA 5DS9A 2QGUA 3DXJF 4CCOA 5DM6F 4DBQA 1TNTA 1I5ZA 4HG2A 1YOVB 1DUXC 1YS7A 2P7CB 2EBIA 1V54H 3EPZA 3HHHA 2VLAA 3NEUA 1FTTA 4IKFA 1FTZA 4PSWA
chains in the Genus database with same CATH topology
3AKZA 1IRXA 3ZR8X 2M4GA 4PSXA 1G8XA 3W3CA 3LSIA 3PNVA 2JA2A 3ZGKA 3K4KA 2R7TA 3DEEA 4XLEA 3ZCOA 3DKXA 2CMPA 4B43A 2WADA 4N4NB 1MW7A 2HPMA 4BE0A 4XORA 4YRVA 4XKVA 4F52A 1X4OA 3L2WA 2W7NA 2IGOA 2HVQA 1Y56A 2HZDA 3CP2A 4PJJA 2W1OA 3CMMA 4OAYA 2X6WA 3TL4X 3S32A 3VYTB 2BOLA 1WJEA 2BW3B 4F93B 3HPGA 3TBIA 2VQCA 2XF5A 3VSLA 3OYMA 2E60A 5FRMA 2KHMA 3CESA 2BW3A 2LH9A 3AL0C 4E7HA 2KMUA 4CH7A 3K10A 2CV0A 1WFXA 4C9YA 4BGDA 1BR4A 4U87A 3S3NA 2LOOA 4ZJZA 3KEYA 2LBFB 3DTEA 3TMOA 2IGMA 3QOEA 4E4HA 2CV2A 3RSNA 3DPUA 4RMNA 3E0JB 3LSHA 1X4PA 1TT0A 2LBFA 5KHDA 2RREA 4ZDPA 1WJCA 4N4OB 4LITA 4ZTFA 3VDXA 3OS0A 4E7LA 5CQGA 3LMMA 2K3PA 3M8JA 1QHHD 4IX7A 3S3MA 2ZSHB 1D1BA 2HQAA 1QU3A 3IUOA 3OYIA 2HPIA 4XR6A 4BXFA 3OYCA 3RPUD 3H9GA 4BACA 3IP4B 4ZC3A 3LSGA 1SFKA 2ZXHA 2IS2A 5KNLA 3CJQB 3OIQA 2BVLA 2ZFUA 3DPLC 3OIPA 2KL4A 4XLHA 4Y33A 3OS1A 3F9KA 2Y0SA 3MKZA 1V5GA 3FHNA 2P0WA 2IGNA 4E7ZA 4BL0B 3OY9A 3AFHA 3RQ4A 2W82A 2VB6A 2XF7A 5TGTA 3H9QA 1WJAA 4FASD 2L9SA 1TZLA 1E0EA 1MNDA 3LSMA 5HVQC 1MNEA 2V4JC 3E1SA 2VJIA 1BR1A 4CCKA 3FBIB 2GOXB 2IXSA 2KP6A 3NWTA 4PFPA 1X1CA 2DOAA 1PJRA 4FETA 2AQEA 3BG6A 2X1DA 3DKYA 3QYFA 3K6GA 2WAQA 2L5QA 3BG7A 4HPQA 4DIQA 3AL0B 3DWLE 3W2WA 4LG3A 1VZ0A 2R7WA 2I8DA 3QODA 3VYSB 2CUZA 2XF6A 3UR3C 5JHFA 2MC4A 4RLFA 1D0YA 3W2VA 2X85A 2PMZA 2VJ5A 3J7AY 1Z7LA 2DT6A 2VASA 3SYTA 3H0DA 4XL9A 4CUGA 3L2RA 4BQQA 4XMYA 3NWSA 2L2OA 4NUBA 4PJNA 1BR2A 4ZDLA 3HC7A 2VKHA 3HKZA 2LC2A 4YELA 2DCEA 3VYUB 4ANJA 2X51A 3OL4A 3OR2C 2W4SA 1R6RA 2VJJA 4YEJA 2R7XA 2BVMA 1LKXA 2M7BA 2F5VA 4Y4RA 2JUGA 4MLOA 4XNFA 1X1DA 2E1MC 3OYEA 5CKTA 3L2VA 3ONQA 1BOBA 2QKMB 1V5EA 2R7OA 3MD2A 3CF2A 3HXLA 1FMVA 3A4CA 4II3A 4BDZA 4XONA 2NOJB 4BE1A 1DGWY 2UV1A 4ZDOA 4IZZA 4LIUA 1X1AA 2HNHA 1WJ5A 3L2QA 5LD2C 4OWRB 2R7RA 1Z3XA 2MABA 4NQWB 5FRNA 2DXIA 2WAEA 4II2A 4DGWB 2RNGA 4J00A 4CZCA 2E5ZA 2Z1DA 4IQJA 2LY1A 2DT7B 1YX3A 3CZ6A 1OLTA 2XC7A 2Q1ZB 3L2UA 2Q2EB 4R79A 2KPMA 4BU2A 3OS2A 2AQFA 4RLQA 3LSKA 4XN3A 3OMYA 5CQEA 1AA7A 1N75A 2XSJC 4XLCA 1WJDA 1X1BA 2KZVA 4PFOA 2VL8A 2R7UA 3C2GA 3CJRB 4DOZA 2RQQA 2IS1A 1Z21A 2GOMA 4KITB 4XKWA 2KDOA 3D5SC 2HDWA 3A1YA 2HVSA 4H4KC 3K4CA 2VQLA 5HNFA 4LIVA 1NG7A 4C2UA 5FROA 3W2AA 4AU7A 2WAFA 1HA8A 3FBNB 3OYHA 4ZYAA 2F6CA 2LRDA 2V6EA 2K9MA 2E1MB 4CCLA 2OC6A 4XKCA 3IAM2 3ZXSA 2IGKA 5HOOA 1J09A 2FUG2 3HG9A 3S8PA 3M1CA 2L9NA 3K70C 2K5CA 3A2KA 4RM3A 2V26A 2R4GA 3VWBA 4RM2A 1WJFA 2MFZA 3OL3A 1V5FA 2WA0A 3EUKL 4HSTA 3K4JA 3PUBA 2A6TA 4G6TB 3FDYA 2R7QA 3FKJA 3K4MA 2R7VA 3I9V2 4B3XA 4B48A 3OYJA 4Y3OA 2M0MA 2UWMA 4BE2A 3DTKA 2A5WA 4KJZA 4JOMA 4HSRA 3BC8A 3GBGA 2VJ4A 2VXDA 3DPTA 2VPLA 1DP3A 3OYLA 2CFOA 4CSWA 2ELJA 3K70D 2O5RA 2WB1A 2VKDA 1MMDA 3OYDA 4E7KA 2CS3A 3IAS2 4PUSA 4NC7A 1G59A 1LDKB 4IQ4A 2PJRB 3OOUA 4HRIA 4XM3A 4C2TA 3OYAA 4B47A 2K9LA 3DU6A 3DU5A 4U7BA 2KRHA 2PJRA 3KX2A 2VQHA 2LY2A 3HOSA 3MMYB 3KYLA 2MYSA 4HNUA 1MMGA 4NC8A 2HU9A 4PJMA 4C30A 4ITVA 4P1WA 4XOPA 4X0GA 1KONA 1MMAA 1D0ZA 2XDVA 4P5OA 3SEZA 3ZQQA 2E5NA 2V1NA 2IS4A 1FMWA 1LVKA 4OAZA 4BJ6C 2V9KA 4BQOA 2KLOA 3BLYA 2Z2SB 2W00A 2CV1A 4XQFA 4PJLA 4BQNA 2HVRA 4NNJA 3OYKA 4DJAA 3OR1C 4AVZA 1UELB 3PJRA 3K4NA 4CA0A 3D5LA 2DJIA 3K4LA 1P9QC 3H35A 1YX5A 2F4IA 2X6YA 4F92B 4E7SA 4PSWA 1DGRM 2ZSIB 2OUMA 2VXZA 2LYCA 3ZRGA 4F55A 1T0FC 4BJTA 4XLAA 4F3QA 3DTIA 4XOTA 4J01A 1D1CA 2MD0A 2UUZA 2LREA 1QHGA 3I3LA 2OV7A 3BCAA 1NG6A 5KCMA 1Y6IA 3QYBA 3VSKA 1K6YA 1ZELA 4CCMA 5HLTA 3EUHC 3OYNA 4BEHB 2CUJA 1S9HA 1T95A 1Z3YA 3LL7A 4E6KG 3HOTA 3OYGA 4D1QA 3S3OA 3PNTA 3N05A 4BEHA 2WBMA 2L7KA 1W36C 1ERDA 2R7SA 1U0JA 4HNTA 4GRIA 3BCBA 4E7JA 3QYEA 1N78A 1MMNA 3SEQA 4ZTJA 2WY7Q 5HNHA 3U21A 2VQGA 2JVHA 1JI8A 1UAAA 1PYVA 1N77A 3H5AA 4BDYA 2M3AA 1D0XA 3VYRB 3MKWB 3RCOA 4QPOA 1UG0A 2CW8A 1LFPA 3OWTA 2IS6A 1OR7C 1DQUA 1W36D 3PSFA 4BUPA 3C2HA 4AYBA 4BJ5C 4QPQA 3H5RA 5LFAA 1D1AA 2WY8Q 3CP8A 3DQVC 4BS9A 3D5RC 3EUAA 1EA3A 3K4BA 4XKBA 2JVGA 3G2BA 4KISA 3SDBA 5CPRB 4CCNA 3OYFA 2JSPA 3MKYB 1X19A 2KQRA 3PSIA 4JQFA 2M4KA 1GLNA 2X6XA 2XAUA 1SAUA 3UNGC 3PFYA 3DLAA 3LFUA 3HL2A 4EATA 2CW7A 4B44A 3H9JA 3RTRA 2V7FA 2KRCA 3PNYA 3S93A 3OYBA 2LG4A 1WJBA 3HUGB 2ZXIA 3HPHA 2VIXA 4CCOA 2Z16A 4DBQA 1YE9A 2X1CA 4HG2A 4F91B 4E7IA 4XN0A 4DBRA 3PL8A 4KT6A 4PK4A 3H5NA 2CH0A 3EPZA 3V42A 4CCJA 4HEA2 4XLFA 2VLAA 3SZGA 4IKFA 2M7AA 4D9JA 2QKLB 2X1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9S A; 
#chains in the Genus database with same CATH topology
 1IRX A;  2VN2 A;  3ZR8 X;  2OA4 A;  1ZHF A;  2XPV A;  3ASO H;  2OTL I;  3I0T A;  3PNV A;  2BEO A;  5J6X A;  4XLE A;  3KZI C;  2CMP A;  1RUN A;  4B43 A;  3CCL I;  3EET A;  1B72 B;  3RJP A;  4BE0 A;  2G7H A;  1QPI A;  5J4V A;  4IHS A;  3BR5 A;  4KDP A;  2XAF A;  2FXA A;  1ZG1 A;  1ZYR F;  2DTR A;  1Y56 A;  1U5T C;  4N0B A;  2DQL A;  1IF1 A;  5EGO B;  3FXQ A;  1WHU A;  2PMZ N;  3CD6 I;  4W1U A;  1RKW A;  1LQ1 A;  2XGD A;  4MO7 A;  1GXQ A;  4ASN A;  1MD0 A;  3WGH A;  4F93 B;  1DP7 P;  1SVM A;  2UXX A;  2XF5 A;  3VSL A;  3OYM A;  2E60 A;  5FRM A;  2QLZ A;  2WB1 N;  4ABZ A;  4IXA A;  4KT5 C;  1ETQ A;  3CES A;  3JTH A;  3SFZ A;  5EG0 B;  5H20 A;  2LH9 A;  3AL0 C;  1STZ A;  4E7H A;  2E2H J;  2LKX A;  1TLH B;  2F4O B;  1ETW A;  1WKM A;  4HDV A;  3QRF F;  3TMO A;  2NRA C;  3IKT A;  1TWF J;  4O3M A;  3R6S A;  5BPI A;  5F6F A;  4N9I A;  5KHD A;  4CIC A;  3WU2 C;  4PDK A;  2LLK A;  3JRD A;  4ESF A;  5JI6 A;  5FLM J;  3M8J A;  2JPB A;  4IX7 A;  2O03 A;  1D1B A;  1N25 A;  3OYI A;  1Z9C A;  4XR6 A;  4W97 A;  2CQX A;  3H9G A;  4A5N A;  5IOY A;  1JHH A;  3E6M A;  3I71 A;  2ZXH A;  4MFE A;  2Z99 A;  3CJQ B;  5HLH A;  2BVL A;  4IRI A;  3LQR A;  1Z77 A;  4XLH A;  3OS1 A;  5EEH A;  1TQI A;  3BTL A;  2HR3 A;  1Y8R B;  2IGN A;  5HS9 A;  1KQ0 A;  3ZQH A;  3BG9 A;  3AFH A;  3JRI A;  1IDY A;  2CRG A;  1VQP I;  2FML A;  3ERM A;  4YII A;  3GFI A;  1E17 A;  1XC5 A;  3FWE A;  3HSR A;  1FYM A;  3H36 A;  3BJA A;  1W7P B;  3CC4 I;  2X48 A;  3E1S A;  3Q9V A;  4CCK A;  1OYI A;  1B59 A;  2JPC A;  1XMK A;  1YHQ I;  3M8E A;  2MH2 A;  2FOK A;  4MQV A;  2BV6 A;  3FKI J;  3K6G A;  2QSG X;  1A36 A;  4L5E A;  2VC0 A;  4RAF A;  3D0S A;  3IRR A;  2I8D A;  2GLO A;  2CUZ A;  2XF6 A;  1X3U A;  3EQL F;  4GYI A;  4M74 A;  4HV5 A;  1V3F A;  1D0Y A;  4PGH A;  5DYM A;  4JX6 A;  3W2V A;  2ZJ2 A;  3WOD F;  5JLW A;  5AON A;  2EFO A;  1FOX A;  3GTL J;  1MNM C;  3G4S I;  4UNO A;  1V4R A;  3KP5 A;  3L2R A;  1X2N A;  4A3E J;  2CQQ A;  1SD4 A;  2DJN A;  2CUE A;  3HC7 A;  3KP2 A;  1XG1 A;  3HKZ A;  1NTC A;  4YEL A;  2DCE A;  2OD5 A;  4ANJ A;  1HKT A;  1YYV A;  4A3L J;  2EFN A;  2X51 A;  4UUT A;  4LG0 A;  2KDZ A;  2IA2 A;  1R6R A;  3FMQ A;  1G6N A;  2DA1 A;  3S1R J;  2JA7 J;  2R5Z B;  2M7B A;  4HZF A;  5IT9 K;  2ZXJ A;  1BIA A;  3BT9 A;  4MLO A;  4K2E A;  3S2W A;  1X1D A;  2E1M C;  1HW2 A;  3F8C A;  1IN4 A;  3HIF A;  4A3D J;  3ONQ A;  4TV7 A;  2W48 A;  1TWG J;  2K85 A;  1V5E A;  2QKM B;  1B9N A;  3MD2 A;  1ETY A;  3CF2 A;  4QTR A;  1FMV A;  5DUI A;  2H27 A;  1GHC A;  4XON A;  3K69 A;  1ZGA A;  4U88 A;  1QPM A;  4IZZ A;  4LIU A;  1E3O C;  4A93 J;  1WJ5 A;  1HC8 A;  2XGC A;  4OWR B;  2YX4 A;  2V1D A;  4ENK A;  1Z3X A;  5F0C A;  2Y31 A;  5FO5 A;  4Y52 J;  1YRN A;  4ZYE A;  3RZO J;  2PX9 A;  2RQP A;  3RKW A;  2ZKZ A;  1T38 A;  4U0V A;  4HAM A;  1OFC X;  3BWG A;  2DOE A;  2DT7 B;  5DV5 A;  3CZ6 A;  3L2U A;  2Q1Z B;  2PFB A;  3QPH A;  1EH8 A;  2KPM A;  1H89 C;  2DLL A;  1K83 J;  1I50 J;  1EV7 A;  1NH3 A;  4R1H A;  4XN3 A;  2TCT A;  4DW6 A;  1ZR2 A;  2V1X A;  3GW2 A;  3LSP A;  1WJD A;  1ZRC A;  1X1B A;  4PFO A;  2VL8 A;  3QWL A;  1Z91 A;  2DA2 A;  4MTD A;  1Z21 A;  4B1R A;  5C4X J;  3BTC A;  3HJE A;  4XKW A;  2RDP A;  3L09 A;  1LEB A;  2KDO A;  2VON A;  2HVS A;  3J7Y J;  2CQ7 A;  1IC8 A;  4FIS A;  5FD6 A;  2CQK A;  3O3K A;  3WTX C;  4MNU A;  1HA8 A;  3TOB A;  5LLQ A;  2YSR A;  2OC6 A;  4XKC A;  3F8F A;  3T8T A;  3ZXS A;  2IVM A;  2YR2 A;  4G8X A;  4XK4 A;  5LBQ A;  4M71 A;  2IGK A;  3BZK A;  1ON1 A;  3DBL B;  1XCB A;  4YFN F;  2FUG 2;  3HG9 A;  1GT0 C;  4KN4 X;  4XSX F;  1ETX A;  5J8F A;  3A2K A;  3T8R A;  4JX4 A;  4M6X A;  2V26 A;  3JCU C;  1A6I A;  4BH9 A;  2MFZ A;  4RS8 A;  3BR1 A;  3OL3 A;  3WHC A;  3B73 A;  4BQA A;  1XGS A;  3CC2 I;  2WA0 A;  5C3E J;  4HST A;  5F08 A;  2XB0 X;  2VE8 A;  3K4J A;  2A6T A;  3TO9 A;  1I27 A;  4QIW N;  4DZP A;  3I9V 2;  4B3X A;  5D5V B;  2B63 J;  2L0K A;  3F6O A;  4BXU A;  2ZB9 A;  2M0M A;  5HS7 A;  3J80 Z;  1IDZ A;  4M3B A;  4KJZ A;  3KCC A;  3DKW A;  3W6V A;  3GBG A;  2HFH A;  3DPT A;  1WI9 A;  1WI3 A;  4CSW A;  1XMX A;  2QEN A;  3GTQ J;  3LWF A;  4U7D A;  1FP2 A;  1UJ8 A;  3ESW B;  4NC7 A;  1G59 A;  3GWZ A;  4IQ4 A;  2RVC A;  2K27 A;  1TL8 A;  4C3J J;  4C2T A;  1GUU A;  1KU7 A;  2DPU A;  1C0W A;  3DU6 A;  3DU5 A;  2GA2 A;  2KRH A;  1YW8 A;  4V19 K;  2QQB A;  2LY2 A;  3HOS A;  2HWV A;  5GPA A;  5LHI A;  3BPX A;  1A31 A;  2MYS A;  1VQL I;  1MMG A;  2HU9 A;  1P7J A;  2L7M P;  1VTN C;  2BBY A;  3WU1 B;  2GIZ A;  4P1W A;  4L5I A;  4RGS A;  2OZ6 A;  3RYR A;  4B8X A;  2LDU A;  2EFQ A;  5J4Y A;  4AID A;  1MMA A;  5E20 A;  4P5O A;  3TKY A;  3FX3 A;  2IS4 A;  2LKS A;  1BN5 A;  1O57 A;  2Y75 A;  4OAZ A;  1MJB A;  4BQO A;  3HB9 A;  2KLO A;  3M8F A;  1OYY A;  2CV1 A;  2DFE A;  1F4K A;  2CUF A;  2HVR A;  2OCE A;  1T6S A;  3BG5 A;  4S05 A;  4M9Z A;  5FFX A;  4P9U A;  4AVZ A;  3UKG A;  3PJR A;  1IV8 A;  3K4N A;  3AG4 H;  3ABT A;  3D5L A;  1RIO H;  3DFG A;  2R5Y B;  2HOT A;  3TDZ C;  3FMS A;  2D45 A;  3BZC A;  5DDG A;  1YX5 A;  5JR3 A;  1BL0 A;  2XAS A;  2X6Y A;  2FQ3 A;  4F92 B;  5EZG A;  4ON0 A;  2XIG A;  5BS6 A;  5ICF A;  2BHY A;  2OAZ A;  2LYC A;  2F5F A;  4F55 A;  1T0F C;  2E2I J;  3S17 J;  3SXY A;  4BJT A;  2ZFW A;  1ZRE A;  5J47 A;  1ZN2 A;  3DTI A;  4J01 A;  1D1C A;  4G12 A;  3I3L A;  4AIH A;  2HS5 A;  3BCA A;  3C1D A;  1NG6 A;  1YIJ I;  4XRF A;  1FEX A;  2EZK A;  3E5Q A;  3I55 I;  5HLG A;  1TBX A;  1YLF A;  2JMW A;  3O6B B;  1ZG5 A;  2DN0 A;  2STW A;  3OYN A;  2NYX A;  3I4N J;  5E3N A;  1S9H A;  1T95 A;  1SVL A;  1Z3Y A;  3HOT A;  1IN6 A;  3F6V A;  3FXO A;  3OYG A;  3S2D J;  5CJ9 A;  5A2Q Z;  3PNT A;  1W7P D;  2NVY J;  4BEH A;  4YIR X;  2CGP A;  2IA1 A;  4UY8 I;  4UVA A;  1FNN A;  2ESH A;  2Y9Y A;  4DNC A;  2NOG A;  2HYF A;  3C18 A;  3M9A A;  3ZQ7 A;  1P2F A;  5D8L B;  2H1L A;  1CQT A;  3SEQ A;  4CYD A;  4ZTJ A;  2IT0 A;  3E6D A;  5HNH A;  2BHZ A;  5HLI A;  4HX8 A;  3WGG A;  4A12 A;  4KFC A;  2JVH A;  1ENH A;  4BBR J;  2EIN H;  2DK5 A;  4J19 A;  5M5Y J;  2M3A A;  1BI2 A;  4M3D A;  3MKW B;  2JRT A;  5D5W B;  3MAJ A;  1UG0 A;  3FIS A;  1LFP A;  2FF4 A;  1D8J A;  5B1B H;  2W25 A;  4FCY A;  3DP7 A;  2O6G E;  1TWH J;  3K1M A;  2PG4 A;  4HX4 A;  3PSF A;  1IRF A;  3TDU C;  5K7Z A;  2RNJ A;  2DA3 A;  1LE8 A;  3Q0V A;  3RKY A;  4MQ9 F;  2K4J A;  4M73 A;  3ROU A;  4CCN A;  3GYH X;  4UUS A;  1X19 A;  2O8X A;  4JQF A;  1XS9 A;  1MDM B;  3CTA A;  2Y30 A;  2ZO4 A;  4CO8 A;  1WCM J;  1PP8 F;  3GEZ A;  3DLA A;  2E1N A;  4A3M J;  4XRS G;  5LGU A;  5D5U B;  5KAF C;  4MTE A;  1RPW A;  1RES A;  2KRC A;  3PO2 J;  3S93 A;  2HOA A;  3OIO A;  4BHB A;  2YPR A;  3BQZ A;  2ETH A;  5DCF A;  1TW3 A;  3HPH A;  2Z16 A;  4IPA A;  2R93 J;  4I0A A;  2V6C A;  2X1C A;  2OF7 A;  3IL2 A;  3RPQ A;  4F91 B;  5BQT A;  4DBR A;  4QSH A;  3HBL A;  4PK4 A;  2AO9 A;  4C3I J;  2CH0 A;  4X1E A;  3V42 A;  4HEA 2;  4XLF A;  4CCJ A;  2QUF A;  4D7M A;  2M8G X;  1D8K A;  5GPC A;  2QKL B;  4MEX F;  2X1E A;  3K4B A;  1IUY A;  3GTO J;  2BXZ A;  2ZJP F;  3LSI A;  3GO5 A;  3R0J A;  2JA2 A;  2DA5 A;  2R7D A;  2QQ8 A;  3K4K A;  1YIT I;  2HDD A;  1ITY A;  2V9V A;  1J59 A;  1AHD P;  4MGR A;  1I1G A;  4NDL A;  3KLO A;  1UHM A;  4N4N B;  5HDN A;  2HPM A;  4XOR A;  4L5J A;  4DQ2 A;  3HM5 A;  2FOW A;  5FKO A;  4I2O A;  3GFL A;  1SD6 A;  3SQN A;  3CP2 A;  3WTT C;  4PJJ A;  2VBZ A;  2XPU A;  2W1O A;  1ZRD A;  3CMM A;  4OAY A;  3TL4 X;  3S32 A;  1B9M A;  3LSR A;  2HXI A;  1WJE A;  5ILS A;  1Y0N A;  5ICG A;  3AAF A;  1YO5 C;  3TBI A;  5LRS A;  2QCO A;  1LVA A;  4D5F A;  1D5V A;  2QF7 A;  3CDH A;  1VI0 A;  3KP4 A;  3CCJ I;  1PDN C;  5IP6 A;  2BW3 A;  3CLO A;  4A0Z A;  2AXL A;  5ED4 A;  1IG7 A;  1MBJ A;  1QVT A;  3K10 A;  3I4M J;  1F1Z A;  2LP0 A;  1R71 A;  1S7A A;  4U87 A;  2LOO A;  2EIJ H;  3DTE A;  2GWR A;  4BNC A;  3P9C A;  1BC8 C;  3RSN A;  3K0L A;  3DPU A;  3C3W A;  3WTV C;  5D6E A;  3I64 A;  3E0J B;  1X3W B;  3NAR A;  5M5W J;  4ESB A;  2LBF A;  4BKX A;  1LJ9 A;  2XV4 S;  3G1M A;  2A3S A;  4IHW A;  2HZT A;  3OS0 A;  1LUJ B;  4E7L A;  2HGC A;  3LMM A;  2K3P A;  1QHH D;  1QZY A;  2ZSH B;  4P96 A;  2ZME A;  4BXF A;  3OYC A;  4P55 A;  1R5H A;  4IJA A;  3RPU D;  1W4M A;  2BY1 A;  3IP4 B;  4UHT A;  1D3Y A;  4ZC3 A;  4GXO A;  3KP6 A;  2F5C A;  2H8W A;  3K7A J;  2XRO A;  1YTY A;  3PQJ A;  3TGN A;  1XDU A;  3OIP A;  4F7Z A;  4HLX A;  1SFO J;  2LR8 A;  1SD7 A;  3F9K A;  2Y0S A;  4FQG A;  2XSD C;  3ML6 A;  1W5C C;  2LTP A;  1V5G A;  1ACI A;  2EV6 A;  2FBI A;  4RBO A;  3MEX A;  2YX7 A;  3FXU A;  3G3Z A;  1K78 B;  1AU7 A;  4Y17 A;  3RQ4 A;  4PJ0 C;  2J5O A;  2GXB A;  5HDG A;  3H9Q A;  5E8G A;  4FAS D;  1KU9 A;  1JTX A;  2NXN B;  3G71 I;  1E0E A;  3LSM A;  5K5Q A;  5HVQ C;  1ONV A;  3H0G J;  4Y13 A;  1B8I A;  1OCC H;  4Q5S F;  5K5R A;  2KP6 A;  3TQN A;  1X1C A;  2DOA A;  2XAQ A;  3RYP A;  4EM1 A;  4S0H B;  2AQE A;  5LHG A;  2X1D A;  1VQ7 I;  4CHU A;  4BBS J;  4NB5 A;  5F1R A;  2L5Q A;  2YU3 A;  3ASN H;  4PGG A;  2DMP A;  2M0C A;  3DWL E;  3W2W A;  4DZJ A;  3JSO A;  3JRA A;  2R7W A;  3QOD A;  2DDB A;  2DFI A;  3MVP A;  2D1H A;  1FIA A;  2MH9 A;  1YFH A;  3HRU A;  3J7A Y;  1ULY A;  2VAS A;  2X6O A;  3SYT A;  4HOB A;  2CFX A;  2JTV A;  3RI4 A;  1WSU A;  1WWX A;  2E1O A;  3HRS A;  1G3S A;  2O0Y A;  2JUC A;  3I4P A;  4RDU A;  2L2O A;  2DDA A;  2Q0O A;  3SZP A;  4ZDL A;  2PJP A;  1EF4 A;  2H8R A;  1YW7 A;  3BTJ A;  2VKH A;  4BHP A;  2RKH A;  5J1U A;  5LRR A;  3BRO A;  2VUM J;  1ZAO A;  3ULQ B;  3VYU B;  4XLN F;  4I7H A;  2JN6 A;  3B6A A;  1Z0X A;  4AD9 A;  3TO7 A;  4A2U A;  5ILU A;  3DCF A;  5GAG J;  1JJ8 C;  2YU9 J;  4YEJ A;  2KJB A;  2R7X A;  2BVM A;  4Y15 A;  5A2Q K;  5D5X B;  2EZI A;  3T5X A;  1IUF A;  4XNF A;  4ZYG A;  3M07 A;  4ENM A;  1UG2 A;  5CKT A;  5EYR A;  1BOB A;  2R7O A;  3HXL A;  5L3B A;  5CLS A;  4QLC U;  4II3 A;  4LOC A;  4O5V A;  5CVR A;  1MSF C;  1O3R A;  2UV1 A;  5E1W A;  1L0O C;  1Z6T A;  3L2Q A;  1XPX A;  5LD2 C;  4WWC A;  1WH5 A;  2DT5 A;  2VE9 A;  3JR9 A;  3V7C A;  4GYG A;  1JKP C;  4IHY A;  2QBY B;  1MMS A;  3DEW A;  2WAE A;  1RRJ A;  1IN7 A;  1VF9 A;  3E5U A;  1RR8 C;  2BGC A;  4MIM A;  3CUQ A;  2EQR A;  2Z1D A;  3M7G A;  3A0H C;  5FLV A;  1YX3 A;  4QWQ A;  2XC7 A;  1T2K A;  3KYC B;  1S7O A;  4LFU A;  1XN7 A;  5E8I A;  1T08 B;  3DF8 A;  2EA2 A;  3V7R A;  1ETK A;  3S1M J;  1ZLK A;  5ICC A;  3LOC A;  1J75 A;  5CQE A;  1AA7 A;  2VPR A;  2XSJ C;  4XLC A;  2Z3Y A;  1LDJ A;  5FLX Z;  1HKQ A;  3FMR A;  2Z5U A;  1SMT A;  2RN7 A;  3IH3 A;  3O2P E;  3HRM A;  1G2H A;  3C2G A;  4DOZ A;  1MJA A;  4UV9 A;  3SFI A;  4HYE A;  1CF7 A;  3QP5 A;  3CCS I;  5LGN A;  1WZ2 A;  3D5S C;  4G94 A;  1VQN I;  5E1X A;  2Z9O A;  3A1Y A;  2ZCW A;  1BI3 A;  4AC0 A;  1NG7 A;  4C2U A;  1TQM A;  1NK3 P;  3KFW X;  5K7F A;  1BW5 A;  3MQ0 A;  5D8K B;  3VEP A;  2V6E A;  1F36 A;  2K9M A;  4M3F A;  5L3E A;  4Z6Y A;  2ACJ A;  2MG4 A;  4HLY A;  5GP9 A;  3Q0W A;  5HOO A;  2JJ7 A;  2A6H F;  3CUO A;  5M3F J;  1K4T A;  1RKT A;  3A02 A;  3CLQ A;  1VQ6 I;  3M1C A;  3K70 C;  2B9S A;  1U2W A;  2PI0 A;  1OIS A;  3PO3 J;  1GDT A;  5EF6 A;  1VQ9 I;  1U5T A;  4RM2 A;  3ZPL A;  2DTZ A;  1WVR A;  3AG3 H;  1V5F A;  3LSJ A;  1W0T A;  3N4M A;  3G1O A;  2BY2 A;  2EIK H;  3HYI A;  2CU7 A;  3PUB A;  1BOA A;  1XCV A;  1S72 I;  2R7Q A;  5DEQ A;  3JRE A;  2R7V A;  2BXY A;  3Q0U A;  4B48 A;  3OYJ A;  2L01 A;  4Q4Z F;  2UWM A;  4I6Z A;  4BE2 A;  2A5W A;  4JOM A;  4HSR A;  1RNL A;  2YS9 A;  2VPL A;  2VXD A;  2VKE A;  3ZMD A;  2KJC A;  1LNW A;  1OCR H;  3K1P A;  4UB8 C;  3MWM A;  3K70 D;  2R92 J;  2R7Z J;  3R4K A;  2O5R A;  4M6V A;  3ZN0 A;  2FSW A;  1W5S A;  3OYD A;  4E7K A;  2CS3 A;  3IAS 2;  3KEQ A;  3IHU A;  1DDN A;  2NS0 A;  3F8N A;  4BHC A;  2G0E A;  1FYL A;  4HRI A;  3ECH A;  3QOP A;  2K9L A;  4OIN F;  4U7B A;  3QU3 A;  3GVA A;  1JT6 A;  2PJR A;  3KX2 A;  3T0Y A;  2DMT A;  3BP8 A;  4M3E A;  1J9I A;  2VQH A;  5BNG A;  4G7H F;  4IF4 A;  4BY7 J;  1FOY A;  3KYL A;  2OU2 A;  4HNU A;  3J81 Z;  4UVB A;  3VOD A;  1A6Q A;  1S8N A;  2LFB A;  3ZQC A;  1QVU A;  4X0G A;  1TTY A;  3ABU A;  4AYB N;  1FMW A;  5LGT A;  1LVK A;  1W0U A;  2IJL A;  1RC9 A;  4KIC A;  2E35 A;  2V1U A;  4E70 A;  3MZ8 A;  4IHT A;  4MFD A;  1I6X A;  3A01 B;  3GTK J;  1CGP A;  3V7S A;  2ZBK A;  3ZQL A;  3OOP A;  2KIS A;  4IHX A;  3K4L A;  1P7I A;  1P9Q C;  3HZJ A;  2ADU A;  3CQZ J;  4ZZD A;  3LST A;  2F4I A;  2R7F A;  2K7L A;  4L9J A;  1YG2 A;  1DGR M;  2DFF A;  3HDD A;  3I59 B;  2VXZ A;  3IH2 A;  2IW5 A;  2M5W A;  2O3F A;  1YJW I;  4OOI A;  4XLA A;  3JRH A;  1O3Q A;  3DV8 A;  2MD0 A;  1U9O A;  2DAO A;  4CYC B;  1QHG A;  2BE5 F;  5M3M J;  2OV7 A;  4PCQ A;  4EJU A;  5FJ8 J;  1R5I D;  3WE2 A;  3TP3 A;  1MBK A;  1BJA A;  3QYB A;  4A69 C;  3WTS C;  1Z1D A;  4D7N A;  3EUH C;  4CXF A;  3CCV I;  3KPH A;  2X0L A;  4IOA F;  3BR0 A;  5K1Y A;  4I01 A;  2ZJQ F;  2QYO A;  5DTD A;  3B02 A;  5IP9 J;  2L7K A;  5JHU A;  1TW2 A;  1KYW A;  3I58 A;  2CO5 A;  1PUF A;  1AKH B;  5E3O A;  4GRI A;  2HEO A;  3BCB A;  2ZC2 A;  1RR7 A;  3QYE A;  4HA8 A;  1MMN A;  3FM5 A;  1SAX A;  4AIJ A;  2EV5 A;  1WH7 A;  2WY7 Q;  2O61 A;  2DOF A;  1EH6 A;  1XSX A;  3U1D A;  4YG2 F;  3C2B A;  4M9X A;  3A0B C;  1N77 A;  3H5A A;  1QNT A;  2IEK A;  4BDY A;  2EIM H;  4EVI A;  3MCZ A;  2E1C A;  3BZ6 A;  4FTH A;  5L3D A;  2IS6 A;  2NS7 A;  1DQU A;  2K02 A;  4HF0 A;  4BUP A;  2WTE A;  3QQA A;  4EJT A;  4BJ5 C;  2EIL H;  2MBF A;  2QEX I;  1R23 A;  4BS9 A;  1OCT C;  2NS8 A;  3KYD B;  3G2B A;  1I3A A;  9ANT A;  4M9S A;  3OYF A;  1OPC A;  2JSP A;  4I02 A;  5LHH A;  2DPD A;  3MKY B;  2NVQ J;  3RKX A;  3E6C C;  3BR3 A;  3F23 A;  1OCO H;  4LLG F;  1JGS A;  1GLN A;  5E79 C;  3PFY A;  4LD5 A;  3WTU C;  5E18 F;  2GAU A;  2Y2Z A;  2Q8K A;  2M87 A;  3GTM J;  2HTS A;  4XRM A;  2CW7 A;  3LA7 A;  4RB1 A;  1U8R A;  3RTR A;  4HQM A;  3BJ6 A;  1OKR A;  5E17 F;  2W84 A;  3P9K A;  4IRG A;  2FBH A;  2ZXI A;  4IL6 C;  2R0Q C;  3KET A;  2VIX A;  1X2M A;  3DBR B;  2L02 A;  1S5L C;  2UZK A;  2M45 A;  4B3A A;  3CO6 C;  5FLX K;  3EUH A;  4E7I A;  4G9Y A;  4XN0 A;  3TP0 A;  4KT6 A;  3G6E I;  1K61 A;  2HXO A;  4CDG A;  3SZG A;  2OBP A;  3J7Z I;  1A35 A;  3I54 A;  1JTY A;  1I1S A;  1DU6 A;  1NHA A;  4C3H J;  1Z67 A;  1T33 A;  2LF8 A;  4KYW A;  4PSX A;  1G8X A;  3W3C A;  2QQA A;  3ZGK A;  3DEE A;  3ZCO A;  2TRT A;  3CME I;  3SZT A;  2HQN A;  5D4R A;  3D1N I;  1ZH5 A;  4YRV A;  4I09 A;  1OMI A;  4XKV A;  4F52 A;  2VOO A;  5D6F A;  2W7N A;  5L3F A;  4OMY A;  3MFK A;  1S3J A;  4YFX F;  3I53 A;  2VOD A;  2HVQ A;  2ISY A;  2V9P A;  1B72 A;  1U8B A;  4BAY A;  5JFR A;  2K9Q A;  5GTI C;  2P5V A;  3GLX A;  2HI3 A;  2ICW G;  3BOQ A;  4ZZL A;  3VYT B;  2BOL A;  1SFX A;  5BMZ A;  3HPG A;  2VQC A;  1R1U A;  5EGO A;  2L9V A;  3JSP A;  2P81 A;  4AUX A;  1PVE A;  2IPQ X;  4LGW A;  3BPV A;  3K2Z A;  1ODD A;  2KMU A;  2HDC A;  3DBH B;  2XHK A;  4LK0 F;  2D5V A;  4CGZ A;  4C9Y A;  2Z33 A;  4BGD A;  4A3K J;  3HKZ N;  3S3N A;  3FXM A;  5EG0 A;  3HOU J;  1HOM A;  2CV2 A;  5DUK A;  4EV0 A;  2PBI A;  4WCG A;  1E2X A;  2Y48 A;  5CVU A;  3FK6 A;  2RRE A;  4ZDP A;  4ESJ A;  1YIO A;  3S3M A;  1L3L A;  3GLL A;  1QU3 A;  2HPI A;  3F8B A;  1OCP A;  3MKL A;  5IOZ A;  3LSG A;  3JRB A;  1SFK A;  4DYC A;  2IS2 A;  1I39 A;  4ENJ A;  3OIQ A;  5J1R A;  3GFJ A;  4NC6 A;  4B4C A;  5TIS C;  1JKR C;  1KYZ A;  3V4G A;  3J81 K;  2JK3 A;  2ZNZ A;  3HHG A;  3FHN A;  3FHZ A;  2P0W A;  1MGT A;  3F3X A;  4BL0 B;  3OY9 A;  3F21 A;  5B1A H;  3S16 J;  2EFP A;  2VB6 A;  2XF7 A;  4UB6 C;  5FD5 A;  3ZMV A;  1O4X A;  5GAH J;  1F5T A;  3MN2 A;  1MZB A;  1WJA A;  1TZL A;  2MLK A;  2BYV E;  5FGM A;  1MNE A;  2VOP A;  2V4J C;  2VJI A;  5F0H A;  5FKL A;  2ECC A;  2GOX B;  2IXS A;  3NWT A;  4PFP A;  1KU2 A;  1JUM A;  2QQ9 A;  4FET A;  3DKY A;  1S29 A;  1T0F A;  3QYF A;  2WAQ A;  3OV8 A;  4HPQ A;  1W7P A;  2DOD A;  1H9G A;  3AL0 B;  1SAN A;  4LG3 A;  1QZZ A;  5DD8 A;  3VYS B;  1UHS A;  3UR3 C;  5JHF A;  2MC4 A;  4U0W A;  2NNY A;  3KE2 A;  4GO1 A;  2PMZ A;  1Z7L A;  1B6A A;  1R36 A;  3H0D A;  4XL9 A;  1DU0 A;  4DYR A;  4CUG A;  2MGQ A;  5BOX A;  1VQK I;  3FXL A;  2KRF A;  4NUB A;  1BR2 A;  4LG0 B;  1MJ9 A;  5B3S H;  1FY7 A;  2JA8 J;  1G4D A;  4D5C A;  4L9T A;  5L3C A;  4CZZ A;  6PAX A;  3X2Q H;  4AIK A;  4PZJ A;  3NRV A;  4KIF A;  3OL4 A;  2J5P A;  2FA5 A;  4KNY A;  2VJJ A;  3R61 A;  2PQ8 A;  2JA5 J;  5DCM A;  1FSH A;  1DPR A;  4EJW A;  1U9N A;  2A68 F;  3DLL F;  2O9L A;  1IRG A;  3S1N J;  2DMU A;  3L2V A;  2R5Z A;  2EZH A;  1P4X A;  3AG2 H;  2VT2 A;  3A4C A;  1E3P A;  4EM2 A;  4BDZ A;  4N9H A;  3QPL A;  1XDS A;  1X1A A;  1QGP A;  1YRN B;  3DEU A;  4KMU X;  2A6E F;  4A6D A;  2YUS A;  2FE3 A;  4BY1 J;  4WXH A;  3JRC A;  2R7R A;  2MAB A;  1IO2 A;  5FRN A;  2M1B A;  1FX7 A;  1IGN A;  4Y7N J;  1KQ9 A;  3U1K A;  2XAG A;  4II2 A;  4DGW B;  2WWY A;  1YW9 A;  4CZC A;  4HQE A;  1IJW C;  5B5E C;  1JHF A;  3KZY A;  3J80 K;  2LY1 A;  3CMY A;  2AHQ A;  1OLT A;  3L7W A;  1HCR A;  1JJ6 C;  3ABM H;  4UV8 A;  3OS2 A;  4EMS A;  1MIJ A;  2DBB A;  3HRT A;  3I56 I;  2ZJR F;  3LSK A;  3RQI A;  3OMY A;  3RKQ A;  2GXA A;  3E3V A;  2N8G A;  1HST A;  2KIQ A;  3H92 A;  2KZV A;  5LEK A;  2FQ4 A;  2MA3 A;  1ZLJ A;  2FNP A;  1ZAR A;  1JKQ C;  2RQQ A;  2FX0 A;  2IS1 A;  3LQQ A;  1T8I A;  2W24 A;  1YS6 A;  2WV0 A;  2ID3 A;  3ZQG A;  2D1V A;  2Y9Z A;  1XD7 A;  3HOV J;  3E5X A;  4RB3 C;  4H4K C;  1J7K A;  4A0X A;  2VQL A;  2LY9 A;  2RV8 A;  5D4S A;  5FRO A;  2HQR A;  2ECB A;  2IAI A;  2WAF A;  4AU7 A;  5IT9 Z;  4KMF A;  1I6H J;  3FBN B;  4I0B A;  5KVR A;  3JAM Z;  2F6C A;  2LRD A;  3LA2 A;  1U6G A;  3L9F A;  4DYQ A;  2E1M B;  2HKO A;  2IBD A;  5AIP A;  2FJ1 A;  2P7V B;  3GXO A;  4L0Y B;  3O8G A;  1HF0 A;  2RGV A;  2Y69 H;  4YIF A;  3F8M A;  3P7N A;  1J09 A;  2KIU A;  4V2G A;  1H8A C;  3ZQI A;  2QSF X;  3KLN A;  1H88 C;  2HOS A;  4RM3 A;  5KAI C;  2LKP A;  1F43 A;  3ELK A;  1XGO A;  4ZYH A;  1J0R A;  5GAE J;  2E36 A;  3EUK L;  3FKJ A;  1QRY A;  3CO7 C;  4A3F J;  1KGS A;  3BR6 A;  1IV6 A;  4LK1 F;  1X1P A;  4ETS A;  1A5J A;  1FBS A;  4Y3O A;  3M1E A;  5E3M A;  3DTK A;  1O7F A;  5DM7 F;  1QA6 A;  3RPU A;  4XBF A;  2X9D A;  3GZN B;  1R22 A;  1DP3 A;  4M72 A;  1Z7U A;  2XVC A;  3IV5 A;  2ELJ A;  1FWZ A;  2E34 A;  4LLL A;  2VKD A;  4KIB A;  4IRH A;  3TW6 A;  2E71 A;  2CW0 F;  3GTG J;  2L4M A;  1LDK B;  1TNS A;  4EEF G;  3CCU I;  2MC3 A;  1BJZ A;  2XB5 A;  4XM3 A;  2AS5 F;  4JBA A;  2L9R A;  3CCE I;  3OYA A;  2VT3 A;  1SFE A;  1FLI A;  4JK1 X;  3EDP A;  2K4B A;  4M3G A;  5FKK A;  2H09 A;  3VB2 A;  1HLV A;  1PUE E;  3P5J A;  5EJC A;  5J1Y A;  2G7U A;  1O3T A;  4WX9 A;  2XAJ A;  2KKO A;  2P4W A;  1REP C;  1WPK A;  4ITV A;  2L7F P;  3RZD J;  1P6R A;  3GTJ J;  1KON A;  1D0Z A;  2ISZ A;  2COM A;  2QM3 A;  2E5N A;  2V1N A;  3IWF A;  4FE7 A;  1WGX A;  4MHG A;  2E2J J;  2NVT J;  5EEA A;  3BLY A;  1LPQ A;  2L3D A;  3K2A A;  2E7X A;  4XQF A;  4PJL A;  3F72 A;  4BQN A;  3OYK A;  3H3U A;  4M6Y A;  1KA8 A;  1GVD A;  1HSJ A;  1G3T A;  2L4A A;  2ELH A;  1QBJ A;  3WTW C;  3HEF A;  3ABL H;  1UEL B;  2QSH X;  4CA0 A;  3ZMT A;  1MBE A;  5HDK A;  3HOZ J;  2DJI A;  1KU3 A;  2OTJ I;  2JRM A;  2WAQ N;  3H35 A;  4A3B J;  3WHB A;  2P5L C;  2KT0 A;  3L2C A;  5ERI A;  2XRN A;  1HBX G;  4NQW A;  4E7S A;  4OU0 A;  4IO9 F;  2R5Y A;  2OUM A;  2P6S A;  1HKS A;  4AM3 A;  2W57 A;  4F3Q A;  1XGN A;  1RUO A;  2K9S A;  5ICE A;  1VQ5 I;  2UUZ A;  2Q2E A;  4LJZ F;  2ID6 A;  3F0C A;  1FBU A;  5GAD J;  1IAW A;  2HYJ A;  1VQ8 I;  1APL C;  4HX7 A;  5KCM A;  1UCR A;  2Y0M A;  3HOW J;  2FBK A;  3VSK A;  1K6Y A;  1V55 H;  2EH3 A;  4KIG A;  4BEH B;  4E6K G;  1OCZ H;  2G9W A;  2PMH A;  1XSV A;  3GUD A;  4OIR F;  1HQC A;  3FZV A;  3PM1 A;  5FKM A;  4O6J A;  4D1Q A;  2PMU A;  3F22 A;  2DI3 A;  2C6Y A;  2CYY A;  1W36 C;  2P8T A;  3KP3 A;  3WG9 A;  2A61 A;  1K7A A;  2R7S A;  2QZ8 A;  4I98 B;  4HNT A;  1K79 A;  4GFB A;  2XKP A;  1S7E A;  4XLP F;  3CJN A;  4ZH4 F;  3BY6 A;  2EFW A;  1Y8Q B;  3QP6 A;  4FX0 A;  4EJV A;  2STT A;  2EB7 A;  2RAE A;  3U21 A;  2VQG A;  2UXN A;  2CJJ A;  1ZK8 A;  4L18 B;  2M30 A;  1JI8 A;  1GV5 A;  2DMQ A;  1FIP A;  2F5D A;  1ZRF A;  2M8E A;  2CW8 A;  3CDI A;  1XGM A;  1YQA A;  1R4N B;  2QVO A;  1LE8 B;  1BIB A;  5IPA A;  3E97 A;  1OR7 C;  2LK2 A;  5KK1 A;  1W36 D;  3C2H A;  1RET A;  5K7H A;  5LFA A;  4UUS B;  3CP8 A;  2WY8 Q;  3DQV C;  3RDI A;  5H2F C;  3D5R C;  1EA3 A;  1YJN I;  2JVG A;  4Q47 A;  2DA6 A;  3SDB A;  3WU0 A;  3S2H J;  1Y0U A;  4HNV A;  1MSE C;  2KQR A;  3PSI A;  2XPW A;  4L9N A;  4L9V A;  3UNG C;  3Q3S A;  4EJO A;  3NAU A;  3LFU A;  3HL2 A;  3W6J B;  1MDM A;  3JRG A;  1FPQ A;  3CJT B;  3H3Z A;  4EAT A;  4IHV A;  2VBX A;  3H9J A;  1NK2 P;  3TW7 A;  4LLN A;  2V7F A;  4A3I J;  2XUB A;  3PNY A;  3TO6 A;  3CCR I;  4IVN A;  1UFM A;  1HDD C;  1XSD A;  2LG4 A;  2MW8 A;  2VBW A;  1BI0 A;  2EWN A;  2Y0S N;  1YE9 A;  1FSE A;  2IRF G;  3KIO A;  3PL8 A;  5JVG F;  1UZC A;  2LNB A;  3FXK A;  3H5N A;  4JX5 A;  3WE3 A;  1Y1V J;  1P92 A;  1R4M B;  1ZTR A;  2M7A A;  4D9J A;  2K3F A;  5DCM B;  1SVO A;  1I3Q J;  3GME A;  3HTU A;  3AKZ A;  3HOX J;  1BC7 C;  2M4G A;  5J3L A;  1B4A A;  2R3S A;  3LA3 A;  3LAJ A;  3BQY A;  4NBQ A;  4AVP A;  3W6K B;  2R7T A;  5F1J A;  5FB2 A;  3QPT A;  4G7Z F;  3DKX A;  1FOW A;  4RAZ A;  2H94 A;  3HGY A;  1EKE A;  2W85 A;  2WAD A;  5TJJ A;  3V8L A;  1MW7 A;  3JAM K;  4R8H A;  3HGG A;  1UB9 A;  2B7E A;  2JQ7 A;  3QU6 A;  1X4O A;  3L2W A;  4A3J J;  2IGO A;  4UVC A;  5B66 C;  2DMN A;  2HZD A;  1Q1H A;  1VQO I;  2XKO A;  2O8K A;  2CQN A;  1Z6R A;  5EEG A;  4HBL A;  2X6W A;  3FXR A;  5EDN A;  2DYS H;  1BA5 A;  1OR7 A;  2BW3 B;  2QA4 I;  2CSO A;  3LNQ A;  2BY0 A;  3QAH A;  1UMQ A;  2RC4 A;  2JWT A;  2XGX A;  1JXS A;  4UUV A;  1ZG3 A;  1ORK A;  2KHM A;  3KEO A;  4X6A J;  1FOK A;  2GIV A;  2WV1 A;  4CH7 A;  2CV0 A;  5GTH C;  1WFX A;  3GF2 A;  1Y39 A;  2E7W A;  1BR4 A;  4IEJ A;  2WC2 A;  4ZJZ A;  3KEY A;  2LBF B;  2IGM A;  3QOE A;  4E4H A;  4RMN A;  1IXR C;  2M34 A;  1T39 A;  3LSH A;  1JT0 A;  1X4P A;  1TT0 A;  4XSZ F;  2ZME B;  1WJC A;  2XGE A;  4EQQ A;  4N4O B;  5CYV A;  2A69 F;  4LIT A;  4ZTF A;  3VDX A;  4WXD A;  3CCM I;  5CQG A;  2GM4 A;  4OIO F;  1TC3 C;  2HQA A;  3ZN1 A;  3IUO A;  1R1T A;  2LF7 A;  3WG7 H;  5IY5 H;  4BAC A;  1LEA A;  2F2E A;  2L7Z A;  2OJE D;  3G1L A;  5KNL A;  2QWW A;  4ZYD A;  5IT3 A;  2F4M B;  2ZFU A;  3DPL C;  5E1Z B;  2KL4 A;  4Y33 A;  2H6B A;  2ELK A;  4RB2 C;  3H3V K;  1OJL A;  3BR2 A;  3MKZ A;  1G3W A;  4G6Q A;  1HW5 A;  3OSF A;  3Q5F A;  4V2F A;  1TWA J;  4E7Z A;  2VC1 A;  2W82 A;  4HDU A;  3S15 J;  1B8I B;  2NAZ A;  3NQO A;  3M3Y J;  5TGT A;  1KQ8 A;  4I76 A;  3REO A;  2L9S A;  1XMA A;  3GX4 X;  1K78 A;  1MND A;  2P6T A;  1T98 A;  2IA0 A;  1GVJ A;  2F48 A;  1BR1 A;  2XAH A;  5IYC J;  1HW1 A;  3FBI B;  1P4W A;  1PJR A;  2D2W A;  1BM9 A;  3BG6 A;  1W1W E;  2EK5 A;  3BG7 A;  1K4S A;  3V8J A;  4LB5 A;  3ECO A;  3BJO A;  3ZMU A;  4DIQ A;  2I10 A;  1VZ0 A;  5AIQ A;  3FF5 A;  1MBG A;  3L1P A;  2K86 A;  4RGX A;  4NHJ A;  4RLF A;  3M4O J;  2KFD A;  2X85 A;  3IWZ A;  3GCM A;  3ERE D;  1LB2 A;  2VI6 A;  2VJ5 A;  3K1N A;  3I5U A;  2DT6 A;  5ILV A;  1AOY A;  5CVI A;  1UHW A;  1SFU A;  4GDF A;  1P4A A;  4BQQ A;  4XMY A;  3N97 A;  3JW4 A;  3NWS A;  1JUS A;  5TRD A;  3MZY A;  3HUG A;  2OQR A;  4PJN A;  1FJL A;  5F04 A;  2GA1 A;  2LC2 A;  2NVX J;  2KZG A;  3EYY A;  1PP7 U;  4BYY A;  3OR2 C;  2W4S A;  1QO0 D;  3PIO F;  4A5M A;  1YI2 I;  1R49 A;  1LKX A;  2A07 F;  2F5V A;  3BG3 A;  4Y4R A;  2JUG A;  1LFU P;  1AWC A;  1RZ4 A;  3OYE A;  4WK8 F;  2JA6 J;  3R0A A;  3B6C A;  2TDX A;  3J7A O;  2ME6 A;  2NOJ B;  3VOE A;  1DGW Y;  2EV0 A;  2FD5 A;  4BE1 A;  1H0M A;  2PLY A;  4ZDO A;  5LEJ A;  1UST A;  2HNH A;  4P9F A;  3VFZ A;  4KA4 A;  5H6R A;  2LD5 A;  1R9T J;  2HYG D;  4A3G J;  1QZE A;  3CUQ B;  4NQW B;  4L0Z B;  2DXI A;  1QQI A;  2BZT A;  4I99 C;  4LMY A;  4RA2 A;  3CMA I;  1R58 A;  3IRQ A;  3CF5 F;  1W5T A;  2RNG A;  2DO7 A;  3CCY A;  4J00 A;  1GXP A;  3GZ5 A;  3IH4 A;  2E5Z A;  3HSE A;  4IQJ A;  2QBY A;  2FU4 A;  1J5Y A;  2Q2E B;  4R79 A;  3U2R A;  2ZXW H;  4BU2 A;  1TT5 B;  4FT8 A;  4XIC A;  4EM0 B;  1J2X A;  3ZQF A;  3R60 A;  2KIM A;  4WXC A;  2AQF A;  3P9I A;  4RLQ A;  1BBY A;  3PUF A;  1EJ9 A;  2K40 A;  2EJR A;  1N75 A;  2E19 A;  3T1B A;  1CF7 B;  4OIP F;  2ESN A;  1T56 A;  2DU9 A;  5DD4 A;  5E3L A;  2H1K A;  2R7U A;  1A04 A;  3CJR B;  4G6D A;  2IP2 A;  1WRJ A;  3GTP J;  2GOM A;  2MSY A;  4KIT B;  3CDL A;  1YJ9 I;  4OMZ A;  3C7J A;  1TWC J;  5IP7 J;  2OPT A;  4EGY A;  2HDW A;  4G7O F;  3MZH A;  3K4C A;  3QPS A;  2JSC A;  3WTZ A;  5HNF A;  4LIV A;  2JT1 A;  4ENN A;  5K5O A;  3W2A A;  2JZY A;  1R7J A;  3ISP A;  3OYH A;  1ETO A;  1B1B A;  2X4H A;  5EZH A;  2LMD A;  1HDP A;  4ZYA A;  5J40 A;  1VFC A;  4CCL A;  4Z2Y A;  1IXC A;  4FX4 A;  2DYR H;  1SEU A;  5F27 A;  3IAM 2;  4YFK F;  1JE8 A;  1U5T B;  2I5U A;  5J8C A;  1OYW A;  4FE4 A;  3S8P A;  1MH4 A;  1IN5 A;  2L9N A;  1JGG A;  2K5C A;  2NNN A;  3L00 A;  2COB A;  4GCV A;  2R4G A;  3VWB A;  1WJF A;  3ABK H;  4UXN A;  3PFI A;  4G6T B;  3FDY A;  3JRF A;  1Z05 A;  3K4M A;  1MH3 A;  3FM3 A;  3WTY C;  5BPD A;  2LVS A;  2VBY A;  1SC7 A;  1ZQ3 P;  4RGU A;  2FNA A;  3U9G A;  2DQR A;  5M5X J;  4HV6 A;  3BC8 A;  3HOY J;  2VJ4 A;  1O7L A;  2FEZ A;  3CC7 I;  3OYL A;  2KIF A;  1D5Y A;  2CFO A;  5JLX A;  1KZH A;  2WB1 A;  4KUM A;  5JVT A;  1R00 A;  1MMD A;  1USS A;  2DA4 A;  2GQQ A;  2F5E A;  3LAP A;  4PUS A;  1VQM I;  3V8K A;  2FRH A;  2CG4 A;  2PJR B;  3OOU A;  1FT9 A;  4RB0 A;  4B47 A;  2DA7 A;  2M9H A;  2PEX A;  4XRS A;  2PN6 A;  1XTA A;  1FYK A;  2EZL A;  4IOC F;  3WGI A;  3MMY B;  2ZME C;  3Q9S A;  3E6B A;  4NC8 A;  3S14 J;  1BW6 A;  2M2E A;  4PJM A;  4C30 A;  3ZOB A;  3GFM A;  4XOP A;  1MKM A;  2FMY A;  3ZQQ A;  2XDV A;  3SEZ A;  4BJ6 C;  2ZNY A;  2V9K A;  1TQP A;  3PIP F;  1FZP B;  2Z2S B;  2W00 A;  2LSO A;  2A5Y B;  2DW4 A;  5F64 A;  1ZR4 A;  4NNJ A;  1U3E M;  4BXX J;  5HS8 A;  2K9N A;  2O7O A;  3HSF A;  4DJA A;  2HQ5 A;  3KP7 A;  3OR1 C;  3FIW A;  2MLG A;  3SDG A;  3COA C;  3OSG A;  1DPU A;  1SMY F;  3A01 A;  3IKV A;  2GBY A;  5F0F A;  1ZGJ A;  4HF2 A;  5FFZ A;  2CWE A;  4HW0 A;  5C44 J;  3TOA A;  1SD5 A;  3FK7 A;  5IYD J;  4D0P A;  1POG A;  2EPF A;  3K9T A;  4WF2 A;  4HF1 A;  1LFB A;  2ZSI B;  3TED A;  1GV2 A;  4MEY F;  5CVJ A;  2V79 A;  1X3Z B;  3ZRG A;  1XB4 A;  1R5G A;  4XOT A;  1EH7 A;  2H6C A;  3I59 A;  2LRE A;  3ZMZ A;  3ZMS A;  3E7L A;  1FBQ A;  2NVU B;  1IXS B;  2MD5 A;  3S1Q J;  3IC7 A;  4GGG A;  1Y6I A;  1M1E B;  3SHF A;  4CYC A;  2HOE A;  2ME0 A;  2VKV A;  2P5K A;  1ZEL A;  3JTG A;  1U78 A;  4CCM A;  5HLT A;  1JKO C;  2OCC H;  2CUJ A;  5CVV A;  3BTI A;  4AWX B;  1IN8 A;  1ZGW A;  3LL7 A;  1PUF B;  2OZU A;  3S3O A;  2OQG A;  1FC3 A;  4RAY A;  3N05 A;  2WBM A;  1IW7 F;  1XX5 A;  1TP4 A;  4C2M J;  5C4J J;  1HXD A;  1ERD A;  1ZKG A;  1JUP A;  1U0J A;  1Y1W J;  4Q48 A;  1K6O A;  2DK8 A;  3H1C A;  3CCQ I;  1ON2 A;  1RI7 A;  3BDD A;  4E7J A;  3RIR A;  2HTJ A;  1N78 A;  4H0E A;  1IRZ A;  4OIQ F;  2B0L A;  3ZP5 A;  1VND A;  1AKH A;  3EYI A;  2GXG A;  4A3C J;  2HKX A;  1VQ4 I;  1UAA A;  1PYV A;  2XRL A;  3G73 A;  4EGZ A;  3LFK A;  1D0X A;  3VYR B;  1H9T A;  1S6L A;  2AXT C;  1FP1 D;  4QPO A;  2A05 A;  3RCO A;  2GZW A;  5FKN A;  3HTS B;  3OWT A;  5L3G A;  1ETV A;  4B09 A;  4AYB A;  4A6E A;  1E3H A;  3AG1 H;  4QPQ A;  1WQ2 A;  3H5R A;  2EA4 A;  4FHT A;  4JP0 A;  1D1A A;  4XID A;  1X58 A;  3EUA A;  3GZ6 A;  1MBH A;  4XKB A;  4KIS A;  4KN7 X;  1R1V A;  5CPR B;  2DFH A;  5IYB J;  3KZZ A;  2L54 A;  3CUQ C;  3A03 A;  4RAG A;  4U0Y A;  2M4K A;  1G3Y A;  2X6X A;  2XAU A;  1SAU A;  5H6Q A;  5HOD A;  1OQY A;  4B44 A;  1MBF A;  1BI1 A;  4A0Y A;  3PQK A;  3SJM A;  1LDD A;  1Q1V A;  3OYB A;  1WJB A;  2BY3 A;  1O3S A;  4LB6 B;  3O8H A;  4S04 A;  3HUG B;  1IZ1 A;  3VPR A;  3FXJ A;  4JYK A;  4RGR A;  1F9N A;  5DS9 A;  2QGU A;  3DXJ F;  4CCO A;  5DM6 F;  4DBQ A;  1TNT A;  1I5Z A;  4HG2 A;  1YOV B;  1DUX C;  1YS7 A;  2P7C B;  2EBI A;  1V54 H;  3EPZ A;  3HHH A;  2VLA A;  3NEU A;  1FTT A;  4IKF A;  1FTZ A;  4PSW A; 
#chains in the Genus database with same CATH homology
 3AKZ A;  1IRX A;  3ZR8 X;  2M4G A;  4PSX A;  1G8X A;  3W3C A;  3LSI A;  3PNV A;  2JA2 A;  3ZGK A;  3K4K A;  2R7T A;  3DEE A;  4XLE A;  3ZCO A;  3DKX A;  2CMP A;  4B43 A;  2WAD A;  4N4N B;  1MW7 A;  2HPM A;  4BE0 A;  4XOR A;  4YRV A;  4XKV A;  4F52 A;  1X4O A;  3L2W A;  2W7N A;  2IGO A;  2HVQ A;  1Y56 A;  2HZD A;  3CP2 A;  4PJJ A;  2W1O A;  3CMM A;  4OAY A;  2X6W A;  3TL4 X;  3S32 A;  3VYT B;  2BOL A;  1WJE A;  2BW3 B;  4F93 B;  3HPG A;  3TBI A;  2VQC A;  2XF5 A;  3VSL A;  3OYM A;  2E60 A;  5FRM A;  2KHM A;  3CES A;  2BW3 A;  2LH9 A;  3AL0 C;  4E7H A;  2KMU A;  4CH7 A;  3K10 A;  2CV0 A;  1WFX A;  4C9Y A;  4BGD A;  1BR4 A;  4U87 A;  3S3N A;  2LOO A;  4ZJZ A;  3KEY A;  2LBF B;  3DTE A;  3TMO A;  2IGM A;  3QOE A;  4E4H A;  2CV2 A;  3RSN A;  3DPU A;  4RMN A;  3E0J B;  3LSH A;  1X4P A;  1TT0 A;  2LBF A;  5KHD A;  2RRE A;  4ZDP A;  1WJC A;  4N4O B;  4LIT A;  4ZTF A;  3VDX A;  3OS0 A;  4E7L A;  5CQG A;  3LMM A;  2K3P A;  3M8J A;  1QHH D;  4IX7 A;  3S3M A;  2ZSH B;  1D1B A;  2HQA A;  1QU3 A;  3IUO A;  3OYI A;  2HPI A;  4XR6 A;  4BXF A;  3OYC A;  3RPU D;  3H9G A;  4BAC A;  3IP4 B;  4ZC3 A;  3LSG A;  1SFK A;  2ZXH A;  2IS2 A;  5KNL A;  3CJQ B;  3OIQ A;  2BVL A;  2ZFU A;  3DPL C;  3OIP A;  2KL4 A;  4XLH A;  4Y33 A;  3OS1 A;  3F9K A;  2Y0S A;  3MKZ A;  1V5G A;  3FHN A;  2P0W A;  2IGN A;  4E7Z A;  4BL0 B;  3OY9 A;  3AFH A;  3RQ4 A;  2W82 A;  2VB6 A;  2XF7 A;  5TGT A;  3H9Q A;  1WJA A;  4FAS D;  2L9S A;  1TZL A;  1E0E A;  1MND A;  3LSM A;  5HVQ C;  1MNE A;  2V4J C;  3E1S A;  2VJI A;  1BR1 A;  4CCK A;  3FBI B;  2GOX B;  2IXS A;  2KP6 A;  3NWT A;  4PFP A;  1X1C A;  2DOA A;  1PJR A;  4FET A;  2AQE A;  3BG6 A;  2X1D A;  3DKY A;  3QYF A;  3K6G A;  2WAQ A;  2L5Q A;  3BG7 A;  4HPQ A;  4DIQ A;  3AL0 B;  3DWL E;  3W2W A;  4LG3 A;  1VZ0 A;  2R7W A;  2I8D A;  3QOD A;  3VYS B;  2CUZ A;  2XF6 A;  3UR3 C;  5JHF A;  2MC4 A;  4RLF A;  1D0Y A;  3W2V A;  2X85 A;  2PMZ A;  2VJ5 A;  3J7A Y;  1Z7L A;  2DT6 A;  2VAS A;  3SYT A;  3H0D A;  4XL9 A;  4CUG A;  3L2R A;  4BQQ A;  4XMY A;  3NWS A;  2L2O A;  4NUB A;  4PJN A;  1BR2 A;  4ZDL A;  3HC7 A;  2VKH A;  3HKZ A;  2LC2 A;  4YEL A;  2DCE A;  3VYU B;  4ANJ A;  2X51 A;  3OL4 A;  3OR2 C;  2W4S A;  1R6R A;  2VJJ A;  4YEJ A;  2R7X A;  2BVM A;  1LKX A;  2M7B A;  2F5V A;  4Y4R A;  2JUG A;  4MLO A;  4XNF A;  1X1D A;  2E1M C;  3OYE A;  5CKT A;  3L2V A;  3ONQ A;  1BOB A;  2QKM B;  1V5E A;  2R7O A;  3MD2 A;  3CF2 A;  3HXL A;  1FMV A;  3A4C A;  4II3 A;  4BDZ A;  4XON A;  2NOJ B;  4BE1 A;  1DGW Y;  2UV1 A;  4ZDO A;  4IZZ A;  4LIU A;  1X1A A;  2HNH A;  1WJ5 A;  3L2Q A;  5LD2 C;  4OWR B;  2R7R A;  1Z3X A;  2MAB A;  4NQW B;  5FRN A;  2DXI A;  2WAE A;  4II2 A;  4DGW B;  2RNG A;  4J00 A;  4CZC A;  2E5Z A;  2Z1D A;  4IQJ A;  2LY1 A;  2DT7 B;  1YX3 A;  3CZ6 A;  1OLT A;  2XC7 A;  2Q1Z B;  3L2U A;  2Q2E B;  4R79 A;  2KPM A;  4BU2 A;  3OS2 A;  2AQF A;  4RLQ A;  3LSK A;  4XN3 A;  3OMY A;  5CQE A;  1AA7 A;  1N75 A;  2XSJ C;  4XLC A;  1WJD A;  1X1B A;  2KZV A;  4PFO A;  2VL8 A;  2R7U A;  3C2G A;  3CJR B;  4DOZ A;  2RQQ A;  2IS1 A;  1Z21 A;  2GOM A;  4KIT B;  4XKW A;  2KDO A;  3D5S C;  2HDW A;  3A1Y A;  2HVS A;  4H4K C;  3K4C A;  2VQL A;  5HNF A;  4LIV A;  1NG7 A;  4C2U A;  5FRO A;  3W2A A;  4AU7 A;  2WAF A;  1HA8 A;  3FBN B;  3OYH A;  4ZYA A;  2F6C A;  2LRD A;  2V6E A;  2K9M A;  2E1M B;  4CCL A;  2OC6 A;  4XKC A;  3IAM 2;  3ZXS A;  2IGK A;  5HOO A;  1J09 A;  2FUG 2;  3HG9 A;  3S8P A;  3M1C A;  2L9N A;  3K70 C;  2K5C A;  3A2K A;  4RM3 A;  2V26 A;  2R4G A;  3VWB A;  4RM2 A;  1WJF A;  2MFZ A;  3OL3 A;  1V5F A;  2WA0 A;  3EUK L;  4HST A;  3K4J A;  3PUB A;  2A6T A;  4G6T B;  3FDY A;  2R7Q A;  3FKJ A;  3K4M A;  2R7V A;  3I9V 2;  4B3X A;  4B48 A;  3OYJ A;  4Y3O A;  2M0M A;  2UWM A;  4BE2 A;  3DTK A;  2A5W A;  4KJZ A;  4JOM A;  4HSR A;  3BC8 A;  3GBG A;  2VJ4 A;  2VXD A;  3DPT A;  2VPL A;  1DP3 A;  3OYL A;  2CFO A;  4CSW A;  2ELJ A;  3K70 D;  2O5R A;  2WB1 A;  2VKD A;  1MMD A;  3OYD A;  4E7K A;  2CS3 A;  3IAS 2;  4PUS A;  4NC7 A;  1G59 A;  1LDK B;  4IQ4 A;  2PJR B;  3OOU A;  4HRI A;  4XM3 A;  4C2T A;  3OYA A;  4B47 A;  2K9L A;  3DU6 A;  3DU5 A;  4U7B A;  2KRH A;  2PJR A;  3KX2 A;  2VQH A;  2LY2 A;  3HOS A;  3MMY B;  3KYL A;  2MYS A;  4HNU A;  1MMG A;  4NC8 A;  2HU9 A;  4PJM A;  4C30 A;  4ITV A;  4P1W A;  4XOP A;  4X0G A;  1KON A;  1MMA A;  1D0Z A;  2XDV A;  4P5O A;  3SEZ A;  3ZQQ A;  2E5N A;  2V1N A;  2IS4 A;  1FMW A;  1LVK A;  4OAZ A;  4BJ6 C;  2V9K A;  4BQO A;  2KLO A;  3BLY A;  2Z2S B;  2W00 A;  2CV1 A;  4XQF A;  4PJL A;  4BQN A;  2HVR A;  4NNJ A;  3OYK A;  4DJA A;  3OR1 C;  4AVZ A;  1UEL B;  3PJR A;  3K4N A;  4CA0 A;  3D5L A;  2DJI A;  3K4L A;  1P9Q C;  3H35 A;  1YX5 A;  2F4I A;  2X6Y A;  4F92 B;  4E7S A;  4PSW A;  1DGR M;  2ZSI B;  2OUM A;  2VXZ A;  2LYC A;  3ZRG A;  4F55 A;  1T0F C;  4BJT A;  4XLA A;  4F3Q A;  3DTI A;  4XOT A;  4J01 A;  1D1C A;  2MD0 A;  2UUZ A;  2LRE A;  1QHG A;  3I3L A;  2OV7 A;  3BCA A;  1NG6 A;  5KCM A;  1Y6I A;  3QYB A;  3VSK A;  1K6Y A;  1ZEL A;  4CCM A;  5HLT A;  3EUH C;  3OYN A;  4BEH B;  2CUJ A;  1S9H A;  1T95 A;  1Z3Y A;  3LL7 A;  4E6K G;  3HOT A;  3OYG A;  4D1Q A;  3S3O A;  3PNT A;  3N05 A;  4BEH A;  2WBM A;  2L7K A;  1W36 C;  1ERD A;  2R7S A;  1U0J A;  4HNT A;  4GRI A;  3BCB A;  4E7J A;  3QYE A;  1N78 A;  1MMN A;  3SEQ A;  4ZTJ A;  2WY7 Q;  5HNH A;  3U21 A;  2VQG A;  2JVH A;  1JI8 A;  1UAA A;  1PYV A;  1N77 A;  3H5A A;  4BDY A;  2M3A A;  1D0X A;  3VYR B;  3MKW B;  3RCO A;  4QPO A;  1UG0 A;  2CW8 A;  1LFP A;  3OWT A;  2IS6 A;  1OR7 C;  1DQU A;  1W36 D;  3PSF A;  4BUP A;  3C2H A;  4AYB A;  4BJ5 C;  4QPQ A;  3H5R A;  5LFA A;  1D1A A;  2WY8 Q;  3CP8 A;  3DQV C;  4BS9 A;  3D5R C;  3EUA A;  1EA3 A;  3K4B A;  4XKB A;  2JVG A;  3G2B A;  4KIS A;  3SDB A;  5CPR B;  4CCN A;  3OYF A;  2JSP A;  3MKY B;  1X19 A;  2KQR A;  3PSI A;  4JQF A;  2M4K A;  1GLN A;  2X6X A;  2XAU A;  1SAU A;  3UNG C;  3PFY A;  3DLA A;  3LFU A;  3HL2 A;  4EAT A;  2CW7 A;  4B44 A;  3H9J A;  3RTR A;  2V7F A;  2KRC A;  3PNY A;  3S93 A;  3OYB A;  2LG4 A;  1WJB A;  3HUG B;  2ZXI A;  3HPH A;  2VIX A;  4CCO A;  2Z16 A;  4DBQ A;  1YE9 A;  2X1C A;  4HG2 A;  4F91 B;  4E7I A;  4XN0 A;  4DBR A;  3PL8 A;  4KT6 A;  4PK4 A;  3H5N A;  2CH0 A;  3EPZ A;  3V42 A;  4CCJ A;  4HEA 2;  4XLF A;  2VLA A;  3SZG A;  4IKF A;  2M7A A;  4D9J A;  2QKL B;  2X1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...