2L9SA

Solution structure of pf1 sid1-msin3a pah2 complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
SNADYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PHD finger protein 12
publication title Solution Structure of the mSin3A PAH2-Pf1 SID1 Complex: A Mad1/Mxd1-Like Interaction Disrupted by MRG15 in the Rpd3S/Sin3S Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1860 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9sA00
2L9SA
chains in the Genus database with same CATH superfamily
1RRJA 1NTCA 2LG4A 1A35A 4BQNA 1USTA 2KL4A 3I71A 4UVCA 1Y0UA 5KK1A 1HXDA 2ISYA 3DTEA 2EJRA 3MZHA 1JJ8C 1SD6A 4L0YB 1ZHFA 1VZ0A 4A5MA 2BY3A 3AG2H 3DWLE 3BG5A 4LG0B 2XKPA 4XSZF 2OZUA 1O3SA 4HLXA 1HBXG 4NQWA 3WGIA 2QLZA 3RSNA 2DA6A 3HB9A 4HOBA 3E1SA 3IKVA 2EIKH 4A3MJ 3LA3A 1DPUA 1YIOA 4IQJA 1IO2A 2K40A 3KEQA 3G71I 2IA1A 1K61A 4A0ZA 1TWAJ 4LG0A 4PJ0C 3SEZA 1E3PA 4PUSA 1SVOA 4DYQA 2X0LA 4IX7A 2LYCA 1G3TA 2MD5A 3FISA 4RMNA 4F52A 4M71A 4XM3A 1MJBA 2RREA 2B9SA 4BJ6C 1XS9A 3DTIA 5BPDA 1LUJB 1RC9A 2FXAA 4X0GA 3CUQC 2ME6A 3MQ0A 5FKOA 1MGTA 1SVMA 3K6GA 3OYKA 4PGHA 4W97A 3R6SA 2V6CA 5K1YA 1UB9A 1ON1A 3BY6A 3CJQB 4ZYEA 1YJWI 1MW7A 1T2KA 2KDOA 1T8IA 5B3SH 3E6DA 1GLNA 5M3FJ 5HODA 4QLCU 1FZPB 2ECBA 3DLAA 3W2WA 2LLKA 2VPLA 2RQPA 2FUG2 2W84A 5KHDA 2F5CA 2HKXA 3FXMA 3HRMA 2I5UA 1R1TA 1WZ2A 1Z1DA 4KISA 2ID3A 6PAXA 1AU7A 4I99C 2BW3B 3OY9A 2E1MC 1LFUP 1RIOH 3GCMA 3BWGA 3F8MA 3LOCA 4U0WA 1IN5A 3J7YJ 3KETA 3HL2A 5TRDA 4E70A 2QKLB 5C4JJ 2H8RA 1CQTA 1D3YA 4OIQF 1ETQA 1FYMA 2UUZA 2ZMEB 4G12A 4XKWA 4II3A 4ENNA 3RKQA 3KX2A 2Z16A 1SAXA 2VC1A 4JP0A 2BW3A 2RAEA 4JK1X 4BAYA 4C2TA 2LP0A 4WF2A 1TQIA 5ICGA 1WJFA 1VQ8I 1IN6A 1SFEA 2WAQA 1BJZA 3ZN0A 3DPLC 3KP6A 3TEDA 2O61A 1ZQ3P 4D7MA 2EV0A 3PM1A 2ZMEA 2M0CA 2WB1N 2OQRA 2L9RA 2OF7A 4GO1A 2BVMA 5DV5A 3F8CA 3JRFA 2WV0A 1MBKA 5D6FA 3ZQGA 3CJTB 4HG2A 4NNJA 4F3QA 1AWCA 3KLOA 4AUXA 3ML6A 3S3MA 4KN7X 4C3HJ 3ULQB 1HKTA 4IXAA 2E71A 2QENA 1N75A 3BR5A 1IXCA 3OWTA 2XF5A 3OYNA 4HNUA 2ZKZA 3GUDA 2L0KA 4IRIA 1HW1A 2M0MA 1LQ1A 3CMMA 5TISC 1YITI 1MNDA 1XC5A 4CXFA 3L2WA 2P5LC 2FBKA 1Z3YA 4MLOA 4HZFA 1ZK8A 5K7ZA 1RKWA 3L2QA 3SZGA 1YFHA 1VQMI 4JOMA 4ITVA 3ABLH 1TBXA 1QQIA 2W00A 1R71A 4HNVA 1UJ8A 3J7ZI 3PQJA 3BTLA 3DPUA 2K9NA 4J00A 3BCAA 4M6VA 1BW5A 4ZH4F 4RS8A 3NWTA 3HOZJ 1A5JA 2XGXA 4L9TA 3VSKA 5ICFA 3PO3J 1IV8A 2FE3A 4CZZA 1U3EM 1IN8A 4RGSA 4DYCA 4OMZA 1R22A 4DNCA 2FRHA 3ZMSA 5EEGA 3EYYA 1D5YA 3FKIJ 3KP5A 1X19A 2V6EA 1XD7A 3H9QA 3A0BC 3HOTA 1NG7A 4RAFA 2VASA 5ED4A 1XSDA 2KLOA 3Q0WA 3FK6A 2PJPA 5KCMA 2EZHA 1HC8A 4M72A 3HOWJ 1S29A 4II2A 1K4TA 4XLCA 4XLPF 2HXIA 2C6YA 1QRYA 1K7AA 2L9NA 4P9UA 4KIBA 1E3HA 3I4NJ 4HPQA 3VYUB 1XCBA 4HX8A 3FXQA 5HS8A 3QU6A 2JVGA 4UVBA 5IOYA 2RGVA 4GRIA 3CMAI 1JKOC 3F6OA 4IEJA 3IL2A 2DBBA 3TW7A 2OTJI 2K86A 1S9HA 2QM3A 4RM3A 5CVJA 4A5NA 2FMYA 2M30A 1BA5A 2KFDA 2BEOA 2DMUA 3JRHA 4CCOA 2JA8J 5IYBJ 2KJCA 4JX6A 1FWZA 5LHIA 3E0JB 2L02A 2Z1DA 3HG9A 3IRRA 1BI3A 4LK1F 5J8FA 1Y56A 4B3AA 1MSFC 1ERDA 3WTTC 1R58A 1G6NA 3ZPLA 5FLXZ 2DA5A 2M34A 5IOZA 3A01A 2PMUA 1OKRA 4BQAA 2PMZA 3EUHA 1FTZA 3CCRI 4CCKA 2PEXA 2K9SA 1YLFA 1J09A 3OL3A 4ZC3A 4PJLA 2ZMEC 3HJEA 2GLOA 3FHNA 2HEOA 5L3BA 2LY1A 4Q5SF 4UB6C 3H5AA 2VLAA 3BG9A 5FD5A 3DKXA 5F0CA 3W6JB 3CDIA 1JT6A 5M3MJ 5KVRA 5J1YA 5D8LB 5CYVA 3ZMUA 5FLVA 1B8IB 3EYIA 4PJMA 2COMA 4ZDPA 1X4PA 4HQMA 3UR3C 3VYSB 1YTYA 2DU9A 3Q9VA 2ZXHA 1V54H 2QCOA 2HQAA 2XGDA 1ZKGA 3AAFA 4H4KC 2R7FA 5JHUA 1X1PA 1KQ0A 1B8IA 1ON2A 2VOOA 1VTNC 2J5PA 3IAS2 3IH3A 1W1WE 2IA2A 2ISZA 1PVEA 5HLGA 2ZXJA 1RR8C 2LH9A 4FE4A 2CU7A 1GVDA 1DGWY 1XGOA 2HOSA 2EK5A 3FIWA 1RKTA 2EA4A 3MKWB 3HEFA 3A0HC 4CHUA 2GXBA 5FLXK 2F2EA 3ZR8X 5DEQA 1I1GA 4RB2C 3KFWX 2CGPA 3KLNA 2K3FA 4A6EA 5IPAA 4I6ZA 1S6LA 4RB1A 4AVZA 1D1BA 1D0YA 4XLHA 1HF0A 2DAOA 4QIWN 4GXOA 2A68F 2EZIA 1AOYA 1CGPA 1G4DA 2KIFA 4HLYA 1BOBA 2RKHA 4B4CA 5HNFA 3LFUA 2R7WA 4JBAA 2R7DA 4XLAA 1U8BA 1U9NA 3M4OJ 4M6YA 3F3XA 4YELA 3IP4B 2ZJRF 2VJ5A 1G3YA 2MH2A 5DTDA 3L1PA 4MIMA 1OCTC 1MJAA 1TWFJ 2EIMH 3BZKA 1LE8B 3CCSI 2PJRB 2V9KA 2JUCA 1XMXA 1XX5A 3D0SA 2F4OB 2F4MB 4KICA 2UZKA 4ZTJA 1IRZA 3NRVA 3CMEI 1Q1VA 2FOKA 1E17A 4U88A 1V3FA 2EZKA 3OYHA 2E34A 1N78A 1YW8A 2QQ9A 5J1RA 2VT2A 3IKTA 3ZMZA 4M74A 3LAPA 1K4SA 3BG7A 4UUVA 1EF4A 4EQQA 2H09A 4S0HB 1FYKA 2HZDA 1C0WA 4NHJA 1IC8A 1LE8A 1QBJA 3MZYA 2MW8A 3S32A 3GTMJ 4IOCF 1LDDA 3F21A 1HKQA 2N8GA 3LWFA 2R7TA 2FMLA 1W7PD 2D1VA 4BJ5C 4F7ZA 1YO5C 1A36A 2KIUA 2RN7A 1DP3A 4HF1A 2M8GX 1DDNA 4ZYHA 1IRGA 1JXSA 3KP7A 4ESJA 4YEJA 2GOXB 2LF7A 1ETYA 2HS5A 2BY0A 2X85A 3VDXA 3RPUA 3ONQA 4G6QA 1T0FA 5D5XB 3PL8A 3T8RA 3DTKA 2XF6A 3EUHC 4PJJA 3QQAA 1OYWA 3L09A 4AYBN 3PQKA 4J01A 4ABZA 2XF7A 2JQ7A 3G1MA 2Z3YA 2FBIA 3EQLF 5JHFA 2PFBA 5FFXA 5BNGA 5H2FC 3TOAA 4XRSA 2R93J 1JTXA 1NG6A 2X1DA 2Q8KA 3QWLA 3ZCOA 4XLEA 1ETWA 2X6OA 1BI2A 3P7NA 2DA2A 2JT1A 4KMUX 1UELB 3ERMA 4U0YA 5E8IA 2K9QA 5BMZA 5F0HA 1W5TA 2BYVE 4Y17A 3HOSA 2PI0A 1O7FA 1ZRCA 1HW5A 1Z7UA 4BHBA 2P7CB 1OCPA 1OLTA 3QAHA 5AONA 1LEBA 4XK4A 3QPTA 1SD7A 2VKVA 2F5EA 3BJOA 5B66C 2VJIA 2PG4A 3AG1H 1IRXA 2XRLA 5M5YJ 3GLXA 1P4WA 4AU7A 4U7BA 4ANJA 5GAGJ 4IHVA 2R92J 1VFCA 2ME0A 3RKWA 3HSFA 3BZCA 3UNGC 3DXJF 4ZJZA 5HDNA 1K83J 2LK2A 1Y39A 3JRIA 1W36D 3G6EI 3HOYJ 4LFUA 4WX9A 3GYHX 2DXIA 2LRDA 3K10A 2IGNA 1IN7A 2HR3A 1I39A 1ZLJA 2GZWA 4XOPA 5GPAA 5IP6A 1SEUA 3LNQA 2R7SA 2V4JC 3NEUA 3LSRA 5JFRA 1Y1VJ 1OQYA 4ZYDA 3OS2A 3MVPA 1MJ9A 3QP6A 5AIPA 2ZB9A 1D1CA 4NBQA 1A31A 3F9KA 3LMMA 2ESNA 1QPIA 3W6KB 3ZMTA 3GO5A 3OL4A 3BCBA 1FBQA 2IP2A 4CZCA 1WJCA 1WJAA 5FRMA 2KRCA 4ENKA 1L3LA 3W3CA 2QGUA 3CDLA 1DU6A 3K1NA 4M9SA 1X3ZB 4S04A 1O3TA 4ESBA 1FOXA 3E7LA 1VQ6I 2XPVA 2FX0A 2LFBA 1I6HJ 5HS9A 1X3UA 3KIOA 1MBGA 4KT5C 1TT0A 1MBFA 3MMYB 1X1DA 1MSEC 4PK4A 2DT6A 2VC0A 4IZZA 5EEHA 1X58A 2W57A 2DFIA 4YRVA 4XKBA 3U2RA 1LFBA 2XAHA 4FTHA 5LFAA 1IW7F 2HKOA 2ICWG 1WRJA 2A5WA 3FKJA 1SAUA 3BLYA 1MIJA 2E2JJ 2NNYA 4BH9A 3FF5A 4MQVA 3WHCA 1PP7U 5JVGF 1D0ZA 1QPMA 3S2DJ 1IXRC 2M4GA 2HQ5A 4ON0A 2IS2A 1P7JA 3JRBA 1F1ZA 1T08B 3SXYA 2ZFUA 3VOEA 1Z05A 4EATA 3CC7I 5EF6A 2FJ1A 2DTZA 4BHPA 2R7QA 1YRNB 3V8JA 4BYYA 1AKHB 2YR2A 3CCJI 3CP8A 3DKYA 1HSTA 3GFMA 3K4JA 3TMOA 2DK8A 1J9IA 5B5EC 3K4NA 3WU0A 1YW7A 4EMSA 3HTSB 3M7GA 3LSHA 3CDHA 2VBZA 2HVRA 4G9YA 2BE5F 1SFUA 4A3EJ 2L5QA 2K9LA 2VQLA 4PSWA 3VEPA 1AKHA 5FKLA 4E6KG 3BQZA 1XMAA 5CVIA 3TO6A 5GAHJ 1ZN2A 1MMAA 2JSCA 3KPHA 1D8KA 4WCGA 2DT7B 4L9JA 3QOEA 5ILSA 3I53A 2L4AA 5A2QZ 3S2WA 4KIFA 1KU7A 5FROA 1BI0A 1R7JA 2ZCWA 2DMQA 3HDDA 2BY1A 1IUYA 3V7SA 2L4MA 2R3SA 4PSXA 4C30A 2F4IA 5E1WA 2K7LA 3LAJA 3BG6A 4M9ZA 2E7XA 2TDXA 1UHWA 2VBXA 2HQNA 4RLFA 5B1AH 5E3OA 3V4GA 2CUEA 3S3NA 4XLNF 3PIOF 3OOPA 2ETHA 4XRMA 2CV2A 2X51A 4Y13A 4GYIA 4A0XA 2W82A 5IYDJ 1RPWA 4BE0A 2CH0A 4ENMA 3EETA 2O8XA 3K69A 5KAIC 5E3LA 5J1UA 3WTZA 4Y7NJ 4LLGF 2IW5A 1TQMA 1YW9A 4FETA 3KZYA 4NC7A 3CQZJ 3OS0A 3F6VA 3I0TA 3IH4A 1Y8RB 4OWRB 3CMYA 2F48A 2IGKA 1KA8A 5J4VA 3DP7A 3SHFA 3FM3A 4KITB 3D5SC 4FX0A 2WAQN 1T56A 4G94A 1JUPA 1ZGWA 3BPXA 2EZLA 3QOPA 2LNBA 3ASNH 4ZYAA 4Y33A 2X9DA 4HDUA 2ZC2A 5C3EJ 1DP7P 1Z6TA 1MBJA 4IO9F 1XGSA 4E7ZA 2XPWA 5A2QK 2RV8A 1GV5A 5FFZA 2L2OA 1N25A 2FD5A 4BY7J 5IYCJ 5DUKA 3LSKA 4I01A 2CFOA 2JPBA 4I7HA 1E2XA 1R1UA 4IRGA 4ZYGA 1VQ7I 4Y52J 3Q5FA 5LGNA 4BHCA 2XV4S 4DGWB 3G73A 1MZBA 2EINH 3CC2I 3HPHA 1SFKA 2VI6A 3GFLA 3CLQA 1YS6A 2M45A 3WTSC 2P81A 5LGUA 3PNYA 3LA2A 3V42A 2CMPA 4Y3OA 4MEXF 4G6DA 1W5SA 3SEQA 3P9KA 1LKXA 3I4PA 4PCQA 4Y4RA 2JJ7A 1YJ9I 1MBHA 3ZQCA 1E0EA 4LMYA 1YE9A 3DF8A 5H6QA 2V1XA 5F64A 4KJZA 4I09A 3A1YA 4KN4X 1Z3XA 3H36A 3MAJA 4P9FA 2VN2A 4Q4ZF 2JA6J 2ZO4A 3ZP5A 2E7WA 2XAGA 1OYIA 2L7FP 3AG3H 3M07A 3IWZA 2DTRA 4BJTA 2ZNYA 2QSFX 4UXNA 1Z6RA 4JYKA 3B02A 2B7EA 3LSTA 1A6QA 1Y6IA 5LGTA 3I58A 1GVJA 1WVRA 3ZQ7A 4RGRA 4RAZA 2GWRA 3FWEA 4UV8A 3L7WA 2P5VA 3ESWB 4DYRA 4X1EA 5K5RA 2F5DA 1ZH5A 2DLLA 1IZ1A 5DD4A 2EQRA 1QZEA 3H9GA 5E3NA 3HHGA 2HTSA 1FBUA 4Z6YA 1IV6A 2Z9OA 3ROUA 2KT0A 4HSTA 5D8KB 3QPHA 1JKQC 1JKPC 1V5GA 2MC3A 4Q47A 2DOAA 3ECOA 3LQRA 2R7OA 2X4HA 4OAZA 2AXLA 3MKYB 1VQ4I 3CO7C 3GTQJ 5FO5A 2Z5UA 1TWCJ 1X4OA 4FQGA 1S72I 2HFHA 1ITYA 4YFKF 4MFEA 3OYEA 1T33A 1JE8A 1JT0A 1PUEE 4D5CA 3CF2A 3DBRB 2OBPA 2O3FA 2GXGA 2CQ7A 5C44J 1SC7A 2MABA 2E19A 2ELJA 3QODA 3F8NA 2PMZN 2Y0SA 2EV6A 3E6BA 3WODF 1QHHD 4BACA 2NVUB 5BS6A 1SFOJ 3GZ5A 2JVHA 3GMEA 1XG1A 3ASOH 3HC7A 3HBLA 4LITA 1FOKA 4CUGA 4XN3A 3FXJA 1WH7A 3TL4X 2UXNA 4B1RA 2KJBA 2MLKA 1ZTRA 2VT3A 4D0PA 2ACJA 1AHDP 2IS1A 4LIVA 1OCOH 1TQPA 1Z21A 2V1NA 2GXAA 2NS0A 1AA7A 1LEAA 2BBYA 2DA1A 4FX4A 1STZA 3JW4A 2ECCA 3OYMA 1IG7A 1UFMA 3DFGA 2HYGD 5DYMA 2NVTJ 2CG4A 5JR3A 1QVTA 1ZG1A 4QPOA 2YS9A 2TRTA 1T98A 4BBRJ 2W25A 4RB3C 3OSFA 3OYJA 2HOEA 1QVUA 5JLXA 3FMSA 1O7LA 3H35A 4HQEA 2J5OA 4LJZF 2STWA 3E3VA 5ILUA 3FXUA 3O6BB 2QEXI 1L0OC 2QUFA 4M73A 2E5NA 3WU1B 3OSGA 2OTLI 4BDYA 3C1DA 4GDFA 3FMQA 2CYYA 4HX4A 2IS6A 1QU3A 2CQQA 1RR7A 4ESFA 3MEXA 2JPCA 2JMWA 1I5ZA 1FC3A 2P0WA 2K3PA 3HOVJ 1ACIA 2LDUA 3NARA 1QNTA 1ENHA 3L2VA 4M9XA 3M1CA 3GZNB 3Q3SA 5E3MA 3S16J 4BKXA 1J5YA 2ZJPF 5F1JA 1XGMA 1UAAA 3H5RA 5IY5H 3S1RJ 5LLQA 4DW6A 4KNYA 5C4XJ 3X2QH 1SMYF 3GTKJ 1ZGJA 2HNHA 3JRCA 1FSEA 1FT9A 3GTPJ 3DU6A 1Y0NA 1IGNA 2WADA 3HRTA 2CSOA 5E1XA 2VKHA 1B1BA 3JREA 1I27A 4XONA 4HSRA 5HS7A 3S3OA 5M5XJ 2A05A 4MGRA 1BI1A 2Q1ZB 1HCRA 2O8KA 2R7ZJ 4IOAF 2ZSHB 1PUFB 1VQLI 4AIDA 5EGOB 2BY2A 3R60A 5BPIA 1ZYRF 3WHBA 2WAFA 1K78B 4LIUA 4L0ZB 2KKOA 3FXOA 2A69F 2OJED 3TDZC 2L01A 3K0LA 3W6VA 4G7OF 1D1AA 1IF1A 4XKCA 3H5NA 5L3EA 2XRNA 2PMHA 4IQ4A 1WGXA 3DV8A 1I3QJ 2QQ8A 1V4RA 1B4AA 1R36A 3FBIB 2V1DA 2E1NA 1FY7A 3ELKA 2AS5F 1IN4A 4MEYF 3LSJA 3P5JA 5EGOA 1HDPA 3V8LA 2KMUA 3HTUA 3KP2A 5F0FA 5GP9A 4OMYA 1K78A 2DI3A 2Y69H 3OYFA 3CJNA 3W2VA 3DPTA 2R7VA 2E60A 3HOXJ 2KDZA 2HYFA 4N4OB 5EG0B 3C2BA 1XCVA 1DPRA 1FIAA 3I9V2 3S14J 3WTYC 3G1OA 1G3SA 4AM3A 2E35A 1MNEA 3ZXSA 3FZVA 2M7AA 1J59A 3Q9SA 5GTIC 2KZVA 1W5CC 1X3WB 4C2MJ 1JI8A 3H0GJ 1ZRFA 1JHFA 1QA6A 1LVAA 3E6MA 2EFOA 3I5UA 3P9CA 4OAYA 3N97A 3VODA 5LEJA 3K7AJ 1CF7B 5EG0A 1Y1WJ 4IF4A 3KCCA 2NVQJ 2IVMA 4B3XA 2BXYA 4XKVA 3D1NI 2M4KA 3BR2A 5J6XA 2R7XA 2LC2A 3F0CA 3CCVI 4EJWA 2LKPA 3CLOA 1TLHB 3K4KA 1FBSA 4IPAA 2WC2A 3AG4H 1FSHA 3G1LA 5DS9A 3C3WA 1CF7A 4IKFA 2ELHA 3BR3A 2LMDA 4L18B 2P8TA 2JN6A 1TNTA 2OCCH 3K2ZA 2W48A 2STTA 1B6AA 1JUSA 3VYRB 2OQGA 4ZZDA 4CCLA 2QQAA 2XVCA 4BXUA 1ZRDA 3MCZA 4L9NA 3LSPA 2ID6A 2HGCA 2L9VA 4HEA2 3MKZA 3WTUC 5EZGA 1H8AC 4R79A 2QBYB 2XGCA 2CUJA 1BC7C 4HNTA 2CWEA 4OOIA 3E5QA 2X48A 2XAQA 1W0UA 4AD9A 1U5TB 3GLLA 4L5EA 2O03A 1TNSA 1W7PB 3BTIA 3G2BA 4C3IJ 1ULYA 3GVAA 3IUOA 2OCEA 4CYDA 2EPFA 4XN0A 5LRSA 4CCMA 4B48A 4XL9A 4UHTA 4RDUA 4ZDOA 4A3IJ 3TDUC 2QBYA 3HPGA 3PFYA 2HZTA 2DA4A 4BXFA 5GADJ 3OYDA 1V5FA 1LNWA 4A3DJ 2V7FA 3CCLI 3PFIA 2VJ4A 2UXXA 2PJRA 5AIQA 3ZQHA 2A07F 4RM2A 1U5TA 3HUGB 2GOMA 2DDBA 1FMWA 2UV1A 3QP5A 3WG7H 2P5KA 1W7PA 2CUZA 4U0VA 1UHSA 4TV7A 4Q48A 2JA2A 3SZTA 2HI3A 1MD0A 4KIGA 3ZQLA 3T8TA 2I10A 1R5ID 1T38A 5DUIA 4AC0A 4IJAA 2NOGA 1YQAA 1XB4A 3CJRB 3PNTA 5F04A 1HW2A 3TBIA 5KAFC 4WXDA 2YX4A 4U7DA 1U78A 1KU2A 1GXQA 2K4JA 5F1RA 2DMNA 3HYIA 3SDBA 3HUGA 2CJJA 2VOPA 4B09A 4OIPF 2MH9A 1YX5A 2IJLA 4ZDLA 3MD2A 1NHAA 1PP8F 2CQKA 3E5UA 3O8GA 4M6XA 2MG4A 3F23A 4BY1J 1FPQA 1T6SA 1BIAA 4YG2F 3BP8A 1HQCA 5DM7F 4A12A 5ICEA 2Z99A 1XDUA 2FBHA 3QYBA 2LREA 3C7JA 3HM5A 3Q0VA 5D6EA 4IRHA 1K6YA 3QYEA 4LD5A 3M8FA 5D5WB 3W2AA 3IH2A 3OYCA 1KYZA 5FKNA 4XORA 3K9TA 1LJ9A 1UG0A 1D0XA 3PSFA 1XPXA 2F6CA 3WTVC 2MFZA 2RVCA 2O7OA 3H9JA 2HTJA 3AL0B 3CCUI 1QGPA 4BQQA 3CP2A 3F8FA 4A3BJ 2UWMA 1WCMJ 1FJLA 3ABUA 4LG3A 2IPQX 2OPTA 4BNCA 3REOA 2DK5A 3M8JA 3I59B 2HDWA 3FM5A 2W85A 3DEEA 4LLLA 4DJAA 1TW2A 3GX4X 2PLYA 1Z77A 4UB8C 3T5XA 5L3CA 5LHHA 3UKGA 1WJBA 2PBIA 2A6TA 2FEZA 3EUKL 4RGXA 1HLVA 2VBWA 5DCFA 5TJJA 3JAMK 4KFCA 1J7KA 3HHHA 4DZJA 1P4XA 2ZXIA 4FISA 1BBYA 1I50J 1VQ9I 3I3LA 1ONVA 2NNNA 1S7AA 1J75A 3DBLB 3RYPA 2E5ZA 1XTAA 3I59A 3CESA 2DYRH 4D5FA 2H27A 2FU4A 3CZ6A 1X1CA 2GIVA 4PFOA 3ECHA 1WI3A 3ABKH 3VPRA 4OU0A 2ZNZA 1X2NA 2VJJA 1SVLA 3BTCA 4V19K 3E5XA 3B6AA 1G59A 1USSA 2E36A 1MMNA 1UG2A 2NAZA 3C2HA 4FE7A 1K6OA 3F72A 1WSUA 2DOEA 4CYCB 2MD0A 4XMYA 4BXXJ 4A3FJ 2GM4A 1VQNI 3HRSA 3JTHA 1RESA 2DO7A 1O4XA 4P5OA 4GYGA 4YFNF 2BHYA 4XBFA 4CCNA 1EV7A 3RCOA 4EVIA 4IHTA 3LQQA 3FXLA 5FD6A 2R5YB 4KT6A 3L2CA 1WH5A 1UMQA 2VXZA 3KEOA 1VF9A 4CYCA 4OIOF 3DKWA 2DODA 2H6CA 1EA3A 2JWTA 4WWCA 1T0FC 4V2FA 4G7ZF 3RZDJ 1U8RA 2O6GE 3M3YJ 3ISPA 1XN7A 2EFNA 2YUSA 1GT0C 3IWFA 2R5YA 4P55A 4LLNA 3BC8A 2WY8Q 1LPQA 1EKEA 2VIXA 3VFZA 2VONA 5DCMB 2JSPA 2HQRA 2KP6A 2YPRA 5JLWA 2CV1A 4NDLA 5FKKA 3E97A 1RUNA 1H9GA 2VKEA 5K7HA 2XB5A 3L9FA 1T95A 1P92A 3MKLA 2Y2ZA 4B47A 5K5QA 1LDJA 3FXRA 3GBGA 1H88C 1JGGA 2EBIA 1ZR2A 1YRNA 3DEUA 3Q0UA 1OCCH 1J0RA 3BR0A 1DGRM 3OOUA 2DW4A 2B0LA 1VNDA 1Z9CA 4KYWA 3PSIA 5DCMA 4QSHA 2VB6A 2W4SA 3R4KA 2E1MB 2EFQA 3ERED 1TL8A 3O3KA 3ZRGA 4LOCA 1ZAOA 1MBEA 5HLIA 1OCZH 1BJAA 3T1BA 2YU9J 4GGGA 4MQ9F 1R23A 3K2AA 4QPQA 1KU3A 3BPVA 3CCQI 1R1VA 1IRFA 4RAYA 3BJ6A 5DM6F 2FQ4A 4MTEA 3MZ8A 1W36C 1ZR4A 5E20A 2NS7A 4J19A 3RQ4A 2K9MA 2LVSA 2HPMA 2EB7A 3A2KA 1B59A 4EGZA 1NK3P 3AL0C 3KEYA 2D45A 1KQ8A 4PZJA 1MNMC 4CCJA 2NOJB 1F9NA 4NC6A 4C2UA 4UNOA 1OMIA 4G8XA 5HDGA 1MKMA 1X1BA 2COBA 1BN5A 5CPRB 1APLC 1ODDA 4RLQA 1I3AA 1PDNC 1FTTA 3JTGA 1DU0A 1S7OA 1HDDC 3GF2A 2XAUA 1GV2A 1YG2A 2VQCA 3WG9A 2M9HA 1XGNA 3I55I 3J7AO 4E7SA 4JQFA 3CCYA 1SMTA 4YIRX 1KQ9A 1TP4A 1TWHJ 4A3CJ 4ZZLA 1H0MA 3WE3A 3CCEI 1HOMA 1YJNI 3WGHA 2Y0SN 4R1HA 4BL0B 2FQ3A 2AO9A 1D5VA 4JX5A 3K1PA 2VL8A 3TP3A 3AKZA 1B9MA 2H8WA 1A6IA 3S1MJ 3ZGKA 3FK7A 3RKYA 1TC3C 2EH3A 3H3UA 4KUMA 4PDKA 1SD4A 1ZG5A 4WXCA 5J8CA 1MH3A 2CW7A 1FIPA 5EJCA 1ETKA 1KU9A 3SYTA 2KISA 1IJWC 4N4NB 2HOTA 2XKOA 2GIZA 4YFXF 1X2MA 2Q0OA 5CVVA 1EH8A 3I64A 4RBOA 2DPDA 3PNVA 4A6DA 2EV5A 2X1CA 2A5YB 3RYRA 2M5WA 4XLFA 5CVRA 2JA7J 4MNUA 4XNFA 5BOXA 5HOOA 2XB0X 1BW6A 5E1ZB 4E7HA 2HYJA 1DUXC 4W1UA 2WA0A 4HX7A 3RIRA 1HKSA 3S2HJ 1G2HA 4V2GA 4G7HF 1ZARA 4M3FA 3O8HA 1WI9A 5CQEA 3U9GA 1YI2I 2HDDA 3AFHA 5F08A 4DQ2A 1VQPI 1FX7A 2OC6A 4CDGA 1R5HA 3V7CA 1LB2A 1OFCX 2MGQA 2QYOA 5DDGA 4B43A 2AQEA 2W24A 2M3AA 2QVOA 5FKMA 1JJ6C 1ETXA 2LF8A 2E2HJ 4IHYA 3ZN1A 4HA8A 1WJ5A 1D8JA 4DOZA 1GDTA 5E18F 2CQXA 2M1BA 3H1CA 3H3ZA 1W0TA 2HVQA 1ZLKA 3K1MA 1X1AA 1R49A 4CSWA 1JKRC 2JRMA 5E79C 2MLGA 3M8EA 1ETOA 5FRNA 1KONA 4HBLA 5ILVA 1EH7A 1N77A 2Q2EB 3EUAA 3DLLF 2XASA 3OS1A 2DFEA 3JCUC 5E17F 2JZYA 5F6FA 1P7IA 3H92A 4XIDA 1YS7A 3K70C 2QSGX 2M7BA 1B72B 1FEXA 2FF4A 5FGMA 2OU2A 4P1WA 3WU2C 3V7RA 2XC7A 3F22A 2Y9ZA 2DJIA 3PUBA 2QZ8A 2R7UA 2G0EA 2ADUA 2F5FA 4NUBA 4I98B 3WTXC 2DMTA 1LDKB 1UCRA 2H6BA 2G7UA 3KE2A 4QWQA 4XQFA 3JRDA 4I76A 1MMDA 2DDAA 2Q2EA 4S05A 2BVLA 1F36A 3HKZA 1B9NA 3CTAA 4L9VA 1IXSB 4ASNA 2EA2A 3KP4A 1P2FA 4U87A 1ZG3A 1B72A 2IBDA 5L3GA 2E2IJ 2OUMA 2ZSIB 1H9TA 2GA2A 3CO6C 1GHCA 2QQBA 3C2GA 1YX3A 2QWWA 2X6YA 1YOVB 2VE9A 3OYGA 3FX3A 1KGSA 3R0JA 4E4HA 2EWNA 3ZOBA 2IXSA 2LBFB 4BBSJ 4A3GJ 1WQ2A 4HW0A 3R0AA 3GTJJ 4O3MA 1XMKA 2OV7A 1MMGA 2OD5A 1Y8QB 2H1KA 4LB6B 4LGWA 4I02A 2KQRA 5H20A 1Q1HA 1JTYA 1GXPA 2MBFA 3ABTA 1BM9A 4EJVA 3HRUA 4MFDA 4HF2A 2RC4A 1PYVA 2CS3A 5B1BH 4Z2YA 4BQOA 1Z0XA 2LBFA 3OR2C 3GW2A 3MN2A 2PQ8A 4XRSG 1SANA 4OIRF 3IAM2 2I8DA 1SD5A 3TO7A 1RNLA 2DA7A 3GTLJ 1XSVA 2BV6A 4HAMA 2IA0A 2V9PA 4MHGA 3K4CA 4LK0F 3O2PE 4XICA 4CGZA 2L9SA 2PX9A 4R8HA 2DA3A 2KHMA 2RNJA 4XR6A 4KMFA 3RI4A 3S15J 3K4LA 2Z33A 2L54A 1FMVA 1Z91A 1VQKI 2JTVA 4B8XA 3GFIA 3DBHB 3M1EA 4M3DA 2CQNA 4HV6A 4A3JJ 2RDPA 4MO7A 2RQQA 1FNNA 2CRGA 3TQNA 4RA2A 1GUUA 3MWMA 3TKYA 1FOYA 3J80Z 2QF7A 2M87A 2P6SA 2Y30A 1ORKA 2XGEA 1WJDA 2WTEA 4IL6C 3BDDA 2NS8A 2NRAC 2Y48A 3OIOA 2WY7Q 4XRFA 3GTOJ 3G4SI 1OJLA 2LR8A 3KZZA 2V79A 1W4MA 4UUTA 3DEWA 4N0BA 1K79A 2IGMA 1SFXA 5CLSA 3RJPA 5GAEJ 9ANTA 3CF5F 1F4KA 5HNHA 2CW8A 1RZ4A 2XAFA 2X6XA 1FLIA 3PO2J 1U2WA 1R4MB 4AVPA 3A01B 4XSXF 2O5RA 1PUFA 1MMSA 4FCYA 1FYLA 4IHXA 2KRHA 4I0BA 2W7NA 3A02A 1UZCA 2RNGA 3GZ6A 5GPCA 2VPRA 1I1SA 1ETVA 1OR7A 1O3QA 4IHSA 4D7NA 4EV0A 4D9JA 5DD8A 2R7RA 1IAWA 4OINF 5FJ8J 4HRIA 2MSYA 4DIQA 2BHZA 1S8NA 3IV5A 3RTRA 4BEHB 2WB1A 3D5RC 2FNPA 3OIPA 3BR6A 3ZMDA 4PJNA 2WWYA 1U0JA 2ZJ2A 5EYRA 3I56I 4A0YA 4A3LJ 4JX4A 2XUBA 4O6JA 3A4CA 3J80K 3E6CC 3B6CA 2V9VA 1R00A 2VBYA 2WV1A 2YX7A 5D4RA 1RUOA 4L5JA 1RETA 2KIQA 2XSJC 2KPMA 2EFWA 2HDCA 4BEHA 2NYXA 1OYYA 2BXZA 3JR9A 3HXLA 2DT5A 5LEKA 1TW3A 1S7EA 3FBNB 1BOAA 5D4SA 3LSIA 2BOLA 4X6AJ 1QZZA 3EDPA 2DN0A 3T0YA 3U21A 4KDPA 1V55H 2X1EA 3FDYA 5EDNA 3TOBA 4AWXB 5IP7J 1R9TJ 3DU5A 1O57A 3SZPA 5K5OA 1QO0D 5E8GA 1IDYA 3S1NJ 4BDZA 2Y31A 1BR2A 4DZPA 1MH4A 2A61A 4GCVA 4E7LA 2IEKA 1UHMA 3H3VK 2GQQA 1LVKA 3ZQFA 4Y15A 3GTGJ 2WAEA 3S17J 3COAC 4IVNA 5L3FA 1BR4A 3WE2A 3KYCB 2XROA 1YYVA 5HDKA 3BG3A 3NAUA 4E7JA 3IHUA 5J4YA 1S5LC 5CJ9A 1IUFA 4AIJA 3RZOJ 4EM1A 2K85A 2ZXWH 3VB2A 3J7AY 4YIFA 3PJRA 1OCRH 5CQGA 2VKDA 3LA7A 3HOUJ 5LD2C 3CCMI 2LOOA 2OAZA 2CV0A 2E1CA 1WWXA 2DFHA 3K4BA 3U1DA 1FP2A 1PJRA 2L3DA 3BZ6A 4YIIA 1WKMA 1A04A 2IS4A 4CO8A 3PUFA 4ETSA 2F5VA 4HF0A 3LL7A 2M2EA 2BZTA 2JA5J 4UUSB 3HSEA 5M5WJ 2XAJA 3N4MA 4BGDA 2L7KA 3NWSA 4E7IA 1ZGAA 1NH3A 4WXHA 2FNAA 4M3GA 3IRQA 2NXNB 3CUOA 4ZTFA 5IT9Z 3IC7A 4UY8I 1EJ9A 2ZJQF 4C3JJ 5JI6A 2AHQA 4P96A 2K4BA 3LSGA 3I54A 2R5ZB 1OR7C 2LY9A 3JAMZ 1LFPA 3RKXA 5HLTA 3OYBA 3J81Z 2Z2SB 2K5CA 2MC4A 1U6GA 5L3DA 1Z67A 3MFKA 4UUSA 2WBMA 1T39A 3KZIC 2CO5A 2D5VA 5IP9J 2YU3A 2JUGA 3S1QJ 3G3ZA 2B63J 2VODA 3RPUD 1QZYA 2OZ6A 2O9LA 1REPC 2XHKA 5ICCA 4HDVA 3HIFA 2R5ZA 1HSJA 4AIHA 2Y75A 2QSHX 1EH6A 1HA8A 4AIKA 2LY2A 3L00A 1OISA 1POGA 1G8XA 2IGOA 5J47A 3N05A 5LHGA 4BUPA 2HVSA 4L5IA 4A3KJ 1OPCA 1V5EA 3SQNA 2ESHA 2FA5A 2IRFG 4F55A 4FHTA 4A93J 3FXKA 4F92B 3DQVC 4DBQA 1E3OC 2XSDC 3OIQA 3RPQA 4BS9A 1KZHA 3OYIA 3ZQIA 5FLMJ 4RAGA 5HLHA 2DYSH 3R61A 3L2UA 5EEAA 3L2RA 5IT9K 2EIJH 5J3LA 1WFXA 1RI7A 2PN6A 2JK3A 3BROA 4EEFG 5LRRA 2LKXA 1NK2P 3BQYA 2K02A 1FP1D 4RGUA 5IT3A 2VUMJ 5LBQA 1R6RA 5KNLA 4LB5A 4EJTA 2DPUA 3J81K 3OR1C 2IT0A 4N9HA 1G3WA 4I2OA 2W1OA 1I6XA 2Y0MA 2L7MP 1M1EB 2CUFA 4KA4A 1BIBA 4N9IA 3GFJA 3JSOA 2BGCA 2GAUA 1JUMA 3QRFF 5JVTA 2HWVA 4MTDA 2D1HA 2KIMA 3QYFA 3RQIA 4IHWA 4D1QA 4I0AA 3KP3A 3CC4I 3VWBA 5BQTA 2OA4A 1DQUA 5H6RA 1TT5B 1FOWA 2K27A 1WJEA 3LFKA 2LD5A 3GXOA 2A6EF 1P9QC 2P4WA 4QTRA 5FB2A 3WGGA 1TZLA 2DJNA 3P9IA 1JHHA 3PIPF 2FOWA 4CA0A 1ZELA 4XOTA 3HGGA 2DQLA 1U5TC 5EZHA 2EILH 4EJUA 1P6RA 1XSXA 5J40A 5HVQC 2V26A 1TWGJ 3KYDB 2KZGA 3A03A 3HSRA 2X6WA 5CVUA 2ZBKA 4B44A 1WPKA 3TW6A 1XDSA 3CD6I 2DOFA 1Z7LA 3LSMA 3RDIA 3CUQB 3GWZA 2TCTA 5D5UB 3K4MA 3SFIA 4M3BA 2QA4I 3S93A 2XPUA 3SDGA 4O5VA 2H1LA 1KYWA 4HV5A 2ZFWA 1P4AA 2LTPA 1YIJI 2AXTC 2XIGA 4CICA 4G6TB 4K2EA 2AQFA 2VQHA 3JRGA 1S3JA 3I4MJ 1MDMB 4UV9A 4AYBA 1VI0A 3ZMVA 1QHGA 4UVAA 4EJOA 2IAIA 5D5VB 2CW0F 4ENJA 3C18A 2FSWA 3CUQA 2MYSA 4NC8A 3GEZA 4RB0A 4A69C 2G7HA 2L7ZA 2HOAA 1U9OA 1YHQI 1IDZA 3VYTB 2YSRA 3BT9A 3KYLA 3HGYA 4HYEA 2VE8A 1JGSA 2NVYJ 4BE1A 1MDMA 3BR1A 2JRTA 3OV8A 3ABMH 3DCFA 4EM2A 2R4GA 3QPSA 3NQOA 3BJAA 3HZJA 2V1UA 3FHZA 2DMPA 2M8EA 2A3SA 3TGNA 3TO9A 1J2XA 4FASD 2GA1A 2DCEA 2P7VB 4BU2A 2CFXA 2D2WA 1BR1A 2DFFA 2HPIA 2P6TA 1F5TA 1BL0A 4BE2A 1ZREA 3U1KA 3SFZA 2R0QC 2G9WA 3WTWC 3OYAA 3M9AA 4WK8F 3JSPA 4C9YA 2E1OA 2LSOA 2GBYA 1VQ5I 4F91B 3BTJA 2H94A 2A6HF 2LKSA 2VXDA 2XDVA 3OYLA 5GTHC 3VSLA 2KRFA 1TTYA 3QU3A 4FT8A 4EM0B 3V8KA 4A2UA 1VQOI 4EGYA 1O3RA 2ELKA 3H0DA 4GFBA 2DQRA 4CH7A 3B73A 2MA3A 1H89C 3F8BA 4F93B 3D5LA 2QKMB 4M3EA 5CKTA 1BC8C 3ZQQA 4PFPA 3K70D 4E7KA 1WHUA 2HXOA 3OMYA 3TP0A 3S8PA 5K7FA 3SJMA 3BOQA 2Y9YA 2NVXJ 3EPZA 5TGTA 4H0EA 5F27A 4DBRA 1R5GA 4NB5A 5ERIA 2VQGA 2O0YA 3FMRA 3HKZN 2EFPA 3JRAA 1R4NB 4NQWB 3QPLA 1F43A 4PGGA 2HU9A
chains in the Genus database with same CATH topology
3K4KA 2OV7A 2LG4A 1MMGA 4BQNA 2KL4A 1D1CA 4IKFA 3F9KA 3OS2A 3DTEA 3LMMA 2KQRA 3OL4A 3BCBA 4CZCA 1VZ0A 1WJCA 1WJAA 3DWLE 1PYVA 2CS3A 5FRMA 2KRCA 3W3CA 4BQOA 3VYRB 2LBFA 4CCLA 3OR2C 3RSNA 3IAM2 2I8DA 4HEA2 3MKZA 4R79A 2CUJA 3E1SA 4HNTA 1TT0A 4IQJA 3K4CA 3MMYB 2L9SA 1X1DA 4PK4A 2KHMA 4XR6A 2DT6A 3K4LA 3G2BA 3SEZA 4IZZA 4PUSA 1FMVA 4IX7A 2LYCA 3IUOA 4YRVA 4XKBA 4F52A 5LFAA 4RMNA 4XN0A 4XM3A 2RREA 4CCMA 4B48A 4XL9A 4BJ6C 2A5WA 4ZDOA 3FKJA 3DTIA 1SAUA 2RQQA 3BLYA 3HPGA 3PFYA 4BXFA 3OYDA 4X0GA 1V5FA 1D0ZA 3K6GA 2V7FA 3OYKA 2M4GA 2VJ4A 2PJRA 2IS2A 4RM2A 3CJQB 3HUGB 1WJDA 2GOMA 1MW7A 1FMWA 2UV1A 2KDOA 2WY7Q 2ZFUA 2CUZA 4EATA 1GLNA 2JA2A 2R7QA 3DLAA 3W2WA 3CP8A 3CJRB 3DKYA 3PNTA 2VPLA 3TBIA 2FUG2 2IGMA 3K4JA 3TMOA 5KHDA 5HNHA 2CW8A 3K4NA 2X6XA 3SDBA 3LSHA 2HVRA 1YX5A 2O5RA 4ZDLA 2KRHA 3MD2A 4KISA 2W7NA 2RNGA 2L5QA 3OY9A 2BW3B 2K9LA 2E1MC 2VQLA 4PSWA 4E6KG 1MMAA 4D9JA 2R7RA 3HL2A 2DT7B 4HRIA 4DIQA 3QOEA 2QKLB 3RTRA 4BEHB 3QYBA 5FROA 2LREA 2UUZA 2WB1A 3D5RC 3OIPA 1K6YA 3QYEA 4XKWA 4II3A 4PJNA 1U0JA 3W2AA 3OYCA 4PSXA 4C30A 4XORA 2F4IA 3KX2A 1UG0A 2Z16A 1D0XA 3PSFA 3BG6A 2BW3A 2F6CA 2MFZA 3H9JA 3A4CA 4C2TA 4RLFA 3AL0B 3S3NA 4BQQA 3CP2A 1WJFA 2CV2A 2X51A 2UWMA 2XSJC 2KPMA 2WAQA 4LG3A 4BEHA 3DPLC 2W82A 3HXLA 2CH0A 4BE0A 3FBNB 3M8JA 3LSIA 2BOLA 4DJAA 2HDWA 3DEEA 2BVMA 1WJBA 3U21A 4FETA 2X1EA 3FDYA 2A6TA 4NC7A 3OS0A 3EUKL 4HG2A 3DU5A 4NNJA 4F3QA 4OWRB 2IGKA 4BDZA 3S3MA 2ZXIA 4KITB 1BR2A 3D5SC 3I3LA 4E7LA 1N75A 2E5ZA 3OWTA 3CESA 2XF5A 4Y33A 4ZYAA 3OYNA 4HNUA 1LVKA 1X1CA 3CZ6A 2WAEA 4PFOA 2M0MA 4E7ZA 3CMMA 1MNDA 3L2WA 2L2OA 2VJJA 1BR4A 1Z3YA 4MLOA 3L2QA 3LSKA 2CFOA 3SZGA 4E7JA 1G59A 4JOMA 4ITVA 1MMNA 3C2HA 2W00A 2MD0A 4XMYA 3J7AY 4DGWB 3PJRA 3DPUA 4J00A 3BCAA 2VKDA 5CQGA 5LD2C 3HPHA 3NWTA 1SFKA 2LOOA 4P5OA 3VSKA 4CCNA 3RCOA 2CV0A 3PNYA 4KT6A 3V42A 3K4BA 1PJRA 2CMPA 4Y3OA 2VXZA 3SEQA 1X19A 2V6EA 2IS4A 1LKXA 3H9QA 3HOTA 1NG7A 2VASA 4Y4RA 2KLOA 2F5VA 1EA3A 3LL7A 1T0FC 1E0EA 4BGDA 1YE9A 2L7KA 3NWSA 4E7IA 4KJZA 5KCMA 3A1YA 4II2A 1Z3XA 3BC8A 4ZTFA 4XLCA 2WY8Q 2VIXA 2JSPA 2KP6A 2L9NA 4BJTA 2CV1A 3LSGA 4HPQA 3VYUB 1OR7C 1LFPA 5HLTA 3OYBA 2JVGA 4B47A 1T95A 2Z2SB 2K5CA 2MC4A 4GRIA 1Y6IA 2WBMA 3GBGA 1S9HA 2JUGA 4RM3A 3RPUD 1DGRM 3OOUA 4CCOA 3PSIA 2VB6A 2W4SA 2E1MB 3E0JB 2Z1DA 3HG9A 1Y56A 3ZRGA 1ERDA 3H9GA 4HSTA 2PMZA 4QPQA 1V5GA 1HA8A 2LY2A 2DOAA 4CCKA 2R7OA 1G8XA 1J09A 2IGOA 4OAZA 3OL3A 4ZC3A 3MKYB 3N05A 4PJLA 1W36C 4BUPA 2HVSA 3FHNA 1X4OA 2LY1A 1V5EA 3H5AA 3RQ4A 2K9MA 2VLAA 3DKXA 4F55A 2HPMA 3OYEA 4F92B 3DQVC 4DBQA 3A2KA 3OIQA 4BS9A 3AL0C 3CF2A 3KEYA 4PJMA 3OYIA 4CCJA 2NOJB 4ZDPA 4C2UA 1X4PA 3L2UA 3L2RA 3UR3C 1X1BA 2MABA 3VYSB 1WFXA 2ELJA 3QODA 2Y0SA 5CPRB 2ZXHA 1QHHD 4RLQA 4BACA 2HQAA 1R6RA 5KNLA 2JVHA 3HC7A 3OR1C 4H4KC 2XAUA 2VQCA 2W1OA 4LITA 4CUGA 4XN3A 3TL4X 4E7SA 4JQFA 2IS1A 3IAS2 4LIVA 1Z21A 2V1NA 2LH9A 1AA7A 3QYFA 1DGWY 3OYMA 4BL0B 4D1QA 4QPOA 3MKWB 3VWBA 2VL8A 3AKZA 3OYJA 1DQUA 3ZR8X 3ZGKA 1WJEA 3H35A 1P9QC 4AVZA 1D1BA 1D0YA 4XLHA 1TZLA 2E5NA 2CW7A 4BDYA 3SYTA 1BOBA 4N4NB 1QU3A 4CA0A 5HNFA 2IS6A 2R7WA 1ZELA 3LFUA 4XLAA 4XOTA 3IP4B 2VJ5A 3PNVA 5HVQC 2V26A 2X1CA 2P0WA 2K3PA 4XLFA 2X6WA 2PJRB 4XNFA 2V9KA 4B44A 3L2VA 5HOOA 3M1CA 4ZTJA 1Z7LA 4E7HA 3LSMA 2WA0A 3K4MA 1UAAA 3H5RA 3S93A 3OYHA 1N78A 5CQEA 2HNHA 3BG7A 3AFHA 3DU6A 4G6TB 2AQFA 2HZDA 2VQHA 2WADA 2VKHA 2OC6A 4XONA 3S32A 4HSRA 4AYBA 3S3OA 1QHGA 2Q1ZB 2R7TA 4B43A 2AQEA 2M3AA 2ZSHB 2MYSA 4NC8A 4BJ5C 1DP3A 1WJ5A 2WAFA 4LIUA 4DOZA 4YEJA 2GOXB 2X85A 3VDXA 1D1AA 4XKCA 3H5NA 3ONQA 3VYTB 3KYLA 3PL8A 4IQ4A 2HVQA 3DTKA 2XF6A 3EUHC 1X1AA 4PJJA 4BE1A 4CSWA 3FBIB 2R4GA 4J01A 2XF7A 5FRNA 1KONA 1N77A 2KMUA 2Q2EB 3EUAA 4FASD 5JHFA 2DCEA 3OS1A 4BU2A 1BR1A 2HPIA 3OYFA 1NG6A 2X1DA 3ZCOA 3K70C 2M7BA 3W2VA 4XLEA 4BE2A 3DPTA 2R7VA 2E60A 2XC7A 4P1WA 4N4OB 1UELB 3OYAA 2DJIA 3PUBA 3I9V2 4C9YA 2R7UA 4NUBA 4F91B 1LDKB 1MNEA 3HOSA 3ZXSA 4XQFA 2M7AA 2VXDA 2XDVA 3OYLA 2KZVA 1OLTA 1MMDA 3VSLA 2BVLA 3HKZA 1JI8A 2VJIA 3H0DA 4U87A 1IRXA 4OAYA 4AU7A 4CH7A 4U7BA 2OUMA 4ANJA 2ZSIB 4F93B 3D5LA 2QKMB 3UNGC 5CKTA 4ZJZA 3ZQQA 4PFPA 3K70D 4E7KA 3OMYA 1W36D 3C2GA 1YX3A 3S8PA 2X6YA 4B3XA 4XKVA 3OYGA 3EPZA 5TGTA 2LRDA 3K10A 2DXIA 2IGNA 4DBRA 2M4KA 4E4HA 2R7XA 4XOPA 2LC2A 2IXSA 2R7SA 2LBFB 2V4JC 2VQGA 4NQWB 4YELA 2HU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9S A; 
#chains in the Genus database with same CATH topology
 1RRJ A;  1NTC A;  2LG4 A;  1A35 A;  4BQN A;  1UST A;  2KL4 A;  3I71 A;  4UVC A;  1Y0U A;  5KK1 A;  1HXD A;  2ISY A;  3DTE A;  2EJR A;  3MZH A;  1JJ8 C;  1SD6 A;  4L0Y B;  1ZHF A;  1VZ0 A;  4A5M A;  2BY3 A;  3AG2 H;  3DWL E;  3BG5 A;  4LG0 B;  2XKP A;  4XSZ F;  2OZU A;  1O3S A;  4HLX A;  1HBX G;  4NQW A;  3WGI A;  2QLZ A;  3RSN A;  2DA6 A;  3HB9 A;  4HOB A;  3E1S A;  3IKV A;  2EIK H;  4A3M J;  3LA3 A;  1DPU A;  1YIO A;  4IQJ A;  1IO2 A;  2K40 A;  3KEQ A;  3G71 I;  2IA1 A;  1K61 A;  4A0Z A;  1TWA J;  4LG0 A;  4PJ0 C;  3SEZ A;  1E3P A;  4PUS A;  1SVO A;  4DYQ A;  2X0L A;  4IX7 A;  2LYC A;  1G3T A;  2MD5 A;  3FIS A;  4RMN A;  4F52 A;  4M71 A;  4XM3 A;  1MJB A;  2RRE A;  2B9S A;  4BJ6 C;  1XS9 A;  3DTI A;  5BPD A;  1LUJ B;  1RC9 A;  2FXA A;  4X0G A;  3CUQ C;  2ME6 A;  3MQ0 A;  5FKO A;  1MGT A;  1SVM A;  3K6G A;  3OYK A;  4PGH A;  4W97 A;  3R6S A;  2V6C A;  5K1Y A;  1UB9 A;  1ON1 A;  3BY6 A;  3CJQ B;  4ZYE A;  1YJW I;  1MW7 A;  1T2K A;  2KDO A;  1T8I A;  5B3S H;  3E6D A;  1GLN A;  5M3F J;  5HOD A;  4QLC U;  1FZP B;  2ECB A;  3DLA A;  3W2W A;  2LLK A;  2VPL A;  2RQP A;  2FUG 2;  2W84 A;  5KHD A;  2F5C A;  2HKX A;  3FXM A;  3HRM A;  2I5U A;  1R1T A;  1WZ2 A;  1Z1D A;  4KIS A;  2ID3 A;  6PAX A;  1AU7 A;  4I99 C;  2BW3 B;  3OY9 A;  2E1M C;  1LFU P;  1RIO H;  3GCM A;  3BWG A;  3F8M A;  3LOC A;  4U0W A;  1IN5 A;  3J7Y J;  3KET A;  3HL2 A;  5TRD A;  4E70 A;  2QKL B;  5C4J J;  2H8R A;  1CQT A;  1D3Y A;  4OIQ F;  1ETQ A;  1FYM A;  2UUZ A;  2ZME B;  4G12 A;  4XKW A;  4II3 A;  4ENN A;  3RKQ A;  3KX2 A;  2Z16 A;  1SAX A;  2VC1 A;  4JP0 A;  2BW3 A;  2RAE A;  4JK1 X;  4BAY A;  4C2T A;  2LP0 A;  4WF2 A;  1TQI A;  5ICG A;  1WJF A;  1VQ8 I;  1IN6 A;  1SFE A;  2WAQ A;  1BJZ A;  3ZN0 A;  3DPL C;  3KP6 A;  3TED A;  2O61 A;  1ZQ3 P;  4D7M A;  2EV0 A;  3PM1 A;  2ZME A;  2M0C A;  2WB1 N;  2OQR A;  2L9R A;  2OF7 A;  4GO1 A;  2BVM A;  5DV5 A;  3F8C A;  3JRF A;  2WV0 A;  1MBK A;  5D6F A;  3ZQG A;  3CJT B;  4HG2 A;  4NNJ A;  4F3Q A;  1AWC A;  3KLO A;  4AUX A;  3ML6 A;  3S3M A;  4KN7 X;  4C3H J;  3ULQ B;  1HKT A;  4IXA A;  2E71 A;  2QEN A;  1N75 A;  3BR5 A;  1IXC A;  3OWT A;  2XF5 A;  3OYN A;  4HNU A;  2ZKZ A;  3GUD A;  2L0K A;  4IRI A;  1HW1 A;  2M0M A;  1LQ1 A;  3CMM A;  5TIS C;  1YIT I;  1MND A;  1XC5 A;  4CXF A;  3L2W A;  2P5L C;  2FBK A;  1Z3Y A;  4MLO A;  4HZF A;  1ZK8 A;  5K7Z A;  1RKW A;  3L2Q A;  3SZG A;  1YFH A;  1VQM I;  4JOM A;  4ITV A;  3ABL H;  1TBX A;  1QQI A;  2W00 A;  1R71 A;  4HNV A;  1UJ8 A;  3J7Z I;  3PQJ A;  3BTL A;  3DPU A;  2K9N A;  4J00 A;  3BCA A;  4M6V A;  1BW5 A;  4ZH4 F;  4RS8 A;  3NWT A;  3HOZ J;  1A5J A;  2XGX A;  4L9T A;  3VSK A;  5ICF A;  3PO3 J;  1IV8 A;  2FE3 A;  4CZZ A;  1U3E M;  1IN8 A;  4RGS A;  4DYC A;  4OMZ A;  1R22 A;  4DNC A;  2FRH A;  3ZMS A;  5EEG A;  3EYY A;  1D5Y A;  3FKI J;  3KP5 A;  1X19 A;  2V6E A;  1XD7 A;  3H9Q A;  3A0B C;  3HOT A;  1NG7 A;  4RAF A;  2VAS A;  5ED4 A;  1XSD A;  2KLO A;  3Q0W A;  3FK6 A;  2PJP A;  5KCM A;  2EZH A;  1HC8 A;  4M72 A;  3HOW J;  1S29 A;  4II2 A;  1K4T A;  4XLC A;  4XLP F;  2HXI A;  2C6Y A;  1QRY A;  1K7A A;  2L9N A;  4P9U A;  4KIB A;  1E3H A;  3I4N J;  4HPQ A;  3VYU B;  1XCB A;  4HX8 A;  3FXQ A;  5HS8 A;  3QU6 A;  2JVG A;  4UVB A;  5IOY A;  2RGV A;  4GRI A;  3CMA I;  1JKO C;  3F6O A;  4IEJ A;  3IL2 A;  2DBB A;  3TW7 A;  2OTJ I;  2K86 A;  1S9H A;  2QM3 A;  4RM3 A;  5CVJ A;  4A5N A;  2FMY A;  2M30 A;  1BA5 A;  2KFD A;  2BEO A;  2DMU A;  3JRH A;  4CCO A;  2JA8 J;  5IYB J;  2KJC A;  4JX6 A;  1FWZ A;  5LHI A;  3E0J B;  2L02 A;  2Z1D A;  3HG9 A;  3IRR A;  1BI3 A;  4LK1 F;  5J8F A;  1Y56 A;  4B3A A;  1MSF C;  1ERD A;  3WTT C;  1R58 A;  1G6N A;  3ZPL A;  5FLX Z;  2DA5 A;  2M34 A;  5IOZ A;  3A01 A;  2PMU A;  1OKR A;  4BQA A;  2PMZ A;  3EUH A;  1FTZ A;  3CCR I;  4CCK A;  2PEX A;  2K9S A;  1YLF A;  1J09 A;  3OL3 A;  4ZC3 A;  4PJL A;  2ZME C;  3HJE A;  2GLO A;  3FHN A;  2HEO A;  5L3B A;  2LY1 A;  4Q5S F;  4UB6 C;  3H5A A;  2VLA A;  3BG9 A;  5FD5 A;  3DKX A;  5F0C A;  3W6J B;  3CDI A;  1JT6 A;  5M3M J;  5KVR A;  5J1Y A;  5D8L B;  5CYV A;  3ZMU A;  5FLV A;  1B8I B;  3EYI A;  4PJM A;  2COM A;  4ZDP A;  1X4P A;  4HQM A;  3UR3 C;  3VYS B;  1YTY A;  2DU9 A;  3Q9V A;  2ZXH A;  1V54 H;  2QCO A;  2HQA A;  2XGD A;  1ZKG A;  3AAF A;  4H4K C;  2R7F A;  5JHU A;  1X1P A;  1KQ0 A;  1B8I A;  1ON2 A;  2VOO A;  1VTN C;  2J5P A;  3IAS 2;  3IH3 A;  1W1W E;  2IA2 A;  2ISZ A;  1PVE A;  5HLG A;  2ZXJ A;  1RR8 C;  2LH9 A;  4FE4 A;  2CU7 A;  1GVD A;  1DGW Y;  1XGO A;  2HOS A;  2EK5 A;  3FIW A;  1RKT A;  2EA4 A;  3MKW B;  3HEF A;  3A0H C;  4CHU A;  2GXB A;  5FLX K;  2F2E A;  3ZR8 X;  5DEQ A;  1I1G A;  4RB2 C;  3KFW X;  2CGP A;  3KLN A;  2K3F A;  4A6E A;  5IPA A;  4I6Z A;  1S6L A;  4RB1 A;  4AVZ A;  1D1B A;  1D0Y A;  4XLH A;  1HF0 A;  2DAO A;  4QIW N;  4GXO A;  2A68 F;  2EZI A;  1AOY A;  1CGP A;  1G4D A;  2KIF A;  4HLY A;  1BOB A;  2RKH A;  4B4C A;  5HNF A;  3LFU A;  2R7W A;  4JBA A;  2R7D A;  4XLA A;  1U8B A;  1U9N A;  3M4O J;  4M6Y A;  3F3X A;  4YEL A;  3IP4 B;  2ZJR F;  2VJ5 A;  1G3Y A;  2MH2 A;  5DTD A;  3L1P A;  4MIM A;  1OCT C;  1MJA A;  1TWF J;  2EIM H;  3BZK A;  1LE8 B;  3CCS I;  2PJR B;  2V9K A;  2JUC A;  1XMX A;  1XX5 A;  3D0S A;  2F4O B;  2F4M B;  4KIC A;  2UZK A;  4ZTJ A;  1IRZ A;  3NRV A;  3CME I;  1Q1V A;  2FOK A;  1E17 A;  4U88 A;  1V3F A;  2EZK A;  3OYH A;  2E34 A;  1N78 A;  1YW8 A;  2QQ9 A;  5J1R A;  2VT2 A;  3IKT A;  3ZMZ A;  4M74 A;  3LAP A;  1K4S A;  3BG7 A;  4UUV A;  1EF4 A;  4EQQ A;  2H09 A;  4S0H B;  1FYK A;  2HZD A;  1C0W A;  4NHJ A;  1IC8 A;  1LE8 A;  1QBJ A;  3MZY A;  2MW8 A;  3S32 A;  3GTM J;  4IOC F;  1LDD A;  3F21 A;  1HKQ A;  2N8G A;  3LWF A;  2R7T A;  2FML A;  1W7P D;  2D1V A;  4BJ5 C;  4F7Z A;  1YO5 C;  1A36 A;  2KIU A;  2RN7 A;  1DP3 A;  4HF1 A;  2M8G X;  1DDN A;  4ZYH A;  1IRG A;  1JXS A;  3KP7 A;  4ESJ A;  4YEJ A;  2GOX B;  2LF7 A;  1ETY A;  2HS5 A;  2BY0 A;  2X85 A;  3VDX A;  3RPU A;  3ONQ A;  4G6Q A;  1T0F A;  5D5X B;  3PL8 A;  3T8R A;  3DTK A;  2XF6 A;  3EUH C;  4PJJ A;  3QQA A;  1OYW A;  3L09 A;  4AYB N;  3PQK A;  4J01 A;  4ABZ A;  2XF7 A;  2JQ7 A;  3G1M A;  2Z3Y A;  2FBI A;  3EQL F;  5JHF A;  2PFB A;  5FFX A;  5BNG A;  5H2F C;  3TOA A;  4XRS A;  2R93 J;  1JTX A;  1NG6 A;  2X1D A;  2Q8K A;  3QWL A;  3ZCO A;  4XLE A;  1ETW A;  2X6O A;  1BI2 A;  3P7N A;  2DA2 A;  2JT1 A;  4KMU X;  1UEL B;  3ERM A;  4U0Y A;  5E8I A;  2K9Q A;  5BMZ A;  5F0H A;  1W5T A;  2BYV E;  4Y17 A;  3HOS A;  2PI0 A;  1O7F A;  1ZRC A;  1HW5 A;  1Z7U A;  4BHB A;  2P7C B;  1OCP A;  1OLT A;  3QAH A;  5AON A;  1LEB A;  4XK4 A;  3QPT A;  1SD7 A;  2VKV A;  2F5E A;  3BJO A;  5B66 C;  2VJI A;  2PG4 A;  3AG1 H;  1IRX A;  2XRL A;  5M5Y J;  3GLX A;  1P4W A;  4AU7 A;  4U7B A;  4ANJ A;  5GAG J;  4IHV A;  2R92 J;  1VFC A;  2ME0 A;  3RKW A;  3HSF A;  3BZC A;  3UNG C;  3DXJ F;  4ZJZ A;  5HDN A;  1K83 J;  2LK2 A;  1Y39 A;  3JRI A;  1W36 D;  3G6E I;  3HOY J;  4LFU A;  4WX9 A;  3GYH X;  2DXI A;  2LRD A;  3K10 A;  2IGN A;  1IN7 A;  2HR3 A;  1I39 A;  1ZLJ A;  2GZW A;  4XOP A;  5GPA A;  5IP6 A;  1SEU A;  3LNQ A;  2R7S A;  2V4J C;  3NEU A;  3LSR A;  5JFR A;  1Y1V J;  1OQY A;  4ZYD A;  3OS2 A;  3MVP A;  1MJ9 A;  3QP6 A;  5AIP A;  2ZB9 A;  1D1C A;  4NBQ A;  1A31 A;  3F9K A;  3LMM A;  2ESN A;  1QPI A;  3W6K B;  3ZMT A;  3GO5 A;  3OL4 A;  3BCB A;  1FBQ A;  2IP2 A;  4CZC A;  1WJC A;  1WJA A;  5FRM A;  2KRC A;  4ENK A;  1L3L A;  3W3C A;  2QGU A;  3CDL A;  1DU6 A;  3K1N A;  4M9S A;  1X3Z B;  4S04 A;  1O3T A;  4ESB A;  1FOX A;  3E7L A;  1VQ6 I;  2XPV A;  2FX0 A;  2LFB A;  1I6H J;  5HS9 A;  1X3U A;  3KIO A;  1MBG A;  4KT5 C;  1TT0 A;  1MBF A;  3MMY B;  1X1D A;  1MSE C;  4PK4 A;  2DT6 A;  2VC0 A;  4IZZ A;  5EEH A;  1X58 A;  2W57 A;  2DFI A;  4YRV A;  4XKB A;  3U2R A;  1LFB A;  2XAH A;  4FTH A;  5LFA A;  1IW7 F;  2HKO A;  2ICW G;  1WRJ A;  2A5W A;  3FKJ A;  1SAU A;  3BLY A;  1MIJ A;  2E2J J;  2NNY A;  4BH9 A;  3FF5 A;  4MQV A;  3WHC A;  1PP7 U;  5JVG F;  1D0Z A;  1QPM A;  3S2D J;  1IXR C;  2M4G A;  2HQ5 A;  4ON0 A;  2IS2 A;  1P7J A;  3JRB A;  1F1Z A;  1T08 B;  3SXY A;  2ZFU A;  3VOE A;  1Z05 A;  4EAT A;  3CC7 I;  5EF6 A;  2FJ1 A;  2DTZ A;  4BHP A;  2R7Q A;  1YRN B;  3V8J A;  4BYY A;  1AKH B;  2YR2 A;  3CCJ I;  3CP8 A;  3DKY A;  1HST A;  3GFM A;  3K4J A;  3TMO A;  2DK8 A;  1J9I A;  5B5E C;  3K4N A;  3WU0 A;  1YW7 A;  4EMS A;  3HTS B;  3M7G A;  3LSH A;  3CDH A;  2VBZ A;  2HVR A;  4G9Y A;  2BE5 F;  1SFU A;  4A3E J;  2L5Q A;  2K9L A;  2VQL A;  4PSW A;  3VEP A;  1AKH A;  5FKL A;  4E6K G;  3BQZ A;  1XMA A;  5CVI A;  3TO6 A;  5GAH J;  1ZN2 A;  1MMA A;  2JSC A;  3KPH A;  1D8K A;  4WCG A;  2DT7 B;  4L9J A;  3QOE A;  5ILS A;  3I53 A;  2L4A A;  5A2Q Z;  3S2W A;  4KIF A;  1KU7 A;  5FRO A;  1BI0 A;  1R7J A;  2ZCW A;  2DMQ A;  3HDD A;  2BY1 A;  1IUY A;  3V7S A;  2L4M A;  2R3S A;  4PSX A;  4C30 A;  2F4I A;  5E1W A;  2K7L A;  3LAJ A;  3BG6 A;  4M9Z A;  2E7X A;  2TDX A;  1UHW A;  2VBX A;  2HQN A;  4RLF A;  5B1A H;  5E3O A;  3V4G A;  2CUE A;  3S3N A;  4XLN F;  3PIO F;  3OOP A;  2ETH A;  4XRM A;  2CV2 A;  2X51 A;  4Y13 A;  4GYI A;  4A0X A;  2W82 A;  5IYD J;  1RPW A;  4BE0 A;  2CH0 A;  4ENM A;  3EET A;  2O8X A;  3K69 A;  5KAI C;  5E3L A;  5J1U A;  3WTZ A;  4Y7N J;  4LLG F;  2IW5 A;  1TQM A;  1YW9 A;  4FET A;  3KZY A;  4NC7 A;  3CQZ J;  3OS0 A;  3F6V A;  3I0T A;  3IH4 A;  1Y8R B;  4OWR B;  3CMY A;  2F48 A;  2IGK A;  1KA8 A;  5J4V A;  3DP7 A;  3SHF A;  3FM3 A;  4KIT B;  3D5S C;  4FX0 A;  2WAQ N;  1T56 A;  4G94 A;  1JUP A;  1ZGW A;  3BPX A;  2EZL A;  3QOP A;  2LNB A;  3ASN H;  4ZYA A;  4Y33 A;  2X9D A;  4HDU A;  2ZC2 A;  5C3E J;  1DP7 P;  1Z6T A;  1MBJ A;  4IO9 F;  1XGS A;  4E7Z A;  2XPW A;  5A2Q K;  2RV8 A;  1GV5 A;  5FFZ A;  2L2O A;  1N25 A;  2FD5 A;  4BY7 J;  5IYC J;  5DUK A;  3LSK A;  4I01 A;  2CFO A;  2JPB A;  4I7H A;  1E2X A;  1R1U A;  4IRG A;  4ZYG A;  1VQ7 I;  4Y52 J;  3Q5F A;  5LGN A;  4BHC A;  2XV4 S;  4DGW B;  3G73 A;  1MZB A;  2EIN H;  3CC2 I;  3HPH A;  1SFK A;  2VI6 A;  3GFL A;  3CLQ A;  1YS6 A;  2M45 A;  3WTS C;  2P81 A;  5LGU A;  3PNY A;  3LA2 A;  3V42 A;  2CMP A;  4Y3O A;  4MEX F;  4G6D A;  1W5S A;  3SEQ A;  3P9K A;  1LKX A;  3I4P A;  4PCQ A;  4Y4R A;  2JJ7 A;  1YJ9 I;  1MBH A;  3ZQC A;  1E0E A;  4LMY A;  1YE9 A;  3DF8 A;  5H6Q A;  2V1X A;  5F64 A;  4KJZ A;  4I09 A;  3A1Y A;  4KN4 X;  1Z3X A;  3H36 A;  3MAJ A;  4P9F A;  2VN2 A;  4Q4Z F;  2JA6 J;  2ZO4 A;  3ZP5 A;  2E7W A;  2XAG A;  1OYI A;  2L7F P;  3AG3 H;  3M07 A;  3IWZ A;  2DTR A;  4BJT A;  2ZNY A;  2QSF X;  4UXN A;  1Z6R A;  4JYK A;  3B02 A;  2B7E A;  3LST A;  1A6Q A;  1Y6I A;  5LGT A;  3I58 A;  1GVJ A;  1WVR A;  3ZQ7 A;  4RGR A;  4RAZ A;  2GWR A;  3FWE A;  4UV8 A;  3L7W A;  2P5V A;  3ESW B;  4DYR A;  4X1E A;  5K5R A;  2F5D A;  1ZH5 A;  2DLL A;  1IZ1 A;  5DD4 A;  2EQR A;  1QZE A;  3H9G A;  5E3N A;  3HHG A;  2HTS A;  1FBU A;  4Z6Y A;  1IV6 A;  2Z9O A;  3ROU A;  2KT0 A;  4HST A;  5D8K B;  3QPH A;  1JKQ C;  1JKP C;  1V5G A;  2MC3 A;  4Q47 A;  2DOA A;  3ECO A;  3LQR A;  2R7O A;  2X4H A;  4OAZ A;  2AXL A;  3MKY B;  1VQ4 I;  3CO7 C;  3GTQ J;  5FO5 A;  2Z5U A;  1TWC J;  1X4O A;  4FQG A;  1S72 I;  2HFH A;  1ITY A;  4YFK F;  4MFE A;  3OYE A;  1T33 A;  1JE8 A;  1JT0 A;  1PUE E;  4D5C A;  3CF2 A;  3DBR B;  2OBP A;  2O3F A;  2GXG A;  2CQ7 A;  5C44 J;  1SC7 A;  2MAB A;  2E19 A;  2ELJ A;  3QOD A;  3F8N A;  2PMZ N;  2Y0S A;  2EV6 A;  3E6B A;  3WOD F;  1QHH D;  4BAC A;  2NVU B;  5BS6 A;  1SFO J;  3GZ5 A;  2JVH A;  3GME A;  1XG1 A;  3ASO H;  3HC7 A;  3HBL A;  4LIT A;  1FOK A;  4CUG A;  4XN3 A;  3FXJ A;  1WH7 A;  3TL4 X;  2UXN A;  4B1R A;  2KJB A;  2MLK A;  1ZTR A;  2VT3 A;  4D0P A;  2ACJ A;  1AHD P;  2IS1 A;  4LIV A;  1OCO H;  1TQP A;  1Z21 A;  2V1N A;  2GXA A;  2NS0 A;  1AA7 A;  1LEA A;  2BBY A;  2DA1 A;  4FX4 A;  1STZ A;  3JW4 A;  2ECC A;  3OYM A;  1IG7 A;  1UFM A;  3DFG A;  2HYG D;  5DYM A;  2NVT J;  2CG4 A;  5JR3 A;  1QVT A;  1ZG1 A;  4QPO A;  2YS9 A;  2TRT A;  1T98 A;  4BBR J;  2W25 A;  4RB3 C;  3OSF A;  3OYJ A;  2HOE A;  1QVU A;  5JLX A;  3FMS A;  1O7L A;  3H35 A;  4HQE A;  2J5O A;  4LJZ F;  2STW A;  3E3V A;  5ILU A;  3FXU A;  3O6B B;  2QEX I;  1L0O C;  2QUF A;  4M73 A;  2E5N A;  3WU1 B;  3OSG A;  2OTL I;  4BDY A;  3C1D A;  4GDF A;  3FMQ A;  2CYY A;  4HX4 A;  2IS6 A;  1QU3 A;  2CQQ A;  1RR7 A;  4ESF A;  3MEX A;  2JPC A;  2JMW A;  1I5Z A;  1FC3 A;  2P0W A;  2K3P A;  3HOV J;  1ACI A;  2LDU A;  3NAR A;  1QNT A;  1ENH A;  3L2V A;  4M9X A;  3M1C A;  3GZN B;  3Q3S A;  5E3M A;  3S16 J;  4BKX A;  1J5Y A;  2ZJP F;  5F1J A;  1XGM A;  1UAA A;  3H5R A;  5IY5 H;  3S1R J;  5LLQ A;  4DW6 A;  4KNY A;  5C4X J;  3X2Q H;  1SMY F;  3GTK J;  1ZGJ A;  2HNH A;  3JRC A;  1FSE A;  1FT9 A;  3GTP J;  3DU6 A;  1Y0N A;  1IGN A;  2WAD A;  3HRT A;  2CSO A;  5E1X A;  2VKH A;  1B1B A;  3JRE A;  1I27 A;  4XON A;  4HSR A;  5HS7 A;  3S3O A;  5M5X J;  2A05 A;  4MGR A;  1BI1 A;  2Q1Z B;  1HCR A;  2O8K A;  2R7Z J;  4IOA F;  2ZSH B;  1PUF B;  1VQL I;  4AID A;  5EGO B;  2BY2 A;  3R60 A;  5BPI A;  1ZYR F;  3WHB A;  2WAF A;  1K78 B;  4LIU A;  4L0Z B;  2KKO A;  3FXO A;  2A69 F;  2OJE D;  3TDZ C;  2L01 A;  3K0L A;  3W6V A;  4G7O F;  1D1A A;  1IF1 A;  4XKC A;  3H5N A;  5L3E A;  2XRN A;  2PMH A;  4IQ4 A;  1WGX A;  3DV8 A;  1I3Q J;  2QQ8 A;  1V4R A;  1B4A A;  1R36 A;  3FBI B;  2V1D A;  2E1N A;  1FY7 A;  3ELK A;  2AS5 F;  1IN4 A;  4MEY F;  3LSJ A;  3P5J A;  5EGO A;  1HDP A;  3V8L A;  2KMU A;  3HTU A;  3KP2 A;  5F0F A;  5GP9 A;  4OMY A;  1K78 A;  2DI3 A;  2Y69 H;  3OYF A;  3CJN A;  3W2V A;  3DPT A;  2R7V A;  2E60 A;  3HOX J;  2KDZ A;  2HYF A;  4N4O B;  5EG0 B;  3C2B A;  1XCV A;  1DPR A;  1FIA A;  3I9V 2;  3S14 J;  3WTY C;  3G1O A;  1G3S A;  4AM3 A;  2E35 A;  1MNE A;  3ZXS A;  3FZV A;  2M7A A;  1J59 A;  3Q9S A;  5GTI C;  2KZV A;  1W5C C;  1X3W B;  4C2M J;  1JI8 A;  3H0G J;  1ZRF A;  1JHF A;  1QA6 A;  1LVA A;  3E6M A;  2EFO A;  3I5U A;  3P9C A;  4OAY A;  3N97 A;  3VOD A;  5LEJ A;  3K7A J;  1CF7 B;  5EG0 A;  1Y1W J;  4IF4 A;  3KCC A;  2NVQ J;  2IVM A;  4B3X A;  2BXY A;  4XKV A;  3D1N I;  2M4K A;  3BR2 A;  5J6X A;  2R7X A;  2LC2 A;  3F0C A;  3CCV I;  4EJW A;  2LKP A;  3CLO A;  1TLH B;  3K4K A;  1FBS A;  4IPA A;  2WC2 A;  3AG4 H;  1FSH A;  3G1L A;  5DS9 A;  3C3W A;  1CF7 A;  4IKF A;  2ELH A;  3BR3 A;  2LMD A;  4L18 B;  2P8T A;  2JN6 A;  1TNT A;  2OCC H;  3K2Z A;  2W48 A;  2STT A;  1B6A A;  1JUS A;  3VYR B;  2OQG A;  4ZZD A;  4CCL A;  2QQA A;  2XVC A;  4BXU A;  1ZRD A;  3MCZ A;  4L9N A;  3LSP A;  2ID6 A;  2HGC A;  2L9V A;  4HEA 2;  3MKZ A;  3WTU C;  5EZG A;  1H8A C;  4R79 A;  2QBY B;  2XGC A;  2CUJ A;  1BC7 C;  4HNT A;  2CWE A;  4OOI A;  3E5Q A;  2X48 A;  2XAQ A;  1W0U A;  4AD9 A;  1U5T B;  3GLL A;  4L5E A;  2O03 A;  1TNS A;  1W7P B;  3BTI A;  3G2B A;  4C3I J;  1ULY A;  3GVA A;  3IUO A;  2OCE A;  4CYD A;  2EPF A;  4XN0 A;  5LRS A;  4CCM A;  4B48 A;  4XL9 A;  4UHT A;  4RDU A;  4ZDO A;  4A3I J;  3TDU C;  2QBY A;  3HPG A;  3PFY A;  2HZT A;  2DA4 A;  4BXF A;  5GAD J;  3OYD A;  1V5F A;  1LNW A;  4A3D J;  2V7F A;  3CCL I;  3PFI A;  2VJ4 A;  2UXX A;  2PJR A;  5AIQ A;  3ZQH A;  2A07 F;  4RM2 A;  1U5T A;  3HUG B;  2GOM A;  2DDB A;  1FMW A;  2UV1 A;  3QP5 A;  3WG7 H;  2P5K A;  1W7P A;  2CUZ A;  4U0V A;  1UHS A;  4TV7 A;  4Q48 A;  2JA2 A;  3SZT A;  2HI3 A;  1MD0 A;  4KIG A;  3ZQL A;  3T8T A;  2I10 A;  1R5I D;  1T38 A;  5DUI A;  4AC0 A;  4IJA A;  2NOG A;  1YQA A;  1XB4 A;  3CJR B;  3PNT A;  5F04 A;  1HW2 A;  3TBI A;  5KAF C;  4WXD A;  2YX4 A;  4U7D A;  1U78 A;  1KU2 A;  1GXQ A;  2K4J A;  5F1R A;  2DMN A;  3HYI A;  3SDB A;  3HUG A;  2CJJ A;  2VOP A;  4B09 A;  4OIP F;  2MH9 A;  1YX5 A;  2IJL A;  4ZDL A;  3MD2 A;  1NHA A;  1PP8 F;  2CQK A;  3E5U A;  3O8G A;  4M6X A;  2MG4 A;  3F23 A;  4BY1 J;  1FPQ A;  1T6S A;  1BIA A;  4YG2 F;  3BP8 A;  1HQC A;  5DM7 F;  4A12 A;  5ICE A;  2Z99 A;  1XDU A;  2FBH A;  3QYB A;  2LRE A;  3C7J A;  3HM5 A;  3Q0V A;  5D6E A;  4IRH A;  1K6Y A;  3QYE A;  4LD5 A;  3M8F A;  5D5W B;  3W2A A;  3IH2 A;  3OYC A;  1KYZ A;  5FKN A;  4XOR A;  3K9T A;  1LJ9 A;  1UG0 A;  1D0X A;  3PSF A;  1XPX A;  2F6C A;  3WTV C;  2MFZ A;  2RVC A;  2O7O A;  3H9J A;  2HTJ A;  3AL0 B;  3CCU I;  1QGP A;  4BQQ A;  3CP2 A;  3F8F A;  4A3B J;  2UWM A;  1WCM J;  1FJL A;  3ABU A;  4LG3 A;  2IPQ X;  2OPT A;  4BNC A;  3REO A;  2DK5 A;  3M8J A;  3I59 B;  2HDW A;  3FM5 A;  2W85 A;  3DEE A;  4LLL A;  4DJA A;  1TW2 A;  3GX4 X;  2PLY A;  1Z77 A;  4UB8 C;  3T5X A;  5L3C A;  5LHH A;  3UKG A;  1WJB A;  2PBI A;  2A6T A;  2FEZ A;  3EUK L;  4RGX A;  1HLV A;  2VBW A;  5DCF A;  5TJJ A;  3JAM K;  4KFC A;  1J7K A;  3HHH A;  4DZJ A;  1P4X A;  2ZXI A;  4FIS A;  1BBY A;  1I50 J;  1VQ9 I;  3I3L A;  1ONV A;  2NNN A;  1S7A A;  1J75 A;  3DBL B;  3RYP A;  2E5Z A;  1XTA A;  3I59 A;  3CES A;  2DYR H;  4D5F A;  2H27 A;  2FU4 A;  3CZ6 A;  1X1C A;  2GIV A;  4PFO A;  3ECH A;  1WI3 A;  3ABK H;  3VPR A;  4OU0 A;  2ZNZ A;  1X2N A;  2VJJ A;  1SVL A;  3BTC A;  4V19 K;  3E5X A;  3B6A A;  1G59 A;  1USS A;  2E36 A;  1MMN A;  1UG2 A;  2NAZ A;  3C2H A;  4FE7 A;  1K6O A;  3F72 A;  1WSU A;  2DOE A;  4CYC B;  2MD0 A;  4XMY A;  4BXX J;  4A3F J;  2GM4 A;  1VQN I;  3HRS A;  3JTH A;  1RES A;  2DO7 A;  1O4X A;  4P5O A;  4GYG A;  4YFN F;  2BHY A;  4XBF A;  4CCN A;  1EV7 A;  3RCO A;  4EVI A;  4IHT A;  3LQQ A;  3FXL A;  5FD6 A;  2R5Y B;  4KT6 A;  3L2C A;  1WH5 A;  1UMQ A;  2VXZ A;  3KEO A;  1VF9 A;  4CYC A;  4OIO F;  3DKW A;  2DOD A;  2H6C A;  1EA3 A;  2JWT A;  4WWC A;  1T0F C;  4V2F A;  4G7Z F;  3RZD J;  1U8R A;  2O6G E;  3M3Y J;  3ISP A;  1XN7 A;  2EFN A;  2YUS A;  1GT0 C;  3IWF A;  2R5Y A;  4P55 A;  4LLN A;  3BC8 A;  2WY8 Q;  1LPQ A;  1EKE A;  2VIX A;  3VFZ A;  2VON A;  5DCM B;  2JSP A;  2HQR A;  2KP6 A;  2YPR A;  5JLW A;  2CV1 A;  4NDL A;  5FKK A;  3E97 A;  1RUN A;  1H9G A;  2VKE A;  5K7H A;  2XB5 A;  3L9F A;  1T95 A;  1P92 A;  3MKL A;  2Y2Z A;  4B47 A;  5K5Q A;  1LDJ A;  3FXR A;  3GBG A;  1H88 C;  1JGG A;  2EBI A;  1ZR2 A;  1YRN A;  3DEU A;  3Q0U A;  1OCC H;  1J0R A;  3BR0 A;  1DGR M;  3OOU A;  2DW4 A;  2B0L A;  1VND A;  1Z9C A;  4KYW A;  3PSI A;  5DCM A;  4QSH A;  2VB6 A;  2W4S A;  3R4K A;  2E1M B;  2EFQ A;  3ERE D;  1TL8 A;  3O3K A;  3ZRG A;  4LOC A;  1ZAO A;  1MBE A;  5HLI A;  1OCZ H;  1BJA A;  3T1B A;  2YU9 J;  4GGG A;  4MQ9 F;  1R23 A;  3K2A A;  4QPQ A;  1KU3 A;  3BPV A;  3CCQ I;  1R1V A;  1IRF A;  4RAY A;  3BJ6 A;  5DM6 F;  2FQ4 A;  4MTE A;  3MZ8 A;  1W36 C;  1ZR4 A;  5E20 A;  2NS7 A;  4J19 A;  3RQ4 A;  2K9M A;  2LVS A;  2HPM A;  2EB7 A;  3A2K A;  1B59 A;  4EGZ A;  1NK3 P;  3AL0 C;  3KEY A;  2D45 A;  1KQ8 A;  4PZJ A;  1MNM C;  4CCJ A;  2NOJ B;  1F9N A;  4NC6 A;  4C2U A;  4UNO A;  1OMI A;  4G8X A;  5HDG A;  1MKM A;  1X1B A;  2COB A;  1BN5 A;  5CPR B;  1APL C;  1ODD A;  4RLQ A;  1I3A A;  1PDN C;  1FTT A;  3JTG A;  1DU0 A;  1S7O A;  1HDD C;  3GF2 A;  2XAU A;  1GV2 A;  1YG2 A;  2VQC A;  3WG9 A;  2M9H A;  1XGN A;  3I55 I;  3J7A O;  4E7S A;  4JQF A;  3CCY A;  1SMT A;  4YIR X;  1KQ9 A;  1TP4 A;  1TWH J;  4A3C J;  4ZZL A;  1H0M A;  3WE3 A;  3CCE I;  1HOM A;  1YJN I;  3WGH A;  2Y0S N;  4R1H A;  4BL0 B;  2FQ3 A;  2AO9 A;  1D5V A;  4JX5 A;  3K1P A;  2VL8 A;  3TP3 A;  3AKZ A;  1B9M A;  2H8W A;  1A6I A;  3S1M J;  3ZGK A;  3FK7 A;  3RKY A;  1TC3 C;  2EH3 A;  3H3U A;  4KUM A;  4PDK A;  1SD4 A;  1ZG5 A;  4WXC A;  5J8C A;  1MH3 A;  2CW7 A;  1FIP A;  5EJC A;  1ETK A;  1KU9 A;  3SYT A;  2KIS A;  1IJW C;  4N4N B;  2HOT A;  2XKO A;  2GIZ A;  4YFX F;  1X2M A;  2Q0O A;  5CVV A;  1EH8 A;  3I64 A;  4RBO A;  2DPD A;  3PNV A;  4A6D A;  2EV5 A;  2X1C A;  2A5Y B;  3RYR A;  2M5W A;  4XLF A;  5CVR A;  2JA7 J;  4MNU A;  4XNF A;  5BOX A;  5HOO A;  2XB0 X;  1BW6 A;  5E1Z B;  4E7H A;  2HYJ A;  1DUX C;  4W1U A;  2WA0 A;  4HX7 A;  3RIR A;  1HKS A;  3S2H J;  1G2H A;  4V2G A;  4G7H F;  1ZAR A;  4M3F A;  3O8H A;  1WI9 A;  5CQE A;  3U9G A;  1YI2 I;  2HDD A;  3AFH A;  5F08 A;  4DQ2 A;  1VQP I;  1FX7 A;  2OC6 A;  4CDG A;  1R5H A;  3V7C A;  1LB2 A;  1OFC X;  2MGQ A;  2QYO A;  5DDG A;  4B43 A;  2AQE A;  2W24 A;  2M3A A;  2QVO A;  5FKM A;  1JJ6 C;  1ETX A;  2LF8 A;  2E2H J;  4IHY A;  3ZN1 A;  4HA8 A;  1WJ5 A;  1D8J A;  4DOZ A;  1GDT A;  5E18 F;  2CQX A;  2M1B A;  3H1C A;  3H3Z A;  1W0T A;  2HVQ A;  1ZLK A;  3K1M A;  1X1A A;  1R49 A;  4CSW A;  1JKR C;  2JRM A;  5E79 C;  2MLG A;  3M8E A;  1ETO A;  5FRN A;  1KON A;  4HBL A;  5ILV A;  1EH7 A;  1N77 A;  2Q2E B;  3EUA A;  3DLL F;  2XAS A;  3OS1 A;  2DFE A;  3JCU C;  5E17 F;  2JZY A;  5F6F A;  1P7I A;  3H92 A;  4XID A;  1YS7 A;  3K70 C;  2QSG X;  2M7B A;  1B72 B;  1FEX A;  2FF4 A;  5FGM A;  2OU2 A;  4P1W A;  3WU2 C;  3V7R A;  2XC7 A;  3F22 A;  2Y9Z A;  2DJI A;  3PUB A;  2QZ8 A;  2R7U A;  2G0E A;  2ADU A;  2F5F A;  4NUB A;  4I98 B;  3WTX C;  2DMT A;  1LDK B;  1UCR A;  2H6B A;  2G7U A;  3KE2 A;  4QWQ A;  4XQF A;  3JRD A;  4I76 A;  1MMD A;  2DDA A;  2Q2E A;  4S05 A;  2BVL A;  1F36 A;  3HKZ A;  1B9N A;  3CTA A;  4L9V A;  1IXS B;  4ASN A;  2EA2 A;  3KP4 A;  1P2F A;  4U87 A;  1ZG3 A;  1B72 A;  2IBD A;  5L3G A;  2E2I J;  2OUM A;  2ZSI B;  1H9T A;  2GA2 A;  3CO6 C;  1GHC A;  2QQB A;  3C2G A;  1YX3 A;  2QWW A;  2X6Y A;  1YOV B;  2VE9 A;  3OYG A;  3FX3 A;  1KGS A;  3R0J A;  4E4H A;  2EWN A;  3ZOB A;  2IXS A;  2LBF B;  4BBS J;  4A3G J;  1WQ2 A;  4HW0 A;  3R0A A;  3GTJ J;  4O3M A;  1XMK A;  2OV7 A;  1MMG A;  2OD5 A;  1Y8Q B;  2H1K A;  4LB6 B;  4LGW A;  4I02 A;  2KQR A;  5H20 A;  1Q1H A;  1JTY A;  1GXP A;  2MBF A;  3ABT A;  1BM9 A;  4EJV A;  3HRU A;  4MFD A;  4HF2 A;  2RC4 A;  1PYV A;  2CS3 A;  5B1B H;  4Z2Y A;  4BQO A;  1Z0X A;  2LBF A;  3OR2 C;  3GW2 A;  3MN2 A;  2PQ8 A;  4XRS G;  1SAN A;  4OIR F;  3IAM 2;  2I8D A;  1SD5 A;  3TO7 A;  1RNL A;  2DA7 A;  3GTL J;  1XSV A;  2BV6 A;  4HAM A;  2IA0 A;  2V9P A;  4MHG A;  3K4C A;  4LK0 F;  3O2P E;  4XIC A;  4CGZ A;  2L9S A;  2PX9 A;  4R8H A;  2DA3 A;  2KHM A;  2RNJ A;  4XR6 A;  4KMF A;  3RI4 A;  3S15 J;  3K4L A;  2Z33 A;  2L54 A;  1FMV A;  1Z91 A;  1VQK I;  2JTV A;  4B8X A;  3GFI A;  3DBH B;  3M1E A;  4M3D A;  2CQN A;  4HV6 A;  4A3J J;  2RDP A;  4MO7 A;  2RQQ A;  1FNN A;  2CRG A;  3TQN A;  4RA2 A;  1GUU A;  3MWM A;  3TKY A;  1FOY A;  3J80 Z;  2QF7 A;  2M87 A;  2P6S A;  2Y30 A;  1ORK A;  2XGE A;  1WJD A;  2WTE A;  4IL6 C;  3BDD A;  2NS8 A;  2NRA C;  2Y48 A;  3OIO A;  2WY7 Q;  4XRF A;  3GTO J;  3G4S I;  1OJL A;  2LR8 A;  3KZZ A;  2V79 A;  1W4M A;  4UUT A;  3DEW A;  4N0B A;  1K79 A;  2IGM A;  1SFX A;  5CLS A;  3RJP A;  5GAE J;  9ANT A;  3CF5 F;  1F4K A;  5HNH A;  2CW8 A;  1RZ4 A;  2XAF A;  2X6X A;  1FLI A;  3PO2 J;  1U2W A;  1R4M B;  4AVP A;  3A01 B;  4XSX F;  2O5R A;  1PUF A;  1MMS A;  4FCY A;  1FYL A;  4IHX A;  2KRH A;  4I0B A;  2W7N A;  3A02 A;  1UZC A;  2RNG A;  3GZ6 A;  5GPC A;  2VPR A;  1I1S A;  1ETV A;  1OR7 A;  1O3Q A;  4IHS A;  4D7N A;  4EV0 A;  4D9J A;  5DD8 A;  2R7R A;  1IAW A;  4OIN F;  5FJ8 J;  4HRI A;  2MSY A;  4DIQ A;  2BHZ A;  1S8N A;  3IV5 A;  3RTR A;  4BEH B;  2WB1 A;  3D5R C;  2FNP A;  3OIP A;  3BR6 A;  3ZMD A;  4PJN A;  2WWY A;  1U0J A;  2ZJ2 A;  5EYR A;  3I56 I;  4A0Y A;  4A3L J;  4JX4 A;  2XUB A;  4O6J A;  3A4C A;  3J80 K;  3E6C C;  3B6C A;  2V9V A;  1R00 A;  2VBY A;  2WV1 A;  2YX7 A;  5D4R A;  1RUO A;  4L5J A;  1RET A;  2KIQ A;  2XSJ C;  2KPM A;  2EFW A;  2HDC A;  4BEH A;  2NYX A;  1OYY A;  2BXZ A;  3JR9 A;  3HXL A;  2DT5 A;  5LEK A;  1TW3 A;  1S7E A;  3FBN B;  1BOA A;  5D4S A;  3LSI A;  2BOL A;  4X6A J;  1QZZ A;  3EDP A;  2DN0 A;  3T0Y A;  3U21 A;  4KDP A;  1V55 H;  2X1E A;  3FDY A;  5EDN A;  3TOB A;  4AWX B;  5IP7 J;  1R9T J;  3DU5 A;  1O57 A;  3SZP A;  5K5O A;  1QO0 D;  5E8G A;  1IDY A;  3S1N J;  4BDZ A;  2Y31 A;  1BR2 A;  4DZP A;  1MH4 A;  2A61 A;  4GCV A;  4E7L A;  2IEK A;  1UHM A;  3H3V K;  2GQQ A;  1LVK A;  3ZQF A;  4Y15 A;  3GTG J;  2WAE A;  3S17 J;  3COA C;  4IVN A;  5L3F A;  1BR4 A;  3WE2 A;  3KYC B;  2XRO A;  1YYV A;  5HDK A;  3BG3 A;  3NAU A;  4E7J A;  3IHU A;  5J4Y A;  1S5L C;  5CJ9 A;  1IUF A;  4AIJ A;  3RZO J;  4EM1 A;  2K85 A;  2ZXW H;  3VB2 A;  3J7A Y;  4YIF A;  3PJR A;  1OCR H;  5CQG A;  2VKD A;  3LA7 A;  3HOU J;  5LD2 C;  3CCM I;  2LOO A;  2OAZ A;  2CV0 A;  2E1C A;  1WWX A;  2DFH A;  3K4B A;  3U1D A;  1FP2 A;  1PJR A;  2L3D A;  3BZ6 A;  4YII A;  1WKM A;  1A04 A;  2IS4 A;  4CO8 A;  3PUF A;  4ETS A;  2F5V A;  4HF0 A;  3LL7 A;  2M2E A;  2BZT A;  2JA5 J;  4UUS B;  3HSE A;  5M5W J;  2XAJ A;  3N4M A;  4BGD A;  2L7K A;  3NWS A;  4E7I A;  1ZGA A;  1NH3 A;  4WXH A;  2FNA A;  4M3G A;  3IRQ A;  2NXN B;  3CUO A;  4ZTF A;  5IT9 Z;  3IC7 A;  4UY8 I;  1EJ9 A;  2ZJQ F;  4C3J J;  5JI6 A;  2AHQ A;  4P96 A;  2K4B A;  3LSG A;  3I54 A;  2R5Z B;  1OR7 C;  2LY9 A;  3JAM Z;  1LFP A;  3RKX A;  5HLT A;  3OYB A;  3J81 Z;  2Z2S B;  2K5C A;  2MC4 A;  1U6G A;  5L3D A;  1Z67 A;  3MFK A;  4UUS A;  2WBM A;  1T39 A;  3KZI C;  2CO5 A;  2D5V A;  5IP9 J;  2YU3 A;  2JUG A;  3S1Q J;  3G3Z A;  2B63 J;  2VOD A;  3RPU D;  1QZY A;  2OZ6 A;  2O9L A;  1REP C;  2XHK A;  5ICC A;  4HDV A;  3HIF A;  2R5Z A;  1HSJ A;  4AIH A;  2Y75 A;  2QSH X;  1EH6 A;  1HA8 A;  4AIK A;  2LY2 A;  3L00 A;  1OIS A;  1POG A;  1G8X A;  2IGO A;  5J47 A;  3N05 A;  5LHG A;  4BUP A;  2HVS A;  4L5I A;  4A3K J;  1OPC A;  1V5E A;  3SQN A;  2ESH A;  2FA5 A;  2IRF G;  4F55 A;  4FHT A;  4A93 J;  3FXK A;  4F92 B;  3DQV C;  4DBQ A;  1E3O C;  2XSD C;  3OIQ A;  3RPQ A;  4BS9 A;  1KZH A;  3OYI A;  3ZQI A;  5FLM J;  4RAG A;  5HLH A;  2DYS H;  3R61 A;  3L2U A;  5EEA A;  3L2R A;  5IT9 K;  2EIJ H;  5J3L A;  1WFX A;  1RI7 A;  2PN6 A;  2JK3 A;  3BRO A;  4EEF G;  5LRR A;  2LKX A;  1NK2 P;  3BQY A;  2K02 A;  1FP1 D;  4RGU A;  5IT3 A;  2VUM J;  5LBQ A;  1R6R A;  5KNL A;  4LB5 A;  4EJT A;  2DPU A;  3J81 K;  3OR1 C;  2IT0 A;  4N9H A;  1G3W A;  4I2O A;  2W1O A;  1I6X A;  2Y0M A;  2L7M P;  1M1E B;  2CUF A;  4KA4 A;  1BIB A;  4N9I A;  3GFJ A;  3JSO A;  2BGC A;  2GAU A;  1JUM A;  3QRF F;  5JVT A;  2HWV A;  4MTD A;  2D1H A;  2KIM A;  3QYF A;  3RQI A;  4IHW A;  4D1Q A;  4I0A A;  3KP3 A;  3CC4 I;  3VWB A;  5BQT A;  2OA4 A;  1DQU A;  5H6R A;  1TT5 B;  1FOW A;  2K27 A;  1WJE A;  3LFK A;  2LD5 A;  3GXO A;  2A6E F;  1P9Q C;  2P4W A;  4QTR A;  5FB2 A;  3WGG A;  1TZL A;  2DJN A;  3P9I A;  1JHH A;  3PIP F;  2FOW A;  4CA0 A;  1ZEL A;  4XOT A;  3HGG A;  2DQL A;  1U5T C;  5EZH A;  2EIL H;  4EJU A;  1P6R A;  1XSX A;  5J40 A;  5HVQ C;  2V26 A;  1TWG J;  3KYD B;  2KZG A;  3A03 A;  3HSR A;  2X6W A;  5CVU A;  2ZBK A;  4B44 A;  1WPK A;  3TW6 A;  1XDS A;  3CD6 I;  2DOF A;  1Z7L A;  3LSM A;  3RDI A;  3CUQ B;  3GWZ A;  2TCT A;  5D5U B;  3K4M A;  3SFI A;  4M3B A;  2QA4 I;  3S93 A;  2XPU A;  3SDG A;  4O5V A;  2H1L A;  1KYW A;  4HV5 A;  2ZFW A;  1P4A A;  2LTP A;  1YIJ I;  2AXT C;  2XIG A;  4CIC A;  4G6T B;  4K2E A;  2AQF A;  2VQH A;  3JRG A;  1S3J A;  3I4M J;  1MDM B;  4UV9 A;  4AYB A;  1VI0 A;  3ZMV A;  1QHG A;  4UVA A;  4EJO A;  2IAI A;  5D5V B;  2CW0 F;  4ENJ A;  3C18 A;  2FSW A;  3CUQ A;  2MYS A;  4NC8 A;  3GEZ A;  4RB0 A;  4A69 C;  2G7H A;  2L7Z A;  2HOA A;  1U9O A;  1YHQ I;  1IDZ A;  3VYT B;  2YSR A;  3BT9 A;  3KYL A;  3HGY A;  4HYE A;  2VE8 A;  1JGS A;  2NVY J;  4BE1 A;  1MDM A;  3BR1 A;  2JRT A;  3OV8 A;  3ABM H;  3DCF A;  4EM2 A;  2R4G A;  3QPS A;  3NQO A;  3BJA A;  3HZJ A;  2V1U A;  3FHZ A;  2DMP A;  2M8E A;  2A3S A;  3TGN A;  3TO9 A;  1J2X A;  4FAS D;  2GA1 A;  2DCE A;  2P7V B;  4BU2 A;  2CFX A;  2D2W A;  1BR1 A;  2DFF A;  2HPI A;  2P6T A;  1F5T A;  1BL0 A;  4BE2 A;  1ZRE A;  3U1K A;  3SFZ A;  2R0Q C;  2G9W A;  3WTW C;  3OYA A;  3M9A A;  4WK8 F;  3JSP A;  4C9Y A;  2E1O A;  2LSO A;  2GBY A;  1VQ5 I;  4F91 B;  3BTJ A;  2H94 A;  2A6H F;  2LKS A;  2VXD A;  2XDV A;  3OYL A;  5GTH C;  3VSL A;  2KRF A;  1TTY A;  3QU3 A;  4FT8 A;  4EM0 B;  3V8K A;  4A2U A;  1VQO I;  4EGY A;  1O3R A;  2ELK A;  3H0D A;  4GFB A;  2DQR A;  4CH7 A;  3B73 A;  2MA3 A;  1H89 C;  3F8B A;  4F93 B;  3D5L A;  2QKM B;  4M3E A;  5CKT A;  1BC8 C;  3ZQQ A;  4PFP A;  3K70 D;  4E7K A;  1WHU A;  2HXO A;  3OMY A;  3TP0 A;  3S8P A;  5K7F A;  3SJM A;  3BOQ A;  2Y9Y A;  2NVX J;  3EPZ A;  5TGT A;  4H0E A;  5F27 A;  4DBR A;  1R5G A;  4NB5 A;  5ERI A;  2VQG A;  2O0Y A;  3FMR A;  3HKZ N;  2EFP A;  3JRA A;  1R4N B;  4NQW B;  3QPL A;  1F43 A;  4PGG A;  2HU9 A; 
#chains in the Genus database with same CATH homology
 3K4K A;  2OV7 A;  2LG4 A;  1MMG A;  4BQN A;  2KL4 A;  1D1C A;  4IKF A;  3F9K A;  3OS2 A;  3DTE A;  3LMM A;  2KQR A;  3OL4 A;  3BCB A;  4CZC A;  1VZ0 A;  1WJC A;  1WJA A;  3DWL E;  1PYV A;  2CS3 A;  5FRM A;  2KRC A;  3W3C A;  4BQO A;  3VYR B;  2LBF A;  4CCL A;  3OR2 C;  3RSN A;  3IAM 2;  2I8D A;  4HEA 2;  3MKZ A;  4R79 A;  2CUJ A;  3E1S A;  4HNT A;  1TT0 A;  4IQJ A;  3K4C A;  3MMY B;  2L9S A;  1X1D A;  4PK4 A;  2KHM A;  4XR6 A;  2DT6 A;  3K4L A;  3G2B A;  3SEZ A;  4IZZ A;  4PUS A;  1FMV A;  4IX7 A;  2LYC A;  3IUO A;  4YRV A;  4XKB A;  4F52 A;  5LFA A;  4RMN A;  4XN0 A;  4XM3 A;  2RRE A;  4CCM A;  4B48 A;  4XL9 A;  4BJ6 C;  2A5W A;  4ZDO A;  3FKJ A;  3DTI A;  1SAU A;  2RQQ A;  3BLY A;  3HPG A;  3PFY A;  4BXF A;  3OYD A;  4X0G A;  1V5F A;  1D0Z A;  3K6G A;  2V7F A;  3OYK A;  2M4G A;  2VJ4 A;  2PJR A;  2IS2 A;  4RM2 A;  3CJQ B;  3HUG B;  1WJD A;  2GOM A;  1MW7 A;  1FMW A;  2UV1 A;  2KDO A;  2WY7 Q;  2ZFU A;  2CUZ A;  4EAT A;  1GLN A;  2JA2 A;  2R7Q A;  3DLA A;  3W2W A;  3CP8 A;  3CJR B;  3DKY A;  3PNT A;  2VPL A;  3TBI A;  2FUG 2;  2IGM A;  3K4J A;  3TMO A;  5KHD A;  5HNH A;  2CW8 A;  3K4N A;  2X6X A;  3SDB A;  3LSH A;  2HVR A;  1YX5 A;  2O5R A;  4ZDL A;  2KRH A;  3MD2 A;  4KIS A;  2W7N A;  2RNG A;  2L5Q A;  3OY9 A;  2BW3 B;  2K9L A;  2E1M C;  2VQL A;  4PSW A;  4E6K G;  1MMA A;  4D9J A;  2R7R A;  3HL2 A;  2DT7 B;  4HRI A;  4DIQ A;  3QOE A;  2QKL B;  3RTR A;  4BEH B;  3QYB A;  5FRO A;  2LRE A;  2UUZ A;  2WB1 A;  3D5R C;  3OIP A;  1K6Y A;  3QYE A;  4XKW A;  4II3 A;  4PJN A;  1U0J A;  3W2A A;  3OYC A;  4PSX A;  4C30 A;  4XOR A;  2F4I A;  3KX2 A;  1UG0 A;  2Z16 A;  1D0X A;  3PSF A;  3BG6 A;  2BW3 A;  2F6C A;  2MFZ A;  3H9J A;  3A4C A;  4C2T A;  4RLF A;  3AL0 B;  3S3N A;  4BQQ A;  3CP2 A;  1WJF A;  2CV2 A;  2X51 A;  2UWM A;  2XSJ C;  2KPM A;  2WAQ A;  4LG3 A;  4BEH A;  3DPL C;  2W82 A;  3HXL A;  2CH0 A;  4BE0 A;  3FBN B;  3M8J A;  3LSI A;  2BOL A;  4DJA A;  2HDW A;  3DEE A;  2BVM A;  1WJB A;  3U21 A;  4FET A;  2X1E A;  3FDY A;  2A6T A;  4NC7 A;  3OS0 A;  3EUK L;  4HG2 A;  3DU5 A;  4NNJ A;  4F3Q A;  4OWR B;  2IGK A;  4BDZ A;  3S3M A;  2ZXI A;  4KIT B;  1BR2 A;  3D5S C;  3I3L A;  4E7L A;  1N75 A;  2E5Z A;  3OWT A;  3CES A;  2XF5 A;  4Y33 A;  4ZYA A;  3OYN A;  4HNU A;  1LVK A;  1X1C A;  3CZ6 A;  2WAE A;  4PFO A;  2M0M A;  4E7Z A;  3CMM A;  1MND A;  3L2W A;  2L2O A;  2VJJ A;  1BR4 A;  1Z3Y A;  4MLO A;  3L2Q A;  3LSK A;  2CFO A;  3SZG A;  4E7J A;  1G59 A;  4JOM A;  4ITV A;  1MMN A;  3C2H A;  2W00 A;  2MD0 A;  4XMY A;  3J7A Y;  4DGW B;  3PJR A;  3DPU A;  4J00 A;  3BCA A;  2VKD A;  5CQG A;  5LD2 C;  3HPH A;  3NWT A;  1SFK A;  2LOO A;  4P5O A;  3VSK A;  4CCN A;  3RCO A;  2CV0 A;  3PNY A;  4KT6 A;  3V42 A;  3K4B A;  1PJR A;  2CMP A;  4Y3O A;  2VXZ A;  3SEQ A;  1X19 A;  2V6E A;  2IS4 A;  1LKX A;  3H9Q A;  3HOT A;  1NG7 A;  2VAS A;  4Y4R A;  2KLO A;  2F5V A;  1EA3 A;  3LL7 A;  1T0F C;  1E0E A;  4BGD A;  1YE9 A;  2L7K A;  3NWS A;  4E7I A;  4KJZ A;  5KCM A;  3A1Y A;  4II2 A;  1Z3X A;  3BC8 A;  4ZTF A;  4XLC A;  2WY8 Q;  2VIX A;  2JSP A;  2KP6 A;  2L9N A;  4BJT A;  2CV1 A;  3LSG A;  4HPQ A;  3VYU B;  1OR7 C;  1LFP A;  5HLT A;  3OYB A;  2JVG A;  4B47 A;  1T95 A;  2Z2S B;  2K5C A;  2MC4 A;  4GRI A;  1Y6I A;  2WBM A;  3GBG A;  1S9H A;  2JUG A;  4RM3 A;  3RPU D;  1DGR M;  3OOU A;  4CCO A;  3PSI A;  2VB6 A;  2W4S A;  2E1M B;  3E0J B;  2Z1D A;  3HG9 A;  1Y56 A;  3ZRG A;  1ERD A;  3H9G A;  4HST A;  2PMZ A;  4QPQ A;  1V5G A;  1HA8 A;  2LY2 A;  2DOA A;  4CCK A;  2R7O A;  1G8X A;  1J09 A;  2IGO A;  4OAZ A;  3OL3 A;  4ZC3 A;  3MKY B;  3N05 A;  4PJL A;  1W36 C;  4BUP A;  2HVS A;  3FHN A;  1X4O A;  2LY1 A;  1V5E A;  3H5A A;  3RQ4 A;  2K9M A;  2VLA A;  3DKX A;  4F55 A;  2HPM A;  3OYE A;  4F92 B;  3DQV C;  4DBQ A;  3A2K A;  3OIQ A;  4BS9 A;  3AL0 C;  3CF2 A;  3KEY A;  4PJM A;  3OYI A;  4CCJ A;  2NOJ B;  4ZDP A;  4C2U A;  1X4P A;  3L2U A;  3L2R A;  3UR3 C;  1X1B A;  2MAB A;  3VYS B;  1WFX A;  2ELJ A;  3QOD A;  2Y0S A;  5CPR B;  2ZXH A;  1QHH D;  4RLQ A;  4BAC A;  2HQA A;  1R6R A;  5KNL A;  2JVH A;  3HC7 A;  3OR1 C;  4H4K C;  2XAU A;  2VQC A;  2W1O A;  4LIT A;  4CUG A;  4XN3 A;  3TL4 X;  4E7S A;  4JQF A;  2IS1 A;  3IAS 2;  4LIV A;  1Z21 A;  2V1N A;  2LH9 A;  1AA7 A;  3QYF A;  1DGW Y;  3OYM A;  4BL0 B;  4D1Q A;  4QPO A;  3MKW B;  3VWB A;  2VL8 A;  3AKZ A;  3OYJ A;  1DQU A;  3ZR8 X;  3ZGK A;  1WJE A;  3H35 A;  1P9Q C;  4AVZ A;  1D1B A;  1D0Y A;  4XLH A;  1TZL A;  2E5N A;  2CW7 A;  4BDY A;  3SYT A;  1BOB A;  4N4N B;  1QU3 A;  4CA0 A;  5HNF A;  2IS6 A;  2R7W A;  1ZEL A;  3LFU A;  4XLA A;  4XOT A;  3IP4 B;  2VJ5 A;  3PNV A;  5HVQ C;  2V26 A;  2X1C A;  2P0W A;  2K3P A;  4XLF A;  2X6W A;  2PJR B;  4XNF A;  2V9K A;  4B44 A;  3L2V A;  5HOO A;  3M1C A;  4ZTJ A;  1Z7L A;  4E7H A;  3LSM A;  2WA0 A;  3K4M A;  1UAA A;  3H5R A;  3S93 A;  3OYH A;  1N78 A;  5CQE A;  2HNH A;  3BG7 A;  3AFH A;  3DU6 A;  4G6T B;  2AQF A;  2HZD A;  2VQH A;  2WAD A;  2VKH A;  2OC6 A;  4XON A;  3S32 A;  4HSR A;  4AYB A;  3S3O A;  1QHG A;  2Q1Z B;  2R7T A;  4B43 A;  2AQE A;  2M3A A;  2ZSH B;  2MYS A;  4NC8 A;  4BJ5 C;  1DP3 A;  1WJ5 A;  2WAF A;  4LIU A;  4DOZ A;  4YEJ A;  2GOX B;  2X85 A;  3VDX A;  1D1A A;  4XKC A;  3H5N A;  3ONQ A;  3VYT B;  3KYL A;  3PL8 A;  4IQ4 A;  2HVQ A;  3DTK A;  2XF6 A;  3EUH C;  1X1A A;  4PJJ A;  4BE1 A;  4CSW A;  3FBI B;  2R4G A;  4J01 A;  2XF7 A;  5FRN A;  1KON A;  1N77 A;  2KMU A;  2Q2E B;  3EUA A;  4FAS D;  5JHF A;  2DCE A;  3OS1 A;  4BU2 A;  1BR1 A;  2HPI A;  3OYF A;  1NG6 A;  2X1D A;  3ZCO A;  3K70 C;  2M7B A;  3W2V A;  4XLE A;  4BE2 A;  3DPT A;  2R7V A;  2E60 A;  2XC7 A;  4P1W A;  4N4O B;  1UEL B;  3OYA A;  2DJI A;  3PUB A;  3I9V 2;  4C9Y A;  2R7U A;  4NUB A;  4F91 B;  1LDK B;  1MNE A;  3HOS A;  3ZXS A;  4XQF A;  2M7A A;  2VXD A;  2XDV A;  3OYL A;  2KZV A;  1OLT A;  1MMD A;  3VSL A;  2BVL A;  3HKZ A;  1JI8 A;  2VJI A;  3H0D A;  4U87 A;  1IRX A;  4OAY A;  4AU7 A;  4CH7 A;  4U7B A;  2OUM A;  4ANJ A;  2ZSI B;  4F93 B;  3D5L A;  2QKM B;  3UNG C;  5CKT A;  4ZJZ A;  3ZQQ A;  4PFP A;  3K70 D;  4E7K A;  3OMY A;  1W36 D;  3C2G A;  1YX3 A;  3S8P A;  2X6Y A;  4B3X A;  4XKV A;  3OYG A;  3EPZ A;  5TGT A;  2LRD A;  3K10 A;  2DXI A;  2IGN A;  4DBR A;  2M4K A;  4E4H A;  2R7X A;  4XOP A;  2LC2 A;  2IXS A;  2R7S A;  2LBF B;  2V4J C;  2VQG A;  4NQW B;  4YEL A;  2HU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...