2L9SA

Solution structure of pf1 sid1-msin3a pah2 complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
45
structure length
45
Chain Sequence
SNADYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the mSin3A PAH2-Pf1 SID1 Complex: A Mad1/Mxd1-Like Interaction Disrupted by MRG15 in the Rpd3S/Sin3S Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PHD finger protein 12
total genus 5
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1860 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l9sA00
2L9SA
chains in the Genus database with same CATH superfamily
2IPQX 2OTJI 2RKHA 3WHBA 1HLVA 2EIMH 3RZOJ 4MGRA 4TV7A 2IA1A 5EG0B 1BL0A 1SD4A 2H8RA 2ZC2A 1XD7A 1JXSA 2IA0A 1I1GA 5FLXK 1I6XA 5KCMA 2A05A 3I0TA 2QENA 3X2QH 2VKEA 3IC7A 1MIJA 4EQQA 3M07A 4IEJA 3GTGJ 4N4OB 1K4TA 4JK1X 3JRAA 1STZA 1S9HA 5IT3A 2M0CA 4EATA 2HYJA 3H35A 1G3WA 2EZIA 5CPRB 4CZZA 1X1PA 1RZ4A 4O5VA 3L2UA 1A31A 3S3OA 1GVJA 2GA2A 4P5OA 3C2HA 4B48A 2K9NA 4OIQF 2DN0A 1F9NA 5M3FJ 2RV8A 3SYTA 3CCMI 2CW7A 2XRNA 1HCRA 1AOYA 4OOIA 2PJRB 3DEWA 3K9TA 3RPQA 1XN7A 1B8IA 3KE2A 4M72A 4B8XA 3L09A 3IV5A 2M2EA 4I09A 4M3GA 3I56I 1W7PD 2LK2A 3HG9A 3PFIA 1SFOJ 3CP8A 6PAXA 2XB5A 3RKQA 1Y6IA 2HQAA 3JRFA 2DXIA 1UHMA 4FT8A 5K5RA 5KVRA 3Q9VA 1IF1A 4FTHA 1KONA 2DT7B 5ICGA 2K9SA 2L02A 3FK7A 3CCYA 4FQGA 1GHCA 1XPXA 2OV7A 4ESBA 4NQWB 1XSDA 4GGGA 1ZELA 2P7CB 2DT5A 1PJRA 2X6OA 3AG3H 1BI2A 2DQLA 2E35A 3GTQJ 3PNTA 3I3LA 3TGNA 5EZHA 3VYUB 3GMEA 3LFUA 2M9HA 2WBMA 5C44J 9ANTA 2VB6A 2EZKA 4AUXA 1PUFA 2ZB9A 4PCQA 1ZRFA 3IL2A 1ZARA 2ZXWH 2K9LA 3RCOA 2HYGD 1SANA 4NUBA 4HZFA 2STTA 3IKTA 5E3LA 4PK4A 4AVZA 2LSOA 3ZQ7A 1OFCX 3FBNB 5HS7A 5E3OA 3PSIA 2KP6A 5EEHA 2PBIA 1TWFJ 2ID3A 2LNBA 4PGHA 5ILVA 3ECOA 1SMTA 4ZYGA 4IO9F 4LITA 2XPWA 4M3BA 1JKQC 1GV5A 5F64A 5LEJA 4WXHA 3ZOBA 1G3YA 3CUQC 1GXQA 2JPCA 5E3MA 3K4CA 1H8AC 3SZGA 5DV5A 2VKVA 2VC0A 4B3XA 4C3IJ 2JUGA 5DYMA 2KMUA 3OYCA 5L3EA 1P9QC 2HXOA 2RN7A 3IHUA 4CDGA 2F4OB 4C30A 4XM3A 3ZMDA 4B09A 4MIMA 2FA5A 3JSPA 5D5XB 3MN2A 1V5EA 2EK5A 3HIFA 2B63J 2DFIA 1SEUA 4YRVA 1ZGWA 4RB1A 3PL8A 3HRUA 5E20A 3OYEA 2XSJC 1USTA 4FX4A 2RQPA 5FLMJ 1UAAA 2Z5UA 5LD2C 1EH6A 2DMNA 2Y9ZA 5HDNA 2WC2A 5TRDA 2ZMEA 2BY0A 3HGGA 3U21A 3OSGA 1IC8A 2EBIA 2EA2A 3ZCOA 1WRJA 1QBJA 5CKTA 1RESA 2Z3YA 3EQLF 5E17F 2P81A 4P1WA 3C3WA 3ZMTA 4M3DA 3BJ6A 3ZQLA 3JRCA 1FBQA 4M71A 5DM7F 2I10A 5L3FA 1LB2A 3EUKL 2MSYA 2D1VA 2LTPA 2IGOA 3OYNA 1ONVA 1OR7A 1R49A 3BT9A 3LSJA 3HKZN 4IRHA 4ZJZA 3LA7A 2DCEA 3ERED 3WTYC 1P4WA 1IUFA 1X4OA 2EB7A 5AIPA 4F52A 2R7DA 4LD5A 1D3YA 3HHGA 1T08B 2KLOA 5J3LA 2QYOA 2XHKA 4B44A 1I3QJ 4LB5A 1OR7C 5F0HA 3HB9A 3S2DJ 2P6TA 3DPLC 1SFXA 1FWZA 2CRGA 4E7LA 1J59A 1NK2P 4W1UA 2VE8A 2HPMA 1DU0A 3BOQA 4XOPA 2DYSH 4PFPA 1IXCA 4PJMA 4F55A 1TT0A 1MBFA 2L4MA 1U78A 2HOAA 1FTTA 2KKOA 3D0SA 3KZZA 1D8KA 2ZMEB 2V6EA 2X48A 4XN3A 1LKXA 4CO8A 2B0LA 4G94A 2BGCA 4I99C 2XUBA 4AWXB 4BDZA 3HOWJ 4YFKF 2RNGA 4ON0A 4JYKA 2ZXHA 1ZTRA 2JSCA 1UCRA 5LBQA 5HLTA 3CCUI 4I01A 3JRGA 2EFPA 2Z1DA 3LSRA 5J1RA 5JFRA 4RBOA 3HOVJ 3COAC 2EA4A 1P6RA 4LLLA 3W6VA 1RC9A 4IHTA 5CLSA 4J00A 4I6ZA 3L2VA 4BU2A 1E3PA 2XSDC 1O4XA 3DPUA 2GLOA 2ZFUA 1VQ6I 5C4XJ 2IW5A 3BTJA 2FQ4A 1OPCA 4BNCA 3DTIA 3KP7A 4H0EA 1UJ8A 3QYBA 4DW6A 1JE8A 3EUHC 4A3EJ 3R0JA 1H9GA 1IAWA 1JUPA 5L3DA 4XR6A 1R5HA 4BACA 1EJ9A 4LIUA 1I5ZA 2TDXA 3ZRGA 3HOXJ 4FE4A 1J75A 4A3GJ 4LFUA 3K4MA 5DS9A 4KIBA 1FIPA 4UXNA 3JAMZ 4RA2A 1FBSA 2EWNA 4DQ2A 2A5YB 2KQRA 4HQEA 2DBBA 1FOXA 1ZG3A 4D5FA 2V79A 3GO5A 2VBWA 3HBLA 3OR1C 1FX7A 3OYGA 2OZ6A 2WTEA 1J9IA 1WSUA 3VOEA 5CVUA 2VONA 2JVHA 1S7OA 3NWSA 2QKLB 4NQWA 3ML6A 4U88A 4QTRA 3TKYA 3AKZA 2W1OA 4R79A 5F04A 2AQEA 2FOKA 2XASA 1TWHJ 1T6SA 3H5RA 5CVIA 4AD9A 1TLHB 4GO1A 1IN7A 2R7UA 3CO7C 2H1KA 4XIDA 1ZQ3P 2LD5A 3Q0WA 2NVXJ 1FC3A 2VPLA 4XK4A 1U2WA 3W6KB 4BBSJ 4U7DA 1YHQI 2EIKH 3LSGA 3OS1A 1X1AA 4GRIA 1RI7A 2QWWA 2W84A 2K85A 1IRFA 3FXLA 2FBIA 4BGDA 2DPDA 4X6AJ 1LJ9A 1XG1A 2KL4A 2LP0A 5J40A 3F23A 1YW8A 4DOZA 3QU6A 2NRAC 4IHVA 2DFHA 2DPUA 2KDZA 3KP5A 3HTUA 1T2KA 3K4KA 4HSTA 1BR1A 2CU7A 4CZCA 4Q4ZF 1W5SA 2XGDA 3U2RA 1ZN2A 5HS8A 4YEJA 1YQAA 2VODA 5ED4A 1WPKA 2M0MA 3WTXC 2QM3A 4OINF 4ESJA 2P5VA 4RGUA 3GLLA 1TWGJ 2L54A 3FXUA 2O3FA 3OYFA 3DLLF 2KRCA 3GTMJ 2KISA 3CTAA 4RLFA 3E5QA 2NOGA 2CH0A 3E6MA 1X3WB 1G8XA 3ZQQA 1B9NA 2DA4A 2H94A 2Y75A 3N05A 2MC4A 3BR1A 4A93J 2YX7A 1JUSA 1KYZA 4I7HA 1GLNA 2QVOA 1I27A 4HV5A 3GW2A 3MQ0A 3HXLA 4E6KG 2K4JA 2PG4A 2W85A 4LOCA 3OYJA 1RUOA 2QZ8A 1W0UA 5HNFA 3GLXA 3A01B 3QP5A 2JSPA 2PMUA 3QODA 4P9UA 3FXKA 3VDXA 2NS8A 2HPIA 3GZ5A 1MNMC 1LEBA 4C2MJ 3FMSA 2K86A 3RI4A 3BR6A 3M7GA 1OCPA 1POGA 4CUGA 1YS7A 2ZSHB 3QPSA 5FKKA 3S2HJ 4ENMA 1O3RA 2HDCA 2F5DA 1OLTA 4A0XA 3JAMK 3ZN1A 2PEXA 4CA0A 4M9SA 4PJLA 4KNYA 2BXYA 2H1LA 4DGWB 1MH3A 3U9GA 2IS4A 5BPDA 4I0AA 4CXFA 3HSEA 5BOXA 1D1BA 2EQRA 3CD6I 4PDKA 2VJJA 3HZJA 1XX5A 1MJAA 3FXJA 1RR8C 1MBJA 4L0ZB 4HQMA 3UNGC 2CUZA 4C9YA 3G6EI 3VFZA 3PSFA 2W57A 1UHSA 4H4KC 3HRSA 1B9MA 4HF0A 4EMSA 2LRDA 3L2CA 2PQ8A 1WJDA 3K2AA 4XLAA 2E5NA 3TOBA 1W7PB 1QVTA 2UXXA 4PJJA 1JTYA 5J8FA 5HLIA 3J81K 4IJAA 4S0HB 1W7PA 1X3UA 3OYHA 1F36A 1U3EM 3PO2J 3QP6A 3TMOA 5FJ8J 1QRYA 1FMWA 1OJLA 3KYDB 3VEPA 4FCYA 4PFOA 3JW4A 1ACIA 2PI0A 2L7FP 2EJRA 1K78B 2XF5A 5EGOA 2W48A 3F0CA 1N78A 1ENHA 3OIPA 3KYCB 2HKXA 2LF7A 2O5RA 3ELKA 3S3NA 1ZREA 2EFQA 1SVLA 1ZGAA 2BY2A 1WJCA 3VPRA 4M74A 3TOAA 2K40A 3ABKH 3WTWC 1MD0A 2UXNA 5E8GA 2LY2A 4BQOA 2CV0A 4EVIA 2W24A 1Z1DA 3NAUA 1TL8A 1JHHA 2LLKA 1MDMA 3T8TA 3LFKA 3RDIA 1OYYA 2E2JJ 5IT9K 3BR0A 3GFLA 1VQNI 1EKEA 5CVRA 4M6YA 4NC7A 2WY8Q 1PDNC 3D1NI 1DDNA 5KAIC 2ZSIB 2HOTA 2L9VA 3JRDA 3BJOA 4WWCA 1OISA 3TL4X 4XQFA 4RGRA 5AONA 1D0ZA 4XSXF 1W36D 2R7RA 1SD7A 1BW6A 5J1UA 2DT6A 1BIBA 1RR7A 2QUFA 2DMPA 2PFBA 4JX5A 3LSMA 2WV1A 1YRNA 2ELKA 1TW2A 4KT6A 2B9SA 4M3EA 4NC6A 2DO7A 1LVKA 5IPAA 1Q1VA 3GTJJ 3GUDA 5FD5A 2QCOA 4D7MA 4UB6C 4XNFA 5ICCA 3GTPJ 2NS7A 4GYIA 4A3FJ 2FSWA 2A69F 2Q0OA 4UVCA 3CMAI 3RYPA 4Y4RA 1VQ9I 1K61A 3W2AA 1Z67A 4BKXA 4Y15A 2Q2EB 4F92B 4OWRB 4YIFA 4HA8A 5EF6A 5LHHA 4AM3A 3BPXA 3O3KA 3RKXA 5IP6A 1KQ8A 1JT0A 2ECCA 3HPHA 2V9VA 2JVGA 4G6DA 2BVLA 2YUSA 4Q47A 4A5MA 4A0ZA 2JRMA 2VKHA 3C18A 2R4GA 2DMQA 2FE3A 4EM0B 2P8TA 3P9CA 4BQAA 1AHDP 3MKWB 3VWBA 1HQCA 2O61A 1ZYRF 2NXNB 1ZLJA 3H3VK 1UFMA 3ZQCA 3D5RC 5FD6A 2QLZA 2H8WA 2VPRA 4DBQA 1MBGA 2DYRH 1BI3A 1HC8A 2XGEA 3FXQA 1BBYA 3R0AA 4P55A 4LIVA 4XRSG 1A6QA 5B1AH 4BHPA 3HHHA 2NVUB 4HX8A 1OCCH 3QYFA 4FASD 2GBYA 2UZKA 2VASA 5E18F 5L3BA 4UV9A 2L7MP 4PUSA 2M7AA 4NNJA 2PMHA 4M6VA 4NB5A 4P9FA 3OV8A 2CWEA 1ZH5A 2ZNYA 2Q2EA 2P5KA 3CMMA 1T56A 1V5GA 5HDKA 3E5UA 2KZGA 3OWTA 3FM5A 3NARA 2HKOA 1DUXC 4G7ZF 4HEA2 2ZCWA 3LAJA 2FNAA 1QHGA 4L5EA 2LR8A 4XLFA 1I6HJ 3OIQA 4A3CJ 3GXOA 2HOEA 3CCLI 2JZYA 3PM1A 2OBPA 2O6GE 2HVSA 2M7BA 3RYRA 2R93J 1YS6A 1KZHA 3L1PA 2L7KA 1ZAOA 4XL9A 2IGKA 3J80Z 3L2WA 4XKWA 2JTVA 5CYVA 1IRZA 2MH2A 4A0YA 4XONA 1ETXA 1SFUA 4HYEA 1WJAA 1VI0A 2W82A 1KU9A 1PVEA 3JRHA 2K4BA 2R7ZJ 4U0VA 3OYBA 3SDGA 3V8KA 2F5VA 3MFKA 2DMTA 4FHTA 2DA3A 4KYWA 2GAUA 2Y0SA 5DEQA 4E7SA 2V7FA 1RKTA 1OQYA 1YI2I 1XSXA 2DOFA 1BC8C 2FQ3A 1IN4A 4KDPA 2BW3A 1R1VA 1S3JA 2DMUA 5LGTA 2OPTA 4EGYA 1QHHD 3CDIA 4N0BA 4BYYA 5GAHJ 2V9KA 1AWCA 3ABTA 5F0CA 2A5WA 3I4MJ 3HSRA 4KT5C 2HZDA 3EPZA 2NS0A 2D2WA 4ZTJA 3CCQI 4Y17A 3LA3A 3LWFA 2BOLA 5HNHA 4IKFA 3FK6A 3BWGA 3MKLA 4C3HJ 3J7YJ 1FIAA 5F27A 3I64A 3C7JA 4A3IJ 4HW0A 2LKSA 2RAEA 3QPHA 3RQ4A 3FXMA 5K7HA 5D5VB 4E7HA 4R8HA 2FUG2 2Y48A 1XGNA 1Z91A 2OCEA 3CLOA 2R7QA 2QQBA 2N8GA 4Q48A 2LDUA 5H2FC 2R5ZA 1ODDA 5FFXA 2VUMJ 1VQ5I 2KJBA 1FP1D 4CCMA 1MBHA 2VLAA 3IWFA 1BJAA 2PN6A 1W36C 3I59B 4HX4A 3MD2A 1MJBA 3S8PA 4KISA 1IUYA 2M8EA 1ZRDA 1GVDA 2KJCA 4BH9A 2VKDA 4A3BJ 2VT3A 2QSHX 3CCVI 4A3DJ 3N4MA 3F22A 2X1CA 1M1EB 1TZLA 1R58A 2MD0A 3LQRA 2EINH 2YS9A 2MGQA 3O8GA 3SFIA 4KMFA 2CQ7A 3C1DA 1HKQA 3ZPLA 2L0KA 3DBRB 1ETYA 2DU9A 4YFNF 4ZYHA 3TW6A 3BTCA 2ACJA 3CC2I 4CYCA 2ESHA 4IHXA 1YOVB 3HM5A 5JLWA 5FLVA 3MZHA 3K4LA 4Y33A 2CW8A 2E7WA 2A6EF 2FX0A 3ZR8X 3J7AO 2V6CA 1TP4A 1VQOI 3ROUA 3PUFA 1X58A 2K3PA 3IUOA 5BPIA 5K5OA 4J01A 2HVQA 3NQOA 5DCMA 1R5ID 3IH3A 4DYCA 2BHZA 4N4NB 3TQNA 5ILSA 1LFPA 5DD4A 3LSPA 1I50J 2M4KA 1U5TC 3DBHB 2DFEA 3OL3A 3K1NA 1Y0UA 1BJZA 3AG4H 1J7KA 1MH4A 5KK1A 3T0YA 1DPUA 3AFHA 1OYIA 4X1EA 2IGNA 3WODF 5GTIC 3QRFF 2H27A 3ZQIA 3Q3SA 2EIJH 2KRHA 4KUMA 2HI3A 3E1SA 1QPMA 1I39A 4IF4A 2LKPA 1R5GA 3DTEA 2FOWA 2OA4A 2G7HA 2W7NA 2JA7J 3KETA 3O8HA 3CP2A 3HYIA 1ZKGA 2LYCA 3ASOH 2X51A 5A2QK 2Q1ZB 3IRQA 3F8NA 4HDUA 4AIJA 1FNNA 1OCOH 3WHCA 2WV0A 3K2ZA 1FYKA 2Y9YA 3N97A 1ORKA 3DKXA 3FMQA 5HDGA 3FKIJ 3OMYA 3EETA 1K6YA 2I5UA 2BE5F 2IS6A 1A35A 3F6OA 1D1AA 5IOYA 1LNWA 2A3SA 2Y0SN 1D8JA 3JR9A 2AHQA 3A2KA 3HPGA 5HS9A 4RB2C 4BJ5C 2WWYA 3BG6A 5DTDA 2XROA 1L0OC 3G71I 2CMPA 2E71A 5CJ9A 3LQQA 3MZ8A 2WA0A 3ZGKA 3MAJA 4CCLA 5FO5A 2GWRA 4MEXF 4QLCU 1MMSA 2JN6A 1TQIA 5EEGA 4AIDA 4D5CA 4UB8C 1MDMB 1YRNB 2KRFA 3F8MA 3QWLA 3CF2A 4ZC3A 2OF7A 4JX4A 4PGGA 2NVQJ 1P92A 1UMQA 4QPOA 1N25A 2HEOA 3KPHA 5C4JJ 1HSJA 2EV6A 2BZTA 5K7ZA 1HW5A 3ZMSA 5D4SA 1R9TJ 3RJPA 2BVMA 3KCCA 5TGTA 4BY7J 3SXYA 4UUSB 3JREA 1FPQA 1QVUA 4BXUA 3FHZA 2DAOA 3VYRB 3RPUA 5HLGA 3JTGA 4BXFA 3GTOJ 5KAFC 5IOZA 3I53A 5DUKA 4DJAA 1E3HA 3CCRI 2OCCH 1E2XA 2DDBA 1FOWA 3H5AA 1X1CA 1ZR2A 4IQJA 1RNLA 4B4CA 2HTJA 2H6CA 1GXPA 2DJIA 4S04A 3LA2A 2CUFA 1IXSB 2HGCA 2AXLA 4B3AA 3OIOA 4KIFA 1YIOA 3ASNH 1U8RA 3PJRA 1VQ4I 4E7JA 2ICWG 3G1OA 1LEAA 5ICEA 1IZ1A 4F93B 1TWAJ 3CCSI 3DTKA 5FFZA 3JRBA 1MMDA 1IJWC 1SFEA 4RAGA 2VXDA 4F3QA 3CO6C 5FGMA 1F5TA 5FKOA 2VJ5A 2JQ7A 5BQTA 1QPIA 3F6VA 2EPFA 4GYGA 2Y2ZA 3H3ZA 4BBRJ 1K78A 4L0YB 2GXBA 1OMIA 1USSA 1UG2A 2WAEA 2IBDA 1MMGA 3BPVA 2DA7A 1ZRCA 2XAJA 5F1RA 2Y0MA 2ZJRF 1MBEA 1NH3A 2JT1A 1XMKA 4BE2A 4ZYEA 2HVRA 4CHUA 2IA2A 1EA3A 2IAIA 1KU3A 3DLAA 3CZ6A 2CSOA 3WE3A 3W2VA 5JVGF 4XKCA 2O03A 2J5OA 2QQAA 4OIOF 1Z7UA 3KZIC 4HV6A 4HF1A 5EJCA 3GYHX 1I1SA 3OS2A 3RKWA 2VBYA 3R4KA 2K9QA 4CSWA 2E1CA 4FETA 1FYLA 3BQYA 3QOEA 4XLCA 1JKRC 1FZPB 3GTKJ 2NVYJ 5CVVA 4MQVA 3L7WA 1DU6A 3WU1B 1GDTA 4OAZA 3G4SI 4UUVA 1TNTA 4HSRA 2ZXIA 1XB4A 1AKHA 2DTZA 3IAM2 1T39A 2QQ9A 5DUIA 2ZKZA 1MZBA 3V42A 2E1MB 1YTYA 4BDYA 3FX3A 4BJ6C 2F48A 1ZG5A 1WJ5A 1FSHA 4E70A 3S17J 1YX5A 2IS1A 2XF7A 2EZLA 1X19A 2VN2A 4JOMA 5A2QZ 2O0YA 3G73A 3K6GA 1NHAA 1T33A 1YJWI 4CGZA 1WZ2A 3WTZA 2KFDA 2IP2A 1MNDA 5FKNA 1ZK8A 5DM6F 3L9FA 4GFBA 4Y3OA 4Y13A 2DK5A 3ECHA 4UNOA 3KLNA 3ULQB 1LQ1A 4L9NA 3M1EA 2AO9A 1W0TA 2Y30A 2BY3A 3EDPA 3CJTB 2UV1A 1JTXA 1XC5A 2XDVA 1D5YA 4C2TA 2VXZA 3CMYA 4ZZLA 4XBFA 1TWCJ 4LK0F 2VBXA 1SFKA 1Y1VJ 3BC8A 3QQAA 3VSKA 1AKHB 3CDLA 2HZTA 2LG4A 2JA5J 1Y1WJ 3GTLJ 1WQ2A 4CYDA 1PUFB 3IH2A 1WVRA 3KZYA 3S3MA 1HOMA 3L00A 5J6XA 3J7AY 4HRIA 4ZDOA 2CV2A 1IV8A 2NYXA 3GFJA 4KIGA 5FKMA 3CLQA 5FRNA 1LDJA 3TDUC 1R1TA 3MMYB 4HLYA 3ESWB 2CUJA 2XIGA 3DKYA 3TO7A 4ETSA 2DA5A 3VYSB 3PIOF 2X6WA 3QYEA 2GOXB 1DGRM 5FB2A 1CGPA 1B1BA 4U87A 4EJOA 3B73A 3KEOA 3HOUJ 3TO9A 3R60A 2JA8J 2OU2A 3ZMZA 1WKMA 4AVPA 2BHYA 3TP3A 1ZGJA 3BDDA 2CG4A 2HDDA 3PFYA 4IPAA 2QA4I 2EFNA 2PMZA 1Y56A 4IVNA 3EYYA 1YG2A 1NG7A 4LG0B 1WWXA 3OYDA 2VQGA 2DQRA 3D5LA 5D6EA 5F08A 1MBKA 1TW3A 2DI3A 2RGVA 3I9V2 2YSRA 2VBZA 4L9JA 2QBYA 5D5UB 3G2BA 3GFMA 3EUAA 2OC6A 2PLYA 4EJUA 2CUEA 3BG7A 4IZZA 1IN5A 3JCUC 3BG5A 5IYBJ 2IEKA 3Q9SA 3NWTA 1U5TB 2CW0F 2DA2A 2QGUA 4ENKA 1FEXA 2KT0A 2C6YA 3Q5FA 1RIOH 3HOYJ 2CO5A 2A68F 1ETQA 1TTYA 5GPAA 1MW7A 3EUHA 3FF5A 1DPRA 1FP2A 4MO7A 3F9KA 2EH3A 3T5XA 3I55I 3FXRA 3GEZA 1B72B 2MG4A 2L9RA 3M8FA 3ZMUA 4UUSA 4IQ4A 4ZH4F 3FBIB 1K4SA 5K5QA 2DLLA 1ZHFA 4AIHA 2GIVA 5EEAA 1NTCA 1V55H 5IY5H 4KN7X 1IV6A 2Y31A 1LUJB 3S1NJ 4G6TB 2LOOA 2E1MC 4BXXJ 3MZYA 5GTHC 2IXSA 2XKPA 1EF4A 1XGSA 2M30A 2M3AA 1VQKI 1T95A 3F3XA 4HX7A 1KYWA 4L9VA 1K7AA 1LFBA 1S5LC 4G9YA 1BM9A 1R23A 1T0FA 3GZ6A 1BIAA 3CCEI 1S8NA 5BMZA 3ERMA 2K27A 2EV5A 3A03A 3H1CA 5LRSA 3V7SA 4EM2A 3F72A 2IT0A 1XCVA 1K83J 2L2OA 3MWMA 4XLHA 2HYFA 3ZXSA 3E6CC 4D9JA 1FMVA 3P5JA 3L2RA 1HDPA 4BHCA 4LG3A 3BROA 3WTUC 2BEOA 3KP6A 5J47A 5E1WA 1R22A 4IHWA 3E0JB 1Z77A 2FNPA 3TP0A 1YO5C 4IHSA 1TNSA 3VB2A 1UG0A 3BZCA 2L5QA 4NHJA 1AU7A 3O6BB 2O7OA 2HOSA 5CVJA 3BCBA 4ESFA 1HBXG 2Z16A 1VQMI 1Z21A 3H9JA 3KIOA 4HF2A 2MD5A 1J09A 2CGPA 4OMYA 1T98A 4BS9A 4XORA 3UKGA 4MFEA 3M8JA 4MTDA 2COBA 3BR2A 3QPTA 1YJNI 4BHBA 5D6FA 5CQGA 2LVSA 2QSGX 1KQ9A 3AL0C 2K02A 4Z2YA 3GCMA 3S14J 2LY1A 1QU3A 1D5VA 1FSEA 2E1OA 1ON2A 2KHMA 2NNNA 2XVCA 1WGXA 4BEHA 1F1ZA 4BAYA 1SVMA 2K7LA 2R7WA 1T0FC 4M3FA 4UY8I 1BR4A 1R36A 2F6CA 1H88C 1X3ZB 3A02A 4XSZF 2L01A 3AG1H 4LGWA 2OAZA 1XSVA 3HRTA 1BW5A 3M8EA 2RC4A 3IAS2 2P6SA 3DP7A 3ISPA 3OR2C 1XTAA 3V8JA 1CF7B 4HPQA 5J4VA 2EV0A 4AU7A 2MLGA 1GT0C 3CC4I 1TC3C 3GFIA 1H0MA 2LBFA 4BUPA 5LFAA 2WAQA 3O2PE 4JBAA 2IJLA 4KN4X 3IRRA 3B02A 4UVBA 3GBGA 4ENJA 4V2FA 1BI0A 3HC7A 4DBRA 1YIJI 4ANJA 3K69A 4OMZA 1HKTA 1X1DA 4I76A 2BY1A 4IX7A 4RDUA 4I2OA 2HU9A 1BI1A 3ABUA 2ELJA 4L5JA 4BQNA 3WTVC 3P9IA 5C3EJ 2DK8A 3F8BA 2CQNA 1B8IB 2OTLI 4OIPF 1ZG1A 4WK8F 2V1XA 2XRLA 4XOTA 3ZMVA 1MJ9A 4ABZA 4G7HF 3LSTA 3PO3J 1REPC 4A6DA 5HOOA 2E5ZA 4IOAF 1V3FA 2PX9A 2ZXJA 1DGWY 2QQ8A 3WU0A 3FM3A 3FIWA 1W5CC 4BL0B 5GP9A 4LJZF 1UELB 2ELHA 2XPUA 1FTZA 1S72I 3TEDA 1R4MB 1LFUP 1RKWA 1SD5A 4FX0A 4LLNA 1IDZA 4KMUX 2A61A 3HOZJ 4I98B 4M6XA 2V26A 4QIWN 5D8KB 4I0BA 1S7AA 1WJBA 2JPBA 2P4WA 3K70C 2VI6A 1KQ0A 3HTSB 3PIPF 4DZJA 2LKXA 2E2HJ 2JWTA 5K7FA 4CICA 1Z05A 2CS3A 2X1DA 3WG7H 3OYIA 2W4SA 3DCFA 4Y7NJ 2JK3A 5JHFA 2OQGA 3OYKA 4PSXA 1WI3A 2DA1A 2UUZA 1TT5B 4HG2A 1TBXA 1WFXA 3KYLA 2QBYB 4D1QA 4U7BA 4OAYA 2V1UA 3WGIA 2Z33A 2ZO4A 3VYTB 1ZLKA 2H6BA 4IXAA 3SJMA 2JMWA 2QKMB 1VNDA 2FMLA 5E8IA 3JSOA 3E3VA 2VC1A 2IS2A 3LAPA 5EGOB 3CESA 2H09A 1D0YA 4ASNA 2F2EA 1YJ9I 4O3MA 4UV8A 4EJTA 5DDGA 1OKRA 2X85A 2G9WA 3CC7I 4CCJA 1V54H 3DEEA 3LL7A 1V5FA 3CUQA 4BEHB 4QPQA 3FZVA 2R7TA 2KIUA 1MMNA 4MHGA 3SDBA 1WJEA 5GAEJ 1ULYA 2OQRA 1PYVA 1IGNA 2E19A 4J19A 3K0LA 4YELA 3H36A 2LH9A 4XLEA 3JRIA 4EM1A 1ETKA 2MH9A 4ENNA 2R0QC 5FLXZ 4LB6B 1T8IA 2EILH 2KDOA 3AG2H 3OSFA 2M87A 3KEQA 5H20A 2MABA 2JUCA 4DYRA 5M5WJ 1Z6RA 1YITI 1E0EA 5E3NA 3TDZC 2DTRA 2A07F 3J81Z 5D4RA 5HLHA 3WE2A 3EYIA 2VQLA 3HOTA 1SC7A 3FKJA 2X6YA 1N77A 1U9OA 2R7SA 3HL2A 3BG9A 3LSIA 5B5EC 2MA3A 4GDFA 5CQEA 2NNYA 1SMYF 3MVPA 1OYWA 4E7IA 1F4KA 4LMYA 2E60A 4CCOA 4WCGA 1IDYA 3B6CA 5J4YA 1BOBA 5B1BH 5FROA 1I3AA 3K4NA 2M1BA 1O3TA 3A4CA 2CQXA 3S1RJ 4W97A 1YX3A 4D7NA 4XMYA 3SQNA 1FOYA 4C3JJ 3RIRA 4RS8A 3FXOA 2DJNA 4XKVA 1Y0NA 5ICFA 3R6SA 3BR5A 3E6DA 2XAFA 2K9MA 3HRMA 2ME0A 4EV0A 4MNUA 5DCMB 3QU3A 3ONQA 2A6TA 3JTHA 4A3MJ 3LSKA 3BCAA 1E17A 2R5YB 1SD6A 1FT9A 5E1XA 1MNEA 3W2WA 2VJIA 1Y8QB 3VSLA 3TO6A 1BR2A 4A3JJ 2QF7A 3CJQB 4RB0A 4EJVA 5L3GA 5LGUA 3G1LA 1D1CA 2LMDA 4KFCA 2F5CA 4MFDA 5IYCJ 3RKYA 2CV1A 3NEUA 4M73A 1OCZH 3RZDJ 4IRIA 1LDDA 3R61A 3M1CA 2M4GA 2X4HA 2ISZA 3IH4A 2HS5A 3A1YA 4M9XA 3SFZA 4HDVA 2KIQA 1FBUA 2WB1A 4UHTA 4P96A 3KP2A 3BTIA 3VODA 1X2MA 3DF8A 2FBHA 2HNHA 5E1ZB 5EG0A 1J0RA 3FWEA 1QZYA 1O7FA 2D1HA 5M3MJ 5BNGA 1XDUA 1JUMA 2ADUA 2L9NA 5TJJA 2XV4S 3IKVA 1Q1HA 2CJJA 1N75A 4ZDLA 5LHIA 1YLFA 1LE8B 2ZNZA 1B4AA 1FY7A 3CUQB 1YFHA 2FD5A 3OYAA 3AL0B 5E79C 3LSHA 3GZNB 1G3TA 2GZWA 1XDSA 5D5WB 3S16J 4RAFA 3H9GA 2RQQA 2BW3B 3P9KA 2MYSA 2GXAA 3C2GA 1MSFC 5IP7J 1HXDA 1WH5A 2PMZN 2OUMA 2XAHA 3E6BA 2G7UA 3CDHA 1Z0XA 2IGMA 4ZYAA 2XGXA 1QA6A 1G2HA 4N9HA 3V7RA 5L3CA 3T1BA 3PNYA 4A12A 3LMMA 1VZ0A 5LRRA 5EDNA 1IRGA 5GPCA 1W1WE 1MSEC 2EZHA 2RVCA 1X4PA 3M9AA 4D0PA 2EFWA 4V2GA 4MEYF 3S32A 3TBIA 1KU2A 2RNJA 4G6QA 1UZCA 5J8CA 5DCFA 1U0JA 1C0WA 3V8LA 4LLGF 4ZYDA 3M4OJ 1JGSA 3AAFA 2FJ1A 3S2WA 2PJPA 1WCMJ 3CJRB 1SAUA 4YIIA 3S1MJ 1VQ7I 2LF8A 1H9TA 3I4NJ 1G4DA 4IL6C 4ZDPA 3C2BA 2R5ZB 1H89C 1Z7LA 4NC8A 2VT2A 4YFXF 3HSFA 3OYLA 3KFWX 1VQLI 4KA4A 3J80K 1UHWA 4K2EA 2IRFG 2YR2A 2FU4A 3W3CA 3I4PA 3DFGA 3OY9A 2MW8A 2HWVA 3QPLA 1P7JA 4V19K 3OOUA 5GAGJ 4HNTA 4HNUA 1P2FA 2BYVE 1A5JA 2CFXA 4L9TA 1E3OC 1KGSA 1S29A 1RUNA 1W5TA 2HDWA 2E34A 3S93A 3IP4B 4NDLA 3HUGB 5JLXA 5M5YJ 1TQPA 4G8XA 1IW7F 4QSHA 3CUOA 3DU6A 3CJNA 4DNCA 3L2QA 2M45A 3WGGA 3H9QA 3K10A 3RTRA 2OZUA 2V1NA 4WX9A 4G12A 4PSWA 3GF2A 5JHUA 5BS6A 2L3DA 4UUTA 1JJ6C 4YIRX 4CYCB 4DZPA 4XRFA 2G0EA 3CF5F 1XMAA 5D8LB 3U1KA 3TW7A 2F5FA 3GX4X 1D0XA 4EEFG 1HW1A 2LC2A 5DD8A 1XCBA 4A2UA 4CCKA 2DA6A 2VOOA 4MLOA 1LDKB 3SZTA 1QGPA 2JJ7A 2O8XA 3P7NA 1BA5A 2XAQA 1XGMA 3SEZA 4FISA 1G3SA 2DFFA 1YW7A 1ETVA 1QZEA 2IVMA 2KPMA 4IRGA 2M8GX 3HUGA 3PQJA 3CMEI 4HLXA 3OL4A 4ITVA 2YPRA 2ZJ2A 2R7VA 2M5WA 1IXRC 2HTSA 1W4MA 3H3UA 1KU7A 3CQZJ 3BG3A 1HF0A 3I59A 1P4XA 1NG6A 4XRMA 4II2A 1GV2A 5B3SH 4RMNA 1S6LA 1T38A 2GIZA 4XLNF 4AYBA 4M9ZA 2QEXI 2AS5F 2DODA 2R3SA 1U8BA 4F91B 3ABMH 1XMXA 1QQIA 2X6XA 2L4AA 3K1PA 2STWA 2AXTC 4XLPF 4UVAA 2HQNA 2MFZA 1G59A 5TISC 2CQQA 3I71A 4RAZA 1O3QA 2E1NA 2VL8A 5H6QA 2GOMA 2ZJQF 1APLC 1MMAA 4E4HA 2JA6J 3K70D 1VF9A 2WY7Q 3MEXA 2FMYA 1DP3A 2KIMA 1LPQA 3BJAA 3MKZA 1IN8A 2ETHA 2V9PA 1JHFA 1WHUA 3PNVA 3BLYA 4Q5SF 1WI9A 4KICA 2XPVA 3M3YJ 4BE0A 2D5VA 3CCJI 4AIKA 2WADA 1CQTA 3WTSC 4WXCA 4PZJA 2VQHA 4PJNA 3H0GJ 4A69C 2EFOA 3DXJF 3BQZA 1VQPI 2RDPA 1J2XA 1OCRH 5KHDA 5LHGA 2XF6A 2ZJPF 3ZQGA 1SVOA 4QWQA 1XGOA 3HKZA 3K4JA 1R00A 3RQIA 1K6OA 2R92J 2NOJB 2M34A 3SZPA 3Q0VA 3WG9A 2FXAA 3E7LA 4ZTFA 3S1QJ 2F4MB 1ETOA 4JX6A 1R7JA 3HOSA 3DV8A 4MQ9F 4A5NA 3H0DA 1WH7A 4RLQA 2ZBKA 1FYMA 5EZGA 2GA1A 2K3FA 2MBFA 2NVTJ 5IT9Z 4RM3A 3E97A 4O6JA 1A36A 2A6HF 3DEUA 3KP3A 5IP9J 2LY9A 3OYMA 3T8RA 4FE7A 2GXGA 4CCNA 2YX4A 1RPWA 2DOEA 2CFOA 2FRHA 1R4NB 2HR3A 3SHFA 1ETWA 1VFCA 2F4IA 4Y52J 5HVQC 4IHYA 1QZZA 3SEQA 1FOKA 2D45A 2XAGA 3H92A 1JI8A 2E7XA 3DPTA 4L5IA 4RAYA 1HW2A 4L18B 2Y69H 4ZZDA 2WAQN 2R5YA 3K1MA 1BC7C 2OD5A 3G1MA 2HQ5A 1Z3YA 2OJED 3GVAA 1HKSA 2V4JC 2Q8KA 1K79A 5B66C 5F6FA 2LFBA 2HXIA 1UB9A 3A01A 2FF4A 2JA2A 2TRTA 3UR3C 3E5XA 3HDDA 3GWZA 4RGSA 1Z9CA 4CH7A 4U0YA 2R7OA 3KP4A 2HQRA 1Y39A 4E7ZA 1WJFA 2L9SA 4II3A 3MKYB 3ZP5A 2Z2SB 3OS0A 1CF7A 1RRJA 5EYRA 1NK3P 2MLKA 1O3SA 4A3KJ 2R7FA 1MKMA 3BR3A 1P7IA 1HA8A 2F5EA 2GQQA 4Z6YA 1KA8A 3DBLB 2XC7A 2ECBA 4U0WA 5FRMA 3MCZA 2NAZA 1YW9A 4B1RA 3LNQA 2DW4A 2BXZA 1R1UA 4IOCF 2PJRA 3W6JB 1TQMA 3FHNA 3Q0UA 5K1YA 1ITYA 1YE9A 4BQQA 1O57A 2VIXA 4RM2A 5JR3A 1MGTA 3V4GA 1V4RA 3HEFA 2FBKA 4HNVA 3F21A 3LOCA 3ABLH 1B6AA 3H5NA 2YU3A 2HFHA 1DQUA 4EJWA 1U6GA 4EGZA 3BZ6A 2VQCA 3DKWA 3I5UA 3FISA 4MTEA 4A6EA 4B43A 4WF2A 1PP7U 1Z3XA 2BBYA 1A04A 2W00A 4C2UA 1L3LA 3S15J 2E36A 1IN6A 4KJZA 3BZKA 5F0FA 3HGYA 4DYQA 2XGCA 1RETA 5M5XJ 1G6NA 5AIQA 3PQKA 2RREA 4LG0A 2YU9J 2ESNA 3IWZA 3B6AA 1IG7A 2J5PA 2LREA 1Y8RB 1F43A 2DOAA 3G3ZA 2V1DA 3V7CA 4KITB 1U9NA 2O9LA 2KIFA 1BOAA 1IO2A 4PJ0C 2Z9OA 4RB3C 1HDDC 3KEYA 4BY1J 1EV7A 2ID6A 2COMA 2W25A 2XB0X 1ON1A 5ILUA 1BN5A 2VE9A 2XAUA 3U1DA 2MC3A 4HBLA 3REOA 1R6RA 4DIQA 1SAXA 5LLQA 4BE1A 3WGHA 1AA7A 1IRXA 2ZFWA 3DQVC 2P0WA 1X2NA 3QOPA 2CQKA 4JQFA 3J7ZI 1J5YA 3F8CA 3I58A 2TCTA 5FKLA 4GCVA 5F1JA 1DP7P 3RSNA 3F8FA 1PP8F 2WB1N 3BY6A 4NBQA 4HAMA 1VTNC 2X0LA 5IYDJ 2O8KA 1JJ8C 2BV6A 5H6RA 2DDAA 3A0HC 1B72A 2CYYA 2L7ZA 4WXDA 5ERIA 2FEZA 3K4BA 3PUBA 3OOPA 4BJTA 3KX2A 4XICA 1QNTA 1OCTC 2R7XA 2LBFB 2Z99A 4F7ZA 1LVAA 1O7LA 4RGXA 4X0GA 1JKOC 1EH7A 3ZQHA 4YG2F 1Z6TA 4N9IA 2P5LC 2WAFA 4HOBA 3ZQFA 5GADJ 2B7EA 1JGGA 3RPUD 2XKOA 1A6IA 2ISYA 3D5SC 2X1EA 2ZMEC 3NRVA 3KLOA 2AQFA 1VQ8I 5LGNA 3FDYA 4GXOA 1HSTA 3DU5A 3QAHA 5JI6A 4AYBN 1QO0D 3K7AJ 4XRSA 2VJ4A 2X9DA 1YYVA 1U5TA 3BTLA 3DWLE 4OU0A 2JRTA 2KZVA 4S05A 1XS9A 4R1HA 1FJLA 4XKBA 3FMRA 2P7VB 1JT6A 1LE8A 4A3LJ 1P4AA 4B47A 4LK1F 1JKPC 4XN0A 4AC0A 2I8DA 3A0BC 5JVTA 1S7EA 1FLIA 1X1BA 3WU2C 3BP8A 4OIRF 3I54A 1B59A 2GM4A 5KNLA 2VOPA 3ZN0A 3HJEA 3WTTC 5LEKA 2ME6A 2UWMA 4I02A 1GUUA 4E7KA 1PUEE 2E2IJ 1ERDA 1EH8A 4JP0A 2K5CA 4G7OF 5HODA 1ZR4A 1R71A 5J1YA 2QSFX
chains in the Genus database with same CATH topology
2XF5A 2HNHA 4OAZA 4HSRA 1N78A 2ZXIA 3OIPA 2O5RA 3IAM2 3S3NA 3V42A 2E1MB 4BDYA 2L9NA 4BJ6C 1WJCA 1WJ5A 1N75A 4ZDLA 1YX5A 2IS1A 2XF7A 4JOMA 1X19A 2LY2A 5KCMA 4BQOA 2CV0A 3K6GA 3OYAA 3AL0B 3LSHA 4N4OB 1MNDA 1S9HA 4NC7A 4Y3OA 2WY8Q 2RQQA 3H9GA 2BW3B 2ZSIB 2MYSA 4EATA 3C2GA 3H35A 5CPRB 2UV1A 3TL4X 4C2TA 2XDVA 4XQFA 2OUMA 2VXZA 3L2UA 1D0ZA 1SFKA 2IGMA 3BC8A 4ZYAA 3S3OA 1W36D 2R7RA 3VSKA 4P5OA 3C2HA 4B48A 2DT6A 3PNYA 2LG4A 3SYTA 2CW7A 3LMMA 3LSMA 1VZ0A 2PJRB 3S3MA 4KT6A 1X4PA 3J7AY 4HRIA 1LVKA 4ZDOA 2CV2A 3S32A 3TBIA 5FRNA 1U0JA 3HG9A 3MMYB 4XNFA 3CP8A 2CUJA 3DKYA 1Y6IA 2HQAA 4Y4RA 2DXIA 3W2AA 3VYSB 2X6WA 3QYEA 2Q2EB 3CJRB 1SAUA 4F92B 2GOXB 1DGRM 4OWRB 4U87A 1KONA 2DT7B 4ZDPA 1Z7LA 4NC8A 3OYLA 3HPHA 2OV7A 2JVGA 4NQWB 2BVLA 1ZELA 3PFYA 1PJRA 3W3CA 3OY9A 2PMZA 1Y56A 3PNTA 3I3LA 3OOUA 3VYUB 1NG7A 3OYDA 2VKHA 2R4GA 2VQGA 3D5LA 3LFUA 4HNTA 4HNUA 3I9V2 2WBMA 3MKWB 3VWBA 2VB6A 3G2BA 2HDWA 2OC6A 3EUAA 3BG7A 3S93A 3IP4B 4IZZA 3HUGB 3D5RC 2K9LA 3RCOA 4DBQA 4NUBA 3DU6A 3L2QA 4PK4A 4AVZA 3NWTA 3FBNB 3H9QA 3PSIA 2KP6A 3K10A 3RTRA 4LIVA 2V1NA 4PSWA 3QYFA 4FASD 1MW7A 4LITA 2VASA 4PUSA 2M7AA 3F9KA 4NNJA 1D0XA 2LC2A 3CMMA 4CCKA 1V5GA 4MLOA 3K4CA 1LDKB 3SZGA 3OWTA 4IQ4A 4B3XA 2JUGA 2KMUA 3FBIB 4HEA2 3SEZA 3OYCA 1P9QC 1QHGA 2KPMA 4C30A 4XM3A 4XLFA 3OIQA 3OL4A 4ITVA 2R7VA 1V5EA 2HVSA 2M7BA 4YRVA 4G6TB 3PL8A 3OYEA 2LOOA 2E1MC 2XSJC 2L7KA 2IXSA 4XL9A 2IGKA 1NG6A 1UAAA 3L2WA 2M3AA 4XKWA 1T95A 5LD2C 4II2A 4XONA 4RMNA 1WJAA 2W82A 3U21A 4AYBA 3ZCOA 5CKTA 4F91B 2X6XA 3OYBA 2F5VA 4XLHA 2L2OA 2Y0SA 4E7SA 3ZXSA 2MFZA 4P1WA 2V7FA 1G59A 4D9JA 1FMVA 3L2RA 2VL8A 2GOMA 4LG3A 1MMAA 4E4HA 3K70D 2WY7Q 3EUKL 1DP3A 2BW3A 2IGOA 3E0JB 3OYNA 3MKZA 1QHHD 1UG0A 3PNVA 2L5QA 2V9KA 3BLYA 4ZJZA 3BCBA 2DCEA 2A5WA 2Z16A 1X4OA 4BE0A 4F52A 1Z21A 2WADA 3H9JA 2HZDA 3EPZA 1J09A 4BS9A 2VQHA 4ZTJA 4PJNA 2KLOA 2BOLA 4XORA 3M8JA 4B44A 5HNHA 4IKFA 5CQGA 1OR7C 5KHDA 2XF6A 3DPLC 3AL0C 3RQ4A 4E7LA 4E7HA 3HKZA 3K4JA 2FUG2 2HPMA 2LY1A 1QU3A 4XOPA 2NOJB 4PFPA 4ZTFA 4PJMA 4F55A 2R7QA 1TT0A 2KHMA 3HOSA 3H0DA 4BEHA 4RLQA 2V6EA 4CCMA 2R7WA 4XN3A 1T0FC 1LKXA 4RM3A 1BR4A 2F6CA 2VLAA 1W36C 4BDZA 3MD2A 3OYMA 4CCNA 2RNGA 2CFOA 3S8PA 4KISA 2ZXHA 3IAS2 3OR2C 2F4IA 5HVQC 5HLTA 3SEQA 4HPQA 2Z1DA 2VKDA 4AU7A 1JI8A 3DPTA 2LBFA 4BUPA 5LFAA 2WAQA 2X1CA 1TZLA 2MD0A 1Z3YA 2V4JC 3GBGA 4DBRA 3HC7A 4ANJA 4J00A 3L2VA 4BU2A 2JA2A 1X1DA 3DPUA 3UR3C 4IX7A 2ZFUA 2HU9A 4CH7A 2ELJA 3DTIA 4BQNA 2R7OA 3QYBA 3EUHC 4E7ZA 1WJFA 2L9SA 3K4LA 4XR6A 4II3A 4Y33A 2CW8A 4LIUA 3MKYB 3ZRGA 4XOTA 4BACA 2Z2SB 3OS0A 3ZR8X 3K4MA 5HOOA 2E5ZA 1DGWY 1HA8A 4BL0B 2K3PA 3IUOA 1UELB 4J01A 2KQRA 2XC7A 2HVQA 5FRMA 4N4NB 1LFPA 2V26A 2PJRA 3OR1C 3OYGA 2M4KA 3FHNA 3OL3A 1WJBA 2JVHA 1YE9A 3K70C 3NWSA 2QKLB 4BQQA 3AKZA 2W1OA 4R79A 3AFHA 2AQEA 3H5RA 2VIXA 4RM2A 2CS3A 2IGNA 2X1DA 3OYIA 2R7UA 2W4SA 2KRHA 5JHFA 3OYKA 4PSXA 3E1SA 2UUZA 4HG2A 3H5NA 1DQUA 1WFXA 3KYLA 3DTEA 4D1QA 4U7BA 4OAYA 2W7NA 2VPLA 2VQCA 3CP2A 3VYTB 4B43A 2LYCA 3LSGA 1Z3XA 2X51A 2Q1ZB 3OS1A 1X1AA 2W00A 4GRIA 4C2UA 2QKMB 4KJZA 4BGDA 3DKXA 2IS2A 2KL4A 3OMYA 1K6YA 3CESA 4DOZA 2RREA 2IS6A 1D0YA 1D1AA 2LREA 2DOAA 4KITB 3A2KA 3HPGA 2X85A 4BJ5C 3K4KA 4CCJA 3DEEA 3BG6A 4HSTA 1BR1A 3LL7A 2CMPA 4CZCA 1V5FA 4BEHB 3KEYA 4QPQA 4YEJA 2WA0A 3ZGKA 4CCLA 2R7TA 1MMNA 3SDBA 1WJEA 2M0MA 1PYVA 2XAUA 4YELA 2LH9A 4XLEA 1R6RA 3OYFA 4DIQA 2KRCA 4RLFA 4BE1A 3CF2A 4ZC3A 1AA7A 1IRXA 2CH0A 3DQVC 2KDOA 2P0WA 1G8XA 3ZQQA 4JQFA 3N05A 4QPOA 2MABA 2MC4A 3RSNA 1E0EA 1GLNA 2BVMA 5TGTA 3HXLA 4E6KG 2VQLA 3HOTA 3OYJA 3FKJA 3VYRB 2X6YA 4BXFA 1N77A 3K4BA 3PUBA 5HNFA 2R7SA 3HL2A 4BJTA 2JSPA 3KX2A 3QODA 4DJAA 3LSIA 5CQEA 3VDXA 2R7XA 3H5AA 4E7IA 1X1CA 2HPIA 2LBFB 4IQJA 2E60A 4CCOA 1BOBA 4X0GA 5FROA 2DJIA 3K4NA 4CUGA 2WAFA 3A4CA 2ZSHB 3PJRA 1YX3A 4XMYA 4E7JA 1OLTA 3RPUD 4F93B 4XKVA 3D5SC 2X1EA 3DTKA 4CA0A 2AQFA 1MMDA 2K9MA 4PJLA 3FDYA 4DGWB 3DU5A 2IS4A 2VXDA 4F3QA 2VJ5A 3ONQA 1D1BA 2A6TA 2VJJA 2VJ4A 3DWLE 3LSKA 2KZVA 3BCAA 4XKBA 3UNGC 2CUZA 4C9YA 1MNEA 2WAEA 2VJIA 1MMGA 3PSFA 3W2WA 3VSLA 4H4KC 4B47A 1BR2A 3CJQB 4XN0A 2LRDA 2I8DA 1D1CA 4BE2A 2HVRA 1WJDA 4XLAA 1EA3A 1X1BA 2E5NA 3DLAA 3CZ6A 5KNLA 4PJJA 2CV1A 3W2VA 4XKCA 3OYHA 3M1CA 2M4GA 2UWMA 3A1YA 3TMOA 4E7KA 3OS2A 1FMWA 4CSWA 1ERDA 4FETA 4PFOA 3QOEA 4XLCA 2K5CA 2WB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9S A; 
#chains in the Genus database with same CATH topology
 2IPQ X;  2OTJ I;  2RKH A;  3WHB A;  1HLV A;  2EIM H;  3RZO J;  4MGR A;  4TV7 A;  2IA1 A;  5EG0 B;  1BL0 A;  1SD4 A;  2H8R A;  2ZC2 A;  1XD7 A;  1JXS A;  2IA0 A;  1I1G A;  5FLX K;  1I6X A;  5KCM A;  2A05 A;  3I0T A;  2QEN A;  3X2Q H;  2VKE A;  3IC7 A;  1MIJ A;  4EQQ A;  3M07 A;  4IEJ A;  3GTG J;  4N4O B;  1K4T A;  4JK1 X;  3JRA A;  1STZ A;  1S9H A;  5IT3 A;  2M0C A;  4EAT A;  2HYJ A;  3H35 A;  1G3W A;  2EZI A;  5CPR B;  4CZZ A;  1X1P A;  1RZ4 A;  4O5V A;  3L2U A;  1A31 A;  3S3O A;  1GVJ A;  2GA2 A;  4P5O A;  3C2H A;  4B48 A;  2K9N A;  4OIQ F;  2DN0 A;  1F9N A;  5M3F J;  2RV8 A;  3SYT A;  3CCM I;  2CW7 A;  2XRN A;  1HCR A;  1AOY A;  4OOI A;  2PJR B;  3DEW A;  3K9T A;  3RPQ A;  1XN7 A;  1B8I A;  3KE2 A;  4M72 A;  4B8X A;  3L09 A;  3IV5 A;  2M2E A;  4I09 A;  4M3G A;  3I56 I;  1W7P D;  2LK2 A;  3HG9 A;  3PFI A;  1SFO J;  3CP8 A;  6PAX A;  2XB5 A;  3RKQ A;  1Y6I A;  2HQA A;  3JRF A;  2DXI A;  1UHM A;  4FT8 A;  5K5R A;  5KVR A;  3Q9V A;  1IF1 A;  4FTH A;  1KON A;  2DT7 B;  5ICG A;  2K9S A;  2L02 A;  3FK7 A;  3CCY A;  4FQG A;  1GHC A;  1XPX A;  2OV7 A;  4ESB A;  4NQW B;  1XSD A;  4GGG A;  1ZEL A;  2P7C B;  2DT5 A;  1PJR A;  2X6O A;  3AG3 H;  1BI2 A;  2DQL A;  2E35 A;  3GTQ J;  3PNT A;  3I3L A;  3TGN A;  5EZH A;  3VYU B;  3GME A;  3LFU A;  2M9H A;  2WBM A;  5C44 J;  9ANT A;  2VB6 A;  2EZK A;  4AUX A;  1PUF A;  2ZB9 A;  4PCQ A;  1ZRF A;  3IL2 A;  1ZAR A;  2ZXW H;  2K9L A;  3RCO A;  2HYG D;  1SAN A;  4NUB A;  4HZF A;  2STT A;  3IKT A;  5E3L A;  4PK4 A;  4AVZ A;  2LSO A;  3ZQ7 A;  1OFC X;  3FBN B;  5HS7 A;  5E3O A;  3PSI A;  2KP6 A;  5EEH A;  2PBI A;  1TWF J;  2ID3 A;  2LNB A;  4PGH A;  5ILV A;  3ECO A;  1SMT A;  4ZYG A;  4IO9 F;  4LIT A;  2XPW A;  4M3B A;  1JKQ C;  1GV5 A;  5F64 A;  5LEJ A;  4WXH A;  3ZOB A;  1G3Y A;  3CUQ C;  1GXQ A;  2JPC A;  5E3M A;  3K4C A;  1H8A C;  3SZG A;  5DV5 A;  2VKV A;  2VC0 A;  4B3X A;  4C3I J;  2JUG A;  5DYM A;  2KMU A;  3OYC A;  5L3E A;  1P9Q C;  2HXO A;  2RN7 A;  3IHU A;  4CDG A;  2F4O B;  4C30 A;  4XM3 A;  3ZMD A;  4B09 A;  4MIM A;  2FA5 A;  3JSP A;  5D5X B;  3MN2 A;  1V5E A;  2EK5 A;  3HIF A;  2B63 J;  2DFI A;  1SEU A;  4YRV A;  1ZGW A;  4RB1 A;  3PL8 A;  3HRU A;  5E20 A;  3OYE A;  2XSJ C;  1UST A;  4FX4 A;  2RQP A;  5FLM J;  1UAA A;  2Z5U A;  5LD2 C;  1EH6 A;  2DMN A;  2Y9Z A;  5HDN A;  2WC2 A;  5TRD A;  2ZME A;  2BY0 A;  3HGG A;  3U21 A;  3OSG A;  1IC8 A;  2EBI A;  2EA2 A;  3ZCO A;  1WRJ A;  1QBJ A;  5CKT A;  1RES A;  2Z3Y A;  3EQL F;  5E17 F;  2P81 A;  4P1W A;  3C3W A;  3ZMT A;  4M3D A;  3BJ6 A;  3ZQL A;  3JRC A;  1FBQ A;  4M71 A;  5DM7 F;  2I10 A;  5L3F A;  1LB2 A;  3EUK L;  2MSY A;  2D1V A;  2LTP A;  2IGO A;  3OYN A;  1ONV A;  1OR7 A;  1R49 A;  3BT9 A;  3LSJ A;  3HKZ N;  4IRH A;  4ZJZ A;  3LA7 A;  2DCE A;  3ERE D;  3WTY C;  1P4W A;  1IUF A;  1X4O A;  2EB7 A;  5AIP A;  4F52 A;  2R7D A;  4LD5 A;  1D3Y A;  3HHG A;  1T08 B;  2KLO A;  5J3L A;  2QYO A;  2XHK A;  4B44 A;  1I3Q J;  4LB5 A;  1OR7 C;  5F0H A;  3HB9 A;  3S2D J;  2P6T A;  3DPL C;  1SFX A;  1FWZ A;  2CRG A;  4E7L A;  1J59 A;  1NK2 P;  4W1U A;  2VE8 A;  2HPM A;  1DU0 A;  3BOQ A;  4XOP A;  2DYS H;  4PFP A;  1IXC A;  4PJM A;  4F55 A;  1TT0 A;  1MBF A;  2L4M A;  1U78 A;  2HOA A;  1FTT A;  2KKO A;  3D0S A;  3KZZ A;  1D8K A;  2ZME B;  2V6E A;  2X48 A;  4XN3 A;  1LKX A;  4CO8 A;  2B0L A;  4G94 A;  2BGC A;  4I99 C;  2XUB A;  4AWX B;  4BDZ A;  3HOW J;  4YFK F;  2RNG A;  4ON0 A;  4JYK A;  2ZXH A;  1ZTR A;  2JSC A;  1UCR A;  5LBQ A;  5HLT A;  3CCU I;  4I01 A;  3JRG A;  2EFP A;  2Z1D A;  3LSR A;  5J1R A;  5JFR A;  4RBO A;  3HOV J;  3COA C;  2EA4 A;  1P6R A;  4LLL A;  3W6V A;  1RC9 A;  4IHT A;  5CLS A;  4J00 A;  4I6Z A;  3L2V A;  4BU2 A;  1E3P A;  2XSD C;  1O4X A;  3DPU A;  2GLO A;  2ZFU A;  1VQ6 I;  5C4X J;  2IW5 A;  3BTJ A;  2FQ4 A;  1OPC A;  4BNC A;  3DTI A;  3KP7 A;  4H0E A;  1UJ8 A;  3QYB A;  4DW6 A;  1JE8 A;  3EUH C;  4A3E J;  3R0J A;  1H9G A;  1IAW A;  1JUP A;  5L3D A;  4XR6 A;  1R5H A;  4BAC A;  1EJ9 A;  4LIU A;  1I5Z A;  2TDX A;  3ZRG A;  3HOX J;  4FE4 A;  1J75 A;  4A3G J;  4LFU A;  3K4M A;  5DS9 A;  4KIB A;  1FIP A;  4UXN A;  3JAM Z;  4RA2 A;  1FBS A;  2EWN A;  4DQ2 A;  2A5Y B;  2KQR A;  4HQE A;  2DBB A;  1FOX A;  1ZG3 A;  4D5F A;  2V79 A;  3GO5 A;  2VBW A;  3HBL A;  3OR1 C;  1FX7 A;  3OYG A;  2OZ6 A;  2WTE A;  1J9I A;  1WSU A;  3VOE A;  5CVU A;  2VON A;  2JVH A;  1S7O A;  3NWS A;  2QKL B;  4NQW A;  3ML6 A;  4U88 A;  4QTR A;  3TKY A;  3AKZ A;  2W1O A;  4R79 A;  5F04 A;  2AQE A;  2FOK A;  2XAS A;  1TWH J;  1T6S A;  3H5R A;  5CVI A;  4AD9 A;  1TLH B;  4GO1 A;  1IN7 A;  2R7U A;  3CO7 C;  2H1K A;  4XID A;  1ZQ3 P;  2LD5 A;  3Q0W A;  2NVX J;  1FC3 A;  2VPL A;  4XK4 A;  1U2W A;  3W6K B;  4BBS J;  4U7D A;  1YHQ I;  2EIK H;  3LSG A;  3OS1 A;  1X1A A;  4GRI A;  1RI7 A;  2QWW A;  2W84 A;  2K85 A;  1IRF A;  3FXL A;  2FBI A;  4BGD A;  2DPD A;  4X6A J;  1LJ9 A;  1XG1 A;  2KL4 A;  2LP0 A;  5J40 A;  3F23 A;  1YW8 A;  4DOZ A;  3QU6 A;  2NRA C;  4IHV A;  2DFH A;  2DPU A;  2KDZ A;  3KP5 A;  3HTU A;  1T2K A;  3K4K A;  4HST A;  1BR1 A;  2CU7 A;  4CZC A;  4Q4Z F;  1W5S A;  2XGD A;  3U2R A;  1ZN2 A;  5HS8 A;  4YEJ A;  1YQA A;  2VOD A;  5ED4 A;  1WPK A;  2M0M A;  3WTX C;  2QM3 A;  4OIN F;  4ESJ A;  2P5V A;  4RGU A;  3GLL A;  1TWG J;  2L54 A;  3FXU A;  2O3F A;  3OYF A;  3DLL F;  2KRC A;  3GTM J;  2KIS A;  3CTA A;  4RLF A;  3E5Q A;  2NOG A;  2CH0 A;  3E6M A;  1X3W B;  1G8X A;  3ZQQ A;  1B9N A;  2DA4 A;  2H94 A;  2Y75 A;  3N05 A;  2MC4 A;  3BR1 A;  4A93 J;  2YX7 A;  1JUS A;  1KYZ A;  4I7H A;  1GLN A;  2QVO A;  1I27 A;  4HV5 A;  3GW2 A;  3MQ0 A;  3HXL A;  4E6K G;  2K4J A;  2PG4 A;  2W85 A;  4LOC A;  3OYJ A;  1RUO A;  2QZ8 A;  1W0U A;  5HNF A;  3GLX A;  3A01 B;  3QP5 A;  2JSP A;  2PMU A;  3QOD A;  4P9U A;  3FXK A;  3VDX A;  2NS8 A;  2HPI A;  3GZ5 A;  1MNM C;  1LEB A;  4C2M J;  3FMS A;  2K86 A;  3RI4 A;  3BR6 A;  3M7G A;  1OCP A;  1POG A;  4CUG A;  1YS7 A;  2ZSH B;  3QPS A;  5FKK A;  3S2H J;  4ENM A;  1O3R A;  2HDC A;  2F5D A;  1OLT A;  4A0X A;  3JAM K;  3ZN1 A;  2PEX A;  4CA0 A;  4M9S A;  4PJL A;  4KNY A;  2BXY A;  2H1L A;  4DGW B;  1MH3 A;  3U9G A;  2IS4 A;  5BPD A;  4I0A A;  4CXF A;  3HSE A;  5BOX A;  1D1B A;  2EQR A;  3CD6 I;  4PDK A;  2VJJ A;  3HZJ A;  1XX5 A;  1MJA A;  3FXJ A;  1RR8 C;  1MBJ A;  4L0Z B;  4HQM A;  3UNG C;  2CUZ A;  4C9Y A;  3G6E I;  3VFZ A;  3PSF A;  2W57 A;  1UHS A;  4H4K C;  3HRS A;  1B9M A;  4HF0 A;  4EMS A;  2LRD A;  3L2C A;  2PQ8 A;  1WJD A;  3K2A A;  4XLA A;  2E5N A;  3TOB A;  1W7P B;  1QVT A;  2UXX A;  4PJJ A;  1JTY A;  5J8F A;  5HLI A;  3J81 K;  4IJA A;  4S0H B;  1W7P A;  1X3U A;  3OYH A;  1F36 A;  1U3E M;  3PO2 J;  3QP6 A;  3TMO A;  5FJ8 J;  1QRY A;  1FMW A;  1OJL A;  3KYD B;  3VEP A;  4FCY A;  4PFO A;  3JW4 A;  1ACI A;  2PI0 A;  2L7F P;  2EJR A;  1K78 B;  2XF5 A;  5EGO A;  2W48 A;  3F0C A;  1N78 A;  1ENH A;  3OIP A;  3KYC B;  2HKX A;  2LF7 A;  2O5R A;  3ELK A;  3S3N A;  1ZRE A;  2EFQ A;  1SVL A;  1ZGA A;  2BY2 A;  1WJC A;  3VPR A;  4M74 A;  3TOA A;  2K40 A;  3ABK H;  3WTW C;  1MD0 A;  2UXN A;  5E8G A;  2LY2 A;  4BQO A;  2CV0 A;  4EVI A;  2W24 A;  1Z1D A;  3NAU A;  1TL8 A;  1JHH A;  2LLK A;  1MDM A;  3T8T A;  3LFK A;  3RDI A;  1OYY A;  2E2J J;  5IT9 K;  3BR0 A;  3GFL A;  1VQN I;  1EKE A;  5CVR A;  4M6Y A;  4NC7 A;  2WY8 Q;  1PDN C;  3D1N I;  1DDN A;  5KAI C;  2ZSI B;  2HOT A;  2L9V A;  3JRD A;  3BJO A;  4WWC A;  1OIS A;  3TL4 X;  4XQF A;  4RGR A;  5AON A;  1D0Z A;  4XSX F;  1W36 D;  2R7R A;  1SD7 A;  1BW6 A;  5J1U A;  2DT6 A;  1BIB A;  1RR7 A;  2QUF A;  2DMP A;  2PFB A;  4JX5 A;  3LSM A;  2WV1 A;  1YRN A;  2ELK A;  1TW2 A;  4KT6 A;  2B9S A;  4M3E A;  4NC6 A;  2DO7 A;  1LVK A;  5IPA A;  1Q1V A;  3GTJ J;  3GUD A;  5FD5 A;  2QCO A;  4D7M A;  4UB6 C;  4XNF A;  5ICC A;  3GTP J;  2NS7 A;  4GYI A;  4A3F J;  2FSW A;  2A69 F;  2Q0O A;  4UVC A;  3CMA I;  3RYP A;  4Y4R A;  1VQ9 I;  1K61 A;  3W2A A;  1Z67 A;  4BKX A;  4Y15 A;  2Q2E B;  4F92 B;  4OWR B;  4YIF A;  4HA8 A;  5EF6 A;  5LHH A;  4AM3 A;  3BPX A;  3O3K A;  3RKX A;  5IP6 A;  1KQ8 A;  1JT0 A;  2ECC A;  3HPH A;  2V9V A;  2JVG A;  4G6D A;  2BVL A;  2YUS A;  4Q47 A;  4A5M A;  4A0Z A;  2JRM A;  2VKH A;  3C18 A;  2R4G A;  2DMQ A;  2FE3 A;  4EM0 B;  2P8T A;  3P9C A;  4BQA A;  1AHD P;  3MKW B;  3VWB A;  1HQC A;  2O61 A;  1ZYR F;  2NXN B;  1ZLJ A;  3H3V K;  1UFM A;  3ZQC A;  3D5R C;  5FD6 A;  2QLZ A;  2H8W A;  2VPR A;  4DBQ A;  1MBG A;  2DYR H;  1BI3 A;  1HC8 A;  2XGE A;  3FXQ A;  1BBY A;  3R0A A;  4P55 A;  4LIV A;  4XRS G;  1A6Q A;  5B1A H;  4BHP A;  3HHH A;  2NVU B;  4HX8 A;  1OCC H;  3QYF A;  4FAS D;  2GBY A;  2UZK A;  2VAS A;  5E18 F;  5L3B A;  4UV9 A;  2L7M P;  4PUS A;  2M7A A;  4NNJ A;  2PMH A;  4M6V A;  4NB5 A;  4P9F A;  3OV8 A;  2CWE A;  1ZH5 A;  2ZNY A;  2Q2E A;  2P5K A;  3CMM A;  1T56 A;  1V5G A;  5HDK A;  3E5U A;  2KZG A;  3OWT A;  3FM5 A;  3NAR A;  2HKO A;  1DUX C;  4G7Z F;  4HEA 2;  2ZCW A;  3LAJ A;  2FNA A;  1QHG A;  4L5E A;  2LR8 A;  4XLF A;  1I6H J;  3OIQ A;  4A3C J;  3GXO A;  2HOE A;  3CCL I;  2JZY A;  3PM1 A;  2OBP A;  2O6G E;  2HVS A;  2M7B A;  3RYR A;  2R93 J;  1YS6 A;  1KZH A;  3L1P A;  2L7K A;  1ZAO A;  4XL9 A;  2IGK A;  3J80 Z;  3L2W A;  4XKW A;  2JTV A;  5CYV A;  1IRZ A;  2MH2 A;  4A0Y A;  4XON A;  1ETX A;  1SFU A;  4HYE A;  1WJA A;  1VI0 A;  2W82 A;  1KU9 A;  1PVE A;  3JRH A;  2K4B A;  2R7Z J;  4U0V A;  3OYB A;  3SDG A;  3V8K A;  2F5V A;  3MFK A;  2DMT A;  4FHT A;  2DA3 A;  4KYW A;  2GAU A;  2Y0S A;  5DEQ A;  4E7S A;  2V7F A;  1RKT A;  1OQY A;  1YI2 I;  1XSX A;  2DOF A;  1BC8 C;  2FQ3 A;  1IN4 A;  4KDP A;  2BW3 A;  1R1V A;  1S3J A;  2DMU A;  5LGT A;  2OPT A;  4EGY A;  1QHH D;  3CDI A;  4N0B A;  4BYY A;  5GAH J;  2V9K A;  1AWC A;  3ABT A;  5F0C A;  2A5W A;  3I4M J;  3HSR A;  4KT5 C;  2HZD A;  3EPZ A;  2NS0 A;  2D2W A;  4ZTJ A;  3CCQ I;  4Y17 A;  3LA3 A;  3LWF A;  2BOL A;  5HNH A;  4IKF A;  3FK6 A;  3BWG A;  3MKL A;  4C3H J;  3J7Y J;  1FIA A;  5F27 A;  3I64 A;  3C7J A;  4A3I J;  4HW0 A;  2LKS A;  2RAE A;  3QPH A;  3RQ4 A;  3FXM A;  5K7H A;  5D5V B;  4E7H A;  4R8H A;  2FUG 2;  2Y48 A;  1XGN A;  1Z91 A;  2OCE A;  3CLO A;  2R7Q A;  2QQB A;  2N8G A;  4Q48 A;  2LDU A;  5H2F C;  2R5Z A;  1ODD A;  5FFX A;  2VUM J;  1VQ5 I;  2KJB A;  1FP1 D;  4CCM A;  1MBH A;  2VLA A;  3IWF A;  1BJA A;  2PN6 A;  1W36 C;  3I59 B;  4HX4 A;  3MD2 A;  1MJB A;  3S8P A;  4KIS A;  1IUY A;  2M8E A;  1ZRD A;  1GVD A;  2KJC A;  4BH9 A;  2VKD A;  4A3B J;  2VT3 A;  2QSH X;  3CCV I;  4A3D J;  3N4M A;  3F22 A;  2X1C A;  1M1E B;  1TZL A;  1R58 A;  2MD0 A;  3LQR A;  2EIN H;  2YS9 A;  2MGQ A;  3O8G A;  3SFI A;  4KMF A;  2CQ7 A;  3C1D A;  1HKQ A;  3ZPL A;  2L0K A;  3DBR B;  1ETY A;  2DU9 A;  4YFN F;  4ZYH A;  3TW6 A;  3BTC A;  2ACJ A;  3CC2 I;  4CYC A;  2ESH A;  4IHX A;  1YOV B;  3HM5 A;  5JLW A;  5FLV A;  3MZH A;  3K4L A;  4Y33 A;  2CW8 A;  2E7W A;  2A6E F;  2FX0 A;  3ZR8 X;  3J7A O;  2V6C A;  1TP4 A;  1VQO I;  3ROU A;  3PUF A;  1X58 A;  2K3P A;  3IUO A;  5BPI A;  5K5O A;  4J01 A;  2HVQ A;  3NQO A;  5DCM A;  1R5I D;  3IH3 A;  4DYC A;  2BHZ A;  4N4N B;  3TQN A;  5ILS A;  1LFP A;  5DD4 A;  3LSP A;  1I50 J;  2M4K A;  1U5T C;  3DBH B;  2DFE A;  3OL3 A;  3K1N A;  1Y0U A;  1BJZ A;  3AG4 H;  1J7K A;  1MH4 A;  5KK1 A;  3T0Y A;  1DPU A;  3AFH A;  1OYI A;  4X1E A;  2IGN A;  3WOD F;  5GTI C;  3QRF F;  2H27 A;  3ZQI A;  3Q3S A;  2EIJ H;  2KRH A;  4KUM A;  2HI3 A;  3E1S A;  1QPM A;  1I39 A;  4IF4 A;  2LKP A;  1R5G A;  3DTE A;  2FOW A;  2OA4 A;  2G7H A;  2W7N A;  2JA7 J;  3KET A;  3O8H A;  3CP2 A;  3HYI A;  1ZKG A;  2LYC A;  3ASO H;  2X51 A;  5A2Q K;  2Q1Z B;  3IRQ A;  3F8N A;  4HDU A;  4AIJ A;  1FNN A;  1OCO H;  3WHC A;  2WV0 A;  3K2Z A;  1FYK A;  2Y9Y A;  3N97 A;  1ORK A;  3DKX A;  3FMQ A;  5HDG A;  3FKI J;  3OMY A;  3EET A;  1K6Y A;  2I5U A;  2BE5 F;  2IS6 A;  1A35 A;  3F6O A;  1D1A A;  5IOY A;  1LNW A;  2A3S A;  2Y0S N;  1D8J A;  3JR9 A;  2AHQ A;  3A2K A;  3HPG A;  5HS9 A;  4RB2 C;  4BJ5 C;  2WWY A;  3BG6 A;  5DTD A;  2XRO A;  1L0O C;  3G71 I;  2CMP A;  2E71 A;  5CJ9 A;  3LQQ A;  3MZ8 A;  2WA0 A;  3ZGK A;  3MAJ A;  4CCL A;  5FO5 A;  2GWR A;  4MEX F;  4QLC U;  1MMS A;  2JN6 A;  1TQI A;  5EEG A;  4AID A;  4D5C A;  4UB8 C;  1MDM B;  1YRN B;  2KRF A;  3F8M A;  3QWL A;  3CF2 A;  4ZC3 A;  2OF7 A;  4JX4 A;  4PGG A;  2NVQ J;  1P92 A;  1UMQ A;  4QPO A;  1N25 A;  2HEO A;  3KPH A;  5C4J J;  1HSJ A;  2EV6 A;  2BZT A;  5K7Z A;  1HW5 A;  3ZMS A;  5D4S A;  1R9T J;  3RJP A;  2BVM A;  3KCC A;  5TGT A;  4BY7 J;  3SXY A;  4UUS B;  3JRE A;  1FPQ A;  1QVU A;  4BXU A;  3FHZ A;  2DAO A;  3VYR B;  3RPU A;  5HLG A;  3JTG A;  4BXF A;  3GTO J;  5KAF C;  5IOZ A;  3I53 A;  5DUK A;  4DJA A;  1E3H A;  3CCR I;  2OCC H;  1E2X A;  2DDB A;  1FOW A;  3H5A A;  1X1C A;  1ZR2 A;  4IQJ A;  1RNL A;  4B4C A;  2HTJ A;  2H6C A;  1GXP A;  2DJI A;  4S04 A;  3LA2 A;  2CUF A;  1IXS B;  2HGC A;  2AXL A;  4B3A A;  3OIO A;  4KIF A;  1YIO A;  3ASN H;  1U8R A;  3PJR A;  1VQ4 I;  4E7J A;  2ICW G;  3G1O A;  1LEA A;  5ICE A;  1IZ1 A;  4F93 B;  1TWA J;  3CCS I;  3DTK A;  5FFZ A;  3JRB A;  1MMD A;  1IJW C;  1SFE A;  4RAG A;  2VXD A;  4F3Q A;  3CO6 C;  5FGM A;  1F5T A;  5FKO A;  2VJ5 A;  2JQ7 A;  5BQT A;  1QPI A;  3F6V A;  2EPF A;  4GYG A;  2Y2Z A;  3H3Z A;  4BBR J;  1K78 A;  4L0Y B;  2GXB A;  1OMI A;  1USS A;  1UG2 A;  2WAE A;  2IBD A;  1MMG A;  3BPV A;  2DA7 A;  1ZRC A;  2XAJ A;  5F1R A;  2Y0M A;  2ZJR F;  1MBE A;  1NH3 A;  2JT1 A;  1XMK A;  4BE2 A;  4ZYE A;  2HVR A;  4CHU A;  2IA2 A;  1EA3 A;  2IAI A;  1KU3 A;  3DLA A;  3CZ6 A;  2CSO A;  3WE3 A;  3W2V A;  5JVG F;  4XKC A;  2O03 A;  2J5O A;  2QQA A;  4OIO F;  1Z7U A;  3KZI C;  4HV6 A;  4HF1 A;  5EJC A;  3GYH X;  1I1S A;  3OS2 A;  3RKW A;  2VBY A;  3R4K A;  2K9Q A;  4CSW A;  2E1C A;  4FET A;  1FYL A;  3BQY A;  3QOE A;  4XLC A;  1JKR C;  1FZP B;  3GTK J;  2NVY J;  5CVV A;  4MQV A;  3L7W A;  1DU6 A;  3WU1 B;  1GDT A;  4OAZ A;  3G4S I;  4UUV A;  1TNT A;  4HSR A;  2ZXI A;  1XB4 A;  1AKH A;  2DTZ A;  3IAM 2;  1T39 A;  2QQ9 A;  5DUI A;  2ZKZ A;  1MZB A;  3V42 A;  2E1M B;  1YTY A;  4BDY A;  3FX3 A;  4BJ6 C;  2F48 A;  1ZG5 A;  1WJ5 A;  1FSH A;  4E70 A;  3S17 J;  1YX5 A;  2IS1 A;  2XF7 A;  2EZL A;  1X19 A;  2VN2 A;  4JOM A;  5A2Q Z;  2O0Y A;  3G73 A;  3K6G A;  1NHA A;  1T33 A;  1YJW I;  4CGZ A;  1WZ2 A;  3WTZ A;  2KFD A;  2IP2 A;  1MND A;  5FKN A;  1ZK8 A;  5DM6 F;  3L9F A;  4GFB A;  4Y3O A;  4Y13 A;  2DK5 A;  3ECH A;  4UNO A;  3KLN A;  3ULQ B;  1LQ1 A;  4L9N A;  3M1E A;  2AO9 A;  1W0T A;  2Y30 A;  2BY3 A;  3EDP A;  3CJT B;  2UV1 A;  1JTX A;  1XC5 A;  2XDV A;  1D5Y A;  4C2T A;  2VXZ A;  3CMY A;  4ZZL A;  4XBF A;  1TWC J;  4LK0 F;  2VBX A;  1SFK A;  1Y1V J;  3BC8 A;  3QQA A;  3VSK A;  1AKH B;  3CDL A;  2HZT A;  2LG4 A;  2JA5 J;  1Y1W J;  3GTL J;  1WQ2 A;  4CYD A;  1PUF B;  3IH2 A;  1WVR A;  3KZY A;  3S3M A;  1HOM A;  3L00 A;  5J6X A;  3J7A Y;  4HRI A;  4ZDO A;  2CV2 A;  1IV8 A;  2NYX A;  3GFJ A;  4KIG A;  5FKM A;  3CLQ A;  5FRN A;  1LDJ A;  3TDU C;  1R1T A;  3MMY B;  4HLY A;  3ESW B;  2CUJ A;  2XIG A;  3DKY A;  3TO7 A;  4ETS A;  2DA5 A;  3VYS B;  3PIO F;  2X6W A;  3QYE A;  2GOX B;  1DGR M;  5FB2 A;  1CGP A;  1B1B A;  4U87 A;  4EJO A;  3B73 A;  3KEO A;  3HOU J;  3TO9 A;  3R60 A;  2JA8 J;  2OU2 A;  3ZMZ A;  1WKM A;  4AVP A;  2BHY A;  3TP3 A;  1ZGJ A;  3BDD A;  2CG4 A;  2HDD A;  3PFY A;  4IPA A;  2QA4 I;  2EFN A;  2PMZ A;  1Y56 A;  4IVN A;  3EYY A;  1YG2 A;  1NG7 A;  4LG0 B;  1WWX A;  3OYD A;  2VQG A;  2DQR A;  3D5L A;  5D6E A;  5F08 A;  1MBK A;  1TW3 A;  2DI3 A;  2RGV A;  3I9V 2;  2YSR A;  2VBZ A;  4L9J A;  2QBY A;  5D5U B;  3G2B A;  3GFM A;  3EUA A;  2OC6 A;  2PLY A;  4EJU A;  2CUE A;  3BG7 A;  4IZZ A;  1IN5 A;  3JCU C;  3BG5 A;  5IYB J;  2IEK A;  3Q9S A;  3NWT A;  1U5T B;  2CW0 F;  2DA2 A;  2QGU A;  4ENK A;  1FEX A;  2KT0 A;  2C6Y A;  3Q5F A;  1RIO H;  3HOY J;  2CO5 A;  2A68 F;  1ETQ A;  1TTY A;  5GPA A;  1MW7 A;  3EUH A;  3FF5 A;  1DPR A;  1FP2 A;  4MO7 A;  3F9K A;  2EH3 A;  3T5X A;  3I55 I;  3FXR A;  3GEZ A;  1B72 B;  2MG4 A;  2L9R A;  3M8F A;  3ZMU A;  4UUS A;  4IQ4 A;  4ZH4 F;  3FBI B;  1K4S A;  5K5Q A;  2DLL A;  1ZHF A;  4AIH A;  2GIV A;  5EEA A;  1NTC A;  1V55 H;  5IY5 H;  4KN7 X;  1IV6 A;  2Y31 A;  1LUJ B;  3S1N J;  4G6T B;  2LOO A;  2E1M C;  4BXX J;  3MZY A;  5GTH C;  2IXS A;  2XKP A;  1EF4 A;  1XGS A;  2M30 A;  2M3A A;  1VQK I;  1T95 A;  3F3X A;  4HX7 A;  1KYW A;  4L9V A;  1K7A A;  1LFB A;  1S5L C;  4G9Y A;  1BM9 A;  1R23 A;  1T0F A;  3GZ6 A;  1BIA A;  3CCE I;  1S8N A;  5BMZ A;  3ERM A;  2K27 A;  2EV5 A;  3A03 A;  3H1C A;  5LRS A;  3V7S A;  4EM2 A;  3F72 A;  2IT0 A;  1XCV A;  1K83 J;  2L2O A;  3MWM A;  4XLH A;  2HYF A;  3ZXS A;  3E6C C;  4D9J A;  1FMV A;  3P5J A;  3L2R A;  1HDP A;  4BHC A;  4LG3 A;  3BRO A;  3WTU C;  2BEO A;  3KP6 A;  5J47 A;  5E1W A;  1R22 A;  4IHW A;  3E0J B;  1Z77 A;  2FNP A;  3TP0 A;  1YO5 C;  4IHS A;  1TNS A;  3VB2 A;  1UG0 A;  3BZC A;  2L5Q A;  4NHJ A;  1AU7 A;  3O6B B;  2O7O A;  2HOS A;  5CVJ A;  3BCB A;  4ESF A;  1HBX G;  2Z16 A;  1VQM I;  1Z21 A;  3H9J A;  3KIO A;  4HF2 A;  2MD5 A;  1J09 A;  2CGP A;  4OMY A;  1T98 A;  4BS9 A;  4XOR A;  3UKG A;  4MFE A;  3M8J A;  4MTD A;  2COB A;  3BR2 A;  3QPT A;  1YJN I;  4BHB A;  5D6F A;  5CQG A;  2LVS A;  2QSG X;  1KQ9 A;  3AL0 C;  2K02 A;  4Z2Y A;  3GCM A;  3S14 J;  2LY1 A;  1QU3 A;  1D5V A;  1FSE A;  2E1O A;  1ON2 A;  2KHM A;  2NNN A;  2XVC A;  1WGX A;  4BEH A;  1F1Z A;  4BAY A;  1SVM A;  2K7L A;  2R7W A;  1T0F C;  4M3F A;  4UY8 I;  1BR4 A;  1R36 A;  2F6C A;  1H88 C;  1X3Z B;  3A02 A;  4XSZ F;  2L01 A;  3AG1 H;  4LGW A;  2OAZ A;  1XSV A;  3HRT A;  1BW5 A;  3M8E A;  2RC4 A;  3IAS 2;  2P6S A;  3DP7 A;  3ISP A;  3OR2 C;  1XTA A;  3V8J A;  1CF7 B;  4HPQ A;  5J4V A;  2EV0 A;  4AU7 A;  2MLG A;  1GT0 C;  3CC4 I;  1TC3 C;  3GFI A;  1H0M A;  2LBF A;  4BUP A;  5LFA A;  2WAQ A;  3O2P E;  4JBA A;  2IJL A;  4KN4 X;  3IRR A;  3B02 A;  4UVB A;  3GBG A;  4ENJ A;  4V2F A;  1BI0 A;  3HC7 A;  4DBR A;  1YIJ I;  4ANJ A;  3K69 A;  4OMZ A;  1HKT A;  1X1D A;  4I76 A;  2BY1 A;  4IX7 A;  4RDU A;  4I2O A;  2HU9 A;  1BI1 A;  3ABU A;  2ELJ A;  4L5J A;  4BQN A;  3WTV C;  3P9I A;  5C3E J;  2DK8 A;  3F8B A;  2CQN A;  1B8I B;  2OTL I;  4OIP F;  1ZG1 A;  4WK8 F;  2V1X A;  2XRL A;  4XOT A;  3ZMV A;  1MJ9 A;  4ABZ A;  4G7H F;  3LST A;  3PO3 J;  1REP C;  4A6D A;  5HOO A;  2E5Z A;  4IOA F;  1V3F A;  2PX9 A;  2ZXJ A;  1DGW Y;  2QQ8 A;  3WU0 A;  3FM3 A;  3FIW A;  1W5C C;  4BL0 B;  5GP9 A;  4LJZ F;  1UEL B;  2ELH A;  2XPU A;  1FTZ A;  1S72 I;  3TED A;  1R4M B;  1LFU P;  1RKW A;  1SD5 A;  4FX0 A;  4LLN A;  1IDZ A;  4KMU X;  2A61 A;  3HOZ J;  4I98 B;  4M6X A;  2V26 A;  4QIW N;  5D8K B;  4I0B A;  1S7A A;  1WJB A;  2JPB A;  2P4W A;  3K70 C;  2VI6 A;  1KQ0 A;  3HTS B;  3PIP F;  4DZJ A;  2LKX A;  2E2H J;  2JWT A;  5K7F A;  4CIC A;  1Z05 A;  2CS3 A;  2X1D A;  3WG7 H;  3OYI A;  2W4S A;  3DCF A;  4Y7N J;  2JK3 A;  5JHF A;  2OQG A;  3OYK A;  4PSX A;  1WI3 A;  2DA1 A;  2UUZ A;  1TT5 B;  4HG2 A;  1TBX A;  1WFX A;  3KYL A;  2QBY B;  4D1Q A;  4U7B A;  4OAY A;  2V1U A;  3WGI A;  2Z33 A;  2ZO4 A;  3VYT B;  1ZLK A;  2H6B A;  4IXA A;  3SJM A;  2JMW A;  2QKM B;  1VND A;  2FML A;  5E8I A;  3JSO A;  3E3V A;  2VC1 A;  2IS2 A;  3LAP A;  5EGO B;  3CES A;  2H09 A;  1D0Y A;  4ASN A;  2F2E A;  1YJ9 I;  4O3M A;  4UV8 A;  4EJT A;  5DDG A;  1OKR A;  2X85 A;  2G9W A;  3CC7 I;  4CCJ A;  1V54 H;  3DEE A;  3LL7 A;  1V5F A;  3CUQ A;  4BEH B;  4QPQ A;  3FZV A;  2R7T A;  2KIU A;  1MMN A;  4MHG A;  3SDB A;  1WJE A;  5GAE J;  1ULY A;  2OQR A;  1PYV A;  1IGN A;  2E19 A;  4J19 A;  3K0L A;  4YEL A;  3H36 A;  2LH9 A;  4XLE A;  3JRI A;  4EM1 A;  1ETK A;  2MH9 A;  4ENN A;  2R0Q C;  5FLX Z;  4LB6 B;  1T8I A;  2EIL H;  2KDO A;  3AG2 H;  3OSF A;  2M87 A;  3KEQ A;  5H20 A;  2MAB A;  2JUC A;  4DYR A;  5M5W J;  1Z6R A;  1YIT I;  1E0E A;  5E3N A;  3TDZ C;  2DTR A;  2A07 F;  3J81 Z;  5D4R A;  5HLH A;  3WE2 A;  3EYI A;  2VQL A;  3HOT A;  1SC7 A;  3FKJ A;  2X6Y A;  1N77 A;  1U9O A;  2R7S A;  3HL2 A;  3BG9 A;  3LSI A;  5B5E C;  2MA3 A;  4GDF A;  5CQE A;  2NNY A;  1SMY F;  3MVP A;  1OYW A;  4E7I A;  1F4K A;  4LMY A;  2E60 A;  4CCO A;  4WCG A;  1IDY A;  3B6C A;  5J4Y A;  1BOB A;  5B1B H;  5FRO A;  1I3A A;  3K4N A;  2M1B A;  1O3T A;  3A4C A;  2CQX A;  3S1R J;  4W97 A;  1YX3 A;  4D7N A;  4XMY A;  3SQN A;  1FOY A;  4C3J J;  3RIR A;  4RS8 A;  3FXO A;  2DJN A;  4XKV A;  1Y0N A;  5ICF A;  3R6S A;  3BR5 A;  3E6D A;  2XAF A;  2K9M A;  3HRM A;  2ME0 A;  4EV0 A;  4MNU A;  5DCM B;  3QU3 A;  3ONQ A;  2A6T A;  3JTH A;  4A3M J;  3LSK A;  3BCA A;  1E17 A;  2R5Y B;  1SD6 A;  1FT9 A;  5E1X A;  1MNE A;  3W2W A;  2VJI A;  1Y8Q B;  3VSL A;  3TO6 A;  1BR2 A;  4A3J J;  2QF7 A;  3CJQ B;  4RB0 A;  4EJV A;  5L3G A;  5LGU A;  3G1L A;  1D1C A;  2LMD A;  4KFC A;  2F5C A;  4MFD A;  5IYC J;  3RKY A;  2CV1 A;  3NEU A;  4M73 A;  1OCZ H;  3RZD J;  4IRI A;  1LDD A;  3R61 A;  3M1C A;  2M4G A;  2X4H A;  2ISZ A;  3IH4 A;  2HS5 A;  3A1Y A;  4M9X A;  3SFZ A;  4HDV A;  2KIQ A;  1FBU A;  2WB1 A;  4UHT A;  4P96 A;  3KP2 A;  3BTI A;  3VOD A;  1X2M A;  3DF8 A;  2FBH A;  2HNH A;  5E1Z B;  5EG0 A;  1J0R A;  3FWE A;  1QZY A;  1O7F A;  2D1H A;  5M3M J;  5BNG A;  1XDU A;  1JUM A;  2ADU A;  2L9N A;  5TJJ A;  2XV4 S;  3IKV A;  1Q1H A;  2CJJ A;  1N75 A;  4ZDL A;  5LHI A;  1YLF A;  1LE8 B;  2ZNZ A;  1B4A A;  1FY7 A;  3CUQ B;  1YFH A;  2FD5 A;  3OYA A;  3AL0 B;  5E79 C;  3LSH A;  3GZN B;  1G3T A;  2GZW A;  1XDS A;  5D5W B;  3S16 J;  4RAF A;  3H9G A;  2RQQ A;  2BW3 B;  3P9K A;  2MYS A;  2GXA A;  3C2G A;  1MSF C;  5IP7 J;  1HXD A;  1WH5 A;  2PMZ N;  2OUM A;  2XAH A;  3E6B A;  2G7U A;  3CDH A;  1Z0X A;  2IGM A;  4ZYA A;  2XGX A;  1QA6 A;  1G2H A;  4N9H A;  3V7R A;  5L3C A;  3T1B A;  3PNY A;  4A12 A;  3LMM A;  1VZ0 A;  5LRR A;  5EDN A;  1IRG A;  5GPC A;  1W1W E;  1MSE C;  2EZH A;  2RVC A;  1X4P A;  3M9A A;  4D0P A;  2EFW A;  4V2G A;  4MEY F;  3S32 A;  3TBI A;  1KU2 A;  2RNJ A;  4G6Q A;  1UZC A;  5J8C A;  5DCF A;  1U0J A;  1C0W A;  3V8L A;  4LLG F;  4ZYD A;  3M4O J;  1JGS A;  3AAF A;  2FJ1 A;  3S2W A;  2PJP A;  1WCM J;  3CJR B;  1SAU A;  4YII A;  3S1M J;  1VQ7 I;  2LF8 A;  1H9T A;  3I4N J;  1G4D A;  4IL6 C;  4ZDP A;  3C2B A;  2R5Z B;  1H89 C;  1Z7L A;  4NC8 A;  2VT2 A;  4YFX F;  3HSF A;  3OYL A;  3KFW X;  1VQL I;  4KA4 A;  3J80 K;  1UHW A;  4K2E A;  2IRF G;  2YR2 A;  2FU4 A;  3W3C A;  3I4P A;  3DFG A;  3OY9 A;  2MW8 A;  2HWV A;  3QPL A;  1P7J A;  4V19 K;  3OOU A;  5GAG J;  4HNT A;  4HNU A;  1P2F A;  2BYV E;  1A5J A;  2CFX A;  4L9T A;  1E3O C;  1KGS A;  1S29 A;  1RUN A;  1W5T A;  2HDW A;  2E34 A;  3S93 A;  3IP4 B;  4NDL A;  3HUG B;  5JLX A;  5M5Y J;  1TQP A;  4G8X A;  1IW7 F;  4QSH A;  3CUO A;  3DU6 A;  3CJN A;  4DNC A;  3L2Q A;  2M45 A;  3WGG A;  3H9Q A;  3K10 A;  3RTR A;  2OZU A;  2V1N A;  4WX9 A;  4G12 A;  4PSW A;  3GF2 A;  5JHU A;  5BS6 A;  2L3D A;  4UUT A;  1JJ6 C;  4YIR X;  4CYC B;  4DZP A;  4XRF A;  2G0E A;  3CF5 F;  1XMA A;  5D8L B;  3U1K A;  3TW7 A;  2F5F A;  3GX4 X;  1D0X A;  4EEF G;  1HW1 A;  2LC2 A;  5DD8 A;  1XCB A;  4A2U A;  4CCK A;  2DA6 A;  2VOO A;  4MLO A;  1LDK B;  3SZT A;  1QGP A;  2JJ7 A;  2O8X A;  3P7N A;  1BA5 A;  2XAQ A;  1XGM A;  3SEZ A;  4FIS A;  1G3S A;  2DFF A;  1YW7 A;  1ETV A;  1QZE A;  2IVM A;  2KPM A;  4IRG A;  2M8G X;  3HUG A;  3PQJ A;  3CME I;  4HLX A;  3OL4 A;  4ITV A;  2YPR A;  2ZJ2 A;  2R7V A;  2M5W A;  1IXR C;  2HTS A;  1W4M A;  3H3U A;  1KU7 A;  3CQZ J;  3BG3 A;  1HF0 A;  3I59 A;  1P4X A;  1NG6 A;  4XRM A;  4II2 A;  1GV2 A;  5B3S H;  4RMN A;  1S6L A;  1T38 A;  2GIZ A;  4XLN F;  4AYB A;  4M9Z A;  2QEX I;  2AS5 F;  2DOD A;  2R3S A;  1U8B A;  4F91 B;  3ABM H;  1XMX A;  1QQI A;  2X6X A;  2L4A A;  3K1P A;  2STW A;  2AXT C;  4XLP F;  4UVA A;  2HQN A;  2MFZ A;  1G59 A;  5TIS C;  2CQQ A;  3I71 A;  4RAZ A;  1O3Q A;  2E1N A;  2VL8 A;  5H6Q A;  2GOM A;  2ZJQ F;  1APL C;  1MMA A;  4E4H A;  2JA6 J;  3K70 D;  1VF9 A;  2WY7 Q;  3MEX A;  2FMY A;  1DP3 A;  2KIM A;  1LPQ A;  3BJA A;  3MKZ A;  1IN8 A;  2ETH A;  2V9P A;  1JHF A;  1WHU A;  3PNV A;  3BLY A;  4Q5S F;  1WI9 A;  4KIC A;  2XPV A;  3M3Y J;  4BE0 A;  2D5V A;  3CCJ I;  4AIK A;  2WAD A;  1CQT A;  3WTS C;  4WXC A;  4PZJ A;  2VQH A;  4PJN A;  3H0G J;  4A69 C;  2EFO A;  3DXJ F;  3BQZ A;  1VQP I;  2RDP A;  1J2X A;  1OCR H;  5KHD A;  5LHG A;  2XF6 A;  2ZJP F;  3ZQG A;  1SVO A;  4QWQ A;  1XGO A;  3HKZ A;  3K4J A;  1R00 A;  3RQI A;  1K6O A;  2R92 J;  2NOJ B;  2M34 A;  3SZP A;  3Q0V A;  3WG9 A;  2FXA A;  3E7L A;  4ZTF A;  3S1Q J;  2F4M B;  1ETO A;  4JX6 A;  1R7J A;  3HOS A;  3DV8 A;  4MQ9 F;  4A5N A;  3H0D A;  1WH7 A;  4RLQ A;  2ZBK A;  1FYM A;  5EZG A;  2GA1 A;  2K3F A;  2MBF A;  2NVT J;  5IT9 Z;  4RM3 A;  3E97 A;  4O6J A;  1A36 A;  2A6H F;  3DEU A;  3KP3 A;  5IP9 J;  2LY9 A;  3OYM A;  3T8R A;  4FE7 A;  2GXG A;  4CCN A;  2YX4 A;  1RPW A;  2DOE A;  2CFO A;  2FRH A;  1R4N B;  2HR3 A;  3SHF A;  1ETW A;  1VFC A;  2F4I A;  4Y52 J;  5HVQ C;  4IHY A;  1QZZ A;  3SEQ A;  1FOK A;  2D45 A;  2XAG A;  3H92 A;  1JI8 A;  2E7X A;  3DPT A;  4L5I A;  4RAY A;  1HW2 A;  4L18 B;  2Y69 H;  4ZZD A;  2WAQ N;  2R5Y A;  3K1M A;  1BC7 C;  2OD5 A;  3G1M A;  2HQ5 A;  1Z3Y A;  2OJE D;  3GVA A;  1HKS A;  2V4J C;  2Q8K A;  1K79 A;  5B66 C;  5F6F A;  2LFB A;  2HXI A;  1UB9 A;  3A01 A;  2FF4 A;  2JA2 A;  2TRT A;  3UR3 C;  3E5X A;  3HDD A;  3GWZ A;  4RGS A;  1Z9C A;  4CH7 A;  4U0Y A;  2R7O A;  3KP4 A;  2HQR A;  1Y39 A;  4E7Z A;  1WJF A;  2L9S A;  4II3 A;  3MKY B;  3ZP5 A;  2Z2S B;  3OS0 A;  1CF7 A;  1RRJ A;  5EYR A;  1NK3 P;  2MLK A;  1O3S A;  4A3K J;  2R7F A;  1MKM A;  3BR3 A;  1P7I A;  1HA8 A;  2F5E A;  2GQQ A;  4Z6Y A;  1KA8 A;  3DBL B;  2XC7 A;  2ECB A;  4U0W A;  5FRM A;  3MCZ A;  2NAZ A;  1YW9 A;  4B1R A;  3LNQ A;  2DW4 A;  2BXZ A;  1R1U A;  4IOC F;  2PJR A;  3W6J B;  1TQM A;  3FHN A;  3Q0U A;  5K1Y A;  1ITY A;  1YE9 A;  4BQQ A;  1O57 A;  2VIX A;  4RM2 A;  5JR3 A;  1MGT A;  3V4G A;  1V4R A;  3HEF A;  2FBK A;  4HNV A;  3F21 A;  3LOC A;  3ABL H;  1B6A A;  3H5N A;  2YU3 A;  2HFH A;  1DQU A;  4EJW A;  1U6G A;  4EGZ A;  3BZ6 A;  2VQC A;  3DKW A;  3I5U A;  3FIS A;  4MTE A;  4A6E A;  4B43 A;  4WF2 A;  1PP7 U;  1Z3X A;  2BBY A;  1A04 A;  2W00 A;  4C2U A;  1L3L A;  3S15 J;  2E36 A;  1IN6 A;  4KJZ A;  3BZK A;  5F0F A;  3HGY A;  4DYQ A;  2XGC A;  1RET A;  5M5X J;  1G6N A;  5AIQ A;  3PQK A;  2RRE A;  4LG0 A;  2YU9 J;  2ESN A;  3IWZ A;  3B6A A;  1IG7 A;  2J5P A;  2LRE A;  1Y8R B;  1F43 A;  2DOA A;  3G3Z A;  2V1D A;  3V7C A;  4KIT B;  1U9N A;  2O9L A;  2KIF A;  1BOA A;  1IO2 A;  4PJ0 C;  2Z9O A;  4RB3 C;  1HDD C;  3KEY A;  4BY1 J;  1EV7 A;  2ID6 A;  2COM A;  2W25 A;  2XB0 X;  1ON1 A;  5ILU A;  1BN5 A;  2VE9 A;  2XAU A;  3U1D A;  2MC3 A;  4HBL A;  3REO A;  1R6R A;  4DIQ A;  1SAX A;  5LLQ A;  4BE1 A;  3WGH A;  1AA7 A;  1IRX A;  2ZFW A;  3DQV C;  2P0W A;  1X2N A;  3QOP A;  2CQK A;  4JQF A;  3J7Z I;  1J5Y A;  3F8C A;  3I58 A;  2TCT A;  5FKL A;  4GCV A;  5F1J A;  1DP7 P;  3RSN A;  3F8F A;  1PP8 F;  2WB1 N;  3BY6 A;  4NBQ A;  4HAM A;  1VTN C;  2X0L A;  5IYD J;  2O8K A;  1JJ8 C;  2BV6 A;  5H6R A;  2DDA A;  3A0H C;  1B72 A;  2CYY A;  2L7Z A;  4WXD A;  5ERI A;  2FEZ A;  3K4B A;  3PUB A;  3OOP A;  4BJT A;  3KX2 A;  4XIC A;  1QNT A;  1OCT C;  2R7X A;  2LBF B;  2Z99 A;  4F7Z A;  1LVA A;  1O7L A;  4RGX A;  4X0G A;  1JKO C;  1EH7 A;  3ZQH A;  4YG2 F;  1Z6T A;  4N9I A;  2P5L C;  2WAF A;  4HOB A;  3ZQF A;  5GAD J;  2B7E A;  1JGG A;  3RPU D;  2XKO A;  1A6I A;  2ISY A;  3D5S C;  2X1E A;  2ZME C;  3NRV A;  3KLO A;  2AQF A;  1VQ8 I;  5LGN A;  3FDY A;  4GXO A;  1HST A;  3DU5 A;  3QAH A;  5JI6 A;  4AYB N;  1QO0 D;  3K7A J;  4XRS A;  2VJ4 A;  2X9D A;  1YYV A;  1U5T A;  3BTL A;  3DWL E;  4OU0 A;  2JRT A;  2KZV A;  4S05 A;  1XS9 A;  4R1H A;  1FJL A;  4XKB A;  3FMR A;  2P7V B;  1JT6 A;  1LE8 A;  4A3L J;  1P4A A;  4B47 A;  4LK1 F;  1JKP C;  4XN0 A;  4AC0 A;  2I8D A;  3A0B C;  5JVT A;  1S7E A;  1FLI A;  1X1B A;  3WU2 C;  3BP8 A;  4OIR F;  3I54 A;  1B59 A;  2GM4 A;  5KNL A;  2VOP A;  3ZN0 A;  3HJE A;  3WTT C;  5LEK A;  2ME6 A;  2UWM A;  4I02 A;  1GUU A;  4E7K A;  1PUE E;  2E2I J;  1ERD A;  1EH8 A;  4JP0 A;  2K5C A;  4G7O F;  5HOD A;  1ZR4 A;  1R71 A;  5J1Y A;  2QSF X; 
#chains in the Genus database with same CATH homology
 2XF5 A;  2HNH A;  4OAZ A;  4HSR A;  1N78 A;  2ZXI A;  3OIP A;  2O5R A;  3IAM 2;  3S3N A;  3V42 A;  2E1M B;  4BDY A;  2L9N A;  4BJ6 C;  1WJC A;  1WJ5 A;  1N75 A;  4ZDL A;  1YX5 A;  2IS1 A;  2XF7 A;  4JOM A;  1X19 A;  2LY2 A;  5KCM A;  4BQO A;  2CV0 A;  3K6G A;  3OYA A;  3AL0 B;  3LSH A;  4N4O B;  1MND A;  1S9H A;  4NC7 A;  4Y3O A;  2WY8 Q;  2RQQ A;  3H9G A;  2BW3 B;  2ZSI B;  2MYS A;  4EAT A;  3C2G A;  3H35 A;  5CPR B;  2UV1 A;  3TL4 X;  4C2T A;  2XDV A;  4XQF A;  2OUM A;  2VXZ A;  3L2U A;  1D0Z A;  1SFK A;  2IGM A;  3BC8 A;  4ZYA A;  3S3O A;  1W36 D;  2R7R A;  3VSK A;  4P5O A;  3C2H A;  4B48 A;  2DT6 A;  3PNY A;  2LG4 A;  3SYT A;  2CW7 A;  3LMM A;  3LSM A;  1VZ0 A;  2PJR B;  3S3M A;  4KT6 A;  1X4P A;  3J7A Y;  4HRI A;  1LVK A;  4ZDO A;  2CV2 A;  3S32 A;  3TBI A;  5FRN A;  1U0J A;  3HG9 A;  3MMY B;  4XNF A;  3CP8 A;  2CUJ A;  3DKY A;  1Y6I A;  2HQA A;  4Y4R A;  2DXI A;  3W2A A;  3VYS B;  2X6W A;  3QYE A;  2Q2E B;  3CJR B;  1SAU A;  4F92 B;  2GOX B;  1DGR M;  4OWR B;  4U87 A;  1KON A;  2DT7 B;  4ZDP A;  1Z7L A;  4NC8 A;  3OYL A;  3HPH A;  2OV7 A;  2JVG A;  4NQW B;  2BVL A;  1ZEL A;  3PFY A;  1PJR A;  3W3C A;  3OY9 A;  2PMZ A;  1Y56 A;  3PNT A;  3I3L A;  3OOU A;  3VYU B;  1NG7 A;  3OYD A;  2VKH A;  2R4G A;  2VQG A;  3D5L A;  3LFU A;  4HNT A;  4HNU A;  3I9V 2;  2WBM A;  3MKW B;  3VWB A;  2VB6 A;  3G2B A;  2HDW A;  2OC6 A;  3EUA A;  3BG7 A;  3S93 A;  3IP4 B;  4IZZ A;  3HUG B;  3D5R C;  2K9L A;  3RCO A;  4DBQ A;  4NUB A;  3DU6 A;  3L2Q A;  4PK4 A;  4AVZ A;  3NWT A;  3FBN B;  3H9Q A;  3PSI A;  2KP6 A;  3K10 A;  3RTR A;  4LIV A;  2V1N A;  4PSW A;  3QYF A;  4FAS D;  1MW7 A;  4LIT A;  2VAS A;  4PUS A;  2M7A A;  3F9K A;  4NNJ A;  1D0X A;  2LC2 A;  3CMM A;  4CCK A;  1V5G A;  4MLO A;  3K4C A;  1LDK B;  3SZG A;  3OWT A;  4IQ4 A;  4B3X A;  2JUG A;  2KMU A;  3FBI B;  4HEA 2;  3SEZ A;  3OYC A;  1P9Q C;  1QHG A;  2KPM A;  4C30 A;  4XM3 A;  4XLF A;  3OIQ A;  3OL4 A;  4ITV A;  2R7V A;  1V5E A;  2HVS A;  2M7B A;  4YRV A;  4G6T B;  3PL8 A;  3OYE A;  2LOO A;  2E1M C;  2XSJ C;  2L7K A;  2IXS A;  4XL9 A;  2IGK A;  1NG6 A;  1UAA A;  3L2W A;  2M3A A;  4XKW A;  1T95 A;  5LD2 C;  4II2 A;  4XON A;  4RMN A;  1WJA A;  2W82 A;  3U21 A;  4AYB A;  3ZCO A;  5CKT A;  4F91 B;  2X6X A;  3OYB A;  2F5V A;  4XLH A;  2L2O A;  2Y0S A;  4E7S A;  3ZXS A;  2MFZ A;  4P1W A;  2V7F A;  1G59 A;  4D9J A;  1FMV A;  3L2R A;  2VL8 A;  2GOM A;  4LG3 A;  1MMA A;  4E4H A;  3K70 D;  2WY7 Q;  3EUK L;  1DP3 A;  2BW3 A;  2IGO A;  3E0J B;  3OYN A;  3MKZ A;  1QHH D;  1UG0 A;  3PNV A;  2L5Q A;  2V9K A;  3BLY A;  4ZJZ A;  3BCB A;  2DCE A;  2A5W A;  2Z16 A;  1X4O A;  4BE0 A;  4F52 A;  1Z21 A;  2WAD A;  3H9J A;  2HZD A;  3EPZ A;  1J09 A;  4BS9 A;  2VQH A;  4ZTJ A;  4PJN A;  2KLO A;  2BOL A;  4XOR A;  3M8J A;  4B44 A;  5HNH A;  4IKF A;  5CQG A;  1OR7 C;  5KHD A;  2XF6 A;  3DPL C;  3AL0 C;  3RQ4 A;  4E7L A;  4E7H A;  3HKZ A;  3K4J A;  2FUG 2;  2HPM A;  2LY1 A;  1QU3 A;  4XOP A;  2NOJ B;  4PFP A;  4ZTF A;  4PJM A;  4F55 A;  2R7Q A;  1TT0 A;  2KHM A;  3HOS A;  3H0D A;  4BEH A;  4RLQ A;  2V6E A;  4CCM A;  2R7W A;  4XN3 A;  1T0F C;  1LKX A;  4RM3 A;  1BR4 A;  2F6C A;  2VLA A;  1W36 C;  4BDZ A;  3MD2 A;  3OYM A;  4CCN A;  2RNG A;  2CFO A;  3S8P A;  4KIS A;  2ZXH A;  3IAS 2;  3OR2 C;  2F4I A;  5HVQ C;  5HLT A;  3SEQ A;  4HPQ A;  2Z1D A;  2VKD A;  4AU7 A;  1JI8 A;  3DPT A;  2LBF A;  4BUP A;  5LFA A;  2WAQ A;  2X1C A;  1TZL A;  2MD0 A;  1Z3Y A;  2V4J C;  3GBG A;  4DBR A;  3HC7 A;  4ANJ A;  4J00 A;  3L2V A;  4BU2 A;  2JA2 A;  1X1D A;  3DPU A;  3UR3 C;  4IX7 A;  2ZFU A;  2HU9 A;  4CH7 A;  2ELJ A;  3DTI A;  4BQN A;  2R7O A;  3QYB A;  3EUH C;  4E7Z A;  1WJF A;  2L9S A;  3K4L A;  4XR6 A;  4II3 A;  4Y33 A;  2CW8 A;  4LIU A;  3MKY B;  3ZRG A;  4XOT A;  4BAC A;  2Z2S B;  3OS0 A;  3ZR8 X;  3K4M A;  5HOO A;  2E5Z A;  1DGW Y;  1HA8 A;  4BL0 B;  2K3P A;  3IUO A;  1UEL B;  4J01 A;  2KQR A;  2XC7 A;  2HVQ A;  5FRM A;  4N4N B;  1LFP A;  2V26 A;  2PJR A;  3OR1 C;  3OYG A;  2M4K A;  3FHN A;  3OL3 A;  1WJB A;  2JVH A;  1YE9 A;  3K70 C;  3NWS A;  2QKL B;  4BQQ A;  3AKZ A;  2W1O A;  4R79 A;  3AFH A;  2AQE A;  3H5R A;  2VIX A;  4RM2 A;  2CS3 A;  2IGN A;  2X1D A;  3OYI A;  2R7U A;  2W4S A;  2KRH A;  5JHF A;  3OYK A;  4PSX A;  3E1S A;  2UUZ A;  4HG2 A;  3H5N A;  1DQU A;  1WFX A;  3KYL A;  3DTE A;  4D1Q A;  4U7B A;  4OAY A;  2W7N A;  2VPL A;  2VQC A;  3CP2 A;  3VYT B;  4B43 A;  2LYC A;  3LSG A;  1Z3X A;  2X51 A;  2Q1Z B;  3OS1 A;  1X1A A;  2W00 A;  4GRI A;  4C2U A;  2QKM B;  4KJZ A;  4BGD A;  3DKX A;  2IS2 A;  2KL4 A;  3OMY A;  1K6Y A;  3CES A;  4DOZ A;  2RRE A;  2IS6 A;  1D0Y A;  1D1A A;  2LRE A;  2DOA A;  4KIT B;  3A2K A;  3HPG A;  2X85 A;  4BJ5 C;  3K4K A;  4CCJ A;  3DEE A;  3BG6 A;  4HST A;  1BR1 A;  3LL7 A;  2CMP A;  4CZC A;  1V5F A;  4BEH B;  3KEY A;  4QPQ A;  4YEJ A;  2WA0 A;  3ZGK A;  4CCL A;  2R7T A;  1MMN A;  3SDB A;  1WJE A;  2M0M A;  1PYV A;  2XAU A;  4YEL A;  2LH9 A;  4XLE A;  1R6R A;  3OYF A;  4DIQ A;  2KRC A;  4RLF A;  4BE1 A;  3CF2 A;  4ZC3 A;  1AA7 A;  1IRX A;  2CH0 A;  3DQV C;  2KDO A;  2P0W A;  1G8X A;  3ZQQ A;  4JQF A;  3N05 A;  4QPO A;  2MAB A;  2MC4 A;  3RSN A;  1E0E A;  1GLN A;  2BVM A;  5TGT A;  3HXL A;  4E6K G;  2VQL A;  3HOT A;  3OYJ A;  3FKJ A;  3VYR B;  2X6Y A;  4BXF A;  1N77 A;  3K4B A;  3PUB A;  5HNF A;  2R7S A;  3HL2 A;  4BJT A;  2JSP A;  3KX2 A;  3QOD A;  4DJA A;  3LSI A;  5CQE A;  3VDX A;  2R7X A;  3H5A A;  4E7I A;  1X1C A;  2HPI A;  2LBF B;  4IQJ A;  2E60 A;  4CCO A;  1BOB A;  4X0G A;  5FRO A;  2DJI A;  3K4N A;  4CUG A;  2WAF A;  3A4C A;  2ZSH B;  3PJR A;  1YX3 A;  4XMY A;  4E7J A;  1OLT A;  3RPU D;  4F93 B;  4XKV A;  3D5S C;  2X1E A;  3DTK A;  4CA0 A;  2AQF A;  1MMD A;  2K9M A;  4PJL A;  3FDY A;  4DGW B;  3DU5 A;  2IS4 A;  2VXD A;  4F3Q A;  2VJ5 A;  3ONQ A;  1D1B A;  2A6T A;  2VJJ A;  2VJ4 A;  3DWL E;  3LSK A;  2KZV A;  3BCA A;  4XKB A;  3UNG C;  2CUZ A;  4C9Y A;  1MNE A;  2WAE A;  2VJI A;  1MMG A;  3PSF A;  3W2W A;  3VSL A;  4H4K C;  4B47 A;  1BR2 A;  3CJQ B;  4XN0 A;  2LRD A;  2I8D A;  1D1C A;  4BE2 A;  2HVR A;  1WJD A;  4XLA A;  1EA3 A;  1X1B A;  2E5N A;  3DLA A;  3CZ6 A;  5KNL A;  4PJJ A;  2CV1 A;  3W2V A;  4XKC A;  3OYH A;  3M1C A;  2M4G A;  2UWM A;  3A1Y A;  3TMO A;  4E7K A;  3OS2 A;  1FMW A;  4CSW A;  1ERD A;  4FET A;  4PFO A;  3QOE A;  4XLC A;  2K5C A;  2WB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...