3QPTA

Crystal structure of the salmonella transcriptional regulator slya
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
132
Chain Sequence
LGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator slyA
publication title Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
pubmed doi rcsb
source organism Salmonella enterica
total genus 49
structure length 132
sequence length 139
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qptA00
2NS0A 1E2XA 1TW3A 5D4RA 5D4SA 1JHFA 1IN5A 4TV7A 3FMSA 3B02A 4I2OA 1T6SA 4HZFA 3ULQB 1TBXA 3VODA 1XGSA 3R4KA 5HLIA 1PUEE 1EV7A 3BZ6A 2PLYA 2STTA 4HF0A 1CF7B 2CYYA 4L0YB 4HX8A 2P7CB 2GA1A 1FBSA 2V79A 2KKOA 1LDKB 2F5CA 3V7CA 4EMSA 5HVQC 5H20A 4IRHA 2IA2A 3E5XA 4RGXA 1RNLA 1ZAOA 3FMQA 4Y13A 3K69A 2OAZA 3WTSC 4YFXF 5CVVA 2RVCA 2CSOA 5ICGA 2HFHA 1SD6A 4GXOA 3GF2A 4U88A 4YIFA 3V7RA 1ZG1A 2VE9A 3T5XA 3EQLF 2PEXA 2FSWA 3SFZA 4HV6A 2O61A 1MJBA 4WF2A 2K86A 1WSUA 4P96A 1U5TC 2P7VB 2CWEA 3KEOA 4A6DA 1B59A 2ZBKA 3DFGA 5CVUA 4KIFA 2DFIA 2GQQA 1G3TA 5BMZA 2IA1A 3F23A 3KEQA 3KP5A 4Y15A 2PJPA 2F5DA 3GZ6A 4MGRA 4ESFA 5D5WB 3C7JA 2VE8A 2FXAA 3QOPA 1MDMA 1WI9A 3CJNA 3E5QA 2HOEA 1LEBA 2GIVA 3CUOA 4OIPF 4JQFA 1KYWA 4O5VA 1ZRDA 3HTUA 3RDIA 2MLKA 4HBLA 2VBYA 2PMHA 2VC1A 1P4WA 4CZZA 1QGPA 2OU2A 1ULYA 1BOAA 4XBFA 3F8CA 3GYHX 1J75A 2O8XA 4M6YA 4BNCA 5ICFA 3LFKA 3TGNA 4AD9A 4AVPA 2HWVA 2GWRA 4I0BA 5K1YA 3F21A 3TOAA 1R1TA 1FP2A 1STZA 2YR2A 1FWZA 3F8BA 3WTTC 2OA4A 4XLPF 3T8RA 2A3SA 4G7OF 4A5NA 4KUMA 1B9MA 2ISYA 2P4WA 3SZTA 2E7WA 1QPMA 2QQAA 3FM3A 1IRGA 1H0MA 2PFBA 1XCBA 2AXLA 3D5LA 3P9CA 4RAYA 3WGIA 4OMZA 2RV8A 3ZMSA 2JZYA 4CXFA 2COMA 3HOSA 2OD5A 2ZMEA 3RI4A 2XKPA 3VOEA 3I59A 2P5LC 4EJTA 3N97A 3I4PA 4LMYA 4P5OA 1YO5C 2HYGD 1SD4A 3FWEA 2ELHA 4IVNA 3JSOA 2Z9OA 5LHGA 4RB2C 2EJRA 3MZHA 5F6FA 5DV5A 2UZKA 4HOBA 2XAFA 1ZLKA 3DPLC 1YW7A 1YG2A 3M9AA 2LDUA 4CICA 1LQ1A 4MNUA 4LLGF 2ISZA 1XB4A 2Z99A 4DNCA 2JTVA 3IRRA 1AOYA 2HKXA 4U0YA 4G9YA 4CDGA 5E17F 4BHPA 3KETA 3KZZA 3R60A 2BV6A 5DD8A 1DPUA 4I0AA 1DPRA 3HRUA 4A2UA 4FHTA 3O2PE 1JGSA 3LA2A 1TLHB 4CGZA 3DKWA 2JRTA 2Z33A 2KJCA 3U2RA 1P4AA 3I0TA 3IL2A 4N9IA 1FPQA 4KMFA 3DQVC 3T8TA 5HS8A 3LQRA 5BQTA 2VC0A 4L9TA 2OZUA 1D3YA 3EUHA 4WXDA 2A68F 3CO7C 3KP6A 5DUIA 1SD5A 4O3MA 1Z91A 5LLQA 4KT5C 1XCVA 1SMYF 1IN7A 3B73A 2ZFWA 2XKOA 1U5TB 4HLYA 2VT3A 3LA3A 3WU0A 1JE8A 1FZPB 3FXQA 3M8EA 2WV0A 1O3TA 1FBUA 5AONA 5FLXK 2XHKA 1O57A 3EYYA 1BC7C 2DU9A 4B09A 1IZ1A 3P9KA 4N0BA 1U2WA 3V4GA 4MTDA 1TW2A 2K7LA 4M9SA 5LHIA 2VXZA 2OZ6A 2K02A 3DP7A 4HQEA 4ZYHA 3V8KA 1HKQA 2D1HA 3SXYA 3FM5A 2CW0F 3WTUC 4ENJA 2YSRA 4GCVA 2XAJA 3RTRA 3F8MA 1R58A 4U0VA 2M5WA 2L02A 1LJ9A 3ZMVA 4RGSA 2VBZA 2W85A 4JBAA 2FBHA 3W6KB 2Q0OA 4L9NA 2X4HA 3HRSA 3M7GA 4O6JA 4ASNA 3TQNA 1F1ZA 2HEOA 3GVAA 2FOKA 4HLXA 1D8KA 1IXSB 1OPCA 4P55A 2VOPA 1MGTA 4HV5A 4HX7A 3ZN0A 3L09A 1D8JA 3IWFA 4EJVA 3KZYA 4I09A 2HTJA 1REPC 2IJLA 2IP2A 3F22A 1G3WA 4GGGA 2LF7A 2P5KA 4WK8F 3N4MA 4IHSA 1I1GA 1TQIA 1DDNA 3PQKA 1GXPA 2DQLA 1KYZA 3GW2A 1HQCA 4PDKA 3FZVA 2G9WA 1I6XA 1ZN2A 1B9NA 2XAQA 3M1EA 5HOOA 1MJ9A 1Y0UA 3KP7A 4YIIA 3F72A 3Q9VA 4ENNA 3HSRA 2BEOA 4WXHA 2ZXJA 3WG9A 4LB6B 1BIBA 3RKXA 1XSDA 2CO5A 1O3SA 3ERED 1F4KA 1IRFA 5D5XB 2HR3A 2DPUA 1HW5A 3E5UA 1ZGAA 2KIFA 3CUQA 3D0SA 3K1PA 3K1MA 2EWNA 1GHCA 2ADUA 1RUNA 2D2WA 4UXNA 5D8KB 4KA4A 1O3RA 1R7JA 3FF5A 3E6MA 1ZRCA 1S6LA 3ML6A 4KNYA 2PG4A 3V8LA 2R7DA 2DO7A 1SAXA 1JHHA 3G3ZA 4BAYA 2XROA 3J7AO 3ZPLA 3ROUA 2NNNA 3KLNA 1EH6A 1SFXA 2NRAC 5E1ZB 4ESJA 3SQNA 3K2ZA 3F8FA 3ZQ7A 1TQMA 2D45A 1W7PA 3W6JB 1KQ8A 3RJPA 3LWFA 4WX9A 2EA4A 5H6QA 4KIGA 4BYYA 2V6CA 3I71A 4OOIA 2OBPA 4EGYA 1KU3A 5HLGA 2P8TA 2XAGA 4RGUA 5ERIA 1Q1HA 1ZG3A 2K27A 1RIOH 5CVRA 5L3EA 4Y17A 3WTYC 2Y48A 1K78B 2Q2EA 2G7UA 3CDHA 2RN7A 3DPTA 3ZP5A 3KP3A 4AIKA 2ESNA 2EFOA 4A0YA 3FHZA 2QQ9A 3MWMA 5CLSA 3E3VA 4M9XA 3OOPA 4FT8A 4MHGA 1EH7A 4M74A 4PGHA 1G3SA 4OIRF 5HDGA 1WRJA 2ZCWA 5CVJA 1BC8C 4BQAA 3NQOA 1XSXA 5E8GA 1T0FA 2HKOA 4A0XA 4ENKA 4KDPA 4LG0A 4FX0A 5K5RA 1WWXA 4EM1A 3M8FA 3HSFA 1J2XA 3FXUA 3GEZA 1HW2A 4WXCA 2M87A 2XVCA 1USSA 3BJAA 4G7HF 3DXJF 5L3BA 1SFUA 5F64A 2HDCA 4G6QA 4LLLA 2XV4S 2DK5A 4U7BA 3TO6A 3CTAA 5TRDA 2FBIA 5DCFA 5AIPA 3MZYA 2VBWA 3ZMDA 3L9FA 1NHAA 3QAHA 1O7LA 2ZKZA 2LKPA 1E17A 3GFLA 1T39A 1FYLA 4K2EA 4EJWA 1W7PD 3QPHA 1Z6TA 5LRSA 2PQ8A 3MCZA 3J81K 5D5UB 1R1UA 4BHBA 2IVMA 1F9NA 4CO8A 3WE2A 3GX4X 3SHFA 5LHHA 1XD7A 3PQJA 1ZARA 4MQ9F 5H6RA 5CYVA 3QPTA 3QU6A 4M6XA 1BI2A 2VBXA 1B4AA 1U3EM 1LVAA 2O3FA 3HYIA 3U1DA 1WKMA 3P9IA 1F5TA 4XRFA 1K79A 3KFWX 1CF7A 2QBYB 3HRTA 3NRVA 4AWXB 2WWYA 5L3DA 4Q47A 1FBQA 3Q9SA 3E6DA 1OMIA 2Z3YA 2VONA 1QBJA 1Z05A 1YS6A 2DBBA 2FQ3A 2K4BA 5ILVA 2A5YB 1S8NA 4GYGA 1YYVA 4HW0A 1HKSA 4UNOA 1GXQA 5FLXZ 2L01A 4HAMA 3MQ0A 2DI3A 3C3WA 2QZ8A 1I1SA 2ZNYA 1C0WA 3KP4A 5DCMB 2M30A 5HS9A 5E8IA 3WTXC 2L4AA 3HUGA 4Q4ZF 4AIJA 4XLNF 1MD0A 2X0LA 4LD5A 2UWMA 3IKTA 1IF1A 4CYDA 3GLXA 4N9HA 3RIRA 1B1BA 2MLGA 1P92A 4UVAA 4YG2F 3H3ZA 1I27A 4BXUA 1XDSA 4UV8A 3QRFF 1SFEA 1KQ9A 1OR7A 3TKYA 1RI7A 4I01A 2GXBA 2YU3A 4R1HA 3J80Z 5ED4A 1XSVA 2GAUA 2GXGA 2QQBA 2JPCA 3R61A 1MKMA 3Q5FA 2DQRA 4CHUA 3IRQA 3C1DA 4B8XA 4ZZLA 5L3GA 3HOTA 3V8JA 1USTA 2CGPA 2EFQA 2UXNA 2XRNA 2LF8A 1FOKA 5DDGA 2NAZA 3HSEA 4IJAA 3BOQA 4LK0F 3F6VA 1BBYA 1UHMA 4ZH4F 4G8XA 2MC3A 1YQAA 2V1XA 3GFMA 5JI6A 2EB7A 5L3FA 2ZNZA 2E1NA 2FNAA 2PN6A 2OQRA 5ICEA 4KICA 3HHHA 1ZRFA 6PAXA 5IT9K 3S2WA 2PMUA 5JVTA 5D6EA 4L0ZB 2EV5A 5DUKA 2ACJA 3EDPA 5L3CA 3E6CC 1IUYA 5LEJA 4XSXF 4OMYA 1YIOA 4UVCA 3QU3A 2P6TA 5EEGA 5DEQA 3EETA 1LNWA 1KU7A 3QP6A 5DYMA 1P4XA 4MEXF 2QM3A 4ZZDA 2GZWA 2A6HF 1H9TA 2EV0A 5LEKA 4GO1A 2MD5A 4UHTA 1OYYA 1QNTA 2E7XA 3WGHA 3L7WA 3MAJA 3J80K 1BI0A 1IN6A 3CLOA 4EM2A 4A12A 4LK1F 4PCQA 2HS5A 1FYKA 3WTWC 4G6DA 1B6AA 2NYXA 5LGUA 3NEUA 3ZMZA 2RNJA 2ZJ2A 4KN7X 2XUBA 4LLNA 1ZREA 4MEYF 2O03A 5BS6A 3BWGA 1I5ZA 1H9GA 3O3KA 4P9FA 1FT9A 4IHTA 2D1VA 2EFWA 2OQGA 1HSJA 2KIUA 2HYFA 1PP7U 3BP8A 2EFPA 1YLFA 5IT3A 1YW8A 2FRHA 1IW7F 2JPBA 4ZYDA 1XGOA 1U5TA 1L3LA 1FP1D 4HDUA 4DQ2A 4LB5A 1J59A 4R79A 1FYMA 2JT1A 1W5SA 2XGXA 1FX7A 2AS5F 3R0JA 1UCRA 2KRFA 3VFZA 1HXDA 2V1DA 4PZJA 4IRGA 4L9JA 3K0LA 4A5MA 3MEXA 2H09A 4U7DA 1LDJA 2RDPA 1BN5A 2ZO4A 4KIBA 4OINF 4EGZA 3GXOA 5ILSA 5K5QA 3H92A 4I98B 2QYOA 4UV9A 1OYWA 2TDXA 3BPVA 3G73A 2P6SA 5K5OA 4JK1X 3SZPA 1ZGJA 3I5UA 2RKHA 4OIOF 2L4MA 1BI1A 4F7ZA 2V9VA 1ON2A 3ZMTA 3VEPA 2GA2A 5E18F 1TNTA 3REOA 3U9GA 1MDMB 3E97A 1FNNA 2YX4A 4S05A 4HDVA 2G7HA 2H6BA 2M45A 3TDUC 2VN2A 1RUOA 3J81Z 4IXAA 5E20A 2UXXA 2KIMA 2BBYA 1PDNC 2C6YA 2WC2A 2HTSA 4L5JA 2QVOA 4FX4A 5AIQA 2VT2A 3LAPA 1ZYRF 1U6GA 1KA8A 1MJAA 1KU2A 3VB2A 3MFKA 3ABUA 5J6XA 5LGTA 1TQPA 2DT5A 1XDUA 3DF8A 5KK1A 2IPQX 1Z9CA 2FMLA 1BJAA 1S7OA 2KJBA 4BHCA 3C18A 3BPXA 1XN7A 4L18B 1V3FA 1LB2A 2DLLA 1IN8A 4EVIA 3KP2A 3ZN1A 1QQIA 2FNPA 5JR3A 2O6GE 4KN4X 1FLIA 3GO5A 3JAMZ 5A2QZ 2FE3A 4RS8A 3WODF 3LQQA 2DW4A 3E6BA 2EA2A 2ETHA 2ZMEB 3TDZC 2BYVE 2RGVA 2YPRA 1OYIA 1R22A 2PBIA 3I59B 1JXSA 4M9ZA 2F5EA 4A0ZA 4YFNF 3LSTA 3ELKA 5CVIA 2IW5A 2BGCA 3TO7A 2M1BA 4L5IA 3KE2A 4NQWA 3GFIA 2HGCA 2YX7A 2MA3A 2Y0MA 2O0YA 2DTRA 4OIQF 1R5HA 1K6OA 1Z7UA 1S29A 4G7ZF 3DEUA 4OU0A 2H94A 3CUQC 4ON0A 5D6FA 4ZYGA 2H27A 5J8FA 1VTNC 2A61A 2L54A 2FEZA 1O7FA 1QZZA 4I7HA 5FD6A 1T38A 1FSEA 2H6CA 2VOOA 1HKTA 4RB3C 2W57A 1YTYA 4P9UA 1SD7A 4HQMA 1HBXG 4MQVA 3WU1B 1W4MA 3ECHA 1BM9A 3HRMA 4R8HA 3RPQA 1K78A 4ETSA 3K9TA 4EQQA 3ABTA 1R00A 3LA7A 3I54A 2R3SA 1R23A 2J5OA 4RB0A 5FFXA 1J0RA 4NHJA 1KU9A 1J5YA 1GVJA 3JTGA 3O6BB 3OV8A 4A6EA 5D5VB 2IRFG 4G94A 5IT9Z 2B0LA 1XGNA 2EFNA 3WTZA 1J9IA 3V7SA 4RB1A 3JAMK 5A2QK 1IN4A 1ON1A 4Q48A 4IRIA 1YFHA 4EV0A 2DPDA 1FSHA 1YS7A 1G6NA 3GZ5A 2BE5F 3COAC 3TO9A 5KVRA 3EYIA 4WCGA 1LEAA 1R1VA 3QP5A 4M73A 1ZLJA 4QLCU 3GWZA 1HW1A 1FC3A 2L3DA 3F8NA 1U78A 4M72A 2DAOA 4EM0B 4Q5SF 2FA5A 5FO5A 2R7FA 4KMUX 3T0YA 1TNSA 2M8EA 1MZBA 1ODDA 1W5TA 1U8RA 4D0PA 2IT0A 5HDNA 4UVBA 3FX3A 4M71A 1TTYA 5D8LB 1K7AA 1V4RA 4QWQA 5E1WA 1QZYA 2A6EF 1DUXC 2Y75A 4ESBA 3RPUA 1ZH5A 5ILUA 4HF1A 2HZTA 4HYEA 2RC4A 2A07F 4LFUA 2P5VA 3HTSB 3IC7A 4LJZF 2NNYA 3TOBA 2F5FA 2IA0A 3L00A 1S7AA 5TJJA 2QBYA 2QLZA 2V1UA 2E1CA 3H3UA 3ECOA 3JW4A 3P7NA 3CO6C 2QWWA 3HIFA 4AIHA 1BI3A 4RGRA 3GUDA 1O3QA 3WGGA 3WE3A 2MH2A 2HQRA 3DV8A 4HF2A 1FY7A 2W25A 5FGMA 1Z1DA 1J7KA 3FXRA 3WTVC 4HX4A 5BOXA 1CGPA 2FF4A 2QENA 5E1XA 1QO0D 1T98A 2EV6A 1EH8A 3CUQB 4HA8A 3GFJA 5FD5A 1Z6RA 4GYIA 2FBKA 5DCMA 1PP8F 2VODA 1P2FA 4H0EA 5LRRA 5J8CA 4EJUA 3HHGA 3LAJA 1UFMA 2A69F 1OKRA 3F3XA 1RZ4A 4RAZA 1IXRC 2FMYA 5JHUA 2HQNA 3JTHA 4ZYEA 1YW9A 2RQPA 3I53A 1R5GA 3PFIA 1XGMA 5DD4A 4KFCA 1UB9A 1G3YA 2CQKA 2STWA 3BY6A 1W7PB 3F6OA 5FFZA 3R6SA 3RYPA 1ONVA 3IHUA 5EEHA 5BPDA 1HSTA 1AWCA 3R0AA 3KCCA 2MBFA 5LBQA 5LGNA 4NB5A 3I64A 1IXCA 4BH9A 4UUVA 2F2EA 4Z2YA 3RYRA 2W24A 3RKYA 2LSOA 2CG4A 3BROA 4MTEA 5HLHA 1ZG5A 1UHWA 1LDDA 1IAWA 1ZHFA 2LNBA 3IWZA 5HS7A 3ISPA 4KYWA 1S3JA 5F1RA 2CFXA 3BDDA 2QUFA 1WQ2A 2ESHA 3KLOA 4LG0B 1G4DA 3RKWA 1KGSA 3I58A 1A04A 5FB2A 4I02A 4YFKF 1R36A 4S04A 2PI0A 2WTEA 2DK8A 2Z5UA 5JFRA 4LGWA 1D5VA 4PGGA 2J5PA 2K4JA 2EK5A 5ICCA 2W84A 2XIGA 2XAHA 3IKVA 5CJ9A 3L2CA 2XASA 4EJOA 5HDKA 1T2KA 3BJOA 1SMTA 2FU4A 4L9VA 3BJ6A 2Q8KA 1DP7P 1XMKA 3K1NA 1XMAA 3JSPA 1X3UA 1BIAA 4IF4A 1KQ0A 2MH9A 4E70A 4WWCA 3FMRA 4U0WA 3T1BA 1L0OC 4XSZF 2JSCA 4ENMA 1P6RA 4IPAA 3AAFA 5BPIA 3ZMUA
chains in the Genus database with same CATH superfamily
2JVGA 2NS0A 1E2XA 1R5ID 1WH7A 1TW3A 2QF7A 2DA2A 5D4RA 2QEXI 5D4SA 1JHFA 3LSMA 1IN5A 3AFHA 4TV7A 2ZXWH 3B02A 3FMSA 4I2OA 1T6SA 2H8RA 3K4KA 4HZFA 3ULQB 1TBXA 3HB9A 3VODA 2W48A 1XGSA 3R4KA 1HC8A 1E3PA 2M0CA 5HLIA 3UR3C 2HQ5A 1PUEE 2COBA 1EV7A 2AQEA 3FIWA 3BZ6A 2PLYA 1T33A 4RMNA 1R49A 4QPOA 1YX5A 2STTA 4HF0A 1CF7B 2CYYA 4L0YB 4N4NB 4HX8A 2P7CB 3HPHA 4XLAA 2GA1A 1FBSA 2V79A 4XRMA 2LKXA 3HM5A 3ZQFA 2JK3A 2KKOA 4ZDLA 5J4YA 1LDKB 2F5CA 3V7CA 4CCMA 4EMSA 1NK2P 3FK6A 5HVQC 4JX6A 2DJIA 4RLQA 5H20A 4GFBA 4W97A 4DBRA 4ZDPA 3OS0A 4IRHA 2A5WA 2IA2A 5B1BH 1I6HJ 2BY3A 4BBSJ 3E5XA 4RGXA 1HDDC 1RNLA 1ZAOA 4NC8A 1T56A 2LR8A 3FMQA 4Y13A 1AKHB 1WCMJ 1MH4A 3K69A 2GLOA 1G59A 2OAZA 2ME6A 1SC7A 3WTSC 3ABKH 3OYBA 1PUFB 4YFXF 5CVVA 3DBRB 2RVCA 1M1EB 2CSOA 5ICGA 2HFHA 1SD6A 4GXOA 3OYFA 3GF2A 4M3GA 5F0HA 2E1MB 2F4MB 2PJRB 4U88A 4YIFA 3V7RA 3BLYA 1ZG1A 2OF7A 1ETOA 2VE9A 3T5XA 1JKPC 3EQLF 1IGNA 4C2UA 2PEXA 2FSWA 1ACIA 5DM7F 2OCEA 3SFZA 5J1RA 3GTKJ 4HV6A 2O61A 1MJBA 3HUGB 4XICA 4WF2A 2K86A 2ELJA 4BKXA 1AA7A 2JRMA 2DA3A 1WSUA 4P96A 1U5TC 2V9PA 4E7SA 2P7VB 2CWEA 3KEOA 3QYBA 4A6DA 2LY2A 1B59A 2K9LA 4XOPA 2ZBKA 3DFGA 5CVUA 4KIFA 3VYRB 5M5XJ 2DFIA 1HA8A 2GQQA 1G3TA 3N05A 4HNVA 3TL4X 5BMZA 2IA1A 3F23A 3KEQA 3KP5A 4IQ4A 4Y15A 2PJPA 4IL6C 2QKLB 2F5DA 5EG0A 3GZ6A 2E2HJ 1Q1VA 4MGRA 2V7FA 3K4LA 1Z3XA 4ESFA 5D5WB 3CC4I 2GIZA 3RZOJ 3C7JA 2VE8A 5K7FA 1WGXA 2FXAA 1MH3A 4IZZA 4M3EA 2E2IJ 2WB1N 4IHXA 4FASD 3QOPA 1MDMA 1A6IA 1WI9A 1X1PA 3FXLA 1F43A 3CJNA 2XGEA 2D5VA 2HI3A 3E5QA 2HOEA 4JX4A 3OYJA 1LEBA 2GIVA 1PYVA 3CUOA 3CCVI 4E7JA 4OIPF 3G1OA 3HOYJ 2EH3A 4JQFA 1KYWA 4O5VA 2YS9A 1ZRDA 3HTUA 5E79C 5F27A 1WJ5A 4FISA 3SDBA 2B9SA 2M3AA 3RDIA 2MLKA 4HBLA 2DMTA 2PMHA 2VBYA 1I39A 2VC1A 2F48A 1P4WA 1VQ7I 3OIOA 1TZLA 4CZZA 5EJCA 1QGPA 4IO9F 4Z6YA 2OU2A 1ULYA 1DP3A 1BOAA 4XBFA 2IBDA 3F8CA 3GYHX 1J75A 4XR6A 1FTZA 4A3KJ 2KQRA 2O8XA 3A1YA 1OFCX 1TT0A 4M6YA 2FD5A 1GV2A 1MNMC 3C2GA 1WI3A 4BNCA 5ICFA 3LFKA 3TGNA 4AD9A 5IP7J 2KZVA 4AVPA 1HCRA 1B8IB 2HWVA 5FKOA 2GWRA 2H8WA 2MSYA 3H0GJ 2MGQA 4I0BA 5K1YA 3F21A 3TOAA 3HG9A 5C44J 1R1TA 2DFFA 1FP2A 3CMEI 1STZA 3MKYB 2YR2A 1FWZA 3F8BA 1MMDA 3J7AY 1VQ4I 3WTTC 2OA4A 1VQ8I 4XLPF 2E35A 3T8RA 4BL0B 3E7LA 2A3SA 4G7OF 3RCOA 3QYFA 4A5NA 4KUMA 1B9MA 2ISYA 2P4WA 3SZTA 2E7WA 1QPMA 3OS2A 2QQAA 3FM3A 1IRGA 1AKHA 2L9VA 4E6KG 1H0MA 3PUFA 2R4GA 4G6TB 2PFBA 1S9HA 3BR2A 4WX9A 3J7ZI 3HGGA 1XCBA 2AXLA 2NVUB 3D5LA 3P9CA 4RAYA 3WGIA 4OMZA 1GVDA 2CMPA 5KAIC 2RV8A 3ZMSA 2JZYA 3BQYA 4CXFA 2COMA 1TT5B 2JN6A 3HOSA 3BZKA 2LFBA 2OD5A 2ZMEA 3S1MJ 3RI4A 3I56I 2XKPA 5TISC 2LMDA 2KRCA 3VOEA 3I59A 2P5LC 4EJTA 3N97A 1H8AC 2IS1A 3I4PA 4LMYA 4P5OA 1YO5C 2HYGD 4RAFA 1SD4A 3JRCA 3OYEA 3FWEA 4DYCA 2X1CA 2ELHA 4IVNA 3JSOA 2Z9OA 2DDAA 3BR6A 1MBJA 3CJRB 5LHGA 2KP6A 1JGGA 4RB2C 4YELA 1Y0NA 2EJRA 3MZHA 5F6FA 4IQJA 4B1RA 5DV5A 2UZKA 4HOBA 2XAFA 1JTXA 4XL9A 3DPLC 3S8PA 3JRIA 1ZLKA 1YW7A 3BG3A 5CQEA 1YG2A 3M9AA 3TW7A 2Y9YA 2LDUA 4PK4A 4CICA 1LE8B 1LQ1A 1SANA 4MNUA 4LLGF 2ISZA 1XB4A 4HSRA 2Z99A 4HSTA 4DNCA 2JTVA 1TL8A 3FXMA 2EIMH 3CCSI 1EF4A 3D5RC 2HZDA 3IRRA 2DT6A 1Z77A 1AOYA 1QPIA 2HKXA 3ABMH 4U0YA 4G9YA 4CDGA 1UZCA 4BHPA 3KETA 5E17F 3KZZA 3R60A 2K3FA 2BV6A 4NDLA 5DD8A 4A3JJ 3TEDA 1DPUA 4I0AA 3LSGA 1DPRA 2P0WA 1DU6A 4X1EA 3HRUA 4A2UA 4FHTA 3O2PE 1JGSA 3LA2A 1QU3A 2HU9A 1TLHB 4BY1J 4CGZA 2ZC2A 4PJLA 2ID6A 3DKWA 2JRTA 2VKDA 2KJCA 3U2RA 2Z33A 3FBNB 1P4AA 3JRAA 4IOCF 3S1QJ 3I0TA 3AG2H 3IL2A 4N9IA 5M3FJ 5C4JJ 2G0EA 4ITVA 1OQYA 2XAUA 3IUOA 3NWSA 1JT6A 1W36D 1RR7A 5F0FA 1FPQA 4KMFA 3DQVC 3T8TA 4RDUA 1QA6A 5HS8A 3UKGA 3LQRA 2VC0A 4HNUA 4L9TA 2OZUA 1D3YA 3EUHA 5BQTA 4WXDA 1JKRC 2A68F 1FJLA 3CO7C 3KP6A 4BACA 5DUIA 1SD5A 3K10A 4O3MA 4A3MJ 1UG0A 1ERDA 1Z91A 1ZR2A 4QPQA 4KT5C 5LLQA 2P81A 3V42A 2Y9ZA 1XCVA 2M9HA 2E71A 4Y4RA 2V26A 3W2AA 1SMYF 2LC2A 3FXOA 1IN7A 5BNGA 2PX9A 3B73A 1LPQA 3OL3A 2ZFWA 2XKOA 1U5TB 2DMPA 4HLYA 3WG7H 4II3A 2VT3A 3LA3A 3WU0A 1JE8A 1FZPB 3FXQA 4ZJZA 3M8EA 2WV0A 1SAUA 2QQ8A 2DYRH 1O3TA 1FBUA 5AONA 5FLXK 4LIVA 1BR1A 2XHKA 5J3LA 1O57A 3EYYA 4CCOA 3PO2J 1BC7C 4IHYA 5IOYA 2VKHA 1KZHA 2DU9A 3BT9A 2RREA 1YHQI 2IAIA 4B09A 3PUBA 5B5EC 2K5CA 1IZ1A 3NWTA 3P9KA 2I5UA 4N0BA 1U2WA 3V4GA 4MTDA 1T8IA 3DBHB 2WV1A 1TW2A 2K7LA 4M9SA 5GP9A 3TMOA 5LHIA 4QTRA 2VXZA 3SYTA 4I76A 1VQMI 2OZ6A 2K02A 2H1LA 3WHCA 3FDYA 2ZXHA 3DP7A 4KT6A 4HQEA 2KRHA 4ZYHA 3OL4A 3V8KA 4DYRA 1HKQA 2D1HA 3CDLA 2CFOA 3FM5A 3SXYA 2CW0F 3WTUC 4ENJA 2YSRA 4GCVA 2EBIA 2RNGA 1IC8A 2XAJA 3RTRA 3F8MA 3DCFA 1R58A 1BR4A 5J40A 4U0VA 2M5WA 2FJ1A 4XM3A 2L02A 1LJ9A 2AO9A 4PSXA 3ZMVA 4RGSA 2VBZA 2Z16A 2KLOA 2W85A 3DKXA 3K4JA 1D1AA 4JBAA 3L2QA 2DMUA 2FBHA 3W6KB 2Q0OA 4L9NA 2X4HA 3A02A 5DS9A 1T95A 3EPZA 3HRSA 4YRVA 3M7GA 4O6JA 5FKNA 4JX5A 2R5YB 3BG6A 4ASNA 3PL8A 3TQNA 2QGUA 3DKYA 1FIPA 1F1ZA 2OPTA 2HEOA 2Y0SA 3GVAA 2FOKA 1U0JA 5FKMA 3OR1C 1FOYA 4HLXA 3ZGKA 1D8KA 5IP9J 3RQIA 5JLXA 2XSJC 1IXSB 2CRGA 4XLHA 1OPCA 4FE7A 2EPFA 4P55A 2VOPA 3BG9A 1MGTA 4HV5A 4HX7A 3ZN0A 1H88C 2R7XA 1N77A 1OCOH 2XDVA 3L09A 1D8JA 3IWFA 1S7EA 3KZYA 4EJVA 4I09A 2XF6A 2HTJA 3BTCA 1REPC 2IJLA 3PO3J 2IP2A 3F22A 1WJCA 3CMMA 1G3WA 1YE9A 1GLNA 3I3LA 1X19A 3A01B 4GGGA 2LF7A 4CA0A 2P5KA 4DJAA 4WK8F 3N4MA 4IHSA 1I1GA 2JA8J 1TQIA 1DDNA 3A2KA 2VKEA 3PQKA 3K4NA 1GXPA 2DQLA 4II2A 1KYZA 1ORKA 4CYCB 2ELKA 4IHWA 3GW2A 1LVKA 4Y33A 3TBIA 1HQCA 3ZQGA 1WZ2A 4PDKA 2XB5A 3FZVA 2G9WA 1I6XA 1ZN2A 4UB8C 5EZGA 5DM6F 1MBKA 1B9NA 2XAQA 3M1EA 3PFYA 5EGOB 1VI0A 5HOOA 1MJ9A 1TP4A 3JCUC 2CUEA 2DOFA 3ZR8X 1BL0A 1Y0UA 3KP7A 1R9TJ 3CZ6A 4YIIA 3M4OJ 3F72A 1OISA 2E34A 3Q9VA 4CCNA 2OCCH 2LK2A 4ENNA 3HSRA 3LSKA 2BEOA 4WXHA 2ZXJA 3WG9A 4LB6B 1MMNA 2LOOA 2DYSH 1BIBA 1ETYA 4UUTA 1HDPA 3RKXA 3K70C 2CO5A 2BOLA 3ERED 3KX2A 1XSDA 1O3SA 1F4KA 1IRFA 1TWHJ 5D5XB 2HR3A 2Y2ZA 1B72B 1BW5A 2DPUA 1HW5A 3E5UA 1D1CA 1ZGAA 1W5CC 2BXZA 2KIFA 3OYGA 1HLVA 3S17J 3CUQA 4IHVA 3I4NJ 2KDOA 3D0SA 3HOXJ 4F52A 2R7UA 4V2GA 3HPGA 1SFKA 1ZR4A 5C3EJ 2LG4A 3VYTB 2E1OA 4PUSA 3K1PA 2M34A 3K1MA 1X1AA 2EWNA 1GHCA 2JMWA 2E5NA 2ADUA 1RUNA 2D2WA 4UXNA 5D8KB 4KA4A 4ZTJA 1YJ9I 1O3RA 1R7JA 4NQWB 3FF5A 3E6MA 1ZRCA 1Y8RB 1S6LA 1JKOC 1UAAA 3ML6A 3OS1A 2IS4A 4KNYA 2PG4A 3FHNA 3V8LA 2PMZA 3DTKA 2R7DA 2DO7A 3IH3A 1SAXA 4ZYAA 1JHHA 3JRFA 3G3ZA 1SVMA 4BAYA 2VQLA 2JUCA 2CUZA 2XROA 3J7AO 2DCEA 3ZPLA 3ROUA 2NNNA 3KLNA 2R5ZA 3ASOH 4AUXA 1EH6A 2LRDA 2R93J 4IX7A 4HEA2 1SFXA 2NRAC 3A4CA 2X9DA 3LOCA 5E1ZB 4ESJA 1YJWI 3SQNA 2V4JC 4AC0A 2AQFA 2JUGA 3K2ZA 5DTDA 3F8FA 2IS6A 1MMAA 3ZQ7A 3HKZA 1TQMA 2D45A 3OYLA 1W7PA 2R7RA 3W6JB 2OTLI 1KQ8A 3RJPA 2Y0SN 3GZNB 2EA4A 3K4MA 1RKWA 3LWFA 1FMVA 4KIGA 5H6QA 4BYYA 2LY1A 2A05A 2V6CA 3I71A 3SJMA 2QCOA 4OOIA 2OBPA 4E7IA 4EGYA 1KU3A 5IP6A 3G6EI 1QHGA 4LIUA 3DEWA 5HLGA 2P8TA 2XAGA 4RGUA 5ERIA 1Q1HA 1ZG3A 2K27A 1RIOH 5CVRA 3CCRI 2X6WA 5L3EA 3U1KA 4Y17A 1N75A 3WTYC 2Y48A 2L9NA 1U8BA 3ONQA 2XC7A 1K78B 1N78A 2Q2EA 2G7UA 2L0KA 3CDHA 4OWRB 2RN7A 3DPTA 1D5YA 3ZP5A 3L2VA 4BGDA 3KP3A 4AIKA 2IS2A 1MW7A 2ESNA 5KHDA 2EFOA 4A0YA 3FHZA 2QQ9A 2ICWG 3W3CA 4BBRJ 1VZ0A 3MWMA 1CQTA 4AVZA 2BY0A 3E3VA 5CLSA 4M9XA 3OOPA 4FT8A 4MHGA 1EH7A 4M74A 3KIOA 1G3SA 2TRTA 4PGHA 4OIRF 3WHBA 4CYCA 2QSFX 5HDGA 4EATA 1WRJA 1TWFJ 3PIOF 2ZCWA 4V2FA 5CVJA 3CCQI 1BC8C 4BQAA 3CCJI 3H9GA 3NQOA 1XSXA 5E8GA 2QA4I 4BY7J 1T0FA 2HKOA 2L9RA 3GLLA 2JJ7A 5F04A 1HF0A 4A0XA 5GPCA 4ENKA 3S2HJ 4KDPA 3L1PA 4LG0A 2OJED 2EZHA 4W1UA 2JSPA 5IYCJ 4FX0A 4UB6C 5K5RA 1I3QJ 1WWXA 2BHZA 4EM1A 3M8FA 3HSFA 3QPSA 4L5EA 1J2XA 3H5AA 3FXUA 3GEZA 5F08A 1HW2A 4WXCA 2M87A 2XVCA 5EYRA 3BG7A 1USSA 2V6EA 4V19K 2DA7A 1YI2I 3CESA 4A3DJ 3BJAA 4G7HF 2HYJA 4B44A 2VIXA 3DXJF 1QVTA 5KCMA 1RESA 5L3BA 3OYMA 1SFUA 1LFUP 2EIKH 2EIJH 5F64A 2CQ7A 1FOWA 4XKVA 1W0UA 2HDCA 4G6QA 2R0QC 1UELB 5J47A 1B72A 2L5QA 4LLLA 2VPRA 2XV4S 2DK5A 3EUKL 4U7BA 3TO6A 3RZDJ 3CTAA 3CMYA 5TRDA 2FBIA 3SFIA 5DCFA 5AIPA 1VQ5I 1X1DA 2EZIA 3MZYA 4XONA 2MC4A 2VBWA 3Q3SA 3ZMDA 3L9FA 3BC8A 4BE0A 1NHAA 3D1NI 5GPAA 1IUFA 3QAHA 1TWGJ 1O7LA 4P1WA 2ZKZA 2PMZN 2LKPA 1E17A 3GFLA 1T39A 4XKBA 3JRBA 4DW6A 3E1SA 2LTPA 2XF7A 1FYLA 1XMXA 4K2EA 4EJWA 1W7PD 3QPHA 1Z6TA 5LRSA 2PQ8A 1DU0A 3MCZA 3J81K 3MKWB 5D5UB 1R1UA 3OOUA 1Z0XA 4BHBA 1WJDA 2IVMA 4RA2A 3OY9A 1VQ9I 1F9NA 1MMGA 1X58A 2IGKA 3HXLA 1ZQ3P 4GDFA 4CO8A 3HKZN 2BW3B 5M5WJ 4GRIA 3WE2A 4BJTA 3GX4X 3SHFA 4I99C 5LHHA 1XD7A 3PQJA 3U21A 1ZARA 4MLOA 4MQ9F 5H6RA 3KYLA 1FOXA 1NG6A 5CYVA 3OIQA 3QPTA 2BHYA 3QU6A 4M6XA 5K7HA 1BI2A 2VBXA 1B4AA 1IDYA 1XX5A 1W1WE 2FOWA 1U3EM 1OCCH 5J1UA 1LVAA 2O3FA 5H2FC 2ZSIB 3HYIA 4FE4A 3U1DA 3UNGC 1WKMA 3H36A 3P9IA 1F5TA 1GV5A 5E3LA 1PVEA 2HVSA 4XRFA 1K79A 4U87A 2JA6J 1YJNI 2HXIA 3KFWX 1SFOJ 1IV8A 2XF5A 1CF7A 2QBYB 3HRTA 3NRVA 2VI6A 4AWXB 2R7WA 2LREA 2WWYA 1W0TA 3I4MJ 5L3DA 2K9SA 1NG7A 2BXYA 4Q47A 3PNTA 1JT0A 4JP0A 2KHMA 1FBQA 3Q9SA 3E6DA 4PJ0C 1K83J 1OMIA 1Y1VJ 2Z3YA 2VONA 4FTHA 1QBJA 1Z05A 2AXTC 3LSPA 2VQGA 4C3IJ 3OWTA 1YS6A 2DBBA 2FQ3A 4OAZA 4C30A 2K4BA 5ILVA 2MD0A 2DOEA 2A5YB 2CU7A 2MYSA 3BR5A 4IEJA 4DYQA 5KAFC 1S8NA 4GYGA 3QQAA 3B6AA 3AKZA 1YYVA 1PUFA 4HW0A 1HKSA 4UNOA 1GXQA 5FLXZ 2BZTA 5IYDJ 2L01A 4HAMA 4F92B 1ZELA 5B66C 4XRSG 1YITI 4XRSA 3MQ0A 2PJRA 4BUPA 2DI3A 3C3WA 4A3CJ 2Y69H 2KPMA 2QZ8A 1I1SA 2HPMA 2ZNYA 1C0WA 3KP4A 1RR8C 2ZFUA 5DCMB 3VYUB 3BZCA 2M30A 5M3MJ 3GTGJ 1POGA 5HS9A 1UHSA 3GCMA 5E8IA 3WTXC 3HOWJ 2L4AA 2XPUA 1BA5A 4XN0A 3HUGA 2CQXA 4Q4ZF 4AIJA 3GTJJ 4XLNF 5FKLA 1MD0A 2X0LA 3MN2A 4LD5A 2DMQA 2UWMA 3W2WA 3IKTA 4I6ZA 4B47A 5FRMA 1IF1A 4XORA 4CYDA 3GLXA 1WVRA 1X2MA 2DFHA 3GTLJ 4N9HA 3RIRA 1B1BA 2MLGA 3ZQCA 1P92A 1JUMA 2DDBA 2LD5A 3HEFA 4UVAA 4YG2F 4RBOA 3H3ZA 2O9LA 1I27A 4BXUA 1XDSA 3H35A 4UV8A 5EF6A 3QRFF 1SFEA 1KQ9A 2XPVA 1OR7A 1G8XA 3TKYA 1RI7A 3O8HA 3I9V2 4E7LA 4I01A 2GXBA 3DEEA 5EZHA 2YU3A 4R1HA 2O5RA 2HOSA 3J80Z 5ED4A 1XSVA 1A5JA 2GAUA 4NC6A 2GXGA 3TP3A 1R4NB 2QQBA 2JPCA 3R61A 2ZXIA 2X6YA 1MKMA 2VASA 4HNTA 1D0XA 3JR9A 3Q5FA 4KITB 1UG2A 2DQRA 4CHUA 3IRQA 1IJWC 3C1DA 2NS7A 4B8XA 3O8GA 3H1CA 4MFDA 4ZZLA 5L3GA 3HOTA 2ZJPF 3V8JA 4C2MJ 1USTA 1TWAJ 5C4XJ 2CGPA 3S15J 3WU2C 2H1KA 2EFQA 2UXNA 2XRNA 2EQRA 2LF8A 2HPIA 1FOKA 2K9MA 5DDGA 2NAZA 2DXIA 1JUPA 3HSEA 4IJAA 1V54H 3BOQA 3GTPJ 4LK0F 3H9JA 4UUSB 3F6VA 1OJLA 2KDZA 1BBYA 1UHMA 2CS3A 4ZH4F 2DOAA 3CF2A 2R7QA 4G8XA 2MC3A 1FTTA 1E3OC 2XRLA 1YQAA 2V1XA 3S2DJ 3GFMA 1B8IA 2XPWA 5JI6A 2EB7A 5L3FA 2LBFB 2L7FP 4XLFA 5IPAA 3S1NJ 2ZNZA 2YU9J 2E1NA 2VKVA 2FNAA 2PN6A 2OQRA 5ICEA 4KICA 3HHHA 1ZRFA 6PAXA 2UUZA 5IT9K 3S2WA 2PMUA 2X6OA 5JVTA 1VQOI 5D6EA 5JHFA 3ZQQA 4HG2A 5IY5H 1X3ZB 4L0ZB 2EV5A 5F0CA 4PFPA 5DUKA 2ACJA 3EDPA 5L3CA 4NNJA 2KL4A 1YRNB 3E6CC 4BS9A 1IUYA 5LEJA 4ZC3A 4XSXF 3VWBA 4OMYA 2W7NA 1YIOA 4UVCA 3CC7I 1UJ8A 3QU3A 2P6TA 4X0GA 2CW7A 5EEGA 1BJZA 5DEQA 3EETA 1ETXA 1W36C 2IXSA 3TW6A 1LNWA 1KU7A 2EILH 3QP6A 5DYMA 3HGYA 2DT7B 3VYSB 4NC7A 1P4XA 4MEXF 2QM3A 2VPLA 2ZB9A 4F3QA 4ZZDA 2E60A 3RKQA 2GZWA 1OCRH 2A6HF 1H9TA 2EV0A 3VDXA 5LEKA 4GO1A 2KFDA 1SEUA 3HJEA 2F4IA 2MD5A 3QWLA 1QVUA 4UHTA 3SZGA 1OYYA 1QNTA 1LFPA 2E7XA 3WGHA 3L7WA 3MAJA 1FMWA 3J80K 3LMMA 1BI0A 1IN6A 3CLOA 4EM2A 2WY8Q 4A12A 4LK1F 4PCQA 2VJIA 2E36A 1K6YA 2HS5A 3ZRGA 2W4SA 1FYKA 3WTWC 1LE8A 4G6DA 1A6QA 1B6AA 2NYXA 3BQZA 2IGOA 5LGUA 1IV6A 2ZMEC 3BTJA 4A3GJ 3NEUA 3ZMZA 1K4TA 1KONA 4E7ZA 4KISA 1MSEC 2RNJA 2ZJ2A 3Q0WA 4KN7X 1MBFA 2XUBA 4LLNA 1ZREA 3K7AJ 2BY1A 2NS8A 4XN3A 3SEQA 3CCMI 3D5SC 3FBIB 2RQQA 1H89C 1E0EA 2MABA 1LUJB 4J01A 4MEYF 2GOMA 2O03A 5BS6A 3BWGA 1VQNI 1I5ZA 3OIPA 1H9GA 3O3KA 4P9FA 1FT9A 4NUBA 2R92J 4IHTA 4AIDA 3MMYB 3IV5A 4A3EJ 4CUGA 1MIJA 4PJJA 3DLLF 2D1VA 2EFWA 1NTCA 2OQGA 4CH7A 1HSJA 1SVOA 2KIUA 5GTIC 2HYFA 2JWTA 4HRIA 1VQLI 3MKZA 2NXNB 3BP8A 1PP7U 2EFPA 5EDNA 1YLFA 1Y8QB 3K6GA 1WPKA 2NOGA 4X6AJ 5IT3A 1YW8A 2FRHA 4CCJA 1IW7F 2TCTA 2JPBA 2X48A 4ZYDA 5E3NA 3JREA 3LNQA 1Y6IA 1IG7A 1JUSA 1YOVB 1XGOA 2W00A 3ABLH 2R7ZJ 4H4KC 1G2HA 1FIAA 1U5TA 2BY2A 1L3LA 1FP1D 2JVHA 3S93A 2WY7Q 4HDUA 3BTIA 3OR2C 4F93B 3GTOJ 4DQ2A 4LB5A 5B1AH 4J00A 3MKLA 4B48A 4IKFA 1J59A 3DTEA 1ZTRA 5FLVA 4R79A 4HPQA 1FYMA 4AU7A 1JKQC 2JT1A 1W5SA 2XGXA 1FX7A 2AS5F 3R0JA 1UCRA 2KRFA 3VFZA 2JQ7A 1HXDA 2V1DA 2R7OA 3EUHC 4PZJA 4IRGA 5E3OA 4L9JA 3K0LA 4A5MA 3MEXA 2KISA 2H09A 4U7DA 2OTJI 1LDJA 2RDPA 4QIWN 1BN5A 2ZO4A 4KIBA 4OINF 1AHDP 3GXOA 2ME0A 5ILSA 5K5QA 4EGZA 3H92A 2I10A 4I98B 2QYOA 4UV9A 1OYWA 3E0JB 3S3NA 2TDXA 2WAQA 1R6RA 2M7AA 3H3VK 2WAEA 3BPVA 1YX3A 3K2AA 3QYEA 4QSHA 2X6XA 3G73A 2P6SA 5LFAA 4B3AA 5K5OA 1VNDA 4JK1X 3SZPA 3CLQA 1GT0C 3SDGA 1JJ6C 1OCTC 1ZGJA 3I5UA 4BU2A 4UY8I 2RKHA 4YIRX 4OIOF 2IEKA 2L4MA 4BXFA 3FK7A 1BI1A 3S3MA 3FXKA 4NBQA 4F7ZA 3BR3A 2V9VA 5EG0B 1ON2A 3NAUA 1ITYA 4BEHB 4M3DA 2CJJA 2VLAA 3ZMTA 3VEPA 4RM2A 2Y31A 3S3OA 2GA2A 3M1CA 1PJRA 5E18F 1DGWY 1TNTA 3KPHA 3REOA 3U9GA 1MDMB 3E97A 1FNNA 3LL7A 2B7EA 2YX4A 4S05A 4HDVA 3OYAA 2NVTJ 2G7HA 1A36A 5E3MA 3DBLB 2R5YA 1U9NA 2H6BA 2M45A 3KYCB 3TDUC 3AG3H 2RAEA 2V1NA 4M6VA 2VN2A 1RUOA 3Q0UA 3J81Z 3VPRA 3J7YJ 4IXAA 5E20A 2UXXA 2KIMA 3P5JA 4DZJA 5HODA 2FX0A 2EZLA 3ZXSA 2BBYA 2L2OA 3MD2A 1Z7LA 1PDNC 3OYNA 1MBGA 5IYBJ 2C6YA 3DU6A 3DPUA 2WC2A 1O4XA 2HTSA 1WHUA 1ETKA 4L5JA 4AYBA 2QVOA 4FX4A 1D0ZA 2M7BA 5AIQA 2VT2A 3LAPA 1ZYRF 1U6GA 1KA8A 5LD2C 4C9YA 2VQHA 1P7IA 1MJAA 1KU2A 3RSNA 3VB2A 3MFKA 1DQUA 3ABUA 2X1DA 5J6XA 3A01A 5LGTA 1NH3A 4F91B 1ETQA 2HOAA 1TQPA 2DT5A 2E19A 1XDUA 3DF8A 5HLTA 2WBMA 5KK1A 2IPQX 5GAHJ 1Z9CA 4IOAF 2BVLA 2FMLA 2MW8A 3Q0VA 2HOTA 1BJAA 1S7OA 3CD6I 2KJBA 4BHCA 3C18A 3BPXA 2QSGX 1XN7A 3PNYA 1ETWA 3HL2A 4L18B 1GDTA 1V3FA 1LB2A 5EGOA 2DLLA 3JRHA 1LKXA 1IN8A 4EVIA 3IH2A 3KP2A 3ZN1A 3S14J 2K85A 2OV7A 1QQIA 2FNPA 3OSGA 1IDZA 4CZCA 2L7MP 5JR3A 4B43A 4M3BA 2O6GE 4DBQA 4KN4X 1FLIA 1TC3C 3GO5A 3JAMZ 1RC9A 5A2QZ 3PNVA 2FE3A 4DGWB 1V5EA 4RS8A 3OYHA 2E5ZA 4XLEA 4G12A 2W82A 3WODF 3LQQA 1RPWA 2DW4A 3CCYA 3A0HC 3E6BA 2YPRA 2EA2A 2ZMEB 2ETHA 2BYVE 2RGVA 3TDZC 1OYIA 3G2BA 1R22A 2CW8A 2MG4A 2PBIA 2Y30A 1X1BA 1OCZH 3I59B 1JXSA 2WAQN 4M9ZA 3BR0A 2F5EA 4A0ZA 4Y52J 4YFNF 3OYDA 3LSTA 4LG3A 3ELKA 5CVIA 2IW5A 2BGCA 3TO7A 3OYIA 2DODA 2UV1A 1WJAA 2M1BA 4L5IA 1S72I 2DA1A 3PSIA 4XNFA 1TWCJ 4XLCA 1VQ6I 1Z67A 3KE2A 4NQWA 3BR1A 3GFIA 3LSRA 1RRJA 5GAEJ 2HGCA 4LITA 2ZJRF 2YX7A 2MA3A 4BE1A 2Y0MA 2O0YA 2DTRA 4OIQF 2FUG2 1V55H 1ZGWA 2K9QA 4ZDOA 2GOXB 2VXDA 4D9JA 2DA5A 4BEHA 1R5HA 1K6OA 1Z7UA 1S29A 1XC5A 4G7ZF 3DEUA 4OU0A 4PSWA 2CUJA 2H94A 2KIQA 3CUQC 5D6FA 4ON0A 3S32A 4ZYGA 1OCPA 2H27A 5J8FA 4MO7A 2XGDA 3CP8A 2LY9A 1K4SA 3G71I 1U9OA 2LP0A 1VTNC 1XPXA 2OC6A 4N4OB 2A61A 3DTIA 2L54A 2FEZA 3ASNH 4PJNA 3LFUA 1O7FA 5TGTA 1QZZA 5GADJ 1N25A 3RQ4A 4B4CA 3H0DA 3K4CA 4I7HA 5FD6A 1T38A 1FSEA 4D7NA 2F4OB 2H6CA 4E7KA 1OLTA 2VOOA 2DA6A 2WADA 1HKTA 4RB3C 2K3PA 4PFOA 1ETVA 2W57A 1YTYA 1WFXA 4P9UA 4AM3A 1SD7A 4HQMA 1HBXG 4MQVA 3WU1B 1DGRM 1W4MA 4DZPA 1X1CA 3ECHA 4BDYA 1Y1WJ 1SVLA 1BM9A 3FKIJ 3HRMA 4R8HA 3RPQA 4AYBN 1K78A 3ERMA 3CCEI 4ETSA 3K9TA 3KEYA 4XMYA 4EQQA 3ABTA 1R00A 2IGMA 3LA7A 3I54A 2R3SA 1R23A 2J5OA 3KYDB 1J09A 4XKWA 4RB0A 5FFXA 3JRGA 1J0RA 4NHJA 3GTQJ 1KU9A 1J5YA 2HXOA 3HOVJ 1GVJA 2NVYJ 1HOMA 1UMQA 2X85A 3JTGA 4A93J 4RAGA 3O6BB 3OV8A 4A6EA 5D5VB 3LSJA 1P9QC 2IRFG 4G94A 1ZK8A 3MZ8A 2B0LA 3GBGA 3H5RA 1XGNA 5IT9Z 2EFNA 3WTZA 1J9IA 3V7SA 5KNLA 4RB1A 3JAMK 5FLMJ 2CQNA 5A2QK 1IN4A 4ANJA 1ON1A 4D5FA 4Q48A 4IRIA 2F6CA 1MBHA 3GTMJ 1YFHA 3NARA 5JVGF 4EV0A 2ECBA 3M8JA 2DPDA 1YS7A 4Y3OA 4A69C 4A3BJ 1FSHA 3PJRA 4J19A 1G6NA 3G1LA 4CCLA 3S1RJ 4B3XA 3GMEA 1JJ8C 2N8GA 4FETA 2LKSA 2DJNA 3OMYA 3PIPF 3GZ5A 2BE5F 2NVXJ 3COAC 3TO9A 5KVRA 2BVMA 3EYIA 1I50J 4WCGA 1LEAA 1R1VA 5FROA 3QP5A 5CQGA 9ANTA 4M73A 5JLWA 3BTLA 1ZLJA 4QLCU 3MVPA 3GWZA 2KMUA 1HW1A 1FC3A 2L3DA 2M4GA 1XS9A 3F8NA 2QKMB 2VJJA 1U78A 1LFBA 3VSLA 2VUMJ 4XKCA 1T0FC 2VQCA 4M72A 4FQGA 2CH0A 2VJ5A 2DAOA 4EEFG 4D1QA 4E7HA 2KZGA 2WAFA 4EM0B 3OYCA 4Q5SF 2FA5A 5FO5A 2R7FA 4KMUX 3AL0C 3T0YA 1TNSA 3TP0A 3CCUI 3ZQHA 5CKTA 1EJ9A 2M8EA 1MZBA 3ZCOA 2XSDC 1ODDA 3HC7A 2NOJB 1W5TA 4YEJA 1U8RA 3OYKA 2JA5J 2CUFA 2L7KA 4XK4A 2LLKA 1ZKGA 4D0PA 2IT0A 5HDNA 4UVBA 3FX3A 4M71A 2HNHA 1TTYA 2LYCA 5D8LB 1K7AA 3PM1A 4F55A 3OSFA 2DN0A 1V4RA 3G1MA 1Z3YA 3HZJA 1BW6A 1JI8A 2K9NA 4QWQA 4A3FJ 3B6CA 1QZYA 5E1WA 2BW3A 2A6EF 1DUXC 2Y75A 4XOTA 5F1JA 4ESBA 5FRNA 3RPUA 3W6VA 4LOCA 1ZH5A 2X51A 5HNHA 3LSHA 5ILUA 4HF1A 3M3YJ 2HZTA 2O7OA 2L7ZA 4HYEA 5FJ8J 2RC4A 2A07F 4LFUA 2P5VA 3HTSB 3IC7A 2X1EA 2Z2SB 4LJZF 4BJ6C 4RLFA 2NNYA 2VL8A 3KZIC 3A0BC 3TOBA 1Y56A 2LVSA 2F5FA 2NVQJ 2IA0A 1RKTA 3L00A 1S7AA 5TJJA 4ABZA 2QBYA 2JA7J 2QLZA 1MNEA 2V1UA 3L2UA 2E1CA 3H3UA 5B3SH 2B63J 1WJBA 3ECOA 1V5GA 3JW4A 3P7NA 4M3FA 4JYKA 1GUUA 3IP4B 3M07A 3CO6C 2QWWA 1IO2A 2GXAA 3I55I 1ENHA 3HIFA 4OAYA 4AIHA 2R7TA 1BI3A 2GM4A 4RGRA 3GUDA 2XGCA 2CV1A 3CCLI 1O3QA 3WGGA 3WE3A 2MH2A 3HDDA 2R7SA 2HQRA 3DV8A 3FKJA 4BQOA 4HF2A 2W1OA 1FY7A 2W25A 5FGMA 4C3HJ 1QHHD 1WJFA 1Z1DA 2HVRA 1J7KA 2KT0A 3H9QA 3FXRA 3WTVC 2HDWA 3SEZA 4A3IJ 4CCKA 3DWLE 3VSKA 4HX4A 4DOZA 5BOXA 1CGPA 2FF4A 2QENA 4D7MA 3C2BA 5E1XA 5HNFA 3DU5A 4FCYA 1A31A 1QO0D 1T98A 3CP2A 2EV6A 1EH8A 3CUQB 5FKKA 4HA8A 1IRZA 3GFJA 5FD5A 1Z6RA 4GYIA 2K40A 2YUSA 1XTAA 1EA3A 2FBKA 5DCMA 1PP8F 2VODA 3ZQIA 1P2FA 3IAM2 4H0EA 2ID3A 3HBLA 5LRRA 5J8CA 3CMAI 1F36A 4EJUA 3HHGA 4BDZA 2Z1DA 1I3AA 2DA4A 3CQZJ 3LAJA 1UFMA 1R4MB 2A69F 2O8KA 3H5NA 2EINH 1OKRA 2I8DA 2CQQA 3CJQB 3F3XA 1RZ4A 3PSFA 4RAZA 5CPRB 1IXRC 2FMYA 1X3WB 5JHUA 5J1YA 2HQNA 1MMSA 3F0CA 2E1MC 3BCBA 4ZTFA 2R5ZB 3JTHA 4ZYEA 1YW9A 2HDDA 2RQPA 2HVQA 3I53A 1BR2A 1R5GA 3PFIA 1R71A 2FQ4A 1XGMA 5DD4A 4KFCA 2M0MA 2DTZA 4MFEA 1UB9A 1G3YA 2AHQA 1X4OA 3BCAA 3EUAA 1WJEA 2CQKA 2STWA 1X2NA 4Y7NJ 1FEXA 3BY6A 1W7PB 3AG1H 3W2VA 2LH9A 1E3HA 1VQPI 3F6OA 2A6TA 3QPLA 2QSHX 5FFZA 3R6SA 3RPUD 3RYPA 4A3LJ 1ONVA 1RETA 3IHUA 5EEHA 4RM3A 5BPDA 1HSTA 1AWCA 5EEAA 2HQAA 1VF9A 3C2HA 2ZJQF 3R0AA 3KCCA 2MBFA 5K7ZA 1S5LC 2XB0X 1A35A 5LBQA 4S0HB 5LGNA 4NB5A 3QODA 3I64A 2DMNA 2JA2A 1IXCA 3IAS2 4BH9A 4UUVA 1OR7C 1T08B 2Q2EB 2F2EA 2WA0A 3CF5F 4Z2YA 3RYRA 3CDIA 2M2EA 2W24A 3IH4A 3RKYA 2LSOA 3K70D 1NK3P 2CG4A 2CV2A 2IGNA 2F5VA 2L9SA 3BROA 4MTEA 4DIQA 4UUSA 3G4SI 2M4KA 5HLHA 4PJMA 1ZG5A 1UHWA 1APLC 1VQKI 1LDDA 1IAWA 1ZHFA 3CJTB 1AU7A 2LNBA 3IWZA 5HS7A 2DFEA 3HOUJ 2LBFA 3ISPA 1QZEA 4KYWA 1S3JA 1D0YA 5F1RA 2CFXA 3BDDA 3CC2I 2VJ4A 3X2QH 2QUFA 4JOMA 4CSWA 1JTYA 1WQ2A 1MBEA 2ESHA 3KLOA 1MNDA 2E2JJ 4XQFA 1WH5A 3FISA 1EKEA 4LG0B 5IOZA 3L2WA 1G4DA 1V5FA 3ZOBA 4C3JJ 3JRDA 3AL0B 3RKWA 1P7JA 3ESWB 1YRNA 2Q1ZB 1QRYA 3DLAA 2V9KA 1KGSA 2VB6A 3I58A 4XIDA 1A04A 5FB2A 4I02A 4YFKF 3AG4H 1R36A 3A03A 4S04A 2ECCA 2WTEA 1BOBA 2PI0A 1X4PA 3K4BA 2DK8A 2Z5UA 5JFRA 3ZQLA 4LGWA 1D5VA 4PGGA 2J5PA 2K4JA 2EK5A 3S16J 2M8GX 2XIGA 2W84A 5ICCA 2XAHA 1VFCA 3IKVA 5CJ9A 2CV0A 3L2CA 2XASA 1XG1A 4EJOA 4BQNA 5HDKA 1T2KA 3BJOA 5GTHC 3FXJA 1SMTA 5M5YJ 2FU4A 2GBYA 4MIMA 1Y39A 4L9VA 4BQQA 3BJ6A 2Q8KA 1DP7P 1XMKA 4E4HA 3K1NA 3L2RA 1XMAA 4C2TA 3JSPA 3QOEA 2ZSHB 4KJZA 1MSFC 1X3UA 1D1BA 1BIAA 1Z21A 4IF4A 1KQ0A 2OUMA 4BE2A 2R7VA 2MH9A 1IRXA 5GAGJ 4E70A 3BG5A 2WB1A 5J4VA 4D5CA 2MFZA 4WWCA 3FMRA 4U0WA 3T1BA 1L0OC 4BJ5C 1YIJI 4XSZF 2JSCA 4ENMA 2EZKA 1K61A 3F9KA 1P6RA 4IPAA 3LSIA 3AAFA 3HOZJ 5BPIA 4BXXJ 3ZMUA
chains in the Genus database with same CATH topology
2NS0A 1E2XA 1TW3A 5D4RA 5D4SA 1JHFA 1IN5A 4TV7A 3FMSA 3B02A 4I2OA 1T6SA 4HZFA 3ULQB 1TBXA 3VODA 1XGSA 3R4KA 5HLIA 1PUEE 1EV7A 3BZ6A 2PLYA 2STTA 4HF0A 1CF7B 2CYYA 4L0YB 4HX8A 2P7CB 2GA1A 1FBSA 2V79A 2KKOA 1LDKB 2F5CA 3V7CA 4EMSA 5HVQC 5H20A 4IRHA 2IA2A 3E5XA 4RGXA 1RNLA 1ZAOA 3FMQA 4Y13A 3K69A 2OAZA 3WTSC 4YFXF 5CVVA 2RVCA 2CSOA 5ICGA 2HFHA 1SD6A 4GXOA 3GF2A 4U88A 4YIFA 3V7RA 1ZG1A 2VE9A 3T5XA 3EQLF 2PEXA 2FSWA 3SFZA 4HV6A 2O61A 1MJBA 4WF2A 2K86A 1WSUA 4P96A 1U5TC 2P7VB 2CWEA 3KEOA 4A6DA 1B59A 2ZBKA 3DFGA 5CVUA 4KIFA 2DFIA 2GQQA 1G3TA 5BMZA 2IA1A 3F23A 3KEQA 3KP5A 4Y15A 2PJPA 2F5DA 3GZ6A 4MGRA 4ESFA 5D5WB 3C7JA 2VE8A 2FXAA 3QOPA 1MDMA 1WI9A 3CJNA 3E5QA 2HOEA 1LEBA 2GIVA 3CUOA 4OIPF 4JQFA 1KYWA 4O5VA 1ZRDA 3HTUA 3RDIA 2MLKA 4HBLA 2VBYA 2PMHA 2VC1A 1P4WA 4CZZA 1QGPA 2OU2A 1ULYA 1BOAA 4XBFA 3F8CA 3GYHX 1J75A 2O8XA 4M6YA 4BNCA 5ICFA 3LFKA 3TGNA 4AD9A 4AVPA 2HWVA 2GWRA 4I0BA 5K1YA 3F21A 3TOAA 1R1TA 1FP2A 1STZA 2YR2A 1FWZA 3F8BA 3WTTC 2OA4A 4XLPF 3T8RA 2A3SA 4G7OF 4A5NA 4KUMA 1B9MA 2ISYA 2P4WA 3SZTA 2E7WA 1QPMA 2QQAA 3FM3A 1IRGA 1H0MA 2PFBA 1XCBA 2AXLA 3D5LA 3P9CA 4RAYA 3WGIA 4OMZA 2RV8A 3ZMSA 2JZYA 4CXFA 2COMA 3HOSA 2OD5A 2ZMEA 3RI4A 2XKPA 3VOEA 3I59A 2P5LC 4EJTA 3N97A 3I4PA 4LMYA 4P5OA 1YO5C 2HYGD 1SD4A 3FWEA 2ELHA 4IVNA 3JSOA 2Z9OA 5LHGA 4RB2C 2EJRA 3MZHA 5F6FA 5DV5A 2UZKA 4HOBA 2XAFA 1ZLKA 3DPLC 1YW7A 1YG2A 3M9AA 2LDUA 4CICA 1LQ1A 4MNUA 4LLGF 2ISZA 1XB4A 2Z99A 4DNCA 2JTVA 3IRRA 1AOYA 2HKXA 4U0YA 4G9YA 4CDGA 5E17F 4BHPA 3KETA 3KZZA 3R60A 2BV6A 5DD8A 1DPUA 4I0AA 1DPRA 3HRUA 4A2UA 4FHTA 3O2PE 1JGSA 3LA2A 1TLHB 4CGZA 3DKWA 2JRTA 2Z33A 2KJCA 3U2RA 1P4AA 3I0TA 3IL2A 4N9IA 1FPQA 4KMFA 3DQVC 3T8TA 5HS8A 3LQRA 5BQTA 2VC0A 4L9TA 2OZUA 1D3YA 3EUHA 4WXDA 2A68F 3CO7C 3KP6A 5DUIA 1SD5A 4O3MA 1Z91A 5LLQA 4KT5C 1XCVA 1SMYF 1IN7A 3B73A 2ZFWA 2XKOA 1U5TB 4HLYA 2VT3A 3LA3A 3WU0A 1JE8A 1FZPB 3FXQA 3M8EA 2WV0A 1O3TA 1FBUA 5AONA 5FLXK 2XHKA 1O57A 3EYYA 1BC7C 2DU9A 4B09A 1IZ1A 3P9KA 4N0BA 1U2WA 3V4GA 4MTDA 1TW2A 2K7LA 4M9SA 5LHIA 2VXZA 2OZ6A 2K02A 3DP7A 4HQEA 4ZYHA 3V8KA 1HKQA 2D1HA 3SXYA 3FM5A 2CW0F 3WTUC 4ENJA 2YSRA 4GCVA 2XAJA 3RTRA 3F8MA 1R58A 4U0VA 2M5WA 2L02A 1LJ9A 3ZMVA 4RGSA 2VBZA 2W85A 4JBAA 2FBHA 3W6KB 2Q0OA 4L9NA 2X4HA 3HRSA 3M7GA 4O6JA 4ASNA 3TQNA 1F1ZA 2HEOA 3GVAA 2FOKA 4HLXA 1D8KA 1IXSB 1OPCA 4P55A 2VOPA 1MGTA 4HV5A 4HX7A 3ZN0A 3L09A 1D8JA 3IWFA 4EJVA 3KZYA 4I09A 2HTJA 1REPC 2IJLA 2IP2A 3F22A 1G3WA 4GGGA 2LF7A 2P5KA 4WK8F 3N4MA 4IHSA 1I1GA 1TQIA 1DDNA 3PQKA 1GXPA 2DQLA 1KYZA 3GW2A 1HQCA 4PDKA 3FZVA 2G9WA 1I6XA 1ZN2A 1B9NA 2XAQA 3M1EA 5HOOA 1MJ9A 1Y0UA 3KP7A 4YIIA 3F72A 3Q9VA 4ENNA 3HSRA 2BEOA 4WXHA 2ZXJA 3WG9A 4LB6B 1BIBA 3RKXA 1XSDA 2CO5A 1O3SA 3ERED 1F4KA 1IRFA 5D5XB 2HR3A 2DPUA 1HW5A 3E5UA 1ZGAA 2KIFA 3CUQA 3D0SA 3K1PA 3K1MA 2EWNA 1GHCA 2ADUA 1RUNA 2D2WA 4UXNA 5D8KB 4KA4A 1O3RA 1R7JA 3FF5A 3E6MA 1ZRCA 1S6LA 3ML6A 4KNYA 2PG4A 3V8LA 2R7DA 2DO7A 1SAXA 1JHHA 3G3ZA 4BAYA 2XROA 3J7AO 3ZPLA 3ROUA 2NNNA 3KLNA 1EH6A 1SFXA 2NRAC 5E1ZB 4ESJA 3SQNA 3K2ZA 3F8FA 3ZQ7A 1TQMA 2D45A 1W7PA 3W6JB 1KQ8A 3RJPA 3LWFA 4WX9A 2EA4A 5H6QA 4KIGA 4BYYA 2V6CA 3I71A 4OOIA 2OBPA 4EGYA 1KU3A 5HLGA 2P8TA 2XAGA 4RGUA 5ERIA 1Q1HA 1ZG3A 2K27A 1RIOH 5CVRA 5L3EA 4Y17A 3WTYC 2Y48A 1K78B 2Q2EA 2G7UA 3CDHA 2RN7A 3DPTA 3ZP5A 3KP3A 4AIKA 2ESNA 2EFOA 4A0YA 3FHZA 2QQ9A 3MWMA 5CLSA 3E3VA 4M9XA 3OOPA 4FT8A 4MHGA 1EH7A 4M74A 4PGHA 1G3SA 4OIRF 5HDGA 1WRJA 2ZCWA 5CVJA 1BC8C 4BQAA 3NQOA 1XSXA 5E8GA 1T0FA 2HKOA 4A0XA 4ENKA 4KDPA 4LG0A 4FX0A 5K5RA 1WWXA 4EM1A 3M8FA 3HSFA 1J2XA 3FXUA 3GEZA 1HW2A 4WXCA 2M87A 2XVCA 1USSA 3BJAA 4G7HF 3DXJF 5L3BA 1SFUA 5F64A 2HDCA 4G6QA 4LLLA 2XV4S 2DK5A 4U7BA 3TO6A 3CTAA 5TRDA 2FBIA 5DCFA 5AIPA 3MZYA 2VBWA 3ZMDA 3L9FA 1NHAA 3QAHA 1O7LA 2ZKZA 2LKPA 1E17A 3GFLA 1T39A 1FYLA 4K2EA 4EJWA 1W7PD 3QPHA 1Z6TA 5LRSA 2PQ8A 3MCZA 3J81K 5D5UB 1R1UA 4BHBA 2IVMA 1F9NA 4CO8A 3WE2A 3GX4X 3SHFA 5LHHA 1XD7A 3PQJA 1ZARA 4MQ9F 5H6RA 5CYVA 3QPTA 3QU6A 4M6XA 1BI2A 2VBXA 1B4AA 1U3EM 1LVAA 2O3FA 3HYIA 3U1DA 1WKMA 3P9IA 1F5TA 4XRFA 1K79A 3KFWX 1CF7A 2QBYB 3HRTA 3NRVA 4AWXB 2WWYA 5L3DA 4Q47A 1FBQA 3Q9SA 3E6DA 1OMIA 2Z3YA 2VONA 1QBJA 1Z05A 1YS6A 2DBBA 2FQ3A 2K4BA 5ILVA 2A5YB 1S8NA 4GYGA 1YYVA 4HW0A 1HKSA 4UNOA 1GXQA 5FLXZ 2L01A 4HAMA 3MQ0A 2DI3A 3C3WA 2QZ8A 1I1SA 2ZNYA 1C0WA 3KP4A 5DCMB 2M30A 5HS9A 5E8IA 3WTXC 2L4AA 3HUGA 4Q4ZF 4AIJA 4XLNF 1MD0A 2X0LA 4LD5A 2UWMA 3IKTA 1IF1A 4CYDA 3GLXA 4N9HA 3RIRA 1B1BA 2MLGA 1P92A 4UVAA 4YG2F 3H3ZA 1I27A 4BXUA 1XDSA 4UV8A 3QRFF 1SFEA 1KQ9A 1OR7A 3TKYA 1RI7A 4I01A 2GXBA 2YU3A 4R1HA 3J80Z 5ED4A 1XSVA 2GAUA 2GXGA 2QQBA 2JPCA 3R61A 1MKMA 3Q5FA 2DQRA 4CHUA 3IRQA 3C1DA 4B8XA 4ZZLA 5L3GA 3HOTA 3V8JA 1USTA 2CGPA 2EFQA 2UXNA 2XRNA 2LF8A 1FOKA 5DDGA 2NAZA 3HSEA 4IJAA 3BOQA 4LK0F 3F6VA 1BBYA 1UHMA 4ZH4F 4G8XA 2MC3A 1YQAA 2V1XA 3GFMA 5JI6A 2EB7A 5L3FA 2ZNZA 2E1NA 2FNAA 2PN6A 2OQRA 5ICEA 4KICA 3HHHA 1ZRFA 6PAXA 5IT9K 3S2WA 2PMUA 5JVTA 5D6EA 4L0ZB 2EV5A 5DUKA 2ACJA 3EDPA 5L3CA 3E6CC 1IUYA 5LEJA 4XSXF 4OMYA 1YIOA 4UVCA 3QU3A 2P6TA 5EEGA 5DEQA 3EETA 1LNWA 1KU7A 3QP6A 5DYMA 1P4XA 4MEXF 2QM3A 4ZZDA 2GZWA 2A6HF 1H9TA 2EV0A 5LEKA 4GO1A 2MD5A 4UHTA 1OYYA 1QNTA 2E7XA 3WGHA 3L7WA 3MAJA 3J80K 1BI0A 1IN6A 3CLOA 4EM2A 4A12A 4LK1F 4PCQA 2HS5A 1FYKA 3WTWC 4G6DA 1B6AA 2NYXA 5LGUA 3NEUA 3ZMZA 2RNJA 2ZJ2A 4KN7X 2XUBA 4LLNA 1ZREA 4MEYF 2O03A 5BS6A 3BWGA 1I5ZA 1H9GA 3O3KA 4P9FA 1FT9A 4IHTA 2D1VA 2EFWA 2OQGA 1HSJA 2KIUA 2HYFA 1PP7U 3BP8A 2EFPA 1YLFA 5IT3A 1YW8A 2FRHA 1IW7F 2JPBA 4ZYDA 1XGOA 1U5TA 1L3LA 1FP1D 4HDUA 4DQ2A 4LB5A 1J59A 4R79A 1FYMA 2JT1A 1W5SA 2XGXA 1FX7A 2AS5F 3R0JA 1UCRA 2KRFA 3VFZA 1HXDA 2V1DA 4PZJA 4IRGA 4L9JA 3K0LA 4A5MA 3MEXA 2H09A 4U7DA 1LDJA 2RDPA 1BN5A 2ZO4A 4KIBA 4OINF 4EGZA 3GXOA 5ILSA 5K5QA 3H92A 4I98B 2QYOA 4UV9A 1OYWA 2TDXA 3BPVA 3G73A 2P6SA 5K5OA 4JK1X 3SZPA 1ZGJA 3I5UA 2RKHA 4OIOF 2L4MA 1BI1A 4F7ZA 2V9VA 1ON2A 3ZMTA 3VEPA 2GA2A 5E18F 1TNTA 3REOA 3U9GA 1MDMB 3E97A 1FNNA 2YX4A 4S05A 4HDVA 2G7HA 2H6BA 2M45A 3TDUC 2VN2A 1RUOA 3J81Z 4IXAA 5E20A 2UXXA 2KIMA 2BBYA 1PDNC 2C6YA 2WC2A 2HTSA 4L5JA 2QVOA 4FX4A 5AIQA 2VT2A 3LAPA 1ZYRF 1U6GA 1KA8A 1MJAA 1KU2A 3VB2A 3MFKA 3ABUA 5J6XA 5LGTA 1TQPA 2DT5A 1XDUA 3DF8A 5KK1A 2IPQX 1Z9CA 2FMLA 1BJAA 1S7OA 2KJBA 4BHCA 3C18A 3BPXA 1XN7A 4L18B 1V3FA 1LB2A 2DLLA 1IN8A 4EVIA 3KP2A 3ZN1A 1QQIA 2FNPA 5JR3A 2O6GE 4KN4X 1FLIA 3GO5A 3JAMZ 5A2QZ 2FE3A 4RS8A 3WODF 3LQQA 2DW4A 3E6BA 2EA2A 2ETHA 2ZMEB 3TDZC 2BYVE 2RGVA 2YPRA 1OYIA 1R22A 2PBIA 3I59B 1JXSA 4M9ZA 2F5EA 4A0ZA 4YFNF 3LSTA 3ELKA 5CVIA 2IW5A 2BGCA 3TO7A 2M1BA 4L5IA 3KE2A 4NQWA 3GFIA 2HGCA 2YX7A 2MA3A 2Y0MA 2O0YA 2DTRA 4OIQF 1R5HA 1K6OA 1Z7UA 1S29A 4G7ZF 3DEUA 4OU0A 2H94A 3CUQC 4ON0A 5D6FA 4ZYGA 2H27A 5J8FA 1VTNC 2A61A 2L54A 2FEZA 1O7FA 1QZZA 4I7HA 5FD6A 1T38A 1FSEA 2H6CA 2VOOA 1HKTA 4RB3C 2W57A 1YTYA 4P9UA 1SD7A 4HQMA 1HBXG 4MQVA 3WU1B 1W4MA 3ECHA 1BM9A 3HRMA 4R8HA 3RPQA 1K78A 4ETSA 3K9TA 4EQQA 3ABTA 1R00A 3LA7A 3I54A 2R3SA 1R23A 2J5OA 4RB0A 5FFXA 1J0RA 4NHJA 1KU9A 1J5YA 1GVJA 3JTGA 3O6BB 3OV8A 4A6EA 5D5VB 2IRFG 4G94A 5IT9Z 2B0LA 1XGNA 2EFNA 3WTZA 1J9IA 3V7SA 4RB1A 3JAMK 5A2QK 1IN4A 1ON1A 4Q48A 4IRIA 1YFHA 4EV0A 2DPDA 1FSHA 1YS7A 1G6NA 3GZ5A 2BE5F 3COAC 3TO9A 5KVRA 3EYIA 4WCGA 1LEAA 1R1VA 3QP5A 4M73A 1ZLJA 4QLCU 3GWZA 1HW1A 1FC3A 2L3DA 3F8NA 1U78A 4M72A 2DAOA 4EM0B 4Q5SF 2FA5A 5FO5A 2R7FA 4KMUX 3T0YA 1TNSA 2M8EA 1MZBA 1ODDA 1W5TA 1U8RA 4D0PA 2IT0A 5HDNA 4UVBA 3FX3A 4M71A 1TTYA 5D8LB 1K7AA 1V4RA 4QWQA 5E1WA 1QZYA 2A6EF 1DUXC 2Y75A 4ESBA 3RPUA 1ZH5A 5ILUA 4HF1A 2HZTA 4HYEA 2RC4A 2A07F 4LFUA 2P5VA 3HTSB 3IC7A 4LJZF 2NNYA 3TOBA 2F5FA 2IA0A 3L00A 1S7AA 5TJJA 2QBYA 2QLZA 2V1UA 2E1CA 3H3UA 3ECOA 3JW4A 3P7NA 3CO6C 2QWWA 3HIFA 4AIHA 1BI3A 4RGRA 3GUDA 1O3QA 3WGGA 3WE3A 2MH2A 2HQRA 3DV8A 4HF2A 1FY7A 2W25A 5FGMA 1Z1DA 1J7KA 3FXRA 3WTVC 4HX4A 5BOXA 1CGPA 2FF4A 2QENA 5E1XA 1QO0D 1T98A 2EV6A 1EH8A 3CUQB 4HA8A 3GFJA 5FD5A 1Z6RA 4GYIA 2FBKA 5DCMA 1PP8F 2VODA 1P2FA 4H0EA 5LRRA 5J8CA 4EJUA 3HHGA 3LAJA 1UFMA 2A69F 1OKRA 3F3XA 1RZ4A 4RAZA 1IXRC 2FMYA 5JHUA 2HQNA 3JTHA 4ZYEA 1YW9A 2RQPA 3I53A 1R5GA 3PFIA 1XGMA 5DD4A 4KFCA 1UB9A 1G3YA 2CQKA 2STWA 3BY6A 1W7PB 3F6OA 5FFZA 3R6SA 3RYPA 1ONVA 3IHUA 5EEHA 5BPDA 1HSTA 1AWCA 3R0AA 3KCCA 2MBFA 5LBQA 5LGNA 4NB5A 3I64A 1IXCA 4BH9A 4UUVA 2F2EA 4Z2YA 3RYRA 2W24A 3RKYA 2LSOA 2CG4A 3BROA 4MTEA 5HLHA 1ZG5A 1UHWA 1LDDA 1IAWA 1ZHFA 2LNBA 3IWZA 5HS7A 3ISPA 4KYWA 1S3JA 5F1RA 2CFXA 3BDDA 2QUFA 1WQ2A 2ESHA 3KLOA 4LG0B 1G4DA 3RKWA 1KGSA 3I58A 1A04A 5FB2A 4I02A 4YFKF 1R36A 4S04A 2PI0A 2WTEA 2DK8A 2Z5UA 5JFRA 4LGWA 1D5VA 4PGGA 2J5PA 2K4JA 2EK5A 5ICCA 2W84A 2XIGA 2XAHA 3IKVA 5CJ9A 3L2CA 2XASA 4EJOA 5HDKA 1T2KA 3BJOA 1SMTA 2FU4A 4L9VA 3BJ6A 2Q8KA 1DP7P 1XMKA 3K1NA 1XMAA 3JSPA 1X3UA 1BIAA 4IF4A 1KQ0A 2MH9A 4E70A 4WWCA 3FMRA 4U0WA 3T1BA 1L0OC 4XSZF 2JSCA 4ENMA 1P6RA 4IPAA 3AAFA 5BPIA 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS0 A;  1E2X A;  1TW3 A;  5D4R A;  5D4S A;  1JHF A;  1IN5 A;  4TV7 A;  3FMS A;  3B02 A;  4I2O A;  1T6S A;  4HZF A;  3ULQ B;  1TBX A;  3VOD A;  1XGS A;  3R4K A;  5HLI A;  1PUE E;  1EV7 A;  3BZ6 A;  2PLY A;  2STT A;  4HF0 A;  1CF7 B;  2CYY A;  4L0Y B;  4HX8 A;  2P7C B;  2GA1 A;  1FBS A;  2V79 A;  2KKO A;  1LDK B;  2F5C A;  3V7C A;  4EMS A;  5HVQ C;  5H20 A;  4IRH A;  2IA2 A;  3E5X A;  4RGX A;  1RNL A;  1ZAO A;  3FMQ A;  4Y13 A;  3K69 A;  2OAZ A;  3WTS C;  4YFX F;  5CVV A;  2RVC A;  2CSO A;  5ICG A;  2HFH A;  1SD6 A;  4GXO A;  3GF2 A;  4U88 A;  4YIF A;  3V7R A;  1ZG1 A;  2VE9 A;  3T5X A;  3EQL F;  2PEX A;  2FSW A;  3SFZ A;  4HV6 A;  2O61 A;  1MJB A;  4WF2 A;  2K86 A;  1WSU A;  4P96 A;  1U5T C;  2P7V B;  2CWE A;  3KEO A;  4A6D A;  1B59 A;  2ZBK A;  3DFG A;  5CVU A;  4KIF A;  2DFI A;  2GQQ A;  1G3T A;  5BMZ A;  2IA1 A;  3F23 A;  3KEQ A;  3KP5 A;  4Y15 A;  2PJP A;  2F5D A;  3GZ6 A;  4MGR A;  4ESF A;  5D5W B;  3C7J A;  2VE8 A;  2FXA A;  3QOP A;  1MDM A;  1WI9 A;  3CJN A;  3E5Q A;  2HOE A;  1LEB A;  2GIV A;  3CUO A;  4OIP F;  4JQF A;  1KYW A;  4O5V A;  1ZRD A;  3HTU A;  3RDI A;  2MLK A;  4HBL A;  2VBY A;  2PMH A;  2VC1 A;  1P4W A;  4CZZ A;  1QGP A;  2OU2 A;  1ULY A;  1BOA A;  4XBF A;  3F8C A;  3GYH X;  1J75 A;  2O8X A;  4M6Y A;  4BNC A;  5ICF A;  3LFK A;  3TGN A;  4AD9 A;  4AVP A;  2HWV A;  2GWR A;  4I0B A;  5K1Y A;  3F21 A;  3TOA A;  1R1T A;  1FP2 A;  1STZ A;  2YR2 A;  1FWZ A;  3F8B A;  3WTT C;  2OA4 A;  4XLP F;  3T8R A;  2A3S A;  4G7O F;  4A5N A;  4KUM A;  1B9M A;  2ISY A;  2P4W A;  3SZT A;  2E7W A;  1QPM A;  2QQA A;  3FM3 A;  1IRG A;  1H0M A;  2PFB A;  1XCB A;  2AXL A;  3D5L A;  3P9C A;  4RAY A;  3WGI A;  4OMZ A;  2RV8 A;  3ZMS A;  2JZY A;  4CXF A;  2COM A;  3HOS A;  2OD5 A;  2ZME A;  3RI4 A;  2XKP A;  3VOE A;  3I59 A;  2P5L C;  4EJT A;  3N97 A;  3I4P A;  4LMY A;  4P5O A;  1YO5 C;  2HYG D;  1SD4 A;  3FWE A;  2ELH A;  4IVN A;  3JSO A;  2Z9O A;  5LHG A;  4RB2 C;  2EJR A;  3MZH A;  5F6F A;  5DV5 A;  2UZK A;  4HOB A;  2XAF A;  1ZLK A;  3DPL C;  1YW7 A;  1YG2 A;  3M9A A;  2LDU A;  4CIC A;  1LQ1 A;  4MNU A;  4LLG F;  2ISZ A;  1XB4 A;  2Z99 A;  4DNC A;  2JTV A;  3IRR A;  1AOY A;  2HKX A;  4U0Y A;  4G9Y A;  4CDG A;  5E17 F;  4BHP A;  3KET A;  3KZZ A;  3R60 A;  2BV6 A;  5DD8 A;  1DPU A;  4I0A A;  1DPR A;  3HRU A;  4A2U A;  4FHT A;  3O2P E;  1JGS A;  3LA2 A;  1TLH B;  4CGZ A;  3DKW A;  2JRT A;  2Z33 A;  2KJC A;  3U2R A;  1P4A A;  3I0T A;  3IL2 A;  4N9I A;  1FPQ A;  4KMF A;  3DQV C;  3T8T A;  5HS8 A;  3LQR A;  5BQT A;  2VC0 A;  4L9T A;  2OZU A;  1D3Y A;  3EUH A;  4WXD A;  2A68 F;  3CO7 C;  3KP6 A;  5DUI A;  1SD5 A;  4O3M A;  1Z91 A;  5LLQ A;  4KT5 C;  1XCV A;  1SMY F;  1IN7 A;  3B73 A;  2ZFW A;  2XKO A;  1U5T B;  4HLY A;  2VT3 A;  3LA3 A;  3WU0 A;  1JE8 A;  1FZP B;  3FXQ A;  3M8E A;  2WV0 A;  1O3T A;  1FBU A;  5AON A;  5FLX K;  2XHK A;  1O57 A;  3EYY A;  1BC7 C;  2DU9 A;  4B09 A;  1IZ1 A;  3P9K A;  4N0B A;  1U2W A;  3V4G A;  4MTD A;  1TW2 A;  2K7L A;  4M9S A;  5LHI A;  2VXZ A;  2OZ6 A;  2K02 A;  3DP7 A;  4HQE A;  4ZYH A;  3V8K A;  1HKQ A;  2D1H A;  3SXY A;  3FM5 A;  2CW0 F;  3WTU C;  4ENJ A;  2YSR A;  4GCV A;  2XAJ A;  3RTR A;  3F8M A;  1R58 A;  4U0V A;  2M5W A;  2L02 A;  1LJ9 A;  3ZMV A;  4RGS A;  2VBZ A;  2W85 A;  4JBA A;  2FBH A;  3W6K B;  2Q0O A;  4L9N A;  2X4H A;  3HRS A;  3M7G A;  4O6J A;  4ASN A;  3TQN A;  1F1Z A;  2HEO A;  3GVA A;  2FOK A;  4HLX A;  1D8K A;  1IXS B;  1OPC A;  4P55 A;  2VOP A;  1MGT A;  4HV5 A;  4HX7 A;  3ZN0 A;  3L09 A;  1D8J A;  3IWF A;  4EJV A;  3KZY A;  4I09 A;  2HTJ A;  1REP C;  2IJL A;  2IP2 A;  3F22 A;  1G3W A;  4GGG A;  2LF7 A;  2P5K A;  4WK8 F;  3N4M A;  4IHS A;  1I1G A;  1TQI A;  1DDN A;  3PQK A;  1GXP A;  2DQL A;  1KYZ A;  3GW2 A;  1HQC A;  4PDK A;  3FZV A;  2G9W A;  1I6X A;  1ZN2 A;  1B9N A;  2XAQ A;  3M1E A;  5HOO A;  1MJ9 A;  1Y0U A;  3KP7 A;  4YII A;  3F72 A;  3Q9V A;  4ENN A;  3HSR A;  2BEO A;  4WXH A;  2ZXJ A;  3WG9 A;  4LB6 B;  1BIB A;  3RKX A;  1XSD A;  2CO5 A;  1O3S A;  3ERE D;  1F4K A;  1IRF A;  5D5X B;  2HR3 A;  2DPU A;  1HW5 A;  3E5U A;  1ZGA A;  2KIF A;  3CUQ A;  3D0S A;  3K1P A;  3K1M A;  2EWN A;  1GHC A;  2ADU A;  1RUN A;  2D2W A;  4UXN A;  5D8K B;  4KA4 A;  1O3R A;  1R7J A;  3FF5 A;  3E6M A;  1ZRC A;  1S6L A;  3ML6 A;  4KNY A;  2PG4 A;  3V8L A;  2R7D A;  2DO7 A;  1SAX A;  1JHH A;  3G3Z A;  4BAY A;  2XRO A;  3J7A O;  3ZPL A;  3ROU A;  2NNN A;  3KLN A;  1EH6 A;  1SFX A;  2NRA C;  5E1Z B;  4ESJ A;  3SQN A;  3K2Z A;  3F8F A;  3ZQ7 A;  1TQM A;  2D45 A;  1W7P A;  3W6J B;  1KQ8 A;  3RJP A;  3LWF A;  4WX9 A;  2EA4 A;  5H6Q A;  4KIG A;  4BYY A;  2V6C A;  3I71 A;  4OOI A;  2OBP A;  4EGY A;  1KU3 A;  5HLG A;  2P8T A;  2XAG A;  4RGU A;  5ERI A;  1Q1H A;  1ZG3 A;  2K27 A;  1RIO H;  5CVR A;  5L3E A;  4Y17 A;  3WTY C;  2Y48 A;  1K78 B;  2Q2E A;  2G7U A;  3CDH A;  2RN7 A;  3DPT A;  3ZP5 A;  3KP3 A;  4AIK A;  2ESN A;  2EFO A;  4A0Y A;  3FHZ A;  2QQ9 A;  3MWM A;  5CLS A;  3E3V A;  4M9X A;  3OOP A;  4FT8 A;  4MHG A;  1EH7 A;  4M74 A;  4PGH A;  1G3S A;  4OIR F;  5HDG A;  1WRJ A;  2ZCW A;  5CVJ A;  1BC8 C;  4BQA A;  3NQO A;  1XSX A;  5E8G A;  1T0F A;  2HKO A;  4A0X A;  4ENK A;  4KDP A;  4LG0 A;  4FX0 A;  5K5R A;  1WWX A;  4EM1 A;  3M8F A;  3HSF A;  1J2X A;  3FXU A;  3GEZ A;  1HW2 A;  4WXC A;  2M87 A;  2XVC A;  1USS A;  3BJA A;  4G7H F;  3DXJ F;  5L3B A;  1SFU A;  5F64 A;  2HDC A;  4G6Q A;  4LLL A;  2XV4 S;  2DK5 A;  4U7B A;  3TO6 A;  3CTA A;  5TRD A;  2FBI A;  5DCF A;  5AIP A;  3MZY A;  2VBW A;  3ZMD A;  3L9F A;  1NHA A;  3QAH A;  1O7L A;  2ZKZ A;  2LKP A;  1E17 A;  3GFL A;  1T39 A;  1FYL A;  4K2E A;  4EJW A;  1W7P D;  3QPH A;  1Z6T A;  5LRS A;  2PQ8 A;  3MCZ A;  3J81 K;  5D5U B;  1R1U A;  4BHB A;  2IVM A;  1F9N A;  4CO8 A;  3WE2 A;  3GX4 X;  3SHF A;  5LHH A;  1XD7 A;  3PQJ A;  1ZAR A;  4MQ9 F;  5H6R A;  5CYV A;  3QPT A;  3QU6 A;  4M6X A;  1BI2 A;  2VBX A;  1B4A A;  1U3E M;  1LVA A;  2O3F A;  3HYI A;  3U1D A;  1WKM A;  3P9I A;  1F5T A;  4XRF A;  1K79 A;  3KFW X;  1CF7 A;  2QBY B;  3HRT A;  3NRV A;  4AWX B;  2WWY A;  5L3D A;  4Q47 A;  1FBQ A;  3Q9S A;  3E6D A;  1OMI A;  2Z3Y A;  2VON A;  1QBJ A;  1Z05 A;  1YS6 A;  2DBB A;  2FQ3 A;  2K4B A;  5ILV A;  2A5Y B;  1S8N A;  4GYG A;  1YYV A;  4HW0 A;  1HKS A;  4UNO A;  1GXQ A;  5FLX Z;  2L01 A;  4HAM A;  3MQ0 A;  2DI3 A;  3C3W A;  2QZ8 A;  1I1S A;  2ZNY A;  1C0W A;  3KP4 A;  5DCM B;  2M30 A;  5HS9 A;  5E8I A;  3WTX C;  2L4A A;  3HUG A;  4Q4Z F;  4AIJ A;  4XLN F;  1MD0 A;  2X0L A;  4LD5 A;  2UWM A;  3IKT A;  1IF1 A;  4CYD A;  3GLX A;  4N9H A;  3RIR A;  1B1B A;  2MLG A;  1P92 A;  4UVA A;  4YG2 F;  3H3Z A;  1I27 A;  4BXU A;  1XDS A;  4UV8 A;  3QRF F;  1SFE A;  1KQ9 A;  1OR7 A;  3TKY A;  1RI7 A;  4I01 A;  2GXB A;  2YU3 A;  4R1H A;  3J80 Z;  5ED4 A;  1XSV A;  2GAU A;  2GXG A;  2QQB A;  2JPC A;  3R61 A;  1MKM A;  3Q5F A;  2DQR A;  4CHU A;  3IRQ A;  3C1D A;  4B8X A;  4ZZL A;  5L3G A;  3HOT A;  3V8J A;  1UST A;  2CGP A;  2EFQ A;  2UXN A;  2XRN A;  2LF8 A;  1FOK A;  5DDG A;  2NAZ A;  3HSE A;  4IJA A;  3BOQ A;  4LK0 F;  3F6V A;  1BBY A;  1UHM A;  4ZH4 F;  4G8X A;  2MC3 A;  1YQA A;  2V1X A;  3GFM A;  5JI6 A;  2EB7 A;  5L3F A;  2ZNZ A;  2E1N A;  2FNA A;  2PN6 A;  2OQR A;  5ICE A;  4KIC A;  3HHH A;  1ZRF A;  6PAX A;  5IT9 K;  3S2W A;  2PMU A;  5JVT A;  5D6E A;  4L0Z B;  2EV5 A;  5DUK A;  2ACJ A;  3EDP A;  5L3C A;  3E6C C;  1IUY A;  5LEJ A;  4XSX F;  4OMY A;  1YIO A;  4UVC A;  3QU3 A;  2P6T A;  5EEG A;  5DEQ A;  3EET A;  1LNW A;  1KU7 A;  3QP6 A;  5DYM A;  1P4X A;  4MEX F;  2QM3 A;  4ZZD A;  2GZW A;  2A6H F;  1H9T A;  2EV0 A;  5LEK A;  4GO1 A;  2MD5 A;  4UHT A;  1OYY A;  1QNT A;  2E7X A;  3WGH A;  3L7W A;  3MAJ A;  3J80 K;  1BI0 A;  1IN6 A;  3CLO A;  4EM2 A;  4A12 A;  4LK1 F;  4PCQ A;  2HS5 A;  1FYK A;  3WTW C;  4G6D A;  1B6A A;  2NYX A;  5LGU A;  3NEU A;  3ZMZ A;  2RNJ A;  2ZJ2 A;  4KN7 X;  2XUB A;  4LLN A;  1ZRE A;  4MEY F;  2O03 A;  5BS6 A;  3BWG A;  1I5Z A;  1H9G A;  3O3K A;  4P9F A;  1FT9 A;  4IHT A;  2D1V A;  2EFW A;  2OQG A;  1HSJ A;  2KIU A;  2HYF A;  1PP7 U;  3BP8 A;  2EFP A;  1YLF A;  5IT3 A;  1YW8 A;  2FRH A;  1IW7 F;  2JPB A;  4ZYD A;  1XGO A;  1U5T A;  1L3L A;  1FP1 D;  4HDU A;  4DQ2 A;  4LB5 A;  1J59 A;  4R79 A;  1FYM A;  2JT1 A;  1W5S A;  2XGX A;  1FX7 A;  2AS5 F;  3R0J A;  1UCR A;  2KRF A;  3VFZ A;  1HXD A;  2V1D A;  4PZJ A;  4IRG A;  4L9J A;  3K0L A;  4A5M A;  3MEX A;  2H09 A;  4U7D A;  1LDJ A;  2RDP A;  1BN5 A;  2ZO4 A;  4KIB A;  4OIN F;  4EGZ A;  3GXO A;  5ILS A;  5K5Q A;  3H92 A;  4I98 B;  2QYO A;  4UV9 A;  1OYW A;  2TDX A;  3BPV A;  3G73 A;  2P6S A;  5K5O A;  4JK1 X;  3SZP A;  1ZGJ A;  3I5U A;  2RKH A;  4OIO F;  2L4M A;  1BI1 A;  4F7Z A;  2V9V A;  1ON2 A;  3ZMT A;  3VEP A;  2GA2 A;  5E18 F;  1TNT A;  3REO A;  3U9G A;  1MDM B;  3E97 A;  1FNN A;  2YX4 A;  4S05 A;  4HDV A;  2G7H A;  2H6B A;  2M45 A;  3TDU C;  2VN2 A;  1RUO A;  3J81 Z;  4IXA A;  5E20 A;  2UXX A;  2KIM A;  2BBY A;  1PDN C;  2C6Y A;  2WC2 A;  2HTS A;  4L5J A;  2QVO A;  4FX4 A;  5AIQ A;  2VT2 A;  3LAP A;  1ZYR F;  1U6G A;  1KA8 A;  1MJA A;  1KU2 A;  3VB2 A;  3MFK A;  3ABU A;  5J6X A;  5LGT A;  1TQP A;  2DT5 A;  1XDU A;  3DF8 A;  5KK1 A;  2IPQ X;  1Z9C A;  2FML A;  1BJA A;  1S7O A;  2KJB A;  4BHC A;  3C18 A;  3BPX A;  1XN7 A;  4L18 B;  1V3F A;  1LB2 A;  2DLL A;  1IN8 A;  4EVI A;  3KP2 A;  3ZN1 A;  1QQI A;  2FNP A;  5JR3 A;  2O6G E;  4KN4 X;  1FLI A;  3GO5 A;  3JAM Z;  5A2Q Z;  2FE3 A;  4RS8 A;  3WOD F;  3LQQ A;  2DW4 A;  3E6B A;  2EA2 A;  2ETH A;  2ZME B;  3TDZ C;  2BYV E;  2RGV A;  2YPR A;  1OYI A;  1R22 A;  2PBI A;  3I59 B;  1JXS A;  4M9Z A;  2F5E A;  4A0Z A;  4YFN F;  3LST A;  3ELK A;  5CVI A;  2IW5 A;  2BGC A;  3TO7 A;  2M1B A;  4L5I A;  3KE2 A;  4NQW A;  3GFI A;  2HGC A;  2YX7 A;  2MA3 A;  2Y0M A;  2O0Y A;  2DTR A;  4OIQ F;  1R5H A;  1K6O A;  1Z7U A;  1S29 A;  4G7Z F;  3DEU A;  4OU0 A;  2H94 A;  3CUQ C;  4ON0 A;  5D6F A;  4ZYG A;  2H27 A;  5J8F A;  1VTN C;  2A61 A;  2L54 A;  2FEZ A;  1O7F A;  1QZZ A;  4I7H A;  5FD6 A;  1T38 A;  1FSE A;  2H6C A;  2VOO A;  1HKT A;  4RB3 C;  2W57 A;  1YTY A;  4P9U A;  1SD7 A;  4HQM A;  1HBX G;  4MQV A;  3WU1 B;  1W4M A;  3ECH A;  1BM9 A;  3HRM A;  4R8H A;  3RPQ A;  1K78 A;  4ETS A;  3K9T A;  4EQQ A;  3ABT A;  1R00 A;  3LA7 A;  3I54 A;  2R3S A;  1R23 A;  2J5O A;  4RB0 A;  5FFX A;  1J0R A;  4NHJ A;  1KU9 A;  1J5Y A;  1GVJ A;  3JTG A;  3O6B B;  3OV8 A;  4A6E A;  5D5V B;  2IRF G;  4G94 A;  5IT9 Z;  2B0L A;  1XGN A;  2EFN A;  3WTZ A;  1J9I A;  3V7S A;  4RB1 A;  3JAM K;  5A2Q K;  1IN4 A;  1ON1 A;  4Q48 A;  4IRI A;  1YFH A;  4EV0 A;  2DPD A;  1FSH A;  1YS7 A;  1G6N A;  3GZ5 A;  2BE5 F;  3COA C;  3TO9 A;  5KVR A;  3EYI A;  4WCG A;  1LEA A;  1R1V A;  3QP5 A;  4M73 A;  1ZLJ A;  4QLC U;  3GWZ A;  1HW1 A;  1FC3 A;  2L3D A;  3F8N A;  1U78 A;  4M72 A;  2DAO A;  4EM0 B;  4Q5S F;  2FA5 A;  5FO5 A;  2R7F A;  4KMU X;  3T0Y A;  1TNS A;  2M8E A;  1MZB A;  1ODD A;  1W5T A;  1U8R A;  4D0P A;  2IT0 A;  5HDN A;  4UVB A;  3FX3 A;  4M71 A;  1TTY A;  5D8L B;  1K7A A;  1V4R A;  4QWQ A;  5E1W A;  1QZY A;  2A6E F;  1DUX C;  2Y75 A;  4ESB A;  3RPU A;  1ZH5 A;  5ILU A;  4HF1 A;  2HZT A;  4HYE A;  2RC4 A;  2A07 F;  4LFU A;  2P5V A;  3HTS B;  3IC7 A;  4LJZ F;  2NNY A;  3TOB A;  2F5F A;  2IA0 A;  3L00 A;  1S7A A;  5TJJ A;  2QBY A;  2QLZ A;  2V1U A;  2E1C A;  3H3U A;  3ECO A;  3JW4 A;  3P7N A;  3CO6 C;  2QWW A;  3HIF A;  4AIH A;  1BI3 A;  4RGR A;  3GUD A;  1O3Q A;  3WGG A;  3WE3 A;  2MH2 A;  2HQR A;  3DV8 A;  4HF2 A;  1FY7 A;  2W25 A;  5FGM A;  1Z1D A;  1J7K A;  3FXR A;  3WTV C;  4HX4 A;  5BOX A;  1CGP A;  2FF4 A;  2QEN A;  5E1X A;  1QO0 D;  1T98 A;  2EV6 A;  1EH8 A;  3CUQ B;  4HA8 A;  3GFJ A;  5FD5 A;  1Z6R A;  4GYI A;  2FBK A;  5DCM A;  1PP8 F;  2VOD A;  1P2F A;  4H0E A;  5LRR A;  5J8C A;  4EJU A;  3HHG A;  3LAJ A;  1UFM A;  2A69 F;  1OKR A;  3F3X A;  1RZ4 A;  4RAZ A;  1IXR C;  2FMY A;  5JHU A;  2HQN A;  3JTH A;  4ZYE A;  1YW9 A;  2RQP A;  3I53 A;  1R5G A;  3PFI A;  1XGM A;  5DD4 A;  4KFC A;  1UB9 A;  1G3Y A;  2CQK A;  2STW A;  3BY6 A;  1W7P B;  3F6O A;  5FFZ A;  3R6S A;  3RYP A;  1ONV A;  3IHU A;  5EEH A;  5BPD A;  1HST A;  1AWC A;  3R0A A;  3KCC A;  2MBF A;  5LBQ A;  5LGN A;  4NB5 A;  3I64 A;  1IXC A;  4BH9 A;  4UUV A;  2F2E A;  4Z2Y A;  3RYR A;  2W24 A;  3RKY A;  2LSO A;  2CG4 A;  3BRO A;  4MTE A;  5HLH A;  1ZG5 A;  1UHW A;  1LDD A;  1IAW A;  1ZHF A;  2LNB A;  3IWZ A;  5HS7 A;  3ISP A;  4KYW A;  1S3J A;  5F1R A;  2CFX A;  3BDD A;  2QUF A;  1WQ2 A;  2ESH A;  3KLO A;  4LG0 B;  1G4D A;  3RKW A;  1KGS A;  3I58 A;  1A04 A;  5FB2 A;  4I02 A;  4YFK F;  1R36 A;  4S04 A;  2PI0 A;  2WTE A;  2DK8 A;  2Z5U A;  5JFR A;  4LGW A;  1D5V A;  4PGG A;  2J5P A;  2K4J A;  2EK5 A;  5ICC A;  2W84 A;  2XIG A;  2XAH A;  3IKV A;  5CJ9 A;  3L2C A;  2XAS A;  4EJO A;  5HDK A;  1T2K A;  3BJO A;  1SMT A;  2FU4 A;  4L9V A;  3BJ6 A;  2Q8K A;  1DP7 P;  1XMK A;  3K1N A;  1XMA A;  3JSP A;  1X3U A;  1BIA A;  4IF4 A;  1KQ0 A;  2MH9 A;  4E70 A;  4WWC A;  3FMR A;  4U0W A;  3T1B A;  1L0O C;  4XSZ F;  2JSC A;  4ENM A;  1P6R A;  4IPA A;  3AAF A;  5BPI A;  3ZMU A; 
#chains in the Genus database with same CATH topology
 2JVG A;  2NS0 A;  1E2X A;  1R5I D;  1WH7 A;  1TW3 A;  2QF7 A;  2DA2 A;  5D4R A;  2QEX I;  5D4S A;  1JHF A;  3LSM A;  1IN5 A;  3AFH A;  4TV7 A;  2ZXW H;  3B02 A;  3FMS A;  4I2O A;  1T6S A;  2H8R A;  3K4K A;  4HZF A;  3ULQ B;  1TBX A;  3HB9 A;  3VOD A;  2W48 A;  1XGS A;  3R4K A;  1HC8 A;  1E3P A;  2M0C A;  5HLI A;  3UR3 C;  2HQ5 A;  1PUE E;  2COB A;  1EV7 A;  2AQE A;  3FIW A;  3BZ6 A;  2PLY A;  1T33 A;  4RMN A;  1R49 A;  4QPO A;  1YX5 A;  2STT A;  4HF0 A;  1CF7 B;  2CYY A;  4L0Y B;  4N4N B;  4HX8 A;  2P7C B;  3HPH A;  4XLA A;  2GA1 A;  1FBS A;  2V79 A;  4XRM A;  2LKX A;  3HM5 A;  3ZQF A;  2JK3 A;  2KKO A;  4ZDL A;  5J4Y A;  1LDK B;  2F5C A;  3V7C A;  4CCM A;  4EMS A;  1NK2 P;  3FK6 A;  5HVQ C;  4JX6 A;  2DJI A;  4RLQ A;  5H20 A;  4GFB A;  4W97 A;  4DBR A;  4ZDP A;  3OS0 A;  4IRH A;  2A5W A;  2IA2 A;  5B1B H;  1I6H J;  2BY3 A;  4BBS J;  3E5X A;  4RGX A;  1HDD C;  1RNL A;  1ZAO A;  4NC8 A;  1T56 A;  2LR8 A;  3FMQ A;  4Y13 A;  1AKH B;  1WCM J;  1MH4 A;  3K69 A;  2GLO A;  1G59 A;  2OAZ A;  2ME6 A;  1SC7 A;  3WTS C;  3ABK H;  3OYB A;  1PUF B;  4YFX F;  5CVV A;  3DBR B;  2RVC A;  1M1E B;  2CSO A;  5ICG A;  2HFH A;  1SD6 A;  4GXO A;  3OYF A;  3GF2 A;  4M3G A;  5F0H A;  2E1M B;  2F4M B;  2PJR B;  4U88 A;  4YIF A;  3V7R A;  3BLY A;  1ZG1 A;  2OF7 A;  1ETO A;  2VE9 A;  3T5X A;  1JKP C;  3EQL F;  1IGN A;  4C2U A;  2PEX A;  2FSW A;  1ACI A;  5DM7 F;  2OCE A;  3SFZ A;  5J1R A;  3GTK J;  4HV6 A;  2O61 A;  1MJB A;  3HUG B;  4XIC A;  4WF2 A;  2K86 A;  2ELJ A;  4BKX A;  1AA7 A;  2JRM A;  2DA3 A;  1WSU A;  4P96 A;  1U5T C;  2V9P A;  4E7S A;  2P7V B;  2CWE A;  3KEO A;  3QYB A;  4A6D A;  2LY2 A;  1B59 A;  2K9L A;  4XOP A;  2ZBK A;  3DFG A;  5CVU A;  4KIF A;  3VYR B;  5M5X J;  2DFI A;  1HA8 A;  2GQQ A;  1G3T A;  3N05 A;  4HNV A;  3TL4 X;  5BMZ A;  2IA1 A;  3F23 A;  3KEQ A;  3KP5 A;  4IQ4 A;  4Y15 A;  2PJP A;  4IL6 C;  2QKL B;  2F5D A;  5EG0 A;  3GZ6 A;  2E2H J;  1Q1V A;  4MGR A;  2V7F A;  3K4L A;  1Z3X A;  4ESF A;  5D5W B;  3CC4 I;  2GIZ A;  3RZO J;  3C7J A;  2VE8 A;  5K7F A;  1WGX A;  2FXA A;  1MH3 A;  4IZZ A;  4M3E A;  2E2I J;  2WB1 N;  4IHX A;  4FAS D;  3QOP A;  1MDM A;  1A6I A;  1WI9 A;  1X1P A;  3FXL A;  1F43 A;  3CJN A;  2XGE A;  2D5V A;  2HI3 A;  3E5Q A;  2HOE A;  4JX4 A;  3OYJ A;  1LEB A;  2GIV A;  1PYV A;  3CUO A;  3CCV I;  4E7J A;  4OIP F;  3G1O A;  3HOY J;  2EH3 A;  4JQF A;  1KYW A;  4O5V A;  2YS9 A;  1ZRD A;  3HTU A;  5E79 C;  5F27 A;  1WJ5 A;  4FIS A;  3SDB A;  2B9S A;  2M3A A;  3RDI A;  2MLK A;  4HBL A;  2DMT A;  2PMH A;  2VBY A;  1I39 A;  2VC1 A;  2F48 A;  1P4W A;  1VQ7 I;  3OIO A;  1TZL A;  4CZZ A;  5EJC A;  1QGP A;  4IO9 F;  4Z6Y A;  2OU2 A;  1ULY A;  1DP3 A;  1BOA A;  4XBF A;  2IBD A;  3F8C A;  3GYH X;  1J75 A;  4XR6 A;  1FTZ A;  4A3K J;  2KQR A;  2O8X A;  3A1Y A;  1OFC X;  1TT0 A;  4M6Y A;  2FD5 A;  1GV2 A;  1MNM C;  3C2G A;  1WI3 A;  4BNC A;  5ICF A;  3LFK A;  3TGN A;  4AD9 A;  5IP7 J;  2KZV A;  4AVP A;  1HCR A;  1B8I B;  2HWV A;  5FKO A;  2GWR A;  2H8W A;  2MSY A;  3H0G J;  2MGQ A;  4I0B A;  5K1Y A;  3F21 A;  3TOA A;  3HG9 A;  5C44 J;  1R1T A;  2DFF A;  1FP2 A;  3CME I;  1STZ A;  3MKY B;  2YR2 A;  1FWZ A;  3F8B A;  1MMD A;  3J7A Y;  1VQ4 I;  3WTT C;  2OA4 A;  1VQ8 I;  4XLP F;  2E35 A;  3T8R A;  4BL0 B;  3E7L A;  2A3S A;  4G7O F;  3RCO A;  3QYF A;  4A5N A;  4KUM A;  1B9M A;  2ISY A;  2P4W A;  3SZT A;  2E7W A;  1QPM A;  3OS2 A;  2QQA A;  3FM3 A;  1IRG A;  1AKH A;  2L9V A;  4E6K G;  1H0M A;  3PUF A;  2R4G A;  4G6T B;  2PFB A;  1S9H A;  3BR2 A;  4WX9 A;  3J7Z I;  3HGG A;  1XCB A;  2AXL A;  2NVU B;  3D5L A;  3P9C A;  4RAY A;  3WGI A;  4OMZ A;  1GVD A;  2CMP A;  5KAI C;  2RV8 A;  3ZMS A;  2JZY A;  3BQY A;  4CXF A;  2COM A;  1TT5 B;  2JN6 A;  3HOS A;  3BZK A;  2LFB A;  2OD5 A;  2ZME A;  3S1M J;  3RI4 A;  3I56 I;  2XKP A;  5TIS C;  2LMD A;  2KRC A;  3VOE A;  3I59 A;  2P5L C;  4EJT A;  3N97 A;  1H8A C;  2IS1 A;  3I4P A;  4LMY A;  4P5O A;  1YO5 C;  2HYG D;  4RAF A;  1SD4 A;  3JRC A;  3OYE A;  3FWE A;  4DYC A;  2X1C A;  2ELH A;  4IVN A;  3JSO A;  2Z9O A;  2DDA A;  3BR6 A;  1MBJ A;  3CJR B;  5LHG A;  2KP6 A;  1JGG A;  4RB2 C;  4YEL A;  1Y0N A;  2EJR A;  3MZH A;  5F6F A;  4IQJ A;  4B1R A;  5DV5 A;  2UZK A;  4HOB A;  2XAF A;  1JTX A;  4XL9 A;  3DPL C;  3S8P A;  3JRI A;  1ZLK A;  1YW7 A;  3BG3 A;  5CQE A;  1YG2 A;  3M9A A;  3TW7 A;  2Y9Y A;  2LDU A;  4PK4 A;  4CIC A;  1LE8 B;  1LQ1 A;  1SAN A;  4MNU A;  4LLG F;  2ISZ A;  1XB4 A;  4HSR A;  2Z99 A;  4HST A;  4DNC A;  2JTV A;  1TL8 A;  3FXM A;  2EIM H;  3CCS I;  1EF4 A;  3D5R C;  2HZD A;  3IRR A;  2DT6 A;  1Z77 A;  1AOY A;  1QPI A;  2HKX A;  3ABM H;  4U0Y A;  4G9Y A;  4CDG A;  1UZC A;  4BHP A;  3KET A;  5E17 F;  3KZZ A;  3R60 A;  2K3F A;  2BV6 A;  4NDL A;  5DD8 A;  4A3J J;  3TED A;  1DPU A;  4I0A A;  3LSG A;  1DPR A;  2P0W A;  1DU6 A;  4X1E A;  3HRU A;  4A2U A;  4FHT A;  3O2P E;  1JGS A;  3LA2 A;  1QU3 A;  2HU9 A;  1TLH B;  4BY1 J;  4CGZ A;  2ZC2 A;  4PJL A;  2ID6 A;  3DKW A;  2JRT A;  2VKD A;  2KJC A;  3U2R A;  2Z33 A;  3FBN B;  1P4A A;  3JRA A;  4IOC F;  3S1Q J;  3I0T A;  3AG2 H;  3IL2 A;  4N9I A;  5M3F J;  5C4J J;  2G0E A;  4ITV A;  1OQY A;  2XAU A;  3IUO A;  3NWS A;  1JT6 A;  1W36 D;  1RR7 A;  5F0F A;  1FPQ A;  4KMF A;  3DQV C;  3T8T A;  4RDU A;  1QA6 A;  5HS8 A;  3UKG A;  3LQR A;  2VC0 A;  4HNU A;  4L9T A;  2OZU A;  1D3Y A;  3EUH A;  5BQT A;  4WXD A;  1JKR C;  2A68 F;  1FJL A;  3CO7 C;  3KP6 A;  4BAC A;  5DUI A;  1SD5 A;  3K10 A;  4O3M A;  4A3M J;  1UG0 A;  1ERD A;  1Z91 A;  1ZR2 A;  4QPQ A;  4KT5 C;  5LLQ A;  2P81 A;  3V42 A;  2Y9Z A;  1XCV A;  2M9H A;  2E71 A;  4Y4R A;  2V26 A;  3W2A A;  1SMY F;  2LC2 A;  3FXO A;  1IN7 A;  5BNG A;  2PX9 A;  3B73 A;  1LPQ A;  3OL3 A;  2ZFW A;  2XKO A;  1U5T B;  2DMP A;  4HLY A;  3WG7 H;  4II3 A;  2VT3 A;  3LA3 A;  3WU0 A;  1JE8 A;  1FZP B;  3FXQ A;  4ZJZ A;  3M8E A;  2WV0 A;  1SAU A;  2QQ8 A;  2DYR H;  1O3T A;  1FBU A;  5AON A;  5FLX K;  4LIV A;  1BR1 A;  2XHK A;  5J3L A;  1O57 A;  3EYY A;  4CCO A;  3PO2 J;  1BC7 C;  4IHY A;  5IOY A;  2VKH A;  1KZH A;  2DU9 A;  3BT9 A;  2RRE A;  1YHQ I;  2IAI A;  4B09 A;  3PUB A;  5B5E C;  2K5C A;  1IZ1 A;  3NWT A;  3P9K A;  2I5U A;  4N0B A;  1U2W A;  3V4G A;  4MTD A;  1T8I A;  3DBH B;  2WV1 A;  1TW2 A;  2K7L A;  4M9S A;  5GP9 A;  3TMO A;  5LHI A;  4QTR A;  2VXZ A;  3SYT A;  4I76 A;  1VQM I;  2OZ6 A;  2K02 A;  2H1L A;  3WHC A;  3FDY A;  2ZXH A;  3DP7 A;  4KT6 A;  4HQE A;  2KRH A;  4ZYH A;  3OL4 A;  3V8K A;  4DYR A;  1HKQ A;  2D1H A;  3CDL A;  2CFO A;  3FM5 A;  3SXY A;  2CW0 F;  3WTU C;  4ENJ A;  2YSR A;  4GCV A;  2EBI A;  2RNG A;  1IC8 A;  2XAJ A;  3RTR A;  3F8M A;  3DCF A;  1R58 A;  1BR4 A;  5J40 A;  4U0V A;  2M5W A;  2FJ1 A;  4XM3 A;  2L02 A;  1LJ9 A;  2AO9 A;  4PSX A;  3ZMV A;  4RGS A;  2VBZ A;  2Z16 A;  2KLO A;  2W85 A;  3DKX A;  3K4J A;  1D1A A;  4JBA A;  3L2Q A;  2DMU A;  2FBH A;  3W6K B;  2Q0O A;  4L9N A;  2X4H A;  3A02 A;  5DS9 A;  1T95 A;  3EPZ A;  3HRS A;  4YRV A;  3M7G A;  4O6J A;  5FKN A;  4JX5 A;  2R5Y B;  3BG6 A;  4ASN A;  3PL8 A;  3TQN A;  2QGU A;  3DKY A;  1FIP A;  1F1Z A;  2OPT A;  2HEO A;  2Y0S A;  3GVA A;  2FOK A;  1U0J A;  5FKM A;  3OR1 C;  1FOY A;  4HLX A;  3ZGK A;  1D8K A;  5IP9 J;  3RQI A;  5JLX A;  2XSJ C;  1IXS B;  2CRG A;  4XLH A;  1OPC A;  4FE7 A;  2EPF A;  4P55 A;  2VOP A;  3BG9 A;  1MGT A;  4HV5 A;  4HX7 A;  3ZN0 A;  1H88 C;  2R7X A;  1N77 A;  1OCO H;  2XDV A;  3L09 A;  1D8J A;  3IWF A;  1S7E A;  3KZY A;  4EJV A;  4I09 A;  2XF6 A;  2HTJ A;  3BTC A;  1REP C;  2IJL A;  3PO3 J;  2IP2 A;  3F22 A;  1WJC A;  3CMM A;  1G3W A;  1YE9 A;  1GLN A;  3I3L A;  1X19 A;  3A01 B;  4GGG A;  2LF7 A;  4CA0 A;  2P5K A;  4DJA A;  4WK8 F;  3N4M A;  4IHS A;  1I1G A;  2JA8 J;  1TQI A;  1DDN A;  3A2K A;  2VKE A;  3PQK A;  3K4N A;  1GXP A;  2DQL A;  4II2 A;  1KYZ A;  1ORK A;  4CYC B;  2ELK A;  4IHW A;  3GW2 A;  1LVK A;  4Y33 A;  3TBI A;  1HQC A;  3ZQG A;  1WZ2 A;  4PDK A;  2XB5 A;  3FZV A;  2G9W A;  1I6X A;  1ZN2 A;  4UB8 C;  5EZG A;  5DM6 F;  1MBK A;  1B9N A;  2XAQ A;  3M1E A;  3PFY A;  5EGO B;  1VI0 A;  5HOO A;  1MJ9 A;  1TP4 A;  3JCU C;  2CUE A;  2DOF A;  3ZR8 X;  1BL0 A;  1Y0U A;  3KP7 A;  1R9T J;  3CZ6 A;  4YII A;  3M4O J;  3F72 A;  1OIS A;  2E34 A;  3Q9V A;  4CCN A;  2OCC H;  2LK2 A;  4ENN A;  3HSR A;  3LSK A;  2BEO A;  4WXH A;  2ZXJ A;  3WG9 A;  4LB6 B;  1MMN A;  2LOO A;  2DYS H;  1BIB A;  1ETY A;  4UUT A;  1HDP A;  3RKX A;  3K70 C;  2CO5 A;  2BOL A;  3ERE D;  3KX2 A;  1XSD A;  1O3S A;  1F4K A;  1IRF A;  1TWH J;  5D5X B;  2HR3 A;  2Y2Z A;  1B72 B;  1BW5 A;  2DPU A;  1HW5 A;  3E5U A;  1D1C A;  1ZGA A;  1W5C C;  2BXZ A;  2KIF A;  3OYG A;  1HLV A;  3S17 J;  3CUQ A;  4IHV A;  3I4N J;  2KDO A;  3D0S A;  3HOX J;  4F52 A;  2R7U A;  4V2G A;  3HPG A;  1SFK A;  1ZR4 A;  5C3E J;  2LG4 A;  3VYT B;  2E1O A;  4PUS A;  3K1P A;  2M34 A;  3K1M A;  1X1A A;  2EWN A;  1GHC A;  2JMW A;  2E5N A;  2ADU A;  1RUN A;  2D2W A;  4UXN A;  5D8K B;  4KA4 A;  4ZTJ A;  1YJ9 I;  1O3R A;  1R7J A;  4NQW B;  3FF5 A;  3E6M A;  1ZRC A;  1Y8R B;  1S6L A;  1JKO C;  1UAA A;  3ML6 A;  3OS1 A;  2IS4 A;  4KNY A;  2PG4 A;  3FHN A;  3V8L A;  2PMZ A;  3DTK A;  2R7D A;  2DO7 A;  3IH3 A;  1SAX A;  4ZYA A;  1JHH A;  3JRF A;  3G3Z A;  1SVM A;  4BAY A;  2VQL A;  2JUC A;  2CUZ A;  2XRO A;  3J7A O;  2DCE A;  3ZPL A;  3ROU A;  2NNN A;  3KLN A;  2R5Z A;  3ASO H;  4AUX A;  1EH6 A;  2LRD A;  2R93 J;  4IX7 A;  4HEA 2;  1SFX A;  2NRA C;  3A4C A;  2X9D A;  3LOC A;  5E1Z B;  4ESJ A;  1YJW I;  3SQN A;  2V4J C;  4AC0 A;  2AQF A;  2JUG A;  3K2Z A;  5DTD A;  3F8F A;  2IS6 A;  1MMA A;  3ZQ7 A;  3HKZ A;  1TQM A;  2D45 A;  3OYL A;  1W7P A;  2R7R A;  3W6J B;  2OTL I;  1KQ8 A;  3RJP A;  2Y0S N;  3GZN B;  2EA4 A;  3K4M A;  1RKW A;  3LWF A;  1FMV A;  4KIG A;  5H6Q A;  4BYY A;  2LY1 A;  2A05 A;  2V6C A;  3I71 A;  3SJM A;  2QCO A;  4OOI A;  2OBP A;  4E7I A;  4EGY A;  1KU3 A;  5IP6 A;  3G6E I;  1QHG A;  4LIU A;  3DEW A;  5HLG A;  2P8T A;  2XAG A;  4RGU A;  5ERI A;  1Q1H A;  1ZG3 A;  2K27 A;  1RIO H;  5CVR A;  3CCR I;  2X6W A;  5L3E A;  3U1K A;  4Y17 A;  1N75 A;  3WTY C;  2Y48 A;  2L9N A;  1U8B A;  3ONQ A;  2XC7 A;  1K78 B;  1N78 A;  2Q2E A;  2G7U A;  2L0K A;  3CDH A;  4OWR B;  2RN7 A;  3DPT A;  1D5Y A;  3ZP5 A;  3L2V A;  4BGD A;  3KP3 A;  4AIK A;  2IS2 A;  1MW7 A;  2ESN A;  5KHD A;  2EFO A;  4A0Y A;  3FHZ A;  2QQ9 A;  2ICW G;  3W3C A;  4BBR J;  1VZ0 A;  3MWM A;  1CQT A;  4AVZ A;  2BY0 A;  3E3V A;  5CLS A;  4M9X A;  3OOP A;  4FT8 A;  4MHG A;  1EH7 A;  4M74 A;  3KIO A;  1G3S A;  2TRT A;  4PGH A;  4OIR F;  3WHB A;  4CYC A;  2QSF X;  5HDG A;  4EAT A;  1WRJ A;  1TWF J;  3PIO F;  2ZCW A;  4V2F A;  5CVJ A;  3CCQ I;  1BC8 C;  4BQA A;  3CCJ I;  3H9G A;  3NQO A;  1XSX A;  5E8G A;  2QA4 I;  4BY7 J;  1T0F A;  2HKO A;  2L9R A;  3GLL A;  2JJ7 A;  5F04 A;  1HF0 A;  4A0X A;  5GPC A;  4ENK A;  3S2H J;  4KDP A;  3L1P A;  4LG0 A;  2OJE D;  2EZH A;  4W1U A;  2JSP A;  5IYC J;  4FX0 A;  4UB6 C;  5K5R A;  1I3Q J;  1WWX A;  2BHZ A;  4EM1 A;  3M8F A;  3HSF A;  3QPS A;  4L5E A;  1J2X A;  3H5A A;  3FXU A;  3GEZ A;  5F08 A;  1HW2 A;  4WXC A;  2M87 A;  2XVC A;  5EYR A;  3BG7 A;  1USS A;  2V6E A;  4V19 K;  2DA7 A;  1YI2 I;  3CES A;  4A3D J;  3BJA A;  4G7H F;  2HYJ A;  4B44 A;  2VIX A;  3DXJ F;  1QVT A;  5KCM A;  1RES A;  5L3B A;  3OYM A;  1SFU A;  1LFU P;  2EIK H;  2EIJ H;  5F64 A;  2CQ7 A;  1FOW A;  4XKV A;  1W0U A;  2HDC A;  4G6Q A;  2R0Q C;  1UEL B;  5J47 A;  1B72 A;  2L5Q A;  4LLL A;  2VPR A;  2XV4 S;  2DK5 A;  3EUK L;  4U7B A;  3TO6 A;  3RZD J;  3CTA A;  3CMY A;  5TRD A;  2FBI A;  3SFI A;  5DCF A;  5AIP A;  1VQ5 I;  1X1D A;  2EZI A;  3MZY A;  4XON A;  2MC4 A;  2VBW A;  3Q3S A;  3ZMD A;  3L9F A;  3BC8 A;  4BE0 A;  1NHA A;  3D1N I;  5GPA A;  1IUF A;  3QAH A;  1TWG J;  1O7L A;  4P1W A;  2ZKZ A;  2PMZ N;  2LKP A;  1E17 A;  3GFL A;  1T39 A;  4XKB A;  3JRB A;  4DW6 A;  3E1S A;  2LTP A;  2XF7 A;  1FYL A;  1XMX A;  4K2E A;  4EJW A;  1W7P D;  3QPH A;  1Z6T A;  5LRS A;  2PQ8 A;  1DU0 A;  3MCZ A;  3J81 K;  3MKW B;  5D5U B;  1R1U A;  3OOU A;  1Z0X A;  4BHB A;  1WJD A;  2IVM A;  4RA2 A;  3OY9 A;  1VQ9 I;  1F9N A;  1MMG A;  1X58 A;  2IGK A;  3HXL A;  1ZQ3 P;  4GDF A;  4CO8 A;  3HKZ N;  2BW3 B;  5M5W J;  4GRI A;  3WE2 A;  4BJT A;  3GX4 X;  3SHF A;  4I99 C;  5LHH A;  1XD7 A;  3PQJ A;  3U21 A;  1ZAR A;  4MLO A;  4MQ9 F;  5H6R A;  3KYL A;  1FOX A;  1NG6 A;  5CYV A;  3OIQ A;  3QPT A;  2BHY A;  3QU6 A;  4M6X A;  5K7H A;  1BI2 A;  2VBX A;  1B4A A;  1IDY A;  1XX5 A;  1W1W E;  2FOW A;  1U3E M;  1OCC H;  5J1U A;  1LVA A;  2O3F A;  5H2F C;  2ZSI B;  3HYI A;  4FE4 A;  3U1D A;  3UNG C;  1WKM A;  3H36 A;  3P9I A;  1F5T A;  1GV5 A;  5E3L A;  1PVE A;  2HVS A;  4XRF A;  1K79 A;  4U87 A;  2JA6 J;  1YJN I;  2HXI A;  3KFW X;  1SFO J;  1IV8 A;  2XF5 A;  1CF7 A;  2QBY B;  3HRT A;  3NRV A;  2VI6 A;  4AWX B;  2R7W A;  2LRE A;  2WWY A;  1W0T A;  3I4M J;  5L3D A;  2K9S A;  1NG7 A;  2BXY A;  4Q47 A;  3PNT A;  1JT0 A;  4JP0 A;  2KHM A;  1FBQ A;  3Q9S A;  3E6D A;  4PJ0 C;  1K83 J;  1OMI A;  1Y1V J;  2Z3Y A;  2VON A;  4FTH A;  1QBJ A;  1Z05 A;  2AXT C;  3LSP A;  2VQG A;  4C3I J;  3OWT A;  1YS6 A;  2DBB A;  2FQ3 A;  4OAZ A;  4C30 A;  2K4B A;  5ILV A;  2MD0 A;  2DOE A;  2A5Y B;  2CU7 A;  2MYS A;  3BR5 A;  4IEJ A;  4DYQ A;  5KAF C;  1S8N A;  4GYG A;  3QQA A;  3B6A A;  3AKZ A;  1YYV A;  1PUF A;  4HW0 A;  1HKS A;  4UNO A;  1GXQ A;  5FLX Z;  2BZT A;  5IYD J;  2L01 A;  4HAM A;  4F92 B;  1ZEL A;  5B66 C;  4XRS G;  1YIT I;  4XRS A;  3MQ0 A;  2PJR A;  4BUP A;  2DI3 A;  3C3W A;  4A3C J;  2Y69 H;  2KPM A;  2QZ8 A;  1I1S A;  2HPM A;  2ZNY A;  1C0W A;  3KP4 A;  1RR8 C;  2ZFU A;  5DCM B;  3VYU B;  3BZC A;  2M30 A;  5M3M J;  3GTG J;  1POG A;  5HS9 A;  1UHS A;  3GCM A;  5E8I A;  3WTX C;  3HOW J;  2L4A A;  2XPU A;  1BA5 A;  4XN0 A;  3HUG A;  2CQX A;  4Q4Z F;  4AIJ A;  3GTJ J;  4XLN F;  5FKL A;  1MD0 A;  2X0L A;  3MN2 A;  4LD5 A;  2DMQ A;  2UWM A;  3W2W A;  3IKT A;  4I6Z A;  4B47 A;  5FRM A;  1IF1 A;  4XOR A;  4CYD A;  3GLX A;  1WVR A;  1X2M A;  2DFH A;  3GTL J;  4N9H A;  3RIR A;  1B1B A;  2MLG A;  3ZQC A;  1P92 A;  1JUM A;  2DDB A;  2LD5 A;  3HEF A;  4UVA A;  4YG2 F;  4RBO A;  3H3Z A;  2O9L A;  1I27 A;  4BXU A;  1XDS A;  3H35 A;  4UV8 A;  5EF6 A;  3QRF F;  1SFE A;  1KQ9 A;  2XPV A;  1OR7 A;  1G8X A;  3TKY A;  1RI7 A;  3O8H A;  3I9V 2;  4E7L A;  4I01 A;  2GXB A;  3DEE A;  5EZH A;  2YU3 A;  4R1H A;  2O5R A;  2HOS A;  3J80 Z;  5ED4 A;  1XSV A;  1A5J A;  2GAU A;  4NC6 A;  2GXG A;  3TP3 A;  1R4N B;  2QQB A;  2JPC A;  3R61 A;  2ZXI A;  2X6Y A;  1MKM A;  2VAS A;  4HNT A;  1D0X A;  3JR9 A;  3Q5F A;  4KIT B;  1UG2 A;  2DQR A;  4CHU A;  3IRQ A;  1IJW C;  3C1D A;  2NS7 A;  4B8X A;  3O8G A;  3H1C A;  4MFD A;  4ZZL A;  5L3G A;  3HOT A;  2ZJP F;  3V8J A;  4C2M J;  1UST A;  1TWA J;  5C4X J;  2CGP A;  3S15 J;  3WU2 C;  2H1K A;  2EFQ A;  2UXN A;  2XRN A;  2EQR A;  2LF8 A;  2HPI A;  1FOK A;  2K9M A;  5DDG A;  2NAZ A;  2DXI A;  1JUP A;  3HSE A;  4IJA A;  1V54 H;  3BOQ A;  3GTP J;  4LK0 F;  3H9J A;  4UUS B;  3F6V A;  1OJL A;  2KDZ A;  1BBY A;  1UHM A;  2CS3 A;  4ZH4 F;  2DOA A;  3CF2 A;  2R7Q A;  4G8X A;  2MC3 A;  1FTT A;  1E3O C;  2XRL A;  1YQA A;  2V1X A;  3S2D J;  3GFM A;  1B8I A;  2XPW A;  5JI6 A;  2EB7 A;  5L3F A;  2LBF B;  2L7F P;  4XLF A;  5IPA A;  3S1N J;  2ZNZ A;  2YU9 J;  2E1N A;  2VKV A;  2FNA A;  2PN6 A;  2OQR A;  5ICE A;  4KIC A;  3HHH A;  1ZRF A;  6PAX A;  2UUZ A;  5IT9 K;  3S2W A;  2PMU A;  2X6O A;  5JVT A;  1VQO I;  5D6E A;  5JHF A;  3ZQQ A;  4HG2 A;  5IY5 H;  1X3Z B;  4L0Z B;  2EV5 A;  5F0C A;  4PFP A;  5DUK A;  2ACJ A;  3EDP A;  5L3C A;  4NNJ A;  2KL4 A;  1YRN B;  3E6C C;  4BS9 A;  1IUY A;  5LEJ A;  4ZC3 A;  4XSX F;  3VWB A;  4OMY A;  2W7N A;  1YIO A;  4UVC A;  3CC7 I;  1UJ8 A;  3QU3 A;  2P6T A;  4X0G A;  2CW7 A;  5EEG A;  1BJZ A;  5DEQ A;  3EET A;  1ETX A;  1W36 C;  2IXS A;  3TW6 A;  1LNW A;  1KU7 A;  2EIL H;  3QP6 A;  5DYM A;  3HGY A;  2DT7 B;  3VYS B;  4NC7 A;  1P4X A;  4MEX F;  2QM3 A;  2VPL A;  2ZB9 A;  4F3Q A;  4ZZD A;  2E60 A;  3RKQ A;  2GZW A;  1OCR H;  2A6H F;  1H9T A;  2EV0 A;  3VDX A;  5LEK A;  4GO1 A;  2KFD A;  1SEU A;  3HJE A;  2F4I A;  2MD5 A;  3QWL A;  1QVU A;  4UHT A;  3SZG A;  1OYY A;  1QNT A;  1LFP A;  2E7X A;  3WGH A;  3L7W A;  3MAJ A;  1FMW A;  3J80 K;  3LMM A;  1BI0 A;  1IN6 A;  3CLO A;  4EM2 A;  2WY8 Q;  4A12 A;  4LK1 F;  4PCQ A;  2VJI A;  2E36 A;  1K6Y A;  2HS5 A;  3ZRG A;  2W4S A;  1FYK A;  3WTW C;  1LE8 A;  4G6D A;  1A6Q A;  1B6A A;  2NYX A;  3BQZ A;  2IGO A;  5LGU A;  1IV6 A;  2ZME C;  3BTJ A;  4A3G J;  3NEU A;  3ZMZ A;  1K4T A;  1KON A;  4E7Z A;  4KIS A;  1MSE C;  2RNJ A;  2ZJ2 A;  3Q0W A;  4KN7 X;  1MBF A;  2XUB A;  4LLN A;  1ZRE A;  3K7A J;  2BY1 A;  2NS8 A;  4XN3 A;  3SEQ A;  3CCM I;  3D5S C;  3FBI B;  2RQQ A;  1H89 C;  1E0E A;  2MAB A;  1LUJ B;  4J01 A;  4MEY F;  2GOM A;  2O03 A;  5BS6 A;  3BWG A;  1VQN I;  1I5Z A;  3OIP A;  1H9G A;  3O3K A;  4P9F A;  1FT9 A;  4NUB A;  2R92 J;  4IHT A;  4AID A;  3MMY B;  3IV5 A;  4A3E J;  4CUG A;  1MIJ A;  4PJJ A;  3DLL F;  2D1V A;  2EFW A;  1NTC A;  2OQG A;  4CH7 A;  1HSJ A;  1SVO A;  2KIU A;  5GTI C;  2HYF A;  2JWT A;  4HRI A;  1VQL I;  3MKZ A;  2NXN B;  3BP8 A;  1PP7 U;  2EFP A;  5EDN A;  1YLF A;  1Y8Q B;  3K6G A;  1WPK A;  2NOG A;  4X6A J;  5IT3 A;  1YW8 A;  2FRH A;  4CCJ A;  1IW7 F;  2TCT A;  2JPB A;  2X48 A;  4ZYD A;  5E3N A;  3JRE A;  3LNQ A;  1Y6I A;  1IG7 A;  1JUS A;  1YOV B;  1XGO A;  2W00 A;  3ABL H;  2R7Z J;  4H4K C;  1G2H A;  1FIA A;  1U5T A;  2BY2 A;  1L3L A;  1FP1 D;  2JVH A;  3S93 A;  2WY7 Q;  4HDU A;  3BTI A;  3OR2 C;  4F93 B;  3GTO J;  4DQ2 A;  4LB5 A;  5B1A H;  4J00 A;  3MKL A;  4B48 A;  4IKF A;  1J59 A;  3DTE A;  1ZTR A;  5FLV A;  4R79 A;  4HPQ A;  1FYM A;  4AU7 A;  1JKQ C;  2JT1 A;  1W5S A;  2XGX A;  1FX7 A;  2AS5 F;  3R0J A;  1UCR A;  2KRF A;  3VFZ A;  2JQ7 A;  1HXD A;  2V1D A;  2R7O A;  3EUH C;  4PZJ A;  4IRG A;  5E3O A;  4L9J A;  3K0L A;  4A5M A;  3MEX A;  2KIS A;  2H09 A;  4U7D A;  2OTJ I;  1LDJ A;  2RDP A;  4QIW N;  1BN5 A;  2ZO4 A;  4KIB A;  4OIN F;  1AHD P;  3GXO A;  2ME0 A;  5ILS A;  5K5Q A;  4EGZ A;  3H92 A;  2I10 A;  4I98 B;  2QYO A;  4UV9 A;  1OYW A;  3E0J B;  3S3N A;  2TDX A;  2WAQ A;  1R6R A;  2M7A A;  3H3V K;  2WAE A;  3BPV A;  1YX3 A;  3K2A A;  3QYE A;  4QSH A;  2X6X A;  3G73 A;  2P6S A;  5LFA A;  4B3A A;  5K5O A;  1VND A;  4JK1 X;  3SZP A;  3CLQ A;  1GT0 C;  3SDG A;  1JJ6 C;  1OCT C;  1ZGJ A;  3I5U A;  4BU2 A;  4UY8 I;  2RKH A;  4YIR X;  4OIO F;  2IEK A;  2L4M A;  4BXF A;  3FK7 A;  1BI1 A;  3S3M A;  3FXK A;  4NBQ A;  4F7Z A;  3BR3 A;  2V9V A;  5EG0 B;  1ON2 A;  3NAU A;  1ITY A;  4BEH B;  4M3D A;  2CJJ A;  2VLA A;  3ZMT A;  3VEP A;  4RM2 A;  2Y31 A;  3S3O A;  2GA2 A;  3M1C A;  1PJR A;  5E18 F;  1DGW Y;  1TNT A;  3KPH A;  3REO A;  3U9G A;  1MDM B;  3E97 A;  1FNN A;  3LL7 A;  2B7E A;  2YX4 A;  4S05 A;  4HDV A;  3OYA A;  2NVT J;  2G7H A;  1A36 A;  5E3M A;  3DBL B;  2R5Y A;  1U9N A;  2H6B A;  2M45 A;  3KYC B;  3TDU C;  3AG3 H;  2RAE A;  2V1N A;  4M6V A;  2VN2 A;  1RUO A;  3Q0U A;  3J81 Z;  3VPR A;  3J7Y J;  4IXA A;  5E20 A;  2UXX A;  2KIM A;  3P5J A;  4DZJ A;  5HOD A;  2FX0 A;  2EZL A;  3ZXS A;  2BBY A;  2L2O A;  3MD2 A;  1Z7L A;  1PDN C;  3OYN A;  1MBG A;  5IYB J;  2C6Y A;  3DU6 A;  3DPU A;  2WC2 A;  1O4X A;  2HTS A;  1WHU A;  1ETK A;  4L5J A;  4AYB A;  2QVO A;  4FX4 A;  1D0Z A;  2M7B A;  5AIQ A;  2VT2 A;  3LAP A;  1ZYR F;  1U6G A;  1KA8 A;  5LD2 C;  4C9Y A;  2VQH A;  1P7I A;  1MJA A;  1KU2 A;  3RSN A;  3VB2 A;  3MFK A;  1DQU A;  3ABU A;  2X1D A;  5J6X A;  3A01 A;  5LGT A;  1NH3 A;  4F91 B;  1ETQ A;  2HOA A;  1TQP A;  2DT5 A;  2E19 A;  1XDU A;  3DF8 A;  5HLT A;  2WBM A;  5KK1 A;  2IPQ X;  5GAH J;  1Z9C A;  4IOA F;  2BVL A;  2FML A;  2MW8 A;  3Q0V A;  2HOT A;  1BJA A;  1S7O A;  3CD6 I;  2KJB A;  4BHC A;  3C18 A;  3BPX A;  2QSG X;  1XN7 A;  3PNY A;  1ETW A;  3HL2 A;  4L18 B;  1GDT A;  1V3F A;  1LB2 A;  5EGO A;  2DLL A;  3JRH A;  1LKX A;  1IN8 A;  4EVI A;  3IH2 A;  3KP2 A;  3ZN1 A;  3S14 J;  2K85 A;  2OV7 A;  1QQI A;  2FNP A;  3OSG A;  1IDZ A;  4CZC A;  2L7M P;  5JR3 A;  4B43 A;  4M3B A;  2O6G E;  4DBQ A;  4KN4 X;  1FLI A;  1TC3 C;  3GO5 A;  3JAM Z;  1RC9 A;  5A2Q Z;  3PNV A;  2FE3 A;  4DGW B;  1V5E A;  4RS8 A;  3OYH A;  2E5Z A;  4XLE A;  4G12 A;  2W82 A;  3WOD F;  3LQQ A;  1RPW A;  2DW4 A;  3CCY A;  3A0H C;  3E6B A;  2YPR A;  2EA2 A;  2ZME B;  2ETH A;  2BYV E;  2RGV A;  3TDZ C;  1OYI A;  3G2B A;  1R22 A;  2CW8 A;  2MG4 A;  2PBI A;  2Y30 A;  1X1B A;  1OCZ H;  3I59 B;  1JXS A;  2WAQ N;  4M9Z A;  3BR0 A;  2F5E A;  4A0Z A;  4Y52 J;  4YFN F;  3OYD A;  3LST A;  4LG3 A;  3ELK A;  5CVI A;  2IW5 A;  2BGC A;  3TO7 A;  3OYI A;  2DOD A;  2UV1 A;  1WJA A;  2M1B A;  4L5I A;  1S72 I;  2DA1 A;  3PSI A;  4XNF A;  1TWC J;  4XLC A;  1VQ6 I;  1Z67 A;  3KE2 A;  4NQW A;  3BR1 A;  3GFI A;  3LSR A;  1RRJ A;  5GAE J;  2HGC A;  4LIT A;  2ZJR F;  2YX7 A;  2MA3 A;  4BE1 A;  2Y0M A;  2O0Y A;  2DTR A;  4OIQ F;  2FUG 2;  1V55 H;  1ZGW A;  2K9Q A;  4ZDO A;  2GOX B;  2VXD A;  4D9J A;  2DA5 A;  4BEH A;  1R5H A;  1K6O A;  1Z7U A;  1S29 A;  1XC5 A;  4G7Z F;  3DEU A;  4OU0 A;  4PSW A;  2CUJ A;  2H94 A;  2KIQ A;  3CUQ C;  5D6F A;  4ON0 A;  3S32 A;  4ZYG A;  1OCP A;  2H27 A;  5J8F A;  4MO7 A;  2XGD A;  3CP8 A;  2LY9 A;  1K4S A;  3G71 I;  1U9O A;  2LP0 A;  1VTN C;  1XPX A;  2OC6 A;  4N4O B;  2A61 A;  3DTI A;  2L54 A;  2FEZ A;  3ASN H;  4PJN A;  3LFU A;  1O7F A;  5TGT A;  1QZZ A;  5GAD J;  1N25 A;  3RQ4 A;  4B4C A;  3H0D A;  3K4C A;  4I7H A;  5FD6 A;  1T38 A;  1FSE A;  4D7N A;  2F4O B;  2H6C A;  4E7K A;  1OLT A;  2VOO A;  2DA6 A;  2WAD A;  1HKT A;  4RB3 C;  2K3P A;  4PFO A;  1ETV A;  2W57 A;  1YTY A;  1WFX A;  4P9U A;  4AM3 A;  1SD7 A;  4HQM A;  1HBX G;  4MQV A;  3WU1 B;  1DGR M;  1W4M A;  4DZP A;  1X1C A;  3ECH A;  4BDY A;  1Y1W J;  1SVL A;  1BM9 A;  3FKI J;  3HRM A;  4R8H A;  3RPQ A;  4AYB N;  1K78 A;  3ERM A;  3CCE I;  4ETS A;  3K9T A;  3KEY A;  4XMY A;  4EQQ A;  3ABT A;  1R00 A;  2IGM A;  3LA7 A;  3I54 A;  2R3S A;  1R23 A;  2J5O A;  3KYD B;  1J09 A;  4XKW A;  4RB0 A;  5FFX A;  3JRG A;  1J0R A;  4NHJ A;  3GTQ J;  1KU9 A;  1J5Y A;  2HXO A;  3HOV J;  1GVJ A;  2NVY J;  1HOM A;  1UMQ A;  2X85 A;  3JTG A;  4A93 J;  4RAG A;  3O6B B;  3OV8 A;  4A6E A;  5D5V B;  3LSJ A;  1P9Q C;  2IRF G;  4G94 A;  1ZK8 A;  3MZ8 A;  2B0L A;  3GBG A;  3H5R A;  1XGN A;  5IT9 Z;  2EFN A;  3WTZ A;  1J9I A;  3V7S A;  5KNL A;  4RB1 A;  3JAM K;  5FLM J;  2CQN A;  5A2Q K;  1IN4 A;  4ANJ A;  1ON1 A;  4D5F A;  4Q48 A;  4IRI A;  2F6C A;  1MBH A;  3GTM J;  1YFH A;  3NAR A;  5JVG F;  4EV0 A;  2ECB A;  3M8J A;  2DPD A;  1YS7 A;  4Y3O A;  4A69 C;  4A3B J;  1FSH A;  3PJR A;  4J19 A;  1G6N A;  3G1L A;  4CCL A;  3S1R J;  4B3X A;  3GME A;  1JJ8 C;  2N8G A;  4FET A;  2LKS A;  2DJN A;  3OMY A;  3PIP F;  3GZ5 A;  2BE5 F;  2NVX J;  3COA C;  3TO9 A;  5KVR A;  2BVM A;  3EYI A;  1I50 J;  4WCG A;  1LEA A;  1R1V A;  5FRO A;  3QP5 A;  5CQG A;  9ANT A;  4M73 A;  5JLW A;  3BTL A;  1ZLJ A;  4QLC U;  3MVP A;  3GWZ A;  2KMU A;  1HW1 A;  1FC3 A;  2L3D A;  2M4G A;  1XS9 A;  3F8N A;  2QKM B;  2VJJ A;  1U78 A;  1LFB A;  3VSL A;  2VUM J;  4XKC A;  1T0F C;  2VQC A;  4M72 A;  4FQG A;  2CH0 A;  2VJ5 A;  2DAO A;  4EEF G;  4D1Q A;  4E7H A;  2KZG A;  2WAF A;  4EM0 B;  3OYC A;  4Q5S F;  2FA5 A;  5FO5 A;  2R7F A;  4KMU X;  3AL0 C;  3T0Y A;  1TNS A;  3TP0 A;  3CCU I;  3ZQH A;  5CKT A;  1EJ9 A;  2M8E A;  1MZB A;  3ZCO A;  2XSD C;  1ODD A;  3HC7 A;  2NOJ B;  1W5T A;  4YEJ A;  1U8R A;  3OYK A;  2JA5 J;  2CUF A;  2L7K A;  4XK4 A;  2LLK A;  1ZKG A;  4D0P A;  2IT0 A;  5HDN A;  4UVB A;  3FX3 A;  4M71 A;  2HNH A;  1TTY A;  2LYC A;  5D8L B;  1K7A A;  3PM1 A;  4F55 A;  3OSF A;  2DN0 A;  1V4R A;  3G1M A;  1Z3Y A;  3HZJ A;  1BW6 A;  1JI8 A;  2K9N A;  4QWQ A;  4A3F J;  3B6C A;  1QZY A;  5E1W A;  2BW3 A;  2A6E F;  1DUX C;  2Y75 A;  4XOT A;  5F1J A;  4ESB A;  5FRN A;  3RPU A;  3W6V A;  4LOC A;  1ZH5 A;  2X51 A;  5HNH A;  3LSH A;  5ILU A;  4HF1 A;  3M3Y J;  2HZT A;  2O7O A;  2L7Z A;  4HYE A;  5FJ8 J;  2RC4 A;  2A07 F;  4LFU A;  2P5V A;  3HTS B;  3IC7 A;  2X1E A;  2Z2S B;  4LJZ F;  4BJ6 C;  4RLF A;  2NNY A;  2VL8 A;  3KZI C;  3A0B C;  3TOB A;  1Y56 A;  2LVS A;  2F5F A;  2NVQ J;  2IA0 A;  1RKT A;  3L00 A;  1S7A A;  5TJJ A;  4ABZ A;  2QBY A;  2JA7 J;  2QLZ A;  1MNE A;  2V1U A;  3L2U A;  2E1C A;  3H3U A;  5B3S H;  2B63 J;  1WJB A;  3ECO A;  1V5G A;  3JW4 A;  3P7N A;  4M3F A;  4JYK A;  1GUU A;  3IP4 B;  3M07 A;  3CO6 C;  2QWW A;  1IO2 A;  2GXA A;  3I55 I;  1ENH A;  3HIF A;  4OAY A;  4AIH A;  2R7T A;  1BI3 A;  2GM4 A;  4RGR A;  3GUD A;  2XGC A;  2CV1 A;  3CCL I;  1O3Q A;  3WGG A;  3WE3 A;  2MH2 A;  3HDD A;  2R7S A;  2HQR A;  3DV8 A;  3FKJ A;  4BQO A;  4HF2 A;  2W1O A;  1FY7 A;  2W25 A;  5FGM A;  4C3H J;  1QHH D;  1WJF A;  1Z1D A;  2HVR A;  1J7K A;  2KT0 A;  3H9Q A;  3FXR A;  3WTV C;  2HDW A;  3SEZ A;  4A3I J;  4CCK A;  3DWL E;  3VSK A;  4HX4 A;  4DOZ A;  5BOX A;  1CGP A;  2FF4 A;  2QEN A;  4D7M A;  3C2B A;  5E1X A;  5HNF A;  3DU5 A;  4FCY A;  1A31 A;  1QO0 D;  1T98 A;  3CP2 A;  2EV6 A;  1EH8 A;  3CUQ B;  5FKK A;  4HA8 A;  1IRZ A;  3GFJ A;  5FD5 A;  1Z6R A;  4GYI A;  2K40 A;  2YUS A;  1XTA A;  1EA3 A;  2FBK A;  5DCM A;  1PP8 F;  2VOD A;  3ZQI A;  1P2F A;  3IAM 2;  4H0E A;  2ID3 A;  3HBL A;  5LRR A;  5J8C A;  3CMA I;  1F36 A;  4EJU A;  3HHG A;  4BDZ A;  2Z1D A;  1I3A A;  2DA4 A;  3CQZ J;  3LAJ A;  1UFM A;  1R4M B;  2A69 F;  2O8K A;  3H5N A;  2EIN H;  1OKR A;  2I8D A;  2CQQ A;  3CJQ B;  3F3X A;  1RZ4 A;  3PSF A;  4RAZ A;  5CPR B;  1IXR C;  2FMY A;  1X3W B;  5JHU A;  5J1Y A;  2HQN A;  1MMS A;  3F0C A;  2E1M C;  3BCB A;  4ZTF A;  2R5Z B;  3JTH A;  4ZYE A;  1YW9 A;  2HDD A;  2RQP A;  2HVQ A;  3I53 A;  1BR2 A;  1R5G A;  3PFI A;  1R71 A;  2FQ4 A;  1XGM A;  5DD4 A;  4KFC A;  2M0M A;  2DTZ A;  4MFE A;  1UB9 A;  1G3Y A;  2AHQ A;  1X4O A;  3BCA A;  3EUA A;  1WJE A;  2CQK A;  2STW A;  1X2N A;  4Y7N J;  1FEX A;  3BY6 A;  1W7P B;  3AG1 H;  3W2V A;  2LH9 A;  1E3H A;  1VQP I;  3F6O A;  2A6T A;  3QPL A;  2QSH X;  5FFZ A;  3R6S A;  3RPU D;  3RYP A;  4A3L J;  1ONV A;  1RET A;  3IHU A;  5EEH A;  4RM3 A;  5BPD A;  1HST A;  1AWC A;  5EEA A;  2HQA A;  1VF9 A;  3C2H A;  2ZJQ F;  3R0A A;  3KCC A;  2MBF A;  5K7Z A;  1S5L C;  2XB0 X;  1A35 A;  5LBQ A;  4S0H B;  5LGN A;  4NB5 A;  3QOD A;  3I64 A;  2DMN A;  2JA2 A;  1IXC A;  3IAS 2;  4BH9 A;  4UUV A;  1OR7 C;  1T08 B;  2Q2E B;  2F2E A;  2WA0 A;  3CF5 F;  4Z2Y A;  3RYR A;  3CDI A;  2M2E A;  2W24 A;  3IH4 A;  3RKY A;  2LSO A;  3K70 D;  1NK3 P;  2CG4 A;  2CV2 A;  2IGN A;  2F5V A;  2L9S A;  3BRO A;  4MTE A;  4DIQ A;  4UUS A;  3G4S I;  2M4K A;  5HLH A;  4PJM A;  1ZG5 A;  1UHW A;  1APL C;  1VQK I;  1LDD A;  1IAW A;  1ZHF A;  3CJT B;  1AU7 A;  2LNB A;  3IWZ A;  5HS7 A;  2DFE A;  3HOU J;  2LBF A;  3ISP A;  1QZE A;  4KYW A;  1S3J A;  1D0Y A;  5F1R A;  2CFX A;  3BDD A;  3CC2 I;  2VJ4 A;  3X2Q H;  2QUF A;  4JOM A;  4CSW A;  1JTY A;  1WQ2 A;  1MBE A;  2ESH A;  3KLO A;  1MND A;  2E2J J;  4XQF A;  1WH5 A;  3FIS A;  1EKE A;  4LG0 B;  5IOZ A;  3L2W A;  1G4D A;  1V5F A;  3ZOB A;  4C3J J;  3JRD A;  3AL0 B;  3RKW A;  1P7J A;  3ESW B;  1YRN A;  2Q1Z B;  1QRY A;  3DLA A;  2V9K A;  1KGS A;  2VB6 A;  3I58 A;  4XID A;  1A04 A;  5FB2 A;  4I02 A;  4YFK F;  3AG4 H;  1R36 A;  3A03 A;  4S04 A;  2ECC A;  2WTE A;  1BOB A;  2PI0 A;  1X4P A;  3K4B A;  2DK8 A;  2Z5U A;  5JFR A;  3ZQL A;  4LGW A;  1D5V A;  4PGG A;  2J5P A;  2K4J A;  2EK5 A;  3S16 J;  2M8G X;  2XIG A;  2W84 A;  5ICC A;  2XAH A;  1VFC A;  3IKV A;  5CJ9 A;  2CV0 A;  3L2C A;  2XAS A;  1XG1 A;  4EJO A;  4BQN A;  5HDK A;  1T2K A;  3BJO A;  5GTH C;  3FXJ A;  1SMT A;  5M5Y J;  2FU4 A;  2GBY A;  4MIM A;  1Y39 A;  4L9V A;  4BQQ A;  3BJ6 A;  2Q8K A;  1DP7 P;  1XMK A;  4E4H A;  3K1N A;  3L2R A;  1XMA A;  4C2T A;  3JSP A;  3QOE A;  2ZSH B;  4KJZ A;  1MSF C;  1X3U A;  1D1B A;  1BIA A;  1Z21 A;  4IF4 A;  1KQ0 A;  2OUM A;  4BE2 A;  2R7V A;  2MH9 A;  1IRX A;  5GAG J;  4E70 A;  3BG5 A;  2WB1 A;  5J4V A;  4D5C A;  2MFZ A;  4WWC A;  3FMR A;  4U0W A;  3T1B A;  1L0O C;  4BJ5 C;  1YIJ I;  4XSZ F;  2JSC A;  4ENM A;  2EZK A;  1K61 A;  3F9K A;  1P6R A;  4IPA A;  3LSI A;  3AAF A;  3HOZ J;  5BPI A;  4BXX J;  3ZMU A; 
#chains in the Genus database with same CATH homology
 2NS0 A;  1E2X A;  1TW3 A;  5D4R A;  5D4S A;  1JHF A;  1IN5 A;  4TV7 A;  3FMS A;  3B02 A;  4I2O A;  1T6S A;  4HZF A;  3ULQ B;  1TBX A;  3VOD A;  1XGS A;  3R4K A;  5HLI A;  1PUE E;  1EV7 A;  3BZ6 A;  2PLY A;  2STT A;  4HF0 A;  1CF7 B;  2CYY A;  4L0Y B;  4HX8 A;  2P7C B;  2GA1 A;  1FBS A;  2V79 A;  2KKO A;  1LDK B;  2F5C A;  3V7C A;  4EMS A;  5HVQ C;  5H20 A;  4IRH A;  2IA2 A;  3E5X A;  4RGX A;  1RNL A;  1ZAO A;  3FMQ A;  4Y13 A;  3K69 A;  2OAZ A;  3WTS C;  4YFX F;  5CVV A;  2RVC A;  2CSO A;  5ICG A;  2HFH A;  1SD6 A;  4GXO A;  3GF2 A;  4U88 A;  4YIF A;  3V7R A;  1ZG1 A;  2VE9 A;  3T5X A;  3EQL F;  2PEX A;  2FSW A;  3SFZ A;  4HV6 A;  2O61 A;  1MJB A;  4WF2 A;  2K86 A;  1WSU A;  4P96 A;  1U5T C;  2P7V B;  2CWE A;  3KEO A;  4A6D A;  1B59 A;  2ZBK A;  3DFG A;  5CVU A;  4KIF A;  2DFI A;  2GQQ A;  1G3T A;  5BMZ A;  2IA1 A;  3F23 A;  3KEQ A;  3KP5 A;  4Y15 A;  2PJP A;  2F5D A;  3GZ6 A;  4MGR A;  4ESF A;  5D5W B;  3C7J A;  2VE8 A;  2FXA A;  3QOP A;  1MDM A;  1WI9 A;  3CJN A;  3E5Q A;  2HOE A;  1LEB A;  2GIV A;  3CUO A;  4OIP F;  4JQF A;  1KYW A;  4O5V A;  1ZRD A;  3HTU A;  3RDI A;  2MLK A;  4HBL A;  2VBY A;  2PMH A;  2VC1 A;  1P4W A;  4CZZ A;  1QGP A;  2OU2 A;  1ULY A;  1BOA A;  4XBF A;  3F8C A;  3GYH X;  1J75 A;  2O8X A;  4M6Y A;  4BNC A;  5ICF A;  3LFK A;  3TGN A;  4AD9 A;  4AVP A;  2HWV A;  2GWR A;  4I0B A;  5K1Y A;  3F21 A;  3TOA A;  1R1T A;  1FP2 A;  1STZ A;  2YR2 A;  1FWZ A;  3F8B A;  3WTT C;  2OA4 A;  4XLP F;  3T8R A;  2A3S A;  4G7O F;  4A5N A;  4KUM A;  1B9M A;  2ISY A;  2P4W A;  3SZT A;  2E7W A;  1QPM A;  2QQA A;  3FM3 A;  1IRG A;  1H0M A;  2PFB A;  1XCB A;  2AXL A;  3D5L A;  3P9C A;  4RAY A;  3WGI A;  4OMZ A;  2RV8 A;  3ZMS A;  2JZY A;  4CXF A;  2COM A;  3HOS A;  2OD5 A;  2ZME A;  3RI4 A;  2XKP A;  3VOE A;  3I59 A;  2P5L C;  4EJT A;  3N97 A;  3I4P A;  4LMY A;  4P5O A;  1YO5 C;  2HYG D;  1SD4 A;  3FWE A;  2ELH A;  4IVN A;  3JSO A;  2Z9O A;  5LHG A;  4RB2 C;  2EJR A;  3MZH A;  5F6F A;  5DV5 A;  2UZK A;  4HOB A;  2XAF A;  1ZLK A;  3DPL C;  1YW7 A;  1YG2 A;  3M9A A;  2LDU A;  4CIC A;  1LQ1 A;  4MNU A;  4LLG F;  2ISZ A;  1XB4 A;  2Z99 A;  4DNC A;  2JTV A;  3IRR A;  1AOY A;  2HKX A;  4U0Y A;  4G9Y A;  4CDG A;  5E17 F;  4BHP A;  3KET A;  3KZZ A;  3R60 A;  2BV6 A;  5DD8 A;  1DPU A;  4I0A A;  1DPR A;  3HRU A;  4A2U A;  4FHT A;  3O2P E;  1JGS A;  3LA2 A;  1TLH B;  4CGZ A;  3DKW A;  2JRT A;  2Z33 A;  2KJC A;  3U2R A;  1P4A A;  3I0T A;  3IL2 A;  4N9I A;  1FPQ A;  4KMF A;  3DQV C;  3T8T A;  5HS8 A;  3LQR A;  5BQT A;  2VC0 A;  4L9T A;  2OZU A;  1D3Y A;  3EUH A;  4WXD A;  2A68 F;  3CO7 C;  3KP6 A;  5DUI A;  1SD5 A;  4O3M A;  1Z91 A;  5LLQ A;  4KT5 C;  1XCV A;  1SMY F;  1IN7 A;  3B73 A;  2ZFW A;  2XKO A;  1U5T B;  4HLY A;  2VT3 A;  3LA3 A;  3WU0 A;  1JE8 A;  1FZP B;  3FXQ A;  3M8E A;  2WV0 A;  1O3T A;  1FBU A;  5AON A;  5FLX K;  2XHK A;  1O57 A;  3EYY A;  1BC7 C;  2DU9 A;  4B09 A;  1IZ1 A;  3P9K A;  4N0B A;  1U2W A;  3V4G A;  4MTD A;  1TW2 A;  2K7L A;  4M9S A;  5LHI A;  2VXZ A;  2OZ6 A;  2K02 A;  3DP7 A;  4HQE A;  4ZYH A;  3V8K A;  1HKQ A;  2D1H A;  3SXY A;  3FM5 A;  2CW0 F;  3WTU C;  4ENJ A;  2YSR A;  4GCV A;  2XAJ A;  3RTR A;  3F8M A;  1R58 A;  4U0V A;  2M5W A;  2L02 A;  1LJ9 A;  3ZMV A;  4RGS A;  2VBZ A;  2W85 A;  4JBA A;  2FBH A;  3W6K B;  2Q0O A;  4L9N A;  2X4H A;  3HRS A;  3M7G A;  4O6J A;  4ASN A;  3TQN A;  1F1Z A;  2HEO A;  3GVA A;  2FOK A;  4HLX A;  1D8K A;  1IXS B;  1OPC A;  4P55 A;  2VOP A;  1MGT A;  4HV5 A;  4HX7 A;  3ZN0 A;  3L09 A;  1D8J A;  3IWF A;  4EJV A;  3KZY A;  4I09 A;  2HTJ A;  1REP C;  2IJL A;  2IP2 A;  3F22 A;  1G3W A;  4GGG A;  2LF7 A;  2P5K A;  4WK8 F;  3N4M A;  4IHS A;  1I1G A;  1TQI A;  1DDN A;  3PQK A;  1GXP A;  2DQL A;  1KYZ A;  3GW2 A;  1HQC A;  4PDK A;  3FZV A;  2G9W A;  1I6X A;  1ZN2 A;  1B9N A;  2XAQ A;  3M1E A;  5HOO A;  1MJ9 A;  1Y0U A;  3KP7 A;  4YII A;  3F72 A;  3Q9V A;  4ENN A;  3HSR A;  2BEO A;  4WXH A;  2ZXJ A;  3WG9 A;  4LB6 B;  1BIB A;  3RKX A;  1XSD A;  2CO5 A;  1O3S A;  3ERE D;  1F4K A;  1IRF A;  5D5X B;  2HR3 A;  2DPU A;  1HW5 A;  3E5U A;  1ZGA A;  2KIF A;  3CUQ A;  3D0S A;  3K1P A;  3K1M A;  2EWN A;  1GHC A;  2ADU A;  1RUN A;  2D2W A;  4UXN A;  5D8K B;  4KA4 A;  1O3R A;  1R7J A;  3FF5 A;  3E6M A;  1ZRC A;  1S6L A;  3ML6 A;  4KNY A;  2PG4 A;  3V8L A;  2R7D A;  2DO7 A;  1SAX A;  1JHH A;  3G3Z A;  4BAY A;  2XRO A;  3J7A O;  3ZPL A;  3ROU A;  2NNN A;  3KLN A;  1EH6 A;  1SFX A;  2NRA C;  5E1Z B;  4ESJ A;  3SQN A;  3K2Z A;  3F8F A;  3ZQ7 A;  1TQM A;  2D45 A;  1W7P A;  3W6J B;  1KQ8 A;  3RJP A;  3LWF A;  4WX9 A;  2EA4 A;  5H6Q A;  4KIG A;  4BYY A;  2V6C A;  3I71 A;  4OOI A;  2OBP A;  4EGY A;  1KU3 A;  5HLG A;  2P8T A;  2XAG A;  4RGU A;  5ERI A;  1Q1H A;  1ZG3 A;  2K27 A;  1RIO H;  5CVR A;  5L3E A;  4Y17 A;  3WTY C;  2Y48 A;  1K78 B;  2Q2E A;  2G7U A;  3CDH A;  2RN7 A;  3DPT A;  3ZP5 A;  3KP3 A;  4AIK A;  2ESN A;  2EFO A;  4A0Y A;  3FHZ A;  2QQ9 A;  3MWM A;  5CLS A;  3E3V A;  4M9X A;  3OOP A;  4FT8 A;  4MHG A;  1EH7 A;  4M74 A;  4PGH A;  1G3S A;  4OIR F;  5HDG A;  1WRJ A;  2ZCW A;  5CVJ A;  1BC8 C;  4BQA A;  3NQO A;  1XSX A;  5E8G A;  1T0F A;  2HKO A;  4A0X A;  4ENK A;  4KDP A;  4LG0 A;  4FX0 A;  5K5R A;  1WWX A;  4EM1 A;  3M8F A;  3HSF A;  1J2X A;  3FXU A;  3GEZ A;  1HW2 A;  4WXC A;  2M87 A;  2XVC A;  1USS A;  3BJA A;  4G7H F;  3DXJ F;  5L3B A;  1SFU A;  5F64 A;  2HDC A;  4G6Q A;  4LLL A;  2XV4 S;  2DK5 A;  4U7B A;  3TO6 A;  3CTA A;  5TRD A;  2FBI A;  5DCF A;  5AIP A;  3MZY A;  2VBW A;  3ZMD A;  3L9F A;  1NHA A;  3QAH A;  1O7L A;  2ZKZ A;  2LKP A;  1E17 A;  3GFL A;  1T39 A;  1FYL A;  4K2E A;  4EJW A;  1W7P D;  3QPH A;  1Z6T A;  5LRS A;  2PQ8 A;  3MCZ A;  3J81 K;  5D5U B;  1R1U A;  4BHB A;  2IVM A;  1F9N A;  4CO8 A;  3WE2 A;  3GX4 X;  3SHF A;  5LHH A;  1XD7 A;  3PQJ A;  1ZAR A;  4MQ9 F;  5H6R A;  5CYV A;  3QPT A;  3QU6 A;  4M6X A;  1BI2 A;  2VBX A;  1B4A A;  1U3E M;  1LVA A;  2O3F A;  3HYI A;  3U1D A;  1WKM A;  3P9I A;  1F5T A;  4XRF A;  1K79 A;  3KFW X;  1CF7 A;  2QBY B;  3HRT A;  3NRV A;  4AWX B;  2WWY A;  5L3D A;  4Q47 A;  1FBQ A;  3Q9S A;  3E6D A;  1OMI A;  2Z3Y A;  2VON A;  1QBJ A;  1Z05 A;  1YS6 A;  2DBB A;  2FQ3 A;  2K4B A;  5ILV A;  2A5Y B;  1S8N A;  4GYG A;  1YYV A;  4HW0 A;  1HKS A;  4UNO A;  1GXQ A;  5FLX Z;  2L01 A;  4HAM A;  3MQ0 A;  2DI3 A;  3C3W A;  2QZ8 A;  1I1S A;  2ZNY A;  1C0W A;  3KP4 A;  5DCM B;  2M30 A;  5HS9 A;  5E8I A;  3WTX C;  2L4A A;  3HUG A;  4Q4Z F;  4AIJ A;  4XLN F;  1MD0 A;  2X0L A;  4LD5 A;  2UWM A;  3IKT A;  1IF1 A;  4CYD A;  3GLX A;  4N9H A;  3RIR A;  1B1B A;  2MLG A;  1P92 A;  4UVA A;  4YG2 F;  3H3Z A;  1I27 A;  4BXU A;  1XDS A;  4UV8 A;  3QRF F;  1SFE A;  1KQ9 A;  1OR7 A;  3TKY A;  1RI7 A;  4I01 A;  2GXB A;  2YU3 A;  4R1H A;  3J80 Z;  5ED4 A;  1XSV A;  2GAU A;  2GXG A;  2QQB A;  2JPC A;  3R61 A;  1MKM A;  3Q5F A;  2DQR A;  4CHU A;  3IRQ A;  3C1D A;  4B8X A;  4ZZL A;  5L3G A;  3HOT A;  3V8J A;  1UST A;  2CGP A;  2EFQ A;  2UXN A;  2XRN A;  2LF8 A;  1FOK A;  5DDG A;  2NAZ A;  3HSE A;  4IJA A;  3BOQ A;  4LK0 F;  3F6V A;  1BBY A;  1UHM A;  4ZH4 F;  4G8X A;  2MC3 A;  1YQA A;  2V1X A;  3GFM A;  5JI6 A;  2EB7 A;  5L3F A;  2ZNZ A;  2E1N A;  2FNA A;  2PN6 A;  2OQR A;  5ICE A;  4KIC A;  3HHH A;  1ZRF A;  6PAX A;  5IT9 K;  3S2W A;  2PMU A;  5JVT A;  5D6E A;  4L0Z B;  2EV5 A;  5DUK A;  2ACJ A;  3EDP A;  5L3C A;  3E6C C;  1IUY A;  5LEJ A;  4XSX F;  4OMY A;  1YIO A;  4UVC A;  3QU3 A;  2P6T A;  5EEG A;  5DEQ A;  3EET A;  1LNW A;  1KU7 A;  3QP6 A;  5DYM A;  1P4X A;  4MEX F;  2QM3 A;  4ZZD A;  2GZW A;  2A6H F;  1H9T A;  2EV0 A;  5LEK A;  4GO1 A;  2MD5 A;  4UHT A;  1OYY A;  1QNT A;  2E7X A;  3WGH A;  3L7W A;  3MAJ A;  3J80 K;  1BI0 A;  1IN6 A;  3CLO A;  4EM2 A;  4A12 A;  4LK1 F;  4PCQ A;  2HS5 A;  1FYK A;  3WTW C;  4G6D A;  1B6A A;  2NYX A;  5LGU A;  3NEU A;  3ZMZ A;  2RNJ A;  2ZJ2 A;  4KN7 X;  2XUB A;  4LLN A;  1ZRE A;  4MEY F;  2O03 A;  5BS6 A;  3BWG A;  1I5Z A;  1H9G A;  3O3K A;  4P9F A;  1FT9 A;  4IHT A;  2D1V A;  2EFW A;  2OQG A;  1HSJ A;  2KIU A;  2HYF A;  1PP7 U;  3BP8 A;  2EFP A;  1YLF A;  5IT3 A;  1YW8 A;  2FRH A;  1IW7 F;  2JPB A;  4ZYD A;  1XGO A;  1U5T A;  1L3L A;  1FP1 D;  4HDU A;  4DQ2 A;  4LB5 A;  1J59 A;  4R79 A;  1FYM A;  2JT1 A;  1W5S A;  2XGX A;  1FX7 A;  2AS5 F;  3R0J A;  1UCR A;  2KRF A;  3VFZ A;  1HXD A;  2V1D A;  4PZJ A;  4IRG A;  4L9J A;  3K0L A;  4A5M A;  3MEX A;  2H09 A;  4U7D A;  1LDJ A;  2RDP A;  1BN5 A;  2ZO4 A;  4KIB A;  4OIN F;  4EGZ A;  3GXO A;  5ILS A;  5K5Q A;  3H92 A;  4I98 B;  2QYO A;  4UV9 A;  1OYW A;  2TDX A;  3BPV A;  3G73 A;  2P6S A;  5K5O A;  4JK1 X;  3SZP A;  1ZGJ A;  3I5U A;  2RKH A;  4OIO F;  2L4M A;  1BI1 A;  4F7Z A;  2V9V A;  1ON2 A;  3ZMT A;  3VEP A;  2GA2 A;  5E18 F;  1TNT A;  3REO A;  3U9G A;  1MDM B;  3E97 A;  1FNN A;  2YX4 A;  4S05 A;  4HDV A;  2G7H A;  2H6B A;  2M45 A;  3TDU C;  2VN2 A;  1RUO A;  3J81 Z;  4IXA A;  5E20 A;  2UXX A;  2KIM A;  2BBY A;  1PDN C;  2C6Y A;  2WC2 A;  2HTS A;  4L5J A;  2QVO A;  4FX4 A;  5AIQ A;  2VT2 A;  3LAP A;  1ZYR F;  1U6G A;  1KA8 A;  1MJA A;  1KU2 A;  3VB2 A;  3MFK A;  3ABU A;  5J6X A;  5LGT A;  1TQP A;  2DT5 A;  1XDU A;  3DF8 A;  5KK1 A;  2IPQ X;  1Z9C A;  2FML A;  1BJA A;  1S7O A;  2KJB A;  4BHC A;  3C18 A;  3BPX A;  1XN7 A;  4L18 B;  1V3F A;  1LB2 A;  2DLL A;  1IN8 A;  4EVI A;  3KP2 A;  3ZN1 A;  1QQI A;  2FNP A;  5JR3 A;  2O6G E;  4KN4 X;  1FLI A;  3GO5 A;  3JAM Z;  5A2Q Z;  2FE3 A;  4RS8 A;  3WOD F;  3LQQ A;  2DW4 A;  3E6B A;  2EA2 A;  2ETH A;  2ZME B;  3TDZ C;  2BYV E;  2RGV A;  2YPR A;  1OYI A;  1R22 A;  2PBI A;  3I59 B;  1JXS A;  4M9Z A;  2F5E A;  4A0Z A;  4YFN F;  3LST A;  3ELK A;  5CVI A;  2IW5 A;  2BGC A;  3TO7 A;  2M1B A;  4L5I A;  3KE2 A;  4NQW A;  3GFI A;  2HGC A;  2YX7 A;  2MA3 A;  2Y0M A;  2O0Y A;  2DTR A;  4OIQ F;  1R5H A;  1K6O A;  1Z7U A;  1S29 A;  4G7Z F;  3DEU A;  4OU0 A;  2H94 A;  3CUQ C;  4ON0 A;  5D6F A;  4ZYG A;  2H27 A;  5J8F A;  1VTN C;  2A61 A;  2L54 A;  2FEZ A;  1O7F A;  1QZZ A;  4I7H A;  5FD6 A;  1T38 A;  1FSE A;  2H6C A;  2VOO A;  1HKT A;  4RB3 C;  2W57 A;  1YTY A;  4P9U A;  1SD7 A;  4HQM A;  1HBX G;  4MQV A;  3WU1 B;  1W4M A;  3ECH A;  1BM9 A;  3HRM A;  4R8H A;  3RPQ A;  1K78 A;  4ETS A;  3K9T A;  4EQQ A;  3ABT A;  1R00 A;  3LA7 A;  3I54 A;  2R3S A;  1R23 A;  2J5O A;  4RB0 A;  5FFX A;  1J0R A;  4NHJ A;  1KU9 A;  1J5Y A;  1GVJ A;  3JTG A;  3O6B B;  3OV8 A;  4A6E A;  5D5V B;  2IRF G;  4G94 A;  5IT9 Z;  2B0L A;  1XGN A;  2EFN A;  3WTZ A;  1J9I A;  3V7S A;  4RB1 A;  3JAM K;  5A2Q K;  1IN4 A;  1ON1 A;  4Q48 A;  4IRI A;  1YFH A;  4EV0 A;  2DPD A;  1FSH A;  1YS7 A;  1G6N A;  3GZ5 A;  2BE5 F;  3COA C;  3TO9 A;  5KVR A;  3EYI A;  4WCG A;  1LEA A;  1R1V A;  3QP5 A;  4M73 A;  1ZLJ A;  4QLC U;  3GWZ A;  1HW1 A;  1FC3 A;  2L3D A;  3F8N A;  1U78 A;  4M72 A;  2DAO A;  4EM0 B;  4Q5S F;  2FA5 A;  5FO5 A;  2R7F A;  4KMU X;  3T0Y A;  1TNS A;  2M8E A;  1MZB A;  1ODD A;  1W5T A;  1U8R A;  4D0P A;  2IT0 A;  5HDN A;  4UVB A;  3FX3 A;  4M71 A;  1TTY A;  5D8L B;  1K7A A;  1V4R A;  4QWQ A;  5E1W A;  1QZY A;  2A6E F;  1DUX C;  2Y75 A;  4ESB A;  3RPU A;  1ZH5 A;  5ILU A;  4HF1 A;  2HZT A;  4HYE A;  2RC4 A;  2A07 F;  4LFU A;  2P5V A;  3HTS B;  3IC7 A;  4LJZ F;  2NNY A;  3TOB A;  2F5F A;  2IA0 A;  3L00 A;  1S7A A;  5TJJ A;  2QBY A;  2QLZ A;  2V1U A;  2E1C A;  3H3U A;  3ECO A;  3JW4 A;  3P7N A;  3CO6 C;  2QWW A;  3HIF A;  4AIH A;  1BI3 A;  4RGR A;  3GUD A;  1O3Q A;  3WGG A;  3WE3 A;  2MH2 A;  2HQR A;  3DV8 A;  4HF2 A;  1FY7 A;  2W25 A;  5FGM A;  1Z1D A;  1J7K A;  3FXR A;  3WTV C;  4HX4 A;  5BOX A;  1CGP A;  2FF4 A;  2QEN A;  5E1X A;  1QO0 D;  1T98 A;  2EV6 A;  1EH8 A;  3CUQ B;  4HA8 A;  3GFJ A;  5FD5 A;  1Z6R A;  4GYI A;  2FBK A;  5DCM A;  1PP8 F;  2VOD A;  1P2F A;  4H0E A;  5LRR A;  5J8C A;  4EJU A;  3HHG A;  3LAJ A;  1UFM A;  2A69 F;  1OKR A;  3F3X A;  1RZ4 A;  4RAZ A;  1IXR C;  2FMY A;  5JHU A;  2HQN A;  3JTH A;  4ZYE A;  1YW9 A;  2RQP A;  3I53 A;  1R5G A;  3PFI A;  1XGM A;  5DD4 A;  4KFC A;  1UB9 A;  1G3Y A;  2CQK A;  2STW A;  3BY6 A;  1W7P B;  3F6O A;  5FFZ A;  3R6S A;  3RYP A;  1ONV A;  3IHU A;  5EEH A;  5BPD A;  1HST A;  1AWC A;  3R0A A;  3KCC A;  2MBF A;  5LBQ A;  5LGN A;  4NB5 A;  3I64 A;  1IXC A;  4BH9 A;  4UUV A;  2F2E A;  4Z2Y A;  3RYR A;  2W24 A;  3RKY A;  2LSO A;  2CG4 A;  3BRO A;  4MTE A;  5HLH A;  1ZG5 A;  1UHW A;  1LDD A;  1IAW A;  1ZHF A;  2LNB A;  3IWZ A;  5HS7 A;  3ISP A;  4KYW A;  1S3J A;  5F1R A;  2CFX A;  3BDD A;  2QUF A;  1WQ2 A;  2ESH A;  3KLO A;  4LG0 B;  1G4D A;  3RKW A;  1KGS A;  3I58 A;  1A04 A;  5FB2 A;  4I02 A;  4YFK F;  1R36 A;  4S04 A;  2PI0 A;  2WTE A;  2DK8 A;  2Z5U A;  5JFR A;  4LGW A;  1D5V A;  4PGG A;  2J5P A;  2K4J A;  2EK5 A;  5ICC A;  2W84 A;  2XIG A;  2XAH A;  3IKV A;  5CJ9 A;  3L2C A;  2XAS A;  4EJO A;  5HDK A;  1T2K A;  3BJO A;  1SMT A;  2FU4 A;  4L9V A;  3BJ6 A;  2Q8K A;  1DP7 P;  1XMK A;  3K1N A;  1XMA A;  3JSP A;  1X3U A;  1BIA A;  4IF4 A;  1KQ0 A;  2MH9 A;  4E70 A;  4WWC A;  3FMR A;  4U0W A;  3T1B A;  1L0O C;  4XSZ F;  2JSC A;  4ENM A;  1P6R A;  4IPA A;  3AAF A;  5BPI A;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...