3QPTA

Crystal structure of the salmonella transcriptional regulator slya
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
132
Chain Sequence
LGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Transcription
molecule keywords Transcriptional regulator slyA
total genus 49
structure length 132
sequence length 139
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qptA00
1P4XA 2D1HA 4OMZA 3T8TA 3E6BA 1LB2A 4I09A 1ZG5A 2P5LC 3F8BA 3FXRA 5AIQA 3GFIA 1DUXC 2H6CA 2KIMA 4P9FA 2LF8A 1BIBA 4WXCA 4R79A 3ISPA 2IA0A 2E1CA 1ZN2A 3OOPA 4JK1X 2EK5A 2K27A 2OZ6A 2VE8A 4AIJA 3WG9A 1ZYRF 2F2EA 2P4WA 5J8FA 3E6MA 1XSDA 4EQQA 4L9JA 4CICA 2DU9A 4LD5A 2ZXJA 1EH6A 3U9GA 1J0RA 2Q8KA 1Z6TA 2MLKA 5BMZA 4UVAA 1RNLA 2A6EF 2PJPA 1SD7A 5D4SA 3SFZA 3LSTA 3PFIA 4KT5C 3VFZA 1QNTA 2X4HA 3R6SA 2P6SA 2JTVA 2JT1A 1KQ8A 4E70A 3KP5A 3RDIA 1EH7A 1JHFA 1UB9A 4U0VA 4A6DA 4HZFA 4ESJA 4ENNA 4HOBA 2EA2A 4L0ZB 3JW4A 1L3LA 2PFBA 2FA5A 1FC3A 2IRFG 4KIBA 2DPUA 5LRSA 1ON2A 3BDDA 3IKVA 1R22A 1YYVA 1OYYA 1T6SA 2BGCA 2VOOA 4KIGA 2HDCA 2A61A 3BZ6A 2VBZA 3I5UA 3J81K 1LDKB 1G3TA 1O3QA 2HKXA 4GYIA 3QP5A 1KU3A 2YX4A 1HW1A 4O6JA 2WWYA 3ABTA 5ILUA 1LNWA 3Q9SA 3I54A 4YIIA 3D0SA 1NHAA 3GXOA 2DK5A 2P7CB 1PUEE 2FBHA 5HLHA 3I64A 1MJ9A 2DW4A 3GFMA 1K79A 2H09A 2UWMA 1J2XA 2NAZA 4A5MA 5D5VB 3E6DA 3F8CA 3QU6A 1OKRA 4QWQA 4HV6A 2RNJA 4G7OF 3ROUA 2R7FA 2YU3A 1U5TB 1B9NA 2IW5A 2NYXA 1DDNA 5D5XB 2XAGA 3HOSA 3OV8A 2IA2A 3GEZA 5KK1A 2GIVA 1SMTA 3EYIA 2M30A 3BWGA 4B09A 3KZZA 2XRNA 2OU2A 5FO5A 3VEPA 2DBBA 3K2ZA 1Z9CA 4FHTA 2O3FA 2V6CA 2M87A 1W4MA 3CUOA 3H3UA 5TRDA 1IW7F 4I98B 4U0YA 3EQLF 4MNUA 5K5OA 4HF0A 1F4KA 4G7ZF 1Z7UA 4LGWA 5ICGA 4M9ZA 2VOPA 4P9UA 2FRHA 1B9MA 3GW2A 2J5PA 1U5TA 1FPQA 4U7DA 5DCFA 1BBYA 1FYLA 3E97A 2HQRA 3RKXA 3P9IA 5CVJA 2W84A 3DFGA 2ZNYA 4HF1A 1ONVA 1S7OA 3FZVA 3J7AO 4LK0F 2B0LA 3GZ6A 4YFNF 4HDVA 3M9AA 3ABUA 4OOIA 3C3WA 3SXYA 2OD5A 1FYMA 1K6OA 1B4AA 3G73A 1Q1HA 3CUQC 4EM1A 2Z33A 3EUHA 2GXGA 3FXQA 2FBIA 4N9HA 4I2OA 4HW0A 3ULQB 1G3WA 2CO5A 4CZZA 4HBLA 1XMKA 2QENA 4U88A 4GGGA 4L9VA 4ZYHA 2EV6A 4ENMA 2A68F 2VN2A 4BHBA 1K78B 1ZG1A 2V1XA 3HSFA 3RJPA 4A0XA 2L02A 3QPHA 3J81Z 2E7XA 4KNYA 2YPRA 4R1HA 5LGNA 1ZRFA 3O6BB 1LVAA 3RYRA 4HDUA 4ZYEA 1S7AA 1XGNA 4XLNF 2DT5A 2QLZA 5FGMA 4CYDA 4EM0B 2VBYA 1IXSB 1WRJA 2FXAA 2COMA 4IHTA 2EWNA 3CO6C 3DEUA 4PGGA 1SFXA 1R00A 3K9TA 3KCCA 4WK8F 3QP6A 4LB6B 2LSOA 3WTXC 4KYWA 3FWEA 2EFQA 5LLQA 2O8XA 4S04A 2XV4S 3FHZA 2DPDA 2ADUA 1KQ9A 3LQRA 2JPCA 4AD9A 3DQVC 3MZYA 3F8MA 1QBJA 4HLXA 2A5YB 4G7HF 5DUIA 1BIAA 5DCMB 3LA7A 1YG2A 1KU9A 2A6HF 1T38A 2IA1A 1BC7C 3F8FA 2NRAC 1TQIA 1FBQA 1D8JA 2XGXA 4EM2A 1A04A 4G6DA 3BPXA 2H6BA 1YS6A 3VOEA 2IVMA 1XB4A 3ZMDA 2FBKA 4MQ9F 5CVIA 1YW7A 4FX0A 2MD5A 5FB2A 4EJUA 3QU3A 3TO7A 1K7AA 2RQPA 2OQGA 5E17F 4RB0A 2DQLA 2FNAA 1HKQA 1ZGAA 3HRTA 1JGSA 4BAYA 1XGMA 4Q47A 1F1ZA 2QZ8A 2PG4A 2K7LA 2L01A 2DFIA 2VC0A 2HFHA 1O3RA 1XD7A 4RS8A 4RAZA 1JHHA 1R1VA 1UCRA 1YO5C 3F6OA 1I27A 3NQOA 1KA8A 1IN5A 1SFUA 4QLCU 1DP7P 1ZLJA 3DP7A 1FBUA 3G3ZA 5KVRA 2RN7A 2Y75A 1FYKA 4LB5A 4N0BA 1Z6RA 1OYIA 3RPUA 5F64A 1R36A 2JSCA 2HKOA 2VBWA 3SQNA 2HEOA 5HS7A 1IN6A 1Z91A 1TTYA 2Q2EA 2R3SA 2E1NA 1Z1DA 3HIFA 2P6TA 4U0WA 2D2WA 2EV5A 1P92A 2P5VA 2HR3A 1AOYA 2K02A 3WE3A 3IRQA 1GVJA 2ZMEB 4P5OA 5JFRA 3TOAA 3WTWC 1H9TA 2YX7A 4L5IA 2RC4A 2LDUA 1HSJA 4RGRA 4Y15A 4RB1A 2XROA 4OMYA 3M8FA 5L3EA 1IXCA 2HYGD 2HWVA 1JXSA 3K69A 2HGCA 2VBXA 1U5TC 4M6YA 1WI9A 2VXZA 2D45A 5LGTA 2X0LA 3TKYA 2PMUA 3MWMA 3K1NA 3NRVA 2BE5F 3C7JA 3L00A 3RKWA 2YSRA 3HTSB 4LLNA 3DV8A 4RAYA 4GCVA 1J5YA 5E20A 4KDPA 3HRSA 3F23A 1QZYA 1YLFA 5ED4A 2IT0A 2Z99A 2LKPA 3F72A 5DUKA 1EV7A 4IHSA 3M7GA 5JR3A 1GXPA 3MFKA 2KRFA 3CDHA 5DYMA 2NNYA 2FEZA 2L4MA 4R8HA 4UXNA 1KYZA 2M45A 2O6GE 4I0BA 3BJ6A 1MJAA 1GXQA 4M9SA 5D6FA 2GQQA 2XASA 1XGSA 4M9XA 4KN7X 3WTVC 1D3YA 4ZYDA 4RGSA 4BHCA 1R5HA 1STZA 4U7BA 1ZRDA 3CO7C 1FP2A 3RPQA 4ZYGA 1IRFA 3ECOA 1BI1A 3FMRA 3K1PA 3RI4A 4EJOA 4UVCA 1R5GA 2OQRA 1O3SA 1ZHFA 2DI3A 3KZYA 3HHHA 1UHWA 3V8KA 2Q0OA 2FQ3A 1R1TA 3IWZA 1F5TA 1EH8A 3PQJA 1OMIA 5DD4A 1XCVA 3EETA 4UVBA 3CUQB 2BYVE 4IF4A 1F9NA 5A2QZ 1XGOA 2V1UA 2XAQA 3PQKA 4EGZA 5LGUA 4IRGA 2XAFA 2ETHA 4XSXF 3LA2A 3EYYA 1H0MA 1C0WA 5ILVA 3L9FA 5D4RA 1ON1A 4NB5A 4L18B 3IHUA 3IRRA 2Y48A 3WTZA 1FBSA 5ICFA 5BPIA 4BXUA 4GXOA 1WSUA 2Z3YA 4LJZF 2EFPA 4GO1A 1IZ1A 4OIOF 3N4MA 2FU4A 2KIUA 3COAC 3GF2A 5F1RA 4YFXF 3KP6A 3W6JB 1ZGJA 1FOKA 3FF5A 5L3CA 5DD8A 3TDZC 3I71A 3K0LA 2CYYA 3WTTC 2C6YA 1U2WA 2OAZA 5HDKA 2RDPA 3R0JA 1P4AA 4G9YA 4ZZLA 2LNBA 1B6AA 1R23A 2M8EA 5E1ZB 2EFNA 4CHUA 5BQTA 2CGPA 1DPUA 3RYPA 2GAUA 1MJBA 3QAHA 1OR7A 5H20A 4KA4A 1RUNA 3E5QA 3NEUA 3GUDA 3MCZA 5HLIA 1UFMA 4OINF 1IAWA 5BS6A 3HRMA 2HS5A 3O2PE 5E18F 1CGPA 4KICA 1QO0D 3BY6A 3EDPA 2V79A 4EJVA 3VODA 1D5VA 1G4DA 2FE3A 4CGZA 2JZYA 1U3EM 2XAHA 2J5OA 2QQ9A 5FLXZ 3GO5A 2V1DA 3BROA 1FP1D 1RUOA 2FOKA 2HTJA 5HLGA 5HDGA 3LFKA 3ZQ7A 4PGHA 3BOQA 4OIPF 2Z5UA 1U78A 3TGNA 5F6FA 4IRIA 3HUGA 2JPBA 2EJRA 3FXUA 3I59B 4IXAA 3LA3A 2MBFA 4BH9A 3CTAA 1PP7U 1E2XA 5E8IA 3FMQA 2XAJA 5D8KB 4MEXF 2IPQX 4ENJA 4UUVA 4CDGA 1I6XA 2WTEA 3KFWX 2RKHA 1I1SA 4Z2YA 4RGXA 3IWFA 4Y13A 1P2FA 4P55A 3S2WA 3DF8A 4S05A 4EV0A 2IJLA 3JAMK 5DV5A 2ZBKA 3ZMVA 1XSVA 2MH9A 3MZHA 1HKTA 3BJOA 1S8NA 1XDUA 5CYVA 3TQNA 1XMAA 2QUFA 5LHHA 2BBYA 3KP2A 4A0ZA 4EJWA 4L9TA 4M74A 3HTUA 1FZPB 2CQKA 4LMYA 1IN7A 1U6GA 3LWFA 2FSWA 1TW2A 4AIKA 1YIOA 1XSXA 3I58A 1QQIA 2ACJA 3MEXA 2G9WA 2RGVA 1W7PA 2VE9A 2CW0F 3MAJA 1LQ1A 1O3TA 1HW5A 2BEOA 2ZO4A 4MEYF 2G7HA 2QBYA 2DQRA 2KIFA 2XUBA 4JBAA 2HOEA 2CFXA 4LG0A 3TDUC 4P96A 3RKYA 3T1BA 1USTA 4GYGA 3E5XA 1SD4A 4HX4A 3E6CC 4MTDA 3TO6A 3T8RA 1KU7A 1G6NA 2DLLA 4UHTA 3AAFA 3GVAA 1FNNA 4BHPA 1T98A 2D1VA 3GX4X 5K5QA 3HRUA 3I59A 4JQFA 1FT9A 1I5ZA 5EEHA 2UZKA 1K78A 4NHJA 3VB2A 2STTA 5JI6A 3FMSA 1FY7A 3R61A 1TQPA 4ASNA 2QQBA 3WGHA 2VT2A 1BN5A 2DO7A 2QQAA 1KQ0A 3LAJA 3LAPA 3ZMUA 4WCGA 4WWCA 4O5VA 3ZN0A 2EV0A 2XKPA 1R1UA 2PLYA 1W7PD 5FFXA 4RB3C 3QRFF 1BOAA 3V7SA 1REPC 3I53A 3SHFA 2ESNA 2O0YA 1UHMA 5LBQA 4FX4A 2CSOA 4K2EA 2W24A 4MTEA 4LLLA 1GHCA 5LHGA 4O3MA 5E1XA 3W6KB 3J80K 1FLIA 1TBXA 3WGGA 5IT3A 1OYWA 5HS9A 4UNOA 1PP8F 2Z9OA 1WWXA 4MHGA 3JSOA 3V8JA 5HS8A 2OA4A 1B59A 2QBYB 5FFZA 5TJJA 2ZNZA 3ZMTA 1KGSA 1MDMB 2EA4A 4OU0A 4N9IA 3LQQA 5FD5A 3K1MA 1JE8A 2A07F 4A0YA 1Y0UA 4WX9A 2WV0A 4MGRA 1FX7A 3R60A 4M71A 2EFOA 3KETA 5L3FA 3U1DA 2BV6A 4XLPF 5E1WA 1TQMA 3L7WA 4Q4ZF 3ZMSA 3ERED 1KYWA 2JRTA 4EMSA 3BPVA 2NS0A 2QVOA 5DDGA 4I01A 3GZ5A 1YQAA 3H92A 4ESBA 2F5EA 4ZH4F 3DPLC 1U8RA 1BI0A 3ML6A 2EB7A 2O03A 3P9CA 4HLYA 3O3KA 3HSEA 1H9GA 4G8XA 2MC3A 4CO8A 1YW8A 1ZARA 5CVUA 2G7UA 2XHKA 2ZCWA 3KP7A 5LEKA 4KMUX 1IRGA 4UV9A 5LRRA 3WTUC 2FF4A 2UXNA 5FD6A 4AIHA 4HX7A 4EGYA 4A5NA 4XSZF 5BPDA 3JTHA 1P6RA 2GXBA 3TOBA 4MQVA 5D5UB 2FMYA 1VTNC 5E8GA 3FM5A 2PEXA 3V7RA 1AWCA 1BI2A 2Y0MA 5J8CA 2CWEA 2AXLA 2FNPA 4XBFA 5DCMA 4L0YB 1X3UA 4HX8A 1BC8C 1TNSA 3WTYC 2MA3A 5JHUA 1SD6A 3M8EA 2M1BA 1W5SA 2CG4A 4IRHA 5D5WB 3BJAA 2VONA 1HW2A 1RI7A 1BM9A 4A2UA 2K86A 1HQCA 3SZTA 3GLXA 1IUYA 5L3DA 3B02A 1ZLKA 1V4RA 2F5DA 1YFHA 2A69F 2ZMEA 2GZWA 3TO9A 3SZPA 1XDSA 5CJ9A 2HZTA 4I02A 1SFEA 3BP8A 2ESHA 3DKWA 5LEJA 3KP4A 4LG0B 1HKSA 4F7ZA 4YFKF 2WC2A 5BOXA 1B1BA 1FSEA 3ZMZA 2PN6A 2K4JA 3KP3A 4HQEA 4ETSA 1MKMA 4Y17A 5HDNA 3WODF 5D6EA 1L0OC 3RTRA 2E7WA 4RGUA 2QYOA 1OPCA 3IKTA 1W5TA 2YR2A 2QM3A 5ERIA 4KIFA 2GA2A 5FLXK 5ICEA 3ZP5A 2RVCA 3ELKA 4NQWA 3D5LA 1S6LA 4UV8A 4PDKA 1G3YA 2XVCA 1R7JA 3H3ZA 5IT9Z 3V7CA 3T0YA 4L5JA 4Q5SF 3JTGA 2V9VA 2L3DA 3R0AA 1LDDA 1IF1A 1YTYA 1J9IA 3ZPLA 2IP2A 4WXHA 3WGIA 1HXDA 2GA1A 1I1GA 3MQ0A 1HBXG 1ZH5A 1IN8A 1SMYF 3P9KA 4FT8A 3L09A 4LFUA 1QZZA 3JAMZ 2O61A 2RV8A 3QOPA 2UXXA 1USSA 5H6QA 1O57A 3I0TA 1BJAA 4XRFA 5EEGA 5HVQC 2PI0A 2QWWA 3ZN1A 4IJAA 3CLOA 2TDXA 2NNNA 1ZRCA 1ZG3A 3WU0A 2PMHA 4EJTA 5H6RA 1LJ9A 1CF7A 3WE2A 2PQ8A 4ENKA 1YW9A 4M6XA 1MZBA 1BI3A 2STWA 4M72A 3ECHA 1XCBA 5AONA 1LEAA 2XIGA 4YG2F 4L9NA 1MGTA 3N97A 4LK1F 1G3SA 3GFLA 5LHIA 3P7NA 2VT3A 1MDMA 4IVNA 6PAXA 5IT9K 3DXJF 4A6EA 2L4AA 4I0AA 2W85A 4ZZDA 5CVVA 5JVTA 5J6XA 4G6QA 3QPTA 5K1YA 5CLSA 1D8KA 4WF2A 3HHGA 4CXFA 3DPTA 3R4KA 4Q48A 2EFWA 2HQNA 1FSHA 3KE2A 4OIQF 3L2CA 2P8TA 3KLNA 1Z05A 1J59A 4DQ2A 3GYHX 2P5KA 3F6VA 3REOA 4AWXB 4YIFA 5L3GA 2ISZA 3CUQA 3Q9VA 2W25A 2KJCA 1SD5A 2MLGA 2DAOA 4D0PA 4HF2A 1QGPA 2FMLA 1FWZA 4EVIA 5DEQA 3B73A 5HOOA 4BNCA 3FX3A 2W57A 1V3FA 3WTSC 1O7LA 3E5UA 4PCQA 5D8LB 4PZJA 1LDJA 3KEQA 3CJNA 1ULYA 2ELHA 1PDNC 4BYYA 3HSRA 4RB2C 1LEBA 3KEOA 1KU2A 4B8XA 4LLGF 3FM3A 1J7KA 1J75A 2PBIA 3GWZA 1RIOH 3C1DA 4HV5A 2H94A 3U2RA 1TW3A 4M73A 5AIPA 4OIRF 3F8NA 5A2QK 3E3VA 1S29A 2HTSA 5ICCA 1XN7A 2P7VB 2KJBA 4G94A 2KKOA 2K4BA 4A12A 2F5CA 3IL2A 3T5XA 1O7FA 4HQMA 3M1EA 1R58A 4I7HA 4KN4X 2VC1A 1T0FA 4DNCA 4IPAA 5K5RA 1TLHB 3GFJA 1DPRA 3I4PA 2OZUA 1SAXA 1CF7B 1S3JA 3JSPA 1ODDA 3IC7A 2L54A 2ZKZA 4TV7A 5ILSA 4HA8A 3J80Z 4HYEA 4ESFA 4HAMA 2OBPA 3RIRA 5L3BA 3WU1B 2DTRA 1WQ2A 2ISYA 4KMFA 1E17A 4H0EA 1YS7A 1W7PB 1WKMA 5CVRA 1T39A 2MH2A 3KLOA 2ZJ2A 3F21A 2AS5F 4KUMA 2XKOA 3V4GA 2F5FA 1ZAOA 1IXRC 2HYFA 4KFCA 1MD0A 1T2KA 1QPMA 3V8LA 1HSTA 3Q5FA 1TNTA 4AVPA 4ON0A 2GWRA 2LF7A 2M5WA 3HOTA 3HYIA 2DK8A 1IN4A 2H27A 1ZREA 3F3XA 4WXDA 2R7DA 2A3SA 3C18A 4BQAA 1RZ4A 2ZFWA 1P4WA 3F22A 2VODA
chains in the Genus database with same CATH superfamily
1P4XA 1TT5B 2D1HA 4OMZA 3T8TA 3E6BA 1LB2A 4I09A 2LBFA 2P5LC 1ZG5A 2WY8Q 3F8BA 2V9PA 3FXRA 4M3BA 1I3QJ 5AIQA 3RCOA 2EQRA 4BQQA 3ASNH 3DKXA 3GFIA 1DUXC 2H6CA 2KIMA 4P9FA 2LF8A 1BIBA 2ICWG 4WXCA 2K9LA 3A4CA 4U87A 4R79A 3ISPA 1G2HA 2JK3A 2IA0A 2E1CA 2CUEA 2TCTA 1ZN2A 3OOPA 4BJTA 3NWTA 4V2FA 4JK1X 2EK5A 2KZVA 3RZDJ 4A3DJ 3D5RC 2K27A 2OZ6A 2VE8A 4AIJA 3WG9A 1ZYRF 2F2EA 2QSGX 2P4WA 4XK4A 3CQZJ 3VYUB 5J8FA 3E6MA 4DGWB 2JSPA 4CH7A 2VQHA 4I99C 1XSDA 2X1CA 4D5CA 4EQQA 4CYCB 2NXNB 4UB6C 4L9JA 4Y33A 4CICA 2DU9A 3HJEA 4LD5A 5CQEA 1BR4A 2X85A 2X6OA 2ZXJA 2ZXIA 3L2QA 3CCLI 1SVLA 1EH6A 3U9GA 1UMQA 3I4MJ 1J0RA 1A6QA 2Q8KA 2W4SA 1Z6TA 2MLKA 5BMZA 1HDPA 4CCLA 4UVAA 3HDDA 1RNLA 2A6EF 2PJPA 1V54H 1SD7A 2M9HA 3M1CA 1W0UA 3GTLJ 5D4SA 3SFZA 3LSTA 3ZQCA 3G4SI 2BY2A 3CCYA 3L2VA 3PFIA 2DDAA 4XLCA 4KT5C 3CDLA 1YX5A 1QNTA 2W1OA 2X4HA 3R6SA 3VFZA 2P6SA 2JTVA 2JT1A 1KQ8A 1F43A 4E70A 3JRIA 4E7IA 3KP5A 3RDIA 1EH7A 1JHFA 1UB9A 4U0VA 4OAZA 2WADA 3PL8A 3OYLA 4A6DA 5FJ8J 1MNMC 4HZFA 1TP4A 4ESJA 4ENNA 4HOBA 3CMYA 2R5ZB 2EA2A 2Z16A 4L0ZB 2ELKA 3JW4A 1UELB 2RAEA 4XMYA 4J01A 1OJLA 1L3LA 2PFBA 5J40A 2FA5A 3QQAA 1FC3A 2BZTA 5E3LA 2IRFG 5FLVA 4KIBA 2DPUA 3L2UA 5LRSA 1ON2A 3BDDA 2KISA 3IKVA 1X1PA 1R22A 4A3IJ 4BE2A 2OCEA 3GZNB 2CW7A 2XF5A 1YYVA 1OYYA 3BG7A 1T6SA 2BGCA 3MN2A 2VOOA 4IEJA 1OR7C 2DCEA 2CRGA 2R5YB 1HCRA 3OYDA 1X1AA 1T8IA 1Y1WJ 4KIGA 2HDCA 2A61A 3BZ6A 2VBZA 3I5UA 1RKWA 3J81K 1LDKB 4UUSB 2R5YA 3KPHA 1ZGWA 1G3TA 1O3QA 3S15J 5JVGF 3S2DJ 3BC8A 2XPUA 2HKXA 4GYIA 3QP5A 1KU3A 3IH4A 2HPIA 2YX4A 4F91B 1HW1A 4O6JA 2WWYA 1YHQI 3ABTA 5ILUA 1LNWA 3Q9SA 3I54A 3Q0WA 3D0SA 4YIIA 2K9SA 4NUBA 1NHAA 3GXOA 2HVRA 2VKHA 5GAGJ 2PX9A 3DTIA 2DK5A 4XLAA 1DGRM 2P7CB 5F27A 4ZJZA 1PUEE 2FBHA 5HLHA 3I64A 1WCMJ 1MJ9A 2DW4A 3GFMA 1WFXA 1T33A 1K79A 2H09A 2UWMA 5GP9A 4G12A 3RQ4A 1J2XA 3K10A 3OSGA 2NAZA 4A5MA 5D5VB 2K9MA 3E6DA 1LFUP 3F8CA 4E7JA 3QU6A 1OKRA 2UV1A 4QWQA 1FIAA 4HV6A 2GBYA 4CA0A 2RNJA 4G7OF 3ROUA 2DFFA 2R7FA 2JJ7A 2YU3A 1MMDA 1U5TB 1B9NA 2IW5A 2NYXA 1DDNA 5D5XB 1WGXA 3DU5A 2VJJA 2XAGA 1ETOA 2M3AA 3OV8A 3HOSA 1AHDP 4OWRB 1I39A 2WB1A 2IA2A 3CC7I 2F4IA 3GEZA 1X4OA 3A0BC 5KK1A 3ZQQA 3HEFA 2QKLB 2GIVA 5EZHA 2BXYA 2NOJB 2QA4I 1SMTA 1JTXA 3EYIA 2M30A 3BWGA 3LSJA 3K70C 3DTEA 4B09A 1XTAA 3KZZA 2XRNA 2W48A 4IOCF 1WJAA 2OU2A 3IAM2 2JQ7A 2JMWA 2XGEA 5FO5A 3VEPA 3DLLF 4QSHA 3S1QJ 3OYFA 2DBBA 3ZQIA 4GDFA 1D0YA 3K2ZA 5KNLA 3OR1C 1Z9CA 2XB0X 3BTIA 4FHTA 4KJZA 2O3FA 3K6GA 1VQLI 2V6CA 2M87A 1W4MA 3VDXA 3CUOA 1W36D 3H3UA 5TRDA 1V55H 3K4KA 4E4HA 1IW7F 1SVOA 4I98B 4U0YA 1AKHA 3EQLF 4MNUA 1RR8C 2QGUA 5K5OA 4HF0A 2YU9J 1H8AC 1WZ2A 1F4KA 3H1CA 3DKYA 5KAFC 1HA8A 1K61A 4G7ZF 4M3EA 1R6RA 3SDGA 1Z7UA 2QEXI 1RKTA 4LGWA 5ICGA 4M9ZA 4C3HJ 1MH3A 2VOPA 3OR2C 3BCBA 3IP4B 4P9UA 2YUSA 2FRHA 2QSFX 3VSLA 3H0GJ 1B9MA 2DA2A 2VJIA 2M0CA 2HOSA 3GW2A 3PO2J 3PM1A 2J5PA 1MNDA 1U5TA 1YRNA 1X1BA 2ZSHB 2CS3A 3BR0A 1FPQA 4U7DA 5DCFA 1BBYA 3HZJA 3K4MA 3KEYA 2OTJI 1FYLA 2VODA 1VQ7I 3E97A 1ETYA 2HQRA 3FK6A 3RKXA 1QPIA 3P9IA 3GTKJ 3DWLE 5CVJA 4RBOA 2KL4A 2W84A 3DFGA 2COBA 1TWAJ 2ZNYA 4HF1A 1ONVA 1O4XA 1ENHA 1S7OA 3FZVA 2DMTA 1AA7A 3J7AO 4LK0F 2B0LA 2VPLA 2IS6A 1K83J 1JUSA 1WI3A 3GZ6A 4YFNF 4HDVA 4ZTFA 5K7HA 3M9AA 1J09A 3ABUA 4OOIA 3H0DA 3C3WA 3SXYA 2F4OB 2OD5A 1A6IA 1K6OA 2R7WA 1B4AA 3G73A 1Q1HA 1FYMA 5DTDA 1MMAA 1G59A 1W5CC 2QKMB 1H89C 2E71A 2R7OA 3CUQC 2JRMA 4XRMA 1MSFC 1A36A 4EM1A 2Z33A 4QPQA 4BU2A 4E7LA 3EUHA 1ZQ3P 1PUFA 2GXGA 2R92J 1TC3C 3ZXSA 3G6EI 3FXQA 2FBIA 1Y56A 1VNDA 5J3LA 2E5ZA 4N9HA 4I2OA 4HW0A 3AG1H 3ULQB 1IC8A 1G3WA 2CO5A 3CJRB 4HBLA 4CZZA 1XMKA 2QENA 2HDDA 1UZCA 4U88A 3S2HJ 4GGGA 4J00A 3UNGC 4L9VA 2Q2EB 4ZYHA 1N25A 2EV6A 4ENMA 2A68F 4PSXA 2VN2A 4BHBA 1K78B 3QYBA 1ZG1A 3PO3J 2Q1ZB 3BR6A 3ERMA 2V1XA 3HSFA 5DS9A 3OYBA 5GAHJ 5F0HA 3RJPA 4A0XA 2L02A 4Y4RA 2E19A 3QPHA 1QHGA 2E7XA 3J81Z 4KNYA 1YITI 5HNFA 4CCJA 3A2KA 3PSIA 2YPRA 2M0MA 4R1HA 3EUAA 3K2AA 5LGNA 3O6BB 1ZRFA 5JLWA 3CCRI 4IHWA 1LVAA 3E0JB 3RYRA 4HDUA 4ZYEA 1S7AA 1XGNA 4XLNF 2DT5A 2QLZA 5FGMA 4CYDA 2PJRA 4YEJA 2WBMA 4EM0B 3CCQI 5EJCA 3SYTA 2VBYA 1IXSB 1WRJA 2CV0A 3FISA 2FXAA 1OCZH 2COMA 3FIWA 3CJQB 4IHTA 5E3OA 4E7KA 3WHBA 2B7EA 1NK3P 2IS1A 3HPHA 1ETKA 2EWNA 3FXOA 2HNHA 3CO6C 5TISC 2F48A 2NVXJ 2DYRH 4LITA 4KISA 3DEUA 4PGGA 1BA5A 1SFXA 1R00A 3K9TA 1GDTA 2Y30A 2KPMA 3BCAA 3KCCA 4WK8F 3K70D 3QP6A 4LB6B 2LSOA 2BVMA 2X9DA 1POGA 3ZRGA 3WTXC 4KYWA 1Z3XA 3FWEA 1PJRA 2EFQA 5LLQA 2DOEA 4CZCA 2O8XA 4S04A 1FJLA 2XV4S 3ABLH 3HGGA 3QPLA 3FHZA 2DPDA 3B6CA 2ADUA 3GTGJ 1KQ9A 2X6XA 2JPCA 3LQRA 4AD9A 4A3FJ 2KDOA 3DQVC 3MZYA 3F8MA 3SJMA 1I3AA 1QBJA 4HLXA 3RPUD 4F93B 4XONA 5IP7J 3LSHA 2A5YB 5EG0B 4D1QA 1B72B 2AXTC 2WAFA 5DUIA 4E7SA 4G7HF 1BIAA 2H8RA 3H5NA 1LKXA 2L7KA 3LA7A 5DCMB 1YG2A 1KU9A 2A6HF 4XICA 4BACA 3M4OJ 3H9GA 4RLFA 1T38A 2KP6A 2IA1A 1BC7C 3CCJI 2JA7J 5B66C 4UUSA 3NARA 3F8FA 4AYBN 2OCCH 1TQIA 1FBQA 3QODA 2NRAC 1D8JA 1IG7A 1UJ8A 2XGXA 4EM2A 1A35A 1A04A 4BBSJ 1IO2A 1OQYA 4G6DA 2X51A 3BPXA 2H6BA 1YS6A 1SFOJ 3VOEA 2IVMA 1X2NA 1WJBA 2HVSA 1TL8A 1XB4A 2HZDA 3PNYA 3ZMDA 9ANTA 2BW3A 2FBKA 4MQ9F 3CP2A 3SEZA 2OF7A 5CVIA 3A01B 4DYQA 1YW7A 4FX0A 1R5ID 2MD5A 5FB2A 4EJUA 2CW8A 3QU3A 2KMUA 1LE8B 3PJRA 3TO7A 2JA2A 3M07A 2DJNA 3JREA 1K7AA 1YX3A 2RQPA 2OQGA 5E17F 4A3BJ 3I56I 1Y0NA 1PVEA 2BW3B 2NOGA 2VUMJ 4RB0A 2DQLA 2FNAA 3DEEA 1LVKA 3Q0UA 5F04A 1XC5A 1E0EA 1HKQA 3AG2H 1ZGAA 3HRTA 2VKDA 1JGSA 4BAYA 2OV7A 1XGMA 4Q47A 3ABKH 3LOCA 1SVMA 5E3MA 2LREA 2M4KA 1F1ZA 2QZ8A 1UHSA 1XX5A 2VJ4A 2XSJC 2PG4A 2ZXWH 1GV5A 4II2A 2K7LA 2L01A 2VIXA 3PNTA 2DFIA 1N77A 3DU6A 2VC0A 2HFHA 1JTYA 1O3RA 1XD7A 3J7AY 3HG9A 4RS8A 4RAZA 3K4CA 1JHHA 4M6VA 3W3CA 2DA4A 3OOUA 1T0FC 1R1VA 1UCRA 1YO5C 3F6OA 2XAUA 1I27A 2IGMA 4ZDOA 1WH5A 3NQOA 2K40A 3J7YJ 1KA8A 1IN5A 1SFUA 2BHYA 4QLCU 1DP7P 1ZLJA 3DP7A 4A69C 1FBUA 3G3ZA 2CFOA 5HNHA 4JX6A 2F5VA 3PNVA 5KVRA 2GOXB 2M2EA 1VFCA 1U0JA 2RN7A 2Y75A 1NG7A 2ZSIB 4PJ0C 2X1EA 1ITYA 1FYKA 4LB5A 2A5WA 1T95A 4ITVA 4A3JJ 4N0BA 1Z6RA 1OYIA 2AQFA 3RPUA 5F64A 1R36A 2JSCA 2GLOA 2HKOA 2VBWA 3KZIC 5FKKA 3SQNA 2HEOA 2NVTJ 5HS7A 1IN6A 1XMXA 1Z91A 1TTYA 2Q2EA 4QTRA 2R3SA 2E1NA 1Z1DA 4D5FA 2XRLA 3HIFA 1RPWA 3N05A 2P6TA 4U0WA 2D2WA 2EV5A 4OAYA 4XLHA 1XPXA 1P92A 5J47A 4A93J 1ERDA 2P5VA 2HR3A 1TWCJ 1QU3A 1AOYA 2K02A 2AQEA 5FLMJ 3AL0B 2DODA 3H9QA 3TW6A 3WE3A 2NS7A 5GADJ 3IRQA 1GVJA 1Z0XA 2XB5A 2ZMEB 4P5OA 4ZTJA 3S3MA 2K9NA 2R7XA 3FXKA 2IGKA 5JFRA 3TOAA 4AIDA 1YIJI 3WTWC 1H9TA 4B4CA 2CV1A 2EIJH 2YX7A 4I6ZA 4L5IA 2RC4A 2LDUA 3OYCA 1BOBA 1HSJA 4RGRA 1U9OA 4Y15A 1ZKGA 4RB1A 2XROA 1JJ8C 1NG6A 4OMYA 4JYKA 2L9VA 2XF7A 3M8FA 4W97A 5L3EA 1IXCA 2HYGD 3OIQA 1Y8RB 2HWVA 1JXSA 4HG2A 2OJED 3K69A 2HGCA 2VBXA 3K4NA 2DT7B 3S16J 1U5TC 4M6YA 1WI9A 2VXZA 2D45A 5LGTA 2X0LA 1ORKA 1VQKI 3TKYA 4CCKA 3E7LA 2PMUA 3MWMA 3K1NA 1X3ZB 3NRVA 1ZK8A 5M5YJ 2I8DA 3EPZA 2V1NA 2R7UA 2BE5F 3C7JA 3G1OA 3L00A 4B3XA 4DZPA 1WJFA 1JKQC 1R4MB 1MBKA 3HL2A 3RKWA 2YSRA 3HTSB 4LLNA 1OCTC 3DV8A 4RAYA 4GCVA 1J5YA 5E20A 4KDPA 3HRSA 4Y7NJ 3W2AA 3F23A 1QZYA 1EA3A 1YLFA 3LSGA 3BQYA 3SDBA 5ED4A 3K4JA 1X4PA 4XN0A 1CF7B 2VKEA 2IT0A 1X3WB 2KT0A 2LH9A 2Z99A 2LKPA 4AM3A 2IGNA 3F72A 3SFIA 5DUKA 3W6VA 3I9V2 2DA5A 3VWBA 5IY5H 3PUBA 1EV7A 3HGYA 4IHSA 3HUGB 3M7GA 5JR3A 2Z2SB 1GXPA 2L2OA 3MFKA 1MBJA 2KRFA 3CDHA 5DYMA 3OIPA 4HEA2 3DCFA 1R9TJ 2NNYA 2KRHA 2FEZA 2L4MA 1HC8A 3M3YJ 3NAUA 4R8HA 3CMAI 2R7SA 3BQZA 4UUTA 4UXNA 2E2HJ 1KYZA 4HSRA 2IAIA 2M45A 2L7FP 4BKXA 2O6GE 3QYFA 2WV1A 4I0BA 3BJ6A 1MJAA 1GXQA 4M9SA 5D6FA 1R71A 2GQQA 3AG4H 2XASA 2LD5A 1YRNB 1XGSA 1BJZA 4BXXJ 3LSMA 2M8GX 4A3EJ 2JA5J 4M9XA 4KN7X 1S7EA 4BEHB 3WTVC 2Y9YA 4BE0A 2BY0A 1D3YA 4ZYDA 3D1NI 2WA0A 2P81A 3H5AA 4RGSA 4F55A 3RZOJ 1WJDA 4BHCA 5C44J 3O8HA 1AU7A 1R5HA 1STZA 4U7BA 1ZRDA 3GMEA 3CO7C 1NH3A 1FP2A 4XOTA 5KHDA 1I6HJ 1IRXA 3RPQA 2GOMA 4ZYGA 1IRFA 2JUCA 3ECOA 3HPGA 3ONQA 3O8GA 1WVRA 1BI1A 2DDBA 5GPAA 3FMRA 3ESWB 1P7IA 4XL9A 4YELA 4F52A 3K1PA 2KIQA 4EJOA 3RI4A 4UVCA 1R5GA 4IHVA 1UAAA 2OQRA 1O3SA 3CF2A 1ZHFA 2DI3A 1RETA 3KZYA 2CUFA 4DZJA 4XRSA 3HHHA 1UHWA 3V8KA 1Z21A 3GTQJ 1A5JA 1X1DA 3L2RA 4XLFA 3HOVJ 5CKTA 1RRJA 2Q0OA 3VYSB 3MKZA 2DFEA 2P0WA 2FQ3A 1R1TA 2FQ4A 3IWZA 1F5TA 1EH8A 2JN6A 3PQJA 2A6TA 1OMIA 2EIKH 5DD4A 4BS9A 4D9JA 1XCVA 3EETA 2LY2A 3G1MA 2VQCA 2CQ7A 4UVBA 2LYCA 3CUQB 2IS2A 3FBIB 1D0ZA 5GPCA 1MIJA 2K85A 2WY7Q 2BYVE 1U8BA 5BNGA 4IF4A 1F9NA 5A2QZ 1XGOA 1K6YA 2V7FA 2V1UA 1JUPA 2XAQA 2LMDA 3PQKA 3F0CA 2ELJA 4EGZA 5LGUA 4IRGA 2XAFA 2ETHA 3OYGA 4XSXF 4KITB 3OYEA 3LA2A 1CQTA 1E3PA 3EYYA 2HVQA 1H0MA 4D7MA 3OY9A 3S17J 1C0WA 5ILVA 3L9FA 1ETQA 3PSFA 4D7NA 3TL4X 4IL6C 5D4RA 1ON1A 4NB5A 4L18B 1FOYA 4F92B 1Y39A 1EKEA 2CMPA 3IHUA 3IRRA 2Y48A 4YIRX 3WU2C 3WTZA 1HF0A 1FBSA 4FE7A 5ICFA 5IOZA 5BPIA 4BXUA 4GXOA 1WSUA 2Z3YA 3CCSI 1W36C 4LJZF 2EFPA 3BG9A 4GO1A 1IZ1A 4OIOF 3N4MA 3A0HC 1OCPA 5M3MJ 2FU4A 2KIUA 1MBFA 3COAC 4BDYA 5IPAA 3GF2A 2GIZA 1LFPA 5F1RA 4YFXF 3IH3A 3KP6A 4KT6A 3AG3H 3W6JB 4M3DA 4HRIA 1ZGJA 1Q1VA 3FF5A 1FOKA 1X58A 3IH2A 4RMNA 2KDZA 3P5JA 5L3CA 5DD8A 3IUOA 4NDLA 3I71A 3TDZC 1JJ6C 1WJCA 3K0LA 2W00A 2CYYA 2KLOA 3WTTC 2G0EA 2C6YA 3DEWA 3ZCOA 2W7NA 1U2WA 4G6TB 4A3LJ 2OAZA 3WHCA 5HDKA 2RDPA 1GT0C 3R0JA 1P4AA 2WAQN 2E1MB 3FK7A 4G9YA 1VQ4I 4ZZLA 3E1SA 5KAIC 2LNBA 1B6AA 2R7QA 4PFOA 1R23A 4DW6A 4S0HB 2M8EA 5E1ZB 1K4TA 2EFNA 2PMZA 4CHUA 5BQTA 2CGPA 1DPUA 3RYPA 2GAUA 5EF6A 2WAEA 1MJBA 5CPRB 2Y31A 5IOYA 3QAHA 1OR7A 5H20A 4KA4A 4A3GJ 1RUNA 3E5QA 3HM5A 3NEUA 4CSWA 3GUDA 3MCZA 5HLIA 1UFMA 2JUGA 4OINF 1IAWA 5BS6A 3HRMA 1BW5A 2FD5A 1LUJB 2HS5A 3O2PE 3IAS2 2DA6A 4DJAA 3OYHA 3LSPA 5E18F 1GUUA 1CGPA 4BL0B 4KICA 2LR8A 1NK2P 1VQMI 4XORA 3ZQFA 2DT6A 1QO0D 3UR3C 2XC7A 2EH3A 3BY6A 3EDPA 4PJJA 1RR7A 2V79A 4EJVA 3VODA 1D5VA 1BR2A 1G4DA 2FE3A 4CGZA 4FETA 2JZYA 1LPQA 1U3EM 2XAHA 5EZGA 3U1KA 3PIPF 2J5OA 2V9KA 3G2BA 1Y1VJ 2QQ9A 3RKQA 5FLXZ 1TZLA 3GO5A 2V1DA 3BR5A 2JA8J 3VYRB 4II3A 3BROA 2BY1A 2JVHA 3ZOBA 1FP1D 4V19K 4ZDLA 1RUOA 2FOKA 2HTJA 2E2IJ 1JKOC 5HLGA 2EPFA 5HDGA 5C3EJ 3DTKA 1IV8A 3LFKA 3K4LA 4NC6A 3ZQ7A 4PGHA 3ZR8X 3BOQA 3AKZA 4OIPF 3DPUA 2Z5UA 1U78A 3TGNA 4NQWB 5F6FA 3BZCA 3HUGA 4IRIA 1OCOH 2JPBA 3OMYA 1QVTA 2EJRA 3VSKA 3FXUA 3I59B 4IXAA 2RNGA 2NVYJ 2OPTA 3LA3A 2MBFA 4BH9A 3CTAA 1PP7U 4DIQA 2VI6A 1KZHA 3U21A 1E2XA 5E8IA 3FMQA 2XAJA 3LL7A 5D8KB 4MEXF 4CCMA 1HDDC 2PJRB 3GTOJ 2LP0A 3BT9A 2IPQX 2CU7A 4ENJA 5FKMA 4UUVA 2LRDA 4CDGA 1I6XA 3LSRA 4P1WA 1S9HA 2WTEA 3S32A 3KFWX 4IHYA 1MSEC 3CF5F 2RKHA 1I1SA 4Z2YA 1D1AA 2EINH 4RGXA 3IWFA 4XIDA 2JVGA 4Y13A 1P2FA 3KYDB 4P55A 4IZZA 3S2WA 3EUKL 3MKYB 1QZEA 3DF8A 4S05A 2X1DA 4EV0A 2IJLA 4PFPA 3JAMK 3DBHB 5DV5A 4XM3A 2ZBKA 2KHMA 3ZMVA 3QOEA 1XSVA 2MGQA 1IDZA 4A3KJ 2MH9A 3MZHA 1HKTA 3HOWJ 3BJOA 1MNEA 2MD0A 4JX4A 2XSDC 1ZTRA 3H3VK 1S8NA 1XDUA 5CYVA 3TQNA 2GXAA 1XMAA 2QUFA 5LHHA 2BBYA 2E5NA 3KP2A 4A0ZA 4EJWA 5B5EC 3QWLA 1X2MA 4L9TA 3CDIA 5M5XJ 4CUGA 4C30A 5J1UA 2O8KA 3ASOH 2BVLA 2EZKA 4ANJA 4M74A 3HTUA 4BXFA 1FZPB 1BL0A 2ZMEC 3ZQHA 1F36A 3LSKA 2CQKA 1B8IB 4ABZA 4LMYA 4DOZA 1IN7A 2XGCA 1U6GA 3LWFA 2FSWA 1TW2A 3BTCA 5GAEJ 4LOCA 4CYCA 4AIKA 4M3GA 1YIOA 1XSXA 2DN0A 3I58A 3S8PA 2DJIA 1QQIA 3PFYA 3X2QH 4CCOA 2ACJA 4JP0A 3MEXA 1JT0A 1SFKA 2G9WA 4LG3A 2HQ5A 2RGVA 1W7PA 3Q0VA 1UG2A 2VE9A 5HLTA 2ZC2A 2CW0F 3MAJA 4YRVA 4E7HA 2LY1A 5C4JJ 1LQ1A 2OTLI 1O3TA 1HW5A 2BEOA 1VQOI 2ZO4A 2O9LA 4MEYF 5H2FC 2G7HA 3BR1A 2QBYA 2L0KA 2DQRA 3EUHC 1EF4A 2DXIA 2KIFA 1GLNA 3IV5A 2XUBA 4JBAA 2DOFA 2HOEA 2DA1A 1Z77A 5J1RA 2CFXA 4LG0A 2VJ5A 1QA6A 2Y69H 3TDUC 4P96A 5KCMA 2QCOA 3RKYA 4HNUA 3T1BA 1USTA 5HODA 4GYGA 3GCMA 3HOYJ 3E5XA 2I5UA 1SD4A 3CCVI 3L1PA 4HX4A 3E6CC 4MTDA 1D1CA 3TO6A 3JRFA 2NVUB 3T8RA 1KU7A 1G6NA 2DLLA 5FKOA 2NS8A 4UHTA 3FXJA 1DQUA 3AAFA 2L9NA 2M7AA 3GVAA 3KYLA 2M7BA 5IYDJ 5F0FA 3VPRA 3CZ6A 2ZFUA 4DYCA 1FNNA 3HKZN 1JKRC 3CJTB 4BHPA 2L7ZA 1T98A 2ZB9A 2D1VA 2L5QA 3GX4X 2ZXHA 2R7ZJ 4Y52J 1MW7A 2D5VA 5K5QA 3HRUA 3I59A 4JQFA 5F08A 1FT9A 1I5ZA 5EEHA 2UZKA 1R4NB 1K78A 3H36A 4NHJA 3VB2A 3WG7H 3UKGA 2STTA 5JI6A 2H1KA 3FDYA 2CQQA 3FMSA 2MW8A 4FTHA 3TMOA 4V2GA 4BBRJ 3CP8A 2MABA 3DBLB 1QRYA 1FY7A 3R61A 1TQPA 4ASNA 4RLQA 5FRMA 2RREA 4X0GA 2QQBA 1YJ9I 3WGHA 2FUG2 2OUMA 5J1YA 2VT2A 4DBRA 3PIOF 1BN5A 1VF9A 4BUPA 2CH0A 2DO7A 1VI0A 2QQAA 1S5LC 1KQ0A 4I76A 5DM7F 3LAJA 3BR3A 4QIWN 3LAPA 4XQFA 4X6AJ 3ZMUA 4WCGA 4WWCA 2ME0A 2V4JC 4O5VA 1HOMA 1NTCA 3ZN0A 3MVPA 2EV0A 3JRHA 2LK2A 5B1AH 2XKPA 1R1UA 2ZJRF 1MBEA 3C2HA 2PLYA 4XR6A 3OYMA 1W7PD 2DMPA 5FFXA 4IHXA 3TP3A 4RB3C 3QRFF 3I55I 1BOAA 3MD2A 4C3IJ 3V7SA 3HXLA 2AO9A 1REPC 1G8XA 3I53A 4BGDA 3SHFA 5GTIC 2ESNA 2IXSA 2O0YA 4PSWA 5IYBJ 1UHMA 5LBQA 4FX4A 2EILH 2CSOA 4K2EA 2W24A 4MTEA 4JX5A 4LLLA 4PUSA 5LHGA 4O3MA 3I3LA 1GHCA 4BQOA 5E1XA 3W6KB 2VPRA 3J80K 3DBRB 1FLIA 1TBXA 1T56A 1VZ0A 3WGGA 4B47A 5IT3A 3J7ZI 1OYWA 1FTZA 5HS9A 4A3CJ 4UNOA 3QPSA 5J4VA 4XRSG 1VQ6I 4C9YA 1PP8F 1W1WE 2N8GA 1IDYA 2Z9OA 1H88C 4IOAF 2JWTA 1WWXA 4MHGA 2I10A 2MG4A 3JSOA 1SC7A 3CCMI 1JGGA 3Q3SA 3MKLA 3V8JA 5HS8A 2OA4A 1B59A 4MO7A 5FFZA 3FKIJ 5TJJA 3V42A 4AVZA 1XS9A 2QBYB 1LFBA 2ZNZA 2EZLA 3ZMTA 1KGSA 2LG4A 1MDMB 2EA4A 2E2JJ 4OU0A 2KQRA 3LQQA 4N9IA 4NC7A 1KONA 1EJ9A 5FD5A 2ECBA 3K1MA 3OSFA 3HB9A 2ZJPF 1JE8A 2BHZA 2A07F 2HI3A 4A0YA 3OWTA 1Y0UA 3A1YA 2DYSH 4WX9A 2WV0A 4MGRA 1YJWI 2Y9ZA 1FX7A 3R60A 4M71A 2EFOA 3NWSA 4CCNA 3KETA 5L3FA 3S1MJ 2HXOA 3U1DA 4XKCA 1JT6A 2BV6A 4XLPF 5E1WA 1TQMA 1IV6A 1SANA 3L7WA 4Q4ZF 1B8IA 3FBNB 3ZMSA 3ERED 1KYWA 2JRTA 4B48A 2HOTA 2DFHA 4EMSA 3BPVA 2NS0A 2QVOA 2MFZA 4I01A 5DDGA 2BXZA 3GZ5A 2K3FA 1YQAA 3GTPJ 3H92A 2L7MP 4ESBA 2F5EA 2R5ZA 4ZH4F 3DPLC 1U8RA 1BI0A 1RC9A 1MMSA 3ML6A 4C2UA 2ME6A 3GBGA 2EB7A 1BW6A 1N75A 4DYRA 4FCYA 2O03A 3P9CA 4HLYA 1E3HA 3O3KA 3HSEA 1H9GA 2XGDA 4G8XA 3OL4A 3OYNA 4IQ4A 2MC3A 2ID6A 1XG1A 3OS1A 1R49A 5EDNA 4CO8A 3HOZJ 1QVUA 1YW8A 1ZARA 2XHKA 2G7UA 2ZCWA 3KP7A 5CVUA 5LEKA 4KMUX 3OS0A 3A02A 2LFBA 1WH7A 3JRDA 1OCCH 1IRGA 1E3OC 4UV9A 1UG0A 5LRRA 3WTUC 2FF4A 2UXNA 3FKJA 5FD6A 4AIHA 4HX7A 4EGYA 4A5NA 3I4NJ 2LTPA 4XSZF 2ZJQF 3JTHA 1P6RA 5M5WJ 5BPDA 1JKPC 2GXBA 4EEFG 2MC4A 3TOBA 1DP3A 2R93J 4MQVA 5D5UB 3RQIA 4MFEA 2QQ8A 2TRTA 2FMYA 1VTNC 5E8GA 3FM5A 3HKZA 2PEXA 4MLOA 3V7RA 1YE9A 2QF7A 5EEAA 3H35A 1AWCA 1BI2A 3MKWB 4FASD 1IRZA 3CC4I 3H9JA 3TP0A 2Y0MA 5J8CA 3OYAA 3FXLA 1HLVA 3VYTB 2CWEA 2AXLA 2FOWA 3BR2A 2FNPA 2EIMH 2DTZA 4XBFA 2AHQA 4RM2A 2V6EA 4W1UA 1IGNA 5DCMA 4L0YB 1X3UA 3JRAA 4HX8A 1BC8C 1B72A 1FMVA 2IS4A 2CUJA 2QSHX 4A3MJ 1TNSA 3WTYC 1LE8A 5E3NA 2MA3A 5JHUA 1SD6A 3M8EA 2M1BA 1W5SA 2CG4A 3JSPA 3S1RJ 3C2BA 4IRHA 1SAUA 3BJAA 5D5WB 2VONA 2CV2A 3MMYB 1MMNA 1HW2A 1RI7A 4C2TA 2JA6J 1BM9A 4A2UA 1ZR4A 2K86A 2F4MB 2FX0A 1TT0A 1HQCA 2Z1DA 3SZTA 3GLXA 2VXDA 3G71I 2PMZN 1IUYA 1JI8A 1FEXA 2O7OA 5L3DA 3B02A 2A05A 1ZLKA 1V4RA 2F5DA 2LKSA 1FMWA 1YFHA 2E1OA 4Y3OA 3BTLA 2A69F 2ZMEA 3S3NA 2GZWA 3TO9A 2XDVA 3SZPA 1XDSA 4RDUA 5CJ9A 2HZTA 3ZGKA 2X6WA 4I02A 1X1CA 1SFEA 3BP8A 2ESHA 5FKNA 3TEDA 3DKWA 3W2WA 5LEJA 4AUXA 5TGTA 2B63J 3KP4A 3CCUI 4LG0B 4XOPA 1PUFB 1HKSA 3A03A 1DGWY 4F7ZA 2E35A 4BY1J 4YFKF 3GTJJ 2K3PA 4RM3A 2DA7A 1BR1A 1TWGJ 3BTJA 2WC2A 5BOXA 1B1BA 4NNJA 3KYCB 1FSEA 3DLAA 3ZMZA 5IP6A 1IJWC 1P7JA 2PN6A 2M4GA 3GLLA 4JOMA 2K4JA 3KP3A 4HQEA 2O5RA 4ETSA 1MKMA 4Y17A 1FOXA 2DMNA 5E79C 5HDNA 3WODF 5EYRA 1U9NA 4XLEA 5D6EA 1L0OC 3RTRA 3CC2I 4AYBA 2E7WA 4RGUA 3FHNA 2QYOA 1OPCA 1VQ8I 2EZIA 3IKTA 1W5TA 2YR2A 2QM3A 3FXMA 1P9QC 4GRIA 4KIFA 5ERIA 2GA2A 5FLXK 5ICEA 3ZP5A 3S1NJ 2RVCA 2KZGA 3ELKA 4NQWA 5CQGA 2XPWA 4B3AA 2HOAA 2HDWA 2F6CA 2V26A 3D5LA 3H5RA 2RQQA 1S6LA 4HNVA 4E7ZA 4UV8A 4PDKA 4ZDPA 5B3SH 1G3YA 2XVCA 1R7JA 3OYKA 4AU7A 3PUFA 3H3ZA 5IT9Z 3V7CA 3T0YA 5B1BH 1ETWA 2VB6A 3AL0C 4L5JA 4Q5SF 2L9SA 1VQPI 3JTGA 2V9VA 2L3DA 5J4YA 2H1LA 3R0AA 3BZKA 2DOAA 1LDDA 1IF1A 1YTYA 1J9IA 3ZPLA 2IP2A 2DMUA 5M3FJ 3F9KA 2IBDA 4FE4A 1IUFA 2CQXA 2CQNA 4WXHA 4E6KG 2KFDA 2LBFB 1YJNI 3WGIA 2R7RA 1HXDA 2GA1A 1I1GA 3MQ0A 1HBXG 1ZH5A 4LIVA 1M1EB 2BOLA 2IGOA 2YS9A 3M8JA 4HSTA 4BJ6C 3JR9A 1IN8A 1SMYF 1WPKA 3P9KA 2Y2ZA 3L09A 2CJJA 4FT8A 1ZR2A 4LFUA 1QZZA 3JAMZ 2O61A 4GFBA 1GV2A 4ZC3A 2RV8A 2NVQJ 3QOPA 3K7AJ 2UXXA 1USSA 4QPOA 5H6QA 2E34A 1O57A 3I0TA 3MZ8A 4Z6YA 3JRGA 1V5GA 3QYEA 1D5YA 2ID3A 3GTMJ 1BJAA 2HU9A 2R7VA 2X6YA 4XRFA 5EEGA 1APLC 5HVQC 2PI0A 2LKXA 1FTTA 2M34A 2QWWA 3ZN1A 4DBQA 4IJAA 3CLOA 3OYIA 2TDXA 2NNNA 4IKFA 1Z7LA 5EGOB 1ZRCA 1ZG3A 2R7TA 1AKHB 4LIUA 1N78A 1OISA 3WU0A 2PMHA 1FOWA 2W82A 2LY9A 4EJTA 5H6RA 1LJ9A 2Y0SA 2B9SA 1CF7A 5K7FA 1K4SA 3WE2A 1SEUA 2PQ8A 2R4GA 4ENKA 4HNTA 1YW9A 3LMMA 2GM4A 4PK4A 4M6XA 4MFDA 1MZBA 2OC6A 1BI3A 2STWA 2VQLA 4M72A 3RSNA 1Z67A 3ECHA 4EATA 4IO9F 1XCBA 5AONA 1FIPA 1LEAA 2XIGA 5FKLA 1OCRH 2X48A 4L9NA 4YG2F 3S3OA 1QHHD 1MGTA 3N97A 4LK1F 1G3SA 3GFLA 5LHIA 1ETVA 2VLAA 1D1BA 3P7NA 2VT3A 1MDMA 4IVNA 6PAXA 5IT9K 4X1EA 3DXJF 4A6EA 4PJMA 2L4AA 1MH4A 2BY3A 1VQ5I 4I0AA 3OL3A 2W85A 4ZZDA 5CVVA 5JVTA 5J6XA 4G6QA 1WJEA 3QPTA 5K1YA 5CLSA 1D8KA 5JLXA 4WF2A 3HOXJ 5FRNA 3HHGA 4CXFA 3DPTA 3R4KA 3L2WA 1GVDA 4Q48A 4ZYAA 2EFWA 2HQNA 1FSHA 3KE2A 4OIQF 3L2CA 2P8TA 1D0XA 5K7ZA 4BJ5C 1Z3YA 4H4KC 3KLNA 1Z05A 1J59A 4DQ2A 1OLTA 3GYHX 2P5KA 3F6VA 3SEQA 3REOA 4AWXB 1VQNI 4YIFA 5L3GA 5IP9J 2ISZA 3CUQA 1TWFJ 2MSYA 5DM6F 3OS2A 2E1MC 1MBGA 2E36A 3KIOA 1I50J 3Q9VA 4UY8I 2W25A 2KJCA 1SD5A 2MLGA 2DAOA 4B1RA 4D0PA 4BQNA 4HF2A 1QGPA 2FMLA 1FWZA 2XPVA 3LNQA 2DA3A 2LLKA 3TBIA 2ECCA 4RA2A 3C2GA 4XKBA 1YI2I 4C2MJ 1W0TA 1ZELA 4EVIA 1PYVA 3B73A 5DEQA 5HOOA 1YOVB 3BG3A 4BNCA 3FX3A 4HPQA 2W57A 4BE1A 1V3FA 3WTSC 1O7LA 3E5UA 1DU6A 4PCQA 4FISA 4BY7J 4PZJA 3ABMH 5D8LB 1LDJA 3KEQA 3CJNA 3ZQGA 2HPMA 3LSIA 1A31A 1ULYA 2ELHA 4BYYA 1PDNC 5FROA 3HSRA 3KX2A 4RB2C 1LEBA 4XKVA 3KEOA 1KU2A 1JUMA 4B8XA 4LLGF 5EG0A 2XF6A 3FM3A 5JHFA 1J7KA 5LD2C 1J75A 4UB8C 2PBIA 3LFUA 2LOOA 3GWZA 1RIOH 3C1DA 4HV5A 2H94A 1MMGA 3U2RA 2FJ1A 1TW3A 4M73A 5AIPA 4OIRF 4J19A 3A01A 3K4BA 2HYJA 4IQJA 3F8NA 4MIMA 2WAQA 5A2QK 3E3VA 2WB1N 4XN3A 1S29A 2HTSA 5ICCA 3ZQLA 1V5FA 1XN7A 2P7VB 5F1JA 2VASA 2KJBA 2VKVA 4AC0A 4PJNA 3AFHA 4G94A 1ACIA 4L5EA 2KKOA 2K4BA 4A12A 4RAFA 2F5CA 3IL2A 1T08B 3T5XA 1O7FA 4N4NB 4HQMA 3M1EA 1R58A 1X19A 4I7HA 2LC2A 4KN4X 3JRBA 2VC1A 1T0FA 3SZGA 4DNCA 2EBIA 2VL8A 4IPAA 4C3JJ 3HOUJ 5K5RA 1TLHB 3GFJA 1DPRA 2HXIA 5GTHC 3OYJA 3I4PA 3JCUC 2OZUA 4NBQA 2IEKA 3HC7A 1SAXA 4FQGA 1S3JA 4XKWA 1ODDA 3IC7A 2L54A 2ZKZA 4NC8A 4TV7A 4HA8A 5ILSA 4F3QA 3J80Z 1WHUA 4HYEA 2Y0SN 2DMQA 1OFCX 4ESFA 4B44A 4HAMA 1V5EA 2OBPA 3RIRA 5L3BA 3WU1B 2DTRA 5C4XJ 1WQ2A 2R0QC 4RAGA 3S14J 4BEHA 2ISYA 1DU0A 2CUZA 4KMFA 1E17A 2EZHA 3CD6I 3B6AA 4H0EA 2E60A 1Y8QB 1YS7A 2K5CA 3BG5A 1W7PB 1WKMA 5CVRA 2LVSA 3CMMA 1T39A 2K9QA 2MH2A 5LFAA 4B43A 3KLOA 2ZJ2A 3F21A 3CLQA 2AS5F 3BG6A 4KUMA 2XKOA 3V4GA 5EGOA 2F5FA 4M3FA 3CESA 3CCEI 2VQGA 1WJ5A 1ZAOA 3CMEI 1RESA 1IXRC 2HYFA 4KFCA 1MD0A 1T2KA 1MBHA 2MYSA 1QPMA 3V8LA 3HBLA 1HSTA 3OIOA 5F0CA 3TW7A 5IYCJ 4IX7A 3Q5FA 1TNTA 1TWHJ 2L9RA 4AVPA 4ON0A 3G1LA 4XNFA 1ETXA 4BDZA 1Y6IA 1S72I 2UUZA 3BLYA 2GWRA 2H8WA 2LF7A 1VQ9I 2M5WA 3D5SC 3HOTA 3HYIA 2DK8A 1IN4A 2H27A 4PJLA 2KRCA 1ZREA 2HQAA 3F3XA 4N4OB 4WXDA 2R7DA 2A3SA 3C18A 3JRCA 4BQAA 1RZ4A 3S93A 2ZFWA 1P4WA 3F22A 3W2VA
chains in the Genus database with same CATH topology
1P4XA 2D1HA 4OMZA 3T8TA 3E6BA 1LB2A 4I09A 1ZG5A 2P5LC 3F8BA 3FXRA 5AIQA 3GFIA 1DUXC 2H6CA 2KIMA 4P9FA 2LF8A 1BIBA 4WXCA 4R79A 3ISPA 2IA0A 2E1CA 1ZN2A 3OOPA 4JK1X 2EK5A 2K27A 2OZ6A 2VE8A 4AIJA 3WG9A 1ZYRF 2F2EA 2P4WA 5J8FA 3E6MA 1XSDA 4EQQA 4L9JA 4CICA 2DU9A 4LD5A 2ZXJA 1EH6A 3U9GA 1J0RA 2Q8KA 1Z6TA 2MLKA 5BMZA 4UVAA 1RNLA 2A6EF 2PJPA 1SD7A 5D4SA 3SFZA 3LSTA 3PFIA 4KT5C 3VFZA 1QNTA 2X4HA 3R6SA 2P6SA 2JTVA 2JT1A 1KQ8A 4E70A 3KP5A 3RDIA 1EH7A 1JHFA 1UB9A 4U0VA 4A6DA 4HZFA 4ESJA 4ENNA 4HOBA 2EA2A 4L0ZB 3JW4A 1L3LA 2PFBA 2FA5A 1FC3A 2IRFG 4KIBA 2DPUA 5LRSA 1ON2A 3BDDA 3IKVA 1R22A 1YYVA 1OYYA 1T6SA 2BGCA 2VOOA 4KIGA 2HDCA 2A61A 3BZ6A 2VBZA 3I5UA 3J81K 1LDKB 1G3TA 1O3QA 2HKXA 4GYIA 3QP5A 1KU3A 2YX4A 1HW1A 4O6JA 2WWYA 3ABTA 5ILUA 1LNWA 3Q9SA 3I54A 4YIIA 3D0SA 1NHAA 3GXOA 2DK5A 2P7CB 1PUEE 2FBHA 5HLHA 3I64A 1MJ9A 2DW4A 3GFMA 1K79A 2H09A 2UWMA 1J2XA 2NAZA 4A5MA 5D5VB 3E6DA 3F8CA 3QU6A 1OKRA 4QWQA 4HV6A 2RNJA 4G7OF 3ROUA 2R7FA 2YU3A 1U5TB 1B9NA 2IW5A 2NYXA 1DDNA 5D5XB 2XAGA 3HOSA 3OV8A 2IA2A 3GEZA 5KK1A 2GIVA 1SMTA 3EYIA 2M30A 3BWGA 4B09A 3KZZA 2XRNA 2OU2A 5FO5A 3VEPA 2DBBA 3K2ZA 1Z9CA 4FHTA 2O3FA 2V6CA 2M87A 1W4MA 3CUOA 3H3UA 5TRDA 1IW7F 4I98B 4U0YA 3EQLF 4MNUA 5K5OA 4HF0A 1F4KA 4G7ZF 1Z7UA 4LGWA 5ICGA 4M9ZA 2VOPA 4P9UA 2FRHA 1B9MA 3GW2A 2J5PA 1U5TA 1FPQA 4U7DA 5DCFA 1BBYA 1FYLA 3E97A 2HQRA 3RKXA 3P9IA 5CVJA 2W84A 3DFGA 2ZNYA 4HF1A 1ONVA 1S7OA 3FZVA 3J7AO 4LK0F 2B0LA 3GZ6A 4YFNF 4HDVA 3M9AA 3ABUA 4OOIA 3C3WA 3SXYA 2OD5A 1FYMA 1K6OA 1B4AA 3G73A 1Q1HA 3CUQC 4EM1A 2Z33A 3EUHA 2GXGA 3FXQA 2FBIA 4N9HA 4I2OA 4HW0A 3ULQB 1G3WA 2CO5A 4CZZA 4HBLA 1XMKA 2QENA 4U88A 4GGGA 4L9VA 4ZYHA 2EV6A 4ENMA 2A68F 2VN2A 4BHBA 1K78B 1ZG1A 2V1XA 3HSFA 3RJPA 4A0XA 2L02A 3QPHA 3J81Z 2E7XA 4KNYA 2YPRA 4R1HA 5LGNA 1ZRFA 3O6BB 1LVAA 3RYRA 4HDUA 4ZYEA 1S7AA 1XGNA 4XLNF 2DT5A 2QLZA 5FGMA 4CYDA 4EM0B 2VBYA 1IXSB 1WRJA 2FXAA 2COMA 4IHTA 2EWNA 3CO6C 3DEUA 4PGGA 1SFXA 1R00A 3K9TA 3KCCA 4WK8F 3QP6A 4LB6B 2LSOA 3WTXC 4KYWA 3FWEA 2EFQA 5LLQA 2O8XA 4S04A 2XV4S 3FHZA 2DPDA 2ADUA 1KQ9A 3LQRA 2JPCA 4AD9A 3DQVC 3MZYA 3F8MA 1QBJA 4HLXA 2A5YB 4G7HF 5DUIA 1BIAA 5DCMB 3LA7A 1YG2A 1KU9A 2A6HF 1T38A 2IA1A 1BC7C 3F8FA 2NRAC 1TQIA 1FBQA 1D8JA 2XGXA 4EM2A 1A04A 4G6DA 3BPXA 2H6BA 1YS6A 3VOEA 2IVMA 1XB4A 3ZMDA 2FBKA 4MQ9F 5CVIA 1YW7A 4FX0A 2MD5A 5FB2A 4EJUA 3QU3A 3TO7A 1K7AA 2RQPA 2OQGA 5E17F 4RB0A 2DQLA 2FNAA 1HKQA 1ZGAA 3HRTA 1JGSA 4BAYA 1XGMA 4Q47A 1F1ZA 2QZ8A 2PG4A 2K7LA 2L01A 2DFIA 2VC0A 2HFHA 1O3RA 1XD7A 4RS8A 4RAZA 1JHHA 1R1VA 1UCRA 1YO5C 3F6OA 1I27A 3NQOA 1KA8A 1IN5A 1SFUA 4QLCU 1DP7P 1ZLJA 3DP7A 1FBUA 3G3ZA 5KVRA 2RN7A 2Y75A 1FYKA 4LB5A 4N0BA 1Z6RA 1OYIA 3RPUA 5F64A 1R36A 2JSCA 2HKOA 2VBWA 3SQNA 2HEOA 5HS7A 1IN6A 1Z91A 1TTYA 2Q2EA 2R3SA 2E1NA 1Z1DA 3HIFA 2P6TA 4U0WA 2D2WA 2EV5A 1P92A 2P5VA 2HR3A 1AOYA 2K02A 3WE3A 3IRQA 1GVJA 2ZMEB 4P5OA 5JFRA 3TOAA 3WTWC 1H9TA 2YX7A 4L5IA 2RC4A 2LDUA 1HSJA 4RGRA 4Y15A 4RB1A 2XROA 4OMYA 3M8FA 5L3EA 1IXCA 2HYGD 2HWVA 1JXSA 3K69A 2HGCA 2VBXA 1U5TC 4M6YA 1WI9A 2VXZA 2D45A 5LGTA 2X0LA 3TKYA 2PMUA 3MWMA 3K1NA 3NRVA 2BE5F 3C7JA 3L00A 3RKWA 2YSRA 3HTSB 4LLNA 3DV8A 4RAYA 4GCVA 1J5YA 5E20A 4KDPA 3HRSA 3F23A 1QZYA 1YLFA 5ED4A 2IT0A 2Z99A 2LKPA 3F72A 5DUKA 1EV7A 4IHSA 3M7GA 5JR3A 1GXPA 3MFKA 2KRFA 3CDHA 5DYMA 2NNYA 2FEZA 2L4MA 4R8HA 4UXNA 1KYZA 2M45A 2O6GE 4I0BA 3BJ6A 1MJAA 1GXQA 4M9SA 5D6FA 2GQQA 2XASA 1XGSA 4M9XA 4KN7X 3WTVC 1D3YA 4ZYDA 4RGSA 4BHCA 1R5HA 1STZA 4U7BA 1ZRDA 3CO7C 1FP2A 3RPQA 4ZYGA 1IRFA 3ECOA 1BI1A 3FMRA 3K1PA 3RI4A 4EJOA 4UVCA 1R5GA 2OQRA 1O3SA 1ZHFA 2DI3A 3KZYA 3HHHA 1UHWA 3V8KA 2Q0OA 2FQ3A 1R1TA 3IWZA 1F5TA 1EH8A 3PQJA 1OMIA 5DD4A 1XCVA 3EETA 4UVBA 3CUQB 2BYVE 4IF4A 1F9NA 5A2QZ 1XGOA 2V1UA 2XAQA 3PQKA 4EGZA 5LGUA 4IRGA 2XAFA 2ETHA 4XSXF 3LA2A 3EYYA 1H0MA 1C0WA 5ILVA 3L9FA 5D4RA 1ON1A 4NB5A 4L18B 3IHUA 3IRRA 2Y48A 3WTZA 1FBSA 5ICFA 5BPIA 4BXUA 4GXOA 1WSUA 2Z3YA 4LJZF 2EFPA 4GO1A 1IZ1A 4OIOF 3N4MA 2FU4A 2KIUA 3COAC 3GF2A 5F1RA 4YFXF 3KP6A 3W6JB 1ZGJA 1FOKA 3FF5A 5L3CA 5DD8A 3TDZC 3I71A 3K0LA 2CYYA 3WTTC 2C6YA 1U2WA 2OAZA 5HDKA 2RDPA 3R0JA 1P4AA 4G9YA 4ZZLA 2LNBA 1B6AA 1R23A 2M8EA 5E1ZB 2EFNA 4CHUA 5BQTA 2CGPA 1DPUA 3RYPA 2GAUA 1MJBA 3QAHA 1OR7A 5H20A 4KA4A 1RUNA 3E5QA 3NEUA 3GUDA 3MCZA 5HLIA 1UFMA 4OINF 1IAWA 5BS6A 3HRMA 2HS5A 3O2PE 5E18F 1CGPA 4KICA 1QO0D 3BY6A 3EDPA 2V79A 4EJVA 3VODA 1D5VA 1G4DA 2FE3A 4CGZA 2JZYA 1U3EM 2XAHA 2J5OA 2QQ9A 5FLXZ 3GO5A 2V1DA 3BROA 1FP1D 1RUOA 2FOKA 2HTJA 5HLGA 5HDGA 3LFKA 3ZQ7A 4PGHA 3BOQA 4OIPF 2Z5UA 1U78A 3TGNA 5F6FA 4IRIA 3HUGA 2JPBA 2EJRA 3FXUA 3I59B 4IXAA 3LA3A 2MBFA 4BH9A 3CTAA 1PP7U 1E2XA 5E8IA 3FMQA 2XAJA 5D8KB 4MEXF 2IPQX 4ENJA 4UUVA 4CDGA 1I6XA 2WTEA 3KFWX 2RKHA 1I1SA 4Z2YA 4RGXA 3IWFA 4Y13A 1P2FA 4P55A 3S2WA 3DF8A 4S05A 4EV0A 2IJLA 3JAMK 5DV5A 2ZBKA 3ZMVA 1XSVA 2MH9A 3MZHA 1HKTA 3BJOA 1S8NA 1XDUA 5CYVA 3TQNA 1XMAA 2QUFA 5LHHA 2BBYA 3KP2A 4A0ZA 4EJWA 4L9TA 4M74A 3HTUA 1FZPB 2CQKA 4LMYA 1IN7A 1U6GA 3LWFA 2FSWA 1TW2A 4AIKA 1YIOA 1XSXA 3I58A 1QQIA 2ACJA 3MEXA 2G9WA 2RGVA 1W7PA 2VE9A 2CW0F 3MAJA 1LQ1A 1O3TA 1HW5A 2BEOA 2ZO4A 4MEYF 2G7HA 2QBYA 2DQRA 2KIFA 2XUBA 4JBAA 2HOEA 2CFXA 4LG0A 3TDUC 4P96A 3RKYA 3T1BA 1USTA 4GYGA 3E5XA 1SD4A 4HX4A 3E6CC 4MTDA 3TO6A 3T8RA 1KU7A 1G6NA 2DLLA 4UHTA 3AAFA 3GVAA 1FNNA 4BHPA 1T98A 2D1VA 3GX4X 5K5QA 3HRUA 3I59A 4JQFA 1FT9A 1I5ZA 5EEHA 2UZKA 1K78A 4NHJA 3VB2A 2STTA 5JI6A 3FMSA 1FY7A 3R61A 1TQPA 4ASNA 2QQBA 3WGHA 2VT2A 1BN5A 2DO7A 2QQAA 1KQ0A 3LAJA 3LAPA 3ZMUA 4WCGA 4WWCA 4O5VA 3ZN0A 2EV0A 2XKPA 1R1UA 2PLYA 1W7PD 5FFXA 4RB3C 3QRFF 1BOAA 3V7SA 1REPC 3I53A 3SHFA 2ESNA 2O0YA 1UHMA 5LBQA 4FX4A 2CSOA 4K2EA 2W24A 4MTEA 4LLLA 1GHCA 5LHGA 4O3MA 5E1XA 3W6KB 3J80K 1FLIA 1TBXA 3WGGA 5IT3A 1OYWA 5HS9A 4UNOA 1PP8F 2Z9OA 1WWXA 4MHGA 3JSOA 3V8JA 5HS8A 2OA4A 1B59A 2QBYB 5FFZA 5TJJA 2ZNZA 3ZMTA 1KGSA 1MDMB 2EA4A 4OU0A 4N9IA 3LQQA 5FD5A 3K1MA 1JE8A 2A07F 4A0YA 1Y0UA 4WX9A 2WV0A 4MGRA 1FX7A 3R60A 4M71A 2EFOA 3KETA 5L3FA 3U1DA 2BV6A 4XLPF 5E1WA 1TQMA 3L7WA 4Q4ZF 3ZMSA 3ERED 1KYWA 2JRTA 4EMSA 3BPVA 2NS0A 2QVOA 5DDGA 4I01A 3GZ5A 1YQAA 3H92A 4ESBA 2F5EA 4ZH4F 3DPLC 1U8RA 1BI0A 3ML6A 2EB7A 2O03A 3P9CA 4HLYA 3O3KA 3HSEA 1H9GA 4G8XA 2MC3A 4CO8A 1YW8A 1ZARA 5CVUA 2G7UA 2XHKA 2ZCWA 3KP7A 5LEKA 4KMUX 1IRGA 4UV9A 5LRRA 3WTUC 2FF4A 2UXNA 5FD6A 4AIHA 4HX7A 4EGYA 4A5NA 4XSZF 5BPDA 3JTHA 1P6RA 2GXBA 3TOBA 4MQVA 5D5UB 2FMYA 1VTNC 5E8GA 3FM5A 2PEXA 3V7RA 1AWCA 1BI2A 2Y0MA 5J8CA 2CWEA 2AXLA 2FNPA 4XBFA 5DCMA 4L0YB 1X3UA 4HX8A 1BC8C 1TNSA 3WTYC 2MA3A 5JHUA 1SD6A 3M8EA 2M1BA 1W5SA 2CG4A 4IRHA 5D5WB 3BJAA 2VONA 1HW2A 1RI7A 1BM9A 4A2UA 2K86A 1HQCA 3SZTA 3GLXA 1IUYA 5L3DA 3B02A 1ZLKA 1V4RA 2F5DA 1YFHA 2A69F 2ZMEA 2GZWA 3TO9A 3SZPA 1XDSA 5CJ9A 2HZTA 4I02A 1SFEA 3BP8A 2ESHA 3DKWA 5LEJA 3KP4A 4LG0B 1HKSA 4F7ZA 4YFKF 2WC2A 5BOXA 1B1BA 1FSEA 3ZMZA 2PN6A 2K4JA 3KP3A 4HQEA 4ETSA 1MKMA 4Y17A 5HDNA 3WODF 5D6EA 1L0OC 3RTRA 2E7WA 4RGUA 2QYOA 1OPCA 3IKTA 1W5TA 2YR2A 2QM3A 5ERIA 4KIFA 2GA2A 5FLXK 5ICEA 3ZP5A 2RVCA 3ELKA 4NQWA 3D5LA 1S6LA 4UV8A 4PDKA 1G3YA 2XVCA 1R7JA 3H3ZA 5IT9Z 3V7CA 3T0YA 4L5JA 4Q5SF 3JTGA 2V9VA 2L3DA 3R0AA 1LDDA 1IF1A 1YTYA 1J9IA 3ZPLA 2IP2A 4WXHA 3WGIA 1HXDA 2GA1A 1I1GA 3MQ0A 1HBXG 1ZH5A 1IN8A 1SMYF 3P9KA 4FT8A 3L09A 4LFUA 1QZZA 3JAMZ 2O61A 2RV8A 3QOPA 2UXXA 1USSA 5H6QA 1O57A 3I0TA 1BJAA 4XRFA 5EEGA 5HVQC 2PI0A 2QWWA 3ZN1A 4IJAA 3CLOA 2TDXA 2NNNA 1ZRCA 1ZG3A 3WU0A 2PMHA 4EJTA 5H6RA 1LJ9A 1CF7A 3WE2A 2PQ8A 4ENKA 1YW9A 4M6XA 1MZBA 1BI3A 2STWA 4M72A 3ECHA 1XCBA 5AONA 1LEAA 2XIGA 4YG2F 4L9NA 1MGTA 3N97A 4LK1F 1G3SA 3GFLA 5LHIA 3P7NA 2VT3A 1MDMA 4IVNA 6PAXA 5IT9K 3DXJF 4A6EA 2L4AA 4I0AA 2W85A 4ZZDA 5CVVA 5JVTA 5J6XA 4G6QA 3QPTA 5K1YA 5CLSA 1D8KA 4WF2A 3HHGA 4CXFA 3DPTA 3R4KA 4Q48A 2EFWA 2HQNA 1FSHA 3KE2A 4OIQF 3L2CA 2P8TA 3KLNA 1Z05A 1J59A 4DQ2A 3GYHX 2P5KA 3F6VA 3REOA 4AWXB 4YIFA 5L3GA 2ISZA 3CUQA 3Q9VA 2W25A 2KJCA 1SD5A 2MLGA 2DAOA 4D0PA 4HF2A 1QGPA 2FMLA 1FWZA 4EVIA 5DEQA 3B73A 5HOOA 4BNCA 3FX3A 2W57A 1V3FA 3WTSC 1O7LA 3E5UA 4PCQA 5D8LB 4PZJA 1LDJA 3KEQA 3CJNA 1ULYA 2ELHA 1PDNC 4BYYA 3HSRA 4RB2C 1LEBA 3KEOA 1KU2A 4B8XA 4LLGF 3FM3A 1J7KA 1J75A 2PBIA 3GWZA 1RIOH 3C1DA 4HV5A 2H94A 3U2RA 1TW3A 4M73A 5AIPA 4OIRF 3F8NA 5A2QK 3E3VA 1S29A 2HTSA 5ICCA 1XN7A 2P7VB 2KJBA 4G94A 2KKOA 2K4BA 4A12A 2F5CA 3IL2A 3T5XA 1O7FA 4HQMA 3M1EA 1R58A 4I7HA 4KN4X 2VC1A 1T0FA 4DNCA 4IPAA 5K5RA 1TLHB 3GFJA 1DPRA 3I4PA 2OZUA 1SAXA 1CF7B 1S3JA 3JSPA 1ODDA 3IC7A 2L54A 2ZKZA 4TV7A 5ILSA 4HA8A 3J80Z 4HYEA 4ESFA 4HAMA 2OBPA 3RIRA 5L3BA 3WU1B 2DTRA 1WQ2A 2ISYA 4KMFA 1E17A 4H0EA 1YS7A 1W7PB 1WKMA 5CVRA 1T39A 2MH2A 3KLOA 2ZJ2A 3F21A 2AS5F 4KUMA 2XKOA 3V4GA 2F5FA 1ZAOA 1IXRC 2HYFA 4KFCA 1MD0A 1T2KA 1QPMA 3V8LA 1HSTA 3Q5FA 1TNTA 4AVPA 4ON0A 2GWRA 2LF7A 2M5WA 3HOTA 3HYIA 2DK8A 1IN4A 2H27A 1ZREA 3F3XA 4WXDA 2R7DA 2A3SA 3C18A 4BQAA 1RZ4A 2ZFWA 1P4WA 3F22A 2VODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4X A;  2D1H A;  4OMZ A;  3T8T A;  3E6B A;  1LB2 A;  4I09 A;  1ZG5 A;  2P5L C;  3F8B A;  3FXR A;  5AIQ A;  3GFI A;  1DUX C;  2H6C A;  2KIM A;  4P9F A;  2LF8 A;  1BIB A;  4WXC A;  4R79 A;  3ISP A;  2IA0 A;  2E1C A;  1ZN2 A;  3OOP A;  4JK1 X;  2EK5 A;  2K27 A;  2OZ6 A;  2VE8 A;  4AIJ A;  3WG9 A;  1ZYR F;  2F2E A;  2P4W A;  5J8F A;  3E6M A;  1XSD A;  4EQQ A;  4L9J A;  4CIC A;  2DU9 A;  4LD5 A;  2ZXJ A;  1EH6 A;  3U9G A;  1J0R A;  2Q8K A;  1Z6T A;  2MLK A;  5BMZ A;  4UVA A;  1RNL A;  2A6E F;  2PJP A;  1SD7 A;  5D4S A;  3SFZ A;  3LST A;  3PFI A;  4KT5 C;  3VFZ A;  1QNT A;  2X4H A;  3R6S A;  2P6S A;  2JTV A;  2JT1 A;  1KQ8 A;  4E70 A;  3KP5 A;  3RDI A;  1EH7 A;  1JHF A;  1UB9 A;  4U0V A;  4A6D A;  4HZF A;  4ESJ A;  4ENN A;  4HOB A;  2EA2 A;  4L0Z B;  3JW4 A;  1L3L A;  2PFB A;  2FA5 A;  1FC3 A;  2IRF G;  4KIB A;  2DPU A;  5LRS A;  1ON2 A;  3BDD A;  3IKV A;  1R22 A;  1YYV A;  1OYY A;  1T6S A;  2BGC A;  2VOO A;  4KIG A;  2HDC A;  2A61 A;  3BZ6 A;  2VBZ A;  3I5U A;  3J81 K;  1LDK B;  1G3T A;  1O3Q A;  2HKX A;  4GYI A;  3QP5 A;  1KU3 A;  2YX4 A;  1HW1 A;  4O6J A;  2WWY A;  3ABT A;  5ILU A;  1LNW A;  3Q9S A;  3I54 A;  4YII A;  3D0S A;  1NHA A;  3GXO A;  2DK5 A;  2P7C B;  1PUE E;  2FBH A;  5HLH A;  3I64 A;  1MJ9 A;  2DW4 A;  3GFM A;  1K79 A;  2H09 A;  2UWM A;  1J2X A;  2NAZ A;  4A5M A;  5D5V B;  3E6D A;  3F8C A;  3QU6 A;  1OKR A;  4QWQ A;  4HV6 A;  2RNJ A;  4G7O F;  3ROU A;  2R7F A;  2YU3 A;  1U5T B;  1B9N A;  2IW5 A;  2NYX A;  1DDN A;  5D5X B;  2XAG A;  3HOS A;  3OV8 A;  2IA2 A;  3GEZ A;  5KK1 A;  2GIV A;  1SMT A;  3EYI A;  2M30 A;  3BWG A;  4B09 A;  3KZZ A;  2XRN A;  2OU2 A;  5FO5 A;  3VEP A;  2DBB A;  3K2Z A;  1Z9C A;  4FHT A;  2O3F A;  2V6C A;  2M87 A;  1W4M A;  3CUO A;  3H3U A;  5TRD A;  1IW7 F;  4I98 B;  4U0Y A;  3EQL F;  4MNU A;  5K5O A;  4HF0 A;  1F4K A;  4G7Z F;  1Z7U A;  4LGW A;  5ICG A;  4M9Z A;  2VOP A;  4P9U A;  2FRH A;  1B9M A;  3GW2 A;  2J5P A;  1U5T A;  1FPQ A;  4U7D A;  5DCF A;  1BBY A;  1FYL A;  3E97 A;  2HQR A;  3RKX A;  3P9I A;  5CVJ A;  2W84 A;  3DFG A;  2ZNY A;  4HF1 A;  1ONV A;  1S7O A;  3FZV A;  3J7A O;  4LK0 F;  2B0L A;  3GZ6 A;  4YFN F;  4HDV A;  3M9A A;  3ABU A;  4OOI A;  3C3W A;  3SXY A;  2OD5 A;  1FYM A;  1K6O A;  1B4A A;  3G73 A;  1Q1H A;  3CUQ C;  4EM1 A;  2Z33 A;  3EUH A;  2GXG A;  3FXQ A;  2FBI A;  4N9H A;  4I2O A;  4HW0 A;  3ULQ B;  1G3W A;  2CO5 A;  4CZZ A;  4HBL A;  1XMK A;  2QEN A;  4U88 A;  4GGG A;  4L9V A;  4ZYH A;  2EV6 A;  4ENM A;  2A68 F;  2VN2 A;  4BHB A;  1K78 B;  1ZG1 A;  2V1X A;  3HSF A;  3RJP A;  4A0X A;  2L02 A;  3QPH A;  3J81 Z;  2E7X A;  4KNY A;  2YPR A;  4R1H A;  5LGN A;  1ZRF A;  3O6B B;  1LVA A;  3RYR A;  4HDU A;  4ZYE A;  1S7A A;  1XGN A;  4XLN F;  2DT5 A;  2QLZ A;  5FGM A;  4CYD A;  4EM0 B;  2VBY A;  1IXS B;  1WRJ A;  2FXA A;  2COM A;  4IHT A;  2EWN A;  3CO6 C;  3DEU A;  4PGG A;  1SFX A;  1R00 A;  3K9T A;  3KCC A;  4WK8 F;  3QP6 A;  4LB6 B;  2LSO A;  3WTX C;  4KYW A;  3FWE A;  2EFQ A;  5LLQ A;  2O8X A;  4S04 A;  2XV4 S;  3FHZ A;  2DPD A;  2ADU A;  1KQ9 A;  3LQR A;  2JPC A;  4AD9 A;  3DQV C;  3MZY A;  3F8M A;  1QBJ A;  4HLX A;  2A5Y B;  4G7H F;  5DUI A;  1BIA A;  5DCM B;  3LA7 A;  1YG2 A;  1KU9 A;  2A6H F;  1T38 A;  2IA1 A;  1BC7 C;  3F8F A;  2NRA C;  1TQI A;  1FBQ A;  1D8J A;  2XGX A;  4EM2 A;  1A04 A;  4G6D A;  3BPX A;  2H6B A;  1YS6 A;  3VOE A;  2IVM A;  1XB4 A;  3ZMD A;  2FBK A;  4MQ9 F;  5CVI A;  1YW7 A;  4FX0 A;  2MD5 A;  5FB2 A;  4EJU A;  3QU3 A;  3TO7 A;  1K7A A;  2RQP A;  2OQG A;  5E17 F;  4RB0 A;  2DQL A;  2FNA A;  1HKQ A;  1ZGA A;  3HRT A;  1JGS A;  4BAY A;  1XGM A;  4Q47 A;  1F1Z A;  2QZ8 A;  2PG4 A;  2K7L A;  2L01 A;  2DFI A;  2VC0 A;  2HFH A;  1O3R A;  1XD7 A;  4RS8 A;  4RAZ A;  1JHH A;  1R1V A;  1UCR A;  1YO5 C;  3F6O A;  1I27 A;  3NQO A;  1KA8 A;  1IN5 A;  1SFU A;  4QLC U;  1DP7 P;  1ZLJ A;  3DP7 A;  1FBU A;  3G3Z A;  5KVR A;  2RN7 A;  2Y75 A;  1FYK A;  4LB5 A;  4N0B A;  1Z6R A;  1OYI A;  3RPU A;  5F64 A;  1R36 A;  2JSC A;  2HKO A;  2VBW A;  3SQN A;  2HEO A;  5HS7 A;  1IN6 A;  1Z91 A;  1TTY A;  2Q2E A;  2R3S A;  2E1N A;  1Z1D A;  3HIF A;  2P6T A;  4U0W A;  2D2W A;  2EV5 A;  1P92 A;  2P5V A;  2HR3 A;  1AOY A;  2K02 A;  3WE3 A;  3IRQ A;  1GVJ A;  2ZME B;  4P5O A;  5JFR A;  3TOA A;  3WTW C;  1H9T A;  2YX7 A;  4L5I A;  2RC4 A;  2LDU A;  1HSJ A;  4RGR A;  4Y15 A;  4RB1 A;  2XRO A;  4OMY A;  3M8F A;  5L3E A;  1IXC A;  2HYG D;  2HWV A;  1JXS A;  3K69 A;  2HGC A;  2VBX A;  1U5T C;  4M6Y A;  1WI9 A;  2VXZ A;  2D45 A;  5LGT A;  2X0L A;  3TKY A;  2PMU A;  3MWM A;  3K1N A;  3NRV A;  2BE5 F;  3C7J A;  3L00 A;  3RKW A;  2YSR A;  3HTS B;  4LLN A;  3DV8 A;  4RAY A;  4GCV A;  1J5Y A;  5E20 A;  4KDP A;  3HRS A;  3F23 A;  1QZY A;  1YLF A;  5ED4 A;  2IT0 A;  2Z99 A;  2LKP A;  3F72 A;  5DUK A;  1EV7 A;  4IHS A;  3M7G A;  5JR3 A;  1GXP A;  3MFK A;  2KRF A;  3CDH A;  5DYM A;  2NNY A;  2FEZ A;  2L4M A;  4R8H A;  4UXN A;  1KYZ A;  2M45 A;  2O6G E;  4I0B A;  3BJ6 A;  1MJA A;  1GXQ A;  4M9S A;  5D6F A;  2GQQ A;  2XAS A;  1XGS A;  4M9X A;  4KN7 X;  3WTV C;  1D3Y A;  4ZYD A;  4RGS A;  4BHC A;  1R5H A;  1STZ A;  4U7B A;  1ZRD A;  3CO7 C;  1FP2 A;  3RPQ A;  4ZYG A;  1IRF A;  3ECO A;  1BI1 A;  3FMR A;  3K1P A;  3RI4 A;  4EJO A;  4UVC A;  1R5G A;  2OQR A;  1O3S A;  1ZHF A;  2DI3 A;  3KZY A;  3HHH A;  1UHW A;  3V8K A;  2Q0O A;  2FQ3 A;  1R1T A;  3IWZ A;  1F5T A;  1EH8 A;  3PQJ A;  1OMI A;  5DD4 A;  1XCV A;  3EET A;  4UVB A;  3CUQ B;  2BYV E;  4IF4 A;  1F9N A;  5A2Q Z;  1XGO A;  2V1U A;  2XAQ A;  3PQK A;  4EGZ A;  5LGU A;  4IRG A;  2XAF A;  2ETH A;  4XSX F;  3LA2 A;  3EYY A;  1H0M A;  1C0W A;  5ILV A;  3L9F A;  5D4R A;  1ON1 A;  4NB5 A;  4L18 B;  3IHU A;  3IRR A;  2Y48 A;  3WTZ A;  1FBS A;  5ICF A;  5BPI A;  4BXU A;  4GXO A;  1WSU A;  2Z3Y A;  4LJZ F;  2EFP A;  4GO1 A;  1IZ1 A;  4OIO F;  3N4M A;  2FU4 A;  2KIU A;  3COA C;  3GF2 A;  5F1R A;  4YFX F;  3KP6 A;  3W6J B;  1ZGJ A;  1FOK A;  3FF5 A;  5L3C A;  5DD8 A;  3TDZ C;  3I71 A;  3K0L A;  2CYY A;  3WTT C;  2C6Y A;  1U2W A;  2OAZ A;  5HDK A;  2RDP A;  3R0J A;  1P4A A;  4G9Y A;  4ZZL A;  2LNB A;  1B6A A;  1R23 A;  2M8E A;  5E1Z B;  2EFN A;  4CHU A;  5BQT A;  2CGP A;  1DPU A;  3RYP A;  2GAU A;  1MJB A;  3QAH A;  1OR7 A;  5H20 A;  4KA4 A;  1RUN A;  3E5Q A;  3NEU A;  3GUD A;  3MCZ A;  5HLI A;  1UFM A;  4OIN F;  1IAW A;  5BS6 A;  3HRM A;  2HS5 A;  3O2P E;  5E18 F;  1CGP A;  4KIC A;  1QO0 D;  3BY6 A;  3EDP A;  2V79 A;  4EJV A;  3VOD A;  1D5V A;  1G4D A;  2FE3 A;  4CGZ A;  2JZY A;  1U3E M;  2XAH A;  2J5O A;  2QQ9 A;  5FLX Z;  3GO5 A;  2V1D A;  3BRO A;  1FP1 D;  1RUO A;  2FOK A;  2HTJ A;  5HLG A;  5HDG A;  3LFK A;  3ZQ7 A;  4PGH A;  3BOQ A;  4OIP F;  2Z5U A;  1U78 A;  3TGN A;  5F6F A;  4IRI A;  3HUG A;  2JPB A;  2EJR A;  3FXU A;  3I59 B;  4IXA A;  3LA3 A;  2MBF A;  4BH9 A;  3CTA A;  1PP7 U;  1E2X A;  5E8I A;  3FMQ A;  2XAJ A;  5D8K B;  4MEX F;  2IPQ X;  4ENJ A;  4UUV A;  4CDG A;  1I6X A;  2WTE A;  3KFW X;  2RKH A;  1I1S A;  4Z2Y A;  4RGX A;  3IWF A;  4Y13 A;  1P2F A;  4P55 A;  3S2W A;  3DF8 A;  4S05 A;  4EV0 A;  2IJL A;  3JAM K;  5DV5 A;  2ZBK A;  3ZMV A;  1XSV A;  2MH9 A;  3MZH A;  1HKT A;  3BJO A;  1S8N A;  1XDU A;  5CYV A;  3TQN A;  1XMA A;  2QUF A;  5LHH A;  2BBY A;  3KP2 A;  4A0Z A;  4EJW A;  4L9T A;  4M74 A;  3HTU A;  1FZP B;  2CQK A;  4LMY A;  1IN7 A;  1U6G A;  3LWF A;  2FSW A;  1TW2 A;  4AIK A;  1YIO A;  1XSX A;  3I58 A;  1QQI A;  2ACJ A;  3MEX A;  2G9W A;  2RGV A;  1W7P A;  2VE9 A;  2CW0 F;  3MAJ A;  1LQ1 A;  1O3T A;  1HW5 A;  2BEO A;  2ZO4 A;  4MEY F;  2G7H A;  2QBY A;  2DQR A;  2KIF A;  2XUB A;  4JBA A;  2HOE A;  2CFX A;  4LG0 A;  3TDU C;  4P96 A;  3RKY A;  3T1B A;  1UST A;  4GYG A;  3E5X A;  1SD4 A;  4HX4 A;  3E6C C;  4MTD A;  3TO6 A;  3T8R A;  1KU7 A;  1G6N A;  2DLL A;  4UHT A;  3AAF A;  3GVA A;  1FNN A;  4BHP A;  1T98 A;  2D1V A;  3GX4 X;  5K5Q A;  3HRU A;  3I59 A;  4JQF A;  1FT9 A;  1I5Z A;  5EEH A;  2UZK A;  1K78 A;  4NHJ A;  3VB2 A;  2STT A;  5JI6 A;  3FMS A;  1FY7 A;  3R61 A;  1TQP A;  4ASN A;  2QQB A;  3WGH A;  2VT2 A;  1BN5 A;  2DO7 A;  2QQA A;  1KQ0 A;  3LAJ A;  3LAP A;  3ZMU A;  4WCG A;  4WWC A;  4O5V A;  3ZN0 A;  2EV0 A;  2XKP A;  1R1U A;  2PLY A;  1W7P D;  5FFX A;  4RB3 C;  3QRF F;  1BOA A;  3V7S A;  1REP C;  3I53 A;  3SHF A;  2ESN A;  2O0Y A;  1UHM A;  5LBQ A;  4FX4 A;  2CSO A;  4K2E A;  2W24 A;  4MTE A;  4LLL A;  1GHC A;  5LHG A;  4O3M A;  5E1X A;  3W6K B;  3J80 K;  1FLI A;  1TBX A;  3WGG A;  5IT3 A;  1OYW A;  5HS9 A;  4UNO A;  1PP8 F;  2Z9O A;  1WWX A;  4MHG A;  3JSO A;  3V8J A;  5HS8 A;  2OA4 A;  1B59 A;  2QBY B;  5FFZ A;  5TJJ A;  2ZNZ A;  3ZMT A;  1KGS A;  1MDM B;  2EA4 A;  4OU0 A;  4N9I A;  3LQQ A;  5FD5 A;  3K1M A;  1JE8 A;  2A07 F;  4A0Y A;  1Y0U A;  4WX9 A;  2WV0 A;  4MGR A;  1FX7 A;  3R60 A;  4M71 A;  2EFO A;  3KET A;  5L3F A;  3U1D A;  2BV6 A;  4XLP F;  5E1W A;  1TQM A;  3L7W A;  4Q4Z F;  3ZMS A;  3ERE D;  1KYW A;  2JRT A;  4EMS A;  3BPV A;  2NS0 A;  2QVO A;  5DDG A;  4I01 A;  3GZ5 A;  1YQA A;  3H92 A;  4ESB A;  2F5E A;  4ZH4 F;  3DPL C;  1U8R A;  1BI0 A;  3ML6 A;  2EB7 A;  2O03 A;  3P9C A;  4HLY A;  3O3K A;  3HSE A;  1H9G A;  4G8X A;  2MC3 A;  4CO8 A;  1YW8 A;  1ZAR A;  5CVU A;  2G7U A;  2XHK A;  2ZCW A;  3KP7 A;  5LEK A;  4KMU X;  1IRG A;  4UV9 A;  5LRR A;  3WTU C;  2FF4 A;  2UXN A;  5FD6 A;  4AIH A;  4HX7 A;  4EGY A;  4A5N A;  4XSZ F;  5BPD A;  3JTH A;  1P6R A;  2GXB A;  3TOB A;  4MQV A;  5D5U B;  2FMY A;  1VTN C;  5E8G A;  3FM5 A;  2PEX A;  3V7R A;  1AWC A;  1BI2 A;  2Y0M A;  5J8C A;  2CWE A;  2AXL A;  2FNP A;  4XBF A;  5DCM A;  4L0Y B;  1X3U A;  4HX8 A;  1BC8 C;  1TNS A;  3WTY C;  2MA3 A;  5JHU A;  1SD6 A;  3M8E A;  2M1B A;  1W5S A;  2CG4 A;  4IRH A;  5D5W B;  3BJA A;  2VON A;  1HW2 A;  1RI7 A;  1BM9 A;  4A2U A;  2K86 A;  1HQC A;  3SZT A;  3GLX A;  1IUY A;  5L3D A;  3B02 A;  1ZLK A;  1V4R A;  2F5D A;  1YFH A;  2A69 F;  2ZME A;  2GZW A;  3TO9 A;  3SZP A;  1XDS A;  5CJ9 A;  2HZT A;  4I02 A;  1SFE A;  3BP8 A;  2ESH A;  3DKW A;  5LEJ A;  3KP4 A;  4LG0 B;  1HKS A;  4F7Z A;  4YFK F;  2WC2 A;  5BOX A;  1B1B A;  1FSE A;  3ZMZ A;  2PN6 A;  2K4J A;  3KP3 A;  4HQE A;  4ETS A;  1MKM A;  4Y17 A;  5HDN A;  3WOD F;  5D6E A;  1L0O C;  3RTR A;  2E7W A;  4RGU A;  2QYO A;  1OPC A;  3IKT A;  1W5T A;  2YR2 A;  2QM3 A;  5ERI A;  4KIF A;  2GA2 A;  5FLX K;  5ICE A;  3ZP5 A;  2RVC A;  3ELK A;  4NQW A;  3D5L A;  1S6L A;  4UV8 A;  4PDK A;  1G3Y A;  2XVC A;  1R7J A;  3H3Z A;  5IT9 Z;  3V7C A;  3T0Y A;  4L5J A;  4Q5S F;  3JTG A;  2V9V A;  2L3D A;  3R0A A;  1LDD A;  1IF1 A;  1YTY A;  1J9I A;  3ZPL A;  2IP2 A;  4WXH A;  3WGI A;  1HXD A;  2GA1 A;  1I1G A;  3MQ0 A;  1HBX G;  1ZH5 A;  1IN8 A;  1SMY F;  3P9K A;  4FT8 A;  3L09 A;  4LFU A;  1QZZ A;  3JAM Z;  2O61 A;  2RV8 A;  3QOP A;  2UXX A;  1USS A;  5H6Q A;  1O57 A;  3I0T A;  1BJA A;  4XRF A;  5EEG A;  5HVQ C;  2PI0 A;  2QWW A;  3ZN1 A;  4IJA A;  3CLO A;  2TDX A;  2NNN A;  1ZRC A;  1ZG3 A;  3WU0 A;  2PMH A;  4EJT A;  5H6R A;  1LJ9 A;  1CF7 A;  3WE2 A;  2PQ8 A;  4ENK A;  1YW9 A;  4M6X A;  1MZB A;  1BI3 A;  2STW A;  4M72 A;  3ECH A;  1XCB A;  5AON A;  1LEA A;  2XIG A;  4YG2 F;  4L9N A;  1MGT A;  3N97 A;  4LK1 F;  1G3S A;  3GFL A;  5LHI A;  3P7N A;  2VT3 A;  1MDM A;  4IVN A;  6PAX A;  5IT9 K;  3DXJ F;  4A6E A;  2L4A A;  4I0A A;  2W85 A;  4ZZD A;  5CVV A;  5JVT A;  5J6X A;  4G6Q A;  3QPT A;  5K1Y A;  5CLS A;  1D8K A;  4WF2 A;  3HHG A;  4CXF A;  3DPT A;  3R4K A;  4Q48 A;  2EFW A;  2HQN A;  1FSH A;  3KE2 A;  4OIQ F;  3L2C A;  2P8T A;  3KLN A;  1Z05 A;  1J59 A;  4DQ2 A;  3GYH X;  2P5K A;  3F6V A;  3REO A;  4AWX B;  4YIF A;  5L3G A;  2ISZ A;  3CUQ A;  3Q9V A;  2W25 A;  2KJC A;  1SD5 A;  2MLG A;  2DAO A;  4D0P A;  4HF2 A;  1QGP A;  2FML A;  1FWZ A;  4EVI A;  5DEQ A;  3B73 A;  5HOO A;  4BNC A;  3FX3 A;  2W57 A;  1V3F A;  3WTS C;  1O7L A;  3E5U A;  4PCQ A;  5D8L B;  4PZJ A;  1LDJ A;  3KEQ A;  3CJN A;  1ULY A;  2ELH A;  1PDN C;  4BYY A;  3HSR A;  4RB2 C;  1LEB A;  3KEO A;  1KU2 A;  4B8X A;  4LLG F;  3FM3 A;  1J7K A;  1J75 A;  2PBI A;  3GWZ A;  1RIO H;  3C1D A;  4HV5 A;  2H94 A;  3U2R A;  1TW3 A;  4M73 A;  5AIP A;  4OIR F;  3F8N A;  5A2Q K;  3E3V A;  1S29 A;  2HTS A;  5ICC A;  1XN7 A;  2P7V B;  2KJB A;  4G94 A;  2KKO A;  2K4B A;  4A12 A;  2F5C A;  3IL2 A;  3T5X A;  1O7F A;  4HQM A;  3M1E A;  1R58 A;  4I7H A;  4KN4 X;  2VC1 A;  1T0F A;  4DNC A;  4IPA A;  5K5R A;  1TLH B;  3GFJ A;  1DPR A;  3I4P A;  2OZU A;  1SAX A;  1CF7 B;  1S3J A;  3JSP A;  1ODD A;  3IC7 A;  2L54 A;  2ZKZ A;  4TV7 A;  5ILS A;  4HA8 A;  3J80 Z;  4HYE A;  4ESF A;  4HAM A;  2OBP A;  3RIR A;  5L3B A;  3WU1 B;  2DTR A;  1WQ2 A;  2ISY A;  4KMF A;  1E17 A;  4H0E A;  1YS7 A;  1W7P B;  1WKM A;  5CVR A;  1T39 A;  2MH2 A;  3KLO A;  2ZJ2 A;  3F21 A;  2AS5 F;  4KUM A;  2XKO A;  3V4G A;  2F5F A;  1ZAO A;  1IXR C;  2HYF A;  4KFC A;  1MD0 A;  1T2K A;  1QPM A;  3V8L A;  1HST A;  3Q5F A;  1TNT A;  4AVP A;  4ON0 A;  2GWR A;  2LF7 A;  2M5W A;  3HOT A;  3HYI A;  2DK8 A;  1IN4 A;  2H27 A;  1ZRE A;  3F3X A;  4WXD A;  2R7D A;  2A3S A;  3C18 A;  4BQA A;  1RZ4 A;  2ZFW A;  1P4W A;  3F22 A;  2VOD A; 
#chains in the Genus database with same CATH topology
 1P4X A;  1TT5 B;  2D1H A;  4OMZ A;  3T8T A;  3E6B A;  1LB2 A;  4I09 A;  2LBF A;  2P5L C;  1ZG5 A;  2WY8 Q;  3F8B A;  2V9P A;  3FXR A;  4M3B A;  1I3Q J;  5AIQ A;  3RCO A;  2EQR A;  4BQQ A;  3ASN H;  3DKX A;  3GFI A;  1DUX C;  2H6C A;  2KIM A;  4P9F A;  2LF8 A;  1BIB A;  2ICW G;  4WXC A;  2K9L A;  3A4C A;  4U87 A;  4R79 A;  3ISP A;  1G2H A;  2JK3 A;  2IA0 A;  2E1C A;  2CUE A;  2TCT A;  1ZN2 A;  3OOP A;  4BJT A;  3NWT A;  4V2F A;  4JK1 X;  2EK5 A;  2KZV A;  3RZD J;  4A3D J;  3D5R C;  2K27 A;  2OZ6 A;  2VE8 A;  4AIJ A;  3WG9 A;  1ZYR F;  2F2E A;  2QSG X;  2P4W A;  4XK4 A;  3CQZ J;  3VYU B;  5J8F A;  3E6M A;  4DGW B;  2JSP A;  4CH7 A;  2VQH A;  4I99 C;  1XSD A;  2X1C A;  4D5C A;  4EQQ A;  4CYC B;  2NXN B;  4UB6 C;  4L9J A;  4Y33 A;  4CIC A;  2DU9 A;  3HJE A;  4LD5 A;  5CQE A;  1BR4 A;  2X85 A;  2X6O A;  2ZXJ A;  2ZXI A;  3L2Q A;  3CCL I;  1SVL A;  1EH6 A;  3U9G A;  1UMQ A;  3I4M J;  1J0R A;  1A6Q A;  2Q8K A;  2W4S A;  1Z6T A;  2MLK A;  5BMZ A;  1HDP A;  4CCL A;  4UVA A;  3HDD A;  1RNL A;  2A6E F;  2PJP A;  1V54 H;  1SD7 A;  2M9H A;  3M1C A;  1W0U A;  3GTL J;  5D4S A;  3SFZ A;  3LST A;  3ZQC A;  3G4S I;  2BY2 A;  3CCY A;  3L2V A;  3PFI A;  2DDA A;  4XLC A;  4KT5 C;  3CDL A;  1YX5 A;  1QNT A;  2W1O A;  2X4H A;  3R6S A;  3VFZ A;  2P6S A;  2JTV A;  2JT1 A;  1KQ8 A;  1F43 A;  4E70 A;  3JRI A;  4E7I A;  3KP5 A;  3RDI A;  1EH7 A;  1JHF A;  1UB9 A;  4U0V A;  4OAZ A;  2WAD A;  3PL8 A;  3OYL A;  4A6D A;  5FJ8 J;  1MNM C;  4HZF A;  1TP4 A;  4ESJ A;  4ENN A;  4HOB A;  3CMY A;  2R5Z B;  2EA2 A;  2Z16 A;  4L0Z B;  2ELK A;  3JW4 A;  1UEL B;  2RAE A;  4XMY A;  4J01 A;  1OJL A;  1L3L A;  2PFB A;  5J40 A;  2FA5 A;  3QQA A;  1FC3 A;  2BZT A;  5E3L A;  2IRF G;  5FLV A;  4KIB A;  2DPU A;  3L2U A;  5LRS A;  1ON2 A;  3BDD A;  2KIS A;  3IKV A;  1X1P A;  1R22 A;  4A3I J;  4BE2 A;  2OCE A;  3GZN B;  2CW7 A;  2XF5 A;  1YYV A;  1OYY A;  3BG7 A;  1T6S A;  2BGC A;  3MN2 A;  2VOO A;  4IEJ A;  1OR7 C;  2DCE A;  2CRG A;  2R5Y B;  1HCR A;  3OYD A;  1X1A A;  1T8I A;  1Y1W J;  4KIG A;  2HDC A;  2A61 A;  3BZ6 A;  2VBZ A;  3I5U A;  1RKW A;  3J81 K;  1LDK B;  4UUS B;  2R5Y A;  3KPH A;  1ZGW A;  1G3T A;  1O3Q A;  3S15 J;  5JVG F;  3S2D J;  3BC8 A;  2XPU A;  2HKX A;  4GYI A;  3QP5 A;  1KU3 A;  3IH4 A;  2HPI A;  2YX4 A;  4F91 B;  1HW1 A;  4O6J A;  2WWY A;  1YHQ I;  3ABT A;  5ILU A;  1LNW A;  3Q9S A;  3I54 A;  3Q0W A;  3D0S A;  4YII A;  2K9S A;  4NUB A;  1NHA A;  3GXO A;  2HVR A;  2VKH A;  5GAG J;  2PX9 A;  3DTI A;  2DK5 A;  4XLA A;  1DGR M;  2P7C B;  5F27 A;  4ZJZ A;  1PUE E;  2FBH A;  5HLH A;  3I64 A;  1WCM J;  1MJ9 A;  2DW4 A;  3GFM A;  1WFX A;  1T33 A;  1K79 A;  2H09 A;  2UWM A;  5GP9 A;  4G12 A;  3RQ4 A;  1J2X A;  3K10 A;  3OSG A;  2NAZ A;  4A5M A;  5D5V B;  2K9M A;  3E6D A;  1LFU P;  3F8C A;  4E7J A;  3QU6 A;  1OKR A;  2UV1 A;  4QWQ A;  1FIA A;  4HV6 A;  2GBY A;  4CA0 A;  2RNJ A;  4G7O F;  3ROU A;  2DFF A;  2R7F A;  2JJ7 A;  2YU3 A;  1MMD A;  1U5T B;  1B9N A;  2IW5 A;  2NYX A;  1DDN A;  5D5X B;  1WGX A;  3DU5 A;  2VJJ A;  2XAG A;  1ETO A;  2M3A A;  3OV8 A;  3HOS A;  1AHD P;  4OWR B;  1I39 A;  2WB1 A;  2IA2 A;  3CC7 I;  2F4I A;  3GEZ A;  1X4O A;  3A0B C;  5KK1 A;  3ZQQ A;  3HEF A;  2QKL B;  2GIV A;  5EZH A;  2BXY A;  2NOJ B;  2QA4 I;  1SMT A;  1JTX A;  3EYI A;  2M30 A;  3BWG A;  3LSJ A;  3K70 C;  3DTE A;  4B09 A;  1XTA A;  3KZZ A;  2XRN A;  2W48 A;  4IOC F;  1WJA A;  2OU2 A;  3IAM 2;  2JQ7 A;  2JMW A;  2XGE A;  5FO5 A;  3VEP A;  3DLL F;  4QSH A;  3S1Q J;  3OYF A;  2DBB A;  3ZQI A;  4GDF A;  1D0Y A;  3K2Z A;  5KNL A;  3OR1 C;  1Z9C A;  2XB0 X;  3BTI A;  4FHT A;  4KJZ A;  2O3F A;  3K6G A;  1VQL I;  2V6C A;  2M87 A;  1W4M A;  3VDX A;  3CUO A;  1W36 D;  3H3U A;  5TRD A;  1V55 H;  3K4K A;  4E4H A;  1IW7 F;  1SVO A;  4I98 B;  4U0Y A;  1AKH A;  3EQL F;  4MNU A;  1RR8 C;  2QGU A;  5K5O A;  4HF0 A;  2YU9 J;  1H8A C;  1WZ2 A;  1F4K A;  3H1C A;  3DKY A;  5KAF C;  1HA8 A;  1K61 A;  4G7Z F;  4M3E A;  1R6R A;  3SDG A;  1Z7U A;  2QEX I;  1RKT A;  4LGW A;  5ICG A;  4M9Z A;  4C3H J;  1MH3 A;  2VOP A;  3OR2 C;  3BCB A;  3IP4 B;  4P9U A;  2YUS A;  2FRH A;  2QSF X;  3VSL A;  3H0G J;  1B9M A;  2DA2 A;  2VJI A;  2M0C A;  2HOS A;  3GW2 A;  3PO2 J;  3PM1 A;  2J5P A;  1MND A;  1U5T A;  1YRN A;  1X1B A;  2ZSH B;  2CS3 A;  3BR0 A;  1FPQ A;  4U7D A;  5DCF A;  1BBY A;  3HZJ A;  3K4M A;  3KEY A;  2OTJ I;  1FYL A;  2VOD A;  1VQ7 I;  3E97 A;  1ETY A;  2HQR A;  3FK6 A;  3RKX A;  1QPI A;  3P9I A;  3GTK J;  3DWL E;  5CVJ A;  4RBO A;  2KL4 A;  2W84 A;  3DFG A;  2COB A;  1TWA J;  2ZNY A;  4HF1 A;  1ONV A;  1O4X A;  1ENH A;  1S7O A;  3FZV A;  2DMT A;  1AA7 A;  3J7A O;  4LK0 F;  2B0L A;  2VPL A;  2IS6 A;  1K83 J;  1JUS A;  1WI3 A;  3GZ6 A;  4YFN F;  4HDV A;  4ZTF A;  5K7H A;  3M9A A;  1J09 A;  3ABU A;  4OOI A;  3H0D A;  3C3W A;  3SXY A;  2F4O B;  2OD5 A;  1A6I A;  1K6O A;  2R7W A;  1B4A A;  3G73 A;  1Q1H A;  1FYM A;  5DTD A;  1MMA A;  1G59 A;  1W5C C;  2QKM B;  1H89 C;  2E71 A;  2R7O A;  3CUQ C;  2JRM A;  4XRM A;  1MSF C;  1A36 A;  4EM1 A;  2Z33 A;  4QPQ A;  4BU2 A;  4E7L A;  3EUH A;  1ZQ3 P;  1PUF A;  2GXG A;  2R92 J;  1TC3 C;  3ZXS A;  3G6E I;  3FXQ A;  2FBI A;  1Y56 A;  1VND A;  5J3L A;  2E5Z A;  4N9H A;  4I2O A;  4HW0 A;  3AG1 H;  3ULQ B;  1IC8 A;  1G3W A;  2CO5 A;  3CJR B;  4HBL A;  4CZZ A;  1XMK A;  2QEN A;  2HDD A;  1UZC A;  4U88 A;  3S2H J;  4GGG A;  4J00 A;  3UNG C;  4L9V A;  2Q2E B;  4ZYH A;  1N25 A;  2EV6 A;  4ENM A;  2A68 F;  4PSX A;  2VN2 A;  4BHB A;  1K78 B;  3QYB A;  1ZG1 A;  3PO3 J;  2Q1Z B;  3BR6 A;  3ERM A;  2V1X A;  3HSF A;  5DS9 A;  3OYB A;  5GAH J;  5F0H A;  3RJP A;  4A0X A;  2L02 A;  4Y4R A;  2E19 A;  3QPH A;  1QHG A;  2E7X A;  3J81 Z;  4KNY A;  1YIT I;  5HNF A;  4CCJ A;  3A2K A;  3PSI A;  2YPR A;  2M0M A;  4R1H A;  3EUA A;  3K2A A;  5LGN A;  3O6B B;  1ZRF A;  5JLW A;  3CCR I;  4IHW A;  1LVA A;  3E0J B;  3RYR A;  4HDU A;  4ZYE A;  1S7A A;  1XGN A;  4XLN F;  2DT5 A;  2QLZ A;  5FGM A;  4CYD A;  2PJR A;  4YEJ A;  2WBM A;  4EM0 B;  3CCQ I;  5EJC A;  3SYT A;  2VBY A;  1IXS B;  1WRJ A;  2CV0 A;  3FIS A;  2FXA A;  1OCZ H;  2COM A;  3FIW A;  3CJQ B;  4IHT A;  5E3O A;  4E7K A;  3WHB A;  2B7E A;  1NK3 P;  2IS1 A;  3HPH A;  1ETK A;  2EWN A;  3FXO A;  2HNH A;  3CO6 C;  5TIS C;  2F48 A;  2NVX J;  2DYR H;  4LIT A;  4KIS A;  3DEU A;  4PGG A;  1BA5 A;  1SFX A;  1R00 A;  3K9T A;  1GDT A;  2Y30 A;  2KPM A;  3BCA A;  3KCC A;  4WK8 F;  3K70 D;  3QP6 A;  4LB6 B;  2LSO A;  2BVM A;  2X9D A;  1POG A;  3ZRG A;  3WTX C;  4KYW A;  1Z3X A;  3FWE A;  1PJR A;  2EFQ A;  5LLQ A;  2DOE A;  4CZC A;  2O8X A;  4S04 A;  1FJL A;  2XV4 S;  3ABL H;  3HGG A;  3QPL A;  3FHZ A;  2DPD A;  3B6C A;  2ADU A;  3GTG J;  1KQ9 A;  2X6X A;  2JPC A;  3LQR A;  4AD9 A;  4A3F J;  2KDO A;  3DQV C;  3MZY A;  3F8M A;  3SJM A;  1I3A A;  1QBJ A;  4HLX A;  3RPU D;  4F93 B;  4XON A;  5IP7 J;  3LSH A;  2A5Y B;  5EG0 B;  4D1Q A;  1B72 B;  2AXT C;  2WAF A;  5DUI A;  4E7S A;  4G7H F;  1BIA A;  2H8R A;  3H5N A;  1LKX A;  2L7K A;  3LA7 A;  5DCM B;  1YG2 A;  1KU9 A;  2A6H F;  4XIC A;  4BAC A;  3M4O J;  3H9G A;  4RLF A;  1T38 A;  2KP6 A;  2IA1 A;  1BC7 C;  3CCJ I;  2JA7 J;  5B66 C;  4UUS A;  3NAR A;  3F8F A;  4AYB N;  2OCC H;  1TQI A;  1FBQ A;  3QOD A;  2NRA C;  1D8J A;  1IG7 A;  1UJ8 A;  2XGX A;  4EM2 A;  1A35 A;  1A04 A;  4BBS J;  1IO2 A;  1OQY A;  4G6D A;  2X51 A;  3BPX A;  2H6B A;  1YS6 A;  1SFO J;  3VOE A;  2IVM A;  1X2N A;  1WJB A;  2HVS A;  1TL8 A;  1XB4 A;  2HZD A;  3PNY A;  3ZMD A;  9ANT A;  2BW3 A;  2FBK A;  4MQ9 F;  3CP2 A;  3SEZ A;  2OF7 A;  5CVI A;  3A01 B;  4DYQ A;  1YW7 A;  4FX0 A;  1R5I D;  2MD5 A;  5FB2 A;  4EJU A;  2CW8 A;  3QU3 A;  2KMU A;  1LE8 B;  3PJR A;  3TO7 A;  2JA2 A;  3M07 A;  2DJN A;  3JRE A;  1K7A A;  1YX3 A;  2RQP A;  2OQG A;  5E17 F;  4A3B J;  3I56 I;  1Y0N A;  1PVE A;  2BW3 B;  2NOG A;  2VUM J;  4RB0 A;  2DQL A;  2FNA A;  3DEE A;  1LVK A;  3Q0U A;  5F04 A;  1XC5 A;  1E0E A;  1HKQ A;  3AG2 H;  1ZGA A;  3HRT A;  2VKD A;  1JGS A;  4BAY A;  2OV7 A;  1XGM A;  4Q47 A;  3ABK H;  3LOC A;  1SVM A;  5E3M A;  2LRE A;  2M4K A;  1F1Z A;  2QZ8 A;  1UHS A;  1XX5 A;  2VJ4 A;  2XSJ C;  2PG4 A;  2ZXW H;  1GV5 A;  4II2 A;  2K7L A;  2L01 A;  2VIX A;  3PNT A;  2DFI A;  1N77 A;  3DU6 A;  2VC0 A;  2HFH A;  1JTY A;  1O3R A;  1XD7 A;  3J7A Y;  3HG9 A;  4RS8 A;  4RAZ A;  3K4C A;  1JHH A;  4M6V A;  3W3C A;  2DA4 A;  3OOU A;  1T0F C;  1R1V A;  1UCR A;  1YO5 C;  3F6O A;  2XAU A;  1I27 A;  2IGM A;  4ZDO A;  1WH5 A;  3NQO A;  2K40 A;  3J7Y J;  1KA8 A;  1IN5 A;  1SFU A;  2BHY A;  4QLC U;  1DP7 P;  1ZLJ A;  3DP7 A;  4A69 C;  1FBU A;  3G3Z A;  2CFO A;  5HNH A;  4JX6 A;  2F5V A;  3PNV A;  5KVR A;  2GOX B;  2M2E A;  1VFC A;  1U0J A;  2RN7 A;  2Y75 A;  1NG7 A;  2ZSI B;  4PJ0 C;  2X1E A;  1ITY A;  1FYK A;  4LB5 A;  2A5W A;  1T95 A;  4ITV A;  4A3J J;  4N0B A;  1Z6R A;  1OYI A;  2AQF A;  3RPU A;  5F64 A;  1R36 A;  2JSC A;  2GLO A;  2HKO A;  2VBW A;  3KZI C;  5FKK A;  3SQN A;  2HEO A;  2NVT J;  5HS7 A;  1IN6 A;  1XMX A;  1Z91 A;  1TTY A;  2Q2E A;  4QTR A;  2R3S A;  2E1N A;  1Z1D A;  4D5F A;  2XRL A;  3HIF A;  1RPW A;  3N05 A;  2P6T A;  4U0W A;  2D2W A;  2EV5 A;  4OAY A;  4XLH A;  1XPX A;  1P92 A;  5J47 A;  4A93 J;  1ERD A;  2P5V A;  2HR3 A;  1TWC J;  1QU3 A;  1AOY A;  2K02 A;  2AQE A;  5FLM J;  3AL0 B;  2DOD A;  3H9Q A;  3TW6 A;  3WE3 A;  2NS7 A;  5GAD J;  3IRQ A;  1GVJ A;  1Z0X A;  2XB5 A;  2ZME B;  4P5O A;  4ZTJ A;  3S3M A;  2K9N A;  2R7X A;  3FXK A;  2IGK A;  5JFR A;  3TOA A;  4AID A;  1YIJ I;  3WTW C;  1H9T A;  4B4C A;  2CV1 A;  2EIJ H;  2YX7 A;  4I6Z A;  4L5I A;  2RC4 A;  2LDU A;  3OYC A;  1BOB A;  1HSJ A;  4RGR A;  1U9O A;  4Y15 A;  1ZKG A;  4RB1 A;  2XRO A;  1JJ8 C;  1NG6 A;  4OMY A;  4JYK A;  2L9V A;  2XF7 A;  3M8F A;  4W97 A;  5L3E A;  1IXC A;  2HYG D;  3OIQ A;  1Y8R B;  2HWV A;  1JXS A;  4HG2 A;  2OJE D;  3K69 A;  2HGC A;  2VBX A;  3K4N A;  2DT7 B;  3S16 J;  1U5T C;  4M6Y A;  1WI9 A;  2VXZ A;  2D45 A;  5LGT A;  2X0L A;  1ORK A;  1VQK I;  3TKY A;  4CCK A;  3E7L A;  2PMU A;  3MWM A;  3K1N A;  1X3Z B;  3NRV A;  1ZK8 A;  5M5Y J;  2I8D A;  3EPZ A;  2V1N A;  2R7U A;  2BE5 F;  3C7J A;  3G1O A;  3L00 A;  4B3X A;  4DZP A;  1WJF A;  1JKQ C;  1R4M B;  1MBK A;  3HL2 A;  3RKW A;  2YSR A;  3HTS B;  4LLN A;  1OCT C;  3DV8 A;  4RAY A;  4GCV A;  1J5Y A;  5E20 A;  4KDP A;  3HRS A;  4Y7N J;  3W2A A;  3F23 A;  1QZY A;  1EA3 A;  1YLF A;  3LSG A;  3BQY A;  3SDB A;  5ED4 A;  3K4J A;  1X4P A;  4XN0 A;  1CF7 B;  2VKE A;  2IT0 A;  1X3W B;  2KT0 A;  2LH9 A;  2Z99 A;  2LKP A;  4AM3 A;  2IGN A;  3F72 A;  3SFI A;  5DUK A;  3W6V A;  3I9V 2;  2DA5 A;  3VWB A;  5IY5 H;  3PUB A;  1EV7 A;  3HGY A;  4IHS A;  3HUG B;  3M7G A;  5JR3 A;  2Z2S B;  1GXP A;  2L2O A;  3MFK A;  1MBJ A;  2KRF A;  3CDH A;  5DYM A;  3OIP A;  4HEA 2;  3DCF A;  1R9T J;  2NNY A;  2KRH A;  2FEZ A;  2L4M A;  1HC8 A;  3M3Y J;  3NAU A;  4R8H A;  3CMA I;  2R7S A;  3BQZ A;  4UUT A;  4UXN A;  2E2H J;  1KYZ A;  4HSR A;  2IAI A;  2M45 A;  2L7F P;  4BKX A;  2O6G E;  3QYF A;  2WV1 A;  4I0B A;  3BJ6 A;  1MJA A;  1GXQ A;  4M9S A;  5D6F A;  1R71 A;  2GQQ A;  3AG4 H;  2XAS A;  2LD5 A;  1YRN B;  1XGS A;  1BJZ A;  4BXX J;  3LSM A;  2M8G X;  4A3E J;  2JA5 J;  4M9X A;  4KN7 X;  1S7E A;  4BEH B;  3WTV C;  2Y9Y A;  4BE0 A;  2BY0 A;  1D3Y A;  4ZYD A;  3D1N I;  2WA0 A;  2P81 A;  3H5A A;  4RGS A;  4F55 A;  3RZO J;  1WJD A;  4BHC A;  5C44 J;  3O8H A;  1AU7 A;  1R5H A;  1STZ A;  4U7B A;  1ZRD A;  3GME A;  3CO7 C;  1NH3 A;  1FP2 A;  4XOT A;  5KHD A;  1I6H J;  1IRX A;  3RPQ A;  2GOM A;  4ZYG A;  1IRF A;  2JUC A;  3ECO A;  3HPG A;  3ONQ A;  3O8G A;  1WVR A;  1BI1 A;  2DDB A;  5GPA A;  3FMR A;  3ESW B;  1P7I A;  4XL9 A;  4YEL A;  4F52 A;  3K1P A;  2KIQ A;  4EJO A;  3RI4 A;  4UVC A;  1R5G A;  4IHV A;  1UAA A;  2OQR A;  1O3S A;  3CF2 A;  1ZHF A;  2DI3 A;  1RET A;  3KZY A;  2CUF A;  4DZJ A;  4XRS A;  3HHH A;  1UHW A;  3V8K A;  1Z21 A;  3GTQ J;  1A5J A;  1X1D A;  3L2R A;  4XLF A;  3HOV J;  5CKT A;  1RRJ A;  2Q0O A;  3VYS B;  3MKZ A;  2DFE A;  2P0W A;  2FQ3 A;  1R1T A;  2FQ4 A;  3IWZ A;  1F5T A;  1EH8 A;  2JN6 A;  3PQJ A;  2A6T A;  1OMI A;  2EIK H;  5DD4 A;  4BS9 A;  4D9J A;  1XCV A;  3EET A;  2LY2 A;  3G1M A;  2VQC A;  2CQ7 A;  4UVB A;  2LYC A;  3CUQ B;  2IS2 A;  3FBI B;  1D0Z A;  5GPC A;  1MIJ A;  2K85 A;  2WY7 Q;  2BYV E;  1U8B A;  5BNG A;  4IF4 A;  1F9N A;  5A2Q Z;  1XGO A;  1K6Y A;  2V7F A;  2V1U A;  1JUP A;  2XAQ A;  2LMD A;  3PQK A;  3F0C A;  2ELJ A;  4EGZ A;  5LGU A;  4IRG A;  2XAF A;  2ETH A;  3OYG A;  4XSX F;  4KIT B;  3OYE A;  3LA2 A;  1CQT A;  1E3P A;  3EYY A;  2HVQ A;  1H0M A;  4D7M A;  3OY9 A;  3S17 J;  1C0W A;  5ILV A;  3L9F A;  1ETQ A;  3PSF A;  4D7N A;  3TL4 X;  4IL6 C;  5D4R A;  1ON1 A;  4NB5 A;  4L18 B;  1FOY A;  4F92 B;  1Y39 A;  1EKE A;  2CMP A;  3IHU A;  3IRR A;  2Y48 A;  4YIR X;  3WU2 C;  3WTZ A;  1HF0 A;  1FBS A;  4FE7 A;  5ICF A;  5IOZ A;  5BPI A;  4BXU A;  4GXO A;  1WSU A;  2Z3Y A;  3CCS I;  1W36 C;  4LJZ F;  2EFP A;  3BG9 A;  4GO1 A;  1IZ1 A;  4OIO F;  3N4M A;  3A0H C;  1OCP A;  5M3M J;  2FU4 A;  2KIU A;  1MBF A;  3COA C;  4BDY A;  5IPA A;  3GF2 A;  2GIZ A;  1LFP A;  5F1R A;  4YFX F;  3IH3 A;  3KP6 A;  4KT6 A;  3AG3 H;  3W6J B;  4M3D A;  4HRI A;  1ZGJ A;  1Q1V A;  3FF5 A;  1FOK A;  1X58 A;  3IH2 A;  4RMN A;  2KDZ A;  3P5J A;  5L3C A;  5DD8 A;  3IUO A;  4NDL A;  3I71 A;  3TDZ C;  1JJ6 C;  1WJC A;  3K0L A;  2W00 A;  2CYY A;  2KLO A;  3WTT C;  2G0E A;  2C6Y A;  3DEW A;  3ZCO A;  2W7N A;  1U2W A;  4G6T B;  4A3L J;  2OAZ A;  3WHC A;  5HDK A;  2RDP A;  1GT0 C;  3R0J A;  1P4A A;  2WAQ N;  2E1M B;  3FK7 A;  4G9Y A;  1VQ4 I;  4ZZL A;  3E1S A;  5KAI C;  2LNB A;  1B6A A;  2R7Q A;  4PFO A;  1R23 A;  4DW6 A;  4S0H B;  2M8E A;  5E1Z B;  1K4T A;  2EFN A;  2PMZ A;  4CHU A;  5BQT A;  2CGP A;  1DPU A;  3RYP A;  2GAU A;  5EF6 A;  2WAE A;  1MJB A;  5CPR B;  2Y31 A;  5IOY A;  3QAH A;  1OR7 A;  5H20 A;  4KA4 A;  4A3G J;  1RUN A;  3E5Q A;  3HM5 A;  3NEU A;  4CSW A;  3GUD A;  3MCZ A;  5HLI A;  1UFM A;  2JUG A;  4OIN F;  1IAW A;  5BS6 A;  3HRM A;  1BW5 A;  2FD5 A;  1LUJ B;  2HS5 A;  3O2P E;  3IAS 2;  2DA6 A;  4DJA A;  3OYH A;  3LSP A;  5E18 F;  1GUU A;  1CGP A;  4BL0 B;  4KIC A;  2LR8 A;  1NK2 P;  1VQM I;  4XOR A;  3ZQF A;  2DT6 A;  1QO0 D;  3UR3 C;  2XC7 A;  2EH3 A;  3BY6 A;  3EDP A;  4PJJ A;  1RR7 A;  2V79 A;  4EJV A;  3VOD A;  1D5V A;  1BR2 A;  1G4D A;  2FE3 A;  4CGZ A;  4FET A;  2JZY A;  1LPQ A;  1U3E M;  2XAH A;  5EZG A;  3U1K A;  3PIP F;  2J5O A;  2V9K A;  3G2B A;  1Y1V J;  2QQ9 A;  3RKQ A;  5FLX Z;  1TZL A;  3GO5 A;  2V1D A;  3BR5 A;  2JA8 J;  3VYR B;  4II3 A;  3BRO A;  2BY1 A;  2JVH A;  3ZOB A;  1FP1 D;  4V19 K;  4ZDL A;  1RUO A;  2FOK A;  2HTJ A;  2E2I J;  1JKO C;  5HLG A;  2EPF A;  5HDG A;  5C3E J;  3DTK A;  1IV8 A;  3LFK A;  3K4L A;  4NC6 A;  3ZQ7 A;  4PGH A;  3ZR8 X;  3BOQ A;  3AKZ A;  4OIP F;  3DPU A;  2Z5U A;  1U78 A;  3TGN A;  4NQW B;  5F6F A;  3BZC A;  3HUG A;  4IRI A;  1OCO H;  2JPB A;  3OMY A;  1QVT A;  2EJR A;  3VSK A;  3FXU A;  3I59 B;  4IXA A;  2RNG A;  2NVY J;  2OPT A;  3LA3 A;  2MBF A;  4BH9 A;  3CTA A;  1PP7 U;  4DIQ A;  2VI6 A;  1KZH A;  3U21 A;  1E2X A;  5E8I A;  3FMQ A;  2XAJ A;  3LL7 A;  5D8K B;  4MEX F;  4CCM A;  1HDD C;  2PJR B;  3GTO J;  2LP0 A;  3BT9 A;  2IPQ X;  2CU7 A;  4ENJ A;  5FKM A;  4UUV A;  2LRD A;  4CDG A;  1I6X A;  3LSR A;  4P1W A;  1S9H A;  2WTE A;  3S32 A;  3KFW X;  4IHY A;  1MSE C;  3CF5 F;  2RKH A;  1I1S A;  4Z2Y A;  1D1A A;  2EIN H;  4RGX A;  3IWF A;  4XID A;  2JVG A;  4Y13 A;  1P2F A;  3KYD B;  4P55 A;  4IZZ A;  3S2W A;  3EUK L;  3MKY B;  1QZE A;  3DF8 A;  4S05 A;  2X1D A;  4EV0 A;  2IJL A;  4PFP A;  3JAM K;  3DBH B;  5DV5 A;  4XM3 A;  2ZBK A;  2KHM A;  3ZMV A;  3QOE A;  1XSV A;  2MGQ A;  1IDZ A;  4A3K J;  2MH9 A;  3MZH A;  1HKT A;  3HOW J;  3BJO A;  1MNE A;  2MD0 A;  4JX4 A;  2XSD C;  1ZTR A;  3H3V K;  1S8N A;  1XDU A;  5CYV A;  3TQN A;  2GXA A;  1XMA A;  2QUF A;  5LHH A;  2BBY A;  2E5N A;  3KP2 A;  4A0Z A;  4EJW A;  5B5E C;  3QWL A;  1X2M A;  4L9T A;  3CDI A;  5M5X J;  4CUG A;  4C30 A;  5J1U A;  2O8K A;  3ASO H;  2BVL A;  2EZK A;  4ANJ A;  4M74 A;  3HTU A;  4BXF A;  1FZP B;  1BL0 A;  2ZME C;  3ZQH A;  1F36 A;  3LSK A;  2CQK A;  1B8I B;  4ABZ A;  4LMY A;  4DOZ A;  1IN7 A;  2XGC A;  1U6G A;  3LWF A;  2FSW A;  1TW2 A;  3BTC A;  5GAE J;  4LOC A;  4CYC A;  4AIK A;  4M3G A;  1YIO A;  1XSX A;  2DN0 A;  3I58 A;  3S8P A;  2DJI A;  1QQI A;  3PFY A;  3X2Q H;  4CCO A;  2ACJ A;  4JP0 A;  3MEX A;  1JT0 A;  1SFK A;  2G9W A;  4LG3 A;  2HQ5 A;  2RGV A;  1W7P A;  3Q0V A;  1UG2 A;  2VE9 A;  5HLT A;  2ZC2 A;  2CW0 F;  3MAJ A;  4YRV A;  4E7H A;  2LY1 A;  5C4J J;  1LQ1 A;  2OTL I;  1O3T A;  1HW5 A;  2BEO A;  1VQO I;  2ZO4 A;  2O9L A;  4MEY F;  5H2F C;  2G7H A;  3BR1 A;  2QBY A;  2L0K A;  2DQR A;  3EUH C;  1EF4 A;  2DXI A;  2KIF A;  1GLN A;  3IV5 A;  2XUB A;  4JBA A;  2DOF A;  2HOE A;  2DA1 A;  1Z77 A;  5J1R A;  2CFX A;  4LG0 A;  2VJ5 A;  1QA6 A;  2Y69 H;  3TDU C;  4P96 A;  5KCM A;  2QCO A;  3RKY A;  4HNU A;  3T1B A;  1UST A;  5HOD A;  4GYG A;  3GCM A;  3HOY J;  3E5X A;  2I5U A;  1SD4 A;  3CCV I;  3L1P A;  4HX4 A;  3E6C C;  4MTD A;  1D1C A;  3TO6 A;  3JRF A;  2NVU B;  3T8R A;  1KU7 A;  1G6N A;  2DLL A;  5FKO A;  2NS8 A;  4UHT A;  3FXJ A;  1DQU A;  3AAF A;  2L9N A;  2M7A A;  3GVA A;  3KYL A;  2M7B A;  5IYD J;  5F0F A;  3VPR A;  3CZ6 A;  2ZFU A;  4DYC A;  1FNN A;  3HKZ N;  1JKR C;  3CJT B;  4BHP A;  2L7Z A;  1T98 A;  2ZB9 A;  2D1V A;  2L5Q A;  3GX4 X;  2ZXH A;  2R7Z J;  4Y52 J;  1MW7 A;  2D5V A;  5K5Q A;  3HRU A;  3I59 A;  4JQF A;  5F08 A;  1FT9 A;  1I5Z A;  5EEH A;  2UZK A;  1R4N B;  1K78 A;  3H36 A;  4NHJ A;  3VB2 A;  3WG7 H;  3UKG A;  2STT A;  5JI6 A;  2H1K A;  3FDY A;  2CQQ A;  3FMS A;  2MW8 A;  4FTH A;  3TMO A;  4V2G A;  4BBR J;  3CP8 A;  2MAB A;  3DBL B;  1QRY A;  1FY7 A;  3R61 A;  1TQP A;  4ASN A;  4RLQ A;  5FRM A;  2RRE A;  4X0G A;  2QQB A;  1YJ9 I;  3WGH A;  2FUG 2;  2OUM A;  5J1Y A;  2VT2 A;  4DBR A;  3PIO F;  1BN5 A;  1VF9 A;  4BUP A;  2CH0 A;  2DO7 A;  1VI0 A;  2QQA A;  1S5L C;  1KQ0 A;  4I76 A;  5DM7 F;  3LAJ A;  3BR3 A;  4QIW N;  3LAP A;  4XQF A;  4X6A J;  3ZMU A;  4WCG A;  4WWC A;  2ME0 A;  2V4J C;  4O5V A;  1HOM A;  1NTC A;  3ZN0 A;  3MVP A;  2EV0 A;  3JRH A;  2LK2 A;  5B1A H;  2XKP A;  1R1U A;  2ZJR F;  1MBE A;  3C2H A;  2PLY A;  4XR6 A;  3OYM A;  1W7P D;  2DMP A;  5FFX A;  4IHX A;  3TP3 A;  4RB3 C;  3QRF F;  3I55 I;  1BOA A;  3MD2 A;  4C3I J;  3V7S A;  3HXL A;  2AO9 A;  1REP C;  1G8X A;  3I53 A;  4BGD A;  3SHF A;  5GTI C;  2ESN A;  2IXS A;  2O0Y A;  4PSW A;  5IYB J;  1UHM A;  5LBQ A;  4FX4 A;  2EIL H;  2CSO A;  4K2E A;  2W24 A;  4MTE A;  4JX5 A;  4LLL A;  4PUS A;  5LHG A;  4O3M A;  3I3L A;  1GHC A;  4BQO A;  5E1X A;  3W6K B;  2VPR A;  3J80 K;  3DBR B;  1FLI A;  1TBX A;  1T56 A;  1VZ0 A;  3WGG A;  4B47 A;  5IT3 A;  3J7Z I;  1OYW A;  1FTZ A;  5HS9 A;  4A3C J;  4UNO A;  3QPS A;  5J4V A;  4XRS G;  1VQ6 I;  4C9Y A;  1PP8 F;  1W1W E;  2N8G A;  1IDY A;  2Z9O A;  1H88 C;  4IOA F;  2JWT A;  1WWX A;  4MHG A;  2I10 A;  2MG4 A;  3JSO A;  1SC7 A;  3CCM I;  1JGG A;  3Q3S A;  3MKL A;  3V8J A;  5HS8 A;  2OA4 A;  1B59 A;  4MO7 A;  5FFZ A;  3FKI J;  5TJJ A;  3V42 A;  4AVZ A;  1XS9 A;  2QBY B;  1LFB A;  2ZNZ A;  2EZL A;  3ZMT A;  1KGS A;  2LG4 A;  1MDM B;  2EA4 A;  2E2J J;  4OU0 A;  2KQR A;  3LQQ A;  4N9I A;  4NC7 A;  1KON A;  1EJ9 A;  5FD5 A;  2ECB A;  3K1M A;  3OSF A;  3HB9 A;  2ZJP F;  1JE8 A;  2BHZ A;  2A07 F;  2HI3 A;  4A0Y A;  3OWT A;  1Y0U A;  3A1Y A;  2DYS H;  4WX9 A;  2WV0 A;  4MGR A;  1YJW I;  2Y9Z A;  1FX7 A;  3R60 A;  4M71 A;  2EFO A;  3NWS A;  4CCN A;  3KET A;  5L3F A;  3S1M J;  2HXO A;  3U1D A;  4XKC A;  1JT6 A;  2BV6 A;  4XLP F;  5E1W A;  1TQM A;  1IV6 A;  1SAN A;  3L7W A;  4Q4Z F;  1B8I A;  3FBN B;  3ZMS A;  3ERE D;  1KYW A;  2JRT A;  4B48 A;  2HOT A;  2DFH A;  4EMS A;  3BPV A;  2NS0 A;  2QVO A;  2MFZ A;  4I01 A;  5DDG A;  2BXZ A;  3GZ5 A;  2K3F A;  1YQA A;  3GTP J;  3H92 A;  2L7M P;  4ESB A;  2F5E A;  2R5Z A;  4ZH4 F;  3DPL C;  1U8R A;  1BI0 A;  1RC9 A;  1MMS A;  3ML6 A;  4C2U A;  2ME6 A;  3GBG A;  2EB7 A;  1BW6 A;  1N75 A;  4DYR A;  4FCY A;  2O03 A;  3P9C A;  4HLY A;  1E3H A;  3O3K A;  3HSE A;  1H9G A;  2XGD A;  4G8X A;  3OL4 A;  3OYN A;  4IQ4 A;  2MC3 A;  2ID6 A;  1XG1 A;  3OS1 A;  1R49 A;  5EDN A;  4CO8 A;  3HOZ J;  1QVU A;  1YW8 A;  1ZAR A;  2XHK A;  2G7U A;  2ZCW A;  3KP7 A;  5CVU A;  5LEK A;  4KMU X;  3OS0 A;  3A02 A;  2LFB A;  1WH7 A;  3JRD A;  1OCC H;  1IRG A;  1E3O C;  4UV9 A;  1UG0 A;  5LRR A;  3WTU C;  2FF4 A;  2UXN A;  3FKJ A;  5FD6 A;  4AIH A;  4HX7 A;  4EGY A;  4A5N A;  3I4N J;  2LTP A;  4XSZ F;  2ZJQ F;  3JTH A;  1P6R A;  5M5W J;  5BPD A;  1JKP C;  2GXB A;  4EEF G;  2MC4 A;  3TOB A;  1DP3 A;  2R93 J;  4MQV A;  5D5U B;  3RQI A;  4MFE A;  2QQ8 A;  2TRT A;  2FMY A;  1VTN C;  5E8G A;  3FM5 A;  3HKZ A;  2PEX A;  4MLO A;  3V7R A;  1YE9 A;  2QF7 A;  5EEA A;  3H35 A;  1AWC A;  1BI2 A;  3MKW B;  4FAS D;  1IRZ A;  3CC4 I;  3H9J A;  3TP0 A;  2Y0M A;  5J8C A;  3OYA A;  3FXL A;  1HLV A;  3VYT B;  2CWE A;  2AXL A;  2FOW A;  3BR2 A;  2FNP A;  2EIM H;  2DTZ A;  4XBF A;  2AHQ A;  4RM2 A;  2V6E A;  4W1U A;  1IGN A;  5DCM A;  4L0Y B;  1X3U A;  3JRA A;  4HX8 A;  1BC8 C;  1B72 A;  1FMV A;  2IS4 A;  2CUJ A;  2QSH X;  4A3M J;  1TNS A;  3WTY C;  1LE8 A;  5E3N A;  2MA3 A;  5JHU A;  1SD6 A;  3M8E A;  2M1B A;  1W5S A;  2CG4 A;  3JSP A;  3S1R J;  3C2B A;  4IRH A;  1SAU A;  3BJA A;  5D5W B;  2VON A;  2CV2 A;  3MMY B;  1MMN A;  1HW2 A;  1RI7 A;  4C2T A;  2JA6 J;  1BM9 A;  4A2U A;  1ZR4 A;  2K86 A;  2F4M B;  2FX0 A;  1TT0 A;  1HQC A;  2Z1D A;  3SZT A;  3GLX A;  2VXD A;  3G71 I;  2PMZ N;  1IUY A;  1JI8 A;  1FEX A;  2O7O A;  5L3D A;  3B02 A;  2A05 A;  1ZLK A;  1V4R A;  2F5D A;  2LKS A;  1FMW A;  1YFH A;  2E1O A;  4Y3O A;  3BTL A;  2A69 F;  2ZME A;  3S3N A;  2GZW A;  3TO9 A;  2XDV A;  3SZP A;  1XDS A;  4RDU A;  5CJ9 A;  2HZT A;  3ZGK A;  2X6W A;  4I02 A;  1X1C A;  1SFE A;  3BP8 A;  2ESH A;  5FKN A;  3TED A;  3DKW A;  3W2W A;  5LEJ A;  4AUX A;  5TGT A;  2B63 J;  3KP4 A;  3CCU I;  4LG0 B;  4XOP A;  1PUF B;  1HKS A;  3A03 A;  1DGW Y;  4F7Z A;  2E35 A;  4BY1 J;  4YFK F;  3GTJ J;  2K3P A;  4RM3 A;  2DA7 A;  1BR1 A;  1TWG J;  3BTJ A;  2WC2 A;  5BOX A;  1B1B A;  4NNJ A;  3KYC B;  1FSE A;  3DLA A;  3ZMZ A;  5IP6 A;  1IJW C;  1P7J A;  2PN6 A;  2M4G A;  3GLL A;  4JOM A;  2K4J A;  3KP3 A;  4HQE A;  2O5R A;  4ETS A;  1MKM A;  4Y17 A;  1FOX A;  2DMN A;  5E79 C;  5HDN A;  3WOD F;  5EYR A;  1U9N A;  4XLE A;  5D6E A;  1L0O C;  3RTR A;  3CC2 I;  4AYB A;  2E7W A;  4RGU A;  3FHN A;  2QYO A;  1OPC A;  1VQ8 I;  2EZI A;  3IKT A;  1W5T A;  2YR2 A;  2QM3 A;  3FXM A;  1P9Q C;  4GRI A;  4KIF A;  5ERI A;  2GA2 A;  5FLX K;  5ICE A;  3ZP5 A;  3S1N J;  2RVC A;  2KZG A;  3ELK A;  4NQW A;  5CQG A;  2XPW A;  4B3A A;  2HOA A;  2HDW A;  2F6C A;  2V26 A;  3D5L A;  3H5R A;  2RQQ A;  1S6L A;  4HNV A;  4E7Z A;  4UV8 A;  4PDK A;  4ZDP A;  5B3S H;  1G3Y A;  2XVC A;  1R7J A;  3OYK A;  4AU7 A;  3PUF A;  3H3Z A;  5IT9 Z;  3V7C A;  3T0Y A;  5B1B H;  1ETW A;  2VB6 A;  3AL0 C;  4L5J A;  4Q5S F;  2L9S A;  1VQP I;  3JTG A;  2V9V A;  2L3D A;  5J4Y A;  2H1L A;  3R0A A;  3BZK A;  2DOA A;  1LDD A;  1IF1 A;  1YTY A;  1J9I A;  3ZPL A;  2IP2 A;  2DMU A;  5M3F J;  3F9K A;  2IBD A;  4FE4 A;  1IUF A;  2CQX A;  2CQN A;  4WXH A;  4E6K G;  2KFD A;  2LBF B;  1YJN I;  3WGI A;  2R7R A;  1HXD A;  2GA1 A;  1I1G A;  3MQ0 A;  1HBX G;  1ZH5 A;  4LIV A;  1M1E B;  2BOL A;  2IGO A;  2YS9 A;  3M8J A;  4HST A;  4BJ6 C;  3JR9 A;  1IN8 A;  1SMY F;  1WPK A;  3P9K A;  2Y2Z A;  3L09 A;  2CJJ A;  4FT8 A;  1ZR2 A;  4LFU A;  1QZZ A;  3JAM Z;  2O61 A;  4GFB A;  1GV2 A;  4ZC3 A;  2RV8 A;  2NVQ J;  3QOP A;  3K7A J;  2UXX A;  1USS A;  4QPO A;  5H6Q A;  2E34 A;  1O57 A;  3I0T A;  3MZ8 A;  4Z6Y A;  3JRG A;  1V5G A;  3QYE A;  1D5Y A;  2ID3 A;  3GTM J;  1BJA A;  2HU9 A;  2R7V A;  2X6Y A;  4XRF A;  5EEG A;  1APL C;  5HVQ C;  2PI0 A;  2LKX A;  1FTT A;  2M34 A;  2QWW A;  3ZN1 A;  4DBQ A;  4IJA A;  3CLO A;  3OYI A;  2TDX A;  2NNN A;  4IKF A;  1Z7L A;  5EGO B;  1ZRC A;  1ZG3 A;  2R7T A;  1AKH B;  4LIU A;  1N78 A;  1OIS A;  3WU0 A;  2PMH A;  1FOW A;  2W82 A;  2LY9 A;  4EJT A;  5H6R A;  1LJ9 A;  2Y0S A;  2B9S A;  1CF7 A;  5K7F A;  1K4S A;  3WE2 A;  1SEU A;  2PQ8 A;  2R4G A;  4ENK A;  4HNT A;  1YW9 A;  3LMM A;  2GM4 A;  4PK4 A;  4M6X A;  4MFD A;  1MZB A;  2OC6 A;  1BI3 A;  2STW A;  2VQL A;  4M72 A;  3RSN A;  1Z67 A;  3ECH A;  4EAT A;  4IO9 F;  1XCB A;  5AON A;  1FIP A;  1LEA A;  2XIG A;  5FKL A;  1OCR H;  2X48 A;  4L9N A;  4YG2 F;  3S3O A;  1QHH D;  1MGT A;  3N97 A;  4LK1 F;  1G3S A;  3GFL A;  5LHI A;  1ETV A;  2VLA A;  1D1B A;  3P7N A;  2VT3 A;  1MDM A;  4IVN A;  6PAX A;  5IT9 K;  4X1E A;  3DXJ F;  4A6E A;  4PJM A;  2L4A A;  1MH4 A;  2BY3 A;  1VQ5 I;  4I0A A;  3OL3 A;  2W85 A;  4ZZD A;  5CVV A;  5JVT A;  5J6X A;  4G6Q A;  1WJE A;  3QPT A;  5K1Y A;  5CLS A;  1D8K A;  5JLX A;  4WF2 A;  3HOX J;  5FRN A;  3HHG A;  4CXF A;  3DPT A;  3R4K A;  3L2W A;  1GVD A;  4Q48 A;  4ZYA A;  2EFW A;  2HQN A;  1FSH A;  3KE2 A;  4OIQ F;  3L2C A;  2P8T A;  1D0X A;  5K7Z A;  4BJ5 C;  1Z3Y A;  4H4K C;  3KLN A;  1Z05 A;  1J59 A;  4DQ2 A;  1OLT A;  3GYH X;  2P5K A;  3F6V A;  3SEQ A;  3REO A;  4AWX B;  1VQN I;  4YIF A;  5L3G A;  5IP9 J;  2ISZ A;  3CUQ A;  1TWF J;  2MSY A;  5DM6 F;  3OS2 A;  2E1M C;  1MBG A;  2E36 A;  3KIO A;  1I50 J;  3Q9V A;  4UY8 I;  2W25 A;  2KJC A;  1SD5 A;  2MLG A;  2DAO A;  4B1R A;  4D0P A;  4BQN A;  4HF2 A;  1QGP A;  2FML A;  1FWZ A;  2XPV A;  3LNQ A;  2DA3 A;  2LLK A;  3TBI A;  2ECC A;  4RA2 A;  3C2G A;  4XKB A;  1YI2 I;  4C2M J;  1W0T A;  1ZEL A;  4EVI A;  1PYV A;  3B73 A;  5DEQ A;  5HOO A;  1YOV B;  3BG3 A;  4BNC A;  3FX3 A;  4HPQ A;  2W57 A;  4BE1 A;  1V3F A;  3WTS C;  1O7L A;  3E5U A;  1DU6 A;  4PCQ A;  4FIS A;  4BY7 J;  4PZJ A;  3ABM H;  5D8L B;  1LDJ A;  3KEQ A;  3CJN A;  3ZQG A;  2HPM A;  3LSI A;  1A31 A;  1ULY A;  2ELH A;  4BYY A;  1PDN C;  5FRO A;  3HSR A;  3KX2 A;  4RB2 C;  1LEB A;  4XKV A;  3KEO A;  1KU2 A;  1JUM A;  4B8X A;  4LLG F;  5EG0 A;  2XF6 A;  3FM3 A;  5JHF A;  1J7K A;  5LD2 C;  1J75 A;  4UB8 C;  2PBI A;  3LFU A;  2LOO A;  3GWZ A;  1RIO H;  3C1D A;  4HV5 A;  2H94 A;  1MMG A;  3U2R A;  2FJ1 A;  1TW3 A;  4M73 A;  5AIP A;  4OIR F;  4J19 A;  3A01 A;  3K4B A;  2HYJ A;  4IQJ A;  3F8N A;  4MIM A;  2WAQ A;  5A2Q K;  3E3V A;  2WB1 N;  4XN3 A;  1S29 A;  2HTS A;  5ICC A;  3ZQL A;  1V5F A;  1XN7 A;  2P7V B;  5F1J A;  2VAS A;  2KJB A;  2VKV A;  4AC0 A;  4PJN A;  3AFH A;  4G94 A;  1ACI A;  4L5E A;  2KKO A;  2K4B A;  4A12 A;  4RAF A;  2F5C A;  3IL2 A;  1T08 B;  3T5X A;  1O7F A;  4N4N B;  4HQM A;  3M1E A;  1R58 A;  1X19 A;  4I7H A;  2LC2 A;  4KN4 X;  3JRB A;  2VC1 A;  1T0F A;  3SZG A;  4DNC A;  2EBI A;  2VL8 A;  4IPA A;  4C3J J;  3HOU J;  5K5R A;  1TLH B;  3GFJ A;  1DPR A;  2HXI A;  5GTH C;  3OYJ A;  3I4P A;  3JCU C;  2OZU A;  4NBQ A;  2IEK A;  3HC7 A;  1SAX A;  4FQG A;  1S3J A;  4XKW A;  1ODD A;  3IC7 A;  2L54 A;  2ZKZ A;  4NC8 A;  4TV7 A;  4HA8 A;  5ILS A;  4F3Q A;  3J80 Z;  1WHU A;  4HYE A;  2Y0S N;  2DMQ A;  1OFC X;  4ESF A;  4B44 A;  4HAM A;  1V5E A;  2OBP A;  3RIR A;  5L3B A;  3WU1 B;  2DTR A;  5C4X J;  1WQ2 A;  2R0Q C;  4RAG A;  3S14 J;  4BEH A;  2ISY A;  1DU0 A;  2CUZ A;  4KMF A;  1E17 A;  2EZH A;  3CD6 I;  3B6A A;  4H0E A;  2E60 A;  1Y8Q B;  1YS7 A;  2K5C A;  3BG5 A;  1W7P B;  1WKM A;  5CVR A;  2LVS A;  3CMM A;  1T39 A;  2K9Q A;  2MH2 A;  5LFA A;  4B43 A;  3KLO A;  2ZJ2 A;  3F21 A;  3CLQ A;  2AS5 F;  3BG6 A;  4KUM A;  2XKO A;  3V4G A;  5EGO A;  2F5F A;  4M3F A;  3CES A;  3CCE I;  2VQG A;  1WJ5 A;  1ZAO A;  3CME I;  1RES A;  1IXR C;  2HYF A;  4KFC A;  1MD0 A;  1T2K A;  1MBH A;  2MYS A;  1QPM A;  3V8L A;  3HBL A;  1HST A;  3OIO A;  5F0C A;  3TW7 A;  5IYC J;  4IX7 A;  3Q5F A;  1TNT A;  1TWH J;  2L9R A;  4AVP A;  4ON0 A;  3G1L A;  4XNF A;  1ETX A;  4BDZ A;  1Y6I A;  1S72 I;  2UUZ A;  3BLY A;  2GWR A;  2H8W A;  2LF7 A;  1VQ9 I;  2M5W A;  3D5S C;  3HOT A;  3HYI A;  2DK8 A;  1IN4 A;  2H27 A;  4PJL A;  2KRC A;  1ZRE A;  2HQA A;  3F3X A;  4N4O B;  4WXD A;  2R7D A;  2A3S A;  3C18 A;  3JRC A;  4BQA A;  1RZ4 A;  3S93 A;  2ZFW A;  1P4W A;  3F22 A;  3W2V A; 
#chains in the Genus database with same CATH homology
 1P4X A;  2D1H A;  4OMZ A;  3T8T A;  3E6B A;  1LB2 A;  4I09 A;  1ZG5 A;  2P5L C;  3F8B A;  3FXR A;  5AIQ A;  3GFI A;  1DUX C;  2H6C A;  2KIM A;  4P9F A;  2LF8 A;  1BIB A;  4WXC A;  4R79 A;  3ISP A;  2IA0 A;  2E1C A;  1ZN2 A;  3OOP A;  4JK1 X;  2EK5 A;  2K27 A;  2OZ6 A;  2VE8 A;  4AIJ A;  3WG9 A;  1ZYR F;  2F2E A;  2P4W A;  5J8F A;  3E6M A;  1XSD A;  4EQQ A;  4L9J A;  4CIC A;  2DU9 A;  4LD5 A;  2ZXJ A;  1EH6 A;  3U9G A;  1J0R A;  2Q8K A;  1Z6T A;  2MLK A;  5BMZ A;  4UVA A;  1RNL A;  2A6E F;  2PJP A;  1SD7 A;  5D4S A;  3SFZ A;  3LST A;  3PFI A;  4KT5 C;  3VFZ A;  1QNT A;  2X4H A;  3R6S A;  2P6S A;  2JTV A;  2JT1 A;  1KQ8 A;  4E70 A;  3KP5 A;  3RDI A;  1EH7 A;  1JHF A;  1UB9 A;  4U0V A;  4A6D A;  4HZF A;  4ESJ A;  4ENN A;  4HOB A;  2EA2 A;  4L0Z B;  3JW4 A;  1L3L A;  2PFB A;  2FA5 A;  1FC3 A;  2IRF G;  4KIB A;  2DPU A;  5LRS A;  1ON2 A;  3BDD A;  3IKV A;  1R22 A;  1YYV A;  1OYY A;  1T6S A;  2BGC A;  2VOO A;  4KIG A;  2HDC A;  2A61 A;  3BZ6 A;  2VBZ A;  3I5U A;  3J81 K;  1LDK B;  1G3T A;  1O3Q A;  2HKX A;  4GYI A;  3QP5 A;  1KU3 A;  2YX4 A;  1HW1 A;  4O6J A;  2WWY A;  3ABT A;  5ILU A;  1LNW A;  3Q9S A;  3I54 A;  4YII A;  3D0S A;  1NHA A;  3GXO A;  2DK5 A;  2P7C B;  1PUE E;  2FBH A;  5HLH A;  3I64 A;  1MJ9 A;  2DW4 A;  3GFM A;  1K79 A;  2H09 A;  2UWM A;  1J2X A;  2NAZ A;  4A5M A;  5D5V B;  3E6D A;  3F8C A;  3QU6 A;  1OKR A;  4QWQ A;  4HV6 A;  2RNJ A;  4G7O F;  3ROU A;  2R7F A;  2YU3 A;  1U5T B;  1B9N A;  2IW5 A;  2NYX A;  1DDN A;  5D5X B;  2XAG A;  3HOS A;  3OV8 A;  2IA2 A;  3GEZ A;  5KK1 A;  2GIV A;  1SMT A;  3EYI A;  2M30 A;  3BWG A;  4B09 A;  3KZZ A;  2XRN A;  2OU2 A;  5FO5 A;  3VEP A;  2DBB A;  3K2Z A;  1Z9C A;  4FHT A;  2O3F A;  2V6C A;  2M87 A;  1W4M A;  3CUO A;  3H3U A;  5TRD A;  1IW7 F;  4I98 B;  4U0Y A;  3EQL F;  4MNU A;  5K5O A;  4HF0 A;  1F4K A;  4G7Z F;  1Z7U A;  4LGW A;  5ICG A;  4M9Z A;  2VOP A;  4P9U A;  2FRH A;  1B9M A;  3GW2 A;  2J5P A;  1U5T A;  1FPQ A;  4U7D A;  5DCF A;  1BBY A;  1FYL A;  3E97 A;  2HQR A;  3RKX A;  3P9I A;  5CVJ A;  2W84 A;  3DFG A;  2ZNY A;  4HF1 A;  1ONV A;  1S7O A;  3FZV A;  3J7A O;  4LK0 F;  2B0L A;  3GZ6 A;  4YFN F;  4HDV A;  3M9A A;  3ABU A;  4OOI A;  3C3W A;  3SXY A;  2OD5 A;  1FYM A;  1K6O A;  1B4A A;  3G73 A;  1Q1H A;  3CUQ C;  4EM1 A;  2Z33 A;  3EUH A;  2GXG A;  3FXQ A;  2FBI A;  4N9H A;  4I2O A;  4HW0 A;  3ULQ B;  1G3W A;  2CO5 A;  4CZZ A;  4HBL A;  1XMK A;  2QEN A;  4U88 A;  4GGG A;  4L9V A;  4ZYH A;  2EV6 A;  4ENM A;  2A68 F;  2VN2 A;  4BHB A;  1K78 B;  1ZG1 A;  2V1X A;  3HSF A;  3RJP A;  4A0X A;  2L02 A;  3QPH A;  3J81 Z;  2E7X A;  4KNY A;  2YPR A;  4R1H A;  5LGN A;  1ZRF A;  3O6B B;  1LVA A;  3RYR A;  4HDU A;  4ZYE A;  1S7A A;  1XGN A;  4XLN F;  2DT5 A;  2QLZ A;  5FGM A;  4CYD A;  4EM0 B;  2VBY A;  1IXS B;  1WRJ A;  2FXA A;  2COM A;  4IHT A;  2EWN A;  3CO6 C;  3DEU A;  4PGG A;  1SFX A;  1R00 A;  3K9T A;  3KCC A;  4WK8 F;  3QP6 A;  4LB6 B;  2LSO A;  3WTX C;  4KYW A;  3FWE A;  2EFQ A;  5LLQ A;  2O8X A;  4S04 A;  2XV4 S;  3FHZ A;  2DPD A;  2ADU A;  1KQ9 A;  3LQR A;  2JPC A;  4AD9 A;  3DQV C;  3MZY A;  3F8M A;  1QBJ A;  4HLX A;  2A5Y B;  4G7H F;  5DUI A;  1BIA A;  5DCM B;  3LA7 A;  1YG2 A;  1KU9 A;  2A6H F;  1T38 A;  2IA1 A;  1BC7 C;  3F8F A;  2NRA C;  1TQI A;  1FBQ A;  1D8J A;  2XGX A;  4EM2 A;  1A04 A;  4G6D A;  3BPX A;  2H6B A;  1YS6 A;  3VOE A;  2IVM A;  1XB4 A;  3ZMD A;  2FBK A;  4MQ9 F;  5CVI A;  1YW7 A;  4FX0 A;  2MD5 A;  5FB2 A;  4EJU A;  3QU3 A;  3TO7 A;  1K7A A;  2RQP A;  2OQG A;  5E17 F;  4RB0 A;  2DQL A;  2FNA A;  1HKQ A;  1ZGA A;  3HRT A;  1JGS A;  4BAY A;  1XGM A;  4Q47 A;  1F1Z A;  2QZ8 A;  2PG4 A;  2K7L A;  2L01 A;  2DFI A;  2VC0 A;  2HFH A;  1O3R A;  1XD7 A;  4RS8 A;  4RAZ A;  1JHH A;  1R1V A;  1UCR A;  1YO5 C;  3F6O A;  1I27 A;  3NQO A;  1KA8 A;  1IN5 A;  1SFU A;  4QLC U;  1DP7 P;  1ZLJ A;  3DP7 A;  1FBU A;  3G3Z A;  5KVR A;  2RN7 A;  2Y75 A;  1FYK A;  4LB5 A;  4N0B A;  1Z6R A;  1OYI A;  3RPU A;  5F64 A;  1R36 A;  2JSC A;  2HKO A;  2VBW A;  3SQN A;  2HEO A;  5HS7 A;  1IN6 A;  1Z91 A;  1TTY A;  2Q2E A;  2R3S A;  2E1N A;  1Z1D A;  3HIF A;  2P6T A;  4U0W A;  2D2W A;  2EV5 A;  1P92 A;  2P5V A;  2HR3 A;  1AOY A;  2K02 A;  3WE3 A;  3IRQ A;  1GVJ A;  2ZME B;  4P5O A;  5JFR A;  3TOA A;  3WTW C;  1H9T A;  2YX7 A;  4L5I A;  2RC4 A;  2LDU A;  1HSJ A;  4RGR A;  4Y15 A;  4RB1 A;  2XRO A;  4OMY A;  3M8F A;  5L3E A;  1IXC A;  2HYG D;  2HWV A;  1JXS A;  3K69 A;  2HGC A;  2VBX A;  1U5T C;  4M6Y A;  1WI9 A;  2VXZ A;  2D45 A;  5LGT A;  2X0L A;  3TKY A;  2PMU A;  3MWM A;  3K1N A;  3NRV A;  2BE5 F;  3C7J A;  3L00 A;  3RKW A;  2YSR A;  3HTS B;  4LLN A;  3DV8 A;  4RAY A;  4GCV A;  1J5Y A;  5E20 A;  4KDP A;  3HRS A;  3F23 A;  1QZY A;  1YLF A;  5ED4 A;  2IT0 A;  2Z99 A;  2LKP A;  3F72 A;  5DUK A;  1EV7 A;  4IHS A;  3M7G A;  5JR3 A;  1GXP A;  3MFK A;  2KRF A;  3CDH A;  5DYM A;  2NNY A;  2FEZ A;  2L4M A;  4R8H A;  4UXN A;  1KYZ A;  2M45 A;  2O6G E;  4I0B A;  3BJ6 A;  1MJA A;  1GXQ A;  4M9S A;  5D6F A;  2GQQ A;  2XAS A;  1XGS A;  4M9X A;  4KN7 X;  3WTV C;  1D3Y A;  4ZYD A;  4RGS A;  4BHC A;  1R5H A;  1STZ A;  4U7B A;  1ZRD A;  3CO7 C;  1FP2 A;  3RPQ A;  4ZYG A;  1IRF A;  3ECO A;  1BI1 A;  3FMR A;  3K1P A;  3RI4 A;  4EJO A;  4UVC A;  1R5G A;  2OQR A;  1O3S A;  1ZHF A;  2DI3 A;  3KZY A;  3HHH A;  1UHW A;  3V8K A;  2Q0O A;  2FQ3 A;  1R1T A;  3IWZ A;  1F5T A;  1EH8 A;  3PQJ A;  1OMI A;  5DD4 A;  1XCV A;  3EET A;  4UVB A;  3CUQ B;  2BYV E;  4IF4 A;  1F9N A;  5A2Q Z;  1XGO A;  2V1U A;  2XAQ A;  3PQK A;  4EGZ A;  5LGU A;  4IRG A;  2XAF A;  2ETH A;  4XSX F;  3LA2 A;  3EYY A;  1H0M A;  1C0W A;  5ILV A;  3L9F A;  5D4R A;  1ON1 A;  4NB5 A;  4L18 B;  3IHU A;  3IRR A;  2Y48 A;  3WTZ A;  1FBS A;  5ICF A;  5BPI A;  4BXU A;  4GXO A;  1WSU A;  2Z3Y A;  4LJZ F;  2EFP A;  4GO1 A;  1IZ1 A;  4OIO F;  3N4M A;  2FU4 A;  2KIU A;  3COA C;  3GF2 A;  5F1R A;  4YFX F;  3KP6 A;  3W6J B;  1ZGJ A;  1FOK A;  3FF5 A;  5L3C A;  5DD8 A;  3TDZ C;  3I71 A;  3K0L A;  2CYY A;  3WTT C;  2C6Y A;  1U2W A;  2OAZ A;  5HDK A;  2RDP A;  3R0J A;  1P4A A;  4G9Y A;  4ZZL A;  2LNB A;  1B6A A;  1R23 A;  2M8E A;  5E1Z B;  2EFN A;  4CHU A;  5BQT A;  2CGP A;  1DPU A;  3RYP A;  2GAU A;  1MJB A;  3QAH A;  1OR7 A;  5H20 A;  4KA4 A;  1RUN A;  3E5Q A;  3NEU A;  3GUD A;  3MCZ A;  5HLI A;  1UFM A;  4OIN F;  1IAW A;  5BS6 A;  3HRM A;  2HS5 A;  3O2P E;  5E18 F;  1CGP A;  4KIC A;  1QO0 D;  3BY6 A;  3EDP A;  2V79 A;  4EJV A;  3VOD A;  1D5V A;  1G4D A;  2FE3 A;  4CGZ A;  2JZY A;  1U3E M;  2XAH A;  2J5O A;  2QQ9 A;  5FLX Z;  3GO5 A;  2V1D A;  3BRO A;  1FP1 D;  1RUO A;  2FOK A;  2HTJ A;  5HLG A;  5HDG A;  3LFK A;  3ZQ7 A;  4PGH A;  3BOQ A;  4OIP F;  2Z5U A;  1U78 A;  3TGN A;  5F6F A;  4IRI A;  3HUG A;  2JPB A;  2EJR A;  3FXU A;  3I59 B;  4IXA A;  3LA3 A;  2MBF A;  4BH9 A;  3CTA A;  1PP7 U;  1E2X A;  5E8I A;  3FMQ A;  2XAJ A;  5D8K B;  4MEX F;  2IPQ X;  4ENJ A;  4UUV A;  4CDG A;  1I6X A;  2WTE A;  3KFW X;  2RKH A;  1I1S A;  4Z2Y A;  4RGX A;  3IWF A;  4Y13 A;  1P2F A;  4P55 A;  3S2W A;  3DF8 A;  4S05 A;  4EV0 A;  2IJL A;  3JAM K;  5DV5 A;  2ZBK A;  3ZMV A;  1XSV A;  2MH9 A;  3MZH A;  1HKT A;  3BJO A;  1S8N A;  1XDU A;  5CYV A;  3TQN A;  1XMA A;  2QUF A;  5LHH A;  2BBY A;  3KP2 A;  4A0Z A;  4EJW A;  4L9T A;  4M74 A;  3HTU A;  1FZP B;  2CQK A;  4LMY A;  1IN7 A;  1U6G A;  3LWF A;  2FSW A;  1TW2 A;  4AIK A;  1YIO A;  1XSX A;  3I58 A;  1QQI A;  2ACJ A;  3MEX A;  2G9W A;  2RGV A;  1W7P A;  2VE9 A;  2CW0 F;  3MAJ A;  1LQ1 A;  1O3T A;  1HW5 A;  2BEO A;  2ZO4 A;  4MEY F;  2G7H A;  2QBY A;  2DQR A;  2KIF A;  2XUB A;  4JBA A;  2HOE A;  2CFX A;  4LG0 A;  3TDU C;  4P96 A;  3RKY A;  3T1B A;  1UST A;  4GYG A;  3E5X A;  1SD4 A;  4HX4 A;  3E6C C;  4MTD A;  3TO6 A;  3T8R A;  1KU7 A;  1G6N A;  2DLL A;  4UHT A;  3AAF A;  3GVA A;  1FNN A;  4BHP A;  1T98 A;  2D1V A;  3GX4 X;  5K5Q A;  3HRU A;  3I59 A;  4JQF A;  1FT9 A;  1I5Z A;  5EEH A;  2UZK A;  1K78 A;  4NHJ A;  3VB2 A;  2STT A;  5JI6 A;  3FMS A;  1FY7 A;  3R61 A;  1TQP A;  4ASN A;  2QQB A;  3WGH A;  2VT2 A;  1BN5 A;  2DO7 A;  2QQA A;  1KQ0 A;  3LAJ A;  3LAP A;  3ZMU A;  4WCG A;  4WWC A;  4O5V A;  3ZN0 A;  2EV0 A;  2XKP A;  1R1U A;  2PLY A;  1W7P D;  5FFX A;  4RB3 C;  3QRF F;  1BOA A;  3V7S A;  1REP C;  3I53 A;  3SHF A;  2ESN A;  2O0Y A;  1UHM A;  5LBQ A;  4FX4 A;  2CSO A;  4K2E A;  2W24 A;  4MTE A;  4LLL A;  1GHC A;  5LHG A;  4O3M A;  5E1X A;  3W6K B;  3J80 K;  1FLI A;  1TBX A;  3WGG A;  5IT3 A;  1OYW A;  5HS9 A;  4UNO A;  1PP8 F;  2Z9O A;  1WWX A;  4MHG A;  3JSO A;  3V8J A;  5HS8 A;  2OA4 A;  1B59 A;  2QBY B;  5FFZ A;  5TJJ A;  2ZNZ A;  3ZMT A;  1KGS A;  1MDM B;  2EA4 A;  4OU0 A;  4N9I A;  3LQQ A;  5FD5 A;  3K1M A;  1JE8 A;  2A07 F;  4A0Y A;  1Y0U A;  4WX9 A;  2WV0 A;  4MGR A;  1FX7 A;  3R60 A;  4M71 A;  2EFO A;  3KET A;  5L3F A;  3U1D A;  2BV6 A;  4XLP F;  5E1W A;  1TQM A;  3L7W A;  4Q4Z F;  3ZMS A;  3ERE D;  1KYW A;  2JRT A;  4EMS A;  3BPV A;  2NS0 A;  2QVO A;  5DDG A;  4I01 A;  3GZ5 A;  1YQA A;  3H92 A;  4ESB A;  2F5E A;  4ZH4 F;  3DPL C;  1U8R A;  1BI0 A;  3ML6 A;  2EB7 A;  2O03 A;  3P9C A;  4HLY A;  3O3K A;  3HSE A;  1H9G A;  4G8X A;  2MC3 A;  4CO8 A;  1YW8 A;  1ZAR A;  5CVU A;  2G7U A;  2XHK A;  2ZCW A;  3KP7 A;  5LEK A;  4KMU X;  1IRG A;  4UV9 A;  5LRR A;  3WTU C;  2FF4 A;  2UXN A;  5FD6 A;  4AIH A;  4HX7 A;  4EGY A;  4A5N A;  4XSZ F;  5BPD A;  3JTH A;  1P6R A;  2GXB A;  3TOB A;  4MQV A;  5D5U B;  2FMY A;  1VTN C;  5E8G A;  3FM5 A;  2PEX A;  3V7R A;  1AWC A;  1BI2 A;  2Y0M A;  5J8C A;  2CWE A;  2AXL A;  2FNP A;  4XBF A;  5DCM A;  4L0Y B;  1X3U A;  4HX8 A;  1BC8 C;  1TNS A;  3WTY C;  2MA3 A;  5JHU A;  1SD6 A;  3M8E A;  2M1B A;  1W5S A;  2CG4 A;  4IRH A;  5D5W B;  3BJA A;  2VON A;  1HW2 A;  1RI7 A;  1BM9 A;  4A2U A;  2K86 A;  1HQC A;  3SZT A;  3GLX A;  1IUY A;  5L3D A;  3B02 A;  1ZLK A;  1V4R A;  2F5D A;  1YFH A;  2A69 F;  2ZME A;  2GZW A;  3TO9 A;  3SZP A;  1XDS A;  5CJ9 A;  2HZT A;  4I02 A;  1SFE A;  3BP8 A;  2ESH A;  3DKW A;  5LEJ A;  3KP4 A;  4LG0 B;  1HKS A;  4F7Z A;  4YFK F;  2WC2 A;  5BOX A;  1B1B A;  1FSE A;  3ZMZ A;  2PN6 A;  2K4J A;  3KP3 A;  4HQE A;  4ETS A;  1MKM A;  4Y17 A;  5HDN A;  3WOD F;  5D6E A;  1L0O C;  3RTR A;  2E7W A;  4RGU A;  2QYO A;  1OPC A;  3IKT A;  1W5T A;  2YR2 A;  2QM3 A;  5ERI A;  4KIF A;  2GA2 A;  5FLX K;  5ICE A;  3ZP5 A;  2RVC A;  3ELK A;  4NQW A;  3D5L A;  1S6L A;  4UV8 A;  4PDK A;  1G3Y A;  2XVC A;  1R7J A;  3H3Z A;  5IT9 Z;  3V7C A;  3T0Y A;  4L5J A;  4Q5S F;  3JTG A;  2V9V A;  2L3D A;  3R0A A;  1LDD A;  1IF1 A;  1YTY A;  1J9I A;  3ZPL A;  2IP2 A;  4WXH A;  3WGI A;  1HXD A;  2GA1 A;  1I1G A;  3MQ0 A;  1HBX G;  1ZH5 A;  1IN8 A;  1SMY F;  3P9K A;  4FT8 A;  3L09 A;  4LFU A;  1QZZ A;  3JAM Z;  2O61 A;  2RV8 A;  3QOP A;  2UXX A;  1USS A;  5H6Q A;  1O57 A;  3I0T A;  1BJA A;  4XRF A;  5EEG A;  5HVQ C;  2PI0 A;  2QWW A;  3ZN1 A;  4IJA A;  3CLO A;  2TDX A;  2NNN A;  1ZRC A;  1ZG3 A;  3WU0 A;  2PMH A;  4EJT A;  5H6R A;  1LJ9 A;  1CF7 A;  3WE2 A;  2PQ8 A;  4ENK A;  1YW9 A;  4M6X A;  1MZB A;  1BI3 A;  2STW A;  4M72 A;  3ECH A;  1XCB A;  5AON A;  1LEA A;  2XIG A;  4YG2 F;  4L9N A;  1MGT A;  3N97 A;  4LK1 F;  1G3S A;  3GFL A;  5LHI A;  3P7N A;  2VT3 A;  1MDM A;  4IVN A;  6PAX A;  5IT9 K;  3DXJ F;  4A6E A;  2L4A A;  4I0A A;  2W85 A;  4ZZD A;  5CVV A;  5JVT A;  5J6X A;  4G6Q A;  3QPT A;  5K1Y A;  5CLS A;  1D8K A;  4WF2 A;  3HHG A;  4CXF A;  3DPT A;  3R4K A;  4Q48 A;  2EFW A;  2HQN A;  1FSH A;  3KE2 A;  4OIQ F;  3L2C A;  2P8T A;  3KLN A;  1Z05 A;  1J59 A;  4DQ2 A;  3GYH X;  2P5K A;  3F6V A;  3REO A;  4AWX B;  4YIF A;  5L3G A;  2ISZ A;  3CUQ A;  3Q9V A;  2W25 A;  2KJC A;  1SD5 A;  2MLG A;  2DAO A;  4D0P A;  4HF2 A;  1QGP A;  2FML A;  1FWZ A;  4EVI A;  5DEQ A;  3B73 A;  5HOO A;  4BNC A;  3FX3 A;  2W57 A;  1V3F A;  3WTS C;  1O7L A;  3E5U A;  4PCQ A;  5D8L B;  4PZJ A;  1LDJ A;  3KEQ A;  3CJN A;  1ULY A;  2ELH A;  1PDN C;  4BYY A;  3HSR A;  4RB2 C;  1LEB A;  3KEO A;  1KU2 A;  4B8X A;  4LLG F;  3FM3 A;  1J7K A;  1J75 A;  2PBI A;  3GWZ A;  1RIO H;  3C1D A;  4HV5 A;  2H94 A;  3U2R A;  1TW3 A;  4M73 A;  5AIP A;  4OIR F;  3F8N A;  5A2Q K;  3E3V A;  1S29 A;  2HTS A;  5ICC A;  1XN7 A;  2P7V B;  2KJB A;  4G94 A;  2KKO A;  2K4B A;  4A12 A;  2F5C A;  3IL2 A;  3T5X A;  1O7F A;  4HQM A;  3M1E A;  1R58 A;  4I7H A;  4KN4 X;  2VC1 A;  1T0F A;  4DNC A;  4IPA A;  5K5R A;  1TLH B;  3GFJ A;  1DPR A;  3I4P A;  2OZU A;  1SAX A;  1CF7 B;  1S3J A;  3JSP A;  1ODD A;  3IC7 A;  2L54 A;  2ZKZ A;  4TV7 A;  5ILS A;  4HA8 A;  3J80 Z;  4HYE A;  4ESF A;  4HAM A;  2OBP A;  3RIR A;  5L3B A;  3WU1 B;  2DTR A;  1WQ2 A;  2ISY A;  4KMF A;  1E17 A;  4H0E A;  1YS7 A;  1W7P B;  1WKM A;  5CVR A;  1T39 A;  2MH2 A;  3KLO A;  2ZJ2 A;  3F21 A;  2AS5 F;  4KUM A;  2XKO A;  3V4G A;  2F5F A;  1ZAO A;  1IXR C;  2HYF A;  4KFC A;  1MD0 A;  1T2K A;  1QPM A;  3V8L A;  1HST A;  3Q5F A;  1TNT A;  4AVP A;  4ON0 A;  2GWR A;  2LF7 A;  2M5W A;  3HOT A;  3HYI A;  2DK8 A;  1IN4 A;  2H27 A;  1ZRE A;  3F3X A;  4WXD A;  2R7D A;  2A3S A;  3C18 A;  4BQA A;  1RZ4 A;  2ZFW A;  1P4W A;  3F22 A;  2VOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...