3QPTA

Crystal structure of the salmonella transcriptional regulator slya
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
132
Chain Sequence
LGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator slyA
publication title Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Transcription
total genus 49
structure length 132
sequence length 139
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qptA00
2B0LA 4HQMA 1ZGJA 2VONA 2ISYA 1LVAA 3KP7A 3RPUA 1FC3A 3CDHA 3DP7A 1S7OA 1PUEE 3LSTA 4M6YA 2ZMEB 2K02A 3LA7A 2HTJA 1OPCA 2BE5F 1IN6A 4EJOA 2HQRA 4IJAA 2WTEA 5LGTA 2WV0A 4GYIA 3TOBA 3ABUA 2D1VA 2XRNA 3WTZA 1O7FA 4I7HA 2DW4A 3TQNA 2C6YA 1DP7P 3MWMA 1MGTA 3DPLC 2A69F 1U2WA 3FM5A 3I53A 4A2UA 2XVCA 4IF4A 2HFHA 1FBQA 1OKRA 1LJ9A 1SMYF 4YIIA 5BPDA 2ZXJA 4LFUA 4BQAA 5L3BA 5FLXK 1XCVA 4KIGA 4M74A 4IXAA 3J7AO 1BN5A 2XHKA 4Q4ZF 4UHTA 2K86A 3V8LA 4I2OA 2DU9A 3IL2A 4ESJA 1XSXA 4MEXF 4BHPA 3SXYA 5ILSA 2FA5A 3HSRA 2ISZA 2V1UA 4KYWA 1HKSA 3L7WA 3Q9SA 2HYFA 1IN4A 2CSOA 2V1XA 4N9HA 1XSDA 1D8JA 1TLHB 2KRFA 3JSOA 3HTUA 2P5LC 1TBXA 2H09A 3K1NA 1J75A 4MGRA 4GGGA 1G6NA 3RJPA 5L3EA 2JZYA 1B4AA 1B9NA 3HRMA 3ECOA 2VBWA 3FXUA 2VOPA 1BIAA 1UHMA 1REPC 2H6BA 1QQIA 5ED4A 4G7HF 3N97A 2XV4S 2DQLA 2MH2A 2PMUA 3E6DA 2ETHA 5AONA 5ICEA 1STZA 1SD5A 4E70A 3F21A 1YG2A 3IC7A 1U3EM 3RI4A 3WU1B 1T2KA 4EJUA 1BC8C 1R1VA 1P92A 3KP5A 4XSZF 3RIRA 1Z9CA 3SZTA 4P9UA 4AIHA 5ICFA 3GZ5A 2XAFA 1LB2A 2FMYA 5DYMA 1KYWA 1I1SA 3N4MA 1KU2A 1G3SA 3LQQA 4G8XA 2CWEA 4O5VA 3G3ZA 4IRIA 3ZMVA 5KVRA 1RI7A 2DFIA 2VXZA 2TDXA 2W24A 4Y15A 1LDJA 2PBIA 2YX7A 3CUQA 4ENJA 1I6XA 2DPDA 1YO5C 1LNWA 4L0YB 1XGNA 3RPQA 2FBKA 1IW7F 3HHHA 4U0WA 3MCZA 5LLQA 2H6CA 4M73A 2K7LA 2QZ8A 5JVTA 2NAZA 4DQ2A 1FX7A 3F72A 3TO6A 5ILVA 3ERED 2M30A 2FNAA 4ON0A 2PLYA 3J80Z 5KK1A 2QLZA 1FYLA 1ZLJA 5D5XB 5D4RA 1J7KA 3CJNA 3VODA 2V6CA 4LD5A 2Q8KA 3F8BA 3HIFA 1W5TA 2RKHA 4UUVA 3FF5A 3M7GA 5FO5A 3PFIA 4WCGA 4EM2A 3GFJA 4A12A 2GWRA 5FFXA 2G9WA 4ESBA 3CLOA 3I59B 3D0SA 5E1XA 2VOOA 3GYHX 3K9TA 4N0BA 1Z6RA 5K1YA 1QNTA 2DAOA 2Z99A 1H0MA 3AAFA 3ZQ7A 1J9IA 2EFWA 2LF7A 1QZYA 4O6JA 3O3KA 2E1NA 3FMSA 1G3TA 4F7ZA 2VODA 2OBPA 5TRDA 2JSCA 5FB2A 2W57A 3JTHA 1Z1DA 2VC0A 1EV7A 3TOAA 3JSPA 3I0TA 3LA2A 2QQ9A 3SFZA 3IRRA 1BOAA 2XUBA 4HV5A 1MJAA 1XCBA 5E18F 4JK1X 4OMZA 2YSRA 1ZRFA 1MD0A 1HKQA 4R1HA 5J8FA 1QGPA 3L09A 1JGSA 5ILUA 1USTA 3TDZC 4KFCA 1XB4A 1XMAA 4GCVA 3SQNA 2FBIA 2PFBA 3MQ0A 3U9GA 3OV8A 4OIOF 2ELHA 4LB5A 1ZRDA 1UFMA 4ZZDA 5HS8A 1SFXA 3WE2A 2FBHA 5D5WB 1MJBA 4U0VA 4M72A 1P4WA 5H6QA 3Q9VA 3W6KB 4Q48A 4M6XA 1BI3A 3I71A 4L9TA 1HQCA 4XRFA 2OQGA 1MDMB 1P6RA 1B9MA 3WTXC 3QP6A 1ZYRF 4P96A 4HF2A 2OZ6A 2IPQX 3J80K 2O3FA 2CFXA 2IA2A 3QPTA 2F5DA 1YW7A 3RYPA 3R0AA 2L02A 4HYEA 1H9GA 3S2WA 1OYIA 5H20A 4LLNA 2A61A 5IT9Z 1U8RA 4U0YA 3OOPA 1T39A 1R23A 2CO5A 1FSHA 1BJAA 4IPAA 2A3SA 5JR3A 1SD7A 2L01A 3ZMUA 2QWWA 5ICCA 5E1WA 3LQRA 1QBJA 3G73A 3KP2A 4LMYA 2STWA 4BYYA 3KLOA 4RB0A 5E8GA 2R7FA 3BDDA 5CVJA 3B73A 3KZZA 3M9AA 1T6SA 3K69A 3V4GA 4ASNA 4AIJA 1WSUA 4OIPF 2HTSA 3KETA 3IWFA 3F23A 2Y75A 2BYVE 3FHZA 3I5UA 3ZMDA 3E3VA 2P7VB 5A2QZ 1O3TA 2XKOA 3M8FA 2KIFA 4S05A 4OOIA 3M8EA 4U88A 2QQBA 4K2EA 3T8TA 1U5TC 1ON2A 4RAYA 1J0RA 1YW8A 2FMLA 3BPXA 1NHAA 3V8KA 2P6TA 1LQ1A 3R4KA 1SMTA 5DUKA 4B8XA 4NQWA 4A0ZA 3CO6C 1YYVA 4A6EA 4UV8A 2M1BA 3SHFA 1RUOA 2AXLA 1TTYA 1HXDA 1R22A 1S6LA 4LK1F 1ZH5A 2K4BA 1ZN2A 2P5VA 2UXNA 3ISPA 3VFZA 2BBYA 4CDGA 3I59A 2HGCA 5HLIA 5D6FA 3QU3A 3QRFF 1IN8A 1T98A 2Z9OA 3QPHA 2QM3A 2RGVA 3TO9A 1DDNA 1BI2A 5CYVA 4G7OF 1FZPB 3V8JA 1KQ8A 2VE8A 4I02A 5E1ZB 4XLPF 1F4KA 2MBFA 1Q1HA 1C0WA 1FBSA 4LB6B 1D5VA 1R36A 3COAC 2IT0A 1I1GA 1UCRA 2EA2A 2DK5A 1D3YA 1F5TA 3ROUA 2LKPA 1ZAOA 4ZH4F 4FT8A 1X3UA 2P5KA 3GWZA 2IA0A 1U6GA 4A0YA 5IT9K 2COMA 4RGXA 4CHUA 2DQRA 2PJPA 5L3FA 3REOA 2M8EA 3GEZA 2E7XA 3F6OA 4FX4A 1YQAA 2ACJA 2M5WA 3WGIA 3TDUC 1W4MA 1XGOA 2F5CA 4ZYGA 3BP8A 1TW2A 1H9TA 1KGSA 3FXRA 1JHHA 3K2ZA 3F6VA 4KIBA 1FP2A 1HSJA 3CUQC 3ML6A 1TW3A 5E8IA 5DCFA 4EGYA 3F22A 5JHUA 2RQPA 1TQPA 3SZPA 3V7RA 4AVPA 1LDKB 4M9XA 1K79A 4EGZA 1YIOA 3ECHA 2CGPA 2HKOA 5A2QK 3E97A 3F8FA 1HKTA 3RYRA 2EFQA 3IWZA 4ENNA 2GIVA 1I5ZA 3WGGA 2RV8A 3KP6A 1O3QA 1YLFA 3E5XA 3H3UA 2L3DA 4HLXA 3ZMTA 3MAJA 1FPQA 1E2XA 1MDMA 5HLGA 1O7LA 2PN6A 3KZYA 4N9IA 4HF0A 1GVJA 1O3SA 5DUIA 2EK5A 2A07F 3EQLF 2MLKA 5D6EA 5IT3A 2DI3A 2KKOA 4CGZA 1IUYA 3BWGA 1Z6TA 1QZZA 2EFPA 1K6OA 1USSA 3QAHA 1WWXA 2RDPA 1BI0A 5BPIA 4EJTA 5LHHA 1XMKA 2G7HA 1P4XA 4XLNF 2OZUA 5E20A 4CZZA 2V9VA 2QYOA 2WWYA 2IRFG 4CICA 1BI1A 2O8XA 2XIGA 4DNCA 1RIOH 3TGNA 4YFKF 2K4JA 4PDKA 1W7PD 1J59A 4OIQF 4WXDA 5BS6A 3T8RA 4HA8A 5D8KB 2DBBA 5D5UB 1MJ9A 3WG9A 2QVOA 2M45A 1UB9A 2WC2A 3H3ZA 4OMYA 2E7WA 4ZYEA 2YR2A 5HOOA 2GXBA 4ZZLA 1TQIA 5CVVA 5K5RA 4G9YA 2R7DA 1IZ1A 4OINF 2EJRA 5CVIA 3ZN0A 4EM0B 1XGSA 4JQFA 4YFNF 2Q0OA 1UHWA 5H6RA 4Z2YA 4ZYHA 2V1DA 5K5OA 1ODDA 1BM9A 1WKMA 1SAXA 3T0YA 1FOKA 5DDGA 2R3SA 2JT1A 3JAMZ 2HEOA 3DEUA 4EV0A 2IW5A 3J81Z 1KU9A 2PG4A 2MLGA 2X4HA 1QO0D 1KQ9A 4LG0B 3U1DA 1CGPA 3KFWX 2H27A 3GXOA 4MEYF 1B59A 3O2PE 3FMQA 2RC4A 2NRAC 1SD4A 4L5IA 2XASA 1BIBA 2O6GE 1R58A 2D2WA 4RS8A 1FP1D 1G3WA 1V3FA 4AD9A 3WTSC 2F5EA 3DKWA 5ICGA 3RKYA 1WQ2A 1KYZA 3HHGA 3HOSA 1U5TB 5F64A 1SD6A 2J5OA 3GO5A 2IA1A 1DPRA 1S8NA 5DD8A 4ENKA 4GYGA 2OD5A 1V4RA 3FMRA 2OQRA 5BQTA 1WI9A 1HSTA 3TKYA 4YFXF 4EJVA 3WTWC 3V7CA 1F9NA 3F8NA 1TNSA 3R60A 2PQ8A 2QQAA 1R5HA 1FYMA 2L54A 4I0BA 2HYGD 1I27A 4MNUA 2G7UA 3QU6A 2ZFWA 2EWNA 3KP4A 1K7AA 2HS5A 1SFEA 1XD7A 2XAGA 2ZKZA 4L9VA 3RKXA 1IAWA 4Y17A 2IVMA 2ZJ2A 4QLCU 4OIRF 1L3LA 1O57A 3P9IA 1XDUA 5FD6A 5F1RA 4NB5A 5HVQC 2XAQA 3KCCA 3BOQA 2XKPA 2CG4A 4HAMA 6PAXA 3BJAA 2YX4A 3BJ6A 1TQMA 2KJBA 2ESNA 4R79A 4IRHA 3WU0A 5CLSA 2EB7A 3JTGA 2JRTA 5LGUA 3JAMK 3BY6A 1KA8A 3L00A 2RVCA 1ZRCA 3J81K 1OYYA 5J6XA 5K5QA 5CJ9A 3I58A 1IRFA 3B02A 2HDCA 5FFZA 4CO8A 4UXNA 1CF7A 3ULQB 2FSWA 1R7JA 4ESFA 2KIMA 4KT5C 3IRQA 3GFLA 2JTVA 2V79A 1ZG5A 4M9ZA 3T5XA 1IN7A 1BBYA 2DLLA 2JPBA 4G94A 1OYWA 2RNJA 2FEZA 3MEXA 2EV6A 3GUDA 3WE3A 3KEQA 4KDPA 3K1MA 2A6EF 4I98B 3C3WA 2ZCWA 3WTVC 3HOTA 3KP3A 3ELKA 2PI0A 1OMIA 1JXSA 2ADUA 4HOBA 3R0JA 4GO1A 1S29A 1K78B 2EA4A 3EYIA 2BV6A 4MQ9F 1SFUA 4LLLA 1R1UA 2A5YB 3F8MA 1BC7C 3EDPA 1DUXC 2VT3A 2EFOA 3HSEA 1GHCA 1QPMA 4WF2A 3O6BB 3HTSB 4I01A 3R6SA 2HZTA 2VBXA 2FF4A 3HSFA 1ZREA 4KICA 3RDIA 2GXGA 4EQQA 5BMZA 4MQVA 2FRHA 1YS6A 1JHFA 4RB1A 3GF2A 1RZ4A 3L9FA 3CUOA 4JBAA 1P4AA 3WGHA 1GXQA 2AS5F 3QOPA 3EUHA 2FQ3A 4MTEA 5LHIA 1TNTA 2OU2A 4LG0A 2NNNA 4EJWA 2FE3A 2X0LA 3HRSA 1IN5A 4A5MA 4HV6A 2XGXA 3W6JB 5L3CA 4IHTA 1LDDA 3GW2A 4AIKA 2HQNA 3ZMZA 4M71A 3DQVC 1IXSB 1IRGA 3VEPA 1FWZA 3KLNA 2DK8A 1FY7A 3EYYA 1Z7UA 2M87A 3F3XA 1ZG3A 4HX7A 1U5TA 3Q5FA 4OU0A 1AWCA 5F6FA 2CW0F 2YPRA 3GX4X 1HW2A 2P7CB 1ONVA 2CYYA 3P9CA 2ZNZA 1MKMA 1XDSA 4H0EA 4GXOA 1PDNC 2LF8A 5HLHA 2HR3A 1HBXG 3IKTA 2L4MA 3ZN1A 3NEUA 3LAPA 4KMUX 1R5GA 4O3MA 3IKVA 1Z05A 2OA4A 4NHJA 2DPUA 2O03A 2QBYB 1J2XA 2P8TA 4G6DA 4HQEA 2MD5A 2UWMA 2FXAA 5D4SA 1B1BA 5L3GA 5D8LB 5D5VB 5LRRA 4AWXB 1YTYA 2Z33A 5LEJA 1FT9A 2HKXA 4KN7X 4B09A 5CVUA 1PP7U 4ETSA 3LAJA 4YIFA 3I54A 4BH9A 3WTUC 2Y0MA 4S04A 4UV9A 4BHBA 4L18B 3M1EA 4WXHA 3MFKA 2GQQA 1J5YA 2LDUA 3FWEA 1HW1A 2VBZA 2QENA 2MA3A 3C1DA 4PZJA 2XROA 2BGCA 2NNYA 4QWQA 3BROA 5HDKA 4HLYA 3ZP5A 1FBUA 2IP2A 2FOKA 1Z91A 1CF7B 3GLXA 3FZVA 2PEXA 5LBQA 2ZNYA 3KE2A 4R8HA 1XN7A 2NS0A 2CQKA 5DV5A 3WTTC 1G4DA 2FU4A 4PGGA 2Q2EA 4LLGF 3LWFA 2QUFA 1YFHA 2RN7A 3MZYA 1ZLKA 1ULYA 4Q47A 3FXQA 2EV0A 5DCMB 4Y13A 4L0ZB 4WK8F 2Z5UA 4D0PA 4CYDA 1KU7A 1W7PB 2P4WA 3LA3A 4IHSA 4LJZF 3HUGA 4I0AA 1ZGAA 4HBLA 1ZARA 5HS9A 1P2FA 1IXRC 3DFGA 2P6SA 2W25A 4UNOA 2ZO4A 4EVIA 4U7BA 4P5OA 1MZBA 1T38A 3QP5A 3E6CC 1G3YA 1IF1A 3C7JA 2FNPA 4RGRA 3RKWA 2VN2A 3U2RA 4G7ZF 2NYXA 2Z3YA 1PP8F 1K78A 1EH6A 2VBYA 1LEAA 2K27A 1T0FA 4G6QA 5HDNA 2DT5A 1YS7A 5JFRA 5FD5A 2F2EA 1DPUA 4HF1A 4XSXF 4M9SA 2GAUA 4EM1A 2ESHA 4A5NA 3H92A 2ZMEA 4Q5SF 3EETA 1ON1A 2GZWA 3F8CA 2XAHA 3GFMA 1R00A 1FSEA 4LK0F 3VOEA 1EH8A 2OAZA 3GFIA 4LGWA 3WODF 2UZKA 1KQ0A 3E5UA 4FX0A 5LHGA 2W85A 4HX8A 4HDUA 4RB3C 4KA4A 2STTA 2GA2A 4RB2C 2EV5A 4KMFA 1W5SA 3NQOA 5LRSA 1FLIA 4A0XA 4L5JA 2D45A 4YG2F 1EH7A 5E17F 3K0LA 3CTAA 3FX3A 1GXPA 1WRJA 5EEGA 4MTDA 3FM3A 4UVAA 4U7DA 1ZG1A 2H94A 1AOYA 4UVBA 4FHTA 1FYKA 2W84A 5J8CA 1LEBA 3E6MA 4I09A 1KU3A 1HW5A 1RUNA 4BNCA 3L2CA 3GZ6A 4PGHA 4WWCA 3BJOA 2O61A 3E6BA 3D5LA 1RNLA 2PMHA 2E1CA 2QBYA 3ABTA 4RGUA 1L0OC 3JW4A 1A04A 1O3RA 2KJCA 2MH9A 4KIFA 3PQKA 4WX9A 5CVRA 1Y0UA 2GA1A 5L3DA 4IRGA 4EMSA 4KUMA 4HDVA 1D8KA 4HZFA 2F5FA 1S7AA 2LNBA 2Y48A 3DXJF 3CO7C 3GVAA 3HYIA 1VTNC 5FGMA 5FLXZ 2O0YA 3P9KA 1F1ZA 3K1PA 3NRVA 3DV8A 1E17A 5TJJA 1XSVA 2EFNA 5ERIA 4XBFA 1XGMA 5AIPA 2JPCA 4L9JA 4TV7A 3RTRA 3I4PA 2DO7A 2LSOA 4A6DA 3P7NA 2HWVA 5HS7A 3PQJA 4ZYDA 4UVCA 3LFKA 2VC1A 5LGNA 2UXXA 3MZHA 4KN4X 3I64A 4BHCA 2XAJA 1YW9A 3IHUA 2L4AA 1S3JA 3CUQB 1U78A 2MC3A 1IXCA 4PCQA 2HOEA 4KNYA 4RAZA 2A68F 2BEOA 3DPTA 1B6AA 5JI6A 4BAYA 3DF8A 3ZMSA 1JE8A 2ZBKA 4HX4A 3TO7A 2A6HF 2VE9A 2D1HA 4P9FA 5DCMA 5HDGA 3V7SA 4BXUA 4P55A 1ZHFA 4CXFA 1W7PA 5AIQA 3BZ6A 4ENMA 2VT2A 3VB2A 3WTYC 3R61A 4L9NA 2DTRA 1FNNA 3KEOA 2KIUA 5EEHA 4MHGA 2IJLA 3T1BA 5DEQA 3C18A 4IVNA 5LEKA 2YU3A 1R1TA 3HRTA 3BPVA 3ZPLA 5DD4A 3E5QA 2J5PA 4WXCA 5BOXA 4HW0A 4RGSA 1OR7A 3HRUA
chains in the Genus database with same CATH superfamily
2B0LA 4HQMA 1ZGJA 2VONA 3BQYA 2ISYA 1LVAA 3KP7A 3RPUA 1Y1WJ 1FC3A 3CDHA 3DP7A 1SAUA 2JA2A 1SVLA 1S7OA 2WA0A 3CDLA 1PUEE 2M7AA 3ZRGA 1EJ9A 1D0YA 3LSTA 2BXYA 2WBMA 3GTMJ 2ID3A 4M6YA 4HPQA 2ZMEB 2K02A 3LA7A 4E4HA 2HTJA 1OPCA 1B72B 2BE5F 1IN6A 1IC8A 2CU7A 4NC7A 4EJOA 3DCFA 5FRNA 2CW8A 2HQRA 4IJAA 2WTEA 5LGTA 2WV0A 2COBA 4GYIA 3TOBA 1WZ2A 3ABUA 2JN6A 2D1VA 2XRNA 3WTZA 3MVPA 4C3HJ 1WH7A 3S16J 3PSIA 1O7FA 2VJ5A 1HDDC 2VASA 2X9DA 4I7HA 3K4JA 2DW4A 3A03A 3TQNA 1MMSA 3FXMA 1J09A 2C6YA 2QKMB 1DP7P 3MWMA 5GTIC 1S5LC 1MGTA 3SEZA 4W1UA 1FJLA 3DPLC 2A69F 1U2WA 3FM5A 3I53A 4A2UA 2XVCA 4IF4A 2HFHA 1TC3C 3L2QA 4A3MJ 1FBQA 1MSEC 1OKRA 1H89C 1MMAA 2LMDA 1LJ9A 1SMYF 1R4NB 3BR2A 2ZXJA 4YIIA 5BPDA 4LFUA 2XF5A 2X6XA 4BQAA 4Y52J 3MKWB 5L3BA 2R7VA 5FLXK 3NARA 3ABLH 5EZGA 3ZQQA 5FJ8J 2VUMJ 3MKYB 1XCVA 2JVGA 2VPLA 4KIGA 3TW7A 4M74A 3KZIC 5M3MJ 4IXAA 2K40A 2R7QA 3B6AA 3J7AO 3VWBA 1TZLA 1BA5A 1BN5A 2XHKA 4QTRA 3PIOF 4Q4ZF 3S1RJ 4UHTA 2DYSH 2K86A 3V8LA 1NK2P 2H1LA 5TGTA 4I2OA 2DU9A 3IL2A 3BTJA 1QHHD 4ESJA 1XSXA 3DTIA 4MEXF 4BHPA 5CPRB 3SXYA 2HDDA 1Q1VA 3PIPF 5ILSA 2VXDA 4XN3A 2FA5A 3HSRA 3J7ZI 1XPXA 2ISZA 4ZDPA 1ETWA 2L9NA 2BW3A 2V1UA 4KYWA 1BOBA 1HKSA 3L7WA 3Q9SA 2HYFA 1IN4A 1R6RA 2CSOA 2V1XA 4N9HA 5B3SH 1XSDA 1D8JA 1TLHB 4BE2A 2VB6A 1WJDA 2KRFA 3MD2A 3JSOA 4YRVA 1Y6IA 3HTUA 3IH2A 2P5LC 1TBXA 2A5WA 2H09A 3K1NA 3SJMA 4MGRA 2FJ1A 1J75A 2DODA 4GGGA 1G6NA 3RJPA 3TP0A 5HLTA 5L3EA 2A05A 1B4AA 2JZYA 2Z2SB 1ZR4A 1B9NA 3DKYA 3HRMA 3RSNA 4CYCA 2XGCA 3RKQA 3ECOA 2YU9J 3A02A 2VBWA 5DM6F 3FXUA 2VOPA 1BIAA 1UHMA 4PK4A 4ANJA 1REPC 3LSKA 2H6BA 1QQIA 5ED4A 4G7HF 4Y3OA 3N97A 2XV4S 2HYJA 2DTZA 2RQQA 3H5NA 2DQLA 2MH2A 4E7ZA 2PMUA 3E6DA 2ETHA 5AONA 5ICEA 2D5VA 3N05A 1STZA 4W97A 1SD5A 4E70A 5IY5H 2M4GA 3F21A 1YG2A 3VSKA 1GVDA 4CCOA 4RDUA 3IC7A 1ZK8A 4BL0B 1U3EM 3RI4A 1FMVA 3WU1B 5FLVA 2KISA 1T2KA 4EJUA 1BC8C 1R1VA 5JLXA 1P92A 3CF2A 2DOAA 3KP5A 4XSZF 2R5ZA 3S1QJ 3RIRA 5CQGA 1Z9CA 3SZTA 2NVXJ 3IH4A 4E7SA 3JRIA 4I6ZA 2VKDA 2BOLA 2ZSHB 4P9UA 4AIHA 1VQOI 4A3BJ 9ANTA 2TRTA 5ICFA 1T0FC 3GZ5A 4AM3A 2XAFA 1LB2A 3G1OA 2FMYA 1T33A 1YOVB 3PUBA 5DYMA 4ZTFA 1MBFA 1KYWA 1I1SA 3D5RC 3N4MA 1KU2A 2M34A 1IO2A 1G3SA 2DA6A 2CQXA 3LQQA 2KDZA 4IL6C 2IAIA 2KP6A 4G8XA 3DWLE 1EF4A 1ZR2A 3H5RA 2CWEA 2EZLA 4O5VA 3G3ZA 1XS9A 2P0WA 4IRIA 1RC9A 3ZMVA 3OYGA 3S3MA 5KVRA 1RI7A 1X3WB 2DFIA 1X19A 2EZKA 2VXZA 2R0QC 2K3PA 2TDXA 2W24A 4Y15A 4IO9F 4BS9A 1LDJA 2PBIA 2QKLB 3SDGA 2YX7A 3EUKL 3OYNA 3CUQA 4ENJA 1I6XA 4CCKA 2DPDA 5F1JA 2VLAA 3S17J 1YO5C 1LNWA 4L0YB 1Y8RB 1XGNA 3HDDA 3RPQA 2FBKA 4DGWB 1IW7F 5E3MA 2CUJA 3HHHA 3QWLA 4U0WA 5E3NA 3MCZA 3W3CA 5LLQA 4HNUA 2H6CA 4M73A 2K7LA 1YIJI 2QZ8A 3Q0WA 5JVTA 3VDXA 2NAZA 1PUFA 4DOZA 4FTHA 4DQ2A 2R7TA 4MFDA 2W00A 4F52A 3CC4I 2WADA 3DLLF 3C2BA 2RAEA 2W82A 1Z67A 2R7WA 1FX7A 3F72A 3TO6A 5F08A 4XKWA 5ILVA 3ERED 2M30A 4NQWB 2FNAA 4ON0A 4D5FA 2PLYA 3J80Z 5KK1A 2QLZA 5B66C 1FYLA 1ZLJA 5D5XB 4HSRA 1J7KA 2BVMA 5D4RA 3CJNA 3VODA 2V6CA 4LD5A 2Q8KA 3F8BA 2I8DA 4BEHB 2E60A 3HIFA 4D5CA 1W5TA 2RKHA 2CQNA 2HQ5A 4UUVA 1Z0XA 3FF5A 3QOEA 3M7GA 4IZZA 5FO5A 3PFIA 2IBDA 3RPUD 4AYBN 4WCGA 3DTEA 4EM2A 2L7FP 3GFJA 3IAM2 3S8PA 2KRHA 4A12A 2K9LA 1GV5A 1KONA 2GWRA 2XGDA 5FFXA 2G9WA 4ESBA 2EBIA 4XNFA 1W0UA 1H88C 3CLOA 3I59B 1VQKI 3D0SA 5E1XA 3ZGKA 2VOOA 3GYHX 3K9TA 1P9QC 4N0BA 1Z6RA 4A3IJ 4KISA 3W6VA 2R92J 3BTCA 4BJTA 1QNTA 2DAOA 5K1YA 2WY7Q 2O5RA 2Z99A 4XICA 4BDZA 1H0MA 1TWFJ 4XRMA 1BL0A 4JP0A 3AAFA 2E71A 4B3AA 3ZQ7A 5E3LA 1J9IA 1S7EA 4ZYAA 2EFWA 3HBLA 2LF7A 1QZYA 4FCYA 2HI3A 3GLLA 4O6JA 3O8HA 2I5UA 3O3KA 2E1NA 1B72A 4IHVA 4PJNA 3FMSA 1G3TA 4F7ZA 2VODA 2OBPA 4B1RA 3SYTA 3DEEA 5TRDA 1VQ6I 5B5EC 2JSCA 5FB2A 2VPRA 2W57A 3JTHA 2JVHA 2DOEA 1Z1DA 2VC0A 1EV7A 5GAHJ 3GCMA 3TOAA 5KAFC 3JSPA 3I0TA 3LA2A 4DBQA 2QQ9A 3SFZA 3IRRA 1BOAA 3ZQGA 2M9HA 2XUBA 3H5AA 3JRAA 4HV5A 1MJAA 3WHCA 1HC8A 1I6HJ 3FKIJ 1XCBA 5E18F 4M3FA 4JK1X 4OMZA 2YSRA 2JA5J 2GIZA 1ZRFA 3FKJA 1N25A 4BY1J 1MD0A 1BR2A 4IQ4A 4A3JJ 3CCUI 3CLQA 4J00A 1HKQA 4R1HA 5J8FA 4RAFA 4LIVA 3OIPA 2BZTA 1F43A 1YITI 1QGPA 3Q0VA 3H3VK 1JTYA 3L09A 3QQAA 1JGSA 5ILUA 1USTA 4IHWA 2NVUB 3TDZC 4KFCA 3QYBA 1XB4A 1GUUA 1OISA 5CQEA 5J1YA 1XMAA 4GCVA 5M5WJ 3SQNA 1EA3A 2FBIA 2PFBA 2EIKH 4DYCA 3FK6A 3MQ0A 2X51A 1LE8B 4CCNA 4XQFA 1T95A 3U9GA 3CP8A 1JUPA 1JKRC 4DYQA 3OV8A 4OIOF 2ELHA 4CYCB 1NTCA 4F55A 2BY1A 3CF5F 4LB5A 1ZRDA 1UFMA 4ZZDA 3K4BA 5HS8A 5EG0A 1SFXA 1X1CA 2BVLA 2DJIA 3WE2A 2FBHA 3K10A 5D5WB 2XAUA 3BZKA 4XLFA 1MJBA 4U0VA 3BQZA 4M72A 2VQGA 1P4WA 5H6QA 5IYCJ 3Q9VA 1RKWA 3W6KB 4Q48A 3BG9A 4M6XA 2IXSA 1BI3A 3I71A 3S2DJ 2R7SA 4L9TA 1HQCA 1OQYA 3WU2C 4RAGA 3K4NA 4XRFA 3IV5A 1ENHA 5FKMA 2OQGA 1MDMB 1P6RA 4UUSB 2R5ZB 1BW5A 1B9MA 3OSFA 3WTXC 3QP6A 1ZYRF 4P96A 4HF2A 3ONQA 4BXFA 2OZ6A 2IPQX 3J80K 1Z3XA 2O3FA 2JA8J 3LSMA 2CFXA 2IA2A 3QPTA 2F5DA 2CRGA 4YELA 2M7BA 1K6YA 1YW7A 3A1YA 3RYPA 3R0AA 1DGRM 5C4JJ 1ZGWA 2L02A 1UG2A 4HYEA 1H9GA 3S2WA 3HJEA 1SEUA 2BHZA 1OYIA 5H20A 4LLNA 1W1WE 2A61A 1B8IA 5IT9Z 3VSLA 1U8RA 4U0YA 2LLKA 3OR2C 3OOPA 1T39A 1IJWC 1R23A 1ZTRA 1WFXA 2CO5A 2TCTA 3QPSA 1BJAA 1FSHA 1YX3A 4IPAA 3BR0A 2A3SA 5JR3A 5FKNA 3NWTA 1T8IA 1IDZA 5IYDJ 2E2HJ 2R93J 1SD7A 2L01A 2R7XA 3ZMUA 2QWWA 3PO2J 3U1KA 5ICCA 2VKEA 5E1WA 3LQRA 1QBJA 4CZCA 2F4OB 3G73A 3KP2A 4D7MA 2R7ZJ 2FD5A 4LITA 1VQMI 1CQTA 3AG3H 3MKZA 4PSXA 4LMYA 3EUHC 2STWA 3IH3A 4BYYA 5FRMA 5FROA 3KLOA 4RB0A 3AL0C 5E8GA 1OJLA 2R7FA 2EZIA 4NUBA 5CKTA 3BDDA 1K61A 4XLAA 3PL8A 3O8GA 5CVJA 2XRLA 1UAAA 3B73A 4C3JJ 3S14J 3M8JA 5KCMA 3KZZA 1D1CA 3JR9A 2XB5A 3M9AA 4HSTA 1T6SA 3K69A 3V4GA 4XORA 4ASNA 1WPKA 4CA0A 5IP6A 4AIJA 1HF0A 4NBQA 1RR7A 3JRHA 1WSUA 3FXJA 4OIPF 5GPCA 2X85A 5IP7J 2HTSA 2NOJB 3WHBA 3KETA 3IWFA 4C2UA 2K3FA 3F23A 2Y75A 2BYVE 2ME0A 2OF7A 2RREA 2WAFA 3FHZA 4UY8I 3I5UA 3ZMDA 4FASD 3E3VA 2P7VB 3FXOA 1RKTA 2DFHA 5A2QZ 1O3TA 5BNGA 2XKOA 3M8FA 3MZ8A 1ACIA 2KIFA 4S05A 4OOIA 3M8EA 4U88A 2QQBA 3LSPA 2CJJA 3HL2A 4K2EA 5FKKA 4C30A 4FE4A 3T8TA 3A0HC 2MW8A 4BY7J 2MSYA 3FXKA 1UJ8A 1U5TC 1ON2A 4RAYA 2ME6A 5IOZA 1J0RA 1Y1VJ 1YW8A 1LKXA 2FMLA 2IS4A 2WAQA 3BPXA 1NHAA 3MKLA 3V8KA 2P6TA 4RM2A 1RETA 3CCVI 4A69C 1LQ1A 4RLFA 3R4KA 2EQRA 3S93A 1SMTA 5DUKA 4B8XA 4NQWA 5EJCA 4A0ZA 3CO6C 2JUCA 2M4KA 3SDBA 4FETA 1YYVA 3W2AA 4A6EA 5M3FJ 4UV8A 4UB6C 4BJ6C 2M1BA 4PJMA 3SHFA 3EUAA 1RUOA 4BEHA 1V55H 2JRMA 4XR6A 3A01B 3HB9A 2AXLA 1TTYA 1HXDA 1R22A 2Y9ZA 1S6LA 2L7MP 2DOFA 4LK1F 4PFOA 1ZH5A 2ZSIB 4CCLA 2K4BA 1ZN2A 2P5VA 3CC2I 1ZKGA 2UXNA 2E1MC 3ISPA 3VFZA 4YEJA 2BBYA 4CDGA 3HC7A 3OIQA 4S0HB 1FTZA 3BR5A 4EEFG 3I59A 2BHYA 2HGCA 5HLIA 2DA2A 5D6FA 1MNDA 1XX5A 1FOWA 1IN8A 3QU3A 3QRFF 1T98A 2Z9OA 3QPHA 2XGEA 1MW7A 4L5EA 2QM3A 2RGVA 3TO9A 1DDNA 2V9KA 1BI2A 1MH4A 2X1CA 1ITYA 3DLAA 4D7NA 5CYVA 1X4OA 4G7OF 1FZPB 2ZJQF 4RM3A 3HG9A 1JJ6C 3V8JA 3WG7H 1KQ8A 5E3OA 3JRGA 1X2NA 4CUGA 4A93J 2VE8A 4I02A 5E1ZB 2HVQA 4XLPF 1F4KA 2LC2A 2MBFA 1Q1HA 2Y31A 3BR6A 3BLYA 1C0WA 1FBSA 3ZQLA 1AA7A 4LB6B 3OL3A 5IYBJ 1R36A 1D5VA 2R5YB 3COAC 1XC5A 2IT0A 3E7LA 4E6KG 3J7YJ 1I1GA 1UCRA 1WI3A 2CH0A 3DBRB 2EA2A 2DK5A 1P7IA 1YJNI 2QSFX 1D3YA 1F5TA 3ROUA 4GDFA 2LKPA 1ZAOA 2DCEA 4ZH4F 4FT8A 1X3UA 1UHSA 2P5KA 3GWZA 2IA0A 1U6GA 4A0YA 5IT9K 3CZ6A 1DU0A 2COMA 4RGXA 4CHUA 2DQRA 5EF6A 2PJPA 3AG4H 5L3FA 3REOA 3V42A 2M8EA 3GEZA 2E7XA 3HOUJ 1ZQ3P 3F6OA 4FX4A 1RPWA 3L2UA 2BY0A 1YQAA 5GP9A 2HQAA 2ACJA 5EG0B 2LH9A 2M5WA 3WGIA 3TDUC 2AHQA 1W4MA 4BBSJ 1XGOA 3H9JA 3DPUA 4J01A 3H9GA 2F5CA 2OUMA 4ZYGA 1D0ZA 1VQLI 3BP8A 1TW2A 3K2AA 3UKGA 2VIXA 1H9TA 1KGSA 2V7FA 3FXRA 4NNJA 1JHHA 2XDVA 3F6VA 3K2ZA 1SFOJ 4QPQA 1LPQA 4KIBA 1FP2A 1HSJA 3CUQC 1JKQC 3ML6A 3H1CA 1LE8A 1TW3A 5E8IA 5DCFA 2DXIA 3OSGA 3M4OJ 2F4IA 4EGYA 3F22A 5JHUA 1Y39A 1G2HA 4BXXJ 3FISA 2RQPA 1TT0A 1TQPA 2L7ZA 3SZPA 2KL4A 2DT6A 4X6AJ 3V7RA 1QVTA 4AVPA 5KHDA 1K4SA 1WJFA 2DMNA 1LDKB 4M9XA 1K79A 4EGZA 3FIWA 1YIOA 3J7AY 3LL7A 3ECHA 2XSDC 4MLOA 1D1BA 4E7HA 2CGPA 2HKOA 5A2QK 1JGGA 3E97A 1V5EA 4B47A 3F8FA 1HKTA 3RYRA 1TL8A 2EFQA 2ID6A 3IWZA 4ENNA 2GIVA 4XRSA 1I5ZA 3WGGA 2RV8A 3KP6A 2MGQA 3B6CA 3L2WA 1VNDA 2R7RA 1O3QA 1YLFA 1SVMA 2E35A 3E5XA 2GBYA 2HOSA 2LYCA 3U21A 3H3UA 2KIQA 2KZGA 2ECCA 2L3DA 4HLXA 3X2QH 3ZMTA 1B8IB 3MAJA 1FPQA 1E2XA 1QHGA 1MDMA 5HLGA 1O7LA 3M07A 4UUSA 3FHNA 5F27A 2PN6A 3KZYA 2K5CA 4N9IA 4HF0A 1IRZA 1GVJA 4A3FJ 1O3SA 1SANA 4PUSA 5DUIA 2E19A 2EK5A 2IEKA 2A07F 1I3QJ 3EQLF 2V6EA 5J47A 1ETXA 4ZDLA 4YIRX 2MLKA 5D6EA 3DBHB 2LY2A 3HGYA 2KPMA 5IT3A 2DI3A 3GMEA 2KKOA 4CGZA 1IUYA 3BWGA 1Z6TA 1QZZA 2EFPA 2GLOA 1K6OA 2XB0X 1V54H 1USSA 3DBLB 5GAGJ 1JUSA 2HZDA 4BDYA 3QAHA 3CJQB 1WWXA 2RDPA 1BI0A 5BPIA 4EJTA 5LHHA 4DYRA 2EZHA 1XMKA 2G7HA 3LMMA 1P4XA 3BG6A 4XLNF 1OCRH 4II3A 3SZGA 4MO7A 2ZMEC 5DS9A 2OZUA 2IS1A 2ZXIA 5E20A 1X4PA 3PSFA 4CZZA 1DU6A 2V9VA 2QYOA 2WWYA 2V26A 2IRFG 1WVRA 1R49A 2VJIA 3BG7A 4CICA 1BI1A 2DYRH 2O8XA 2XIGA 2L2OA 4DNCA 1RIOH 4C2MJ 1E3PA 3TGNA 2VI6A 5J40A 4YFKF 2K4JA 3ZQIA 1MBEA 2YUSA 2KHMA 4PDKA 1W7PD 2DA1A 1J59A 4OIQF 2H8RA 3GTJJ 1P7JA 4EATA 4WXDA 1MNMC 2CW7A 5BS6A 3T8RA 4HA8A 5FLMJ 1R71A 5D8KB 2DBBA 1OCOH 5D5UB 1MJ9A 5LD2C 2KT0A 3WG9A 2QVOA 2M45A 1UB9A 4BQNA 2WC2A 3H3ZA 3OS1A 4OMYA 2E7WA 4ZYEA 2YR2A 3MMYB 5HOOA 3BC8A 2GXBA 1D1AA 4ZZLA 1TQIA 4A3GJ 5CVVA 5K5RA 2Y69H 3JCUC 4ZDOA 2FX0A 2GOMA 4BGDA 2XF6A 1VI0A 4G9YA 2R7DA 1IZ1A 3LSGA 3RQIA 1AKHA 4OINF 1V5GA 2EJRA 3M3YJ 5CVIA 2IGNA 3ZN0A 2JMWA 3OYMA 2WB1N 1N78A 4EM0B 1XGSA 4JQFA 4PJLA 4YFNF 2Q0OA 1UHWA 5H6RA 2G0EA 4Z2YA 3I9V2 2MABA 2M3AA 4ZYHA 3CMEI 3I56I 2V1DA 1YI2I 2R7UA 2LKSA 3ZXSA 5K5OA 1ODDA 1BM9A 1WKMA 1SAXA 3T0YA 1FOKA 5DDGA 2R3SA 1FOXA 2JT1A 4J19A 3JAMZ 3A01A 2HEOA 3OYDA 2NS7A 3FXLA 3HZJA 5C3EJ 2DMPA 3DEUA 3CCLI 3S1NJ 4UB8C 4QIWN 2CUZA 4EV0A 2IW5A 3CCYA 3L2VA 3ASNH 3J81Z 2FQ4A 1KU9A 1R4MB 2DDBA 2MLGA 2PG4A 2X4HA 1QO0D 1KQ9A 4LG0B 4RBOA 3U1DA 1CGPA 4F3QA 3KFWX 3AKZA 3FBIB 2H27A 3AG1H 3OS0A 3GXOA 4MEYF 2LFBA 1BR4A 1B59A 3G4SI 3L2RA 3O2PE 3FMQA 1WJAA 2RC4A 2OCCH 2NRAC 1U8BA 3VYRB 4KJZA 1SD4A 1ETQA 4L5IA 2LY1A 3VPRA 2XASA 4D9JA 1VQ9I 1XTAA 1BIBA 3LFUA 2O6GE 2VKVA 4BU2A 2B63J 4XM3A 1NG7A 1R58A 2D2WA 3GZNB 1FP1D 4RS8A 2L7KA 1G3WA 3L1PA 4AYBA 1VFCA 2EIJH 4FQGA 3CCRI 1V3FA 4AD9A 5F0HA 2XF7A 2F5EA 3DKWA 3WTSC 2R7OA 4C9YA 5ICGA 2R5YA 3RKYA 1WQ2A 1KYZA 2Y30A 3G1LA 3HHGA 3HOSA 2B9SA 1U5TB 5F64A 4X0GA 1SD6A 3HKZN 2J5OA 3OWTA 3GO5A 2LBFB 2IA1A 1DPRA 3CESA 1S8NA 4QSHA 1GDTA 5F0FA 2LD5A 2ICWG 2K9MA 5DD8A 2OTLI 4ENKA 1VQPI 4GYGA 2OD5A 1U9NA 1V4RA 2OQRA 3FMRA 2V9PA 1NK3P 5BQTA 1IG7A 4IQJA 1WI9A 3OOUA 1HSTA 2KMUA 3TKYA 4YFXF 4EJVA 4CSWA 1JJ8C 3WTWC 3OYJA 3V7CA 5EEAA 2KFDA 4XLHA 2LVSA 3ERMA 3GTQJ 3GBGA 1E3OC 1F9NA 3F8NA 3IP4B 1TNSA 3HM5A 3R60A 3CCEI 4IOAF 3H0DA 3H9QA 2PQ8A 2QQAA 5HNHA 1R5HA 1FYMA 2X6WA 2PMZA 2VQCA 2IS2A 2L54A 3SFIA 4I0BA 2HYGD 1I27A 4MNUA 3OS2A 1ETKA 2ZFWA 1OCCH 2G7UA 2EWNA 3KP4A 3QU6A 1K7AA 4XKBA 3CMAI 1FMWA 2QA4I 3C2HA 2HS5A 1APLC 2UUZA 2ZB9A 4BBRJ 1SFEA 1XD7A 2XAGA 2ZKZA 4L9VA 3RKXA 1VQ8I 1IAWA 4Y17A 3KX2A 2F48A 2IVMA 2MC4A 2ZJ2A 1TWAJ 3BR3A 4GFBA 4KITB 4QLCU 4A3EJ 2X48A 4OIRF 1L3LA 2EILH 1O57A 1IDYA 3P9IA 3Q0UA 2GXAA 1XDUA 1VQ7I 4XOPA 1MIJA 3KIOA 5FD6A 2Y0SN 3NAUA 1D5YA 5F1RA 3BTIA 3OMYA 4NB5A 5KNLA 5HVQC 2XAQA 3KCCA 1IUFA 2JK3A 3BOQA 3ZQFA 4C2TA 1PVEA 1OFCX 5E79C 3DU6A 2XKPA 1MBGA 5TISC 2CG4A 4DZJA 2XPUA 1S9HA 1A6QA 4HAMA 6PAXA 3A2KA 3BJAA 1WJ5A 1OR7C 3OYAA 2YX4A 1YHQI 2L9RA 3HEFA 3BJ6A 4JX5A 1TQMA 2KJBA 3CDIA 4HG2A 2ESNA 2LRDA 4R79A 4IRHA 2HDWA 3CJRB 2ELJA 5LFAA 5GADJ 3TL4X 3MN2A 2XSJC 2E2JJ 1DP3A 4AU7A 2HPMA 3WU0A 5CLSA 2P81A 2HNHA 3GTOJ 4A3DJ 1QU3A 2DA5A 2EB7A 3F9KA 3JTGA 3D1NI 2O8KA 2JRTA 2QCOA 2NVQJ 5LGUA 3JAMK 3BY6A 4HEA2 4F91B 3G71I 1H8AC 1NH3A 1KA8A 3L00A 4V2FA 1YJ9I 2Q2EB 4OAZA 5IOYA 4XN0A 2RVCA 1ZRCA 1X58A 3J81K 1OYYA 1W36D 5J6XA 5K5QA 5CJ9A 3I58A 1IRFA 2DMUA 4I76A 1MH3A 1S72I 3B02A 2HDCA 3LNQA 2DMTA 2WV1A 5FFZA 4CO8A 4IX7A 4UXNA 5EGOA 3S32A 1XMXA 4PJ0C 1CF7A 3ULQB 2FSWA 1ETVA 1R7JA 4ESFA 4FISA 2KIMA 4KT5C 3IRQA 3GFLA 2JTVA 3CJTB 4N4OB 1MBKA 2DFEA 1WCMJ 2V79A 1ZG5A 3AFHA 4M9ZA 4NDLA 3T5XA 1IN7A 1BBYA 2DLLA 2JPBA 2MFZA 2X6OA 5DTDA 1TP4A 4G94A 1OYWA 2RNJA 2FEZA 5FKLA 3MEXA 1IV6A 2EV6A 4V2GA 2B7EA 3RQ4A 3TBIA 3DEWA 3GUDA 4RA2A 2OC6A 3WE3A 3KEQA 3H35A 2BY2A 4DIQA 1AKHB 3DKXA 4KDPA 3K1MA 2A6EF 3PNYA 1T08B 3K70D 3CD6I 4I98B 2LTPA 3BT9A 3C3WA 2ZCWA 3WTVC 5GAEJ 3KP3A 3ELKA 3KEYA 3HOTA 2PI0A 3HPHA 1OMIA 3JRBA 4JOMA 1JXSA 2ADUA 2CV2A 4HOBA 3R0JA 3RZDJ 4GO1A 3S3OA 1JT6A 1S29A 1UELB 2ELKA 3LSJA 2HXIA 1K78B 2EA4A 3EYIA 2M0CA 5GTHC 2BV6A 4GRIA 4MQ9F 5JVGF 1SFUA 1LUJB 4LLLA 1R1UA 2A5YB 3F8MA 3JRCA 1BC7C 3EDPA 1DUXC 3S1MJ 2OJED 2VT3A 3ABMH 3UNGC 5H2FC 1V5FA 2A6TA 2WY8Q 2L5QA 2EFOA 3HSEA 2QF7A 4BQOA 1OCTC 1GHCA 1QPMA 1M1EB 1LFBA 4WF2A 3ZCOA 3O6BB 4CH7A 3HTSB 4I01A 3R6SA 2HZTA 2VBXA 2FF4A 4BE0A 3HSFA 1ZREA 4KICA 3RDIA 2GXGA 2OV7A 4EQQA 2ZJRF 3TW6A 5BMZA 4XRSG 2E34A 4MQVA 2FRHA 4CCJA 1YS6A 1JHFA 2LP0A 3UR3C 4RB1A 1YRNB 3GF2A 4BKXA 5C4XJ 3TP3A 1OLTA 1RZ4A 3QYEA 5J4YA 3L9FA 5M5YJ 3CUOA 4JBAA 1P4AA 1X2MA 2KZVA 2AQFA 3WGHA 1GXQA 2MYSA 3HPGA 2AS5F 3QOPA 3EUHA 2FQ3A 1NG6A 4MTEA 5LHIA 3KYCB 4A3LJ 1TNTA 2OU2A 4LG0A 2NNNA 4EJWA 2UV1A 2ECBA 2HOTA 2FE3A 2X0LA 3HRSA 5F04A 1IN5A 4A5MA 4HV6A 4JX4A 3I55I 2XGXA 1GT0C 3OR1C 1TWGJ 2X6YA 4Y7NJ 2XC7A 2XPVA 2EH3A 1MMGA 3W6JB 5IPAA 5L3CA 4IHTA 1LDDA 3GW2A 1HLVA 2OPTA 2M8GX 4AIKA 2LREA 4E7JA 4XL9A 1UZCA 2HQNA 3ZMZA 4B3XA 4M71A 2IGKA 1IXSB 1Z3YA 2FOWA 3DQVC 1DGWY 2Y2ZA 1IRGA 3VEPA 1FWZA 2PX9A 4G6TB 3KLNA 3K4KA 1HCRA 1GLNA 1WJEA 3IUOA 2DK8A 4XK4A 3I4NJ 1YX5A 1X1DA 1FY7A 1JI8A 4PSWA 2NXNB 3EYYA 2DA4A 2JQ7A 2LKXA 1Z7UA 2M87A 1QVUA 4ITVA 3F3XA 4I99C 1ZG3A 4HX7A 1U5TA 3Q5FA 1WJCA 3FDYA 4E7KA 4RMNA 4OU0A 1AWCA 5F6FA 2LBFA 2CW0F 3RCOA 2YPRA 2ZXWH 2NS8A 3GX4X 1ETYA 2X1EA 5J4VA 2XPWA 4MIMA 1HW2A 1QA6A 2P7CB 3E0JB 2DN0A 1WHUA 4IEJA 2M2EA 1ONVA 1U9OA 2CYYA 2YS9A 3P9CA 2ZNZA 1MKMA 1XDSA 4H0EA 4GXOA 1PDNC 4M3GA 1W36C 2LF8A 2IS6A 5C44J 1XG1A 2JWTA 4ZC3A 5HLHA 2HR3A 1HBXG 3IKTA 2L4MA 3ZN1A 3JRDA 2FUG2 3NEUA 3S3NA 3LAPA 4KMUX 1R5GA 4O3MA 4X1EA 3IKVA 1Z05A 2OA4A 3BG3A 4NHJA 2DPUA 3OYKA 4XIDA 2O03A 2QEXI 2QBYB 4BJ5C 5EYRA 1J2XA 3W2WA 2P8TA 2Z1DA 4G6DA 4HQEA 2MD5A 2UWMA 2FXAA 4V19K 5D4SA 1B1BA 2OCEA 5L3GA 5D8LB 5D5VB 3S15J 5KAIC 5LRRA 1E0EA 4AWXB 1YTYA 2Z33A 2ZXHA 1DQUA 5FKOA 5LEJA 1FT9A 2HKXA 4KT6A 4DW6A 4KN7X 4B09A 5CVUA 3GTKJ 2LOOA 1VQNI 1PP7U 4ETSA 3OIOA 1ORKA 1R5ID 1YJWI 3LAJA 4YIFA 3I54A 4BH9A 3WTUC 3K70C 3K7AJ 2Y0MA 2IGMA 2H1KA 4S04A 4E7IA 4UV9A 4BHBA 3LSHA 4BE1A 4AC0A 3M1EA 4L18B 4WXHA 1MMDA 3MFKA 4RLQA 5JLWA 2GQQA 3DU5A 1J5YA 1A5JA 1FEXA 1W5CC 2LDUA 3FWEA 3BZCA 3HOYJ 1HW1A 2VBZA 5M5XJ 2JA7J 2QENA 2DJNA 2MA3A 3C1DA 2E36A 1FIAA 4G12A 4PZJA 2XROA 2BGCA 2NNYA 4QWQA 3BG5A 3TMOA 1I39A 3BROA 5HDKA 4HLYA 2E1OA 1LFPA 3ZP5A 3GTGJ 1KZHA 2ZFUA 4AUXA 1LFUP 5J1UA 1Z77A 1FBUA 2IP2A 3HOWJ 5EZHA 2AXTC 1X1BA 3A0BC 3FK7A 5EGOB 2FOKA 5EDNA 1Z91A 2EINH 1CF7B 1Y0NA 3GLXA 3FZVA 1MNEA 2KRCA 3OYLA 2QQ8A 3BCBA 2PEXA 1BJZA 4N4NB 2ZJPF 5LBQA 2E5NA 2ZNYA 3P5JA 3KE2A 1WH5A 1A31A 4R8HA 1XN7A 1N75A 2NS0A 3HOXJ 2CQKA 4XLEA 5DV5A 3WTTC 1G4DA 2FU4A 3KPHA 4MFEA 4PGGA 4BQQA 2Q2EA 2LK2A 4LLGF 3AG2H 3W2VA 3LWFA 2QUFA 4AVZA 3HOZJ 4LIUA 1ETOA 4DBRA 2KLOA 1YFHA 2RN7A 3RZOJ 5F0CA 5IP9J 3MZYA 2LY9A 1JUMA 1ZLKA 4IKFA 1ULYA 4Q47A 3FXQA 2HVSA 2EV0A 5DCMB 1N77A 3OYEA 3CCJI 4Y13A 2HPIA 2O7OA 1BW6A 4L0ZB 4WK8F 2Z5UA 2HU9A 3KYLA 1MBJA 4D0PA 4CYDA 2VQLA 4ABZA 1KU7A 1W7PB 2NVYJ 2PJRB 3G1MA 2P4WA 3LA3A 2CUEA 4IHSA 4LJZF 3HUGA 4I0AA 3PNVA 1ZGAA 2CUFA 4HBLA 1ZARA 5HS9A 1P2FA 1IXRC 3G2BA 1TWHJ 2K85A 3DFGA 2L0KA 2P6SA 4PJJA 2W25A 4UNOA 2ZO4A 2VKHA 1WJBA 4EVIA 1D0XA 4U7BA 4P5OA 2W7NA 4II2A 1MZBA 4XOTA 1T38A 2I10A 3LSIA 1OCPA 3QP5A 2Y9YA 4IHXA 1K83J 2CMPA 3E6CC 1G3YA 3PJRA 1IF1A 3C7JA 2FNPA 4RGRA 3RKWA 5B1AH 2VN2A 2LG4A 4QPOA 3U2RA 4G7ZF 2NYXA 1YE9A 4B44A 5GPAA 2Z3YA 3K4CA 2IGOA 1PP8F 5K7HA 3OYHA 3CP2A 4BUPA 1UMQA 1K78A 1F36A 1EH6A 4XLCA 2VBYA 1LEAA 4M3DA 3PUFA 1SFKA 2K27A 1T0FA 4G6QA 2E5ZA 5HDNA 5HNFA 2DT5A 1YS7A 3OYIA 2GOXB 2OTJI 1FIPA 2KDOA 2M0MA 1PYVA 4M3EA 1JT0A 5JFRA 5FD5A 1EKEA 3AL0B 2F2EA 1ERDA 1DPUA 4HF1A 3G6EI 4XSXF 3OL4A 4M9SA 4U87A 3OYBA 2CS3A 2GAUA 4EM1A 1RESA 1Y8QB 2NVTJ 5K7FA 1X3ZB 1A36A 2ESHA 4A5NA 1YRNA 3VYUB 2ZC2A 2X1DA 1AU7A 2DFFA 1Z7LA 1A35A 3OYCA 3QYFA 3M1CA 3H92A 2CV0A 2ZMEA 4Q5SF 4LG3A 3EETA 1ON1A 2K9SA 2GZWA 5JHFA 1POGA 4B4CA 3F8CA 2XAHA 3CC7I 3GFMA 1R00A 3FBNB 4OAYA 2VL8A 1G8XA 2H8WA 3CCQI 1FSEA 1JKPC 1JTXA 2V1NA 4LK0F 3K4MA 1K4TA 1T56A 3NWSA 3VOEA 1EH8A 2WB1A 3BR1A 2OAZA 3GFIA 3TEDA 4LGWA 3WODF 5HODA 4AIDA 2PMZN 3ZOBA 1LVKA 3PFYA 2UZKA 2E2IJ 1KQ0A 2QGUA 3E5UA 2F5VA 3K6GA 4FX0A 5LHGA 5J1RA 3GTPJ 3LOCA 2BXZA 1JKOC 2VQHA 2W85A 2W48A 4HX8A 4JX6A 4HDUA 1I50J 3H0GJ 2AO9A 4RB3C 4KA4A 2STTA 1OCZH 2GA2A 2F6CA 4RB2C 2EV5A 2CFOA 2K9QA 4KMFA 1SVOA 1W5SA 3NQOA 5LRSA 4IOCF 1FLIA 4OWRB 4A0XA 2L9VA 3PNTA 5J3LA 4L5JA 2D45A 4YG2F 1EH7A 2JJ7A 5E17F 1Y56A 3K0LA 3CTAA 3FX3A 1GXPA 1WRJA 1X1AA 2BW3B 3HXLA 5EEGA 4MTDA 3FM3A 1MBHA 4UVAA 4U7DA 3ZQHA 4ZTJA 1MMNA 1ZG1A 2H94A 4HNTA 1AOYA 4UVBA 3GTLJ 1R9TJ 4FHTA 1FYKA 2HXOA 2W84A 5J8CA 1FOYA 2E1MB 1HA8A 1LEBA 3DTKA 3E6MA 3KYDB 1O4XA 1IRXA 4I09A 1AHDP 4JYKA 1KU3A 2GM4A 2QSGX 5B1BH 1HW5A 1RUNA 4BNCA 2JA6J 3L2CA 1FTTA 3HGGA 3GZ6A 4PGHA 1Z21A 3BCAA 4WWCA 3CMYA 3BJOA 2O61A 1GV2A 2NOGA 3E6BA 3D5LA 3ZR8X 3CQZJ 2DT7B 1RNLA 3OYFA 1W0TA 3I4MJ 2PMHA 4B43A 2E1CA 2HVRA 2QBYA 4NC6A 2N8GA 3ABTA 4RGUA 2R4GA 1L0OC 2QSHX 3JW4A 3HKZA 1A04A 1O3RA 2KJCA 2MH9A 4XKVA 4KIFA 4CCMA 3PQKA 3HOVJ 1TWCJ 4WX9A 3ASOH 2CQ7A 3C2GA 1IGNA 5CVRA 2V4JC 1Y0UA 2GA1A 5L3DA 3CCSI 4IRGA 4EMSA 3A4CA 3OY9A 4BACA 1I3AA 4KUMA 2MG4A 4HDVA 1D8KA 4C3IJ 4HZFA 2F5FA 1S7AA 1G59A 2LNBA 2Y48A 1VF9A 4DJAA 4IHYA 3DXJF 3JREA 3CO7C 3GVAA 4A3KJ 1UG0A 3HYIA 1VTNC 5FGMA 5FLXZ 1IV8A 2O9LA 2EIMH 4Y33A 2O0YA 3P9KA 1F1ZA 3K1PA 3NRVA 3DV8A 1E17A 5TJJA 4PFPA 2CV1A 1XSVA 1RR8C 2EFNA 5ERIA 2VJ4A 2DA7A 4XBFA 3SEQA 1QPIA 1XGMA 5AIPA 2AQEA 4A3CJ 2LR8A 2VJJA 3VYSB 2JPCA 4L9JA 1QRYA 3Q3SA 4TV7A 3I4PA 3RTRA 5DM7F 2DO7A 2LSOA 3ESWB 4A6DA 4F92B 3P7NA 2BY3A 2HWVA 3S2HJ 5HS7A 3I3LA 3PQJA 2WAQN 3PM1A 4ZYDA 4UVCA 2KQRA 3LFKA 2VC1A 5LGNA 2UXXA 3MZHA 4KN4X 3I64A 4BHCA 2XAJA 1YW9A 3IHUA 1HDPA 1VZ0A 3JRFA 1PJRA 4F93B 2L4AA 1S3JA 2Y0SA 4E7LA 3CUQB 3PO3J 3QPLA 4NC8A 3F0CA 1U78A 2MC3A 1IXCA 2DA3A 1X1PA 4PCQA 2HOEA 4KNYA 4RAZA 4FE7A 3HUGB 3LSRA 4H4KC 2A68F 2W1OA 2BEOA 3H36A 3DPTA 1B6AA 5JI6A 2F4MB 4M3BA 4BAYA 3DF8A 3ZMSA 4B48A 1JE8A 2ZBKA 2WAEA 1PUFB 4HX4A 3BTLA 3TO7A 4DZPA 4XKCA 2A6HF 3E1SA 5K7ZA 2VE9A 4M6VA 2D1HA 1TT5B 2RNGA 3CMMA 4XONA 3CCMI 1HOMA 4P9FA 5DCMA 5HDGA 3V7SA 2DDAA 2EPFA 1A6IA 4XMYA 4BXUA 2CQQA 4P55A 1ZHFA 2Q1ZB 4CXFA 3QODA 1W7PA 5AIQA 3BZ6A 4ENMA 2PJRA 2MD0A 2VT2A 3VB2A 3WTYC 3K4LA 3EPZA 3R61A 4L9NA 2DTRA 3IAS2 2W4SA 1FNNA 4HNVA 1RRJA 3KEOA 1ZELA 2KIUA 5EEHA 4MHGA 2IJLA 3T1BA 3VYTB 4Y4RA 5DEQA 3ZQCA 3C18A 3ABKH 4IVNA 2JSPA 5LEKA 2YU3A 1R1TA 1MSFC 2DMQA 2HOAA 2Z16A 4P1WA 4UUTA 1VQ4I 1U0JA 1E3HA 3HRTA 4D1QA 3BPVA 4ZJZA 3ZPLA 5DD4A 3E5QA 2J5PA 2K9NA 4WXCA 4LOCA 5BOXA 2JUGA 1BR1A 2L9SA 4Z6YA 1QZEA 4HW0A 4RGSA 1OR7A 1VQ5I 3HRUA 3D5SC 1SC7A 4HRIA 1WGXA
chains in the Genus database with same CATH topology
2B0LA 4HQMA 1ZGJA 2VONA 2ISYA 1LVAA 3KP7A 3RPUA 1FC3A 3CDHA 3DP7A 1S7OA 1PUEE 3LSTA 4M6YA 2ZMEB 2K02A 3LA7A 2HTJA 1OPCA 2BE5F 1IN6A 4EJOA 2HQRA 4IJAA 2WTEA 5LGTA 2WV0A 4GYIA 3TOBA 3ABUA 2D1VA 2XRNA 3WTZA 1O7FA 4I7HA 2DW4A 3TQNA 2C6YA 1DP7P 3MWMA 1MGTA 3DPLC 2A69F 1U2WA 3FM5A 3I53A 4A2UA 2XVCA 4IF4A 2HFHA 1FBQA 1OKRA 1LJ9A 1SMYF 4YIIA 5BPDA 2ZXJA 4LFUA 4BQAA 5L3BA 5FLXK 1XCVA 4KIGA 4M74A 4IXAA 3J7AO 1BN5A 2XHKA 4Q4ZF 4UHTA 2K86A 3V8LA 4I2OA 2DU9A 3IL2A 4ESJA 1XSXA 4MEXF 4BHPA 3SXYA 5ILSA 2FA5A 3HSRA 2ISZA 2V1UA 4KYWA 1HKSA 3L7WA 3Q9SA 2HYFA 1IN4A 2CSOA 2V1XA 4N9HA 1XSDA 1D8JA 1TLHB 2KRFA 3JSOA 3HTUA 2P5LC 1TBXA 2H09A 3K1NA 1J75A 4MGRA 4GGGA 1G6NA 3RJPA 5L3EA 2JZYA 1B4AA 1B9NA 3HRMA 3ECOA 2VBWA 3FXUA 2VOPA 1BIAA 1UHMA 1REPC 2H6BA 1QQIA 5ED4A 4G7HF 3N97A 2XV4S 2DQLA 2MH2A 2PMUA 3E6DA 2ETHA 5AONA 5ICEA 1STZA 1SD5A 4E70A 3F21A 1YG2A 3IC7A 1U3EM 3RI4A 3WU1B 1T2KA 4EJUA 1BC8C 1R1VA 1P92A 3KP5A 4XSZF 3RIRA 1Z9CA 3SZTA 4P9UA 4AIHA 5ICFA 3GZ5A 2XAFA 1LB2A 2FMYA 5DYMA 1KYWA 1I1SA 3N4MA 1KU2A 1G3SA 3LQQA 4G8XA 2CWEA 4O5VA 3G3ZA 4IRIA 3ZMVA 5KVRA 1RI7A 2DFIA 2VXZA 2TDXA 2W24A 4Y15A 1LDJA 2PBIA 2YX7A 3CUQA 4ENJA 1I6XA 2DPDA 1YO5C 1LNWA 4L0YB 1XGNA 3RPQA 2FBKA 1IW7F 3HHHA 4U0WA 3MCZA 5LLQA 2H6CA 4M73A 2K7LA 2QZ8A 5JVTA 2NAZA 4DQ2A 1FX7A 3F72A 3TO6A 5ILVA 3ERED 2M30A 2FNAA 4ON0A 2PLYA 3J80Z 5KK1A 2QLZA 1FYLA 1ZLJA 5D5XB 5D4RA 1J7KA 3CJNA 3VODA 2V6CA 4LD5A 2Q8KA 3F8BA 3HIFA 1W5TA 2RKHA 4UUVA 3FF5A 3M7GA 5FO5A 3PFIA 4WCGA 4EM2A 3GFJA 4A12A 2GWRA 5FFXA 2G9WA 4ESBA 3CLOA 3I59B 3D0SA 5E1XA 2VOOA 3GYHX 3K9TA 4N0BA 1Z6RA 5K1YA 1QNTA 2DAOA 2Z99A 1H0MA 3AAFA 3ZQ7A 1J9IA 2EFWA 2LF7A 1QZYA 4O6JA 3O3KA 2E1NA 3FMSA 1G3TA 4F7ZA 2VODA 2OBPA 5TRDA 2JSCA 5FB2A 2W57A 3JTHA 1Z1DA 2VC0A 1EV7A 3TOAA 3JSPA 3I0TA 3LA2A 2QQ9A 3SFZA 3IRRA 1BOAA 2XUBA 4HV5A 1MJAA 1XCBA 5E18F 4JK1X 4OMZA 2YSRA 1ZRFA 1MD0A 1HKQA 4R1HA 5J8FA 1QGPA 3L09A 1JGSA 5ILUA 1USTA 3TDZC 4KFCA 1XB4A 1XMAA 4GCVA 3SQNA 2FBIA 2PFBA 3MQ0A 3U9GA 3OV8A 4OIOF 2ELHA 4LB5A 1ZRDA 1UFMA 4ZZDA 5HS8A 1SFXA 3WE2A 2FBHA 5D5WB 1MJBA 4U0VA 4M72A 1P4WA 5H6QA 3Q9VA 3W6KB 4Q48A 4M6XA 1BI3A 3I71A 4L9TA 1HQCA 4XRFA 2OQGA 1MDMB 1P6RA 1B9MA 3WTXC 3QP6A 1ZYRF 4P96A 4HF2A 2OZ6A 2IPQX 3J80K 2O3FA 2CFXA 2IA2A 3QPTA 2F5DA 1YW7A 3RYPA 3R0AA 2L02A 4HYEA 1H9GA 3S2WA 1OYIA 5H20A 4LLNA 2A61A 5IT9Z 1U8RA 4U0YA 3OOPA 1T39A 1R23A 2CO5A 1FSHA 1BJAA 4IPAA 2A3SA 5JR3A 1SD7A 2L01A 3ZMUA 2QWWA 5ICCA 5E1WA 3LQRA 1QBJA 3G73A 3KP2A 4LMYA 2STWA 4BYYA 3KLOA 4RB0A 5E8GA 2R7FA 3BDDA 5CVJA 3B73A 3KZZA 3M9AA 1T6SA 3K69A 3V4GA 4ASNA 4AIJA 1WSUA 4OIPF 2HTSA 3KETA 3IWFA 3F23A 2Y75A 2BYVE 3FHZA 3I5UA 3ZMDA 3E3VA 2P7VB 5A2QZ 1O3TA 2XKOA 3M8FA 2KIFA 4S05A 4OOIA 3M8EA 4U88A 2QQBA 4K2EA 3T8TA 1U5TC 1ON2A 4RAYA 1J0RA 1YW8A 2FMLA 3BPXA 1NHAA 3V8KA 2P6TA 1LQ1A 3R4KA 1SMTA 5DUKA 4B8XA 4NQWA 4A0ZA 3CO6C 1YYVA 4A6EA 4UV8A 2M1BA 3SHFA 1RUOA 2AXLA 1TTYA 1HXDA 1R22A 1S6LA 4LK1F 1ZH5A 2K4BA 1ZN2A 2P5VA 2UXNA 3ISPA 3VFZA 2BBYA 4CDGA 3I59A 2HGCA 5HLIA 5D6FA 3QU3A 3QRFF 1IN8A 1T98A 2Z9OA 3QPHA 2QM3A 2RGVA 3TO9A 1DDNA 1BI2A 5CYVA 4G7OF 1FZPB 3V8JA 1KQ8A 2VE8A 4I02A 5E1ZB 4XLPF 1F4KA 2MBFA 1Q1HA 1C0WA 1FBSA 4LB6B 1D5VA 1R36A 3COAC 2IT0A 1I1GA 1UCRA 2EA2A 2DK5A 1D3YA 1F5TA 3ROUA 2LKPA 1ZAOA 4ZH4F 4FT8A 1X3UA 2P5KA 3GWZA 2IA0A 1U6GA 4A0YA 5IT9K 2COMA 4RGXA 4CHUA 2DQRA 2PJPA 5L3FA 3REOA 2M8EA 3GEZA 2E7XA 3F6OA 4FX4A 1YQAA 2ACJA 2M5WA 3WGIA 3TDUC 1W4MA 1XGOA 2F5CA 4ZYGA 3BP8A 1TW2A 1H9TA 1KGSA 3FXRA 1JHHA 3K2ZA 3F6VA 4KIBA 1FP2A 1HSJA 3CUQC 3ML6A 1TW3A 5E8IA 5DCFA 4EGYA 3F22A 5JHUA 2RQPA 1TQPA 3SZPA 3V7RA 4AVPA 1LDKB 4M9XA 1K79A 4EGZA 1YIOA 3ECHA 2CGPA 2HKOA 5A2QK 3E97A 3F8FA 1HKTA 3RYRA 2EFQA 3IWZA 4ENNA 2GIVA 1I5ZA 3WGGA 2RV8A 3KP6A 1O3QA 1YLFA 3E5XA 3H3UA 2L3DA 4HLXA 3ZMTA 3MAJA 1FPQA 1E2XA 1MDMA 5HLGA 1O7LA 2PN6A 3KZYA 4N9IA 4HF0A 1GVJA 1O3SA 5DUIA 2EK5A 2A07F 3EQLF 2MLKA 5D6EA 5IT3A 2DI3A 2KKOA 4CGZA 1IUYA 3BWGA 1Z6TA 1QZZA 2EFPA 1K6OA 1USSA 3QAHA 1WWXA 2RDPA 1BI0A 5BPIA 4EJTA 5LHHA 1XMKA 2G7HA 1P4XA 4XLNF 2OZUA 5E20A 4CZZA 2V9VA 2QYOA 2WWYA 2IRFG 4CICA 1BI1A 2O8XA 2XIGA 4DNCA 1RIOH 3TGNA 4YFKF 2K4JA 4PDKA 1W7PD 1J59A 4OIQF 4WXDA 5BS6A 3T8RA 4HA8A 5D8KB 2DBBA 5D5UB 1MJ9A 3WG9A 2QVOA 2M45A 1UB9A 2WC2A 3H3ZA 4OMYA 2E7WA 4ZYEA 2YR2A 5HOOA 2GXBA 4ZZLA 1TQIA 5CVVA 5K5RA 4G9YA 2R7DA 1IZ1A 4OINF 2EJRA 5CVIA 3ZN0A 4EM0B 1XGSA 4JQFA 4YFNF 2Q0OA 1UHWA 5H6RA 4Z2YA 4ZYHA 2V1DA 5K5OA 1ODDA 1BM9A 1WKMA 1SAXA 3T0YA 1FOKA 5DDGA 2R3SA 2JT1A 3JAMZ 2HEOA 3DEUA 4EV0A 2IW5A 3J81Z 1KU9A 2PG4A 2MLGA 2X4HA 1QO0D 1KQ9A 4LG0B 3U1DA 1CGPA 3KFWX 2H27A 3GXOA 4MEYF 1B59A 3O2PE 3FMQA 2RC4A 2NRAC 1SD4A 4L5IA 2XASA 1BIBA 2O6GE 1R58A 2D2WA 4RS8A 1FP1D 1G3WA 1V3FA 4AD9A 3WTSC 2F5EA 3DKWA 5ICGA 3RKYA 1WQ2A 1KYZA 3HHGA 3HOSA 1U5TB 5F64A 1SD6A 2J5OA 3GO5A 2IA1A 1DPRA 1S8NA 5DD8A 4ENKA 4GYGA 2OD5A 1V4RA 3FMRA 2OQRA 5BQTA 1WI9A 1HSTA 3TKYA 4YFXF 4EJVA 3WTWC 3V7CA 1F9NA 3F8NA 1TNSA 3R60A 2PQ8A 2QQAA 1R5HA 1FYMA 2L54A 4I0BA 2HYGD 1I27A 4MNUA 2G7UA 3QU6A 2ZFWA 2EWNA 3KP4A 1K7AA 2HS5A 1SFEA 1XD7A 2XAGA 2ZKZA 4L9VA 3RKXA 1IAWA 4Y17A 2IVMA 2ZJ2A 4QLCU 4OIRF 1L3LA 1O57A 3P9IA 1XDUA 5FD6A 5F1RA 4NB5A 5HVQC 2XAQA 3KCCA 3BOQA 2XKPA 2CG4A 4HAMA 6PAXA 3BJAA 2YX4A 3BJ6A 1TQMA 2KJBA 2ESNA 4R79A 4IRHA 3WU0A 5CLSA 2EB7A 3JTGA 2JRTA 5LGUA 3JAMK 3BY6A 1KA8A 3L00A 2RVCA 1ZRCA 3J81K 1OYYA 5J6XA 5K5QA 5CJ9A 3I58A 1IRFA 3B02A 2HDCA 5FFZA 4CO8A 4UXNA 1CF7A 3ULQB 2FSWA 1R7JA 4ESFA 2KIMA 4KT5C 3IRQA 3GFLA 2JTVA 2V79A 1ZG5A 4M9ZA 3T5XA 1IN7A 1BBYA 2DLLA 2JPBA 4G94A 1OYWA 2RNJA 2FEZA 3MEXA 2EV6A 3GUDA 3WE3A 3KEQA 4KDPA 3K1MA 2A6EF 4I98B 3C3WA 2ZCWA 3WTVC 3HOTA 3KP3A 3ELKA 2PI0A 1OMIA 1JXSA 2ADUA 4HOBA 3R0JA 4GO1A 1S29A 1K78B 2EA4A 3EYIA 2BV6A 4MQ9F 1SFUA 4LLLA 1R1UA 2A5YB 3F8MA 1BC7C 3EDPA 1DUXC 2VT3A 2EFOA 3HSEA 1GHCA 1QPMA 4WF2A 3O6BB 3HTSB 4I01A 3R6SA 2HZTA 2VBXA 2FF4A 3HSFA 1ZREA 4KICA 3RDIA 2GXGA 4EQQA 5BMZA 4MQVA 2FRHA 1YS6A 1JHFA 4RB1A 3GF2A 1RZ4A 3L9FA 3CUOA 4JBAA 1P4AA 3WGHA 1GXQA 2AS5F 3QOPA 3EUHA 2FQ3A 4MTEA 5LHIA 1TNTA 2OU2A 4LG0A 2NNNA 4EJWA 2FE3A 2X0LA 3HRSA 1IN5A 4A5MA 4HV6A 2XGXA 3W6JB 5L3CA 4IHTA 1LDDA 3GW2A 4AIKA 2HQNA 3ZMZA 4M71A 3DQVC 1IXSB 1IRGA 3VEPA 1FWZA 3KLNA 2DK8A 1FY7A 3EYYA 1Z7UA 2M87A 3F3XA 1ZG3A 4HX7A 1U5TA 3Q5FA 4OU0A 1AWCA 5F6FA 2CW0F 2YPRA 3GX4X 1HW2A 2P7CB 1ONVA 2CYYA 3P9CA 2ZNZA 1MKMA 1XDSA 4H0EA 4GXOA 1PDNC 2LF8A 5HLHA 2HR3A 1HBXG 3IKTA 2L4MA 3ZN1A 3NEUA 3LAPA 4KMUX 1R5GA 4O3MA 3IKVA 1Z05A 2OA4A 4NHJA 2DPUA 2O03A 2QBYB 1J2XA 2P8TA 4G6DA 4HQEA 2MD5A 2UWMA 2FXAA 5D4SA 1B1BA 5L3GA 5D8LB 5D5VB 5LRRA 4AWXB 1YTYA 2Z33A 5LEJA 1FT9A 2HKXA 4KN7X 4B09A 5CVUA 1PP7U 4ETSA 3LAJA 4YIFA 3I54A 4BH9A 3WTUC 2Y0MA 4S04A 4UV9A 4BHBA 4L18B 3M1EA 4WXHA 3MFKA 2GQQA 1J5YA 2LDUA 3FWEA 1HW1A 2VBZA 2QENA 2MA3A 3C1DA 4PZJA 2XROA 2BGCA 2NNYA 4QWQA 3BROA 5HDKA 4HLYA 3ZP5A 1FBUA 2IP2A 2FOKA 1Z91A 1CF7B 3GLXA 3FZVA 2PEXA 5LBQA 2ZNYA 3KE2A 4R8HA 1XN7A 2NS0A 2CQKA 5DV5A 3WTTC 1G4DA 2FU4A 4PGGA 2Q2EA 4LLGF 3LWFA 2QUFA 1YFHA 2RN7A 3MZYA 1ZLKA 1ULYA 4Q47A 3FXQA 2EV0A 5DCMB 4Y13A 4L0ZB 4WK8F 2Z5UA 4D0PA 4CYDA 1KU7A 1W7PB 2P4WA 3LA3A 4IHSA 4LJZF 3HUGA 4I0AA 1ZGAA 4HBLA 1ZARA 5HS9A 1P2FA 1IXRC 3DFGA 2P6SA 2W25A 4UNOA 2ZO4A 4EVIA 4U7BA 4P5OA 1MZBA 1T38A 3QP5A 3E6CC 1G3YA 1IF1A 3C7JA 2FNPA 4RGRA 3RKWA 2VN2A 3U2RA 4G7ZF 2NYXA 2Z3YA 1PP8F 1K78A 1EH6A 2VBYA 1LEAA 2K27A 1T0FA 4G6QA 5HDNA 2DT5A 1YS7A 5JFRA 5FD5A 2F2EA 1DPUA 4HF1A 4XSXF 4M9SA 2GAUA 4EM1A 2ESHA 4A5NA 3H92A 2ZMEA 4Q5SF 3EETA 1ON1A 2GZWA 3F8CA 2XAHA 3GFMA 1R00A 1FSEA 4LK0F 3VOEA 1EH8A 2OAZA 3GFIA 4LGWA 3WODF 2UZKA 1KQ0A 3E5UA 4FX0A 5LHGA 2W85A 4HX8A 4HDUA 4RB3C 4KA4A 2STTA 2GA2A 4RB2C 2EV5A 4KMFA 1W5SA 3NQOA 5LRSA 1FLIA 4A0XA 4L5JA 2D45A 4YG2F 1EH7A 5E17F 3K0LA 3CTAA 3FX3A 1GXPA 1WRJA 5EEGA 4MTDA 3FM3A 4UVAA 4U7DA 1ZG1A 2H94A 1AOYA 4UVBA 4FHTA 1FYKA 2W84A 5J8CA 1LEBA 3E6MA 4I09A 1KU3A 1HW5A 1RUNA 4BNCA 3L2CA 3GZ6A 4PGHA 4WWCA 3BJOA 2O61A 3E6BA 3D5LA 1RNLA 2PMHA 2E1CA 2QBYA 3ABTA 4RGUA 1L0OC 3JW4A 1A04A 1O3RA 2KJCA 2MH9A 4KIFA 3PQKA 4WX9A 5CVRA 1Y0UA 2GA1A 5L3DA 4IRGA 4EMSA 4KUMA 4HDVA 1D8KA 4HZFA 2F5FA 1S7AA 2LNBA 2Y48A 3DXJF 3CO7C 3GVAA 3HYIA 1VTNC 5FGMA 5FLXZ 2O0YA 3P9KA 1F1ZA 3K1PA 3NRVA 3DV8A 1E17A 5TJJA 1XSVA 2EFNA 5ERIA 4XBFA 1XGMA 5AIPA 2JPCA 4L9JA 4TV7A 3RTRA 3I4PA 2DO7A 2LSOA 4A6DA 3P7NA 2HWVA 5HS7A 3PQJA 4ZYDA 4UVCA 3LFKA 2VC1A 5LGNA 2UXXA 3MZHA 4KN4X 3I64A 4BHCA 2XAJA 1YW9A 3IHUA 2L4AA 1S3JA 3CUQB 1U78A 2MC3A 1IXCA 4PCQA 2HOEA 4KNYA 4RAZA 2A68F 2BEOA 3DPTA 1B6AA 5JI6A 4BAYA 3DF8A 3ZMSA 1JE8A 2ZBKA 4HX4A 3TO7A 2A6HF 2VE9A 2D1HA 4P9FA 5DCMA 5HDGA 3V7SA 4BXUA 4P55A 1ZHFA 4CXFA 1W7PA 5AIQA 3BZ6A 4ENMA 2VT2A 3VB2A 3WTYC 3R61A 4L9NA 2DTRA 1FNNA 3KEOA 2KIUA 5EEHA 4MHGA 2IJLA 3T1BA 5DEQA 3C18A 4IVNA 5LEKA 2YU3A 1R1TA 3HRTA 3BPVA 3ZPLA 5DD4A 3E5QA 2J5PA 4WXCA 5BOXA 4HW0A 4RGSA 1OR7A 3HRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0L A;  4HQM A;  1ZGJ A;  2VON A;  2ISY A;  1LVA A;  3KP7 A;  3RPU A;  1FC3 A;  3CDH A;  3DP7 A;  1S7O A;  1PUE E;  3LST A;  4M6Y A;  2ZME B;  2K02 A;  3LA7 A;  2HTJ A;  1OPC A;  2BE5 F;  1IN6 A;  4EJO A;  2HQR A;  4IJA A;  2WTE A;  5LGT A;  2WV0 A;  4GYI A;  3TOB A;  3ABU A;  2D1V A;  2XRN A;  3WTZ A;  1O7F A;  4I7H A;  2DW4 A;  3TQN A;  2C6Y A;  1DP7 P;  3MWM A;  1MGT A;  3DPL C;  2A69 F;  1U2W A;  3FM5 A;  3I53 A;  4A2U A;  2XVC A;  4IF4 A;  2HFH A;  1FBQ A;  1OKR A;  1LJ9 A;  1SMY F;  4YII A;  5BPD A;  2ZXJ A;  4LFU A;  4BQA A;  5L3B A;  5FLX K;  1XCV A;  4KIG A;  4M74 A;  4IXA A;  3J7A O;  1BN5 A;  2XHK A;  4Q4Z F;  4UHT A;  2K86 A;  3V8L A;  4I2O A;  2DU9 A;  3IL2 A;  4ESJ A;  1XSX A;  4MEX F;  4BHP A;  3SXY A;  5ILS A;  2FA5 A;  3HSR A;  2ISZ A;  2V1U A;  4KYW A;  1HKS A;  3L7W A;  3Q9S A;  2HYF A;  1IN4 A;  2CSO A;  2V1X A;  4N9H A;  1XSD A;  1D8J A;  1TLH B;  2KRF A;  3JSO A;  3HTU A;  2P5L C;  1TBX A;  2H09 A;  3K1N A;  1J75 A;  4MGR A;  4GGG A;  1G6N A;  3RJP A;  5L3E A;  2JZY A;  1B4A A;  1B9N A;  3HRM A;  3ECO A;  2VBW A;  3FXU A;  2VOP A;  1BIA A;  1UHM A;  1REP C;  2H6B A;  1QQI A;  5ED4 A;  4G7H F;  3N97 A;  2XV4 S;  2DQL A;  2MH2 A;  2PMU A;  3E6D A;  2ETH A;  5AON A;  5ICE A;  1STZ A;  1SD5 A;  4E70 A;  3F21 A;  1YG2 A;  3IC7 A;  1U3E M;  3RI4 A;  3WU1 B;  1T2K A;  4EJU A;  1BC8 C;  1R1V A;  1P92 A;  3KP5 A;  4XSZ F;  3RIR A;  1Z9C A;  3SZT A;  4P9U A;  4AIH A;  5ICF A;  3GZ5 A;  2XAF A;  1LB2 A;  2FMY A;  5DYM A;  1KYW A;  1I1S A;  3N4M A;  1KU2 A;  1G3S A;  3LQQ A;  4G8X A;  2CWE A;  4O5V A;  3G3Z A;  4IRI A;  3ZMV A;  5KVR A;  1RI7 A;  2DFI A;  2VXZ A;  2TDX A;  2W24 A;  4Y15 A;  1LDJ A;  2PBI A;  2YX7 A;  3CUQ A;  4ENJ A;  1I6X A;  2DPD A;  1YO5 C;  1LNW A;  4L0Y B;  1XGN A;  3RPQ A;  2FBK A;  1IW7 F;  3HHH A;  4U0W A;  3MCZ A;  5LLQ A;  2H6C A;  4M73 A;  2K7L A;  2QZ8 A;  5JVT A;  2NAZ A;  4DQ2 A;  1FX7 A;  3F72 A;  3TO6 A;  5ILV A;  3ERE D;  2M30 A;  2FNA A;  4ON0 A;  2PLY A;  3J80 Z;  5KK1 A;  2QLZ A;  1FYL A;  1ZLJ A;  5D5X B;  5D4R A;  1J7K A;  3CJN A;  3VOD A;  2V6C A;  4LD5 A;  2Q8K A;  3F8B A;  3HIF A;  1W5T A;  2RKH A;  4UUV A;  3FF5 A;  3M7G A;  5FO5 A;  3PFI A;  4WCG A;  4EM2 A;  3GFJ A;  4A12 A;  2GWR A;  5FFX A;  2G9W A;  4ESB A;  3CLO A;  3I59 B;  3D0S A;  5E1X A;  2VOO A;  3GYH X;  3K9T A;  4N0B A;  1Z6R A;  5K1Y A;  1QNT A;  2DAO A;  2Z99 A;  1H0M A;  3AAF A;  3ZQ7 A;  1J9I A;  2EFW A;  2LF7 A;  1QZY A;  4O6J A;  3O3K A;  2E1N A;  3FMS A;  1G3T A;  4F7Z A;  2VOD A;  2OBP A;  5TRD A;  2JSC A;  5FB2 A;  2W57 A;  3JTH A;  1Z1D A;  2VC0 A;  1EV7 A;  3TOA A;  3JSP A;  3I0T A;  3LA2 A;  2QQ9 A;  3SFZ A;  3IRR A;  1BOA A;  2XUB A;  4HV5 A;  1MJA A;  1XCB A;  5E18 F;  4JK1 X;  4OMZ A;  2YSR A;  1ZRF A;  1MD0 A;  1HKQ A;  4R1H A;  5J8F A;  1QGP A;  3L09 A;  1JGS A;  5ILU A;  1UST A;  3TDZ C;  4KFC A;  1XB4 A;  1XMA A;  4GCV A;  3SQN A;  2FBI A;  2PFB A;  3MQ0 A;  3U9G A;  3OV8 A;  4OIO F;  2ELH A;  4LB5 A;  1ZRD A;  1UFM A;  4ZZD A;  5HS8 A;  1SFX A;  3WE2 A;  2FBH A;  5D5W B;  1MJB A;  4U0V A;  4M72 A;  1P4W A;  5H6Q A;  3Q9V A;  3W6K B;  4Q48 A;  4M6X A;  1BI3 A;  3I71 A;  4L9T A;  1HQC A;  4XRF A;  2OQG A;  1MDM B;  1P6R A;  1B9M A;  3WTX C;  3QP6 A;  1ZYR F;  4P96 A;  4HF2 A;  2OZ6 A;  2IPQ X;  3J80 K;  2O3F A;  2CFX A;  2IA2 A;  3QPT A;  2F5D A;  1YW7 A;  3RYP A;  3R0A A;  2L02 A;  4HYE A;  1H9G A;  3S2W A;  1OYI A;  5H20 A;  4LLN A;  2A61 A;  5IT9 Z;  1U8R A;  4U0Y A;  3OOP A;  1T39 A;  1R23 A;  2CO5 A;  1FSH A;  1BJA A;  4IPA A;  2A3S A;  5JR3 A;  1SD7 A;  2L01 A;  3ZMU A;  2QWW A;  5ICC A;  5E1W A;  3LQR A;  1QBJ A;  3G73 A;  3KP2 A;  4LMY A;  2STW A;  4BYY A;  3KLO A;  4RB0 A;  5E8G A;  2R7F A;  3BDD A;  5CVJ A;  3B73 A;  3KZZ A;  3M9A A;  1T6S A;  3K69 A;  3V4G A;  4ASN A;  4AIJ A;  1WSU A;  4OIP F;  2HTS A;  3KET A;  3IWF A;  3F23 A;  2Y75 A;  2BYV E;  3FHZ A;  3I5U A;  3ZMD A;  3E3V A;  2P7V B;  5A2Q Z;  1O3T A;  2XKO A;  3M8F A;  2KIF A;  4S05 A;  4OOI A;  3M8E A;  4U88 A;  2QQB A;  4K2E A;  3T8T A;  1U5T C;  1ON2 A;  4RAY A;  1J0R A;  1YW8 A;  2FML A;  3BPX A;  1NHA A;  3V8K A;  2P6T A;  1LQ1 A;  3R4K A;  1SMT A;  5DUK A;  4B8X A;  4NQW A;  4A0Z A;  3CO6 C;  1YYV A;  4A6E A;  4UV8 A;  2M1B A;  3SHF A;  1RUO A;  2AXL A;  1TTY A;  1HXD A;  1R22 A;  1S6L A;  4LK1 F;  1ZH5 A;  2K4B A;  1ZN2 A;  2P5V A;  2UXN A;  3ISP A;  3VFZ A;  2BBY A;  4CDG A;  3I59 A;  2HGC A;  5HLI A;  5D6F A;  3QU3 A;  3QRF F;  1IN8 A;  1T98 A;  2Z9O A;  3QPH A;  2QM3 A;  2RGV A;  3TO9 A;  1DDN A;  1BI2 A;  5CYV A;  4G7O F;  1FZP B;  3V8J A;  1KQ8 A;  2VE8 A;  4I02 A;  5E1Z B;  4XLP F;  1F4K A;  2MBF A;  1Q1H A;  1C0W A;  1FBS A;  4LB6 B;  1D5V A;  1R36 A;  3COA C;  2IT0 A;  1I1G A;  1UCR A;  2EA2 A;  2DK5 A;  1D3Y A;  1F5T A;  3ROU A;  2LKP A;  1ZAO A;  4ZH4 F;  4FT8 A;  1X3U A;  2P5K A;  3GWZ A;  2IA0 A;  1U6G A;  4A0Y A;  5IT9 K;  2COM A;  4RGX A;  4CHU A;  2DQR A;  2PJP A;  5L3F A;  3REO A;  2M8E A;  3GEZ A;  2E7X A;  3F6O A;  4FX4 A;  1YQA A;  2ACJ A;  2M5W A;  3WGI A;  3TDU C;  1W4M A;  1XGO A;  2F5C A;  4ZYG A;  3BP8 A;  1TW2 A;  1H9T A;  1KGS A;  3FXR A;  1JHH A;  3K2Z A;  3F6V A;  4KIB A;  1FP2 A;  1HSJ A;  3CUQ C;  3ML6 A;  1TW3 A;  5E8I A;  5DCF A;  4EGY A;  3F22 A;  5JHU A;  2RQP A;  1TQP A;  3SZP A;  3V7R A;  4AVP A;  1LDK B;  4M9X A;  1K79 A;  4EGZ A;  1YIO A;  3ECH A;  2CGP A;  2HKO A;  5A2Q K;  3E97 A;  3F8F A;  1HKT A;  3RYR A;  2EFQ A;  3IWZ A;  4ENN A;  2GIV A;  1I5Z A;  3WGG A;  2RV8 A;  3KP6 A;  1O3Q A;  1YLF A;  3E5X A;  3H3U A;  2L3D A;  4HLX A;  3ZMT A;  3MAJ A;  1FPQ A;  1E2X A;  1MDM A;  5HLG A;  1O7L A;  2PN6 A;  3KZY A;  4N9I A;  4HF0 A;  1GVJ A;  1O3S A;  5DUI A;  2EK5 A;  2A07 F;  3EQL F;  2MLK A;  5D6E A;  5IT3 A;  2DI3 A;  2KKO A;  4CGZ A;  1IUY A;  3BWG A;  1Z6T A;  1QZZ A;  2EFP A;  1K6O A;  1USS A;  3QAH A;  1WWX A;  2RDP A;  1BI0 A;  5BPI A;  4EJT A;  5LHH A;  1XMK A;  2G7H A;  1P4X A;  4XLN F;  2OZU A;  5E20 A;  4CZZ A;  2V9V A;  2QYO A;  2WWY A;  2IRF G;  4CIC A;  1BI1 A;  2O8X A;  2XIG A;  4DNC A;  1RIO H;  3TGN A;  4YFK F;  2K4J A;  4PDK A;  1W7P D;  1J59 A;  4OIQ F;  4WXD A;  5BS6 A;  3T8R A;  4HA8 A;  5D8K B;  2DBB A;  5D5U B;  1MJ9 A;  3WG9 A;  2QVO A;  2M45 A;  1UB9 A;  2WC2 A;  3H3Z A;  4OMY A;  2E7W A;  4ZYE A;  2YR2 A;  5HOO A;  2GXB A;  4ZZL A;  1TQI A;  5CVV A;  5K5R A;  4G9Y A;  2R7D A;  1IZ1 A;  4OIN F;  2EJR A;  5CVI A;  3ZN0 A;  4EM0 B;  1XGS A;  4JQF A;  4YFN F;  2Q0O A;  1UHW A;  5H6R A;  4Z2Y A;  4ZYH A;  2V1D A;  5K5O A;  1ODD A;  1BM9 A;  1WKM A;  1SAX A;  3T0Y A;  1FOK A;  5DDG A;  2R3S A;  2JT1 A;  3JAM Z;  2HEO A;  3DEU A;  4EV0 A;  2IW5 A;  3J81 Z;  1KU9 A;  2PG4 A;  2MLG A;  2X4H A;  1QO0 D;  1KQ9 A;  4LG0 B;  3U1D A;  1CGP A;  3KFW X;  2H27 A;  3GXO A;  4MEY F;  1B59 A;  3O2P E;  3FMQ A;  2RC4 A;  2NRA C;  1SD4 A;  4L5I A;  2XAS A;  1BIB A;  2O6G E;  1R58 A;  2D2W A;  4RS8 A;  1FP1 D;  1G3W A;  1V3F A;  4AD9 A;  3WTS C;  2F5E A;  3DKW A;  5ICG A;  3RKY A;  1WQ2 A;  1KYZ A;  3HHG A;  3HOS A;  1U5T B;  5F64 A;  1SD6 A;  2J5O A;  3GO5 A;  2IA1 A;  1DPR A;  1S8N A;  5DD8 A;  4ENK A;  4GYG A;  2OD5 A;  1V4R A;  3FMR A;  2OQR A;  5BQT A;  1WI9 A;  1HST A;  3TKY A;  4YFX F;  4EJV A;  3WTW C;  3V7C A;  1F9N A;  3F8N A;  1TNS A;  3R60 A;  2PQ8 A;  2QQA A;  1R5H A;  1FYM A;  2L54 A;  4I0B A;  2HYG D;  1I27 A;  4MNU A;  2G7U A;  3QU6 A;  2ZFW A;  2EWN A;  3KP4 A;  1K7A A;  2HS5 A;  1SFE A;  1XD7 A;  2XAG A;  2ZKZ A;  4L9V A;  3RKX A;  1IAW A;  4Y17 A;  2IVM A;  2ZJ2 A;  4QLC U;  4OIR F;  1L3L A;  1O57 A;  3P9I A;  1XDU A;  5FD6 A;  5F1R A;  4NB5 A;  5HVQ C;  2XAQ A;  3KCC A;  3BOQ A;  2XKP A;  2CG4 A;  4HAM A;  6PAX A;  3BJA A;  2YX4 A;  3BJ6 A;  1TQM A;  2KJB A;  2ESN A;  4R79 A;  4IRH A;  3WU0 A;  5CLS A;  2EB7 A;  3JTG A;  2JRT A;  5LGU A;  3JAM K;  3BY6 A;  1KA8 A;  3L00 A;  2RVC A;  1ZRC A;  3J81 K;  1OYY A;  5J6X A;  5K5Q A;  5CJ9 A;  3I58 A;  1IRF A;  3B02 A;  2HDC A;  5FFZ A;  4CO8 A;  4UXN A;  1CF7 A;  3ULQ B;  2FSW A;  1R7J A;  4ESF A;  2KIM A;  4KT5 C;  3IRQ A;  3GFL A;  2JTV A;  2V79 A;  1ZG5 A;  4M9Z A;  3T5X A;  1IN7 A;  1BBY A;  2DLL A;  2JPB A;  4G94 A;  1OYW A;  2RNJ A;  2FEZ A;  3MEX A;  2EV6 A;  3GUD A;  3WE3 A;  3KEQ A;  4KDP A;  3K1M A;  2A6E F;  4I98 B;  3C3W A;  2ZCW A;  3WTV C;  3HOT A;  3KP3 A;  3ELK A;  2PI0 A;  1OMI A;  1JXS A;  2ADU A;  4HOB A;  3R0J A;  4GO1 A;  1S29 A;  1K78 B;  2EA4 A;  3EYI A;  2BV6 A;  4MQ9 F;  1SFU A;  4LLL A;  1R1U A;  2A5Y B;  3F8M A;  1BC7 C;  3EDP A;  1DUX C;  2VT3 A;  2EFO A;  3HSE A;  1GHC A;  1QPM A;  4WF2 A;  3O6B B;  3HTS B;  4I01 A;  3R6S A;  2HZT A;  2VBX A;  2FF4 A;  3HSF A;  1ZRE A;  4KIC A;  3RDI A;  2GXG A;  4EQQ A;  5BMZ A;  4MQV A;  2FRH A;  1YS6 A;  1JHF A;  4RB1 A;  3GF2 A;  1RZ4 A;  3L9F A;  3CUO A;  4JBA A;  1P4A A;  3WGH A;  1GXQ A;  2AS5 F;  3QOP A;  3EUH A;  2FQ3 A;  4MTE A;  5LHI A;  1TNT A;  2OU2 A;  4LG0 A;  2NNN A;  4EJW A;  2FE3 A;  2X0L A;  3HRS A;  1IN5 A;  4A5M A;  4HV6 A;  2XGX A;  3W6J B;  5L3C A;  4IHT A;  1LDD A;  3GW2 A;  4AIK A;  2HQN A;  3ZMZ A;  4M71 A;  3DQV C;  1IXS B;  1IRG A;  3VEP A;  1FWZ A;  3KLN A;  2DK8 A;  1FY7 A;  3EYY A;  1Z7U A;  2M87 A;  3F3X A;  1ZG3 A;  4HX7 A;  1U5T A;  3Q5F A;  4OU0 A;  1AWC A;  5F6F A;  2CW0 F;  2YPR A;  3GX4 X;  1HW2 A;  2P7C B;  1ONV A;  2CYY A;  3P9C A;  2ZNZ A;  1MKM A;  1XDS A;  4H0E A;  4GXO A;  1PDN C;  2LF8 A;  5HLH A;  2HR3 A;  1HBX G;  3IKT A;  2L4M A;  3ZN1 A;  3NEU A;  3LAP A;  4KMU X;  1R5G A;  4O3M A;  3IKV A;  1Z05 A;  2OA4 A;  4NHJ A;  2DPU A;  2O03 A;  2QBY B;  1J2X A;  2P8T A;  4G6D A;  4HQE A;  2MD5 A;  2UWM A;  2FXA A;  5D4S A;  1B1B A;  5L3G A;  5D8L B;  5D5V B;  5LRR A;  4AWX B;  1YTY A;  2Z33 A;  5LEJ A;  1FT9 A;  2HKX A;  4KN7 X;  4B09 A;  5CVU A;  1PP7 U;  4ETS A;  3LAJ A;  4YIF A;  3I54 A;  4BH9 A;  3WTU C;  2Y0M A;  4S04 A;  4UV9 A;  4BHB A;  4L18 B;  3M1E A;  4WXH A;  3MFK A;  2GQQ A;  1J5Y A;  2LDU A;  3FWE A;  1HW1 A;  2VBZ A;  2QEN A;  2MA3 A;  3C1D A;  4PZJ A;  2XRO A;  2BGC A;  2NNY A;  4QWQ A;  3BRO A;  5HDK A;  4HLY A;  3ZP5 A;  1FBU A;  2IP2 A;  2FOK A;  1Z91 A;  1CF7 B;  3GLX A;  3FZV A;  2PEX A;  5LBQ A;  2ZNY A;  3KE2 A;  4R8H A;  1XN7 A;  2NS0 A;  2CQK A;  5DV5 A;  3WTT C;  1G4D A;  2FU4 A;  4PGG A;  2Q2E A;  4LLG F;  3LWF A;  2QUF A;  1YFH A;  2RN7 A;  3MZY A;  1ZLK A;  1ULY A;  4Q47 A;  3FXQ A;  2EV0 A;  5DCM B;  4Y13 A;  4L0Z B;  4WK8 F;  2Z5U A;  4D0P A;  4CYD A;  1KU7 A;  1W7P B;  2P4W A;  3LA3 A;  4IHS A;  4LJZ F;  3HUG A;  4I0A A;  1ZGA A;  4HBL A;  1ZAR A;  5HS9 A;  1P2F A;  1IXR C;  3DFG A;  2P6S A;  2W25 A;  4UNO A;  2ZO4 A;  4EVI A;  4U7B A;  4P5O A;  1MZB A;  1T38 A;  3QP5 A;  3E6C C;  1G3Y A;  1IF1 A;  3C7J A;  2FNP A;  4RGR A;  3RKW A;  2VN2 A;  3U2R A;  4G7Z F;  2NYX A;  2Z3Y A;  1PP8 F;  1K78 A;  1EH6 A;  2VBY A;  1LEA A;  2K27 A;  1T0F A;  4G6Q A;  5HDN A;  2DT5 A;  1YS7 A;  5JFR A;  5FD5 A;  2F2E A;  1DPU A;  4HF1 A;  4XSX F;  4M9S A;  2GAU A;  4EM1 A;  2ESH A;  4A5N A;  3H92 A;  2ZME A;  4Q5S F;  3EET A;  1ON1 A;  2GZW A;  3F8C A;  2XAH A;  3GFM A;  1R00 A;  1FSE A;  4LK0 F;  3VOE A;  1EH8 A;  2OAZ A;  3GFI A;  4LGW A;  3WOD F;  2UZK A;  1KQ0 A;  3E5U A;  4FX0 A;  5LHG A;  2W85 A;  4HX8 A;  4HDU A;  4RB3 C;  4KA4 A;  2STT A;  2GA2 A;  4RB2 C;  2EV5 A;  4KMF A;  1W5S A;  3NQO A;  5LRS A;  1FLI A;  4A0X A;  4L5J A;  2D45 A;  4YG2 F;  1EH7 A;  5E17 F;  3K0L A;  3CTA A;  3FX3 A;  1GXP A;  1WRJ A;  5EEG A;  4MTD A;  3FM3 A;  4UVA A;  4U7D A;  1ZG1 A;  2H94 A;  1AOY A;  4UVB A;  4FHT A;  1FYK A;  2W84 A;  5J8C A;  1LEB A;  3E6M A;  4I09 A;  1KU3 A;  1HW5 A;  1RUN A;  4BNC A;  3L2C A;  3GZ6 A;  4PGH A;  4WWC A;  3BJO A;  2O61 A;  3E6B A;  3D5L A;  1RNL A;  2PMH A;  2E1C A;  2QBY A;  3ABT A;  4RGU A;  1L0O C;  3JW4 A;  1A04 A;  1O3R A;  2KJC A;  2MH9 A;  4KIF A;  3PQK A;  4WX9 A;  5CVR A;  1Y0U A;  2GA1 A;  5L3D A;  4IRG A;  4EMS A;  4KUM A;  4HDV A;  1D8K A;  4HZF A;  2F5F A;  1S7A A;  2LNB A;  2Y48 A;  3DXJ F;  3CO7 C;  3GVA A;  3HYI A;  1VTN C;  5FGM A;  5FLX Z;  2O0Y A;  3P9K A;  1F1Z A;  3K1P A;  3NRV A;  3DV8 A;  1E17 A;  5TJJ A;  1XSV A;  2EFN A;  5ERI A;  4XBF A;  1XGM A;  5AIP A;  2JPC A;  4L9J A;  4TV7 A;  3RTR A;  3I4P A;  2DO7 A;  2LSO A;  4A6D A;  3P7N A;  2HWV A;  5HS7 A;  3PQJ A;  4ZYD A;  4UVC A;  3LFK A;  2VC1 A;  5LGN A;  2UXX A;  3MZH A;  4KN4 X;  3I64 A;  4BHC A;  2XAJ A;  1YW9 A;  3IHU A;  2L4A A;  1S3J A;  3CUQ B;  1U78 A;  2MC3 A;  1IXC A;  4PCQ A;  2HOE A;  4KNY A;  4RAZ A;  2A68 F;  2BEO A;  3DPT A;  1B6A A;  5JI6 A;  4BAY A;  3DF8 A;  3ZMS A;  1JE8 A;  2ZBK A;  4HX4 A;  3TO7 A;  2A6H F;  2VE9 A;  2D1H A;  4P9F A;  5DCM A;  5HDG A;  3V7S A;  4BXU A;  4P55 A;  1ZHF A;  4CXF A;  1W7P A;  5AIQ A;  3BZ6 A;  4ENM A;  2VT2 A;  3VB2 A;  3WTY C;  3R61 A;  4L9N A;  2DTR A;  1FNN A;  3KEO A;  2KIU A;  5EEH A;  4MHG A;  2IJL A;  3T1B A;  5DEQ A;  3C18 A;  4IVN A;  5LEK A;  2YU3 A;  1R1T A;  3HRT A;  3BPV A;  3ZPL A;  5DD4 A;  3E5Q A;  2J5P A;  4WXC A;  5BOX A;  4HW0 A;  4RGS A;  1OR7 A;  3HRU A; 
#chains in the Genus database with same CATH topology
 2B0L A;  4HQM A;  1ZGJ A;  2VON A;  3BQY A;  2ISY A;  1LVA A;  3KP7 A;  3RPU A;  1Y1W J;  1FC3 A;  3CDH A;  3DP7 A;  1SAU A;  2JA2 A;  1SVL A;  1S7O A;  2WA0 A;  3CDL A;  1PUE E;  2M7A A;  3ZRG A;  1EJ9 A;  1D0Y A;  3LST A;  2BXY A;  2WBM A;  3GTM J;  2ID3 A;  4M6Y A;  4HPQ A;  2ZME B;  2K02 A;  3LA7 A;  4E4H A;  2HTJ A;  1OPC A;  1B72 B;  2BE5 F;  1IN6 A;  1IC8 A;  2CU7 A;  4NC7 A;  4EJO A;  3DCF A;  5FRN A;  2CW8 A;  2HQR A;  4IJA A;  2WTE A;  5LGT A;  2WV0 A;  2COB A;  4GYI A;  3TOB A;  1WZ2 A;  3ABU A;  2JN6 A;  2D1V A;  2XRN A;  3WTZ A;  3MVP A;  4C3H J;  1WH7 A;  3S16 J;  3PSI A;  1O7F A;  2VJ5 A;  1HDD C;  2VAS A;  2X9D A;  4I7H A;  3K4J A;  2DW4 A;  3A03 A;  3TQN A;  1MMS A;  3FXM A;  1J09 A;  2C6Y A;  2QKM B;  1DP7 P;  3MWM A;  5GTI C;  1S5L C;  1MGT A;  3SEZ A;  4W1U A;  1FJL A;  3DPL C;  2A69 F;  1U2W A;  3FM5 A;  3I53 A;  4A2U A;  2XVC A;  4IF4 A;  2HFH A;  1TC3 C;  3L2Q A;  4A3M J;  1FBQ A;  1MSE C;  1OKR A;  1H89 C;  1MMA A;  2LMD A;  1LJ9 A;  1SMY F;  1R4N B;  3BR2 A;  2ZXJ A;  4YII A;  5BPD A;  4LFU A;  2XF5 A;  2X6X A;  4BQA A;  4Y52 J;  3MKW B;  5L3B A;  2R7V A;  5FLX K;  3NAR A;  3ABL H;  5EZG A;  3ZQQ A;  5FJ8 J;  2VUM J;  3MKY B;  1XCV A;  2JVG A;  2VPL A;  4KIG A;  3TW7 A;  4M74 A;  3KZI C;  5M3M J;  4IXA A;  2K40 A;  2R7Q A;  3B6A A;  3J7A O;  3VWB A;  1TZL A;  1BA5 A;  1BN5 A;  2XHK A;  4QTR A;  3PIO F;  4Q4Z F;  3S1R J;  4UHT A;  2DYS H;  2K86 A;  3V8L A;  1NK2 P;  2H1L A;  5TGT A;  4I2O A;  2DU9 A;  3IL2 A;  3BTJ A;  1QHH D;  4ESJ A;  1XSX A;  3DTI A;  4MEX F;  4BHP A;  5CPR B;  3SXY A;  2HDD A;  1Q1V A;  3PIP F;  5ILS A;  2VXD A;  4XN3 A;  2FA5 A;  3HSR A;  3J7Z I;  1XPX A;  2ISZ A;  4ZDP A;  1ETW A;  2L9N A;  2BW3 A;  2V1U A;  4KYW A;  1BOB A;  1HKS A;  3L7W A;  3Q9S A;  2HYF A;  1IN4 A;  1R6R A;  2CSO A;  2V1X A;  4N9H A;  5B3S H;  1XSD A;  1D8J A;  1TLH B;  4BE2 A;  2VB6 A;  1WJD A;  2KRF A;  3MD2 A;  3JSO A;  4YRV A;  1Y6I A;  3HTU A;  3IH2 A;  2P5L C;  1TBX A;  2A5W A;  2H09 A;  3K1N A;  3SJM A;  4MGR A;  2FJ1 A;  1J75 A;  2DOD A;  4GGG A;  1G6N A;  3RJP A;  3TP0 A;  5HLT A;  5L3E A;  2A05 A;  1B4A A;  2JZY A;  2Z2S B;  1ZR4 A;  1B9N A;  3DKY A;  3HRM A;  3RSN A;  4CYC A;  2XGC A;  3RKQ A;  3ECO A;  2YU9 J;  3A02 A;  2VBW A;  5DM6 F;  3FXU A;  2VOP A;  1BIA A;  1UHM A;  4PK4 A;  4ANJ A;  1REP C;  3LSK A;  2H6B A;  1QQI A;  5ED4 A;  4G7H F;  4Y3O A;  3N97 A;  2XV4 S;  2HYJ A;  2DTZ A;  2RQQ A;  3H5N A;  2DQL A;  2MH2 A;  4E7Z A;  2PMU A;  3E6D A;  2ETH A;  5AON A;  5ICE A;  2D5V A;  3N05 A;  1STZ A;  4W97 A;  1SD5 A;  4E70 A;  5IY5 H;  2M4G A;  3F21 A;  1YG2 A;  3VSK A;  1GVD A;  4CCO A;  4RDU A;  3IC7 A;  1ZK8 A;  4BL0 B;  1U3E M;  3RI4 A;  1FMV A;  3WU1 B;  5FLV A;  2KIS A;  1T2K A;  4EJU A;  1BC8 C;  1R1V A;  5JLX A;  1P92 A;  3CF2 A;  2DOA A;  3KP5 A;  4XSZ F;  2R5Z A;  3S1Q J;  3RIR A;  5CQG A;  1Z9C A;  3SZT A;  2NVX J;  3IH4 A;  4E7S A;  3JRI A;  4I6Z A;  2VKD A;  2BOL A;  2ZSH B;  4P9U A;  4AIH A;  1VQO I;  4A3B J;  9ANT A;  2TRT A;  5ICF A;  1T0F C;  3GZ5 A;  4AM3 A;  2XAF A;  1LB2 A;  3G1O A;  2FMY A;  1T33 A;  1YOV B;  3PUB A;  5DYM A;  4ZTF A;  1MBF A;  1KYW A;  1I1S A;  3D5R C;  3N4M A;  1KU2 A;  2M34 A;  1IO2 A;  1G3S A;  2DA6 A;  2CQX A;  3LQQ A;  2KDZ A;  4IL6 C;  2IAI A;  2KP6 A;  4G8X A;  3DWL E;  1EF4 A;  1ZR2 A;  3H5R A;  2CWE A;  2EZL A;  4O5V A;  3G3Z A;  1XS9 A;  2P0W A;  4IRI A;  1RC9 A;  3ZMV A;  3OYG A;  3S3M A;  5KVR A;  1RI7 A;  1X3W B;  2DFI A;  1X19 A;  2EZK A;  2VXZ A;  2R0Q C;  2K3P A;  2TDX A;  2W24 A;  4Y15 A;  4IO9 F;  4BS9 A;  1LDJ A;  2PBI A;  2QKL B;  3SDG A;  2YX7 A;  3EUK L;  3OYN A;  3CUQ A;  4ENJ A;  1I6X A;  4CCK A;  2DPD A;  5F1J A;  2VLA A;  3S17 J;  1YO5 C;  1LNW A;  4L0Y B;  1Y8R B;  1XGN A;  3HDD A;  3RPQ A;  2FBK A;  4DGW B;  1IW7 F;  5E3M A;  2CUJ A;  3HHH A;  3QWL A;  4U0W A;  5E3N A;  3MCZ A;  3W3C A;  5LLQ A;  4HNU A;  2H6C A;  4M73 A;  2K7L A;  1YIJ I;  2QZ8 A;  3Q0W A;  5JVT A;  3VDX A;  2NAZ A;  1PUF A;  4DOZ A;  4FTH A;  4DQ2 A;  2R7T A;  4MFD A;  2W00 A;  4F52 A;  3CC4 I;  2WAD A;  3DLL F;  3C2B A;  2RAE A;  2W82 A;  1Z67 A;  2R7W A;  1FX7 A;  3F72 A;  3TO6 A;  5F08 A;  4XKW A;  5ILV A;  3ERE D;  2M30 A;  4NQW B;  2FNA A;  4ON0 A;  4D5F A;  2PLY A;  3J80 Z;  5KK1 A;  2QLZ A;  5B66 C;  1FYL A;  1ZLJ A;  5D5X B;  4HSR A;  1J7K A;  2BVM A;  5D4R A;  3CJN A;  3VOD A;  2V6C A;  4LD5 A;  2Q8K A;  3F8B A;  2I8D A;  4BEH B;  2E60 A;  3HIF A;  4D5C A;  1W5T A;  2RKH A;  2CQN A;  2HQ5 A;  4UUV A;  1Z0X A;  3FF5 A;  3QOE A;  3M7G A;  4IZZ A;  5FO5 A;  3PFI A;  2IBD A;  3RPU D;  4AYB N;  4WCG A;  3DTE A;  4EM2 A;  2L7F P;  3GFJ A;  3IAM 2;  3S8P A;  2KRH A;  4A12 A;  2K9L A;  1GV5 A;  1KON A;  2GWR A;  2XGD A;  5FFX A;  2G9W A;  4ESB A;  2EBI A;  4XNF A;  1W0U A;  1H88 C;  3CLO A;  3I59 B;  1VQK I;  3D0S A;  5E1X A;  3ZGK A;  2VOO A;  3GYH X;  3K9T A;  1P9Q C;  4N0B A;  1Z6R A;  4A3I J;  4KIS A;  3W6V A;  2R92 J;  3BTC A;  4BJT A;  1QNT A;  2DAO A;  5K1Y A;  2WY7 Q;  2O5R A;  2Z99 A;  4XIC A;  4BDZ A;  1H0M A;  1TWF J;  4XRM A;  1BL0 A;  4JP0 A;  3AAF A;  2E71 A;  4B3A A;  3ZQ7 A;  5E3L A;  1J9I A;  1S7E A;  4ZYA A;  2EFW A;  3HBL A;  2LF7 A;  1QZY A;  4FCY A;  2HI3 A;  3GLL A;  4O6J A;  3O8H A;  2I5U A;  3O3K A;  2E1N A;  1B72 A;  4IHV A;  4PJN A;  3FMS A;  1G3T A;  4F7Z A;  2VOD A;  2OBP A;  4B1R A;  3SYT A;  3DEE A;  5TRD A;  1VQ6 I;  5B5E C;  2JSC A;  5FB2 A;  2VPR A;  2W57 A;  3JTH A;  2JVH A;  2DOE A;  1Z1D A;  2VC0 A;  1EV7 A;  5GAH J;  3GCM A;  3TOA A;  5KAF C;  3JSP A;  3I0T A;  3LA2 A;  4DBQ A;  2QQ9 A;  3SFZ A;  3IRR A;  1BOA A;  3ZQG A;  2M9H A;  2XUB A;  3H5A A;  3JRA A;  4HV5 A;  1MJA A;  3WHC A;  1HC8 A;  1I6H J;  3FKI J;  1XCB A;  5E18 F;  4M3F A;  4JK1 X;  4OMZ A;  2YSR A;  2JA5 J;  2GIZ A;  1ZRF A;  3FKJ A;  1N25 A;  4BY1 J;  1MD0 A;  1BR2 A;  4IQ4 A;  4A3J J;  3CCU I;  3CLQ A;  4J00 A;  1HKQ A;  4R1H A;  5J8F A;  4RAF A;  4LIV A;  3OIP A;  2BZT A;  1F43 A;  1YIT I;  1QGP A;  3Q0V A;  3H3V K;  1JTY A;  3L09 A;  3QQA A;  1JGS A;  5ILU A;  1UST A;  4IHW A;  2NVU B;  3TDZ C;  4KFC A;  3QYB A;  1XB4 A;  1GUU A;  1OIS A;  5CQE A;  5J1Y A;  1XMA A;  4GCV A;  5M5W J;  3SQN A;  1EA3 A;  2FBI A;  2PFB A;  2EIK H;  4DYC A;  3FK6 A;  3MQ0 A;  2X51 A;  1LE8 B;  4CCN A;  4XQF A;  1T95 A;  3U9G A;  3CP8 A;  1JUP A;  1JKR C;  4DYQ A;  3OV8 A;  4OIO F;  2ELH A;  4CYC B;  1NTC A;  4F55 A;  2BY1 A;  3CF5 F;  4LB5 A;  1ZRD A;  1UFM A;  4ZZD A;  3K4B A;  5HS8 A;  5EG0 A;  1SFX A;  1X1C A;  2BVL A;  2DJI A;  3WE2 A;  2FBH A;  3K10 A;  5D5W B;  2XAU A;  3BZK A;  4XLF A;  1MJB A;  4U0V A;  3BQZ A;  4M72 A;  2VQG A;  1P4W A;  5H6Q A;  5IYC J;  3Q9V A;  1RKW A;  3W6K B;  4Q48 A;  3BG9 A;  4M6X A;  2IXS A;  1BI3 A;  3I71 A;  3S2D J;  2R7S A;  4L9T A;  1HQC A;  1OQY A;  3WU2 C;  4RAG A;  3K4N A;  4XRF A;  3IV5 A;  1ENH A;  5FKM A;  2OQG A;  1MDM B;  1P6R A;  4UUS B;  2R5Z B;  1BW5 A;  1B9M A;  3OSF A;  3WTX C;  3QP6 A;  1ZYR F;  4P96 A;  4HF2 A;  3ONQ A;  4BXF A;  2OZ6 A;  2IPQ X;  3J80 K;  1Z3X A;  2O3F A;  2JA8 J;  3LSM A;  2CFX A;  2IA2 A;  3QPT A;  2F5D A;  2CRG A;  4YEL A;  2M7B A;  1K6Y A;  1YW7 A;  3A1Y A;  3RYP A;  3R0A A;  1DGR M;  5C4J J;  1ZGW A;  2L02 A;  1UG2 A;  4HYE A;  1H9G A;  3S2W A;  3HJE A;  1SEU A;  2BHZ A;  1OYI A;  5H20 A;  4LLN A;  1W1W E;  2A61 A;  1B8I A;  5IT9 Z;  3VSL A;  1U8R A;  4U0Y A;  2LLK A;  3OR2 C;  3OOP A;  1T39 A;  1IJW C;  1R23 A;  1ZTR A;  1WFX A;  2CO5 A;  2TCT A;  3QPS A;  1BJA A;  1FSH A;  1YX3 A;  4IPA A;  3BR0 A;  2A3S A;  5JR3 A;  5FKN A;  3NWT A;  1T8I A;  1IDZ A;  5IYD J;  2E2H J;  2R93 J;  1SD7 A;  2L01 A;  2R7X A;  3ZMU A;  2QWW A;  3PO2 J;  3U1K A;  5ICC A;  2VKE A;  5E1W A;  3LQR A;  1QBJ A;  4CZC A;  2F4O B;  3G73 A;  3KP2 A;  4D7M A;  2R7Z J;  2FD5 A;  4LIT A;  1VQM I;  1CQT A;  3AG3 H;  3MKZ A;  4PSX A;  4LMY A;  3EUH C;  2STW A;  3IH3 A;  4BYY A;  5FRM A;  5FRO A;  3KLO A;  4RB0 A;  3AL0 C;  5E8G A;  1OJL A;  2R7F A;  2EZI A;  4NUB A;  5CKT A;  3BDD A;  1K61 A;  4XLA A;  3PL8 A;  3O8G A;  5CVJ A;  2XRL A;  1UAA A;  3B73 A;  4C3J J;  3S14 J;  3M8J A;  5KCM A;  3KZZ A;  1D1C A;  3JR9 A;  2XB5 A;  3M9A A;  4HST A;  1T6S A;  3K69 A;  3V4G A;  4XOR A;  4ASN A;  1WPK A;  4CA0 A;  5IP6 A;  4AIJ A;  1HF0 A;  4NBQ A;  1RR7 A;  3JRH A;  1WSU A;  3FXJ A;  4OIP F;  5GPC A;  2X85 A;  5IP7 J;  2HTS A;  2NOJ B;  3WHB A;  3KET A;  3IWF A;  4C2U A;  2K3F A;  3F23 A;  2Y75 A;  2BYV E;  2ME0 A;  2OF7 A;  2RRE A;  2WAF A;  3FHZ A;  4UY8 I;  3I5U A;  3ZMD A;  4FAS D;  3E3V A;  2P7V B;  3FXO A;  1RKT A;  2DFH A;  5A2Q Z;  1O3T A;  5BNG A;  2XKO A;  3M8F A;  3MZ8 A;  1ACI A;  2KIF A;  4S05 A;  4OOI A;  3M8E A;  4U88 A;  2QQB A;  3LSP A;  2CJJ A;  3HL2 A;  4K2E A;  5FKK A;  4C30 A;  4FE4 A;  3T8T A;  3A0H C;  2MW8 A;  4BY7 J;  2MSY A;  3FXK A;  1UJ8 A;  1U5T C;  1ON2 A;  4RAY A;  2ME6 A;  5IOZ A;  1J0R A;  1Y1V J;  1YW8 A;  1LKX A;  2FML A;  2IS4 A;  2WAQ A;  3BPX A;  1NHA A;  3MKL A;  3V8K A;  2P6T A;  4RM2 A;  1RET A;  3CCV I;  4A69 C;  1LQ1 A;  4RLF A;  3R4K A;  2EQR A;  3S93 A;  1SMT A;  5DUK A;  4B8X A;  4NQW A;  5EJC A;  4A0Z A;  3CO6 C;  2JUC A;  2M4K A;  3SDB A;  4FET A;  1YYV A;  3W2A A;  4A6E A;  5M3F J;  4UV8 A;  4UB6 C;  4BJ6 C;  2M1B A;  4PJM A;  3SHF A;  3EUA A;  1RUO A;  4BEH A;  1V55 H;  2JRM A;  4XR6 A;  3A01 B;  3HB9 A;  2AXL A;  1TTY A;  1HXD A;  1R22 A;  2Y9Z A;  1S6L A;  2L7M P;  2DOF A;  4LK1 F;  4PFO A;  1ZH5 A;  2ZSI B;  4CCL A;  2K4B A;  1ZN2 A;  2P5V A;  3CC2 I;  1ZKG A;  2UXN A;  2E1M C;  3ISP A;  3VFZ A;  4YEJ A;  2BBY A;  4CDG A;  3HC7 A;  3OIQ A;  4S0H B;  1FTZ A;  3BR5 A;  4EEF G;  3I59 A;  2BHY A;  2HGC A;  5HLI A;  2DA2 A;  5D6F A;  1MND A;  1XX5 A;  1FOW A;  1IN8 A;  3QU3 A;  3QRF F;  1T98 A;  2Z9O A;  3QPH A;  2XGE A;  1MW7 A;  4L5E A;  2QM3 A;  2RGV A;  3TO9 A;  1DDN A;  2V9K A;  1BI2 A;  1MH4 A;  2X1C A;  1ITY A;  3DLA A;  4D7N A;  5CYV A;  1X4O A;  4G7O F;  1FZP B;  2ZJQ F;  4RM3 A;  3HG9 A;  1JJ6 C;  3V8J A;  3WG7 H;  1KQ8 A;  5E3O A;  3JRG A;  1X2N A;  4CUG A;  4A93 J;  2VE8 A;  4I02 A;  5E1Z B;  2HVQ A;  4XLP F;  1F4K A;  2LC2 A;  2MBF A;  1Q1H A;  2Y31 A;  3BR6 A;  3BLY A;  1C0W A;  1FBS A;  3ZQL A;  1AA7 A;  4LB6 B;  3OL3 A;  5IYB J;  1R36 A;  1D5V A;  2R5Y B;  3COA C;  1XC5 A;  2IT0 A;  3E7L A;  4E6K G;  3J7Y J;  1I1G A;  1UCR A;  1WI3 A;  2CH0 A;  3DBR B;  2EA2 A;  2DK5 A;  1P7I A;  1YJN I;  2QSF X;  1D3Y A;  1F5T A;  3ROU A;  4GDF A;  2LKP A;  1ZAO A;  2DCE A;  4ZH4 F;  4FT8 A;  1X3U A;  1UHS A;  2P5K A;  3GWZ A;  2IA0 A;  1U6G A;  4A0Y A;  5IT9 K;  3CZ6 A;  1DU0 A;  2COM A;  4RGX A;  4CHU A;  2DQR A;  5EF6 A;  2PJP A;  3AG4 H;  5L3F A;  3REO A;  3V42 A;  2M8E A;  3GEZ A;  2E7X A;  3HOU J;  1ZQ3 P;  3F6O A;  4FX4 A;  1RPW A;  3L2U A;  2BY0 A;  1YQA A;  5GP9 A;  2HQA A;  2ACJ A;  5EG0 B;  2LH9 A;  2M5W A;  3WGI A;  3TDU C;  2AHQ A;  1W4M A;  4BBS J;  1XGO A;  3H9J A;  3DPU A;  4J01 A;  3H9G A;  2F5C A;  2OUM A;  4ZYG A;  1D0Z A;  1VQL I;  3BP8 A;  1TW2 A;  3K2A A;  3UKG A;  2VIX A;  1H9T A;  1KGS A;  2V7F A;  3FXR A;  4NNJ A;  1JHH A;  2XDV A;  3F6V A;  3K2Z A;  1SFO J;  4QPQ A;  1LPQ A;  4KIB A;  1FP2 A;  1HSJ A;  3CUQ C;  1JKQ C;  3ML6 A;  3H1C A;  1LE8 A;  1TW3 A;  5E8I A;  5DCF A;  2DXI A;  3OSG A;  3M4O J;  2F4I A;  4EGY A;  3F22 A;  5JHU A;  1Y39 A;  1G2H A;  4BXX J;  3FIS A;  2RQP A;  1TT0 A;  1TQP A;  2L7Z A;  3SZP A;  2KL4 A;  2DT6 A;  4X6A J;  3V7R A;  1QVT A;  4AVP A;  5KHD A;  1K4S A;  1WJF A;  2DMN A;  1LDK B;  4M9X A;  1K79 A;  4EGZ A;  3FIW A;  1YIO A;  3J7A Y;  3LL7 A;  3ECH A;  2XSD C;  4MLO A;  1D1B A;  4E7H A;  2CGP A;  2HKO A;  5A2Q K;  1JGG A;  3E97 A;  1V5E A;  4B47 A;  3F8F A;  1HKT A;  3RYR A;  1TL8 A;  2EFQ A;  2ID6 A;  3IWZ A;  4ENN A;  2GIV A;  4XRS A;  1I5Z A;  3WGG A;  2RV8 A;  3KP6 A;  2MGQ A;  3B6C A;  3L2W A;  1VND A;  2R7R A;  1O3Q A;  1YLF A;  1SVM A;  2E35 A;  3E5X A;  2GBY A;  2HOS A;  2LYC A;  3U21 A;  3H3U A;  2KIQ A;  2KZG A;  2ECC A;  2L3D A;  4HLX A;  3X2Q H;  3ZMT A;  1B8I B;  3MAJ A;  1FPQ A;  1E2X A;  1QHG A;  1MDM A;  5HLG A;  1O7L A;  3M07 A;  4UUS A;  3FHN A;  5F27 A;  2PN6 A;  3KZY A;  2K5C A;  4N9I A;  4HF0 A;  1IRZ A;  1GVJ A;  4A3F J;  1O3S A;  1SAN A;  4PUS A;  5DUI A;  2E19 A;  2EK5 A;  2IEK A;  2A07 F;  1I3Q J;  3EQL F;  2V6E A;  5J47 A;  1ETX A;  4ZDL A;  4YIR X;  2MLK A;  5D6E A;  3DBH B;  2LY2 A;  3HGY A;  2KPM A;  5IT3 A;  2DI3 A;  3GME A;  2KKO A;  4CGZ A;  1IUY A;  3BWG A;  1Z6T A;  1QZZ A;  2EFP A;  2GLO A;  1K6O A;  2XB0 X;  1V54 H;  1USS A;  3DBL B;  5GAG J;  1JUS A;  2HZD A;  4BDY A;  3QAH A;  3CJQ B;  1WWX A;  2RDP A;  1BI0 A;  5BPI A;  4EJT A;  5LHH A;  4DYR A;  2EZH A;  1XMK A;  2G7H A;  3LMM A;  1P4X A;  3BG6 A;  4XLN F;  1OCR H;  4II3 A;  3SZG A;  4MO7 A;  2ZME C;  5DS9 A;  2OZU A;  2IS1 A;  2ZXI A;  5E20 A;  1X4P A;  3PSF A;  4CZZ A;  1DU6 A;  2V9V A;  2QYO A;  2WWY A;  2V26 A;  2IRF G;  1WVR A;  1R49 A;  2VJI A;  3BG7 A;  4CIC A;  1BI1 A;  2DYR H;  2O8X A;  2XIG A;  2L2O A;  4DNC A;  1RIO H;  4C2M J;  1E3P A;  3TGN A;  2VI6 A;  5J40 A;  4YFK F;  2K4J A;  3ZQI A;  1MBE A;  2YUS A;  2KHM A;  4PDK A;  1W7P D;  2DA1 A;  1J59 A;  4OIQ F;  2H8R A;  3GTJ J;  1P7J A;  4EAT A;  4WXD A;  1MNM C;  2CW7 A;  5BS6 A;  3T8R A;  4HA8 A;  5FLM J;  1R71 A;  5D8K B;  2DBB A;  1OCO H;  5D5U B;  1MJ9 A;  5LD2 C;  2KT0 A;  3WG9 A;  2QVO A;  2M45 A;  1UB9 A;  4BQN A;  2WC2 A;  3H3Z A;  3OS1 A;  4OMY A;  2E7W A;  4ZYE A;  2YR2 A;  3MMY B;  5HOO A;  3BC8 A;  2GXB A;  1D1A A;  4ZZL A;  1TQI A;  4A3G J;  5CVV A;  5K5R A;  2Y69 H;  3JCU C;  4ZDO A;  2FX0 A;  2GOM A;  4BGD A;  2XF6 A;  1VI0 A;  4G9Y A;  2R7D A;  1IZ1 A;  3LSG A;  3RQI A;  1AKH A;  4OIN F;  1V5G A;  2EJR A;  3M3Y J;  5CVI A;  2IGN A;  3ZN0 A;  2JMW A;  3OYM A;  2WB1 N;  1N78 A;  4EM0 B;  1XGS A;  4JQF A;  4PJL A;  4YFN F;  2Q0O A;  1UHW A;  5H6R A;  2G0E A;  4Z2Y A;  3I9V 2;  2MAB A;  2M3A A;  4ZYH A;  3CME I;  3I56 I;  2V1D A;  1YI2 I;  2R7U A;  2LKS A;  3ZXS A;  5K5O A;  1ODD A;  1BM9 A;  1WKM A;  1SAX A;  3T0Y A;  1FOK A;  5DDG A;  2R3S A;  1FOX A;  2JT1 A;  4J19 A;  3JAM Z;  3A01 A;  2HEO A;  3OYD A;  2NS7 A;  3FXL A;  3HZJ A;  5C3E J;  2DMP A;  3DEU A;  3CCL I;  3S1N J;  4UB8 C;  4QIW N;  2CUZ A;  4EV0 A;  2IW5 A;  3CCY A;  3L2V A;  3ASN H;  3J81 Z;  2FQ4 A;  1KU9 A;  1R4M B;  2DDB A;  2MLG A;  2PG4 A;  2X4H A;  1QO0 D;  1KQ9 A;  4LG0 B;  4RBO A;  3U1D A;  1CGP A;  4F3Q A;  3KFW X;  3AKZ A;  3FBI B;  2H27 A;  3AG1 H;  3OS0 A;  3GXO A;  4MEY F;  2LFB A;  1BR4 A;  1B59 A;  3G4S I;  3L2R A;  3O2P E;  3FMQ A;  1WJA A;  2RC4 A;  2OCC H;  2NRA C;  1U8B A;  3VYR B;  4KJZ A;  1SD4 A;  1ETQ A;  4L5I A;  2LY1 A;  3VPR A;  2XAS A;  4D9J A;  1VQ9 I;  1XTA A;  1BIB A;  3LFU A;  2O6G E;  2VKV A;  4BU2 A;  2B63 J;  4XM3 A;  1NG7 A;  1R58 A;  2D2W A;  3GZN B;  1FP1 D;  4RS8 A;  2L7K A;  1G3W A;  3L1P A;  4AYB A;  1VFC A;  2EIJ H;  4FQG A;  3CCR I;  1V3F A;  4AD9 A;  5F0H A;  2XF7 A;  2F5E A;  3DKW A;  3WTS C;  2R7O A;  4C9Y A;  5ICG A;  2R5Y A;  3RKY A;  1WQ2 A;  1KYZ A;  2Y30 A;  3G1L A;  3HHG A;  3HOS A;  2B9S A;  1U5T B;  5F64 A;  4X0G A;  1SD6 A;  3HKZ N;  2J5O A;  3OWT A;  3GO5 A;  2LBF B;  2IA1 A;  1DPR A;  3CES A;  1S8N A;  4QSH A;  1GDT A;  5F0F A;  2LD5 A;  2ICW G;  2K9M A;  5DD8 A;  2OTL I;  4ENK A;  1VQP I;  4GYG A;  2OD5 A;  1U9N A;  1V4R A;  2OQR A;  3FMR A;  2V9P A;  1NK3 P;  5BQT A;  1IG7 A;  4IQJ A;  1WI9 A;  3OOU A;  1HST A;  2KMU A;  3TKY A;  4YFX F;  4EJV A;  4CSW A;  1JJ8 C;  3WTW C;  3OYJ A;  3V7C A;  5EEA A;  2KFD A;  4XLH A;  2LVS A;  3ERM A;  3GTQ J;  3GBG A;  1E3O C;  1F9N A;  3F8N A;  3IP4 B;  1TNS A;  3HM5 A;  3R60 A;  3CCE I;  4IOA F;  3H0D A;  3H9Q A;  2PQ8 A;  2QQA A;  5HNH A;  1R5H A;  1FYM A;  2X6W A;  2PMZ A;  2VQC A;  2IS2 A;  2L54 A;  3SFI A;  4I0B A;  2HYG D;  1I27 A;  4MNU A;  3OS2 A;  1ETK A;  2ZFW A;  1OCC H;  2G7U A;  2EWN A;  3KP4 A;  3QU6 A;  1K7A A;  4XKB A;  3CMA I;  1FMW A;  2QA4 I;  3C2H A;  2HS5 A;  1APL C;  2UUZ A;  2ZB9 A;  4BBR J;  1SFE A;  1XD7 A;  2XAG A;  2ZKZ A;  4L9V A;  3RKX A;  1VQ8 I;  1IAW A;  4Y17 A;  3KX2 A;  2F48 A;  2IVM A;  2MC4 A;  2ZJ2 A;  1TWA J;  3BR3 A;  4GFB A;  4KIT B;  4QLC U;  4A3E J;  2X48 A;  4OIR F;  1L3L A;  2EIL H;  1O57 A;  1IDY A;  3P9I A;  3Q0U A;  2GXA A;  1XDU A;  1VQ7 I;  4XOP A;  1MIJ A;  3KIO A;  5FD6 A;  2Y0S N;  3NAU A;  1D5Y A;  5F1R A;  3BTI A;  3OMY A;  4NB5 A;  5KNL A;  5HVQ C;  2XAQ A;  3KCC A;  1IUF A;  2JK3 A;  3BOQ A;  3ZQF A;  4C2T A;  1PVE A;  1OFC X;  5E79 C;  3DU6 A;  2XKP A;  1MBG A;  5TIS C;  2CG4 A;  4DZJ A;  2XPU A;  1S9H A;  1A6Q A;  4HAM A;  6PAX A;  3A2K A;  3BJA A;  1WJ5 A;  1OR7 C;  3OYA A;  2YX4 A;  1YHQ I;  2L9R A;  3HEF A;  3BJ6 A;  4JX5 A;  1TQM A;  2KJB A;  3CDI A;  4HG2 A;  2ESN A;  2LRD A;  4R79 A;  4IRH A;  2HDW A;  3CJR B;  2ELJ A;  5LFA A;  5GAD J;  3TL4 X;  3MN2 A;  2XSJ C;  2E2J J;  1DP3 A;  4AU7 A;  2HPM A;  3WU0 A;  5CLS A;  2P81 A;  2HNH A;  3GTO J;  4A3D J;  1QU3 A;  2DA5 A;  2EB7 A;  3F9K A;  3JTG A;  3D1N I;  2O8K A;  2JRT A;  2QCO A;  2NVQ J;  5LGU A;  3JAM K;  3BY6 A;  4HEA 2;  4F91 B;  3G71 I;  1H8A C;  1NH3 A;  1KA8 A;  3L00 A;  4V2F A;  1YJ9 I;  2Q2E B;  4OAZ A;  5IOY A;  4XN0 A;  2RVC A;  1ZRC A;  1X58 A;  3J81 K;  1OYY A;  1W36 D;  5J6X A;  5K5Q A;  5CJ9 A;  3I58 A;  1IRF A;  2DMU A;  4I76 A;  1MH3 A;  1S72 I;  3B02 A;  2HDC A;  3LNQ A;  2DMT A;  2WV1 A;  5FFZ A;  4CO8 A;  4IX7 A;  4UXN A;  5EGO A;  3S32 A;  1XMX A;  4PJ0 C;  1CF7 A;  3ULQ B;  2FSW A;  1ETV A;  1R7J A;  4ESF A;  4FIS A;  2KIM A;  4KT5 C;  3IRQ A;  3GFL A;  2JTV A;  3CJT B;  4N4O B;  1MBK A;  2DFE A;  1WCM J;  2V79 A;  1ZG5 A;  3AFH A;  4M9Z A;  4NDL A;  3T5X A;  1IN7 A;  1BBY A;  2DLL A;  2JPB A;  2MFZ A;  2X6O A;  5DTD A;  1TP4 A;  4G94 A;  1OYW A;  2RNJ A;  2FEZ A;  5FKL A;  3MEX A;  1IV6 A;  2EV6 A;  4V2G A;  2B7E A;  3RQ4 A;  3TBI A;  3DEW A;  3GUD A;  4RA2 A;  2OC6 A;  3WE3 A;  3KEQ A;  3H35 A;  2BY2 A;  4DIQ A;  1AKH B;  3DKX A;  4KDP A;  3K1M A;  2A6E F;  3PNY A;  1T08 B;  3K70 D;  3CD6 I;  4I98 B;  2LTP A;  3BT9 A;  3C3W A;  2ZCW A;  3WTV C;  5GAE J;  3KP3 A;  3ELK A;  3KEY A;  3HOT A;  2PI0 A;  3HPH A;  1OMI A;  3JRB A;  4JOM A;  1JXS A;  2ADU A;  2CV2 A;  4HOB A;  3R0J A;  3RZD J;  4GO1 A;  3S3O A;  1JT6 A;  1S29 A;  1UEL B;  2ELK A;  3LSJ A;  2HXI A;  1K78 B;  2EA4 A;  3EYI A;  2M0C A;  5GTH C;  2BV6 A;  4GRI A;  4MQ9 F;  5JVG F;  1SFU A;  1LUJ B;  4LLL A;  1R1U A;  2A5Y B;  3F8M A;  3JRC A;  1BC7 C;  3EDP A;  1DUX C;  3S1M J;  2OJE D;  2VT3 A;  3ABM H;  3UNG C;  5H2F C;  1V5F A;  2A6T A;  2WY8 Q;  2L5Q A;  2EFO A;  3HSE A;  2QF7 A;  4BQO A;  1OCT C;  1GHC A;  1QPM A;  1M1E B;  1LFB A;  4WF2 A;  3ZCO A;  3O6B B;  4CH7 A;  3HTS B;  4I01 A;  3R6S A;  2HZT A;  2VBX A;  2FF4 A;  4BE0 A;  3HSF A;  1ZRE A;  4KIC A;  3RDI A;  2GXG A;  2OV7 A;  4EQQ A;  2ZJR F;  3TW6 A;  5BMZ A;  4XRS G;  2E34 A;  4MQV A;  2FRH A;  4CCJ A;  1YS6 A;  1JHF A;  2LP0 A;  3UR3 C;  4RB1 A;  1YRN B;  3GF2 A;  4BKX A;  5C4X J;  3TP3 A;  1OLT A;  1RZ4 A;  3QYE A;  5J4Y A;  3L9F A;  5M5Y J;  3CUO A;  4JBA A;  1P4A A;  1X2M A;  2KZV A;  2AQF A;  3WGH A;  1GXQ A;  2MYS A;  3HPG A;  2AS5 F;  3QOP A;  3EUH A;  2FQ3 A;  1NG6 A;  4MTE A;  5LHI A;  3KYC B;  4A3L J;  1TNT A;  2OU2 A;  4LG0 A;  2NNN A;  4EJW A;  2UV1 A;  2ECB A;  2HOT A;  2FE3 A;  2X0L A;  3HRS A;  5F04 A;  1IN5 A;  4A5M A;  4HV6 A;  4JX4 A;  3I55 I;  2XGX A;  1GT0 C;  3OR1 C;  1TWG J;  2X6Y A;  4Y7N J;  2XC7 A;  2XPV A;  2EH3 A;  1MMG A;  3W6J B;  5IPA A;  5L3C A;  4IHT A;  1LDD A;  3GW2 A;  1HLV A;  2OPT A;  2M8G X;  4AIK A;  2LRE A;  4E7J A;  4XL9 A;  1UZC A;  2HQN A;  3ZMZ A;  4B3X A;  4M71 A;  2IGK A;  1IXS B;  1Z3Y A;  2FOW A;  3DQV C;  1DGW Y;  2Y2Z A;  1IRG A;  3VEP A;  1FWZ A;  2PX9 A;  4G6T B;  3KLN A;  3K4K A;  1HCR A;  1GLN A;  1WJE A;  3IUO A;  2DK8 A;  4XK4 A;  3I4N J;  1YX5 A;  1X1D A;  1FY7 A;  1JI8 A;  4PSW A;  2NXN B;  3EYY A;  2DA4 A;  2JQ7 A;  2LKX A;  1Z7U A;  2M87 A;  1QVU A;  4ITV A;  3F3X A;  4I99 C;  1ZG3 A;  4HX7 A;  1U5T A;  3Q5F A;  1WJC A;  3FDY A;  4E7K A;  4RMN A;  4OU0 A;  1AWC A;  5F6F A;  2LBF A;  2CW0 F;  3RCO A;  2YPR A;  2ZXW H;  2NS8 A;  3GX4 X;  1ETY A;  2X1E A;  5J4V A;  2XPW A;  4MIM A;  1HW2 A;  1QA6 A;  2P7C B;  3E0J B;  2DN0 A;  1WHU A;  4IEJ A;  2M2E A;  1ONV A;  1U9O A;  2CYY A;  2YS9 A;  3P9C A;  2ZNZ A;  1MKM A;  1XDS A;  4H0E A;  4GXO A;  1PDN C;  4M3G A;  1W36 C;  2LF8 A;  2IS6 A;  5C44 J;  1XG1 A;  2JWT A;  4ZC3 A;  5HLH A;  2HR3 A;  1HBX G;  3IKT A;  2L4M A;  3ZN1 A;  3JRD A;  2FUG 2;  3NEU A;  3S3N A;  3LAP A;  4KMU X;  1R5G A;  4O3M A;  4X1E A;  3IKV A;  1Z05 A;  2OA4 A;  3BG3 A;  4NHJ A;  2DPU A;  3OYK A;  4XID A;  2O03 A;  2QEX I;  2QBY B;  4BJ5 C;  5EYR A;  1J2X A;  3W2W A;  2P8T A;  2Z1D A;  4G6D A;  4HQE A;  2MD5 A;  2UWM A;  2FXA A;  4V19 K;  5D4S A;  1B1B A;  2OCE A;  5L3G A;  5D8L B;  5D5V B;  3S15 J;  5KAI C;  5LRR A;  1E0E A;  4AWX B;  1YTY A;  2Z33 A;  2ZXH A;  1DQU A;  5FKO A;  5LEJ A;  1FT9 A;  2HKX A;  4KT6 A;  4DW6 A;  4KN7 X;  4B09 A;  5CVU A;  3GTK J;  2LOO A;  1VQN I;  1PP7 U;  4ETS A;  3OIO A;  1ORK A;  1R5I D;  1YJW I;  3LAJ A;  4YIF A;  3I54 A;  4BH9 A;  3WTU C;  3K70 C;  3K7A J;  2Y0M A;  2IGM A;  2H1K A;  4S04 A;  4E7I A;  4UV9 A;  4BHB A;  3LSH A;  4BE1 A;  4AC0 A;  3M1E A;  4L18 B;  4WXH A;  1MMD A;  3MFK A;  4RLQ A;  5JLW A;  2GQQ A;  3DU5 A;  1J5Y A;  1A5J A;  1FEX A;  1W5C C;  2LDU A;  3FWE A;  3BZC A;  3HOY J;  1HW1 A;  2VBZ A;  5M5X J;  2JA7 J;  2QEN A;  2DJN A;  2MA3 A;  3C1D A;  2E36 A;  1FIA A;  4G12 A;  4PZJ A;  2XRO A;  2BGC A;  2NNY A;  4QWQ A;  3BG5 A;  3TMO A;  1I39 A;  3BRO A;  5HDK A;  4HLY A;  2E1O A;  1LFP A;  3ZP5 A;  3GTG J;  1KZH A;  2ZFU A;  4AUX A;  1LFU P;  5J1U A;  1Z77 A;  1FBU A;  2IP2 A;  3HOW J;  5EZH A;  2AXT C;  1X1B A;  3A0B C;  3FK7 A;  5EGO B;  2FOK A;  5EDN A;  1Z91 A;  2EIN H;  1CF7 B;  1Y0N A;  3GLX A;  3FZV A;  1MNE A;  2KRC A;  3OYL A;  2QQ8 A;  3BCB A;  2PEX A;  1BJZ A;  4N4N B;  2ZJP F;  5LBQ A;  2E5N A;  2ZNY A;  3P5J A;  3KE2 A;  1WH5 A;  1A31 A;  4R8H A;  1XN7 A;  1N75 A;  2NS0 A;  3HOX J;  2CQK A;  4XLE A;  5DV5 A;  3WTT C;  1G4D A;  2FU4 A;  3KPH A;  4MFE A;  4PGG A;  4BQQ A;  2Q2E A;  2LK2 A;  4LLG F;  3AG2 H;  3W2V A;  3LWF A;  2QUF A;  4AVZ A;  3HOZ J;  4LIU A;  1ETO A;  4DBR A;  2KLO A;  1YFH A;  2RN7 A;  3RZO J;  5F0C A;  5IP9 J;  3MZY A;  2LY9 A;  1JUM A;  1ZLK A;  4IKF A;  1ULY A;  4Q47 A;  3FXQ A;  2HVS A;  2EV0 A;  5DCM B;  1N77 A;  3OYE A;  3CCJ I;  4Y13 A;  2HPI A;  2O7O A;  1BW6 A;  4L0Z B;  4WK8 F;  2Z5U A;  2HU9 A;  3KYL A;  1MBJ A;  4D0P A;  4CYD A;  2VQL A;  4ABZ A;  1KU7 A;  1W7P B;  2NVY J;  2PJR B;  3G1M A;  2P4W A;  3LA3 A;  2CUE A;  4IHS A;  4LJZ F;  3HUG A;  4I0A A;  3PNV A;  1ZGA A;  2CUF A;  4HBL A;  1ZAR A;  5HS9 A;  1P2F A;  1IXR C;  3G2B A;  1TWH J;  2K85 A;  3DFG A;  2L0K A;  2P6S A;  4PJJ A;  2W25 A;  4UNO A;  2ZO4 A;  2VKH A;  1WJB A;  4EVI A;  1D0X A;  4U7B A;  4P5O A;  2W7N A;  4II2 A;  1MZB A;  4XOT A;  1T38 A;  2I10 A;  3LSI A;  1OCP A;  3QP5 A;  2Y9Y A;  4IHX A;  1K83 J;  2CMP A;  3E6C C;  1G3Y A;  3PJR A;  1IF1 A;  3C7J A;  2FNP A;  4RGR A;  3RKW A;  5B1A H;  2VN2 A;  2LG4 A;  4QPO A;  3U2R A;  4G7Z F;  2NYX A;  1YE9 A;  4B44 A;  5GPA A;  2Z3Y A;  3K4C A;  2IGO A;  1PP8 F;  5K7H A;  3OYH A;  3CP2 A;  4BUP A;  1UMQ A;  1K78 A;  1F36 A;  1EH6 A;  4XLC A;  2VBY A;  1LEA A;  4M3D A;  3PUF A;  1SFK A;  2K27 A;  1T0F A;  4G6Q A;  2E5Z A;  5HDN A;  5HNF A;  2DT5 A;  1YS7 A;  3OYI A;  2GOX B;  2OTJ I;  1FIP A;  2KDO A;  2M0M A;  1PYV A;  4M3E A;  1JT0 A;  5JFR A;  5FD5 A;  1EKE A;  3AL0 B;  2F2E A;  1ERD A;  1DPU A;  4HF1 A;  3G6E I;  4XSX F;  3OL4 A;  4M9S A;  4U87 A;  3OYB A;  2CS3 A;  2GAU A;  4EM1 A;  1RES A;  1Y8Q B;  2NVT J;  5K7F A;  1X3Z B;  1A36 A;  2ESH A;  4A5N A;  1YRN A;  3VYU B;  2ZC2 A;  2X1D A;  1AU7 A;  2DFF A;  1Z7L A;  1A35 A;  3OYC A;  3QYF A;  3M1C A;  3H92 A;  2CV0 A;  2ZME A;  4Q5S F;  4LG3 A;  3EET A;  1ON1 A;  2K9S A;  2GZW A;  5JHF A;  1POG A;  4B4C A;  3F8C A;  2XAH A;  3CC7 I;  3GFM A;  1R00 A;  3FBN B;  4OAY A;  2VL8 A;  1G8X A;  2H8W A;  3CCQ I;  1FSE A;  1JKP C;  1JTX A;  2V1N A;  4LK0 F;  3K4M A;  1K4T A;  1T56 A;  3NWS A;  3VOE A;  1EH8 A;  2WB1 A;  3BR1 A;  2OAZ A;  3GFI A;  3TED A;  4LGW A;  3WOD F;  5HOD A;  4AID A;  2PMZ N;  3ZOB A;  1LVK A;  3PFY A;  2UZK A;  2E2I J;  1KQ0 A;  2QGU A;  3E5U A;  2F5V A;  3K6G A;  4FX0 A;  5LHG A;  5J1R A;  3GTP J;  3LOC A;  2BXZ A;  1JKO C;  2VQH A;  2W85 A;  2W48 A;  4HX8 A;  4JX6 A;  4HDU A;  1I50 J;  3H0G J;  2AO9 A;  4RB3 C;  4KA4 A;  2STT A;  1OCZ H;  2GA2 A;  2F6C A;  4RB2 C;  2EV5 A;  2CFO A;  2K9Q A;  4KMF A;  1SVO A;  1W5S A;  3NQO A;  5LRS A;  4IOC F;  1FLI A;  4OWR B;  4A0X A;  2L9V A;  3PNT A;  5J3L A;  4L5J A;  2D45 A;  4YG2 F;  1EH7 A;  2JJ7 A;  5E17 F;  1Y56 A;  3K0L A;  3CTA A;  3FX3 A;  1GXP A;  1WRJ A;  1X1A A;  2BW3 B;  3HXL A;  5EEG A;  4MTD A;  3FM3 A;  1MBH A;  4UVA A;  4U7D A;  3ZQH A;  4ZTJ A;  1MMN A;  1ZG1 A;  2H94 A;  4HNT A;  1AOY A;  4UVB A;  3GTL J;  1R9T J;  4FHT A;  1FYK A;  2HXO A;  2W84 A;  5J8C A;  1FOY A;  2E1M B;  1HA8 A;  1LEB A;  3DTK A;  3E6M A;  3KYD B;  1O4X A;  1IRX A;  4I09 A;  1AHD P;  4JYK A;  1KU3 A;  2GM4 A;  2QSG X;  5B1B H;  1HW5 A;  1RUN A;  4BNC A;  2JA6 J;  3L2C A;  1FTT A;  3HGG A;  3GZ6 A;  4PGH A;  1Z21 A;  3BCA A;  4WWC A;  3CMY A;  3BJO A;  2O61 A;  1GV2 A;  2NOG A;  3E6B A;  3D5L A;  3ZR8 X;  3CQZ J;  2DT7 B;  1RNL A;  3OYF A;  1W0T A;  3I4M J;  2PMH A;  4B43 A;  2E1C A;  2HVR A;  2QBY A;  4NC6 A;  2N8G A;  3ABT A;  4RGU A;  2R4G A;  1L0O C;  2QSH X;  3JW4 A;  3HKZ A;  1A04 A;  1O3R A;  2KJC A;  2MH9 A;  4XKV A;  4KIF A;  4CCM A;  3PQK A;  3HOV J;  1TWC J;  4WX9 A;  3ASO H;  2CQ7 A;  3C2G A;  1IGN A;  5CVR A;  2V4J C;  1Y0U A;  2GA1 A;  5L3D A;  3CCS I;  4IRG A;  4EMS A;  3A4C A;  3OY9 A;  4BAC A;  1I3A A;  4KUM A;  2MG4 A;  4HDV A;  1D8K A;  4C3I J;  4HZF A;  2F5F A;  1S7A A;  1G59 A;  2LNB A;  2Y48 A;  1VF9 A;  4DJA A;  4IHY A;  3DXJ F;  3JRE A;  3CO7 C;  3GVA A;  4A3K J;  1UG0 A;  3HYI A;  1VTN C;  5FGM A;  5FLX Z;  1IV8 A;  2O9L A;  2EIM H;  4Y33 A;  2O0Y A;  3P9K A;  1F1Z A;  3K1P A;  3NRV A;  3DV8 A;  1E17 A;  5TJJ A;  4PFP A;  2CV1 A;  1XSV A;  1RR8 C;  2EFN A;  5ERI A;  2VJ4 A;  2DA7 A;  4XBF A;  3SEQ A;  1QPI A;  1XGM A;  5AIP A;  2AQE A;  4A3C J;  2LR8 A;  2VJJ A;  3VYS B;  2JPC A;  4L9J A;  1QRY A;  3Q3S A;  4TV7 A;  3I4P A;  3RTR A;  5DM7 F;  2DO7 A;  2LSO A;  3ESW B;  4A6D A;  4F92 B;  3P7N A;  2BY3 A;  2HWV A;  3S2H J;  5HS7 A;  3I3L A;  3PQJ A;  2WAQ N;  3PM1 A;  4ZYD A;  4UVC A;  2KQR A;  3LFK A;  2VC1 A;  5LGN A;  2UXX A;  3MZH A;  4KN4 X;  3I64 A;  4BHC A;  2XAJ A;  1YW9 A;  3IHU A;  1HDP A;  1VZ0 A;  3JRF A;  1PJR A;  4F93 B;  2L4A A;  1S3J A;  2Y0S A;  4E7L A;  3CUQ B;  3PO3 J;  3QPL A;  4NC8 A;  3F0C A;  1U78 A;  2MC3 A;  1IXC A;  2DA3 A;  1X1P A;  4PCQ A;  2HOE A;  4KNY A;  4RAZ A;  4FE7 A;  3HUG B;  3LSR A;  4H4K C;  2A68 F;  2W1O A;  2BEO A;  3H36 A;  3DPT A;  1B6A A;  5JI6 A;  2F4M B;  4M3B A;  4BAY A;  3DF8 A;  3ZMS A;  4B48 A;  1JE8 A;  2ZBK A;  2WAE A;  1PUF B;  4HX4 A;  3BTL A;  3TO7 A;  4DZP A;  4XKC A;  2A6H F;  3E1S A;  5K7Z A;  2VE9 A;  4M6V A;  2D1H A;  1TT5 B;  2RNG A;  3CMM A;  4XON A;  3CCM I;  1HOM A;  4P9F A;  5DCM A;  5HDG A;  3V7S A;  2DDA A;  2EPF A;  1A6I A;  4XMY A;  4BXU A;  2CQQ A;  4P55 A;  1ZHF A;  2Q1Z B;  4CXF A;  3QOD A;  1W7P A;  5AIQ A;  3BZ6 A;  4ENM A;  2PJR A;  2MD0 A;  2VT2 A;  3VB2 A;  3WTY C;  3K4L A;  3EPZ A;  3R61 A;  4L9N A;  2DTR A;  3IAS 2;  2W4S A;  1FNN A;  4HNV A;  1RRJ A;  3KEO A;  1ZEL A;  2KIU A;  5EEH A;  4MHG A;  2IJL A;  3T1B A;  3VYT B;  4Y4R A;  5DEQ A;  3ZQC A;  3C18 A;  3ABK H;  4IVN A;  2JSP A;  5LEK A;  2YU3 A;  1R1T A;  1MSF C;  2DMQ A;  2HOA A;  2Z16 A;  4P1W A;  4UUT A;  1VQ4 I;  1U0J A;  1E3H A;  3HRT A;  4D1Q A;  3BPV A;  4ZJZ A;  3ZPL A;  5DD4 A;  3E5Q A;  2J5P A;  2K9N A;  4WXC A;  4LOC A;  5BOX A;  2JUG A;  1BR1 A;  2L9S A;  4Z6Y A;  1QZE A;  4HW0 A;  4RGS A;  1OR7 A;  1VQ5 I;  3HRU A;  3D5S C;  1SC7 A;  4HRI A;  1WGX A; 
#chains in the Genus database with same CATH homology
 2B0L A;  4HQM A;  1ZGJ A;  2VON A;  2ISY A;  1LVA A;  3KP7 A;  3RPU A;  1FC3 A;  3CDH A;  3DP7 A;  1S7O A;  1PUE E;  3LST A;  4M6Y A;  2ZME B;  2K02 A;  3LA7 A;  2HTJ A;  1OPC A;  2BE5 F;  1IN6 A;  4EJO A;  2HQR A;  4IJA A;  2WTE A;  5LGT A;  2WV0 A;  4GYI A;  3TOB A;  3ABU A;  2D1V A;  2XRN A;  3WTZ A;  1O7F A;  4I7H A;  2DW4 A;  3TQN A;  2C6Y A;  1DP7 P;  3MWM A;  1MGT A;  3DPL C;  2A69 F;  1U2W A;  3FM5 A;  3I53 A;  4A2U A;  2XVC A;  4IF4 A;  2HFH A;  1FBQ A;  1OKR A;  1LJ9 A;  1SMY F;  4YII A;  5BPD A;  2ZXJ A;  4LFU A;  4BQA A;  5L3B A;  5FLX K;  1XCV A;  4KIG A;  4M74 A;  4IXA A;  3J7A O;  1BN5 A;  2XHK A;  4Q4Z F;  4UHT A;  2K86 A;  3V8L A;  4I2O A;  2DU9 A;  3IL2 A;  4ESJ A;  1XSX A;  4MEX F;  4BHP A;  3SXY A;  5ILS A;  2FA5 A;  3HSR A;  2ISZ A;  2V1U A;  4KYW A;  1HKS A;  3L7W A;  3Q9S A;  2HYF A;  1IN4 A;  2CSO A;  2V1X A;  4N9H A;  1XSD A;  1D8J A;  1TLH B;  2KRF A;  3JSO A;  3HTU A;  2P5L C;  1TBX A;  2H09 A;  3K1N A;  1J75 A;  4MGR A;  4GGG A;  1G6N A;  3RJP A;  5L3E A;  2JZY A;  1B4A A;  1B9N A;  3HRM A;  3ECO A;  2VBW A;  3FXU A;  2VOP A;  1BIA A;  1UHM A;  1REP C;  2H6B A;  1QQI A;  5ED4 A;  4G7H F;  3N97 A;  2XV4 S;  2DQL A;  2MH2 A;  2PMU A;  3E6D A;  2ETH A;  5AON A;  5ICE A;  1STZ A;  1SD5 A;  4E70 A;  3F21 A;  1YG2 A;  3IC7 A;  1U3E M;  3RI4 A;  3WU1 B;  1T2K A;  4EJU A;  1BC8 C;  1R1V A;  1P92 A;  3KP5 A;  4XSZ F;  3RIR A;  1Z9C A;  3SZT A;  4P9U A;  4AIH A;  5ICF A;  3GZ5 A;  2XAF A;  1LB2 A;  2FMY A;  5DYM A;  1KYW A;  1I1S A;  3N4M A;  1KU2 A;  1G3S A;  3LQQ A;  4G8X A;  2CWE A;  4O5V A;  3G3Z A;  4IRI A;  3ZMV A;  5KVR A;  1RI7 A;  2DFI A;  2VXZ A;  2TDX A;  2W24 A;  4Y15 A;  1LDJ A;  2PBI A;  2YX7 A;  3CUQ A;  4ENJ A;  1I6X A;  2DPD A;  1YO5 C;  1LNW A;  4L0Y B;  1XGN A;  3RPQ A;  2FBK A;  1IW7 F;  3HHH A;  4U0W A;  3MCZ A;  5LLQ A;  2H6C A;  4M73 A;  2K7L A;  2QZ8 A;  5JVT A;  2NAZ A;  4DQ2 A;  1FX7 A;  3F72 A;  3TO6 A;  5ILV A;  3ERE D;  2M30 A;  2FNA A;  4ON0 A;  2PLY A;  3J80 Z;  5KK1 A;  2QLZ A;  1FYL A;  1ZLJ A;  5D5X B;  5D4R A;  1J7K A;  3CJN A;  3VOD A;  2V6C A;  4LD5 A;  2Q8K A;  3F8B A;  3HIF A;  1W5T A;  2RKH A;  4UUV A;  3FF5 A;  3M7G A;  5FO5 A;  3PFI A;  4WCG A;  4EM2 A;  3GFJ A;  4A12 A;  2GWR A;  5FFX A;  2G9W A;  4ESB A;  3CLO A;  3I59 B;  3D0S A;  5E1X A;  2VOO A;  3GYH X;  3K9T A;  4N0B A;  1Z6R A;  5K1Y A;  1QNT A;  2DAO A;  2Z99 A;  1H0M A;  3AAF A;  3ZQ7 A;  1J9I A;  2EFW A;  2LF7 A;  1QZY A;  4O6J A;  3O3K A;  2E1N A;  3FMS A;  1G3T A;  4F7Z A;  2VOD A;  2OBP A;  5TRD A;  2JSC A;  5FB2 A;  2W57 A;  3JTH A;  1Z1D A;  2VC0 A;  1EV7 A;  3TOA A;  3JSP A;  3I0T A;  3LA2 A;  2QQ9 A;  3SFZ A;  3IRR A;  1BOA A;  2XUB A;  4HV5 A;  1MJA A;  1XCB A;  5E18 F;  4JK1 X;  4OMZ A;  2YSR A;  1ZRF A;  1MD0 A;  1HKQ A;  4R1H A;  5J8F A;  1QGP A;  3L09 A;  1JGS A;  5ILU A;  1UST A;  3TDZ C;  4KFC A;  1XB4 A;  1XMA A;  4GCV A;  3SQN A;  2FBI A;  2PFB A;  3MQ0 A;  3U9G A;  3OV8 A;  4OIO F;  2ELH A;  4LB5 A;  1ZRD A;  1UFM A;  4ZZD A;  5HS8 A;  1SFX A;  3WE2 A;  2FBH A;  5D5W B;  1MJB A;  4U0V A;  4M72 A;  1P4W A;  5H6Q A;  3Q9V A;  3W6K B;  4Q48 A;  4M6X A;  1BI3 A;  3I71 A;  4L9T A;  1HQC A;  4XRF A;  2OQG A;  1MDM B;  1P6R A;  1B9M A;  3WTX C;  3QP6 A;  1ZYR F;  4P96 A;  4HF2 A;  2OZ6 A;  2IPQ X;  3J80 K;  2O3F A;  2CFX A;  2IA2 A;  3QPT A;  2F5D A;  1YW7 A;  3RYP A;  3R0A A;  2L02 A;  4HYE A;  1H9G A;  3S2W A;  1OYI A;  5H20 A;  4LLN A;  2A61 A;  5IT9 Z;  1U8R A;  4U0Y A;  3OOP A;  1T39 A;  1R23 A;  2CO5 A;  1FSH A;  1BJA A;  4IPA A;  2A3S A;  5JR3 A;  1SD7 A;  2L01 A;  3ZMU A;  2QWW A;  5ICC A;  5E1W A;  3LQR A;  1QBJ A;  3G73 A;  3KP2 A;  4LMY A;  2STW A;  4BYY A;  3KLO A;  4RB0 A;  5E8G A;  2R7F A;  3BDD A;  5CVJ A;  3B73 A;  3KZZ A;  3M9A A;  1T6S A;  3K69 A;  3V4G A;  4ASN A;  4AIJ A;  1WSU A;  4OIP F;  2HTS A;  3KET A;  3IWF A;  3F23 A;  2Y75 A;  2BYV E;  3FHZ A;  3I5U A;  3ZMD A;  3E3V A;  2P7V B;  5A2Q Z;  1O3T A;  2XKO A;  3M8F A;  2KIF A;  4S05 A;  4OOI A;  3M8E A;  4U88 A;  2QQB A;  4K2E A;  3T8T A;  1U5T C;  1ON2 A;  4RAY A;  1J0R A;  1YW8 A;  2FML A;  3BPX A;  1NHA A;  3V8K A;  2P6T A;  1LQ1 A;  3R4K A;  1SMT A;  5DUK A;  4B8X A;  4NQW A;  4A0Z A;  3CO6 C;  1YYV A;  4A6E A;  4UV8 A;  2M1B A;  3SHF A;  1RUO A;  2AXL A;  1TTY A;  1HXD A;  1R22 A;  1S6L A;  4LK1 F;  1ZH5 A;  2K4B A;  1ZN2 A;  2P5V A;  2UXN A;  3ISP A;  3VFZ A;  2BBY A;  4CDG A;  3I59 A;  2HGC A;  5HLI A;  5D6F A;  3QU3 A;  3QRF F;  1IN8 A;  1T98 A;  2Z9O A;  3QPH A;  2QM3 A;  2RGV A;  3TO9 A;  1DDN A;  1BI2 A;  5CYV A;  4G7O F;  1FZP B;  3V8J A;  1KQ8 A;  2VE8 A;  4I02 A;  5E1Z B;  4XLP F;  1F4K A;  2MBF A;  1Q1H A;  1C0W A;  1FBS A;  4LB6 B;  1D5V A;  1R36 A;  3COA C;  2IT0 A;  1I1G A;  1UCR A;  2EA2 A;  2DK5 A;  1D3Y A;  1F5T A;  3ROU A;  2LKP A;  1ZAO A;  4ZH4 F;  4FT8 A;  1X3U A;  2P5K A;  3GWZ A;  2IA0 A;  1U6G A;  4A0Y A;  5IT9 K;  2COM A;  4RGX A;  4CHU A;  2DQR A;  2PJP A;  5L3F A;  3REO A;  2M8E A;  3GEZ A;  2E7X A;  3F6O A;  4FX4 A;  1YQA A;  2ACJ A;  2M5W A;  3WGI A;  3TDU C;  1W4M A;  1XGO A;  2F5C A;  4ZYG A;  3BP8 A;  1TW2 A;  1H9T A;  1KGS A;  3FXR A;  1JHH A;  3K2Z A;  3F6V A;  4KIB A;  1FP2 A;  1HSJ A;  3CUQ C;  3ML6 A;  1TW3 A;  5E8I A;  5DCF A;  4EGY A;  3F22 A;  5JHU A;  2RQP A;  1TQP A;  3SZP A;  3V7R A;  4AVP A;  1LDK B;  4M9X A;  1K79 A;  4EGZ A;  1YIO A;  3ECH A;  2CGP A;  2HKO A;  5A2Q K;  3E97 A;  3F8F A;  1HKT A;  3RYR A;  2EFQ A;  3IWZ A;  4ENN A;  2GIV A;  1I5Z A;  3WGG A;  2RV8 A;  3KP6 A;  1O3Q A;  1YLF A;  3E5X A;  3H3U A;  2L3D A;  4HLX A;  3ZMT A;  3MAJ A;  1FPQ A;  1E2X A;  1MDM A;  5HLG A;  1O7L A;  2PN6 A;  3KZY A;  4N9I A;  4HF0 A;  1GVJ A;  1O3S A;  5DUI A;  2EK5 A;  2A07 F;  3EQL F;  2MLK A;  5D6E A;  5IT3 A;  2DI3 A;  2KKO A;  4CGZ A;  1IUY A;  3BWG A;  1Z6T A;  1QZZ A;  2EFP A;  1K6O A;  1USS A;  3QAH A;  1WWX A;  2RDP A;  1BI0 A;  5BPI A;  4EJT A;  5LHH A;  1XMK A;  2G7H A;  1P4X A;  4XLN F;  2OZU A;  5E20 A;  4CZZ A;  2V9V A;  2QYO A;  2WWY A;  2IRF G;  4CIC A;  1BI1 A;  2O8X A;  2XIG A;  4DNC A;  1RIO H;  3TGN A;  4YFK F;  2K4J A;  4PDK A;  1W7P D;  1J59 A;  4OIQ F;  4WXD A;  5BS6 A;  3T8R A;  4HA8 A;  5D8K B;  2DBB A;  5D5U B;  1MJ9 A;  3WG9 A;  2QVO A;  2M45 A;  1UB9 A;  2WC2 A;  3H3Z A;  4OMY A;  2E7W A;  4ZYE A;  2YR2 A;  5HOO A;  2GXB A;  4ZZL A;  1TQI A;  5CVV A;  5K5R A;  4G9Y A;  2R7D A;  1IZ1 A;  4OIN F;  2EJR A;  5CVI A;  3ZN0 A;  4EM0 B;  1XGS A;  4JQF A;  4YFN F;  2Q0O A;  1UHW A;  5H6R A;  4Z2Y A;  4ZYH A;  2V1D A;  5K5O A;  1ODD A;  1BM9 A;  1WKM A;  1SAX A;  3T0Y A;  1FOK A;  5DDG A;  2R3S A;  2JT1 A;  3JAM Z;  2HEO A;  3DEU A;  4EV0 A;  2IW5 A;  3J81 Z;  1KU9 A;  2PG4 A;  2MLG A;  2X4H A;  1QO0 D;  1KQ9 A;  4LG0 B;  3U1D A;  1CGP A;  3KFW X;  2H27 A;  3GXO A;  4MEY F;  1B59 A;  3O2P E;  3FMQ A;  2RC4 A;  2NRA C;  1SD4 A;  4L5I A;  2XAS A;  1BIB A;  2O6G E;  1R58 A;  2D2W A;  4RS8 A;  1FP1 D;  1G3W A;  1V3F A;  4AD9 A;  3WTS C;  2F5E A;  3DKW A;  5ICG A;  3RKY A;  1WQ2 A;  1KYZ A;  3HHG A;  3HOS A;  1U5T B;  5F64 A;  1SD6 A;  2J5O A;  3GO5 A;  2IA1 A;  1DPR A;  1S8N A;  5DD8 A;  4ENK A;  4GYG A;  2OD5 A;  1V4R A;  3FMR A;  2OQR A;  5BQT A;  1WI9 A;  1HST A;  3TKY A;  4YFX F;  4EJV A;  3WTW C;  3V7C A;  1F9N A;  3F8N A;  1TNS A;  3R60 A;  2PQ8 A;  2QQA A;  1R5H A;  1FYM A;  2L54 A;  4I0B A;  2HYG D;  1I27 A;  4MNU A;  2G7U A;  3QU6 A;  2ZFW A;  2EWN A;  3KP4 A;  1K7A A;  2HS5 A;  1SFE A;  1XD7 A;  2XAG A;  2ZKZ A;  4L9V A;  3RKX A;  1IAW A;  4Y17 A;  2IVM A;  2ZJ2 A;  4QLC U;  4OIR F;  1L3L A;  1O57 A;  3P9I A;  1XDU A;  5FD6 A;  5F1R A;  4NB5 A;  5HVQ C;  2XAQ A;  3KCC A;  3BOQ A;  2XKP A;  2CG4 A;  4HAM A;  6PAX A;  3BJA A;  2YX4 A;  3BJ6 A;  1TQM A;  2KJB A;  2ESN A;  4R79 A;  4IRH A;  3WU0 A;  5CLS A;  2EB7 A;  3JTG A;  2JRT A;  5LGU A;  3JAM K;  3BY6 A;  1KA8 A;  3L00 A;  2RVC A;  1ZRC A;  3J81 K;  1OYY A;  5J6X A;  5K5Q A;  5CJ9 A;  3I58 A;  1IRF A;  3B02 A;  2HDC A;  5FFZ A;  4CO8 A;  4UXN A;  1CF7 A;  3ULQ B;  2FSW A;  1R7J A;  4ESF A;  2KIM A;  4KT5 C;  3IRQ A;  3GFL A;  2JTV A;  2V79 A;  1ZG5 A;  4M9Z A;  3T5X A;  1IN7 A;  1BBY A;  2DLL A;  2JPB A;  4G94 A;  1OYW A;  2RNJ A;  2FEZ A;  3MEX A;  2EV6 A;  3GUD A;  3WE3 A;  3KEQ A;  4KDP A;  3K1M A;  2A6E F;  4I98 B;  3C3W A;  2ZCW A;  3WTV C;  3HOT A;  3KP3 A;  3ELK A;  2PI0 A;  1OMI A;  1JXS A;  2ADU A;  4HOB A;  3R0J A;  4GO1 A;  1S29 A;  1K78 B;  2EA4 A;  3EYI A;  2BV6 A;  4MQ9 F;  1SFU A;  4LLL A;  1R1U A;  2A5Y B;  3F8M A;  1BC7 C;  3EDP A;  1DUX C;  2VT3 A;  2EFO A;  3HSE A;  1GHC A;  1QPM A;  4WF2 A;  3O6B B;  3HTS B;  4I01 A;  3R6S A;  2HZT A;  2VBX A;  2FF4 A;  3HSF A;  1ZRE A;  4KIC A;  3RDI A;  2GXG A;  4EQQ A;  5BMZ A;  4MQV A;  2FRH A;  1YS6 A;  1JHF A;  4RB1 A;  3GF2 A;  1RZ4 A;  3L9F A;  3CUO A;  4JBA A;  1P4A A;  3WGH A;  1GXQ A;  2AS5 F;  3QOP A;  3EUH A;  2FQ3 A;  4MTE A;  5LHI A;  1TNT A;  2OU2 A;  4LG0 A;  2NNN A;  4EJW A;  2FE3 A;  2X0L A;  3HRS A;  1IN5 A;  4A5M A;  4HV6 A;  2XGX A;  3W6J B;  5L3C A;  4IHT A;  1LDD A;  3GW2 A;  4AIK A;  2HQN A;  3ZMZ A;  4M71 A;  3DQV C;  1IXS B;  1IRG A;  3VEP A;  1FWZ A;  3KLN A;  2DK8 A;  1FY7 A;  3EYY A;  1Z7U A;  2M87 A;  3F3X A;  1ZG3 A;  4HX7 A;  1U5T A;  3Q5F A;  4OU0 A;  1AWC A;  5F6F A;  2CW0 F;  2YPR A;  3GX4 X;  1HW2 A;  2P7C B;  1ONV A;  2CYY A;  3P9C A;  2ZNZ A;  1MKM A;  1XDS A;  4H0E A;  4GXO A;  1PDN C;  2LF8 A;  5HLH A;  2HR3 A;  1HBX G;  3IKT A;  2L4M A;  3ZN1 A;  3NEU A;  3LAP A;  4KMU X;  1R5G A;  4O3M A;  3IKV A;  1Z05 A;  2OA4 A;  4NHJ A;  2DPU A;  2O03 A;  2QBY B;  1J2X A;  2P8T A;  4G6D A;  4HQE A;  2MD5 A;  2UWM A;  2FXA A;  5D4S A;  1B1B A;  5L3G A;  5D8L B;  5D5V B;  5LRR A;  4AWX B;  1YTY A;  2Z33 A;  5LEJ A;  1FT9 A;  2HKX A;  4KN7 X;  4B09 A;  5CVU A;  1PP7 U;  4ETS A;  3LAJ A;  4YIF A;  3I54 A;  4BH9 A;  3WTU C;  2Y0M A;  4S04 A;  4UV9 A;  4BHB A;  4L18 B;  3M1E A;  4WXH A;  3MFK A;  2GQQ A;  1J5Y A;  2LDU A;  3FWE A;  1HW1 A;  2VBZ A;  2QEN A;  2MA3 A;  3C1D A;  4PZJ A;  2XRO A;  2BGC A;  2NNY A;  4QWQ A;  3BRO A;  5HDK A;  4HLY A;  3ZP5 A;  1FBU A;  2IP2 A;  2FOK A;  1Z91 A;  1CF7 B;  3GLX A;  3FZV A;  2PEX A;  5LBQ A;  2ZNY A;  3KE2 A;  4R8H A;  1XN7 A;  2NS0 A;  2CQK A;  5DV5 A;  3WTT C;  1G4D A;  2FU4 A;  4PGG A;  2Q2E A;  4LLG F;  3LWF A;  2QUF A;  1YFH A;  2RN7 A;  3MZY A;  1ZLK A;  1ULY A;  4Q47 A;  3FXQ A;  2EV0 A;  5DCM B;  4Y13 A;  4L0Z B;  4WK8 F;  2Z5U A;  4D0P A;  4CYD A;  1KU7 A;  1W7P B;  2P4W A;  3LA3 A;  4IHS A;  4LJZ F;  3HUG A;  4I0A A;  1ZGA A;  4HBL A;  1ZAR A;  5HS9 A;  1P2F A;  1IXR C;  3DFG A;  2P6S A;  2W25 A;  4UNO A;  2ZO4 A;  4EVI A;  4U7B A;  4P5O A;  1MZB A;  1T38 A;  3QP5 A;  3E6C C;  1G3Y A;  1IF1 A;  3C7J A;  2FNP A;  4RGR A;  3RKW A;  2VN2 A;  3U2R A;  4G7Z F;  2NYX A;  2Z3Y A;  1PP8 F;  1K78 A;  1EH6 A;  2VBY A;  1LEA A;  2K27 A;  1T0F A;  4G6Q A;  5HDN A;  2DT5 A;  1YS7 A;  5JFR A;  5FD5 A;  2F2E A;  1DPU A;  4HF1 A;  4XSX F;  4M9S A;  2GAU A;  4EM1 A;  2ESH A;  4A5N A;  3H92 A;  2ZME A;  4Q5S F;  3EET A;  1ON1 A;  2GZW A;  3F8C A;  2XAH A;  3GFM A;  1R00 A;  1FSE A;  4LK0 F;  3VOE A;  1EH8 A;  2OAZ A;  3GFI A;  4LGW A;  3WOD F;  2UZK A;  1KQ0 A;  3E5U A;  4FX0 A;  5LHG A;  2W85 A;  4HX8 A;  4HDU A;  4RB3 C;  4KA4 A;  2STT A;  2GA2 A;  4RB2 C;  2EV5 A;  4KMF A;  1W5S A;  3NQO A;  5LRS A;  1FLI A;  4A0X A;  4L5J A;  2D45 A;  4YG2 F;  1EH7 A;  5E17 F;  3K0L A;  3CTA A;  3FX3 A;  1GXP A;  1WRJ A;  5EEG A;  4MTD A;  3FM3 A;  4UVA A;  4U7D A;  1ZG1 A;  2H94 A;  1AOY A;  4UVB A;  4FHT A;  1FYK A;  2W84 A;  5J8C A;  1LEB A;  3E6M A;  4I09 A;  1KU3 A;  1HW5 A;  1RUN A;  4BNC A;  3L2C A;  3GZ6 A;  4PGH A;  4WWC A;  3BJO A;  2O61 A;  3E6B A;  3D5L A;  1RNL A;  2PMH A;  2E1C A;  2QBY A;  3ABT A;  4RGU A;  1L0O C;  3JW4 A;  1A04 A;  1O3R A;  2KJC A;  2MH9 A;  4KIF A;  3PQK A;  4WX9 A;  5CVR A;  1Y0U A;  2GA1 A;  5L3D A;  4IRG A;  4EMS A;  4KUM A;  4HDV A;  1D8K A;  4HZF A;  2F5F A;  1S7A A;  2LNB A;  2Y48 A;  3DXJ F;  3CO7 C;  3GVA A;  3HYI A;  1VTN C;  5FGM A;  5FLX Z;  2O0Y A;  3P9K A;  1F1Z A;  3K1P A;  3NRV A;  3DV8 A;  1E17 A;  5TJJ A;  1XSV A;  2EFN A;  5ERI A;  4XBF A;  1XGM A;  5AIP A;  2JPC A;  4L9J A;  4TV7 A;  3RTR A;  3I4P A;  2DO7 A;  2LSO A;  4A6D A;  3P7N A;  2HWV A;  5HS7 A;  3PQJ A;  4ZYD A;  4UVC A;  3LFK A;  2VC1 A;  5LGN A;  2UXX A;  3MZH A;  4KN4 X;  3I64 A;  4BHC A;  2XAJ A;  1YW9 A;  3IHU A;  2L4A A;  1S3J A;  3CUQ B;  1U78 A;  2MC3 A;  1IXC A;  4PCQ A;  2HOE A;  4KNY A;  4RAZ A;  2A68 F;  2BEO A;  3DPT A;  1B6A A;  5JI6 A;  4BAY A;  3DF8 A;  3ZMS A;  1JE8 A;  2ZBK A;  4HX4 A;  3TO7 A;  2A6H F;  2VE9 A;  2D1H A;  4P9F A;  5DCM A;  5HDG A;  3V7S A;  4BXU A;  4P55 A;  1ZHF A;  4CXF A;  1W7P A;  5AIQ A;  3BZ6 A;  4ENM A;  2VT2 A;  3VB2 A;  3WTY C;  3R61 A;  4L9N A;  2DTR A;  1FNN A;  3KEO A;  2KIU A;  5EEH A;  4MHG A;  2IJL A;  3T1B A;  5DEQ A;  3C18 A;  4IVN A;  5LEK A;  2YU3 A;  1R1T A;  3HRT A;  3BPV A;  3ZPL A;  5DD4 A;  3E5Q A;  2J5P A;  4WXC A;  5BOX A;  4HW0 A;  4RGS A;  1OR7 A;  3HRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...