1Z1DA

Structural model for the interaction between rpa32 c-terminal domain and sv40 t antigen origin binding domain.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
69
structure length
69
Chain Sequence
ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords Replication protein A 32 kDa subunit
publication title Insights into hRPA32 C-terminal domain--mediated assembly of the simian virus 40 replisome.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z1dA00
4P9FA 1T38A 2LKPA 3HSEA 3K1MA 2VXZA 1UHMA 3HRUA 4UVCA 1TNTA 4CXFA 3JTHA 5LRRA 3LQQA 4HDVA 1J9IA 1KA8A 4KMFA 5ILSA 2EFPA 5LGUA 1RNLA 2BBYA 2L01A 3BJOA 5ILVA 1FOKA 3WGHA 3HRTA 3RKYA 1AWCA 2ZMEA 1XMAA 4WCGA 5F64A 4HX7A 2P7CB 5ICCA 2W84A 4A2UA 1YW8A 1UB9A 4CGZA 1YTYA 3GFMA 1P92A 1BC7C 1I1SA 1Z91A 4BHCA 3MFKA 2ZCWA 1XDSA 4OINF 3LFKA 4AD9A 3VFZA 5E18F 1EH8A 1HW5A 2V9VA 1O3TA 1U6GA 5BPDA 1USSA 1STZA 1F9NA 1XD7A 2CFXA 1B59A 4MEYF 4UV8A 4HBLA 2E1NA 2OBPA 4L5IA 3ABUA 3SQNA 4EQQA 1FP1D 2XROA 4RGRA 3KP6A 4MTEA 1TW3A 1IRGA 1ZG1A 2EFWA 1IXCA 2LF8A 1I5ZA 1W7PA 4I0AA 1R5HA 2EA4A 3ZMSA 3LA7A 3RIRA 2QQBA 2W57A 1O7LA 1H0MA 4KICA 4Y13A 3R60A 3KLNA 1R58A 2P5KA 1KYZA 4ZYDA 1K6OA 3F6OA 2YR2A 2FEZA 3ZMDA 1IN7A 4G7HF 3IKVA 2A5YB 3VEPA 2HYFA 3LAPA 3KEQA 1ZG3A 4EJTA 4RB2C 3MWMA 5LRSA 3QPTA 4UHTA 4IF4A 2HQRA 1BM9A 4KDPA 2JZYA 4GCVA 1QZYA 3FXRA 1G3WA 2L3DA 5FB2A 2XHKA 4AVPA 1YYVA 2DPUA 2L4AA 4N9IA 2J5PA 3GX4X 1WQ2A 2J5OA 4AIHA 1EV7A 2AXLA 4OIPF 1OYIA 4HZFA 3SXYA 2XAFA 2IRFG 1R1UA 3IRRA 3KE2A 5D5UB 1BC8C 3F6VA 3P9IA 4O3MA 4LD5A 2LDUA 1IF1A 3RJPA 3EYIA 3KP3A 2YSRA 3C1DA 1B6AA 2L4MA 2GQQA 1V3FA 1E17A 2ETHA 2QENA 3CO6C 2BEOA 5D6FA 2V6CA 2FE3A 4I98B 5FGMA 2CGPA 4EVIA 3ZMZA 2H6CA 2H09A 2FOKA 5JI6A 4RB1A 4ESFA 1CF7B 1FYKA 1TW2A 1P4XA 4U7DA 4O5VA 2VBWA 2XKPA 3WTZA 3LA2A 5H6QA 1R1TA 1ZREA 3T1BA 2VT2A 2XAHA 2GXGA 3V4GA 1BBYA 4ETSA 3NQOA 2COMA 1R00A 3FXUA 1L0OC 5JR3A 4U0VA 4BXUA 4I01A 5E1WA 2WTEA 3TOBA 4H0EA 1O3QA 2XASA 2FBIA 3WGIA 1XSDA 4KT5C 4L9NA 2A6HF 2M5WA 2OD5A 4GO1A 1FYMA 1FY7A 3KP7A 3K2ZA 2V1XA 2MLKA 1TBXA 3CDHA 4WXCA 1ODDA 5LHGA 2RDPA 3HRMA 2K02A 3GXOA 2EB7A 4BHBA 2M8EA 2RKHA 3FMQA 4BHPA 2UWMA 3CLOA 1I27A 4WK8F 4YFXF 3ZMVA 5JHUA 2DK8A 4EGZA 4CYDA 4U0YA 2WV0A 3T8RA 3TO9A 3GW2A 2A07F 3EQLF 4EJUA 1JE8A 1B9MA 5BOXA 1WRJA 2P8TA 4BNCA 2CO5A 3C7JA 3BWGA 1J75A 2Z99A 1P2FA 4G7OF 2L54A 3EYYA 3DPLC 1G4DA 3MQ0A 3SHFA 5ICFA 5FFXA 3FWEA 5L3EA 3B02A 4QLCU 2UXXA 3HOSA 2X4HA 3E5QA 2Z5UA 1WSUA 4RAYA 1KU2A 5H20A 2EFOA 4RGXA 1TNSA 5BQTA 1BI1A 1S3JA 2YPRA 3FZVA 5DYMA 5HOOA 1GXPA 4NB5A 3EETA 2O03A 2YX7A 1XDUA 2QM3A 2VOPA 2AS5F 4HLYA 2R7DA 1S6LA 2ZJ2A 2Q0OA 3JW4A 1R5GA 5HDNA 1PUEE 1T6SA 3HYIA 1YO5C 1S7OA 1U5TB 3RYPA 3WTWC 4BQAA 1YS6A 2W25A 3C3WA 3K1NA 3R4KA 5DUKA 5H6RA 1Z05A 2Y48A 4LK1F 2HTJA 1P4WA 4EJOA 4TV7A 4EV0A 3ZPLA 3H92A 4EJVA 4G9YA 3R6SA 5A2QK 5D5VB 2ELHA 4HW0A 4LG0A 2QLZA 2P5VA 2FRHA 2P5LC 2HR3A 3CUQB 1EH7A 3TKYA 4LMYA 4E70A 2G7UA 2HYGD 2FNPA 3KCCA 5J8FA 3B73A 3GZ5A 1PP8F 1R22A 2DBBA 1U8RA 1GHCA 2DT5A 2IW5A 1VTNC 4RGUA 3C18A 5E1ZB 3GO5A 1ZGJA 1O3RA 4ON0A 1YG2A 3M1EA 3R61A 2Z33A 2Y75A 2DQLA 3U9GA 3M8FA 3V7RA 1OYYA 2ZFWA 2F5CA 1HW2A 3L9FA 3IKTA 4M74A 4RB3C 5A2QZ 4EM0B 1LEBA 1SFXA 3JSOA 3TQNA 2RC4A 1HKTA 2JSCA 5F1RA 4KUMA 3QRFF 1LNWA 3I59A 4CICA 4I09A 4M73A 1HKQA 1LDDA 1SFUA 3DFGA 4LLLA 2XAGA 3L7WA 5HS8A 2KKOA 3OOPA 3GYHX 5EEGA 2MC3A 3L09A 2KRFA 2XGXA 2HKOA 4ZH4F 2NAZA 5K5QA 1S8NA 3ZMUA 4GYGA 2YU3A 2PJPA 2D45A 3LSTA 3KP2A 1HBXG 1L3LA 2W85A 3GF2A 3MZHA 4ZYGA 2FXAA 3W6KB 5LEJA 2P6SA 4IRGA 1KU3A 4WXHA 3CTAA 3E6MA 2FBKA 2ZO4A 2QWWA 5HLIA 1T2KA 1FX7A 2OZUA 2QZ8A 4Y15A 3NEUA 5AONA 4A0YA 3GFJA 2LSOA 4G6DA 1IAWA 3TOAA 1OR7A 4PDKA 3ERED 4L0ZB 3CUOA 1LVAA 3HUGA 3WU0A 5DCMB 4KIFA 3KP4A 1ZN2A 2EWNA 3QU3A 4UUVA 5FD6A 2GIVA 1IXSB 3DF8A 3E6DA 4A5NA 2EV5A 1MKMA 4EM1A 2PG4A 4IVNA 2OU2A 4Y17A 2XV4S 4HV5A 4OU0A 4U7BA 2NNYA 4KIBA 2VC0A 4Q47A 2QQAA 4M6YA 2X0LA 2HEOA 4RAZA 4N0BA 1KQ9A 2QBYB 2A3SA 4CDGA 1SD5A 3LA3A 1ZRCA 4WX9A 4GGGA 3K1PA 3V8LA 5HS9A 2DPDA 2HZTA 4OMYA 2O8XA 2CWEA 1ZGAA 3FX3A 4XSXF 5L3GA 5J8CA 1G3SA 5E8IA 1FSEA 4KN7X 2GAUA 2Z9OA 3NRVA 3IHUA 1HXDA 5HS7A 5DD4A 1I6XA 2KJBA 1K79A 5HLGA 5L3DA 4GXOA 4JBAA 3F22A 2XAJA 2NYXA 3G73A 1XSVA 2XRNA 2CSOA 2BGCA 3ELKA 4OIQF 5D4RA 2M1BA 1MDMA 4R8HA 4P55A 1ULYA 2XUBA 2NNNA 4HDUA 3O3KA 3I64A 1YFHA 3WODF 5BPIA 2VBYA 2WC2A 5AIPA 2ZMEB 1DPUA 4Q5SF 3TO6A 2KJCA 3FF5A 3QP6A 1B4AA 2FF4A 1EH6A 2K4BA 3DXJF 4FX4A 1LJ9A 2Q2EA 1YW7A 5ICEA 3WE2A 3GFIA 1V4RA 4AWXB 5ICGA 1U2WA 4NQWA 4S05A 3PQJA 4ENJA 1YIOA 4RGSA 5LHIA 1A04A 1BI0A 1IN6A 3V8JA 2IT0A 3E5UA 1LEAA 2Z3YA 2DFIA 1GVJA 2W24A 1FPQA 1ZRDA 1CGPA 3AAFA 4IXAA 4MQ9F 5CVRA 2FMYA 1W7PB 1QGPA 3GEZA 1F4KA 2GWRA 4R79A 1D8JA 1J0RA 5CLSA 3H3ZA 3KZYA 1RZ4A 4HYEA 4XBFA 3P7NA 5HVQC 3IL2A 2HQNA 4Q4ZF 1D5VA 2VOOA 1XMKA 1D8KA 2V1UA 1IRFA 2ZNZA 4EMSA 3WTVC 4A6DA 1R7JA 4JQFA 4P9UA 1DP7P 3HRSA 1W5SA 5JFRA 2F5EA 4UVBA 3G3ZA 1MGTA 1QNTA 3HHHA 2PI0A 2O0YA 2ISYA 3HSFA 4RB0A 1D3YA 2IA0A 2DO7A 3WU1B 1FP2A 5EEHA 2A6EF 3FXQA 2QYOA 3QU6A 5ERIA 4HF1A 4M9ZA 2QQ9A 1J7KA 1IN8A 3ZP5A 4HA8A 1WKMA 2ISZA 1P4AA 2D1VA 2VC1A 1PP7U 3ROUA 1FWZA 4B09A 2RN7A 4LLNA 4B8XA 4ENNA 3L00A 1QQIA 4PGHA 5K1YA 2CYYA 1RI7A 3QP5A 2JTVA 5LLQA 2VE9A 5F6FA 4IPAA 2G7HA 3I58A 3GVAA 2V79A 2OA4A 1UCRA 4G94A 4G6QA 1XSXA 2F5FA 5HLHA 1K78A 1H9GA 2ZKZA 1MD0A 4ENMA 2VBXA 1JHHA 2DLLA 2VT3A 4XRFA 4OIOF 3MAJA 3E6BA 2HWVA 5AIQA 5D5WB 1REPC 2PEXA 2FMLA 1HW1A 3M9AA 5CYVA 1ZRFA 2KIMA 4S04A 2BYVE 1LDKB 3F23A 3E6CC 3GZ6A 3FHZA 4HOBA 3S2WA 1QO0D 2VE8A 1DDNA 3I0TA 4KIGA 3M8EA 3T0YA 3KETA 3BJ6A 3KFWX 4ZYEA 5E20A 4MEXF 1MZBA 2RVCA 1XCVA 2RV8A 5L3FA 2M87A 1XB4A 2ESHA 2PLYA 1FZPB 2E7XA 2PMHA 4EM2A 2R7FA 3RDIA 3FMRA 2PN6A 1YS7A 4UV9A 4EGYA 1XGSA 2HOEA 3RKWA 4HX4A 2FA5A 2QVOA 1E2XA 3BDDA 3TO7A 2RNJA 5LEKA 1YLFA 1ZLJA 4JK1X 3J81K 3ULQB 2MLGA 2BV6A 2LF7A 5FLXK 1O57A 3GFLA 2HDCA 1SFEA 3W6JB 3ISPA 1Z7UA 3KP5A 2D2WA 4L9VA 4F7ZA 4A12A 2P7VB 3FMSA 3R0JA 2BE5F 4FHTA 2ZBKA 2IP2A 3ECOA 1TQMA 2DW4A 3DPTA 3SZTA 2VONA 2B0LA 3WTSC 1KQ0A 3REOA 4G8XA 1O3SA 2EV0A 2EA2A 1TLHB 5LBQA 3D5LA 5DCFA 1DPRA 4MQVA 3CO7C 4O6JA 1G3TA 2EJRA 4P96A 1FBUA 3J81Z 2EK5A 5IT9K 5BS6A 5K5OA 1ON2A 1WI9A 4MHGA 5D8LB 2KIFA 1XN7A 1DUXC 4BH9A 2K86A 1XGOA 1MJ9A 5FLXZ 2FSWA 1QPMA 1RUOA 3H3UA 2IPQX 3N97A 2Q8KA 4WXDA 2EFNA 2JRTA 3MZYA 1HKSA 1YQAA 1XGNA 3JTGA 2FQ3A 1G6NA 4LG0B 3U2RA 2QBYA 4U88A 3GWZA 2R3SA 3E97A 4XLPF 2HTSA 1OMIA 4GYIA 1XGMA 2DQRA 3Q5FA 3GUDA 5ILUA 4LFUA 4R1HA 4A6EA 1AOYA 5CVVA 2LNBA 2OQGA 2XKOA 5BMZA 4DNCA 2P6TA 3WTUC 5IT9Z 1FYLA 3BP8A 4HF2A 4LLGF 4WF2A 1KGSA 1RIOH 3TDUC 3IWZA 1SMYF 1IZ1A 2VODA 3K0LA 4IRHA 1Z1DA 3F8BA 3LQRA 3ZN1A 3K9TA 4A5MA 4I7HA 1O7FA 4QWQA 5E8GA 3IWFA 1OYWA 4OOIA 2NS0A 4M71A 2E7WA 2EFQA 3R0AA 3PQKA 1FC3A 3I59B 5KK1A 1ZHFA 3TDZC 3T8TA 1USTA 1HSTA 4MGRA 1SMTA 3QPHA 2UXNA 1W4MA 1KQ8A 3V7CA 1ZG5A 5DD8A 1BI3A 3V8KA 3MCZA 4ZZDA 1UFMA 3BPVA 2H6BA 1NHAA 3HTUA 4BAYA 1SAXA 1QZZA 1OKRA 3I71A 2MA3A 1K7AA 3T5XA 3I53A 1BI2A 1BN5A 5CVIA 2STWA 5CVJA 3ZQ7A 3ZMTA 3P9CA 3BPXA 2V1DA 1R23A 3ABTA 4YFKF 3ZN0A 1WWXA 2O61A 4L9JA 3HIFA 1B1BA 3SFZA 3JAMK 4UVAA 1CF7A 3HTSB 3VB2A 2PQ8A 3BJAA 3DP7A 1IXRC 4HQEA 2ACJA 2TDXA 4EJWA 2STTA 3EDPA 3KEOA 1SD7A 4ASNA 1U5TC 2DTRA 5CVUA 1F5TA 1IN4A 1RUNA 4PCQA 1J5YA 2DK5A 1YW9A 2CW0F 3VODA 1TQIA 4HAMA 4XLNF 3LAJA 4M9XA 2H27A 4BYYA 1T0FA 3D0SA 1BIAA 2JPBA 3F21A 1LDJA 1LQ1A 4I02A 2FBHA 2HS5A 3DV8A 1R36A 4N9HA 3FM3A 2ADUA 2OAZA 3HOTA 2VN2A 4AIKA 4KFCA 3DEUA 4DQ2A 1H9TA 3CUQC 1HSJA 2KIUA 4LB5A 3WTXC 3JAMZ 4FT8A 2RQPA 1ON1A 5TJJA 4XSZF 2HKXA 3U1DA 4L0YB 3DQVC 1TTYA 5LGTA 1P6RA 2MD5A 1KU7A 1FBSA 4I0BA 1LB2A 2F5DA 4ESBA 2DAOA 4LGWA 1GXQA 2RGVA 1OPCA 1Z6TA 2CG4A 1IN5A 3E3VA 3KLOA 1MDMB 2FU4A 2ESNA 3SZPA 2OZ6A 2QUFA 1I1GA 5E1XA 5IT3A 1MJBA 1SD6A 2OQRA 4LB6B 2ZNYA 2C6YA 2ZXJA 2A68F 4IHSA 4LJZF 2CQKA 4PGGA 4YIFA 5FO5A 3P9KA 5D4SA 3ML6A 3IC7A 5K5RA 1BOAA 4U0WA 5CJ9A 1F1ZA 3WTYC 1FBQA 3L2CA 2MH2A 4AIJA 5TRDA 2DI3A 2YX4A 3F72A 3M7GA 2K4JA 2GZWA 5FD5A 2HGCA 4HF0A 5HDKA 2EV6A 1TQPA 4M72A 4HX8A 1JXSA 3F8MA 1U5TA 3LWFA 2JT1A 1QBJA 3I5UA 2JPCA 2PFBA 2D1HA 1JGSA 2IA2A 2GA1A 3RPQA 2VBZA 1KU9A 3HSRA 1B9NA 1FT9A 4A0ZA 2K7LA 2G9WA 3BZ6A 1Y0UA 4KYWA 3RTRA 1X3UA 5D5XB 3HHGA 3BY6A 5D8KB 1ZAOA 2UZKA 3WE3A 3CUQA 2M45A 3Q9SA 4YFNF 4G7ZF 4NHJA 3RYRA 5FFZA 4HLXA 2WWYA 1Z6RA 4KA4A 1KYWA 4D0PA 1JHFA 3JSPA 3J7AO 4CHUA 2GA2A 3PFIA 2A69F 3TGNA 4M6XA 2O3FA 1G3YA 4P5OA 1W5TA 5L3CA 3E5XA 4YIIA 3WG9A 3QAHA 1ZYRF 4IHTA 2IA1A 2F2EA 4CZZA 3OV8A 1T39A 3RPUA 3MEXA 1SD4A 1PDNC 3N4MA 1ZARA 3IRQA 2IVMA 3Q9VA 1FSHA 5J6XA 1BIBA 4K2EA 4PZJA 3F8CA 3ECHA 1W7PD 4I2OA 2XAQA 3I4PA 5DV5A 2GXBA 5L3BA 1MJAA 2P4WA 5E17F 5JVTA 6PAXA 1T98A 4MNUA 5ED4A 2XVCA 4ZZLA 2H94A 2L02A 3O6BB 1BJAA 5DUIA 4HQMA 3RI4A 3F8FA 4UNOA 5KVRA 2DU9A 1Q1HA 3J80K 3F8NA 1U3EM 1R1VA 3I54A 2XIGA 1IUYA 2NRAC 3O2PE 1K78B 5D6EA 3WTTC 1IW7F 4ENKA 2FNAA 5HDGA 2A61A 4IRIA 2E1CA 4Z2YA 2O6GE 4L5JA 2Y0MA 1ZH5A 2IJLA 4OIRF 4A0XA 4IJAA 3BOQA 1FLIA 1UHWA 5LHHA 3FM5A 2MH9A 3RKXA 1S7AA 4L18B 4OMZA 3VOEA 4MTDA 5LGNA 1ZLKA 3QOPA 1ONVA 3DKWA 4ZYHA 5DCMA 4M9SA 3KZZA 3BROA 1C0WA 1XCBA 3J80Z 4ESJA 4KN4X 4KNYA 1FNNA 2PMUA 4FX0A 5DDGA 3CJNA 4Q48A 3WGGA 3V7SA 4LK0F 3GLXA 5DEQA 4RS8A 2MBFA 4CO8A 1J2XA 2M30A 4WWCA 1Z9CA 2HFHA 1J59A 2PBIA 3K69A 4UXNA 4HV6A 3EUHA 3F3XA 2K27A 4L9TA 1S29A 4YG2F 1U78A 1HQCA 3COAC 4KMUX
chains in the Genus database with same CATH superfamily
4P9FA 1T38A 1MBJA 1UELB 2JA8J 1MNEA 2HYJA 2LKPA 3HSEA 3K1MA 2BXZA 2ZB9A 2VXZA 3DBRB 2LOOA 1UHMA 4Y4RA 1YJ9I 3HRUA 4UVCA 4CCKA 1TNTA 1D1AA 5JLWA 3LFUA 4CXFA 2ZFUA 3V42A 3E7LA 5IY5H 1T8IA 3JTHA 5LRRA 3LQQA 4HDVA 3H0DA 1J9IA 2QF7A 1KA8A 4KMFA 5ILSA 2EFPA 5LGUA 4HNTA 1RNLA 1H89C 4Y52J 2BBYA 2L01A 3DLAA 3LSJA 3BJOA 5ILVA 1FOKA 1ETWA 3WGHA 2R92J 4HNVA 3HRTA 3U1KA 4YRVA 1SVLA 3RKYA 1AWCA 1YRNB 2KT0A 2MYSA 3OIPA 2ZMEA 1XMAA 4WCGA 5F64A 4HX7A 3HOUJ 2P7CB 4B3XA 5ICCA 2Y69H 2W84A 4A2UA 1YW8A 1UB9A 4DYCA 1I3QJ 1QHGA 2BY3A 5EGOA 4XIDA 4CGZA 2BVMA 3K2AA 2ID6A 1YTYA 3GFMA 1P92A 1BC7C 1I1SA 4RDUA 2ZJPF 1Z91A 4QTRA 4A3IJ 4BHCA 3MFKA 3HOZJ 2RREA 2ZCWA 4MO7A 4ZDOA 1TWGJ 2BXYA 1XDSA 1F43A 2XGEA 1EA3A 4OINF 3LOCA 4XONA 3BTLA 3LFKA 3RZDJ 2WAQN 4AD9A 3DBHB 3VFZA 5E18F 1EH8A 1HW5A 2WY7Q 3EUAA 2CU7A 2V9VA 2X6OA 4B48A 4BY7J 4DOZA 3DPUA 3D5SC 1JKRC 1X58A 1O3TA 2KP6A 1U6GA 4UB8C 4LOCA 2V1NA 5BPDA 1USSA 5J1UA 2YU9J 1STZA 1F9NA 1XD7A 2CFXA 1B59A 3FDYA 2NXNB 4MEYF 4UV8A 2R7VA 4HBLA 2E1NA 2OBPA 4L5IA 5FKLA 3ABUA 3S14J 1Y39A 3SQNA 2DMNA 4EQQA 1FP1D 2XROA 4I99C 1UZCA 4RGRA 1P7IA 3S1QJ 3KP6A 4MTEA 1TW3A 2L7FP 4CCLA 1ZG1A 1IRGA 2EFWA 1IXCA 2LF8A 1I5ZA 1W7PA 4I0AA 2JSPA 3SDGA 1R5HA 3ASOH 4J00A 4UUSB 3OSGA 3PNTA 1LE8A 2EA4A 3ZMSA 3LA7A 1V55H 3RIRA 2QQBA 2W57A 1O7LA 3B6CA 4MIMA 1VQ8I 2HQAA 3JREA 1WPKA 1H0MA 3K4MA 4KICA 4Y13A 3R60A 3KLNA 3RPUD 2NOGA 5DTDA 2EIJH 4KISA 4FCYA 1YJWI 5K7ZA 1EJ9A 1R58A 2P5KA 1KYZA 4YEJA 4V2GA 1S7EA 3HUGB 4ZYDA 4Y7NJ 2E36A 2YR2A 3F6OA 1K6OA 3EPZA 3H36A 3FK7A 2FEZA 3ZMDA 1IN7A 4G7HF 3IKVA 3A0HC 2A5YB 3VEPA 2EILH 2HYFA 1PUFB 4AYBN 3LAPA 3KEQA 1ZG3A 2B7EA 2P81A 3S16J 2OCCH 5IOYA 4EJTA 3W3CA 4RB2C 1JUPA 3MWMA 3HG9A 2UV1A 4E7HA 5LRSA 3CZ6A 3QPTA 3AG2H 2NVXJ 4B44A 4UHTA 4IF4A 2JVGA 1P9QC 1B72B 2HQRA 1BM9A 3LSRA 3H9JA 2LY9A 5B66C 3HKZA 4KDPA 5C4XJ 2JZYA 4GCVA 1QZYA 2VJ4A 3FXRA 1G3WA 2L3DA 3PNYA 1JUSA 5FB2A 1IDYA 2XHKA 4AVPA 1YYVA 2DPUA 3BZKA 2L4AA 3OYMA 1O4XA 4N9IA 2VPRA 2J5PA 3GX4X 4F55A 2E2IJ 1WQ2A 3PIPF 5E3MA 2J5OA 4AIHA 1EV7A 2AXLA 4DGWB 2JA6J 4OIPF 1OYIA 4HZFA 4LITA 3SXYA 2NVTJ 2XAFA 3GLLA 1IDZA 2IRFG 1R1UA 3ZQQA 3IRRA 3KE2A 5D5UB 1BC8C 3F6VA 5BNGA 1OCCH 3P9IA 4O3MA 2JK3A 4LD5A 3CF2A 2LDUA 4M3EA 4XOPA 1IF1A 3VYTB 3RJPA 3EYIA 1YHQI 3KP3A 2YSRA 3C1DA 4C3IJ 1B6AA 2L4MA 3OYBA 3FKJA 2GQQA 2DMPA 1V3FA 1E17A 3PFYA 2ETHA 3OS0A 2QENA 3CP2A 4XNFA 2NOJB 2ZXIA 4RAGA 4IOCF 3CO6C 4RLFA 2BEOA 5D6FA 2M0CA 2V6CA 2FE3A 4I98B 2Z1DA 5FGMA 4F52A 2CGPA 4EVIA 4PJ0C 4XOTA 3ZMZA 2H6CA 2ID3A 2H09A 3S3NA 5LD2C 3I4NJ 2OUMA 2FOKA 5JI6A 4RB1A 2WV1A 3L2VA 1RKTA 2HDDA 2IS2A 4ESFA 1CF7B 3HPHA 1FYKA 3M3YJ 1TW2A 5C44J 1P4XA 4U7DA 4O5VA 2VBWA 3JRIA 2XKPA 3MMYB 2L2OA 3WTZA 3LA2A 5H6QA 1R1TA 1X19A 1ZREA 2BOLA 5FKKA 3T1BA 2VT2A 2XAHA 2WY8Q 4FASD 1HCRA 5JHFA 2GXGA 3V4GA 1BBYA 2VKHA 4ETSA 2OTJI 3NQOA 2COMA 1R00A 3FXUA 1VQMI 1APLC 1L0OC 5JR3A 2Y2ZA 2Q2EB 4U0VA 4BXUA 4I01A 1ENHA 5E1WA 2WTEA 3TOBA 5GAHJ 4H0EA 2ECCA 1O3QA 2XASA 2V7FA 2FBIA 3WGIA 2XF5A 1XSDA 4KT5C 3TW7A 4L9NA 5FKNA 2A6HF 1QZEA 3ZRGA 1U8BA 2CQQA 3A01A 1G2HA 4NQWB 2BY1A 3LSGA 2M5WA 1EKEA 4BU2A 1ZQ3P 2OD5A 4AM3A 4GO1A 1FYMA 1FY7A 3KP7A 3K2ZA 3FXKA 3M4OJ 2V1XA 2MLKA 1BA5A 1TBXA 1X1AA 3CDHA 4WXCA 1ODDA 5LHGA 3JRDA 2RDPA 3JRCA 3HRMA 2OTLI 1MNDA 2R93J 2K02A 2L9VA 1Y56A 3VYUB 3FHNA 3GXOA 2EB7A 4BHBA 2M8EA 2RKHA 3FMQA 1XX5A 4BHPA 1OFCX 4LG3A 2UWMA 3CLOA 2MFZA 1I27A 4WK8F 4YFXF 3ZMVA 5JHUA 2WA0A 4D5CA 2DK8A 2X48A 4NBQA 1D0ZA 4CYDA 4DYQA 2WV0A 4U0YA 4EGZA 3T8RA 3TO9A 3GW2A 1S5LC 2A07F 3I9V2 3BC8A 4DIQA 3EQLF 3L2UA 4EJUA 2KLOA 3DEEA 1JE8A 1B9MA 5BOXA 3ZQHA 1WRJA 3DU6A 2JQ7A 2DFHA 2P8TA 2ZXWH 4BNCA 2CH0A 2CO5A 3C7JA 3BWGA 1D1CA 1J75A 4A3JJ 1RKWA 5JLXA 2GLOA 2Z99A 4L5EA 1P2FA 4JX4A 4G7OF 2L54A 1K4TA 3EYYA 3DPLC 1G4DA 3MQ0A 4XICA 2LBFB 3SHFA 5ICFA 5FFXA 3ZCOA 2DFFA 3FWEA 5L3EA 1T08B 2RQQA 3B02A 1YJNI 4QLCU 3M07A 2UXXA 5E3LA 2V4JC 4PJJA 2E1MB 3HOSA 1TWFJ 1XMXA 2A6TA 2X4HA 3E5QA 2Z5UA 1WSUA 4RAYA 3CCSI 1KU2A 2IGNA 1Z67A 5C3EJ 3ZQCA 5H20A 1MMDA 2EFOA 3A1YA 3HB9A 4RGXA 1TC3C 1S9HA 1TNSA 2QA4I 5J1YA 1VQ4I 2PMZN 5BQTA 3AL0B 1VQLI 1BI1A 1LUJB 5F1JA 1S3JA 1I50J 2YPRA 3FZVA 1GV2A 5DYMA 5HOOA 1GXPA 4NB5A 3EETA 2DT7B 2O03A 2DA2A 4RMNA 1IRZA 2YX7A 4ITVA 5GAGJ 3BZCA 1UAAA 1XDUA 2QM3A 1DGWY 2DA6A 2VOPA 2HVRA 2AS5F 3RQ4A 4HLYA 1FIAA 1S6LA 2R7DA 2ZJ2A 5J4YA 2E60A 2Q0OA 2E5ZA 3JW4A 2FQ4A 3PSFA 3JRFA 4IHWA 2MG4A 1R5GA 5HDNA 1PUEE 1T6SA 1JKQC 1OCOH 3HYIA 1X2MA 1YO5C 1S7OA 4HNUA 1U5TB 4CCNA 4DJAA 1N25A 4XRSA 3RYPA 3WTWC 3HEFA 4NDLA 4BQAA 4A3LJ 1YS6A 2FJ1A 2W25A 3C3WA 3K1NA 4F92B 3R4KA 5DUKA 1TL8A 4XQFA 4F3QA 5H6RA 1IO2A 3HJEA 3A0BC 1Y1VJ 1Z05A 3VSKA 3GZNB 5J40A 2Y48A 4LK1F 3L2WA 2HTJA 1P4WA 1MH4A 4EJOA 4A3DJ 2O9LA 4V2FA 3CCMI 4TV7A 3RQIA 1NH3A 3TL4X 1PVEA 1MSFC 2CQ7A 1QHHD 4EV0A 3CDLA 3ZPLA 4FETA 1WGXA 3CQZJ 3H92A 3DCFA 4EJVA 5GAEJ 4G9YA 3R6SA 5A2QK 4AC0A 1OR7C 2HVQA 3OMYA 4V19K 5D5VB 2ELHA 3AG1H 1R49A 4HW0A 4LG0A 1QPIA 3GTGJ 3MZ8A 2QLZA 2R7UA 2P5VA 3KIOA 2FRHA 2P5LC 1XS9A 2HR3A 3CUQB 3CCUI 1EH7A 3DTKA 4A93J 4OAZA 1RRJA 2AQFA 1TWAJ 1UHSA 4BJTA 2JMWA 3TKYA 4LMYA 1JKOC 2W1OA 1OLTA 4E70A 2OF7A 3S2HJ 2G7UA 2DA5A 4DYRA 4UB6C 2HYGD 2FNPA 3KCCA 1FMVA 5J8FA 3S15J 3B73A 3GZ5A 3OYAA 1PP8F 2CQNA 1DQUA 1R22A 2K3FA 2K5CA 2DBBA 3ZQIA 1K6YA 1U8RA 1MBFA 4JX6A 1GHCA 1YX3A 2R7QA 2DOEA 3IH2A 4A3BJ 2DT5A 2EPFA 2IW5A 3TEDA 4OWRB 1VTNC 4RGUA 3W2WA 3C18A 4XRMA 5E1ZB 3GO5A 1ZGJA 1O3RA 4ON0A 1E3HA 1YG2A 3M1EA 3R61A 2Z33A 2XPWA 1Y8RB 2Y75A 2DQLA 3U9GA 2EH3A 1LVKA 3M8FA 3V7RA 1ZR2A 2FX0A 3C2GA 2DDAA 3GTPJ 4MFDA 2BHYA 3TMOA 1OYYA 4BL0B 2ZFWA 5LFAA 2EBIA 3VYRB 1A5JA 2M3AA 2F5CA 2DFEA 1HW2A 4BACA 1VZ0A 3L9FA 2JRMA 1NG7A 3IKTA 1ZGWA 4M74A 2I5UA 1LFPA 4RB3C 5A2QZ 4E7LA 2X51A 2DA4A 4EM0B 1YRNA 1IUFA 1TWHJ 2F4MB 1T33A 1LEBA 4CCMA 1SFXA 3JSOA 3TQNA 2RC4A 1HKTA 2JSCA 2VQLA 5F1RA 4KUMA 4B47A 4X0GA 1LNWA 3QRFF 3I59A 4CYCB 3CF5F 4M3FA 4CICA 4I09A 3FBIB 3AFHA 5FKOA 1ETOA 2KFDA 1HKQA 2MC4A 1LDDA 2EIKH 2XRLA 4M73A 1SFUA 1ETKA 2XSJC 3DFGA 3KZIC 2XC7A 4LLLA 2XAGA 3CD6I 3L7WA 5HS8A 2FOWA 2KL4A 2KKOA 5KNLA 3OYNA 3OOPA 3GYHX 1JJ8C 5EEGA 2DODA 2MC3A 3L09A 3H3VK 2KRFA 2XGXA 2HKOA 5TGTA 4ZH4F 2NAZA 3I55I 2XF6A 5K5QA 1TT5B 1V5EA 1S8NA 3HZJA 4C30A 3ZMUA 3ESWB 3OYGA 1VQPI 4GYGA 2YU3A 3CMMA 4XKBA 1OCPA 2PJPA 2D45A 3TW6A 1HA8A 3LSTA 4BS9A 1DGRM 2K9NA 1U9OA 4JP0A 3KP2A 2VQHA 4ZYAA 4J19A 1HBXG 3QOEA 2X9DA 2QCOA 3BR5A 4XLEA 1ETVA 2LVSA 1L3LA 2W85A 1WCMJ 2R0QC 3GF2A 3MZHA 4ZYGA 2FXAA 3W6KB 5LEJA 2P6SA 2OV7A 4HSTA 4IRGA 1KU3A 5CQGA 3PSIA 4WXHA 3CTAA 3E6MA 2JWTA 2JA2A 4D7NA 2FBKA 2ZO4A 3AG4H 2VB6A 3ABMH 2QWWA 5HLIA 1T2KA 1FX7A 2OZUA 3FBNB 2ZC2A 2QZ8A 4JX5A 4Y15A 3NEUA 2WADA 5AONA 4A0YA 1E0EA 2QQ8A 2CUEA 4D5FA 3GFJA 3J7ZI 2LSOA 4G6DA 4XN3A 4RAFA 1IAWA 3TOAA 1OR7A 4PDKA 3ERED 4L0ZB 2LC2A 3CLQA 5J1RA 3CUOA 4E4HA 1LVAA 3HUGA 3WU0A 5DCMB 3QPSA 4KIFA 3KP4A 1ZN2A 2M7AA 2EWNA 3TBIA 1Y8QB 1FOXA 3QU3A 4UUVA 3DU5A 1V54H 5FD6A 2GIVA 1K4SA 4BEHB 1FMWA 1HDDC 1XC5A 2HNHA 1IXSB 1GLNA 1T95A 3DF8A 3E6DA 2EV5A 4A5NA 5FJ8J 3IAS2 1MKMA 4EM1A 2PG4A 3BCBA 4IVNA 2OU2A 2EZKA 3RSNA 2B9SA 3FISA 4Y17A 5K7HA 2XV4S 4HV5A 4IL6C 4OU0A 1B72A 2ICWG 4W1UA 3QYFA 4U7BA 2NNYA 1MBEA 4OAYA 4CSWA 2XSDC 4KIBA 1JKPC 2VC0A 4BBRJ 4RBOA 3CP8A 3CMEI 4B4CA 2GOXB 4KITB 1SEUA 3ONQA 4Q47A 2QQAA 3W2AA 1IGNA 4M6YA 2X0LA 3OYDA 1OQYA 2HEOA 4RAZA 3K4KA 4N0BA 1A36A 1KQ9A 2QBYB 2A3SA 2KHMA 3A03A 1XPXA 5CKTA 4CDGA 1SD5A 2GM4A 3LA3A 5GPCA 1ZRCA 3CC4I 4QPOA 4WX9A 4GGGA 3EUKL 3K1PA 3V8LA 5HS9A 2DPDA 2HZTA 2K9SA 5E79C 4OMYA 2JA7J 2O8XA 2CWEA 1ZGAA 2BW3A 3FX3A 4XSXF 3DEWA 5L3GA 5J8CA 1G3SA 1Z0XA 2KZGA 5E8IA 1FSEA 3H0GJ 4KN7X 3HOXJ 2GAUA 2Z9OA 3NRVA 3IHUA 2E5NA 1HXDA 5HS7A 1SVOA 2CUFA 3OYJA 5DD4A 1I6XA 4E7SA 1AU7A 1GDTA 2KJBA 1K79A 5HLGA 2R4GA 5L3DA 4C2UA 4GXOA 4JBAA 2XAJA 2TCTA 3G1OA 3F22A 9ANTA 3SJMA 2NYXA 3G73A 1XSVA 2XRNA 2CSOA 2BGCA 3ELKA 3NWTA 4C2MJ 2K9QA 4OIQF 2I8DA 3G6EI 1RPWA 5D4RA 4C3JJ 2M1BA 2Y0SN 1MDMA 4R8HA 4P55A 4HG2A 5FLVA 4BJ5C 1ULYA 2XUBA 1NK3P 5GTIC 2R7WA 2NNNA 4HDUA 3O3KA 3I64A 2HDWA 1W5CC 2ELKA 1YFHA 3WODF 5BPIA 3OR2C 2ME0A 3S1MJ 1ERDA 2VBYA 3H5RA 3LMMA 5F04A 2WC2A 3UNGC 5AIPA 2M9HA 4CCJA 2ZMEB 1QVTA 1DPUA 4Q5SF 3TO6A 2KJCA 3HOYJ 3FF5A 3QP6A 1B4AA 3Q0VA 2FF4A 1EH6A 2K4BA 3DXJF 2QKLB 3OYLA 4FX4A 1TT0A 3JRGA 1LJ9A 2Q2EA 1YW7A 4YELA 5ICEA 3M1CA 3WE2A 1JJ6C 3GFIA 2RAEA 1V4RA 1BJZA 2K85A 4AWXB 5ICGA 1A31A 1U2WA 4RM3A 2CFOA 2WB1N 4NQWA 4S05A 4JYKA 4M3BA 3PQJA 5EG0A 1MSEC 1AHDP 1R4MB 2VASA 3PUFA 4ENJA 1YIOA 5DS9A 2EIMH 3DWLE 2L5QA 4RGSA 5LHIA 2ZXHA 1A04A 1BI0A 2LD5A 4XLFA 2E35A 1IN6A 4PFOA 3WHBA 3V8JA 3CJTB 3C2HA 3FXJA 3E5UA 3SDBA 2IT0A 3KYLA 1QVUA 1LEAA 2Z3YA 1IV8A 2ZSHB 2DFIA 3UR3C 1GVJA 2VXDA 2VQGA 2X85A 3VDXA 2W24A 2L9NA 4CCOA 1FPQA 3S93A 2HZDA 3H5AA 1ZRDA 1CGPA 3AAFA 2Z2SB 4IXAA 3ZOBA 4MQ9F 2JUCA 3IH4A 5CVRA 2FMYA 1S72I 1W7PB 1QGPA 3GEZA 1F4KA 3QPLA 5KCMA 2GWRA 4R79A 1D8JA 1J0RA 1X1DA 5CLSA 4Z6YA 1LE8B 3H3ZA 4J01A 4A3GJ 3PUBA 3KZYA 2A05A 1RZ4A 3ERMA 1GV5A 4HYEA 4XBFA 1OISA 2DA7A 3P7NA 4RA2A 2X6WA 5HVQC 3IL2A 2K3PA 2HQNA 4PFPA 5J47A 4Q4ZF 1D5VA 2LBFA 3G4SI 4A3FJ 1SFKA 2VJ5A 2VOOA 3BR2A 1E3OC 1W0UA 1H8AC 2QKMB 5F0CA 4N4OB 2HPMA 2TRTA 3PM1A 3PIOF 1XMKA 1D8KA 2R5ZB 1VQKI 2V1UA 1IRFA 2ZNZA 1MW7A 3BQZA 3CCQI 3MD2A 3WG7H 4EMSA 3WTVC 3GBGA 3MKLA 3PJRA 3D1NI 2E2JJ 4A6DA 2XPVA 1R7JA 2WAQA 3A4CA 4JQFA 4P9UA 1DP7P 3HRSA 1W5SA 5JFRA 1R71A 1QA6A 2F5EA 4UVBA 3G3ZA 1MGTA 1QNTA 5B1AH 3SYTA 4BXXJ 3HHHA 2LH9A 2PI0A 3PNVA 2O0YA 2ISYA 3HSFA 4RB0A 1D3YA 2IA0A 2R5YB 2DO7A 3WU1B 3BTJA 3BR0A 2H8RA 1YITI 1FP2A 5EEHA 2A6EF 4HRIA 1ZTRA 1R6RA 3FXQA 2QYOA 3F0CA 3QU6A 5ERIA 4HF1A 4M9ZA 2QQ9A 1T56A 1J7KA 1IN8A 3FKIJ 3ZP5A 4HA8A 1WKMA 2ISZA 4I76A 1P4AA 3FXMA 1FIPA 3TP0A 2D1VA 2VC1A 5E3OA 3QYBA 4JOMA 4LIUA 1PP7U 3ROUA 5B1BH 1BOBA 1JTYA 1FWZA 4B09A 2RN7A 4LLNA 2KRHA 3JRHA 1IJWC 3BR6A 4B8XA 2CJJA 4ENNA 2AXTC 3L00A 3IP4B 1U0JA 3ZQFA 4B3AA 1VQ5I 1QQIA 4PGHA 1RETA 2O8KA 5K1YA 3MKYB 2CYYA 1RI7A 3QP5A 2JTVA 5LLQA 2VE9A 5F6FA 4IPAA 4XK4A 2ZSIB 1Q1VA 2G7HA 3BCAA 3GVAA 3I58A 1RESA 5IOZA 2V79A 3SEQA 5F27A 3ZQGA 4AU7A 2OA4A 1UCRA 4G94A 1Z3YA 3D5RC 3IH3A 3CDIA 4KJZA 3BR3A 2ME6A 4G6QA 1XSXA 2F5FA 4BQNA 5HLHA 3CCJI 3AKZA 3OYIA 3CESA 4BE1A 1H9GA 1K78A 2VKVA 1Z77A 2ZKZA 1MD0A 1RC9A 4ENMA 2VBXA 4XLHA 1JHHA 1VNDA 2DLLA 2LMDA 2VT3A 4XRFA 1VQ7I 4OIOF 1X3ZB 2LR8A 1VI0A 3E6BA 3MAJA 4QSHA 2HWVA 3I4MJ 2XPUA 2I10A 5AIQA 5D5WB 1REPC 3DKYA 3K10A 2PEXA 4Y3OA 2KRCA 4CA0A 2X6XA 2FMLA 1VQ9I 1HW1A 3M9AA 5CYVA 3S3MA 1ZRFA 2EQRA 4BE0A 2KIMA 3OYCA 3CC2I 4S04A 4DBQA 3GMEA 2BYVE 1LDKB 3F23A 3E6CC 3GZ6A 4BJ6C 5KAIC 2PX9A 2M4KA 3FHZA 2IEKA 2JJ7A 4MFEA 4HOBA 2IAIA 3S2WA 2E2HJ 1QO0D 2VE8A 2OC6A 2M4GA 2W00A 4X6AJ 4PJNA 1DDNA 3I0TA 1WH5A 4KIGA 1I3AA 3M8EA 2LKXA 2IGKA 3T0YA 3BJ6A 3DBLB 5E3NA 3KETA 3KFWX 2ZJRF 2W7NA 1YIJI 3QODA 4BBSJ 4ZYEA 4LIVA 2NVYJ 4CH7A 5E20A 4MEXF 1MZBA 2RVCA 1EF4A 3PO3J 1DU6A 1XCVA 2M8GX 2RV8A 3KYDB 4AVZA 5L3FA 2M87A 2F4OB 1G59A 2COBA 1XB4A 2ESHA 2PLYA 4I6ZA 1FZPB 2E7XA 3HOWJ 2PMHA 2FUG2 2DJIA 4EM2A 2R7FA 3RDIA 1LFUP 3FMRA 2PN6A 1YS7A 2R7XA 4G12A 2CRGA 4UV9A 4CYCA 4EGYA 1XGSA 2HOEA 3IAM2 4MLOA 3RKWA 1FJLA 5GTHC 2F4IA 5K7FA 4HX4A 4M3DA 2PJRB 4D9JA 1ZKGA 1BR1A 2FA5A 2YS9A 2QVOA 5EZHA 3CMAI 1E2XA 1Z7LA 3BDDA 3TO7A 3CCRI 3LSKA 4IKFA 2RNJA 5LEKA 1YLFA 1ZLJA 1I6HJ 1VF9A 4JK1X 2HOSA 3J81K 3ULQB 2MLGA 5M5XJ 3CCLI 4FQGA 2NVQJ 1HOMA 2DJNA 2BV6A 1X1BA 1FTZA 1X1CA 1ZR4A 2LF7A 2F6CA 3ABLH 1D0XA 3C2BA 3S1RJ 5FLXK 2EZLA 1O57A 5EF6A 3GFLA 3KYCB 2HDCA 1SFEA 4ZTFA 3HGYA 4E7JA 2V9PA 3OY9A 3W6JB 3J7YJ 3ISPA 1Z7UA 3KP5A 2D2WA 4L9VA 3WU2C 2CUJA 2E34A 2IS6A 3OSFA 3FXOA 3BQYA 4F7ZA 4A12A 2P7VB 3FMSA 3R0JA 3SEZA 2BE5F 4FHTA 5B3SH 2H1KA 2ZBKA 2IP2A 3ECOA 2VQCA 3FK6A 2Z16A 4F91B 2BY2A 4B43A 1TQMA 2DW4A 4G6TB 4ABZA 3DPTA 3SZTA 2VONA 2B0LA 2W4SA 3CJRB 3MN2A 3VSLA 3WTSC 1K61A 1KQ0A 3RZOJ 4IO9F 3REOA 1A35A 3PL8A 2IXSA 4G8XA 3IV5A 1O3SA 2MSYA 3S3OA 2EV0A 2EA2A 1TLHB 3S32A 5LBQA 3D5LA 5DCFA 2XF7A 1DPRA 4XORA 4MQVA 2L9RA 3OS1A 3CO7C 4O6JA 2AHQA 4FE4A 1G3TA 2EJRA 1IG7A 4P96A 1E3PA 1MMAA 1FBUA 3J81Z 2V9KA 2EK5A 4QIWN 4BEHA 2Y9ZA 1Y1WJ 5IT9K 3Q0WA 5BS6A 3GTJJ 5K5OA 2ZJQF 2L9SA 4M3GA 1ON2A 1WI9A 4MHGA 5D8LB 2KIFA 1XN7A 1YX5A 4CUGA 1DUXC 4HPQA 1FOYA 2VLAA 1SC7A 4BH9A 2XGCA 2K86A 2L7KA 3G1MA 1XGOA 1MJ9A 5FLXZ 1X4PA 2FSWA 3BT9A 4A3CJ 1QPMA 2LYCA 2DXIA 1PJRA 3QWLA 1HLVA 1D0YA 1RUOA 2Q1ZB 2IBDA 3H3UA 3M8JA 1KZHA 2IPQX 2R7SA 5EJCA 3N97A 5J4VA 1LFBA 1DP3A 2Q8KA 1X4OA 4WXDA 5EYRA 4E7ZA 2EFNA 2B63J 1YE9A 4II3A 2JRTA 3HKZN 3MZYA 1HKSA 3AG3H 1YQAA 1XGNA 3JTGA 2FQ3A 2H1LA 2WBMA 1D5YA 3VPRA 1G6NA 4LG0B 2XGDA 3U2RA 3PO2J 2QBYA 2LKSA 2PMZA 4U88A 3GWZA 3IUOA 2KISA 3HL2A 4XMYA 4B1RA 4DZPA 3BG3A 2R3SA 2A5WA 2DMUA 2HTSA 3E97A 2IGOA 2KPMA 4XLPF 1JGGA 1OMIA 4GYIA 4XRSG 1XGMA 4BKXA 3SFIA 2DQRA 5H2FC 1N77A 3MKWB 3Q5FA 5JVGF 3GUDA 5ILUA 4LFUA 1Y0NA 4R1HA 4A6EA 3VYSB 1AOYA 1IV6A 5CVVA 2DMQA 2LNBA 4UUSA 5IPAA 2OQGA 2XKOA 1IC8A 5BMZA 4QPQA 3B6AA 4DNCA 2P6TA 3WTUC 1W36C 4HEA2 3LSMA 5IT9Z 1FYLA 3BP8A 4IQJA 3F9KA 4HF2A 4LLGF 4WF2A 1KGSA 1RIOH 2M0MA 3OYHA 3TDUC 3OR1C 3IWZA 1SMYF 1IZ1A 3ASNH 1VQNI 4FE7A 2VODA 3K0LA 2M2EA 4NNJA 2DTZA 4IRHA 4XR6A 2MW8A 2O7OA 1P7JA 3G71I 2XAUA 1Z1DA 2V26A 4D1QA 4AIDA 1PUFA 1NTCA 2DA3A 4KT6A 4XKWA 2WAFA 3F8BA 3GTMJ 3BG5A 3A2KA 3LQRA 3ZN1A 1AA7A 4AUXA 2DOFA 2DOAA 3K9TA 4A5MA 2LLKA 3K4CA 4I7HA 1B8IB 1O7FA 4C2TA 3L2RA 4GDFA 4QWQA 5E8GA 3IWFA 1OYWA 2NS8A 4OOIA 3VWBA 2NS0A 2LP0A 4M71A 1QRYA 2E7WA 2EFQA 2F5VA 3R0AA 3PQKA 2X6YA 1FC3A 3K6GA 3I59B 5KK1A 5M3FJ 1ZHFA 3TDZC 1F36A 2JA5J 3LSPA 1G8XA 4PK4A 4BXFA 2LK2A 2VKDA 3T8TA 3Q0UA 1USTA 4IEJA 2VJIA 5F0FA 1HSTA 4MGRA 1SMTA 3BLYA 2UXNA 1W4MA 1JT6A 3QPHA 3S8PA 3V7CA 4A3MJ 1KQ8A 2BVLA 2L0KA 2DYRH 1ZG5A 1NK2P 4GFBA 5DD8A 1BI3A 3V8KA 2BHZA 3MCZA 4ZZDA 1ZK8A 2LFBA 1WJCA 2GBYA 1TZLA 1UFMA 2E1MC 5DM7F 3BPVA 2H6BA 2CUZA 1NHAA 3HTUA 4BAYA 5HODA 4X1EA 2QGUA 2VPLA 3MVPA 1AKHB 4C3HJ 1SAXA 1U9NA 1QZZA 2EZIA 1OKRA 3I71A 2M34A 2MA3A 1K7AA 3T5XA 3I53A 1BI2A 1BN5A 1XG1A 2DMTA 5CVIA 3AL0C 1SFOJ 3UKGA 2STWA 1MBHA 4S0HB 3LSIA 1N78A 3NAUA 2H8WA 5CVJA 3ZQ7A 3ZMTA 3P9CA 1ETYA 5F08A 3BPXA 2V1DA 4UY8I 1R23A 3ABTA 3O8HA 3HPGA 3GTQJ 4YFKF 4GRIA 2Y31A 3ZN0A 1WWXA 2O61A 4L9JA 3HIFA 2HVSA 1B1BA 3SFZA 3JAMK 3BR1A 4UVAA 1CF7A 3HTSB 3VB2A 2PQ8A 3BJAA 3DP7A 1IXRC 4HQEA 2ACJA 2TDXA 3BG7A 4EJWA 2N8GA 1WI3A 5C4JJ 4XLAA 2STTA 3EDPA 1GUUA 3KEOA 1SD7A 4ASNA 1J09A 1U5TC 2DTRA 5CVUA 3OWTA 4U87A 2VUMJ 1A6QA 1F5TA 2E71A 1IN4A 1JTXA 1VQOI 1RUNA 4PCQA 1J5YA 4ANJA 3G1LA 2DK5A 2G0EA 3L2QA 2NVUB 2R7TA 1YW9A 2CW0F 2V6EA 1A6IA 2BY0A 2DDBA 2R5ZA 4E7IA 1WJAA 5KAFC 3VODA 3NARA 5EGOB 3QQAA 1TQIA 4IZZA 4HAMA 2MD0A 4XLNF 3LAJA 4M9XA 2CV2A 2H27A 4BYYA 1T0FA 1CQTA 3D0SA 1BIAA 2JPBA 3CJQB 3F21A 1LDJA 4IQ4A 3BG6A 1LQ1A 4I02A 2AQEA 4PSWA 3OOUA 4P1WA 3CCEI 2FBHA 5IP6A 3CMYA 2HS5A 3DV8A 1R36A 4N9HA 5J3LA 4ZJZA 3FM3A 2ADUA 5GP9A 3OYEA 5HLTA 2OAZA 1POGA 5EEAA 4FTHA 3HOTA 2VN2A 4AIKA 2R5YA 3W2VA 5FLMJ 4KFCA 1GVDA 4H4KC 1OJLA 3DEUA 4DQ2A 1H9TA 3CUQC 4XM3A 2W48A 1WFXA 1HSJA 2HPIA 2KIUA 4IHXA 2QSFX 4LB5A 3WTXC 5IP9J 1XTAA 3JAMZ 4FT8A 2AO9A 4N4NB 2CW7A 2Y9YA 1SVMA 2RQPA 2DYSH 1ON1A 5TJJA 5M5YJ 2QEXI 3HBLA 4IHYA 4XSZF 4XL9A 1ZELA 2HKXA 3U1DA 2BW3B 1RR8C 3DQVC 4L0YB 4BQOA 4C9YA 1TTYA 2VIXA 5LGTA 3NWSA 1P6RA 2MD5A 2R7OA 1KU7A 4BDZA 4NC6A 3S1NJ 3JRAA 3E1SA 1FBSA 4I0BA 1LB2A 2F5DA 4ESBA 2DAOA 4LGWA 4UUTA 4A3KJ 4II2A 4BUPA 1GXQA 2GXAA 1WJEA 3K7AJ 2RGVA 1OPCA 1Z3XA 3W6VA 1Z6TA 1UMQA 3BTCA 1WJ5A 5FROA 2ELJA 2CG4A 1IN5A 2FD5A 3E3VA 3KLOA 3E0JB 1MDMB 1UJ8A 2FU4A 2ESNA 3ZR8X 3SZPA 2OZ6A 2QUFA 1I1GA 5E1XA 3BTIA 5IT3A 3KEYA 3N05A 1MJBA 1SD6A 3CCYA 2OQRA 1BW5A 2CW8A 4PSXA 4LB6B 2ZNYA 1W0TA 2C6YA 1HDPA 1HC8A 2Y30A 4XKCA 2ZXJA 1RR7A 2R7RA 2A68F 4IHSA 4LJZF 2CQKA 4PGGA 4IHVA 4YIFA 5FO5A 1IRXA 1BW6A 2LTPA 3P9KA 4DZJA 2F48A 5D4SA 3ML6A 1MH3A 2KDOA 3LL7A 3IC7A 4E6KG 5K5RA 1TP4A 2L7ZA 3DTEA 1BOAA 4YIRX 4U0WA 5CJ9A 1F1ZA 1R4NB 3WTYC 1FBQA 3L2CA 2JN6A 2MH2A 3ZGKA 3CC7I 4AIJA 5TRDA 5DM6F 1NG6A 2DI3A 2MABA 2YX4A 3F72A 3TP3A 4EATA 2OPTA 2BZTA 3MKZA 3M7GA 2QSGX 2K4JA 4HSRA 2GZWA 4XLCA 5FD5A 5EG0B 1JT0A 2HGCA 4HF0A 5HDKA 3HM5A 4RLQA 2EV6A 1BL0A 2X1CA 1TQPA 4M72A 4HX8A 4PJMA 1JXSA 3F8MA 1W1WE 1U5TA 2E19A 3HXLA 3LWFA 4NC8A 2JT1A 1QBJA 3QYEA 3I5UA 2R7ZJ 2DCEA 1OCRH 2JPCA 2PFBA 2D1HA 2KIQA 2O5RA 1JGSA 3H5NA 2IA2A 2GA1A 3S17J 3H9QA 3RPQA 2GIZA 2HXOA 2UUZA 1MMSA 3P5JA 2VBZA 2NS7A 1KU9A 3SZGA 3HSRA 2KZVA 3J7AY 2Y0SA 3DLLF 1B9NA 4ZC3A 4W97A 1FT9A 4A0ZA 2ECBA 4NUBA 2K7LA 1DU0A 4D7MA 2G9WA 5B5EC 1SAUA 3BZ6A 2CV1A 1Y0UA 5KHDA 1UG2A 4AYBA 3HDDA 3OIQA 2HXIA 4RM2A 1V5GA 4KYWA 3RTRA 1X3UA 5D5XB 2PJRA 3K4BA 4ZTJA 1I39A 3G2BA 1OCZH 2YUSA 4A69C 2OJED 3HHGA 3BY6A 3OS2A 3DTIA 5D8KB 1ZAOA 2CS3A 3OYFA 2UZKA 3WE3A 3CUQA 1ORKA 4NC7A 2M45A 3Q9SA 3DKXA 3JR9A 2WAEA 4YFNF 2KMUA 4G7ZF 4NHJA 1MMGA 3RYRA 5FFZA 3GTKJ 3H9GA 4HLXA 3ABKH 1R5ID 2WWYA 1Z6RA 4KA4A 1WVRA 1KYWA 4D0PA 1JHFA 2LY2A 3JSPA 2CV0A 4CHUA 3J7AO 2WB1A 1ETXA 2GA2A 4BY1J 5GPAA 3I56I 3PFIA 1FOWA 3HGGA 1LPQA 3X2QH 2D5VA 1VQ6I 2A69F 3TGNA 3K4LA 4BE2A 2HOTA 4M6XA 2O3FA 3A01B 3A02A 1G3YA 4P5OA 1MNMC 3OL3A 5IYDJ 3LSHA 1R9TJ 1X1PA 2OCEA 3GCMA 1W5TA 3JCUC 5L3CA 3E5XA 4YIIA 3WG9A 2XB5A 3QAHA 5M3MJ 1ZYRF 1MIJA 2VL8A 4IHTA 2IA1A 2F2EA 4CZZA 2K9LA 3OV8A 1T39A 3RPUA 5GADJ 3FXLA 2QSHX 3MEXA 3EUHC 1SD4A 2EINH 2M7BA 1PDNC 5FRMA 1ACIA 3N4MA 5TISC 1ZARA 3IRQA 2IVMA 3GTOJ 3Q9VA 1FSHA 1KONA 5J6XA 1BIBA 4K2EA 4PZJA 5IP7J 3F8CA 3ECHA 1W7PD 4I2OA 2XAQA 3I4PA 5DV5A 2GXBA 5L3BA 2HI3A 3KX2A 1MJAA 2P4WA 5E17F 2W82A 4FISA 5JVTA 1YOVB 1WJFA 3GTLJ 6PAXA 1T98A 4MNUA 4BQQA 2XVCA 5ED4A 5FRNA 1YI2I 4ZZLA 2H94A 4IX7A 2L02A 3O6BB 3ZQLA 1BJAA 1SANA 2VKEA 4HQMA 5DUIA 3L1PA 3RI4A 3F8FA 4UNOA 2CMPA 2CQXA 2JVHA 2DU9A 3BG9A 5KVRA 1Q1HA 3J80K 2K40A 3K4NA 2P0WA 3F8NA 1U3EM 1R1VA 1WJBA 3I54A 4A3EJ 1VFCA 2XIGA 1IUYA 5FKMA 2NRAC 1WJDA 2IS1A 3KPHA 3O2PE 1K78B 1X3WB 5D6EA 3WTTC 1IW7F 1K83J 1WZ2A 4ENKA 4CZCA 2LG4A 4PUSA 3K70D 2ZMEC 5M5WJ 2IS4A 3S2DJ 2FNAA 5HDGA 2A61A 4IRIA 5CPRB 2E1CA 2XDVA 3JRBA 2MGQA 5IYCJ 3ZXSA 4Z2YA 2LRDA 1QU3A 3HC7A 2O6GE 4L5JA 1Z21A 2Y0MA 1ZH5A 2IJLA 4OIRF 4A0XA 4M6VA 4IJAA 1W36D 3BOQA 1FLIA 3OYKA 4DBRA 1X2NA 2K9MA 3I3LA 5F0HA 1UHWA 3OIOA 4Y33A 4IOAF 2DN0A 1OCTC 3U21A 1V5FA 1JI8A 5LHHA 2HU9A 3HOVJ 3FM5A 2MH9A 2L7MP 3RKXA 1S7AA 4E7KA 4BGDA 4L18B 4OMZA 2E1OA 3VOEA 4MTDA 5LGNA 5IYBJ 3QOPA 1ZLKA 1ONVA 2X1DA 3DKWA 2RNGA 5DCMA 4ZYHA 2LY1A 3FIWA 4M9SA 3KZZA 2DT6A 3BROA 3RKQA 1C0WA 1FEXA 1N75A 1MBGA 1TWCJ 3H35A 1XCBA 3J80Z 4ESJA 1Y6IA 5CQEA 2HOAA 4ZDLA 4KN4X 1D1BA 1B8IA 4KNYA 3Q3SA 4PJLA 1FNNA 2PMUA 4FX0A 5DDGA 1M1EB 1HF0A 3CJNA 1GT0C 3LNQA 1BR4A 2DA1A 4Q48A 2IGMA 4XKVA 3CCVI 2XB0X 3WGGA 3V7SA 1JUMA 4LK0F 3GLXA 5EDNA 2VI6A 3O8GA 5HNHA 5DEQA 3K4JA 4RS8A 2MBFA 4CO8A 1J2XA 1MBKA 2M30A 4WWCA 2KQRA 1Z9CA 2EZHA 2VJJA 3H1CA 3WHCA 2KDZA 1PYVA 1H88C 2HFHA 2HQ5A 1J59A 2PBIA 1UG0A 2X1EA 4DW6A 1WH7A 4BDYA 3K69A 4ZDPA 1MMNA 1ETQA 5HNFA 4UXNA 1WHUA 2JUGA 1FTTA 5EZGA 3K70C 1AKHA 4HV6A 3EUHA 1ITYA 2LREA 1BR2A 2GOMA 4EEFG 1LKXA 1T0FC 3F3XA 3OL4A 2K27A 4L9TA 4XN0A 1S29A 3RCOA 4YG2F 4F93B 1U78A 1HQCA 3COAC 4KMUX
chains in the Genus database with same CATH topology
4P9FA 1T38A 2LKPA 3HSEA 3K1MA 2VXZA 1UHMA 3HRUA 4UVCA 1TNTA 4CXFA 3JTHA 5LRRA 3LQQA 4HDVA 1J9IA 1KA8A 4KMFA 5ILSA 2EFPA 5LGUA 1RNLA 2BBYA 2L01A 3BJOA 5ILVA 1FOKA 3WGHA 3HRTA 3RKYA 1AWCA 2ZMEA 1XMAA 4WCGA 5F64A 4HX7A 2P7CB 5ICCA 2W84A 4A2UA 1YW8A 1UB9A 4CGZA 1YTYA 3GFMA 1P92A 1BC7C 1I1SA 1Z91A 4BHCA 3MFKA 2ZCWA 1XDSA 4OINF 3LFKA 4AD9A 3VFZA 5E18F 1EH8A 1HW5A 2V9VA 1O3TA 1U6GA 5BPDA 1USSA 1STZA 1F9NA 1XD7A 2CFXA 1B59A 4MEYF 4UV8A 4HBLA 2E1NA 2OBPA 4L5IA 3ABUA 3SQNA 4EQQA 1FP1D 2XROA 4RGRA 3KP6A 4MTEA 1TW3A 1IRGA 1ZG1A 2EFWA 1IXCA 2LF8A 1I5ZA 1W7PA 4I0AA 1R5HA 2EA4A 3ZMSA 3LA7A 3RIRA 2QQBA 2W57A 1O7LA 1H0MA 4KICA 4Y13A 3R60A 3KLNA 1R58A 2P5KA 1KYZA 4ZYDA 1K6OA 3F6OA 2YR2A 2FEZA 3ZMDA 1IN7A 4G7HF 3IKVA 2A5YB 3VEPA 2HYFA 3LAPA 3KEQA 1ZG3A 4EJTA 4RB2C 3MWMA 5LRSA 3QPTA 4UHTA 4IF4A 2HQRA 1BM9A 4KDPA 2JZYA 4GCVA 1QZYA 3FXRA 1G3WA 2L3DA 5FB2A 2XHKA 4AVPA 1YYVA 2DPUA 2L4AA 4N9IA 2J5PA 3GX4X 1WQ2A 2J5OA 4AIHA 1EV7A 2AXLA 4OIPF 1OYIA 4HZFA 3SXYA 2XAFA 2IRFG 1R1UA 3IRRA 3KE2A 5D5UB 1BC8C 3F6VA 3P9IA 4O3MA 4LD5A 2LDUA 1IF1A 3RJPA 3EYIA 3KP3A 2YSRA 3C1DA 1B6AA 2L4MA 2GQQA 1V3FA 1E17A 2ETHA 2QENA 3CO6C 2BEOA 5D6FA 2V6CA 2FE3A 4I98B 5FGMA 2CGPA 4EVIA 3ZMZA 2H6CA 2H09A 2FOKA 5JI6A 4RB1A 4ESFA 1CF7B 1FYKA 1TW2A 1P4XA 4U7DA 4O5VA 2VBWA 2XKPA 3WTZA 3LA2A 5H6QA 1R1TA 1ZREA 3T1BA 2VT2A 2XAHA 2GXGA 3V4GA 1BBYA 4ETSA 3NQOA 2COMA 1R00A 3FXUA 1L0OC 5JR3A 4U0VA 4BXUA 4I01A 5E1WA 2WTEA 3TOBA 4H0EA 1O3QA 2XASA 2FBIA 3WGIA 1XSDA 4KT5C 4L9NA 2A6HF 2M5WA 2OD5A 4GO1A 1FYMA 1FY7A 3KP7A 3K2ZA 2V1XA 2MLKA 1TBXA 3CDHA 4WXCA 1ODDA 5LHGA 2RDPA 3HRMA 2K02A 3GXOA 2EB7A 4BHBA 2M8EA 2RKHA 3FMQA 4BHPA 2UWMA 3CLOA 1I27A 4WK8F 4YFXF 3ZMVA 5JHUA 2DK8A 4EGZA 4CYDA 4U0YA 2WV0A 3T8RA 3TO9A 3GW2A 2A07F 3EQLF 4EJUA 1JE8A 1B9MA 5BOXA 1WRJA 2P8TA 4BNCA 2CO5A 3C7JA 3BWGA 1J75A 2Z99A 1P2FA 4G7OF 2L54A 3EYYA 3DPLC 1G4DA 3MQ0A 3SHFA 5ICFA 5FFXA 3FWEA 5L3EA 3B02A 4QLCU 2UXXA 3HOSA 2X4HA 3E5QA 2Z5UA 1WSUA 4RAYA 1KU2A 5H20A 2EFOA 4RGXA 1TNSA 5BQTA 1BI1A 1S3JA 2YPRA 3FZVA 5DYMA 5HOOA 1GXPA 4NB5A 3EETA 2O03A 2YX7A 1XDUA 2QM3A 2VOPA 2AS5F 4HLYA 2R7DA 1S6LA 2ZJ2A 2Q0OA 3JW4A 1R5GA 5HDNA 1PUEE 1T6SA 3HYIA 1YO5C 1S7OA 1U5TB 3RYPA 3WTWC 4BQAA 1YS6A 2W25A 3C3WA 3K1NA 3R4KA 5DUKA 5H6RA 1Z05A 2Y48A 4LK1F 2HTJA 1P4WA 4EJOA 4TV7A 4EV0A 3ZPLA 3H92A 4EJVA 4G9YA 3R6SA 5A2QK 5D5VB 2ELHA 4HW0A 4LG0A 2QLZA 2P5VA 2FRHA 2P5LC 2HR3A 3CUQB 1EH7A 3TKYA 4LMYA 4E70A 2G7UA 2HYGD 2FNPA 3KCCA 5J8FA 3B73A 3GZ5A 1PP8F 1R22A 2DBBA 1U8RA 1GHCA 2DT5A 2IW5A 1VTNC 4RGUA 3C18A 5E1ZB 3GO5A 1ZGJA 1O3RA 4ON0A 1YG2A 3M1EA 3R61A 2Z33A 2Y75A 2DQLA 3U9GA 3M8FA 3V7RA 1OYYA 2ZFWA 2F5CA 1HW2A 3L9FA 3IKTA 4M74A 4RB3C 5A2QZ 4EM0B 1LEBA 1SFXA 3JSOA 3TQNA 2RC4A 1HKTA 2JSCA 5F1RA 4KUMA 3QRFF 1LNWA 3I59A 4CICA 4I09A 4M73A 1HKQA 1LDDA 1SFUA 3DFGA 4LLLA 2XAGA 3L7WA 5HS8A 2KKOA 3OOPA 3GYHX 5EEGA 2MC3A 3L09A 2KRFA 2XGXA 2HKOA 4ZH4F 2NAZA 5K5QA 1S8NA 3ZMUA 4GYGA 2YU3A 2PJPA 2D45A 3LSTA 3KP2A 1HBXG 1L3LA 2W85A 3GF2A 3MZHA 4ZYGA 2FXAA 3W6KB 5LEJA 2P6SA 4IRGA 1KU3A 4WXHA 3CTAA 3E6MA 2FBKA 2ZO4A 2QWWA 5HLIA 1T2KA 1FX7A 2OZUA 2QZ8A 4Y15A 3NEUA 5AONA 4A0YA 3GFJA 2LSOA 4G6DA 1IAWA 3TOAA 1OR7A 4PDKA 3ERED 4L0ZB 3CUOA 1LVAA 3HUGA 3WU0A 5DCMB 4KIFA 3KP4A 1ZN2A 2EWNA 3QU3A 4UUVA 5FD6A 2GIVA 1IXSB 3DF8A 3E6DA 4A5NA 2EV5A 1MKMA 4EM1A 2PG4A 4IVNA 2OU2A 4Y17A 2XV4S 4HV5A 4OU0A 4U7BA 2NNYA 4KIBA 2VC0A 4Q47A 2QQAA 4M6YA 2X0LA 2HEOA 4RAZA 4N0BA 1KQ9A 2QBYB 2A3SA 4CDGA 1SD5A 3LA3A 1ZRCA 4WX9A 4GGGA 3K1PA 3V8LA 5HS9A 2DPDA 2HZTA 4OMYA 2O8XA 2CWEA 1ZGAA 3FX3A 4XSXF 5L3GA 5J8CA 1G3SA 5E8IA 1FSEA 4KN7X 2GAUA 2Z9OA 3NRVA 3IHUA 1HXDA 5HS7A 5DD4A 1I6XA 2KJBA 1K79A 5HLGA 5L3DA 4GXOA 4JBAA 3F22A 2XAJA 2NYXA 3G73A 1XSVA 2XRNA 2CSOA 2BGCA 3ELKA 4OIQF 5D4RA 2M1BA 1MDMA 4R8HA 4P55A 1ULYA 2XUBA 2NNNA 4HDUA 3O3KA 3I64A 1YFHA 3WODF 5BPIA 2VBYA 2WC2A 5AIPA 2ZMEB 1DPUA 4Q5SF 3TO6A 2KJCA 3FF5A 3QP6A 1B4AA 2FF4A 1EH6A 2K4BA 3DXJF 4FX4A 1LJ9A 2Q2EA 1YW7A 5ICEA 3WE2A 3GFIA 1V4RA 4AWXB 5ICGA 1U2WA 4NQWA 4S05A 3PQJA 4ENJA 1YIOA 4RGSA 5LHIA 1A04A 1BI0A 1IN6A 3V8JA 2IT0A 3E5UA 1LEAA 2Z3YA 2DFIA 1GVJA 2W24A 1FPQA 1ZRDA 1CGPA 3AAFA 4IXAA 4MQ9F 5CVRA 2FMYA 1W7PB 1QGPA 3GEZA 1F4KA 2GWRA 4R79A 1D8JA 1J0RA 5CLSA 3H3ZA 3KZYA 1RZ4A 4HYEA 4XBFA 3P7NA 5HVQC 3IL2A 2HQNA 4Q4ZF 1D5VA 2VOOA 1XMKA 1D8KA 2V1UA 1IRFA 2ZNZA 4EMSA 3WTVC 4A6DA 1R7JA 4JQFA 4P9UA 1DP7P 3HRSA 1W5SA 5JFRA 2F5EA 4UVBA 3G3ZA 1MGTA 1QNTA 3HHHA 2PI0A 2O0YA 2ISYA 3HSFA 4RB0A 1D3YA 2IA0A 2DO7A 3WU1B 1FP2A 5EEHA 2A6EF 3FXQA 2QYOA 3QU6A 5ERIA 4HF1A 4M9ZA 2QQ9A 1J7KA 1IN8A 3ZP5A 4HA8A 1WKMA 2ISZA 1P4AA 2D1VA 2VC1A 1PP7U 3ROUA 1FWZA 4B09A 2RN7A 4LLNA 4B8XA 4ENNA 3L00A 1QQIA 4PGHA 5K1YA 2CYYA 1RI7A 3QP5A 2JTVA 5LLQA 2VE9A 5F6FA 4IPAA 2G7HA 3I58A 3GVAA 2V79A 2OA4A 1UCRA 4G94A 4G6QA 1XSXA 2F5FA 5HLHA 1K78A 1H9GA 2ZKZA 1MD0A 4ENMA 2VBXA 1JHHA 2DLLA 2VT3A 4XRFA 4OIOF 3MAJA 3E6BA 2HWVA 5AIQA 5D5WB 1REPC 2PEXA 2FMLA 1HW1A 3M9AA 5CYVA 1ZRFA 2KIMA 4S04A 2BYVE 1LDKB 3F23A 3E6CC 3GZ6A 3FHZA 4HOBA 3S2WA 1QO0D 2VE8A 1DDNA 3I0TA 4KIGA 3M8EA 3T0YA 3KETA 3BJ6A 3KFWX 4ZYEA 5E20A 4MEXF 1MZBA 2RVCA 1XCVA 2RV8A 5L3FA 2M87A 1XB4A 2ESHA 2PLYA 1FZPB 2E7XA 2PMHA 4EM2A 2R7FA 3RDIA 3FMRA 2PN6A 1YS7A 4UV9A 4EGYA 1XGSA 2HOEA 3RKWA 4HX4A 2FA5A 2QVOA 1E2XA 3BDDA 3TO7A 2RNJA 5LEKA 1YLFA 1ZLJA 4JK1X 3J81K 3ULQB 2MLGA 2BV6A 2LF7A 5FLXK 1O57A 3GFLA 2HDCA 1SFEA 3W6JB 3ISPA 1Z7UA 3KP5A 2D2WA 4L9VA 4F7ZA 4A12A 2P7VB 3FMSA 3R0JA 2BE5F 4FHTA 2ZBKA 2IP2A 3ECOA 1TQMA 2DW4A 3DPTA 3SZTA 2VONA 2B0LA 3WTSC 1KQ0A 3REOA 4G8XA 1O3SA 2EV0A 2EA2A 1TLHB 5LBQA 3D5LA 5DCFA 1DPRA 4MQVA 3CO7C 4O6JA 1G3TA 2EJRA 4P96A 1FBUA 3J81Z 2EK5A 5IT9K 5BS6A 5K5OA 1ON2A 1WI9A 4MHGA 5D8LB 2KIFA 1XN7A 1DUXC 4BH9A 2K86A 1XGOA 1MJ9A 5FLXZ 2FSWA 1QPMA 1RUOA 3H3UA 2IPQX 3N97A 2Q8KA 4WXDA 2EFNA 2JRTA 3MZYA 1HKSA 1YQAA 1XGNA 3JTGA 2FQ3A 1G6NA 4LG0B 3U2RA 2QBYA 4U88A 3GWZA 2R3SA 3E97A 4XLPF 2HTSA 1OMIA 4GYIA 1XGMA 2DQRA 3Q5FA 3GUDA 5ILUA 4LFUA 4R1HA 4A6EA 1AOYA 5CVVA 2LNBA 2OQGA 2XKOA 5BMZA 4DNCA 2P6TA 3WTUC 5IT9Z 1FYLA 3BP8A 4HF2A 4LLGF 4WF2A 1KGSA 1RIOH 3TDUC 3IWZA 1SMYF 1IZ1A 2VODA 3K0LA 4IRHA 1Z1DA 3F8BA 3LQRA 3ZN1A 3K9TA 4A5MA 4I7HA 1O7FA 4QWQA 5E8GA 3IWFA 1OYWA 4OOIA 2NS0A 4M71A 2E7WA 2EFQA 3R0AA 3PQKA 1FC3A 3I59B 5KK1A 1ZHFA 3TDZC 3T8TA 1USTA 1HSTA 4MGRA 1SMTA 3QPHA 2UXNA 1W4MA 1KQ8A 3V7CA 1ZG5A 5DD8A 1BI3A 3V8KA 3MCZA 4ZZDA 1UFMA 3BPVA 2H6BA 1NHAA 3HTUA 4BAYA 1SAXA 1QZZA 1OKRA 3I71A 2MA3A 1K7AA 3T5XA 3I53A 1BI2A 1BN5A 5CVIA 2STWA 5CVJA 3ZQ7A 3ZMTA 3P9CA 3BPXA 2V1DA 1R23A 3ABTA 4YFKF 3ZN0A 1WWXA 2O61A 4L9JA 3HIFA 1B1BA 3SFZA 3JAMK 4UVAA 1CF7A 3HTSB 3VB2A 2PQ8A 3BJAA 3DP7A 1IXRC 4HQEA 2ACJA 2TDXA 4EJWA 2STTA 3EDPA 3KEOA 1SD7A 4ASNA 1U5TC 2DTRA 5CVUA 1F5TA 1IN4A 1RUNA 4PCQA 1J5YA 2DK5A 1YW9A 2CW0F 3VODA 1TQIA 4HAMA 4XLNF 3LAJA 4M9XA 2H27A 4BYYA 1T0FA 3D0SA 1BIAA 2JPBA 3F21A 1LDJA 1LQ1A 4I02A 2FBHA 2HS5A 3DV8A 1R36A 4N9HA 3FM3A 2ADUA 2OAZA 3HOTA 2VN2A 4AIKA 4KFCA 3DEUA 4DQ2A 1H9TA 3CUQC 1HSJA 2KIUA 4LB5A 3WTXC 3JAMZ 4FT8A 2RQPA 1ON1A 5TJJA 4XSZF 2HKXA 3U1DA 4L0YB 3DQVC 1TTYA 5LGTA 1P6RA 2MD5A 1KU7A 1FBSA 4I0BA 1LB2A 2F5DA 4ESBA 2DAOA 4LGWA 1GXQA 2RGVA 1OPCA 1Z6TA 2CG4A 1IN5A 3E3VA 3KLOA 1MDMB 2FU4A 2ESNA 3SZPA 2OZ6A 2QUFA 1I1GA 5E1XA 5IT3A 1MJBA 1SD6A 2OQRA 4LB6B 2ZNYA 2C6YA 2ZXJA 2A68F 4IHSA 4LJZF 2CQKA 4PGGA 4YIFA 5FO5A 3P9KA 5D4SA 3ML6A 3IC7A 5K5RA 1BOAA 4U0WA 5CJ9A 1F1ZA 3WTYC 1FBQA 3L2CA 2MH2A 4AIJA 5TRDA 2DI3A 2YX4A 3F72A 3M7GA 2K4JA 2GZWA 5FD5A 2HGCA 4HF0A 5HDKA 2EV6A 1TQPA 4M72A 4HX8A 1JXSA 3F8MA 1U5TA 3LWFA 2JT1A 1QBJA 3I5UA 2JPCA 2PFBA 2D1HA 1JGSA 2IA2A 2GA1A 3RPQA 2VBZA 1KU9A 3HSRA 1B9NA 1FT9A 4A0ZA 2K7LA 2G9WA 3BZ6A 1Y0UA 4KYWA 3RTRA 1X3UA 5D5XB 3HHGA 3BY6A 5D8KB 1ZAOA 2UZKA 3WE3A 3CUQA 2M45A 3Q9SA 4YFNF 4G7ZF 4NHJA 3RYRA 5FFZA 4HLXA 2WWYA 1Z6RA 4KA4A 1KYWA 4D0PA 1JHFA 3JSPA 3J7AO 4CHUA 2GA2A 3PFIA 2A69F 3TGNA 4M6XA 2O3FA 1G3YA 4P5OA 1W5TA 5L3CA 3E5XA 4YIIA 3WG9A 3QAHA 1ZYRF 4IHTA 2IA1A 2F2EA 4CZZA 3OV8A 1T39A 3RPUA 3MEXA 1SD4A 1PDNC 3N4MA 1ZARA 3IRQA 2IVMA 3Q9VA 1FSHA 5J6XA 1BIBA 4K2EA 4PZJA 3F8CA 3ECHA 1W7PD 4I2OA 2XAQA 3I4PA 5DV5A 2GXBA 5L3BA 1MJAA 2P4WA 5E17F 5JVTA 6PAXA 1T98A 4MNUA 5ED4A 2XVCA 4ZZLA 2H94A 2L02A 3O6BB 1BJAA 5DUIA 4HQMA 3RI4A 3F8FA 4UNOA 5KVRA 2DU9A 1Q1HA 3J80K 3F8NA 1U3EM 1R1VA 3I54A 2XIGA 1IUYA 2NRAC 3O2PE 1K78B 5D6EA 3WTTC 1IW7F 4ENKA 2FNAA 5HDGA 2A61A 4IRIA 2E1CA 4Z2YA 2O6GE 4L5JA 2Y0MA 1ZH5A 2IJLA 4OIRF 4A0XA 4IJAA 3BOQA 1FLIA 1UHWA 5LHHA 3FM5A 2MH9A 3RKXA 1S7AA 4L18B 4OMZA 3VOEA 4MTDA 5LGNA 1ZLKA 3QOPA 1ONVA 3DKWA 4ZYHA 5DCMA 4M9SA 3KZZA 3BROA 1C0WA 1XCBA 3J80Z 4ESJA 4KN4X 4KNYA 1FNNA 2PMUA 4FX0A 5DDGA 3CJNA 4Q48A 3WGGA 3V7SA 4LK0F 3GLXA 5DEQA 4RS8A 2MBFA 4CO8A 1J2XA 2M30A 4WWCA 1Z9CA 2HFHA 1J59A 2PBIA 3K69A 4UXNA 4HV6A 3EUHA 3F3XA 2K27A 4L9TA 1S29A 4YG2F 1U78A 1HQCA 3COAC 4KMUX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9F A;  1T38 A;  2LKP A;  3HSE A;  3K1M A;  2VXZ A;  1UHM A;  3HRU A;  4UVC A;  1TNT A;  4CXF A;  3JTH A;  5LRR A;  3LQQ A;  4HDV A;  1J9I A;  1KA8 A;  4KMF A;  5ILS A;  2EFP A;  5LGU A;  1RNL A;  2BBY A;  2L01 A;  3BJO A;  5ILV A;  1FOK A;  3WGH A;  3HRT A;  3RKY A;  1AWC A;  2ZME A;  1XMA A;  4WCG A;  5F64 A;  4HX7 A;  2P7C B;  5ICC A;  2W84 A;  4A2U A;  1YW8 A;  1UB9 A;  4CGZ A;  1YTY A;  3GFM A;  1P92 A;  1BC7 C;  1I1S A;  1Z91 A;  4BHC A;  3MFK A;  2ZCW A;  1XDS A;  4OIN F;  3LFK A;  4AD9 A;  3VFZ A;  5E18 F;  1EH8 A;  1HW5 A;  2V9V A;  1O3T A;  1U6G A;  5BPD A;  1USS A;  1STZ A;  1F9N A;  1XD7 A;  2CFX A;  1B59 A;  4MEY F;  4UV8 A;  4HBL A;  2E1N A;  2OBP A;  4L5I A;  3ABU A;  3SQN A;  4EQQ A;  1FP1 D;  2XRO A;  4RGR A;  3KP6 A;  4MTE A;  1TW3 A;  1IRG A;  1ZG1 A;  2EFW A;  1IXC A;  2LF8 A;  1I5Z A;  1W7P A;  4I0A A;  1R5H A;  2EA4 A;  3ZMS A;  3LA7 A;  3RIR A;  2QQB A;  2W57 A;  1O7L A;  1H0M A;  4KIC A;  4Y13 A;  3R60 A;  3KLN A;  1R58 A;  2P5K A;  1KYZ A;  4ZYD A;  1K6O A;  3F6O A;  2YR2 A;  2FEZ A;  3ZMD A;  1IN7 A;  4G7H F;  3IKV A;  2A5Y B;  3VEP A;  2HYF A;  3LAP A;  3KEQ A;  1ZG3 A;  4EJT A;  4RB2 C;  3MWM A;  5LRS A;  3QPT A;  4UHT A;  4IF4 A;  2HQR A;  1BM9 A;  4KDP A;  2JZY A;  4GCV A;  1QZY A;  3FXR A;  1G3W A;  2L3D A;  5FB2 A;  2XHK A;  4AVP A;  1YYV A;  2DPU A;  2L4A A;  4N9I A;  2J5P A;  3GX4 X;  1WQ2 A;  2J5O A;  4AIH A;  1EV7 A;  2AXL A;  4OIP F;  1OYI A;  4HZF A;  3SXY A;  2XAF A;  2IRF G;  1R1U A;  3IRR A;  3KE2 A;  5D5U B;  1BC8 C;  3F6V A;  3P9I A;  4O3M A;  4LD5 A;  2LDU A;  1IF1 A;  3RJP A;  3EYI A;  3KP3 A;  2YSR A;  3C1D A;  1B6A A;  2L4M A;  2GQQ A;  1V3F A;  1E17 A;  2ETH A;  2QEN A;  3CO6 C;  2BEO A;  5D6F A;  2V6C A;  2FE3 A;  4I98 B;  5FGM A;  2CGP A;  4EVI A;  3ZMZ A;  2H6C A;  2H09 A;  2FOK A;  5JI6 A;  4RB1 A;  4ESF A;  1CF7 B;  1FYK A;  1TW2 A;  1P4X A;  4U7D A;  4O5V A;  2VBW A;  2XKP A;  3WTZ A;  3LA2 A;  5H6Q A;  1R1T A;  1ZRE A;  3T1B A;  2VT2 A;  2XAH A;  2GXG A;  3V4G A;  1BBY A;  4ETS A;  3NQO A;  2COM A;  1R00 A;  3FXU A;  1L0O C;  5JR3 A;  4U0V A;  4BXU A;  4I01 A;  5E1W A;  2WTE A;  3TOB A;  4H0E A;  1O3Q A;  2XAS A;  2FBI A;  3WGI A;  1XSD A;  4KT5 C;  4L9N A;  2A6H F;  2M5W A;  2OD5 A;  4GO1 A;  1FYM A;  1FY7 A;  3KP7 A;  3K2Z A;  2V1X A;  2MLK A;  1TBX A;  3CDH A;  4WXC A;  1ODD A;  5LHG A;  2RDP A;  3HRM A;  2K02 A;  3GXO A;  2EB7 A;  4BHB A;  2M8E A;  2RKH A;  3FMQ A;  4BHP A;  2UWM A;  3CLO A;  1I27 A;  4WK8 F;  4YFX F;  3ZMV A;  5JHU A;  2DK8 A;  4EGZ A;  4CYD A;  4U0Y A;  2WV0 A;  3T8R A;  3TO9 A;  3GW2 A;  2A07 F;  3EQL F;  4EJU A;  1JE8 A;  1B9M A;  5BOX A;  1WRJ A;  2P8T A;  4BNC A;  2CO5 A;  3C7J A;  3BWG A;  1J75 A;  2Z99 A;  1P2F A;  4G7O F;  2L54 A;  3EYY A;  3DPL C;  1G4D A;  3MQ0 A;  3SHF A;  5ICF A;  5FFX A;  3FWE A;  5L3E A;  3B02 A;  4QLC U;  2UXX A;  3HOS A;  2X4H A;  3E5Q A;  2Z5U A;  1WSU A;  4RAY A;  1KU2 A;  5H20 A;  2EFO A;  4RGX A;  1TNS A;  5BQT A;  1BI1 A;  1S3J A;  2YPR A;  3FZV A;  5DYM A;  5HOO A;  1GXP A;  4NB5 A;  3EET A;  2O03 A;  2YX7 A;  1XDU A;  2QM3 A;  2VOP A;  2AS5 F;  4HLY A;  2R7D A;  1S6L A;  2ZJ2 A;  2Q0O A;  3JW4 A;  1R5G A;  5HDN A;  1PUE E;  1T6S A;  3HYI A;  1YO5 C;  1S7O A;  1U5T B;  3RYP A;  3WTW C;  4BQA A;  1YS6 A;  2W25 A;  3C3W A;  3K1N A;  3R4K A;  5DUK A;  5H6R A;  1Z05 A;  2Y48 A;  4LK1 F;  2HTJ A;  1P4W A;  4EJO A;  4TV7 A;  4EV0 A;  3ZPL A;  3H92 A;  4EJV A;  4G9Y A;  3R6S A;  5A2Q K;  5D5V B;  2ELH A;  4HW0 A;  4LG0 A;  2QLZ A;  2P5V A;  2FRH A;  2P5L C;  2HR3 A;  3CUQ B;  1EH7 A;  3TKY A;  4LMY A;  4E70 A;  2G7U A;  2HYG D;  2FNP A;  3KCC A;  5J8F A;  3B73 A;  3GZ5 A;  1PP8 F;  1R22 A;  2DBB A;  1U8R A;  1GHC A;  2DT5 A;  2IW5 A;  1VTN C;  4RGU A;  3C18 A;  5E1Z B;  3GO5 A;  1ZGJ A;  1O3R A;  4ON0 A;  1YG2 A;  3M1E A;  3R61 A;  2Z33 A;  2Y75 A;  2DQL A;  3U9G A;  3M8F A;  3V7R A;  1OYY A;  2ZFW A;  2F5C A;  1HW2 A;  3L9F A;  3IKT A;  4M74 A;  4RB3 C;  5A2Q Z;  4EM0 B;  1LEB A;  1SFX A;  3JSO A;  3TQN A;  2RC4 A;  1HKT A;  2JSC A;  5F1R A;  4KUM A;  3QRF F;  1LNW A;  3I59 A;  4CIC A;  4I09 A;  4M73 A;  1HKQ A;  1LDD A;  1SFU A;  3DFG A;  4LLL A;  2XAG A;  3L7W A;  5HS8 A;  2KKO A;  3OOP A;  3GYH X;  5EEG A;  2MC3 A;  3L09 A;  2KRF A;  2XGX A;  2HKO A;  4ZH4 F;  2NAZ A;  5K5Q A;  1S8N A;  3ZMU A;  4GYG A;  2YU3 A;  2PJP A;  2D45 A;  3LST A;  3KP2 A;  1HBX G;  1L3L A;  2W85 A;  3GF2 A;  3MZH A;  4ZYG A;  2FXA A;  3W6K B;  5LEJ A;  2P6S A;  4IRG A;  1KU3 A;  4WXH A;  3CTA A;  3E6M A;  2FBK A;  2ZO4 A;  2QWW A;  5HLI A;  1T2K A;  1FX7 A;  2OZU A;  2QZ8 A;  4Y15 A;  3NEU A;  5AON A;  4A0Y A;  3GFJ A;  2LSO A;  4G6D A;  1IAW A;  3TOA A;  1OR7 A;  4PDK A;  3ERE D;  4L0Z B;  3CUO A;  1LVA A;  3HUG A;  3WU0 A;  5DCM B;  4KIF A;  3KP4 A;  1ZN2 A;  2EWN A;  3QU3 A;  4UUV A;  5FD6 A;  2GIV A;  1IXS B;  3DF8 A;  3E6D A;  4A5N A;  2EV5 A;  1MKM A;  4EM1 A;  2PG4 A;  4IVN A;  2OU2 A;  4Y17 A;  2XV4 S;  4HV5 A;  4OU0 A;  4U7B A;  2NNY A;  4KIB A;  2VC0 A;  4Q47 A;  2QQA A;  4M6Y A;  2X0L A;  2HEO A;  4RAZ A;  4N0B A;  1KQ9 A;  2QBY B;  2A3S A;  4CDG A;  1SD5 A;  3LA3 A;  1ZRC A;  4WX9 A;  4GGG A;  3K1P A;  3V8L A;  5HS9 A;  2DPD A;  2HZT A;  4OMY A;  2O8X A;  2CWE A;  1ZGA A;  3FX3 A;  4XSX F;  5L3G A;  5J8C A;  1G3S A;  5E8I A;  1FSE A;  4KN7 X;  2GAU A;  2Z9O A;  3NRV A;  3IHU A;  1HXD A;  5HS7 A;  5DD4 A;  1I6X A;  2KJB A;  1K79 A;  5HLG A;  5L3D A;  4GXO A;  4JBA A;  3F22 A;  2XAJ A;  2NYX A;  3G73 A;  1XSV A;  2XRN A;  2CSO A;  2BGC A;  3ELK A;  4OIQ F;  5D4R A;  2M1B A;  1MDM A;  4R8H A;  4P55 A;  1ULY A;  2XUB A;  2NNN A;  4HDU A;  3O3K A;  3I64 A;  1YFH A;  3WOD F;  5BPI A;  2VBY A;  2WC2 A;  5AIP A;  2ZME B;  1DPU A;  4Q5S F;  3TO6 A;  2KJC A;  3FF5 A;  3QP6 A;  1B4A A;  2FF4 A;  1EH6 A;  2K4B A;  3DXJ F;  4FX4 A;  1LJ9 A;  2Q2E A;  1YW7 A;  5ICE A;  3WE2 A;  3GFI A;  1V4R A;  4AWX B;  5ICG A;  1U2W A;  4NQW A;  4S05 A;  3PQJ A;  4ENJ A;  1YIO A;  4RGS A;  5LHI A;  1A04 A;  1BI0 A;  1IN6 A;  3V8J A;  2IT0 A;  3E5U A;  1LEA A;  2Z3Y A;  2DFI A;  1GVJ A;  2W24 A;  1FPQ A;  1ZRD A;  1CGP A;  3AAF A;  4IXA A;  4MQ9 F;  5CVR A;  2FMY A;  1W7P B;  1QGP A;  3GEZ A;  1F4K A;  2GWR A;  4R79 A;  1D8J A;  1J0R A;  5CLS A;  3H3Z A;  3KZY A;  1RZ4 A;  4HYE A;  4XBF A;  3P7N A;  5HVQ C;  3IL2 A;  2HQN A;  4Q4Z F;  1D5V A;  2VOO A;  1XMK A;  1D8K A;  2V1U A;  1IRF A;  2ZNZ A;  4EMS A;  3WTV C;  4A6D A;  1R7J A;  4JQF A;  4P9U A;  1DP7 P;  3HRS A;  1W5S A;  5JFR A;  2F5E A;  4UVB A;  3G3Z A;  1MGT A;  1QNT A;  3HHH A;  2PI0 A;  2O0Y A;  2ISY A;  3HSF A;  4RB0 A;  1D3Y A;  2IA0 A;  2DO7 A;  3WU1 B;  1FP2 A;  5EEH A;  2A6E F;  3FXQ A;  2QYO A;  3QU6 A;  5ERI A;  4HF1 A;  4M9Z A;  2QQ9 A;  1J7K A;  1IN8 A;  3ZP5 A;  4HA8 A;  1WKM A;  2ISZ A;  1P4A A;  2D1V A;  2VC1 A;  1PP7 U;  3ROU A;  1FWZ A;  4B09 A;  2RN7 A;  4LLN A;  4B8X A;  4ENN A;  3L00 A;  1QQI A;  4PGH A;  5K1Y A;  2CYY A;  1RI7 A;  3QP5 A;  2JTV A;  5LLQ A;  2VE9 A;  5F6F A;  4IPA A;  2G7H A;  3I58 A;  3GVA A;  2V79 A;  2OA4 A;  1UCR A;  4G94 A;  4G6Q A;  1XSX A;  2F5F A;  5HLH A;  1K78 A;  1H9G A;  2ZKZ A;  1MD0 A;  4ENM A;  2VBX A;  1JHH A;  2DLL A;  2VT3 A;  4XRF A;  4OIO F;  3MAJ A;  3E6B A;  2HWV A;  5AIQ A;  5D5W B;  1REP C;  2PEX A;  2FML A;  1HW1 A;  3M9A A;  5CYV A;  1ZRF A;  2KIM A;  4S04 A;  2BYV E;  1LDK B;  3F23 A;  3E6C C;  3GZ6 A;  3FHZ A;  4HOB A;  3S2W A;  1QO0 D;  2VE8 A;  1DDN A;  3I0T A;  4KIG A;  3M8E A;  3T0Y A;  3KET A;  3BJ6 A;  3KFW X;  4ZYE A;  5E20 A;  4MEX F;  1MZB A;  2RVC A;  1XCV A;  2RV8 A;  5L3F A;  2M87 A;  1XB4 A;  2ESH A;  2PLY A;  1FZP B;  2E7X A;  2PMH A;  4EM2 A;  2R7F A;  3RDI A;  3FMR A;  2PN6 A;  1YS7 A;  4UV9 A;  4EGY A;  1XGS A;  2HOE A;  3RKW A;  4HX4 A;  2FA5 A;  2QVO A;  1E2X A;  3BDD A;  3TO7 A;  2RNJ A;  5LEK A;  1YLF A;  1ZLJ A;  4JK1 X;  3J81 K;  3ULQ B;  2MLG A;  2BV6 A;  2LF7 A;  5FLX K;  1O57 A;  3GFL A;  2HDC A;  1SFE A;  3W6J B;  3ISP A;  1Z7U A;  3KP5 A;  2D2W A;  4L9V A;  4F7Z A;  4A12 A;  2P7V B;  3FMS A;  3R0J A;  2BE5 F;  4FHT A;  2ZBK A;  2IP2 A;  3ECO A;  1TQM A;  2DW4 A;  3DPT A;  3SZT A;  2VON A;  2B0L A;  3WTS C;  1KQ0 A;  3REO A;  4G8X A;  1O3S A;  2EV0 A;  2EA2 A;  1TLH B;  5LBQ A;  3D5L A;  5DCF A;  1DPR A;  4MQV A;  3CO7 C;  4O6J A;  1G3T A;  2EJR A;  4P96 A;  1FBU A;  3J81 Z;  2EK5 A;  5IT9 K;  5BS6 A;  5K5O A;  1ON2 A;  1WI9 A;  4MHG A;  5D8L B;  2KIF A;  1XN7 A;  1DUX C;  4BH9 A;  2K86 A;  1XGO A;  1MJ9 A;  5FLX Z;  2FSW A;  1QPM A;  1RUO A;  3H3U A;  2IPQ X;  3N97 A;  2Q8K A;  4WXD A;  2EFN A;  2JRT A;  3MZY A;  1HKS A;  1YQA A;  1XGN A;  3JTG A;  2FQ3 A;  1G6N A;  4LG0 B;  3U2R A;  2QBY A;  4U88 A;  3GWZ A;  2R3S A;  3E97 A;  4XLP F;  2HTS A;  1OMI A;  4GYI A;  1XGM A;  2DQR A;  3Q5F A;  3GUD A;  5ILU A;  4LFU A;  4R1H A;  4A6E A;  1AOY A;  5CVV A;  2LNB A;  2OQG A;  2XKO A;  5BMZ A;  4DNC A;  2P6T A;  3WTU C;  5IT9 Z;  1FYL A;  3BP8 A;  4HF2 A;  4LLG F;  4WF2 A;  1KGS A;  1RIO H;  3TDU C;  3IWZ A;  1SMY F;  1IZ1 A;  2VOD A;  3K0L A;  4IRH A;  1Z1D A;  3F8B A;  3LQR A;  3ZN1 A;  3K9T A;  4A5M A;  4I7H A;  1O7F A;  4QWQ A;  5E8G A;  3IWF A;  1OYW A;  4OOI A;  2NS0 A;  4M71 A;  2E7W A;  2EFQ A;  3R0A A;  3PQK A;  1FC3 A;  3I59 B;  5KK1 A;  1ZHF A;  3TDZ C;  3T8T A;  1UST A;  1HST A;  4MGR A;  1SMT A;  3QPH A;  2UXN A;  1W4M A;  1KQ8 A;  3V7C A;  1ZG5 A;  5DD8 A;  1BI3 A;  3V8K A;  3MCZ A;  4ZZD A;  1UFM A;  3BPV A;  2H6B A;  1NHA A;  3HTU A;  4BAY A;  1SAX A;  1QZZ A;  1OKR A;  3I71 A;  2MA3 A;  1K7A A;  3T5X A;  3I53 A;  1BI2 A;  1BN5 A;  5CVI A;  2STW A;  5CVJ A;  3ZQ7 A;  3ZMT A;  3P9C A;  3BPX A;  2V1D A;  1R23 A;  3ABT A;  4YFK F;  3ZN0 A;  1WWX A;  2O61 A;  4L9J A;  3HIF A;  1B1B A;  3SFZ A;  3JAM K;  4UVA A;  1CF7 A;  3HTS B;  3VB2 A;  2PQ8 A;  3BJA A;  3DP7 A;  1IXR C;  4HQE A;  2ACJ A;  2TDX A;  4EJW A;  2STT A;  3EDP A;  3KEO A;  1SD7 A;  4ASN A;  1U5T C;  2DTR A;  5CVU A;  1F5T A;  1IN4 A;  1RUN A;  4PCQ A;  1J5Y A;  2DK5 A;  1YW9 A;  2CW0 F;  3VOD A;  1TQI A;  4HAM A;  4XLN F;  3LAJ A;  4M9X A;  2H27 A;  4BYY A;  1T0F A;  3D0S A;  1BIA A;  2JPB A;  3F21 A;  1LDJ A;  1LQ1 A;  4I02 A;  2FBH A;  2HS5 A;  3DV8 A;  1R36 A;  4N9H A;  3FM3 A;  2ADU A;  2OAZ A;  3HOT A;  2VN2 A;  4AIK A;  4KFC A;  3DEU A;  4DQ2 A;  1H9T A;  3CUQ C;  1HSJ A;  2KIU A;  4LB5 A;  3WTX C;  3JAM Z;  4FT8 A;  2RQP A;  1ON1 A;  5TJJ A;  4XSZ F;  2HKX A;  3U1D A;  4L0Y B;  3DQV C;  1TTY A;  5LGT A;  1P6R A;  2MD5 A;  1KU7 A;  1FBS A;  4I0B A;  1LB2 A;  2F5D A;  4ESB A;  2DAO A;  4LGW A;  1GXQ A;  2RGV A;  1OPC A;  1Z6T A;  2CG4 A;  1IN5 A;  3E3V A;  3KLO A;  1MDM B;  2FU4 A;  2ESN A;  3SZP A;  2OZ6 A;  2QUF A;  1I1G A;  5E1X A;  5IT3 A;  1MJB A;  1SD6 A;  2OQR A;  4LB6 B;  2ZNY A;  2C6Y A;  2ZXJ A;  2A68 F;  4IHS A;  4LJZ F;  2CQK A;  4PGG A;  4YIF A;  5FO5 A;  3P9K A;  5D4S A;  3ML6 A;  3IC7 A;  5K5R A;  1BOA A;  4U0W A;  5CJ9 A;  1F1Z A;  3WTY C;  1FBQ A;  3L2C A;  2MH2 A;  4AIJ A;  5TRD A;  2DI3 A;  2YX4 A;  3F72 A;  3M7G A;  2K4J A;  2GZW A;  5FD5 A;  2HGC A;  4HF0 A;  5HDK A;  2EV6 A;  1TQP A;  4M72 A;  4HX8 A;  1JXS A;  3F8M A;  1U5T A;  3LWF A;  2JT1 A;  1QBJ A;  3I5U A;  2JPC A;  2PFB A;  2D1H A;  1JGS A;  2IA2 A;  2GA1 A;  3RPQ A;  2VBZ A;  1KU9 A;  3HSR A;  1B9N A;  1FT9 A;  4A0Z A;  2K7L A;  2G9W A;  3BZ6 A;  1Y0U A;  4KYW A;  3RTR A;  1X3U A;  5D5X B;  3HHG A;  3BY6 A;  5D8K B;  1ZAO A;  2UZK A;  3WE3 A;  3CUQ A;  2M45 A;  3Q9S A;  4YFN F;  4G7Z F;  4NHJ A;  3RYR A;  5FFZ A;  4HLX A;  2WWY A;  1Z6R A;  4KA4 A;  1KYW A;  4D0P A;  1JHF A;  3JSP A;  3J7A O;  4CHU A;  2GA2 A;  3PFI A;  2A69 F;  3TGN A;  4M6X A;  2O3F A;  1G3Y A;  4P5O A;  1W5T A;  5L3C A;  3E5X A;  4YII A;  3WG9 A;  3QAH A;  1ZYR F;  4IHT A;  2IA1 A;  2F2E A;  4CZZ A;  3OV8 A;  1T39 A;  3RPU A;  3MEX A;  1SD4 A;  1PDN C;  3N4M A;  1ZAR A;  3IRQ A;  2IVM A;  3Q9V A;  1FSH A;  5J6X A;  1BIB A;  4K2E A;  4PZJ A;  3F8C A;  3ECH A;  1W7P D;  4I2O A;  2XAQ A;  3I4P A;  5DV5 A;  2GXB A;  5L3B A;  1MJA A;  2P4W A;  5E17 F;  5JVT A;  6PAX A;  1T98 A;  4MNU A;  5ED4 A;  2XVC A;  4ZZL A;  2H94 A;  2L02 A;  3O6B B;  1BJA A;  5DUI A;  4HQM A;  3RI4 A;  3F8F A;  4UNO A;  5KVR A;  2DU9 A;  1Q1H A;  3J80 K;  3F8N A;  1U3E M;  1R1V A;  3I54 A;  2XIG A;  1IUY A;  2NRA C;  3O2P E;  1K78 B;  5D6E A;  3WTT C;  1IW7 F;  4ENK A;  2FNA A;  5HDG A;  2A61 A;  4IRI A;  2E1C A;  4Z2Y A;  2O6G E;  4L5J A;  2Y0M A;  1ZH5 A;  2IJL A;  4OIR F;  4A0X A;  4IJA A;  3BOQ A;  1FLI A;  1UHW A;  5LHH A;  3FM5 A;  2MH9 A;  3RKX A;  1S7A A;  4L18 B;  4OMZ A;  3VOE A;  4MTD A;  5LGN A;  1ZLK A;  3QOP A;  1ONV A;  3DKW A;  4ZYH A;  5DCM A;  4M9S A;  3KZZ A;  3BRO A;  1C0W A;  1XCB A;  3J80 Z;  4ESJ A;  4KN4 X;  4KNY A;  1FNN A;  2PMU A;  4FX0 A;  5DDG A;  3CJN A;  4Q48 A;  3WGG A;  3V7S A;  4LK0 F;  3GLX A;  5DEQ A;  4RS8 A;  2MBF A;  4CO8 A;  1J2X A;  2M30 A;  4WWC A;  1Z9C A;  2HFH A;  1J59 A;  2PBI A;  3K69 A;  4UXN A;  4HV6 A;  3EUH A;  3F3X A;  2K27 A;  4L9T A;  1S29 A;  4YG2 F;  1U78 A;  1HQC A;  3COA C;  4KMU X; 
#chains in the Genus database with same CATH topology
 4P9F A;  1T38 A;  1MBJ A;  1UEL B;  2JA8 J;  1MNE A;  2HYJ A;  2LKP A;  3HSE A;  3K1M A;  2BXZ A;  2ZB9 A;  2VXZ A;  3DBR B;  2LOO A;  1UHM A;  4Y4R A;  1YJ9 I;  3HRU A;  4UVC A;  4CCK A;  1TNT A;  1D1A A;  5JLW A;  3LFU A;  4CXF A;  2ZFU A;  3V42 A;  3E7L A;  5IY5 H;  1T8I A;  3JTH A;  5LRR A;  3LQQ A;  4HDV A;  3H0D A;  1J9I A;  2QF7 A;  1KA8 A;  4KMF A;  5ILS A;  2EFP A;  5LGU A;  4HNT A;  1RNL A;  1H89 C;  4Y52 J;  2BBY A;  2L01 A;  3DLA A;  3LSJ A;  3BJO A;  5ILV A;  1FOK A;  1ETW A;  3WGH A;  2R92 J;  4HNV A;  3HRT A;  3U1K A;  4YRV A;  1SVL A;  3RKY A;  1AWC A;  1YRN B;  2KT0 A;  2MYS A;  3OIP A;  2ZME A;  1XMA A;  4WCG A;  5F64 A;  4HX7 A;  3HOU J;  2P7C B;  4B3X A;  5ICC A;  2Y69 H;  2W84 A;  4A2U A;  1YW8 A;  1UB9 A;  4DYC A;  1I3Q J;  1QHG A;  2BY3 A;  5EGO A;  4XID A;  4CGZ A;  2BVM A;  3K2A A;  2ID6 A;  1YTY A;  3GFM A;  1P92 A;  1BC7 C;  1I1S A;  4RDU A;  2ZJP F;  1Z91 A;  4QTR A;  4A3I J;  4BHC A;  3MFK A;  3HOZ J;  2RRE A;  2ZCW A;  4MO7 A;  4ZDO A;  1TWG J;  2BXY A;  1XDS A;  1F43 A;  2XGE A;  1EA3 A;  4OIN F;  3LOC A;  4XON A;  3BTL A;  3LFK A;  3RZD J;  2WAQ N;  4AD9 A;  3DBH B;  3VFZ A;  5E18 F;  1EH8 A;  1HW5 A;  2WY7 Q;  3EUA A;  2CU7 A;  2V9V A;  2X6O A;  4B48 A;  4BY7 J;  4DOZ A;  3DPU A;  3D5S C;  1JKR C;  1X58 A;  1O3T A;  2KP6 A;  1U6G A;  4UB8 C;  4LOC A;  2V1N A;  5BPD A;  1USS A;  5J1U A;  2YU9 J;  1STZ A;  1F9N A;  1XD7 A;  2CFX A;  1B59 A;  3FDY A;  2NXN B;  4MEY F;  4UV8 A;  2R7V A;  4HBL A;  2E1N A;  2OBP A;  4L5I A;  5FKL A;  3ABU A;  3S14 J;  1Y39 A;  3SQN A;  2DMN A;  4EQQ A;  1FP1 D;  2XRO A;  4I99 C;  1UZC A;  4RGR A;  1P7I A;  3S1Q J;  3KP6 A;  4MTE A;  1TW3 A;  2L7F P;  4CCL A;  1ZG1 A;  1IRG A;  2EFW A;  1IXC A;  2LF8 A;  1I5Z A;  1W7P A;  4I0A A;  2JSP A;  3SDG A;  1R5H A;  3ASO H;  4J00 A;  4UUS B;  3OSG A;  3PNT A;  1LE8 A;  2EA4 A;  3ZMS A;  3LA7 A;  1V55 H;  3RIR A;  2QQB A;  2W57 A;  1O7L A;  3B6C A;  4MIM A;  1VQ8 I;  2HQA A;  3JRE A;  1WPK A;  1H0M A;  3K4M A;  4KIC A;  4Y13 A;  3R60 A;  3KLN A;  3RPU D;  2NOG A;  5DTD A;  2EIJ H;  4KIS A;  4FCY A;  1YJW I;  5K7Z A;  1EJ9 A;  1R58 A;  2P5K A;  1KYZ A;  4YEJ A;  4V2G A;  1S7E A;  3HUG B;  4ZYD A;  4Y7N J;  2E36 A;  2YR2 A;  3F6O A;  1K6O A;  3EPZ A;  3H36 A;  3FK7 A;  2FEZ A;  3ZMD A;  1IN7 A;  4G7H F;  3IKV A;  3A0H C;  2A5Y B;  3VEP A;  2EIL H;  2HYF A;  1PUF B;  4AYB N;  3LAP A;  3KEQ A;  1ZG3 A;  2B7E A;  2P81 A;  3S16 J;  2OCC H;  5IOY A;  4EJT A;  3W3C A;  4RB2 C;  1JUP A;  3MWM A;  3HG9 A;  2UV1 A;  4E7H A;  5LRS A;  3CZ6 A;  3QPT A;  3AG2 H;  2NVX J;  4B44 A;  4UHT A;  4IF4 A;  2JVG A;  1P9Q C;  1B72 B;  2HQR A;  1BM9 A;  3LSR A;  3H9J A;  2LY9 A;  5B66 C;  3HKZ A;  4KDP A;  5C4X J;  2JZY A;  4GCV A;  1QZY A;  2VJ4 A;  3FXR A;  1G3W A;  2L3D A;  3PNY A;  1JUS A;  5FB2 A;  1IDY A;  2XHK A;  4AVP A;  1YYV A;  2DPU A;  3BZK A;  2L4A A;  3OYM A;  1O4X A;  4N9I A;  2VPR A;  2J5P A;  3GX4 X;  4F55 A;  2E2I J;  1WQ2 A;  3PIP F;  5E3M A;  2J5O A;  4AIH A;  1EV7 A;  2AXL A;  4DGW B;  2JA6 J;  4OIP F;  1OYI A;  4HZF A;  4LIT A;  3SXY A;  2NVT J;  2XAF A;  3GLL A;  1IDZ A;  2IRF G;  1R1U A;  3ZQQ A;  3IRR A;  3KE2 A;  5D5U B;  1BC8 C;  3F6V A;  5BNG A;  1OCC H;  3P9I A;  4O3M A;  2JK3 A;  4LD5 A;  3CF2 A;  2LDU A;  4M3E A;  4XOP A;  1IF1 A;  3VYT B;  3RJP A;  3EYI A;  1YHQ I;  3KP3 A;  2YSR A;  3C1D A;  4C3I J;  1B6A A;  2L4M A;  3OYB A;  3FKJ A;  2GQQ A;  2DMP A;  1V3F A;  1E17 A;  3PFY A;  2ETH A;  3OS0 A;  2QEN A;  3CP2 A;  4XNF A;  2NOJ B;  2ZXI A;  4RAG A;  4IOC F;  3CO6 C;  4RLF A;  2BEO A;  5D6F A;  2M0C A;  2V6C A;  2FE3 A;  4I98 B;  2Z1D A;  5FGM A;  4F52 A;  2CGP A;  4EVI A;  4PJ0 C;  4XOT A;  3ZMZ A;  2H6C A;  2ID3 A;  2H09 A;  3S3N A;  5LD2 C;  3I4N J;  2OUM A;  2FOK A;  5JI6 A;  4RB1 A;  2WV1 A;  3L2V A;  1RKT A;  2HDD A;  2IS2 A;  4ESF A;  1CF7 B;  3HPH A;  1FYK A;  3M3Y J;  1TW2 A;  5C44 J;  1P4X A;  4U7D A;  4O5V A;  2VBW A;  3JRI A;  2XKP A;  3MMY B;  2L2O A;  3WTZ A;  3LA2 A;  5H6Q A;  1R1T A;  1X19 A;  1ZRE A;  2BOL A;  5FKK A;  3T1B A;  2VT2 A;  2XAH A;  2WY8 Q;  4FAS D;  1HCR A;  5JHF A;  2GXG A;  3V4G A;  1BBY A;  2VKH A;  4ETS A;  2OTJ I;  3NQO A;  2COM A;  1R00 A;  3FXU A;  1VQM I;  1APL C;  1L0O C;  5JR3 A;  2Y2Z A;  2Q2E B;  4U0V A;  4BXU A;  4I01 A;  1ENH A;  5E1W A;  2WTE A;  3TOB A;  5GAH J;  4H0E A;  2ECC A;  1O3Q A;  2XAS A;  2V7F A;  2FBI A;  3WGI A;  2XF5 A;  1XSD A;  4KT5 C;  3TW7 A;  4L9N A;  5FKN A;  2A6H F;  1QZE A;  3ZRG A;  1U8B A;  2CQQ A;  3A01 A;  1G2H A;  4NQW B;  2BY1 A;  3LSG A;  2M5W A;  1EKE A;  4BU2 A;  1ZQ3 P;  2OD5 A;  4AM3 A;  4GO1 A;  1FYM A;  1FY7 A;  3KP7 A;  3K2Z A;  3FXK A;  3M4O J;  2V1X A;  2MLK A;  1BA5 A;  1TBX A;  1X1A A;  3CDH A;  4WXC A;  1ODD A;  5LHG A;  3JRD A;  2RDP A;  3JRC A;  3HRM A;  2OTL I;  1MND A;  2R93 J;  2K02 A;  2L9V A;  1Y56 A;  3VYU B;  3FHN A;  3GXO A;  2EB7 A;  4BHB A;  2M8E A;  2RKH A;  3FMQ A;  1XX5 A;  4BHP A;  1OFC X;  4LG3 A;  2UWM A;  3CLO A;  2MFZ A;  1I27 A;  4WK8 F;  4YFX F;  3ZMV A;  5JHU A;  2WA0 A;  4D5C A;  2DK8 A;  2X48 A;  4NBQ A;  1D0Z A;  4CYD A;  4DYQ A;  2WV0 A;  4U0Y A;  4EGZ A;  3T8R A;  3TO9 A;  3GW2 A;  1S5L C;  2A07 F;  3I9V 2;  3BC8 A;  4DIQ A;  3EQL F;  3L2U A;  4EJU A;  2KLO A;  3DEE A;  1JE8 A;  1B9M A;  5BOX A;  3ZQH A;  1WRJ A;  3DU6 A;  2JQ7 A;  2DFH A;  2P8T A;  2ZXW H;  4BNC A;  2CH0 A;  2CO5 A;  3C7J A;  3BWG A;  1D1C A;  1J75 A;  4A3J J;  1RKW A;  5JLX A;  2GLO A;  2Z99 A;  4L5E A;  1P2F A;  4JX4 A;  4G7O F;  2L54 A;  1K4T A;  3EYY A;  3DPL C;  1G4D A;  3MQ0 A;  4XIC A;  2LBF B;  3SHF A;  5ICF A;  5FFX A;  3ZCO A;  2DFF A;  3FWE A;  5L3E A;  1T08 B;  2RQQ A;  3B02 A;  1YJN I;  4QLC U;  3M07 A;  2UXX A;  5E3L A;  2V4J C;  4PJJ A;  2E1M B;  3HOS A;  1TWF J;  1XMX A;  2A6T A;  2X4H A;  3E5Q A;  2Z5U A;  1WSU A;  4RAY A;  3CCS I;  1KU2 A;  2IGN A;  1Z67 A;  5C3E J;  3ZQC A;  5H20 A;  1MMD A;  2EFO A;  3A1Y A;  3HB9 A;  4RGX A;  1TC3 C;  1S9H A;  1TNS A;  2QA4 I;  5J1Y A;  1VQ4 I;  2PMZ N;  5BQT A;  3AL0 B;  1VQL I;  1BI1 A;  1LUJ B;  5F1J A;  1S3J A;  1I50 J;  2YPR A;  3FZV A;  1GV2 A;  5DYM A;  5HOO A;  1GXP A;  4NB5 A;  3EET A;  2DT7 B;  2O03 A;  2DA2 A;  4RMN A;  1IRZ A;  2YX7 A;  4ITV A;  5GAG J;  3BZC A;  1UAA A;  1XDU A;  2QM3 A;  1DGW Y;  2DA6 A;  2VOP A;  2HVR A;  2AS5 F;  3RQ4 A;  4HLY A;  1FIA A;  1S6L A;  2R7D A;  2ZJ2 A;  5J4Y A;  2E60 A;  2Q0O A;  2E5Z A;  3JW4 A;  2FQ4 A;  3PSF A;  3JRF A;  4IHW A;  2MG4 A;  1R5G A;  5HDN A;  1PUE E;  1T6S A;  1JKQ C;  1OCO H;  3HYI A;  1X2M A;  1YO5 C;  1S7O A;  4HNU A;  1U5T B;  4CCN A;  4DJA A;  1N25 A;  4XRS A;  3RYP A;  3WTW C;  3HEF A;  4NDL A;  4BQA A;  4A3L J;  1YS6 A;  2FJ1 A;  2W25 A;  3C3W A;  3K1N A;  4F92 B;  3R4K A;  5DUK A;  1TL8 A;  4XQF A;  4F3Q A;  5H6R A;  1IO2 A;  3HJE A;  3A0B C;  1Y1V J;  1Z05 A;  3VSK A;  3GZN B;  5J40 A;  2Y48 A;  4LK1 F;  3L2W A;  2HTJ A;  1P4W A;  1MH4 A;  4EJO A;  4A3D J;  2O9L A;  4V2F A;  3CCM I;  4TV7 A;  3RQI A;  1NH3 A;  3TL4 X;  1PVE A;  1MSF C;  2CQ7 A;  1QHH D;  4EV0 A;  3CDL A;  3ZPL A;  4FET A;  1WGX A;  3CQZ J;  3H92 A;  3DCF A;  4EJV A;  5GAE J;  4G9Y A;  3R6S A;  5A2Q K;  4AC0 A;  1OR7 C;  2HVQ A;  3OMY A;  4V19 K;  5D5V B;  2ELH A;  3AG1 H;  1R49 A;  4HW0 A;  4LG0 A;  1QPI A;  3GTG J;  3MZ8 A;  2QLZ A;  2R7U A;  2P5V A;  3KIO A;  2FRH A;  2P5L C;  1XS9 A;  2HR3 A;  3CUQ B;  3CCU I;  1EH7 A;  3DTK A;  4A93 J;  4OAZ A;  1RRJ A;  2AQF A;  1TWA J;  1UHS A;  4BJT A;  2JMW A;  3TKY A;  4LMY A;  1JKO C;  2W1O A;  1OLT A;  4E70 A;  2OF7 A;  3S2H J;  2G7U A;  2DA5 A;  4DYR A;  4UB6 C;  2HYG D;  2FNP A;  3KCC A;  1FMV A;  5J8F A;  3S15 J;  3B73 A;  3GZ5 A;  3OYA A;  1PP8 F;  2CQN A;  1DQU A;  1R22 A;  2K3F A;  2K5C A;  2DBB A;  3ZQI A;  1K6Y A;  1U8R A;  1MBF A;  4JX6 A;  1GHC A;  1YX3 A;  2R7Q A;  2DOE A;  3IH2 A;  4A3B J;  2DT5 A;  2EPF A;  2IW5 A;  3TED A;  4OWR B;  1VTN C;  4RGU A;  3W2W A;  3C18 A;  4XRM A;  5E1Z B;  3GO5 A;  1ZGJ A;  1O3R A;  4ON0 A;  1E3H A;  1YG2 A;  3M1E A;  3R61 A;  2Z33 A;  2XPW A;  1Y8R B;  2Y75 A;  2DQL A;  3U9G A;  2EH3 A;  1LVK A;  3M8F A;  3V7R A;  1ZR2 A;  2FX0 A;  3C2G A;  2DDA A;  3GTP J;  4MFD A;  2BHY A;  3TMO A;  1OYY A;  4BL0 B;  2ZFW A;  5LFA A;  2EBI A;  3VYR B;  1A5J A;  2M3A A;  2F5C A;  2DFE A;  1HW2 A;  4BAC A;  1VZ0 A;  3L9F A;  2JRM A;  1NG7 A;  3IKT A;  1ZGW A;  4M74 A;  2I5U A;  1LFP A;  4RB3 C;  5A2Q Z;  4E7L A;  2X51 A;  2DA4 A;  4EM0 B;  1YRN A;  1IUF A;  1TWH J;  2F4M B;  1T33 A;  1LEB A;  4CCM A;  1SFX A;  3JSO A;  3TQN A;  2RC4 A;  1HKT A;  2JSC A;  2VQL A;  5F1R A;  4KUM A;  4B47 A;  4X0G A;  1LNW A;  3QRF F;  3I59 A;  4CYC B;  3CF5 F;  4M3F A;  4CIC A;  4I09 A;  3FBI B;  3AFH A;  5FKO A;  1ETO A;  2KFD A;  1HKQ A;  2MC4 A;  1LDD A;  2EIK H;  2XRL A;  4M73 A;  1SFU A;  1ETK A;  2XSJ C;  3DFG A;  3KZI C;  2XC7 A;  4LLL A;  2XAG A;  3CD6 I;  3L7W A;  5HS8 A;  2FOW A;  2KL4 A;  2KKO A;  5KNL A;  3OYN A;  3OOP A;  3GYH X;  1JJ8 C;  5EEG A;  2DOD A;  2MC3 A;  3L09 A;  3H3V K;  2KRF A;  2XGX A;  2HKO A;  5TGT A;  4ZH4 F;  2NAZ A;  3I55 I;  2XF6 A;  5K5Q A;  1TT5 B;  1V5E A;  1S8N A;  3HZJ A;  4C30 A;  3ZMU A;  3ESW B;  3OYG A;  1VQP I;  4GYG A;  2YU3 A;  3CMM A;  4XKB A;  1OCP A;  2PJP A;  2D45 A;  3TW6 A;  1HA8 A;  3LST A;  4BS9 A;  1DGR M;  2K9N A;  1U9O A;  4JP0 A;  3KP2 A;  2VQH A;  4ZYA A;  4J19 A;  1HBX G;  3QOE A;  2X9D A;  2QCO A;  3BR5 A;  4XLE A;  1ETV A;  2LVS A;  1L3L A;  2W85 A;  1WCM J;  2R0Q C;  3GF2 A;  3MZH A;  4ZYG A;  2FXA A;  3W6K B;  5LEJ A;  2P6S A;  2OV7 A;  4HST A;  4IRG A;  1KU3 A;  5CQG A;  3PSI A;  4WXH A;  3CTA A;  3E6M A;  2JWT A;  2JA2 A;  4D7N A;  2FBK A;  2ZO4 A;  3AG4 H;  2VB6 A;  3ABM H;  2QWW A;  5HLI A;  1T2K A;  1FX7 A;  2OZU A;  3FBN B;  2ZC2 A;  2QZ8 A;  4JX5 A;  4Y15 A;  3NEU A;  2WAD A;  5AON A;  4A0Y A;  1E0E A;  2QQ8 A;  2CUE A;  4D5F A;  3GFJ A;  3J7Z I;  2LSO A;  4G6D A;  4XN3 A;  4RAF A;  1IAW A;  3TOA A;  1OR7 A;  4PDK A;  3ERE D;  4L0Z B;  2LC2 A;  3CLQ A;  5J1R A;  3CUO A;  4E4H A;  1LVA A;  3HUG A;  3WU0 A;  5DCM B;  3QPS A;  4KIF A;  3KP4 A;  1ZN2 A;  2M7A A;  2EWN A;  3TBI A;  1Y8Q B;  1FOX A;  3QU3 A;  4UUV A;  3DU5 A;  1V54 H;  5FD6 A;  2GIV A;  1K4S A;  4BEH B;  1FMW A;  1HDD C;  1XC5 A;  2HNH A;  1IXS B;  1GLN A;  1T95 A;  3DF8 A;  3E6D A;  2EV5 A;  4A5N A;  5FJ8 J;  3IAS 2;  1MKM A;  4EM1 A;  2PG4 A;  3BCB A;  4IVN A;  2OU2 A;  2EZK A;  3RSN A;  2B9S A;  3FIS A;  4Y17 A;  5K7H A;  2XV4 S;  4HV5 A;  4IL6 C;  4OU0 A;  1B72 A;  2ICW G;  4W1U A;  3QYF A;  4U7B A;  2NNY A;  1MBE A;  4OAY A;  4CSW A;  2XSD C;  4KIB A;  1JKP C;  2VC0 A;  4BBR J;  4RBO A;  3CP8 A;  3CME I;  4B4C A;  2GOX B;  4KIT B;  1SEU A;  3ONQ A;  4Q47 A;  2QQA A;  3W2A A;  1IGN A;  4M6Y A;  2X0L A;  3OYD A;  1OQY A;  2HEO A;  4RAZ A;  3K4K A;  4N0B A;  1A36 A;  1KQ9 A;  2QBY B;  2A3S A;  2KHM A;  3A03 A;  1XPX A;  5CKT A;  4CDG A;  1SD5 A;  2GM4 A;  3LA3 A;  5GPC A;  1ZRC A;  3CC4 I;  4QPO A;  4WX9 A;  4GGG A;  3EUK L;  3K1P A;  3V8L A;  5HS9 A;  2DPD A;  2HZT A;  2K9S A;  5E79 C;  4OMY A;  2JA7 J;  2O8X A;  2CWE A;  1ZGA A;  2BW3 A;  3FX3 A;  4XSX F;  3DEW A;  5L3G A;  5J8C A;  1G3S A;  1Z0X A;  2KZG A;  5E8I A;  1FSE A;  3H0G J;  4KN7 X;  3HOX J;  2GAU A;  2Z9O A;  3NRV A;  3IHU A;  2E5N A;  1HXD A;  5HS7 A;  1SVO A;  2CUF A;  3OYJ A;  5DD4 A;  1I6X A;  4E7S A;  1AU7 A;  1GDT A;  2KJB A;  1K79 A;  5HLG A;  2R4G A;  5L3D A;  4C2U A;  4GXO A;  4JBA A;  2XAJ A;  2TCT A;  3G1O A;  3F22 A;  9ANT A;  3SJM A;  2NYX A;  3G73 A;  1XSV A;  2XRN A;  2CSO A;  2BGC A;  3ELK A;  3NWT A;  4C2M J;  2K9Q A;  4OIQ F;  2I8D A;  3G6E I;  1RPW A;  5D4R A;  4C3J J;  2M1B A;  2Y0S N;  1MDM A;  4R8H A;  4P55 A;  4HG2 A;  5FLV A;  4BJ5 C;  1ULY A;  2XUB A;  1NK3 P;  5GTI C;  2R7W A;  2NNN A;  4HDU A;  3O3K A;  3I64 A;  2HDW A;  1W5C C;  2ELK A;  1YFH A;  3WOD F;  5BPI A;  3OR2 C;  2ME0 A;  3S1M J;  1ERD A;  2VBY A;  3H5R A;  3LMM A;  5F04 A;  2WC2 A;  3UNG C;  5AIP A;  2M9H A;  4CCJ A;  2ZME B;  1QVT A;  1DPU A;  4Q5S F;  3TO6 A;  2KJC A;  3HOY J;  3FF5 A;  3QP6 A;  1B4A A;  3Q0V A;  2FF4 A;  1EH6 A;  2K4B A;  3DXJ F;  2QKL B;  3OYL A;  4FX4 A;  1TT0 A;  3JRG A;  1LJ9 A;  2Q2E A;  1YW7 A;  4YEL A;  5ICE A;  3M1C A;  3WE2 A;  1JJ6 C;  3GFI A;  2RAE A;  1V4R A;  1BJZ A;  2K85 A;  4AWX B;  5ICG A;  1A31 A;  1U2W A;  4RM3 A;  2CFO A;  2WB1 N;  4NQW A;  4S05 A;  4JYK A;  4M3B A;  3PQJ A;  5EG0 A;  1MSE C;  1AHD P;  1R4M B;  2VAS A;  3PUF A;  4ENJ A;  1YIO A;  5DS9 A;  2EIM H;  3DWL E;  2L5Q A;  4RGS A;  5LHI A;  2ZXH A;  1A04 A;  1BI0 A;  2LD5 A;  4XLF A;  2E35 A;  1IN6 A;  4PFO A;  3WHB A;  3V8J A;  3CJT B;  3C2H A;  3FXJ A;  3E5U A;  3SDB A;  2IT0 A;  3KYL A;  1QVU A;  1LEA A;  2Z3Y A;  1IV8 A;  2ZSH B;  2DFI A;  3UR3 C;  1GVJ A;  2VXD A;  2VQG A;  2X85 A;  3VDX A;  2W24 A;  2L9N A;  4CCO A;  1FPQ A;  3S93 A;  2HZD A;  3H5A A;  1ZRD A;  1CGP A;  3AAF A;  2Z2S B;  4IXA A;  3ZOB A;  4MQ9 F;  2JUC A;  3IH4 A;  5CVR A;  2FMY A;  1S72 I;  1W7P B;  1QGP A;  3GEZ A;  1F4K A;  3QPL A;  5KCM A;  2GWR A;  4R79 A;  1D8J A;  1J0R A;  1X1D A;  5CLS A;  4Z6Y A;  1LE8 B;  3H3Z A;  4J01 A;  4A3G J;  3PUB A;  3KZY A;  2A05 A;  1RZ4 A;  3ERM A;  1GV5 A;  4HYE A;  4XBF A;  1OIS A;  2DA7 A;  3P7N A;  4RA2 A;  2X6W A;  5HVQ C;  3IL2 A;  2K3P A;  2HQN A;  4PFP A;  5J47 A;  4Q4Z F;  1D5V A;  2LBF A;  3G4S I;  4A3F J;  1SFK A;  2VJ5 A;  2VOO A;  3BR2 A;  1E3O C;  1W0U A;  1H8A C;  2QKM B;  5F0C A;  4N4O B;  2HPM A;  2TRT A;  3PM1 A;  3PIO F;  1XMK A;  1D8K A;  2R5Z B;  1VQK I;  2V1U A;  1IRF A;  2ZNZ A;  1MW7 A;  3BQZ A;  3CCQ I;  3MD2 A;  3WG7 H;  4EMS A;  3WTV C;  3GBG A;  3MKL A;  3PJR A;  3D1N I;  2E2J J;  4A6D A;  2XPV A;  1R7J A;  2WAQ A;  3A4C A;  4JQF A;  4P9U A;  1DP7 P;  3HRS A;  1W5S A;  5JFR A;  1R71 A;  1QA6 A;  2F5E A;  4UVB A;  3G3Z A;  1MGT A;  1QNT A;  5B1A H;  3SYT A;  4BXX J;  3HHH A;  2LH9 A;  2PI0 A;  3PNV A;  2O0Y A;  2ISY A;  3HSF A;  4RB0 A;  1D3Y A;  2IA0 A;  2R5Y B;  2DO7 A;  3WU1 B;  3BTJ A;  3BR0 A;  2H8R A;  1YIT I;  1FP2 A;  5EEH A;  2A6E F;  4HRI A;  1ZTR A;  1R6R A;  3FXQ A;  2QYO A;  3F0C A;  3QU6 A;  5ERI A;  4HF1 A;  4M9Z A;  2QQ9 A;  1T56 A;  1J7K A;  1IN8 A;  3FKI J;  3ZP5 A;  4HA8 A;  1WKM A;  2ISZ A;  4I76 A;  1P4A A;  3FXM A;  1FIP A;  3TP0 A;  2D1V A;  2VC1 A;  5E3O A;  3QYB A;  4JOM A;  4LIU A;  1PP7 U;  3ROU A;  5B1B H;  1BOB A;  1JTY A;  1FWZ A;  4B09 A;  2RN7 A;  4LLN A;  2KRH A;  3JRH A;  1IJW C;  3BR6 A;  4B8X A;  2CJJ A;  4ENN A;  2AXT C;  3L00 A;  3IP4 B;  1U0J A;  3ZQF A;  4B3A A;  1VQ5 I;  1QQI A;  4PGH A;  1RET A;  2O8K A;  5K1Y A;  3MKY B;  2CYY A;  1RI7 A;  3QP5 A;  2JTV A;  5LLQ A;  2VE9 A;  5F6F A;  4IPA A;  4XK4 A;  2ZSI B;  1Q1V A;  2G7H A;  3BCA A;  3GVA A;  3I58 A;  1RES A;  5IOZ A;  2V79 A;  3SEQ A;  5F27 A;  3ZQG A;  4AU7 A;  2OA4 A;  1UCR A;  4G94 A;  1Z3Y A;  3D5R C;  3IH3 A;  3CDI A;  4KJZ A;  3BR3 A;  2ME6 A;  4G6Q A;  1XSX A;  2F5F A;  4BQN A;  5HLH A;  3CCJ I;  3AKZ A;  3OYI A;  3CES A;  4BE1 A;  1H9G A;  1K78 A;  2VKV A;  1Z77 A;  2ZKZ A;  1MD0 A;  1RC9 A;  4ENM A;  2VBX A;  4XLH A;  1JHH A;  1VND A;  2DLL A;  2LMD A;  2VT3 A;  4XRF A;  1VQ7 I;  4OIO F;  1X3Z B;  2LR8 A;  1VI0 A;  3E6B A;  3MAJ A;  4QSH A;  2HWV A;  3I4M J;  2XPU A;  2I10 A;  5AIQ A;  5D5W B;  1REP C;  3DKY A;  3K10 A;  2PEX A;  4Y3O A;  2KRC A;  4CA0 A;  2X6X A;  2FML A;  1VQ9 I;  1HW1 A;  3M9A A;  5CYV A;  3S3M A;  1ZRF A;  2EQR A;  4BE0 A;  2KIM A;  3OYC A;  3CC2 I;  4S04 A;  4DBQ A;  3GME A;  2BYV E;  1LDK B;  3F23 A;  3E6C C;  3GZ6 A;  4BJ6 C;  5KAI C;  2PX9 A;  2M4K A;  3FHZ A;  2IEK A;  2JJ7 A;  4MFE A;  4HOB A;  2IAI A;  3S2W A;  2E2H J;  1QO0 D;  2VE8 A;  2OC6 A;  2M4G A;  2W00 A;  4X6A J;  4PJN A;  1DDN A;  3I0T A;  1WH5 A;  4KIG A;  1I3A A;  3M8E A;  2LKX A;  2IGK A;  3T0Y A;  3BJ6 A;  3DBL B;  5E3N A;  3KET A;  3KFW X;  2ZJR F;  2W7N A;  1YIJ I;  3QOD A;  4BBS J;  4ZYE A;  4LIV A;  2NVY J;  4CH7 A;  5E20 A;  4MEX F;  1MZB A;  2RVC A;  1EF4 A;  3PO3 J;  1DU6 A;  1XCV A;  2M8G X;  2RV8 A;  3KYD B;  4AVZ A;  5L3F A;  2M87 A;  2F4O B;  1G59 A;  2COB A;  1XB4 A;  2ESH A;  2PLY A;  4I6Z A;  1FZP B;  2E7X A;  3HOW J;  2PMH A;  2FUG 2;  2DJI A;  4EM2 A;  2R7F A;  3RDI A;  1LFU P;  3FMR A;  2PN6 A;  1YS7 A;  2R7X A;  4G12 A;  2CRG A;  4UV9 A;  4CYC A;  4EGY A;  1XGS A;  2HOE A;  3IAM 2;  4MLO A;  3RKW A;  1FJL A;  5GTH C;  2F4I A;  5K7F A;  4HX4 A;  4M3D A;  2PJR B;  4D9J A;  1ZKG A;  1BR1 A;  2FA5 A;  2YS9 A;  2QVO A;  5EZH A;  3CMA I;  1E2X A;  1Z7L A;  3BDD A;  3TO7 A;  3CCR I;  3LSK A;  4IKF A;  2RNJ A;  5LEK A;  1YLF A;  1ZLJ A;  1I6H J;  1VF9 A;  4JK1 X;  2HOS A;  3J81 K;  3ULQ B;  2MLG A;  5M5X J;  3CCL I;  4FQG A;  2NVQ J;  1HOM A;  2DJN A;  2BV6 A;  1X1B A;  1FTZ A;  1X1C A;  1ZR4 A;  2LF7 A;  2F6C A;  3ABL H;  1D0X A;  3C2B A;  3S1R J;  5FLX K;  2EZL A;  1O57 A;  5EF6 A;  3GFL A;  3KYC B;  2HDC A;  1SFE A;  4ZTF A;  3HGY A;  4E7J A;  2V9P A;  3OY9 A;  3W6J B;  3J7Y J;  3ISP A;  1Z7U A;  3KP5 A;  2D2W A;  4L9V A;  3WU2 C;  2CUJ A;  2E34 A;  2IS6 A;  3OSF A;  3FXO A;  3BQY A;  4F7Z A;  4A12 A;  2P7V B;  3FMS A;  3R0J A;  3SEZ A;  2BE5 F;  4FHT A;  5B3S H;  2H1K A;  2ZBK A;  2IP2 A;  3ECO A;  2VQC A;  3FK6 A;  2Z16 A;  4F91 B;  2BY2 A;  4B43 A;  1TQM A;  2DW4 A;  4G6T B;  4ABZ A;  3DPT A;  3SZT A;  2VON A;  2B0L A;  2W4S A;  3CJR B;  3MN2 A;  3VSL A;  3WTS C;  1K61 A;  1KQ0 A;  3RZO J;  4IO9 F;  3REO A;  1A35 A;  3PL8 A;  2IXS A;  4G8X A;  3IV5 A;  1O3S A;  2MSY A;  3S3O A;  2EV0 A;  2EA2 A;  1TLH B;  3S32 A;  5LBQ A;  3D5L A;  5DCF A;  2XF7 A;  1DPR A;  4XOR A;  4MQV A;  2L9R A;  3OS1 A;  3CO7 C;  4O6J A;  2AHQ A;  4FE4 A;  1G3T A;  2EJR A;  1IG7 A;  4P96 A;  1E3P A;  1MMA A;  1FBU A;  3J81 Z;  2V9K A;  2EK5 A;  4QIW N;  4BEH A;  2Y9Z A;  1Y1W J;  5IT9 K;  3Q0W A;  5BS6 A;  3GTJ J;  5K5O A;  2ZJQ F;  2L9S A;  4M3G A;  1ON2 A;  1WI9 A;  4MHG A;  5D8L B;  2KIF A;  1XN7 A;  1YX5 A;  4CUG A;  1DUX C;  4HPQ A;  1FOY A;  2VLA A;  1SC7 A;  4BH9 A;  2XGC A;  2K86 A;  2L7K A;  3G1M A;  1XGO A;  1MJ9 A;  5FLX Z;  1X4P A;  2FSW A;  3BT9 A;  4A3C J;  1QPM A;  2LYC A;  2DXI A;  1PJR A;  3QWL A;  1HLV A;  1D0Y A;  1RUO A;  2Q1Z B;  2IBD A;  3H3U A;  3M8J A;  1KZH A;  2IPQ X;  2R7S A;  5EJC A;  3N97 A;  5J4V A;  1LFB A;  1DP3 A;  2Q8K A;  1X4O A;  4WXD A;  5EYR A;  4E7Z A;  2EFN A;  2B63 J;  1YE9 A;  4II3 A;  2JRT A;  3HKZ N;  3MZY A;  1HKS A;  3AG3 H;  1YQA A;  1XGN A;  3JTG A;  2FQ3 A;  2H1L A;  2WBM A;  1D5Y A;  3VPR A;  1G6N A;  4LG0 B;  2XGD A;  3U2R A;  3PO2 J;  2QBY A;  2LKS A;  2PMZ A;  4U88 A;  3GWZ A;  3IUO A;  2KIS A;  3HL2 A;  4XMY A;  4B1R A;  4DZP A;  3BG3 A;  2R3S A;  2A5W A;  2DMU A;  2HTS A;  3E97 A;  2IGO A;  2KPM A;  4XLP F;  1JGG A;  1OMI A;  4GYI A;  4XRS G;  1XGM A;  4BKX A;  3SFI A;  2DQR A;  5H2F C;  1N77 A;  3MKW B;  3Q5F A;  5JVG F;  3GUD A;  5ILU A;  4LFU A;  1Y0N A;  4R1H A;  4A6E A;  3VYS B;  1AOY A;  1IV6 A;  5CVV A;  2DMQ A;  2LNB A;  4UUS A;  5IPA A;  2OQG A;  2XKO A;  1IC8 A;  5BMZ A;  4QPQ A;  3B6A A;  4DNC A;  2P6T A;  3WTU C;  1W36 C;  4HEA 2;  3LSM A;  5IT9 Z;  1FYL A;  3BP8 A;  4IQJ A;  3F9K A;  4HF2 A;  4LLG F;  4WF2 A;  1KGS A;  1RIO H;  2M0M A;  3OYH A;  3TDU C;  3OR1 C;  3IWZ A;  1SMY F;  1IZ1 A;  3ASN H;  1VQN I;  4FE7 A;  2VOD A;  3K0L A;  2M2E A;  4NNJ A;  2DTZ A;  4IRH A;  4XR6 A;  2MW8 A;  2O7O A;  1P7J A;  3G71 I;  2XAU A;  1Z1D A;  2V26 A;  4D1Q A;  4AID A;  1PUF A;  1NTC A;  2DA3 A;  4KT6 A;  4XKW A;  2WAF A;  3F8B A;  3GTM J;  3BG5 A;  3A2K A;  3LQR A;  3ZN1 A;  1AA7 A;  4AUX A;  2DOF A;  2DOA A;  3K9T A;  4A5M A;  2LLK A;  3K4C A;  4I7H A;  1B8I B;  1O7F A;  4C2T A;  3L2R A;  4GDF A;  4QWQ A;  5E8G A;  3IWF A;  1OYW A;  2NS8 A;  4OOI A;  3VWB A;  2NS0 A;  2LP0 A;  4M71 A;  1QRY A;  2E7W A;  2EFQ A;  2F5V A;  3R0A A;  3PQK A;  2X6Y A;  1FC3 A;  3K6G A;  3I59 B;  5KK1 A;  5M3F J;  1ZHF A;  3TDZ C;  1F36 A;  2JA5 J;  3LSP A;  1G8X A;  4PK4 A;  4BXF A;  2LK2 A;  2VKD A;  3T8T A;  3Q0U A;  1UST A;  4IEJ A;  2VJI A;  5F0F A;  1HST A;  4MGR A;  1SMT A;  3BLY A;  2UXN A;  1W4M A;  1JT6 A;  3QPH A;  3S8P A;  3V7C A;  4A3M J;  1KQ8 A;  2BVL A;  2L0K A;  2DYR H;  1ZG5 A;  1NK2 P;  4GFB A;  5DD8 A;  1BI3 A;  3V8K A;  2BHZ A;  3MCZ A;  4ZZD A;  1ZK8 A;  2LFB A;  1WJC A;  2GBY A;  1TZL A;  1UFM A;  2E1M C;  5DM7 F;  3BPV A;  2H6B A;  2CUZ A;  1NHA A;  3HTU A;  4BAY A;  5HOD A;  4X1E A;  2QGU A;  2VPL A;  3MVP A;  1AKH B;  4C3H J;  1SAX A;  1U9N A;  1QZZ A;  2EZI A;  1OKR A;  3I71 A;  2M34 A;  2MA3 A;  1K7A A;  3T5X A;  3I53 A;  1BI2 A;  1BN5 A;  1XG1 A;  2DMT A;  5CVI A;  3AL0 C;  1SFO J;  3UKG A;  2STW A;  1MBH A;  4S0H B;  3LSI A;  1N78 A;  3NAU A;  2H8W A;  5CVJ A;  3ZQ7 A;  3ZMT A;  3P9C A;  1ETY A;  5F08 A;  3BPX A;  2V1D A;  4UY8 I;  1R23 A;  3ABT A;  3O8H A;  3HPG A;  3GTQ J;  4YFK F;  4GRI A;  2Y31 A;  3ZN0 A;  1WWX A;  2O61 A;  4L9J A;  3HIF A;  2HVS A;  1B1B A;  3SFZ A;  3JAM K;  3BR1 A;  4UVA A;  1CF7 A;  3HTS B;  3VB2 A;  2PQ8 A;  3BJA A;  3DP7 A;  1IXR C;  4HQE A;  2ACJ A;  2TDX A;  3BG7 A;  4EJW A;  2N8G A;  1WI3 A;  5C4J J;  4XLA A;  2STT A;  3EDP A;  1GUU A;  3KEO A;  1SD7 A;  4ASN A;  1J09 A;  1U5T C;  2DTR A;  5CVU A;  3OWT A;  4U87 A;  2VUM J;  1A6Q A;  1F5T A;  2E71 A;  1IN4 A;  1JTX A;  1VQO I;  1RUN A;  4PCQ A;  1J5Y A;  4ANJ A;  3G1L A;  2DK5 A;  2G0E A;  3L2Q A;  2NVU B;  2R7T A;  1YW9 A;  2CW0 F;  2V6E A;  1A6I A;  2BY0 A;  2DDB A;  2R5Z A;  4E7I A;  1WJA A;  5KAF C;  3VOD A;  3NAR A;  5EGO B;  3QQA A;  1TQI A;  4IZZ A;  4HAM A;  2MD0 A;  4XLN F;  3LAJ A;  4M9X A;  2CV2 A;  2H27 A;  4BYY A;  1T0F A;  1CQT A;  3D0S A;  1BIA A;  2JPB A;  3CJQ B;  3F21 A;  1LDJ A;  4IQ4 A;  3BG6 A;  1LQ1 A;  4I02 A;  2AQE A;  4PSW A;  3OOU A;  4P1W A;  3CCE I;  2FBH A;  5IP6 A;  3CMY A;  2HS5 A;  3DV8 A;  1R36 A;  4N9H A;  5J3L A;  4ZJZ A;  3FM3 A;  2ADU A;  5GP9 A;  3OYE A;  5HLT A;  2OAZ A;  1POG A;  5EEA A;  4FTH A;  3HOT A;  2VN2 A;  4AIK A;  2R5Y A;  3W2V A;  5FLM J;  4KFC A;  1GVD A;  4H4K C;  1OJL A;  3DEU A;  4DQ2 A;  1H9T A;  3CUQ C;  4XM3 A;  2W48 A;  1WFX A;  1HSJ A;  2HPI A;  2KIU A;  4IHX A;  2QSF X;  4LB5 A;  3WTX C;  5IP9 J;  1XTA A;  3JAM Z;  4FT8 A;  2AO9 A;  4N4N B;  2CW7 A;  2Y9Y A;  1SVM A;  2RQP A;  2DYS H;  1ON1 A;  5TJJ A;  5M5Y J;  2QEX I;  3HBL A;  4IHY A;  4XSZ F;  4XL9 A;  1ZEL A;  2HKX A;  3U1D A;  2BW3 B;  1RR8 C;  3DQV C;  4L0Y B;  4BQO A;  4C9Y A;  1TTY A;  2VIX A;  5LGT A;  3NWS A;  1P6R A;  2MD5 A;  2R7O A;  1KU7 A;  4BDZ A;  4NC6 A;  3S1N J;  3JRA A;  3E1S A;  1FBS A;  4I0B A;  1LB2 A;  2F5D A;  4ESB A;  2DAO A;  4LGW A;  4UUT A;  4A3K J;  4II2 A;  4BUP A;  1GXQ A;  2GXA A;  1WJE A;  3K7A J;  2RGV A;  1OPC A;  1Z3X A;  3W6V A;  1Z6T A;  1UMQ A;  3BTC A;  1WJ5 A;  5FRO A;  2ELJ A;  2CG4 A;  1IN5 A;  2FD5 A;  3E3V A;  3KLO A;  3E0J B;  1MDM B;  1UJ8 A;  2FU4 A;  2ESN A;  3ZR8 X;  3SZP A;  2OZ6 A;  2QUF A;  1I1G A;  5E1X A;  3BTI A;  5IT3 A;  3KEY A;  3N05 A;  1MJB A;  1SD6 A;  3CCY A;  2OQR A;  1BW5 A;  2CW8 A;  4PSX A;  4LB6 B;  2ZNY A;  1W0T A;  2C6Y A;  1HDP A;  1HC8 A;  2Y30 A;  4XKC A;  2ZXJ A;  1RR7 A;  2R7R A;  2A68 F;  4IHS A;  4LJZ F;  2CQK A;  4PGG A;  4IHV A;  4YIF A;  5FO5 A;  1IRX A;  1BW6 A;  2LTP A;  3P9K A;  4DZJ A;  2F48 A;  5D4S A;  3ML6 A;  1MH3 A;  2KDO A;  3LL7 A;  3IC7 A;  4E6K G;  5K5R A;  1TP4 A;  2L7Z A;  3DTE A;  1BOA A;  4YIR X;  4U0W A;  5CJ9 A;  1F1Z A;  1R4N B;  3WTY C;  1FBQ A;  3L2C A;  2JN6 A;  2MH2 A;  3ZGK A;  3CC7 I;  4AIJ A;  5TRD A;  5DM6 F;  1NG6 A;  2DI3 A;  2MAB A;  2YX4 A;  3F72 A;  3TP3 A;  4EAT A;  2OPT A;  2BZT A;  3MKZ A;  3M7G A;  2QSG X;  2K4J A;  4HSR A;  2GZW A;  4XLC A;  5FD5 A;  5EG0 B;  1JT0 A;  2HGC A;  4HF0 A;  5HDK A;  3HM5 A;  4RLQ A;  2EV6 A;  1BL0 A;  2X1C A;  1TQP A;  4M72 A;  4HX8 A;  4PJM A;  1JXS A;  3F8M A;  1W1W E;  1U5T A;  2E19 A;  3HXL A;  3LWF A;  4NC8 A;  2JT1 A;  1QBJ A;  3QYE A;  3I5U A;  2R7Z J;  2DCE A;  1OCR H;  2JPC A;  2PFB A;  2D1H A;  2KIQ A;  2O5R A;  1JGS A;  3H5N A;  2IA2 A;  2GA1 A;  3S17 J;  3H9Q A;  3RPQ A;  2GIZ A;  2HXO A;  2UUZ A;  1MMS A;  3P5J A;  2VBZ A;  2NS7 A;  1KU9 A;  3SZG A;  3HSR A;  2KZV A;  3J7A Y;  2Y0S A;  3DLL F;  1B9N A;  4ZC3 A;  4W97 A;  1FT9 A;  4A0Z A;  2ECB A;  4NUB A;  2K7L A;  1DU0 A;  4D7M A;  2G9W A;  5B5E C;  1SAU A;  3BZ6 A;  2CV1 A;  1Y0U A;  5KHD A;  1UG2 A;  4AYB A;  3HDD A;  3OIQ A;  2HXI A;  4RM2 A;  1V5G A;  4KYW A;  3RTR A;  1X3U A;  5D5X B;  2PJR A;  3K4B A;  4ZTJ A;  1I39 A;  3G2B A;  1OCZ H;  2YUS A;  4A69 C;  2OJE D;  3HHG A;  3BY6 A;  3OS2 A;  3DTI A;  5D8K B;  1ZAO A;  2CS3 A;  3OYF A;  2UZK A;  3WE3 A;  3CUQ A;  1ORK A;  4NC7 A;  2M45 A;  3Q9S A;  3DKX A;  3JR9 A;  2WAE A;  4YFN F;  2KMU A;  4G7Z F;  4NHJ A;  1MMG A;  3RYR A;  5FFZ A;  3GTK J;  3H9G A;  4HLX A;  3ABK H;  1R5I D;  2WWY A;  1Z6R A;  4KA4 A;  1WVR A;  1KYW A;  4D0P A;  1JHF A;  2LY2 A;  3JSP A;  2CV0 A;  4CHU A;  3J7A O;  2WB1 A;  1ETX A;  2GA2 A;  4BY1 J;  5GPA A;  3I56 I;  3PFI A;  1FOW A;  3HGG A;  1LPQ A;  3X2Q H;  2D5V A;  1VQ6 I;  2A69 F;  3TGN A;  3K4L A;  4BE2 A;  2HOT A;  4M6X A;  2O3F A;  3A01 B;  3A02 A;  1G3Y A;  4P5O A;  1MNM C;  3OL3 A;  5IYD J;  3LSH A;  1R9T J;  1X1P A;  2OCE A;  3GCM A;  1W5T A;  3JCU C;  5L3C A;  3E5X A;  4YII A;  3WG9 A;  2XB5 A;  3QAH A;  5M3M J;  1ZYR F;  1MIJ A;  2VL8 A;  4IHT A;  2IA1 A;  2F2E A;  4CZZ A;  2K9L A;  3OV8 A;  1T39 A;  3RPU A;  5GAD J;  3FXL A;  2QSH X;  3MEX A;  3EUH C;  1SD4 A;  2EIN H;  2M7B A;  1PDN C;  5FRM A;  1ACI A;  3N4M A;  5TIS C;  1ZAR A;  3IRQ A;  2IVM A;  3GTO J;  3Q9V A;  1FSH A;  1KON A;  5J6X A;  1BIB A;  4K2E A;  4PZJ A;  5IP7 J;  3F8C A;  3ECH A;  1W7P D;  4I2O A;  2XAQ A;  3I4P A;  5DV5 A;  2GXB A;  5L3B A;  2HI3 A;  3KX2 A;  1MJA A;  2P4W A;  5E17 F;  2W82 A;  4FIS A;  5JVT A;  1YOV B;  1WJF A;  3GTL J;  6PAX A;  1T98 A;  4MNU A;  4BQQ A;  2XVC A;  5ED4 A;  5FRN A;  1YI2 I;  4ZZL A;  2H94 A;  4IX7 A;  2L02 A;  3O6B B;  3ZQL A;  1BJA A;  1SAN A;  2VKE A;  4HQM A;  5DUI A;  3L1P A;  3RI4 A;  3F8F A;  4UNO A;  2CMP A;  2CQX A;  2JVH A;  2DU9 A;  3BG9 A;  5KVR A;  1Q1H A;  3J80 K;  2K40 A;  3K4N A;  2P0W A;  3F8N A;  1U3E M;  1R1V A;  1WJB A;  3I54 A;  4A3E J;  1VFC A;  2XIG A;  1IUY A;  5FKM A;  2NRA C;  1WJD A;  2IS1 A;  3KPH A;  3O2P E;  1K78 B;  1X3W B;  5D6E A;  3WTT C;  1IW7 F;  1K83 J;  1WZ2 A;  4ENK A;  4CZC A;  2LG4 A;  4PUS A;  3K70 D;  2ZME C;  5M5W J;  2IS4 A;  3S2D J;  2FNA A;  5HDG A;  2A61 A;  4IRI A;  5CPR B;  2E1C A;  2XDV A;  3JRB A;  2MGQ A;  5IYC J;  3ZXS A;  4Z2Y A;  2LRD A;  1QU3 A;  3HC7 A;  2O6G E;  4L5J A;  1Z21 A;  2Y0M A;  1ZH5 A;  2IJL A;  4OIR F;  4A0X A;  4M6V A;  4IJA A;  1W36 D;  3BOQ A;  1FLI A;  3OYK A;  4DBR A;  1X2N A;  2K9M A;  3I3L A;  5F0H A;  1UHW A;  3OIO A;  4Y33 A;  4IOA F;  2DN0 A;  1OCT C;  3U21 A;  1V5F A;  1JI8 A;  5LHH A;  2HU9 A;  3HOV J;  3FM5 A;  2MH9 A;  2L7M P;  3RKX A;  1S7A A;  4E7K A;  4BGD A;  4L18 B;  4OMZ A;  2E1O A;  3VOE A;  4MTD A;  5LGN A;  5IYB J;  3QOP A;  1ZLK A;  1ONV A;  2X1D A;  3DKW A;  2RNG A;  5DCM A;  4ZYH A;  2LY1 A;  3FIW A;  4M9S A;  3KZZ A;  2DT6 A;  3BRO A;  3RKQ A;  1C0W A;  1FEX A;  1N75 A;  1MBG A;  1TWC J;  3H35 A;  1XCB A;  3J80 Z;  4ESJ A;  1Y6I A;  5CQE A;  2HOA A;  4ZDL A;  4KN4 X;  1D1B A;  1B8I A;  4KNY A;  3Q3S A;  4PJL A;  1FNN A;  2PMU A;  4FX0 A;  5DDG A;  1M1E B;  1HF0 A;  3CJN A;  1GT0 C;  3LNQ A;  1BR4 A;  2DA1 A;  4Q48 A;  2IGM A;  4XKV A;  3CCV I;  2XB0 X;  3WGG A;  3V7S A;  1JUM A;  4LK0 F;  3GLX A;  5EDN A;  2VI6 A;  3O8G A;  5HNH A;  5DEQ A;  3K4J A;  4RS8 A;  2MBF A;  4CO8 A;  1J2X A;  1MBK A;  2M30 A;  4WWC A;  2KQR A;  1Z9C A;  2EZH A;  2VJJ A;  3H1C A;  3WHC A;  2KDZ A;  1PYV A;  1H88 C;  2HFH A;  2HQ5 A;  1J59 A;  2PBI A;  1UG0 A;  2X1E A;  4DW6 A;  1WH7 A;  4BDY A;  3K69 A;  4ZDP A;  1MMN A;  1ETQ A;  5HNF A;  4UXN A;  1WHU A;  2JUG A;  1FTT A;  5EZG A;  3K70 C;  1AKH A;  4HV6 A;  3EUH A;  1ITY A;  2LRE A;  1BR2 A;  2GOM A;  4EEF G;  1LKX A;  1T0F C;  3F3X A;  3OL4 A;  2K27 A;  4L9T A;  4XN0 A;  1S29 A;  3RCO A;  4YG2 F;  4F93 B;  1U78 A;  1HQC A;  3COA C;  4KMU X; 
#chains in the Genus database with same CATH homology
 4P9F A;  1T38 A;  2LKP A;  3HSE A;  3K1M A;  2VXZ A;  1UHM A;  3HRU A;  4UVC A;  1TNT A;  4CXF A;  3JTH A;  5LRR A;  3LQQ A;  4HDV A;  1J9I A;  1KA8 A;  4KMF A;  5ILS A;  2EFP A;  5LGU A;  1RNL A;  2BBY A;  2L01 A;  3BJO A;  5ILV A;  1FOK A;  3WGH A;  3HRT A;  3RKY A;  1AWC A;  2ZME A;  1XMA A;  4WCG A;  5F64 A;  4HX7 A;  2P7C B;  5ICC A;  2W84 A;  4A2U A;  1YW8 A;  1UB9 A;  4CGZ A;  1YTY A;  3GFM A;  1P92 A;  1BC7 C;  1I1S A;  1Z91 A;  4BHC A;  3MFK A;  2ZCW A;  1XDS A;  4OIN F;  3LFK A;  4AD9 A;  3VFZ A;  5E18 F;  1EH8 A;  1HW5 A;  2V9V A;  1O3T A;  1U6G A;  5BPD A;  1USS A;  1STZ A;  1F9N A;  1XD7 A;  2CFX A;  1B59 A;  4MEY F;  4UV8 A;  4HBL A;  2E1N A;  2OBP A;  4L5I A;  3ABU A;  3SQN A;  4EQQ A;  1FP1 D;  2XRO A;  4RGR A;  3KP6 A;  4MTE A;  1TW3 A;  1IRG A;  1ZG1 A;  2EFW A;  1IXC A;  2LF8 A;  1I5Z A;  1W7P A;  4I0A A;  1R5H A;  2EA4 A;  3ZMS A;  3LA7 A;  3RIR A;  2QQB A;  2W57 A;  1O7L A;  1H0M A;  4KIC A;  4Y13 A;  3R60 A;  3KLN A;  1R58 A;  2P5K A;  1KYZ A;  4ZYD A;  1K6O A;  3F6O A;  2YR2 A;  2FEZ A;  3ZMD A;  1IN7 A;  4G7H F;  3IKV A;  2A5Y B;  3VEP A;  2HYF A;  3LAP A;  3KEQ A;  1ZG3 A;  4EJT A;  4RB2 C;  3MWM A;  5LRS A;  3QPT A;  4UHT A;  4IF4 A;  2HQR A;  1BM9 A;  4KDP A;  2JZY A;  4GCV A;  1QZY A;  3FXR A;  1G3W A;  2L3D A;  5FB2 A;  2XHK A;  4AVP A;  1YYV A;  2DPU A;  2L4A A;  4N9I A;  2J5P A;  3GX4 X;  1WQ2 A;  2J5O A;  4AIH A;  1EV7 A;  2AXL A;  4OIP F;  1OYI A;  4HZF A;  3SXY A;  2XAF A;  2IRF G;  1R1U A;  3IRR A;  3KE2 A;  5D5U B;  1BC8 C;  3F6V A;  3P9I A;  4O3M A;  4LD5 A;  2LDU A;  1IF1 A;  3RJP A;  3EYI A;  3KP3 A;  2YSR A;  3C1D A;  1B6A A;  2L4M A;  2GQQ A;  1V3F A;  1E17 A;  2ETH A;  2QEN A;  3CO6 C;  2BEO A;  5D6F A;  2V6C A;  2FE3 A;  4I98 B;  5FGM A;  2CGP A;  4EVI A;  3ZMZ A;  2H6C A;  2H09 A;  2FOK A;  5JI6 A;  4RB1 A;  4ESF A;  1CF7 B;  1FYK A;  1TW2 A;  1P4X A;  4U7D A;  4O5V A;  2VBW A;  2XKP A;  3WTZ A;  3LA2 A;  5H6Q A;  1R1T A;  1ZRE A;  3T1B A;  2VT2 A;  2XAH A;  2GXG A;  3V4G A;  1BBY A;  4ETS A;  3NQO A;  2COM A;  1R00 A;  3FXU A;  1L0O C;  5JR3 A;  4U0V A;  4BXU A;  4I01 A;  5E1W A;  2WTE A;  3TOB A;  4H0E A;  1O3Q A;  2XAS A;  2FBI A;  3WGI A;  1XSD A;  4KT5 C;  4L9N A;  2A6H F;  2M5W A;  2OD5 A;  4GO1 A;  1FYM A;  1FY7 A;  3KP7 A;  3K2Z A;  2V1X A;  2MLK A;  1TBX A;  3CDH A;  4WXC A;  1ODD A;  5LHG A;  2RDP A;  3HRM A;  2K02 A;  3GXO A;  2EB7 A;  4BHB A;  2M8E A;  2RKH A;  3FMQ A;  4BHP A;  2UWM A;  3CLO A;  1I27 A;  4WK8 F;  4YFX F;  3ZMV A;  5JHU A;  2DK8 A;  4EGZ A;  4CYD A;  4U0Y A;  2WV0 A;  3T8R A;  3TO9 A;  3GW2 A;  2A07 F;  3EQL F;  4EJU A;  1JE8 A;  1B9M A;  5BOX A;  1WRJ A;  2P8T A;  4BNC A;  2CO5 A;  3C7J A;  3BWG A;  1J75 A;  2Z99 A;  1P2F A;  4G7O F;  2L54 A;  3EYY A;  3DPL C;  1G4D A;  3MQ0 A;  3SHF A;  5ICF A;  5FFX A;  3FWE A;  5L3E A;  3B02 A;  4QLC U;  2UXX A;  3HOS A;  2X4H A;  3E5Q A;  2Z5U A;  1WSU A;  4RAY A;  1KU2 A;  5H20 A;  2EFO A;  4RGX A;  1TNS A;  5BQT A;  1BI1 A;  1S3J A;  2YPR A;  3FZV A;  5DYM A;  5HOO A;  1GXP A;  4NB5 A;  3EET A;  2O03 A;  2YX7 A;  1XDU A;  2QM3 A;  2VOP A;  2AS5 F;  4HLY A;  2R7D A;  1S6L A;  2ZJ2 A;  2Q0O A;  3JW4 A;  1R5G A;  5HDN A;  1PUE E;  1T6S A;  3HYI A;  1YO5 C;  1S7O A;  1U5T B;  3RYP A;  3WTW C;  4BQA A;  1YS6 A;  2W25 A;  3C3W A;  3K1N A;  3R4K A;  5DUK A;  5H6R A;  1Z05 A;  2Y48 A;  4LK1 F;  2HTJ A;  1P4W A;  4EJO A;  4TV7 A;  4EV0 A;  3ZPL A;  3H92 A;  4EJV A;  4G9Y A;  3R6S A;  5A2Q K;  5D5V B;  2ELH A;  4HW0 A;  4LG0 A;  2QLZ A;  2P5V A;  2FRH A;  2P5L C;  2HR3 A;  3CUQ B;  1EH7 A;  3TKY A;  4LMY A;  4E70 A;  2G7U A;  2HYG D;  2FNP A;  3KCC A;  5J8F A;  3B73 A;  3GZ5 A;  1PP8 F;  1R22 A;  2DBB A;  1U8R A;  1GHC A;  2DT5 A;  2IW5 A;  1VTN C;  4RGU A;  3C18 A;  5E1Z B;  3GO5 A;  1ZGJ A;  1O3R A;  4ON0 A;  1YG2 A;  3M1E A;  3R61 A;  2Z33 A;  2Y75 A;  2DQL A;  3U9G A;  3M8F A;  3V7R A;  1OYY A;  2ZFW A;  2F5C A;  1HW2 A;  3L9F A;  3IKT A;  4M74 A;  4RB3 C;  5A2Q Z;  4EM0 B;  1LEB A;  1SFX A;  3JSO A;  3TQN A;  2RC4 A;  1HKT A;  2JSC A;  5F1R A;  4KUM A;  3QRF F;  1LNW A;  3I59 A;  4CIC A;  4I09 A;  4M73 A;  1HKQ A;  1LDD A;  1SFU A;  3DFG A;  4LLL A;  2XAG A;  3L7W A;  5HS8 A;  2KKO A;  3OOP A;  3GYH X;  5EEG A;  2MC3 A;  3L09 A;  2KRF A;  2XGX A;  2HKO A;  4ZH4 F;  2NAZ A;  5K5Q A;  1S8N A;  3ZMU A;  4GYG A;  2YU3 A;  2PJP A;  2D45 A;  3LST A;  3KP2 A;  1HBX G;  1L3L A;  2W85 A;  3GF2 A;  3MZH A;  4ZYG A;  2FXA A;  3W6K B;  5LEJ A;  2P6S A;  4IRG A;  1KU3 A;  4WXH A;  3CTA A;  3E6M A;  2FBK A;  2ZO4 A;  2QWW A;  5HLI A;  1T2K A;  1FX7 A;  2OZU A;  2QZ8 A;  4Y15 A;  3NEU A;  5AON A;  4A0Y A;  3GFJ A;  2LSO A;  4G6D A;  1IAW A;  3TOA A;  1OR7 A;  4PDK A;  3ERE D;  4L0Z B;  3CUO A;  1LVA A;  3HUG A;  3WU0 A;  5DCM B;  4KIF A;  3KP4 A;  1ZN2 A;  2EWN A;  3QU3 A;  4UUV A;  5FD6 A;  2GIV A;  1IXS B;  3DF8 A;  3E6D A;  4A5N A;  2EV5 A;  1MKM A;  4EM1 A;  2PG4 A;  4IVN A;  2OU2 A;  4Y17 A;  2XV4 S;  4HV5 A;  4OU0 A;  4U7B A;  2NNY A;  4KIB A;  2VC0 A;  4Q47 A;  2QQA A;  4M6Y A;  2X0L A;  2HEO A;  4RAZ A;  4N0B A;  1KQ9 A;  2QBY B;  2A3S A;  4CDG A;  1SD5 A;  3LA3 A;  1ZRC A;  4WX9 A;  4GGG A;  3K1P A;  3V8L A;  5HS9 A;  2DPD A;  2HZT A;  4OMY A;  2O8X A;  2CWE A;  1ZGA A;  3FX3 A;  4XSX F;  5L3G A;  5J8C A;  1G3S A;  5E8I A;  1FSE A;  4KN7 X;  2GAU A;  2Z9O A;  3NRV A;  3IHU A;  1HXD A;  5HS7 A;  5DD4 A;  1I6X A;  2KJB A;  1K79 A;  5HLG A;  5L3D A;  4GXO A;  4JBA A;  3F22 A;  2XAJ A;  2NYX A;  3G73 A;  1XSV A;  2XRN A;  2CSO A;  2BGC A;  3ELK A;  4OIQ F;  5D4R A;  2M1B A;  1MDM A;  4R8H A;  4P55 A;  1ULY A;  2XUB A;  2NNN A;  4HDU A;  3O3K A;  3I64 A;  1YFH A;  3WOD F;  5BPI A;  2VBY A;  2WC2 A;  5AIP A;  2ZME B;  1DPU A;  4Q5S F;  3TO6 A;  2KJC A;  3FF5 A;  3QP6 A;  1B4A A;  2FF4 A;  1EH6 A;  2K4B A;  3DXJ F;  4FX4 A;  1LJ9 A;  2Q2E A;  1YW7 A;  5ICE A;  3WE2 A;  3GFI A;  1V4R A;  4AWX B;  5ICG A;  1U2W A;  4NQW A;  4S05 A;  3PQJ A;  4ENJ A;  1YIO A;  4RGS A;  5LHI A;  1A04 A;  1BI0 A;  1IN6 A;  3V8J A;  2IT0 A;  3E5U A;  1LEA A;  2Z3Y A;  2DFI A;  1GVJ A;  2W24 A;  1FPQ A;  1ZRD A;  1CGP A;  3AAF A;  4IXA A;  4MQ9 F;  5CVR A;  2FMY A;  1W7P B;  1QGP A;  3GEZ A;  1F4K A;  2GWR A;  4R79 A;  1D8J A;  1J0R A;  5CLS A;  3H3Z A;  3KZY A;  1RZ4 A;  4HYE A;  4XBF A;  3P7N A;  5HVQ C;  3IL2 A;  2HQN A;  4Q4Z F;  1D5V A;  2VOO A;  1XMK A;  1D8K A;  2V1U A;  1IRF A;  2ZNZ A;  4EMS A;  3WTV C;  4A6D A;  1R7J A;  4JQF A;  4P9U A;  1DP7 P;  3HRS A;  1W5S A;  5JFR A;  2F5E A;  4UVB A;  3G3Z A;  1MGT A;  1QNT A;  3HHH A;  2PI0 A;  2O0Y A;  2ISY A;  3HSF A;  4RB0 A;  1D3Y A;  2IA0 A;  2DO7 A;  3WU1 B;  1FP2 A;  5EEH A;  2A6E F;  3FXQ A;  2QYO A;  3QU6 A;  5ERI A;  4HF1 A;  4M9Z A;  2QQ9 A;  1J7K A;  1IN8 A;  3ZP5 A;  4HA8 A;  1WKM A;  2ISZ A;  1P4A A;  2D1V A;  2VC1 A;  1PP7 U;  3ROU A;  1FWZ A;  4B09 A;  2RN7 A;  4LLN A;  4B8X A;  4ENN A;  3L00 A;  1QQI A;  4PGH A;  5K1Y A;  2CYY A;  1RI7 A;  3QP5 A;  2JTV A;  5LLQ A;  2VE9 A;  5F6F A;  4IPA A;  2G7H A;  3I58 A;  3GVA A;  2V79 A;  2OA4 A;  1UCR A;  4G94 A;  4G6Q A;  1XSX A;  2F5F A;  5HLH A;  1K78 A;  1H9G A;  2ZKZ A;  1MD0 A;  4ENM A;  2VBX A;  1JHH A;  2DLL A;  2VT3 A;  4XRF A;  4OIO F;  3MAJ A;  3E6B A;  2HWV A;  5AIQ A;  5D5W B;  1REP C;  2PEX A;  2FML A;  1HW1 A;  3M9A A;  5CYV A;  1ZRF A;  2KIM A;  4S04 A;  2BYV E;  1LDK B;  3F23 A;  3E6C C;  3GZ6 A;  3FHZ A;  4HOB A;  3S2W A;  1QO0 D;  2VE8 A;  1DDN A;  3I0T A;  4KIG A;  3M8E A;  3T0Y A;  3KET A;  3BJ6 A;  3KFW X;  4ZYE A;  5E20 A;  4MEX F;  1MZB A;  2RVC A;  1XCV A;  2RV8 A;  5L3F A;  2M87 A;  1XB4 A;  2ESH A;  2PLY A;  1FZP B;  2E7X A;  2PMH A;  4EM2 A;  2R7F A;  3RDI A;  3FMR A;  2PN6 A;  1YS7 A;  4UV9 A;  4EGY A;  1XGS A;  2HOE A;  3RKW A;  4HX4 A;  2FA5 A;  2QVO A;  1E2X A;  3BDD A;  3TO7 A;  2RNJ A;  5LEK A;  1YLF A;  1ZLJ A;  4JK1 X;  3J81 K;  3ULQ B;  2MLG A;  2BV6 A;  2LF7 A;  5FLX K;  1O57 A;  3GFL A;  2HDC A;  1SFE A;  3W6J B;  3ISP A;  1Z7U A;  3KP5 A;  2D2W A;  4L9V A;  4F7Z A;  4A12 A;  2P7V B;  3FMS A;  3R0J A;  2BE5 F;  4FHT A;  2ZBK A;  2IP2 A;  3ECO A;  1TQM A;  2DW4 A;  3DPT A;  3SZT A;  2VON A;  2B0L A;  3WTS C;  1KQ0 A;  3REO A;  4G8X A;  1O3S A;  2EV0 A;  2EA2 A;  1TLH B;  5LBQ A;  3D5L A;  5DCF A;  1DPR A;  4MQV A;  3CO7 C;  4O6J A;  1G3T A;  2EJR A;  4P96 A;  1FBU A;  3J81 Z;  2EK5 A;  5IT9 K;  5BS6 A;  5K5O A;  1ON2 A;  1WI9 A;  4MHG A;  5D8L B;  2KIF A;  1XN7 A;  1DUX C;  4BH9 A;  2K86 A;  1XGO A;  1MJ9 A;  5FLX Z;  2FSW A;  1QPM A;  1RUO A;  3H3U A;  2IPQ X;  3N97 A;  2Q8K A;  4WXD A;  2EFN A;  2JRT A;  3MZY A;  1HKS A;  1YQA A;  1XGN A;  3JTG A;  2FQ3 A;  1G6N A;  4LG0 B;  3U2R A;  2QBY A;  4U88 A;  3GWZ A;  2R3S A;  3E97 A;  4XLP F;  2HTS A;  1OMI A;  4GYI A;  1XGM A;  2DQR A;  3Q5F A;  3GUD A;  5ILU A;  4LFU A;  4R1H A;  4A6E A;  1AOY A;  5CVV A;  2LNB A;  2OQG A;  2XKO A;  5BMZ A;  4DNC A;  2P6T A;  3WTU C;  5IT9 Z;  1FYL A;  3BP8 A;  4HF2 A;  4LLG F;  4WF2 A;  1KGS A;  1RIO H;  3TDU C;  3IWZ A;  1SMY F;  1IZ1 A;  2VOD A;  3K0L A;  4IRH A;  1Z1D A;  3F8B A;  3LQR A;  3ZN1 A;  3K9T A;  4A5M A;  4I7H A;  1O7F A;  4QWQ A;  5E8G A;  3IWF A;  1OYW A;  4OOI A;  2NS0 A;  4M71 A;  2E7W A;  2EFQ A;  3R0A A;  3PQK A;  1FC3 A;  3I59 B;  5KK1 A;  1ZHF A;  3TDZ C;  3T8T A;  1UST A;  1HST A;  4MGR A;  1SMT A;  3QPH A;  2UXN A;  1W4M A;  1KQ8 A;  3V7C A;  1ZG5 A;  5DD8 A;  1BI3 A;  3V8K A;  3MCZ A;  4ZZD A;  1UFM A;  3BPV A;  2H6B A;  1NHA A;  3HTU A;  4BAY A;  1SAX A;  1QZZ A;  1OKR A;  3I71 A;  2MA3 A;  1K7A A;  3T5X A;  3I53 A;  1BI2 A;  1BN5 A;  5CVI A;  2STW A;  5CVJ A;  3ZQ7 A;  3ZMT A;  3P9C A;  3BPX A;  2V1D A;  1R23 A;  3ABT A;  4YFK F;  3ZN0 A;  1WWX A;  2O61 A;  4L9J A;  3HIF A;  1B1B A;  3SFZ A;  3JAM K;  4UVA A;  1CF7 A;  3HTS B;  3VB2 A;  2PQ8 A;  3BJA A;  3DP7 A;  1IXR C;  4HQE A;  2ACJ A;  2TDX A;  4EJW A;  2STT A;  3EDP A;  3KEO A;  1SD7 A;  4ASN A;  1U5T C;  2DTR A;  5CVU A;  1F5T A;  1IN4 A;  1RUN A;  4PCQ A;  1J5Y A;  2DK5 A;  1YW9 A;  2CW0 F;  3VOD A;  1TQI A;  4HAM A;  4XLN F;  3LAJ A;  4M9X A;  2H27 A;  4BYY A;  1T0F A;  3D0S A;  1BIA A;  2JPB A;  3F21 A;  1LDJ A;  1LQ1 A;  4I02 A;  2FBH A;  2HS5 A;  3DV8 A;  1R36 A;  4N9H A;  3FM3 A;  2ADU A;  2OAZ A;  3HOT A;  2VN2 A;  4AIK A;  4KFC A;  3DEU A;  4DQ2 A;  1H9T A;  3CUQ C;  1HSJ A;  2KIU A;  4LB5 A;  3WTX C;  3JAM Z;  4FT8 A;  2RQP A;  1ON1 A;  5TJJ A;  4XSZ F;  2HKX A;  3U1D A;  4L0Y B;  3DQV C;  1TTY A;  5LGT A;  1P6R A;  2MD5 A;  1KU7 A;  1FBS A;  4I0B A;  1LB2 A;  2F5D A;  4ESB A;  2DAO A;  4LGW A;  1GXQ A;  2RGV A;  1OPC A;  1Z6T A;  2CG4 A;  1IN5 A;  3E3V A;  3KLO A;  1MDM B;  2FU4 A;  2ESN A;  3SZP A;  2OZ6 A;  2QUF A;  1I1G A;  5E1X A;  5IT3 A;  1MJB A;  1SD6 A;  2OQR A;  4LB6 B;  2ZNY A;  2C6Y A;  2ZXJ A;  2A68 F;  4IHS A;  4LJZ F;  2CQK A;  4PGG A;  4YIF A;  5FO5 A;  3P9K A;  5D4S A;  3ML6 A;  3IC7 A;  5K5R A;  1BOA A;  4U0W A;  5CJ9 A;  1F1Z A;  3WTY C;  1FBQ A;  3L2C A;  2MH2 A;  4AIJ A;  5TRD A;  2DI3 A;  2YX4 A;  3F72 A;  3M7G A;  2K4J A;  2GZW A;  5FD5 A;  2HGC A;  4HF0 A;  5HDK A;  2EV6 A;  1TQP A;  4M72 A;  4HX8 A;  1JXS A;  3F8M A;  1U5T A;  3LWF A;  2JT1 A;  1QBJ A;  3I5U A;  2JPC A;  2PFB A;  2D1H A;  1JGS A;  2IA2 A;  2GA1 A;  3RPQ A;  2VBZ A;  1KU9 A;  3HSR A;  1B9N A;  1FT9 A;  4A0Z A;  2K7L A;  2G9W A;  3BZ6 A;  1Y0U A;  4KYW A;  3RTR A;  1X3U A;  5D5X B;  3HHG A;  3BY6 A;  5D8K B;  1ZAO A;  2UZK A;  3WE3 A;  3CUQ A;  2M45 A;  3Q9S A;  4YFN F;  4G7Z F;  4NHJ A;  3RYR A;  5FFZ A;  4HLX A;  2WWY A;  1Z6R A;  4KA4 A;  1KYW A;  4D0P A;  1JHF A;  3JSP A;  3J7A O;  4CHU A;  2GA2 A;  3PFI A;  2A69 F;  3TGN A;  4M6X A;  2O3F A;  1G3Y A;  4P5O A;  1W5T A;  5L3C A;  3E5X A;  4YII A;  3WG9 A;  3QAH A;  1ZYR F;  4IHT A;  2IA1 A;  2F2E A;  4CZZ A;  3OV8 A;  1T39 A;  3RPU A;  3MEX A;  1SD4 A;  1PDN C;  3N4M A;  1ZAR A;  3IRQ A;  2IVM A;  3Q9V A;  1FSH A;  5J6X A;  1BIB A;  4K2E A;  4PZJ A;  3F8C A;  3ECH A;  1W7P D;  4I2O A;  2XAQ A;  3I4P A;  5DV5 A;  2GXB A;  5L3B A;  1MJA A;  2P4W A;  5E17 F;  5JVT A;  6PAX A;  1T98 A;  4MNU A;  5ED4 A;  2XVC A;  4ZZL A;  2H94 A;  2L02 A;  3O6B B;  1BJA A;  5DUI A;  4HQM A;  3RI4 A;  3F8F A;  4UNO A;  5KVR A;  2DU9 A;  1Q1H A;  3J80 K;  3F8N A;  1U3E M;  1R1V A;  3I54 A;  2XIG A;  1IUY A;  2NRA C;  3O2P E;  1K78 B;  5D6E A;  3WTT C;  1IW7 F;  4ENK A;  2FNA A;  5HDG A;  2A61 A;  4IRI A;  2E1C A;  4Z2Y A;  2O6G E;  4L5J A;  2Y0M A;  1ZH5 A;  2IJL A;  4OIR F;  4A0X A;  4IJA A;  3BOQ A;  1FLI A;  1UHW A;  5LHH A;  3FM5 A;  2MH9 A;  3RKX A;  1S7A A;  4L18 B;  4OMZ A;  3VOE A;  4MTD A;  5LGN A;  1ZLK A;  3QOP A;  1ONV A;  3DKW A;  4ZYH A;  5DCM A;  4M9S A;  3KZZ A;  3BRO A;  1C0W A;  1XCB A;  3J80 Z;  4ESJ A;  4KN4 X;  4KNY A;  1FNN A;  2PMU A;  4FX0 A;  5DDG A;  3CJN A;  4Q48 A;  3WGG A;  3V7S A;  4LK0 F;  3GLX A;  5DEQ A;  4RS8 A;  2MBF A;  4CO8 A;  1J2X A;  2M30 A;  4WWC A;  1Z9C A;  2HFH A;  1J59 A;  2PBI A;  3K69 A;  4UXN A;  4HV6 A;  3EUH A;  3F3X A;  2K27 A;  4L9T A;  1S29 A;  4YG2 F;  1U78 A;  1HQC A;  3COA C;  4KMU X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...