1Z1DA

Structural model for the interaction between rpa32 c-terminal domain and sv40 t antigen origin binding domain.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
69
structure length
69
Chain Sequence
ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replication protein A 32 kDa subunit
publication title Insights into hRPA32 C-terminal domain--mediated assembly of the simian virus 40 replisome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 22
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z1dA00
5JFRA 3HSEA 4M71A 5D4SA 4YFKF 3T5XA 1MJBA 2B0LA 4HX8A 3V7RA 3M7GA 1JGSA 1R58A 1L3LA 3F8CA 2Y75A 1KYZA 2D1HA 2Z33A 1Z05A 1ZGAA 1FSHA 5A2QZ 3DPLC 4HF0A 1D8JA 5E1ZB 2DAOA 1VTNC 2P6TA 5IT9Z 4G8XA 2Z5UA 3ECHA 3RKXA 3F8NA 5BMZA 3G73A 1QQIA 5LBQA 3CO7C 4TV7A 2UWMA 2IA0A 2R3SA 3PQKA 4RAZA 1ZLJA 3IC7A 2EFWA 1FYMA 4RB2C 4AIKA 4QLCU 2K7LA 1J59A 3ROUA 1MJ9A 1FBUA 4KT5C 3IRRA 3FM3A 1S7AA 4EJUA 4L0ZB 2DTRA 3V7SA 2HGCA 2STWA 2Q0OA 3SXYA 4ZYDA 3SFZA 3J81Z 1XGOA 2QLZA 1BIAA 1YW9A 1YG2A 1B59A 3F72A 2ZBKA 1CF7B 3RTRA 3PQJA 2VBZA 1S8NA 1PP7U 5D5UB 1WQ2A 4L9TA 3I5UA 1P4WA 2QYOA 4U0YA 3WE2A 3GUDA 2P7VB 3ZMTA 4RGSA 2FMYA 4O5VA 3IHUA 1UHMA 3GWZA 1LDJA 3QP5A 1STZA 1ON1A 4XSZF 1XD7A 4M73A 5BPIA 2NS0A 4L18B 1ZLKA 4XLPF 4IXAA 4LB5A 5LHHA 1YFHA 1K6OA 2QBYB 1B6AA 2Y48A 1OR7A 5CVRA 3C3WA 2D45A 2KIFA 1B4AA 5TJJA 3U1DA 1IW7F 1WSUA 2FMLA 3U2RA 2ADUA 5BPDA 2V79A 3LQRA 1TNSA 4L9NA 5D5VB 1JHFA 1O3RA 3N4MA 2GXBA 1W4MA 4RS8A 1W5TA 4FX0A 1H9TA 4MTDA 2AS5F 3R0AA 5LEKA 2OD5A 3HHGA 4YFNF 2DO7A 1IN5A 3R0JA 1FBQA 4HF1A 4FX4A 4O6JA 1R5HA 3CUQC 1USTA 2HFHA 3D5LA 4P9FA 1KQ0A 2XV4S 5DUIA 4KFCA 4BHPA 2W57A 1GVJA 2F5FA 2K86A 1RIOH 3O6BB 5DCFA 3EYIA 1XMKA 1P2FA 3ZMVA 4AWXB 4P55A 2KJBA 2XIGA 1PDNC 1MDMA 2Z9OA 1XGNA 1LEBA 2FNPA 4L5JA 4ESFA 3MZHA 2G7UA 3KCCA 3JSOA 3K69A 1IZ1A 3NQOA 1OPCA 2XAJA 1BBYA 3T1BA 4XSXF 4EJWA 3F6OA 2FEZA 2YR2A 1YS7A 3DEUA 5HDKA 3B02A 5LRRA 1KU3A 1FX7A 2IVMA 3I0TA 3RYPA 1CF7A 3HRMA 4HAMA 1TBXA 3BP8A 2FA5A 1IXSB 1QGPA 3Q9VA 1B9MA 4KMUX 1SD7A 1P6RA 2F5DA 2J5OA 3GX4X 2M5WA 1ZGJA 4EGYA 4UV8A 4BXUA 3GFMA 2ZJ2A 2P5LC 2IA2A 4LG0A 1X3UA 2M30A 4A6DA 4OINF 3B73A 5CJ9A 1KQ8A 3FXQA 4UVCA 3HTSB 1RZ4A 1FBSA 4Y17A 3AAFA 4FHTA 1ZARA 1FP1D 5K5RA 4OIOF 2ACJA 2A68F 1PP8F 2FE3A 2CGPA 4R1HA 2RV8A 3QU6A 1T98A 2RVCA 3CDHA 4I2OA 1AOYA 2RKHA 3E3VA 5E1XA 4IVNA 3R4KA 1D3YA 2EFNA 3HSRA 5CVIA 1HBXG 2FRHA 3GFIA 4KIGA 2XUBA 4CXFA 3WGGA 1MKMA 5A2QK 2ELHA 4LB6B 2HS5A 1W7PD 5L3DA 3ECOA 3I64A 4BQAA 3HYIA 2VC1A 3ABTA 4CO8A 1FC3A 1XDSA 3KP4A 2O03A 2IT0A 4PCQA 3V4GA 1LDKB 2BE5F 3QOPA 1I1SA 4M6YA 3DXJF 4BHCA 2X0LA 4ENMA 1F5TA 2DK5A 2NNNA 3HTUA 4WX9A 1QBJA 1O3TA 3KP3A 1QZYA 2R7FA 5IT3A 3T8TA 1W5SA 2GA2A 3M1EA 3BWGA 4KN7X 1FT9A 2GAUA 2KIMA 5HVQC 1D5VA 3TO9A 2PMUA 3K1MA 3E5UA 4DNCA 2ZKZA 3R60A 1S3JA 4NQWA 4K2EA 1BI3A 2NNYA 5J8FA 3WTTC 4YG2F 1ZRCA 4HBLA 1OYWA 3K1NA 1T38A 2PMHA 2A6HF 4LLLA 1SFXA 4IRIA 2V1UA 3LAPA 1ZYRF 1HKSA 4KMFA 4G7HF 4OOIA 2MLKA 1KU7A 1JXSA 5D6FA 4UVAA 3F8BA 1XCVA 2RC4A 4M9SA 2FXAA 3W6KB 2Z99A 4HYEA 4KICA 1K78A 3HHHA 3LSTA 2ZMEA 1Z7UA 3BY6A 3GYHX 2COMA 4Z2YA 4EM2A 2W85A 1RUNA 5FO5A 5E17F 4JBAA 3O2PE 4YIFA 5FFXA 5TRDA 2M1BA 2VE9A 4E70A 2NYXA 1T2KA 2LNBA 3VFZA 2MLGA 3R61A 2QQAA 2L4AA 2UXXA 2VE8A 5HS9A 4B09A 2HDCA 4PGGA 3WGHA 1IN4A 3C1DA 2DQRA 3KP5A 1OKRA 1TQPA 2XHKA 1MJAA 2X4HA 5CVVA 1BC8C 2YU3A 3I71A 3WG9A 5HDGA 1SMYF 2VT3A 4A0ZA 1R1UA 2KIUA 4IHTA 2JTVA 3EUHA 3I58A 4I09A 3RPQA 3E6MA 1XSDA 1ZG3A 2A61A 1SD5A 3MCZA 2YPRA 1P4AA 1RUOA 2A5YB 1Z1DA 3LFKA 3ZN1A 2RN7A 2HTSA 1EH7A 1FP2A 2JZYA 3K9TA 5AONA 2VBWA 4CHUA 2DI3A 4EMSA 4ETSA 3KEOA 3DP7A 4L9JA 3S2WA 3MWMA 2CSOA 2V1DA 2EV5A 1KU2A 4AIJA 1YW7A 1R22A 3DV8A 4HQEA 2H6CA 4AIHA 2G9WA 1RI7A 2JT1A 1SD4A 1G4DA 1ONVA 5LHIA 5FD5A 1OYYA 4LK1F 2XAGA 3FXRA 5LRSA 2PEXA 1TW2A 5L3EA 2ISYA 2PFBA 1WKMA 2A69F 2VONA 3ZP5A 4DQ2A 2HZTA 4GYGA 1LQ1A 2FSWA 4ZYHA 4RB1A 1MDMB 1TW3A 1B1BA 3VEPA 1YTYA 2HYGD 1E2XA 4G9YA 1Z91A 3I53A 1FOKA 1Q1HA 3CJNA 2HKXA 5DCMB 5DD8A 4G94A 3KP2A 1BIBA 4LLGF 1O7LA 2CO5A 4O3MA 2F5CA 4EM0B 1TQIA 2LF8A 2RNJA 5JI6A 3K2ZA 4N9IA 2W24A 2EA4A 3FMRA 3IKTA 3V8JA 1I1GA 3JAMK 3DF8A 2FOKA 2PLYA 3FF5A 5D6EA 5LEJA 3FWEA 1E17A 4Y13A 4GGGA 1IRFA 3MAJA 3ZN0A 3E6DA 4Q4ZF 2HQRA 3FM5A 5KK1A 1TLHB 5E18F 4I0AA 4KNYA 3EDPA 1BI1A 4LD5A 4PZJA 1DPRA 3TDZC 4QWQA 2VN2A 3OV8A 1KGSA 3MZYA 2PJPA 1NHAA 1C0WA 3H3UA 2QZ8A 3E5XA 4UNOA 4MEYF 1U5TA 4HDVA 1I6XA 2TDXA 4LG0B 1ZG5A 2OA4A 4A0YA 1FNNA 2P5KA 4UXNA 1ON2A 3TKYA 2VXZA 4OMYA 2IA1A 4RB3C 2O8XA 4Q5SF 4R79A 1WRJA 5F1RA 1K79A 1HW2A 2PG4A 4IHSA 2HR3A 1JE8A 2M45A 2A3SA 1K7AA 3U9GA 1XMAA 1IRGA 3H3ZA 1FYLA 2WTEA 1DP7P 5LGUA 3RDIA 3E6CC 5ERIA 3BJOA 4EJVA 4ZZDA 3LA2A 3F6VA 3ABUA 2CW0F 3L00A 4GYIA 1HW1A 4I98B 2XASA 2DW4A 3IWFA 1IN8A 3SZTA 2AXLA 1DPUA 4N9HA 3SQNA 4A0XA 2Y0MA 5D8KB 2RGVA 5J6XA 1A04A 5DCMA 4UV9A 3O3KA 3DKWA 3JTHA 3JSPA 3GXOA 2L3DA 4WF2A 1G3SA 3IL2A 4U88A 3BDDA 2OBPA 1LNWA 3MQ0A 3F3XA 3KFWX 3WTUC 1KA8A 4KDPA 5HLHA 3WTXC 4PDKA 4A5MA 3BJAA 2LF7A 2ZO4A 2QVOA 2EV6A 3V8KA 2O3FA 2L01A 3BOQA 3HSFA 3JAMZ 2HTJA 3ZMDA 5DYMA 2FU4A 3EQLF 3EYYA 1Z9CA 2LDUA 1ZRFA 1BJAA 4LFUA 4MTEA 3W6JB 3L2CA 5DUKA 4JK1X 1IXCA 1K78B 2ZMEB 2UZKA 1F4KA 3DFGA 2E7WA 5CVJA 2VT2A 1QPMA 1HKTA 3R6SA 1SD6A 5H20A 1ZH5A 1XCBA 4MEXF 2DU9A 2NAZA 4F7ZA 2CFXA 5ICCA 1R1VA 3GFLA 3GW2A 4H0EA 5HOOA 4Q47A 2EB7A 3GF2A 1LDDA 2GXGA 5FFZA 1EH8A 3VB2A 4EM1A 5JR3A 2FBHA 2OZUA 1U6GA 2QUFA 3P9KA 1BI0A 2DFIA 2KKOA 4OIPF 4IPAA 2DPDA 4LMYA 1DUXC 2ESHA 4ZYGA 5K5OA 5JVTA 2P6SA 1HSTA 1USSA 4S04A 3HOSA 1G3TA 5DEQA 4FT8A 4LK0F 4MQVA 4EJTA 1YIOA 1J9IA 1I5ZA 2H09A 4RGUA 1OMIA 2JPCA 1J7KA 1R36A 1HKQA 2V1XA 1GXPA 1YLFA 2WC2A 3QPTA 5HS7A 2EK5A 2L54A 3HRTA 2O0YA 3EETA 3KETA 1O7FA 4ESBA 1HSJA 3CUQA 4ENKA 4AD9A 3TOAA 4HDUA 4KIFA 3WTWC 4WCGA 1ZAOA 5E8GA 4Y15A 1G6NA 3TDUC 2IRFG 3ULQB 2EJRA 5F6FA 3L9FA 4M74A 5AIPA 1XDUA 3P9IA 3QPHA 1XN7A 3WE3A 2XVCA 3JTGA 1MGTA 5FB2A 3ISPA 5J8CA 2FQ3A 1O3SA 3RI4A 4GO1A 5DDGA 1YQAA 4BYYA 2HOEA 3LA3A 2JSCA 3HRUA 3C18A 3M8EA 1ZRDA 4KUMA 5D5WB 3KP7A 3QU3A 2XAQA 2DT5A 1U5TC 1KQ9A 3OOPA 4HV6A 1W7PB 1YO5C 1T6SA 2OAZA 3F21A 2FBIA 3RPUA 1I27A 2HWVA 2NRAC 2EFOA 4EVIA 2D2WA 3F22A 2BEOA 1IXRC 2G7HA 4CICA 2LSOA 1DDNA 1FPQA 3GO5A 1U5TB 5ICFA 1J75A 3RJPA 2LKPA 5BS6A 3WTVC 4ENJA 4HX4A 3JW4A 4JQFA 4OIRF 2PQ8A 4NB5A 3NRVA 1BOAA 1GXQA 4ZH4F 2K02A 3I59A 5JHUA 2Z3YA 3KLOA 4G7ZF 1T39A 3GVAA 3RIRA 1J5YA 3J7AO 1EV7A 3PFIA 2ISZA 1UB9A 2YX4A 5L3CA 2RDPA 3NEUA 3VOEA 3ZPLA 4WXCA 4L5IA 1R00A 2QQ9A 3ZMSA 1ZHFA 3KZYA 3L09A 1HW5A 2UXNA 3LA7A 3D0SA 4GXOA 2ZNZA 4HOBA 3FMSA 1H9GA 3CTAA 5L3FA 1U3EM 4BNCA 2IW5A 1XGMA 1MZBA 4ZZLA 4M6XA 4ESJA 3Q5FA 1EH6A 2P7CB 1S7OA 2VC0A 1BN5A 2Q8KA 4N0BA 2JRTA 1SAXA 3BZ6A 4WWCA 3KE2A 5FLXZ 2YX7A 3C7JA 5KVRA 3V7CA 4ON0A 3BPVA 3FXUA 1S6LA 1YYVA 4R8HA 2BV6A 2ESNA 2QENA 1ULYA 2XAFA 3HIFA 1TNTA 4P96A 2DK8A 3CO6C 2P8TA 3ML6A 2MA3A 3GEZA 1IF1A 1IAWA 1B9NA 1TTYA 1CGPA 2ZNYA 3FMQA 3WGIA 2OQGA 3E6BA 2FF4A 4EGZA 1RNLA 4L0YB 5D8LB 1W7PA 3REOA 2CG4A 5E8IA 4KIBA 4WXHA 1XSVA 3GZ5A 2Q2EA 4L9VA 1WI9A 5LGNA 2WWYA 2A07F 1UCRA 4NHJA 1ZG1A 2GZWA 2OZ6A 1L0OC 4P9UA 5L3GA 5K5QA 3KP6A 1AWCA 4UHTA 2EFQA 4G7OF 3IWZA 2F5EA 1Y0UA 5D4RA 4UVBA 5EEGA 2EA2A 1LB2A 1UFMA 4LJZF 2PN6A 5ILUA 4HLXA 4IRHA 1FY7A 4A2UA 2GIVA 3SZPA 3K1PA 1Z6RA 3J80Z 1SMTA 2A6EF 3LWFA 2STTA 2D1VA 1MD0A 3P7NA 5ILSA 1P4XA 5BQTA 4RB0A 4HA8A 1T0FA 3F8MA 1BI2A 4EV0A 5HLGA 2V9VA 5FGMA 1OYIA 2O61A 3HRSA 2W84A 4XLNF 3RKWA 2P5VA 2OU2A 1TQMA 2J5PA 1BC7C 4U7DA 4U0WA 3T0YA 1FWZA 2PBIA 5FD6A 2M87A 3VODA 4OU0A 2BYVE 2QM3A 2VOOA 1REPC 5K1YA 3DPTA 4RGRA 2CQKA 5ICGA 1U8RA 4CDGA 3WODF 5D5XB 4I02A 1GHCA 2QWWA 3SHFA 1FLIA 4MNUA 5E20A 4WK8F 2E1CA 2H6BA 2L4MA 2IP2A 3LAJA 2PI0A 2FBKA 5BOXA 4RGXA 2GA1A 2DLLA 2W25A 2VOPA 2DBBA 5F64A 3LQQA 4XBFA 4A12A 1YW8A 3ZMUA 4BH9A 3KZZA 2HQNA 2CYYA 3CUQB 1JHHA 5L3BA 3M8FA 1SFUA 2XRNA 4IJAA 1KU9A 2MD5A 4MQ9F 4KYWA 3E97A 4OIQF 1FSEA 1G3YA 3HOTA 3IKVA 3T8RA 3E5QA 1HXDA 2KJCA 2EWNA 5LGTA 1IN6A 3M9AA 1WWXA 1J0RA 1FZPB 2JPBA 1U78A 2MH2A 4D0PA 4IRGA 4GCVA 4HQMA 4I01A 2O6GE 3ERED 1YS6A 4A6EA 1HQCA 2E1NA 4HX7A 2YSRA 1S29A 3P9CA 3N97A 2C6YA 5AIQA 2K4BA 4BHBA 3QRFF 1R7JA 3I54A 4HW0A 2DPUA 1LJ9A 1U2WA 3RYRA 4CGZA 2RQPA 2FNAA 2QBYA 2VODA 1LEAA 2M8EA 2ZXJA 3WTZA 2XAHA 3H92A 3F23A 2H94A 1R23A 3TO6A 3FX3A 1QZZA 2QQBA 4HLYA 2VBYA 1F1ZA 3L7WA 2VBXA 1G3WA 5DD4A 1UHWA 2HEOA 4KA4A 3BPXA 3WU0A 3FHZA 3GLXA 1O3QA 2GWRA 1D8KA 4LGWA 4MGRA 1LVAA 3FZVA 4M9XA 2R7DA 4P5OA 2BBYA 2F2EA 1XB4A 3V8LA 5HS8A 3TOBA 3I59B 4ASNA 3K0LA 1QO0D 2IPQX 4HZFA 2K27A 3COAC 1V4RA 4RAYA 2OQRA 2DQLA 3IRQA 2XKPA 2H27A 3CUOA 5IT9K 4ZYEA 4XRFA 3WTYC 4U7BA 4YIIA 4M9ZA 1ODDA 5ILVA 5ED4A 5FLXK 2XROA 3QAHA 5CVUA 3CLOA 1J2XA 2KRFA 4OMZA 2GQQA 1H0MA 5DV5A 4EQQA 5H6RA 4CZZA 2BGCA 1PUEE 2ZFWA 3ELKA 2HKOA 1F9NA 4U0VA 3QP6A 3BJ6A 5HDNA 3KEQA 3ZMZA 2ETHA 5HLIA 1O57A 4PGHA 4I0BA 3J81K 2WV0A 3BROA 3I4PA 4UUVA 5EEHA 2HYFA 2EFPA 5H6QA 1QNTA 4AVPA 2XKOA 3WU1B 3RKYA 1IN7A 4M72A 4LLNA 5LLQA 5ICEA 1R5GA 1XGSA 4ENNA 1V3FA 2IJLA 2V6CA 3GFJA 4Q48A 2XGXA 3Q9SA 4EJOA 1ZREA 1XSXA 5CYVA 1ZN2A 1R1TA 5E1WA 3MEXA 2MBFA 3J80K 4G6DA 3TQNA 4B8XA 4MHGA 4KN4X 2CWEA 1FYKA 4A5NA 4WXDA 3DQVC 2MC3A 3GZ6A 3KLNA 1KYWA 3HUGA 2MH9A 3G3ZA 2EV0A 4HF2A 5CLSA 4HV5A 1BM9A 3F8FA 1SFEA 2ZCWA 6PAXA 2K4JA 2P4WA 3TO7A 4I7HA 2L02A 3ZQ7A 4S05A 2E7XA 1P92A 4BAYA 1IUYA 4IF4A 3MFKA 3WTSC 5LHGA 4G6QA 4YFXF 3TGNA 1Z6TA 4CYDA
chains in the Genus database with same CATH superfamily
5JFRA 1RC9A 3HSEA 2HDDA 4M71A 2CJJA 2HQ5A 5D4SA 4YFKF 1EKEA 3FHNA 1X2MA 1KZHA 2GLOA 3IAM2 1MJBA 2B0LA 1XMXA 3T5XA 4DJAA 3CC4I 3OWTA 4HX8A 3V7RA 3M7GA 3OIOA 3M3YJ 1JGSA 3OYLA 4BBRJ 3JRIA 1R58A 3J7ZI 1L3LA 4PJLA 5IYDJ 1JKQC 3F8CA 1IV6A 2Y75A 1KYZA 3A2KA 2D1HA 5IOYA 2Z33A 1Z05A 3RZOJ 2V9KA 1ZGAA 4BE0A 1FSHA 5A2QZ 3DPLC 4HF0A 1WJAA 1D8JA 4F3QA 5E1ZB 2DAOA 1F43A 4KT6A 4NC8A 3SJMA 1VTNC 2P6TA 3OR1C 1R71A 3JRDA 1VQKI 1QRYA 3ZQFA 4M3GA 4G8XA 5IT9Z 2Z5UA 2EH3A 2GIZA 2KLOA 3ECHA 3RKXA 3D5SC 1ETXA 2ME6A 3TW6A 3F8NA 5BMZA 3G73A 3DCFA 1QQIA 5LBQA 3L1PA 3CO7C 2DJIA 4NUBA 4TV7A 3HOZJ 2UWMA 2IA0A 2QGUA 2R3SA 3ZQHA 3PQKA 4RAZA 2ZSHB 1ZLJA 2CW7A 5E79C 3WHCA 3IC7A 2KL4A 2CV2A 2EFWA 3K4LA 1FYMA 4RB2C 4AIKA 4QLCU 5EJCA 2K7LA 2DOAA 1J59A 3AL0B 3FISA 3ROUA 1MJ9A 1FBUA 4KT5C 3IRRA 3FM3A 3M8JA 1DU6A 2XSJC 1S7AA 5EGOB 4EJUA 4L0ZB 3S17J 3HPHA 2DTRA 4AYBN 3MVPA 1QA6A 1FMVA 3V7SA 3I4MJ 2WAQN 2HGCA 3PIOF 3GTLJ 1QVUA 4Z6YA 2STWA 2Q0OA 5FKNA 2B7EA 3NARA 4Y33A 3SXYA 4ZYDA 3SFZA 2X6WA 3CMYA 4D1QA 3J81Z 1XGOA 2QLZA 1BIAA 4BJ6C 1YW9A 2EBIA 3AG3H 1RR8C 1YG2A 1B59A 3F72A 1E3HA 3PIPF 2ZBKA 1YX5A 1CF7B 3ERMA 3RTRA 2XB5A 5LD2C 2AXTC 3PQJA 2QSHX 1HF0A 5K7HA 1S5LC 2VBZA 1B72A 1S8NA 1X1CA 1Z3YA 1PP7U 3DTIA 5D5UB 1WQ2A 3ZQIA 4L9TA 4XKCA 2CV1A 3CQZJ 3I5UA 4N4OB 1P4WA 2QYOA 4U0YA 3WE2A 1POGA 1NTCA 1T56A 1IJWC 2FJ1A 3GUDA 2P7VB 2P81A 3ZMTA 4RGSA 3FKIJ 2KZVA 2FMYA 4O5VA 3IHUA 1UHMA 1V55H 3GWZA 2B9SA 5HNHA 2LKXA 1V54H 1LDJA 3QP5A 1F36A 2K9MA 4DW6A 1STZA 1UJ8A 1ON1A 4XRMA 1BR4A 4XSZF 3U1KA 1XD7A 2EINH 2KFDA 4C9YA 5GADJ 4M73A 5BPIA 3AG2H 2NS0A 3CZ6A 4L18B 1ZQ3P 1ZLKA 1G59A 4XLPF 5B1AH 4IXAA 4LB5A 5LHHA 1YFHA 1UG2A 3CP8A 2VQGA 1K6OA 2QBYB 1B6AA 3HKZA 2Y48A 1OR7A 5CVRA 1OJLA 3I56I 4Y7NJ 2W7NA 3C3WA 2D45A 2ZXWH 5EG0A 2KIFA 3JREA 4E7JA 3I4NJ 1B4AA 5TJJA 3C2HA 2CV0A 3HDDA 2EIJH 3U1DA 1IW7F 1WSUA 1WGXA 2FMLA 2LBFA 3U2RA 2ADUA 5BPDA 2V79A 3LQRA 1TNSA 4L9NA 3X2QH 4DZPA 5D5VB 1JHFA 3KX2A 3BR1A 3L2RA 1O3RA 3N4MA 3TL4X 2GXBA 1W4MA 1SC7A 4RS8A 1W5TA 3W3CA 4NNJA 4HSRA 1A31A 4FX0A 2VB6A 1RESA 2UUZA 3BQZA 1H9TA 2MGQA 4MTDA 2AS5F 3R0AA 5HLTA 1TWHJ 5LEKA 3FKJA 2OD5A 2LG4A 3HHGA 1JKPC 4YFNF 2P0WA 2XGCA 2GOMA 2DO7A 1ETOA 1MBJA 1IN5A 3R0JA 3CCSI 2JUCA 1FBQA 4BDYA 4HF1A 3GTGJ 4FX4A 4O6JA 5DM6F 1R5HA 3CUQC 4E7IA 1W0TA 1USTA 2HFHA 1B8IB 3D5LA 4P9FA 1KQ0A 2XV4S 1YI2I 5DUIA 2W00A 3CD6I 4KFCA 4BHPA 2W57A 2WY8Q 1R9TJ 3CDIA 1GVJA 2F5FA 3CESA 2K86A 1RIOH 3O6BB 5DCFA 3EYIA 1XMKA 1P2FA 4FISA 3ZMVA 3LSGA 4AWXB 1DU0A 2E2IJ 2CMPA 2Y2ZA 4P55A 3MKWB 5M5YJ 4A3LJ 2KJBA 2XIGA 1PDNC 2M0MA 3LSIA 1LUJB 4F91B 2M9HA 1MDMA 2Z9OA 3BZCA 1FTTA 1XGNA 3HPGA 1LEBA 2KRHA 3S3OA 4BQNA 2DTZA 3IAS2 2FNPA 4L5JA 4ESFA 3BTIA 5H2FC 1WJBA 3BR0A 2RQQA 3MZHA 4C2UA 2G7UA 3KCCA 4E6KG 5EGOA 4BS9A 3JSOA 3K69A 1IZ1A 2IBDA 3NQOA 1OPCA 1VFCA 2XAJA 1BBYA 2IGOA 3T1BA 2ECCA 4XSXF 3CCMI 4EJWA 3F6OA 2FEZA 1OCTC 2I5UA 2NVYJ 5K7ZA 2YR2A 1YS7A 3DEUA 4NDLA 5HDKA 3B02A 3KZIC 1KU3A 4NQWB 5LRRA 2WB1N 1FX7A 2IVMA 3I0TA 3RYPA 2XB0X 1CF7A 1WH7A 4PJJA 3HRMA 4HAMA 2HXIA 1TBXA 1V5FA 3BP8A 1YIJI 2FA5A 4MO7A 4D5CA 1IXSB 1QGPA 3Q9VA 1B9MA 4X6AJ 2AQFA 1X58A 1H88C 2JMWA 4KMUX 1SD7A 1MNDA 4B48A 5F0CA 3PNYA 3S1RJ 2Z2SB 1P6RA 3RCOA 3FBIB 1OCPA 3ZQGA 2HU9A 4CH7A 4BUPA 2O8KA 2F5DA 3KEYA 2J5OA 3ZR8X 3GX4X 3HBLA 2E36A 1MBFA 1MBGA 2KPMA 1X1BA 2PX9A 3FXJA 2MW8A 1HOMA 3ZGKA 1UZCA 2WV1A 3H5AA 1X4PA 2M5WA 3OYBA 2YU9J 2VJIA 2R4GA 4MFDA 1ZGJA 2ZJRF 4EGYA 5IP9J 2BY2A 4UV8A 4BXUA 2LY1A 1LPQA 3GFMA 2ZJ2A 2JVGA 2E2HJ 4D7MA 2LLKA 2R7OA 3K6GA 4BGDA 3DLLF 2P5LC 2IA2A 4LG0A 1X3UA 2M30A 1VNDA 4A6DA 4OINF 2KISA 4CYCB 2XPUA 3JRBA 3LNQA 1U0JA 3PL8A 1ETYA 2R5YB 2ECBA 3HG9A 3L2WA 4B1RA 3B73A 5CJ9A 3ZXSA 5B3SH 1KQ8A 3FXQA 3BG6A 5J3LA 4UVCA 1ORKA 3HTSB 5GAHJ 1RZ4A 4UUSA 1FBSA 4Y17A 3AAFA 4FHTA 1RKTA 1ZARA 1FP1D 5K5RA 4OIOF 2QEXI 1SAUA 2ACJA 2A68F 1PP8F 2FE3A 2CQXA 2CGPA 2OC6A 1VF9A 1X1AA 1W0UA 4R1HA 4AVZA 1YX3A 4PJMA 1GV5A 4S0HB 1IG7A 2RV8A 2CUJA 3QU6A 2XC7A 1T98A 2RVCA 4F52A 2IXSA 3CDHA 2BVLA 4FETA 4I2OA 1AOYA 1D0XA 3CCRI 2RKHA 1AA7A 3E3VA 5TISC 5E1XA 4IVNA 3R4KA 5GPAA 1D3YA 2EFNA 4IHXA 1MMSA 3HSRA 3SDBA 5CVIA 1HBXG 2FRHA 2FQ4A 2WAEA 4KIGA 3GFIA 2XUBA 3LL7A 4CXFA 2H1KA 1M1EB 3WGGA 4BEHB 1MKMA 1WJCA 3DBLB 5A2QK 3OYEA 2ELHA 1A35A 3IH4A 2E60A 5F1JA 4LB6B 1VQOI 3J7AY 4XOPA 2HS5A 1W7PD 5L3DA 1NK2P 3H9JA 2VPRA 3ECOA 3I64A 4BQAA 3HYIA 2VC1A 3ABTA 4CO8A 1FC3A 4C2TA 3WG7H 1XDSA 3KP4A 2O03A 2IT0A 5E3OA 4PCQA 3V4GA 3SZGA 1VZ0A 1Q1VA 2EZIA 4FCYA 2K9NA 1LDKB 2BE5F 3QOPA 5K7FA 1I1SA 4M6YA 3DXJF 4BHCA 2X0LA 5EZHA 2TRTA 4ENMA 1FOWA 5IP7J 4CCNA 1F5TA 4HG2A 2DK5A 2NNNA 4A69C 3HTUA 2XGDA 4RA2A 4WX9A 1O3TA 3KP3A 4EATA 1QZYA 2R7FA 1QBJA 5IT3A 4XLAA 3T8TA 1W5SA 2GA2A 3M1EA 3RKQA 4BQOA 1WJEA 2K3PA 3BWGA 3MZ8A 1LFUP 1T8IA 4J00A 3ESWB 4KN7X 1FT9A 2GAUA 2KIMA 2RREA 5HVQC 1D5VA 3TO9A 2PMUA 2LRDA 2DA5A 2ZXHA 3K1MA 3E5UA 4DNCA 3HOUJ 2ZKZA 3R60A 1S3JA 4NQWA 4C3JJ 4K2EA 2Y9YA 2XPVA 1BI3A 2NNYA 2X9DA 2OUMA 4II2A 3CCQI 2W4SA 5J8FA 2DA6A 3WTTC 1T95A 3RSNA 4YG2F 1ZRCA 2G0EA 4HBLA 4G12A 1OYWA 4B3XA 3DTKA 4C2MJ 3K1NA 1T38A 4GFBA 2PMHA 1ZGWA 2E1MC 2A6HF 4LLLA 2EZKA 1SFXA 4IRIA 2V1UA 1X3WB 3ABMH 3LMMA 3LAPA 1ZYRF 1BW6A 4IOCF 1HKSA 2VIXA 4KMFA 4G7HF 1D5YA 3PO2J 1UMQA 3C2GA 4OOIA 4J19A 5DM7F 2MLKA 3KPHA 1KU7A 2KIQA 3CF5F 1JXSA 5D6FA 2BXYA 4UVAA 3F8BA 4XIDA 1XCVA 2RC4A 4ABZA 4M9SA 2EILH 2DFEA 3H35A 2EZHA 2FXAA 3W6KB 3CC7I 3QYEA 2R7UA 4II3A 2Z99A 4M3DA 1PUFB 1CQTA 4HYEA 4KICA 4XR6A 1K78A 3HHHA 3LSTA 3O8HA 4B43A 2ZMEA 3S1QJ 3OL4A 1Z7UA 3BY6A 3GYHX 2COMA 4Z2YA 4EM2A 2W85A 3DKYA 4FE4A 4CYCA 2LK2A 1ACIA 2IGNA 1RUNA 5FO5A 5E17F 1B72B 3K70C 4JBAA 1W36C 1QPIA 3O2PE 1T0FC 2K9LA 5FFXA 4YIFA 4W1UA 3GMEA 2ID3A 5GPCA 5TRDA 2M1BA 3HJEA 3JR9A 2VE9A 1U8BA 1MSFC 4E70A 3D5RC 2NYXA 1T2KA 2DT6A 2LNBA 3VFZA 3DBHB 4RAFA 2MLGA 3R61A 2QQAA 3OYHA 1PVEA 2L4AA 2UXXA 2VE8A 5HS9A 4B09A 2HDCA 4PGGA 1FMWA 1U9NA 3IUOA 3WGHA 1IN4A 2BZTA 3C1DA 4BE2A 2DQRA 2Q1ZB 1XC5A 3KP5A 1OKRA 2ZXIA 1TQPA 3ONQA 2NVUB 2XHKA 4CCOA 1MJAA 2X4HA 3CJRB 5CVVA 1BC8C 2DA7A 1EA3A 1T33A 2YU3A 2L0KA 3I71A 3WG9A 5J1UA 1S72I 2QCOA 5HDGA 1SMYF 4IO9F 2XAUA 4QSHA 2K9SA 2ZFUA 2VT3A 4D7NA 4XORA 4A0ZA 1R1UA 2KIUA 2LTPA 1OISA 4IHTA 2JTVA 3EUHA 2KRCA 1K61A 1ETQA 3I58A 4CUGA 4I09A 3RPQA 4IHWA 3E6MA 1XSDA 1ZG3A 3L2VA 3ABKH 4DYCA 2JA8J 2A61A 1SD5A 4DBQA 3H3VK 3HOXJ 3MCZA 2YPRA 1P4AA 1RUOA 2A5YB 3GTQJ 1Z1DA 3LFKA 9ANTA 3HOYJ 3ZN1A 2RN7A 2HTSA 3BZKA 3I3LA 1EH7A 4AM3A 1FP2A 3FIWA 2JZYA 3K9TA 5AONA 2VI6A 4ZDPA 2VBWA 4CHUA 1GV2A 3CF2A 2DI3A 1VQ7I 4A3IJ 5E3LA 2VJ4A 4EMSA 5J4YA 4ETSA 1Y8RB 3CCJI 3KEOA 5GAEJ 3DP7A 1QHHD 4L9JA 3MWMA 3S2WA 5C3EJ 3OYJA 2CSOA 1R49A 3A1YA 2V1DA 4BQQA 3OYMA 3AL0C 2RAEA 2M7BA 2EV5A 2Y0SA 2FUG2 1KU2A 3E0JB 3D1NI 4AIJA 1YW7A 5FROA 1R22A 3DV8A 1AHDP 4HQEA 2H6CA 1VQ5I 4AIHA 2G9WA 2LR8A 5J47A 1RI7A 4A3DJ 2JT1A 1SD4A 4IQJA 1G4DA 1ONVA 5LHIA 3BG5A 5FD5A 1OYYA 4LK1F 3VYRB 5C4XJ 2R7RA 4BDZA 2XAGA 3LSPA 4E7HA 2JK3A 3MKZA 4HEA2 3FXRA 1JUMA 1OFCX 4XK4A 3P5JA 5LRSA 1W5CC 2PEXA 4XN0A 1TW2A 5L3EA 2ISYA 2PFBA 4UUTA 1TWGJ 1WKMA 2A69F 2N8GA 2VONA 1A6IA 4DQ2A 3ZP5A 1JJ6C 2HZTA 2BY1A 2L9VA 2V4JC 4GYGA 4CCMA 2FSWA 3RQIA 1LQ1A 4ZYHA 4RB1A 2BY3A 4M3FA 1MDMB 2L9NA 2Y9ZA 1TW3A 1B1BA 1LVKA 2DDBA 1N75A 3KYLA 3VEPA 3ZRGA 2QSFX 1FOXA 1YTYA 2HYGD 4AUXA 1E2XA 4G9YA 4ZDOA 1Z91A 3I53A 2R0QC 1FOKA 1HDDC 4CCJA 1MMDA 1BA5A 1Q1HA 2BW3B 3BR2A 3CJNA 5DTDA 2HKXA 5DCMB 2QF7A 4AC0A 5DD8A 4ANJA 2E34A 4G94A 2IEKA 3KP2A 1BIBA 4LLGF 1O7LA 2CO5A 1TT0A 1MMAA 1IDYA 2F5CA 4LOCA 4O3MA 4EM0B 2LP0A 3GTJJ 1TQIA 2LF8A 2RNJA 2VQHA 3QYBA 2IS6A 1V5GA 5JI6A 1EF4A 3K2ZA 4N9IA 2W24A 1WVRA 2LC2A 2EA4A 1YJ9I 3MKLA 3FMRA 3IKTA 1PUFA 3BT9A 3V8JA 1I1GA 3JAMK 5EEAA 3DF8A 2FOKA 2BVMA 3QOEA 2PLYA 2Y30A 2TCTA 3FF5A 5B5EC 2DA4A 2KQRA 3OSFA 2IS1A 5D6EA 3CDLA 1A6QA 5LEJA 2L9SA 3FWEA 1E17A 1JT0A 4Y13A 4GGGA 1IRFA 3MAJA 1QU3A 3ZN0A 3E6DA 1LE8B 4Q4ZF 3W6VA 1K4SA 3QPLA 4XQFA 2HQRA 2WAFA 3FM5A 5FRMA 3UNGC 4RMNA 5JLXA 5KK1A 1TLHB 1YRNB 2NOGA 5E18F 1D0YA 4I0AA 3VDXA 1Z67A 2XF6A 2JA6J 4KNYA 3EDPA 4F55A 1BI1A 4LD5A 4PZJA 1DPRA 5KHDA 2ELKA 3TDZC 3NAUA 4QWQA 2VN2A 1YE9A 1KGSA 3MZYA 3OV8A 1HLVA 2PJPA 4YIRX 1NHAA 4XKWA 1C0WA 3H3UA 2QZ8A 3E5XA 3EUAA 3S2DJ 4UNOA 4MEYF 1U5TA 3CP2A 4HDVA 1I6XA 2TDXA 1MMGA 4LG0B 1ZG5A 2OA4A 3M07A 3DBRB 2VJJA 4A0YA 2R5ZA 3JRCA 5FKKA 4Y52J 2DN0A 1FNNA 2JVHA 2P5KA 4UXNA 1ON2A 2F5VA 3TKYA 2BOLA 2GBYA 5BNGA 2VXZA 4OMYA 2IA1A 4RB3C 3G1MA 4UUSB 3JCUC 5CKTA 2O8XA 4Q5SF 4R79A 4JOMA 1WRJA 3IV5A 2E5ZA 3OYAA 4CZCA 5F1RA 1K79A 1W1WE 1HW2A 5CQGA 2PG4A 2M8GX 3K7AJ 2L9RA 5TGTA 4PK4A 4IHSA 2HR3A 1JE8A 3OYDA 2M45A 2A3SA 1K7AA 3U9GA 1XMAA 2A5WA 1NG7A 1IRGA 3H3ZA 3W2WA 1FYLA 2B63J 1G8XA 2WTEA 1DP7P 4XM3A 5LGUA 2VQCA 2R7TA 2YS9A 4PJ0C 3RDIA 2X6XA 3E6CC 1MBHA 5ERIA 1MH3A 3BJOA 3FXMA 1X19A 4N4NB 4EJVA 4ZZDA 2IAIA 3FK6A 3HXLA 4M6VA 3LA2A 3F6VA 2I8DA 4IHVA 3K4JA 3ABUA 3V42A 4C3IJ 2CW0F 3CJQB 4BKXA 4JP0A 3DPUA 3L00A 4GYIA 1HW1A 2MFZA 4H4KC 4I98B 2XASA 3PSIA 5JVGF 2DW4A 3IWFA 3MD2A 1BR2A 1IN8A 1R4NB 4D5FA 3SZTA 1A5JA 3B6AA 1WHUA 2AXLA 4IEJA 1DPUA 4N9HA 1MIJA 4X1EA 1VQ9I 1Z3XA 3SQNA 3RPUD 4A0XA 4XRSA 2F4OB 2Y0MA 3FXOA 1MBKA 5D8KB 2RGVA 4MIMA 2X85A 5E3MA 5J6XA 4IKFA 4I99C 3MKYB 2BW3A 1A04A 5DCMA 4UV9A 3O3KA 3DKWA 3S15J 2WADA 3JTHA 2NXNB 1NK3P 2L7KA 3JSPA 1I50J 3GXOA 2PMZN 2L3DA 2UV1A 2JWTA 4WF2A 2Z16A 2QKLB 1G3SA 3IL2A 2MSYA 4U88A 2HOAA 3BDDA 2OBPA 3OYGA 1LNWA 3BTJA 1ENHA 3MQ0A 1VQ4I 3F3XA 3AG4H 3KFWX 3WTUC 1KA8A 3DEEA 3PNVA 1Y56A 2ZMEC 5EDNA 4KDPA 5LFAA 5HLHA 3CCEI 4OAZA 4UY8I 1VQ6I 2E35A 1DP3A 2NVTJ 3WTXC 4PDKA 2H8WA 3Q0WA 2W1OA 4A5MA 3BJAA 2LF7A 2ZO4A 2CS3A 3CMEI 1LE8A 2QVOA 2EV6A 2VKVA 2MC4A 4A3BJ 1UELB 3M1CA 3V8KA 2MYSA 2O3FA 3TEDA 2L01A 2DYSH 3BOQA 1SFOJ 3HSFA 2IGKA 1YRNA 1H8AC 2XRLA 1LFBA 1Y6IA 2AHQA 3JAMZ 2HTJA 4M3EA 3ZMDA 5DYMA 3TMOA 2FU4A 3EQLF 3VYTB 2HPIA 3EYYA 1Z9CA 1WPKA 2LDUA 1BJAA 4HNUA 1DQUA 1ZRFA 2X48A 5J40A 4LFUA 2HNHA 4AYBA 4MTEA 3H9QA 2DYRH 3W6JB 5CPRB 1XS9A 3L2CA 5DUKA 1N25A 1K6YA 2HXOA 4JK1X 4V2GA 3CMAI 3H5NA 1IXCA 3S2HJ 2EIKH 4IZZA 1K78B 2ZMEB 2UZKA 5GTHC 1F4KA 1RR7A 3DFGA 2E7WA 5CVJA 2VT2A 3QYFA 2XDVA 3NWTA 1QPMA 2DA2A 3ZCOA 4FASD 2KZGA 3R6SA 1HKTA 1SD6A 3GTKJ 5H20A 4BU2A 1ZH5A 3A4CA 1XCBA 4UB6C 4RM3A 4QPQA 2DU9A 2NOJB 4MEXF 2GOXB 1SANA 1IRXA 2NAZA 3EUHC 4F7ZA 2CFXA 1D0ZA 3JRAA 5ICCA 1R1VA 3GFLA 3GW2A 4H0EA 5HOOA 1NH3A 2ME0A 4Q47A 2EB7A 4EEFG 5KAFC 2F6CA 3GF2A 2KDZA 2VUMJ 1LDDA 2GXGA 5FFZA 5EZGA 1EH8A 3VB2A 4EM1A 2ICWG 1RKWA 5JR3A 2FBHA 2L7ZA 2VL8A 1MH4A 3CCUI 2OZUA 4IQ4A 1U6GA 2H8RA 3KYCB 1OCZH 2QUFA 3K2AA 3OR2C 3IH3A 2LH9A 3P9KA 1Y39A 4V19K 1LKXA 4DYRA 1JI8A 4E7KA 1BI0A 2DFIA 1I6HJ 4BY1J 2KKOA 4UB8C 4OIPF 2R92J 4IPAA 2HQAA 5IY5H 3K10A 1HC8A 2DPDA 4LMYA 1DUXC 2ESHA 3G4SI 5KNLA 4ZYGA 5K5OA 2V9PA 4B47A 2BXZA 3FXLA 5JVTA 2P6SA 2LMDA 3OY9A 1HSTA 1SVLA 4Y4RA 4XLCA 2OTLI 3UKGA 5KCMA 1ERDA 1USSA 4S04A 3HOSA 1ZK8A 1G3TA 3QPSA 5DEQA 4FT8A 4RLQA 4XOTA 4LK0F 1WJDA 4CCKA 3SFIA 4MQVA 4EJTA 2LY2A 1FJLA 1YIOA 1J9IA 1I5ZA 3DWLE 3OYFA 1ZR2A 2CUEA 2H09A 4RGUA 5IYCJ 1OMIA 2JPCA 3Q3SA 1J7KA 2JA5J 2D5VA 3PFYA 3OSGA 1R36A 1UHSA 1HKQA 3PJRA 2V1XA 4E7ZA 2VKHA 1YLFA 1GXPA 5HNFA 4ZTJA 2EQRA 2WC2A 3K4NA 3QPTA 5HS7A 2ZJPF 3PNTA 2EK5A 2F48A 2L54A 2XF7A 3HRTA 1BW5A 3AG1H 2DOFA 2O0YA 1TT5B 3GBGA 2NS7A 4J01A 3A0HC 3EETA 3KETA 3BLYA 1OCCH 5C44J 1O7FA 1JKOC 3H36A 4ESBA 1HSJA 3CUQA 4W97A 4ENKA 4BBSJ 4AD9A 1I3QJ 1JTYA 4F93B 3H0GJ 3TOAA 3S1NJ 4HDUA 4KIFA 3WTWC 4WCGA 3ABLH 1ZAOA 5E8GA 4IOAF 3K70D 4Y15A 2KT0A 3WHBA 1G6NA 4LITA 1W36D 3TDUC 2IRFG 3ULQB 2EJRA 3S14J 4A93J 5F6FA 1Z7LA 3N05A 4A3JJ 3ZQCA 2W48A 4U87A 3F0CA 3L9FA 4M74A 5AIPA 1XDUA 2WY7Q 3P9IA 3QPHA 4CA0A 2QA4I 1PYVA 3LSHA 3JRHA 2HVQA 1XN7A 4BXXJ 4JX5A 3WE3A 2XVCA 3JTGA 3CCYA 1MGTA 1X4OA 2ZSIB 5FB2A 2OCEA 3ISPA 5J8CA 3CC2I 2FQ3A 3QWLA 1O3SA 1AKHA 2LOOA 4LIVA 3AFHA 4GO1A 3RI4A 2E1OA 1WJFA 5DDGA 2DDAA 1YQAA 1MW7A 4BYYA 2ELJA 2HOEA 2LVSA 2JSCA 3LA3A 4QTRA 3ZQQA 3HRUA 3C18A 3M8EA 3BCBA 1ZRDA 2PJRA 3GZNB 4KUMA 5D5WB 3KP7A 1U9OA 2WB1A 3DU5A 3QU3A 3W2AA 2XAQA 1U5TC 2DT5A 1KQ9A 3OOPA 5F0FA 2R7WA 4I6ZA 4HRIA 4HV6A 1W7PB 1YO5C 1T6SA 1OR7C 2OAZA 3F21A 3W2VA 3HKZN 3TP0A 4PFOA 3RQ4A 2FBIA 1TC3C 3J7YJ 3LSKA 3RPUA 4P1WA 4HNTA 1I27A 3A02A 5IPAA 2DA3A 3MN2A 2HWVA 2X1CA 1Y8QB 2DJNA 1E3PA 2NRAC 4E7SA 2EFOA 4EVIA 2D2WA 2KDOA 3F22A 3BG9A 2BEOA 3VPRA 4NC6A 2L5QA 2ZB9A 1IXRC 4IL6C 4JX4A 3EUKL 1O4XA 4PSWA 3H0DA 2G7HA 4CICA 3L2UA 2K85A 2LSOA 1DDNA 1X3ZB 1FPQA 2JN6A 3GO5A 1WJ5A 3GTPJ 1G2HA 1U5TB 5ICFA 1J75A 2DMQA 2M0CA 2OTJI 3RJPA 2LKPA 5BS6A 3WTVC 4ENJA 4HX4A 2HPMA 2BY0A 3JW4A 2R5ZB 1Y1VJ 3BG7A 4JQFA 2W82A 4OIRF 4A3GJ 2PQ8A 4NB5A 4L5EA 1N78A 3NRVA 3OYKA 1BOAA 4D9JA 4BL0B 1X1DA 1GXQA 4ZH4F 1XX5A 3ZQLA 1D1AA 2K02A 3I59A 4BJ5C 5JHUA 4PFPA 1BOBA 2Z3YA 2CRGA 3KLOA 4G7ZF 1T39A 1FTZA 4OWRB 3GVAA 4XLHA 3RIRA 3OIQA 1J5YA 3J7AO 1XTAA 2DFFA 3A0BC 3DKXA 2XGEA 1EV7A 3PFIA 2ISZA 1TWAJ 3HM5A 4G6TB 1UB9A 3HGYA 3FK7A 1TZLA 4XMYA 5F0HA 2YX4A 1QVTA 1ETKA 5L3CA 2HVSA 2RDPA 3NEUA 4Y3OA 1SFKA 4KJZA 3VOEA 4YRVA 2DOEA 3ZPLA 3OMYA 4WXCA 4L5IA 1R00A 2QQ9A 3ZMSA 5FLVA 1ETWA 1ZHFA 1GT0C 1VI0A 3KZYA 3L09A 4FQGA 4JX6A 2ZJQF 2DMTA 2BHZA 1HW5A 2XF5A 2DA1A 2UXNA 4E4HA 3LA7A 4V2FA 3D0SA 1IC8A 4GXOA 5KAIC 2ZNZA 4HOBA 3FMSA 1H9GA 2R7ZJ 3CTAA 5L3FA 1HCRA 1U3EM 4BNCA 2IW5A 1XGMA 1MZBA 3IP4B 2AO9A 2K40A 1DGWY 4ZZLA 3SDGA 3JRFA 1JUPA 2IS4A 4M6XA 4ESJA 3Q5FA 5HODA 4XRSG 1EH6A 1V5EA 3QQAA 2P7CB 1S7OA 1VQPI 2JRMA 1R6RA 1GDTA 2VC0A 1BN5A 2Q8KA 3JRGA 4N0BA 2FX0A 3GTMJ 2JRTA 1SAXA 4MLOA 1EJ9A 4QPOA 3BZ6A 4WWCA 5B66C 3KE2A 1MNMC 2CU7A 5FLXZ 1I3AA 2YX7A 3C7JA 5KVRA 3PUBA 3V7CA 2OPTA 3VYUB 4QIWN 1T08B 4ON0A 3BPVA 3FXUA 1S6LA 1S9HA 1YYVA 4R8HA 2BV6A 3DU6A 3H5RA 3PSFA 2ESNA 2CQQA 2QENA 5IYBJ 1ULYA 2XAFA 3HIFA 1TNTA 4P96A 2DK8A 2NVQJ 3BR6A 2VLAA 3CO6C 2P8TA 3ML6A 4XKBA 3OS0A 2MA3A 2XPWA 1JJ8C 3GEZA 1IF1A 1IAWA 1B9NA 1TTYA 2JSPA 1CGPA 2ZNYA 3FMQA 3WGIA 2HOSA 2VPLA 2OQGA 3E6BA 4I76A 1JT6A 2FF4A 4EGZA 4ZTFA 1RNLA 2L7MP 4L0YB 5D8LB 1W7PA 3M4OJ 3REOA 2CQNA 2CG4A 5E8IA 2HZDA 3S16J 3BQYA 4BXFA 4KIBA 3LOCA 3FXKA 1OCOH 1OLTA 4WXHA 3OYCA 1XSVA 3GZ5A 4ZC3A 1KONA 4NBQA 2Q2EA 2IGMA 2X1DA 4L9VA 1WI9A 5LGNA 2K3FA 1TP4A 3A01A 2WWYA 2A07F 2DFHA 1UCRA 2JUGA 3Q0UA 4NHJA 4ZJZA 1UAAA 4AU7A 2VKDA 4RAGA 1ZG1A 3O8GA 4XN3A 3BC8A 3NWSA 2GZWA 2OZ6A 1L0OC 1JTXA 4P9UA 5L3GA 5K5QA 1Y0NA 1MSEC 3KP6A 5EYRA 4UHTA 1AWCA 3A03A 2HI3A 3SYTA 2EFQA 2VASA 3IWZA 4G7OF 1HDPA 2F5EA 3ASNH 1Y0UA 4RDUA 5D4RA 1PJRA 4UVBA 2E71A 5EEGA 5FKMA 3BR5A 3FBNB 1JUSA 2EA2A 1LB2A 1UFMA 4LJZF 2PN6A 5ILUA 4HLXA 1ZR4A 4IRHA 1FY7A 4A2UA 2GIVA 2DMNA 3SZPA 3K1PA 1Z6RA 3G71I 3J80Z 1SMTA 2A6EF 3LWFA 2STTA 2D1VA 4B4CA 3GLLA 1HA8A 1MD0A 3P7NA 5J4VA 5ILSA 3TBIA 3B6CA 4XLEA 2I10A 3ASOH 1P4XA 3DLAA 2A05A 5BQTA 1GUUA 2DXIA 4RB0A 4HA8A 2XSDC 1T0FA 1VQLI 3F9KA 2R93J 2M7AA 2QSGX 3F8MA 1BI2A 3S8PA 4EV0A 5HLGA 2WBMA 2V9VA 5FGMA 4JYKA 1OYIA 2O61A 3LSMA 3HRSA 3OYIA 3S1MJ 2W84A 3LSJA 4F92B 4XLNF 3RKWA 2P5VA 3RZDJ 2QKMB 5FRNA 5JLWA 2OU2A 2OCCH 1TQMA 1D1BA 2E19A 2J5PA 1RETA 4XL9A 4U0WA 3T0YA 3K4CA 4U7DA 1JGGA 1BC7C 1FWZA 2PBIA 5FD6A 2M87A 2CH0A 2COBA 3VODA 4OU0A 2BYVE 2CUFA 3PM1A 2QM3A 4OAYA 2R7QA 2VOOA 2R7VA 2Y31A 1ETVA 1REPC 5K1YA 1S7EA 2H1LA 1TL8A 3DPTA 3IH2A 1I39A 2LFBA 2X6YA 4RGRA 2CUZA 1XG1A 1MMNA 2R7XA 2CQKA 5ICGA 1NG6A 1U8RA 3I55I 3SEZA 4CDGA 3I9V2 3WODF 5D5XB 4I02A 1GHCA 2QWWA 5M5WJ 3SHFA 1FLIA 4MNUA 1GVDA 5M3MJ 5E20A 3OS2A 4WK8F 1H89C 2E1CA 2H6BA 2L4MA 1UG0A 2IP2A 3LAJA 4A3EJ 2PI0A 1IDZA 2FBKA 5BOXA 4RGXA 4ZYAA 3MMYB 3CCLI 5FLMJ 2GA1A 2DLLA 2W25A 2Z1DA 3EPZA 2HDWA 1ZTRA 2VOPA 2DBBA 5F64A 2HOTA 5IP6A 1RRJA 5FJ8J 4IHYA 1WCMJ 3LQQA 4XBFA 1FOYA 3WU2C 1ZELA 4A3FJ 4A12A 1WZ2A 1YW8A 2X51A 5GTIC 2F4IA 5CQEA 3ZMUA 2JQ7A 4BH9A 2KP6A 3KZZA 2HQNA 2CYYA 3VWBA 4ITVA 3CUQB 1JHHA 3HGGA 5L3BA 3M8FA 1QZEA 2JJ7A 1SFUA 1BL0A 2V1NA 2V26A 4PUSA 2OF7A 1FEXA 2XRNA 4IJAA 1KU9A 2MD5A 5M5XJ 4MQ9F 4KYWA 3VSLA 2VQLA 3E97A 2E5NA 1AU7A 2E2JJ 3G2BA 1BR1A 4BACA 1TWFJ 3CCVI 4DYQA 4OIQF 3BG3A 2CQ7A 2MD0A 2GXAA 3OYNA 4FTHA 1FSEA 1FIPA 1G3YA 2LKSA 3E7LA 3DEWA 3ZOBA 3HOTA 3IKVA 3T8RA 2GM4A 3E5QA 1IO2A 1HXDA 2KJCA 2EWNA 1ITYA 5LGTA 1IN6A 1P9QC 1AKHB 3M9AA 3G6EI 3Q0VA 1WWXA 2WAQA 1J0RA 1J09A 1FZPB 5IOZA 2JPBA 4IX7A 3H9GA 1U78A 2MH2A 4DBRA 3H1CA 4D0PA 4IRGA 5DS9A 4GCVA 4HQMA 3S32A 2PJRB 4I01A 2O6GE 3ERED 3U21A 1VQNI 1YS6A 4A6EA 1HQCA 2E1NA 1YJWI 4HX7A 1QHGA 2YSRA 4B44A 1S29A 2RNGA 3P9CA 3TP3A 3N97A 4XICA 1MNEA 2C6YA 2O9LA 5AIQA 2K4BA 4BHBA 3QRFF 1R7JA 3I54A 4HW0A 1Z21A 1LJ9A 1U2WA 4YEJA 3RYRA 2DPUA 4CGZA 3HB9A 2RQPA 2F4MB 4M3BA 2FNAA 4B3AA 3FDYA 2QBYA 2VODA 1LEAA 5F08A 2M8EA 2ZXJA 3WTZA 3CMMA 1YHQI 2XAHA 3H92A 1MBEA 3F23A 1VQMI 1K83J 2H94A 1R23A 1P7IA 3TO6A 3K4KA 4ZDLA 3FX3A 1QZZA 2QQBA 4HLYA 3BR3A 2VBYA 1F1ZA 3L7WA 2VBXA 1G3WA 5DD4A 2YUSA 1UHWA 2HEOA 4KA4A 3UR3C 3BPXA 3WU0A 3FHZA 1P7JA 1YJNI 3GLXA 3CLQA 1O3QA 2GWRA 1D8KA 2LD5A 4PSXA 2LYCA 1OQYA 1APLC 3OS1A 3HUGB 4AIDA 4LGWA 2HVRA 4LG3A 4RBOA 4MGRA 1LVAA 3FZVA 4M9XA 1E0EA 2AQEA 2R7DA 4P5OA 5F27A 2BBYA 2LREA 1N77A 2F2EA 1XB4A 4DOZA 1SEUA 2Y0SN 5FKLA 3V8LA 3HL2A 5HS8A 4CSWA 3TOBA 1IRZA 3I59B 4ASNA 1WFXA 3K0LA 4FE7A 2CFOA 4XLFA 4MFEA 4NC7A 3HOWJ 1QO0D 2IPQX 2EZLA 1B8IA 4HZFA 1R4MB 2K27A 3BTLA 1DGRM 3DTEA 3COAC 1V4RA 3TW7A 4BY7J 4DGWB 4RAYA 2K9QA 2OQRA 5J1RA 1X1PA 2M4KA 2CW8A 2DQLA 2VXDA 3IRQA 3L2QA 2XKPA 2H27A 3AKZA 2X6OA 3CUOA 1FIAA 4DIQA 1YITI 5IT9K 4DZJA 4ZYEA 4XRFA 3WTYC 5EF6A 1E3OC 4HPQA 3CJTB 4U7BA 1ZKGA 4YIIA 5GAGJ 3HC7A 4M9ZA 4GRIA 1XPXA 2VKEA 1ODDA 3KYDB 4HNVA 3HOVJ 2ZC2A 5ILVA 5ED4A 5FLXK 2XROA 3QAHA 5CVUA 5JHFA 3CLOA 1J2XA 3HEFA 2KRFA 4OMZA 5F04A 3LSRA 3QODA 3HZJA 1WH5A 3PUFA 2QQ8A 2IS2A 2EIMH 5FKOA 2JA7J 2GQQA 1H0MA 5DV5A 2MABA 2DT7B 2MG4A 4EQQA 5H6RA 1R5ID 4CZZA 3K4BA 2L2OA 2BGCA 1PUEE 2ZFWA 3ELKA 2HKOA 1F9NA 4X0GA 4A3CJ 4U0VA 3QP6A 2DCEA 3BJ6A 3OL3A 4GDFA 2Y69H 4PJNA 5HDNA 4E7LA 3KEQA 1Y1WJ 3KIOA 3ZMZA 3GTOJ 5GP9A 2ETHA 2OV7A 5HLIA 1O57A 4PGHA 2WA0A 4I0BA 3K4MA 3J81K 2WV0A 2FD5A 1IV8A 3BROA 3I4PA 4CCLA 1X2NA 3SEQA 4UUVA 2FOWA 2M4GA 4KISA 3VSKA 5EEHA 2HYFA 2O5RA 2EFPA 2V6EA 5H6QA 1QNTA 4AVPA 1D1CA 2DMUA 2X1EA 1Z77A 2XKOA 3WU1B 1Z0XA 2PMZA 3LFUA 3RKYA 1IN7A 4M72A 2OJED 1TWCJ 4LLNA 1LFPA 4C30A 3VYSB 5LLQA 5ICEA 2BHYA 1R5GA 3S93A 1XGSA 4ENNA 2R7SA 2A6TA 2DODA 3GCMA 3C2BA 1V3FA 2NS8A 2IJLA 2V6CA 3GFJA 4Q48A 2XGXA 3Q9SA 2KMUA 1RPWA 2V7FA 4EJOA 2JA2A 2DMPA 2O7OA 1ZREA 4XNFA 5M3FJ 4YELA 1XSXA 3BTCA 2Q2EB 3OIPA 2HYJA 5B1BH 5CYVA 1ZN2A 1R1TA 4XKVA 5E1WA 3G1LA 3MEXA 3A01B 2MBFA 3J80K 2R5YA 4G6DA 1BJZA 2E1MB 3BCAA 4A3KJ 2L7FP 4LIUA 4RM2A 3S3NA 3TQNA 4B8XA 3G1OA 4A3MJ 1OCRH 4MHGA 3PO3J 4KN4X 2CWEA 2M3AA 1FYKA 1VQ8I 4BE1A 1WI3A 3S3MA 1JKRC 4A5NA 4WXDA 3DQVC 2MC3A 3GZ6A 3KLNA 2K5CA 1KYWA 3HUGA 1GLNA 4C3HJ 2MH9A 2KHMA 1IUFA 3G3ZA 2EV0A 1IGNA 1SVOA 1SVMA 4HF2A 1A36A 2NVXJ 5CLSA 2M2EA 3OOUA 5J1YA 5E3NA 2EPFA 4HV5A 1BM9A 4HSTA 3F8FA 1SFEA 2ZCWA 6PAXA 2K4JA 2P4WA 3TO7A 4RLFA 2ID6A 4I7HA 2L02A 4KITB 3ZQ7A 4S05A 1K4TA 2E7XA 1P92A 4BAYA 1YOVB 1IUYA 4IF4A 2M34A 3MFKA 4XONA 3WTSC 2VJ5A 5LHGA 4BEHA 4G6QA 5EG0B 4YFXF 2LY9A 3TGNA 3E1SA 1Z6TA 5C4JJ 4BJTA 4CYDA 2LBFB
chains in the Genus database with same CATH topology
5JFRA 3HSEA 4M71A 5D4SA 4YFKF 3T5XA 1MJBA 2B0LA 4HX8A 3V7RA 3M7GA 1JGSA 1R58A 1L3LA 3F8CA 2Y75A 1KYZA 2D1HA 2Z33A 1Z05A 1ZGAA 1FSHA 5A2QZ 3DPLC 4HF0A 1D8JA 5E1ZB 2DAOA 1VTNC 2P6TA 5IT9Z 4G8XA 2Z5UA 3ECHA 3RKXA 3F8NA 5BMZA 3G73A 1QQIA 5LBQA 3CO7C 4TV7A 2UWMA 2IA0A 2R3SA 3PQKA 4RAZA 1ZLJA 3IC7A 2EFWA 1FYMA 4RB2C 4AIKA 4QLCU 2K7LA 1J59A 3ROUA 1MJ9A 1FBUA 4KT5C 3IRRA 3FM3A 1S7AA 4EJUA 4L0ZB 2DTRA 3V7SA 2HGCA 2STWA 2Q0OA 3SXYA 4ZYDA 3SFZA 3J81Z 1XGOA 2QLZA 1BIAA 1YW9A 1YG2A 1B59A 3F72A 2ZBKA 1CF7B 3RTRA 3PQJA 2VBZA 1S8NA 1PP7U 5D5UB 1WQ2A 4L9TA 3I5UA 1P4WA 2QYOA 4U0YA 3WE2A 3GUDA 2P7VB 3ZMTA 4RGSA 2FMYA 4O5VA 3IHUA 1UHMA 3GWZA 1LDJA 3QP5A 1STZA 1ON1A 4XSZF 1XD7A 4M73A 5BPIA 2NS0A 4L18B 1ZLKA 4XLPF 4IXAA 4LB5A 5LHHA 1YFHA 1K6OA 2QBYB 1B6AA 2Y48A 1OR7A 5CVRA 3C3WA 2D45A 2KIFA 1B4AA 5TJJA 3U1DA 1IW7F 1WSUA 2FMLA 3U2RA 2ADUA 5BPDA 2V79A 3LQRA 1TNSA 4L9NA 5D5VB 1JHFA 1O3RA 3N4MA 2GXBA 1W4MA 4RS8A 1W5TA 4FX0A 1H9TA 4MTDA 2AS5F 3R0AA 5LEKA 2OD5A 3HHGA 4YFNF 2DO7A 1IN5A 3R0JA 1FBQA 4HF1A 4FX4A 4O6JA 1R5HA 3CUQC 1USTA 2HFHA 3D5LA 4P9FA 1KQ0A 2XV4S 5DUIA 4KFCA 4BHPA 2W57A 1GVJA 2F5FA 2K86A 1RIOH 3O6BB 5DCFA 3EYIA 1XMKA 1P2FA 3ZMVA 4AWXB 4P55A 2KJBA 2XIGA 1PDNC 1MDMA 2Z9OA 1XGNA 1LEBA 2FNPA 4L5JA 4ESFA 3MZHA 2G7UA 3KCCA 3JSOA 3K69A 1IZ1A 3NQOA 1OPCA 2XAJA 1BBYA 3T1BA 4XSXF 4EJWA 3F6OA 2FEZA 2YR2A 1YS7A 3DEUA 5HDKA 3B02A 5LRRA 1KU3A 1FX7A 2IVMA 3I0TA 3RYPA 1CF7A 3HRMA 4HAMA 1TBXA 3BP8A 2FA5A 1IXSB 1QGPA 3Q9VA 1B9MA 4KMUX 1SD7A 1P6RA 2F5DA 2J5OA 3GX4X 2M5WA 1ZGJA 4EGYA 4UV8A 4BXUA 3GFMA 2ZJ2A 2P5LC 2IA2A 4LG0A 1X3UA 2M30A 4A6DA 4OINF 3B73A 5CJ9A 1KQ8A 3FXQA 4UVCA 3HTSB 1RZ4A 1FBSA 4Y17A 3AAFA 4FHTA 1ZARA 1FP1D 5K5RA 4OIOF 2ACJA 2A68F 1PP8F 2FE3A 2CGPA 4R1HA 2RV8A 3QU6A 1T98A 2RVCA 3CDHA 4I2OA 1AOYA 2RKHA 3E3VA 5E1XA 4IVNA 3R4KA 1D3YA 2EFNA 3HSRA 5CVIA 1HBXG 2FRHA 3GFIA 4KIGA 2XUBA 4CXFA 3WGGA 1MKMA 5A2QK 2ELHA 4LB6B 2HS5A 1W7PD 5L3DA 3ECOA 3I64A 4BQAA 3HYIA 2VC1A 3ABTA 4CO8A 1FC3A 1XDSA 3KP4A 2O03A 2IT0A 4PCQA 3V4GA 1LDKB 2BE5F 3QOPA 1I1SA 4M6YA 3DXJF 4BHCA 2X0LA 4ENMA 1F5TA 2DK5A 2NNNA 3HTUA 4WX9A 1QBJA 1O3TA 3KP3A 1QZYA 2R7FA 5IT3A 3T8TA 1W5SA 2GA2A 3M1EA 3BWGA 4KN7X 1FT9A 2GAUA 2KIMA 5HVQC 1D5VA 3TO9A 2PMUA 3K1MA 3E5UA 4DNCA 2ZKZA 3R60A 1S3JA 4NQWA 4K2EA 1BI3A 2NNYA 5J8FA 3WTTC 4YG2F 1ZRCA 4HBLA 1OYWA 3K1NA 1T38A 2PMHA 2A6HF 4LLLA 1SFXA 4IRIA 2V1UA 3LAPA 1ZYRF 1HKSA 4KMFA 4G7HF 4OOIA 2MLKA 1KU7A 1JXSA 5D6FA 4UVAA 3F8BA 1XCVA 2RC4A 4M9SA 2FXAA 3W6KB 2Z99A 4HYEA 4KICA 1K78A 3HHHA 3LSTA 2ZMEA 1Z7UA 3BY6A 3GYHX 2COMA 4Z2YA 4EM2A 2W85A 1RUNA 5FO5A 5E17F 4JBAA 3O2PE 4YIFA 5FFXA 5TRDA 2M1BA 2VE9A 4E70A 2NYXA 1T2KA 2LNBA 3VFZA 2MLGA 3R61A 2QQAA 2L4AA 2UXXA 2VE8A 5HS9A 4B09A 2HDCA 4PGGA 3WGHA 1IN4A 3C1DA 2DQRA 3KP5A 1OKRA 1TQPA 2XHKA 1MJAA 2X4HA 5CVVA 1BC8C 2YU3A 3I71A 3WG9A 5HDGA 1SMYF 2VT3A 4A0ZA 1R1UA 2KIUA 4IHTA 2JTVA 3EUHA 3I58A 4I09A 3RPQA 3E6MA 1XSDA 1ZG3A 2A61A 1SD5A 3MCZA 2YPRA 1P4AA 1RUOA 2A5YB 1Z1DA 3LFKA 3ZN1A 2RN7A 2HTSA 1EH7A 1FP2A 2JZYA 3K9TA 5AONA 2VBWA 4CHUA 2DI3A 4EMSA 4ETSA 3KEOA 3DP7A 4L9JA 3S2WA 3MWMA 2CSOA 2V1DA 2EV5A 1KU2A 4AIJA 1YW7A 1R22A 3DV8A 4HQEA 2H6CA 4AIHA 2G9WA 1RI7A 2JT1A 1SD4A 1G4DA 1ONVA 5LHIA 5FD5A 1OYYA 4LK1F 2XAGA 3FXRA 5LRSA 2PEXA 1TW2A 5L3EA 2ISYA 2PFBA 1WKMA 2A69F 2VONA 3ZP5A 4DQ2A 2HZTA 4GYGA 1LQ1A 2FSWA 4ZYHA 4RB1A 1MDMB 1TW3A 1B1BA 3VEPA 1YTYA 2HYGD 1E2XA 4G9YA 1Z91A 3I53A 1FOKA 1Q1HA 3CJNA 2HKXA 5DCMB 5DD8A 4G94A 3KP2A 1BIBA 4LLGF 1O7LA 2CO5A 4O3MA 2F5CA 4EM0B 1TQIA 2LF8A 2RNJA 5JI6A 3K2ZA 4N9IA 2W24A 2EA4A 3FMRA 3IKTA 3V8JA 1I1GA 3JAMK 3DF8A 2FOKA 2PLYA 3FF5A 5D6EA 5LEJA 3FWEA 1E17A 4Y13A 4GGGA 1IRFA 3MAJA 3ZN0A 3E6DA 4Q4ZF 2HQRA 3FM5A 5KK1A 1TLHB 5E18F 4I0AA 4KNYA 3EDPA 1BI1A 4LD5A 4PZJA 1DPRA 3TDZC 4QWQA 2VN2A 3OV8A 1KGSA 3MZYA 2PJPA 1NHAA 1C0WA 3H3UA 2QZ8A 3E5XA 4UNOA 4MEYF 1U5TA 4HDVA 1I6XA 2TDXA 4LG0B 1ZG5A 2OA4A 4A0YA 1FNNA 2P5KA 4UXNA 1ON2A 3TKYA 2VXZA 4OMYA 2IA1A 4RB3C 2O8XA 4Q5SF 4R79A 1WRJA 5F1RA 1K79A 1HW2A 2PG4A 4IHSA 2HR3A 1JE8A 2M45A 2A3SA 1K7AA 3U9GA 1XMAA 1IRGA 3H3ZA 1FYLA 2WTEA 1DP7P 5LGUA 3RDIA 3E6CC 5ERIA 3BJOA 4EJVA 4ZZDA 3LA2A 3F6VA 3ABUA 2CW0F 3L00A 4GYIA 1HW1A 4I98B 2XASA 2DW4A 3IWFA 1IN8A 3SZTA 2AXLA 1DPUA 4N9HA 3SQNA 4A0XA 2Y0MA 5D8KB 2RGVA 5J6XA 1A04A 5DCMA 4UV9A 3O3KA 3DKWA 3JTHA 3JSPA 3GXOA 2L3DA 4WF2A 1G3SA 3IL2A 4U88A 3BDDA 2OBPA 1LNWA 3MQ0A 3F3XA 3KFWX 3WTUC 1KA8A 4KDPA 5HLHA 3WTXC 4PDKA 4A5MA 3BJAA 2LF7A 2ZO4A 2QVOA 2EV6A 3V8KA 2O3FA 2L01A 3BOQA 3HSFA 3JAMZ 2HTJA 3ZMDA 5DYMA 2FU4A 3EQLF 3EYYA 1Z9CA 2LDUA 1ZRFA 1BJAA 4LFUA 4MTEA 3W6JB 3L2CA 5DUKA 4JK1X 1IXCA 1K78B 2ZMEB 2UZKA 1F4KA 3DFGA 2E7WA 5CVJA 2VT2A 1QPMA 1HKTA 3R6SA 1SD6A 5H20A 1ZH5A 1XCBA 4MEXF 2DU9A 2NAZA 4F7ZA 2CFXA 5ICCA 1R1VA 3GFLA 3GW2A 4H0EA 5HOOA 4Q47A 2EB7A 3GF2A 1LDDA 2GXGA 5FFZA 1EH8A 3VB2A 4EM1A 5JR3A 2FBHA 2OZUA 1U6GA 2QUFA 3P9KA 1BI0A 2DFIA 2KKOA 4OIPF 4IPAA 2DPDA 4LMYA 1DUXC 2ESHA 4ZYGA 5K5OA 5JVTA 2P6SA 1HSTA 1USSA 4S04A 3HOSA 1G3TA 5DEQA 4FT8A 4LK0F 4MQVA 4EJTA 1YIOA 1J9IA 1I5ZA 2H09A 4RGUA 1OMIA 2JPCA 1J7KA 1R36A 1HKQA 2V1XA 1GXPA 1YLFA 2WC2A 3QPTA 5HS7A 2EK5A 2L54A 3HRTA 2O0YA 3EETA 3KETA 1O7FA 4ESBA 1HSJA 3CUQA 4ENKA 4AD9A 3TOAA 4HDUA 4KIFA 3WTWC 4WCGA 1ZAOA 5E8GA 4Y15A 1G6NA 3TDUC 2IRFG 3ULQB 2EJRA 5F6FA 3L9FA 4M74A 5AIPA 1XDUA 3P9IA 3QPHA 1XN7A 3WE3A 2XVCA 3JTGA 1MGTA 5FB2A 3ISPA 5J8CA 2FQ3A 1O3SA 3RI4A 4GO1A 5DDGA 1YQAA 4BYYA 2HOEA 3LA3A 2JSCA 3HRUA 3C18A 3M8EA 1ZRDA 4KUMA 5D5WB 3KP7A 3QU3A 2XAQA 2DT5A 1U5TC 1KQ9A 3OOPA 4HV6A 1W7PB 1YO5C 1T6SA 2OAZA 3F21A 2FBIA 3RPUA 1I27A 2HWVA 2NRAC 2EFOA 4EVIA 2D2WA 3F22A 2BEOA 1IXRC 2G7HA 4CICA 2LSOA 1DDNA 1FPQA 3GO5A 1U5TB 5ICFA 1J75A 3RJPA 2LKPA 5BS6A 3WTVC 4ENJA 4HX4A 3JW4A 4JQFA 4OIRF 2PQ8A 4NB5A 3NRVA 1BOAA 1GXQA 4ZH4F 2K02A 3I59A 5JHUA 2Z3YA 3KLOA 4G7ZF 1T39A 3GVAA 3RIRA 1J5YA 3J7AO 1EV7A 3PFIA 2ISZA 1UB9A 2YX4A 5L3CA 2RDPA 3NEUA 3VOEA 3ZPLA 4WXCA 4L5IA 1R00A 2QQ9A 3ZMSA 1ZHFA 3KZYA 3L09A 1HW5A 2UXNA 3LA7A 3D0SA 4GXOA 2ZNZA 4HOBA 3FMSA 1H9GA 3CTAA 5L3FA 1U3EM 4BNCA 2IW5A 1XGMA 1MZBA 4ZZLA 4M6XA 4ESJA 3Q5FA 1EH6A 2P7CB 1S7OA 2VC0A 1BN5A 2Q8KA 4N0BA 2JRTA 1SAXA 3BZ6A 4WWCA 3KE2A 5FLXZ 2YX7A 3C7JA 5KVRA 3V7CA 4ON0A 3BPVA 3FXUA 1S6LA 1YYVA 4R8HA 2BV6A 2ESNA 2QENA 1ULYA 2XAFA 3HIFA 1TNTA 4P96A 2DK8A 3CO6C 2P8TA 3ML6A 2MA3A 3GEZA 1IF1A 1IAWA 1B9NA 1TTYA 1CGPA 2ZNYA 3FMQA 3WGIA 2OQGA 3E6BA 2FF4A 4EGZA 1RNLA 4L0YB 5D8LB 1W7PA 3REOA 2CG4A 5E8IA 4KIBA 4WXHA 1XSVA 3GZ5A 2Q2EA 4L9VA 1WI9A 5LGNA 2WWYA 2A07F 1UCRA 4NHJA 1ZG1A 2GZWA 2OZ6A 1L0OC 4P9UA 5L3GA 5K5QA 3KP6A 1AWCA 4UHTA 2EFQA 4G7OF 3IWZA 2F5EA 1Y0UA 5D4RA 4UVBA 5EEGA 2EA2A 1LB2A 1UFMA 4LJZF 2PN6A 5ILUA 4HLXA 4IRHA 1FY7A 4A2UA 2GIVA 3SZPA 3K1PA 1Z6RA 3J80Z 1SMTA 2A6EF 3LWFA 2STTA 2D1VA 1MD0A 3P7NA 5ILSA 1P4XA 5BQTA 4RB0A 4HA8A 1T0FA 3F8MA 1BI2A 4EV0A 5HLGA 2V9VA 5FGMA 1OYIA 2O61A 3HRSA 2W84A 4XLNF 3RKWA 2P5VA 2OU2A 1TQMA 2J5PA 1BC7C 4U7DA 4U0WA 3T0YA 1FWZA 2PBIA 5FD6A 2M87A 3VODA 4OU0A 2BYVE 2QM3A 2VOOA 1REPC 5K1YA 3DPTA 4RGRA 2CQKA 5ICGA 1U8RA 4CDGA 3WODF 5D5XB 4I02A 1GHCA 2QWWA 3SHFA 1FLIA 4MNUA 5E20A 4WK8F 2E1CA 2H6BA 2L4MA 2IP2A 3LAJA 2PI0A 2FBKA 5BOXA 4RGXA 2GA1A 2DLLA 2W25A 2VOPA 2DBBA 5F64A 3LQQA 4XBFA 4A12A 1YW8A 3ZMUA 4BH9A 3KZZA 2HQNA 2CYYA 3CUQB 1JHHA 5L3BA 3M8FA 1SFUA 2XRNA 4IJAA 1KU9A 2MD5A 4MQ9F 4KYWA 3E97A 4OIQF 1FSEA 1G3YA 3HOTA 3IKVA 3T8RA 3E5QA 1HXDA 2KJCA 2EWNA 5LGTA 1IN6A 3M9AA 1WWXA 1J0RA 1FZPB 2JPBA 1U78A 2MH2A 4D0PA 4IRGA 4GCVA 4HQMA 4I01A 2O6GE 3ERED 1YS6A 4A6EA 1HQCA 2E1NA 4HX7A 2YSRA 1S29A 3P9CA 3N97A 2C6YA 5AIQA 2K4BA 4BHBA 3QRFF 1R7JA 3I54A 4HW0A 2DPUA 1LJ9A 1U2WA 3RYRA 4CGZA 2RQPA 2FNAA 2QBYA 2VODA 1LEAA 2M8EA 2ZXJA 3WTZA 2XAHA 3H92A 3F23A 2H94A 1R23A 3TO6A 3FX3A 1QZZA 2QQBA 4HLYA 2VBYA 1F1ZA 3L7WA 2VBXA 1G3WA 5DD4A 1UHWA 2HEOA 4KA4A 3BPXA 3WU0A 3FHZA 3GLXA 1O3QA 2GWRA 1D8KA 4LGWA 4MGRA 1LVAA 3FZVA 4M9XA 2R7DA 4P5OA 2BBYA 2F2EA 1XB4A 3V8LA 5HS8A 3TOBA 3I59B 4ASNA 3K0LA 1QO0D 2IPQX 4HZFA 2K27A 3COAC 1V4RA 4RAYA 2OQRA 2DQLA 3IRQA 2XKPA 2H27A 3CUOA 5IT9K 4ZYEA 4XRFA 3WTYC 4U7BA 4YIIA 4M9ZA 1ODDA 5ILVA 5ED4A 5FLXK 2XROA 3QAHA 5CVUA 3CLOA 1J2XA 2KRFA 4OMZA 2GQQA 1H0MA 5DV5A 4EQQA 5H6RA 4CZZA 2BGCA 1PUEE 2ZFWA 3ELKA 2HKOA 1F9NA 4U0VA 3QP6A 3BJ6A 5HDNA 3KEQA 3ZMZA 2ETHA 5HLIA 1O57A 4PGHA 4I0BA 3J81K 2WV0A 3BROA 3I4PA 4UUVA 5EEHA 2HYFA 2EFPA 5H6QA 1QNTA 4AVPA 2XKOA 3WU1B 3RKYA 1IN7A 4M72A 4LLNA 5LLQA 5ICEA 1R5GA 1XGSA 4ENNA 1V3FA 2IJLA 2V6CA 3GFJA 4Q48A 2XGXA 3Q9SA 4EJOA 1ZREA 1XSXA 5CYVA 1ZN2A 1R1TA 5E1WA 3MEXA 2MBFA 3J80K 4G6DA 3TQNA 4B8XA 4MHGA 4KN4X 2CWEA 1FYKA 4A5NA 4WXDA 3DQVC 2MC3A 3GZ6A 3KLNA 1KYWA 3HUGA 2MH9A 3G3ZA 2EV0A 4HF2A 5CLSA 4HV5A 1BM9A 3F8FA 1SFEA 2ZCWA 6PAXA 2K4JA 2P4WA 3TO7A 4I7HA 2L02A 3ZQ7A 4S05A 2E7XA 1P92A 4BAYA 1IUYA 4IF4A 3MFKA 3WTSC 5LHGA 4G6QA 4YFXF 3TGNA 1Z6TA 4CYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFR A;  3HSE A;  4M71 A;  5D4S A;  4YFK F;  3T5X A;  1MJB A;  2B0L A;  4HX8 A;  3V7R A;  3M7G A;  1JGS A;  1R58 A;  1L3L A;  3F8C A;  2Y75 A;  1KYZ A;  2D1H A;  2Z33 A;  1Z05 A;  1ZGA A;  1FSH A;  5A2Q Z;  3DPL C;  4HF0 A;  1D8J A;  5E1Z B;  2DAO A;  1VTN C;  2P6T A;  5IT9 Z;  4G8X A;  2Z5U A;  3ECH A;  3RKX A;  3F8N A;  5BMZ A;  3G73 A;  1QQI A;  5LBQ A;  3CO7 C;  4TV7 A;  2UWM A;  2IA0 A;  2R3S A;  3PQK A;  4RAZ A;  1ZLJ A;  3IC7 A;  2EFW A;  1FYM A;  4RB2 C;  4AIK A;  4QLC U;  2K7L A;  1J59 A;  3ROU A;  1MJ9 A;  1FBU A;  4KT5 C;  3IRR A;  3FM3 A;  1S7A A;  4EJU A;  4L0Z B;  2DTR A;  3V7S A;  2HGC A;  2STW A;  2Q0O A;  3SXY A;  4ZYD A;  3SFZ A;  3J81 Z;  1XGO A;  2QLZ A;  1BIA A;  1YW9 A;  1YG2 A;  1B59 A;  3F72 A;  2ZBK A;  1CF7 B;  3RTR A;  3PQJ A;  2VBZ A;  1S8N A;  1PP7 U;  5D5U B;  1WQ2 A;  4L9T A;  3I5U A;  1P4W A;  2QYO A;  4U0Y A;  3WE2 A;  3GUD A;  2P7V B;  3ZMT A;  4RGS A;  2FMY A;  4O5V A;  3IHU A;  1UHM A;  3GWZ A;  1LDJ A;  3QP5 A;  1STZ A;  1ON1 A;  4XSZ F;  1XD7 A;  4M73 A;  5BPI A;  2NS0 A;  4L18 B;  1ZLK A;  4XLP F;  4IXA A;  4LB5 A;  5LHH A;  1YFH A;  1K6O A;  2QBY B;  1B6A A;  2Y48 A;  1OR7 A;  5CVR A;  3C3W A;  2D45 A;  2KIF A;  1B4A A;  5TJJ A;  3U1D A;  1IW7 F;  1WSU A;  2FML A;  3U2R A;  2ADU A;  5BPD A;  2V79 A;  3LQR A;  1TNS A;  4L9N A;  5D5V B;  1JHF A;  1O3R A;  3N4M A;  2GXB A;  1W4M A;  4RS8 A;  1W5T A;  4FX0 A;  1H9T A;  4MTD A;  2AS5 F;  3R0A A;  5LEK A;  2OD5 A;  3HHG A;  4YFN F;  2DO7 A;  1IN5 A;  3R0J A;  1FBQ A;  4HF1 A;  4FX4 A;  4O6J A;  1R5H A;  3CUQ C;  1UST A;  2HFH A;  3D5L A;  4P9F A;  1KQ0 A;  2XV4 S;  5DUI A;  4KFC A;  4BHP A;  2W57 A;  1GVJ A;  2F5F A;  2K86 A;  1RIO H;  3O6B B;  5DCF A;  3EYI A;  1XMK A;  1P2F A;  3ZMV A;  4AWX B;  4P55 A;  2KJB A;  2XIG A;  1PDN C;  1MDM A;  2Z9O A;  1XGN A;  1LEB A;  2FNP A;  4L5J A;  4ESF A;  3MZH A;  2G7U A;  3KCC A;  3JSO A;  3K69 A;  1IZ1 A;  3NQO A;  1OPC A;  2XAJ A;  1BBY A;  3T1B A;  4XSX F;  4EJW A;  3F6O A;  2FEZ A;  2YR2 A;  1YS7 A;  3DEU A;  5HDK A;  3B02 A;  5LRR A;  1KU3 A;  1FX7 A;  2IVM A;  3I0T A;  3RYP A;  1CF7 A;  3HRM A;  4HAM A;  1TBX A;  3BP8 A;  2FA5 A;  1IXS B;  1QGP A;  3Q9V A;  1B9M A;  4KMU X;  1SD7 A;  1P6R A;  2F5D A;  2J5O A;  3GX4 X;  2M5W A;  1ZGJ A;  4EGY A;  4UV8 A;  4BXU A;  3GFM A;  2ZJ2 A;  2P5L C;  2IA2 A;  4LG0 A;  1X3U A;  2M30 A;  4A6D A;  4OIN F;  3B73 A;  5CJ9 A;  1KQ8 A;  3FXQ A;  4UVC A;  3HTS B;  1RZ4 A;  1FBS A;  4Y17 A;  3AAF A;  4FHT A;  1ZAR A;  1FP1 D;  5K5R A;  4OIO F;  2ACJ A;  2A68 F;  1PP8 F;  2FE3 A;  2CGP A;  4R1H A;  2RV8 A;  3QU6 A;  1T98 A;  2RVC A;  3CDH A;  4I2O A;  1AOY A;  2RKH A;  3E3V A;  5E1X A;  4IVN A;  3R4K A;  1D3Y A;  2EFN A;  3HSR A;  5CVI A;  1HBX G;  2FRH A;  3GFI A;  4KIG A;  2XUB A;  4CXF A;  3WGG A;  1MKM A;  5A2Q K;  2ELH A;  4LB6 B;  2HS5 A;  1W7P D;  5L3D A;  3ECO A;  3I64 A;  4BQA A;  3HYI A;  2VC1 A;  3ABT A;  4CO8 A;  1FC3 A;  1XDS A;  3KP4 A;  2O03 A;  2IT0 A;  4PCQ A;  3V4G A;  1LDK B;  2BE5 F;  3QOP A;  1I1S A;  4M6Y A;  3DXJ F;  4BHC A;  2X0L A;  4ENM A;  1F5T A;  2DK5 A;  2NNN A;  3HTU A;  4WX9 A;  1QBJ A;  1O3T A;  3KP3 A;  1QZY A;  2R7F A;  5IT3 A;  3T8T A;  1W5S A;  2GA2 A;  3M1E A;  3BWG A;  4KN7 X;  1FT9 A;  2GAU A;  2KIM A;  5HVQ C;  1D5V A;  3TO9 A;  2PMU A;  3K1M A;  3E5U A;  4DNC A;  2ZKZ A;  3R60 A;  1S3J A;  4NQW A;  4K2E A;  1BI3 A;  2NNY A;  5J8F A;  3WTT C;  4YG2 F;  1ZRC A;  4HBL A;  1OYW A;  3K1N A;  1T38 A;  2PMH A;  2A6H F;  4LLL A;  1SFX A;  4IRI A;  2V1U A;  3LAP A;  1ZYR F;  1HKS A;  4KMF A;  4G7H F;  4OOI A;  2MLK A;  1KU7 A;  1JXS A;  5D6F A;  4UVA A;  3F8B A;  1XCV A;  2RC4 A;  4M9S A;  2FXA A;  3W6K B;  2Z99 A;  4HYE A;  4KIC A;  1K78 A;  3HHH A;  3LST A;  2ZME A;  1Z7U A;  3BY6 A;  3GYH X;  2COM A;  4Z2Y A;  4EM2 A;  2W85 A;  1RUN A;  5FO5 A;  5E17 F;  4JBA A;  3O2P E;  4YIF A;  5FFX A;  5TRD A;  2M1B A;  2VE9 A;  4E70 A;  2NYX A;  1T2K A;  2LNB A;  3VFZ A;  2MLG A;  3R61 A;  2QQA A;  2L4A A;  2UXX A;  2VE8 A;  5HS9 A;  4B09 A;  2HDC A;  4PGG A;  3WGH A;  1IN4 A;  3C1D A;  2DQR A;  3KP5 A;  1OKR A;  1TQP A;  2XHK A;  1MJA A;  2X4H A;  5CVV A;  1BC8 C;  2YU3 A;  3I71 A;  3WG9 A;  5HDG A;  1SMY F;  2VT3 A;  4A0Z A;  1R1U A;  2KIU A;  4IHT A;  2JTV A;  3EUH A;  3I58 A;  4I09 A;  3RPQ A;  3E6M A;  1XSD A;  1ZG3 A;  2A61 A;  1SD5 A;  3MCZ A;  2YPR A;  1P4A A;  1RUO A;  2A5Y B;  1Z1D A;  3LFK A;  3ZN1 A;  2RN7 A;  2HTS A;  1EH7 A;  1FP2 A;  2JZY A;  3K9T A;  5AON A;  2VBW A;  4CHU A;  2DI3 A;  4EMS A;  4ETS A;  3KEO A;  3DP7 A;  4L9J A;  3S2W A;  3MWM A;  2CSO A;  2V1D A;  2EV5 A;  1KU2 A;  4AIJ A;  1YW7 A;  1R22 A;  3DV8 A;  4HQE A;  2H6C A;  4AIH A;  2G9W A;  1RI7 A;  2JT1 A;  1SD4 A;  1G4D A;  1ONV A;  5LHI A;  5FD5 A;  1OYY A;  4LK1 F;  2XAG A;  3FXR A;  5LRS A;  2PEX A;  1TW2 A;  5L3E A;  2ISY A;  2PFB A;  1WKM A;  2A69 F;  2VON A;  3ZP5 A;  4DQ2 A;  2HZT A;  4GYG A;  1LQ1 A;  2FSW A;  4ZYH A;  4RB1 A;  1MDM B;  1TW3 A;  1B1B A;  3VEP A;  1YTY A;  2HYG D;  1E2X A;  4G9Y A;  1Z91 A;  3I53 A;  1FOK A;  1Q1H A;  3CJN A;  2HKX A;  5DCM B;  5DD8 A;  4G94 A;  3KP2 A;  1BIB A;  4LLG F;  1O7L A;  2CO5 A;  4O3M A;  2F5C A;  4EM0 B;  1TQI A;  2LF8 A;  2RNJ A;  5JI6 A;  3K2Z A;  4N9I A;  2W24 A;  2EA4 A;  3FMR A;  3IKT A;  3V8J A;  1I1G A;  3JAM K;  3DF8 A;  2FOK A;  2PLY A;  3FF5 A;  5D6E A;  5LEJ A;  3FWE A;  1E17 A;  4Y13 A;  4GGG A;  1IRF A;  3MAJ A;  3ZN0 A;  3E6D A;  4Q4Z F;  2HQR A;  3FM5 A;  5KK1 A;  1TLH B;  5E18 F;  4I0A A;  4KNY A;  3EDP A;  1BI1 A;  4LD5 A;  4PZJ A;  1DPR A;  3TDZ C;  4QWQ A;  2VN2 A;  3OV8 A;  1KGS A;  3MZY A;  2PJP A;  1NHA A;  1C0W A;  3H3U A;  2QZ8 A;  3E5X A;  4UNO A;  4MEY F;  1U5T A;  4HDV A;  1I6X A;  2TDX A;  4LG0 B;  1ZG5 A;  2OA4 A;  4A0Y A;  1FNN A;  2P5K A;  4UXN A;  1ON2 A;  3TKY A;  2VXZ A;  4OMY A;  2IA1 A;  4RB3 C;  2O8X A;  4Q5S F;  4R79 A;  1WRJ A;  5F1R A;  1K79 A;  1HW2 A;  2PG4 A;  4IHS A;  2HR3 A;  1JE8 A;  2M45 A;  2A3S A;  1K7A A;  3U9G A;  1XMA A;  1IRG A;  3H3Z A;  1FYL A;  2WTE A;  1DP7 P;  5LGU A;  3RDI A;  3E6C C;  5ERI A;  3BJO A;  4EJV A;  4ZZD A;  3LA2 A;  3F6V A;  3ABU A;  2CW0 F;  3L00 A;  4GYI A;  1HW1 A;  4I98 B;  2XAS A;  2DW4 A;  3IWF A;  1IN8 A;  3SZT A;  2AXL A;  1DPU A;  4N9H A;  3SQN A;  4A0X A;  2Y0M A;  5D8K B;  2RGV A;  5J6X A;  1A04 A;  5DCM A;  4UV9 A;  3O3K A;  3DKW A;  3JTH A;  3JSP A;  3GXO A;  2L3D A;  4WF2 A;  1G3S A;  3IL2 A;  4U88 A;  3BDD A;  2OBP A;  1LNW A;  3MQ0 A;  3F3X A;  3KFW X;  3WTU C;  1KA8 A;  4KDP A;  5HLH A;  3WTX C;  4PDK A;  4A5M A;  3BJA A;  2LF7 A;  2ZO4 A;  2QVO A;  2EV6 A;  3V8K A;  2O3F A;  2L01 A;  3BOQ A;  3HSF A;  3JAM Z;  2HTJ A;  3ZMD A;  5DYM A;  2FU4 A;  3EQL F;  3EYY A;  1Z9C A;  2LDU A;  1ZRF A;  1BJA A;  4LFU A;  4MTE A;  3W6J B;  3L2C A;  5DUK A;  4JK1 X;  1IXC A;  1K78 B;  2ZME B;  2UZK A;  1F4K A;  3DFG A;  2E7W A;  5CVJ A;  2VT2 A;  1QPM A;  1HKT A;  3R6S A;  1SD6 A;  5H20 A;  1ZH5 A;  1XCB A;  4MEX F;  2DU9 A;  2NAZ A;  4F7Z A;  2CFX A;  5ICC A;  1R1V A;  3GFL A;  3GW2 A;  4H0E A;  5HOO A;  4Q47 A;  2EB7 A;  3GF2 A;  1LDD A;  2GXG A;  5FFZ A;  1EH8 A;  3VB2 A;  4EM1 A;  5JR3 A;  2FBH A;  2OZU A;  1U6G A;  2QUF A;  3P9K A;  1BI0 A;  2DFI A;  2KKO A;  4OIP F;  4IPA A;  2DPD A;  4LMY A;  1DUX C;  2ESH A;  4ZYG A;  5K5O A;  5JVT A;  2P6S A;  1HST A;  1USS A;  4S04 A;  3HOS A;  1G3T A;  5DEQ A;  4FT8 A;  4LK0 F;  4MQV A;  4EJT A;  1YIO A;  1J9I A;  1I5Z A;  2H09 A;  4RGU A;  1OMI A;  2JPC A;  1J7K A;  1R36 A;  1HKQ A;  2V1X A;  1GXP A;  1YLF A;  2WC2 A;  3QPT A;  5HS7 A;  2EK5 A;  2L54 A;  3HRT A;  2O0Y A;  3EET A;  3KET A;  1O7F A;  4ESB A;  1HSJ A;  3CUQ A;  4ENK A;  4AD9 A;  3TOA A;  4HDU A;  4KIF A;  3WTW C;  4WCG A;  1ZAO A;  5E8G A;  4Y15 A;  1G6N A;  3TDU C;  2IRF G;  3ULQ B;  2EJR A;  5F6F A;  3L9F A;  4M74 A;  5AIP A;  1XDU A;  3P9I A;  3QPH A;  1XN7 A;  3WE3 A;  2XVC A;  3JTG A;  1MGT A;  5FB2 A;  3ISP A;  5J8C A;  2FQ3 A;  1O3S A;  3RI4 A;  4GO1 A;  5DDG A;  1YQA A;  4BYY A;  2HOE A;  3LA3 A;  2JSC A;  3HRU A;  3C18 A;  3M8E A;  1ZRD A;  4KUM A;  5D5W B;  3KP7 A;  3QU3 A;  2XAQ A;  2DT5 A;  1U5T C;  1KQ9 A;  3OOP A;  4HV6 A;  1W7P B;  1YO5 C;  1T6S A;  2OAZ A;  3F21 A;  2FBI A;  3RPU A;  1I27 A;  2HWV A;  2NRA C;  2EFO A;  4EVI A;  2D2W A;  3F22 A;  2BEO A;  1IXR C;  2G7H A;  4CIC A;  2LSO A;  1DDN A;  1FPQ A;  3GO5 A;  1U5T B;  5ICF A;  1J75 A;  3RJP A;  2LKP A;  5BS6 A;  3WTV C;  4ENJ A;  4HX4 A;  3JW4 A;  4JQF A;  4OIR F;  2PQ8 A;  4NB5 A;  3NRV A;  1BOA A;  1GXQ A;  4ZH4 F;  2K02 A;  3I59 A;  5JHU A;  2Z3Y A;  3KLO A;  4G7Z F;  1T39 A;  3GVA A;  3RIR A;  1J5Y A;  3J7A O;  1EV7 A;  3PFI A;  2ISZ A;  1UB9 A;  2YX4 A;  5L3C A;  2RDP A;  3NEU A;  3VOE A;  3ZPL A;  4WXC A;  4L5I A;  1R00 A;  2QQ9 A;  3ZMS A;  1ZHF A;  3KZY A;  3L09 A;  1HW5 A;  2UXN A;  3LA7 A;  3D0S A;  4GXO A;  2ZNZ A;  4HOB A;  3FMS A;  1H9G A;  3CTA A;  5L3F A;  1U3E M;  4BNC A;  2IW5 A;  1XGM A;  1MZB A;  4ZZL A;  4M6X A;  4ESJ A;  3Q5F A;  1EH6 A;  2P7C B;  1S7O A;  2VC0 A;  1BN5 A;  2Q8K A;  4N0B A;  2JRT A;  1SAX A;  3BZ6 A;  4WWC A;  3KE2 A;  5FLX Z;  2YX7 A;  3C7J A;  5KVR A;  3V7C A;  4ON0 A;  3BPV A;  3FXU A;  1S6L A;  1YYV A;  4R8H A;  2BV6 A;  2ESN A;  2QEN A;  1ULY A;  2XAF A;  3HIF A;  1TNT A;  4P96 A;  2DK8 A;  3CO6 C;  2P8T A;  3ML6 A;  2MA3 A;  3GEZ A;  1IF1 A;  1IAW A;  1B9N A;  1TTY A;  1CGP A;  2ZNY A;  3FMQ A;  3WGI A;  2OQG A;  3E6B A;  2FF4 A;  4EGZ A;  1RNL A;  4L0Y B;  5D8L B;  1W7P A;  3REO A;  2CG4 A;  5E8I A;  4KIB A;  4WXH A;  1XSV A;  3GZ5 A;  2Q2E A;  4L9V A;  1WI9 A;  5LGN A;  2WWY A;  2A07 F;  1UCR A;  4NHJ A;  1ZG1 A;  2GZW A;  2OZ6 A;  1L0O C;  4P9U A;  5L3G A;  5K5Q A;  3KP6 A;  1AWC A;  4UHT A;  2EFQ A;  4G7O F;  3IWZ A;  2F5E A;  1Y0U A;  5D4R A;  4UVB A;  5EEG A;  2EA2 A;  1LB2 A;  1UFM A;  4LJZ F;  2PN6 A;  5ILU A;  4HLX A;  4IRH A;  1FY7 A;  4A2U A;  2GIV A;  3SZP A;  3K1P A;  1Z6R A;  3J80 Z;  1SMT A;  2A6E F;  3LWF A;  2STT A;  2D1V A;  1MD0 A;  3P7N A;  5ILS A;  1P4X A;  5BQT A;  4RB0 A;  4HA8 A;  1T0F A;  3F8M A;  1BI2 A;  4EV0 A;  5HLG A;  2V9V A;  5FGM A;  1OYI A;  2O61 A;  3HRS A;  2W84 A;  4XLN F;  3RKW A;  2P5V A;  2OU2 A;  1TQM A;  2J5P A;  1BC7 C;  4U7D A;  4U0W A;  3T0Y A;  1FWZ A;  2PBI A;  5FD6 A;  2M87 A;  3VOD A;  4OU0 A;  2BYV E;  2QM3 A;  2VOO A;  1REP C;  5K1Y A;  3DPT A;  4RGR A;  2CQK A;  5ICG A;  1U8R A;  4CDG A;  3WOD F;  5D5X B;  4I02 A;  1GHC A;  2QWW A;  3SHF A;  1FLI A;  4MNU A;  5E20 A;  4WK8 F;  2E1C A;  2H6B A;  2L4M A;  2IP2 A;  3LAJ A;  2PI0 A;  2FBK A;  5BOX A;  4RGX A;  2GA1 A;  2DLL A;  2W25 A;  2VOP A;  2DBB A;  5F64 A;  3LQQ A;  4XBF A;  4A12 A;  1YW8 A;  3ZMU A;  4BH9 A;  3KZZ A;  2HQN A;  2CYY A;  3CUQ B;  1JHH A;  5L3B A;  3M8F A;  1SFU A;  2XRN A;  4IJA A;  1KU9 A;  2MD5 A;  4MQ9 F;  4KYW A;  3E97 A;  4OIQ F;  1FSE A;  1G3Y A;  3HOT A;  3IKV A;  3T8R A;  3E5Q A;  1HXD A;  2KJC A;  2EWN A;  5LGT A;  1IN6 A;  3M9A A;  1WWX A;  1J0R A;  1FZP B;  2JPB A;  1U78 A;  2MH2 A;  4D0P A;  4IRG A;  4GCV A;  4HQM A;  4I01 A;  2O6G E;  3ERE D;  1YS6 A;  4A6E A;  1HQC A;  2E1N A;  4HX7 A;  2YSR A;  1S29 A;  3P9C A;  3N97 A;  2C6Y A;  5AIQ A;  2K4B A;  4BHB A;  3QRF F;  1R7J A;  3I54 A;  4HW0 A;  2DPU A;  1LJ9 A;  1U2W A;  3RYR A;  4CGZ A;  2RQP A;  2FNA A;  2QBY A;  2VOD A;  1LEA A;  2M8E A;  2ZXJ A;  3WTZ A;  2XAH A;  3H92 A;  3F23 A;  2H94 A;  1R23 A;  3TO6 A;  3FX3 A;  1QZZ A;  2QQB A;  4HLY A;  2VBY A;  1F1Z A;  3L7W A;  2VBX A;  1G3W A;  5DD4 A;  1UHW A;  2HEO A;  4KA4 A;  3BPX A;  3WU0 A;  3FHZ A;  3GLX A;  1O3Q A;  2GWR A;  1D8K A;  4LGW A;  4MGR A;  1LVA A;  3FZV A;  4M9X A;  2R7D A;  4P5O A;  2BBY A;  2F2E A;  1XB4 A;  3V8L A;  5HS8 A;  3TOB A;  3I59 B;  4ASN A;  3K0L A;  1QO0 D;  2IPQ X;  4HZF A;  2K27 A;  3COA C;  1V4R A;  4RAY A;  2OQR A;  2DQL A;  3IRQ A;  2XKP A;  2H27 A;  3CUO A;  5IT9 K;  4ZYE A;  4XRF A;  3WTY C;  4U7B A;  4YII A;  4M9Z A;  1ODD A;  5ILV A;  5ED4 A;  5FLX K;  2XRO A;  3QAH A;  5CVU A;  3CLO A;  1J2X A;  2KRF A;  4OMZ A;  2GQQ A;  1H0M A;  5DV5 A;  4EQQ A;  5H6R A;  4CZZ A;  2BGC A;  1PUE E;  2ZFW A;  3ELK A;  2HKO A;  1F9N A;  4U0V A;  3QP6 A;  3BJ6 A;  5HDN A;  3KEQ A;  3ZMZ A;  2ETH A;  5HLI A;  1O57 A;  4PGH A;  4I0B A;  3J81 K;  2WV0 A;  3BRO A;  3I4P A;  4UUV A;  5EEH A;  2HYF A;  2EFP A;  5H6Q A;  1QNT A;  4AVP A;  2XKO A;  3WU1 B;  3RKY A;  1IN7 A;  4M72 A;  4LLN A;  5LLQ A;  5ICE A;  1R5G A;  1XGS A;  4ENN A;  1V3F A;  2IJL A;  2V6C A;  3GFJ A;  4Q48 A;  2XGX A;  3Q9S A;  4EJO A;  1ZRE A;  1XSX A;  5CYV A;  1ZN2 A;  1R1T A;  5E1W A;  3MEX A;  2MBF A;  3J80 K;  4G6D A;  3TQN A;  4B8X A;  4MHG A;  4KN4 X;  2CWE A;  1FYK A;  4A5N A;  4WXD A;  3DQV C;  2MC3 A;  3GZ6 A;  3KLN A;  1KYW A;  3HUG A;  2MH9 A;  3G3Z A;  2EV0 A;  4HF2 A;  5CLS A;  4HV5 A;  1BM9 A;  3F8F A;  1SFE A;  2ZCW A;  6PAX A;  2K4J A;  2P4W A;  3TO7 A;  4I7H A;  2L02 A;  3ZQ7 A;  4S05 A;  2E7X A;  1P92 A;  4BAY A;  1IUY A;  4IF4 A;  3MFK A;  3WTS C;  5LHG A;  4G6Q A;  4YFX F;  3TGN A;  1Z6T A;  4CYD A; 
#chains in the Genus database with same CATH topology
 5JFR A;  1RC9 A;  3HSE A;  2HDD A;  4M71 A;  2CJJ A;  2HQ5 A;  5D4S A;  4YFK F;  1EKE A;  3FHN A;  1X2M A;  1KZH A;  2GLO A;  3IAM 2;  1MJB A;  2B0L A;  1XMX A;  3T5X A;  4DJA A;  3CC4 I;  3OWT A;  4HX8 A;  3V7R A;  3M7G A;  3OIO A;  3M3Y J;  1JGS A;  3OYL A;  4BBR J;  3JRI A;  1R58 A;  3J7Z I;  1L3L A;  4PJL A;  5IYD J;  1JKQ C;  3F8C A;  1IV6 A;  2Y75 A;  1KYZ A;  3A2K A;  2D1H A;  5IOY A;  2Z33 A;  1Z05 A;  3RZO J;  2V9K A;  1ZGA A;  4BE0 A;  1FSH A;  5A2Q Z;  3DPL C;  4HF0 A;  1WJA A;  1D8J A;  4F3Q A;  5E1Z B;  2DAO A;  1F43 A;  4KT6 A;  4NC8 A;  3SJM A;  1VTN C;  2P6T A;  3OR1 C;  1R71 A;  3JRD A;  1VQK I;  1QRY A;  3ZQF A;  4M3G A;  4G8X A;  5IT9 Z;  2Z5U A;  2EH3 A;  2GIZ A;  2KLO A;  3ECH A;  3RKX A;  3D5S C;  1ETX A;  2ME6 A;  3TW6 A;  3F8N A;  5BMZ A;  3G73 A;  3DCF A;  1QQI A;  5LBQ A;  3L1P A;  3CO7 C;  2DJI A;  4NUB A;  4TV7 A;  3HOZ J;  2UWM A;  2IA0 A;  2QGU A;  2R3S A;  3ZQH A;  3PQK A;  4RAZ A;  2ZSH B;  1ZLJ A;  2CW7 A;  5E79 C;  3WHC A;  3IC7 A;  2KL4 A;  2CV2 A;  2EFW A;  3K4L A;  1FYM A;  4RB2 C;  4AIK A;  4QLC U;  5EJC A;  2K7L A;  2DOA A;  1J59 A;  3AL0 B;  3FIS A;  3ROU A;  1MJ9 A;  1FBU A;  4KT5 C;  3IRR A;  3FM3 A;  3M8J A;  1DU6 A;  2XSJ C;  1S7A A;  5EGO B;  4EJU A;  4L0Z B;  3S17 J;  3HPH A;  2DTR A;  4AYB N;  3MVP A;  1QA6 A;  1FMV A;  3V7S A;  3I4M J;  2WAQ N;  2HGC A;  3PIO F;  3GTL J;  1QVU A;  4Z6Y A;  2STW A;  2Q0O A;  5FKN A;  2B7E A;  3NAR A;  4Y33 A;  3SXY A;  4ZYD A;  3SFZ A;  2X6W A;  3CMY A;  4D1Q A;  3J81 Z;  1XGO A;  2QLZ A;  1BIA A;  4BJ6 C;  1YW9 A;  2EBI A;  3AG3 H;  1RR8 C;  1YG2 A;  1B59 A;  3F72 A;  1E3H A;  3PIP F;  2ZBK A;  1YX5 A;  1CF7 B;  3ERM A;  3RTR A;  2XB5 A;  5LD2 C;  2AXT C;  3PQJ A;  2QSH X;  1HF0 A;  5K7H A;  1S5L C;  2VBZ A;  1B72 A;  1S8N A;  1X1C A;  1Z3Y A;  1PP7 U;  3DTI A;  5D5U B;  1WQ2 A;  3ZQI A;  4L9T A;  4XKC A;  2CV1 A;  3CQZ J;  3I5U A;  4N4O B;  1P4W A;  2QYO A;  4U0Y A;  3WE2 A;  1POG A;  1NTC A;  1T56 A;  1IJW C;  2FJ1 A;  3GUD A;  2P7V B;  2P81 A;  3ZMT A;  4RGS A;  3FKI J;  2KZV A;  2FMY A;  4O5V A;  3IHU A;  1UHM A;  1V55 H;  3GWZ A;  2B9S A;  5HNH A;  2LKX A;  1V54 H;  1LDJ A;  3QP5 A;  1F36 A;  2K9M A;  4DW6 A;  1STZ A;  1UJ8 A;  1ON1 A;  4XRM A;  1BR4 A;  4XSZ F;  3U1K A;  1XD7 A;  2EIN H;  2KFD A;  4C9Y A;  5GAD J;  4M73 A;  5BPI A;  3AG2 H;  2NS0 A;  3CZ6 A;  4L18 B;  1ZQ3 P;  1ZLK A;  1G59 A;  4XLP F;  5B1A H;  4IXA A;  4LB5 A;  5LHH A;  1YFH A;  1UG2 A;  3CP8 A;  2VQG A;  1K6O A;  2QBY B;  1B6A A;  3HKZ A;  2Y48 A;  1OR7 A;  5CVR A;  1OJL A;  3I56 I;  4Y7N J;  2W7N A;  3C3W A;  2D45 A;  2ZXW H;  5EG0 A;  2KIF A;  3JRE A;  4E7J A;  3I4N J;  1B4A A;  5TJJ A;  3C2H A;  2CV0 A;  3HDD A;  2EIJ H;  3U1D A;  1IW7 F;  1WSU A;  1WGX A;  2FML A;  2LBF A;  3U2R A;  2ADU A;  5BPD A;  2V79 A;  3LQR A;  1TNS A;  4L9N A;  3X2Q H;  4DZP A;  5D5V B;  1JHF A;  3KX2 A;  3BR1 A;  3L2R A;  1O3R A;  3N4M A;  3TL4 X;  2GXB A;  1W4M A;  1SC7 A;  4RS8 A;  1W5T A;  3W3C A;  4NNJ A;  4HSR A;  1A31 A;  4FX0 A;  2VB6 A;  1RES A;  2UUZ A;  3BQZ A;  1H9T A;  2MGQ A;  4MTD A;  2AS5 F;  3R0A A;  5HLT A;  1TWH J;  5LEK A;  3FKJ A;  2OD5 A;  2LG4 A;  3HHG A;  1JKP C;  4YFN F;  2P0W A;  2XGC A;  2GOM A;  2DO7 A;  1ETO A;  1MBJ A;  1IN5 A;  3R0J A;  3CCS I;  2JUC A;  1FBQ A;  4BDY A;  4HF1 A;  3GTG J;  4FX4 A;  4O6J A;  5DM6 F;  1R5H A;  3CUQ C;  4E7I A;  1W0T A;  1UST A;  2HFH A;  1B8I B;  3D5L A;  4P9F A;  1KQ0 A;  2XV4 S;  1YI2 I;  5DUI A;  2W00 A;  3CD6 I;  4KFC A;  4BHP A;  2W57 A;  2WY8 Q;  1R9T J;  3CDI A;  1GVJ A;  2F5F A;  3CES A;  2K86 A;  1RIO H;  3O6B B;  5DCF A;  3EYI A;  1XMK A;  1P2F A;  4FIS A;  3ZMV A;  3LSG A;  4AWX B;  1DU0 A;  2E2I J;  2CMP A;  2Y2Z A;  4P55 A;  3MKW B;  5M5Y J;  4A3L J;  2KJB A;  2XIG A;  1PDN C;  2M0M A;  3LSI A;  1LUJ B;  4F91 B;  2M9H A;  1MDM A;  2Z9O A;  3BZC A;  1FTT A;  1XGN A;  3HPG A;  1LEB A;  2KRH A;  3S3O A;  4BQN A;  2DTZ A;  3IAS 2;  2FNP A;  4L5J A;  4ESF A;  3BTI A;  5H2F C;  1WJB A;  3BR0 A;  2RQQ A;  3MZH A;  4C2U A;  2G7U A;  3KCC A;  4E6K G;  5EGO A;  4BS9 A;  3JSO A;  3K69 A;  1IZ1 A;  2IBD A;  3NQO A;  1OPC A;  1VFC A;  2XAJ A;  1BBY A;  2IGO A;  3T1B A;  2ECC A;  4XSX F;  3CCM I;  4EJW A;  3F6O A;  2FEZ A;  1OCT C;  2I5U A;  2NVY J;  5K7Z A;  2YR2 A;  1YS7 A;  3DEU A;  4NDL A;  5HDK A;  3B02 A;  3KZI C;  1KU3 A;  4NQW B;  5LRR A;  2WB1 N;  1FX7 A;  2IVM A;  3I0T A;  3RYP A;  2XB0 X;  1CF7 A;  1WH7 A;  4PJJ A;  3HRM A;  4HAM A;  2HXI A;  1TBX A;  1V5F A;  3BP8 A;  1YIJ I;  2FA5 A;  4MO7 A;  4D5C A;  1IXS B;  1QGP A;  3Q9V A;  1B9M A;  4X6A J;  2AQF A;  1X58 A;  1H88 C;  2JMW A;  4KMU X;  1SD7 A;  1MND A;  4B48 A;  5F0C A;  3PNY A;  3S1R J;  2Z2S B;  1P6R A;  3RCO A;  3FBI B;  1OCP A;  3ZQG A;  2HU9 A;  4CH7 A;  4BUP A;  2O8K A;  2F5D A;  3KEY A;  2J5O A;  3ZR8 X;  3GX4 X;  3HBL A;  2E36 A;  1MBF A;  1MBG A;  2KPM A;  1X1B A;  2PX9 A;  3FXJ A;  2MW8 A;  1HOM A;  3ZGK A;  1UZC A;  2WV1 A;  3H5A A;  1X4P A;  2M5W A;  3OYB A;  2YU9 J;  2VJI A;  2R4G A;  4MFD A;  1ZGJ A;  2ZJR F;  4EGY A;  5IP9 J;  2BY2 A;  4UV8 A;  4BXU A;  2LY1 A;  1LPQ A;  3GFM A;  2ZJ2 A;  2JVG A;  2E2H J;  4D7M A;  2LLK A;  2R7O A;  3K6G A;  4BGD A;  3DLL F;  2P5L C;  2IA2 A;  4LG0 A;  1X3U A;  2M30 A;  1VND A;  4A6D A;  4OIN F;  2KIS A;  4CYC B;  2XPU A;  3JRB A;  3LNQ A;  1U0J A;  3PL8 A;  1ETY A;  2R5Y B;  2ECB A;  3HG9 A;  3L2W A;  4B1R A;  3B73 A;  5CJ9 A;  3ZXS A;  5B3S H;  1KQ8 A;  3FXQ A;  3BG6 A;  5J3L A;  4UVC A;  1ORK A;  3HTS B;  5GAH J;  1RZ4 A;  4UUS A;  1FBS A;  4Y17 A;  3AAF A;  4FHT A;  1RKT A;  1ZAR A;  1FP1 D;  5K5R A;  4OIO F;  2QEX I;  1SAU A;  2ACJ A;  2A68 F;  1PP8 F;  2FE3 A;  2CQX A;  2CGP A;  2OC6 A;  1VF9 A;  1X1A A;  1W0U A;  4R1H A;  4AVZ A;  1YX3 A;  4PJM A;  1GV5 A;  4S0H B;  1IG7 A;  2RV8 A;  2CUJ A;  3QU6 A;  2XC7 A;  1T98 A;  2RVC A;  4F52 A;  2IXS A;  3CDH A;  2BVL A;  4FET A;  4I2O A;  1AOY A;  1D0X A;  3CCR I;  2RKH A;  1AA7 A;  3E3V A;  5TIS C;  5E1X A;  4IVN A;  3R4K A;  5GPA A;  1D3Y A;  2EFN A;  4IHX A;  1MMS A;  3HSR A;  3SDB A;  5CVI A;  1HBX G;  2FRH A;  2FQ4 A;  2WAE A;  4KIG A;  3GFI A;  2XUB A;  3LL7 A;  4CXF A;  2H1K A;  1M1E B;  3WGG A;  4BEH B;  1MKM A;  1WJC A;  3DBL B;  5A2Q K;  3OYE A;  2ELH A;  1A35 A;  3IH4 A;  2E60 A;  5F1J A;  4LB6 B;  1VQO I;  3J7A Y;  4XOP A;  2HS5 A;  1W7P D;  5L3D A;  1NK2 P;  3H9J A;  2VPR A;  3ECO A;  3I64 A;  4BQA A;  3HYI A;  2VC1 A;  3ABT A;  4CO8 A;  1FC3 A;  4C2T A;  3WG7 H;  1XDS A;  3KP4 A;  2O03 A;  2IT0 A;  5E3O A;  4PCQ A;  3V4G A;  3SZG A;  1VZ0 A;  1Q1V A;  2EZI A;  4FCY A;  2K9N A;  1LDK B;  2BE5 F;  3QOP A;  5K7F A;  1I1S A;  4M6Y A;  3DXJ F;  4BHC A;  2X0L A;  5EZH A;  2TRT A;  4ENM A;  1FOW A;  5IP7 J;  4CCN A;  1F5T A;  4HG2 A;  2DK5 A;  2NNN A;  4A69 C;  3HTU A;  2XGD A;  4RA2 A;  4WX9 A;  1O3T A;  3KP3 A;  4EAT A;  1QZY A;  2R7F A;  1QBJ A;  5IT3 A;  4XLA A;  3T8T A;  1W5S A;  2GA2 A;  3M1E A;  3RKQ A;  4BQO A;  1WJE A;  2K3P A;  3BWG A;  3MZ8 A;  1LFU P;  1T8I A;  4J00 A;  3ESW B;  4KN7 X;  1FT9 A;  2GAU A;  2KIM A;  2RRE A;  5HVQ C;  1D5V A;  3TO9 A;  2PMU A;  2LRD A;  2DA5 A;  2ZXH A;  3K1M A;  3E5U A;  4DNC A;  3HOU J;  2ZKZ A;  3R60 A;  1S3J A;  4NQW A;  4C3J J;  4K2E A;  2Y9Y A;  2XPV A;  1BI3 A;  2NNY A;  2X9D A;  2OUM A;  4II2 A;  3CCQ I;  2W4S A;  5J8F A;  2DA6 A;  3WTT C;  1T95 A;  3RSN A;  4YG2 F;  1ZRC A;  2G0E A;  4HBL A;  4G12 A;  1OYW A;  4B3X A;  3DTK A;  4C2M J;  3K1N A;  1T38 A;  4GFB A;  2PMH A;  1ZGW A;  2E1M C;  2A6H F;  4LLL A;  2EZK A;  1SFX A;  4IRI A;  2V1U A;  1X3W B;  3ABM H;  3LMM A;  3LAP A;  1ZYR F;  1BW6 A;  4IOC F;  1HKS A;  2VIX A;  4KMF A;  4G7H F;  1D5Y A;  3PO2 J;  1UMQ A;  3C2G A;  4OOI A;  4J19 A;  5DM7 F;  2MLK A;  3KPH A;  1KU7 A;  2KIQ A;  3CF5 F;  1JXS A;  5D6F A;  2BXY A;  4UVA A;  3F8B A;  4XID A;  1XCV A;  2RC4 A;  4ABZ A;  4M9S A;  2EIL H;  2DFE A;  3H35 A;  2EZH A;  2FXA A;  3W6K B;  3CC7 I;  3QYE A;  2R7U A;  4II3 A;  2Z99 A;  4M3D A;  1PUF B;  1CQT A;  4HYE A;  4KIC A;  4XR6 A;  1K78 A;  3HHH A;  3LST A;  3O8H A;  4B43 A;  2ZME A;  3S1Q J;  3OL4 A;  1Z7U A;  3BY6 A;  3GYH X;  2COM A;  4Z2Y A;  4EM2 A;  2W85 A;  3DKY A;  4FE4 A;  4CYC A;  2LK2 A;  1ACI A;  2IGN A;  1RUN A;  5FO5 A;  5E17 F;  1B72 B;  3K70 C;  4JBA A;  1W36 C;  1QPI A;  3O2P E;  1T0F C;  2K9L A;  5FFX A;  4YIF A;  4W1U A;  3GME A;  2ID3 A;  5GPC A;  5TRD A;  2M1B A;  3HJE A;  3JR9 A;  2VE9 A;  1U8B A;  1MSF C;  4E70 A;  3D5R C;  2NYX A;  1T2K A;  2DT6 A;  2LNB A;  3VFZ A;  3DBH B;  4RAF A;  2MLG A;  3R61 A;  2QQA A;  3OYH A;  1PVE A;  2L4A A;  2UXX A;  2VE8 A;  5HS9 A;  4B09 A;  2HDC A;  4PGG A;  1FMW A;  1U9N A;  3IUO A;  3WGH A;  1IN4 A;  2BZT A;  3C1D A;  4BE2 A;  2DQR A;  2Q1Z B;  1XC5 A;  3KP5 A;  1OKR A;  2ZXI A;  1TQP A;  3ONQ A;  2NVU B;  2XHK A;  4CCO A;  1MJA A;  2X4H A;  3CJR B;  5CVV A;  1BC8 C;  2DA7 A;  1EA3 A;  1T33 A;  2YU3 A;  2L0K A;  3I71 A;  3WG9 A;  5J1U A;  1S72 I;  2QCO A;  5HDG A;  1SMY F;  4IO9 F;  2XAU A;  4QSH A;  2K9S A;  2ZFU A;  2VT3 A;  4D7N A;  4XOR A;  4A0Z A;  1R1U A;  2KIU A;  2LTP A;  1OIS A;  4IHT A;  2JTV A;  3EUH A;  2KRC A;  1K61 A;  1ETQ A;  3I58 A;  4CUG A;  4I09 A;  3RPQ A;  4IHW A;  3E6M A;  1XSD A;  1ZG3 A;  3L2V A;  3ABK H;  4DYC A;  2JA8 J;  2A61 A;  1SD5 A;  4DBQ A;  3H3V K;  3HOX J;  3MCZ A;  2YPR A;  1P4A A;  1RUO A;  2A5Y B;  3GTQ J;  1Z1D A;  3LFK A;  9ANT A;  3HOY J;  3ZN1 A;  2RN7 A;  2HTS A;  3BZK A;  3I3L A;  1EH7 A;  4AM3 A;  1FP2 A;  3FIW A;  2JZY A;  3K9T A;  5AON A;  2VI6 A;  4ZDP A;  2VBW A;  4CHU A;  1GV2 A;  3CF2 A;  2DI3 A;  1VQ7 I;  4A3I J;  5E3L A;  2VJ4 A;  4EMS A;  5J4Y A;  4ETS A;  1Y8R B;  3CCJ I;  3KEO A;  5GAE J;  3DP7 A;  1QHH D;  4L9J A;  3MWM A;  3S2W A;  5C3E J;  3OYJ A;  2CSO A;  1R49 A;  3A1Y A;  2V1D A;  4BQQ A;  3OYM A;  3AL0 C;  2RAE A;  2M7B A;  2EV5 A;  2Y0S A;  2FUG 2;  1KU2 A;  3E0J B;  3D1N I;  4AIJ A;  1YW7 A;  5FRO A;  1R22 A;  3DV8 A;  1AHD P;  4HQE A;  2H6C A;  1VQ5 I;  4AIH A;  2G9W A;  2LR8 A;  5J47 A;  1RI7 A;  4A3D J;  2JT1 A;  1SD4 A;  4IQJ A;  1G4D A;  1ONV A;  5LHI A;  3BG5 A;  5FD5 A;  1OYY A;  4LK1 F;  3VYR B;  5C4X J;  2R7R A;  4BDZ A;  2XAG A;  3LSP A;  4E7H A;  2JK3 A;  3MKZ A;  4HEA 2;  3FXR A;  1JUM A;  1OFC X;  4XK4 A;  3P5J A;  5LRS A;  1W5C C;  2PEX A;  4XN0 A;  1TW2 A;  5L3E A;  2ISY A;  2PFB A;  4UUT A;  1TWG J;  1WKM A;  2A69 F;  2N8G A;  2VON A;  1A6I A;  4DQ2 A;  3ZP5 A;  1JJ6 C;  2HZT A;  2BY1 A;  2L9V A;  2V4J C;  4GYG A;  4CCM A;  2FSW A;  3RQI A;  1LQ1 A;  4ZYH A;  4RB1 A;  2BY3 A;  4M3F A;  1MDM B;  2L9N A;  2Y9Z A;  1TW3 A;  1B1B A;  1LVK A;  2DDB A;  1N75 A;  3KYL A;  3VEP A;  3ZRG A;  2QSF X;  1FOX A;  1YTY A;  2HYG D;  4AUX A;  1E2X A;  4G9Y A;  4ZDO A;  1Z91 A;  3I53 A;  2R0Q C;  1FOK A;  1HDD C;  4CCJ A;  1MMD A;  1BA5 A;  1Q1H A;  2BW3 B;  3BR2 A;  3CJN A;  5DTD A;  2HKX A;  5DCM B;  2QF7 A;  4AC0 A;  5DD8 A;  4ANJ A;  2E34 A;  4G94 A;  2IEK A;  3KP2 A;  1BIB A;  4LLG F;  1O7L A;  2CO5 A;  1TT0 A;  1MMA A;  1IDY A;  2F5C A;  4LOC A;  4O3M A;  4EM0 B;  2LP0 A;  3GTJ J;  1TQI A;  2LF8 A;  2RNJ A;  2VQH A;  3QYB A;  2IS6 A;  1V5G A;  5JI6 A;  1EF4 A;  3K2Z A;  4N9I A;  2W24 A;  1WVR A;  2LC2 A;  2EA4 A;  1YJ9 I;  3MKL A;  3FMR A;  3IKT A;  1PUF A;  3BT9 A;  3V8J A;  1I1G A;  3JAM K;  5EEA A;  3DF8 A;  2FOK A;  2BVM A;  3QOE A;  2PLY A;  2Y30 A;  2TCT A;  3FF5 A;  5B5E C;  2DA4 A;  2KQR A;  3OSF A;  2IS1 A;  5D6E A;  3CDL A;  1A6Q A;  5LEJ A;  2L9S A;  3FWE A;  1E17 A;  1JT0 A;  4Y13 A;  4GGG A;  1IRF A;  3MAJ A;  1QU3 A;  3ZN0 A;  3E6D A;  1LE8 B;  4Q4Z F;  3W6V A;  1K4S A;  3QPL A;  4XQF A;  2HQR A;  2WAF A;  3FM5 A;  5FRM A;  3UNG C;  4RMN A;  5JLX A;  5KK1 A;  1TLH B;  1YRN B;  2NOG A;  5E18 F;  1D0Y A;  4I0A A;  3VDX A;  1Z67 A;  2XF6 A;  2JA6 J;  4KNY A;  3EDP A;  4F55 A;  1BI1 A;  4LD5 A;  4PZJ A;  1DPR A;  5KHD A;  2ELK A;  3TDZ C;  3NAU A;  4QWQ A;  2VN2 A;  1YE9 A;  1KGS A;  3MZY A;  3OV8 A;  1HLV A;  2PJP A;  4YIR X;  1NHA A;  4XKW A;  1C0W A;  3H3U A;  2QZ8 A;  3E5X A;  3EUA A;  3S2D J;  4UNO A;  4MEY F;  1U5T A;  3CP2 A;  4HDV A;  1I6X A;  2TDX A;  1MMG A;  4LG0 B;  1ZG5 A;  2OA4 A;  3M07 A;  3DBR B;  2VJJ A;  4A0Y A;  2R5Z A;  3JRC A;  5FKK A;  4Y52 J;  2DN0 A;  1FNN A;  2JVH A;  2P5K A;  4UXN A;  1ON2 A;  2F5V A;  3TKY A;  2BOL A;  2GBY A;  5BNG A;  2VXZ A;  4OMY A;  2IA1 A;  4RB3 C;  3G1M A;  4UUS B;  3JCU C;  5CKT A;  2O8X A;  4Q5S F;  4R79 A;  4JOM A;  1WRJ A;  3IV5 A;  2E5Z A;  3OYA A;  4CZC A;  5F1R A;  1K79 A;  1W1W E;  1HW2 A;  5CQG A;  2PG4 A;  2M8G X;  3K7A J;  2L9R A;  5TGT A;  4PK4 A;  4IHS A;  2HR3 A;  1JE8 A;  3OYD A;  2M45 A;  2A3S A;  1K7A A;  3U9G A;  1XMA A;  2A5W A;  1NG7 A;  1IRG A;  3H3Z A;  3W2W A;  1FYL A;  2B63 J;  1G8X A;  2WTE A;  1DP7 P;  4XM3 A;  5LGU A;  2VQC A;  2R7T A;  2YS9 A;  4PJ0 C;  3RDI A;  2X6X A;  3E6C C;  1MBH A;  5ERI A;  1MH3 A;  3BJO A;  3FXM A;  1X19 A;  4N4N B;  4EJV A;  4ZZD A;  2IAI A;  3FK6 A;  3HXL A;  4M6V A;  3LA2 A;  3F6V A;  2I8D A;  4IHV A;  3K4J A;  3ABU A;  3V42 A;  4C3I J;  2CW0 F;  3CJQ B;  4BKX A;  4JP0 A;  3DPU A;  3L00 A;  4GYI A;  1HW1 A;  2MFZ A;  4H4K C;  4I98 B;  2XAS A;  3PSI A;  5JVG F;  2DW4 A;  3IWF A;  3MD2 A;  1BR2 A;  1IN8 A;  1R4N B;  4D5F A;  3SZT A;  1A5J A;  3B6A A;  1WHU A;  2AXL A;  4IEJ A;  1DPU A;  4N9H A;  1MIJ A;  4X1E A;  1VQ9 I;  1Z3X A;  3SQN A;  3RPU D;  4A0X A;  4XRS A;  2F4O B;  2Y0M A;  3FXO A;  1MBK A;  5D8K B;  2RGV A;  4MIM A;  2X85 A;  5E3M A;  5J6X A;  4IKF A;  4I99 C;  3MKY B;  2BW3 A;  1A04 A;  5DCM A;  4UV9 A;  3O3K A;  3DKW A;  3S15 J;  2WAD A;  3JTH A;  2NXN B;  1NK3 P;  2L7K A;  3JSP A;  1I50 J;  3GXO A;  2PMZ N;  2L3D A;  2UV1 A;  2JWT A;  4WF2 A;  2Z16 A;  2QKL B;  1G3S A;  3IL2 A;  2MSY A;  4U88 A;  2HOA A;  3BDD A;  2OBP A;  3OYG A;  1LNW A;  3BTJ A;  1ENH A;  3MQ0 A;  1VQ4 I;  3F3X A;  3AG4 H;  3KFW X;  3WTU C;  1KA8 A;  3DEE A;  3PNV A;  1Y56 A;  2ZME C;  5EDN A;  4KDP A;  5LFA A;  5HLH A;  3CCE I;  4OAZ A;  4UY8 I;  1VQ6 I;  2E35 A;  1DP3 A;  2NVT J;  3WTX C;  4PDK A;  2H8W A;  3Q0W A;  2W1O A;  4A5M A;  3BJA A;  2LF7 A;  2ZO4 A;  2CS3 A;  3CME I;  1LE8 A;  2QVO A;  2EV6 A;  2VKV A;  2MC4 A;  4A3B J;  1UEL B;  3M1C A;  3V8K A;  2MYS A;  2O3F A;  3TED A;  2L01 A;  2DYS H;  3BOQ A;  1SFO J;  3HSF A;  2IGK A;  1YRN A;  1H8A C;  2XRL A;  1LFB A;  1Y6I A;  2AHQ A;  3JAM Z;  2HTJ A;  4M3E A;  3ZMD A;  5DYM A;  3TMO A;  2FU4 A;  3EQL F;  3VYT B;  2HPI A;  3EYY A;  1Z9C A;  1WPK A;  2LDU A;  1BJA A;  4HNU A;  1DQU A;  1ZRF A;  2X48 A;  5J40 A;  4LFU A;  2HNH A;  4AYB A;  4MTE A;  3H9Q A;  2DYR H;  3W6J B;  5CPR B;  1XS9 A;  3L2C A;  5DUK A;  1N25 A;  1K6Y A;  2HXO A;  4JK1 X;  4V2G A;  3CMA I;  3H5N A;  1IXC A;  3S2H J;  2EIK H;  4IZZ A;  1K78 B;  2ZME B;  2UZK A;  5GTH C;  1F4K A;  1RR7 A;  3DFG A;  2E7W A;  5CVJ A;  2VT2 A;  3QYF A;  2XDV A;  3NWT A;  1QPM A;  2DA2 A;  3ZCO A;  4FAS D;  2KZG A;  3R6S A;  1HKT A;  1SD6 A;  3GTK J;  5H20 A;  4BU2 A;  1ZH5 A;  3A4C A;  1XCB A;  4UB6 C;  4RM3 A;  4QPQ A;  2DU9 A;  2NOJ B;  4MEX F;  2GOX B;  1SAN A;  1IRX A;  2NAZ A;  3EUH C;  4F7Z A;  2CFX A;  1D0Z A;  3JRA A;  5ICC A;  1R1V A;  3GFL A;  3GW2 A;  4H0E A;  5HOO A;  1NH3 A;  2ME0 A;  4Q47 A;  2EB7 A;  4EEF G;  5KAF C;  2F6C A;  3GF2 A;  2KDZ A;  2VUM J;  1LDD A;  2GXG A;  5FFZ A;  5EZG A;  1EH8 A;  3VB2 A;  4EM1 A;  2ICW G;  1RKW A;  5JR3 A;  2FBH A;  2L7Z A;  2VL8 A;  1MH4 A;  3CCU I;  2OZU A;  4IQ4 A;  1U6G A;  2H8R A;  3KYC B;  1OCZ H;  2QUF A;  3K2A A;  3OR2 C;  3IH3 A;  2LH9 A;  3P9K A;  1Y39 A;  4V19 K;  1LKX A;  4DYR A;  1JI8 A;  4E7K A;  1BI0 A;  2DFI A;  1I6H J;  4BY1 J;  2KKO A;  4UB8 C;  4OIP F;  2R92 J;  4IPA A;  2HQA A;  5IY5 H;  3K10 A;  1HC8 A;  2DPD A;  4LMY A;  1DUX C;  2ESH A;  3G4S I;  5KNL A;  4ZYG A;  5K5O A;  2V9P A;  4B47 A;  2BXZ A;  3FXL A;  5JVT A;  2P6S A;  2LMD A;  3OY9 A;  1HST A;  1SVL A;  4Y4R A;  4XLC A;  2OTL I;  3UKG A;  5KCM A;  1ERD A;  1USS A;  4S04 A;  3HOS A;  1ZK8 A;  1G3T A;  3QPS A;  5DEQ A;  4FT8 A;  4RLQ A;  4XOT A;  4LK0 F;  1WJD A;  4CCK A;  3SFI A;  4MQV A;  4EJT A;  2LY2 A;  1FJL A;  1YIO A;  1J9I A;  1I5Z A;  3DWL E;  3OYF A;  1ZR2 A;  2CUE A;  2H09 A;  4RGU A;  5IYC J;  1OMI A;  2JPC A;  3Q3S A;  1J7K A;  2JA5 J;  2D5V A;  3PFY A;  3OSG A;  1R36 A;  1UHS A;  1HKQ A;  3PJR A;  2V1X A;  4E7Z A;  2VKH A;  1YLF A;  1GXP A;  5HNF A;  4ZTJ A;  2EQR A;  2WC2 A;  3K4N A;  3QPT A;  5HS7 A;  2ZJP F;  3PNT A;  2EK5 A;  2F48 A;  2L54 A;  2XF7 A;  3HRT A;  1BW5 A;  3AG1 H;  2DOF A;  2O0Y A;  1TT5 B;  3GBG A;  2NS7 A;  4J01 A;  3A0H C;  3EET A;  3KET A;  3BLY A;  1OCC H;  5C44 J;  1O7F A;  1JKO C;  3H36 A;  4ESB A;  1HSJ A;  3CUQ A;  4W97 A;  4ENK A;  4BBS J;  4AD9 A;  1I3Q J;  1JTY A;  4F93 B;  3H0G J;  3TOA A;  3S1N J;  4HDU A;  4KIF A;  3WTW C;  4WCG A;  3ABL H;  1ZAO A;  5E8G A;  4IOA F;  3K70 D;  4Y15 A;  2KT0 A;  3WHB A;  1G6N A;  4LIT A;  1W36 D;  3TDU C;  2IRF G;  3ULQ B;  2EJR A;  3S14 J;  4A93 J;  5F6F A;  1Z7L A;  3N05 A;  4A3J J;  3ZQC A;  2W48 A;  4U87 A;  3F0C A;  3L9F A;  4M74 A;  5AIP A;  1XDU A;  2WY7 Q;  3P9I A;  3QPH A;  4CA0 A;  2QA4 I;  1PYV A;  3LSH A;  3JRH A;  2HVQ A;  1XN7 A;  4BXX J;  4JX5 A;  3WE3 A;  2XVC A;  3JTG A;  3CCY A;  1MGT A;  1X4O A;  2ZSI B;  5FB2 A;  2OCE A;  3ISP A;  5J8C A;  3CC2 I;  2FQ3 A;  3QWL A;  1O3S A;  1AKH A;  2LOO A;  4LIV A;  3AFH A;  4GO1 A;  3RI4 A;  2E1O A;  1WJF A;  5DDG A;  2DDA A;  1YQA A;  1MW7 A;  4BYY A;  2ELJ A;  2HOE A;  2LVS A;  2JSC A;  3LA3 A;  4QTR A;  3ZQQ A;  3HRU A;  3C18 A;  3M8E A;  3BCB A;  1ZRD A;  2PJR A;  3GZN B;  4KUM A;  5D5W B;  3KP7 A;  1U9O A;  2WB1 A;  3DU5 A;  3QU3 A;  3W2A A;  2XAQ A;  1U5T C;  2DT5 A;  1KQ9 A;  3OOP A;  5F0F A;  2R7W A;  4I6Z A;  4HRI A;  4HV6 A;  1W7P B;  1YO5 C;  1T6S A;  1OR7 C;  2OAZ A;  3F21 A;  3W2V A;  3HKZ N;  3TP0 A;  4PFO A;  3RQ4 A;  2FBI A;  1TC3 C;  3J7Y J;  3LSK A;  3RPU A;  4P1W A;  4HNT A;  1I27 A;  3A02 A;  5IPA A;  2DA3 A;  3MN2 A;  2HWV A;  2X1C A;  1Y8Q B;  2DJN A;  1E3P A;  2NRA C;  4E7S A;  2EFO A;  4EVI A;  2D2W A;  2KDO A;  3F22 A;  3BG9 A;  2BEO A;  3VPR A;  4NC6 A;  2L5Q A;  2ZB9 A;  1IXR C;  4IL6 C;  4JX4 A;  3EUK L;  1O4X A;  4PSW A;  3H0D A;  2G7H A;  4CIC A;  3L2U A;  2K85 A;  2LSO A;  1DDN A;  1X3Z B;  1FPQ A;  2JN6 A;  3GO5 A;  1WJ5 A;  3GTP J;  1G2H A;  1U5T B;  5ICF A;  1J75 A;  2DMQ A;  2M0C A;  2OTJ I;  3RJP A;  2LKP A;  5BS6 A;  3WTV C;  4ENJ A;  4HX4 A;  2HPM A;  2BY0 A;  3JW4 A;  2R5Z B;  1Y1V J;  3BG7 A;  4JQF A;  2W82 A;  4OIR F;  4A3G J;  2PQ8 A;  4NB5 A;  4L5E A;  1N78 A;  3NRV A;  3OYK A;  1BOA A;  4D9J A;  4BL0 B;  1X1D A;  1GXQ A;  4ZH4 F;  1XX5 A;  3ZQL A;  1D1A A;  2K02 A;  3I59 A;  4BJ5 C;  5JHU A;  4PFP A;  1BOB A;  2Z3Y A;  2CRG A;  3KLO A;  4G7Z F;  1T39 A;  1FTZ A;  4OWR B;  3GVA A;  4XLH A;  3RIR A;  3OIQ A;  1J5Y A;  3J7A O;  1XTA A;  2DFF A;  3A0B C;  3DKX A;  2XGE A;  1EV7 A;  3PFI A;  2ISZ A;  1TWA J;  3HM5 A;  4G6T B;  1UB9 A;  3HGY A;  3FK7 A;  1TZL A;  4XMY A;  5F0H A;  2YX4 A;  1QVT A;  1ETK A;  5L3C A;  2HVS A;  2RDP A;  3NEU A;  4Y3O A;  1SFK A;  4KJZ A;  3VOE A;  4YRV A;  2DOE A;  3ZPL A;  3OMY A;  4WXC A;  4L5I A;  1R00 A;  2QQ9 A;  3ZMS A;  5FLV A;  1ETW A;  1ZHF A;  1GT0 C;  1VI0 A;  3KZY A;  3L09 A;  4FQG A;  4JX6 A;  2ZJQ F;  2DMT A;  2BHZ A;  1HW5 A;  2XF5 A;  2DA1 A;  2UXN A;  4E4H A;  3LA7 A;  4V2F A;  3D0S A;  1IC8 A;  4GXO A;  5KAI C;  2ZNZ A;  4HOB A;  3FMS A;  1H9G A;  2R7Z J;  3CTA A;  5L3F A;  1HCR A;  1U3E M;  4BNC A;  2IW5 A;  1XGM A;  1MZB A;  3IP4 B;  2AO9 A;  2K40 A;  1DGW Y;  4ZZL A;  3SDG A;  3JRF A;  1JUP A;  2IS4 A;  4M6X A;  4ESJ A;  3Q5F A;  5HOD A;  4XRS G;  1EH6 A;  1V5E A;  3QQA A;  2P7C B;  1S7O A;  1VQP I;  2JRM A;  1R6R A;  1GDT A;  2VC0 A;  1BN5 A;  2Q8K A;  3JRG A;  4N0B A;  2FX0 A;  3GTM J;  2JRT A;  1SAX A;  4MLO A;  1EJ9 A;  4QPO A;  3BZ6 A;  4WWC A;  5B66 C;  3KE2 A;  1MNM C;  2CU7 A;  5FLX Z;  1I3A A;  2YX7 A;  3C7J A;  5KVR A;  3PUB A;  3V7C A;  2OPT A;  3VYU B;  4QIW N;  1T08 B;  4ON0 A;  3BPV A;  3FXU A;  1S6L A;  1S9H A;  1YYV A;  4R8H A;  2BV6 A;  3DU6 A;  3H5R A;  3PSF A;  2ESN A;  2CQQ A;  2QEN A;  5IYB J;  1ULY A;  2XAF A;  3HIF A;  1TNT A;  4P96 A;  2DK8 A;  2NVQ J;  3BR6 A;  2VLA A;  3CO6 C;  2P8T A;  3ML6 A;  4XKB A;  3OS0 A;  2MA3 A;  2XPW A;  1JJ8 C;  3GEZ A;  1IF1 A;  1IAW A;  1B9N A;  1TTY A;  2JSP A;  1CGP A;  2ZNY A;  3FMQ A;  3WGI A;  2HOS A;  2VPL A;  2OQG A;  3E6B A;  4I76 A;  1JT6 A;  2FF4 A;  4EGZ A;  4ZTF A;  1RNL A;  2L7M P;  4L0Y B;  5D8L B;  1W7P A;  3M4O J;  3REO A;  2CQN A;  2CG4 A;  5E8I A;  2HZD A;  3S16 J;  3BQY A;  4BXF A;  4KIB A;  3LOC A;  3FXK A;  1OCO H;  1OLT A;  4WXH A;  3OYC A;  1XSV A;  3GZ5 A;  4ZC3 A;  1KON A;  4NBQ A;  2Q2E A;  2IGM A;  2X1D A;  4L9V A;  1WI9 A;  5LGN A;  2K3F A;  1TP4 A;  3A01 A;  2WWY A;  2A07 F;  2DFH A;  1UCR A;  2JUG A;  3Q0U A;  4NHJ A;  4ZJZ A;  1UAA A;  4AU7 A;  2VKD A;  4RAG A;  1ZG1 A;  3O8G A;  4XN3 A;  3BC8 A;  3NWS A;  2GZW A;  2OZ6 A;  1L0O C;  1JTX A;  4P9U A;  5L3G A;  5K5Q A;  1Y0N A;  1MSE C;  3KP6 A;  5EYR A;  4UHT A;  1AWC A;  3A03 A;  2HI3 A;  3SYT A;  2EFQ A;  2VAS A;  3IWZ A;  4G7O F;  1HDP A;  2F5E A;  3ASN H;  1Y0U A;  4RDU A;  5D4R A;  1PJR A;  4UVB A;  2E71 A;  5EEG A;  5FKM A;  3BR5 A;  3FBN B;  1JUS A;  2EA2 A;  1LB2 A;  1UFM A;  4LJZ F;  2PN6 A;  5ILU A;  4HLX A;  1ZR4 A;  4IRH A;  1FY7 A;  4A2U A;  2GIV A;  2DMN A;  3SZP A;  3K1P A;  1Z6R A;  3G71 I;  3J80 Z;  1SMT A;  2A6E F;  3LWF A;  2STT A;  2D1V A;  4B4C A;  3GLL A;  1HA8 A;  1MD0 A;  3P7N A;  5J4V A;  5ILS A;  3TBI A;  3B6C A;  4XLE A;  2I10 A;  3ASO H;  1P4X A;  3DLA A;  2A05 A;  5BQT A;  1GUU A;  2DXI A;  4RB0 A;  4HA8 A;  2XSD C;  1T0F A;  1VQL I;  3F9K A;  2R93 J;  2M7A A;  2QSG X;  3F8M A;  1BI2 A;  3S8P A;  4EV0 A;  5HLG A;  2WBM A;  2V9V A;  5FGM A;  4JYK A;  1OYI A;  2O61 A;  3LSM A;  3HRS A;  3OYI A;  3S1M J;  2W84 A;  3LSJ A;  4F92 B;  4XLN F;  3RKW A;  2P5V A;  3RZD J;  2QKM B;  5FRN A;  5JLW A;  2OU2 A;  2OCC H;  1TQM A;  1D1B A;  2E19 A;  2J5P A;  1RET A;  4XL9 A;  4U0W A;  3T0Y A;  3K4C A;  4U7D A;  1JGG A;  1BC7 C;  1FWZ A;  2PBI A;  5FD6 A;  2M87 A;  2CH0 A;  2COB A;  3VOD A;  4OU0 A;  2BYV E;  2CUF A;  3PM1 A;  2QM3 A;  4OAY A;  2R7Q A;  2VOO A;  2R7V A;  2Y31 A;  1ETV A;  1REP C;  5K1Y A;  1S7E A;  2H1L A;  1TL8 A;  3DPT A;  3IH2 A;  1I39 A;  2LFB A;  2X6Y A;  4RGR A;  2CUZ A;  1XG1 A;  1MMN A;  2R7X A;  2CQK A;  5ICG A;  1NG6 A;  1U8R A;  3I55 I;  3SEZ A;  4CDG A;  3I9V 2;  3WOD F;  5D5X B;  4I02 A;  1GHC A;  2QWW A;  5M5W J;  3SHF A;  1FLI A;  4MNU A;  1GVD A;  5M3M J;  5E20 A;  3OS2 A;  4WK8 F;  1H89 C;  2E1C A;  2H6B A;  2L4M A;  1UG0 A;  2IP2 A;  3LAJ A;  4A3E J;  2PI0 A;  1IDZ A;  2FBK A;  5BOX A;  4RGX A;  4ZYA A;  3MMY B;  3CCL I;  5FLM J;  2GA1 A;  2DLL A;  2W25 A;  2Z1D A;  3EPZ A;  2HDW A;  1ZTR A;  2VOP A;  2DBB A;  5F64 A;  2HOT A;  5IP6 A;  1RRJ A;  5FJ8 J;  4IHY A;  1WCM J;  3LQQ A;  4XBF A;  1FOY A;  3WU2 C;  1ZEL A;  4A3F J;  4A12 A;  1WZ2 A;  1YW8 A;  2X51 A;  5GTI C;  2F4I A;  5CQE A;  3ZMU A;  2JQ7 A;  4BH9 A;  2KP6 A;  3KZZ A;  2HQN A;  2CYY A;  3VWB A;  4ITV A;  3CUQ B;  1JHH A;  3HGG A;  5L3B A;  3M8F A;  1QZE A;  2JJ7 A;  1SFU A;  1BL0 A;  2V1N A;  2V26 A;  4PUS A;  2OF7 A;  1FEX A;  2XRN A;  4IJA A;  1KU9 A;  2MD5 A;  5M5X J;  4MQ9 F;  4KYW A;  3VSL A;  2VQL A;  3E97 A;  2E5N A;  1AU7 A;  2E2J J;  3G2B A;  1BR1 A;  4BAC A;  1TWF J;  3CCV I;  4DYQ A;  4OIQ F;  3BG3 A;  2CQ7 A;  2MD0 A;  2GXA A;  3OYN A;  4FTH A;  1FSE A;  1FIP A;  1G3Y A;  2LKS A;  3E7L A;  3DEW A;  3ZOB A;  3HOT A;  3IKV A;  3T8R A;  2GM4 A;  3E5Q A;  1IO2 A;  1HXD A;  2KJC A;  2EWN A;  1ITY A;  5LGT A;  1IN6 A;  1P9Q C;  1AKH B;  3M9A A;  3G6E I;  3Q0V A;  1WWX A;  2WAQ A;  1J0R A;  1J09 A;  1FZP B;  5IOZ A;  2JPB A;  4IX7 A;  3H9G A;  1U78 A;  2MH2 A;  4DBR A;  3H1C A;  4D0P A;  4IRG A;  5DS9 A;  4GCV A;  4HQM A;  3S32 A;  2PJR B;  4I01 A;  2O6G E;  3ERE D;  3U21 A;  1VQN I;  1YS6 A;  4A6E A;  1HQC A;  2E1N A;  1YJW I;  4HX7 A;  1QHG A;  2YSR A;  4B44 A;  1S29 A;  2RNG A;  3P9C A;  3TP3 A;  3N97 A;  4XIC A;  1MNE A;  2C6Y A;  2O9L A;  5AIQ A;  2K4B A;  4BHB A;  3QRF F;  1R7J A;  3I54 A;  4HW0 A;  1Z21 A;  1LJ9 A;  1U2W A;  4YEJ A;  3RYR A;  2DPU A;  4CGZ A;  3HB9 A;  2RQP A;  2F4M B;  4M3B A;  2FNA A;  4B3A A;  3FDY A;  2QBY A;  2VOD A;  1LEA A;  5F08 A;  2M8E A;  2ZXJ A;  3WTZ A;  3CMM A;  1YHQ I;  2XAH A;  3H92 A;  1MBE A;  3F23 A;  1VQM I;  1K83 J;  2H94 A;  1R23 A;  1P7I A;  3TO6 A;  3K4K A;  4ZDL A;  3FX3 A;  1QZZ A;  2QQB A;  4HLY A;  3BR3 A;  2VBY A;  1F1Z A;  3L7W A;  2VBX A;  1G3W A;  5DD4 A;  2YUS A;  1UHW A;  2HEO A;  4KA4 A;  3UR3 C;  3BPX A;  3WU0 A;  3FHZ A;  1P7J A;  1YJN I;  3GLX A;  3CLQ A;  1O3Q A;  2GWR A;  1D8K A;  2LD5 A;  4PSX A;  2LYC A;  1OQY A;  1APL C;  3OS1 A;  3HUG B;  4AID A;  4LGW A;  2HVR A;  4LG3 A;  4RBO A;  4MGR A;  1LVA A;  3FZV A;  4M9X A;  1E0E A;  2AQE A;  2R7D A;  4P5O A;  5F27 A;  2BBY A;  2LRE A;  1N77 A;  2F2E A;  1XB4 A;  4DOZ A;  1SEU A;  2Y0S N;  5FKL A;  3V8L A;  3HL2 A;  5HS8 A;  4CSW A;  3TOB A;  1IRZ A;  3I59 B;  4ASN A;  1WFX A;  3K0L A;  4FE7 A;  2CFO A;  4XLF A;  4MFE A;  4NC7 A;  3HOW J;  1QO0 D;  2IPQ X;  2EZL A;  1B8I A;  4HZF A;  1R4M B;  2K27 A;  3BTL A;  1DGR M;  3DTE A;  3COA C;  1V4R A;  3TW7 A;  4BY7 J;  4DGW B;  4RAY A;  2K9Q A;  2OQR A;  5J1R A;  1X1P A;  2M4K A;  2CW8 A;  2DQL A;  2VXD A;  3IRQ A;  3L2Q A;  2XKP A;  2H27 A;  3AKZ A;  2X6O A;  3CUO A;  1FIA A;  4DIQ A;  1YIT I;  5IT9 K;  4DZJ A;  4ZYE A;  4XRF A;  3WTY C;  5EF6 A;  1E3O C;  4HPQ A;  3CJT B;  4U7B A;  1ZKG A;  4YII A;  5GAG J;  3HC7 A;  4M9Z A;  4GRI A;  1XPX A;  2VKE A;  1ODD A;  3KYD B;  4HNV A;  3HOV J;  2ZC2 A;  5ILV A;  5ED4 A;  5FLX K;  2XRO A;  3QAH A;  5CVU A;  5JHF A;  3CLO A;  1J2X A;  3HEF A;  2KRF A;  4OMZ A;  5F04 A;  3LSR A;  3QOD A;  3HZJ A;  1WH5 A;  3PUF A;  2QQ8 A;  2IS2 A;  2EIM H;  5FKO A;  2JA7 J;  2GQQ A;  1H0M A;  5DV5 A;  2MAB A;  2DT7 B;  2MG4 A;  4EQQ A;  5H6R A;  1R5I D;  4CZZ A;  3K4B A;  2L2O A;  2BGC A;  1PUE E;  2ZFW A;  3ELK A;  2HKO A;  1F9N A;  4X0G A;  4A3C J;  4U0V A;  3QP6 A;  2DCE A;  3BJ6 A;  3OL3 A;  4GDF A;  2Y69 H;  4PJN A;  5HDN A;  4E7L A;  3KEQ A;  1Y1W J;  3KIO A;  3ZMZ A;  3GTO J;  5GP9 A;  2ETH A;  2OV7 A;  5HLI A;  1O57 A;  4PGH A;  2WA0 A;  4I0B A;  3K4M A;  3J81 K;  2WV0 A;  2FD5 A;  1IV8 A;  3BRO A;  3I4P A;  4CCL A;  1X2N A;  3SEQ A;  4UUV A;  2FOW A;  2M4G A;  4KIS A;  3VSK A;  5EEH A;  2HYF A;  2O5R A;  2EFP A;  2V6E A;  5H6Q A;  1QNT A;  4AVP A;  1D1C A;  2DMU A;  2X1E A;  1Z77 A;  2XKO A;  3WU1 B;  1Z0X A;  2PMZ A;  3LFU A;  3RKY A;  1IN7 A;  4M72 A;  2OJE D;  1TWC J;  4LLN A;  1LFP A;  4C30 A;  3VYS B;  5LLQ A;  5ICE A;  2BHY A;  1R5G A;  3S93 A;  1XGS A;  4ENN A;  2R7S A;  2A6T A;  2DOD A;  3GCM A;  3C2B A;  1V3F A;  2NS8 A;  2IJL A;  2V6C A;  3GFJ A;  4Q48 A;  2XGX A;  3Q9S A;  2KMU A;  1RPW A;  2V7F A;  4EJO A;  2JA2 A;  2DMP A;  2O7O A;  1ZRE A;  4XNF A;  5M3F J;  4YEL A;  1XSX A;  3BTC A;  2Q2E B;  3OIP A;  2HYJ A;  5B1B H;  5CYV A;  1ZN2 A;  1R1T A;  4XKV A;  5E1W A;  3G1L A;  3MEX A;  3A01 B;  2MBF A;  3J80 K;  2R5Y A;  4G6D A;  1BJZ A;  2E1M B;  3BCA A;  4A3K J;  2L7F P;  4LIU A;  4RM2 A;  3S3N A;  3TQN A;  4B8X A;  3G1O A;  4A3M J;  1OCR H;  4MHG A;  3PO3 J;  4KN4 X;  2CWE A;  2M3A A;  1FYK A;  1VQ8 I;  4BE1 A;  1WI3 A;  3S3M A;  1JKR C;  4A5N A;  4WXD A;  3DQV C;  2MC3 A;  3GZ6 A;  3KLN A;  2K5C A;  1KYW A;  3HUG A;  1GLN A;  4C3H J;  2MH9 A;  2KHM A;  1IUF A;  3G3Z A;  2EV0 A;  1IGN A;  1SVO A;  1SVM A;  4HF2 A;  1A36 A;  2NVX J;  5CLS A;  2M2E A;  3OOU A;  5J1Y A;  5E3N A;  2EPF A;  4HV5 A;  1BM9 A;  4HST A;  3F8F A;  1SFE A;  2ZCW A;  6PAX A;  2K4J A;  2P4W A;  3TO7 A;  4RLF A;  2ID6 A;  4I7H A;  2L02 A;  4KIT B;  3ZQ7 A;  4S05 A;  1K4T A;  2E7X A;  1P92 A;  4BAY A;  1YOV B;  1IUY A;  4IF4 A;  2M34 A;  3MFK A;  4XON A;  3WTS C;  2VJ5 A;  5LHG A;  4BEH A;  4G6Q A;  5EG0 B;  4YFX F;  2LY9 A;  3TGN A;  3E1S A;  1Z6T A;  5C4J J;  4BJT A;  4CYD A;  2LBF B; 
#chains in the Genus database with same CATH homology
 5JFR A;  3HSE A;  4M71 A;  5D4S A;  4YFK F;  3T5X A;  1MJB A;  2B0L A;  4HX8 A;  3V7R A;  3M7G A;  1JGS A;  1R58 A;  1L3L A;  3F8C A;  2Y75 A;  1KYZ A;  2D1H A;  2Z33 A;  1Z05 A;  1ZGA A;  1FSH A;  5A2Q Z;  3DPL C;  4HF0 A;  1D8J A;  5E1Z B;  2DAO A;  1VTN C;  2P6T A;  5IT9 Z;  4G8X A;  2Z5U A;  3ECH A;  3RKX A;  3F8N A;  5BMZ A;  3G73 A;  1QQI A;  5LBQ A;  3CO7 C;  4TV7 A;  2UWM A;  2IA0 A;  2R3S A;  3PQK A;  4RAZ A;  1ZLJ A;  3IC7 A;  2EFW A;  1FYM A;  4RB2 C;  4AIK A;  4QLC U;  2K7L A;  1J59 A;  3ROU A;  1MJ9 A;  1FBU A;  4KT5 C;  3IRR A;  3FM3 A;  1S7A A;  4EJU A;  4L0Z B;  2DTR A;  3V7S A;  2HGC A;  2STW A;  2Q0O A;  3SXY A;  4ZYD A;  3SFZ A;  3J81 Z;  1XGO A;  2QLZ A;  1BIA A;  1YW9 A;  1YG2 A;  1B59 A;  3F72 A;  2ZBK A;  1CF7 B;  3RTR A;  3PQJ A;  2VBZ A;  1S8N A;  1PP7 U;  5D5U B;  1WQ2 A;  4L9T A;  3I5U A;  1P4W A;  2QYO A;  4U0Y A;  3WE2 A;  3GUD A;  2P7V B;  3ZMT A;  4RGS A;  2FMY A;  4O5V A;  3IHU A;  1UHM A;  3GWZ A;  1LDJ A;  3QP5 A;  1STZ A;  1ON1 A;  4XSZ F;  1XD7 A;  4M73 A;  5BPI A;  2NS0 A;  4L18 B;  1ZLK A;  4XLP F;  4IXA A;  4LB5 A;  5LHH A;  1YFH A;  1K6O A;  2QBY B;  1B6A A;  2Y48 A;  1OR7 A;  5CVR A;  3C3W A;  2D45 A;  2KIF A;  1B4A A;  5TJJ A;  3U1D A;  1IW7 F;  1WSU A;  2FML A;  3U2R A;  2ADU A;  5BPD A;  2V79 A;  3LQR A;  1TNS A;  4L9N A;  5D5V B;  1JHF A;  1O3R A;  3N4M A;  2GXB A;  1W4M A;  4RS8 A;  1W5T A;  4FX0 A;  1H9T A;  4MTD A;  2AS5 F;  3R0A A;  5LEK A;  2OD5 A;  3HHG A;  4YFN F;  2DO7 A;  1IN5 A;  3R0J A;  1FBQ A;  4HF1 A;  4FX4 A;  4O6J A;  1R5H A;  3CUQ C;  1UST A;  2HFH A;  3D5L A;  4P9F A;  1KQ0 A;  2XV4 S;  5DUI A;  4KFC A;  4BHP A;  2W57 A;  1GVJ A;  2F5F A;  2K86 A;  1RIO H;  3O6B B;  5DCF A;  3EYI A;  1XMK A;  1P2F A;  3ZMV A;  4AWX B;  4P55 A;  2KJB A;  2XIG A;  1PDN C;  1MDM A;  2Z9O A;  1XGN A;  1LEB A;  2FNP A;  4L5J A;  4ESF A;  3MZH A;  2G7U A;  3KCC A;  3JSO A;  3K69 A;  1IZ1 A;  3NQO A;  1OPC A;  2XAJ A;  1BBY A;  3T1B A;  4XSX F;  4EJW A;  3F6O A;  2FEZ A;  2YR2 A;  1YS7 A;  3DEU A;  5HDK A;  3B02 A;  5LRR A;  1KU3 A;  1FX7 A;  2IVM A;  3I0T A;  3RYP A;  1CF7 A;  3HRM A;  4HAM A;  1TBX A;  3BP8 A;  2FA5 A;  1IXS B;  1QGP A;  3Q9V A;  1B9M A;  4KMU X;  1SD7 A;  1P6R A;  2F5D A;  2J5O A;  3GX4 X;  2M5W A;  1ZGJ A;  4EGY A;  4UV8 A;  4BXU A;  3GFM A;  2ZJ2 A;  2P5L C;  2IA2 A;  4LG0 A;  1X3U A;  2M30 A;  4A6D A;  4OIN F;  3B73 A;  5CJ9 A;  1KQ8 A;  3FXQ A;  4UVC A;  3HTS B;  1RZ4 A;  1FBS A;  4Y17 A;  3AAF A;  4FHT A;  1ZAR A;  1FP1 D;  5K5R A;  4OIO F;  2ACJ A;  2A68 F;  1PP8 F;  2FE3 A;  2CGP A;  4R1H A;  2RV8 A;  3QU6 A;  1T98 A;  2RVC A;  3CDH A;  4I2O A;  1AOY A;  2RKH A;  3E3V A;  5E1X A;  4IVN A;  3R4K A;  1D3Y A;  2EFN A;  3HSR A;  5CVI A;  1HBX G;  2FRH A;  3GFI A;  4KIG A;  2XUB A;  4CXF A;  3WGG A;  1MKM A;  5A2Q K;  2ELH A;  4LB6 B;  2HS5 A;  1W7P D;  5L3D A;  3ECO A;  3I64 A;  4BQA A;  3HYI A;  2VC1 A;  3ABT A;  4CO8 A;  1FC3 A;  1XDS A;  3KP4 A;  2O03 A;  2IT0 A;  4PCQ A;  3V4G A;  1LDK B;  2BE5 F;  3QOP A;  1I1S A;  4M6Y A;  3DXJ F;  4BHC A;  2X0L A;  4ENM A;  1F5T A;  2DK5 A;  2NNN A;  3HTU A;  4WX9 A;  1QBJ A;  1O3T A;  3KP3 A;  1QZY A;  2R7F A;  5IT3 A;  3T8T A;  1W5S A;  2GA2 A;  3M1E A;  3BWG A;  4KN7 X;  1FT9 A;  2GAU A;  2KIM A;  5HVQ C;  1D5V A;  3TO9 A;  2PMU A;  3K1M A;  3E5U A;  4DNC A;  2ZKZ A;  3R60 A;  1S3J A;  4NQW A;  4K2E A;  1BI3 A;  2NNY A;  5J8F A;  3WTT C;  4YG2 F;  1ZRC A;  4HBL A;  1OYW A;  3K1N A;  1T38 A;  2PMH A;  2A6H F;  4LLL A;  1SFX A;  4IRI A;  2V1U A;  3LAP A;  1ZYR F;  1HKS A;  4KMF A;  4G7H F;  4OOI A;  2MLK A;  1KU7 A;  1JXS A;  5D6F A;  4UVA A;  3F8B A;  1XCV A;  2RC4 A;  4M9S A;  2FXA A;  3W6K B;  2Z99 A;  4HYE A;  4KIC A;  1K78 A;  3HHH A;  3LST A;  2ZME A;  1Z7U A;  3BY6 A;  3GYH X;  2COM A;  4Z2Y A;  4EM2 A;  2W85 A;  1RUN A;  5FO5 A;  5E17 F;  4JBA A;  3O2P E;  4YIF A;  5FFX A;  5TRD A;  2M1B A;  2VE9 A;  4E70 A;  2NYX A;  1T2K A;  2LNB A;  3VFZ A;  2MLG A;  3R61 A;  2QQA A;  2L4A A;  2UXX A;  2VE8 A;  5HS9 A;  4B09 A;  2HDC A;  4PGG A;  3WGH A;  1IN4 A;  3C1D A;  2DQR A;  3KP5 A;  1OKR A;  1TQP A;  2XHK A;  1MJA A;  2X4H A;  5CVV A;  1BC8 C;  2YU3 A;  3I71 A;  3WG9 A;  5HDG A;  1SMY F;  2VT3 A;  4A0Z A;  1R1U A;  2KIU A;  4IHT A;  2JTV A;  3EUH A;  3I58 A;  4I09 A;  3RPQ A;  3E6M A;  1XSD A;  1ZG3 A;  2A61 A;  1SD5 A;  3MCZ A;  2YPR A;  1P4A A;  1RUO A;  2A5Y B;  1Z1D A;  3LFK A;  3ZN1 A;  2RN7 A;  2HTS A;  1EH7 A;  1FP2 A;  2JZY A;  3K9T A;  5AON A;  2VBW A;  4CHU A;  2DI3 A;  4EMS A;  4ETS A;  3KEO A;  3DP7 A;  4L9J A;  3S2W A;  3MWM A;  2CSO A;  2V1D A;  2EV5 A;  1KU2 A;  4AIJ A;  1YW7 A;  1R22 A;  3DV8 A;  4HQE A;  2H6C A;  4AIH A;  2G9W A;  1RI7 A;  2JT1 A;  1SD4 A;  1G4D A;  1ONV A;  5LHI A;  5FD5 A;  1OYY A;  4LK1 F;  2XAG A;  3FXR A;  5LRS A;  2PEX A;  1TW2 A;  5L3E A;  2ISY A;  2PFB A;  1WKM A;  2A69 F;  2VON A;  3ZP5 A;  4DQ2 A;  2HZT A;  4GYG A;  1LQ1 A;  2FSW A;  4ZYH A;  4RB1 A;  1MDM B;  1TW3 A;  1B1B A;  3VEP A;  1YTY A;  2HYG D;  1E2X A;  4G9Y A;  1Z91 A;  3I53 A;  1FOK A;  1Q1H A;  3CJN A;  2HKX A;  5DCM B;  5DD8 A;  4G94 A;  3KP2 A;  1BIB A;  4LLG F;  1O7L A;  2CO5 A;  4O3M A;  2F5C A;  4EM0 B;  1TQI A;  2LF8 A;  2RNJ A;  5JI6 A;  3K2Z A;  4N9I A;  2W24 A;  2EA4 A;  3FMR A;  3IKT A;  3V8J A;  1I1G A;  3JAM K;  3DF8 A;  2FOK A;  2PLY A;  3FF5 A;  5D6E A;  5LEJ A;  3FWE A;  1E17 A;  4Y13 A;  4GGG A;  1IRF A;  3MAJ A;  3ZN0 A;  3E6D A;  4Q4Z F;  2HQR A;  3FM5 A;  5KK1 A;  1TLH B;  5E18 F;  4I0A A;  4KNY A;  3EDP A;  1BI1 A;  4LD5 A;  4PZJ A;  1DPR A;  3TDZ C;  4QWQ A;  2VN2 A;  3OV8 A;  1KGS A;  3MZY A;  2PJP A;  1NHA A;  1C0W A;  3H3U A;  2QZ8 A;  3E5X A;  4UNO A;  4MEY F;  1U5T A;  4HDV A;  1I6X A;  2TDX A;  4LG0 B;  1ZG5 A;  2OA4 A;  4A0Y A;  1FNN A;  2P5K A;  4UXN A;  1ON2 A;  3TKY A;  2VXZ A;  4OMY A;  2IA1 A;  4RB3 C;  2O8X A;  4Q5S F;  4R79 A;  1WRJ A;  5F1R A;  1K79 A;  1HW2 A;  2PG4 A;  4IHS A;  2HR3 A;  1JE8 A;  2M45 A;  2A3S A;  1K7A A;  3U9G A;  1XMA A;  1IRG A;  3H3Z A;  1FYL A;  2WTE A;  1DP7 P;  5LGU A;  3RDI A;  3E6C C;  5ERI A;  3BJO A;  4EJV A;  4ZZD A;  3LA2 A;  3F6V A;  3ABU A;  2CW0 F;  3L00 A;  4GYI A;  1HW1 A;  4I98 B;  2XAS A;  2DW4 A;  3IWF A;  1IN8 A;  3SZT A;  2AXL A;  1DPU A;  4N9H A;  3SQN A;  4A0X A;  2Y0M A;  5D8K B;  2RGV A;  5J6X A;  1A04 A;  5DCM A;  4UV9 A;  3O3K A;  3DKW A;  3JTH A;  3JSP A;  3GXO A;  2L3D A;  4WF2 A;  1G3S A;  3IL2 A;  4U88 A;  3BDD A;  2OBP A;  1LNW A;  3MQ0 A;  3F3X A;  3KFW X;  3WTU C;  1KA8 A;  4KDP A;  5HLH A;  3WTX C;  4PDK A;  4A5M A;  3BJA A;  2LF7 A;  2ZO4 A;  2QVO A;  2EV6 A;  3V8K A;  2O3F A;  2L01 A;  3BOQ A;  3HSF A;  3JAM Z;  2HTJ A;  3ZMD A;  5DYM A;  2FU4 A;  3EQL F;  3EYY A;  1Z9C A;  2LDU A;  1ZRF A;  1BJA A;  4LFU A;  4MTE A;  3W6J B;  3L2C A;  5DUK A;  4JK1 X;  1IXC A;  1K78 B;  2ZME B;  2UZK A;  1F4K A;  3DFG A;  2E7W A;  5CVJ A;  2VT2 A;  1QPM A;  1HKT A;  3R6S A;  1SD6 A;  5H20 A;  1ZH5 A;  1XCB A;  4MEX F;  2DU9 A;  2NAZ A;  4F7Z A;  2CFX A;  5ICC A;  1R1V A;  3GFL A;  3GW2 A;  4H0E A;  5HOO A;  4Q47 A;  2EB7 A;  3GF2 A;  1LDD A;  2GXG A;  5FFZ A;  1EH8 A;  3VB2 A;  4EM1 A;  5JR3 A;  2FBH A;  2OZU A;  1U6G A;  2QUF A;  3P9K A;  1BI0 A;  2DFI A;  2KKO A;  4OIP F;  4IPA A;  2DPD A;  4LMY A;  1DUX C;  2ESH A;  4ZYG A;  5K5O A;  5JVT A;  2P6S A;  1HST A;  1USS A;  4S04 A;  3HOS A;  1G3T A;  5DEQ A;  4FT8 A;  4LK0 F;  4MQV A;  4EJT A;  1YIO A;  1J9I A;  1I5Z A;  2H09 A;  4RGU A;  1OMI A;  2JPC A;  1J7K A;  1R36 A;  1HKQ A;  2V1X A;  1GXP A;  1YLF A;  2WC2 A;  3QPT A;  5HS7 A;  2EK5 A;  2L54 A;  3HRT A;  2O0Y A;  3EET A;  3KET A;  1O7F A;  4ESB A;  1HSJ A;  3CUQ A;  4ENK A;  4AD9 A;  3TOA A;  4HDU A;  4KIF A;  3WTW C;  4WCG A;  1ZAO A;  5E8G A;  4Y15 A;  1G6N A;  3TDU C;  2IRF G;  3ULQ B;  2EJR A;  5F6F A;  3L9F A;  4M74 A;  5AIP A;  1XDU A;  3P9I A;  3QPH A;  1XN7 A;  3WE3 A;  2XVC A;  3JTG A;  1MGT A;  5FB2 A;  3ISP A;  5J8C A;  2FQ3 A;  1O3S A;  3RI4 A;  4GO1 A;  5DDG A;  1YQA A;  4BYY A;  2HOE A;  3LA3 A;  2JSC A;  3HRU A;  3C18 A;  3M8E A;  1ZRD A;  4KUM A;  5D5W B;  3KP7 A;  3QU3 A;  2XAQ A;  2DT5 A;  1U5T C;  1KQ9 A;  3OOP A;  4HV6 A;  1W7P B;  1YO5 C;  1T6S A;  2OAZ A;  3F21 A;  2FBI A;  3RPU A;  1I27 A;  2HWV A;  2NRA C;  2EFO A;  4EVI A;  2D2W A;  3F22 A;  2BEO A;  1IXR C;  2G7H A;  4CIC A;  2LSO A;  1DDN A;  1FPQ A;  3GO5 A;  1U5T B;  5ICF A;  1J75 A;  3RJP A;  2LKP A;  5BS6 A;  3WTV C;  4ENJ A;  4HX4 A;  3JW4 A;  4JQF A;  4OIR F;  2PQ8 A;  4NB5 A;  3NRV A;  1BOA A;  1GXQ A;  4ZH4 F;  2K02 A;  3I59 A;  5JHU A;  2Z3Y A;  3KLO A;  4G7Z F;  1T39 A;  3GVA A;  3RIR A;  1J5Y A;  3J7A O;  1EV7 A;  3PFI A;  2ISZ A;  1UB9 A;  2YX4 A;  5L3C A;  2RDP A;  3NEU A;  3VOE A;  3ZPL A;  4WXC A;  4L5I A;  1R00 A;  2QQ9 A;  3ZMS A;  1ZHF A;  3KZY A;  3L09 A;  1HW5 A;  2UXN A;  3LA7 A;  3D0S A;  4GXO A;  2ZNZ A;  4HOB A;  3FMS A;  1H9G A;  3CTA A;  5L3F A;  1U3E M;  4BNC A;  2IW5 A;  1XGM A;  1MZB A;  4ZZL A;  4M6X A;  4ESJ A;  3Q5F A;  1EH6 A;  2P7C B;  1S7O A;  2VC0 A;  1BN5 A;  2Q8K A;  4N0B A;  2JRT A;  1SAX A;  3BZ6 A;  4WWC A;  3KE2 A;  5FLX Z;  2YX7 A;  3C7J A;  5KVR A;  3V7C A;  4ON0 A;  3BPV A;  3FXU A;  1S6L A;  1YYV A;  4R8H A;  2BV6 A;  2ESN A;  2QEN A;  1ULY A;  2XAF A;  3HIF A;  1TNT A;  4P96 A;  2DK8 A;  3CO6 C;  2P8T A;  3ML6 A;  2MA3 A;  3GEZ A;  1IF1 A;  1IAW A;  1B9N A;  1TTY A;  1CGP A;  2ZNY A;  3FMQ A;  3WGI A;  2OQG A;  3E6B A;  2FF4 A;  4EGZ A;  1RNL A;  4L0Y B;  5D8L B;  1W7P A;  3REO A;  2CG4 A;  5E8I A;  4KIB A;  4WXH A;  1XSV A;  3GZ5 A;  2Q2E A;  4L9V A;  1WI9 A;  5LGN A;  2WWY A;  2A07 F;  1UCR A;  4NHJ A;  1ZG1 A;  2GZW A;  2OZ6 A;  1L0O C;  4P9U A;  5L3G A;  5K5Q A;  3KP6 A;  1AWC A;  4UHT A;  2EFQ A;  4G7O F;  3IWZ A;  2F5E A;  1Y0U A;  5D4R A;  4UVB A;  5EEG A;  2EA2 A;  1LB2 A;  1UFM A;  4LJZ F;  2PN6 A;  5ILU A;  4HLX A;  4IRH A;  1FY7 A;  4A2U A;  2GIV A;  3SZP A;  3K1P A;  1Z6R A;  3J80 Z;  1SMT A;  2A6E F;  3LWF A;  2STT A;  2D1V A;  1MD0 A;  3P7N A;  5ILS A;  1P4X A;  5BQT A;  4RB0 A;  4HA8 A;  1T0F A;  3F8M A;  1BI2 A;  4EV0 A;  5HLG A;  2V9V A;  5FGM A;  1OYI A;  2O61 A;  3HRS A;  2W84 A;  4XLN F;  3RKW A;  2P5V A;  2OU2 A;  1TQM A;  2J5P A;  1BC7 C;  4U7D A;  4U0W A;  3T0Y A;  1FWZ A;  2PBI A;  5FD6 A;  2M87 A;  3VOD A;  4OU0 A;  2BYV E;  2QM3 A;  2VOO A;  1REP C;  5K1Y A;  3DPT A;  4RGR A;  2CQK A;  5ICG A;  1U8R A;  4CDG A;  3WOD F;  5D5X B;  4I02 A;  1GHC A;  2QWW A;  3SHF A;  1FLI A;  4MNU A;  5E20 A;  4WK8 F;  2E1C A;  2H6B A;  2L4M A;  2IP2 A;  3LAJ A;  2PI0 A;  2FBK A;  5BOX A;  4RGX A;  2GA1 A;  2DLL A;  2W25 A;  2VOP A;  2DBB A;  5F64 A;  3LQQ A;  4XBF A;  4A12 A;  1YW8 A;  3ZMU A;  4BH9 A;  3KZZ A;  2HQN A;  2CYY A;  3CUQ B;  1JHH A;  5L3B A;  3M8F A;  1SFU A;  2XRN A;  4IJA A;  1KU9 A;  2MD5 A;  4MQ9 F;  4KYW A;  3E97 A;  4OIQ F;  1FSE A;  1G3Y A;  3HOT A;  3IKV A;  3T8R A;  3E5Q A;  1HXD A;  2KJC A;  2EWN A;  5LGT A;  1IN6 A;  3M9A A;  1WWX A;  1J0R A;  1FZP B;  2JPB A;  1U78 A;  2MH2 A;  4D0P A;  4IRG A;  4GCV A;  4HQM A;  4I01 A;  2O6G E;  3ERE D;  1YS6 A;  4A6E A;  1HQC A;  2E1N A;  4HX7 A;  2YSR A;  1S29 A;  3P9C A;  3N97 A;  2C6Y A;  5AIQ A;  2K4B A;  4BHB A;  3QRF F;  1R7J A;  3I54 A;  4HW0 A;  2DPU A;  1LJ9 A;  1U2W A;  3RYR A;  4CGZ A;  2RQP A;  2FNA A;  2QBY A;  2VOD A;  1LEA A;  2M8E A;  2ZXJ A;  3WTZ A;  2XAH A;  3H92 A;  3F23 A;  2H94 A;  1R23 A;  3TO6 A;  3FX3 A;  1QZZ A;  2QQB A;  4HLY A;  2VBY A;  1F1Z A;  3L7W A;  2VBX A;  1G3W A;  5DD4 A;  1UHW A;  2HEO A;  4KA4 A;  3BPX A;  3WU0 A;  3FHZ A;  3GLX A;  1O3Q A;  2GWR A;  1D8K A;  4LGW A;  4MGR A;  1LVA A;  3FZV A;  4M9X A;  2R7D A;  4P5O A;  2BBY A;  2F2E A;  1XB4 A;  3V8L A;  5HS8 A;  3TOB A;  3I59 B;  4ASN A;  3K0L A;  1QO0 D;  2IPQ X;  4HZF A;  2K27 A;  3COA C;  1V4R A;  4RAY A;  2OQR A;  2DQL A;  3IRQ A;  2XKP A;  2H27 A;  3CUO A;  5IT9 K;  4ZYE A;  4XRF A;  3WTY C;  4U7B A;  4YII A;  4M9Z A;  1ODD A;  5ILV A;  5ED4 A;  5FLX K;  2XRO A;  3QAH A;  5CVU A;  3CLO A;  1J2X A;  2KRF A;  4OMZ A;  2GQQ A;  1H0M A;  5DV5 A;  4EQQ A;  5H6R A;  4CZZ A;  2BGC A;  1PUE E;  2ZFW A;  3ELK A;  2HKO A;  1F9N A;  4U0V A;  3QP6 A;  3BJ6 A;  5HDN A;  3KEQ A;  3ZMZ A;  2ETH A;  5HLI A;  1O57 A;  4PGH A;  4I0B A;  3J81 K;  2WV0 A;  3BRO A;  3I4P A;  4UUV A;  5EEH A;  2HYF A;  2EFP A;  5H6Q A;  1QNT A;  4AVP A;  2XKO A;  3WU1 B;  3RKY A;  1IN7 A;  4M72 A;  4LLN A;  5LLQ A;  5ICE A;  1R5G A;  1XGS A;  4ENN A;  1V3F A;  2IJL A;  2V6C A;  3GFJ A;  4Q48 A;  2XGX A;  3Q9S A;  4EJO A;  1ZRE A;  1XSX A;  5CYV A;  1ZN2 A;  1R1T A;  5E1W A;  3MEX A;  2MBF A;  3J80 K;  4G6D A;  3TQN A;  4B8X A;  4MHG A;  4KN4 X;  2CWE A;  1FYK A;  4A5N A;  4WXD A;  3DQV C;  2MC3 A;  3GZ6 A;  3KLN A;  1KYW A;  3HUG A;  2MH9 A;  3G3Z A;  2EV0 A;  4HF2 A;  5CLS A;  4HV5 A;  1BM9 A;  3F8F A;  1SFE A;  2ZCW A;  6PAX A;  2K4J A;  2P4W A;  3TO7 A;  4I7H A;  2L02 A;  3ZQ7 A;  4S05 A;  2E7X A;  1P92 A;  4BAY A;  1IUY A;  4IF4 A;  3MFK A;  3WTS C;  5LHG A;  4G6Q A;  4YFX F;  3TGN A;  1Z6T A;  4CYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...