2XF7A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone. high-resolution structure.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
ESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
molecule keywords GP23.1
total genus 17
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf7A00
2XF5A 2XF7A 2XF6A
chains in the Genus database with same CATH superfamily
3FXKA 2X6YA 3CUOA 5JLWA 1LE8B 4HBLA 2YU9J 3IH3A 1ETYA 2O0YA 4NDLA 1XPXA 3LA7A 3WTWC 2QSHX 4CXFA 3A0BC 4BE0A 3I59B 1ZR2A 2LKPA 2PEXA 5LRSA 3NARA 3CMYA 1VTNC 1A04A 2WV1A 2H1LA 4XIDA 3N05A 3E5XA 1SD5A 4HPQA 1J9IA 2FJ1A 2QEXI 2TCTA 1XG1A 1DPUA 5J1RA 2X48A 3T1BA 2QZ8A 3L2CA 3MEXA 2VE9A 5FO5A 1YS7A 1JUMA 1W4MA 2ELKA 1J09A 2VKVA 3UKGA 3HRSA 3Q0WA 3MN2A 3PSIA 1UHSA 5B3SH 2QGUA 3LFUA 3A4CA 4NQWB 3BTJA 5K7ZA 3BZKA 1GUUA 4Y4RA 2V4JC 2FQ4A 3REOA 3ZGKA 1P4WA 3FKIJ 4KUMA 4CGZA 3WTTC 4MIMA 1MJ9A 1ETOA 1BIAA 2DMPA 4B43A 4II2A 3LA3A 1HW1A 2CUJA 5HNFA 5J47A 4XLEA 1RC9A 3GFMA 4A5NA 3K4JA 3W6JB 2ME6A 1B4AA 1MZBA 3IH2A 3QYBA 4MEYF 3VDXA 4XONA 2W7NA 4N4NB 3GTPJ 5FFXA 1K4TA 1MH3A 1K61A 2P6TA 3TO9A 3ZMZA 1SVOA 2ESNA 2HDCA 4AWXB 4XSZF 3QU3A 2CQNA 5CVJA 4BJ5C 4UVBA 2KIFA 4XRMA 5D8KB 1FPQA 2FRHA 5BQTA 5J8FA 1Y0UA 1W0UA 2IP2A 2ETHA 1E3HA 1V5GA 3K1PA 1IV8A 3V7SA 2DI3A 4XLPF 4XRSG 1YRNB 1V54H 1BIBA 1T2KA 5CVVA 2A07F 1GV2A 3MVPA 1K78A 4XLNF 5E3LA 1ZELA 2MLKA 2NRAC 1BL0A 5K7FA 2XPVA 2PFBA 5FGMA 4F3QA 3JRDA 2E7XA 4GYIA 4HNUA 3KEQA 1IN5A 3KEOA 5FROA 4LMYA 1YW9A 1WCMJ 1BM9A 4BY1J 3MKYB 5LEJA 1TW3A 2IVMA 4G8XA 1JT6A 2JA7J 3E5UA 1K78B 2ZBKA 2HWVA 3GXOA 4PSXA 4D0PA 3WU1B 3CC7I 1R7JA 5D8LB 5FKOA 2FF4A 3IP4B 2XHKA 4DW6A 5F0HA 4YG2F 5F04A 3DTKA 1A6QA 3WG9A 1D0XA 3COAC 1E17A 2VBYA 3RZOJ 2E2JJ 1YLFA 2PMHA 1XS9A 4IF4A 1P92A 3GX4X 3CDIA 1U8BA 3SDGA 3BPXA 4OAZA 1ZRDA 3F3XA 1D0YA 5CVIA 2R5ZB 4GGGA 3LOCA 1ORKA 3K7AJ 2XF7A 1DP3A 1G3WA 3HOXJ 1MBEA 4XKBA 2KQRA 3F23A 2WY8Q 4BDYA 4P9FA 4KMFA 3S1NJ 2F4IA 4R8HA 1K7AA 1AU7A 3TO7A 1O3TA 2DFIA 2QQ8A 2DOEA 3Q0UA 4A0XA 3BG9A 4B4CA 4EM1A 5LHIA 4DNCA 2P8TA 4Y33A 2WBMA 3T5XA 5CKTA 1R4MB 3PL8A 3FXQA 1RI7A 2COBA 3WTUC 1PUFB 2ECBA 2NNNA 1Z67A 1G2HA 1FP2A 1I39A 4ZTFA 2M5WA 3W6KB 1QNTA 2EZHA 4YFXF 3QOEA 5HS9A 4L9VA 4O5VA 1YFHA 3FISA 4HV5A 2OQRA 3QP5A 4FETA 3RQIA 3T8TA 1T98A 5EEHA 2CV0A 1Y0NA 3DBHB 3Q9SA 3LWFA 3HSRA 1TLHB 4NC6A 2EWNA 2BV6A 3F0CA 3S32A 1FLIA 3KYDB 2N8GA 2VONA 2XRLA 2NVUB 4HLXA 2STTA 4G6TB 4UY8I 3GBGA 4LD5A 3ABLH 2OTLI 3T8RA 5TISC 2MW8A 3K4KA 3MCZA 1DDNA 1BR1A 2XGDA 3LAJA 1KQ0A 2K4JA 3QYFA 2FU4A 5A2QZ 1LE8A 1JKRC 1R5ID 4JYKA 3HM5A 3TQNA 3HTSB 2LDUA 2BBYA 2OUMA 3V8JA 2BW3A 2H09A 4BHBA 2Z3YA 4ZZLA 2HU9A 3F8FA 3PQJA 1SMYF 3S1RJ 5IOZA 2VPLA 1LDJA 2YX4A 2OA4A 3AG4H 3K4NA 3A01A 5FJ8J 5B1BH 2CWEA 3HKZA 2Y0SN 4QPOA 1QQIA 4F92B 1FYKA 2QUFA 1REPC 4IQ4A 1NG6A 1ZK8A 3HPGA 5LGUA 2MLGA 1G6NA 1U0JA 2F4OB 3BR1A 1X3WB 2E1NA 5GP9A 1X2NA 4ZYEA 2W57A 5ED4A 3GUDA 3DWLE 2NS8A 4HX7A 1H88C 1N78A 4B47A 5EZHA 2HTJA 1DU0A 1YS6A 2BY0A 3ERMA 1MMDA 2K9LA 1R9TJ 3RYRA 4HW0A 3IV5A 1MH4A 1S7EA 4LOCA 2BZTA 1FBUA 1CF7A 4I7HA 3DPLC 2GIVA 3L09A 4A5MA 4KISA 3ZQHA 2K3FA 2KDOA 1HA8A 1OR7A 4L5EA 1I6HJ 2XKOA 2ZXJA 3GFJA 2FBKA 4ZJZA 3QPSA 1LVKA 1IXSB 4HYEA 3OYHA 4XRSA 4Y15A 4EVIA 2E5ZA 1GXQA 1G3SA 5HS7A 4H0EA 3F8NA 4E7ZA 2ZMEA 1MJBA 2JRTA 5L3CA 3WGGA 1HSTA 2X1CA 1JJ6C 3F72A 3DEEA 5D6FA 5L3DA 2H8WA 3G6EI 4BBSJ 1KQ8A 2DA7A 5GTIC 2EV6A 1D1AA 3CD6I 2V79A 4L9TA 4M73A 4A12A 2DPUA 3RKWA 2GAUA 2VXZA 5ICEA 4V2GA 3I54A 2R7UA 1BBYA 2IW5A 4HEA2 4P9UA 1D8JA 4NNJA 1FMWA 2WB1A 3F9KA 3ML6A 1WH7A 2F5DA 2NAZA 1LFPA 2VASA 2WAQN 2XPUA 2Z16A 4P55A 5C4XJ 3GTQJ 1O57A 3PFYA 2VL8A 1FT9A 2W82A 3DTEA 3LL7A 1VFCA 1ZARA 2X51A 1R6RA 2DMQA 3OS1A 3BJOA 2HOTA 2F6CA 3KX2A 5EGOB 4ESBA 1WJEA 1QZYA 5H2FC 4Y13A 3A2KA 1IXRC 2M0MA 4YRVA 3I4PA 4YIFA 3CCQI 4M74A 1TQMA 4NQWA 2KIUA 1RIOH 4D1QA 2L02A 4XNFA 3H9JA 3RJPA 2QKMB 4LFUA 3H9QA 2DPDA 5JI6A 5LBQA 3R0JA 2E1MB 3C2GA 2VOPA 1HSJA 3JREA 3FIWA 4HSTA 3CLQA 4DQ2A 1ENHA 2NVYJ 1LVAA 1EV7A 1WJBA 1Z77A 4Z2YA 2DT7B 2W1OA 3E0JB 3FK7A 1RESA 3IKVA 3IWZA 2JSCA 4KFCA 3OYNA 3HGGA 3KP4A 4ZDOA 3OWTA 3J81Z 1U9OA 3SJMA 1T38A 4PZJA 4LB6B 1MIJA 4CZZA 1FWZA 1Z7LA 1SFKA 4U7DA 1OCPA 5IT3A 5LHHA 3W2WA 4BYYA 2ID6A 2IBDA 3WTVC 1NHAA 4D9JA 4AC0A 3JRAA 2K85A 1FOWA 3DV8A 1TWHJ 2P5LC 1NH3A 2OD5A 3PNVA 3PQKA 4HDUA 3FMQA 2NOJB 2FNPA 3FMSA 2K9QA 3KEYA 9ANTA 3I59A 1NTCA 4OU0A 1T8IA 3HRMA 1YJWI 1FEXA 4L9JA 1XCBA 1JGGA 1JJ8C 4XN3A 1PUEE 4DYRA 1OMIA 4ZYGA 4U88A 2F48A 5CLSA 4CCJA 2DTRA 3PUBA 3ZR8X 2R7FA 4UV8A 5J6XA 3TW6A 1QBJA 4KN7X 1ETVA 3BLYA 3PO2J 2Q8KA 5CPRB 4XR6A 1MD0A 1MMGA 3HEFA 3C2BA 2HDDA 2VODA 1OCRH 1ZHFA 4L0ZB 3R0AA 1YW8A 3D5LA 4IHWA 4JK1X 4F55A 5IOYA 2F5VA 3DPUA 3CC2I 4AYBA 2ISZA 3GTGJ 4ZYDA 1WI3A 2HQNA 3TDZC 1YW7A 4MHGA 1XCVA 4B1RA 3MFKA 3M4OJ 2E5NA 1IO2A 2A6HF 4ETSA 5KAFC 4CICA 1QZEA 3JRCA 2P7CB 2HVRA 2HR3A 5E20A 3S8PA 1ZRCA 4BHPA 4I2OA 1U9NA 2OZUA 3VYSB 1X3ZB 1P4AA 2BY1A 4EGYA 2RAEA 2HPMA 4E4HA 4F52A 2F5FA 3EUHC 3M9AA 4XLAA 1Y8RB 3K4MA 5F08A 4F91B 5HLGA 2K9NA 3D0SA 2ZSHB 1MMAA 1IUYA 2ME0A 2O7OA 3E6DA 4UB6C 3ZMVA 5F0FA 1MMSA 4FASD 4EEFG 1LB2A 2DA3A 2I8DA 2Y2ZA 3S1MJ 2Y0MA 1Z91A 4AIDA 2R7WA 3EQLF 4DYQA 3KZIC 3HIFA 3OV8A 4IL6C 5IT9K 1IRFA 4PFPA 1GXPA 1FOXA 5CVUA 3H3UA 5DD4A 5LLQA 1YJNI 1MBJA 1IDZA 1WH5A 1B59A 2KLOA 1YIJI 2J5OA 2ZJPF 3VODA 1YOVB 2KKOA 3OYJA 2Y69H 4XKWA 3HSFA 2GOXB 4S04A 3VEPA 5DS9A 2B63J 2LTPA 2DMUA 2XF6A 3V42A 1FZPB 2ZB9A 2HXIA 3PIPF 1OPCA 2K4BA 1U5TB 2UUZA 1GHCA 3SFZA 4A3FJ 1ZLJA 3NAUA 3VFZA 2VQCA 2BGCA 2ZXWH 2MBFA 4BQQA 5BPDA 2DJNA 4AIJA 3OYAA 2R7RA 3FHNA 2LG4A 2PN6A 1TTYA 3E6CC 1RUNA 3BG7A 1FTTA 2R7OA 3BTIA 2QM3A 2VE8A 3K1NA 1ZGJA 2NNYA 2EFWA 2PJRA 5IYDJ 1T0FC 4ESFA 2OCEA 3HHGA 2XAUA 5ILVA 3M1CA 5F27A 5D4RA 2M0CA 2VKDA 2WAQA 4M9SA 1IGNA 2HVQA 5E3NA 4HSRA 1ZQ3P 3KP3A 3MWMA 4UUSB 4ZZDA 3S16J 5E79C 3D5RC 2Y31A 4FISA 1J59A 2B9SA 1TW2A 4A3KJ 2PQ8A 3P7NA 3L2QA 3BT9A 3K70D 2PBIA 2DCEA 1BW6A 3G73A 4PK4A 1XDSA 4M3FA 1OQYA 3OSGA 3SZGA 2AS5F 4A3IJ 4NBQA 1QO0D 2BYVE 2XGXA 2ZNZA 4XKVA 1WWXA 3U1DA 4E7KA 2XGEA 4JP0A 4M3DA 3TBIA 2JT1A 1LUJB 5C44J 2H27A 2AXLA 3LSRA 2HOAA 2D1HA 2WTEA 3S3NA 4KT5C 1SANA 2E34A 2EFPA 3TEDA 4FCYA 1IZ1A 3I71A 3GTMJ 4M6VA 1F1ZA 3BR3A 5H20A 5ILUA 2JA5J 1B9NA 3K2ZA 3CDHA 1WJAA 1S8NA 2DYSH 2KL4A 3A03A 1V4RA 2OPTA 2XAFA 3RCOA 2VT3A 4EMSA 3A01B 1ONVA 1U8RA 1O3QA 1Y8QB 2IGKA 1LKXA 3FXUA 1WPKA 3JRGA 1EA3A 1MSFC 3VPRA 3WE2A 2XASA 4GXOA 3TGNA 2QBYA 2ID3A 3ZN1A 1HF0A 1XTAA 2GWRA 1I3QJ 1ZLKA 1XDUA 3TMOA 4BACA 3I53A 2R92J 4D5FA 2LK2A 2R7QA 3OIOA 2K9SA 2HYFA 3SZPA 1JTYA 3G1LA 2R5ZA 5J3LA 3TP0A 2IGMA 4HF2A 1RUOA 2RGVA 2I5UA 3ZQLA 4O3MA 4XOPA 2OC6A 3ASOH 3LSPA 2IT0A 1RRJA 1J5YA 2DT5A 1E2XA 3IRRA 1X1BA 2CRGA 3TOBA 3BTCA 5LHGA 3FXLA 4QPQA 2ZJQF 5EZGA 3H5RA 3HOZJ 2LLKA 4AU7A 5F6FA 2W4SA 3PNYA 1QVUA 2KIQA 2A61A 1KONA 2XF5A 3BG5A 4I0AA 5CQGA 1WI9A 4RAYA 1SFXA 1GV5A 1UG2A 2UV1A 1QGPA 1SAUA 5F1JA 2OCCH 3NWTA 4GYGA 4EGZA 4HNTA 3KYLA 1S7AA 2IGNA 2DFEA 2Y9YA 2AQEA 2V1DA 2EQRA 4F93B 2E19A 1TQIA 4CDGA 5EDNA 2P81A 5BS6A 1SD4A 2RNJA 1KGSA 3G3ZA 3O3KA 4C30A 2CV1A 4IRGA 3G4SI 2VQHA 2PMZN 1IV6A 2EBIA 3FXJA 2FMLA 4G9YA 4AD9A 1FBSA 1PJRA 2F4MB 1I50J 3SHFA 2VBZA 1JI8A 3RI4A 1KU2A 2QQAA 3OYBA 1HOMA 4JX5A 2ZFUA 4LIVA 2Y48A 2DJIA 1MBKA 4X1EA 3JAMZ 3HHHA 2HS5A 2X0LA 3ZP5A 1OLTA 1ERDA 3OYMA 4RB3C 3V4GA 1I1SA 4HOBA 3LSJA 5FD5A 5FLXZ 2IA2A 2P6SA 5DUKA 4EJUA 4LIUA 5HLIA 1LPQA 3QU6A 2W24A 3GFLA 3IL2A 3PUFA 3GZ6A 3N4MA 1J75A 3H3VK 5E3OA 2QQ9A 4HDVA 3CCSI 2RVCA 1HQCA 3KLOA 4CH7A 4ENNA 3HOUJ 3TP3A 5M5XJ 2ECCA 3HJEA 3S14J 4A3CJ 2V9PA 1STZA 1OFCX 3AG1H 2GXGA 4IQJA 3FZVA 3VB2A 3JSOA 4ZTJA 2WWYA 1ZGWA 4BS9A 2BY2A 3OY9A 1YG2A 3BR6A 1IF1A 3GLXA 5TRDA 3SFIA 2VB6A 1XX5A 2ZFWA 1HKTA 5H6RA 2HNHA 2X6XA 1XSDA 3U1KA 2HKOA 3RPUA 2DN0A 4G6DA 3CTAA 3KP2A 2M7AA 2IEKA 4MFEA 2Y9ZA 1T95A 2X1DA 2H1KA 1EH7A 5JLXA 2LNBA 3PFIA 1TWCJ 2CFOA 3E6MA 5EYRA 5K1YA 5GAHJ 2EA4A 1BR2A 2HOEA 3MMYB 3PJRA 3L2RA 3ZQGA 2RREA 5J1YA 2EINH 2GZWA 4FQGA 1IG7A 1Y1WJ 1YI2I 2EFOA 4MTDA 4ESJA 4HX4A 2D2WA 2HEOA 3VYTB 4BXUA 4RA2A 4LG3A 2FOWA 5BMZA 2JQ7A 1T56A 3W2AA 1X1DA 2CU7A 3L2WA 1G3TA 2KIMA 4S05A 2JWTA 3FBNB 4LLNA 3QPHA 3W6VA 5IY5H 3B6AA 4A3BJ 1BI1A 2QSFX 5J1UA 5FKKA 5HODA 3DU6A 1PVEA 2LY9A 1LNWA 3G2BA 1W36D 1B9MA 4ENMA 4RAGA 3A02A 2LREA 3ECHA 4HV6A 5A2QK 4PJLA 4PFOA 4BGDA 1FNNA 2EIJH 2AHQA 3RZDJ 1NG7A 2LKSA 2FSWA 2MFZA 1CGPA 1VQNI 2R7SA 3OS0A 4E7LA 2CUZA 3P5JA 1TWFJ 2P5VA 2OZ6A 3WHBA 3GFIA 3BR5A 1Z6RA 3LSIA 3C2HA 3EUAA 1BR4A 4I99C 1LDKB 5K7HA 1E3PA 5GTHC 4M9ZA 1D5VA 2QA4I 3WTZA 5IYCJ 3H5NA 3GF2A 4U87A 5HDNA 2ZMEB 3EUKL 1BC7C 2BVLA 1AKHB 2GLOA 1AHDP 1HBXG 2AXTC 3B6CA 4FE7A 1JE8A 3DKYA 4WK8F 2DK5A 2B0LA 4IOCF 1MBHA 2M1BA 3H36A 2ZJ2A 4LGWA 4MEXF 4XRFA 3FM3A 1YE9A 2VC0A 2BOLA 3ONQA 4JBAA 5LGNA 2A68F 2VJJA 1VF9A 2QBYB 3JTGA 1TC3C 2E71A 4M72A 2ISYA 4BH9A 4QWQA 2JA2A 3H0GJ 5L3FA 3DLLF 1T0FA 5EGOA 3TDUC 1Y56A 2F5EA 3MKZA 3S17J 3VYUB 2RV8A 2CGPA 2MYSA 3BG3A 5JVTA 4CUGA 2E36A 2EA2A 5DEQA 3S2WA 3P9KA 2O3FA 2O9LA 4G6QA 1IRZA 5CYVA 3O2PE 3WE3A 4UNOA 3GTJJ 3BPVA 1UB9A 2FMYA 5KHDA 3C18A 2W00A 1HKQA 2DA5A 3K4BA 2E35A 1R1TA 4UVCA 2DQRA 1VQPI 3BJAA 4XBFA 1PYVA 4Z6YA 4XLFA 1F5TA 4IZZA 1X1AA 4B3AA 2FA5A 3HXLA 1LJ9A 4B8XA 1WQ2A 1XMXA 2A5WA 2MGQA 2VT2A 1VNDA 3T0YA 2E2IJ 1TWGJ 2G7HA 4RLQA 3RSNA 2FBHA 4CHUA 4GRIA 2F5CA 2DA1A 5E1XA 5D5VB 2YSRA 3G1MA 1KYZA 1XMAA 3HUGB 3I0TA 1B1BA 3GTOJ 1R22A 3VSKA 4BQOA 4MLOA 2K02A 2NS7A 4C9YA 1N77A 3QYEA 4DZPA 2MD5A 4NUBA 5DD8A 3CCLI 3ZMSA 2EZKA 3OMYA 4N0BA 4N9IA 2E1CA 2OF7A 4HLYA 1QRYA 4D7MA 2CQKA 3VYRB 1FIPA 1FSEA 4ZYHA 1LFUP 2HXOA 3M8EA 3FDYA 4XN0A 2ZCWA 2JVHA 2RC4A 3F8BA 3MKLA 2BXZA 3GVAA 2NOGA 2XAJA 2Y0SA 2IJLA 5AONA 2R3SA 3SZTA 3CP8A 5EG0A 4RB2C 2ELHA 4LB5A 3HOVJ 5DTDA 4K2EA 2R7VA 3M07A 3EDPA 3KETA 1ZREA 4L5IA 4EQQA 1B6AA 1Q1VA 3K70C 2BXYA 1IN8A 3DBRB 4PUSA 1C0WA 1U5TA 3BQYA 3VSLA 4A6DA 1PUFA 1BJZA 1BOAA 2HOSA 2V9VA 1R36A 1D3YA 1S6LA 4UVAA 3WODF 1OCCH 2OU2A 4XSXF 1DU6A 2DODA 2KT0A 3S93A 3OYCA 2Z99A 2NS0A 4A0YA 2EV5A 2L3DA 3HRUA 3ZRGA 3HTUA 4V19K 2LVSA 2LYCA 3PNTA 4TV7A 4Y52J 5IT9Z 4N9HA 3NQOA 1ZH5A 1T33A 3OOUA 5ICFA 4CYDA 2A69F 5K5OA 5HVQC 1SC7A 2QF7A 2OQGA 3NWSA 4Q4ZF 1SVLA 4U0YA 3R4KA 5C3EJ 3JAMK 2K40A 3I3LA 3LAPA 5F64A 1Y1VJ 1FP1D 2DA4A 2A6EF 1JGSA 3WTSC 2XC7A 2IAIA 1D0ZA 4YFNF 3AKZA 2VBXA 3E1SA 2M9HA 2FQ3A 2NYXA 1YTYA 2CQXA 4RLFA 5B66C 2KHMA 4UB8C 3F8CA 1BN5A 2DT6A 1ZRFA 4KN4X 1T08B 3Q3SA 1FYLA 3CJQB 3HBLA 2COMA 2LBFA 5DM7F 1GLNA 1XN7A 2WB1N 4ZDPA 1OISA 4JOMA 1YHQI 1TZLA 3K0LA 3ROUA 4LJZF 1OCOH 1O7LA 2CG4A 2IPQX 5M3MJ 3WTXC 2BE5F 1ZTRA 2EV0A 1QHGA 3KPHA 3BJ6A 4ENJA 1X1PA 1X58A 4WWCA 3HG9A 2YS9A 2PLYA 4XLHA 1G3YA 1X4PA 4AYBN 1F4KA 2DA6A 1A35A 1IRXA 2R5YA 4Q5SF 4CYCA 2ZJRF 3DPTA 3H3ZA 1GVJA 2VN2A 3U9GA 2KDZA 1HDPA 2Q0OA 2DMNA 4I76A 4BAYA 3ZQIA 3TW7A 4WF2A 5L3GA 1SD6A 2M3AA 4NHJA 2W85A 2JZYA 2JJ7A 3M3YJ 4EJOA 1HC8A 1FYMA 4B3XA 1FOYA 3JRFA 5DDGA 2V26A 3KZZA 1G59A 4G94A 3BP8A 3K9TA 3CCJI 4FX4A 2DFHA 4IX7A 2OJED 3FWEA 1VQOI 4M6YA 2DBBA 4H4KC 3JR9A 4D7NA 1WKMA 5DCMA 2M2EA 5KNLA 3IAM2 4DBQA 1WFXA 3MAJA 3ZMTA 4Y7NJ 4L9NA 1XC5A 2DTZA 5F1RA 1H89C 4OIQF 2L0KA 1BC8C 3CCYA 4AVPA 1MBFA 3K69A 1YO5C 4ENKA 1IC8A 2C6YA 4EJTA 3IAS2 2PX9A 1V3FA 4RM2A 5AIPA 2R0QC 3KP7A 4XICA 2XSJC 2LC2A 5LD2C 5KCMA 3GZNB 4CCNA 1XMKA 1XSXA 4OMYA 2XDVA 1Z6TA 2L5QA 3DF8A 4OMZA 1RKWA 3OSFA 1KA8A 1KQ9A 2L7KA 4O6JA 5EF6A 3L2UA 4GFBA 3OYEA 1R1VA 3JW4A 4IRHA 1N25A 2WA0A 3CP2A 3KP5A 4KICA 1SEUA 2RKHA 4XM3A 4XOTA 3ELKA 1JUSA 4ZYAA 2CW8A 4XORA 3RKXA 3RPQA 5HLTA 1FJLA 4EM2A 5IP9J 3IRQA 1Z7UA 3S3OA 1LEBA 2ZC2A 2ZXIA 4PGGA 3ZQQA 1EH6A 4I01A 2CUFA 3HOYJ 4PGHA 1RETA 1I27A 1R5GA 1PDNC 3ULQB 1B72B 3OYIA 2LF8A 4A69C 1VZ0A 3HDDA 4CO8A 3J7AY 3HSEA 4LG0A 4U7BA 2K9MA 3HPHA 4QIWN 1OYWA 2R5YB 1UMQA 4OINF 5HS8A 1WJFA 2JUCA 2MG4A 4QSHA 1FBQA 1WJCA 3ZQFA 2FD5A 2CFXA 2HQAA 1XD7A 3V7RA 3HB9A 4GCVA 3HKZN 2CW7A 1Q1HA 2EILH 5JHUA 2MSYA 2LD5A 1JHFA 2E2HJ 3NEUA 3KCCA 3OR2C 3KLNA 4ZDLA 4ON0A 2HQRA 4RBOA 1EKEA 3BWGA 2A5YB 5DCFA 2M4KA 3AFHA 3OS2A 2JA8J 2LFBA 4C2MJ 5GPCA 2JPBA 4A3JJ 4PJJA 3L9FA 5EG0B 1QPMA 4HA8A 5IYBJ 2O61A 4BQNA 4MFDA 1P9QC 1VQLI 4IKFA 5JVGF 2QQBA 1IRGA 3OYFA 3AL0B 3FXOA 4EJVA 3K4LA 2YU3A 1RR8C 1XB4A 2G7UA 2VLAA 1V5EA 1MNEA 3H9GA 3W3CA 1XGMA 4V2FA 1JKQC 4OOIA 1VQ8I 2L9NA 2DW4A 4DYCA 3EYIA 1VQ6I 4C2UA 3FX3A 3ISPA 3HOTA 2KPMA 2LSOA 4Q47A 3E5QA 4L0YB 1MKMA 4KT6A 2O03A 4NC7A 2M45A 4RGUA 1KYWA 3FK6A 3ZN0A 1AOYA 4UHTA 2Z33A 2GBYA 1J0RA 1NK2P 3H0DA 4U0WA 1VQ9I 1L3LA 4C2TA 5BPIA 3O8HA 3M8FA 4B48A 4A93J 4CA0A 3ERED 4E7JA 2JA6J 2KISA 1F43A 1P2FA 1CF7B 1AKHA 4WXDA 3D1NI 3NRVA 1D1BA 2YPRA 2ZXHA 1ZAOA 3G1OA 5L3EA 4MQVA 2VXDA 5E8GA 2O8XA 3JRBA 1TP4A 3RKQA 2M8GX 1Y39A 4IOAF 2EIKH 1ACIA 4BJ6C 4CCMA 2UXNA 3QPLA 2DOAA 1SFUA 1G4DA 3JRIA 2ZKZA 1RZ4A 2MH2A 3S1QJ 5FRNA 2VUMJ 3OYGA 2OBPA 3BZ6A 5HNHA 5M5YJ 2DK8A 3M8JA 2QYOA 4M71A 1W5TA 4I6ZA 1BI3A 3I56I 2CV2A 4A2UA 4W1UA 3CZ6A 4BU2A 2IA1A 1WSUA 1HCRA 2IGOA 1U6GA 3GTLJ 3I9V2 1KU9A 4BQAA 2WADA 4F7ZA 3E6BA 3S3MA 2R7XA 2FXAA 3AL0C 2L4MA 3R6SA 1U3EM 2A3SA 1F36A 4Y3OA 2CQ7A 2E1MC 1USSA 1S5LC 2AO9A 2LY1A 3BC8A 4BXXJ 2XRNA 1I1GA 3W2VA 5D5XB 3S2HJ 4WCGA 4BJTA 2V1XA 3N97A 4X0GA 2MC3A 4UXNA 2PG4A 3TL4X 3VWBA 1HW5A 1L0OC 4AM3A 5IP6A 2X6OA 5C4JJ 5D5UB 1B72A 3DKXA 2CUEA 3KE2A 3TOAA 2IRFG 1J7KA 2L01A 3GLLA 5LFAA 1BW5A 5E8IA 2XB0X 3GO5A 4MTEA 1YYVA 1SFEA 4HF0A 1TBXA 3LQRA 1S7OA 2XAQA 4E7IA 5CVRA 2V9KA 5JR3A 4KYWA 3WGHA 1B8IB 1H9TA 1TNSA 3SYTA 3HOWJ 4OIOF 4RMNA 3AG3H 1XSVA 4A3LJ 3ECOA 3RQ4A 2L4AA 1Z21A 3ZPLA 4FT8A 3LSKA 2M4GA 1W7PD 3K2AA 3UNGC 1ULYA 3EPZA 3H92A 1JXSA 4G7HF 4JX4A 3QP6A 3A0HC 2VQLA 3FM5A 4BE1A 4HRIA 1MGTA 2WAEA 1ZGAA 1FC3A 3MZHA 4FE4A 1OR7C 3GMEA 4PJ0C 4CCLA 1SVMA 5IP7J 1OYIA 3IH4A 3SEQA 3PIOF 2WV0A 2ICWG 3FMRA 2O5RA 5J8CA 3FHZA 1R71A 4S0HB 3OYDA 2H6CA 3LSHA 4CCKA 2LBFB 3AG2H 1WHUA 4M3BA 3I55I 2XSDC 3CJTB 5TGTA 1AA7A 3QPTA 3MKWB 5DCMB 1UHMA 3P9IA 1UCRA 3GZ5A 3HZJA 1S9HA 1OYYA 3QOPA 2HPIA 2UXXA 1HLVA 2DLLA 4YIIA 2L54A 3CF5F 5M5WJ 2NVTJ 2KP6A 1R5HA 3SDBA 5HOOA 4R79A 4A6EA 1XGOA 1D1CA 2KRCA 3BR2A 3JCUC 3I4MJ 3HRTA 5FB2A 3V7CA 2Y30A 4IHTA 2DYRH 4DIQA 4PSWA 2XKPA 2ACJA 1DGWY 2KRFA 2BY3A 2GXBA 4AIHA 2EB7A 1MNMC 4J01A 2G9WA 3KIOA 2MC4A 2QKLB 4EV0A 3J81K 2NVXJ 1VQKI 3ZMDA 4CSWA 2D1VA 2PMZA 5DV5A 2HKXA 5E3MA 2K7LA 4IHXA 2EK5A 4BY7J 4IO9F 1YRNA 1Z1DA 3HGYA 2YUSA 2QSGX 1JUPA 3MZ8A 1TQPA 4G7OF 2WY7Q 1SAXA 2ZO4A 3KYCB 4M3EA 4XK4A 3M1EA 5HDKA 2QCOA 1TT5B 3F8MA 4IHYA 2VJ4A 4HG2A 2LKXA 3BR0A 5B5EC 2MD0A 3OR1C 2R7TA 1K79A 4BEHA 2V1UA 4G12A 2F2EA 1W0TA 3WTYC 1EF4A 3A1YA 4AVZA 5EEGA 3LMMA 2STWA 1HDDC 4CYCB 4A3MJ 1IDYA 1RR7A 2CMPA 2RQPA 4OAYA 3QRFF 3C7JA 3LSTA 4FX0A 1P6RA 1R00A 4PDKA 5IPAA 1AWCA 4D5CA 3CCRI 2L7ZA 1EJ9A 2M8EA 4P5OA 3AAFA 1QA6A 4ABZA 4DJAA 3JSPA 3GTKJ 2YR2A 2HDWA 3TO6A 3CMEI 4C3HJ 4CZCA 2Q1ZB 4HQEA 1GDTA 1DQUA 1IN4A 3ZOBA 4XL9A 1A6IA 2X9DA 3ABTA 1V5FA 3FBIB 1U5TC 1WRJA 1PP7U 1Z3XA 1J2XA 4XQFA 2XVCA 5GAGJ 2VOOA 3IHUA 3BZCA 1JKOC 4FHTA 1E0EA 4KA4A 1HKSA 4U0VA 4IRIA 1R58A 4PCQA 3JTHA 2ELJA 2CS3A 1RKTA 2EFNA 1GVDA 4DBRA 3PM1A 1K83J 3KP6A 2PJPA 1ON2A 2H6BA 2KMUA 3LSMA 3L1PA 1K6YA 4IXAA 3I64A 4M9XA 1K4SA 2XGCA 2JUGA 3E3VA 1VQMI 1F9NA 2FX0A 2Q2EA 5J40A 4L5JA 2UWMA 2KRHA 2CYYA 2W84A 4QTRA 4BBRJ 2NXNB 3HL2A 1W36C 2EJRA 1G8XA 2XROA 2FNAA 4IPAA 1ETQA 1YX3A 2TDXA 4KITB 4NC8A 2FOKA 2MABA 3DU5A 1IJWC 1MMNA 3I5UA 2XB5A 1KU3A 5KAIC 2D5VA 1IXCA 3ABKH 5DUIA 4LK1F 1T6SA 1FSHA 2P7VB 2DQLA 3C3WA 3R61A 4X6AJ 3EETA 1DPRA 2O6GE 1WJ5A 5K5QA 1WJDA 2IXSA 1YIOA 1BI0A 4GO1A 1SMTA 2GA1A 1VQ7I 2LR8A 3CUQA 5CJ9A 3OL3A 2H94A 4RGXA 1UFMA 1WGXA 2DAOA 3PSFA 1X4OA 4EJWA 2VJ5A 1RPWA 1EH8A 1XGNA 3J7AO 3I4NJ 4OIPF 5E1ZB 2JMWA 4ZH4F 2HYJA 3DXJF 4BXFA 2VQGA 2Z2SB 4A3GJ 1CQTA 1E3OC 4HX8A 2DA2A 4NB5A 3LSGA 2BW3B 1YQAA 3CJRB 3CJNA 3ABMH 4RAZA 4P1WA 5J4VA 2B7EA 4A0ZA 1VQ4I 1W7PA 3H5AA 3LFKA 2CJJA 2J5PA 2NVQJ 2H8RA 5KVRA 2MH9A 3GYHX 4IEJA 2VC1A 2XV4S 1ZG5A 4ANJA 4I98B 1WZ2A 1ZG3A 2VPRA 4IHSA 3DP7A 3B73A 1U2WA 2YX7A 4MQ9F 2VI6A 3IUOA 2IS2A 2W25A 3H1CA 4LLLA 3DKWA 3RTRA 1ZYRF 2FBIA 4BKXA 4DGWB 2HGCA 4I0BA 1MJAA 3HC7A 3P9CA 1IN6A 3BCAA 3DTIA 3FKJA 4J00A 3IWFA 5L3BA 2EZLA 2GQQA 2D45A 1YX5A 2VIXA 2EPFA 1D5YA 3C1DA 1H0MA 3WGIA 1QU3A 1TNTA 3Q9VA 2LH9A 2K3PA 2XAGA 1Z9CA 2CO5A 3V8KA 1A31A 1A5JA 3GWZA 1BJAA 3CCEI 2GXAA 4MO7A 4E70A 1QZZA 4UUSA 4PJMA 2OTJI 4RS8A 4KDPA 3ZQCA 3K6GA 3DEUA 5DYMA 4J19A 2JK3A 3DQVC 4WXHA 1MSEC 4XKCA 2P4WA 3WHCA 3CCUI 3ZMUA 2IA0A 1ETKA 3BQZA 5FD6A 1LEAA 2ZNYA 3IC7A 3DBLB 2DXIA 2EIMH 5FFZA 3WU0A 4RB0A 2E7WA 4G7ZF 2XPWA 4PJNA 2RQQA 4OIRF 3J7ZI 3E7LA 1IN7A 2JVGA 3FXMA 1LFBA 5GADJ 1MDMA 1UG0A 2K5CA 4UUTA 5FRMA 4M3GA 4YFKF 1T39A 5FLXK 2KJBA 4R1HA 2GA2A 3LA2A 3ZCOA 3S15J 5BOXA 4A3DJ 1S3JA 2OAZA 1YJ9I 4KNYA 2V1NA 3F6VA 1U78A 2VBWA 1JKPC 2JPCA 4KIGA 1QPIA 2EH3A 3ESWB 3MQ0A 1R4NB 4BNCA 4RB1A 1YITI 2JRMA 2Y75A 5HDGA 5EJCA 5LRRA 2Z9OA 3OYKA 1O3RA 3CUQC 1ZR4A 5ILSA 3OIQA 4UV9A 2DDBA 2VJIA 3PO3J 3CO7C 1BI2A 1ON1A 1JTXA 5E1WA 2R7DA 5BNGA 1MBGA 3K1MA 4DZJA 1Z3YA 2W48A 1O3SA 3OOPA 3F22A 3BOQA 4ASNA 2LRDA 1IUFA 2WC2A 3D5SC 2V6CA 3O8GA 2X1EA 4C3IJ 1OCTC 6PAXA 4MNUA 5ICGA 3QODA 1HXDA 3J80Z 2QVOA 1ITYA 2ADUA 5CQEA 1P7IA 2HYGD 3BG6A 4QLCU 4RAFA 2A6TA 3CQZJ 1WVRA 3L00A 3WU2C 2X6WA 2DMTA 2TRTA 2HFHA 1UZCA 5B1AH 3RPUD 2ZSIB 2WAFA 1MDMB 2V7FA 1ETWA 2CSOA 3M7GA 3BDDA 2L2OA 4C3JJ 1I5ZA 2GOMA 2A05A 1VI0A 4BUPA 2QENA 1UAAA 4ITVA 1W7PB 1SFOJ 2L9RA 5J4YA 1ZKGA 2FE3A 3X2QH 4HQMA 4JQFA 4Q48A 2FUG2 5E17F 2IS6A 5ERIA 3U21A 3ZQ7A 1DGRM 4B09A 5GAEJ 2KZVA 5LGTA 1APLC 3OYLA 3FXRA 5HLHA 1O7FA 2I10A 2RNGA 4BE2A 4I09A 5D4SA 2P0WA 1M1EB 1UJ8A 2P5KA 3K10A 2M30A 2CQQA 3EYYA 2ESHA 1P4XA 2MA3A 3U2RA 2L7MP 2PI0A 4YEJA 5JFRA 4I02A 1FMVA 4L18B 3E97A 3KZYA 3CUQB 3F6OA 2KFDA 3QQAA 4Y17A 4RGSA 3BTLA 3CF2A 3RDIA 3CO6C 1OKRA 4A3EJ 2IS1A 4KMUX 4RGRA 4EATA 3J80K 1PP8F 3V8LA 2VKHA 3MD2A 1FIAA 1ODDA 1DP7P 3OIPA 5H6QA 3SQNA 2AQFA 1Z05A 2XAHA 5GPAA 1W1WE 4RM3A 3WG7H 1GT0C 3EUHA 1XGSA 1BOBA 4OWRB 5FKLA 2LF7A 1R49A 2ZMEC 2LMDA 3L7WA 2L7FP 3LNQA 3HYIA 3CESA 3R60A 2DFFA 4KIFA 4E7SA 1W5SA 1TT0A 2K27A 2DU9A 4FTHA 1LQ1A 4M6XA 2EZIA 3HUGA 2CH0A 5FKMA 1NK3P 2X85A 4XMYA 3VOEA 1MW7A 1O4XA 4AIKA 4LITA 1IAWA 1ETXA 2PJRB 1MNDA 5JHFA 4B44A 2BEOA 3CCVI 2FEZA 2HZDA 4WXCA 1TWAJ 3Q5FA 1V55H 2HI3A 1FTZA 1D8KA 1H9GA 5E18F 1K6OA 2QWWA 2PMUA 2HVSA 3TKYA 4BDZA 1B8IA 4BHCA 4HF1A 1X2MA 2EFQA 4LK0F 2VKEA 3CDLA 3H35A 3RYPA 4E6KG 2UZKA 1QHHD 1UELB 2HTSA 3RKYA 1KU7A 2CW0F 4YELA 4IHVA 3K4CA 5D5WB 2GM4A 3SEZA 3MZYA 1W5CC 1LDDA 1Y6IA 5D6EA 1X1CA 4KJZA 3CC4I 1IW7F 1X19A 1X3UA 2LP0A 2RDPA 4MGRA 3RIRA 3L2VA 4HZFA 4EM0B 3DEWA 4WX9A 3S2DJ 4JX6A 3CMAI 4BL0B 2M7BA 2JN6A 3QWLA 2V6EA 4N4OB 4P96A 4HNVA 2DO7A 3J7YJ 2LY2A 4XLCA 4YIRX 4ZC3A 1FOKA 2M34A 2G0EA 2HZTA 3FF5A 3OL4A 2Z1DA 5K5RA 4GDFA 2OV7A 3BY6A 3KFWX 1SD7A 1VQ5I 5FLMJ 3ZXSA 1R23A 3CMMA 1FY7A 1Z0XA 5TJJA 1H8AC 2O8KA 2Z5UA 2HQ5A 5FKNA 2JSPA 2K86A 5FLVA 2GIZA 3I58A 1N75A 5DM6F 3GCMA 4HAMA 3DCFA 5KK1A 3UR3C 2KZGA 2QLZA 2M87A 3JRHA 3O6BB 4IVNA 3F21A 1OJLA 4LG0B 1S72I 3BROA 2L9SA 2XUBA 3ASNH 1HW2A 1UHWA 5ICCA 3Q0VA 2DOFA 5LEKA 1JT0A 4BEHB 2E60A 2BVMA 3BCBA 2R7ZJ 2BHZA 5M3FJ 3G71I 3QAHA 2X4HA 4CCOA 3DFGA 1FX7A 4II3A 4UUVA 1ZN2A 2L9VA 4RDUA 4AUXA 1USTA 1RNLA 3GEZA 5EEAA 3CCMI 1DUXC 2R93J 2KJCA 2IS4A 1A36A 4W97A 3GW2A 2JTVA 3B02A 4KIBA 2R4GA 1OCZH 3ABUA 4LLGF 2LOOA 3HOSA 1QVTA 5F0CA 1R1UA 1I6XA 1P7JA 1TL8A 2E1OA 2DDAA 1BA5A 4E7HA 2XIGA 4DOZA 4IJAA 1KZHA 1S29A 3DLAA 3SXYA 1I3AA 2BHYA 2RN7A 1ZG1A 1POGA 1JHHA 5AIQA 2Q2EB 3IKTA 3LQQA 3CLOA
chains in the Genus database with same CATH topology
3OOUA 2KLOA 2X6YA 2HDWA 5HVQC 3NWSA 2Q1ZB 4CZCA 1DQUA 3OYJA 4XKWA 4XL9A 2GOXB 4BE0A 3I3LA 1V5FA 3FBIB 2XF6A 3V42A 1Z3XA 4XQFA 2XC7A 1D0ZA 3AKZA 2UUZA 3E1SA 2VQCA 4RLFA 2KHMA 1E0EA 3N05A 2DT6A 4BQQA 4HPQA 3OYAA 2R7RA 3FHNA 2ELJA 2CS3A 2LG4A 3CJQB 2LBFA 1GLNA 4DBRA 4ZDPA 3BG7A 4JOMA 1TZLA 3LSMA 2KMUA 2R7OA 1K6YA 1J09A 2PJRA 1T0FC 2JUGA 2XAUA 3PSIA 3M1CA 2UWMA 3LFUA 3A4CA 1QHGA 2KRHA 2VKDA 2WAQA 4NQWB 3HG9A 2HVQA 4HSRA 4Y4RA 2V4JC 3ZGKA 4XLHA 3HL2A 1W36C 3D5RC 1X4PA 1G8XA 4B43A 4II2A 1IRXA 1YX3A 2CUJA 5HNFA 4KITB 3DPTA 3L2QA 4NC8A 3K70D 2MABA 3DU5A 4XLEA 2DCEA 1MMNA 3K4JA 4PK4A 3QYBA 3SZGA 3VDXA 4XONA 4XKVA 2W7NA 4N4NB 4E7KA 2M3AA 3TBIA 4B3XA 1WJ5A 2V26A 1WJDA 2IXSA 3S3NA 1G59A 4BJ5C 4IX7A 3OL3A 4H4KC 5KNLA 3PSFA 1V5GA 1X4OA 3IAM2 4DBQA 1WFXA 2VJ5A 1WJAA 2KL4A 3RCOA 1ZELA 2IGKA 1LKXA 3IAS2 4BXFA 1EA3A 2VQGA 2Z2SB 4F3QA 3LSGA 4RM2A 4HNUA 2BW3B 3CJRB 5FROA 2XSJC 3TMOA 4BACA 2LC2A 2R7QA 5LD2C 4P1WA 5KCMA 4CCNA 2XDVA 2L5QA 2IGMA 3H5AA 2L7KA 3MKYB 3L2UA 3OYEA 4XOPA 2OC6A 2WA0A 3CP2A 4XM3A 1X1BA 4XOTA 4PSXA 4ANJA 4ZYAA 4QPQA 2CW8A 4XORA 5HLTA 3H5RA 4AU7A 2W4SA 3S3OA 3PNYA 3IP4B 1KONA 2XF5A 2ZXIA 3IUOA 5CQGA 3DTKA 2IS2A 3ZQQA 1D0XA 3RTRA 2UV1A 4DGWB 1SAUA 3HC7A 3NWTA 3BCAA 3DTIA 3FKJA 4J00A 3OYIA 4HNTA 3KYLA 1VZ0A 3J7AY 2IGNA 2AQEA 4OAZA 1YX5A 1D0YA 2VIXA 4U7BA 2K9MA 1QU3A 3HPHA 4F93B 2XF7A 1DP3A 2LH9A 2K3PA 4XKBA 2KQRA 1WJFA 2WY8Q 4BDYA 1WJCA 2HQAA 2F4IA 2CW7A 4C30A 2CV1A 4PJMA 2VQHA 3OR2C 4Y33A 3K6GA 2WBMA 3DQVC 5CKTA 4ZDLA 1PJRA 4XKCA 3PL8A 1JI8A 2M4KA 3AFHA 3OYBA 2DXIA 2ZFUA 4LIVA 3OS2A 4ZTFA 2DJIA 4PJJA 4PJNA 2RQQA 4BQNA 3QOEA 2JVGA 1OLTA 1P9QC 1ERDA 3OYMA 4IKFA 1UG0A 2K5CA 5FRMA 4FETA 3OYFA 2CV0A 3AL0B 3K4LA 4LIUA 3ZCOA 3S32A 2VLAA 2V1NA 1V5EA 1MNEA 3H9GA 4G6TB 3W3CA 4CH7A 2L9NA 3GBGA 4C2UA 3K4KA 3HOTA 2KPMA 1BR1A 4IQJA 4KT6A 3QYFA 4NC7A 4ZTJA 3OYKA 4BS9A 3OY9A 3OIQA 2OUMA 2BW3A 2VB6A 2VJIA 3H0DA 4C2TA 2HU9A 4B48A 4CA0A 2VPLA 4E7JA 2HNHA 2X6XA 1Z3YA 3K4NA 1D1BA 2LRDA 3D5SC 2M7AA 3HKZA 2ZXHA 2X1EA 1T95A 4QPOA 2X1DA 4F92B 4IQ4A 2VXDA 1NG6A 3QODA 3HPGA 1U0JA 2CFOA 4BJ6C 5CQEA 4CCMA 1BR2A 3BG6A 2DOAA 3MMYB 3PJRA 2A6TA 3L2RA 3DWLE 2X6WA 2RREA 1N78A 4B47A 5FRNA 3RPUD 2ZSIB 2WAFA 3OYGA 2V7FA 1MMDA 2K9LA 2L2OA 5HNHA 2GOMA 3M8JA 3VYTB 4LG3A 4BUPA 3W2AA 1UAAA 1X1DA 3DPLC 4ITVA 2CV2A 4BU2A 3CZ6A 3L2WA 4KISA 2IGOA 3FBNB 4JQFA 2KDOA 1HA8A 2FUG2 3I9V2 2IS6A 2WADA 3S3MA 2R7XA 3U21A 1DGRM 3AL0C 4ZJZA 1LVKA 3DU6A 3OYHA 3G2BA 2KZVA 1W36D 4Y3OA 2LY1A 2E1MC 3BC8A 3OYLA 2RNGA 2E5ZA 2LREA 3W2VA 4BE2A 4BJTA 4E7ZA 2P0WA 3K10A 4PJLA 4PFOA 4X0GA 3TL4X 4BGDA 3VWBA 2X1CA 1NG7A 2MFZA 2R7SA 3DEEA 3OS0A 4YEJA 4E7LA 2CUZA 3DKXA 1D1AA 1FMVA 5LFAA 3CF2A 3LSIA 2VXZA 3C2HA 3EUAA 1BR4A 1LDKB 2IS1A 4EATA 2R7UA 2VKHA 3MD2A 4HEA2 4E7IA 2V9KA 4NNJA 1FMWA 2WB1A 3OIPA 3F9KA 1LFPA 2VASA 2Z16A 2AQFA 3SYTA 3PFYA 3H5NA 4U87A 2VL8A 4RMNA 3DTEA 2W82A 4RM3A 3EUKL 3LL7A 2X51A 1BOBA 1R6RA 4OWRB 3RQ4A 3OS1A 1Z21A 2BVLA 2F6CA 3KX2A 1WJEA 3CESA 3LSKA 2M4GA 4E7SA 3A2KA 3UNGC 1TT0A 2M0MA 3DKYA 3EPZA 4YRVA 2VQLA 2CH0A 4BE1A 4HRIA 4D1QA 2WAEA 4XNFA 3H9JA 1YE9A 2X85A 2QKMB 2BOLA 3ONQA 3H9QA 4XMYA 1MW7A 1OR7C 4LITA 2VJJA 2E1MB 4CCLA 2PJRB 3C2GA 1MNDA 5JHFA 4B44A 3SEQA 2JA2A 2HZDA 1Y56A 2O5RA 4HSTA 3MKZA 3VYUB 3OYDA 1WJBA 2MYSA 3LSHA 2DT7B 2LBFB 4CCKA 4CUGA 2W1OA 3E0JB 2HVSA 3OYNA 4BDZA 5TGTA 4ZDOA 3OWTA 1AA7A 3MKWB 4E6KG 3H35A 1Z7LA 1QHHD 1SFKA 1UELB 1S9HA 5KHDA 4YELA 3W2WA 2HPIA 3K4CA 2W00A 3K4BA 3SEZA 4D9JA 1Y6IA 1X1CA 4KJZA 1X19A 3PNVA 3L2VA 1PYVA 4XLFA 2KP6A 2NOJB 3KEYA 3SDBA 5HOOA 4BL0B 4IZZA 2M7BA 1X1AA 2V6EA 4N4OB 3HXLA 4XN3A 4R79A 1D1CA 2KRCA 2A5WA 2LY2A 4XLCA 4CCJA 4RLQA 4ZC3A 3PUBA 3RSNA 3ZR8X 4GRIA 4DIQA 3OL4A 4PSWA 2Z1DA 2OV7A 1DGWY 3HUGB 3BLYA 5CPRB 3ZXSA 3VSKA 4BQOA 4MLOA 4XR6A 3CMMA 4C9YA 4J01A 1N77A 3QYEA 1MMGA 2MC4A 4NUBA 2QKLB 2JSPA 3OMYA 4CSWA 2PMZA 1N75A 3UR3C 3D5LA 4F55A 3VYRB 2L9SA 2F5VA 3DPUA 4AYBA 3FDYA 2WY7Q 4XN0A 4BEHB 2E60A 2JVHA 2BVMA 3BCBA 2E5NA 4CCOA 2Y0SA 2VJ4A 4HG2A 2HVRA 4II3A 3S8PA 2MD0A 3OR1C 3CP8A 2R7TA 4BEHA 2R7VA 3VYSB 3K70C 2HPMA 4PUSA 4E4HA 3A1YA 2IS4A 4F52A 3VSLA 4AVZA 3EUHC 3LMMA 4XLAA 3K4MA 2R4GA 4F91B 3HOSA 2LOOA 2ZSHB 1MMAA 2CMPA 3S93A 3OYCA 4OAYA 4E7HA 4DOZA 4FASD 2I8DA 3DLAA 3ZRGA 2R7WA 4P5OA 2LYCA 3PNTA 4PFPA 4DJAA 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF5 A;  2XF7 A;  2XF6 A; 
#chains in the Genus database with same CATH topology
 3FXK A;  2X6Y A;  3CUO A;  5JLW A;  1LE8 B;  4HBL A;  2YU9 J;  3IH3 A;  1ETY A;  2O0Y A;  4NDL A;  1XPX A;  3LA7 A;  3WTW C;  2QSH X;  4CXF A;  3A0B C;  4BE0 A;  3I59 B;  1ZR2 A;  2LKP A;  2PEX A;  5LRS A;  3NAR A;  3CMY A;  1VTN C;  1A04 A;  2WV1 A;  2H1L A;  4XID A;  3N05 A;  3E5X A;  1SD5 A;  4HPQ A;  1J9I A;  2FJ1 A;  2QEX I;  2TCT A;  1XG1 A;  1DPU A;  5J1R A;  2X48 A;  3T1B A;  2QZ8 A;  3L2C A;  3MEX A;  2VE9 A;  5FO5 A;  1YS7 A;  1JUM A;  1W4M A;  2ELK A;  1J09 A;  2VKV A;  3UKG A;  3HRS A;  3Q0W A;  3MN2 A;  3PSI A;  1UHS A;  5B3S H;  2QGU A;  3LFU A;  3A4C A;  4NQW B;  3BTJ A;  5K7Z A;  3BZK A;  1GUU A;  4Y4R A;  2V4J C;  2FQ4 A;  3REO A;  3ZGK A;  1P4W A;  3FKI J;  4KUM A;  4CGZ A;  3WTT C;  4MIM A;  1MJ9 A;  1ETO A;  1BIA A;  2DMP A;  4B43 A;  4II2 A;  3LA3 A;  1HW1 A;  2CUJ A;  5HNF A;  5J47 A;  4XLE A;  1RC9 A;  3GFM A;  4A5N A;  3K4J A;  3W6J B;  2ME6 A;  1B4A A;  1MZB A;  3IH2 A;  3QYB A;  4MEY F;  3VDX A;  4XON A;  2W7N A;  4N4N B;  3GTP J;  5FFX A;  1K4T A;  1MH3 A;  1K61 A;  2P6T A;  3TO9 A;  3ZMZ A;  1SVO A;  2ESN A;  2HDC A;  4AWX B;  4XSZ F;  3QU3 A;  2CQN A;  5CVJ A;  4BJ5 C;  4UVB A;  2KIF A;  4XRM A;  5D8K B;  1FPQ A;  2FRH A;  5BQT A;  5J8F A;  1Y0U A;  1W0U A;  2IP2 A;  2ETH A;  1E3H A;  1V5G A;  3K1P A;  1IV8 A;  3V7S A;  2DI3 A;  4XLP F;  4XRS G;  1YRN B;  1V54 H;  1BIB A;  1T2K A;  5CVV A;  2A07 F;  1GV2 A;  3MVP A;  1K78 A;  4XLN F;  5E3L A;  1ZEL A;  2MLK A;  2NRA C;  1BL0 A;  5K7F A;  2XPV A;  2PFB A;  5FGM A;  4F3Q A;  3JRD A;  2E7X A;  4GYI A;  4HNU A;  3KEQ A;  1IN5 A;  3KEO A;  5FRO A;  4LMY A;  1YW9 A;  1WCM J;  1BM9 A;  4BY1 J;  3MKY B;  5LEJ A;  1TW3 A;  2IVM A;  4G8X A;  1JT6 A;  2JA7 J;  3E5U A;  1K78 B;  2ZBK A;  2HWV A;  3GXO A;  4PSX A;  4D0P A;  3WU1 B;  3CC7 I;  1R7J A;  5D8L B;  5FKO A;  2FF4 A;  3IP4 B;  2XHK A;  4DW6 A;  5F0H A;  4YG2 F;  5F04 A;  3DTK A;  1A6Q A;  3WG9 A;  1D0X A;  3COA C;  1E17 A;  2VBY A;  3RZO J;  2E2J J;  1YLF A;  2PMH A;  1XS9 A;  4IF4 A;  1P92 A;  3GX4 X;  3CDI A;  1U8B A;  3SDG A;  3BPX A;  4OAZ A;  1ZRD A;  3F3X A;  1D0Y A;  5CVI A;  2R5Z B;  4GGG A;  3LOC A;  1ORK A;  3K7A J;  2XF7 A;  1DP3 A;  1G3W A;  3HOX J;  1MBE A;  4XKB A;  2KQR A;  3F23 A;  2WY8 Q;  4BDY A;  4P9F A;  4KMF A;  3S1N J;  2F4I A;  4R8H A;  1K7A A;  1AU7 A;  3TO7 A;  1O3T A;  2DFI A;  2QQ8 A;  2DOE A;  3Q0U A;  4A0X A;  3BG9 A;  4B4C A;  4EM1 A;  5LHI A;  4DNC A;  2P8T A;  4Y33 A;  2WBM A;  3T5X A;  5CKT A;  1R4M B;  3PL8 A;  3FXQ A;  1RI7 A;  2COB A;  3WTU C;  1PUF B;  2ECB A;  2NNN A;  1Z67 A;  1G2H A;  1FP2 A;  1I39 A;  4ZTF A;  2M5W A;  3W6K B;  1QNT A;  2EZH A;  4YFX F;  3QOE A;  5HS9 A;  4L9V A;  4O5V A;  1YFH A;  3FIS A;  4HV5 A;  2OQR A;  3QP5 A;  4FET A;  3RQI A;  3T8T A;  1T98 A;  5EEH A;  2CV0 A;  1Y0N A;  3DBH B;  3Q9S A;  3LWF A;  3HSR A;  1TLH B;  4NC6 A;  2EWN A;  2BV6 A;  3F0C A;  3S32 A;  1FLI A;  3KYD B;  2N8G A;  2VON A;  2XRL A;  2NVU B;  4HLX A;  2STT A;  4G6T B;  4UY8 I;  3GBG A;  4LD5 A;  3ABL H;  2OTL I;  3T8R A;  5TIS C;  2MW8 A;  3K4K A;  3MCZ A;  1DDN A;  1BR1 A;  2XGD A;  3LAJ A;  1KQ0 A;  2K4J A;  3QYF A;  2FU4 A;  5A2Q Z;  1LE8 A;  1JKR C;  1R5I D;  4JYK A;  3HM5 A;  3TQN A;  3HTS B;  2LDU A;  2BBY A;  2OUM A;  3V8J A;  2BW3 A;  2H09 A;  4BHB A;  2Z3Y A;  4ZZL A;  2HU9 A;  3F8F A;  3PQJ A;  1SMY F;  3S1R J;  5IOZ A;  2VPL A;  1LDJ A;  2YX4 A;  2OA4 A;  3AG4 H;  3K4N A;  3A01 A;  5FJ8 J;  5B1B H;  2CWE A;  3HKZ A;  2Y0S N;  4QPO A;  1QQI A;  4F92 B;  1FYK A;  2QUF A;  1REP C;  4IQ4 A;  1NG6 A;  1ZK8 A;  3HPG A;  5LGU A;  2MLG A;  1G6N A;  1U0J A;  2F4O B;  3BR1 A;  1X3W B;  2E1N A;  5GP9 A;  1X2N A;  4ZYE A;  2W57 A;  5ED4 A;  3GUD A;  3DWL E;  2NS8 A;  4HX7 A;  1H88 C;  1N78 A;  4B47 A;  5EZH A;  2HTJ A;  1DU0 A;  1YS6 A;  2BY0 A;  3ERM A;  1MMD A;  2K9L A;  1R9T J;  3RYR A;  4HW0 A;  3IV5 A;  1MH4 A;  1S7E A;  4LOC A;  2BZT A;  1FBU A;  1CF7 A;  4I7H A;  3DPL C;  2GIV A;  3L09 A;  4A5M A;  4KIS A;  3ZQH A;  2K3F A;  2KDO A;  1HA8 A;  1OR7 A;  4L5E A;  1I6H J;  2XKO A;  2ZXJ A;  3GFJ A;  2FBK A;  4ZJZ A;  3QPS A;  1LVK A;  1IXS B;  4HYE A;  3OYH A;  4XRS A;  4Y15 A;  4EVI A;  2E5Z A;  1GXQ A;  1G3S A;  5HS7 A;  4H0E A;  3F8N A;  4E7Z A;  2ZME A;  1MJB A;  2JRT A;  5L3C A;  3WGG A;  1HST A;  2X1C A;  1JJ6 C;  3F72 A;  3DEE A;  5D6F A;  5L3D A;  2H8W A;  3G6E I;  4BBS J;  1KQ8 A;  2DA7 A;  5GTI C;  2EV6 A;  1D1A A;  3CD6 I;  2V79 A;  4L9T A;  4M73 A;  4A12 A;  2DPU A;  3RKW A;  2GAU A;  2VXZ A;  5ICE A;  4V2G A;  3I54 A;  2R7U A;  1BBY A;  2IW5 A;  4HEA 2;  4P9U A;  1D8J A;  4NNJ A;  1FMW A;  2WB1 A;  3F9K A;  3ML6 A;  1WH7 A;  2F5D A;  2NAZ A;  1LFP A;  2VAS A;  2WAQ N;  2XPU A;  2Z16 A;  4P55 A;  5C4X J;  3GTQ J;  1O57 A;  3PFY A;  2VL8 A;  1FT9 A;  2W82 A;  3DTE A;  3LL7 A;  1VFC A;  1ZAR A;  2X51 A;  1R6R A;  2DMQ A;  3OS1 A;  3BJO A;  2HOT A;  2F6C A;  3KX2 A;  5EGO B;  4ESB A;  1WJE A;  1QZY A;  5H2F C;  4Y13 A;  3A2K A;  1IXR C;  2M0M A;  4YRV A;  3I4P A;  4YIF A;  3CCQ I;  4M74 A;  1TQM A;  4NQW A;  2KIU A;  1RIO H;  4D1Q A;  2L02 A;  4XNF A;  3H9J A;  3RJP A;  2QKM B;  4LFU A;  3H9Q A;  2DPD A;  5JI6 A;  5LBQ A;  3R0J A;  2E1M B;  3C2G A;  2VOP A;  1HSJ A;  3JRE A;  3FIW A;  4HST A;  3CLQ A;  4DQ2 A;  1ENH A;  2NVY J;  1LVA A;  1EV7 A;  1WJB A;  1Z77 A;  4Z2Y A;  2DT7 B;  2W1O A;  3E0J B;  3FK7 A;  1RES A;  3IKV A;  3IWZ A;  2JSC A;  4KFC A;  3OYN A;  3HGG A;  3KP4 A;  4ZDO A;  3OWT A;  3J81 Z;  1U9O A;  3SJM A;  1T38 A;  4PZJ A;  4LB6 B;  1MIJ A;  4CZZ A;  1FWZ A;  1Z7L A;  1SFK A;  4U7D A;  1OCP A;  5IT3 A;  5LHH A;  3W2W A;  4BYY A;  2ID6 A;  2IBD A;  3WTV C;  1NHA A;  4D9J A;  4AC0 A;  3JRA A;  2K85 A;  1FOW A;  3DV8 A;  1TWH J;  2P5L C;  1NH3 A;  2OD5 A;  3PNV A;  3PQK A;  4HDU A;  3FMQ A;  2NOJ B;  2FNP A;  3FMS A;  2K9Q A;  3KEY A;  9ANT A;  3I59 A;  1NTC A;  4OU0 A;  1T8I A;  3HRM A;  1YJW I;  1FEX A;  4L9J A;  1XCB A;  1JGG A;  1JJ8 C;  4XN3 A;  1PUE E;  4DYR A;  1OMI A;  4ZYG A;  4U88 A;  2F48 A;  5CLS A;  4CCJ A;  2DTR A;  3PUB A;  3ZR8 X;  2R7F A;  4UV8 A;  5J6X A;  3TW6 A;  1QBJ A;  4KN7 X;  1ETV A;  3BLY A;  3PO2 J;  2Q8K A;  5CPR B;  4XR6 A;  1MD0 A;  1MMG A;  3HEF A;  3C2B A;  2HDD A;  2VOD A;  1OCR H;  1ZHF A;  4L0Z B;  3R0A A;  1YW8 A;  3D5L A;  4IHW A;  4JK1 X;  4F55 A;  5IOY A;  2F5V A;  3DPU A;  3CC2 I;  4AYB A;  2ISZ A;  3GTG J;  4ZYD A;  1WI3 A;  2HQN A;  3TDZ C;  1YW7 A;  4MHG A;  1XCV A;  4B1R A;  3MFK A;  3M4O J;  2E5N A;  1IO2 A;  2A6H F;  4ETS A;  5KAF C;  4CIC A;  1QZE A;  3JRC A;  2P7C B;  2HVR A;  2HR3 A;  5E20 A;  3S8P A;  1ZRC A;  4BHP A;  4I2O A;  1U9N A;  2OZU A;  3VYS B;  1X3Z B;  1P4A A;  2BY1 A;  4EGY A;  2RAE A;  2HPM A;  4E4H A;  4F52 A;  2F5F A;  3EUH C;  3M9A A;  4XLA A;  1Y8R B;  3K4M A;  5F08 A;  4F91 B;  5HLG A;  2K9N A;  3D0S A;  2ZSH B;  1MMA A;  1IUY A;  2ME0 A;  2O7O A;  3E6D A;  4UB6 C;  3ZMV A;  5F0F A;  1MMS A;  4FAS D;  4EEF G;  1LB2 A;  2DA3 A;  2I8D A;  2Y2Z A;  3S1M J;  2Y0M A;  1Z91 A;  4AID A;  2R7W A;  3EQL F;  4DYQ A;  3KZI C;  3HIF A;  3OV8 A;  4IL6 C;  5IT9 K;  1IRF A;  4PFP A;  1GXP A;  1FOX A;  5CVU A;  3H3U A;  5DD4 A;  5LLQ A;  1YJN I;  1MBJ A;  1IDZ A;  1WH5 A;  1B59 A;  2KLO A;  1YIJ I;  2J5O A;  2ZJP F;  3VOD A;  1YOV B;  2KKO A;  3OYJ A;  2Y69 H;  4XKW A;  3HSF A;  2GOX B;  4S04 A;  3VEP A;  5DS9 A;  2B63 J;  2LTP A;  2DMU A;  2XF6 A;  3V42 A;  1FZP B;  2ZB9 A;  2HXI A;  3PIP F;  1OPC A;  2K4B A;  1U5T B;  2UUZ A;  1GHC A;  3SFZ A;  4A3F J;  1ZLJ A;  3NAU A;  3VFZ A;  2VQC A;  2BGC A;  2ZXW H;  2MBF A;  4BQQ A;  5BPD A;  2DJN A;  4AIJ A;  3OYA A;  2R7R A;  3FHN A;  2LG4 A;  2PN6 A;  1TTY A;  3E6C C;  1RUN A;  3BG7 A;  1FTT A;  2R7O A;  3BTI A;  2QM3 A;  2VE8 A;  3K1N A;  1ZGJ A;  2NNY A;  2EFW A;  2PJR A;  5IYD J;  1T0F C;  4ESF A;  2OCE A;  3HHG A;  2XAU A;  5ILV A;  3M1C A;  5F27 A;  5D4R A;  2M0C A;  2VKD A;  2WAQ A;  4M9S A;  1IGN A;  2HVQ A;  5E3N A;  4HSR A;  1ZQ3 P;  3KP3 A;  3MWM A;  4UUS B;  4ZZD A;  3S16 J;  5E79 C;  3D5R C;  2Y31 A;  4FIS A;  1J59 A;  2B9S A;  1TW2 A;  4A3K J;  2PQ8 A;  3P7N A;  3L2Q A;  3BT9 A;  3K70 D;  2PBI A;  2DCE A;  1BW6 A;  3G73 A;  4PK4 A;  1XDS A;  4M3F A;  1OQY A;  3OSG A;  3SZG A;  2AS5 F;  4A3I J;  4NBQ A;  1QO0 D;  2BYV E;  2XGX A;  2ZNZ A;  4XKV A;  1WWX A;  3U1D A;  4E7K A;  2XGE A;  4JP0 A;  4M3D A;  3TBI A;  2JT1 A;  1LUJ B;  5C44 J;  2H27 A;  2AXL A;  3LSR A;  2HOA A;  2D1H A;  2WTE A;  3S3N A;  4KT5 C;  1SAN A;  2E34 A;  2EFP A;  3TED A;  4FCY A;  1IZ1 A;  3I71 A;  3GTM J;  4M6V A;  1F1Z A;  3BR3 A;  5H20 A;  5ILU A;  2JA5 J;  1B9N A;  3K2Z A;  3CDH A;  1WJA A;  1S8N A;  2DYS H;  2KL4 A;  3A03 A;  1V4R A;  2OPT A;  2XAF A;  3RCO A;  2VT3 A;  4EMS A;  3A01 B;  1ONV A;  1U8R A;  1O3Q A;  1Y8Q B;  2IGK A;  1LKX A;  3FXU A;  1WPK A;  3JRG A;  1EA3 A;  1MSF C;  3VPR A;  3WE2 A;  2XAS A;  4GXO A;  3TGN A;  2QBY A;  2ID3 A;  3ZN1 A;  1HF0 A;  1XTA A;  2GWR A;  1I3Q J;  1ZLK A;  1XDU A;  3TMO A;  4BAC A;  3I53 A;  2R92 J;  4D5F A;  2LK2 A;  2R7Q A;  3OIO A;  2K9S A;  2HYF A;  3SZP A;  1JTY A;  3G1L A;  2R5Z A;  5J3L A;  3TP0 A;  2IGM A;  4HF2 A;  1RUO A;  2RGV A;  2I5U A;  3ZQL A;  4O3M A;  4XOP A;  2OC6 A;  3ASO H;  3LSP A;  2IT0 A;  1RRJ A;  1J5Y A;  2DT5 A;  1E2X A;  3IRR A;  1X1B A;  2CRG A;  3TOB A;  3BTC A;  5LHG A;  3FXL A;  4QPQ A;  2ZJQ F;  5EZG A;  3H5R A;  3HOZ J;  2LLK A;  4AU7 A;  5F6F A;  2W4S A;  3PNY A;  1QVU A;  2KIQ A;  2A61 A;  1KON A;  2XF5 A;  3BG5 A;  4I0A A;  5CQG A;  1WI9 A;  4RAY A;  1SFX A;  1GV5 A;  1UG2 A;  2UV1 A;  1QGP A;  1SAU A;  5F1J A;  2OCC H;  3NWT A;  4GYG A;  4EGZ A;  4HNT A;  3KYL A;  1S7A A;  2IGN A;  2DFE A;  2Y9Y A;  2AQE A;  2V1D A;  2EQR A;  4F93 B;  2E19 A;  1TQI A;  4CDG A;  5EDN A;  2P81 A;  5BS6 A;  1SD4 A;  2RNJ A;  1KGS A;  3G3Z A;  3O3K A;  4C30 A;  2CV1 A;  4IRG A;  3G4S I;  2VQH A;  2PMZ N;  1IV6 A;  2EBI A;  3FXJ A;  2FML A;  4G9Y A;  4AD9 A;  1FBS A;  1PJR A;  2F4M B;  1I50 J;  3SHF A;  2VBZ A;  1JI8 A;  3RI4 A;  1KU2 A;  2QQA A;  3OYB A;  1HOM A;  4JX5 A;  2ZFU A;  4LIV A;  2Y48 A;  2DJI A;  1MBK A;  4X1E A;  3JAM Z;  3HHH A;  2HS5 A;  2X0L A;  3ZP5 A;  1OLT A;  1ERD A;  3OYM A;  4RB3 C;  3V4G A;  1I1S A;  4HOB A;  3LSJ A;  5FD5 A;  5FLX Z;  2IA2 A;  2P6S A;  5DUK A;  4EJU A;  4LIU A;  5HLI A;  1LPQ A;  3QU6 A;  2W24 A;  3GFL A;  3IL2 A;  3PUF A;  3GZ6 A;  3N4M A;  1J75 A;  3H3V K;  5E3O A;  2QQ9 A;  4HDV A;  3CCS I;  2RVC A;  1HQC A;  3KLO A;  4CH7 A;  4ENN A;  3HOU J;  3TP3 A;  5M5X J;  2ECC A;  3HJE A;  3S14 J;  4A3C J;  2V9P A;  1STZ A;  1OFC X;  3AG1 H;  2GXG A;  4IQJ A;  3FZV A;  3VB2 A;  3JSO A;  4ZTJ A;  2WWY A;  1ZGW A;  4BS9 A;  2BY2 A;  3OY9 A;  1YG2 A;  3BR6 A;  1IF1 A;  3GLX A;  5TRD A;  3SFI A;  2VB6 A;  1XX5 A;  2ZFW A;  1HKT A;  5H6R A;  2HNH A;  2X6X A;  1XSD A;  3U1K A;  2HKO A;  3RPU A;  2DN0 A;  4G6D A;  3CTA A;  3KP2 A;  2M7A A;  2IEK A;  4MFE A;  2Y9Z A;  1T95 A;  2X1D A;  2H1K A;  1EH7 A;  5JLX A;  2LNB A;  3PFI A;  1TWC J;  2CFO A;  3E6M A;  5EYR A;  5K1Y A;  5GAH J;  2EA4 A;  1BR2 A;  2HOE A;  3MMY B;  3PJR A;  3L2R A;  3ZQG A;  2RRE A;  5J1Y A;  2EIN H;  2GZW A;  4FQG A;  1IG7 A;  1Y1W J;  1YI2 I;  2EFO A;  4MTD A;  4ESJ A;  4HX4 A;  2D2W A;  2HEO A;  3VYT B;  4BXU A;  4RA2 A;  4LG3 A;  2FOW A;  5BMZ A;  2JQ7 A;  1T56 A;  3W2A A;  1X1D A;  2CU7 A;  3L2W A;  1G3T A;  2KIM A;  4S05 A;  2JWT A;  3FBN B;  4LLN A;  3QPH A;  3W6V A;  5IY5 H;  3B6A A;  4A3B J;  1BI1 A;  2QSF X;  5J1U A;  5FKK A;  5HOD A;  3DU6 A;  1PVE A;  2LY9 A;  1LNW A;  3G2B A;  1W36 D;  1B9M A;  4ENM A;  4RAG A;  3A02 A;  2LRE A;  3ECH A;  4HV6 A;  5A2Q K;  4PJL A;  4PFO A;  4BGD A;  1FNN A;  2EIJ H;  2AHQ A;  3RZD J;  1NG7 A;  2LKS A;  2FSW A;  2MFZ A;  1CGP A;  1VQN I;  2R7S A;  3OS0 A;  4E7L A;  2CUZ A;  3P5J A;  1TWF J;  2P5V A;  2OZ6 A;  3WHB A;  3GFI A;  3BR5 A;  1Z6R A;  3LSI A;  3C2H A;  3EUA A;  1BR4 A;  4I99 C;  1LDK B;  5K7H A;  1E3P A;  5GTH C;  4M9Z A;  1D5V A;  2QA4 I;  3WTZ A;  5IYC J;  3H5N A;  3GF2 A;  4U87 A;  5HDN A;  2ZME B;  3EUK L;  1BC7 C;  2BVL A;  1AKH B;  2GLO A;  1AHD P;  1HBX G;  2AXT C;  3B6C A;  4FE7 A;  1JE8 A;  3DKY A;  4WK8 F;  2DK5 A;  2B0L A;  4IOC F;  1MBH A;  2M1B A;  3H36 A;  2ZJ2 A;  4LGW A;  4MEX F;  4XRF A;  3FM3 A;  1YE9 A;  2VC0 A;  2BOL A;  3ONQ A;  4JBA A;  5LGN A;  2A68 F;  2VJJ A;  1VF9 A;  2QBY B;  3JTG A;  1TC3 C;  2E71 A;  4M72 A;  2ISY A;  4BH9 A;  4QWQ A;  2JA2 A;  3H0G J;  5L3F A;  3DLL F;  1T0F A;  5EGO A;  3TDU C;  1Y56 A;  2F5E A;  3MKZ A;  3S17 J;  3VYU B;  2RV8 A;  2CGP A;  2MYS A;  3BG3 A;  5JVT A;  4CUG A;  2E36 A;  2EA2 A;  5DEQ A;  3S2W A;  3P9K A;  2O3F A;  2O9L A;  4G6Q A;  1IRZ A;  5CYV A;  3O2P E;  3WE3 A;  4UNO A;  3GTJ J;  3BPV A;  1UB9 A;  2FMY A;  5KHD A;  3C18 A;  2W00 A;  1HKQ A;  2DA5 A;  3K4B A;  2E35 A;  1R1T A;  4UVC A;  2DQR A;  1VQP I;  3BJA A;  4XBF A;  1PYV A;  4Z6Y A;  4XLF A;  1F5T A;  4IZZ A;  1X1A A;  4B3A A;  2FA5 A;  3HXL A;  1LJ9 A;  4B8X A;  1WQ2 A;  1XMX A;  2A5W A;  2MGQ A;  2VT2 A;  1VND A;  3T0Y A;  2E2I J;  1TWG J;  2G7H A;  4RLQ A;  3RSN A;  2FBH A;  4CHU A;  4GRI A;  2F5C A;  2DA1 A;  5E1X A;  5D5V B;  2YSR A;  3G1M A;  1KYZ A;  1XMA A;  3HUG B;  3I0T A;  1B1B A;  3GTO J;  1R22 A;  3VSK A;  4BQO A;  4MLO A;  2K02 A;  2NS7 A;  4C9Y A;  1N77 A;  3QYE A;  4DZP A;  2MD5 A;  4NUB A;  5DD8 A;  3CCL I;  3ZMS A;  2EZK A;  3OMY A;  4N0B A;  4N9I A;  2E1C A;  2OF7 A;  4HLY A;  1QRY A;  4D7M A;  2CQK A;  3VYR B;  1FIP A;  1FSE A;  4ZYH A;  1LFU P;  2HXO A;  3M8E A;  3FDY A;  4XN0 A;  2ZCW A;  2JVH A;  2RC4 A;  3F8B A;  3MKL A;  2BXZ A;  3GVA A;  2NOG A;  2XAJ A;  2Y0S A;  2IJL A;  5AON A;  2R3S A;  3SZT A;  3CP8 A;  5EG0 A;  4RB2 C;  2ELH A;  4LB5 A;  3HOV J;  5DTD A;  4K2E A;  2R7V A;  3M07 A;  3EDP A;  3KET A;  1ZRE A;  4L5I A;  4EQQ A;  1B6A A;  1Q1V A;  3K70 C;  2BXY A;  1IN8 A;  3DBR B;  4PUS A;  1C0W A;  1U5T A;  3BQY A;  3VSL A;  4A6D A;  1PUF A;  1BJZ A;  1BOA A;  2HOS A;  2V9V A;  1R36 A;  1D3Y A;  1S6L A;  4UVA A;  3WOD F;  1OCC H;  2OU2 A;  4XSX F;  1DU6 A;  2DOD A;  2KT0 A;  3S93 A;  3OYC A;  2Z99 A;  2NS0 A;  4A0Y A;  2EV5 A;  2L3D A;  3HRU A;  3ZRG A;  3HTU A;  4V19 K;  2LVS A;  2LYC A;  3PNT A;  4TV7 A;  4Y52 J;  5IT9 Z;  4N9H A;  3NQO A;  1ZH5 A;  1T33 A;  3OOU A;  5ICF A;  4CYD A;  2A69 F;  5K5O A;  5HVQ C;  1SC7 A;  2QF7 A;  2OQG A;  3NWS A;  4Q4Z F;  1SVL A;  4U0Y A;  3R4K A;  5C3E J;  3JAM K;  2K40 A;  3I3L A;  3LAP A;  5F64 A;  1Y1V J;  1FP1 D;  2DA4 A;  2A6E F;  1JGS A;  3WTS C;  2XC7 A;  2IAI A;  1D0Z A;  4YFN F;  3AKZ A;  2VBX A;  3E1S A;  2M9H A;  2FQ3 A;  2NYX A;  1YTY A;  2CQX A;  4RLF A;  5B66 C;  2KHM A;  4UB8 C;  3F8C A;  1BN5 A;  2DT6 A;  1ZRF A;  4KN4 X;  1T08 B;  3Q3S A;  1FYL A;  3CJQ B;  3HBL A;  2COM A;  2LBF A;  5DM7 F;  1GLN A;  1XN7 A;  2WB1 N;  4ZDP A;  1OIS A;  4JOM A;  1YHQ I;  1TZL A;  3K0L A;  3ROU A;  4LJZ F;  1OCO H;  1O7L A;  2CG4 A;  2IPQ X;  5M3M J;  3WTX C;  2BE5 F;  1ZTR A;  2EV0 A;  1QHG A;  3KPH A;  3BJ6 A;  4ENJ A;  1X1P A;  1X58 A;  4WWC A;  3HG9 A;  2YS9 A;  2PLY A;  4XLH A;  1G3Y A;  1X4P A;  4AYB N;  1F4K A;  2DA6 A;  1A35 A;  1IRX A;  2R5Y A;  4Q5S F;  4CYC A;  2ZJR F;  3DPT A;  3H3Z A;  1GVJ A;  2VN2 A;  3U9G A;  2KDZ A;  1HDP A;  2Q0O A;  2DMN A;  4I76 A;  4BAY A;  3ZQI A;  3TW7 A;  4WF2 A;  5L3G A;  1SD6 A;  2M3A A;  4NHJ A;  2W85 A;  2JZY A;  2JJ7 A;  3M3Y J;  4EJO A;  1HC8 A;  1FYM A;  4B3X A;  1FOY A;  3JRF A;  5DDG A;  2V26 A;  3KZZ A;  1G59 A;  4G94 A;  3BP8 A;  3K9T A;  3CCJ I;  4FX4 A;  2DFH A;  4IX7 A;  2OJE D;  3FWE A;  1VQO I;  4M6Y A;  2DBB A;  4H4K C;  3JR9 A;  4D7N A;  1WKM A;  5DCM A;  2M2E A;  5KNL A;  3IAM 2;  4DBQ A;  1WFX A;  3MAJ A;  3ZMT A;  4Y7N J;  4L9N A;  1XC5 A;  2DTZ A;  5F1R A;  1H89 C;  4OIQ F;  2L0K A;  1BC8 C;  3CCY A;  4AVP A;  1MBF A;  3K69 A;  1YO5 C;  4ENK A;  1IC8 A;  2C6Y A;  4EJT A;  3IAS 2;  2PX9 A;  1V3F A;  4RM2 A;  5AIP A;  2R0Q C;  3KP7 A;  4XIC A;  2XSJ C;  2LC2 A;  5LD2 C;  5KCM A;  3GZN B;  4CCN A;  1XMK A;  1XSX A;  4OMY A;  2XDV A;  1Z6T A;  2L5Q A;  3DF8 A;  4OMZ A;  1RKW A;  3OSF A;  1KA8 A;  1KQ9 A;  2L7K A;  4O6J A;  5EF6 A;  3L2U A;  4GFB A;  3OYE A;  1R1V A;  3JW4 A;  4IRH A;  1N25 A;  2WA0 A;  3CP2 A;  3KP5 A;  4KIC A;  1SEU A;  2RKH A;  4XM3 A;  4XOT A;  3ELK A;  1JUS A;  4ZYA A;  2CW8 A;  4XOR A;  3RKX A;  3RPQ A;  5HLT A;  1FJL A;  4EM2 A;  5IP9 J;  3IRQ A;  1Z7U A;  3S3O A;  1LEB A;  2ZC2 A;  2ZXI A;  4PGG A;  3ZQQ A;  1EH6 A;  4I01 A;  2CUF A;  3HOY J;  4PGH A;  1RET A;  1I27 A;  1R5G A;  1PDN C;  3ULQ B;  1B72 B;  3OYI A;  2LF8 A;  4A69 C;  1VZ0 A;  3HDD A;  4CO8 A;  3J7A Y;  3HSE A;  4LG0 A;  4U7B A;  2K9M A;  3HPH A;  4QIW N;  1OYW A;  2R5Y B;  1UMQ A;  4OIN F;  5HS8 A;  1WJF A;  2JUC A;  2MG4 A;  4QSH A;  1FBQ A;  1WJC A;  3ZQF A;  2FD5 A;  2CFX A;  2HQA A;  1XD7 A;  3V7R A;  3HB9 A;  4GCV A;  3HKZ N;  2CW7 A;  1Q1H A;  2EIL H;  5JHU A;  2MSY A;  2LD5 A;  1JHF A;  2E2H J;  3NEU A;  3KCC A;  3OR2 C;  3KLN A;  4ZDL A;  4ON0 A;  2HQR A;  4RBO A;  1EKE A;  3BWG A;  2A5Y B;  5DCF A;  2M4K A;  3AFH A;  3OS2 A;  2JA8 J;  2LFB A;  4C2M J;  5GPC A;  2JPB A;  4A3J J;  4PJJ A;  3L9F A;  5EG0 B;  1QPM A;  4HA8 A;  5IYB J;  2O61 A;  4BQN A;  4MFD A;  1P9Q C;  1VQL I;  4IKF A;  5JVG F;  2QQB A;  1IRG A;  3OYF A;  3AL0 B;  3FXO A;  4EJV A;  3K4L A;  2YU3 A;  1RR8 C;  1XB4 A;  2G7U A;  2VLA A;  1V5E A;  1MNE A;  3H9G A;  3W3C A;  1XGM A;  4V2F A;  1JKQ C;  4OOI A;  1VQ8 I;  2L9N A;  2DW4 A;  4DYC A;  3EYI A;  1VQ6 I;  4C2U A;  3FX3 A;  3ISP A;  3HOT A;  2KPM A;  2LSO A;  4Q47 A;  3E5Q A;  4L0Y B;  1MKM A;  4KT6 A;  2O03 A;  4NC7 A;  2M45 A;  4RGU A;  1KYW A;  3FK6 A;  3ZN0 A;  1AOY A;  4UHT A;  2Z33 A;  2GBY A;  1J0R A;  1NK2 P;  3H0D A;  4U0W A;  1VQ9 I;  1L3L A;  4C2T A;  5BPI A;  3O8H A;  3M8F A;  4B48 A;  4A93 J;  4CA0 A;  3ERE D;  4E7J A;  2JA6 J;  2KIS A;  1F43 A;  1P2F A;  1CF7 B;  1AKH A;  4WXD A;  3D1N I;  3NRV A;  1D1B A;  2YPR A;  2ZXH A;  1ZAO A;  3G1O A;  5L3E A;  4MQV A;  2VXD A;  5E8G A;  2O8X A;  3JRB A;  1TP4 A;  3RKQ A;  2M8G X;  1Y39 A;  4IOA F;  2EIK H;  1ACI A;  4BJ6 C;  4CCM A;  2UXN A;  3QPL A;  2DOA A;  1SFU A;  1G4D A;  3JRI A;  2ZKZ A;  1RZ4 A;  2MH2 A;  3S1Q J;  5FRN A;  2VUM J;  3OYG A;  2OBP A;  3BZ6 A;  5HNH A;  5M5Y J;  2DK8 A;  3M8J A;  2QYO A;  4M71 A;  1W5T A;  4I6Z A;  1BI3 A;  3I56 I;  2CV2 A;  4A2U A;  4W1U A;  3CZ6 A;  4BU2 A;  2IA1 A;  1WSU A;  1HCR A;  2IGO A;  1U6G A;  3GTL J;  3I9V 2;  1KU9 A;  4BQA A;  2WAD A;  4F7Z A;  3E6B A;  3S3M A;  2R7X A;  2FXA A;  3AL0 C;  2L4M A;  3R6S A;  1U3E M;  2A3S A;  1F36 A;  4Y3O A;  2CQ7 A;  2E1M C;  1USS A;  1S5L C;  2AO9 A;  2LY1 A;  3BC8 A;  4BXX J;  2XRN A;  1I1G A;  3W2V A;  5D5X B;  3S2H J;  4WCG A;  4BJT A;  2V1X A;  3N97 A;  4X0G A;  2MC3 A;  4UXN A;  2PG4 A;  3TL4 X;  3VWB A;  1HW5 A;  1L0O C;  4AM3 A;  5IP6 A;  2X6O A;  5C4J J;  5D5U B;  1B72 A;  3DKX A;  2CUE A;  3KE2 A;  3TOA A;  2IRF G;  1J7K A;  2L01 A;  3GLL A;  5LFA A;  1BW5 A;  5E8I A;  2XB0 X;  3GO5 A;  4MTE A;  1YYV A;  1SFE A;  4HF0 A;  1TBX A;  3LQR A;  1S7O A;  2XAQ A;  4E7I A;  5CVR A;  2V9K A;  5JR3 A;  4KYW A;  3WGH A;  1B8I B;  1H9T A;  1TNS A;  3SYT A;  3HOW J;  4OIO F;  4RMN A;  3AG3 H;  1XSV A;  4A3L J;  3ECO A;  3RQ4 A;  2L4A A;  1Z21 A;  3ZPL A;  4FT8 A;  3LSK A;  2M4G A;  1W7P D;  3K2A A;  3UNG C;  1ULY A;  3EPZ A;  3H92 A;  1JXS A;  4G7H F;  4JX4 A;  3QP6 A;  3A0H C;  2VQL A;  3FM5 A;  4BE1 A;  4HRI A;  1MGT A;  2WAE A;  1ZGA A;  1FC3 A;  3MZH A;  4FE4 A;  1OR7 C;  3GME A;  4PJ0 C;  4CCL A;  1SVM A;  5IP7 J;  1OYI A;  3IH4 A;  3SEQ A;  3PIO F;  2WV0 A;  2ICW G;  3FMR A;  2O5R A;  5J8C A;  3FHZ A;  1R71 A;  4S0H B;  3OYD A;  2H6C A;  3LSH A;  4CCK A;  2LBF B;  3AG2 H;  1WHU A;  4M3B A;  3I55 I;  2XSD C;  3CJT B;  5TGT A;  1AA7 A;  3QPT A;  3MKW B;  5DCM B;  1UHM A;  3P9I A;  1UCR A;  3GZ5 A;  3HZJ A;  1S9H A;  1OYY A;  3QOP A;  2HPI A;  2UXX A;  1HLV A;  2DLL A;  4YII A;  2L54 A;  3CF5 F;  5M5W J;  2NVT J;  2KP6 A;  1R5H A;  3SDB A;  5HOO A;  4R79 A;  4A6E A;  1XGO A;  1D1C A;  2KRC A;  3BR2 A;  3JCU C;  3I4M J;  3HRT A;  5FB2 A;  3V7C A;  2Y30 A;  4IHT A;  2DYR H;  4DIQ A;  4PSW A;  2XKP A;  2ACJ A;  1DGW Y;  2KRF A;  2BY3 A;  2GXB A;  4AIH A;  2EB7 A;  1MNM C;  4J01 A;  2G9W A;  3KIO A;  2MC4 A;  2QKL B;  4EV0 A;  3J81 K;  2NVX J;  1VQK I;  3ZMD A;  4CSW A;  2D1V A;  2PMZ A;  5DV5 A;  2HKX A;  5E3M A;  2K7L A;  4IHX A;  2EK5 A;  4BY7 J;  4IO9 F;  1YRN A;  1Z1D A;  3HGY A;  2YUS A;  2QSG X;  1JUP A;  3MZ8 A;  1TQP A;  4G7O F;  2WY7 Q;  1SAX A;  2ZO4 A;  3KYC B;  4M3E A;  4XK4 A;  3M1E A;  5HDK A;  2QCO A;  1TT5 B;  3F8M A;  4IHY A;  2VJ4 A;  4HG2 A;  2LKX A;  3BR0 A;  5B5E C;  2MD0 A;  3OR1 C;  2R7T A;  1K79 A;  4BEH A;  2V1U A;  4G12 A;  2F2E A;  1W0T A;  3WTY C;  1EF4 A;  3A1Y A;  4AVZ A;  5EEG A;  3LMM A;  2STW A;  1HDD C;  4CYC B;  4A3M J;  1IDY A;  1RR7 A;  2CMP A;  2RQP A;  4OAY A;  3QRF F;  3C7J A;  3LST A;  4FX0 A;  1P6R A;  1R00 A;  4PDK A;  5IPA A;  1AWC A;  4D5C A;  3CCR I;  2L7Z A;  1EJ9 A;  2M8E A;  4P5O A;  3AAF A;  1QA6 A;  4ABZ A;  4DJA A;  3JSP A;  3GTK J;  2YR2 A;  2HDW A;  3TO6 A;  3CME I;  4C3H J;  4CZC A;  2Q1Z B;  4HQE A;  1GDT A;  1DQU A;  1IN4 A;  3ZOB A;  4XL9 A;  1A6I A;  2X9D A;  3ABT A;  1V5F A;  3FBI B;  1U5T C;  1WRJ A;  1PP7 U;  1Z3X A;  1J2X A;  4XQF A;  2XVC A;  5GAG J;  2VOO A;  3IHU A;  3BZC A;  1JKO C;  4FHT A;  1E0E A;  4KA4 A;  1HKS A;  4U0V A;  4IRI A;  1R58 A;  4PCQ A;  3JTH A;  2ELJ A;  2CS3 A;  1RKT A;  2EFN A;  1GVD A;  4DBR A;  3PM1 A;  1K83 J;  3KP6 A;  2PJP A;  1ON2 A;  2H6B A;  2KMU A;  3LSM A;  3L1P A;  1K6Y A;  4IXA A;  3I64 A;  4M9X A;  1K4S A;  2XGC A;  2JUG A;  3E3V A;  1VQM I;  1F9N A;  2FX0 A;  2Q2E A;  5J40 A;  4L5J A;  2UWM A;  2KRH A;  2CYY A;  2W84 A;  4QTR A;  4BBR J;  2NXN B;  3HL2 A;  1W36 C;  2EJR A;  1G8X A;  2XRO A;  2FNA A;  4IPA A;  1ETQ A;  1YX3 A;  2TDX A;  4KIT B;  4NC8 A;  2FOK A;  2MAB A;  3DU5 A;  1IJW C;  1MMN A;  3I5U A;  2XB5 A;  1KU3 A;  5KAI C;  2D5V A;  1IXC A;  3ABK H;  5DUI A;  4LK1 F;  1T6S A;  1FSH A;  2P7V B;  2DQL A;  3C3W A;  3R61 A;  4X6A J;  3EET A;  1DPR A;  2O6G E;  1WJ5 A;  5K5Q A;  1WJD A;  2IXS A;  1YIO A;  1BI0 A;  4GO1 A;  1SMT A;  2GA1 A;  1VQ7 I;  2LR8 A;  3CUQ A;  5CJ9 A;  3OL3 A;  2H94 A;  4RGX A;  1UFM A;  1WGX A;  2DAO A;  3PSF A;  1X4O A;  4EJW A;  2VJ5 A;  1RPW A;  1EH8 A;  1XGN A;  3J7A O;  3I4N J;  4OIP F;  5E1Z B;  2JMW A;  4ZH4 F;  2HYJ A;  3DXJ F;  4BXF A;  2VQG A;  2Z2S B;  4A3G J;  1CQT A;  1E3O C;  4HX8 A;  2DA2 A;  4NB5 A;  3LSG A;  2BW3 B;  1YQA A;  3CJR B;  3CJN A;  3ABM H;  4RAZ A;  4P1W A;  5J4V A;  2B7E A;  4A0Z A;  1VQ4 I;  1W7P A;  3H5A A;  3LFK A;  2CJJ A;  2J5P A;  2NVQ J;  2H8R A;  5KVR A;  2MH9 A;  3GYH X;  4IEJ A;  2VC1 A;  2XV4 S;  1ZG5 A;  4ANJ A;  4I98 B;  1WZ2 A;  1ZG3 A;  2VPR A;  4IHS A;  3DP7 A;  3B73 A;  1U2W A;  2YX7 A;  4MQ9 F;  2VI6 A;  3IUO A;  2IS2 A;  2W25 A;  3H1C A;  4LLL A;  3DKW A;  3RTR A;  1ZYR F;  2FBI A;  4BKX A;  4DGW B;  2HGC A;  4I0B A;  1MJA A;  3HC7 A;  3P9C A;  1IN6 A;  3BCA A;  3DTI A;  3FKJ A;  4J00 A;  3IWF A;  5L3B A;  2EZL A;  2GQQ A;  2D45 A;  1YX5 A;  2VIX A;  2EPF A;  1D5Y A;  3C1D A;  1H0M A;  3WGI A;  1QU3 A;  1TNT A;  3Q9V A;  2LH9 A;  2K3P A;  2XAG A;  1Z9C A;  2CO5 A;  3V8K A;  1A31 A;  1A5J A;  3GWZ A;  1BJA A;  3CCE I;  2GXA A;  4MO7 A;  4E70 A;  1QZZ A;  4UUS A;  4PJM A;  2OTJ I;  4RS8 A;  4KDP A;  3ZQC A;  3K6G A;  3DEU A;  5DYM A;  4J19 A;  2JK3 A;  3DQV C;  4WXH A;  1MSE C;  4XKC A;  2P4W A;  3WHC A;  3CCU I;  3ZMU A;  2IA0 A;  1ETK A;  3BQZ A;  5FD6 A;  1LEA A;  2ZNY A;  3IC7 A;  3DBL B;  2DXI A;  2EIM H;  5FFZ A;  3WU0 A;  4RB0 A;  2E7W A;  4G7Z F;  2XPW A;  4PJN A;  2RQQ A;  4OIR F;  3J7Z I;  3E7L A;  1IN7 A;  2JVG A;  3FXM A;  1LFB A;  5GAD J;  1MDM A;  1UG0 A;  2K5C A;  4UUT A;  5FRM A;  4M3G A;  4YFK F;  1T39 A;  5FLX K;  2KJB A;  4R1H A;  2GA2 A;  3LA2 A;  3ZCO A;  3S15 J;  5BOX A;  4A3D J;  1S3J A;  2OAZ A;  1YJ9 I;  4KNY A;  2V1N A;  3F6V A;  1U78 A;  2VBW A;  1JKP C;  2JPC A;  4KIG A;  1QPI A;  2EH3 A;  3ESW B;  3MQ0 A;  1R4N B;  4BNC A;  4RB1 A;  1YIT I;  2JRM A;  2Y75 A;  5HDG A;  5EJC A;  5LRR A;  2Z9O A;  3OYK A;  1O3R A;  3CUQ C;  1ZR4 A;  5ILS A;  3OIQ A;  4UV9 A;  2DDB A;  2VJI A;  3PO3 J;  3CO7 C;  1BI2 A;  1ON1 A;  1JTX A;  5E1W A;  2R7D A;  5BNG A;  1MBG A;  3K1M A;  4DZJ A;  1Z3Y A;  2W48 A;  1O3S A;  3OOP A;  3F22 A;  3BOQ A;  4ASN A;  2LRD A;  1IUF A;  2WC2 A;  3D5S C;  2V6C A;  3O8G A;  2X1E A;  4C3I J;  1OCT C;  6PAX A;  4MNU A;  5ICG A;  3QOD A;  1HXD A;  3J80 Z;  2QVO A;  1ITY A;  2ADU A;  5CQE A;  1P7I A;  2HYG D;  3BG6 A;  4QLC U;  4RAF A;  2A6T A;  3CQZ J;  1WVR A;  3L00 A;  3WU2 C;  2X6W A;  2DMT A;  2TRT A;  2HFH A;  1UZC A;  5B1A H;  3RPU D;  2ZSI B;  2WAF A;  1MDM B;  2V7F A;  1ETW A;  2CSO A;  3M7G A;  3BDD A;  2L2O A;  4C3J J;  1I5Z A;  2GOM A;  2A05 A;  1VI0 A;  4BUP A;  2QEN A;  1UAA A;  4ITV A;  1W7P B;  1SFO J;  2L9R A;  5J4Y A;  1ZKG A;  2FE3 A;  3X2Q H;  4HQM A;  4JQF A;  4Q48 A;  2FUG 2;  5E17 F;  2IS6 A;  5ERI A;  3U21 A;  3ZQ7 A;  1DGR M;  4B09 A;  5GAE J;  2KZV A;  5LGT A;  1APL C;  3OYL A;  3FXR A;  5HLH A;  1O7F A;  2I10 A;  2RNG A;  4BE2 A;  4I09 A;  5D4S A;  2P0W A;  1M1E B;  1UJ8 A;  2P5K A;  3K10 A;  2M30 A;  2CQQ A;  3EYY A;  2ESH A;  1P4X A;  2MA3 A;  3U2R A;  2L7M P;  2PI0 A;  4YEJ A;  5JFR A;  4I02 A;  1FMV A;  4L18 B;  3E97 A;  3KZY A;  3CUQ B;  3F6O A;  2KFD A;  3QQA A;  4Y17 A;  4RGS A;  3BTL A;  3CF2 A;  3RDI A;  3CO6 C;  1OKR A;  4A3E J;  2IS1 A;  4KMU X;  4RGR A;  4EAT A;  3J80 K;  1PP8 F;  3V8L A;  2VKH A;  3MD2 A;  1FIA A;  1ODD A;  1DP7 P;  3OIP A;  5H6Q A;  3SQN A;  2AQF A;  1Z05 A;  2XAH A;  5GPA A;  1W1W E;  4RM3 A;  3WG7 H;  1GT0 C;  3EUH A;  1XGS A;  1BOB A;  4OWR B;  5FKL A;  2LF7 A;  1R49 A;  2ZME C;  2LMD A;  3L7W A;  2L7F P;  3LNQ A;  3HYI A;  3CES A;  3R60 A;  2DFF A;  4KIF A;  4E7S A;  1W5S A;  1TT0 A;  2K27 A;  2DU9 A;  4FTH A;  1LQ1 A;  4M6X A;  2EZI A;  3HUG A;  2CH0 A;  5FKM A;  1NK3 P;  2X85 A;  4XMY A;  3VOE A;  1MW7 A;  1O4X A;  4AIK A;  4LIT A;  1IAW A;  1ETX A;  2PJR B;  1MND A;  5JHF A;  4B44 A;  2BEO A;  3CCV I;  2FEZ A;  2HZD A;  4WXC A;  1TWA J;  3Q5F A;  1V55 H;  2HI3 A;  1FTZ A;  1D8K A;  1H9G A;  5E18 F;  1K6O A;  2QWW A;  2PMU A;  2HVS A;  3TKY A;  4BDZ A;  1B8I A;  4BHC A;  4HF1 A;  1X2M A;  2EFQ A;  4LK0 F;  2VKE A;  3CDL A;  3H35 A;  3RYP A;  4E6K G;  2UZK A;  1QHH D;  1UEL B;  2HTS A;  3RKY A;  1KU7 A;  2CW0 F;  4YEL A;  4IHV A;  3K4C A;  5D5W B;  2GM4 A;  3SEZ A;  3MZY A;  1W5C C;  1LDD A;  1Y6I A;  5D6E A;  1X1C A;  4KJZ A;  3CC4 I;  1IW7 F;  1X19 A;  1X3U A;  2LP0 A;  2RDP A;  4MGR A;  3RIR A;  3L2V A;  4HZF A;  4EM0 B;  3DEW A;  4WX9 A;  3S2D J;  4JX6 A;  3CMA I;  4BL0 B;  2M7B A;  2JN6 A;  3QWL A;  2V6E A;  4N4O B;  4P96 A;  4HNV A;  2DO7 A;  3J7Y J;  2LY2 A;  4XLC A;  4YIR X;  4ZC3 A;  1FOK A;  2M34 A;  2G0E A;  2HZT A;  3FF5 A;  3OL4 A;  2Z1D A;  5K5R A;  4GDF A;  2OV7 A;  3BY6 A;  3KFW X;  1SD7 A;  1VQ5 I;  5FLM J;  3ZXS A;  1R23 A;  3CMM A;  1FY7 A;  1Z0X A;  5TJJ A;  1H8A C;  2O8K A;  2Z5U A;  2HQ5 A;  5FKN A;  2JSP A;  2K86 A;  5FLV A;  2GIZ A;  3I58 A;  1N75 A;  5DM6 F;  3GCM A;  4HAM A;  3DCF A;  5KK1 A;  3UR3 C;  2KZG A;  2QLZ A;  2M87 A;  3JRH A;  3O6B B;  4IVN A;  3F21 A;  1OJL A;  4LG0 B;  1S72 I;  3BRO A;  2L9S A;  2XUB A;  3ASN H;  1HW2 A;  1UHW A;  5ICC A;  3Q0V A;  2DOF A;  5LEK A;  1JT0 A;  4BEH B;  2E60 A;  2BVM A;  3BCB A;  2R7Z J;  2BHZ A;  5M3F J;  3G71 I;  3QAH A;  2X4H A;  4CCO A;  3DFG A;  1FX7 A;  4II3 A;  4UUV A;  1ZN2 A;  2L9V A;  4RDU A;  4AUX A;  1UST A;  1RNL A;  3GEZ A;  5EEA A;  3CCM I;  1DUX C;  2R93 J;  2KJC A;  2IS4 A;  1A36 A;  4W97 A;  3GW2 A;  2JTV A;  3B02 A;  4KIB A;  2R4G A;  1OCZ H;  3ABU A;  4LLG F;  2LOO A;  3HOS A;  1QVT A;  5F0C A;  1R1U A;  1I6X A;  1P7J A;  1TL8 A;  2E1O A;  2DDA A;  1BA5 A;  4E7H A;  2XIG A;  4DOZ A;  4IJA A;  1KZH A;  1S29 A;  3DLA A;  3SXY A;  1I3A A;  2BHY A;  2RN7 A;  1ZG1 A;  1POG A;  1JHH A;  5AIQ A;  2Q2E B;  3IKT A;  3LQQ A;  3CLO A; 
#chains in the Genus database with same CATH homology
 3OOU A;  2KLO A;  2X6Y A;  2HDW A;  5HVQ C;  3NWS A;  2Q1Z B;  4CZC A;  1DQU A;  3OYJ A;  4XKW A;  4XL9 A;  2GOX B;  4BE0 A;  3I3L A;  1V5F A;  3FBI B;  2XF6 A;  3V42 A;  1Z3X A;  4XQF A;  2XC7 A;  1D0Z A;  3AKZ A;  2UUZ A;  3E1S A;  2VQC A;  4RLF A;  2KHM A;  1E0E A;  3N05 A;  2DT6 A;  4BQQ A;  4HPQ A;  3OYA A;  2R7R A;  3FHN A;  2ELJ A;  2CS3 A;  2LG4 A;  3CJQ B;  2LBF A;  1GLN A;  4DBR A;  4ZDP A;  3BG7 A;  4JOM A;  1TZL A;  3LSM A;  2KMU A;  2R7O A;  1K6Y A;  1J09 A;  2PJR A;  1T0F C;  2JUG A;  2XAU A;  3PSI A;  3M1C A;  2UWM A;  3LFU A;  3A4C A;  1QHG A;  2KRH A;  2VKD A;  2WAQ A;  4NQW B;  3HG9 A;  2HVQ A;  4HSR A;  4Y4R A;  2V4J C;  3ZGK A;  4XLH A;  3HL2 A;  1W36 C;  3D5R C;  1X4P A;  1G8X A;  4B43 A;  4II2 A;  1IRX A;  1YX3 A;  2CUJ A;  5HNF A;  4KIT B;  3DPT A;  3L2Q A;  4NC8 A;  3K70 D;  2MAB A;  3DU5 A;  4XLE A;  2DCE A;  1MMN A;  3K4J A;  4PK4 A;  3QYB A;  3SZG A;  3VDX A;  4XON A;  4XKV A;  2W7N A;  4N4N B;  4E7K A;  2M3A A;  3TBI A;  4B3X A;  1WJ5 A;  2V26 A;  1WJD A;  2IXS A;  3S3N A;  1G59 A;  4BJ5 C;  4IX7 A;  3OL3 A;  4H4K C;  5KNL A;  3PSF A;  1V5G A;  1X4O A;  3IAM 2;  4DBQ A;  1WFX A;  2VJ5 A;  1WJA A;  2KL4 A;  3RCO A;  1ZEL A;  2IGK A;  1LKX A;  3IAS 2;  4BXF A;  1EA3 A;  2VQG A;  2Z2S B;  4F3Q A;  3LSG A;  4RM2 A;  4HNU A;  2BW3 B;  3CJR B;  5FRO A;  2XSJ C;  3TMO A;  4BAC A;  2LC2 A;  2R7Q A;  5LD2 C;  4P1W A;  5KCM A;  4CCN A;  2XDV A;  2L5Q A;  2IGM A;  3H5A A;  2L7K A;  3MKY B;  3L2U A;  3OYE A;  4XOP A;  2OC6 A;  2WA0 A;  3CP2 A;  4XM3 A;  1X1B A;  4XOT A;  4PSX A;  4ANJ A;  4ZYA A;  4QPQ A;  2CW8 A;  4XOR A;  5HLT A;  3H5R A;  4AU7 A;  2W4S A;  3S3O A;  3PNY A;  3IP4 B;  1KON A;  2XF5 A;  2ZXI A;  3IUO A;  5CQG A;  3DTK A;  2IS2 A;  3ZQQ A;  1D0X A;  3RTR A;  2UV1 A;  4DGW B;  1SAU A;  3HC7 A;  3NWT A;  3BCA A;  3DTI A;  3FKJ A;  4J00 A;  3OYI A;  4HNT A;  3KYL A;  1VZ0 A;  3J7A Y;  2IGN A;  2AQE A;  4OAZ A;  1YX5 A;  1D0Y A;  2VIX A;  4U7B A;  2K9M A;  1QU3 A;  3HPH A;  4F93 B;  2XF7 A;  1DP3 A;  2LH9 A;  2K3P A;  4XKB A;  2KQR A;  1WJF A;  2WY8 Q;  4BDY A;  1WJC A;  2HQA A;  2F4I A;  2CW7 A;  4C30 A;  2CV1 A;  4PJM A;  2VQH A;  3OR2 C;  4Y33 A;  3K6G A;  2WBM A;  3DQV C;  5CKT A;  4ZDL A;  1PJR A;  4XKC A;  3PL8 A;  1JI8 A;  2M4K A;  3AFH A;  3OYB A;  2DXI A;  2ZFU A;  4LIV A;  3OS2 A;  4ZTF A;  2DJI A;  4PJJ A;  4PJN A;  2RQQ A;  4BQN A;  3QOE A;  2JVG A;  1OLT A;  1P9Q C;  1ERD A;  3OYM A;  4IKF A;  1UG0 A;  2K5C A;  5FRM A;  4FET A;  3OYF A;  2CV0 A;  3AL0 B;  3K4L A;  4LIU A;  3ZCO A;  3S32 A;  2VLA A;  2V1N A;  1V5E A;  1MNE A;  3H9G A;  4G6T B;  3W3C A;  4CH7 A;  2L9N A;  3GBG A;  4C2U A;  3K4K A;  3HOT A;  2KPM A;  1BR1 A;  4IQJ A;  4KT6 A;  3QYF A;  4NC7 A;  4ZTJ A;  3OYK A;  4BS9 A;  3OY9 A;  3OIQ A;  2OUM A;  2BW3 A;  2VB6 A;  2VJI A;  3H0D A;  4C2T A;  2HU9 A;  4B48 A;  4CA0 A;  2VPL A;  4E7J A;  2HNH A;  2X6X A;  1Z3Y A;  3K4N A;  1D1B A;  2LRD A;  3D5S C;  2M7A A;  3HKZ A;  2ZXH A;  2X1E A;  1T95 A;  4QPO A;  2X1D A;  4F92 B;  4IQ4 A;  2VXD A;  1NG6 A;  3QOD A;  3HPG A;  1U0J A;  2CFO A;  4BJ6 C;  5CQE A;  4CCM A;  1BR2 A;  3BG6 A;  2DOA A;  3MMY B;  3PJR A;  2A6T A;  3L2R A;  3DWL E;  2X6W A;  2RRE A;  1N78 A;  4B47 A;  5FRN A;  3RPU D;  2ZSI B;  2WAF A;  3OYG A;  2V7F A;  1MMD A;  2K9L A;  2L2O A;  5HNH A;  2GOM A;  3M8J A;  3VYT B;  4LG3 A;  4BUP A;  3W2A A;  1UAA A;  1X1D A;  3DPL C;  4ITV A;  2CV2 A;  4BU2 A;  3CZ6 A;  3L2W A;  4KIS A;  2IGO A;  3FBN B;  4JQF A;  2KDO A;  1HA8 A;  2FUG 2;  3I9V 2;  2IS6 A;  2WAD A;  3S3M A;  2R7X A;  3U21 A;  1DGR M;  3AL0 C;  4ZJZ A;  1LVK A;  3DU6 A;  3OYH A;  3G2B A;  2KZV A;  1W36 D;  4Y3O A;  2LY1 A;  2E1M C;  3BC8 A;  3OYL A;  2RNG A;  2E5Z A;  2LRE A;  3W2V A;  4BE2 A;  4BJT A;  4E7Z A;  2P0W A;  3K10 A;  4PJL A;  4PFO A;  4X0G A;  3TL4 X;  4BGD A;  3VWB A;  2X1C A;  1NG7 A;  2MFZ A;  2R7S A;  3DEE A;  3OS0 A;  4YEJ A;  4E7L A;  2CUZ A;  3DKX A;  1D1A A;  1FMV A;  5LFA A;  3CF2 A;  3LSI A;  2VXZ A;  3C2H A;  3EUA A;  1BR4 A;  1LDK B;  2IS1 A;  4EAT A;  2R7U A;  2VKH A;  3MD2 A;  4HEA 2;  4E7I A;  2V9K A;  4NNJ A;  1FMW A;  2WB1 A;  3OIP A;  3F9K A;  1LFP A;  2VAS A;  2Z16 A;  2AQF A;  3SYT A;  3PFY A;  3H5N A;  4U87 A;  2VL8 A;  4RMN A;  3DTE A;  2W82 A;  4RM3 A;  3EUK L;  3LL7 A;  2X51 A;  1BOB A;  1R6R A;  4OWR B;  3RQ4 A;  3OS1 A;  1Z21 A;  2BVL A;  2F6C A;  3KX2 A;  1WJE A;  3CES A;  3LSK A;  2M4G A;  4E7S A;  3A2K A;  3UNG C;  1TT0 A;  2M0M A;  3DKY A;  3EPZ A;  4YRV A;  2VQL A;  2CH0 A;  4BE1 A;  4HRI A;  4D1Q A;  2WAE A;  4XNF A;  3H9J A;  1YE9 A;  2X85 A;  2QKM B;  2BOL A;  3ONQ A;  3H9Q A;  4XMY A;  1MW7 A;  1OR7 C;  4LIT A;  2VJJ A;  2E1M B;  4CCL A;  2PJR B;  3C2G A;  1MND A;  5JHF A;  4B44 A;  3SEQ A;  2JA2 A;  2HZD A;  1Y56 A;  2O5R A;  4HST A;  3MKZ A;  3VYU B;  3OYD A;  1WJB A;  2MYS A;  3LSH A;  2DT7 B;  2LBF B;  4CCK A;  4CUG A;  2W1O A;  3E0J B;  2HVS A;  3OYN A;  4BDZ A;  5TGT A;  4ZDO A;  3OWT A;  1AA7 A;  3MKW B;  4E6K G;  3H35 A;  1Z7L A;  1QHH D;  1SFK A;  1UEL B;  1S9H A;  5KHD A;  4YEL A;  3W2W A;  2HPI A;  3K4C A;  2W00 A;  3K4B A;  3SEZ A;  4D9J A;  1Y6I A;  1X1C A;  4KJZ A;  1X19 A;  3PNV A;  3L2V A;  1PYV A;  4XLF A;  2KP6 A;  2NOJ B;  3KEY A;  3SDB A;  5HOO A;  4BL0 B;  4IZZ A;  2M7B A;  1X1A A;  2V6E A;  4N4O B;  3HXL A;  4XN3 A;  4R79 A;  1D1C A;  2KRC A;  2A5W A;  2LY2 A;  4XLC A;  4CCJ A;  4RLQ A;  4ZC3 A;  3PUB A;  3RSN A;  3ZR8 X;  4GRI A;  4DIQ A;  3OL4 A;  4PSW A;  2Z1D A;  2OV7 A;  1DGW Y;  3HUG B;  3BLY A;  5CPR B;  3ZXS A;  3VSK A;  4BQO A;  4MLO A;  4XR6 A;  3CMM A;  4C9Y A;  4J01 A;  1N77 A;  3QYE A;  1MMG A;  2MC4 A;  4NUB A;  2QKL B;  2JSP A;  3OMY A;  4CSW A;  2PMZ A;  1N75 A;  3UR3 C;  3D5L A;  4F55 A;  3VYR B;  2L9S A;  2F5V A;  3DPU A;  4AYB A;  3FDY A;  2WY7 Q;  4XN0 A;  4BEH B;  2E60 A;  2JVH A;  2BVM A;  3BCB A;  2E5N A;  4CCO A;  2Y0S A;  2VJ4 A;  4HG2 A;  2HVR A;  4II3 A;  3S8P A;  2MD0 A;  3OR1 C;  3CP8 A;  2R7T A;  4BEH A;  2R7V A;  3VYS B;  3K70 C;  2HPM A;  4PUS A;  4E4H A;  3A1Y A;  2IS4 A;  4F52 A;  3VSL A;  4AVZ A;  3EUH C;  3LMM A;  4XLA A;  3K4M A;  2R4G A;  4F91 B;  3HOS A;  2LOO A;  2ZSH B;  1MMA A;  2CMP A;  3S93 A;  3OYC A;  4OAY A;  4E7H A;  4DOZ A;  4FAS D;  2I8D A;  3DLA A;  3ZRG A;  2R7W A;  4P5O A;  2LYC A;  3PNT A;  4PFP A;  4DJA A;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...