2XF7A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone. high-resolution structure.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
ESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
total genus 17
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf7A00
2XF7A 2XF6A 2XF5A
chains in the Genus database with same CATH superfamily
1PUFA 4DJAA 4LMYA 1F5TA 3A1YA 1WGXA 1U6GA 2QCOA 3SEQA 1O3SA 1XGNA 1LE8A 4CYCB 2D45A 2DFHA 4EJUA 1YG2A 1G3YA 2FJ1A 3BR3A 3P9KA 5M3FJ 3VYTB 2CMPA 1MBEA 4IHYA 2F4OB 3GWZA 2LK2A 2R7UA 2IP2A 2XAFA 4WXCA 3R60A 4G6TB 1IXRC 3C18A 2K3PA 4RLFA 2BZTA 1BR2A 4HSRA 4KITB 5LRRA 6PAXA 3IV5A 4XN0A 5J40A 3JRCA 3QRFF 2VE8A 1JI8A 4YFKF 3KZIC 4FQGA 4KA4A 3WGGA 2V1UA 1YW9A 2IEKA 3Q9VA 2E5ZA 4A3DJ 3KEYA 2K40A 3LAPA 1XSXA 1VFCA 3D0SA 2Q0OA 1Y8QB 4CCJA 4F55A 3ZQ7A 1TQIA 4KIGA 1FEXA 3X2QH 3MVPA 3H9QA 2KRHA 3FDYA 1QGPA 5HNFA 4H0EA 1X4PA 3Q5FA 3F8CA 1Y56A 4Y4RA 3RKYA 3N05A 2FQ3A 3S14J 3Q0UA 5D8KB 4BHCA 2BY0A 4OINF 1EH7A 2GXBA 3M1EA 2B9SA 2RVCA 2F5CA 1SD6A 2R5YA 2QBYA 3MKZA 3AFHA 4ZYAA 4A3GJ 1Z91A 4MEXF 2KRFA 3WTSC 1O3TA 2KIQA 1D5VA 3LSMA 4EJOA 3W2VA 3OYLA 1FMWA 2KL4A 1YIJI 4G6QA 1SD5A 2FNAA 4XNFA 2DJNA 2P6TA 5L3FA 3BOQA 5M3MJ 1V4RA 2ID6A 4Y13A 4WXHA 3ECHA 4AD9A 1MGTA 2JVHA 2PEXA 4AYBN 3TW6A 1T98A 5BMZA 4KN4X 3WU1B 2XF7A 2HPIA 3VFZA 2X6YA 1STZA 3Q9SA 2BW3B 4DZJA 4CCMA 1P6RA 5FKNA 2AQEA 4HF1A 2R93J 3DKXA 1J7KA 3BWGA 4HRIA 4L18B 2TCTA 3I4MJ 3JRBA 2E36A 4A93J 2PMZN 4YRVA 2XKOA 3BG9A 2KDOA 3HHGA 5E3NA 2HGCA 3HXLA 5E79C 1G2HA 2R3SA 4LD5A 1YJWI 4XMYA 1W36D 5ILVA 4HV6A 5KAIC 2QKMB 2EIJH 4YIRX 2DK8A 1HCRA 1IUYA 3F8NA 4DNCA 5JHUA 2STWA 1D8JA 2VKVA 3DEUA 3OS1A 1QQIA 1W36C 1AKHA 3OV8A 1WI3A 1EF4A 3R61A 3FMSA 2K9LA 4ESJA 2O61A 4FE4A 5IPAA 4IVNA 2BGCA 3RZDJ 2ESNA 4HQEA 1TWGJ 1IDYA 1MNMC 3OIOA 4S04A 4M9SA 1YS7A 3ZQLA 4PJNA 5E3MA 2KJCA 1YYVA 4YELA 5JI6A 1YJNI 4GO1A 5ED4A 4I2OA 5E3OA 3GLXA 3FXMA 2DW4A 3RKXA 2MGQA 3FXRA 1HSTA 2OCCH 2GXAA 3WTUC 3RPUD 3P7NA 2L9NA 1P9QC 1MIJA 1OFCX 3LMMA 1IRGA 4ANJA 3L2WA 3ESWB 1H9TA 4A3BJ 4CXFA 4JP0A 1K61A 3ISPA 3WHCA 2MG4A 4PK4A 1U8RA 3CMYA 1P4WA 1ZG3A 1CF7B 3AG2H 3KYDB 2QQBA 4G7HF 1G4DA 3IKTA 3H9JA 3U1KA 2DDBA 4JYKA 5BQTA 4DYQA 4KN7X 1X1AA 4CUGA 2PLYA 4BBSJ 2VKEA 3GUDA 1UJ8A 1T6SA 4CICA 2HKOA 2OZUA 4R8HA 1HQCA 1N25A 4P9FA 3J81K 2O8KA 2F5FA 3V8JA 4ZZDA 4LG0B 2XSDC 1VQ9I 2Z99A 4C3JJ 3RCOA 2NS8A 2BVLA 3BQYA 1ETWA 2X4HA 2R7RA 2IGNA 1WRJA 2PN6A 4EM2A 2VOPA 5ICGA 2JSPA 5HS9A 3OYAA 1DDNA 2A6EF 2DQLA 1FNNA 3LA7A 1J2XA 2R7FA 1B59A 1Z67A 1ERDA 3HRMA 2D5VA 1APLC 3AL0B 2FMYA 5LFAA 1OCPA 1QRYA 1YOVB 2DI3A 4ZYEA 1DU0A 2Q2EA 1ZRCA 1RPWA 1ZARA 2MC3A 4RM3A 3IL2A 3L2CA 3S1QJ 4IHVA 1IZ1A 2FX0A 3K4MA 4B3AA 1TP4A 3MFKA 2CV1A 4HSTA 5LGNA 3ZPLA 1KU9A 3S2DJ 4K2EA 2A6TA 3IC7A 1M1EB 5EZHA 2BBYA 4BE2A 4FX4A 4OIQF 2WB1A 3RZOJ 1XCBA 1HKTA 4RDUA 3O3KA 4GRIA 5L3GA 3TP3A 1XTAA 1POGA 1Z05A 2RC4A 1Y0NA 1T0FA 5H2FC 1VQ8I 1WCMJ 5TRDA 2MLKA 2LFBA 2IS1A 2LD5A 5FLXK 3QU6A 1JT0A 2VLAA 4BE1A 1UHMA 3ROUA 4ZDPA 1AA7A 3IAM2 3TW7A 3S1RJ 1IRFA 4BYYA 2O8XA 1ETOA 3VWBA 3NQOA 2FRHA 2KZVA 3TO7A 3HHHA 2EFPA 3OL4A 4IL6C 2M34A 3CCLI 4BHBA 1UB9A 5C4XJ 3DCFA 2HR3A 1PP7U 3ABLH 3GVAA 2XGCA 1S3JA 2ESHA 4OAZA 1AHDP 5HOOA 5A2QK 4KFCA 2JA6J 2M45A 3M8JA 4XORA 2AHQA 1IGNA 5B3SH 4OU0A 1BI0A 4MGRA 4M72A 2HFHA 3V8KA 1A04A 4F91B 5EJCA 5K7FA 5LEJA 1T2KA 1BI1A 1D8KA 1P92A 4LIVA 1IUFA 2F5EA 3NAUA 5ICCA 2W82A 1X19A 4B47A 3F72A 3ZQGA 1A35A 4KNYA 1D0ZA 2VL8A 5IT9Z 2OPTA 1BR4A 1BBYA 2VPRA 3RDIA 3KP3A 1EH6A 1WHUA 3WTZA 5BPDA 1FIAA 4IRHA 2YU3A 3L7WA 5CKTA 3KLNA 1SVMA 2MBFA 2UXXA 2K9MA 2J5OA 3JAMZ 2HVQA 2K3FA 3W6JB 3J7ZI 1DP3A 2HQ5A 1IDZA 2QVOA 3EETA 4I98B 2I10A 1B4AA 4WXDA 5CQGA 2HTSA 3BR1A 4A5NA 2KZGA 3DFGA 1USTA 2DTRA 1X58A 1R4NB 1CGPA 1R49A 4P55A 3GF2A 2F48A 1GV5A 4A6DA 1JT6A 4BS9A 1C0WA 1JXSA 5C44J 1K4TA 1UG0A 2KPMA 3DEWA 4JBAA 3EYIA 3BTCA 3BTLA 3LSJA 3U21A 4YG2F 3E0JB 3DQVC 1LKXA 1SFOJ 1QO0D 4NDLA 1LEBA 4ZJZA 2A5YB 4NC7A 4WK8F 3KZYA 5C3EJ 3BZCA 4Q4ZF 1Z6TA 4O6JA 2CW7A 3HPGA 3HRUA 4NUBA 5K1YA 2EWNA 2LF8A 2RV8A 3T5XA 4RB3C 1LVAA 4CHUA 1W4MA 4C3HJ 1VQ4I 1X2NA 2YS9A 2M87A 2XHKA 4CCNA 2H27A 4U0VA 3H9GA 4AIHA 3ZQHA 1S29A 3FM5A 2QSGX 2OQGA 4F52A 4KMFA 2BHZA 2M8EA 2WY8Q 2WAEA 3FXQA 3QP5A 2JPBA 1A6IA 5GAGJ 4WX9A 2DT7B 3CZ6A 3SDBA 3T0YA 1OLTA 2P0WA 2QA4I 2OCEA 1O3RA 2XAJA 4BXUA 3CUQB 3ZMVA 3LSRA 2EH3A 2W24A 4EM1A 3CJQB 4MLOA 2H6CA 3BCBA 3EUAA 1XSDA 1MW7A 1QVTA 3F8FA 5EG0B 1X3UA 2VJJA 4FTHA 1JUPA 4EVIA 5L3EA 1E3OC 2D2WA 4HX8A 4GDFA 4E7SA 2QSHX 3RKQA 3UKGA 1UAAA 4M6XA 4HF2A 3K10A 4A12A 4D9JA 3JRAA 3FBIB 1K78B 2E1NA 5DUKA 2XVCA 3ZGKA 3A01A 2DLLA 4OIRF 3P9IA 2MH2A 4YIFA 5CJ9A 1S72I 1QHHD 2HTJA 1ITYA 1MBJA 2L9SA 2F4MB 4D5CA 2L54A 3QU3A 1TBXA 3BR5A 3IKVA 1MKMA 3DWLE 2DA5A 2O3FA 4RAGA 1SAUA 1T0FC 2WADA 1X3WB 1JUMA 1Z1DA 4IJAA 3PNYA 2X6XA 2HI3A 3SYTA 1IN4A 2V1NA 3LNQA 1JJ6C 4Q47A 2XPUA 2HVRA 2X51A 2P8TA 5F64A 5HS7A 5E8IA 3RYRA 3HZJA 3A0BC 5IOYA 1I6HJ 3RIRA 1WH5A 3H0DA 2A69F 3VSLA 3I0TA 3RI4A 3MZ8A 4MTEA 4CSWA 1IG7A 4C2UA 2X6WA 4PJLA 1YX3A 2DA6A 2LP0A 1IN8A 2KJBA 1W5TA 4AM3A 1TQPA 3IWFA 3SFZA 2GIVA 2X6OA 1IC8A 2UXNA 2FNPA 2FUG2 3KZZA 2HOSA 1D1BA 1L3LA 3FHZA 3HL2A 2IA2A 3OYGA 3HSEA 2EFWA 3PIOF 1JKPC 1ZG5A 4HX4A 4ABZA 1J59A 2JA7J 3A0HC 2XGXA 1FWZA 1BOBA 2JA2A 3REOA 3ASNH 4RGXA 2LKXA 2HNHA 1KU2A 1ZLJA 1D1CA 2RQQA 1JE8A 1A31A 1Z77A 4ZTFA 4V19K 3M3YJ 3FMQA 4QPQA 2KLOA 4PJ0C 1I6XA 3GCMA 5J1RA 2NVXJ 3PUFA 3E6BA 2HOAA 2NVQJ 2I8DA 1V55H 2DFEA 2R7ZJ 5HLGA 3NEUA 5D5VB 4ENNA 2F5DA 1S7AA 2IBDA 2DTZA 4OMYA 1XPXA 2ISYA 4F3QA 3GTLJ 2CUEA 2BYVE 4LLLA 1BI2A 2LYCA 3CD6I 2OU2A 3RTRA 2LBFA 4HEA2 3H5NA 3WHBA 1FTZA 1WJAA 3C3WA 4FASD 4IQJA 5D4RA 4RAFA 4KIBA 4Z2YA 1MDMA 4IX7A 4ENMA 5DCMB 3JREA 5FFXA 1YO5C 1V5FA 1WKMA 5DM6F 3WTWC 1VQPI 2K02A 1RKWA 2HYJA 4MFDA 5JVTA 1KU7A 1F43A 3IH4A 1P2FA 2EIMH 3KPHA 2CQ7A 5HDKA 3QYEA 3QPTA 3G1LA 1K6YA 3OMYA 1G8XA 1IN6A 1K6OA 3S32A 2VBYA 3K0LA 3QP6A 3WODF 4ZH4F 3BG6A 4IPAA 3EUKL 5F27A 2R5ZA 4EATA 1FT9A 3CDIA 1SD4A 4HNVA 5JFRA 1YX5A 3OYMA 1I5ZA 3O6BB 4RBOA 3G4SI 4B44A 3LSIA 4LB5A 1T33A 2DFIA 4CYCA 4EQQA 1OYYA 1UG2A 2DA1A 4ZDLA 2IGOA 2EBIA 4BQAA 1IJWC 1VI0A 2L7MP 3U2RA 5B66C 5HS8A 2HQNA 3OOPA 3WE2A 2F2EA 3IRRA 2AS5F 1G59A 2R7QA 5L3BA 4XRSA 1NG6A 5CVVA 3MQ0A 2LSOA 2XUBA 4RMNA 2RKHA 2Y9ZA 2EILH 2TRTA 3BR0A 4PUSA 4UUSB 1JKRC 1FYKA 2WY7Q 5FJ8J 2DOEA 5EEAA 4QLCU 2C6YA 4L5EA 2CUFA 1J0RA 3S2HJ 4HNTA 1U9OA 1R00A 3KX2A 4RM2A 3H3VK 3G1MA 4BNCA 3EYYA 3HTSB 4X1EA 2CJJA 2EV0A 1YW7A 3M8EA 3HTUA 4BEHB 3TO6A 1SC7A 3LA2A 5TGTA 5JVGF 1VQ7I 4BQOA 1VQMI 3H3UA 3KYLA 5K7HA 3S2WA 3T8TA 1KA8A 2OA4A 3C2BA 5HNHA 3CCJI 3DTKA 1ZGJA 1XGOA 3WG9A 3AAFA 1ZN2A 4BUPA 4II3A 3E5XA 3O2PE 1ETQA 1AWCA 2X1DA 2V9PA 4ZTJA 3FISA 2RGVA 1R71A 1HW2A 4E4HA 1SEUA 1NHAA 3GZ6A 2CO5A 4KDPA 2CV0A 3FXUA 5EYRA 3CJRB 2DT6A 1E17A 2DMNA 4QWQA 2NOJB 3MKLA 3ZOBA 4E6KG 4B8XA 2R7VA 2W84A 5EZGA 4ON0A 5GAEJ 2QSFX 2ZCWA 3WTVC 2JVGA 1FBQA 5IP6A 4J00A 4ZDOA 3GZNB 5F0FA 1HF0A 2BW3A 3RQIA 2FMLA 3S93A 4M3DA 2DMQA 5DS9A 2LC2A 2JTVA 1ZQ3P 4CYDA 2DMTA 2HQAA 1HW5A 1MNEA 2QF7A 3F6OA 1MZBA 1I1GA 1BC7C 3BG7A 1EH8A 3EPZA 2GLOA 2Q1ZB 3PQJA 3MKYB 4AIDA 1N77A 5F04A 3I55I 1JKOC 3PSFA 2R92J 3JCUC 4AYBA 3K1MA 5H20A 3ZQQA 1FX7A 2MH9A 1E2XA 3OIQA 4OMZA 5E18F 3HOYJ 3J7AO 4IQ4A 4IO9F 3MKWB 3BJAA 3KP6A 5CVUA 1YRNB 2DT5A 3F22A 1VQLI 4A69C 4P9UA 2CU7A 1BJAA 1MBHA 1NK3P 1MBKA 2DODA 2DYRH 2V7FA 1VNDA 1T8IA 2LY1A 2PMZA 2BHYA 3J80K 5LGUA 3BLYA 2GM4A 4DYCA 2L01A 4LGWA 2ZMEB 1OISA 1ZHFA 2QGUA 1IXSB 4MHGA 2GOXB 1GT0C 2Z16A 3BJ6A 3VSKA 4A3CJ 3ZN0A 2KP6A 2EPFA 2M2EA 1JHFA 2QM3A 1Y6IA 2DYSH 4C2TA 1YJ9I 4KICA 1WJCA 4KMUX 2E71A 4BDZA 3G2BA 3PL8A 4DYRA 4BE0A 1SFUA 4Y52J 4M6VA 2FU4A 2K85A 3FF5A 2PJRB 1XB4A 2L3DA 5DTDA 1XDUA 2R4GA 3QQAA 1D3YA 2L9RA 4EMSA 2HYFA 1WJFA 1KU3A 4ITVA 3T1BA 2OTJI 5J3LA 1CF7A 3B6CA 1O7FA 1U0JA 3CDHA 3KIOA 1XGMA 4N4OB 3O8GA 5AIQA 3J81Z 1SMYF 2BVMA 3TQNA 2ME0A 4L5IA 3HUGB 3CJNA 4E70A 2ZJRF 4W97A 3VYSB 3F8MA 2UWMA 2L4AA 3NARA 1PYVA 5IT3A 4LB6B 3I56I 2JPCA 4LLGF 3DP7A 2GOMA 3NWTA 3D1NI 3M9AA 3BR2A 2WTEA 4U87A 5ERIA 2N8GA 3S17J 4U7DA 2E2IJ 5HLTA 3JRGA 2RAEA 3ABTA 3G1OA 1FYMA 3W2WA 2ZKZA 3LSKA 3FIWA 3SHFA 1JGGA 2Z1DA 4XRSG 4BH9A 2PJPA 4I76A 4D0PA 3OSGA 2VQGA 2IRFG 3E97A 2KRCA 2VT3A 5FGMA 2DA2A 4A0YA 2CFXA 3L2RA 1VQOI 1HDDC 3S1MJ 4IXAA 1XGSA 1ZLKA 1OCRH 2W7NA 4MIMA 1H0MA 5H6QA 1HC8A 4M3BA 2CYYA 4LK1F 3U9GA 2XKPA 3BZKA 4A0XA 5IYDJ 5FLXZ 1T95A 1VTNC 3L9FA 4A2UA 2QQAA 4ETSA 4HPQA 4PSWA 2TDXA 4A3IJ 1FBSA 2QZ8A 1IV6A 2DU9A 2X9DA 1FOYA 1ULYA 3QOEA 2L4MA 2O0YA 4KIFA 2R5YB 2DMUA 1XCVA 3AG1H 3E6CC 2E7XA 4HLXA 2DPUA 3F3XA 1LFUP 2FA5A 3LQQA 3FK6A 2ELJA 1RC9A 5A2QZ 2X0LA 3NRVA 2FQ4A 2E1CA 2E5NA 3ZQIA 4EV0A 3IHUA 2EZLA 3GXOA 3MEXA 4L9VA 4P5OA 2STTA 2ZXIA 5K5RA 2IXSA 2P5LC 2WBMA 2VT2A 4M73A 3DKYA 1KGSA 2PG4A 3F23A 4FCYA 3QPSA 2A61A 2E1OA 1W7PB 4XLCA 1RR7A 1ZRFA 3LSGA 1EA3A 1JTYA 3LL7A 1BL0A 5KHDA 4JX4A 3JSOA 3SZTA 3W6KB 3GFIA 2Z5UA 1ZR2A 1PP8F 1EV7A 2VQLA 1TWAJ 1FOWA 4N4NB 3B02A 5FFZA 5FD6A 1AOYA 5FKLA 4R79A 3ZR8X 2XC7A 1LDJA 5B1AH 3BG5A 5L3CA 1KZHA 1OCCH 4BGDA 5DDGA 2LREA 3QOPA 3KETA 2BXZA 5IY5H 1IXCA 1TZLA 2CWEA 3S3MA 2VBXA 3G73A 4EGZA 2I5UA 2LOOA 1B8IB 3V8LA 2B0LA 3SQNA 4G7ZF 3S1NJ 2FOWA 4CCLA 5DD4A 5EGOB 1ZELA 3MCZA 1IF1A 1LDDA 5FB2A 3ZQFA 2R7XA 4DZPA 4HQMA 4JQFA 3DKWA 4AC0A 5IP7J 1Z21A 4IF4A 3DTIA 4AWXB 4GYGA 2Y48A 1FOXA 2ZSIB 5C4JJ 1G3TA 3TBIA 2MLGA 2JWTA 4OAYA 3IH2A 2PMUA 3SDGA 1FZPB 1BM9A 3S16J 2VPLA 3FXKA 1TWFJ 2DA3A 5BPIA 3ZMSA 3CC4I 3TDZC 1TQMA 2OQRA 3E6DA 2HYGD 2XPVA 3S15J 1FY7A 2MFZA 9ANTA 3S3OA 1R4MB 4HLYA 3LFUA 1MSEC 2ECBA 1I1SA 1S5LC 4DBRA 4IKFA 4RGSA 1W1WE 4G94A 3I71A 5IP9J 3DLAA 3OYIA 3GX4X 3RKWA 1OJLA 3K69A 5EG0A 1ZRDA 1H9GA 2MC4A 4UUTA 4QPOA 1GXPA 1WI9A 2FXAA 1U5TA 4RGRA 3CP8A 4LK0F 2IGKA 4XICA 3N97A 4LIUA 3ZXSA 4IRIA 1Y0UA 2A5WA 2ZBKA 1OR7A 1FJLA 1BC8C 1E3PA 4EJVA 3MMYB 3AL0C 1K78A 4BDYA 2VQHA 1SMTA 5M5YJ 3H3ZA 4HG2A 5F1JA 2Z9OA 1L0OC 3I53A 3V7SA 5LRSA 2CQKA 1I39A 1VZ0A 2VJ5A 2Y0MA 4EJTA 2ZFWA 2QLZA 2IS2A 1MH3A 2K9SA 3OYDA 1Z3XA 2Q2EB 4CO8A 5TJJA 2RN7A 1HW1A 3F9KA 1YS6A 2EZIA 2V26A 5CPRB 2KISA 3Q3SA 5LD2C 1DQUA 5CQEA 4YEJA 2XPWA 1P7IA 3FKJA 2CSOA 4A0ZA 1S6LA 1XG1A 2D1VA 4NNJA 4L0ZB 3EUHA 4OIPF 2NS7A 2VIXA 1DUXC 2W1OA 2HOTA 2COBA 4CA0A 3DBHB 1TTYA 2V9VA 4LJZF 1B72B 3BPXA 2ID3A 3PSIA 4CCKA 1DU6A 2WV1A 3DU5A 3L2UA 4PJMA 3HDDA 2NNYA 4KUMA 1GV2A 4M74A 4G6DA 3CCMI 4UVAA 2WV0A 5HLIA 2AQFA 3BT9A 5FKKA 3W3CA 4RB1A 5AONA 1J75A 2YU9J 3K9TA 3HOWJ 2ADUA 2V6CA 3HB9A 3TL4X 2KT0A 4Y15A 1HBXG 1UFMA 5K7ZA 2DA7A 1R1VA 1X1PA 4M3GA 3WU2C 2M4GA 4E7KA 1KYZA 3SXYA 2M7BA 2BE5F 3CLQA 1D0XA 1RZ4A 4ESBA 4F7ZA 3DBLB 2M0MA 2KDZA 5EDNA 4F92B 2HS5A 2KQRA 3MD2A 2HU9A 3C1DA 3Q0WA 4EM0B 3M07A 4AIKA 1LJ9A 2LH9A 4E7LA 5F0HA 1ETKA 1Y1WJ 3OYJA 2GIZA 2LF7A 2HKXA 5JR3A 2LKPA 1K79A 2VJIA 3LSTA 2KIFA 1R9TJ 2ICWG 3ZMTA 1A6QA 4XR6A 2MD5A 3H36A 3I54A 3CDLA 2Z2SB 4AVPA 3GBGA 4U88A 5GTIC 5EF6A 1X1DA 1SANA 1VF9A 1WQ2A 1REPC 3B6AA 2E1MB 3EDPA 2XGEA 3A03A 1IW7F 3HC7A 2V4JC 1MJ9A 3DXJF 2EQRA 1J5YA 1OYWA 3L00A 4HAMA 2QKLB 3VOEA 3K1PA 2A05A 4YFNF 1ODDA 2VXZA 5J4VA 4XLAA 4NBQA 3DLLF 3VEPA 2H09A 3NWSA 4X0GA 3S3NA 2QENA 1N78A 4RAZA 5LHGA 4FE7A 3FHNA 3ML6A 4L5JA 4V2FA 3ZMZA 2P81A 3CMAI 4KT5C 3GFMA 3FBNB 3P5JA 3OYBA 3OYEA 2OTLI 4MNUA 2ZO4A 3VPRA 4L9JA 1MJBA 4BACA 2R0QC 3WG7H 1WH7A 2ELHA 3I3LA 3TP0A 2M8GX 4C2MJ 4EEFG 1TW2A 2XRNA 4PJJA 4XKWA 2HVSA 2VI6A 3L1PA 1F1ZA 1LNWA 3FX3A 3CO7C 2EA2A 4DW6A 4J01A 1Z3YA 2CG4A 2QWWA 1Y1VJ 1BJZA 5BNGA 3ZMUA 2A68F 2FBKA 4MQ9F 3GZ5A 5FKOA 1TC3C 1U5TC 2XAHA 3IUOA 4HDVA 2F4IA 5DM7F 1FC3A 3QPLA 1W0TA 2JK3A 1IRXA 3D5RC 1HOMA 2PMHA 4NQWB 2P5KA 2LNBA 1DP7P 1OR7C 4BQNA 2LDUA 2OV7A 3OL3A 1YI2I 5CYVA 2QQ9A 4UUSA 1HA8A 4HZFA 5DEQA 1Y39A 1U8BA 3WGHA 4IRGA 3FM3A 3KE2A 3M8FA 1W0UA 1LFBA 3K4LA 1HSJA 2Z33A 2ZXHA 3JSPA 4XOTA 4EJWA 3HOZJ 3D5SC 3DV8A 4YIIA 3F6VA 5E20A 1B1BA 4ZC3A 4LFUA 1K4SA 4BEHA 4BHPA 4Y3OA 3DBRB 1QHGA 3E3VA 1X3ZB 2PX9A 2CH0A 2QYOA 1Z7UA 1QZZA 2YPRA 1WJEA 2ZFUA 4HF0A 2PFBA 2EFQA 3QPHA 5KVRA 3CCQI 3EUHC 3MZYA 2DN0A 1JGSA 2HOEA 4I99C 1TW3A 1E0EA 3A2KA 2M0CA 5FD5A 4BY1J 3ZMDA 2BXYA 4L9NA 1K7AA 3SEZA 1XMXA 5J47A 1R58A 4A5MA 2JT1A 4B43A 3CCEI 1I3AA 2Y75A 1RUNA 3IAS2 1ETVA 3GMEA 4A3FJ 1ON1A 3GLLA 5K5QA 4JX6A 5J8FA 4M9XA 3PIPF 3CC7I 3DTEA 1WWXA 1ZAOA 1V5GA 4RA2A 1HLVA 3HBLA 2VBZA 3VODA 3J7YJ 1H88C 1LQ1A 1LB2A 3QWLA 2NVTJ 4M6YA 1O7LA 1S9HA 2DPDA 2VUMJ 1SVLA 4QIWN 4FX0A 1KQ0A 2PBIA 4CGZA 5DCFA 2W85A 1Q1HA 2ELKA 2H1LA 2OJED 5E1WA 4XQFA 2X1EA 2XV4S 3ELKA 3HM5A 3CCRI 2ACJA 2OZ6A 4CZZA 2RNJA 1Z6RA 3V7RA 2DK5A 5DUIA 2P4WA 4PCQA 3KP2A 1NG7A 3KYCB 3OYHA 4IHXA 1R22A 2QQ8A 3J80Z 1JKQC 1I50J 4CZCA 2CRGA 5HODA 3RQ4A 2L02A 2OBPA 3KLOA 2E7WA 3H92A 1RUOA 4UUVA 4I01A 3JRIA 4LLNA 4XONA 1YLFA 2ZB9A 4UHTA 2ME6A 2ZMEA 2JA8J 2JZYA 1O57A 2DO7A 5K5OA 1MD0A 3D5LA 2CUJA 2EZKA 2XROA 2LG4A 2JMWA 5B5EC 1X2MA 3HSRA 3K6GA 2LBFB 1FP1D 2CUZA 1VQ6I 3WGIA 2JUCA 3I59B 1GLNA 3WTTC 1MDMB 3WTXC 1NTCA 1XMAA 1ZREA 1TWCJ 4UXNA 1WJBA 3GO5A 3CC2I 3TMOA 3PUBA 4A3MJ 3P9CA 1XDSA 1XMKA 3GFLA 1O3QA 2HEOA 4B1RA 5AIPA 1V54H 3OYFA 5KNLA 2PJRA 1MBFA 3K70C 3VYUB 1D0YA 2E19A 3C2HA 4HV5A 2ETHA 3CMEI 3RYPA 3PNTA 3S8PA 4AVZA 4XL9A 4EGYA 3BCAA 2R7TA 4E7HA 4MEYF 1D1AA 1V5EA 3ZQCA 4U0YA 1XX5A 1RNLA 4GGGA 4C9YA 1OCOH 3JRFA 2EJRA 4G9YA 4D5FA 1MNDA 2EB7A 2GZWA 2NAZA 2DJIA 2NYXA 5ILSA 3CJTB 3GW2A 1NH3A 2ISZA 4D7NA 1PDNC 4ENJA 2GA2A 3FWEA 1FLIA 4G12A 5JLWA 5F6FA 1YTYA 4U0WA 4GXOA 5JHFA 3K4NA 2OAZA 2FOKA 4E7ZA 5LHHA 2LR8A 2BOLA 4PZJA 2JRMA 4BJ6C 2AXTC 3RSNA 4OOIA 1J09A 3HG9A 3K4CA 5EEGA 5BOXA 4X6AJ 3R0AA 2IVMA 4XRFA 2XGDA 1USSA 2J5PA 5FKMA 2M1BA 3VDXA 1KONA 2H94A 2BV6A 3LAJA 2PI0A 2HXIA 4PFPA 4NC8A 3BY6A 4BXXJ 3MZHA 3OYCA 3VYRB 2KIUA 4UVBA 2JA5J 1TNSA 2HDWA 4JX5A 1KQ8A 2H1KA 1R36A 2VBWA 4JK1X 5IOZA 4KISA 4ENKA 2W57A 2P6SA 1HKSA 1B6AA 4RAYA 4XM3A 5D5XB 2LMDA 3OY9A 1SFXA 2NNNA 2DOFA 1FMVA 2XAUA 2FSWA 4M9ZA 5E1XA 1YFHA 4Q5SF 2XF6A 1MBGA 4NHJA 3OR2C 1QVUA 1Q1VA 2VODA 4XK4A 2HZDA 2GQQA 3BDDA 2OD5A 2FBHA 3AKZA 4DQ2A 1GXQA 5GPCA 2EK5A 2HZTA 3OIPA 1ZKGA 2Z3YA 1LEAA 3HPHA 3TO9A 4UNOA 3PO3J 3GTMJ 4G7OF 1PUFB 1P4AA 4BY7J 2LY2A 3PJRA 5D6FA 4OWRB 1LE8B 3KFWX 3CLOA 2ZC2A 4LG0A 1U9NA 1W7PA 5FROA 1Z9CA 1U3EM 4MO7A 4IHSA 3CTAA 5IYCJ 2OUMA 1WJ5A 2V79A 2IW5A 4RGUA 3K1NA 1ZTRA 3V4GA 2K86A 3DPTA 4ESFA 3BTJA 2AXLA 2LRDA 1S8NA 2EFOA 1UZCA 4BBRJ 1ETXA 2HDDA 3BZ6A 4PDKA 4WWCA 4U7BA 2CFOA 1I3QJ 1FPQA 2IJLA 4Y17A 3G3ZA 4A3JJ 5J1UA 2IA1A 2CGPA 1R7JA 2FD5A 4AUXA 2DOAA 3JTHA 1ZK8A 1B8IA 1E3HA 3BQZA 2K9NA 5IYBJ 3CCYA 4UV8A 2ZMEC 1FP2A 3H1CA 3DF8A 4IZZA 1BR1A 5EGOA 1T39A 3V42A 1QBJA 3N4MA 1V3FA 2V1DA 2M9HA 1OCTC 4IOAF 4HDUA 2EZHA 1MJAA 2CQQA 1MMGA 1P4XA 2Y30A 1MSFC 5ILUA 1TWHJ 1ZG1A 4N9IA 2MSYA 3AG4H 3JRDA 1SAXA 2QBYB 4HYEA 4ZYHA 2BY2A 5M5XJ 1FOKA 2W25A 4A3LJ 2ZSHB 5D8LB 4XIDA 5M5WJ 3A02A 2BY3A 1YW8A 5F08A 1GUUA 2JRTA 1R23A 3MWMA 2WC2A 4II2A 1TLHB 2R7OA 3QAHA 2L7KA 4S0HB 1RR8C 4R1HA 2JN6A 3PFYA 4QTRA 4D1QA 1EJ9A 4B09A 2EFNA 2UUZA 1JUSA 4PGGA 1HDPA 2Y31A 3DEEA 3OOUA 2DAOA 1WSUA 2L2OA 3HJEA 2L9VA 2A3SA 2QUFA 3M7GA 2GWRA 4XLHA 4XSZF 2Y69H 1QZEA 2IS6A 4M3FA 3JTGA 2ZXWH 1J9IA 3HOSA 3VB2A 1ONVA 5JLXA 2ZNYA 3E5QA 2WA0A 3CP2A 2FBIA 3KEQA 5CLSA 3F21A 2O9LA 3C2GA 2A07F 3HIFA 2R7SA 1QPIA 3H0GJ 4BQQA 5ICEA 4CDGA 4N9HA 2JQ7A 3HOVJ 2CW0F 3OYNA 1MMSA 2KHMA 4ZYDA 4XKBA 1AKHB 5J8CA 2CW8A 2EA4A 1UMQA 2XF5A 3OWTA 2LTPA 5KCMA 4RB2C 1GVDA 1NK2P 2IGMA 2L5QA 1XC5A 1K83J 2VQCA 5D5WB 3FKIJ 1LDKB 2VJ4A 5H6RA 5J4YA 1YITI 1SFKA 1XD7A 3FXJA 2H6BA 4XLFA 1PUEE 1Y8RB 2KMUA 3OYKA 2M30A 1T56A 1LPQA 1DGRM 5LEKA 1HXDA 2D1HA 2NVUB 1SVOA 1UHSA 1WFXA 1B72A 3BROA 5FLMJ 1S7OA 1VQ5I 4O3MA 3IP4B 4ZZLA 1R1UA 4XLPF 1B9NA 3I5UA 2CV2A 3J7AY 2M5WA 3CCSI 3ZRGA 2E34A 3GTOJ 1Z7LA 2E2HJ 1VQKI 5L3DA 1W7PD 5J1YA 1R5HA 3RPQA 2XB0X 1PVEA 3CUQA 1B9MA 3T8RA 3E1SA 3R4KA 4JOMA 4CCOA 2RREA 3SZGA 2DMPA 2WAQA 4LITA 4TV7A 2B63J 1P7JA 2VXDA 5CVJA 5F1RA 4DBQA 2CQXA 3L2VA 1DPRA 4L9TA 3BP8A 4MFEA 3ZCOA 4F93B 2YX4A 3TKYA 4DIQA 2IA0A 1MMNA 2YX7A 3K4KA 2YSRA 2L0KA 5CVRA 1D5YA 4OIOF 4AIJA 1KYWA 4V2GA 4I02A 2WB1N 3PO2J 2K5CA 2DFFA 1GDTA 3QYBA 3CESA 2WWYA 4Y33A 2DQRA 5GP9A 3K4JA 2GBYA 1BIAA 1I27A 2XB5A 3JW4A 5F0CA 1G3SA 5J6XA 2Y2ZA 2FEZA 1U78A 5D6EA 2IS4A 2LY9A 3QODA 2NRAC 2XDVA 2KIMA 4BJTA 1RIOH 1DGWY 3K2ZA 4LOCA 2HQRA 3PQKA 2VKHA 2KFDA 4NC6A 2ZJQF 4GYIA 1JJ8C 5GAHJ 1QNTA 1BN5A 4IOCF 4E7JA 1MH4A 1OKRA 2NOGA 1A36A 4A3EJ 1QPMA 4BKXA 2F6CA 2M7AA 4PFOA 4D7MA 1IN7A 3OR1C 2EV5A 2PQ8A 1W5CC 3HRTA 3ECOA 1X1BA 4BU2A 2WAQN 5HDGA 4M71A 4RLQA 3Q0VA 4IEJA 2LLKA 3JRHA 1UELB 1EKEA 2VB6A 1RETA 5D5UB 2B7EA 3W2AA 5BS6A 4KYWA 3L09A 3AG3H 3ZN1A 5FRNA 3BR6A 4GFBA 1S7EA 1IV8A 3I9V2 3HOXJ 2W4SA 2ZXJA 1H89C 3LSHA 3KP7A 4KT6A 2K7LA 5TISC 3TEDA 3ZP5A 1YE9A 1SFEA 3K2AA 1RESA 4G8XA 1QZYA 2GA1A 4BL0B 4IHWA 2E2JJ 2VC0A 1R1TA 3CF2A 3CCVI 1BOAA 1N75A 3CQZJ 2JSCA 3TGNA 1ZYRF 2MA3A 3FXOA 3KP5A 1FIPA 2HWVA 5HVQC 2F5VA 4XBFA 1FYLA 1BA5A 3ULQB 2VOOA 1TT0A 3LOCA 3CCUI 3GTQJ 4DOZA 5KK1A 3GTPJ 2VASA 1AU7A 3LA3A 2VC1A 4I0BA 3FZVA 2ZNZA 4P96A 2W00A 3TDUC 3OS2A 2XIGA 3M1CA 3ABMH 2H8WA 1ON2A 5E3LA 2GAUA 4NQWA 5LHIA 3I4NJ 4XKVA 2NVYJ 5B1BH 2VN2A 1U5TB 3HRSA 3R0JA 3V7CA 3W6VA 5IT9K 2RNGA 2MW8A 2VONA 1IRZA 2COMA 1IAWA 3LSPA 3IWZA 2X1CA 3FK7A 2IT0A 1F36A 4HX7A 3RJPA 1ENHA 1WVRA 3JAMK 3I64A 4UV9A 3HSFA 1ZR4A 1VQNI 1OYIA 3CMMA 2XSJC 2EINH 2X85A 2P7VB 4C3IJ 2UZKA 3EQLF 3BPVA 2EV6A 5DCMA 2ZJ2A 1XN7A 1GVJA 1T38A 3GTJJ 3OS0A 4Q48A 3LQRA 2R7WA 1XS9A 3MAJA 2JJ7A 4I6ZA 3E7LA 3KEOA 3E6MA 1MMAA 2NS0A 1YQAA 4W1UA 3FMRA 1LVKA 3PNVA 5LLQA 2M4KA 3UNGC 2DCEA 2K9QA 1YHQI 3GFJA 5LGTA 2YR2A 2XASA 1YIOA 3HOUJ 1JHHA 3CUQC 4XLEA 2O5RA 1FTTA 2A6HF 4PSXA 3ABUA 3I58A 2W48A 3U1DA 3SJMA 3KCCA 4XKCA 2K4JA 4N0BA 1LUJB 3SZPA 2M3AA 4QSHA 2IPQX 3H5AA 2V9KA 3DPLC 3DPUA 2HDCA 3GYHX 1JTXA 4FISA 4GCVA 3G6EI 1LFPA 1OMIA 3WU0A 2LKSA 3K7AJ 3M4OJ 2FF4A 4HW0A 1OCZH 1IO2A 5D4SA 2X48A 1MMDA 5E17F 3HGGA 5CVIA 3F8BA 2G9WA 1FSHA 2E35A 3I4PA 1OQYA 3HYIA 1FBUA 3BTIA 3L2QA 1CQTA 4B3XA 1X1CA 4B48A 3COAC 1TNTA 3BC8A 3A01B 2E1MC 5LBQA 2HXOA 4FT8A 1BW5A 1HKQA 1TL8A 1ZH5A 3KP4A 1Z0XA 3BJOA 5HDNA 2ECCA 2G0EA 3QYFA 4Y7NJ 1ORKA 5EEHA 2DA4A 3HKZA 2L7ZA 2CS3A 2IAIA 3CUOA 1QU3A 2BEOA 2MABA 1FSEA 3MN2A 1DPUA 1T08B 3IH3A 2K4BA 3ONQA 1WJDA 2DDAA 4IHTA 3GTKJ 4YFXF 2OF7A 4J19A 4HOBA 4B4CA 1BIBA 3I59A 4FHTA 1IN5A 2KKOA 4DGWB 4XN3A 2RDPA 1WPKA 3PM1A 3SFIA 3HEFA 4FETA 4I09A 2DBBA 2LVSA 2WAFA 3E5UA 1TT5B 1ZGAA 4E7IA 2R7DA 3O8HA 5E8GA 4BXFA 5FRMA 2DXIA 2V6EA 5GADJ 2Y9YA 2JUGA 3WTYC 2Y0SA 2P7CB 3C7JA 2UV1A 3PFIA 3GTGJ 2XAQA 1H8AC 3JR9A 4PGHA 4H4KC 3R6SA 1UHWA 2RQPA 4P1WA 4XSXF 1G3WA 3IRQA 1U2WA 4CH7A 2G7HA 4MQVA 2XAGA 2NXNB 3BG3A 5HLHA 4XLNF 4UB6C 2EIKH 4RB0A 1G6NA 4HBLA 4A6EA 3HKZN 1F4KA 5GPAA 2E60A 3H5RA 4RS8A 4MTDA 2VE9A 4UY8I 1F9NA 1ETYA 4AU7A 4HNUA 2P5VA 1YRNA 2MYSA 4XOPA 4M3EA 3UR3C 3CO6C 4S05A 2FE3A 2GXGA 3ABKH 4KJZA 2Q8KA 5ICFA 4Z6YA 1SD7A 2O03A 4O5VA 2BY1A 1RI7A 2L7FP 3TOAA 3ERED 4I7HA 1W5SA 3A4CA 2OC6A 3OSFA 2V1XA 3HOTA 3CF5F 1RKTA 3ERMA 4HA8A 1ZGWA 5GTHC 1PJRA 2Y0SN 1ACIA 3G71I 4A3KJ 1X4OA 1XSVA 3FXLA 2HPMA 1BI3A 1O4XA 2G7UA 3H35A 1R5GA 1R5ID 4XRMA 4NB5A 5DD8A 5FO5A 3DU6A 4BAYA 2H8RA 1A5JA 1WZ2A 2VKDA 2MD0A 1BW6A 3LFKA 3K70D 2QEXI 3ASOH 1UCRA 1RRJA 5DV5A 2ZJPF 2YUSA 4ASNA 2O6GE 1R6RA 4L0YB 4WCGA 3F0CA 4C30A 4WF2A 3K4BA 3WE3A 1GHCA 5E1ZB 4ZYGA 4UB8C 4BJ5C 3LWFA 2AO9A 1KQ9A 3GEZA 1QA6A 1OPCA 2CQNA 3B73A 4UVCA 2R5ZB 5FLVA 4LG3A 3TOBA 3HUGA 5DYMA 2XRLA 3HGYA 2O7OA 3RPUA 5KAFC 2K27A 4I0AA
chains in the Genus database with same CATH topology
4ZTFA 4DJAA 3OYDA 1Z3XA 4QPQA 3A1YA 2Q2EB 2KLOA 3SEQA 3F9KA 2V26A 5CPRB 4II2A 5LD2C 1DQUA 2R7OA 5CQEA 4YEJA 2L7KA 3VYTB 2CMPA 3FKJA 2R7UA 2I8DA 3PFYA 4G6TB 4NNJA 4D1QA 2VIXA 2K3PA 4RLFA 1BR2A 4HSRA 4KITB 2W1OA 4F3QA 4CA0A 2UUZA 4XN0A 1JI8A 3DEEA 3OOUA 2LYCA 3PSIA 3RTRA 2LBFA 4CCKA 2L2OA 2E5ZA 3DU5A 3KEYA 4HEA2 3H5NA 3L2UA 4PJMA 1WJAA 4FASD 4IQJA 4XLHA 4CCJA 4F55A 4IX7A 2IS6A 2AQFA 3W3CA 1V5FA 3HOSA 3H9QA 2KRHA 3FDYA 2WA0A 3CP2A 5HNFA 3C2GA 2R7SA 3TL4X 4BQQA 1X4PA 3QYEA 2M4GA 1K6YA 1Y56A 4Y4RA 3OYNA 3N05A 1G8XA 2M7BA 3OMYA 4E7KA 2KHMA 3S32A 1D0XA 4XKBA 3BG6A 3EUKL 2M0MA 4EATA 2CW8A 4F92B 2KQRA 3MKZA 3MD2A 2HU9A 3AFHA 2XF5A 3OWTA 4ZYAA 1YX5A 5KCMA 2LH9A 3OYMA 2IGMA 4E7LA 3LSMA 3OYLA 2L5QA 3W2VA 1FMWA 2KL4A 4B44A 3LSIA 3OYJA 2VQCA 2VJIA 4XNFA 1LDKB 2VJ4A 4ZDLA 2IGOA 1SFKA 4XR6A 2Z2SB 3GBGA 2JVHA 1X1DA 4XLFA 2KMUA 2E1MB 3OYKA 2XF7A 1G59A 2R7QA 2HPIA 3HC7A 2X6YA 2V4JC 1DGRM 1NG6A 2BW3B 1WFXA 4RMNA 2QKLB 3IP4B 4CCMA 2AQEA 4PUSA 2VXZA 2CV2A 2WY7Q 3DKXA 4XLAA 3J7AY 4HRIA 3ZRGA 3NWSA 4X0GA 3S3NA 4HNTA 4YRVA 1Z7LA 1N78A 3KX2A 4RM2A 3FHNA 2KDOA 3HXLA 3FBNB 3E1SA 4XMYA 3OYBA 4JOMA 4CCOA 2RREA 3SZGA 4BEHB 1W36D 3OYEA 2WAQA 4LITA 2QKMB 5TGTA 4BQOA 2VXDA 4DBQA 3KYLA 3L2VA 3ZCOA 3OS1A 4F93B 1W36C 5HNHA 4DIQA 4BACA 3DTKA 1MMNA 3K4KA 3I3LA 4BUPA 4II3A 2K9LA 4PJJA 4XKWA 2X1DA 2HVSA 4ZTJA 2K5CA 3QYBA 4E4HA 3CESA 4Y33A 2CV0A 4J01A 1Z3YA 3K4JA 4PJNA 3CJRB 2DT6A 4YELA 2NOJB 4E6KG 2IS4A 3QODA 2R7VA 2XDVA 3IUOA 4BJTA 2F4IA 1DGWY 2VKHA 1IRXA 3D5RC 4NQWB 2JVGA 4J00A 1OR7C 4BQNA 4ZDOA 4E7JA 3OL3A 2BW3A 2OV7A 3S93A 2LC2A 2F6CA 3RPUD 2M7AA 4PFOA 3OR1C 1HA8A 2L9NA 2HQAA 1MNEA 1P9QC 3LMMA 4ANJA 3L2WA 1X1BA 4BU2A 3BG7A 3EPZA 4RLQA 3K4LA 1UELB 2Q1ZB 2VB6A 2ZXHA 4PK4A 3MKYB 4XOTA 1N77A 3PSFA 3W2AA 3D5SC 4ZC3A 4AYBA 3ZQQA 3H9JA 5FRNA 3OIQA 4BEHA 3I9V2 4Y3OA 2W4SA 1QHGA 3LSHA 1X1AA 4KT6A 4IQ4A 4CUGA 2CH0A 3MKWB 1YE9A 1WJEA 2ZFUA 4BL0B 3CF2A 1N75A 3EUHC 2V7FA 3RCOA 2BVLA 1E0EA 2R7RA 2LY1A 2PMZA 2IGNA 3A2KA 3BLYA 2JSPA 5HVQC 2F5VA 3OYAA 1TT0A 3SEZA 2GOXB 2Z16A 4DOZA 1ERDA 2VASA 4B43A 3VSKA 3AL0B 5LFAA 3IAS2 2KP6A 2W00A 3OS2A 3M1CA 4RM3A 1Y6IA 3DTEA 4C2TA 1V5GA 3K4MA 4XKVA 2CV1A 4HSTA 1WJCA 2A6TA 4BDZA 4BE2A 2RNGA 3G2BA 2WB1A 3PL8A 1S9HA 4BE0A 4GRIA 2X1CA 2PJRB 2R4GA 4XQFA 1WJFA 4ITVA 2IS1A 2X1EA 3CMMA 2VLAA 1U0JA 2XSJC 4ZDPA 4BE1A 4N4OB 1AA7A 3IAM2 2BVMA 2X85A 3HUGB 3VYSB 1NG7A 3OYHA 3VWBA 2UWMA 2KZVA 1PYVA 3OS0A 3OL4A 4CZCA 2GOMA 2R7WA 3NWTA 3RQ4A 4U87A 4XONA 4OAZA 1MMAA 5HOOA 5HLTA 3M8JA 4XORA 1LVKA 3W2WA 3PNVA 3LSKA 2M4KA 3D5LA 3UNGC 2DCEA 2CUJA 4F91B 2Z1DA 2LG4A 4LIVA 2W82A 1X19A 2VQGA 3K6GA 2LBFB 4B47A 1D0ZA 2VL8A 2KRCA 1BR4A 2CUZA 4XLEA 2O5RA 3L2RA 1GLNA 4PSXA 1WJBA 2W7NA 5CKTA 3TMOA 3PUBA 4XKCA 2K9MA 2HVQA 1DP3A 2M3AA 3OYFA 1T95A 3H5AA 5KNLA 2PJRA 3K70C 2V9KA 3VYUB 3DPLC 3DPUA 1D0YA 3C2HA 5CQGA 4HPQA 4PSWA 1LFPA 3PNTA 3S8PA 4AVZA 4XL9A 3BCAA 2R7TA 4E7HA 1D1AA 1V5EA 1MMDA 4C9YA 3QOEA 4BS9A 1MNDA 1UG0A 2KPMA 2DJIA 3L2QA 3U21A 4B3XA 1X1CA 3E0JB 4B48A 2ELJA 3DQVC 3BC8A 1LKXA 2E1MC 2E5NA 4ZJZA 5JHFA 4NC7A 3K4NA 4P5OA 4E7ZA 3QYFA 2CW7A 2ZXIA 3HPGA 2IXSA 4NUBA 2WBMA 3HKZA 3DKYA 2CS3A 2BOLA 1QU3A 2MABA 4XLCA 4BJ6C 3RSNA 3LSGA 3ONQA 1EA3A 1J09A 1WJDA 4CCNA 3H9GA 3HG9A 3K4CA 3LL7A 5KHDA 4F52A 3VDXA 2VQLA 2WAEA 2WY8Q 4DGWB 1KONA 4N4NB 4XN3A 2DT7B 4FETA 3CZ6A 4NC8A 4PFPA 1OLTA 2P0WA 3SDBA 4R79A 2XC7A 2WAFA 3ZR8X 3OYCA 3VYRB 2HDWA 4E7IA 3CJQB 4BGDA 4MLOA 4BXFA 2LREA 3BCBA 3EUAA 2DXIA 4KISA 1MW7A 2V6EA 5FRMA 1TZLA 2VJJA 2JUGA 3S3MA 2Y0SA 2UV1A 4XM3A 3OY9A 2LOOA 4H4KC 1FMVA 2XAUA 4P1WA 4E7SA 2XF6A 3OR2C 4CH7A 4CCLA 1UAAA 1ZELA 3K10A 2HZDA 4D9JA 3FBIB 2R7XA 2E60A 3H5RA 4JQFA 3ZGKA 1Z21A 3AKZA 3DTIA 3OIPA 2ZSIB 4AU7A 3HPHA 4HNUA 3TBIA 1QHHD 2L9SA 4OAYA 2MYSA 2LY2A 4XOPA 3PJRA 2VPLA 3UR3C 4OWRB 3DWLE 4KJZA 5FROA 1SAUA 1T0FC 2WADA 2OUMA 1WJ5A 3PNYA 2X6XA 3SYTA 3A4CA 2MFZA 2OC6A 3S3OA 3HOTA 2V1NA 2HVRA 3DPTA 2X51A 2LRDA 3LFUA 1PJRA 4DBRA 4IKFA 1X4OA 2HPMA 3H0DA 3H35A 3VSLA 3DLAA 3DU6A 4CSWA 3OYIA 4U7BA 2CFOA 2VKDA 4C2UA 2X6WA 4PJLA 1YX3A 2MD0A 2MC4A 4QPOA 3K70D 2DOAA 2FUG2 3CP8A 1D1BA 2IGKA 1R6RA 4LIUA 4C30A 3ZXSA 3HL2A 3K4BA 4IZZA 2A5WA 1BR1A 3OYGA 3MMYB 4BJ5C 3AL0C 3V42A 4BDYA 2VQHA 1BOBA 2JA2A 4HG2A 1MMGA 2HNHA 2RQQA 4LG3A 1D1CA 1VZ0A 2VJ5A 2IS2A 2ZSHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF7 A;  2XF6 A;  2XF5 A; 
#chains in the Genus database with same CATH topology
 1PUF A;  4DJA A;  4LMY A;  1F5T A;  3A1Y A;  1WGX A;  1U6G A;  2QCO A;  3SEQ A;  1O3S A;  1XGN A;  1LE8 A;  4CYC B;  2D45 A;  2DFH A;  4EJU A;  1YG2 A;  1G3Y A;  2FJ1 A;  3BR3 A;  3P9K A;  5M3F J;  3VYT B;  2CMP A;  1MBE A;  4IHY A;  2F4O B;  3GWZ A;  2LK2 A;  2R7U A;  2IP2 A;  2XAF A;  4WXC A;  3R60 A;  4G6T B;  1IXR C;  3C18 A;  2K3P A;  4RLF A;  2BZT A;  1BR2 A;  4HSR A;  4KIT B;  5LRR A;  6PAX A;  3IV5 A;  4XN0 A;  5J40 A;  3JRC A;  3QRF F;  2VE8 A;  1JI8 A;  4YFK F;  3KZI C;  4FQG A;  4KA4 A;  3WGG A;  2V1U A;  1YW9 A;  2IEK A;  3Q9V A;  2E5Z A;  4A3D J;  3KEY A;  2K40 A;  3LAP A;  1XSX A;  1VFC A;  3D0S A;  2Q0O A;  1Y8Q B;  4CCJ A;  4F55 A;  3ZQ7 A;  1TQI A;  4KIG A;  1FEX A;  3X2Q H;  3MVP A;  3H9Q A;  2KRH A;  3FDY A;  1QGP A;  5HNF A;  4H0E A;  1X4P A;  3Q5F A;  3F8C A;  1Y56 A;  4Y4R A;  3RKY A;  3N05 A;  2FQ3 A;  3S14 J;  3Q0U A;  5D8K B;  4BHC A;  2BY0 A;  4OIN F;  1EH7 A;  2GXB A;  3M1E A;  2B9S A;  2RVC A;  2F5C A;  1SD6 A;  2R5Y A;  2QBY A;  3MKZ A;  3AFH A;  4ZYA A;  4A3G J;  1Z91 A;  4MEX F;  2KRF A;  3WTS C;  1O3T A;  2KIQ A;  1D5V A;  3LSM A;  4EJO A;  3W2V A;  3OYL A;  1FMW A;  2KL4 A;  1YIJ I;  4G6Q A;  1SD5 A;  2FNA A;  4XNF A;  2DJN A;  2P6T A;  5L3F A;  3BOQ A;  5M3M J;  1V4R A;  2ID6 A;  4Y13 A;  4WXH A;  3ECH A;  4AD9 A;  1MGT A;  2JVH A;  2PEX A;  4AYB N;  3TW6 A;  1T98 A;  5BMZ A;  4KN4 X;  3WU1 B;  2XF7 A;  2HPI A;  3VFZ A;  2X6Y A;  1STZ A;  3Q9S A;  2BW3 B;  4DZJ A;  4CCM A;  1P6R A;  5FKN A;  2AQE A;  4HF1 A;  2R93 J;  3DKX A;  1J7K A;  3BWG A;  4HRI A;  4L18 B;  2TCT A;  3I4M J;  3JRB A;  2E36 A;  4A93 J;  2PMZ N;  4YRV A;  2XKO A;  3BG9 A;  2KDO A;  3HHG A;  5E3N A;  2HGC A;  3HXL A;  5E79 C;  1G2H A;  2R3S A;  4LD5 A;  1YJW I;  4XMY A;  1W36 D;  5ILV A;  4HV6 A;  5KAI C;  2QKM B;  2EIJ H;  4YIR X;  2DK8 A;  1HCR A;  1IUY A;  3F8N A;  4DNC A;  5JHU A;  2STW A;  1D8J A;  2VKV A;  3DEU A;  3OS1 A;  1QQI A;  1W36 C;  1AKH A;  3OV8 A;  1WI3 A;  1EF4 A;  3R61 A;  3FMS A;  2K9L A;  4ESJ A;  2O61 A;  4FE4 A;  5IPA A;  4IVN A;  2BGC A;  3RZD J;  2ESN A;  4HQE A;  1TWG J;  1IDY A;  1MNM C;  3OIO A;  4S04 A;  4M9S A;  1YS7 A;  3ZQL A;  4PJN A;  5E3M A;  2KJC A;  1YYV A;  4YEL A;  5JI6 A;  1YJN I;  4GO1 A;  5ED4 A;  4I2O A;  5E3O A;  3GLX A;  3FXM A;  2DW4 A;  3RKX A;  2MGQ A;  3FXR A;  1HST A;  2OCC H;  2GXA A;  3WTU C;  3RPU D;  3P7N A;  2L9N A;  1P9Q C;  1MIJ A;  1OFC X;  3LMM A;  1IRG A;  4ANJ A;  3L2W A;  3ESW B;  1H9T A;  4A3B J;  4CXF A;  4JP0 A;  1K61 A;  3ISP A;  3WHC A;  2MG4 A;  4PK4 A;  1U8R A;  3CMY A;  1P4W A;  1ZG3 A;  1CF7 B;  3AG2 H;  3KYD B;  2QQB A;  4G7H F;  1G4D A;  3IKT A;  3H9J A;  3U1K A;  2DDB A;  4JYK A;  5BQT A;  4DYQ A;  4KN7 X;  1X1A A;  4CUG A;  2PLY A;  4BBS J;  2VKE A;  3GUD A;  1UJ8 A;  1T6S A;  4CIC A;  2HKO A;  2OZU A;  4R8H A;  1HQC A;  1N25 A;  4P9F A;  3J81 K;  2O8K A;  2F5F A;  3V8J A;  4ZZD A;  4LG0 B;  2XSD C;  1VQ9 I;  2Z99 A;  4C3J J;  3RCO A;  2NS8 A;  2BVL A;  3BQY A;  1ETW A;  2X4H A;  2R7R A;  2IGN A;  1WRJ A;  2PN6 A;  4EM2 A;  2VOP A;  5ICG A;  2JSP A;  5HS9 A;  3OYA A;  1DDN A;  2A6E F;  2DQL A;  1FNN A;  3LA7 A;  1J2X A;  2R7F A;  1B59 A;  1Z67 A;  1ERD A;  3HRM A;  2D5V A;  1APL C;  3AL0 B;  2FMY A;  5LFA A;  1OCP A;  1QRY A;  1YOV B;  2DI3 A;  4ZYE A;  1DU0 A;  2Q2E A;  1ZRC A;  1RPW A;  1ZAR A;  2MC3 A;  4RM3 A;  3IL2 A;  3L2C A;  3S1Q J;  4IHV A;  1IZ1 A;  2FX0 A;  3K4M A;  4B3A A;  1TP4 A;  3MFK A;  2CV1 A;  4HST A;  5LGN A;  3ZPL A;  1KU9 A;  3S2D J;  4K2E A;  2A6T A;  3IC7 A;  1M1E B;  5EZH A;  2BBY A;  4BE2 A;  4FX4 A;  4OIQ F;  2WB1 A;  3RZO J;  1XCB A;  1HKT A;  4RDU A;  3O3K A;  4GRI A;  5L3G A;  3TP3 A;  1XTA A;  1POG A;  1Z05 A;  2RC4 A;  1Y0N A;  1T0F A;  5H2F C;  1VQ8 I;  1WCM J;  5TRD A;  2MLK A;  2LFB A;  2IS1 A;  2LD5 A;  5FLX K;  3QU6 A;  1JT0 A;  2VLA A;  4BE1 A;  1UHM A;  3ROU A;  4ZDP A;  1AA7 A;  3IAM 2;  3TW7 A;  3S1R J;  1IRF A;  4BYY A;  2O8X A;  1ETO A;  3VWB A;  3NQO A;  2FRH A;  2KZV A;  3TO7 A;  3HHH A;  2EFP A;  3OL4 A;  4IL6 C;  2M34 A;  3CCL I;  4BHB A;  1UB9 A;  5C4X J;  3DCF A;  2HR3 A;  1PP7 U;  3ABL H;  3GVA A;  2XGC A;  1S3J A;  2ESH A;  4OAZ A;  1AHD P;  5HOO A;  5A2Q K;  4KFC A;  2JA6 J;  2M45 A;  3M8J A;  4XOR A;  2AHQ A;  1IGN A;  5B3S H;  4OU0 A;  1BI0 A;  4MGR A;  4M72 A;  2HFH A;  3V8K A;  1A04 A;  4F91 B;  5EJC A;  5K7F A;  5LEJ A;  1T2K A;  1BI1 A;  1D8K A;  1P92 A;  4LIV A;  1IUF A;  2F5E A;  3NAU A;  5ICC A;  2W82 A;  1X19 A;  4B47 A;  3F72 A;  3ZQG A;  1A35 A;  4KNY A;  1D0Z A;  2VL8 A;  5IT9 Z;  2OPT A;  1BR4 A;  1BBY A;  2VPR A;  3RDI A;  3KP3 A;  1EH6 A;  1WHU A;  3WTZ A;  5BPD A;  1FIA A;  4IRH A;  2YU3 A;  3L7W A;  5CKT A;  3KLN A;  1SVM A;  2MBF A;  2UXX A;  2K9M A;  2J5O A;  3JAM Z;  2HVQ A;  2K3F A;  3W6J B;  3J7Z I;  1DP3 A;  2HQ5 A;  1IDZ A;  2QVO A;  3EET A;  4I98 B;  2I10 A;  1B4A A;  4WXD A;  5CQG A;  2HTS A;  3BR1 A;  4A5N A;  2KZG A;  3DFG A;  1UST A;  2DTR A;  1X58 A;  1R4N B;  1CGP A;  1R49 A;  4P55 A;  3GF2 A;  2F48 A;  1GV5 A;  4A6D A;  1JT6 A;  4BS9 A;  1C0W A;  1JXS A;  5C44 J;  1K4T A;  1UG0 A;  2KPM A;  3DEW A;  4JBA A;  3EYI A;  3BTC A;  3BTL A;  3LSJ A;  3U21 A;  4YG2 F;  3E0J B;  3DQV C;  1LKX A;  1SFO J;  1QO0 D;  4NDL A;  1LEB A;  4ZJZ A;  2A5Y B;  4NC7 A;  4WK8 F;  3KZY A;  5C3E J;  3BZC A;  4Q4Z F;  1Z6T A;  4O6J A;  2CW7 A;  3HPG A;  3HRU A;  4NUB A;  5K1Y A;  2EWN A;  2LF8 A;  2RV8 A;  3T5X A;  4RB3 C;  1LVA A;  4CHU A;  1W4M A;  4C3H J;  1VQ4 I;  1X2N A;  2YS9 A;  2M87 A;  2XHK A;  4CCN A;  2H27 A;  4U0V A;  3H9G A;  4AIH A;  3ZQH A;  1S29 A;  3FM5 A;  2QSG X;  2OQG A;  4F52 A;  4KMF A;  2BHZ A;  2M8E A;  2WY8 Q;  2WAE A;  3FXQ A;  3QP5 A;  2JPB A;  1A6I A;  5GAG J;  4WX9 A;  2DT7 B;  3CZ6 A;  3SDB A;  3T0Y A;  1OLT A;  2P0W A;  2QA4 I;  2OCE A;  1O3R A;  2XAJ A;  4BXU A;  3CUQ B;  3ZMV A;  3LSR A;  2EH3 A;  2W24 A;  4EM1 A;  3CJQ B;  4MLO A;  2H6C A;  3BCB A;  3EUA A;  1XSD A;  1MW7 A;  1QVT A;  3F8F A;  5EG0 B;  1X3U A;  2VJJ A;  4FTH A;  1JUP A;  4EVI A;  5L3E A;  1E3O C;  2D2W A;  4HX8 A;  4GDF A;  4E7S A;  2QSH X;  3RKQ A;  3UKG A;  1UAA A;  4M6X A;  4HF2 A;  3K10 A;  4A12 A;  4D9J A;  3JRA A;  3FBI B;  1K78 B;  2E1N A;  5DUK A;  2XVC A;  3ZGK A;  3A01 A;  2DLL A;  4OIR F;  3P9I A;  2MH2 A;  4YIF A;  5CJ9 A;  1S72 I;  1QHH D;  2HTJ A;  1ITY A;  1MBJ A;  2L9S A;  2F4M B;  4D5C A;  2L54 A;  3QU3 A;  1TBX A;  3BR5 A;  3IKV A;  1MKM A;  3DWL E;  2DA5 A;  2O3F A;  4RAG A;  1SAU A;  1T0F C;  2WAD A;  1X3W B;  1JUM A;  1Z1D A;  4IJA A;  3PNY A;  2X6X A;  2HI3 A;  3SYT A;  1IN4 A;  2V1N A;  3LNQ A;  1JJ6 C;  4Q47 A;  2XPU A;  2HVR A;  2X51 A;  2P8T A;  5F64 A;  5HS7 A;  5E8I A;  3RYR A;  3HZJ A;  3A0B C;  5IOY A;  1I6H J;  3RIR A;  1WH5 A;  3H0D A;  2A69 F;  3VSL A;  3I0T A;  3RI4 A;  3MZ8 A;  4MTE A;  4CSW A;  1IG7 A;  4C2U A;  2X6W A;  4PJL A;  1YX3 A;  2DA6 A;  2LP0 A;  1IN8 A;  2KJB A;  1W5T A;  4AM3 A;  1TQP A;  3IWF A;  3SFZ A;  2GIV A;  2X6O A;  1IC8 A;  2UXN A;  2FNP A;  2FUG 2;  3KZZ A;  2HOS A;  1D1B A;  1L3L A;  3FHZ A;  3HL2 A;  2IA2 A;  3OYG A;  3HSE A;  2EFW A;  3PIO F;  1JKP C;  1ZG5 A;  4HX4 A;  4ABZ A;  1J59 A;  2JA7 J;  3A0H C;  2XGX A;  1FWZ A;  1BOB A;  2JA2 A;  3REO A;  3ASN H;  4RGX A;  2LKX A;  2HNH A;  1KU2 A;  1ZLJ A;  1D1C A;  2RQQ A;  1JE8 A;  1A31 A;  1Z77 A;  4ZTF A;  4V19 K;  3M3Y J;  3FMQ A;  4QPQ A;  2KLO A;  4PJ0 C;  1I6X A;  3GCM A;  5J1R A;  2NVX J;  3PUF A;  3E6B A;  2HOA A;  2NVQ J;  2I8D A;  1V55 H;  2DFE A;  2R7Z J;  5HLG A;  3NEU A;  5D5V B;  4ENN A;  2F5D A;  1S7A A;  2IBD A;  2DTZ A;  4OMY A;  1XPX A;  2ISY A;  4F3Q A;  3GTL J;  2CUE A;  2BYV E;  4LLL A;  1BI2 A;  2LYC A;  3CD6 I;  2OU2 A;  3RTR A;  2LBF A;  4HEA 2;  3H5N A;  3WHB A;  1FTZ A;  1WJA A;  3C3W A;  4FAS D;  4IQJ A;  5D4R A;  4RAF A;  4KIB A;  4Z2Y A;  1MDM A;  4IX7 A;  4ENM A;  5DCM B;  3JRE A;  5FFX A;  1YO5 C;  1V5F A;  1WKM A;  5DM6 F;  3WTW C;  1VQP I;  2K02 A;  1RKW A;  2HYJ A;  4MFD A;  5JVT A;  1KU7 A;  1F43 A;  3IH4 A;  1P2F A;  2EIM H;  3KPH A;  2CQ7 A;  5HDK A;  3QYE A;  3QPT A;  3G1L A;  1K6Y A;  3OMY A;  1G8X A;  1IN6 A;  1K6O A;  3S32 A;  2VBY A;  3K0L A;  3QP6 A;  3WOD F;  4ZH4 F;  3BG6 A;  4IPA A;  3EUK L;  5F27 A;  2R5Z A;  4EAT A;  1FT9 A;  3CDI A;  1SD4 A;  4HNV A;  5JFR A;  1YX5 A;  3OYM A;  1I5Z A;  3O6B B;  4RBO A;  3G4S I;  4B44 A;  3LSI A;  4LB5 A;  1T33 A;  2DFI A;  4CYC A;  4EQQ A;  1OYY A;  1UG2 A;  2DA1 A;  4ZDL A;  2IGO A;  2EBI A;  4BQA A;  1IJW C;  1VI0 A;  2L7M P;  3U2R A;  5B66 C;  5HS8 A;  2HQN A;  3OOP A;  3WE2 A;  2F2E A;  3IRR A;  2AS5 F;  1G59 A;  2R7Q A;  5L3B A;  4XRS A;  1NG6 A;  5CVV A;  3MQ0 A;  2LSO A;  2XUB A;  4RMN A;  2RKH A;  2Y9Z A;  2EIL H;  2TRT A;  3BR0 A;  4PUS A;  4UUS B;  1JKR C;  1FYK A;  2WY7 Q;  5FJ8 J;  2DOE A;  5EEA A;  4QLC U;  2C6Y A;  4L5E A;  2CUF A;  1J0R A;  3S2H J;  4HNT A;  1U9O A;  1R00 A;  3KX2 A;  4RM2 A;  3H3V K;  3G1M A;  4BNC A;  3EYY A;  3HTS B;  4X1E A;  2CJJ A;  2EV0 A;  1YW7 A;  3M8E A;  3HTU A;  4BEH B;  3TO6 A;  1SC7 A;  3LA2 A;  5TGT A;  5JVG F;  1VQ7 I;  4BQO A;  1VQM I;  3H3U A;  3KYL A;  5K7H A;  3S2W A;  3T8T A;  1KA8 A;  2OA4 A;  3C2B A;  5HNH A;  3CCJ I;  3DTK A;  1ZGJ A;  1XGO A;  3WG9 A;  3AAF A;  1ZN2 A;  4BUP A;  4II3 A;  3E5X A;  3O2P E;  1ETQ A;  1AWC A;  2X1D A;  2V9P A;  4ZTJ A;  3FIS A;  2RGV A;  1R71 A;  1HW2 A;  4E4H A;  1SEU A;  1NHA A;  3GZ6 A;  2CO5 A;  4KDP A;  2CV0 A;  3FXU A;  5EYR A;  3CJR B;  2DT6 A;  1E17 A;  2DMN A;  4QWQ A;  2NOJ B;  3MKL A;  3ZOB A;  4E6K G;  4B8X A;  2R7V A;  2W84 A;  5EZG A;  4ON0 A;  5GAE J;  2QSF X;  2ZCW A;  3WTV C;  2JVG A;  1FBQ A;  5IP6 A;  4J00 A;  4ZDO A;  3GZN B;  5F0F A;  1HF0 A;  2BW3 A;  3RQI A;  2FML A;  3S93 A;  4M3D A;  2DMQ A;  5DS9 A;  2LC2 A;  2JTV A;  1ZQ3 P;  4CYD A;  2DMT A;  2HQA A;  1HW5 A;  1MNE A;  2QF7 A;  3F6O A;  1MZB A;  1I1G A;  1BC7 C;  3BG7 A;  1EH8 A;  3EPZ A;  2GLO A;  2Q1Z B;  3PQJ A;  3MKY B;  4AID A;  1N77 A;  5F04 A;  3I55 I;  1JKO C;  3PSF A;  2R92 J;  3JCU C;  4AYB A;  3K1M A;  5H20 A;  3ZQQ A;  1FX7 A;  2MH9 A;  1E2X A;  3OIQ A;  4OMZ A;  5E18 F;  3HOY J;  3J7A O;  4IQ4 A;  4IO9 F;  3MKW B;  3BJA A;  3KP6 A;  5CVU A;  1YRN B;  2DT5 A;  3F22 A;  1VQL I;  4A69 C;  4P9U A;  2CU7 A;  1BJA A;  1MBH A;  1NK3 P;  1MBK A;  2DOD A;  2DYR H;  2V7F A;  1VND A;  1T8I A;  2LY1 A;  2PMZ A;  2BHY A;  3J80 K;  5LGU A;  3BLY A;  2GM4 A;  4DYC A;  2L01 A;  4LGW A;  2ZME B;  1OIS A;  1ZHF A;  2QGU A;  1IXS B;  4MHG A;  2GOX B;  1GT0 C;  2Z16 A;  3BJ6 A;  3VSK A;  4A3C J;  3ZN0 A;  2KP6 A;  2EPF A;  2M2E A;  1JHF A;  2QM3 A;  1Y6I A;  2DYS H;  4C2T A;  1YJ9 I;  4KIC A;  1WJC A;  4KMU X;  2E71 A;  4BDZ A;  3G2B A;  3PL8 A;  4DYR A;  4BE0 A;  1SFU A;  4Y52 J;  4M6V A;  2FU4 A;  2K85 A;  3FF5 A;  2PJR B;  1XB4 A;  2L3D A;  5DTD A;  1XDU A;  2R4G A;  3QQA A;  1D3Y A;  2L9R A;  4EMS A;  2HYF A;  1WJF A;  1KU3 A;  4ITV A;  3T1B A;  2OTJ I;  5J3L A;  1CF7 A;  3B6C A;  1O7F A;  1U0J A;  3CDH A;  3KIO A;  1XGM A;  4N4O B;  3O8G A;  5AIQ A;  3J81 Z;  1SMY F;  2BVM A;  3TQN A;  2ME0 A;  4L5I A;  3HUG B;  3CJN A;  4E70 A;  2ZJR F;  4W97 A;  3VYS B;  3F8M A;  2UWM A;  2L4A A;  3NAR A;  1PYV A;  5IT3 A;  4LB6 B;  3I56 I;  2JPC A;  4LLG F;  3DP7 A;  2GOM A;  3NWT A;  3D1N I;  3M9A A;  3BR2 A;  2WTE A;  4U87 A;  5ERI A;  2N8G A;  3S17 J;  4U7D A;  2E2I J;  5HLT A;  3JRG A;  2RAE A;  3ABT A;  3G1O A;  1FYM A;  3W2W A;  2ZKZ A;  3LSK A;  3FIW A;  3SHF A;  1JGG A;  2Z1D A;  4XRS G;  4BH9 A;  2PJP A;  4I76 A;  4D0P A;  3OSG A;  2VQG A;  2IRF G;  3E97 A;  2KRC A;  2VT3 A;  5FGM A;  2DA2 A;  4A0Y A;  2CFX A;  3L2R A;  1VQO I;  1HDD C;  3S1M J;  4IXA A;  1XGS A;  1ZLK A;  1OCR H;  2W7N A;  4MIM A;  1H0M A;  5H6Q A;  1HC8 A;  4M3B A;  2CYY A;  4LK1 F;  3U9G A;  2XKP A;  3BZK A;  4A0X A;  5IYD J;  5FLX Z;  1T95 A;  1VTN C;  3L9F A;  4A2U A;  2QQA A;  4ETS A;  4HPQ A;  4PSW A;  2TDX A;  4A3I J;  1FBS A;  2QZ8 A;  1IV6 A;  2DU9 A;  2X9D A;  1FOY A;  1ULY A;  3QOE A;  2L4M A;  2O0Y A;  4KIF A;  2R5Y B;  2DMU A;  1XCV A;  3AG1 H;  3E6C C;  2E7X A;  4HLX A;  2DPU A;  3F3X A;  1LFU P;  2FA5 A;  3LQQ A;  3FK6 A;  2ELJ A;  1RC9 A;  5A2Q Z;  2X0L A;  3NRV A;  2FQ4 A;  2E1C A;  2E5N A;  3ZQI A;  4EV0 A;  3IHU A;  2EZL A;  3GXO A;  3MEX A;  4L9V A;  4P5O A;  2STT A;  2ZXI A;  5K5R A;  2IXS A;  2P5L C;  2WBM A;  2VT2 A;  4M73 A;  3DKY A;  1KGS A;  2PG4 A;  3F23 A;  4FCY A;  3QPS A;  2A61 A;  2E1O A;  1W7P B;  4XLC A;  1RR7 A;  1ZRF A;  3LSG A;  1EA3 A;  1JTY A;  3LL7 A;  1BL0 A;  5KHD A;  4JX4 A;  3JSO A;  3SZT A;  3W6K B;  3GFI A;  2Z5U A;  1ZR2 A;  1PP8 F;  1EV7 A;  2VQL A;  1TWA J;  1FOW A;  4N4N B;  3B02 A;  5FFZ A;  5FD6 A;  1AOY A;  5FKL A;  4R79 A;  3ZR8 X;  2XC7 A;  1LDJ A;  5B1A H;  3BG5 A;  5L3C A;  1KZH A;  1OCC H;  4BGD A;  5DDG A;  2LRE A;  3QOP A;  3KET A;  2BXZ A;  5IY5 H;  1IXC A;  1TZL A;  2CWE A;  3S3M A;  2VBX A;  3G73 A;  4EGZ A;  2I5U A;  2LOO A;  1B8I B;  3V8L A;  2B0L A;  3SQN A;  4G7Z F;  3S1N J;  2FOW A;  4CCL A;  5DD4 A;  5EGO B;  1ZEL A;  3MCZ A;  1IF1 A;  1LDD A;  5FB2 A;  3ZQF A;  2R7X A;  4DZP A;  4HQM A;  4JQF A;  3DKW A;  4AC0 A;  5IP7 J;  1Z21 A;  4IF4 A;  3DTI A;  4AWX B;  4GYG A;  2Y48 A;  1FOX A;  2ZSI B;  5C4J J;  1G3T A;  3TBI A;  2MLG A;  2JWT A;  4OAY A;  3IH2 A;  2PMU A;  3SDG A;  1FZP B;  1BM9 A;  3S16 J;  2VPL A;  3FXK A;  1TWF J;  2DA3 A;  5BPI A;  3ZMS A;  3CC4 I;  3TDZ C;  1TQM A;  2OQR A;  3E6D A;  2HYG D;  2XPV A;  3S15 J;  1FY7 A;  2MFZ A;  9ANT A;  3S3O A;  1R4M B;  4HLY A;  3LFU A;  1MSE C;  2ECB A;  1I1S A;  1S5L C;  4DBR A;  4IKF A;  4RGS A;  1W1W E;  4G94 A;  3I71 A;  5IP9 J;  3DLA A;  3OYI A;  3GX4 X;  3RKW A;  1OJL A;  3K69 A;  5EG0 A;  1ZRD A;  1H9G A;  2MC4 A;  4UUT A;  4QPO A;  1GXP A;  1WI9 A;  2FXA A;  1U5T A;  4RGR A;  3CP8 A;  4LK0 F;  2IGK A;  4XIC A;  3N97 A;  4LIU A;  3ZXS A;  4IRI A;  1Y0U A;  2A5W A;  2ZBK A;  1OR7 A;  1FJL A;  1BC8 C;  1E3P A;  4EJV A;  3MMY B;  3AL0 C;  1K78 A;  4BDY A;  2VQH A;  1SMT A;  5M5Y J;  3H3Z A;  4HG2 A;  5F1J A;  2Z9O A;  1L0O C;  3I53 A;  3V7S A;  5LRS A;  2CQK A;  1I39 A;  1VZ0 A;  2VJ5 A;  2Y0M A;  4EJT A;  2ZFW A;  2QLZ A;  2IS2 A;  1MH3 A;  2K9S A;  3OYD A;  1Z3X A;  2Q2E B;  4CO8 A;  5TJJ A;  2RN7 A;  1HW1 A;  3F9K A;  1YS6 A;  2EZI A;  2V26 A;  5CPR B;  2KIS A;  3Q3S A;  5LD2 C;  1DQU A;  5CQE A;  4YEJ A;  2XPW A;  1P7I A;  3FKJ A;  2CSO A;  4A0Z A;  1S6L A;  1XG1 A;  2D1V A;  4NNJ A;  4L0Z B;  3EUH A;  4OIP F;  2NS7 A;  2VIX A;  1DUX C;  2W1O A;  2HOT A;  2COB A;  4CA0 A;  3DBH B;  1TTY A;  2V9V A;  4LJZ F;  1B72 B;  3BPX A;  2ID3 A;  3PSI A;  4CCK A;  1DU6 A;  2WV1 A;  3DU5 A;  3L2U A;  4PJM A;  3HDD A;  2NNY A;  4KUM A;  1GV2 A;  4M74 A;  4G6D A;  3CCM I;  4UVA A;  2WV0 A;  5HLI A;  2AQF A;  3BT9 A;  5FKK A;  3W3C A;  4RB1 A;  5AON A;  1J75 A;  2YU9 J;  3K9T A;  3HOW J;  2ADU A;  2V6C A;  3HB9 A;  3TL4 X;  2KT0 A;  4Y15 A;  1HBX G;  1UFM A;  5K7Z A;  2DA7 A;  1R1V A;  1X1P A;  4M3G A;  3WU2 C;  2M4G A;  4E7K A;  1KYZ A;  3SXY A;  2M7B A;  2BE5 F;  3CLQ A;  1D0X A;  1RZ4 A;  4ESB A;  4F7Z A;  3DBL B;  2M0M A;  2KDZ A;  5EDN A;  4F92 B;  2HS5 A;  2KQR A;  3MD2 A;  2HU9 A;  3C1D A;  3Q0W A;  4EM0 B;  3M07 A;  4AIK A;  1LJ9 A;  2LH9 A;  4E7L A;  5F0H A;  1ETK A;  1Y1W J;  3OYJ A;  2GIZ A;  2LF7 A;  2HKX A;  5JR3 A;  2LKP A;  1K79 A;  2VJI A;  3LST A;  2KIF A;  1R9T J;  2ICW G;  3ZMT A;  1A6Q A;  4XR6 A;  2MD5 A;  3H36 A;  3I54 A;  3CDL A;  2Z2S B;  4AVP A;  3GBG A;  4U88 A;  5GTI C;  5EF6 A;  1X1D A;  1SAN A;  1VF9 A;  1WQ2 A;  1REP C;  3B6A A;  2E1M B;  3EDP A;  2XGE A;  3A03 A;  1IW7 F;  3HC7 A;  2V4J C;  1MJ9 A;  3DXJ F;  2EQR A;  1J5Y A;  1OYW A;  3L00 A;  4HAM A;  2QKL B;  3VOE A;  3K1P A;  2A05 A;  4YFN F;  1ODD A;  2VXZ A;  5J4V A;  4XLA A;  4NBQ A;  3DLL F;  3VEP A;  2H09 A;  3NWS A;  4X0G A;  3S3N A;  2QEN A;  1N78 A;  4RAZ A;  5LHG A;  4FE7 A;  3FHN A;  3ML6 A;  4L5J A;  4V2F A;  3ZMZ A;  2P81 A;  3CMA I;  4KT5 C;  3GFM A;  3FBN B;  3P5J A;  3OYB A;  3OYE A;  2OTL I;  4MNU A;  2ZO4 A;  3VPR A;  4L9J A;  1MJB A;  4BAC A;  2R0Q C;  3WG7 H;  1WH7 A;  2ELH A;  3I3L A;  3TP0 A;  2M8G X;  4C2M J;  4EEF G;  1TW2 A;  2XRN A;  4PJJ A;  4XKW A;  2HVS A;  2VI6 A;  3L1P A;  1F1Z A;  1LNW A;  3FX3 A;  3CO7 C;  2EA2 A;  4DW6 A;  4J01 A;  1Z3Y A;  2CG4 A;  2QWW A;  1Y1V J;  1BJZ A;  5BNG A;  3ZMU A;  2A68 F;  2FBK A;  4MQ9 F;  3GZ5 A;  5FKO A;  1TC3 C;  1U5T C;  2XAH A;  3IUO A;  4HDV A;  2F4I A;  5DM7 F;  1FC3 A;  3QPL A;  1W0T A;  2JK3 A;  1IRX A;  3D5R C;  1HOM A;  2PMH A;  4NQW B;  2P5K A;  2LNB A;  1DP7 P;  1OR7 C;  4BQN A;  2LDU A;  2OV7 A;  3OL3 A;  1YI2 I;  5CYV A;  2QQ9 A;  4UUS A;  1HA8 A;  4HZF A;  5DEQ A;  1Y39 A;  1U8B A;  3WGH A;  4IRG A;  3FM3 A;  3KE2 A;  3M8F A;  1W0U A;  1LFB A;  3K4L A;  1HSJ A;  2Z33 A;  2ZXH A;  3JSP A;  4XOT A;  4EJW A;  3HOZ J;  3D5S C;  3DV8 A;  4YII A;  3F6V A;  5E20 A;  1B1B A;  4ZC3 A;  4LFU A;  1K4S A;  4BEH A;  4BHP A;  4Y3O A;  3DBR B;  1QHG A;  3E3V A;  1X3Z B;  2PX9 A;  2CH0 A;  2QYO A;  1Z7U A;  1QZZ A;  2YPR A;  1WJE A;  2ZFU A;  4HF0 A;  2PFB A;  2EFQ A;  3QPH A;  5KVR A;  3CCQ I;  3EUH C;  3MZY A;  2DN0 A;  1JGS A;  2HOE A;  4I99 C;  1TW3 A;  1E0E A;  3A2K A;  2M0C A;  5FD5 A;  4BY1 J;  3ZMD A;  2BXY A;  4L9N A;  1K7A A;  3SEZ A;  1XMX A;  5J47 A;  1R58 A;  4A5M A;  2JT1 A;  4B43 A;  3CCE I;  1I3A A;  2Y75 A;  1RUN A;  3IAS 2;  1ETV A;  3GME A;  4A3F J;  1ON1 A;  3GLL A;  5K5Q A;  4JX6 A;  5J8F A;  4M9X A;  3PIP F;  3CC7 I;  3DTE A;  1WWX A;  1ZAO A;  1V5G A;  4RA2 A;  1HLV A;  3HBL A;  2VBZ A;  3VOD A;  3J7Y J;  1H88 C;  1LQ1 A;  1LB2 A;  3QWL A;  2NVT J;  4M6Y A;  1O7L A;  1S9H A;  2DPD A;  2VUM J;  1SVL A;  4QIW N;  4FX0 A;  1KQ0 A;  2PBI A;  4CGZ A;  5DCF A;  2W85 A;  1Q1H A;  2ELK A;  2H1L A;  2OJE D;  5E1W A;  4XQF A;  2X1E A;  2XV4 S;  3ELK A;  3HM5 A;  3CCR I;  2ACJ A;  2OZ6 A;  4CZZ A;  2RNJ A;  1Z6R A;  3V7R A;  2DK5 A;  5DUI A;  2P4W A;  4PCQ A;  3KP2 A;  1NG7 A;  3KYC B;  3OYH A;  4IHX A;  1R22 A;  2QQ8 A;  3J80 Z;  1JKQ C;  1I50 J;  4CZC A;  2CRG A;  5HOD A;  3RQ4 A;  2L02 A;  2OBP A;  3KLO A;  2E7W A;  3H92 A;  1RUO A;  4UUV A;  4I01 A;  3JRI A;  4LLN A;  4XON A;  1YLF A;  2ZB9 A;  4UHT A;  2ME6 A;  2ZME A;  2JA8 J;  2JZY A;  1O57 A;  2DO7 A;  5K5O A;  1MD0 A;  3D5L A;  2CUJ A;  2EZK A;  2XRO A;  2LG4 A;  2JMW A;  5B5E C;  1X2M A;  3HSR A;  3K6G A;  2LBF B;  1FP1 D;  2CUZ A;  1VQ6 I;  3WGI A;  2JUC A;  3I59 B;  1GLN A;  3WTT C;  1MDM B;  3WTX C;  1NTC A;  1XMA A;  1ZRE A;  1TWC J;  4UXN A;  1WJB A;  3GO5 A;  3CC2 I;  3TMO A;  3PUB A;  4A3M J;  3P9C A;  1XDS A;  1XMK A;  3GFL A;  1O3Q A;  2HEO A;  4B1R A;  5AIP A;  1V54 H;  3OYF A;  5KNL A;  2PJR A;  1MBF A;  3K70 C;  3VYU B;  1D0Y A;  2E19 A;  3C2H A;  4HV5 A;  2ETH A;  3CME I;  3RYP A;  3PNT A;  3S8P A;  4AVZ A;  4XL9 A;  4EGY A;  3BCA A;  2R7T A;  4E7H A;  4MEY F;  1D1A A;  1V5E A;  3ZQC A;  4U0Y A;  1XX5 A;  1RNL A;  4GGG A;  4C9Y A;  1OCO H;  3JRF A;  2EJR A;  4G9Y A;  4D5F A;  1MND A;  2EB7 A;  2GZW A;  2NAZ A;  2DJI A;  2NYX A;  5ILS A;  3CJT B;  3GW2 A;  1NH3 A;  2ISZ A;  4D7N A;  1PDN C;  4ENJ A;  2GA2 A;  3FWE A;  1FLI A;  4G12 A;  5JLW A;  5F6F A;  1YTY A;  4U0W A;  4GXO A;  5JHF A;  3K4N A;  2OAZ A;  2FOK A;  4E7Z A;  5LHH A;  2LR8 A;  2BOL A;  4PZJ A;  2JRM A;  4BJ6 C;  2AXT C;  3RSN A;  4OOI A;  1J09 A;  3HG9 A;  3K4C A;  5EEG A;  5BOX A;  4X6A J;  3R0A A;  2IVM A;  4XRF A;  2XGD A;  1USS A;  2J5P A;  5FKM A;  2M1B A;  3VDX A;  1KON A;  2H94 A;  2BV6 A;  3LAJ A;  2PI0 A;  2HXI A;  4PFP A;  4NC8 A;  3BY6 A;  4BXX J;  3MZH A;  3OYC A;  3VYR B;  2KIU A;  4UVB A;  2JA5 J;  1TNS A;  2HDW A;  4JX5 A;  1KQ8 A;  2H1K A;  1R36 A;  2VBW A;  4JK1 X;  5IOZ A;  4KIS A;  4ENK A;  2W57 A;  2P6S A;  1HKS A;  1B6A A;  4RAY A;  4XM3 A;  5D5X B;  2LMD A;  3OY9 A;  1SFX A;  2NNN A;  2DOF A;  1FMV A;  2XAU A;  2FSW A;  4M9Z A;  5E1X A;  1YFH A;  4Q5S F;  2XF6 A;  1MBG A;  4NHJ A;  3OR2 C;  1QVU A;  1Q1V A;  2VOD A;  4XK4 A;  2HZD A;  2GQQ A;  3BDD A;  2OD5 A;  2FBH A;  3AKZ A;  4DQ2 A;  1GXQ A;  5GPC A;  2EK5 A;  2HZT A;  3OIP A;  1ZKG A;  2Z3Y A;  1LEA A;  3HPH A;  3TO9 A;  4UNO A;  3PO3 J;  3GTM J;  4G7O F;  1PUF B;  1P4A A;  4BY7 J;  2LY2 A;  3PJR A;  5D6F A;  4OWR B;  1LE8 B;  3KFW X;  3CLO A;  2ZC2 A;  4LG0 A;  1U9N A;  1W7P A;  5FRO A;  1Z9C A;  1U3E M;  4MO7 A;  4IHS A;  3CTA A;  5IYC J;  2OUM A;  1WJ5 A;  2V79 A;  2IW5 A;  4RGU A;  3K1N A;  1ZTR A;  3V4G A;  2K86 A;  3DPT A;  4ESF A;  3BTJ A;  2AXL A;  2LRD A;  1S8N A;  2EFO A;  1UZC A;  4BBR J;  1ETX A;  2HDD A;  3BZ6 A;  4PDK A;  4WWC A;  4U7B A;  2CFO A;  1I3Q J;  1FPQ A;  2IJL A;  4Y17 A;  3G3Z A;  4A3J J;  5J1U A;  2IA1 A;  2CGP A;  1R7J A;  2FD5 A;  4AUX A;  2DOA A;  3JTH A;  1ZK8 A;  1B8I A;  1E3H A;  3BQZ A;  2K9N A;  5IYB J;  3CCY A;  4UV8 A;  2ZME C;  1FP2 A;  3H1C A;  3DF8 A;  4IZZ A;  1BR1 A;  5EGO A;  1T39 A;  3V42 A;  1QBJ A;  3N4M A;  1V3F A;  2V1D A;  2M9H A;  1OCT C;  4IOA F;  4HDU A;  2EZH A;  1MJA A;  2CQQ A;  1MMG A;  1P4X A;  2Y30 A;  1MSF C;  5ILU A;  1TWH J;  1ZG1 A;  4N9I A;  2MSY A;  3AG4 H;  3JRD A;  1SAX A;  2QBY B;  4HYE A;  4ZYH A;  2BY2 A;  5M5X J;  1FOK A;  2W25 A;  4A3L J;  2ZSH B;  5D8L B;  4XID A;  5M5W J;  3A02 A;  2BY3 A;  1YW8 A;  5F08 A;  1GUU A;  2JRT A;  1R23 A;  3MWM A;  2WC2 A;  4II2 A;  1TLH B;  2R7O A;  3QAH A;  2L7K A;  4S0H B;  1RR8 C;  4R1H A;  2JN6 A;  3PFY A;  4QTR A;  4D1Q A;  1EJ9 A;  4B09 A;  2EFN A;  2UUZ A;  1JUS A;  4PGG A;  1HDP A;  2Y31 A;  3DEE A;  3OOU A;  2DAO A;  1WSU A;  2L2O A;  3HJE A;  2L9V A;  2A3S A;  2QUF A;  3M7G A;  2GWR A;  4XLH A;  4XSZ F;  2Y69 H;  1QZE A;  2IS6 A;  4M3F A;  3JTG A;  2ZXW H;  1J9I A;  3HOS A;  3VB2 A;  1ONV A;  5JLX A;  2ZNY A;  3E5Q A;  2WA0 A;  3CP2 A;  2FBI A;  3KEQ A;  5CLS A;  3F21 A;  2O9L A;  3C2G A;  2A07 F;  3HIF A;  2R7S A;  1QPI A;  3H0G J;  4BQQ A;  5ICE A;  4CDG A;  4N9H A;  2JQ7 A;  3HOV J;  2CW0 F;  3OYN A;  1MMS A;  2KHM A;  4ZYD A;  4XKB A;  1AKH B;  5J8C A;  2CW8 A;  2EA4 A;  1UMQ A;  2XF5 A;  3OWT A;  2LTP A;  5KCM A;  4RB2 C;  1GVD A;  1NK2 P;  2IGM A;  2L5Q A;  1XC5 A;  1K83 J;  2VQC A;  5D5W B;  3FKI J;  1LDK B;  2VJ4 A;  5H6R A;  5J4Y A;  1YIT I;  1SFK A;  1XD7 A;  3FXJ A;  2H6B A;  4XLF A;  1PUE E;  1Y8R B;  2KMU A;  3OYK A;  2M30 A;  1T56 A;  1LPQ A;  1DGR M;  5LEK A;  1HXD A;  2D1H A;  2NVU B;  1SVO A;  1UHS A;  1WFX A;  1B72 A;  3BRO A;  5FLM J;  1S7O A;  1VQ5 I;  4O3M A;  3IP4 B;  4ZZL A;  1R1U A;  4XLP F;  1B9N A;  3I5U A;  2CV2 A;  3J7A Y;  2M5W A;  3CCS I;  3ZRG A;  2E34 A;  3GTO J;  1Z7L A;  2E2H J;  1VQK I;  5L3D A;  1W7P D;  5J1Y A;  1R5H A;  3RPQ A;  2XB0 X;  1PVE A;  3CUQ A;  1B9M A;  3T8R A;  3E1S A;  3R4K A;  4JOM A;  4CCO A;  2RRE A;  3SZG A;  2DMP A;  2WAQ A;  4LIT A;  4TV7 A;  2B63 J;  1P7J A;  2VXD A;  5CVJ A;  5F1R A;  4DBQ A;  2CQX A;  3L2V A;  1DPR A;  4L9T A;  3BP8 A;  4MFE A;  3ZCO A;  4F93 B;  2YX4 A;  3TKY A;  4DIQ A;  2IA0 A;  1MMN A;  2YX7 A;  3K4K A;  2YSR A;  2L0K A;  5CVR A;  1D5Y A;  4OIO F;  4AIJ A;  1KYW A;  4V2G A;  4I02 A;  2WB1 N;  3PO2 J;  2K5C A;  2DFF A;  1GDT A;  3QYB A;  3CES A;  2WWY A;  4Y33 A;  2DQR A;  5GP9 A;  3K4J A;  2GBY A;  1BIA A;  1I27 A;  2XB5 A;  3JW4 A;  5F0C A;  1G3S A;  5J6X A;  2Y2Z A;  2FEZ A;  1U78 A;  5D6E A;  2IS4 A;  2LY9 A;  3QOD A;  2NRA C;  2XDV A;  2KIM A;  4BJT A;  1RIO H;  1DGW Y;  3K2Z A;  4LOC A;  2HQR A;  3PQK A;  2VKH A;  2KFD A;  4NC6 A;  2ZJQ F;  4GYI A;  1JJ8 C;  5GAH J;  1QNT A;  1BN5 A;  4IOC F;  4E7J A;  1MH4 A;  1OKR A;  2NOG A;  1A36 A;  4A3E J;  1QPM A;  4BKX A;  2F6C A;  2M7A A;  4PFO A;  4D7M A;  1IN7 A;  3OR1 C;  2EV5 A;  2PQ8 A;  1W5C C;  3HRT A;  3ECO A;  1X1B A;  4BU2 A;  2WAQ N;  5HDG A;  4M71 A;  4RLQ A;  3Q0V A;  4IEJ A;  2LLK A;  3JRH A;  1UEL B;  1EKE A;  2VB6 A;  1RET A;  5D5U B;  2B7E A;  3W2A A;  5BS6 A;  4KYW A;  3L09 A;  3AG3 H;  3ZN1 A;  5FRN A;  3BR6 A;  4GFB A;  1S7E A;  1IV8 A;  3I9V 2;  3HOX J;  2W4S A;  2ZXJ A;  1H89 C;  3LSH A;  3KP7 A;  4KT6 A;  2K7L A;  5TIS C;  3TED A;  3ZP5 A;  1YE9 A;  1SFE A;  3K2A A;  1RES A;  4G8X A;  1QZY A;  2GA1 A;  4BL0 B;  4IHW A;  2E2J J;  2VC0 A;  1R1T A;  3CF2 A;  3CCV I;  1BOA A;  1N75 A;  3CQZ J;  2JSC A;  3TGN A;  1ZYR F;  2MA3 A;  3FXO A;  3KP5 A;  1FIP A;  2HWV A;  5HVQ C;  2F5V A;  4XBF A;  1FYL A;  1BA5 A;  3ULQ B;  2VOO A;  1TT0 A;  3LOC A;  3CCU I;  3GTQ J;  4DOZ A;  5KK1 A;  3GTP J;  2VAS A;  1AU7 A;  3LA3 A;  2VC1 A;  4I0B A;  3FZV A;  2ZNZ A;  4P96 A;  2W00 A;  3TDU C;  3OS2 A;  2XIG A;  3M1C A;  3ABM H;  2H8W A;  1ON2 A;  5E3L A;  2GAU A;  4NQW A;  5LHI A;  3I4N J;  4XKV A;  2NVY J;  5B1B H;  2VN2 A;  1U5T B;  3HRS A;  3R0J A;  3V7C A;  3W6V A;  5IT9 K;  2RNG A;  2MW8 A;  2VON A;  1IRZ A;  2COM A;  1IAW A;  3LSP A;  3IWZ A;  2X1C A;  3FK7 A;  2IT0 A;  1F36 A;  4HX7 A;  3RJP A;  1ENH A;  1WVR A;  3JAM K;  3I64 A;  4UV9 A;  3HSF A;  1ZR4 A;  1VQN I;  1OYI A;  3CMM A;  2XSJ C;  2EIN H;  2X85 A;  2P7V B;  4C3I J;  2UZK A;  3EQL F;  3BPV A;  2EV6 A;  5DCM A;  2ZJ2 A;  1XN7 A;  1GVJ A;  1T38 A;  3GTJ J;  3OS0 A;  4Q48 A;  3LQR A;  2R7W A;  1XS9 A;  3MAJ A;  2JJ7 A;  4I6Z A;  3E7L A;  3KEO A;  3E6M A;  1MMA A;  2NS0 A;  1YQA A;  4W1U A;  3FMR A;  1LVK A;  3PNV A;  5LLQ A;  2M4K A;  3UNG C;  2DCE A;  2K9Q A;  1YHQ I;  3GFJ A;  5LGT A;  2YR2 A;  2XAS A;  1YIO A;  3HOU J;  1JHH A;  3CUQ C;  4XLE A;  2O5R A;  1FTT A;  2A6H F;  4PSX A;  3ABU A;  3I58 A;  2W48 A;  3U1D A;  3SJM A;  3KCC A;  4XKC A;  2K4J A;  4N0B A;  1LUJ B;  3SZP A;  2M3A A;  4QSH A;  2IPQ X;  3H5A A;  2V9K A;  3DPL C;  3DPU A;  2HDC A;  3GYH X;  1JTX A;  4FIS A;  4GCV A;  3G6E I;  1LFP A;  1OMI A;  3WU0 A;  2LKS A;  3K7A J;  3M4O J;  2FF4 A;  4HW0 A;  1OCZ H;  1IO2 A;  5D4S A;  2X48 A;  1MMD A;  5E17 F;  3HGG A;  5CVI A;  3F8B A;  2G9W A;  1FSH A;  2E35 A;  3I4P A;  1OQY A;  3HYI A;  1FBU A;  3BTI A;  3L2Q A;  1CQT A;  4B3X A;  1X1C A;  4B48 A;  3COA C;  1TNT A;  3BC8 A;  3A01 B;  2E1M C;  5LBQ A;  2HXO A;  4FT8 A;  1BW5 A;  1HKQ A;  1TL8 A;  1ZH5 A;  3KP4 A;  1Z0X A;  3BJO A;  5HDN A;  2ECC A;  2G0E A;  3QYF A;  4Y7N J;  1ORK A;  5EEH A;  2DA4 A;  3HKZ A;  2L7Z A;  2CS3 A;  2IAI A;  3CUO A;  1QU3 A;  2BEO A;  2MAB A;  1FSE A;  3MN2 A;  1DPU A;  1T08 B;  3IH3 A;  2K4B A;  3ONQ A;  1WJD A;  2DDA A;  4IHT A;  3GTK J;  4YFX F;  2OF7 A;  4J19 A;  4HOB A;  4B4C A;  1BIB A;  3I59 A;  4FHT A;  1IN5 A;  2KKO A;  4DGW B;  4XN3 A;  2RDP A;  1WPK A;  3PM1 A;  3SFI A;  3HEF A;  4FET A;  4I09 A;  2DBB A;  2LVS A;  2WAF A;  3E5U A;  1TT5 B;  1ZGA A;  4E7I A;  2R7D A;  3O8H A;  5E8G A;  4BXF A;  5FRM A;  2DXI A;  2V6E A;  5GAD J;  2Y9Y A;  2JUG A;  3WTY C;  2Y0S A;  2P7C B;  3C7J A;  2UV1 A;  3PFI A;  3GTG J;  2XAQ A;  1H8A C;  3JR9 A;  4PGH A;  4H4K C;  3R6S A;  1UHW A;  2RQP A;  4P1W A;  4XSX F;  1G3W A;  3IRQ A;  1U2W A;  4CH7 A;  2G7H A;  4MQV A;  2XAG A;  2NXN B;  3BG3 A;  5HLH A;  4XLN F;  4UB6 C;  2EIK H;  4RB0 A;  1G6N A;  4HBL A;  4A6E A;  3HKZ N;  1F4K A;  5GPA A;  2E60 A;  3H5R A;  4RS8 A;  4MTD A;  2VE9 A;  4UY8 I;  1F9N A;  1ETY A;  4AU7 A;  4HNU A;  2P5V A;  1YRN A;  2MYS A;  4XOP A;  4M3E A;  3UR3 C;  3CO6 C;  4S05 A;  2FE3 A;  2GXG A;  3ABK H;  4KJZ A;  2Q8K A;  5ICF A;  4Z6Y A;  1SD7 A;  2O03 A;  4O5V A;  2BY1 A;  1RI7 A;  2L7F P;  3TOA A;  3ERE D;  4I7H A;  1W5S A;  3A4C A;  2OC6 A;  3OSF A;  2V1X A;  3HOT A;  3CF5 F;  1RKT A;  3ERM A;  4HA8 A;  1ZGW A;  5GTH C;  1PJR A;  2Y0S N;  1ACI A;  3G71 I;  4A3K J;  1X4O A;  1XSV A;  3FXL A;  2HPM A;  1BI3 A;  1O4X A;  2G7U A;  3H35 A;  1R5G A;  1R5I D;  4XRM A;  4NB5 A;  5DD8 A;  5FO5 A;  3DU6 A;  4BAY A;  2H8R A;  1A5J A;  1WZ2 A;  2VKD A;  2MD0 A;  1BW6 A;  3LFK A;  3K70 D;  2QEX I;  3ASO H;  1UCR A;  1RRJ A;  5DV5 A;  2ZJP F;  2YUS A;  4ASN A;  2O6G E;  1R6R A;  4L0Y B;  4WCG A;  3F0C A;  4C30 A;  4WF2 A;  3K4B A;  3WE3 A;  1GHC A;  5E1Z B;  4ZYG A;  4UB8 C;  4BJ5 C;  3LWF A;  2AO9 A;  1KQ9 A;  3GEZ A;  1QA6 A;  1OPC A;  2CQN A;  3B73 A;  4UVC A;  2R5Z B;  5FLV A;  4LG3 A;  3TOB A;  3HUG A;  5DYM A;  2XRL A;  3HGY A;  2O7O A;  3RPU A;  5KAF C;  2K27 A;  4I0A A; 
#chains in the Genus database with same CATH homology
 4ZTF A;  4DJA A;  3OYD A;  1Z3X A;  4QPQ A;  3A1Y A;  2Q2E B;  2KLO A;  3SEQ A;  3F9K A;  2V26 A;  5CPR B;  4II2 A;  5LD2 C;  1DQU A;  2R7O A;  5CQE A;  4YEJ A;  2L7K A;  3VYT B;  2CMP A;  3FKJ A;  2R7U A;  2I8D A;  3PFY A;  4G6T B;  4NNJ A;  4D1Q A;  2VIX A;  2K3P A;  4RLF A;  1BR2 A;  4HSR A;  4KIT B;  2W1O A;  4F3Q A;  4CA0 A;  2UUZ A;  4XN0 A;  1JI8 A;  3DEE A;  3OOU A;  2LYC A;  3PSI A;  3RTR A;  2LBF A;  4CCK A;  2L2O A;  2E5Z A;  3DU5 A;  3KEY A;  4HEA 2;  3H5N A;  3L2U A;  4PJM A;  1WJA A;  4FAS D;  4IQJ A;  4XLH A;  4CCJ A;  4F55 A;  4IX7 A;  2IS6 A;  2AQF A;  3W3C A;  1V5F A;  3HOS A;  3H9Q A;  2KRH A;  3FDY A;  2WA0 A;  3CP2 A;  5HNF A;  3C2G A;  2R7S A;  3TL4 X;  4BQQ A;  1X4P A;  3QYE A;  2M4G A;  1K6Y A;  1Y56 A;  4Y4R A;  3OYN A;  3N05 A;  1G8X A;  2M7B A;  3OMY A;  4E7K A;  2KHM A;  3S32 A;  1D0X A;  4XKB A;  3BG6 A;  3EUK L;  2M0M A;  4EAT A;  2CW8 A;  4F92 B;  2KQR A;  3MKZ A;  3MD2 A;  2HU9 A;  3AFH A;  2XF5 A;  3OWT A;  4ZYA A;  1YX5 A;  5KCM A;  2LH9 A;  3OYM A;  2IGM A;  4E7L A;  3LSM A;  3OYL A;  2L5Q A;  3W2V A;  1FMW A;  2KL4 A;  4B44 A;  3LSI A;  3OYJ A;  2VQC A;  2VJI A;  4XNF A;  1LDK B;  2VJ4 A;  4ZDL A;  2IGO A;  1SFK A;  4XR6 A;  2Z2S B;  3GBG A;  2JVH A;  1X1D A;  4XLF A;  2KMU A;  2E1M B;  3OYK A;  2XF7 A;  1G59 A;  2R7Q A;  2HPI A;  3HC7 A;  2X6Y A;  2V4J C;  1DGR M;  1NG6 A;  2BW3 B;  1WFX A;  4RMN A;  2QKL B;  3IP4 B;  4CCM A;  2AQE A;  4PUS A;  2VXZ A;  2CV2 A;  2WY7 Q;  3DKX A;  4XLA A;  3J7A Y;  4HRI A;  3ZRG A;  3NWS A;  4X0G A;  3S3N A;  4HNT A;  4YRV A;  1Z7L A;  1N78 A;  3KX2 A;  4RM2 A;  3FHN A;  2KDO A;  3HXL A;  3FBN B;  3E1S A;  4XMY A;  3OYB A;  4JOM A;  4CCO A;  2RRE A;  3SZG A;  4BEH B;  1W36 D;  3OYE A;  2WAQ A;  4LIT A;  2QKM B;  5TGT A;  4BQO A;  2VXD A;  4DBQ A;  3KYL A;  3L2V A;  3ZCO A;  3OS1 A;  4F93 B;  1W36 C;  5HNH A;  4DIQ A;  4BAC A;  3DTK A;  1MMN A;  3K4K A;  3I3L A;  4BUP A;  4II3 A;  2K9L A;  4PJJ A;  4XKW A;  2X1D A;  2HVS A;  4ZTJ A;  2K5C A;  3QYB A;  4E4H A;  3CES A;  4Y33 A;  2CV0 A;  4J01 A;  1Z3Y A;  3K4J A;  4PJN A;  3CJR B;  2DT6 A;  4YEL A;  2NOJ B;  4E6K G;  2IS4 A;  3QOD A;  2R7V A;  2XDV A;  3IUO A;  4BJT A;  2F4I A;  1DGW Y;  2VKH A;  1IRX A;  3D5R C;  4NQW B;  2JVG A;  4J00 A;  1OR7 C;  4BQN A;  4ZDO A;  4E7J A;  3OL3 A;  2BW3 A;  2OV7 A;  3S93 A;  2LC2 A;  2F6C A;  3RPU D;  2M7A A;  4PFO A;  3OR1 C;  1HA8 A;  2L9N A;  2HQA A;  1MNE A;  1P9Q C;  3LMM A;  4ANJ A;  3L2W A;  1X1B A;  4BU2 A;  3BG7 A;  3EPZ A;  4RLQ A;  3K4L A;  1UEL B;  2Q1Z B;  2VB6 A;  2ZXH A;  4PK4 A;  3MKY B;  4XOT A;  1N77 A;  3PSF A;  3W2A A;  3D5S C;  4ZC3 A;  4AYB A;  3ZQQ A;  3H9J A;  5FRN A;  3OIQ A;  4BEH A;  3I9V 2;  4Y3O A;  2W4S A;  1QHG A;  3LSH A;  1X1A A;  4KT6 A;  4IQ4 A;  4CUG A;  2CH0 A;  3MKW B;  1YE9 A;  1WJE A;  2ZFU A;  4BL0 B;  3CF2 A;  1N75 A;  3EUH C;  2V7F A;  3RCO A;  2BVL A;  1E0E A;  2R7R A;  2LY1 A;  2PMZ A;  2IGN A;  3A2K A;  3BLY A;  2JSP A;  5HVQ C;  2F5V A;  3OYA A;  1TT0 A;  3SEZ A;  2GOX B;  2Z16 A;  4DOZ A;  1ERD A;  2VAS A;  4B43 A;  3VSK A;  3AL0 B;  5LFA A;  3IAS 2;  2KP6 A;  2W00 A;  3OS2 A;  3M1C A;  4RM3 A;  1Y6I A;  3DTE A;  4C2T A;  1V5G A;  3K4M A;  4XKV A;  2CV1 A;  4HST A;  1WJC A;  2A6T A;  4BDZ A;  4BE2 A;  2RNG A;  3G2B A;  2WB1 A;  3PL8 A;  1S9H A;  4BE0 A;  4GRI A;  2X1C A;  2PJR B;  2R4G A;  4XQF A;  1WJF A;  4ITV A;  2IS1 A;  2X1E A;  3CMM A;  2VLA A;  1U0J A;  2XSJ C;  4ZDP A;  4BE1 A;  4N4O B;  1AA7 A;  3IAM 2;  2BVM A;  2X85 A;  3HUG B;  3VYS B;  1NG7 A;  3OYH A;  3VWB A;  2UWM A;  2KZV A;  1PYV A;  3OS0 A;  3OL4 A;  4CZC A;  2GOM A;  2R7W A;  3NWT A;  3RQ4 A;  4U87 A;  4XON A;  4OAZ A;  1MMA A;  5HOO A;  5HLT A;  3M8J A;  4XOR A;  1LVK A;  3W2W A;  3PNV A;  3LSK A;  2M4K A;  3D5L A;  3UNG C;  2DCE A;  2CUJ A;  4F91 B;  2Z1D A;  2LG4 A;  4LIV A;  2W82 A;  1X19 A;  2VQG A;  3K6G A;  2LBF B;  4B47 A;  1D0Z A;  2VL8 A;  2KRC A;  1BR4 A;  2CUZ A;  4XLE A;  2O5R A;  3L2R A;  1GLN A;  4PSX A;  1WJB A;  2W7N A;  5CKT A;  3TMO A;  3PUB A;  4XKC A;  2K9M A;  2HVQ A;  1DP3 A;  2M3A A;  3OYF A;  1T95 A;  3H5A A;  5KNL A;  2PJR A;  3K70 C;  2V9K A;  3VYU B;  3DPL C;  3DPU A;  1D0Y A;  3C2H A;  5CQG A;  4HPQ A;  4PSW A;  1LFP A;  3PNT A;  3S8P A;  4AVZ A;  4XL9 A;  3BCA A;  2R7T A;  4E7H A;  1D1A A;  1V5E A;  1MMD A;  4C9Y A;  3QOE A;  4BS9 A;  1MND A;  1UG0 A;  2KPM A;  2DJI A;  3L2Q A;  3U21 A;  4B3X A;  1X1C A;  3E0J B;  4B48 A;  2ELJ A;  3DQV C;  3BC8 A;  1LKX A;  2E1M C;  2E5N A;  4ZJZ A;  5JHF A;  4NC7 A;  3K4N A;  4P5O A;  4E7Z A;  3QYF A;  2CW7 A;  2ZXI A;  3HPG A;  2IXS A;  4NUB A;  2WBM A;  3HKZ A;  3DKY A;  2CS3 A;  2BOL A;  1QU3 A;  2MAB A;  4XLC A;  4BJ6 C;  3RSN A;  3LSG A;  3ONQ A;  1EA3 A;  1J09 A;  1WJD A;  4CCN A;  3H9G A;  3HG9 A;  3K4C A;  3LL7 A;  5KHD A;  4F52 A;  3VDX A;  2VQL A;  2WAE A;  2WY8 Q;  4DGW B;  1KON A;  4N4N B;  4XN3 A;  2DT7 B;  4FET A;  3CZ6 A;  4NC8 A;  4PFP A;  1OLT A;  2P0W A;  3SDB A;  4R79 A;  2XC7 A;  2WAF A;  3ZR8 X;  3OYC A;  3VYR B;  2HDW A;  4E7I A;  3CJQ B;  4BGD A;  4MLO A;  4BXF A;  2LRE A;  3BCB A;  3EUA A;  2DXI A;  4KIS A;  1MW7 A;  2V6E A;  5FRM A;  1TZL A;  2VJJ A;  2JUG A;  3S3M A;  2Y0S A;  2UV1 A;  4XM3 A;  3OY9 A;  2LOO A;  4H4K C;  1FMV A;  2XAU A;  4P1W A;  4E7S A;  2XF6 A;  3OR2 C;  4CH7 A;  4CCL A;  1UAA A;  1ZEL A;  3K10 A;  2HZD A;  4D9J A;  3FBI B;  2R7X A;  2E60 A;  3H5R A;  4JQF A;  3ZGK A;  1Z21 A;  3AKZ A;  3DTI A;  3OIP A;  2ZSI B;  4AU7 A;  3HPH A;  4HNU A;  3TBI A;  1QHH D;  2L9S A;  4OAY A;  2MYS A;  2LY2 A;  4XOP A;  3PJR A;  2VPL A;  3UR3 C;  4OWR B;  3DWL E;  4KJZ A;  5FRO A;  1SAU A;  1T0F C;  2WAD A;  2OUM A;  1WJ5 A;  3PNY A;  2X6X A;  3SYT A;  3A4C A;  2MFZ A;  2OC6 A;  3S3O A;  3HOT A;  2V1N A;  2HVR A;  3DPT A;  2X51 A;  2LRD A;  3LFU A;  1PJR A;  4DBR A;  4IKF A;  1X4O A;  2HPM A;  3H0D A;  3H35 A;  3VSL A;  3DLA A;  3DU6 A;  4CSW A;  3OYI A;  4U7B A;  2CFO A;  2VKD A;  4C2U A;  2X6W A;  4PJL A;  1YX3 A;  2MD0 A;  2MC4 A;  4QPO A;  3K70 D;  2DOA A;  2FUG 2;  3CP8 A;  1D1B A;  2IGK A;  1R6R A;  4LIU A;  4C30 A;  3ZXS A;  3HL2 A;  3K4B A;  4IZZ A;  2A5W A;  1BR1 A;  3OYG A;  3MMY B;  4BJ5 C;  3AL0 C;  3V42 A;  4BDY A;  2VQH A;  1BOB A;  2JA2 A;  4HG2 A;  1MMG A;  2HNH A;  2RQQ A;  4LG3 A;  1D1C A;  1VZ0 A;  2VJ5 A;  2IS2 A;  2ZSH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...