2XF7A

Crystal structure of bacillus subtilis spp1 phage gp23.1, a putative chaperone. high-resolution structure.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
48
structure length
48
Chain Sequence
b'ESLLYGYFLDSWLDGTASEELLRVAVNAGDLTQEEADKIMSYPWGAWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP23.1
publication title Crystal Structure of Bacillus Subtilis Spp1 Phage Gp23.1, A Putative Chaperone.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 17
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xf7A00
2XF6A 2XF5A 2XF7A
chains in the Genus database with same CATH superfamily
1IDZA 2F5EA 1MJBA 2H09A 4I99C 4ZJZA 2EIJH 4XN3A 3WG9A 3OR2C 2XPVA 2A68F 2F5CA 1UFMA 2K7LA 2KJCA 5FD5A 3OL3A 2A05A 3ABLH 2M2EA 4FE4A 1TZLA 1HW1A 4CZCA 3I4MJ 4A5MA 2R7XA 2IGMA 2QWWA 2WTEA 1FBSA 3KX2A 4PJ0C 4EATA 1EKEA 2MH2A 1I1SA 3K1MA 3L2RA 1K4TA 1GDTA 2J5PA 3OYIA 4Y17A 2HZDA 3SZPA 4E7ZA 3DBHB 2O61A 3S3MA 4M6YA 5E79C 4BQAA 1ZK8A 1ZYRF 4A3IJ 4A3CJ 1MBJA 5EEHA 3J80Z 1WJAA 2DFIA 3BG3A 2K85A 2XDVA 1I3AA 3KEOA 4RB0A 4RBOA 4IOCF 2LY1A 4U7BA 1JKOC 1E17A 2E1MB 5JVGF 3OYHA 2IRFG 4BQNA 1LKXA 2HDDA 2KLOA 4B3XA 2GM4A 5D5WB 2ECBA 3K10A 1ZARA 3F72A 4IHXA 1ERDA 4UB8C 3P9IA 1E3PA 4W1UA 3EPZA 5E18F 1CGPA 1O7LA 4XQFA 2KIQA 3LQQA 3JRAA 5FLMJ 1YITI 3KP3A 1LEAA 2FMYA 1YW8A 4PGHA 1GVJA 1OCRH 2BW3A 2DN0A 1S72I 1LFBA 5D5UB 1DUXC 1W7PD 2OTLI 1LDKB 5EG0A 2MC4A 3GWZA 5C44J 3I71A 3L9FA 3F0CA 4RAZA 2VI6A 2LBFB 2KDOA 4J00A 2RV8A 4DIQA 1Z3YA 3TEDA 2KIFA 1ZELA 3LA2A 5E20A 3WHBA 1K79A 2O03A 1MBFA 4I98B 2A5WA 2DA1A 3ZQQA 1FBQA 1OYIA 2VQGA 4ZH4F 3JTGA 2Y30A 1NG6A 3LL7A 3OIPA 4RLFA 5HLGA 2UUZA 3HUGB 1T98A 3BTJA 4IL6C 4DGWB 2CGPA 3TW6A 3G4SI 1R1UA 3DKXA 2DU9A 5K7ZA 5FKLA 2G7UA 2KP6A 4G7HF 1R00A 1ZLJA 4LB5A 2W24A 1E3HA 2VOPA 2BBYA 1WJEA 2XSDC 2VE9A 4BDZA 4MFDA 1BOBA 3QOEA 1WJFA 2OUMA 4G9YA 4OMYA 1LB2A 2PMUA 2R7QA 2F5FA 3WGHA 1O3TA 4EMSA 3R0AA 1YJ9I 2FXAA 3IUOA 1GV5A 3PUFA 3OYMA 1ZG5A 1XCBA 4IO9F 1FJLA 2OU2A 2W1OA 2HOSA 3F3XA 4XORA 4OWRB 5GPAA 2QQBA 2VPLA 1OLTA 1E2XA 2P4WA 1XCVA 1JGGA 4B8XA 2DA3A 2WADA 3Q3SA 4CXFA 3F22A 3JRCA 1MH3A 4KT6A 2R92J 2W48A 1FOKA 1TWGJ 3LFKA 3OYEA 1TBXA 1U5TB 4RS8A 4YELA 2IA1A 1MIJA 3OYCA 1UAAA 1MKMA 2TCTA 3ISPA 1UHMA 5JHFA 2L02A 2Y31A 3EQLF 5AIPA 2DMPA 1SFUA 5F64A 1AOYA 4RAGA 2QVOA 2XVCA 3QP6A 1SC7A 4M71A 2JA8J 4IHWA 2D2WA 3D5LA 5IYCJ 1QZYA 5LLQA 3BPXA 1SD5A 1TT5B 2JVHA 3OYBA 2H1KA 4LIUA 3R6SA 1RC9A 3QQAA 4HPQA 4II3A 4L9JA 4MQ9F 2DT7B 1OCPA 5HS9A 1D1AA 3E6CC 5CVVA 4U7DA 1Z7UA 5CVJA 2NVXJ 1FZPB 2FQ4A 2HI3A 1IF1A 1O3SA 3R60A 2K86A 3D5RC 4KN4X 5L3GA 4B48A 2LREA 3FDYA 4BXFA 3JSOA 3H5RA 4HV5A 2E71A 2ADUA 3FBNB 3HZJA 2LK2A 3LSPA 4XSXF 2DMQA 1XSVA 1EJ9A 2ZMEB 2BYVE 3K70D 3F23A 2ACJA 5CKTA 1N77A 3M07A 2IS1A 2ECCA 2Z16A 3LSKA 2HYGD 2R7FA 2ZSIB 5JR3A 3VB2A 3V8KA 3CLQA 4L5JA 4JK1X 3WTXC 2V9VA 3CMAI 5ICFA 1MDMB 3S93A 6PAXA 3GTLJ 3KP7A 1EH6A 5ED4A 4PDKA 1WHUA 4Z2YA 1ZRCA 2LBFA 4HOBA 3ESWB 4ZYEA 3CCQI 2CUJA 3M9AA 2KQRA 3HGGA 3AFHA 4DYRA 2XPUA 2Z2SB 2ZFUA 1WKMA 2LOOA 5EDNA 2R5ZA 1Y6IA 2FU4A 4BGDA 1JI8A 1SFXA 1WH7A 3EYYA 2O8XA 4ZC3A 4XSZF 5M5YJ 2ZJPF 3ZQFA 2KZGA 2G0EA 2DK5A 1SAUA 4JQFA 5GTHC 2OQGA 3HUGA 1A5JA 2FMLA 3MZYA 1O7FA 1B8IB 1S5LC 4KN7X 4WXCA 1BA5A 3P7NA 5EJCA 4XLPF 3DCFA 2KZVA 4P5OA 4M74A 1J0RA 2OJED 4YRVA 1TWCJ 2ZXIA 4BXXJ 3GO5A 3GZ6A 1ETXA 2RNJA 3HPHA 2K9QA 4GYGA 2M34A 3TDZC 2O0YA 2B63J 3ZR8X 1HSJA 1Z21A 2NNNA 5L3CA 1T0FA 5F27A 2XHKA 4B43A 4CYCB 4KITB 2K4BA 1BM9A 4A0ZA 1FP1D 3S8PA 1H89C 3VSKA 2JPBA 2X48A 5L3EA 2EQRA 2G7HA 1IRZA 3KP2A 3LWFA 3WTSC 3S2DJ 4F93B 4B4CA 5BNGA 5FROA 3KEQA 5JI6A 4HDVA 3RKWA 2HGCA 2LLKA 3AG3H 2HXOA 3GLXA 3RPQA 1QVUA 1SD7A 1HDDC 3GMEA 3IP4B 2UXNA 4ON0A 1TTYA 3PQKA 4IEJA 4QPQA 3TO6A 1Y1VJ 4BJTA 4XKBA 3IAS2 2LKXA 4R8HA 1U5TA 2DCEA 4D1QA 2VPRA 5DDGA 2XAHA 3DWLE 2DJNA 2Y0MA 2L2OA 2IW5A 2XF7A 2Z33A 1OQYA 2EINH 3BC8A 4C2MJ 4A69C 2DOEA 1N78A 1DPUA 3CDHA 2WWYA 2V1XA 2ME0A 2XAFA 2COMA 3EUHA 3HC7A 1K7AA 2MW8A 2RREA 2NVQJ 2RGVA 1X58A 2X0LA 4MFEA 2M5WA 1PDNC 3DF8A 4P55A 2IEKA 1QZEA 3QPLA 3ZPLA 1LNWA 4A3MJ 4HG2A 1FYMA 2V1UA 3RQ4A 2L9RA 4A3LJ 1R4MB 2GLOA 2JMWA 3Q0UA 3BR3A 2DOAA 2NAZA 1A6IA 4XRSG 2LG4A 1W0TA 5JVTA 4ENJA 5IP6A 4ZDLA 1FYLA 1NH3A 2HVQA 4L9VA 3QPTA 1S8NA 4I2OA 4PCQA 4E7KA 3JSPA 2YS9A 3ZMSA 5DS9A 1VQ7I 1P92A 3I64A 2DYSH 3FF5A 4PSWA 2Z1DA 4BEHA 2CJJA 1R4NB 2JA6J 4HX4A 3IH3A 3DEUA 2ZMEA 3DLLF 2R7UA 1FOXA 1UZCA 1W1WE 3H5NA 3DTIA 4AM3A 2QQ9A 3FHZA 3J80K 3W2VA 1R49A 5GAEJ 3OY9A 1I39A 4M3DA 1IN6A 3SXYA 2PQ8A 4BUPA 2WAFA 2F2EA 1D5YA 2DQRA 1SAXA 2HR3A 1WJBA 1UG0A 4XRMA 1MBHA 1WFXA 4IJAA 2MD5A 1RETA 2A5YB 4KT5C 3LSGA 1BR1A 1YW9A 5ERIA 1ZGJA 1IN7A 3A02A 1Z6RA 1SD6A 2QGUA 5H20A 3OYKA 1WJ5A 2H27A 2JUCA 3JCUC 4BNCA 1XN7A 3CZ6A 2NOGA 3FXQA 2E36A 4PUSA 2NS0A 4AIKA 3DTEA 1JT6A 1JKQC 1XPXA 5FRMA 2W85A 4EJUA 4IRGA 5BPIA 4HNUA 2VBZA 2UZKA 2JA2A 2IVMA 3CC7I 3D0SA 1SVLA 1ULYA 4E70A 1H88C 1B8IA 3M1EA 2ZJRF 1A6QA 4Y4RA 3JRHA 2BZTA 3I53A 4BY1J 1P7JA 4R1HA 1IN5A 3H5AA 3IHUA 3RKXA 3C2BA 3CCEI 1Y8QB 2ZNYA 5H2FC 3KP5A 2C6YA 1R7JA 3LSRA 3BT9A 3HOVJ 2VJ5A 4O6JA 1BR2A 2GOMA 3G1MA 4A3JJ 2X6OA 4U0WA 3CMEI 4OIOF 2EA2A 1O3RA 1QBJA 3F8FA 4CCMA 5EZGA 4CYCA 3CF5F 2EWNA 1VQOI 1NG7A 4KA4A 2ZXWH 4IHSA 2UWMA 3IH4A 1WH5A 4M6VA 3JRFA 2HVSA 3R0JA 2Y48A 4N0BA 3BQZA 2DFFA 2PMZN 4DQ2A 1P2FA 3LSHA 1YQAA 4MLOA 4XN0A 5CJ9A 5J1UA 3J7AO 4C3HJ 2XGEA 4V2GA 2FRHA 1JKRC 5E1XA 2E5ZA 1VF9A 1I5ZA 2M1BA 4C3IJ 2AS5F 2QA4I 2KHMA 3GVAA 3QYBA 5F1JA 3B6CA 2O7OA 3L00A 3JAMK 4IXAA 1FMWA 1L3LA 2EILH 1XMKA 2FX0A 4XONA 5BS6A 4EM0B 2LFBA 2HDWA 4MTEA 2IS6A 2HTJA 2DMTA 5KHDA 3T5XA 2HZTA 5E8GA 1L0OC 1WQ2A 4A6DA 3ML6A 1EV7A 3M4OJ 3ABMH 3F9KA 2VXDA 2YUSA 2PMHA 4I76A 1V54H 3WG7H 1OMIA 4DOZA 2W4SA 2J5OA 3M3YJ 1T39A 3OYFA 3DBRB 4ABZA 1LE8B 1DP7P 1QPIA 2CQ7A 3WTUC 2P7CB 2IJLA 3SFIA 3F8MA 2LY2A 1J9IA 3S1QJ 3H0DA 1WVRA 5J4YA 2STWA 4HNTA 1P7IA 4D7NA 2PLYA 4KYWA 4IHTA 1X1PA 3VYRB 5IP9J 2PBIA 3A1YA 4LITA 3K70C 4LB6B 4BACA 4KMUX 5M3FJ 1GXPA 1RKWA 3W2AA 3TO9A 2P8TA 3PIPF 1LFPA 2GXAA 1IN8A 2DYRH 4JX4A 2D45A 2V9KA 2NS8A 2LTPA 5J8FA 2ICWG 1KU7A 3UKGA 4RAFA 1TC3C 3TMOA 3RPUA 3V4GA 1VTNC 2CUFA 2DK8A 2AQEA 2X6WA 3I5UA 4ZYHA 1PYVA 3OS0A 4D5FA 3CF2A 3M8EA 4OOIA 2L9NA 2ZCWA 1D0XA 3OL4A 4ENNA 1K4SA 2XV4S 4AIDA 4HZFA 1QPMA 3LA7A 4HX7A 2FSWA 3P5JA 1LEBA 2E35A 1POGA 2ID3A 4JBAA 2TDXA 1X2MA 1IUFA 2XAQA 2STTA 3I59B 1EF4A 1IXSB 3WTWC 4EGYA 1S6LA 5HLTA 2VASA 1ZQ3P 2XIGA 2GIZA 4FISA 2QSFX 2VKHA 3OS2A 4N4NB 3L2CA 3QAHA 1REPC 4LFUA 2OZ6A 5GAHJ 4M9ZA 3RQIA 2JN6A 2VBXA 4FQGA 3LSMA 2CG4A 2K4JA 3OR1C 3MFKA 3ELKA 2HOEA 4BL0B 1NHAA 4QIWN 1O57A 2MSYA 3BG7A 4ITVA 3BG5A 2Q8KA 5DYMA 2XASA 1TNSA 2LRDA 4XKWA 2K3FA 2M8EA 2MLGA 4GXOA 2QQAA 3BZ6A 3BWGA 5LHHA 2R7RA 1PUFB 5ICCA 3ZCOA 1SMYF 3E3VA 1R9TJ 3OOPA 4Q48A 4Y13A 5HOOA 4MQVA 2M0MA 5D6FA 3L1PA 5GP9A 3K1NA 3VWBA 3TW7A 1KYZA 2K27A 5J8CA 5LGTA 3ABUA 3ASNH 2NRAC 3CUQC 3ASOH 2DT5A 2DTZA 5KVRA 3K69A 1H0MA 2V1NA 4F52A 3CCMI 3HL2A 4KNYA 2M4GA 2JTVA 5BMZA 3PUBA 3RIRA 4U0YA 5FKOA 5KK1A 1IRFA 5B1BH 2HNHA 4I0BA 3ULQB 5KCMA 1Y1WJ 4RMNA 2DW4A 1HC8A 2PI0A 2L7FP 2ZBKA 3SEQA 1R6RA 1OYYA 2CUZA 4FASD 1MJ9A 1YHQI 1X1CA 3HPGA 1PVEA 4UUSB 4F91B 5CPRB 2EH3A 1W5SA 3KP6A 2BY0A 1PUEE 2DMNA 1QU3A 1V5GA 5K1YA 3CJRB 2CQNA 4IRIA 4FCYA 2DLLA 4Q47A 4ENMA 1GXQA 4OIPF 1LE8A 2K40A 3BY6A 5ILUA 4IKFA 1SFKA 1P9QC 4I7HA 3J7YJ 2D5VA 2PMZA 3BCBA 1XGSA 1U3EM 3QODA 1DPRA 4A3BJ 4CCLA 1DGRM 2LYCA 3OWTA 1YRNB 3J81K 2OV7A 5EF6A 2BHYA 2OCCH 3L09A 2GBYA 2Y9ZA 1F43A 1MMGA 2F6CA 5TRDA 3Q0WA 4UV9A 4BQOA 1JE8A 3ZGKA 5E3LA 3HEFA 3OIOA 4E7LA 2H8RA 1AA7A 4C2UA 2ZSHB 4MNUA 3E7LA 3G1LA 4X1EA 4BHCA 1Q1HA 2FBIA 2YPRA 2GAUA 2KISA 3QYEA 5D8KB 1TQPA 2DJIA 3PIOF 2HDCA 5J1RA 3S3NA 4HW0A 4G94A 4HDUA 1UMQA 3ABTA 4RM2A 3OMYA 2HQAA 1MSEC 3GFJA 4G6DA 1IUYA 2NS7A 1G6NA 4F3QA 3K7AJ 4AWXB 2H1LA 3ZMDA 3EETA 3GCMA 3JW4A 2M7BA 2HYJA 1XTAA 4MGRA 1ZG3A 3HJEA 4B47A 2O3FA 4ASNA 1KYWA 1UHSA 3RCOA 1SVOA 3HYIA 2WV0A 1SANA 5LEJA 1UELB 3L2VA 5M5XJ 3MWMA 1GHCA 1K6YA 4FE7A 3I9V2 3HG9A 4QWQA 3V7SA 4A0XA 2HEOA 4L5EA 2B7EA 4EJVA 4GO1A 5M5WJ 2VXZA 3W3CA 3RJPA 2ZB9A 4LG0A 3RZDJ 4HNVA 3AKZA 3OV8A 1ZKGA 1PP7U 2CH0A 3O3KA 4GRIA 3IAM2 2ZC2A 1OCCH 4L5IA 3X2QH 3C1DA 4ESJA 1EH7A 4BJ5C 1QHGA 2XAJA 1JTYA 3BJ6A 4IX7A 2ID6A 4HYEA 4UHTA 2LD5A 1Z9CA 1U8BA 3K6GA 4AYBA 1ETVA 2IS4A 3W6VA 2DOFA 3REOA 1PUFA 2EV0A 3JAMZ 5DV5A 4C9YA 1S9HA 4AUXA 2XROA 1AU7A 1SFOJ 3IRQA 2WAEA 4GYIA 1G8XA 1R36A 3OSGA 2OAZA 5D8LB 3QWLA 4U0VA 2EZLA 5B3SH 4PGGA 1T38A 1K83J 2RKHA 4A6EA 1VQ4I 4PJMA 4NB5A 3I4PA 3GUDA 3BZKA 3FKJA 5J4VA 4BQQA 3K4MA 3LOCA 2OTJI 4CA0A 5J1YA 1B72B 2DO7A 3H9GA 4XRFA 3KFWX 4C30A 4EQQA 3CC4I 3H36A 3HOUJ 3CLOA 5A2QZ 1ENHA 5JFRA 3TOAA 4R79A 2FNPA 5IT9Z 1CF7B 2HPMA 2JPCA 2R7ZJ 2FA5A 3ZQHA 3COAC 5CLSA 5E8IA 1FBUA 3PQJA 3S1NJ 1HW5A 3AG1H 1HSTA 3O8GA 4G12A 4RA2A 2VKEA 3DBLB 2WB1A 4UUSA 4V2FA 5LRSA 1ZR2A 3DPTA 3SHFA 3KYLA 1D1CA 5TJJA 1FIPA 5D4SA 1XMXA 2HQRA 4C3JJ 1R71A 2OCEA 4JYKA 3WHCA 3CJTB 1LVAA 1DU6A 3S1RJ 2AQFA 1V5EA 2HU9A 4C2TA 2E5NA 1V55H 2V4JC 1UHWA 3IWFA 4YIRX 1RR8C 2V7FA 2JT1A 5L3DA 4IRHA 3CTAA 3OYLA 1OR7A 4NBQA 3KYCB 3FIWA 4A3KJ 1VFCA 2M9HA 2YX4A 1YRNA 4PJLA 1HXDA 2R4GA 3TOBA 1EA3A 5DM6F 2CFOA 2EFQA 4L9TA 4MO7A 3PNTA 3K2ZA 4BBRJ 2HKOA 4A93J 3A03A 3PFYA 1HBXG 3LMMA 3KETA 3I56I 2Z3YA 3BR0A 3Q9VA 2FF4A 1QA6A 3G3ZA 2CQKA 2P0WA 1AHDP 2H8WA 2QSHX 3BJAA 3ZRGA 3FM5A 5FLXZ 1FEXA 2CW0F 1FT9A 2K5CA 2GZWA 3RYRA 1ZREA 4YIFA 3PO3J 3CUOA 2K9NA 5DD8A 2GXBA 1BC8C 2XSJC 2KIUA 2EZKA 2ZFWA 2FEZA 3KIOA 1R5ID 1RZ4A 2FOKA 3Q0VA 5BOXA 2I10A 3N4MA 1MBKA 1APLC 5GTIC 1WCMJ 4YFXF 2R93J 2Y69H 3DPLC 3F6VA 4E7SA 1IGNA 2OA4A 1WRJA 3MCZA 2KRFA 3QU3A 4Y33A 4CYDA 1FLIA 4PK4A 4KFCA 1SVMA 5DTDA 1ZN2A 5LHGA 3CUQB 4IQ4A 3BTLA 3AG4H 3CESA 2E2JJ 5AIQA 4LIVA 3ONQA 1FYKA 4A2UA 3BROA 2QSGX 2GOXB 2HOTA 2CMPA 3I58A 4X0GA 1VQ5I 3JRBA 5K5QA 3C7JA 3FXKA 1E0EA 5E1WA 2QZ8A 2KDZA 3KEYA 4A3EJ 5LRRA 1G59A 3J7ZI 2HPIA 1ETWA 1MMDA 2DA5A 1FX7A 3HSRA 1TQMA 1ZTRA 2CYYA 4LG3A 3GFIA 3I55I 1LDJA 2EFPA 1K6OA 1BI1A 3GXOA 4HF2A 4OIQF 1XB4A 4ETSA 1WSUA 3A2KA 2EIKH 3U21A 2V79A 2Y2ZA 3VDXA 3N05A 3VYSB 1X19A 2QYOA 2PN6A 2CV2A 5FRNA 1AWCA 2A6TA 1MD0A 3ZQ7A 2L5QA 5HNHA 1V3FA 5HDGA 4L18B 1FSEA 3OOUA 4AC0A 3KZYA 4BE0A 3FM3A 4Y3OA 1JTXA 1B72A 3ZMUA 5LGNA 4HX8A 3J7AY 4A3FJ 2DA2A 3SZTA 5E3NA 2IS2A 1YIOA 3MZHA 2L01A 4LLGF 3IV5A 3WGGA 4XLEA 1IV8A 3I54A 1OCTC 4A3GJ 3TBIA 3J81Z 3H1CA 1STZA 1X3WB 3NARA 4DJAA 3TP0A 4E7JA 4OAYA 1IW7F 3E97A 3D1NI 3LFUA 4F7ZA 3MZ8A 2EV6A 4AU7A 1NK2P 2NNYA 2XF6A 4NHJA 3DKWA 4D9JA 1IJWC 2ELKA 4NC7A 1FSHA 1RKTA 5IOYA 3FISA 1S7AA 4BDYA 2E34A 1OKRA 2IP2A 2Q2EB 1JJ8C 1VQ6I 3BG9A 4XLNF 2COBA 2R0QC 2JRTA 2ZKZA 3A01B 5HS8A 1FTTA 2F48A 2GWRA 1G3YA 3HGYA 3HKZN 4M72A 2VC1A 4CUGA 4I6ZA 4ZTFA 2W00A 2YR2A 2DDAA 4AD9A 1Z3XA 5LHIA 5FFZA 4DYCA 2OF7A 2H6CA 3P9CA 2YU9J 1E3OC 2L7ZA 1ITYA 4EJOA 3E1SA 1HDPA 2DA7A 1XD7A 3H3UA 3JTHA 5IYBJ 3SFZA 3CCRI 5J6XA 3R61A 4D7MA 1MDMA 3DQVC 4RGSA 1MBGA 4XLAA 3U2RA 1ONVA 4F92B 2X1CA 3HTUA 3NWSA 5E3MA 1F1ZA 4XRSA 1ON2A 1YX5A 2RQQA 5C3EJ 3HOTA 4HF0A 4UUTA 1X3ZB 2IT0A 3E6MA 1Y39A 2KMUA 2EPFA 1ZH5A 3KZIC 2QENA 2XUBA 1ZAOA 1D8JA 4I0AA 2VIXA 3EUAA 1I1GA 1RNLA 1YJNI 1TNTA 3V42A 1VQNI 1JJ6C 5DCMB 4HEA2 2NOJB 3ZQGA 2XF5A 1KONA 2AHQA 2EIMH 3FMRA 3QPHA 2D1VA 3PNVA 3CUQA 4K2EA 3M8JA 2V1DA 3FXJA 4UV8A 4OU0A 2E1MC 4ZYGA 2EV5A 1W36D 2FQ3A 2DTRA 2D1HA 5CVRA 1A04A 4BE1A 3W6KB 1LDDA 1RRJA 3BJOA 3LQRA 1MNEA 2QUFA 2W84A 5GAGJ 5GPCA 4IZZA 4UB6C 4WF2A 1XGOA 3PSIA 2F5VA 1YS7A 5ILVA 2HWVA 1Z67A 2OPTA 2BVLA 1G3SA 3WTYC 2CWEA 3MEXA 1KGSA 1A36A 2PJPA 1OCOH 1W5TA 5IY5H 4E7IA 2XAGA 1TL8A 3RPUD 3V8JA 5E1ZB 1Z1DA 3NEUA 3SJMA 4I02A 3CCLI 2XAUA 4WX9A 3TDUC 1TLHB 3ZN1A 2QF7A 4FX0A 2V9PA 4HA8A 4BKXA 1I6XA 2DA6A 1QNTA 4FHTA 3LSTA 1YW7A 2I5UA 4RDUA 1OFCX 1BW5A 1ZHFA 2FD5A 3HHGA 3ZXSA 3NWTA 4AVPA 2DPDA 4UVBA 1ODDA 1MSFC 2ZJ2A 4L0ZB 3GLLA 2NVYJ 2NXNB 2PX9A 1VQMI 3GF2A 4ZDPA 4XK4A 2MD0A 1J5YA 1JUSA 3RZOJ 4LD5A 2L0KA 4HV6A 1XGMA 2M8GX 3DKYA 1BBYA 2HYFA 4WCGA 3CCSI 3R4KA 2JRMA 5EZHA 2HVRA 3S14J 1FNNA 1T08B 5K7FA 2EZHA 2ZXHA 4P9UA 3JRIA 1XMAA 4KUMA 4OIRF 5A2QK 2W7NA 3B6AA 5IT9K 5EEAA 2L4MA 4BS9A 1SMTA 3A0BC 1LVKA 1T0FC 2GQQA 2WAQN 1QVTA 3OIQA 3S3OA 4M3EA 3FK6A 2BY3A 3U1KA 1YLFA 5DM7F 3A01A 2Q1ZB 1MZBA 3V7RA 1AKHB 4Q5SF 2E1NA 2XC7A 1VI0A 5LEKA 5HS7A 2F5DA 2H6BA 1QZZA 1BR4A 2IAIA 2E2IJ 1LFUP 2B9SA 3MKYB 1LPQA 1ETKA 3VYTB 4D0PA 1N25A 2Y9YA 3I4NJ 2RQPA 2G9WA 3UR3C 4CCKA 4EM2A 5HNFA 1HKSA 1KU9A 5IT3A 2K02A 1F9NA 5BQTA 1XGNA 2KIMA 2PJRB 3LAPA 1RUNA 1T8IA 1YTYA 1GT0C 1K61A 1HCRA 3RKYA 3CCUI 3TGNA 2X1DA 2FJ1A 2VN2A 3EUHC 1UJ8A 1MMAA 3OYAA 2DXIA 1T33A 3BLYA 4H4KC 3GX4X 1O4XA 3GTKJ 1IAWA 3K4CA 2JA7J 1T56A 3H3ZA 5FLXK 4ENKA 2VOOA 5DUKA 4XMYA 3HRMA 2QM3A 4XBFA 3F8NA 3GTQJ 1JGSA 2VODA 3WU2C 5DCMA 4MHGA 1P4WA 1XDUA 1FOWA 3C18A 2Z9OA 1R5HA 1UCRA 3CDIA 3E5QA 3BR1A 4M3FA 4BHPA 2VC0A 3NRVA 3KLOA 1QGPA 4G7OF 1BW6A 3BQYA 3HRUA 3RTRA 2LH9A 4CCNA 4DNCA 3A4CA 2EFOA 1YO5C 1TWHJ 1A35A 2I8DA 3VPRA 1IO2A 2MFZA 3BR5A 3HOYJ 3C2HA 5CYVA 4BYYA 2CQXA 2H94A 2XB5A 2IPQX 2XGCA 2K9LA 1OYWA 2LR8A 2MH9A 3WTTC 2P5KA 3MQ0A 5F04A 1BJZA 3H3VK 3E5XA 2MABA 1BIAA 2AXLA 2ZMEC 2ZO4A 1N75A 2LF7A 3FMSA 1IDYA 3BZCA 1LUJB 2HKXA 4ESFA 1Z05A 1Z77A 1V4RA 2LP0A 4XOPA 4ZYDA 3ZMVA 3BOQA 2LKPA 2VT2A 4XKCA 1WI3A 2ZJQF 2V6EA 5EYRA 2X51A 2EB7A 3MKLA 3G2BA 3DFGA 2DDBA 1SFEA 2GXGA 5LD2C 1MNMC 3S2WA 1G4DA 3SZGA 4S0HB 1KQ9A 4YFNF 1DQUA 2FOWA 3CP2A 3MD2A 4KDPA 1EH8A 3HXLA 3MN2A 5DCFA 5TGTA 3AL0C 1TQIA 2Y75A 3FK7A 4JX6A 2O6GE 1W4MA 1Q1VA 1SEUA 1T95A 5F6FA 2X6XA 5B1AH 1W7PB 2DI3A 4G8XA 4JP0A 1VQ8I 4LGWA 5F0CA 1ZG1A 2MBFA 4CSWA 1U2WA 3IRRA 2ESHA 2WV1A 3QU6A 3Q9SA 4YIIA 2VLAA 2F4OB 3O8HA 3U1DA 3FXRA 1B6AA 3OSFA 4EJTA 2DFEA 1MNDA 4GDFA 4RM3A 3DU5A 1JHFA 4YEJA 4BE2A 3BTIA 2V6CA 2OD5A 2HS5A 1ZGWA 5F08A 2ME6A 4ANJA 2QKLB 1RESA 4LOCA 3AAFA 2X1EA 4KJZA 2VUMJ 4FETA 5JLWA 2VKDA 4PFOA 2QLZA 1MBEA 3QP5A 3L7WA 1AKHA 1T6SA 2HQ5A 3ERMA 3QYFA 4HLXA 2HOAA 2P7VB 1U9OA 1YX3A 4CZZA 5K5RA 1J75A 4XLCA 4RLQA 3MMYB 4LK1F 5D6EA 4B44A 4DBQA 3IKVA 3DXJF 4YG2F 5CVIA 2JA5J 2IGKA 3E6DA 3TP3A 3WODF 5LFAA 4N4OB 1XDSA 2LMDA 2PJRA 2NVTJ 2DA4A 4XLHA 4HQMA 1T2KA 2O5RA 1U0JA 3EDPA 3QRFF 4KIFA 1JUPA 2F4IA 2R7DA 2WAQA 5FJ8J 4S05A 1M1EB 3BDDA 2LF8A 3I59A 2W25A 1MMSA 3DTKA 1A31A 3GTMJ 1ON1A 3C3WA 3T0YA 2PEXA 4DBRA 1ETYA 4D5CA 3VYUB 4ZZLA 1LQ1A 1W36C 3ZP5A 1YOVB 3K2AA 2M30A 3M8FA 2OQRA 2QKMB 2VJIA 2O8KA 3KE2A 3S15J 1QO0D 2R5ZB 2VJ4A 3CO7C 1W5CC 2VBYA 2IA0A 1F4KA 1HKTA 5LGUA 3K4NA 1R5GA 3RKQA 3LA3A 3S16J 3FXLA 1YE9A 1P4AA 3WU0A 1D0YA 3H35A 2P6SA 5HLHA 4B09A 1IRGA 1WPKA 3DEWA 2KRCA 4QSHA 2QBYB 3TL4X 4S04A 3ZMTA 4I01A 4XLFA 4NUBA 3WTVC 4KICA 1Y0UA 2XRLA 4WXHA 3CC2I 3DV8A 2WBMA 1I3QJ 4PSXA 2MGQA 4EV0A 1UG2A 2OC6A 1F36A 3FMQA 4FTHA 5JLXA 2MLKA 1OPCA 3PFIA 2P5LC 4G6TB 1F5TA 2VQCA 2LY9A 3KPHA 4RGXA 4B1RA 4M9XA 2WY7Q 4LK0F 1ZGAA 3LNQA 4XM3A 3CD6I 1BJAA 1S29A 2EZIA 1J09A 2ESNA 2LVSA 4A12A 2E60A 1FMVA 2VJJA 2GA2A 3WE3A 2BXZA 4BY7J 4BBSJ 2JUGA 1WJCA 2P6TA 3CQZJ 1U6GA 3B73A 5D5XB 4RGRA 4GCVA 2L9SA 3KLNA 4GGGA 2E7XA 3BCAA 3RYPA 4CICA 2CSOA 3G1OA 3F8BA 4BU2A 1W7PA 2ZNZA 2BXYA 4UY8I 3W6JB 4A5NA 2XGXA 3CDLA 3HM5A 3GTPJ 4IOAF 3SQNA 2CW7A 1NK3P 3HSFA 3V8LA 2MC3A 1QRYA 2XPWA 5M3MJ 4HRIA 5ICEA 5B5EC 2WY8Q 4RB1A 3S17J 2L7KA 4TV7A 1WZ2A 4A3DJ 2GA1A 2M4KA 1USTA 1I6HJ 1Y8RB 1BN5A 4U87A 3ZQIA 4PJJA 1S7EA 5J40A 5CVUA 1YS6A 5B66C 2L54A 3MVPA 1BI3A 3C2GA 2RVCA 4HQEA 1YIJI 2NYXA 3F21A 3QPSA 5AONA 3ZN0A 1H8AC 2DODA 2FUG2 5HDKA 3SYTA 3DU6A 1BIBA 1RPWA 3OYGA 2FBKA 2KRHA 1BL0A 3HOSA 5D4RA 2JSPA 1X3UA 1WGXA 3CO6C 1MJAA 5FFXA 3HOXJ 5HODA 2VE8A 4PFPA 3FHNA 1G3TA 4Y7NJ 1ZRDA 3FXMA 4ZTJA 2KKOA 4E7HA 1KA8A 2R5YB 1B9MA 4BEHB 4EGZA 3S32A 3JR9A 2A6EF 2CS3A 5CQGA 2MYSA 3ECHA 4CCOA 2CV1A 5JHUA 2X4HA 4FT8A 2KPMA 2BY2A 2E7WA 3BR6A 3GFMA 2K9SA 1J7KA 1I50J 2JZYA 4J19A 3SDGA 4RB2C 1XG1A 1KU3A 3GZ5A 2L7MP 2X6YA 2R7OA 4FX4A 4XR6A 4CGZA 5FO5A 1DDNA 4O3MA 3B02A 1KU2A 3IH2A 5ILSA 3EYIA 4MIMA 1VNDA 2DT6A 3V7CA 3KP4A 4UVCA 3ZMZA 3TQNA 1IXRC 1HLVA 3K4LA 2LNBA 1FTZA 3NQOA 3P9KA 4KIGA 1WJDA 2R3SA 3VFZA 1FOYA 4XKVA 2EJRA 2FBHA 3AL0B 3ABKH 4AIHA 1P6RA 4CHUA 2V26A 1GV2A 5EEGA 3GZNB 5CQEA 1HW2A 3PL8A 3CCJI 1C0WA 2QBYA 3PJRA 1X2NA 3FZVA 1FIAA 2ISYA 4WK8F 2A69F 3E5UA 3KZZA 3TO7A 1HKQA 2F4MB 3CCYA 4GFBA 1RR7A 3PSFA 3VODA 1GVDA 3QOPA 2E1CA 4M3BA 2IA2A 4HLYA 3ZQLA 2BVMA 4UVAA 3IC7A 2IGNA 2BOLA 4XICA 1RUOA 3HRTA 2OZUA 2N8GA 2BEOA 1MMNA 1ZR4A 1XC5A 2MA3A 3K4KA 1IV6A 1DU0A 1G2HA 4M9SA 3BPVA 3MAJA 5H6QA 1ZRFA 1U78A 2BGCA 1VQ9I 1Z6TA 1BOAA 2HQNA 4WXDA 1D3YA 1CF7A 1IZ1A 4HBLA 1VQLI 2E1OA 2ETHA 1FP2A 4DZJA 1OISA 3BP8A 3RSNA 1BI0A 4BH9A 5TISC 4MEYF 5FD6A 2VONA 4DW6A 4IHVA 2R7WA 1S3JA 2Z99A 5H6RA 2IBDA 2M7AA 3CP8A 3T1BA 2A6HF 2VQHA 2RC4A 1USSA 4XNFA 4QTRA 4OINF 2XKPA 1KZHA 1XX5A 2CUEA 3O6BB 3KCCA 3CMMA 2AO9A 2P5VA 3GFLA 3CJQB 1HF0A 2GIVA 1GLNA 4F55A 4BXUA 1TP4A 1UB9A 4E4HA 2X9DA 5F0FA 1P4XA 2AXTC 4M6XA 3CCVI 2EFWA 2XGDA 1X4PA 4EJWA 2WC2A 4IQJA 2R7VA 3RI4A 1Z0XA 1NTCA 3FKIJ 2BY1A 2DQLA 1HOMA 3CJNA 3WGIA 1H9GA 4G6QA 1QHHD 1X1DA 2DMUA 3A0HC 3FXOA 4EVIA 2Y0SN 1Y0NA 3GW2A 5KNLA 1IXCA 1IG7A 1B1BA 1DP3A 5E3OA 1D0ZA 2WA0A 3K0LA 1KQ0A 1TW3A 3S2HJ 2RNGA 3PO2J 2CW8A 1R1VA 3HIFA 1VZ0A 1FPQA 4HSTA 4O5VA 5FKKA 4WWCA 3LAJA 2Z5UA 1RIOH 3D5SC 2M0CA 5LBQA 2R5YA 2CQQA 3GTGJ 1SD4A 4OAZA 1OCZH 4P9FA 4Q4ZF 2LSOA 5HVQC 2XB0X 3VSLA 4ZYAA 3JREA 3PNYA 2NVUB 2E2HJ 3FWEA 2Q0OA 4PZJA 1MW7A 5KAFC 2PG4A 4UNOA 4MEXF 2BHZA 2FNAA 1JHHA 2P81A 1B4AA 2DPUA 2ZXJA 3VOEA 4J01A 1W0UA 4JX5A 5F1RA 1B59A 4P1WA 2JQ7A 3VEPA 3Q5FA 4Y52J 2M87A 4BAYA 4G7ZF 2K3PA 3E6BA 1YFHA 1OR7C 5KAIC 1JKPC 3E0JB 2R7SA 4P96A 2CO5A 5IYDJ 3IKTA 1MH4A 5GADJ 3JRGA 3HRSA 4HAMA 3GEZA 1R23A 5E17F 3DPUA 1Z7LA 2L3DA 1QQIA 3K9TA 4NC6A 2VBWA 1B9NA 3U9GA 1MGTA 1R58A 1XSXA 2VL8A 3L2WA 2A3SA 3K4BA 2IXSA 4DYQA 1XSDA 5DUIA 4L9NA 4ESBA 4BHBA 1D1BA 4LJZF 2L4AA 2O9LA 1TW2A 2VKVA 4CH7A 4KIBA 4CDGA 2VT3A 4JOMA 3MKZA 1CQTA 1YYVA 3IL2A 1YI2I 2EFNA 4YFKF 2EBIA 1U8RA 2VQLA 2YX7A 2BE5F 2DBBA 3GBGA 5EGOB 3S1MJ 3IWZA 4CCJA 5L3FA 2M45A 5K5OA 1K78B 3GTOJ 2LDUA 2XKOA 3F6OA 2A07F 4NQWB 1IN4A 2M3AA 5FKNA 2UV1A 1FY7A 1YJWI 2BV6A 3H0GJ 4X6AJ 2QEXI 2KFDA 5DEQA 3NAUA 1IRXA 4L0YB 4OMZA 3G6EI 2VB6A 4KMFA 2ELJA 3BTCA 4B3AA 2CV0A 2DFHA 5FKMA 3O2PE 1Z91A 3K1PA 3CMYA 5HLIA 1JT0A 2RN7A 5J3LA 3MKWB 3OS1A 3GYHX 4KISA 2JJ7A 1D8KA 2L9VA 4NDLA 1WI9A 3H92A 3G73A 3M7GA 2ISZA 5IOZA 2HFHA 3JRDA 4I09A 1Y56A 3SDBA 2OBPA 3T8TA 1H9TA 2LC2A 2HXIA 1XS9A 2Q2EA 1U9NA 4HSRA 4A0YA 1X1BA 3SEZA 3WTZA 1OJLA 3OYDA 9ANTA 2HTSA 5D5VB 2X85A 3RDIA 3LSJA 2IGOA 4XOTA 4UXNA 1DGWY 4EEFG 3GTJJ 4ZDOA 4QLCU 2A61A 1ETOA 4XIDA 2W82A 1R22A 1U5TC 4RAYA 1KQ8A 3DLAA 3H9JA 1BC7C 2ELHA 4LMYA 5K7HA 2RDPA 3DEEA 2FE3A 4N9HA 1ZLKA 3HTSB 1R1TA 2KJBA 2KT0A 4IF4A 4HF1A 1BI2A 1ACIA 5FLVA 1TT0A 5IPAA 4EM1A 2E19A 4BJ6C 4U88A 5L3BA 4M3GA 4NC8A 3WU1B 3OYJA 1JUMA 4ZZDA 3HOZJ 5HDNA 2K9MA 1O3QA 5J47A 3TKYA 2DAOA 4AIJA 2BW3B 4E6KG 4H0EA 1X1AA 5ICGA 2XRNA 3F8CA 3HSEA 2RAEA 5EG0B 4V19K 1I27A 3ZOBA 3ZQCA 4LLNA 2YU3A 4NNJA 2QCOA 2JWTA 1VQPI 4PJNA 4MTDA 3G71I 3PM1A 2B0LA 4AYBN 2UXXA 3HKZA 4AVZA 1J2XA 3HOWJ 4W97A 4LLLA 2Y0SA 1PP8F 3ECOA 2JK3A 1TWAJ 3BR2A 4CO8A 4XL9A 3OYNA 3L2UA 3HB9A 2MG4A 1ORKA 2YSRA 3I0TA 2CRGA 3KYDB 5FGMA 1J59A 1VQKI 2R7TA 5C4JJ 5FB2A 4IPAA 5C4XJ 1G3WA 2JVGA 2LKSA 1HA8A 4QPOA 4N9IA 1X4OA 3HBLA 3K4JA 4IVNA 4IHYA 3DP7A 4RB3C 3I3LA 4RGUA 3UNGC 3BG6A 1TWFJ 3N97A 4LG0B 2QQ8A 5BPDA 3FX3A 5DD4A 3AG2H 1D5VA 4II2A 2JSCA 2EA4A 1HQCA 3WE2A 3HDDA 2TRTA 3FXUA 4M73A 1LJ9A 1JXSA 1FC3A 1RI7A 1ETQA 5EGOA 4Y15A 2WB1N 3T8RA 2W57A 3M1CA 1K78A 4Z6YA 1V5FA 3W2WA 4UUVA 1S7OA 2CFXA 1GUUA 4DZPA 4NQWA 1PJRA 1FWZA 3LSIA 2EK5A 3HHHA 2CU7A 2KL4A 2PFBA 5IP7J 3L2QA 1IC8A 3EUKL 3H9QA 1WWXA 5F0HA 3ROUA 3FBIB 1YG2A 3ERED
chains in the Genus database with same CATH topology
4BU2A 4ZJZA 4XN3A 4XLEA 1FMWA 3OR2C 3TBIA 2CW7A 4XONA 4HRIA 4DJAA 2HDWA 2IS6A 4E7JA 3OL3A 5KHDA 2WY8Q 4OAYA 2L7KA 1TZLA 2M4KA 3LFUA 4CZCA 4U87A 2R7XA 2IGMA 4PJJA 3F9KA 2VXDA 4AU7A 3KX2A 2XF6A 4EATA 4DOZA 2W4SA 3C2GA 4D9JA 3OYFA 4NC7A 3L2RA 4BDYA 3OYIA 2FUG2 2HZDA 2LY2A 3SYTA 3DU6A 4E7ZA 3S3MA 3H0DA 3OYGA 2Q2EB 2KRHA 3HOSA 1WJAA 4HNTA 2XDVA 2LY1A 3VYRB 4U7BA 2E1MB 2JSPA 3A1YA 3OYHA 4LITA 3K70C 4BACA 4CUGA 4BQNA 1LKXA 3W2AA 4ZTFA 2KLOA 1LFPA 2W00A 4B3XA 1Z3XA 4PFPA 2V9KA 3K10A 3FHNA 1ERDA 3E1SA 3TMOA 3EPZA 4ZTJA 4E7HA 4XQFA 2AQEA 2X6WA 4BEHB 3DQVC 1PYVA 3OS0A 3CF2A 4XLAA 3S32A 4F92B 2L9NA 2X1CA 2CS3A 3NWSA 5CQGA 2BW3A 2MYSA 1D0XA 3OL4A 4CCOA 2CV1A 1YX5A 2RQQA 1LDKB 2KPMA 3HOTA 2MC4A 2KMUA 2LBFB 2KDOA 4J00A 4DIQA 1Z3YA 1ZELA 2VIXA 2X6YA 2R7OA 3EUAA 4XR6A 3V42A 2A5WA 3ZQQA 2DT6A 2VQGA 5HLTA 2VASA 4HEA2 2NOJB 2XF5A 1KONA 2VKHA 1NG6A 3K4LA 3LL7A 3OIPA 3PNVA 3OS2A 4RLFA 4N4NB 2UUZA 1WJDA 3M8JA 3HUGB 4XKVA 2E1MC 1W36D 4DGWB 3AL0B 3DKXA 4BE1A 3LSMA 2KP6A 2V26A 3OR1C 4BL0B 5CQEA 1MNEA 1WJEA 3BG7A 3PL8A 4ITVA 4IZZA 4BDZA 3PJRA 1BOBA 3QOEA 3PSIA 1WJFA 2OUMA 2F5VA 2LRDA 4XKWA 2BVLA 2R7QA 3PSFA 2R7RA 3ZCOA 3IUOA 3OYMA 2BVMA 4E7IA 3RPUD 2IGNA 5HOOA 2BOLA 2M0MA 2W1OA 2XAUA 4XORA 4OWRB 3VWBA 1MMNA 2IS2A 3K4KA 2VPLA 1OLTA 2WADA 2V1NA 4F52A 3HL2A 4KT6A 3ZXSA 3NWTA 3RSNA 2M4GA 3PUBA 3OYEA 2R7WA 4ZDPA 2HNHA 4YELA 2MD0A 5KCMA 2M7AA 3CP8A 3OYCA 4RMNA 1UAAA 2VQHA 4XNFA 3DKYA 3SEQA 1R6RA 2CUZA 4FASD 1X1CA 3HPGA 5JHFA 4F91B 5CPRB 2HVRA 3CMMA 1QU3A 2ZXHA 3CJQB 1V5GA 1GLNA 3CJRB 4F55A 4E4HA 3D5LA 2W7NA 4BS9A 3QYBA 1LVKA 1T0FC 1SFKA 2JVHA 1X4PA 3OYBA 4IKFA 3OIQA 4IQJA 4LIUA 2R7VA 1P9QC 3S3OA 4HPQA 4II3A 2DT7B 2PMZA 3BCBA 3QODA 1D1AA 4CCLA 1DGRM 2LYCA 3OWTA 2OV7A 1QHHD 2Q1ZB 1X1DA 3D5RC 2XC7A 5KNLA 4B48A 1DP3A 2LREA 1D0ZA 2WA0A 3FDYA 4BXFA 1MMGA 2F6CA 1BR4A 4BQOA 2RNGA 3H5RA 2CW8A 3ZGKA 3MKYB 1VZ0A 3FBNB 4HSTA 3VYTB 4E7LA 1AA7A 4C2UA 3K70D 4CCKA 3UR3C 2ZSHB 3D5SC 5HNFA 5CKTA 1N77A 2IS1A 2Z16A 3LSKA 4OAZA 2ZSIB 5HVQC 2PJRB 3QYEA 2DJIA 3VSLA 4ZYAA 3S3NA 3PNYA 2X1DA 3EUHC 1MW7A 3S93A 4RM2A 3OMYA 2HQAA 1MMAA 3OYAA 2DXIA 2LBFA 3BLYA 2CUJA 4H4KC 4F3QA 2KQRA 4J01A 3K4CA 4P1WA 3AFHA 2M7BA 2Z2SB 2ZFUA 4B47A 2LOOA 4XMYA 3RCOA 2K3PA 1Y6IA 4BGDA 1JI8A 4ZC3A 1OR7C 2R7SA 3E0JB 1UELB 3L2VA 1K6YA 3I9V2 3HG9A 1SAUA 4JQFA 3RTRA 4CCNA 2LH9A 3DPUA 3A4CA 1Z7LA 2VXZA 2I8DA 3W3CA 2MFZA 3AKZA 3C2HA 2VL8A 3L2WA 2CH0A 2IXSA 3K4BA 4GRIA 3IAM2 2K9LA 2KZVA 4P5OA 2MABA 4YRVA 2ZXIA 1D1BA 4BJ5C 1N75A 1QHGA 4CH7A 4IX7A 3HPHA 3K6GA 4AYBA 4XOPA 4JOMA 3MKZA 2IS4A 3ZR8X 1Z21A 4XKCA 2V6EA 4C9YA 1S9HA 2VQLA 2X51A 3GBGA 2WAEA 1G8XA 4B43A 3G2BA 4CCJA 4KITB 3S8PA 3VSKA 5LD2C 3SZGA 4F93B 4PJMA 4NQWB 1DQUA 2M3AA 5FROA 3CP2A 2UV1A 3FKJA 3MD2A 4BQQA 3K4MA 4CA0A 3IP4B 3H9GA 4C30A 3HXLA 5TGTA 4QPQA 3AL0C 1IRXA 4BJTA 4XKBA 4R79A 3IAS2 2DCEA 4D1QA 1T95A 2VB6A 2X6XA 2HPMA 2ELJA 3DWLE 2CV0A 2L2OA 2XF7A 4CSWA 3BC8A 3MKWB 1N78A 3OS1A 4KISA 2WB1A 3DPTA 2VLAA 3HC7A 1D1CA 3KYLA 2RREA 1MNDA 1Y56A 3SDBA 4RM3A 2AQFA 1V5EA 3DU5A 2HU9A 4C2TA 2E5NA 2V4JC 4YEJA 4BE2A 2LC2A 2V7FA 4HSRA 4HG2A 3RQ4A 4ANJA 3OYLA 2QKLB 1X1BA 3SEZA 2X1EA 4KJZA 3OYDA 4FETA 2DOAA 2LG4A 2VKDA 4PFOA 4ZDLA 4PJLA 2R4GA 3QYFA 1EA3A 2X85A 2CFOA 2HVQA 2IGOA 4XOTA 1YX3A 3PNTA 4E7KA 4XLCA 4RLQA 3MMYB 1DGWY 3PFYA 4ZDOA 2W82A 4B44A 3LMMA 4DBQA 3DLAA 3H9JA 4PSWA 2P0WA 2Z1DA 4BEHA 3DEEA 3ZRGA 2R7UA 3H5NA 2IGKA 3DTIA 1TT0A 2K5CA 5LFAA 4BJ6C 4N4OB 3OYJA 4NC8A 2PJRA 3W2VA 3OY9A 4XLHA 2K9MA 2XSJC 4BUPA 2WAFA 2BW3B 2O5RA 4E6KG 1WJBA 1X1AA 1UG0A 1U0JA 1WFXA 2F4IA 2WAQA 3LSGA 4NNJA 1BR1A 4PJNA 3DTKA 3OYKA 1WJ5A 3HKZA 4AVZA 4DBRA 3DPLC 3CZ6A 4E7SA 3VYUB 1W36C 2Y0SA 4Y33A 4PUSA 3DTEA 2QKMB 2VJIA 4PK4A 4XL9A 3OYNA 3L2UA 5FRMA 2VJ4A 4IQ4A 3K4NA 4HNUA 3CESA 2JA2A 4LIVA 3ONQA 1YE9A 2R7TA 1D0YA 2GOXB 2CMPA 3H35A 4Y4RA 2JVGA 4X0GA 1HA8A 4QPOA 1X4OA 3K4JA 1E0EA 3H5AA 3I3LA 3KEYA 3BG6A 3UNGC 2KRCA 3TL4X 4XLFA 1G59A 4NUBA 2HPIA 1MMDA 4II2A 2VJ5A 1BR2A 2WBMA 4LG3A 2GOMA 4PSXA 2OC6A 4CCMA 3A2KA 4G6TB 3U21A 3VDXA 2VQCA 1NG7A 3N05A 1X19A 3VYSB 2UWMA 3M1CA 2WY7Q 2CV2A 5FRNA 1V5FA 2A6TA 3W2WA 2HVSA 2L5QA 4XM3A 5HNHA 1PJRA 3OOUA 3LSIA 1J09A 4BE0A 4Y3OA 2KL4A 3LSHA 4MLOA 2E60A 1FMVA 2VJJA 4XN0A 3L2QA 2JUGA 1WJCA 3J7AY 3EUKL 3H9QA 2E5ZA 3FBIB 2L9SA 3BCAA 2KHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XF6 A;  2XF5 A;  2XF7 A; 
#chains in the Genus database with same CATH topology
 1IDZ A;  2F5E A;  1MJB A;  2H09 A;  4I99 C;  4ZJZ A;  2EIJ H;  4XN3 A;  3WG9 A;  3OR2 C;  2XPV A;  2A68 F;  2F5C A;  1UFM A;  2K7L A;  2KJC A;  5FD5 A;  3OL3 A;  2A05 A;  3ABL H;  2M2E A;  4FE4 A;  1TZL A;  1HW1 A;  4CZC A;  3I4M J;  4A5M A;  2R7X A;  2IGM A;  2QWW A;  2WTE A;  1FBS A;  3KX2 A;  4PJ0 C;  4EAT A;  1EKE A;  2MH2 A;  1I1S A;  3K1M A;  3L2R A;  1K4T A;  1GDT A;  2J5P A;  3OYI A;  4Y17 A;  2HZD A;  3SZP A;  4E7Z A;  3DBH B;  2O61 A;  3S3M A;  4M6Y A;  5E79 C;  4BQA A;  1ZK8 A;  1ZYR F;  4A3I J;  4A3C J;  1MBJ A;  5EEH A;  3J80 Z;  1WJA A;  2DFI A;  3BG3 A;  2K85 A;  2XDV A;  1I3A A;  3KEO A;  4RB0 A;  4RBO A;  4IOC F;  2LY1 A;  4U7B A;  1JKO C;  1E17 A;  2E1M B;  5JVG F;  3OYH A;  2IRF G;  4BQN A;  1LKX A;  2HDD A;  2KLO A;  4B3X A;  2GM4 A;  5D5W B;  2ECB A;  3K10 A;  1ZAR A;  3F72 A;  4IHX A;  1ERD A;  4UB8 C;  3P9I A;  1E3P A;  4W1U A;  3EPZ A;  5E18 F;  1CGP A;  1O7L A;  4XQF A;  2KIQ A;  3LQQ A;  3JRA A;  5FLM J;  1YIT I;  3KP3 A;  1LEA A;  2FMY A;  1YW8 A;  4PGH A;  1GVJ A;  1OCR H;  2BW3 A;  2DN0 A;  1S72 I;  1LFB A;  5D5U B;  1DUX C;  1W7P D;  2OTL I;  1LDK B;  5EG0 A;  2MC4 A;  3GWZ A;  5C44 J;  3I71 A;  3L9F A;  3F0C A;  4RAZ A;  2VI6 A;  2LBF B;  2KDO A;  4J00 A;  2RV8 A;  4DIQ A;  1Z3Y A;  3TED A;  2KIF A;  1ZEL A;  3LA2 A;  5E20 A;  3WHB A;  1K79 A;  2O03 A;  1MBF A;  4I98 B;  2A5W A;  2DA1 A;  3ZQQ A;  1FBQ A;  1OYI A;  2VQG A;  4ZH4 F;  3JTG A;  2Y30 A;  1NG6 A;  3LL7 A;  3OIP A;  4RLF A;  5HLG A;  2UUZ A;  3HUG B;  1T98 A;  3BTJ A;  4IL6 C;  4DGW B;  2CGP A;  3TW6 A;  3G4S I;  1R1U A;  3DKX A;  2DU9 A;  5K7Z A;  5FKL A;  2G7U A;  2KP6 A;  4G7H F;  1R00 A;  1ZLJ A;  4LB5 A;  2W24 A;  1E3H A;  2VOP A;  2BBY A;  1WJE A;  2XSD C;  2VE9 A;  4BDZ A;  4MFD A;  1BOB A;  3QOE A;  1WJF A;  2OUM A;  4G9Y A;  4OMY A;  1LB2 A;  2PMU A;  2R7Q A;  2F5F A;  3WGH A;  1O3T A;  4EMS A;  3R0A A;  1YJ9 I;  2FXA A;  3IUO A;  1GV5 A;  3PUF A;  3OYM A;  1ZG5 A;  1XCB A;  4IO9 F;  1FJL A;  2OU2 A;  2W1O A;  2HOS A;  3F3X A;  4XOR A;  4OWR B;  5GPA A;  2QQB A;  2VPL A;  1OLT A;  1E2X A;  2P4W A;  1XCV A;  1JGG A;  4B8X A;  2DA3 A;  2WAD A;  3Q3S A;  4CXF A;  3F22 A;  3JRC A;  1MH3 A;  4KT6 A;  2R92 J;  2W48 A;  1FOK A;  1TWG J;  3LFK A;  3OYE A;  1TBX A;  1U5T B;  4RS8 A;  4YEL A;  2IA1 A;  1MIJ A;  3OYC A;  1UAA A;  1MKM A;  2TCT A;  3ISP A;  1UHM A;  5JHF A;  2L02 A;  2Y31 A;  3EQL F;  5AIP A;  2DMP A;  1SFU A;  5F64 A;  1AOY A;  4RAG A;  2QVO A;  2XVC A;  3QP6 A;  1SC7 A;  4M71 A;  2JA8 J;  4IHW A;  2D2W A;  3D5L A;  5IYC J;  1QZY A;  5LLQ A;  3BPX A;  1SD5 A;  1TT5 B;  2JVH A;  3OYB A;  2H1K A;  4LIU A;  3R6S A;  1RC9 A;  3QQA A;  4HPQ A;  4II3 A;  4L9J A;  4MQ9 F;  2DT7 B;  1OCP A;  5HS9 A;  1D1A A;  3E6C C;  5CVV A;  4U7D A;  1Z7U A;  5CVJ A;  2NVX J;  1FZP B;  2FQ4 A;  2HI3 A;  1IF1 A;  1O3S A;  3R60 A;  2K86 A;  3D5R C;  4KN4 X;  5L3G A;  4B48 A;  2LRE A;  3FDY A;  4BXF A;  3JSO A;  3H5R A;  4HV5 A;  2E71 A;  2ADU A;  3FBN B;  3HZJ A;  2LK2 A;  3LSP A;  4XSX F;  2DMQ A;  1XSV A;  1EJ9 A;  2ZME B;  2BYV E;  3K70 D;  3F23 A;  2ACJ A;  5CKT A;  1N77 A;  3M07 A;  2IS1 A;  2ECC A;  2Z16 A;  3LSK A;  2HYG D;  2R7F A;  2ZSI B;  5JR3 A;  3VB2 A;  3V8K A;  3CLQ A;  4L5J A;  4JK1 X;  3WTX C;  2V9V A;  3CMA I;  5ICF A;  1MDM B;  3S93 A;  6PAX A;  3GTL J;  3KP7 A;  1EH6 A;  5ED4 A;  4PDK A;  1WHU A;  4Z2Y A;  1ZRC A;  2LBF A;  4HOB A;  3ESW B;  4ZYE A;  3CCQ I;  2CUJ A;  3M9A A;  2KQR A;  3HGG A;  3AFH A;  4DYR A;  2XPU A;  2Z2S B;  2ZFU A;  1WKM A;  2LOO A;  5EDN A;  2R5Z A;  1Y6I A;  2FU4 A;  4BGD A;  1JI8 A;  1SFX A;  1WH7 A;  3EYY A;  2O8X A;  4ZC3 A;  4XSZ F;  5M5Y J;  2ZJP F;  3ZQF A;  2KZG A;  2G0E A;  2DK5 A;  1SAU A;  4JQF A;  5GTH C;  2OQG A;  3HUG A;  1A5J A;  2FML A;  3MZY A;  1O7F A;  1B8I B;  1S5L C;  4KN7 X;  4WXC A;  1BA5 A;  3P7N A;  5EJC A;  4XLP F;  3DCF A;  2KZV A;  4P5O A;  4M74 A;  1J0R A;  2OJE D;  4YRV A;  1TWC J;  2ZXI A;  4BXX J;  3GO5 A;  3GZ6 A;  1ETX A;  2RNJ A;  3HPH A;  2K9Q A;  4GYG A;  2M34 A;  3TDZ C;  2O0Y A;  2B63 J;  3ZR8 X;  1HSJ A;  1Z21 A;  2NNN A;  5L3C A;  1T0F A;  5F27 A;  2XHK A;  4B43 A;  4CYC B;  4KIT B;  2K4B A;  1BM9 A;  4A0Z A;  1FP1 D;  3S8P A;  1H89 C;  3VSK A;  2JPB A;  2X48 A;  5L3E A;  2EQR A;  2G7H A;  1IRZ A;  3KP2 A;  3LWF A;  3WTS C;  3S2D J;  4F93 B;  4B4C A;  5BNG A;  5FRO A;  3KEQ A;  5JI6 A;  4HDV A;  3RKW A;  2HGC A;  2LLK A;  3AG3 H;  2HXO A;  3GLX A;  3RPQ A;  1QVU A;  1SD7 A;  1HDD C;  3GME A;  3IP4 B;  2UXN A;  4ON0 A;  1TTY A;  3PQK A;  4IEJ A;  4QPQ A;  3TO6 A;  1Y1V J;  4BJT A;  4XKB A;  3IAS 2;  2LKX A;  4R8H A;  1U5T A;  2DCE A;  4D1Q A;  2VPR A;  5DDG A;  2XAH A;  3DWL E;  2DJN A;  2Y0M A;  2L2O A;  2IW5 A;  2XF7 A;  2Z33 A;  1OQY A;  2EIN H;  3BC8 A;  4C2M J;  4A69 C;  2DOE A;  1N78 A;  1DPU A;  3CDH A;  2WWY A;  2V1X A;  2ME0 A;  2XAF A;  2COM A;  3EUH A;  3HC7 A;  1K7A A;  2MW8 A;  2RRE A;  2NVQ J;  2RGV A;  1X58 A;  2X0L A;  4MFE A;  2M5W A;  1PDN C;  3DF8 A;  4P55 A;  2IEK A;  1QZE A;  3QPL A;  3ZPL A;  1LNW A;  4A3M J;  4HG2 A;  1FYM A;  2V1U A;  3RQ4 A;  2L9R A;  4A3L J;  1R4M B;  2GLO A;  2JMW A;  3Q0U A;  3BR3 A;  2DOA A;  2NAZ A;  1A6I A;  4XRS G;  2LG4 A;  1W0T A;  5JVT A;  4ENJ A;  5IP6 A;  4ZDL A;  1FYL A;  1NH3 A;  2HVQ A;  4L9V A;  3QPT A;  1S8N A;  4I2O A;  4PCQ A;  4E7K A;  3JSP A;  2YS9 A;  3ZMS A;  5DS9 A;  1VQ7 I;  1P92 A;  3I64 A;  2DYS H;  3FF5 A;  4PSW A;  2Z1D A;  4BEH A;  2CJJ A;  1R4N B;  2JA6 J;  4HX4 A;  3IH3 A;  3DEU A;  2ZME A;  3DLL F;  2R7U A;  1FOX A;  1UZC A;  1W1W E;  3H5N A;  3DTI A;  4AM3 A;  2QQ9 A;  3FHZ A;  3J80 K;  3W2V A;  1R49 A;  5GAE J;  3OY9 A;  1I39 A;  4M3D A;  1IN6 A;  3SXY A;  2PQ8 A;  4BUP A;  2WAF A;  2F2E A;  1D5Y A;  2DQR A;  1SAX A;  2HR3 A;  1WJB A;  1UG0 A;  4XRM A;  1MBH A;  1WFX A;  4IJA A;  2MD5 A;  1RET A;  2A5Y B;  4KT5 C;  3LSG A;  1BR1 A;  1YW9 A;  5ERI A;  1ZGJ A;  1IN7 A;  3A02 A;  1Z6R A;  1SD6 A;  2QGU A;  5H20 A;  3OYK A;  1WJ5 A;  2H27 A;  2JUC A;  3JCU C;  4BNC A;  1XN7 A;  3CZ6 A;  2NOG A;  3FXQ A;  2E36 A;  4PUS A;  2NS0 A;  4AIK A;  3DTE A;  1JT6 A;  1JKQ C;  1XPX A;  5FRM A;  2W85 A;  4EJU A;  4IRG A;  5BPI A;  4HNU A;  2VBZ A;  2UZK A;  2JA2 A;  2IVM A;  3CC7 I;  3D0S A;  1SVL A;  1ULY A;  4E70 A;  1H88 C;  1B8I A;  3M1E A;  2ZJR F;  1A6Q A;  4Y4R A;  3JRH A;  2BZT A;  3I53 A;  4BY1 J;  1P7J A;  4R1H A;  1IN5 A;  3H5A A;  3IHU A;  3RKX A;  3C2B A;  3CCE I;  1Y8Q B;  2ZNY A;  5H2F C;  3KP5 A;  2C6Y A;  1R7J A;  3LSR A;  3BT9 A;  3HOV J;  2VJ5 A;  4O6J A;  1BR2 A;  2GOM A;  3G1M A;  4A3J J;  2X6O A;  4U0W A;  3CME I;  4OIO F;  2EA2 A;  1O3R A;  1QBJ A;  3F8F A;  4CCM A;  5EZG A;  4CYC A;  3CF5 F;  2EWN A;  1VQO I;  1NG7 A;  4KA4 A;  2ZXW H;  4IHS A;  2UWM A;  3IH4 A;  1WH5 A;  4M6V A;  3JRF A;  2HVS A;  3R0J A;  2Y48 A;  4N0B A;  3BQZ A;  2DFF A;  2PMZ N;  4DQ2 A;  1P2F A;  3LSH A;  1YQA A;  4MLO A;  4XN0 A;  5CJ9 A;  5J1U A;  3J7A O;  4C3H J;  2XGE A;  4V2G A;  2FRH A;  1JKR C;  5E1X A;  2E5Z A;  1VF9 A;  1I5Z A;  2M1B A;  4C3I J;  2AS5 F;  2QA4 I;  2KHM A;  3GVA A;  3QYB A;  5F1J A;  3B6C A;  2O7O A;  3L00 A;  3JAM K;  4IXA A;  1FMW A;  1L3L A;  2EIL H;  1XMK A;  2FX0 A;  4XON A;  5BS6 A;  4EM0 B;  2LFB A;  2HDW A;  4MTE A;  2IS6 A;  2HTJ A;  2DMT A;  5KHD A;  3T5X A;  2HZT A;  5E8G A;  1L0O C;  1WQ2 A;  4A6D A;  3ML6 A;  1EV7 A;  3M4O J;  3ABM H;  3F9K A;  2VXD A;  2YUS A;  2PMH A;  4I76 A;  1V54 H;  3WG7 H;  1OMI A;  4DOZ A;  2W4S A;  2J5O A;  3M3Y J;  1T39 A;  3OYF A;  3DBR B;  4ABZ A;  1LE8 B;  1DP7 P;  1QPI A;  2CQ7 A;  3WTU C;  2P7C B;  2IJL A;  3SFI A;  3F8M A;  2LY2 A;  1J9I A;  3S1Q J;  3H0D A;  1WVR A;  5J4Y A;  2STW A;  4HNT A;  1P7I A;  4D7N A;  2PLY A;  4KYW A;  4IHT A;  1X1P A;  3VYR B;  5IP9 J;  2PBI A;  3A1Y A;  4LIT A;  3K70 C;  4LB6 B;  4BAC A;  4KMU X;  5M3F J;  1GXP A;  1RKW A;  3W2A A;  3TO9 A;  2P8T A;  3PIP F;  1LFP A;  2GXA A;  1IN8 A;  2DYR H;  4JX4 A;  2D45 A;  2V9K A;  2NS8 A;  2LTP A;  5J8F A;  2ICW G;  1KU7 A;  3UKG A;  4RAF A;  1TC3 C;  3TMO A;  3RPU A;  3V4G A;  1VTN C;  2CUF A;  2DK8 A;  2AQE A;  2X6W A;  3I5U A;  4ZYH A;  1PYV A;  3OS0 A;  4D5F A;  3CF2 A;  3M8E A;  4OOI A;  2L9N A;  2ZCW A;  1D0X A;  3OL4 A;  4ENN A;  1K4S A;  2XV4 S;  4AID A;  4HZF A;  1QPM A;  3LA7 A;  4HX7 A;  2FSW A;  3P5J A;  1LEB A;  2E35 A;  1POG A;  2ID3 A;  4JBA A;  2TDX A;  1X2M A;  1IUF A;  2XAQ A;  2STT A;  3I59 B;  1EF4 A;  1IXS B;  3WTW C;  4EGY A;  1S6L A;  5HLT A;  2VAS A;  1ZQ3 P;  2XIG A;  2GIZ A;  4FIS A;  2QSF X;  2VKH A;  3OS2 A;  4N4N B;  3L2C A;  3QAH A;  1REP C;  4LFU A;  2OZ6 A;  5GAH J;  4M9Z A;  3RQI A;  2JN6 A;  2VBX A;  4FQG A;  3LSM A;  2CG4 A;  2K4J A;  3OR1 C;  3MFK A;  3ELK A;  2HOE A;  4BL0 B;  1NHA A;  4QIW N;  1O57 A;  2MSY A;  3BG7 A;  4ITV A;  3BG5 A;  2Q8K A;  5DYM A;  2XAS A;  1TNS A;  2LRD A;  4XKW A;  2K3F A;  2M8E A;  2MLG A;  4GXO A;  2QQA A;  3BZ6 A;  3BWG A;  5LHH A;  2R7R A;  1PUF B;  5ICC A;  3ZCO A;  1SMY F;  3E3V A;  1R9T J;  3OOP A;  4Q48 A;  4Y13 A;  5HOO A;  4MQV A;  2M0M A;  5D6F A;  3L1P A;  5GP9 A;  3K1N A;  3VWB A;  3TW7 A;  1KYZ A;  2K27 A;  5J8C A;  5LGT A;  3ABU A;  3ASN H;  2NRA C;  3CUQ C;  3ASO H;  2DT5 A;  2DTZ A;  5KVR A;  3K69 A;  1H0M A;  2V1N A;  4F52 A;  3CCM I;  3HL2 A;  4KNY A;  2M4G A;  2JTV A;  5BMZ A;  3PUB A;  3RIR A;  4U0Y A;  5FKO A;  5KK1 A;  1IRF A;  5B1B H;  2HNH A;  4I0B A;  3ULQ B;  5KCM A;  1Y1W J;  4RMN A;  2DW4 A;  1HC8 A;  2PI0 A;  2L7F P;  2ZBK A;  3SEQ A;  1R6R A;  1OYY A;  2CUZ A;  4FAS D;  1MJ9 A;  1YHQ I;  1X1C A;  3HPG A;  1PVE A;  4UUS B;  4F91 B;  5CPR B;  2EH3 A;  1W5S A;  3KP6 A;  2BY0 A;  1PUE E;  2DMN A;  1QU3 A;  1V5G A;  5K1Y A;  3CJR B;  2CQN A;  4IRI A;  4FCY A;  2DLL A;  4Q47 A;  4ENM A;  1GXQ A;  4OIP F;  1LE8 A;  2K40 A;  3BY6 A;  5ILU A;  4IKF A;  1SFK A;  1P9Q C;  4I7H A;  3J7Y J;  2D5V A;  2PMZ A;  3BCB A;  1XGS A;  1U3E M;  3QOD A;  1DPR A;  4A3B J;  4CCL A;  1DGR M;  2LYC A;  3OWT A;  1YRN B;  3J81 K;  2OV7 A;  5EF6 A;  2BHY A;  2OCC H;  3L09 A;  2GBY A;  2Y9Z A;  1F43 A;  1MMG A;  2F6C A;  5TRD A;  3Q0W A;  4UV9 A;  4BQO A;  1JE8 A;  3ZGK A;  5E3L A;  3HEF A;  3OIO A;  4E7L A;  2H8R A;  1AA7 A;  4C2U A;  2ZSH B;  4MNU A;  3E7L A;  3G1L A;  4X1E A;  4BHC A;  1Q1H A;  2FBI A;  2YPR A;  2GAU A;  2KIS A;  3QYE A;  5D8K B;  1TQP A;  2DJI A;  3PIO F;  2HDC A;  5J1R A;  3S3N A;  4HW0 A;  4G94 A;  4HDU A;  1UMQ A;  3ABT A;  4RM2 A;  3OMY A;  2HQA A;  1MSE C;  3GFJ A;  4G6D A;  1IUY A;  2NS7 A;  1G6N A;  4F3Q A;  3K7A J;  4AWX B;  2H1L A;  3ZMD A;  3EET A;  3GCM A;  3JW4 A;  2M7B A;  2HYJ A;  1XTA A;  4MGR A;  1ZG3 A;  3HJE A;  4B47 A;  2O3F A;  4ASN A;  1KYW A;  1UHS A;  3RCO A;  1SVO A;  3HYI A;  2WV0 A;  1SAN A;  5LEJ A;  1UEL B;  3L2V A;  5M5X J;  3MWM A;  1GHC A;  1K6Y A;  4FE7 A;  3I9V 2;  3HG9 A;  4QWQ A;  3V7S A;  4A0X A;  2HEO A;  4L5E A;  2B7E A;  4EJV A;  4GO1 A;  5M5W J;  2VXZ A;  3W3C A;  3RJP A;  2ZB9 A;  4LG0 A;  3RZD J;  4HNV A;  3AKZ A;  3OV8 A;  1ZKG A;  1PP7 U;  2CH0 A;  3O3K A;  4GRI A;  3IAM 2;  2ZC2 A;  1OCC H;  4L5I A;  3X2Q H;  3C1D A;  4ESJ A;  1EH7 A;  4BJ5 C;  1QHG A;  2XAJ A;  1JTY A;  3BJ6 A;  4IX7 A;  2ID6 A;  4HYE A;  4UHT A;  2LD5 A;  1Z9C A;  1U8B A;  3K6G A;  4AYB A;  1ETV A;  2IS4 A;  3W6V A;  2DOF A;  3REO A;  1PUF A;  2EV0 A;  3JAM Z;  5DV5 A;  4C9Y A;  1S9H A;  4AUX A;  2XRO A;  1AU7 A;  1SFO J;  3IRQ A;  2WAE A;  4GYI A;  1G8X A;  1R36 A;  3OSG A;  2OAZ A;  5D8L B;  3QWL A;  4U0V A;  2EZL A;  5B3S H;  4PGG A;  1T38 A;  1K83 J;  2RKH A;  4A6E A;  1VQ4 I;  4PJM A;  4NB5 A;  3I4P A;  3GUD A;  3BZK A;  3FKJ A;  5J4V A;  4BQQ A;  3K4M A;  3LOC A;  2OTJ I;  4CA0 A;  5J1Y A;  1B72 B;  2DO7 A;  3H9G A;  4XRF A;  3KFW X;  4C30 A;  4EQQ A;  3CC4 I;  3H36 A;  3HOU J;  3CLO A;  5A2Q Z;  1ENH A;  5JFR A;  3TOA A;  4R79 A;  2FNP A;  5IT9 Z;  1CF7 B;  2HPM A;  2JPC A;  2R7Z J;  2FA5 A;  3ZQH A;  3COA C;  5CLS A;  5E8I A;  1FBU A;  3PQJ A;  3S1N J;  1HW5 A;  3AG1 H;  1HST A;  3O8G A;  4G12 A;  4RA2 A;  2VKE A;  3DBL B;  2WB1 A;  4UUS A;  4V2F A;  5LRS A;  1ZR2 A;  3DPT A;  3SHF A;  3KYL A;  1D1C A;  5TJJ A;  1FIP A;  5D4S A;  1XMX A;  2HQR A;  4C3J J;  1R71 A;  2OCE A;  4JYK A;  3WHC A;  3CJT B;  1LVA A;  1DU6 A;  3S1R J;  2AQF A;  1V5E A;  2HU9 A;  4C2T A;  2E5N A;  1V55 H;  2V4J C;  1UHW A;  3IWF A;  4YIR X;  1RR8 C;  2V7F A;  2JT1 A;  5L3D A;  4IRH A;  3CTA A;  3OYL A;  1OR7 A;  4NBQ A;  3KYC B;  3FIW A;  4A3K J;  1VFC A;  2M9H A;  2YX4 A;  1YRN A;  4PJL A;  1HXD A;  2R4G A;  3TOB A;  1EA3 A;  5DM6 F;  2CFO A;  2EFQ A;  4L9T A;  4MO7 A;  3PNT A;  3K2Z A;  4BBR J;  2HKO A;  4A93 J;  3A03 A;  3PFY A;  1HBX G;  3LMM A;  3KET A;  3I56 I;  2Z3Y A;  3BR0 A;  3Q9V A;  2FF4 A;  1QA6 A;  3G3Z A;  2CQK A;  2P0W A;  1AHD P;  2H8W A;  2QSH X;  3BJA A;  3ZRG A;  3FM5 A;  5FLX Z;  1FEX A;  2CW0 F;  1FT9 A;  2K5C A;  2GZW A;  3RYR A;  1ZRE A;  4YIF A;  3PO3 J;  3CUO A;  2K9N A;  5DD8 A;  2GXB A;  1BC8 C;  2XSJ C;  2KIU A;  2EZK A;  2ZFW A;  2FEZ A;  3KIO A;  1R5I D;  1RZ4 A;  2FOK A;  3Q0V A;  5BOX A;  2I10 A;  3N4M A;  1MBK A;  1APL C;  5GTI C;  1WCM J;  4YFX F;  2R93 J;  2Y69 H;  3DPL C;  3F6V A;  4E7S A;  1IGN A;  2OA4 A;  1WRJ A;  3MCZ A;  2KRF A;  3QU3 A;  4Y33 A;  4CYD A;  1FLI A;  4PK4 A;  4KFC A;  1SVM A;  5DTD A;  1ZN2 A;  5LHG A;  3CUQ B;  4IQ4 A;  3BTL A;  3AG4 H;  3CES A;  2E2J J;  5AIQ A;  4LIV A;  3ONQ A;  1FYK A;  4A2U A;  3BRO A;  2QSG X;  2GOX B;  2HOT A;  2CMP A;  3I58 A;  4X0G A;  1VQ5 I;  3JRB A;  5K5Q A;  3C7J A;  3FXK A;  1E0E A;  5E1W A;  2QZ8 A;  2KDZ A;  3KEY A;  4A3E J;  5LRR A;  1G59 A;  3J7Z I;  2HPI A;  1ETW A;  1MMD A;  2DA5 A;  1FX7 A;  3HSR A;  1TQM A;  1ZTR A;  2CYY A;  4LG3 A;  3GFI A;  3I55 I;  1LDJ A;  2EFP A;  1K6O A;  1BI1 A;  3GXO A;  4HF2 A;  4OIQ F;  1XB4 A;  4ETS A;  1WSU A;  3A2K A;  2EIK H;  3U21 A;  2V79 A;  2Y2Z A;  3VDX A;  3N05 A;  3VYS B;  1X19 A;  2QYO A;  2PN6 A;  2CV2 A;  5FRN A;  1AWC A;  2A6T A;  1MD0 A;  3ZQ7 A;  2L5Q A;  5HNH A;  1V3F A;  5HDG A;  4L18 B;  1FSE A;  3OOU A;  4AC0 A;  3KZY A;  4BE0 A;  3FM3 A;  4Y3O A;  1JTX A;  1B72 A;  3ZMU A;  5LGN A;  4HX8 A;  3J7A Y;  4A3F J;  2DA2 A;  3SZT A;  5E3N A;  2IS2 A;  1YIO A;  3MZH A;  2L01 A;  4LLG F;  3IV5 A;  3WGG A;  4XLE A;  1IV8 A;  3I54 A;  1OCT C;  4A3G J;  3TBI A;  3J81 Z;  3H1C A;  1STZ A;  1X3W B;  3NAR A;  4DJA A;  3TP0 A;  4E7J A;  4OAY A;  1IW7 F;  3E97 A;  3D1N I;  3LFU A;  4F7Z A;  3MZ8 A;  2EV6 A;  4AU7 A;  1NK2 P;  2NNY A;  2XF6 A;  4NHJ A;  3DKW A;  4D9J A;  1IJW C;  2ELK A;  4NC7 A;  1FSH A;  1RKT A;  5IOY A;  3FIS A;  1S7A A;  4BDY A;  2E34 A;  1OKR A;  2IP2 A;  2Q2E B;  1JJ8 C;  1VQ6 I;  3BG9 A;  4XLN F;  2COB A;  2R0Q C;  2JRT A;  2ZKZ A;  3A01 B;  5HS8 A;  1FTT A;  2F48 A;  2GWR A;  1G3Y A;  3HGY A;  3HKZ N;  4M72 A;  2VC1 A;  4CUG A;  4I6Z A;  4ZTF A;  2W00 A;  2YR2 A;  2DDA A;  4AD9 A;  1Z3X A;  5LHI A;  5FFZ A;  4DYC A;  2OF7 A;  2H6C A;  3P9C A;  2YU9 J;  1E3O C;  2L7Z A;  1ITY A;  4EJO A;  3E1S A;  1HDP A;  2DA7 A;  1XD7 A;  3H3U A;  3JTH A;  5IYB J;  3SFZ A;  3CCR I;  5J6X A;  3R61 A;  4D7M A;  1MDM A;  3DQV C;  4RGS A;  1MBG A;  4XLA A;  3U2R A;  1ONV A;  4F92 B;  2X1C A;  3HTU A;  3NWS A;  5E3M A;  1F1Z A;  4XRS A;  1ON2 A;  1YX5 A;  2RQQ A;  5C3E J;  3HOT A;  4HF0 A;  4UUT A;  1X3Z B;  2IT0 A;  3E6M A;  1Y39 A;  2KMU A;  2EPF A;  1ZH5 A;  3KZI C;  2QEN A;  2XUB A;  1ZAO A;  1D8J A;  4I0A A;  2VIX A;  3EUA A;  1I1G A;  1RNL A;  1YJN I;  1TNT A;  3V42 A;  1VQN I;  1JJ6 C;  5DCM B;  4HEA 2;  2NOJ B;  3ZQG A;  2XF5 A;  1KON A;  2AHQ A;  2EIM H;  3FMR A;  3QPH A;  2D1V A;  3PNV A;  3CUQ A;  4K2E A;  3M8J A;  2V1D A;  3FXJ A;  4UV8 A;  4OU0 A;  2E1M C;  4ZYG A;  2EV5 A;  1W36 D;  2FQ3 A;  2DTR A;  2D1H A;  5CVR A;  1A04 A;  4BE1 A;  3W6K B;  1LDD A;  1RRJ A;  3BJO A;  3LQR A;  1MNE A;  2QUF A;  2W84 A;  5GAG J;  5GPC A;  4IZZ A;  4UB6 C;  4WF2 A;  1XGO A;  3PSI A;  2F5V A;  1YS7 A;  5ILV A;  2HWV A;  1Z67 A;  2OPT A;  2BVL A;  1G3S A;  3WTY C;  2CWE A;  3MEX A;  1KGS A;  1A36 A;  2PJP A;  1OCO H;  1W5T A;  5IY5 H;  4E7I A;  2XAG A;  1TL8 A;  3RPU D;  3V8J A;  5E1Z B;  1Z1D A;  3NEU A;  3SJM A;  4I02 A;  3CCL I;  2XAU A;  4WX9 A;  3TDU C;  1TLH B;  3ZN1 A;  2QF7 A;  4FX0 A;  2V9P A;  4HA8 A;  4BKX A;  1I6X A;  2DA6 A;  1QNT A;  4FHT A;  3LST A;  1YW7 A;  2I5U A;  4RDU A;  1OFC X;  1BW5 A;  1ZHF A;  2FD5 A;  3HHG A;  3ZXS A;  3NWT A;  4AVP A;  2DPD A;  4UVB A;  1ODD A;  1MSF C;  2ZJ2 A;  4L0Z B;  3GLL A;  2NVY J;  2NXN B;  2PX9 A;  1VQM I;  3GF2 A;  4ZDP A;  4XK4 A;  2MD0 A;  1J5Y A;  1JUS A;  3RZO J;  4LD5 A;  2L0K A;  4HV6 A;  1XGM A;  2M8G X;  3DKY A;  1BBY A;  2HYF A;  4WCG A;  3CCS I;  3R4K A;  2JRM A;  5EZH A;  2HVR A;  3S14 J;  1FNN A;  1T08 B;  5K7F A;  2EZH A;  2ZXH A;  4P9U A;  3JRI A;  1XMA A;  4KUM A;  4OIR F;  5A2Q K;  2W7N A;  3B6A A;  5IT9 K;  5EEA A;  2L4M A;  4BS9 A;  1SMT A;  3A0B C;  1LVK A;  1T0F C;  2GQQ A;  2WAQ N;  1QVT A;  3OIQ A;  3S3O A;  4M3E A;  3FK6 A;  2BY3 A;  3U1K A;  1YLF A;  5DM7 F;  3A01 A;  2Q1Z B;  1MZB A;  3V7R A;  1AKH B;  4Q5S F;  2E1N A;  2XC7 A;  1VI0 A;  5LEK A;  5HS7 A;  2F5D A;  2H6B A;  1QZZ A;  1BR4 A;  2IAI A;  2E2I J;  1LFU P;  2B9S A;  3MKY B;  1LPQ A;  1ETK A;  3VYT B;  4D0P A;  1N25 A;  2Y9Y A;  3I4N J;  2RQP A;  2G9W A;  3UR3 C;  4CCK A;  4EM2 A;  5HNF A;  1HKS A;  1KU9 A;  5IT3 A;  2K02 A;  1F9N A;  5BQT A;  1XGN A;  2KIM A;  2PJR B;  3LAP A;  1RUN A;  1T8I A;  1YTY A;  1GT0 C;  1K61 A;  1HCR A;  3RKY A;  3CCU I;  3TGN A;  2X1D A;  2FJ1 A;  2VN2 A;  3EUH C;  1UJ8 A;  1MMA A;  3OYA A;  2DXI A;  1T33 A;  3BLY A;  4H4K C;  3GX4 X;  1O4X A;  3GTK J;  1IAW A;  3K4C A;  2JA7 J;  1T56 A;  3H3Z A;  5FLX K;  4ENK A;  2VOO A;  5DUK A;  4XMY A;  3HRM A;  2QM3 A;  4XBF A;  3F8N A;  3GTQ J;  1JGS A;  2VOD A;  3WU2 C;  5DCM A;  4MHG A;  1P4W A;  1XDU A;  1FOW A;  3C18 A;  2Z9O A;  1R5H A;  1UCR A;  3CDI A;  3E5Q A;  3BR1 A;  4M3F A;  4BHP A;  2VC0 A;  3NRV A;  3KLO A;  1QGP A;  4G7O F;  1BW6 A;  3BQY A;  3HRU A;  3RTR A;  2LH9 A;  4CCN A;  4DNC A;  3A4C A;  2EFO A;  1YO5 C;  1TWH J;  1A35 A;  2I8D A;  3VPR A;  1IO2 A;  2MFZ A;  3BR5 A;  3HOY J;  3C2H A;  5CYV A;  4BYY A;  2CQX A;  2H94 A;  2XB5 A;  2IPQ X;  2XGC A;  2K9L A;  1OYW A;  2LR8 A;  2MH9 A;  3WTT C;  2P5K A;  3MQ0 A;  5F04 A;  1BJZ A;  3H3V K;  3E5X A;  2MAB A;  1BIA A;  2AXL A;  2ZME C;  2ZO4 A;  1N75 A;  2LF7 A;  3FMS A;  1IDY A;  3BZC A;  1LUJ B;  2HKX A;  4ESF A;  1Z05 A;  1Z77 A;  1V4R A;  2LP0 A;  4XOP A;  4ZYD A;  3ZMV A;  3BOQ A;  2LKP A;  2VT2 A;  4XKC A;  1WI3 A;  2ZJQ F;  2V6E A;  5EYR A;  2X51 A;  2EB7 A;  3MKL A;  3G2B A;  3DFG A;  2DDB A;  1SFE A;  2GXG A;  5LD2 C;  1MNM C;  3S2W A;  1G4D A;  3SZG A;  4S0H B;  1KQ9 A;  4YFN F;  1DQU A;  2FOW A;  3CP2 A;  3MD2 A;  4KDP A;  1EH8 A;  3HXL A;  3MN2 A;  5DCF A;  5TGT A;  3AL0 C;  1TQI A;  2Y75 A;  3FK7 A;  4JX6 A;  2O6G E;  1W4M A;  1Q1V A;  1SEU A;  1T95 A;  5F6F A;  2X6X A;  5B1A H;  1W7P B;  2DI3 A;  4G8X A;  4JP0 A;  1VQ8 I;  4LGW A;  5F0C A;  1ZG1 A;  2MBF A;  4CSW A;  1U2W A;  3IRR A;  2ESH A;  2WV1 A;  3QU6 A;  3Q9S A;  4YII A;  2VLA A;  2F4O B;  3O8H A;  3U1D A;  3FXR A;  1B6A A;  3OSF A;  4EJT A;  2DFE A;  1MND A;  4GDF A;  4RM3 A;  3DU5 A;  1JHF A;  4YEJ A;  4BE2 A;  3BTI A;  2V6C A;  2OD5 A;  2HS5 A;  1ZGW A;  5F08 A;  2ME6 A;  4ANJ A;  2QKL B;  1RES A;  4LOC A;  3AAF A;  2X1E A;  4KJZ A;  2VUM J;  4FET A;  5JLW A;  2VKD A;  4PFO A;  2QLZ A;  1MBE A;  3QP5 A;  3L7W A;  1AKH A;  1T6S A;  2HQ5 A;  3ERM A;  3QYF A;  4HLX A;  2HOA A;  2P7V B;  1U9O A;  1YX3 A;  4CZZ A;  5K5R A;  1J75 A;  4XLC A;  4RLQ A;  3MMY B;  4LK1 F;  5D6E A;  4B44 A;  4DBQ A;  3IKV A;  3DXJ F;  4YG2 F;  5CVI A;  2JA5 J;  2IGK A;  3E6D A;  3TP3 A;  3WOD F;  5LFA A;  4N4O B;  1XDS A;  2LMD A;  2PJR A;  2NVT J;  2DA4 A;  4XLH A;  4HQM A;  1T2K A;  2O5R A;  1U0J A;  3EDP A;  3QRF F;  4KIF A;  1JUP A;  2F4I A;  2R7D A;  2WAQ A;  5FJ8 J;  4S05 A;  1M1E B;  3BDD A;  2LF8 A;  3I59 A;  2W25 A;  1MMS A;  3DTK A;  1A31 A;  3GTM J;  1ON1 A;  3C3W A;  3T0Y A;  2PEX A;  4DBR A;  1ETY A;  4D5C A;  3VYU B;  4ZZL A;  1LQ1 A;  1W36 C;  3ZP5 A;  1YOV B;  3K2A A;  2M30 A;  3M8F A;  2OQR A;  2QKM B;  2VJI A;  2O8K A;  3KE2 A;  3S15 J;  1QO0 D;  2R5Z B;  2VJ4 A;  3CO7 C;  1W5C C;  2VBY A;  2IA0 A;  1F4K A;  1HKT A;  5LGU A;  3K4N A;  1R5G A;  3RKQ A;  3LA3 A;  3S16 J;  3FXL A;  1YE9 A;  1P4A A;  3WU0 A;  1D0Y A;  3H35 A;  2P6S A;  5HLH A;  4B09 A;  1IRG A;  1WPK A;  3DEW A;  2KRC A;  4QSH A;  2QBY B;  3TL4 X;  4S04 A;  3ZMT A;  4I01 A;  4XLF A;  4NUB A;  3WTV C;  4KIC A;  1Y0U A;  2XRL A;  4WXH A;  3CC2 I;  3DV8 A;  2WBM A;  1I3Q J;  4PSX A;  2MGQ A;  4EV0 A;  1UG2 A;  2OC6 A;  1F36 A;  3FMQ A;  4FTH A;  5JLX A;  2MLK A;  1OPC A;  3PFI A;  2P5L C;  4G6T B;  1F5T A;  2VQC A;  2LY9 A;  3KPH A;  4RGX A;  4B1R A;  4M9X A;  2WY7 Q;  4LK0 F;  1ZGA A;  3LNQ A;  4XM3 A;  3CD6 I;  1BJA A;  1S29 A;  2EZI A;  1J09 A;  2ESN A;  2LVS A;  4A12 A;  2E60 A;  1FMV A;  2VJJ A;  2GA2 A;  3WE3 A;  2BXZ A;  4BY7 J;  4BBS J;  2JUG A;  1WJC A;  2P6T A;  3CQZ J;  1U6G A;  3B73 A;  5D5X B;  4RGR A;  4GCV A;  2L9S A;  3KLN A;  4GGG A;  2E7X A;  3BCA A;  3RYP A;  4CIC A;  2CSO A;  3G1O A;  3F8B A;  4BU2 A;  1W7P A;  2ZNZ A;  2BXY A;  4UY8 I;  3W6J B;  4A5N A;  2XGX A;  3CDL A;  3HM5 A;  3GTP J;  4IOA F;  3SQN A;  2CW7 A;  1NK3 P;  3HSF A;  3V8L A;  2MC3 A;  1QRY A;  2XPW A;  5M3M J;  4HRI A;  5ICE A;  5B5E C;  2WY8 Q;  4RB1 A;  3S17 J;  2L7K A;  4TV7 A;  1WZ2 A;  4A3D J;  2GA1 A;  2M4K A;  1UST A;  1I6H J;  1Y8R B;  1BN5 A;  4U87 A;  3ZQI A;  4PJJ A;  1S7E A;  5J40 A;  5CVU A;  1YS6 A;  5B66 C;  2L54 A;  3MVP A;  1BI3 A;  3C2G A;  2RVC A;  4HQE A;  1YIJ I;  2NYX A;  3F21 A;  3QPS A;  5AON A;  3ZN0 A;  1H8A C;  2DOD A;  2FUG 2;  5HDK A;  3SYT A;  3DU6 A;  1BIB A;  1RPW A;  3OYG A;  2FBK A;  2KRH A;  1BL0 A;  3HOS A;  5D4R A;  2JSP A;  1X3U A;  1WGX A;  3CO6 C;  1MJA A;  5FFX A;  3HOX J;  5HOD A;  2VE8 A;  4PFP A;  3FHN A;  1G3T A;  4Y7N J;  1ZRD A;  3FXM A;  4ZTJ A;  2KKO A;  4E7H A;  1KA8 A;  2R5Y B;  1B9M A;  4BEH B;  4EGZ A;  3S32 A;  3JR9 A;  2A6E F;  2CS3 A;  5CQG A;  2MYS A;  3ECH A;  4CCO A;  2CV1 A;  5JHU A;  2X4H A;  4FT8 A;  2KPM A;  2BY2 A;  2E7W A;  3BR6 A;  3GFM A;  2K9S A;  1J7K A;  1I50 J;  2JZY A;  4J19 A;  3SDG A;  4RB2 C;  1XG1 A;  1KU3 A;  3GZ5 A;  2L7M P;  2X6Y A;  2R7O A;  4FX4 A;  4XR6 A;  4CGZ A;  5FO5 A;  1DDN A;  4O3M A;  3B02 A;  1KU2 A;  3IH2 A;  5ILS A;  3EYI A;  4MIM A;  1VND A;  2DT6 A;  3V7C A;  3KP4 A;  4UVC A;  3ZMZ A;  3TQN A;  1IXR C;  1HLV A;  3K4L A;  2LNB A;  1FTZ A;  3NQO A;  3P9K A;  4KIG A;  1WJD A;  2R3S A;  3VFZ A;  1FOY A;  4XKV A;  2EJR A;  2FBH A;  3AL0 B;  3ABK H;  4AIH A;  1P6R A;  4CHU A;  2V26 A;  1GV2 A;  5EEG A;  3GZN B;  5CQE A;  1HW2 A;  3PL8 A;  3CCJ I;  1C0W A;  2QBY A;  3PJR A;  1X2N A;  3FZV A;  1FIA A;  2ISY A;  4WK8 F;  2A69 F;  3E5U A;  3KZZ A;  3TO7 A;  1HKQ A;  2F4M B;  3CCY A;  4GFB A;  1RR7 A;  3PSF A;  3VOD A;  1GVD A;  3QOP A;  2E1C A;  4M3B A;  2IA2 A;  4HLY A;  3ZQL A;  2BVM A;  4UVA A;  3IC7 A;  2IGN A;  2BOL A;  4XIC A;  1RUO A;  3HRT A;  2OZU A;  2N8G A;  2BEO A;  1MMN A;  1ZR4 A;  1XC5 A;  2MA3 A;  3K4K A;  1IV6 A;  1DU0 A;  1G2H A;  4M9S A;  3BPV A;  3MAJ A;  5H6Q A;  1ZRF A;  1U78 A;  2BGC A;  1VQ9 I;  1Z6T A;  1BOA A;  2HQN A;  4WXD A;  1D3Y A;  1CF7 A;  1IZ1 A;  4HBL A;  1VQL I;  2E1O A;  2ETH A;  1FP2 A;  4DZJ A;  1OIS A;  3BP8 A;  3RSN A;  1BI0 A;  4BH9 A;  5TIS C;  4MEY F;  5FD6 A;  2VON A;  4DW6 A;  4IHV A;  2R7W A;  1S3J A;  2Z99 A;  5H6R A;  2IBD A;  2M7A A;  3CP8 A;  3T1B A;  2A6H F;  2VQH A;  2RC4 A;  1USS A;  4XNF A;  4QTR A;  4OIN F;  2XKP A;  1KZH A;  1XX5 A;  2CUE A;  3O6B B;  3KCC A;  3CMM A;  2AO9 A;  2P5V A;  3GFL A;  3CJQ B;  1HF0 A;  2GIV A;  1GLN A;  4F55 A;  4BXU A;  1TP4 A;  1UB9 A;  4E4H A;  2X9D A;  5F0F A;  1P4X A;  2AXT C;  4M6X A;  3CCV I;  2EFW A;  2XGD A;  1X4P A;  4EJW A;  2WC2 A;  4IQJ A;  2R7V A;  3RI4 A;  1Z0X A;  1NTC A;  3FKI J;  2BY1 A;  2DQL A;  1HOM A;  3CJN A;  3WGI A;  1H9G A;  4G6Q A;  1QHH D;  1X1D A;  2DMU A;  3A0H C;  3FXO A;  4EVI A;  2Y0S N;  1Y0N A;  3GW2 A;  5KNL A;  1IXC A;  1IG7 A;  1B1B A;  1DP3 A;  5E3O A;  1D0Z A;  2WA0 A;  3K0L A;  1KQ0 A;  1TW3 A;  3S2H J;  2RNG A;  3PO2 J;  2CW8 A;  1R1V A;  3HIF A;  1VZ0 A;  1FPQ A;  4HST A;  4O5V A;  5FKK A;  4WWC A;  3LAJ A;  2Z5U A;  1RIO H;  3D5S C;  2M0C A;  5LBQ A;  2R5Y A;  2CQQ A;  3GTG J;  1SD4 A;  4OAZ A;  1OCZ H;  4P9F A;  4Q4Z F;  2LSO A;  5HVQ C;  2XB0 X;  3VSL A;  4ZYA A;  3JRE A;  3PNY A;  2NVU B;  2E2H J;  3FWE A;  2Q0O A;  4PZJ A;  1MW7 A;  5KAF C;  2PG4 A;  4UNO A;  4MEX F;  2BHZ A;  2FNA A;  1JHH A;  2P81 A;  1B4A A;  2DPU A;  2ZXJ A;  3VOE A;  4J01 A;  1W0U A;  4JX5 A;  5F1R A;  1B59 A;  4P1W A;  2JQ7 A;  3VEP A;  3Q5F A;  4Y52 J;  2M87 A;  4BAY A;  4G7Z F;  2K3P A;  3E6B A;  1YFH A;  1OR7 C;  5KAI C;  1JKP C;  3E0J B;  2R7S A;  4P96 A;  2CO5 A;  5IYD J;  3IKT A;  1MH4 A;  5GAD J;  3JRG A;  3HRS A;  4HAM A;  3GEZ A;  1R23 A;  5E17 F;  3DPU A;  1Z7L A;  2L3D A;  1QQI A;  3K9T A;  4NC6 A;  2VBW A;  1B9N A;  3U9G A;  1MGT A;  1R58 A;  1XSX A;  2VL8 A;  3L2W A;  2A3S A;  3K4B A;  2IXS A;  4DYQ A;  1XSD A;  5DUI A;  4L9N A;  4ESB A;  4BHB A;  1D1B A;  4LJZ F;  2L4A A;  2O9L A;  1TW2 A;  2VKV A;  4CH7 A;  4KIB A;  4CDG A;  2VT3 A;  4JOM A;  3MKZ A;  1CQT A;  1YYV A;  3IL2 A;  1YI2 I;  2EFN A;  4YFK F;  2EBI A;  1U8R A;  2VQL A;  2YX7 A;  2BE5 F;  2DBB A;  3GBG A;  5EGO B;  3S1M J;  3IWZ A;  4CCJ A;  5L3F A;  2M45 A;  5K5O A;  1K78 B;  3GTO J;  2LDU A;  2XKO A;  3F6O A;  2A07 F;  4NQW B;  1IN4 A;  2M3A A;  5FKN A;  2UV1 A;  1FY7 A;  1YJW I;  2BV6 A;  3H0G J;  4X6A J;  2QEX I;  2KFD A;  5DEQ A;  3NAU A;  1IRX A;  4L0Y B;  4OMZ A;  3G6E I;  2VB6 A;  4KMF A;  2ELJ A;  3BTC A;  4B3A A;  2CV0 A;  2DFH A;  5FKM A;  3O2P E;  1Z91 A;  3K1P A;  3CMY A;  5HLI A;  1JT0 A;  2RN7 A;  5J3L A;  3MKW B;  3OS1 A;  3GYH X;  4KIS A;  2JJ7 A;  1D8K A;  2L9V A;  4NDL A;  1WI9 A;  3H92 A;  3G73 A;  3M7G A;  2ISZ A;  5IOZ A;  2HFH A;  3JRD A;  4I09 A;  1Y56 A;  3SDB A;  2OBP A;  3T8T A;  1H9T A;  2LC2 A;  2HXI A;  1XS9 A;  2Q2E A;  1U9N A;  4HSR A;  4A0Y A;  1X1B A;  3SEZ A;  3WTZ A;  1OJL A;  3OYD A;  9ANT A;  2HTS A;  5D5V B;  2X85 A;  3RDI A;  3LSJ A;  2IGO A;  4XOT A;  4UXN A;  1DGW Y;  4EEF G;  3GTJ J;  4ZDO A;  4QLC U;  2A61 A;  1ETO A;  4XID A;  2W82 A;  1R22 A;  1U5T C;  4RAY A;  1KQ8 A;  3DLA A;  3H9J A;  1BC7 C;  2ELH A;  4LMY A;  5K7H A;  2RDP A;  3DEE A;  2FE3 A;  4N9H A;  1ZLK A;  3HTS B;  1R1T A;  2KJB A;  2KT0 A;  4IF4 A;  4HF1 A;  1BI2 A;  1ACI A;  5FLV A;  1TT0 A;  5IPA A;  4EM1 A;  2E19 A;  4BJ6 C;  4U88 A;  5L3B A;  4M3G A;  4NC8 A;  3WU1 B;  3OYJ A;  1JUM A;  4ZZD A;  3HOZ J;  5HDN A;  2K9M A;  1O3Q A;  5J47 A;  3TKY A;  2DAO A;  4AIJ A;  2BW3 B;  4E6K G;  4H0E A;  1X1A A;  5ICG A;  2XRN A;  3F8C A;  3HSE A;  2RAE A;  5EG0 B;  4V19 K;  1I27 A;  3ZOB A;  3ZQC A;  4LLN A;  2YU3 A;  4NNJ A;  2QCO A;  2JWT A;  1VQP I;  4PJN A;  4MTD A;  3G71 I;  3PM1 A;  2B0L A;  4AYB N;  2UXX A;  3HKZ A;  4AVZ A;  1J2X A;  3HOW J;  4W97 A;  4LLL A;  2Y0S A;  1PP8 F;  3ECO A;  2JK3 A;  1TWA J;  3BR2 A;  4CO8 A;  4XL9 A;  3OYN A;  3L2U A;  3HB9 A;  2MG4 A;  1ORK A;  2YSR A;  3I0T A;  2CRG A;  3KYD B;  5FGM A;  1J59 A;  1VQK I;  2R7T A;  5C4J J;  5FB2 A;  4IPA A;  5C4X J;  1G3W A;  2JVG A;  2LKS A;  1HA8 A;  4QPO A;  4N9I A;  1X4O A;  3HBL A;  3K4J A;  4IVN A;  4IHY A;  3DP7 A;  4RB3 C;  3I3L A;  4RGU A;  3UNG C;  3BG6 A;  1TWF J;  3N97 A;  4LG0 B;  2QQ8 A;  5BPD A;  3FX3 A;  5DD4 A;  3AG2 H;  1D5V A;  4II2 A;  2JSC A;  2EA4 A;  1HQC A;  3WE2 A;  3HDD A;  2TRT A;  3FXU A;  4M73 A;  1LJ9 A;  1JXS A;  1FC3 A;  1RI7 A;  1ETQ A;  5EGO A;  4Y15 A;  2WB1 N;  3T8R A;  2W57 A;  3M1C A;  1K78 A;  4Z6Y A;  1V5F A;  3W2W A;  4UUV A;  1S7O A;  2CFX A;  1GUU A;  4DZP A;  4NQW A;  1PJR A;  1FWZ A;  3LSI A;  2EK5 A;  3HHH A;  2CU7 A;  2KL4 A;  2PFB A;  5IP7 J;  3L2Q A;  1IC8 A;  3EUK L;  3H9Q A;  1WWX A;  5F0H A;  3ROU A;  3FBI B;  1YG2 A;  3ERE D; 
#chains in the Genus database with same CATH homology
 4BU2 A;  4ZJZ A;  4XN3 A;  4XLE A;  1FMW A;  3OR2 C;  3TBI A;  2CW7 A;  4XON A;  4HRI A;  4DJA A;  2HDW A;  2IS6 A;  4E7J A;  3OL3 A;  5KHD A;  2WY8 Q;  4OAY A;  2L7K A;  1TZL A;  2M4K A;  3LFU A;  4CZC A;  4U87 A;  2R7X A;  2IGM A;  4PJJ A;  3F9K A;  2VXD A;  4AU7 A;  3KX2 A;  2XF6 A;  4EAT A;  4DOZ A;  2W4S A;  3C2G A;  4D9J A;  3OYF A;  4NC7 A;  3L2R A;  4BDY A;  3OYI A;  2FUG 2;  2HZD A;  2LY2 A;  3SYT A;  3DU6 A;  4E7Z A;  3S3M A;  3H0D A;  3OYG A;  2Q2E B;  2KRH A;  3HOS A;  1WJA A;  4HNT A;  2XDV A;  2LY1 A;  3VYR B;  4U7B A;  2E1M B;  2JSP A;  3A1Y A;  3OYH A;  4LIT A;  3K70 C;  4BAC A;  4CUG A;  4BQN A;  1LKX A;  3W2A A;  4ZTF A;  2KLO A;  1LFP A;  2W00 A;  4B3X A;  1Z3X A;  4PFP A;  2V9K A;  3K10 A;  3FHN A;  1ERD A;  3E1S A;  3TMO A;  3EPZ A;  4ZTJ A;  4E7H A;  4XQF A;  2AQE A;  2X6W A;  4BEH B;  3DQV C;  1PYV A;  3OS0 A;  3CF2 A;  4XLA A;  3S32 A;  4F92 B;  2L9N A;  2X1C A;  2CS3 A;  3NWS A;  5CQG A;  2BW3 A;  2MYS A;  1D0X A;  3OL4 A;  4CCO A;  2CV1 A;  1YX5 A;  2RQQ A;  1LDK B;  2KPM A;  3HOT A;  2MC4 A;  2KMU A;  2LBF B;  2KDO A;  4J00 A;  4DIQ A;  1Z3Y A;  1ZEL A;  2VIX A;  2X6Y A;  2R7O A;  3EUA A;  4XR6 A;  3V42 A;  2A5W A;  3ZQQ A;  2DT6 A;  2VQG A;  5HLT A;  2VAS A;  4HEA 2;  2NOJ B;  2XF5 A;  1KON A;  2VKH A;  1NG6 A;  3K4L A;  3LL7 A;  3OIP A;  3PNV A;  3OS2 A;  4RLF A;  4N4N B;  2UUZ A;  1WJD A;  3M8J A;  3HUG B;  4XKV A;  2E1M C;  1W36 D;  4DGW B;  3AL0 B;  3DKX A;  4BE1 A;  3LSM A;  2KP6 A;  2V26 A;  3OR1 C;  4BL0 B;  5CQE A;  1MNE A;  1WJE A;  3BG7 A;  3PL8 A;  4ITV A;  4IZZ A;  4BDZ A;  3PJR A;  1BOB A;  3QOE A;  3PSI A;  1WJF A;  2OUM A;  2F5V A;  2LRD A;  4XKW A;  2BVL A;  2R7Q A;  3PSF A;  2R7R A;  3ZCO A;  3IUO A;  3OYM A;  2BVM A;  4E7I A;  3RPU D;  2IGN A;  5HOO A;  2BOL A;  2M0M A;  2W1O A;  2XAU A;  4XOR A;  4OWR B;  3VWB A;  1MMN A;  2IS2 A;  3K4K A;  2VPL A;  1OLT A;  2WAD A;  2V1N A;  4F52 A;  3HL2 A;  4KT6 A;  3ZXS A;  3NWT A;  3RSN A;  2M4G A;  3PUB A;  3OYE A;  2R7W A;  4ZDP A;  2HNH A;  4YEL A;  2MD0 A;  5KCM A;  2M7A A;  3CP8 A;  3OYC A;  4RMN A;  1UAA A;  2VQH A;  4XNF A;  3DKY A;  3SEQ A;  1R6R A;  2CUZ A;  4FAS D;  1X1C A;  3HPG A;  5JHF A;  4F91 B;  5CPR B;  2HVR A;  3CMM A;  1QU3 A;  2ZXH A;  3CJQ B;  1V5G A;  1GLN A;  3CJR B;  4F55 A;  4E4H A;  3D5L A;  2W7N A;  4BS9 A;  3QYB A;  1LVK A;  1T0F C;  1SFK A;  2JVH A;  1X4P A;  3OYB A;  4IKF A;  3OIQ A;  4IQJ A;  4LIU A;  2R7V A;  1P9Q C;  3S3O A;  4HPQ A;  4II3 A;  2DT7 B;  2PMZ A;  3BCB A;  3QOD A;  1D1A A;  4CCL A;  1DGR M;  2LYC A;  3OWT A;  2OV7 A;  1QHH D;  2Q1Z B;  1X1D A;  3D5R C;  2XC7 A;  5KNL A;  4B48 A;  1DP3 A;  2LRE A;  1D0Z A;  2WA0 A;  3FDY A;  4BXF A;  1MMG A;  2F6C A;  1BR4 A;  4BQO A;  2RNG A;  3H5R A;  2CW8 A;  3ZGK A;  3MKY B;  1VZ0 A;  3FBN B;  4HST A;  3VYT B;  4E7L A;  1AA7 A;  4C2U A;  3K70 D;  4CCK A;  3UR3 C;  2ZSH B;  3D5S C;  5HNF A;  5CKT A;  1N77 A;  2IS1 A;  2Z16 A;  3LSK A;  4OAZ A;  2ZSI B;  5HVQ C;  2PJR B;  3QYE A;  2DJI A;  3VSL A;  4ZYA A;  3S3N A;  3PNY A;  2X1D A;  3EUH C;  1MW7 A;  3S93 A;  4RM2 A;  3OMY A;  2HQA A;  1MMA A;  3OYA A;  2DXI A;  2LBF A;  3BLY A;  2CUJ A;  4H4K C;  4F3Q A;  2KQR A;  4J01 A;  3K4C A;  4P1W A;  3AFH A;  2M7B A;  2Z2S B;  2ZFU A;  4B47 A;  2LOO A;  4XMY A;  3RCO A;  2K3P A;  1Y6I A;  4BGD A;  1JI8 A;  4ZC3 A;  1OR7 C;  2R7S A;  3E0J B;  1UEL B;  3L2V A;  1K6Y A;  3I9V 2;  3HG9 A;  1SAU A;  4JQF A;  3RTR A;  4CCN A;  2LH9 A;  3DPU A;  3A4C A;  1Z7L A;  2VXZ A;  2I8D A;  3W3C A;  2MFZ A;  3AKZ A;  3C2H A;  2VL8 A;  3L2W A;  2CH0 A;  2IXS A;  3K4B A;  4GRI A;  3IAM 2;  2K9L A;  2KZV A;  4P5O A;  2MAB A;  4YRV A;  2ZXI A;  1D1B A;  4BJ5 C;  1N75 A;  1QHG A;  4CH7 A;  4IX7 A;  3HPH A;  3K6G A;  4AYB A;  4XOP A;  4JOM A;  3MKZ A;  2IS4 A;  3ZR8 X;  1Z21 A;  4XKC A;  2V6E A;  4C9Y A;  1S9H A;  2VQL A;  2X51 A;  3GBG A;  2WAE A;  1G8X A;  4B43 A;  3G2B A;  4CCJ A;  4KIT B;  3S8P A;  3VSK A;  5LD2 C;  3SZG A;  4F93 B;  4PJM A;  4NQW B;  1DQU A;  2M3A A;  5FRO A;  3CP2 A;  2UV1 A;  3FKJ A;  3MD2 A;  4BQQ A;  3K4M A;  4CA0 A;  3IP4 B;  3H9G A;  4C30 A;  3HXL A;  5TGT A;  4QPQ A;  3AL0 C;  1IRX A;  4BJT A;  4XKB A;  4R79 A;  3IAS 2;  2DCE A;  4D1Q A;  1T95 A;  2VB6 A;  2X6X A;  2HPM A;  2ELJ A;  3DWL E;  2CV0 A;  2L2O A;  2XF7 A;  4CSW A;  3BC8 A;  3MKW B;  1N78 A;  3OS1 A;  4KIS A;  2WB1 A;  3DPT A;  2VLA A;  3HC7 A;  1D1C A;  3KYL A;  2RRE A;  1MND A;  1Y56 A;  3SDB A;  4RM3 A;  2AQF A;  1V5E A;  3DU5 A;  2HU9 A;  4C2T A;  2E5N A;  2V4J C;  4YEJ A;  4BE2 A;  2LC2 A;  2V7F A;  4HSR A;  4HG2 A;  3RQ4 A;  4ANJ A;  3OYL A;  2QKL B;  1X1B A;  3SEZ A;  2X1E A;  4KJZ A;  3OYD A;  4FET A;  2DOA A;  2LG4 A;  2VKD A;  4PFO A;  4ZDL A;  4PJL A;  2R4G A;  3QYF A;  1EA3 A;  2X85 A;  2CFO A;  2HVQ A;  2IGO A;  4XOT A;  1YX3 A;  3PNT A;  4E7K A;  4XLC A;  4RLQ A;  3MMY B;  1DGW Y;  3PFY A;  4ZDO A;  2W82 A;  4B44 A;  3LMM A;  4DBQ A;  3DLA A;  3H9J A;  4PSW A;  2P0W A;  2Z1D A;  4BEH A;  3DEE A;  3ZRG A;  2R7U A;  3H5N A;  2IGK A;  3DTI A;  1TT0 A;  2K5C A;  5LFA A;  4BJ6 C;  4N4O B;  3OYJ A;  4NC8 A;  2PJR A;  3W2V A;  3OY9 A;  4XLH A;  2K9M A;  2XSJ C;  4BUP A;  2WAF A;  2BW3 B;  2O5R A;  4E6K G;  1WJB A;  1X1A A;  1UG0 A;  1U0J A;  1WFX A;  2F4I A;  2WAQ A;  3LSG A;  4NNJ A;  1BR1 A;  4PJN A;  3DTK A;  3OYK A;  1WJ5 A;  3HKZ A;  4AVZ A;  4DBR A;  3DPL C;  3CZ6 A;  4E7S A;  3VYU B;  1W36 C;  2Y0S A;  4Y33 A;  4PUS A;  3DTE A;  2QKM B;  2VJI A;  4PK4 A;  4XL9 A;  3OYN A;  3L2U A;  5FRM A;  2VJ4 A;  4IQ4 A;  3K4N A;  4HNU A;  3CES A;  2JA2 A;  4LIV A;  3ONQ A;  1YE9 A;  2R7T A;  1D0Y A;  2GOX B;  2CMP A;  3H35 A;  4Y4R A;  2JVG A;  4X0G A;  1HA8 A;  4QPO A;  1X4O A;  3K4J A;  1E0E A;  3H5A A;  3I3L A;  3KEY A;  3BG6 A;  3UNG C;  2KRC A;  3TL4 X;  4XLF A;  1G59 A;  4NUB A;  2HPI A;  1MMD A;  4II2 A;  2VJ5 A;  1BR2 A;  2WBM A;  4LG3 A;  2GOM A;  4PSX A;  2OC6 A;  4CCM A;  3A2K A;  4G6T B;  3U21 A;  3VDX A;  2VQC A;  1NG7 A;  3N05 A;  1X19 A;  3VYS B;  2UWM A;  3M1C A;  2WY7 Q;  2CV2 A;  5FRN A;  1V5F A;  2A6T A;  3W2W A;  2HVS A;  2L5Q A;  4XM3 A;  5HNH A;  1PJR A;  3OOU A;  3LSI A;  1J09 A;  4BE0 A;  4Y3O A;  2KL4 A;  3LSH A;  4MLO A;  2E60 A;  1FMV A;  2VJJ A;  4XN0 A;  3L2Q A;  2JUG A;  1WJC A;  3J7A Y;  3EUK L;  3H9Q A;  2E5Z A;  3FBI B;  2L9S A;  3BCA A;  2KHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...