2BBYA

Dna-binding domain from human rap30, nmr, 30 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
RARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation
molecule keywords RAP30
publication title Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02270 TFIIF_beta TFIIF, beta subunit HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bbyA00
2XAHA 3IL2A 2DK5A 5D4RA 4I02A 4EGYA 5LHGA 5HLGA 2K4JA 3CJNA 3WTXC 4MGRA 4QWQA 5D4SA 2ISYA 3FXUA 4N9HA 3WTZA 4DQ2A 3WE3A 1IXCA 4OMZA 1QZZA 2FOKA 1B4AA 1OYIA 2L3DA 2MD5A 2DT5A 1BI1A 1DP7P 3ISPA 2MH2A 3F3XA 4YG2F 4KNYA 3HOTA 1V4RA 2L02A 2XRNA 1P4XA 2H27A 4ENMA 1FNNA 1JGSA 3U1DA 3ECOA 4YIFA 1O7LA 3T8TA 1S3JA 2ZBKA 2ADUA 4HF2A 1EV7A 4EM2A 2FBKA 3LFKA 4EGZA 3GZ5A 5J8FA 4RB2C 4KIGA 2F2EA 3HSEA 4LJZF 3MZYA 2ZJ2A 4RB3C 2XAJA 1XD7A 1P92A 5D8KB 1U5TC 1Z91A 2QBYB 2HYGD 2TDXA 5BPIA 2STTA 2YX4A 3DFGA 1H0MA 1ON2A 4IRHA 1R1UA 3IC7A 2BV6A 1XSXA 3U9GA 4IF4A 1B6AA 1FC3A 3I0TA 2FSWA 4HDUA 3SQNA 2UWMA 3CO7C 4FHTA 5E18F 2FU4A 2JT1A 4UV9A 1REPC 3JTHA 4L5JA 3T8RA 5D6FA 1YO5C 4FX4A 3W6KB 2K27A 3IHUA 4WCGA 3GFJA 4OU0A 2YX7A 2EWNA 1ZGJA 4HV6A 5BOXA 1IW7F 2EFNA 1ZAOA 1USSA 1SD5A 2QLZA 2CWEA 1OYYA 1XSVA 1FX7A 3C3WA 3RJPA 5EEHA 4G7HF 1XDUA 1WWXA 2P5LC 2IPQX 3MAJA 2OZUA 2O0YA 4Q4ZF 2PI0A 4P9FA 2O61A 2W25A 1U3EM 3FWEA 5BMZA 1YYVA 5BS6A 1FYKA 2BEOA 4LG0B 3PFIA 4P96A 1IUYA 2ACJA 2ZXJA 3MFKA 4LG0A 3FF5A 2A68F 4ZYHA 2K02A 1K79A 4LB5A 5ICGA 1R00A 2A07F 2XV4S 1ZRCA 1MJ9A 4B09A 3G73A 3HTSB 4NB5A 1STZA 2FE3A 3BJAA 2PEXA 1UHWA 2GZWA 3JTGA 2OAZA 2Q2EA 3RYRA 2XIGA 2G7HA 4I01A 1OYWA 1XGOA 5E8GA 1KU7A 2EA2A 5H6RA 3MZHA 1TW2A 2VOPA 4KDPA 4P9UA 2M1BA 4BH9A 4KFCA 3O3KA 5LHHA 3WU0A 1FPQA 4UUVA 4I2OA 1IF1A 1I1SA 3R6SA 3FMQA 4HX7A 3U2RA 2VBWA 1QNTA 2YU3A 3ROUA 3HRUA 1O57A 3CTAA 1J9IA 1FP2A 2DO7A 1LVAA 1TQPA 2L4AA 1PUEE 4ZYGA 2E1NA 2A3SA 1W5TA 5K5QA 4HX8A 1U6GA 1U78A 3CUQC 1QO0D 1OKRA 4N9IA 2O03A 3F8NA 5L3FA 1ZRDA 1TQMA 4HZFA 5E1WA 4EMSA 3HRTA 1SD7A 2ZNYA 5CLSA 5L3BA 4TV7A 2FNPA 5ILUA 5F1RA 4IVNA 3V7SA 2Z5UA 1RUOA 3CLOA 3BPVA 3KFWX 1A04A 3F23A 5LHIA 3I64A 1T98A 4LB6B 3QU6A 3P9IA 1WRJA 5IT3A 3BDDA 1G3TA 5E1XA 5L3CA 3NRVA 3KLNA 2HWVA 4AIJA 2D1HA 3ZPLA 1LEAA 4CXFA 2DBBA 2IA0A 4RAZA 2NYXA 4O6JA 3JAMZ 2OA4A 4KMUX 3KLOA 1KQ9A 2W57A 3M7GA 1S29A 1O3RA 4FX0A 1YS7A 4BYYA 5JVTA 3HRSA 4ZH4F 5DYMA 3KZZA 3HSFA 4R1HA 2MA3A 1B9NA 3SXYA 1ZH5A 4K2EA 1UCRA 2KJCA 3LA2A 4GYIA 2OBPA 2VC0A 3BWGA 3TKYA 2RQPA 1PDNC 3BPXA 1UHMA 2AS5F 4EJWA 3E5QA 3S2WA 3ECHA 1LDDA 4A0YA 3KEQA 2P6TA 1ZLKA 4L5IA 1NHAA 2E1CA 4O5VA 1W5SA 2EFWA 3TOBA 4KIBA 3B02A 1R1VA 3DP7A 3TO7A 4AD9A 5ICEA 3P9CA 3GZ6A 3IRQA 3I53A 2ZFWA 4B8XA 1YW7A 1ZARA 3IWFA 2PBIA 2V1UA 2DAOA 2H94A 5D5UB 5F64A 1WQ2A 4KICA 1YW8A 3N97A 3F8FA 4O3MA 3KP2A 1RUNA 3BZ6A 3JAMK 2G9WA 4CGZA 2F5DA 1CF7B 2EJRA 3E6DA 3RKXA 1T2KA 2EFPA 1B59A 2VE8A 1CF7A 2IJLA 4WXHA 5A2QZ 6PAXA 5TRDA 2Q0OA 1WKMA 2K86A 3KE2A 4ZZDA 2XAFA 4M73A 1G6NA 1KU2A 2GA1A 2D45A 2Z9OA 1Y0UA 2GAUA 1XGNA 5L3DA 4N0BA 3QPTA 1D8JA 4PZJA 2W84A 2WV0A 3F22A 2L54A 3E6BA 3J80Z 4KIFA 3BP8A 2ZMEB 5DD8A 4MQVA 3WTUC 4UXNA 1FT9A 3Q9VA 2ZMEA 1CGPA 3FHZA 1D8KA 4KN7X 2B0LA 2D1VA 4XLPF 2WC2A 2HEOA 5CJ9A 2EFOA 3L2CA 1P4AA 1HW5A 2BYVE 1LDJA 2W85A 1RNLA 1O3QA 4CO8A 2VOOA 4ESFA 3AAFA 3N4MA 2JRTA 4AIKA 3RPQA 2HFHA 2DI3A 2VBXA 2NNNA 1S6LA 5H6QA 4R8HA 4I98B 3ZMDA 2Z33A 3T5XA 1R7JA 5A2QK 5HS9A 1F9NA 2FBIA 4A6DA 3TDZC 1Z6RA 5K5OA 1L0OC 5BQTA 1R5GA 2HR3A 4KN4X 2NNYA 2FNAA 3GWZA 4P5OA 2MLKA 5CVJA 3EDPA 2VODA 3QOPA 1IN8A 1YIOA 1O7FA 1LQ1A 2PG4A 3J80K 4AWXB 4U7DA 4G94A 2DPDA 1RIOH 1BIBA 1YG2A 3ELKA 1BJAA 1BC7C 2H6BA 1XB4A 1PP8F 1DPRA 5D8LB 4OIPF 4YFNF 2P5KA 2WTEA 3PQJA 1DPUA 3SZPA 5FB2A 4HA8A 3F8MA 4AIHA 2FA5A 3WGGA 1SMYF 1OPCA 1IN7A 4MEXF 2QQBA 4ESBA 2DQRA 2XAGA 2W24A 3E5XA 2HKOA 3H3UA 4L0ZB 3HOSA 2A61A 2M45A 1IRFA 3DQVC 5EEGA 2DQLA 1SFUA 2R7DA 4D0PA 3DEUA 4RGSA 2XASA 2CW0F 4F7ZA 4IRIA 4ZYEA 2F5EA 1GHCA 5HVQC 4M74A 2O8XA 1ZG1A 1R23A 3BY6A 4WX9A 1IAWA 2ETHA 2DPUA 1S7OA 2XKOA 1TBXA 4U0YA 5LEJA 4L9TA 2XUBA 3E3VA 3GYHX 4L9VA 2XHKA 1FWZA 3W6JB 3WTTC 1T39A 1C0WA 4EVIA 4ENKA 3E97A 1BIAA 1FLIA 2KJBA 4MHGA 1XCBA 5D5XB 3WGHA 1T38A 3ML6A 1Q1HA 5HDNA 2ZKZA 4LD5A 1BM9A 4BHBA 2QVOA 4MTEA 1J0RA 3FZVA 2PJPA 3JSOA 2P5VA 4AVPA 3R4KA 1Z9CA 4BAYA 1EH7A 2MC3A 2LF7A 5E8IA 2ELHA 3Q9SA 1FSEA 4EJVA 1G3WA 2HKXA 4BXUA 4M71A 5LGUA 3GFMA 2RVCA 2HQNA 4HOBA 1D3YA 3FX3A 1BOAA 4UV8A 1W4MA 4WXCA 3O2PE 1HSTA 4A0ZA 3SHFA 2A5YB 1RI7A 2STWA 1V3FA 4IPAA 1FOKA 2LNBA 1JXSA 3OV8A 4Q5SF 3GO5A 4XRFA 3I59B 4FT8A 1IRGA 2P6SA 4NHJA 3I59A 1SFXA 5J8CA 2DTRA 1ZG3A 2JTVA 3P7NA 3RTRA 2WWYA 5FD6A 2VT2A 5LEKA 3RKWA 3FMRA 5KVRA 4RB1A 4I0AA 4IHSA 1IN6A 3LWFA 3E6CC 2J5OA 3LA3A 4IRGA 4U0WA 1XMAA 4ENJA 4DNCA 5ICCA 3GLXA 1P4WA 3SZTA 3I58A 3QRFF 2ZCWA 4U7BA 2NRAC 3DV8A 1QZYA 4UVCA 5LRRA 5AONA 3F8BA 2VBYA 2Y75A 4I0BA 1ZG5A 4NQWA 2YSRA 4RS8A 2CSOA 3T1BA 3ZQ7A 4JK1X 2IRFG 4LMYA 3WODF 5HS8A 2EV6A 3K2ZA 1YQAA 1XSDA 1LEBA 2KIUA 1R36A 3WTWC 1HW2A 2ESHA 2L4MA 2COMA 2OU2A 2XVCA 3IRRA 4M9ZA 4P55A 4M72A 1QGPA 3D5LA 1FZPB 4RB0A 5FFXA 4G7OF 2O3FA 3IWZA 5DV5A 4GXOA 1F1ZA 3KEOA 3KZYA 1IN4A 1O3SA 1XN7A 4I09A 4ZZLA 3ABTA 3SFZA 2A6EF 4KT5C 1AWCA 2VXZA 2HYFA 2DW4A 4I7HA 2L01A 3J81Z 2PMUA 1XCVA 2QZ8A 2HTJA 3DXJF 4LGWA 3VOEA 3F6OA 2JZYA 5AIPA 5K1YA 1L3LA 5D5VB 3LQRA 2P7CB 4HYEA 2XAQA 1BI2A 3TO6A 3K1MA 4LK0F 4GCVA 2FF4A 3ZN1A 3ZMTA 3ZMVA 3WGIA 5CVVA 3L9FA 3IKVA 4OOIA 3LA7A 2G7UA 2JPBA 2IA2A 1MDMA 4Q48A 3VODA 4A6EA 3ZMUA 3REOA 2IVMA 3COAC 2YPRA 4L18B 1ZREA 1UFMA 3FM5A 3I5UA 1U2WA 2YR2A 2RDPA 3L00A 1B1BA 1R22A 5ERIA 2DK8A 2V79A 1RZ4A 1QQIA 3HIFA 5BPDA 3WE2A 4U88A 2RC4A 1KU9A 5HDGA 2HQRA 1G3YA 4HDVA 3J81K 4CDGA 2HZTA 5CVUA 3K1NA 2P7VB 1E17A 4BHCA 1IN5A 2C6YA 3IKTA 2RNJA 1O3TA 1GXPA 3ULQB 1T6SA 1EH6A 4A5MA 4ON0A 2O6GE 1FBUA 3HHGA 3M1EA 2RN7A 3V7RA 4G7ZF 4IJAA 4LLNA 2P4WA 3EUHA 1J2XA 2VE9A 1BC8C 1U5TB 4LLGF 4PGHA 1U5TA 3C18A 2FQ3A 1H9TA 4BHPA 2IW5A 1FY7A 1ZGAA 3R60A 2ZO4A 4M6YA 3BOQA 1HKQA 5L3EA 4A5NA 4ZYDA 1KYWA 2F5CA 1R58A 5FD5A 1IXSB 1TW3A 4A2UA 4R79A 5ED4A 3R0JA 1USTA 4YIIA 1FYLA 3ZP5A 1ZYRF 1F5TA 2V1DA 3K9TA 4HLXA 4JBAA 2VT3A 3MQ0A 1HW1A 1LDKB 1YS6A 3VFZA 1XDSA 5DEQA 1KQ8A 1YLFA 4RGXA 1FYMA 1MJAA 2KKOA 2LSOA 3ZN0A 3TO9A 1VTNC 2GWRA 4EJTA 1MZBA 4CICA 4ETSA 2Y48A 3L7WA 1F4KA 5LGNA 4S05A 2E7WA 3KP3A 1R5HA 4BQAA 5H20A 4LLLA 3VEPA 1SD4A 5E1ZB 2FMYA 1KA8A 3FMSA 2K4BA 4OIQF 2KRFA 2NS0A 4ASNA 2CGPA 1Z1DA 4RGUA 3J7AO 4WWCA 3V4GA 4HAMA 1WI9A 1BBYA 4M9SA 3P9KA 2AXLA 5JFRA 1P6RA 1XGMA 1MD0A 3LAJA 3GFIA 4YFKF 5K5RA 2XROA 2HTSA 2H6CA 3E6MA 4XSZF 3EQLF 4L0YB 2MLGA 4G8XA 2ESNA 2H09A 4MQ9F 3RPUA 3RI4A 1JE8A 1HKSA 5IT9Z 1XGSA 2FXAA 2BGCA 2CQKA 5KK1A 3BJ6A 3GFLA 3WTYC 4Z2YA 4UVAA 4XBFA 2VN2A 3KCCA 3WTSC 4CYDA 4LK1F 4KYWA 2UZKA 3GW2A 3HUGA 3EYYA 3NQOA 1LJ9A 2OZ6A 1TNSA 5JHUA 4IHTA 5FGMA 2X4HA 5DUIA 1HXDA 1ULYA 1K7AA 1U8RA 3BJOA 4L9NA 4HQEA 1TNTA 3T0YA 1I27A 3V7CA 3QU3A 2UXNA 2K7LA 2HOEA 2R3SA 3QP6A 3KP7A 2PQ8A 2OQGA 3KP4A 2EFQA 1SD6A 4EJOA 2QBYA 4Y13A 4G6DA 4HX4A 1IZ1A 1FBSA 4GGGA 3QPHA 4MNUA 1E2XA 3CUQB 4ESJA 2NAZA 2J5PA 3MWMA 4WK8F 2XGXA 5LRSA 5CVRA 3CO6C 5IT9K 3CUQA 5DCFA 2EA4A 1G3SA 2LF8A 3WG9A 1PP7U 1MJBA 2KIFA 3E5UA 1J75A 2Q8KA 4EJUA 2PLYA 5LLQA 2D2WA 3D0SA 1I6XA 3F8CA 2FMLA 5DCMB 3O6BB 2IA1A 5HS7A 2V6CA 4Q47A 3F72A 1TLHB 5DCMA 4M9XA 5E17F 5HLHA 1HQCA 1J59A 2V9VA 5JR3A 4OIOF 1I5ZA 1IXRC 1FBQA 2GA2A 3FXQA 1YFHA 2JSCA 1X3UA 2RKHA 5E20A 1Z05A 3TQNA 4MTDA 1OMIA 3EETA 2RV8A 5LGTA 3H3ZA 2GXGA 4GYGA 1B9MA 3K1PA 3GUDA 2X0LA 1QPMA 4KUMA 2VC1A 1HSJA 5CYVA 5DD4A 4EV0A 3JSPA 2GXBA 2MBFA 4U0VA 4G9YA 1ZLJA 1JHHA 3JW4A 3KP5A 1YTYA 2HS5A 2CO5A 4HF1A 1JHFA 1MGTA 2A6HF 2CFXA 1BN5A 3M8EA 3GVAA 2PMHA 5AIQA 3OOPA 1SMTA 3QP5A 5JI6A 4Y15A 3DKWA 4CHUA 1HKTA 4PDKA 3V8LA 2Z3YA 3LAPA 5DUKA 2EK5A 3ZMSA 4GO1A 3CDHA 3I54A 2QQAA 4HW0A 2GQQA 1K6OA 3TOAA 2CYYA 3TDUC 5ILVA 1W7PD 1DUXC 5HLIA 4RGRA 4Y17A 2QUFA 3RIRA 5FLXZ 4BNCA 1GXQA 1J5YA 3B73A 4LFUA 1TTYA 2A69F 4IXAA 2LKPA 2KIMA 4UVBA 2BBYA 3CUOA 1EH8A 1OR7A 5FFZA 3LQQA 4M6XA 2EB7A 3DF8A 2F5FA 3G3ZA 3GEZA 1P2FA 3GF2A 3F6VA 3K69A 2IP2A 5J6XA 1KGSA 4S04A 4EQQA 3LSTA 1BI0A 5HDKA 2LDUA 3TGNA 4L9JA 2M8EA 1H9GA 2V1XA 1K78B 3ZMZA 2E7XA 4PGGA 2M5WA 4A0XA 1K78A 4XSXF 2M30A 5D5WB 2VONA 2Z99A 1AOYA 3F21A 1FSHA 1KYZA 2BE5F 3ABUA 5L3GA 2DFIA 4WXDA 3BROA 2OD5A 5FLXK 2HGCA 4YFXF 3H92A 2QENA 4OMYA 1ZHFA 3C1DA 2FBHA 4MEYF 1ON1A 1KU3A 2OQRA 1MKMA 2PN6A 3ERED 5HOOA 4A12A 3KP6A 1FP1D 3WU1B 2FEZA 4HQMA 3I71A 3HYIA 1MDMB 3RDIA 4EM1A 2UXXA 1G4DA 4PCQA 3R0AA 2HDCA 1LB2A 4OINF 3R61A 5ICFA 4KA4A 1J7KA 4UHTA 1Z6TA 2GIVA 1WSUA 1GVJA 4G6QA 4CZZA 3EYIA 4QLCU 1QBJA 5LBQA 3MEXA 3V8KA 1YW9A 3HRMA 1HBXG 1ONVA 3KETA 4OIRF 4WF2A 3DPTA 3L09A 2M87A 2QM3A 3V8JA 1W7PB 1SFEA 2QQ9A 2Y0MA 2IT0A 4EM0B 4JQFA 1SAXA 1W7PA 3QAHA 3PQKA 4KMFA 3K0LA 1ZN2A 3M8FA 2ZNZA 2FRHA 1KQ0A 2JPCA 5FO5A 2VBZA 1ZRFA 3VB2A 4E70A 1S8NA 5CVIA 3HTUA 4UNOA 4RAYA 3C7JA 3M9AA 2EV0A 2MH9A 3RKYA 3DPLC 4HBLA 2R7FA 2RGVA 4ENNA 1ODDA 5F6FA 3I4PA 2QWWA 4H0EA 2EV5A 3MCZA 1R1TA 2DLLA 1DDNA 4HF0A 5TJJA 2QYOA 3GXOA 1TQIA 3WTVC 2CG4A 1S7AA 5D6EA 1XMKA 3Q5FA 2PFBA 3HHHA 3RYPA 4XLNF 2ISZA 3GX4X 1T0FA 1D5VA 1BI3A 1LNWA 4HLYA 2DU9A 4HV5A 1UB9A 5ILSA 1Z7UA 5DDGA 2P8TA 3FM3A 3NEUA 2XKPA 3HSRA 3FXRA 1I1GA
chains in the Genus database with same CATH superfamily
4E7SA 3JR9A 4E4HA 2BVLA 2XAHA 4W97A 2O9LA 3GTJJ 3IL2A 2DK5A 5D4RA 4IHXA 4I02A 1FTZA 1WPKA 5LHGA 2V9KA 4EGYA 1VFCA 5HLGA 2K4JA 4D1QA 1LE8A 3I3LA 1SVLA 3LL7A 3CJNA 3WTXC 3SEZA 3F9KA 4MGRA 2LG4A 4QWQA 2WA0A 5D4SA 2ISYA 3OL3A 3HDDA 2H1LA 3FXUA 4N9HA 3TP3A 1PJRA 3WTZA 4DQ2A 4CCLA 4Y4RA 3A4CA 1IXCA 3WE3A 3IAS2 5EJCA 4OMZA 1QZZA 1SVOA 2FOKA 4A3CJ 2WY8Q 4Y52J 1FJLA 3NWTA 1B4AA 1OYIA 2DFFA 2L3DA 2WAQN 4XNFA 2MD5A 2ME0A 3IP4B 1EA3A 3MZ8A 3QQAA 2DT5A 3HL2A 2ELKA 1BI1A 4A69C 4BEHB 1SAUA 1MNMC 1DP7P 2DMQA 3ISPA 2MH2A 3F3XA 4NDLA 4YG2F 4BEHA 4KNYA 2KLOA 3HOTA 1B72B 1V4RA 2L02A 2XRNA 4XIDA 3BR3A 1RETA 4RM2A 1P4XA 1I6HJ 2HI3A 2ZSIB 4Y7NJ 1B72A 2H27A 4ENMA 1OJLA 1T8IA 2TRTA 2LH9A 1E3HA 1FNNA 1MMSA 1JGSA 2XC7A 3HB9A 2VJJA 4CA0A 3U1DA 1IUFA 3PJRA 2LMDA 2ZJQF 3ECOA 4BXXJ 4YIFA 1YIJI 2AO9A 3ZXSA 1O7LA 3T8TA 1E3PA 1S3JA 2ZBKA 1EKEA 1LPQA 2ADUA 2PMZN 1JJ6C 4HF2A 2UUZA 1EV7A 4Z6YA 4OWRB 2NS8A 4EM2A 2FBKA 3CZ6A 3LFKA 2EIMH 4EGZA 3GZ5A 3CCUI 1HDDC 5J8FA 3ZR8X 3PNYA 3K4NA 2K9QA 3EUHC 2LOOA 4RB2C 4KIGA 4C2TA 4PSWA 3HC7A 3BZCA 2ME6A 2R7SA 1VQ6I 2F2EA 3HSEA 4LJZF 3MZYA 2ZJ2A 4RB3C 2XAJA 1XD7A 1P92A 5D8KB 3S1MJ 1U5TC 1Z91A 2QBYB 2HYGD 4XRSG 2TDXA 5BPIA 1QPIA 5FKMA 2STTA 2YX4A 3DFGA 1H0MA 2MGQA 1ON2A 4IRHA 1LFPA 2KMUA 2ZJPF 1A6QA 2IBDA 1R1UA 3BG9A 4W1UA 1YRNB 4XN3A 4AYBN 3IC7A 1YITI 2BV6A 1XSXA 2L9NA 1B8IB 3U9GA 4IF4A 2KP6A 1B6AA 4OAYA 2XDVA 3ZQIA 1FC3A 4JP0A 1B8IA 2KDZA 3Q3SA 3I0TA 4YRVA 4RAGA 4IHVA 2FSWA 4B3AA 4HDUA 3SQNA 3S2HJ 3OYCA 4F3QA 3BR6A 1FMVA 2UWMA 5KNLA 4HNUA 1ETWA 3CO7C 4FHTA 5E18F 4N4NB 2FU4A 2JT1A 4UV9A 3DCFA 1ORKA 1REPC 3JTHA 4FETA 4L5JA 2JUGA 3D5RC 3T8RA 3S93A 5D6FA 2QA4I 3OSGA 1YO5C 2XPVA 4FX4A 2EQRA 3W6KB 3H9GA 4WWCA 2K27A 3IHUA 2EBIA 4WCGA 3GFJA 1AKHA 2JVHA 4OU0A 2YX7A 1IO2A 3H36A 2EWNA 1VQ5I 1ZGJA 4XRSA 4HV6A 3WG7H 2CUFA 5BOXA 1IW7F 1V5EA 2EFNA 1ZAOA 5M3MJ 1USSA 2CQQA 1WJDA 3IH3A 1SD5A 2QLZA 5EYRA 5GAGJ 1RKTA 2CWEA 1PVEA 1OYYA 1XSVA 4A3IJ 1K61A 5EDNA 2DYSH 1WJFA 1FX7A 3OIPA 2F5VA 3C3WA 3BTCA 3RJPA 5EEHA 1XDUA 1WWXA 4H4KC 4G7HF 2CQNA 2P5LC 3JRGA 3NARA 2IPQX 3MAJA 2OZUA 4M3GA 2O0YA 4Q4ZF 2PI0A 4P9FA 2O61A 3PSIA 2W25A 1U3EM 3FWEA 5BMZA 1YYVA 3SDBA 1ZR2A 4XONA 2TCTA 1XG1A 5KCMA 5BS6A 2K9SA 1FYKA 3G1LA 2BEOA 4LG0B 3PFIA 3UKGA 4P96A 2B9SA 1IUYA 2ACJA 1FMWA 2ZXJA 3MFKA 3CLQA 1YJ9I 4LG0A 3FF5A 2A68F 4ZYHA 2K02A 3L2UA 1K79A 4LB5A 3FXLA 5ICGA 1R00A 5EG0B 1A5JA 2KIQA 2A07F 1F36A 2XV4S 1ZRCA 2M34A 1MJ9A 4B09A 1W0TA 2DJNA 5EG0A 3BT9A 1I3QJ 3G73A 3HTSB 4NB5A 2Q2EB 1STZA 1MBHA 2FE3A 3BJAA 4J01A 2PEXA 1UHWA 2GZWA 4AIDA 2OAZA 3JTGA 2Q2EA 3I56I 3OIOA 3RYRA 2XIGA 2G7HA 2ZC2A 4I01A 4BL0B 1FIAA 4LIVA 1OYWA 2E1MC 1EJ9A 4NC8A 3PO3J 1XGOA 2K3PA 5E8GA 1KU7A 1QHGA 2EA2A 3PUFA 5H6RA 3MZHA 1TW2A 2KRHA 2VOPA 2LKSA 5B66C 4KDPA 4IKFA 3EUAA 4P9UA 4PJ0C 3OS0A 2M1BA 4BH9A 4BDZA 4KFCA 3O3KA 3DU5A 4JX4A 2COBA 3WU0A 5LHHA 1FPQA 2DYRH 3K4BA 5IOYA 4CUGA 5F27A 4LIUA 2EZKA 3SDGA 3ERMA 1MBJA 4PJJA 3ZQCA 4UUVA 4I2OA 1FEXA 3H9JA 1IF1A 2OJED 1I1SA 3R6SA 3E7LA 2QQ8A 3FMQA 2XF6A 2O7OA 1X3WB 3IUOA 2DN0A 3HJEA 4HX7A 3U2RA 2VBWA 1QNTA 2LKXA 2YU3A 2HOSA 3ROUA 3LMMA 4FQGA 4DYRA 4XMYA 3HRUA 4A3EJ 1O57A 4BQNA 3CTAA 5LFAA 3FXKA 1J9IA 1FP2A 2DO7A 3PNTA 4G12A 2O8KA 1LVAA 3W2WA 1TQPA 2L4AA 1PUEE 2L2OA 4ZTFA 4ZYGA 2E1NA 4IOAF 4BGDA 1KZHA 2A3SA 1RKWA 1W5TA 3BQYA 1HC8A 4XM3A 5K5QA 2OF7A 1G59A 5IYCJ 3PFYA 4HX8A 1U6GA 1U78A 1MH4A 3CUQC 1QO0D 1OKRA 5F0HA 4N9IA 2O03A 3F8NA 5L3FA 1ZRDA 1TQMA 2X51A 4HZFA 3A0BC 5E1WA 4BUPA 4EMSA 1LUJB 4CCMA 3HRTA 3OMYA 1SD7A 2ZNYA 5CLSA 5L3BA 2E2HJ 4TV7A 3OYEA 2L9SA 2FNPA 1K83J 1R5ID 3FBIB 5ILUA 2JK3A 2LVSA 5F1RA 4IVNA 3V7SA 2KISA 2GLOA 3I55I 2Z5UA 4BBSJ 4AUXA 2E5NA 2WBMA 1RUOA 4X0GA 2QSHX 3CLOA 3BPVA 3E1SA 3KFWX 1A04A 3S14J 5LHIA 3F23A 3C2BA 3GZNB 4NC7A 3I64A 1T98A 4LB6B 3L1PA 3QU6A 3LSPA 3P9IA 1IJWC 3ASNH 1WRJA 5IT3A 3A01B 4XLEA 3BDDA 2CW8A 1G3TA 3CC7I 2DT6A 5E1XA 5L3CA 3NRVA 1Z77A 3KLNA 5HODA 3A01A 3EUKL 2ID3A 5K7ZA 5J4YA 1T33A 2E71A 1AU7A 2HWVA 4AIJA 2D1HA 1LFUP 1ETKA 4BE0A 4PJNA 3ZPLA 1LEAA 1I39A 4CXFA 2IGOA 3S2DJ 2DBBA 2MW8A 2IA0A 1BR4A 1I3AA 4XQFA 3HG9A 4RAZA 3BTJA 4RDUA 2CRGA 4DZJA 2NYXA 2M8GX 4O6JA 3JAMZ 5J3LA 2OA4A 2M7BA 2Y2ZA 4KMUX 3IAM2 3KLOA 1KQ9A 2GOXB 2QEXI 2W57A 3M7GA 1S29A 2HDDA 1O3RA 1W36C 4FX0A 2R7XA 1LFBA 1T56A 1YS7A 4LITA 4BYYA 5JVTA 3HRSA 3ZRGA 3QOEA 3ZQLA 4ZH4F 1X1PA 5DYMA 3KZZA 3HSFA 3GTMJ 3BG3A 4FE7A 2MA3A 2X1EA 4R1HA 1B9NA 3SXYA 1VQ9I 1ZH5A 1AHDP 1VQMI 4K2EA 1UCRA 2KJCA 5KHDA 3LA2A 4GYIA 2OBPA 2VC0A 3BWGA 3TKYA 1WJ5A 2RQPA 3VYRB 1PDNC 3BPXA 2GOMA 1UHMA 2X1DA 3RCOA 2AS5F 4EJWA 2GIZA 3E5QA 3S2WA 3ECHA 1LDDA 4A0YA 5M5WJ 4IHWA 3KEQA 3JREA 2P6TA 2JQ7A 1TWHJ 1K4SA 1A31A 2Y69H 1ZLKA 4L5IA 1NHAA 3WHBA 1R9TJ 2E1CA 4IOCF 4O5VA 1W5SA 2EFWA 3TOBA 4KIBA 3B02A 3FXOA 1R1VA 3ZOBA 3PIOF 3DP7A 3TO7A 4JX5A 4AD9A 5ICEA 3P9CA 2LY9A 3GZ6A 3IRQA 3RPUD 3I53A 4IX7A 2ZFWA 4B8XA 1YW7A 1ZARA 3IWFA 2PBIA 4RBOA 2V1UA 4D5FA 2DAOA 2H94A 4D9JA 2DFHA 5D5UB 3BG6A 5F64A 1WQ2A 1WVRA 4KICA 2HPMA 1YW8A 3N97A 3F8FA 3OYLA 4O3MA 4BJ6C 3KP2A 1D0XA 1RUNA 3BZ6A 3JAMK 2G9WA 4CGZA 3HOUJ 1JT6A 1W1WE 2F5DA 2HXOA 3GCMA 1CF7B 2EJRA 2MYSA 4NC6A 4PFOA 3M07A 3E6DA 3RKXA 3DLLF 1T2KA 1B59A 2EFPA 2VE8A 1Z7LA 3B6AA 1CF7A 2IJLA 1WJEA 4WXHA 5A2QZ 1I50J 1OR7C 6PAXA 5TRDA 2Q0OA 2UV1A 3CMAI 1JKPC 1WKMA 5E3MA 2DODA 2K86A 2BY3A 3HGYA 2K9NA 3KE2A 2E35A 4ZZDA 2XAFA 4M73A 4EEFG 1G6NA 1ZELA 3JRIA 3CMYA 1KU2A 2GA1A 2D45A 2Z9OA 4II3A 3MN2A 1Y0UA 3BQZA 2GAUA 1XGNA 4ITVA 5L3DA 4N0BA 3QPTA 4MFDA 1S5LC 2HQ5A 1D8JA 1UMQA 2VKVA 2EIKH 4PZJA 2W84A 2WV0A 2BHYA 4AC0A 2W7NA 3F22A 3JRBA 1Z21A 2X6OA 2CUJA 2L54A 2Y31A 3E6BA 2VKEA 3J80Z 4KIFA 2NVYJ 3BP8A 2ZMEB 2Z16A 1JI8A 2LY1A 5DD8A 4MQVA 3WTUC 4DZPA 4UXNA 3KEYA 1FT9A 3Q9VA 2ZMEA 3BR1A 1CGPA 3FHZA 1D8KA 4KN7X 4CCKA 4AU7A 2B0LA 2D1VA 4XLPF 2WC2A 2HEOA 5CJ9A 2EFOA 3L2CA 1P4AA 4AVZA 1HW5A 2BYVE 1LDJA 2W85A 4UB6C 2FOWA 2V26A 1RNLA 4YEJA 3DBLB 1O3QA 4CO8A 1ETVA 2HQAA 2VOOA 1X3ZB 1TZLA 2JWTA 4ESFA 2ECCA 3AAFA 4G6TB 3DTKA 2XSDC 4PK4A 3N4MA 2JRTA 2L7ZA 1POGA 2L7FP 2R7OA 1TC3C 4XRMA 4AIKA 3RPQA 1LE8B 2HFHA 3PIPF 2DI3A 2VBXA 3BTLA 3A03A 2WAEA 3O8GA 2NNNA 1S6LA 5H6QA 2F4OB 3FHNA 4R8HA 4BXFA 5CKTA 2WADA 4I98B 2QSFX 3ZMDA 2Z33A 3T5XA 4HSRA 1D5YA 1R7JA 3CF5F 2EH3A 5A2QK 3E0JB 2P81A 1LKXA 5HS9A 1F9NA 1ETQA 1K4TA 3IV5A 2CH0A 3BG5A 1NG7A 2E5ZA 2FBIA 3JRHA 2R7TA 4A6DA 2DA2A 2DA4A 3TDZC 4B47A 1TWGJ 1Z6RA 3PM1A 5K5OA 1L0OC 5BQTA 5E79C 1R5GA 2HR3A 4KN4X 5J1YA 2NNYA 2FNAA 3GWZA 3HOYJ 3M4OJ 2HXIA 2HOTA 1WJCA 5IY5H 4P5OA 1BJZA 1Y56A 3M3YJ 2DDBA 2MLKA 3S1NJ 2CUZA 1SVMA 5CVJA 3EDPA 2VODA 3QOPA 1IN8A 1YIOA 5TISC 1O7FA 3QYBA 3ESWB 5J4VA 3PUBA 3HPGA 2G0EA 1LQ1A 2PG4A 3J80K 4AWXB 4U7DA 4G94A 2EINH 2DPDA 4CYCB 3K70D 1RIOH 1BIBA 1YG2A 3ELKA 3W2VA 3BR5A 1BJAA 3OIQA 5C4JJ 1JKQC 1BC7C 1G2HA 2H6BA 1WJAA 2IEKA 4CYCA 2RQQA 1XB4A 1PP8F 1DPRA 3H5AA 2ZB9A 2OV7A 3PL8A 5D8LB 4QIWN 4OIPF 4YFNF 2P5KA 1MBGA 1BL0A 1U9OA 1RC9A 2BXYA 2WTEA 3PQJA 5IPAA 3S1RJ 5F08A 1DPUA 3SZPA 4UUSA 5FB2A 4HA8A 1XTAA 2A05A 2QCOA 4F55A 3F8MA 3GMEA 4AIHA 1E3OC 2E2JJ 2Y30A 2FA5A 4F93B 4ZTJA 3KX2A 3IH2A 5F0FA 4IZZA 3WGGA 4DIQA 2OC6A 1J09A 3CF2A 1SMYF 1OPCA 1IN7A 1BR2A 4MEXF 1GV2A 2QQBA 4ESBA 2DQRA 1VQ4I 2XAGA 1OCOH 2W24A 2E60A 2DJIA 3E5XA 2HKOA 1A6IA 3H3UA 5EZGA 4L0ZB 4F91B 3HOSA 1IGNA 4MO7A 4XOTA 2BY1A 2A61A 2M45A 1IRFA 3DQVC 2Y0SN 4U87A 5EEGA 5F1JA 2DQLA 1SFUA 3LOCA 4IQ4A 2R7DA 4D0PA 1S9HA 4A3GJ 3DEUA 4RGSA 2XASA 4FE4A 3GTGJ 2CW0F 4F7ZA 3S32A 2VJIA 3OR2C 3C2HA 4ZYEA 1HCRA 2F5EA 4IRIA 5HVQC 1GHCA 4M74A 3UR3C 4DBRA 2E36A 2O8XA 1BW6A 1ZG1A 1MSFC 3GTPJ 2V4JC 1R23A 3BY6A 4WX9A 2LYCA 1IAWA 1QVTA 1IV8A 2ETHA 2DPUA 1S7OA 2BZTA 1TBXA 2XKOA 3CESA 1RESA 2L9RA 1PUFB 2B7EA 1ENHA 3RSNA 4II2A 3I4NJ 4ANJA 4U0YA 5LEJA 1Z67A 4L9TA 2XUBA 3E3VA 3GYHX 1IDYA 1PUFA 4L9VA 1X4OA 2MFZA 2XHKA 2JN6A 4FASD 1FWZA 2W00A 3W6JB 3CQZJ 3WTTC 1T39A 4A93J 4CCOA 1C0WA 1T0FC 3FKJA 4UY8I 4EVIA 3AKZA 2QGUA 2EZHA 1X1DA 2HVQA 2NOGA 1MIJA 4ENKA 3E97A 1BIAA 1FLIA 1AKHB 2QSGX 2KJBA 5IYDJ 2X6XA 1U8BA 2X9DA 3G1OA 4B44A 2F4MB 4MFEA 1VQ8I 3V42A 2XPWA 1MNDA 4JOMA 4MHGA 1XCBA 3FK6A 2VXDA 5JLXA 5D5XB 2HZDA 3NAUA 1H89C 3CJQB 3WGHA 1T38A 2EZLA 4DJAA 3ML6A 5GTIC 3M8JA 2M0MA 1Q1HA 5HDNA 2ZKZA 4LD5A 3Q0WA 1BM9A 1UELB 4FISA 2DMPA 4BHBA 1WGXA 2QVOA 3L2QA 3G71I 1IRXA 4XK4A 4MTEA 1J0RA 5DS9A 3FZVA 1UG2A 2JRMA 1VQNI 3S1QJ 5E3OA 2JA5J 2PJPA 4C9YA 4XOPA 2PX9A 3JSOA 5E3NA 3I4MJ 2P5VA 4AVPA 1SANA 1WH7A 3R4KA 4M3DA 1Z9CA 1NG6A 1EH7A 5F0CA 3HKZA 4BAYA 1SFOJ 2WB1N 2MC3A 4ZJZA 3CCYA 2LF7A 5E8IA 3DBHB 1YOVB 2E1OA 2ELHA 4RAFA 2M4GA 3Q9SA 1FSEA 4EJVA 1G3WA 2P0WA 1X4PA 2HKXA 2ZXIA 2LTPA 1TWFJ 4XORA 4BXUA 5KAFC 5E3LA 1NK3P 4M71A 2H1KA 5LGUA 1FOXA 3ABKH 3GFMA 2RVCA 2HQNA 3CMMA 4HOBA 1WCMJ 1D3YA 3FX3A 1BOAA 3MD2A 4UV8A 4PFPA 1W4MA 2W48A 4WXCA 1VQLI 3O2PE 1HSTA 1A35A 2V9PA 2I5UA 4A0ZA 4A3DJ 3SHFA 1MSEC 3S8PA 2A5YB 3N05A 1RI7A 2NOJB 2STWA 1V3FA 4IPAA 1MW7A 1FOKA 2LNBA 2MABA 1JXSA 3U1KA 2OCCH 1QHHD 3H1CA 3OV8A 1BR1A 4Q5SF 3GO5A 3ASOH 3IH4A 4XRFA 3I59B 1MH3A 3K4CA 3ZQFA 3OYFA 4FT8A 1IRGA 4AYBA 3RQIA 2P6SA 5BNGA 3OYAA 4NHJA 2WY7Q 1SFXA 3I59A 2DTRA 5CPRB 1ZG3A 5J8CA 4CSWA 3W6VA 2JTVA 3P7NA 3RTRA 3TW6A 3FKIJ 2WWYA 3MVPA 1VQKI 5FD6A 2R7WA 2L7MP 1QVUA 3QYEA 2VT2A 5LEKA 3RKWA 3FMRA 3OY9A 5KVRA 2DA3A 3CDIA 1QA6A 1ZGWA 4RB1A 3VDXA 4I0AA 4IHSA 1IN6A 3LWFA 4RA2A 2VPLA 2YS9A 3E6CC 2J5OA 2X1CA 3LA3A 4IRGA 1GV5A 4M3BA 4U0WA 3H0GJ 2XGEA 2JA2A 1XMAA 4RLFA 4ENJA 4DNCA 3TEDA 5ICCA 1LVKA 3GLXA 2QKLB 1P4WA 2Y9ZA 3W3CA 2R93J 3SZTA 2QKMB 3I58A 3M1CA 4XLCA 1A36A 3QRFF 3Q0VA 2ZCWA 1APLC 1D0ZA 3LFUA 4A3MJ 2CV2A 2R4GA 4U7BA 3DBRB 2MG4A 2NRAC 1VQ7I 4NQWB 3I9V2 3DV8A 1QZYA 4JYKA 4UVCA 5LRRA 3VWBA 5AONA 3F8BA 2VBYA 2Y75A 4I0BA 5FKOA 4NQWA 1ZG5A 1Y1VJ 2DA1A 2YSRA 2JUCA 2NVXJ 3Q0UA 3FBNB 4RS8A 2CSOA 2HU9A 3T1BA 3ZQ7A 2IGNA 4JK1X 2IRFG 3LSGA 4LMYA 3WODF 4IEJA 2O5RA 5HS8A 1MMGA 5EF6A 2EV6A 2A5WA 2KZGA 1ETYA 4C2MJ 3P5JA 3K2ZA 4HNTA 1YQAA 2IGKA 2H8RA 2LP0A 3JRAA 1XSDA 3CP8A 1LEBA 2KIUA 3AFHA 1R36A 3WTWC 1HW2A 1H88C 1V5GA 5GPAA 3OYHA 2ESHA 3BG7A 2CJJA 4I76A 1SC7A 4C3HJ 3J7YJ 4GDFA 2F4IA 2L4MA 2COMA 3RKQA 2OU2A 2Q1ZB 2XVCA 1FOYA 2DOAA 3QODA 3IRRA 4M9ZA 4P55A 4M72A 2XB0X 4HG2A 2IAIA 1QGPA 1Y39A 3D5LA 2FX0A 1FZPB 4RB0A 2VQHA 2OPTA 5FFXA 4G7OF 2O3FA 3IWZA 3BZKA 1N78A 5DV5A 2RNGA 4GXOA 1F1ZA 3KEOA 3KZYA 1IN4A 1O3SA 1XN7A 2K9LA 2L7KA 3SFIA 4I09A 4ZZLA 2BHZA 3ABTA 3SFZA 1OCCH 2A6EF 1R4NB 4KT5C 1AWCA 4E7HA 1JKOC 2VXZA 3HM5A 5FLMJ 4CCJA 2HYFA 4UB8C 2DW4A 4I7HA 4HSTA 3OS1A 4XKVA 2L01A 3J81Z 1XPXA 2PMUA 4NUBA 2L5QA 2KDOA 1XCVA 2QZ8A 5B1BH 1VI0A 2HTJA 2ZSHB 3S3OA 3DXJF 4LGWA 1ZKGA 4YELA 3VOEA 4XR6A 2H8WA 1AA7A 5FRNA 3G4SI 4A3KJ 3F6OA 2JZYA 2R0QC 5AIPA 3HOXJ 4BJTA 2CFOA 4E7ZA 5K1YA 1L3LA 5D5VB 3MKZA 2OTLI 2LBFB 3LQRA 2P7CB 4HYEA 2XAQA 1BI2A 3S17J 3TO6A 2DA5A 1JGGA 3K1MA 4LK0F 3WU2C 1HF0A 4GCVA 2FF4A 2LBFA 3ZN1A 3DPUA 3ZMTA 3ZMVA 1JTXA 2EZIA 3WGIA 5CVVA 2VKHA 3G6EI 3L9FA 3IKVA 4OOIA 3CCJI 2Z1DA 3LA7A 2G7UA 2LK2A 2JPBA 1D0YA 2IA2A 2EIJH 3X2QH 1MDMA 2R7QA 3CC2I 4Q48A 3VODA 4A6EA 3ZMUA 3REOA 5B3SH 3K10A 3OWTA 3HPHA 2IVMA 3COAC 2YPRA 4L18B 2IS2A 3H5NA 1WI3A 1FOWA 1ZREA 1UFMA 4KJZA 3S16J 3FM5A 4P1WA 4ZYAA 3D1NI 1WFXA 2KPMA 1UG0A 1NH3A 4DYQA 3I5UA 2NVTJ 1YJWI 3J7ZI 1U2WA 2YR2A 2RDPA 3L00A 2KRCA 1RRJA 2GXAA 1B1BA 1R22A 3JRDA 5ERIA 2DK8A 2V79A 3J7AY 1RZ4A 2IS6A 2HPIA 3BR2A 1QQIA 3HIFA 3OL4A 5BPDA 1UJ8A 3WE2A 4U88A 2RC4A 1KU9A 2VB6A 3G2BA 5HDGA 2HQRA 3A0HC 2L9VA 2Y9YA 1G3YA 3GTQJ 4HDVA 3LSKA 5EZHA 3J81K 4CDGA 1YX5A 2HZTA 1V55H 5CVUA 3K1NA 1JKRC 1D1BA 2P7VB 1E17A 2MSYA 4GFBA 2DA7A 4BDYA 2I10A 4BHCA 1IN5A 2C6YA 1YJNI 3IKTA 4RLQA 3MKWB 2K3FA 2K9MA 2RNJA 3GTLJ 1O3TA 1GXPA 3ULQB 1T6SA 1EH6A 4A5MA 4ON0A 2O6GE 1FBUA 2HVSA 3HHGA 3CDLA 3M1EA 2V6EA 3TBIA 5IP6A 3AL0B 4LOCA 3WHCA 1JUMA 1ETOA 2RN7A 3V7RA 1VZ0A 2XB5A 4G7ZF 4IJAA 2R5ZA 4LLNA 3DLAA 2P4WA 3EUHA 1J2XA 3QPSA 2VJ4A 4IHYA 2VE9A 1BC8C 1U5TB 3KPHA 4LLGF 5GTHC 1H8AC 1GT0C 5IYBJ 4PGHA 5EGOB 1U5TA 1RR8C 1R71A 3C18A 2FQ3A 3ZCOA 5EGOA 1H9TA 1OISA 4BHPA 2IW5A 4UUTA 4D7MA 4JX6A 1FY7A 4X6AJ 3AG3H 1NTCA 4LG3A 1ZGAA 3R60A 2ZO4A 1UZCA 4M6YA 2DT7B 3BOQA 1HKQA 3CJRB 1TT5B 5L3EA 4HPQA 1KYWA 2F5CA 4A5NA 4ZYDA 3AG1H 4BACA 2LFBA 1R58A 1V54H 5FD5A 3EPZA 3QYFA 1IXSB 1TW3A 2JVGA 4A2UA 2ID6A 3R0JA 1USTA 1P7JA 4YIIA 4R79A 5ED4A 3FXJA 3ZP5A 1ZYRF 1FYLA 5KAIC 4BU2A 1OFCX 1F5TA 1F43A 2V1DA 3K9TA 3K4LA 2NS7A 4HLXA 4JBAA 2VT3A 4QTRA 3MQ0A 1HW1A 3A02A 1LDKB 1YS6A 2VQLA 3VFZA 2AQEA 5HNHA 1XDSA 5DEQA 1KQ8A 1YLFA 4RGXA 1FYMA 1MJAA 2KKOA 1HDPA 2LSOA 3ZN0A 3TO9A 1DU0A 1VTNC 2GWRA 4EJTA 2B63J 1X1AA 1MZBA 2NXNB 4M6VA 5J47A 1Y1WJ 4CICA 4ETSA 1MMNA 2Y48A 3L7WA 3QWLA 1F4KA 1YHQI 5LGNA 1G8XA 1TT0A 4S05A 2E7WA 2VQCA 3HOWJ 1K6YA 2HOAA 2DMTA 1OCRH 3H35A 3KP3A 1R5HA 4BQAA 1IG7A 5H20A 1MMDA 4LLLA 4ZDPA 3VEPA 4RM3A 1SD4A 2F6CA 2X85A 5E1ZB 2FMYA 3MMYB 1KA8A 2DMNA 4S0HB 3JRFA 1U9NA 3FMSA 2K4BA 1OCZH 2WV1A 4HRIA 4OIQF 2VJ5A 2W1OA 2KRFA 3OYBA 4PSXA 2NS0A 4PUSA 4ASNA 5C44J 4V2FA 2CGPA 1Z1DA 4RGUA 4B43A 1MMAA 3J7AO 1RPWA 2KL4A 3DKYA 3H9QA 1WI9A 1BBYA 4HAMA 3P9KA 4M9SA 5FKNA 3V4GA 3LSHA 2AXLA 4M3FA 5JFRA 2R5YB 4RMNA 2R7ZJ 2OTJI 3VSKA 1P6RA 1XGMA 2LD5A 3SJMA 2X6YA 1MD0A 3FISA 3LAJA 2R5YA 3GFIA 1M1EB 4YFKF 5K5RA 2XROA 2HTSA 1CQTA 2H6CA 3MKLA 1JTYA 3E6MA 4XSZF 3EQLF 3K2AA 4L0YB 4BE1A 2FQ4A 2MLGA 3KYDB 1Y8QB 4MIMA 3DTEA 4G8XA 3CMEI 2ESNA 2NVUB 2H09A 1D1AA 4X1EA 3FXMA 4MQ9F 3RPUA 4C3JJ 3RI4A 1JE8A 3TP0A 1W36D 4BY7J 1HKSA 4L5EA 5IT9Z 1XGSA 4UUSB 5J1RA 1VF9A 1W0UA 1OCPA 2FXAA 1KONA 2LC2A 2BGCA 2CQKA 5KK1A 3BJ6A 3GFLA 3WTYC 4Z2YA 4UVAA 4XBFA 2VN2A 3KCCA 3HUGB 3WTSC 4CYDA 2IGMA 1IDZA 4LK1F 4KYWA 3DU6A 2CQ7A 2E1MB 5JLWA 4BY1J 2UZKA 1DP3A 3GW2A 3HUGA 4ABZA 3EYYA 1TL8A 1PYVA 3NQOA 2VLAA 1LJ9A 1YE9A 2OZ6A 1TNSA 2E34A 5JHUA 5C4XJ 3H3VK 3HKZN 4IHTA 1ERDA 5FGMA 2X4HA 1JUSA 3K7AJ 5DUIA 1IC8A 2RAEA 2RREA 1FTTA 1HXDA 3OYJA 1E0EA 1ULYA 2X6WA 1K7AA 3PO2J 1U8RA 2FUG2 5CQGA 1BW5A 3BJOA 3W2AA 3OSFA 4L9NA 4HQEA 1TNTA 2DFEA 3T0YA 1JT0A 3AL0C 4MLOA 5GADJ 2N8GA 1I27A 1N75A 3V7CA 3VPRA 3QU3A 2UXNA 4XL9A 3OYNA 2K7LA 2AXTC 1JJ8C 2CU7A 2HOEA 2R3SA 3QP6A 4DBQA 4A3LJ 4BBRJ 3KIOA 1X1CA 4XKBA 3KP7A 3SYTA 3VYUB 4V19K 4HEA2 2BW3B 2PQ8A 2XGCA 2K85A 2OQGA 3KP4A 5FKLA 2EFQA 2DXIA 1SD6A 3BR0A 3BLYA 4EJOA 2BW3A 2QBYA 4A3JJ 4Y13A 4PJMA 4G6DA 4HX4A 1HLVA 3F0CA 4C2UA 3OYMA 1IZ1A 4QPOA 1FBSA 1U0JA 4GGGA 3FDYA 3QPHA 3CC4I 1Q1VA 2CW7A 4MNUA 1E2XA 2ZMEC 3QPLA 1XX5A 3CCRI 1HA8A 2OCEA 3CUQB 5M5XJ 4ESJA 2NAZA 2J5PA 1OLTA 3MWMA 4WK8F 1YRNA 1NK2P 2XGXA 5LRSA 2WAQA 5CVRA 5J1UA 1N77A 3CO6C 5IT9K 3CUQA 5DCFA 3AG4H 2DOFA 3TMOA 2PJRB 4CCNA 2CMPA 2EA4A 2BXZA 1G3SA 2LF8A 3WG9A 2PJRA 1PP7U 1MJBA 5TGTA 2KIFA 3E5UA 1J75A 2VI6A 2Q8KA 9ANTA 1BA5A 4EJUA 2PLYA 4ZDLA 5LLQA 1QU3A 2D2WA 5K7HA 3D0SA 1R4MB 1I6XA 4NNJA 3HXLA 2ZFUA 2KT0A 3F8CA 1ZTRA 2FMLA 3DTIA 1HOMA 5DCMB 1ZR4A 2VIXA 2IA1A 3O6BB 3OYDA 5HS7A 2V6CA 4Q47A 3HOVJ 3F72A 1FIPA 1TLHB 1TWCJ 5DCMA 1DGRM 5J40A 4M9XA 5E17F 1WJBA 2M7AA 3CJTB 5JHFA 5HLHA 1HQCA 1O4XA 1J59A 2V9VA 4M3EA 4D7NA 5JR3A 5LD2C 1GVDA 4OIOF 1I5ZA 3RZDJ 2E2IJ 2PMZA 3CCQI 1IXRC 1FBQA 2GA2A 3FXQA 1YFHA 1N25A 2JSCA 4Y3OA 2FD5A 1X3UA 4B1RA 2RKHA 3KZIC 4KISA 1S7EA 1P7IA 1W5CC 5E20A 4AM3A 5B5EC 3K4MA 4CH7A 1MBFA 1Z05A 2KFDA 1Y8RB 3TQNA 1OMIA 4MTDA 3EETA 2RV8A 5LGTA 3H3ZA 2GXGA 4GYGA 3NWSA 1B9MA 3K1PA 4KT6A 3GUDA 2X0LA 1QPMA 4XN0A 3KYLA 4KUMA 3LNQA 5DM6F 2Y0SA 2VC1A 1HSJA 4XKWA 5CYVA 5DD4A 4EV0A 3JSPA 4E7KA 1WH5A 3LSJA 2GXBA 2MBFA 2LRDA 4U0VA 2M4KA 4G9YA 2KHMA 1ZLJA 1JHHA 3JW4A 3KP5A 1YTYA 2HS5A 2CO5A 1Y0NA 3H5RA 5FRMA 4C30A 4HF1A 2M3AA 5FROA 1DGWY 1JHFA 2XRLA 2DDAA 3PSFA 2V1NA 5F04A 1MGTA 3AG2H 2A6HF 2BY2A 2CFXA 1BN5A 3M8EA 3GVAA 2PMHA 4XLAA 3OOPA 5AIQA 3ZGKA 3H0DA 1SMTA 3QP5A 3OR1C 1XMXA 5JI6A 3K4JA 3HZJA 3DEEA 4J19A 2BVMA 4Y15A 3RQ4A 3VYTB 3DKWA 2A6TA 4CHUA 1HKTA 4PDKA 2VUMJ 2EILH 3C2GA 3V8LA 2Z3YA 3LAPA 5DUKA 2HYJA 3GTKJ 1YI2I 1DQUA 2EK5A 2M2EA 3ZMSA 3TL4X 4YIRX 4IO9F 3O8HA 4GO1A 1Z3YA 2ICWG 1ZK8A 3LSRA 3CCMI 1V5FA 4BQQA 3CDHA 4ZC3A 3LSMA 3OYGA 3I54A 4FCYA 2QQAA 4HW0A 5HLTA 2GQQA 1K6OA 3TOAA 1JUPA 2CYYA 3TDUC 2FJ1A 2KZVA 5ILVA 1ACIA 1W7PD 1DUXC 2GM4A 5HLIA 4RGRA 2K40A 4Y17A 5GAEJ 2QUFA 3RIRA 2R7VA 5FLXZ 4BNCA 1GXQA 1J5YA 1Z0XA 1X58A 3B73A 5B1AH 1Z3XA 2ZJRF 2VL8A 4LFUA 5GPCA 1XC5A 2XF7A 1TTYA 2A69F 4IXAA 2LKPA 1P9QC 2KIMA 3S3NA 4UVBA 5IOZA 1SEUA 4DYCA 2WB1A 2DA6A 2HDWA 3SEQA 2BBYA 3CUOA 4I99C 1EH8A 4BJ5C 1OR7A 3VSLA 5FFZA 4HNVA 3LQQA 4M6XA 5H2FC 2EB7A 3DF8A 3JCUC 2F5FA 2JA6J 2L0KA 3B6CA 2R92J 3K4KA 3G3ZA 4XICA 3CCLI 3S15J 3HEFA 4FTHA 3GEZA 4B3XA 1GUUA 1P2FA 2KQRA 2V7FA 3GF2A 2R7UA 3F6VA 3K69A 3U21A 2IP2A 1X2NA 1KGSA 5J6XA 4S04A 3L2VA 3D5SC 4EQQA 1Y6IA 2E19A 2CQXA 3LSTA 4XLHA 5M3FJ 1TP4A 3CD6I 1BI0A 5HDKA 2LDUA 3HOZJ 2CUEA 1RR7A 2VKDA 4NBQA 3TGNA 4L9JA 5M5YJ 1VNDA 2M8EA 1H9GA 2V1XA 1QRYA 2AHQA 3GLLA 4B48A 5IP9J 1K78B 3ZMZA 2XGDA 5IP7J 2E7XA 3HBLA 4PGGA 2M5WA 2JJ7A 3DKXA 4A0XA 3CCEI 1K78A 2ECBA 1UHSA 4KITB 4XSXF 3DEWA 2M30A 5GAHJ 3G1MA 4IL6C 5DM7F 5D5WB 2F48A 2VONA 1S72I 2I8DA 2Z99A 5EEAA 1AOYA 3F21A 5DTDA 1IRZA 4E7LA 1FSHA 3S3MA 4Y33A 1GDTA 1BOBA 5HNFA 1KYZA 2Z2SB 2BE5F 3ABUA 2M0CA 3OYKA 2D5VA 2VASA 5L3GA 2DFIA 2VQGA 2ZXHA 4WXDA 4BKXA 1IV6A 3BROA 2OD5A 2HVRA 2K5CA 3OYIA 5FLXK 5FJ8J 2HGCA 2DCEA 4YFXF 2GBYA 3H92A 2QENA 4OMYA 1EF4A 1ZHFA 3C1DA 4A3FJ 2FBHA 4MEYF 3K70C 1ETXA 1ON1A 1KU3A 3OOUA 2VPRA 2DOEA 1MKMA 2OQRA 2PN6A 5HOOA 3ERED 3CCVI 4A12A 2IXSA 2W4SA 3KP6A 4C3IJ 1FP1D 1GLNA 3WU1B 3MKYB 4QPQA 2FEZA 2XAUA 3K6GA 2YUSA 4HQMA 1SFKA 3I71A 2OUMA 3HYIA 1MDMB 2W82A 3RDIA 4EM1A 2CV0A 3A2KA 2UXXA 5CQEA 1G4DA 5C3EJ 4PCQA 4BS9A 3R0AA 2X48A 2HDCA 4D5CA 1LB2A 2XPUA 4OINF 4E7JA 3R61A 5ICFA 1TWAJ 2BOLA 2M9HA 1ITYA 3UNGC 2XSJC 4KA4A 2LY2A 1VQOI 1J7KA 4UHTA 2IS1A 1Z6TA 2GIVA 2YU9J 4ZDOA 1WSUA 1GVJA 4G6QA 4CZZA 4BE2A 3EYIA 1YX3A 4QLCU 4I6ZA 1QBJA 4IQJA 5LBQA 1D1CA 3DWLE 3MEXA 3V8KA 1YW9A 2MD0A 3HRMA 2BY0A 1HBXG 2LR8A 4A3BJ 1ONVA 3KETA 4DGWB 3BCBA 3HGGA 4OIRF 4WF2A 3CP2A 3DPTA 3L09A 2M87A 1WHUA 2QM3A 3V8JA 1MBKA 1SFEA 1W7PB 1R49A 2QQ9A 3ZQGA 1OCTC 4PJLA 2Y0MA 2IT0A 4EM0B 4JQFA 2QF7A 2LLKA 1SAXA 1W7PA 4B4CA 2HNHA 3QAHA 3PQKA 4DOZA 2R7RA 4KMFA 4V2GA 3K0LA 1ZN2A 1MBEA 3M8FA 2ZNZA 4XLFA 2FRHA 1KQ0A 2R5ZB 1R6RA 2LREA 5GP9A 2JPCA 5FO5A 1T95A 2VBZA 5K7FA 3CCSI 1ZRFA 3VB2A 4CZCA 1T08B 5FLVA 1X2MA 4J00A 2CS3A 4E70A 1S8NA 3ZQHA 5CVIA 3HTUA 2XF5A 3L2RA 4OAZA 3FIWA 3BCAA 4UNOA 3VYSB 4RAYA 3ABLH 2CV1A 3C7JA 3M9AA 1WZ2A 2EV0A 1X19A 2MH9A 3RKYA 3DPLC 3SZGA 4HBLA 1VQPI 2R7FA 4QSHA 2RGVA 4EATA 4ENNA 5FKKA 1ODDA 5F6FA 3I4PA 2ELJA 2QWWA 4H0EA 1XS9A 2EV5A 3LSIA 2NVQJ 3RZOJ 4DW6A 3ZQQA 3MCZA 1R1TA 2DLLA 3JRCA 1DDNA 3ONQA 4HF0A 5TJJA 4E6KG 2QYOA 3GXOA 3TW7A 1TQIA 3PNVA 1MNEA 4GRIA 4XKCA 3WTVC 2CG4A 1S7AA 5D6EA 4E7IA 2JMWA 3KYCB 1DU6A 3GTOJ 4N4OB 2MC4A 4F52A 1UAAA 1XMKA 2JA8J 3Q5FA 2PFBA 3HHHA 3RYPA 4XLNF 2ISZA 3GX4X 3A1YA 1T0FA 1D5VA 5JVGF 3GBGA 1BI3A 1LNWA 4HLYA 2DTZA 1ZQ3P 2AQFA 2DMUA 2JSPA 2DU9A 3BTIA 4HV5A 3BC8A 4BQOA 3OS2A 2EPFA 1QZEA 3FK7A 4F92B 2WAFA 3L2WA 1UB9A 5ILSA 2JA7J 1Z7UA 5DDGA 2P8TA 3FM3A 3NEUA 2XKPA 3HSRA 3FXRA 3ABMH 2IS4A 2ZXWH 1I1GA 1X1BA 1OQYA
chains in the Genus database with same CATH topology
2XAHA 3IL2A 2DK5A 5D4RA 4I02A 4EGYA 5LHGA 5HLGA 2K4JA 3CJNA 3WTXC 4MGRA 4QWQA 5D4SA 2ISYA 3FXUA 4N9HA 3WTZA 4DQ2A 3WE3A 1IXCA 4OMZA 1QZZA 2FOKA 1B4AA 1OYIA 2L3DA 2MD5A 2DT5A 1BI1A 1DP7P 3ISPA 2MH2A 3F3XA 4YG2F 4KNYA 3HOTA 1V4RA 2L02A 2XRNA 1P4XA 2H27A 4ENMA 1FNNA 1JGSA 3U1DA 3ECOA 4YIFA 1O7LA 3T8TA 1S3JA 2ZBKA 2ADUA 4HF2A 1EV7A 4EM2A 2FBKA 3LFKA 4EGZA 3GZ5A 5J8FA 4RB2C 4KIGA 2F2EA 3HSEA 4LJZF 3MZYA 2ZJ2A 4RB3C 2XAJA 1XD7A 1P92A 5D8KB 1U5TC 1Z91A 2QBYB 2HYGD 2TDXA 5BPIA 2STTA 2YX4A 3DFGA 1H0MA 1ON2A 4IRHA 1R1UA 3IC7A 2BV6A 1XSXA 3U9GA 4IF4A 1B6AA 1FC3A 3I0TA 2FSWA 4HDUA 3SQNA 2UWMA 3CO7C 4FHTA 5E18F 2FU4A 2JT1A 4UV9A 1REPC 3JTHA 4L5JA 3T8RA 5D6FA 1YO5C 4FX4A 3W6KB 2K27A 3IHUA 4WCGA 3GFJA 4OU0A 2YX7A 2EWNA 1ZGJA 4HV6A 5BOXA 1IW7F 2EFNA 1ZAOA 1USSA 1SD5A 2QLZA 2CWEA 1OYYA 1XSVA 1FX7A 3C3WA 3RJPA 5EEHA 4G7HF 1XDUA 1WWXA 2P5LC 2IPQX 3MAJA 2OZUA 2O0YA 4Q4ZF 2PI0A 4P9FA 2O61A 2W25A 1U3EM 3FWEA 5BMZA 1YYVA 5BS6A 1FYKA 2BEOA 4LG0B 3PFIA 4P96A 1IUYA 2ACJA 2ZXJA 3MFKA 4LG0A 3FF5A 2A68F 4ZYHA 2K02A 1K79A 4LB5A 5ICGA 1R00A 2A07F 2XV4S 1ZRCA 1MJ9A 4B09A 3G73A 3HTSB 4NB5A 1STZA 2FE3A 3BJAA 2PEXA 1UHWA 2GZWA 3JTGA 2OAZA 2Q2EA 3RYRA 2XIGA 2G7HA 4I01A 1OYWA 1XGOA 5E8GA 1KU7A 2EA2A 5H6RA 3MZHA 1TW2A 2VOPA 4KDPA 4P9UA 2M1BA 4BH9A 4KFCA 3O3KA 5LHHA 3WU0A 1FPQA 4UUVA 4I2OA 1IF1A 1I1SA 3R6SA 3FMQA 4HX7A 3U2RA 2VBWA 1QNTA 2YU3A 3ROUA 3HRUA 1O57A 3CTAA 1J9IA 1FP2A 2DO7A 1LVAA 1TQPA 2L4AA 1PUEE 4ZYGA 2E1NA 2A3SA 1W5TA 5K5QA 4HX8A 1U6GA 1U78A 3CUQC 1QO0D 1OKRA 4N9IA 2O03A 3F8NA 5L3FA 1ZRDA 1TQMA 4HZFA 5E1WA 4EMSA 3HRTA 1SD7A 2ZNYA 5CLSA 5L3BA 4TV7A 2FNPA 5ILUA 5F1RA 4IVNA 3V7SA 2Z5UA 1RUOA 3CLOA 3BPVA 3KFWX 1A04A 3F23A 5LHIA 3I64A 1T98A 4LB6B 3QU6A 3P9IA 1WRJA 5IT3A 3BDDA 1G3TA 5E1XA 5L3CA 3NRVA 3KLNA 2HWVA 4AIJA 2D1HA 3ZPLA 1LEAA 4CXFA 2DBBA 2IA0A 4RAZA 2NYXA 4O6JA 3JAMZ 2OA4A 4KMUX 3KLOA 1KQ9A 2W57A 3M7GA 1S29A 1O3RA 4FX0A 1YS7A 4BYYA 5JVTA 3HRSA 4ZH4F 5DYMA 3KZZA 3HSFA 4R1HA 2MA3A 1B9NA 3SXYA 1ZH5A 4K2EA 1UCRA 2KJCA 3LA2A 4GYIA 2OBPA 2VC0A 3BWGA 3TKYA 2RQPA 1PDNC 3BPXA 1UHMA 2AS5F 4EJWA 3E5QA 3S2WA 3ECHA 1LDDA 4A0YA 3KEQA 2P6TA 1ZLKA 4L5IA 1NHAA 2E1CA 4O5VA 1W5SA 2EFWA 3TOBA 4KIBA 3B02A 1R1VA 3DP7A 3TO7A 4AD9A 5ICEA 3P9CA 3GZ6A 3IRQA 3I53A 2ZFWA 4B8XA 1YW7A 1ZARA 3IWFA 2PBIA 2V1UA 2DAOA 2H94A 5D5UB 5F64A 1WQ2A 4KICA 1YW8A 3N97A 3F8FA 4O3MA 3KP2A 1RUNA 3BZ6A 3JAMK 2G9WA 4CGZA 2F5DA 1CF7B 2EJRA 3E6DA 3RKXA 1T2KA 2EFPA 1B59A 2VE8A 1CF7A 2IJLA 4WXHA 5A2QZ 6PAXA 5TRDA 2Q0OA 1WKMA 2K86A 3KE2A 4ZZDA 2XAFA 4M73A 1G6NA 1KU2A 2GA1A 2D45A 2Z9OA 1Y0UA 2GAUA 1XGNA 5L3DA 4N0BA 3QPTA 1D8JA 4PZJA 2W84A 2WV0A 3F22A 2L54A 3E6BA 3J80Z 4KIFA 3BP8A 2ZMEB 5DD8A 4MQVA 3WTUC 4UXNA 1FT9A 3Q9VA 2ZMEA 1CGPA 3FHZA 1D8KA 4KN7X 2B0LA 2D1VA 4XLPF 2WC2A 2HEOA 5CJ9A 2EFOA 3L2CA 1P4AA 1HW5A 2BYVE 1LDJA 2W85A 1RNLA 1O3QA 4CO8A 2VOOA 4ESFA 3AAFA 3N4MA 2JRTA 4AIKA 3RPQA 2HFHA 2DI3A 2VBXA 2NNNA 1S6LA 5H6QA 4R8HA 4I98B 3ZMDA 2Z33A 3T5XA 1R7JA 5A2QK 5HS9A 1F9NA 2FBIA 4A6DA 3TDZC 1Z6RA 5K5OA 1L0OC 5BQTA 1R5GA 2HR3A 4KN4X 2NNYA 2FNAA 3GWZA 4P5OA 2MLKA 5CVJA 3EDPA 2VODA 3QOPA 1IN8A 1YIOA 1O7FA 1LQ1A 2PG4A 3J80K 4AWXB 4U7DA 4G94A 2DPDA 1RIOH 1BIBA 1YG2A 3ELKA 1BJAA 1BC7C 2H6BA 1XB4A 1PP8F 1DPRA 5D8LB 4OIPF 4YFNF 2P5KA 2WTEA 3PQJA 1DPUA 3SZPA 5FB2A 4HA8A 3F8MA 4AIHA 2FA5A 3WGGA 1SMYF 1OPCA 1IN7A 4MEXF 2QQBA 4ESBA 2DQRA 2XAGA 2W24A 3E5XA 2HKOA 3H3UA 4L0ZB 3HOSA 2A61A 2M45A 1IRFA 3DQVC 5EEGA 2DQLA 1SFUA 2R7DA 4D0PA 3DEUA 4RGSA 2XASA 2CW0F 4F7ZA 4IRIA 4ZYEA 2F5EA 1GHCA 5HVQC 4M74A 2O8XA 1ZG1A 1R23A 3BY6A 4WX9A 1IAWA 2ETHA 2DPUA 1S7OA 2XKOA 1TBXA 4U0YA 5LEJA 4L9TA 2XUBA 3E3VA 3GYHX 4L9VA 2XHKA 1FWZA 3W6JB 3WTTC 1T39A 1C0WA 4EVIA 4ENKA 3E97A 1BIAA 1FLIA 2KJBA 4MHGA 1XCBA 5D5XB 3WGHA 1T38A 3ML6A 1Q1HA 5HDNA 2ZKZA 4LD5A 1BM9A 4BHBA 2QVOA 4MTEA 1J0RA 3FZVA 2PJPA 3JSOA 2P5VA 4AVPA 3R4KA 1Z9CA 4BAYA 1EH7A 2MC3A 2LF7A 5E8IA 2ELHA 3Q9SA 1FSEA 4EJVA 1G3WA 2HKXA 4BXUA 4M71A 5LGUA 3GFMA 2RVCA 2HQNA 4HOBA 1D3YA 3FX3A 1BOAA 4UV8A 1W4MA 4WXCA 3O2PE 1HSTA 4A0ZA 3SHFA 2A5YB 1RI7A 2STWA 1V3FA 4IPAA 1FOKA 2LNBA 1JXSA 3OV8A 4Q5SF 3GO5A 4XRFA 3I59B 4FT8A 1IRGA 2P6SA 4NHJA 3I59A 1SFXA 5J8CA 2DTRA 1ZG3A 2JTVA 3P7NA 3RTRA 2WWYA 5FD6A 2VT2A 5LEKA 3RKWA 3FMRA 5KVRA 4RB1A 4I0AA 4IHSA 1IN6A 3LWFA 3E6CC 2J5OA 3LA3A 4IRGA 4U0WA 1XMAA 4ENJA 4DNCA 5ICCA 3GLXA 1P4WA 3SZTA 3I58A 3QRFF 2ZCWA 4U7BA 2NRAC 3DV8A 1QZYA 4UVCA 5LRRA 5AONA 3F8BA 2VBYA 2Y75A 4I0BA 1ZG5A 4NQWA 2YSRA 4RS8A 2CSOA 3T1BA 3ZQ7A 4JK1X 2IRFG 4LMYA 3WODF 5HS8A 2EV6A 3K2ZA 1YQAA 1XSDA 1LEBA 2KIUA 1R36A 3WTWC 1HW2A 2ESHA 2L4MA 2COMA 2OU2A 2XVCA 3IRRA 4M9ZA 4P55A 4M72A 1QGPA 3D5LA 1FZPB 4RB0A 5FFXA 4G7OF 2O3FA 3IWZA 5DV5A 4GXOA 1F1ZA 3KEOA 3KZYA 1IN4A 1O3SA 1XN7A 4I09A 4ZZLA 3ABTA 3SFZA 2A6EF 4KT5C 1AWCA 2VXZA 2HYFA 2DW4A 4I7HA 2L01A 3J81Z 2PMUA 1XCVA 2QZ8A 2HTJA 3DXJF 4LGWA 3VOEA 3F6OA 2JZYA 5AIPA 5K1YA 1L3LA 5D5VB 3LQRA 2P7CB 4HYEA 2XAQA 1BI2A 3TO6A 3K1MA 4LK0F 4GCVA 2FF4A 3ZN1A 3ZMTA 3ZMVA 3WGIA 5CVVA 3L9FA 3IKVA 4OOIA 3LA7A 2G7UA 2JPBA 2IA2A 1MDMA 4Q48A 3VODA 4A6EA 3ZMUA 3REOA 2IVMA 3COAC 2YPRA 4L18B 1ZREA 1UFMA 3FM5A 3I5UA 1U2WA 2YR2A 2RDPA 3L00A 1B1BA 1R22A 5ERIA 2DK8A 2V79A 1RZ4A 1QQIA 3HIFA 5BPDA 3WE2A 4U88A 2RC4A 1KU9A 5HDGA 2HQRA 1G3YA 4HDVA 3J81K 4CDGA 2HZTA 5CVUA 3K1NA 2P7VB 1E17A 4BHCA 1IN5A 2C6YA 3IKTA 2RNJA 1O3TA 1GXPA 3ULQB 1T6SA 1EH6A 4A5MA 4ON0A 2O6GE 1FBUA 3HHGA 3M1EA 2RN7A 3V7RA 4G7ZF 4IJAA 4LLNA 2P4WA 3EUHA 1J2XA 2VE9A 1BC8C 1U5TB 4LLGF 4PGHA 1U5TA 3C18A 2FQ3A 1H9TA 4BHPA 2IW5A 1FY7A 1ZGAA 3R60A 2ZO4A 4M6YA 3BOQA 1HKQA 5L3EA 4A5NA 4ZYDA 1KYWA 2F5CA 1R58A 5FD5A 1IXSB 1TW3A 4A2UA 4R79A 5ED4A 3R0JA 1USTA 4YIIA 1FYLA 3ZP5A 1ZYRF 1F5TA 2V1DA 3K9TA 4HLXA 4JBAA 2VT3A 3MQ0A 1HW1A 1LDKB 1YS6A 3VFZA 1XDSA 5DEQA 1KQ8A 1YLFA 4RGXA 1FYMA 1MJAA 2KKOA 2LSOA 3ZN0A 3TO9A 1VTNC 2GWRA 4EJTA 1MZBA 4CICA 4ETSA 2Y48A 3L7WA 1F4KA 5LGNA 4S05A 2E7WA 3KP3A 1R5HA 4BQAA 5H20A 4LLLA 3VEPA 1SD4A 5E1ZB 2FMYA 1KA8A 3FMSA 2K4BA 4OIQF 2KRFA 2NS0A 4ASNA 2CGPA 1Z1DA 4RGUA 3J7AO 4WWCA 3V4GA 4HAMA 1WI9A 1BBYA 4M9SA 3P9KA 2AXLA 5JFRA 1P6RA 1XGMA 1MD0A 3LAJA 3GFIA 4YFKF 5K5RA 2XROA 2HTSA 2H6CA 3E6MA 4XSZF 3EQLF 4L0YB 2MLGA 4G8XA 2ESNA 2H09A 4MQ9F 3RPUA 3RI4A 1JE8A 1HKSA 5IT9Z 1XGSA 2FXAA 2BGCA 2CQKA 5KK1A 3BJ6A 3GFLA 3WTYC 4Z2YA 4UVAA 4XBFA 2VN2A 3KCCA 3WTSC 4CYDA 4LK1F 4KYWA 2UZKA 3GW2A 3HUGA 3EYYA 3NQOA 1LJ9A 2OZ6A 1TNSA 5JHUA 4IHTA 5FGMA 2X4HA 5DUIA 1HXDA 1ULYA 1K7AA 1U8RA 3BJOA 4L9NA 4HQEA 1TNTA 3T0YA 1I27A 3V7CA 3QU3A 2UXNA 2K7LA 2HOEA 2R3SA 3QP6A 3KP7A 2PQ8A 2OQGA 3KP4A 2EFQA 1SD6A 4EJOA 2QBYA 4Y13A 4G6DA 4HX4A 1IZ1A 1FBSA 4GGGA 3QPHA 4MNUA 1E2XA 3CUQB 4ESJA 2NAZA 2J5PA 3MWMA 4WK8F 2XGXA 5LRSA 5CVRA 3CO6C 5IT9K 3CUQA 5DCFA 2EA4A 1G3SA 2LF8A 3WG9A 1PP7U 1MJBA 2KIFA 3E5UA 1J75A 2Q8KA 4EJUA 2PLYA 5LLQA 2D2WA 3D0SA 1I6XA 3F8CA 2FMLA 5DCMB 3O6BB 2IA1A 5HS7A 2V6CA 4Q47A 3F72A 1TLHB 5DCMA 4M9XA 5E17F 5HLHA 1HQCA 1J59A 2V9VA 5JR3A 4OIOF 1I5ZA 1IXRC 1FBQA 2GA2A 3FXQA 1YFHA 2JSCA 1X3UA 2RKHA 5E20A 1Z05A 3TQNA 4MTDA 1OMIA 3EETA 2RV8A 5LGTA 3H3ZA 2GXGA 4GYGA 1B9MA 3K1PA 3GUDA 2X0LA 1QPMA 4KUMA 2VC1A 1HSJA 5CYVA 5DD4A 4EV0A 3JSPA 2GXBA 2MBFA 4U0VA 4G9YA 1ZLJA 1JHHA 3JW4A 3KP5A 1YTYA 2HS5A 2CO5A 4HF1A 1JHFA 1MGTA 2A6HF 2CFXA 1BN5A 3M8EA 3GVAA 2PMHA 5AIQA 3OOPA 1SMTA 3QP5A 5JI6A 4Y15A 3DKWA 4CHUA 1HKTA 4PDKA 3V8LA 2Z3YA 3LAPA 5DUKA 2EK5A 3ZMSA 4GO1A 3CDHA 3I54A 2QQAA 4HW0A 2GQQA 1K6OA 3TOAA 2CYYA 3TDUC 5ILVA 1W7PD 1DUXC 5HLIA 4RGRA 4Y17A 2QUFA 3RIRA 5FLXZ 4BNCA 1GXQA 1J5YA 3B73A 4LFUA 1TTYA 2A69F 4IXAA 2LKPA 2KIMA 4UVBA 2BBYA 3CUOA 1EH8A 1OR7A 5FFZA 3LQQA 4M6XA 2EB7A 3DF8A 2F5FA 3G3ZA 3GEZA 1P2FA 3GF2A 3F6VA 3K69A 2IP2A 5J6XA 1KGSA 4S04A 4EQQA 3LSTA 1BI0A 5HDKA 2LDUA 3TGNA 4L9JA 2M8EA 1H9GA 2V1XA 1K78B 3ZMZA 2E7XA 4PGGA 2M5WA 4A0XA 1K78A 4XSXF 2M30A 5D5WB 2VONA 2Z99A 1AOYA 3F21A 1FSHA 1KYZA 2BE5F 3ABUA 5L3GA 2DFIA 4WXDA 3BROA 2OD5A 5FLXK 2HGCA 4YFXF 3H92A 2QENA 4OMYA 1ZHFA 3C1DA 2FBHA 4MEYF 1ON1A 1KU3A 2OQRA 1MKMA 2PN6A 3ERED 5HOOA 4A12A 3KP6A 1FP1D 3WU1B 2FEZA 4HQMA 3I71A 3HYIA 1MDMB 3RDIA 4EM1A 2UXXA 1G4DA 4PCQA 3R0AA 2HDCA 1LB2A 4OINF 3R61A 5ICFA 4KA4A 1J7KA 4UHTA 1Z6TA 2GIVA 1WSUA 1GVJA 4G6QA 4CZZA 3EYIA 4QLCU 1QBJA 5LBQA 3MEXA 3V8KA 1YW9A 3HRMA 1HBXG 1ONVA 3KETA 4OIRF 4WF2A 3DPTA 3L09A 2M87A 2QM3A 3V8JA 1W7PB 1SFEA 2QQ9A 2Y0MA 2IT0A 4EM0B 4JQFA 1SAXA 1W7PA 3QAHA 3PQKA 4KMFA 3K0LA 1ZN2A 3M8FA 2ZNZA 2FRHA 1KQ0A 2JPCA 5FO5A 2VBZA 1ZRFA 3VB2A 4E70A 1S8NA 5CVIA 3HTUA 4UNOA 4RAYA 3C7JA 3M9AA 2EV0A 2MH9A 3RKYA 3DPLC 4HBLA 2R7FA 2RGVA 4ENNA 1ODDA 5F6FA 3I4PA 2QWWA 4H0EA 2EV5A 3MCZA 1R1TA 2DLLA 1DDNA 4HF0A 5TJJA 2QYOA 3GXOA 1TQIA 3WTVC 2CG4A 1S7AA 5D6EA 1XMKA 3Q5FA 2PFBA 3HHHA 3RYPA 4XLNF 2ISZA 3GX4X 1T0FA 1D5VA 1BI3A 1LNWA 4HLYA 2DU9A 4HV5A 1UB9A 5ILSA 1Z7UA 5DDGA 2P8TA 3FM3A 3NEUA 2XKPA 3HSRA 3FXRA 1I1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAH A;  3IL2 A;  2DK5 A;  5D4R A;  4I02 A;  4EGY A;  5LHG A;  5HLG A;  2K4J A;  3CJN A;  3WTX C;  4MGR A;  4QWQ A;  5D4S A;  2ISY A;  3FXU A;  4N9H A;  3WTZ A;  4DQ2 A;  3WE3 A;  1IXC A;  4OMZ A;  1QZZ A;  2FOK A;  1B4A A;  1OYI A;  2L3D A;  2MD5 A;  2DT5 A;  1BI1 A;  1DP7 P;  3ISP A;  2MH2 A;  3F3X A;  4YG2 F;  4KNY A;  3HOT A;  1V4R A;  2L02 A;  2XRN A;  1P4X A;  2H27 A;  4ENM A;  1FNN A;  1JGS A;  3U1D A;  3ECO A;  4YIF A;  1O7L A;  3T8T A;  1S3J A;  2ZBK A;  2ADU A;  4HF2 A;  1EV7 A;  4EM2 A;  2FBK A;  3LFK A;  4EGZ A;  3GZ5 A;  5J8F A;  4RB2 C;  4KIG A;  2F2E A;  3HSE A;  4LJZ F;  3MZY A;  2ZJ2 A;  4RB3 C;  2XAJ A;  1XD7 A;  1P92 A;  5D8K B;  1U5T C;  1Z91 A;  2QBY B;  2HYG D;  2TDX A;  5BPI A;  2STT A;  2YX4 A;  3DFG A;  1H0M A;  1ON2 A;  4IRH A;  1R1U A;  3IC7 A;  2BV6 A;  1XSX A;  3U9G A;  4IF4 A;  1B6A A;  1FC3 A;  3I0T A;  2FSW A;  4HDU A;  3SQN A;  2UWM A;  3CO7 C;  4FHT A;  5E18 F;  2FU4 A;  2JT1 A;  4UV9 A;  1REP C;  3JTH A;  4L5J A;  3T8R A;  5D6F A;  1YO5 C;  4FX4 A;  3W6K B;  2K27 A;  3IHU A;  4WCG A;  3GFJ A;  4OU0 A;  2YX7 A;  2EWN A;  1ZGJ A;  4HV6 A;  5BOX A;  1IW7 F;  2EFN A;  1ZAO A;  1USS A;  1SD5 A;  2QLZ A;  2CWE A;  1OYY A;  1XSV A;  1FX7 A;  3C3W A;  3RJP A;  5EEH A;  4G7H F;  1XDU A;  1WWX A;  2P5L C;  2IPQ X;  3MAJ A;  2OZU A;  2O0Y A;  4Q4Z F;  2PI0 A;  4P9F A;  2O61 A;  2W25 A;  1U3E M;  3FWE A;  5BMZ A;  1YYV A;  5BS6 A;  1FYK A;  2BEO A;  4LG0 B;  3PFI A;  4P96 A;  1IUY A;  2ACJ A;  2ZXJ A;  3MFK A;  4LG0 A;  3FF5 A;  2A68 F;  4ZYH A;  2K02 A;  1K79 A;  4LB5 A;  5ICG A;  1R00 A;  2A07 F;  2XV4 S;  1ZRC A;  1MJ9 A;  4B09 A;  3G73 A;  3HTS B;  4NB5 A;  1STZ A;  2FE3 A;  3BJA A;  2PEX A;  1UHW A;  2GZW A;  3JTG A;  2OAZ A;  2Q2E A;  3RYR A;  2XIG A;  2G7H A;  4I01 A;  1OYW A;  1XGO A;  5E8G A;  1KU7 A;  2EA2 A;  5H6R A;  3MZH A;  1TW2 A;  2VOP A;  4KDP A;  4P9U A;  2M1B A;  4BH9 A;  4KFC A;  3O3K A;  5LHH A;  3WU0 A;  1FPQ A;  4UUV A;  4I2O A;  1IF1 A;  1I1S A;  3R6S A;  3FMQ A;  4HX7 A;  3U2R A;  2VBW A;  1QNT A;  2YU3 A;  3ROU A;  3HRU A;  1O57 A;  3CTA A;  1J9I A;  1FP2 A;  2DO7 A;  1LVA A;  1TQP A;  2L4A A;  1PUE E;  4ZYG A;  2E1N A;  2A3S A;  1W5T A;  5K5Q A;  4HX8 A;  1U6G A;  1U78 A;  3CUQ C;  1QO0 D;  1OKR A;  4N9I A;  2O03 A;  3F8N A;  5L3F A;  1ZRD A;  1TQM A;  4HZF A;  5E1W A;  4EMS A;  3HRT A;  1SD7 A;  2ZNY A;  5CLS A;  5L3B A;  4TV7 A;  2FNP A;  5ILU A;  5F1R A;  4IVN A;  3V7S A;  2Z5U A;  1RUO A;  3CLO A;  3BPV A;  3KFW X;  1A04 A;  3F23 A;  5LHI A;  3I64 A;  1T98 A;  4LB6 B;  3QU6 A;  3P9I A;  1WRJ A;  5IT3 A;  3BDD A;  1G3T A;  5E1X A;  5L3C A;  3NRV A;  3KLN A;  2HWV A;  4AIJ A;  2D1H A;  3ZPL A;  1LEA A;  4CXF A;  2DBB A;  2IA0 A;  4RAZ A;  2NYX A;  4O6J A;  3JAM Z;  2OA4 A;  4KMU X;  3KLO A;  1KQ9 A;  2W57 A;  3M7G A;  1S29 A;  1O3R A;  4FX0 A;  1YS7 A;  4BYY A;  5JVT A;  3HRS A;  4ZH4 F;  5DYM A;  3KZZ A;  3HSF A;  4R1H A;  2MA3 A;  1B9N A;  3SXY A;  1ZH5 A;  4K2E A;  1UCR A;  2KJC A;  3LA2 A;  4GYI A;  2OBP A;  2VC0 A;  3BWG A;  3TKY A;  2RQP A;  1PDN C;  3BPX A;  1UHM A;  2AS5 F;  4EJW A;  3E5Q A;  3S2W A;  3ECH A;  1LDD A;  4A0Y A;  3KEQ A;  2P6T A;  1ZLK A;  4L5I A;  1NHA A;  2E1C A;  4O5V A;  1W5S A;  2EFW A;  3TOB A;  4KIB A;  3B02 A;  1R1V A;  3DP7 A;  3TO7 A;  4AD9 A;  5ICE A;  3P9C A;  3GZ6 A;  3IRQ A;  3I53 A;  2ZFW A;  4B8X A;  1YW7 A;  1ZAR A;  3IWF A;  2PBI A;  2V1U A;  2DAO A;  2H94 A;  5D5U B;  5F64 A;  1WQ2 A;  4KIC A;  1YW8 A;  3N97 A;  3F8F A;  4O3M A;  3KP2 A;  1RUN A;  3BZ6 A;  3JAM K;  2G9W A;  4CGZ A;  2F5D A;  1CF7 B;  2EJR A;  3E6D A;  3RKX A;  1T2K A;  2EFP A;  1B59 A;  2VE8 A;  1CF7 A;  2IJL A;  4WXH A;  5A2Q Z;  6PAX A;  5TRD A;  2Q0O A;  1WKM A;  2K86 A;  3KE2 A;  4ZZD A;  2XAF A;  4M73 A;  1G6N A;  1KU2 A;  2GA1 A;  2D45 A;  2Z9O A;  1Y0U A;  2GAU A;  1XGN A;  5L3D A;  4N0B A;  3QPT A;  1D8J A;  4PZJ A;  2W84 A;  2WV0 A;  3F22 A;  2L54 A;  3E6B A;  3J80 Z;  4KIF A;  3BP8 A;  2ZME B;  5DD8 A;  4MQV A;  3WTU C;  4UXN A;  1FT9 A;  3Q9V A;  2ZME A;  1CGP A;  3FHZ A;  1D8K A;  4KN7 X;  2B0L A;  2D1V A;  4XLP F;  2WC2 A;  2HEO A;  5CJ9 A;  2EFO A;  3L2C A;  1P4A A;  1HW5 A;  2BYV E;  1LDJ A;  2W85 A;  1RNL A;  1O3Q A;  4CO8 A;  2VOO A;  4ESF A;  3AAF A;  3N4M A;  2JRT A;  4AIK A;  3RPQ A;  2HFH A;  2DI3 A;  2VBX A;  2NNN A;  1S6L A;  5H6Q A;  4R8H A;  4I98 B;  3ZMD A;  2Z33 A;  3T5X A;  1R7J A;  5A2Q K;  5HS9 A;  1F9N A;  2FBI A;  4A6D A;  3TDZ C;  1Z6R A;  5K5O A;  1L0O C;  5BQT A;  1R5G A;  2HR3 A;  4KN4 X;  2NNY A;  2FNA A;  3GWZ A;  4P5O A;  2MLK A;  5CVJ A;  3EDP A;  2VOD A;  3QOP A;  1IN8 A;  1YIO A;  1O7F A;  1LQ1 A;  2PG4 A;  3J80 K;  4AWX B;  4U7D A;  4G94 A;  2DPD A;  1RIO H;  1BIB A;  1YG2 A;  3ELK A;  1BJA A;  1BC7 C;  2H6B A;  1XB4 A;  1PP8 F;  1DPR A;  5D8L B;  4OIP F;  4YFN F;  2P5K A;  2WTE A;  3PQJ A;  1DPU A;  3SZP A;  5FB2 A;  4HA8 A;  3F8M A;  4AIH A;  2FA5 A;  3WGG A;  1SMY F;  1OPC A;  1IN7 A;  4MEX F;  2QQB A;  4ESB A;  2DQR A;  2XAG A;  2W24 A;  3E5X A;  2HKO A;  3H3U A;  4L0Z B;  3HOS A;  2A61 A;  2M45 A;  1IRF A;  3DQV C;  5EEG A;  2DQL A;  1SFU A;  2R7D A;  4D0P A;  3DEU A;  4RGS A;  2XAS A;  2CW0 F;  4F7Z A;  4IRI A;  4ZYE A;  2F5E A;  1GHC A;  5HVQ C;  4M74 A;  2O8X A;  1ZG1 A;  1R23 A;  3BY6 A;  4WX9 A;  1IAW A;  2ETH A;  2DPU A;  1S7O A;  2XKO A;  1TBX A;  4U0Y A;  5LEJ A;  4L9T A;  2XUB A;  3E3V A;  3GYH X;  4L9V A;  2XHK A;  1FWZ A;  3W6J B;  3WTT C;  1T39 A;  1C0W A;  4EVI A;  4ENK A;  3E97 A;  1BIA A;  1FLI A;  2KJB A;  4MHG A;  1XCB A;  5D5X B;  3WGH A;  1T38 A;  3ML6 A;  1Q1H A;  5HDN A;  2ZKZ A;  4LD5 A;  1BM9 A;  4BHB A;  2QVO A;  4MTE A;  1J0R A;  3FZV A;  2PJP A;  3JSO A;  2P5V A;  4AVP A;  3R4K A;  1Z9C A;  4BAY A;  1EH7 A;  2MC3 A;  2LF7 A;  5E8I A;  2ELH A;  3Q9S A;  1FSE A;  4EJV A;  1G3W A;  2HKX A;  4BXU A;  4M71 A;  5LGU A;  3GFM A;  2RVC A;  2HQN A;  4HOB A;  1D3Y A;  3FX3 A;  1BOA A;  4UV8 A;  1W4M A;  4WXC A;  3O2P E;  1HST A;  4A0Z A;  3SHF A;  2A5Y B;  1RI7 A;  2STW A;  1V3F A;  4IPA A;  1FOK A;  2LNB A;  1JXS A;  3OV8 A;  4Q5S F;  3GO5 A;  4XRF A;  3I59 B;  4FT8 A;  1IRG A;  2P6S A;  4NHJ A;  3I59 A;  1SFX A;  5J8C A;  2DTR A;  1ZG3 A;  2JTV A;  3P7N A;  3RTR A;  2WWY A;  5FD6 A;  2VT2 A;  5LEK A;  3RKW A;  3FMR A;  5KVR A;  4RB1 A;  4I0A A;  4IHS A;  1IN6 A;  3LWF A;  3E6C C;  2J5O A;  3LA3 A;  4IRG A;  4U0W A;  1XMA A;  4ENJ A;  4DNC A;  5ICC A;  3GLX A;  1P4W A;  3SZT A;  3I58 A;  3QRF F;  2ZCW A;  4U7B A;  2NRA C;  3DV8 A;  1QZY A;  4UVC A;  5LRR A;  5AON A;  3F8B A;  2VBY A;  2Y75 A;  4I0B A;  1ZG5 A;  4NQW A;  2YSR A;  4RS8 A;  2CSO A;  3T1B A;  3ZQ7 A;  4JK1 X;  2IRF G;  4LMY A;  3WOD F;  5HS8 A;  2EV6 A;  3K2Z A;  1YQA A;  1XSD A;  1LEB A;  2KIU A;  1R36 A;  3WTW C;  1HW2 A;  2ESH A;  2L4M A;  2COM A;  2OU2 A;  2XVC A;  3IRR A;  4M9Z A;  4P55 A;  4M72 A;  1QGP A;  3D5L A;  1FZP B;  4RB0 A;  5FFX A;  4G7O F;  2O3F A;  3IWZ A;  5DV5 A;  4GXO A;  1F1Z A;  3KEO A;  3KZY A;  1IN4 A;  1O3S A;  1XN7 A;  4I09 A;  4ZZL A;  3ABT A;  3SFZ A;  2A6E F;  4KT5 C;  1AWC A;  2VXZ A;  2HYF A;  2DW4 A;  4I7H A;  2L01 A;  3J81 Z;  2PMU A;  1XCV A;  2QZ8 A;  2HTJ A;  3DXJ F;  4LGW A;  3VOE A;  3F6O A;  2JZY A;  5AIP A;  5K1Y A;  1L3L A;  5D5V B;  3LQR A;  2P7C B;  4HYE A;  2XAQ A;  1BI2 A;  3TO6 A;  3K1M A;  4LK0 F;  4GCV A;  2FF4 A;  3ZN1 A;  3ZMT A;  3ZMV A;  3WGI A;  5CVV A;  3L9F A;  3IKV A;  4OOI A;  3LA7 A;  2G7U A;  2JPB A;  2IA2 A;  1MDM A;  4Q48 A;  3VOD A;  4A6E A;  3ZMU A;  3REO A;  2IVM A;  3COA C;  2YPR A;  4L18 B;  1ZRE A;  1UFM A;  3FM5 A;  3I5U A;  1U2W A;  2YR2 A;  2RDP A;  3L00 A;  1B1B A;  1R22 A;  5ERI A;  2DK8 A;  2V79 A;  1RZ4 A;  1QQI A;  3HIF A;  5BPD A;  3WE2 A;  4U88 A;  2RC4 A;  1KU9 A;  5HDG A;  2HQR A;  1G3Y A;  4HDV A;  3J81 K;  4CDG A;  2HZT A;  5CVU A;  3K1N A;  2P7V B;  1E17 A;  4BHC A;  1IN5 A;  2C6Y A;  3IKT A;  2RNJ A;  1O3T A;  1GXP A;  3ULQ B;  1T6S A;  1EH6 A;  4A5M A;  4ON0 A;  2O6G E;  1FBU A;  3HHG A;  3M1E A;  2RN7 A;  3V7R A;  4G7Z F;  4IJA A;  4LLN A;  2P4W A;  3EUH A;  1J2X A;  2VE9 A;  1BC8 C;  1U5T B;  4LLG F;  4PGH A;  1U5T A;  3C18 A;  2FQ3 A;  1H9T A;  4BHP A;  2IW5 A;  1FY7 A;  1ZGA A;  3R60 A;  2ZO4 A;  4M6Y A;  3BOQ A;  1HKQ A;  5L3E A;  4A5N A;  4ZYD A;  1KYW A;  2F5C A;  1R58 A;  5FD5 A;  1IXS B;  1TW3 A;  4A2U A;  4R79 A;  5ED4 A;  3R0J A;  1UST A;  4YII A;  1FYL A;  3ZP5 A;  1ZYR F;  1F5T A;  2V1D A;  3K9T A;  4HLX A;  4JBA A;  2VT3 A;  3MQ0 A;  1HW1 A;  1LDK B;  1YS6 A;  3VFZ A;  1XDS A;  5DEQ A;  1KQ8 A;  1YLF A;  4RGX A;  1FYM A;  1MJA A;  2KKO A;  2LSO A;  3ZN0 A;  3TO9 A;  1VTN C;  2GWR A;  4EJT A;  1MZB A;  4CIC A;  4ETS A;  2Y48 A;  3L7W A;  1F4K A;  5LGN A;  4S05 A;  2E7W A;  3KP3 A;  1R5H A;  4BQA A;  5H20 A;  4LLL A;  3VEP A;  1SD4 A;  5E1Z B;  2FMY A;  1KA8 A;  3FMS A;  2K4B A;  4OIQ F;  2KRF A;  2NS0 A;  4ASN A;  2CGP A;  1Z1D A;  4RGU A;  3J7A O;  4WWC A;  3V4G A;  4HAM A;  1WI9 A;  1BBY A;  4M9S A;  3P9K A;  2AXL A;  5JFR A;  1P6R A;  1XGM A;  1MD0 A;  3LAJ A;  3GFI A;  4YFK F;  5K5R A;  2XRO A;  2HTS A;  2H6C A;  3E6M A;  4XSZ F;  3EQL F;  4L0Y B;  2MLG A;  4G8X A;  2ESN A;  2H09 A;  4MQ9 F;  3RPU A;  3RI4 A;  1JE8 A;  1HKS A;  5IT9 Z;  1XGS A;  2FXA A;  2BGC A;  2CQK A;  5KK1 A;  3BJ6 A;  3GFL A;  3WTY C;  4Z2Y A;  4UVA A;  4XBF A;  2VN2 A;  3KCC A;  3WTS C;  4CYD A;  4LK1 F;  4KYW A;  2UZK A;  3GW2 A;  3HUG A;  3EYY A;  3NQO A;  1LJ9 A;  2OZ6 A;  1TNS A;  5JHU A;  4IHT A;  5FGM A;  2X4H A;  5DUI A;  1HXD A;  1ULY A;  1K7A A;  1U8R A;  3BJO A;  4L9N A;  4HQE A;  1TNT A;  3T0Y A;  1I27 A;  3V7C A;  3QU3 A;  2UXN A;  2K7L A;  2HOE A;  2R3S A;  3QP6 A;  3KP7 A;  2PQ8 A;  2OQG A;  3KP4 A;  2EFQ A;  1SD6 A;  4EJO A;  2QBY A;  4Y13 A;  4G6D A;  4HX4 A;  1IZ1 A;  1FBS A;  4GGG A;  3QPH A;  4MNU A;  1E2X A;  3CUQ B;  4ESJ A;  2NAZ A;  2J5P A;  3MWM A;  4WK8 F;  2XGX A;  5LRS A;  5CVR A;  3CO6 C;  5IT9 K;  3CUQ A;  5DCF A;  2EA4 A;  1G3S A;  2LF8 A;  3WG9 A;  1PP7 U;  1MJB A;  2KIF A;  3E5U A;  1J75 A;  2Q8K A;  4EJU A;  2PLY A;  5LLQ A;  2D2W A;  3D0S A;  1I6X A;  3F8C A;  2FML A;  5DCM B;  3O6B B;  2IA1 A;  5HS7 A;  2V6C A;  4Q47 A;  3F72 A;  1TLH B;  5DCM A;  4M9X A;  5E17 F;  5HLH A;  1HQC A;  1J59 A;  2V9V A;  5JR3 A;  4OIO F;  1I5Z A;  1IXR C;  1FBQ A;  2GA2 A;  3FXQ A;  1YFH A;  2JSC A;  1X3U A;  2RKH A;  5E20 A;  1Z05 A;  3TQN A;  4MTD A;  1OMI A;  3EET A;  2RV8 A;  5LGT A;  3H3Z A;  2GXG A;  4GYG A;  1B9M A;  3K1P A;  3GUD A;  2X0L A;  1QPM A;  4KUM A;  2VC1 A;  1HSJ A;  5CYV A;  5DD4 A;  4EV0 A;  3JSP A;  2GXB A;  2MBF A;  4U0V A;  4G9Y A;  1ZLJ A;  1JHH A;  3JW4 A;  3KP5 A;  1YTY A;  2HS5 A;  2CO5 A;  4HF1 A;  1JHF A;  1MGT A;  2A6H F;  2CFX A;  1BN5 A;  3M8E A;  3GVA A;  2PMH A;  5AIQ A;  3OOP A;  1SMT A;  3QP5 A;  5JI6 A;  4Y15 A;  3DKW A;  4CHU A;  1HKT A;  4PDK A;  3V8L A;  2Z3Y A;  3LAP A;  5DUK A;  2EK5 A;  3ZMS A;  4GO1 A;  3CDH A;  3I54 A;  2QQA A;  4HW0 A;  2GQQ A;  1K6O A;  3TOA A;  2CYY A;  3TDU C;  5ILV A;  1W7P D;  1DUX C;  5HLI A;  4RGR A;  4Y17 A;  2QUF A;  3RIR A;  5FLX Z;  4BNC A;  1GXQ A;  1J5Y A;  3B73 A;  4LFU A;  1TTY A;  2A69 F;  4IXA A;  2LKP A;  2KIM A;  4UVB A;  2BBY A;  3CUO A;  1EH8 A;  1OR7 A;  5FFZ A;  3LQQ A;  4M6X A;  2EB7 A;  3DF8 A;  2F5F A;  3G3Z A;  3GEZ A;  1P2F A;  3GF2 A;  3F6V A;  3K69 A;  2IP2 A;  5J6X A;  1KGS A;  4S04 A;  4EQQ A;  3LST A;  1BI0 A;  5HDK A;  2LDU A;  3TGN A;  4L9J A;  2M8E A;  1H9G A;  2V1X A;  1K78 B;  3ZMZ A;  2E7X A;  4PGG A;  2M5W A;  4A0X A;  1K78 A;  4XSX F;  2M30 A;  5D5W B;  2VON A;  2Z99 A;  1AOY A;  3F21 A;  1FSH A;  1KYZ A;  2BE5 F;  3ABU A;  5L3G A;  2DFI A;  4WXD A;  3BRO A;  2OD5 A;  5FLX K;  2HGC A;  4YFX F;  3H92 A;  2QEN A;  4OMY A;  1ZHF A;  3C1D A;  2FBH A;  4MEY F;  1ON1 A;  1KU3 A;  2OQR A;  1MKM A;  2PN6 A;  3ERE D;  5HOO A;  4A12 A;  3KP6 A;  1FP1 D;  3WU1 B;  2FEZ A;  4HQM A;  3I71 A;  3HYI A;  1MDM B;  3RDI A;  4EM1 A;  2UXX A;  1G4D A;  4PCQ A;  3R0A A;  2HDC A;  1LB2 A;  4OIN F;  3R61 A;  5ICF A;  4KA4 A;  1J7K A;  4UHT A;  1Z6T A;  2GIV A;  1WSU A;  1GVJ A;  4G6Q A;  4CZZ A;  3EYI A;  4QLC U;  1QBJ A;  5LBQ A;  3MEX A;  3V8K A;  1YW9 A;  3HRM A;  1HBX G;  1ONV A;  3KET A;  4OIR F;  4WF2 A;  3DPT A;  3L09 A;  2M87 A;  2QM3 A;  3V8J A;  1W7P B;  1SFE A;  2QQ9 A;  2Y0M A;  2IT0 A;  4EM0 B;  4JQF A;  1SAX A;  1W7P A;  3QAH A;  3PQK A;  4KMF A;  3K0L A;  1ZN2 A;  3M8F A;  2ZNZ A;  2FRH A;  1KQ0 A;  2JPC A;  5FO5 A;  2VBZ A;  1ZRF A;  3VB2 A;  4E70 A;  1S8N A;  5CVI A;  3HTU A;  4UNO A;  4RAY A;  3C7J A;  3M9A A;  2EV0 A;  2MH9 A;  3RKY A;  3DPL C;  4HBL A;  2R7F A;  2RGV A;  4ENN A;  1ODD A;  5F6F A;  3I4P A;  2QWW A;  4H0E A;  2EV5 A;  3MCZ A;  1R1T A;  2DLL A;  1DDN A;  4HF0 A;  5TJJ A;  2QYO A;  3GXO A;  1TQI A;  3WTV C;  2CG4 A;  1S7A A;  5D6E A;  1XMK A;  3Q5F A;  2PFB A;  3HHH A;  3RYP A;  4XLN F;  2ISZ A;  3GX4 X;  1T0F A;  1D5V A;  1BI3 A;  1LNW A;  4HLY A;  2DU9 A;  4HV5 A;  1UB9 A;  5ILS A;  1Z7U A;  5DDG A;  2P8T A;  3FM3 A;  3NEU A;  2XKP A;  3HSR A;  3FXR A;  1I1G A; 
#chains in the Genus database with same CATH topology
 4E7S A;  3JR9 A;  4E4H A;  2BVL A;  2XAH A;  4W97 A;  2O9L A;  3GTJ J;  3IL2 A;  2DK5 A;  5D4R A;  4IHX A;  4I02 A;  1FTZ A;  1WPK A;  5LHG A;  2V9K A;  4EGY A;  1VFC A;  5HLG A;  2K4J A;  4D1Q A;  1LE8 A;  3I3L A;  1SVL A;  3LL7 A;  3CJN A;  3WTX C;  3SEZ A;  3F9K A;  4MGR A;  2LG4 A;  4QWQ A;  2WA0 A;  5D4S A;  2ISY A;  3OL3 A;  3HDD A;  2H1L A;  3FXU A;  4N9H A;  3TP3 A;  1PJR A;  3WTZ A;  4DQ2 A;  4CCL A;  4Y4R A;  3A4C A;  1IXC A;  3WE3 A;  3IAS 2;  5EJC A;  4OMZ A;  1QZZ A;  1SVO A;  2FOK A;  4A3C J;  2WY8 Q;  4Y52 J;  1FJL A;  3NWT A;  1B4A A;  1OYI A;  2DFF A;  2L3D A;  2WAQ N;  4XNF A;  2MD5 A;  2ME0 A;  3IP4 B;  1EA3 A;  3MZ8 A;  3QQA A;  2DT5 A;  3HL2 A;  2ELK A;  1BI1 A;  4A69 C;  4BEH B;  1SAU A;  1MNM C;  1DP7 P;  2DMQ A;  3ISP A;  2MH2 A;  3F3X A;  4NDL A;  4YG2 F;  4BEH A;  4KNY A;  2KLO A;  3HOT A;  1B72 B;  1V4R A;  2L02 A;  2XRN A;  4XID A;  3BR3 A;  1RET A;  4RM2 A;  1P4X A;  1I6H J;  2HI3 A;  2ZSI B;  4Y7N J;  1B72 A;  2H27 A;  4ENM A;  1OJL A;  1T8I A;  2TRT A;  2LH9 A;  1E3H A;  1FNN A;  1MMS A;  1JGS A;  2XC7 A;  3HB9 A;  2VJJ A;  4CA0 A;  3U1D A;  1IUF A;  3PJR A;  2LMD A;  2ZJQ F;  3ECO A;  4BXX J;  4YIF A;  1YIJ I;  2AO9 A;  3ZXS A;  1O7L A;  3T8T A;  1E3P A;  1S3J A;  2ZBK A;  1EKE A;  1LPQ A;  2ADU A;  2PMZ N;  1JJ6 C;  4HF2 A;  2UUZ A;  1EV7 A;  4Z6Y A;  4OWR B;  2NS8 A;  4EM2 A;  2FBK A;  3CZ6 A;  3LFK A;  2EIM H;  4EGZ A;  3GZ5 A;  3CCU I;  1HDD C;  5J8F A;  3ZR8 X;  3PNY A;  3K4N A;  2K9Q A;  3EUH C;  2LOO A;  4RB2 C;  4KIG A;  4C2T A;  4PSW A;  3HC7 A;  3BZC A;  2ME6 A;  2R7S A;  1VQ6 I;  2F2E A;  3HSE A;  4LJZ F;  3MZY A;  2ZJ2 A;  4RB3 C;  2XAJ A;  1XD7 A;  1P92 A;  5D8K B;  3S1M J;  1U5T C;  1Z91 A;  2QBY B;  2HYG D;  4XRS G;  2TDX A;  5BPI A;  1QPI A;  5FKM A;  2STT A;  2YX4 A;  3DFG A;  1H0M A;  2MGQ A;  1ON2 A;  4IRH A;  1LFP A;  2KMU A;  2ZJP F;  1A6Q A;  2IBD A;  1R1U A;  3BG9 A;  4W1U A;  1YRN B;  4XN3 A;  4AYB N;  3IC7 A;  1YIT I;  2BV6 A;  1XSX A;  2L9N A;  1B8I B;  3U9G A;  4IF4 A;  2KP6 A;  1B6A A;  4OAY A;  2XDV A;  3ZQI A;  1FC3 A;  4JP0 A;  1B8I A;  2KDZ A;  3Q3S A;  3I0T A;  4YRV A;  4RAG A;  4IHV A;  2FSW A;  4B3A A;  4HDU A;  3SQN A;  3S2H J;  3OYC A;  4F3Q A;  3BR6 A;  1FMV A;  2UWM A;  5KNL A;  4HNU A;  1ETW A;  3CO7 C;  4FHT A;  5E18 F;  4N4N B;  2FU4 A;  2JT1 A;  4UV9 A;  3DCF A;  1ORK A;  1REP C;  3JTH A;  4FET A;  4L5J A;  2JUG A;  3D5R C;  3T8R A;  3S93 A;  5D6F A;  2QA4 I;  3OSG A;  1YO5 C;  2XPV A;  4FX4 A;  2EQR A;  3W6K B;  3H9G A;  4WWC A;  2K27 A;  3IHU A;  2EBI A;  4WCG A;  3GFJ A;  1AKH A;  2JVH A;  4OU0 A;  2YX7 A;  1IO2 A;  3H36 A;  2EWN A;  1VQ5 I;  1ZGJ A;  4XRS A;  4HV6 A;  3WG7 H;  2CUF A;  5BOX A;  1IW7 F;  1V5E A;  2EFN A;  1ZAO A;  5M3M J;  1USS A;  2CQQ A;  1WJD A;  3IH3 A;  1SD5 A;  2QLZ A;  5EYR A;  5GAG J;  1RKT A;  2CWE A;  1PVE A;  1OYY A;  1XSV A;  4A3I J;  1K61 A;  5EDN A;  2DYS H;  1WJF A;  1FX7 A;  3OIP A;  2F5V A;  3C3W A;  3BTC A;  3RJP A;  5EEH A;  1XDU A;  1WWX A;  4H4K C;  4G7H F;  2CQN A;  2P5L C;  3JRG A;  3NAR A;  2IPQ X;  3MAJ A;  2OZU A;  4M3G A;  2O0Y A;  4Q4Z F;  2PI0 A;  4P9F A;  2O61 A;  3PSI A;  2W25 A;  1U3E M;  3FWE A;  5BMZ A;  1YYV A;  3SDB A;  1ZR2 A;  4XON A;  2TCT A;  1XG1 A;  5KCM A;  5BS6 A;  2K9S A;  1FYK A;  3G1L A;  2BEO A;  4LG0 B;  3PFI A;  3UKG A;  4P96 A;  2B9S A;  1IUY A;  2ACJ A;  1FMW A;  2ZXJ A;  3MFK A;  3CLQ A;  1YJ9 I;  4LG0 A;  3FF5 A;  2A68 F;  4ZYH A;  2K02 A;  3L2U A;  1K79 A;  4LB5 A;  3FXL A;  5ICG A;  1R00 A;  5EG0 B;  1A5J A;  2KIQ A;  2A07 F;  1F36 A;  2XV4 S;  1ZRC A;  2M34 A;  1MJ9 A;  4B09 A;  1W0T A;  2DJN A;  5EG0 A;  3BT9 A;  1I3Q J;  3G73 A;  3HTS B;  4NB5 A;  2Q2E B;  1STZ A;  1MBH A;  2FE3 A;  3BJA A;  4J01 A;  2PEX A;  1UHW A;  2GZW A;  4AID A;  2OAZ A;  3JTG A;  2Q2E A;  3I56 I;  3OIO A;  3RYR A;  2XIG A;  2G7H A;  2ZC2 A;  4I01 A;  4BL0 B;  1FIA A;  4LIV A;  1OYW A;  2E1M C;  1EJ9 A;  4NC8 A;  3PO3 J;  1XGO A;  2K3P A;  5E8G A;  1KU7 A;  1QHG A;  2EA2 A;  3PUF A;  5H6R A;  3MZH A;  1TW2 A;  2KRH A;  2VOP A;  2LKS A;  5B66 C;  4KDP A;  4IKF A;  3EUA A;  4P9U A;  4PJ0 C;  3OS0 A;  2M1B A;  4BH9 A;  4BDZ A;  4KFC A;  3O3K A;  3DU5 A;  4JX4 A;  2COB A;  3WU0 A;  5LHH A;  1FPQ A;  2DYR H;  3K4B A;  5IOY A;  4CUG A;  5F27 A;  4LIU A;  2EZK A;  3SDG A;  3ERM A;  1MBJ A;  4PJJ A;  3ZQC A;  4UUV A;  4I2O A;  1FEX A;  3H9J A;  1IF1 A;  2OJE D;  1I1S A;  3R6S A;  3E7L A;  2QQ8 A;  3FMQ A;  2XF6 A;  2O7O A;  1X3W B;  3IUO A;  2DN0 A;  3HJE A;  4HX7 A;  3U2R A;  2VBW A;  1QNT A;  2LKX A;  2YU3 A;  2HOS A;  3ROU A;  3LMM A;  4FQG A;  4DYR A;  4XMY A;  3HRU A;  4A3E J;  1O57 A;  4BQN A;  3CTA A;  5LFA A;  3FXK A;  1J9I A;  1FP2 A;  2DO7 A;  3PNT A;  4G12 A;  2O8K A;  1LVA A;  3W2W A;  1TQP A;  2L4A A;  1PUE E;  2L2O A;  4ZTF A;  4ZYG A;  2E1N A;  4IOA F;  4BGD A;  1KZH A;  2A3S A;  1RKW A;  1W5T A;  3BQY A;  1HC8 A;  4XM3 A;  5K5Q A;  2OF7 A;  1G59 A;  5IYC J;  3PFY A;  4HX8 A;  1U6G A;  1U78 A;  1MH4 A;  3CUQ C;  1QO0 D;  1OKR A;  5F0H A;  4N9I A;  2O03 A;  3F8N A;  5L3F A;  1ZRD A;  1TQM A;  2X51 A;  4HZF A;  3A0B C;  5E1W A;  4BUP A;  4EMS A;  1LUJ B;  4CCM A;  3HRT A;  3OMY A;  1SD7 A;  2ZNY A;  5CLS A;  5L3B A;  2E2H J;  4TV7 A;  3OYE A;  2L9S A;  2FNP A;  1K83 J;  1R5I D;  3FBI B;  5ILU A;  2JK3 A;  2LVS A;  5F1R A;  4IVN A;  3V7S A;  2KIS A;  2GLO A;  3I55 I;  2Z5U A;  4BBS J;  4AUX A;  2E5N A;  2WBM A;  1RUO A;  4X0G A;  2QSH X;  3CLO A;  3BPV A;  3E1S A;  3KFW X;  1A04 A;  3S14 J;  5LHI A;  3F23 A;  3C2B A;  3GZN B;  4NC7 A;  3I64 A;  1T98 A;  4LB6 B;  3L1P A;  3QU6 A;  3LSP A;  3P9I A;  1IJW C;  3ASN H;  1WRJ A;  5IT3 A;  3A01 B;  4XLE A;  3BDD A;  2CW8 A;  1G3T A;  3CC7 I;  2DT6 A;  5E1X A;  5L3C A;  3NRV A;  1Z77 A;  3KLN A;  5HOD A;  3A01 A;  3EUK L;  2ID3 A;  5K7Z A;  5J4Y A;  1T33 A;  2E71 A;  1AU7 A;  2HWV A;  4AIJ A;  2D1H A;  1LFU P;  1ETK A;  4BE0 A;  4PJN A;  3ZPL A;  1LEA A;  1I39 A;  4CXF A;  2IGO A;  3S2D J;  2DBB A;  2MW8 A;  2IA0 A;  1BR4 A;  1I3A A;  4XQF A;  3HG9 A;  4RAZ A;  3BTJ A;  4RDU A;  2CRG A;  4DZJ A;  2NYX A;  2M8G X;  4O6J A;  3JAM Z;  5J3L A;  2OA4 A;  2M7B A;  2Y2Z A;  4KMU X;  3IAM 2;  3KLO A;  1KQ9 A;  2GOX B;  2QEX I;  2W57 A;  3M7G A;  1S29 A;  2HDD A;  1O3R A;  1W36 C;  4FX0 A;  2R7X A;  1LFB A;  1T56 A;  1YS7 A;  4LIT A;  4BYY A;  5JVT A;  3HRS A;  3ZRG A;  3QOE A;  3ZQL A;  4ZH4 F;  1X1P A;  5DYM A;  3KZZ A;  3HSF A;  3GTM J;  3BG3 A;  4FE7 A;  2MA3 A;  2X1E A;  4R1H A;  1B9N A;  3SXY A;  1VQ9 I;  1ZH5 A;  1AHD P;  1VQM I;  4K2E A;  1UCR A;  2KJC A;  5KHD A;  3LA2 A;  4GYI A;  2OBP A;  2VC0 A;  3BWG A;  3TKY A;  1WJ5 A;  2RQP A;  3VYR B;  1PDN C;  3BPX A;  2GOM A;  1UHM A;  2X1D A;  3RCO A;  2AS5 F;  4EJW A;  2GIZ A;  3E5Q A;  3S2W A;  3ECH A;  1LDD A;  4A0Y A;  5M5W J;  4IHW A;  3KEQ A;  3JRE A;  2P6T A;  2JQ7 A;  1TWH J;  1K4S A;  1A31 A;  2Y69 H;  1ZLK A;  4L5I A;  1NHA A;  3WHB A;  1R9T J;  2E1C A;  4IOC F;  4O5V A;  1W5S A;  2EFW A;  3TOB A;  4KIB A;  3B02 A;  3FXO A;  1R1V A;  3ZOB A;  3PIO F;  3DP7 A;  3TO7 A;  4JX5 A;  4AD9 A;  5ICE A;  3P9C A;  2LY9 A;  3GZ6 A;  3IRQ A;  3RPU D;  3I53 A;  4IX7 A;  2ZFW A;  4B8X A;  1YW7 A;  1ZAR A;  3IWF A;  2PBI A;  4RBO A;  2V1U A;  4D5F A;  2DAO A;  2H94 A;  4D9J A;  2DFH A;  5D5U B;  3BG6 A;  5F64 A;  1WQ2 A;  1WVR A;  4KIC A;  2HPM A;  1YW8 A;  3N97 A;  3F8F A;  3OYL A;  4O3M A;  4BJ6 C;  3KP2 A;  1D0X A;  1RUN A;  3BZ6 A;  3JAM K;  2G9W A;  4CGZ A;  3HOU J;  1JT6 A;  1W1W E;  2F5D A;  2HXO A;  3GCM A;  1CF7 B;  2EJR A;  2MYS A;  4NC6 A;  4PFO A;  3M07 A;  3E6D A;  3RKX A;  3DLL F;  1T2K A;  1B59 A;  2EFP A;  2VE8 A;  1Z7L A;  3B6A A;  1CF7 A;  2IJL A;  1WJE A;  4WXH A;  5A2Q Z;  1I50 J;  1OR7 C;  6PAX A;  5TRD A;  2Q0O A;  2UV1 A;  3CMA I;  1JKP C;  1WKM A;  5E3M A;  2DOD A;  2K86 A;  2BY3 A;  3HGY A;  2K9N A;  3KE2 A;  2E35 A;  4ZZD A;  2XAF A;  4M73 A;  4EEF G;  1G6N A;  1ZEL A;  3JRI A;  3CMY A;  1KU2 A;  2GA1 A;  2D45 A;  2Z9O A;  4II3 A;  3MN2 A;  1Y0U A;  3BQZ A;  2GAU A;  1XGN A;  4ITV A;  5L3D A;  4N0B A;  3QPT A;  4MFD A;  1S5L C;  2HQ5 A;  1D8J A;  1UMQ A;  2VKV A;  2EIK H;  4PZJ A;  2W84 A;  2WV0 A;  2BHY A;  4AC0 A;  2W7N A;  3F22 A;  3JRB A;  1Z21 A;  2X6O A;  2CUJ A;  2L54 A;  2Y31 A;  3E6B A;  2VKE A;  3J80 Z;  4KIF A;  2NVY J;  3BP8 A;  2ZME B;  2Z16 A;  1JI8 A;  2LY1 A;  5DD8 A;  4MQV A;  3WTU C;  4DZP A;  4UXN A;  3KEY A;  1FT9 A;  3Q9V A;  2ZME A;  3BR1 A;  1CGP A;  3FHZ A;  1D8K A;  4KN7 X;  4CCK A;  4AU7 A;  2B0L A;  2D1V A;  4XLP F;  2WC2 A;  2HEO A;  5CJ9 A;  2EFO A;  3L2C A;  1P4A A;  4AVZ A;  1HW5 A;  2BYV E;  1LDJ A;  2W85 A;  4UB6 C;  2FOW A;  2V26 A;  1RNL A;  4YEJ A;  3DBL B;  1O3Q A;  4CO8 A;  1ETV A;  2HQA A;  2VOO A;  1X3Z B;  1TZL A;  2JWT A;  4ESF A;  2ECC A;  3AAF A;  4G6T B;  3DTK A;  2XSD C;  4PK4 A;  3N4M A;  2JRT A;  2L7Z A;  1POG A;  2L7F P;  2R7O A;  1TC3 C;  4XRM A;  4AIK A;  3RPQ A;  1LE8 B;  2HFH A;  3PIP F;  2DI3 A;  2VBX A;  3BTL A;  3A03 A;  2WAE A;  3O8G A;  2NNN A;  1S6L A;  5H6Q A;  2F4O B;  3FHN A;  4R8H A;  4BXF A;  5CKT A;  2WAD A;  4I98 B;  2QSF X;  3ZMD A;  2Z33 A;  3T5X A;  4HSR A;  1D5Y A;  1R7J A;  3CF5 F;  2EH3 A;  5A2Q K;  3E0J B;  2P81 A;  1LKX A;  5HS9 A;  1F9N A;  1ETQ A;  1K4T A;  3IV5 A;  2CH0 A;  3BG5 A;  1NG7 A;  2E5Z A;  2FBI A;  3JRH A;  2R7T A;  4A6D A;  2DA2 A;  2DA4 A;  3TDZ C;  4B47 A;  1TWG J;  1Z6R A;  3PM1 A;  5K5O A;  1L0O C;  5BQT A;  5E79 C;  1R5G A;  2HR3 A;  4KN4 X;  5J1Y A;  2NNY A;  2FNA A;  3GWZ A;  3HOY J;  3M4O J;  2HXI A;  2HOT A;  1WJC A;  5IY5 H;  4P5O A;  1BJZ A;  1Y56 A;  3M3Y J;  2DDB A;  2MLK A;  3S1N J;  2CUZ A;  1SVM A;  5CVJ A;  3EDP A;  2VOD A;  3QOP A;  1IN8 A;  1YIO A;  5TIS C;  1O7F A;  3QYB A;  3ESW B;  5J4V A;  3PUB A;  3HPG A;  2G0E A;  1LQ1 A;  2PG4 A;  3J80 K;  4AWX B;  4U7D A;  4G94 A;  2EIN H;  2DPD A;  4CYC B;  3K70 D;  1RIO H;  1BIB A;  1YG2 A;  3ELK A;  3W2V A;  3BR5 A;  1BJA A;  3OIQ A;  5C4J J;  1JKQ C;  1BC7 C;  1G2H A;  2H6B A;  1WJA A;  2IEK A;  4CYC A;  2RQQ A;  1XB4 A;  1PP8 F;  1DPR A;  3H5A A;  2ZB9 A;  2OV7 A;  3PL8 A;  5D8L B;  4QIW N;  4OIP F;  4YFN F;  2P5K A;  1MBG A;  1BL0 A;  1U9O A;  1RC9 A;  2BXY A;  2WTE A;  3PQJ A;  5IPA A;  3S1R J;  5F08 A;  1DPU A;  3SZP A;  4UUS A;  5FB2 A;  4HA8 A;  1XTA A;  2A05 A;  2QCO A;  4F55 A;  3F8M A;  3GME A;  4AIH A;  1E3O C;  2E2J J;  2Y30 A;  2FA5 A;  4F93 B;  4ZTJ A;  3KX2 A;  3IH2 A;  5F0F A;  4IZZ A;  3WGG A;  4DIQ A;  2OC6 A;  1J09 A;  3CF2 A;  1SMY F;  1OPC A;  1IN7 A;  1BR2 A;  4MEX F;  1GV2 A;  2QQB A;  4ESB A;  2DQR A;  1VQ4 I;  2XAG A;  1OCO H;  2W24 A;  2E60 A;  2DJI A;  3E5X A;  2HKO A;  1A6I A;  3H3U A;  5EZG A;  4L0Z B;  4F91 B;  3HOS A;  1IGN A;  4MO7 A;  4XOT A;  2BY1 A;  2A61 A;  2M45 A;  1IRF A;  3DQV C;  2Y0S N;  4U87 A;  5EEG A;  5F1J A;  2DQL A;  1SFU A;  3LOC A;  4IQ4 A;  2R7D A;  4D0P A;  1S9H A;  4A3G J;  3DEU A;  4RGS A;  2XAS A;  4FE4 A;  3GTG J;  2CW0 F;  4F7Z A;  3S32 A;  2VJI A;  3OR2 C;  3C2H A;  4ZYE A;  1HCR A;  2F5E A;  4IRI A;  5HVQ C;  1GHC A;  4M74 A;  3UR3 C;  4DBR A;  2E36 A;  2O8X A;  1BW6 A;  1ZG1 A;  1MSF C;  3GTP J;  2V4J C;  1R23 A;  3BY6 A;  4WX9 A;  2LYC A;  1IAW A;  1QVT A;  1IV8 A;  2ETH A;  2DPU A;  1S7O A;  2BZT A;  1TBX A;  2XKO A;  3CES A;  1RES A;  2L9R A;  1PUF B;  2B7E A;  1ENH A;  3RSN A;  4II2 A;  3I4N J;  4ANJ A;  4U0Y A;  5LEJ A;  1Z67 A;  4L9T A;  2XUB A;  3E3V A;  3GYH X;  1IDY A;  1PUF A;  4L9V A;  1X4O A;  2MFZ A;  2XHK A;  2JN6 A;  4FAS D;  1FWZ A;  2W00 A;  3W6J B;  3CQZ J;  3WTT C;  1T39 A;  4A93 J;  4CCO A;  1C0W A;  1T0F C;  3FKJ A;  4UY8 I;  4EVI A;  3AKZ A;  2QGU A;  2EZH A;  1X1D A;  2HVQ A;  2NOG A;  1MIJ A;  4ENK A;  3E97 A;  1BIA A;  1FLI A;  1AKH B;  2QSG X;  2KJB A;  5IYD J;  2X6X A;  1U8B A;  2X9D A;  3G1O A;  4B44 A;  2F4M B;  4MFE A;  1VQ8 I;  3V42 A;  2XPW A;  1MND A;  4JOM A;  4MHG A;  1XCB A;  3FK6 A;  2VXD A;  5JLX A;  5D5X B;  2HZD A;  3NAU A;  1H89 C;  3CJQ B;  3WGH A;  1T38 A;  2EZL A;  4DJA A;  3ML6 A;  5GTI C;  3M8J A;  2M0M A;  1Q1H A;  5HDN A;  2ZKZ A;  4LD5 A;  3Q0W A;  1BM9 A;  1UEL B;  4FIS A;  2DMP A;  4BHB A;  1WGX A;  2QVO A;  3L2Q A;  3G71 I;  1IRX A;  4XK4 A;  4MTE A;  1J0R A;  5DS9 A;  3FZV A;  1UG2 A;  2JRM A;  1VQN I;  3S1Q J;  5E3O A;  2JA5 J;  2PJP A;  4C9Y A;  4XOP A;  2PX9 A;  3JSO A;  5E3N A;  3I4M J;  2P5V A;  4AVP A;  1SAN A;  1WH7 A;  3R4K A;  4M3D A;  1Z9C A;  1NG6 A;  1EH7 A;  5F0C A;  3HKZ A;  4BAY A;  1SFO J;  2WB1 N;  2MC3 A;  4ZJZ A;  3CCY A;  2LF7 A;  5E8I A;  3DBH B;  1YOV B;  2E1O A;  2ELH A;  4RAF A;  2M4G A;  3Q9S A;  1FSE A;  4EJV A;  1G3W A;  2P0W A;  1X4P A;  2HKX A;  2ZXI A;  2LTP A;  1TWF J;  4XOR A;  4BXU A;  5KAF C;  5E3L A;  1NK3 P;  4M71 A;  2H1K A;  5LGU A;  1FOX A;  3ABK H;  3GFM A;  2RVC A;  2HQN A;  3CMM A;  4HOB A;  1WCM J;  1D3Y A;  3FX3 A;  1BOA A;  3MD2 A;  4UV8 A;  4PFP A;  1W4M A;  2W48 A;  4WXC A;  1VQL I;  3O2P E;  1HST A;  1A35 A;  2V9P A;  2I5U A;  4A0Z A;  4A3D J;  3SHF A;  1MSE C;  3S8P A;  2A5Y B;  3N05 A;  1RI7 A;  2NOJ B;  2STW A;  1V3F A;  4IPA A;  1MW7 A;  1FOK A;  2LNB A;  2MAB A;  1JXS A;  3U1K A;  2OCC H;  1QHH D;  3H1C A;  3OV8 A;  1BR1 A;  4Q5S F;  3GO5 A;  3ASO H;  3IH4 A;  4XRF A;  3I59 B;  1MH3 A;  3K4C A;  3ZQF A;  3OYF A;  4FT8 A;  1IRG A;  4AYB A;  3RQI A;  2P6S A;  5BNG A;  3OYA A;  4NHJ A;  2WY7 Q;  1SFX A;  3I59 A;  2DTR A;  5CPR B;  1ZG3 A;  5J8C A;  4CSW A;  3W6V A;  2JTV A;  3P7N A;  3RTR A;  3TW6 A;  3FKI J;  2WWY A;  3MVP A;  1VQK I;  5FD6 A;  2R7W A;  2L7M P;  1QVU A;  3QYE A;  2VT2 A;  5LEK A;  3RKW A;  3FMR A;  3OY9 A;  5KVR A;  2DA3 A;  3CDI A;  1QA6 A;  1ZGW A;  4RB1 A;  3VDX A;  4I0A A;  4IHS A;  1IN6 A;  3LWF A;  4RA2 A;  2VPL A;  2YS9 A;  3E6C C;  2J5O A;  2X1C A;  3LA3 A;  4IRG A;  1GV5 A;  4M3B A;  4U0W A;  3H0G J;  2XGE A;  2JA2 A;  1XMA A;  4RLF A;  4ENJ A;  4DNC A;  3TED A;  5ICC A;  1LVK A;  3GLX A;  2QKL B;  1P4W A;  2Y9Z A;  3W3C A;  2R93 J;  3SZT A;  2QKM B;  3I58 A;  3M1C A;  4XLC A;  1A36 A;  3QRF F;  3Q0V A;  2ZCW A;  1APL C;  1D0Z A;  3LFU A;  4A3M J;  2CV2 A;  2R4G A;  4U7B A;  3DBR B;  2MG4 A;  2NRA C;  1VQ7 I;  4NQW B;  3I9V 2;  3DV8 A;  1QZY A;  4JYK A;  4UVC A;  5LRR A;  3VWB A;  5AON A;  3F8B A;  2VBY A;  2Y75 A;  4I0B A;  5FKO A;  4NQW A;  1ZG5 A;  1Y1V J;  2DA1 A;  2YSR A;  2JUC A;  2NVX J;  3Q0U A;  3FBN B;  4RS8 A;  2CSO A;  2HU9 A;  3T1B A;  3ZQ7 A;  2IGN A;  4JK1 X;  2IRF G;  3LSG A;  4LMY A;  3WOD F;  4IEJ A;  2O5R A;  5HS8 A;  1MMG A;  5EF6 A;  2EV6 A;  2A5W A;  2KZG A;  1ETY A;  4C2M J;  3P5J A;  3K2Z A;  4HNT A;  1YQA A;  2IGK A;  2H8R A;  2LP0 A;  3JRA A;  1XSD A;  3CP8 A;  1LEB A;  2KIU A;  3AFH A;  1R36 A;  3WTW C;  1HW2 A;  1H88 C;  1V5G A;  5GPA A;  3OYH A;  2ESH A;  3BG7 A;  2CJJ A;  4I76 A;  1SC7 A;  4C3H J;  3J7Y J;  4GDF A;  2F4I A;  2L4M A;  2COM A;  3RKQ A;  2OU2 A;  2Q1Z B;  2XVC A;  1FOY A;  2DOA A;  3QOD A;  3IRR A;  4M9Z A;  4P55 A;  4M72 A;  2XB0 X;  4HG2 A;  2IAI A;  1QGP A;  1Y39 A;  3D5L A;  2FX0 A;  1FZP B;  4RB0 A;  2VQH A;  2OPT A;  5FFX A;  4G7O F;  2O3F A;  3IWZ A;  3BZK A;  1N78 A;  5DV5 A;  2RNG A;  4GXO A;  1F1Z A;  3KEO A;  3KZY A;  1IN4 A;  1O3S A;  1XN7 A;  2K9L A;  2L7K A;  3SFI A;  4I09 A;  4ZZL A;  2BHZ A;  3ABT A;  3SFZ A;  1OCC H;  2A6E F;  1R4N B;  4KT5 C;  1AWC A;  4E7H A;  1JKO C;  2VXZ A;  3HM5 A;  5FLM J;  4CCJ A;  2HYF A;  4UB8 C;  2DW4 A;  4I7H A;  4HST A;  3OS1 A;  4XKV A;  2L01 A;  3J81 Z;  1XPX A;  2PMU A;  4NUB A;  2L5Q A;  2KDO A;  1XCV A;  2QZ8 A;  5B1B H;  1VI0 A;  2HTJ A;  2ZSH B;  3S3O A;  3DXJ F;  4LGW A;  1ZKG A;  4YEL A;  3VOE A;  4XR6 A;  2H8W A;  1AA7 A;  5FRN A;  3G4S I;  4A3K J;  3F6O A;  2JZY A;  2R0Q C;  5AIP A;  3HOX J;  4BJT A;  2CFO A;  4E7Z A;  5K1Y A;  1L3L A;  5D5V B;  3MKZ A;  2OTL I;  2LBF B;  3LQR A;  2P7C B;  4HYE A;  2XAQ A;  1BI2 A;  3S17 J;  3TO6 A;  2DA5 A;  1JGG A;  3K1M A;  4LK0 F;  3WU2 C;  1HF0 A;  4GCV A;  2FF4 A;  2LBF A;  3ZN1 A;  3DPU A;  3ZMT A;  3ZMV A;  1JTX A;  2EZI A;  3WGI A;  5CVV A;  2VKH A;  3G6E I;  3L9F A;  3IKV A;  4OOI A;  3CCJ I;  2Z1D A;  3LA7 A;  2G7U A;  2LK2 A;  2JPB A;  1D0Y A;  2IA2 A;  2EIJ H;  3X2Q H;  1MDM A;  2R7Q A;  3CC2 I;  4Q48 A;  3VOD A;  4A6E A;  3ZMU A;  3REO A;  5B3S H;  3K10 A;  3OWT A;  3HPH A;  2IVM A;  3COA C;  2YPR A;  4L18 B;  2IS2 A;  3H5N A;  1WI3 A;  1FOW A;  1ZRE A;  1UFM A;  4KJZ A;  3S16 J;  3FM5 A;  4P1W A;  4ZYA A;  3D1N I;  1WFX A;  2KPM A;  1UG0 A;  1NH3 A;  4DYQ A;  3I5U A;  2NVT J;  1YJW I;  3J7Z I;  1U2W A;  2YR2 A;  2RDP A;  3L00 A;  2KRC A;  1RRJ A;  2GXA A;  1B1B A;  1R22 A;  3JRD A;  5ERI A;  2DK8 A;  2V79 A;  3J7A Y;  1RZ4 A;  2IS6 A;  2HPI A;  3BR2 A;  1QQI A;  3HIF A;  3OL4 A;  5BPD A;  1UJ8 A;  3WE2 A;  4U88 A;  2RC4 A;  1KU9 A;  2VB6 A;  3G2B A;  5HDG A;  2HQR A;  3A0H C;  2L9V A;  2Y9Y A;  1G3Y A;  3GTQ J;  4HDV A;  3LSK A;  5EZH A;  3J81 K;  4CDG A;  1YX5 A;  2HZT A;  1V55 H;  5CVU A;  3K1N A;  1JKR C;  1D1B A;  2P7V B;  1E17 A;  2MSY A;  4GFB A;  2DA7 A;  4BDY A;  2I10 A;  4BHC A;  1IN5 A;  2C6Y A;  1YJN I;  3IKT A;  4RLQ A;  3MKW B;  2K3F A;  2K9M A;  2RNJ A;  3GTL J;  1O3T A;  1GXP A;  3ULQ B;  1T6S A;  1EH6 A;  4A5M A;  4ON0 A;  2O6G E;  1FBU A;  2HVS A;  3HHG A;  3CDL A;  3M1E A;  2V6E A;  3TBI A;  5IP6 A;  3AL0 B;  4LOC A;  3WHC A;  1JUM A;  1ETO A;  2RN7 A;  3V7R A;  1VZ0 A;  2XB5 A;  4G7Z F;  4IJA A;  2R5Z A;  4LLN A;  3DLA A;  2P4W A;  3EUH A;  1J2X A;  3QPS A;  2VJ4 A;  4IHY A;  2VE9 A;  1BC8 C;  1U5T B;  3KPH A;  4LLG F;  5GTH C;  1H8A C;  1GT0 C;  5IYB J;  4PGH A;  5EGO B;  1U5T A;  1RR8 C;  1R71 A;  3C18 A;  2FQ3 A;  3ZCO A;  5EGO A;  1H9T A;  1OIS A;  4BHP A;  2IW5 A;  4UUT A;  4D7M A;  4JX6 A;  1FY7 A;  4X6A J;  3AG3 H;  1NTC A;  4LG3 A;  1ZGA A;  3R60 A;  2ZO4 A;  1UZC A;  4M6Y A;  2DT7 B;  3BOQ A;  1HKQ A;  3CJR B;  1TT5 B;  5L3E A;  4HPQ A;  1KYW A;  2F5C A;  4A5N A;  4ZYD A;  3AG1 H;  4BAC A;  2LFB A;  1R58 A;  1V54 H;  5FD5 A;  3EPZ A;  3QYF A;  1IXS B;  1TW3 A;  2JVG A;  4A2U A;  2ID6 A;  3R0J A;  1UST A;  1P7J A;  4YII A;  4R79 A;  5ED4 A;  3FXJ A;  3ZP5 A;  1ZYR F;  1FYL A;  5KAI C;  4BU2 A;  1OFC X;  1F5T A;  1F43 A;  2V1D A;  3K9T A;  3K4L A;  2NS7 A;  4HLX A;  4JBA A;  2VT3 A;  4QTR A;  3MQ0 A;  1HW1 A;  3A02 A;  1LDK B;  1YS6 A;  2VQL A;  3VFZ A;  2AQE A;  5HNH A;  1XDS A;  5DEQ A;  1KQ8 A;  1YLF A;  4RGX A;  1FYM A;  1MJA A;  2KKO A;  1HDP A;  2LSO A;  3ZN0 A;  3TO9 A;  1DU0 A;  1VTN C;  2GWR A;  4EJT A;  2B63 J;  1X1A A;  1MZB A;  2NXN B;  4M6V A;  5J47 A;  1Y1W J;  4CIC A;  4ETS A;  1MMN A;  2Y48 A;  3L7W A;  3QWL A;  1F4K A;  1YHQ I;  5LGN A;  1G8X A;  1TT0 A;  4S05 A;  2E7W A;  2VQC A;  3HOW J;  1K6Y A;  2HOA A;  2DMT A;  1OCR H;  3H35 A;  3KP3 A;  1R5H A;  4BQA A;  1IG7 A;  5H20 A;  1MMD A;  4LLL A;  4ZDP A;  3VEP A;  4RM3 A;  1SD4 A;  2F6C A;  2X85 A;  5E1Z B;  2FMY A;  3MMY B;  1KA8 A;  2DMN A;  4S0H B;  3JRF A;  1U9N A;  3FMS A;  2K4B A;  1OCZ H;  2WV1 A;  4HRI A;  4OIQ F;  2VJ5 A;  2W1O A;  2KRF A;  3OYB A;  4PSX A;  2NS0 A;  4PUS A;  4ASN A;  5C44 J;  4V2F A;  2CGP A;  1Z1D A;  4RGU A;  4B43 A;  1MMA A;  3J7A O;  1RPW A;  2KL4 A;  3DKY A;  3H9Q A;  1WI9 A;  1BBY A;  4HAM A;  3P9K A;  4M9S A;  5FKN A;  3V4G A;  3LSH A;  2AXL A;  4M3F A;  5JFR A;  2R5Y B;  4RMN A;  2R7Z J;  2OTJ I;  3VSK A;  1P6R A;  1XGM A;  2LD5 A;  3SJM A;  2X6Y A;  1MD0 A;  3FIS A;  3LAJ A;  2R5Y A;  3GFI A;  1M1E B;  4YFK F;  5K5R A;  2XRO A;  2HTS A;  1CQT A;  2H6C A;  3MKL A;  1JTY A;  3E6M A;  4XSZ F;  3EQL F;  3K2A A;  4L0Y B;  4BE1 A;  2FQ4 A;  2MLG A;  3KYD B;  1Y8Q B;  4MIM A;  3DTE A;  4G8X A;  3CME I;  2ESN A;  2NVU B;  2H09 A;  1D1A A;  4X1E A;  3FXM A;  4MQ9 F;  3RPU A;  4C3J J;  3RI4 A;  1JE8 A;  3TP0 A;  1W36 D;  4BY7 J;  1HKS A;  4L5E A;  5IT9 Z;  1XGS A;  4UUS B;  5J1R A;  1VF9 A;  1W0U A;  1OCP A;  2FXA A;  1KON A;  2LC2 A;  2BGC A;  2CQK A;  5KK1 A;  3BJ6 A;  3GFL A;  3WTY C;  4Z2Y A;  4UVA A;  4XBF A;  2VN2 A;  3KCC A;  3HUG B;  3WTS C;  4CYD A;  2IGM A;  1IDZ A;  4LK1 F;  4KYW A;  3DU6 A;  2CQ7 A;  2E1M B;  5JLW A;  4BY1 J;  2UZK A;  1DP3 A;  3GW2 A;  3HUG A;  4ABZ A;  3EYY A;  1TL8 A;  1PYV A;  3NQO A;  2VLA A;  1LJ9 A;  1YE9 A;  2OZ6 A;  1TNS A;  2E34 A;  5JHU A;  5C4X J;  3H3V K;  3HKZ N;  4IHT A;  1ERD A;  5FGM A;  2X4H A;  1JUS A;  3K7A J;  5DUI A;  1IC8 A;  2RAE A;  2RRE A;  1FTT A;  1HXD A;  3OYJ A;  1E0E A;  1ULY A;  2X6W A;  1K7A A;  3PO2 J;  1U8R A;  2FUG 2;  5CQG A;  1BW5 A;  3BJO A;  3W2A A;  3OSF A;  4L9N A;  4HQE A;  1TNT A;  2DFE A;  3T0Y A;  1JT0 A;  3AL0 C;  4MLO A;  5GAD J;  2N8G A;  1I27 A;  1N75 A;  3V7C A;  3VPR A;  3QU3 A;  2UXN A;  4XL9 A;  3OYN A;  2K7L A;  2AXT C;  1JJ8 C;  2CU7 A;  2HOE A;  2R3S A;  3QP6 A;  4DBQ A;  4A3L J;  4BBR J;  3KIO A;  1X1C A;  4XKB A;  3KP7 A;  3SYT A;  3VYU B;  4V19 K;  4HEA 2;  2BW3 B;  2PQ8 A;  2XGC A;  2K85 A;  2OQG A;  3KP4 A;  5FKL A;  2EFQ A;  2DXI A;  1SD6 A;  3BR0 A;  3BLY A;  4EJO A;  2BW3 A;  2QBY A;  4A3J J;  4Y13 A;  4PJM A;  4G6D A;  4HX4 A;  1HLV A;  3F0C A;  4C2U A;  3OYM A;  1IZ1 A;  4QPO A;  1FBS A;  1U0J A;  4GGG A;  3FDY A;  3QPH A;  3CC4 I;  1Q1V A;  2CW7 A;  4MNU A;  1E2X A;  2ZME C;  3QPL A;  1XX5 A;  3CCR I;  1HA8 A;  2OCE A;  3CUQ B;  5M5X J;  4ESJ A;  2NAZ A;  2J5P A;  1OLT A;  3MWM A;  4WK8 F;  1YRN A;  1NK2 P;  2XGX A;  5LRS A;  2WAQ A;  5CVR A;  5J1U A;  1N77 A;  3CO6 C;  5IT9 K;  3CUQ A;  5DCF A;  3AG4 H;  2DOF A;  3TMO A;  2PJR B;  4CCN A;  2CMP A;  2EA4 A;  2BXZ A;  1G3S A;  2LF8 A;  3WG9 A;  2PJR A;  1PP7 U;  1MJB A;  5TGT A;  2KIF A;  3E5U A;  1J75 A;  2VI6 A;  2Q8K A;  9ANT A;  1BA5 A;  4EJU A;  2PLY A;  4ZDL A;  5LLQ A;  1QU3 A;  2D2W A;  5K7H A;  3D0S A;  1R4M B;  1I6X A;  4NNJ A;  3HXL A;  2ZFU A;  2KT0 A;  3F8C A;  1ZTR A;  2FML A;  3DTI A;  1HOM A;  5DCM B;  1ZR4 A;  2VIX A;  2IA1 A;  3O6B B;  3OYD A;  5HS7 A;  2V6C A;  4Q47 A;  3HOV J;  3F72 A;  1FIP A;  1TLH B;  1TWC J;  5DCM A;  1DGR M;  5J40 A;  4M9X A;  5E17 F;  1WJB A;  2M7A A;  3CJT B;  5JHF A;  5HLH A;  1HQC A;  1O4X A;  1J59 A;  2V9V A;  4M3E A;  4D7N A;  5JR3 A;  5LD2 C;  1GVD A;  4OIO F;  1I5Z A;  3RZD J;  2E2I J;  2PMZ A;  3CCQ I;  1IXR C;  1FBQ A;  2GA2 A;  3FXQ A;  1YFH A;  1N25 A;  2JSC A;  4Y3O A;  2FD5 A;  1X3U A;  4B1R A;  2RKH A;  3KZI C;  4KIS A;  1S7E A;  1P7I A;  1W5C C;  5E20 A;  4AM3 A;  5B5E C;  3K4M A;  4CH7 A;  1MBF A;  1Z05 A;  2KFD A;  1Y8R B;  3TQN A;  1OMI A;  4MTD A;  3EET A;  2RV8 A;  5LGT A;  3H3Z A;  2GXG A;  4GYG A;  3NWS A;  1B9M A;  3K1P A;  4KT6 A;  3GUD A;  2X0L A;  1QPM A;  4XN0 A;  3KYL A;  4KUM A;  3LNQ A;  5DM6 F;  2Y0S A;  2VC1 A;  1HSJ A;  4XKW A;  5CYV A;  5DD4 A;  4EV0 A;  3JSP A;  4E7K A;  1WH5 A;  3LSJ A;  2GXB A;  2MBF A;  2LRD A;  4U0V A;  2M4K A;  4G9Y A;  2KHM A;  1ZLJ A;  1JHH A;  3JW4 A;  3KP5 A;  1YTY A;  2HS5 A;  2CO5 A;  1Y0N A;  3H5R A;  5FRM A;  4C30 A;  4HF1 A;  2M3A A;  5FRO A;  1DGW Y;  1JHF A;  2XRL A;  2DDA A;  3PSF A;  2V1N A;  5F04 A;  1MGT A;  3AG2 H;  2A6H F;  2BY2 A;  2CFX A;  1BN5 A;  3M8E A;  3GVA A;  2PMH A;  4XLA A;  3OOP A;  5AIQ A;  3ZGK A;  3H0D A;  1SMT A;  3QP5 A;  3OR1 C;  1XMX A;  5JI6 A;  3K4J A;  3HZJ A;  3DEE A;  4J19 A;  2BVM A;  4Y15 A;  3RQ4 A;  3VYT B;  3DKW A;  2A6T A;  4CHU A;  1HKT A;  4PDK A;  2VUM J;  2EIL H;  3C2G A;  3V8L A;  2Z3Y A;  3LAP A;  5DUK A;  2HYJ A;  3GTK J;  1YI2 I;  1DQU A;  2EK5 A;  2M2E A;  3ZMS A;  3TL4 X;  4YIR X;  4IO9 F;  3O8H A;  4GO1 A;  1Z3Y A;  2ICW G;  1ZK8 A;  3LSR A;  3CCM I;  1V5F A;  4BQQ A;  3CDH A;  4ZC3 A;  3LSM A;  3OYG A;  3I54 A;  4FCY A;  2QQA A;  4HW0 A;  5HLT A;  2GQQ A;  1K6O A;  3TOA A;  1JUP A;  2CYY A;  3TDU C;  2FJ1 A;  2KZV A;  5ILV A;  1ACI A;  1W7P D;  1DUX C;  2GM4 A;  5HLI A;  4RGR A;  2K40 A;  4Y17 A;  5GAE J;  2QUF A;  3RIR A;  2R7V A;  5FLX Z;  4BNC A;  1GXQ A;  1J5Y A;  1Z0X A;  1X58 A;  3B73 A;  5B1A H;  1Z3X A;  2ZJR F;  2VL8 A;  4LFU A;  5GPC A;  1XC5 A;  2XF7 A;  1TTY A;  2A69 F;  4IXA A;  2LKP A;  1P9Q C;  2KIM A;  3S3N A;  4UVB A;  5IOZ A;  1SEU A;  4DYC A;  2WB1 A;  2DA6 A;  2HDW A;  3SEQ A;  2BBY A;  3CUO A;  4I99 C;  1EH8 A;  4BJ5 C;  1OR7 A;  3VSL A;  5FFZ A;  4HNV A;  3LQQ A;  4M6X A;  5H2F C;  2EB7 A;  3DF8 A;  3JCU C;  2F5F A;  2JA6 J;  2L0K A;  3B6C A;  2R92 J;  3K4K A;  3G3Z A;  4XIC A;  3CCL I;  3S15 J;  3HEF A;  4FTH A;  3GEZ A;  4B3X A;  1GUU A;  1P2F A;  2KQR A;  2V7F A;  3GF2 A;  2R7U A;  3F6V A;  3K69 A;  3U21 A;  2IP2 A;  1X2N A;  1KGS A;  5J6X A;  4S04 A;  3L2V A;  3D5S C;  4EQQ A;  1Y6I A;  2E19 A;  2CQX A;  3LST A;  4XLH A;  5M3F J;  1TP4 A;  3CD6 I;  1BI0 A;  5HDK A;  2LDU A;  3HOZ J;  2CUE A;  1RR7 A;  2VKD A;  4NBQ A;  3TGN A;  4L9J A;  5M5Y J;  1VND A;  2M8E A;  1H9G A;  2V1X A;  1QRY A;  2AHQ A;  3GLL A;  4B48 A;  5IP9 J;  1K78 B;  3ZMZ A;  2XGD A;  5IP7 J;  2E7X A;  3HBL A;  4PGG A;  2M5W A;  2JJ7 A;  3DKX A;  4A0X A;  3CCE I;  1K78 A;  2ECB A;  1UHS A;  4KIT B;  4XSX F;  3DEW A;  2M30 A;  5GAH J;  3G1M A;  4IL6 C;  5DM7 F;  5D5W B;  2F48 A;  2VON A;  1S72 I;  2I8D A;  2Z99 A;  5EEA A;  1AOY A;  3F21 A;  5DTD A;  1IRZ A;  4E7L A;  1FSH A;  3S3M A;  4Y33 A;  1GDT A;  1BOB A;  5HNF A;  1KYZ A;  2Z2S B;  2BE5 F;  3ABU A;  2M0C A;  3OYK A;  2D5V A;  2VAS A;  5L3G A;  2DFI A;  2VQG A;  2ZXH A;  4WXD A;  4BKX A;  1IV6 A;  3BRO A;  2OD5 A;  2HVR A;  2K5C A;  3OYI A;  5FLX K;  5FJ8 J;  2HGC A;  2DCE A;  4YFX F;  2GBY A;  3H92 A;  2QEN A;  4OMY A;  1EF4 A;  1ZHF A;  3C1D A;  4A3F J;  2FBH A;  4MEY F;  3K70 C;  1ETX A;  1ON1 A;  1KU3 A;  3OOU A;  2VPR A;  2DOE A;  1MKM A;  2OQR A;  2PN6 A;  5HOO A;  3ERE D;  3CCV I;  4A12 A;  2IXS A;  2W4S A;  3KP6 A;  4C3I J;  1FP1 D;  1GLN A;  3WU1 B;  3MKY B;  4QPQ A;  2FEZ A;  2XAU A;  3K6G A;  2YUS A;  4HQM A;  1SFK A;  3I71 A;  2OUM A;  3HYI A;  1MDM B;  2W82 A;  3RDI A;  4EM1 A;  2CV0 A;  3A2K A;  2UXX A;  5CQE A;  1G4D A;  5C3E J;  4PCQ A;  4BS9 A;  3R0A A;  2X48 A;  2HDC A;  4D5C A;  1LB2 A;  2XPU A;  4OIN F;  4E7J A;  3R61 A;  5ICF A;  1TWA J;  2BOL A;  2M9H A;  1ITY A;  3UNG C;  2XSJ C;  4KA4 A;  2LY2 A;  1VQO I;  1J7K A;  4UHT A;  2IS1 A;  1Z6T A;  2GIV A;  2YU9 J;  4ZDO A;  1WSU A;  1GVJ A;  4G6Q A;  4CZZ A;  4BE2 A;  3EYI A;  1YX3 A;  4QLC U;  4I6Z A;  1QBJ A;  4IQJ A;  5LBQ A;  1D1C A;  3DWL E;  3MEX A;  3V8K A;  1YW9 A;  2MD0 A;  3HRM A;  2BY0 A;  1HBX G;  2LR8 A;  4A3B J;  1ONV A;  3KET A;  4DGW B;  3BCB A;  3HGG A;  4OIR F;  4WF2 A;  3CP2 A;  3DPT A;  3L09 A;  2M87 A;  1WHU A;  2QM3 A;  3V8J A;  1MBK A;  1SFE A;  1W7P B;  1R49 A;  2QQ9 A;  3ZQG A;  1OCT C;  4PJL A;  2Y0M A;  2IT0 A;  4EM0 B;  4JQF A;  2QF7 A;  2LLK A;  1SAX A;  1W7P A;  4B4C A;  2HNH A;  3QAH A;  3PQK A;  4DOZ A;  2R7R A;  4KMF A;  4V2G A;  3K0L A;  1ZN2 A;  1MBE A;  3M8F A;  2ZNZ A;  4XLF A;  2FRH A;  1KQ0 A;  2R5Z B;  1R6R A;  2LRE A;  5GP9 A;  2JPC A;  5FO5 A;  1T95 A;  2VBZ A;  5K7F A;  3CCS I;  1ZRF A;  3VB2 A;  4CZC A;  1T08 B;  5FLV A;  1X2M A;  4J00 A;  2CS3 A;  4E70 A;  1S8N A;  3ZQH A;  5CVI A;  3HTU A;  2XF5 A;  3L2R A;  4OAZ A;  3FIW A;  3BCA A;  4UNO A;  3VYS B;  4RAY A;  3ABL H;  2CV1 A;  3C7J A;  3M9A A;  1WZ2 A;  2EV0 A;  1X19 A;  2MH9 A;  3RKY A;  3DPL C;  3SZG A;  4HBL A;  1VQP I;  2R7F A;  4QSH A;  2RGV A;  4EAT A;  4ENN A;  5FKK A;  1ODD A;  5F6F A;  3I4P A;  2ELJ A;  2QWW A;  4H0E A;  1XS9 A;  2EV5 A;  3LSI A;  2NVQ J;  3RZO J;  4DW6 A;  3ZQQ A;  3MCZ A;  1R1T A;  2DLL A;  3JRC A;  1DDN A;  3ONQ A;  4HF0 A;  5TJJ A;  4E6K G;  2QYO A;  3GXO A;  3TW7 A;  1TQI A;  3PNV A;  1MNE A;  4GRI A;  4XKC A;  3WTV C;  2CG4 A;  1S7A A;  5D6E A;  4E7I A;  2JMW A;  3KYC B;  1DU6 A;  3GTO J;  4N4O B;  2MC4 A;  4F52 A;  1UAA A;  1XMK A;  2JA8 J;  3Q5F A;  2PFB A;  3HHH A;  3RYP A;  4XLN F;  2ISZ A;  3GX4 X;  3A1Y A;  1T0F A;  1D5V A;  5JVG F;  3GBG A;  1BI3 A;  1LNW A;  4HLY A;  2DTZ A;  1ZQ3 P;  2AQF A;  2DMU A;  2JSP A;  2DU9 A;  3BTI A;  4HV5 A;  3BC8 A;  4BQO A;  3OS2 A;  2EPF A;  1QZE A;  3FK7 A;  4F92 B;  2WAF A;  3L2W A;  1UB9 A;  5ILS A;  2JA7 J;  1Z7U A;  5DDG A;  2P8T A;  3FM3 A;  3NEU A;  2XKP A;  3HSR A;  3FXR A;  3ABM H;  2IS4 A;  2ZXW H;  1I1G A;  1X1B A;  1OQY A; 
#chains in the Genus database with same CATH homology
 2XAH A;  3IL2 A;  2DK5 A;  5D4R A;  4I02 A;  4EGY A;  5LHG A;  5HLG A;  2K4J A;  3CJN A;  3WTX C;  4MGR A;  4QWQ A;  5D4S A;  2ISY A;  3FXU A;  4N9H A;  3WTZ A;  4DQ2 A;  3WE3 A;  1IXC A;  4OMZ A;  1QZZ A;  2FOK A;  1B4A A;  1OYI A;  2L3D A;  2MD5 A;  2DT5 A;  1BI1 A;  1DP7 P;  3ISP A;  2MH2 A;  3F3X A;  4YG2 F;  4KNY A;  3HOT A;  1V4R A;  2L02 A;  2XRN A;  1P4X A;  2H27 A;  4ENM A;  1FNN A;  1JGS A;  3U1D A;  3ECO A;  4YIF A;  1O7L A;  3T8T A;  1S3J A;  2ZBK A;  2ADU A;  4HF2 A;  1EV7 A;  4EM2 A;  2FBK A;  3LFK A;  4EGZ A;  3GZ5 A;  5J8F A;  4RB2 C;  4KIG A;  2F2E A;  3HSE A;  4LJZ F;  3MZY A;  2ZJ2 A;  4RB3 C;  2XAJ A;  1XD7 A;  1P92 A;  5D8K B;  1U5T C;  1Z91 A;  2QBY B;  2HYG D;  2TDX A;  5BPI A;  2STT A;  2YX4 A;  3DFG A;  1H0M A;  1ON2 A;  4IRH A;  1R1U A;  3IC7 A;  2BV6 A;  1XSX A;  3U9G A;  4IF4 A;  1B6A A;  1FC3 A;  3I0T A;  2FSW A;  4HDU A;  3SQN A;  2UWM A;  3CO7 C;  4FHT A;  5E18 F;  2FU4 A;  2JT1 A;  4UV9 A;  1REP C;  3JTH A;  4L5J A;  3T8R A;  5D6F A;  1YO5 C;  4FX4 A;  3W6K B;  2K27 A;  3IHU A;  4WCG A;  3GFJ A;  4OU0 A;  2YX7 A;  2EWN A;  1ZGJ A;  4HV6 A;  5BOX A;  1IW7 F;  2EFN A;  1ZAO A;  1USS A;  1SD5 A;  2QLZ A;  2CWE A;  1OYY A;  1XSV A;  1FX7 A;  3C3W A;  3RJP A;  5EEH A;  4G7H F;  1XDU A;  1WWX A;  2P5L C;  2IPQ X;  3MAJ A;  2OZU A;  2O0Y A;  4Q4Z F;  2PI0 A;  4P9F A;  2O61 A;  2W25 A;  1U3E M;  3FWE A;  5BMZ A;  1YYV A;  5BS6 A;  1FYK A;  2BEO A;  4LG0 B;  3PFI A;  4P96 A;  1IUY A;  2ACJ A;  2ZXJ A;  3MFK A;  4LG0 A;  3FF5 A;  2A68 F;  4ZYH A;  2K02 A;  1K79 A;  4LB5 A;  5ICG A;  1R00 A;  2A07 F;  2XV4 S;  1ZRC A;  1MJ9 A;  4B09 A;  3G73 A;  3HTS B;  4NB5 A;  1STZ A;  2FE3 A;  3BJA A;  2PEX A;  1UHW A;  2GZW A;  3JTG A;  2OAZ A;  2Q2E A;  3RYR A;  2XIG A;  2G7H A;  4I01 A;  1OYW A;  1XGO A;  5E8G A;  1KU7 A;  2EA2 A;  5H6R A;  3MZH A;  1TW2 A;  2VOP A;  4KDP A;  4P9U A;  2M1B A;  4BH9 A;  4KFC A;  3O3K A;  5LHH A;  3WU0 A;  1FPQ A;  4UUV A;  4I2O A;  1IF1 A;  1I1S A;  3R6S A;  3FMQ A;  4HX7 A;  3U2R A;  2VBW A;  1QNT A;  2YU3 A;  3ROU A;  3HRU A;  1O57 A;  3CTA A;  1J9I A;  1FP2 A;  2DO7 A;  1LVA A;  1TQP A;  2L4A A;  1PUE E;  4ZYG A;  2E1N A;  2A3S A;  1W5T A;  5K5Q A;  4HX8 A;  1U6G A;  1U78 A;  3CUQ C;  1QO0 D;  1OKR A;  4N9I A;  2O03 A;  3F8N A;  5L3F A;  1ZRD A;  1TQM A;  4HZF A;  5E1W A;  4EMS A;  3HRT A;  1SD7 A;  2ZNY A;  5CLS A;  5L3B A;  4TV7 A;  2FNP A;  5ILU A;  5F1R A;  4IVN A;  3V7S A;  2Z5U A;  1RUO A;  3CLO A;  3BPV A;  3KFW X;  1A04 A;  3F23 A;  5LHI A;  3I64 A;  1T98 A;  4LB6 B;  3QU6 A;  3P9I A;  1WRJ A;  5IT3 A;  3BDD A;  1G3T A;  5E1X A;  5L3C A;  3NRV A;  3KLN A;  2HWV A;  4AIJ A;  2D1H A;  3ZPL A;  1LEA A;  4CXF A;  2DBB A;  2IA0 A;  4RAZ A;  2NYX A;  4O6J A;  3JAM Z;  2OA4 A;  4KMU X;  3KLO A;  1KQ9 A;  2W57 A;  3M7G A;  1S29 A;  1O3R A;  4FX0 A;  1YS7 A;  4BYY A;  5JVT A;  3HRS A;  4ZH4 F;  5DYM A;  3KZZ A;  3HSF A;  4R1H A;  2MA3 A;  1B9N A;  3SXY A;  1ZH5 A;  4K2E A;  1UCR A;  2KJC A;  3LA2 A;  4GYI A;  2OBP A;  2VC0 A;  3BWG A;  3TKY A;  2RQP A;  1PDN C;  3BPX A;  1UHM A;  2AS5 F;  4EJW A;  3E5Q A;  3S2W A;  3ECH A;  1LDD A;  4A0Y A;  3KEQ A;  2P6T A;  1ZLK A;  4L5I A;  1NHA A;  2E1C A;  4O5V A;  1W5S A;  2EFW A;  3TOB A;  4KIB A;  3B02 A;  1R1V A;  3DP7 A;  3TO7 A;  4AD9 A;  5ICE A;  3P9C A;  3GZ6 A;  3IRQ A;  3I53 A;  2ZFW A;  4B8X A;  1YW7 A;  1ZAR A;  3IWF A;  2PBI A;  2V1U A;  2DAO A;  2H94 A;  5D5U B;  5F64 A;  1WQ2 A;  4KIC A;  1YW8 A;  3N97 A;  3F8F A;  4O3M A;  3KP2 A;  1RUN A;  3BZ6 A;  3JAM K;  2G9W A;  4CGZ A;  2F5D A;  1CF7 B;  2EJR A;  3E6D A;  3RKX A;  1T2K A;  2EFP A;  1B59 A;  2VE8 A;  1CF7 A;  2IJL A;  4WXH A;  5A2Q Z;  6PAX A;  5TRD A;  2Q0O A;  1WKM A;  2K86 A;  3KE2 A;  4ZZD A;  2XAF A;  4M73 A;  1G6N A;  1KU2 A;  2GA1 A;  2D45 A;  2Z9O A;  1Y0U A;  2GAU A;  1XGN A;  5L3D A;  4N0B A;  3QPT A;  1D8J A;  4PZJ A;  2W84 A;  2WV0 A;  3F22 A;  2L54 A;  3E6B A;  3J80 Z;  4KIF A;  3BP8 A;  2ZME B;  5DD8 A;  4MQV A;  3WTU C;  4UXN A;  1FT9 A;  3Q9V A;  2ZME A;  1CGP A;  3FHZ A;  1D8K A;  4KN7 X;  2B0L A;  2D1V A;  4XLP F;  2WC2 A;  2HEO A;  5CJ9 A;  2EFO A;  3L2C A;  1P4A A;  1HW5 A;  2BYV E;  1LDJ A;  2W85 A;  1RNL A;  1O3Q A;  4CO8 A;  2VOO A;  4ESF A;  3AAF A;  3N4M A;  2JRT A;  4AIK A;  3RPQ A;  2HFH A;  2DI3 A;  2VBX A;  2NNN A;  1S6L A;  5H6Q A;  4R8H A;  4I98 B;  3ZMD A;  2Z33 A;  3T5X A;  1R7J A;  5A2Q K;  5HS9 A;  1F9N A;  2FBI A;  4A6D A;  3TDZ C;  1Z6R A;  5K5O A;  1L0O C;  5BQT A;  1R5G A;  2HR3 A;  4KN4 X;  2NNY A;  2FNA A;  3GWZ A;  4P5O A;  2MLK A;  5CVJ A;  3EDP A;  2VOD A;  3QOP A;  1IN8 A;  1YIO A;  1O7F A;  1LQ1 A;  2PG4 A;  3J80 K;  4AWX B;  4U7D A;  4G94 A;  2DPD A;  1RIO H;  1BIB A;  1YG2 A;  3ELK A;  1BJA A;  1BC7 C;  2H6B A;  1XB4 A;  1PP8 F;  1DPR A;  5D8L B;  4OIP F;  4YFN F;  2P5K A;  2WTE A;  3PQJ A;  1DPU A;  3SZP A;  5FB2 A;  4HA8 A;  3F8M A;  4AIH A;  2FA5 A;  3WGG A;  1SMY F;  1OPC A;  1IN7 A;  4MEX F;  2QQB A;  4ESB A;  2DQR A;  2XAG A;  2W24 A;  3E5X A;  2HKO A;  3H3U A;  4L0Z B;  3HOS A;  2A61 A;  2M45 A;  1IRF A;  3DQV C;  5EEG A;  2DQL A;  1SFU A;  2R7D A;  4D0P A;  3DEU A;  4RGS A;  2XAS A;  2CW0 F;  4F7Z A;  4IRI A;  4ZYE A;  2F5E A;  1GHC A;  5HVQ C;  4M74 A;  2O8X A;  1ZG1 A;  1R23 A;  3BY6 A;  4WX9 A;  1IAW A;  2ETH A;  2DPU A;  1S7O A;  2XKO A;  1TBX A;  4U0Y A;  5LEJ A;  4L9T A;  2XUB A;  3E3V A;  3GYH X;  4L9V A;  2XHK A;  1FWZ A;  3W6J B;  3WTT C;  1T39 A;  1C0W A;  4EVI A;  4ENK A;  3E97 A;  1BIA A;  1FLI A;  2KJB A;  4MHG A;  1XCB A;  5D5X B;  3WGH A;  1T38 A;  3ML6 A;  1Q1H A;  5HDN A;  2ZKZ A;  4LD5 A;  1BM9 A;  4BHB A;  2QVO A;  4MTE A;  1J0R A;  3FZV A;  2PJP A;  3JSO A;  2P5V A;  4AVP A;  3R4K A;  1Z9C A;  4BAY A;  1EH7 A;  2MC3 A;  2LF7 A;  5E8I A;  2ELH A;  3Q9S A;  1FSE A;  4EJV A;  1G3W A;  2HKX A;  4BXU A;  4M71 A;  5LGU A;  3GFM A;  2RVC A;  2HQN A;  4HOB A;  1D3Y A;  3FX3 A;  1BOA A;  4UV8 A;  1W4M A;  4WXC A;  3O2P E;  1HST A;  4A0Z A;  3SHF A;  2A5Y B;  1RI7 A;  2STW A;  1V3F A;  4IPA A;  1FOK A;  2LNB A;  1JXS A;  3OV8 A;  4Q5S F;  3GO5 A;  4XRF A;  3I59 B;  4FT8 A;  1IRG A;  2P6S A;  4NHJ A;  3I59 A;  1SFX A;  5J8C A;  2DTR A;  1ZG3 A;  2JTV A;  3P7N A;  3RTR A;  2WWY A;  5FD6 A;  2VT2 A;  5LEK A;  3RKW A;  3FMR A;  5KVR A;  4RB1 A;  4I0A A;  4IHS A;  1IN6 A;  3LWF A;  3E6C C;  2J5O A;  3LA3 A;  4IRG A;  4U0W A;  1XMA A;  4ENJ A;  4DNC A;  5ICC A;  3GLX A;  1P4W A;  3SZT A;  3I58 A;  3QRF F;  2ZCW A;  4U7B A;  2NRA C;  3DV8 A;  1QZY A;  4UVC A;  5LRR A;  5AON A;  3F8B A;  2VBY A;  2Y75 A;  4I0B A;  1ZG5 A;  4NQW A;  2YSR A;  4RS8 A;  2CSO A;  3T1B A;  3ZQ7 A;  4JK1 X;  2IRF G;  4LMY A;  3WOD F;  5HS8 A;  2EV6 A;  3K2Z A;  1YQA A;  1XSD A;  1LEB A;  2KIU A;  1R36 A;  3WTW C;  1HW2 A;  2ESH A;  2L4M A;  2COM A;  2OU2 A;  2XVC A;  3IRR A;  4M9Z A;  4P55 A;  4M72 A;  1QGP A;  3D5L A;  1FZP B;  4RB0 A;  5FFX A;  4G7O F;  2O3F A;  3IWZ A;  5DV5 A;  4GXO A;  1F1Z A;  3KEO A;  3KZY A;  1IN4 A;  1O3S A;  1XN7 A;  4I09 A;  4ZZL A;  3ABT A;  3SFZ A;  2A6E F;  4KT5 C;  1AWC A;  2VXZ A;  2HYF A;  2DW4 A;  4I7H A;  2L01 A;  3J81 Z;  2PMU A;  1XCV A;  2QZ8 A;  2HTJ A;  3DXJ F;  4LGW A;  3VOE A;  3F6O A;  2JZY A;  5AIP A;  5K1Y A;  1L3L A;  5D5V B;  3LQR A;  2P7C B;  4HYE A;  2XAQ A;  1BI2 A;  3TO6 A;  3K1M A;  4LK0 F;  4GCV A;  2FF4 A;  3ZN1 A;  3ZMT A;  3ZMV A;  3WGI A;  5CVV A;  3L9F A;  3IKV A;  4OOI A;  3LA7 A;  2G7U A;  2JPB A;  2IA2 A;  1MDM A;  4Q48 A;  3VOD A;  4A6E A;  3ZMU A;  3REO A;  2IVM A;  3COA C;  2YPR A;  4L18 B;  1ZRE A;  1UFM A;  3FM5 A;  3I5U A;  1U2W A;  2YR2 A;  2RDP A;  3L00 A;  1B1B A;  1R22 A;  5ERI A;  2DK8 A;  2V79 A;  1RZ4 A;  1QQI A;  3HIF A;  5BPD A;  3WE2 A;  4U88 A;  2RC4 A;  1KU9 A;  5HDG A;  2HQR A;  1G3Y A;  4HDV A;  3J81 K;  4CDG A;  2HZT A;  5CVU A;  3K1N A;  2P7V B;  1E17 A;  4BHC A;  1IN5 A;  2C6Y A;  3IKT A;  2RNJ A;  1O3T A;  1GXP A;  3ULQ B;  1T6S A;  1EH6 A;  4A5M A;  4ON0 A;  2O6G E;  1FBU A;  3HHG A;  3M1E A;  2RN7 A;  3V7R A;  4G7Z F;  4IJA A;  4LLN A;  2P4W A;  3EUH A;  1J2X A;  2VE9 A;  1BC8 C;  1U5T B;  4LLG F;  4PGH A;  1U5T A;  3C18 A;  2FQ3 A;  1H9T A;  4BHP A;  2IW5 A;  1FY7 A;  1ZGA A;  3R60 A;  2ZO4 A;  4M6Y A;  3BOQ A;  1HKQ A;  5L3E A;  4A5N A;  4ZYD A;  1KYW A;  2F5C A;  1R58 A;  5FD5 A;  1IXS B;  1TW3 A;  4A2U A;  4R79 A;  5ED4 A;  3R0J A;  1UST A;  4YII A;  1FYL A;  3ZP5 A;  1ZYR F;  1F5T A;  2V1D A;  3K9T A;  4HLX A;  4JBA A;  2VT3 A;  3MQ0 A;  1HW1 A;  1LDK B;  1YS6 A;  3VFZ A;  1XDS A;  5DEQ A;  1KQ8 A;  1YLF A;  4RGX A;  1FYM A;  1MJA A;  2KKO A;  2LSO A;  3ZN0 A;  3TO9 A;  1VTN C;  2GWR A;  4EJT A;  1MZB A;  4CIC A;  4ETS A;  2Y48 A;  3L7W A;  1F4K A;  5LGN A;  4S05 A;  2E7W A;  3KP3 A;  1R5H A;  4BQA A;  5H20 A;  4LLL A;  3VEP A;  1SD4 A;  5E1Z B;  2FMY A;  1KA8 A;  3FMS A;  2K4B A;  4OIQ F;  2KRF A;  2NS0 A;  4ASN A;  2CGP A;  1Z1D A;  4RGU A;  3J7A O;  4WWC A;  3V4G A;  4HAM A;  1WI9 A;  1BBY A;  4M9S A;  3P9K A;  2AXL A;  5JFR A;  1P6R A;  1XGM A;  1MD0 A;  3LAJ A;  3GFI A;  4YFK F;  5K5R A;  2XRO A;  2HTS A;  2H6C A;  3E6M A;  4XSZ F;  3EQL F;  4L0Y B;  2MLG A;  4G8X A;  2ESN A;  2H09 A;  4MQ9 F;  3RPU A;  3RI4 A;  1JE8 A;  1HKS A;  5IT9 Z;  1XGS A;  2FXA A;  2BGC A;  2CQK A;  5KK1 A;  3BJ6 A;  3GFL A;  3WTY C;  4Z2Y A;  4UVA A;  4XBF A;  2VN2 A;  3KCC A;  3WTS C;  4CYD A;  4LK1 F;  4KYW A;  2UZK A;  3GW2 A;  3HUG A;  3EYY A;  3NQO A;  1LJ9 A;  2OZ6 A;  1TNS A;  5JHU A;  4IHT A;  5FGM A;  2X4H A;  5DUI A;  1HXD A;  1ULY A;  1K7A A;  1U8R A;  3BJO A;  4L9N A;  4HQE A;  1TNT A;  3T0Y A;  1I27 A;  3V7C A;  3QU3 A;  2UXN A;  2K7L A;  2HOE A;  2R3S A;  3QP6 A;  3KP7 A;  2PQ8 A;  2OQG A;  3KP4 A;  2EFQ A;  1SD6 A;  4EJO A;  2QBY A;  4Y13 A;  4G6D A;  4HX4 A;  1IZ1 A;  1FBS A;  4GGG A;  3QPH A;  4MNU A;  1E2X A;  3CUQ B;  4ESJ A;  2NAZ A;  2J5P A;  3MWM A;  4WK8 F;  2XGX A;  5LRS A;  5CVR A;  3CO6 C;  5IT9 K;  3CUQ A;  5DCF A;  2EA4 A;  1G3S A;  2LF8 A;  3WG9 A;  1PP7 U;  1MJB A;  2KIF A;  3E5U A;  1J75 A;  2Q8K A;  4EJU A;  2PLY A;  5LLQ A;  2D2W A;  3D0S A;  1I6X A;  3F8C A;  2FML A;  5DCM B;  3O6B B;  2IA1 A;  5HS7 A;  2V6C A;  4Q47 A;  3F72 A;  1TLH B;  5DCM A;  4M9X A;  5E17 F;  5HLH A;  1HQC A;  1J59 A;  2V9V A;  5JR3 A;  4OIO F;  1I5Z A;  1IXR C;  1FBQ A;  2GA2 A;  3FXQ A;  1YFH A;  2JSC A;  1X3U A;  2RKH A;  5E20 A;  1Z05 A;  3TQN A;  4MTD A;  1OMI A;  3EET A;  2RV8 A;  5LGT A;  3H3Z A;  2GXG A;  4GYG A;  1B9M A;  3K1P A;  3GUD A;  2X0L A;  1QPM A;  4KUM A;  2VC1 A;  1HSJ A;  5CYV A;  5DD4 A;  4EV0 A;  3JSP A;  2GXB A;  2MBF A;  4U0V A;  4G9Y A;  1ZLJ A;  1JHH A;  3JW4 A;  3KP5 A;  1YTY A;  2HS5 A;  2CO5 A;  4HF1 A;  1JHF A;  1MGT A;  2A6H F;  2CFX A;  1BN5 A;  3M8E A;  3GVA A;  2PMH A;  5AIQ A;  3OOP A;  1SMT A;  3QP5 A;  5JI6 A;  4Y15 A;  3DKW A;  4CHU A;  1HKT A;  4PDK A;  3V8L A;  2Z3Y A;  3LAP A;  5DUK A;  2EK5 A;  3ZMS A;  4GO1 A;  3CDH A;  3I54 A;  2QQA A;  4HW0 A;  2GQQ A;  1K6O A;  3TOA A;  2CYY A;  3TDU C;  5ILV A;  1W7P D;  1DUX C;  5HLI A;  4RGR A;  4Y17 A;  2QUF A;  3RIR A;  5FLX Z;  4BNC A;  1GXQ A;  1J5Y A;  3B73 A;  4LFU A;  1TTY A;  2A69 F;  4IXA A;  2LKP A;  2KIM A;  4UVB A;  2BBY A;  3CUO A;  1EH8 A;  1OR7 A;  5FFZ A;  3LQQ A;  4M6X A;  2EB7 A;  3DF8 A;  2F5F A;  3G3Z A;  3GEZ A;  1P2F A;  3GF2 A;  3F6V A;  3K69 A;  2IP2 A;  5J6X A;  1KGS A;  4S04 A;  4EQQ A;  3LST A;  1BI0 A;  5HDK A;  2LDU A;  3TGN A;  4L9J A;  2M8E A;  1H9G A;  2V1X A;  1K78 B;  3ZMZ A;  2E7X A;  4PGG A;  2M5W A;  4A0X A;  1K78 A;  4XSX F;  2M30 A;  5D5W B;  2VON A;  2Z99 A;  1AOY A;  3F21 A;  1FSH A;  1KYZ A;  2BE5 F;  3ABU A;  5L3G A;  2DFI A;  4WXD A;  3BRO A;  2OD5 A;  5FLX K;  2HGC A;  4YFX F;  3H92 A;  2QEN A;  4OMY A;  1ZHF A;  3C1D A;  2FBH A;  4MEY F;  1ON1 A;  1KU3 A;  2OQR A;  1MKM A;  2PN6 A;  3ERE D;  5HOO A;  4A12 A;  3KP6 A;  1FP1 D;  3WU1 B;  2FEZ A;  4HQM A;  3I71 A;  3HYI A;  1MDM B;  3RDI A;  4EM1 A;  2UXX A;  1G4D A;  4PCQ A;  3R0A A;  2HDC A;  1LB2 A;  4OIN F;  3R61 A;  5ICF A;  4KA4 A;  1J7K A;  4UHT A;  1Z6T A;  2GIV A;  1WSU A;  1GVJ A;  4G6Q A;  4CZZ A;  3EYI A;  4QLC U;  1QBJ A;  5LBQ A;  3MEX A;  3V8K A;  1YW9 A;  3HRM A;  1HBX G;  1ONV A;  3KET A;  4OIR F;  4WF2 A;  3DPT A;  3L09 A;  2M87 A;  2QM3 A;  3V8J A;  1W7P B;  1SFE A;  2QQ9 A;  2Y0M A;  2IT0 A;  4EM0 B;  4JQF A;  1SAX A;  1W7P A;  3QAH A;  3PQK A;  4KMF A;  3K0L A;  1ZN2 A;  3M8F A;  2ZNZ A;  2FRH A;  1KQ0 A;  2JPC A;  5FO5 A;  2VBZ A;  1ZRF A;  3VB2 A;  4E70 A;  1S8N A;  5CVI A;  3HTU A;  4UNO A;  4RAY A;  3C7J A;  3M9A A;  2EV0 A;  2MH9 A;  3RKY A;  3DPL C;  4HBL A;  2R7F A;  2RGV A;  4ENN A;  1ODD A;  5F6F A;  3I4P A;  2QWW A;  4H0E A;  2EV5 A;  3MCZ A;  1R1T A;  2DLL A;  1DDN A;  4HF0 A;  5TJJ A;  2QYO A;  3GXO A;  1TQI A;  3WTV C;  2CG4 A;  1S7A A;  5D6E A;  1XMK A;  3Q5F A;  2PFB A;  3HHH A;  3RYP A;  4XLN F;  2ISZ A;  3GX4 X;  1T0F A;  1D5V A;  1BI3 A;  1LNW A;  4HLY A;  2DU9 A;  4HV5 A;  1UB9 A;  5ILS A;  1Z7U A;  5DDG A;  2P8T A;  3FM3 A;  3NEU A;  2XKP A;  3HSR A;  3FXR A;  1I1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...