2BBYA

Dna-binding domain from human rap30, nmr, 30 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
b'RARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAP30
publication title Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 14
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02270 TFIIF_beta TFIIF, beta subunit HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bbyA00
2OU2A 1W5SA 2M5WA 1MGTA 2LF8A 1OKRA 2PMUA 2DBBA 2BE5F 1W7PB 1E2XA 3E5XA 3J81Z 1XCBA 4HLXA 4E70A 2FA5A 2XAFA 4RGSA 4OMZA 3KFWX 3KLNA 4Y17A 3ZMUA 4IRHA 1PUEE 1J0RA 3KZZA 1SD5A 3JSPA 4I0BA 1R36A 4M9ZA 3DFGA 4AIHA 2CG4A 1F4KA 1BI2A 4LFUA 4A0YA 3TDUC 4PGHA 1MD0A 4XBFA 4HF1A 1K78B 5LBQA 2DQLA 1IW7F 2G7HA 1Z91A 5IT9Z 3GFIA 1T38A 2VBZA 1YW9A 3WTZA 3U9GA 3LQRA 1FBQA 1W5TA 5EEHA 1LB2A 4L0YB 1ZLKA 3IL2A 3B02A 2YX7A 5LGUA 2ACJA 2DK8A 1ULYA 4HV5A 4H0EA 5FLXZ 4QLCU 3ZMVA 2C6YA 1XMKA 2RV8A 5E1XA 1LEAA 5FO5A 4YIFA 3CO7C 1J9IA 4WK8F 2MA3A 3FWEA 2VE8A 2VOPA 5JI6A 1WQ2A 2IA0A 2WTEA 4LB5A 3QP5A 3NRVA 1UB9A 5ILSA 1RI7A 2Z99A 1LQ1A 1BIBA 5ILUA 2VBWA 3TKYA 5K5QA 1RUOA 2VE9A 3R0JA 1IN5A 4HA8A 2EV0A 2F5EA 2L4MA 1I1SA 3E6BA 3E97A 1QZZA 4XLPF 2FQ3A 4U0WA 1X3UA 4M6XA 2E1NA 5D6FA 2QUFA 2FMLA 3I58A 4KMUX 3WE2A 4IHTA 5D5UB 2P7VB 2VC0A 2ETHA 4ZYEA 4MEXF 4CDGA 2ISYA 3KE2A 3IC7A 1HW5A 1XDSA 3SZPA 3W6JB 4HOBA 2NAZA 4BHBA 3KP4A 4UNOA 4IRIA 3FM3A 1YLFA 2HZTA 2QENA 4P9UA 2ZJ2A 3GFLA 3QU6A 5CYVA 3HHHA 4A2UA 4Z2YA 1S8NA 2XAHA 3RDIA 1O7LA 3H92A 1R5HA 2IVMA 1G3YA 2IP2A 2G9WA 2K4JA 3VEPA 4HDUA 5LLQA 2XAJA 3WGGA 4LG0B 3TOBA 3C1DA 3LQQA 4Q47A 3MZHA 2MBFA 2STWA 4Y13A 1OYWA 3WTYC 4G7OF 5CJ9A 4HYEA 2P5VA 1YFHA 2JSCA 4UVCA 3RTRA 4OU0A 3FMQA 3E3VA 5H6RA 5E1ZB 3RYPA 2O3FA 2STTA 2JRTA 4GGGA 1GXQA 1Z05A 5DCMA 2QQ9A 5AIPA 3NEUA 1I6XA 5F6FA 1B9MA 5KK1A 4G9YA 1UFMA 1MJAA 4LJZF 2FU4A 1LNWA 1XCVA 2P8TA 2DLLA 1ZARA 4IXAA 4YFKF 2OA4A 2NS0A 3LA2A 1YS6A 3K1MA 4UVBA 3J80K 1MDMB 4KN4X 4O5VA 1TNSA 3BDDA 3ECHA 4OIPF 1ZH5A 1Q1HA 4TV7A 4BAYA 1KU2A 2DO7A 2X4HA 1I5ZA 3V4GA 1TLHB 4HX4A 2ZNYA 3R4KA 2J5OA 4ON0A 3OOPA 5FFZA 4LK0F 3E6DA 3RIRA 5HLGA 5D4SA 1LJ9A 2D45A 4Q5SF 1OYIA 1G3WA 2DPUA 3EUHA 2XAGA 5DCFA 2A69F 1ZHFA 1HBXG 4GCVA 2EV5A 5K5OA 3BZ6A 1XGSA 2F2EA 2VC1A 3KCCA 1S7AA 1IRGA 1U5TB 4ENMA 4YG2F 1TTYA 2H09A 1OYYA 3REOA 4L18B 5D5XB 1Z6TA 4LGWA 1KU7A 5BPDA 2E1CA 3HSFA 1OR7A 2E7WA 4BYYA 3E6MA 2VT2A 2Z9OA 4BH9A 1BBYA 3F72A 2KKOA 4M6YA 4RGXA 3HYIA 4ESFA 2YPRA 4IRGA 4RAYA 1JGSA 1XD7A 2KIUA 1REPC 4M73A 3F23A 2VT3A 3I64A 3U2RA 1H0MA 3SQNA 3K1NA 4XLNF 3WG9A 5TJJA 2ZXJA 3HRMA 3QOPA 3F6VA 5FB2A 5E8GA 2FXAA 3I0TA 1FZPB 4HX8A 3KLOA 2MC3A 4PZJA 4Q48A 4NHJA 1WKMA 3Q9SA 3E5UA 3I59A 2L02A 3FHZA 4O3MA 4XRFA 2XIGA 2XKOA 2Z3YA 2KRFA 4UV9A 3TO6A 3DPTA 2L3DA 5CVVA 1XMAA 4U0YA 2VODA 2EK5A 1G4DA 5A2QZ 1DP7P 2JTVA 3WTUC 4D0PA 4AWXB 1T6SA 3V8LA 1IXCA 2FMYA 1ON2A 4KIGA 3VODA 4G7HF 3BWGA 3WODF 1ZG5A 5ICFA 4ZYHA 2OD5A 3KZYA 4EM0B 4CHUA 2FE3A 3JW4A 3ISPA 3LAJA 2RQPA 3IWFA 4ETSA 1FSEA 3HTUA 4NB5A 4U7BA 4BHCA 5JR3A 2ESNA 4LMYA 1KA8A 1C0WA 3CUQA 3WTWC 1FLIA 2OQRA 5E18F 4G8XA 3GLXA 4EJOA 2GQQA 4I09A 1F1ZA 2DI3A 4MQVA 3FX3A 2MLKA 1FYMA 1G3SA 1HQCA 5HDGA 3EQLF 4EJUA 2A68F 3QRFF 2TDXA 4N0BA 3P7NA 2Q2EA 3GZ5A 5KVRA 2PG4A 5HS8A 4KT5C 4A0ZA 3R0AA 1YYVA 4OIQF 5HLHA 4KYWA 1U3EM 3F8CA 3HOTA 1K7AA 1XGOA 2G7UA 2E7XA 3BOQA 3J81K 3V8KA 2W84A 4MNUA 1IAWA 2ESHA 3GVAA 2DTRA 4MQ9F 2HFHA 3DKWA 2RGVA 3K9TA 2HQNA 2KJCA 2IJLA 3GW2A 1QBJA 1KQ8A 1IUYA 3M8EA 1GXPA 5JVTA 1B6AA 4EQQA 1EH7A 4IHSA 2RKHA 5IT9K 2FBIA 2XAQA 1ZYRF 1D3YA 4IPAA 4HQEA 1MKMA 4MTEA 3I4PA 3V7RA 5ICEA 3GYHX 1PDNC 3KETA 2BGCA 2Y75A 5HS7A 4EJWA 2GWRA 5L3BA 1BOAA 2W85A 5DEQA 1U8RA 3SZTA 3GF2A 2O0YA 1XSVA 3ZMTA 4UUVA 5DYMA 4EV0A 3VOEA 2PFBA 1EV7A 5ICCA 4IJAA 5BQTA 5HS9A 5FLXK 2MD5A 4HDVA 3MCZA 3WTSC 2O8XA 5DD4A 5HLIA 4B8XA 5JFRA 2FF4A 3T1BA 4F7ZA 4I7HA 5LRSA 1BN5A 5J6XA 5K1YA 3BY6A 2QQAA 2IRFG 4WF2A 1UHWA 5E1WA 4U0VA 2NYXA 2P7CB 1S6LA 5BPIA 2BYVE 3EYYA 1T2KA 1K6OA 3T8RA 4M71A 4M74A 2O6GE 4KNYA 4XSZF 2PI0A 1O3TA 4ZZDA 4GYGA 4YFXF 2HDCA 4LLLA 5J8CA 3QP6A 3O3KA 4CXFA 5EEGA 2QBYA 1USTA 3F21A 3SFZA 4AIJA 4FX4A 1B9NA 1J7KA 2V1DA 1Y0UA 4RB3C 3H3ZA 1D5VA 5DUIA 2V79A 1G6NA 3EDPA 1DPUA 2K7LA 4EJVA 3P9CA 3LA7A 3JTGA 2IA2A 5DDGA 4A12A 1LEBA 1FBSA 2VBXA 3FMSA 1FT9A 4L9NA 3PQKA 3FMRA 1TBXA 4ASNA 1RIOH 2K02A 2DT5A 2FBKA 2DAOA 2HYFA 2A3SA 5FGMA 2ZMEB 3WGIA 4KUMA 4UXNA 3K2ZA 4PGGA 2K4BA 3CUQC 2WV0A 3TO7A 2MH9A 2CGPA 1HSJA 1YW7A 2HGCA 2KIFA 2HKOA 4KA4A 2HTJA 1V3FA 3K0LA 2OZUA 3ZP5A 1TQMA 1CF7A 4LK1F 1STZA 5LGNA 1L3LA 1QQIA 5HDKA 1U78A 4CZZA 4PCQA 2PQ8A 1YIOA 1SMTA 4GO1A 4ZYDA 1YW8A 5H20A 4LLNA 1B59A 1HKQA 2IW5A 3ELKA 2M1BA 2XV4S 3DEUA 4ZH4F 4N9HA 3MEXA 1MJBA 3ABUA 2PLYA 2EB7A 5E20A 2DK5A 1RNLA 1F5TA 1SD4A 3VB2A 1WWXA 4YFNF 5CVJA 1ZG1A 1ODDA 2JZYA 1USSA 4MTDA 5DV5A 5CVIA 4K2EA 3R61A 4A6EA 2OBPA 5TRDA 3C7JA 4OINF 3HRUA 3ZQ7A 5D8LB 4WX9A 1SAXA 4HF2A 1LDKB 2PN6A 3G3ZA 3GXOA 2ZO4A 1R1UA 3T5XA 5D5WB 3RI4A 1QGPA 2EA2A 3LAPA 3ZMDA 5AIQA 5F1RA 2QLZA 3TQNA 2CO5A 4LD5A 3U1DA 2F5CA 1A04A 1I1GA 3DV8A 3HOSA 3W6KB 2GAUA 4NQWA 4B09A 1IZ1A 5ILVA 1FSHA 2XGXA 2B0LA 3F8BA 4I02A 2AXLA 3BPXA 5ERIA 5BOXA 3RJPA 1T39A 5CLSA 3F3XA 5FD6A 5DD8A 3ULQB 1DUXC 4QWQA 1T98A 1HW2A 3DP7A 4LB6B 3F22A 4ENJA 3P9KA 2VN2A 2IPQX 2HR3A 4CGZA 3N97A 1QNTA 4I0AA 1W7PA 3WTXC 4U7DA 2DQRA 1DDNA 5DUKA 1Z1DA 3V7SA 3GZ6A 2RN7A 1O7FA 5K5RA 4L5JA 4WWCA 1IF1A 5D8KB 3COAC 4L9TA 3CLOA 4U88A 1TW3A 3FXUA 1YTYA 2HKXA 2M30A 4AVPA 3R60A 4WCGA 1J5YA 1MZBA 2OQGA 1FBUA 4L9VA 3BJOA 3HSEA 4JK1X 2ZFWA 4A5MA 2LF7A 3R6SA 1QO0D 1ZGJA 2A07F 1K79A 4HAMA 4ZZLA 5ED4A 3NQOA 2P4WA 4M72A 1FP2A 1AWCA 4HLYA 2QQBA 2QWWA 5BS6A 2P5LC 2DU9A 2YX4A 3K69A 3FM5A 5A2QK 1J2XA 2UZKA 4ENKA 1P4XA 4P5OA 3KP5A 4HF0A 1BC8C 2FRHA 2LKPA 1U2WA 1SD7A 2PEXA 2HQRA 3CO6C 1KU9A 3DPLC 2XASA 2R7DA 1OMIA 2P6TA 3V8JA 3SHFA 5DCMB 1IXSB 2J5PA 5ICGA 4RB2C 3BROA 3F8FA 2R7FA 3PFIA 3IKVA 1IXRC 2COMA 2Y48A 2EFNA 2JPCA 2R3SA 3ML6A 1GHCA 3HIFA 1BM9A 2UWMA 1BIAA 2QVOA 3C3WA 2O61A 1XGNA 2V9VA 4GYIA 3D5LA 4YIIA 2Z5UA 2CYYA 3GFMA 3M9AA 1KGSA 1FY7A 1YG2A 2YSRA 3H3UA 1ZN2A 3D0SA 5D5VB 4XSXF 1PP8F 3ZN1A 4HW0A 3GO5A 2HEOA 3S2WA 1P4AA 2F5DA 1U6GA 4CO8A 2ZCWA 4RB0A 1KU3A 3PQJA 2BEOA 4MGRA 2BBYA 3KEOA 3WTTC 4EM2A 1Z9CA 3TOAA 1ZRDA 3L09A 3JAMZ 4G7ZF 5FD5A 2M8EA 4KFCA 2DW4A 3ZN0A 3E6CC 3F8NA 2NNYA 4Q4ZF 2EV6A 3TDZC 1HSTA 2IT0A 1W7PD 1W4MA 4JQFA 2DPDA 3ERED 4LG0A 2IA1A 1TW2A 2FNPA 3KP3A 4KN7X 1B1BA 1BC7C 4BQAA 1H9GA 3O6BB 4EJTA 5LHHA 2M87A 1BI3A 2CQKA 3T8TA 3K1PA 2L54A 1TNTA 3BPVA 3O2PE 1FNNA 1FOKA 4UHTA 2EWNA 2HTSA 4KICA 4I98B 4BNCA 3RPUA 1ON1A 3IWZA 3HUGA 2HS5A 1VTNC 2RDPA 1Z6RA 2QZ8A 3I59B 1MDMA 2GXBA 3CJNA 2F5FA 2XVCA 3HRTA 1E17A 5BMZA 4M9XA 2ELHA 1V4RA 2YR2A 3Q9VA 2XROA 2CFXA 2OAZA 3FF5A 1R5GA 4N9IA 1P4WA 2MH2A 4DNCA 3MFKA 3L7WA 1S3JA 3ZPLA 3RKWA 5L3FA 2P6SA 1CGPA 2ZBKA 1I27A 1Z7UA 2PMHA 5LRRA 3I54A 4IF4A 5LGTA 5D6EA 5IT3A 2V1XA 5HVQC 2WWYA 4KIBA 3HTSB 3I71A 3AAFA 1LDDA 1ZGAA 2AS5F 4A6DA 2EFOA 3P9IA 3LA3A 3CDHA 1IN4A 3CUQB 4FHTA 1IN6A 1U5TA 4MHGA 3RKYA 3L00A 1P6RA 3LFKA 2PBIA 4FT8A 3F6OA 2A6EF 1R00A 3M1EA 5AONA 2EA4A 3M7GA 2RVCA 5JHUA 2W57A 2ZNZA 3OV8A 5HOOA 1OPCA 2L4AA 4P9FA 5LEKA 1FC3A 5J8FA 5L3DA 2GIVA 4S05A 1ZLJA 3J7AO 5L3CA 2XKPA 2LNBA 2Z33A 1D8JA 1F9NA 4I01A 2A6HF 3LWFA 3MWMA 1KQ9A 1R1VA 4HZFA 5LEJA 2HOEA 1XN7A 4AD9A 1EH8A 2A5YB 3I5UA 2D1HA 1FX7A 3QPHA 3HSRA 3KP2A 1EH6A 4HBLA 1O3SA 3VFZA 3HRSA 3IKTA 3RKXA 2K27A 2ADUA 5H6QA 3JTHA 1WSUA 4RS8A 4ZYGA 1FPQA 4KIFA 2V6CA 2VXZA 1BI0A 5LHGA 2YU3A 4P96A 1H9TA 1PP7U 1MJ9A 4AIKA 1JXSA 4JBAA 1DPRA 1S7OA 4L5IA 2L01A 3WTVC 4S04A 1B4AA 2QYOA 1XGMA 5HDNA 3EYIA 4IVNA 1R1TA 4A0XA 1J59A 5CVUA 2RC4A 1D8KA 4HV6A 4R1HA 1WRJA 2CW0F 4CICA 1NHAA 2D1VA 2ISZA 2JPBA 1L0OC 4CYDA 2PJPA 1GVJA 3DF8A 6PAXA 1IN7A 3KP6A 3WU0A 4BHPA 4WXHA 2W25A 3KP7A 3FXRA 3J80Z 1R22A 5E17F 1BI1A 3GEZA 1YO5C 3L2CA 3ZMZA 3GX4X 4RB1A 2LDUA 4M9SA 3DXJF 3TO9A 4UVAA 3IRRA 2VONA 2P5KA 1RZ4A 1O3QA 4RGRA 2Q8KA 1ONVA 1IN8A 2Y0MA 2H6CA 1HKSA 4BXUA 1R7JA 1ZRCA 2XRNA 4R8HA 4EMSA 5FFXA 4I2OA 5E8IA 4G94A 2WC2A 3GUDA 2HYGD 4MEYF 3MAJA 3JSOA 3HHGA 3KEQA 1JHHA 1HW1A 2VBYA 3IHUA 1AOYA 3T0YA 3TGNA 1FYKA 3I53A 2GZWA 1JE8A 1FWZA 2ZKZA 1HKTA 1TQPA 3M8FA 4OOIA 2QBYB 4ESBA 1XDUA 2FBHA 2W24A 2VOOA 2A61A 4WXDA 4G6QA 1QZYA 2H94A 1HXDA 1SMYF 1WI9A 2RNJA 2KJBA 2MLGA 2BV6A 3E5QA 2EJRA 5F64A 1J75A 4OIOF 4DQ2A 3GFJA 2QM3A 4EGZA 1XSXA 1R23A 4ENNA 3WE3A 2O03A 2GXGA 3ABTA 4L0ZB 1SFEA 2EFQA 4P55A 3BJ6A 3V7CA 1YQAA 1K78A 3QU3A 4OIRF 1KYZA 4GXOA 2NRAC 3MZYA 1JHFA 4G6DA 1U5TC 4HX7A 1O57A 4EVIA 2JT1A 4RGUA 4HQMA 4PDKA 3CTAA 3GWZA 1ZRFA 3ECOA 1CF7B 1R58A 5LHIA 4O6JA 1FYLA 2UXXA 2H27A 1T0FA 2Q0OA 1QPMA 2XUBA 3LSTA 1SFXA 2EFWA 2FNAA 3WU1B 1S29A 3SXYA 3FXQA 3MQ0A 3BP8A 4WXCA 1FP1D 2KIMA 2NNNA 4A5NA 4EM1A 5D4RA 2HWVA 3B73A 2EFPA 2V1UA 1KQ0A 2X0LA 1P92A 3WGHA 1ZREA 4R79A 2K86A 1IRFA 3N4MA 1TQIA 2GA1A 4Y15A 1UHMA 2CSOA 3ROUA 4UV8A 3DQVC 1ZAOA 3QAHA 1O3RA 2DFIA 2M45A 3Q5FA 2FSWA 1SD6A 2GA2A 1SFUA 2FEZA 1XSDA 2OZ6A 2H6BA 3RPQA 1ZG3A 2FOKA 3L9FA 2XHKA 4EGYA 1LDJA 1XB4A 2D2WA 4L9JA 1YS7A 4FX0A 5L3EA 4KDPA 2CWEA 4RAZA 5L3GA 1BJAA 3QPTA 1G3TA 1P2FA 3IRQA 3EETA 3BJAA 3CUOA 2UXNA 4ESJA 4OMYA 2LSOA 3FZVA 3ZMSA 3JAMK 1UCRA 3C18A 5CVRA 4KMFA 2ZMEA 1LVAA 3F8MA 1RUNA 3G73A 4LLGF 1KYWA 3RYRA
chains in the Genus database with same CATH superfamily
2OU2A 1W5SA 3BTJA 2M5WA 2OV7A 3ABKH 1MGTA 2LF8A 3DBHB 1OKRA 2PMUA 2R7TA 2DBBA 1EF4A 2BE5F 1TP4A 1W7PB 1E2XA 3E5XA 4C3JJ 3BZCA 1O4XA 3J81Z 1XCBA 4HLXA 4E70A 2W4SA 4ZC3A 2CW8A 2FA5A 2CS3A 2OTJI 3FISA 2XAFA 3K2AA 3LSGA 3KYDB 4RGSA 2LK2A 4OMZA 3S16J 1E3PA 3KFWX 3KLNA 4Y17A 3ZMUA 4IRHA 1PUEE 1J0RA 3KZZA 1SD5A 1GDTA 2HU9A 1LE8B 2EZLA 3JSPA 3DKYA 4I0BA 2XF5A 1N75A 1R36A 4M9ZA 2ME6A 2ELKA 3DFGA 1RKTA 4AIHA 4J19A 2CG4A 5TISC 1F4KA 1BI2A 4CCLA 4LFUA 1MMNA 4A0YA 3TDUC 4PGHA 1MD0A 4XBFA 3CMAI 4HF1A 3FXOA 2X6WA 5M3FJ 1K78B 1MBKA 5F1JA 5LBQA 2DQLA 3Q0VA 2PMZN 1IW7F 2G7HA 1Z91A 5IT9Z 3GFIA 1D0ZA 3CLQA 2W82A 4CCKA 2VBZA 3CDLA 1T38A 2UUZA 1YOVB 1YW9A 3UKGA 3WTZA 3K4NA 3U9GA 3LQRA 1FBQA 2XGCA 2X6YA 1W5TA 5EEHA 3L2RA 1LB2A 4L0YB 1ZLKA 2E71A 3QPLA 3TP0A 3IL2A 3CC2I 2A6TA 3B02A 2YX7A 4D9JA 5LGUA 2IAIA 1X1PA 3MKYB 3A2KA 2E60A 3L2QA 2ACJA 3BTIA 3DEEA 1LFBA 4FTHA 2DK8A 1ULYA 4HV5A 2Z16A 2KDZA 4H0EA 2ZFUA 5FLXZ 4QLCU 3ZMVA 4ZTJA 1QVTA 2C6YA 1TWCJ 1XMKA 2RV8A 3DEWA 1LEAA 5E1XA 3WHCA 1D5YA 4CCMA 1D1AA 5FO5A 3TW7A 4YIFA 3CO7C 5CKTA 3GCMA 3OYKA 1J9IA 1TT0A 4WK8F 2MA3A 1YX5A 3FWEA 3H3VK 2VE8A 2GM4A 3HGGA 5JI6A 2VOPA 2R5ZA 1VNDA 1WQ2A 2IA0A 2WTEA 4LB5A 4XK4A 4PFOA 2ZC2A 3QP5A 3OYCA 1W1WE 2TRTA 3NRVA 1UB9A 1V5FA 2JA6J 3CC7I 5ILSA 1OFCX 1RI7A 2DYSH 2Z99A 3CCLI 1BIBA 1LQ1A 5ILUA 2VBWA 3TKYA 4LIVA 5K5QA 3OMYA 1RUOA 2XPVA 2VE9A 4FETA 3R0JA 1IN5A 2K5CA 4HA8A 3SEZA 2OCEA 3VYUB 3LOCA 1UAAA 2X85A 2ID6A 2DCEA 2EV0A 2F5EA 2L4MA 1I1SA 1LFPA 3E6BA 3E97A 4B4CA 1QZZA 4XLPF 2JRMA 1Z21A 2FQ3A 4U0WA 1H8AC 3NAUA 1X3UA 2ELJA 4M6XA 2E1NA 3G71I 2DOEA 4OAYA 1Z67A 1T0FC 1MNDA 3L1PA 3G4SI 5D6FA 2CQ7A 2QUFA 2FMLA 2HVQA 1GVDA 4HRIA 3I58A 2K9QA 4KMUX 2HOAA 2VQLA 4CUGA 1WJ5A 1QHGA 2HNHA 2E2JJ 1Z3YA 3WE2A 4IHTA 5D5UB 1D0YA 2P7VB 2AHQA 2VC0A 3Q0UA 2L7KA 2F4MB 3JRBA 2K3FA 5FRMA 3CCEI 2ETHA 3G1OA 4ZYEA 1Y8QB 4MEXF 4CDGA 3H1CA 2R0QC 1Q1VA 2ISYA 3KE2A 3IC7A 4RLFA 4J01A 1ETOA 2IS4A 3FDYA 1HW5A 3VYRB 5GAHJ 3UR3C 4B48A 1XDSA 3SZPA 3BQYA 2VQCA 4MIMA 2DT6A 3CF5F 2CQXA 3W6JB 4HOBA 2NAZA 2ME0A 4BHBA 3GZNB 3KP4A 4UNOA 1ZGWA 1I3AA 4IRIA 3FM3A 1YLFA 1ETVA 2HZTA 2QENA 3S32A 1JKQC 4P9UA 3SJMA 1MBFA 2ZJ2A 2BXZA 1D1BA 2BY1A 3AL0B 3GFLA 3QU6A 5CYVA 4ZDLA 2JJ7A 3HHHA 4A2UA 2MD0A 3HPHA 4Z2YA 2DMQA 1S8NA 4CSWA 1H88C 3HM5A 2XAHA 2B63J 3TMOA 1GT0C 3BCBA 3RDIA 1O7LA 1QVUA 2A05A 3H92A 1R5HA 2IVMA 1VQLI 3HOYJ 1G3YA 2KT0A 2IP2A 2G9WA 2K4JA 3VEPA 4HDUA 5LLQA 2XAJA 3WGGA 5E3NA 3TOBA 4LG0B 3FXLA 2MC4A 3RQIA 3C1DA 3LQQA 4Q47A 3HOXJ 4LIUA 3MZHA 3S2DJ 2MBFA 3GLLA 2CV1A 2STWA 4F91B 4Y13A 1OYWA 3WTYC 2LTPA 4G7OF 5CJ9A 4HYEA 5DS9A 2EH3A 2P5VA 1YFHA 2JSCA 4UVCA 3QYEA 1TL8A 1P9QC 3RTRA 2NVQJ 4OU0A 2GXAA 3FMQA 5J47A 1LFUP 2HXIA 2WB1A 4A3GJ 3AL0C 4ANJA 4IHVA 5IP6A 3E3VA 3OYJA 4IX7A 4IHWA 5H6RA 5E1ZB 3RYPA 5HLTA 4EEFG 2DT7B 1MW7A 2O3FA 3K6GA 2ZMEC 2JRTA 3A03A 4LITA 4GGGA 3ZR8X 1GXQA 1QPIA 2STTA 1JKOC 1Z05A 5DCMA 1NTCA 2QQ9A 5AIPA 3NEUA 1I6XA 5F6FA 1B9MA 1NG7A 5KK1A 4G9YA 2M4GA 2X1CA 3DTIA 1UFMA 3KIOA 3CCVI 1MJAA 5LD2C 1Y1WJ 4LJZF 4XOPA 2FU4A 1LNWA 1XCVA 2P8TA 2E35A 2DMUA 4AYBA 3DBLB 2DLLA 1ZARA 4IXAA 4RMNA 3IH4A 3HUGB 3BR5A 4YFKF 2OA4A 2NS0A 4PJLA 4NUBA 2F4OB 3LA2A 1YS6A 5DM6F 3ZQIA 2RNGA 3K1MA 4UVBA 3J80K 2M0MA 1MDMB 1R4NB 3OIOA 4KN4X 3DTKA 4O5VA 1TNSA 1DP3A 3BDDA 3ECHA 4OIPF 1ZH5A 1Q1HA 2ZJRF 4H4KC 4TV7A 4BAYA 1KU2A 2DO7A 3S1QJ 2X4HA 1K83J 1I5ZA 4I99C 1TLHB 2LKSA 3V4GA 2V1NA 1X1BA 4NC7A 4HX4A 3QODA 4JX6A 3I55I 3I4MJ 2ZNYA 3R4KA 2J5OA 4ON0A 3OOPA 2GOXB 5FFZA 1VQ5I 3H9JA 4LK0F 4BE1A 2KL4A 3E6DA 2K9NA 3RIRA 5HLGA 5JLWA 5D4SA 1LJ9A 1N25A 3PUBA 2D45A 4Q5SF 1OYIA 1GV5A 3PUFA 1G3WA 4CCJA 1BR2A 3FKIJ 1VQNI 2OC6A 2DPUA 3EUHA 2XAGA 5DCFA 2A69F 4XLCA 3HDDA 1SVOA 5C3EJ 1ZHFA 4A3DJ 4XKVA 4XKWA 2JVHA 1HBXG 3B6AA 1Y1VJ 4GCVA 1WFXA 4F52A 2EV5A 4II3A 5M5XJ 5K5OA 3BZ6A 1XGSA 2F2EA 1FMVA 2L5QA 2VC1A 3KCCA 5F27A 2K9MA 2A5WA 3LSIA 3L2UA 2EIKH 1S7AA 1IRGA 3BR0A 4PUSA 2KRCA 1U5TB 3OYEA 4ENMA 4YG2F 4I6ZA 1TTYA 3CMMA 2H09A 1OYYA 3REOA 1ORKA 5D5XB 1JKRC 4L18B 1B72A 1Z6TA 9ANTA 4OAZA 4LGWA 4XOTA 2LD5A 2MYSA 2IEKA 1KU7A 2QGUA 5BPDA 2E1CA 1VQ8I 3HSFA 1OR7A 5C4JJ 2E7WA 4UUTA 5EZGA 4BYYA 2OJED 2DA1A 3D1NI 4UB8C 3E6MA 3PM1A 4BACA 4BE0A 3K4KA 2VT2A 1WGXA 2Z9OA 1IDZA 2VKHA 3LMMA 4BH9A 1BBYA 2IGMA 4CYCA 3F72A 4DYCA 2KKOA 1DQUA 4M6YA 4RGXA 4E7LA 1HCRA 5FKKA 1K61A 2FD5A 3HYIA 5J4VA 3DLLF 4ESFA 2YPRA 4IRGA 2V7FA 4RAYA 1X3ZB 2DTZA 1JGSA 1XD7A 2KIUA 5GAEJ 1REPC 4M73A 3MVPA 4BQOA 3VYSB 3F23A 3LSMA 3HG9A 2VT3A 3I64A 3BT9A 5KAIC 3ZCOA 4HNTA 2QCOA 5EEAA 3U2RA 1E3OC 1H0MA 3SQNA 5FKMA 1HDDC 3K1NA 2IS1A 4XLNF 2Y9ZA 3WG9A 5TJJA 1UJ8A 5IYDJ 3OYBA 2ZXJA 1YJWI 3HRMA 3QOPA 3F6VA 5E8GA 5FB2A 2FXAA 3I0TA 2Y0SA 5JHFA 2BW3B 1FZPB 4V19K 1UZCA 2OCCH 4HX8A 3VSKA 3KLOA 2MC3A 1BL0A 4PZJA 4Q48A 4S0HB 1LVKA 4NHJA 2BXYA 4HEA2 3IP4B 1WKMA 4XN0A 2DA3A 2DYRH 3Q9SA 1JTXA 2KPMA 3NWTA 1ZELA 3E5UA 1MBEA 3I59A 1RR7A 2L02A 3FHZA 3BLYA 4O3MA 4XRFA 3J7ZI 1H89C 2XIGA 1VQ7I 4RM2A 5J3LA 2XKOA 2Z3YA 2NS7A 1RPWA 3S14J 2KRFA 4UV9A 5EG0A 4RDUA 4F92B 3TO6A 3DPTA 2L3DA 5CVVA 2PJRA 1XMAA 4U0YA 2EZHA 2VODA 2EK5A 1G4DA 1AKHB 2ZXHA 5A2QZ 4A3FJ 2DMTA 4ZDOA 1PUFB 1DP7P 2JTVA 3WTUC 4D0PA 2R7WA 2HQAA 1IC8A 4AWXB 1T6SA 3SEQA 3W2WA 3V8LA 1IXCA 3ZRGA 2FMYA 1ON2A 4KIGA 3VODA 2E19A 4G7HF 3BWGA 3WODF 1ZG5A 4RAFA 2LREA 5ICFA 4ZYHA 2ZXWH 2OD5A 3KZYA 4EM0B 3HOUJ 2MABA 2KZVA 4CHUA 4YEJA 2FE3A 3JRGA 4FQGA 4Y4RA 3JW4A 2E1OA 3ISPA 3LAJA 2RQPA 3IWFA 4ETSA 1FSEA 3IV5A 3LSHA 3FIWA 2JUGA 1DGWY 3CJTB 3GTQJ 3HTUA 4M3BA 4NB5A 4U7BA 3CCYA 4IHYA 4BHCA 2IGKA 5JR3A 4IOAF 2ESNA 2AQFA 3BCAA 4LMYA 1MBHA 1KA8A 1SFOJ 1C0WA 3CUQA 3WTWC 3H9GA 1U9NA 1D1CA 1FLIA 2OQRA 2ZSIB 3AG1H 4G8XA 5E18F 1IJWC 3GLXA 2HXOA 1YE9A 1WHUA 4EJOA 2F5VA 2R4GA 1YIJI 1MMSA 2GQQA 4I09A 2DDBA 4DIQA 1F1ZA 2DI3A 4MQVA 3FX3A 2R92J 1IG7A 4XONA 1HF0A 1BW5A 2MLKA 3S17J 3TEDA 1FYMA 4IEJA 3QYFA 3FK6A 1OISA 4GRIA 1MBJA 1G3SA 1HQCA 5HDGA 2XSJC 3EQLF 4EJUA 1OLTA 2A68F 1AA7A 1X1CA 2P0WA 3QRFF 4BEHA 5F0HA 4C2MJ 5J1UA 2TDXA 2I10A 4N0BA 2DODA 2HI3A 4GFBA 2VQHA 2CUEA 3P7NA 1E0EA 2VL8A 1XMXA 1FIAA 2Q2EA 1QA6A 3GZ5A 4BXXJ 3J7YJ 3IH3A 5KVRA 2DA7A 3DCFA 2PG4A 1HOMA 1T95A 2EZIA 5HS8A 4C3IJ 4KT5C 3K4MA 3OWTA 4A0ZA 3R0AA 1YYVA 3JRCA 4XRSA 4OIQF 5HLHA 4BY7J 4KYWA 1U3EM 4CA0A 3F8CA 3I3LA 3HOTA 1K7AA 1MIJA 1XGOA 4V2GA 2G7UA 2E7XA 3BOQA 3J81K 1V55H 4E7HA 3CZ6A 3PIPF 2K9SA 2L9NA 3V8KA 2W84A 4MNUA 3ZQGA 1IAWA 4RM3A 4XRSG 4PFPA 2ESHA 1Z3XA 3SFIA 4II2A 1HLVA 3DLAA 3GVAA 2DTRA 4MQ9F 2HFHA 1RKWA 3DKWA 4HG2A 2RGVA 3K9TA 2HQNA 2KJCA 3M1CA 3W2VA 2IJLA 3GW2A 1QBJA 5IPAA 1KQ8A 1HC8A 1VF9A 1IUYA 2FX0A 3M8EA 1GXPA 2L2OA 2F48A 5KNLA 3LFUA 5JVTA 3RQ4A 3GTGJ 3CP2A 4XQFA 1B6AA 5KCMA 1OQYA 1Y0NA 3L2VA 1B8IA 4EQQA 1EH7A 2IXSA 4Z6YA 5EGOA 2YU9J 2CRGA 2W7NA 4IHSA 4XIDA 2RKHA 3HC7A 3GTOJ 5IT9K 3PJRA 2FBIA 3CCJI 2XAQA 1YRNB 1ZYRF 1D3YA 4IPAA 3H5AA 3HL2A 1ENHA 4HQEA 1MKMA 1X58A 2WADA 5FJ8J 4BUPA 2OPTA 4MTEA 3I4PA 3V7RA 4A3LJ 1BOBA 5ICEA 3BTLA 3GYHX 3VSLA 2R5YA 1PDNC 1HDPA 3KETA 5CPRB 2BGCA 2Y75A 1RC9A 5HS7A 3JREA 1DGRM 2XF7A 3PIOF 4EJWA 4NBQA 2GWRA 4BS9A 5L3BA 1BOAA 2W85A 4XKCA 5DEQA 1U8RA 1ZTRA 3SZTA 1OR7C 3GF2A 3G6EI 2O0YA 1XSVA 3JRHA 3ZMTA 2BHZA 1Y39A 5DYMA 4UUVA 2AO9A 4EV0A 3VOEA 2PFBA 2DMNA 1EV7A 2HZDA 3SDGA 2LR8A 1OCPA 2K9LA 5ICCA 3BZKA 4IJAA 3W3CA 5BQTA 2R7SA 4BL0B 5HS9A 5FLXK 4P1WA 2NVUB 2MD5A 4HDVA 3MCZA 3WTSC 2O8XA 3F9KA 3I56I 3A01B 1Z7LA 5DD4A 5HLIA 1DU0A 2R93J 4D7MA 4B8XA 3IAS2 5JFRA 2FF4A 2X1DA 3T1BA 4F7ZA 1UMQA 1WVRA 4JX5A 4I7HA 2HQ5A 5LRSA 3CF2A 1BN5A 5J6XA 3OYGA 5E3MA 1V5EA 5K1YA 1NK2P 3H9QA 4MLOA 3BY6A 2LFBA 2QQAA 2IRFG 4WF2A 3S1RJ 1TC3C 3HKZN 2QF7A 1UHWA 5E1WA 5M5YJ 2CV0A 1KZHA 1JUSA 4U0VA 5GPAA 2NYXA 3OSFA 2P7CB 3WU2C 2KP6A 1S6LA 4E7KA 2W00A 5BPIA 2BYVE 2VXDA 3EYYA 3K10A 2DMPA 1T2KA 1N77A 1K6OA 3BR1A 3T8RA 2AQEA 1ETYA 2BY0A 5IP7J 3MN2A 4M71A 4M74A 2O6GE 4KNYA 4XSZF 2PI0A 1O3TA 2VIXA 4ZZDA 2EIMH 3QOEA 4E4HA 2I8DA 4GYGA 1JI8A 4YFXF 1ZK8A 2HDCA 3LSRA 4LLLA 3ABLH 3QP6A 1ZKGA 1TWHJ 3O3KA 5J8CA 1SEUA 1JJ8C 1WCMJ 5J4YA 1NK3P 2X6OA 4CXFA 3M07A 5EEGA 2JA8J 1BA5A 2QBYA 1USTA 3F21A 4XLAA 3SFZA 2DDAA 4AIJA 4FX4A 1B9NA 2O7OA 1J7KA 2V1DA 4FCYA 4OWRB 1S9HA 1Y0UA 4RB3C 3C2BA 2H1KA 3H3ZA 1D5VA 1WZ2A 2Z2SB 5DUIA 2V79A 3HZJA 1G6NA 4Y7NJ 3EUAA 3LSKA 4XL9A 3EDPA 1DPUA 5B1BH 3W2AA 1K6YA 2K7LA 4D1QA 4EJVA 4BE2A 2QA4I 3P9CA 3LA7A 2KQRA 2IA2A 3JTGA 4M3GA 3OYFA 5DDGA 5H2FC 4A12A 1LEBA 3OS2A 1G8XA 3MKZA 2LBFB 1APLC 1FBSA 3C2HA 5JVGF 2VBXA 3FMSA 1FT9A 4L9NA 4FE4A 4XKBA 2AXTC 3PQKA 4Y33A 1W5CC 1S7EA 3FMRA 1TBXA 4ASNA 2VB6A 1RIOH 4UY8I 2K02A 2DT5A 3OR2C 2FBKA 2DAOA 2HYFA 1NH3A 2A3SA 5FGMA 2ZMEB 3WGIA 1UG2A 2CFOA 4KUMA 4UXNA 3K2ZA 4PGGA 3G2BA 4A3MJ 1KONA 2K4BA 3CUQC 2WV0A 3TO7A 2YS9A 4RA2A 2MH9A 2CGPA 1HSJA 1YW7A 2HGCA 2JVGA 2KIFA 2HKOA 5EZHA 4KA4A 3DU5A 2HTJA 3OSGA 2XPUA 2CQQA 1V3FA 3K0LA 2OZUA 3ZP5A 1FTTA 1TQMA 1G2HA 1CF7A 4LK1F 1STZA 1YJ9I 3TL4X 5LGNA 1L3LA 2Q1ZB 5DM7F 1JUPA 1U9OA 1QQIA 3SYTA 5HDKA 1U78A 2L9VA 4CZZA 4PCQA 2PQ8A 1JJ6C 1YIOA 1VQ9I 1SMTA 4GO1A 2NOJB 4ZYDA 1YW8A 5H20A 4LLNA 4XN3A 4PK4A 1B59A 1HKQA 2XAUA 2IW5A 2VKVA 3ELKA 2M1BA 2XV4S 3DEUA 4A69C 4ZH4F 3M8JA 3OYLA 3D5RC 4N9HA 3MEXA 1MJBA 2X6XA 3ABUA 5DTDA 3OYIA 2PLYA 2EB7A 4CH7A 5E20A 2DK5A 1RNLA 1F5TA 2WAFA 1SD4A 3VB2A 1WWXA 4YFNF 3X2QH 3OS1A 5CVJA 2WV1A 1ZG1A 4L5EA 1ODDA 2JZYA 3GBGA 1USSA 4MTDA 2VJIA 2GIZA 2L7FP 5FKOA 4A3JJ 5DV5A 4D7NA 4DJAA 2WAEA 2R7UA 2M2EA 5CVIA 4K2EA 3BG7A 3R61A 4A6EA 2OBPA 1X4PA 5TRDA 4BQQA 4DGWB 3C7JA 4OINF 3HRUA 3ZOBA 3ZQ7A 5D8LB 5IOZA 4WX9A 1SAXA 2QQ8A 4HF2A 1LDKB 2PN6A 3HGYA 3H5RA 4DZPA 3G3ZA 3GXOA 2Y31A 5GADJ 2NS8A 2ZO4A 1R1UA 3BC8A 2ZXIA 2EINH 3IH2A 3T5XA 5D5WB 1X4OA 1QGPA 3FK7A 3RI4A 2EA2A 2ICWG 3LAPA 3A1YA 5AIQA 3ZMDA 5F1RA 2QLZA 1TWAJ 3TQNA 3AKZA 2R7ZJ 2CO5A 4LD5A 4B3AA 3U1DA 3M4OJ 2F5CA 2DA4A 1A04A 1I1GA 3DV8A 1QHHD 2JWTA 3HOSA 3W6KB 1QRYA 1FOXA 2GAUA 4NQWA 2QEXI 4B09A 4IZZA 1IZ1A 3FHNA 3ZGKA 4F3QA 5KAFC 2R5ZB 5ILVA 1FSHA 2XGXA 3MD2A 3OYNA 3E0JB 1TWGJ 2B0LA 1IDYA 3F8BA 4I02A 2AXLA 2KZGA 3BPXA 4KITB 5ERIA 5BOXA 3CJQB 3RJPA 1T39A 5CLSA 1F43A 3F3XA 3BG5A 5FD6A 5DD8A 1BW6A 3ULQB 1DUXC 3HOWJ 2RAEA 4QWQA 2JA7J 2ZJPF 2R7OA 1T98A 1VQKI 3BR2A 2E1MC 4D5FA 1HW2A 2BY2A 3DP7A 4LB6B 1TWFJ 5IY5H 5F0FA 2W1OA 3F22A 5FLVA 1ERDA 4ENJA 1A35A 3AG4H 2LY9A 1FMWA 1A6QA 3ZQLA 3D5SC 3P9KA 4HSTA 4F55A 5GTIC 2VN2A 4C30A 2IPQX 2HR3A 4CGZA 2CQNA 1T56A 2DJIA 3DU6A 3N97A 1QNTA 2QSFX 1XS9A 1BR4A 4IQ4A 4I0AA 1W7PA 3WTXC 5IOYA 3CC4I 4U7DA 1D0XA 3KPHA 2DQRA 3BTCA 3DWLE 1DDNA 5DUKA 1Z1DA 2M8GX 3V7SA 3GZ6A 2RN7A 4F93B 4X6AJ 1O7FA 5K5RA 1AU7A 2X1EA 4XLFA 2MW8A 5JLXA 3N05A 4L5JA 4WWCA 1IF1A 5D8KB 3COAC 1LE8A 2GLOA 4Y52J 3QQAA 4L9TA 1EKEA 2Y2ZA 3CLOA 4U88A 1SVMA 3BG3A 4C9YA 3H0GJ 2P81A 2EBIA 1TW3A 3FXUA 5K7ZA 1QZEA 2Y30A 1YTYA 4XM3A 2HKXA 2X51A 2M30A 1FJLA 2RQQA 4N4OB 4AVPA 1SAUA 2BVLA 4ABZA 5HODA 3R60A 4WCGA 2CW7A 2PMZA 1MMDA 1CQTA 1J5YA 4XRMA 1MZBA 3CCQI 2OQGA 1J09A 1FBUA 4L9VA 3K70D 3FXJA 2EZKA 3I4NJ 4AVZA 3BJOA 3BR6A 3HSEA 4JK1X 2ZFWA 4A5MA 1UG0A 2LF7A 4PJMA 3R6SA 2DFHA 4BDZA 2ZSHB 1QO0D 3ZQCA 1ZGJA 4DBRA 3H35A 2A07F 1K79A 3CCMI 4HAMA 4ZZLA 3LSJA 3ERMA 5ED4A 3NQOA 1LPQA 2O8KA 2P4WA 2EPFA 4M72A 4ZJZA 1FOYA 4CCOA 2HOSA 1FP2A 3S3MA 1G59A 1AWCA 2E5ZA 4HLYA 2DA5A 2QQBA 2QWWA 2DOFA 5BS6A 2P5LC 2LG4A 2DU9A 2KLOA 2YX4A 3K69A 1FTZA 3FM5A 3HBLA 5A2QK 1J2XA 2UZKA 2IGNA 2CJJA 4ENKA 1P4XA 2LP0A 4P5OA 3U1KA 3PFYA 3KP5A 4HF0A 1BC8C 3HOZJ 2FRHA 2FQ4A 2LKPA 1U2WA 2WB1N 1SD7A 2PEXA 2HQRA 3CO6C 2IS6A 1E3HA 3ABMH 1KU9A 3DPLC 2XASA 3HOVJ 3HKZA 2XSDC 2BOLA 1OMIA 2R7DA 3K70C 2P6TA 3V8JA 2CUFA 3SHFA 5DCMB 3H36A 2E2IJ 1MBGA 1XC5A 1Z0XA 1IXSB 1S5LC 2J5PA 1RESA 5E79C 3PNYA 4PSXA 3FBIB 5ICGA 2VJ5A 3BROA 3F8FA 4RB2C 2R7FA 3PFIA 3A0HC 5F0CA 4XLHA 3IKVA 4AYBN 3G1LA 2NVYJ 1IXRC 2COMA 4DZJA 5B66C 2V26A 2Y48A 2EFNA 2JPCA 2E2HJ 2R3SA 3B6CA 3F0CA 3ML6A 1GHCA 1IUFA 3HIFA 3BQZA 1BM9A 3OY9A 2ECBA 2UWMA 4BJ6C 1ZR4A 3I9V2 1BIAA 2QVOA 1XG1A 3C3WA 1N78A 2O61A 1XGNA 4KJZA 3K4JA 2V9VA 3P5JA 4GYIA 3D5LA 1SANA 4YIIA 2Z5UA 1BR1A 3VDXA 2VQGA 2CYYA 3GFMA 3M9AA 1KGSA 1FY7A 1YG2A 2YSRA 3H3UA 1ZN2A 3D0SA 2M0CA 5D5VB 3QPSA 1M1EB 4XNFA 4XORA 1K4TA 2WY7Q 3KYCB 4XSXF 1YITI 1PP8F 3ZN1A 2N8GA 1WPKA 2KMUA 4HW0A 3JRAA 3GO5A 4DOZA 2HEOA 3S2WA 1P4AA 5B5EC 1VFCA 1OCCH 2F5DA 1YI2I 1U6GA 3G1MA 1JT6A 2NXNB 4CO8A 2QKMB 1IV8A 2ZCWA 4RB0A 1KU3A 3PQJA 2BEOA 3CQZJ 4MGRA 2WAQN 4BY1J 2BBYA 3KEOA 3TBIA 3ESWB 1ZQ3P 3WTTC 1A31A 4IHXA 2XC7A 4EM2A 1Z9CA 3TOAA 3FBNB 4A3CJ 1ZRDA 3L09A 4G6TB 3JAMZ 1VQ4I 4PSWA 1Y56A 4G7ZF 1R5ID 2M8EA 5FD5A 4KFCA 5CQEA 2DW4A 3ZN0A 3E6CC 3F8NA 4W1UA 1B72B 5F04A 2NNYA 4Q4ZF 3PO3J 3PL8A 2EV6A 1ETKA 3PSFA 3TDZC 1IV6A 2R7QA 2BY3A 4FE7A 1HSTA 2IT0A 1JKPC 1W7PD 1W4MA 4JQFA 2DPDA 3ERED 4LG0A 1T8IA 2IA1A 1TW2A 2CH0A 4X1EA 4CYCB 1R4MB 2DA2A 2FNPA 3EUHC 5F08A 2H8RA 1X3WB 3KP3A 4KN7X 1A5JA 5GAGJ 2UV1A 1B1BA 4B44A 4IOCF 1BC7C 3ONQA 4BQAA 2JK3A 1H9GA 1X19A 3O6BB 4EJTA 1MSEC 5LHHA 2M87A 1RR8C 4W97A 5C4XJ 1BI3A 4NC6A 2V6EA 4GDFA 2CQKA 1QU3A 3T8TA 2LMDA 2IS2A 3K1PA 2L54A 1TNTA 1W36D 3BPVA 2E34A 2M7AA 3O2PE 2XF6A 1FNNA 1FOKA 4UHTA 2XGEA 2VPLA 4MO7A 4FASD 2Y0SN 2EWNA 1AHDP 2HTSA 4A3EJ 3ZXSA 4KICA 4I98B 2F6CA 4BNCA 2XB5A 3KX2A 5EJCA 2OTLI 2E36A 1JUMA 4C2TA 3RPUA 3OR1C 5KHDA 2X9DA 5FRNA 2L9RA 1ON1A 2XPWA 1S72I 3IWZA 3HUGA 4LOCA 2HS5A 4XLEA 1VTNC 2RDPA 2DFEA 1Z6RA 2QZ8A 2KDOA 3K4BA 3I59B 3GTKJ 2LKXA 1W0TA 3A02A 3KEYA 3RSNA 1MDMA 2GXBA 3CJNA 1POGA 1WJBA 2F5FA 5EG0B 2XVCA 3HRTA 3BG6A 1U8BA 3ZQHA 4HNUA 2PJRB 1E17A 5BMZA 5K7FA 4G12A 4M9XA 2D5VA 5GP9A 2ELHA 4BBSJ 1WI3A 1V4RA 2YR2A 3Q9VA 2XROA 2CFXA 2OAZA 1MNEA 3FF5A 1R5GA 4N9IA 5GPCA 4NC8A 1JGGA 1ACIA 2CUZA 1P4WA 2MH2A 3JRFA 4DNCA 1W36C 3MFKA 4MFEA 3ZQFA 3L7WA 1S3JA 1OCTC 3ZPLA 3MKLA 2IBDA 2JMWA 3OYHA 3RKWA 5L3FA 2P6SA 3E1SA 2Y69H 1CGPA 5EF6A 3U21A 1XTAA 2ZBKA 1I27A 2DXIA 1Z7UA 2PMHA 5LRRA 4BJ5C 3I54A 5B3SH 4XICA 2VJ4A 5IP9J 4IF4A 3LSPA 5LGTA 5D6EA 3WHBA 1VQ6I 4HSRA 5IT3A 2V1XA 1EA3A 3CCSI 2KIQA 5HVQC 4KIBA 2WWYA 3HTSB 3I71A 1X2MA 2JQ7A 2NVXJ 3AAFA 1LDDA 1ZGAA 2AS5F 2QSHX 4A6DA 2EFOA 1FOWA 4UUSA 1A36A 4FISA 3P9IA 3LA3A 3AG2H 4B47A 3DPUA 4E7ZA 3KYLA 4BDYA 4AU7A 3CDHA 1IN4A 3CUQB 4FHTA 1IN6A 1U5TA 2V4JC 4BQNA 4XMYA 3CDIA 3CMYA 2EIJH 4ZDPA 3S8PA 4MHGA 1NG6A 3RKYA 3JCUC 3L00A 2Z1DA 1P6RA 4C2UA 4HPQA 2YUSA 3LFKA 4QPOA 2PBIA 4FT8A 3F6OA 3MZ8A 2A6EF 1R00A 4MFDA 3NWSA 2HPMA 3M1EA 5AONA 4M3DA 5M5WJ 1IGNA 4AM3A 2ZJQF 2HDWA 2HVSA 2GBYA 2EA4A 2ID3A 3M7GA 5IYCJ 2RVCA 4XR6A 5GTHC 3CCRI 5JHUA 4IKFA 2W57A 5HNFA 4QTRA 2ZNZA 3OV8A 5HOOA 1OPCA 2L4AA 4P9FA 1MH3A 3VWBA 5LEKA 1FC3A 4N4NB 4BEHB 3OYAA 3JR9A 5J8FA 5L3DA 2GIVA 4S05A 3A0BC 1ZLJA 4YELA 3J7AO 1GV2A 1TZLA 5L3CA 5J1RA 2CUJA 2XKPA 1PJRA 2LNBA 2Q2EB 2Z33A 1OCRH 1D8JA 5E3LA 2L7MP 2K40A 1F9NA 4I01A 2A6HF 3LWFA 3MWMA 1ZR2A 4RBOA 5FKNA 1KQ9A 1R1VA 4HZFA 5LEJA 2HOEA 2G0EA 3Q3SA 1XN7A 4AD9A 1ETXA 3HEFA 1EH8A 5EDNA 2A5YB 2BW3A 3I5UA 3RKQA 2D1HA 1FX7A 2HVRA 4M6VA 3S1MJ 4QIWN 3S15J 2ZB9A 3QPHA 1PYVA 1OCOH 4PJNA 2CU7A 3HSRA 1MMGA 3KP2A 4AUXA 1EH6A 4HBLA 1O3SA 3VFZA 2M3AA 2VASA 3HRSA 3IKTA 2L9SA 2Y9YA 2CMPA 4B43A 3RKXA 2K27A 2ADUA 2XB0X 2DOAA 5H6QA 3TP3A 1IRZA 2WBMA 3JTHA 2VKDA 1WSUA 4RS8A 4ZYGA 1ETQA 1FPQA 4KIFA 2M34A 2V6CA 2VXZA 4U87A 1X1AA 1BI0A 5LHGA 2L0KA 2YU3A 4P96A 1H9TA 1PP7U 4V2FA 1MJ9A 4AIKA 1JXSA 4JBAA 2MFZA 3FKJA 4M3FA 4DBQA 1DPRA 1S7OA 2R7XA 3HPGA 1AKHA 4L5IA 1DU6A 1WJFA 2L01A 3WTVC 2JA5J 1MH4A 1B8IB 1TT5B 1JTYA 1PUFA 4BU2A 3K4CA 3RZOJ 4S04A 5EGOB 3ASOH 1B4AA 3OL3A 3HB9A 1I6HJ 2QYOA 3DTEA 1XGMA 5HDNA 3EYIA 4IVNA 3W6VA 1GLNA 1R1TA 4A0XA 1J59A 1WJCA 5BNGA 1VI0A 1WJDA 5CVUA 2LYCA 2BZTA 4UB6C 2KISA 2RC4A 1D8KA 3QYBA 2R5YB 1OJLA 4HV6A 5FKLA 2WA0A 4R1HA 2O9LA 1WRJA 2VLAA 2CW0F 3Q0WA 4CICA 2E1MB 1NHAA 4EATA 2D1VA 3OS0A 1V54H 2ISZA 3HJEA 4QSHA 2JPBA 1L0OC 4CYDA 2PJPA 1GVJA 3PSIA 2EILH 3DF8A 6PAXA 2DN0A 1IN7A 4BGDA 3KP6A 3RPUD 2V9PA 1HA8A 2JA2A 3WU0A 4BHPA 4WXHA 4ZTFA 3MMYB 1W0UA 2R7RA 2W25A 3KP7A 3FXRA 4IO9F 2NVTJ 4A3BJ 3J80Z 1R22A 5E17F 1BI1A 3GEZA 3CCUI 1ITYA 4PJ0C 1YO5C 3L2CA 4M3EA 1R71A 3ZMZA 3GX4X 3CJRB 4RB1A 2LDUA 2L7ZA 5CQGA 4M9SA 5M3MJ 4E7JA 2LVSA 4AIDA 2ECCA 2MGQA 1R49A 4BBRJ 3JRIA 3DXJF 3TO9A 4UVAA 3IRRA 2VONA 2P5KA 1RZ4A 1O3QA 1ETWA 4RGRA 2PX9A 2Q8KA 1UELB 3MKWB 5HNHA 1ONVA 1IN8A 2Y0MA 1VQOI 1P7JA 1Y8RB 2H6CA 1HKSA 5K7HA 1WJEA 2LLKA 4AC0A 3H5NA 4BKXA 4BXUA 1R7JA 2JSPA 1ZRCA 3FXKA 4KT6A 4E7IA 3HXLA 2XRNA 4R8HA 1X2NA 3WG7H 4EMSA 5FFXA 4I2OA 5E8IA 2XDVA 1P7IA 1SVLA 2JN6A 4G94A 2WC2A 3GUDA 3PNTA 1LKXA 3S2HJ 2HYGD 5FLMJ 4MEYF 3MAJA 3JSOA 1JT0A 3HHGA 3PO2J 3H0DA 2WY8Q 3KEQA 1JHHA 1Z77A 3OIQA 1HW1A 1VQPI 2VBYA 3IHUA 1AOYA 2FUG2 3SZGA 3T0YA 2VI6A 2WAQA 3TGNA 4JYKA 3RZDJ 3I53A 1FYKA 2GZWA 1JE8A 4UUSB 1FWZA 2ZKZA 1IO2A 1HKTA 2CV2A 1TQPA 3L2WA 1T08B 3M8FA 1YJNI 4OOIA 2QBYB 1IRXA 4ESBA 3OIPA 1XDUA 2FBHA 2W24A 2VOOA 2KHMA 2A61A 3CESA 1I3QJ 4WXDA 4G6QA 1QZYA 2DFFA 2H94A 2LC2A 1HXDA 2K3PA 4QPQA 2KFDA 1SMYF 1WI9A 2RNJA 2KJBA 2MLGA 2BV6A 3E5QA 2EJRA 3S93A 2MG4A 5F64A 1J75A 4OIOF 4DQ2A 3GFJA 5E3OA 2QM3A 4D5CA 4EGZA 3CD6I 4C3HJ 1XSXA 1UHSA 3NARA 4J00A 4E6KG 1R23A 4ENNA 3WE3A 2O03A 4DYQA 4A3IJ 2GXGA 3OL4A 3ABTA 4L0ZB 1SFEA 2EFQA 3AFHA 3BJ6A 4P55A 4Y3OA 3V7CA 2VJJA 1YQAA 2FJ1A 3JRDA 1K78A 3QU3A 4OIRF 1I39A 1T33A 2OUMA 4CCNA 1KYZA 4GXOA 4ZYAA 3E7LA 3OYDA 3J7AY 5J1YA 2IGOA 2RREA 2M7BA 1YRNA 1FIPA 2NRAC 1MSFC 3IAM2 3ZQQA 3MZYA 2BVMA 1MNMC 1JHFA 4G6DA 1WH7A 3GTPJ 2OF7A 1SC7A 1U5TC 4HX7A 2MSYA 3O8GA 1O57A 2LOOA 4DW6A 4EVIA 2JT1A 4RGUA 4X0GA 1OCZH 4HQMA 4PDKA 4DYRA 3CTAA 2VKEA 1SFKA 3BR3A 3GWZA 2COBA 3K7AJ 2O5RA 3ECOA 1CF7B 1ZRFA 1R58A 3GTMJ 5LHIA 3GMEA 3DKXA 1XPXA 4IL6C 4O6JA 3GTLJ 2HOTA 1I50J 2V9KA 4I76A 4B1RA 3OOUA 2HYJA 5IYBJ 1X1DA 4A3KJ 2B7EA 1FYLA 2UXXA 2H27A 2XGDA 2FOWA 3CMEI 1T0FA 1PVEA 2Q0OA 4B3XA 2K85A 1FEXA 2DJNA 2TCTA 1WJAA 4IQJA 1QPMA 3A01A 2XUBA 3A4CA 3LSTA 1SFXA 3EPZA 2EFWA 2NOGA 2FNAA 3WU1B 1S29A 3SXYA 1R6RA 3SDBA 3M3YJ 2KRHA 3FXQA 4JX4A 3S3NA 3MQ0A 1V5GA 1F36A 3BP8A 2B9SA 4WXCA 1FP1D 3UNGC 1LUJB 2GOMA 2KIMA 3OYMA 2LY1A 2NNNA 4A5NA 4YRVA 4EM1A 1YX3A 5D4RA 1GUUA 2HWVA 2F4IA 3B73A 2EFPA 2V1UA 4A93J 4JP0A 3CP8A 5LFAA 1KQ0A 2X0LA 1P92A 3WGHA 1ZREA 4R79A 2K86A 1IRFA 1VQMI 3N4MA 4ITVA 4RAGA 4CZCA 2R7VA 1TQIA 1K4SA 4E7SA 2GA1A 2LH9A 1UHMA 4Y15A 2CSOA 1Y6IA 3EUKL 3ROUA 2BHYA 1A6IA 5FROA 3BG9A 4UV8A 3LNQA 3K4LA 3DQVC 1ZAOA 3QAHA 5EYRA 1O3RA 2HDDA 4BXFA 3LL7A 2DFIA 2M45A 3Q5FA 2FSWA 4KISA 1WH5A 4PJJA 1SD6A 2DA6A 2GA2A 3PNVA 4YIRX 2FEZA 2HPIA 1XSDA 2OZ6A 1SFUA 3ASNH 2M4KA 2H6BA 3AG3H 3RPQA 1ZG3A 2M9HA 2FOKA 2JUCA 3L9FA 1RETA 2XHKA 1YHQI 3O8HA 4EGYA 3S3OA 4JOMA 1LDJA 1R9TJ 1XB4A 3FXMA 1MMAA 2VUMJ 1U0JA 2D2WA 4L9JA 2H1LA 1YS7A 4FX0A 4NDLA 5L3EA 4NQWB 3C2GA 2XRLA 2W48A 4KDPA 2CWEA 4HNVA 2X48A 4LG3A 1EJ9A 3S1NJ 4RAZA 5L3GA 2I5UA 1XX5A 1BJAA 2VPRA 1BJZA 2LY2A 2LBFA 5B1AH 3KZIC 2QKLB 3QPTA 1G3TA 1P2FA 3GTJJ 3IRQA 3RCOA 3VYTB 4BJTA 2H8WA 3EETA 5C44J 3BJAA 3CUOA 4RLQA 2UXNA 4ESJA 4OMYA 1VZ0A 2LSOA 3FZVA 5TGTA 3TW6A 3ZMSA 3JAMK 2LRDA 3DBRB 4NNJA 1RRJA 5J40A 1UCRA 3C18A 5CVRA 2QSGX 3IUOA 4KMFA 2ZMEA 1LVAA 3V42A 3F8MA 2EQRA 2E5NA 1RUNA 3VPRA 3G73A 3QWLA 4LLGF 1KYWA 3RYRA
chains in the Genus database with same CATH topology
2OU2A 1W5SA 2M5WA 1MGTA 2LF8A 1OKRA 2PMUA 2DBBA 2BE5F 1W7PB 1E2XA 3E5XA 3J81Z 1XCBA 4HLXA 4E70A 2FA5A 2XAFA 4RGSA 4OMZA 3KFWX 3KLNA 4Y17A 3ZMUA 4IRHA 1PUEE 1J0RA 3KZZA 1SD5A 3JSPA 4I0BA 1R36A 4M9ZA 3DFGA 4AIHA 2CG4A 1F4KA 1BI2A 4LFUA 4A0YA 3TDUC 4PGHA 1MD0A 4XBFA 4HF1A 1K78B 5LBQA 2DQLA 1IW7F 2G7HA 1Z91A 5IT9Z 3GFIA 1T38A 2VBZA 1YW9A 3WTZA 3U9GA 3LQRA 1FBQA 1W5TA 5EEHA 1LB2A 4L0YB 1ZLKA 3IL2A 3B02A 2YX7A 5LGUA 2ACJA 2DK8A 1ULYA 4HV5A 4H0EA 5FLXZ 4QLCU 3ZMVA 2C6YA 1XMKA 2RV8A 5E1XA 1LEAA 5FO5A 4YIFA 3CO7C 1J9IA 4WK8F 2MA3A 3FWEA 2VE8A 2VOPA 5JI6A 1WQ2A 2IA0A 2WTEA 4LB5A 3QP5A 3NRVA 1UB9A 5ILSA 1RI7A 2Z99A 1LQ1A 1BIBA 5ILUA 2VBWA 3TKYA 5K5QA 1RUOA 2VE9A 3R0JA 1IN5A 4HA8A 2EV0A 2F5EA 2L4MA 1I1SA 3E6BA 3E97A 1QZZA 4XLPF 2FQ3A 4U0WA 1X3UA 4M6XA 2E1NA 5D6FA 2QUFA 2FMLA 3I58A 4KMUX 3WE2A 4IHTA 5D5UB 2P7VB 2VC0A 2ETHA 4ZYEA 4MEXF 4CDGA 2ISYA 3KE2A 3IC7A 1HW5A 1XDSA 3SZPA 3W6JB 4HOBA 2NAZA 4BHBA 3KP4A 4UNOA 4IRIA 3FM3A 1YLFA 2HZTA 2QENA 4P9UA 2ZJ2A 3GFLA 3QU6A 5CYVA 3HHHA 4A2UA 4Z2YA 1S8NA 2XAHA 3RDIA 1O7LA 3H92A 1R5HA 2IVMA 1G3YA 2IP2A 2G9WA 2K4JA 3VEPA 4HDUA 5LLQA 2XAJA 3WGGA 4LG0B 3TOBA 3C1DA 3LQQA 4Q47A 3MZHA 2MBFA 2STWA 4Y13A 1OYWA 3WTYC 4G7OF 5CJ9A 4HYEA 2P5VA 1YFHA 2JSCA 4UVCA 3RTRA 4OU0A 3FMQA 3E3VA 5H6RA 5E1ZB 3RYPA 2O3FA 2STTA 2JRTA 4GGGA 1GXQA 1Z05A 5DCMA 2QQ9A 5AIPA 3NEUA 1I6XA 5F6FA 1B9MA 5KK1A 4G9YA 1UFMA 1MJAA 4LJZF 2FU4A 1LNWA 1XCVA 2P8TA 2DLLA 1ZARA 4IXAA 4YFKF 2OA4A 2NS0A 3LA2A 1YS6A 3K1MA 4UVBA 3J80K 1MDMB 4KN4X 4O5VA 1TNSA 3BDDA 3ECHA 4OIPF 1ZH5A 1Q1HA 4TV7A 4BAYA 1KU2A 2DO7A 2X4HA 1I5ZA 3V4GA 1TLHB 4HX4A 2ZNYA 3R4KA 2J5OA 4ON0A 3OOPA 5FFZA 4LK0F 3E6DA 3RIRA 5HLGA 5D4SA 1LJ9A 2D45A 4Q5SF 1OYIA 1G3WA 2DPUA 3EUHA 2XAGA 5DCFA 2A69F 1ZHFA 1HBXG 4GCVA 2EV5A 5K5OA 3BZ6A 1XGSA 2F2EA 2VC1A 3KCCA 1S7AA 1IRGA 1U5TB 4ENMA 4YG2F 1TTYA 2H09A 1OYYA 3REOA 4L18B 5D5XB 1Z6TA 4LGWA 1KU7A 5BPDA 2E1CA 3HSFA 1OR7A 2E7WA 4BYYA 3E6MA 2VT2A 2Z9OA 4BH9A 1BBYA 3F72A 2KKOA 4M6YA 4RGXA 3HYIA 4ESFA 2YPRA 4IRGA 4RAYA 1JGSA 1XD7A 2KIUA 1REPC 4M73A 3F23A 2VT3A 3I64A 3U2RA 1H0MA 3SQNA 3K1NA 4XLNF 3WG9A 5TJJA 2ZXJA 3HRMA 3QOPA 3F6VA 5FB2A 5E8GA 2FXAA 3I0TA 1FZPB 4HX8A 3KLOA 2MC3A 4PZJA 4Q48A 4NHJA 1WKMA 3Q9SA 3E5UA 3I59A 2L02A 3FHZA 4O3MA 4XRFA 2XIGA 2XKOA 2Z3YA 2KRFA 4UV9A 3TO6A 3DPTA 2L3DA 5CVVA 1XMAA 4U0YA 2VODA 2EK5A 1G4DA 5A2QZ 1DP7P 2JTVA 3WTUC 4D0PA 4AWXB 1T6SA 3V8LA 1IXCA 2FMYA 1ON2A 4KIGA 3VODA 4G7HF 3BWGA 3WODF 1ZG5A 5ICFA 4ZYHA 2OD5A 3KZYA 4EM0B 4CHUA 2FE3A 3JW4A 3ISPA 3LAJA 2RQPA 3IWFA 4ETSA 1FSEA 3HTUA 4NB5A 4U7BA 4BHCA 5JR3A 2ESNA 4LMYA 1KA8A 1C0WA 3CUQA 3WTWC 1FLIA 2OQRA 5E18F 4G8XA 3GLXA 4EJOA 2GQQA 4I09A 1F1ZA 2DI3A 4MQVA 3FX3A 2MLKA 1FYMA 1G3SA 1HQCA 5HDGA 3EQLF 4EJUA 2A68F 3QRFF 2TDXA 4N0BA 3P7NA 2Q2EA 3GZ5A 5KVRA 2PG4A 5HS8A 4KT5C 4A0ZA 3R0AA 1YYVA 4OIQF 5HLHA 4KYWA 1U3EM 3F8CA 3HOTA 1K7AA 1XGOA 2G7UA 2E7XA 3BOQA 3J81K 3V8KA 2W84A 4MNUA 1IAWA 2ESHA 3GVAA 2DTRA 4MQ9F 2HFHA 3DKWA 2RGVA 3K9TA 2HQNA 2KJCA 2IJLA 3GW2A 1QBJA 1KQ8A 1IUYA 3M8EA 1GXPA 5JVTA 1B6AA 4EQQA 1EH7A 4IHSA 2RKHA 5IT9K 2FBIA 2XAQA 1ZYRF 1D3YA 4IPAA 4HQEA 1MKMA 4MTEA 3I4PA 3V7RA 5ICEA 3GYHX 1PDNC 3KETA 2BGCA 2Y75A 5HS7A 4EJWA 2GWRA 5L3BA 1BOAA 2W85A 5DEQA 1U8RA 3SZTA 3GF2A 2O0YA 1XSVA 3ZMTA 4UUVA 5DYMA 4EV0A 3VOEA 2PFBA 1EV7A 5ICCA 4IJAA 5BQTA 5HS9A 5FLXK 2MD5A 4HDVA 3MCZA 3WTSC 2O8XA 5DD4A 5HLIA 4B8XA 5JFRA 2FF4A 3T1BA 4F7ZA 4I7HA 5LRSA 1BN5A 5J6XA 5K1YA 3BY6A 2QQAA 2IRFG 4WF2A 1UHWA 5E1WA 4U0VA 2NYXA 2P7CB 1S6LA 5BPIA 2BYVE 3EYYA 1T2KA 1K6OA 3T8RA 4M71A 4M74A 2O6GE 4KNYA 4XSZF 2PI0A 1O3TA 4ZZDA 4GYGA 4YFXF 2HDCA 4LLLA 5J8CA 3QP6A 3O3KA 4CXFA 5EEGA 2QBYA 1USTA 3F21A 3SFZA 4AIJA 4FX4A 1B9NA 1J7KA 2V1DA 1Y0UA 4RB3C 3H3ZA 1D5VA 5DUIA 2V79A 1G6NA 3EDPA 1DPUA 2K7LA 4EJVA 3P9CA 3LA7A 3JTGA 2IA2A 5DDGA 4A12A 1LEBA 1FBSA 2VBXA 3FMSA 1FT9A 4L9NA 3PQKA 3FMRA 1TBXA 4ASNA 1RIOH 2K02A 2DT5A 2FBKA 2DAOA 2HYFA 2A3SA 5FGMA 2ZMEB 3WGIA 4KUMA 4UXNA 3K2ZA 4PGGA 2K4BA 3CUQC 2WV0A 3TO7A 2MH9A 2CGPA 1HSJA 1YW7A 2HGCA 2KIFA 2HKOA 4KA4A 2HTJA 1V3FA 3K0LA 2OZUA 3ZP5A 1TQMA 1CF7A 4LK1F 1STZA 5LGNA 1L3LA 1QQIA 5HDKA 1U78A 4CZZA 4PCQA 2PQ8A 1YIOA 1SMTA 4GO1A 4ZYDA 1YW8A 5H20A 4LLNA 1B59A 1HKQA 2IW5A 3ELKA 2M1BA 2XV4S 3DEUA 4ZH4F 4N9HA 3MEXA 1MJBA 3ABUA 2PLYA 2EB7A 5E20A 2DK5A 1RNLA 1F5TA 1SD4A 3VB2A 1WWXA 4YFNF 5CVJA 1ZG1A 1ODDA 2JZYA 1USSA 4MTDA 5DV5A 5CVIA 4K2EA 3R61A 4A6EA 2OBPA 5TRDA 3C7JA 4OINF 3HRUA 3ZQ7A 5D8LB 4WX9A 1SAXA 4HF2A 1LDKB 2PN6A 3G3ZA 3GXOA 2ZO4A 1R1UA 3T5XA 5D5WB 3RI4A 1QGPA 2EA2A 3LAPA 3ZMDA 5AIQA 5F1RA 2QLZA 3TQNA 2CO5A 4LD5A 3U1DA 2F5CA 1A04A 1I1GA 3DV8A 3HOSA 3W6KB 2GAUA 4NQWA 4B09A 1IZ1A 5ILVA 1FSHA 2XGXA 2B0LA 3F8BA 4I02A 2AXLA 3BPXA 5ERIA 5BOXA 3RJPA 1T39A 5CLSA 3F3XA 5FD6A 5DD8A 3ULQB 1DUXC 4QWQA 1T98A 1HW2A 3DP7A 4LB6B 3F22A 4ENJA 3P9KA 2VN2A 2IPQX 2HR3A 4CGZA 3N97A 1QNTA 4I0AA 1W7PA 3WTXC 4U7DA 2DQRA 1DDNA 5DUKA 1Z1DA 3V7SA 3GZ6A 2RN7A 1O7FA 5K5RA 4L5JA 4WWCA 1IF1A 5D8KB 3COAC 4L9TA 3CLOA 4U88A 1TW3A 3FXUA 1YTYA 2HKXA 2M30A 4AVPA 3R60A 4WCGA 1J5YA 1MZBA 2OQGA 1FBUA 4L9VA 3BJOA 3HSEA 4JK1X 2ZFWA 4A5MA 2LF7A 3R6SA 1QO0D 1ZGJA 2A07F 1K79A 4HAMA 4ZZLA 5ED4A 3NQOA 2P4WA 4M72A 1FP2A 1AWCA 4HLYA 2QQBA 2QWWA 5BS6A 2P5LC 2DU9A 2YX4A 3K69A 3FM5A 5A2QK 1J2XA 2UZKA 4ENKA 1P4XA 4P5OA 3KP5A 4HF0A 1BC8C 2FRHA 2LKPA 1U2WA 1SD7A 2PEXA 2HQRA 3CO6C 1KU9A 3DPLC 2XASA 2R7DA 1OMIA 2P6TA 3V8JA 3SHFA 5DCMB 1IXSB 2J5PA 5ICGA 4RB2C 3BROA 3F8FA 2R7FA 3PFIA 3IKVA 1IXRC 2COMA 2Y48A 2EFNA 2JPCA 2R3SA 3ML6A 1GHCA 3HIFA 1BM9A 2UWMA 1BIAA 2QVOA 3C3WA 2O61A 1XGNA 2V9VA 4GYIA 3D5LA 4YIIA 2Z5UA 2CYYA 3GFMA 3M9AA 1KGSA 1FY7A 1YG2A 2YSRA 3H3UA 1ZN2A 3D0SA 5D5VB 4XSXF 1PP8F 3ZN1A 4HW0A 3GO5A 2HEOA 3S2WA 1P4AA 2F5DA 1U6GA 4CO8A 2ZCWA 4RB0A 1KU3A 3PQJA 2BEOA 4MGRA 2BBYA 3KEOA 3WTTC 4EM2A 1Z9CA 3TOAA 1ZRDA 3L09A 3JAMZ 4G7ZF 5FD5A 2M8EA 4KFCA 2DW4A 3ZN0A 3E6CC 3F8NA 2NNYA 4Q4ZF 2EV6A 3TDZC 1HSTA 2IT0A 1W7PD 1W4MA 4JQFA 2DPDA 3ERED 4LG0A 2IA1A 1TW2A 2FNPA 3KP3A 4KN7X 1B1BA 1BC7C 4BQAA 1H9GA 3O6BB 4EJTA 5LHHA 2M87A 1BI3A 2CQKA 3T8TA 3K1PA 2L54A 1TNTA 3BPVA 3O2PE 1FNNA 1FOKA 4UHTA 2EWNA 2HTSA 4KICA 4I98B 4BNCA 3RPUA 1ON1A 3IWZA 3HUGA 2HS5A 1VTNC 2RDPA 1Z6RA 2QZ8A 3I59B 1MDMA 2GXBA 3CJNA 2F5FA 2XVCA 3HRTA 1E17A 5BMZA 4M9XA 2ELHA 1V4RA 2YR2A 3Q9VA 2XROA 2CFXA 2OAZA 3FF5A 1R5GA 4N9IA 1P4WA 2MH2A 4DNCA 3MFKA 3L7WA 1S3JA 3ZPLA 3RKWA 5L3FA 2P6SA 1CGPA 2ZBKA 1I27A 1Z7UA 2PMHA 5LRRA 3I54A 4IF4A 5LGTA 5D6EA 5IT3A 2V1XA 5HVQC 2WWYA 4KIBA 3HTSB 3I71A 3AAFA 1LDDA 1ZGAA 2AS5F 4A6DA 2EFOA 3P9IA 3LA3A 3CDHA 1IN4A 3CUQB 4FHTA 1IN6A 1U5TA 4MHGA 3RKYA 3L00A 1P6RA 3LFKA 2PBIA 4FT8A 3F6OA 2A6EF 1R00A 3M1EA 5AONA 2EA4A 3M7GA 2RVCA 5JHUA 2W57A 2ZNZA 3OV8A 5HOOA 1OPCA 2L4AA 4P9FA 5LEKA 1FC3A 5J8FA 5L3DA 2GIVA 4S05A 1ZLJA 3J7AO 5L3CA 2XKPA 2LNBA 2Z33A 1D8JA 1F9NA 4I01A 2A6HF 3LWFA 3MWMA 1KQ9A 1R1VA 4HZFA 5LEJA 2HOEA 1XN7A 4AD9A 1EH8A 2A5YB 3I5UA 2D1HA 1FX7A 3QPHA 3HSRA 3KP2A 1EH6A 4HBLA 1O3SA 3VFZA 3HRSA 3IKTA 3RKXA 2K27A 2ADUA 5H6QA 3JTHA 1WSUA 4RS8A 4ZYGA 1FPQA 4KIFA 2V6CA 2VXZA 1BI0A 5LHGA 2YU3A 4P96A 1H9TA 1PP7U 1MJ9A 4AIKA 1JXSA 4JBAA 1DPRA 1S7OA 4L5IA 2L01A 3WTVC 4S04A 1B4AA 2QYOA 1XGMA 5HDNA 3EYIA 4IVNA 1R1TA 4A0XA 1J59A 5CVUA 2RC4A 1D8KA 4HV6A 4R1HA 1WRJA 2CW0F 4CICA 1NHAA 2D1VA 2ISZA 2JPBA 1L0OC 4CYDA 2PJPA 1GVJA 3DF8A 6PAXA 1IN7A 3KP6A 3WU0A 4BHPA 4WXHA 2W25A 3KP7A 3FXRA 3J80Z 1R22A 5E17F 1BI1A 3GEZA 1YO5C 3L2CA 3ZMZA 3GX4X 4RB1A 2LDUA 4M9SA 3DXJF 3TO9A 4UVAA 3IRRA 2VONA 2P5KA 1RZ4A 1O3QA 4RGRA 2Q8KA 1ONVA 1IN8A 2Y0MA 2H6CA 1HKSA 4BXUA 1R7JA 1ZRCA 2XRNA 4R8HA 4EMSA 5FFXA 4I2OA 5E8IA 4G94A 2WC2A 3GUDA 2HYGD 4MEYF 3MAJA 3JSOA 3HHGA 3KEQA 1JHHA 1HW1A 2VBYA 3IHUA 1AOYA 3T0YA 3TGNA 1FYKA 3I53A 2GZWA 1JE8A 1FWZA 2ZKZA 1HKTA 1TQPA 3M8FA 4OOIA 2QBYB 4ESBA 1XDUA 2FBHA 2W24A 2VOOA 2A61A 4WXDA 4G6QA 1QZYA 2H94A 1HXDA 1SMYF 1WI9A 2RNJA 2KJBA 2MLGA 2BV6A 3E5QA 2EJRA 5F64A 1J75A 4OIOF 4DQ2A 3GFJA 2QM3A 4EGZA 1XSXA 1R23A 4ENNA 3WE3A 2O03A 2GXGA 3ABTA 4L0ZB 1SFEA 2EFQA 4P55A 3BJ6A 3V7CA 1YQAA 1K78A 3QU3A 4OIRF 1KYZA 4GXOA 2NRAC 3MZYA 1JHFA 4G6DA 1U5TC 4HX7A 1O57A 4EVIA 2JT1A 4RGUA 4HQMA 4PDKA 3CTAA 3GWZA 1ZRFA 3ECOA 1CF7B 1R58A 5LHIA 4O6JA 1FYLA 2UXXA 2H27A 1T0FA 2Q0OA 1QPMA 2XUBA 3LSTA 1SFXA 2EFWA 2FNAA 3WU1B 1S29A 3SXYA 3FXQA 3MQ0A 3BP8A 4WXCA 1FP1D 2KIMA 2NNNA 4A5NA 4EM1A 5D4RA 2HWVA 3B73A 2EFPA 2V1UA 1KQ0A 2X0LA 1P92A 3WGHA 1ZREA 4R79A 2K86A 1IRFA 3N4MA 1TQIA 2GA1A 4Y15A 1UHMA 2CSOA 3ROUA 4UV8A 3DQVC 1ZAOA 3QAHA 1O3RA 2DFIA 2M45A 3Q5FA 2FSWA 1SD6A 2GA2A 1SFUA 2FEZA 1XSDA 2OZ6A 2H6BA 3RPQA 1ZG3A 2FOKA 3L9FA 2XHKA 4EGYA 1LDJA 1XB4A 2D2WA 4L9JA 1YS7A 4FX0A 5L3EA 4KDPA 2CWEA 4RAZA 5L3GA 1BJAA 3QPTA 1G3TA 1P2FA 3IRQA 3EETA 3BJAA 3CUOA 2UXNA 4ESJA 4OMYA 2LSOA 3FZVA 3ZMSA 3JAMK 1UCRA 3C18A 5CVRA 4KMFA 2ZMEA 1LVAA 3F8MA 1RUNA 3G73A 4LLGF 1KYWA 3RYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU2 A;  1W5S A;  2M5W A;  1MGT A;  2LF8 A;  1OKR A;  2PMU A;  2DBB A;  2BE5 F;  1W7P B;  1E2X A;  3E5X A;  3J81 Z;  1XCB A;  4HLX A;  4E70 A;  2FA5 A;  2XAF A;  4RGS A;  4OMZ A;  3KFW X;  3KLN A;  4Y17 A;  3ZMU A;  4IRH A;  1PUE E;  1J0R A;  3KZZ A;  1SD5 A;  3JSP A;  4I0B A;  1R36 A;  4M9Z A;  3DFG A;  4AIH A;  2CG4 A;  1F4K A;  1BI2 A;  4LFU A;  4A0Y A;  3TDU C;  4PGH A;  1MD0 A;  4XBF A;  4HF1 A;  1K78 B;  5LBQ A;  2DQL A;  1IW7 F;  2G7H A;  1Z91 A;  5IT9 Z;  3GFI A;  1T38 A;  2VBZ A;  1YW9 A;  3WTZ A;  3U9G A;  3LQR A;  1FBQ A;  1W5T A;  5EEH A;  1LB2 A;  4L0Y B;  1ZLK A;  3IL2 A;  3B02 A;  2YX7 A;  5LGU A;  2ACJ A;  2DK8 A;  1ULY A;  4HV5 A;  4H0E A;  5FLX Z;  4QLC U;  3ZMV A;  2C6Y A;  1XMK A;  2RV8 A;  5E1X A;  1LEA A;  5FO5 A;  4YIF A;  3CO7 C;  1J9I A;  4WK8 F;  2MA3 A;  3FWE A;  2VE8 A;  2VOP A;  5JI6 A;  1WQ2 A;  2IA0 A;  2WTE A;  4LB5 A;  3QP5 A;  3NRV A;  1UB9 A;  5ILS A;  1RI7 A;  2Z99 A;  1LQ1 A;  1BIB A;  5ILU A;  2VBW A;  3TKY A;  5K5Q A;  1RUO A;  2VE9 A;  3R0J A;  1IN5 A;  4HA8 A;  2EV0 A;  2F5E A;  2L4M A;  1I1S A;  3E6B A;  3E97 A;  1QZZ A;  4XLP F;  2FQ3 A;  4U0W A;  1X3U A;  4M6X A;  2E1N A;  5D6F A;  2QUF A;  2FML A;  3I58 A;  4KMU X;  3WE2 A;  4IHT A;  5D5U B;  2P7V B;  2VC0 A;  2ETH A;  4ZYE A;  4MEX F;  4CDG A;  2ISY A;  3KE2 A;  3IC7 A;  1HW5 A;  1XDS A;  3SZP A;  3W6J B;  4HOB A;  2NAZ A;  4BHB A;  3KP4 A;  4UNO A;  4IRI A;  3FM3 A;  1YLF A;  2HZT A;  2QEN A;  4P9U A;  2ZJ2 A;  3GFL A;  3QU6 A;  5CYV A;  3HHH A;  4A2U A;  4Z2Y A;  1S8N A;  2XAH A;  3RDI A;  1O7L A;  3H92 A;  1R5H A;  2IVM A;  1G3Y A;  2IP2 A;  2G9W A;  2K4J A;  3VEP A;  4HDU A;  5LLQ A;  2XAJ A;  3WGG A;  4LG0 B;  3TOB A;  3C1D A;  3LQQ A;  4Q47 A;  3MZH A;  2MBF A;  2STW A;  4Y13 A;  1OYW A;  3WTY C;  4G7O F;  5CJ9 A;  4HYE A;  2P5V A;  1YFH A;  2JSC A;  4UVC A;  3RTR A;  4OU0 A;  3FMQ A;  3E3V A;  5H6R A;  5E1Z B;  3RYP A;  2O3F A;  2STT A;  2JRT A;  4GGG A;  1GXQ A;  1Z05 A;  5DCM A;  2QQ9 A;  5AIP A;  3NEU A;  1I6X A;  5F6F A;  1B9M A;  5KK1 A;  4G9Y A;  1UFM A;  1MJA A;  4LJZ F;  2FU4 A;  1LNW A;  1XCV A;  2P8T A;  2DLL A;  1ZAR A;  4IXA A;  4YFK F;  2OA4 A;  2NS0 A;  3LA2 A;  1YS6 A;  3K1M A;  4UVB A;  3J80 K;  1MDM B;  4KN4 X;  4O5V A;  1TNS A;  3BDD A;  3ECH A;  4OIP F;  1ZH5 A;  1Q1H A;  4TV7 A;  4BAY A;  1KU2 A;  2DO7 A;  2X4H A;  1I5Z A;  3V4G A;  1TLH B;  4HX4 A;  2ZNY A;  3R4K A;  2J5O A;  4ON0 A;  3OOP A;  5FFZ A;  4LK0 F;  3E6D A;  3RIR A;  5HLG A;  5D4S A;  1LJ9 A;  2D45 A;  4Q5S F;  1OYI A;  1G3W A;  2DPU A;  3EUH A;  2XAG A;  5DCF A;  2A69 F;  1ZHF A;  1HBX G;  4GCV A;  2EV5 A;  5K5O A;  3BZ6 A;  1XGS A;  2F2E A;  2VC1 A;  3KCC A;  1S7A A;  1IRG A;  1U5T B;  4ENM A;  4YG2 F;  1TTY A;  2H09 A;  1OYY A;  3REO A;  4L18 B;  5D5X B;  1Z6T A;  4LGW A;  1KU7 A;  5BPD A;  2E1C A;  3HSF A;  1OR7 A;  2E7W A;  4BYY A;  3E6M A;  2VT2 A;  2Z9O A;  4BH9 A;  1BBY A;  3F72 A;  2KKO A;  4M6Y A;  4RGX A;  3HYI A;  4ESF A;  2YPR A;  4IRG A;  4RAY A;  1JGS A;  1XD7 A;  2KIU A;  1REP C;  4M73 A;  3F23 A;  2VT3 A;  3I64 A;  3U2R A;  1H0M A;  3SQN A;  3K1N A;  4XLN F;  3WG9 A;  5TJJ A;  2ZXJ A;  3HRM A;  3QOP A;  3F6V A;  5FB2 A;  5E8G A;  2FXA A;  3I0T A;  1FZP B;  4HX8 A;  3KLO A;  2MC3 A;  4PZJ A;  4Q48 A;  4NHJ A;  1WKM A;  3Q9S A;  3E5U A;  3I59 A;  2L02 A;  3FHZ A;  4O3M A;  4XRF A;  2XIG A;  2XKO A;  2Z3Y A;  2KRF A;  4UV9 A;  3TO6 A;  3DPT A;  2L3D A;  5CVV A;  1XMA A;  4U0Y A;  2VOD A;  2EK5 A;  1G4D A;  5A2Q Z;  1DP7 P;  2JTV A;  3WTU C;  4D0P A;  4AWX B;  1T6S A;  3V8L A;  1IXC A;  2FMY A;  1ON2 A;  4KIG A;  3VOD A;  4G7H F;  3BWG A;  3WOD F;  1ZG5 A;  5ICF A;  4ZYH A;  2OD5 A;  3KZY A;  4EM0 B;  4CHU A;  2FE3 A;  3JW4 A;  3ISP A;  3LAJ A;  2RQP A;  3IWF A;  4ETS A;  1FSE A;  3HTU A;  4NB5 A;  4U7B A;  4BHC A;  5JR3 A;  2ESN A;  4LMY A;  1KA8 A;  1C0W A;  3CUQ A;  3WTW C;  1FLI A;  2OQR A;  5E18 F;  4G8X A;  3GLX A;  4EJO A;  2GQQ A;  4I09 A;  1F1Z A;  2DI3 A;  4MQV A;  3FX3 A;  2MLK A;  1FYM A;  1G3S A;  1HQC A;  5HDG A;  3EQL F;  4EJU A;  2A68 F;  3QRF F;  2TDX A;  4N0B A;  3P7N A;  2Q2E A;  3GZ5 A;  5KVR A;  2PG4 A;  5HS8 A;  4KT5 C;  4A0Z A;  3R0A A;  1YYV A;  4OIQ F;  5HLH A;  4KYW A;  1U3E M;  3F8C A;  3HOT A;  1K7A A;  1XGO A;  2G7U A;  2E7X A;  3BOQ A;  3J81 K;  3V8K A;  2W84 A;  4MNU A;  1IAW A;  2ESH A;  3GVA A;  2DTR A;  4MQ9 F;  2HFH A;  3DKW A;  2RGV A;  3K9T A;  2HQN A;  2KJC A;  2IJL A;  3GW2 A;  1QBJ A;  1KQ8 A;  1IUY A;  3M8E A;  1GXP A;  5JVT A;  1B6A A;  4EQQ A;  1EH7 A;  4IHS A;  2RKH A;  5IT9 K;  2FBI A;  2XAQ A;  1ZYR F;  1D3Y A;  4IPA A;  4HQE A;  1MKM A;  4MTE A;  3I4P A;  3V7R A;  5ICE A;  3GYH X;  1PDN C;  3KET A;  2BGC A;  2Y75 A;  5HS7 A;  4EJW A;  2GWR A;  5L3B A;  1BOA A;  2W85 A;  5DEQ A;  1U8R A;  3SZT A;  3GF2 A;  2O0Y A;  1XSV A;  3ZMT A;  4UUV A;  5DYM A;  4EV0 A;  3VOE A;  2PFB A;  1EV7 A;  5ICC A;  4IJA A;  5BQT A;  5HS9 A;  5FLX K;  2MD5 A;  4HDV A;  3MCZ A;  3WTS C;  2O8X A;  5DD4 A;  5HLI A;  4B8X A;  5JFR A;  2FF4 A;  3T1B A;  4F7Z A;  4I7H A;  5LRS A;  1BN5 A;  5J6X A;  5K1Y A;  3BY6 A;  2QQA A;  2IRF G;  4WF2 A;  1UHW A;  5E1W A;  4U0V A;  2NYX A;  2P7C B;  1S6L A;  5BPI A;  2BYV E;  3EYY A;  1T2K A;  1K6O A;  3T8R A;  4M71 A;  4M74 A;  2O6G E;  4KNY A;  4XSZ F;  2PI0 A;  1O3T A;  4ZZD A;  4GYG A;  4YFX F;  2HDC A;  4LLL A;  5J8C A;  3QP6 A;  3O3K A;  4CXF A;  5EEG A;  2QBY A;  1UST A;  3F21 A;  3SFZ A;  4AIJ A;  4FX4 A;  1B9N A;  1J7K A;  2V1D A;  1Y0U A;  4RB3 C;  3H3Z A;  1D5V A;  5DUI A;  2V79 A;  1G6N A;  3EDP A;  1DPU A;  2K7L A;  4EJV A;  3P9C A;  3LA7 A;  3JTG A;  2IA2 A;  5DDG A;  4A12 A;  1LEB A;  1FBS A;  2VBX A;  3FMS A;  1FT9 A;  4L9N A;  3PQK A;  3FMR A;  1TBX A;  4ASN A;  1RIO H;  2K02 A;  2DT5 A;  2FBK A;  2DAO A;  2HYF A;  2A3S A;  5FGM A;  2ZME B;  3WGI A;  4KUM A;  4UXN A;  3K2Z A;  4PGG A;  2K4B A;  3CUQ C;  2WV0 A;  3TO7 A;  2MH9 A;  2CGP A;  1HSJ A;  1YW7 A;  2HGC A;  2KIF A;  2HKO A;  4KA4 A;  2HTJ A;  1V3F A;  3K0L A;  2OZU A;  3ZP5 A;  1TQM A;  1CF7 A;  4LK1 F;  1STZ A;  5LGN A;  1L3L A;  1QQI A;  5HDK A;  1U78 A;  4CZZ A;  4PCQ A;  2PQ8 A;  1YIO A;  1SMT A;  4GO1 A;  4ZYD A;  1YW8 A;  5H20 A;  4LLN A;  1B59 A;  1HKQ A;  2IW5 A;  3ELK A;  2M1B A;  2XV4 S;  3DEU A;  4ZH4 F;  4N9H A;  3MEX A;  1MJB A;  3ABU A;  2PLY A;  2EB7 A;  5E20 A;  2DK5 A;  1RNL A;  1F5T A;  1SD4 A;  3VB2 A;  1WWX A;  4YFN F;  5CVJ A;  1ZG1 A;  1ODD A;  2JZY A;  1USS A;  4MTD A;  5DV5 A;  5CVI A;  4K2E A;  3R61 A;  4A6E A;  2OBP A;  5TRD A;  3C7J A;  4OIN F;  3HRU A;  3ZQ7 A;  5D8L B;  4WX9 A;  1SAX A;  4HF2 A;  1LDK B;  2PN6 A;  3G3Z A;  3GXO A;  2ZO4 A;  1R1U A;  3T5X A;  5D5W B;  3RI4 A;  1QGP A;  2EA2 A;  3LAP A;  3ZMD A;  5AIQ A;  5F1R A;  2QLZ A;  3TQN A;  2CO5 A;  4LD5 A;  3U1D A;  2F5C A;  1A04 A;  1I1G A;  3DV8 A;  3HOS A;  3W6K B;  2GAU A;  4NQW A;  4B09 A;  1IZ1 A;  5ILV A;  1FSH A;  2XGX A;  2B0L A;  3F8B A;  4I02 A;  2AXL A;  3BPX A;  5ERI A;  5BOX A;  3RJP A;  1T39 A;  5CLS A;  3F3X A;  5FD6 A;  5DD8 A;  3ULQ B;  1DUX C;  4QWQ A;  1T98 A;  1HW2 A;  3DP7 A;  4LB6 B;  3F22 A;  4ENJ A;  3P9K A;  2VN2 A;  2IPQ X;  2HR3 A;  4CGZ A;  3N97 A;  1QNT A;  4I0A A;  1W7P A;  3WTX C;  4U7D A;  2DQR A;  1DDN A;  5DUK A;  1Z1D A;  3V7S A;  3GZ6 A;  2RN7 A;  1O7F A;  5K5R A;  4L5J A;  4WWC A;  1IF1 A;  5D8K B;  3COA C;  4L9T A;  3CLO A;  4U88 A;  1TW3 A;  3FXU A;  1YTY A;  2HKX A;  2M30 A;  4AVP A;  3R60 A;  4WCG A;  1J5Y A;  1MZB A;  2OQG A;  1FBU A;  4L9V A;  3BJO A;  3HSE A;  4JK1 X;  2ZFW A;  4A5M A;  2LF7 A;  3R6S A;  1QO0 D;  1ZGJ A;  2A07 F;  1K79 A;  4HAM A;  4ZZL A;  5ED4 A;  3NQO A;  2P4W A;  4M72 A;  1FP2 A;  1AWC A;  4HLY A;  2QQB A;  2QWW A;  5BS6 A;  2P5L C;  2DU9 A;  2YX4 A;  3K69 A;  3FM5 A;  5A2Q K;  1J2X A;  2UZK A;  4ENK A;  1P4X A;  4P5O A;  3KP5 A;  4HF0 A;  1BC8 C;  2FRH A;  2LKP A;  1U2W A;  1SD7 A;  2PEX A;  2HQR A;  3CO6 C;  1KU9 A;  3DPL C;  2XAS A;  2R7D A;  1OMI A;  2P6T A;  3V8J A;  3SHF A;  5DCM B;  1IXS B;  2J5P A;  5ICG A;  4RB2 C;  3BRO A;  3F8F A;  2R7F A;  3PFI A;  3IKV A;  1IXR C;  2COM A;  2Y48 A;  2EFN A;  2JPC A;  2R3S A;  3ML6 A;  1GHC A;  3HIF A;  1BM9 A;  2UWM A;  1BIA A;  2QVO A;  3C3W A;  2O61 A;  1XGN A;  2V9V A;  4GYI A;  3D5L A;  4YII A;  2Z5U A;  2CYY A;  3GFM A;  3M9A A;  1KGS A;  1FY7 A;  1YG2 A;  2YSR A;  3H3U A;  1ZN2 A;  3D0S A;  5D5V B;  4XSX F;  1PP8 F;  3ZN1 A;  4HW0 A;  3GO5 A;  2HEO A;  3S2W A;  1P4A A;  2F5D A;  1U6G A;  4CO8 A;  2ZCW A;  4RB0 A;  1KU3 A;  3PQJ A;  2BEO A;  4MGR A;  2BBY A;  3KEO A;  3WTT C;  4EM2 A;  1Z9C A;  3TOA A;  1ZRD A;  3L09 A;  3JAM Z;  4G7Z F;  5FD5 A;  2M8E A;  4KFC A;  2DW4 A;  3ZN0 A;  3E6C C;  3F8N A;  2NNY A;  4Q4Z F;  2EV6 A;  3TDZ C;  1HST A;  2IT0 A;  1W7P D;  1W4M A;  4JQF A;  2DPD A;  3ERE D;  4LG0 A;  2IA1 A;  1TW2 A;  2FNP A;  3KP3 A;  4KN7 X;  1B1B A;  1BC7 C;  4BQA A;  1H9G A;  3O6B B;  4EJT A;  5LHH A;  2M87 A;  1BI3 A;  2CQK A;  3T8T A;  3K1P A;  2L54 A;  1TNT A;  3BPV A;  3O2P E;  1FNN A;  1FOK A;  4UHT A;  2EWN A;  2HTS A;  4KIC A;  4I98 B;  4BNC A;  3RPU A;  1ON1 A;  3IWZ A;  3HUG A;  2HS5 A;  1VTN C;  2RDP A;  1Z6R A;  2QZ8 A;  3I59 B;  1MDM A;  2GXB A;  3CJN A;  2F5F A;  2XVC A;  3HRT A;  1E17 A;  5BMZ A;  4M9X A;  2ELH A;  1V4R A;  2YR2 A;  3Q9V A;  2XRO A;  2CFX A;  2OAZ A;  3FF5 A;  1R5G A;  4N9I A;  1P4W A;  2MH2 A;  4DNC A;  3MFK A;  3L7W A;  1S3J A;  3ZPL A;  3RKW A;  5L3F A;  2P6S A;  1CGP A;  2ZBK A;  1I27 A;  1Z7U A;  2PMH A;  5LRR A;  3I54 A;  4IF4 A;  5LGT A;  5D6E A;  5IT3 A;  2V1X A;  5HVQ C;  2WWY A;  4KIB A;  3HTS B;  3I71 A;  3AAF A;  1LDD A;  1ZGA A;  2AS5 F;  4A6D A;  2EFO A;  3P9I A;  3LA3 A;  3CDH A;  1IN4 A;  3CUQ B;  4FHT A;  1IN6 A;  1U5T A;  4MHG A;  3RKY A;  3L00 A;  1P6R A;  3LFK A;  2PBI A;  4FT8 A;  3F6O A;  2A6E F;  1R00 A;  3M1E A;  5AON A;  2EA4 A;  3M7G A;  2RVC A;  5JHU A;  2W57 A;  2ZNZ A;  3OV8 A;  5HOO A;  1OPC A;  2L4A A;  4P9F A;  5LEK A;  1FC3 A;  5J8F A;  5L3D A;  2GIV A;  4S05 A;  1ZLJ A;  3J7A O;  5L3C A;  2XKP A;  2LNB A;  2Z33 A;  1D8J A;  1F9N A;  4I01 A;  2A6H F;  3LWF A;  3MWM A;  1KQ9 A;  1R1V A;  4HZF A;  5LEJ A;  2HOE A;  1XN7 A;  4AD9 A;  1EH8 A;  2A5Y B;  3I5U A;  2D1H A;  1FX7 A;  3QPH A;  3HSR A;  3KP2 A;  1EH6 A;  4HBL A;  1O3S A;  3VFZ A;  3HRS A;  3IKT A;  3RKX A;  2K27 A;  2ADU A;  5H6Q A;  3JTH A;  1WSU A;  4RS8 A;  4ZYG A;  1FPQ A;  4KIF A;  2V6C A;  2VXZ A;  1BI0 A;  5LHG A;  2YU3 A;  4P96 A;  1H9T A;  1PP7 U;  1MJ9 A;  4AIK A;  1JXS A;  4JBA A;  1DPR A;  1S7O A;  4L5I A;  2L01 A;  3WTV C;  4S04 A;  1B4A A;  2QYO A;  1XGM A;  5HDN A;  3EYI A;  4IVN A;  1R1T A;  4A0X A;  1J59 A;  5CVU A;  2RC4 A;  1D8K A;  4HV6 A;  4R1H A;  1WRJ A;  2CW0 F;  4CIC A;  1NHA A;  2D1V A;  2ISZ A;  2JPB A;  1L0O C;  4CYD A;  2PJP A;  1GVJ A;  3DF8 A;  6PAX A;  1IN7 A;  3KP6 A;  3WU0 A;  4BHP A;  4WXH A;  2W25 A;  3KP7 A;  3FXR A;  3J80 Z;  1R22 A;  5E17 F;  1BI1 A;  3GEZ A;  1YO5 C;  3L2C A;  3ZMZ A;  3GX4 X;  4RB1 A;  2LDU A;  4M9S A;  3DXJ F;  3TO9 A;  4UVA A;  3IRR A;  2VON A;  2P5K A;  1RZ4 A;  1O3Q A;  4RGR A;  2Q8K A;  1ONV A;  1IN8 A;  2Y0M A;  2H6C A;  1HKS A;  4BXU A;  1R7J A;  1ZRC A;  2XRN A;  4R8H A;  4EMS A;  5FFX A;  4I2O A;  5E8I A;  4G94 A;  2WC2 A;  3GUD A;  2HYG D;  4MEY F;  3MAJ A;  3JSO A;  3HHG A;  3KEQ A;  1JHH A;  1HW1 A;  2VBY A;  3IHU A;  1AOY A;  3T0Y A;  3TGN A;  1FYK A;  3I53 A;  2GZW A;  1JE8 A;  1FWZ A;  2ZKZ A;  1HKT A;  1TQP A;  3M8F A;  4OOI A;  2QBY B;  4ESB A;  1XDU A;  2FBH A;  2W24 A;  2VOO A;  2A61 A;  4WXD A;  4G6Q A;  1QZY A;  2H94 A;  1HXD A;  1SMY F;  1WI9 A;  2RNJ A;  2KJB A;  2MLG A;  2BV6 A;  3E5Q A;  2EJR A;  5F64 A;  1J75 A;  4OIO F;  4DQ2 A;  3GFJ A;  2QM3 A;  4EGZ A;  1XSX A;  1R23 A;  4ENN A;  3WE3 A;  2O03 A;  2GXG A;  3ABT A;  4L0Z B;  1SFE A;  2EFQ A;  4P55 A;  3BJ6 A;  3V7C A;  1YQA A;  1K78 A;  3QU3 A;  4OIR F;  1KYZ A;  4GXO A;  2NRA C;  3MZY A;  1JHF A;  4G6D A;  1U5T C;  4HX7 A;  1O57 A;  4EVI A;  2JT1 A;  4RGU A;  4HQM A;  4PDK A;  3CTA A;  3GWZ A;  1ZRF A;  3ECO A;  1CF7 B;  1R58 A;  5LHI A;  4O6J A;  1FYL A;  2UXX A;  2H27 A;  1T0F A;  2Q0O A;  1QPM A;  2XUB A;  3LST A;  1SFX A;  2EFW A;  2FNA A;  3WU1 B;  1S29 A;  3SXY A;  3FXQ A;  3MQ0 A;  3BP8 A;  4WXC A;  1FP1 D;  2KIM A;  2NNN A;  4A5N A;  4EM1 A;  5D4R A;  2HWV A;  3B73 A;  2EFP A;  2V1U A;  1KQ0 A;  2X0L A;  1P92 A;  3WGH A;  1ZRE A;  4R79 A;  2K86 A;  1IRF A;  3N4M A;  1TQI A;  2GA1 A;  4Y15 A;  1UHM A;  2CSO A;  3ROU A;  4UV8 A;  3DQV C;  1ZAO A;  3QAH A;  1O3R A;  2DFI A;  2M45 A;  3Q5F A;  2FSW A;  1SD6 A;  2GA2 A;  1SFU A;  2FEZ A;  1XSD A;  2OZ6 A;  2H6B A;  3RPQ A;  1ZG3 A;  2FOK A;  3L9F A;  2XHK A;  4EGY A;  1LDJ A;  1XB4 A;  2D2W A;  4L9J A;  1YS7 A;  4FX0 A;  5L3E A;  4KDP A;  2CWE A;  4RAZ A;  5L3G A;  1BJA A;  3QPT A;  1G3T A;  1P2F A;  3IRQ A;  3EET A;  3BJA A;  3CUO A;  2UXN A;  4ESJ A;  4OMY A;  2LSO A;  3FZV A;  3ZMS A;  3JAM K;  1UCR A;  3C18 A;  5CVR A;  4KMF A;  2ZME A;  1LVA A;  3F8M A;  1RUN A;  3G73 A;  4LLG F;  1KYW A;  3RYR A; 
#chains in the Genus database with same CATH topology
 2OU2 A;  1W5S A;  3BTJ A;  2M5W A;  2OV7 A;  3ABK H;  1MGT A;  2LF8 A;  3DBH B;  1OKR A;  2PMU A;  2R7T A;  2DBB A;  1EF4 A;  2BE5 F;  1TP4 A;  1W7P B;  1E2X A;  3E5X A;  4C3J J;  3BZC A;  1O4X A;  3J81 Z;  1XCB A;  4HLX A;  4E70 A;  2W4S A;  4ZC3 A;  2CW8 A;  2FA5 A;  2CS3 A;  2OTJ I;  3FIS A;  2XAF A;  3K2A A;  3LSG A;  3KYD B;  4RGS A;  2LK2 A;  4OMZ A;  3S16 J;  1E3P A;  3KFW X;  3KLN A;  4Y17 A;  3ZMU A;  4IRH A;  1PUE E;  1J0R A;  3KZZ A;  1SD5 A;  1GDT A;  2HU9 A;  1LE8 B;  2EZL A;  3JSP A;  3DKY A;  4I0B A;  2XF5 A;  1N75 A;  1R36 A;  4M9Z A;  2ME6 A;  2ELK A;  3DFG A;  1RKT A;  4AIH A;  4J19 A;  2CG4 A;  5TIS C;  1F4K A;  1BI2 A;  4CCL A;  4LFU A;  1MMN A;  4A0Y A;  3TDU C;  4PGH A;  1MD0 A;  4XBF A;  3CMA I;  4HF1 A;  3FXO A;  2X6W A;  5M3F J;  1K78 B;  1MBK A;  5F1J A;  5LBQ A;  2DQL A;  3Q0V A;  2PMZ N;  1IW7 F;  2G7H A;  1Z91 A;  5IT9 Z;  3GFI A;  1D0Z A;  3CLQ A;  2W82 A;  4CCK A;  2VBZ A;  3CDL A;  1T38 A;  2UUZ A;  1YOV B;  1YW9 A;  3UKG A;  3WTZ A;  3K4N A;  3U9G A;  3LQR A;  1FBQ A;  2XGC A;  2X6Y A;  1W5T A;  5EEH A;  3L2R A;  1LB2 A;  4L0Y B;  1ZLK A;  2E71 A;  3QPL A;  3TP0 A;  3IL2 A;  3CC2 I;  2A6T A;  3B02 A;  2YX7 A;  4D9J A;  5LGU A;  2IAI A;  1X1P A;  3MKY B;  3A2K A;  2E60 A;  3L2Q A;  2ACJ A;  3BTI A;  3DEE A;  1LFB A;  4FTH A;  2DK8 A;  1ULY A;  4HV5 A;  2Z16 A;  2KDZ A;  4H0E A;  2ZFU A;  5FLX Z;  4QLC U;  3ZMV A;  4ZTJ A;  1QVT A;  2C6Y A;  1TWC J;  1XMK A;  2RV8 A;  3DEW A;  1LEA A;  5E1X A;  3WHC A;  1D5Y A;  4CCM A;  1D1A A;  5FO5 A;  3TW7 A;  4YIF A;  3CO7 C;  5CKT A;  3GCM A;  3OYK A;  1J9I A;  1TT0 A;  4WK8 F;  2MA3 A;  1YX5 A;  3FWE A;  3H3V K;  2VE8 A;  2GM4 A;  3HGG A;  5JI6 A;  2VOP A;  2R5Z A;  1VND A;  1WQ2 A;  2IA0 A;  2WTE A;  4LB5 A;  4XK4 A;  4PFO A;  2ZC2 A;  3QP5 A;  3OYC A;  1W1W E;  2TRT A;  3NRV A;  1UB9 A;  1V5F A;  2JA6 J;  3CC7 I;  5ILS A;  1OFC X;  1RI7 A;  2DYS H;  2Z99 A;  3CCL I;  1BIB A;  1LQ1 A;  5ILU A;  2VBW A;  3TKY A;  4LIV A;  5K5Q A;  3OMY A;  1RUO A;  2XPV A;  2VE9 A;  4FET A;  3R0J A;  1IN5 A;  2K5C A;  4HA8 A;  3SEZ A;  2OCE A;  3VYU B;  3LOC A;  1UAA A;  2X85 A;  2ID6 A;  2DCE A;  2EV0 A;  2F5E A;  2L4M A;  1I1S A;  1LFP A;  3E6B A;  3E97 A;  4B4C A;  1QZZ A;  4XLP F;  2JRM A;  1Z21 A;  2FQ3 A;  4U0W A;  1H8A C;  3NAU A;  1X3U A;  2ELJ A;  4M6X A;  2E1N A;  3G71 I;  2DOE A;  4OAY A;  1Z67 A;  1T0F C;  1MND A;  3L1P A;  3G4S I;  5D6F A;  2CQ7 A;  2QUF A;  2FML A;  2HVQ A;  1GVD A;  4HRI A;  3I58 A;  2K9Q A;  4KMU X;  2HOA A;  2VQL A;  4CUG A;  1WJ5 A;  1QHG A;  2HNH A;  2E2J J;  1Z3Y A;  3WE2 A;  4IHT A;  5D5U B;  1D0Y A;  2P7V B;  2AHQ A;  2VC0 A;  3Q0U A;  2L7K A;  2F4M B;  3JRB A;  2K3F A;  5FRM A;  3CCE I;  2ETH A;  3G1O A;  4ZYE A;  1Y8Q B;  4MEX F;  4CDG A;  3H1C A;  2R0Q C;  1Q1V A;  2ISY A;  3KE2 A;  3IC7 A;  4RLF A;  4J01 A;  1ETO A;  2IS4 A;  3FDY A;  1HW5 A;  3VYR B;  5GAH J;  3UR3 C;  4B48 A;  1XDS A;  3SZP A;  3BQY A;  2VQC A;  4MIM A;  2DT6 A;  3CF5 F;  2CQX A;  3W6J B;  4HOB A;  2NAZ A;  2ME0 A;  4BHB A;  3GZN B;  3KP4 A;  4UNO A;  1ZGW A;  1I3A A;  4IRI A;  3FM3 A;  1YLF A;  1ETV A;  2HZT A;  2QEN A;  3S32 A;  1JKQ C;  4P9U A;  3SJM A;  1MBF A;  2ZJ2 A;  2BXZ A;  1D1B A;  2BY1 A;  3AL0 B;  3GFL A;  3QU6 A;  5CYV A;  4ZDL A;  2JJ7 A;  3HHH A;  4A2U A;  2MD0 A;  3HPH A;  4Z2Y A;  2DMQ A;  1S8N A;  4CSW A;  1H88 C;  3HM5 A;  2XAH A;  2B63 J;  3TMO A;  1GT0 C;  3BCB A;  3RDI A;  1O7L A;  1QVU A;  2A05 A;  3H92 A;  1R5H A;  2IVM A;  1VQL I;  3HOY J;  1G3Y A;  2KT0 A;  2IP2 A;  2G9W A;  2K4J A;  3VEP A;  4HDU A;  5LLQ A;  2XAJ A;  3WGG A;  5E3N A;  3TOB A;  4LG0 B;  3FXL A;  2MC4 A;  3RQI A;  3C1D A;  3LQQ A;  4Q47 A;  3HOX J;  4LIU A;  3MZH A;  3S2D J;  2MBF A;  3GLL A;  2CV1 A;  2STW A;  4F91 B;  4Y13 A;  1OYW A;  3WTY C;  2LTP A;  4G7O F;  5CJ9 A;  4HYE A;  5DS9 A;  2EH3 A;  2P5V A;  1YFH A;  2JSC A;  4UVC A;  3QYE A;  1TL8 A;  1P9Q C;  3RTR A;  2NVQ J;  4OU0 A;  2GXA A;  3FMQ A;  5J47 A;  1LFU P;  2HXI A;  2WB1 A;  4A3G J;  3AL0 C;  4ANJ A;  4IHV A;  5IP6 A;  3E3V A;  3OYJ A;  4IX7 A;  4IHW A;  5H6R A;  5E1Z B;  3RYP A;  5HLT A;  4EEF G;  2DT7 B;  1MW7 A;  2O3F A;  3K6G A;  2ZME C;  2JRT A;  3A03 A;  4LIT A;  4GGG A;  3ZR8 X;  1GXQ A;  1QPI A;  2STT A;  1JKO C;  1Z05 A;  5DCM A;  1NTC A;  2QQ9 A;  5AIP A;  3NEU A;  1I6X A;  5F6F A;  1B9M A;  1NG7 A;  5KK1 A;  4G9Y A;  2M4G A;  2X1C A;  3DTI A;  1UFM A;  3KIO A;  3CCV I;  1MJA A;  5LD2 C;  1Y1W J;  4LJZ F;  4XOP A;  2FU4 A;  1LNW A;  1XCV A;  2P8T A;  2E35 A;  2DMU A;  4AYB A;  3DBL B;  2DLL A;  1ZAR A;  4IXA A;  4RMN A;  3IH4 A;  3HUG B;  3BR5 A;  4YFK F;  2OA4 A;  2NS0 A;  4PJL A;  4NUB A;  2F4O B;  3LA2 A;  1YS6 A;  5DM6 F;  3ZQI A;  2RNG A;  3K1M A;  4UVB A;  3J80 K;  2M0M A;  1MDM B;  1R4N B;  3OIO A;  4KN4 X;  3DTK A;  4O5V A;  1TNS A;  1DP3 A;  3BDD A;  3ECH A;  4OIP F;  1ZH5 A;  1Q1H A;  2ZJR F;  4H4K C;  4TV7 A;  4BAY A;  1KU2 A;  2DO7 A;  3S1Q J;  2X4H A;  1K83 J;  1I5Z A;  4I99 C;  1TLH B;  2LKS A;  3V4G A;  2V1N A;  1X1B A;  4NC7 A;  4HX4 A;  3QOD A;  4JX6 A;  3I55 I;  3I4M J;  2ZNY A;  3R4K A;  2J5O A;  4ON0 A;  3OOP A;  2GOX B;  5FFZ A;  1VQ5 I;  3H9J A;  4LK0 F;  4BE1 A;  2KL4 A;  3E6D A;  2K9N A;  3RIR A;  5HLG A;  5JLW A;  5D4S A;  1LJ9 A;  1N25 A;  3PUB A;  2D45 A;  4Q5S F;  1OYI A;  1GV5 A;  3PUF A;  1G3W A;  4CCJ A;  1BR2 A;  3FKI J;  1VQN I;  2OC6 A;  2DPU A;  3EUH A;  2XAG A;  5DCF A;  2A69 F;  4XLC A;  3HDD A;  1SVO A;  5C3E J;  1ZHF A;  4A3D J;  4XKV A;  4XKW A;  2JVH A;  1HBX G;  3B6A A;  1Y1V J;  4GCV A;  1WFX A;  4F52 A;  2EV5 A;  4II3 A;  5M5X J;  5K5O A;  3BZ6 A;  1XGS A;  2F2E A;  1FMV A;  2L5Q A;  2VC1 A;  3KCC A;  5F27 A;  2K9M A;  2A5W A;  3LSI A;  3L2U A;  2EIK H;  1S7A A;  1IRG A;  3BR0 A;  4PUS A;  2KRC A;  1U5T B;  3OYE A;  4ENM A;  4YG2 F;  4I6Z A;  1TTY A;  3CMM A;  2H09 A;  1OYY A;  3REO A;  1ORK A;  5D5X B;  1JKR C;  4L18 B;  1B72 A;  1Z6T A;  9ANT A;  4OAZ A;  4LGW A;  4XOT A;  2LD5 A;  2MYS A;  2IEK A;  1KU7 A;  2QGU A;  5BPD A;  2E1C A;  1VQ8 I;  3HSF A;  1OR7 A;  5C4J J;  2E7W A;  4UUT A;  5EZG A;  4BYY A;  2OJE D;  2DA1 A;  3D1N I;  4UB8 C;  3E6M A;  3PM1 A;  4BAC A;  4BE0 A;  3K4K A;  2VT2 A;  1WGX A;  2Z9O A;  1IDZ A;  2VKH A;  3LMM A;  4BH9 A;  1BBY A;  2IGM A;  4CYC A;  3F72 A;  4DYC A;  2KKO A;  1DQU A;  4M6Y A;  4RGX A;  4E7L A;  1HCR A;  5FKK A;  1K61 A;  2FD5 A;  3HYI A;  5J4V A;  3DLL F;  4ESF A;  2YPR A;  4IRG A;  2V7F A;  4RAY A;  1X3Z B;  2DTZ A;  1JGS A;  1XD7 A;  2KIU A;  5GAE J;  1REP C;  4M73 A;  3MVP A;  4BQO A;  3VYS B;  3F23 A;  3LSM A;  3HG9 A;  2VT3 A;  3I64 A;  3BT9 A;  5KAI C;  3ZCO A;  4HNT A;  2QCO A;  5EEA A;  3U2R A;  1E3O C;  1H0M A;  3SQN A;  5FKM A;  1HDD C;  3K1N A;  2IS1 A;  4XLN F;  2Y9Z A;  3WG9 A;  5TJJ A;  1UJ8 A;  5IYD J;  3OYB A;  2ZXJ A;  1YJW I;  3HRM A;  3QOP A;  3F6V A;  5E8G A;  5FB2 A;  2FXA A;  3I0T A;  2Y0S A;  5JHF A;  2BW3 B;  1FZP B;  4V19 K;  1UZC A;  2OCC H;  4HX8 A;  3VSK A;  3KLO A;  2MC3 A;  1BL0 A;  4PZJ A;  4Q48 A;  4S0H B;  1LVK A;  4NHJ A;  2BXY A;  4HEA 2;  3IP4 B;  1WKM A;  4XN0 A;  2DA3 A;  2DYR H;  3Q9S A;  1JTX A;  2KPM A;  3NWT A;  1ZEL A;  3E5U A;  1MBE A;  3I59 A;  1RR7 A;  2L02 A;  3FHZ A;  3BLY A;  4O3M A;  4XRF A;  3J7Z I;  1H89 C;  2XIG A;  1VQ7 I;  4RM2 A;  5J3L A;  2XKO A;  2Z3Y A;  2NS7 A;  1RPW A;  3S14 J;  2KRF A;  4UV9 A;  5EG0 A;  4RDU A;  4F92 B;  3TO6 A;  3DPT A;  2L3D A;  5CVV A;  2PJR A;  1XMA A;  4U0Y A;  2EZH A;  2VOD A;  2EK5 A;  1G4D A;  1AKH B;  2ZXH A;  5A2Q Z;  4A3F J;  2DMT A;  4ZDO A;  1PUF B;  1DP7 P;  2JTV A;  3WTU C;  4D0P A;  2R7W A;  2HQA A;  1IC8 A;  4AWX B;  1T6S A;  3SEQ A;  3W2W A;  3V8L A;  1IXC A;  3ZRG A;  2FMY A;  1ON2 A;  4KIG A;  3VOD A;  2E19 A;  4G7H F;  3BWG A;  3WOD F;  1ZG5 A;  4RAF A;  2LRE A;  5ICF A;  4ZYH A;  2ZXW H;  2OD5 A;  3KZY A;  4EM0 B;  3HOU J;  2MAB A;  2KZV A;  4CHU A;  4YEJ A;  2FE3 A;  3JRG A;  4FQG A;  4Y4R A;  3JW4 A;  2E1O A;  3ISP A;  3LAJ A;  2RQP A;  3IWF A;  4ETS A;  1FSE A;  3IV5 A;  3LSH A;  3FIW A;  2JUG A;  1DGW Y;  3CJT B;  3GTQ J;  3HTU A;  4M3B A;  4NB5 A;  4U7B A;  3CCY A;  4IHY A;  4BHC A;  2IGK A;  5JR3 A;  4IOA F;  2ESN A;  2AQF A;  3BCA A;  4LMY A;  1MBH A;  1KA8 A;  1SFO J;  1C0W A;  3CUQ A;  3WTW C;  3H9G A;  1U9N A;  1D1C A;  1FLI A;  2OQR A;  2ZSI B;  3AG1 H;  4G8X A;  5E18 F;  1IJW C;  3GLX A;  2HXO A;  1YE9 A;  1WHU A;  4EJO A;  2F5V A;  2R4G A;  1YIJ I;  1MMS A;  2GQQ A;  4I09 A;  2DDB A;  4DIQ A;  1F1Z A;  2DI3 A;  4MQV A;  3FX3 A;  2R92 J;  1IG7 A;  4XON A;  1HF0 A;  1BW5 A;  2MLK A;  3S17 J;  3TED A;  1FYM A;  4IEJ A;  3QYF A;  3FK6 A;  1OIS A;  4GRI A;  1MBJ A;  1G3S A;  1HQC A;  5HDG A;  2XSJ C;  3EQL F;  4EJU A;  1OLT A;  2A68 F;  1AA7 A;  1X1C A;  2P0W A;  3QRF F;  4BEH A;  5F0H A;  4C2M J;  5J1U A;  2TDX A;  2I10 A;  4N0B A;  2DOD A;  2HI3 A;  4GFB A;  2VQH A;  2CUE A;  3P7N A;  1E0E A;  2VL8 A;  1XMX A;  1FIA A;  2Q2E A;  1QA6 A;  3GZ5 A;  4BXX J;  3J7Y J;  3IH3 A;  5KVR A;  2DA7 A;  3DCF A;  2PG4 A;  1HOM A;  1T95 A;  2EZI A;  5HS8 A;  4C3I J;  4KT5 C;  3K4M A;  3OWT A;  4A0Z A;  3R0A A;  1YYV A;  3JRC A;  4XRS A;  4OIQ F;  5HLH A;  4BY7 J;  4KYW A;  1U3E M;  4CA0 A;  3F8C A;  3I3L A;  3HOT A;  1K7A A;  1MIJ A;  1XGO A;  4V2G A;  2G7U A;  2E7X A;  3BOQ A;  3J81 K;  1V55 H;  4E7H A;  3CZ6 A;  3PIP F;  2K9S A;  2L9N A;  3V8K A;  2W84 A;  4MNU A;  3ZQG A;  1IAW A;  4RM3 A;  4XRS G;  4PFP A;  2ESH A;  1Z3X A;  3SFI A;  4II2 A;  1HLV A;  3DLA A;  3GVA A;  2DTR A;  4MQ9 F;  2HFH A;  1RKW A;  3DKW A;  4HG2 A;  2RGV A;  3K9T A;  2HQN A;  2KJC A;  3M1C A;  3W2V A;  2IJL A;  3GW2 A;  1QBJ A;  5IPA A;  1KQ8 A;  1HC8 A;  1VF9 A;  1IUY A;  2FX0 A;  3M8E A;  1GXP A;  2L2O A;  2F48 A;  5KNL A;  3LFU A;  5JVT A;  3RQ4 A;  3GTG J;  3CP2 A;  4XQF A;  1B6A A;  5KCM A;  1OQY A;  1Y0N A;  3L2V A;  1B8I A;  4EQQ A;  1EH7 A;  2IXS A;  4Z6Y A;  5EGO A;  2YU9 J;  2CRG A;  2W7N A;  4IHS A;  4XID A;  2RKH A;  3HC7 A;  3GTO J;  5IT9 K;  3PJR A;  2FBI A;  3CCJ I;  2XAQ A;  1YRN B;  1ZYR F;  1D3Y A;  4IPA A;  3H5A A;  3HL2 A;  1ENH A;  4HQE A;  1MKM A;  1X58 A;  2WAD A;  5FJ8 J;  4BUP A;  2OPT A;  4MTE A;  3I4P A;  3V7R A;  4A3L J;  1BOB A;  5ICE A;  3BTL A;  3GYH X;  3VSL A;  2R5Y A;  1PDN C;  1HDP A;  3KET A;  5CPR B;  2BGC A;  2Y75 A;  1RC9 A;  5HS7 A;  3JRE A;  1DGR M;  2XF7 A;  3PIO F;  4EJW A;  4NBQ A;  2GWR A;  4BS9 A;  5L3B A;  1BOA A;  2W85 A;  4XKC A;  5DEQ A;  1U8R A;  1ZTR A;  3SZT A;  1OR7 C;  3GF2 A;  3G6E I;  2O0Y A;  1XSV A;  3JRH A;  3ZMT A;  2BHZ A;  1Y39 A;  5DYM A;  4UUV A;  2AO9 A;  4EV0 A;  3VOE A;  2PFB A;  2DMN A;  1EV7 A;  2HZD A;  3SDG A;  2LR8 A;  1OCP A;  2K9L A;  5ICC A;  3BZK A;  4IJA A;  3W3C A;  5BQT A;  2R7S A;  4BL0 B;  5HS9 A;  5FLX K;  4P1W A;  2NVU B;  2MD5 A;  4HDV A;  3MCZ A;  3WTS C;  2O8X A;  3F9K A;  3I56 I;  3A01 B;  1Z7L A;  5DD4 A;  5HLI A;  1DU0 A;  2R93 J;  4D7M A;  4B8X A;  3IAS 2;  5JFR A;  2FF4 A;  2X1D A;  3T1B A;  4F7Z A;  1UMQ A;  1WVR A;  4JX5 A;  4I7H A;  2HQ5 A;  5LRS A;  3CF2 A;  1BN5 A;  5J6X A;  3OYG A;  5E3M A;  1V5E A;  5K1Y A;  1NK2 P;  3H9Q A;  4MLO A;  3BY6 A;  2LFB A;  2QQA A;  2IRF G;  4WF2 A;  3S1R J;  1TC3 C;  3HKZ N;  2QF7 A;  1UHW A;  5E1W A;  5M5Y J;  2CV0 A;  1KZH A;  1JUS A;  4U0V A;  5GPA A;  2NYX A;  3OSF A;  2P7C B;  3WU2 C;  2KP6 A;  1S6L A;  4E7K A;  2W00 A;  5BPI A;  2BYV E;  2VXD A;  3EYY A;  3K10 A;  2DMP A;  1T2K A;  1N77 A;  1K6O A;  3BR1 A;  3T8R A;  2AQE A;  1ETY A;  2BY0 A;  5IP7 J;  3MN2 A;  4M71 A;  4M74 A;  2O6G E;  4KNY A;  4XSZ F;  2PI0 A;  1O3T A;  2VIX A;  4ZZD A;  2EIM H;  3QOE A;  4E4H A;  2I8D A;  4GYG A;  1JI8 A;  4YFX F;  1ZK8 A;  2HDC A;  3LSR A;  4LLL A;  3ABL H;  3QP6 A;  1ZKG A;  1TWH J;  3O3K A;  5J8C A;  1SEU A;  1JJ8 C;  1WCM J;  5J4Y A;  1NK3 P;  2X6O A;  4CXF A;  3M07 A;  5EEG A;  2JA8 J;  1BA5 A;  2QBY A;  1UST A;  3F21 A;  4XLA A;  3SFZ A;  2DDA A;  4AIJ A;  4FX4 A;  1B9N A;  2O7O A;  1J7K A;  2V1D A;  4FCY A;  4OWR B;  1S9H A;  1Y0U A;  4RB3 C;  3C2B A;  2H1K A;  3H3Z A;  1D5V A;  1WZ2 A;  2Z2S B;  5DUI A;  2V79 A;  3HZJ A;  1G6N A;  4Y7N J;  3EUA A;  3LSK A;  4XL9 A;  3EDP A;  1DPU A;  5B1B H;  3W2A A;  1K6Y A;  2K7L A;  4D1Q A;  4EJV A;  4BE2 A;  2QA4 I;  3P9C A;  3LA7 A;  2KQR A;  2IA2 A;  3JTG A;  4M3G A;  3OYF A;  5DDG A;  5H2F C;  4A12 A;  1LEB A;  3OS2 A;  1G8X A;  3MKZ A;  2LBF B;  1APL C;  1FBS A;  3C2H A;  5JVG F;  2VBX A;  3FMS A;  1FT9 A;  4L9N A;  4FE4 A;  4XKB A;  2AXT C;  3PQK A;  4Y33 A;  1W5C C;  1S7E A;  3FMR A;  1TBX A;  4ASN A;  2VB6 A;  1RIO H;  4UY8 I;  2K02 A;  2DT5 A;  3OR2 C;  2FBK A;  2DAO A;  2HYF A;  1NH3 A;  2A3S A;  5FGM A;  2ZME B;  3WGI A;  1UG2 A;  2CFO A;  4KUM A;  4UXN A;  3K2Z A;  4PGG A;  3G2B A;  4A3M J;  1KON A;  2K4B A;  3CUQ C;  2WV0 A;  3TO7 A;  2YS9 A;  4RA2 A;  2MH9 A;  2CGP A;  1HSJ A;  1YW7 A;  2HGC A;  2JVG A;  2KIF A;  2HKO A;  5EZH A;  4KA4 A;  3DU5 A;  2HTJ A;  3OSG A;  2XPU A;  2CQQ A;  1V3F A;  3K0L A;  2OZU A;  3ZP5 A;  1FTT A;  1TQM A;  1G2H A;  1CF7 A;  4LK1 F;  1STZ A;  1YJ9 I;  3TL4 X;  5LGN A;  1L3L A;  2Q1Z B;  5DM7 F;  1JUP A;  1U9O A;  1QQI A;  3SYT A;  5HDK A;  1U78 A;  2L9V A;  4CZZ A;  4PCQ A;  2PQ8 A;  1JJ6 C;  1YIO A;  1VQ9 I;  1SMT A;  4GO1 A;  2NOJ B;  4ZYD A;  1YW8 A;  5H20 A;  4LLN A;  4XN3 A;  4PK4 A;  1B59 A;  1HKQ A;  2XAU A;  2IW5 A;  2VKV A;  3ELK A;  2M1B A;  2XV4 S;  3DEU A;  4A69 C;  4ZH4 F;  3M8J A;  3OYL A;  3D5R C;  4N9H A;  3MEX A;  1MJB A;  2X6X A;  3ABU A;  5DTD A;  3OYI A;  2PLY A;  2EB7 A;  4CH7 A;  5E20 A;  2DK5 A;  1RNL A;  1F5T A;  2WAF A;  1SD4 A;  3VB2 A;  1WWX A;  4YFN F;  3X2Q H;  3OS1 A;  5CVJ A;  2WV1 A;  1ZG1 A;  4L5E A;  1ODD A;  2JZY A;  3GBG A;  1USS A;  4MTD A;  2VJI A;  2GIZ A;  2L7F P;  5FKO A;  4A3J J;  5DV5 A;  4D7N A;  4DJA A;  2WAE A;  2R7U A;  2M2E A;  5CVI A;  4K2E A;  3BG7 A;  3R61 A;  4A6E A;  2OBP A;  1X4P A;  5TRD A;  4BQQ A;  4DGW B;  3C7J A;  4OIN F;  3HRU A;  3ZOB A;  3ZQ7 A;  5D8L B;  5IOZ A;  4WX9 A;  1SAX A;  2QQ8 A;  4HF2 A;  1LDK B;  2PN6 A;  3HGY A;  3H5R A;  4DZP A;  3G3Z A;  3GXO A;  2Y31 A;  5GAD J;  2NS8 A;  2ZO4 A;  1R1U A;  3BC8 A;  2ZXI A;  2EIN H;  3IH2 A;  3T5X A;  5D5W B;  1X4O A;  1QGP A;  3FK7 A;  3RI4 A;  2EA2 A;  2ICW G;  3LAP A;  3A1Y A;  5AIQ A;  3ZMD A;  5F1R A;  2QLZ A;  1TWA J;  3TQN A;  3AKZ A;  2R7Z J;  2CO5 A;  4LD5 A;  4B3A A;  3U1D A;  3M4O J;  2F5C A;  2DA4 A;  1A04 A;  1I1G A;  3DV8 A;  1QHH D;  2JWT A;  3HOS A;  3W6K B;  1QRY A;  1FOX A;  2GAU A;  4NQW A;  2QEX I;  4B09 A;  4IZZ A;  1IZ1 A;  3FHN A;  3ZGK A;  4F3Q A;  5KAF C;  2R5Z B;  5ILV A;  1FSH A;  2XGX A;  3MD2 A;  3OYN A;  3E0J B;  1TWG J;  2B0L A;  1IDY A;  3F8B A;  4I02 A;  2AXL A;  2KZG A;  3BPX A;  4KIT B;  5ERI A;  5BOX A;  3CJQ B;  3RJP A;  1T39 A;  5CLS A;  1F43 A;  3F3X A;  3BG5 A;  5FD6 A;  5DD8 A;  1BW6 A;  3ULQ B;  1DUX C;  3HOW J;  2RAE A;  4QWQ A;  2JA7 J;  2ZJP F;  2R7O A;  1T98 A;  1VQK I;  3BR2 A;  2E1M C;  4D5F A;  1HW2 A;  2BY2 A;  3DP7 A;  4LB6 B;  1TWF J;  5IY5 H;  5F0F A;  2W1O A;  3F22 A;  5FLV A;  1ERD A;  4ENJ A;  1A35 A;  3AG4 H;  2LY9 A;  1FMW A;  1A6Q A;  3ZQL A;  3D5S C;  3P9K A;  4HST A;  4F55 A;  5GTI C;  2VN2 A;  4C30 A;  2IPQ X;  2HR3 A;  4CGZ A;  2CQN A;  1T56 A;  2DJI A;  3DU6 A;  3N97 A;  1QNT A;  2QSF X;  1XS9 A;  1BR4 A;  4IQ4 A;  4I0A A;  1W7P A;  3WTX C;  5IOY A;  3CC4 I;  4U7D A;  1D0X A;  3KPH A;  2DQR A;  3BTC A;  3DWL E;  1DDN A;  5DUK A;  1Z1D A;  2M8G X;  3V7S A;  3GZ6 A;  2RN7 A;  4F93 B;  4X6A J;  1O7F A;  5K5R A;  1AU7 A;  2X1E A;  4XLF A;  2MW8 A;  5JLX A;  3N05 A;  4L5J A;  4WWC A;  1IF1 A;  5D8K B;  3COA C;  1LE8 A;  2GLO A;  4Y52 J;  3QQA A;  4L9T A;  1EKE A;  2Y2Z A;  3CLO A;  4U88 A;  1SVM A;  3BG3 A;  4C9Y A;  3H0G J;  2P81 A;  2EBI A;  1TW3 A;  3FXU A;  5K7Z A;  1QZE A;  2Y30 A;  1YTY A;  4XM3 A;  2HKX A;  2X51 A;  2M30 A;  1FJL A;  2RQQ A;  4N4O B;  4AVP A;  1SAU A;  2BVL A;  4ABZ A;  5HOD A;  3R60 A;  4WCG A;  2CW7 A;  2PMZ A;  1MMD A;  1CQT A;  1J5Y A;  4XRM A;  1MZB A;  3CCQ I;  2OQG A;  1J09 A;  1FBU A;  4L9V A;  3K70 D;  3FXJ A;  2EZK A;  3I4N J;  4AVZ A;  3BJO A;  3BR6 A;  3HSE A;  4JK1 X;  2ZFW A;  4A5M A;  1UG0 A;  2LF7 A;  4PJM A;  3R6S A;  2DFH A;  4BDZ A;  2ZSH B;  1QO0 D;  3ZQC A;  1ZGJ A;  4DBR A;  3H35 A;  2A07 F;  1K79 A;  3CCM I;  4HAM A;  4ZZL A;  3LSJ A;  3ERM A;  5ED4 A;  3NQO A;  1LPQ A;  2O8K A;  2P4W A;  2EPF A;  4M72 A;  4ZJZ A;  1FOY A;  4CCO A;  2HOS A;  1FP2 A;  3S3M A;  1G59 A;  1AWC A;  2E5Z A;  4HLY A;  2DA5 A;  2QQB A;  2QWW A;  2DOF A;  5BS6 A;  2P5L C;  2LG4 A;  2DU9 A;  2KLO A;  2YX4 A;  3K69 A;  1FTZ A;  3FM5 A;  3HBL A;  5A2Q K;  1J2X A;  2UZK A;  2IGN A;  2CJJ A;  4ENK A;  1P4X A;  2LP0 A;  4P5O A;  3U1K A;  3PFY A;  3KP5 A;  4HF0 A;  1BC8 C;  3HOZ J;  2FRH A;  2FQ4 A;  2LKP A;  1U2W A;  2WB1 N;  1SD7 A;  2PEX A;  2HQR A;  3CO6 C;  2IS6 A;  1E3H A;  3ABM H;  1KU9 A;  3DPL C;  2XAS A;  3HOV J;  3HKZ A;  2XSD C;  2BOL A;  1OMI A;  2R7D A;  3K70 C;  2P6T A;  3V8J A;  2CUF A;  3SHF A;  5DCM B;  3H36 A;  2E2I J;  1MBG A;  1XC5 A;  1Z0X A;  1IXS B;  1S5L C;  2J5P A;  1RES A;  5E79 C;  3PNY A;  4PSX A;  3FBI B;  5ICG A;  2VJ5 A;  3BRO A;  3F8F A;  4RB2 C;  2R7F A;  3PFI A;  3A0H C;  5F0C A;  4XLH A;  3IKV A;  4AYB N;  3G1L A;  2NVY J;  1IXR C;  2COM A;  4DZJ A;  5B66 C;  2V26 A;  2Y48 A;  2EFN A;  2JPC A;  2E2H J;  2R3S A;  3B6C A;  3F0C A;  3ML6 A;  1GHC A;  1IUF A;  3HIF A;  3BQZ A;  1BM9 A;  3OY9 A;  2ECB A;  2UWM A;  4BJ6 C;  1ZR4 A;  3I9V 2;  1BIA A;  2QVO A;  1XG1 A;  3C3W A;  1N78 A;  2O61 A;  1XGN A;  4KJZ A;  3K4J A;  2V9V A;  3P5J A;  4GYI A;  3D5L A;  1SAN A;  4YII A;  2Z5U A;  1BR1 A;  3VDX A;  2VQG A;  2CYY A;  3GFM A;  3M9A A;  1KGS A;  1FY7 A;  1YG2 A;  2YSR A;  3H3U A;  1ZN2 A;  3D0S A;  2M0C A;  5D5V B;  3QPS A;  1M1E B;  4XNF A;  4XOR A;  1K4T A;  2WY7 Q;  3KYC B;  4XSX F;  1YIT I;  1PP8 F;  3ZN1 A;  2N8G A;  1WPK A;  2KMU A;  4HW0 A;  3JRA A;  3GO5 A;  4DOZ A;  2HEO A;  3S2W A;  1P4A A;  5B5E C;  1VFC A;  1OCC H;  2F5D A;  1YI2 I;  1U6G A;  3G1M A;  1JT6 A;  2NXN B;  4CO8 A;  2QKM B;  1IV8 A;  2ZCW A;  4RB0 A;  1KU3 A;  3PQJ A;  2BEO A;  3CQZ J;  4MGR A;  2WAQ N;  4BY1 J;  2BBY A;  3KEO A;  3TBI A;  3ESW B;  1ZQ3 P;  3WTT C;  1A31 A;  4IHX A;  2XC7 A;  4EM2 A;  1Z9C A;  3TOA A;  3FBN B;  4A3C J;  1ZRD A;  3L09 A;  4G6T B;  3JAM Z;  1VQ4 I;  4PSW A;  1Y56 A;  4G7Z F;  1R5I D;  2M8E A;  5FD5 A;  4KFC A;  5CQE A;  2DW4 A;  3ZN0 A;  3E6C C;  3F8N A;  4W1U A;  1B72 B;  5F04 A;  2NNY A;  4Q4Z F;  3PO3 J;  3PL8 A;  2EV6 A;  1ETK A;  3PSF A;  3TDZ C;  1IV6 A;  2R7Q A;  2BY3 A;  4FE7 A;  1HST A;  2IT0 A;  1JKP C;  1W7P D;  1W4M A;  4JQF A;  2DPD A;  3ERE D;  4LG0 A;  1T8I A;  2IA1 A;  1TW2 A;  2CH0 A;  4X1E A;  4CYC B;  1R4M B;  2DA2 A;  2FNP A;  3EUH C;  5F08 A;  2H8R A;  1X3W B;  3KP3 A;  4KN7 X;  1A5J A;  5GAG J;  2UV1 A;  1B1B A;  4B44 A;  4IOC F;  1BC7 C;  3ONQ A;  4BQA A;  2JK3 A;  1H9G A;  1X19 A;  3O6B B;  4EJT A;  1MSE C;  5LHH A;  2M87 A;  1RR8 C;  4W97 A;  5C4X J;  1BI3 A;  4NC6 A;  2V6E A;  4GDF A;  2CQK A;  1QU3 A;  3T8T A;  2LMD A;  2IS2 A;  3K1P A;  2L54 A;  1TNT A;  1W36 D;  3BPV A;  2E34 A;  2M7A A;  3O2P E;  2XF6 A;  1FNN A;  1FOK A;  4UHT A;  2XGE A;  2VPL A;  4MO7 A;  4FAS D;  2Y0S N;  2EWN A;  1AHD P;  2HTS A;  4A3E J;  3ZXS A;  4KIC A;  4I98 B;  2F6C A;  4BNC A;  2XB5 A;  3KX2 A;  5EJC A;  2OTL I;  2E36 A;  1JUM A;  4C2T A;  3RPU A;  3OR1 C;  5KHD A;  2X9D A;  5FRN A;  2L9R A;  1ON1 A;  2XPW A;  1S72 I;  3IWZ A;  3HUG A;  4LOC A;  2HS5 A;  4XLE A;  1VTN C;  2RDP A;  2DFE A;  1Z6R A;  2QZ8 A;  2KDO A;  3K4B A;  3I59 B;  3GTK J;  2LKX A;  1W0T A;  3A02 A;  3KEY A;  3RSN A;  1MDM A;  2GXB A;  3CJN A;  1POG A;  1WJB A;  2F5F A;  5EG0 B;  2XVC A;  3HRT A;  3BG6 A;  1U8B A;  3ZQH A;  4HNU A;  2PJR B;  1E17 A;  5BMZ A;  5K7F A;  4G12 A;  4M9X A;  2D5V A;  5GP9 A;  2ELH A;  4BBS J;  1WI3 A;  1V4R A;  2YR2 A;  3Q9V A;  2XRO A;  2CFX A;  2OAZ A;  1MNE A;  3FF5 A;  1R5G A;  4N9I A;  5GPC A;  4NC8 A;  1JGG A;  1ACI A;  2CUZ A;  1P4W A;  2MH2 A;  3JRF A;  4DNC A;  1W36 C;  3MFK A;  4MFE A;  3ZQF A;  3L7W A;  1S3J A;  1OCT C;  3ZPL A;  3MKL A;  2IBD A;  2JMW A;  3OYH A;  3RKW A;  5L3F A;  2P6S A;  3E1S A;  2Y69 H;  1CGP A;  5EF6 A;  3U21 A;  1XTA A;  2ZBK A;  1I27 A;  2DXI A;  1Z7U A;  2PMH A;  5LRR A;  4BJ5 C;  3I54 A;  5B3S H;  4XIC A;  2VJ4 A;  5IP9 J;  4IF4 A;  3LSP A;  5LGT A;  5D6E A;  3WHB A;  1VQ6 I;  4HSR A;  5IT3 A;  2V1X A;  1EA3 A;  3CCS I;  2KIQ A;  5HVQ C;  4KIB A;  2WWY A;  3HTS B;  3I71 A;  1X2M A;  2JQ7 A;  2NVX J;  3AAF A;  1LDD A;  1ZGA A;  2AS5 F;  2QSH X;  4A6D A;  2EFO A;  1FOW A;  4UUS A;  1A36 A;  4FIS A;  3P9I A;  3LA3 A;  3AG2 H;  4B47 A;  3DPU A;  4E7Z A;  3KYL A;  4BDY A;  4AU7 A;  3CDH A;  1IN4 A;  3CUQ B;  4FHT A;  1IN6 A;  1U5T A;  2V4J C;  4BQN A;  4XMY A;  3CDI A;  3CMY A;  2EIJ H;  4ZDP A;  3S8P A;  4MHG A;  1NG6 A;  3RKY A;  3JCU C;  3L00 A;  2Z1D A;  1P6R A;  4C2U A;  4HPQ A;  2YUS A;  3LFK A;  4QPO A;  2PBI A;  4FT8 A;  3F6O A;  3MZ8 A;  2A6E F;  1R00 A;  4MFD A;  3NWS A;  2HPM A;  3M1E A;  5AON A;  4M3D A;  5M5W J;  1IGN A;  4AM3 A;  2ZJQ F;  2HDW A;  2HVS A;  2GBY A;  2EA4 A;  2ID3 A;  3M7G A;  5IYC J;  2RVC A;  4XR6 A;  5GTH C;  3CCR I;  5JHU A;  4IKF A;  2W57 A;  5HNF A;  4QTR A;  2ZNZ A;  3OV8 A;  5HOO A;  1OPC A;  2L4A A;  4P9F A;  1MH3 A;  3VWB A;  5LEK A;  1FC3 A;  4N4N B;  4BEH B;  3OYA A;  3JR9 A;  5J8F A;  5L3D A;  2GIV A;  4S05 A;  3A0B C;  1ZLJ A;  4YEL A;  3J7A O;  1GV2 A;  1TZL A;  5L3C A;  5J1R A;  2CUJ A;  2XKP A;  1PJR A;  2LNB A;  2Q2E B;  2Z33 A;  1OCR H;  1D8J A;  5E3L A;  2L7M P;  2K40 A;  1F9N A;  4I01 A;  2A6H F;  3LWF A;  3MWM A;  1ZR2 A;  4RBO A;  5FKN A;  1KQ9 A;  1R1V A;  4HZF A;  5LEJ A;  2HOE A;  2G0E A;  3Q3S A;  1XN7 A;  4AD9 A;  1ETX A;  3HEF A;  1EH8 A;  5EDN A;  2A5Y B;  2BW3 A;  3I5U A;  3RKQ A;  2D1H A;  1FX7 A;  2HVR A;  4M6V A;  3S1M J;  4QIW N;  3S15 J;  2ZB9 A;  3QPH A;  1PYV A;  1OCO H;  4PJN A;  2CU7 A;  3HSR A;  1MMG A;  3KP2 A;  4AUX A;  1EH6 A;  4HBL A;  1O3S A;  3VFZ A;  2M3A A;  2VAS A;  3HRS A;  3IKT A;  2L9S A;  2Y9Y A;  2CMP A;  4B43 A;  3RKX A;  2K27 A;  2ADU A;  2XB0 X;  2DOA A;  5H6Q A;  3TP3 A;  1IRZ A;  2WBM A;  3JTH A;  2VKD A;  1WSU A;  4RS8 A;  4ZYG A;  1ETQ A;  1FPQ A;  4KIF A;  2M34 A;  2V6C A;  2VXZ A;  4U87 A;  1X1A A;  1BI0 A;  5LHG A;  2L0K A;  2YU3 A;  4P96 A;  1H9T A;  1PP7 U;  4V2F A;  1MJ9 A;  4AIK A;  1JXS A;  4JBA A;  2MFZ A;  3FKJ A;  4M3F A;  4DBQ A;  1DPR A;  1S7O A;  2R7X A;  3HPG A;  1AKH A;  4L5I A;  1DU6 A;  1WJF A;  2L01 A;  3WTV C;  2JA5 J;  1MH4 A;  1B8I B;  1TT5 B;  1JTY A;  1PUF A;  4BU2 A;  3K4C A;  3RZO J;  4S04 A;  5EGO B;  3ASO H;  1B4A A;  3OL3 A;  3HB9 A;  1I6H J;  2QYO A;  3DTE A;  1XGM A;  5HDN A;  3EYI A;  4IVN A;  3W6V A;  1GLN A;  1R1T A;  4A0X A;  1J59 A;  1WJC A;  5BNG A;  1VI0 A;  1WJD A;  5CVU A;  2LYC A;  2BZT A;  4UB6 C;  2KIS A;  2RC4 A;  1D8K A;  3QYB A;  2R5Y B;  1OJL A;  4HV6 A;  5FKL A;  2WA0 A;  4R1H A;  2O9L A;  1WRJ A;  2VLA A;  2CW0 F;  3Q0W A;  4CIC A;  2E1M B;  1NHA A;  4EAT A;  2D1V A;  3OS0 A;  1V54 H;  2ISZ A;  3HJE A;  4QSH A;  2JPB A;  1L0O C;  4CYD A;  2PJP A;  1GVJ A;  3PSI A;  2EIL H;  3DF8 A;  6PAX A;  2DN0 A;  1IN7 A;  4BGD A;  3KP6 A;  3RPU D;  2V9P A;  1HA8 A;  2JA2 A;  3WU0 A;  4BHP A;  4WXH A;  4ZTF A;  3MMY B;  1W0U A;  2R7R A;  2W25 A;  3KP7 A;  3FXR A;  4IO9 F;  2NVT J;  4A3B J;  3J80 Z;  1R22 A;  5E17 F;  1BI1 A;  3GEZ A;  3CCU I;  1ITY A;  4PJ0 C;  1YO5 C;  3L2C A;  4M3E A;  1R71 A;  3ZMZ A;  3GX4 X;  3CJR B;  4RB1 A;  2LDU A;  2L7Z A;  5CQG A;  4M9S A;  5M3M J;  4E7J A;  2LVS A;  4AID A;  2ECC A;  2MGQ A;  1R49 A;  4BBR J;  3JRI A;  3DXJ F;  3TO9 A;  4UVA A;  3IRR A;  2VON A;  2P5K A;  1RZ4 A;  1O3Q A;  1ETW A;  4RGR A;  2PX9 A;  2Q8K A;  1UEL B;  3MKW B;  5HNH A;  1ONV A;  1IN8 A;  2Y0M A;  1VQO I;  1P7J A;  1Y8R B;  2H6C A;  1HKS A;  5K7H A;  1WJE A;  2LLK A;  4AC0 A;  3H5N A;  4BKX A;  4BXU A;  1R7J A;  2JSP A;  1ZRC A;  3FXK A;  4KT6 A;  4E7I A;  3HXL A;  2XRN A;  4R8H A;  1X2N A;  3WG7 H;  4EMS A;  5FFX A;  4I2O A;  5E8I A;  2XDV A;  1P7I A;  1SVL A;  2JN6 A;  4G94 A;  2WC2 A;  3GUD A;  3PNT A;  1LKX A;  3S2H J;  2HYG D;  5FLM J;  4MEY F;  3MAJ A;  3JSO A;  1JT0 A;  3HHG A;  3PO2 J;  3H0D A;  2WY8 Q;  3KEQ A;  1JHH A;  1Z77 A;  3OIQ A;  1HW1 A;  1VQP I;  2VBY A;  3IHU A;  1AOY A;  2FUG 2;  3SZG A;  3T0Y A;  2VI6 A;  2WAQ A;  3TGN A;  4JYK A;  3RZD J;  3I53 A;  1FYK A;  2GZW A;  1JE8 A;  4UUS B;  1FWZ A;  2ZKZ A;  1IO2 A;  1HKT A;  2CV2 A;  1TQP A;  3L2W A;  1T08 B;  3M8F A;  1YJN I;  4OOI A;  2QBY B;  1IRX A;  4ESB A;  3OIP A;  1XDU A;  2FBH A;  2W24 A;  2VOO A;  2KHM A;  2A61 A;  3CES A;  1I3Q J;  4WXD A;  4G6Q A;  1QZY A;  2DFF A;  2H94 A;  2LC2 A;  1HXD A;  2K3P A;  4QPQ A;  2KFD A;  1SMY F;  1WI9 A;  2RNJ A;  2KJB A;  2MLG A;  2BV6 A;  3E5Q A;  2EJR A;  3S93 A;  2MG4 A;  5F64 A;  1J75 A;  4OIO F;  4DQ2 A;  3GFJ A;  5E3O A;  2QM3 A;  4D5C A;  4EGZ A;  3CD6 I;  4C3H J;  1XSX A;  1UHS A;  3NAR A;  4J00 A;  4E6K G;  1R23 A;  4ENN A;  3WE3 A;  2O03 A;  4DYQ A;  4A3I J;  2GXG A;  3OL4 A;  3ABT A;  4L0Z B;  1SFE A;  2EFQ A;  3AFH A;  3BJ6 A;  4P55 A;  4Y3O A;  3V7C A;  2VJJ A;  1YQA A;  2FJ1 A;  3JRD A;  1K78 A;  3QU3 A;  4OIR F;  1I39 A;  1T33 A;  2OUM A;  4CCN A;  1KYZ A;  4GXO A;  4ZYA A;  3E7L A;  3OYD A;  3J7A Y;  5J1Y A;  2IGO A;  2RRE A;  2M7B A;  1YRN A;  1FIP A;  2NRA C;  1MSF C;  3IAM 2;  3ZQQ A;  3MZY A;  2BVM A;  1MNM C;  1JHF A;  4G6D A;  1WH7 A;  3GTP J;  2OF7 A;  1SC7 A;  1U5T C;  4HX7 A;  2MSY A;  3O8G A;  1O57 A;  2LOO A;  4DW6 A;  4EVI A;  2JT1 A;  4RGU A;  4X0G A;  1OCZ H;  4HQM A;  4PDK A;  4DYR A;  3CTA A;  2VKE A;  1SFK A;  3BR3 A;  3GWZ A;  2COB A;  3K7A J;  2O5R A;  3ECO A;  1CF7 B;  1ZRF A;  1R58 A;  3GTM J;  5LHI A;  3GME A;  3DKX A;  1XPX A;  4IL6 C;  4O6J A;  3GTL J;  2HOT A;  1I50 J;  2V9K A;  4I76 A;  4B1R A;  3OOU A;  2HYJ A;  5IYB J;  1X1D A;  4A3K J;  2B7E A;  1FYL A;  2UXX A;  2H27 A;  2XGD A;  2FOW A;  3CME I;  1T0F A;  1PVE A;  2Q0O A;  4B3X A;  2K85 A;  1FEX A;  2DJN A;  2TCT A;  1WJA A;  4IQJ A;  1QPM A;  3A01 A;  2XUB A;  3A4C A;  3LST A;  1SFX A;  3EPZ A;  2EFW A;  2NOG A;  2FNA A;  3WU1 B;  1S29 A;  3SXY A;  1R6R A;  3SDB A;  3M3Y J;  2KRH A;  3FXQ A;  4JX4 A;  3S3N A;  3MQ0 A;  1V5G A;  1F36 A;  3BP8 A;  2B9S A;  4WXC A;  1FP1 D;  3UNG C;  1LUJ B;  2GOM A;  2KIM A;  3OYM A;  2LY1 A;  2NNN A;  4A5N A;  4YRV A;  4EM1 A;  1YX3 A;  5D4R A;  1GUU A;  2HWV A;  2F4I A;  3B73 A;  2EFP A;  2V1U A;  4A93 J;  4JP0 A;  3CP8 A;  5LFA A;  1KQ0 A;  2X0L A;  1P92 A;  3WGH A;  1ZRE A;  4R79 A;  2K86 A;  1IRF A;  1VQM I;  3N4M A;  4ITV A;  4RAG A;  4CZC A;  2R7V A;  1TQI A;  1K4S A;  4E7S A;  2GA1 A;  2LH9 A;  1UHM A;  4Y15 A;  2CSO A;  1Y6I A;  3EUK L;  3ROU A;  2BHY A;  1A6I A;  5FRO A;  3BG9 A;  4UV8 A;  3LNQ A;  3K4L A;  3DQV C;  1ZAO A;  3QAH A;  5EYR A;  1O3R A;  2HDD A;  4BXF A;  3LL7 A;  2DFI A;  2M45 A;  3Q5F A;  2FSW A;  4KIS A;  1WH5 A;  4PJJ A;  1SD6 A;  2DA6 A;  2GA2 A;  3PNV A;  4YIR X;  2FEZ A;  2HPI A;  1XSD A;  2OZ6 A;  1SFU A;  3ASN H;  2M4K A;  2H6B A;  3AG3 H;  3RPQ A;  1ZG3 A;  2M9H A;  2FOK A;  2JUC A;  3L9F A;  1RET A;  2XHK A;  1YHQ I;  3O8H A;  4EGY A;  3S3O A;  4JOM A;  1LDJ A;  1R9T J;  1XB4 A;  3FXM A;  1MMA A;  2VUM J;  1U0J A;  2D2W A;  4L9J A;  2H1L A;  1YS7 A;  4FX0 A;  4NDL A;  5L3E A;  4NQW B;  3C2G A;  2XRL A;  2W48 A;  4KDP A;  2CWE A;  4HNV A;  2X48 A;  4LG3 A;  1EJ9 A;  3S1N J;  4RAZ A;  5L3G A;  2I5U A;  1XX5 A;  1BJA A;  2VPR A;  1BJZ A;  2LY2 A;  2LBF A;  5B1A H;  3KZI C;  2QKL B;  3QPT A;  1G3T A;  1P2F A;  3GTJ J;  3IRQ A;  3RCO A;  3VYT B;  4BJT A;  2H8W A;  3EET A;  5C44 J;  3BJA A;  3CUO A;  4RLQ A;  2UXN A;  4ESJ A;  4OMY A;  1VZ0 A;  2LSO A;  3FZV A;  5TGT A;  3TW6 A;  3ZMS A;  3JAM K;  2LRD A;  3DBR B;  4NNJ A;  1RRJ A;  5J40 A;  1UCR A;  3C18 A;  5CVR A;  2QSG X;  3IUO A;  4KMF A;  2ZME A;  1LVA A;  3V42 A;  3F8M A;  2EQR A;  2E5N A;  1RUN A;  3VPR A;  3G73 A;  3QWL A;  4LLG F;  1KYW A;  3RYR A; 
#chains in the Genus database with same CATH homology
 2OU2 A;  1W5S A;  2M5W A;  1MGT A;  2LF8 A;  1OKR A;  2PMU A;  2DBB A;  2BE5 F;  1W7P B;  1E2X A;  3E5X A;  3J81 Z;  1XCB A;  4HLX A;  4E70 A;  2FA5 A;  2XAF A;  4RGS A;  4OMZ A;  3KFW X;  3KLN A;  4Y17 A;  3ZMU A;  4IRH A;  1PUE E;  1J0R A;  3KZZ A;  1SD5 A;  3JSP A;  4I0B A;  1R36 A;  4M9Z A;  3DFG A;  4AIH A;  2CG4 A;  1F4K A;  1BI2 A;  4LFU A;  4A0Y A;  3TDU C;  4PGH A;  1MD0 A;  4XBF A;  4HF1 A;  1K78 B;  5LBQ A;  2DQL A;  1IW7 F;  2G7H A;  1Z91 A;  5IT9 Z;  3GFI A;  1T38 A;  2VBZ A;  1YW9 A;  3WTZ A;  3U9G A;  3LQR A;  1FBQ A;  1W5T A;  5EEH A;  1LB2 A;  4L0Y B;  1ZLK A;  3IL2 A;  3B02 A;  2YX7 A;  5LGU A;  2ACJ A;  2DK8 A;  1ULY A;  4HV5 A;  4H0E A;  5FLX Z;  4QLC U;  3ZMV A;  2C6Y A;  1XMK A;  2RV8 A;  5E1X A;  1LEA A;  5FO5 A;  4YIF A;  3CO7 C;  1J9I A;  4WK8 F;  2MA3 A;  3FWE A;  2VE8 A;  2VOP A;  5JI6 A;  1WQ2 A;  2IA0 A;  2WTE A;  4LB5 A;  3QP5 A;  3NRV A;  1UB9 A;  5ILS A;  1RI7 A;  2Z99 A;  1LQ1 A;  1BIB A;  5ILU A;  2VBW A;  3TKY A;  5K5Q A;  1RUO A;  2VE9 A;  3R0J A;  1IN5 A;  4HA8 A;  2EV0 A;  2F5E A;  2L4M A;  1I1S A;  3E6B A;  3E97 A;  1QZZ A;  4XLP F;  2FQ3 A;  4U0W A;  1X3U A;  4M6X A;  2E1N A;  5D6F A;  2QUF A;  2FML A;  3I58 A;  4KMU X;  3WE2 A;  4IHT A;  5D5U B;  2P7V B;  2VC0 A;  2ETH A;  4ZYE A;  4MEX F;  4CDG A;  2ISY A;  3KE2 A;  3IC7 A;  1HW5 A;  1XDS A;  3SZP A;  3W6J B;  4HOB A;  2NAZ A;  4BHB A;  3KP4 A;  4UNO A;  4IRI A;  3FM3 A;  1YLF A;  2HZT A;  2QEN A;  4P9U A;  2ZJ2 A;  3GFL A;  3QU6 A;  5CYV A;  3HHH A;  4A2U A;  4Z2Y A;  1S8N A;  2XAH A;  3RDI A;  1O7L A;  3H92 A;  1R5H A;  2IVM A;  1G3Y A;  2IP2 A;  2G9W A;  2K4J A;  3VEP A;  4HDU A;  5LLQ A;  2XAJ A;  3WGG A;  4LG0 B;  3TOB A;  3C1D A;  3LQQ A;  4Q47 A;  3MZH A;  2MBF A;  2STW A;  4Y13 A;  1OYW A;  3WTY C;  4G7O F;  5CJ9 A;  4HYE A;  2P5V A;  1YFH A;  2JSC A;  4UVC A;  3RTR A;  4OU0 A;  3FMQ A;  3E3V A;  5H6R A;  5E1Z B;  3RYP A;  2O3F A;  2STT A;  2JRT A;  4GGG A;  1GXQ A;  1Z05 A;  5DCM A;  2QQ9 A;  5AIP A;  3NEU A;  1I6X A;  5F6F A;  1B9M A;  5KK1 A;  4G9Y A;  1UFM A;  1MJA A;  4LJZ F;  2FU4 A;  1LNW A;  1XCV A;  2P8T A;  2DLL A;  1ZAR A;  4IXA A;  4YFK F;  2OA4 A;  2NS0 A;  3LA2 A;  1YS6 A;  3K1M A;  4UVB A;  3J80 K;  1MDM B;  4KN4 X;  4O5V A;  1TNS A;  3BDD A;  3ECH A;  4OIP F;  1ZH5 A;  1Q1H A;  4TV7 A;  4BAY A;  1KU2 A;  2DO7 A;  2X4H A;  1I5Z A;  3V4G A;  1TLH B;  4HX4 A;  2ZNY A;  3R4K A;  2J5O A;  4ON0 A;  3OOP A;  5FFZ A;  4LK0 F;  3E6D A;  3RIR A;  5HLG A;  5D4S A;  1LJ9 A;  2D45 A;  4Q5S F;  1OYI A;  1G3W A;  2DPU A;  3EUH A;  2XAG A;  5DCF A;  2A69 F;  1ZHF A;  1HBX G;  4GCV A;  2EV5 A;  5K5O A;  3BZ6 A;  1XGS A;  2F2E A;  2VC1 A;  3KCC A;  1S7A A;  1IRG A;  1U5T B;  4ENM A;  4YG2 F;  1TTY A;  2H09 A;  1OYY A;  3REO A;  4L18 B;  5D5X B;  1Z6T A;  4LGW A;  1KU7 A;  5BPD A;  2E1C A;  3HSF A;  1OR7 A;  2E7W A;  4BYY A;  3E6M A;  2VT2 A;  2Z9O A;  4BH9 A;  1BBY A;  3F72 A;  2KKO A;  4M6Y A;  4RGX A;  3HYI A;  4ESF A;  2YPR A;  4IRG A;  4RAY A;  1JGS A;  1XD7 A;  2KIU A;  1REP C;  4M73 A;  3F23 A;  2VT3 A;  3I64 A;  3U2R A;  1H0M A;  3SQN A;  3K1N A;  4XLN F;  3WG9 A;  5TJJ A;  2ZXJ A;  3HRM A;  3QOP A;  3F6V A;  5FB2 A;  5E8G A;  2FXA A;  3I0T A;  1FZP B;  4HX8 A;  3KLO A;  2MC3 A;  4PZJ A;  4Q48 A;  4NHJ A;  1WKM A;  3Q9S A;  3E5U A;  3I59 A;  2L02 A;  3FHZ A;  4O3M A;  4XRF A;  2XIG A;  2XKO A;  2Z3Y A;  2KRF A;  4UV9 A;  3TO6 A;  3DPT A;  2L3D A;  5CVV A;  1XMA A;  4U0Y A;  2VOD A;  2EK5 A;  1G4D A;  5A2Q Z;  1DP7 P;  2JTV A;  3WTU C;  4D0P A;  4AWX B;  1T6S A;  3V8L A;  1IXC A;  2FMY A;  1ON2 A;  4KIG A;  3VOD A;  4G7H F;  3BWG A;  3WOD F;  1ZG5 A;  5ICF A;  4ZYH A;  2OD5 A;  3KZY A;  4EM0 B;  4CHU A;  2FE3 A;  3JW4 A;  3ISP A;  3LAJ A;  2RQP A;  3IWF A;  4ETS A;  1FSE A;  3HTU A;  4NB5 A;  4U7B A;  4BHC A;  5JR3 A;  2ESN A;  4LMY A;  1KA8 A;  1C0W A;  3CUQ A;  3WTW C;  1FLI A;  2OQR A;  5E18 F;  4G8X A;  3GLX A;  4EJO A;  2GQQ A;  4I09 A;  1F1Z A;  2DI3 A;  4MQV A;  3FX3 A;  2MLK A;  1FYM A;  1G3S A;  1HQC A;  5HDG A;  3EQL F;  4EJU A;  2A68 F;  3QRF F;  2TDX A;  4N0B A;  3P7N A;  2Q2E A;  3GZ5 A;  5KVR A;  2PG4 A;  5HS8 A;  4KT5 C;  4A0Z A;  3R0A A;  1YYV A;  4OIQ F;  5HLH A;  4KYW A;  1U3E M;  3F8C A;  3HOT A;  1K7A A;  1XGO A;  2G7U A;  2E7X A;  3BOQ A;  3J81 K;  3V8K A;  2W84 A;  4MNU A;  1IAW A;  2ESH A;  3GVA A;  2DTR A;  4MQ9 F;  2HFH A;  3DKW A;  2RGV A;  3K9T A;  2HQN A;  2KJC A;  2IJL A;  3GW2 A;  1QBJ A;  1KQ8 A;  1IUY A;  3M8E A;  1GXP A;  5JVT A;  1B6A A;  4EQQ A;  1EH7 A;  4IHS A;  2RKH A;  5IT9 K;  2FBI A;  2XAQ A;  1ZYR F;  1D3Y A;  4IPA A;  4HQE A;  1MKM A;  4MTE A;  3I4P A;  3V7R A;  5ICE A;  3GYH X;  1PDN C;  3KET A;  2BGC A;  2Y75 A;  5HS7 A;  4EJW A;  2GWR A;  5L3B A;  1BOA A;  2W85 A;  5DEQ A;  1U8R A;  3SZT A;  3GF2 A;  2O0Y A;  1XSV A;  3ZMT A;  4UUV A;  5DYM A;  4EV0 A;  3VOE A;  2PFB A;  1EV7 A;  5ICC A;  4IJA A;  5BQT A;  5HS9 A;  5FLX K;  2MD5 A;  4HDV A;  3MCZ A;  3WTS C;  2O8X A;  5DD4 A;  5HLI A;  4B8X A;  5JFR A;  2FF4 A;  3T1B A;  4F7Z A;  4I7H A;  5LRS A;  1BN5 A;  5J6X A;  5K1Y A;  3BY6 A;  2QQA A;  2IRF G;  4WF2 A;  1UHW A;  5E1W A;  4U0V A;  2NYX A;  2P7C B;  1S6L A;  5BPI A;  2BYV E;  3EYY A;  1T2K A;  1K6O A;  3T8R A;  4M71 A;  4M74 A;  2O6G E;  4KNY A;  4XSZ F;  2PI0 A;  1O3T A;  4ZZD A;  4GYG A;  4YFX F;  2HDC A;  4LLL A;  5J8C A;  3QP6 A;  3O3K A;  4CXF A;  5EEG A;  2QBY A;  1UST A;  3F21 A;  3SFZ A;  4AIJ A;  4FX4 A;  1B9N A;  1J7K A;  2V1D A;  1Y0U A;  4RB3 C;  3H3Z A;  1D5V A;  5DUI A;  2V79 A;  1G6N A;  3EDP A;  1DPU A;  2K7L A;  4EJV A;  3P9C A;  3LA7 A;  3JTG A;  2IA2 A;  5DDG A;  4A12 A;  1LEB A;  1FBS A;  2VBX A;  3FMS A;  1FT9 A;  4L9N A;  3PQK A;  3FMR A;  1TBX A;  4ASN A;  1RIO H;  2K02 A;  2DT5 A;  2FBK A;  2DAO A;  2HYF A;  2A3S A;  5FGM A;  2ZME B;  3WGI A;  4KUM A;  4UXN A;  3K2Z A;  4PGG A;  2K4B A;  3CUQ C;  2WV0 A;  3TO7 A;  2MH9 A;  2CGP A;  1HSJ A;  1YW7 A;  2HGC A;  2KIF A;  2HKO A;  4KA4 A;  2HTJ A;  1V3F A;  3K0L A;  2OZU A;  3ZP5 A;  1TQM A;  1CF7 A;  4LK1 F;  1STZ A;  5LGN A;  1L3L A;  1QQI A;  5HDK A;  1U78 A;  4CZZ A;  4PCQ A;  2PQ8 A;  1YIO A;  1SMT A;  4GO1 A;  4ZYD A;  1YW8 A;  5H20 A;  4LLN A;  1B59 A;  1HKQ A;  2IW5 A;  3ELK A;  2M1B A;  2XV4 S;  3DEU A;  4ZH4 F;  4N9H A;  3MEX A;  1MJB A;  3ABU A;  2PLY A;  2EB7 A;  5E20 A;  2DK5 A;  1RNL A;  1F5T A;  1SD4 A;  3VB2 A;  1WWX A;  4YFN F;  5CVJ A;  1ZG1 A;  1ODD A;  2JZY A;  1USS A;  4MTD A;  5DV5 A;  5CVI A;  4K2E A;  3R61 A;  4A6E A;  2OBP A;  5TRD A;  3C7J A;  4OIN F;  3HRU A;  3ZQ7 A;  5D8L B;  4WX9 A;  1SAX A;  4HF2 A;  1LDK B;  2PN6 A;  3G3Z A;  3GXO A;  2ZO4 A;  1R1U A;  3T5X A;  5D5W B;  3RI4 A;  1QGP A;  2EA2 A;  3LAP A;  3ZMD A;  5AIQ A;  5F1R A;  2QLZ A;  3TQN A;  2CO5 A;  4LD5 A;  3U1D A;  2F5C A;  1A04 A;  1I1G A;  3DV8 A;  3HOS A;  3W6K B;  2GAU A;  4NQW A;  4B09 A;  1IZ1 A;  5ILV A;  1FSH A;  2XGX A;  2B0L A;  3F8B A;  4I02 A;  2AXL A;  3BPX A;  5ERI A;  5BOX A;  3RJP A;  1T39 A;  5CLS A;  3F3X A;  5FD6 A;  5DD8 A;  3ULQ B;  1DUX C;  4QWQ A;  1T98 A;  1HW2 A;  3DP7 A;  4LB6 B;  3F22 A;  4ENJ A;  3P9K A;  2VN2 A;  2IPQ X;  2HR3 A;  4CGZ A;  3N97 A;  1QNT A;  4I0A A;  1W7P A;  3WTX C;  4U7D A;  2DQR A;  1DDN A;  5DUK A;  1Z1D A;  3V7S A;  3GZ6 A;  2RN7 A;  1O7F A;  5K5R A;  4L5J A;  4WWC A;  1IF1 A;  5D8K B;  3COA C;  4L9T A;  3CLO A;  4U88 A;  1TW3 A;  3FXU A;  1YTY A;  2HKX A;  2M30 A;  4AVP A;  3R60 A;  4WCG A;  1J5Y A;  1MZB A;  2OQG A;  1FBU A;  4L9V A;  3BJO A;  3HSE A;  4JK1 X;  2ZFW A;  4A5M A;  2LF7 A;  3R6S A;  1QO0 D;  1ZGJ A;  2A07 F;  1K79 A;  4HAM A;  4ZZL A;  5ED4 A;  3NQO A;  2P4W A;  4M72 A;  1FP2 A;  1AWC A;  4HLY A;  2QQB A;  2QWW A;  5BS6 A;  2P5L C;  2DU9 A;  2YX4 A;  3K69 A;  3FM5 A;  5A2Q K;  1J2X A;  2UZK A;  4ENK A;  1P4X A;  4P5O A;  3KP5 A;  4HF0 A;  1BC8 C;  2FRH A;  2LKP A;  1U2W A;  1SD7 A;  2PEX A;  2HQR A;  3CO6 C;  1KU9 A;  3DPL C;  2XAS A;  2R7D A;  1OMI A;  2P6T A;  3V8J A;  3SHF A;  5DCM B;  1IXS B;  2J5P A;  5ICG A;  4RB2 C;  3BRO A;  3F8F A;  2R7F A;  3PFI A;  3IKV A;  1IXR C;  2COM A;  2Y48 A;  2EFN A;  2JPC A;  2R3S A;  3ML6 A;  1GHC A;  3HIF A;  1BM9 A;  2UWM A;  1BIA A;  2QVO A;  3C3W A;  2O61 A;  1XGN A;  2V9V A;  4GYI A;  3D5L A;  4YII A;  2Z5U A;  2CYY A;  3GFM A;  3M9A A;  1KGS A;  1FY7 A;  1YG2 A;  2YSR A;  3H3U A;  1ZN2 A;  3D0S A;  5D5V B;  4XSX F;  1PP8 F;  3ZN1 A;  4HW0 A;  3GO5 A;  2HEO A;  3S2W A;  1P4A A;  2F5D A;  1U6G A;  4CO8 A;  2ZCW A;  4RB0 A;  1KU3 A;  3PQJ A;  2BEO A;  4MGR A;  2BBY A;  3KEO A;  3WTT C;  4EM2 A;  1Z9C A;  3TOA A;  1ZRD A;  3L09 A;  3JAM Z;  4G7Z F;  5FD5 A;  2M8E A;  4KFC A;  2DW4 A;  3ZN0 A;  3E6C C;  3F8N A;  2NNY A;  4Q4Z F;  2EV6 A;  3TDZ C;  1HST A;  2IT0 A;  1W7P D;  1W4M A;  4JQF A;  2DPD A;  3ERE D;  4LG0 A;  2IA1 A;  1TW2 A;  2FNP A;  3KP3 A;  4KN7 X;  1B1B A;  1BC7 C;  4BQA A;  1H9G A;  3O6B B;  4EJT A;  5LHH A;  2M87 A;  1BI3 A;  2CQK A;  3T8T A;  3K1P A;  2L54 A;  1TNT A;  3BPV A;  3O2P E;  1FNN A;  1FOK A;  4UHT A;  2EWN A;  2HTS A;  4KIC A;  4I98 B;  4BNC A;  3RPU A;  1ON1 A;  3IWZ A;  3HUG A;  2HS5 A;  1VTN C;  2RDP A;  1Z6R A;  2QZ8 A;  3I59 B;  1MDM A;  2GXB A;  3CJN A;  2F5F A;  2XVC A;  3HRT A;  1E17 A;  5BMZ A;  4M9X A;  2ELH A;  1V4R A;  2YR2 A;  3Q9V A;  2XRO A;  2CFX A;  2OAZ A;  3FF5 A;  1R5G A;  4N9I A;  1P4W A;  2MH2 A;  4DNC A;  3MFK A;  3L7W A;  1S3J A;  3ZPL A;  3RKW A;  5L3F A;  2P6S A;  1CGP A;  2ZBK A;  1I27 A;  1Z7U A;  2PMH A;  5LRR A;  3I54 A;  4IF4 A;  5LGT A;  5D6E A;  5IT3 A;  2V1X A;  5HVQ C;  2WWY A;  4KIB A;  3HTS B;  3I71 A;  3AAF A;  1LDD A;  1ZGA A;  2AS5 F;  4A6D A;  2EFO A;  3P9I A;  3LA3 A;  3CDH A;  1IN4 A;  3CUQ B;  4FHT A;  1IN6 A;  1U5T A;  4MHG A;  3RKY A;  3L00 A;  1P6R A;  3LFK A;  2PBI A;  4FT8 A;  3F6O A;  2A6E F;  1R00 A;  3M1E A;  5AON A;  2EA4 A;  3M7G A;  2RVC A;  5JHU A;  2W57 A;  2ZNZ A;  3OV8 A;  5HOO A;  1OPC A;  2L4A A;  4P9F A;  5LEK A;  1FC3 A;  5J8F A;  5L3D A;  2GIV A;  4S05 A;  1ZLJ A;  3J7A O;  5L3C A;  2XKP A;  2LNB A;  2Z33 A;  1D8J A;  1F9N A;  4I01 A;  2A6H F;  3LWF A;  3MWM A;  1KQ9 A;  1R1V A;  4HZF A;  5LEJ A;  2HOE A;  1XN7 A;  4AD9 A;  1EH8 A;  2A5Y B;  3I5U A;  2D1H A;  1FX7 A;  3QPH A;  3HSR A;  3KP2 A;  1EH6 A;  4HBL A;  1O3S A;  3VFZ A;  3HRS A;  3IKT A;  3RKX A;  2K27 A;  2ADU A;  5H6Q A;  3JTH A;  1WSU A;  4RS8 A;  4ZYG A;  1FPQ A;  4KIF A;  2V6C A;  2VXZ A;  1BI0 A;  5LHG A;  2YU3 A;  4P96 A;  1H9T A;  1PP7 U;  1MJ9 A;  4AIK A;  1JXS A;  4JBA A;  1DPR A;  1S7O A;  4L5I A;  2L01 A;  3WTV C;  4S04 A;  1B4A A;  2QYO A;  1XGM A;  5HDN A;  3EYI A;  4IVN A;  1R1T A;  4A0X A;  1J59 A;  5CVU A;  2RC4 A;  1D8K A;  4HV6 A;  4R1H A;  1WRJ A;  2CW0 F;  4CIC A;  1NHA A;  2D1V A;  2ISZ A;  2JPB A;  1L0O C;  4CYD A;  2PJP A;  1GVJ A;  3DF8 A;  6PAX A;  1IN7 A;  3KP6 A;  3WU0 A;  4BHP A;  4WXH A;  2W25 A;  3KP7 A;  3FXR A;  3J80 Z;  1R22 A;  5E17 F;  1BI1 A;  3GEZ A;  1YO5 C;  3L2C A;  3ZMZ A;  3GX4 X;  4RB1 A;  2LDU A;  4M9S A;  3DXJ F;  3TO9 A;  4UVA A;  3IRR A;  2VON A;  2P5K A;  1RZ4 A;  1O3Q A;  4RGR A;  2Q8K A;  1ONV A;  1IN8 A;  2Y0M A;  2H6C A;  1HKS A;  4BXU A;  1R7J A;  1ZRC A;  2XRN A;  4R8H A;  4EMS A;  5FFX A;  4I2O A;  5E8I A;  4G94 A;  2WC2 A;  3GUD A;  2HYG D;  4MEY F;  3MAJ A;  3JSO A;  3HHG A;  3KEQ A;  1JHH A;  1HW1 A;  2VBY A;  3IHU A;  1AOY A;  3T0Y A;  3TGN A;  1FYK A;  3I53 A;  2GZW A;  1JE8 A;  1FWZ A;  2ZKZ A;  1HKT A;  1TQP A;  3M8F A;  4OOI A;  2QBY B;  4ESB A;  1XDU A;  2FBH A;  2W24 A;  2VOO A;  2A61 A;  4WXD A;  4G6Q A;  1QZY A;  2H94 A;  1HXD A;  1SMY F;  1WI9 A;  2RNJ A;  2KJB A;  2MLG A;  2BV6 A;  3E5Q A;  2EJR A;  5F64 A;  1J75 A;  4OIO F;  4DQ2 A;  3GFJ A;  2QM3 A;  4EGZ A;  1XSX A;  1R23 A;  4ENN A;  3WE3 A;  2O03 A;  2GXG A;  3ABT A;  4L0Z B;  1SFE A;  2EFQ A;  4P55 A;  3BJ6 A;  3V7C A;  1YQA A;  1K78 A;  3QU3 A;  4OIR F;  1KYZ A;  4GXO A;  2NRA C;  3MZY A;  1JHF A;  4G6D A;  1U5T C;  4HX7 A;  1O57 A;  4EVI A;  2JT1 A;  4RGU A;  4HQM A;  4PDK A;  3CTA A;  3GWZ A;  1ZRF A;  3ECO A;  1CF7 B;  1R58 A;  5LHI A;  4O6J A;  1FYL A;  2UXX A;  2H27 A;  1T0F A;  2Q0O A;  1QPM A;  2XUB A;  3LST A;  1SFX A;  2EFW A;  2FNA A;  3WU1 B;  1S29 A;  3SXY A;  3FXQ A;  3MQ0 A;  3BP8 A;  4WXC A;  1FP1 D;  2KIM A;  2NNN A;  4A5N A;  4EM1 A;  5D4R A;  2HWV A;  3B73 A;  2EFP A;  2V1U A;  1KQ0 A;  2X0L A;  1P92 A;  3WGH A;  1ZRE A;  4R79 A;  2K86 A;  1IRF A;  3N4M A;  1TQI A;  2GA1 A;  4Y15 A;  1UHM A;  2CSO A;  3ROU A;  4UV8 A;  3DQV C;  1ZAO A;  3QAH A;  1O3R A;  2DFI A;  2M45 A;  3Q5F A;  2FSW A;  1SD6 A;  2GA2 A;  1SFU A;  2FEZ A;  1XSD A;  2OZ6 A;  2H6B A;  3RPQ A;  1ZG3 A;  2FOK A;  3L9F A;  2XHK A;  4EGY A;  1LDJ A;  1XB4 A;  2D2W A;  4L9J A;  1YS7 A;  4FX0 A;  5L3E A;  4KDP A;  2CWE A;  4RAZ A;  5L3G A;  1BJA A;  3QPT A;  1G3T A;  1P2F A;  3IRQ A;  3EET A;  3BJA A;  3CUO A;  2UXN A;  4ESJ A;  4OMY A;  2LSO A;  3FZV A;  3ZMS A;  3JAM K;  1UCR A;  3C18 A;  5CVR A;  4KMF A;  2ZME A;  1LVA A;  3F8M A;  1RUN A;  3G73 A;  4LLG F;  1KYW A;  3RYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...