2BBYA

Dna-binding domain from human rap30, nmr, 30 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
RARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAP30
publication title Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 14
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02270 TFIIF_beta TFIIF, beta subunit HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bbyA00
2Z9OA 2QQ9A 2P5LC 2PQ8A 4BQAA 2FBKA 1FBUA 3F8NA 1OMIA 4HV6A 2QLZA 3BJ6A 2DQRA 3IL2A 5LGUA 5LGTA 2BGCA 5HVQC 1D5VA 3FX3A 4QWQA 1FBSA 1IF1A 2P6SA 3HTUA 3CLOA 3ZPLA 4M9ZA 3C1DA 2LKPA 3PFIA 4RGSA 3EYIA 1FY7A 1QZYA 5AIQA 5ILSA 2KRFA 3I4PA 3P9IA 3HRSA 2JSCA 3VOEA 2YR2A 3KLOA 1R5HA 5K5RA 3HYIA 4S04A 1ZHFA 1OPCA 4KNYA 1XCBA 2ZCWA 1QPMA 1ZLJA 2W57A 5DD8A 3HRUA 1ODDA 5LHGA 1F4KA 4AIHA 1ZRFA 4JK1X 4OOIA 3DPLC 5FO5A 3LWFA 3F72A 1V3FA 1D8JA 3JAMZ 1EV7A 3WTZA 1B9MA 4HF1A 1JGSA 3U2RA 4EGZA 3F8FA 4KFCA 2DW4A 3BPVA 1R23A 3GFIA 2KJCA 1ON2A 1T2KA 3E6DA 3ZMUA 3F21A 2KIMA 1IN6A 5LEJA 1O7FA 5CYVA 5JHUA 4ASNA 2XV4S 1ULYA 4IRGA 3V4GA 1V4RA 1UFMA 1XGMA 2VOPA 1OR7A 5D5UB 4U0WA 2XIGA 5E18F 2H6BA 2FMLA 3K0LA 4NQWA 2KIFA 3N4MA 3H92A 2GWRA 4LLGF 1DUXC 4OIQF 2XAQA 4IHSA 5DV5A 1SD4A 2YSRA 3KEQA 1IXRC 3L09A 1HW2A 1WQ2A 4HA8A 3CUQC 1I6XA 4YFKF 4UV8A 1IXSB 2D2WA 2OZ6A 5HLIA 2CWEA 1HW1A 1I5ZA 3V8KA 3VFZA 2PG4A 4L9JA 2LF7A 3WTYC 3D0SA 3KP4A 3WU1B 3R61A 3GX4X 3SZPA 1UHMA 1S29A 3F8CA 3M8FA 2P4WA 2BEOA 4E70A 2DT5A 4CHUA 3I59B 2O03A 3NEUA 2MLKA 4Q47A 4QLCU 3DPTA 1IN7A 4XLNF 3BOQA 5FFZA 4MTDA 2RQPA 2EFWA 4R79A 1T38A 4I01A 1A04A 1GVJA 3GW2A 1B6AA 2OAZA 1TW2A 2K7LA 4ZYDA 3BJAA 4AWXB 2MH9A 1W7PD 2UWMA 3IKVA 4M71A 1AOYA 2V1UA 1XMAA 3KP5A 5HLGA 3GXOA 2HYGD 4L5JA 2W25A 5DD4A 1BOAA 3ERED 3K9TA 2VODA 2D1VA 2K27A 2QBYA 2IT0A 4EQQA 3REOA 4OMYA 5LHHA 2JPBA 1P4AA 4A0XA 4ESFA 4RGXA 1FX7A 5KVRA 3TGNA 1ON1A 1R00A 2TDXA 2CGPA 3FWEA 1KGSA 4EGYA 1MKMA 2V1DA 5LRRA 2MLGA 3BROA 4M6YA 3GVAA 3CO7C 2VBWA 2HS5A 3NRVA 4EJOA 3ZMTA 4LFUA 4KUMA 1YO5C 3HUGA 2DI3A 5DUKA 2QWWA 2GA2A 4KICA 4DNCA 5L3EA 3OV8A 3JW4A 2K02A 2VBZA 1ZLKA 1FP1D 2FF4A 5DUIA 1KU9A 2XAFA 5ED4A 4KMUX 2COMA 3ZMVA 2W84A 4ESJA 5ILVA 3PQKA 4M6XA 3ZMDA 3BZ6A 3IRRA 2VBYA 1DP7P 4HX8A 2H94A 3I54A 5LBQA 3I64A 3GF2A 2L4AA 3LSTA 2O0YA 4G9YA 4YFXF 4LB6B 1JXSA 1YG2A 5TJJA 1DPUA 4OIPF 3EETA 4TV7A 1FYLA 5H6QA 3P7NA 3EDPA 2IVMA 1TNSA 3KCCA 2QQAA 3FXQA 3J80K 4MTEA 1FBQA 3RPQA 4HYEA 4N9HA 4DQ2A 1XN7A 4HX7A 2GXGA 2EV0A 2VOOA 1HBXG 3O2PE 2B0LA 3K2ZA 3K69A 4GCVA 5K5OA 4CDGA 2P5KA 4HF2A 2O8XA 4RS8A 5E1ZB 3F6VA 5F1RA 1Z7UA 3WTWC 2L3DA 3FXRA 5D6FA 4LG0B 4ETSA 1ZGAA 4U7BA 5FD5A 4R8HA 5D5XB 1BC7C 3WE3A 3KFWX 2Y0MA 1J59A 3WTXC 4KDPA 3HIFA 2OQGA 5DCFA 3R0JA 1PP7U 1BI0A 1WRJA 2M30A 3HHGA 4ZH4F 1J9IA 1WWXA 4RB3C 3WGGA 4EM1A 1QQIA 2G9WA 4GGGA 4UNOA 5ICGA 4RGUA 1LB2A 3LAPA 1RUOA 1O3TA 2F5FA 2VONA 2L02A 1HKSA 1J7KA 2EJRA 4I0AA 2ZFWA 4XRFA 3CUOA 4UUVA 1KYZA 3N97A 2O61A 2IJLA 3DF8A 3JSPA 1MDMB 1T39A 1ZRCA 5BPDA 5EEGA 3F23A 2XUBA 3R6SA 1SD6A 3GZ6A 3MZHA 2P5VA 1D3YA 1WKMA 3J81Z 2HQNA 4UVBA 3RYPA 3U1DA 4PZJA 1G6NA 1MD0A 2PBIA 4M9XA 2MC3A 1BIBA 4OMZA 3ECHA 2FRHA 1MJBA 2XGXA 2XRNA 1O57A 1YW8A 4OIRF 4N0BA 2DAOA 1W4MA 2F5EA 5L3BA 4AVPA 1CF7A 4LG0A 4YIFA 1SMYF 3R60A 4KA4A 4S05A 4ZYEA 2NAZA 1SFEA 3MAJA 1R22A 1USSA 2NNNA 4HLXA 2YU3A 4P9FA 1B59A 4EV0A 2FBHA 4A6DA 4YIIA 4EVIA 2ZXJA 2PEXA 3I71A 1QGPA 3RDIA 3F8BA 6PAXA 4HX4A 2VC0A 2ACJA 4HZFA 1LVAA 4O6JA 1P4WA 4BH9A 4BYYA 4KT5C 4RB0A 1TW3A 3JAMK 3GFJA 4FHTA 1IRGA 4A6EA 5FLXK 5L3CA 5E1WA 1MDMA 5K1YA 3DXJF 1ZARA 2ZKZA 1CGPA 1XGSA 3WTTC 1U6GA 2FEZA 1K6OA 3ZN1A 4P96A 4ENMA 3KZZA 4OU0A 1D8KA 4EMSA 4WF2A 2XKOA 1EH7A 2STTA 3MEXA 1U8RA 2ZNYA 2CO5A 3F6OA 1FLIA 3TO6A 1FPQA 3RIRA 4MQ9F 3F22A 3IRQA 3RKWA 4G7ZF 4I7HA 3ZMZA 4EM0B 1S7AA 1YYVA 2XROA 4A12A 4HDUA 4LGWA 4MHGA 1YIOA 1HXDA 3R0AA 2NNYA 1HKQA 3TKYA 1UB9A 2JRTA 4HF0A 4ZZLA 4R1HA 3FHZA 3F8MA 3WTUC 1W7PB 3CTAA 3V8LA 3BP8A 4NHJA 4CXFA 4GXOA 5BMZA 4L0YB 5L3FA 2R7FA 1J75A 1W5SA 3P9KA 4Q4ZF 2ESHA 4XLPF 2HFHA 4EM2A 1H0MA 4IJAA 2IP2A 1O3SA 2MD5A 2HQRA 4U0YA 5ICCA 1O3RA 3WTVC 1IXCA 5F6FA 2EFOA 4LK0F 1F5TA 5K5QA 4UHTA 1TLHB 5LHIA 2P6TA 3SHFA 3HSEA 1BN5A 1SMTA 1LDJA 4RB1A 3PQJA 2NRAC 3I5UA 3SQNA 1YTYA 2P8TA 3H3UA 4HV5A 4L9NA 5D8LB 3HOTA 4G94A 4F7ZA 3NQOA 2A3SA 3ABUA 4FX4A 1IN8A 2HTSA 4KN7X 5H20A 5AIPA 1Z6RA 4BHPA 1NHAA 3K1NA 4I0BA 4ESBA 2IRFG 1I1GA 1SFUA 1YS7A 3GWZA 2ELHA 5DEQA 2MA3A 1XDUA 1IN4A 1E2XA 5D8KB 2DTRA 2Q8KA 3KETA 3AAFA 2HYFA 1KQ9A 1I1SA 3GFMA 4Z2YA 1W7PA 2K4BA 2OZUA 3T5XA 1FC3A 2QBYB 4ON0A 5JR3A 3T1BA 3G73A 1H9TA 3ZP5A 3T0YA 4EJVA 4CGZA 5HDGA 5LRSA 2DQLA 3IC7A 3VB2A 1KA8A 2JZYA 5HS7A 2FQ3A 2BV6A 1XGNA 4M73A 2UZKA 4UVAA 2XAJA 3T8TA 2ZBKA 4UXNA 2VT2A 1KQ0A 2V1XA 1JHFA 2D45A 1G3YA 4HQMA 1HKTA 1G4DA 1B1BA 1L3LA 5ERIA 1OKRA 1TQIA 1XDSA 4Q48A 1R5GA 3BJOA 5D4SA 2VN2A 4G8XA 2HTJA 2XAGA 3QP5A 1LQ1A 1KU7A 3QOPA 2M87A 4WX9A 1JHHA 2AS5F 4Q5SF 3L7WA 2GQQA 3V7CA 4BAYA 2HOEA 1UHWA 4IVNA 2WTEA 4ZZDA 2HDCA 4M72A 3V7RA 4YFNF 3ISPA 3O6BB 3BDDA 3ABTA 2QENA 4N9IA 1LDDA 4AD9A 5KK1A 2EB7A 5J8CA 1R1UA 4L9TA 4PDKA 4WCGA 2QZ8A 1XGOA 1Z1DA 1OYIA 2QQBA 3GO5A 1J0RA 1YW7A 4AIKA 1WI9A 1FP2A 3E97A 1FZPB 1STZA 4JQFA 1R1TA 2AXLA 2A6HF 2PMUA 2Z99A 2A6EF 5JFRA 1KQ8A 4ENJA 4G6DA 4IPAA 3QU3A 4B8XA 4L18B 2FMYA 2XVCA 1XSVA 4U88A 2PJPA 1ZREA 5TRDA 2FBIA 5FFXA 2GIVA 3EQLF 3CUQA 3K1PA 2Y75A 4RAZA 2M5WA 2YX4A 1I27A 5DDGA 4HBLA 4G7HF 1C0WA 2J5OA 4H0EA 3FZVA 5EEHA 2GA1A 4UV9A 2DFIA 3B02A 1U3EM 3P9CA 3WGHA 2OD5A 1RI7A 1PUEE 2VBXA 3W6KB 4G7OF 1MJ9A 2ETHA 2WWYA 1R36A 1E17A 4I2OA 1QO0D 3ZN0A 1BBYA 4I09A 3RKYA 2MBFA 1L0OC 4WXCA 4CYDA 4A0YA 5E20A 4CZZA 3J81K 3KZYA 3IWFA 3E5UA 2P7VB 1U78A 2E1CA 2O6GE 1ZG1A 1XMKA 3ML6A 4Y15A 2GZWA 3WGIA 1CF7B 4U7DA 1FSHA 3DP7A 1GHCA 1O3QA 1MGTA 3RJPA 2E7WA 1OYWA 3JSOA 3MQ0A 5CVRA 5CVJA 3E6MA 2DBBA 2RNJA 1FNNA 2G7UA 4BXUA 4HDVA 2QVOA 2H6CA 2OQRA 1FWZA 3C18A 2FNPA 2DO7A 4RGRA 5JI6A 3KE2A 3TDZC 2IA0A 2EV5A 2M8EA 4YG2F 3J7AO 1R7JA 1T0FA 3KP2A 3W6JB 3HRTA 3MZYA 5DCMB 1YS6A 5L3DA 5HOOA 2XAHA 3J80Z 2XHKA 5CVVA 1ZH5A 3DKWA 5HDNA 1W5TA 5FD6A 5CVUA 4D0PA 2OA4A 4UVCA 1Y0UA 3LA3A 2NYXA 3F3XA 3ROUA 2Z5UA 2A69F 2X4HA 5HS8A 3RKXA 4CO8A 3RYRA 3HOSA 1U5TB 2WV0A 1P92A 4P9UA 4PGGA 4U0VA 2RC4A 4WXHA 2ZMEA 5IT3A 3WG9A 2QM3A 5ILUA 3SXYA 1R1VA 1F1ZA 1ZG5A 3E5XA 1IZ1A 2IA2A 3FF5A 2PLYA 2M1BA 3L9FA 1O7LA 5LEKA 2EFQA 1PDNC 4IF4A 5DCMA 3Q9VA 4LMYA 1HQCA 3FMQA 1Z6TA 1ZN2A 4BHBA 5D6EA 4L9VA 2W85A 2H27A 4I02A 2Y48A 4CICA 4M9SA 2FNAA 4G6QA 2VE8A 2KIUA 1FYMA 1K7AA 2Q0OA 1DDNA 5HLHA 2A68F 4EJWA 2PN6A 3M7GA 5J8FA 4LD5A 1U5TA 1AWCA 5D5WB 3VEPA 5A2QZ 2G7HA 2PFBA 2YX7A 1FSEA 3RPUA 1ZRDA 5JVTA 3QAHA 4A0ZA 5IT9Z 2HZTA 1IW7F 1REPC 2IPQX 2E7XA 2FSWA 3QP6A 4Y13A 5LLQA 2EFPA 2LNBA 3KP3A 1RZ4A 3GYHX 3V7SA 3LQRA 4XSZF 3TOBA 3M9AA 5E8IA 2E1NA 2D1HA 1FOKA 2Z3YA 2BE5F 2J5PA 1YW9A 3JTHA 3WE2A 1RUNA 2HR3A 1G3TA 5DYMA 2L01A 3E6CC 2EA4A 4GYIA 1H9GA 1IUYA 1JE8A 2CG4A 1K79A 2VT3A 2KJBA 2V6CA 4KIGA 4JBAA 5FLXZ 4BHCA 1XSXA 1MZBA 2CQKA 1LEBA 1G3SA 3G3ZA 5CLSA 3IHUA 2EV6A 1J2XA 1Z9CA 1EH6A 4ZYGA 3CO6C 5ICEA 1GXPA 2OU2A 1MJAA 2QUFA 2DLLA 3IWZA 1KU2A 2L54A 4MEXF 3RTRA 2ADUA 2Z33A 1SAXA 4HLYA 5CVIA 2ZJ2A 3FMRA 1B4AA 2UXXA 2K4JA 3KP6A 3C7JA 4A5MA 1ONVA 1TTYA 3WU0A 2ISZA 3GLXA 5ICFA 1TQMA 3C3WA 5D5VB 1TNTA 3E6BA 4Y17A 4RAYA 2RVCA 1HSTA 4IHTA 2V79A 3FM3A 5E1XA 3H3ZA 4MQVA 4I98B 2W24A 3SZTA 4ZYHA 2LSOA 2LF8A 2HGCA 1BM9A 2JTVA 1FT9A 1BI3A 5F64A 1LEAA 3TO9A 1YFHA 4P5OA 3M8EA 2DK8A 2H09A 3MFKA 3LA2A 4WWCA 4BNCA 4B09A 2EFNA 1BIAA 2FU4A 3TDUC 2F5CA 3DV8A 3WTSC 2HKXA 2A07F 2X0LA 2QYOA 1BC8C 2HEOA 4KN4X 4LJZF 5BPIA 5HS9A 3MWMA 2UXNA 3DFGA 3Q5FA 4EJUA 1ZG3A 3HSRA 1P6RA 4ENKA 4A2UA 3BPXA 3WODF 2VC1A 4IRHA 1B9NA 2CSOA 3CUQB 3LQQA 3HRMA 2RN7A 3BY6A 1FYKA 2RV8A 3GUDA 3I58A 1X3UA 3TOAA 2K86A 2F5DA 1T98A 4OINF 4L5IA 1ZYRF 1WSUA 3M1EA 3CJNA 1F9NA 1QBJA 2HWVA 2A5YB 3GFLA 3QRFF 4GO1A 4LLLA 1XSDA 3TO7A 1Z05A 3I53A 1S7OA 1XD7A 1Z91A 4GYGA 3KP7A 3EUHA 2R7DA 4AIJA 2L4MA 5D4RA 2P7CB 3E5QA 3QPHA 4MGRA 3I0TA 4XSXF 3MCZA 2GAUA 3ZQ7A 2KKOA 2PI0A 4LB5A 3VODA 1EH8A 4M74A 5H6RA 3K1MA 2O3FA 4KIFA 2DPUA 1P2FA 4OIOF 5BS6A 3I59A 1YLFA 3CDHA 4IXAA 2DK5A 2FOKA 4A5NA 1RIOH 2F2EA 4LK1F 4LLNA 3Q9SA 3JTGA 1LJ9A 1LDKB 1BJAA 3BWGA 1IAWA 4K2EA 3TQNA 2OBPA 2C6YA 2ZO4A 4MEYF 1Q1HA 3KLNA 5E17F 1QZZA 3LAJA 2WC2A 2RKHA 2M45A 2R3SA 2EA2A 1J5YA 4KIBA 2DU9A 2MH2A 2RDPA 2VXZA 4ENNA 1S6LA 2XKPA 5BQTA 1IN5A 1R58A 1SFXA 2EWNA 1ZAOA 5CJ9A 4RB2C 4NB5A 2A61A 1USTA 1K78B 3QU6A 4O5VA 2BBYA 1BI1A 3R4KA 3OOPA 3U9GA 4WK8F 3COAC 5J6XA 3ECOA 3ULQB 1T6SA 1TQPA 3QPTA 2CFXA 3T8RA 2DPDA 2ZMEB 2YPRA 1S3JA 3S2WA 5E8GA 2JPCA 3V8JA 3GZ5A 2FXAA 3D5LA 1XB4A 3B73A 2NS0A 4KYWA 2IW5A 1LNWA 3KEOA 3RI4A 1IRFA 5L3GA 2FE3A 2XASA 3HHHA 2HKOA 3LA7A 4HQEA 4PCQA 4PGHA 1VTNC 2PMHA 1U5TC 3HTSB 4FX0A 1XCVA 3LFKA 5FB2A 3IKTA 2Q2EA 1OYYA 4HAMA 2RGVA 3SFZA 1KU3A 3ELKA 2GXBA 1RNLA 4IRIA 3DQVC 1P4XA 1K78A 4O3MA 1G3WA 3FMSA 3FM5A 1DPRA 3FXUA 1KYWA 3L2CA 2LDUA 2IA1A 2VE9A 3E3VA 1ZGJA 1HW5A 1U2WA 4P55A 5A2QK 2ISYA 2STWA 2BYVE 4MNUA 3HSFA 4HW0A 2CW0F 4L0ZB 5IT9K 4XBFA 4WXDA 1SD7A 3O3KA 3GEZA 1HSJA 2CYYA 3DEUA 4FT8A 2ESNA 4HOBA 2ZNZA 1GXQA 4EJTA 2V9VA 1QNTA 5FGMA 1PP8F 5AONA 5BOXA 5HDKA 1BI2A 3L00A 1SD5A 1TBXA 4KMFA 2JT1A 2FA5A 5LGNA 1YQAA 1UCRA 3EYYA 1S8NA 2EK5A 3ZMSA
chains in the Genus database with same CATH superfamily
2Z9OA 2QQ9A 2P5LC 4AYBA 2PQ8A 4BQAA 2FBKA 3CCRI 1FBUA 2E5NA 3F8NA 1OMIA 4HV6A 2QLZA 3BJ6A 2HPIA 1YITI 2DQRA 3IL2A 4XKBA 5LGUA 2F4MB 3PNYA 2HI3A 4XLCA 5LGTA 3CDLA 4PJMA 3S32A 3ZQFA 2BGCA 1TWGJ 5HVQC 2CFOA 1D5VA 3GCMA 1D0YA 3FX3A 4QWQA 2LY2A 1N77A 1FBSA 4LITA 3ABMH 1XMXA 4UB8C 2VKDA 1IF1A 3K70D 2Y31A 2P6SA 3HTUA 3CLOA 3PNTA 2OV7A 4U87A 3ZPLA 1JGGA 3IAM2 3VSLA 4M9ZA 3C1DA 2LKPA 5EG0B 1ETQA 3PFIA 4RGSA 3EYIA 2L7KA 2K85A 2JRMA 1FY7A 5GPAA 1QZYA 5AIQA 2JN6A 5FKOA 5FKLA 1JJ8C 4AM3A 1HLVA 5ILSA 1RR8C 2E2IJ 2KRFA 3I4PA 3P9IA 3HRSA 2JSCA 4RAFA 3JRAA 3VOEA 3LSJA 2YR2A 3GMEA 5GPCA 3RZOJ 2PMZA 3KLOA 1R5HA 3L2VA 1ETVA 3AFHA 5EZHA 5K5RA 3HYIA 4S04A 2E34A 1ZHFA 1LFBA 3ZQCA 2VIXA 1OPCA 2YUSA 4KNYA 1JUSA 1XCBA 2ZCWA 1QPMA 1ZLJA 2W57A 5DD8A 4D9JA 1VQMI 4F93B 3HRUA 2COBA 1ODDA 3ESWB 2GXAA 5LHGA 1F4KA 2YS9A 3DEWA 4E7HA 2E1OA 3NWSA 3KPHA 2ME6A 4AIHA 1ZRFA 2XSJC 4JK1X 4OOIA 3DPLC 5FO5A 3LWFA 4BE1A 1EF4A 2TCTA 2W48A 3F72A 1V3FA 1D8JA 3JAMZ 1B72B 5B3SH 1EV7A 4IHWA 5B5EC 3WTZA 1B9MA 5FLMJ 4HF1A 1JGSA 2ZSIB 2CV2A 3U2RA 3HOWJ 4BBRJ 4EGZA 3F8FA 3BCAA 4KFCA 2DW4A 2I10A 4FQGA 2B63J 5F0CA 3BPVA 1R23A 1RESA 4XKWA 1Q1VA 5CPRB 3GFIA 2X85A 4QTRA 3JREA 2KJCA 1ON2A 1T2KA 3X2QH 3E6DA 3ZMUA 3F21A 1MNEA 2H8RA 2JMWA 3OYBA 2KIMA 5E3LA 4AYBN 1IN6A 5LEJA 5CKTA 2QA4I 1O7FA 5CYVA 5JHUA 4CCLA 4ASNA 5E3OA 2XV4S 3H36A 2FD5A 2IBDA 1X1PA 2N8GA 1ULYA 4IRGA 4B43A 4IHXA 1IV8A 2VL8A 3V4GA 1V4RA 1E3PA 5GTHC 1UFMA 5F0HA 4BQOA 1Z0XA 1XGMA 4XOPA 2DJNA 2OUMA 5E3MA 2VOPA 1OR7A 5D5UB 3SFIA 3K4MA 1OJLA 2F5VA 2XIGA 4U0WA 5CQEA 4XLHA 1EA3A 5E18F 2H6BA 3BG7A 1BR1A 3BCBA 2FMLA 3K0LA 4NQWA 1Z7LA 2CS3A 2KIFA 3N4MA 2ELJA 3H92A 3K4BA 2GWRA 1WHUA 2FX0A 4LLGF 2V6EA 1DUXC 2A6TA 4OIQF 2XAQA 4Y7NJ 1WGXA 4IHSA 5DV5A 1SD4A 2H1KA 2YSRA 3KEQA 1IXRC 2WB1A 3L09A 3AG2H 1HW2A 1ACIA 1MSEC 3IUOA 2VQGA 1WQ2A 4HA8A 3CUQC 1I6XA 2PMZN 2Y69H 1R71A 4YFKF 4UV8A 3U1KA 1IXSB 2D2WA 2OZ6A 1A6IA 1W0UA 2IS1A 5HLIA 5IP9J 2CWEA 1HOMA 1HW1A 1I5ZA 2DYRH 3V8KA 3VFZA 2PG4A 3J7YJ 3RKQA 4L9JA 2LF7A 1UG2A 3DLAA 3WTYC 1D0ZA 3D0SA 3C2GA 3KP4A 3WU1B 3R61A 3GX4X 2R4GA 3SZPA 1UHMA 2E1MB 1XPXA 3D5RC 1S29A 4FASD 3F8CA 2VQCA 2P4WA 2DOFA 3M8FA 2BEOA 2EINH 4E70A 2DT5A 4XIDA 1FJLA 4CHUA 3I59B 4X1EA 3PSFA 3S16J 1QU3A 5B1BH 2O03A 3KYCB 3NEUA 3HUGB 4J00A 2MLKA 4A93J 1D1BA 4Q47A 2HVRA 4QLCU 3DPTA 1IN7A 4XLNF 3P5JA 3BOQA 5FFZA 3A03A 2GOXB 4F3QA 2ZB9A 4MTDA 2RQPA 4ZDLA 2EFWA 3GTOJ 3HM5A 2HYJA 3BG3A 4R79A 3DLLF 1N75A 4D5CA 1JKPC 1T38A 4I01A 1A04A 1GVJA 1QHGA 3GW2A 3VWBA 1B6AA 2LTPA 2OAZA 1TW2A 2K7LA 1AU7A 1Y1WJ 4ZYDA 3BJAA 4AWXB 4G6TB 2MH9A 1W7PD 4B1RA 5DM6F 2UWMA 5E3NA 3J7ZI 2X51A 4E6KG 3MZ8A 3IKVA 2E60A 4M71A 1AOYA 2V1UA 1XMAA 4LOCA 3KP5A 5HLGA 3GXOA 4NC8A 2DOEA 2HYGD 3RZDJ 2OCEA 3ZGKA 4BUPA 5FRMA 2R7SA 1P7JA 1YHQI 2K40A 4L5JA 2W25A 1JUMA 5DD4A 1BOAA 3ERED 1EKEA 3K9TA 1SC7A 2IS2A 2M34A 2VODA 2D1VA 2K27A 2X6WA 2EQRA 2QBYA 2IT0A 4Y3OA 4EQQA 3REOA 4UUSA 4OMYA 3PNVA 5LHHA 1ETXA 1X2MA 2JPBA 1P4AA 1RC9A 4F91B 4A0XA 4ESFA 1BOBA 4RGXA 1FX7A 5KVRA 3TGNA 2Y9ZA 1ON1A 3CCLI 1XX5A 1R00A 2TDXA 2CGPA 4B47A 3FWEA 1KGSA 3LOCA 1Z3YA 4EGYA 3RCOA 2KZGA 3FXKA 1MKMA 2V1DA 5LRRA 2OTLI 2KISA 1MMGA 5TGTA 1Z67A 1IUFA 4X0GA 2MLGA 3BROA 4M6YA 5EEAA 4A3IJ 3GVAA 3S3NA 3CO7C 2VBWA 2HS5A 3NRVA 3LFUA 4EJOA 3CP8A 4EATA 3ZMTA 2CW7A 3OIOA 4LFUA 4KUMA 1YO5C 3HC7A 3HUGA 2DMUA 2DI3A 3VYSB 1XG1A 5DUKA 2VJIA 1YJWI 5JLWA 1FTZA 3IP4B 2QWWA 3G4SI 2GA2A 1T0FC 4KICA 4DNCA 4PK4A 5L3EA 3M1CA 3OV8A 3JW4A 2K02A 4HNVA 3VYRB 5HLTA 2VBZA 1ZLKA 1JTXA 2BZTA 1FP1D 2FF4A 5DUIA 1KU9A 2XAFA 4C30A 1RR7A 4XLFA 4NC7A 5ED4A 3DU6A 2PJRA 2DT6A 4A3CJ 4KMUX 2P0WA 4B3AA 2COMA 3ZMVA 2W84A 4ZJZA 1KZHA 4ESJA 3BQYA 5ILVA 1X1DA 3PQKA 4M6XA 1JKQC 3ZMDA 3BZ6A 5IPAA 3IRRA 2Z1DA 1V5EA 1G2HA 2VBYA 1DP7P 4HX8A 2H94A 3I54A 4N4OB 3I64A 4DBRA 5LBQA 3GF2A 2L4AA 3LSTA 2O0YA 2RNGA 3CZ6A 4G9YA 4LB6B 4YFXF 1JXSA 1YG2A 4JX6A 5TJJA 1DPUA 4ANJA 4IQJA 4OIPF 1TWHJ 3EETA 2HVQA 4TV7A 5H6QA 3P7NA 1FYLA 3EDPA 2IVMA 4BU2A 2XDVA 1TNSA 4KITB 3KCCA 3KYLA 2QQAA 3FXQA 3HZJA 4JOMA 2Q2EB 3FK6A 2DDBA 1B8IB 1N25A 3CCYA 3J80K 2KL4A 1UMQA 2ZMEC 4MTEA 1FBQA 3RPQA 1W5CC 4HYEA 2L9NA 4N9HA 3DTIA 4DQ2A 3LSRA 1XN7A 1H8AC 3OYCA 4HX7A 2JVHA 2GXGA 3S17J 4FETA 3PUBA 2EV0A 4XRMA 2VOOA 2FUG2 1HBXG 1D1AA 3C2BA 2ZSHB 3O2PE 4BY7J 2B0LA 2AXTC 2GIZA 2E71A 3K2ZA 2DA5A 3K69A 4GCVA 5K5OA 4CDGA 2P5KA 1DU6A 4HF2A 2O8XA 4RS8A 1I39A 2AHQA 3I55I 3OYJA 5E1ZB 3F6VA 1IDYA 4JX5A 3TW6A 3ZQIA 1HDPA 4XN3A 5F1RA 1Z7UA 3WTWC 1SVMA 2L3DA 3FXRA 1X4PA 5D6FA 4ETSA 4LG0B 1WH5A 1ZGAA 4U7BA 5FD5A 4R8HA 5D5XB 2QKMB 1BC7C 1GT0C 3WE3A 3KFWX 2Y0MA 1J59A 3B6AA 3WTXC 4KDPA 3HIFA 2OQGA 5DCFA 4E7JA 3R0JA 1PP7U 1BI0A 1WRJA 3QYBA 2LVSA 2M30A 3E7LA 5GTIC 2GBYA 3HHGA 2VLAA 4ZH4F 1WI3A 1ZK8A 4GRIA 1J9IA 1WWXA 3SZGA 4RB3C 2BHZA 4XL9A 3WGGA 3CMMA 4Y52J 4EM1A 2DFFA 3G1MA 1QQIA 2G9WA 4GGGA 1R9TJ 4UB6C 5ICGA 4RGUA 1LB2A 4UNOA 3I4MJ 3LAPA 5C44J 1RUOA 1O3TA 2F5FA 2LH9A 2VONA 2L02A 5FRNA 2MABA 1HKSA 1J7KA 5IOYA 1PVEA 2AQEA 2EJRA 4I0AA 1YIJI 2ZFWA 4XICA 4XRFA 3CUOA 4UUVA 1KYZA 3QYEA 3N97A 2FOWA 1SVOA 2O61A 2IJLA 3A02A 2OPTA 3DF8A 2VQLA 3JSPA 3UKGA 4D5FA 4B4CA 1MDMB 1T39A 1PYVA 1GLNA 2UV1A 1QVUA 2DA7A 2EPFA 1ZRCA 3M4OJ 1Z3XA 2X1CA 1F36A 4HSRA 5BPDA 5EEGA 3F23A 2XUBA 3R6SA 1MBKA 3K6GA 1SD6A 5HODA 4G7OF 4JP0A 3GZ6A 1RPWA 4XORA 3MZHA 2P5VA 1D3YA 1WKMA 3J81Z 2HQNA 4UVBA 3IAS2 3RYPA 3J7AY 3U1DA 4PZJA 1G6NA 2CQQA 1MD0A 2PBIA 4M9XA 3TP3A 2MC3A 1BIBA 4OMZA 3G1OA 3ECHA 2FRHA 1TT0A 2DMQA 1WVRA 2KFDA 1X1CA 1MJBA 5IYBJ 4AUXA 2XGXA 1HDDC 2DJIA 2XRNA 1O57A 1YW8A 3JRFA 4OIRF 4N0BA 2DAOA 1W4MA 2F5EA 3BZKA 5L3BA 4AVPA 2KDZA 1CF7A 4LG0A 4YIFA 2NS8A 1Z77A 1SMYF 2WADA 3R60A 2Y30A 4M6VA 3L2QA 1LPQA 4KA4A 2QSFX 4S05A 4ZYEA 2NAZA 1SFEA 3MAJA 1R22A 1USSA 3GTJJ 2CRGA 3I4NJ 4Y4RA 3OYAA 1G59A 3V42A 3GTLJ 5DM7F 3CDIA 3MMYB 2NNNA 4HLXA 2YU3A 1VI0A 3L1PA 4P9FA 9ANTA 1B59A 4EV0A 1ETWA 2FBHA 3FBNB 2P81A 4A6DA 4F55A 2EH3A 2W00A 4YIIA 2ZXJA 4EVIA 2E2HJ 1VQNI 3ZQLA 5FKMA 1OLTA 2JUCA 3GTQJ 2R0QC 2ECBA 2PEXA 2LD5A 2F4IA 4AC0A 3I71A 1ZELA 1QGPA 2MG4A 2VPRA 3F8BA 3RDIA 2BVLA 3OSGA 1TL8A 6PAXA 4HX4A 2VC0A 1T56A 4ITVA 3TBIA 5F0FA 1JTYA 3TP0A 2ACJA 4DBQA 4HZFA 1VQ6I 3IH2A 3FK7A 2IGKA 1LVAA 4O6JA 1P4WA 4BH9A 2DA4A 4BYYA 4KT5C 3PFYA 4RB0A 1TW3A 3JAMK 3GFJA 1V5FA 1WJBA 4FHTA 4Z6YA 1IRGA 2X1EA 2K9LA 4A6EA 5FLXK 3L2UA 4X6AJ 5L3CA 4LIUA 3S93A 3JRBA 2JA6J 2R7WA 5E1WA 1MDMA 1U0JA 2L2OA 5K1YA 5J1UA 2M7BA 3DXJF 5M5XJ 1ZARA 2Z16A 2ZKZA 1CGPA 1XGSA 5IOZA 3WTTC 1U6GA 2DCEA 2FEZA 1K6OA 1FMVA 3G2BA 3OYIA 3ZN1A 3OYFA 4QSHA 4P96A 4ENMA 1T8IA 2IS4A 3KZZA 4OU0A 2QCOA 1D8KA 1MH3A 3M8JA 3PUFA 2XKOA 4WF2A 4EMSA 5EYRA 1EH7A 1U9NA 2STTA 3MEXA 1U8RA 3H9QA 1SFKA 1DU0A 1HC8A 2ZJQF 3BG6A 2ZC2A 2ZNYA 3B6CA 2CO5A 3F6OA 1FLIA 3TO6A 2O8KA 3GLLA 3ZCOA 1FPQA 2ZJRF 3RIRA 1QA6A 4MQ9F 1ITYA 2HXIA 1X3ZB 3F22A 3IRQA 4II2A 2R7RA 5IYDJ 3RKWA 4G7ZF 4I7HA 2F48A 2ZFUA 3ZMZA 2XB0X 4EM0B 3VYTB 3HL2A 4D1QA 1S7AA 4M3BA 2KPMA 1YYVA 4CCJA 1YE9A 4XM3A 3A2KA 2XROA 4A12A 1ZQ3P 2BXZA 2IGOA 3ABKH 4HDUA 2CUEA 4LGWA 4P1WA 2DFHA 4MHGA 4IOCF 4NQWB 1YIOA 1HXDA 3R0AA 2NNYA 1X3WB 5CQGA 4ABZA 1HKQA 3TKYA 4BACA 3I56I 3Q0WA 1UB9A 2JRTA 3CMYA 4XRSG 4HF0A 1Y8RB 4RM2A 4ZZLA 3W2VA 1ZKGA 4R1HA 3FHZA 2JA5J 2M8GX 3F8MA 5DTDA 3WTUC 1W7PB 2OF7A 3CTAA 3V8LA 1W36C 3BP8A 4MIMA 4NHJA 1LFUP 4CXFA 2L7FP 2JSPA 1GV2A 3BTIA 4GXOA 5BMZA 4L0YB 5L3FA 3CF5F 1LUJB 2R7FA 4IL6C 4BL0B 1J75A 4XLAA 1W5SA 3P9KA 2WBMA 4Q4ZF 2ESHA 4XLPF 1WJEA 1S72I 2QSHX 3HGGA 2HFHA 4M3GA 3G71I 4EM2A 1H0MA 1FIAA 4IJAA 2IP2A 4D7MA 1O3SA 2MD5A 2HQRA 4U0YA 5ICCA 3OOUA 1O3RA 4CCKA 3WTVC 1IXCA 4I76A 5F6FA 3RPUD 2F4OB 1ZGWA 2EFOA 4LK0F 3KZIC 1F5TA 5K5QA 4UHTA 4D7NA 1TLHB 5LHIA 2CMPA 2P6TA 3SHFA 1UZCA 1FOYA 2GM4A 3OIQA 3S3OA 2M3AA 1Y8QB 3HSEA 1BN5A 1VQ9I 1SMTA 1LDJA 4RB1A 2ICWG 3PQJA 2DTZA 2X1DA 3I5UA 3SQNA 2NRAC 1YTYA 1WJCA 2P8TA 2X6OA 3H3UA 2DN0A 3HB9A 4HV5A 4L9NA 4G94A 4NUBA 2L7ZA 1R4MB 3EUHC 5D8LB 2DYSH 2NVYJ 2NOJB 4F7ZA 3NQOA 4M3FA 4PFOA 2A3SA 1ZR4A 4CUGA 3ABUA 3DKXA 4FX4A 1IN8A 2HTSA 2L5QA 4KN7X 5H20A 1SEUA 5BNGA 5AIPA 3OYEA 1Z6RA 4BHPA 1NHAA 3K1NA 4I0BA 4ESBA 4E7KA 2GLOA 3CJRB 1MBFA 2IRFG 1I1GA 4C3HJ 3OY9A 1SFUA 3SYTA 1YS7A 3H35A 3GWZA 2ELHA 3H1CA 3G1LA 3D5SC 2E1MC 5DEQA 2MA3A 1XDUA 1IN4A 1E2XA 2HDWA 5F27A 5D8KB 1OCTC 2DTRA 5IP7J 1OCZH 2Q8KA 2LYCA 1S5LC 3IH3A 3KETA 3JRDA 3AAFA 1UELB 1SFOJ 4N4NB 1SAUA 2NVTJ 2HYFA 5EZGA 1KQ9A 1I1SA 3PM1A 1NG6A 3GFMA 4Z2YA 1W7PA 2K4BA 2OZUA 3T5XA 1FC3A 3DBLB 2QBYB 2L9SA 4ON0A 5JR3A 3T1BA 3G73A 1H9TA 3T0YA 4EJVA 4UUSB 3ZP5A 4CGZA 2JA7J 1K83J 2R93J 3WG7H 3W6VA 3CLQA 1HCRA 1Y0NA 5HDGA 2BW3B 5LRSA 1DGRM 2DQLA 3IC7A 4KJZA 3VB2A 3QWLA 1JUPA 3ASNH 1KA8A 2JZYA 5HS7A 2FQ3A 1IJWC 1YJNI 3S1QJ 2DFEA 3OL4A 3OWTA 2BV6A 4PJ0C 1XGNA 4M73A 2UZKA 2M4GA 3NARA 5J1YA 2IAIA 3AG3H 4UVAA 2LKSA 2XAJA 3T8TA 2BY3A 2ZBKA 4UXNA 2VT2A 1KQ0A 3VYUB 3OS1A 2MSYA 2V1XA 1JJ6C 1JHFA 2NVUB 2K9SA 2D45A 1G3YA 4HQMA 3K4CA 3HJEA 1H88C 1HKTA 2UUZA 1G4DA 1MW7A 3OS2A 1B1BA 3SEZA 4BJ6C 1L3LA 5ERIA 1NH3A 4IO9F 2LP0A 1OKRA 1TQIA 1XDSA 4E7LA 1JKOC 2EBIA 4Q48A 1R5GA 3BJOA 5D4SA 2XSDC 3JRCA 2VPLA 2VN2A 2X6YA 4XKCA 2PJRB 3SDGA 3CCVI 4G8XA 2HDDA 1MH4A 4HSTA 4DOZA 2HTJA 2XAGA 3FDYA 3QP5A 3OYNA 4ZTJA 1LQ1A 1KU7A 2RQQA 3PIPF 3QOPA 3Q3SA 2M87A 4WX9A 5TISC 3OYKA 1JHHA 3CCEI 1VF9A 1OCRH 2AS5F 3LSHA 2JVGA 4Q5SF 1K61A 3L7WA 2GQQA 3BG9A 1Y1VJ 2XGEA 3V7CA 2R92J 3MKLA 4BAYA 2HOEA 1UHWA 1AA7A 4IVNA 4V2GA 2WTEA 3H9JA 4ZZDA 4CCMA 2HDCA 4M72A 3V7RA 4DW6A 2K9QA 4AVZA 4YFNF 3ISPA 2R7OA 3O6BB 3BDDA 3ABTA 5EGOA 2QENA 3JCUC 4N9IA 1LDDA 4AD9A 2LREA 5JVGF 3BZCA 3S2DJ 1WPKA 3WHCA 5KK1A 2BW3A 2XPWA 3DTEA 2NOGA 3K7AJ 2EB7A 4II3A 1IRXA 5J8CA 3UR3C 1R1UA 4L9TA 5M3MJ 2CUZA 4C2UA 4PDKA 2F6CA 4WCGA 1NK2P 1OISA 2QZ8A 2LY1A 2QKLB 1XGOA 1Z1DA 4KISA 1OYIA 2QQBA 3GO5A 2WAEA 1J0RA 3LSKA 1OCCH 1YW7A 2K3PA 3CC4I 2E35A 4AIKA 2BVMA 1WI9A 2ZJPF 3DU5A 1FP2A 3E97A 1VQLI 2WAQA 4DIQA 1FZPB 2CU7A 2WY7Q 1STZA 3KEYA 4HEA2 2CQNA 2WA0A 1GVDA 4JQFA 1RETA 1R1TA 2AXLA 2A6HF 2PMUA 2Z99A 3DPUA 1MBJA 2A6EF 3O8HA 2R7QA 5JFRA 5C4JJ 1KQ8A 4ENJA 4G6DA 4IPAA 2IS6A 1D5YA 2HQAA 3QU3A 4B8XA 4L18B 2FMYA 1POGA 2XVCA 3QOEA 4BKXA 3TEDA 1XSVA 4U88A 1Y6IA 2PJPA 3OYDA 1ZREA 5TRDA 2R7TA 4JYKA 4OWRB 1BR4A 2FBIA 2O9LA 5FFXA 2GIVA 3EQLF 2RAEA 2FQ4A 1K4SA 3HOZJ 1IG7A 1GV5A 3CUQA 4XLEA 3DKYA 3L2WA 4HG2A 3K1PA 1XTAA 5FLVA 2Y75A 4RAZA 3ASOH 2Z2SB 2M5WA 2YX4A 4PJJA 3H3VK 1I27A 1VQOI 2LOOA 5DDGA 3CC2I 4HBLA 2IGNA 1T33A 2AQFA 4G7HF 1ETOA 1C0WA 2J5OA 2VKEA 3E1SA 4H0EA 4UUTA 3FZVA 2DODA 5M3FJ 2DDAA 3LL7A 5EEHA 2GA1A 3TMOA 4UV9A 3K4KA 2DFIA 3B02A 1IDZA 1U3EM 2XRLA 4EEFG 3P9CA 2E36A 2LC2A 1M1EB 4RBOA 3WGHA 2DA6A 2V26A 2NVXJ 3K2AA 1ENHA 5C3EJ 2OD5A 1RI7A 4IX7A 2O5RA 1PUEE 2LR8A 2VBXA 3W6KB 4HPQA 1MJ9A 2ETHA 3HPGA 5KNLA 2WWYA 5E79C 1R36A 2DXIA 1E17A 3K70C 4PFPA 4I2OA 2MGQA 3S15J 1QO0D 2WV1A 3ZN0A 1BBYA 4I09A 3GBGA 2NXNB 3RKYA 2MBFA 4C3IJ 3IH4A 1L0OC 5J4VA 2M0CA 1VQ8I 4IOAF 2EZIA 3A0HC 4WXCA 4CYDA 4A0YA 1MMNA 5E20A 4CCOA 4CZZA 1FOWA 3SJMA 1LE8A 3J81K 3KZYA 2XAUA 4IEJA 1AHDP 3IWFA 2LY9A 3E5UA 2RREA 2XPUA 2B9SA 1MSFC 1LKXA 1V54H 2P7VB 3CQZJ 1VFCA 1U78A 1A36A 1VQKI 2E1CA 2O6GE 4C9YA 1ZG1A 1XMKA 3ML6A 2L7MP 4Y15A 2GZWA 1S7EA 3WGIA 1CF7B 3F9KA 4U7DA 1FSHA 3CCSI 3DP7A 1GHCA 1O3QA 2WAQN 1MGTA 3KYDB 3RJPA 4DGWB 2KIQA 4F92B 3HKZA 2E7WA 4DJAA 3Q0VA 1OYWA 4L5EA 3JSOA 2LK2A 3BLYA 3MQ0A 2Y9YA 5CVRA 2BY1A 4ZDOA 1MBEA 5CVJA 3E6MA 3PJRA 1MNMC 3EPZA 1OFCX 2DBBA 2RNJA 3W3CA 1IRZA 3MKYB 1FNNA 1I3AA 4V19K 2G7UA 4BXUA 4HDVA 2LBFB 1VNDA 1MBHA 4JX4A 2QVOA 2H6CA 5EJCA 2IGMA 4BXXJ 2OQRA 1FWZA 3C18A 2LKXA 2FNPA 1CQTA 2DO7A 4RGRA 3ZRGA 4M3DA 5JI6A 1FTTA 3GTGJ 2E19A 3KE2A 3TDZC 2IA0A 3CD6I 2EV5A 4RMNA 3NAUA 1DP3A 2M8EA 2DT7B 2LMDA 1ETYA 4XNFA 4YG2F 3J7AO 1E3OC 1R7JA 1T0FA 3KP2A 4G12A 3W6JB 3HRTA 3AL0B 3MZYA 5GP9A 5DCMB 1YS6A 3FXJA 5L3DA 2VQHA 3SEQA 3OL3A 1QRYA 2JA8J 5HOOA 2I5UA 2XAHA 4QPQA 3J80Z 2KHMA 2XHKA 2MW8A 1R5ID 5CVVA 1ZH5A 3DKWA 5HDNA 1W5TA 5FD6A 1I6HJ 5CVUA 3S1NJ 1NK3P 2OC6A 4D0PA 2OA4A 3U21A 2KRHA 4UVCA 4XK4A 1Y0UA 2ZXWH 1KONA 2KT0A 2NYXA 2CW8A 3F3XA 1FIPA 3LA3A 4RA2A 3ROUA 4BJTA 2M0MA 3O8GA 1HA8A 2Z5UA 2A69F 2DMNA 2X4HA 3ZQQA 2E5ZA 5HS8A 3RKXA 1TZLA 4CO8A 1P7IA 1ZTRA 2JK3A 2CQXA 3RYRA 3HOSA 4DYRA 5B1AH 1U5TB 2WV0A 3HXLA 4CCNA 4BBSJ 3L2RA 3I3LA 5FJ8J 1P92A 1I3QJ 4P9UA 3HDDA 3A4CA 2XGCA 4PGGA 1WZ2A 1SVLA 3MD2A 4U0VA 4C2TA 2CUFA 2RC4A 4WXHA 2ZMEA 4YIRX 3OMYA 4F52A 4IHYA 3PIOF 1U8BA 3H5NA 5IT3A 1MMDA 5B66C 3WG9A 2DMPA 2QM3A 5ILUA 3SXYA 1R1VA 2DA1A 1F1ZA 2LBFA 5GAGJ 1GDTA 1QHHD 2HOTA 1ZG5A 5GADJ 1T08B 4BXFA 3E5XA 4RAGA 4XR6A 1IZ1A 2M9HA 5EDNA 5J3LA 3EUKL 4BEHA 3ZQGA 3N05A 4W1UA 2IA2A 3FF5A 3H5AA 5FKKA 2PLYA 2M1BA 3L9FA 1O7LA 3HKZN 5LEKA 2E2JJ 1RRJA 2EFQA 4HRIA 2HPMA 4IF4A 5DCMA 3Q9VA 1SANA 4LMYA 1PDNC 1HQCA 3FMQA 1Z6TA 3S1MJ 4M3EA 1ZN2A 4BHBA 4RLFA 1TWAJ 2DA3A 5D6EA 2H8WA 4L9VA 5K7HA 2W85A 3KX2A 4NBQA 3LSGA 2H27A 2A05A 1OR7C 3E0JB 4AU7A 4I02A 3G6EI 2JA2A 1Y39A 2AO9A 5LFAA 2Y48A 3RSNA 4CICA 4M9SA 2FNAA 4G6QA 2VE8A 2KIUA 3MN2A 2PX9A 1X4OA 4DYQA 1FYMA 3BR6A 1K7AA 3BR1A 2Q0OA 1DDNA 3GTKJ 5HLHA 3A01B 2A68F 1DGWY 4EJWA 2M2EA 2VI6A 2L9RA 2NS7A 2PN6A 4NNJA 4HNTA 1N78A 3M7GA 5J8FA 4LD5A 4CYCB 4LG3A 4FE4A 1U5TA 4XQFA 1AWCA 5D5WB 4A3BJ 5LD2C 3VEPA 5A2QZ 1R4NB 2G7HA 2PFBA 3A0BC 2QEXI 3F0CA 3IV5A 2YX7A 1IO2A 2K9MA 2KZVA 1FSEA 2GOMA 2VJ4A 3RPUA 1ZRDA 5FKNA 5JVTA 3QAHA 4A0ZA 4A3EJ 2Y0SA 5IT9Z 2HZTA 1IW7F 1UAAA 3DBRB 1REPC 2HNHA 2IPQX 2E7XA 3OYLA 4BY1J 2FSWA 3QP6A 4Y13A 1W1WE 2EZKA 3QYFA 5LLQA 2EFPA 2LNBA 3KP3A 1YJ9I 1RZ4A 4PUSA 3LQRA 4XSZF 3V7SA 3GYHX 3JRHA 2VASA 1LFPA 3TOBA 1ZR2A 1YOVB 4BE0A 5KHDA 2Q1ZB 3VPRA 3M9AA 5E8IA 2E1NA 3FXMA 1WCMJ 2D1HA 1FOKA 2R7VA 2Z3YA 4OAYA 2BE5F 2J5PA 4B44A 4BQQA 1MMAA 1YW9A 3JTHA 3WE2A 1RUNA 2HR3A 1G3TA 2I8DA 5DYMA 1QPIA 2L01A 3I9V2 2KRCA 1BA5A 2OCCH 3E6CC 2EA4A 3A1YA 4GYIA 1H9GA 4FTHA 1IUYA 3ZR8X 1JE8A 2CG4A 1K79A 2VT3A 5K7ZA 2ID3A 3HOUJ 2KJBA 2V6CA 4KIGA 4JBAA 4BS9A 5FLXZ 4BHCA 1XSXA 1MZBA 2CQKA 1LEBA 3S3MA 1G3SA 3PO2J 3BR3A 4IKFA 3UNGC 2IEKA 1UHSA 3G3ZA 5CLSA 2CQ7A 2M7AA 3IHUA 2EV6A 1J2XA 1Z9CA 1EH6A 4ZYGA 2LG4A 3A01A 1S9HA 2FJ1A 3CO6C 5J1RA 5ICEA 1GXPA 2OU2A 3PO3J 1MJAA 4CYCA 3MKWB 2QUFA 2DLLA 3IWZA 1KU2A 3S1RJ 3LSMA 1UG0A 3W2WA 2L54A 3CP2A 4MEXF 3RTRA 2ADUA 1A6QA 2Z33A 4IZZA 2HOAA 1SAXA 4HLYA 5EG0A 5CVIA 2ZJ2A 2DMTA 1O4XA 3FMRA 1B4AA 1AKHB 2UXXA 4PJLA 5H2FC 4ZTFA 2K4JA 3KP6A 3BTLA 2XC7A 2XB5A 1YX3A 5F08A 1TC3C 3C7JA 4XONA 4A5MA 1ONVA 1TTYA 3WU0A 2ISZA 3GLXA 1RKWA 5ICFA 1TQMA 4BGDA 3AKZA 3C3WA 5D5VB 1TNTA 2XF5A 3E6BA 4Y17A 4E7SA 4RAYA 2V4JC 2RVCA 1G8XA 1HSTA 4IHTA 2V79A 3FM3A 5E1XA 2EZLA 3H3ZA 4MQVA 2JQ7A 1DQUA 4I98B 2CV1A 3S2HJ 5IYCJ 2W24A 3SZTA 4ZYHA 2LSOA 2LF8A 5EGOB 1JT0A 2HGCA 1A31A 1F43A 2BY0A 2Y0SN 4A3GJ 4DYCA 1BM9A 2JTVA 1FT9A 3FKIJ 5J47A 1BI3A 5F64A 1LEAA 3ABLH 3TO9A 3OR2C 1YFHA 4P5OA 3M8EA 2DK8A 2H09A 4XMYA 3MFKA 3CCJI 3LA2A 4WWCA 1WJ5A 2K3FA 4BNCA 4B09A 2HZDA 2BXYA 1J09A 2EFNA 3JRGA 4QPOA 1BIAA 2A5WA 2FU4A 3C2HA 3LMMA 4CH7A 3TDUC 4J01A 2F5CA 3GZNB 2VJJA 3DV8A 4CZCA 3WTSC 3CESA 3CJQB 4ZYAA 2JJ7A 1B72A 3WHBA 1I50J 2HKXA 4FISA 2A07F 2X0LA 3GTPJ 2R7ZJ 1X19A 2QYOA 3TW7A 1BC8C 2HEOA 3K4JA 3JR9A 4KN4X 4LJZF 3FISA 3LNQA 2MYSA 2W1OA 1VQ4I 1EJ9A 3OSFA 2LFBA 2XF7A 3GTMJ 2EIKH 3K10A 1IC8A 3OYGA 5BPIA 3BT9A 5HS9A 2CUJA 1ERDA 4B48A 3MWMA 2UXNA 3HPHA 5J40A 1P9QC 3DFGA 3Q5FA 4EJUA 4BDZA 1TT5B 2LRDA 1ZG3A 3HSRA 1P6RA 4ENKA 4A2UA 3CF2A 3BPXA 2YU9J 3WODF 2VC1A 5GAHJ 4IRHA 4AIDA 1B9NA 2CSOA 3CUQB 1AKHA 3PL8A 3LQQA 2W4SA 1MNDA 3HRMA 2RN7A 3BY6A 3BC8A 4ZC3A 2HVSA 3JRIA 3DEEA 1Y56A 2QQ8A 1D0XA 1FYKA 1E0EA 2RV8A 3GUDA 1WJDA 4UY8I 3I58A 1X3UA 3TOAA 4W97A 2K86A 3PSIA 3HGYA 2F5DA 5K7FA 1T98A 4OINF 3BR2A 4L5IA 1K4TA 1ZYRF 1WSUA 3M1EA 3CJNA 1VQ7I 1ETKA 1F9NA 3K4NA 3VSKA 3CMEI 3WU2C 1JKRC 1QBJA 2HWVA 2A5YB 3GFLA 1K6YA 4PSXA 3BR5A 3QRFF 3HOTA 1FMWA 4GO1A 2O7OA 3CJTB 1OCOH 1QZEA 2OJED 3EUAA 4LLLA 1XSDA 3DWLE 1MBGA 3TO7A 1Z05A 3I53A 2KLOA 4ZDPA 4DZJA 2EIMH 3AG4H 1S7OA 1XD7A 1PUFB 1Z91A 3H5RA 4BE2A 4GYGA 2QSGX 2ID6A 4NC6A 2V7FA 2JUGA 3ONQA 5KAIC 3KP7A 3EUHA 3S8PA 1MMSA 2R7DA 4AIJA 2L4MA 2R7UA 5D4RA 4MLOA 4RDUA 2P7CB 2X48A 3E5QA 3QPHA 4MGRA 3I0TA 4XSXF 3MCZA 2WY8Q 2GAUA 3ZQ7A 2KKOA 4E4HA 2PI0A 3CCMI 1Z21A 4LB5A 3HOYJ 1MIJA 2JWTA 3VODA 5M5WJ 1EH8A 1XC5A 1YRNB 3QPLA 1W36D 1BW5A 4M74A 5H6RA 2ECCA 4MFEA 4IQ4A 3K1MA 5GAEJ 1LE8B 2Y2ZA 2KP6A 2O3FA 2BOLA 4KIFA 2DPUA 1P2FA 4OIOF 2WB1N 5BS6A 2HU9A 3I59A 3FKJA 1YLFA 3DBHB 2G0EA 2BY2A 3CDHA 4IXAA 3OR1C 1RKTA 2KDOA 2R5ZB 3M07A 2V9PA 4BQNA 2DK5A 2FOKA 2HQ5A 1JI8A 4A5NA 4Y33A 2KMUA 4C2MJ 2V1NA 4I99C 1RIOH 2VKHA 2F2EA 4LK1F 2LLKA 1X58A 5J4YA 4LLNA 5JLXA 3Q9SA 3JTGA 1U9OA 2CH0A 1LJ9A 1LDKB 1BJAA 4XKVA 4FE7A 3BWGA 1IAWA 4K2EA 3TQNA 2OBPA 2C6YA 1GUUA 3AG1H 3CCQI 2ZO4A 4MEYF 1Q1HA 3KLNA 5E17F 1QZZA 3LAJA 2K9NA 4I6ZA 3K4LA 3H0DA 1FOXA 4A3MJ 2WC2A 3HOXJ 4GDFA 2RKHA 2M45A 2R3SA 2QF7A 1WFXA 2EA2A 3TL4X 4YRVA 1BW6A 4S0HB 2NVQJ 1J5YA 4KIBA 1PUFA 2DU9A 4XOTA 1T95A 3ZOBA 4A3DJ 2MH2A 2D5VA 5F04A 3M3YJ 3QQAA 3VDXA 5DS9A 2RDPA 2VXZA 4A3KJ 5C4XJ 3HG9A 4ENNA 2CV0A 5IP6A 4A3FJ 1LVKA 1S6LA 2XKPA 5KCMA 2ME0A 5BQTA 4BDYA 1IN5A 1R58A 1SFXA 2EWNA 4BJ5C 4CA0A 1ZAOA 2VB6A 5CJ9A 4RB2C 1YRNA 4NB5A 3OS0A 4GFBA 4NDLA 2A61A 3OYMA 1USTA 2TRTA 1K78B 1BL0A 2H1LA 3QU6A 5FROA 1BR2A 2QGUA 4O5VA 2BBYA 4IHVA 1BI1A 1ORKA 2ZXHA 2HXOA 2BHYA 3MVPA 3R4KA 1WJAA 1V5GA 3OOPA 1X2NA 3RQ4A 3U9GA 3BTCA 4MFDA 4WK8F 3S14J 2EILH 2IXSA 5F1JA 3COAC 5J6XA 4FCYA 3ECOA 3ZQHA 3ULQB 1BJZA 1VQ5I 1UJ8A 1V55H 4YEJA 4B3XA 1T6SA 2R5ZA 1TQPA 2V9KA 3QPTA 2CFXA 3T8RA 3BG5A 3HEFA 3AL0C 2DPDA 4PJNA 2ZMEB 2ZXIA 2YPRA 1S3JA 2W7NA 3S2WA 5E8GA 1YI2I 2JPCA 3FHNA 3V8JA 3OYHA 4PSWA 1R49A 3GZ5A 2FXAA 3D5LA 2R5YB 3FXOA 1XB4A 1VQPI 3B73A 2NS0A 4KYWA 3ERMA 3Q0UA 2IW5A 1LNWA 2DA2A 2L0KA 3CMAI 2EIJH 3KEOA 3LSPA 1XS9A 3RI4A 4DZPA 4BEHB 3FBIB 4MO7A 1PJRA 1IRFA 5L3GA 2FE3A 4H4KC 2XASA 3HHHA 2HKOA 2WAFA 3LA7A 1QVTA 3W2AA 4RM3A 4HQEA 4PCQA 4PGHA 4CSWA 2PMHA 1VTNC 1U5TC 4A69C 5JHFA 3HTSB 4FX0A 4J19A 1OCPA 4A3JJ 1X1BA 1XCVA 3RQIA 4A3LJ 1TWCJ 3DTKA 3LFKA 3QODA 5FB2A 2XF6A 3BR0A 3IKTA 2HOSA 3LSIA 2Q2EA 1NG7A 3QPSA 1B8IA 1OYYA 3BQZA 4HAMA 2VUMJ 2X6XA 1A35A 2RGVA 3SFZA 4LIVA 2ELKA 1KU3A 3HBLA 3ELKA 3CCUI 2DOAA 2GXBA 1RNLA 1OQYA 4QIWN 3DQVC 4IRIA 1P4XA 1K78A 2VKVA 4C3JJ 2L9VA 1WH7A 5IY5H 1W0TA 5M5YJ 4O3MA 1G3WA 1IV6A 2M4KA 3FMSA 3H9GA 2MFZA 3FM5A 4V2FA 4OAZA 4YELA 1DPRA 3FXUA 1HF0A 1KYWA 2KQRA 5HNFA 2LDUA 2IA1A 3L2CA 2VE9A 3E3VA 3HOVJ 1ZGJA 4E7IA 1HW5A 2XGDA 1U2WA 3CC7I 1R6RA 4P55A 5A2QK 2ISYA 2STWA 1JT6A 2CJJA 2BYVE 4MNUA 4RLQA 3HSFA 4HW0A 4XN0A 2CW0F 4L0ZB 5IT9K 2B7EA 3FXLA 3OIPA 4XBFA 1YX5A 4XRSA 4WXDA 1SD7A 3O3KA 2X9DA 3GEZA 2R5YA 1HSJA 3D1NI 1FEXA 2CYYA 3DEUA 1WJFA 5HNHA 3NWTA 1VZ0A 2W82A 4FT8A 2ESNA 4HNUA 3KIOA 4KT6A 4HOBA 1E3HA 2VXDA 2MD0A 2ZNZA 1GXQA 2OTJI 3BTJA 2VJ5A 4EJTA 1IGNA 3MKZA 2V9VA 1QNTA 5FGMA 1A5JA 1PP8F 5AONA 5BOXA 1TWFJ 3DCFA 2EZHA 1BI2A 3L00A 5HDKA 1H89C 2R7XA 3H0GJ 1SD5A 1APLC 1NTCA 1TP4A 2MC4A 1TBXA 2XPVA 4KMFA 2JT1A 1X1AA 2FA5A 5LGNA 1D1CA 4E7ZA 1YQAA 3SDBA 1UCRA 3EYYA 5EF6A 1S8NA 2EK5A 5KAFC 2K5CA 3ZMSA 3FIWA 3ZXSA
chains in the Genus database with same CATH topology
2Z9OA 2QQ9A 2P5LC 2PQ8A 4BQAA 2FBKA 1FBUA 3F8NA 1OMIA 4HV6A 2QLZA 3BJ6A 2DQRA 3IL2A 5LGUA 5LGTA 2BGCA 5HVQC 1D5VA 3FX3A 4QWQA 1FBSA 1IF1A 2P6SA 3HTUA 3CLOA 3ZPLA 4M9ZA 3C1DA 2LKPA 3PFIA 4RGSA 3EYIA 1FY7A 1QZYA 5AIQA 5ILSA 2KRFA 3I4PA 3P9IA 3HRSA 2JSCA 3VOEA 2YR2A 3KLOA 1R5HA 5K5RA 3HYIA 4S04A 1ZHFA 1OPCA 4KNYA 1XCBA 2ZCWA 1QPMA 1ZLJA 2W57A 5DD8A 3HRUA 1ODDA 5LHGA 1F4KA 4AIHA 1ZRFA 4JK1X 4OOIA 3DPLC 5FO5A 3LWFA 3F72A 1V3FA 1D8JA 3JAMZ 1EV7A 3WTZA 1B9MA 4HF1A 1JGSA 3U2RA 4EGZA 3F8FA 4KFCA 2DW4A 3BPVA 1R23A 3GFIA 2KJCA 1ON2A 1T2KA 3E6DA 3ZMUA 3F21A 2KIMA 1IN6A 5LEJA 1O7FA 5CYVA 5JHUA 4ASNA 2XV4S 1ULYA 4IRGA 3V4GA 1V4RA 1UFMA 1XGMA 2VOPA 1OR7A 5D5UB 4U0WA 2XIGA 5E18F 2H6BA 2FMLA 3K0LA 4NQWA 2KIFA 3N4MA 3H92A 2GWRA 4LLGF 1DUXC 4OIQF 2XAQA 4IHSA 5DV5A 1SD4A 2YSRA 3KEQA 1IXRC 3L09A 1HW2A 1WQ2A 4HA8A 3CUQC 1I6XA 4YFKF 4UV8A 1IXSB 2D2WA 2OZ6A 5HLIA 2CWEA 1HW1A 1I5ZA 3V8KA 3VFZA 2PG4A 4L9JA 2LF7A 3WTYC 3D0SA 3KP4A 3WU1B 3R61A 3GX4X 3SZPA 1UHMA 1S29A 3F8CA 3M8FA 2P4WA 2BEOA 4E70A 2DT5A 4CHUA 3I59B 2O03A 3NEUA 2MLKA 4Q47A 4QLCU 3DPTA 1IN7A 4XLNF 3BOQA 5FFZA 4MTDA 2RQPA 2EFWA 4R79A 1T38A 4I01A 1A04A 1GVJA 3GW2A 1B6AA 2OAZA 1TW2A 2K7LA 4ZYDA 3BJAA 4AWXB 2MH9A 1W7PD 2UWMA 3IKVA 4M71A 1AOYA 2V1UA 1XMAA 3KP5A 5HLGA 3GXOA 2HYGD 4L5JA 2W25A 5DD4A 1BOAA 3ERED 3K9TA 2VODA 2D1VA 2K27A 2QBYA 2IT0A 4EQQA 3REOA 4OMYA 5LHHA 2JPBA 1P4AA 4A0XA 4ESFA 4RGXA 1FX7A 5KVRA 3TGNA 1ON1A 1R00A 2TDXA 2CGPA 3FWEA 1KGSA 4EGYA 1MKMA 2V1DA 5LRRA 2MLGA 3BROA 4M6YA 3GVAA 3CO7C 2VBWA 2HS5A 3NRVA 4EJOA 3ZMTA 4LFUA 4KUMA 1YO5C 3HUGA 2DI3A 5DUKA 2QWWA 2GA2A 4KICA 4DNCA 5L3EA 3OV8A 3JW4A 2K02A 2VBZA 1ZLKA 1FP1D 2FF4A 5DUIA 1KU9A 2XAFA 5ED4A 4KMUX 2COMA 3ZMVA 2W84A 4ESJA 5ILVA 3PQKA 4M6XA 3ZMDA 3BZ6A 3IRRA 2VBYA 1DP7P 4HX8A 2H94A 3I54A 5LBQA 3I64A 3GF2A 2L4AA 3LSTA 2O0YA 4G9YA 4YFXF 4LB6B 1JXSA 1YG2A 5TJJA 1DPUA 4OIPF 3EETA 4TV7A 1FYLA 5H6QA 3P7NA 3EDPA 2IVMA 1TNSA 3KCCA 2QQAA 3FXQA 3J80K 4MTEA 1FBQA 3RPQA 4HYEA 4N9HA 4DQ2A 1XN7A 4HX7A 2GXGA 2EV0A 2VOOA 1HBXG 3O2PE 2B0LA 3K2ZA 3K69A 4GCVA 5K5OA 4CDGA 2P5KA 4HF2A 2O8XA 4RS8A 5E1ZB 3F6VA 5F1RA 1Z7UA 3WTWC 2L3DA 3FXRA 5D6FA 4LG0B 4ETSA 1ZGAA 4U7BA 5FD5A 4R8HA 5D5XB 1BC7C 3WE3A 3KFWX 2Y0MA 1J59A 3WTXC 4KDPA 3HIFA 2OQGA 5DCFA 3R0JA 1PP7U 1BI0A 1WRJA 2M30A 3HHGA 4ZH4F 1J9IA 1WWXA 4RB3C 3WGGA 4EM1A 1QQIA 2G9WA 4GGGA 4UNOA 5ICGA 4RGUA 1LB2A 3LAPA 1RUOA 1O3TA 2F5FA 2VONA 2L02A 1HKSA 1J7KA 2EJRA 4I0AA 2ZFWA 4XRFA 3CUOA 4UUVA 1KYZA 3N97A 2O61A 2IJLA 3DF8A 3JSPA 1MDMB 1T39A 1ZRCA 5BPDA 5EEGA 3F23A 2XUBA 3R6SA 1SD6A 3GZ6A 3MZHA 2P5VA 1D3YA 1WKMA 3J81Z 2HQNA 4UVBA 3RYPA 3U1DA 4PZJA 1G6NA 1MD0A 2PBIA 4M9XA 2MC3A 1BIBA 4OMZA 3ECHA 2FRHA 1MJBA 2XGXA 2XRNA 1O57A 1YW8A 4OIRF 4N0BA 2DAOA 1W4MA 2F5EA 5L3BA 4AVPA 1CF7A 4LG0A 4YIFA 1SMYF 3R60A 4KA4A 4S05A 4ZYEA 2NAZA 1SFEA 3MAJA 1R22A 1USSA 2NNNA 4HLXA 2YU3A 4P9FA 1B59A 4EV0A 2FBHA 4A6DA 4YIIA 4EVIA 2ZXJA 2PEXA 3I71A 1QGPA 3RDIA 3F8BA 6PAXA 4HX4A 2VC0A 2ACJA 4HZFA 1LVAA 4O6JA 1P4WA 4BH9A 4BYYA 4KT5C 4RB0A 1TW3A 3JAMK 3GFJA 4FHTA 1IRGA 4A6EA 5FLXK 5L3CA 5E1WA 1MDMA 5K1YA 3DXJF 1ZARA 2ZKZA 1CGPA 1XGSA 3WTTC 1U6GA 2FEZA 1K6OA 3ZN1A 4P96A 4ENMA 3KZZA 4OU0A 1D8KA 4EMSA 4WF2A 2XKOA 1EH7A 2STTA 3MEXA 1U8RA 2ZNYA 2CO5A 3F6OA 1FLIA 3TO6A 1FPQA 3RIRA 4MQ9F 3F22A 3IRQA 3RKWA 4G7ZF 4I7HA 3ZMZA 4EM0B 1S7AA 1YYVA 2XROA 4A12A 4HDUA 4LGWA 4MHGA 1YIOA 1HXDA 3R0AA 2NNYA 1HKQA 3TKYA 1UB9A 2JRTA 4HF0A 4ZZLA 4R1HA 3FHZA 3F8MA 3WTUC 1W7PB 3CTAA 3V8LA 3BP8A 4NHJA 4CXFA 4GXOA 5BMZA 4L0YB 5L3FA 2R7FA 1J75A 1W5SA 3P9KA 4Q4ZF 2ESHA 4XLPF 2HFHA 4EM2A 1H0MA 4IJAA 2IP2A 1O3SA 2MD5A 2HQRA 4U0YA 5ICCA 1O3RA 3WTVC 1IXCA 5F6FA 2EFOA 4LK0F 1F5TA 5K5QA 4UHTA 1TLHB 5LHIA 2P6TA 3SHFA 3HSEA 1BN5A 1SMTA 1LDJA 4RB1A 3PQJA 2NRAC 3I5UA 3SQNA 1YTYA 2P8TA 3H3UA 4HV5A 4L9NA 5D8LB 3HOTA 4G94A 4F7ZA 3NQOA 2A3SA 3ABUA 4FX4A 1IN8A 2HTSA 4KN7X 5H20A 5AIPA 1Z6RA 4BHPA 1NHAA 3K1NA 4I0BA 4ESBA 2IRFG 1I1GA 1SFUA 1YS7A 3GWZA 2ELHA 5DEQA 2MA3A 1XDUA 1IN4A 1E2XA 5D8KB 2DTRA 2Q8KA 3KETA 3AAFA 2HYFA 1KQ9A 1I1SA 3GFMA 4Z2YA 1W7PA 2K4BA 2OZUA 3T5XA 1FC3A 2QBYB 4ON0A 5JR3A 3T1BA 3G73A 1H9TA 3ZP5A 3T0YA 4EJVA 4CGZA 5HDGA 5LRSA 2DQLA 3IC7A 3VB2A 1KA8A 2JZYA 5HS7A 2FQ3A 2BV6A 1XGNA 4M73A 2UZKA 4UVAA 2XAJA 3T8TA 2ZBKA 4UXNA 2VT2A 1KQ0A 2V1XA 1JHFA 2D45A 1G3YA 4HQMA 1HKTA 1G4DA 1B1BA 1L3LA 5ERIA 1OKRA 1TQIA 1XDSA 4Q48A 1R5GA 3BJOA 5D4SA 2VN2A 4G8XA 2HTJA 2XAGA 3QP5A 1LQ1A 1KU7A 3QOPA 2M87A 4WX9A 1JHHA 2AS5F 4Q5SF 3L7WA 2GQQA 3V7CA 4BAYA 2HOEA 1UHWA 4IVNA 2WTEA 4ZZDA 2HDCA 4M72A 3V7RA 4YFNF 3ISPA 3O6BB 3BDDA 3ABTA 2QENA 4N9IA 1LDDA 4AD9A 5KK1A 2EB7A 5J8CA 1R1UA 4L9TA 4PDKA 4WCGA 2QZ8A 1XGOA 1Z1DA 1OYIA 2QQBA 3GO5A 1J0RA 1YW7A 4AIKA 1WI9A 1FP2A 3E97A 1FZPB 1STZA 4JQFA 1R1TA 2AXLA 2A6HF 2PMUA 2Z99A 2A6EF 5JFRA 1KQ8A 4ENJA 4G6DA 4IPAA 3QU3A 4B8XA 4L18B 2FMYA 2XVCA 1XSVA 4U88A 2PJPA 1ZREA 5TRDA 2FBIA 5FFXA 2GIVA 3EQLF 3CUQA 3K1PA 2Y75A 4RAZA 2M5WA 2YX4A 1I27A 5DDGA 4HBLA 4G7HF 1C0WA 2J5OA 4H0EA 3FZVA 5EEHA 2GA1A 4UV9A 2DFIA 3B02A 1U3EM 3P9CA 3WGHA 2OD5A 1RI7A 1PUEE 2VBXA 3W6KB 4G7OF 1MJ9A 2ETHA 2WWYA 1R36A 1E17A 4I2OA 1QO0D 3ZN0A 1BBYA 4I09A 3RKYA 2MBFA 1L0OC 4WXCA 4CYDA 4A0YA 5E20A 4CZZA 3J81K 3KZYA 3IWFA 3E5UA 2P7VB 1U78A 2E1CA 2O6GE 1ZG1A 1XMKA 3ML6A 4Y15A 2GZWA 3WGIA 1CF7B 4U7DA 1FSHA 3DP7A 1GHCA 1O3QA 1MGTA 3RJPA 2E7WA 1OYWA 3JSOA 3MQ0A 5CVRA 5CVJA 3E6MA 2DBBA 2RNJA 1FNNA 2G7UA 4BXUA 4HDVA 2QVOA 2H6CA 2OQRA 1FWZA 3C18A 2FNPA 2DO7A 4RGRA 5JI6A 3KE2A 3TDZC 2IA0A 2EV5A 2M8EA 4YG2F 3J7AO 1R7JA 1T0FA 3KP2A 3W6JB 3HRTA 3MZYA 5DCMB 1YS6A 5L3DA 5HOOA 2XAHA 3J80Z 2XHKA 5CVVA 1ZH5A 3DKWA 5HDNA 1W5TA 5FD6A 5CVUA 4D0PA 2OA4A 4UVCA 1Y0UA 3LA3A 2NYXA 3F3XA 3ROUA 2Z5UA 2A69F 2X4HA 5HS8A 3RKXA 4CO8A 3RYRA 3HOSA 1U5TB 2WV0A 1P92A 4P9UA 4PGGA 4U0VA 2RC4A 4WXHA 2ZMEA 5IT3A 3WG9A 2QM3A 5ILUA 3SXYA 1R1VA 1F1ZA 1ZG5A 3E5XA 1IZ1A 2IA2A 3FF5A 2PLYA 2M1BA 3L9FA 1O7LA 5LEKA 2EFQA 1PDNC 4IF4A 5DCMA 3Q9VA 4LMYA 1HQCA 3FMQA 1Z6TA 1ZN2A 4BHBA 5D6EA 4L9VA 2W85A 2H27A 4I02A 2Y48A 4CICA 4M9SA 2FNAA 4G6QA 2VE8A 2KIUA 1FYMA 1K7AA 2Q0OA 1DDNA 5HLHA 2A68F 4EJWA 2PN6A 3M7GA 5J8FA 4LD5A 1U5TA 1AWCA 5D5WB 3VEPA 5A2QZ 2G7HA 2PFBA 2YX7A 1FSEA 3RPUA 1ZRDA 5JVTA 3QAHA 4A0ZA 5IT9Z 2HZTA 1IW7F 1REPC 2IPQX 2E7XA 2FSWA 3QP6A 4Y13A 5LLQA 2EFPA 2LNBA 3KP3A 1RZ4A 3GYHX 3V7SA 3LQRA 4XSZF 3TOBA 3M9AA 5E8IA 2E1NA 2D1HA 1FOKA 2Z3YA 2BE5F 2J5PA 1YW9A 3JTHA 3WE2A 1RUNA 2HR3A 1G3TA 5DYMA 2L01A 3E6CC 2EA4A 4GYIA 1H9GA 1IUYA 1JE8A 2CG4A 1K79A 2VT3A 2KJBA 2V6CA 4KIGA 4JBAA 5FLXZ 4BHCA 1XSXA 1MZBA 2CQKA 1LEBA 1G3SA 3G3ZA 5CLSA 3IHUA 2EV6A 1J2XA 1Z9CA 1EH6A 4ZYGA 3CO6C 5ICEA 1GXPA 2OU2A 1MJAA 2QUFA 2DLLA 3IWZA 1KU2A 2L54A 4MEXF 3RTRA 2ADUA 2Z33A 1SAXA 4HLYA 5CVIA 2ZJ2A 3FMRA 1B4AA 2UXXA 2K4JA 3KP6A 3C7JA 4A5MA 1ONVA 1TTYA 3WU0A 2ISZA 3GLXA 5ICFA 1TQMA 3C3WA 5D5VB 1TNTA 3E6BA 4Y17A 4RAYA 2RVCA 1HSTA 4IHTA 2V79A 3FM3A 5E1XA 3H3ZA 4MQVA 4I98B 2W24A 3SZTA 4ZYHA 2LSOA 2LF8A 2HGCA 1BM9A 2JTVA 1FT9A 1BI3A 5F64A 1LEAA 3TO9A 1YFHA 4P5OA 3M8EA 2DK8A 2H09A 3MFKA 3LA2A 4WWCA 4BNCA 4B09A 2EFNA 1BIAA 2FU4A 3TDUC 2F5CA 3DV8A 3WTSC 2HKXA 2A07F 2X0LA 2QYOA 1BC8C 2HEOA 4KN4X 4LJZF 5BPIA 5HS9A 3MWMA 2UXNA 3DFGA 3Q5FA 4EJUA 1ZG3A 3HSRA 1P6RA 4ENKA 4A2UA 3BPXA 3WODF 2VC1A 4IRHA 1B9NA 2CSOA 3CUQB 3LQQA 3HRMA 2RN7A 3BY6A 1FYKA 2RV8A 3GUDA 3I58A 1X3UA 3TOAA 2K86A 2F5DA 1T98A 4OINF 4L5IA 1ZYRF 1WSUA 3M1EA 3CJNA 1F9NA 1QBJA 2HWVA 2A5YB 3GFLA 3QRFF 4GO1A 4LLLA 1XSDA 3TO7A 1Z05A 3I53A 1S7OA 1XD7A 1Z91A 4GYGA 3KP7A 3EUHA 2R7DA 4AIJA 2L4MA 5D4RA 2P7CB 3E5QA 3QPHA 4MGRA 3I0TA 4XSXF 3MCZA 2GAUA 3ZQ7A 2KKOA 2PI0A 4LB5A 3VODA 1EH8A 4M74A 5H6RA 3K1MA 2O3FA 4KIFA 2DPUA 1P2FA 4OIOF 5BS6A 3I59A 1YLFA 3CDHA 4IXAA 2DK5A 2FOKA 4A5NA 1RIOH 2F2EA 4LK1F 4LLNA 3Q9SA 3JTGA 1LJ9A 1LDKB 1BJAA 3BWGA 1IAWA 4K2EA 3TQNA 2OBPA 2C6YA 2ZO4A 4MEYF 1Q1HA 3KLNA 5E17F 1QZZA 3LAJA 2WC2A 2RKHA 2M45A 2R3SA 2EA2A 1J5YA 4KIBA 2DU9A 2MH2A 2RDPA 2VXZA 4ENNA 1S6LA 2XKPA 5BQTA 1IN5A 1R58A 1SFXA 2EWNA 1ZAOA 5CJ9A 4RB2C 4NB5A 2A61A 1USTA 1K78B 3QU6A 4O5VA 2BBYA 1BI1A 3R4KA 3OOPA 3U9GA 4WK8F 3COAC 5J6XA 3ECOA 3ULQB 1T6SA 1TQPA 3QPTA 2CFXA 3T8RA 2DPDA 2ZMEB 2YPRA 1S3JA 3S2WA 5E8GA 2JPCA 3V8JA 3GZ5A 2FXAA 3D5LA 1XB4A 3B73A 2NS0A 4KYWA 2IW5A 1LNWA 3KEOA 3RI4A 1IRFA 5L3GA 2FE3A 2XASA 3HHHA 2HKOA 3LA7A 4HQEA 4PCQA 4PGHA 1VTNC 2PMHA 1U5TC 3HTSB 4FX0A 1XCVA 3LFKA 5FB2A 3IKTA 2Q2EA 1OYYA 4HAMA 2RGVA 3SFZA 1KU3A 3ELKA 2GXBA 1RNLA 4IRIA 3DQVC 1P4XA 1K78A 4O3MA 1G3WA 3FMSA 3FM5A 1DPRA 3FXUA 1KYWA 3L2CA 2LDUA 2IA1A 2VE9A 3E3VA 1ZGJA 1HW5A 1U2WA 4P55A 5A2QK 2ISYA 2STWA 2BYVE 4MNUA 3HSFA 4HW0A 2CW0F 4L0ZB 5IT9K 4XBFA 4WXDA 1SD7A 3O3KA 3GEZA 1HSJA 2CYYA 3DEUA 4FT8A 2ESNA 4HOBA 2ZNZA 1GXQA 4EJTA 2V9VA 1QNTA 5FGMA 1PP8F 5AONA 5BOXA 5HDKA 1BI2A 3L00A 1SD5A 1TBXA 4KMFA 2JT1A 2FA5A 5LGNA 1YQAA 1UCRA 3EYYA 1S8NA 2EK5A 3ZMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9O A;  2QQ9 A;  2P5L C;  2PQ8 A;  4BQA A;  2FBK A;  1FBU A;  3F8N A;  1OMI A;  4HV6 A;  2QLZ A;  3BJ6 A;  2DQR A;  3IL2 A;  5LGU A;  5LGT A;  2BGC A;  5HVQ C;  1D5V A;  3FX3 A;  4QWQ A;  1FBS A;  1IF1 A;  2P6S A;  3HTU A;  3CLO A;  3ZPL A;  4M9Z A;  3C1D A;  2LKP A;  3PFI A;  4RGS A;  3EYI A;  1FY7 A;  1QZY A;  5AIQ A;  5ILS A;  2KRF A;  3I4P A;  3P9I A;  3HRS A;  2JSC A;  3VOE A;  2YR2 A;  3KLO A;  1R5H A;  5K5R A;  3HYI A;  4S04 A;  1ZHF A;  1OPC A;  4KNY A;  1XCB A;  2ZCW A;  1QPM A;  1ZLJ A;  2W57 A;  5DD8 A;  3HRU A;  1ODD A;  5LHG A;  1F4K A;  4AIH A;  1ZRF A;  4JK1 X;  4OOI A;  3DPL C;  5FO5 A;  3LWF A;  3F72 A;  1V3F A;  1D8J A;  3JAM Z;  1EV7 A;  3WTZ A;  1B9M A;  4HF1 A;  1JGS A;  3U2R A;  4EGZ A;  3F8F A;  4KFC A;  2DW4 A;  3BPV A;  1R23 A;  3GFI A;  2KJC A;  1ON2 A;  1T2K A;  3E6D A;  3ZMU A;  3F21 A;  2KIM A;  1IN6 A;  5LEJ A;  1O7F A;  5CYV A;  5JHU A;  4ASN A;  2XV4 S;  1ULY A;  4IRG A;  3V4G A;  1V4R A;  1UFM A;  1XGM A;  2VOP A;  1OR7 A;  5D5U B;  4U0W A;  2XIG A;  5E18 F;  2H6B A;  2FML A;  3K0L A;  4NQW A;  2KIF A;  3N4M A;  3H92 A;  2GWR A;  4LLG F;  1DUX C;  4OIQ F;  2XAQ A;  4IHS A;  5DV5 A;  1SD4 A;  2YSR A;  3KEQ A;  1IXR C;  3L09 A;  1HW2 A;  1WQ2 A;  4HA8 A;  3CUQ C;  1I6X A;  4YFK F;  4UV8 A;  1IXS B;  2D2W A;  2OZ6 A;  5HLI A;  2CWE A;  1HW1 A;  1I5Z A;  3V8K A;  3VFZ A;  2PG4 A;  4L9J A;  2LF7 A;  3WTY C;  3D0S A;  3KP4 A;  3WU1 B;  3R61 A;  3GX4 X;  3SZP A;  1UHM A;  1S29 A;  3F8C A;  3M8F A;  2P4W A;  2BEO A;  4E70 A;  2DT5 A;  4CHU A;  3I59 B;  2O03 A;  3NEU A;  2MLK A;  4Q47 A;  4QLC U;  3DPT A;  1IN7 A;  4XLN F;  3BOQ A;  5FFZ A;  4MTD A;  2RQP A;  2EFW A;  4R79 A;  1T38 A;  4I01 A;  1A04 A;  1GVJ A;  3GW2 A;  1B6A A;  2OAZ A;  1TW2 A;  2K7L A;  4ZYD A;  3BJA A;  4AWX B;  2MH9 A;  1W7P D;  2UWM A;  3IKV A;  4M71 A;  1AOY A;  2V1U A;  1XMA A;  3KP5 A;  5HLG A;  3GXO A;  2HYG D;  4L5J A;  2W25 A;  5DD4 A;  1BOA A;  3ERE D;  3K9T A;  2VOD A;  2D1V A;  2K27 A;  2QBY A;  2IT0 A;  4EQQ A;  3REO A;  4OMY A;  5LHH A;  2JPB A;  1P4A A;  4A0X A;  4ESF A;  4RGX A;  1FX7 A;  5KVR A;  3TGN A;  1ON1 A;  1R00 A;  2TDX A;  2CGP A;  3FWE A;  1KGS A;  4EGY A;  1MKM A;  2V1D A;  5LRR A;  2MLG A;  3BRO A;  4M6Y A;  3GVA A;  3CO7 C;  2VBW A;  2HS5 A;  3NRV A;  4EJO A;  3ZMT A;  4LFU A;  4KUM A;  1YO5 C;  3HUG A;  2DI3 A;  5DUK A;  2QWW A;  2GA2 A;  4KIC A;  4DNC A;  5L3E A;  3OV8 A;  3JW4 A;  2K02 A;  2VBZ A;  1ZLK A;  1FP1 D;  2FF4 A;  5DUI A;  1KU9 A;  2XAF A;  5ED4 A;  4KMU X;  2COM A;  3ZMV A;  2W84 A;  4ESJ A;  5ILV A;  3PQK A;  4M6X A;  3ZMD A;  3BZ6 A;  3IRR A;  2VBY A;  1DP7 P;  4HX8 A;  2H94 A;  3I54 A;  5LBQ A;  3I64 A;  3GF2 A;  2L4A A;  3LST A;  2O0Y A;  4G9Y A;  4YFX F;  4LB6 B;  1JXS A;  1YG2 A;  5TJJ A;  1DPU A;  4OIP F;  3EET A;  4TV7 A;  1FYL A;  5H6Q A;  3P7N A;  3EDP A;  2IVM A;  1TNS A;  3KCC A;  2QQA A;  3FXQ A;  3J80 K;  4MTE A;  1FBQ A;  3RPQ A;  4HYE A;  4N9H A;  4DQ2 A;  1XN7 A;  4HX7 A;  2GXG A;  2EV0 A;  2VOO A;  1HBX G;  3O2P E;  2B0L A;  3K2Z A;  3K69 A;  4GCV A;  5K5O A;  4CDG A;  2P5K A;  4HF2 A;  2O8X A;  4RS8 A;  5E1Z B;  3F6V A;  5F1R A;  1Z7U A;  3WTW C;  2L3D A;  3FXR A;  5D6F A;  4LG0 B;  4ETS A;  1ZGA A;  4U7B A;  5FD5 A;  4R8H A;  5D5X B;  1BC7 C;  3WE3 A;  3KFW X;  2Y0M A;  1J59 A;  3WTX C;  4KDP A;  3HIF A;  2OQG A;  5DCF A;  3R0J A;  1PP7 U;  1BI0 A;  1WRJ A;  2M30 A;  3HHG A;  4ZH4 F;  1J9I A;  1WWX A;  4RB3 C;  3WGG A;  4EM1 A;  1QQI A;  2G9W A;  4GGG A;  4UNO A;  5ICG A;  4RGU A;  1LB2 A;  3LAP A;  1RUO A;  1O3T A;  2F5F A;  2VON A;  2L02 A;  1HKS A;  1J7K A;  2EJR A;  4I0A A;  2ZFW A;  4XRF A;  3CUO A;  4UUV A;  1KYZ A;  3N97 A;  2O61 A;  2IJL A;  3DF8 A;  3JSP A;  1MDM B;  1T39 A;  1ZRC A;  5BPD A;  5EEG A;  3F23 A;  2XUB A;  3R6S A;  1SD6 A;  3GZ6 A;  3MZH A;  2P5V A;  1D3Y A;  1WKM A;  3J81 Z;  2HQN A;  4UVB A;  3RYP A;  3U1D A;  4PZJ A;  1G6N A;  1MD0 A;  2PBI A;  4M9X A;  2MC3 A;  1BIB A;  4OMZ A;  3ECH A;  2FRH A;  1MJB A;  2XGX A;  2XRN A;  1O57 A;  1YW8 A;  4OIR F;  4N0B A;  2DAO A;  1W4M A;  2F5E A;  5L3B A;  4AVP A;  1CF7 A;  4LG0 A;  4YIF A;  1SMY F;  3R60 A;  4KA4 A;  4S05 A;  4ZYE A;  2NAZ A;  1SFE A;  3MAJ A;  1R22 A;  1USS A;  2NNN A;  4HLX A;  2YU3 A;  4P9F A;  1B59 A;  4EV0 A;  2FBH A;  4A6D A;  4YII A;  4EVI A;  2ZXJ A;  2PEX A;  3I71 A;  1QGP A;  3RDI A;  3F8B A;  6PAX A;  4HX4 A;  2VC0 A;  2ACJ A;  4HZF A;  1LVA A;  4O6J A;  1P4W A;  4BH9 A;  4BYY A;  4KT5 C;  4RB0 A;  1TW3 A;  3JAM K;  3GFJ A;  4FHT A;  1IRG A;  4A6E A;  5FLX K;  5L3C A;  5E1W A;  1MDM A;  5K1Y A;  3DXJ F;  1ZAR A;  2ZKZ A;  1CGP A;  1XGS A;  3WTT C;  1U6G A;  2FEZ A;  1K6O A;  3ZN1 A;  4P96 A;  4ENM A;  3KZZ A;  4OU0 A;  1D8K A;  4EMS A;  4WF2 A;  2XKO A;  1EH7 A;  2STT A;  3MEX A;  1U8R A;  2ZNY A;  2CO5 A;  3F6O A;  1FLI A;  3TO6 A;  1FPQ A;  3RIR A;  4MQ9 F;  3F22 A;  3IRQ A;  3RKW A;  4G7Z F;  4I7H A;  3ZMZ A;  4EM0 B;  1S7A A;  1YYV A;  2XRO A;  4A12 A;  4HDU A;  4LGW A;  4MHG A;  1YIO A;  1HXD A;  3R0A A;  2NNY A;  1HKQ A;  3TKY A;  1UB9 A;  2JRT A;  4HF0 A;  4ZZL A;  4R1H A;  3FHZ A;  3F8M A;  3WTU C;  1W7P B;  3CTA A;  3V8L A;  3BP8 A;  4NHJ A;  4CXF A;  4GXO A;  5BMZ A;  4L0Y B;  5L3F A;  2R7F A;  1J75 A;  1W5S A;  3P9K A;  4Q4Z F;  2ESH A;  4XLP F;  2HFH A;  4EM2 A;  1H0M A;  4IJA A;  2IP2 A;  1O3S A;  2MD5 A;  2HQR A;  4U0Y A;  5ICC A;  1O3R A;  3WTV C;  1IXC A;  5F6F A;  2EFO A;  4LK0 F;  1F5T A;  5K5Q A;  4UHT A;  1TLH B;  5LHI A;  2P6T A;  3SHF A;  3HSE A;  1BN5 A;  1SMT A;  1LDJ A;  4RB1 A;  3PQJ A;  2NRA C;  3I5U A;  3SQN A;  1YTY A;  2P8T A;  3H3U A;  4HV5 A;  4L9N A;  5D8L B;  3HOT A;  4G94 A;  4F7Z A;  3NQO A;  2A3S A;  3ABU A;  4FX4 A;  1IN8 A;  2HTS A;  4KN7 X;  5H20 A;  5AIP A;  1Z6R A;  4BHP A;  1NHA A;  3K1N A;  4I0B A;  4ESB A;  2IRF G;  1I1G A;  1SFU A;  1YS7 A;  3GWZ A;  2ELH A;  5DEQ A;  2MA3 A;  1XDU A;  1IN4 A;  1E2X A;  5D8K B;  2DTR A;  2Q8K A;  3KET A;  3AAF A;  2HYF A;  1KQ9 A;  1I1S A;  3GFM A;  4Z2Y A;  1W7P A;  2K4B A;  2OZU A;  3T5X A;  1FC3 A;  2QBY B;  4ON0 A;  5JR3 A;  3T1B A;  3G73 A;  1H9T A;  3ZP5 A;  3T0Y A;  4EJV A;  4CGZ A;  5HDG A;  5LRS A;  2DQL A;  3IC7 A;  3VB2 A;  1KA8 A;  2JZY A;  5HS7 A;  2FQ3 A;  2BV6 A;  1XGN A;  4M73 A;  2UZK A;  4UVA A;  2XAJ A;  3T8T A;  2ZBK A;  4UXN A;  2VT2 A;  1KQ0 A;  2V1X A;  1JHF A;  2D45 A;  1G3Y A;  4HQM A;  1HKT A;  1G4D A;  1B1B A;  1L3L A;  5ERI A;  1OKR A;  1TQI A;  1XDS A;  4Q48 A;  1R5G A;  3BJO A;  5D4S A;  2VN2 A;  4G8X A;  2HTJ A;  2XAG A;  3QP5 A;  1LQ1 A;  1KU7 A;  3QOP A;  2M87 A;  4WX9 A;  1JHH A;  2AS5 F;  4Q5S F;  3L7W A;  2GQQ A;  3V7C A;  4BAY A;  2HOE A;  1UHW A;  4IVN A;  2WTE A;  4ZZD A;  2HDC A;  4M72 A;  3V7R A;  4YFN F;  3ISP A;  3O6B B;  3BDD A;  3ABT A;  2QEN A;  4N9I A;  1LDD A;  4AD9 A;  5KK1 A;  2EB7 A;  5J8C A;  1R1U A;  4L9T A;  4PDK A;  4WCG A;  2QZ8 A;  1XGO A;  1Z1D A;  1OYI A;  2QQB A;  3GO5 A;  1J0R A;  1YW7 A;  4AIK A;  1WI9 A;  1FP2 A;  3E97 A;  1FZP B;  1STZ A;  4JQF A;  1R1T A;  2AXL A;  2A6H F;  2PMU A;  2Z99 A;  2A6E F;  5JFR A;  1KQ8 A;  4ENJ A;  4G6D A;  4IPA A;  3QU3 A;  4B8X A;  4L18 B;  2FMY A;  2XVC A;  1XSV A;  4U88 A;  2PJP A;  1ZRE A;  5TRD A;  2FBI A;  5FFX A;  2GIV A;  3EQL F;  3CUQ A;  3K1P A;  2Y75 A;  4RAZ A;  2M5W A;  2YX4 A;  1I27 A;  5DDG A;  4HBL A;  4G7H F;  1C0W A;  2J5O A;  4H0E A;  3FZV A;  5EEH A;  2GA1 A;  4UV9 A;  2DFI A;  3B02 A;  1U3E M;  3P9C A;  3WGH A;  2OD5 A;  1RI7 A;  1PUE E;  2VBX A;  3W6K B;  4G7O F;  1MJ9 A;  2ETH A;  2WWY A;  1R36 A;  1E17 A;  4I2O A;  1QO0 D;  3ZN0 A;  1BBY A;  4I09 A;  3RKY A;  2MBF A;  1L0O C;  4WXC A;  4CYD A;  4A0Y A;  5E20 A;  4CZZ A;  3J81 K;  3KZY A;  3IWF A;  3E5U A;  2P7V B;  1U78 A;  2E1C A;  2O6G E;  1ZG1 A;  1XMK A;  3ML6 A;  4Y15 A;  2GZW A;  3WGI A;  1CF7 B;  4U7D A;  1FSH A;  3DP7 A;  1GHC A;  1O3Q A;  1MGT A;  3RJP A;  2E7W A;  1OYW A;  3JSO A;  3MQ0 A;  5CVR A;  5CVJ A;  3E6M A;  2DBB A;  2RNJ A;  1FNN A;  2G7U A;  4BXU A;  4HDV A;  2QVO A;  2H6C A;  2OQR A;  1FWZ A;  3C18 A;  2FNP A;  2DO7 A;  4RGR A;  5JI6 A;  3KE2 A;  3TDZ C;  2IA0 A;  2EV5 A;  2M8E A;  4YG2 F;  3J7A O;  1R7J A;  1T0F A;  3KP2 A;  3W6J B;  3HRT A;  3MZY A;  5DCM B;  1YS6 A;  5L3D A;  5HOO A;  2XAH A;  3J80 Z;  2XHK A;  5CVV A;  1ZH5 A;  3DKW A;  5HDN A;  1W5T A;  5FD6 A;  5CVU A;  4D0P A;  2OA4 A;  4UVC A;  1Y0U A;  3LA3 A;  2NYX A;  3F3X A;  3ROU A;  2Z5U A;  2A69 F;  2X4H A;  5HS8 A;  3RKX A;  4CO8 A;  3RYR A;  3HOS A;  1U5T B;  2WV0 A;  1P92 A;  4P9U A;  4PGG A;  4U0V A;  2RC4 A;  4WXH A;  2ZME A;  5IT3 A;  3WG9 A;  2QM3 A;  5ILU A;  3SXY A;  1R1V A;  1F1Z A;  1ZG5 A;  3E5X A;  1IZ1 A;  2IA2 A;  3FF5 A;  2PLY A;  2M1B A;  3L9F A;  1O7L A;  5LEK A;  2EFQ A;  1PDN C;  4IF4 A;  5DCM A;  3Q9V A;  4LMY A;  1HQC A;  3FMQ A;  1Z6T A;  1ZN2 A;  4BHB A;  5D6E A;  4L9V A;  2W85 A;  2H27 A;  4I02 A;  2Y48 A;  4CIC A;  4M9S A;  2FNA A;  4G6Q A;  2VE8 A;  2KIU A;  1FYM A;  1K7A A;  2Q0O A;  1DDN A;  5HLH A;  2A68 F;  4EJW A;  2PN6 A;  3M7G A;  5J8F A;  4LD5 A;  1U5T A;  1AWC A;  5D5W B;  3VEP A;  5A2Q Z;  2G7H A;  2PFB A;  2YX7 A;  1FSE A;  3RPU A;  1ZRD A;  5JVT A;  3QAH A;  4A0Z A;  5IT9 Z;  2HZT A;  1IW7 F;  1REP C;  2IPQ X;  2E7X A;  2FSW A;  3QP6 A;  4Y13 A;  5LLQ A;  2EFP A;  2LNB A;  3KP3 A;  1RZ4 A;  3GYH X;  3V7S A;  3LQR A;  4XSZ F;  3TOB A;  3M9A A;  5E8I A;  2E1N A;  2D1H A;  1FOK A;  2Z3Y A;  2BE5 F;  2J5P A;  1YW9 A;  3JTH A;  3WE2 A;  1RUN A;  2HR3 A;  1G3T A;  5DYM A;  2L01 A;  3E6C C;  2EA4 A;  4GYI A;  1H9G A;  1IUY A;  1JE8 A;  2CG4 A;  1K79 A;  2VT3 A;  2KJB A;  2V6C A;  4KIG A;  4JBA A;  5FLX Z;  4BHC A;  1XSX A;  1MZB A;  2CQK A;  1LEB A;  1G3S A;  3G3Z A;  5CLS A;  3IHU A;  2EV6 A;  1J2X A;  1Z9C A;  1EH6 A;  4ZYG A;  3CO6 C;  5ICE A;  1GXP A;  2OU2 A;  1MJA A;  2QUF A;  2DLL A;  3IWZ A;  1KU2 A;  2L54 A;  4MEX F;  3RTR A;  2ADU A;  2Z33 A;  1SAX A;  4HLY A;  5CVI A;  2ZJ2 A;  3FMR A;  1B4A A;  2UXX A;  2K4J A;  3KP6 A;  3C7J A;  4A5M A;  1ONV A;  1TTY A;  3WU0 A;  2ISZ A;  3GLX A;  5ICF A;  1TQM A;  3C3W A;  5D5V B;  1TNT A;  3E6B A;  4Y17 A;  4RAY A;  2RVC A;  1HST A;  4IHT A;  2V79 A;  3FM3 A;  5E1X A;  3H3Z A;  4MQV A;  4I98 B;  2W24 A;  3SZT A;  4ZYH A;  2LSO A;  2LF8 A;  2HGC A;  1BM9 A;  2JTV A;  1FT9 A;  1BI3 A;  5F64 A;  1LEA A;  3TO9 A;  1YFH A;  4P5O A;  3M8E A;  2DK8 A;  2H09 A;  3MFK A;  3LA2 A;  4WWC A;  4BNC A;  4B09 A;  2EFN A;  1BIA A;  2FU4 A;  3TDU C;  2F5C A;  3DV8 A;  3WTS C;  2HKX A;  2A07 F;  2X0L A;  2QYO A;  1BC8 C;  2HEO A;  4KN4 X;  4LJZ F;  5BPI A;  5HS9 A;  3MWM A;  2UXN A;  3DFG A;  3Q5F A;  4EJU A;  1ZG3 A;  3HSR A;  1P6R A;  4ENK A;  4A2U A;  3BPX A;  3WOD F;  2VC1 A;  4IRH A;  1B9N A;  2CSO A;  3CUQ B;  3LQQ A;  3HRM A;  2RN7 A;  3BY6 A;  1FYK A;  2RV8 A;  3GUD A;  3I58 A;  1X3U A;  3TOA A;  2K86 A;  2F5D A;  1T98 A;  4OIN F;  4L5I A;  1ZYR F;  1WSU A;  3M1E A;  3CJN A;  1F9N A;  1QBJ A;  2HWV A;  2A5Y B;  3GFL A;  3QRF F;  4GO1 A;  4LLL A;  1XSD A;  3TO7 A;  1Z05 A;  3I53 A;  1S7O A;  1XD7 A;  1Z91 A;  4GYG A;  3KP7 A;  3EUH A;  2R7D A;  4AIJ A;  2L4M A;  5D4R A;  2P7C B;  3E5Q A;  3QPH A;  4MGR A;  3I0T A;  4XSX F;  3MCZ A;  2GAU A;  3ZQ7 A;  2KKO A;  2PI0 A;  4LB5 A;  3VOD A;  1EH8 A;  4M74 A;  5H6R A;  3K1M A;  2O3F A;  4KIF A;  2DPU A;  1P2F A;  4OIO F;  5BS6 A;  3I59 A;  1YLF A;  3CDH A;  4IXA A;  2DK5 A;  2FOK A;  4A5N A;  1RIO H;  2F2E A;  4LK1 F;  4LLN A;  3Q9S A;  3JTG A;  1LJ9 A;  1LDK B;  1BJA A;  3BWG A;  1IAW A;  4K2E A;  3TQN A;  2OBP A;  2C6Y A;  2ZO4 A;  4MEY F;  1Q1H A;  3KLN A;  5E17 F;  1QZZ A;  3LAJ A;  2WC2 A;  2RKH A;  2M45 A;  2R3S A;  2EA2 A;  1J5Y A;  4KIB A;  2DU9 A;  2MH2 A;  2RDP A;  2VXZ A;  4ENN A;  1S6L A;  2XKP A;  5BQT A;  1IN5 A;  1R58 A;  1SFX A;  2EWN A;  1ZAO A;  5CJ9 A;  4RB2 C;  4NB5 A;  2A61 A;  1UST A;  1K78 B;  3QU6 A;  4O5V A;  2BBY A;  1BI1 A;  3R4K A;  3OOP A;  3U9G A;  4WK8 F;  3COA C;  5J6X A;  3ECO A;  3ULQ B;  1T6S A;  1TQP A;  3QPT A;  2CFX A;  3T8R A;  2DPD A;  2ZME B;  2YPR A;  1S3J A;  3S2W A;  5E8G A;  2JPC A;  3V8J A;  3GZ5 A;  2FXA A;  3D5L A;  1XB4 A;  3B73 A;  2NS0 A;  4KYW A;  2IW5 A;  1LNW A;  3KEO A;  3RI4 A;  1IRF A;  5L3G A;  2FE3 A;  2XAS A;  3HHH A;  2HKO A;  3LA7 A;  4HQE A;  4PCQ A;  4PGH A;  1VTN C;  2PMH A;  1U5T C;  3HTS B;  4FX0 A;  1XCV A;  3LFK A;  5FB2 A;  3IKT A;  2Q2E A;  1OYY A;  4HAM A;  2RGV A;  3SFZ A;  1KU3 A;  3ELK A;  2GXB A;  1RNL A;  4IRI A;  3DQV C;  1P4X A;  1K78 A;  4O3M A;  1G3W A;  3FMS A;  3FM5 A;  1DPR A;  3FXU A;  1KYW A;  3L2C A;  2LDU A;  2IA1 A;  2VE9 A;  3E3V A;  1ZGJ A;  1HW5 A;  1U2W A;  4P55 A;  5A2Q K;  2ISY A;  2STW A;  2BYV E;  4MNU A;  3HSF A;  4HW0 A;  2CW0 F;  4L0Z B;  5IT9 K;  4XBF A;  4WXD A;  1SD7 A;  3O3K A;  3GEZ A;  1HSJ A;  2CYY A;  3DEU A;  4FT8 A;  2ESN A;  4HOB A;  2ZNZ A;  1GXQ A;  4EJT A;  2V9V A;  1QNT A;  5FGM A;  1PP8 F;  5AON A;  5BOX A;  5HDK A;  1BI2 A;  3L00 A;  1SD5 A;  1TBX A;  4KMF A;  2JT1 A;  2FA5 A;  5LGN A;  1YQA A;  1UCR A;  3EYY A;  1S8N A;  2EK5 A;  3ZMS A; 
#chains in the Genus database with same CATH topology
 2Z9O A;  2QQ9 A;  2P5L C;  4AYB A;  2PQ8 A;  4BQA A;  2FBK A;  3CCR I;  1FBU A;  2E5N A;  3F8N A;  1OMI A;  4HV6 A;  2QLZ A;  3BJ6 A;  2HPI A;  1YIT I;  2DQR A;  3IL2 A;  4XKB A;  5LGU A;  2F4M B;  3PNY A;  2HI3 A;  4XLC A;  5LGT A;  3CDL A;  4PJM A;  3S32 A;  3ZQF A;  2BGC A;  1TWG J;  5HVQ C;  2CFO A;  1D5V A;  3GCM A;  1D0Y A;  3FX3 A;  4QWQ A;  2LY2 A;  1N77 A;  1FBS A;  4LIT A;  3ABM H;  1XMX A;  4UB8 C;  2VKD A;  1IF1 A;  3K70 D;  2Y31 A;  2P6S A;  3HTU A;  3CLO A;  3PNT A;  2OV7 A;  4U87 A;  3ZPL A;  1JGG A;  3IAM 2;  3VSL A;  4M9Z A;  3C1D A;  2LKP A;  5EG0 B;  1ETQ A;  3PFI A;  4RGS A;  3EYI A;  2L7K A;  2K85 A;  2JRM A;  1FY7 A;  5GPA A;  1QZY A;  5AIQ A;  2JN6 A;  5FKO A;  5FKL A;  1JJ8 C;  4AM3 A;  1HLV A;  5ILS A;  1RR8 C;  2E2I J;  2KRF A;  3I4P A;  3P9I A;  3HRS A;  2JSC A;  4RAF A;  3JRA A;  3VOE A;  3LSJ A;  2YR2 A;  3GME A;  5GPC A;  3RZO J;  2PMZ A;  3KLO A;  1R5H A;  3L2V A;  1ETV A;  3AFH A;  5EZH A;  5K5R A;  3HYI A;  4S04 A;  2E34 A;  1ZHF A;  1LFB A;  3ZQC A;  2VIX A;  1OPC A;  2YUS A;  4KNY A;  1JUS A;  1XCB A;  2ZCW A;  1QPM A;  1ZLJ A;  2W57 A;  5DD8 A;  4D9J A;  1VQM I;  4F93 B;  3HRU A;  2COB A;  1ODD A;  3ESW B;  2GXA A;  5LHG A;  1F4K A;  2YS9 A;  3DEW A;  4E7H A;  2E1O A;  3NWS A;  3KPH A;  2ME6 A;  4AIH A;  1ZRF A;  2XSJ C;  4JK1 X;  4OOI A;  3DPL C;  5FO5 A;  3LWF A;  4BE1 A;  1EF4 A;  2TCT A;  2W48 A;  3F72 A;  1V3F A;  1D8J A;  3JAM Z;  1B72 B;  5B3S H;  1EV7 A;  4IHW A;  5B5E C;  3WTZ A;  1B9M A;  5FLM J;  4HF1 A;  1JGS A;  2ZSI B;  2CV2 A;  3U2R A;  3HOW J;  4BBR J;  4EGZ A;  3F8F A;  3BCA A;  4KFC A;  2DW4 A;  2I10 A;  4FQG A;  2B63 J;  5F0C A;  3BPV A;  1R23 A;  1RES A;  4XKW A;  1Q1V A;  5CPR B;  3GFI A;  2X85 A;  4QTR A;  3JRE A;  2KJC A;  1ON2 A;  1T2K A;  3X2Q H;  3E6D A;  3ZMU A;  3F21 A;  1MNE A;  2H8R A;  2JMW A;  3OYB A;  2KIM A;  5E3L A;  4AYB N;  1IN6 A;  5LEJ A;  5CKT A;  2QA4 I;  1O7F A;  5CYV A;  5JHU A;  4CCL A;  4ASN A;  5E3O A;  2XV4 S;  3H36 A;  2FD5 A;  2IBD A;  1X1P A;  2N8G A;  1ULY A;  4IRG A;  4B43 A;  4IHX A;  1IV8 A;  2VL8 A;  3V4G A;  1V4R A;  1E3P A;  5GTH C;  1UFM A;  5F0H A;  4BQO A;  1Z0X A;  1XGM A;  4XOP A;  2DJN A;  2OUM A;  5E3M A;  2VOP A;  1OR7 A;  5D5U B;  3SFI A;  3K4M A;  1OJL A;  2F5V A;  2XIG A;  4U0W A;  5CQE A;  4XLH A;  1EA3 A;  5E18 F;  2H6B A;  3BG7 A;  1BR1 A;  3BCB A;  2FML A;  3K0L A;  4NQW A;  1Z7L A;  2CS3 A;  2KIF A;  3N4M A;  2ELJ A;  3H92 A;  3K4B A;  2GWR A;  1WHU A;  2FX0 A;  4LLG F;  2V6E A;  1DUX C;  2A6T A;  4OIQ F;  2XAQ A;  4Y7N J;  1WGX A;  4IHS A;  5DV5 A;  1SD4 A;  2H1K A;  2YSR A;  3KEQ A;  1IXR C;  2WB1 A;  3L09 A;  3AG2 H;  1HW2 A;  1ACI A;  1MSE C;  3IUO A;  2VQG A;  1WQ2 A;  4HA8 A;  3CUQ C;  1I6X A;  2PMZ N;  2Y69 H;  1R71 A;  4YFK F;  4UV8 A;  3U1K A;  1IXS B;  2D2W A;  2OZ6 A;  1A6I A;  1W0U A;  2IS1 A;  5HLI A;  5IP9 J;  2CWE A;  1HOM A;  1HW1 A;  1I5Z A;  2DYR H;  3V8K A;  3VFZ A;  2PG4 A;  3J7Y J;  3RKQ A;  4L9J A;  2LF7 A;  1UG2 A;  3DLA A;  3WTY C;  1D0Z A;  3D0S A;  3C2G A;  3KP4 A;  3WU1 B;  3R61 A;  3GX4 X;  2R4G A;  3SZP A;  1UHM A;  2E1M B;  1XPX A;  3D5R C;  1S29 A;  4FAS D;  3F8C A;  2VQC A;  2P4W A;  2DOF A;  3M8F A;  2BEO A;  2EIN H;  4E70 A;  2DT5 A;  4XID A;  1FJL A;  4CHU A;  3I59 B;  4X1E A;  3PSF A;  3S16 J;  1QU3 A;  5B1B H;  2O03 A;  3KYC B;  3NEU A;  3HUG B;  4J00 A;  2MLK A;  4A93 J;  1D1B A;  4Q47 A;  2HVR A;  4QLC U;  3DPT A;  1IN7 A;  4XLN F;  3P5J A;  3BOQ A;  5FFZ A;  3A03 A;  2GOX B;  4F3Q A;  2ZB9 A;  4MTD A;  2RQP A;  4ZDL A;  2EFW A;  3GTO J;  3HM5 A;  2HYJ A;  3BG3 A;  4R79 A;  3DLL F;  1N75 A;  4D5C A;  1JKP C;  1T38 A;  4I01 A;  1A04 A;  1GVJ A;  1QHG A;  3GW2 A;  3VWB A;  1B6A A;  2LTP A;  2OAZ A;  1TW2 A;  2K7L A;  1AU7 A;  1Y1W J;  4ZYD A;  3BJA A;  4AWX B;  4G6T B;  2MH9 A;  1W7P D;  4B1R A;  5DM6 F;  2UWM A;  5E3N A;  3J7Z I;  2X51 A;  4E6K G;  3MZ8 A;  3IKV A;  2E60 A;  4M71 A;  1AOY A;  2V1U A;  1XMA A;  4LOC A;  3KP5 A;  5HLG A;  3GXO A;  4NC8 A;  2DOE A;  2HYG D;  3RZD J;  2OCE A;  3ZGK A;  4BUP A;  5FRM A;  2R7S A;  1P7J A;  1YHQ I;  2K40 A;  4L5J A;  2W25 A;  1JUM A;  5DD4 A;  1BOA A;  3ERE D;  1EKE A;  3K9T A;  1SC7 A;  2IS2 A;  2M34 A;  2VOD A;  2D1V A;  2K27 A;  2X6W A;  2EQR A;  2QBY A;  2IT0 A;  4Y3O A;  4EQQ A;  3REO A;  4UUS A;  4OMY A;  3PNV A;  5LHH A;  1ETX A;  1X2M A;  2JPB A;  1P4A A;  1RC9 A;  4F91 B;  4A0X A;  4ESF A;  1BOB A;  4RGX A;  1FX7 A;  5KVR A;  3TGN A;  2Y9Z A;  1ON1 A;  3CCL I;  1XX5 A;  1R00 A;  2TDX A;  2CGP A;  4B47 A;  3FWE A;  1KGS A;  3LOC A;  1Z3Y A;  4EGY A;  3RCO A;  2KZG A;  3FXK A;  1MKM A;  2V1D A;  5LRR A;  2OTL I;  2KIS A;  1MMG A;  5TGT A;  1Z67 A;  1IUF A;  4X0G A;  2MLG A;  3BRO A;  4M6Y A;  5EEA A;  4A3I J;  3GVA A;  3S3N A;  3CO7 C;  2VBW A;  2HS5 A;  3NRV A;  3LFU A;  4EJO A;  3CP8 A;  4EAT A;  3ZMT A;  2CW7 A;  3OIO A;  4LFU A;  4KUM A;  1YO5 C;  3HC7 A;  3HUG A;  2DMU A;  2DI3 A;  3VYS B;  1XG1 A;  5DUK A;  2VJI A;  1YJW I;  5JLW A;  1FTZ A;  3IP4 B;  2QWW A;  3G4S I;  2GA2 A;  1T0F C;  4KIC A;  4DNC A;  4PK4 A;  5L3E A;  3M1C A;  3OV8 A;  3JW4 A;  2K02 A;  4HNV A;  3VYR B;  5HLT A;  2VBZ A;  1ZLK A;  1JTX A;  2BZT A;  1FP1 D;  2FF4 A;  5DUI A;  1KU9 A;  2XAF A;  4C30 A;  1RR7 A;  4XLF A;  4NC7 A;  5ED4 A;  3DU6 A;  2PJR A;  2DT6 A;  4A3C J;  4KMU X;  2P0W A;  4B3A A;  2COM A;  3ZMV A;  2W84 A;  4ZJZ A;  1KZH A;  4ESJ A;  3BQY A;  5ILV A;  1X1D A;  3PQK A;  4M6X A;  1JKQ C;  3ZMD A;  3BZ6 A;  5IPA A;  3IRR A;  2Z1D A;  1V5E A;  1G2H A;  2VBY A;  1DP7 P;  4HX8 A;  2H94 A;  3I54 A;  4N4O B;  3I64 A;  4DBR A;  5LBQ A;  3GF2 A;  2L4A A;  3LST A;  2O0Y A;  2RNG A;  3CZ6 A;  4G9Y A;  4LB6 B;  4YFX F;  1JXS A;  1YG2 A;  4JX6 A;  5TJJ A;  1DPU A;  4ANJ A;  4IQJ A;  4OIP F;  1TWH J;  3EET A;  2HVQ A;  4TV7 A;  5H6Q A;  3P7N A;  1FYL A;  3EDP A;  2IVM A;  4BU2 A;  2XDV A;  1TNS A;  4KIT B;  3KCC A;  3KYL A;  2QQA A;  3FXQ A;  3HZJ A;  4JOM A;  2Q2E B;  3FK6 A;  2DDB A;  1B8I B;  1N25 A;  3CCY A;  3J80 K;  2KL4 A;  1UMQ A;  2ZME C;  4MTE A;  1FBQ A;  3RPQ A;  1W5C C;  4HYE A;  2L9N A;  4N9H A;  3DTI A;  4DQ2 A;  3LSR A;  1XN7 A;  1H8A C;  3OYC A;  4HX7 A;  2JVH A;  2GXG A;  3S17 J;  4FET A;  3PUB A;  2EV0 A;  4XRM A;  2VOO A;  2FUG 2;  1HBX G;  1D1A A;  3C2B A;  2ZSH B;  3O2P E;  4BY7 J;  2B0L A;  2AXT C;  2GIZ A;  2E71 A;  3K2Z A;  2DA5 A;  3K69 A;  4GCV A;  5K5O A;  4CDG A;  2P5K A;  1DU6 A;  4HF2 A;  2O8X A;  4RS8 A;  1I39 A;  2AHQ A;  3I55 I;  3OYJ A;  5E1Z B;  3F6V A;  1IDY A;  4JX5 A;  3TW6 A;  3ZQI A;  1HDP A;  4XN3 A;  5F1R A;  1Z7U A;  3WTW C;  1SVM A;  2L3D A;  3FXR A;  1X4P A;  5D6F A;  4ETS A;  4LG0 B;  1WH5 A;  1ZGA A;  4U7B A;  5FD5 A;  4R8H A;  5D5X B;  2QKM B;  1BC7 C;  1GT0 C;  3WE3 A;  3KFW X;  2Y0M A;  1J59 A;  3B6A A;  3WTX C;  4KDP A;  3HIF A;  2OQG A;  5DCF A;  4E7J A;  3R0J A;  1PP7 U;  1BI0 A;  1WRJ A;  3QYB A;  2LVS A;  2M30 A;  3E7L A;  5GTI C;  2GBY A;  3HHG A;  2VLA A;  4ZH4 F;  1WI3 A;  1ZK8 A;  4GRI A;  1J9I A;  1WWX A;  3SZG A;  4RB3 C;  2BHZ A;  4XL9 A;  3WGG A;  3CMM A;  4Y52 J;  4EM1 A;  2DFF A;  3G1M A;  1QQI A;  2G9W A;  4GGG A;  1R9T J;  4UB6 C;  5ICG A;  4RGU A;  1LB2 A;  4UNO A;  3I4M J;  3LAP A;  5C44 J;  1RUO A;  1O3T A;  2F5F A;  2LH9 A;  2VON A;  2L02 A;  5FRN A;  2MAB A;  1HKS A;  1J7K A;  5IOY A;  1PVE A;  2AQE A;  2EJR A;  4I0A A;  1YIJ I;  2ZFW A;  4XIC A;  4XRF A;  3CUO A;  4UUV A;  1KYZ A;  3QYE A;  3N97 A;  2FOW A;  1SVO A;  2O61 A;  2IJL A;  3A02 A;  2OPT A;  3DF8 A;  2VQL A;  3JSP A;  3UKG A;  4D5F A;  4B4C A;  1MDM B;  1T39 A;  1PYV A;  1GLN A;  2UV1 A;  1QVU A;  2DA7 A;  2EPF A;  1ZRC A;  3M4O J;  1Z3X A;  2X1C A;  1F36 A;  4HSR A;  5BPD A;  5EEG A;  3F23 A;  2XUB A;  3R6S A;  1MBK A;  3K6G A;  1SD6 A;  5HOD A;  4G7O F;  4JP0 A;  3GZ6 A;  1RPW A;  4XOR A;  3MZH A;  2P5V A;  1D3Y A;  1WKM A;  3J81 Z;  2HQN A;  4UVB A;  3IAS 2;  3RYP A;  3J7A Y;  3U1D A;  4PZJ A;  1G6N A;  2CQQ A;  1MD0 A;  2PBI A;  4M9X A;  3TP3 A;  2MC3 A;  1BIB A;  4OMZ A;  3G1O A;  3ECH A;  2FRH A;  1TT0 A;  2DMQ A;  1WVR A;  2KFD A;  1X1C A;  1MJB A;  5IYB J;  4AUX A;  2XGX A;  1HDD C;  2DJI A;  2XRN A;  1O57 A;  1YW8 A;  3JRF A;  4OIR F;  4N0B A;  2DAO A;  1W4M A;  2F5E A;  3BZK A;  5L3B A;  4AVP A;  2KDZ A;  1CF7 A;  4LG0 A;  4YIF A;  2NS8 A;  1Z77 A;  1SMY F;  2WAD A;  3R60 A;  2Y30 A;  4M6V A;  3L2Q A;  1LPQ A;  4KA4 A;  2QSF X;  4S05 A;  4ZYE A;  2NAZ A;  1SFE A;  3MAJ A;  1R22 A;  1USS A;  3GTJ J;  2CRG A;  3I4N J;  4Y4R A;  3OYA A;  1G59 A;  3V42 A;  3GTL J;  5DM7 F;  3CDI A;  3MMY B;  2NNN A;  4HLX A;  2YU3 A;  1VI0 A;  3L1P A;  4P9F A;  9ANT A;  1B59 A;  4EV0 A;  1ETW A;  2FBH A;  3FBN B;  2P81 A;  4A6D A;  4F55 A;  2EH3 A;  2W00 A;  4YII A;  2ZXJ A;  4EVI A;  2E2H J;  1VQN I;  3ZQL A;  5FKM A;  1OLT A;  2JUC A;  3GTQ J;  2R0Q C;  2ECB A;  2PEX A;  2LD5 A;  2F4I A;  4AC0 A;  3I71 A;  1ZEL A;  1QGP A;  2MG4 A;  2VPR A;  3F8B A;  3RDI A;  2BVL A;  3OSG A;  1TL8 A;  6PAX A;  4HX4 A;  2VC0 A;  1T56 A;  4ITV A;  3TBI A;  5F0F A;  1JTY A;  3TP0 A;  2ACJ A;  4DBQ A;  4HZF A;  1VQ6 I;  3IH2 A;  3FK7 A;  2IGK A;  1LVA A;  4O6J A;  1P4W A;  4BH9 A;  2DA4 A;  4BYY A;  4KT5 C;  3PFY A;  4RB0 A;  1TW3 A;  3JAM K;  3GFJ A;  1V5F A;  1WJB A;  4FHT A;  4Z6Y A;  1IRG A;  2X1E A;  2K9L A;  4A6E A;  5FLX K;  3L2U A;  4X6A J;  5L3C A;  4LIU A;  3S93 A;  3JRB A;  2JA6 J;  2R7W A;  5E1W A;  1MDM A;  1U0J A;  2L2O A;  5K1Y A;  5J1U A;  2M7B A;  3DXJ F;  5M5X J;  1ZAR A;  2Z16 A;  2ZKZ A;  1CGP A;  1XGS A;  5IOZ A;  3WTT C;  1U6G A;  2DCE A;  2FEZ A;  1K6O A;  1FMV A;  3G2B A;  3OYI A;  3ZN1 A;  3OYF A;  4QSH A;  4P96 A;  4ENM A;  1T8I A;  2IS4 A;  3KZZ A;  4OU0 A;  2QCO A;  1D8K A;  1MH3 A;  3M8J A;  3PUF A;  2XKO A;  4WF2 A;  4EMS A;  5EYR A;  1EH7 A;  1U9N A;  2STT A;  3MEX A;  1U8R A;  3H9Q A;  1SFK A;  1DU0 A;  1HC8 A;  2ZJQ F;  3BG6 A;  2ZC2 A;  2ZNY A;  3B6C A;  2CO5 A;  3F6O A;  1FLI A;  3TO6 A;  2O8K A;  3GLL A;  3ZCO A;  1FPQ A;  2ZJR F;  3RIR A;  1QA6 A;  4MQ9 F;  1ITY A;  2HXI A;  1X3Z B;  3F22 A;  3IRQ A;  4II2 A;  2R7R A;  5IYD J;  3RKW A;  4G7Z F;  4I7H A;  2F48 A;  2ZFU A;  3ZMZ A;  2XB0 X;  4EM0 B;  3VYT B;  3HL2 A;  4D1Q A;  1S7A A;  4M3B A;  2KPM A;  1YYV A;  4CCJ A;  1YE9 A;  4XM3 A;  3A2K A;  2XRO A;  4A12 A;  1ZQ3 P;  2BXZ A;  2IGO A;  3ABK H;  4HDU A;  2CUE A;  4LGW A;  4P1W A;  2DFH A;  4MHG A;  4IOC F;  4NQW B;  1YIO A;  1HXD A;  3R0A A;  2NNY A;  1X3W B;  5CQG A;  4ABZ A;  1HKQ A;  3TKY A;  4BAC A;  3I56 I;  3Q0W A;  1UB9 A;  2JRT A;  3CMY A;  4XRS G;  4HF0 A;  1Y8R B;  4RM2 A;  4ZZL A;  3W2V A;  1ZKG A;  4R1H A;  3FHZ A;  2JA5 J;  2M8G X;  3F8M A;  5DTD A;  3WTU C;  1W7P B;  2OF7 A;  3CTA A;  3V8L A;  1W36 C;  3BP8 A;  4MIM A;  4NHJ A;  1LFU P;  4CXF A;  2L7F P;  2JSP A;  1GV2 A;  3BTI A;  4GXO A;  5BMZ A;  4L0Y B;  5L3F A;  3CF5 F;  1LUJ B;  2R7F A;  4IL6 C;  4BL0 B;  1J75 A;  4XLA A;  1W5S A;  3P9K A;  2WBM A;  4Q4Z F;  2ESH A;  4XLP F;  1WJE A;  1S72 I;  2QSH X;  3HGG A;  2HFH A;  4M3G A;  3G71 I;  4EM2 A;  1H0M A;  1FIA A;  4IJA A;  2IP2 A;  4D7M A;  1O3S A;  2MD5 A;  2HQR A;  4U0Y A;  5ICC A;  3OOU A;  1O3R A;  4CCK A;  3WTV C;  1IXC A;  4I76 A;  5F6F A;  3RPU D;  2F4O B;  1ZGW A;  2EFO A;  4LK0 F;  3KZI C;  1F5T A;  5K5Q A;  4UHT A;  4D7N A;  1TLH B;  5LHI A;  2CMP A;  2P6T A;  3SHF A;  1UZC A;  1FOY A;  2GM4 A;  3OIQ A;  3S3O A;  2M3A A;  1Y8Q B;  3HSE A;  1BN5 A;  1VQ9 I;  1SMT A;  1LDJ A;  4RB1 A;  2ICW G;  3PQJ A;  2DTZ A;  2X1D A;  3I5U A;  3SQN A;  2NRA C;  1YTY A;  1WJC A;  2P8T A;  2X6O A;  3H3U A;  2DN0 A;  3HB9 A;  4HV5 A;  4L9N A;  4G94 A;  4NUB A;  2L7Z A;  1R4M B;  3EUH C;  5D8L B;  2DYS H;  2NVY J;  2NOJ B;  4F7Z A;  3NQO A;  4M3F A;  4PFO A;  2A3S A;  1ZR4 A;  4CUG A;  3ABU A;  3DKX A;  4FX4 A;  1IN8 A;  2HTS A;  2L5Q A;  4KN7 X;  5H20 A;  1SEU A;  5BNG A;  5AIP A;  3OYE A;  1Z6R A;  4BHP A;  1NHA A;  3K1N A;  4I0B A;  4ESB A;  4E7K A;  2GLO A;  3CJR B;  1MBF A;  2IRF G;  1I1G A;  4C3H J;  3OY9 A;  1SFU A;  3SYT A;  1YS7 A;  3H35 A;  3GWZ A;  2ELH A;  3H1C A;  3G1L A;  3D5S C;  2E1M C;  5DEQ A;  2MA3 A;  1XDU A;  1IN4 A;  1E2X A;  2HDW A;  5F27 A;  5D8K B;  1OCT C;  2DTR A;  5IP7 J;  1OCZ H;  2Q8K A;  2LYC A;  1S5L C;  3IH3 A;  3KET A;  3JRD A;  3AAF A;  1UEL B;  1SFO J;  4N4N B;  1SAU A;  2NVT J;  2HYF A;  5EZG A;  1KQ9 A;  1I1S A;  3PM1 A;  1NG6 A;  3GFM A;  4Z2Y A;  1W7P A;  2K4B A;  2OZU A;  3T5X A;  1FC3 A;  3DBL B;  2QBY B;  2L9S A;  4ON0 A;  5JR3 A;  3T1B A;  3G73 A;  1H9T A;  3T0Y A;  4EJV A;  4UUS B;  3ZP5 A;  4CGZ A;  2JA7 J;  1K83 J;  2R93 J;  3WG7 H;  3W6V A;  3CLQ A;  1HCR A;  1Y0N A;  5HDG A;  2BW3 B;  5LRS A;  1DGR M;  2DQL A;  3IC7 A;  4KJZ A;  3VB2 A;  3QWL A;  1JUP A;  3ASN H;  1KA8 A;  2JZY A;  5HS7 A;  2FQ3 A;  1IJW C;  1YJN I;  3S1Q J;  2DFE A;  3OL4 A;  3OWT A;  2BV6 A;  4PJ0 C;  1XGN A;  4M73 A;  2UZK A;  2M4G A;  3NAR A;  5J1Y A;  2IAI A;  3AG3 H;  4UVA A;  2LKS A;  2XAJ A;  3T8T A;  2BY3 A;  2ZBK A;  4UXN A;  2VT2 A;  1KQ0 A;  3VYU B;  3OS1 A;  2MSY A;  2V1X A;  1JJ6 C;  1JHF A;  2NVU B;  2K9S A;  2D45 A;  1G3Y A;  4HQM A;  3K4C A;  3HJE A;  1H88 C;  1HKT A;  2UUZ A;  1G4D A;  1MW7 A;  3OS2 A;  1B1B A;  3SEZ A;  4BJ6 C;  1L3L A;  5ERI A;  1NH3 A;  4IO9 F;  2LP0 A;  1OKR A;  1TQI A;  1XDS A;  4E7L A;  1JKO C;  2EBI A;  4Q48 A;  1R5G A;  3BJO A;  5D4S A;  2XSD C;  3JRC A;  2VPL A;  2VN2 A;  2X6Y A;  4XKC A;  2PJR B;  3SDG A;  3CCV I;  4G8X A;  2HDD A;  1MH4 A;  4HST A;  4DOZ A;  2HTJ A;  2XAG A;  3FDY A;  3QP5 A;  3OYN A;  4ZTJ A;  1LQ1 A;  1KU7 A;  2RQQ A;  3PIP F;  3QOP A;  3Q3S A;  2M87 A;  4WX9 A;  5TIS C;  3OYK A;  1JHH A;  3CCE I;  1VF9 A;  1OCR H;  2AS5 F;  3LSH A;  2JVG A;  4Q5S F;  1K61 A;  3L7W A;  2GQQ A;  3BG9 A;  1Y1V J;  2XGE A;  3V7C A;  2R92 J;  3MKL A;  4BAY A;  2HOE A;  1UHW A;  1AA7 A;  4IVN A;  4V2G A;  2WTE A;  3H9J A;  4ZZD A;  4CCM A;  2HDC A;  4M72 A;  3V7R A;  4DW6 A;  2K9Q A;  4AVZ A;  4YFN F;  3ISP A;  2R7O A;  3O6B B;  3BDD A;  3ABT A;  5EGO A;  2QEN A;  3JCU C;  4N9I A;  1LDD A;  4AD9 A;  2LRE A;  5JVG F;  3BZC A;  3S2D J;  1WPK A;  3WHC A;  5KK1 A;  2BW3 A;  2XPW A;  3DTE A;  2NOG A;  3K7A J;  2EB7 A;  4II3 A;  1IRX A;  5J8C A;  3UR3 C;  1R1U A;  4L9T A;  5M3M J;  2CUZ A;  4C2U A;  4PDK A;  2F6C A;  4WCG A;  1NK2 P;  1OIS A;  2QZ8 A;  2LY1 A;  2QKL B;  1XGO A;  1Z1D A;  4KIS A;  1OYI A;  2QQB A;  3GO5 A;  2WAE A;  1J0R A;  3LSK A;  1OCC H;  1YW7 A;  2K3P A;  3CC4 I;  2E35 A;  4AIK A;  2BVM A;  1WI9 A;  2ZJP F;  3DU5 A;  1FP2 A;  3E97 A;  1VQL I;  2WAQ A;  4DIQ A;  1FZP B;  2CU7 A;  2WY7 Q;  1STZ A;  3KEY A;  4HEA 2;  2CQN A;  2WA0 A;  1GVD A;  4JQF A;  1RET A;  1R1T A;  2AXL A;  2A6H F;  2PMU A;  2Z99 A;  3DPU A;  1MBJ A;  2A6E F;  3O8H A;  2R7Q A;  5JFR A;  5C4J J;  1KQ8 A;  4ENJ A;  4G6D A;  4IPA A;  2IS6 A;  1D5Y A;  2HQA A;  3QU3 A;  4B8X A;  4L18 B;  2FMY A;  1POG A;  2XVC A;  3QOE A;  4BKX A;  3TED A;  1XSV A;  4U88 A;  1Y6I A;  2PJP A;  3OYD A;  1ZRE A;  5TRD A;  2R7T A;  4JYK A;  4OWR B;  1BR4 A;  2FBI A;  2O9L A;  5FFX A;  2GIV A;  3EQL F;  2RAE A;  2FQ4 A;  1K4S A;  3HOZ J;  1IG7 A;  1GV5 A;  3CUQ A;  4XLE A;  3DKY A;  3L2W A;  4HG2 A;  3K1P A;  1XTA A;  5FLV A;  2Y75 A;  4RAZ A;  3ASO H;  2Z2S B;  2M5W A;  2YX4 A;  4PJJ A;  3H3V K;  1I27 A;  1VQO I;  2LOO A;  5DDG A;  3CC2 I;  4HBL A;  2IGN A;  1T33 A;  2AQF A;  4G7H F;  1ETO A;  1C0W A;  2J5O A;  2VKE A;  3E1S A;  4H0E A;  4UUT A;  3FZV A;  2DOD A;  5M3F J;  2DDA A;  3LL7 A;  5EEH A;  2GA1 A;  3TMO A;  4UV9 A;  3K4K A;  2DFI A;  3B02 A;  1IDZ A;  1U3E M;  2XRL A;  4EEF G;  3P9C A;  2E36 A;  2LC2 A;  1M1E B;  4RBO A;  3WGH A;  2DA6 A;  2V26 A;  2NVX J;  3K2A A;  1ENH A;  5C3E J;  2OD5 A;  1RI7 A;  4IX7 A;  2O5R A;  1PUE E;  2LR8 A;  2VBX A;  3W6K B;  4HPQ A;  1MJ9 A;  2ETH A;  3HPG A;  5KNL A;  2WWY A;  5E79 C;  1R36 A;  2DXI A;  1E17 A;  3K70 C;  4PFP A;  4I2O A;  2MGQ A;  3S15 J;  1QO0 D;  2WV1 A;  3ZN0 A;  1BBY A;  4I09 A;  3GBG A;  2NXN B;  3RKY A;  2MBF A;  4C3I J;  3IH4 A;  1L0O C;  5J4V A;  2M0C A;  1VQ8 I;  4IOA F;  2EZI A;  3A0H C;  4WXC A;  4CYD A;  4A0Y A;  1MMN A;  5E20 A;  4CCO A;  4CZZ A;  1FOW A;  3SJM A;  1LE8 A;  3J81 K;  3KZY A;  2XAU A;  4IEJ A;  1AHD P;  3IWF A;  2LY9 A;  3E5U A;  2RRE A;  2XPU A;  2B9S A;  1MSF C;  1LKX A;  1V54 H;  2P7V B;  3CQZ J;  1VFC A;  1U78 A;  1A36 A;  1VQK I;  2E1C A;  2O6G E;  4C9Y A;  1ZG1 A;  1XMK A;  3ML6 A;  2L7M P;  4Y15 A;  2GZW A;  1S7E A;  3WGI A;  1CF7 B;  3F9K A;  4U7D A;  1FSH A;  3CCS I;  3DP7 A;  1GHC A;  1O3Q A;  2WAQ N;  1MGT A;  3KYD B;  3RJP A;  4DGW B;  2KIQ A;  4F92 B;  3HKZ A;  2E7W A;  4DJA A;  3Q0V A;  1OYW A;  4L5E A;  3JSO A;  2LK2 A;  3BLY A;  3MQ0 A;  2Y9Y A;  5CVR A;  2BY1 A;  4ZDO A;  1MBE A;  5CVJ A;  3E6M A;  3PJR A;  1MNM C;  3EPZ A;  1OFC X;  2DBB A;  2RNJ A;  3W3C A;  1IRZ A;  3MKY B;  1FNN A;  1I3A A;  4V19 K;  2G7U A;  4BXU A;  4HDV A;  2LBF B;  1VND A;  1MBH A;  4JX4 A;  2QVO A;  2H6C A;  5EJC A;  2IGM A;  4BXX J;  2OQR A;  1FWZ A;  3C18 A;  2LKX A;  2FNP A;  1CQT A;  2DO7 A;  4RGR A;  3ZRG A;  4M3D A;  5JI6 A;  1FTT A;  3GTG J;  2E19 A;  3KE2 A;  3TDZ C;  2IA0 A;  3CD6 I;  2EV5 A;  4RMN A;  3NAU A;  1DP3 A;  2M8E A;  2DT7 B;  2LMD A;  1ETY A;  4XNF A;  4YG2 F;  3J7A O;  1E3O C;  1R7J A;  1T0F A;  3KP2 A;  4G12 A;  3W6J B;  3HRT A;  3AL0 B;  3MZY A;  5GP9 A;  5DCM B;  1YS6 A;  3FXJ A;  5L3D A;  2VQH A;  3SEQ A;  3OL3 A;  1QRY A;  2JA8 J;  5HOO A;  2I5U A;  2XAH A;  4QPQ A;  3J80 Z;  2KHM A;  2XHK A;  2MW8 A;  1R5I D;  5CVV A;  1ZH5 A;  3DKW A;  5HDN A;  1W5T A;  5FD6 A;  1I6H J;  5CVU A;  3S1N J;  1NK3 P;  2OC6 A;  4D0P A;  2OA4 A;  3U21 A;  2KRH A;  4UVC A;  4XK4 A;  1Y0U A;  2ZXW H;  1KON A;  2KT0 A;  2NYX A;  2CW8 A;  3F3X A;  1FIP A;  3LA3 A;  4RA2 A;  3ROU A;  4BJT A;  2M0M A;  3O8G A;  1HA8 A;  2Z5U A;  2A69 F;  2DMN A;  2X4H A;  3ZQQ A;  2E5Z A;  5HS8 A;  3RKX A;  1TZL A;  4CO8 A;  1P7I A;  1ZTR A;  2JK3 A;  2CQX A;  3RYR A;  3HOS A;  4DYR A;  5B1A H;  1U5T B;  2WV0 A;  3HXL A;  4CCN A;  4BBS J;  3L2R A;  3I3L A;  5FJ8 J;  1P92 A;  1I3Q J;  4P9U A;  3HDD A;  3A4C A;  2XGC A;  4PGG A;  1WZ2 A;  1SVL A;  3MD2 A;  4U0V A;  4C2T A;  2CUF A;  2RC4 A;  4WXH A;  2ZME A;  4YIR X;  3OMY A;  4F52 A;  4IHY A;  3PIO F;  1U8B A;  3H5N A;  5IT3 A;  1MMD A;  5B66 C;  3WG9 A;  2DMP A;  2QM3 A;  5ILU A;  3SXY A;  1R1V A;  2DA1 A;  1F1Z A;  2LBF A;  5GAG J;  1GDT A;  1QHH D;  2HOT A;  1ZG5 A;  5GAD J;  1T08 B;  4BXF A;  3E5X A;  4RAG A;  4XR6 A;  1IZ1 A;  2M9H A;  5EDN A;  5J3L A;  3EUK L;  4BEH A;  3ZQG A;  3N05 A;  4W1U A;  2IA2 A;  3FF5 A;  3H5A A;  5FKK A;  2PLY A;  2M1B A;  3L9F A;  1O7L A;  3HKZ N;  5LEK A;  2E2J J;  1RRJ A;  2EFQ A;  4HRI A;  2HPM A;  4IF4 A;  5DCM A;  3Q9V A;  1SAN A;  4LMY A;  1PDN C;  1HQC A;  3FMQ A;  1Z6T A;  3S1M J;  4M3E A;  1ZN2 A;  4BHB A;  4RLF A;  1TWA J;  2DA3 A;  5D6E A;  2H8W A;  4L9V A;  5K7H A;  2W85 A;  3KX2 A;  4NBQ A;  3LSG A;  2H27 A;  2A05 A;  1OR7 C;  3E0J B;  4AU7 A;  4I02 A;  3G6E I;  2JA2 A;  1Y39 A;  2AO9 A;  5LFA A;  2Y48 A;  3RSN A;  4CIC A;  4M9S A;  2FNA A;  4G6Q A;  2VE8 A;  2KIU A;  3MN2 A;  2PX9 A;  1X4O A;  4DYQ A;  1FYM A;  3BR6 A;  1K7A A;  3BR1 A;  2Q0O A;  1DDN A;  3GTK J;  5HLH A;  3A01 B;  2A68 F;  1DGW Y;  4EJW A;  2M2E A;  2VI6 A;  2L9R A;  2NS7 A;  2PN6 A;  4NNJ A;  4HNT A;  1N78 A;  3M7G A;  5J8F A;  4LD5 A;  4CYC B;  4LG3 A;  4FE4 A;  1U5T A;  4XQF A;  1AWC A;  5D5W B;  4A3B J;  5LD2 C;  3VEP A;  5A2Q Z;  1R4N B;  2G7H A;  2PFB A;  3A0B C;  2QEX I;  3F0C A;  3IV5 A;  2YX7 A;  1IO2 A;  2K9M A;  2KZV A;  1FSE A;  2GOM A;  2VJ4 A;  3RPU A;  1ZRD A;  5FKN A;  5JVT A;  3QAH A;  4A0Z A;  4A3E J;  2Y0S A;  5IT9 Z;  2HZT A;  1IW7 F;  1UAA A;  3DBR B;  1REP C;  2HNH A;  2IPQ X;  2E7X A;  3OYL A;  4BY1 J;  2FSW A;  3QP6 A;  4Y13 A;  1W1W E;  2EZK A;  3QYF A;  5LLQ A;  2EFP A;  2LNB A;  3KP3 A;  1YJ9 I;  1RZ4 A;  4PUS A;  3LQR A;  4XSZ F;  3V7S A;  3GYH X;  3JRH A;  2VAS A;  1LFP A;  3TOB A;  1ZR2 A;  1YOV B;  4BE0 A;  5KHD A;  2Q1Z B;  3VPR A;  3M9A A;  5E8I A;  2E1N A;  3FXM A;  1WCM J;  2D1H A;  1FOK A;  2R7V A;  2Z3Y A;  4OAY A;  2BE5 F;  2J5P A;  4B44 A;  4BQQ A;  1MMA A;  1YW9 A;  3JTH A;  3WE2 A;  1RUN A;  2HR3 A;  1G3T A;  2I8D A;  5DYM A;  1QPI A;  2L01 A;  3I9V 2;  2KRC A;  1BA5 A;  2OCC H;  3E6C C;  2EA4 A;  3A1Y A;  4GYI A;  1H9G A;  4FTH A;  1IUY A;  3ZR8 X;  1JE8 A;  2CG4 A;  1K79 A;  2VT3 A;  5K7Z A;  2ID3 A;  3HOU J;  2KJB A;  2V6C A;  4KIG A;  4JBA A;  4BS9 A;  5FLX Z;  4BHC A;  1XSX A;  1MZB A;  2CQK A;  1LEB A;  3S3M A;  1G3S A;  3PO2 J;  3BR3 A;  4IKF A;  3UNG C;  2IEK A;  1UHS A;  3G3Z A;  5CLS A;  2CQ7 A;  2M7A A;  3IHU A;  2EV6 A;  1J2X A;  1Z9C A;  1EH6 A;  4ZYG A;  2LG4 A;  3A01 A;  1S9H A;  2FJ1 A;  3CO6 C;  5J1R A;  5ICE A;  1GXP A;  2OU2 A;  3PO3 J;  1MJA A;  4CYC A;  3MKW B;  2QUF A;  2DLL A;  3IWZ A;  1KU2 A;  3S1R J;  3LSM A;  1UG0 A;  3W2W A;  2L54 A;  3CP2 A;  4MEX F;  3RTR A;  2ADU A;  1A6Q A;  2Z33 A;  4IZZ A;  2HOA A;  1SAX A;  4HLY A;  5EG0 A;  5CVI A;  2ZJ2 A;  2DMT A;  1O4X A;  3FMR A;  1B4A A;  1AKH B;  2UXX A;  4PJL A;  5H2F C;  4ZTF A;  2K4J A;  3KP6 A;  3BTL A;  2XC7 A;  2XB5 A;  1YX3 A;  5F08 A;  1TC3 C;  3C7J A;  4XON A;  4A5M A;  1ONV A;  1TTY A;  3WU0 A;  2ISZ A;  3GLX A;  1RKW A;  5ICF A;  1TQM A;  4BGD A;  3AKZ A;  3C3W A;  5D5V B;  1TNT A;  2XF5 A;  3E6B A;  4Y17 A;  4E7S A;  4RAY A;  2V4J C;  2RVC A;  1G8X A;  1HST A;  4IHT A;  2V79 A;  3FM3 A;  5E1X A;  2EZL A;  3H3Z A;  4MQV A;  2JQ7 A;  1DQU A;  4I98 B;  2CV1 A;  3S2H J;  5IYC J;  2W24 A;  3SZT A;  4ZYH A;  2LSO A;  2LF8 A;  5EGO B;  1JT0 A;  2HGC A;  1A31 A;  1F43 A;  2BY0 A;  2Y0S N;  4A3G J;  4DYC A;  1BM9 A;  2JTV A;  1FT9 A;  3FKI J;  5J47 A;  1BI3 A;  5F64 A;  1LEA A;  3ABL H;  3TO9 A;  3OR2 C;  1YFH A;  4P5O A;  3M8E A;  2DK8 A;  2H09 A;  4XMY A;  3MFK A;  3CCJ I;  3LA2 A;  4WWC A;  1WJ5 A;  2K3F A;  4BNC A;  4B09 A;  2HZD A;  2BXY A;  1J09 A;  2EFN A;  3JRG A;  4QPO A;  1BIA A;  2A5W A;  2FU4 A;  3C2H A;  3LMM A;  4CH7 A;  3TDU C;  4J01 A;  2F5C A;  3GZN B;  2VJJ A;  3DV8 A;  4CZC A;  3WTS C;  3CES A;  3CJQ B;  4ZYA A;  2JJ7 A;  1B72 A;  3WHB A;  1I50 J;  2HKX A;  4FIS A;  2A07 F;  2X0L A;  3GTP J;  2R7Z J;  1X19 A;  2QYO A;  3TW7 A;  1BC8 C;  2HEO A;  3K4J A;  3JR9 A;  4KN4 X;  4LJZ F;  3FIS A;  3LNQ A;  2MYS A;  2W1O A;  1VQ4 I;  1EJ9 A;  3OSF A;  2LFB A;  2XF7 A;  3GTM J;  2EIK H;  3K10 A;  1IC8 A;  3OYG A;  5BPI A;  3BT9 A;  5HS9 A;  2CUJ A;  1ERD A;  4B48 A;  3MWM A;  2UXN A;  3HPH A;  5J40 A;  1P9Q C;  3DFG A;  3Q5F A;  4EJU A;  4BDZ A;  1TT5 B;  2LRD A;  1ZG3 A;  3HSR A;  1P6R A;  4ENK A;  4A2U A;  3CF2 A;  3BPX A;  2YU9 J;  3WOD F;  2VC1 A;  5GAH J;  4IRH A;  4AID A;  1B9N A;  2CSO A;  3CUQ B;  1AKH A;  3PL8 A;  3LQQ A;  2W4S A;  1MND A;  3HRM A;  2RN7 A;  3BY6 A;  3BC8 A;  4ZC3 A;  2HVS A;  3JRI A;  3DEE A;  1Y56 A;  2QQ8 A;  1D0X A;  1FYK A;  1E0E A;  2RV8 A;  3GUD A;  1WJD A;  4UY8 I;  3I58 A;  1X3U A;  3TOA A;  4W97 A;  2K86 A;  3PSI A;  3HGY A;  2F5D A;  5K7F A;  1T98 A;  4OIN F;  3BR2 A;  4L5I A;  1K4T A;  1ZYR F;  1WSU A;  3M1E A;  3CJN A;  1VQ7 I;  1ETK A;  1F9N A;  3K4N A;  3VSK A;  3CME I;  3WU2 C;  1JKR C;  1QBJ A;  2HWV A;  2A5Y B;  3GFL A;  1K6Y A;  4PSX A;  3BR5 A;  3QRF F;  3HOT A;  1FMW A;  4GO1 A;  2O7O A;  3CJT B;  1OCO H;  1QZE A;  2OJE D;  3EUA A;  4LLL A;  1XSD A;  3DWL E;  1MBG A;  3TO7 A;  1Z05 A;  3I53 A;  2KLO A;  4ZDP A;  4DZJ A;  2EIM H;  3AG4 H;  1S7O A;  1XD7 A;  1PUF B;  1Z91 A;  3H5R A;  4BE2 A;  4GYG A;  2QSG X;  2ID6 A;  4NC6 A;  2V7F A;  2JUG A;  3ONQ A;  5KAI C;  3KP7 A;  3EUH A;  3S8P A;  1MMS A;  2R7D A;  4AIJ A;  2L4M A;  2R7U A;  5D4R A;  4MLO A;  4RDU A;  2P7C B;  2X48 A;  3E5Q A;  3QPH A;  4MGR A;  3I0T A;  4XSX F;  3MCZ A;  2WY8 Q;  2GAU A;  3ZQ7 A;  2KKO A;  4E4H A;  2PI0 A;  3CCM I;  1Z21 A;  4LB5 A;  3HOY J;  1MIJ A;  2JWT A;  3VOD A;  5M5W J;  1EH8 A;  1XC5 A;  1YRN B;  3QPL A;  1W36 D;  1BW5 A;  4M74 A;  5H6R A;  2ECC A;  4MFE A;  4IQ4 A;  3K1M A;  5GAE J;  1LE8 B;  2Y2Z A;  2KP6 A;  2O3F A;  2BOL A;  4KIF A;  2DPU A;  1P2F A;  4OIO F;  2WB1 N;  5BS6 A;  2HU9 A;  3I59 A;  3FKJ A;  1YLF A;  3DBH B;  2G0E A;  2BY2 A;  3CDH A;  4IXA A;  3OR1 C;  1RKT A;  2KDO A;  2R5Z B;  3M07 A;  2V9P A;  4BQN A;  2DK5 A;  2FOK A;  2HQ5 A;  1JI8 A;  4A5N A;  4Y33 A;  2KMU A;  4C2M J;  2V1N A;  4I99 C;  1RIO H;  2VKH A;  2F2E A;  4LK1 F;  2LLK A;  1X58 A;  5J4Y A;  4LLN A;  5JLX A;  3Q9S A;  3JTG A;  1U9O A;  2CH0 A;  1LJ9 A;  1LDK B;  1BJA A;  4XKV A;  4FE7 A;  3BWG A;  1IAW A;  4K2E A;  3TQN A;  2OBP A;  2C6Y A;  1GUU A;  3AG1 H;  3CCQ I;  2ZO4 A;  4MEY F;  1Q1H A;  3KLN A;  5E17 F;  1QZZ A;  3LAJ A;  2K9N A;  4I6Z A;  3K4L A;  3H0D A;  1FOX A;  4A3M J;  2WC2 A;  3HOX J;  4GDF A;  2RKH A;  2M45 A;  2R3S A;  2QF7 A;  1WFX A;  2EA2 A;  3TL4 X;  4YRV A;  1BW6 A;  4S0H B;  2NVQ J;  1J5Y A;  4KIB A;  1PUF A;  2DU9 A;  4XOT A;  1T95 A;  3ZOB A;  4A3D J;  2MH2 A;  2D5V A;  5F04 A;  3M3Y J;  3QQA A;  3VDX A;  5DS9 A;  2RDP A;  2VXZ A;  4A3K J;  5C4X J;  3HG9 A;  4ENN A;  2CV0 A;  5IP6 A;  4A3F J;  1LVK A;  1S6L A;  2XKP A;  5KCM A;  2ME0 A;  5BQT A;  4BDY A;  1IN5 A;  1R58 A;  1SFX A;  2EWN A;  4BJ5 C;  4CA0 A;  1ZAO A;  2VB6 A;  5CJ9 A;  4RB2 C;  1YRN A;  4NB5 A;  3OS0 A;  4GFB A;  4NDL A;  2A61 A;  3OYM A;  1UST A;  2TRT A;  1K78 B;  1BL0 A;  2H1L A;  3QU6 A;  5FRO A;  1BR2 A;  2QGU A;  4O5V A;  2BBY A;  4IHV A;  1BI1 A;  1ORK A;  2ZXH A;  2HXO A;  2BHY A;  3MVP A;  3R4K A;  1WJA A;  1V5G A;  3OOP A;  1X2N A;  3RQ4 A;  3U9G A;  3BTC A;  4MFD A;  4WK8 F;  3S14 J;  2EIL H;  2IXS A;  5F1J A;  3COA C;  5J6X A;  4FCY A;  3ECO A;  3ZQH A;  3ULQ B;  1BJZ A;  1VQ5 I;  1UJ8 A;  1V55 H;  4YEJ A;  4B3X A;  1T6S A;  2R5Z A;  1TQP A;  2V9K A;  3QPT A;  2CFX A;  3T8R A;  3BG5 A;  3HEF A;  3AL0 C;  2DPD A;  4PJN A;  2ZME B;  2ZXI A;  2YPR A;  1S3J A;  2W7N A;  3S2W A;  5E8G A;  1YI2 I;  2JPC A;  3FHN A;  3V8J A;  3OYH A;  4PSW A;  1R49 A;  3GZ5 A;  2FXA A;  3D5L A;  2R5Y B;  3FXO A;  1XB4 A;  1VQP I;  3B73 A;  2NS0 A;  4KYW A;  3ERM A;  3Q0U A;  2IW5 A;  1LNW A;  2DA2 A;  2L0K A;  3CMA I;  2EIJ H;  3KEO A;  3LSP A;  1XS9 A;  3RI4 A;  4DZP A;  4BEH B;  3FBI B;  4MO7 A;  1PJR A;  1IRF A;  5L3G A;  2FE3 A;  4H4K C;  2XAS A;  3HHH A;  2HKO A;  2WAF A;  3LA7 A;  1QVT A;  3W2A A;  4RM3 A;  4HQE A;  4PCQ A;  4PGH A;  4CSW A;  2PMH A;  1VTN C;  1U5T C;  4A69 C;  5JHF A;  3HTS B;  4FX0 A;  4J19 A;  1OCP A;  4A3J J;  1X1B A;  1XCV A;  3RQI A;  4A3L J;  1TWC J;  3DTK A;  3LFK A;  3QOD A;  5FB2 A;  2XF6 A;  3BR0 A;  3IKT A;  2HOS A;  3LSI A;  2Q2E A;  1NG7 A;  3QPS A;  1B8I A;  1OYY A;  3BQZ A;  4HAM A;  2VUM J;  2X6X A;  1A35 A;  2RGV A;  3SFZ A;  4LIV A;  2ELK A;  1KU3 A;  3HBL A;  3ELK A;  3CCU I;  2DOA A;  2GXB A;  1RNL A;  1OQY A;  4QIW N;  3DQV C;  4IRI A;  1P4X A;  1K78 A;  2VKV A;  4C3J J;  2L9V A;  1WH7 A;  5IY5 H;  1W0T A;  5M5Y J;  4O3M A;  1G3W A;  1IV6 A;  2M4K A;  3FMS A;  3H9G A;  2MFZ A;  3FM5 A;  4V2F A;  4OAZ A;  4YEL A;  1DPR A;  3FXU A;  1HF0 A;  1KYW A;  2KQR A;  5HNF A;  2LDU A;  2IA1 A;  3L2C A;  2VE9 A;  3E3V A;  3HOV J;  1ZGJ A;  4E7I A;  1HW5 A;  2XGD A;  1U2W A;  3CC7 I;  1R6R A;  4P55 A;  5A2Q K;  2ISY A;  2STW A;  1JT6 A;  2CJJ A;  2BYV E;  4MNU A;  4RLQ A;  3HSF A;  4HW0 A;  4XN0 A;  2CW0 F;  4L0Z B;  5IT9 K;  2B7E A;  3FXL A;  3OIP A;  4XBF A;  1YX5 A;  4XRS A;  4WXD A;  1SD7 A;  3O3K A;  2X9D A;  3GEZ A;  2R5Y A;  1HSJ A;  3D1N I;  1FEX A;  2CYY A;  3DEU A;  1WJF A;  5HNH A;  3NWT A;  1VZ0 A;  2W82 A;  4FT8 A;  2ESN A;  4HNU A;  3KIO A;  4KT6 A;  4HOB A;  1E3H A;  2VXD A;  2MD0 A;  2ZNZ A;  1GXQ A;  2OTJ I;  3BTJ A;  2VJ5 A;  4EJT A;  1IGN A;  3MKZ A;  2V9V A;  1QNT A;  5FGM A;  1A5J A;  1PP8 F;  5AON A;  5BOX A;  1TWF J;  3DCF A;  2EZH A;  1BI2 A;  3L00 A;  5HDK A;  1H89 C;  2R7X A;  3H0G J;  1SD5 A;  1APL C;  1NTC A;  1TP4 A;  2MC4 A;  1TBX A;  2XPV A;  4KMF A;  2JT1 A;  1X1A A;  2FA5 A;  5LGN A;  1D1C A;  4E7Z A;  1YQA A;  3SDB A;  1UCR A;  3EYY A;  5EF6 A;  1S8N A;  2EK5 A;  5KAF C;  2K5C A;  3ZMS A;  3FIW A;  3ZXS A; 
#chains in the Genus database with same CATH homology
 2Z9O A;  2QQ9 A;  2P5L C;  2PQ8 A;  4BQA A;  2FBK A;  1FBU A;  3F8N A;  1OMI A;  4HV6 A;  2QLZ A;  3BJ6 A;  2DQR A;  3IL2 A;  5LGU A;  5LGT A;  2BGC A;  5HVQ C;  1D5V A;  3FX3 A;  4QWQ A;  1FBS A;  1IF1 A;  2P6S A;  3HTU A;  3CLO A;  3ZPL A;  4M9Z A;  3C1D A;  2LKP A;  3PFI A;  4RGS A;  3EYI A;  1FY7 A;  1QZY A;  5AIQ A;  5ILS A;  2KRF A;  3I4P A;  3P9I A;  3HRS A;  2JSC A;  3VOE A;  2YR2 A;  3KLO A;  1R5H A;  5K5R A;  3HYI A;  4S04 A;  1ZHF A;  1OPC A;  4KNY A;  1XCB A;  2ZCW A;  1QPM A;  1ZLJ A;  2W57 A;  5DD8 A;  3HRU A;  1ODD A;  5LHG A;  1F4K A;  4AIH A;  1ZRF A;  4JK1 X;  4OOI A;  3DPL C;  5FO5 A;  3LWF A;  3F72 A;  1V3F A;  1D8J A;  3JAM Z;  1EV7 A;  3WTZ A;  1B9M A;  4HF1 A;  1JGS A;  3U2R A;  4EGZ A;  3F8F A;  4KFC A;  2DW4 A;  3BPV A;  1R23 A;  3GFI A;  2KJC A;  1ON2 A;  1T2K A;  3E6D A;  3ZMU A;  3F21 A;  2KIM A;  1IN6 A;  5LEJ A;  1O7F A;  5CYV A;  5JHU A;  4ASN A;  2XV4 S;  1ULY A;  4IRG A;  3V4G A;  1V4R A;  1UFM A;  1XGM A;  2VOP A;  1OR7 A;  5D5U B;  4U0W A;  2XIG A;  5E18 F;  2H6B A;  2FML A;  3K0L A;  4NQW A;  2KIF A;  3N4M A;  3H92 A;  2GWR A;  4LLG F;  1DUX C;  4OIQ F;  2XAQ A;  4IHS A;  5DV5 A;  1SD4 A;  2YSR A;  3KEQ A;  1IXR C;  3L09 A;  1HW2 A;  1WQ2 A;  4HA8 A;  3CUQ C;  1I6X A;  4YFK F;  4UV8 A;  1IXS B;  2D2W A;  2OZ6 A;  5HLI A;  2CWE A;  1HW1 A;  1I5Z A;  3V8K A;  3VFZ A;  2PG4 A;  4L9J A;  2LF7 A;  3WTY C;  3D0S A;  3KP4 A;  3WU1 B;  3R61 A;  3GX4 X;  3SZP A;  1UHM A;  1S29 A;  3F8C A;  3M8F A;  2P4W A;  2BEO A;  4E70 A;  2DT5 A;  4CHU A;  3I59 B;  2O03 A;  3NEU A;  2MLK A;  4Q47 A;  4QLC U;  3DPT A;  1IN7 A;  4XLN F;  3BOQ A;  5FFZ A;  4MTD A;  2RQP A;  2EFW A;  4R79 A;  1T38 A;  4I01 A;  1A04 A;  1GVJ A;  3GW2 A;  1B6A A;  2OAZ A;  1TW2 A;  2K7L A;  4ZYD A;  3BJA A;  4AWX B;  2MH9 A;  1W7P D;  2UWM A;  3IKV A;  4M71 A;  1AOY A;  2V1U A;  1XMA A;  3KP5 A;  5HLG A;  3GXO A;  2HYG D;  4L5J A;  2W25 A;  5DD4 A;  1BOA A;  3ERE D;  3K9T A;  2VOD A;  2D1V A;  2K27 A;  2QBY A;  2IT0 A;  4EQQ A;  3REO A;  4OMY A;  5LHH A;  2JPB A;  1P4A A;  4A0X A;  4ESF A;  4RGX A;  1FX7 A;  5KVR A;  3TGN A;  1ON1 A;  1R00 A;  2TDX A;  2CGP A;  3FWE A;  1KGS A;  4EGY A;  1MKM A;  2V1D A;  5LRR A;  2MLG A;  3BRO A;  4M6Y A;  3GVA A;  3CO7 C;  2VBW A;  2HS5 A;  3NRV A;  4EJO A;  3ZMT A;  4LFU A;  4KUM A;  1YO5 C;  3HUG A;  2DI3 A;  5DUK A;  2QWW A;  2GA2 A;  4KIC A;  4DNC A;  5L3E A;  3OV8 A;  3JW4 A;  2K02 A;  2VBZ A;  1ZLK A;  1FP1 D;  2FF4 A;  5DUI A;  1KU9 A;  2XAF A;  5ED4 A;  4KMU X;  2COM A;  3ZMV A;  2W84 A;  4ESJ A;  5ILV A;  3PQK A;  4M6X A;  3ZMD A;  3BZ6 A;  3IRR A;  2VBY A;  1DP7 P;  4HX8 A;  2H94 A;  3I54 A;  5LBQ A;  3I64 A;  3GF2 A;  2L4A A;  3LST A;  2O0Y A;  4G9Y A;  4YFX F;  4LB6 B;  1JXS A;  1YG2 A;  5TJJ A;  1DPU A;  4OIP F;  3EET A;  4TV7 A;  1FYL A;  5H6Q A;  3P7N A;  3EDP A;  2IVM A;  1TNS A;  3KCC A;  2QQA A;  3FXQ A;  3J80 K;  4MTE A;  1FBQ A;  3RPQ A;  4HYE A;  4N9H A;  4DQ2 A;  1XN7 A;  4HX7 A;  2GXG A;  2EV0 A;  2VOO A;  1HBX G;  3O2P E;  2B0L A;  3K2Z A;  3K69 A;  4GCV A;  5K5O A;  4CDG A;  2P5K A;  4HF2 A;  2O8X A;  4RS8 A;  5E1Z B;  3F6V A;  5F1R A;  1Z7U A;  3WTW C;  2L3D A;  3FXR A;  5D6F A;  4LG0 B;  4ETS A;  1ZGA A;  4U7B A;  5FD5 A;  4R8H A;  5D5X B;  1BC7 C;  3WE3 A;  3KFW X;  2Y0M A;  1J59 A;  3WTX C;  4KDP A;  3HIF A;  2OQG A;  5DCF A;  3R0J A;  1PP7 U;  1BI0 A;  1WRJ A;  2M30 A;  3HHG A;  4ZH4 F;  1J9I A;  1WWX A;  4RB3 C;  3WGG A;  4EM1 A;  1QQI A;  2G9W A;  4GGG A;  4UNO A;  5ICG A;  4RGU A;  1LB2 A;  3LAP A;  1RUO A;  1O3T A;  2F5F A;  2VON A;  2L02 A;  1HKS A;  1J7K A;  2EJR A;  4I0A A;  2ZFW A;  4XRF A;  3CUO A;  4UUV A;  1KYZ A;  3N97 A;  2O61 A;  2IJL A;  3DF8 A;  3JSP A;  1MDM B;  1T39 A;  1ZRC A;  5BPD A;  5EEG A;  3F23 A;  2XUB A;  3R6S A;  1SD6 A;  3GZ6 A;  3MZH A;  2P5V A;  1D3Y A;  1WKM A;  3J81 Z;  2HQN A;  4UVB A;  3RYP A;  3U1D A;  4PZJ A;  1G6N A;  1MD0 A;  2PBI A;  4M9X A;  2MC3 A;  1BIB A;  4OMZ A;  3ECH A;  2FRH A;  1MJB A;  2XGX A;  2XRN A;  1O57 A;  1YW8 A;  4OIR F;  4N0B A;  2DAO A;  1W4M A;  2F5E A;  5L3B A;  4AVP A;  1CF7 A;  4LG0 A;  4YIF A;  1SMY F;  3R60 A;  4KA4 A;  4S05 A;  4ZYE A;  2NAZ A;  1SFE A;  3MAJ A;  1R22 A;  1USS A;  2NNN A;  4HLX A;  2YU3 A;  4P9F A;  1B59 A;  4EV0 A;  2FBH A;  4A6D A;  4YII A;  4EVI A;  2ZXJ A;  2PEX A;  3I71 A;  1QGP A;  3RDI A;  3F8B A;  6PAX A;  4HX4 A;  2VC0 A;  2ACJ A;  4HZF A;  1LVA A;  4O6J A;  1P4W A;  4BH9 A;  4BYY A;  4KT5 C;  4RB0 A;  1TW3 A;  3JAM K;  3GFJ A;  4FHT A;  1IRG A;  4A6E A;  5FLX K;  5L3C A;  5E1W A;  1MDM A;  5K1Y A;  3DXJ F;  1ZAR A;  2ZKZ A;  1CGP A;  1XGS A;  3WTT C;  1U6G A;  2FEZ A;  1K6O A;  3ZN1 A;  4P96 A;  4ENM A;  3KZZ A;  4OU0 A;  1D8K A;  4EMS A;  4WF2 A;  2XKO A;  1EH7 A;  2STT A;  3MEX A;  1U8R A;  2ZNY A;  2CO5 A;  3F6O A;  1FLI A;  3TO6 A;  1FPQ A;  3RIR A;  4MQ9 F;  3F22 A;  3IRQ A;  3RKW A;  4G7Z F;  4I7H A;  3ZMZ A;  4EM0 B;  1S7A A;  1YYV A;  2XRO A;  4A12 A;  4HDU A;  4LGW A;  4MHG A;  1YIO A;  1HXD A;  3R0A A;  2NNY A;  1HKQ A;  3TKY A;  1UB9 A;  2JRT A;  4HF0 A;  4ZZL A;  4R1H A;  3FHZ A;  3F8M A;  3WTU C;  1W7P B;  3CTA A;  3V8L A;  3BP8 A;  4NHJ A;  4CXF A;  4GXO A;  5BMZ A;  4L0Y B;  5L3F A;  2R7F A;  1J75 A;  1W5S A;  3P9K A;  4Q4Z F;  2ESH A;  4XLP F;  2HFH A;  4EM2 A;  1H0M A;  4IJA A;  2IP2 A;  1O3S A;  2MD5 A;  2HQR A;  4U0Y A;  5ICC A;  1O3R A;  3WTV C;  1IXC A;  5F6F A;  2EFO A;  4LK0 F;  1F5T A;  5K5Q A;  4UHT A;  1TLH B;  5LHI A;  2P6T A;  3SHF A;  3HSE A;  1BN5 A;  1SMT A;  1LDJ A;  4RB1 A;  3PQJ A;  2NRA C;  3I5U A;  3SQN A;  1YTY A;  2P8T A;  3H3U A;  4HV5 A;  4L9N A;  5D8L B;  3HOT A;  4G94 A;  4F7Z A;  3NQO A;  2A3S A;  3ABU A;  4FX4 A;  1IN8 A;  2HTS A;  4KN7 X;  5H20 A;  5AIP A;  1Z6R A;  4BHP A;  1NHA A;  3K1N A;  4I0B A;  4ESB A;  2IRF G;  1I1G A;  1SFU A;  1YS7 A;  3GWZ A;  2ELH A;  5DEQ A;  2MA3 A;  1XDU A;  1IN4 A;  1E2X A;  5D8K B;  2DTR A;  2Q8K A;  3KET A;  3AAF A;  2HYF A;  1KQ9 A;  1I1S A;  3GFM A;  4Z2Y A;  1W7P A;  2K4B A;  2OZU A;  3T5X A;  1FC3 A;  2QBY B;  4ON0 A;  5JR3 A;  3T1B A;  3G73 A;  1H9T A;  3ZP5 A;  3T0Y A;  4EJV A;  4CGZ A;  5HDG A;  5LRS A;  2DQL A;  3IC7 A;  3VB2 A;  1KA8 A;  2JZY A;  5HS7 A;  2FQ3 A;  2BV6 A;  1XGN A;  4M73 A;  2UZK A;  4UVA A;  2XAJ A;  3T8T A;  2ZBK A;  4UXN A;  2VT2 A;  1KQ0 A;  2V1X A;  1JHF A;  2D45 A;  1G3Y A;  4HQM A;  1HKT A;  1G4D A;  1B1B A;  1L3L A;  5ERI A;  1OKR A;  1TQI A;  1XDS A;  4Q48 A;  1R5G A;  3BJO A;  5D4S A;  2VN2 A;  4G8X A;  2HTJ A;  2XAG A;  3QP5 A;  1LQ1 A;  1KU7 A;  3QOP A;  2M87 A;  4WX9 A;  1JHH A;  2AS5 F;  4Q5S F;  3L7W A;  2GQQ A;  3V7C A;  4BAY A;  2HOE A;  1UHW A;  4IVN A;  2WTE A;  4ZZD A;  2HDC A;  4M72 A;  3V7R A;  4YFN F;  3ISP A;  3O6B B;  3BDD A;  3ABT A;  2QEN A;  4N9I A;  1LDD A;  4AD9 A;  5KK1 A;  2EB7 A;  5J8C A;  1R1U A;  4L9T A;  4PDK A;  4WCG A;  2QZ8 A;  1XGO A;  1Z1D A;  1OYI A;  2QQB A;  3GO5 A;  1J0R A;  1YW7 A;  4AIK A;  1WI9 A;  1FP2 A;  3E97 A;  1FZP B;  1STZ A;  4JQF A;  1R1T A;  2AXL A;  2A6H F;  2PMU A;  2Z99 A;  2A6E F;  5JFR A;  1KQ8 A;  4ENJ A;  4G6D A;  4IPA A;  3QU3 A;  4B8X A;  4L18 B;  2FMY A;  2XVC A;  1XSV A;  4U88 A;  2PJP A;  1ZRE A;  5TRD A;  2FBI A;  5FFX A;  2GIV A;  3EQL F;  3CUQ A;  3K1P A;  2Y75 A;  4RAZ A;  2M5W A;  2YX4 A;  1I27 A;  5DDG A;  4HBL A;  4G7H F;  1C0W A;  2J5O A;  4H0E A;  3FZV A;  5EEH A;  2GA1 A;  4UV9 A;  2DFI A;  3B02 A;  1U3E M;  3P9C A;  3WGH A;  2OD5 A;  1RI7 A;  1PUE E;  2VBX A;  3W6K B;  4G7O F;  1MJ9 A;  2ETH A;  2WWY A;  1R36 A;  1E17 A;  4I2O A;  1QO0 D;  3ZN0 A;  1BBY A;  4I09 A;  3RKY A;  2MBF A;  1L0O C;  4WXC A;  4CYD A;  4A0Y A;  5E20 A;  4CZZ A;  3J81 K;  3KZY A;  3IWF A;  3E5U A;  2P7V B;  1U78 A;  2E1C A;  2O6G E;  1ZG1 A;  1XMK A;  3ML6 A;  4Y15 A;  2GZW A;  3WGI A;  1CF7 B;  4U7D A;  1FSH A;  3DP7 A;  1GHC A;  1O3Q A;  1MGT A;  3RJP A;  2E7W A;  1OYW A;  3JSO A;  3MQ0 A;  5CVR A;  5CVJ A;  3E6M A;  2DBB A;  2RNJ A;  1FNN A;  2G7U A;  4BXU A;  4HDV A;  2QVO A;  2H6C A;  2OQR A;  1FWZ A;  3C18 A;  2FNP A;  2DO7 A;  4RGR A;  5JI6 A;  3KE2 A;  3TDZ C;  2IA0 A;  2EV5 A;  2M8E A;  4YG2 F;  3J7A O;  1R7J A;  1T0F A;  3KP2 A;  3W6J B;  3HRT A;  3MZY A;  5DCM B;  1YS6 A;  5L3D A;  5HOO A;  2XAH A;  3J80 Z;  2XHK A;  5CVV A;  1ZH5 A;  3DKW A;  5HDN A;  1W5T A;  5FD6 A;  5CVU A;  4D0P A;  2OA4 A;  4UVC A;  1Y0U A;  3LA3 A;  2NYX A;  3F3X A;  3ROU A;  2Z5U A;  2A69 F;  2X4H A;  5HS8 A;  3RKX A;  4CO8 A;  3RYR A;  3HOS A;  1U5T B;  2WV0 A;  1P92 A;  4P9U A;  4PGG A;  4U0V A;  2RC4 A;  4WXH A;  2ZME A;  5IT3 A;  3WG9 A;  2QM3 A;  5ILU A;  3SXY A;  1R1V A;  1F1Z A;  1ZG5 A;  3E5X A;  1IZ1 A;  2IA2 A;  3FF5 A;  2PLY A;  2M1B A;  3L9F A;  1O7L A;  5LEK A;  2EFQ A;  1PDN C;  4IF4 A;  5DCM A;  3Q9V A;  4LMY A;  1HQC A;  3FMQ A;  1Z6T A;  1ZN2 A;  4BHB A;  5D6E A;  4L9V A;  2W85 A;  2H27 A;  4I02 A;  2Y48 A;  4CIC A;  4M9S A;  2FNA A;  4G6Q A;  2VE8 A;  2KIU A;  1FYM A;  1K7A A;  2Q0O A;  1DDN A;  5HLH A;  2A68 F;  4EJW A;  2PN6 A;  3M7G A;  5J8F A;  4LD5 A;  1U5T A;  1AWC A;  5D5W B;  3VEP A;  5A2Q Z;  2G7H A;  2PFB A;  2YX7 A;  1FSE A;  3RPU A;  1ZRD A;  5JVT A;  3QAH A;  4A0Z A;  5IT9 Z;  2HZT A;  1IW7 F;  1REP C;  2IPQ X;  2E7X A;  2FSW A;  3QP6 A;  4Y13 A;  5LLQ A;  2EFP A;  2LNB A;  3KP3 A;  1RZ4 A;  3GYH X;  3V7S A;  3LQR A;  4XSZ F;  3TOB A;  3M9A A;  5E8I A;  2E1N A;  2D1H A;  1FOK A;  2Z3Y A;  2BE5 F;  2J5P A;  1YW9 A;  3JTH A;  3WE2 A;  1RUN A;  2HR3 A;  1G3T A;  5DYM A;  2L01 A;  3E6C C;  2EA4 A;  4GYI A;  1H9G A;  1IUY A;  1JE8 A;  2CG4 A;  1K79 A;  2VT3 A;  2KJB A;  2V6C A;  4KIG A;  4JBA A;  5FLX Z;  4BHC A;  1XSX A;  1MZB A;  2CQK A;  1LEB A;  1G3S A;  3G3Z A;  5CLS A;  3IHU A;  2EV6 A;  1J2X A;  1Z9C A;  1EH6 A;  4ZYG A;  3CO6 C;  5ICE A;  1GXP A;  2OU2 A;  1MJA A;  2QUF A;  2DLL A;  3IWZ A;  1KU2 A;  2L54 A;  4MEX F;  3RTR A;  2ADU A;  2Z33 A;  1SAX A;  4HLY A;  5CVI A;  2ZJ2 A;  3FMR A;  1B4A A;  2UXX A;  2K4J A;  3KP6 A;  3C7J A;  4A5M A;  1ONV A;  1TTY A;  3WU0 A;  2ISZ A;  3GLX A;  5ICF A;  1TQM A;  3C3W A;  5D5V B;  1TNT A;  3E6B A;  4Y17 A;  4RAY A;  2RVC A;  1HST A;  4IHT A;  2V79 A;  3FM3 A;  5E1X A;  3H3Z A;  4MQV A;  4I98 B;  2W24 A;  3SZT A;  4ZYH A;  2LSO A;  2LF8 A;  2HGC A;  1BM9 A;  2JTV A;  1FT9 A;  1BI3 A;  5F64 A;  1LEA A;  3TO9 A;  1YFH A;  4P5O A;  3M8E A;  2DK8 A;  2H09 A;  3MFK A;  3LA2 A;  4WWC A;  4BNC A;  4B09 A;  2EFN A;  1BIA A;  2FU4 A;  3TDU C;  2F5C A;  3DV8 A;  3WTS C;  2HKX A;  2A07 F;  2X0L A;  2QYO A;  1BC8 C;  2HEO A;  4KN4 X;  4LJZ F;  5BPI A;  5HS9 A;  3MWM A;  2UXN A;  3DFG A;  3Q5F A;  4EJU A;  1ZG3 A;  3HSR A;  1P6R A;  4ENK A;  4A2U A;  3BPX A;  3WOD F;  2VC1 A;  4IRH A;  1B9N A;  2CSO A;  3CUQ B;  3LQQ A;  3HRM A;  2RN7 A;  3BY6 A;  1FYK A;  2RV8 A;  3GUD A;  3I58 A;  1X3U A;  3TOA A;  2K86 A;  2F5D A;  1T98 A;  4OIN F;  4L5I A;  1ZYR F;  1WSU A;  3M1E A;  3CJN A;  1F9N A;  1QBJ A;  2HWV A;  2A5Y B;  3GFL A;  3QRF F;  4GO1 A;  4LLL A;  1XSD A;  3TO7 A;  1Z05 A;  3I53 A;  1S7O A;  1XD7 A;  1Z91 A;  4GYG A;  3KP7 A;  3EUH A;  2R7D A;  4AIJ A;  2L4M A;  5D4R A;  2P7C B;  3E5Q A;  3QPH A;  4MGR A;  3I0T A;  4XSX F;  3MCZ A;  2GAU A;  3ZQ7 A;  2KKO A;  2PI0 A;  4LB5 A;  3VOD A;  1EH8 A;  4M74 A;  5H6R A;  3K1M A;  2O3F A;  4KIF A;  2DPU A;  1P2F A;  4OIO F;  5BS6 A;  3I59 A;  1YLF A;  3CDH A;  4IXA A;  2DK5 A;  2FOK A;  4A5N A;  1RIO H;  2F2E A;  4LK1 F;  4LLN A;  3Q9S A;  3JTG A;  1LJ9 A;  1LDK B;  1BJA A;  3BWG A;  1IAW A;  4K2E A;  3TQN A;  2OBP A;  2C6Y A;  2ZO4 A;  4MEY F;  1Q1H A;  3KLN A;  5E17 F;  1QZZ A;  3LAJ A;  2WC2 A;  2RKH A;  2M45 A;  2R3S A;  2EA2 A;  1J5Y A;  4KIB A;  2DU9 A;  2MH2 A;  2RDP A;  2VXZ A;  4ENN A;  1S6L A;  2XKP A;  5BQT A;  1IN5 A;  1R58 A;  1SFX A;  2EWN A;  1ZAO A;  5CJ9 A;  4RB2 C;  4NB5 A;  2A61 A;  1UST A;  1K78 B;  3QU6 A;  4O5V A;  2BBY A;  1BI1 A;  3R4K A;  3OOP A;  3U9G A;  4WK8 F;  3COA C;  5J6X A;  3ECO A;  3ULQ B;  1T6S A;  1TQP A;  3QPT A;  2CFX A;  3T8R A;  2DPD A;  2ZME B;  2YPR A;  1S3J A;  3S2W A;  5E8G A;  2JPC A;  3V8J A;  3GZ5 A;  2FXA A;  3D5L A;  1XB4 A;  3B73 A;  2NS0 A;  4KYW A;  2IW5 A;  1LNW A;  3KEO A;  3RI4 A;  1IRF A;  5L3G A;  2FE3 A;  2XAS A;  3HHH A;  2HKO A;  3LA7 A;  4HQE A;  4PCQ A;  4PGH A;  1VTN C;  2PMH A;  1U5T C;  3HTS B;  4FX0 A;  1XCV A;  3LFK A;  5FB2 A;  3IKT A;  2Q2E A;  1OYY A;  4HAM A;  2RGV A;  3SFZ A;  1KU3 A;  3ELK A;  2GXB A;  1RNL A;  4IRI A;  3DQV C;  1P4X A;  1K78 A;  4O3M A;  1G3W A;  3FMS A;  3FM5 A;  1DPR A;  3FXU A;  1KYW A;  3L2C A;  2LDU A;  2IA1 A;  2VE9 A;  3E3V A;  1ZGJ A;  1HW5 A;  1U2W A;  4P55 A;  5A2Q K;  2ISY A;  2STW A;  2BYV E;  4MNU A;  3HSF A;  4HW0 A;  2CW0 F;  4L0Z B;  5IT9 K;  4XBF A;  4WXD A;  1SD7 A;  3O3K A;  3GEZ A;  1HSJ A;  2CYY A;  3DEU A;  4FT8 A;  2ESN A;  4HOB A;  2ZNZ A;  1GXQ A;  4EJT A;  2V9V A;  1QNT A;  5FGM A;  1PP8 F;  5AON A;  5BOX A;  5HDK A;  1BI2 A;  3L00 A;  1SD5 A;  1TBX A;  4KMF A;  2JT1 A;  2FA5 A;  5LGN A;  1YQA A;  1UCR A;  3EYY A;  1S8N A;  2EK5 A;  3ZMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...