5HDGA

Crystal structure of heat shock factor 1-dbd
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
94
Chain Sequence
HVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEDTEFQHPCFLRGQEQLLENIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Heat shock factor protein 1
publication title HSF1-DBD crystal structure
rcsb
source organism Homo sapiens
total genus 23
structure length 94
sequence length 104
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hdgA00
3HRSA 3DV8A 5LEKA 5DUKA 3SZPA 1HXDA 1ZH5A 1GVJA 2O03A 2GZWA 3KLOA 3PQKA 4M74A 2BE5F 3BOQA 3DKWA 3VB2A 4L0ZB 2F5EA 4A6DA 3U9GA 4G6DA 2VC0A 3JAMK 3I71A 4ZH4F 2HS5A 1TLHB 1ZYRF 4IXAA 3DXJF 2XAHA 3WE3A 1L3LA 1ZG1A 4IRHA 1MZBA 4CZZA 3N97A 2QBYB 3NEUA 2XGXA 4LB5A 4N0BA 4I01A 4YIFA 1D5VA 3WGGA 1R00A 1OKRA 1XMKA 2ISZA 1XDSA 1BOAA 4U0VA 1MDMA 3KP4A 2FU4A 2EV6A 2DK8A 2PEXA 3HRMA 2EFWA 1W5SA 2HTSA 1MJ9A 4MTEA 3HHGA 2Z5UA 3J81Z 2GXBA 4EM0B 5F64A 2IA0A 3DFGA 1UHMA 1ON2A 3I4PA 1WI9A 4M9SA 5D6EA 5K5QA 5ED4A 2ELHA 2RC4A 1S6LA 2FSWA 3CUQA 4BHBA 1HSJA 2GAUA 1O3SA 2PLYA 5D6FA 1L0OC 4A5MA 1PDNC 5DV5A 1OYYA 1SFEA 2VONA 3FHZA 1T38A 4IJAA 3ABTA 2EJRA 3GW2A 3T8RA 3LQQA 2W24A 3FXQA 2XKPA 2Z9OA 4G7HF 3FM5A 2A07F 2LKPA 3ZMSA 4RB1A 3I54A 1BI3A 4HDVA 3FF5A 5D5WB 3R61A 1KQ8A 2VBWA 3QU3A 4UV8A 3RYPA 3K1NA 3WTVC 3KZYA 4ENMA 1WKMA 1LDJA 4OOIA 5KVRA 4A5NA 3ECOA 2FE3A 4IF4A 3T0YA 3HTSB 3E6CC 2E7XA 2PFBA 4LJZF 1AOYA 5H6RA 4MQ9F 4IRGA 1Y0UA 3JTHA 2FQ3A 4P9FA 1ZN2A 3WU1B 2QWWA 3AAFA 4HLXA 3JTGA 1P4WA 5E1ZB 1I6XA 3K1MA 3L09A 2FBHA 1C0WA 1QNTA 2VBXA 5HLIA 3MZYA 2QM3A 4S04A 3CTAA 1HSTA 1W7PD 3H3ZA 2EB7A 2DAOA 1ODDA 1YG2A 5A2QZ 4G8XA 3BY6A 1HQCA 2ZMEB 4EMSA 1IZ1A 3ELKA 2CYYA 2PMHA 3L2CA 1OYIA 4IRIA 1YLFA 3BROA 3E6BA 4U0WA 2E1CA 3ZN0A 4L9TA 2WC2A 2HGCA 1FX7A 1FYLA 2O61A 1XGNA 1ZLKA 3V4GA 3WG9A 3ZP5A 1R1VA 2Z33A 2VC1A 1OYWA 2CFXA 1G4DA 2FMYA 2IP2A 2EA2A 4IHSA 1J2XA 1F5TA 3GEZA 4HF0A 4ZZDA 1VTNC 2FXAA 4EJOA 5BQTA 3FMSA 4AIKA 2Y0MA 3DPTA 3F8FA 3HSEA 2QQBA 5DUIA 3TOAA 1SD7A 2ZNYA 5FLXZ 3WTXC 4CYDA 2VT3A 4XSZF 1UFMA 4A0XA 1EH6A 3O3KA 2G7UA 5JI6A 2YU3A 5LHGA 2VE9A 3M9AA 2PN6A 1IN5A 4NHJA 5DCFA 1T98A 2XV4S 3QPTA 3T1BA 3B73A 4O5VA 4DQ2A 2G7HA 1Z6TA 5J6XA 3I59A 1QBJA 1F4KA 4EVIA 1DP7P 1ZGJA 4IVNA 3J7AO 3J80Z 3C1DA 4EGZA 3F6VA 1XGSA 1S8NA 3ISPA 5CLSA 1Q1HA 4G94A 3ROUA 4M6XA 4HV5A 1T39A 4I0BA 2UWMA 2PG4A 3E6MA 2UXXA 2XAQA 1FY7A 4G9YA 1HW2A 4CICA 2VXZA 4ESJA 2JSCA 3ZMTA 4LMYA 2PI0A 2EV5A 1YO5C 5ERIA 1YW8A 2JPCA 2OA4A 4MQVA 2V1XA 3ZQ7A 1USSA 4WXHA 3M8EA 4M9XA 3GF2A 4BXUA 1ZRDA 5DCMB 3G73A 4HF2A 3BWGA 2HTJA 3K69A 4FT8A 4U0YA 2YPRA 1USTA 2K7LA 2WV0A 3IRRA 2OD5A 4G6QA 2K27A 1PUEE 2VOOA 1U5TA 2A6EF 2EFQA 4UHTA 1R58A 1KA8A 4M73A 1FWZA 2H09A 3GO5A 3SFZA 1TTYA 2IVMA 4OIPF 1XB4A 3J80K 1R1TA 4I09A 4LLNA 4HA8A 1T2KA 1B6AA 2HQRA 2EFNA 4RGUA 4A0YA 2ISYA 3ZN1A 3E6DA 4M9ZA 3RKYA 2XAGA 1IAWA 4XBFA 3ECHA 3GFIA 4JQFA 3SXYA 3TGNA 3KE2A 1ZG3A 4PGGA 3VFZA 2XIGA 4CHUA 3RPUA 4AVPA 2QBYA 3JAMZ 1FZPB 1FNNA 5E17F 4WXDA 2X4HA 1XSDA 1RUOA 2L3DA 1K79A 4XSXF 2M45A 5FGMA 1I1GA 3MAJA 3R0JA 5JVTA 2W85A 3ML6A 2C6YA 1R5HA 4PZJA 2V79A 3WTUC 2HEOA 2A69F 1DPUA 4L18B 3BJAA 2DW4A 4ZYEA 1ZREA 2F2EA 2LF8A 5K5OA 3QPHA 3K0LA 3HSRA 3I5UA 2L02A 1IN8A 4E70A 4U7BA 1FPQA 2DTRA 5HS9A 1S7OA 1ZGAA 2P4WA 4EM2A 4R79A 4HX8A 2LSOA 5CVRA 2OAZA 4MTDA 3VODA 4XLNF 4QWQA 1K6OA 3LA2A 2VT2A 2O8XA 1ZG5A 5D5VB 3N4MA 1Z91A 5LGUA 3MZHA 3KP2A 3QOPA 2IA2A 5HOOA 4ENNA 1O7FA 2HR3A 5JFRA 2XAJA 3CUQC 1KQ0A 3Q9SA 3D0SA 5ICGA 3EDPA 1S7AA 2QUFA 4KMFA 3V8LA 1IN4A 4LK1F 2FA5A 1FLIA 1YW9A 3M7GA 2OZUA 3WTYC 1J0RA 4EJVA 3QP5A 1B9NA 1HKQA 3P9CA 5IT9K 1E17A 4ASNA 1DPRA 2OQGA 2ZCWA 2NAZA 2CQKA 2CG4A 2QQ9A 1TW3A 3W6KB 5DEQA 2MD5A 4BQAA 3IKTA 4KICA 4BAYA 5L3GA 3LA7A 3KP7A 2KJBA 1ZHFA 2STWA 4GYIA 1YW7A 3P9KA 1BIAA 1YYVA 2HQNA 2QENA 3IL2A 1WSUA 1FOKA 1REPC 4M72A 3MQ0A 2KJCA 4LK0F 1R22A 2KIMA 1LJ9A 1QGPA 2A3SA 3KEQA 1YS7A 4EJWA 4Y15A 2IRFG 4KYWA 3V8KA 2DU9A 5IT3A 4RB3C 4ESBA 3KETA 1D8JA 3RJPA 2ZMEA 1G3TA 4IPAA 1F9NA 1Z9CA 4ESFA 4HW0A 5J8FA 4LFUA 4OMZA 1H9GA 3JW4A 1TBXA 3CDHA 5BPIA 1IN7A 3SZTA 4HQEA 3GFJA 4QLCU 5L3CA 1V4RA 3LA3A 2L54A 1WRJA 1RI7A 4CXFA 2EFOA 5K5RA 2FNAA 4ZYHA 1XGMA 2HKOA 2F5DA 2E7WA 3CLOA 3HIFA 5FD5A 3FZVA 3L7WA 4UNOA 3IKVA 2GA1A 1D8KA 4ETSA 2F5FA 4I02A 4D0PA 4L5IA 4P96A 2XRNA 4RGRA 1D3YA 3MCZA 3V7RA 2D2WA 3P7NA 4OIOF 4KN7X 3S2WA 4R1HA 3GZ6A 2D45A 1MDMB 4Q4ZF 4L9VA 1LQ1A 3F8CA 2R3SA 2H27A 3V7CA 1STZA 1J75A 3F21A 4KIFA 3Q9VA 5FFXA 1SFXA 3WTWC 1I1SA 1W4MA 2KIFA 4HYEA 1CGPA 3T5XA 2DFIA 1DDNA 1TQIA 1KYWA 5TRDA 3GUDA 5AONA 1GXPA 3CUQB 3E5UA 3R0AA 1UHWA 1IUYA 1DUXC 4HX4A 3W6JB 4NQWA 3MEXA 5HLGA 4PGHA 1SD4A 3CO7C 3QU6A 1SD5A 3GFLA 2R7DA 4B8XA 1YS6A 2QZ8A 2B0LA 4GCVA 4KNYA 1O3TA 2GIVA 1GXQA 1P2FA 2FEZA 5BS6A 2M5WA 1J5YA 3I0TA 4FX0A 1SAXA 2OU2A 5DCMA 2Q0OA 2DT5A 4DNCA 4Y13A 3FXUA 4UXNA 2H6BA 5EEGA 3TO6A 2HWVA 3EYIA 4L5JA 4N9IA 5ICEA 2BGCA 2M30A 1RNLA 2P5KA 5DD8A 3VOEA 3BJOA 2JZYA 4EJUA 1JHFA 4RGXA 3ZMVA 5ILSA 3WU0A 3FMQA 2MC3A 2P6TA 1Z05A 1KU7A 4AIJA 1OMIA 4KA4A 4L9JA 2L01A 4MGRA 3R4KA 3C3WA 4L9NA 1KYZA 4BYYA 1U5TC 3MFKA 5HVQC 3ZPLA 1ONVA 2A68F 2DI3A 4OINF 3BDDA 2W84A 2VBYA 5HDKA 4HX7A 4BH9A 1XGOA 2YX4A 5ILUA 4RAZA 4LG0B 5H6QA 4F7ZA 1JGSA 3CJNA 3LAJA 2FNPA 5LRRA 2QLZA 3ZMUA 1I27A 3H3UA 2K02A 5E1WA 4UVBA 2MBFA 4FX4A 5LGTA 1OPCA 3LAPA 3BPVA 3WTSC 4MEXF 4KMUX 3HRUA 1QO0D 1U8RA 2JT1A 2WTEA 5ICCA 3VEPA 5LRSA 1TW2A 4EM1A 4ZYDA 4HOBA 1R5GA 2L4AA 5AIPA 3TO9A 1ZRCA 4WK8F 2STTA 2ZJ2A 5D5XB 2CWEA 3EUHA 1RUNA 2MA3A 2W25A 2IJLA 4KIBA 1XMAA 4AD9A 5LGNA 2KRFA 1SD6A 3E3VA 2WWYA 1FBSA 4FHTA 3E5QA 2D1HA 2GXGA 4H0EA 4O6JA 1AWCA 3H92A 1U78A 2PQ8A 4WX9A 1IRGA 2PBIA 1XD7A 4P5OA 5D8LB 2A61A 2NNNA 4PDKA 2UXNA 2MLGA 3GVAA 4HV6A 3T8TA 1IF1A 3DF8A 4NB5A 3F22A 3WGHA 1CF7B 1QPMA 1JXSA 1QZYA 4YG2F 2K4JA 2M8EA 2GA2A 1XCBA 2E1NA 1K78B 1TQPA 1IRFA 1B1BA 2IA1A 1EH7A 4A2UA 3OOPA 3FXRA 3EYYA 5CVJA 3K9TA 1BN5A 1IW7F 5F6FA 1BI2A 1A04A 1FC3A 3K1PA 4BHPA 1R23A 3QP6A 1ZARA 3HOSA 1PP7U 5FB2A 1MJAA 2A6HF 1B4AA 2CW0F 1HKSA 4KUMA 4Q47A 1WWXA 4K2EA 2VOPA 2P5VA 5HS8A 2GWRA 3QAHA 4LLGF 5EEHA 1XCVA 5AIQA 3BPXA 5LHIA 2LDUA 1IXRC 3WE2A 5IT9Z 2J5PA 1U3EM 4EV0A 1P6RA 2FBIA 3GWZA 3BJ6A 4ON0A 2NNYA 4A12A 1FSEA 4UVAA 4P55A 5E8GA 1S3JA 2ZBKA 2XHKA 1BIBA 2P7VB 1BC7C 1TNTA 4LGWA 2V6CA 1FT9A 4UV9A 3TDUC 2O6GE 1U6GA 1FBUA 2EWNA 1B59A 5D5UB 2DLLA 5L3EA 2Z3YA 4RB2C 3I64A 4MEYF 2LNBA 2G9WA 3TOBA 3FWEA 5CVVA 1MGTA 2V9VA 3FM3A 2KKOA 2UZKA 3BP8A 3KP5A 4I0AA 2Q2EA 4LLLA 4KT5C 3GX4X 1LB2A 2RQPA 5E1XA 1LDDA 4WF2A 5D4SA 4EQQA 1I5ZA 2RGVA 2EA4A 1G6NA 2HOEA 2JPBA 2D1VA 3HSFA 2HYGD 2NRAC 2IW5A 4RGSA 3FX3A 1YIOA 4M71A 4M6YA 3I53A 2YSRA 5BMZA 3I58A 1LEBA 1FYMA 2DK5A 1R1UA 2ADUA 4ZZLA 1XSXA 2HKXA 2JRTA 2DBBA 3E5XA 3RYRA 5BPDA 3IRQA 1MD0A 1Z1DA 2TDXA 3L9FA 1K7AA 2BEOA 3EQLF 3KCCA 4R8HA 4UUVA 1YFHA 5ICFA 5K1YA 2ZXJA 1E2XA 2RN7A 3IWZA 1F1ZA 3RTRA 5LEJA 2ESHA 3U1DA 5LLQA 5E20A 1OR7A 2ACJA 1W7PB 3REOA 5H20A 1FSHA 2DQRA 4U7DA 5DDGA 1LEAA 2X0LA 2K4BA 5D4RA 2P7CB 3D5LA 3GZ5A 2XAFA 2XUBA 4HZFA 2ETHA 1JE8A 3PQJA 2OBPA 3ABUA 4I7HA 4YFKF 2MH9A 5LHHA 3C18A 3BZ6A 5DD4A 5JHUA 4G7OF 1MJBA 3RPQA 3K2ZA 3L00A 2W57A 3ZMZA 1HW1A 3CO6C 1G3WA 4G7ZF 3NRVA 3RKXA 4MNUA 4KN4X 3GLXA 1BI1A 2VN2A 3KLNA 1RZ4A 1SMYF 1P4XA 3FMRA 3KEOA 5CVUA 1PP8F 4HAMA 3C7JA 4RS8A 2Y48A 3J81K 2XVCA 4HF1A 2YX7A 3M1EA 3TO7A 1H9TA 2EK5A 2O3FA 2EV0A 1HBXG 1NHAA 2DPUA 2JTVA 2BBYA 5CYVA 2ZNZA 3LFKA 4I2OA 1O7LA 3B02A 1YQAA 1W5TA 3HTUA 3WTTC 2CGPA 4Q48A 2OZ6A 1UB9A 4PCQA 2H6CA 1FYKA 2HYFA 1IN6A 2LF7A 4B09A 4ENJA 3MWMA 3GYHX 4LG0A 4LD5A 1LVAA 1XSVA 4KFCA 2YR2A 4HBLA 5J8CA 3G3ZA 1YTYA 1QQIA 2FRHA 3RI4A 1R36A 3ERED 3HUGA 5HDNA 2FOKA 3F72A 2XKOA 4OIRF 4BNCA 4Q5SF 1ZLJA 3DQVC 1SFUA 1T0FA 3IHUA 2FF4A 4OIQF 2XROA 4EJTA 4LB6B 3E97A 5BOXA 4YIIA 4WWCA 4CGZA 4RB0A 1G3YA 2PJPA 3F6OA 3F8NA 1U2WA 1O3RA 3GXOA 4A6EA 3IC7A 4XLPF 1TQMA 1WQ2A 2L4MA 5L3BA 1J59A 2P5LC 4OMYA 4YFXF 3KZZA 1KQ9A 5KK1A 2HZTA 2FMLA 2V1UA 5L3DA 6PAXA 1HW5A 2COMA 2M1BA 1KU9A 2VE8A 2QVOA 4KDPA 5E8IA 3TQNA 3F8MA 5A2QK 4I98B 2MLKA 3HHHA 2RNJA 5L3FA 1S29A 1KU3A 1P4AA 4GXOA 4CO8A 1CF7A 4Y17A 4TV7A 3SHFA 1K78A 1XDUA 4AWXB 2Z99A 2ESNA 3HRTA 3HYIA 2F5CA 3M8FA 5CJ9A 4S05A 3WGIA 1H0MA 2QYOA 3RKWA 2DQLA 3F23A 3OV8A 2CSOA 4N9HA 3V8JA 1GHCA 1ZRFA 5CVIA 1BC8C 1TNSA 1X3UA 4YFNF 2O0YA 2QQAA 2H94A 4MHGA 4HDUA 1T6SA 2ZO4A 3O6BB 3HOTA 2MH2A 3COAC 4L0YB 5FLXK 2HFHA 1V3FA 5HDGA 5F1RA 2PMUA 3RDIA 2FBKA 4Z2YA 4HQMA 2VBZA 1FP2A 2K86A 3ULQB 3DEUA 2GQQA 5E18F 2KIUA 5DYMA 1O3QA 3R60A 4HLYA 1FBQA 1XN7A 1MKMA 3R6SA 3Q5FA 2A5YB 2DO7A 1Z6RA 3JSPA 5HS7A 3KP6A 1J9IA 4P9UA 4OU0A 1LDKB 3NQOA 3DPLC 5ILVA 3GFMA 1BI0A 4KIGA 1ULYA 1SMTA 4GGGA 2V1DA 3PFIA 2NS0A 3LWFA 2M87A 5D8KB 1P92A 3WODF 4EGYA 2NYXA 3I59B 2BV6A 3O2PE 1B9MA 1HKTA 1ZAOA 1JHHA 4GO1A 3U2RA 1Z7UA 2HDCA 4ENKA 4AIHA 3CUOA 3P9IA 1BM9A 3KFWX 5FFZA 2RDPA 2ZFWA 4RAYA 3TDZC 5FD6A 3IWFA 1BBYA 1ON1A 2IT0A 3SQNA 3JSOA 2CO5A 2AS5F 3V7SA 2VODA 4IHTA 3RIRA 3WTZA 4ZYGA 2AXLA 1IXSB 3LQRA 4UVCA 1EH8A 1RIOH 4JK1X 2R7FA 1KGSA 4XRFA 2Y75A 2RV8A 2IPQX 2P6SA 2RVCA 4WXCA 4JBAA 3TKYA 1EV7A 1QZZA 5TJJA 2Q8KA 1G3SA 4O3MA 5FO5A 1KU2A 2RKHA 3ZMDA 4BHCA 1UCRA 2P8TA 3DP7A 1W7PA 2DPDA 3F8BA 4WCGA 1LNWA 1U5TB 2J5OA 4A0ZA 2ZKZA 4GYGA 3EETA 3QRFF 1IXCA 4CDGA 2OQRA 1FP1D 3KP3A 1R7JA 2XASA 1BJAA 2EFPA 2BYVE 3LSTA 4U88A 1O57A 1J7KA 5HLHA 5LBQA 5JR3A 3F3XA
chains in the Genus database with same CATH superfamily
2IGOA 3HRSA 4D7NA 3DV8A 5LEKA 3CCUI 5DUKA 4LG3A 3SZPA 1HXDA 1ZH5A 1GVJA 2O03A 3PL8A 2GZWA 3KLOA 4JX4A 3PQKA 4M74A 2BE5F 3BOQA 3DKWA 3VB2A 3FXKA 4L0ZB 4PFPA 2F5EA 4A6DA 3U9GA 4MLOA 4G6DA 2VC0A 4AC0A 2ZMEC 3PIPF 1WJCA 1Z7LA 2DJNA 3JAMK 2FJ1A 3A0BC 4UUSB 2H8WA 3I71A 4ZH4F 3EUAA 1QU3A 1FOYA 5FRNA 2HS5A 1TLHB 1ZYRF 3J7ZI 4IXAA 3DXJF 2XAHA 3WE3A 1L3LA 2FUG2 2VJIA 1LUJB 3MZ8A 4B3XA 1ZG1A 4IRHA 2XRLA 1MZBA 2VI6A 4CZZA 3N97A 3AG2H 4JX5A 2QBYB 3NEUA 1GDTA 1FIAA 2XGXA 4LB5A 1ETKA 2DA6A 4N0BA 4BS9A 2XGDA 4I01A 4YIFA 1D5VA 3LFUA 3WGGA 1R00A 1OKRA 1XMKA 4HPQA 2ISZA 3MMYB 1XDSA 4F93B 3C2GA 3MD2A 4QPOA 2VPLA 1BOAA 4U0VA 2JRMA 1MDMA 3KP4A 1NK3P 2KHMA 2TCTA 5F04A 1V5EA 3CJRB 3JRAA 2FU4A 5EYRA 3CCMI 2EV6A 2DK8A 3CC2I 2WY8Q 3LOCA 3QODA 2CV2A 1ETQA 5E3OA 3VPRA 1U0JA 2PEXA 3A0HC 3HRMA 2EFWA 1W5SA 2HTSA 1MJ9A 3HKZA 4MTEA 3HHGA 4AYBA 2Z5UA 1WHUA 3J81Z 4EM0B 2GXBA 2F5VA 4BXXJ 1GLNA 5F64A 2IA0A 3DFGA 4D9JA 1UHMA 2VASA 3PM1A 1Z77A 3QOEA 1ON2A 3I4PA 1WI9A 3GBGA 1E3HA 4M9SA 5D6EA 4C3JJ 5K5QA 3ASOH 5ED4A 1UG0A 1AKHA 2ELHA 2NS7A 2RC4A 1S6LA 2FSWA 3CUQA 4BHBA 1HSJA 2GAUA 1O3SA 5KAIC 2PLYA 5D6FA 1AA7A 1SVOA 2LBFA 1L0OC 4A5MA 1PDNC 4MO7A 2KPMA 5DV5A 2R0QC 1AHDP 1OYYA 1SFEA 5GAGJ 2VONA 3S2DJ 2QQ8A 3DKXA 3FHZA 2X51A 1T38A 1LE8B 4IJAA 3ABTA 4PSWA 1Z0XA 4HRIA 2EJRA 2LLKA 3OYLA 3GW2A 3T8RA 3LQQA 1MMNA 2W24A 1P9QC 3OSGA 3FXQA 2XGEA 2XKPA 1R6RA 2Z9OA 4G7HF 1MSFC 3FXOA 3FM5A 2A07F 3BLYA 2LKPA 3ZMSA 2EH3A 3E7LA 1JKRC 4B48A 4RB1A 3I54A 1BI3A 4HDVA 3FF5A 3GTGJ 5D5WB 3R61A 1KQ8A 2VBWA 3QU3A 4UV8A 3SEQA 3RYPA 9ANTA 1IJWC 1RKTA 3K1NA 3WTVC 3KZYA 4ENMA 1WKMA 1LDJA 4OOIA 5KVRA 2F4IA 4A5NA 2BVLA 4CCLA 4HNUA 1XC5A 2HU9A 3ECOA 3LMMA 4AM3A 3A01A 3RQ4A 2FE3A 2LKSA 4IF4A 3T0YA 3HTSB 2PJRA 1IDZA 3E6CC 5FLVA 5EGOA 2E7XA 2PFBA 1MH4A 1D1AA 2M0MA 2VL8A 3FXMA 4LJZF 3ZRGA 2E1MC 3FXLA 4LIVA 5H6RA 1AOYA 4MQ9F 4IRGA 1Y0UA 3JTHA 3QPSA 5CQGA 2FQ3A 3H0DA 2HVRA 5IYCJ 1MBGA 4P9FA 1X4OA 1ZN2A 3WU1B 2QWWA 3OL3A 1K6YA 3H1CA 2AO9A 3F9KA 1T0FC 3AAFA 2CS3A 3LSGA 2E71A 1Y56A 5EDNA 3PO2J 3IH4A 5EZGA 4LIUA 4HLXA 1XG1A 3HZJA 3JTGA 1P4WA 3H9JA 5E1ZB 1I6XA 4NC8A 1R49A 3K1MA 3L09A 2FBHA 3GZNB 2IXSA 1C0WA 3CP8A 4XLAA 4CCJA 1QNTA 2VBXA 2XDVA 5HLIA 4BQNA 4BDZA 1B72A 2KP6A 3MZYA 2QM3A 4S04A 3CTAA 1UG2A 2W48A 1HSTA 4II3A 3P5JA 1W7PD 3H3ZA 1N78A 1VQ9I 2EB7A 2EQRA 5IP9J 4U87A 2CQXA 1X2NA 1VQNI 4Y7NJ 2RNGA 1FTZA 3G6EI 3LL7A 3KYDB 1Z3XA 4XRSA 4FTHA 2DAOA 3BTJA 1POGA 1ODDA 1YG2A 2EIJH 1ETWA 5A2QZ 2A6TA 4XOPA 4G8XA 5LFAA 1HA8A 3KPHA 2ZXIA 4HEA2 4PJLA 2K3PA 3V42A 2M8GX 5JLWA 2BXZA 3BY6A 1HQCA 2ZMEB 4EMSA 3CMEI 1TWCJ 1GT0C 1IZ1A 2XGCA 3ELKA 2JMWA 3HKZN 3OYDA 2CYYA 2PMHA 3L2CA 2YU9J 4IHVA 1OYIA 2M7AA 4AYBN 4E7LA 4IRIA 4IQJA 1T33A 1YLFA 3BROA 3G1MA 1E0EA 3E6BA 1T8IA 4FQGA 3DBLB 4U0WA 4E7JA 2E1CA 4EEFG 3ZN0A 1ACIA 1D0ZA 4L9TA 4FE4A 2K5CA 2WC2A 5M5WJ 2HGCA 4IO9F 1FX7A 1FYLA 2O61A 1XGNA 3IAS2 1ZLKA 3V4GA 2JA7J 3WG9A 3ZP5A 4DYQA 1R1VA 2BY0A 3OIQA 1FTTA 2HDWA 2L9NA 3H9QA 2X6YA 2Z33A 3G2BA 5KNLA 2EBIA 2VC1A 1X1CA 1OYWA 2DOAA 2KT0A 4ZDLA 1I6HJ 2L7FP 2CFXA 1G4DA 3BG6A 2FMYA 3BR0A 4JOMA 2IP2A 3KX2A 2EA2A 1LPQA 4IHSA 1J2XA 2IS1A 2JA5J 1F5TA 4BY7J 2O9LA 3GEZA 3DU5A 3H0GJ 4MFEA 3DTKA 4HF0A 4ZZDA 2HI3A 1VTNC 2FXAA 4EJOA 1QVUA 2DFEA 4E7SA 5BQTA 3FMSA 1HDDC 2JQ7A 4UY8I 3DPTA 2Y0MA 1IV8A 3H9GA 2E35A 4AIKA 3F8FA 4NC6A 1LFPA 2Z1DA 3HSEA 3VYRB 2QQBA 4A3BJ 5DUIA 1Z67A 3TOAA 1SD7A 2VKDA 2ZNYA 1VQ7I 5FLXZ 3WTXC 4CYDA 1A31A 1YX5A 4DGWB 4C2UA 2VT3A 5J47A 4L5EA 2JSPA 4ABZA 4BBRJ 3C2HA 3HM5A 4RDUA 4XSZF 1UFMA 4A0XA 4AUXA 1EH6A 3VSLA 3O3KA 2G7UA 3BCBA 4IL6C 5JI6A 2YU3A 5LHGA 2VE9A 3M9AA 3FXJA 2PN6A 1IN5A 3PNYA 5K7HA 2DCEA 3LSKA 5DCFA 4NHJA 1T98A 2DMQA 2XV4S 3EUHC 3QPTA 5J1UA 2L9VA 3T1BA 1Y39A 3K4CA 5EF6A 3B73A 3BR3A 4O5VA 3OYFA 4DQ2A 2G7HA 1Z6TA 5J6XA 4B4CA 2EIKH 4RM2A 2R4GA 1WCMJ 1VQLI 3C2BA 4XKBA 2HOAA 4E4HA 3I59A 2EIMH 2Y2ZA 3UKGA 1ZR4A 2QKMB 1QBJA 2VKVA 1F4KA 1JJ6C 2R7QA 4EVIA 4DOZA 1NH3A 2HXIA 2DTZA 4Z6YA 1DP7P 1OCRH 1ZGJA 3G1OA 5EJCA 4IVNA 3J7AO 3J80Z 3SEZA 3C1DA 3BT9A 3BZKA 4EGZA 3F6VA 1XGSA 3S15J 2EPFA 2Q1ZB 1S8NA 2AQFA 3OS0A 2OTJI 3ISPA 5CLSA 1FEXA 1Q1HA 4G94A 3ROUA 4BJTA 1X3WB 3CC4I 4NQWB 2ZB9A 4M6XA 2VQLA 4YIRX 2ZSHB 1OFCX 3OS2A 4HV5A 1T39A 1TZLA 4I0BA 2UWMA 2PG4A 3E6MA 4V19K 2UXXA 3CJTB 4PJNA 2W4SA 3DLAA 2XAQA 1FY7A 4G9YA 1BW5A 2E1MB 1HW2A 4HNTA 4CICA 2VXZA 4ESJA 2JSCA 3ZMTA 4LMYA 2PI0A 2EV5A 3S3NA 1YO5C 5ERIA 1YW8A 2Y9YA 2JPCA 2OA4A 4MQVA 3IAM2 2V1XA 3ZQ7A 3DU6A 1USSA 4WXHA 2K3FA 1SANA 5GTHC 4XOTA 4E7ZA 3M8EA 1ETXA 1D5YA 4M9XA 3GF2A 4BXUA 2DDAA 2M7BA 1DGWY 3H5NA 1ZRDA 5DCMB 3G73A 4HF2A 3HGGA 3BWGA 2HTJA 4XN3A 3SYTA 1MBFA 3K69A 4FT8A 3W2WA 1BR4A 2YPRA 5EG0B 4U0YA 3HGYA 1USTA 2K7LA 3HBLA 4RM3A 2WV0A 3IRRA 2ZJPF 2XSJC 3RZOJ 4GDFA 2OD5A 1RR7A 4G6QA 4CCNA 2K27A 2DXIA 1MNEA 1B8IB 3BG7A 1PUEE 1TWHJ 4RLFA 2VOOA 2NOJB 4E7HA 4IKFA 1U5TA 2A6EF 1MMDA 2EFQA 2K9LA 3HOXJ 3H35A 4B43A 5M5XJ 4UHTA 1R58A 1KA8A 1TT5B 2CUFA 2I10A 4QTRA 1IC8A 4M73A 1FWZA 2H09A 3GO5A 3SFZA 2QA4I 1TTYA 2IVMA 4OIPF 1W0UA 1XB4A 3J80K 1R1TA 4XKVA 4I09A 1Y0NA 4IEJA 5GP9A 3CMYA 2R5YA 4LLNA 4HA8A 1T2KA 3HC7A 3ZQFA 1B6AA 3ZQLA 2MW8A 2HQRA 2EFNA 4RGUA 4A0YA 2CQ7A 1DU6A 2ISYA 3OL4A 3ZN1A 1FMVA 3E6DA 4JX6A 4RLQA 2KDOA 4M9ZA 3RKYA 3QQAA 2XAGA 1IAWA 4XBFA 4UUSA 3ECHA 3S8PA 2QSFX 3GFIA 2L7KA 4JQFA 3SXYA 3TGNA 1ZGWA 2F4MB 3KE2A 1ZG3A 3CF2A 1JKQC 4PGGA 4XRMA 5BNGA 3VFZA 4NDLA 1VF9A 2VKHA 2XIGA 1MH3A 2NS8A 4CHUA 3RPUA 3QWLA 4AVPA 2QBYA 3JAMZ 1FZPB 1FNNA 1GV5A 3SFIA 5E17F 1RETA 4WXDA 2X4HA 1MBEA 1XSDA 1RUOA 2L3DA 1K79A 2L9RA 1OCOH 4XSXF 2M45A 1LFUP 5FGMA 1I1GA 1YX3A 3MAJA 3R0JA 4MIMA 5JVTA 2W85A 2R7XA 2K9NA 3ML6A 1RC9A 2OF7A 2C6YA 2O7OA 2JWTA 1E3OC 1R5HA 4PZJA 4BEHB 2V79A 3WTUC 3OYCA 2HEOA 1BR1A 2A69F 1DPUA 4L18B 2KISA 3BJAA 2DW4A 4ZYEA 1ZREA 2X1DA 2F2EA 2LF8A 4NBQA 2DMTA 5GPCA 5K5OA 4IZZA 2EZLA 3QPHA 3K0LA 3HSRA 3I5UA 2HQ5A 4BQOA 2L02A 1IN8A 4E70A 4U7BA 1FPQA 2DTRA 4OAYA 5GADJ 5HS9A 1S7OA 1ZGAA 2P4WA 2NVTJ 2FD5A 4I99C 3Q0UA 4EM2A 3WU2C 4R79A 2KRHA 5IYBJ 4HX8A 2LSOA 1W36C 3PNVA 4NUBA 5CVRA 3HG9A 2LMDA 2OAZA 2XPUA 4MTDA 3VODA 4XLNF 2M34A 4QWQA 2L2OA 1K61A 3FBNB 3FHNA 1W0TA 2OCCH 3RCOA 2GM4A 1K6OA 2CUJA 3LA2A 1LKXA 4A3MJ 2VT2A 4F55A 3HPHA 1T95A 2O8XA 1ZG5A 1OR7C 1IG7A 5D5VB 1LE8A 4Y4RA 4YEJA 2ZJQF 3N4MA 1Z91A 5LGUA 5FRMA 3MZHA 2LYCA 3S1NJ 2XSDC 4XLHA 3OYBA 3KP2A 3QOPA 2IA2A 3AL0C 2UV1A 1ZK8A 5HOOA 4AIDA 1VNDA 1PUFB 1X19A 3LSJA 3K4KA 1VQ4I 4XKCA 3S93A 4ENNA 1O7FA 2HR3A 5JFRA 2XAJA 4CZCA 3CUQC 1KQ0A 3IUOA 3Q9SA 2ID3A 2X6XA 3Q3SA 3D0SA 4NC7A 3W3CA 1SAUA 2N8GA 5ICGA 2MD0A 2DA2A 2XF6A 3EDPA 3FDYA 1S7AA 2QUFA 4BQQA 1WH7A 4KMFA 3V8LA 1IN4A 3CCLI 5TGTA 1Y6IA 3CP2A 4LK1F 5IY5H 1ITYA 3OR2C 3PFYA 3U1KA 2FA5A 1FLIA 2XB5A 2BY3A 4BGDA 1YW9A 3HOYJ 4A3CJ 3M7GA 2OZUA 3WTYC 1MIJA 1J0RA 3AG4H 4EJVA 4CSWA 4IX7A 2ID6A 3QP5A 4ZC3A 4A3EJ 3H3VK 1B9NA 2FQ4A 2Y9ZA 3GTOJ 1HKQA 5FKNA 3ESWB 3P9CA 1R9TJ 5IT9K 3FIWA 5J4YA 4XL9A 1E17A 4ASNA 5FJ8J 1V5GA 1SFKA 3JRBA 1DPRA 2OQGA 2ZCWA 2NAZA 3I3LA 2CQKA 2CG4A 2QQ9A 1TW3A 1ZR2A 3W6KB 5DEQA 2MD5A 4BQAA 3BR1A 3IKTA 4KICA 2JA6J 2V4JC 4BAYA 5L3GA 5HNFA 3LA7A 3KP7A 2NVQJ 2KJBA 1ZHFA 2STWA 4GYIA 4AU7A 3HOZJ 1YW7A 2ECBA 3P9KA 3IH2A 1BIAA 1YYVA 2HQNA 1W1WE 2QENA 3H5AA 3IL2A 1WSUA 3I4MJ 1IDYA 1YRNB 3LSMA 3CDLA 2VJJA 3TMOA 3BQZA 2E19A 1FOKA 2LRDA 1REPC 4X6AJ 3DCFA 4M72A 3MQ0A 2KJCA 3S1RJ 2VXDA 4LK0F 1R22A 2KIMA 1LJ9A 1QGPA 2A3SA 3LSIA 2LREA 1WJEA 1XS9A 2X48A 4CCOA 3KEQA 1YS7A 4EJWA 2VKEA 4Y15A 2IRFG 3B6CA 2E2JJ 4KYWA 2E36A 1VQMI 3V8KA 5C44J 2DU9A 2WAEA 5IT3A 4RB3C 4ESBA 3KETA 1A35A 1D8JA 2DA4A 3FKJA 3RJPA 2ZMEA 1VFCA 4GRIA 1UJ8A 1VQ6I 1G3TA 2XPVA 2JK3A 2WADA 4IPAA 1F9NA 4W1UA 4A93J 3BTIA 1Z9CA 4ESFA 4HW0A 5J8FA 4LFUA 4OMZA 5C3EJ 2OTLI 1H9GA 4DZPA 3JW4A 1TBXA 3CDHA 3OYKA 5BPIA 1IN7A 2KLOA 3SZTA 4A3GJ 3CJQB 2Q2EB 4HQEA 3GFJA 4ZTFA 4QLCU 1IRZA 1ENHA 5L3CA 1V4RA 3LA3A 2L54A 1WRJA 3LSPA 2UUZA 3JRHA 3ZCOA 2VQHA 4CCMA 1VQKI 1RI7A 4CXFA 2EFOA 5K5RA 2FNAA 3HPGA 4ZYHA 1XGMA 2HKOA 2F5DA 2E7WA 3CLOA 3HIFA 5FD5A 3RPUD 3JR9A 3FZVA 5J1RA 3L7WA 4BXFA 4UNOA 2COBA 3IKVA 2R7TA 2DA5A 2GA1A 1D8KA 2DA1A 3A02A 4ETSA 1MNDA 2F5FA 2KFDA 5JVGF 2KMUA 4I02A 4X0GA 4D0PA 4L5IA 4P96A 1A5JA 1JKOC 1TWFJ 2XRNA 3ASNH 4RGRA 3SZGA 2W7NA 3I55I 1D3YA 2ICWG 1YOVB 2BOLA 3MCZA 1G2HA 3V7RA 1A36A 1F36A 2D2WA 5GTIC 3P7NA 4A3KJ 4OIOF 4XN0A 4KN7X 3S2WA 4R1HA 4XLEA 1TP4A 3OYEA 3GZ6A 2D45A 1MDMB 2CUZA 4Q4ZF 5DM7F 4L9VA 1LQ1A 3F8CA 2NXNB 3ZQQA 1BJZA 4M3GA 2R3SA 2H27A 2QKLB 3E0JB 2LG4A 3V7CA 2O5RA 3VWBA 2KRCA 1STZA 1K83J 5E3LA 1J75A 1X2MA 3F21A 4BACA 4KIFA 3Q9VA 5FFXA 1SFXA 2DOFA 3WTWC 1I1SA 1W4MA 2KIFA 2V7FA 5IOYA 4HYEA 1CGPA 3T5XA 2DFIA 2ELKA 3NARA 1DDNA 1TQIA 3OYGA 4MFDA 2GXAA 4XLFA 1VQOI 1KYWA 5TRDA 1GUUA 3IH3A 3ONQA 3GUDA 5AONA 1GXPA 1OCTC 2IGNA 5F0HA 2CW8A 1SFOJ 2MGQA 3D5SC 4PUSA 3CUQB 3E5UA 3R0AA 1UHWA 2GOXB 1HCRA 3CD6I 1IUYA 5IP7J 1MBJA 1DUXC 4HX4A 1RESA 2LBFB 3W6JB 4M3BA 3TL4X 3CZ6A 3ZOBA 3ZXSA 1YITI 4NQWA 3MEXA 2JVHA 5HLGA 3TEDA 4PGHA 2E5NA 1SD4A 3CO7C 2MABA 3HL2A 1D0XA 3QU6A 3BG9A 4D1QA 1SD5A 3GFLA 1OCCH 1PJRA 1WJFA 2R7DA 1FOWA 5F08A 3N05A 1YS6A 2QZ8A 4B8XA 2B0LA 2KL4A 2JN6A 4GCVA 2WV1A 2B63J 3K4LA 3MN2A 1HC8A 4KNYA 2AHQA 2KIQA 2RAEA 2IAIA 5F27A 3H5RA 2G0EA 1O3TA 3CCYA 2GIVA 1GXQA 1P2FA 2FEZA 3GMEA 3H36A 2KZVA 5BS6A 2MG4A 2M5WA 3WHBA 4A3JJ 3ZQCA 1J5YA 2EILH 2VPRA 3I0TA 3DEEA 3VDXA 4FX0A 2CV1A 1DU0A 1SAXA 1TWGJ 1UZCA 2OU2A 5DCMA 2Q0OA 2QGUA 2DT5A 3BG3A 4DNCA 4Y13A 1DQUA 3OIOA 1V54H 3FXUA 4UXNA 1S5LC 5EG0A 2W1OA 2WAQN 2CFOA 5J1YA 4NNJA 2H6BA 5EEGA 1JKPC 3TO6A 2HWVA 3DPUA 3EYIA 4L5JA 4BUPA 4M3EA 4N9IA 2BGCA 5ICEA 3FKIJ 2R7RA 1B8IA 1IRXA 2M30A 5B3SH 1RNLA 2P5KA 2V26A 1MW7A 5DD8A 2WAFA 2DT6A 2JJ7A 2V6EA 3VOEA 1WH5A 5EZHA 3A03A 2E34A 2CMPA 3FK6A 1JJ8C 3BJOA 2JZYA 4EJUA 1JHFA 5JLXA 4RGXA 3ZMVA 5ILSA 3WU0A 3FMQA 2IBDA 4IOCF 1BOBA 2MC3A 2P6TA 3KYLA 1Z05A 1VQ5I 1R71A 1KU7A 1DP3A 4C2MJ 3JREA 4AIJA 1OMIA 4KA4A 4L9JA 3CDIA 2X6WA 2L01A 1B72B 2LY9A 2WA0A 1JGGA 4MGRA 3S32A 3R4KA 3C3WA 4LITA 4L9NA 1KYZA 4BYYA 4D5CA 1U5TC 3MFKA 3DBHB 5HVQC 3ZPLA 1ONVA 5B5EC 4GFBA 2A68F 2AQEA 1R4MB 2DI3A 3BDDA 3KYCB 4OINF 5TISC 1Y1WJ 2W84A 1RR8C 2L7MP 2VBYA 3O8HA 5HDKA 2LD5A 4HX7A 4BH9A 1XGOA 2HDDA 3HB9A 1EKEA 2YX4A 1MBHA 1OCPA 5ILUA 3TW6A 4RAZA 2DDBA 2X85A 4LG0B 5H6QA 3L1PA 4F7ZA 1JGSA 4M3DA 2L5QA 2MSYA 3CJNA 3LAJA 3PJRA 2FNPA 5LRRA 5M3MJ 2QLZA 2OPTA 4KITB 3ZQGA 2ME0A 3L2UA 2H8RA 3HUGB 3DEWA 3RSNA 4M3FA 3ZMUA 1I27A 2YUSA 3M8JA 3OIPA 2HXOA 4CYCA 1UMQA 3H3UA 3HOUJ 4E7IA 1MMGA 2K02A 3PSFA 5E1WA 4UVBA 1R5ID 2BHZA 2MBFA 4FX4A 3K4JA 5LGTA 1OPCA 3LAPA 2LH9A 1QRYA 1YIJI 4A69C 3S16J 2BVMA 1ETOA 5B1AH 3ZQIA 1T08B 3BPVA 3WTSC 3FK7A 4DBQA 4MEXF 4BEHA 4KMUX 3HRUA 1QO0D 1Y1VJ 1U8RA 2JT1A 3CESA 1NG6A 1A6IA 2DMNA 3JRFA 5F1JA 2Z16A 2WTEA 1VZ0A 2DFHA 2DA3A 2EZIA 5ICCA 3VEPA 3IP4B 3NWTA 4RA2A 5LRSA 2M4KA 1TW2A 4DBRA 4EM1A 4ZYDA 1QPIA 2HPIA 4HOBA 2ZJRF 1R5GA 2L4AA 5AIPA 2HQAA 3TO9A 2Y0SA 3K70D 1ZRCA 4WK8F 2STTA 2GIZA 2ZJ2A 3ERMA 5D5XB 5M3FJ 4PJMA 2CWEA 2XPWA 1ZKGA 2WB1N 3EUHA 1RUNA 3HXLA 2MA3A 2W25A 4CCKA 2IJLA 4KIBA 4FCYA 1XMAA 4AD9A 5LGNA 2KRFA 1SD6A 3E3VA 4DW6A 1FBSA 2DA7A 1VI0A 2WWYA 3RKQA 2E60A 4FHTA 2X1EA 1UAAA 3E5QA 2D1HA 3O8GA 3GTJJ 2GXGA 2ELJA 4Y3OA 4H0EA 4O6JA 1AWCA 3H92A 3JRGA 3K6GA 2PQ8A 1U78A 1U9NA 4WX9A 1SC7A 5FROA 1IRGA 2CH0A 2PBIA 1I39A 4BBSJ 1XD7A 3BTLA 4P5OA 3W2AA 5D8LB 3A2KA 2A61A 4N4OB 2NNNA 3K4MA 4PDKA 2UXNA 2MLGA 3GVAA 3IV5A 4PFOA 1YI2I 4HV6A 3MKLA 3T8TA 1IF1A 3DF8A 4NB5A 3F22A 4LOCA 1SVMA 1JUMA 3GTMJ 3WGHA 1CF7B 1QPMA 1JXSA 1QZYA 4YG2F 1M1EB 2K4JA 2M8EA 3I56I 2HOSA 2GA2A 4XMYA 3M07A 1XCBA 2E1NA 3TP3A 3BR5A 1K78B 1TQPA 3BR6A 3S3MA 1IRFA 3GTPJ 1B1BA 2IA1A 1V55H 2M2EA 3A4CA 1EH7A 4A2UA 2L7ZA 3OOPA 1YJNI 1K4TA 1BL0A 3FXRA 1UHSA 3EYYA 5GPAA 3UR3C 5CVJA 4RAGA 3K9TA 1BN5A 1IW7F 5F6FA 1BR2A 3LSHA 1YJ9I 4P1WA 2R7WA 3D1NI 2VJ5A 1BI2A 3L2RA 1A04A 1FC3A 3K1PA 2VQGA 2Y69H 1R23A 3QP6A 1ZARA 4XR6A 4BHPA 3HOSA 1PP7U 3HOVJ 1FOXA 1YE9A 2IGKA 5FB2A 1MJAA 5EEAA 3MKWB 3VYTB 1IV6A 1DGRM 2A6HF 2LFBA 3OYAA 1B4AA 2F4OB 2PX9A 2WY7Q 2CW0F 1HKSA 4KUMA 4YRVA 1JUSA 4Q47A 1WWXA 4K2EA 1JI8A 3K10A 2VOPA 3DBRB 2P5VA 3BZCA 4FETA 5HS8A 2OUMA 2E5ZA 2GWRA 3QAHA 4J01A 2E2IJ 4LLGF 2B9SA 5EEHA 1XCVA 2E1OA 5AIQA 2JA8J 1T56A 3BPXA 5LHIA 2LDUA 1IXRC 3WE2A 1RRJA 5IT9Z 2J5PA 3CLQA 1U3EM 4EV0A 1P6RA 2LK2A 1P7JA 3Q0VA 2FBIA 2Z2SB 1JUPA 3GWZA 2D5VA 3AFHA 1X1BA 1JTXA 3BJ6A 4ON0A 2GOMA 2NNYA 1YRNA 3F0CA 3KZIC 2FX0A 4A12A 1FSEA 4UVAA 4P55A 1EJ9A 5E8GA 1S3JA 3VSKA 4B47A 2ZBKA 5JHFA 3RZDJ 4HSTA 2XHKA 3TW7A 1BIBA 3MKYB 2P7VB 1BC7C 4XKWA 4IOAF 1TNTA 4LGWA 4XICA 1D0YA 2V6CA 1FT9A 3L2VA 1ZQ3P 3WG7H 4UV9A 2M9HA 3TDUC 3QYBA 2O6GE 1U6GA 1FBUA 2EWNA 1QA6A 4I76A 1B59A 3DTIA 1I3QJ 5D5UB 2DLLA 5L3EA 2Z3YA 4RB2C 1ETVA 3Q0WA 1X3ZB 3FBIB 3WHCA 3I64A 2Y30A 1Z3YA 2R5ZB 4MEYF 4YELA 2LNBA 3JRDA 2G9WA 2Y0SN 3TOBA 3FWEA 3OYHA 1O4XA 4M6VA 5CVVA 4BU2A 5IOZA 1MGTA 2V9VA 3FM3A 5KCMA 2R5YB 2KKOA 1OISA 2UZKA 3BP8A 4C2TA 3KP5A 4I0AA 4UUTA 2F6CA 1IO2A 2Q2EA 4LLLA 4DIQA 4KT5C 3GX4X 1LB2A 2RQPA 5E1XA 3G4SI 2X9DA 2LR8A 2JVGA 2ZC2A 4JP0A 1LDDA 2HVSA 4WF2A 5D4SA 4EQQA 1I5ZA 1X1AA 2RGVA 2EA4A 1MMSA 2RQQA 4DZJA 1G6NA 2HOEA 1HDPA 1TL8A 2JPBA 2D1VA 3HSFA 2HYGD 2NRAC 5K7FA 2IW5A 4FE7A 4RGSA 3FX3A 3QYFA 1YIOA 4M71A 4IQ4A 4M6YA 3HJEA 3I53A 2YSRA 1AU7A 2VLAA 2DJIA 2OC6A 3I58A 5BMZA 1LEBA 1FYMA 1XMXA 4XORA 2DK5A 1R1UA 3AG3H 2ADUA 2Y31A 3AKZA 1WGXA 4ZZLA 4BY1J 1XSXA 4PJJA 2HKXA 2JRTA 3UNGC 2DBBA 1PYVA 3E5XA 2P81A 3RYRA 5BPDA 3IRQA 3GTLJ 1MD0A 4KJZA 5B66C 3HOWJ 1Z1DA 2TDXA 4C30A 4D7MA 3BC8A 2H1KA 1ORKA 4RMNA 3L9FA 2AXTC 1K7AA 4BKXA 3S1MJ 1TC3C 2BEOA 3EQLF 3KCCA 4R8HA 2IS2A 2CUEA 1U9OA 3DKYA 1JT6A 4UUVA 1YFHA 2HNHA 5ICFA 5K1YA 1Z21A 2ZXJA 1E2XA 4N4NB 2RN7A 3IWZA 3LNQA 4XLCA 1F1ZA 3QPLA 2OV7A 3RQIA 3K70C 3RTRA 2PMZN 3K7AJ 2EZHA 2GBYA 5LEJA 3G71I 2ESHA 3U1DA 5LLQA 2R7OA 5E20A 2GLOA 1KONA 1OR7A 5GAEJ 2ACJA 1W7PB 4B1RA 3REOA 2E2HJ 2BW3B 5H20A 1FSHA 2BY2A 2DQRA 2ME6A 1MNMC 3OSFA 4U7DA 5DDGA 1V5FA 1LEAA 2X0LA 2K4BA 5J3LA 2P0WA 3PUBA 3I9V2 5D4RA 2BZTA 4IHXA 2KDZA 2P7CB 4XK4A 3S17J 3D5LA 5F0FA 3TP0A 3GZ5A 2XAFA 1NG7A 1KZHA 2XUBA 5KHDA 3L2QA 4HZFA 2ETHA 2WAQA 3I4NJ 2LKXA 1JE8A 3PQJA 4UB6C 2OBPA 3ABUA 4I7HA 3W2VA 2R7UA 5DS9A 4I6ZA 1I50J 4YFKF 3U21A 2MH9A 3DTEA 3S2HJ 5LHHA 3C18A 5M5YJ 3BZ6A 2OJED 3MVPA 5DD4A 5JHUA 4G7OF 1MJBA 1MMAA 4RAFA 1X1PA 1WJBA 3K4BA 3RPQA 2NVYJ 3GLLA 3K2ZA 1PVEA 3BG5A 1TWAJ 2W57A 3L00A 3ZMZA 2LC2A 3DLLF 4W97A 2LY1A 3ZGKA 1HW1A 4J19A 3ABKH 3CO6C 1G3WA 4G7ZF 4ZDOA 1ERDA 2BXYA 3NRVA 3RKXA 1G8XA 1BA5A 2LVSA 4C9YA 1J09A 2EZKA 4MNUA 4KN4X 3GLXA 1UELB 2RREA 4BL0B 1BI1A 2VN2A 5FLMJ 3S3OA 3KLNA 2DFFA 1RZ4A 3GTKJ 1U8BA 3JRIA 1I3AA 3W6VA 1SMYF 2KZGA 4G12A 4BE2A 1P4XA 3FMRA 2I5UA 4XQFA 2VB6A 3KEOA 5CVUA 4KT6A 1PP8F 4HAMA 4F3QA 3C7JA 4RS8A 2Y48A 5GAHJ 3J81K 2XVCA 4HF1A 2EINH 1N77A 2YX7A 3M1EA 4H4KC 3S14J 4EATA 3TO7A 1H9TA 2EK5A 2O3FA 2EV0A 1RKWA 3PSIA 2OCEA 1HBXG 1NHAA 2DPUA 2V9PA 2XF7A 2JTVA 2BBYA 4XM3A 4AVZA 5CYVA 3NWSA 4DYCA 2ZNZA 2XC7A 1N25A 2V1NA 3LFKA 1GV2A 1O7LA 3B02A 4I2OA 1YQAA 4PSXA 2CQQA 4A3IJ 3AL0B 4Y33A 2W00A 1W5TA 3HTUA 4JYKA 3WTTC 1WFXA 4BJ6C 2CGPA 3CCVI 4Q48A 5FKKA 4S0HB 2OZ6A 1SVLA 1WJ5A 3BQYA 3CCEI 1UB9A 1AKHB 5CKTA 4DYRA 3LSRA 4ZTJA 4PCQA 4C3IJ 4HG2A 2H6CA 1FYKA 2X6OA 2LTPA 2XF5A 5J4VA 3CMAI 2HYFA 1IN6A 2LF7A 4B09A 4ENJA 3MWMA 3GYHX 4LG0A 4LD5A 1LVAA 1XSVA 4HSRA 4KFCA 2YR2A 4HBLA 5J8CA 3G3ZA 5C4JJ 3M3YJ 1YTYA 4F52A 5B1BH 4XIDA 1QQIA 2FRHA 3RI4A 4J00A 1R36A 3PO3J 2ZFUA 3ERED 3HUGA 2A05A 2L9SA 3K2AA 1ETYA 5HDNA 1WPKA 3VYSB 2FOKA 3F72A 2XKOA 2WB1A 4OIRF 3HEFA 1EA3A 3J7YJ 4BNCA 2L0KA 4BDYA 2LOOA 4Q5SF 5C4XJ 3EPZA 3GTQJ 1QZEA 1QVTA 1ZLJA 4RBOA 2R7VA 3DQVC 1SFUA 1Y8RB 1T0FA 4QSHA 2DN0A 3IHUA 2FF4A 5KAFC 4OIQF 4UB8C 3BTCA 2XROA 4EJTA 5DTDA 2VQCA 4LB6B 3E97A 4BE0A 5BOXA 3A01B 4CA0A 2PJRB 4YIIA 4WWCA 4DJAA 4CGZA 1FJLA 5EGOB 3JCUC 3OOUA 4RB0A 1G3YA 2PJPA 2CW7A 3F6OA 3CQZJ 3F8NA 4KISA 1U2WA 1O3RA 3GXOA 1VQPI 4A6EA 3IC7A 4XLPF 1TQMA 1WQ2A 5E3NA 1SEUA 4OAZA 2VIXA 5H2FC 4BE1A 4E6KG 2L4MA 5L3BA 1J59A 3OWTA 2P5LC 4OMYA 4YFXF 3J7AY 2QCOA 1YJWI 2K9SA 3KZZA 2CV0A 1KQ9A 1JT0A 5KK1A 2XAUA 2HZTA 2FMLA 2V1UA 4PK4A 1X4PA 2MFZA 3OYNA 3ZR8X 5L3DA 6PAXA 5HODA 4ZJZA 1HW5A 5E79C 1W36D 4IHYA 3S1QJ 4HNVA 1EF4A 2COMA 2O8KA 1XPXA 2M1BA 1KU9A 2VE8A 3A1YA 2QVOA 4ANJA 1YHQI 2K9MA 4KDPA 2R7ZJ 5E8IA 3GCMA 2VUMJ 3TQNA 3F8MA 5A2QK 4I98B 2MLKA 1OCZH 3HHHA 1Y8QB 1OQYA 2RNJA 3M4OJ 2LY2A 2ZXHA 5L3FA 1S29A 4QIWN 1KU3A 1P4AA 2MC4A 4E7KA 1CQTA 1WVRA 2BHYA 4GXOA 3B6AA 4CO8A 1CF7A 4Y17A 1N75A 4TV7A 3SHFA 1K78A 1XDUA 1FMWA 4AWXB 2M0CA 2R7SA 3E1SA 2Z99A 2ESNA 1OJLA 4A3FJ 3HRTA 3ABMH 3CCJI 3CMMA 2HVQA 3HYIA 2F5CA 3M8FA 4V2GA 5CJ9A 3BR2A 4S05A 2QF7A 4ZYAA 3PNTA 2ECCA 2HZDA 3WGIA 1H0MA 2K40A 2K9QA 2QYOA 3RKWA 2IGMA 2DQLA 5K7ZA 4B3AA 4X1EA 3OV8A 2CSOA 3F23A 1VQ8I 4II2A 4N9HA 3V8JA 1GHCA 2HYJA 1ZRFA 5CVIA 3PIOF 1TNSA 1BC8C 1X3UA 4G6TB 4YFNF 2O0YA 2QQAA 2R93J 2H94A 1H88C 2TRTA 4MHGA 3MKZA 1WZ2A 2K85A 2IEKA 5CQEA 4HDUA 1F43A 1K4SA 1T6SA 5FKOA 5HNHA 2CJJA 1E3PA 2ZO4A 2MH2A 3O6BB 3HOTA 3COAC 5LD2C 1NK2P 4L0YB 5FLXK 3JRCA 1TT0A 2HFHA 1V3FA 5HDGA 5F1RA 2PMUA 3PUFA 3RDIA 2FBKA 4ITVA 3SDGA 1BW6A 5IYDJ 1HOMA 5DM6F 4Z2YA 1IGNA 4HQMA 2VBZA 1FP2A 2K86A 3ULQB 4F92B 3DEUA 2GQQA 5F0CA 5FKMA 5E18F 2KIUA 5DYMA 1O3QA 3R60A 4HLYA 1FBQA 1XN7A 2HPMA 3VYUB 3OR1C 1MKMA 3R6SA 2QSHX 2IS6A 3NAUA 2M4GA 2YS9A 2I8DA 2B7EA 3Q5FA 2DYSH 4IHWA 2A5YB 2DO7A 1Z6RA 2JA2A 3FISA 3X2QH 3JSPA 5HS7A 2DYRH 1S72I 3KP6A 1J9IA 1JTYA 1W5CC 1QHHD 4CH7A 4P9UA 4OU0A 2IS4A 1Q1VA 2R5ZA 1LDKB 3NQOA 3DPLC 3CCQI 5ILVA 3GFMA 1BI0A 3D5RC 4KIGA 1PUFA 1ULYA 1ZTRA 3OY9A 2QEXI 2CU7A 4F91B 2M3AA 1SMTA 4GGGA 2V1DA 3PFIA 4XONA 2NS0A 3LWFA 2M87A 5D8KB 1P92A 2DODA 3WODF 4CUGA 3SDBA 4EGYA 3CC7I 1APLC 2NYXA 1QHGA 1RPWA 3I59B 2BV6A 3O2PE 3OYIA 4C3HJ 1B9MA 5J40A 1ZAOA 1HKTA 2X1CA 3OS1A 1A6QA 3TBIA 3KEYA 1JHHA 4GO1A 3U2RA 4V2FA 1H89C 2VJ4A 1Z7UA 2HDCA 4ENKA 1LVKA 2DMUA 1OLTA 2ZXWH 3ZQHA 4AIHA 3M1CA 5CPRB 3CUOA 2R92J 3P9IA 1BM9A 1XTAA 3KFWX 4Y52J 3ABLH 3CCSI 2MYSA 2WBMA 2PMZA 5FFZA 2RDPA 2ZFWA 5FKLA 4RAYA 2LP0A 3TDZC 5FD6A 3IWFA 1BBYA 2DT7B 1HF0A 1ON1A 2IT0A 1D1BA 3SJMA 4XNFA 3SQNA 1R4NB 3JSOA 2CO5A 3G1LA 3CCRI 2AS5F 4D5FA 2CQNA 3V7SA 4A3DJ 1FIPA 3OYJA 4PJ0C 2VODA 4CYCB 4IHTA 2QSGX 3RIRA 3CF5F 2A5WA 1MBKA 3WTZA 4ZYGA 1GVDA 1G59A 1X58A 2AXLA 2HOTA 1IXSB 3LQRA 4UVCA 1S9HA 4ZDPA 1EH8A 1RIOH 4JK1X 2H1LA 4FASD 2R7FA 1KGSA 4A3LJ 4XRFA 2Y75A 2RV8A 3L2WA 2IPQX 1NTCA 5IPAA 4B44A 2P6SA 2RVCA 1WI3A 2XB0X 2F48A 4WXCA 4BJ5C 2V9KA 4JBAA 3TKYA 1EV7A 1QZZA 5TJJA 3BCAA 2Q8KA 1G3SA 1LFBA 1IUFA 2BY1A 4O3MA 2CRGA 2DMPA 1S7EA 5FO5A 1KU2A 2RKHA 3ZMDA 4BHCA 4QPQA 2ZSIB 3K4NA 1UCRA 2NVUB 2P8TA 3AG1H 3DP7A 1WJDA 1W7PA 1H8AC 2DPDA 3EUKL 3QYEA 4XRSG 3F8BA 4WCGA 2BW3A 4FISA 1LNWA 1U5TB 2J5OA 3OYMA 4A0ZA 2ZKZA 4GYGA 5HLTA 4OWRB 1ZELA 3EETA 1IXCA 3QRFF 2NVXJ 1WJAA 4CDGA 3DWLE 2OQRA 2W82A 1FP1D 2FOWA 2KQRA 3KP3A 1R7JA 2XASA 1BJAA 2DOEA 1X1DA 3OMYA 3KIOA 2EFPA 2BYVE 2JUCA 1D1CA 2NOGA 3LSTA 4U88A 1XX5A 2JUGA 5E3MA 1O57A 1P7IA 1J7KA 5HLHA 5LBQA 5JR3A 1MSEC 5IP6A 1HLVA 3HDDA 3F3XA
chains in the Genus database with same CATH topology
3HRSA 3DV8A 5LEKA 5DUKA 3SZPA 1HXDA 1ZH5A 1GVJA 2O03A 2GZWA 3KLOA 3PQKA 4M74A 2BE5F 3BOQA 3DKWA 3VB2A 4L0ZB 2F5EA 4A6DA 3U9GA 4G6DA 2VC0A 3JAMK 3I71A 4ZH4F 2HS5A 1TLHB 1ZYRF 4IXAA 3DXJF 2XAHA 3WE3A 1L3LA 1ZG1A 4IRHA 1MZBA 4CZZA 3N97A 2QBYB 3NEUA 2XGXA 4LB5A 4N0BA 4I01A 4YIFA 1D5VA 3WGGA 1R00A 1OKRA 1XMKA 2ISZA 1XDSA 1BOAA 4U0VA 1MDMA 3KP4A 2FU4A 2EV6A 2DK8A 2PEXA 3HRMA 2EFWA 1W5SA 2HTSA 1MJ9A 4MTEA 3HHGA 2Z5UA 3J81Z 2GXBA 4EM0B 5F64A 2IA0A 3DFGA 1UHMA 1ON2A 3I4PA 1WI9A 4M9SA 5D6EA 5K5QA 5ED4A 2ELHA 2RC4A 1S6LA 2FSWA 3CUQA 4BHBA 1HSJA 2GAUA 1O3SA 2PLYA 5D6FA 1L0OC 4A5MA 1PDNC 5DV5A 1OYYA 1SFEA 2VONA 3FHZA 1T38A 4IJAA 3ABTA 2EJRA 3GW2A 3T8RA 3LQQA 2W24A 3FXQA 2XKPA 2Z9OA 4G7HF 3FM5A 2A07F 2LKPA 3ZMSA 4RB1A 3I54A 1BI3A 4HDVA 3FF5A 5D5WB 3R61A 1KQ8A 2VBWA 3QU3A 4UV8A 3RYPA 3K1NA 3WTVC 3KZYA 4ENMA 1WKMA 1LDJA 4OOIA 5KVRA 4A5NA 3ECOA 2FE3A 4IF4A 3T0YA 3HTSB 3E6CC 2E7XA 2PFBA 4LJZF 1AOYA 5H6RA 4MQ9F 4IRGA 1Y0UA 3JTHA 2FQ3A 4P9FA 1ZN2A 3WU1B 2QWWA 3AAFA 4HLXA 3JTGA 1P4WA 5E1ZB 1I6XA 3K1MA 3L09A 2FBHA 1C0WA 1QNTA 2VBXA 5HLIA 3MZYA 2QM3A 4S04A 3CTAA 1HSTA 1W7PD 3H3ZA 2EB7A 2DAOA 1ODDA 1YG2A 5A2QZ 4G8XA 3BY6A 1HQCA 2ZMEB 4EMSA 1IZ1A 3ELKA 2CYYA 2PMHA 3L2CA 1OYIA 4IRIA 1YLFA 3BROA 3E6BA 4U0WA 2E1CA 3ZN0A 4L9TA 2WC2A 2HGCA 1FX7A 1FYLA 2O61A 1XGNA 1ZLKA 3V4GA 3WG9A 3ZP5A 1R1VA 2Z33A 2VC1A 1OYWA 2CFXA 1G4DA 2FMYA 2IP2A 2EA2A 4IHSA 1J2XA 1F5TA 3GEZA 4HF0A 4ZZDA 1VTNC 2FXAA 4EJOA 5BQTA 3FMSA 4AIKA 2Y0MA 3DPTA 3F8FA 3HSEA 2QQBA 5DUIA 3TOAA 1SD7A 2ZNYA 5FLXZ 3WTXC 4CYDA 2VT3A 4XSZF 1UFMA 4A0XA 1EH6A 3O3KA 2G7UA 5JI6A 2YU3A 5LHGA 2VE9A 3M9AA 2PN6A 1IN5A 4NHJA 5DCFA 1T98A 2XV4S 3QPTA 3T1BA 3B73A 4O5VA 4DQ2A 2G7HA 1Z6TA 5J6XA 3I59A 1QBJA 1F4KA 4EVIA 1DP7P 1ZGJA 4IVNA 3J7AO 3J80Z 3C1DA 4EGZA 3F6VA 1XGSA 1S8NA 3ISPA 5CLSA 1Q1HA 4G94A 3ROUA 4M6XA 4HV5A 1T39A 4I0BA 2UWMA 2PG4A 3E6MA 2UXXA 2XAQA 1FY7A 4G9YA 1HW2A 4CICA 2VXZA 4ESJA 2JSCA 3ZMTA 4LMYA 2PI0A 2EV5A 1YO5C 5ERIA 1YW8A 2JPCA 2OA4A 4MQVA 2V1XA 3ZQ7A 1USSA 4WXHA 3M8EA 4M9XA 3GF2A 4BXUA 1ZRDA 5DCMB 3G73A 4HF2A 3BWGA 2HTJA 3K69A 4FT8A 4U0YA 2YPRA 1USTA 2K7LA 2WV0A 3IRRA 2OD5A 4G6QA 2K27A 1PUEE 2VOOA 1U5TA 2A6EF 2EFQA 4UHTA 1R58A 1KA8A 4M73A 1FWZA 2H09A 3GO5A 3SFZA 1TTYA 2IVMA 4OIPF 1XB4A 3J80K 1R1TA 4I09A 4LLNA 4HA8A 1T2KA 1B6AA 2HQRA 2EFNA 4RGUA 4A0YA 2ISYA 3ZN1A 3E6DA 4M9ZA 3RKYA 2XAGA 1IAWA 4XBFA 3ECHA 3GFIA 4JQFA 3SXYA 3TGNA 3KE2A 1ZG3A 4PGGA 3VFZA 2XIGA 4CHUA 3RPUA 4AVPA 2QBYA 3JAMZ 1FZPB 1FNNA 5E17F 4WXDA 2X4HA 1XSDA 1RUOA 2L3DA 1K79A 4XSXF 2M45A 5FGMA 1I1GA 3MAJA 3R0JA 5JVTA 2W85A 3ML6A 2C6YA 1R5HA 4PZJA 2V79A 3WTUC 2HEOA 2A69F 1DPUA 4L18B 3BJAA 2DW4A 4ZYEA 1ZREA 2F2EA 2LF8A 5K5OA 3QPHA 3K0LA 3HSRA 3I5UA 2L02A 1IN8A 4E70A 4U7BA 1FPQA 2DTRA 5HS9A 1S7OA 1ZGAA 2P4WA 4EM2A 4R79A 4HX8A 2LSOA 5CVRA 2OAZA 4MTDA 3VODA 4XLNF 4QWQA 1K6OA 3LA2A 2VT2A 2O8XA 1ZG5A 5D5VB 3N4MA 1Z91A 5LGUA 3MZHA 3KP2A 3QOPA 2IA2A 5HOOA 4ENNA 1O7FA 2HR3A 5JFRA 2XAJA 3CUQC 1KQ0A 3Q9SA 3D0SA 5ICGA 3EDPA 1S7AA 2QUFA 4KMFA 3V8LA 1IN4A 4LK1F 2FA5A 1FLIA 1YW9A 3M7GA 2OZUA 3WTYC 1J0RA 4EJVA 3QP5A 1B9NA 1HKQA 3P9CA 5IT9K 1E17A 4ASNA 1DPRA 2OQGA 2ZCWA 2NAZA 2CQKA 2CG4A 2QQ9A 1TW3A 3W6KB 5DEQA 2MD5A 4BQAA 3IKTA 4KICA 4BAYA 5L3GA 3LA7A 3KP7A 2KJBA 1ZHFA 2STWA 4GYIA 1YW7A 3P9KA 1BIAA 1YYVA 2HQNA 2QENA 3IL2A 1WSUA 1FOKA 1REPC 4M72A 3MQ0A 2KJCA 4LK0F 1R22A 2KIMA 1LJ9A 1QGPA 2A3SA 3KEQA 1YS7A 4EJWA 4Y15A 2IRFG 4KYWA 3V8KA 2DU9A 5IT3A 4RB3C 4ESBA 3KETA 1D8JA 3RJPA 2ZMEA 1G3TA 4IPAA 1F9NA 1Z9CA 4ESFA 4HW0A 5J8FA 4LFUA 4OMZA 1H9GA 3JW4A 1TBXA 3CDHA 5BPIA 1IN7A 3SZTA 4HQEA 3GFJA 4QLCU 5L3CA 1V4RA 3LA3A 2L54A 1WRJA 1RI7A 4CXFA 2EFOA 5K5RA 2FNAA 4ZYHA 1XGMA 2HKOA 2F5DA 2E7WA 3CLOA 3HIFA 5FD5A 3FZVA 3L7WA 4UNOA 3IKVA 2GA1A 1D8KA 4ETSA 2F5FA 4I02A 4D0PA 4L5IA 4P96A 2XRNA 4RGRA 1D3YA 3MCZA 3V7RA 2D2WA 3P7NA 4OIOF 4KN7X 3S2WA 4R1HA 3GZ6A 2D45A 1MDMB 4Q4ZF 4L9VA 1LQ1A 3F8CA 2R3SA 2H27A 3V7CA 1STZA 1J75A 3F21A 4KIFA 3Q9VA 5FFXA 1SFXA 3WTWC 1I1SA 1W4MA 2KIFA 4HYEA 1CGPA 3T5XA 2DFIA 1DDNA 1TQIA 1KYWA 5TRDA 3GUDA 5AONA 1GXPA 3CUQB 3E5UA 3R0AA 1UHWA 1IUYA 1DUXC 4HX4A 3W6JB 4NQWA 3MEXA 5HLGA 4PGHA 1SD4A 3CO7C 3QU6A 1SD5A 3GFLA 2R7DA 4B8XA 1YS6A 2QZ8A 2B0LA 4GCVA 4KNYA 1O3TA 2GIVA 1GXQA 1P2FA 2FEZA 5BS6A 2M5WA 1J5YA 3I0TA 4FX0A 1SAXA 2OU2A 5DCMA 2Q0OA 2DT5A 4DNCA 4Y13A 3FXUA 4UXNA 2H6BA 5EEGA 3TO6A 2HWVA 3EYIA 4L5JA 4N9IA 5ICEA 2BGCA 2M30A 1RNLA 2P5KA 5DD8A 3VOEA 3BJOA 2JZYA 4EJUA 1JHFA 4RGXA 3ZMVA 5ILSA 3WU0A 3FMQA 2MC3A 2P6TA 1Z05A 1KU7A 4AIJA 1OMIA 4KA4A 4L9JA 2L01A 4MGRA 3R4KA 3C3WA 4L9NA 1KYZA 4BYYA 1U5TC 3MFKA 5HVQC 3ZPLA 1ONVA 2A68F 2DI3A 4OINF 3BDDA 2W84A 2VBYA 5HDKA 4HX7A 4BH9A 1XGOA 2YX4A 5ILUA 4RAZA 4LG0B 5H6QA 4F7ZA 1JGSA 3CJNA 3LAJA 2FNPA 5LRRA 2QLZA 3ZMUA 1I27A 3H3UA 2K02A 5E1WA 4UVBA 2MBFA 4FX4A 5LGTA 1OPCA 3LAPA 3BPVA 3WTSC 4MEXF 4KMUX 3HRUA 1QO0D 1U8RA 2JT1A 2WTEA 5ICCA 3VEPA 5LRSA 1TW2A 4EM1A 4ZYDA 4HOBA 1R5GA 2L4AA 5AIPA 3TO9A 1ZRCA 4WK8F 2STTA 2ZJ2A 5D5XB 2CWEA 3EUHA 1RUNA 2MA3A 2W25A 2IJLA 4KIBA 1XMAA 4AD9A 5LGNA 2KRFA 1SD6A 3E3VA 2WWYA 1FBSA 4FHTA 3E5QA 2D1HA 2GXGA 4H0EA 4O6JA 1AWCA 3H92A 1U78A 2PQ8A 4WX9A 1IRGA 2PBIA 1XD7A 4P5OA 5D8LB 2A61A 2NNNA 4PDKA 2UXNA 2MLGA 3GVAA 4HV6A 3T8TA 1IF1A 3DF8A 4NB5A 3F22A 3WGHA 1CF7B 1QPMA 1JXSA 1QZYA 4YG2F 2K4JA 2M8EA 2GA2A 1XCBA 2E1NA 1K78B 1TQPA 1IRFA 1B1BA 2IA1A 1EH7A 4A2UA 3OOPA 3FXRA 3EYYA 5CVJA 3K9TA 1BN5A 1IW7F 5F6FA 1BI2A 1A04A 1FC3A 3K1PA 4BHPA 1R23A 3QP6A 1ZARA 3HOSA 1PP7U 5FB2A 1MJAA 2A6HF 1B4AA 2CW0F 1HKSA 4KUMA 4Q47A 1WWXA 4K2EA 2VOPA 2P5VA 5HS8A 2GWRA 3QAHA 4LLGF 5EEHA 1XCVA 5AIQA 3BPXA 5LHIA 2LDUA 1IXRC 3WE2A 5IT9Z 2J5PA 1U3EM 4EV0A 1P6RA 2FBIA 3GWZA 3BJ6A 4ON0A 2NNYA 4A12A 1FSEA 4UVAA 4P55A 5E8GA 1S3JA 2ZBKA 2XHKA 1BIBA 2P7VB 1BC7C 1TNTA 4LGWA 2V6CA 1FT9A 4UV9A 3TDUC 2O6GE 1U6GA 1FBUA 2EWNA 1B59A 5D5UB 2DLLA 5L3EA 2Z3YA 4RB2C 3I64A 4MEYF 2LNBA 2G9WA 3TOBA 3FWEA 5CVVA 1MGTA 2V9VA 3FM3A 2KKOA 2UZKA 3BP8A 3KP5A 4I0AA 2Q2EA 4LLLA 4KT5C 3GX4X 1LB2A 2RQPA 5E1XA 1LDDA 4WF2A 5D4SA 4EQQA 1I5ZA 2RGVA 2EA4A 1G6NA 2HOEA 2JPBA 2D1VA 3HSFA 2HYGD 2NRAC 2IW5A 4RGSA 3FX3A 1YIOA 4M71A 4M6YA 3I53A 2YSRA 5BMZA 3I58A 1LEBA 1FYMA 2DK5A 1R1UA 2ADUA 4ZZLA 1XSXA 2HKXA 2JRTA 2DBBA 3E5XA 3RYRA 5BPDA 3IRQA 1MD0A 1Z1DA 2TDXA 3L9FA 1K7AA 2BEOA 3EQLF 3KCCA 4R8HA 4UUVA 1YFHA 5ICFA 5K1YA 2ZXJA 1E2XA 2RN7A 3IWZA 1F1ZA 3RTRA 5LEJA 2ESHA 3U1DA 5LLQA 5E20A 1OR7A 2ACJA 1W7PB 3REOA 5H20A 1FSHA 2DQRA 4U7DA 5DDGA 1LEAA 2X0LA 2K4BA 5D4RA 2P7CB 3D5LA 3GZ5A 2XAFA 2XUBA 4HZFA 2ETHA 1JE8A 3PQJA 2OBPA 3ABUA 4I7HA 4YFKF 2MH9A 5LHHA 3C18A 3BZ6A 5DD4A 5JHUA 4G7OF 1MJBA 3RPQA 3K2ZA 3L00A 2W57A 3ZMZA 1HW1A 3CO6C 1G3WA 4G7ZF 3NRVA 3RKXA 4MNUA 4KN4X 3GLXA 1BI1A 2VN2A 3KLNA 1RZ4A 1SMYF 1P4XA 3FMRA 3KEOA 5CVUA 1PP8F 4HAMA 3C7JA 4RS8A 2Y48A 3J81K 2XVCA 4HF1A 2YX7A 3M1EA 3TO7A 1H9TA 2EK5A 2O3FA 2EV0A 1HBXG 1NHAA 2DPUA 2JTVA 2BBYA 5CYVA 2ZNZA 3LFKA 4I2OA 1O7LA 3B02A 1YQAA 1W5TA 3HTUA 3WTTC 2CGPA 4Q48A 2OZ6A 1UB9A 4PCQA 2H6CA 1FYKA 2HYFA 1IN6A 2LF7A 4B09A 4ENJA 3MWMA 3GYHX 4LG0A 4LD5A 1LVAA 1XSVA 4KFCA 2YR2A 4HBLA 5J8CA 3G3ZA 1YTYA 1QQIA 2FRHA 3RI4A 1R36A 3ERED 3HUGA 5HDNA 2FOKA 3F72A 2XKOA 4OIRF 4BNCA 4Q5SF 1ZLJA 3DQVC 1SFUA 1T0FA 3IHUA 2FF4A 4OIQF 2XROA 4EJTA 4LB6B 3E97A 5BOXA 4YIIA 4WWCA 4CGZA 4RB0A 1G3YA 2PJPA 3F6OA 3F8NA 1U2WA 1O3RA 3GXOA 4A6EA 3IC7A 4XLPF 1TQMA 1WQ2A 2L4MA 5L3BA 1J59A 2P5LC 4OMYA 4YFXF 3KZZA 1KQ9A 5KK1A 2HZTA 2FMLA 2V1UA 5L3DA 6PAXA 1HW5A 2COMA 2M1BA 1KU9A 2VE8A 2QVOA 4KDPA 5E8IA 3TQNA 3F8MA 5A2QK 4I98B 2MLKA 3HHHA 2RNJA 5L3FA 1S29A 1KU3A 1P4AA 4GXOA 4CO8A 1CF7A 4Y17A 4TV7A 3SHFA 1K78A 1XDUA 4AWXB 2Z99A 2ESNA 3HRTA 3HYIA 2F5CA 3M8FA 5CJ9A 4S05A 3WGIA 1H0MA 2QYOA 3RKWA 2DQLA 3F23A 3OV8A 2CSOA 4N9HA 3V8JA 1GHCA 1ZRFA 5CVIA 1BC8C 1TNSA 1X3UA 4YFNF 2O0YA 2QQAA 2H94A 4MHGA 4HDUA 1T6SA 2ZO4A 3O6BB 3HOTA 2MH2A 3COAC 4L0YB 5FLXK 2HFHA 1V3FA 5HDGA 5F1RA 2PMUA 3RDIA 2FBKA 4Z2YA 4HQMA 2VBZA 1FP2A 2K86A 3ULQB 3DEUA 2GQQA 5E18F 2KIUA 5DYMA 1O3QA 3R60A 4HLYA 1FBQA 1XN7A 1MKMA 3R6SA 3Q5FA 2A5YB 2DO7A 1Z6RA 3JSPA 5HS7A 3KP6A 1J9IA 4P9UA 4OU0A 1LDKB 3NQOA 3DPLC 5ILVA 3GFMA 1BI0A 4KIGA 1ULYA 1SMTA 4GGGA 2V1DA 3PFIA 2NS0A 3LWFA 2M87A 5D8KB 1P92A 3WODF 4EGYA 2NYXA 3I59B 2BV6A 3O2PE 1B9MA 1HKTA 1ZAOA 1JHHA 4GO1A 3U2RA 1Z7UA 2HDCA 4ENKA 4AIHA 3CUOA 3P9IA 1BM9A 3KFWX 5FFZA 2RDPA 2ZFWA 4RAYA 3TDZC 5FD6A 3IWFA 1BBYA 1ON1A 2IT0A 3SQNA 3JSOA 2CO5A 2AS5F 3V7SA 2VODA 4IHTA 3RIRA 3WTZA 4ZYGA 2AXLA 1IXSB 3LQRA 4UVCA 1EH8A 1RIOH 4JK1X 2R7FA 1KGSA 4XRFA 2Y75A 2RV8A 2IPQX 2P6SA 2RVCA 4WXCA 4JBAA 3TKYA 1EV7A 1QZZA 5TJJA 2Q8KA 1G3SA 4O3MA 5FO5A 1KU2A 2RKHA 3ZMDA 4BHCA 1UCRA 2P8TA 3DP7A 1W7PA 2DPDA 3F8BA 4WCGA 1LNWA 1U5TB 2J5OA 4A0ZA 2ZKZA 4GYGA 3EETA 3QRFF 1IXCA 4CDGA 2OQRA 1FP1D 3KP3A 1R7JA 2XASA 1BJAA 2EFPA 2BYVE 3LSTA 4U88A 1O57A 1J7KA 5HLHA 5LBQA 5JR3A 3F3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRS A;  3DV8 A;  5LEK A;  5DUK A;  3SZP A;  1HXD A;  1ZH5 A;  1GVJ A;  2O03 A;  2GZW A;  3KLO A;  3PQK A;  4M74 A;  2BE5 F;  3BOQ A;  3DKW A;  3VB2 A;  4L0Z B;  2F5E A;  4A6D A;  3U9G A;  4G6D A;  2VC0 A;  3JAM K;  3I71 A;  4ZH4 F;  2HS5 A;  1TLH B;  1ZYR F;  4IXA A;  3DXJ F;  2XAH A;  3WE3 A;  1L3L A;  1ZG1 A;  4IRH A;  1MZB A;  4CZZ A;  3N97 A;  2QBY B;  3NEU A;  2XGX A;  4LB5 A;  4N0B A;  4I01 A;  4YIF A;  1D5V A;  3WGG A;  1R00 A;  1OKR A;  1XMK A;  2ISZ A;  1XDS A;  1BOA A;  4U0V A;  1MDM A;  3KP4 A;  2FU4 A;  2EV6 A;  2DK8 A;  2PEX A;  3HRM A;  2EFW A;  1W5S A;  2HTS A;  1MJ9 A;  4MTE A;  3HHG A;  2Z5U A;  3J81 Z;  2GXB A;  4EM0 B;  5F64 A;  2IA0 A;  3DFG A;  1UHM A;  1ON2 A;  3I4P A;  1WI9 A;  4M9S A;  5D6E A;  5K5Q A;  5ED4 A;  2ELH A;  2RC4 A;  1S6L A;  2FSW A;  3CUQ A;  4BHB A;  1HSJ A;  2GAU A;  1O3S A;  2PLY A;  5D6F A;  1L0O C;  4A5M A;  1PDN C;  5DV5 A;  1OYY A;  1SFE A;  2VON A;  3FHZ A;  1T38 A;  4IJA A;  3ABT A;  2EJR A;  3GW2 A;  3T8R A;  3LQQ A;  2W24 A;  3FXQ A;  2XKP A;  2Z9O A;  4G7H F;  3FM5 A;  2A07 F;  2LKP A;  3ZMS A;  4RB1 A;  3I54 A;  1BI3 A;  4HDV A;  3FF5 A;  5D5W B;  3R61 A;  1KQ8 A;  2VBW A;  3QU3 A;  4UV8 A;  3RYP A;  3K1N A;  3WTV C;  3KZY A;  4ENM A;  1WKM A;  1LDJ A;  4OOI A;  5KVR A;  4A5N A;  3ECO A;  2FE3 A;  4IF4 A;  3T0Y A;  3HTS B;  3E6C C;  2E7X A;  2PFB A;  4LJZ F;  1AOY A;  5H6R A;  4MQ9 F;  4IRG A;  1Y0U A;  3JTH A;  2FQ3 A;  4P9F A;  1ZN2 A;  3WU1 B;  2QWW A;  3AAF A;  4HLX A;  3JTG A;  1P4W A;  5E1Z B;  1I6X A;  3K1M A;  3L09 A;  2FBH A;  1C0W A;  1QNT A;  2VBX A;  5HLI A;  3MZY A;  2QM3 A;  4S04 A;  3CTA A;  1HST A;  1W7P D;  3H3Z A;  2EB7 A;  2DAO A;  1ODD A;  1YG2 A;  5A2Q Z;  4G8X A;  3BY6 A;  1HQC A;  2ZME B;  4EMS A;  1IZ1 A;  3ELK A;  2CYY A;  2PMH A;  3L2C A;  1OYI A;  4IRI A;  1YLF A;  3BRO A;  3E6B A;  4U0W A;  2E1C A;  3ZN0 A;  4L9T A;  2WC2 A;  2HGC A;  1FX7 A;  1FYL A;  2O61 A;  1XGN A;  1ZLK A;  3V4G A;  3WG9 A;  3ZP5 A;  1R1V A;  2Z33 A;  2VC1 A;  1OYW A;  2CFX A;  1G4D A;  2FMY A;  2IP2 A;  2EA2 A;  4IHS A;  1J2X A;  1F5T A;  3GEZ A;  4HF0 A;  4ZZD A;  1VTN C;  2FXA A;  4EJO A;  5BQT A;  3FMS A;  4AIK A;  2Y0M A;  3DPT A;  3F8F A;  3HSE A;  2QQB A;  5DUI A;  3TOA A;  1SD7 A;  2ZNY A;  5FLX Z;  3WTX C;  4CYD A;  2VT3 A;  4XSZ F;  1UFM A;  4A0X A;  1EH6 A;  3O3K A;  2G7U A;  5JI6 A;  2YU3 A;  5LHG A;  2VE9 A;  3M9A A;  2PN6 A;  1IN5 A;  4NHJ A;  5DCF A;  1T98 A;  2XV4 S;  3QPT A;  3T1B A;  3B73 A;  4O5V A;  4DQ2 A;  2G7H A;  1Z6T A;  5J6X A;  3I59 A;  1QBJ A;  1F4K A;  4EVI A;  1DP7 P;  1ZGJ A;  4IVN A;  3J7A O;  3J80 Z;  3C1D A;  4EGZ A;  3F6V A;  1XGS A;  1S8N A;  3ISP A;  5CLS A;  1Q1H A;  4G94 A;  3ROU A;  4M6X A;  4HV5 A;  1T39 A;  4I0B A;  2UWM A;  2PG4 A;  3E6M A;  2UXX A;  2XAQ A;  1FY7 A;  4G9Y A;  1HW2 A;  4CIC A;  2VXZ A;  4ESJ A;  2JSC A;  3ZMT A;  4LMY A;  2PI0 A;  2EV5 A;  1YO5 C;  5ERI A;  1YW8 A;  2JPC A;  2OA4 A;  4MQV A;  2V1X A;  3ZQ7 A;  1USS A;  4WXH A;  3M8E A;  4M9X A;  3GF2 A;  4BXU A;  1ZRD A;  5DCM B;  3G73 A;  4HF2 A;  3BWG A;  2HTJ A;  3K69 A;  4FT8 A;  4U0Y A;  2YPR A;  1UST A;  2K7L A;  2WV0 A;  3IRR A;  2OD5 A;  4G6Q A;  2K27 A;  1PUE E;  2VOO A;  1U5T A;  2A6E F;  2EFQ A;  4UHT A;  1R58 A;  1KA8 A;  4M73 A;  1FWZ A;  2H09 A;  3GO5 A;  3SFZ A;  1TTY A;  2IVM A;  4OIP F;  1XB4 A;  3J80 K;  1R1T A;  4I09 A;  4LLN A;  4HA8 A;  1T2K A;  1B6A A;  2HQR A;  2EFN A;  4RGU A;  4A0Y A;  2ISY A;  3ZN1 A;  3E6D A;  4M9Z A;  3RKY A;  2XAG A;  1IAW A;  4XBF A;  3ECH A;  3GFI A;  4JQF A;  3SXY A;  3TGN A;  3KE2 A;  1ZG3 A;  4PGG A;  3VFZ A;  2XIG A;  4CHU A;  3RPU A;  4AVP A;  2QBY A;  3JAM Z;  1FZP B;  1FNN A;  5E17 F;  4WXD A;  2X4H A;  1XSD A;  1RUO A;  2L3D A;  1K79 A;  4XSX F;  2M45 A;  5FGM A;  1I1G A;  3MAJ A;  3R0J A;  5JVT A;  2W85 A;  3ML6 A;  2C6Y A;  1R5H A;  4PZJ A;  2V79 A;  3WTU C;  2HEO A;  2A69 F;  1DPU A;  4L18 B;  3BJA A;  2DW4 A;  4ZYE A;  1ZRE A;  2F2E A;  2LF8 A;  5K5O A;  3QPH A;  3K0L A;  3HSR A;  3I5U A;  2L02 A;  1IN8 A;  4E70 A;  4U7B A;  1FPQ A;  2DTR A;  5HS9 A;  1S7O A;  1ZGA A;  2P4W A;  4EM2 A;  4R79 A;  4HX8 A;  2LSO A;  5CVR A;  2OAZ A;  4MTD A;  3VOD A;  4XLN F;  4QWQ A;  1K6O A;  3LA2 A;  2VT2 A;  2O8X A;  1ZG5 A;  5D5V B;  3N4M A;  1Z91 A;  5LGU A;  3MZH A;  3KP2 A;  3QOP A;  2IA2 A;  5HOO A;  4ENN A;  1O7F A;  2HR3 A;  5JFR A;  2XAJ A;  3CUQ C;  1KQ0 A;  3Q9S A;  3D0S A;  5ICG A;  3EDP A;  1S7A A;  2QUF A;  4KMF A;  3V8L A;  1IN4 A;  4LK1 F;  2FA5 A;  1FLI A;  1YW9 A;  3M7G A;  2OZU A;  3WTY C;  1J0R A;  4EJV A;  3QP5 A;  1B9N A;  1HKQ A;  3P9C A;  5IT9 K;  1E17 A;  4ASN A;  1DPR A;  2OQG A;  2ZCW A;  2NAZ A;  2CQK A;  2CG4 A;  2QQ9 A;  1TW3 A;  3W6K B;  5DEQ A;  2MD5 A;  4BQA A;  3IKT A;  4KIC A;  4BAY A;  5L3G A;  3LA7 A;  3KP7 A;  2KJB A;  1ZHF A;  2STW A;  4GYI A;  1YW7 A;  3P9K A;  1BIA A;  1YYV A;  2HQN A;  2QEN A;  3IL2 A;  1WSU A;  1FOK A;  1REP C;  4M72 A;  3MQ0 A;  2KJC A;  4LK0 F;  1R22 A;  2KIM A;  1LJ9 A;  1QGP A;  2A3S A;  3KEQ A;  1YS7 A;  4EJW A;  4Y15 A;  2IRF G;  4KYW A;  3V8K A;  2DU9 A;  5IT3 A;  4RB3 C;  4ESB A;  3KET A;  1D8J A;  3RJP A;  2ZME A;  1G3T A;  4IPA A;  1F9N A;  1Z9C A;  4ESF A;  4HW0 A;  5J8F A;  4LFU A;  4OMZ A;  1H9G A;  3JW4 A;  1TBX A;  3CDH A;  5BPI A;  1IN7 A;  3SZT A;  4HQE A;  3GFJ A;  4QLC U;  5L3C A;  1V4R A;  3LA3 A;  2L54 A;  1WRJ A;  1RI7 A;  4CXF A;  2EFO A;  5K5R A;  2FNA A;  4ZYH A;  1XGM A;  2HKO A;  2F5D A;  2E7W A;  3CLO A;  3HIF A;  5FD5 A;  3FZV A;  3L7W A;  4UNO A;  3IKV A;  2GA1 A;  1D8K A;  4ETS A;  2F5F A;  4I02 A;  4D0P A;  4L5I A;  4P96 A;  2XRN A;  4RGR A;  1D3Y A;  3MCZ A;  3V7R A;  2D2W A;  3P7N A;  4OIO F;  4KN7 X;  3S2W A;  4R1H A;  3GZ6 A;  2D45 A;  1MDM B;  4Q4Z F;  4L9V A;  1LQ1 A;  3F8C A;  2R3S A;  2H27 A;  3V7C A;  1STZ A;  1J75 A;  3F21 A;  4KIF A;  3Q9V A;  5FFX A;  1SFX A;  3WTW C;  1I1S A;  1W4M A;  2KIF A;  4HYE A;  1CGP A;  3T5X A;  2DFI A;  1DDN A;  1TQI A;  1KYW A;  5TRD A;  3GUD A;  5AON A;  1GXP A;  3CUQ B;  3E5U A;  3R0A A;  1UHW A;  1IUY A;  1DUX C;  4HX4 A;  3W6J B;  4NQW A;  3MEX A;  5HLG A;  4PGH A;  1SD4 A;  3CO7 C;  3QU6 A;  1SD5 A;  3GFL A;  2R7D A;  4B8X A;  1YS6 A;  2QZ8 A;  2B0L A;  4GCV A;  4KNY A;  1O3T A;  2GIV A;  1GXQ A;  1P2F A;  2FEZ A;  5BS6 A;  2M5W A;  1J5Y A;  3I0T A;  4FX0 A;  1SAX A;  2OU2 A;  5DCM A;  2Q0O A;  2DT5 A;  4DNC A;  4Y13 A;  3FXU A;  4UXN A;  2H6B A;  5EEG A;  3TO6 A;  2HWV A;  3EYI A;  4L5J A;  4N9I A;  5ICE A;  2BGC A;  2M30 A;  1RNL A;  2P5K A;  5DD8 A;  3VOE A;  3BJO A;  2JZY A;  4EJU A;  1JHF A;  4RGX A;  3ZMV A;  5ILS A;  3WU0 A;  3FMQ A;  2MC3 A;  2P6T A;  1Z05 A;  1KU7 A;  4AIJ A;  1OMI A;  4KA4 A;  4L9J A;  2L01 A;  4MGR A;  3R4K A;  3C3W A;  4L9N A;  1KYZ A;  4BYY A;  1U5T C;  3MFK A;  5HVQ C;  3ZPL A;  1ONV A;  2A68 F;  2DI3 A;  4OIN F;  3BDD A;  2W84 A;  2VBY A;  5HDK A;  4HX7 A;  4BH9 A;  1XGO A;  2YX4 A;  5ILU A;  4RAZ A;  4LG0 B;  5H6Q A;  4F7Z A;  1JGS A;  3CJN A;  3LAJ A;  2FNP A;  5LRR A;  2QLZ A;  3ZMU A;  1I27 A;  3H3U A;  2K02 A;  5E1W A;  4UVB A;  2MBF A;  4FX4 A;  5LGT A;  1OPC A;  3LAP A;  3BPV A;  3WTS C;  4MEX F;  4KMU X;  3HRU A;  1QO0 D;  1U8R A;  2JT1 A;  2WTE A;  5ICC A;  3VEP A;  5LRS A;  1TW2 A;  4EM1 A;  4ZYD A;  4HOB A;  1R5G A;  2L4A A;  5AIP A;  3TO9 A;  1ZRC A;  4WK8 F;  2STT A;  2ZJ2 A;  5D5X B;  2CWE A;  3EUH A;  1RUN A;  2MA3 A;  2W25 A;  2IJL A;  4KIB A;  1XMA A;  4AD9 A;  5LGN A;  2KRF A;  1SD6 A;  3E3V A;  2WWY A;  1FBS A;  4FHT A;  3E5Q A;  2D1H A;  2GXG A;  4H0E A;  4O6J A;  1AWC A;  3H92 A;  1U78 A;  2PQ8 A;  4WX9 A;  1IRG A;  2PBI A;  1XD7 A;  4P5O A;  5D8L B;  2A61 A;  2NNN A;  4PDK A;  2UXN A;  2MLG A;  3GVA A;  4HV6 A;  3T8T A;  1IF1 A;  3DF8 A;  4NB5 A;  3F22 A;  3WGH A;  1CF7 B;  1QPM A;  1JXS A;  1QZY A;  4YG2 F;  2K4J A;  2M8E A;  2GA2 A;  1XCB A;  2E1N A;  1K78 B;  1TQP A;  1IRF A;  1B1B A;  2IA1 A;  1EH7 A;  4A2U A;  3OOP A;  3FXR A;  3EYY A;  5CVJ A;  3K9T A;  1BN5 A;  1IW7 F;  5F6F A;  1BI2 A;  1A04 A;  1FC3 A;  3K1P A;  4BHP A;  1R23 A;  3QP6 A;  1ZAR A;  3HOS A;  1PP7 U;  5FB2 A;  1MJA A;  2A6H F;  1B4A A;  2CW0 F;  1HKS A;  4KUM A;  4Q47 A;  1WWX A;  4K2E A;  2VOP A;  2P5V A;  5HS8 A;  2GWR A;  3QAH A;  4LLG F;  5EEH A;  1XCV A;  5AIQ A;  3BPX A;  5LHI A;  2LDU A;  1IXR C;  3WE2 A;  5IT9 Z;  2J5P A;  1U3E M;  4EV0 A;  1P6R A;  2FBI A;  3GWZ A;  3BJ6 A;  4ON0 A;  2NNY A;  4A12 A;  1FSE A;  4UVA A;  4P55 A;  5E8G A;  1S3J A;  2ZBK A;  2XHK A;  1BIB A;  2P7V B;  1BC7 C;  1TNT A;  4LGW A;  2V6C A;  1FT9 A;  4UV9 A;  3TDU C;  2O6G E;  1U6G A;  1FBU A;  2EWN A;  1B59 A;  5D5U B;  2DLL A;  5L3E A;  2Z3Y A;  4RB2 C;  3I64 A;  4MEY F;  2LNB A;  2G9W A;  3TOB A;  3FWE A;  5CVV A;  1MGT A;  2V9V A;  3FM3 A;  2KKO A;  2UZK A;  3BP8 A;  3KP5 A;  4I0A A;  2Q2E A;  4LLL A;  4KT5 C;  3GX4 X;  1LB2 A;  2RQP A;  5E1X A;  1LDD A;  4WF2 A;  5D4S A;  4EQQ A;  1I5Z A;  2RGV A;  2EA4 A;  1G6N A;  2HOE A;  2JPB A;  2D1V A;  3HSF A;  2HYG D;  2NRA C;  2IW5 A;  4RGS A;  3FX3 A;  1YIO A;  4M71 A;  4M6Y A;  3I53 A;  2YSR A;  5BMZ A;  3I58 A;  1LEB A;  1FYM A;  2DK5 A;  1R1U A;  2ADU A;  4ZZL A;  1XSX A;  2HKX A;  2JRT A;  2DBB A;  3E5X A;  3RYR A;  5BPD A;  3IRQ A;  1MD0 A;  1Z1D A;  2TDX A;  3L9F A;  1K7A A;  2BEO A;  3EQL F;  3KCC A;  4R8H A;  4UUV A;  1YFH A;  5ICF A;  5K1Y A;  2ZXJ A;  1E2X A;  2RN7 A;  3IWZ A;  1F1Z A;  3RTR A;  5LEJ A;  2ESH A;  3U1D A;  5LLQ A;  5E20 A;  1OR7 A;  2ACJ A;  1W7P B;  3REO A;  5H20 A;  1FSH A;  2DQR A;  4U7D A;  5DDG A;  1LEA A;  2X0L A;  2K4B A;  5D4R A;  2P7C B;  3D5L A;  3GZ5 A;  2XAF A;  2XUB A;  4HZF A;  2ETH A;  1JE8 A;  3PQJ A;  2OBP A;  3ABU A;  4I7H A;  4YFK F;  2MH9 A;  5LHH A;  3C18 A;  3BZ6 A;  5DD4 A;  5JHU A;  4G7O F;  1MJB A;  3RPQ A;  3K2Z A;  3L00 A;  2W57 A;  3ZMZ A;  1HW1 A;  3CO6 C;  1G3W A;  4G7Z F;  3NRV A;  3RKX A;  4MNU A;  4KN4 X;  3GLX A;  1BI1 A;  2VN2 A;  3KLN A;  1RZ4 A;  1SMY F;  1P4X A;  3FMR A;  3KEO A;  5CVU A;  1PP8 F;  4HAM A;  3C7J A;  4RS8 A;  2Y48 A;  3J81 K;  2XVC A;  4HF1 A;  2YX7 A;  3M1E A;  3TO7 A;  1H9T A;  2EK5 A;  2O3F A;  2EV0 A;  1HBX G;  1NHA A;  2DPU A;  2JTV A;  2BBY A;  5CYV A;  2ZNZ A;  3LFK A;  4I2O A;  1O7L A;  3B02 A;  1YQA A;  1W5T A;  3HTU A;  3WTT C;  2CGP A;  4Q48 A;  2OZ6 A;  1UB9 A;  4PCQ A;  2H6C A;  1FYK A;  2HYF A;  1IN6 A;  2LF7 A;  4B09 A;  4ENJ A;  3MWM A;  3GYH X;  4LG0 A;  4LD5 A;  1LVA A;  1XSV A;  4KFC A;  2YR2 A;  4HBL A;  5J8C A;  3G3Z A;  1YTY A;  1QQI A;  2FRH A;  3RI4 A;  1R36 A;  3ERE D;  3HUG A;  5HDN A;  2FOK A;  3F72 A;  2XKO A;  4OIR F;  4BNC A;  4Q5S F;  1ZLJ A;  3DQV C;  1SFU A;  1T0F A;  3IHU A;  2FF4 A;  4OIQ F;  2XRO A;  4EJT A;  4LB6 B;  3E97 A;  5BOX A;  4YII A;  4WWC A;  4CGZ A;  4RB0 A;  1G3Y A;  2PJP A;  3F6O A;  3F8N A;  1U2W A;  1O3R A;  3GXO A;  4A6E A;  3IC7 A;  4XLP F;  1TQM A;  1WQ2 A;  2L4M A;  5L3B A;  1J59 A;  2P5L C;  4OMY A;  4YFX F;  3KZZ A;  1KQ9 A;  5KK1 A;  2HZT A;  2FML A;  2V1U A;  5L3D A;  6PAX A;  1HW5 A;  2COM A;  2M1B A;  1KU9 A;  2VE8 A;  2QVO A;  4KDP A;  5E8I A;  3TQN A;  3F8M A;  5A2Q K;  4I98 B;  2MLK A;  3HHH A;  2RNJ A;  5L3F A;  1S29 A;  1KU3 A;  1P4A A;  4GXO A;  4CO8 A;  1CF7 A;  4Y17 A;  4TV7 A;  3SHF A;  1K78 A;  1XDU A;  4AWX B;  2Z99 A;  2ESN A;  3HRT A;  3HYI A;  2F5C A;  3M8F A;  5CJ9 A;  4S05 A;  3WGI A;  1H0M A;  2QYO A;  3RKW A;  2DQL A;  3F23 A;  3OV8 A;  2CSO A;  4N9H A;  3V8J A;  1GHC A;  1ZRF A;  5CVI A;  1BC8 C;  1TNS A;  1X3U A;  4YFN F;  2O0Y A;  2QQA A;  2H94 A;  4MHG A;  4HDU A;  1T6S A;  2ZO4 A;  3O6B B;  3HOT A;  2MH2 A;  3COA C;  4L0Y B;  5FLX K;  2HFH A;  1V3F A;  5HDG A;  5F1R A;  2PMU A;  3RDI A;  2FBK A;  4Z2Y A;  4HQM A;  2VBZ A;  1FP2 A;  2K86 A;  3ULQ B;  3DEU A;  2GQQ A;  5E18 F;  2KIU A;  5DYM A;  1O3Q A;  3R60 A;  4HLY A;  1FBQ A;  1XN7 A;  1MKM A;  3R6S A;  3Q5F A;  2A5Y B;  2DO7 A;  1Z6R A;  3JSP A;  5HS7 A;  3KP6 A;  1J9I A;  4P9U A;  4OU0 A;  1LDK B;  3NQO A;  3DPL C;  5ILV A;  3GFM A;  1BI0 A;  4KIG A;  1ULY A;  1SMT A;  4GGG A;  2V1D A;  3PFI A;  2NS0 A;  3LWF A;  2M87 A;  5D8K B;  1P92 A;  3WOD F;  4EGY A;  2NYX A;  3I59 B;  2BV6 A;  3O2P E;  1B9M A;  1HKT A;  1ZAO A;  1JHH A;  4GO1 A;  3U2R A;  1Z7U A;  2HDC A;  4ENK A;  4AIH A;  3CUO A;  3P9I A;  1BM9 A;  3KFW X;  5FFZ A;  2RDP A;  2ZFW A;  4RAY A;  3TDZ C;  5FD6 A;  3IWF A;  1BBY A;  1ON1 A;  2IT0 A;  3SQN A;  3JSO A;  2CO5 A;  2AS5 F;  3V7S A;  2VOD A;  4IHT A;  3RIR A;  3WTZ A;  4ZYG A;  2AXL A;  1IXS B;  3LQR A;  4UVC A;  1EH8 A;  1RIO H;  4JK1 X;  2R7F A;  1KGS A;  4XRF A;  2Y75 A;  2RV8 A;  2IPQ X;  2P6S A;  2RVC A;  4WXC A;  4JBA A;  3TKY A;  1EV7 A;  1QZZ A;  5TJJ A;  2Q8K A;  1G3S A;  4O3M A;  5FO5 A;  1KU2 A;  2RKH A;  3ZMD A;  4BHC A;  1UCR A;  2P8T A;  3DP7 A;  1W7P A;  2DPD A;  3F8B A;  4WCG A;  1LNW A;  1U5T B;  2J5O A;  4A0Z A;  2ZKZ A;  4GYG A;  3EET A;  3QRF F;  1IXC A;  4CDG A;  2OQR A;  1FP1 D;  3KP3 A;  1R7J A;  2XAS A;  1BJA A;  2EFP A;  2BYV E;  3LST A;  4U88 A;  1O57 A;  1J7K A;  5HLH A;  5LBQ A;  5JR3 A;  3F3X A; 
#chains in the Genus database with same CATH topology
 2IGO A;  3HRS A;  4D7N A;  3DV8 A;  5LEK A;  3CCU I;  5DUK A;  4LG3 A;  3SZP A;  1HXD A;  1ZH5 A;  1GVJ A;  2O03 A;  3PL8 A;  2GZW A;  3KLO A;  4JX4 A;  3PQK A;  4M74 A;  2BE5 F;  3BOQ A;  3DKW A;  3VB2 A;  3FXK A;  4L0Z B;  4PFP A;  2F5E A;  4A6D A;  3U9G A;  4MLO A;  4G6D A;  2VC0 A;  4AC0 A;  2ZME C;  3PIP F;  1WJC A;  1Z7L A;  2DJN A;  3JAM K;  2FJ1 A;  3A0B C;  4UUS B;  2H8W A;  3I71 A;  4ZH4 F;  3EUA A;  1QU3 A;  1FOY A;  5FRN A;  2HS5 A;  1TLH B;  1ZYR F;  3J7Z I;  4IXA A;  3DXJ F;  2XAH A;  3WE3 A;  1L3L A;  2FUG 2;  2VJI A;  1LUJ B;  3MZ8 A;  4B3X A;  1ZG1 A;  4IRH A;  2XRL A;  1MZB A;  2VI6 A;  4CZZ A;  3N97 A;  3AG2 H;  4JX5 A;  2QBY B;  3NEU A;  1GDT A;  1FIA A;  2XGX A;  4LB5 A;  1ETK A;  2DA6 A;  4N0B A;  4BS9 A;  2XGD A;  4I01 A;  4YIF A;  1D5V A;  3LFU A;  3WGG A;  1R00 A;  1OKR A;  1XMK A;  4HPQ A;  2ISZ A;  3MMY B;  1XDS A;  4F93 B;  3C2G A;  3MD2 A;  4QPO A;  2VPL A;  1BOA A;  4U0V A;  2JRM A;  1MDM A;  3KP4 A;  1NK3 P;  2KHM A;  2TCT A;  5F04 A;  1V5E A;  3CJR B;  3JRA A;  2FU4 A;  5EYR A;  3CCM I;  2EV6 A;  2DK8 A;  3CC2 I;  2WY8 Q;  3LOC A;  3QOD A;  2CV2 A;  1ETQ A;  5E3O A;  3VPR A;  1U0J A;  2PEX A;  3A0H C;  3HRM A;  2EFW A;  1W5S A;  2HTS A;  1MJ9 A;  3HKZ A;  4MTE A;  3HHG A;  4AYB A;  2Z5U A;  1WHU A;  3J81 Z;  4EM0 B;  2GXB A;  2F5V A;  4BXX J;  1GLN A;  5F64 A;  2IA0 A;  3DFG A;  4D9J A;  1UHM A;  2VAS A;  3PM1 A;  1Z77 A;  3QOE A;  1ON2 A;  3I4P A;  1WI9 A;  3GBG A;  1E3H A;  4M9S A;  5D6E A;  4C3J J;  5K5Q A;  3ASO H;  5ED4 A;  1UG0 A;  1AKH A;  2ELH A;  2NS7 A;  2RC4 A;  1S6L A;  2FSW A;  3CUQ A;  4BHB A;  1HSJ A;  2GAU A;  1O3S A;  5KAI C;  2PLY A;  5D6F A;  1AA7 A;  1SVO A;  2LBF A;  1L0O C;  4A5M A;  1PDN C;  4MO7 A;  2KPM A;  5DV5 A;  2R0Q C;  1AHD P;  1OYY A;  1SFE A;  5GAG J;  2VON A;  3S2D J;  2QQ8 A;  3DKX A;  3FHZ A;  2X51 A;  1T38 A;  1LE8 B;  4IJA A;  3ABT A;  4PSW A;  1Z0X A;  4HRI A;  2EJR A;  2LLK A;  3OYL A;  3GW2 A;  3T8R A;  3LQQ A;  1MMN A;  2W24 A;  1P9Q C;  3OSG A;  3FXQ A;  2XGE A;  2XKP A;  1R6R A;  2Z9O A;  4G7H F;  1MSF C;  3FXO A;  3FM5 A;  2A07 F;  3BLY A;  2LKP A;  3ZMS A;  2EH3 A;  3E7L A;  1JKR C;  4B48 A;  4RB1 A;  3I54 A;  1BI3 A;  4HDV A;  3FF5 A;  3GTG J;  5D5W B;  3R61 A;  1KQ8 A;  2VBW A;  3QU3 A;  4UV8 A;  3SEQ A;  3RYP A;  9ANT A;  1IJW C;  1RKT A;  3K1N A;  3WTV C;  3KZY A;  4ENM A;  1WKM A;  1LDJ A;  4OOI A;  5KVR A;  2F4I A;  4A5N A;  2BVL A;  4CCL A;  4HNU A;  1XC5 A;  2HU9 A;  3ECO A;  3LMM A;  4AM3 A;  3A01 A;  3RQ4 A;  2FE3 A;  2LKS A;  4IF4 A;  3T0Y A;  3HTS B;  2PJR A;  1IDZ A;  3E6C C;  5FLV A;  5EGO A;  2E7X A;  2PFB A;  1MH4 A;  1D1A A;  2M0M A;  2VL8 A;  3FXM A;  4LJZ F;  3ZRG A;  2E1M C;  3FXL A;  4LIV A;  5H6R A;  1AOY A;  4MQ9 F;  4IRG A;  1Y0U A;  3JTH A;  3QPS A;  5CQG A;  2FQ3 A;  3H0D A;  2HVR A;  5IYC J;  1MBG A;  4P9F A;  1X4O A;  1ZN2 A;  3WU1 B;  2QWW A;  3OL3 A;  1K6Y A;  3H1C A;  2AO9 A;  3F9K A;  1T0F C;  3AAF A;  2CS3 A;  3LSG A;  2E71 A;  1Y56 A;  5EDN A;  3PO2 J;  3IH4 A;  5EZG A;  4LIU A;  4HLX A;  1XG1 A;  3HZJ A;  3JTG A;  1P4W A;  3H9J A;  5E1Z B;  1I6X A;  4NC8 A;  1R49 A;  3K1M A;  3L09 A;  2FBH A;  3GZN B;  2IXS A;  1C0W A;  3CP8 A;  4XLA A;  4CCJ A;  1QNT A;  2VBX A;  2XDV A;  5HLI A;  4BQN A;  4BDZ A;  1B72 A;  2KP6 A;  3MZY A;  2QM3 A;  4S04 A;  3CTA A;  1UG2 A;  2W48 A;  1HST A;  4II3 A;  3P5J A;  1W7P D;  3H3Z A;  1N78 A;  1VQ9 I;  2EB7 A;  2EQR A;  5IP9 J;  4U87 A;  2CQX A;  1X2N A;  1VQN I;  4Y7N J;  2RNG A;  1FTZ A;  3G6E I;  3LL7 A;  3KYD B;  1Z3X A;  4XRS A;  4FTH A;  2DAO A;  3BTJ A;  1POG A;  1ODD A;  1YG2 A;  2EIJ H;  1ETW A;  5A2Q Z;  2A6T A;  4XOP A;  4G8X A;  5LFA A;  1HA8 A;  3KPH A;  2ZXI A;  4HEA 2;  4PJL A;  2K3P A;  3V42 A;  2M8G X;  5JLW A;  2BXZ A;  3BY6 A;  1HQC A;  2ZME B;  4EMS A;  3CME I;  1TWC J;  1GT0 C;  1IZ1 A;  2XGC A;  3ELK A;  2JMW A;  3HKZ N;  3OYD A;  2CYY A;  2PMH A;  3L2C A;  2YU9 J;  4IHV A;  1OYI A;  2M7A A;  4AYB N;  4E7L A;  4IRI A;  4IQJ A;  1T33 A;  1YLF A;  3BRO A;  3G1M A;  1E0E A;  3E6B A;  1T8I A;  4FQG A;  3DBL B;  4U0W A;  4E7J A;  2E1C A;  4EEF G;  3ZN0 A;  1ACI A;  1D0Z A;  4L9T A;  4FE4 A;  2K5C A;  2WC2 A;  5M5W J;  2HGC A;  4IO9 F;  1FX7 A;  1FYL A;  2O61 A;  1XGN A;  3IAS 2;  1ZLK A;  3V4G A;  2JA7 J;  3WG9 A;  3ZP5 A;  4DYQ A;  1R1V A;  2BY0 A;  3OIQ A;  1FTT A;  2HDW A;  2L9N A;  3H9Q A;  2X6Y A;  2Z33 A;  3G2B A;  5KNL A;  2EBI A;  2VC1 A;  1X1C A;  1OYW A;  2DOA A;  2KT0 A;  4ZDL A;  1I6H J;  2L7F P;  2CFX A;  1G4D A;  3BG6 A;  2FMY A;  3BR0 A;  4JOM A;  2IP2 A;  3KX2 A;  2EA2 A;  1LPQ A;  4IHS A;  1J2X A;  2IS1 A;  2JA5 J;  1F5T A;  4BY7 J;  2O9L A;  3GEZ A;  3DU5 A;  3H0G J;  4MFE A;  3DTK A;  4HF0 A;  4ZZD A;  2HI3 A;  1VTN C;  2FXA A;  4EJO A;  1QVU A;  2DFE A;  4E7S A;  5BQT A;  3FMS A;  1HDD C;  2JQ7 A;  4UY8 I;  3DPT A;  2Y0M A;  1IV8 A;  3H9G A;  2E35 A;  4AIK A;  3F8F A;  4NC6 A;  1LFP A;  2Z1D A;  3HSE A;  3VYR B;  2QQB A;  4A3B J;  5DUI A;  1Z67 A;  3TOA A;  1SD7 A;  2VKD A;  2ZNY A;  1VQ7 I;  5FLX Z;  3WTX C;  4CYD A;  1A31 A;  1YX5 A;  4DGW B;  4C2U A;  2VT3 A;  5J47 A;  4L5E A;  2JSP A;  4ABZ A;  4BBR J;  3C2H A;  3HM5 A;  4RDU A;  4XSZ F;  1UFM A;  4A0X A;  4AUX A;  1EH6 A;  3VSL A;  3O3K A;  2G7U A;  3BCB A;  4IL6 C;  5JI6 A;  2YU3 A;  5LHG A;  2VE9 A;  3M9A A;  3FXJ A;  2PN6 A;  1IN5 A;  3PNY A;  5K7H A;  2DCE A;  3LSK A;  5DCF A;  4NHJ A;  1T98 A;  2DMQ A;  2XV4 S;  3EUH C;  3QPT A;  5J1U A;  2L9V A;  3T1B A;  1Y39 A;  3K4C A;  5EF6 A;  3B73 A;  3BR3 A;  4O5V A;  3OYF A;  4DQ2 A;  2G7H A;  1Z6T A;  5J6X A;  4B4C A;  2EIK H;  4RM2 A;  2R4G A;  1WCM J;  1VQL I;  3C2B A;  4XKB A;  2HOA A;  4E4H A;  3I59 A;  2EIM H;  2Y2Z A;  3UKG A;  1ZR4 A;  2QKM B;  1QBJ A;  2VKV A;  1F4K A;  1JJ6 C;  2R7Q A;  4EVI A;  4DOZ A;  1NH3 A;  2HXI A;  2DTZ A;  4Z6Y A;  1DP7 P;  1OCR H;  1ZGJ A;  3G1O A;  5EJC A;  4IVN A;  3J7A O;  3J80 Z;  3SEZ A;  3C1D A;  3BT9 A;  3BZK A;  4EGZ A;  3F6V A;  1XGS A;  3S15 J;  2EPF A;  2Q1Z B;  1S8N A;  2AQF A;  3OS0 A;  2OTJ I;  3ISP A;  5CLS A;  1FEX A;  1Q1H A;  4G94 A;  3ROU A;  4BJT A;  1X3W B;  3CC4 I;  4NQW B;  2ZB9 A;  4M6X A;  2VQL A;  4YIR X;  2ZSH B;  1OFC X;  3OS2 A;  4HV5 A;  1T39 A;  1TZL A;  4I0B A;  2UWM A;  2PG4 A;  3E6M A;  4V19 K;  2UXX A;  3CJT B;  4PJN A;  2W4S A;  3DLA A;  2XAQ A;  1FY7 A;  4G9Y A;  1BW5 A;  2E1M B;  1HW2 A;  4HNT A;  4CIC A;  2VXZ A;  4ESJ A;  2JSC A;  3ZMT A;  4LMY A;  2PI0 A;  2EV5 A;  3S3N A;  1YO5 C;  5ERI A;  1YW8 A;  2Y9Y A;  2JPC A;  2OA4 A;  4MQV A;  3IAM 2;  2V1X A;  3ZQ7 A;  3DU6 A;  1USS A;  4WXH A;  2K3F A;  1SAN A;  5GTH C;  4XOT A;  4E7Z A;  3M8E A;  1ETX A;  1D5Y A;  4M9X A;  3GF2 A;  4BXU A;  2DDA A;  2M7B A;  1DGW Y;  3H5N A;  1ZRD A;  5DCM B;  3G73 A;  4HF2 A;  3HGG A;  3BWG A;  2HTJ A;  4XN3 A;  3SYT A;  1MBF A;  3K69 A;  4FT8 A;  3W2W A;  1BR4 A;  2YPR A;  5EG0 B;  4U0Y A;  3HGY A;  1UST A;  2K7L A;  3HBL A;  4RM3 A;  2WV0 A;  3IRR A;  2ZJP F;  2XSJ C;  3RZO J;  4GDF A;  2OD5 A;  1RR7 A;  4G6Q A;  4CCN A;  2K27 A;  2DXI A;  1MNE A;  1B8I B;  3BG7 A;  1PUE E;  1TWH J;  4RLF A;  2VOO A;  2NOJ B;  4E7H A;  4IKF A;  1U5T A;  2A6E F;  1MMD A;  2EFQ A;  2K9L A;  3HOX J;  3H35 A;  4B43 A;  5M5X J;  4UHT A;  1R58 A;  1KA8 A;  1TT5 B;  2CUF A;  2I10 A;  4QTR A;  1IC8 A;  4M73 A;  1FWZ A;  2H09 A;  3GO5 A;  3SFZ A;  2QA4 I;  1TTY A;  2IVM A;  4OIP F;  1W0U A;  1XB4 A;  3J80 K;  1R1T A;  4XKV A;  4I09 A;  1Y0N A;  4IEJ A;  5GP9 A;  3CMY A;  2R5Y A;  4LLN A;  4HA8 A;  1T2K A;  3HC7 A;  3ZQF A;  1B6A A;  3ZQL A;  2MW8 A;  2HQR A;  2EFN A;  4RGU A;  4A0Y A;  2CQ7 A;  1DU6 A;  2ISY A;  3OL4 A;  3ZN1 A;  1FMV A;  3E6D A;  4JX6 A;  4RLQ A;  2KDO A;  4M9Z A;  3RKY A;  3QQA A;  2XAG A;  1IAW A;  4XBF A;  4UUS A;  3ECH A;  3S8P A;  2QSF X;  3GFI A;  2L7K A;  4JQF A;  3SXY A;  3TGN A;  1ZGW A;  2F4M B;  3KE2 A;  1ZG3 A;  3CF2 A;  1JKQ C;  4PGG A;  4XRM A;  5BNG A;  3VFZ A;  4NDL A;  1VF9 A;  2VKH A;  2XIG A;  1MH3 A;  2NS8 A;  4CHU A;  3RPU A;  3QWL A;  4AVP A;  2QBY A;  3JAM Z;  1FZP B;  1FNN A;  1GV5 A;  3SFI A;  5E17 F;  1RET A;  4WXD A;  2X4H A;  1MBE A;  1XSD A;  1RUO A;  2L3D A;  1K79 A;  2L9R A;  1OCO H;  4XSX F;  2M45 A;  1LFU P;  5FGM A;  1I1G A;  1YX3 A;  3MAJ A;  3R0J A;  4MIM A;  5JVT A;  2W85 A;  2R7X A;  2K9N A;  3ML6 A;  1RC9 A;  2OF7 A;  2C6Y A;  2O7O A;  2JWT A;  1E3O C;  1R5H A;  4PZJ A;  4BEH B;  2V79 A;  3WTU C;  3OYC A;  2HEO A;  1BR1 A;  2A69 F;  1DPU A;  4L18 B;  2KIS A;  3BJA A;  2DW4 A;  4ZYE A;  1ZRE A;  2X1D A;  2F2E A;  2LF8 A;  4NBQ A;  2DMT A;  5GPC A;  5K5O A;  4IZZ A;  2EZL A;  3QPH A;  3K0L A;  3HSR A;  3I5U A;  2HQ5 A;  4BQO A;  2L02 A;  1IN8 A;  4E70 A;  4U7B A;  1FPQ A;  2DTR A;  4OAY A;  5GAD J;  5HS9 A;  1S7O A;  1ZGA A;  2P4W A;  2NVT J;  2FD5 A;  4I99 C;  3Q0U A;  4EM2 A;  3WU2 C;  4R79 A;  2KRH A;  5IYB J;  4HX8 A;  2LSO A;  1W36 C;  3PNV A;  4NUB A;  5CVR A;  3HG9 A;  2LMD A;  2OAZ A;  2XPU A;  4MTD A;  3VOD A;  4XLN F;  2M34 A;  4QWQ A;  2L2O A;  1K61 A;  3FBN B;  3FHN A;  1W0T A;  2OCC H;  3RCO A;  2GM4 A;  1K6O A;  2CUJ A;  3LA2 A;  1LKX A;  4A3M J;  2VT2 A;  4F55 A;  3HPH A;  1T95 A;  2O8X A;  1ZG5 A;  1OR7 C;  1IG7 A;  5D5V B;  1LE8 A;  4Y4R A;  4YEJ A;  2ZJQ F;  3N4M A;  1Z91 A;  5LGU A;  5FRM A;  3MZH A;  2LYC A;  3S1N J;  2XSD C;  4XLH A;  3OYB A;  3KP2 A;  3QOP A;  2IA2 A;  3AL0 C;  2UV1 A;  1ZK8 A;  5HOO A;  4AID A;  1VND A;  1PUF B;  1X19 A;  3LSJ A;  3K4K A;  1VQ4 I;  4XKC A;  3S93 A;  4ENN A;  1O7F A;  2HR3 A;  5JFR A;  2XAJ A;  4CZC A;  3CUQ C;  1KQ0 A;  3IUO A;  3Q9S A;  2ID3 A;  2X6X A;  3Q3S A;  3D0S A;  4NC7 A;  3W3C A;  1SAU A;  2N8G A;  5ICG A;  2MD0 A;  2DA2 A;  2XF6 A;  3EDP A;  3FDY A;  1S7A A;  2QUF A;  4BQQ A;  1WH7 A;  4KMF A;  3V8L A;  1IN4 A;  3CCL I;  5TGT A;  1Y6I A;  3CP2 A;  4LK1 F;  5IY5 H;  1ITY A;  3OR2 C;  3PFY A;  3U1K A;  2FA5 A;  1FLI A;  2XB5 A;  2BY3 A;  4BGD A;  1YW9 A;  3HOY J;  4A3C J;  3M7G A;  2OZU A;  3WTY C;  1MIJ A;  1J0R A;  3AG4 H;  4EJV A;  4CSW A;  4IX7 A;  2ID6 A;  3QP5 A;  4ZC3 A;  4A3E J;  3H3V K;  1B9N A;  2FQ4 A;  2Y9Z A;  3GTO J;  1HKQ A;  5FKN A;  3ESW B;  3P9C A;  1R9T J;  5IT9 K;  3FIW A;  5J4Y A;  4XL9 A;  1E17 A;  4ASN A;  5FJ8 J;  1V5G A;  1SFK A;  3JRB A;  1DPR A;  2OQG A;  2ZCW A;  2NAZ A;  3I3L A;  2CQK A;  2CG4 A;  2QQ9 A;  1TW3 A;  1ZR2 A;  3W6K B;  5DEQ A;  2MD5 A;  4BQA A;  3BR1 A;  3IKT A;  4KIC A;  2JA6 J;  2V4J C;  4BAY A;  5L3G A;  5HNF A;  3LA7 A;  3KP7 A;  2NVQ J;  2KJB A;  1ZHF A;  2STW A;  4GYI A;  4AU7 A;  3HOZ J;  1YW7 A;  2ECB A;  3P9K A;  3IH2 A;  1BIA A;  1YYV A;  2HQN A;  1W1W E;  2QEN A;  3H5A A;  3IL2 A;  1WSU A;  3I4M J;  1IDY A;  1YRN B;  3LSM A;  3CDL A;  2VJJ A;  3TMO A;  3BQZ A;  2E19 A;  1FOK A;  2LRD A;  1REP C;  4X6A J;  3DCF A;  4M72 A;  3MQ0 A;  2KJC A;  3S1R J;  2VXD A;  4LK0 F;  1R22 A;  2KIM A;  1LJ9 A;  1QGP A;  2A3S A;  3LSI A;  2LRE A;  1WJE A;  1XS9 A;  2X48 A;  4CCO A;  3KEQ A;  1YS7 A;  4EJW A;  2VKE A;  4Y15 A;  2IRF G;  3B6C A;  2E2J J;  4KYW A;  2E36 A;  1VQM I;  3V8K A;  5C44 J;  2DU9 A;  2WAE A;  5IT3 A;  4RB3 C;  4ESB A;  3KET A;  1A35 A;  1D8J A;  2DA4 A;  3FKJ A;  3RJP A;  2ZME A;  1VFC A;  4GRI A;  1UJ8 A;  1VQ6 I;  1G3T A;  2XPV A;  2JK3 A;  2WAD A;  4IPA A;  1F9N A;  4W1U A;  4A93 J;  3BTI A;  1Z9C A;  4ESF A;  4HW0 A;  5J8F A;  4LFU A;  4OMZ A;  5C3E J;  2OTL I;  1H9G A;  4DZP A;  3JW4 A;  1TBX A;  3CDH A;  3OYK A;  5BPI A;  1IN7 A;  2KLO A;  3SZT A;  4A3G J;  3CJQ B;  2Q2E B;  4HQE A;  3GFJ A;  4ZTF A;  4QLC U;  1IRZ A;  1ENH A;  5L3C A;  1V4R A;  3LA3 A;  2L54 A;  1WRJ A;  3LSP A;  2UUZ A;  3JRH A;  3ZCO A;  2VQH A;  4CCM A;  1VQK I;  1RI7 A;  4CXF A;  2EFO A;  5K5R A;  2FNA A;  3HPG A;  4ZYH A;  1XGM A;  2HKO A;  2F5D A;  2E7W A;  3CLO A;  3HIF A;  5FD5 A;  3RPU D;  3JR9 A;  3FZV A;  5J1R A;  3L7W A;  4BXF A;  4UNO A;  2COB A;  3IKV A;  2R7T A;  2DA5 A;  2GA1 A;  1D8K A;  2DA1 A;  3A02 A;  4ETS A;  1MND A;  2F5F A;  2KFD A;  5JVG F;  2KMU A;  4I02 A;  4X0G A;  4D0P A;  4L5I A;  4P96 A;  1A5J A;  1JKO C;  1TWF J;  2XRN A;  3ASN H;  4RGR A;  3SZG A;  2W7N A;  3I55 I;  1D3Y A;  2ICW G;  1YOV B;  2BOL A;  3MCZ A;  1G2H A;  3V7R A;  1A36 A;  1F36 A;  2D2W A;  5GTI C;  3P7N A;  4A3K J;  4OIO F;  4XN0 A;  4KN7 X;  3S2W A;  4R1H A;  4XLE A;  1TP4 A;  3OYE A;  3GZ6 A;  2D45 A;  1MDM B;  2CUZ A;  4Q4Z F;  5DM7 F;  4L9V A;  1LQ1 A;  3F8C A;  2NXN B;  3ZQQ A;  1BJZ A;  4M3G A;  2R3S A;  2H27 A;  2QKL B;  3E0J B;  2LG4 A;  3V7C A;  2O5R A;  3VWB A;  2KRC A;  1STZ A;  1K83 J;  5E3L A;  1J75 A;  1X2M A;  3F21 A;  4BAC A;  4KIF A;  3Q9V A;  5FFX A;  1SFX A;  2DOF A;  3WTW C;  1I1S A;  1W4M A;  2KIF A;  2V7F A;  5IOY A;  4HYE A;  1CGP A;  3T5X A;  2DFI A;  2ELK A;  3NAR A;  1DDN A;  1TQI A;  3OYG A;  4MFD A;  2GXA A;  4XLF A;  1VQO I;  1KYW A;  5TRD A;  1GUU A;  3IH3 A;  3ONQ A;  3GUD A;  5AON A;  1GXP A;  1OCT C;  2IGN A;  5F0H A;  2CW8 A;  1SFO J;  2MGQ A;  3D5S C;  4PUS A;  3CUQ B;  3E5U A;  3R0A A;  1UHW A;  2GOX B;  1HCR A;  3CD6 I;  1IUY A;  5IP7 J;  1MBJ A;  1DUX C;  4HX4 A;  1RES A;  2LBF B;  3W6J B;  4M3B A;  3TL4 X;  3CZ6 A;  3ZOB A;  3ZXS A;  1YIT I;  4NQW A;  3MEX A;  2JVH A;  5HLG A;  3TED A;  4PGH A;  2E5N A;  1SD4 A;  3CO7 C;  2MAB A;  3HL2 A;  1D0X A;  3QU6 A;  3BG9 A;  4D1Q A;  1SD5 A;  3GFL A;  1OCC H;  1PJR A;  1WJF A;  2R7D A;  1FOW A;  5F08 A;  3N05 A;  1YS6 A;  2QZ8 A;  4B8X A;  2B0L A;  2KL4 A;  2JN6 A;  4GCV A;  2WV1 A;  2B63 J;  3K4L A;  3MN2 A;  1HC8 A;  4KNY A;  2AHQ A;  2KIQ A;  2RAE A;  2IAI A;  5F27 A;  3H5R A;  2G0E A;  1O3T A;  3CCY A;  2GIV A;  1GXQ A;  1P2F A;  2FEZ A;  3GME A;  3H36 A;  2KZV A;  5BS6 A;  2MG4 A;  2M5W A;  3WHB A;  4A3J J;  3ZQC A;  1J5Y A;  2EIL H;  2VPR A;  3I0T A;  3DEE A;  3VDX A;  4FX0 A;  2CV1 A;  1DU0 A;  1SAX A;  1TWG J;  1UZC A;  2OU2 A;  5DCM A;  2Q0O A;  2QGU A;  2DT5 A;  3BG3 A;  4DNC A;  4Y13 A;  1DQU A;  3OIO A;  1V54 H;  3FXU A;  4UXN A;  1S5L C;  5EG0 A;  2W1O A;  2WAQ N;  2CFO A;  5J1Y A;  4NNJ A;  2H6B A;  5EEG A;  1JKP C;  3TO6 A;  2HWV A;  3DPU A;  3EYI A;  4L5J A;  4BUP A;  4M3E A;  4N9I A;  2BGC A;  5ICE A;  3FKI J;  2R7R A;  1B8I A;  1IRX A;  2M30 A;  5B3S H;  1RNL A;  2P5K A;  2V26 A;  1MW7 A;  5DD8 A;  2WAF A;  2DT6 A;  2JJ7 A;  2V6E A;  3VOE A;  1WH5 A;  5EZH A;  3A03 A;  2E34 A;  2CMP A;  3FK6 A;  1JJ8 C;  3BJO A;  2JZY A;  4EJU A;  1JHF A;  5JLX A;  4RGX A;  3ZMV A;  5ILS A;  3WU0 A;  3FMQ A;  2IBD A;  4IOC F;  1BOB A;  2MC3 A;  2P6T A;  3KYL A;  1Z05 A;  1VQ5 I;  1R71 A;  1KU7 A;  1DP3 A;  4C2M J;  3JRE A;  4AIJ A;  1OMI A;  4KA4 A;  4L9J A;  3CDI A;  2X6W A;  2L01 A;  1B72 B;  2LY9 A;  2WA0 A;  1JGG A;  4MGR A;  3S32 A;  3R4K A;  3C3W A;  4LIT A;  4L9N A;  1KYZ A;  4BYY A;  4D5C A;  1U5T C;  3MFK A;  3DBH B;  5HVQ C;  3ZPL A;  1ONV A;  5B5E C;  4GFB A;  2A68 F;  2AQE A;  1R4M B;  2DI3 A;  3BDD A;  3KYC B;  4OIN F;  5TIS C;  1Y1W J;  2W84 A;  1RR8 C;  2L7M P;  2VBY A;  3O8H A;  5HDK A;  2LD5 A;  4HX7 A;  4BH9 A;  1XGO A;  2HDD A;  3HB9 A;  1EKE A;  2YX4 A;  1MBH A;  1OCP A;  5ILU A;  3TW6 A;  4RAZ A;  2DDB A;  2X85 A;  4LG0 B;  5H6Q A;  3L1P A;  4F7Z A;  1JGS A;  4M3D A;  2L5Q A;  2MSY A;  3CJN A;  3LAJ A;  3PJR A;  2FNP A;  5LRR A;  5M3M J;  2QLZ A;  2OPT A;  4KIT B;  3ZQG A;  2ME0 A;  3L2U A;  2H8R A;  3HUG B;  3DEW A;  3RSN A;  4M3F A;  3ZMU A;  1I27 A;  2YUS A;  3M8J A;  3OIP A;  2HXO A;  4CYC A;  1UMQ A;  3H3U A;  3HOU J;  4E7I A;  1MMG A;  2K02 A;  3PSF A;  5E1W A;  4UVB A;  1R5I D;  2BHZ A;  2MBF A;  4FX4 A;  3K4J A;  5LGT A;  1OPC A;  3LAP A;  2LH9 A;  1QRY A;  1YIJ I;  4A69 C;  3S16 J;  2BVM A;  1ETO A;  5B1A H;  3ZQI A;  1T08 B;  3BPV A;  3WTS C;  3FK7 A;  4DBQ A;  4MEX F;  4BEH A;  4KMU X;  3HRU A;  1QO0 D;  1Y1V J;  1U8R A;  2JT1 A;  3CES A;  1NG6 A;  1A6I A;  2DMN A;  3JRF A;  5F1J A;  2Z16 A;  2WTE A;  1VZ0 A;  2DFH A;  2DA3 A;  2EZI A;  5ICC A;  3VEP A;  3IP4 B;  3NWT A;  4RA2 A;  5LRS A;  2M4K A;  1TW2 A;  4DBR A;  4EM1 A;  4ZYD A;  1QPI A;  2HPI A;  4HOB A;  2ZJR F;  1R5G A;  2L4A A;  5AIP A;  2HQA A;  3TO9 A;  2Y0S A;  3K70 D;  1ZRC A;  4WK8 F;  2STT A;  2GIZ A;  2ZJ2 A;  3ERM A;  5D5X B;  5M3F J;  4PJM A;  2CWE A;  2XPW A;  1ZKG A;  2WB1 N;  3EUH A;  1RUN A;  3HXL A;  2MA3 A;  2W25 A;  4CCK A;  2IJL A;  4KIB A;  4FCY A;  1XMA A;  4AD9 A;  5LGN A;  2KRF A;  1SD6 A;  3E3V A;  4DW6 A;  1FBS A;  2DA7 A;  1VI0 A;  2WWY A;  3RKQ A;  2E60 A;  4FHT A;  2X1E A;  1UAA A;  3E5Q A;  2D1H A;  3O8G A;  3GTJ J;  2GXG A;  2ELJ A;  4Y3O A;  4H0E A;  4O6J A;  1AWC A;  3H92 A;  3JRG A;  3K6G A;  2PQ8 A;  1U78 A;  1U9N A;  4WX9 A;  1SC7 A;  5FRO A;  1IRG A;  2CH0 A;  2PBI A;  1I39 A;  4BBS J;  1XD7 A;  3BTL A;  4P5O A;  3W2A A;  5D8L B;  3A2K A;  2A61 A;  4N4O B;  2NNN A;  3K4M A;  4PDK A;  2UXN A;  2MLG A;  3GVA A;  3IV5 A;  4PFO A;  1YI2 I;  4HV6 A;  3MKL A;  3T8T A;  1IF1 A;  3DF8 A;  4NB5 A;  3F22 A;  4LOC A;  1SVM A;  1JUM A;  3GTM J;  3WGH A;  1CF7 B;  1QPM A;  1JXS A;  1QZY A;  4YG2 F;  1M1E B;  2K4J A;  2M8E A;  3I56 I;  2HOS A;  2GA2 A;  4XMY A;  3M07 A;  1XCB A;  2E1N A;  3TP3 A;  3BR5 A;  1K78 B;  1TQP A;  3BR6 A;  3S3M A;  1IRF A;  3GTP J;  1B1B A;  2IA1 A;  1V55 H;  2M2E A;  3A4C A;  1EH7 A;  4A2U A;  2L7Z A;  3OOP A;  1YJN I;  1K4T A;  1BL0 A;  3FXR A;  1UHS A;  3EYY A;  5GPA A;  3UR3 C;  5CVJ A;  4RAG A;  3K9T A;  1BN5 A;  1IW7 F;  5F6F A;  1BR2 A;  3LSH A;  1YJ9 I;  4P1W A;  2R7W A;  3D1N I;  2VJ5 A;  1BI2 A;  3L2R A;  1A04 A;  1FC3 A;  3K1P A;  2VQG A;  2Y69 H;  1R23 A;  3QP6 A;  1ZAR A;  4XR6 A;  4BHP A;  3HOS A;  1PP7 U;  3HOV J;  1FOX A;  1YE9 A;  2IGK A;  5FB2 A;  1MJA A;  5EEA A;  3MKW B;  3VYT B;  1IV6 A;  1DGR M;  2A6H F;  2LFB A;  3OYA A;  1B4A A;  2F4O B;  2PX9 A;  2WY7 Q;  2CW0 F;  1HKS A;  4KUM A;  4YRV A;  1JUS A;  4Q47 A;  1WWX A;  4K2E A;  1JI8 A;  3K10 A;  2VOP A;  3DBR B;  2P5V A;  3BZC A;  4FET A;  5HS8 A;  2OUM A;  2E5Z A;  2GWR A;  3QAH A;  4J01 A;  2E2I J;  4LLG F;  2B9S A;  5EEH A;  1XCV A;  2E1O A;  5AIQ A;  2JA8 J;  1T56 A;  3BPX A;  5LHI A;  2LDU A;  1IXR C;  3WE2 A;  1RRJ A;  5IT9 Z;  2J5P A;  3CLQ A;  1U3E M;  4EV0 A;  1P6R A;  2LK2 A;  1P7J A;  3Q0V A;  2FBI A;  2Z2S B;  1JUP A;  3GWZ A;  2D5V A;  3AFH A;  1X1B A;  1JTX A;  3BJ6 A;  4ON0 A;  2GOM A;  2NNY A;  1YRN A;  3F0C A;  3KZI C;  2FX0 A;  4A12 A;  1FSE A;  4UVA A;  4P55 A;  1EJ9 A;  5E8G A;  1S3J A;  3VSK A;  4B47 A;  2ZBK A;  5JHF A;  3RZD J;  4HST A;  2XHK A;  3TW7 A;  1BIB A;  3MKY B;  2P7V B;  1BC7 C;  4XKW A;  4IOA F;  1TNT A;  4LGW A;  4XIC A;  1D0Y A;  2V6C A;  1FT9 A;  3L2V A;  1ZQ3 P;  3WG7 H;  4UV9 A;  2M9H A;  3TDU C;  3QYB A;  2O6G E;  1U6G A;  1FBU A;  2EWN A;  1QA6 A;  4I76 A;  1B59 A;  3DTI A;  1I3Q J;  5D5U B;  2DLL A;  5L3E A;  2Z3Y A;  4RB2 C;  1ETV A;  3Q0W A;  1X3Z B;  3FBI B;  3WHC A;  3I64 A;  2Y30 A;  1Z3Y A;  2R5Z B;  4MEY F;  4YEL A;  2LNB A;  3JRD A;  2G9W A;  2Y0S N;  3TOB A;  3FWE A;  3OYH A;  1O4X A;  4M6V A;  5CVV A;  4BU2 A;  5IOZ A;  1MGT A;  2V9V A;  3FM3 A;  5KCM A;  2R5Y B;  2KKO A;  1OIS A;  2UZK A;  3BP8 A;  4C2T A;  3KP5 A;  4I0A A;  4UUT A;  2F6C A;  1IO2 A;  2Q2E A;  4LLL A;  4DIQ A;  4KT5 C;  3GX4 X;  1LB2 A;  2RQP A;  5E1X A;  3G4S I;  2X9D A;  2LR8 A;  2JVG A;  2ZC2 A;  4JP0 A;  1LDD A;  2HVS A;  4WF2 A;  5D4S A;  4EQQ A;  1I5Z A;  1X1A A;  2RGV A;  2EA4 A;  1MMS A;  2RQQ A;  4DZJ A;  1G6N A;  2HOE A;  1HDP A;  1TL8 A;  2JPB A;  2D1V A;  3HSF A;  2HYG D;  2NRA C;  5K7F A;  2IW5 A;  4FE7 A;  4RGS A;  3FX3 A;  3QYF A;  1YIO A;  4M71 A;  4IQ4 A;  4M6Y A;  3HJE A;  3I53 A;  2YSR A;  1AU7 A;  2VLA A;  2DJI A;  2OC6 A;  3I58 A;  5BMZ A;  1LEB A;  1FYM A;  1XMX A;  4XOR A;  2DK5 A;  1R1U A;  3AG3 H;  2ADU A;  2Y31 A;  3AKZ A;  1WGX A;  4ZZL A;  4BY1 J;  1XSX A;  4PJJ A;  2HKX A;  2JRT A;  3UNG C;  2DBB A;  1PYV A;  3E5X A;  2P81 A;  3RYR A;  5BPD A;  3IRQ A;  3GTL J;  1MD0 A;  4KJZ A;  5B66 C;  3HOW J;  1Z1D A;  2TDX A;  4C30 A;  4D7M A;  3BC8 A;  2H1K A;  1ORK A;  4RMN A;  3L9F A;  2AXT C;  1K7A A;  4BKX A;  3S1M J;  1TC3 C;  2BEO A;  3EQL F;  3KCC A;  4R8H A;  2IS2 A;  2CUE A;  1U9O A;  3DKY A;  1JT6 A;  4UUV A;  1YFH A;  2HNH A;  5ICF A;  5K1Y A;  1Z21 A;  2ZXJ A;  1E2X A;  4N4N B;  2RN7 A;  3IWZ A;  3LNQ A;  4XLC A;  1F1Z A;  3QPL A;  2OV7 A;  3RQI A;  3K70 C;  3RTR A;  2PMZ N;  3K7A J;  2EZH A;  2GBY A;  5LEJ A;  3G71 I;  2ESH A;  3U1D A;  5LLQ A;  2R7O A;  5E20 A;  2GLO A;  1KON A;  1OR7 A;  5GAE J;  2ACJ A;  1W7P B;  4B1R A;  3REO A;  2E2H J;  2BW3 B;  5H20 A;  1FSH A;  2BY2 A;  2DQR A;  2ME6 A;  1MNM C;  3OSF A;  4U7D A;  5DDG A;  1V5F A;  1LEA A;  2X0L A;  2K4B A;  5J3L A;  2P0W A;  3PUB A;  3I9V 2;  5D4R A;  2BZT A;  4IHX A;  2KDZ A;  2P7C B;  4XK4 A;  3S17 J;  3D5L A;  5F0F A;  3TP0 A;  3GZ5 A;  2XAF A;  1NG7 A;  1KZH A;  2XUB A;  5KHD A;  3L2Q A;  4HZF A;  2ETH A;  2WAQ A;  3I4N J;  2LKX A;  1JE8 A;  3PQJ A;  4UB6 C;  2OBP A;  3ABU A;  4I7H A;  3W2V A;  2R7U A;  5DS9 A;  4I6Z A;  1I50 J;  4YFK F;  3U21 A;  2MH9 A;  3DTE A;  3S2H J;  5LHH A;  3C18 A;  5M5Y J;  3BZ6 A;  2OJE D;  3MVP A;  5DD4 A;  5JHU A;  4G7O F;  1MJB A;  1MMA A;  4RAF A;  1X1P A;  1WJB A;  3K4B A;  3RPQ A;  2NVY J;  3GLL A;  3K2Z A;  1PVE A;  3BG5 A;  1TWA J;  2W57 A;  3L00 A;  3ZMZ A;  2LC2 A;  3DLL F;  4W97 A;  2LY1 A;  3ZGK A;  1HW1 A;  4J19 A;  3ABK H;  3CO6 C;  1G3W A;  4G7Z F;  4ZDO A;  1ERD A;  2BXY A;  3NRV A;  3RKX A;  1G8X A;  1BA5 A;  2LVS A;  4C9Y A;  1J09 A;  2EZK A;  4MNU A;  4KN4 X;  3GLX A;  1UEL B;  2RRE A;  4BL0 B;  1BI1 A;  2VN2 A;  5FLM J;  3S3O A;  3KLN A;  2DFF A;  1RZ4 A;  3GTK J;  1U8B A;  3JRI A;  1I3A A;  3W6V A;  1SMY F;  2KZG A;  4G12 A;  4BE2 A;  1P4X A;  3FMR A;  2I5U A;  4XQF A;  2VB6 A;  3KEO A;  5CVU A;  4KT6 A;  1PP8 F;  4HAM A;  4F3Q A;  3C7J A;  4RS8 A;  2Y48 A;  5GAH J;  3J81 K;  2XVC A;  4HF1 A;  2EIN H;  1N77 A;  2YX7 A;  3M1E A;  4H4K C;  3S14 J;  4EAT A;  3TO7 A;  1H9T A;  2EK5 A;  2O3F A;  2EV0 A;  1RKW A;  3PSI A;  2OCE A;  1HBX G;  1NHA A;  2DPU A;  2V9P A;  2XF7 A;  2JTV A;  2BBY A;  4XM3 A;  4AVZ A;  5CYV A;  3NWS A;  4DYC A;  2ZNZ A;  2XC7 A;  1N25 A;  2V1N A;  3LFK A;  1GV2 A;  1O7L A;  3B02 A;  4I2O A;  1YQA A;  4PSX A;  2CQQ A;  4A3I J;  3AL0 B;  4Y33 A;  2W00 A;  1W5T A;  3HTU A;  4JYK A;  3WTT C;  1WFX A;  4BJ6 C;  2CGP A;  3CCV I;  4Q48 A;  5FKK A;  4S0H B;  2OZ6 A;  1SVL A;  1WJ5 A;  3BQY A;  3CCE I;  1UB9 A;  1AKH B;  5CKT A;  4DYR A;  3LSR A;  4ZTJ A;  4PCQ A;  4C3I J;  4HG2 A;  2H6C A;  1FYK A;  2X6O A;  2LTP A;  2XF5 A;  5J4V A;  3CMA I;  2HYF A;  1IN6 A;  2LF7 A;  4B09 A;  4ENJ A;  3MWM A;  3GYH X;  4LG0 A;  4LD5 A;  1LVA A;  1XSV A;  4HSR A;  4KFC A;  2YR2 A;  4HBL A;  5J8C A;  3G3Z A;  5C4J J;  3M3Y J;  1YTY A;  4F52 A;  5B1B H;  4XID A;  1QQI A;  2FRH A;  3RI4 A;  4J00 A;  1R36 A;  3PO3 J;  2ZFU A;  3ERE D;  3HUG A;  2A05 A;  2L9S A;  3K2A A;  1ETY A;  5HDN A;  1WPK A;  3VYS B;  2FOK A;  3F72 A;  2XKO A;  2WB1 A;  4OIR F;  3HEF A;  1EA3 A;  3J7Y J;  4BNC A;  2L0K A;  4BDY A;  2LOO A;  4Q5S F;  5C4X J;  3EPZ A;  3GTQ J;  1QZE A;  1QVT A;  1ZLJ A;  4RBO A;  2R7V A;  3DQV C;  1SFU A;  1Y8R B;  1T0F A;  4QSH A;  2DN0 A;  3IHU A;  2FF4 A;  5KAF C;  4OIQ F;  4UB8 C;  3BTC A;  2XRO A;  4EJT A;  5DTD A;  2VQC A;  4LB6 B;  3E97 A;  4BE0 A;  5BOX A;  3A01 B;  4CA0 A;  2PJR B;  4YII A;  4WWC A;  4DJA A;  4CGZ A;  1FJL A;  5EGO B;  3JCU C;  3OOU A;  4RB0 A;  1G3Y A;  2PJP A;  2CW7 A;  3F6O A;  3CQZ J;  3F8N A;  4KIS A;  1U2W A;  1O3R A;  3GXO A;  1VQP I;  4A6E A;  3IC7 A;  4XLP F;  1TQM A;  1WQ2 A;  5E3N A;  1SEU A;  4OAZ A;  2VIX A;  5H2F C;  4BE1 A;  4E6K G;  2L4M A;  5L3B A;  1J59 A;  3OWT A;  2P5L C;  4OMY A;  4YFX F;  3J7A Y;  2QCO A;  1YJW I;  2K9S A;  3KZZ A;  2CV0 A;  1KQ9 A;  1JT0 A;  5KK1 A;  2XAU A;  2HZT A;  2FML A;  2V1U A;  4PK4 A;  1X4P A;  2MFZ A;  3OYN A;  3ZR8 X;  5L3D A;  6PAX A;  5HOD A;  4ZJZ A;  1HW5 A;  5E79 C;  1W36 D;  4IHY A;  3S1Q J;  4HNV A;  1EF4 A;  2COM A;  2O8K A;  1XPX A;  2M1B A;  1KU9 A;  2VE8 A;  3A1Y A;  2QVO A;  4ANJ A;  1YHQ I;  2K9M A;  4KDP A;  2R7Z J;  5E8I A;  3GCM A;  2VUM J;  3TQN A;  3F8M A;  5A2Q K;  4I98 B;  2MLK A;  1OCZ H;  3HHH A;  1Y8Q B;  1OQY A;  2RNJ A;  3M4O J;  2LY2 A;  2ZXH A;  5L3F A;  1S29 A;  4QIW N;  1KU3 A;  1P4A A;  2MC4 A;  4E7K A;  1CQT A;  1WVR A;  2BHY A;  4GXO A;  3B6A A;  4CO8 A;  1CF7 A;  4Y17 A;  1N75 A;  4TV7 A;  3SHF A;  1K78 A;  1XDU A;  1FMW A;  4AWX B;  2M0C A;  2R7S A;  3E1S A;  2Z99 A;  2ESN A;  1OJL A;  4A3F J;  3HRT A;  3ABM H;  3CCJ I;  3CMM A;  2HVQ A;  3HYI A;  2F5C A;  3M8F A;  4V2G A;  5CJ9 A;  3BR2 A;  4S05 A;  2QF7 A;  4ZYA A;  3PNT A;  2ECC A;  2HZD A;  3WGI A;  1H0M A;  2K40 A;  2K9Q A;  2QYO A;  3RKW A;  2IGM A;  2DQL A;  5K7Z A;  4B3A A;  4X1E A;  3OV8 A;  2CSO A;  3F23 A;  1VQ8 I;  4II2 A;  4N9H A;  3V8J A;  1GHC A;  2HYJ A;  1ZRF A;  5CVI A;  3PIO F;  1TNS A;  1BC8 C;  1X3U A;  4G6T B;  4YFN F;  2O0Y A;  2QQA A;  2R93 J;  2H94 A;  1H88 C;  2TRT A;  4MHG A;  3MKZ A;  1WZ2 A;  2K85 A;  2IEK A;  5CQE A;  4HDU A;  1F43 A;  1K4S A;  1T6S A;  5FKO A;  5HNH A;  2CJJ A;  1E3P A;  2ZO4 A;  2MH2 A;  3O6B B;  3HOT A;  3COA C;  5LD2 C;  1NK2 P;  4L0Y B;  5FLX K;  3JRC A;  1TT0 A;  2HFH A;  1V3F A;  5HDG A;  5F1R A;  2PMU A;  3PUF A;  3RDI A;  2FBK A;  4ITV A;  3SDG A;  1BW6 A;  5IYD J;  1HOM A;  5DM6 F;  4Z2Y A;  1IGN A;  4HQM A;  2VBZ A;  1FP2 A;  2K86 A;  3ULQ B;  4F92 B;  3DEU A;  2GQQ A;  5F0C A;  5FKM A;  5E18 F;  2KIU A;  5DYM A;  1O3Q A;  3R60 A;  4HLY A;  1FBQ A;  1XN7 A;  2HPM A;  3VYU B;  3OR1 C;  1MKM A;  3R6S A;  2QSH X;  2IS6 A;  3NAU A;  2M4G A;  2YS9 A;  2I8D A;  2B7E A;  3Q5F A;  2DYS H;  4IHW A;  2A5Y B;  2DO7 A;  1Z6R A;  2JA2 A;  3FIS A;  3X2Q H;  3JSP A;  5HS7 A;  2DYR H;  1S72 I;  3KP6 A;  1J9I A;  1JTY A;  1W5C C;  1QHH D;  4CH7 A;  4P9U A;  4OU0 A;  2IS4 A;  1Q1V A;  2R5Z A;  1LDK B;  3NQO A;  3DPL C;  3CCQ I;  5ILV A;  3GFM A;  1BI0 A;  3D5R C;  4KIG A;  1PUF A;  1ULY A;  1ZTR A;  3OY9 A;  2QEX I;  2CU7 A;  4F91 B;  2M3A A;  1SMT A;  4GGG A;  2V1D A;  3PFI A;  4XON A;  2NS0 A;  3LWF A;  2M87 A;  5D8K B;  1P92 A;  2DOD A;  3WOD F;  4CUG A;  3SDB A;  4EGY A;  3CC7 I;  1APL C;  2NYX A;  1QHG A;  1RPW A;  3I59 B;  2BV6 A;  3O2P E;  3OYI A;  4C3H J;  1B9M A;  5J40 A;  1ZAO A;  1HKT A;  2X1C A;  3OS1 A;  1A6Q A;  3TBI A;  3KEY A;  1JHH A;  4GO1 A;  3U2R A;  4V2F A;  1H89 C;  2VJ4 A;  1Z7U A;  2HDC A;  4ENK A;  1LVK A;  2DMU A;  1OLT A;  2ZXW H;  3ZQH A;  4AIH A;  3M1C A;  5CPR B;  3CUO A;  2R92 J;  3P9I A;  1BM9 A;  1XTA A;  3KFW X;  4Y52 J;  3ABL H;  3CCS I;  2MYS A;  2WBM A;  2PMZ A;  5FFZ A;  2RDP A;  2ZFW A;  5FKL A;  4RAY A;  2LP0 A;  3TDZ C;  5FD6 A;  3IWF A;  1BBY A;  2DT7 B;  1HF0 A;  1ON1 A;  2IT0 A;  1D1B A;  3SJM A;  4XNF A;  3SQN A;  1R4N B;  3JSO A;  2CO5 A;  3G1L A;  3CCR I;  2AS5 F;  4D5F A;  2CQN A;  3V7S A;  4A3D J;  1FIP A;  3OYJ A;  4PJ0 C;  2VOD A;  4CYC B;  4IHT A;  2QSG X;  3RIR A;  3CF5 F;  2A5W A;  1MBK A;  3WTZ A;  4ZYG A;  1GVD A;  1G59 A;  1X58 A;  2AXL A;  2HOT A;  1IXS B;  3LQR A;  4UVC A;  1S9H A;  4ZDP A;  1EH8 A;  1RIO H;  4JK1 X;  2H1L A;  4FAS D;  2R7F A;  1KGS A;  4A3L J;  4XRF A;  2Y75 A;  2RV8 A;  3L2W A;  2IPQ X;  1NTC A;  5IPA A;  4B44 A;  2P6S A;  2RVC A;  1WI3 A;  2XB0 X;  2F48 A;  4WXC A;  4BJ5 C;  2V9K A;  4JBA A;  3TKY A;  1EV7 A;  1QZZ A;  5TJJ A;  3BCA A;  2Q8K A;  1G3S A;  1LFB A;  1IUF A;  2BY1 A;  4O3M A;  2CRG A;  2DMP A;  1S7E A;  5FO5 A;  1KU2 A;  2RKH A;  3ZMD A;  4BHC A;  4QPQ A;  2ZSI B;  3K4N A;  1UCR A;  2NVU B;  2P8T A;  3AG1 H;  3DP7 A;  1WJD A;  1W7P A;  1H8A C;  2DPD A;  3EUK L;  3QYE A;  4XRS G;  3F8B A;  4WCG A;  2BW3 A;  4FIS A;  1LNW A;  1U5T B;  2J5O A;  3OYM A;  4A0Z A;  2ZKZ A;  4GYG A;  5HLT A;  4OWR B;  1ZEL A;  3EET A;  1IXC A;  3QRF F;  2NVX J;  1WJA A;  4CDG A;  3DWL E;  2OQR A;  2W82 A;  1FP1 D;  2FOW A;  2KQR A;  3KP3 A;  1R7J A;  2XAS A;  1BJA A;  2DOE A;  1X1D A;  3OMY A;  3KIO A;  2EFP A;  2BYV E;  2JUC A;  1D1C A;  2NOG A;  3LST A;  4U88 A;  1XX5 A;  2JUG A;  5E3M A;  1O57 A;  1P7I A;  1J7K A;  5HLH A;  5LBQ A;  5JR3 A;  1MSE C;  5IP6 A;  1HLV A;  3HDD A;  3F3X A; 
#chains in the Genus database with same CATH homology
 3HRS A;  3DV8 A;  5LEK A;  5DUK A;  3SZP A;  1HXD A;  1ZH5 A;  1GVJ A;  2O03 A;  2GZW A;  3KLO A;  3PQK A;  4M74 A;  2BE5 F;  3BOQ A;  3DKW A;  3VB2 A;  4L0Z B;  2F5E A;  4A6D A;  3U9G A;  4G6D A;  2VC0 A;  3JAM K;  3I71 A;  4ZH4 F;  2HS5 A;  1TLH B;  1ZYR F;  4IXA A;  3DXJ F;  2XAH A;  3WE3 A;  1L3L A;  1ZG1 A;  4IRH A;  1MZB A;  4CZZ A;  3N97 A;  2QBY B;  3NEU A;  2XGX A;  4LB5 A;  4N0B A;  4I01 A;  4YIF A;  1D5V A;  3WGG A;  1R00 A;  1OKR A;  1XMK A;  2ISZ A;  1XDS A;  1BOA A;  4U0V A;  1MDM A;  3KP4 A;  2FU4 A;  2EV6 A;  2DK8 A;  2PEX A;  3HRM A;  2EFW A;  1W5S A;  2HTS A;  1MJ9 A;  4MTE A;  3HHG A;  2Z5U A;  3J81 Z;  2GXB A;  4EM0 B;  5F64 A;  2IA0 A;  3DFG A;  1UHM A;  1ON2 A;  3I4P A;  1WI9 A;  4M9S A;  5D6E A;  5K5Q A;  5ED4 A;  2ELH A;  2RC4 A;  1S6L A;  2FSW A;  3CUQ A;  4BHB A;  1HSJ A;  2GAU A;  1O3S A;  2PLY A;  5D6F A;  1L0O C;  4A5M A;  1PDN C;  5DV5 A;  1OYY A;  1SFE A;  2VON A;  3FHZ A;  1T38 A;  4IJA A;  3ABT A;  2EJR A;  3GW2 A;  3T8R A;  3LQQ A;  2W24 A;  3FXQ A;  2XKP A;  2Z9O A;  4G7H F;  3FM5 A;  2A07 F;  2LKP A;  3ZMS A;  4RB1 A;  3I54 A;  1BI3 A;  4HDV A;  3FF5 A;  5D5W B;  3R61 A;  1KQ8 A;  2VBW A;  3QU3 A;  4UV8 A;  3RYP A;  3K1N A;  3WTV C;  3KZY A;  4ENM A;  1WKM A;  1LDJ A;  4OOI A;  5KVR A;  4A5N A;  3ECO A;  2FE3 A;  4IF4 A;  3T0Y A;  3HTS B;  3E6C C;  2E7X A;  2PFB A;  4LJZ F;  1AOY A;  5H6R A;  4MQ9 F;  4IRG A;  1Y0U A;  3JTH A;  2FQ3 A;  4P9F A;  1ZN2 A;  3WU1 B;  2QWW A;  3AAF A;  4HLX A;  3JTG A;  1P4W A;  5E1Z B;  1I6X A;  3K1M A;  3L09 A;  2FBH A;  1C0W A;  1QNT A;  2VBX A;  5HLI A;  3MZY A;  2QM3 A;  4S04 A;  3CTA A;  1HST A;  1W7P D;  3H3Z A;  2EB7 A;  2DAO A;  1ODD A;  1YG2 A;  5A2Q Z;  4G8X A;  3BY6 A;  1HQC A;  2ZME B;  4EMS A;  1IZ1 A;  3ELK A;  2CYY A;  2PMH A;  3L2C A;  1OYI A;  4IRI A;  1YLF A;  3BRO A;  3E6B A;  4U0W A;  2E1C A;  3ZN0 A;  4L9T A;  2WC2 A;  2HGC A;  1FX7 A;  1FYL A;  2O61 A;  1XGN A;  1ZLK A;  3V4G A;  3WG9 A;  3ZP5 A;  1R1V A;  2Z33 A;  2VC1 A;  1OYW A;  2CFX A;  1G4D A;  2FMY A;  2IP2 A;  2EA2 A;  4IHS A;  1J2X A;  1F5T A;  3GEZ A;  4HF0 A;  4ZZD A;  1VTN C;  2FXA A;  4EJO A;  5BQT A;  3FMS A;  4AIK A;  2Y0M A;  3DPT A;  3F8F A;  3HSE A;  2QQB A;  5DUI A;  3TOA A;  1SD7 A;  2ZNY A;  5FLX Z;  3WTX C;  4CYD A;  2VT3 A;  4XSZ F;  1UFM A;  4A0X A;  1EH6 A;  3O3K A;  2G7U A;  5JI6 A;  2YU3 A;  5LHG A;  2VE9 A;  3M9A A;  2PN6 A;  1IN5 A;  4NHJ A;  5DCF A;  1T98 A;  2XV4 S;  3QPT A;  3T1B A;  3B73 A;  4O5V A;  4DQ2 A;  2G7H A;  1Z6T A;  5J6X A;  3I59 A;  1QBJ A;  1F4K A;  4EVI A;  1DP7 P;  1ZGJ A;  4IVN A;  3J7A O;  3J80 Z;  3C1D A;  4EGZ A;  3F6V A;  1XGS A;  1S8N A;  3ISP A;  5CLS A;  1Q1H A;  4G94 A;  3ROU A;  4M6X A;  4HV5 A;  1T39 A;  4I0B A;  2UWM A;  2PG4 A;  3E6M A;  2UXX A;  2XAQ A;  1FY7 A;  4G9Y A;  1HW2 A;  4CIC A;  2VXZ A;  4ESJ A;  2JSC A;  3ZMT A;  4LMY A;  2PI0 A;  2EV5 A;  1YO5 C;  5ERI A;  1YW8 A;  2JPC A;  2OA4 A;  4MQV A;  2V1X A;  3ZQ7 A;  1USS A;  4WXH A;  3M8E A;  4M9X A;  3GF2 A;  4BXU A;  1ZRD A;  5DCM B;  3G73 A;  4HF2 A;  3BWG A;  2HTJ A;  3K69 A;  4FT8 A;  4U0Y A;  2YPR A;  1UST A;  2K7L A;  2WV0 A;  3IRR A;  2OD5 A;  4G6Q A;  2K27 A;  1PUE E;  2VOO A;  1U5T A;  2A6E F;  2EFQ A;  4UHT A;  1R58 A;  1KA8 A;  4M73 A;  1FWZ A;  2H09 A;  3GO5 A;  3SFZ A;  1TTY A;  2IVM A;  4OIP F;  1XB4 A;  3J80 K;  1R1T A;  4I09 A;  4LLN A;  4HA8 A;  1T2K A;  1B6A A;  2HQR A;  2EFN A;  4RGU A;  4A0Y A;  2ISY A;  3ZN1 A;  3E6D A;  4M9Z A;  3RKY A;  2XAG A;  1IAW A;  4XBF A;  3ECH A;  3GFI A;  4JQF A;  3SXY A;  3TGN A;  3KE2 A;  1ZG3 A;  4PGG A;  3VFZ A;  2XIG A;  4CHU A;  3RPU A;  4AVP A;  2QBY A;  3JAM Z;  1FZP B;  1FNN A;  5E17 F;  4WXD A;  2X4H A;  1XSD A;  1RUO A;  2L3D A;  1K79 A;  4XSX F;  2M45 A;  5FGM A;  1I1G A;  3MAJ A;  3R0J A;  5JVT A;  2W85 A;  3ML6 A;  2C6Y A;  1R5H A;  4PZJ A;  2V79 A;  3WTU C;  2HEO A;  2A69 F;  1DPU A;  4L18 B;  3BJA A;  2DW4 A;  4ZYE A;  1ZRE A;  2F2E A;  2LF8 A;  5K5O A;  3QPH A;  3K0L A;  3HSR A;  3I5U A;  2L02 A;  1IN8 A;  4E70 A;  4U7B A;  1FPQ A;  2DTR A;  5HS9 A;  1S7O A;  1ZGA A;  2P4W A;  4EM2 A;  4R79 A;  4HX8 A;  2LSO A;  5CVR A;  2OAZ A;  4MTD A;  3VOD A;  4XLN F;  4QWQ A;  1K6O A;  3LA2 A;  2VT2 A;  2O8X A;  1ZG5 A;  5D5V B;  3N4M A;  1Z91 A;  5LGU A;  3MZH A;  3KP2 A;  3QOP A;  2IA2 A;  5HOO A;  4ENN A;  1O7F A;  2HR3 A;  5JFR A;  2XAJ A;  3CUQ C;  1KQ0 A;  3Q9S A;  3D0S A;  5ICG A;  3EDP A;  1S7A A;  2QUF A;  4KMF A;  3V8L A;  1IN4 A;  4LK1 F;  2FA5 A;  1FLI A;  1YW9 A;  3M7G A;  2OZU A;  3WTY C;  1J0R A;  4EJV A;  3QP5 A;  1B9N A;  1HKQ A;  3P9C A;  5IT9 K;  1E17 A;  4ASN A;  1DPR A;  2OQG A;  2ZCW A;  2NAZ A;  2CQK A;  2CG4 A;  2QQ9 A;  1TW3 A;  3W6K B;  5DEQ A;  2MD5 A;  4BQA A;  3IKT A;  4KIC A;  4BAY A;  5L3G A;  3LA7 A;  3KP7 A;  2KJB A;  1ZHF A;  2STW A;  4GYI A;  1YW7 A;  3P9K A;  1BIA A;  1YYV A;  2HQN A;  2QEN A;  3IL2 A;  1WSU A;  1FOK A;  1REP C;  4M72 A;  3MQ0 A;  2KJC A;  4LK0 F;  1R22 A;  2KIM A;  1LJ9 A;  1QGP A;  2A3S A;  3KEQ A;  1YS7 A;  4EJW A;  4Y15 A;  2IRF G;  4KYW A;  3V8K A;  2DU9 A;  5IT3 A;  4RB3 C;  4ESB A;  3KET A;  1D8J A;  3RJP A;  2ZME A;  1G3T A;  4IPA A;  1F9N A;  1Z9C A;  4ESF A;  4HW0 A;  5J8F A;  4LFU A;  4OMZ A;  1H9G A;  3JW4 A;  1TBX A;  3CDH A;  5BPI A;  1IN7 A;  3SZT A;  4HQE A;  3GFJ A;  4QLC U;  5L3C A;  1V4R A;  3LA3 A;  2L54 A;  1WRJ A;  1RI7 A;  4CXF A;  2EFO A;  5K5R A;  2FNA A;  4ZYH A;  1XGM A;  2HKO A;  2F5D A;  2E7W A;  3CLO A;  3HIF A;  5FD5 A;  3FZV A;  3L7W A;  4UNO A;  3IKV A;  2GA1 A;  1D8K A;  4ETS A;  2F5F A;  4I02 A;  4D0P A;  4L5I A;  4P96 A;  2XRN A;  4RGR A;  1D3Y A;  3MCZ A;  3V7R A;  2D2W A;  3P7N A;  4OIO F;  4KN7 X;  3S2W A;  4R1H A;  3GZ6 A;  2D45 A;  1MDM B;  4Q4Z F;  4L9V A;  1LQ1 A;  3F8C A;  2R3S A;  2H27 A;  3V7C A;  1STZ A;  1J75 A;  3F21 A;  4KIF A;  3Q9V A;  5FFX A;  1SFX A;  3WTW C;  1I1S A;  1W4M A;  2KIF A;  4HYE A;  1CGP A;  3T5X A;  2DFI A;  1DDN A;  1TQI A;  1KYW A;  5TRD A;  3GUD A;  5AON A;  1GXP A;  3CUQ B;  3E5U A;  3R0A A;  1UHW A;  1IUY A;  1DUX C;  4HX4 A;  3W6J B;  4NQW A;  3MEX A;  5HLG A;  4PGH A;  1SD4 A;  3CO7 C;  3QU6 A;  1SD5 A;  3GFL A;  2R7D A;  4B8X A;  1YS6 A;  2QZ8 A;  2B0L A;  4GCV A;  4KNY A;  1O3T A;  2GIV A;  1GXQ A;  1P2F A;  2FEZ A;  5BS6 A;  2M5W A;  1J5Y A;  3I0T A;  4FX0 A;  1SAX A;  2OU2 A;  5DCM A;  2Q0O A;  2DT5 A;  4DNC A;  4Y13 A;  3FXU A;  4UXN A;  2H6B A;  5EEG A;  3TO6 A;  2HWV A;  3EYI A;  4L5J A;  4N9I A;  5ICE A;  2BGC A;  2M30 A;  1RNL A;  2P5K A;  5DD8 A;  3VOE A;  3BJO A;  2JZY A;  4EJU A;  1JHF A;  4RGX A;  3ZMV A;  5ILS A;  3WU0 A;  3FMQ A;  2MC3 A;  2P6T A;  1Z05 A;  1KU7 A;  4AIJ A;  1OMI A;  4KA4 A;  4L9J A;  2L01 A;  4MGR A;  3R4K A;  3C3W A;  4L9N A;  1KYZ A;  4BYY A;  1U5T C;  3MFK A;  5HVQ C;  3ZPL A;  1ONV A;  2A68 F;  2DI3 A;  4OIN F;  3BDD A;  2W84 A;  2VBY A;  5HDK A;  4HX7 A;  4BH9 A;  1XGO A;  2YX4 A;  5ILU A;  4RAZ A;  4LG0 B;  5H6Q A;  4F7Z A;  1JGS A;  3CJN A;  3LAJ A;  2FNP A;  5LRR A;  2QLZ A;  3ZMU A;  1I27 A;  3H3U A;  2K02 A;  5E1W A;  4UVB A;  2MBF A;  4FX4 A;  5LGT A;  1OPC A;  3LAP A;  3BPV A;  3WTS C;  4MEX F;  4KMU X;  3HRU A;  1QO0 D;  1U8R A;  2JT1 A;  2WTE A;  5ICC A;  3VEP A;  5LRS A;  1TW2 A;  4EM1 A;  4ZYD A;  4HOB A;  1R5G A;  2L4A A;  5AIP A;  3TO9 A;  1ZRC A;  4WK8 F;  2STT A;  2ZJ2 A;  5D5X B;  2CWE A;  3EUH A;  1RUN A;  2MA3 A;  2W25 A;  2IJL A;  4KIB A;  1XMA A;  4AD9 A;  5LGN A;  2KRF A;  1SD6 A;  3E3V A;  2WWY A;  1FBS A;  4FHT A;  3E5Q A;  2D1H A;  2GXG A;  4H0E A;  4O6J A;  1AWC A;  3H92 A;  1U78 A;  2PQ8 A;  4WX9 A;  1IRG A;  2PBI A;  1XD7 A;  4P5O A;  5D8L B;  2A61 A;  2NNN A;  4PDK A;  2UXN A;  2MLG A;  3GVA A;  4HV6 A;  3T8T A;  1IF1 A;  3DF8 A;  4NB5 A;  3F22 A;  3WGH A;  1CF7 B;  1QPM A;  1JXS A;  1QZY A;  4YG2 F;  2K4J A;  2M8E A;  2GA2 A;  1XCB A;  2E1N A;  1K78 B;  1TQP A;  1IRF A;  1B1B A;  2IA1 A;  1EH7 A;  4A2U A;  3OOP A;  3FXR A;  3EYY A;  5CVJ A;  3K9T A;  1BN5 A;  1IW7 F;  5F6F A;  1BI2 A;  1A04 A;  1FC3 A;  3K1P A;  4BHP A;  1R23 A;  3QP6 A;  1ZAR A;  3HOS A;  1PP7 U;  5FB2 A;  1MJA A;  2A6H F;  1B4A A;  2CW0 F;  1HKS A;  4KUM A;  4Q47 A;  1WWX A;  4K2E A;  2VOP A;  2P5V A;  5HS8 A;  2GWR A;  3QAH A;  4LLG F;  5EEH A;  1XCV A;  5AIQ A;  3BPX A;  5LHI A;  2LDU A;  1IXR C;  3WE2 A;  5IT9 Z;  2J5P A;  1U3E M;  4EV0 A;  1P6R A;  2FBI A;  3GWZ A;  3BJ6 A;  4ON0 A;  2NNY A;  4A12 A;  1FSE A;  4UVA A;  4P55 A;  5E8G A;  1S3J A;  2ZBK A;  2XHK A;  1BIB A;  2P7V B;  1BC7 C;  1TNT A;  4LGW A;  2V6C A;  1FT9 A;  4UV9 A;  3TDU C;  2O6G E;  1U6G A;  1FBU A;  2EWN A;  1B59 A;  5D5U B;  2DLL A;  5L3E A;  2Z3Y A;  4RB2 C;  3I64 A;  4MEY F;  2LNB A;  2G9W A;  3TOB A;  3FWE A;  5CVV A;  1MGT A;  2V9V A;  3FM3 A;  2KKO A;  2UZK A;  3BP8 A;  3KP5 A;  4I0A A;  2Q2E A;  4LLL A;  4KT5 C;  3GX4 X;  1LB2 A;  2RQP A;  5E1X A;  1LDD A;  4WF2 A;  5D4S A;  4EQQ A;  1I5Z A;  2RGV A;  2EA4 A;  1G6N A;  2HOE A;  2JPB A;  2D1V A;  3HSF A;  2HYG D;  2NRA C;  2IW5 A;  4RGS A;  3FX3 A;  1YIO A;  4M71 A;  4M6Y A;  3I53 A;  2YSR A;  5BMZ A;  3I58 A;  1LEB A;  1FYM A;  2DK5 A;  1R1U A;  2ADU A;  4ZZL A;  1XSX A;  2HKX A;  2JRT A;  2DBB A;  3E5X A;  3RYR A;  5BPD A;  3IRQ A;  1MD0 A;  1Z1D A;  2TDX A;  3L9F A;  1K7A A;  2BEO A;  3EQL F;  3KCC A;  4R8H A;  4UUV A;  1YFH A;  5ICF A;  5K1Y A;  2ZXJ A;  1E2X A;  2RN7 A;  3IWZ A;  1F1Z A;  3RTR A;  5LEJ A;  2ESH A;  3U1D A;  5LLQ A;  5E20 A;  1OR7 A;  2ACJ A;  1W7P B;  3REO A;  5H20 A;  1FSH A;  2DQR A;  4U7D A;  5DDG A;  1LEA A;  2X0L A;  2K4B A;  5D4R A;  2P7C B;  3D5L A;  3GZ5 A;  2XAF A;  2XUB A;  4HZF A;  2ETH A;  1JE8 A;  3PQJ A;  2OBP A;  3ABU A;  4I7H A;  4YFK F;  2MH9 A;  5LHH A;  3C18 A;  3BZ6 A;  5DD4 A;  5JHU A;  4G7O F;  1MJB A;  3RPQ A;  3K2Z A;  3L00 A;  2W57 A;  3ZMZ A;  1HW1 A;  3CO6 C;  1G3W A;  4G7Z F;  3NRV A;  3RKX A;  4MNU A;  4KN4 X;  3GLX A;  1BI1 A;  2VN2 A;  3KLN A;  1RZ4 A;  1SMY F;  1P4X A;  3FMR A;  3KEO A;  5CVU A;  1PP8 F;  4HAM A;  3C7J A;  4RS8 A;  2Y48 A;  3J81 K;  2XVC A;  4HF1 A;  2YX7 A;  3M1E A;  3TO7 A;  1H9T A;  2EK5 A;  2O3F A;  2EV0 A;  1HBX G;  1NHA A;  2DPU A;  2JTV A;  2BBY A;  5CYV A;  2ZNZ A;  3LFK A;  4I2O A;  1O7L A;  3B02 A;  1YQA A;  1W5T A;  3HTU A;  3WTT C;  2CGP A;  4Q48 A;  2OZ6 A;  1UB9 A;  4PCQ A;  2H6C A;  1FYK A;  2HYF A;  1IN6 A;  2LF7 A;  4B09 A;  4ENJ A;  3MWM A;  3GYH X;  4LG0 A;  4LD5 A;  1LVA A;  1XSV A;  4KFC A;  2YR2 A;  4HBL A;  5J8C A;  3G3Z A;  1YTY A;  1QQI A;  2FRH A;  3RI4 A;  1R36 A;  3ERE D;  3HUG A;  5HDN A;  2FOK A;  3F72 A;  2XKO A;  4OIR F;  4BNC A;  4Q5S F;  1ZLJ A;  3DQV C;  1SFU A;  1T0F A;  3IHU A;  2FF4 A;  4OIQ F;  2XRO A;  4EJT A;  4LB6 B;  3E97 A;  5BOX A;  4YII A;  4WWC A;  4CGZ A;  4RB0 A;  1G3Y A;  2PJP A;  3F6O A;  3F8N A;  1U2W A;  1O3R A;  3GXO A;  4A6E A;  3IC7 A;  4XLP F;  1TQM A;  1WQ2 A;  2L4M A;  5L3B A;  1J59 A;  2P5L C;  4OMY A;  4YFX F;  3KZZ A;  1KQ9 A;  5KK1 A;  2HZT A;  2FML A;  2V1U A;  5L3D A;  6PAX A;  1HW5 A;  2COM A;  2M1B A;  1KU9 A;  2VE8 A;  2QVO A;  4KDP A;  5E8I A;  3TQN A;  3F8M A;  5A2Q K;  4I98 B;  2MLK A;  3HHH A;  2RNJ A;  5L3F A;  1S29 A;  1KU3 A;  1P4A A;  4GXO A;  4CO8 A;  1CF7 A;  4Y17 A;  4TV7 A;  3SHF A;  1K78 A;  1XDU A;  4AWX B;  2Z99 A;  2ESN A;  3HRT A;  3HYI A;  2F5C A;  3M8F A;  5CJ9 A;  4S05 A;  3WGI A;  1H0M A;  2QYO A;  3RKW A;  2DQL A;  3F23 A;  3OV8 A;  2CSO A;  4N9H A;  3V8J A;  1GHC A;  1ZRF A;  5CVI A;  1BC8 C;  1TNS A;  1X3U A;  4YFN F;  2O0Y A;  2QQA A;  2H94 A;  4MHG A;  4HDU A;  1T6S A;  2ZO4 A;  3O6B B;  3HOT A;  2MH2 A;  3COA C;  4L0Y B;  5FLX K;  2HFH A;  1V3F A;  5HDG A;  5F1R A;  2PMU A;  3RDI A;  2FBK A;  4Z2Y A;  4HQM A;  2VBZ A;  1FP2 A;  2K86 A;  3ULQ B;  3DEU A;  2GQQ A;  5E18 F;  2KIU A;  5DYM A;  1O3Q A;  3R60 A;  4HLY A;  1FBQ A;  1XN7 A;  1MKM A;  3R6S A;  3Q5F A;  2A5Y B;  2DO7 A;  1Z6R A;  3JSP A;  5HS7 A;  3KP6 A;  1J9I A;  4P9U A;  4OU0 A;  1LDK B;  3NQO A;  3DPL C;  5ILV A;  3GFM A;  1BI0 A;  4KIG A;  1ULY A;  1SMT A;  4GGG A;  2V1D A;  3PFI A;  2NS0 A;  3LWF A;  2M87 A;  5D8K B;  1P92 A;  3WOD F;  4EGY A;  2NYX A;  3I59 B;  2BV6 A;  3O2P E;  1B9M A;  1HKT A;  1ZAO A;  1JHH A;  4GO1 A;  3U2R A;  1Z7U A;  2HDC A;  4ENK A;  4AIH A;  3CUO A;  3P9I A;  1BM9 A;  3KFW X;  5FFZ A;  2RDP A;  2ZFW A;  4RAY A;  3TDZ C;  5FD6 A;  3IWF A;  1BBY A;  1ON1 A;  2IT0 A;  3SQN A;  3JSO A;  2CO5 A;  2AS5 F;  3V7S A;  2VOD A;  4IHT A;  3RIR A;  3WTZ A;  4ZYG A;  2AXL A;  1IXS B;  3LQR A;  4UVC A;  1EH8 A;  1RIO H;  4JK1 X;  2R7F A;  1KGS A;  4XRF A;  2Y75 A;  2RV8 A;  2IPQ X;  2P6S A;  2RVC A;  4WXC A;  4JBA A;  3TKY A;  1EV7 A;  1QZZ A;  5TJJ A;  2Q8K A;  1G3S A;  4O3M A;  5FO5 A;  1KU2 A;  2RKH A;  3ZMD A;  4BHC A;  1UCR A;  2P8T A;  3DP7 A;  1W7P A;  2DPD A;  3F8B A;  4WCG A;  1LNW A;  1U5T B;  2J5O A;  4A0Z A;  2ZKZ A;  4GYG A;  3EET A;  3QRF F;  1IXC A;  4CDG A;  2OQR A;  1FP1 D;  3KP3 A;  1R7J A;  2XAS A;  1BJA A;  2EFP A;  2BYV E;  3LST A;  4U88 A;  1O57 A;  1J7K A;  5HLH A;  5LBQ A;  5JR3 A;  3F3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...