5HDGA

Crystal structure of heat shock factor 1-dbd
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
94
Chain Sequence
HVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEDTEFQHPCFLRGQEQLLENIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock factor protein 1
publication title HSF1-DBD crystal structure
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 23
structure length 94
sequence length 104
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hdgA00
1P4XA 2QBYB 1IZ1A 2MH2A 5HLHA 3HOSA 1K79A 1S6LA 3IKVA 2FNPA 2L02A 2OAZA 3BROA 1GHCA 1R1VA 3HTSB 3K2ZA 4N9HA 2M45A 3GZ6A 3MWMA 5H20A 5DUIA 1K6OA 5HDGA 1BIBA 1JGSA 3CTAA 5KK1A 1OR7A 2HTSA 1BC8C 5DUKA 3RI4A 4M6YA 3K1PA 4OMYA 1OPCA 5FD5A 4BYYA 3MEXA 1TLHB 1T0FA 2Y75A 2OD5A 4M73A 4OIQF 4EM2A 1Z7UA 4EJUA 2ZFWA 1I6XA 3C3WA 4GYIA 1U3EM 2RN7A 4MTEA 5DCFA 3F21A 2HQNA 1GVJA 3HRMA 2J5OA 2FQ3A 1IW7F 3O6BB 2EV6A 4HQEA 2IT0A 1T98A 1Z6RA 3J80Z 4KFCA 1ZG3A 2L01A 1T38A 5H6RA 5HOOA 4I98B 1Y0UA 4ESBA 2VN2A 4YFNF 2W84A 1L0OC 2VT2A 5L3FA 3GFMA 3T8TA 1IN7A 2ISZA 2RVCA 5CVRA 4OMZA 3J7AO 2V1UA 2L4MA 2RDPA 2K02A 3E5UA 3FM5A 1LJ9A 4GGGA 2OA4A 5E8IA 4IVNA 1KU2A 3MCZA 3LQRA 1FNNA 1P6RA 3KP6A 1GXQA 2G9WA 3J80K 3S2WA 1QPMA 2A6HF 4U0VA 4BXUA 4WWCA 2EV5A 4L9JA 2DU9A 3RTRA 4Y13A 2A61A 2STWA 1MZBA 1AOYA 4A2UA 1IN4A 4LLGF 4HX8A 3ABTA 4EM0B 1ON1A 3I59A 5ILUA 1ZLKA 4L18B 3W6JB 5BQTA 1BBYA 3FMRA 2H6CA 5DV5A 4HX7A 3ZPLA 5JR3A 1R00A 2QVOA 4IRGA 1HW1A 1U5TC 4I09A 4RGSA 3WTTC 3RKXA 1VTNC 2P5VA 1TNSA 3L9FA 4I2OA 1X3UA 4HX4A 5A2QZ 1XSXA 3LWFA 5HS9A 3BPVA 4IF4A 5D8LB 4G8XA 2YR2A 1MDMA 2FSWA 2V6CA 3EYYA 1IF1A 4L0ZB 3GW2A 3WU1B 3E5XA 5D6FA 3CUOA 2B0LA 1YW9A 5BPDA 2KIUA 3FM3A 1D3YA 1ODDA 2F2EA 4EV0A 1OMIA 3V8LA 4L5IA 1ZG1A 4KNYA 1FZPB 4M74A 2FBIA 1HSTA 1K7AA 1R23A 2QQBA 1FP1D 2VONA 2XROA 2ZJ2A 4I0AA 4G7HF 2Z99A 1UFMA 5LHIA 4O3MA 2FMYA 4G9YA 5DD4A 3VODA 1QBJA 2D1HA 5AIQA 2J5PA 1SD4A 2VC0A 5D5XB 3WTWC 4EGYA 3Q5FA 3GFJA 1SMTA 5LHHA 2O03A 3F8BA 3K69A 2NNNA 3IRRA 5DYMA 5ILVA 1XB4A 5J8CA 3F22A 2QENA 2VXZA 1FLIA 2IPQX 4YG2F 1FX7A 4IRHA 4G7OF 2BYVE 2P6SA 4PZJA 2JTVA 3R0JA 1BM9A 4HQMA 2FNAA 3KEQA 3K0LA 3JTGA 5KVRA 3WE3A 1TQMA 2OBPA 5LHGA 1YIOA 3F3XA 3PQKA 4U88A 4IJAA 1YO5C 2PBIA 2ZNYA 3BJ6A 3IWZA 5L3BA 4PGGA 1J0RA 1KGSA 2GAUA 4GYGA 3JSOA 2FEZA 1LNWA 3G3ZA 2YX4A 5H6QA 2P8TA 4JQFA 2IRFG 1SFUA 3DPTA 1DDNA 5JI6A 2MLGA 5FFXA 3WTYC 4HZFA 2RGVA 2X4HA 3LA3A 1H0MA 3FF5A 2XAJA 3QP6A 2K86A 5FD6A 2LSOA 2EFOA 3BY6A 3Q9SA 3ZMVA 4QWQA 4NHJA 2PQ8A 4R1HA 1REPC 1RUNA 1ZRCA 1YTYA 2QYOA 1LDKB 4RB3C 2MD5A 2P4WA 2DAOA 1ON2A 4G94A 4OIRF 3VEPA 2PLYA 4LLNA 2PMHA 1JHHA 1FBSA 3N4MA 3F8CA 2E7WA 4UXNA 2P5KA 1OYWA 3H3UA 3V7SA 4HAMA 1R5HA 2HS5A 5D4RA 3HHHA 2ZMEB 4B09A 2Y48A 2XRNA 1XDUA 4A6EA 3KP5A 2HWVA 4BHBA 5LLQA 3WGIA 1LEBA 2XV4S 1BI2A 3ZQ7A 5BOXA 5DCMA 1U5TB 3M8EA 3AAFA 4OINF 1YLFA 2JPCA 3FX3A 1W7PB 4Q5SF 4M9XA 1EH8A 3HTUA 1UHWA 3FWEA 5ED4A 3WG9A 2WTEA 1P4WA 5E20A 1ZYRF 2DQLA 2OQRA 4M9SA 2XAGA 4BHPA 3HSRA 4OOIA 2VBXA 3KLNA 4A6DA 1XSVA 1DPUA 3FMSA 5EEGA 3MZYA 3QU3A 4L9NA 2ETHA 5IT3A 3ZMUA 3GUDA 4AVPA 1J59A 2EJRA 1FSEA 4PCQA 2LF7A 3I54A 2Z3YA 2F5EA 3QOPA 2HYGD 3RYPA 4AD9A 3FXRA 4P55A 4RB2C 1I1SA 3HRTA 3JW4A 1PP7U 3F6OA 1A04A 4UVCA 1E17A 3LA7A 4ASNA 1MJBA 4IHSA 1Z6TA 5EEHA 2L3DA 4P9FA 3MZHA 4WF2A 2HYFA 3ZMDA 5HS8A 3RYRA 4CO8A 2KJBA 5HDNA 3C1DA 3GZ5A 4RAZA 5L3GA 1ZHFA 1IN6A 4M6XA 2D45A 2DTRA 2Q2EA 1BI3A 3L7WA 2GWRA 1AWCA 1P4AA 2CG4A 4CYDA 3IL2A 4KYWA 2IW5A 3C18A 4IPAA 4Y15A 4K2EA 1RZ4A 4HF0A 3R4KA 3CJNA 1TNTA 3T5XA 3IC7A 4R8HA 3LAPA 1FWZA 4KN7X 1TTYA 1G3WA 4ZZDA 1RUOA 3BDDA 3PFIA 2ZXJA 4G7ZF 1HKSA 4L9VA 1H9GA 1ZLJA 5HS7A 3HSEA 1S29A 1DP7P 1O7FA 4HF1A 1GXPA 5LGUA 1J75A 5CJ9A 2R3SA 4KIFA 1WI9A 1SAXA 3IHUA 4BHCA 2HFHA 3GEZA 4LJZF 2CO5A 3KCCA 3SFZA 2EFWA 2GZWA 4MEYF 2EFQA 2VBZA 5AIPA 1KU7A 2DT5A 4ON0A 4U7DA 4ENMA 2QZ8A 1IAWA 1YQAA 4MQ9F 1LDDA 4M9ZA 1K78A 1IRFA 4P96A 4KDPA 2LDUA 2Q8KA 1Z1DA 1ZRDA 3NQOA 3TOAA 4XBFA 2CWEA 2DO7A 1KU9A 1YS7A 2RV8A 4ZH4F 5BPIA 4B8XA 3HRUA 2M1BA 4HDVA 5HVQC 2EA4A 1Z05A 2BV6A 1DUXC 4AWXB 2ZBKA 2A07F 1BI0A 4O5VA 1HKTA 2M5WA 3I59B 5IT9Z 1D5VA 3TKYA 2F5FA 1H9TA 2XUBA 5E18F 1C0WA 4ESFA 1HBXG 3GFLA 1O3SA 3GWZA 4EMSA 2NNYA 3GXOA 1ZAOA 1XMKA 5L3EA 4CICA 1XN7A 3EQLF 3OOPA 4UVAA 1YFHA 4HOBA 1ZH5A 1G3YA 4KIGA 1JHFA 3SQNA 5LBQA 2CGPA 4ENKA 1ONVA 2E1NA 4P9UA 3GFIA 3I0TA 2M8EA 2ESNA 4A5NA 2L54A 2G7UA 3I58A 1J2XA 1D8JA 2LF8A 2OZUA 4RGRA 3COAC 1WQ2A 1MDMB 2VBWA 4EM1A 2Z5UA 5LRSA 2IA2A 2VODA 2XHKA 3ROUA 5D5UB 3CO6C 1KU3A 5DD8A 4AIJA 1G3TA 3P9IA 2YX7A 2CFXA 1KA8A 3RDIA 1S7AA 2V1XA 1MD0A 2WV0A 3RKWA 4I02A 1B9MA 4YIIA 4R79A 2FOKA 1WWXA 1L3LA 3R0AA 1I5ZA 2GA2A 2ISYA 3U1DA 2DK5A 3LFKA 5L3DA 1JXSA 3OV8A 1UHMA 1LEAA 3TOBA 4D0PA 4FX0A 3T1BA 1ZREA 4HLXA 2ESHA 1QGPA 3V8KA 1EH6A 3V7CA 3DPLC 4MHGA 5CYVA 1ZG5A 2CW0F 3TDZC 2HR3A 4L0YB 5E1XA 5A2QK 2BGCA 2FBKA 4CZZA 5E8GA 1RI7A 2E7XA 1S8NA 1USSA 1SD7A 3DFGA 1J9IA 2PJPA 1V4RA 4KA4A 2EK5A 4AIHA 4LG0A 4EJWA 2IP2A 3NRVA 3HHGA 1IUYA 2IJLA 5TRDA 5HLIA 1IXCA 4UUVA 3IWFA 3BWGA 5CVUA 3ECHA 4N0BA 2JT1A 3QU6A 2STTA 4HBLA 3SXYA 1I1GA 1T39A 3DKWA 1B6AA 3ERED 1QQIA 3TDUC 4O6JA 3ISPA 2QQ9A 4OIOF 4MNUA 1E2XA 1V3FA 1U6GA 4Q47A 2VE9A 3QRFF 3HYIA 1J7KA 1CGPA 4RB1A 2UXXA 2MBFA 4WXDA 4QLCU 5J6XA 1R5GA 4JK1X 5K1YA 3E6CC 3E6MA 2DPDA 1O7LA 1YW8A 3I5UA 2KRFA 4CXFA 1P92A 4HV6A 4UV8A 3I4PA 5LEKA 1R1UA 2A3SA 1YS6A 2TDXA 2E1CA 1BI1A 5LRRA 1XGNA 1F4KA 1FY7A 1STZA 2DBBA 5ERIA 5HLGA 2V9VA 2W85A 4HLYA 1ULYA 3QPTA 3ELKA 3IKTA 3BOQA 4WK8F 3M8FA 1XCVA 5TJJA 3TO9A 4MQVA 4WXHA 1R36A 2FXAA 4PDKA 5J8FA 3B02A 2UWMA 5AONA 5DCMB 4KN4X 1RIOH 4E70A 2MH9A 2OU2A 2ELHA 3JTHA 2O3FA 4KICA 2XKPA 1B4AA 2A68F 1CF7A 2JRTA 3E6BA 5D8KB 3WU0A 1MJ9A 1F5TA 3QAHA 1XGMA 4EQQA 4M71A 2D2WA 3M1EA 4UHTA 4LK0F 1OYYA 2XKOA 3HSFA 2YSRA 4XLNF 5JHUA 1DPRA 3HRSA 3KE2A 2UXNA 3P9KA 2R7DA 4WCGA 1XD7A 4KMUX 1Z9CA 3HUGA 4L9TA 1KYZA 3M9AA 1LVAA 2VC1A 2A5YB 1R22A 4IHTA 3RPQA 3F8MA 5K5RA 3HIFA 4G6DA 4RGXA 2WC2A 2NS0A 1IN8A 2QWWA 4EGZA 3MAJA 3I53A 2PN6A 1KQ9A 3TGNA 1PDNC 4EJOA 1TW2A 3HOTA 3K9TA 4Q48A 3E5QA 3O2PE 3E97A 4Y17A 3P9CA 2HEOA 5CVJA 3TO7A 2L4AA 4UVBA 2FA5A 2DW4A 4EVIA 5DEQA 2VBYA 3CUQA 5ILSA 3MQ0A 1G4DA 2CQKA 3KP4A 3KZYA 1O3RA 2ADUA 2FF4A 1BC7C 5F6FA 5LGNA 4IRIA 5HDKA 3L09A 3G73A 3H92A 4RGUA 5BS6A 3DXJF 1QO0D 3EUHA 1FYKA 1SD5A 4I01A 4RAYA 4NB5A 1S7OA 4CDGA 1W5SA 5CLSA 5CVIA 3KETA 2Z33A 4ETSA 1FYMA 3NEUA 1BOAA 1FSHA 3LQQA 2P7VB 4XSXF 1KYWA 2FRHA 1Z91A 4G6QA 5E1WA 2O8XA 3CDHA 1O3QA 1O57A 5K5OA 3N97A 3QPHA 3EYIA 2CSOA 2RQPA 2HZTA 1JE8A 4HW0A 4KIBA 3GYHX 3BP8A 2XASA 2KIFA 3W6KB 3CO7C 2M87A 3D5LA 4P5OA 2CYYA 4XRFA 1RNLA 3FZVA 1IN5A 3LSTA 2XAQA 1FYLA 4BQAA 1FPQA 2RNJA 4DQ2A 1HSJA 2XAHA 2A6EF 1K78B 4F7ZA 5FFZA 1XGOA 2ZCWA 4A12A 1FP2A 2FE3A 3ZMZA 1U78A 4S04A 2R7FA 2QBYA 3REOA 4Q4ZF 1LB2A 2EB7A 1ZARA 2D1VA 2UZKA 2WWYA 4H0EA 5D4SA 2K4JA 4HF2A 1IXSB 2NRAC 2AS5F 1PP8F 4ESJA 1XCBA 2VOPA 4ZZLA 3KLOA 1SMYF 3GVAA 5LGTA 5ICGA 2F5CA 3WE2A 3K1NA 4A0XA 1SD6A 4WX9A 4MGRA 2H27A 1OKRA 2HDCA 3DF8A 2DQRA 1W5TA 1FBQA 1LQ1A 4HV5A 5FO5A 1YG2A 4I7HA 2YPRA 4U7BA 1TW3A 1WRJA 2IA0A 5LEJA 5FLXZ 3ZP5A 2MC3A 5ICCA 2O0YA 2K7LA 1O3TA 2FU4A 3DEUA 2HOEA 1U8RA 3VB2A 3DV8A 4I0BA 3QP5A 3FHZA 2X0LA 3WTUC 2IA1A 1PUEE 3BJAA 3FMQA 3LA2A 3LAJA 1U2WA 2V79A 1ZN2A 2KJCA 4DNCA 4Z2YA 4EJVA 3KP2A 2QM3A 3SHFA 2QLZA 5D6EA 4LK1F 4BH9A 4HDUA 5FLXK 4L5JA 2FBHA 2MLKA 3GLXA 3O3KA 5F1RA 5E17F 5IT9K 3CLOA 3RIRA 3F72A 3WTVC 2P6TA 5D5VB 2VE8A 3F23A 3ECOA 2P5LC 1XMAA 1KQ8A 3PQJA 1S3JA 4LFUA 1XSDA 1QZZA 4LGWA 4U0YA 4YIFA 1ZGJA 4GCVA 2IVMA 2PEXA 4XSZF 2O61A 1R7JA 1HQCA 2DFIA 1T2KA 3CUQC 1W7PD 1HW2A 1XGSA 2M30A 2VOOA 1NHAA 4CHUA 3T8RA 3KEOA 2OZ6A 4BNCA 3R6SA 1SFEA 4OU0A 5ICEA 4ZYHA 3ZMTA 3F8NA 4A5MA 3Q9VA 4LG0B 5E1ZB 3RPUA 3IRQA 2PMUA 2JPBA 1J5YA 3EDPA 1KQ0A 4GO1A 2HTJA 2LNBA 2YU3A 3V4GA 2DK8A 1YW7A 4LB5A 2OQGA 2P7CB 2C6YA 3L00A 2ZO4A 4WXCA 1BJAA 1XDSA 2XGXA 2PFBA 1R58A 1IXRC 4RB0A 1G3SA 3F6VA 2EFPA 3FXUA 4NQWA 2COMA 1HW5A 3VFZA 4BAYA 1YYVA 2A69F 3TQNA 3FXQA 2DPUA 4LB6B 3T0YA 3JSPA 1Q1HA 4N9IA 4RS8A 1MKMA 1W4MA 4ZYDA 2EV0A 3ZN1A 3BPXA 3GF2A 1I27A 3H3ZA 4KMFA 3V7RA 5CVVA 3K1MA 3MFKA 1WKMA 2PG4A 1LDJA 1FT9A 3ML6A 3TO6A 2W57A 2MA3A 2QQAA 3ZMSA 1EV7A 4UNOA 1HKQA 2GA1A 5DDGA 3D0SA 2EFNA 3E6DA 3ZN0A 2QUFA 5L3CA 3RJPA 1QZYA 1F1ZA 4AIKA 2VT3A 1WSUA 1ZGAA 1CF7B 5K5QA 4MEXF 2AXLA 2JZYA 1FOKA 1IRGA 3SZPA 1B1BA 3RKYA 4GXOA 2NYXA 3U9GA 2HQRA 4KT5C 2KKOA 3VOEA 2XVCA 3ULQB 5JVTA 3KZZA 5FGMA 2HGCA 1OYIA 2HKOA 2KIMA 1B9NA 2BE5F 1SFXA 4ZYGA 6PAXA 3KP3A 4YFKF 5FB2A 3WTSC 3E3VA 1UB9A 2W25A 3KP7A 5BMZA 1D8KA 1MGTA 3BZ6A 3P7NA 4A0YA 4ZYEA 3WGHA 1BN5A 3J81Z 3WTZA 4UV9A 4M72A 3WTXC 1USTA 2H09A 3B73A 4LMYA 3R60A 1TQIA 1T6SA 5JFRA 2XAFA 4EJTA 4OIPF 2V1DA 1QNTA 1TQPA 4YFXF 3R61A 3F8FA 3I64A 4A0ZA 1FC3A 3EETA 1HXDA 4LD5A 2O6GE 2GIVA 1R1TA 2JSCA 4MTDA 3L2CA 1FBUA 3GX4X 4IXAA 2Q0OA 2XIGA 3CUQB 2DLLA 2H94A 2ZKZA 1MJAA 4ENNA 2BEOA 3JAMZ 2DI3A 3DP7A 3WODF 4HYEA 3J81K 3SZTA 4FT8A 3WGGA 3M7GA 4U0WA 3BJOA 2ACJA 2K27A 4XLPF 2PI0A 3DQVC 4TV7A 2GXBA 4FX4A 2G7HA 2Y0MA 2FMLA 2ZMEA 2HKXA 3U2RA 4FHTA 3ABUA 5ICFA 2RC4A 2GXGA 1UCRA 3GO5A 1U5TA 3I71A 2Z9OA 1W7PA 1P2FA 2GQQA 2K4BA 4ENJA 3C7JA 3JAMK 5D5WB 2RKHA 3V8JA 1G6NA 2H6BA 2W24A 4KUMA 1EH7A 2ZNZA 5F64A 1ZRFA 2EWNA 1B59A 4CGZA 1TBXA 2EA2A 4S05A 4JBAA 1F9NA 2F5DA 2BBYA 2NAZA 4HA8A 4PGHA 1BIAA 4LLLA 3KFWX 2LKPA
chains in the Genus database with same CATH superfamily
1P4XA 4XRSG 2QBYB 3EUAA 1IZ1A 3BR3A 2R7UA 2MH2A 4DYRA 5HLHA 3HOSA 1K79A 2JA7J 1S6LA 3BG6A 1LE8B 3IKVA 2FNPA 1XMXA 5M3FJ 2JSPA 4A3CJ 4E7HA 4B47A 3MVPA 4DIQA 2E71A 1JJ6C 2L02A 2OAZA 3L2WA 3BROA 1GHCA 1U8BA 3S17J 1R1VA 4JX4A 3HTSB 1LVKA 4FQGA 2HXOA 3K2ZA 1QU3A 4QPQA 1ORKA 3A01A 1TC3C 2LVSA 1EJ9A 4N9HA 2M45A 3GZ6A 1JUMA 2K3PA 3MWMA 3A0HC 5H20A 2HOSA 4M3GA 5DUIA 5HDGA 1NH3A 1K6OA 1BIBA 1JGSA 3CTAA 2M3AA 5KK1A 2OTJI 1OR7A 2HTSA 1BC8C 1RKTA 3DKXA 5HNFA 5DUKA 1VQ8I 3RI4A 4IOAF 2IBDA 4M6YA 4C30A 3K1PA 4BEHB 1X4PA 3BG3A 2N8GA 2WADA 2R7WA 2WY8Q 4OMYA 4CYCB 2QCOA 1OPCA 5FD5A 1Y6IA 3MEXA 1TLHB 4BYYA 2R7RA 3ZQHA 2HDWA 1OQYA 1T0FA 2Y69H 4Y33A 3J7YJ 2Y75A 2OD5A 2VJJA 5E3OA 1LFPA 4XRSA 2DODA 3RQIA 4M73A 4OIQF 1HCRA 1LFUP 1HDPA 1W5CC 2E34A 4EM2A 2R0QC 1Z7UA 5JLXA 1YIJI 5C4JJ 3OL3A 4EJUA 2ZFWA 4IQJA 4D5FA 2QF7A 2D5VA 3K7AJ 2WY7Q 1I6XA 2HZDA 3OY9A 3C3WA 3NARA 4GYIA 1U3EM 2RN7A 3CD6I 4MTEA 5DCFA 3F21A 2HQNA 2WBMA 1MMGA 2EIKH 1S9HA 1GVJA 2OV7A 3LSHA 3HRMA 2NXNB 2J5OA 1QVUA 2FQ3A 3TP3A 4B48A 4F91B 4A3DJ 5K7HA 1IW7F 3HJEA 4CCOA 3O6BB 1YHQI 2EV6A 1D0XA 4HQEA 2IT0A 2ZSIB 2DMPA 1T98A 1Z6RA 3J80Z 4J19A 1JKPC 1D0ZA 4KFCA 1ZG3A 2L01A 5IOZA 1T38A 5H6RA 5HOOA 3H1CA 2LY1A 2MGQA 4I98B 4D1QA 3PIPF 2MYSA 1Y0UA 4RAFA 3TP0A 4ESBA 2VN2A 4YFNF 2W84A 2DA7A 2R5YA 1L0OC 2VT2A 3U1KA 5GTIC 3CC2I 2X1EA 1Y56A 5L3FA 4DGWB 3GFMA 1VQKI 3ABLH 3BR6A 3T8TA 4S0HB 1IN7A 2ISZA 4FE4A 2RVCA 5CVRA 4OMZA 2F4IA 4NUBA 2E5ZA 3J7ZI 2BVMA 3J7AO 5J4VA 2V1UA 2L4MA 2JMWA 2RDPA 2K02A 3E5UA 3FM5A 1LJ9A 4GGGA 2OA4A 5E8IA 3BTCA 3QYEA 4IVNA 1KU2A 3MCZA 3LQRA 4FE7A 4W97A 3M4OJ 1OCRH 1FNNA 1P6RA 3KP6A 1GXQA 1NG6A 2XF7A 1QRYA 4IX7A 2G9WA 1BR4A 3J80K 3LNQA 4A3JJ 3BQYA 3S2WA 1QPMA 2R92J 4CH7A 2A6HF 4U0VA 4BXUA 2KRHA 2PMZN 1XTAA 3I9V2 4NDLA 2DCEA 4WWCA 4XQFA 4CZCA 3PNTA 2EV5A 4QSHA 4C2TA 2FJ1A 2DU9A 2JVHA 3B6AA 4L9JA 3RTRA 4Y13A 1ZTRA 2EZHA 2A61A 2QKMB 2STWA 3CC7I 1MZBA 2UV1A 1HOMA 1AOYA 4A2UA 4AVZA 1HA8A 1IN4A 4LLGF 3A03A 3K2AA 2AXTC 4HX8A 3ABTA 2JA5J 5FLMJ 4XLHA 4ZTFA 4EM0B 2LRDA 1ON1A 3I59A 2R7TA 5DM6F 4E7SA 5ILUA 1H88C 3JR9A 1ZLKA 3E0JB 3DLLF 4L18B 3W6JB 2ZMEC 5BQTA 1BBYA 1XS9A 3FMRA 1B72B 2H6CA 5DV5A 2Y30A 5EYRA 4HX7A 3ZPLA 3S32A 5JR3A 5E3NA 4BDZA 3PL8A 1FMWA 1R00A 1MBFA 2QVOA 4IRGA 1HW1A 3K4MA 4JX5A 2VKVA 1U5TC 4I09A 1SAUA 3LSMA 4RGSA 3WTTC 3DPUA 3AKZA 3CDIA 2XPVA 3RKXA 1VTNC 5HODA 1E3OC 3S1MJ 3U21A 4I99C 2P5VA 2I10A 2DJNA 1TNSA 1YJNI 4M3FA 3CCLI 3GTOJ 2L7FP 1OCTC 3PSIA 3L9FA 4I2OA 2JWTA 1X3UA 2HVQA 4HX4A 5A2QZ 1XSXA 2CS3A 3W2WA 3LWFA 5HS9A 2JRMA 2E1MB 3BPVA 4IF4A 5D8LB 4G8XA 3G1MA 2YR2A 1ZR2A 5FKLA 4BKXA 3OYMA 1MDMA 1K4SA 2FSWA 2V6CA 3EYYA 1IF1A 4L0ZB 1WPKA 1RESA 3GW2A 3WU1B 3BCBA 3E5XA 3B6CA 3CJQB 3Q3SA 3AG4H 5D6FA 3CUOA 1FIPA 2KRCA 3I4NJ 2B0LA 1YW9A 5BPDA 2KIUA 3FM3A 4NQWB 1D3YA 1ODDA 2F2EA 4EV0A 1JTXA 1OMIA 1VQNI 2Y31A 1U9OA 3V8LA 4L5IA 1ZG1A 5M3MJ 4KNYA 4BJTA 1FZPB 2HQAA 4PUSA 1LPQA 2CFOA 5IYBJ 1D0YA 2FBIA 4M74A 4A3GJ 3L1PA 2ZXIA 4FTHA 2OF7A 1HSTA 3MKZA 1K7AA 1R23A 4ZYAA 2QQBA 1FP1D 1TT0A 4FASD 3ABMH 4BQNA 2VONA 3FDYA 3G1LA 5M5YJ 3C2GA 3S3NA 4YELA 2XROA 4BQQA 4EATA 2ZJ2A 4LITA 4I0AA 4G7HF 2M34A 2Z99A 3Q0UA 1UFMA 5LHIA 2KDOA 2FMYA 3L2RA 4O3MA 4G9YA 1Z77A 5DD4A 2VQLA 3VODA 2F6CA 1QBJA 2D1HA 5AIQA 3VSLA 2J5PA 4X0GA 1SD4A 2VC0A 5D5XB 3DWLE 1WJCA 3WTWC 4EGYA 3Q5FA 3GFJA 1WGXA 1JTYA 1SMTA 5LHHA 2O03A 1X3WB 3F8BA 2NNNA 3K69A 1HC8A 2XB0X 3IRRA 5DYMA 4LIUA 5ILVA 1V5EA 1XB4A 3OOUA 3CP8A 5J8CA 1Z21A 4UY8I 2OC6A 2QENA 2VXZA 3F22A 2LOOA 1FLIA 2IPQX 3IAM2 4YG2F 2LD5A 1FX7A 3AG3H 4IRHA 1KONA 5K7ZA 3S15J 2KP6A 4G7OF 2BYVE 3PM1A 1R4NB 2ZXWH 2P6SA 4PZJA 1T0FC 3IP4B 3BR1A 4P1WA 3H5NA 2JTVA 2CQQA 3GMEA 3QPLA 5J1YA 1TWCJ 3R0JA 1BM9A 4OAYA 4B3XA 4QIWN 1UG2A 4HQMA 2FNAA 1ZR4A 4RM3A 3FXLA 3KEQA 3K0LA 1VF9A 3OYHA 3JTGA 2PX9A 4KITB 5KVRA 3DU5A 3WE3A 1VQMI 2M0MA 1TQMA 2OBPA 2BY3A 5IP6A 5LHGA 1YIOA 2NVYJ 3F3XA 2VJIA 3PQKA 4DYCA 1N75A 4U88A 2L9NA 4IJAA 1YO5C 1ZELA 3ZXSA 1QHGA 3HXLA 3OSFA 2PBIA 2ZNYA 3BJ6A 3KPHA 2YUSA 3IWZA 5L3BA 4PGGA 1J0RA 1KGSA 2L9SA 3PNVA 2HQ5A 1Q1VA 2GAUA 5M5XJ 4GYGA 3OYDA 5F0FA 3JSOA 2FEZA 4XR6A 3ERMA 2KQRA 3NWTA 1LNWA 2TRTA 1RR8C 3G3ZA 2GIZA 1VFCA 2JUGA 2YX4A 5E79C 2P8TA 5H6QA 2HI3A 5JLWA 4JQFA 4J01A 2IRFG 1SFUA 5C4XJ 3LSPA 3DPTA 1DDNA 1WJ5A 2E5NA 5JI6A 2MLGA 5FFXA 3WTYC 3DBRB 2JK3A 4HZFA 2W1OA 3SEZA 4BBRJ 2KIQA 4C3IJ 2VQHA 3FKIJ 3S93A 5F27A 2RGVA 1PYVA 2ID6A 2X4HA 3LA3A 4I6ZA 2MFZA 1H0MA 3S14J 1D5YA 3FF5A 3A4CA 2XAJA 1ZK8A 3QP6A 2K86A 5FD6A 2LSOA 2DA3A 2EFOA 1IV8A 3HOUJ 1QPIA 3BY6A 3CCJI 3CCVI 3Q9SA 3ZMVA 4QWQA 2YS9A 2QSGX 4NHJA 3ZGKA 2PQ8A 3C2BA 4R1HA 1A35A 1REPC 2RNGA 3OR2C 1OJLA 5JHFA 1RUNA 1ZRCA 1YTYA 2QYOA 1LDKB 4XNFA 4RB3C 2MD5A 2P4WA 2DAOA 1ON2A 4J00A 2NS8A 3K4LA 5E3MA 4G94A 4OIRF 1WJDA 4M6VA 5CKTA 4G6TB 1WHUA 3VEPA 2PLYA 4DBRA 4LLNA 1MBEA 2PMHA 2COBA 2OJED 2JA6J 1G8XA 1JHHA 2ZSHB 3PO2J 2K9MA 1FBSA 3N4MA 3F8CA 2E7WA 3ZQGA 4UXNA 4AIDA 2P5KA 1OYWA 3H3UA 3LFUA 1WH5A 3V7SA 2A6TA 4HAMA 1R5HA 2HS5A 1SC7A 3QOEA 5D4RA 2V1NA 3HHHA 2ZMEB 4B09A 2Y48A 2XRNA 1U9NA 1XDUA 4E4HA 4E7JA 4RA2A 3KP5A 4A6EA 2HWVA 1UAAA 4BHBA 5LLQA 3WGIA 3GTJJ 1LEBA 2XV4S 1FOYA 2IGNA 3OYCA 1BI2A 3ZQ7A 5BOXA 3PJRA 5DCMA 1U5TB 3M8EA 1MBHA 3AAFA 4A3FJ 4OINF 1YLFA 2JPCA 3FX3A 1W7PB 4JOMA 4Q5SF 4M9XA 1Z67A 1MNDA 1EH8A 4N4OB 2H1LA 3HTUA 2FD5A 1UHWA 3FK7A 3GTLJ 5KNLA 3FWEA 2VQGA 2W7NA 4E7ZA 2KLOA 3WG9A 2WTEA 5ED4A 1P4WA 5E20A 1ZYRF 1IDYA 2DQLA 3IH2A 2OQRA 4M9SA 2LY9A 2XAGA 4BHPA 3JRAA 3HSRA 2IAIA 4OOIA 5GTHC 2NVXJ 1MMNA 2VBXA 4B43A 4XICA 2ID3A 3KLNA 2M4KA 4CA0A 1SFOJ 2AHQA 4A6DA 1XSVA 3G4SI 4GFBA 2KPMA 1DPUA 3FMSA 1R6RA 4HNUA 1R9TJ 5EGOB 3GCMA 2M8GX 1RPWA 4IQ4A 5EEGA 1MMSA 3D1NI 3MZYA 3QU3A 3SDBA 2DYSH 4L9NA 2DFEA 2ETHA 5IT3A 3ZMUA 2IXSA 2QKLB 2KZVA 4AYBA 4BBSJ 3GUDA 5TGTA 2FOWA 1PJRA 4AVPA 1J59A 2EJRA 1TL8A 1FSEA 1V5FA 3CDLA 4PCQA 2LF7A 3I54A 5GPAA 4NBQA 4RDUA 2Z3YA 2JA8J 2F5EA 3QOPA 2HYGD 2ZFUA 4A3LJ 3RYPA 4AD9A 3FXRA 3DKYA 4P55A 4RB2C 3CCMI 4C2UA 2EIMH 1VQLI 1I1SA 3HRTA 3JW4A 4CCMA 2W82A 3F6OA 1PP7U 3CC4I 1HDDC 2CU7A 1A04A 4UVCA 1T56A 4X6AJ 1B8IA 2WAQN 3GBGA 3LA7A 1MJBA 4ASNA 4IHSA 4HG2A 1J09A 1Z6TA 4II2A 2ZJPF 5EEHA 3BLYA 1EA3A 4XMYA 1LKXA 2L3DA 3S16J 4P9FA 3DU6A 3MZHA 2OTLI 3K4BA 1DGRM 2M0CA 3Q0VA 4WF2A 2HYFA 3ZMDA 5HS8A 3RYRA 3A01B 4CO8A 4CSWA 2DN0A 4XKBA 4C3JJ 4Y4RA 1X1PA 2KJBA 2HYJA 3BR5A 2PJRA 5HDNA 2O7OA 3C1DA 3GZ5A 4RAZA 5F0HA 5L3GA 1X1DA 3HZJA 1VQ7I 1ZHFA 1POGA 3G6EI 2HDDA 1IN6A 4M6XA 2D45A 1W1WE 1W0TA 2JA2A 2DTRA 2ELJA 1BI3A 2Q2EA 4HEA2 3OIQA 3L7WA 2GWRA 1W36D 1AWCA 1HF0A 1P4AA 1W36C 2O5RA 4BL0B 3FHNA 2B9SA 4C9YA 1ETOA 2CG4A 4CYDA 2I5UA 1VQ9I 3IL2A 4KYWA 4BQOA 4RLFA 1VQ4I 5KAIC 1BW6A 2VASA 2IW5A 3C18A 4IPAA 4Y15A 1R5ID 1YRNA 4K2EA 1RZ4A 2EH3A 4HF0A 3R4KA 1K61A 3BQZA 3HKZN 3CJNA 1TNTA 3T5XA 1ACIA 2DTZA 3IC7A 1MSFC 4R8HA 3RQ4A 3LAPA 2XSDC 3CCRI 4E7LA 1FWZA 2WB1N 2BVLA 2I8DA 4KN7X 4BACA 1TTYA 5FLVA 1YE9A 4NC7A 2MW8A 1X1CA 2LR8A 1G3WA 1F43A 2ME6A 4ZZDA 1RUOA 1IRXA 3BDDA 4F52A 3PFIA 3A2KA 2ZXJA 4G7ZF 1HKSA 4L9VA 1H9GA 1BR2A 5LD2C 1ZLJA 1JT6A 3BR0A 2K9QA 5CQGA 2EZIA 4IHXA 1Y8QB 5HS7A 3HSEA 1S29A 1DP7P 1O7FA 4HF1A 3HGGA 1GXPA 5LGUA 1IC8A 2XGCA 1MIJA 1J75A 2CV0A 5CJ9A 4IO9F 2R3SA 4KIFA 2DA4A 1W0UA 3TL4X 2L7MP 2EINH 1WI9A 1SAXA 4V2GA 1VI0A 2K40A 3IHUA 2EBIA 4BHCA 2HFHA 3S1QJ 3GEZA 4LJZF 1T08B 5GADJ 2CO5A 2JVGA 2R5YB 2B63J 5DTDA 2DA6A 3MMYB 3KCCA 3SFZA 2E1OA 2EFWA 2GZWA 4MEYF 4NNJA 2EFQA 2VBZA 4BY1J 5AIPA 1KU7A 3HOXJ 4MIMA 2DT5A 4ON0A 4XK4A 4U7DA 4ENMA 2QZ8A 1IAWA 1YQAA 4MQ9F 1DP3A 2MC4A 1LDDA 3W6VA 4M9ZA 3AG2H 1IRFA 1K78A 4P96A 2HVSA 4KDPA 2BY1A 2LDUA 2Q8KA 1Z1DA 2VL8A 1ZRDA 3NQOA 3L2QA 3TOAA 5C44J 3DTIA 2CQ7A 4XBFA 3LSJA 2CWEA 2DO7A 1KU9A 3ZRGA 1YS7A 4KISA 2RV8A 4ZH4F 5BPIA 3H35A 1WJBA 4B8XA 3HRUA 2M1BA 4HDVA 4HRIA 5HVQC 2EA4A 1Z05A 1X3ZB 3FK6A 1IGNA 2BV6A 1DUXC 2H8RA 2ICWG 4AWXB 3S3MA 2VQCA 4NC6A 1A36A 2ZBKA 3SJMA 2A07F 1BI0A 4O5VA 1HKTA 1IG7A 4A3IJ 4DZJA 4PJMA 2L9VA 2M5WA 5BNGA 3I59B 5IT9Z 1D5VA 3TKYA 2F5FA 1H9TA 4PFOA 2XF6A 2XUBA 3KYLA 1PUFA 5E18F 4FISA 1C0WA 4ESFA 1HBXG 3GFLA 1O3SA 3DCFA 3GWZA 5EZHA 4EMSA 2NNYA 2E2JJ 2CUEA 3GXOA 1ZAOA 1XMKA 5L3EA 4CICA 2GXAA 1XN7A 3UKGA 1JGGA 3H9QA 3EQLF 3OOPA 4UVAA 1KZHA 1YFHA 1BOBA 1E0EA 4HOBA 5J3LA 1ZH5A 1G3YA 4KIGA 4EEFG 1DGWY 1JHFA 3SQNA 5LBQA 3S1RJ 2CGPA 1E17A 3KYDB 2K9NA 3W2VA 4OAZA 4ENKA 1I50J 4XLAA 1ONVA 1V5GA 5GPCA 2DFHA 3HOZJ 2E1NA 2WV1A 2X6XA 2X6WA 2X6YA 4P9UA 3NWSA 3GFIA 4A69C 3I0TA 2M8EA 2M7BA 2ESNA 2L54A 4A5NA 2G7UA 3I58A 1J2XA 5GAEJ 2ELKA 2CV1A 1D8JA 5EF6A 1YX3A 1A31A 2LF8A 2P0WA 2OZUA 3CJTB 1P7IA 4RGRA 2HPMA 3A02A 2QSHX 4ZDOA 2XB5A 3COAC 4F92B 3Q0WA 1WQ2A 1MDMB 1I39A 2VBWA 4ZTJA 1GUUA 3H5AA 3CJRB 5IOYA 1AHDP 1ETQA 4EM1A 2Z5UA 4MO7A 3OYGA 5LRSA 2F48A 2O9LA 2IA2A 2VODA 2XHKA 4FETA 3ROUA 2K9SA 2LREA 1Z0XA 2R7VA 2X6OA 4LIVA 5D5UB 2IS2A 3CO6C 1KU3A 5DD8A 4AIJA 1G3TA 2M9HA 3P9IA 5FKNA 3JRGA 2YX7A 2CFXA 1KA8A 2DMQA 2DDAA 4MFDA 3RDIA 1S7AA 5C3EJ 1JKQC 1U0JA 2V1XA 1WJFA 1MD0A 2DYRH 2WV0A 3RKWA 1IV6A 4I02A 1UMQA 2IGKA 3H9GA 3F0CA 4Y7NJ 1OISA 2NVTJ 1B9MA 4YIIA 3AFHA 3DTKA 4G12A 2FOKA 4R79A 1WCMJ 4XOTA 3WHCA 1WWXA 1L3LA 4YRVA 1X4OA 4AM3A 4BE1A 3ZCOA 4HPQA 4PJNA 4BS9A 2LFBA 1XX5A 1AU7A 3R0AA 4M3EA 3V42A 1I5ZA 2GA2A 2ISYA 1IJWC 3U1DA 1MBJA 3HM5A 1YX5A 2DK5A 3LFKA 2Z16A 5L3DA 1JXSA 3OV8A 5GAGJ 1UHMA 1R71A 1LEAA 2GOXB 3TOBA 4OWRB 4D0PA 4FX0A 3T1BA 1ZREA 4HLXA 1G2HA 5DM7F 3RZDJ 5J40A 2ESHA 2R7OA 1QGPA 4IL6C 4CCLA 4XLEA 4C2MJ 3V8KA 1EH6A 3V7CA 3DPLC 4MHGA 5CYVA 1D1AA 2CQNA 1WJAA 1ZG5A 2CW0F 3TDZC 2HR3A 3HEFA 4L0YB 5E1XA 2MABA 2K3FA 3S3OA 1I3QJ 4W1UA 2BGCA 3H0GJ 3ASNH 5A2QK 2FBKA 5M5WJ 4CZZA 1YI2I 3J7AY 5E8GA 1RI7A 2E7XA 1S8NA 1USSA 1ZKGA 1Y39A 4HNTA 2OPTA 4RLQA 3HB9A 4DOZA 1R49A 4QTRA 5GAHJ 1SD7A 3DFGA 2LYCA 1J9IA 2PJPA 2BHYA 5J1UA 1V4RA 4KA4A 2EK5A 4LG0A 4AIHA 4EJWA 2IP2A 2XGDA 3X2QH 4E6KG 4XN3A 3NRVA 4B1RA 3CMYA 1ZQ3P 3FXJA 3HHGA 2RQQA 4F93B 2JUCA 1IUYA 3S2DJ 4QPOA 4ZDPA 4BJ6C 2EPFA 2IJLA 5TRDA 5IYDJ 5HLIA 1IXCA 4UUVA 3IWFA 3BWGA 3FXKA 2KFDA 4XM3A 5CVUA 3ECHA 3OIPA 4N0BA 2JT1A 3QU6A 4CCKA 1FMVA 2STTA 4HBLA 3SXYA 1I1GA 1T39A 3CQZJ 3S1NJ 2E60A 3DKWA 1B6AA 3ERED 1QQIA 3DBLB 3TDUC 4O6JA 4D5CA 1JKOC 4ZC3A 1SEUA 2E35A 3ISPA 3AL0C 3PO3J 2QQ9A 4OIOF 4MNUA 2LK2A 1Z7LA 1E2XA 4CUGA 1V3FA 1U6GA 4Q47A 2VE9A 3QRFF 3HYIA 1J7KA 1CGPA 4RB1A 2UXXA 2MBFA 1D1CA 4IHYA 4WXDA 3S2HJ 4QLCU 5J6XA 1R5GA 4JK1X 5K1YA 3HKZA 2CRGA 3E6CC 2BHZA 3E6MA 3GZNB 4A3KJ 2DPDA 1O7LA 3O8GA 1YW8A 3I5UA 3VYSB 5KHDA 2KRFA 4CXFA 1P92A 4HV6A 3CMEI 2BXZA 4UV8A 3MD2A 3I4PA 5LEKA 3ABKH 1R1UA 4XRMA 2A3SA 1YS6A 2L2OA 2TDXA 1VNDA 3S8PA 2DOEA 2E1CA 1BI1A 4XONA 4Y52J 1MW7A 1XGNA 2K5CA 5LRRA 4LG3A 9ANTA 2VPLA 3G71I 2NVUB 5F04A 2LBFA 1F4KA 1FY7A 2A05A 3MKYB 1WH7A 1STZA 2DBBA 5ERIA 5HLGA 2V9VA 2W85A 4HLYA 2R5ZA 1ULYA 3QPTA 4PJLA 3ELKA 3IKTA 3BOQA 4WK8F 2FQ4A 3BT9A 3OS0A 1DU0A 1TWFJ 3M8FA 3JRIA 3JRCA 2AQEA 4NC8A 1XCVA 2IS1A 2DT7B 5EG0B 5TJJA 3TO9A 5H2FC 4MQVA 4WXHA 1R36A 2FXAA 2ZC2A 4PDKA 4RMNA 4B3AA 5J8FA 3GTQJ 3VSKA 3B02A 2JN6A 3HOWJ 4ABZA 2VJ4A 2UWMA 5AONA 1VQOI 3MKLA 2HU9A 5DCMB 1UJ8A 5IPAA 1DU6A 4KN4X 1VZ0A 4E70A 1RIOH 1V54H 3E1SA 3TMOA 2MH9A 2OU2A 2ELHA 3JTHA 1ETWA 2O3FA 1QVTA 3ONQA 4KICA 3IAS2 2CW7A 3SEQA 2XKPA 1B4AA 2A68F 1CF7A 2JRTA 2V9KA 3E6BA 5D8KB 3WU0A 1MJ9A 1F5TA 3QAHA 1XGMA 2JQ7A 2CV2A 4ANJA 4EQQA 1JI8A 4M71A 2D2WA 3M1EA 4UHTA 4LK0F 1OYYA 2XKOA 3HSFA 4B4CA 2YSRA 2VKHA 3DEEA 5EG0A 4XLNF 3ZQCA 1BL0A 5JHUA 1DPRA 2M2EA 4IEJA 2DMUA 3HRSA 1O4XA 2F4OB 1ETYA 3KE2A 2UXNA 5CQEA 2LKXA 5KCMA 3DBHB 2R7DA 3P9KA 2ECBA 5EEAA 4WCGA 1NTCA 1XD7A 2IGMA 4KMUX 1Z9CA 3HUGA 2HNHA 2QA4I 3WG7H 4L9TA 4PFPA 1KYZA 3M9AA 1LVAA 2VC1A 2R7QA 4CCJA 2A5YB 3W3CA 1R22A 4IHTA 3RPQA 3F8MA 4XLCA 5K5RA 3HIFA 2PMZA 4G6DA 4RGXA 2IS6A 2WC2A 2L0KA 1B8IB 2NS0A 3L2UA 1IN8A 2QWWA 4EGZA 3MAJA 3I53A 2PN6A 2JJ7A 3ZQQA 1KQ9A 1JJ8C 3TGNA 2R93J 1PDNC 2VI6A 3KIOA 3BTIA 2V4JC 4EJOA 1H89C 1TW2A 2EZLA 3HOTA 3K9TA 4Q48A 2VKDA 3E5QA 3O2PE 5FROA 3E97A 2KL4A 3K4KA 4JYKA 4Y17A 3P9CA 2LTPA 2PJRB 4D7NA 2HEOA 1X1AA 5CVJA 5B1BH 3O8HA 3TO7A 1RETA 2KZGA 1WI3A 3P5JA 2R7ZJ 2L4AA 1M1EB 4UVBA 2FA5A 4E7KA 1D1BA 2DW4A 2GM4A 4EVIA 3OMYA 2Q2EB 1T33A 5DEQA 1AKHA 2VBYA 3CUQA 5ILSA 4C3HJ 3VDXA 2MSYA 1ETVA 1FEXA 3MQ0A 2CQXA 2XAUA 1G4DA 2CQKA 1JKRC 3HGYA 5IYCJ 2H8WA 3GTKJ 3OYIA 3SFIA 3KP4A 3KZYA 1O3RA 3C2HA 2ADUA 3LL7A 1YRNB 2FF4A 1BC7C 4BUPA 5KAFC 5F6FA 5LGNA 2E36A 2VXDA 4IRIA 5HDKA 3L09A 2QSFX 4PJJA 3VPRA 4B44A 3H92A 3G73A 4RGUA 1XC5A 5BS6A 2FUG2 3DXJF 3WU2C 1QO0D 3EUHA 3G1OA 1FYKA 2HPIA 1SD5A 3VYRB 5LFAA 2DMTA 4I01A 5F0CA 4RAYA 1SVMA 1DQUA 4NB5A 1S7OA 4CDGA 1W5SA 4XKVA 5CLSA 4AUXA 5CVIA 3KETA 2Z2SB 3ZR8X 3I55I 2Z33A 2W48A 2MD0A 4ETSA 1FYMA 3NEUA 1BOAA 5HNHA 1FSHA 3LQQA 5J1RA 3JCUC 2P7VB 4ITVA 4XSXF 3TW6A 3CCYA 1KYWA 2XC7A 1BJZA 1Z91A 2FRHA 4G6QA 5E1WA 2O8XA 3CDHA 3L2VA 1O3QA 3CF5F 3HC7A 4A3EJ 3QQAA 1O57A 5K5OA 4DW6A 4RAGA 3N97A 3QPHA 3A0BC 3EYIA 2CSOA 2RQPA 3AL0B 1S7EA 2HZTA 3DEWA 1JE8A 3FISA 2X51A 1EKEA 2BW3A 4HW0A 4KIBA 3HPGA 3GYHX 4X1EA 3BP8A 2XASA 4XLFA 2F4MB 1P9QC 2KIFA 3W6KB 3BG9A 3CO7C 3AG1H 3D5LA 2M87A 4MLOA 4P5OA 2CYYA 3TW7A 4XRFA 1RNLA 2CJJA 3FZVA 2O8KA 1ETXA 1IRZA 1IN5A 2GBYA 3I4MJ 3LSTA 3OS1A 2QQ8A 3G2BA 2XAQA 1FYLA 1MSEC 4BQAA 2B7EA 2V6EA 2W4SA 1FPQA 2RNJA 4DQ2A 3KYCB 3FBNB 2LKSA 1HSJA 2XAHA 2A6EF 4BXFA 1K78B 4F7ZA 5FFZA 5JVGF 1XGOA 2ZCWA 4A12A 1FP2A 2FE3A 3ZMZA 3RKQA 4D7MA 1U78A 4S04A 3N05A 4A3MJ 3PNYA 2DA5A 2HOTA 3HOYJ 3FBIB 3HL2A 2R7FA 4Y3OA 2OCEA 3QPSA 2QBYA 3REOA 4Q4ZF 3JRHA 5FKMA 1LB2A 2EB7A 4N4NB 1ZARA 1GT0C 3OYEA 2D1VA 3ASOH 3M3YJ 2UZKA 1LE8A 2WWYA 4H0EA 5D4SA 2K4JA 1IUFA 4HF2A 2KT0A 1IXSB 2NRAC 4DJAA 3H0DA 2AS5F 1SVOA 2EIJH 3KX2A 3PUFA 3LMMA 1PP8F 3BC8A 4YEJA 4ESJA 1YITI 2DMNA 3GTMJ 2Z1DA 1GVDA 1XCBA 3OYFA 1PUFB 2VOPA 2DOAA 4ZZLA 1ZGWA 1S5LC 3KLOA 1ERDA 1MNEA 1SMYF 3GVAA 5LGTA 5ICGA 4UB6C 4BEHA 4BXXJ 2F5CA 2G0EA 3K1NA 4U87A 2Y0SN 3WE2A 5IY5H 3LSRA 4A0XA 1SD6A 4CYCA 4WX9A 4MGRA 2VJ5A 5FKOA 2H27A 1OKRA 2HDCA 3TBIA 2IS4A 3DF8A 2DQRA 1W5TA 3BTLA 1FBQA 1Y0NA 3A1YA 2LY2A 3W2AA 3GTPJ 1LQ1A 3CF2A 5FJ8J 4HV5A 5FO5A 1YG2A 4I7HA 2YPRA 1Z3YA 3IH3A 4ZDLA 4U7BA 1TW3A 2XPUA 1WRJA 3ZQLA 1FOXA 2IA0A 1MNMC 2HOAA 3FXMA 5LEJA 5FLXZ 3ZP5A 2NOGA 3IV5A 4RBOA 5E3LA 2MC3A 2XRLA 5ICCA 3D5SC 3EPZA 1EF4A 2O0YA 2K7LA 1O3TA 2FU4A 2L5QA 2HOEA 1E3HA 3DEUA 3MN2A 5IP7J 1U8RA 1JUPA 3VB2A 1Z3XA 1GDTA 3K6GA 2LMDA 3DV8A 4IKFA 4I0BA 2WA0A 3QP5A 2V7FA 3FHZA 2X0LA 1LFBA 3WTUC 3OR1C 1X19A 2IA1A 1PUEE 2MG4A 3OYLA 3BJAA 2W00A 5EJCA 3FMQA 1WFXA 2YU9J 3CMAI 3LA2A 3LAJA 4RM2A 5EDNA 1U2WA 4FCYA 1RR7A 1ZN2A 2V79A 1F36A 3OYJA 3DTEA 3HBLA 1VQ6I 2KJCA 4DNCA 4Z2YA 4EJVA 2CUJA 3KP2A 2DA1A 2QM3A 1NG7A 2VKEA 3SHFA 2P81A 3K4JA 4PK4A 2QLZA 2KISA 5IP9J 5D6EA 4XL9A 1IDZA 1TZLA 2WAEA 4LK1F 3HG9A 4BH9A 1TWHJ 1NK3P 3CCSI 4HDUA 5FLXK 2LC2A 4L5JA 4BGDA 5B3SH 2FBHA 2MLKA 3GLXA 3O3KA 3QYBA 5F1RA 2GLOA 2OCCH 4DBQA 3CLOA 1WZ2A 3M1CA 4M3DA 3F72A 4XORA 3RIRA 5E17F 5IT9K 1RKWA 3WTVC 2P6TA 4XOPA 5D5VB 1T8IA 1CQTA 3ESWB 1SANA 3OL4A 4KJZA 1OCZH 2VE8A 3F23A 3ECOA 2P5LC 2XPWA 1XMAA 3BTJA 4AYBN 1APLC 1KQ8A 3PQJA 2E19A 1S3JA 4ZJZA 4LFUA 3E7LA 1OCPA 1XSDA 1QZZA 4LGWA 4U0YA 4YIFA 1ZGJA 2BZTA 4GCVA 2LLKA 2IVMA 1R4MB 4D9JA 1N77A 2PEXA 1Y1WJ 4F3QA 3JRBA 4XSZF 3HOVJ 2O61A 5F1JA 1R7JA 1HQCA 2H1KA 2DFIA 1T2KA 1X1BA 3CUQC 1S72I 1W7PD 2VIXA 3LOCA 1HW2A 4IOCF 1XGSA 2M30A 2VOOA 1NHAA 4CHUA 3T8RA 3PSFA 3KEOA 2OZ6A 3LSIA 4BNCA 3R6SA 1SFEA 4OU0A 2AQFA 4PJ0C 3VYUB 5ICEA 4XIDA 1K83J 4BE0A 4ZYHA 1NK2P 3VWBA 3DLAA 3ZMTA 3F8NA 5FKKA 4A5MA 2BY2A 3Q9VA 4LG0B 2DFFA 3EUHC 3VYTB 3KEYA 5E1ZB 5F08A 3RPUA 2IGOA 4JX6A 3BZCA 4H4KC 3IRQA 2PMUA 1B72A 2RREA 2JPBA 1J5YA 3SYTA 3HDDA 1OFCX 3EDPA 1KQ0A 4GO1A 2L7KA 2DXIA 2TCTA 2FX0A 2HTJA 4HNVA 2L7ZA 2EZKA 2OUMA 2LNBA 2CMPA 2YU3A 3MKWB 3V4GA 2R7SA 2BOLA 1SFKA 2DK8A 1QZEA 1YW7A 4LB5A 2OQGA 2VB6A 2P7CB 2C6YA 3L00A 2WAQA 3K10A 1WVRA 2ZO4A 3NAUA 2Y9ZA 3CESA 4WXCA 1BJAA 3CMMA 1GLNA 2ZXHA 2A5WA 1FOWA 3JRFA 3ZQIA 1XDSA 3H9JA 1MMDA 2XGXA 2PFBA 1R58A 1IXRC 4RB0A 1G3SA 3F6VA 1MBGA 2EILH 2EFPA 3FXUA 4PSXA 3QWLA 4NQWA 2COMA 1K6YA 1HW5A 3VFZA 4BAYA 1YYVA 2K85A 2A69F 3TQNA 2X85A 5FRMA 5B5EC 3FXQA 2DPUA 2HVRA 1GV5A 3HPHA 4LB6B 3T0YA 1OR7C 1YJWI 3JSPA 1Q1HA 4N9IA 4RS8A 1MKMA 4DYQA 5HLTA 1W4MA 3QODA 4ZYDA 1MH3A 2XF5A 4BJ5C 2EV0A 3I56I 1I6HJ 4UB8C 5TISC 2X1CA 1H8AC 2LBFB 2DT6A 4HSTA 2CUZA 3ZN1A 2ZJQF 1IO2A 3BPXA 3GF2A 3BCAA 1FJLA 2BXYA 4M3BA 1I27A 3H3ZA 4KMFA 2VLAA 3V7RA 3SZGA 1VQ5I 2R5ZB 5CVVA 3K1MA 1MMAA 3MFKA 3PFYA 4XKCA 4MFEA 1WKMA 2PG4A 4GDFA 1QA6A 2EQRA 1LDJA 1FT9A 3ML6A 3RCOA 3TO6A 2W57A 2AO9A 2MA3A 2KDZA 2QQAA 3ZMSA 1EV7A 2X48A 2WB1A 1Y1VJ 2KHMA 1K4TA 4UNOA 5FRNA 1HKQA 3GLLA 4GRIA 2GA1A 3WHBA 4CCNA 5DDGA 3M8JA 3D0SA 2EFNA 3E6DA 4LOCA 1FTZA 3ZN0A 4IZZA 4II3A 2QUFA 5L3CA 2XSJC 2M4GA 4A93J 3RJPA 1QZYA 1YOVB 2R7XA 1F1ZA 4AIKA 2VT3A 1WSUA 3IH4A 4V19K 1ZGAA 1TP4A 3K4CA 1CF7B 5CPRB 4PSWA 2WAFA 5K5QA 2ECCA 5B66C 4MEXF 3BG5A 1OCOH 1JUSA 2AXLA 2JZYA 1FOKA 1IRGA 3SZPA 3ZOBA 1AA7A 4E7IA 1UELB 4F55A 5GP9A 4HSRA 1B1BA 1TWAJ 3RKYA 5B1AH 4GXOA 2NYXA 3OYKA 1Y8RB 3U9GA 2HQRA 2K9LA 4KT5C 2KKOA 2QGUA 3VOEA 2XVCA 2X1DA 3F9KA 3CCUI 3ULQB 5JVTA 1XG1A 2DJIA 3KZZA 5FGMA 2HGCA 1OYIA 2HKOA 2KIMA 2V26A 1B9NA 3RZOJ 2BE5F 1SFXA 3H5RA 5J47A 4ZYGA 6PAXA 3KP3A 3HUGB 4YFKF 3H36A 3K70D 4AC0A 5FB2A 3WTSC 3K70C 1SVLA 3BR2A 4Z6YA 3K4NA 3E3VA 1UB9A 2ZJRF 2W25A 3PUBA 3KP7A 4L5EA 3KZIC 3CZ6A 5BMZA 1D8KA 1MGTA 3BZ6A 3P7NA 4A0YA 2Y0SA 3OYBA 4ZYEA 5K7FA 3WGHA 1BN5A 1I3AA 1WJEA 3J81Z 1YJ9I 3H3VK 3EUKL 2M7AA 3WTZA 4UV9A 4M72A 3WTXC 2R4GA 1USTA 2H09A 2ME0A 3B73A 4LMYA 1X58A 3R60A 3FIWA 2ZB9A 1TQIA 1T6SA 5JFRA 2XAFA 3D5RC 3FXOA 4EJTA 5EZGA 4OIPF 2NS7A 1QNTA 2L9RA 2V1DA 1FIAA 2XGEA 1TQPA 1G59A 4YFXF 1PVEA 2LG4A 4XKWA 3R61A 1BW5A 3F8FA 3I64A 2X9DA 3JRDA 4A0ZA 3ZQFA 1BR1A 1FC3A 3EETA 3OWTA 2VUMJ 1HXDA 4LD5A 2O6GE 4UUTA 2QEXI 3LSGA 2GIVA 1R1TA 2JSCA 4V2FA 4MTDA 3L2CA 1P7JA 1FBUA 3GX4X 2IEKA 4IXAA 2DA2A 2LH9A 2Q0OA 1AKHB 2Q1ZB 1RRJA 2XIGA 2DDBA 1N25A 4XN0A 2RAEA 3CUQB 3GTGJ 2DLLA 3CP2A 2H94A 2ZKZA 1JT0A 1MJAA 4ENNA 4BE2A 1MH4A 1UG0A 1X2MA 2BEOA 1OLTA 2CW8A 1ITYA 3JAMZ 2DI3A 3DP7A 3WODF 4HYEA 3J81K 3SZTA 1FTTA 4FT8A 3WGGA 3CCEI 1E3PA 3M7GA 1A6IA 4U0WA 1X2NA 3OS2A 1OCCH 4IHWA 3UNGC 2CH0A 3BJOA 4YIRX 1TT5B 1VQPI 2V9PA 2ACJA 2K27A 4XLPF 1LUJB 2PI0A 1ENHA 3DQVC 4TV7A 2GXBA 2Y9YA 3SDGA 4FX4A 2KMUA 1ETKA 2G7HA 2Y0MA 2FMLA 3QYFA 2ZMEA 3RSNA 4UUSB 2HKXA 3U2RA 4FHTA 3ABUA 5ICFA 2RC4A 2GXGA 3RPUD 4BU2A 1UHSA 1A5JA 1UCRA 3GO5A 1U5TA 3I71A 2Z9OA 1N78A 4KT6A 1BA5A 4BDYA 1XPXA 1W7PA 2LP0A 1P2FA 4A3BJ 2GQQA 2K4BA 4ENJA 1GV2A 3C7JA 3JREA 3JAMK 3CLQA 5D5WB 2UUZA 4BY7J 2BY0A 2RKHA 1V55H 3V8JA 3IUOA 2NVQJ 1G6NA 1T95A 2H6BA 2DOFA 2Y2ZA 2BW3B 2W24A 3BZKA 4KUMA 3OYAA 1EH7A 3UR3C 3OIOA 3CCQI 3OYNA 2ZNZA 3PIOF 4IHVA 1QHHD 3MZ8A 4UUSA 2XDVA 1MBKA 5F64A 1ZRFA 2E2HJ 2NOJB 2EWNA 2E1MC 2HXIA 1A6QA 4DZPA 1B59A 4JP0A 1UZCA 3FKJA 4CGZA 5EGOA 1TBXA 3M07A 3TEDA 2EA2A 2E2IJ 5DS9A 3LSKA 2CUFA 1HLVA 1TWGJ 3I3LA 4S05A 4JBAA 3BG7A 1F9NA 2F5DA 2BBYA 4AU7A 2NAZA 4HA8A 4PGHA 3OSGA 1BIAA 4I76A 4LLLA 5J4YA 2GOMA 1RC9A 2F5VA 2VPRA 3KFWX 2LKPA
chains in the Genus database with same CATH topology
1P4XA 2QBYB 1IZ1A 2MH2A 5HLHA 3HOSA 1K79A 1S6LA 3IKVA 2FNPA 2L02A 2OAZA 3BROA 1GHCA 1R1VA 3HTSB 3K2ZA 4N9HA 2M45A 3GZ6A 3MWMA 5H20A 5DUIA 1K6OA 5HDGA 1BIBA 1JGSA 3CTAA 5KK1A 1OR7A 2HTSA 1BC8C 5DUKA 3RI4A 4M6YA 3K1PA 4OMYA 1OPCA 5FD5A 4BYYA 3MEXA 1TLHB 1T0FA 2Y75A 2OD5A 4M73A 4OIQF 4EM2A 1Z7UA 4EJUA 2ZFWA 1I6XA 3C3WA 4GYIA 1U3EM 2RN7A 4MTEA 5DCFA 3F21A 2HQNA 1GVJA 3HRMA 2J5OA 2FQ3A 1IW7F 3O6BB 2EV6A 4HQEA 2IT0A 1T98A 1Z6RA 3J80Z 4KFCA 1ZG3A 2L01A 1T38A 5H6RA 5HOOA 4I98B 1Y0UA 4ESBA 2VN2A 4YFNF 2W84A 1L0OC 2VT2A 5L3FA 3GFMA 3T8TA 1IN7A 2ISZA 2RVCA 5CVRA 4OMZA 3J7AO 2V1UA 2L4MA 2RDPA 2K02A 3E5UA 3FM5A 1LJ9A 4GGGA 2OA4A 5E8IA 4IVNA 1KU2A 3MCZA 3LQRA 1FNNA 1P6RA 3KP6A 1GXQA 2G9WA 3J80K 3S2WA 1QPMA 2A6HF 4U0VA 4BXUA 4WWCA 2EV5A 4L9JA 2DU9A 3RTRA 4Y13A 2A61A 2STWA 1MZBA 1AOYA 4A2UA 1IN4A 4LLGF 4HX8A 3ABTA 4EM0B 1ON1A 3I59A 5ILUA 1ZLKA 4L18B 3W6JB 5BQTA 1BBYA 3FMRA 2H6CA 5DV5A 4HX7A 3ZPLA 5JR3A 1R00A 2QVOA 4IRGA 1HW1A 1U5TC 4I09A 4RGSA 3WTTC 3RKXA 1VTNC 2P5VA 1TNSA 3L9FA 4I2OA 1X3UA 4HX4A 5A2QZ 1XSXA 3LWFA 5HS9A 3BPVA 4IF4A 5D8LB 4G8XA 2YR2A 1MDMA 2FSWA 2V6CA 3EYYA 1IF1A 4L0ZB 3GW2A 3WU1B 3E5XA 5D6FA 3CUOA 2B0LA 1YW9A 5BPDA 2KIUA 3FM3A 1D3YA 1ODDA 2F2EA 4EV0A 1OMIA 3V8LA 4L5IA 1ZG1A 4KNYA 1FZPB 4M74A 2FBIA 1HSTA 1K7AA 1R23A 2QQBA 1FP1D 2VONA 2XROA 2ZJ2A 4I0AA 4G7HF 2Z99A 1UFMA 5LHIA 4O3MA 2FMYA 4G9YA 5DD4A 3VODA 1QBJA 2D1HA 5AIQA 2J5PA 1SD4A 2VC0A 5D5XB 3WTWC 4EGYA 3Q5FA 3GFJA 1SMTA 5LHHA 2O03A 3F8BA 3K69A 2NNNA 3IRRA 5DYMA 5ILVA 1XB4A 5J8CA 3F22A 2QENA 2VXZA 1FLIA 2IPQX 4YG2F 1FX7A 4IRHA 4G7OF 2BYVE 2P6SA 4PZJA 2JTVA 3R0JA 1BM9A 4HQMA 2FNAA 3KEQA 3K0LA 3JTGA 5KVRA 3WE3A 1TQMA 2OBPA 5LHGA 1YIOA 3F3XA 3PQKA 4U88A 4IJAA 1YO5C 2PBIA 2ZNYA 3BJ6A 3IWZA 5L3BA 4PGGA 1J0RA 1KGSA 2GAUA 4GYGA 3JSOA 2FEZA 1LNWA 3G3ZA 2YX4A 5H6QA 2P8TA 4JQFA 2IRFG 1SFUA 3DPTA 1DDNA 5JI6A 2MLGA 5FFXA 3WTYC 4HZFA 2RGVA 2X4HA 3LA3A 1H0MA 3FF5A 2XAJA 3QP6A 2K86A 5FD6A 2LSOA 2EFOA 3BY6A 3Q9SA 3ZMVA 4QWQA 4NHJA 2PQ8A 4R1HA 1REPC 1RUNA 1ZRCA 1YTYA 2QYOA 1LDKB 4RB3C 2MD5A 2P4WA 2DAOA 1ON2A 4G94A 4OIRF 3VEPA 2PLYA 4LLNA 2PMHA 1JHHA 1FBSA 3N4MA 3F8CA 2E7WA 4UXNA 2P5KA 1OYWA 3H3UA 3V7SA 4HAMA 1R5HA 2HS5A 5D4RA 3HHHA 2ZMEB 4B09A 2Y48A 2XRNA 1XDUA 4A6EA 3KP5A 2HWVA 4BHBA 5LLQA 3WGIA 1LEBA 2XV4S 1BI2A 3ZQ7A 5BOXA 5DCMA 1U5TB 3M8EA 3AAFA 4OINF 1YLFA 2JPCA 3FX3A 1W7PB 4Q5SF 4M9XA 1EH8A 3HTUA 1UHWA 3FWEA 5ED4A 3WG9A 2WTEA 1P4WA 5E20A 1ZYRF 2DQLA 2OQRA 4M9SA 2XAGA 4BHPA 3HSRA 4OOIA 2VBXA 3KLNA 4A6DA 1XSVA 1DPUA 3FMSA 5EEGA 3MZYA 3QU3A 4L9NA 2ETHA 5IT3A 3ZMUA 3GUDA 4AVPA 1J59A 2EJRA 1FSEA 4PCQA 2LF7A 3I54A 2Z3YA 2F5EA 3QOPA 2HYGD 3RYPA 4AD9A 3FXRA 4P55A 4RB2C 1I1SA 3HRTA 3JW4A 1PP7U 3F6OA 1A04A 4UVCA 1E17A 3LA7A 4ASNA 1MJBA 4IHSA 1Z6TA 5EEHA 2L3DA 4P9FA 3MZHA 4WF2A 2HYFA 3ZMDA 5HS8A 3RYRA 4CO8A 2KJBA 5HDNA 3C1DA 3GZ5A 4RAZA 5L3GA 1ZHFA 1IN6A 4M6XA 2D45A 2DTRA 2Q2EA 1BI3A 3L7WA 2GWRA 1AWCA 1P4AA 2CG4A 4CYDA 3IL2A 4KYWA 2IW5A 3C18A 4IPAA 4Y15A 4K2EA 1RZ4A 4HF0A 3R4KA 3CJNA 1TNTA 3T5XA 3IC7A 4R8HA 3LAPA 1FWZA 4KN7X 1TTYA 1G3WA 4ZZDA 1RUOA 3BDDA 3PFIA 2ZXJA 4G7ZF 1HKSA 4L9VA 1H9GA 1ZLJA 5HS7A 3HSEA 1S29A 1DP7P 1O7FA 4HF1A 1GXPA 5LGUA 1J75A 5CJ9A 2R3SA 4KIFA 1WI9A 1SAXA 3IHUA 4BHCA 2HFHA 3GEZA 4LJZF 2CO5A 3KCCA 3SFZA 2EFWA 2GZWA 4MEYF 2EFQA 2VBZA 5AIPA 1KU7A 2DT5A 4ON0A 4U7DA 4ENMA 2QZ8A 1IAWA 1YQAA 4MQ9F 1LDDA 4M9ZA 1K78A 1IRFA 4P96A 4KDPA 2LDUA 2Q8KA 1Z1DA 1ZRDA 3NQOA 3TOAA 4XBFA 2CWEA 2DO7A 1KU9A 1YS7A 2RV8A 4ZH4F 5BPIA 4B8XA 3HRUA 2M1BA 4HDVA 5HVQC 2EA4A 1Z05A 2BV6A 1DUXC 4AWXB 2ZBKA 2A07F 1BI0A 4O5VA 1HKTA 2M5WA 3I59B 5IT9Z 1D5VA 3TKYA 2F5FA 1H9TA 2XUBA 5E18F 1C0WA 4ESFA 1HBXG 3GFLA 1O3SA 3GWZA 4EMSA 2NNYA 3GXOA 1ZAOA 1XMKA 5L3EA 4CICA 1XN7A 3EQLF 3OOPA 4UVAA 1YFHA 4HOBA 1ZH5A 1G3YA 4KIGA 1JHFA 3SQNA 5LBQA 2CGPA 4ENKA 1ONVA 2E1NA 4P9UA 3GFIA 3I0TA 2M8EA 2ESNA 4A5NA 2L54A 2G7UA 3I58A 1J2XA 1D8JA 2LF8A 2OZUA 4RGRA 3COAC 1WQ2A 1MDMB 2VBWA 4EM1A 2Z5UA 5LRSA 2IA2A 2VODA 2XHKA 3ROUA 5D5UB 3CO6C 1KU3A 5DD8A 4AIJA 1G3TA 3P9IA 2YX7A 2CFXA 1KA8A 3RDIA 1S7AA 2V1XA 1MD0A 2WV0A 3RKWA 4I02A 1B9MA 4YIIA 4R79A 2FOKA 1WWXA 1L3LA 3R0AA 1I5ZA 2GA2A 2ISYA 3U1DA 2DK5A 3LFKA 5L3DA 1JXSA 3OV8A 1UHMA 1LEAA 3TOBA 4D0PA 4FX0A 3T1BA 1ZREA 4HLXA 2ESHA 1QGPA 3V8KA 1EH6A 3V7CA 3DPLC 4MHGA 5CYVA 1ZG5A 2CW0F 3TDZC 2HR3A 4L0YB 5E1XA 5A2QK 2BGCA 2FBKA 4CZZA 5E8GA 1RI7A 2E7XA 1S8NA 1USSA 1SD7A 3DFGA 1J9IA 2PJPA 1V4RA 4KA4A 2EK5A 4AIHA 4LG0A 4EJWA 2IP2A 3NRVA 3HHGA 1IUYA 2IJLA 5TRDA 5HLIA 1IXCA 4UUVA 3IWFA 3BWGA 5CVUA 3ECHA 4N0BA 2JT1A 3QU6A 2STTA 4HBLA 3SXYA 1I1GA 1T39A 3DKWA 1B6AA 3ERED 1QQIA 3TDUC 4O6JA 3ISPA 2QQ9A 4OIOF 4MNUA 1E2XA 1V3FA 1U6GA 4Q47A 2VE9A 3QRFF 3HYIA 1J7KA 1CGPA 4RB1A 2UXXA 2MBFA 4WXDA 4QLCU 5J6XA 1R5GA 4JK1X 5K1YA 3E6CC 3E6MA 2DPDA 1O7LA 1YW8A 3I5UA 2KRFA 4CXFA 1P92A 4HV6A 4UV8A 3I4PA 5LEKA 1R1UA 2A3SA 1YS6A 2TDXA 2E1CA 1BI1A 5LRRA 1XGNA 1F4KA 1FY7A 1STZA 2DBBA 5ERIA 5HLGA 2V9VA 2W85A 4HLYA 1ULYA 3QPTA 3ELKA 3IKTA 3BOQA 4WK8F 3M8FA 1XCVA 5TJJA 3TO9A 4MQVA 4WXHA 1R36A 2FXAA 4PDKA 5J8FA 3B02A 2UWMA 5AONA 5DCMB 4KN4X 1RIOH 4E70A 2MH9A 2OU2A 2ELHA 3JTHA 2O3FA 4KICA 2XKPA 1B4AA 2A68F 1CF7A 2JRTA 3E6BA 5D8KB 3WU0A 1MJ9A 1F5TA 3QAHA 1XGMA 4EQQA 4M71A 2D2WA 3M1EA 4UHTA 4LK0F 1OYYA 2XKOA 3HSFA 2YSRA 4XLNF 5JHUA 1DPRA 3HRSA 3KE2A 2UXNA 3P9KA 2R7DA 4WCGA 1XD7A 4KMUX 1Z9CA 3HUGA 4L9TA 1KYZA 3M9AA 1LVAA 2VC1A 2A5YB 1R22A 4IHTA 3RPQA 3F8MA 5K5RA 3HIFA 4G6DA 4RGXA 2WC2A 2NS0A 1IN8A 2QWWA 4EGZA 3MAJA 3I53A 2PN6A 1KQ9A 3TGNA 1PDNC 4EJOA 1TW2A 3HOTA 3K9TA 4Q48A 3E5QA 3O2PE 3E97A 4Y17A 3P9CA 2HEOA 5CVJA 3TO7A 2L4AA 4UVBA 2FA5A 2DW4A 4EVIA 5DEQA 2VBYA 3CUQA 5ILSA 3MQ0A 1G4DA 2CQKA 3KP4A 3KZYA 1O3RA 2ADUA 2FF4A 1BC7C 5F6FA 5LGNA 4IRIA 5HDKA 3L09A 3G73A 3H92A 4RGUA 5BS6A 3DXJF 1QO0D 3EUHA 1FYKA 1SD5A 4I01A 4RAYA 4NB5A 1S7OA 4CDGA 1W5SA 5CLSA 5CVIA 3KETA 2Z33A 4ETSA 1FYMA 3NEUA 1BOAA 1FSHA 3LQQA 2P7VB 4XSXF 1KYWA 2FRHA 1Z91A 4G6QA 5E1WA 2O8XA 3CDHA 1O3QA 1O57A 5K5OA 3N97A 3QPHA 3EYIA 2CSOA 2RQPA 2HZTA 1JE8A 4HW0A 4KIBA 3GYHX 3BP8A 2XASA 2KIFA 3W6KB 3CO7C 2M87A 3D5LA 4P5OA 2CYYA 4XRFA 1RNLA 3FZVA 1IN5A 3LSTA 2XAQA 1FYLA 4BQAA 1FPQA 2RNJA 4DQ2A 1HSJA 2XAHA 2A6EF 1K78B 4F7ZA 5FFZA 1XGOA 2ZCWA 4A12A 1FP2A 2FE3A 3ZMZA 1U78A 4S04A 2R7FA 2QBYA 3REOA 4Q4ZF 1LB2A 2EB7A 1ZARA 2D1VA 2UZKA 2WWYA 4H0EA 5D4SA 2K4JA 4HF2A 1IXSB 2NRAC 2AS5F 1PP8F 4ESJA 1XCBA 2VOPA 4ZZLA 3KLOA 1SMYF 3GVAA 5LGTA 5ICGA 2F5CA 3WE2A 3K1NA 4A0XA 1SD6A 4WX9A 4MGRA 2H27A 1OKRA 2HDCA 3DF8A 2DQRA 1W5TA 1FBQA 1LQ1A 4HV5A 5FO5A 1YG2A 4I7HA 2YPRA 4U7BA 1TW3A 1WRJA 2IA0A 5LEJA 5FLXZ 3ZP5A 2MC3A 5ICCA 2O0YA 2K7LA 1O3TA 2FU4A 3DEUA 2HOEA 1U8RA 3VB2A 3DV8A 4I0BA 3QP5A 3FHZA 2X0LA 3WTUC 2IA1A 1PUEE 3BJAA 3FMQA 3LA2A 3LAJA 1U2WA 2V79A 1ZN2A 2KJCA 4DNCA 4Z2YA 4EJVA 3KP2A 2QM3A 3SHFA 2QLZA 5D6EA 4LK1F 4BH9A 4HDUA 5FLXK 4L5JA 2FBHA 2MLKA 3GLXA 3O3KA 5F1RA 5E17F 5IT9K 3CLOA 3RIRA 3F72A 3WTVC 2P6TA 5D5VB 2VE8A 3F23A 3ECOA 2P5LC 1XMAA 1KQ8A 3PQJA 1S3JA 4LFUA 1XSDA 1QZZA 4LGWA 4U0YA 4YIFA 1ZGJA 4GCVA 2IVMA 2PEXA 4XSZF 2O61A 1R7JA 1HQCA 2DFIA 1T2KA 3CUQC 1W7PD 1HW2A 1XGSA 2M30A 2VOOA 1NHAA 4CHUA 3T8RA 3KEOA 2OZ6A 4BNCA 3R6SA 1SFEA 4OU0A 5ICEA 4ZYHA 3ZMTA 3F8NA 4A5MA 3Q9VA 4LG0B 5E1ZB 3RPUA 3IRQA 2PMUA 2JPBA 1J5YA 3EDPA 1KQ0A 4GO1A 2HTJA 2LNBA 2YU3A 3V4GA 2DK8A 1YW7A 4LB5A 2OQGA 2P7CB 2C6YA 3L00A 2ZO4A 4WXCA 1BJAA 1XDSA 2XGXA 2PFBA 1R58A 1IXRC 4RB0A 1G3SA 3F6VA 2EFPA 3FXUA 4NQWA 2COMA 1HW5A 3VFZA 4BAYA 1YYVA 2A69F 3TQNA 3FXQA 2DPUA 4LB6B 3T0YA 3JSPA 1Q1HA 4N9IA 4RS8A 1MKMA 1W4MA 4ZYDA 2EV0A 3ZN1A 3BPXA 3GF2A 1I27A 3H3ZA 4KMFA 3V7RA 5CVVA 3K1MA 3MFKA 1WKMA 2PG4A 1LDJA 1FT9A 3ML6A 3TO6A 2W57A 2MA3A 2QQAA 3ZMSA 1EV7A 4UNOA 1HKQA 2GA1A 5DDGA 3D0SA 2EFNA 3E6DA 3ZN0A 2QUFA 5L3CA 3RJPA 1QZYA 1F1ZA 4AIKA 2VT3A 1WSUA 1ZGAA 1CF7B 5K5QA 4MEXF 2AXLA 2JZYA 1FOKA 1IRGA 3SZPA 1B1BA 3RKYA 4GXOA 2NYXA 3U9GA 2HQRA 4KT5C 2KKOA 3VOEA 2XVCA 3ULQB 5JVTA 3KZZA 5FGMA 2HGCA 1OYIA 2HKOA 2KIMA 1B9NA 2BE5F 1SFXA 4ZYGA 6PAXA 3KP3A 4YFKF 5FB2A 3WTSC 3E3VA 1UB9A 2W25A 3KP7A 5BMZA 1D8KA 1MGTA 3BZ6A 3P7NA 4A0YA 4ZYEA 3WGHA 1BN5A 3J81Z 3WTZA 4UV9A 4M72A 3WTXC 1USTA 2H09A 3B73A 4LMYA 3R60A 1TQIA 1T6SA 5JFRA 2XAFA 4EJTA 4OIPF 2V1DA 1QNTA 1TQPA 4YFXF 3R61A 3F8FA 3I64A 4A0ZA 1FC3A 3EETA 1HXDA 4LD5A 2O6GE 2GIVA 1R1TA 2JSCA 4MTDA 3L2CA 1FBUA 3GX4X 4IXAA 2Q0OA 2XIGA 3CUQB 2DLLA 2H94A 2ZKZA 1MJAA 4ENNA 2BEOA 3JAMZ 2DI3A 3DP7A 3WODF 4HYEA 3J81K 3SZTA 4FT8A 3WGGA 3M7GA 4U0WA 3BJOA 2ACJA 2K27A 4XLPF 2PI0A 3DQVC 4TV7A 2GXBA 4FX4A 2G7HA 2Y0MA 2FMLA 2ZMEA 2HKXA 3U2RA 4FHTA 3ABUA 5ICFA 2RC4A 2GXGA 1UCRA 3GO5A 1U5TA 3I71A 2Z9OA 1W7PA 1P2FA 2GQQA 2K4BA 4ENJA 3C7JA 3JAMK 5D5WB 2RKHA 3V8JA 1G6NA 2H6BA 2W24A 4KUMA 1EH7A 2ZNZA 5F64A 1ZRFA 2EWNA 1B59A 4CGZA 1TBXA 2EA2A 4S05A 4JBAA 1F9NA 2F5DA 2BBYA 2NAZA 4HA8A 4PGHA 1BIAA 4LLLA 3KFWX 2LKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4X A;  2QBY B;  1IZ1 A;  2MH2 A;  5HLH A;  3HOS A;  1K79 A;  1S6L A;  3IKV A;  2FNP A;  2L02 A;  2OAZ A;  3BRO A;  1GHC A;  1R1V A;  3HTS B;  3K2Z A;  4N9H A;  2M45 A;  3GZ6 A;  3MWM A;  5H20 A;  5DUI A;  1K6O A;  5HDG A;  1BIB A;  1JGS A;  3CTA A;  5KK1 A;  1OR7 A;  2HTS A;  1BC8 C;  5DUK A;  3RI4 A;  4M6Y A;  3K1P A;  4OMY A;  1OPC A;  5FD5 A;  4BYY A;  3MEX A;  1TLH B;  1T0F A;  2Y75 A;  2OD5 A;  4M73 A;  4OIQ F;  4EM2 A;  1Z7U A;  4EJU A;  2ZFW A;  1I6X A;  3C3W A;  4GYI A;  1U3E M;  2RN7 A;  4MTE A;  5DCF A;  3F21 A;  2HQN A;  1GVJ A;  3HRM A;  2J5O A;  2FQ3 A;  1IW7 F;  3O6B B;  2EV6 A;  4HQE A;  2IT0 A;  1T98 A;  1Z6R A;  3J80 Z;  4KFC A;  1ZG3 A;  2L01 A;  1T38 A;  5H6R A;  5HOO A;  4I98 B;  1Y0U A;  4ESB A;  2VN2 A;  4YFN F;  2W84 A;  1L0O C;  2VT2 A;  5L3F A;  3GFM A;  3T8T A;  1IN7 A;  2ISZ A;  2RVC A;  5CVR A;  4OMZ A;  3J7A O;  2V1U A;  2L4M A;  2RDP A;  2K02 A;  3E5U A;  3FM5 A;  1LJ9 A;  4GGG A;  2OA4 A;  5E8I A;  4IVN A;  1KU2 A;  3MCZ A;  3LQR A;  1FNN A;  1P6R A;  3KP6 A;  1GXQ A;  2G9W A;  3J80 K;  3S2W A;  1QPM A;  2A6H F;  4U0V A;  4BXU A;  4WWC A;  2EV5 A;  4L9J A;  2DU9 A;  3RTR A;  4Y13 A;  2A61 A;  2STW A;  1MZB A;  1AOY A;  4A2U A;  1IN4 A;  4LLG F;  4HX8 A;  3ABT A;  4EM0 B;  1ON1 A;  3I59 A;  5ILU A;  1ZLK A;  4L18 B;  3W6J B;  5BQT A;  1BBY A;  3FMR A;  2H6C A;  5DV5 A;  4HX7 A;  3ZPL A;  5JR3 A;  1R00 A;  2QVO A;  4IRG A;  1HW1 A;  1U5T C;  4I09 A;  4RGS A;  3WTT C;  3RKX A;  1VTN C;  2P5V A;  1TNS A;  3L9F A;  4I2O A;  1X3U A;  4HX4 A;  5A2Q Z;  1XSX A;  3LWF A;  5HS9 A;  3BPV A;  4IF4 A;  5D8L B;  4G8X A;  2YR2 A;  1MDM A;  2FSW A;  2V6C A;  3EYY A;  1IF1 A;  4L0Z B;  3GW2 A;  3WU1 B;  3E5X A;  5D6F A;  3CUO A;  2B0L A;  1YW9 A;  5BPD A;  2KIU A;  3FM3 A;  1D3Y A;  1ODD A;  2F2E A;  4EV0 A;  1OMI A;  3V8L A;  4L5I A;  1ZG1 A;  4KNY A;  1FZP B;  4M74 A;  2FBI A;  1HST A;  1K7A A;  1R23 A;  2QQB A;  1FP1 D;  2VON A;  2XRO A;  2ZJ2 A;  4I0A A;  4G7H F;  2Z99 A;  1UFM A;  5LHI A;  4O3M A;  2FMY A;  4G9Y A;  5DD4 A;  3VOD A;  1QBJ A;  2D1H A;  5AIQ A;  2J5P A;  1SD4 A;  2VC0 A;  5D5X B;  3WTW C;  4EGY A;  3Q5F A;  3GFJ A;  1SMT A;  5LHH A;  2O03 A;  3F8B A;  3K69 A;  2NNN A;  3IRR A;  5DYM A;  5ILV A;  1XB4 A;  5J8C A;  3F22 A;  2QEN A;  2VXZ A;  1FLI A;  2IPQ X;  4YG2 F;  1FX7 A;  4IRH A;  4G7O F;  2BYV E;  2P6S A;  4PZJ A;  2JTV A;  3R0J A;  1BM9 A;  4HQM A;  2FNA A;  3KEQ A;  3K0L A;  3JTG A;  5KVR A;  3WE3 A;  1TQM A;  2OBP A;  5LHG A;  1YIO A;  3F3X A;  3PQK A;  4U88 A;  4IJA A;  1YO5 C;  2PBI A;  2ZNY A;  3BJ6 A;  3IWZ A;  5L3B A;  4PGG A;  1J0R A;  1KGS A;  2GAU A;  4GYG A;  3JSO A;  2FEZ A;  1LNW A;  3G3Z A;  2YX4 A;  5H6Q A;  2P8T A;  4JQF A;  2IRF G;  1SFU A;  3DPT A;  1DDN A;  5JI6 A;  2MLG A;  5FFX A;  3WTY C;  4HZF A;  2RGV A;  2X4H A;  3LA3 A;  1H0M A;  3FF5 A;  2XAJ A;  3QP6 A;  2K86 A;  5FD6 A;  2LSO A;  2EFO A;  3BY6 A;  3Q9S A;  3ZMV A;  4QWQ A;  4NHJ A;  2PQ8 A;  4R1H A;  1REP C;  1RUN A;  1ZRC A;  1YTY A;  2QYO A;  1LDK B;  4RB3 C;  2MD5 A;  2P4W A;  2DAO A;  1ON2 A;  4G94 A;  4OIR F;  3VEP A;  2PLY A;  4LLN A;  2PMH A;  1JHH A;  1FBS A;  3N4M A;  3F8C A;  2E7W A;  4UXN A;  2P5K A;  1OYW A;  3H3U A;  3V7S A;  4HAM A;  1R5H A;  2HS5 A;  5D4R A;  3HHH A;  2ZME B;  4B09 A;  2Y48 A;  2XRN A;  1XDU A;  4A6E A;  3KP5 A;  2HWV A;  4BHB A;  5LLQ A;  3WGI A;  1LEB A;  2XV4 S;  1BI2 A;  3ZQ7 A;  5BOX A;  5DCM A;  1U5T B;  3M8E A;  3AAF A;  4OIN F;  1YLF A;  2JPC A;  3FX3 A;  1W7P B;  4Q5S F;  4M9X A;  1EH8 A;  3HTU A;  1UHW A;  3FWE A;  5ED4 A;  3WG9 A;  2WTE A;  1P4W A;  5E20 A;  1ZYR F;  2DQL A;  2OQR A;  4M9S A;  2XAG A;  4BHP A;  3HSR A;  4OOI A;  2VBX A;  3KLN A;  4A6D A;  1XSV A;  1DPU A;  3FMS A;  5EEG A;  3MZY A;  3QU3 A;  4L9N A;  2ETH A;  5IT3 A;  3ZMU A;  3GUD A;  4AVP A;  1J59 A;  2EJR A;  1FSE A;  4PCQ A;  2LF7 A;  3I54 A;  2Z3Y A;  2F5E A;  3QOP A;  2HYG D;  3RYP A;  4AD9 A;  3FXR A;  4P55 A;  4RB2 C;  1I1S A;  3HRT A;  3JW4 A;  1PP7 U;  3F6O A;  1A04 A;  4UVC A;  1E17 A;  3LA7 A;  4ASN A;  1MJB A;  4IHS A;  1Z6T A;  5EEH A;  2L3D A;  4P9F A;  3MZH A;  4WF2 A;  2HYF A;  3ZMD A;  5HS8 A;  3RYR A;  4CO8 A;  2KJB A;  5HDN A;  3C1D A;  3GZ5 A;  4RAZ A;  5L3G A;  1ZHF A;  1IN6 A;  4M6X A;  2D45 A;  2DTR A;  2Q2E A;  1BI3 A;  3L7W A;  2GWR A;  1AWC A;  1P4A A;  2CG4 A;  4CYD A;  3IL2 A;  4KYW A;  2IW5 A;  3C18 A;  4IPA A;  4Y15 A;  4K2E A;  1RZ4 A;  4HF0 A;  3R4K A;  3CJN A;  1TNT A;  3T5X A;  3IC7 A;  4R8H A;  3LAP A;  1FWZ A;  4KN7 X;  1TTY A;  1G3W A;  4ZZD A;  1RUO A;  3BDD A;  3PFI A;  2ZXJ A;  4G7Z F;  1HKS A;  4L9V A;  1H9G A;  1ZLJ A;  5HS7 A;  3HSE A;  1S29 A;  1DP7 P;  1O7F A;  4HF1 A;  1GXP A;  5LGU A;  1J75 A;  5CJ9 A;  2R3S A;  4KIF A;  1WI9 A;  1SAX A;  3IHU A;  4BHC A;  2HFH A;  3GEZ A;  4LJZ F;  2CO5 A;  3KCC A;  3SFZ A;  2EFW A;  2GZW A;  4MEY F;  2EFQ A;  2VBZ A;  5AIP A;  1KU7 A;  2DT5 A;  4ON0 A;  4U7D A;  4ENM A;  2QZ8 A;  1IAW A;  1YQA A;  4MQ9 F;  1LDD A;  4M9Z A;  1K78 A;  1IRF A;  4P96 A;  4KDP A;  2LDU A;  2Q8K A;  1Z1D A;  1ZRD A;  3NQO A;  3TOA A;  4XBF A;  2CWE A;  2DO7 A;  1KU9 A;  1YS7 A;  2RV8 A;  4ZH4 F;  5BPI A;  4B8X A;  3HRU A;  2M1B A;  4HDV A;  5HVQ C;  2EA4 A;  1Z05 A;  2BV6 A;  1DUX C;  4AWX B;  2ZBK A;  2A07 F;  1BI0 A;  4O5V A;  1HKT A;  2M5W A;  3I59 B;  5IT9 Z;  1D5V A;  3TKY A;  2F5F A;  1H9T A;  2XUB A;  5E18 F;  1C0W A;  4ESF A;  1HBX G;  3GFL A;  1O3S A;  3GWZ A;  4EMS A;  2NNY A;  3GXO A;  1ZAO A;  1XMK A;  5L3E A;  4CIC A;  1XN7 A;  3EQL F;  3OOP A;  4UVA A;  1YFH A;  4HOB A;  1ZH5 A;  1G3Y A;  4KIG A;  1JHF A;  3SQN A;  5LBQ A;  2CGP A;  4ENK A;  1ONV A;  2E1N A;  4P9U A;  3GFI A;  3I0T A;  2M8E A;  2ESN A;  4A5N A;  2L54 A;  2G7U A;  3I58 A;  1J2X A;  1D8J A;  2LF8 A;  2OZU A;  4RGR A;  3COA C;  1WQ2 A;  1MDM B;  2VBW A;  4EM1 A;  2Z5U A;  5LRS A;  2IA2 A;  2VOD A;  2XHK A;  3ROU A;  5D5U B;  3CO6 C;  1KU3 A;  5DD8 A;  4AIJ A;  1G3T A;  3P9I A;  2YX7 A;  2CFX A;  1KA8 A;  3RDI A;  1S7A A;  2V1X A;  1MD0 A;  2WV0 A;  3RKW A;  4I02 A;  1B9M A;  4YII A;  4R79 A;  2FOK A;  1WWX A;  1L3L A;  3R0A A;  1I5Z A;  2GA2 A;  2ISY A;  3U1D A;  2DK5 A;  3LFK A;  5L3D A;  1JXS A;  3OV8 A;  1UHM A;  1LEA A;  3TOB A;  4D0P A;  4FX0 A;  3T1B A;  1ZRE A;  4HLX A;  2ESH A;  1QGP A;  3V8K A;  1EH6 A;  3V7C A;  3DPL C;  4MHG A;  5CYV A;  1ZG5 A;  2CW0 F;  3TDZ C;  2HR3 A;  4L0Y B;  5E1X A;  5A2Q K;  2BGC A;  2FBK A;  4CZZ A;  5E8G A;  1RI7 A;  2E7X A;  1S8N A;  1USS A;  1SD7 A;  3DFG A;  1J9I A;  2PJP A;  1V4R A;  4KA4 A;  2EK5 A;  4AIH A;  4LG0 A;  4EJW A;  2IP2 A;  3NRV A;  3HHG A;  1IUY A;  2IJL A;  5TRD A;  5HLI A;  1IXC A;  4UUV A;  3IWF A;  3BWG A;  5CVU A;  3ECH A;  4N0B A;  2JT1 A;  3QU6 A;  2STT A;  4HBL A;  3SXY A;  1I1G A;  1T39 A;  3DKW A;  1B6A A;  3ERE D;  1QQI A;  3TDU C;  4O6J A;  3ISP A;  2QQ9 A;  4OIO F;  4MNU A;  1E2X A;  1V3F A;  1U6G A;  4Q47 A;  2VE9 A;  3QRF F;  3HYI A;  1J7K A;  1CGP A;  4RB1 A;  2UXX A;  2MBF A;  4WXD A;  4QLC U;  5J6X A;  1R5G A;  4JK1 X;  5K1Y A;  3E6C C;  3E6M A;  2DPD A;  1O7L A;  1YW8 A;  3I5U A;  2KRF A;  4CXF A;  1P92 A;  4HV6 A;  4UV8 A;  3I4P A;  5LEK A;  1R1U A;  2A3S A;  1YS6 A;  2TDX A;  2E1C A;  1BI1 A;  5LRR A;  1XGN A;  1F4K A;  1FY7 A;  1STZ A;  2DBB A;  5ERI A;  5HLG A;  2V9V A;  2W85 A;  4HLY A;  1ULY A;  3QPT A;  3ELK A;  3IKT A;  3BOQ A;  4WK8 F;  3M8F A;  1XCV A;  5TJJ A;  3TO9 A;  4MQV A;  4WXH A;  1R36 A;  2FXA A;  4PDK A;  5J8F A;  3B02 A;  2UWM A;  5AON A;  5DCM B;  4KN4 X;  1RIO H;  4E70 A;  2MH9 A;  2OU2 A;  2ELH A;  3JTH A;  2O3F A;  4KIC A;  2XKP A;  1B4A A;  2A68 F;  1CF7 A;  2JRT A;  3E6B A;  5D8K B;  3WU0 A;  1MJ9 A;  1F5T A;  3QAH A;  1XGM A;  4EQQ A;  4M71 A;  2D2W A;  3M1E A;  4UHT A;  4LK0 F;  1OYY A;  2XKO A;  3HSF A;  2YSR A;  4XLN F;  5JHU A;  1DPR A;  3HRS A;  3KE2 A;  2UXN A;  3P9K A;  2R7D A;  4WCG A;  1XD7 A;  4KMU X;  1Z9C A;  3HUG A;  4L9T A;  1KYZ A;  3M9A A;  1LVA A;  2VC1 A;  2A5Y B;  1R22 A;  4IHT A;  3RPQ A;  3F8M A;  5K5R A;  3HIF A;  4G6D A;  4RGX A;  2WC2 A;  2NS0 A;  1IN8 A;  2QWW A;  4EGZ A;  3MAJ A;  3I53 A;  2PN6 A;  1KQ9 A;  3TGN A;  1PDN C;  4EJO A;  1TW2 A;  3HOT A;  3K9T A;  4Q48 A;  3E5Q A;  3O2P E;  3E97 A;  4Y17 A;  3P9C A;  2HEO A;  5CVJ A;  3TO7 A;  2L4A A;  4UVB A;  2FA5 A;  2DW4 A;  4EVI A;  5DEQ A;  2VBY A;  3CUQ A;  5ILS A;  3MQ0 A;  1G4D A;  2CQK A;  3KP4 A;  3KZY A;  1O3R A;  2ADU A;  2FF4 A;  1BC7 C;  5F6F A;  5LGN A;  4IRI A;  5HDK A;  3L09 A;  3G73 A;  3H92 A;  4RGU A;  5BS6 A;  3DXJ F;  1QO0 D;  3EUH A;  1FYK A;  1SD5 A;  4I01 A;  4RAY A;  4NB5 A;  1S7O A;  4CDG A;  1W5S A;  5CLS A;  5CVI A;  3KET A;  2Z33 A;  4ETS A;  1FYM A;  3NEU A;  1BOA A;  1FSH A;  3LQQ A;  2P7V B;  4XSX F;  1KYW A;  2FRH A;  1Z91 A;  4G6Q A;  5E1W A;  2O8X A;  3CDH A;  1O3Q A;  1O57 A;  5K5O A;  3N97 A;  3QPH A;  3EYI A;  2CSO A;  2RQP A;  2HZT A;  1JE8 A;  4HW0 A;  4KIB A;  3GYH X;  3BP8 A;  2XAS A;  2KIF A;  3W6K B;  3CO7 C;  2M87 A;  3D5L A;  4P5O A;  2CYY A;  4XRF A;  1RNL A;  3FZV A;  1IN5 A;  3LST A;  2XAQ A;  1FYL A;  4BQA A;  1FPQ A;  2RNJ A;  4DQ2 A;  1HSJ A;  2XAH A;  2A6E F;  1K78 B;  4F7Z A;  5FFZ A;  1XGO A;  2ZCW A;  4A12 A;  1FP2 A;  2FE3 A;  3ZMZ A;  1U78 A;  4S04 A;  2R7F A;  2QBY A;  3REO A;  4Q4Z F;  1LB2 A;  2EB7 A;  1ZAR A;  2D1V A;  2UZK A;  2WWY A;  4H0E A;  5D4S A;  2K4J A;  4HF2 A;  1IXS B;  2NRA C;  2AS5 F;  1PP8 F;  4ESJ A;  1XCB A;  2VOP A;  4ZZL A;  3KLO A;  1SMY F;  3GVA A;  5LGT A;  5ICG A;  2F5C A;  3WE2 A;  3K1N A;  4A0X A;  1SD6 A;  4WX9 A;  4MGR A;  2H27 A;  1OKR A;  2HDC A;  3DF8 A;  2DQR A;  1W5T A;  1FBQ A;  1LQ1 A;  4HV5 A;  5FO5 A;  1YG2 A;  4I7H A;  2YPR A;  4U7B A;  1TW3 A;  1WRJ A;  2IA0 A;  5LEJ A;  5FLX Z;  3ZP5 A;  2MC3 A;  5ICC A;  2O0Y A;  2K7L A;  1O3T A;  2FU4 A;  3DEU A;  2HOE A;  1U8R A;  3VB2 A;  3DV8 A;  4I0B A;  3QP5 A;  3FHZ A;  2X0L A;  3WTU C;  2IA1 A;  1PUE E;  3BJA A;  3FMQ A;  3LA2 A;  3LAJ A;  1U2W A;  2V79 A;  1ZN2 A;  2KJC A;  4DNC A;  4Z2Y A;  4EJV A;  3KP2 A;  2QM3 A;  3SHF A;  2QLZ A;  5D6E A;  4LK1 F;  4BH9 A;  4HDU A;  5FLX K;  4L5J A;  2FBH A;  2MLK A;  3GLX A;  3O3K A;  5F1R A;  5E17 F;  5IT9 K;  3CLO A;  3RIR A;  3F72 A;  3WTV C;  2P6T A;  5D5V B;  2VE8 A;  3F23 A;  3ECO A;  2P5L C;  1XMA A;  1KQ8 A;  3PQJ A;  1S3J A;  4LFU A;  1XSD A;  1QZZ A;  4LGW A;  4U0Y A;  4YIF A;  1ZGJ A;  4GCV A;  2IVM A;  2PEX A;  4XSZ F;  2O61 A;  1R7J A;  1HQC A;  2DFI A;  1T2K A;  3CUQ C;  1W7P D;  1HW2 A;  1XGS A;  2M30 A;  2VOO A;  1NHA A;  4CHU A;  3T8R A;  3KEO A;  2OZ6 A;  4BNC A;  3R6S A;  1SFE A;  4OU0 A;  5ICE A;  4ZYH A;  3ZMT A;  3F8N A;  4A5M A;  3Q9V A;  4LG0 B;  5E1Z B;  3RPU A;  3IRQ A;  2PMU A;  2JPB A;  1J5Y A;  3EDP A;  1KQ0 A;  4GO1 A;  2HTJ A;  2LNB A;  2YU3 A;  3V4G A;  2DK8 A;  1YW7 A;  4LB5 A;  2OQG A;  2P7C B;  2C6Y A;  3L00 A;  2ZO4 A;  4WXC A;  1BJA A;  1XDS A;  2XGX A;  2PFB A;  1R58 A;  1IXR C;  4RB0 A;  1G3S A;  3F6V A;  2EFP A;  3FXU A;  4NQW A;  2COM A;  1HW5 A;  3VFZ A;  4BAY A;  1YYV A;  2A69 F;  3TQN A;  3FXQ A;  2DPU A;  4LB6 B;  3T0Y A;  3JSP A;  1Q1H A;  4N9I A;  4RS8 A;  1MKM A;  1W4M A;  4ZYD A;  2EV0 A;  3ZN1 A;  3BPX A;  3GF2 A;  1I27 A;  3H3Z A;  4KMF A;  3V7R A;  5CVV A;  3K1M A;  3MFK A;  1WKM A;  2PG4 A;  1LDJ A;  1FT9 A;  3ML6 A;  3TO6 A;  2W57 A;  2MA3 A;  2QQA A;  3ZMS A;  1EV7 A;  4UNO A;  1HKQ A;  2GA1 A;  5DDG A;  3D0S A;  2EFN A;  3E6D A;  3ZN0 A;  2QUF A;  5L3C A;  3RJP A;  1QZY A;  1F1Z A;  4AIK A;  2VT3 A;  1WSU A;  1ZGA A;  1CF7 B;  5K5Q A;  4MEX F;  2AXL A;  2JZY A;  1FOK A;  1IRG A;  3SZP A;  1B1B A;  3RKY A;  4GXO A;  2NYX A;  3U9G A;  2HQR A;  4KT5 C;  2KKO A;  3VOE A;  2XVC A;  3ULQ B;  5JVT A;  3KZZ A;  5FGM A;  2HGC A;  1OYI A;  2HKO A;  2KIM A;  1B9N A;  2BE5 F;  1SFX A;  4ZYG A;  6PAX A;  3KP3 A;  4YFK F;  5FB2 A;  3WTS C;  3E3V A;  1UB9 A;  2W25 A;  3KP7 A;  5BMZ A;  1D8K A;  1MGT A;  3BZ6 A;  3P7N A;  4A0Y A;  4ZYE A;  3WGH A;  1BN5 A;  3J81 Z;  3WTZ A;  4UV9 A;  4M72 A;  3WTX C;  1UST A;  2H09 A;  3B73 A;  4LMY A;  3R60 A;  1TQI A;  1T6S A;  5JFR A;  2XAF A;  4EJT A;  4OIP F;  2V1D A;  1QNT A;  1TQP A;  4YFX F;  3R61 A;  3F8F A;  3I64 A;  4A0Z A;  1FC3 A;  3EET A;  1HXD A;  4LD5 A;  2O6G E;  2GIV A;  1R1T A;  2JSC A;  4MTD A;  3L2C A;  1FBU A;  3GX4 X;  4IXA A;  2Q0O A;  2XIG A;  3CUQ B;  2DLL A;  2H94 A;  2ZKZ A;  1MJA A;  4ENN A;  2BEO A;  3JAM Z;  2DI3 A;  3DP7 A;  3WOD F;  4HYE A;  3J81 K;  3SZT A;  4FT8 A;  3WGG A;  3M7G A;  4U0W A;  3BJO A;  2ACJ A;  2K27 A;  4XLP F;  2PI0 A;  3DQV C;  4TV7 A;  2GXB A;  4FX4 A;  2G7H A;  2Y0M A;  2FML A;  2ZME A;  2HKX A;  3U2R A;  4FHT A;  3ABU A;  5ICF A;  2RC4 A;  2GXG A;  1UCR A;  3GO5 A;  1U5T A;  3I71 A;  2Z9O A;  1W7P A;  1P2F A;  2GQQ A;  2K4B A;  4ENJ A;  3C7J A;  3JAM K;  5D5W B;  2RKH A;  3V8J A;  1G6N A;  2H6B A;  2W24 A;  4KUM A;  1EH7 A;  2ZNZ A;  5F64 A;  1ZRF A;  2EWN A;  1B59 A;  4CGZ A;  1TBX A;  2EA2 A;  4S05 A;  4JBA A;  1F9N A;  2F5D A;  2BBY A;  2NAZ A;  4HA8 A;  4PGH A;  1BIA A;  4LLL A;  3KFW X;  2LKP A; 
#chains in the Genus database with same CATH topology
 1P4X A;  4XRS G;  2QBY B;  3EUA A;  1IZ1 A;  3BR3 A;  2R7U A;  2MH2 A;  4DYR A;  5HLH A;  3HOS A;  1K79 A;  2JA7 J;  1S6L A;  3BG6 A;  1LE8 B;  3IKV A;  2FNP A;  1XMX A;  5M3F J;  2JSP A;  4A3C J;  4E7H A;  4B47 A;  3MVP A;  4DIQ A;  2E71 A;  1JJ6 C;  2L02 A;  2OAZ A;  3L2W A;  3BRO A;  1GHC A;  1U8B A;  3S17 J;  1R1V A;  4JX4 A;  3HTS B;  1LVK A;  4FQG A;  2HXO A;  3K2Z A;  1QU3 A;  4QPQ A;  1ORK A;  3A01 A;  1TC3 C;  2LVS A;  1EJ9 A;  4N9H A;  2M45 A;  3GZ6 A;  1JUM A;  2K3P A;  3MWM A;  3A0H C;  5H20 A;  2HOS A;  4M3G A;  5DUI A;  5HDG A;  1NH3 A;  1K6O A;  1BIB A;  1JGS A;  3CTA A;  2M3A A;  5KK1 A;  2OTJ I;  1OR7 A;  2HTS A;  1BC8 C;  1RKT A;  3DKX A;  5HNF A;  5DUK A;  1VQ8 I;  3RI4 A;  4IOA F;  2IBD A;  4M6Y A;  4C30 A;  3K1P A;  4BEH B;  1X4P A;  3BG3 A;  2N8G A;  2WAD A;  2R7W A;  2WY8 Q;  4OMY A;  4CYC B;  2QCO A;  1OPC A;  5FD5 A;  1Y6I A;  3MEX A;  1TLH B;  4BYY A;  2R7R A;  3ZQH A;  2HDW A;  1OQY A;  1T0F A;  2Y69 H;  4Y33 A;  3J7Y J;  2Y75 A;  2OD5 A;  2VJJ A;  5E3O A;  1LFP A;  4XRS A;  2DOD A;  3RQI A;  4M73 A;  4OIQ F;  1HCR A;  1LFU P;  1HDP A;  1W5C C;  2E34 A;  4EM2 A;  2R0Q C;  1Z7U A;  5JLX A;  1YIJ I;  5C4J J;  3OL3 A;  4EJU A;  2ZFW A;  4IQJ A;  4D5F A;  2QF7 A;  2D5V A;  3K7A J;  2WY7 Q;  1I6X A;  2HZD A;  3OY9 A;  3C3W A;  3NAR A;  4GYI A;  1U3E M;  2RN7 A;  3CD6 I;  4MTE A;  5DCF A;  3F21 A;  2HQN A;  2WBM A;  1MMG A;  2EIK H;  1S9H A;  1GVJ A;  2OV7 A;  3LSH A;  3HRM A;  2NXN B;  2J5O A;  1QVU A;  2FQ3 A;  3TP3 A;  4B48 A;  4F91 B;  4A3D J;  5K7H A;  1IW7 F;  3HJE A;  4CCO A;  3O6B B;  1YHQ I;  2EV6 A;  1D0X A;  4HQE A;  2IT0 A;  2ZSI B;  2DMP A;  1T98 A;  1Z6R A;  3J80 Z;  4J19 A;  1JKP C;  1D0Z A;  4KFC A;  1ZG3 A;  2L01 A;  5IOZ A;  1T38 A;  5H6R A;  5HOO A;  3H1C A;  2LY1 A;  2MGQ A;  4I98 B;  4D1Q A;  3PIP F;  2MYS A;  1Y0U A;  4RAF A;  3TP0 A;  4ESB A;  2VN2 A;  4YFN F;  2W84 A;  2DA7 A;  2R5Y A;  1L0O C;  2VT2 A;  3U1K A;  5GTI C;  3CC2 I;  2X1E A;  1Y56 A;  5L3F A;  4DGW B;  3GFM A;  1VQK I;  3ABL H;  3BR6 A;  3T8T A;  4S0H B;  1IN7 A;  2ISZ A;  4FE4 A;  2RVC A;  5CVR A;  4OMZ A;  2F4I A;  4NUB A;  2E5Z A;  3J7Z I;  2BVM A;  3J7A O;  5J4V A;  2V1U A;  2L4M A;  2JMW A;  2RDP A;  2K02 A;  3E5U A;  3FM5 A;  1LJ9 A;  4GGG A;  2OA4 A;  5E8I A;  3BTC A;  3QYE A;  4IVN A;  1KU2 A;  3MCZ A;  3LQR A;  4FE7 A;  4W97 A;  3M4O J;  1OCR H;  1FNN A;  1P6R A;  3KP6 A;  1GXQ A;  1NG6 A;  2XF7 A;  1QRY A;  4IX7 A;  2G9W A;  1BR4 A;  3J80 K;  3LNQ A;  4A3J J;  3BQY A;  3S2W A;  1QPM A;  2R92 J;  4CH7 A;  2A6H F;  4U0V A;  4BXU A;  2KRH A;  2PMZ N;  1XTA A;  3I9V 2;  4NDL A;  2DCE A;  4WWC A;  4XQF A;  4CZC A;  3PNT A;  2EV5 A;  4QSH A;  4C2T A;  2FJ1 A;  2DU9 A;  2JVH A;  3B6A A;  4L9J A;  3RTR A;  4Y13 A;  1ZTR A;  2EZH A;  2A61 A;  2QKM B;  2STW A;  3CC7 I;  1MZB A;  2UV1 A;  1HOM A;  1AOY A;  4A2U A;  4AVZ A;  1HA8 A;  1IN4 A;  4LLG F;  3A03 A;  3K2A A;  2AXT C;  4HX8 A;  3ABT A;  2JA5 J;  5FLM J;  4XLH A;  4ZTF A;  4EM0 B;  2LRD A;  1ON1 A;  3I59 A;  2R7T A;  5DM6 F;  4E7S A;  5ILU A;  1H88 C;  3JR9 A;  1ZLK A;  3E0J B;  3DLL F;  4L18 B;  3W6J B;  2ZME C;  5BQT A;  1BBY A;  1XS9 A;  3FMR A;  1B72 B;  2H6C A;  5DV5 A;  2Y30 A;  5EYR A;  4HX7 A;  3ZPL A;  3S32 A;  5JR3 A;  5E3N A;  4BDZ A;  3PL8 A;  1FMW A;  1R00 A;  1MBF A;  2QVO A;  4IRG A;  1HW1 A;  3K4M A;  4JX5 A;  2VKV A;  1U5T C;  4I09 A;  1SAU A;  3LSM A;  4RGS A;  3WTT C;  3DPU A;  3AKZ A;  3CDI A;  2XPV A;  3RKX A;  1VTN C;  5HOD A;  1E3O C;  3S1M J;  3U21 A;  4I99 C;  2P5V A;  2I10 A;  2DJN A;  1TNS A;  1YJN I;  4M3F A;  3CCL I;  3GTO J;  2L7F P;  1OCT C;  3PSI A;  3L9F A;  4I2O A;  2JWT A;  1X3U A;  2HVQ A;  4HX4 A;  5A2Q Z;  1XSX A;  2CS3 A;  3W2W A;  3LWF A;  5HS9 A;  2JRM A;  2E1M B;  3BPV A;  4IF4 A;  5D8L B;  4G8X A;  3G1M A;  2YR2 A;  1ZR2 A;  5FKL A;  4BKX A;  3OYM A;  1MDM A;  1K4S A;  2FSW A;  2V6C A;  3EYY A;  1IF1 A;  4L0Z B;  1WPK A;  1RES A;  3GW2 A;  3WU1 B;  3BCB A;  3E5X A;  3B6C A;  3CJQ B;  3Q3S A;  3AG4 H;  5D6F A;  3CUO A;  1FIP A;  2KRC A;  3I4N J;  2B0L A;  1YW9 A;  5BPD A;  2KIU A;  3FM3 A;  4NQW B;  1D3Y A;  1ODD A;  2F2E A;  4EV0 A;  1JTX A;  1OMI A;  1VQN I;  2Y31 A;  1U9O A;  3V8L A;  4L5I A;  1ZG1 A;  5M3M J;  4KNY A;  4BJT A;  1FZP B;  2HQA A;  4PUS A;  1LPQ A;  2CFO A;  5IYB J;  1D0Y A;  2FBI A;  4M74 A;  4A3G J;  3L1P A;  2ZXI A;  4FTH A;  2OF7 A;  1HST A;  3MKZ A;  1K7A A;  1R23 A;  4ZYA A;  2QQB A;  1FP1 D;  1TT0 A;  4FAS D;  3ABM H;  4BQN A;  2VON A;  3FDY A;  3G1L A;  5M5Y J;  3C2G A;  3S3N A;  4YEL A;  2XRO A;  4BQQ A;  4EAT A;  2ZJ2 A;  4LIT A;  4I0A A;  4G7H F;  2M34 A;  2Z99 A;  3Q0U A;  1UFM A;  5LHI A;  2KDO A;  2FMY A;  3L2R A;  4O3M A;  4G9Y A;  1Z77 A;  5DD4 A;  2VQL A;  3VOD A;  2F6C A;  1QBJ A;  2D1H A;  5AIQ A;  3VSL A;  2J5P A;  4X0G A;  1SD4 A;  2VC0 A;  5D5X B;  3DWL E;  1WJC A;  3WTW C;  4EGY A;  3Q5F A;  3GFJ A;  1WGX A;  1JTY A;  1SMT A;  5LHH A;  2O03 A;  1X3W B;  3F8B A;  2NNN A;  3K69 A;  1HC8 A;  2XB0 X;  3IRR A;  5DYM A;  4LIU A;  5ILV A;  1V5E A;  1XB4 A;  3OOU A;  3CP8 A;  5J8C A;  1Z21 A;  4UY8 I;  2OC6 A;  2QEN A;  2VXZ A;  3F22 A;  2LOO A;  1FLI A;  2IPQ X;  3IAM 2;  4YG2 F;  2LD5 A;  1FX7 A;  3AG3 H;  4IRH A;  1KON A;  5K7Z A;  3S15 J;  2KP6 A;  4G7O F;  2BYV E;  3PM1 A;  1R4N B;  2ZXW H;  2P6S A;  4PZJ A;  1T0F C;  3IP4 B;  3BR1 A;  4P1W A;  3H5N A;  2JTV A;  2CQQ A;  3GME A;  3QPL A;  5J1Y A;  1TWC J;  3R0J A;  1BM9 A;  4OAY A;  4B3X A;  4QIW N;  1UG2 A;  4HQM A;  2FNA A;  1ZR4 A;  4RM3 A;  3FXL A;  3KEQ A;  3K0L A;  1VF9 A;  3OYH A;  3JTG A;  2PX9 A;  4KIT B;  5KVR A;  3DU5 A;  3WE3 A;  1VQM I;  2M0M A;  1TQM A;  2OBP A;  2BY3 A;  5IP6 A;  5LHG A;  1YIO A;  2NVY J;  3F3X A;  2VJI A;  3PQK A;  4DYC A;  1N75 A;  4U88 A;  2L9N A;  4IJA A;  1YO5 C;  1ZEL A;  3ZXS A;  1QHG A;  3HXL A;  3OSF A;  2PBI A;  2ZNY A;  3BJ6 A;  3KPH A;  2YUS A;  3IWZ A;  5L3B A;  4PGG A;  1J0R A;  1KGS A;  2L9S A;  3PNV A;  2HQ5 A;  1Q1V A;  2GAU A;  5M5X J;  4GYG A;  3OYD A;  5F0F A;  3JSO A;  2FEZ A;  4XR6 A;  3ERM A;  2KQR A;  3NWT A;  1LNW A;  2TRT A;  1RR8 C;  3G3Z A;  2GIZ A;  1VFC A;  2JUG A;  2YX4 A;  5E79 C;  2P8T A;  5H6Q A;  2HI3 A;  5JLW A;  4JQF A;  4J01 A;  2IRF G;  1SFU A;  5C4X J;  3LSP A;  3DPT A;  1DDN A;  1WJ5 A;  2E5N A;  5JI6 A;  2MLG A;  5FFX A;  3WTY C;  3DBR B;  2JK3 A;  4HZF A;  2W1O A;  3SEZ A;  4BBR J;  2KIQ A;  4C3I J;  2VQH A;  3FKI J;  3S93 A;  5F27 A;  2RGV A;  1PYV A;  2ID6 A;  2X4H A;  3LA3 A;  4I6Z A;  2MFZ A;  1H0M A;  3S14 J;  1D5Y A;  3FF5 A;  3A4C A;  2XAJ A;  1ZK8 A;  3QP6 A;  2K86 A;  5FD6 A;  2LSO A;  2DA3 A;  2EFO A;  1IV8 A;  3HOU J;  1QPI A;  3BY6 A;  3CCJ I;  3CCV I;  3Q9S A;  3ZMV A;  4QWQ A;  2YS9 A;  2QSG X;  4NHJ A;  3ZGK A;  2PQ8 A;  3C2B A;  4R1H A;  1A35 A;  1REP C;  2RNG A;  3OR2 C;  1OJL A;  5JHF A;  1RUN A;  1ZRC A;  1YTY A;  2QYO A;  1LDK B;  4XNF A;  4RB3 C;  2MD5 A;  2P4W A;  2DAO A;  1ON2 A;  4J00 A;  2NS8 A;  3K4L A;  5E3M A;  4G94 A;  4OIR F;  1WJD A;  4M6V A;  5CKT A;  4G6T B;  1WHU A;  3VEP A;  2PLY A;  4DBR A;  4LLN A;  1MBE A;  2PMH A;  2COB A;  2OJE D;  2JA6 J;  1G8X A;  1JHH A;  2ZSH B;  3PO2 J;  2K9M A;  1FBS A;  3N4M A;  3F8C A;  2E7W A;  3ZQG A;  4UXN A;  4AID A;  2P5K A;  1OYW A;  3H3U A;  3LFU A;  1WH5 A;  3V7S A;  2A6T A;  4HAM A;  1R5H A;  2HS5 A;  1SC7 A;  3QOE A;  5D4R A;  2V1N A;  3HHH A;  2ZME B;  4B09 A;  2Y48 A;  2XRN A;  1U9N A;  1XDU A;  4E4H A;  4E7J A;  4RA2 A;  3KP5 A;  4A6E A;  2HWV A;  1UAA A;  4BHB A;  5LLQ A;  3WGI A;  3GTJ J;  1LEB A;  2XV4 S;  1FOY A;  2IGN A;  3OYC A;  1BI2 A;  3ZQ7 A;  5BOX A;  3PJR A;  5DCM A;  1U5T B;  3M8E A;  1MBH A;  3AAF A;  4A3F J;  4OIN F;  1YLF A;  2JPC A;  3FX3 A;  1W7P B;  4JOM A;  4Q5S F;  4M9X A;  1Z67 A;  1MND A;  1EH8 A;  4N4O B;  2H1L A;  3HTU A;  2FD5 A;  1UHW A;  3FK7 A;  3GTL J;  5KNL A;  3FWE A;  2VQG A;  2W7N A;  4E7Z A;  2KLO A;  3WG9 A;  2WTE A;  5ED4 A;  1P4W A;  5E20 A;  1ZYR F;  1IDY A;  2DQL A;  3IH2 A;  2OQR A;  4M9S A;  2LY9 A;  2XAG A;  4BHP A;  3JRA A;  3HSR A;  2IAI A;  4OOI A;  5GTH C;  2NVX J;  1MMN A;  2VBX A;  4B43 A;  4XIC A;  2ID3 A;  3KLN A;  2M4K A;  4CA0 A;  1SFO J;  2AHQ A;  4A6D A;  1XSV A;  3G4S I;  4GFB A;  2KPM A;  1DPU A;  3FMS A;  1R6R A;  4HNU A;  1R9T J;  5EGO B;  3GCM A;  2M8G X;  1RPW A;  4IQ4 A;  5EEG A;  1MMS A;  3D1N I;  3MZY A;  3QU3 A;  3SDB A;  2DYS H;  4L9N A;  2DFE A;  2ETH A;  5IT3 A;  3ZMU A;  2IXS A;  2QKL B;  2KZV A;  4AYB A;  4BBS J;  3GUD A;  5TGT A;  2FOW A;  1PJR A;  4AVP A;  1J59 A;  2EJR A;  1TL8 A;  1FSE A;  1V5F A;  3CDL A;  4PCQ A;  2LF7 A;  3I54 A;  5GPA A;  4NBQ A;  4RDU A;  2Z3Y A;  2JA8 J;  2F5E A;  3QOP A;  2HYG D;  2ZFU A;  4A3L J;  3RYP A;  4AD9 A;  3FXR A;  3DKY A;  4P55 A;  4RB2 C;  3CCM I;  4C2U A;  2EIM H;  1VQL I;  1I1S A;  3HRT A;  3JW4 A;  4CCM A;  2W82 A;  3F6O A;  1PP7 U;  3CC4 I;  1HDD C;  2CU7 A;  1A04 A;  4UVC A;  1T56 A;  4X6A J;  1B8I A;  2WAQ N;  3GBG A;  3LA7 A;  1MJB A;  4ASN A;  4IHS A;  4HG2 A;  1J09 A;  1Z6T A;  4II2 A;  2ZJP F;  5EEH A;  3BLY A;  1EA3 A;  4XMY A;  1LKX A;  2L3D A;  3S16 J;  4P9F A;  3DU6 A;  3MZH A;  2OTL I;  3K4B A;  1DGR M;  2M0C A;  3Q0V A;  4WF2 A;  2HYF A;  3ZMD A;  5HS8 A;  3RYR A;  3A01 B;  4CO8 A;  4CSW A;  2DN0 A;  4XKB A;  4C3J J;  4Y4R A;  1X1P A;  2KJB A;  2HYJ A;  3BR5 A;  2PJR A;  5HDN A;  2O7O A;  3C1D A;  3GZ5 A;  4RAZ A;  5F0H A;  5L3G A;  1X1D A;  3HZJ A;  1VQ7 I;  1ZHF A;  1POG A;  3G6E I;  2HDD A;  1IN6 A;  4M6X A;  2D45 A;  1W1W E;  1W0T A;  2JA2 A;  2DTR A;  2ELJ A;  1BI3 A;  2Q2E A;  4HEA 2;  3OIQ A;  3L7W A;  2GWR A;  1W36 D;  1AWC A;  1HF0 A;  1P4A A;  1W36 C;  2O5R A;  4BL0 B;  3FHN A;  2B9S A;  4C9Y A;  1ETO A;  2CG4 A;  4CYD A;  2I5U A;  1VQ9 I;  3IL2 A;  4KYW A;  4BQO A;  4RLF A;  1VQ4 I;  5KAI C;  1BW6 A;  2VAS A;  2IW5 A;  3C18 A;  4IPA A;  4Y15 A;  1R5I D;  1YRN A;  4K2E A;  1RZ4 A;  2EH3 A;  4HF0 A;  3R4K A;  1K61 A;  3BQZ A;  3HKZ N;  3CJN A;  1TNT A;  3T5X A;  1ACI A;  2DTZ A;  3IC7 A;  1MSF C;  4R8H A;  3RQ4 A;  3LAP A;  2XSD C;  3CCR I;  4E7L A;  1FWZ A;  2WB1 N;  2BVL A;  2I8D A;  4KN7 X;  4BAC A;  1TTY A;  5FLV A;  1YE9 A;  4NC7 A;  2MW8 A;  1X1C A;  2LR8 A;  1G3W A;  1F43 A;  2ME6 A;  4ZZD A;  1RUO A;  1IRX A;  3BDD A;  4F52 A;  3PFI A;  3A2K A;  2ZXJ A;  4G7Z F;  1HKS A;  4L9V A;  1H9G A;  1BR2 A;  5LD2 C;  1ZLJ A;  1JT6 A;  3BR0 A;  2K9Q A;  5CQG A;  2EZI A;  4IHX A;  1Y8Q B;  5HS7 A;  3HSE A;  1S29 A;  1DP7 P;  1O7F A;  4HF1 A;  3HGG A;  1GXP A;  5LGU A;  1IC8 A;  2XGC A;  1MIJ A;  1J75 A;  2CV0 A;  5CJ9 A;  4IO9 F;  2R3S A;  4KIF A;  2DA4 A;  1W0U A;  3TL4 X;  2L7M P;  2EIN H;  1WI9 A;  1SAX A;  4V2G A;  1VI0 A;  2K40 A;  3IHU A;  2EBI A;  4BHC A;  2HFH A;  3S1Q J;  3GEZ A;  4LJZ F;  1T08 B;  5GAD J;  2CO5 A;  2JVG A;  2R5Y B;  2B63 J;  5DTD A;  2DA6 A;  3MMY B;  3KCC A;  3SFZ A;  2E1O A;  2EFW A;  2GZW A;  4MEY F;  4NNJ A;  2EFQ A;  2VBZ A;  4BY1 J;  5AIP A;  1KU7 A;  3HOX J;  4MIM A;  2DT5 A;  4ON0 A;  4XK4 A;  4U7D A;  4ENM A;  2QZ8 A;  1IAW A;  1YQA A;  4MQ9 F;  1DP3 A;  2MC4 A;  1LDD A;  3W6V A;  4M9Z A;  3AG2 H;  1IRF A;  1K78 A;  4P96 A;  2HVS A;  4KDP A;  2BY1 A;  2LDU A;  2Q8K A;  1Z1D A;  2VL8 A;  1ZRD A;  3NQO A;  3L2Q A;  3TOA A;  5C44 J;  3DTI A;  2CQ7 A;  4XBF A;  3LSJ A;  2CWE A;  2DO7 A;  1KU9 A;  3ZRG A;  1YS7 A;  4KIS A;  2RV8 A;  4ZH4 F;  5BPI A;  3H35 A;  1WJB A;  4B8X A;  3HRU A;  2M1B A;  4HDV A;  4HRI A;  5HVQ C;  2EA4 A;  1Z05 A;  1X3Z B;  3FK6 A;  1IGN A;  2BV6 A;  1DUX C;  2H8R A;  2ICW G;  4AWX B;  3S3M A;  2VQC A;  4NC6 A;  1A36 A;  2ZBK A;  3SJM A;  2A07 F;  1BI0 A;  4O5V A;  1HKT A;  1IG7 A;  4A3I J;  4DZJ A;  4PJM A;  2L9V A;  2M5W A;  5BNG A;  3I59 B;  5IT9 Z;  1D5V A;  3TKY A;  2F5F A;  1H9T A;  4PFO A;  2XF6 A;  2XUB A;  3KYL A;  1PUF A;  5E18 F;  4FIS A;  1C0W A;  4ESF A;  1HBX G;  3GFL A;  1O3S A;  3DCF A;  3GWZ A;  5EZH A;  4EMS A;  2NNY A;  2E2J J;  2CUE A;  3GXO A;  1ZAO A;  1XMK A;  5L3E A;  4CIC A;  2GXA A;  1XN7 A;  3UKG A;  1JGG A;  3H9Q A;  3EQL F;  3OOP A;  4UVA A;  1KZH A;  1YFH A;  1BOB A;  1E0E A;  4HOB A;  5J3L A;  1ZH5 A;  1G3Y A;  4KIG A;  4EEF G;  1DGW Y;  1JHF A;  3SQN A;  5LBQ A;  3S1R J;  2CGP A;  1E17 A;  3KYD B;  2K9N A;  3W2V A;  4OAZ A;  4ENK A;  1I50 J;  4XLA A;  1ONV A;  1V5G A;  5GPC A;  2DFH A;  3HOZ J;  2E1N A;  2WV1 A;  2X6X A;  2X6W A;  2X6Y A;  4P9U A;  3NWS A;  3GFI A;  4A69 C;  3I0T A;  2M8E A;  2M7B A;  2ESN A;  2L54 A;  4A5N A;  2G7U A;  3I58 A;  1J2X A;  5GAE J;  2ELK A;  2CV1 A;  1D8J A;  5EF6 A;  1YX3 A;  1A31 A;  2LF8 A;  2P0W A;  2OZU A;  3CJT B;  1P7I A;  4RGR A;  2HPM A;  3A02 A;  2QSH X;  4ZDO A;  2XB5 A;  3COA C;  4F92 B;  3Q0W A;  1WQ2 A;  1MDM B;  1I39 A;  2VBW A;  4ZTJ A;  1GUU A;  3H5A A;  3CJR B;  5IOY A;  1AHD P;  1ETQ A;  4EM1 A;  2Z5U A;  4MO7 A;  3OYG A;  5LRS A;  2F48 A;  2O9L A;  2IA2 A;  2VOD A;  2XHK A;  4FET A;  3ROU A;  2K9S A;  2LRE A;  1Z0X A;  2R7V A;  2X6O A;  4LIV A;  5D5U B;  2IS2 A;  3CO6 C;  1KU3 A;  5DD8 A;  4AIJ A;  1G3T A;  2M9H A;  3P9I A;  5FKN A;  3JRG A;  2YX7 A;  2CFX A;  1KA8 A;  2DMQ A;  2DDA A;  4MFD A;  3RDI A;  1S7A A;  5C3E J;  1JKQ C;  1U0J A;  2V1X A;  1WJF A;  1MD0 A;  2DYR H;  2WV0 A;  3RKW A;  1IV6 A;  4I02 A;  1UMQ A;  2IGK A;  3H9G A;  3F0C A;  4Y7N J;  1OIS A;  2NVT J;  1B9M A;  4YII A;  3AFH A;  3DTK A;  4G12 A;  2FOK A;  4R79 A;  1WCM J;  4XOT A;  3WHC A;  1WWX A;  1L3L A;  4YRV A;  1X4O A;  4AM3 A;  4BE1 A;  3ZCO A;  4HPQ A;  4PJN A;  4BS9 A;  2LFB A;  1XX5 A;  1AU7 A;  3R0A A;  4M3E A;  3V42 A;  1I5Z A;  2GA2 A;  2ISY A;  1IJW C;  3U1D A;  1MBJ A;  3HM5 A;  1YX5 A;  2DK5 A;  3LFK A;  2Z16 A;  5L3D A;  1JXS A;  3OV8 A;  5GAG J;  1UHM A;  1R71 A;  1LEA A;  2GOX B;  3TOB A;  4OWR B;  4D0P A;  4FX0 A;  3T1B A;  1ZRE A;  4HLX A;  1G2H A;  5DM7 F;  3RZD J;  5J40 A;  2ESH A;  2R7O A;  1QGP A;  4IL6 C;  4CCL A;  4XLE A;  4C2M J;  3V8K A;  1EH6 A;  3V7C A;  3DPL C;  4MHG A;  5CYV A;  1D1A A;  2CQN A;  1WJA A;  1ZG5 A;  2CW0 F;  3TDZ C;  2HR3 A;  3HEF A;  4L0Y B;  5E1X A;  2MAB A;  2K3F A;  3S3O A;  1I3Q J;  4W1U A;  2BGC A;  3H0G J;  3ASN H;  5A2Q K;  2FBK A;  5M5W J;  4CZZ A;  1YI2 I;  3J7A Y;  5E8G A;  1RI7 A;  2E7X A;  1S8N A;  1USS A;  1ZKG A;  1Y39 A;  4HNT A;  2OPT A;  4RLQ A;  3HB9 A;  4DOZ A;  1R49 A;  4QTR A;  5GAH J;  1SD7 A;  3DFG A;  2LYC A;  1J9I A;  2PJP A;  2BHY A;  5J1U A;  1V4R A;  4KA4 A;  2EK5 A;  4LG0 A;  4AIH A;  4EJW A;  2IP2 A;  2XGD A;  3X2Q H;  4E6K G;  4XN3 A;  3NRV A;  4B1R A;  3CMY A;  1ZQ3 P;  3FXJ A;  3HHG A;  2RQQ A;  4F93 B;  2JUC A;  1IUY A;  3S2D J;  4QPO A;  4ZDP A;  4BJ6 C;  2EPF A;  2IJL A;  5TRD A;  5IYD J;  5HLI A;  1IXC A;  4UUV A;  3IWF A;  3BWG A;  3FXK A;  2KFD A;  4XM3 A;  5CVU A;  3ECH A;  3OIP A;  4N0B A;  2JT1 A;  3QU6 A;  4CCK A;  1FMV A;  2STT A;  4HBL A;  3SXY A;  1I1G A;  1T39 A;  3CQZ J;  3S1N J;  2E60 A;  3DKW A;  1B6A A;  3ERE D;  1QQI A;  3DBL B;  3TDU C;  4O6J A;  4D5C A;  1JKO C;  4ZC3 A;  1SEU A;  2E35 A;  3ISP A;  3AL0 C;  3PO3 J;  2QQ9 A;  4OIO F;  4MNU A;  2LK2 A;  1Z7L A;  1E2X A;  4CUG A;  1V3F A;  1U6G A;  4Q47 A;  2VE9 A;  3QRF F;  3HYI A;  1J7K A;  1CGP A;  4RB1 A;  2UXX A;  2MBF A;  1D1C A;  4IHY A;  4WXD A;  3S2H J;  4QLC U;  5J6X A;  1R5G A;  4JK1 X;  5K1Y A;  3HKZ A;  2CRG A;  3E6C C;  2BHZ A;  3E6M A;  3GZN B;  4A3K J;  2DPD A;  1O7L A;  3O8G A;  1YW8 A;  3I5U A;  3VYS B;  5KHD A;  2KRF A;  4CXF A;  1P92 A;  4HV6 A;  3CME I;  2BXZ A;  4UV8 A;  3MD2 A;  3I4P A;  5LEK A;  3ABK H;  1R1U A;  4XRM A;  2A3S A;  1YS6 A;  2L2O A;  2TDX A;  1VND A;  3S8P A;  2DOE A;  2E1C A;  1BI1 A;  4XON A;  4Y52 J;  1MW7 A;  1XGN A;  2K5C A;  5LRR A;  4LG3 A;  9ANT A;  2VPL A;  3G71 I;  2NVU B;  5F04 A;  2LBF A;  1F4K A;  1FY7 A;  2A05 A;  3MKY B;  1WH7 A;  1STZ A;  2DBB A;  5ERI A;  5HLG A;  2V9V A;  2W85 A;  4HLY A;  2R5Z A;  1ULY A;  3QPT A;  4PJL A;  3ELK A;  3IKT A;  3BOQ A;  4WK8 F;  2FQ4 A;  3BT9 A;  3OS0 A;  1DU0 A;  1TWF J;  3M8F A;  3JRI A;  3JRC A;  2AQE A;  4NC8 A;  1XCV A;  2IS1 A;  2DT7 B;  5EG0 B;  5TJJ A;  3TO9 A;  5H2F C;  4MQV A;  4WXH A;  1R36 A;  2FXA A;  2ZC2 A;  4PDK A;  4RMN A;  4B3A A;  5J8F A;  3GTQ J;  3VSK A;  3B02 A;  2JN6 A;  3HOW J;  4ABZ A;  2VJ4 A;  2UWM A;  5AON A;  1VQO I;  3MKL A;  2HU9 A;  5DCM B;  1UJ8 A;  5IPA A;  1DU6 A;  4KN4 X;  1VZ0 A;  4E70 A;  1RIO H;  1V54 H;  3E1S A;  3TMO A;  2MH9 A;  2OU2 A;  2ELH A;  3JTH A;  1ETW A;  2O3F A;  1QVT A;  3ONQ A;  4KIC A;  3IAS 2;  2CW7 A;  3SEQ A;  2XKP A;  1B4A A;  2A68 F;  1CF7 A;  2JRT A;  2V9K A;  3E6B A;  5D8K B;  3WU0 A;  1MJ9 A;  1F5T A;  3QAH A;  1XGM A;  2JQ7 A;  2CV2 A;  4ANJ A;  4EQQ A;  1JI8 A;  4M71 A;  2D2W A;  3M1E A;  4UHT A;  4LK0 F;  1OYY A;  2XKO A;  3HSF A;  4B4C A;  2YSR A;  2VKH A;  3DEE A;  5EG0 A;  4XLN F;  3ZQC A;  1BL0 A;  5JHU A;  1DPR A;  2M2E A;  4IEJ A;  2DMU A;  3HRS A;  1O4X A;  2F4O B;  1ETY A;  3KE2 A;  2UXN A;  5CQE A;  2LKX A;  5KCM A;  3DBH B;  2R7D A;  3P9K A;  2ECB A;  5EEA A;  4WCG A;  1NTC A;  1XD7 A;  2IGM A;  4KMU X;  1Z9C A;  3HUG A;  2HNH A;  2QA4 I;  3WG7 H;  4L9T A;  4PFP A;  1KYZ A;  3M9A A;  1LVA A;  2VC1 A;  2R7Q A;  4CCJ A;  2A5Y B;  3W3C A;  1R22 A;  4IHT A;  3RPQ A;  3F8M A;  4XLC A;  5K5R A;  3HIF A;  2PMZ A;  4G6D A;  4RGX A;  2IS6 A;  2WC2 A;  2L0K A;  1B8I B;  2NS0 A;  3L2U A;  1IN8 A;  2QWW A;  4EGZ A;  3MAJ A;  3I53 A;  2PN6 A;  2JJ7 A;  3ZQQ A;  1KQ9 A;  1JJ8 C;  3TGN A;  2R93 J;  1PDN C;  2VI6 A;  3KIO A;  3BTI A;  2V4J C;  4EJO A;  1H89 C;  1TW2 A;  2EZL A;  3HOT A;  3K9T A;  4Q48 A;  2VKD A;  3E5Q A;  3O2P E;  5FRO A;  3E97 A;  2KL4 A;  3K4K A;  4JYK A;  4Y17 A;  3P9C A;  2LTP A;  2PJR B;  4D7N A;  2HEO A;  1X1A A;  5CVJ A;  5B1B H;  3O8H A;  3TO7 A;  1RET A;  2KZG A;  1WI3 A;  3P5J A;  2R7Z J;  2L4A A;  1M1E B;  4UVB A;  2FA5 A;  4E7K A;  1D1B A;  2DW4 A;  2GM4 A;  4EVI A;  3OMY A;  2Q2E B;  1T33 A;  5DEQ A;  1AKH A;  2VBY A;  3CUQ A;  5ILS A;  4C3H J;  3VDX A;  2MSY A;  1ETV A;  1FEX A;  3MQ0 A;  2CQX A;  2XAU A;  1G4D A;  2CQK A;  1JKR C;  3HGY A;  5IYC J;  2H8W A;  3GTK J;  3OYI A;  3SFI A;  3KP4 A;  3KZY A;  1O3R A;  3C2H A;  2ADU A;  3LL7 A;  1YRN B;  2FF4 A;  1BC7 C;  4BUP A;  5KAF C;  5F6F A;  5LGN A;  2E36 A;  2VXD A;  4IRI A;  5HDK A;  3L09 A;  2QSF X;  4PJJ A;  3VPR A;  4B44 A;  3H92 A;  3G73 A;  4RGU A;  1XC5 A;  5BS6 A;  2FUG 2;  3DXJ F;  3WU2 C;  1QO0 D;  3EUH A;  3G1O A;  1FYK A;  2HPI A;  1SD5 A;  3VYR B;  5LFA A;  2DMT A;  4I01 A;  5F0C A;  4RAY A;  1SVM A;  1DQU A;  4NB5 A;  1S7O A;  4CDG A;  1W5S A;  4XKV A;  5CLS A;  4AUX A;  5CVI A;  3KET A;  2Z2S B;  3ZR8 X;  3I55 I;  2Z33 A;  2W48 A;  2MD0 A;  4ETS A;  1FYM A;  3NEU A;  1BOA A;  5HNH A;  1FSH A;  3LQQ A;  5J1R A;  3JCU C;  2P7V B;  4ITV A;  4XSX F;  3TW6 A;  3CCY A;  1KYW A;  2XC7 A;  1BJZ A;  1Z91 A;  2FRH A;  4G6Q A;  5E1W A;  2O8X A;  3CDH A;  3L2V A;  1O3Q A;  3CF5 F;  3HC7 A;  4A3E J;  3QQA A;  1O57 A;  5K5O A;  4DW6 A;  4RAG A;  3N97 A;  3QPH A;  3A0B C;  3EYI A;  2CSO A;  2RQP A;  3AL0 B;  1S7E A;  2HZT A;  3DEW A;  1JE8 A;  3FIS A;  2X51 A;  1EKE A;  2BW3 A;  4HW0 A;  4KIB A;  3HPG A;  3GYH X;  4X1E A;  3BP8 A;  2XAS A;  4XLF A;  2F4M B;  1P9Q C;  2KIF A;  3W6K B;  3BG9 A;  3CO7 C;  3AG1 H;  3D5L A;  2M87 A;  4MLO A;  4P5O A;  2CYY A;  3TW7 A;  4XRF A;  1RNL A;  2CJJ A;  3FZV A;  2O8K A;  1ETX A;  1IRZ A;  1IN5 A;  2GBY A;  3I4M J;  3LST A;  3OS1 A;  2QQ8 A;  3G2B A;  2XAQ A;  1FYL A;  1MSE C;  4BQA A;  2B7E A;  2V6E A;  2W4S A;  1FPQ A;  2RNJ A;  4DQ2 A;  3KYC B;  3FBN B;  2LKS A;  1HSJ A;  2XAH A;  2A6E F;  4BXF A;  1K78 B;  4F7Z A;  5FFZ A;  5JVG F;  1XGO A;  2ZCW A;  4A12 A;  1FP2 A;  2FE3 A;  3ZMZ A;  3RKQ A;  4D7M A;  1U78 A;  4S04 A;  3N05 A;  4A3M J;  3PNY A;  2DA5 A;  2HOT A;  3HOY J;  3FBI B;  3HL2 A;  2R7F A;  4Y3O A;  2OCE A;  3QPS A;  2QBY A;  3REO A;  4Q4Z F;  3JRH A;  5FKM A;  1LB2 A;  2EB7 A;  4N4N B;  1ZAR A;  1GT0 C;  3OYE A;  2D1V A;  3ASO H;  3M3Y J;  2UZK A;  1LE8 A;  2WWY A;  4H0E A;  5D4S A;  2K4J A;  1IUF A;  4HF2 A;  2KT0 A;  1IXS B;  2NRA C;  4DJA A;  3H0D A;  2AS5 F;  1SVO A;  2EIJ H;  3KX2 A;  3PUF A;  3LMM A;  1PP8 F;  3BC8 A;  4YEJ A;  4ESJ A;  1YIT I;  2DMN A;  3GTM J;  2Z1D A;  1GVD A;  1XCB A;  3OYF A;  1PUF B;  2VOP A;  2DOA A;  4ZZL A;  1ZGW A;  1S5L C;  3KLO A;  1ERD A;  1MNE A;  1SMY F;  3GVA A;  5LGT A;  5ICG A;  4UB6 C;  4BEH A;  4BXX J;  2F5C A;  2G0E A;  3K1N A;  4U87 A;  2Y0S N;  3WE2 A;  5IY5 H;  3LSR A;  4A0X A;  1SD6 A;  4CYC A;  4WX9 A;  4MGR A;  2VJ5 A;  5FKO A;  2H27 A;  1OKR A;  2HDC A;  3TBI A;  2IS4 A;  3DF8 A;  2DQR A;  1W5T A;  3BTL A;  1FBQ A;  1Y0N A;  3A1Y A;  2LY2 A;  3W2A A;  3GTP J;  1LQ1 A;  3CF2 A;  5FJ8 J;  4HV5 A;  5FO5 A;  1YG2 A;  4I7H A;  2YPR A;  1Z3Y A;  3IH3 A;  4ZDL A;  4U7B A;  1TW3 A;  2XPU A;  1WRJ A;  3ZQL A;  1FOX A;  2IA0 A;  1MNM C;  2HOA A;  3FXM A;  5LEJ A;  5FLX Z;  3ZP5 A;  2NOG A;  3IV5 A;  4RBO A;  5E3L A;  2MC3 A;  2XRL A;  5ICC A;  3D5S C;  3EPZ A;  1EF4 A;  2O0Y A;  2K7L A;  1O3T A;  2FU4 A;  2L5Q A;  2HOE A;  1E3H A;  3DEU A;  3MN2 A;  5IP7 J;  1U8R A;  1JUP A;  3VB2 A;  1Z3X A;  1GDT A;  3K6G A;  2LMD A;  3DV8 A;  4IKF A;  4I0B A;  2WA0 A;  3QP5 A;  2V7F A;  3FHZ A;  2X0L A;  1LFB A;  3WTU C;  3OR1 C;  1X19 A;  2IA1 A;  1PUE E;  2MG4 A;  3OYL A;  3BJA A;  2W00 A;  5EJC A;  3FMQ A;  1WFX A;  2YU9 J;  3CMA I;  3LA2 A;  3LAJ A;  4RM2 A;  5EDN A;  1U2W A;  4FCY A;  1RR7 A;  1ZN2 A;  2V79 A;  1F36 A;  3OYJ A;  3DTE A;  3HBL A;  1VQ6 I;  2KJC A;  4DNC A;  4Z2Y A;  4EJV A;  2CUJ A;  3KP2 A;  2DA1 A;  2QM3 A;  1NG7 A;  2VKE A;  3SHF A;  2P81 A;  3K4J A;  4PK4 A;  2QLZ A;  2KIS A;  5IP9 J;  5D6E A;  4XL9 A;  1IDZ A;  1TZL A;  2WAE A;  4LK1 F;  3HG9 A;  4BH9 A;  1TWH J;  1NK3 P;  3CCS I;  4HDU A;  5FLX K;  2LC2 A;  4L5J A;  4BGD A;  5B3S H;  2FBH A;  2MLK A;  3GLX A;  3O3K A;  3QYB A;  5F1R A;  2GLO A;  2OCC H;  4DBQ A;  3CLO A;  1WZ2 A;  3M1C A;  4M3D A;  3F72 A;  4XOR A;  3RIR A;  5E17 F;  5IT9 K;  1RKW A;  3WTV C;  2P6T A;  4XOP A;  5D5V B;  1T8I A;  1CQT A;  3ESW B;  1SAN A;  3OL4 A;  4KJZ A;  1OCZ H;  2VE8 A;  3F23 A;  3ECO A;  2P5L C;  2XPW A;  1XMA A;  3BTJ A;  4AYB N;  1APL C;  1KQ8 A;  3PQJ A;  2E19 A;  1S3J A;  4ZJZ A;  4LFU A;  3E7L A;  1OCP A;  1XSD A;  1QZZ A;  4LGW A;  4U0Y A;  4YIF A;  1ZGJ A;  2BZT A;  4GCV A;  2LLK A;  2IVM A;  1R4M B;  4D9J A;  1N77 A;  2PEX A;  1Y1W J;  4F3Q A;  3JRB A;  4XSZ F;  3HOV J;  2O61 A;  5F1J A;  1R7J A;  1HQC A;  2H1K A;  2DFI A;  1T2K A;  1X1B A;  3CUQ C;  1S72 I;  1W7P D;  2VIX A;  3LOC A;  1HW2 A;  4IOC F;  1XGS A;  2M30 A;  2VOO A;  1NHA A;  4CHU A;  3T8R A;  3PSF A;  3KEO A;  2OZ6 A;  3LSI A;  4BNC A;  3R6S A;  1SFE A;  4OU0 A;  2AQF A;  4PJ0 C;  3VYU B;  5ICE A;  4XID A;  1K83 J;  4BE0 A;  4ZYH A;  1NK2 P;  3VWB A;  3DLA A;  3ZMT A;  3F8N A;  5FKK A;  4A5M A;  2BY2 A;  3Q9V A;  4LG0 B;  2DFF A;  3EUH C;  3VYT B;  3KEY A;  5E1Z B;  5F08 A;  3RPU A;  2IGO A;  4JX6 A;  3BZC A;  4H4K C;  3IRQ A;  2PMU A;  1B72 A;  2RRE A;  2JPB A;  1J5Y A;  3SYT A;  3HDD A;  1OFC X;  3EDP A;  1KQ0 A;  4GO1 A;  2L7K A;  2DXI A;  2TCT A;  2FX0 A;  2HTJ A;  4HNV A;  2L7Z A;  2EZK A;  2OUM A;  2LNB A;  2CMP A;  2YU3 A;  3MKW B;  3V4G A;  2R7S A;  2BOL A;  1SFK A;  2DK8 A;  1QZE A;  1YW7 A;  4LB5 A;  2OQG A;  2VB6 A;  2P7C B;  2C6Y A;  3L00 A;  2WAQ A;  3K10 A;  1WVR A;  2ZO4 A;  3NAU A;  2Y9Z A;  3CES A;  4WXC A;  1BJA A;  3CMM A;  1GLN A;  2ZXH A;  2A5W A;  1FOW A;  3JRF A;  3ZQI A;  1XDS A;  3H9J A;  1MMD A;  2XGX A;  2PFB A;  1R58 A;  1IXR C;  4RB0 A;  1G3S A;  3F6V A;  1MBG A;  2EIL H;  2EFP A;  3FXU A;  4PSX A;  3QWL A;  4NQW A;  2COM A;  1K6Y A;  1HW5 A;  3VFZ A;  4BAY A;  1YYV A;  2K85 A;  2A69 F;  3TQN A;  2X85 A;  5FRM A;  5B5E C;  3FXQ A;  2DPU A;  2HVR A;  1GV5 A;  3HPH A;  4LB6 B;  3T0Y A;  1OR7 C;  1YJW I;  3JSP A;  1Q1H A;  4N9I A;  4RS8 A;  1MKM A;  4DYQ A;  5HLT A;  1W4M A;  3QOD A;  4ZYD A;  1MH3 A;  2XF5 A;  4BJ5 C;  2EV0 A;  3I56 I;  1I6H J;  4UB8 C;  5TIS C;  2X1C A;  1H8A C;  2LBF B;  2DT6 A;  4HST A;  2CUZ A;  3ZN1 A;  2ZJQ F;  1IO2 A;  3BPX A;  3GF2 A;  3BCA A;  1FJL A;  2BXY A;  4M3B A;  1I27 A;  3H3Z A;  4KMF A;  2VLA A;  3V7R A;  3SZG A;  1VQ5 I;  2R5Z B;  5CVV A;  3K1M A;  1MMA A;  3MFK A;  3PFY A;  4XKC A;  4MFE A;  1WKM A;  2PG4 A;  4GDF A;  1QA6 A;  2EQR A;  1LDJ A;  1FT9 A;  3ML6 A;  3RCO A;  3TO6 A;  2W57 A;  2AO9 A;  2MA3 A;  2KDZ A;  2QQA A;  3ZMS A;  1EV7 A;  2X48 A;  2WB1 A;  1Y1V J;  2KHM A;  1K4T A;  4UNO A;  5FRN A;  1HKQ A;  3GLL A;  4GRI A;  2GA1 A;  3WHB A;  4CCN A;  5DDG A;  3M8J A;  3D0S A;  2EFN A;  3E6D A;  4LOC A;  1FTZ A;  3ZN0 A;  4IZZ A;  4II3 A;  2QUF A;  5L3C A;  2XSJ C;  2M4G A;  4A93 J;  3RJP A;  1QZY A;  1YOV B;  2R7X A;  1F1Z A;  4AIK A;  2VT3 A;  1WSU A;  3IH4 A;  4V19 K;  1ZGA A;  1TP4 A;  3K4C A;  1CF7 B;  5CPR B;  4PSW A;  2WAF A;  5K5Q A;  2ECC A;  5B66 C;  4MEX F;  3BG5 A;  1OCO H;  1JUS A;  2AXL A;  2JZY A;  1FOK A;  1IRG A;  3SZP A;  3ZOB A;  1AA7 A;  4E7I A;  1UEL B;  4F55 A;  5GP9 A;  4HSR A;  1B1B A;  1TWA J;  3RKY A;  5B1A H;  4GXO A;  2NYX A;  3OYK A;  1Y8R B;  3U9G A;  2HQR A;  2K9L A;  4KT5 C;  2KKO A;  2QGU A;  3VOE A;  2XVC A;  2X1D A;  3F9K A;  3CCU I;  3ULQ B;  5JVT A;  1XG1 A;  2DJI A;  3KZZ A;  5FGM A;  2HGC A;  1OYI A;  2HKO A;  2KIM A;  2V26 A;  1B9N A;  3RZO J;  2BE5 F;  1SFX A;  3H5R A;  5J47 A;  4ZYG A;  6PAX A;  3KP3 A;  3HUG B;  4YFK F;  3H36 A;  3K70 D;  4AC0 A;  5FB2 A;  3WTS C;  3K70 C;  1SVL A;  3BR2 A;  4Z6Y A;  3K4N A;  3E3V A;  1UB9 A;  2ZJR F;  2W25 A;  3PUB A;  3KP7 A;  4L5E A;  3KZI C;  3CZ6 A;  5BMZ A;  1D8K A;  1MGT A;  3BZ6 A;  3P7N A;  4A0Y A;  2Y0S A;  3OYB A;  4ZYE A;  5K7F A;  3WGH A;  1BN5 A;  1I3A A;  1WJE A;  3J81 Z;  1YJ9 I;  3H3V K;  3EUK L;  2M7A A;  3WTZ A;  4UV9 A;  4M72 A;  3WTX C;  2R4G A;  1UST A;  2H09 A;  2ME0 A;  3B73 A;  4LMY A;  1X58 A;  3R60 A;  3FIW A;  2ZB9 A;  1TQI A;  1T6S A;  5JFR A;  2XAF A;  3D5R C;  3FXO A;  4EJT A;  5EZG A;  4OIP F;  2NS7 A;  1QNT A;  2L9R A;  2V1D A;  1FIA A;  2XGE A;  1TQP A;  1G59 A;  4YFX F;  1PVE A;  2LG4 A;  4XKW A;  3R61 A;  1BW5 A;  3F8F A;  3I64 A;  2X9D A;  3JRD A;  4A0Z A;  3ZQF A;  1BR1 A;  1FC3 A;  3EET A;  3OWT A;  2VUM J;  1HXD A;  4LD5 A;  2O6G E;  4UUT A;  2QEX I;  3LSG A;  2GIV A;  1R1T A;  2JSC A;  4V2F A;  4MTD A;  3L2C A;  1P7J A;  1FBU A;  3GX4 X;  2IEK A;  4IXA A;  2DA2 A;  2LH9 A;  2Q0O A;  1AKH B;  2Q1Z B;  1RRJ A;  2XIG A;  2DDB A;  1N25 A;  4XN0 A;  2RAE A;  3CUQ B;  3GTG J;  2DLL A;  3CP2 A;  2H94 A;  2ZKZ A;  1JT0 A;  1MJA A;  4ENN A;  4BE2 A;  1MH4 A;  1UG0 A;  1X2M A;  2BEO A;  1OLT A;  2CW8 A;  1ITY A;  3JAM Z;  2DI3 A;  3DP7 A;  3WOD F;  4HYE A;  3J81 K;  3SZT A;  1FTT A;  4FT8 A;  3WGG A;  3CCE I;  1E3P A;  3M7G A;  1A6I A;  4U0W A;  1X2N A;  3OS2 A;  1OCC H;  4IHW A;  3UNG C;  2CH0 A;  3BJO A;  4YIR X;  1TT5 B;  1VQP I;  2V9P A;  2ACJ A;  2K27 A;  4XLP F;  1LUJ B;  2PI0 A;  1ENH A;  3DQV C;  4TV7 A;  2GXB A;  2Y9Y A;  3SDG A;  4FX4 A;  2KMU A;  1ETK A;  2G7H A;  2Y0M A;  2FML A;  3QYF A;  2ZME A;  3RSN A;  4UUS B;  2HKX A;  3U2R A;  4FHT A;  3ABU A;  5ICF A;  2RC4 A;  2GXG A;  3RPU D;  4BU2 A;  1UHS A;  1A5J A;  1UCR A;  3GO5 A;  1U5T A;  3I71 A;  2Z9O A;  1N78 A;  4KT6 A;  1BA5 A;  4BDY A;  1XPX A;  1W7P A;  2LP0 A;  1P2F A;  4A3B J;  2GQQ A;  2K4B A;  4ENJ A;  1GV2 A;  3C7J A;  3JRE A;  3JAM K;  3CLQ A;  5D5W B;  2UUZ A;  4BY7 J;  2BY0 A;  2RKH A;  1V55 H;  3V8J A;  3IUO A;  2NVQ J;  1G6N A;  1T95 A;  2H6B A;  2DOF A;  2Y2Z A;  2BW3 B;  2W24 A;  3BZK A;  4KUM A;  3OYA A;  1EH7 A;  3UR3 C;  3OIO A;  3CCQ I;  3OYN A;  2ZNZ A;  3PIO F;  4IHV A;  1QHH D;  3MZ8 A;  4UUS A;  2XDV A;  1MBK A;  5F64 A;  1ZRF A;  2E2H J;  2NOJ B;  2EWN A;  2E1M C;  2HXI A;  1A6Q A;  4DZP A;  1B59 A;  4JP0 A;  1UZC A;  3FKJ A;  4CGZ A;  5EGO A;  1TBX A;  3M07 A;  3TED A;  2EA2 A;  2E2I J;  5DS9 A;  3LSK A;  2CUF A;  1HLV A;  1TWG J;  3I3L A;  4S05 A;  4JBA A;  3BG7 A;  1F9N A;  2F5D A;  2BBY A;  4AU7 A;  2NAZ A;  4HA8 A;  4PGH A;  3OSG A;  1BIA A;  4I76 A;  4LLL A;  5J4Y A;  2GOM A;  1RC9 A;  2F5V A;  2VPR A;  3KFW X;  2LKP A; 
#chains in the Genus database with same CATH homology
 1P4X A;  2QBY B;  1IZ1 A;  2MH2 A;  5HLH A;  3HOS A;  1K79 A;  1S6L A;  3IKV A;  2FNP A;  2L02 A;  2OAZ A;  3BRO A;  1GHC A;  1R1V A;  3HTS B;  3K2Z A;  4N9H A;  2M45 A;  3GZ6 A;  3MWM A;  5H20 A;  5DUI A;  1K6O A;  5HDG A;  1BIB A;  1JGS A;  3CTA A;  5KK1 A;  1OR7 A;  2HTS A;  1BC8 C;  5DUK A;  3RI4 A;  4M6Y A;  3K1P A;  4OMY A;  1OPC A;  5FD5 A;  4BYY A;  3MEX A;  1TLH B;  1T0F A;  2Y75 A;  2OD5 A;  4M73 A;  4OIQ F;  4EM2 A;  1Z7U A;  4EJU A;  2ZFW A;  1I6X A;  3C3W A;  4GYI A;  1U3E M;  2RN7 A;  4MTE A;  5DCF A;  3F21 A;  2HQN A;  1GVJ A;  3HRM A;  2J5O A;  2FQ3 A;  1IW7 F;  3O6B B;  2EV6 A;  4HQE A;  2IT0 A;  1T98 A;  1Z6R A;  3J80 Z;  4KFC A;  1ZG3 A;  2L01 A;  1T38 A;  5H6R A;  5HOO A;  4I98 B;  1Y0U A;  4ESB A;  2VN2 A;  4YFN F;  2W84 A;  1L0O C;  2VT2 A;  5L3F A;  3GFM A;  3T8T A;  1IN7 A;  2ISZ A;  2RVC A;  5CVR A;  4OMZ A;  3J7A O;  2V1U A;  2L4M A;  2RDP A;  2K02 A;  3E5U A;  3FM5 A;  1LJ9 A;  4GGG A;  2OA4 A;  5E8I A;  4IVN A;  1KU2 A;  3MCZ A;  3LQR A;  1FNN A;  1P6R A;  3KP6 A;  1GXQ A;  2G9W A;  3J80 K;  3S2W A;  1QPM A;  2A6H F;  4U0V A;  4BXU A;  4WWC A;  2EV5 A;  4L9J A;  2DU9 A;  3RTR A;  4Y13 A;  2A61 A;  2STW A;  1MZB A;  1AOY A;  4A2U A;  1IN4 A;  4LLG F;  4HX8 A;  3ABT A;  4EM0 B;  1ON1 A;  3I59 A;  5ILU A;  1ZLK A;  4L18 B;  3W6J B;  5BQT A;  1BBY A;  3FMR A;  2H6C A;  5DV5 A;  4HX7 A;  3ZPL A;  5JR3 A;  1R00 A;  2QVO A;  4IRG A;  1HW1 A;  1U5T C;  4I09 A;  4RGS A;  3WTT C;  3RKX A;  1VTN C;  2P5V A;  1TNS A;  3L9F A;  4I2O A;  1X3U A;  4HX4 A;  5A2Q Z;  1XSX A;  3LWF A;  5HS9 A;  3BPV A;  4IF4 A;  5D8L B;  4G8X A;  2YR2 A;  1MDM A;  2FSW A;  2V6C A;  3EYY A;  1IF1 A;  4L0Z B;  3GW2 A;  3WU1 B;  3E5X A;  5D6F A;  3CUO A;  2B0L A;  1YW9 A;  5BPD A;  2KIU A;  3FM3 A;  1D3Y A;  1ODD A;  2F2E A;  4EV0 A;  1OMI A;  3V8L A;  4L5I A;  1ZG1 A;  4KNY A;  1FZP B;  4M74 A;  2FBI A;  1HST A;  1K7A A;  1R23 A;  2QQB A;  1FP1 D;  2VON A;  2XRO A;  2ZJ2 A;  4I0A A;  4G7H F;  2Z99 A;  1UFM A;  5LHI A;  4O3M A;  2FMY A;  4G9Y A;  5DD4 A;  3VOD A;  1QBJ A;  2D1H A;  5AIQ A;  2J5P A;  1SD4 A;  2VC0 A;  5D5X B;  3WTW C;  4EGY A;  3Q5F A;  3GFJ A;  1SMT A;  5LHH A;  2O03 A;  3F8B A;  3K69 A;  2NNN A;  3IRR A;  5DYM A;  5ILV A;  1XB4 A;  5J8C A;  3F22 A;  2QEN A;  2VXZ A;  1FLI A;  2IPQ X;  4YG2 F;  1FX7 A;  4IRH A;  4G7O F;  2BYV E;  2P6S A;  4PZJ A;  2JTV A;  3R0J A;  1BM9 A;  4HQM A;  2FNA A;  3KEQ A;  3K0L A;  3JTG A;  5KVR A;  3WE3 A;  1TQM A;  2OBP A;  5LHG A;  1YIO A;  3F3X A;  3PQK A;  4U88 A;  4IJA A;  1YO5 C;  2PBI A;  2ZNY A;  3BJ6 A;  3IWZ A;  5L3B A;  4PGG A;  1J0R A;  1KGS A;  2GAU A;  4GYG A;  3JSO A;  2FEZ A;  1LNW A;  3G3Z A;  2YX4 A;  5H6Q A;  2P8T A;  4JQF A;  2IRF G;  1SFU A;  3DPT A;  1DDN A;  5JI6 A;  2MLG A;  5FFX A;  3WTY C;  4HZF A;  2RGV A;  2X4H A;  3LA3 A;  1H0M A;  3FF5 A;  2XAJ A;  3QP6 A;  2K86 A;  5FD6 A;  2LSO A;  2EFO A;  3BY6 A;  3Q9S A;  3ZMV A;  4QWQ A;  4NHJ A;  2PQ8 A;  4R1H A;  1REP C;  1RUN A;  1ZRC A;  1YTY A;  2QYO A;  1LDK B;  4RB3 C;  2MD5 A;  2P4W A;  2DAO A;  1ON2 A;  4G94 A;  4OIR F;  3VEP A;  2PLY A;  4LLN A;  2PMH A;  1JHH A;  1FBS A;  3N4M A;  3F8C A;  2E7W A;  4UXN A;  2P5K A;  1OYW A;  3H3U A;  3V7S A;  4HAM A;  1R5H A;  2HS5 A;  5D4R A;  3HHH A;  2ZME B;  4B09 A;  2Y48 A;  2XRN A;  1XDU A;  4A6E A;  3KP5 A;  2HWV A;  4BHB A;  5LLQ A;  3WGI A;  1LEB A;  2XV4 S;  1BI2 A;  3ZQ7 A;  5BOX A;  5DCM A;  1U5T B;  3M8E A;  3AAF A;  4OIN F;  1YLF A;  2JPC A;  3FX3 A;  1W7P B;  4Q5S F;  4M9X A;  1EH8 A;  3HTU A;  1UHW A;  3FWE A;  5ED4 A;  3WG9 A;  2WTE A;  1P4W A;  5E20 A;  1ZYR F;  2DQL A;  2OQR A;  4M9S A;  2XAG A;  4BHP A;  3HSR A;  4OOI A;  2VBX A;  3KLN A;  4A6D A;  1XSV A;  1DPU A;  3FMS A;  5EEG A;  3MZY A;  3QU3 A;  4L9N A;  2ETH A;  5IT3 A;  3ZMU A;  3GUD A;  4AVP A;  1J59 A;  2EJR A;  1FSE A;  4PCQ A;  2LF7 A;  3I54 A;  2Z3Y A;  2F5E A;  3QOP A;  2HYG D;  3RYP A;  4AD9 A;  3FXR A;  4P55 A;  4RB2 C;  1I1S A;  3HRT A;  3JW4 A;  1PP7 U;  3F6O A;  1A04 A;  4UVC A;  1E17 A;  3LA7 A;  4ASN A;  1MJB A;  4IHS A;  1Z6T A;  5EEH A;  2L3D A;  4P9F A;  3MZH A;  4WF2 A;  2HYF A;  3ZMD A;  5HS8 A;  3RYR A;  4CO8 A;  2KJB A;  5HDN A;  3C1D A;  3GZ5 A;  4RAZ A;  5L3G A;  1ZHF A;  1IN6 A;  4M6X A;  2D45 A;  2DTR A;  2Q2E A;  1BI3 A;  3L7W A;  2GWR A;  1AWC A;  1P4A A;  2CG4 A;  4CYD A;  3IL2 A;  4KYW A;  2IW5 A;  3C18 A;  4IPA A;  4Y15 A;  4K2E A;  1RZ4 A;  4HF0 A;  3R4K A;  3CJN A;  1TNT A;  3T5X A;  3IC7 A;  4R8H A;  3LAP A;  1FWZ A;  4KN7 X;  1TTY A;  1G3W A;  4ZZD A;  1RUO A;  3BDD A;  3PFI A;  2ZXJ A;  4G7Z F;  1HKS A;  4L9V A;  1H9G A;  1ZLJ A;  5HS7 A;  3HSE A;  1S29 A;  1DP7 P;  1O7F A;  4HF1 A;  1GXP A;  5LGU A;  1J75 A;  5CJ9 A;  2R3S A;  4KIF A;  1WI9 A;  1SAX A;  3IHU A;  4BHC A;  2HFH A;  3GEZ A;  4LJZ F;  2CO5 A;  3KCC A;  3SFZ A;  2EFW A;  2GZW A;  4MEY F;  2EFQ A;  2VBZ A;  5AIP A;  1KU7 A;  2DT5 A;  4ON0 A;  4U7D A;  4ENM A;  2QZ8 A;  1IAW A;  1YQA A;  4MQ9 F;  1LDD A;  4M9Z A;  1K78 A;  1IRF A;  4P96 A;  4KDP A;  2LDU A;  2Q8K A;  1Z1D A;  1ZRD A;  3NQO A;  3TOA A;  4XBF A;  2CWE A;  2DO7 A;  1KU9 A;  1YS7 A;  2RV8 A;  4ZH4 F;  5BPI A;  4B8X A;  3HRU A;  2M1B A;  4HDV A;  5HVQ C;  2EA4 A;  1Z05 A;  2BV6 A;  1DUX C;  4AWX B;  2ZBK A;  2A07 F;  1BI0 A;  4O5V A;  1HKT A;  2M5W A;  3I59 B;  5IT9 Z;  1D5V A;  3TKY A;  2F5F A;  1H9T A;  2XUB A;  5E18 F;  1C0W A;  4ESF A;  1HBX G;  3GFL A;  1O3S A;  3GWZ A;  4EMS A;  2NNY A;  3GXO A;  1ZAO A;  1XMK A;  5L3E A;  4CIC A;  1XN7 A;  3EQL F;  3OOP A;  4UVA A;  1YFH A;  4HOB A;  1ZH5 A;  1G3Y A;  4KIG A;  1JHF A;  3SQN A;  5LBQ A;  2CGP A;  4ENK A;  1ONV A;  2E1N A;  4P9U A;  3GFI A;  3I0T A;  2M8E A;  2ESN A;  4A5N A;  2L54 A;  2G7U A;  3I58 A;  1J2X A;  1D8J A;  2LF8 A;  2OZU A;  4RGR A;  3COA C;  1WQ2 A;  1MDM B;  2VBW A;  4EM1 A;  2Z5U A;  5LRS A;  2IA2 A;  2VOD A;  2XHK A;  3ROU A;  5D5U B;  3CO6 C;  1KU3 A;  5DD8 A;  4AIJ A;  1G3T A;  3P9I A;  2YX7 A;  2CFX A;  1KA8 A;  3RDI A;  1S7A A;  2V1X A;  1MD0 A;  2WV0 A;  3RKW A;  4I02 A;  1B9M A;  4YII A;  4R79 A;  2FOK A;  1WWX A;  1L3L A;  3R0A A;  1I5Z A;  2GA2 A;  2ISY A;  3U1D A;  2DK5 A;  3LFK A;  5L3D A;  1JXS A;  3OV8 A;  1UHM A;  1LEA A;  3TOB A;  4D0P A;  4FX0 A;  3T1B A;  1ZRE A;  4HLX A;  2ESH A;  1QGP A;  3V8K A;  1EH6 A;  3V7C A;  3DPL C;  4MHG A;  5CYV A;  1ZG5 A;  2CW0 F;  3TDZ C;  2HR3 A;  4L0Y B;  5E1X A;  5A2Q K;  2BGC A;  2FBK A;  4CZZ A;  5E8G A;  1RI7 A;  2E7X A;  1S8N A;  1USS A;  1SD7 A;  3DFG A;  1J9I A;  2PJP A;  1V4R A;  4KA4 A;  2EK5 A;  4AIH A;  4LG0 A;  4EJW A;  2IP2 A;  3NRV A;  3HHG A;  1IUY A;  2IJL A;  5TRD A;  5HLI A;  1IXC A;  4UUV A;  3IWF A;  3BWG A;  5CVU A;  3ECH A;  4N0B A;  2JT1 A;  3QU6 A;  2STT A;  4HBL A;  3SXY A;  1I1G A;  1T39 A;  3DKW A;  1B6A A;  3ERE D;  1QQI A;  3TDU C;  4O6J A;  3ISP A;  2QQ9 A;  4OIO F;  4MNU A;  1E2X A;  1V3F A;  1U6G A;  4Q47 A;  2VE9 A;  3QRF F;  3HYI A;  1J7K A;  1CGP A;  4RB1 A;  2UXX A;  2MBF A;  4WXD A;  4QLC U;  5J6X A;  1R5G A;  4JK1 X;  5K1Y A;  3E6C C;  3E6M A;  2DPD A;  1O7L A;  1YW8 A;  3I5U A;  2KRF A;  4CXF A;  1P92 A;  4HV6 A;  4UV8 A;  3I4P A;  5LEK A;  1R1U A;  2A3S A;  1YS6 A;  2TDX A;  2E1C A;  1BI1 A;  5LRR A;  1XGN A;  1F4K A;  1FY7 A;  1STZ A;  2DBB A;  5ERI A;  5HLG A;  2V9V A;  2W85 A;  4HLY A;  1ULY A;  3QPT A;  3ELK A;  3IKT A;  3BOQ A;  4WK8 F;  3M8F A;  1XCV A;  5TJJ A;  3TO9 A;  4MQV A;  4WXH A;  1R36 A;  2FXA A;  4PDK A;  5J8F A;  3B02 A;  2UWM A;  5AON A;  5DCM B;  4KN4 X;  1RIO H;  4E70 A;  2MH9 A;  2OU2 A;  2ELH A;  3JTH A;  2O3F A;  4KIC A;  2XKP A;  1B4A A;  2A68 F;  1CF7 A;  2JRT A;  3E6B A;  5D8K B;  3WU0 A;  1MJ9 A;  1F5T A;  3QAH A;  1XGM A;  4EQQ A;  4M71 A;  2D2W A;  3M1E A;  4UHT A;  4LK0 F;  1OYY A;  2XKO A;  3HSF A;  2YSR A;  4XLN F;  5JHU A;  1DPR A;  3HRS A;  3KE2 A;  2UXN A;  3P9K A;  2R7D A;  4WCG A;  1XD7 A;  4KMU X;  1Z9C A;  3HUG A;  4L9T A;  1KYZ A;  3M9A A;  1LVA A;  2VC1 A;  2A5Y B;  1R22 A;  4IHT A;  3RPQ A;  3F8M A;  5K5R A;  3HIF A;  4G6D A;  4RGX A;  2WC2 A;  2NS0 A;  1IN8 A;  2QWW A;  4EGZ A;  3MAJ A;  3I53 A;  2PN6 A;  1KQ9 A;  3TGN A;  1PDN C;  4EJO A;  1TW2 A;  3HOT A;  3K9T A;  4Q48 A;  3E5Q A;  3O2P E;  3E97 A;  4Y17 A;  3P9C A;  2HEO A;  5CVJ A;  3TO7 A;  2L4A A;  4UVB A;  2FA5 A;  2DW4 A;  4EVI A;  5DEQ A;  2VBY A;  3CUQ A;  5ILS A;  3MQ0 A;  1G4D A;  2CQK A;  3KP4 A;  3KZY A;  1O3R A;  2ADU A;  2FF4 A;  1BC7 C;  5F6F A;  5LGN A;  4IRI A;  5HDK A;  3L09 A;  3G73 A;  3H92 A;  4RGU A;  5BS6 A;  3DXJ F;  1QO0 D;  3EUH A;  1FYK A;  1SD5 A;  4I01 A;  4RAY A;  4NB5 A;  1S7O A;  4CDG A;  1W5S A;  5CLS A;  5CVI A;  3KET A;  2Z33 A;  4ETS A;  1FYM A;  3NEU A;  1BOA A;  1FSH A;  3LQQ A;  2P7V B;  4XSX F;  1KYW A;  2FRH A;  1Z91 A;  4G6Q A;  5E1W A;  2O8X A;  3CDH A;  1O3Q A;  1O57 A;  5K5O A;  3N97 A;  3QPH A;  3EYI A;  2CSO A;  2RQP A;  2HZT A;  1JE8 A;  4HW0 A;  4KIB A;  3GYH X;  3BP8 A;  2XAS A;  2KIF A;  3W6K B;  3CO7 C;  2M87 A;  3D5L A;  4P5O A;  2CYY A;  4XRF A;  1RNL A;  3FZV A;  1IN5 A;  3LST A;  2XAQ A;  1FYL A;  4BQA A;  1FPQ A;  2RNJ A;  4DQ2 A;  1HSJ A;  2XAH A;  2A6E F;  1K78 B;  4F7Z A;  5FFZ A;  1XGO A;  2ZCW A;  4A12 A;  1FP2 A;  2FE3 A;  3ZMZ A;  1U78 A;  4S04 A;  2R7F A;  2QBY A;  3REO A;  4Q4Z F;  1LB2 A;  2EB7 A;  1ZAR A;  2D1V A;  2UZK A;  2WWY A;  4H0E A;  5D4S A;  2K4J A;  4HF2 A;  1IXS B;  2NRA C;  2AS5 F;  1PP8 F;  4ESJ A;  1XCB A;  2VOP A;  4ZZL A;  3KLO A;  1SMY F;  3GVA A;  5LGT A;  5ICG A;  2F5C A;  3WE2 A;  3K1N A;  4A0X A;  1SD6 A;  4WX9 A;  4MGR A;  2H27 A;  1OKR A;  2HDC A;  3DF8 A;  2DQR A;  1W5T A;  1FBQ A;  1LQ1 A;  4HV5 A;  5FO5 A;  1YG2 A;  4I7H A;  2YPR A;  4U7B A;  1TW3 A;  1WRJ A;  2IA0 A;  5LEJ A;  5FLX Z;  3ZP5 A;  2MC3 A;  5ICC A;  2O0Y A;  2K7L A;  1O3T A;  2FU4 A;  3DEU A;  2HOE A;  1U8R A;  3VB2 A;  3DV8 A;  4I0B A;  3QP5 A;  3FHZ A;  2X0L A;  3WTU C;  2IA1 A;  1PUE E;  3BJA A;  3FMQ A;  3LA2 A;  3LAJ A;  1U2W A;  2V79 A;  1ZN2 A;  2KJC A;  4DNC A;  4Z2Y A;  4EJV A;  3KP2 A;  2QM3 A;  3SHF A;  2QLZ A;  5D6E A;  4LK1 F;  4BH9 A;  4HDU A;  5FLX K;  4L5J A;  2FBH A;  2MLK A;  3GLX A;  3O3K A;  5F1R A;  5E17 F;  5IT9 K;  3CLO A;  3RIR A;  3F72 A;  3WTV C;  2P6T A;  5D5V B;  2VE8 A;  3F23 A;  3ECO A;  2P5L C;  1XMA A;  1KQ8 A;  3PQJ A;  1S3J A;  4LFU A;  1XSD A;  1QZZ A;  4LGW A;  4U0Y A;  4YIF A;  1ZGJ A;  4GCV A;  2IVM A;  2PEX A;  4XSZ F;  2O61 A;  1R7J A;  1HQC A;  2DFI A;  1T2K A;  3CUQ C;  1W7P D;  1HW2 A;  1XGS A;  2M30 A;  2VOO A;  1NHA A;  4CHU A;  3T8R A;  3KEO A;  2OZ6 A;  4BNC A;  3R6S A;  1SFE A;  4OU0 A;  5ICE A;  4ZYH A;  3ZMT A;  3F8N A;  4A5M A;  3Q9V A;  4LG0 B;  5E1Z B;  3RPU A;  3IRQ A;  2PMU A;  2JPB A;  1J5Y A;  3EDP A;  1KQ0 A;  4GO1 A;  2HTJ A;  2LNB A;  2YU3 A;  3V4G A;  2DK8 A;  1YW7 A;  4LB5 A;  2OQG A;  2P7C B;  2C6Y A;  3L00 A;  2ZO4 A;  4WXC A;  1BJA A;  1XDS A;  2XGX A;  2PFB A;  1R58 A;  1IXR C;  4RB0 A;  1G3S A;  3F6V A;  2EFP A;  3FXU A;  4NQW A;  2COM A;  1HW5 A;  3VFZ A;  4BAY A;  1YYV A;  2A69 F;  3TQN A;  3FXQ A;  2DPU A;  4LB6 B;  3T0Y A;  3JSP A;  1Q1H A;  4N9I A;  4RS8 A;  1MKM A;  1W4M A;  4ZYD A;  2EV0 A;  3ZN1 A;  3BPX A;  3GF2 A;  1I27 A;  3H3Z A;  4KMF A;  3V7R A;  5CVV A;  3K1M A;  3MFK A;  1WKM A;  2PG4 A;  1LDJ A;  1FT9 A;  3ML6 A;  3TO6 A;  2W57 A;  2MA3 A;  2QQA A;  3ZMS A;  1EV7 A;  4UNO A;  1HKQ A;  2GA1 A;  5DDG A;  3D0S A;  2EFN A;  3E6D A;  3ZN0 A;  2QUF A;  5L3C A;  3RJP A;  1QZY A;  1F1Z A;  4AIK A;  2VT3 A;  1WSU A;  1ZGA A;  1CF7 B;  5K5Q A;  4MEX F;  2AXL A;  2JZY A;  1FOK A;  1IRG A;  3SZP A;  1B1B A;  3RKY A;  4GXO A;  2NYX A;  3U9G A;  2HQR A;  4KT5 C;  2KKO A;  3VOE A;  2XVC A;  3ULQ B;  5JVT A;  3KZZ A;  5FGM A;  2HGC A;  1OYI A;  2HKO A;  2KIM A;  1B9N A;  2BE5 F;  1SFX A;  4ZYG A;  6PAX A;  3KP3 A;  4YFK F;  5FB2 A;  3WTS C;  3E3V A;  1UB9 A;  2W25 A;  3KP7 A;  5BMZ A;  1D8K A;  1MGT A;  3BZ6 A;  3P7N A;  4A0Y A;  4ZYE A;  3WGH A;  1BN5 A;  3J81 Z;  3WTZ A;  4UV9 A;  4M72 A;  3WTX C;  1UST A;  2H09 A;  3B73 A;  4LMY A;  3R60 A;  1TQI A;  1T6S A;  5JFR A;  2XAF A;  4EJT A;  4OIP F;  2V1D A;  1QNT A;  1TQP A;  4YFX F;  3R61 A;  3F8F A;  3I64 A;  4A0Z A;  1FC3 A;  3EET A;  1HXD A;  4LD5 A;  2O6G E;  2GIV A;  1R1T A;  2JSC A;  4MTD A;  3L2C A;  1FBU A;  3GX4 X;  4IXA A;  2Q0O A;  2XIG A;  3CUQ B;  2DLL A;  2H94 A;  2ZKZ A;  1MJA A;  4ENN A;  2BEO A;  3JAM Z;  2DI3 A;  3DP7 A;  3WOD F;  4HYE A;  3J81 K;  3SZT A;  4FT8 A;  3WGG A;  3M7G A;  4U0W A;  3BJO A;  2ACJ A;  2K27 A;  4XLP F;  2PI0 A;  3DQV C;  4TV7 A;  2GXB A;  4FX4 A;  2G7H A;  2Y0M A;  2FML A;  2ZME A;  2HKX A;  3U2R A;  4FHT A;  3ABU A;  5ICF A;  2RC4 A;  2GXG A;  1UCR A;  3GO5 A;  1U5T A;  3I71 A;  2Z9O A;  1W7P A;  1P2F A;  2GQQ A;  2K4B A;  4ENJ A;  3C7J A;  3JAM K;  5D5W B;  2RKH A;  3V8J A;  1G6N A;  2H6B A;  2W24 A;  4KUM A;  1EH7 A;  2ZNZ A;  5F64 A;  1ZRF A;  2EWN A;  1B59 A;  4CGZ A;  1TBX A;  2EA2 A;  4S05 A;  4JBA A;  1F9N A;  2F5D A;  2BBY A;  2NAZ A;  4HA8 A;  4PGH A;  1BIA A;  4LLL A;  3KFW X;  2LKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...