5HS8A

Crystal structure of the diamide-treated yodb from b. subtilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
HMMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator YodB
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs8A00
1TNSA 3DPLC 1HW2A 1T98A 4M72A 1G3SA 2MLGA 4L5JA 3JAMK 2X4HA 2IJLA 5BS6A 4I0BA 5JI6A 2GIVA 2PQ8A 2VN2A 4CHUA 4O6JA 1S7AA 5KVRA 2VOPA 1MJBA 3C3WA 1RZ4A 2XV4S 3F22A 2MA3A 4ENMA 2H27A 5J6XA 3HUGA 4YIIA 3RDIA 2VBYA 1J2XA 1WWXA 1XGSA 4IHTA 1MZBA 1IN6A 2RVCA 2PJPA 1ON1A 4CO8A 5LLQA 1KQ8A 4EVIA 1R58A 2PBIA 1W7PD 2MC3A 1R5HA 2P7VB 2NYXA 4MTDA 3K0LA 3D5LA 4L9VA 4H0EA 1G3TA 2EFQA 3WTSC 1W4MA 3TKYA 2O0YA 3ZPLA 3VB2A 2D45A 1W5SA 1IRFA 3LQRA 3O6BB 3WTUC 1XDSA 3Q9VA 2P4WA 4ZZLA 3BJAA 4UV8A 1LB2A 1ON2A 2VBWA 2IRFG 4R8HA 2EK5A 2ELHA 3CDHA 2UZKA 5CYVA 4O3MA 4Y17A 1KA8A 4G9YA 1OMIA 3F72A 3E3VA 3CTAA 4I0AA 2J5OA 1E2XA 1K7AA 2CWEA 4U0VA 4PCQA 2IA2A 1Z6TA 5L3BA 2G9WA 5E20A 1ZLKA 2ESHA 2NS0A 2XIGA 1I1GA 2HYFA 3HSFA 1KYWA 4KIFA 5CJ9A 4I02A 5CLSA 4BHPA 2FBHA 4CGZA 1LJ9A 2IA1A 3MFKA 4B09A 5E8IA 3BPVA 4I7HA 4L9JA 3MAJA 3FHZA 3FMQA 3TDUC 2DBBA 3I59A 2EFNA 4GO1A 4KIGA 5F1RA 4ZYGA 1B9MA 5EEGA 2DK8A 1BJAA 1MD0A 3HOTA 1XB4A 1B1BA 3ZMZA 5DUIA 5L3EA 3I71A 4BYYA 3IKVA 5LHHA 1QZZA 1BIAA 2ZXJA 2PFBA 3DV8A 4OIRF 3JSPA 5JFRA 1YS6A 4ENKA 1U8RA 3SQNA 3LAPA 1T39A 1DPUA 1WQ2A 2R7FA 2XUBA 1YW8A 4AD9A 3ZN1A 1K79A 4R1HA 3NQOA 2XAHA 4OU0A 1I6XA 2W85A 3WTXC 2QZ8A 1GXQA 3KZYA 2YPRA 1R1TA 3ZQ7A 1S3JA 1FC3A 1FBSA 4RB0A 3TO9A 3HYIA 4NB5A 4U0WA 4LFUA 4KT5C 3LQQA 1T2KA 4KN4X 1K6OA 1SFXA 3ML6A 5BOXA 1LDKB 5HLHA 5BPDA 2ZJ2A 2P5KA 2VONA 3RI4A 4Y15A 1KQ0A 1TW3A 3V4GA 1L0OC 4FHTA 1R1VA 4F7ZA 1XDUA 3ZMSA 3IKTA 4DQ2A 5K5QA 1QBJA 3DEUA 5DCMA 3GXOA 3HRMA 3E5QA 2DQLA 4HDVA 4KA4A 1FLIA 1Z9CA 2KRFA 1U5TC 4GXOA 3IRRA 1UFMA 4M73A 1Z91A 4EQQA 3WU1B 1JE8A 4L0YB 3LA7A 4P9UA 2M87A 4LLNA 4UV9A 3EQLF 4JK1X 3QPHA 4IRHA 1T0FA 5FLXK 5ED4A 1ZREA 4OIOF 1REPC 1O3QA 2C6YA 3TDZC 2E7XA 2RN7A 3E6DA 3QU3A 3T5XA 1UB9A 2XRNA 1IXSB 1OYYA 3ZMUA 3WG9A 1TTYA 2MLKA 1IUYA 4I01A 1YLFA 1LDJA 3E97A 4UUVA 2A3SA 5K1YA 4HF1A 4EJWA 1Z7UA 4IJAA 2ISYA 2QQBA 3JSOA 1YTYA 2IVMA 2COMA 2ZCWA 4LLGF 4ENNA 3V8LA 3F6VA 1MDMB 1STZA 2OQRA 1U78A 4BNCA 4WF2A 2L3DA 1HSJA 3ZMDA 1ULYA 1O7FA 4OMYA 3TQNA 1HKQA 5HS7A 1TW2A 3KLOA 5ICGA 2XAFA 5LRRA 1SD4A 4EJTA 4IVNA 3RKWA 2QBYB 2ZO4A 3C18A 4WWCA 2ETHA 2VOOA 2EFPA 5L3DA 2D2WA 3RYPA 5DD8A 3V7CA 2CYYA 4YFXF 2EFWA 3CJNA 2QWWA 1R1UA 1C0WA 4HQMA 4LG0B 3EDPA 1FX7A 2XKPA 4LB6B 1B6AA 2HWVA 4EV0A 2F5DA 4RGRA 1ZGJA 2BV6A 3KP3A 5DYMA 2LSOA 3NEUA 2ZNYA 1SFEA 5BMZA 3WGGA 3KEOA 1YW9A 1YO5C 1T6SA 2CG4A 3F23A 3O3KA 2YSRA 2OZ6A 1IXCA 1K78B 4U7BA 2O03A 1QPMA 3F8BA 3ECOA 1ZHFA 4A0ZA 2VBZA 4Q4ZF 2JT1A 3EETA 1XGNA 3C7JA 2XROA 2DW4A 1EV7A 3GVAA 3WGIA 3ABTA 4IXAA 3V8JA 2FEZA 4HV5A 4ESBA 2FF4A 5CVIA 1Z6RA 1ZN2A 5D4SA 1FBQA 2R3SA 4LK1F 2HS5A 3GZ6A 2HEOA 1I1SA 1JHFA 2XGXA 2Q0OA 3IHUA 3F8NA 4IF4A 1ZRFA 5HS8A 2AS5F 4HBLA 2JTVA 4RGSA 2FNPA 4RGXA 2EFOA 4KYWA 3VFZA 3QPTA 2D1VA 5D8KB 3GX4X 1H9TA 1FOKA 3AAFA 4N0BA 3U2RA 1BM9A 4L9NA 2CQKA 3GZ5A 4AIJA 1FY7A 3FXRA 4XRFA 3RKYA 4KMFA 5LRSA 1DUXC 1S7OA 4PDKA 2FXAA 4L18B 2LNBA 2W25A 5A2QK 2WWYA 2BYVE 3WTVC 1IN5A 2Z9OA 3WU0A 2GXBA 2XASA 5LGUA 1YG2A 3GW2A 4XLPF 1TNTA 3MQ0A 2K27A 2RV8A 2Z5UA 2ESNA 2CSOA 3CLOA 2K4BA 2OAZA 4I2OA 1Z1DA 2OA4A 5J8FA 2JPCA 4L5IA 2F5EA 1S29A 1XSVA 5D5UB 3BDDA 2M45A 2L02A 2GXGA 4M9XA 2Z33A 1LDDA 1FWZA 4FX0A 2R7DA 2M8EA 5H20A 4L9TA 4ESFA 4AIKA 2OD5A 3K1NA 3D0SA 4KUMA 2LF8A 3F21A 5L3FA 5LBQA 4UXNA 2J5PA 2QQAA 3F3XA 4B8XA 1JHHA 3HSRA 4A5NA 2VE8A 2HKXA 1O3TA 1R22A 2DI3A 4G7ZF 2OBPA 4HF2A 3M8FA 1KU3A 1USTA 3M9AA 4AWXB 1DPRA 3FM3A 4UHTA 2GAUA 1BI3A 4MEXF 3KP7A 3FM5A 4MQ9F 4Q48A 3TOAA 3RYRA 3Q5FA 1J5YA 3E6MA 2MBFA 3KE2A 4O5VA 3ZMVA 4RB1A 1XMAA 2E1NA 3MZHA 1BOAA 2ZNZA 1MKMA 3F8FA 5HOOA 4ON0A 3DKWA 5FFZA 5HDKA 1ONVA 1CF7A 2FE3A 3TOBA 2JZYA 2JPBA 2EA4A 2XAGA 1IRGA 1F1ZA 1B59A 3TO6A 5ILSA 1OPCA 3K9TA 3G3ZA 5HLIA 1HW5A 4RAYA 1V4RA 3COAC 1U5TA 4OIQF 2M30A 3VOEA 2QM3A 5DDGA 1E17A 1F9NA 3B73A 2XAJA 2G7HA 2Y48A 2V9VA 4WXDA 1LEBA 2HTSA 5D6FA 1G3YA 1VTNC 1R5GA 4P9FA 2JSCA 2IW5A 5AONA 4Q5SF 3SZPA 1ZGAA 4EJVA 2E7WA 1FPQA 3HOSA 2OQGA 2PG4A 3I59B 5ICEA 1R7JA 2FRHA 3KP6A 1FNNA 5HLGA 2KJBA 3DFGA 1G4DA 2HGCA 2MH2A 1SD7A 4A0XA 4OINF 5ILVA 4HLXA 3JAMZ 1D3YA 3DF8A 4A0YA 1WI9A 5IT3A 2GQQA 3KEQA 3ZMTA 1SAXA 4KFCA 3U1DA 3BWGA 3BZ6A 3FWEA 2VC1A 1S8NA 4MQVA 1TQIA 4KNYA 3WTYC 3KP5A 4OIPF 2H09A 4PGHA 5HDNA 3CO7C 2HQNA 3ELKA 2G7UA 3J80K 2F2EA 1ZARA 3B02A 1Z05A 3GWZA 3R61A 1RUNA 2DU9A 2NNNA 3QP5A 3HRTA 2FNAA 1TLHB 4KIBA 1LNWA 1P4AA 3ECHA 2HFHA 2XVCA 1RIOH 1IF1A 2P5LC 5DCMB 5D6EA 1GVJA 3H3ZA 3LWFA 1IZ1A 2HQRA 2NNYA 4BAYA 2H94A 1J9IA 1J0RA 2P6SA 1YFHA 3BROA 5LGNA 2EA2A 4M6YA 4NHJA 2MD5A 1Y0UA 1ZH5A 3VEPA 3L2CA 4HLYA 1MJ9A 1ZRCA 2PMUA 1S6LA 4AIHA 4MGRA 2V1DA 1SD6A 5DV5A 4M74A 5LEJA 2UXNA 1BN5A 1HBXG 1OYWA 4QLCU 3L00A 1D5VA 5AIPA 3L7WA 2JRTA 2UWMA 4AVPA 1P4WA 2RNJA 2STWA 1B4AA 4RGUA 2WV0A 4HAMA 3WGHA 1QO0D 5JHUA 2K86A 2ZBKA 1SD5A 3EYIA 1W7PA 2QQ9A 3BOQA 3WE2A 2F5FA 3T0YA 3V7RA 2GWRA 2ISZA 1T38A 3K1PA 3M7GA 2YU3A 3DPTA 4WCGA 1XSDA 2ZFWA 5FD5A 5LGTA 2M5WA 3GEZA 3M8EA 3LAJA 5D5VB 4BHBA 5ICCA 2A5YB 1JXSA 4R79A 2YR2A 1JGSA 2FMYA 2VT2A 3K69A 2A69F 3T8RA 1G6NA 3HRSA 1G3WA 4U0YA 1F4KA 4EM1A 4A6EA 1UCRA 1FYMA 1YS7A 1ZG3A 3I54A 3L09A 1HSTA 3W6JB 1ZG1A 3SXYA 2QVOA 3REOA 4PGGA 3DQVC 4MHGA 2FMLA 3S2WA 2X0LA 3ROUA 4Y13A 3WTTC 1QQIA 2IA0A 5KK1A 4ZZDA 1FZPB 1D8KA 2XHKA 2ZKZA 4PZJA 4ESJA 3MCZA 1U2WA 1P4XA 3H92A 3OV8A 2HYGD 5IT9Z 2K02A 3I4PA 1EH8A 1YYVA 5FLXZ 1I27A 1R23A 4KICA 1FP2A 5CVRA 3SZTA 2VBXA 1ZG5A 3J7AO 1IN4A 4L0ZB 4EM2A 1HKTA 4HZFA 3IWFA 2ZMEA 1F5TA 4WK8F 2Y0MA 2VC0A 5LHGA 2DPUA 3L9FA 4MEYF 1XMKA 3N97A 2P6TA 4BHCA 4G6DA 2BGCA 3I64A 4YIFA 3DXJF 4IPAA 5LHIA 2O3FA 2B0LA 1J59A 2Y75A 4UVAA 1QNTA 3RTRA 1IAWA 4P55A 3T8TA 1DP7P 3CUQA 3DP7A 1MGTA 2FBKA 3R6SA 3ISPA 2FSWA 2CO5A 2L4MA 3BJ6A 3PQKA 3BPXA 3I0TA 3QOPA 4WX9A 1B9NA 1GXPA 5FFXA 1XGMA 1BI0A 4YFKF 3F8CA 1A04A 3R0JA 2VXZA 3KP2A 3GYHX 4G8XA 5DEQA 1P92A 4IHSA 4KN7X 3GFJA 1OYIA 2IPQX 2KIMA 2A6EF 1FBUA 1L3LA 4LJZF 1U6GA 3O2PE 4Q47A 3LA3A 4YFNF 1U3EM 1IN7A 4N9HA 4G6QA 2XAQA 3RPUA 3RJPA 2DFIA 5E1XA 4HYEA 2FA5A 2BE5F 3Q9SA 2RGVA 1P2FA 1FT9A 4S04A 1KU9A 1H9GA 2L4AA 2WTEA 3V8KA 3R4KA 2EWNA 5CVUA 3GFMA 2HKOA 2PI0A 2QUFA 1W5TA 2H6CA 5J8CA 3QAHA 3ERED 4CYDA 3M1EA 3HHHA 1BIBA 1CF7B 1IN8A 5D5XB 5HDGA 3ABUA 1HQCA 1XGOA 2EV6A 1GHCA 3CO6C 1DDNA 3J81Z 5K5RA 2NRAC 1FP1D 1ZAOA 2BEOA 3IC7A 1U5TB 3HIFA 4GGGA 3FXQA 2CGPA 2EV0A 1PP7U 2RC4A 1HKSA 3F6OA 1I5ZA 1ODDA 2STTA 1PUEE 2K4JA 4EJUA 5D5WB 3CUQC 5DCFA 5A2QZ 2TDXA 3RKXA 1HXDA 3QRFF 4S05A 2CFXA 1TQMA 2CW0F 4TV7A 3PFIA 1WRJA 4FX4A 1FYKA 3TGNA 4EM0B 2KIFA 3PQJA 4EMSA 2NAZA 3WTWC 4A5MA 2V79A 2FBIA 4GYIA 2GA2A 2O6GE 3IWZA 4HOBA 4JBAA 1WKMA 5H6RA 1UHWA 2VE9A 3JTHA 4MNUA 2L01A 5F6FA 2ACJA 2PMHA 2EV5A 2W84A 4ZYHA 4LB5A 1R00A 4LLLA 5E17F 1AWCA 3BP8A 3E5XA 4NQWA 4WXHA 5H6QA 2DAOA 2MH9A 2QENA 2DT5A 3KP4A 1BI1A 5E1WA 1XN7A 4QWQA 4HDUA 3N4MA 1H0MA 3LA2A 3IL2A 4P5OA 2GZWA 2L54A 4RB2C 3FX3A 4I09A 3TO7A 1BI2A 5FD6A 2A07F 4HX8A 4ZYDA 4A12A 4HX7A 5DUKA 5LEKA 3HSEA 3KFWX 4K2EA 3QU6A 6PAXA 3I58A 2HR3A 4KDPA 3CUOA 4G7OF 4XSZF 1KYZA 5F64A 2FQ3A 1UHMA 2AXLA 4CICA 2Q2EA 3RIRA 1SFUA 5EEHA 3V7SA 2M1BA 2EJRA 2W57A 4LK0F 4P96A 1FSHA 5JVTA 4XSXF 4M9SA 2KIUA 2OU2A 3SFZA 2V1UA 4LMYA 3ULQB 3FMRA 2HZTA 3JTGA 2GA1A 2LF7A 4LD5A 4N9IA 4XBFA 5HS9A 2BBYA 2P7CB 2EB7A 3H3UA 4RS8A 5DD4A 4BQAA 4HW0A 2RQPA 2Z3YA 3HHGA 5E8GA 5FB2A 2HOEA 1MJAA 2RKHA 2ADUA 3E6BA 5CVVA 4YG2F 3ZP5A 1O57A 5IT9K 3IRQA 1BC8C 4EGZA 3R0AA 4E70A 1TBXA 4XLNF 2LDUA 1FYLA 2LKPA 3K2ZA 1EH7A 1YIOA 3WTZA 3HTSB 3KCCA 5TJJA 2E1CA 1O3SA 3ZN0A 1J7KA 2KJCA 1W7PB 1BC7C 4U7DA 3P9IA 1HW1A 5TRDA 2F5CA 2K7LA 4G7HF 3T1BA 1AOYA 2A6HF 4ZH4F 2P5VA 3MWMA 3RPQA 1LEAA 1FSEA 3R60A 4M71A 2WC2A 5CVJA 3BY6A 4U88A 2HDCA 2Z99A 5BQTA 3HTUA 1LVAA 3LSTA 2DK5A 1MDMA 2A61A 4KMUX 4HV6A 2W24A 4GCVA 3J80Z 3NRVA 1OKRA 4MTEA 4LGWA 4OOIA 5ILUA 1O3RA 2IT0A 3U9GA 4RB3C 1XD7A 1V3FA 1WSUA 1ZRDA 5E18F 2DO7A 4UNOA 4Z2YA 4I98B 5BPIA 3QP6A 3GLXA 4EJOA 2YX4A 2QBYA 2D1HA 1YQAA 3GFIA 3OOPA 3MEXA 1ZLJA 5JR3A 2RDPA 2V6CA 3C1DA 2QYOA 4M9ZA 4WXCA 4ASNA 1KU2A 4BH9A 4CXFA 1J75A 4LG0A 2PEXA 3FF5A 4UVBA 2H6BA 4BXUA 4OMZA 4M6XA 1QZYA 3FXUA 4IRIA 3SHFA 3I53A 5K5OA 4DNCA 1TQPA 1RI7A 3GFLA 5HVQC 5E1ZB 5FO5A 3VODA 4GYGA 5D4RA 2UXXA 1CGPA 2A68F 2VT3A 1XSXA 1QGPA 3GUDA 1KU7A 3LFKA 4HF0A 1ZYRF 2ZMEB 4FT8A 1K78A 1KQ9A 2DLLA 4UVCA 1LQ1A 4CZZA 5ICFA 3KLNA 3W6KB 5AIQA 1BBYA 5L3CA 3P9CA 3GF2A 2FOKA 1NHAA 2QLZA 2IP2A 3P9KA 1SMTA 3KZZA 3GO5A 3KETA 1IXRC 2HTJA 1O7LA 4A6DA 2O8XA 3E6CC 5FGMA 3CUQB 3E5UA 1YW7A 1OR7A 2VODA 2DQRA 3WE3A 3WODF 3FMSA 4A2UA 3JW4A 4G94A 2PN6A 3J81K 5D8LB 2O61A 3HRUA 1RUOA 4HQEA 3P7NA 1KGSA 2Q8KA 1R36A 2KKOA 4RAZA 1RNLA 1XCVA 1XCBA 4IRGA 3EUHA 4ETSA 5L3GA 2DTRA 2FU4A 4EGYA 3F8MA 1D8JA 2P8TA 1PDNC 1PP8F 1EH6A 3FZVA 4ENJA 4HX4A 3G73A 4D0PA 1X3UA 3K1MA 1USSA 1SMYF 3EYYA 2YX7A 1IW7F 3MZYA 4JQFA 3BJOA 1Q1HA 2OZUA 1P6RA 3I5UA 4HA8A 2DPDA 2XKOA 2PLYA 4CDGA 5ERIA 4ZYEA 2V1XA
chains in the Genus database with same CATH superfamily
1TNSA 3DPLC 4D1QA 1IDZA 1HW2A 2XGEA 1T98A 2QKMB 3OIOA 4M3GA 4M72A 3H0DA 2QCOA 3JRGA 1G3SA 3PIPF 2MLGA 4L5JA 3JAMK 2X4HA 2Z2SB 2IJLA 5EZGA 5BS6A 4YEJA 4I0BA 1ETKA 5DS9A 1ERDA 3IH4A 1A35A 5JI6A 2GIVA 3B6CA 2PQ8A 2VN2A 2MW8A 4CHUA 5KHDA 2KZVA 1MMNA 4O6JA 1S7AA 2HOAA 5KVRA 2VOPA 1MJBA 3C3WA 1RZ4A 2XV4S 1WFXA 3K70C 3IAM2 3F22A 1J09A 2MA3A 4ENMA 2H27A 5J6XA 5FKLA 3LSPA 1Y39A 3HUGA 2VQCA 4YIIA 2XAUA 1F36A 4DOZA 3RDIA 2VBYA 1J2XA 4YIRX 1WWXA 1XGSA 4IHTA 1MZBA 5IOYA 1IN6A 3HPGA 2RVCA 2PJPA 4C3JJ 1ON1A 1H88C 1MBGA 2ECBA 4CO8A 4F55A 2ZXWH 2WY8Q 5LLQA 1KQ8A 2BW3A 4EVIA 1R58A 2PBIA 4LIUA 1W7PD 2MC3A 2PJRB 2VIXA 3H9GA 1R5HA 2P7VB 3ZQQA 1TL8A 3JRFA 2NYXA 2WADA 4MTDA 1MH3A 5JHFA 3OMYA 2K3FA 3K0LA 3D5LA 4L9VA 1N77A 4H0EA 1G3TA 2EFQA 3WTSC 2HU9A 2VQLA 2B63J 1W5CC 1W4MA 3TKYA 2O0YA 3ZPLA 1P7JA 3VB2A 2D45A 2LKXA 1W5SA 1IRFA 3LQRA 3O6BB 2DFHA 3WTUC 3WHCA 2R7UA 1B72B 1XDSA 3Q9VA 1SFKA 2P4WA 2XPWA 4ZZLA 3LSRA 3BJAA 3CZ6A 4UV8A 4XIDA 1ON2A 1LB2A 4BQQA 1JUPA 2F4MB 2VBWA 2IRFG 5GAGJ 4R8HA 4HNUA 3GTQJ 2EK5A 2ELHA 3CDHA 2DT6A 1FMVA 2NXNB 5GPCA 1OR7C 1QVUA 3C2HA 2UZKA 2DA4A 3VPRA 5CYVA 2BZTA 4MLOA 4O3MA 4XOPA 4Y17A 3KYLA 2M0MA 1KA8A 4G9YA 1OMIA 2M3AA 3F72A 3E3VA 4N4NB 3CTAA 4I0AA 3S1NJ 2J5OA 3DTIA 1E2XA 3RSNA 1K7AA 5K7FA 2ELKA 5EG0B 2E36A 3Q3SA 2CWEA 3M8JA 1JT6A 2TCTA 1NH3A 5FRMA 1VQ4I 4U0VA 2DTZA 4PCQA 2JRMA 1WJEA 3W2WA 2X1CA 4CUGA 2IA2A 3HKZN 5JLXA 2VJJA 2VKHA 3BG7A 1Z6TA 5L3BA 1HC8A 2G9WA 5E20A 1ZLKA 4A3JJ 2ESHA 2NS0A 2XIGA 3CCQI 1I1GA 1APLC 4II2A 2HYFA 3HSFA 4PSXA 1KYWA 4KIFA 5CJ9A 4I02A 5CLSA 4A3LJ 2XF7A 4RDUA 4PFOA 4BHPA 2FBHA 4CGZA 1LJ9A 2IA1A 3MFKA 4A69C 2GLOA 3K70D 3G1MA 3EUKL 4NQWB 4B09A 3NARA 1K4SA 5E8IA 4E7SA 2KDOA 3BPVA 1R71A 3S2DJ 3OIQA 4A3IJ 4I7HA 4L9JA 3MAJA 3FHZA 3FMQA 3GMEA 3TDUC 2DBBA 3I59A 3DLAA 4YELA 2EFNA 4GO1A 4KIGA 5F1RA 4ZYGA 4XICA 1Y56A 1HOMA 1HDPA 1B9MA 4RLFA 1LE8B 5EEGA 2DK8A 1BJAA 1MD0A 2VUMJ 3HOTA 1XB4A 1B1BA 3ZMZA 5DUIA 5L3EA 3I71A 4BYYA 1PYVA 2HXOA 3IKVA 1VQPI 5B66C 1GVDA 5LHHA 3RZDJ 1QZZA 1BIAA 1TWAJ 4E7KA 2ZXJA 4QPOA 2PFBA 3DV8A 4XQFA 4ANJA 4XK4A 2R7VA 4OIRF 3JSPA 5JFRA 1FIAA 1YS6A 2R7RA 4I76A 4ENKA 1U8RA 1EF4A 4Y52J 1BOBA 4M3EA 3SQNA 3LSIA 1YJ9I 2RAEA 3LAPA 3F9KA 3HOVJ 3VSKA 1T39A 2CV2A 1YJWI 4JX5A 4G12A 1DPUA 1WQ2A 5LFAA 1FEXA 2R7FA 2XUBA 1YW8A 4AD9A 3ZN1A 5EEAA 3ZR8X 2R4GA 3AL0C 2Q2EB 1K79A 4R1HA 3NQOA 2XAHA 4OU0A 1I6XA 2W85A 2ID3A 3WTXC 3FK6A 2QZ8A 2Y9ZA 1N78A 1GXQA 2V4JC 2WAFA 3KZYA 3GTKJ 2JUGA 2YPRA 1R1TA 3ZQ7A 5C44J 1S3JA 1FC3A 3HG9A 1RR8C 1T95A 1SAUA 1FBSA 3ERMA 4RB0A 3TO9A 3HYIA 4NB5A 2OTJI 4U0WA 4LFUA 2R7XA 4KT5C 4BACA 3LQQA 1X4PA 1T2KA 3L1PA 2MFZA 4KN4X 1K6OA 2H1LA 5M3FJ 1QHHD 1SFXA 3ML6A 5BOXA 1LDKB 5HLHA 5BPDA 2ZJ2A 3OOUA 2P5KA 5GP9A 5TGTA 2VONA 3I4NJ 3CMMA 1U0JA 3RI4A 4Y15A 1KQ0A 1TW3A 3V4GA 1LVKA 1MMGA 2V6EA 1L0OC 4I99C 3QPSA 4PJNA 3LFUA 4NDLA 3S32A 3PIOF 4FHTA 1R1VA 4F7ZA 1XC5A 2V9PA 1XDUA 3ZMSA 1E3PA 4M3DA 3IKTA 4DQ2A 5K5QA 5CPRB 3UNGC 1QBJA 2X6WA 3DEUA 5DCMA 3GXOA 3HRMA 3E7LA 3LL7A 5FJ8J 3E5QA 2DQLA 3S93A 2IS4A 4HDVA 4KA4A 1FLIA 1YJNI 1Z9CA 2KRFA 4V2FA 1U5TC 4GXOA 4W97A 3IRRA 2O5RA 1UFMA 4M73A 1Z91A 4EQQA 3WU1B 1JE8A 4L0YB 2R7SA 3LA7A 4P9UA 2M87A 3DBRB 3U1KA 4UV9A 1IGNA 4LLNA 3QOEA 3EQLF 3NAUA 4JK1X 3JRBA 2R7TA 4RLQA 3QPHA 4LIVA 2OF7A 4IRHA 1T0FA 5FLXK 2VKDA 2DMUA 5ED4A 1ZREA 3BG9A 4OIOF 1XS9A 1FJLA 1Y1VJ 4C3HJ 2X1EA 2ZJPF 4PJMA 1K4TA 2NS8A 4CCMA 5IY5H 1O3QA 1REPC 2C6YA 3TDZC 2E7XA 2RN7A 3PNYA 4CCKA 4AYBA 2RQQA 3E6DA 3QU3A 3T5XA 4DYCA 1UB9A 2Y30A 4DYQA 2XRNA 3TW7A 2LKSA 2LLKA 2VKVA 1ETQA 1IXSB 3H5RA 1OYYA 3ZMUA 2ZB9A 3WG9A 1TTYA 2MLKA 2R5ZA 2AHQA 1YRNB 1IUYA 4I01A 4A3CJ 4XOTA 3QYEA 5K7HA 1IJWC 1YLFA 1LDJA 1WJCA 3E97A 4UUVA 4XLEA 2A3SA 1N75A 1E3HA 2JVHA 3BR1A 5K1YA 4HF1A 4EJWA 1Z7UA 4IJAA 2ISYA 2P0WA 3G6EI 1HCRA 2QQBA 4B4CA 2HZDA 3JSOA 2IVMA 1YTYA 2COMA 2ZCWA 4LLGF 4ENNA 1NG7A 1PJRA 2B7EA 5IOZA 2XDVA 3V8LA 3F6VA 1MDMB 1STZA 2OQRA 1U78A 1I3AA 4E7JA 4BNCA 5J1UA 1BJZA 4Y4RA 4RM3A 4WF2A 2VJ4A 2XF6A 2NVTJ 2L3DA 1HSJA 3ZMDA 1ULYA 1O7FA 4OMYA 1Z3XA 3ZGKA 2ID6A 4KJZA 3OY9A 1S9HA 3OR2C 3CCRI 3TQNA 1HKQA 2YS9A 3IP4B 5HS7A 1TW2A 2IGKA 3ZQGA 2L7ZA 4IHVA 3KLOA 2WV1A 4Z6YA 5ICGA 1G2HA 4YRVA 2LBFA 2XAFA 3LOCA 5LRRA 1SD4A 3DCFA 1X19A 4EJTA 4IVNA 1BL0A 3RKWA 2M8GX 2QBYB 2ZO4A 3C18A 4WWCA 4XKBA 2ETHA 2VOOA 1D0ZA 1SANA 2EFPA 2E1MC 5L3DA 3W2AA 2D2WA 2KRHA 3GCMA 5CQEA 3RYPA 5DD8A 3V7CA 2CYYA 4YFXF 3K7AJ 2EZLA 2EFWA 3CJNA 2QWWA 1R1UA 1C0WA 4HQMA 4LG0B 2VJIA 3EDPA 3GLLA 1FX7A 2CU7A 2XKPA 3H35A 3NWTA 4LB6B 3S3NA 1B6AA 2HWVA 4EV0A 3OYMA 3K4LA 4B48A 2EBIA 3Q0WA 5M3MJ 2F5DA 3GTMJ 4RGRA 1ZGJA 2BV6A 3JRAA 3KP3A 4BDYA 2LY9A 5DYMA 3KZIC 2DJIA 1ITYA 2E71A 1UG2A 2LSOA 2DOAA 3NEUA 1EJ9A 1WCMJ 2LP0A 2ZNYA 4XN3A 1SFEA 5BMZA 1YX5A 4HEA2 4XKCA 3WGGA 3KEOA 1D1BA 1YW9A 4HPQA 3TP0A 1YO5C 2CW8A 1T6SA 2CG4A 3I4MJ 3F23A 3O3KA 2DOFA 2MSYA 3A03A 3FIWA 4RMNA 2YSRA 1A6IA 3TEDA 1VQ7I 2OZ6A 5BNGA 3ASNH 2R7ZJ 1VQOI 1VF9A 4XLAA 1IXCA 1K78B 2KP6A 5B1BH 4U7BA 3ZCOA 2O03A 1QPMA 3F8BA 5F27A 5FKKA 3ECOA 2CMPA 1ZHFA 4A0ZA 4BKXA 2VBZA 2OCCH 3KYDB 4Q4ZF 2XF5A 1DU0A 2JT1A 3EETA 1SVMA 2R92J 4IOAF 1VQ9I 2WY7Q 3FDYA 3DEWA 3CCYA 1UJ8A 1XGNA 5C4XJ 5JLWA 5KNLA 3C7JA 2XROA 2K9MA 2DW4A 1JI8A 1D0XA 1EV7A 2EH3A 3GVAA 1TWFJ 3WGIA 3ABTA 4IXAA 9ANTA 4BXFA 5EGOA 3V8JA 2H8WA 2FEZA 3MZ8A 4HV5A 2FF4A 5CKTA 5CVIA 1Z6RA 3Q0UA 4ESBA 1ZN2A 4FISA 5HNFA 3OS1A 5D4SA 4DYRA 2V7FA 3MVPA 1FBQA 2R3SA 1WJBA 2HS5A 2HYJA 4LK1F 3VYTB 3GZ6A 3S3MA 2HEOA 1I1SA 1Z21A 1RETA 1JHFA 2DDBA 4IQJA 2XGXA 2HQ5A 2Q0OA 3IHUA 3F8NA 4IF4A 1ZRFA 5CQGA 5HS8A 4DBQA 2AS5F 3H0GJ 1ORKA 4DIQA 4HBLA 2JTVA 4S0HB 4E7LA 2HNHA 4RGSA 2FNPA 4UUTA 2Y0SA 3HB9A 4RGXA 3K4CA 3CP2A 2HQAA 3S2HJ 2OTLI 3ZQLA 2EFOA 4KYWA 1OCCH 4Y7NJ 2AXTC 3VFZA 3QPTA 2D1VA 5D8KB 1W0UA 4LOCA 3GX4X 1H9TA 1FOKA 4IEJA 3AAFA 1MBKA 2DA6A 4N0BA 3U2RA 4CYCB 2IS6A 1BM9A 2CFOA 4L9NA 3IAS2 2CQKA 3GZ5A 4F52A 4XL9A 1FY7A 4AIJA 2CJJA 1LFPA 2DYRH 1A6QA 5FKOA 1H8AC 3FXRA 4XRFA 5HLTA 1WZ2A 3RKYA 4KMFA 1VQMI 2D5VA 5LRSA 1DUXC 1S7OA 4PDKA 2FXAA 3RQIA 1MMDA 4L18B 3AG2H 2LNBA 2W25A 5A2QK 2WWYA 2X9DA 2BYVE 3BG5A 3WTVC 1IN5A 2Z9OA 4OAZA 2XSJC 2RREA 4XRSA 3WU0A 4ZDLA 4MFEA 5FLMJ 3PFYA 1AA7A 3E1SA 2GXBA 2XASA 5LGUA 1PUFB 1QHGA 1YG2A 3OYHA 3H3VK 2DODA 1X4OA 5J1RA 2L7KA 3GW2A 2BVLA 3VSLA 4XLPF 1TNTA 4CA0A 4N4OB 3MQ0A 4XRMA 2K27A 2RV8A 4MIMA 4CH7A 2Z5UA 2ESNA 2CSOA 3FK7A 2R5YB 2JJ7A 3DEEA 3CLOA 2K4BA 2OAZA 4I2OA 2CRGA 3FBNB 1Z1DA 1X3ZB 2OA4A 1YX3A 5J8FA 2JPCA 4L5IA 2F5EA 4CCLA 2OPTA 1S29A 3CCLI 1HLVA 1XSVA 5D5UB 2F6CA 3BDDA 4XM3A 2M45A 2BVMA 2M4GA 2L02A 2GBYA 2GXGA 4M9XA 2Z33A 1ZQ3P 1LDDA 1FWZA 1U9OA 4FX0A 2CUFA 2R7DA 2M8EA 5H20A 4L9TA 3SDBA 1W1WE 4ESFA 4AIKA 2OD5A 3K1NA 3D0SA 4KUMA 2LF8A 3F21A 5L3FA 2M2EA 1X1CA 1JKQC 2QSFX 5LBQA 2CV0A 5B5EC 4UXNA 2QSGX 3HUGB 2J5PA 2LOOA 2QQAA 1AKHA 2O8KA 3F3XA 3AG3H 1JHHA 4B8XA 2HOTA 2LY1A 3HSRA 2BY2A 4ZC3A 4A5NA 4JP0A 2VE8A 2HKXA 1O3TA 1R22A 1UG0A 2DI3A 3LSJA 4G7ZF 2ZFUA 1JKRC 2OBPA 3CJQB 4HF2A 2Y31A 2DMTA 5HODA 5E3NA 5FRNA 3M8FA 2OJED 2BW3B 4V19K 1KU3A 1USTA 3M9AA 4AWXB 1DPRA 1JKOC 3FM3A 4UHTA 2X48A 2GAUA 1BI3A 5F08A 4MEXF 3KP7A 2HDWA 3FM5A 2VPLA 3BZCA 1QPIA 4MQ9F 4IO9F 3M1CA 4Q48A 2GIZA 4NUBA 3S8PA 3TOAA 3RYRA 2OCEA 3Q5FA 1J5YA 3I9V2 3E6MA 2MBFA 2WAEA 3KE2A 2MYSA 4O5VA 3S16J 1T8IA 3ZMVA 3IV5A 3W3CA 4RB1A 4RA2A 1BR1A 2XSDC 1XMAA 2E1NA 3HKZA 5F04A 5M5WJ 3MZHA 2LC2A 1BOAA 3SJMA 2ZNZA 4FTHA 1MKMA 2LMDA 3F8FA 2MD0A 2ZMEC 5FKNA 5HOOA 4ON0A 3ONQA 3DKWA 5FFZA 5HDKA 1UELB 2K9NA 3JRIA 1ONVA 4HG2A 4B3AA 2LG4A 3G71I 2QGUA 1BW6A 1CF7A 1OQYA 2FE3A 3TOBA 3A4CA 2JZYA 2JPBA 2EA4A 3FXJA 2XAGA 1IRGA 3OYLA 1F1ZA 1X2NA 3OR1C 1B59A 3TO6A 1RESA 2XB5A 2F4IA 5ILSA 1OPCA 3K9TA 3G3ZA 5HLIA 1HW5A 2ZSHB 2L7FP 4RAYA 1V4RA 3COAC 1U5TA 4OIQF 3QPLA 1MNMC 1WJFA 2M30A 2O7OA 3VOEA 1QRYA 2LY2A 3BQZA 4HNTA 4AIDA 1K61A 2KMUA 2QM3A 5DDGA 3BLYA 4XR6A 1E17A 1F9NA 1Z3YA 3B73A 2XAJA 1JUMA 3B6AA 2G7HA 1DQUA 2Y48A 2V9VA 4WXDA 1LEBA 1LUJB 2HTSA 5D6FA 3DBLB 4E7IA 3AFHA 4XLFA 1G3YA 1VTNC 1R5GA 1I3QJ 4P9FA 3G1LA 4PUSA 2JSCA 3BR3A 2IW5A 5AONA 4Q5SF 2EZHA 3SZPA 3TBIA 1ZGAA 1N25A 3WU2C 4EJVA 3OL4A 4HSTA 2Y9YA 2OUMA 2E7WA 2KFDA 2JK3A 1FPQA 2KHMA 4BXXJ 3EUAA 4AVZA 2DA7A 5E3LA 3HOSA 2LYCA 2OQGA 2PG4A 3I59B 2K40A 5ICEA 2KL4A 2A05A 1R7JA 1S7EA 4RAGA 2FRHA 3KP6A 1ETYA 2N8GA 2LFBA 1FNNA 5HLGA 1I39A 3ABLH 2PMZN 4GDFA 2K9SA 2Q1ZB 2KJBA 3DFGA 1G4DA 2HGCA 2MH2A 1SD7A 3PSFA 4Y33A 4A0XA 4OINF 2X1DA 2DA1A 5ILVA 3S15J 2KISA 4HLXA 4PFPA 3JAMZ 4F3QA 4B1RA 1D3YA 3DF8A 3H5NA 4A0YA 1WI9A 5IT3A 2GQQA 3IH3A 2CUEA 2DJNA 3KEQA 3Q0VA 3ZMTA 1SAXA 3BTCA 4KFCA 3A01A 1OISA 4KT6A 2QA4I 2E1OA 3VDXA 3U1DA 4KISA 3BWGA 3BZ6A 3FWEA 4AC0A 5F1JA 2VC1A 2VQHA 4E6KG 1VZ0A 1XMXA 2JUCA 1S8NA 5J3LA 4MQVA 3L2UA 1Y8QB 1TQIA 4XMYA 1IUFA 5DM6F 2WB1N 3WTYC 2CUJA 3KP5A 4KNYA 4OIPF 1MW7A 5KAFC 2H09A 3BCAA 4PGHA 1SVOA 5HDNA 4BEHA 3HL2A 1TWHJ 3CO7C 3H9QA 2HQNA 3CMEI 3LMMA 4D5CA 3ELKA 3SEQA 1D1CA 1RKWA 1YHQI 2G7UA 3J80K 2F2EA 2LVSA 4D7MA 1ZARA 3B02A 3MN2A 4QIWN 3CC7I 3BR6A 1Z05A 3BG3A 3GWZA 2EZKA 3DWLE 3R61A 1RUNA 3OYIA 1UZCA 2DU9A 4BBSJ 2NNNA 3QP5A 3HRTA 2FNAA 2UV1A 4XN0A 1TLHB 1MH4A 4KIBA 1GUUA 4MO7A 3FXMA 1LNWA 4FQGA 2EINH 2E5ZA 1VI0A 1P4AA 2HXIA 3AKZA 3ECHA 3KPHA 1DGWY 4GRIA 4ZDOA 3CCUI 2HFHA 2XVCA 2JA7J 1RIOH 4CCOA 5GTHC 3BTIA 1IF1A 2P5LC 4J19A 2PX9A 2Z1DA 5DCMB 5D6EA 3BTLA 1GVJA 2HI3A 3H3ZA 1WH5A 3LWFA 4QTRA 5E3OA 3FBIB 1IZ1A 3OYKA 3L2QA 3HBLA 4B44A 2HQRA 2NNYA 4BAYA 3ESWB 1ETVA 2H94A 4H4KC 1J9IA 1IDYA 3HGYA 1J0RA 5GPAA 3GTJJ 2KDZA 1Y0NA 3N05A 2E2JJ 2P6SA 1GT0C 1YFHA 3BROA 3OL3A 4FE4A 4X0GA 2VJ5A 5LGNA 2EA2A 4M6YA 4NHJA 4IX7A 2Y2ZA 2LTPA 3DU6A 2MD5A 1Y0UA 3PNVA 3OIPA 3SYTA 2H1KA 1ZH5A 3CF5F 3VEPA 1ZR4A 3L2CA 4HLYA 3UKGA 1MJ9A 1S72I 5DM7F 1MBHA 1ZRCA 2W1OA 5J40A 3GTOJ 2BY0A 1WPKA 2PMUA 5EZHA 1S6LA 3OYAA 2BOLA 2LR8A 4AIHA 5IYCJ 4MGRA 2JSPA 2L2OA 3OYGA 4BS9A 2ZSIB 3FXKA 2V1DA 3A0BC 3HOXJ 2R5ZB 1JTYA 4QPQA 1SD6A 4A3GJ 5DV5A 3MMYB 4M74A 3CC2I 2DCEA 1H89C 5LEJA 4XLCA 2UXNA 1MMAA 1BN5A 3V42A 2MABA 3RPUD 1HBXG 1OYWA 2EQRA 2XGCA 4QLCU 3L00A 3GTLJ 5AIPA 1D5VA 3L7WA 2JRTA 2UWMA 1UHSA 3I3LA 4MFDA 4AVPA 1P4WA 2RNJA 2STWA 3ABKH 1B4AA 4RGUA 2WV0A 4HAMA 3WGHA 2KQRA 1QO0D 5JHUA 2K86A 2DA2A 2ZBKA 2EPFA 1SD5A 2R7OA 2NVUB 1W7PA 3EYIA 3CDLA 2NVQJ 5GTIC 2QQ9A 3BOQA 3WE2A 2F5FA 3IH2A 4FCYA 4BJ5C 2E34A 3M07A 3T0YA 3V7RA 3TL4X 2GWRA 2LBFB 1B8IA 3CD6I 2Y69H 3VWBA 2ISZA 4NC7A 2MC4A 4A3KJ 1T38A 1X1BA 3K1PA 2GXAA 1V55H 3M7GA 2IGNA 2YU3A 3DPTA 1WJ5A 2QSHX 3OS2A 4WCGA 4XKVA 1XSDA 2ZFWA 5FD5A 5LGTA 2M5WA 1XPXA 2JA5J 2E60A 3GEZA 3M8EA 3DKYA 3LAJA 3BT9A 5D5VB 1Z7LA 4BHBA 3QQAA 5ICCA 2A5YB 1JXSA 3WHBA 2F4OB 5KCMA 4R79A 1KZHA 2YR2A 4A3FJ 1JGSA 1ETWA 2FMYA 3ZRGA 4IHYA 3LSKA 2VT2A 4PK4A 1VQ5I 3K69A 2A69F 3T8RA 1G6NA 3HRSA 2ZC2A 3JRHA 1G3WA 4U0YA 1F4KA 4JX4A 4EM1A 4A6EA 1UCRA 1FYMA 1YS7A 3DKXA 1ZG3A 2JVGA 3HC7A 3I54A 3HOYJ 1EKEA 3L09A 2VXDA 1HSTA 2W48A 4QSHA 3MKLA 4XONA 3DBHB 3W6JB 1ZG1A 3SXYA 2K85A 1ENHA 2QVOA 4PGGA 3REOA 3DQVC 4MHGA 2WAQN 2FMLA 3S2WA 2X0LA 1R6RA 3ZQHA 2FX0A 2I10A 3HOUJ 1JJ6C 3HEFA 3ROUA 3MKYB 1A36A 3CC4I 4Y13A 1Q1VA 3WTTC 1BR4A 1QQIA 2IA0A 5KK1A 4ZZDA 1D8KA 4ZYAA 1FZPB 2XHKA 2IAIA 2ZKZA 2BHZA 4PZJA 4ESJA 3MCZA 1U2WA 4F93B 1P4XA 1VQNI 3H92A 4XNFA 3OV8A 2CQ7A 2HYGD 3SZGA 3MD2A 5IT9Z 3DLLF 2K02A 5IP7J 3I4PA 2EILH 4B47A 2IEKA 1EH8A 2CQNA 1TT5B 3PM1A 1YYVA 5FLXZ 2F48A 2COBA 3PJRA 5EGOB 1I27A 1R23A 4KICA 2VKEA 1FP2A 5CVRA 3SZTA 2YU9J 2VBXA 2TRTA 4II3A 1R4MB 1ZG5A 3J7AO 4NNJA 1IN4A 4L0ZB 4EM2A 1R9TJ 1HKTA 4HZFA 5IPAA 3IWFA 1ZR2A 3JREA 1IC8A 2L5QA 2ZMEA 1F5TA 1G8XA 1WJDA 3BR2A 5EYRA 2AQFA 4WK8F 1IV6A 2Y0MA 3OYBA 2VC0A 5LHGA 2DPUA 3RZOJ 4W1UA 2CQXA 3L9FA 4MEYF 1XMKA 4V2GA 3N97A 2P6TA 4BHCA 3M4OJ 2L0KA 4G6DA 2IGMA 2BGCA 3I64A 4YIFA 3DXJF 4IPAA 5LHIA 2O3FA 3PUBA 1DP3A 2B0LA 1J59A 2IGOA 3FKJA 3ZQIA 2Y75A 5E79C 3CJTB 2M0CA 5GAHJ 5J1YA 2XB0X 4UVAA 2JWTA 2X6OA 3DPUA 1QNTA 2FQ4A 3QODA 3RTRA 2JA6J 1IAWA 2IXSA 4P55A 2X85A 2JA8J 3T8TA 1DP7P 3CUQA 1D1AA 3DP7A 3FHNA 1MGTA 1Z67A 2FBKA 3R6SA 2EIKH 4M3BA 3CDIA 1FMWA 3ISPA 1TWGJ 4IL6C 2FSWA 3CF2A 2CO5A 2L4MA 3BJ6A 3BQYA 3PQKA 1ZK8A 2FOWA 3HM5A 3BPXA 2AO9A 3I0TA 2KPMA 1CQTA 3QOPA 4WX9A 1SEUA 3LSMA 1B9NA 4JX6A 2V9KA 4BBRJ 4A93J 1I6HJ 2L9RA 1GXPA 4EATA 4UB6C 2K5CA 5FFXA 1XGMA 1BI0A 3FKIJ 3D5SC 4YFKF 3F8CA 4UUSA 2X51A 1A04A 2HVSA 3ABMH 2OC6A 3QYBA 3R0JA 2V1NA 2VXZA 3KP2A 2R0QC 1E0EA 3GYHX 1OLTA 4G8XA 1P92A 5DEQA 4IHSA 5J4YA 1IRZA 1AHDP 1SVLA 4KN7X 1MMSA 4Y3OA 1IRXA 3S1MJ 3GFJA 2RNGA 4CCJA 4UB8C 4RM2A 4IZZA 1OYIA 2DDAA 2IPQX 2ICWG 2KIMA 2A6EF 1JJ8C 2R7WA 3QYFA 2NOJB 1FBUA 1IO2A 1L3LA 4LJZF 3S3OA 1AKHB 5C3EJ 4J00A 1K83J 1U6GA 4C30A 3O2PE 1S5LC 5B3SH 4P1WA 3HOWJ 3BG6A 1V5FA 1MSFC 5EDNA 2FJ1A 4Q47A 3LA3A 3AL0B 4YFNF 1U3EM 1NTCA 1IN7A 4N9HA 3BR5A 4G6QA 2XAQA 3K4KA 1NG6A 2KRCA 2JQ7A 3RPUA 1TC3C 2GM4A 3RJPA 3OWTA 4B3XA 2DFIA 2E5NA 2GOMA 2ZXIA 5E1XA 4HYEA 3BTJA 2FA5A 2Z16A 2BY3A 4IQ4A 2OV7A 2BE5F 3Q9SA 1R49A 3SFIA 3CCMI 2RGVA 1P2FA 1FT9A 4S04A 1UMQA 1KU9A 1H9GA 2L4AA 2NVYJ 2WTEA 3LNQA 2VI6A 3E0JB 2LK2A 2XGDA 3V8KA 3D5RC 3R4KA 2EWNA 3K10A 4ZDPA 5CVUA 3GFMA 4EEFG 1MIJA 2HKOA 2PI0A 3K4BA 1X58A 1RPWA 2QUFA 1E3OC 1W5TA 2H6CA 5J8CA 3QAHA 2R93J 3ERED 4CYDA 3L2VA 3M1EA 1LPQA 2ELJA 2A5WA 3HHHA 4UY8I 1BW5A 4C3IJ 1BIBA 3HPHA 5LD2C 4LG3A 1CF7B 1IN8A 1TWCJ 1GV2A 5D5XB 5HDGA 3L2WA 3GTGJ 3ABUA 1HQCA 1XGOA 2EV6A 1GHCA 3CO6C 2HVRA 1DDNA 3J7AY 2PJRA 3J81Z 5K5RA 1TT0A 4XKWA 1VNDA 3TW6A 1HA8A 2NRAC 2NOGA 1FP1D 1ZAOA 2BEOA 5TISC 2I5UA 3IC7A 3O8HA 1U5TB 1TZLA 3HIFA 1IG7A 3HGGA 3NWSA 4GGGA 4XRSG 2DMQA 3FXQA 2CGPA 2EV0A 2EIMH 1PP7U 2RC4A 3H1CA 3BC8A 1HKSA 2UUZA 1B72A 2CUZA 1RKTA 2PMZA 2M34A 3F6OA 1OCRH 1I5ZA 1ODDA 2STTA 1OCPA 1PUEE 4AU7A 1QZEA 2K4JA 4EJUA 5D5WB 3CUQC 3RKQA 5DCFA 5A2QZ 4IKFA 2DA3A 2TDXA 3RKXA 2NS7A 3S1QJ 4BE1A 4DJAA 3RCOA 1HF0A 4HRIA 1HXDA 3CLQA 1IV8A 3QRFF 4S05A 2CFXA 1TQMA 2W00A 2CW0F 4TV7A 2IS2A 5C4JJ 3PFIA 2L7MP 3WG7H 4XLHA 1RC9A 1WRJA 4FX4A 2VPRA 5EG0A 1FYKA 2EZIA 2FD5A 3EUHC 3TGNA 1YOVB 4CCNA 4E7ZA 4EM0B 1X1PA 2KIFA 3PQJA 3BR0A 4BJ6C 4EMSA 2WB1A 2DMNA 1X2MA 3HOZJ 2NAZA 3WTWC 4A5MA 2V79A 2FBIA 4GYIA 2GA2A 5IP6A 2O6GE 3IWZA 3GZNB 1O4XA 4HOBA 4JBAA 1WKMA 5H6RA 1UHWA 4HNVA 1G59A 3BCBA 2VE9A 4ABZA 3JTHA 3K4NA 4MNUA 3S14J 3GBGA 3PUFA 1SC7A 2L01A 5F6FA 2ACJA 2QKLB 3G4SI 3A01B 2CH0A 3A0HC 2PMHA 2EV5A 3F0CA 1JT0A 5GAEJ 2W84A 4ZYHA 4D5FA 5J4VA 4LB5A 1U8BA 1R00A 4LLLA 3I55I 5E17F 1AWCA 5IYDJ 3BP8A 3CQZJ 2LRDA 3E5XA 2JN6A 4NQWA 4WXHA 5H6QA 2DAOA 1VFCA 2MH9A 2QENA 2DT5A 1UAAA 2A6TA 3KP4A 1BI1A 1WJAA 2DN0A 5E1WA 1XN7A 4E7HA 3PL8A 2DXIA 4QWQA 4A3EJ 2DOEA 4HDUA 2QEXI 3N4MA 1H0MA 3LA2A 3IL2A 4P5OA 2CS3A 3ZQFA 2GZWA 2L54A 3OSFA 1YIJI 1NK2P 2P81A 3JR9A 4BEHB 4ZTJA 5JVGF 4RB2C 1LE8A 3FX3A 4I09A 3TO7A 1BI2A 5FD6A 1WGXA 1XTAA 1JKPC 4HX8A 4ZYDA 4A12A 2A07F 2QQ8A 4IHXA 2E1MB 4HX7A 5DUKA 3M3YJ 5LEKA 3HSEA 4BU2A 3KFWX 4K2EA 3W6VA 3OYFA 3K6GA 3QU6A 5KAIC 6PAXA 3I58A 1PVEA 1Y1WJ 3KIOA 4M3FA 2ME6A 2HR3A 2WBMA 4KDPA 2XC7A 4A3BJ 3SDGA 4F92B 1MBFA 5J47A 3CUOA 1P9QC 4G7OF 3S17J 1FOWA 4XSZF 3DTKA 2FUG2 1KYZA 3TP3A 1JTXA 3LSGA 1RRJA 5F64A 2E2IJ 3HZJA 2LH9A 2FQ3A 1UHMA 2AXLA 4CICA 1MBEA 2BXYA 1LFBA 2Q2EA 3DU5A 3RIRA 3S1RJ 2YUSA 3KYCB 2JMWA 2W7NA 1SFUA 5EEHA 1ETXA 3V7SA 2M1BA 2EJRA 1V5GA 4BY7J 3A2KA 4A3DJ 2W57A 4LK0F 4OWRB 1OFCX 4P96A 3HXLA 4DZPA 3CCVI 1FSHA 5JVTA 4XSXF 3AG1H 1AU7A 4M9SA 2G0EA 2KIUA 2OU2A 3SFZA 2VQGA 2V1UA 1OCOH 3CP8A 4PJJA 4LMYA 2M4KA 4G6TB 3ULQB 3FMRA 2HZTA 1WHUA 3JTGA 2GA1A 2LF7A 1X3WB 4DZJA 4LD5A 4N9IA 4RBOA 3CCEI 4XBFA 2LD5A 1T56A 5HS9A 2BBYA 2P7CB 2EB7A 3H3UA 4RS8A 5DD4A 3VYUB 4BQAA 3MKWB 4HW0A 2IBDA 1A31A 3CCJI 2RQPA 2IS1A 2Z3YA 3HHGA 5E8GA 2L9SA 1D5YA 3O8GA 2XPVA 3FISA 4JYKA 1YE9A 2QF7A 5FB2A 4BQOA 1BR2A 2HOEA 1MJAA 2E19A 2RKHA 2ADUA 3E6BA 2R7QA 5CVVA 1MBJA 2VLAA 4BL0B 4ZTFA 2DA5A 1NK3P 2M9HA 4B43A 4RAFA 4XORA 2ZXHA 4YG2F 3ZP5A 1EA3A 1O57A 2HOSA 5IT9K 3IRQA 1BC8C 3OYNA 4EGZA 1WI3A 4FETA 3R0AA 4E70A 3OYDA 1TBXA 4XLNF 1MSEC 1FTZA 2LDUA 3FXOA 2LKPA 1FYLA 3K2ZA 1EH7A 1LKXA 1YIOA 3WTZA 1ZGWA 2K3PA 3HTSB 3KCCA 5TJJA 3TMOA 2ECCA 2E1CA 2M7BA 4ITVA 1HDDC 1O3SA 1VQKI 3ZN0A 1GV5A 1XX5A 1J7KA 4IHWA 2KJCA 4J01A 2V26A 2EIJH 3K4MA 4NC8A 3KX2A 1W7PB 1BC7C 4U7DA 2BXZA 3P9IA 3JRDA 2ME0A 1HW1A 1JUSA 5TRDA 1R4NB 1Z77A 2F5CA 2K7LA 4BGDA 3T1BA 4G7HF 1LFUP 1OCTC 1AOYA 2A6HF 2BY1A 2VB6A 3H9JA 3P5JA 4ZH4F 2P5VA 4PJLA 2KIQA 3MWMA 3RPQA 2AQEA 1LEAA 3CESA 1FSEA 3R60A 1YRNA 4M71A 3UR3C 1B8IB 1VQ8I 4DGWB 4BE2A 2WC2A 1W0TA 2K9QA 2DT7B 3X2QH 4L5EA 3PSIA 3BY6A 4U88A 5CVJA 3CMYA 2X6YA 2HDCA 1ACIA 2Z99A 4X6AJ 5BQTA 3HTUA 5HNHA 1LVAA 3LSTA 2DK5A 2VL8A 1MDMA 2A61A 2WAQA 4KMUX 4HV6A 1QVTA 2W24A 5DTDA 4GCVA 4AYBN 2L9NA 4JOMA 3J80Z 1GDTA 4BY1J 2GOXB 4LITA 2O9LA 4DW6A 2H8RA 3NRVA 1OKRA 3VYRB 5E3MA 4MTEA 3OYEA 4LGWA 4OOIA 4CSWA 5ILUA 1WVRA 1DGRM 4BUPA 1O3RA 3VYSB 2IT0A 1WH7A 1GLNA 2VASA 3U9GA 2XRLA 4RB3C 2B9SA 1XD7A 1V3FA 2K9LA 1WSUA 5E18F 2DO7A 1ZRDA 2KZGA 4UNOA 2DMPA 4Z2YA 3K2AA 2NVXJ 4I98B 5BPIA 3QP6A 3GLXA 4EJOA 1YITI 2YX4A 3JCUC 3HJEA 2QBYA 1DU6A 2D1HA 5K7ZA 5FROA 1YQAA 3GFIA 3OOPA 2E2HJ 4C2TA 3MEXA 1FTTA 4OAYA 1ZLJA 1VQ6I 5M5YJ 5JR3A 4DBRA 5GADJ 2RDPA 5F0FA 2V6CA 3OYJA 3H5AA 3C1DA 2QYOA 3A1YA 4M9ZA 1K6YA 4WXCA 4ASNA 1V54H 1KU2A 4BH9A 4CXFA 3GTPJ 1J75A 3HDDA 1ZELA 4LG0A 4CZCA 2PEXA 3FF5A 4UVBA 2WA0A 4GFBA 1U9NA 2H6BA 4BXUA 4OMZA 4M6XA 5M5XJ 2F5VA 1QZYA 3K4JA 3FXUA 3D1NI 4IRIA 1FOYA 3SHFA 3I53A 5K5OA 1Z0XA 4DNCA 1TQPA 1MNDA 4AM3A 1M1EB 1RI7A 2HPMA 4HSRA 3GFLA 5HVQC 5E1ZB 5FO5A 3VODA 4GYGA 5D4RA 2UXXA 2MGQA 1A5JA 3ZXSA 1CGPA 3PNTA 1OJLA 2A68F 2VT3A 1XSXA 1QGPA 4PSWA 4FE7A 3GUDA 1KU7A 5FKMA 3JRCA 3LFKA 4HF0A 1ZYRF 2ZMEB 4FT8A 3U21A 3J7ZI 1K78A 1KQ9A 3H36A 1W36C 1FIPA 2KLOA 2I8DA 1Y6IA 5FLVA 3OS0A 2DLLA 2ZJQF 3EPZA 4A3MJ 4UVCA 1LQ1A 1JGGA 4CZZA 5ICFA 4D9JA 3KLNA 2W82A 3W6KB 5AIQA 1BBYA 5L3CA 3P9CA 3C2GA 3AG4H 3GF2A 4BQNA 2FOKA 1T0FC 4I6ZA 1NHAA 2QLZA 3L2RA 1ZTRA 2IP2A 3J7YJ 3P9KA 3W2VA 3MKZA 1VQLI 1SMTA 2DFEA 4KITB 4C9YA 4BDZA 3KZZA 3GO5A 1R5ID 5H2FC 2M7AA 2XPUA 3KETA 1IXRC 2HTJA 3PO2J 2DFFA 3RQ4A 1O7LA 5F0CA 4A6DA 2O8XA 3E6CC 5FGMA 3G2BA 3CUQB 4C2MJ 3QWLA 3E5UA 1QU3A 1YW7A 1OR7A 3CMAI 3I56I 2VODA 2LREA 2W4SA 3ZQCA 2DQRA 3WE3A 3WODF 1Y8RB 4FASD 2HDDA 1BA5A 3FMSA 4NC6A 4A2UA 2DYSH 3JW4A 1I50J 4BJTA 1ETOA 4G94A 2PN6A 5EF6A 5D8LB 3J81K 1RR7A 1POGA 2O61A 2JA2A 5EJCA 3ASOH 3HRUA 4NBQA 4C2UA 3A02A 5F0HA 1RUOA 3G1OA 5IP9J 4HQEA 1ZKGA 3P7NA 1KGSA 2Q8KA 1FOXA 1R36A 3IUOA 2KKOA 2BHYA 4RAZA 1RNLA 2CQQA 3SEZA 1XCVA 3DTEA 1XCBA 4IRGA 2HVQA 1X1DA 3EUHA 3OYCA 1X1AA 4U87A 4CYCA 1V5EA 4F91B 4ETSA 5B1AH 5L3GA 1T08B 4UUSB 2KT0A 4ZJZA 4M6VA 4AUXA 2DTRA 2FU4A 4EGYA 3C2BA 3F8MA 3ZOBA 1D0YA 2P8TA 1D8JA 1PDNC 1PP8F 1EH6A 2L9VA 3FZVA 3CJRB 4ENJA 1XG1A 4HX4A 1YI2I 3FXLA 5IYBJ 1F43A 2Y0SN 3BZKA 2CW7A 4D0PA 3G73A 1X3UA 3K1MA 1T33A 1P7IA 1USSA 1SMYF 3EYYA 3PO3J 2YX7A 4X1EA 1IW7F 2ZJRF 1PUFA 4IOCF 3KEYA 4PJ0C 3MZYA 2CV1A 2E35A 1KONA 4E4HA 4JQFA 1OCZH 3BJOA 1Q1HA 2OZUA 1P6RA 4BE0A 3I5UA 3OSGA 4HA8A 2DPDA 2MG4A 4D7NA 2X6XA 1W36D 2XKOA 2PLYA 4CDGA 1QA6A 1MNEA 3CCSI 3LSHA 2R5YA 1SFOJ 2HPIA 5ERIA 4ZYEA 1TP4A 2V1XA
chains in the Genus database with same CATH topology
1TNSA 3DPLC 1HW2A 1T98A 4M72A 1G3SA 2MLGA 4L5JA 3JAMK 2X4HA 2IJLA 5BS6A 4I0BA 5JI6A 2GIVA 2PQ8A 2VN2A 4CHUA 4O6JA 1S7AA 5KVRA 2VOPA 1MJBA 3C3WA 1RZ4A 2XV4S 3F22A 2MA3A 4ENMA 2H27A 5J6XA 3HUGA 4YIIA 3RDIA 2VBYA 1J2XA 1WWXA 1XGSA 4IHTA 1MZBA 1IN6A 2RVCA 2PJPA 1ON1A 4CO8A 5LLQA 1KQ8A 4EVIA 1R58A 2PBIA 1W7PD 2MC3A 1R5HA 2P7VB 2NYXA 4MTDA 3K0LA 3D5LA 4L9VA 4H0EA 1G3TA 2EFQA 3WTSC 1W4MA 3TKYA 2O0YA 3ZPLA 3VB2A 2D45A 1W5SA 1IRFA 3LQRA 3O6BB 3WTUC 1XDSA 3Q9VA 2P4WA 4ZZLA 3BJAA 4UV8A 1LB2A 1ON2A 2VBWA 2IRFG 4R8HA 2EK5A 2ELHA 3CDHA 2UZKA 5CYVA 4O3MA 4Y17A 1KA8A 4G9YA 1OMIA 3F72A 3E3VA 3CTAA 4I0AA 2J5OA 1E2XA 1K7AA 2CWEA 4U0VA 4PCQA 2IA2A 1Z6TA 5L3BA 2G9WA 5E20A 1ZLKA 2ESHA 2NS0A 2XIGA 1I1GA 2HYFA 3HSFA 1KYWA 4KIFA 5CJ9A 4I02A 5CLSA 4BHPA 2FBHA 4CGZA 1LJ9A 2IA1A 3MFKA 4B09A 5E8IA 3BPVA 4I7HA 4L9JA 3MAJA 3FHZA 3FMQA 3TDUC 2DBBA 3I59A 2EFNA 4GO1A 4KIGA 5F1RA 4ZYGA 1B9MA 5EEGA 2DK8A 1BJAA 1MD0A 3HOTA 1XB4A 1B1BA 3ZMZA 5DUIA 5L3EA 3I71A 4BYYA 3IKVA 5LHHA 1QZZA 1BIAA 2ZXJA 2PFBA 3DV8A 4OIRF 3JSPA 5JFRA 1YS6A 4ENKA 1U8RA 3SQNA 3LAPA 1T39A 1DPUA 1WQ2A 2R7FA 2XUBA 1YW8A 4AD9A 3ZN1A 1K79A 4R1HA 3NQOA 2XAHA 4OU0A 1I6XA 2W85A 3WTXC 2QZ8A 1GXQA 3KZYA 2YPRA 1R1TA 3ZQ7A 1S3JA 1FC3A 1FBSA 4RB0A 3TO9A 3HYIA 4NB5A 4U0WA 4LFUA 4KT5C 3LQQA 1T2KA 4KN4X 1K6OA 1SFXA 3ML6A 5BOXA 1LDKB 5HLHA 5BPDA 2ZJ2A 2P5KA 2VONA 3RI4A 4Y15A 1KQ0A 1TW3A 3V4GA 1L0OC 4FHTA 1R1VA 4F7ZA 1XDUA 3ZMSA 3IKTA 4DQ2A 5K5QA 1QBJA 3DEUA 5DCMA 3GXOA 3HRMA 3E5QA 2DQLA 4HDVA 4KA4A 1FLIA 1Z9CA 2KRFA 1U5TC 4GXOA 3IRRA 1UFMA 4M73A 1Z91A 4EQQA 3WU1B 1JE8A 4L0YB 3LA7A 4P9UA 2M87A 4LLNA 4UV9A 3EQLF 4JK1X 3QPHA 4IRHA 1T0FA 5FLXK 5ED4A 1ZREA 4OIOF 1REPC 1O3QA 2C6YA 3TDZC 2E7XA 2RN7A 3E6DA 3QU3A 3T5XA 1UB9A 2XRNA 1IXSB 1OYYA 3ZMUA 3WG9A 1TTYA 2MLKA 1IUYA 4I01A 1YLFA 1LDJA 3E97A 4UUVA 2A3SA 5K1YA 4HF1A 4EJWA 1Z7UA 4IJAA 2ISYA 2QQBA 3JSOA 1YTYA 2IVMA 2COMA 2ZCWA 4LLGF 4ENNA 3V8LA 3F6VA 1MDMB 1STZA 2OQRA 1U78A 4BNCA 4WF2A 2L3DA 1HSJA 3ZMDA 1ULYA 1O7FA 4OMYA 3TQNA 1HKQA 5HS7A 1TW2A 3KLOA 5ICGA 2XAFA 5LRRA 1SD4A 4EJTA 4IVNA 3RKWA 2QBYB 2ZO4A 3C18A 4WWCA 2ETHA 2VOOA 2EFPA 5L3DA 2D2WA 3RYPA 5DD8A 3V7CA 2CYYA 4YFXF 2EFWA 3CJNA 2QWWA 1R1UA 1C0WA 4HQMA 4LG0B 3EDPA 1FX7A 2XKPA 4LB6B 1B6AA 2HWVA 4EV0A 2F5DA 4RGRA 1ZGJA 2BV6A 3KP3A 5DYMA 2LSOA 3NEUA 2ZNYA 1SFEA 5BMZA 3WGGA 3KEOA 1YW9A 1YO5C 1T6SA 2CG4A 3F23A 3O3KA 2YSRA 2OZ6A 1IXCA 1K78B 4U7BA 2O03A 1QPMA 3F8BA 3ECOA 1ZHFA 4A0ZA 2VBZA 4Q4ZF 2JT1A 3EETA 1XGNA 3C7JA 2XROA 2DW4A 1EV7A 3GVAA 3WGIA 3ABTA 4IXAA 3V8JA 2FEZA 4HV5A 4ESBA 2FF4A 5CVIA 1Z6RA 1ZN2A 5D4SA 1FBQA 2R3SA 4LK1F 2HS5A 3GZ6A 2HEOA 1I1SA 1JHFA 2XGXA 2Q0OA 3IHUA 3F8NA 4IF4A 1ZRFA 5HS8A 2AS5F 4HBLA 2JTVA 4RGSA 2FNPA 4RGXA 2EFOA 4KYWA 3VFZA 3QPTA 2D1VA 5D8KB 3GX4X 1H9TA 1FOKA 3AAFA 4N0BA 3U2RA 1BM9A 4L9NA 2CQKA 3GZ5A 4AIJA 1FY7A 3FXRA 4XRFA 3RKYA 4KMFA 5LRSA 1DUXC 1S7OA 4PDKA 2FXAA 4L18B 2LNBA 2W25A 5A2QK 2WWYA 2BYVE 3WTVC 1IN5A 2Z9OA 3WU0A 2GXBA 2XASA 5LGUA 1YG2A 3GW2A 4XLPF 1TNTA 3MQ0A 2K27A 2RV8A 2Z5UA 2ESNA 2CSOA 3CLOA 2K4BA 2OAZA 4I2OA 1Z1DA 2OA4A 5J8FA 2JPCA 4L5IA 2F5EA 1S29A 1XSVA 5D5UB 3BDDA 2M45A 2L02A 2GXGA 4M9XA 2Z33A 1LDDA 1FWZA 4FX0A 2R7DA 2M8EA 5H20A 4L9TA 4ESFA 4AIKA 2OD5A 3K1NA 3D0SA 4KUMA 2LF8A 3F21A 5L3FA 5LBQA 4UXNA 2J5PA 2QQAA 3F3XA 4B8XA 1JHHA 3HSRA 4A5NA 2VE8A 2HKXA 1O3TA 1R22A 2DI3A 4G7ZF 2OBPA 4HF2A 3M8FA 1KU3A 1USTA 3M9AA 4AWXB 1DPRA 3FM3A 4UHTA 2GAUA 1BI3A 4MEXF 3KP7A 3FM5A 4MQ9F 4Q48A 3TOAA 3RYRA 3Q5FA 1J5YA 3E6MA 2MBFA 3KE2A 4O5VA 3ZMVA 4RB1A 1XMAA 2E1NA 3MZHA 1BOAA 2ZNZA 1MKMA 3F8FA 5HOOA 4ON0A 3DKWA 5FFZA 5HDKA 1ONVA 1CF7A 2FE3A 3TOBA 2JZYA 2JPBA 2EA4A 2XAGA 1IRGA 1F1ZA 1B59A 3TO6A 5ILSA 1OPCA 3K9TA 3G3ZA 5HLIA 1HW5A 4RAYA 1V4RA 3COAC 1U5TA 4OIQF 2M30A 3VOEA 2QM3A 5DDGA 1E17A 1F9NA 3B73A 2XAJA 2G7HA 2Y48A 2V9VA 4WXDA 1LEBA 2HTSA 5D6FA 1G3YA 1VTNC 1R5GA 4P9FA 2JSCA 2IW5A 5AONA 4Q5SF 3SZPA 1ZGAA 4EJVA 2E7WA 1FPQA 3HOSA 2OQGA 2PG4A 3I59B 5ICEA 1R7JA 2FRHA 3KP6A 1FNNA 5HLGA 2KJBA 3DFGA 1G4DA 2HGCA 2MH2A 1SD7A 4A0XA 4OINF 5ILVA 4HLXA 3JAMZ 1D3YA 3DF8A 4A0YA 1WI9A 5IT3A 2GQQA 3KEQA 3ZMTA 1SAXA 4KFCA 3U1DA 3BWGA 3BZ6A 3FWEA 2VC1A 1S8NA 4MQVA 1TQIA 4KNYA 3WTYC 3KP5A 4OIPF 2H09A 4PGHA 5HDNA 3CO7C 2HQNA 3ELKA 2G7UA 3J80K 2F2EA 1ZARA 3B02A 1Z05A 3GWZA 3R61A 1RUNA 2DU9A 2NNNA 3QP5A 3HRTA 2FNAA 1TLHB 4KIBA 1LNWA 1P4AA 3ECHA 2HFHA 2XVCA 1RIOH 1IF1A 2P5LC 5DCMB 5D6EA 1GVJA 3H3ZA 3LWFA 1IZ1A 2HQRA 2NNYA 4BAYA 2H94A 1J9IA 1J0RA 2P6SA 1YFHA 3BROA 5LGNA 2EA2A 4M6YA 4NHJA 2MD5A 1Y0UA 1ZH5A 3VEPA 3L2CA 4HLYA 1MJ9A 1ZRCA 2PMUA 1S6LA 4AIHA 4MGRA 2V1DA 1SD6A 5DV5A 4M74A 5LEJA 2UXNA 1BN5A 1HBXG 1OYWA 4QLCU 3L00A 1D5VA 5AIPA 3L7WA 2JRTA 2UWMA 4AVPA 1P4WA 2RNJA 2STWA 1B4AA 4RGUA 2WV0A 4HAMA 3WGHA 1QO0D 5JHUA 2K86A 2ZBKA 1SD5A 3EYIA 1W7PA 2QQ9A 3BOQA 3WE2A 2F5FA 3T0YA 3V7RA 2GWRA 2ISZA 1T38A 3K1PA 3M7GA 2YU3A 3DPTA 4WCGA 1XSDA 2ZFWA 5FD5A 5LGTA 2M5WA 3GEZA 3M8EA 3LAJA 5D5VB 4BHBA 5ICCA 2A5YB 1JXSA 4R79A 2YR2A 1JGSA 2FMYA 2VT2A 3K69A 2A69F 3T8RA 1G6NA 3HRSA 1G3WA 4U0YA 1F4KA 4EM1A 4A6EA 1UCRA 1FYMA 1YS7A 1ZG3A 3I54A 3L09A 1HSTA 3W6JB 1ZG1A 3SXYA 2QVOA 3REOA 4PGGA 3DQVC 4MHGA 2FMLA 3S2WA 2X0LA 3ROUA 4Y13A 3WTTC 1QQIA 2IA0A 5KK1A 4ZZDA 1FZPB 1D8KA 2XHKA 2ZKZA 4PZJA 4ESJA 3MCZA 1U2WA 1P4XA 3H92A 3OV8A 2HYGD 5IT9Z 2K02A 3I4PA 1EH8A 1YYVA 5FLXZ 1I27A 1R23A 4KICA 1FP2A 5CVRA 3SZTA 2VBXA 1ZG5A 3J7AO 1IN4A 4L0ZB 4EM2A 1HKTA 4HZFA 3IWFA 2ZMEA 1F5TA 4WK8F 2Y0MA 2VC0A 5LHGA 2DPUA 3L9FA 4MEYF 1XMKA 3N97A 2P6TA 4BHCA 4G6DA 2BGCA 3I64A 4YIFA 3DXJF 4IPAA 5LHIA 2O3FA 2B0LA 1J59A 2Y75A 4UVAA 1QNTA 3RTRA 1IAWA 4P55A 3T8TA 1DP7P 3CUQA 3DP7A 1MGTA 2FBKA 3R6SA 3ISPA 2FSWA 2CO5A 2L4MA 3BJ6A 3PQKA 3BPXA 3I0TA 3QOPA 4WX9A 1B9NA 1GXPA 5FFXA 1XGMA 1BI0A 4YFKF 3F8CA 1A04A 3R0JA 2VXZA 3KP2A 3GYHX 4G8XA 5DEQA 1P92A 4IHSA 4KN7X 3GFJA 1OYIA 2IPQX 2KIMA 2A6EF 1FBUA 1L3LA 4LJZF 1U6GA 3O2PE 4Q47A 3LA3A 4YFNF 1U3EM 1IN7A 4N9HA 4G6QA 2XAQA 3RPUA 3RJPA 2DFIA 5E1XA 4HYEA 2FA5A 2BE5F 3Q9SA 2RGVA 1P2FA 1FT9A 4S04A 1KU9A 1H9GA 2L4AA 2WTEA 3V8KA 3R4KA 2EWNA 5CVUA 3GFMA 2HKOA 2PI0A 2QUFA 1W5TA 2H6CA 5J8CA 3QAHA 3ERED 4CYDA 3M1EA 3HHHA 1BIBA 1CF7B 1IN8A 5D5XB 5HDGA 3ABUA 1HQCA 1XGOA 2EV6A 1GHCA 3CO6C 1DDNA 3J81Z 5K5RA 2NRAC 1FP1D 1ZAOA 2BEOA 3IC7A 1U5TB 3HIFA 4GGGA 3FXQA 2CGPA 2EV0A 1PP7U 2RC4A 1HKSA 3F6OA 1I5ZA 1ODDA 2STTA 1PUEE 2K4JA 4EJUA 5D5WB 3CUQC 5DCFA 5A2QZ 2TDXA 3RKXA 1HXDA 3QRFF 4S05A 2CFXA 1TQMA 2CW0F 4TV7A 3PFIA 1WRJA 4FX4A 1FYKA 3TGNA 4EM0B 2KIFA 3PQJA 4EMSA 2NAZA 3WTWC 4A5MA 2V79A 2FBIA 4GYIA 2GA2A 2O6GE 3IWZA 4HOBA 4JBAA 1WKMA 5H6RA 1UHWA 2VE9A 3JTHA 4MNUA 2L01A 5F6FA 2ACJA 2PMHA 2EV5A 2W84A 4ZYHA 4LB5A 1R00A 4LLLA 5E17F 1AWCA 3BP8A 3E5XA 4NQWA 4WXHA 5H6QA 2DAOA 2MH9A 2QENA 2DT5A 3KP4A 1BI1A 5E1WA 1XN7A 4QWQA 4HDUA 3N4MA 1H0MA 3LA2A 3IL2A 4P5OA 2GZWA 2L54A 4RB2C 3FX3A 4I09A 3TO7A 1BI2A 5FD6A 2A07F 4HX8A 4ZYDA 4A12A 4HX7A 5DUKA 5LEKA 3HSEA 3KFWX 4K2EA 3QU6A 6PAXA 3I58A 2HR3A 4KDPA 3CUOA 4G7OF 4XSZF 1KYZA 5F64A 2FQ3A 1UHMA 2AXLA 4CICA 2Q2EA 3RIRA 1SFUA 5EEHA 3V7SA 2M1BA 2EJRA 2W57A 4LK0F 4P96A 1FSHA 5JVTA 4XSXF 4M9SA 2KIUA 2OU2A 3SFZA 2V1UA 4LMYA 3ULQB 3FMRA 2HZTA 3JTGA 2GA1A 2LF7A 4LD5A 4N9IA 4XBFA 5HS9A 2BBYA 2P7CB 2EB7A 3H3UA 4RS8A 5DD4A 4BQAA 4HW0A 2RQPA 2Z3YA 3HHGA 5E8GA 5FB2A 2HOEA 1MJAA 2RKHA 2ADUA 3E6BA 5CVVA 4YG2F 3ZP5A 1O57A 5IT9K 3IRQA 1BC8C 4EGZA 3R0AA 4E70A 1TBXA 4XLNF 2LDUA 1FYLA 2LKPA 3K2ZA 1EH7A 1YIOA 3WTZA 3HTSB 3KCCA 5TJJA 2E1CA 1O3SA 3ZN0A 1J7KA 2KJCA 1W7PB 1BC7C 4U7DA 3P9IA 1HW1A 5TRDA 2F5CA 2K7LA 4G7HF 3T1BA 1AOYA 2A6HF 4ZH4F 2P5VA 3MWMA 3RPQA 1LEAA 1FSEA 3R60A 4M71A 2WC2A 5CVJA 3BY6A 4U88A 2HDCA 2Z99A 5BQTA 3HTUA 1LVAA 3LSTA 2DK5A 1MDMA 2A61A 4KMUX 4HV6A 2W24A 4GCVA 3J80Z 3NRVA 1OKRA 4MTEA 4LGWA 4OOIA 5ILUA 1O3RA 2IT0A 3U9GA 4RB3C 1XD7A 1V3FA 1WSUA 1ZRDA 5E18F 2DO7A 4UNOA 4Z2YA 4I98B 5BPIA 3QP6A 3GLXA 4EJOA 2YX4A 2QBYA 2D1HA 1YQAA 3GFIA 3OOPA 3MEXA 1ZLJA 5JR3A 2RDPA 2V6CA 3C1DA 2QYOA 4M9ZA 4WXCA 4ASNA 1KU2A 4BH9A 4CXFA 1J75A 4LG0A 2PEXA 3FF5A 4UVBA 2H6BA 4BXUA 4OMZA 4M6XA 1QZYA 3FXUA 4IRIA 3SHFA 3I53A 5K5OA 4DNCA 1TQPA 1RI7A 3GFLA 5HVQC 5E1ZB 5FO5A 3VODA 4GYGA 5D4RA 2UXXA 1CGPA 2A68F 2VT3A 1XSXA 1QGPA 3GUDA 1KU7A 3LFKA 4HF0A 1ZYRF 2ZMEB 4FT8A 1K78A 1KQ9A 2DLLA 4UVCA 1LQ1A 4CZZA 5ICFA 3KLNA 3W6KB 5AIQA 1BBYA 5L3CA 3P9CA 3GF2A 2FOKA 1NHAA 2QLZA 2IP2A 3P9KA 1SMTA 3KZZA 3GO5A 3KETA 1IXRC 2HTJA 1O7LA 4A6DA 2O8XA 3E6CC 5FGMA 3CUQB 3E5UA 1YW7A 1OR7A 2VODA 2DQRA 3WE3A 3WODF 3FMSA 4A2UA 3JW4A 4G94A 2PN6A 3J81K 5D8LB 2O61A 3HRUA 1RUOA 4HQEA 3P7NA 1KGSA 2Q8KA 1R36A 2KKOA 4RAZA 1RNLA 1XCVA 1XCBA 4IRGA 3EUHA 4ETSA 5L3GA 2DTRA 2FU4A 4EGYA 3F8MA 1D8JA 2P8TA 1PDNC 1PP8F 1EH6A 3FZVA 4ENJA 4HX4A 3G73A 4D0PA 1X3UA 3K1MA 1USSA 1SMYF 3EYYA 2YX7A 1IW7F 3MZYA 4JQFA 3BJOA 1Q1HA 2OZUA 1P6RA 3I5UA 4HA8A 2DPDA 2XKOA 2PLYA 4CDGA 5ERIA 4ZYEA 2V1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNS A;  3DPL C;  1HW2 A;  1T98 A;  4M72 A;  1G3S A;  2MLG A;  4L5J A;  3JAM K;  2X4H A;  2IJL A;  5BS6 A;  4I0B A;  5JI6 A;  2GIV A;  2PQ8 A;  2VN2 A;  4CHU A;  4O6J A;  1S7A A;  5KVR A;  2VOP A;  1MJB A;  3C3W A;  1RZ4 A;  2XV4 S;  3F22 A;  2MA3 A;  4ENM A;  2H27 A;  5J6X A;  3HUG A;  4YII A;  3RDI A;  2VBY A;  1J2X A;  1WWX A;  1XGS A;  4IHT A;  1MZB A;  1IN6 A;  2RVC A;  2PJP A;  1ON1 A;  4CO8 A;  5LLQ A;  1KQ8 A;  4EVI A;  1R58 A;  2PBI A;  1W7P D;  2MC3 A;  1R5H A;  2P7V B;  2NYX A;  4MTD A;  3K0L A;  3D5L A;  4L9V A;  4H0E A;  1G3T A;  2EFQ A;  3WTS C;  1W4M A;  3TKY A;  2O0Y A;  3ZPL A;  3VB2 A;  2D45 A;  1W5S A;  1IRF A;  3LQR A;  3O6B B;  3WTU C;  1XDS A;  3Q9V A;  2P4W A;  4ZZL A;  3BJA A;  4UV8 A;  1LB2 A;  1ON2 A;  2VBW A;  2IRF G;  4R8H A;  2EK5 A;  2ELH A;  3CDH A;  2UZK A;  5CYV A;  4O3M A;  4Y17 A;  1KA8 A;  4G9Y A;  1OMI A;  3F72 A;  3E3V A;  3CTA A;  4I0A A;  2J5O A;  1E2X A;  1K7A A;  2CWE A;  4U0V A;  4PCQ A;  2IA2 A;  1Z6T A;  5L3B A;  2G9W A;  5E20 A;  1ZLK A;  2ESH A;  2NS0 A;  2XIG A;  1I1G A;  2HYF A;  3HSF A;  1KYW A;  4KIF A;  5CJ9 A;  4I02 A;  5CLS A;  4BHP A;  2FBH A;  4CGZ A;  1LJ9 A;  2IA1 A;  3MFK A;  4B09 A;  5E8I A;  3BPV A;  4I7H A;  4L9J A;  3MAJ A;  3FHZ A;  3FMQ A;  3TDU C;  2DBB A;  3I59 A;  2EFN A;  4GO1 A;  4KIG A;  5F1R A;  4ZYG A;  1B9M A;  5EEG A;  2DK8 A;  1BJA A;  1MD0 A;  3HOT A;  1XB4 A;  1B1B A;  3ZMZ A;  5DUI A;  5L3E A;  3I71 A;  4BYY A;  3IKV A;  5LHH A;  1QZZ A;  1BIA A;  2ZXJ A;  2PFB A;  3DV8 A;  4OIR F;  3JSP A;  5JFR A;  1YS6 A;  4ENK A;  1U8R A;  3SQN A;  3LAP A;  1T39 A;  1DPU A;  1WQ2 A;  2R7F A;  2XUB A;  1YW8 A;  4AD9 A;  3ZN1 A;  1K79 A;  4R1H A;  3NQO A;  2XAH A;  4OU0 A;  1I6X A;  2W85 A;  3WTX C;  2QZ8 A;  1GXQ A;  3KZY A;  2YPR A;  1R1T A;  3ZQ7 A;  1S3J A;  1FC3 A;  1FBS A;  4RB0 A;  3TO9 A;  3HYI A;  4NB5 A;  4U0W A;  4LFU A;  4KT5 C;  3LQQ A;  1T2K A;  4KN4 X;  1K6O A;  1SFX A;  3ML6 A;  5BOX A;  1LDK B;  5HLH A;  5BPD A;  2ZJ2 A;  2P5K A;  2VON A;  3RI4 A;  4Y15 A;  1KQ0 A;  1TW3 A;  3V4G A;  1L0O C;  4FHT A;  1R1V A;  4F7Z A;  1XDU A;  3ZMS A;  3IKT A;  4DQ2 A;  5K5Q A;  1QBJ A;  3DEU A;  5DCM A;  3GXO A;  3HRM A;  3E5Q A;  2DQL A;  4HDV A;  4KA4 A;  1FLI A;  1Z9C A;  2KRF A;  1U5T C;  4GXO A;  3IRR A;  1UFM A;  4M73 A;  1Z91 A;  4EQQ A;  3WU1 B;  1JE8 A;  4L0Y B;  3LA7 A;  4P9U A;  2M87 A;  4LLN A;  4UV9 A;  3EQL F;  4JK1 X;  3QPH A;  4IRH A;  1T0F A;  5FLX K;  5ED4 A;  1ZRE A;  4OIO F;  1REP C;  1O3Q A;  2C6Y A;  3TDZ C;  2E7X A;  2RN7 A;  3E6D A;  3QU3 A;  3T5X A;  1UB9 A;  2XRN A;  1IXS B;  1OYY A;  3ZMU A;  3WG9 A;  1TTY A;  2MLK A;  1IUY A;  4I01 A;  1YLF A;  1LDJ A;  3E97 A;  4UUV A;  2A3S A;  5K1Y A;  4HF1 A;  4EJW A;  1Z7U A;  4IJA A;  2ISY A;  2QQB A;  3JSO A;  1YTY A;  2IVM A;  2COM A;  2ZCW A;  4LLG F;  4ENN A;  3V8L A;  3F6V A;  1MDM B;  1STZ A;  2OQR A;  1U78 A;  4BNC A;  4WF2 A;  2L3D A;  1HSJ A;  3ZMD A;  1ULY A;  1O7F A;  4OMY A;  3TQN A;  1HKQ A;  5HS7 A;  1TW2 A;  3KLO A;  5ICG A;  2XAF A;  5LRR A;  1SD4 A;  4EJT A;  4IVN A;  3RKW A;  2QBY B;  2ZO4 A;  3C18 A;  4WWC A;  2ETH A;  2VOO A;  2EFP A;  5L3D A;  2D2W A;  3RYP A;  5DD8 A;  3V7C A;  2CYY A;  4YFX F;  2EFW A;  3CJN A;  2QWW A;  1R1U A;  1C0W A;  4HQM A;  4LG0 B;  3EDP A;  1FX7 A;  2XKP A;  4LB6 B;  1B6A A;  2HWV A;  4EV0 A;  2F5D A;  4RGR A;  1ZGJ A;  2BV6 A;  3KP3 A;  5DYM A;  2LSO A;  3NEU A;  2ZNY A;  1SFE A;  5BMZ A;  3WGG A;  3KEO A;  1YW9 A;  1YO5 C;  1T6S A;  2CG4 A;  3F23 A;  3O3K A;  2YSR A;  2OZ6 A;  1IXC A;  1K78 B;  4U7B A;  2O03 A;  1QPM A;  3F8B A;  3ECO A;  1ZHF A;  4A0Z A;  2VBZ A;  4Q4Z F;  2JT1 A;  3EET A;  1XGN A;  3C7J A;  2XRO A;  2DW4 A;  1EV7 A;  3GVA A;  3WGI A;  3ABT A;  4IXA A;  3V8J A;  2FEZ A;  4HV5 A;  4ESB A;  2FF4 A;  5CVI A;  1Z6R A;  1ZN2 A;  5D4S A;  1FBQ A;  2R3S A;  4LK1 F;  2HS5 A;  3GZ6 A;  2HEO A;  1I1S A;  1JHF A;  2XGX A;  2Q0O A;  3IHU A;  3F8N A;  4IF4 A;  1ZRF A;  5HS8 A;  2AS5 F;  4HBL A;  2JTV A;  4RGS A;  2FNP A;  4RGX A;  2EFO A;  4KYW A;  3VFZ A;  3QPT A;  2D1V A;  5D8K B;  3GX4 X;  1H9T A;  1FOK A;  3AAF A;  4N0B A;  3U2R A;  1BM9 A;  4L9N A;  2CQK A;  3GZ5 A;  4AIJ A;  1FY7 A;  3FXR A;  4XRF A;  3RKY A;  4KMF A;  5LRS A;  1DUX C;  1S7O A;  4PDK A;  2FXA A;  4L18 B;  2LNB A;  2W25 A;  5A2Q K;  2WWY A;  2BYV E;  3WTV C;  1IN5 A;  2Z9O A;  3WU0 A;  2GXB A;  2XAS A;  5LGU A;  1YG2 A;  3GW2 A;  4XLP F;  1TNT A;  3MQ0 A;  2K27 A;  2RV8 A;  2Z5U A;  2ESN A;  2CSO A;  3CLO A;  2K4B A;  2OAZ A;  4I2O A;  1Z1D A;  2OA4 A;  5J8F A;  2JPC A;  4L5I A;  2F5E A;  1S29 A;  1XSV A;  5D5U B;  3BDD A;  2M45 A;  2L02 A;  2GXG A;  4M9X A;  2Z33 A;  1LDD A;  1FWZ A;  4FX0 A;  2R7D A;  2M8E A;  5H20 A;  4L9T A;  4ESF A;  4AIK A;  2OD5 A;  3K1N A;  3D0S A;  4KUM A;  2LF8 A;  3F21 A;  5L3F A;  5LBQ A;  4UXN A;  2J5P A;  2QQA A;  3F3X A;  4B8X A;  1JHH A;  3HSR A;  4A5N A;  2VE8 A;  2HKX A;  1O3T A;  1R22 A;  2DI3 A;  4G7Z F;  2OBP A;  4HF2 A;  3M8F A;  1KU3 A;  1UST A;  3M9A A;  4AWX B;  1DPR A;  3FM3 A;  4UHT A;  2GAU A;  1BI3 A;  4MEX F;  3KP7 A;  3FM5 A;  4MQ9 F;  4Q48 A;  3TOA A;  3RYR A;  3Q5F A;  1J5Y A;  3E6M A;  2MBF A;  3KE2 A;  4O5V A;  3ZMV A;  4RB1 A;  1XMA A;  2E1N A;  3MZH A;  1BOA A;  2ZNZ A;  1MKM A;  3F8F A;  5HOO A;  4ON0 A;  3DKW A;  5FFZ A;  5HDK A;  1ONV A;  1CF7 A;  2FE3 A;  3TOB A;  2JZY A;  2JPB A;  2EA4 A;  2XAG A;  1IRG A;  1F1Z A;  1B59 A;  3TO6 A;  5ILS A;  1OPC A;  3K9T A;  3G3Z A;  5HLI A;  1HW5 A;  4RAY A;  1V4R A;  3COA C;  1U5T A;  4OIQ F;  2M30 A;  3VOE A;  2QM3 A;  5DDG A;  1E17 A;  1F9N A;  3B73 A;  2XAJ A;  2G7H A;  2Y48 A;  2V9V A;  4WXD A;  1LEB A;  2HTS A;  5D6F A;  1G3Y A;  1VTN C;  1R5G A;  4P9F A;  2JSC A;  2IW5 A;  5AON A;  4Q5S F;  3SZP A;  1ZGA A;  4EJV A;  2E7W A;  1FPQ A;  3HOS A;  2OQG A;  2PG4 A;  3I59 B;  5ICE A;  1R7J A;  2FRH A;  3KP6 A;  1FNN A;  5HLG A;  2KJB A;  3DFG A;  1G4D A;  2HGC A;  2MH2 A;  1SD7 A;  4A0X A;  4OIN F;  5ILV A;  4HLX A;  3JAM Z;  1D3Y A;  3DF8 A;  4A0Y A;  1WI9 A;  5IT3 A;  2GQQ A;  3KEQ A;  3ZMT A;  1SAX A;  4KFC A;  3U1D A;  3BWG A;  3BZ6 A;  3FWE A;  2VC1 A;  1S8N A;  4MQV A;  1TQI A;  4KNY A;  3WTY C;  3KP5 A;  4OIP F;  2H09 A;  4PGH A;  5HDN A;  3CO7 C;  2HQN A;  3ELK A;  2G7U A;  3J80 K;  2F2E A;  1ZAR A;  3B02 A;  1Z05 A;  3GWZ A;  3R61 A;  1RUN A;  2DU9 A;  2NNN A;  3QP5 A;  3HRT A;  2FNA A;  1TLH B;  4KIB A;  1LNW A;  1P4A A;  3ECH A;  2HFH A;  2XVC A;  1RIO H;  1IF1 A;  2P5L C;  5DCM B;  5D6E A;  1GVJ A;  3H3Z A;  3LWF A;  1IZ1 A;  2HQR A;  2NNY A;  4BAY A;  2H94 A;  1J9I A;  1J0R A;  2P6S A;  1YFH A;  3BRO A;  5LGN A;  2EA2 A;  4M6Y A;  4NHJ A;  2MD5 A;  1Y0U A;  1ZH5 A;  3VEP A;  3L2C A;  4HLY A;  1MJ9 A;  1ZRC A;  2PMU A;  1S6L A;  4AIH A;  4MGR A;  2V1D A;  1SD6 A;  5DV5 A;  4M74 A;  5LEJ A;  2UXN A;  1BN5 A;  1HBX G;  1OYW A;  4QLC U;  3L00 A;  1D5V A;  5AIP A;  3L7W A;  2JRT A;  2UWM A;  4AVP A;  1P4W A;  2RNJ A;  2STW A;  1B4A A;  4RGU A;  2WV0 A;  4HAM A;  3WGH A;  1QO0 D;  5JHU A;  2K86 A;  2ZBK A;  1SD5 A;  3EYI A;  1W7P A;  2QQ9 A;  3BOQ A;  3WE2 A;  2F5F A;  3T0Y A;  3V7R A;  2GWR A;  2ISZ A;  1T38 A;  3K1P A;  3M7G A;  2YU3 A;  3DPT A;  4WCG A;  1XSD A;  2ZFW A;  5FD5 A;  5LGT A;  2M5W A;  3GEZ A;  3M8E A;  3LAJ A;  5D5V B;  4BHB A;  5ICC A;  2A5Y B;  1JXS A;  4R79 A;  2YR2 A;  1JGS A;  2FMY A;  2VT2 A;  3K69 A;  2A69 F;  3T8R A;  1G6N A;  3HRS A;  1G3W A;  4U0Y A;  1F4K A;  4EM1 A;  4A6E A;  1UCR A;  1FYM A;  1YS7 A;  1ZG3 A;  3I54 A;  3L09 A;  1HST A;  3W6J B;  1ZG1 A;  3SXY A;  2QVO A;  3REO A;  4PGG A;  3DQV C;  4MHG A;  2FML A;  3S2W A;  2X0L A;  3ROU A;  4Y13 A;  3WTT C;  1QQI A;  2IA0 A;  5KK1 A;  4ZZD A;  1FZP B;  1D8K A;  2XHK A;  2ZKZ A;  4PZJ A;  4ESJ A;  3MCZ A;  1U2W A;  1P4X A;  3H92 A;  3OV8 A;  2HYG D;  5IT9 Z;  2K02 A;  3I4P A;  1EH8 A;  1YYV A;  5FLX Z;  1I27 A;  1R23 A;  4KIC A;  1FP2 A;  5CVR A;  3SZT A;  2VBX A;  1ZG5 A;  3J7A O;  1IN4 A;  4L0Z B;  4EM2 A;  1HKT A;  4HZF A;  3IWF A;  2ZME A;  1F5T A;  4WK8 F;  2Y0M A;  2VC0 A;  5LHG A;  2DPU A;  3L9F A;  4MEY F;  1XMK A;  3N97 A;  2P6T A;  4BHC A;  4G6D A;  2BGC A;  3I64 A;  4YIF A;  3DXJ F;  4IPA A;  5LHI A;  2O3F A;  2B0L A;  1J59 A;  2Y75 A;  4UVA A;  1QNT A;  3RTR A;  1IAW A;  4P55 A;  3T8T A;  1DP7 P;  3CUQ A;  3DP7 A;  1MGT A;  2FBK A;  3R6S A;  3ISP A;  2FSW A;  2CO5 A;  2L4M A;  3BJ6 A;  3PQK A;  3BPX A;  3I0T A;  3QOP A;  4WX9 A;  1B9N A;  1GXP A;  5FFX A;  1XGM A;  1BI0 A;  4YFK F;  3F8C A;  1A04 A;  3R0J A;  2VXZ A;  3KP2 A;  3GYH X;  4G8X A;  5DEQ A;  1P92 A;  4IHS A;  4KN7 X;  3GFJ A;  1OYI A;  2IPQ X;  2KIM A;  2A6E F;  1FBU A;  1L3L A;  4LJZ F;  1U6G A;  3O2P E;  4Q47 A;  3LA3 A;  4YFN F;  1U3E M;  1IN7 A;  4N9H A;  4G6Q A;  2XAQ A;  3RPU A;  3RJP A;  2DFI A;  5E1X A;  4HYE A;  2FA5 A;  2BE5 F;  3Q9S A;  2RGV A;  1P2F A;  1FT9 A;  4S04 A;  1KU9 A;  1H9G A;  2L4A A;  2WTE A;  3V8K A;  3R4K A;  2EWN A;  5CVU A;  3GFM A;  2HKO A;  2PI0 A;  2QUF A;  1W5T A;  2H6C A;  5J8C A;  3QAH A;  3ERE D;  4CYD A;  3M1E A;  3HHH A;  1BIB A;  1CF7 B;  1IN8 A;  5D5X B;  5HDG A;  3ABU A;  1HQC A;  1XGO A;  2EV6 A;  1GHC A;  3CO6 C;  1DDN A;  3J81 Z;  5K5R A;  2NRA C;  1FP1 D;  1ZAO A;  2BEO A;  3IC7 A;  1U5T B;  3HIF A;  4GGG A;  3FXQ A;  2CGP A;  2EV0 A;  1PP7 U;  2RC4 A;  1HKS A;  3F6O A;  1I5Z A;  1ODD A;  2STT A;  1PUE E;  2K4J A;  4EJU A;  5D5W B;  3CUQ C;  5DCF A;  5A2Q Z;  2TDX A;  3RKX A;  1HXD A;  3QRF F;  4S05 A;  2CFX A;  1TQM A;  2CW0 F;  4TV7 A;  3PFI A;  1WRJ A;  4FX4 A;  1FYK A;  3TGN A;  4EM0 B;  2KIF A;  3PQJ A;  4EMS A;  2NAZ A;  3WTW C;  4A5M A;  2V79 A;  2FBI A;  4GYI A;  2GA2 A;  2O6G E;  3IWZ A;  4HOB A;  4JBA A;  1WKM A;  5H6R A;  1UHW A;  2VE9 A;  3JTH A;  4MNU A;  2L01 A;  5F6F A;  2ACJ A;  2PMH A;  2EV5 A;  2W84 A;  4ZYH A;  4LB5 A;  1R00 A;  4LLL A;  5E17 F;  1AWC A;  3BP8 A;  3E5X A;  4NQW A;  4WXH A;  5H6Q A;  2DAO A;  2MH9 A;  2QEN A;  2DT5 A;  3KP4 A;  1BI1 A;  5E1W A;  1XN7 A;  4QWQ A;  4HDU A;  3N4M A;  1H0M A;  3LA2 A;  3IL2 A;  4P5O A;  2GZW A;  2L54 A;  4RB2 C;  3FX3 A;  4I09 A;  3TO7 A;  1BI2 A;  5FD6 A;  2A07 F;  4HX8 A;  4ZYD A;  4A12 A;  4HX7 A;  5DUK A;  5LEK A;  3HSE A;  3KFW X;  4K2E A;  3QU6 A;  6PAX A;  3I58 A;  2HR3 A;  4KDP A;  3CUO A;  4G7O F;  4XSZ F;  1KYZ A;  5F64 A;  2FQ3 A;  1UHM A;  2AXL A;  4CIC A;  2Q2E A;  3RIR A;  1SFU A;  5EEH A;  3V7S A;  2M1B A;  2EJR A;  2W57 A;  4LK0 F;  4P96 A;  1FSH A;  5JVT A;  4XSX F;  4M9S A;  2KIU A;  2OU2 A;  3SFZ A;  2V1U A;  4LMY A;  3ULQ B;  3FMR A;  2HZT A;  3JTG A;  2GA1 A;  2LF7 A;  4LD5 A;  4N9I A;  4XBF A;  5HS9 A;  2BBY A;  2P7C B;  2EB7 A;  3H3U A;  4RS8 A;  5DD4 A;  4BQA A;  4HW0 A;  2RQP A;  2Z3Y A;  3HHG A;  5E8G A;  5FB2 A;  2HOE A;  1MJA A;  2RKH A;  2ADU A;  3E6B A;  5CVV A;  4YG2 F;  3ZP5 A;  1O57 A;  5IT9 K;  3IRQ A;  1BC8 C;  4EGZ A;  3R0A A;  4E70 A;  1TBX A;  4XLN F;  2LDU A;  1FYL A;  2LKP A;  3K2Z A;  1EH7 A;  1YIO A;  3WTZ A;  3HTS B;  3KCC A;  5TJJ A;  2E1C A;  1O3S A;  3ZN0 A;  1J7K A;  2KJC A;  1W7P B;  1BC7 C;  4U7D A;  3P9I A;  1HW1 A;  5TRD A;  2F5C A;  2K7L A;  4G7H F;  3T1B A;  1AOY A;  2A6H F;  4ZH4 F;  2P5V A;  3MWM A;  3RPQ A;  1LEA A;  1FSE A;  3R60 A;  4M71 A;  2WC2 A;  5CVJ A;  3BY6 A;  4U88 A;  2HDC A;  2Z99 A;  5BQT A;  3HTU A;  1LVA A;  3LST A;  2DK5 A;  1MDM A;  2A61 A;  4KMU X;  4HV6 A;  2W24 A;  4GCV A;  3J80 Z;  3NRV A;  1OKR A;  4MTE A;  4LGW A;  4OOI A;  5ILU A;  1O3R A;  2IT0 A;  3U9G A;  4RB3 C;  1XD7 A;  1V3F A;  1WSU A;  1ZRD A;  5E18 F;  2DO7 A;  4UNO A;  4Z2Y A;  4I98 B;  5BPI A;  3QP6 A;  3GLX A;  4EJO A;  2YX4 A;  2QBY A;  2D1H A;  1YQA A;  3GFI A;  3OOP A;  3MEX A;  1ZLJ A;  5JR3 A;  2RDP A;  2V6C A;  3C1D A;  2QYO A;  4M9Z A;  4WXC A;  4ASN A;  1KU2 A;  4BH9 A;  4CXF A;  1J75 A;  4LG0 A;  2PEX A;  3FF5 A;  4UVB A;  2H6B A;  4BXU A;  4OMZ A;  4M6X A;  1QZY A;  3FXU A;  4IRI A;  3SHF A;  3I53 A;  5K5O A;  4DNC A;  1TQP A;  1RI7 A;  3GFL A;  5HVQ C;  5E1Z B;  5FO5 A;  3VOD A;  4GYG A;  5D4R A;  2UXX A;  1CGP A;  2A68 F;  2VT3 A;  1XSX A;  1QGP A;  3GUD A;  1KU7 A;  3LFK A;  4HF0 A;  1ZYR F;  2ZME B;  4FT8 A;  1K78 A;  1KQ9 A;  2DLL A;  4UVC A;  1LQ1 A;  4CZZ A;  5ICF A;  3KLN A;  3W6K B;  5AIQ A;  1BBY A;  5L3C A;  3P9C A;  3GF2 A;  2FOK A;  1NHA A;  2QLZ A;  2IP2 A;  3P9K A;  1SMT A;  3KZZ A;  3GO5 A;  3KET A;  1IXR C;  2HTJ A;  1O7L A;  4A6D A;  2O8X A;  3E6C C;  5FGM A;  3CUQ B;  3E5U A;  1YW7 A;  1OR7 A;  2VOD A;  2DQR A;  3WE3 A;  3WOD F;  3FMS A;  4A2U A;  3JW4 A;  4G94 A;  2PN6 A;  3J81 K;  5D8L B;  2O61 A;  3HRU A;  1RUO A;  4HQE A;  3P7N A;  1KGS A;  2Q8K A;  1R36 A;  2KKO A;  4RAZ A;  1RNL A;  1XCV A;  1XCB A;  4IRG A;  3EUH A;  4ETS A;  5L3G A;  2DTR A;  2FU4 A;  4EGY A;  3F8M A;  1D8J A;  2P8T A;  1PDN C;  1PP8 F;  1EH6 A;  3FZV A;  4ENJ A;  4HX4 A;  3G73 A;  4D0P A;  1X3U A;  3K1M A;  1USS A;  1SMY F;  3EYY A;  2YX7 A;  1IW7 F;  3MZY A;  4JQF A;  3BJO A;  1Q1H A;  2OZU A;  1P6R A;  3I5U A;  4HA8 A;  2DPD A;  2XKO A;  2PLY A;  4CDG A;  5ERI A;  4ZYE A;  2V1X A; 
#chains in the Genus database with same CATH topology
 1TNS A;  3DPL C;  4D1Q A;  1IDZ A;  1HW2 A;  2XGE A;  1T98 A;  2QKM B;  3OIO A;  4M3G A;  4M72 A;  3H0D A;  2QCO A;  3JRG A;  1G3S A;  3PIP F;  2MLG A;  4L5J A;  3JAM K;  2X4H A;  2Z2S B;  2IJL A;  5EZG A;  5BS6 A;  4YEJ A;  4I0B A;  1ETK A;  5DS9 A;  1ERD A;  3IH4 A;  1A35 A;  5JI6 A;  2GIV A;  3B6C A;  2PQ8 A;  2VN2 A;  2MW8 A;  4CHU A;  5KHD A;  2KZV A;  1MMN A;  4O6J A;  1S7A A;  2HOA A;  5KVR A;  2VOP A;  1MJB A;  3C3W A;  1RZ4 A;  2XV4 S;  1WFX A;  3K70 C;  3IAM 2;  3F22 A;  1J09 A;  2MA3 A;  4ENM A;  2H27 A;  5J6X A;  5FKL A;  3LSP A;  1Y39 A;  3HUG A;  2VQC A;  4YII A;  2XAU A;  1F36 A;  4DOZ A;  3RDI A;  2VBY A;  1J2X A;  4YIR X;  1WWX A;  1XGS A;  4IHT A;  1MZB A;  5IOY A;  1IN6 A;  3HPG A;  2RVC A;  2PJP A;  4C3J J;  1ON1 A;  1H88 C;  1MBG A;  2ECB A;  4CO8 A;  4F55 A;  2ZXW H;  2WY8 Q;  5LLQ A;  1KQ8 A;  2BW3 A;  4EVI A;  1R58 A;  2PBI A;  4LIU A;  1W7P D;  2MC3 A;  2PJR B;  2VIX A;  3H9G A;  1R5H A;  2P7V B;  3ZQQ A;  1TL8 A;  3JRF A;  2NYX A;  2WAD A;  4MTD A;  1MH3 A;  5JHF A;  3OMY A;  2K3F A;  3K0L A;  3D5L A;  4L9V A;  1N77 A;  4H0E A;  1G3T A;  2EFQ A;  3WTS C;  2HU9 A;  2VQL A;  2B63 J;  1W5C C;  1W4M A;  3TKY A;  2O0Y A;  3ZPL A;  1P7J A;  3VB2 A;  2D45 A;  2LKX A;  1W5S A;  1IRF A;  3LQR A;  3O6B B;  2DFH A;  3WTU C;  3WHC A;  2R7U A;  1B72 B;  1XDS A;  3Q9V A;  1SFK A;  2P4W A;  2XPW A;  4ZZL A;  3LSR A;  3BJA A;  3CZ6 A;  4UV8 A;  4XID A;  1ON2 A;  1LB2 A;  4BQQ A;  1JUP A;  2F4M B;  2VBW A;  2IRF G;  5GAG J;  4R8H A;  4HNU A;  3GTQ J;  2EK5 A;  2ELH A;  3CDH A;  2DT6 A;  1FMV A;  2NXN B;  5GPC A;  1OR7 C;  1QVU A;  3C2H A;  2UZK A;  2DA4 A;  3VPR A;  5CYV A;  2BZT A;  4MLO A;  4O3M A;  4XOP A;  4Y17 A;  3KYL A;  2M0M A;  1KA8 A;  4G9Y A;  1OMI A;  2M3A A;  3F72 A;  3E3V A;  4N4N B;  3CTA A;  4I0A A;  3S1N J;  2J5O A;  3DTI A;  1E2X A;  3RSN A;  1K7A A;  5K7F A;  2ELK A;  5EG0 B;  2E36 A;  3Q3S A;  2CWE A;  3M8J A;  1JT6 A;  2TCT A;  1NH3 A;  5FRM A;  1VQ4 I;  4U0V A;  2DTZ A;  4PCQ A;  2JRM A;  1WJE A;  3W2W A;  2X1C A;  4CUG A;  2IA2 A;  3HKZ N;  5JLX A;  2VJJ A;  2VKH A;  3BG7 A;  1Z6T A;  5L3B A;  1HC8 A;  2G9W A;  5E20 A;  1ZLK A;  4A3J J;  2ESH A;  2NS0 A;  2XIG A;  3CCQ I;  1I1G A;  1APL C;  4II2 A;  2HYF A;  3HSF A;  4PSX A;  1KYW A;  4KIF A;  5CJ9 A;  4I02 A;  5CLS A;  4A3L J;  2XF7 A;  4RDU A;  4PFO A;  4BHP A;  2FBH A;  4CGZ A;  1LJ9 A;  2IA1 A;  3MFK A;  4A69 C;  2GLO A;  3K70 D;  3G1M A;  3EUK L;  4NQW B;  4B09 A;  3NAR A;  1K4S A;  5E8I A;  4E7S A;  2KDO A;  3BPV A;  1R71 A;  3S2D J;  3OIQ A;  4A3I J;  4I7H A;  4L9J A;  3MAJ A;  3FHZ A;  3FMQ A;  3GME A;  3TDU C;  2DBB A;  3I59 A;  3DLA A;  4YEL A;  2EFN A;  4GO1 A;  4KIG A;  5F1R A;  4ZYG A;  4XIC A;  1Y56 A;  1HOM A;  1HDP A;  1B9M A;  4RLF A;  1LE8 B;  5EEG A;  2DK8 A;  1BJA A;  1MD0 A;  2VUM J;  3HOT A;  1XB4 A;  1B1B A;  3ZMZ A;  5DUI A;  5L3E A;  3I71 A;  4BYY A;  1PYV A;  2HXO A;  3IKV A;  1VQP I;  5B66 C;  1GVD A;  5LHH A;  3RZD J;  1QZZ A;  1BIA A;  1TWA J;  4E7K A;  2ZXJ A;  4QPO A;  2PFB A;  3DV8 A;  4XQF A;  4ANJ A;  4XK4 A;  2R7V A;  4OIR F;  3JSP A;  5JFR A;  1FIA A;  1YS6 A;  2R7R A;  4I76 A;  4ENK A;  1U8R A;  1EF4 A;  4Y52 J;  1BOB A;  4M3E A;  3SQN A;  3LSI A;  1YJ9 I;  2RAE A;  3LAP A;  3F9K A;  3HOV J;  3VSK A;  1T39 A;  2CV2 A;  1YJW I;  4JX5 A;  4G12 A;  1DPU A;  1WQ2 A;  5LFA A;  1FEX A;  2R7F A;  2XUB A;  1YW8 A;  4AD9 A;  3ZN1 A;  5EEA A;  3ZR8 X;  2R4G A;  3AL0 C;  2Q2E B;  1K79 A;  4R1H A;  3NQO A;  2XAH A;  4OU0 A;  1I6X A;  2W85 A;  2ID3 A;  3WTX C;  3FK6 A;  2QZ8 A;  2Y9Z A;  1N78 A;  1GXQ A;  2V4J C;  2WAF A;  3KZY A;  3GTK J;  2JUG A;  2YPR A;  1R1T A;  3ZQ7 A;  5C44 J;  1S3J A;  1FC3 A;  3HG9 A;  1RR8 C;  1T95 A;  1SAU A;  1FBS A;  3ERM A;  4RB0 A;  3TO9 A;  3HYI A;  4NB5 A;  2OTJ I;  4U0W A;  4LFU A;  2R7X A;  4KT5 C;  4BAC A;  3LQQ A;  1X4P A;  1T2K A;  3L1P A;  2MFZ A;  4KN4 X;  1K6O A;  2H1L A;  5M3F J;  1QHH D;  1SFX A;  3ML6 A;  5BOX A;  1LDK B;  5HLH A;  5BPD A;  2ZJ2 A;  3OOU A;  2P5K A;  5GP9 A;  5TGT A;  2VON A;  3I4N J;  3CMM A;  1U0J A;  3RI4 A;  4Y15 A;  1KQ0 A;  1TW3 A;  3V4G A;  1LVK A;  1MMG A;  2V6E A;  1L0O C;  4I99 C;  3QPS A;  4PJN A;  3LFU A;  4NDL A;  3S32 A;  3PIO F;  4FHT A;  1R1V A;  4F7Z A;  1XC5 A;  2V9P A;  1XDU A;  3ZMS A;  1E3P A;  4M3D A;  3IKT A;  4DQ2 A;  5K5Q A;  5CPR B;  3UNG C;  1QBJ A;  2X6W A;  3DEU A;  5DCM A;  3GXO A;  3HRM A;  3E7L A;  3LL7 A;  5FJ8 J;  3E5Q A;  2DQL A;  3S93 A;  2IS4 A;  4HDV A;  4KA4 A;  1FLI A;  1YJN I;  1Z9C A;  2KRF A;  4V2F A;  1U5T C;  4GXO A;  4W97 A;  3IRR A;  2O5R A;  1UFM A;  4M73 A;  1Z91 A;  4EQQ A;  3WU1 B;  1JE8 A;  4L0Y B;  2R7S A;  3LA7 A;  4P9U A;  2M87 A;  3DBR B;  3U1K A;  4UV9 A;  1IGN A;  4LLN A;  3QOE A;  3EQL F;  3NAU A;  4JK1 X;  3JRB A;  2R7T A;  4RLQ A;  3QPH A;  4LIV A;  2OF7 A;  4IRH A;  1T0F A;  5FLX K;  2VKD A;  2DMU A;  5ED4 A;  1ZRE A;  3BG9 A;  4OIO F;  1XS9 A;  1FJL A;  1Y1V J;  4C3H J;  2X1E A;  2ZJP F;  4PJM A;  1K4T A;  2NS8 A;  4CCM A;  5IY5 H;  1O3Q A;  1REP C;  2C6Y A;  3TDZ C;  2E7X A;  2RN7 A;  3PNY A;  4CCK A;  4AYB A;  2RQQ A;  3E6D A;  3QU3 A;  3T5X A;  4DYC A;  1UB9 A;  2Y30 A;  4DYQ A;  2XRN A;  3TW7 A;  2LKS A;  2LLK A;  2VKV A;  1ETQ A;  1IXS B;  3H5R A;  1OYY A;  3ZMU A;  2ZB9 A;  3WG9 A;  1TTY A;  2MLK A;  2R5Z A;  2AHQ A;  1YRN B;  1IUY A;  4I01 A;  4A3C J;  4XOT A;  3QYE A;  5K7H A;  1IJW C;  1YLF A;  1LDJ A;  1WJC A;  3E97 A;  4UUV A;  4XLE A;  2A3S A;  1N75 A;  1E3H A;  2JVH A;  3BR1 A;  5K1Y A;  4HF1 A;  4EJW A;  1Z7U A;  4IJA A;  2ISY A;  2P0W A;  3G6E I;  1HCR A;  2QQB A;  4B4C A;  2HZD A;  3JSO A;  2IVM A;  1YTY A;  2COM A;  2ZCW A;  4LLG F;  4ENN A;  1NG7 A;  1PJR A;  2B7E A;  5IOZ A;  2XDV A;  3V8L A;  3F6V A;  1MDM B;  1STZ A;  2OQR A;  1U78 A;  1I3A A;  4E7J A;  4BNC A;  5J1U A;  1BJZ A;  4Y4R A;  4RM3 A;  4WF2 A;  2VJ4 A;  2XF6 A;  2NVT J;  2L3D A;  1HSJ A;  3ZMD A;  1ULY A;  1O7F A;  4OMY A;  1Z3X A;  3ZGK A;  2ID6 A;  4KJZ A;  3OY9 A;  1S9H A;  3OR2 C;  3CCR I;  3TQN A;  1HKQ A;  2YS9 A;  3IP4 B;  5HS7 A;  1TW2 A;  2IGK A;  3ZQG A;  2L7Z A;  4IHV A;  3KLO A;  2WV1 A;  4Z6Y A;  5ICG A;  1G2H A;  4YRV A;  2LBF A;  2XAF A;  3LOC A;  5LRR A;  1SD4 A;  3DCF A;  1X19 A;  4EJT A;  4IVN A;  1BL0 A;  3RKW A;  2M8G X;  2QBY B;  2ZO4 A;  3C18 A;  4WWC A;  4XKB A;  2ETH A;  2VOO A;  1D0Z A;  1SAN A;  2EFP A;  2E1M C;  5L3D A;  3W2A A;  2D2W A;  2KRH A;  3GCM A;  5CQE A;  3RYP A;  5DD8 A;  3V7C A;  2CYY A;  4YFX F;  3K7A J;  2EZL A;  2EFW A;  3CJN A;  2QWW A;  1R1U A;  1C0W A;  4HQM A;  4LG0 B;  2VJI A;  3EDP A;  3GLL A;  1FX7 A;  2CU7 A;  2XKP A;  3H35 A;  3NWT A;  4LB6 B;  3S3N A;  1B6A A;  2HWV A;  4EV0 A;  3OYM A;  3K4L A;  4B48 A;  2EBI A;  3Q0W A;  5M3M J;  2F5D A;  3GTM J;  4RGR A;  1ZGJ A;  2BV6 A;  3JRA A;  3KP3 A;  4BDY A;  2LY9 A;  5DYM A;  3KZI C;  2DJI A;  1ITY A;  2E71 A;  1UG2 A;  2LSO A;  2DOA A;  3NEU A;  1EJ9 A;  1WCM J;  2LP0 A;  2ZNY A;  4XN3 A;  1SFE A;  5BMZ A;  1YX5 A;  4HEA 2;  4XKC A;  3WGG A;  3KEO A;  1D1B A;  1YW9 A;  4HPQ A;  3TP0 A;  1YO5 C;  2CW8 A;  1T6S A;  2CG4 A;  3I4M J;  3F23 A;  3O3K A;  2DOF A;  2MSY A;  3A03 A;  3FIW A;  4RMN A;  2YSR A;  1A6I A;  3TED A;  1VQ7 I;  2OZ6 A;  5BNG A;  3ASN H;  2R7Z J;  1VQO I;  1VF9 A;  4XLA A;  1IXC A;  1K78 B;  2KP6 A;  5B1B H;  4U7B A;  3ZCO A;  2O03 A;  1QPM A;  3F8B A;  5F27 A;  5FKK A;  3ECO A;  2CMP A;  1ZHF A;  4A0Z A;  4BKX A;  2VBZ A;  2OCC H;  3KYD B;  4Q4Z F;  2XF5 A;  1DU0 A;  2JT1 A;  3EET A;  1SVM A;  2R92 J;  4IOA F;  1VQ9 I;  2WY7 Q;  3FDY A;  3DEW A;  3CCY A;  1UJ8 A;  1XGN A;  5C4X J;  5JLW A;  5KNL A;  3C7J A;  2XRO A;  2K9M A;  2DW4 A;  1JI8 A;  1D0X A;  1EV7 A;  2EH3 A;  3GVA A;  1TWF J;  3WGI A;  3ABT A;  4IXA A;  9ANT A;  4BXF A;  5EGO A;  3V8J A;  2H8W A;  2FEZ A;  3MZ8 A;  4HV5 A;  2FF4 A;  5CKT A;  5CVI A;  1Z6R A;  3Q0U A;  4ESB A;  1ZN2 A;  4FIS A;  5HNF A;  3OS1 A;  5D4S A;  4DYR A;  2V7F A;  3MVP A;  1FBQ A;  2R3S A;  1WJB A;  2HS5 A;  2HYJ A;  4LK1 F;  3VYT B;  3GZ6 A;  3S3M A;  2HEO A;  1I1S A;  1Z21 A;  1RET A;  1JHF A;  2DDB A;  4IQJ A;  2XGX A;  2HQ5 A;  2Q0O A;  3IHU A;  3F8N A;  4IF4 A;  1ZRF A;  5CQG A;  5HS8 A;  4DBQ A;  2AS5 F;  3H0G J;  1ORK A;  4DIQ A;  4HBL A;  2JTV A;  4S0H B;  4E7L A;  2HNH A;  4RGS A;  2FNP A;  4UUT A;  2Y0S A;  3HB9 A;  4RGX A;  3K4C A;  3CP2 A;  2HQA A;  3S2H J;  2OTL I;  3ZQL A;  2EFO A;  4KYW A;  1OCC H;  4Y7N J;  2AXT C;  3VFZ A;  3QPT A;  2D1V A;  5D8K B;  1W0U A;  4LOC A;  3GX4 X;  1H9T A;  1FOK A;  4IEJ A;  3AAF A;  1MBK A;  2DA6 A;  4N0B A;  3U2R A;  4CYC B;  2IS6 A;  1BM9 A;  2CFO A;  4L9N A;  3IAS 2;  2CQK A;  3GZ5 A;  4F52 A;  4XL9 A;  1FY7 A;  4AIJ A;  2CJJ A;  1LFP A;  2DYR H;  1A6Q A;  5FKO A;  1H8A C;  3FXR A;  4XRF A;  5HLT A;  1WZ2 A;  3RKY A;  4KMF A;  1VQM I;  2D5V A;  5LRS A;  1DUX C;  1S7O A;  4PDK A;  2FXA A;  3RQI A;  1MMD A;  4L18 B;  3AG2 H;  2LNB A;  2W25 A;  5A2Q K;  2WWY A;  2X9D A;  2BYV E;  3BG5 A;  3WTV C;  1IN5 A;  2Z9O A;  4OAZ A;  2XSJ C;  2RRE A;  4XRS A;  3WU0 A;  4ZDL A;  4MFE A;  5FLM J;  3PFY A;  1AA7 A;  3E1S A;  2GXB A;  2XAS A;  5LGU A;  1PUF B;  1QHG A;  1YG2 A;  3OYH A;  3H3V K;  2DOD A;  1X4O A;  5J1R A;  2L7K A;  3GW2 A;  2BVL A;  3VSL A;  4XLP F;  1TNT A;  4CA0 A;  4N4O B;  3MQ0 A;  4XRM A;  2K27 A;  2RV8 A;  4MIM A;  4CH7 A;  2Z5U A;  2ESN A;  2CSO A;  3FK7 A;  2R5Y B;  2JJ7 A;  3DEE A;  3CLO A;  2K4B A;  2OAZ A;  4I2O A;  2CRG A;  3FBN B;  1Z1D A;  1X3Z B;  2OA4 A;  1YX3 A;  5J8F A;  2JPC A;  4L5I A;  2F5E A;  4CCL A;  2OPT A;  1S29 A;  3CCL I;  1HLV A;  1XSV A;  5D5U B;  2F6C A;  3BDD A;  4XM3 A;  2M45 A;  2BVM A;  2M4G A;  2L02 A;  2GBY A;  2GXG A;  4M9X A;  2Z33 A;  1ZQ3 P;  1LDD A;  1FWZ A;  1U9O A;  4FX0 A;  2CUF A;  2R7D A;  2M8E A;  5H20 A;  4L9T A;  3SDB A;  1W1W E;  4ESF A;  4AIK A;  2OD5 A;  3K1N A;  3D0S A;  4KUM A;  2LF8 A;  3F21 A;  5L3F A;  2M2E A;  1X1C A;  1JKQ C;  2QSF X;  5LBQ A;  2CV0 A;  5B5E C;  4UXN A;  2QSG X;  3HUG B;  2J5P A;  2LOO A;  2QQA A;  1AKH A;  2O8K A;  3F3X A;  3AG3 H;  1JHH A;  4B8X A;  2HOT A;  2LY1 A;  3HSR A;  2BY2 A;  4ZC3 A;  4A5N A;  4JP0 A;  2VE8 A;  2HKX A;  1O3T A;  1R22 A;  1UG0 A;  2DI3 A;  3LSJ A;  4G7Z F;  2ZFU A;  1JKR C;  2OBP A;  3CJQ B;  4HF2 A;  2Y31 A;  2DMT A;  5HOD A;  5E3N A;  5FRN A;  3M8F A;  2OJE D;  2BW3 B;  4V19 K;  1KU3 A;  1UST A;  3M9A A;  4AWX B;  1DPR A;  1JKO C;  3FM3 A;  4UHT A;  2X48 A;  2GAU A;  1BI3 A;  5F08 A;  4MEX F;  3KP7 A;  2HDW A;  3FM5 A;  2VPL A;  3BZC A;  1QPI A;  4MQ9 F;  4IO9 F;  3M1C A;  4Q48 A;  2GIZ A;  4NUB A;  3S8P A;  3TOA A;  3RYR A;  2OCE A;  3Q5F A;  1J5Y A;  3I9V 2;  3E6M A;  2MBF A;  2WAE A;  3KE2 A;  2MYS A;  4O5V A;  3S16 J;  1T8I A;  3ZMV A;  3IV5 A;  3W3C A;  4RB1 A;  4RA2 A;  1BR1 A;  2XSD C;  1XMA A;  2E1N A;  3HKZ A;  5F04 A;  5M5W J;  3MZH A;  2LC2 A;  1BOA A;  3SJM A;  2ZNZ A;  4FTH A;  1MKM A;  2LMD A;  3F8F A;  2MD0 A;  2ZME C;  5FKN A;  5HOO A;  4ON0 A;  3ONQ A;  3DKW A;  5FFZ A;  5HDK A;  1UEL B;  2K9N A;  3JRI A;  1ONV A;  4HG2 A;  4B3A A;  2LG4 A;  3G71 I;  2QGU A;  1BW6 A;  1CF7 A;  1OQY A;  2FE3 A;  3TOB A;  3A4C A;  2JZY A;  2JPB A;  2EA4 A;  3FXJ A;  2XAG A;  1IRG A;  3OYL A;  1F1Z A;  1X2N A;  3OR1 C;  1B59 A;  3TO6 A;  1RES A;  2XB5 A;  2F4I A;  5ILS A;  1OPC A;  3K9T A;  3G3Z A;  5HLI A;  1HW5 A;  2ZSH B;  2L7F P;  4RAY A;  1V4R A;  3COA C;  1U5T A;  4OIQ F;  3QPL A;  1MNM C;  1WJF A;  2M30 A;  2O7O A;  3VOE A;  1QRY A;  2LY2 A;  3BQZ A;  4HNT A;  4AID A;  1K61 A;  2KMU A;  2QM3 A;  5DDG A;  3BLY A;  4XR6 A;  1E17 A;  1F9N A;  1Z3Y A;  3B73 A;  2XAJ A;  1JUM A;  3B6A A;  2G7H A;  1DQU A;  2Y48 A;  2V9V A;  4WXD A;  1LEB A;  1LUJ B;  2HTS A;  5D6F A;  3DBL B;  4E7I A;  3AFH A;  4XLF A;  1G3Y A;  1VTN C;  1R5G A;  1I3Q J;  4P9F A;  3G1L A;  4PUS A;  2JSC A;  3BR3 A;  2IW5 A;  5AON A;  4Q5S F;  2EZH A;  3SZP A;  3TBI A;  1ZGA A;  1N25 A;  3WU2 C;  4EJV A;  3OL4 A;  4HST A;  2Y9Y A;  2OUM A;  2E7W A;  2KFD A;  2JK3 A;  1FPQ A;  2KHM A;  4BXX J;  3EUA A;  4AVZ A;  2DA7 A;  5E3L A;  3HOS A;  2LYC A;  2OQG A;  2PG4 A;  3I59 B;  2K40 A;  5ICE A;  2KL4 A;  2A05 A;  1R7J A;  1S7E A;  4RAG A;  2FRH A;  3KP6 A;  1ETY A;  2N8G A;  2LFB A;  1FNN A;  5HLG A;  1I39 A;  3ABL H;  2PMZ N;  4GDF A;  2K9S A;  2Q1Z B;  2KJB A;  3DFG A;  1G4D A;  2HGC A;  2MH2 A;  1SD7 A;  3PSF A;  4Y33 A;  4A0X A;  4OIN F;  2X1D A;  2DA1 A;  5ILV A;  3S15 J;  2KIS A;  4HLX A;  4PFP A;  3JAM Z;  4F3Q A;  4B1R A;  1D3Y A;  3DF8 A;  3H5N A;  4A0Y A;  1WI9 A;  5IT3 A;  2GQQ A;  3IH3 A;  2CUE A;  2DJN A;  3KEQ A;  3Q0V A;  3ZMT A;  1SAX A;  3BTC A;  4KFC A;  3A01 A;  1OIS A;  4KT6 A;  2QA4 I;  2E1O A;  3VDX A;  3U1D A;  4KIS A;  3BWG A;  3BZ6 A;  3FWE A;  4AC0 A;  5F1J A;  2VC1 A;  2VQH A;  4E6K G;  1VZ0 A;  1XMX A;  2JUC A;  1S8N A;  5J3L A;  4MQV A;  3L2U A;  1Y8Q B;  1TQI A;  4XMY A;  1IUF A;  5DM6 F;  2WB1 N;  3WTY C;  2CUJ A;  3KP5 A;  4KNY A;  4OIP F;  1MW7 A;  5KAF C;  2H09 A;  3BCA A;  4PGH A;  1SVO A;  5HDN A;  4BEH A;  3HL2 A;  1TWH J;  3CO7 C;  3H9Q A;  2HQN A;  3CME I;  3LMM A;  4D5C A;  3ELK A;  3SEQ A;  1D1C A;  1RKW A;  1YHQ I;  2G7U A;  3J80 K;  2F2E A;  2LVS A;  4D7M A;  1ZAR A;  3B02 A;  3MN2 A;  4QIW N;  3CC7 I;  3BR6 A;  1Z05 A;  3BG3 A;  3GWZ A;  2EZK A;  3DWL E;  3R61 A;  1RUN A;  3OYI A;  1UZC A;  2DU9 A;  4BBS J;  2NNN A;  3QP5 A;  3HRT A;  2FNA A;  2UV1 A;  4XN0 A;  1TLH B;  1MH4 A;  4KIB A;  1GUU A;  4MO7 A;  3FXM A;  1LNW A;  4FQG A;  2EIN H;  2E5Z A;  1VI0 A;  1P4A A;  2HXI A;  3AKZ A;  3ECH A;  3KPH A;  1DGW Y;  4GRI A;  4ZDO A;  3CCU I;  2HFH A;  2XVC A;  2JA7 J;  1RIO H;  4CCO A;  5GTH C;  3BTI A;  1IF1 A;  2P5L C;  4J19 A;  2PX9 A;  2Z1D A;  5DCM B;  5D6E A;  3BTL A;  1GVJ A;  2HI3 A;  3H3Z A;  1WH5 A;  3LWF A;  4QTR A;  5E3O A;  3FBI B;  1IZ1 A;  3OYK A;  3L2Q A;  3HBL A;  4B44 A;  2HQR A;  2NNY A;  4BAY A;  3ESW B;  1ETV A;  2H94 A;  4H4K C;  1J9I A;  1IDY A;  3HGY A;  1J0R A;  5GPA A;  3GTJ J;  2KDZ A;  1Y0N A;  3N05 A;  2E2J J;  2P6S A;  1GT0 C;  1YFH A;  3BRO A;  3OL3 A;  4FE4 A;  4X0G A;  2VJ5 A;  5LGN A;  2EA2 A;  4M6Y A;  4NHJ A;  4IX7 A;  2Y2Z A;  2LTP A;  3DU6 A;  2MD5 A;  1Y0U A;  3PNV A;  3OIP A;  3SYT A;  2H1K A;  1ZH5 A;  3CF5 F;  3VEP A;  1ZR4 A;  3L2C A;  4HLY A;  3UKG A;  1MJ9 A;  1S72 I;  5DM7 F;  1MBH A;  1ZRC A;  2W1O A;  5J40 A;  3GTO J;  2BY0 A;  1WPK A;  2PMU A;  5EZH A;  1S6L A;  3OYA A;  2BOL A;  2LR8 A;  4AIH A;  5IYC J;  4MGR A;  2JSP A;  2L2O A;  3OYG A;  4BS9 A;  2ZSI B;  3FXK A;  2V1D A;  3A0B C;  3HOX J;  2R5Z B;  1JTY A;  4QPQ A;  1SD6 A;  4A3G J;  5DV5 A;  3MMY B;  4M74 A;  3CC2 I;  2DCE A;  1H89 C;  5LEJ A;  4XLC A;  2UXN A;  1MMA A;  1BN5 A;  3V42 A;  2MAB A;  3RPU D;  1HBX G;  1OYW A;  2EQR A;  2XGC A;  4QLC U;  3L00 A;  3GTL J;  5AIP A;  1D5V A;  3L7W A;  2JRT A;  2UWM A;  1UHS A;  3I3L A;  4MFD A;  4AVP A;  1P4W A;  2RNJ A;  2STW A;  3ABK H;  1B4A A;  4RGU A;  2WV0 A;  4HAM A;  3WGH A;  2KQR A;  1QO0 D;  5JHU A;  2K86 A;  2DA2 A;  2ZBK A;  2EPF A;  1SD5 A;  2R7O A;  2NVU B;  1W7P A;  3EYI A;  3CDL A;  2NVQ J;  5GTI C;  2QQ9 A;  3BOQ A;  3WE2 A;  2F5F A;  3IH2 A;  4FCY A;  4BJ5 C;  2E34 A;  3M07 A;  3T0Y A;  3V7R A;  3TL4 X;  2GWR A;  2LBF B;  1B8I A;  3CD6 I;  2Y69 H;  3VWB A;  2ISZ A;  4NC7 A;  2MC4 A;  4A3K J;  1T38 A;  1X1B A;  3K1P A;  2GXA A;  1V55 H;  3M7G A;  2IGN A;  2YU3 A;  3DPT A;  1WJ5 A;  2QSH X;  3OS2 A;  4WCG A;  4XKV A;  1XSD A;  2ZFW A;  5FD5 A;  5LGT A;  2M5W A;  1XPX A;  2JA5 J;  2E60 A;  3GEZ A;  3M8E A;  3DKY A;  3LAJ A;  3BT9 A;  5D5V B;  1Z7L A;  4BHB A;  3QQA A;  5ICC A;  2A5Y B;  1JXS A;  3WHB A;  2F4O B;  5KCM A;  4R79 A;  1KZH A;  2YR2 A;  4A3F J;  1JGS A;  1ETW A;  2FMY A;  3ZRG A;  4IHY A;  3LSK A;  2VT2 A;  4PK4 A;  1VQ5 I;  3K69 A;  2A69 F;  3T8R A;  1G6N A;  3HRS A;  2ZC2 A;  3JRH A;  1G3W A;  4U0Y A;  1F4K A;  4JX4 A;  4EM1 A;  4A6E A;  1UCR A;  1FYM A;  1YS7 A;  3DKX A;  1ZG3 A;  2JVG A;  3HC7 A;  3I54 A;  3HOY J;  1EKE A;  3L09 A;  2VXD A;  1HST A;  2W48 A;  4QSH A;  3MKL A;  4XON A;  3DBH B;  3W6J B;  1ZG1 A;  3SXY A;  2K85 A;  1ENH A;  2QVO A;  4PGG A;  3REO A;  3DQV C;  4MHG A;  2WAQ N;  2FML A;  3S2W A;  2X0L A;  1R6R A;  3ZQH A;  2FX0 A;  2I10 A;  3HOU J;  1JJ6 C;  3HEF A;  3ROU A;  3MKY B;  1A36 A;  3CC4 I;  4Y13 A;  1Q1V A;  3WTT C;  1BR4 A;  1QQI A;  2IA0 A;  5KK1 A;  4ZZD A;  1D8K A;  4ZYA A;  1FZP B;  2XHK A;  2IAI A;  2ZKZ A;  2BHZ A;  4PZJ A;  4ESJ A;  3MCZ A;  1U2W A;  4F93 B;  1P4X A;  1VQN I;  3H92 A;  4XNF A;  3OV8 A;  2CQ7 A;  2HYG D;  3SZG A;  3MD2 A;  5IT9 Z;  3DLL F;  2K02 A;  5IP7 J;  3I4P A;  2EIL H;  4B47 A;  2IEK A;  1EH8 A;  2CQN A;  1TT5 B;  3PM1 A;  1YYV A;  5FLX Z;  2F48 A;  2COB A;  3PJR A;  5EGO B;  1I27 A;  1R23 A;  4KIC A;  2VKE A;  1FP2 A;  5CVR A;  3SZT A;  2YU9 J;  2VBX A;  2TRT A;  4II3 A;  1R4M B;  1ZG5 A;  3J7A O;  4NNJ A;  1IN4 A;  4L0Z B;  4EM2 A;  1R9T J;  1HKT A;  4HZF A;  5IPA A;  3IWF A;  1ZR2 A;  3JRE A;  1IC8 A;  2L5Q A;  2ZME A;  1F5T A;  1G8X A;  1WJD A;  3BR2 A;  5EYR A;  2AQF A;  4WK8 F;  1IV6 A;  2Y0M A;  3OYB A;  2VC0 A;  5LHG A;  2DPU A;  3RZO J;  4W1U A;  2CQX A;  3L9F A;  4MEY F;  1XMK A;  4V2G A;  3N97 A;  2P6T A;  4BHC A;  3M4O J;  2L0K A;  4G6D A;  2IGM A;  2BGC A;  3I64 A;  4YIF A;  3DXJ F;  4IPA A;  5LHI A;  2O3F A;  3PUB A;  1DP3 A;  2B0L A;  1J59 A;  2IGO A;  3FKJ A;  3ZQI A;  2Y75 A;  5E79 C;  3CJT B;  2M0C A;  5GAH J;  5J1Y A;  2XB0 X;  4UVA A;  2JWT A;  2X6O A;  3DPU A;  1QNT A;  2FQ4 A;  3QOD A;  3RTR A;  2JA6 J;  1IAW A;  2IXS A;  4P55 A;  2X85 A;  2JA8 J;  3T8T A;  1DP7 P;  3CUQ A;  1D1A A;  3DP7 A;  3FHN A;  1MGT A;  1Z67 A;  2FBK A;  3R6S A;  2EIK H;  4M3B A;  3CDI A;  1FMW A;  3ISP A;  1TWG J;  4IL6 C;  2FSW A;  3CF2 A;  2CO5 A;  2L4M A;  3BJ6 A;  3BQY A;  3PQK A;  1ZK8 A;  2FOW A;  3HM5 A;  3BPX A;  2AO9 A;  3I0T A;  2KPM A;  1CQT A;  3QOP A;  4WX9 A;  1SEU A;  3LSM A;  1B9N A;  4JX6 A;  2V9K A;  4BBR J;  4A93 J;  1I6H J;  2L9R A;  1GXP A;  4EAT A;  4UB6 C;  2K5C A;  5FFX A;  1XGM A;  1BI0 A;  3FKI J;  3D5S C;  4YFK F;  3F8C A;  4UUS A;  2X51 A;  1A04 A;  2HVS A;  3ABM H;  2OC6 A;  3QYB A;  3R0J A;  2V1N A;  2VXZ A;  3KP2 A;  2R0Q C;  1E0E A;  3GYH X;  1OLT A;  4G8X A;  1P92 A;  5DEQ A;  4IHS A;  5J4Y A;  1IRZ A;  1AHD P;  1SVL A;  4KN7 X;  1MMS A;  4Y3O A;  1IRX A;  3S1M J;  3GFJ A;  2RNG A;  4CCJ A;  4UB8 C;  4RM2 A;  4IZZ A;  1OYI A;  2DDA A;  2IPQ X;  2ICW G;  2KIM A;  2A6E F;  1JJ8 C;  2R7W A;  3QYF A;  2NOJ B;  1FBU A;  1IO2 A;  1L3L A;  4LJZ F;  3S3O A;  1AKH B;  5C3E J;  4J00 A;  1K83 J;  1U6G A;  4C30 A;  3O2P E;  1S5L C;  5B3S H;  4P1W A;  3HOW J;  3BG6 A;  1V5F A;  1MSF C;  5EDN A;  2FJ1 A;  4Q47 A;  3LA3 A;  3AL0 B;  4YFN F;  1U3E M;  1NTC A;  1IN7 A;  4N9H A;  3BR5 A;  4G6Q A;  2XAQ A;  3K4K A;  1NG6 A;  2KRC A;  2JQ7 A;  3RPU A;  1TC3 C;  2GM4 A;  3RJP A;  3OWT A;  4B3X A;  2DFI A;  2E5N A;  2GOM A;  2ZXI A;  5E1X A;  4HYE A;  3BTJ A;  2FA5 A;  2Z16 A;  2BY3 A;  4IQ4 A;  2OV7 A;  2BE5 F;  3Q9S A;  1R49 A;  3SFI A;  3CCM I;  2RGV A;  1P2F A;  1FT9 A;  4S04 A;  1UMQ A;  1KU9 A;  1H9G A;  2L4A A;  2NVY J;  2WTE A;  3LNQ A;  2VI6 A;  3E0J B;  2LK2 A;  2XGD A;  3V8K A;  3D5R C;  3R4K A;  2EWN A;  3K10 A;  4ZDP A;  5CVU A;  3GFM A;  4EEF G;  1MIJ A;  2HKO A;  2PI0 A;  3K4B A;  1X58 A;  1RPW A;  2QUF A;  1E3O C;  1W5T A;  2H6C A;  5J8C A;  3QAH A;  2R93 J;  3ERE D;  4CYD A;  3L2V A;  3M1E A;  1LPQ A;  2ELJ A;  2A5W A;  3HHH A;  4UY8 I;  1BW5 A;  4C3I J;  1BIB A;  3HPH A;  5LD2 C;  4LG3 A;  1CF7 B;  1IN8 A;  1TWC J;  1GV2 A;  5D5X B;  5HDG A;  3L2W A;  3GTG J;  3ABU A;  1HQC A;  1XGO A;  2EV6 A;  1GHC A;  3CO6 C;  2HVR A;  1DDN A;  3J7A Y;  2PJR A;  3J81 Z;  5K5R A;  1TT0 A;  4XKW A;  1VND A;  3TW6 A;  1HA8 A;  2NRA C;  2NOG A;  1FP1 D;  1ZAO A;  2BEO A;  5TIS C;  2I5U A;  3IC7 A;  3O8H A;  1U5T B;  1TZL A;  3HIF A;  1IG7 A;  3HGG A;  3NWS A;  4GGG A;  4XRS G;  2DMQ A;  3FXQ A;  2CGP A;  2EV0 A;  2EIM H;  1PP7 U;  2RC4 A;  3H1C A;  3BC8 A;  1HKS A;  2UUZ A;  1B72 A;  2CUZ A;  1RKT A;  2PMZ A;  2M34 A;  3F6O A;  1OCR H;  1I5Z A;  1ODD A;  2STT A;  1OCP A;  1PUE E;  4AU7 A;  1QZE A;  2K4J A;  4EJU A;  5D5W B;  3CUQ C;  3RKQ A;  5DCF A;  5A2Q Z;  4IKF A;  2DA3 A;  2TDX A;  3RKX A;  2NS7 A;  3S1Q J;  4BE1 A;  4DJA A;  3RCO A;  1HF0 A;  4HRI A;  1HXD A;  3CLQ A;  1IV8 A;  3QRF F;  4S05 A;  2CFX A;  1TQM A;  2W00 A;  2CW0 F;  4TV7 A;  2IS2 A;  5C4J J;  3PFI A;  2L7M P;  3WG7 H;  4XLH A;  1RC9 A;  1WRJ A;  4FX4 A;  2VPR A;  5EG0 A;  1FYK A;  2EZI A;  2FD5 A;  3EUH C;  3TGN A;  1YOV B;  4CCN A;  4E7Z A;  4EM0 B;  1X1P A;  2KIF A;  3PQJ A;  3BR0 A;  4BJ6 C;  4EMS A;  2WB1 A;  2DMN A;  1X2M A;  3HOZ J;  2NAZ A;  3WTW C;  4A5M A;  2V79 A;  2FBI A;  4GYI A;  2GA2 A;  5IP6 A;  2O6G E;  3IWZ A;  3GZN B;  1O4X A;  4HOB A;  4JBA A;  1WKM A;  5H6R A;  1UHW A;  4HNV A;  1G59 A;  3BCB A;  2VE9 A;  4ABZ A;  3JTH A;  3K4N A;  4MNU A;  3S14 J;  3GBG A;  3PUF A;  1SC7 A;  2L01 A;  5F6F A;  2ACJ A;  2QKL B;  3G4S I;  3A01 B;  2CH0 A;  3A0H C;  2PMH A;  2EV5 A;  3F0C A;  1JT0 A;  5GAE J;  2W84 A;  4ZYH A;  4D5F A;  5J4V A;  4LB5 A;  1U8B A;  1R00 A;  4LLL A;  3I55 I;  5E17 F;  1AWC A;  5IYD J;  3BP8 A;  3CQZ J;  2LRD A;  3E5X A;  2JN6 A;  4NQW A;  4WXH A;  5H6Q A;  2DAO A;  1VFC A;  2MH9 A;  2QEN A;  2DT5 A;  1UAA A;  2A6T A;  3KP4 A;  1BI1 A;  1WJA A;  2DN0 A;  5E1W A;  1XN7 A;  4E7H A;  3PL8 A;  2DXI A;  4QWQ A;  4A3E J;  2DOE A;  4HDU A;  2QEX I;  3N4M A;  1H0M A;  3LA2 A;  3IL2 A;  4P5O A;  2CS3 A;  3ZQF A;  2GZW A;  2L54 A;  3OSF A;  1YIJ I;  1NK2 P;  2P81 A;  3JR9 A;  4BEH B;  4ZTJ A;  5JVG F;  4RB2 C;  1LE8 A;  3FX3 A;  4I09 A;  3TO7 A;  1BI2 A;  5FD6 A;  1WGX A;  1XTA A;  1JKP C;  4HX8 A;  4ZYD A;  4A12 A;  2A07 F;  2QQ8 A;  4IHX A;  2E1M B;  4HX7 A;  5DUK A;  3M3Y J;  5LEK A;  3HSE A;  4BU2 A;  3KFW X;  4K2E A;  3W6V A;  3OYF A;  3K6G A;  3QU6 A;  5KAI C;  6PAX A;  3I58 A;  1PVE A;  1Y1W J;  3KIO A;  4M3F A;  2ME6 A;  2HR3 A;  2WBM A;  4KDP A;  2XC7 A;  4A3B J;  3SDG A;  4F92 B;  1MBF A;  5J47 A;  3CUO A;  1P9Q C;  4G7O F;  3S17 J;  1FOW A;  4XSZ F;  3DTK A;  2FUG 2;  1KYZ A;  3TP3 A;  1JTX A;  3LSG A;  1RRJ A;  5F64 A;  2E2I J;  3HZJ A;  2LH9 A;  2FQ3 A;  1UHM A;  2AXL A;  4CIC A;  1MBE A;  2BXY A;  1LFB A;  2Q2E A;  3DU5 A;  3RIR A;  3S1R J;  2YUS A;  3KYC B;  2JMW A;  2W7N A;  1SFU A;  5EEH A;  1ETX A;  3V7S A;  2M1B A;  2EJR A;  1V5G A;  4BY7 J;  3A2K A;  4A3D J;  2W57 A;  4LK0 F;  4OWR B;  1OFC X;  4P96 A;  3HXL A;  4DZP A;  3CCV I;  1FSH A;  5JVT A;  4XSX F;  3AG1 H;  1AU7 A;  4M9S A;  2G0E A;  2KIU A;  2OU2 A;  3SFZ A;  2VQG A;  2V1U A;  1OCO H;  3CP8 A;  4PJJ A;  4LMY A;  2M4K A;  4G6T B;  3ULQ B;  3FMR A;  2HZT A;  1WHU A;  3JTG A;  2GA1 A;  2LF7 A;  1X3W B;  4DZJ A;  4LD5 A;  4N9I A;  4RBO A;  3CCE I;  4XBF A;  2LD5 A;  1T56 A;  5HS9 A;  2BBY A;  2P7C B;  2EB7 A;  3H3U A;  4RS8 A;  5DD4 A;  3VYU B;  4BQA A;  3MKW B;  4HW0 A;  2IBD A;  1A31 A;  3CCJ I;  2RQP A;  2IS1 A;  2Z3Y A;  3HHG A;  5E8G A;  2L9S A;  1D5Y A;  3O8G A;  2XPV A;  3FIS A;  4JYK A;  1YE9 A;  2QF7 A;  5FB2 A;  4BQO A;  1BR2 A;  2HOE A;  1MJA A;  2E19 A;  2RKH A;  2ADU A;  3E6B A;  2R7Q A;  5CVV A;  1MBJ A;  2VLA A;  4BL0 B;  4ZTF A;  2DA5 A;  1NK3 P;  2M9H A;  4B43 A;  4RAF A;  4XOR A;  2ZXH A;  4YG2 F;  3ZP5 A;  1EA3 A;  1O57 A;  2HOS A;  5IT9 K;  3IRQ A;  1BC8 C;  3OYN A;  4EGZ A;  1WI3 A;  4FET A;  3R0A A;  4E70 A;  3OYD A;  1TBX A;  4XLN F;  1MSE C;  1FTZ A;  2LDU A;  3FXO A;  2LKP A;  1FYL A;  3K2Z A;  1EH7 A;  1LKX A;  1YIO A;  3WTZ A;  1ZGW A;  2K3P A;  3HTS B;  3KCC A;  5TJJ A;  3TMO A;  2ECC A;  2E1C A;  2M7B A;  4ITV A;  1HDD C;  1O3S A;  1VQK I;  3ZN0 A;  1GV5 A;  1XX5 A;  1J7K A;  4IHW A;  2KJC A;  4J01 A;  2V26 A;  2EIJ H;  3K4M A;  4NC8 A;  3KX2 A;  1W7P B;  1BC7 C;  4U7D A;  2BXZ A;  3P9I A;  3JRD A;  2ME0 A;  1HW1 A;  1JUS A;  5TRD A;  1R4N B;  1Z77 A;  2F5C A;  2K7L A;  4BGD A;  3T1B A;  4G7H F;  1LFU P;  1OCT C;  1AOY A;  2A6H F;  2BY1 A;  2VB6 A;  3H9J A;  3P5J A;  4ZH4 F;  2P5V A;  4PJL A;  2KIQ A;  3MWM A;  3RPQ A;  2AQE A;  1LEA A;  3CES A;  1FSE A;  3R60 A;  1YRN A;  4M71 A;  3UR3 C;  1B8I B;  1VQ8 I;  4DGW B;  4BE2 A;  2WC2 A;  1W0T A;  2K9Q A;  2DT7 B;  3X2Q H;  4L5E A;  3PSI A;  3BY6 A;  4U88 A;  5CVJ A;  3CMY A;  2X6Y A;  2HDC A;  1ACI A;  2Z99 A;  4X6A J;  5BQT A;  3HTU A;  5HNH A;  1LVA A;  3LST A;  2DK5 A;  2VL8 A;  1MDM A;  2A61 A;  2WAQ A;  4KMU X;  4HV6 A;  1QVT A;  2W24 A;  5DTD A;  4GCV A;  4AYB N;  2L9N A;  4JOM A;  3J80 Z;  1GDT A;  4BY1 J;  2GOX B;  4LIT A;  2O9L A;  4DW6 A;  2H8R A;  3NRV A;  1OKR A;  3VYR B;  5E3M A;  4MTE A;  3OYE A;  4LGW A;  4OOI A;  4CSW A;  5ILU A;  1WVR A;  1DGR M;  4BUP A;  1O3R A;  3VYS B;  2IT0 A;  1WH7 A;  1GLN A;  2VAS A;  3U9G A;  2XRL A;  4RB3 C;  2B9S A;  1XD7 A;  1V3F A;  2K9L A;  1WSU A;  5E18 F;  2DO7 A;  1ZRD A;  2KZG A;  4UNO A;  2DMP A;  4Z2Y A;  3K2A A;  2NVX J;  4I98 B;  5BPI A;  3QP6 A;  3GLX A;  4EJO A;  1YIT I;  2YX4 A;  3JCU C;  3HJE A;  2QBY A;  1DU6 A;  2D1H A;  5K7Z A;  5FRO A;  1YQA A;  3GFI A;  3OOP A;  2E2H J;  4C2T A;  3MEX A;  1FTT A;  4OAY A;  1ZLJ A;  1VQ6 I;  5M5Y J;  5JR3 A;  4DBR A;  5GAD J;  2RDP A;  5F0F A;  2V6C A;  3OYJ A;  3H5A A;  3C1D A;  2QYO A;  3A1Y A;  4M9Z A;  1K6Y A;  4WXC A;  4ASN A;  1V54 H;  1KU2 A;  4BH9 A;  4CXF A;  3GTP J;  1J75 A;  3HDD A;  1ZEL A;  4LG0 A;  4CZC A;  2PEX A;  3FF5 A;  4UVB A;  2WA0 A;  4GFB A;  1U9N A;  2H6B A;  4BXU A;  4OMZ A;  4M6X A;  5M5X J;  2F5V A;  1QZY A;  3K4J A;  3FXU A;  3D1N I;  4IRI A;  1FOY A;  3SHF A;  3I53 A;  5K5O A;  1Z0X A;  4DNC A;  1TQP A;  1MND A;  4AM3 A;  1M1E B;  1RI7 A;  2HPM A;  4HSR A;  3GFL A;  5HVQ C;  5E1Z B;  5FO5 A;  3VOD A;  4GYG A;  5D4R A;  2UXX A;  2MGQ A;  1A5J A;  3ZXS A;  1CGP A;  3PNT A;  1OJL A;  2A68 F;  2VT3 A;  1XSX A;  1QGP A;  4PSW A;  4FE7 A;  3GUD A;  1KU7 A;  5FKM A;  3JRC A;  3LFK A;  4HF0 A;  1ZYR F;  2ZME B;  4FT8 A;  3U21 A;  3J7Z I;  1K78 A;  1KQ9 A;  3H36 A;  1W36 C;  1FIP A;  2KLO A;  2I8D A;  1Y6I A;  5FLV A;  3OS0 A;  2DLL A;  2ZJQ F;  3EPZ A;  4A3M J;  4UVC A;  1LQ1 A;  1JGG A;  4CZZ A;  5ICF A;  4D9J A;  3KLN A;  2W82 A;  3W6K B;  5AIQ A;  1BBY A;  5L3C A;  3P9C A;  3C2G A;  3AG4 H;  3GF2 A;  4BQN A;  2FOK A;  1T0F C;  4I6Z A;  1NHA A;  2QLZ A;  3L2R A;  1ZTR A;  2IP2 A;  3J7Y J;  3P9K A;  3W2V A;  3MKZ A;  1VQL I;  1SMT A;  2DFE A;  4KIT B;  4C9Y A;  4BDZ A;  3KZZ A;  3GO5 A;  1R5I D;  5H2F C;  2M7A A;  2XPU A;  3KET A;  1IXR C;  2HTJ A;  3PO2 J;  2DFF A;  3RQ4 A;  1O7L A;  5F0C A;  4A6D A;  2O8X A;  3E6C C;  5FGM A;  3G2B A;  3CUQ B;  4C2M J;  3QWL A;  3E5U A;  1QU3 A;  1YW7 A;  1OR7 A;  3CMA I;  3I56 I;  2VOD A;  2LRE A;  2W4S A;  3ZQC A;  2DQR A;  3WE3 A;  3WOD F;  1Y8R B;  4FAS D;  2HDD A;  1BA5 A;  3FMS A;  4NC6 A;  4A2U A;  2DYS H;  3JW4 A;  1I50 J;  4BJT A;  1ETO A;  4G94 A;  2PN6 A;  5EF6 A;  5D8L B;  3J81 K;  1RR7 A;  1POG A;  2O61 A;  2JA2 A;  5EJC A;  3ASO H;  3HRU A;  4NBQ A;  4C2U A;  3A02 A;  5F0H A;  1RUO A;  3G1O A;  5IP9 J;  4HQE A;  1ZKG A;  3P7N A;  1KGS A;  2Q8K A;  1FOX A;  1R36 A;  3IUO A;  2KKO A;  2BHY A;  4RAZ A;  1RNL A;  2CQQ A;  3SEZ A;  1XCV A;  3DTE A;  1XCB A;  4IRG A;  2HVQ A;  1X1D A;  3EUH A;  3OYC A;  1X1A A;  4U87 A;  4CYC A;  1V5E A;  4F91 B;  4ETS A;  5B1A H;  5L3G A;  1T08 B;  4UUS B;  2KT0 A;  4ZJZ A;  4M6V A;  4AUX A;  2DTR A;  2FU4 A;  4EGY A;  3C2B A;  3F8M A;  3ZOB A;  1D0Y A;  2P8T A;  1D8J A;  1PDN C;  1PP8 F;  1EH6 A;  2L9V A;  3FZV A;  3CJR B;  4ENJ A;  1XG1 A;  4HX4 A;  1YI2 I;  3FXL A;  5IYB J;  1F43 A;  2Y0S N;  3BZK A;  2CW7 A;  4D0P A;  3G73 A;  1X3U A;  3K1M A;  1T33 A;  1P7I A;  1USS A;  1SMY F;  3EYY A;  3PO3 J;  2YX7 A;  4X1E A;  1IW7 F;  2ZJR F;  1PUF A;  4IOC F;  3KEY A;  4PJ0 C;  3MZY A;  2CV1 A;  2E35 A;  1KON A;  4E4H A;  4JQF A;  1OCZ H;  3BJO A;  1Q1H A;  2OZU A;  1P6R A;  4BE0 A;  3I5U A;  3OSG A;  4HA8 A;  2DPD A;  2MG4 A;  4D7N A;  2X6X A;  1W36 D;  2XKO A;  2PLY A;  4CDG A;  1QA6 A;  1MNE A;  3CCS I;  3LSH A;  2R5Y A;  1SFO J;  2HPI A;  5ERI A;  4ZYE A;  1TP4 A;  2V1X A; 
#chains in the Genus database with same CATH homology
 1TNS A;  3DPL C;  1HW2 A;  1T98 A;  4M72 A;  1G3S A;  2MLG A;  4L5J A;  3JAM K;  2X4H A;  2IJL A;  5BS6 A;  4I0B A;  5JI6 A;  2GIV A;  2PQ8 A;  2VN2 A;  4CHU A;  4O6J A;  1S7A A;  5KVR A;  2VOP A;  1MJB A;  3C3W A;  1RZ4 A;  2XV4 S;  3F22 A;  2MA3 A;  4ENM A;  2H27 A;  5J6X A;  3HUG A;  4YII A;  3RDI A;  2VBY A;  1J2X A;  1WWX A;  1XGS A;  4IHT A;  1MZB A;  1IN6 A;  2RVC A;  2PJP A;  1ON1 A;  4CO8 A;  5LLQ A;  1KQ8 A;  4EVI A;  1R58 A;  2PBI A;  1W7P D;  2MC3 A;  1R5H A;  2P7V B;  2NYX A;  4MTD A;  3K0L A;  3D5L A;  4L9V A;  4H0E A;  1G3T A;  2EFQ A;  3WTS C;  1W4M A;  3TKY A;  2O0Y A;  3ZPL A;  3VB2 A;  2D45 A;  1W5S A;  1IRF A;  3LQR A;  3O6B B;  3WTU C;  1XDS A;  3Q9V A;  2P4W A;  4ZZL A;  3BJA A;  4UV8 A;  1LB2 A;  1ON2 A;  2VBW A;  2IRF G;  4R8H A;  2EK5 A;  2ELH A;  3CDH A;  2UZK A;  5CYV A;  4O3M A;  4Y17 A;  1KA8 A;  4G9Y A;  1OMI A;  3F72 A;  3E3V A;  3CTA A;  4I0A A;  2J5O A;  1E2X A;  1K7A A;  2CWE A;  4U0V A;  4PCQ A;  2IA2 A;  1Z6T A;  5L3B A;  2G9W A;  5E20 A;  1ZLK A;  2ESH A;  2NS0 A;  2XIG A;  1I1G A;  2HYF A;  3HSF A;  1KYW A;  4KIF A;  5CJ9 A;  4I02 A;  5CLS A;  4BHP A;  2FBH A;  4CGZ A;  1LJ9 A;  2IA1 A;  3MFK A;  4B09 A;  5E8I A;  3BPV A;  4I7H A;  4L9J A;  3MAJ A;  3FHZ A;  3FMQ A;  3TDU C;  2DBB A;  3I59 A;  2EFN A;  4GO1 A;  4KIG A;  5F1R A;  4ZYG A;  1B9M A;  5EEG A;  2DK8 A;  1BJA A;  1MD0 A;  3HOT A;  1XB4 A;  1B1B A;  3ZMZ A;  5DUI A;  5L3E A;  3I71 A;  4BYY A;  3IKV A;  5LHH A;  1QZZ A;  1BIA A;  2ZXJ A;  2PFB A;  3DV8 A;  4OIR F;  3JSP A;  5JFR A;  1YS6 A;  4ENK A;  1U8R A;  3SQN A;  3LAP A;  1T39 A;  1DPU A;  1WQ2 A;  2R7F A;  2XUB A;  1YW8 A;  4AD9 A;  3ZN1 A;  1K79 A;  4R1H A;  3NQO A;  2XAH A;  4OU0 A;  1I6X A;  2W85 A;  3WTX C;  2QZ8 A;  1GXQ A;  3KZY A;  2YPR A;  1R1T A;  3ZQ7 A;  1S3J A;  1FC3 A;  1FBS A;  4RB0 A;  3TO9 A;  3HYI A;  4NB5 A;  4U0W A;  4LFU A;  4KT5 C;  3LQQ A;  1T2K A;  4KN4 X;  1K6O A;  1SFX A;  3ML6 A;  5BOX A;  1LDK B;  5HLH A;  5BPD A;  2ZJ2 A;  2P5K A;  2VON A;  3RI4 A;  4Y15 A;  1KQ0 A;  1TW3 A;  3V4G A;  1L0O C;  4FHT A;  1R1V A;  4F7Z A;  1XDU A;  3ZMS A;  3IKT A;  4DQ2 A;  5K5Q A;  1QBJ A;  3DEU A;  5DCM A;  3GXO A;  3HRM A;  3E5Q A;  2DQL A;  4HDV A;  4KA4 A;  1FLI A;  1Z9C A;  2KRF A;  1U5T C;  4GXO A;  3IRR A;  1UFM A;  4M73 A;  1Z91 A;  4EQQ A;  3WU1 B;  1JE8 A;  4L0Y B;  3LA7 A;  4P9U A;  2M87 A;  4LLN A;  4UV9 A;  3EQL F;  4JK1 X;  3QPH A;  4IRH A;  1T0F A;  5FLX K;  5ED4 A;  1ZRE A;  4OIO F;  1REP C;  1O3Q A;  2C6Y A;  3TDZ C;  2E7X A;  2RN7 A;  3E6D A;  3QU3 A;  3T5X A;  1UB9 A;  2XRN A;  1IXS B;  1OYY A;  3ZMU A;  3WG9 A;  1TTY A;  2MLK A;  1IUY A;  4I01 A;  1YLF A;  1LDJ A;  3E97 A;  4UUV A;  2A3S A;  5K1Y A;  4HF1 A;  4EJW A;  1Z7U A;  4IJA A;  2ISY A;  2QQB A;  3JSO A;  1YTY A;  2IVM A;  2COM A;  2ZCW A;  4LLG F;  4ENN A;  3V8L A;  3F6V A;  1MDM B;  1STZ A;  2OQR A;  1U78 A;  4BNC A;  4WF2 A;  2L3D A;  1HSJ A;  3ZMD A;  1ULY A;  1O7F A;  4OMY A;  3TQN A;  1HKQ A;  5HS7 A;  1TW2 A;  3KLO A;  5ICG A;  2XAF A;  5LRR A;  1SD4 A;  4EJT A;  4IVN A;  3RKW A;  2QBY B;  2ZO4 A;  3C18 A;  4WWC A;  2ETH A;  2VOO A;  2EFP A;  5L3D A;  2D2W A;  3RYP A;  5DD8 A;  3V7C A;  2CYY A;  4YFX F;  2EFW A;  3CJN A;  2QWW A;  1R1U A;  1C0W A;  4HQM A;  4LG0 B;  3EDP A;  1FX7 A;  2XKP A;  4LB6 B;  1B6A A;  2HWV A;  4EV0 A;  2F5D A;  4RGR A;  1ZGJ A;  2BV6 A;  3KP3 A;  5DYM A;  2LSO A;  3NEU A;  2ZNY A;  1SFE A;  5BMZ A;  3WGG A;  3KEO A;  1YW9 A;  1YO5 C;  1T6S A;  2CG4 A;  3F23 A;  3O3K A;  2YSR A;  2OZ6 A;  1IXC A;  1K78 B;  4U7B A;  2O03 A;  1QPM A;  3F8B A;  3ECO A;  1ZHF A;  4A0Z A;  2VBZ A;  4Q4Z F;  2JT1 A;  3EET A;  1XGN A;  3C7J A;  2XRO A;  2DW4 A;  1EV7 A;  3GVA A;  3WGI A;  3ABT A;  4IXA A;  3V8J A;  2FEZ A;  4HV5 A;  4ESB A;  2FF4 A;  5CVI A;  1Z6R A;  1ZN2 A;  5D4S A;  1FBQ A;  2R3S A;  4LK1 F;  2HS5 A;  3GZ6 A;  2HEO A;  1I1S A;  1JHF A;  2XGX A;  2Q0O A;  3IHU A;  3F8N A;  4IF4 A;  1ZRF A;  5HS8 A;  2AS5 F;  4HBL A;  2JTV A;  4RGS A;  2FNP A;  4RGX A;  2EFO A;  4KYW A;  3VFZ A;  3QPT A;  2D1V A;  5D8K B;  3GX4 X;  1H9T A;  1FOK A;  3AAF A;  4N0B A;  3U2R A;  1BM9 A;  4L9N A;  2CQK A;  3GZ5 A;  4AIJ A;  1FY7 A;  3FXR A;  4XRF A;  3RKY A;  4KMF A;  5LRS A;  1DUX C;  1S7O A;  4PDK A;  2FXA A;  4L18 B;  2LNB A;  2W25 A;  5A2Q K;  2WWY A;  2BYV E;  3WTV C;  1IN5 A;  2Z9O A;  3WU0 A;  2GXB A;  2XAS A;  5LGU A;  1YG2 A;  3GW2 A;  4XLP F;  1TNT A;  3MQ0 A;  2K27 A;  2RV8 A;  2Z5U A;  2ESN A;  2CSO A;  3CLO A;  2K4B A;  2OAZ A;  4I2O A;  1Z1D A;  2OA4 A;  5J8F A;  2JPC A;  4L5I A;  2F5E A;  1S29 A;  1XSV A;  5D5U B;  3BDD A;  2M45 A;  2L02 A;  2GXG A;  4M9X A;  2Z33 A;  1LDD A;  1FWZ A;  4FX0 A;  2R7D A;  2M8E A;  5H20 A;  4L9T A;  4ESF A;  4AIK A;  2OD5 A;  3K1N A;  3D0S A;  4KUM A;  2LF8 A;  3F21 A;  5L3F A;  5LBQ A;  4UXN A;  2J5P A;  2QQA A;  3F3X A;  4B8X A;  1JHH A;  3HSR A;  4A5N A;  2VE8 A;  2HKX A;  1O3T A;  1R22 A;  2DI3 A;  4G7Z F;  2OBP A;  4HF2 A;  3M8F A;  1KU3 A;  1UST A;  3M9A A;  4AWX B;  1DPR A;  3FM3 A;  4UHT A;  2GAU A;  1BI3 A;  4MEX F;  3KP7 A;  3FM5 A;  4MQ9 F;  4Q48 A;  3TOA A;  3RYR A;  3Q5F A;  1J5Y A;  3E6M A;  2MBF A;  3KE2 A;  4O5V A;  3ZMV A;  4RB1 A;  1XMA A;  2E1N A;  3MZH A;  1BOA A;  2ZNZ A;  1MKM A;  3F8F A;  5HOO A;  4ON0 A;  3DKW A;  5FFZ A;  5HDK A;  1ONV A;  1CF7 A;  2FE3 A;  3TOB A;  2JZY A;  2JPB A;  2EA4 A;  2XAG A;  1IRG A;  1F1Z A;  1B59 A;  3TO6 A;  5ILS A;  1OPC A;  3K9T A;  3G3Z A;  5HLI A;  1HW5 A;  4RAY A;  1V4R A;  3COA C;  1U5T A;  4OIQ F;  2M30 A;  3VOE A;  2QM3 A;  5DDG A;  1E17 A;  1F9N A;  3B73 A;  2XAJ A;  2G7H A;  2Y48 A;  2V9V A;  4WXD A;  1LEB A;  2HTS A;  5D6F A;  1G3Y A;  1VTN C;  1R5G A;  4P9F A;  2JSC A;  2IW5 A;  5AON A;  4Q5S F;  3SZP A;  1ZGA A;  4EJV A;  2E7W A;  1FPQ A;  3HOS A;  2OQG A;  2PG4 A;  3I59 B;  5ICE A;  1R7J A;  2FRH A;  3KP6 A;  1FNN A;  5HLG A;  2KJB A;  3DFG A;  1G4D A;  2HGC A;  2MH2 A;  1SD7 A;  4A0X A;  4OIN F;  5ILV A;  4HLX A;  3JAM Z;  1D3Y A;  3DF8 A;  4A0Y A;  1WI9 A;  5IT3 A;  2GQQ A;  3KEQ A;  3ZMT A;  1SAX A;  4KFC A;  3U1D A;  3BWG A;  3BZ6 A;  3FWE A;  2VC1 A;  1S8N A;  4MQV A;  1TQI A;  4KNY A;  3WTY C;  3KP5 A;  4OIP F;  2H09 A;  4PGH A;  5HDN A;  3CO7 C;  2HQN A;  3ELK A;  2G7U A;  3J80 K;  2F2E A;  1ZAR A;  3B02 A;  1Z05 A;  3GWZ A;  3R61 A;  1RUN A;  2DU9 A;  2NNN A;  3QP5 A;  3HRT A;  2FNA A;  1TLH B;  4KIB A;  1LNW A;  1P4A A;  3ECH A;  2HFH A;  2XVC A;  1RIO H;  1IF1 A;  2P5L C;  5DCM B;  5D6E A;  1GVJ A;  3H3Z A;  3LWF A;  1IZ1 A;  2HQR A;  2NNY A;  4BAY A;  2H94 A;  1J9I A;  1J0R A;  2P6S A;  1YFH A;  3BRO A;  5LGN A;  2EA2 A;  4M6Y A;  4NHJ A;  2MD5 A;  1Y0U A;  1ZH5 A;  3VEP A;  3L2C A;  4HLY A;  1MJ9 A;  1ZRC A;  2PMU A;  1S6L A;  4AIH A;  4MGR A;  2V1D A;  1SD6 A;  5DV5 A;  4M74 A;  5LEJ A;  2UXN A;  1BN5 A;  1HBX G;  1OYW A;  4QLC U;  3L00 A;  1D5V A;  5AIP A;  3L7W A;  2JRT A;  2UWM A;  4AVP A;  1P4W A;  2RNJ A;  2STW A;  1B4A A;  4RGU A;  2WV0 A;  4HAM A;  3WGH A;  1QO0 D;  5JHU A;  2K86 A;  2ZBK A;  1SD5 A;  3EYI A;  1W7P A;  2QQ9 A;  3BOQ A;  3WE2 A;  2F5F A;  3T0Y A;  3V7R A;  2GWR A;  2ISZ A;  1T38 A;  3K1P A;  3M7G A;  2YU3 A;  3DPT A;  4WCG A;  1XSD A;  2ZFW A;  5FD5 A;  5LGT A;  2M5W A;  3GEZ A;  3M8E A;  3LAJ A;  5D5V B;  4BHB A;  5ICC A;  2A5Y B;  1JXS A;  4R79 A;  2YR2 A;  1JGS A;  2FMY A;  2VT2 A;  3K69 A;  2A69 F;  3T8R A;  1G6N A;  3HRS A;  1G3W A;  4U0Y A;  1F4K A;  4EM1 A;  4A6E A;  1UCR A;  1FYM A;  1YS7 A;  1ZG3 A;  3I54 A;  3L09 A;  1HST A;  3W6J B;  1ZG1 A;  3SXY A;  2QVO A;  3REO A;  4PGG A;  3DQV C;  4MHG A;  2FML A;  3S2W A;  2X0L A;  3ROU A;  4Y13 A;  3WTT C;  1QQI A;  2IA0 A;  5KK1 A;  4ZZD A;  1FZP B;  1D8K A;  2XHK A;  2ZKZ A;  4PZJ A;  4ESJ A;  3MCZ A;  1U2W A;  1P4X A;  3H92 A;  3OV8 A;  2HYG D;  5IT9 Z;  2K02 A;  3I4P A;  1EH8 A;  1YYV A;  5FLX Z;  1I27 A;  1R23 A;  4KIC A;  1FP2 A;  5CVR A;  3SZT A;  2VBX A;  1ZG5 A;  3J7A O;  1IN4 A;  4L0Z B;  4EM2 A;  1HKT A;  4HZF A;  3IWF A;  2ZME A;  1F5T A;  4WK8 F;  2Y0M A;  2VC0 A;  5LHG A;  2DPU A;  3L9F A;  4MEY F;  1XMK A;  3N97 A;  2P6T A;  4BHC A;  4G6D A;  2BGC A;  3I64 A;  4YIF A;  3DXJ F;  4IPA A;  5LHI A;  2O3F A;  2B0L A;  1J59 A;  2Y75 A;  4UVA A;  1QNT A;  3RTR A;  1IAW A;  4P55 A;  3T8T A;  1DP7 P;  3CUQ A;  3DP7 A;  1MGT A;  2FBK A;  3R6S A;  3ISP A;  2FSW A;  2CO5 A;  2L4M A;  3BJ6 A;  3PQK A;  3BPX A;  3I0T A;  3QOP A;  4WX9 A;  1B9N A;  1GXP A;  5FFX A;  1XGM A;  1BI0 A;  4YFK F;  3F8C A;  1A04 A;  3R0J A;  2VXZ A;  3KP2 A;  3GYH X;  4G8X A;  5DEQ A;  1P92 A;  4IHS A;  4KN7 X;  3GFJ A;  1OYI A;  2IPQ X;  2KIM A;  2A6E F;  1FBU A;  1L3L A;  4LJZ F;  1U6G A;  3O2P E;  4Q47 A;  3LA3 A;  4YFN F;  1U3E M;  1IN7 A;  4N9H A;  4G6Q A;  2XAQ A;  3RPU A;  3RJP A;  2DFI A;  5E1X A;  4HYE A;  2FA5 A;  2BE5 F;  3Q9S A;  2RGV A;  1P2F A;  1FT9 A;  4S04 A;  1KU9 A;  1H9G A;  2L4A A;  2WTE A;  3V8K A;  3R4K A;  2EWN A;  5CVU A;  3GFM A;  2HKO A;  2PI0 A;  2QUF A;  1W5T A;  2H6C A;  5J8C A;  3QAH A;  3ERE D;  4CYD A;  3M1E A;  3HHH A;  1BIB A;  1CF7 B;  1IN8 A;  5D5X B;  5HDG A;  3ABU A;  1HQC A;  1XGO A;  2EV6 A;  1GHC A;  3CO6 C;  1DDN A;  3J81 Z;  5K5R A;  2NRA C;  1FP1 D;  1ZAO A;  2BEO A;  3IC7 A;  1U5T B;  3HIF A;  4GGG A;  3FXQ A;  2CGP A;  2EV0 A;  1PP7 U;  2RC4 A;  1HKS A;  3F6O A;  1I5Z A;  1ODD A;  2STT A;  1PUE E;  2K4J A;  4EJU A;  5D5W B;  3CUQ C;  5DCF A;  5A2Q Z;  2TDX A;  3RKX A;  1HXD A;  3QRF F;  4S05 A;  2CFX A;  1TQM A;  2CW0 F;  4TV7 A;  3PFI A;  1WRJ A;  4FX4 A;  1FYK A;  3TGN A;  4EM0 B;  2KIF A;  3PQJ A;  4EMS A;  2NAZ A;  3WTW C;  4A5M A;  2V79 A;  2FBI A;  4GYI A;  2GA2 A;  2O6G E;  3IWZ A;  4HOB A;  4JBA A;  1WKM A;  5H6R A;  1UHW A;  2VE9 A;  3JTH A;  4MNU A;  2L01 A;  5F6F A;  2ACJ A;  2PMH A;  2EV5 A;  2W84 A;  4ZYH A;  4LB5 A;  1R00 A;  4LLL A;  5E17 F;  1AWC A;  3BP8 A;  3E5X A;  4NQW A;  4WXH A;  5H6Q A;  2DAO A;  2MH9 A;  2QEN A;  2DT5 A;  3KP4 A;  1BI1 A;  5E1W A;  1XN7 A;  4QWQ A;  4HDU A;  3N4M A;  1H0M A;  3LA2 A;  3IL2 A;  4P5O A;  2GZW A;  2L54 A;  4RB2 C;  3FX3 A;  4I09 A;  3TO7 A;  1BI2 A;  5FD6 A;  2A07 F;  4HX8 A;  4ZYD A;  4A12 A;  4HX7 A;  5DUK A;  5LEK A;  3HSE A;  3KFW X;  4K2E A;  3QU6 A;  6PAX A;  3I58 A;  2HR3 A;  4KDP A;  3CUO A;  4G7O F;  4XSZ F;  1KYZ A;  5F64 A;  2FQ3 A;  1UHM A;  2AXL A;  4CIC A;  2Q2E A;  3RIR A;  1SFU A;  5EEH A;  3V7S A;  2M1B A;  2EJR A;  2W57 A;  4LK0 F;  4P96 A;  1FSH A;  5JVT A;  4XSX F;  4M9S A;  2KIU A;  2OU2 A;  3SFZ A;  2V1U A;  4LMY A;  3ULQ B;  3FMR A;  2HZT A;  3JTG A;  2GA1 A;  2LF7 A;  4LD5 A;  4N9I A;  4XBF A;  5HS9 A;  2BBY A;  2P7C B;  2EB7 A;  3H3U A;  4RS8 A;  5DD4 A;  4BQA A;  4HW0 A;  2RQP A;  2Z3Y A;  3HHG A;  5E8G A;  5FB2 A;  2HOE A;  1MJA A;  2RKH A;  2ADU A;  3E6B A;  5CVV A;  4YG2 F;  3ZP5 A;  1O57 A;  5IT9 K;  3IRQ A;  1BC8 C;  4EGZ A;  3R0A A;  4E70 A;  1TBX A;  4XLN F;  2LDU A;  1FYL A;  2LKP A;  3K2Z A;  1EH7 A;  1YIO A;  3WTZ A;  3HTS B;  3KCC A;  5TJJ A;  2E1C A;  1O3S A;  3ZN0 A;  1J7K A;  2KJC A;  1W7P B;  1BC7 C;  4U7D A;  3P9I A;  1HW1 A;  5TRD A;  2F5C A;  2K7L A;  4G7H F;  3T1B A;  1AOY A;  2A6H F;  4ZH4 F;  2P5V A;  3MWM A;  3RPQ A;  1LEA A;  1FSE A;  3R60 A;  4M71 A;  2WC2 A;  5CVJ A;  3BY6 A;  4U88 A;  2HDC A;  2Z99 A;  5BQT A;  3HTU A;  1LVA A;  3LST A;  2DK5 A;  1MDM A;  2A61 A;  4KMU X;  4HV6 A;  2W24 A;  4GCV A;  3J80 Z;  3NRV A;  1OKR A;  4MTE A;  4LGW A;  4OOI A;  5ILU A;  1O3R A;  2IT0 A;  3U9G A;  4RB3 C;  1XD7 A;  1V3F A;  1WSU A;  1ZRD A;  5E18 F;  2DO7 A;  4UNO A;  4Z2Y A;  4I98 B;  5BPI A;  3QP6 A;  3GLX A;  4EJO A;  2YX4 A;  2QBY A;  2D1H A;  1YQA A;  3GFI A;  3OOP A;  3MEX A;  1ZLJ A;  5JR3 A;  2RDP A;  2V6C A;  3C1D A;  2QYO A;  4M9Z A;  4WXC A;  4ASN A;  1KU2 A;  4BH9 A;  4CXF A;  1J75 A;  4LG0 A;  2PEX A;  3FF5 A;  4UVB A;  2H6B A;  4BXU A;  4OMZ A;  4M6X A;  1QZY A;  3FXU A;  4IRI A;  3SHF A;  3I53 A;  5K5O A;  4DNC A;  1TQP A;  1RI7 A;  3GFL A;  5HVQ C;  5E1Z B;  5FO5 A;  3VOD A;  4GYG A;  5D4R A;  2UXX A;  1CGP A;  2A68 F;  2VT3 A;  1XSX A;  1QGP A;  3GUD A;  1KU7 A;  3LFK A;  4HF0 A;  1ZYR F;  2ZME B;  4FT8 A;  1K78 A;  1KQ9 A;  2DLL A;  4UVC A;  1LQ1 A;  4CZZ A;  5ICF A;  3KLN A;  3W6K B;  5AIQ A;  1BBY A;  5L3C A;  3P9C A;  3GF2 A;  2FOK A;  1NHA A;  2QLZ A;  2IP2 A;  3P9K A;  1SMT A;  3KZZ A;  3GO5 A;  3KET A;  1IXR C;  2HTJ A;  1O7L A;  4A6D A;  2O8X A;  3E6C C;  5FGM A;  3CUQ B;  3E5U A;  1YW7 A;  1OR7 A;  2VOD A;  2DQR A;  3WE3 A;  3WOD F;  3FMS A;  4A2U A;  3JW4 A;  4G94 A;  2PN6 A;  3J81 K;  5D8L B;  2O61 A;  3HRU A;  1RUO A;  4HQE A;  3P7N A;  1KGS A;  2Q8K A;  1R36 A;  2KKO A;  4RAZ A;  1RNL A;  1XCV A;  1XCB A;  4IRG A;  3EUH A;  4ETS A;  5L3G A;  2DTR A;  2FU4 A;  4EGY A;  3F8M A;  1D8J A;  2P8T A;  1PDN C;  1PP8 F;  1EH6 A;  3FZV A;  4ENJ A;  4HX4 A;  3G73 A;  4D0P A;  1X3U A;  3K1M A;  1USS A;  1SMY F;  3EYY A;  2YX7 A;  1IW7 F;  3MZY A;  4JQF A;  3BJO A;  1Q1H A;  2OZU A;  1P6R A;  3I5U A;  4HA8 A;  2DPD A;  2XKO A;  2PLY A;  4CDG A;  5ERI A;  4ZYE A;  2V1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...