5HS8A

Crystal structure of the diamide-treated yodb from b. subtilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
HMMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator YodB
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs8A00
1ZN2A 3BPVA 4PGHA 5KVRA 3E97A 4YIFA 2COMA 2DO7A 1LDJA 1FP2A 1UHMA 1DUXC 3K1MA 1OR7A 2TDXA 4LK0F 1S8NA 4M9SA 4ENNA 2HYGD 4WXCA 3N4MA 2CW0F 2VN2A 1ONVA 1FBQA 4LJZF 1MGTA 4ZZDA 1U6GA 4P96A 4KN4X 3GEZA 2Y0MA 2XAQA 5IT3A 3HRUA 4ZYDA 4QLCU 1L0OC 5L3CA 2RC4A 1F1ZA 1YLFA 2K27A 3HHHA 1S7OA 3F21A 5EEHA 2WTEA 4FT8A 1BI1A 4I2OA 3P7NA 1W7PB 3KCCA 1B9MA 5AIPA 4BAYA 2O03A 2E1NA 3GFMA 2ZFWA 1ZHFA 2FSWA 1HSTA 1P2FA 1SD6A 2MH2A 1RUNA 2O61A 1FBSA 4KIBA 2Y75A 1O3SA 3BJ6A 3JAMZ 1KA8A 4FX4A 2W84A 3TO9A 2OU2A 4LB5A 2STWA 3QP6A 4YFNF 1LEBA 3I71A 2MA3A 3EYYA 4U88A 3E6DA 1J2XA 1ZRCA 3JSPA 3I59B 3RI4A 2JPBA 5A2QZ 3F8CA 3HHGA 4EVIA 1I5ZA 1QZYA 4I02A 3HRTA 1PP7U 3EYIA 1AWCA 2L02A 1MJAA 5LGNA 2ZXJA 5D6FA 4KIGA 3WTTC 1O7LA 3ZMVA 3MZYA 2V9VA 2Z9OA 6PAXA 1R58A 1T6SA 4PCQA 4IHSA 1RI7A 2DK5A 2XVCA 2CFXA 3ECHA 3V8JA 5BMZA 3CUQA 2JTVA 3RKXA 1USTA 3B73A 4RGRA 3SZPA 2CYYA 2M5WA 4Q5SF 4DQ2A 3RIRA 3WU0A 1EV7A 1FNNA 5L3BA 2G9WA 4BHBA 1FLIA 1FSEA 4A6EA 2XAHA 2M8EA 2Q2EA 2QENA 2HFHA 1F5TA 3KLOA 3FXQA 4MTDA 2LSOA 2DI3A 3GWZA 3N97A 2FU4A 2PN6A 4LLNA 1ZG1A 1K78B 3PFIA 1B1BA 4G7OF 2EV0A 4ON0A 4HV6A 1X3UA 5LRSA 5E18F 2FEZA 1ZG3A 4YG2F 3Q9SA 1ON2A 3CO6C 2EFWA 3E5UA 2P6SA 4RGUA 1YG2A 4OINF 3GFJA 4IHTA 3K69A 4P55A 1UHWA 2O0YA 1BIBA 1JGSA 3WG9A 1KU2A 2A6HF 1FOKA 4YFKF 3SZTA 1TQPA 3TGNA 3F72A 1CGPA 3ROUA 1P4WA 1XDSA 3IWZA 5ERIA 5HVQC 4LGWA 4Q48A 2QM3A 3KP7A 3VFZA 3F3XA 1IRFA 2IVMA 4O3MA 4LK1F 3E5XA 3MAJA 1R7JA 4LFUA 4OIPF 5IT9K 2IA0A 4UNOA 1QQIA 4BXUA 3M7GA 3CO7C 3ULQB 3WTYC 2LF8A 1XCBA 3W6JB 3L09A 5DUKA 2D1HA 5FD5A 4UV9A 1BI0A 4I01A 1R5GA 3QRFF 1Z6RA 4M9ZA 2K4JA 2NS0A 3IRQA 4WWCA 3GO5A 3WTSC 4WK8F 1L3LA 2B0LA 2JPCA 2VONA 3M8EA 3COAC 3K9TA 3H92A 5CVVA 2KJBA 3FMSA 2PFBA 3MWMA 1J5YA 1OYIA 3ZMTA 3FXRA 3GFIA 1V3FA 1YW8A 4HX8A 1DPRA 1G3SA 4GCVA 4LG0B 4HF2A 2EA2A 2V79A 2NNYA 1K79A 2VOPA 3KP6A 2EV5A 4HAMA 5ICCA 1T38A 1WKMA 2XKPA 3K0LA 2CO5A 2E1CA 1P4XA 2QQ9A 3K1NA 5JVTA 2ZCWA 4HQMA 1HW2A 3CUOA 2VBZA 1GVJA 1ZLKA 1J75A 2HGCA 5BPIA 4CICA 4HW0A 1MD0A 1TQMA 1W7PD 5H20A 2K86A 4A2UA 4O6JA 4EJVA 2FNPA 2J5OA 5JI6A 3ZMSA 1LEAA 1I6XA 5FD6A 1XGSA 2OQGA 1D8JA 5CLSA 2MH9A 3VODA 1A04A 1OYYA 4FHTA 4HDUA 4R1HA 5BQTA 1TNTA 3DV8A 1T39A 1D5VA 2HDCA 1Z6TA 5E1WA 4OIQF 3BY6A 3BJOA 4P9UA 1U5TB 3FXUA 3G3ZA 2VBXA 2O6GE 1P4AA 2ESHA 5CVIA 5J8CA 3KFWX 2YX4A 1S3JA 4HLYA 1SFEA 1E2XA 4HF0A 3DP7A 3QOPA 3WGHA 1YO5C 1HKQA 1MDMA 4GYGA 3ERED 3I64A 1ZAOA 3U2RA 2QYOA 3ZMZA 4CGZA 1E17A 2VODA 1BBYA 1XMKA 2OZ6A 2HR3A 3TOBA 3ZMUA 2P7VB 4AVPA 3R4KA 1R1TA 1R1VA 5LBQA 1KQ8A 3HYIA 1KU7A 1O3TA 2VC0A 3HOSA 3K2ZA 1TNSA 1BM9A 3BROA 2E7WA 4UVCA 4MTEA 2K7LA 1XSDA 4IRIA 1FX7A 1OMIA 2YX7A 2VE8A 1RZ4A 2KIUA 3DKWA 1FYMA 4KNYA 3DPTA 1QZZA 1PUEE 2MD5A 3O6BB 3BJAA 3GYHX 3HSEA 2OQRA 2ZNZA 1Z91A 4JK1X 2RGVA 2IA2A 4RB3C 1QPMA 2CGPA 1USSA 1FC3A 1Z9CA 2X4HA 3EDPA 5H6QA 2HEOA 5K5OA 1U2WA 2WV0A 4M72A 4KMUX 2F2EA 1Y0UA 4IF4A 4N0BA 1FYKA 1CF7B 1KU3A 2XV4S 1FP1D 2MLKA 5HLHA 4EMSA 2F5DA 4GO1A 3BPXA 2ZNYA 2BBYA 2ADUA 2ZMEA 4BNCA 2VBWA 3OV8A 3L00A 4HDVA 2YU3A 1ULYA 2XRNA 1V4RA 3I0TA 5FFXA 4XSZF 4AIHA 5ILUA 4ZZLA 1DP7P 1QNTA 2Q8KA 4U0WA 2YSRA 1SFUA 3I53A 2W85A 1ZG5A 5HS8A 3B02A 4BQAA 4HYEA 3E3VA 3I58A 4MQVA 5F64A 3IHUA 1UFMA 2BYVE 1IXCA 3F6VA 5DV5A 5L3FA 4HA8A 1BJAA 2MC3A 1W5SA 3HSRA 1J0RA 3LAPA 4B8XA 2DQLA 2XKOA 1KU9A 2O3FA 3LWFA 4UXNA 4L5JA 1ON1A 4IPAA 5AIQA 2ZJ2A 3CUQC 2PI0A 3V7CA 2RVCA 5ICGA 3J7AO 1ZRDA 1BC7C 2PBIA 2LDUA 1VTNC 1CF7A 3PQKA 2PMHA 1YIOA 2EFNA 3REOA 4WXHA 4MEXF 4NB5A 4HOBA 1QO0D 2XAJA 2YR2A 1IXSB 4AIJA 2D1VA 2DT5A 2XASA 3JW4A 4ZYHA 4KA4A 5LEKA 2ESNA 1S29A 4MGRA 1PDNC 4K2EA 4CHUA 1WQ2A 1GXQA 2IA1A 4I0AA 5LRRA 3O2PE 1JHFA 1U78A 3TOAA 5D5WB 3SQNA 3ABUA 5LHIA 3GX4X 1GHCA 3WODF 1DDNA 1TW3A 2DK8A 4WX9A 3IL2A 2CWEA 2QWWA 1EH6A 3HUGA 3L9FA 3WTVC 1S6LA 1BC8C 2FOKA 2V1DA 1YS7A 1H0MA 3LFKA 2IPQX 3MEXA 2ZBKA 3P9CA 4LB6B 2DFIA 2XAGA 2UXXA 5D8KB 3G73A 4XLNF 5FB2A 3TDZC 1FBUA 3JTGA 1R00A 4GYIA 2NYXA 2DPUA 3VOEA 2P7CB 2ACJA 4L18B 1W7PA 4N9IA 3TDUC 1O3QA 2XHKA 1BOAA 2Y48A 4HX7A 2CSOA 2VT3A 4KN7X 3TO6A 1EH7A 4BYYA 5FFZA 1EH8A 3C3WA 1TW2A 3KP3A 2Z33A 3DPLC 4D0PA 4YFXF 2QQBA 4JQFA 4ASNA 2A68F 3QP5A 5KK1A 3R61A 1MJBA 1FT9A 1XDUA 3TKYA 1ZREA 3ZPLA 3HTUA 2ELHA 2BGCA 2FRHA 3I59A 3DFGA 2P6TA 4I98B 4CZZA 2QQAA 5DD8A 1G3TA 2RKHA 2XUBA 1FYLA 3ZQ7A 4HZFA 4KDPA 5JHUA 1H9GA 3LA2A 4BHPA 4MEYF 1BI2A 2OBPA 5BPDA 2DBBA 3GLXA 4DNCA 3PQJA 4MHGA 4A0ZA 4KFCA 3MZHA 3V7RA 3EQLF 1HQCA 3C1DA 3QPTA 4XSXF 1SMTA 2BEOA 1IAWA 4G8XA 1HW1A 3KZYA 3KP2A 5D6EA 5J8FA 1GXPA 4EM1A 3F8MA 1XD7A 3ELKA 2BE5F 1ZRFA 3ZN0A 1LDDA 3SFZA 2QBYB 5E8IA 2HWVA 1OYWA 1KYWA 1XGNA 3CTAA 1K78A 2OD5A 1D3YA 2VOOA 2E7XA 1T2KA 5LEJA 2HOEA 3W6KB 5FLXK 2DPDA 3E6CC 5ED4A 2HKOA 2H94A 2FA5A 4G6DA 4OIRF 2RQPA 2GWRA 1ZH5A 2RDPA 5L3GA 3ISPA 1P92A 4Z2YA 5E17F 1IN8A 2YPRA 2A3SA 2DAOA 2HKXA 3WGIA 1I27A 5DCMB 2FE3A 2EV6A 4WF2A 4UV8A 3FWEA 4CYDA 1IN4A 1KQ0A 4EGYA 1UB9A 5JFRA 2HYFA 5HLGA 4EGZA 3RPUA 4XBFA 4EV0A 2IW5A 2EWNA 2QZ8A 2Z5UA 5ILSA 4OU0A 2JT1A 3L7WA 2ISZA 2STTA 3RJPA 1F4KA 3LSTA 4ESFA 1G3YA 5HOOA 4BHCA 4OMZA 3F23A 4IVNA 1ZGJA 5K5QA 3KLNA 1IN6A 1QBJA 4CO8A 2P5LC 3LA3A 3R0AA 2PLYA 2ZKZA 4Q47A 2M1BA 4ESBA 2OZUA 2PMUA 5IT9Z 3T1BA 2DQRA 2F5FA 4ZH4F 4O5VA 1U8RA 5LHGA 3D0SA 1IN5A 1YW9A 1LNWA 3RYPA 1YS6A 3C7JA 2NRAC 2GQQA 2L4MA 4LG0A 4G6QA 2LF7A 3WU1B 1JE8A 5D5UB 4HF1A 3F6OA 2AXLA 5J6XA 1YYVA 4PDKA 4G94A 5DCMA 5FO5A 2GAUA 2EFPA 3H3UA 4U0VA 2FXAA 1Z7UA 2F5EA 5D5XB 4KT5C 3KEQA 4ENMA 4L9VA 4RAYA 5ILVA 2EJRA 5E1XA 4M9XA 1WI9A 4QWQA 5D4RA 3GZ5A 2GA2A 4KYWA 4IJAA 4U0YA 1HKTA 3RKYA 3RPQA 5FLXZ 4WXDA 1DPUA 4ETSA 1SD5A 2W25A 1PP8F 3DQVC 4L9JA 2JRTA 5HDKA 1F9NA 1R5HA 2JZYA 4TV7A 2VE9A 3QPHA 1U5TA 2FF4A 4L0YB 4XLPF 1SD7A 3JAMK 2DU9A 2XIGA 1HSJA 1OKRA 1R36A 3M1EA 4EJOA 2NAZA 2IRFG 1IN7A 3S2WA 3DF8A 3FZVA 3R0JA 3EETA 3LA7A 4RS8A 3L2CA 3OOPA 4ZYGA 4RB1A 1WWXA 3MQ0A 3F8BA 3RDIA 4Y15A 4GXOA 4A12A 3M9AA 5FGMA 4EM0B 4KIFA 1HBXG 3FM5A 2IJLA 1G4DA 1TLHB 4NQWA 2A69F 1IXRC 4RGXA 2H27A 4EJWA 5CVUA 1MJ9A 1R1UA 4EJUA 1O57A 2CG4A 2RNJA 1SAXA 1IW7F 1T98A 3QAHA 1XB4A 3T0YA 1KGSA 1XGMA 3R60A 4LMYA 3GW2A 1HKSA 3CLOA 5CVJA 3MCZA 2XAFA 1RIOH 3ZMDA 1TBXA 1SFXA 3CUQB 4YIIA 1U3EM 2GXGA 3FHZA 3GZ6A 1G3WA 3VB2A 4AWXB 2UZKA 2UXNA 4RGSA 4M6XA 1IUYA 5CYVA 2L54A 4Y13A 1LDKB 2A61A 3FMQA 1XCVA 5EEGA 3BDDA 3BP8A 2NNNA 1I1SA 2R7FA 3GF2A 1AOYA 4EQQA 2ZO4A 3K1PA 4G7HF 1TQIA 1LJ9A 5HS9A 2EA4A 1XSVA 4PGGA 2H6BA 2PG4A 2M45A 4G9YA 3ZP5A 3ABTA 4UHTA 5DD4A 3J80K 3ECOA 2VXZA 2HS5A 4MQ9F 3HTSB 3V4GA 1ZGAA 4Q4ZF 2FNAA 3F8FA 2C6YA 5JR3A 2VT2A 4HBLA 4H0EA 3T5XA 4RB2C 2KKOA 1WSUA 4ENJA 3QU6A 2PEXA 4OOIA 2H6CA 2BV6A 5CJ9A 2VBYA 3KZZA 3HRMA 2A6EF 2PQ8A 3RYRA 4PZJA 2EFOA 4GGGA 2H09A 3RTRA 1JHHA 1I1GA 2W24A 4NHJA 1IZ1A 5HDNA 5H6RA 1OPCA 4B09A 3I54A 3FF5A 4MNUA 5E1ZB 1RUOA 3P9KA 3CDHA 1Q1HA 5ICFA 3F22A 1YW7A 4FX0A 2ETHA 3ZN1A 2VC1A 5HDGA 5BS6A 3R6SA 4IRGA 2HQNA 3DEUA 5DEQA 1C0WA 2M30A 2R7DA 4A0XA 3NQOA 4L0ZB 2K02A 2X0LA 1HW5A 1FPQA 2PJPA 3V8KA 4HLXA 3BWGA 4R79A 1STZA 2CQKA 1ODDA 2O8XA 3KE2A 1LB2A 2IP2A 2KJCA 2FBKA 3NRVA 4M71A 4R8HA 5LLQA 4M73A 4ZYEA 3GFLA 1YFHA 2HTSA 3HOTA 2FBIA 3KETA 3QU3A 3DXJF 1YTYA 3KP5A 3BZ6A 1LQ1A 3T8TA 3WTXC 3SHFA 4P9FA 5TRDA 1FZPB 2V1UA 2MLGA 3HIFA 2D2WA 2DTRA 5HLIA 4KUMA 4CDGA 1SD4A 3GXOA 1XSXA 4IXAA 4E70A 2WC2A 3FX3A 5F1RA 5BOXA 2UWMA 1KQ9A 4OIOF 3NEUA 2L3DA 3Q5FA 3J80Z 4JBAA 5K1YA 3V8LA 1J7KA 2P5VA 4I09A 3E6MA 3U1DA 2M87A 4UUVA 1XN7A 3RKWA 4CXFA 1FSHA 2FBHA 2W57A 5TJJA 2GA1A 1MDMB 4P5OA 4UVAA 1R22A 1HXDA 5E8GA 4RAZA 1W5TA 4F7ZA 2WWYA 1RNLA 1UCRA 1R23A 3F8NA 1B6AA 5CVRA 3M8FA 1K7AA 1QGPA 2Z99A 1K6OA 3CJNA 4N9HA 1W4MA 1B4AA 2Z3YA 3TQNA 4BH9A 1MKMA 4A5NA 3IKTA 4ESJA 1G6NA 1IF1A 3HRSA 2A07F 2HZTA 3LQQA 3E6BA 2QUFA 1FY7A 4IRHA 2OAZA 3J81K 1T0FA 1YQAA 4I0BA 1P6RA 3GUDA 2F5CA 3IKVA 3HSFA 2RV8A 1XGOA 1S7AA 5E20A 4L9TA 1REPC 4OMYA 2EFQA 4ENKA 4S05A 1BI3A 2LKPA 4A6DA 5DDGA 5K5RA 2EB7A 2GIVA 3I5UA 1J59A 4G7ZF 3SXYA 1U5TC 3JSOA 4HX4A 1WRJA 1TTYA 1Z1DA 2QBYA 4L9NA 4LLLA 1BIAA 2OA4A 1ZLJA 3TO7A 5AONA 2L01A 3WTUC 2V1XA 1H9TA 3WTZA 3H3ZA 3JTHA 3WE3A 2DLLA 1XMAA 3D5LA 4XRFA 2ZMEB 2L4AA 4AD9A 5D8LB 3Q9VA 2KRFA 1NHAA 3BOQA 2A5YB 5DCFA 4M6YA 5LGTA 1O7FA 4WCGA 3FMRA 2P5KA 5DYMA 2XGXA 2FMLA 4EM2A 1J9IA 1BN5A 5D5VB 2AS5F 5HS7A 3C18A 3LQRA 4UVBA 5L3DA 5LHHA 2EK5A 2Q0OA 4RB0A 5F6FA 3IC7A 1B59A 3WGGA 2LNBA 3AAFA 2KIMA 4EJTA 5ICEA 4L5IA 1D8KA 4KICA 2GXBA 4KMFA 2G7HA 4U7BA 3V7SA 3LAJA 2QLZA 5L3EA 5DUIA 3WE2A 3E5QA 3P9IA 2R3SA 1ZARA 4LLGF 2FMYA 4Y17A 4A0YA 4HV5A 4AIKA 1KYZA 4U7DA 3MFKA 4LD5A 1B9NA 3KP4A 1FWZA 3IWFA 2GZWA 2DW4A 2IT0A 4M74A 5A2QK 3J81Z 2JSCA 2RN7A 2QVOA 4S04A 2HQRA 5LGUA 4I7HA 2P4WA 2HTJA 2XROA 1ZYRF 3T8RA 2G7UA 2K4BA 1LVAA 1MZBA 3FM3A 2ISYA 3I4PA 2FQ3A 3KEOA 1SMYF 2J5PA 3VEPA 2V6CA 4HQEA 2KIFA 2P8TA 3IRRA 3ML6A 2MBFA 5D4SA 1O3RA 3WTWC 3EUHA 1JXSA 4A5MA 1Z05A 3O3KA 1IRGA 2D45A 3U9GA 3GVAA
chains in the Genus database with same CATH superfamily
3S2HJ 1ZN2A 3BPVA 1Z3YA 3VDXA 3CC2I 4PGHA 2GBYA 4LIUA 5KVRA 3E97A 5C4XJ 4YIFA 5GP9A 2COMA 2ZJPF 2DO7A 1K4TA 5DM6F 3HPHA 2R7OA 1QRYA 1LDJA 1FP2A 1UHMA 4B3AA 3ZQQA 5FKLA 1DUXC 2LG4A 3K1MA 1OR7A 2TDXA 4LK0F 3CC4I 4IHVA 4BUPA 4J19A 1S8NA 4XIDA 4M9SA 4ENNA 2HYGD 4WXCA 3HUGB 3N4MA 2CW0F 3ABMH 2VN2A 1ONVA 2F6CA 1FBQA 4LJZF 1MGTA 4ZZDA 3PO2J 4NDLA 1U6GA 4P96A 4CCMA 3G2BA 4CYCB 1NK3P 4KN4X 3C2HA 2Y0MA 2XAQA 3GEZA 4IHYA 1HA8A 5IT3A 3HRUA 4ZYDA 4QLCU 1LPQA 1L0OC 2VPRA 5L3CA 2RC4A 1F1ZA 4BQOA 3GTMJ 2WAQN 1YLFA 2K27A 3HHHA 2KDZA 3GBGA 1S7OA 3F21A 5EEHA 2L7FP 3HOXJ 4AC0A 5IYBJ 5EDNA 2WTEA 4FT8A 1IO2A 2F4OB 1BI1A 4I2OA 3P7NA 1GLNA 1YIJI 1W7PB 3KCCA 1B9MA 3PJRA 5H2FC 3BTCA 1RR8C 3B6CA 5AIPA 1IC8A 4BAYA 2O03A 4PFPA 2E1NA 3GFMA 2L9SA 2ZFWA 4BE1A 1IV6A 1ZHFA 2FSWA 5IP9J 1BA5A 1HSTA 3OYIA 2MGQA 1P2FA 4X6AJ 1SD6A 2MH2A 4JX4A 1RUNA 2O61A 3HC7A 2VL8A 1FBSA 4KIBA 3L2QA 2Y75A 3OR2C 1O3SA 5JHFA 3BJ6A 4EATA 3JAMZ 1KA8A 4FX4A 2W84A 3TO9A 2OU2A 4LB5A 4CZCA 3EPZA 1X1PA 4V2FA 1JKRC 2STWA 3QP6A 1WFXA 4YFNF 2M0CA 1LEBA 2HVQA 2VKVA 4G12A 1V5FA 4Z6YA 3HGYA 3I71A 3DWLE 1Y39A 1MMAA 2MA3A 3EYYA 4U88A 2E5ZA 1J2XA 2DT6A 3E6DA 2ME6A 1ZRCA 2WY7Q 2X48A 4XRSG 3JSPA 3I59B 4X0GA 3RI4A 2JPBA 5A2QZ 2W00A 3F8CA 4C3JJ 3HHGA 5B3SH 4EVIA 1I5ZA 1QZYA 4I02A 4E7HA 1VQ4I 2E36A 3HRTA 1KZHA 3HOYJ 1PP7U 3EYIA 1WJ5A 2LBFB 1AWCA 2L02A 1MJAA 2DT7B 5LGNA 2R5YA 2ZXJA 5D6FA 4KIGA 3OYMA 4HNUA 1O7LA 4XLFA 3WTTC 3ZMVA 4CCJA 2X1EA 3JRGA 3MZYA 2ZFUA 2V9VA 4PJNA 2F48A 2Z9OA 2CUFA 2ECBA 3IAM2 2JA5J 6PAXA 3SEQA 2WAEA 4ZYAA 1P9QC 1Z67A 1R58A 1T6SA 4PCQA 4IHSA 1RI7A 2DK5A 2XVCA 4JYKA 5B5EC 2CFXA 1WJDA 4ANJA 2K9QA 4XLCA 2GLOA 3ECHA 4XOPA 3V8JA 5BMZA 3CUQA 2JTVA 4XRMA 3BTJA 1VFCA 4FCYA 4UUTA 1USTA 3B73A 3RKXA 2MFZA 4G6TB 1R4NB 4RGRA 3OWTA 4PJ0C 2BHYA 3SZPA 2CYYA 3CCUI 1ERDA 3BG9A 2M5WA 4Q5SF 4DQ2A 2WB1A 1X1AA 4QIWN 5GTHC 3RIRA 3WU0A 1EV7A 2R0QC 1FNNA 1R71A 5L3BA 4BBRJ 4PJJA 3JREA 2R7WA 2G9WA 4BHBA 1FLIA 2JVHA 3D5RC 1FSEA 1MMDA 2XGEA 4A6EA 2XAHA 2M8EA 4IKFA 3DTKA 2Q2EA 2QENA 1YJWI 2HFHA 1F5TA 3KLOA 4MLOA 2CQQA 5CKTA 1G2HA 3FXQA 3O8HA 4MTDA 2DMPA 3LSPA 2R92J 2H1KA 1R9TJ 2LSOA 2DI3A 4CCKA 1VQOI 1JT0A 1DP3A 2A6TA 3GWZA 1IDZA 3N97A 3GTPJ 2M7BA 3H9QA 3K4BA 2FU4A 2PN6A 4LLNA 4GRIA 1ZG1A 1ZR4A 1K78B 3PFIA 1B1BA 3TP3A 4G7OF 2EV0A 4ON0A 2B7EA 1ITYA 1RR7A 3C2GA 4HV6A 4XNFA 1X3UA 2DYSH 5LRSA 3OR1C 2OV7A 5E18F 2FEZA 2VQLA 2LC2A 1ZG3A 1NG7A 4YG2F 2IS4A 3Q9SA 1JKOC 1ON2A 1F36A 3CO6C 2EFWA 3IH3A 3TEDA 4YELA 3E5UA 2P6SA 4RGUA 1YG2A 4OINF 4YIRX 1POGA 3GFJA 4IHTA 2M8GX 3K69A 4P55A 1UHWA 2O0YA 3NAUA 1BIBA 4IOAF 3ZRGA 3IH4A 1JGSA 2DMNA 3WG9A 1KU2A 2A6HF 1FOKA 4YFKF 4W97A 4DJAA 4B48A 3SZTA 1TQPA 1TWAJ 3F72A 3TGNA 2LBFA 1CGPA 3ROUA 4D5FA 1P4WA 1TWHJ 4X1EA 1XDSA 3IWZA 5ERIA 5HVQC 4LGWA 4Q48A 2QCOA 2CUZA 2QM3A 3KP7A 3VFZA 3F3XA 1IRFA 3HGGA 3RQIA 1YJNI 2IVMA 3EUKL 4O3MA 5HNHA 4LK1F 3E5XA 3UNGC 3MAJA 1R7JA 4LFUA 4OIPF 2E19A 5IT9K 3OYAA 4XOTA 3K70C 4CUGA 1T8IA 2HOSA 2IA0A 3ZQLA 3CCJI 4UNOA 5B1BH 2OCCH 1E3HA 2M9HA 1YX3A 3BR2A 1QQIA 1IRZA 1U9NA 1YI2I 4BXUA 3FK7A 3FBNB 3M7GA 3K4JA 3CO7C 2NXNB 2KLOA 1OLTA 3ULQB 3WTYC 3HOVJ 1FTZA 4HSTA 3S1RJ 4B4CA 2LF8A 1XCBA 5KNLA 3L09A 5DUKA 2D1HA 5FD5A 3W6JB 4HNTA 1Z7LA 4UV9A 1BI0A 2K40A 4I01A 1R5GA 2GOXB 2Q1ZB 2L7MP 3QRFF 4OAZA 1ZR2A 2E5NA 2DMTA 1Z6RA 4M9ZA 1WJCA 2K4JA 2NS0A 4UB6C 3IRQA 4WWCA 3GO5A 2VKEA 3WTSC 1WH5A 4WK8F 1L3LA 1ETVA 2B0LA 2JPCA 2VONA 3M8EA 4YRVA 3Q0VA 2IS1A 3COAC 3OIQA 3K9TA 3VSKA 2LTPA 1G8XA 3H92A 2HDDA 3GTLJ 1Z21A 2XSJC 2KJBA 5CVVA 3FMSA 4PSWA 4XLAA 1YHQI 4M3FA 2PFBA 3MWMA 2Y9YA 1J5YA 4KISA 1OYIA 3ZMTA 2E71A 3FXRA 3SZGA 3KYCB 3FKIJ 3GFIA 3CP2A 2E60A 1V3FA 1YW8A 4HX8A 1DPRA 1G3SA 3OL3A 4GCVA 4LG0B 4HF2A 2EA2A 5GADJ 4C9YA 2V79A 2NNYA 1RETA 2FQ4A 3HM5A 1K79A 2CUJA 3GCMA 2VOPA 3KP6A 2EV5A 3M3YJ 4HAMA 5ICCA 3QYBA 1EKEA 2XDVA 4XK4A 2XPWA 1T38A 1WKMA 3BR3A 2CU7A 3H5NA 2XKPA 2VQGA 3K0LA 3CJRB 2CO5A 2E1CA 2L9RA 1P4XA 2QQ9A 4RMNA 3K1NA 4XONA 5JVTA 2ZCWA 4HQMA 1HW2A 3CUOA 2VBZA 2CFOA 2Z16A 1GVJA 1ZLKA 1J75A 2HGCA 5BPIA 4CICA 4HW0A 1MD0A 1UG0A 1JI8A 1TQMA 1W7PD 3QQAA 2NVYJ 2K86A 4NC6A 5H20A 4A2UA 3J7YJ 4O6JA 2TRTA 1FJLA 2L9NA 4EJVA 2FNPA 2J5OA 2O7OA 3ZMSA 1LEAA 1I6XA 5FD6A 5JI6A 1XGSA 2OQGA 2CV2A 1D8JA 4HG2A 1NG6A 3L2RA 1Z3XA 5CLSA 2MH9A 5J4VA 3CCSI 5JLXA 3VODA 1A04A 4GFBA 1OYYA 4FHTA 4UUSB 1Y1WJ 4HDUA 4R1HA 1OFCX 5BQTA 3S3OA 1TNTA 3DV8A 1T39A 1JKPC 1D5VA 3DCFA 2BY1A 3RZDJ 2HOTA 2HDCA 1Z6TA 2O9LA 5E1WA 4C3IJ 1FIPA 4OIQF 3LSMA 2AHQA 3BY6A 3BJOA 1H89C 4P9UA 2CV1A 2JA2A 1U5TB 5HLTA 3FXUA 1R49A 3G3ZA 3RQ4A 1XS9A 2R93J 3HOUJ 2VBXA 2O6GE 2KISA 1P4AA 1LE8B 2TCTA 4UB8C 2DA2A 3A02A 4M3GA 2ESHA 5CVIA 5J8CA 3KFWX 1ZELA 2YX4A 4BDZA 2HDWA 3W3CA 1S3JA 5FKMA 4HLYA 1SFEA 1E2XA 4HF0A 3DP7A 3S3NA 3QOPA 3WGHA 1YO5C 1HKQA 2MG4A 1MDMA 2ZB9A 4GYGA 5GTIC 3ERED 4ZJZA 4BKXA 3P5JA 4A69C 3I64A 5JLWA 1ZAOA 3U2RA 2QYOA 3ZMZA 4CGZA 2HOAA 2VODA 1E17A 5EGOA 5TISC 2AXTC 1BBYA 1XMKA 2OZ6A 2M7AA 2HR3A 2PX9A 3TOBA 4OAYA 3ZMUA 5E3MA 5EZHA 2XAUA 2P7VB 2E2IJ 4AVPA 3J7ZI 3R4KA 4PFOA 1YOVB 5IP7J 3RZOJ 1R1TA 1LVKA 5IOYA 1R1VA 5LBQA 1KQ8A 3S2DJ 3HYIA 1KU7A 1YRNB 1O3TA 2VC0A 4NQWB 3HOSA 3K2ZA 1TNSA 3IP4B 1BM9A 2BOLA 3BROA 3PO3J 2E7WA 3OOUA 2DJIA 1APLC 4UVCA 3K4NA 1X4OA 4MTEA 2K7LA 3EUAA 3DKYA 1XSDA 4IRIA 1FX7A 3DEEA 1VQ7I 1OMIA 2YX7A 2VE8A 1RZ4A 2KIUA 3DKWA 2XGDA 1FYMA 4KNYA 2Y2ZA 3DPTA 1QZZA 1PUEE 2MD5A 3EUHC 3O6BB 3BJAA 3JRDA 1OCRH 1PVEA 1VQNI 3GYHX 2IGOA 3HSEA 1QVTA 2OQRA 2ZNZA 1QZEA 4FE7A 1Z91A 4JK1X 1BJZA 1CQTA 2G0EA 3PFYA 2RGVA 2HU9A 2BY3A 2IA2A 4RB3C 3H35A 1QPMA 2CGPA 1USSA 1FC3A 2DOEA 1Z9CA 2HPIA 2X4HA 2ZXWH 4B43A 2XPUA 1OJLA 3CC7I 3FXMA 2HI3A 1DGRM 1SFOJ 1OR7C 2R7TA 3EDPA 5H6QA 1VZ0A 2HEOA 2WADA 5K5OA 1U2WA 3M1CA 2WV0A 2R7VA 1MMGA 4M72A 4QTRA 2VXDA 4KMUX 2V6EA 2JA7J 4M3BA 1ZKGA 4ZDPA 4RDUA 1FOXA 2F2EA 3SEZA 3ZQCA 3UKGA 1Y0UA 4IF4A 4N0BA 1FYKA 2BHZA 1CF7B 3AG2H 4LIVA 2E1MB 1LE8A 1KU3A 2XV4S 2XF5A 1FP1D 2MLKA 2PJRA 1MBHA 5HLHA 3BCBA 5K7FA 1VF9A 4EMSA 2LKXA 1MBEA 3QPSA 4C3HJ 2F5DA 4GO1A 2HQ5A 3VSLA 3BPXA 2ZNYA 1WVRA 4IX7A 3SYTA 2BBYA 1QVUA 2ADUA 2ZMEA 2ZSHB 3BLYA 3OYHA 1W36C 4BNCA 2VBWA 4ZC3A 3F9KA 3OV8A 3FXJA 3CCEI 3BR6A 1BR1A 1EA3A 3L00A 1A31A 2HZDA 3NWSA 4A3FJ 4HDVA 5M3MJ 1D5YA 4E7ZA 4HSRA 2YU3A 1ULYA 2XRNA 1V4RA 4E7IA 3I0TA 5FFXA 4XSZF 3IH2A 4AIHA 5ILUA 4DIQA 4ZZLA 1DP7P 1QNTA 3ESWB 2K5CA 2OF7A 2Q8KA 4PSXA 4U0WA 2YSRA 1RRJA 1SFUA 3BC8A 3CP8A 3I53A 2W85A 1ZG5A 1RKTA 1AKHB 5HS8A 2Y0SN 1SVOA 1WCMJ 1BR4A 3DTEA 3B02A 1YJ9I 2KZGA 1QA6A 2KQRA 4BQAA 5LD2C 4HYEA 3E3VA 3I58A 2W1OA 4HPQA 4MQVA 5F64A 3DBHB 3IHUA 2VJIA 5E3OA 1UFMA 5M3FJ 2BYVE 3ONQA 1MNMC 2V9PA 3QYFA 1U9OA 1IXCA 1JTXA 3F6VA 5DV5A 4HNVA 3CDIA 4HA8A 5L3FA 2R5ZB 5C3EJ 1BJAA 4A3CJ 5C4JJ 2MC3A 3HEFA 1ENHA 1ETYA 4JX5A 1W5SA 3HSRA 3HL2A 2ID6A 1J0RA 3HXLA 2A05A 1MH4A 3LAPA 4Y3OA 4A3DJ 4B8XA 2DQLA 2LFBA 4DYCA 2JN6A 3A01B 2XKOA 5E3LA 1KU9A 2O3FA 4IOCF 4Y52J 3LWFA 1OQYA 4UXNA 4L5JA 1BR2A 2LOOA 4LG3A 1XTAA 1SVMA 1ON1A 3MD2A 4IPAA 5AIQA 1PUFA 1HOMA 2ZJ2A 1SEUA 5KAIC 3CUQC 3SFIA 3JCUC 2RVCA 3V7CA 2PI0A 5ICGA 3JRHA 3J7AO 1ZRDA 1BC7C 1OCPA 2KIQA 2PBIA 2LDUA 2VASA 3PNYA 4AYBN 1VTNC 1YE9A 5K7HA 2NVUB 4LITA 1BW6A 4IO9F 2DTZA 1CF7A 2OUMA 3PQKA 1D1AA 2PMHA 1YIOA 1TZLA 2EFNA 3REOA 4WXHA 4MEXF 4NB5A 1B72A 3FBIB 2I10A 4HOBA 3GTJJ 1VQMI 3I9V2 3ZGKA 1WJEA 1QO0D 5J4YA 2XAJA 2RQQA 3O8GA 2YR2A 1IXSB 4MFDA 4AIJA 2EIMH 1ORKA 1FMVA 2D1VA 2V1NA 2JVGA 2DT5A 4BJ6C 5FROA 2OCEA 2XASA 3JW4A 4ZYHA 2LVSA 1Y8QB 4KA4A 2LY1A 5LEKA 2ESNA 4D1QA 1S9HA 1S29A 4RM3A 4RLFA 3K4LA 4MGRA 2B9SA 5CQEA 1PDNC 1E3PA 3ERMA 4XICA 3FXOA 4K2EA 4CHUA 4ZTFA 3WU2C 2XGCA 3W2VA 1WQ2A 2QKMB 4Y7NJ 2QEXI 3S1QJ 1GXQA 2LK2A 2IA1A 4I0AA 1TL8A 5LRRA 3O2PE 1JHFA 1U78A 1Y8RB 3TOAA 5D5WB 3CMAI 5FJ8J 1TC3C 3SQNA 3ABUA 4E4HA 1O4XA 3PL8A 1HF0A 1VQ9I 3DLAA 5LHIA 3GX4X 2F5VA 1GHCA 4XLHA 3WODF 2EH3A 1DDNA 1JTYA 1TW3A 4BQNA 2DK8A 3KIOA 4PJLA 3TW6A 1R5ID 1UELB 4WX9A 5IYDJ 3IL2A 2CWEA 2PMZN 2M2EA 2QWWA 3G1MA 3LSKA 1EH6A 3VYTB 1P7IA 3S32A 3HUGA 1TP4A 3GZNB 3L9FA 2R5ZA 1V5GA 1MBGA 4I76A 3BG5A 3WTVC 1I6HJ 1S6LA 1BC8C 2FOKA 4CYCA 2V1DA 1YS7A 3BT9A 4BEHB 1H0MA 3LFKA 2V26A 2WV1A 1RPWA 2DA1A 2IPQX 5F0FA 3MEXA 2ZBKA 2HYJA 3P9CA 4LB6B 2DFIA 2XAGA 3W6VA 3BR1A 1GUUA 3VWBA 2UXXA 5D8KB 5J1YA 2X1CA 3G73A 3HDDA 4XLNF 5FB2A 3H5AA 1DQUA 3TDZC 3RKQA 1FBUA 3OYEA 3JTGA 1R00A 4GYIA 2NYXA 2DPUA 3VOEA 2P7CB 3QPLA 3KX2A 2ACJA 1B8IB 4L18B 1W7PA 3JRIA 1ETQA 4N9IA 3TDUC 3OS1A 1O3QA 2XHKA 2KP6A 3DBRB 2DA6A 2CS3A 2HNHA 1JUMA 1BOAA 2Y48A 2JUCA 3PIPF 1Z77A 4XLEA 5TGTA 3I3LA 4HX7A 2CSOA 3BR0A 2VT3A 4D7NA 4KN7X 2DOFA 2HPMA 2ZJRF 3TO6A 2Y9ZA 1EH7A 4BYYA 3DEWA 5FFZA 1EH8A 3TMOA 3C3WA 1TW2A 4CH7A 3KP3A 2Z33A 3DPLC 4D0PA 4YFXF 4I6ZA 2LYCA 1FEXA 3L1PA 2QQBA 4JQFA 3ZQFA 4ASNA 4A3JJ 2A68F 3QP5A 3BZKA 5KK1A 3R61A 1MJBA 1UMQA 3I56I 1FT9A 2DFEA 1Y0NA 3MKYB 1XDUA 3TKYA 1W0UA 1ZREA 3ZPLA 3HTUA 2L2OA 1RC9A 3OYCA 2ELHA 2BGCA 3WHBA 2FRHA 2VQCA 2VKDA 1FTTA 2AQEA 3I59A 3BR5A 3DFGA 2KL4A 2P6TA 4I98B 3LL7A 3W2WA 1MMNA 2QQAA 4CZZA 5DD8A 1G3TA 4BL0B 2L0KA 2RKHA 2VKHA 2XUBA 3CCMI 2X9DA 2LP0A 1FYLA 1EJ9A 3ZQ7A 4HZFA 2E34A 2ZSIB 4KDPA 5JHUA 1H9GA 3LA2A 4BHPA 2CUEA 2W48A 2BY0A 2IXSA 4MEYF 1S7EA 1F43A 1BI2A 1TWGJ 1QPIA 2CW8A 4DOZA 1TT0A 2OBPA 3U1KA 5BPDA 2DBBA 3GLXA 5FRNA 3ZOBA 4QPQA 4DNCA 2IGMA 3PQJA 4MHGA 4A0ZA 4ITVA 2VQHA 4KFCA 3MZHA 1T0FC 3V7RA 4DW6A 3PUBA 3G71I 1DGWY 3PNTA 3S16J 1MBKA 2E35A 1WH7A 1BOBA 2BW3B 4PK4A 1OCOH 1I3QJ 3EQLF 2JA6J 1HQCA 2O5RA 3BG7A 3C1DA 3QPTA 4XSXF 4BEHA 3G4SI 1SMTA 2BEOA 1IAWA 2EQRA 4G8XA 5IP6A 1MBFA 3X2QH 1HW1A 3KZYA 3KP2A 3IV5A 5D6EA 4E6KG 5J8FA 1GXPA 2RREA 1UZCA 4EM1A 3IUOA 2I8DA 2X51A 4Y4RA 3F8MA 5IY5H 1XD7A 2LH9A 3L2UA 2ZXHA 3ELKA 5JVGF 4BGDA 2BE5F 1ZRFA 3M4OJ 3ZCOA 3ZN0A 3FHNA 3S1NJ 1LDDA 3MZ8A 3SFZA 1SVLA 1KONA 2M4GA 2OPTA 2V4JC 2K9MA 4KT6A 3C2BA 1N75A 1X2NA 2QBYB 5E8IA 2HWVA 5BNGA 1N77A 1OYWA 1T95A 1KYWA 1XGNA 5F27A 2VIXA 3BQYA 3CTAA 1K78A 2OD5A 1D3YA 3M07A 5B1AH 1XMXA 2VOOA 3JRCA 2E7XA 2L7ZA 3LSGA 3QOEA 3S1MJ 4A3BJ 3D5SC 3OSFA 1WJBA 1T2KA 1S5LC 5LEJA 2OTLI 2HOEA 3U21A 3W6KB 2JK3A 5FLXK 4NUBA 3E6CC 5ED4A 2DPDA 1ZK8A 2HKOA 2HXIA 2H94A 2KDOA 1VQ5I 2FA5A 3OS0A 3IAS2 4G6DA 4OIRF 3A4CA 3CCYA 1MBJA 2RQPA 4J01A 4IZZA 2GWRA 1ZH5A 2RDPA 5L3GA 3ISPA 3JRAA 1P92A 2EIKH 1X3ZB 4Z2YA 5E17F 1IN8A 2YPRA 3I4NJ 4NNJA 4AVZA 2A3SA 2DAOA 2HKXA 1MMSA 2R7XA 4A3EJ 2DJNA 5F0HA 3WGIA 3JRBA 4GDFA 1I27A 5DCMB 3OYNA 2FE3A 2Y31A 3K4KA 2EV6A 1SFKA 2D5VA 4WF2A 4UV8A 1TWFJ 1R4MB 5C44J 2KZVA 3FWEA 4CYDA 2NVXJ 1IN4A 3WHCA 2WAQA 1D1BA 3OMYA 1KQ0A 5FKOA 3KPHA 4EGYA 2JQ7A 3HG9A 1UB9A 1G59A 5F08A 3PIOF 5JFRA 3HZJA 2HYFA 3CMEI 5HLGA 4EGZA 3RPUA 4XBFA 4EV0A 2IW5A 2VPLA 3K10A 2EWNA 2QZ8A 1SANA 3CJTB 2JWTA 3K2AA 2Z5UA 5ILSA 4OU0A 2JT1A 4HRIA 3L7WA 2ISZA 2STTA 4AYBA 4B1RA 3RJPA 3ZQHA 1F4KA 1WJAA 4DBRA 2BW3A 3LSTA 2LR8A 3HOZJ 4ESFA 2GIZA 1G3YA 3H9GA 5HOOA 1BW5A 3GTQJ 4BHCA 4B3XA 4OMZA 1GV2A 3F23A 3CDLA 4IVNA 1ZGJA 3F0CA 5K5QA 1W1WE 3KLNA 4FASD 1IN6A 1QBJA 4CO8A 2P5LC 3LA3A 3R0AA 2ZXIA 2PLYA 1VQLI 4D9JA 1VQ8I 5J1UA 2ZKZA 1AA7A 4Q47A 2M1BA 4ESBA 2E2HJ 2OZUA 2PMUA 2FJ1A 3H36A 5IT9Z 4CA0A 3T1BA 2DQRA 2F5FA 4RBOA 4ZH4F 3ABLH 4O5VA 2H8WA 1WGXA 3AL0C 1FOYA 1U8RA 1N25A 3DPUA 5EYRA 2EZKA 5LHGA 3D0SA 4XM3A 4A3MJ 1IN5A 2N8GA 1YW9A 1LNWA 1MNDA 3RYPA 2X6XA 1YS6A 3C7JA 2O8KA 2DDBA 2NRAC 2GQQA 2L4MA 2WA0A 3BG6A 4LG0A 4BXXJ 4RAFA 1DU0A 4G6QA 2LF7A 5GPAA 2ZMEC 3PUFA 3WU1B 1JE8A 2BXYA 1J09A 1NK2P 1FIAA 5J1RA 5D5UB 1SC7A 4HF1A 1DU6A 1ETWA 3F6OA 5EG0B 4AU7A 1D0YA 2IEKA 2AXLA 5J6XA 1X1DA 2PMZA 5F1JA 3PM1A 4XKCA 4XN3A 1YYVA 4PDKA 4G94A 3BZCA 3ASOH 5DCMA 5FO5A 3CCVI 2GAUA 5FRMA 1D0ZA 2FD5A 2XSDC 3CCLI 2EFPA 2FUG2 3H3UA 4U0VA 2FXAA 2KFDA 2VJ5A 1X58A 1Z7UA 1I50J 2F5EA 4NC7A 4KT5C 3KEQA 4QPOA 5D5XB 4ENMA 1RESA 4L9VA 4RAYA 3KYLA 5FLVA 5ILVA 2EJRA 5E1XA 4P1WA 4DYQA 4M9XA 1WI9A 4QWQA 3VYRB 5D4RA 3GZ5A 2GA2A 1A35A 4KYWA 4IJAA 4F93B 4U0YA 1HKTA 5CPRB 2MYSA 3RKYA 1X2MA 3RPQA 2QQ8A 5FLXZ 1K83J 2ME0A 4WXDA 1XC5A 4ETSA 1DPUA 4UUSA 2R7ZJ 1SD5A 2W25A 1PP8F 1HLVA 3DQVC 1A36A 4L9JA 4MFEA 4MIMA 2KRHA 4BXFA 1U0JA 2JRTA 5HDKA 1F9NA 1R5HA 2K3FA 2JZYA 4TV7A 2VE9A 4CSWA 2DDAA 3QPHA 5DM7F 5GAHJ 3JRFA 2CV0A 1MSEC 3GTKJ 4C2MJ 1U5TA 2FF4A 2W4SA 3PNVA 3K7AJ 4L0YB 4XLPF 3CZ6A 1SD7A 3JAMK 2DU9A 2XIGA 1HSJA 5B66C 1PYVA 5E79C 1OKRA 1R36A 3M1EA 2X6WA 4EJOA 3VYSB 3OIPA 4XL9A 1W5CC 2NAZA 2IRFG 1OCZH 2DMQA 1IN7A 3MKWB 5J47A 4E7SA 2KPMA 4XKWA 3GLLA 3S2WA 3DF8A 3FZVA 2KHMA 3R0JA 3EETA 4XQFA 2KRCA 3LA7A 1X1BA 4RS8A 3L2CA 3OOPA 3MN2A 1JUSA 4IL6C 4E7JA 4ZYGA 1AHDP 3S15J 3OYGA 4RB1A 1WWXA 3A0BC 4F52A 3MQ0A 3F8BA 3RDIA 3RPUD 4Y15A 9ANTA 4GXOA 4A12A 4IEJA 1IG7A 1FMWA 3HPGA 1IJWC 3OYBA 3M9AA 5FGMA 4RM2A 2XF7A 4JP0A 4EM0B 4IQJA 4KIFA 1HBXG 3FM5A 2IJLA 3K6GA 3H0DA 2LD5A 1G4DA 2VJJA 1ZGWA 1TLHB 3LNQA 1YRNA 3PSIA 4NQWA 3E1SA 2A69F 2EINH 1IXRC 4M3EA 4RGXA 2H27A 4EJWA 5CVUA 4BJ5C 3ASNH 1MJ9A 2QF7A 3BTIA 3CF2A 3DTIA 1R1UA 5EG0A 3K4CA 3S3MA 4EJUA 4W1UA 1O57A 3G1LA 2CG4A 3HKZN 2L9VA 2RNJA 1JJ8C 1SAXA 2R7UA 1IW7F 1TWCJ 1T98A 2CRGA 2M34A 3QAHA 1XB4A 3T0YA 2XB0X 1OCTC 1KGSA 1WJFA 1XGMA 1P7JA 3R60A 4LMYA 1VQKI 1D0XA 3GW2A 1HKSA 3CLOA 1JKQC 3VYUB 4ZDLA 2QKLB 2Y69H 5KAFC 5EEAA 1WPKA 5CVJA 4XKBA 3MCZA 2X6OA 1NTCA 3DU5A 2XAFA 1ETOA 1RIOH 2CQ7A 3ZMDA 2QA4I 3M8JA 1E3OC 1Q1VA 1TBXA 1SFXA 4IHWA 2ICWG 3CUQB 4YIIA 4PUSA 1U3EM 1ACIA 1ETXA 2GXGA 2JA8J 3FHZA 3GZ6A 2Y30A 2DA3A 1G3WA 3LSJA 3VB2A 2XPVA 4AWXB 2UZKA 2NVTJ 2UXNA 2HXOA 4RGSA 4RAGA 2JSPA 2IS2A 4M6XA 3OYLA 1IUYA 3A2KA 5CYVA 2L54A 4Y13A 1W0TA 1LDKB 3S93A 2A61A 1WZ2A 4FTHA 3FMQA 2Q2EB 3G6EI 4A3LJ 4CCNA 1XCVA 3Q0WA 2DFFA 5EEGA 2KT0A 5IPAA 3BDDA 3BP8A 2NNNA 4LOCA 1I1SA 1ETKA 2RAEA 1MIJA 2R7FA 3GF2A 1AOYA 1Y56A 1UAAA 2P0WA 2F4MB 2ZO4A 4EQQA 3K1PA 3A0HC 2DFHA 3QWLA 5CQGA 4G7HF 1TQIA 2GM4A 1LJ9A 2YUSA 5HS9A 2V9KA 4FQGA 5M5WJ 3DKXA 2EA4A 1XSVA 4PGGA 5HODA 2H6BA 2PG4A 4V19K 3H3VK 2M45A 4G9YA 3ZP5A 3ABTA 2M4KA 3H5RA 4UHTA 4XN0A 5DD4A 1T56A 2DA4A 3J80K 3J7AY 4A3GJ 2UUZA 4XKVA 4M3DA 5GAEJ 3ECOA 4D5CA 2VXZA 3UR3C 2DXIA 2HS5A 4MQ9F 3V42A 4E7LA 1LFPA 3V4GA 3HTSB 1ZGAA 4Q4ZF 1AKHA 2FNAA 3ZQIA 3F8FA 2C6YA 5JR3A 3DLLF 2MW8A 2VT2A 5EZGA 4BU2A 4BS9A 4HBLA 2CH0A 4H0EA 3T5XA 2LY2A 4RB2C 3ZQGA 2KKOA 2R4GA 1X4PA 3CF5F 1WSUA 5EJCA 1SAUA 2NOJB 3S8PA 4ENJA 3OYKA 4AM3A 3QU6A 1QU3A 2PEXA 2BZTA 2E1OA 4OOIA 4EEFG 1I3AA 2H6CA 1V5EA 1ZTRA 2P81A 2BV6A 3OL4A 4JX6A 5CJ9A 2VBYA 5DS9A 5LFAA 3KZZA 3HRMA 4J00A 2A6EF 2PQ8A 1QHGA 4PZJA 3RYRA 2EFOA 4GGGA 4F55A 3E0JB 3A01A 2VJ4A 2H09A 3A03A 1HCRA 3RTRA 1JHHA 3S17J 2EPFA 4HEA2 1I1GA 4A3KJ 2W24A 5F0CA 4NHJA 1IZ1A 2OJED 5HDNA 3K4MA 4BACA 2GOMA 3PSFA 5H6RA 4NC8A 1V54H 2BY2A 3VPRA 2COBA 4XRSA 1OPCA 4B09A 4F91B 2VUMJ 2AO9A 3I54A 2XF6A 2YS9A 2JUGA 3FF5A 4MNUA 1OCCH 5E1ZB 1RUOA 3P9KA 1V55H 3CDHA 1Q1HA 5ICFA 3F22A 1YW7A 4FX0A 2VI6A 3HBLA 2ETHA 1YX5A 3ZN1A 2VC1A 4FISA 2XB5A 5HDGA 5BS6A 2NOGA 3LOCA 1OISA 3R6SA 4IRGA 4N4NB 4ZTJA 2HQNA 3DEUA 5DEQA 1C0WA 2B63J 2M30A 3TBIA 2R7DA 1T08B 1IRXA 4A0XA 4AIDA 4F92B 3NQOA 3H9JA 4L0ZB 2K02A 2X0LA 1HW5A 3CD6I 1FPQA 2UV1A 3V8KA 4HLXA 2PJPA 3BWGA 4R79A 1VNDA 1X1CA 3BQZA 1HDDC 1STZA 2CQKA 2V7FA 2ZC2A 3ZXSA 4E7KA 1ODDA 1XX5A 1MNEA 2O8XA 3KE2A 2MD0A 4I99C 3TP0A 3WG7H 1LB2A 2VLAA 5EF6A 3DU6A 2IP2A 2KJCA 2FBKA 3NRVA 3SDBA 4M71A 4R8HA 5LLQA 4M73A 4ZYEA 4BJTA 3GFLA 2OTJI 1YFHA 2HTSA 2YU9J 3HOTA 2FBIA 3KETA 3QU3A 3DXJF 4U87A 1HDPA 3NARA 3DBLB 1YTYA 3KP5A 4NBQA 3BZ6A 1LQ1A 3Q0UA 3T8TA 2WY8Q 4B44A 3WTXC 3SHFA 4P9FA 2X1DA 5TRDA 1VQPI 2GXAA 2NS8A 1FZPB 2CMPA 2V1UA 2A5WA 2MLGA 5IYCJ 2JMWA 5FKNA 3HIFA 4DZPA 2D2WA 4DYRA 2DTRA 5HLIA 2LY9A 1S72I 1NH3A 2CQXA 4KUMA 4IHXA 4CDGA 1SD4A 2W82A 3GXOA 1W36D 2K9LA 1XSXA 4KITB 1MW7A 3NWTA 4IXAA 4E70A 2WC2A 3FX3A 2DA5A 1GV5A 2DOAA 3GTOJ 5F1RA 5BOXA 2UWMA 1KQ9A 4OIOF 2H1LA 3NEUA 2L3DA 4A3IJ 3Q5FA 1UHSA 4M6VA 3J80Z 2QSFX 5GAGJ 3MKZA 2DA7A 4JBAA 4KJZA 2DYRH 5K1YA 5FKKA 3V8LA 1E0EA 1J7KA 2P5VA 4I09A 3G1OA 3BTLA 3TL4X 2R7QA 2W7NA 1A6QA 3GTGJ 4CCLA 3E6MA 2EZIA 2ZJQF 3U1DA 4FE4A 1B8IA 1A6IA 5DTDA 2FOWA 2M87A 4FETA 3CCQI 4UUVA 1XN7A 2ELKA 3FKJA 3AKZA 3L2WA 1R6RA 3RKWA 4CXFA 2DMUA 1FSHA 2FBHA 2W57A 5TJJA 2ID3A 2QSHX 3MVPA 1XPXA 2GA1A 1MDMB 4P5OA 4UVAA 2IBDA 4BE0A 1R22A 2HVSA 1K61A 1HXDA 5E8GA 4RAZA 5EGOB 2K9SA 1VQ6I 1W5TA 3OYDA 3FK6A 2Y0SA 2BVLA 2JRMA 4F7ZA 2WWYA 1RNLA 1UCRA 1R23A 3F8NA 4A93J 1HC8A 3HKZA 4OWRB 3H0GJ 3KYDB 3A1YA 1B6AA 3QYEA 2AQFA 5CVRA 1H8AC 3M8FA 2LKSA 1K7AA 1QGPA 4JOMA 2Z99A 1K6OA 3AFHA 3CJNA 4XORA 2X6YA 3FDYA 4RLQA 3HB9A 1W4MA 4N9HA 1B4AA 4V2GA 2Z3YA 4C2TA 2ECCA 3W2AA 1JUPA 3TQNA 2EBIA 4DBQA 2EZHA 4BY1J 3LSRA 4BH9A 1MKMA 4A5NA 3IKTA 4ESJA 2DODA 1G6NA 1IF1A 3HRSA 2A07F 2HZTA 3LQQA 3AG1H 1N78A 1LKXA 3E6BA 2IAIA 1FY7A 2QUFA 2M3AA 4DZJA 3I55I 1A5JA 4IRHA 2OAZA 3J81K 1T0FA 1YQAA 4I0BA 1P6RA 2LRDA 3L2VA 3GUDA 4B47A 3CESA 2M0MA 5E3NA 4BE2A 4II3A 2F5CA 3IKVA 3HSFA 3LSIA 2RV8A 2WAFA 2K3PA 1XGOA 1S7AA 1IV8A 5E20A 2NS7A 2IGNA 4L9TA 1REPC 4OMYA 4DGWB 2EFQA 4ENKA 4H4KC 4II2A 4S05A 4BDYA 2IGKA 4UY8I 4L5EA 1BI3A 5K7ZA 2LKPA 2HVRA 4C30A 2QSGX 2BVMA 3LFUA 2LMDA 5FLMJ 4A6DA 5DDGA 5K5RA 2EB7A 2GIVA 3I5UA 3TW7A 1TT5B 1J59A 4G7ZF 2BXZA 3SXYA 2K85A 4XR6A 5J3LA 2XC7A 2R7RA 3AL0B 3HJEA 2NVQJ 3LMMA 4QSHA 2H8RA 1U5TC 3JSOA 2Z2SB 4HX4A 3KZIC 1WRJA 3RCOA 1TTYA 1Z1DA 2PJRB 2QBYA 4L9NA 4LLLA 2WB1N 1BIAA 2OA4A 2IS6A 1ZLJA 1IUFA 3TO7A 4YEJA 2MABA 5AONA 2L01A 3WTUC 3CLQA 2V1XA 1H9TA 3WTZA 2K9NA 3H3ZA 2LREA 3FIWA 1GDTA 4C2UA 3JTHA 4MO7A 3WE3A 1AU7A 2DLLA 3JR9A 5KHDA 1XMAA 3D5LA 4XRFA 2ZMEB 3MMYB 2L4AA 1LFUP 4S0HB 2OC6A 1WHUA 4AD9A 5GPCA 4RA2A 5D8LB 3Q9VA 2JJ7A 2KRFA 1UJ8A 1NHAA 3BOQA 3S14J 5M5YJ 2A5YB 3LSHA 1EF4A 5DCFA 3OS2A 4M6YA 5LGTA 3D1NI 1O7FA 4WCGA 3FMRA 2EZLA 2P5KA 5DYMA 2CW7A 2FMLA 1M1EB 2XGXA 2VB6A 1LUJB 3ZR8X 3OYFA 3HOWJ 4EM2A 1J9IA 4BBSJ 1BN5A 3E7LA 1YITI 2DN0A 3OY9A 5D5VB 2AS5F 5HS7A 2CJJA 1Z0XA 3C18A 3LQRA 4N4OB 4UVBA 5L3DA 5LHHA 2EK5A 2Q0OA 4RB0A 1FOWA 3MKLA 5F6FA 1WI3A 1T33A 3IC7A 1B59A 3WGGA 2LNBA 3AAFA 2KIMA 4EJTA 4ABZA 3RSNA 4L5IA 1D8KA 5ICEA 4KICA 2GXBA 4KMFA 2G7HA 4U7BA 3V7SA 3LAJA 3BG3A 2QLZA 4F3QA 1JGGA 5L3EA 4AUXA 2X85A 1JT6A 3AG3H 5DUIA 3WE2A 3CQZJ 2MSYA 2DCEA 3E5QA 1U8BA 3P9IA 2R3SA 4CCOA 3AG4H 2KMUA 1ZARA 3FXLA 4LLGF 2FMYA 4Y17A 3H1CA 2QGUA 4A0YA 4HV5A 4AIKA 1KYZA 1X19A 3ABKH 4U7DA 3MFKA 4LD5A 1PJRA 3CJQB 1VI0A 1B9NA 3KP4A 1PUFB 1MH3A 1FWZA 3IWFA 1K4SA 1GT0C 5F04A 1RKWA 1ZQ3P 4XMYA 5HNFA 2GZWA 1X3WB 2MC4A 2DW4A 5IOZA 2IT0A 4D7MA 3CMYA 1D1CA 4M74A 2E2JJ 5A2QK 3GMEA 3J81Z 2EIJH 2JSCA 2Z1DA 4IQ4A 1XG1A 2RN7A 2QVOA 3CMMA 2EILH 2HQRA 1I39A 1LFBA 3FXKA 4S04A 5LGUA 4I7HA 2P4WA 3Q3SA 2HTJA 2XROA 3SJMA 3OSGA 1ZYRF 3T8RA 2CQNA 5J40A 4BQQA 2E1MC 2G7UA 1LVAA 1MZBA 2K4BA 1B72B 4Y33A 1MSFC 3K70D 4BY7J 2F4IA 2I5UA 3N05A 3FISA 3FM3A 2ISYA 3I4PA 1QHHD 3SDGA 2FQ3A 3KEOA 1IGNA 2R7SA 1SMYF 2XRLA 1IDYA 2J5PA 3VEPA 2L5QA 2V6CA 1Y6IA 2HQAA 2L7KA 3OIOA 4HQEA 3I4MJ 2KIFA 1H88C 2P8TA 1Y1VJ 1UG2A 1K6YA 3QODA 3IRRA 3OYJA 4ZDOA 2ELJA 3ML6A 2MBFA 5D4SA 5M5XJ 1O3RA 3WTWC 3EUHA 3CCRI 4A5MA 4PJMA 1JXSA 1Z05A 2WBMA 1BL0A 3O3KA 1IRGA 5KCMA 3BCAA 2D45A 2LLKA 2FX0A 3B6AA 3U9GA 1JJ6C 3GVAA 2R5YB 2RNGA 1GVDA 3KEYA
chains in the Genus database with same CATH topology
1ZN2A 3BPVA 4PGHA 5KVRA 3E97A 4YIFA 2COMA 2DO7A 1LDJA 1FP2A 1UHMA 1DUXC 3K1MA 1OR7A 2TDXA 4LK0F 1S8NA 4M9SA 4ENNA 2HYGD 4WXCA 3N4MA 2CW0F 2VN2A 1ONVA 1FBQA 4LJZF 1MGTA 4ZZDA 1U6GA 4P96A 4KN4X 3GEZA 2Y0MA 2XAQA 5IT3A 3HRUA 4ZYDA 4QLCU 1L0OC 5L3CA 2RC4A 1F1ZA 1YLFA 2K27A 3HHHA 1S7OA 3F21A 5EEHA 2WTEA 4FT8A 1BI1A 4I2OA 3P7NA 1W7PB 3KCCA 1B9MA 5AIPA 4BAYA 2O03A 2E1NA 3GFMA 2ZFWA 1ZHFA 2FSWA 1HSTA 1P2FA 1SD6A 2MH2A 1RUNA 2O61A 1FBSA 4KIBA 2Y75A 1O3SA 3BJ6A 3JAMZ 1KA8A 4FX4A 2W84A 3TO9A 2OU2A 4LB5A 2STWA 3QP6A 4YFNF 1LEBA 3I71A 2MA3A 3EYYA 4U88A 3E6DA 1J2XA 1ZRCA 3JSPA 3I59B 3RI4A 2JPBA 5A2QZ 3F8CA 3HHGA 4EVIA 1I5ZA 1QZYA 4I02A 3HRTA 1PP7U 3EYIA 1AWCA 2L02A 1MJAA 5LGNA 2ZXJA 5D6FA 4KIGA 3WTTC 1O7LA 3ZMVA 3MZYA 2V9VA 2Z9OA 6PAXA 1R58A 1T6SA 4PCQA 4IHSA 1RI7A 2DK5A 2XVCA 2CFXA 3ECHA 3V8JA 5BMZA 3CUQA 2JTVA 3RKXA 1USTA 3B73A 4RGRA 3SZPA 2CYYA 2M5WA 4Q5SF 4DQ2A 3RIRA 3WU0A 1EV7A 1FNNA 5L3BA 2G9WA 4BHBA 1FLIA 1FSEA 4A6EA 2XAHA 2M8EA 2Q2EA 2QENA 2HFHA 1F5TA 3KLOA 3FXQA 4MTDA 2LSOA 2DI3A 3GWZA 3N97A 2FU4A 2PN6A 4LLNA 1ZG1A 1K78B 3PFIA 1B1BA 4G7OF 2EV0A 4ON0A 4HV6A 1X3UA 5LRSA 5E18F 2FEZA 1ZG3A 4YG2F 3Q9SA 1ON2A 3CO6C 2EFWA 3E5UA 2P6SA 4RGUA 1YG2A 4OINF 3GFJA 4IHTA 3K69A 4P55A 1UHWA 2O0YA 1BIBA 1JGSA 3WG9A 1KU2A 2A6HF 1FOKA 4YFKF 3SZTA 1TQPA 3TGNA 3F72A 1CGPA 3ROUA 1P4WA 1XDSA 3IWZA 5ERIA 5HVQC 4LGWA 4Q48A 2QM3A 3KP7A 3VFZA 3F3XA 1IRFA 2IVMA 4O3MA 4LK1F 3E5XA 3MAJA 1R7JA 4LFUA 4OIPF 5IT9K 2IA0A 4UNOA 1QQIA 4BXUA 3M7GA 3CO7C 3ULQB 3WTYC 2LF8A 1XCBA 3W6JB 3L09A 5DUKA 2D1HA 5FD5A 4UV9A 1BI0A 4I01A 1R5GA 3QRFF 1Z6RA 4M9ZA 2K4JA 2NS0A 3IRQA 4WWCA 3GO5A 3WTSC 4WK8F 1L3LA 2B0LA 2JPCA 2VONA 3M8EA 3COAC 3K9TA 3H92A 5CVVA 2KJBA 3FMSA 2PFBA 3MWMA 1J5YA 1OYIA 3ZMTA 3FXRA 3GFIA 1V3FA 1YW8A 4HX8A 1DPRA 1G3SA 4GCVA 4LG0B 4HF2A 2EA2A 2V79A 2NNYA 1K79A 2VOPA 3KP6A 2EV5A 4HAMA 5ICCA 1T38A 1WKMA 2XKPA 3K0LA 2CO5A 2E1CA 1P4XA 2QQ9A 3K1NA 5JVTA 2ZCWA 4HQMA 1HW2A 3CUOA 2VBZA 1GVJA 1ZLKA 1J75A 2HGCA 5BPIA 4CICA 4HW0A 1MD0A 1TQMA 1W7PD 5H20A 2K86A 4A2UA 4O6JA 4EJVA 2FNPA 2J5OA 5JI6A 3ZMSA 1LEAA 1I6XA 5FD6A 1XGSA 2OQGA 1D8JA 5CLSA 2MH9A 3VODA 1A04A 1OYYA 4FHTA 4HDUA 4R1HA 5BQTA 1TNTA 3DV8A 1T39A 1D5VA 2HDCA 1Z6TA 5E1WA 4OIQF 3BY6A 3BJOA 4P9UA 1U5TB 3FXUA 3G3ZA 2VBXA 2O6GE 1P4AA 2ESHA 5CVIA 5J8CA 3KFWX 2YX4A 1S3JA 4HLYA 1SFEA 1E2XA 4HF0A 3DP7A 3QOPA 3WGHA 1YO5C 1HKQA 1MDMA 4GYGA 3ERED 3I64A 1ZAOA 3U2RA 2QYOA 3ZMZA 4CGZA 1E17A 2VODA 1BBYA 1XMKA 2OZ6A 2HR3A 3TOBA 3ZMUA 2P7VB 4AVPA 3R4KA 1R1TA 1R1VA 5LBQA 1KQ8A 3HYIA 1KU7A 1O3TA 2VC0A 3HOSA 3K2ZA 1TNSA 1BM9A 3BROA 2E7WA 4UVCA 4MTEA 2K7LA 1XSDA 4IRIA 1FX7A 1OMIA 2YX7A 2VE8A 1RZ4A 2KIUA 3DKWA 1FYMA 4KNYA 3DPTA 1QZZA 1PUEE 2MD5A 3O6BB 3BJAA 3GYHX 3HSEA 2OQRA 2ZNZA 1Z91A 4JK1X 2RGVA 2IA2A 4RB3C 1QPMA 2CGPA 1USSA 1FC3A 1Z9CA 2X4HA 3EDPA 5H6QA 2HEOA 5K5OA 1U2WA 2WV0A 4M72A 4KMUX 2F2EA 1Y0UA 4IF4A 4N0BA 1FYKA 1CF7B 1KU3A 2XV4S 1FP1D 2MLKA 5HLHA 4EMSA 2F5DA 4GO1A 3BPXA 2ZNYA 2BBYA 2ADUA 2ZMEA 4BNCA 2VBWA 3OV8A 3L00A 4HDVA 2YU3A 1ULYA 2XRNA 1V4RA 3I0TA 5FFXA 4XSZF 4AIHA 5ILUA 4ZZLA 1DP7P 1QNTA 2Q8KA 4U0WA 2YSRA 1SFUA 3I53A 2W85A 1ZG5A 5HS8A 3B02A 4BQAA 4HYEA 3E3VA 3I58A 4MQVA 5F64A 3IHUA 1UFMA 2BYVE 1IXCA 3F6VA 5DV5A 5L3FA 4HA8A 1BJAA 2MC3A 1W5SA 3HSRA 1J0RA 3LAPA 4B8XA 2DQLA 2XKOA 1KU9A 2O3FA 3LWFA 4UXNA 4L5JA 1ON1A 4IPAA 5AIQA 2ZJ2A 3CUQC 2PI0A 3V7CA 2RVCA 5ICGA 3J7AO 1ZRDA 1BC7C 2PBIA 2LDUA 1VTNC 1CF7A 3PQKA 2PMHA 1YIOA 2EFNA 3REOA 4WXHA 4MEXF 4NB5A 4HOBA 1QO0D 2XAJA 2YR2A 1IXSB 4AIJA 2D1VA 2DT5A 2XASA 3JW4A 4ZYHA 4KA4A 5LEKA 2ESNA 1S29A 4MGRA 1PDNC 4K2EA 4CHUA 1WQ2A 1GXQA 2IA1A 4I0AA 5LRRA 3O2PE 1JHFA 1U78A 3TOAA 5D5WB 3SQNA 3ABUA 5LHIA 3GX4X 1GHCA 3WODF 1DDNA 1TW3A 2DK8A 4WX9A 3IL2A 2CWEA 2QWWA 1EH6A 3HUGA 3L9FA 3WTVC 1S6LA 1BC8C 2FOKA 2V1DA 1YS7A 1H0MA 3LFKA 2IPQX 3MEXA 2ZBKA 3P9CA 4LB6B 2DFIA 2XAGA 2UXXA 5D8KB 3G73A 4XLNF 5FB2A 3TDZC 1FBUA 3JTGA 1R00A 4GYIA 2NYXA 2DPUA 3VOEA 2P7CB 2ACJA 4L18B 1W7PA 4N9IA 3TDUC 1O3QA 2XHKA 1BOAA 2Y48A 4HX7A 2CSOA 2VT3A 4KN7X 3TO6A 1EH7A 4BYYA 5FFZA 1EH8A 3C3WA 1TW2A 3KP3A 2Z33A 3DPLC 4D0PA 4YFXF 2QQBA 4JQFA 4ASNA 2A68F 3QP5A 5KK1A 3R61A 1MJBA 1FT9A 1XDUA 3TKYA 1ZREA 3ZPLA 3HTUA 2ELHA 2BGCA 2FRHA 3I59A 3DFGA 2P6TA 4I98B 4CZZA 2QQAA 5DD8A 1G3TA 2RKHA 2XUBA 1FYLA 3ZQ7A 4HZFA 4KDPA 5JHUA 1H9GA 3LA2A 4BHPA 4MEYF 1BI2A 2OBPA 5BPDA 2DBBA 3GLXA 4DNCA 3PQJA 4MHGA 4A0ZA 4KFCA 3MZHA 3V7RA 3EQLF 1HQCA 3C1DA 3QPTA 4XSXF 1SMTA 2BEOA 1IAWA 4G8XA 1HW1A 3KZYA 3KP2A 5D6EA 5J8FA 1GXPA 4EM1A 3F8MA 1XD7A 3ELKA 2BE5F 1ZRFA 3ZN0A 1LDDA 3SFZA 2QBYB 5E8IA 2HWVA 1OYWA 1KYWA 1XGNA 3CTAA 1K78A 2OD5A 1D3YA 2VOOA 2E7XA 1T2KA 5LEJA 2HOEA 3W6KB 5FLXK 2DPDA 3E6CC 5ED4A 2HKOA 2H94A 2FA5A 4G6DA 4OIRF 2RQPA 2GWRA 1ZH5A 2RDPA 5L3GA 3ISPA 1P92A 4Z2YA 5E17F 1IN8A 2YPRA 2A3SA 2DAOA 2HKXA 3WGIA 1I27A 5DCMB 2FE3A 2EV6A 4WF2A 4UV8A 3FWEA 4CYDA 1IN4A 1KQ0A 4EGYA 1UB9A 5JFRA 2HYFA 5HLGA 4EGZA 3RPUA 4XBFA 4EV0A 2IW5A 2EWNA 2QZ8A 2Z5UA 5ILSA 4OU0A 2JT1A 3L7WA 2ISZA 2STTA 3RJPA 1F4KA 3LSTA 4ESFA 1G3YA 5HOOA 4BHCA 4OMZA 3F23A 4IVNA 1ZGJA 5K5QA 3KLNA 1IN6A 1QBJA 4CO8A 2P5LC 3LA3A 3R0AA 2PLYA 2ZKZA 4Q47A 2M1BA 4ESBA 2OZUA 2PMUA 5IT9Z 3T1BA 2DQRA 2F5FA 4ZH4F 4O5VA 1U8RA 5LHGA 3D0SA 1IN5A 1YW9A 1LNWA 3RYPA 1YS6A 3C7JA 2NRAC 2GQQA 2L4MA 4LG0A 4G6QA 2LF7A 3WU1B 1JE8A 5D5UB 4HF1A 3F6OA 2AXLA 5J6XA 1YYVA 4PDKA 4G94A 5DCMA 5FO5A 2GAUA 2EFPA 3H3UA 4U0VA 2FXAA 1Z7UA 2F5EA 5D5XB 4KT5C 3KEQA 4ENMA 4L9VA 4RAYA 5ILVA 2EJRA 5E1XA 4M9XA 1WI9A 4QWQA 5D4RA 3GZ5A 2GA2A 4KYWA 4IJAA 4U0YA 1HKTA 3RKYA 3RPQA 5FLXZ 4WXDA 1DPUA 4ETSA 1SD5A 2W25A 1PP8F 3DQVC 4L9JA 2JRTA 5HDKA 1F9NA 1R5HA 2JZYA 4TV7A 2VE9A 3QPHA 1U5TA 2FF4A 4L0YB 4XLPF 1SD7A 3JAMK 2DU9A 2XIGA 1HSJA 1OKRA 1R36A 3M1EA 4EJOA 2NAZA 2IRFG 1IN7A 3S2WA 3DF8A 3FZVA 3R0JA 3EETA 3LA7A 4RS8A 3L2CA 3OOPA 4ZYGA 4RB1A 1WWXA 3MQ0A 3F8BA 3RDIA 4Y15A 4GXOA 4A12A 3M9AA 5FGMA 4EM0B 4KIFA 1HBXG 3FM5A 2IJLA 1G4DA 1TLHB 4NQWA 2A69F 1IXRC 4RGXA 2H27A 4EJWA 5CVUA 1MJ9A 1R1UA 4EJUA 1O57A 2CG4A 2RNJA 1SAXA 1IW7F 1T98A 3QAHA 1XB4A 3T0YA 1KGSA 1XGMA 3R60A 4LMYA 3GW2A 1HKSA 3CLOA 5CVJA 3MCZA 2XAFA 1RIOH 3ZMDA 1TBXA 1SFXA 3CUQB 4YIIA 1U3EM 2GXGA 3FHZA 3GZ6A 1G3WA 3VB2A 4AWXB 2UZKA 2UXNA 4RGSA 4M6XA 1IUYA 5CYVA 2L54A 4Y13A 1LDKB 2A61A 3FMQA 1XCVA 5EEGA 3BDDA 3BP8A 2NNNA 1I1SA 2R7FA 3GF2A 1AOYA 4EQQA 2ZO4A 3K1PA 4G7HF 1TQIA 1LJ9A 5HS9A 2EA4A 1XSVA 4PGGA 2H6BA 2PG4A 2M45A 4G9YA 3ZP5A 3ABTA 4UHTA 5DD4A 3J80K 3ECOA 2VXZA 2HS5A 4MQ9F 3HTSB 3V4GA 1ZGAA 4Q4ZF 2FNAA 3F8FA 2C6YA 5JR3A 2VT2A 4HBLA 4H0EA 3T5XA 4RB2C 2KKOA 1WSUA 4ENJA 3QU6A 2PEXA 4OOIA 2H6CA 2BV6A 5CJ9A 2VBYA 3KZZA 3HRMA 2A6EF 2PQ8A 3RYRA 4PZJA 2EFOA 4GGGA 2H09A 3RTRA 1JHHA 1I1GA 2W24A 4NHJA 1IZ1A 5HDNA 5H6RA 1OPCA 4B09A 3I54A 3FF5A 4MNUA 5E1ZB 1RUOA 3P9KA 3CDHA 1Q1HA 5ICFA 3F22A 1YW7A 4FX0A 2ETHA 3ZN1A 2VC1A 5HDGA 5BS6A 3R6SA 4IRGA 2HQNA 3DEUA 5DEQA 1C0WA 2M30A 2R7DA 4A0XA 3NQOA 4L0ZB 2K02A 2X0LA 1HW5A 1FPQA 2PJPA 3V8KA 4HLXA 3BWGA 4R79A 1STZA 2CQKA 1ODDA 2O8XA 3KE2A 1LB2A 2IP2A 2KJCA 2FBKA 3NRVA 4M71A 4R8HA 5LLQA 4M73A 4ZYEA 3GFLA 1YFHA 2HTSA 3HOTA 2FBIA 3KETA 3QU3A 3DXJF 1YTYA 3KP5A 3BZ6A 1LQ1A 3T8TA 3WTXC 3SHFA 4P9FA 5TRDA 1FZPB 2V1UA 2MLGA 3HIFA 2D2WA 2DTRA 5HLIA 4KUMA 4CDGA 1SD4A 3GXOA 1XSXA 4IXAA 4E70A 2WC2A 3FX3A 5F1RA 5BOXA 2UWMA 1KQ9A 4OIOF 3NEUA 2L3DA 3Q5FA 3J80Z 4JBAA 5K1YA 3V8LA 1J7KA 2P5VA 4I09A 3E6MA 3U1DA 2M87A 4UUVA 1XN7A 3RKWA 4CXFA 1FSHA 2FBHA 2W57A 5TJJA 2GA1A 1MDMB 4P5OA 4UVAA 1R22A 1HXDA 5E8GA 4RAZA 1W5TA 4F7ZA 2WWYA 1RNLA 1UCRA 1R23A 3F8NA 1B6AA 5CVRA 3M8FA 1K7AA 1QGPA 2Z99A 1K6OA 3CJNA 4N9HA 1W4MA 1B4AA 2Z3YA 3TQNA 4BH9A 1MKMA 4A5NA 3IKTA 4ESJA 1G6NA 1IF1A 3HRSA 2A07F 2HZTA 3LQQA 3E6BA 2QUFA 1FY7A 4IRHA 2OAZA 3J81K 1T0FA 1YQAA 4I0BA 1P6RA 3GUDA 2F5CA 3IKVA 3HSFA 2RV8A 1XGOA 1S7AA 5E20A 4L9TA 1REPC 4OMYA 2EFQA 4ENKA 4S05A 1BI3A 2LKPA 4A6DA 5DDGA 5K5RA 2EB7A 2GIVA 3I5UA 1J59A 4G7ZF 3SXYA 1U5TC 3JSOA 4HX4A 1WRJA 1TTYA 1Z1DA 2QBYA 4L9NA 4LLLA 1BIAA 2OA4A 1ZLJA 3TO7A 5AONA 2L01A 3WTUC 2V1XA 1H9TA 3WTZA 3H3ZA 3JTHA 3WE3A 2DLLA 1XMAA 3D5LA 4XRFA 2ZMEB 2L4AA 4AD9A 5D8LB 3Q9VA 2KRFA 1NHAA 3BOQA 2A5YB 5DCFA 4M6YA 5LGTA 1O7FA 4WCGA 3FMRA 2P5KA 5DYMA 2XGXA 2FMLA 4EM2A 1J9IA 1BN5A 5D5VB 2AS5F 5HS7A 3C18A 3LQRA 4UVBA 5L3DA 5LHHA 2EK5A 2Q0OA 4RB0A 5F6FA 3IC7A 1B59A 3WGGA 2LNBA 3AAFA 2KIMA 4EJTA 5ICEA 4L5IA 1D8KA 4KICA 2GXBA 4KMFA 2G7HA 4U7BA 3V7SA 3LAJA 2QLZA 5L3EA 5DUIA 3WE2A 3E5QA 3P9IA 2R3SA 1ZARA 4LLGF 2FMYA 4Y17A 4A0YA 4HV5A 4AIKA 1KYZA 4U7DA 3MFKA 4LD5A 1B9NA 3KP4A 1FWZA 3IWFA 2GZWA 2DW4A 2IT0A 4M74A 5A2QK 3J81Z 2JSCA 2RN7A 2QVOA 4S04A 2HQRA 5LGUA 4I7HA 2P4WA 2HTJA 2XROA 1ZYRF 3T8RA 2G7UA 2K4BA 1LVAA 1MZBA 3FM3A 2ISYA 3I4PA 2FQ3A 3KEOA 1SMYF 2J5PA 3VEPA 2V6CA 4HQEA 2KIFA 2P8TA 3IRRA 3ML6A 2MBFA 5D4SA 1O3RA 3WTWC 3EUHA 1JXSA 4A5MA 1Z05A 3O3KA 1IRGA 2D45A 3U9GA 3GVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZN2 A;  3BPV A;  4PGH A;  5KVR A;  3E97 A;  4YIF A;  2COM A;  2DO7 A;  1LDJ A;  1FP2 A;  1UHM A;  1DUX C;  3K1M A;  1OR7 A;  2TDX A;  4LK0 F;  1S8N A;  4M9S A;  4ENN A;  2HYG D;  4WXC A;  3N4M A;  2CW0 F;  2VN2 A;  1ONV A;  1FBQ A;  4LJZ F;  1MGT A;  4ZZD A;  1U6G A;  4P96 A;  4KN4 X;  3GEZ A;  2Y0M A;  2XAQ A;  5IT3 A;  3HRU A;  4ZYD A;  4QLC U;  1L0O C;  5L3C A;  2RC4 A;  1F1Z A;  1YLF A;  2K27 A;  3HHH A;  1S7O A;  3F21 A;  5EEH A;  2WTE A;  4FT8 A;  1BI1 A;  4I2O A;  3P7N A;  1W7P B;  3KCC A;  1B9M A;  5AIP A;  4BAY A;  2O03 A;  2E1N A;  3GFM A;  2ZFW A;  1ZHF A;  2FSW A;  1HST A;  1P2F A;  1SD6 A;  2MH2 A;  1RUN A;  2O61 A;  1FBS A;  4KIB A;  2Y75 A;  1O3S A;  3BJ6 A;  3JAM Z;  1KA8 A;  4FX4 A;  2W84 A;  3TO9 A;  2OU2 A;  4LB5 A;  2STW A;  3QP6 A;  4YFN F;  1LEB A;  3I71 A;  2MA3 A;  3EYY A;  4U88 A;  3E6D A;  1J2X A;  1ZRC A;  3JSP A;  3I59 B;  3RI4 A;  2JPB A;  5A2Q Z;  3F8C A;  3HHG A;  4EVI A;  1I5Z A;  1QZY A;  4I02 A;  3HRT A;  1PP7 U;  3EYI A;  1AWC A;  2L02 A;  1MJA A;  5LGN A;  2ZXJ A;  5D6F A;  4KIG A;  3WTT C;  1O7L A;  3ZMV A;  3MZY A;  2V9V A;  2Z9O A;  6PAX A;  1R58 A;  1T6S A;  4PCQ A;  4IHS A;  1RI7 A;  2DK5 A;  2XVC A;  2CFX A;  3ECH A;  3V8J A;  5BMZ A;  3CUQ A;  2JTV A;  3RKX A;  1UST A;  3B73 A;  4RGR A;  3SZP A;  2CYY A;  2M5W A;  4Q5S F;  4DQ2 A;  3RIR A;  3WU0 A;  1EV7 A;  1FNN A;  5L3B A;  2G9W A;  4BHB A;  1FLI A;  1FSE A;  4A6E A;  2XAH A;  2M8E A;  2Q2E A;  2QEN A;  2HFH A;  1F5T A;  3KLO A;  3FXQ A;  4MTD A;  2LSO A;  2DI3 A;  3GWZ A;  3N97 A;  2FU4 A;  2PN6 A;  4LLN A;  1ZG1 A;  1K78 B;  3PFI A;  1B1B A;  4G7O F;  2EV0 A;  4ON0 A;  4HV6 A;  1X3U A;  5LRS A;  5E18 F;  2FEZ A;  1ZG3 A;  4YG2 F;  3Q9S A;  1ON2 A;  3CO6 C;  2EFW A;  3E5U A;  2P6S A;  4RGU A;  1YG2 A;  4OIN F;  3GFJ A;  4IHT A;  3K69 A;  4P55 A;  1UHW A;  2O0Y A;  1BIB A;  1JGS A;  3WG9 A;  1KU2 A;  2A6H F;  1FOK A;  4YFK F;  3SZT A;  1TQP A;  3TGN A;  3F72 A;  1CGP A;  3ROU A;  1P4W A;  1XDS A;  3IWZ A;  5ERI A;  5HVQ C;  4LGW A;  4Q48 A;  2QM3 A;  3KP7 A;  3VFZ A;  3F3X A;  1IRF A;  2IVM A;  4O3M A;  4LK1 F;  3E5X A;  3MAJ A;  1R7J A;  4LFU A;  4OIP F;  5IT9 K;  2IA0 A;  4UNO A;  1QQI A;  4BXU A;  3M7G A;  3CO7 C;  3ULQ B;  3WTY C;  2LF8 A;  1XCB A;  3W6J B;  3L09 A;  5DUK A;  2D1H A;  5FD5 A;  4UV9 A;  1BI0 A;  4I01 A;  1R5G A;  3QRF F;  1Z6R A;  4M9Z A;  2K4J A;  2NS0 A;  3IRQ A;  4WWC A;  3GO5 A;  3WTS C;  4WK8 F;  1L3L A;  2B0L A;  2JPC A;  2VON A;  3M8E A;  3COA C;  3K9T A;  3H92 A;  5CVV A;  2KJB A;  3FMS A;  2PFB A;  3MWM A;  1J5Y A;  1OYI A;  3ZMT A;  3FXR A;  3GFI A;  1V3F A;  1YW8 A;  4HX8 A;  1DPR A;  1G3S A;  4GCV A;  4LG0 B;  4HF2 A;  2EA2 A;  2V79 A;  2NNY A;  1K79 A;  2VOP A;  3KP6 A;  2EV5 A;  4HAM A;  5ICC A;  1T38 A;  1WKM A;  2XKP A;  3K0L A;  2CO5 A;  2E1C A;  1P4X A;  2QQ9 A;  3K1N A;  5JVT A;  2ZCW A;  4HQM A;  1HW2 A;  3CUO A;  2VBZ A;  1GVJ A;  1ZLK A;  1J75 A;  2HGC A;  5BPI A;  4CIC A;  4HW0 A;  1MD0 A;  1TQM A;  1W7P D;  5H20 A;  2K86 A;  4A2U A;  4O6J A;  4EJV A;  2FNP A;  2J5O A;  5JI6 A;  3ZMS A;  1LEA A;  1I6X A;  5FD6 A;  1XGS A;  2OQG A;  1D8J A;  5CLS A;  2MH9 A;  3VOD A;  1A04 A;  1OYY A;  4FHT A;  4HDU A;  4R1H A;  5BQT A;  1TNT A;  3DV8 A;  1T39 A;  1D5V A;  2HDC A;  1Z6T A;  5E1W A;  4OIQ F;  3BY6 A;  3BJO A;  4P9U A;  1U5T B;  3FXU A;  3G3Z A;  2VBX A;  2O6G E;  1P4A A;  2ESH A;  5CVI A;  5J8C A;  3KFW X;  2YX4 A;  1S3J A;  4HLY A;  1SFE A;  1E2X A;  4HF0 A;  3DP7 A;  3QOP A;  3WGH A;  1YO5 C;  1HKQ A;  1MDM A;  4GYG A;  3ERE D;  3I64 A;  1ZAO A;  3U2R A;  2QYO A;  3ZMZ A;  4CGZ A;  1E17 A;  2VOD A;  1BBY A;  1XMK A;  2OZ6 A;  2HR3 A;  3TOB A;  3ZMU A;  2P7V B;  4AVP A;  3R4K A;  1R1T A;  1R1V A;  5LBQ A;  1KQ8 A;  3HYI A;  1KU7 A;  1O3T A;  2VC0 A;  3HOS A;  3K2Z A;  1TNS A;  1BM9 A;  3BRO A;  2E7W A;  4UVC A;  4MTE A;  2K7L A;  1XSD A;  4IRI A;  1FX7 A;  1OMI A;  2YX7 A;  2VE8 A;  1RZ4 A;  2KIU A;  3DKW A;  1FYM A;  4KNY A;  3DPT A;  1QZZ A;  1PUE E;  2MD5 A;  3O6B B;  3BJA A;  3GYH X;  3HSE A;  2OQR A;  2ZNZ A;  1Z91 A;  4JK1 X;  2RGV A;  2IA2 A;  4RB3 C;  1QPM A;  2CGP A;  1USS A;  1FC3 A;  1Z9C A;  2X4H A;  3EDP A;  5H6Q A;  2HEO A;  5K5O A;  1U2W A;  2WV0 A;  4M72 A;  4KMU X;  2F2E A;  1Y0U A;  4IF4 A;  4N0B A;  1FYK A;  1CF7 B;  1KU3 A;  2XV4 S;  1FP1 D;  2MLK A;  5HLH A;  4EMS A;  2F5D A;  4GO1 A;  3BPX A;  2ZNY A;  2BBY A;  2ADU A;  2ZME A;  4BNC A;  2VBW A;  3OV8 A;  3L00 A;  4HDV A;  2YU3 A;  1ULY A;  2XRN A;  1V4R A;  3I0T A;  5FFX A;  4XSZ F;  4AIH A;  5ILU A;  4ZZL A;  1DP7 P;  1QNT A;  2Q8K A;  4U0W A;  2YSR A;  1SFU A;  3I53 A;  2W85 A;  1ZG5 A;  5HS8 A;  3B02 A;  4BQA A;  4HYE A;  3E3V A;  3I58 A;  4MQV A;  5F64 A;  3IHU A;  1UFM A;  2BYV E;  1IXC A;  3F6V A;  5DV5 A;  5L3F A;  4HA8 A;  1BJA A;  2MC3 A;  1W5S A;  3HSR A;  1J0R A;  3LAP A;  4B8X A;  2DQL A;  2XKO A;  1KU9 A;  2O3F A;  3LWF A;  4UXN A;  4L5J A;  1ON1 A;  4IPA A;  5AIQ A;  2ZJ2 A;  3CUQ C;  2PI0 A;  3V7C A;  2RVC A;  5ICG A;  3J7A O;  1ZRD A;  1BC7 C;  2PBI A;  2LDU A;  1VTN C;  1CF7 A;  3PQK A;  2PMH A;  1YIO A;  2EFN A;  3REO A;  4WXH A;  4MEX F;  4NB5 A;  4HOB A;  1QO0 D;  2XAJ A;  2YR2 A;  1IXS B;  4AIJ A;  2D1V A;  2DT5 A;  2XAS A;  3JW4 A;  4ZYH A;  4KA4 A;  5LEK A;  2ESN A;  1S29 A;  4MGR A;  1PDN C;  4K2E A;  4CHU A;  1WQ2 A;  1GXQ A;  2IA1 A;  4I0A A;  5LRR A;  3O2P E;  1JHF A;  1U78 A;  3TOA A;  5D5W B;  3SQN A;  3ABU A;  5LHI A;  3GX4 X;  1GHC A;  3WOD F;  1DDN A;  1TW3 A;  2DK8 A;  4WX9 A;  3IL2 A;  2CWE A;  2QWW A;  1EH6 A;  3HUG A;  3L9F A;  3WTV C;  1S6L A;  1BC8 C;  2FOK A;  2V1D A;  1YS7 A;  1H0M A;  3LFK A;  2IPQ X;  3MEX A;  2ZBK A;  3P9C A;  4LB6 B;  2DFI A;  2XAG A;  2UXX A;  5D8K B;  3G73 A;  4XLN F;  5FB2 A;  3TDZ C;  1FBU A;  3JTG A;  1R00 A;  4GYI A;  2NYX A;  2DPU A;  3VOE A;  2P7C B;  2ACJ A;  4L18 B;  1W7P A;  4N9I A;  3TDU C;  1O3Q A;  2XHK A;  1BOA A;  2Y48 A;  4HX7 A;  2CSO A;  2VT3 A;  4KN7 X;  3TO6 A;  1EH7 A;  4BYY A;  5FFZ A;  1EH8 A;  3C3W A;  1TW2 A;  3KP3 A;  2Z33 A;  3DPL C;  4D0P A;  4YFX F;  2QQB A;  4JQF A;  4ASN A;  2A68 F;  3QP5 A;  5KK1 A;  3R61 A;  1MJB A;  1FT9 A;  1XDU A;  3TKY A;  1ZRE A;  3ZPL A;  3HTU A;  2ELH A;  2BGC A;  2FRH A;  3I59 A;  3DFG A;  2P6T A;  4I98 B;  4CZZ A;  2QQA A;  5DD8 A;  1G3T A;  2RKH A;  2XUB A;  1FYL A;  3ZQ7 A;  4HZF A;  4KDP A;  5JHU A;  1H9G A;  3LA2 A;  4BHP A;  4MEY F;  1BI2 A;  2OBP A;  5BPD A;  2DBB A;  3GLX A;  4DNC A;  3PQJ A;  4MHG A;  4A0Z A;  4KFC A;  3MZH A;  3V7R A;  3EQL F;  1HQC A;  3C1D A;  3QPT A;  4XSX F;  1SMT A;  2BEO A;  1IAW A;  4G8X A;  1HW1 A;  3KZY A;  3KP2 A;  5D6E A;  5J8F A;  1GXP A;  4EM1 A;  3F8M A;  1XD7 A;  3ELK A;  2BE5 F;  1ZRF A;  3ZN0 A;  1LDD A;  3SFZ A;  2QBY B;  5E8I A;  2HWV A;  1OYW A;  1KYW A;  1XGN A;  3CTA A;  1K78 A;  2OD5 A;  1D3Y A;  2VOO A;  2E7X A;  1T2K A;  5LEJ A;  2HOE A;  3W6K B;  5FLX K;  2DPD A;  3E6C C;  5ED4 A;  2HKO A;  2H94 A;  2FA5 A;  4G6D A;  4OIR F;  2RQP A;  2GWR A;  1ZH5 A;  2RDP A;  5L3G A;  3ISP A;  1P92 A;  4Z2Y A;  5E17 F;  1IN8 A;  2YPR A;  2A3S A;  2DAO A;  2HKX A;  3WGI A;  1I27 A;  5DCM B;  2FE3 A;  2EV6 A;  4WF2 A;  4UV8 A;  3FWE A;  4CYD A;  1IN4 A;  1KQ0 A;  4EGY A;  1UB9 A;  5JFR A;  2HYF A;  5HLG A;  4EGZ A;  3RPU A;  4XBF A;  4EV0 A;  2IW5 A;  2EWN A;  2QZ8 A;  2Z5U A;  5ILS A;  4OU0 A;  2JT1 A;  3L7W A;  2ISZ A;  2STT A;  3RJP A;  1F4K A;  3LST A;  4ESF A;  1G3Y A;  5HOO A;  4BHC A;  4OMZ A;  3F23 A;  4IVN A;  1ZGJ A;  5K5Q A;  3KLN A;  1IN6 A;  1QBJ A;  4CO8 A;  2P5L C;  3LA3 A;  3R0A A;  2PLY A;  2ZKZ A;  4Q47 A;  2M1B A;  4ESB A;  2OZU A;  2PMU A;  5IT9 Z;  3T1B A;  2DQR A;  2F5F A;  4ZH4 F;  4O5V A;  1U8R A;  5LHG A;  3D0S A;  1IN5 A;  1YW9 A;  1LNW A;  3RYP A;  1YS6 A;  3C7J A;  2NRA C;  2GQQ A;  2L4M A;  4LG0 A;  4G6Q A;  2LF7 A;  3WU1 B;  1JE8 A;  5D5U B;  4HF1 A;  3F6O A;  2AXL A;  5J6X A;  1YYV A;  4PDK A;  4G94 A;  5DCM A;  5FO5 A;  2GAU A;  2EFP A;  3H3U A;  4U0V A;  2FXA A;  1Z7U A;  2F5E A;  5D5X B;  4KT5 C;  3KEQ A;  4ENM A;  4L9V A;  4RAY A;  5ILV A;  2EJR A;  5E1X A;  4M9X A;  1WI9 A;  4QWQ A;  5D4R A;  3GZ5 A;  2GA2 A;  4KYW A;  4IJA A;  4U0Y A;  1HKT A;  3RKY A;  3RPQ A;  5FLX Z;  4WXD A;  1DPU A;  4ETS A;  1SD5 A;  2W25 A;  1PP8 F;  3DQV C;  4L9J A;  2JRT A;  5HDK A;  1F9N A;  1R5H A;  2JZY A;  4TV7 A;  2VE9 A;  3QPH A;  1U5T A;  2FF4 A;  4L0Y B;  4XLP F;  1SD7 A;  3JAM K;  2DU9 A;  2XIG A;  1HSJ A;  1OKR A;  1R36 A;  3M1E A;  4EJO A;  2NAZ A;  2IRF G;  1IN7 A;  3S2W A;  3DF8 A;  3FZV A;  3R0J A;  3EET A;  3LA7 A;  4RS8 A;  3L2C A;  3OOP A;  4ZYG A;  4RB1 A;  1WWX A;  3MQ0 A;  3F8B A;  3RDI A;  4Y15 A;  4GXO A;  4A12 A;  3M9A A;  5FGM A;  4EM0 B;  4KIF A;  1HBX G;  3FM5 A;  2IJL A;  1G4D A;  1TLH B;  4NQW A;  2A69 F;  1IXR C;  4RGX A;  2H27 A;  4EJW A;  5CVU A;  1MJ9 A;  1R1U A;  4EJU A;  1O57 A;  2CG4 A;  2RNJ A;  1SAX A;  1IW7 F;  1T98 A;  3QAH A;  1XB4 A;  3T0Y A;  1KGS A;  1XGM A;  3R60 A;  4LMY A;  3GW2 A;  1HKS A;  3CLO A;  5CVJ A;  3MCZ A;  2XAF A;  1RIO H;  3ZMD A;  1TBX A;  1SFX A;  3CUQ B;  4YII A;  1U3E M;  2GXG A;  3FHZ A;  3GZ6 A;  1G3W A;  3VB2 A;  4AWX B;  2UZK A;  2UXN A;  4RGS A;  4M6X A;  1IUY A;  5CYV A;  2L54 A;  4Y13 A;  1LDK B;  2A61 A;  3FMQ A;  1XCV A;  5EEG A;  3BDD A;  3BP8 A;  2NNN A;  1I1S A;  2R7F A;  3GF2 A;  1AOY A;  4EQQ A;  2ZO4 A;  3K1P A;  4G7H F;  1TQI A;  1LJ9 A;  5HS9 A;  2EA4 A;  1XSV A;  4PGG A;  2H6B A;  2PG4 A;  2M45 A;  4G9Y A;  3ZP5 A;  3ABT A;  4UHT A;  5DD4 A;  3J80 K;  3ECO A;  2VXZ A;  2HS5 A;  4MQ9 F;  3HTS B;  3V4G A;  1ZGA A;  4Q4Z F;  2FNA A;  3F8F A;  2C6Y A;  5JR3 A;  2VT2 A;  4HBL A;  4H0E A;  3T5X A;  4RB2 C;  2KKO A;  1WSU A;  4ENJ A;  3QU6 A;  2PEX A;  4OOI A;  2H6C A;  2BV6 A;  5CJ9 A;  2VBY A;  3KZZ A;  3HRM A;  2A6E F;  2PQ8 A;  3RYR A;  4PZJ A;  2EFO A;  4GGG A;  2H09 A;  3RTR A;  1JHH A;  1I1G A;  2W24 A;  4NHJ A;  1IZ1 A;  5HDN A;  5H6R A;  1OPC A;  4B09 A;  3I54 A;  3FF5 A;  4MNU A;  5E1Z B;  1RUO A;  3P9K A;  3CDH A;  1Q1H A;  5ICF A;  3F22 A;  1YW7 A;  4FX0 A;  2ETH A;  3ZN1 A;  2VC1 A;  5HDG A;  5BS6 A;  3R6S A;  4IRG A;  2HQN A;  3DEU A;  5DEQ A;  1C0W A;  2M30 A;  2R7D A;  4A0X A;  3NQO A;  4L0Z B;  2K02 A;  2X0L A;  1HW5 A;  1FPQ A;  2PJP A;  3V8K A;  4HLX A;  3BWG A;  4R79 A;  1STZ A;  2CQK A;  1ODD A;  2O8X A;  3KE2 A;  1LB2 A;  2IP2 A;  2KJC A;  2FBK A;  3NRV A;  4M71 A;  4R8H A;  5LLQ A;  4M73 A;  4ZYE A;  3GFL A;  1YFH A;  2HTS A;  3HOT A;  2FBI A;  3KET A;  3QU3 A;  3DXJ F;  1YTY A;  3KP5 A;  3BZ6 A;  1LQ1 A;  3T8T A;  3WTX C;  3SHF A;  4P9F A;  5TRD A;  1FZP B;  2V1U A;  2MLG A;  3HIF A;  2D2W A;  2DTR A;  5HLI A;  4KUM A;  4CDG A;  1SD4 A;  3GXO A;  1XSX A;  4IXA A;  4E70 A;  2WC2 A;  3FX3 A;  5F1R A;  5BOX A;  2UWM A;  1KQ9 A;  4OIO F;  3NEU A;  2L3D A;  3Q5F A;  3J80 Z;  4JBA A;  5K1Y A;  3V8L A;  1J7K A;  2P5V A;  4I09 A;  3E6M A;  3U1D A;  2M87 A;  4UUV A;  1XN7 A;  3RKW A;  4CXF A;  1FSH A;  2FBH A;  2W57 A;  5TJJ A;  2GA1 A;  1MDM B;  4P5O A;  4UVA A;  1R22 A;  1HXD A;  5E8G A;  4RAZ A;  1W5T A;  4F7Z A;  2WWY A;  1RNL A;  1UCR A;  1R23 A;  3F8N A;  1B6A A;  5CVR A;  3M8F A;  1K7A A;  1QGP A;  2Z99 A;  1K6O A;  3CJN A;  4N9H A;  1W4M A;  1B4A A;  2Z3Y A;  3TQN A;  4BH9 A;  1MKM A;  4A5N A;  3IKT A;  4ESJ A;  1G6N A;  1IF1 A;  3HRS A;  2A07 F;  2HZT A;  3LQQ A;  3E6B A;  2QUF A;  1FY7 A;  4IRH A;  2OAZ A;  3J81 K;  1T0F A;  1YQA A;  4I0B A;  1P6R A;  3GUD A;  2F5C A;  3IKV A;  3HSF A;  2RV8 A;  1XGO A;  1S7A A;  5E20 A;  4L9T A;  1REP C;  4OMY A;  2EFQ A;  4ENK A;  4S05 A;  1BI3 A;  2LKP A;  4A6D A;  5DDG A;  5K5R A;  2EB7 A;  2GIV A;  3I5U A;  1J59 A;  4G7Z F;  3SXY A;  1U5T C;  3JSO A;  4HX4 A;  1WRJ A;  1TTY A;  1Z1D A;  2QBY A;  4L9N A;  4LLL A;  1BIA A;  2OA4 A;  1ZLJ A;  3TO7 A;  5AON A;  2L01 A;  3WTU C;  2V1X A;  1H9T A;  3WTZ A;  3H3Z A;  3JTH A;  3WE3 A;  2DLL A;  1XMA A;  3D5L A;  4XRF A;  2ZME B;  2L4A A;  4AD9 A;  5D8L B;  3Q9V A;  2KRF A;  1NHA A;  3BOQ A;  2A5Y B;  5DCF A;  4M6Y A;  5LGT A;  1O7F A;  4WCG A;  3FMR A;  2P5K A;  5DYM A;  2XGX A;  2FML A;  4EM2 A;  1J9I A;  1BN5 A;  5D5V B;  2AS5 F;  5HS7 A;  3C18 A;  3LQR A;  4UVB A;  5L3D A;  5LHH A;  2EK5 A;  2Q0O A;  4RB0 A;  5F6F A;  3IC7 A;  1B59 A;  3WGG A;  2LNB A;  3AAF A;  2KIM A;  4EJT A;  5ICE A;  4L5I A;  1D8K A;  4KIC A;  2GXB A;  4KMF A;  2G7H A;  4U7B A;  3V7S A;  3LAJ A;  2QLZ A;  5L3E A;  5DUI A;  3WE2 A;  3E5Q A;  3P9I A;  2R3S A;  1ZAR A;  4LLG F;  2FMY A;  4Y17 A;  4A0Y A;  4HV5 A;  4AIK A;  1KYZ A;  4U7D A;  3MFK A;  4LD5 A;  1B9N A;  3KP4 A;  1FWZ A;  3IWF A;  2GZW A;  2DW4 A;  2IT0 A;  4M74 A;  5A2Q K;  3J81 Z;  2JSC A;  2RN7 A;  2QVO A;  4S04 A;  2HQR A;  5LGU A;  4I7H A;  2P4W A;  2HTJ A;  2XRO A;  1ZYR F;  3T8R A;  2G7U A;  2K4B A;  1LVA A;  1MZB A;  3FM3 A;  2ISY A;  3I4P A;  2FQ3 A;  3KEO A;  1SMY F;  2J5P A;  3VEP A;  2V6C A;  4HQE A;  2KIF A;  2P8T A;  3IRR A;  3ML6 A;  2MBF A;  5D4S A;  1O3R A;  3WTW C;  3EUH A;  1JXS A;  4A5M A;  1Z05 A;  3O3K A;  1IRG A;  2D45 A;  3U9G A;  3GVA A; 
#chains in the Genus database with same CATH topology
 3S2H J;  1ZN2 A;  3BPV A;  1Z3Y A;  3VDX A;  3CC2 I;  4PGH A;  2GBY A;  4LIU A;  5KVR A;  3E97 A;  5C4X J;  4YIF A;  5GP9 A;  2COM A;  2ZJP F;  2DO7 A;  1K4T A;  5DM6 F;  3HPH A;  2R7O A;  1QRY A;  1LDJ A;  1FP2 A;  1UHM A;  4B3A A;  3ZQQ A;  5FKL A;  1DUX C;  2LG4 A;  3K1M A;  1OR7 A;  2TDX A;  4LK0 F;  3CC4 I;  4IHV A;  4BUP A;  4J19 A;  1S8N A;  4XID A;  4M9S A;  4ENN A;  2HYG D;  4WXC A;  3HUG B;  3N4M A;  2CW0 F;  3ABM H;  2VN2 A;  1ONV A;  2F6C A;  1FBQ A;  4LJZ F;  1MGT A;  4ZZD A;  3PO2 J;  4NDL A;  1U6G A;  4P96 A;  4CCM A;  3G2B A;  4CYC B;  1NK3 P;  4KN4 X;  3C2H A;  2Y0M A;  2XAQ A;  3GEZ A;  4IHY A;  1HA8 A;  5IT3 A;  3HRU A;  4ZYD A;  4QLC U;  1LPQ A;  1L0O C;  2VPR A;  5L3C A;  2RC4 A;  1F1Z A;  4BQO A;  3GTM J;  2WAQ N;  1YLF A;  2K27 A;  3HHH A;  2KDZ A;  3GBG A;  1S7O A;  3F21 A;  5EEH A;  2L7F P;  3HOX J;  4AC0 A;  5IYB J;  5EDN A;  2WTE A;  4FT8 A;  1IO2 A;  2F4O B;  1BI1 A;  4I2O A;  3P7N A;  1GLN A;  1YIJ I;  1W7P B;  3KCC A;  1B9M A;  3PJR A;  5H2F C;  3BTC A;  1RR8 C;  3B6C A;  5AIP A;  1IC8 A;  4BAY A;  2O03 A;  4PFP A;  2E1N A;  3GFM A;  2L9S A;  2ZFW A;  4BE1 A;  1IV6 A;  1ZHF A;  2FSW A;  5IP9 J;  1BA5 A;  1HST A;  3OYI A;  2MGQ A;  1P2F A;  4X6A J;  1SD6 A;  2MH2 A;  4JX4 A;  1RUN A;  2O61 A;  3HC7 A;  2VL8 A;  1FBS A;  4KIB A;  3L2Q A;  2Y75 A;  3OR2 C;  1O3S A;  5JHF A;  3BJ6 A;  4EAT A;  3JAM Z;  1KA8 A;  4FX4 A;  2W84 A;  3TO9 A;  2OU2 A;  4LB5 A;  4CZC A;  3EPZ A;  1X1P A;  4V2F A;  1JKR C;  2STW A;  3QP6 A;  1WFX A;  4YFN F;  2M0C A;  1LEB A;  2HVQ A;  2VKV A;  4G12 A;  1V5F A;  4Z6Y A;  3HGY A;  3I71 A;  3DWL E;  1Y39 A;  1MMA A;  2MA3 A;  3EYY A;  4U88 A;  2E5Z A;  1J2X A;  2DT6 A;  3E6D A;  2ME6 A;  1ZRC A;  2WY7 Q;  2X48 A;  4XRS G;  3JSP A;  3I59 B;  4X0G A;  3RI4 A;  2JPB A;  5A2Q Z;  2W00 A;  3F8C A;  4C3J J;  3HHG A;  5B3S H;  4EVI A;  1I5Z A;  1QZY A;  4I02 A;  4E7H A;  1VQ4 I;  2E36 A;  3HRT A;  1KZH A;  3HOY J;  1PP7 U;  3EYI A;  1WJ5 A;  2LBF B;  1AWC A;  2L02 A;  1MJA A;  2DT7 B;  5LGN A;  2R5Y A;  2ZXJ A;  5D6F A;  4KIG A;  3OYM A;  4HNU A;  1O7L A;  4XLF A;  3WTT C;  3ZMV A;  4CCJ A;  2X1E A;  3JRG A;  3MZY A;  2ZFU A;  2V9V A;  4PJN A;  2F48 A;  2Z9O A;  2CUF A;  2ECB A;  3IAM 2;  2JA5 J;  6PAX A;  3SEQ A;  2WAE A;  4ZYA A;  1P9Q C;  1Z67 A;  1R58 A;  1T6S A;  4PCQ A;  4IHS A;  1RI7 A;  2DK5 A;  2XVC A;  4JYK A;  5B5E C;  2CFX A;  1WJD A;  4ANJ A;  2K9Q A;  4XLC A;  2GLO A;  3ECH A;  4XOP A;  3V8J A;  5BMZ A;  3CUQ A;  2JTV A;  4XRM A;  3BTJ A;  1VFC A;  4FCY A;  4UUT A;  1UST A;  3B73 A;  3RKX A;  2MFZ A;  4G6T B;  1R4N B;  4RGR A;  3OWT A;  4PJ0 C;  2BHY A;  3SZP A;  2CYY A;  3CCU I;  1ERD A;  3BG9 A;  2M5W A;  4Q5S F;  4DQ2 A;  2WB1 A;  1X1A A;  4QIW N;  5GTH C;  3RIR A;  3WU0 A;  1EV7 A;  2R0Q C;  1FNN A;  1R71 A;  5L3B A;  4BBR J;  4PJJ A;  3JRE A;  2R7W A;  2G9W A;  4BHB A;  1FLI A;  2JVH A;  3D5R C;  1FSE A;  1MMD A;  2XGE A;  4A6E A;  2XAH A;  2M8E A;  4IKF A;  3DTK A;  2Q2E A;  2QEN A;  1YJW I;  2HFH A;  1F5T A;  3KLO A;  4MLO A;  2CQQ A;  5CKT A;  1G2H A;  3FXQ A;  3O8H A;  4MTD A;  2DMP A;  3LSP A;  2R92 J;  2H1K A;  1R9T J;  2LSO A;  2DI3 A;  4CCK A;  1VQO I;  1JT0 A;  1DP3 A;  2A6T A;  3GWZ A;  1IDZ A;  3N97 A;  3GTP J;  2M7B A;  3H9Q A;  3K4B A;  2FU4 A;  2PN6 A;  4LLN A;  4GRI A;  1ZG1 A;  1ZR4 A;  1K78 B;  3PFI A;  1B1B A;  3TP3 A;  4G7O F;  2EV0 A;  4ON0 A;  2B7E A;  1ITY A;  1RR7 A;  3C2G A;  4HV6 A;  4XNF A;  1X3U A;  2DYS H;  5LRS A;  3OR1 C;  2OV7 A;  5E18 F;  2FEZ A;  2VQL A;  2LC2 A;  1ZG3 A;  1NG7 A;  4YG2 F;  2IS4 A;  3Q9S A;  1JKO C;  1ON2 A;  1F36 A;  3CO6 C;  2EFW A;  3IH3 A;  3TED A;  4YEL A;  3E5U A;  2P6S A;  4RGU A;  1YG2 A;  4OIN F;  4YIR X;  1POG A;  3GFJ A;  4IHT A;  2M8G X;  3K69 A;  4P55 A;  1UHW A;  2O0Y A;  3NAU A;  1BIB A;  4IOA F;  3ZRG A;  3IH4 A;  1JGS A;  2DMN A;  3WG9 A;  1KU2 A;  2A6H F;  1FOK A;  4YFK F;  4W97 A;  4DJA A;  4B48 A;  3SZT A;  1TQP A;  1TWA J;  3F72 A;  3TGN A;  2LBF A;  1CGP A;  3ROU A;  4D5F A;  1P4W A;  1TWH J;  4X1E A;  1XDS A;  3IWZ A;  5ERI A;  5HVQ C;  4LGW A;  4Q48 A;  2QCO A;  2CUZ A;  2QM3 A;  3KP7 A;  3VFZ A;  3F3X A;  1IRF A;  3HGG A;  3RQI A;  1YJN I;  2IVM A;  3EUK L;  4O3M A;  5HNH A;  4LK1 F;  3E5X A;  3UNG C;  3MAJ A;  1R7J A;  4LFU A;  4OIP F;  2E19 A;  5IT9 K;  3OYA A;  4XOT A;  3K70 C;  4CUG A;  1T8I A;  2HOS A;  2IA0 A;  3ZQL A;  3CCJ I;  4UNO A;  5B1B H;  2OCC H;  1E3H A;  2M9H A;  1YX3 A;  3BR2 A;  1QQI A;  1IRZ A;  1U9N A;  1YI2 I;  4BXU A;  3FK7 A;  3FBN B;  3M7G A;  3K4J A;  3CO7 C;  2NXN B;  2KLO A;  1OLT A;  3ULQ B;  3WTY C;  3HOV J;  1FTZ A;  4HST A;  3S1R J;  4B4C A;  2LF8 A;  1XCB A;  5KNL A;  3L09 A;  5DUK A;  2D1H A;  5FD5 A;  3W6J B;  4HNT A;  1Z7L A;  4UV9 A;  1BI0 A;  2K40 A;  4I01 A;  1R5G A;  2GOX B;  2Q1Z B;  2L7M P;  3QRF F;  4OAZ A;  1ZR2 A;  2E5N A;  2DMT A;  1Z6R A;  4M9Z A;  1WJC A;  2K4J A;  2NS0 A;  4UB6 C;  3IRQ A;  4WWC A;  3GO5 A;  2VKE A;  3WTS C;  1WH5 A;  4WK8 F;  1L3L A;  1ETV A;  2B0L A;  2JPC A;  2VON A;  3M8E A;  4YRV A;  3Q0V A;  2IS1 A;  3COA C;  3OIQ A;  3K9T A;  3VSK A;  2LTP A;  1G8X A;  3H92 A;  2HDD A;  3GTL J;  1Z21 A;  2XSJ C;  2KJB A;  5CVV A;  3FMS A;  4PSW A;  4XLA A;  1YHQ I;  4M3F A;  2PFB A;  3MWM A;  2Y9Y A;  1J5Y A;  4KIS A;  1OYI A;  3ZMT A;  2E71 A;  3FXR A;  3SZG A;  3KYC B;  3FKI J;  3GFI A;  3CP2 A;  2E60 A;  1V3F A;  1YW8 A;  4HX8 A;  1DPR A;  1G3S A;  3OL3 A;  4GCV A;  4LG0 B;  4HF2 A;  2EA2 A;  5GAD J;  4C9Y A;  2V79 A;  2NNY A;  1RET A;  2FQ4 A;  3HM5 A;  1K79 A;  2CUJ A;  3GCM A;  2VOP A;  3KP6 A;  2EV5 A;  3M3Y J;  4HAM A;  5ICC A;  3QYB A;  1EKE A;  2XDV A;  4XK4 A;  2XPW A;  1T38 A;  1WKM A;  3BR3 A;  2CU7 A;  3H5N A;  2XKP A;  2VQG A;  3K0L A;  3CJR B;  2CO5 A;  2E1C A;  2L9R A;  1P4X A;  2QQ9 A;  4RMN A;  3K1N A;  4XON A;  5JVT A;  2ZCW A;  4HQM A;  1HW2 A;  3CUO A;  2VBZ A;  2CFO A;  2Z16 A;  1GVJ A;  1ZLK A;  1J75 A;  2HGC A;  5BPI A;  4CIC A;  4HW0 A;  1MD0 A;  1UG0 A;  1JI8 A;  1TQM A;  1W7P D;  3QQA A;  2NVY J;  2K86 A;  4NC6 A;  5H20 A;  4A2U A;  3J7Y J;  4O6J A;  2TRT A;  1FJL A;  2L9N A;  4EJV A;  2FNP A;  2J5O A;  2O7O A;  3ZMS A;  1LEA A;  1I6X A;  5FD6 A;  5JI6 A;  1XGS A;  2OQG A;  2CV2 A;  1D8J A;  4HG2 A;  1NG6 A;  3L2R A;  1Z3X A;  5CLS A;  2MH9 A;  5J4V A;  3CCS I;  5JLX A;  3VOD A;  1A04 A;  4GFB A;  1OYY A;  4FHT A;  4UUS B;  1Y1W J;  4HDU A;  4R1H A;  1OFC X;  5BQT A;  3S3O A;  1TNT A;  3DV8 A;  1T39 A;  1JKP C;  1D5V A;  3DCF A;  2BY1 A;  3RZD J;  2HOT A;  2HDC A;  1Z6T A;  2O9L A;  5E1W A;  4C3I J;  1FIP A;  4OIQ F;  3LSM A;  2AHQ A;  3BY6 A;  3BJO A;  1H89 C;  4P9U A;  2CV1 A;  2JA2 A;  1U5T B;  5HLT A;  3FXU A;  1R49 A;  3G3Z A;  3RQ4 A;  1XS9 A;  2R93 J;  3HOU J;  2VBX A;  2O6G E;  2KIS A;  1P4A A;  1LE8 B;  2TCT A;  4UB8 C;  2DA2 A;  3A02 A;  4M3G A;  2ESH A;  5CVI A;  5J8C A;  3KFW X;  1ZEL A;  2YX4 A;  4BDZ A;  2HDW A;  3W3C A;  1S3J A;  5FKM A;  4HLY A;  1SFE A;  1E2X A;  4HF0 A;  3DP7 A;  3S3N A;  3QOP A;  3WGH A;  1YO5 C;  1HKQ A;  2MG4 A;  1MDM A;  2ZB9 A;  4GYG A;  5GTI C;  3ERE D;  4ZJZ A;  4BKX A;  3P5J A;  4A69 C;  3I64 A;  5JLW A;  1ZAO A;  3U2R A;  2QYO A;  3ZMZ A;  4CGZ A;  2HOA A;  2VOD A;  1E17 A;  5EGO A;  5TIS C;  2AXT C;  1BBY A;  1XMK A;  2OZ6 A;  2M7A A;  2HR3 A;  2PX9 A;  3TOB A;  4OAY A;  3ZMU A;  5E3M A;  5EZH A;  2XAU A;  2P7V B;  2E2I J;  4AVP A;  3J7Z I;  3R4K A;  4PFO A;  1YOV B;  5IP7 J;  3RZO J;  1R1T A;  1LVK A;  5IOY A;  1R1V A;  5LBQ A;  1KQ8 A;  3S2D J;  3HYI A;  1KU7 A;  1YRN B;  1O3T A;  2VC0 A;  4NQW B;  3HOS A;  3K2Z A;  1TNS A;  3IP4 B;  1BM9 A;  2BOL A;  3BRO A;  3PO3 J;  2E7W A;  3OOU A;  2DJI A;  1APL C;  4UVC A;  3K4N A;  1X4O A;  4MTE A;  2K7L A;  3EUA A;  3DKY A;  1XSD A;  4IRI A;  1FX7 A;  3DEE A;  1VQ7 I;  1OMI A;  2YX7 A;  2VE8 A;  1RZ4 A;  2KIU A;  3DKW A;  2XGD A;  1FYM A;  4KNY A;  2Y2Z A;  3DPT A;  1QZZ A;  1PUE E;  2MD5 A;  3EUH C;  3O6B B;  3BJA A;  3JRD A;  1OCR H;  1PVE A;  1VQN I;  3GYH X;  2IGO A;  3HSE A;  1QVT A;  2OQR A;  2ZNZ A;  1QZE A;  4FE7 A;  1Z91 A;  4JK1 X;  1BJZ A;  1CQT A;  2G0E A;  3PFY A;  2RGV A;  2HU9 A;  2BY3 A;  2IA2 A;  4RB3 C;  3H35 A;  1QPM A;  2CGP A;  1USS A;  1FC3 A;  2DOE A;  1Z9C A;  2HPI A;  2X4H A;  2ZXW H;  4B43 A;  2XPU A;  1OJL A;  3CC7 I;  3FXM A;  2HI3 A;  1DGR M;  1SFO J;  1OR7 C;  2R7T A;  3EDP A;  5H6Q A;  1VZ0 A;  2HEO A;  2WAD A;  5K5O A;  1U2W A;  3M1C A;  2WV0 A;  2R7V A;  1MMG A;  4M72 A;  4QTR A;  2VXD A;  4KMU X;  2V6E A;  2JA7 J;  4M3B A;  1ZKG A;  4ZDP A;  4RDU A;  1FOX A;  2F2E A;  3SEZ A;  3ZQC A;  3UKG A;  1Y0U A;  4IF4 A;  4N0B A;  1FYK A;  2BHZ A;  1CF7 B;  3AG2 H;  4LIV A;  2E1M B;  1LE8 A;  1KU3 A;  2XV4 S;  2XF5 A;  1FP1 D;  2MLK A;  2PJR A;  1MBH A;  5HLH A;  3BCB A;  5K7F A;  1VF9 A;  4EMS A;  2LKX A;  1MBE A;  3QPS A;  4C3H J;  2F5D A;  4GO1 A;  2HQ5 A;  3VSL A;  3BPX A;  2ZNY A;  1WVR A;  4IX7 A;  3SYT A;  2BBY A;  1QVU A;  2ADU A;  2ZME A;  2ZSH B;  3BLY A;  3OYH A;  1W36 C;  4BNC A;  2VBW A;  4ZC3 A;  3F9K A;  3OV8 A;  3FXJ A;  3CCE I;  3BR6 A;  1BR1 A;  1EA3 A;  3L00 A;  1A31 A;  2HZD A;  3NWS A;  4A3F J;  4HDV A;  5M3M J;  1D5Y A;  4E7Z A;  4HSR A;  2YU3 A;  1ULY A;  2XRN A;  1V4R A;  4E7I A;  3I0T A;  5FFX A;  4XSZ F;  3IH2 A;  4AIH A;  5ILU A;  4DIQ A;  4ZZL A;  1DP7 P;  1QNT A;  3ESW B;  2K5C A;  2OF7 A;  2Q8K A;  4PSX A;  4U0W A;  2YSR A;  1RRJ A;  1SFU A;  3BC8 A;  3CP8 A;  3I53 A;  2W85 A;  1ZG5 A;  1RKT A;  1AKH B;  5HS8 A;  2Y0S N;  1SVO A;  1WCM J;  1BR4 A;  3DTE A;  3B02 A;  1YJ9 I;  2KZG A;  1QA6 A;  2KQR A;  4BQA A;  5LD2 C;  4HYE A;  3E3V A;  3I58 A;  2W1O A;  4HPQ A;  4MQV A;  5F64 A;  3DBH B;  3IHU A;  2VJI A;  5E3O A;  1UFM A;  5M3F J;  2BYV E;  3ONQ A;  1MNM C;  2V9P A;  3QYF A;  1U9O A;  1IXC A;  1JTX A;  3F6V A;  5DV5 A;  4HNV A;  3CDI A;  4HA8 A;  5L3F A;  2R5Z B;  5C3E J;  1BJA A;  4A3C J;  5C4J J;  2MC3 A;  3HEF A;  1ENH A;  1ETY A;  4JX5 A;  1W5S A;  3HSR A;  3HL2 A;  2ID6 A;  1J0R A;  3HXL A;  2A05 A;  1MH4 A;  3LAP A;  4Y3O A;  4A3D J;  4B8X A;  2DQL A;  2LFB A;  4DYC A;  2JN6 A;  3A01 B;  2XKO A;  5E3L A;  1KU9 A;  2O3F A;  4IOC F;  4Y52 J;  3LWF A;  1OQY A;  4UXN A;  4L5J A;  1BR2 A;  2LOO A;  4LG3 A;  1XTA A;  1SVM A;  1ON1 A;  3MD2 A;  4IPA A;  5AIQ A;  1PUF A;  1HOM A;  2ZJ2 A;  1SEU A;  5KAI C;  3CUQ C;  3SFI A;  3JCU C;  2RVC A;  3V7C A;  2PI0 A;  5ICG A;  3JRH A;  3J7A O;  1ZRD A;  1BC7 C;  1OCP A;  2KIQ A;  2PBI A;  2LDU A;  2VAS A;  3PNY A;  4AYB N;  1VTN C;  1YE9 A;  5K7H A;  2NVU B;  4LIT A;  1BW6 A;  4IO9 F;  2DTZ A;  1CF7 A;  2OUM A;  3PQK A;  1D1A A;  2PMH A;  1YIO A;  1TZL A;  2EFN A;  3REO A;  4WXH A;  4MEX F;  4NB5 A;  1B72 A;  3FBI B;  2I10 A;  4HOB A;  3GTJ J;  1VQM I;  3I9V 2;  3ZGK A;  1WJE A;  1QO0 D;  5J4Y A;  2XAJ A;  2RQQ A;  3O8G A;  2YR2 A;  1IXS B;  4MFD A;  4AIJ A;  2EIM H;  1ORK A;  1FMV A;  2D1V A;  2V1N A;  2JVG A;  2DT5 A;  4BJ6 C;  5FRO A;  2OCE A;  2XAS A;  3JW4 A;  4ZYH A;  2LVS A;  1Y8Q B;  4KA4 A;  2LY1 A;  5LEK A;  2ESN A;  4D1Q A;  1S9H A;  1S29 A;  4RM3 A;  4RLF A;  3K4L A;  4MGR A;  2B9S A;  5CQE A;  1PDN C;  1E3P A;  3ERM A;  4XIC A;  3FXO A;  4K2E A;  4CHU A;  4ZTF A;  3WU2 C;  2XGC A;  3W2V A;  1WQ2 A;  2QKM B;  4Y7N J;  2QEX I;  3S1Q J;  1GXQ A;  2LK2 A;  2IA1 A;  4I0A A;  1TL8 A;  5LRR A;  3O2P E;  1JHF A;  1U78 A;  1Y8R B;  3TOA A;  5D5W B;  3CMA I;  5FJ8 J;  1TC3 C;  3SQN A;  3ABU A;  4E4H A;  1O4X A;  3PL8 A;  1HF0 A;  1VQ9 I;  3DLA A;  5LHI A;  3GX4 X;  2F5V A;  1GHC A;  4XLH A;  3WOD F;  2EH3 A;  1DDN A;  1JTY A;  1TW3 A;  4BQN A;  2DK8 A;  3KIO A;  4PJL A;  3TW6 A;  1R5I D;  1UEL B;  4WX9 A;  5IYD J;  3IL2 A;  2CWE A;  2PMZ N;  2M2E A;  2QWW A;  3G1M A;  3LSK A;  1EH6 A;  3VYT B;  1P7I A;  3S32 A;  3HUG A;  1TP4 A;  3GZN B;  3L9F A;  2R5Z A;  1V5G A;  1MBG A;  4I76 A;  3BG5 A;  3WTV C;  1I6H J;  1S6L A;  1BC8 C;  2FOK A;  4CYC A;  2V1D A;  1YS7 A;  3BT9 A;  4BEH B;  1H0M A;  3LFK A;  2V26 A;  2WV1 A;  1RPW A;  2DA1 A;  2IPQ X;  5F0F A;  3MEX A;  2ZBK A;  2HYJ A;  3P9C A;  4LB6 B;  2DFI A;  2XAG A;  3W6V A;  3BR1 A;  1GUU A;  3VWB A;  2UXX A;  5D8K B;  5J1Y A;  2X1C A;  3G73 A;  3HDD A;  4XLN F;  5FB2 A;  3H5A A;  1DQU A;  3TDZ C;  3RKQ A;  1FBU A;  3OYE A;  3JTG A;  1R00 A;  4GYI A;  2NYX A;  2DPU A;  3VOE A;  2P7C B;  3QPL A;  3KX2 A;  2ACJ A;  1B8I B;  4L18 B;  1W7P A;  3JRI A;  1ETQ A;  4N9I A;  3TDU C;  3OS1 A;  1O3Q A;  2XHK A;  2KP6 A;  3DBR B;  2DA6 A;  2CS3 A;  2HNH A;  1JUM A;  1BOA A;  2Y48 A;  2JUC A;  3PIP F;  1Z77 A;  4XLE A;  5TGT A;  3I3L A;  4HX7 A;  2CSO A;  3BR0 A;  2VT3 A;  4D7N A;  4KN7 X;  2DOF A;  2HPM A;  2ZJR F;  3TO6 A;  2Y9Z A;  1EH7 A;  4BYY A;  3DEW A;  5FFZ A;  1EH8 A;  3TMO A;  3C3W A;  1TW2 A;  4CH7 A;  3KP3 A;  2Z33 A;  3DPL C;  4D0P A;  4YFX F;  4I6Z A;  2LYC A;  1FEX A;  3L1P A;  2QQB A;  4JQF A;  3ZQF A;  4ASN A;  4A3J J;  2A68 F;  3QP5 A;  3BZK A;  5KK1 A;  3R61 A;  1MJB A;  1UMQ A;  3I56 I;  1FT9 A;  2DFE A;  1Y0N A;  3MKY B;  1XDU A;  3TKY A;  1W0U A;  1ZRE A;  3ZPL A;  3HTU A;  2L2O A;  1RC9 A;  3OYC A;  2ELH A;  2BGC A;  3WHB A;  2FRH A;  2VQC A;  2VKD A;  1FTT A;  2AQE A;  3I59 A;  3BR5 A;  3DFG A;  2KL4 A;  2P6T A;  4I98 B;  3LL7 A;  3W2W A;  1MMN A;  2QQA A;  4CZZ A;  5DD8 A;  1G3T A;  4BL0 B;  2L0K A;  2RKH A;  2VKH A;  2XUB A;  3CCM I;  2X9D A;  2LP0 A;  1FYL A;  1EJ9 A;  3ZQ7 A;  4HZF A;  2E34 A;  2ZSI B;  4KDP A;  5JHU A;  1H9G A;  3LA2 A;  4BHP A;  2CUE A;  2W48 A;  2BY0 A;  2IXS A;  4MEY F;  1S7E A;  1F43 A;  1BI2 A;  1TWG J;  1QPI A;  2CW8 A;  4DOZ A;  1TT0 A;  2OBP A;  3U1K A;  5BPD A;  2DBB A;  3GLX A;  5FRN A;  3ZOB A;  4QPQ A;  4DNC A;  2IGM A;  3PQJ A;  4MHG A;  4A0Z A;  4ITV A;  2VQH A;  4KFC A;  3MZH A;  1T0F C;  3V7R A;  4DW6 A;  3PUB A;  3G71 I;  1DGW Y;  3PNT A;  3S16 J;  1MBK A;  2E35 A;  1WH7 A;  1BOB A;  2BW3 B;  4PK4 A;  1OCO H;  1I3Q J;  3EQL F;  2JA6 J;  1HQC A;  2O5R A;  3BG7 A;  3C1D A;  3QPT A;  4XSX F;  4BEH A;  3G4S I;  1SMT A;  2BEO A;  1IAW A;  2EQR A;  4G8X A;  5IP6 A;  1MBF A;  3X2Q H;  1HW1 A;  3KZY A;  3KP2 A;  3IV5 A;  5D6E A;  4E6K G;  5J8F A;  1GXP A;  2RRE A;  1UZC A;  4EM1 A;  3IUO A;  2I8D A;  2X51 A;  4Y4R A;  3F8M A;  5IY5 H;  1XD7 A;  2LH9 A;  3L2U A;  2ZXH A;  3ELK A;  5JVG F;  4BGD A;  2BE5 F;  1ZRF A;  3M4O J;  3ZCO A;  3ZN0 A;  3FHN A;  3S1N J;  1LDD A;  3MZ8 A;  3SFZ A;  1SVL A;  1KON A;  2M4G A;  2OPT A;  2V4J C;  2K9M A;  4KT6 A;  3C2B A;  1N75 A;  1X2N A;  2QBY B;  5E8I A;  2HWV A;  5BNG A;  1N77 A;  1OYW A;  1T95 A;  1KYW A;  1XGN A;  5F27 A;  2VIX A;  3BQY A;  3CTA A;  1K78 A;  2OD5 A;  1D3Y A;  3M07 A;  5B1A H;  1XMX A;  2VOO A;  3JRC A;  2E7X A;  2L7Z A;  3LSG A;  3QOE A;  3S1M J;  4A3B J;  3D5S C;  3OSF A;  1WJB A;  1T2K A;  1S5L C;  5LEJ A;  2OTL I;  2HOE A;  3U21 A;  3W6K B;  2JK3 A;  5FLX K;  4NUB A;  3E6C C;  5ED4 A;  2DPD A;  1ZK8 A;  2HKO A;  2HXI A;  2H94 A;  2KDO A;  1VQ5 I;  2FA5 A;  3OS0 A;  3IAS 2;  4G6D A;  4OIR F;  3A4C A;  3CCY A;  1MBJ A;  2RQP A;  4J01 A;  4IZZ A;  2GWR A;  1ZH5 A;  2RDP A;  5L3G A;  3ISP A;  3JRA A;  1P92 A;  2EIK H;  1X3Z B;  4Z2Y A;  5E17 F;  1IN8 A;  2YPR A;  3I4N J;  4NNJ A;  4AVZ A;  2A3S A;  2DAO A;  2HKX A;  1MMS A;  2R7X A;  4A3E J;  2DJN A;  5F0H A;  3WGI A;  3JRB A;  4GDF A;  1I27 A;  5DCM B;  3OYN A;  2FE3 A;  2Y31 A;  3K4K A;  2EV6 A;  1SFK A;  2D5V A;  4WF2 A;  4UV8 A;  1TWF J;  1R4M B;  5C44 J;  2KZV A;  3FWE A;  4CYD A;  2NVX J;  1IN4 A;  3WHC A;  2WAQ A;  1D1B A;  3OMY A;  1KQ0 A;  5FKO A;  3KPH A;  4EGY A;  2JQ7 A;  3HG9 A;  1UB9 A;  1G59 A;  5F08 A;  3PIO F;  5JFR A;  3HZJ A;  2HYF A;  3CME I;  5HLG A;  4EGZ A;  3RPU A;  4XBF A;  4EV0 A;  2IW5 A;  2VPL A;  3K10 A;  2EWN A;  2QZ8 A;  1SAN A;  3CJT B;  2JWT A;  3K2A A;  2Z5U A;  5ILS A;  4OU0 A;  2JT1 A;  4HRI A;  3L7W A;  2ISZ A;  2STT A;  4AYB A;  4B1R A;  3RJP A;  3ZQH A;  1F4K A;  1WJA A;  4DBR A;  2BW3 A;  3LST A;  2LR8 A;  3HOZ J;  4ESF A;  2GIZ A;  1G3Y A;  3H9G A;  5HOO A;  1BW5 A;  3GTQ J;  4BHC A;  4B3X A;  4OMZ A;  1GV2 A;  3F23 A;  3CDL A;  4IVN A;  1ZGJ A;  3F0C A;  5K5Q A;  1W1W E;  3KLN A;  4FAS D;  1IN6 A;  1QBJ A;  4CO8 A;  2P5L C;  3LA3 A;  3R0A A;  2ZXI A;  2PLY A;  1VQL I;  4D9J A;  1VQ8 I;  5J1U A;  2ZKZ A;  1AA7 A;  4Q47 A;  2M1B A;  4ESB A;  2E2H J;  2OZU A;  2PMU A;  2FJ1 A;  3H36 A;  5IT9 Z;  4CA0 A;  3T1B A;  2DQR A;  2F5F A;  4RBO A;  4ZH4 F;  3ABL H;  4O5V A;  2H8W A;  1WGX A;  3AL0 C;  1FOY A;  1U8R A;  1N25 A;  3DPU A;  5EYR A;  2EZK A;  5LHG A;  3D0S A;  4XM3 A;  4A3M J;  1IN5 A;  2N8G A;  1YW9 A;  1LNW A;  1MND A;  3RYP A;  2X6X A;  1YS6 A;  3C7J A;  2O8K A;  2DDB A;  2NRA C;  2GQQ A;  2L4M A;  2WA0 A;  3BG6 A;  4LG0 A;  4BXX J;  4RAF A;  1DU0 A;  4G6Q A;  2LF7 A;  5GPA A;  2ZME C;  3PUF A;  3WU1 B;  1JE8 A;  2BXY A;  1J09 A;  1NK2 P;  1FIA A;  5J1R A;  5D5U B;  1SC7 A;  4HF1 A;  1DU6 A;  1ETW A;  3F6O A;  5EG0 B;  4AU7 A;  1D0Y A;  2IEK A;  2AXL A;  5J6X A;  1X1D A;  2PMZ A;  5F1J A;  3PM1 A;  4XKC A;  4XN3 A;  1YYV A;  4PDK A;  4G94 A;  3BZC A;  3ASO H;  5DCM A;  5FO5 A;  3CCV I;  2GAU A;  5FRM A;  1D0Z A;  2FD5 A;  2XSD C;  3CCL I;  2EFP A;  2FUG 2;  3H3U A;  4U0V A;  2FXA A;  2KFD A;  2VJ5 A;  1X58 A;  1Z7U A;  1I50 J;  2F5E A;  4NC7 A;  4KT5 C;  3KEQ A;  4QPO A;  5D5X B;  4ENM A;  1RES A;  4L9V A;  4RAY A;  3KYL A;  5FLV A;  5ILV A;  2EJR A;  5E1X A;  4P1W A;  4DYQ A;  4M9X A;  1WI9 A;  4QWQ A;  3VYR B;  5D4R A;  3GZ5 A;  2GA2 A;  1A35 A;  4KYW A;  4IJA A;  4F93 B;  4U0Y A;  1HKT A;  5CPR B;  2MYS A;  3RKY A;  1X2M A;  3RPQ A;  2QQ8 A;  5FLX Z;  1K83 J;  2ME0 A;  4WXD A;  1XC5 A;  4ETS A;  1DPU A;  4UUS A;  2R7Z J;  1SD5 A;  2W25 A;  1PP8 F;  1HLV A;  3DQV C;  1A36 A;  4L9J A;  4MFE A;  4MIM A;  2KRH A;  4BXF A;  1U0J A;  2JRT A;  5HDK A;  1F9N A;  1R5H A;  2K3F A;  2JZY A;  4TV7 A;  2VE9 A;  4CSW A;  2DDA A;  3QPH A;  5DM7 F;  5GAH J;  3JRF A;  2CV0 A;  1MSE C;  3GTK J;  4C2M J;  1U5T A;  2FF4 A;  2W4S A;  3PNV A;  3K7A J;  4L0Y B;  4XLP F;  3CZ6 A;  1SD7 A;  3JAM K;  2DU9 A;  2XIG A;  1HSJ A;  5B66 C;  1PYV A;  5E79 C;  1OKR A;  1R36 A;  3M1E A;  2X6W A;  4EJO A;  3VYS B;  3OIP A;  4XL9 A;  1W5C C;  2NAZ A;  2IRF G;  1OCZ H;  2DMQ A;  1IN7 A;  3MKW B;  5J47 A;  4E7S A;  2KPM A;  4XKW A;  3GLL A;  3S2W A;  3DF8 A;  3FZV A;  2KHM A;  3R0J A;  3EET A;  4XQF A;  2KRC A;  3LA7 A;  1X1B A;  4RS8 A;  3L2C A;  3OOP A;  3MN2 A;  1JUS A;  4IL6 C;  4E7J A;  4ZYG A;  1AHD P;  3S15 J;  3OYG A;  4RB1 A;  1WWX A;  3A0B C;  4F52 A;  3MQ0 A;  3F8B A;  3RDI A;  3RPU D;  4Y15 A;  9ANT A;  4GXO A;  4A12 A;  4IEJ A;  1IG7 A;  1FMW A;  3HPG A;  1IJW C;  3OYB A;  3M9A A;  5FGM A;  4RM2 A;  2XF7 A;  4JP0 A;  4EM0 B;  4IQJ A;  4KIF A;  1HBX G;  3FM5 A;  2IJL A;  3K6G A;  3H0D A;  2LD5 A;  1G4D A;  2VJJ A;  1ZGW A;  1TLH B;  3LNQ A;  1YRN A;  3PSI A;  4NQW A;  3E1S A;  2A69 F;  2EIN H;  1IXR C;  4M3E A;  4RGX A;  2H27 A;  4EJW A;  5CVU A;  4BJ5 C;  3ASN H;  1MJ9 A;  2QF7 A;  3BTI A;  3CF2 A;  3DTI A;  1R1U A;  5EG0 A;  3K4C A;  3S3M A;  4EJU A;  4W1U A;  1O57 A;  3G1L A;  2CG4 A;  3HKZ N;  2L9V A;  2RNJ A;  1JJ8 C;  1SAX A;  2R7U A;  1IW7 F;  1TWC J;  1T98 A;  2CRG A;  2M34 A;  3QAH A;  1XB4 A;  3T0Y A;  2XB0 X;  1OCT C;  1KGS A;  1WJF A;  1XGM A;  1P7J A;  3R60 A;  4LMY A;  1VQK I;  1D0X A;  3GW2 A;  1HKS A;  3CLO A;  1JKQ C;  3VYU B;  4ZDL A;  2QKL B;  2Y69 H;  5KAF C;  5EEA A;  1WPK A;  5CVJ A;  4XKB A;  3MCZ A;  2X6O A;  1NTC A;  3DU5 A;  2XAF A;  1ETO A;  1RIO H;  2CQ7 A;  3ZMD A;  2QA4 I;  3M8J A;  1E3O C;  1Q1V A;  1TBX A;  1SFX A;  4IHW A;  2ICW G;  3CUQ B;  4YII A;  4PUS A;  1U3E M;  1ACI A;  1ETX A;  2GXG A;  2JA8 J;  3FHZ A;  3GZ6 A;  2Y30 A;  2DA3 A;  1G3W A;  3LSJ A;  3VB2 A;  2XPV A;  4AWX B;  2UZK A;  2NVT J;  2UXN A;  2HXO A;  4RGS A;  4RAG A;  2JSP A;  2IS2 A;  4M6X A;  3OYL A;  1IUY A;  3A2K A;  5CYV A;  2L54 A;  4Y13 A;  1W0T A;  1LDK B;  3S93 A;  2A61 A;  1WZ2 A;  4FTH A;  3FMQ A;  2Q2E B;  3G6E I;  4A3L J;  4CCN A;  1XCV A;  3Q0W A;  2DFF A;  5EEG A;  2KT0 A;  5IPA A;  3BDD A;  3BP8 A;  2NNN A;  4LOC A;  1I1S A;  1ETK A;  2RAE A;  1MIJ A;  2R7F A;  3GF2 A;  1AOY A;  1Y56 A;  1UAA A;  2P0W A;  2F4M B;  2ZO4 A;  4EQQ A;  3K1P A;  3A0H C;  2DFH A;  3QWL A;  5CQG A;  4G7H F;  1TQI A;  2GM4 A;  1LJ9 A;  2YUS A;  5HS9 A;  2V9K A;  4FQG A;  5M5W J;  3DKX A;  2EA4 A;  1XSV A;  4PGG A;  5HOD A;  2H6B A;  2PG4 A;  4V19 K;  3H3V K;  2M45 A;  4G9Y A;  3ZP5 A;  3ABT A;  2M4K A;  3H5R A;  4UHT A;  4XN0 A;  5DD4 A;  1T56 A;  2DA4 A;  3J80 K;  3J7A Y;  4A3G J;  2UUZ A;  4XKV A;  4M3D A;  5GAE J;  3ECO A;  4D5C A;  2VXZ A;  3UR3 C;  2DXI A;  2HS5 A;  4MQ9 F;  3V42 A;  4E7L A;  1LFP A;  3V4G A;  3HTS B;  1ZGA A;  4Q4Z F;  1AKH A;  2FNA A;  3ZQI A;  3F8F A;  2C6Y A;  5JR3 A;  3DLL F;  2MW8 A;  2VT2 A;  5EZG A;  4BU2 A;  4BS9 A;  4HBL A;  2CH0 A;  4H0E A;  3T5X A;  2LY2 A;  4RB2 C;  3ZQG A;  2KKO A;  2R4G A;  1X4P A;  3CF5 F;  1WSU A;  5EJC A;  1SAU A;  2NOJ B;  3S8P A;  4ENJ A;  3OYK A;  4AM3 A;  3QU6 A;  1QU3 A;  2PEX A;  2BZT A;  2E1O A;  4OOI A;  4EEF G;  1I3A A;  2H6C A;  1V5E A;  1ZTR A;  2P81 A;  2BV6 A;  3OL4 A;  4JX6 A;  5CJ9 A;  2VBY A;  5DS9 A;  5LFA A;  3KZZ A;  3HRM A;  4J00 A;  2A6E F;  2PQ8 A;  1QHG A;  4PZJ A;  3RYR A;  2EFO A;  4GGG A;  4F55 A;  3E0J B;  3A01 A;  2VJ4 A;  2H09 A;  3A03 A;  1HCR A;  3RTR A;  1JHH A;  3S17 J;  2EPF A;  4HEA 2;  1I1G A;  4A3K J;  2W24 A;  5F0C A;  4NHJ A;  1IZ1 A;  2OJE D;  5HDN A;  3K4M A;  4BAC A;  2GOM A;  3PSF A;  5H6R A;  4NC8 A;  1V54 H;  2BY2 A;  3VPR A;  2COB A;  4XRS A;  1OPC A;  4B09 A;  4F91 B;  2VUM J;  2AO9 A;  3I54 A;  2XF6 A;  2YS9 A;  2JUG A;  3FF5 A;  4MNU A;  1OCC H;  5E1Z B;  1RUO A;  3P9K A;  1V55 H;  3CDH A;  1Q1H A;  5ICF A;  3F22 A;  1YW7 A;  4FX0 A;  2VI6 A;  3HBL A;  2ETH A;  1YX5 A;  3ZN1 A;  2VC1 A;  4FIS A;  2XB5 A;  5HDG A;  5BS6 A;  2NOG A;  3LOC A;  1OIS A;  3R6S A;  4IRG A;  4N4N B;  4ZTJ A;  2HQN A;  3DEU A;  5DEQ A;  1C0W A;  2B63 J;  2M30 A;  3TBI A;  2R7D A;  1T08 B;  1IRX A;  4A0X A;  4AID A;  4F92 B;  3NQO A;  3H9J A;  4L0Z B;  2K02 A;  2X0L A;  1HW5 A;  3CD6 I;  1FPQ A;  2UV1 A;  3V8K A;  4HLX A;  2PJP A;  3BWG A;  4R79 A;  1VND A;  1X1C A;  3BQZ A;  1HDD C;  1STZ A;  2CQK A;  2V7F A;  2ZC2 A;  3ZXS A;  4E7K A;  1ODD A;  1XX5 A;  1MNE A;  2O8X A;  3KE2 A;  2MD0 A;  4I99 C;  3TP0 A;  3WG7 H;  1LB2 A;  2VLA A;  5EF6 A;  3DU6 A;  2IP2 A;  2KJC A;  2FBK A;  3NRV A;  3SDB A;  4M71 A;  4R8H A;  5LLQ A;  4M73 A;  4ZYE A;  4BJT A;  3GFL A;  2OTJ I;  1YFH A;  2HTS A;  2YU9 J;  3HOT A;  2FBI A;  3KET A;  3QU3 A;  3DXJ F;  4U87 A;  1HDP A;  3NAR A;  3DBL B;  1YTY A;  3KP5 A;  4NBQ A;  3BZ6 A;  1LQ1 A;  3Q0U A;  3T8T A;  2WY8 Q;  4B44 A;  3WTX C;  3SHF A;  4P9F A;  2X1D A;  5TRD A;  1VQP I;  2GXA A;  2NS8 A;  1FZP B;  2CMP A;  2V1U A;  2A5W A;  2MLG A;  5IYC J;  2JMW A;  5FKN A;  3HIF A;  4DZP A;  2D2W A;  4DYR A;  2DTR A;  5HLI A;  2LY9 A;  1S72 I;  1NH3 A;  2CQX A;  4KUM A;  4IHX A;  4CDG A;  1SD4 A;  2W82 A;  3GXO A;  1W36 D;  2K9L A;  1XSX A;  4KIT B;  1MW7 A;  3NWT A;  4IXA A;  4E70 A;  2WC2 A;  3FX3 A;  2DA5 A;  1GV5 A;  2DOA A;  3GTO J;  5F1R A;  5BOX A;  2UWM A;  1KQ9 A;  4OIO F;  2H1L A;  3NEU A;  2L3D A;  4A3I J;  3Q5F A;  1UHS A;  4M6V A;  3J80 Z;  2QSF X;  5GAG J;  3MKZ A;  2DA7 A;  4JBA A;  4KJZ A;  2DYR H;  5K1Y A;  5FKK A;  3V8L A;  1E0E A;  1J7K A;  2P5V A;  4I09 A;  3G1O A;  3BTL A;  3TL4 X;  2R7Q A;  2W7N A;  1A6Q A;  3GTG J;  4CCL A;  3E6M A;  2EZI A;  2ZJQ F;  3U1D A;  4FE4 A;  1B8I A;  1A6I A;  5DTD A;  2FOW A;  2M87 A;  4FET A;  3CCQ I;  4UUV A;  1XN7 A;  2ELK A;  3FKJ A;  3AKZ A;  3L2W A;  1R6R A;  3RKW A;  4CXF A;  2DMU A;  1FSH A;  2FBH A;  2W57 A;  5TJJ A;  2ID3 A;  2QSH X;  3MVP A;  1XPX A;  2GA1 A;  1MDM B;  4P5O A;  4UVA A;  2IBD A;  4BE0 A;  1R22 A;  2HVS A;  1K61 A;  1HXD A;  5E8G A;  4RAZ A;  5EGO B;  2K9S A;  1VQ6 I;  1W5T A;  3OYD A;  3FK6 A;  2Y0S A;  2BVL A;  2JRM A;  4F7Z A;  2WWY A;  1RNL A;  1UCR A;  1R23 A;  3F8N A;  4A93 J;  1HC8 A;  3HKZ A;  4OWR B;  3H0G J;  3KYD B;  3A1Y A;  1B6A A;  3QYE A;  2AQF A;  5CVR A;  1H8A C;  3M8F A;  2LKS A;  1K7A A;  1QGP A;  4JOM A;  2Z99 A;  1K6O A;  3AFH A;  3CJN A;  4XOR A;  2X6Y A;  3FDY A;  4RLQ A;  3HB9 A;  1W4M A;  4N9H A;  1B4A A;  4V2G A;  2Z3Y A;  4C2T A;  2ECC A;  3W2A A;  1JUP A;  3TQN A;  2EBI A;  4DBQ A;  2EZH A;  4BY1 J;  3LSR A;  4BH9 A;  1MKM A;  4A5N A;  3IKT A;  4ESJ A;  2DOD A;  1G6N A;  1IF1 A;  3HRS A;  2A07 F;  2HZT A;  3LQQ A;  3AG1 H;  1N78 A;  1LKX A;  3E6B A;  2IAI A;  1FY7 A;  2QUF A;  2M3A A;  4DZJ A;  3I55 I;  1A5J A;  4IRH A;  2OAZ A;  3J81 K;  1T0F A;  1YQA A;  4I0B A;  1P6R A;  2LRD A;  3L2V A;  3GUD A;  4B47 A;  3CES A;  2M0M A;  5E3N A;  4BE2 A;  4II3 A;  2F5C A;  3IKV A;  3HSF A;  3LSI A;  2RV8 A;  2WAF A;  2K3P A;  1XGO A;  1S7A A;  1IV8 A;  5E20 A;  2NS7 A;  2IGN A;  4L9T A;  1REP C;  4OMY A;  4DGW B;  2EFQ A;  4ENK A;  4H4K C;  4II2 A;  4S05 A;  4BDY A;  2IGK A;  4UY8 I;  4L5E A;  1BI3 A;  5K7Z A;  2LKP A;  2HVR A;  4C30 A;  2QSG X;  2BVM A;  3LFU A;  2LMD A;  5FLM J;  4A6D A;  5DDG A;  5K5R A;  2EB7 A;  2GIV A;  3I5U A;  3TW7 A;  1TT5 B;  1J59 A;  4G7Z F;  2BXZ A;  3SXY A;  2K85 A;  4XR6 A;  5J3L A;  2XC7 A;  2R7R A;  3AL0 B;  3HJE A;  2NVQ J;  3LMM A;  4QSH A;  2H8R A;  1U5T C;  3JSO A;  2Z2S B;  4HX4 A;  3KZI C;  1WRJ A;  3RCO A;  1TTY A;  1Z1D A;  2PJR B;  2QBY A;  4L9N A;  4LLL A;  2WB1 N;  1BIA A;  2OA4 A;  2IS6 A;  1ZLJ A;  1IUF A;  3TO7 A;  4YEJ A;  2MAB A;  5AON A;  2L01 A;  3WTU C;  3CLQ A;  2V1X A;  1H9T A;  3WTZ A;  2K9N A;  3H3Z A;  2LRE A;  3FIW A;  1GDT A;  4C2U A;  3JTH A;  4MO7 A;  3WE3 A;  1AU7 A;  2DLL A;  3JR9 A;  5KHD A;  1XMA A;  3D5L A;  4XRF A;  2ZME B;  3MMY B;  2L4A A;  1LFU P;  4S0H B;  2OC6 A;  1WHU A;  4AD9 A;  5GPC A;  4RA2 A;  5D8L B;  3Q9V A;  2JJ7 A;  2KRF A;  1UJ8 A;  1NHA A;  3BOQ A;  3S14 J;  5M5Y J;  2A5Y B;  3LSH A;  1EF4 A;  5DCF A;  3OS2 A;  4M6Y A;  5LGT A;  3D1N I;  1O7F A;  4WCG A;  3FMR A;  2EZL A;  2P5K A;  5DYM A;  2CW7 A;  2FML A;  1M1E B;  2XGX A;  2VB6 A;  1LUJ B;  3ZR8 X;  3OYF A;  3HOW J;  4EM2 A;  1J9I A;  4BBS J;  1BN5 A;  3E7L A;  1YIT I;  2DN0 A;  3OY9 A;  5D5V B;  2AS5 F;  5HS7 A;  2CJJ A;  1Z0X A;  3C18 A;  3LQR A;  4N4O B;  4UVB A;  5L3D A;  5LHH A;  2EK5 A;  2Q0O A;  4RB0 A;  1FOW A;  3MKL A;  5F6F A;  1WI3 A;  1T33 A;  3IC7 A;  1B59 A;  3WGG A;  2LNB A;  3AAF A;  2KIM A;  4EJT A;  4ABZ A;  3RSN A;  4L5I A;  1D8K A;  5ICE A;  4KIC A;  2GXB A;  4KMF A;  2G7H A;  4U7B A;  3V7S A;  3LAJ A;  3BG3 A;  2QLZ A;  4F3Q A;  1JGG A;  5L3E A;  4AUX A;  2X85 A;  1JT6 A;  3AG3 H;  5DUI A;  3WE2 A;  3CQZ J;  2MSY A;  2DCE A;  3E5Q A;  1U8B A;  3P9I A;  2R3S A;  4CCO A;  3AG4 H;  2KMU A;  1ZAR A;  3FXL A;  4LLG F;  2FMY A;  4Y17 A;  3H1C A;  2QGU A;  4A0Y A;  4HV5 A;  4AIK A;  1KYZ A;  1X19 A;  3ABK H;  4U7D A;  3MFK A;  4LD5 A;  1PJR A;  3CJQ B;  1VI0 A;  1B9N A;  3KP4 A;  1PUF B;  1MH3 A;  1FWZ A;  3IWF A;  1K4S A;  1GT0 C;  5F04 A;  1RKW A;  1ZQ3 P;  4XMY A;  5HNF A;  2GZW A;  1X3W B;  2MC4 A;  2DW4 A;  5IOZ A;  2IT0 A;  4D7M A;  3CMY A;  1D1C A;  4M74 A;  2E2J J;  5A2Q K;  3GME A;  3J81 Z;  2EIJ H;  2JSC A;  2Z1D A;  4IQ4 A;  1XG1 A;  2RN7 A;  2QVO A;  3CMM A;  2EIL H;  2HQR A;  1I39 A;  1LFB A;  3FXK A;  4S04 A;  5LGU A;  4I7H A;  2P4W A;  3Q3S A;  2HTJ A;  2XRO A;  3SJM A;  3OSG A;  1ZYR F;  3T8R A;  2CQN A;  5J40 A;  4BQQ A;  2E1M C;  2G7U A;  1LVA A;  1MZB A;  2K4B A;  1B72 B;  4Y33 A;  1MSF C;  3K70 D;  4BY7 J;  2F4I A;  2I5U A;  3N05 A;  3FIS A;  3FM3 A;  2ISY A;  3I4P A;  1QHH D;  3SDG A;  2FQ3 A;  3KEO A;  1IGN A;  2R7S A;  1SMY F;  2XRL A;  1IDY A;  2J5P A;  3VEP A;  2L5Q A;  2V6C A;  1Y6I A;  2HQA A;  2L7K A;  3OIO A;  4HQE A;  3I4M J;  2KIF A;  1H88 C;  2P8T A;  1Y1V J;  1UG2 A;  1K6Y A;  3QOD A;  3IRR A;  3OYJ A;  4ZDO A;  2ELJ A;  3ML6 A;  2MBF A;  5D4S A;  5M5X J;  1O3R A;  3WTW C;  3EUH A;  3CCR I;  4A5M A;  4PJM A;  1JXS A;  1Z05 A;  2WBM A;  1BL0 A;  3O3K A;  1IRG A;  5KCM A;  3BCA A;  2D45 A;  2LLK A;  2FX0 A;  3B6A A;  3U9G A;  1JJ6 C;  3GVA A;  2R5Y B;  2RNG A;  1GVD A;  3KEY A; 
#chains in the Genus database with same CATH homology
 1ZN2 A;  3BPV A;  4PGH A;  5KVR A;  3E97 A;  4YIF A;  2COM A;  2DO7 A;  1LDJ A;  1FP2 A;  1UHM A;  1DUX C;  3K1M A;  1OR7 A;  2TDX A;  4LK0 F;  1S8N A;  4M9S A;  4ENN A;  2HYG D;  4WXC A;  3N4M A;  2CW0 F;  2VN2 A;  1ONV A;  1FBQ A;  4LJZ F;  1MGT A;  4ZZD A;  1U6G A;  4P96 A;  4KN4 X;  3GEZ A;  2Y0M A;  2XAQ A;  5IT3 A;  3HRU A;  4ZYD A;  4QLC U;  1L0O C;  5L3C A;  2RC4 A;  1F1Z A;  1YLF A;  2K27 A;  3HHH A;  1S7O A;  3F21 A;  5EEH A;  2WTE A;  4FT8 A;  1BI1 A;  4I2O A;  3P7N A;  1W7P B;  3KCC A;  1B9M A;  5AIP A;  4BAY A;  2O03 A;  2E1N A;  3GFM A;  2ZFW A;  1ZHF A;  2FSW A;  1HST A;  1P2F A;  1SD6 A;  2MH2 A;  1RUN A;  2O61 A;  1FBS A;  4KIB A;  2Y75 A;  1O3S A;  3BJ6 A;  3JAM Z;  1KA8 A;  4FX4 A;  2W84 A;  3TO9 A;  2OU2 A;  4LB5 A;  2STW A;  3QP6 A;  4YFN F;  1LEB A;  3I71 A;  2MA3 A;  3EYY A;  4U88 A;  3E6D A;  1J2X A;  1ZRC A;  3JSP A;  3I59 B;  3RI4 A;  2JPB A;  5A2Q Z;  3F8C A;  3HHG A;  4EVI A;  1I5Z A;  1QZY A;  4I02 A;  3HRT A;  1PP7 U;  3EYI A;  1AWC A;  2L02 A;  1MJA A;  5LGN A;  2ZXJ A;  5D6F A;  4KIG A;  3WTT C;  1O7L A;  3ZMV A;  3MZY A;  2V9V A;  2Z9O A;  6PAX A;  1R58 A;  1T6S A;  4PCQ A;  4IHS A;  1RI7 A;  2DK5 A;  2XVC A;  2CFX A;  3ECH A;  3V8J A;  5BMZ A;  3CUQ A;  2JTV A;  3RKX A;  1UST A;  3B73 A;  4RGR A;  3SZP A;  2CYY A;  2M5W A;  4Q5S F;  4DQ2 A;  3RIR A;  3WU0 A;  1EV7 A;  1FNN A;  5L3B A;  2G9W A;  4BHB A;  1FLI A;  1FSE A;  4A6E A;  2XAH A;  2M8E A;  2Q2E A;  2QEN A;  2HFH A;  1F5T A;  3KLO A;  3FXQ A;  4MTD A;  2LSO A;  2DI3 A;  3GWZ A;  3N97 A;  2FU4 A;  2PN6 A;  4LLN A;  1ZG1 A;  1K78 B;  3PFI A;  1B1B A;  4G7O F;  2EV0 A;  4ON0 A;  4HV6 A;  1X3U A;  5LRS A;  5E18 F;  2FEZ A;  1ZG3 A;  4YG2 F;  3Q9S A;  1ON2 A;  3CO6 C;  2EFW A;  3E5U A;  2P6S A;  4RGU A;  1YG2 A;  4OIN F;  3GFJ A;  4IHT A;  3K69 A;  4P55 A;  1UHW A;  2O0Y A;  1BIB A;  1JGS A;  3WG9 A;  1KU2 A;  2A6H F;  1FOK A;  4YFK F;  3SZT A;  1TQP A;  3TGN A;  3F72 A;  1CGP A;  3ROU A;  1P4W A;  1XDS A;  3IWZ A;  5ERI A;  5HVQ C;  4LGW A;  4Q48 A;  2QM3 A;  3KP7 A;  3VFZ A;  3F3X A;  1IRF A;  2IVM A;  4O3M A;  4LK1 F;  3E5X A;  3MAJ A;  1R7J A;  4LFU A;  4OIP F;  5IT9 K;  2IA0 A;  4UNO A;  1QQI A;  4BXU A;  3M7G A;  3CO7 C;  3ULQ B;  3WTY C;  2LF8 A;  1XCB A;  3W6J B;  3L09 A;  5DUK A;  2D1H A;  5FD5 A;  4UV9 A;  1BI0 A;  4I01 A;  1R5G A;  3QRF F;  1Z6R A;  4M9Z A;  2K4J A;  2NS0 A;  3IRQ A;  4WWC A;  3GO5 A;  3WTS C;  4WK8 F;  1L3L A;  2B0L A;  2JPC A;  2VON A;  3M8E A;  3COA C;  3K9T A;  3H92 A;  5CVV A;  2KJB A;  3FMS A;  2PFB A;  3MWM A;  1J5Y A;  1OYI A;  3ZMT A;  3FXR A;  3GFI A;  1V3F A;  1YW8 A;  4HX8 A;  1DPR A;  1G3S A;  4GCV A;  4LG0 B;  4HF2 A;  2EA2 A;  2V79 A;  2NNY A;  1K79 A;  2VOP A;  3KP6 A;  2EV5 A;  4HAM A;  5ICC A;  1T38 A;  1WKM A;  2XKP A;  3K0L A;  2CO5 A;  2E1C A;  1P4X A;  2QQ9 A;  3K1N A;  5JVT A;  2ZCW A;  4HQM A;  1HW2 A;  3CUO A;  2VBZ A;  1GVJ A;  1ZLK A;  1J75 A;  2HGC A;  5BPI A;  4CIC A;  4HW0 A;  1MD0 A;  1TQM A;  1W7P D;  5H20 A;  2K86 A;  4A2U A;  4O6J A;  4EJV A;  2FNP A;  2J5O A;  5JI6 A;  3ZMS A;  1LEA A;  1I6X A;  5FD6 A;  1XGS A;  2OQG A;  1D8J A;  5CLS A;  2MH9 A;  3VOD A;  1A04 A;  1OYY A;  4FHT A;  4HDU A;  4R1H A;  5BQT A;  1TNT A;  3DV8 A;  1T39 A;  1D5V A;  2HDC A;  1Z6T A;  5E1W A;  4OIQ F;  3BY6 A;  3BJO A;  4P9U A;  1U5T B;  3FXU A;  3G3Z A;  2VBX A;  2O6G E;  1P4A A;  2ESH A;  5CVI A;  5J8C A;  3KFW X;  2YX4 A;  1S3J A;  4HLY A;  1SFE A;  1E2X A;  4HF0 A;  3DP7 A;  3QOP A;  3WGH A;  1YO5 C;  1HKQ A;  1MDM A;  4GYG A;  3ERE D;  3I64 A;  1ZAO A;  3U2R A;  2QYO A;  3ZMZ A;  4CGZ A;  1E17 A;  2VOD A;  1BBY A;  1XMK A;  2OZ6 A;  2HR3 A;  3TOB A;  3ZMU A;  2P7V B;  4AVP A;  3R4K A;  1R1T A;  1R1V A;  5LBQ A;  1KQ8 A;  3HYI A;  1KU7 A;  1O3T A;  2VC0 A;  3HOS A;  3K2Z A;  1TNS A;  1BM9 A;  3BRO A;  2E7W A;  4UVC A;  4MTE A;  2K7L A;  1XSD A;  4IRI A;  1FX7 A;  1OMI A;  2YX7 A;  2VE8 A;  1RZ4 A;  2KIU A;  3DKW A;  1FYM A;  4KNY A;  3DPT A;  1QZZ A;  1PUE E;  2MD5 A;  3O6B B;  3BJA A;  3GYH X;  3HSE A;  2OQR A;  2ZNZ A;  1Z91 A;  4JK1 X;  2RGV A;  2IA2 A;  4RB3 C;  1QPM A;  2CGP A;  1USS A;  1FC3 A;  1Z9C A;  2X4H A;  3EDP A;  5H6Q A;  2HEO A;  5K5O A;  1U2W A;  2WV0 A;  4M72 A;  4KMU X;  2F2E A;  1Y0U A;  4IF4 A;  4N0B A;  1FYK A;  1CF7 B;  1KU3 A;  2XV4 S;  1FP1 D;  2MLK A;  5HLH A;  4EMS A;  2F5D A;  4GO1 A;  3BPX A;  2ZNY A;  2BBY A;  2ADU A;  2ZME A;  4BNC A;  2VBW A;  3OV8 A;  3L00 A;  4HDV A;  2YU3 A;  1ULY A;  2XRN A;  1V4R A;  3I0T A;  5FFX A;  4XSZ F;  4AIH A;  5ILU A;  4ZZL A;  1DP7 P;  1QNT A;  2Q8K A;  4U0W A;  2YSR A;  1SFU A;  3I53 A;  2W85 A;  1ZG5 A;  5HS8 A;  3B02 A;  4BQA A;  4HYE A;  3E3V A;  3I58 A;  4MQV A;  5F64 A;  3IHU A;  1UFM A;  2BYV E;  1IXC A;  3F6V A;  5DV5 A;  5L3F A;  4HA8 A;  1BJA A;  2MC3 A;  1W5S A;  3HSR A;  1J0R A;  3LAP A;  4B8X A;  2DQL A;  2XKO A;  1KU9 A;  2O3F A;  3LWF A;  4UXN A;  4L5J A;  1ON1 A;  4IPA A;  5AIQ A;  2ZJ2 A;  3CUQ C;  2PI0 A;  3V7C A;  2RVC A;  5ICG A;  3J7A O;  1ZRD A;  1BC7 C;  2PBI A;  2LDU A;  1VTN C;  1CF7 A;  3PQK A;  2PMH A;  1YIO A;  2EFN A;  3REO A;  4WXH A;  4MEX F;  4NB5 A;  4HOB A;  1QO0 D;  2XAJ A;  2YR2 A;  1IXS B;  4AIJ A;  2D1V A;  2DT5 A;  2XAS A;  3JW4 A;  4ZYH A;  4KA4 A;  5LEK A;  2ESN A;  1S29 A;  4MGR A;  1PDN C;  4K2E A;  4CHU A;  1WQ2 A;  1GXQ A;  2IA1 A;  4I0A A;  5LRR A;  3O2P E;  1JHF A;  1U78 A;  3TOA A;  5D5W B;  3SQN A;  3ABU A;  5LHI A;  3GX4 X;  1GHC A;  3WOD F;  1DDN A;  1TW3 A;  2DK8 A;  4WX9 A;  3IL2 A;  2CWE A;  2QWW A;  1EH6 A;  3HUG A;  3L9F A;  3WTV C;  1S6L A;  1BC8 C;  2FOK A;  2V1D A;  1YS7 A;  1H0M A;  3LFK A;  2IPQ X;  3MEX A;  2ZBK A;  3P9C A;  4LB6 B;  2DFI A;  2XAG A;  2UXX A;  5D8K B;  3G73 A;  4XLN F;  5FB2 A;  3TDZ C;  1FBU A;  3JTG A;  1R00 A;  4GYI A;  2NYX A;  2DPU A;  3VOE A;  2P7C B;  2ACJ A;  4L18 B;  1W7P A;  4N9I A;  3TDU C;  1O3Q A;  2XHK A;  1BOA A;  2Y48 A;  4HX7 A;  2CSO A;  2VT3 A;  4KN7 X;  3TO6 A;  1EH7 A;  4BYY A;  5FFZ A;  1EH8 A;  3C3W A;  1TW2 A;  3KP3 A;  2Z33 A;  3DPL C;  4D0P A;  4YFX F;  2QQB A;  4JQF A;  4ASN A;  2A68 F;  3QP5 A;  5KK1 A;  3R61 A;  1MJB A;  1FT9 A;  1XDU A;  3TKY A;  1ZRE A;  3ZPL A;  3HTU A;  2ELH A;  2BGC A;  2FRH A;  3I59 A;  3DFG A;  2P6T A;  4I98 B;  4CZZ A;  2QQA A;  5DD8 A;  1G3T A;  2RKH A;  2XUB A;  1FYL A;  3ZQ7 A;  4HZF A;  4KDP A;  5JHU A;  1H9G A;  3LA2 A;  4BHP A;  4MEY F;  1BI2 A;  2OBP A;  5BPD A;  2DBB A;  3GLX A;  4DNC A;  3PQJ A;  4MHG A;  4A0Z A;  4KFC A;  3MZH A;  3V7R A;  3EQL F;  1HQC A;  3C1D A;  3QPT A;  4XSX F;  1SMT A;  2BEO A;  1IAW A;  4G8X A;  1HW1 A;  3KZY A;  3KP2 A;  5D6E A;  5J8F A;  1GXP A;  4EM1 A;  3F8M A;  1XD7 A;  3ELK A;  2BE5 F;  1ZRF A;  3ZN0 A;  1LDD A;  3SFZ A;  2QBY B;  5E8I A;  2HWV A;  1OYW A;  1KYW A;  1XGN A;  3CTA A;  1K78 A;  2OD5 A;  1D3Y A;  2VOO A;  2E7X A;  1T2K A;  5LEJ A;  2HOE A;  3W6K B;  5FLX K;  2DPD A;  3E6C C;  5ED4 A;  2HKO A;  2H94 A;  2FA5 A;  4G6D A;  4OIR F;  2RQP A;  2GWR A;  1ZH5 A;  2RDP A;  5L3G A;  3ISP A;  1P92 A;  4Z2Y A;  5E17 F;  1IN8 A;  2YPR A;  2A3S A;  2DAO A;  2HKX A;  3WGI A;  1I27 A;  5DCM B;  2FE3 A;  2EV6 A;  4WF2 A;  4UV8 A;  3FWE A;  4CYD A;  1IN4 A;  1KQ0 A;  4EGY A;  1UB9 A;  5JFR A;  2HYF A;  5HLG A;  4EGZ A;  3RPU A;  4XBF A;  4EV0 A;  2IW5 A;  2EWN A;  2QZ8 A;  2Z5U A;  5ILS A;  4OU0 A;  2JT1 A;  3L7W A;  2ISZ A;  2STT A;  3RJP A;  1F4K A;  3LST A;  4ESF A;  1G3Y A;  5HOO A;  4BHC A;  4OMZ A;  3F23 A;  4IVN A;  1ZGJ A;  5K5Q A;  3KLN A;  1IN6 A;  1QBJ A;  4CO8 A;  2P5L C;  3LA3 A;  3R0A A;  2PLY A;  2ZKZ A;  4Q47 A;  2M1B A;  4ESB A;  2OZU A;  2PMU A;  5IT9 Z;  3T1B A;  2DQR A;  2F5F A;  4ZH4 F;  4O5V A;  1U8R A;  5LHG A;  3D0S A;  1IN5 A;  1YW9 A;  1LNW A;  3RYP A;  1YS6 A;  3C7J A;  2NRA C;  2GQQ A;  2L4M A;  4LG0 A;  4G6Q A;  2LF7 A;  3WU1 B;  1JE8 A;  5D5U B;  4HF1 A;  3F6O A;  2AXL A;  5J6X A;  1YYV A;  4PDK A;  4G94 A;  5DCM A;  5FO5 A;  2GAU A;  2EFP A;  3H3U A;  4U0V A;  2FXA A;  1Z7U A;  2F5E A;  5D5X B;  4KT5 C;  3KEQ A;  4ENM A;  4L9V A;  4RAY A;  5ILV A;  2EJR A;  5E1X A;  4M9X A;  1WI9 A;  4QWQ A;  5D4R A;  3GZ5 A;  2GA2 A;  4KYW A;  4IJA A;  4U0Y A;  1HKT A;  3RKY A;  3RPQ A;  5FLX Z;  4WXD A;  1DPU A;  4ETS A;  1SD5 A;  2W25 A;  1PP8 F;  3DQV C;  4L9J A;  2JRT A;  5HDK A;  1F9N A;  1R5H A;  2JZY A;  4TV7 A;  2VE9 A;  3QPH A;  1U5T A;  2FF4 A;  4L0Y B;  4XLP F;  1SD7 A;  3JAM K;  2DU9 A;  2XIG A;  1HSJ A;  1OKR A;  1R36 A;  3M1E A;  4EJO A;  2NAZ A;  2IRF G;  1IN7 A;  3S2W A;  3DF8 A;  3FZV A;  3R0J A;  3EET A;  3LA7 A;  4RS8 A;  3L2C A;  3OOP A;  4ZYG A;  4RB1 A;  1WWX A;  3MQ0 A;  3F8B A;  3RDI A;  4Y15 A;  4GXO A;  4A12 A;  3M9A A;  5FGM A;  4EM0 B;  4KIF A;  1HBX G;  3FM5 A;  2IJL A;  1G4D A;  1TLH B;  4NQW A;  2A69 F;  1IXR C;  4RGX A;  2H27 A;  4EJW A;  5CVU A;  1MJ9 A;  1R1U A;  4EJU A;  1O57 A;  2CG4 A;  2RNJ A;  1SAX A;  1IW7 F;  1T98 A;  3QAH A;  1XB4 A;  3T0Y A;  1KGS A;  1XGM A;  3R60 A;  4LMY A;  3GW2 A;  1HKS A;  3CLO A;  5CVJ A;  3MCZ A;  2XAF A;  1RIO H;  3ZMD A;  1TBX A;  1SFX A;  3CUQ B;  4YII A;  1U3E M;  2GXG A;  3FHZ A;  3GZ6 A;  1G3W A;  3VB2 A;  4AWX B;  2UZK A;  2UXN A;  4RGS A;  4M6X A;  1IUY A;  5CYV A;  2L54 A;  4Y13 A;  1LDK B;  2A61 A;  3FMQ A;  1XCV A;  5EEG A;  3BDD A;  3BP8 A;  2NNN A;  1I1S A;  2R7F A;  3GF2 A;  1AOY A;  4EQQ A;  2ZO4 A;  3K1P A;  4G7H F;  1TQI A;  1LJ9 A;  5HS9 A;  2EA4 A;  1XSV A;  4PGG A;  2H6B A;  2PG4 A;  2M45 A;  4G9Y A;  3ZP5 A;  3ABT A;  4UHT A;  5DD4 A;  3J80 K;  3ECO A;  2VXZ A;  2HS5 A;  4MQ9 F;  3HTS B;  3V4G A;  1ZGA A;  4Q4Z F;  2FNA A;  3F8F A;  2C6Y A;  5JR3 A;  2VT2 A;  4HBL A;  4H0E A;  3T5X A;  4RB2 C;  2KKO A;  1WSU A;  4ENJ A;  3QU6 A;  2PEX A;  4OOI A;  2H6C A;  2BV6 A;  5CJ9 A;  2VBY A;  3KZZ A;  3HRM A;  2A6E F;  2PQ8 A;  3RYR A;  4PZJ A;  2EFO A;  4GGG A;  2H09 A;  3RTR A;  1JHH A;  1I1G A;  2W24 A;  4NHJ A;  1IZ1 A;  5HDN A;  5H6R A;  1OPC A;  4B09 A;  3I54 A;  3FF5 A;  4MNU A;  5E1Z B;  1RUO A;  3P9K A;  3CDH A;  1Q1H A;  5ICF A;  3F22 A;  1YW7 A;  4FX0 A;  2ETH A;  3ZN1 A;  2VC1 A;  5HDG A;  5BS6 A;  3R6S A;  4IRG A;  2HQN A;  3DEU A;  5DEQ A;  1C0W A;  2M30 A;  2R7D A;  4A0X A;  3NQO A;  4L0Z B;  2K02 A;  2X0L A;  1HW5 A;  1FPQ A;  2PJP A;  3V8K A;  4HLX A;  3BWG A;  4R79 A;  1STZ A;  2CQK A;  1ODD A;  2O8X A;  3KE2 A;  1LB2 A;  2IP2 A;  2KJC A;  2FBK A;  3NRV A;  4M71 A;  4R8H A;  5LLQ A;  4M73 A;  4ZYE A;  3GFL A;  1YFH A;  2HTS A;  3HOT A;  2FBI A;  3KET A;  3QU3 A;  3DXJ F;  1YTY A;  3KP5 A;  3BZ6 A;  1LQ1 A;  3T8T A;  3WTX C;  3SHF A;  4P9F A;  5TRD A;  1FZP B;  2V1U A;  2MLG A;  3HIF A;  2D2W A;  2DTR A;  5HLI A;  4KUM A;  4CDG A;  1SD4 A;  3GXO A;  1XSX A;  4IXA A;  4E70 A;  2WC2 A;  3FX3 A;  5F1R A;  5BOX A;  2UWM A;  1KQ9 A;  4OIO F;  3NEU A;  2L3D A;  3Q5F A;  3J80 Z;  4JBA A;  5K1Y A;  3V8L A;  1J7K A;  2P5V A;  4I09 A;  3E6M A;  3U1D A;  2M87 A;  4UUV A;  1XN7 A;  3RKW A;  4CXF A;  1FSH A;  2FBH A;  2W57 A;  5TJJ A;  2GA1 A;  1MDM B;  4P5O A;  4UVA A;  1R22 A;  1HXD A;  5E8G A;  4RAZ A;  1W5T A;  4F7Z A;  2WWY A;  1RNL A;  1UCR A;  1R23 A;  3F8N A;  1B6A A;  5CVR A;  3M8F A;  1K7A A;  1QGP A;  2Z99 A;  1K6O A;  3CJN A;  4N9H A;  1W4M A;  1B4A A;  2Z3Y A;  3TQN A;  4BH9 A;  1MKM A;  4A5N A;  3IKT A;  4ESJ A;  1G6N A;  1IF1 A;  3HRS A;  2A07 F;  2HZT A;  3LQQ A;  3E6B A;  2QUF A;  1FY7 A;  4IRH A;  2OAZ A;  3J81 K;  1T0F A;  1YQA A;  4I0B A;  1P6R A;  3GUD A;  2F5C A;  3IKV A;  3HSF A;  2RV8 A;  1XGO A;  1S7A A;  5E20 A;  4L9T A;  1REP C;  4OMY A;  2EFQ A;  4ENK A;  4S05 A;  1BI3 A;  2LKP A;  4A6D A;  5DDG A;  5K5R A;  2EB7 A;  2GIV A;  3I5U A;  1J59 A;  4G7Z F;  3SXY A;  1U5T C;  3JSO A;  4HX4 A;  1WRJ A;  1TTY A;  1Z1D A;  2QBY A;  4L9N A;  4LLL A;  1BIA A;  2OA4 A;  1ZLJ A;  3TO7 A;  5AON A;  2L01 A;  3WTU C;  2V1X A;  1H9T A;  3WTZ A;  3H3Z A;  3JTH A;  3WE3 A;  2DLL A;  1XMA A;  3D5L A;  4XRF A;  2ZME B;  2L4A A;  4AD9 A;  5D8L B;  3Q9V A;  2KRF A;  1NHA A;  3BOQ A;  2A5Y B;  5DCF A;  4M6Y A;  5LGT A;  1O7F A;  4WCG A;  3FMR A;  2P5K A;  5DYM A;  2XGX A;  2FML A;  4EM2 A;  1J9I A;  1BN5 A;  5D5V B;  2AS5 F;  5HS7 A;  3C18 A;  3LQR A;  4UVB A;  5L3D A;  5LHH A;  2EK5 A;  2Q0O A;  4RB0 A;  5F6F A;  3IC7 A;  1B59 A;  3WGG A;  2LNB A;  3AAF A;  2KIM A;  4EJT A;  5ICE A;  4L5I A;  1D8K A;  4KIC A;  2GXB A;  4KMF A;  2G7H A;  4U7B A;  3V7S A;  3LAJ A;  2QLZ A;  5L3E A;  5DUI A;  3WE2 A;  3E5Q A;  3P9I A;  2R3S A;  1ZAR A;  4LLG F;  2FMY A;  4Y17 A;  4A0Y A;  4HV5 A;  4AIK A;  1KYZ A;  4U7D A;  3MFK A;  4LD5 A;  1B9N A;  3KP4 A;  1FWZ A;  3IWF A;  2GZW A;  2DW4 A;  2IT0 A;  4M74 A;  5A2Q K;  3J81 Z;  2JSC A;  2RN7 A;  2QVO A;  4S04 A;  2HQR A;  5LGU A;  4I7H A;  2P4W A;  2HTJ A;  2XRO A;  1ZYR F;  3T8R A;  2G7U A;  2K4B A;  1LVA A;  1MZB A;  3FM3 A;  2ISY A;  3I4P A;  2FQ3 A;  3KEO A;  1SMY F;  2J5P A;  3VEP A;  2V6C A;  4HQE A;  2KIF A;  2P8T A;  3IRR A;  3ML6 A;  2MBF A;  5D4S A;  1O3R A;  3WTW C;  3EUH A;  1JXS A;  4A5M A;  1Z05 A;  3O3K A;  1IRG A;  2D45 A;  3U9G A;  3GVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...