5HS8A

Crystal structure of the diamide-treated yodb from b. subtilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
b'HMMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator YodB
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs8A00
2F5CA 1RUOA 2CG4A 2OAZA 2XIGA 1ZREA 1HKQA 4LB6B 5JI6A 3ZN0A 2F5FA 1R36A 2PEXA 1MJ9A 3DPLC 1IXCA 1F4KA 4XLNF 1B9MA 4U7BA 2F5DA 1S29A 1F9NA 2RN7A 4B09A 2K86A 2YPRA 1ZG1A 4DQ2A 4NQWA 3BY6A 3F6VA 4ESJA 3IKVA 1IXRC 3M9AA 4G6DA 1YFHA 3HTUA 4KN4X 5D5XB 2Z5UA 1R5GA 3K1MA 1ZG5A 3H92A 1XGSA 4ZZDA 4RAZA 3KCCA 4FT8A 4I0BA 5ILVA 3T1BA 4Q4ZF 3QP6A 2DW4A 1RI7A 4RAYA 1MDMB 1KGSA 1Q1HA 3CUOA 3ROUA 4BYYA 4L5IA 2RVCA 2VT3A 5DYMA 1C0WA 1KQ9A 1FT9A 2A3SA 3D0SA 5EEGA 2VT2A 3KE2A 2EFWA 2D45A 2DQRA 5L3CA 3RJPA 4LD5A 2A6EF 5ERIA 1SMTA 4U7DA 3K2ZA 3L9FA 1IXSB 4LLLA 3SZTA 4CICA 1ON1A 1R00A 2W24A 2STWA 1JE8A 1XCVA 2MD5A 3K69A 2CSOA 3HTSB 3IRQA 2IA2A 4ESBA 2ACJA 5J8CA 4KYWA 2QQBA 3P9CA 5E8IA 1U5TB 2OQGA 3RKYA 4R8HA 4Y15A 3M7GA 3WE3A 2M87A 3QOPA 2K02A 3F21A 2H09A 1FBQA 3G3ZA 1EH8A 2Q8KA 3U2RA 1TQPA 1G3WA 3QAHA 3TO6A 2EB7A 4I2OA 1XGMA 3E5QA 5CVVA 2HFHA 5DUKA 4YFNF 1WSUA 1GXPA 1MGTA 1EH7A 4AIHA 3VB2A 2QWWA 1S7AA 1LJ9A 3WG9A 1ZLKA 2XRNA 4M72A 5LGTA 2E7XA 2OZ6A 4KA4A 1K78A 1J0RA 2W57A 2K4BA 4RGXA 4OIRF 2B0LA 4EMSA 3HYIA 1USSA 4UVCA 1TQMA 1YIOA 2OQRA 1K7AA 3IHUA 3NQOA 1YG2A 3P7NA 3F23A 4PGHA 5E1WA 2MLGA 2VBZA 3IRRA 3QU3A 2NRAC 4Q5SF 1R22A 3MCZA 2O03A 3LAJA 2O3FA 2VE9A 1UB9A 2PFBA 2XKPA 2FBIA 3HOTA 1KU3A 2R7DA 1X3UA 4M9ZA 2QQ9A 4RB2C 1MKMA 3GEZA 2LDUA 5AONA 1EH6A 1P4XA 3JSOA 1IN4A 3ZMSA 4XBFA 3WTTC 5A2QK 4A2UA 3PQKA 1XSVA 1G3TA 3IC7A 1KYWA 3O3KA 4Q47A 5L3GA 2Z3YA 3TDZC 4KNYA 3KFWX 2RV8A 3RKXA 3SHFA 1O57A 1Z05A 1SD5A 1XSXA 3E6CC 4LK0F 1U5TC 2HKOA 1FX7A 3V8KA 4WWCA 2QLZA 4KIBA 1W5TA 2XAGA 3F3XA 3BWGA 3LSTA 4P5OA 1SFUA 1IW7F 4H0EA 2GWRA 1FWZA 4MEXF 4HX8A 3FMSA 4DNCA 2KIMA 1WRJA 2OD5A 5K5RA 3QP5A 4EV0A 3ML6A 5FLXK 2G7UA 2OA4A 3VEPA 1PP7U 4A5MA 3IWFA 4EJTA 3KP5A 3E6BA 4RGUA 1FSHA 2DU9A 4MTDA 1F5TA 3TOBA 4LLNA 2LKPA 1J5YA 3N97A 4RB1A 2H6CA 1RUNA 4A12A 1LB2A 5IT3A 2VBWA 1LDJA 1GHCA 1OR7A 3ABTA 3NEUA 2FE3A 2LSOA 3E5XA 4P55A 4N9IA 5D8LB 4LGWA 4NHJA 3LFKA 4IXAA 1W4MA 2FXAA 3EYYA 2HZTA 2PBIA 2NYXA 1G3YA 1Z6RA 2XAQA 1FYMA 2KKOA 3GFJA 2NNNA 3RKWA 4RB0A 3ZMTA 2ZBKA 2YSRA 4KICA 4Y13A 3GXOA 4OMYA 1IAWA 1K78B 4UUVA 4E70A 2RKHA 2G9WA 5D4RA 1B59A 4S05A 2L4MA 3GZ5A 2L54A 4EGYA 4ZH4F 1D3YA 4I7HA 5D5WB 3LA7A 3EETA 2E7WA 2L4AA 1PUEE 4YIIA 3C18A 1XDSA 3DF8A 3T0YA 2FEZA 1ODDA 1OKRA 5D4SA 2YU3A 3K0LA 3WGIA 4KMFA 1U3EM 4AWXB 2LF8A 1R1UA 5L3FA 3TOAA 1FOKA 1W7PD 3ULQB 2XVCA 3CO6C 1T0FA 4JBAA 3RIRA 4HLXA 2CW0F 5E8GA 2QZ8A 1ZHFA 4N0BA 1LQ1A 1I6XA 2J5OA 1FNNA 1FYLA 2ZMEA 1SD4A 2EFNA 1BC8C 4KIFA 1GXQA 3KEOA 4ETSA 2Y48A 3T5XA 2BV6A 4L9TA 3GO5A 3FM5A 2EFOA 1T38A 3FHZA 1L0OC 2A68F 4I98B 5LEKA 2AXLA 3D5LA 4MEYF 3DKWA 1QZZA 2STTA 1Z1DA 3E6MA 2WV0A 4I02A 5HVQC 2W84A 2OZUA 5FD6A 4PGGA 3RTRA 3F8BA 5HDNA 3LAPA 5L3DA 1GVJA 2WWYA 3LA2A 3MEXA 4YG2F 2JPBA 1FSEA 2P6SA 1FYKA 4K2EA 4OU0A 4U0VA 3V7RA 5ILUA 3J81Z 1R1TA 5IT9K 3MZYA 2ADUA 1Z6TA 2DPDA 4HV6A 1R5HA 1H9GA 2P7VB 4A0YA 2QYOA 1KU9A 1KU2A 3E97A 5D5UB 4I0AA 2KJCA 5F64A 5TJJA 4HLYA 2F5EA 2HYFA 2W25A 1MJBA 5CVIA 1HSJA 1U6GA 3E6DA 1D5VA 4EM1A 2BGCA 2O61A 4U0WA 2JSCA 4IRHA 3GX4X 1BI2A 1ZYRF 3C3WA 4L0YB 4RB3C 1P6RA 3B02A 2PLYA 3QRFF 2DK5A 2UZKA 5BS6A 2V1UA 4EQQA 1IN8A 4OINF 4O3MA 2FOKA 3GLXA 5CLSA 4MQ9F 1XD7A 3JAMZ 2IW5A 1XB4A 5BPIA 4JK1X 4IHTA 2A6HF 3K1NA 1I1SA 5TRDA 4HAMA 5E17F 3H3ZA 4BAYA 1HW5A 4HF0A 3GFLA 3FMQA 3JSPA 4Q48A 1JGSA 3M1EA 2FQ3A 4HBLA 1YLFA 3FX3A 4A0ZA 3SZPA 3WGHA 2DPUA 2XKOA 4OMZA 4EJUA 5D6EA 1T39A 2KIFA 1TNTA 3CTAA 5DUIA 1PDNC 1IRFA 3F22A 5ILSA 2H94A 2E1NA 1IN7A 3G73A 3J80K 2IRFG 5FB2A 4ZYGA 5LHGA 2G7HA 4BH9A 2Q2EA 3BROA 2IA1A 2ZMEB 3WGGA 3WU1B 3WTXC 2XAJA 1TQIA 4EJVA 1O3TA 2EV0A 4EGZA 5DCMA 1P4AA 2QQAA 3O2PE 4M9XA 1BJAA 3V7SA 5AIQA 4ENNA 3GF2A 3F8CA 5E20A 2HGCA 2M5WA 2VC1A 1EV7A 2FMYA 1CF7A 1FP2A 2IVMA 2P5KA 4U0YA 3L09A 1B4AA 4EM2A 5ICFA 1HXDA 2L01A 4M9SA 3R61A 3HSFA 4BHPA 3WODF 1IRGA 3T8TA 5J8FA 2YX7A 2BBYA 4ZZLA 1LDDA 1U78A 4G7OF 3I54A 5D6FA 4WX9A 2VN2A 1BN5A 2M8EA 3I53A 1YW9A 5AIPA 2Y0MA 3ECHA 2E1CA 2NAZA 2ZXJA 5CJ9A 3BJAA 3KP3A 3MFKA 2V79A 1F1ZA 4YFXF 2OBPA 2HTSA 2HR3A 1AOYA 3ABUA 3TDUC 2K7LA 4LLGF 5LRSA 1YW7A 4MGRA 4OIPF 1HBXG 3RPUA 2CYYA 4WXHA 4Z2YA 4GGGA 1D8JA 5L3BA 3P9KA 5HS9A 4KFCA 2CFXA 2D1VA 2A61A 4EM0B 2FU4A 4LB5A 2DO7A 1UHMA 3E5UA 2YR2A 2TDXA 5KVRA 3RDIA 3BPVA 4FX0A 2QBYA 1U8RA 2OU2A 4N9HA 5E1ZB 5BPDA 5KK1A 1REPC 2MC3A 3WTSC 2ZFWA 1J9IA 2Q0OA 2KIUA 1MJAA 1R1VA 5K1YA 1ZAOA 4UVBA 1ZN2A 5HS7A 2COMA 2ESHA 1BI1A 5CVUA 2GA1A 4EVIA 2VOPA 1G3SA 4OIQF 1ZARA 3LWFA 1UCRA 2MH9A 2FRHA 3MQ0A 3KZZA 4XSXF 3ZQ7A 2V9VA 5LEJA 4FHTA 3DPTA 4G94A 4HZFA 1MZBA 2GIVA 3JTGA 2EJRA 4HF1A 1YTYA 3BOQA 2HEOA 5FFZA 5HS8A 1SD7A 3R0JA 1OMIA 5DCMB 1G4DA 4KN7X 1XMAA 5ICGA 2W85A 1MD0A 1FBSA 2VXZA 2JPCA 4QWQA 2CWEA 1UHWA 2AS5F 1U2WA 2ISZA 3FWEA 4MTEA 2P8TA 4EJOA 5D5VB 5A2QZ 4KDPA 3WTVC 2PN6A 1HQCA 1LDKB 4AIJA 2O0YA 2MH2A 5K5QA 1BI3A 4PDKA 4S04A 1FY7A 1CF7B 5EEHA 5DD4A 2QM3A 3I58A 2P4WA 3DV8A 1PP8F 2Y75A 3R6SA 4L9JA 1XSDA 5H20A 2DBBA 4ENMA 3ZMVA 4CXFA 1XMKA 2DAOA 1H9TA 2XHKA 3SQNA 1QBJA 1ZH5A 5J6XA 1BM9A 1BBYA 4L0ZB 1TNSA 2KRFA 4IF4A 3F8MA 4WXCA 3TO7A 2K4JA 5FLXZ 2IT0A 3V4GA 2JT1A 1RZ4A 1LEBA 2J5PA 1CGPA 5LGNA 3CJNA 4XSZF 4I09A 1LNWA 1OYYA 5DDGA 5F1RA 3ZMDA 1QO0D 2R7FA 3KP4A 4LFUA 1O7FA 3M8EA 3C7JA 3LQRA 4O5VA 3FXQA 1QZYA 3C1DA 4UXNA 3DXJF 2M45A 2QVOA 4KIGA 4XLPF 5FD5A 5JHUA 3WTWC 4HF2A 1Y0UA 3U9GA 4HX4A 2VODA 2BE5F 4UV9A 1KQ0A 3ELKA 4G8XA 1E17A 1W7PA 1LEAA 3GUDA 1JXSA 4ENKA 3I64A 4ENJA 2MLKA 2QBYB 2UXXA 5DD8A 2P6TA 1OPCA 3DEUA 1YO5C 2ISYA 1ULYA 4ON0A 3TGNA 2P7CB 3GYHX 5E18F 3ZMZA 4CYDA 1R7JA 2L02A 1G6NA 4JQFA 3M8FA 2A69F 3TO9A 4GYIA 1ZRCA 2VBXA 3OV8A 1HW2A 3GW2A 1DDNA 5BQTA 1IUYA 2FNAA 3I59A 2CGPA 1SD6A 4M71A 3BDDA 4M74A 1YQAA 2HQNA 1DPRA 3FXRA 1ZRFA 2ESNA 1ON2A 4WF2A 5HLIA 1S7OA 1QPMA 4P9UA 1IF1A 3RI4A 3I5UA 4AD9A 4ZYDA 3GWZA 3HRTA 1B1BA 3IWZA 3FZVA 3KETA 3BP8A 1YYVA 1Z7UA 5BOXA 4IVNA 4GYGA 3COAC 3KLNA 4U88A 2EWNA 1TW2A 2GZWA 4PZJA 1TW3A 2LF7A 1P4WA 2MBFA 2GA2A 5DEQA 2VC0A 4A5NA 3V8LA 2Z9OA 3J7AO 2HKXA 1SMYF 4FX4A 2O6GE 1XGNA 4R79A 3V7CA 3I71A 2P5VA 3QPTA 4HX7A 3VOEA 5ED4A 1DUXC 3KP6A 4QLCU 2O8XA 4TV7A 2M1BA 3WU0A 5LHHA 1P2FA 4P96A 4RGSA 2H6BA 3DP7A 4A6EA 5FFXA 3O6BB 2V1DA 3E3VA 2PMHA 1LVAA 1HKSA 2X0LA 4A0XA 2PG4A 2XROA 2D2WA 4RS8A 2C6YA 2Z33A 1K79A 1TTYA 3KLOA 4R1HA 5IT9Z 3B73A 2XGXA 3EQLF 2VONA 3V8JA 2ZKZA 4ZYHA 2PMUA 2FF4A 1FLIA 3L00A 1J59A 1KA8A 1XN7A 4KMUX 1K6OA 1IZ1A 3DFGA 1E2XA 3PQJA 5CVJA 1T6SA 4HQEA 2IPQX 1Z91A 4ESFA 5HOOA 1OYWA 4A6DA 4BHBA 5LLQA 4EJWA 2WTEA 2ZO4A 2DK8A 3CO7C 4KUMA 2FMLA 2VBYA 3HHHA 5HDKA 1J75A 3RYPA 1I1GA 2DT5A 4HQMA 1S6LA 2QENA 2EK5A 5L3EA 2ZCWA 1ONVA 1T2KA 3CUQA 4L9VA 1ZGJA 1BI0A 5DCFA 1BC7C 1W7PB 2RGVA 4IHSA 2EA4A 2IP2A 3Q9SA 4WCGA 4IPAA 3CDHA 4CDGA 2DI3A 5F6FA 1Z9CA 1W5SA 5ICEA 2XUBA 3SFZA 3ZN1A 2M30A 3ISPA 2HDCA 3IKTA 2EV6A 4L9NA 2HQRA 4IJAA 2HTJA 1FBUA 3U1DA 2FBKA 3W6JB 4LG0A 5FGMA 2CQKA 1FZPB 1KYZA 1YS7A 2DQLA 1RIOH 3WE2A 2ETHA 2EFPA 2HWVA 3MAJA 3I59B 2FBHA 3PFIA 2UWMA 3LQQA 3K9TA 2PI0A 3N4MA 2A07F 2A5YB 3OOPA 2H27A 4CGZA 2MA3A 4OOIA 4O6JA 3DQVC 2KJBA 2Z99A 3BPXA 4LK1F 3HRMA 1A04A 3RPQA 5H6QA 2UXNA 4CZZA 4CO8A 4WK8F 1XDUA 3I0TA 1P92A 3J80Z 4BHCA 4BNCA 1S8NA 2XAHA 3R4KA 4LJZF 2X4HA 2DFIA 1ZG3A 4HW0A 5FO5A 3TKYA 1SAXA 2ZNYA 1ZRDA 1R58A 4UV8A 3L7WA 3FM3A 3L2CA 2IA0A 1WQ2A 2GXGA 5JR3A 5K5OA 3HOSA 2GAUA 1R23A 2RNJA 3Q5FA 3P9IA 6PAXA 4HOBA 1YW8A 3EYIA 3GVAA 4B8XA 3EUHA 4M6XA 2F2EA 4IRIA 2GQQA 1SFXA 3REOA 3VODA 4ASNA 3ECOA 3HRSA 3IL2A 3Q9VA 4WXDA 4IRGA 4HDVA 4GXOA 4G7ZF 1FPQA 1BIBA 1QNTA 2IJLA 4NB5A 2XASA 2JRTA 2PQ8A 3S2WA 4HDUA 3I4PA 2HS5A 1O3QA 1JHFA 3AAFA 1B9NA 3WTZA 1XCBA 4G9YA 3HSEA 3LA3A 3W6KB 1I5ZA 2FNPA 1S3JA 2XAFA 1YS6A 3CUQB 2ELHA 5LHIA 1V4RA 3R60A 3BJOA 3QU6A 2JZYA 2P5LC 2XV4S 4HYEA 4OIOF 3WTUC 1IN5A 4Y17A 2EV5A 3ZPLA 2V6CA 3H3UA 2RDPA 1IN6A 2GXBA 3JTHA 2BYVE 1WI9A 2DLLA 2D1HA 2EFQA 4UHTA 1FC3A 2EA2A 3HHGA 3FMRA 2JTVA 1O3SA 1HW1A 1STZA 3QPHA 4LG0B 4HA8A 4D0PA 2ZNZA 5HDGA 1DPUA 4I01A 3HRUA 1ZGAA 3RYRA 4YFKF 1D8KA 5CVRA 3KZYA 1J2XA 4ZYEA 1BOAA 3BZ6A 2PJPA 3HSRA 3T8RA 3KEQA 5D8KB 2WC2A 5HLGA 4HV5A 3HUGA 4GO1A 2K27A 3F8FA 2LNBA 1HSTA 1O7LA 3CLOA 1UFMA 2YX4A 4L18B 3F8NA 4AVPA 4YIFA 4MQVA 3ZMUA 3F72A 2BEOA 1TLHB 1SFEA 1BIAA 3BJ6A 2R3SA 1L3LA 1MDMA 1J7KA 1VTNC 5HLHA 1QGPA 2VE8A 3J81K 3MZHA 2CO5A 3VFZA 2V1XA 1FP1D 4F7ZA 3MWMA 4MNUA 4LMYA 1KU7A 4UVAA 3F6OA 4RGRA 2HOEA 3ERED 5DV5A 3FF5A 2VOOA 4XRFA 3ZP5A 2NNYA 4PCQA 4L5JA 3GFMA 5JVTA 4KT5C 2ZJ2A 3TQNA 1KQ8A 1AWCA 1WWXA 3GZ6A 1HKTA 1DP7P 1USTA 1WKMA 2FA5A 3FXUA 3HIFA 4G6QA 3CUQC 3KP2A 2FSWA 3NRVA 2NS0A 1RNLA 4P9FA 1U5TA 2QUFA 4MHGA 5E1XA 2L3DA 1I27A 1B6AA 1V3FA 3WTYC 1XGOA 5LGUA 2RQPA 2DTRA 3KP7A 5LBQA 3JAMK 5JFRA 1NHAA 5ICCA 3JW4A 4UNOA 2HYGD 4CHUA 2RC4A 1ZLJA 1JHHA 3GFIA 4BXUA 5BMZA 1TBXA 5CYVA 5H6RA 1O3RA 1QQIA 3EDPA 4BQAA 1OYIA 4G7HF 4M6YA 3K1PA 1H0MA 5LRRA 1T98A 4M73A 3R0AA 4AIKA 4GCVA 3SXYA
chains in the Genus database with same CATH superfamily
2F5CA 1RUOA 2JJ7A 3A4CA 3O8HA 2CG4A 2ECCA 2OAZA 2JSPA 2XIGA 1ZREA 1HKQA 4LB6B 5JI6A 4LG3A 2NOGA 1A35A 5LFAA 3ZN0A 1OCOH 4B3XA 4KITB 2F5FA 2MFZA 1R36A 2PEXA 4RM2A 1MJ9A 3DPLC 3BG6A 1IXCA 3RSNA 1F4KA 2DA7A 1UHSA 2KMUA 3BQZA 1YOVB 4XLNF 2LFBA 1B9MA 2CW8A 2NS8A 1YJ9I 1EA3A 3CZ6A 2E36A 4U7BA 2PJRB 3IAM2 2V1NA 3A01B 5C3EJ 4NBQA 3FXOA 1JGGA 3K4JA 2F5DA 2GBYA 3MKWB 3C2GA 4UUSB 2VUMJ 1BA5A 1MNDA 1S29A 1F9NA 4KISA 2RN7A 2R92J 4MFEA 4B09A 3RQ4A 2K86A 2YPRA 4D5CA 1ZG1A 2LVSA 4DQ2A 1ZGWA 2JMWA 4NQWA 4CCNA 4M3FA 1X4OA 4E7KA 4FE4A 1RESA 2R7TA 3PJRA 5FLMJ 3V42A 2DYRH 3BY6A 3F6VA 4BGDA 3H35A 4ESJA 2ZB9A 3IKVA 1IXRC 3M9AA 5GPAA 3BTJA 4G6DA 4JP0A 3HTUA 1YFHA 4KN4X 5D5XB 4BE2A 4IHYA 2Z5UA 1R5GA 3K1MA 1ZG5A 3CDLA 4PJ0C 3HUGB 3H92A 1XGSA 4ZZDA 1MBEA 2LC2A 4RAZA 2BOLA 2WAQN 2X6XA 3CCQI 4XN3A 5KAFC 3KCCA 4FT8A 3CCJI 2ZSIB 2OPTA 4I0BA 4A3CJ 2L9SA 2QKLB 5ILVA 3F9KA 3T1BA 4Q4ZF 3QP6A 2DW4A 1RI7A 4RAYA 1MDMB 3ERMA 3EUHC 2GLOA 1KGSA 1Q1HA 2VKEA 2Q1ZB 3OMYA 2B7EA 4FCYA 1X1AA 4XOPA 3CUOA 3CP2A 3BT9A 1Z3XA 5K7HA 2DODA 3ROUA 4BYYA 4L5IA 3S93A 3OR2C 2RVCA 2VT3A 3RCOA 2M34A 5DYMA 1C0WA 3S32A 4Z6YA 2KDOA 1KQ9A 1FT9A 5EEAA 5CQGA 3BR0A 2A3SA 3D0SA 3ZQCA 5EEGA 2VT2A 1OFCX 2XPUA 3KE2A 2EFWA 2D45A 2KIQA 2LKSA 4XQFA 2DQRA 5L3CA 3RJPA 4LD5A 2A6EF 5ERIA 1SMTA 1YX3A 1Z21A 1FOYA 4U7DA 1AKHA 2BY0A 3K2ZA 3L9FA 1IXSB 1T56A 3TMOA 3I4NJ 2VKVA 2Z16A 3BR5A 4LLLA 3SZTA 4CICA 1ON1A 3AG1H 1R00A 2W24A 4E4HA 2STWA 1JE8A 1XCVA 2MD5A 4CSWA 4IX7A 5FKOA 3K69A 4E7SA 2CSOA 3CMAI 4M3GA 3HTSB 3IRQA 2IA2A 3DEWA 4ESBA 1MNEA 2ACJA 3FHNA 2LRDA 5J8CA 2EIJH 4KYWA 2QQBA 2M4KA 3P9CA 5E8IA 1U5TB 2OQGA 3RKYA 4R8HA 4Y15A 3M7GA 3WE3A 2M87A 3QOPA 2K02A 1VQLI 3F21A 2H09A 1FBQA 2DA5A 2DT7B 3G3ZA 1EH8A 2Q8KA 4BUPA 3K4LA 4CYCB 1X3ZB 3B6AA 3U2RA 4ZDPA 1A5JA 1TQPA 2NVTJ 4GRIA 1V55H 3WG7H 1G3WA 3QAHA 4AYBA 3ZR8X 2CUEA 2ICWG 1Y8QB 3TO6A 5FROA 3OYIA 2EB7A 4BDZA 3VYUB 4I2OA 1XGMA 2VPLA 3E5QA 5CVVA 4XICA 3LSRA 2HFHA 1I3QJ 5DUKA 4YFNF 3TP0A 2HI3A 4XL9A 1S9HA 1WSUA 5IP7J 4CA0A 3TW6A 1GXPA 1MGTA 2KLOA 1EH7A 4AIHA 4A3BJ 3PL8A 1X3WB 2ELJA 3VB2A 2QWWA 3FKJA 4MO7A 1S7AA 1R5ID 1LJ9A 2I8DA 5HLTA 3WG9A 4MFDA 4V2FA 1ZLKA 3GTLJ 4DIQA 3W2AA 2XRNA 2CFOA 2ME6A 4M72A 3S3OA 5LGTA 2E7XA 2OZ6A 4KA4A 1ACIA 5IPAA 3TP3A 1K78A 1J0RA 1MW7A 2W57A 1VF9A 2K4BA 2L9NA 4RGXA 2W48A 1ZKGA 4OIRF 2B0LA 2LH9A 5GADJ 4EMSA 3H3VK 3HYIA 1MMNA 2RREA 1FMWA 1USSA 4UVCA 2IBDA 4XLCA 4DYQA 3I56I 1TQMA 1YIOA 2OQRA 3ZQHA 4L5EA 2QA4I 1K7AA 1XG1A 3IHUA 2VJ5A 3NQOA 2KFDA 1A6IA 3RPUD 1YG2A 1UMQA 3P7NA 3F23A 4BACA 4PGHA 1R6RA 4D7MA 2Z2SB 1QPIA 3WU2C 5E1WA 1BOBA 2MLGA 2VBZA 2OF7A 3IRRA 1MIJA 3IH3A 1EF4A 3QU3A 2NRAC 4Q5SF 1R22A 3MCZA 2O03A 4NQWB 2ZC2A 3LAJA 2O3FA 2LKXA 2V6EA 1QVTA 2VE9A 1UB9A 2PFBA 2EH3A 2L7FP 2XKPA 3ZGKA 1WGXA 1QRYA 2FBIA 3HOTA 1KU3A 4Y33A 2R7DA 5TISC 1GUUA 2VQHA 1X3UA 1LE8A 4M9ZA 2QQ9A 2NVXJ 4RB2C 1MKMA 1JJ6C 2K40A 3HPHA 2V9KA 3DBRB 3GEZA 2LDUA 5AONA 4A3FJ 3S15J 4YELA 1EH6A 1DU0A 3HJEA 2MYSA 1QHGA 1P4XA 3JSOA 1IN4A 3PNTA 3ZMSA 4XBFA 2KRCA 1TZLA 4D9JA 2PMZN 3WTTC 1B8IA 1DGWY 4A2UA 5A2QK 3PQKA 3M1CA 1XSVA 1G3TA 2W1OA 3LSHA 3IC7A 3NAUA 3A0BC 1KYWA 3O3KA 4Q47A 3EUKL 5L3GA 2V9PA 2Z3YA 2XAUA 1E3HA 4Y52J 2EQRA 4ITVA 3TDZC 4KNYA 2QSGX 3W6VA 3KFWX 2RV8A 5E3NA 3RKXA 4GFBA 3SHFA 1O57A 3BCBA 1Z05A 2LOOA 5FKKA 1SD5A 1XSXA 3E6CC 1ETKA 1QZEA 4LK0F 1U5TC 2HKOA 2KHMA 3ABLH 1VQ5I 1FX7A 2EINH 4HEA2 3V8KA 4CCOA 4WWCA 1D0ZA 2F5VA 3HDDA 2QLZA 4IHXA 4KIBA 3M07A 1W5TA 2MG4A 2XAGA 3F3XA 2NS7A 2VIXA 3BWGA 3DCFA 3LSTA 2XB0X 4P5OA 5FKMA 1SFUA 4D7NA 2DJNA 1IW7F 4H0EA 3H5RA 3GBGA 2GWRA 2WV1A 1IRXA 1LKXA 1FWZA 4MEXF 4HX8A 3FMSA 4AC0A 1GV2A 1BR2A 2A5WA 4BXFA 2QF7A 3H5NA 2VI6A 4DNCA 4QIWN 2R7QA 2KIMA 1WRJA 2OD5A 3A0HC 5K5RA 4CCJA 3QP5A 4EV0A 3S1RJ 5J47A 2EPFA 3ML6A 5DS9A 1PYVA 1VQOI 1AKHB 5FLXK 3H9JA 2G7UA 2OA4A 3VEPA 1PP7U 4A5MA 2TRTA 3IWFA 3QWLA 2E1MB 3DLAA 3IV5A 3GCMA 4HNUA 4EJTA 2I10A 4P1WA 3KP5A 3E6BA 4XONA 4RGUA 1FSHA 2DU9A 5IYCJ 4MTDA 1F5TA 1E3PA 3TOBA 4LLNA 3K4MA 4HNVA 2LKPA 1J5YA 2LY1A 3N97A 4RB1A 2H6CA 1RUNA 3AG2H 3TL4X 4BQQA 3CF2A 3MN2A 4A12A 4XLEA 1KZHA 1LB2A 5IT3A 2JQ7A 2VBWA 2R7RA 1LDJA 4DGWB 4JOMA 1GHCA 2XB5A 1E0EA 3HOWJ 3I9V2 5GTHC 1OR7A 1WH5A 3ABTA 3NEUA 3ZRGA 1YIJI 1TWGJ 2BZTA 1HF0A 2FE3A 3CCMI 1IJWC 5IOYA 3Q0VA 1R49A 2LSOA 3E5XA 3DBLB 3RZOJ 2JK3A 2OJED 4P55A 3S1QJ 4N9IA 5D8LB 4LGWA 2ZJPF 4CH7A 2MABA 2UV1A 3DWLE 4NHJA 3LFKA 4IXAA 2JA6J 1W4MA 2FXAA 3OY9A 3EYYA 2HZTA 2PBIA 3RKQA 4C2TA 1ZELA 2NYXA 2V7FA 4OWRB 1G3YA 1Z6RA 2XAQA 4RM3A 2B9SA 1FYMA 2KKOA 3GFJA 2R5ZA 1QU3A 2NNNA 3BQYA 5KHDA 3RKWA 3QODA 2DMNA 4RB0A 1R9TJ 1Q1VA 3ZMTA 2DA2A 5FRMA 1T95A 1Y56A 1W1WE 2ZBKA 2YSRA 4KICA 4Y13A 2ZJRF 3GXOA 4OMYA 2X1DA 2XDVA 1IAWA 2H8RA 1K78B 4UUVA 4E70A 2LY2A 2RKHA 2G9WA 3P5JA 5D4RA 1JKRC 1B59A 4S05A 2L4MA 2EZKA 3PFYA 3KYCB 3OWTA 3GZ5A 2L54A 4EGYA 3GTMJ 2IGNA 4ZH4F 2BY2A 1OCPA 1D3YA 4I7HA 2AQEA 3JRCA 2X1CA 3X2QH 3LA7A 3EETA 1WCMJ 5D5WB 4QSHA 2CUJA 2E7WA 2L4AA 1PUEE 1ETOA 4YIIA 5GAEJ 2H1LA 3C18A 2WY7Q 1XDSA 3DF8A 3T0YA 2FEZA 2LTPA 1Y1VJ 1ODDA 1OKRA 5D4SA 3PUFA 2YU3A 3K0LA 4MIMA 3WGIA 1XC5A 3FXLA 1H89C 4KMFA 1U3EM 3VPRA 4AWXB 3LL7A 2BY3A 5M5WJ 1WJDA 2LF8A 1R1UA 2AO9A 3TOAA 5L3FA 1FOKA 1W7PD 5K7FA 3OIPA 1JUSA 3ULQB 2FOWA 2XVCA 2H1KA 3CO6C 2X1EA 4B48A 1T0FA 1OJLA 5JLWA 1LE8B 1MBHA 2DMUA 1OCTC 4JBAA 2ELKA 2VPRA 3CDIA 3RIRA 3MKZA 2K3PA 4EEFG 4HLXA 2CW0F 5FRNA 1IRZA 5E8GA 2QZ8A 1G8XA 1ZHFA 4N0BA 1LQ1A 1W36C 1I6XA 1EKEA 3QYFA 3CLQA 1B8IB 4DBQA 2J5OA 1FNNA 4MLOA 1FYLA 2ZMEA 2HDWA 1UG0A 1SD4A 3AG3H 2EFNA 1BC8C 4KIFA 3S2HJ 4AU7A 1JT6A 2HXIA 3LOCA 1IGNA 1GXQA 4G12A 2E1MC 3KEOA 2Y48A 4ETSA 3T5XA 2BV6A 4L9TA 3GO5A 3FM5A 1NK3P 2EFOA 3H9QA 1T38A 4KT6A 3FHZA 3C2HA 1L0OC 2A68F 4I98B 5LEKA 2AXLA 2R5YA 3D5LA 2JVHA 4MEYF 3DKWA 2DA4A 5HODA 2XGEA 2K9NA 5JHFA 1QZZA 3VSKA 1OQYA 5FKNA 2STTA 1Z1DA 3E6MA 2WV0A 4I02A 5HVQC 2GIZA 2ZXWH 2OZUA 2W84A 3ESWB 5FD6A 1TT5B 5EYRA 4PGGA 2HPIA 4N4NB 3RTRA 2MGQA 3F8BA 5HDNA 3A02A 4I6ZA 3LAPA 1ZR2A 2L7ZA 5L3DA 4JX4A 3BG3A 1NK2P 1SC7A 3PIOF 1GVJA 2WWYA 3LA2A 3MEXA 4YG2F 2JPBA 1O4XA 4F93B 1FSEA 2P6SA 3G71I 1FYKA 3PNYA 4K2EA 4OU0A 4U0VA 3V7RA 5ILUA 3G4SI 4RLQA 3W3CA 3J81Z 1R1TA 4PSWA 5IT9K 3MZYA 2ADUA 1Z6TA 1RR7A 2EZHA 3G1LA 4XNFA 2DPDA 4HV6A 3GTKJ 1R5HA 1H9GA 2P7VB 2YUSA 4A0YA 2QYOA 1KU9A 3JRAA 1KU2A 2JA2A 3E97A 5D5UB 4I0AA 3NWSA 2KJCA 5F64A 5TJJA 3VYSB 4F92B 1GVDA 1W0TA 4HLYA 4AUXA 3BG9A 1APLC 2ZJQF 2F5EA 2JA7J 4F91B 1WZ2A 1YJWI 4IQ4A 3KYDB 2HYFA 2W25A 1MJBA 4FETA 5CVIA 1HSJA 3OL4A 3A1YA 1U6GA 3E6DA 1S72I 3HGYA 4IL6C 1D5VA 3FBIB 4EM1A 1ZTRA 1SFOJ 2BGCA 1I39A 3EPZA 5F1JA 2O61A 4U0WA 5EF6A 2I5UA 2JSCA 3DLLF 4IRHA 3GX4X 1BI2A 1ZYRF 3C3WA 4L0YB 3CD6I 3W2VA 1VQ9I 4RB3C 1P6RA 3B02A 2PLYA 3QPSA 2X85A 3QRFF 5FJ8J 3K7AJ 1WJ5A 2DK5A 2BW3A 2UZKA 1YJNI 5BS6A 4PFPA 1K61A 2V1UA 1TL8A 4EQQA 3OYJA 4C9YA 3JREA 1IN8A 1TWAJ 2L0KA 4OINF 4OAZA 4BEHA 2R5ZB 2CV0A 2GXAA 3CCRI 4W97A 4O3MA 2HDDA 4QPQA 2FOKA 3GLXA 5CLSA 4MQ9F 1XD7A 1FTTA 3GMEA 1XS9A 3JAMZ 1ZK8A 2IW5A 1XB4A 2M7BA 3VSLA 2E1OA 5BPIA 2HZDA 4JK1X 3I3LA 4IHTA 2A6HF 1WH7A 3K1NA 4PJMA 5DTDA 3G2BA 1I1SA 3OIQA 1P7IA 5TRDA 4ZYAA 3K4NA 3G6EI 4HAMA 5E17F 3H3ZA 5IP9J 2NVUB 1U0JA 2Y0SA 5K7ZA 4BAYA 1HW5A 5GAGJ 4HF0A 4LIUA 3GFLA 2CW7A 1RKWA 3QYEA 3PSIA 3FMQA 3JSPA 2H8WA 4Q48A 1JGSA 3TEDA 3IH4A 1JJ8C 5C4XJ 1MH3A 3M1EA 2FQ3A 1JI8A 4HBLA 1YLFA 3FX3A 4A0ZA 4U87A 3SZPA 3WGHA 3BTIA 4DYCA 2LLKA 2DPUA 2AHQA 4XKWA 5CKTA 2E60A 3ZQGA 1P7JA 2XKOA 4UB8C 4OMZA 4BE0A 4EJUA 5D6EA 2JA8J 2DN0A 1T39A 2KIFA 1TNTA 3CTAA 2VXDA 4G6TB 1G2HA 5DUIA 1PDNC 1IRFA 1NTCA 3F22A 5ILSA 2H94A 1MMSA 2E1NA 2CS3A 2K5CA 2W4SA 1IN7A 3G73A 3ZOBA 3J80K 3S14J 2IRFG 2OCCH 5FB2A 4HRIA 4BBRJ 4ZYGA 5LHGA 2G7HA 3HC7A 4BH9A 3DKXA 2DYSH 1N75A 2Q2EA 3BROA 3OSFA 2IA1A 4IEJA 2ZMEB 3WGGA 2KZGA 3FKIJ 4AYBN 3WU1B 4ZJZA 3WTXC 1Z3YA 4RBOA 5HNFA 1BR4A 4JX5A 2XAJA 2KP6A 3BZCA 4RLFA 5F04A 1TQIA 4EJVA 2OCEA 1O3TA 2EV0A 4EGZA 2HXOA 2IXSA 1MBJA 5DCMA 4HSRA 1P4AA 2QQAA 3K70C 2LBFA 3FXJA 3O2PE 4LOCA 2VKDA 4M9XA 5IY5H 1BJAA 2R5YB 3V7SA 2WB1A 4C2MJ 3SDGA 5AIQA 4C3HJ 1RETA 4A3GJ 4PJNA 3H36A 2L2OA 4ENNA 2E34A 3OL3A 1X2MA 1R4MB 2LREA 2QQ8A 5KAIC 3GF2A 4XR6A 3L2VA 1DU6A 3F8CA 2HVRA 4FQGA 1MMGA 5E20A 4F3QA 1PUFA 1OR7C 2HGCA 2M5WA 3HOXJ 3JRGA 3KIOA 2VC1A 2DFHA 1EV7A 2FMYA 1K4SA 2D5VA 3CC7I 3SEZA 4LITA 1CF7A 1FP2A 2IVMA 2P5KA 3CC2I 4U0YA 5EGOA 4C2UA 4I76A 3L09A 1B4AA 4EM2A 1FOXA 5ICFA 2EILH 1HXDA 3D1NI 2L01A 4M9SA 3OYFA 1V5GA 3CJTB 4XMYA 2DFEA 5EJCA 3J7YJ 1RR8C 3R61A 3HSFA 4BHPA 3DEEA 3WODF 3S17J 1IRGA 3T8TA 2F48A 5J8FA 2YX7A 2BBYA 4YEJA 4S0HB 4C3JJ 3HPGA 3H5AA 4B3AA 1LDDA 4ZZLA 1U78A 4IHVA 3CMYA 2HNHA 3S16J 4G7OF 1Y1WJ 1YRNA 3I54A 4W1UA 2CQ7A 2KQRA 5D6FA 1X2NA 4WX9A 1TP4A 1BN5A 2COBA 2M8EA 1Y0NA 2VN2A 3DU5A 3I53A 4XORA 1EJ9A 1YW9A 3OR1C 5AIPA 2Y0MA 4JX6A 3ECHA 2E1CA 2BVLA 3HOVJ 2NAZA 2ZXJA 2R0QC 3CCEI 5CJ9A 1IO2A 2VQLA 3BJAA 3KP3A 3MFKA 1MSFC 2V79A 2XSJC 1F1ZA 4YFXF 2OBPA 4Y4RA 2HTSA 3BR1A 5F27A 2HR3A 1AOYA 3ABUA 2BW3B 2VJJA 1Z7LA 3KPHA 3TDUC 2A6TA 1MBKA 2K7LA 4LLGF 1JUPA 5LRSA 3SZGA 1YW7A 2R7UA 4MGRA 1ENHA 4OIPF 1HBXG 4BEHB 3RPUA 3PUBA 4FE7A 1QVUA 2CYYA 1G59A 3HOUJ 4WXHA 4Z2YA 2QGUA 2KRHA 3E1SA 4GGGA 1LPQA 5L3BA 1D8JA 4QPOA 3P9KA 4AVZA 4CZCA 2DT6A 1VQMI 1T0FC 5HS9A 1XPXA 3K6GA 4JYKA 4KFCA 2CFXA 1B72A 2R7ZJ 2D1VA 2A61A 4EM0B 3DU6A 2FU4A 4LB5A 2DO7A 1UHMA 4DBRA 2DMQA 3E5UA 2YR2A 2TDXA 5KVRA 3RDIA 3BPVA 1BW5A 3GLLA 4FX0A 3LSPA 2ZMEC 2L7MP 4ZC3A 2QBYA 1WJFA 1U8RA 2OU2A 3ASOH 4N9HA 5E1ZB 3WHCA 1LFBA 3SYTA 2K85A 2B63J 5BPDA 2OTJI 2LR8A 2UUZA 1J09A 5KK1A 1DP3A 1REPC 2MC3A 3WTSC 2ZFWA 2R7VA 1X4PA 2Q0OA 1J9IA 3C2BA 2KIUA 1MJAA 1R1VA 5K1YA 1ZAOA 4RMNA 5KNLA 2VB6A 1JKQC 4UVBA 2FX0A 4A3MJ 1ZN2A 5HS7A 2COMA 2ESHA 1BI1A 5CVUA 2GA1A 4EVIA 2VOPA 1G3SA 4OIQF 2HYJA 3LSJA 3FXMA 1ZARA 3FIWA 3LWFA 1UCRA 2MH9A 4CCKA 3MZ8A 2L9RA 1JTXA 1Y6IA 1UAAA 4M3EA 4F52A 2FRHA 3MQ0A 1BR1A 1I6HJ 2FD5A 3KZZA 4XSXF 3ZQ7A 4E7HA 2V9VA 5DM7F 5LEJA 4FHTA 3DPTA 4G94A 4HZFA 2CRGA 1MZBA 2WBMA 3BG7A 2GIVA 1WJAA 3JTGA 2EJRA 1WJEA 3G1MA 4HF1A 3ONQA 1YTYA 2TCTA 2Q2EB 1X1DA 4M3DA 3OS1A 5J3LA 2R7SA 3BOQA 2HEOA 1VQPI 1ORKA 1X58A 2M4GA 3Q0WA 5FFZA 5HS8A 1SD7A 2VKHA 1R71A 2EZIA 1BW6A 3R0JA 3L2RA 1OMIA 1HA8A 5GP9A 5DCMB 1U9NA 1G4DA 1LVKA 2LBFB 2HOTA 4KN7X 1XMAA 2ID3A 5ICGA 2W85A 1MD0A 2F6CA 1FBSA 2KPMA 2VXZA 3HZJA 3OYKA 4ZDOA 2FQ4A 2LYCA 4DW6A 2K9LA 2JPCA 2XC7A 4QWQA 2CWEA 1UHWA 2AS5F 4D1QA 1U2WA 4A3DJ 4XRSA 2K9QA 2ISZA 3IUOA 3FWEA 4MTEA 2P8TA 3JRBA 4UUTA 4EJOA 5D5VB 5A2QZ 4KDPA 2CU7A 1X19A 2DDBA 2PN6A 4BS9A 3WTVC 2DDAA 1YX5A 1HQCA 2CV2A 1LDKB 2VASA 4AIJA 2O0YA 1PUFB 2QKMB 2MH2A 5K5QA 1BI3A 4PDKA 4S04A 5IYDJ 3HKZA 3DKYA 2E2IJ 1FY7A 2O9LA 4XKCA 1VQ7I 2E71A 2IGOA 1XTAA 2IGKA 5EEHA 1CF7B 1RKTA 2WAEA 5DD4A 2QM3A 3MKYB 5EGOB 3I58A 3ZQQA 2P4WA 3DV8A 2RAEA 4A3LJ 1PP8F 1FIAA 3GTOJ 2Y75A 3A03A 3R6SA 3BTCA 3SJMA 4L9JA 1XSDA 5H20A 2M2EA 2DBBA 3JRFA 2WADA 4ENMA 3ZMVA 4CXFA 1XMKA 2LP0A 2DAOA 2CV1A 3CCUI 3K4BA 1H9TA 2L9VA 4NDLA 1SFKA 2XHKA 3S3MA 3SQNA 3Q0UA 1QBJA 1ZH5A 1FOWA 5B1BH 1W0UA 3NWTA 5J6XA 4PJLA 1YRNB 1BM9A 1BBYA 2DTZA 1ZR4A 3OOUA 4L0ZB 1TNSA 4OAYA 2KRFA 1UZCA 3OYGA 1HLVA 4IF4A 1LUJB 3F8MA 4WXCA 3TO7A 2K4JA 5FLXZ 2IT0A 1WHUA 3V4GA 2JT1A 1RZ4A 2LK2A 1LEBA 2J5PA 3L1PA 4IO9F 2JUCA 2VLAA 1CGPA 5LGNA 3CJNA 2AXTC 4XSZF 4I09A 3FK6A 4N4OB 1LNWA 5M5XJ 4M3BA 1OYYA 5DDGA 4RAFA 5F1RA 1MMAA 3L2QA 3FDYA 5J1UA 3OYCA 3ZMDA 1TWCJ 1QO0D 1Y8RB 3OYHA 2R7FA 1MSEC 3KP4A 3LMMA 4LFUA 1O7FA 2HOAA 4J19A 3FK7A 5IOZA 3M8EA 3C7JA 1DQUA 3LQRA 1Z67A 4O5VA 3SDBA 2XGCA 3FXQA 2MW8A 5IP6A 1QZYA 3C1DA 5F0FA 4UXNA 3DXJF 2M45A 2CQNA 2QVOA 4KIGA 4XLPF 4A3KJ 2EZLA 5FD5A 5KCMA 5JHUA 3KEYA 3WTWC 1YHQI 4IHWA 3LSIA 1V54H 4HF2A 5J1YA 1Y0UA 3U9GA 4HX4A 1I50J 4CCMA 1B72B 1OCZH 2VODA 3CMMA 3OYDA 1WI3A 4J01A 2YS9A 2BE5F 1T08B 4UV9A 2VJIA 1KQ0A 3UKGA 3ELKA 4G8XA 5J1RA 1E17A 1W7PA 1LEAA 3GUDA 1JXSA 4ENKA 2CH0A 1GT0C 1AHDP 2GOMA 3I64A 4ENJA 3M4OJ 3PM1A 2MLKA 2QBYB 2UXXA 1UG2A 3D5SC 5JVGF 5DD8A 3OYBA 2P6TA 1OPCA 3DEUA 4D5FA 1YO5C 2ISYA 4CCLA 3HBLA 1ULYA 4ON0A 3TGNA 3WHBA 4IQJA 1K4TA 3N05A 3GTGJ 3OYEA 1XMXA 4F55A 3LNQA 5E3MA 2GOXB 3CQZJ 2P7CB 5J40A 4B4CA 3GYHX 3MMYB 5E18F 3ZMZA 3HOZJ 4CYDA 1R7JA 1MMDA 2L02A 1G6NA 3OS2A 5F0CA 4FASD 4JQFA 4BQOA 3IH2A 3GTJJ 3CCVI 1VQ4I 3M8FA 2A69F 1HOMA 3TO9A 4GYIA 2ZSHB 2M8GX 2VJ4A 2VBXA 4XRSG 3OV8A 4B47A 4E6KG 1ZRCA 2WAFA 1HW2A 4CUGA 2M0CA 3GW2A 1D1BA 3BC8A 1ETQA 1DDNA 2F4IA 4BJTA 5BQTA 4II3A 1IUYA 2FNAA 2ECBA 3I59A 2CGPA 1SD6A 4M6VA 4M71A 3BDDA 3ABMH 4M74A 1YQAA 2HQNA 4XM3A 1DPRA 3FXRA 1ZRFA 1TC3C 2ESNA 1ON2A 2KT0A 3CCYA 4WF2A 1S7OA 5HLIA 1QPMA 4P9UA 1IF1A 3RI4A 3I5UA 4AD9A 4ZYDA 3GWZA 3HRTA 1JKOC 1B1BA 2DMTA 1QHHD 3IWZA 3LFUA 3FZVA 3KETA 3JRDA 1VQNI 1PJRA 3BP8A 2ZXIA 3KX2A 1YYVA 3OSGA 4C30A 4YRVA 1Z7UA 2W82A 5BOXA 4IVNA 5GAHJ 4GYGA 3COAC 3KLNA 1IDYA 4U88A 3W2WA 3GTPJ 1X1BA 2JN6A 2LD5A 4E7ZA 4A3JJ 1FMVA 4XLFA 2EWNA 3AG4H 1TW2A 2GZWA 3DBHB 4PZJA 4A3IJ 1TW3A 3DTIA 2LF7A 1P4WA 2MBFA 2GA2A 5DEQA 2DA6A 2VC0A 4A5NA 3LSGA 3V8LA 1IC8A 2BHYA 2Z9OA 1D5YA 3J7AO 1K6YA 2HKXA 5F0HA 2QCOA 1SMYF 4FX4A 2K3FA 4PUSA 2O6GE 3U1KA 1XGNA 2CQQA 2Y0SN 4R79A 3V7CA 3PIPF 3I71A 2P5VA 3QPTA 4HX7A 3VOEA 5ED4A 1DUXC 3KP6A 2QSFX 4QLCU 4E7JA 4RDUA 4PJJA 2O8XA 4TV7A 2M1BA 3WU0A 5LHHA 1P2FA 4P96A 3IAS2 3OYNA 5EDNA 4RGSA 3GZNB 2H6BA 3DP7A 4LIVA 4A6EA 5FFXA 3O6BB 3HM5A 1UELB 2V1DA 2ME0A 1WJBA 3BR6A 3E3VA 1ITYA 4XIDA 2PMHA 2VL8A 1LVAA 2XPVA 1HKSA 1RC9A 2X0LA 4A0XA 2PG4A 2XROA 1UJ8A 2D2WA 4RAGA 1VI0A 4RS8A 2C6YA 1RPWA 2Z33A 1K79A 2IS1A 1TTYA 3KLOA 1ETXA 4R1HA 3OS0A 2MC4A 3BLYA 5IT9Z 3B73A 2XGXA 3CCSI 3EQLF 2VONA 4B43A 3V8JA 1W36D 2ZKZA 4ZYHA 2PMUA 2FF4A 2Y69H 1FLIA 3BTLA 4BJ5C 3L00A 2JUGA 1VQ8I 1F43A 1J59A 1KA8A 2OV7A 1XN7A 1IUFA 4X6AJ 2WAQA 4KMUX 2X6YA 1K6OA 1IZ1A 4PSXA 4AIDA 1FJLA 1A6QA 4NC6A 3DFGA 3UNGC 1E2XA 3PQJA 5CVJA 1T6SA 4XKVA 4HQEA 2IPQX 1Z91A 4ESFA 1NG7A 5HOOA 1OYWA 4A6DA 4BHBA 5LLQA 2NVYJ 2IAIA 4EJWA 3DTKA 3VYTB 2WTEA 2ZO4A 4H4KC 2FJ1A 5EG0A 2DK8A 2VQGA 3K10A 2OTLI 2M0MA 3CO7C 4DJAA 4KUMA 4E7IA 2FMLA 2VBYA 3ZQFA 3HHHA 4XRMA 2KL4A 3HXLA 5HDKA 4IOCF 1J75A 2BXYA 3RYPA 2CJJA 2WB1N 2IS6A 3K4CA 1I1GA 2DT5A 4HQMA 2O8KA 1S6LA 2QENA 5FKLA 2EK5A 1D0YA 3SFIA 1WJCA 2ZCWA 5L3EA 1ERDA 1ONVA 1T2KA 3CUQA 4L9VA 3H0DA 1ZGJA 1XX5A 2M9HA 5B1AH 1BI0A 5DCFA 1BC7C 4ABZA 1W7PB 2RGVA 2F4OB 2XGDA 4IHSA 2R7XA 2V26A 2EA4A 3FXKA 2IP2A 3Q9SA 4WCGA 4IPAA 3FBNB 3CDHA 2KZVA 4CDGA 2DI3A 4BKXA 1NG6A 4XOTA 5F6FA 2X6OA 1Z9CA 1JKPC 2GM4A 1W5SA 4BU2A 5ICEA 2XUBA 3SFZA 3ZN1A 2P81A 4XKBA 4BY1J 2M30A 3ISPA 3IP4B 1TT0A 2HDCA 3IKTA 5LD2C 4Y3OA 3OYAA 4NUBA 2EV6A 4L9NA 2HQRA 4IJAA 2DOAA 5CQEA 3CC4I 2DMPA 2HTJA 1IG7A 1FBUA 3U1DA 2FBKA 4BY7J 2W7NA 1POGA 3W6JB 4LG0A 2R7OA 5FGMA 2HU9A 2CQKA 2EBIA 4PFOA 1FZPB 1KYZA 2A05A 1YS7A 2DQLA 1RIOH 3WE2A 2ETHA 2HQ5A 2EFPA 5DM6F 1A31A 2HWVA 2V4JC 3MAJA 1VNDA 2LMDA 3I59B 2FBHA 2XPWA 2KDZA 3CF5F 3AL0B 3PFIA 2UWMA 3OYMA 1T8IA 3LQQA 3K9TA 2PI0A 3N4MA 2A07F 2A5YB 3OOPA 2JVGA 2ID6A 1YITI 1SVOA 2JWTA 2H27A 4CGZA 2MA3A 4X1EA 2FUG2 4OOIA 4DZPA 4O6JA 3DQVC 4XK4A 3LSKA 1F36A 2KJBA 2Z99A 3BPXA 4LK1F 4X0GA 3BZKA 1IDZA 4E7LA 3HRMA 1A04A 1IV8A 3RPQA 1R4NB 5H6QA 2OC6A 3S2DJ 2G0EA 2UXNA 4CZZA 1D1CA 3LSMA 1ZQ3P 4CO8A 2E19A 5E3OA 2LG4A 4WK8F 1XDUA 1Z0XA 3I0TA 1P92A 3J80Z 4BHCA 3E0JB 4BNCA 1WFXA 2E5NA 1S8NA 2XAHA 1Z77A 3H1CA 5CPRB 2O7OA 3R4KA 4LJZF 1N78A 2N8GA 2PX9A 3DTEA 3S8PA 2XF7A 3VDXA 1FIPA 1SAUA 2DFIA 2X4HA 3S1NJ 4A93J 1ZG3A 2RNGA 2ZXHA 4B1RA 4HW0A 3BR3A 5H2FC 5FO5A 1LFUP 3TKYA 2XF5A 9ANTA 4UB6C 1BL0A 4NC8A 3U21A 1SAXA 2DFFA 2ZNYA 1ZRDA 1LFPA 2L7KA 4BXXJ 1R58A 1CQTA 4UV8A 4HNTA 2R93J 3L7WA 3FM3A 3L2CA 2E35A 4V19K 1TWHJ 2IA0A 1WQ2A 1N77A 2DA3A 2GXGA 5JR3A 5K5OA 3HOSA 1E3OC 1OISA 1TWFJ 4XLAA 2VQCA 2GAUA 3ZXSA 1R23A 5IYBJ 2RNJA 2WY8Q 1OLTA 2X6WA 1HDPA 3Q5FA 5FLVA 2CUZA 3P9IA 5JLXA 4BQNA 3HB9A 5TGTA 3ABKH 2DA1A 1NH3A 6PAXA 2IS4A 2ZFUA 3RZDJ 4HOBA 1YW8A 4EATA 4UY8I 3EYIA 1VQKI 2EIMH 2IS2A 3GVAA 4B8XA 3EUHA 4M6XA 3CJRB 2F2EA 4IRIA 2GQQA 2NVQJ 1SFXA 3REOA 4BDYA 2JA5J 3TBIA 3VODA 3QPLA 2HQAA 1PVEA 2X48A 2NOJB 5HNHA 4FTHA 3JRHA 1GDTA 3PO2J 3MD2A 5C44J 1HC8A 4ASNA 3ECOA 3HRSA 4A69C 2O5RA 2Z1DA 1HCRA 3IL2A 3Q9VA 2M3AA 4WXDA 3QYBA 1A36A 3QQAA 2DCEA 4IRGA 4HDVA 5M5YJ 3OIOA 2PMZA 5C4JJ 2K9SA 1U8BA 3J7AY 4GXOA 3K4KA 3DPUA 4G7ZF 2K9MA 1X1CA 1FPQA 1DGRM 1BIBA 3HG9A 1QNTA 2IJLA 4NB5A 3A2KA 3K70D 5EG0B 2XASA 2DOEA 1JUMA 2JRTA 2PQ8A 3S2WA 4NNJA 4HDUA 1KONA 4ZTJA 1WVRA 3I4PA 2MD0A 1V5FA 3GTQJ 2HS5A 2RQQA 1O3QA 1JHFA 1GLNA 3AAFA 1B9NA 3WTZA 3H9GA 1XCBA 4G9YA 3HSEA 3LA3A 3W6KB 1I5ZA 3UR3C 2FNPA 3CESA 3KYLA 2QSHX 1S3JA 2HOSA 2XAFA 1YS6A 3NARA 1X1PA 3CUQB 3AL0C 4B44A 5B5EC 1N25A 1T33A 2ELHA 1RRJA 3JR9A 1D0XA 5LHIA 1V4RA 3HEFA 3R60A 1JT0A 3BJOA 3QU6A 2JZYA 3BG5A 4V2GA 3K2AA 2XV4S 4HYEA 2P5LC 4OIOF 3WTUC 1IN5A 3HKZN 2EV5A 4Y17A 4NC7A 5GPCA 3ZPLA 2R4GA 2V6CA 3H3UA 4ZTFA 2RDPA 1IN6A 2GXBA 3JTHA 2BYVE 1WI9A 2DLLA 2D1HA 2HVSA 1M1EB 2EFQA 3AFHA 4UHTA 1FC3A 2EA2A 2JRMA 1MBFA 3HHGA 4ZDLA 5GTIC 2E2HJ 4DOZA 2Y2ZA 3FMRA 2HPMA 2PJRA 3O8GA 3A01A 2MSYA 2JTVA 1O3SA 1H8AC 1HW1A 1STZA 3J7ZI 3QPHA 4BJ6C 4UUSA 2IGMA 1SEUA 1GV5A 2Y31A 4LG0B 4HA8A 1V5EA 4D0PA 2ZNZA 5M3FJ 5HDGA 1DPUA 3MKLA 4I01A 3SEQA 3HRUA 1ZGAA 3EUAA 1FEXA 2E2JJ 3RYRA 3ZQIA 1ETVA 4YFKF 3AKZA 1D8KA 3HGGA 3BR2A 3VYRB 4IKFA 5CVRA 3BCAA 4PK4A 3KZYA 1VZ0A 3OYLA 3JCUC 1J2XA 3I55I 4ZYEA 3S1MJ 2LY9A 2BXZA 3FISA 4BL0B 2E5ZA 3CCLI 1BOAA 3BZ6A 1MBGA 2PJPA 3HSRA 1SVMA 3T8RA 3KEQA 5D8KB 2WC2A 5HLGA 1K83J 4HV5A 1ETWA 3G1OA 2DOFA 3HUGA 4GO1A 4Y7NJ 3CMEI 2K27A 1VFCA 3F8FA 5J4VA 4AM3A 2LNBA 1HSTA 1O7LA 2L5QA 3CLOA 2BVMA 4II2A 1UFMA 2YX4A 4HPQA 4L18B 5BNGA 1YE9A 3ZQLA 2OUMA 2XF6A 3F8NA 4AVPA 4YIFA 4MQVA 4RA2A 4IOAF 3ZMUA 3F72A 3L2UA 5B66C 4XLHA 3HOYJ 4YIRX 2XRLA 2BEOA 3I4MJ 3F0CA 1TLHB 1SFEA 1BIAA 3BJ6A 1AA7A 2R3SA 1L3LA 1MDMA 2CQXA 1J7KA 3M8JA 1VTNC 5HLHA 1QGPA 2NXNB 2VE8A 1QA6A 3J81K 4BBSJ 2F4MB 4A3EJ 3CJQB 3MZHA 2CO5A 4DYRA 3PO3J 3VFZA 4BE1A 3MVPA 1P9QC 3CP8A 2V1XA 1FP1D 4F7ZA 3MWMA 3D5RC 4MNUA 2IEKA 4LMYA 1D1AA 2QEXI 2Y9YA 2EIKH 4IZZA 1BJZA 1KU7A 4UVAA 1WPKA 3F6OA 4RGRA 2KISA 2HOEA 2CMPA 4HSTA 3PNVA 5E3LA 3L2WA 3ERED 1U9OA 5DV5A 3RQIA 5F08A 3FF5A 1YI2I 2R7WA 1IV6A 3H0GJ 1S7EA 2VOOA 1H88C 4XRFA 4DZJA 3QOEA 3ZP5A 4XN0A 4PCQA 2NNYA 4L5JA 3GFMA 3ZCOA 5JVTA 4KT5C 2ZJ2A 3TQNA 1KQ8A 1AWCA 1WWXA 3GZ6A 3B6CA 1HKTA 5EZGA 3PSFA 1DP7P 2YU9J 1USTA 1VQ6I 1WKMA 2FA5A 5J4YA 3FXUA 2W00A 2DJIA 3S3NA 4QTRA 3JRIA 3HIFA 4G6QA 3Q3SA 4GDFA 2P0WA 3CUQC 1JTYA 2M7AA 3KP2A 1Y39A 2FSWA 3NRVA 2NS0A 2BHZA 2BY1A 2CUFA 1RNLA 4HG2A 2Y9ZA 1SVLA 2XSDC 4P9FA 5M3MJ 1U5TA 1MNMC 2X51A 2QUFA 1HDDC 4MHGA 5E1XA 4ANJA 2L3DA 1I27A 1B6AA 1AU7A 4J00A 1V3FA 2X9DA 3WTYC 1XGOA 2HVQA 5LGUA 2RQPA 1OCCH 4CYCA 3TW7A 2DTRA 1ETYA 3KP7A 5LBQA 3JAMK 2WA0A 2DXIA 5JFRA 1NHAA 1MH4A 5ICCA 1FTZA 5EZHA 3KZIC 3JW4A 5E79C 1I3AA 4KJZA 4UNOA 2AQFA 2HYGD 4C3IJ 4CHUA 2RC4A 1ZLJA 1JHHA 1W5CC 3HL2A 1SANA 3GFIA 4BXUA 4I99C 5BMZA 1TBXA 5CYVA 5H6RA 1O3RA 2Y30A 3E7LA 5B3SH 1QQIA 1S5LC 3EDPA 4BQAA 1OYIA 4G7HF 3M3YJ 1OCRH 4M6YA 3K1PA 1H0MA 3VWBA 5LRRA 1T98A 4M73A 4FISA 3R0AA 4AIKA 3ASNH 4GCVA 3SXYA
chains in the Genus database with same CATH topology
2F5CA 1RUOA 2CG4A 2OAZA 2XIGA 1ZREA 1HKQA 4LB6B 5JI6A 3ZN0A 2F5FA 1R36A 2PEXA 1MJ9A 3DPLC 1IXCA 1F4KA 4XLNF 1B9MA 4U7BA 2F5DA 1S29A 1F9NA 2RN7A 4B09A 2K86A 2YPRA 1ZG1A 4DQ2A 4NQWA 3BY6A 3F6VA 4ESJA 3IKVA 1IXRC 3M9AA 4G6DA 1YFHA 3HTUA 4KN4X 5D5XB 2Z5UA 1R5GA 3K1MA 1ZG5A 3H92A 1XGSA 4ZZDA 4RAZA 3KCCA 4FT8A 4I0BA 5ILVA 3T1BA 4Q4ZF 3QP6A 2DW4A 1RI7A 4RAYA 1MDMB 1KGSA 1Q1HA 3CUOA 3ROUA 4BYYA 4L5IA 2RVCA 2VT3A 5DYMA 1C0WA 1KQ9A 1FT9A 2A3SA 3D0SA 5EEGA 2VT2A 3KE2A 2EFWA 2D45A 2DQRA 5L3CA 3RJPA 4LD5A 2A6EF 5ERIA 1SMTA 4U7DA 3K2ZA 3L9FA 1IXSB 4LLLA 3SZTA 4CICA 1ON1A 1R00A 2W24A 2STWA 1JE8A 1XCVA 2MD5A 3K69A 2CSOA 3HTSB 3IRQA 2IA2A 4ESBA 2ACJA 5J8CA 4KYWA 2QQBA 3P9CA 5E8IA 1U5TB 2OQGA 3RKYA 4R8HA 4Y15A 3M7GA 3WE3A 2M87A 3QOPA 2K02A 3F21A 2H09A 1FBQA 3G3ZA 1EH8A 2Q8KA 3U2RA 1TQPA 1G3WA 3QAHA 3TO6A 2EB7A 4I2OA 1XGMA 3E5QA 5CVVA 2HFHA 5DUKA 4YFNF 1WSUA 1GXPA 1MGTA 1EH7A 4AIHA 3VB2A 2QWWA 1S7AA 1LJ9A 3WG9A 1ZLKA 2XRNA 4M72A 5LGTA 2E7XA 2OZ6A 4KA4A 1K78A 1J0RA 2W57A 2K4BA 4RGXA 4OIRF 2B0LA 4EMSA 3HYIA 1USSA 4UVCA 1TQMA 1YIOA 2OQRA 1K7AA 3IHUA 3NQOA 1YG2A 3P7NA 3F23A 4PGHA 5E1WA 2MLGA 2VBZA 3IRRA 3QU3A 2NRAC 4Q5SF 1R22A 3MCZA 2O03A 3LAJA 2O3FA 2VE9A 1UB9A 2PFBA 2XKPA 2FBIA 3HOTA 1KU3A 2R7DA 1X3UA 4M9ZA 2QQ9A 4RB2C 1MKMA 3GEZA 2LDUA 5AONA 1EH6A 1P4XA 3JSOA 1IN4A 3ZMSA 4XBFA 3WTTC 5A2QK 4A2UA 3PQKA 1XSVA 1G3TA 3IC7A 1KYWA 3O3KA 4Q47A 5L3GA 2Z3YA 3TDZC 4KNYA 3KFWX 2RV8A 3RKXA 3SHFA 1O57A 1Z05A 1SD5A 1XSXA 3E6CC 4LK0F 1U5TC 2HKOA 1FX7A 3V8KA 4WWCA 2QLZA 4KIBA 1W5TA 2XAGA 3F3XA 3BWGA 3LSTA 4P5OA 1SFUA 1IW7F 4H0EA 2GWRA 1FWZA 4MEXF 4HX8A 3FMSA 4DNCA 2KIMA 1WRJA 2OD5A 5K5RA 3QP5A 4EV0A 3ML6A 5FLXK 2G7UA 2OA4A 3VEPA 1PP7U 4A5MA 3IWFA 4EJTA 3KP5A 3E6BA 4RGUA 1FSHA 2DU9A 4MTDA 1F5TA 3TOBA 4LLNA 2LKPA 1J5YA 3N97A 4RB1A 2H6CA 1RUNA 4A12A 1LB2A 5IT3A 2VBWA 1LDJA 1GHCA 1OR7A 3ABTA 3NEUA 2FE3A 2LSOA 3E5XA 4P55A 4N9IA 5D8LB 4LGWA 4NHJA 3LFKA 4IXAA 1W4MA 2FXAA 3EYYA 2HZTA 2PBIA 2NYXA 1G3YA 1Z6RA 2XAQA 1FYMA 2KKOA 3GFJA 2NNNA 3RKWA 4RB0A 3ZMTA 2ZBKA 2YSRA 4KICA 4Y13A 3GXOA 4OMYA 1IAWA 1K78B 4UUVA 4E70A 2RKHA 2G9WA 5D4RA 1B59A 4S05A 2L4MA 3GZ5A 2L54A 4EGYA 4ZH4F 1D3YA 4I7HA 5D5WB 3LA7A 3EETA 2E7WA 2L4AA 1PUEE 4YIIA 3C18A 1XDSA 3DF8A 3T0YA 2FEZA 1ODDA 1OKRA 5D4SA 2YU3A 3K0LA 3WGIA 4KMFA 1U3EM 4AWXB 2LF8A 1R1UA 5L3FA 3TOAA 1FOKA 1W7PD 3ULQB 2XVCA 3CO6C 1T0FA 4JBAA 3RIRA 4HLXA 2CW0F 5E8GA 2QZ8A 1ZHFA 4N0BA 1LQ1A 1I6XA 2J5OA 1FNNA 1FYLA 2ZMEA 1SD4A 2EFNA 1BC8C 4KIFA 1GXQA 3KEOA 4ETSA 2Y48A 3T5XA 2BV6A 4L9TA 3GO5A 3FM5A 2EFOA 1T38A 3FHZA 1L0OC 2A68F 4I98B 5LEKA 2AXLA 3D5LA 4MEYF 3DKWA 1QZZA 2STTA 1Z1DA 3E6MA 2WV0A 4I02A 5HVQC 2W84A 2OZUA 5FD6A 4PGGA 3RTRA 3F8BA 5HDNA 3LAPA 5L3DA 1GVJA 2WWYA 3LA2A 3MEXA 4YG2F 2JPBA 1FSEA 2P6SA 1FYKA 4K2EA 4OU0A 4U0VA 3V7RA 5ILUA 3J81Z 1R1TA 5IT9K 3MZYA 2ADUA 1Z6TA 2DPDA 4HV6A 1R5HA 1H9GA 2P7VB 4A0YA 2QYOA 1KU9A 1KU2A 3E97A 5D5UB 4I0AA 2KJCA 5F64A 5TJJA 4HLYA 2F5EA 2HYFA 2W25A 1MJBA 5CVIA 1HSJA 1U6GA 3E6DA 1D5VA 4EM1A 2BGCA 2O61A 4U0WA 2JSCA 4IRHA 3GX4X 1BI2A 1ZYRF 3C3WA 4L0YB 4RB3C 1P6RA 3B02A 2PLYA 3QRFF 2DK5A 2UZKA 5BS6A 2V1UA 4EQQA 1IN8A 4OINF 4O3MA 2FOKA 3GLXA 5CLSA 4MQ9F 1XD7A 3JAMZ 2IW5A 1XB4A 5BPIA 4JK1X 4IHTA 2A6HF 3K1NA 1I1SA 5TRDA 4HAMA 5E17F 3H3ZA 4BAYA 1HW5A 4HF0A 3GFLA 3FMQA 3JSPA 4Q48A 1JGSA 3M1EA 2FQ3A 4HBLA 1YLFA 3FX3A 4A0ZA 3SZPA 3WGHA 2DPUA 2XKOA 4OMZA 4EJUA 5D6EA 1T39A 2KIFA 1TNTA 3CTAA 5DUIA 1PDNC 1IRFA 3F22A 5ILSA 2H94A 2E1NA 1IN7A 3G73A 3J80K 2IRFG 5FB2A 4ZYGA 5LHGA 2G7HA 4BH9A 2Q2EA 3BROA 2IA1A 2ZMEB 3WGGA 3WU1B 3WTXC 2XAJA 1TQIA 4EJVA 1O3TA 2EV0A 4EGZA 5DCMA 1P4AA 2QQAA 3O2PE 4M9XA 1BJAA 3V7SA 5AIQA 4ENNA 3GF2A 3F8CA 5E20A 2HGCA 2M5WA 2VC1A 1EV7A 2FMYA 1CF7A 1FP2A 2IVMA 2P5KA 4U0YA 3L09A 1B4AA 4EM2A 5ICFA 1HXDA 2L01A 4M9SA 3R61A 3HSFA 4BHPA 3WODF 1IRGA 3T8TA 5J8FA 2YX7A 2BBYA 4ZZLA 1LDDA 1U78A 4G7OF 3I54A 5D6FA 4WX9A 2VN2A 1BN5A 2M8EA 3I53A 1YW9A 5AIPA 2Y0MA 3ECHA 2E1CA 2NAZA 2ZXJA 5CJ9A 3BJAA 3KP3A 3MFKA 2V79A 1F1ZA 4YFXF 2OBPA 2HTSA 2HR3A 1AOYA 3ABUA 3TDUC 2K7LA 4LLGF 5LRSA 1YW7A 4MGRA 4OIPF 1HBXG 3RPUA 2CYYA 4WXHA 4Z2YA 4GGGA 1D8JA 5L3BA 3P9KA 5HS9A 4KFCA 2CFXA 2D1VA 2A61A 4EM0B 2FU4A 4LB5A 2DO7A 1UHMA 3E5UA 2YR2A 2TDXA 5KVRA 3RDIA 3BPVA 4FX0A 2QBYA 1U8RA 2OU2A 4N9HA 5E1ZB 5BPDA 5KK1A 1REPC 2MC3A 3WTSC 2ZFWA 1J9IA 2Q0OA 2KIUA 1MJAA 1R1VA 5K1YA 1ZAOA 4UVBA 1ZN2A 5HS7A 2COMA 2ESHA 1BI1A 5CVUA 2GA1A 4EVIA 2VOPA 1G3SA 4OIQF 1ZARA 3LWFA 1UCRA 2MH9A 2FRHA 3MQ0A 3KZZA 4XSXF 3ZQ7A 2V9VA 5LEJA 4FHTA 3DPTA 4G94A 4HZFA 1MZBA 2GIVA 3JTGA 2EJRA 4HF1A 1YTYA 3BOQA 2HEOA 5FFZA 5HS8A 1SD7A 3R0JA 1OMIA 5DCMB 1G4DA 4KN7X 1XMAA 5ICGA 2W85A 1MD0A 1FBSA 2VXZA 2JPCA 4QWQA 2CWEA 1UHWA 2AS5F 1U2WA 2ISZA 3FWEA 4MTEA 2P8TA 4EJOA 5D5VB 5A2QZ 4KDPA 3WTVC 2PN6A 1HQCA 1LDKB 4AIJA 2O0YA 2MH2A 5K5QA 1BI3A 4PDKA 4S04A 1FY7A 1CF7B 5EEHA 5DD4A 2QM3A 3I58A 2P4WA 3DV8A 1PP8F 2Y75A 3R6SA 4L9JA 1XSDA 5H20A 2DBBA 4ENMA 3ZMVA 4CXFA 1XMKA 2DAOA 1H9TA 2XHKA 3SQNA 1QBJA 1ZH5A 5J6XA 1BM9A 1BBYA 4L0ZB 1TNSA 2KRFA 4IF4A 3F8MA 4WXCA 3TO7A 2K4JA 5FLXZ 2IT0A 3V4GA 2JT1A 1RZ4A 1LEBA 2J5PA 1CGPA 5LGNA 3CJNA 4XSZF 4I09A 1LNWA 1OYYA 5DDGA 5F1RA 3ZMDA 1QO0D 2R7FA 3KP4A 4LFUA 1O7FA 3M8EA 3C7JA 3LQRA 4O5VA 3FXQA 1QZYA 3C1DA 4UXNA 3DXJF 2M45A 2QVOA 4KIGA 4XLPF 5FD5A 5JHUA 3WTWC 4HF2A 1Y0UA 3U9GA 4HX4A 2VODA 2BE5F 4UV9A 1KQ0A 3ELKA 4G8XA 1E17A 1W7PA 1LEAA 3GUDA 1JXSA 4ENKA 3I64A 4ENJA 2MLKA 2QBYB 2UXXA 5DD8A 2P6TA 1OPCA 3DEUA 1YO5C 2ISYA 1ULYA 4ON0A 3TGNA 2P7CB 3GYHX 5E18F 3ZMZA 4CYDA 1R7JA 2L02A 1G6NA 4JQFA 3M8FA 2A69F 3TO9A 4GYIA 1ZRCA 2VBXA 3OV8A 1HW2A 3GW2A 1DDNA 5BQTA 1IUYA 2FNAA 3I59A 2CGPA 1SD6A 4M71A 3BDDA 4M74A 1YQAA 2HQNA 1DPRA 3FXRA 1ZRFA 2ESNA 1ON2A 4WF2A 5HLIA 1S7OA 1QPMA 4P9UA 1IF1A 3RI4A 3I5UA 4AD9A 4ZYDA 3GWZA 3HRTA 1B1BA 3IWZA 3FZVA 3KETA 3BP8A 1YYVA 1Z7UA 5BOXA 4IVNA 4GYGA 3COAC 3KLNA 4U88A 2EWNA 1TW2A 2GZWA 4PZJA 1TW3A 2LF7A 1P4WA 2MBFA 2GA2A 5DEQA 2VC0A 4A5NA 3V8LA 2Z9OA 3J7AO 2HKXA 1SMYF 4FX4A 2O6GE 1XGNA 4R79A 3V7CA 3I71A 2P5VA 3QPTA 4HX7A 3VOEA 5ED4A 1DUXC 3KP6A 4QLCU 2O8XA 4TV7A 2M1BA 3WU0A 5LHHA 1P2FA 4P96A 4RGSA 2H6BA 3DP7A 4A6EA 5FFXA 3O6BB 2V1DA 3E3VA 2PMHA 1LVAA 1HKSA 2X0LA 4A0XA 2PG4A 2XROA 2D2WA 4RS8A 2C6YA 2Z33A 1K79A 1TTYA 3KLOA 4R1HA 5IT9Z 3B73A 2XGXA 3EQLF 2VONA 3V8JA 2ZKZA 4ZYHA 2PMUA 2FF4A 1FLIA 3L00A 1J59A 1KA8A 1XN7A 4KMUX 1K6OA 1IZ1A 3DFGA 1E2XA 3PQJA 5CVJA 1T6SA 4HQEA 2IPQX 1Z91A 4ESFA 5HOOA 1OYWA 4A6DA 4BHBA 5LLQA 4EJWA 2WTEA 2ZO4A 2DK8A 3CO7C 4KUMA 2FMLA 2VBYA 3HHHA 5HDKA 1J75A 3RYPA 1I1GA 2DT5A 4HQMA 1S6LA 2QENA 2EK5A 5L3EA 2ZCWA 1ONVA 1T2KA 3CUQA 4L9VA 1ZGJA 1BI0A 5DCFA 1BC7C 1W7PB 2RGVA 4IHSA 2EA4A 2IP2A 3Q9SA 4WCGA 4IPAA 3CDHA 4CDGA 2DI3A 5F6FA 1Z9CA 1W5SA 5ICEA 2XUBA 3SFZA 3ZN1A 2M30A 3ISPA 2HDCA 3IKTA 2EV6A 4L9NA 2HQRA 4IJAA 2HTJA 1FBUA 3U1DA 2FBKA 3W6JB 4LG0A 5FGMA 2CQKA 1FZPB 1KYZA 1YS7A 2DQLA 1RIOH 3WE2A 2ETHA 2EFPA 2HWVA 3MAJA 3I59B 2FBHA 3PFIA 2UWMA 3LQQA 3K9TA 2PI0A 3N4MA 2A07F 2A5YB 3OOPA 2H27A 4CGZA 2MA3A 4OOIA 4O6JA 3DQVC 2KJBA 2Z99A 3BPXA 4LK1F 3HRMA 1A04A 3RPQA 5H6QA 2UXNA 4CZZA 4CO8A 4WK8F 1XDUA 3I0TA 1P92A 3J80Z 4BHCA 4BNCA 1S8NA 2XAHA 3R4KA 4LJZF 2X4HA 2DFIA 1ZG3A 4HW0A 5FO5A 3TKYA 1SAXA 2ZNYA 1ZRDA 1R58A 4UV8A 3L7WA 3FM3A 3L2CA 2IA0A 1WQ2A 2GXGA 5JR3A 5K5OA 3HOSA 2GAUA 1R23A 2RNJA 3Q5FA 3P9IA 6PAXA 4HOBA 1YW8A 3EYIA 3GVAA 4B8XA 3EUHA 4M6XA 2F2EA 4IRIA 2GQQA 1SFXA 3REOA 3VODA 4ASNA 3ECOA 3HRSA 3IL2A 3Q9VA 4WXDA 4IRGA 4HDVA 4GXOA 4G7ZF 1FPQA 1BIBA 1QNTA 2IJLA 4NB5A 2XASA 2JRTA 2PQ8A 3S2WA 4HDUA 3I4PA 2HS5A 1O3QA 1JHFA 3AAFA 1B9NA 3WTZA 1XCBA 4G9YA 3HSEA 3LA3A 3W6KB 1I5ZA 2FNPA 1S3JA 2XAFA 1YS6A 3CUQB 2ELHA 5LHIA 1V4RA 3R60A 3BJOA 3QU6A 2JZYA 2P5LC 2XV4S 4HYEA 4OIOF 3WTUC 1IN5A 4Y17A 2EV5A 3ZPLA 2V6CA 3H3UA 2RDPA 1IN6A 2GXBA 3JTHA 2BYVE 1WI9A 2DLLA 2D1HA 2EFQA 4UHTA 1FC3A 2EA2A 3HHGA 3FMRA 2JTVA 1O3SA 1HW1A 1STZA 3QPHA 4LG0B 4HA8A 4D0PA 2ZNZA 5HDGA 1DPUA 4I01A 3HRUA 1ZGAA 3RYRA 4YFKF 1D8KA 5CVRA 3KZYA 1J2XA 4ZYEA 1BOAA 3BZ6A 2PJPA 3HSRA 3T8RA 3KEQA 5D8KB 2WC2A 5HLGA 4HV5A 3HUGA 4GO1A 2K27A 3F8FA 2LNBA 1HSTA 1O7LA 3CLOA 1UFMA 2YX4A 4L18B 3F8NA 4AVPA 4YIFA 4MQVA 3ZMUA 3F72A 2BEOA 1TLHB 1SFEA 1BIAA 3BJ6A 2R3SA 1L3LA 1MDMA 1J7KA 1VTNC 5HLHA 1QGPA 2VE8A 3J81K 3MZHA 2CO5A 3VFZA 2V1XA 1FP1D 4F7ZA 3MWMA 4MNUA 4LMYA 1KU7A 4UVAA 3F6OA 4RGRA 2HOEA 3ERED 5DV5A 3FF5A 2VOOA 4XRFA 3ZP5A 2NNYA 4PCQA 4L5JA 3GFMA 5JVTA 4KT5C 2ZJ2A 3TQNA 1KQ8A 1AWCA 1WWXA 3GZ6A 1HKTA 1DP7P 1USTA 1WKMA 2FA5A 3FXUA 3HIFA 4G6QA 3CUQC 3KP2A 2FSWA 3NRVA 2NS0A 1RNLA 4P9FA 1U5TA 2QUFA 4MHGA 5E1XA 2L3DA 1I27A 1B6AA 1V3FA 3WTYC 1XGOA 5LGUA 2RQPA 2DTRA 3KP7A 5LBQA 3JAMK 5JFRA 1NHAA 5ICCA 3JW4A 4UNOA 2HYGD 4CHUA 2RC4A 1ZLJA 1JHHA 3GFIA 4BXUA 5BMZA 1TBXA 5CYVA 5H6RA 1O3RA 1QQIA 3EDPA 4BQAA 1OYIA 4G7HF 4M6YA 3K1PA 1H0MA 5LRRA 1T98A 4M73A 3R0AA 4AIKA 4GCVA 3SXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5C A;  1RUO A;  2CG4 A;  2OAZ A;  2XIG A;  1ZRE A;  1HKQ A;  4LB6 B;  5JI6 A;  3ZN0 A;  2F5F A;  1R36 A;  2PEX A;  1MJ9 A;  3DPL C;  1IXC A;  1F4K A;  4XLN F;  1B9M A;  4U7B A;  2F5D A;  1S29 A;  1F9N A;  2RN7 A;  4B09 A;  2K86 A;  2YPR A;  1ZG1 A;  4DQ2 A;  4NQW A;  3BY6 A;  3F6V A;  4ESJ A;  3IKV A;  1IXR C;  3M9A A;  4G6D A;  1YFH A;  3HTU A;  4KN4 X;  5D5X B;  2Z5U A;  1R5G A;  3K1M A;  1ZG5 A;  3H92 A;  1XGS A;  4ZZD A;  4RAZ A;  3KCC A;  4FT8 A;  4I0B A;  5ILV A;  3T1B A;  4Q4Z F;  3QP6 A;  2DW4 A;  1RI7 A;  4RAY A;  1MDM B;  1KGS A;  1Q1H A;  3CUO A;  3ROU A;  4BYY A;  4L5I A;  2RVC A;  2VT3 A;  5DYM A;  1C0W A;  1KQ9 A;  1FT9 A;  2A3S A;  3D0S A;  5EEG A;  2VT2 A;  3KE2 A;  2EFW A;  2D45 A;  2DQR A;  5L3C A;  3RJP A;  4LD5 A;  2A6E F;  5ERI A;  1SMT A;  4U7D A;  3K2Z A;  3L9F A;  1IXS B;  4LLL A;  3SZT A;  4CIC A;  1ON1 A;  1R00 A;  2W24 A;  2STW A;  1JE8 A;  1XCV A;  2MD5 A;  3K69 A;  2CSO A;  3HTS B;  3IRQ A;  2IA2 A;  4ESB A;  2ACJ A;  5J8C A;  4KYW A;  2QQB A;  3P9C A;  5E8I A;  1U5T B;  2OQG A;  3RKY A;  4R8H A;  4Y15 A;  3M7G A;  3WE3 A;  2M87 A;  3QOP A;  2K02 A;  3F21 A;  2H09 A;  1FBQ A;  3G3Z A;  1EH8 A;  2Q8K A;  3U2R A;  1TQP A;  1G3W A;  3QAH A;  3TO6 A;  2EB7 A;  4I2O A;  1XGM A;  3E5Q A;  5CVV A;  2HFH A;  5DUK A;  4YFN F;  1WSU A;  1GXP A;  1MGT A;  1EH7 A;  4AIH A;  3VB2 A;  2QWW A;  1S7A A;  1LJ9 A;  3WG9 A;  1ZLK A;  2XRN A;  4M72 A;  5LGT A;  2E7X A;  2OZ6 A;  4KA4 A;  1K78 A;  1J0R A;  2W57 A;  2K4B A;  4RGX A;  4OIR F;  2B0L A;  4EMS A;  3HYI A;  1USS A;  4UVC A;  1TQM A;  1YIO A;  2OQR A;  1K7A A;  3IHU A;  3NQO A;  1YG2 A;  3P7N A;  3F23 A;  4PGH A;  5E1W A;  2MLG A;  2VBZ A;  3IRR A;  3QU3 A;  2NRA C;  4Q5S F;  1R22 A;  3MCZ A;  2O03 A;  3LAJ A;  2O3F A;  2VE9 A;  1UB9 A;  2PFB A;  2XKP A;  2FBI A;  3HOT A;  1KU3 A;  2R7D A;  1X3U A;  4M9Z A;  2QQ9 A;  4RB2 C;  1MKM A;  3GEZ A;  2LDU A;  5AON A;  1EH6 A;  1P4X A;  3JSO A;  1IN4 A;  3ZMS A;  4XBF A;  3WTT C;  5A2Q K;  4A2U A;  3PQK A;  1XSV A;  1G3T A;  3IC7 A;  1KYW A;  3O3K A;  4Q47 A;  5L3G A;  2Z3Y A;  3TDZ C;  4KNY A;  3KFW X;  2RV8 A;  3RKX A;  3SHF A;  1O57 A;  1Z05 A;  1SD5 A;  1XSX A;  3E6C C;  4LK0 F;  1U5T C;  2HKO A;  1FX7 A;  3V8K A;  4WWC A;  2QLZ A;  4KIB A;  1W5T A;  2XAG A;  3F3X A;  3BWG A;  3LST A;  4P5O A;  1SFU A;  1IW7 F;  4H0E A;  2GWR A;  1FWZ A;  4MEX F;  4HX8 A;  3FMS A;  4DNC A;  2KIM A;  1WRJ A;  2OD5 A;  5K5R A;  3QP5 A;  4EV0 A;  3ML6 A;  5FLX K;  2G7U A;  2OA4 A;  3VEP A;  1PP7 U;  4A5M A;  3IWF A;  4EJT A;  3KP5 A;  3E6B A;  4RGU A;  1FSH A;  2DU9 A;  4MTD A;  1F5T A;  3TOB A;  4LLN A;  2LKP A;  1J5Y A;  3N97 A;  4RB1 A;  2H6C A;  1RUN A;  4A12 A;  1LB2 A;  5IT3 A;  2VBW A;  1LDJ A;  1GHC A;  1OR7 A;  3ABT A;  3NEU A;  2FE3 A;  2LSO A;  3E5X A;  4P55 A;  4N9I A;  5D8L B;  4LGW A;  4NHJ A;  3LFK A;  4IXA A;  1W4M A;  2FXA A;  3EYY A;  2HZT A;  2PBI A;  2NYX A;  1G3Y A;  1Z6R A;  2XAQ A;  1FYM A;  2KKO A;  3GFJ A;  2NNN A;  3RKW A;  4RB0 A;  3ZMT A;  2ZBK A;  2YSR A;  4KIC A;  4Y13 A;  3GXO A;  4OMY A;  1IAW A;  1K78 B;  4UUV A;  4E70 A;  2RKH A;  2G9W A;  5D4R A;  1B59 A;  4S05 A;  2L4M A;  3GZ5 A;  2L54 A;  4EGY A;  4ZH4 F;  1D3Y A;  4I7H A;  5D5W B;  3LA7 A;  3EET A;  2E7W A;  2L4A A;  1PUE E;  4YII A;  3C18 A;  1XDS A;  3DF8 A;  3T0Y A;  2FEZ A;  1ODD A;  1OKR A;  5D4S A;  2YU3 A;  3K0L A;  3WGI A;  4KMF A;  1U3E M;  4AWX B;  2LF8 A;  1R1U A;  5L3F A;  3TOA A;  1FOK A;  1W7P D;  3ULQ B;  2XVC A;  3CO6 C;  1T0F A;  4JBA A;  3RIR A;  4HLX A;  2CW0 F;  5E8G A;  2QZ8 A;  1ZHF A;  4N0B A;  1LQ1 A;  1I6X A;  2J5O A;  1FNN A;  1FYL A;  2ZME A;  1SD4 A;  2EFN A;  1BC8 C;  4KIF A;  1GXQ A;  3KEO A;  4ETS A;  2Y48 A;  3T5X A;  2BV6 A;  4L9T A;  3GO5 A;  3FM5 A;  2EFO A;  1T38 A;  3FHZ A;  1L0O C;  2A68 F;  4I98 B;  5LEK A;  2AXL A;  3D5L A;  4MEY F;  3DKW A;  1QZZ A;  2STT A;  1Z1D A;  3E6M A;  2WV0 A;  4I02 A;  5HVQ C;  2W84 A;  2OZU A;  5FD6 A;  4PGG A;  3RTR A;  3F8B A;  5HDN A;  3LAP A;  5L3D A;  1GVJ A;  2WWY A;  3LA2 A;  3MEX A;  4YG2 F;  2JPB A;  1FSE A;  2P6S A;  1FYK A;  4K2E A;  4OU0 A;  4U0V A;  3V7R A;  5ILU A;  3J81 Z;  1R1T A;  5IT9 K;  3MZY A;  2ADU A;  1Z6T A;  2DPD A;  4HV6 A;  1R5H A;  1H9G A;  2P7V B;  4A0Y A;  2QYO A;  1KU9 A;  1KU2 A;  3E97 A;  5D5U B;  4I0A A;  2KJC A;  5F64 A;  5TJJ A;  4HLY A;  2F5E A;  2HYF A;  2W25 A;  1MJB A;  5CVI A;  1HSJ A;  1U6G A;  3E6D A;  1D5V A;  4EM1 A;  2BGC A;  2O61 A;  4U0W A;  2JSC A;  4IRH A;  3GX4 X;  1BI2 A;  1ZYR F;  3C3W A;  4L0Y B;  4RB3 C;  1P6R A;  3B02 A;  2PLY A;  3QRF F;  2DK5 A;  2UZK A;  5BS6 A;  2V1U A;  4EQQ A;  1IN8 A;  4OIN F;  4O3M A;  2FOK A;  3GLX A;  5CLS A;  4MQ9 F;  1XD7 A;  3JAM Z;  2IW5 A;  1XB4 A;  5BPI A;  4JK1 X;  4IHT A;  2A6H F;  3K1N A;  1I1S A;  5TRD A;  4HAM A;  5E17 F;  3H3Z A;  4BAY A;  1HW5 A;  4HF0 A;  3GFL A;  3FMQ A;  3JSP A;  4Q48 A;  1JGS A;  3M1E A;  2FQ3 A;  4HBL A;  1YLF A;  3FX3 A;  4A0Z A;  3SZP A;  3WGH A;  2DPU A;  2XKO A;  4OMZ A;  4EJU A;  5D6E A;  1T39 A;  2KIF A;  1TNT A;  3CTA A;  5DUI A;  1PDN C;  1IRF A;  3F22 A;  5ILS A;  2H94 A;  2E1N A;  1IN7 A;  3G73 A;  3J80 K;  2IRF G;  5FB2 A;  4ZYG A;  5LHG A;  2G7H A;  4BH9 A;  2Q2E A;  3BRO A;  2IA1 A;  2ZME B;  3WGG A;  3WU1 B;  3WTX C;  2XAJ A;  1TQI A;  4EJV A;  1O3T A;  2EV0 A;  4EGZ A;  5DCM A;  1P4A A;  2QQA A;  3O2P E;  4M9X A;  1BJA A;  3V7S A;  5AIQ A;  4ENN A;  3GF2 A;  3F8C A;  5E20 A;  2HGC A;  2M5W A;  2VC1 A;  1EV7 A;  2FMY A;  1CF7 A;  1FP2 A;  2IVM A;  2P5K A;  4U0Y A;  3L09 A;  1B4A A;  4EM2 A;  5ICF A;  1HXD A;  2L01 A;  4M9S A;  3R61 A;  3HSF A;  4BHP A;  3WOD F;  1IRG A;  3T8T A;  5J8F A;  2YX7 A;  2BBY A;  4ZZL A;  1LDD A;  1U78 A;  4G7O F;  3I54 A;  5D6F A;  4WX9 A;  2VN2 A;  1BN5 A;  2M8E A;  3I53 A;  1YW9 A;  5AIP A;  2Y0M A;  3ECH A;  2E1C A;  2NAZ A;  2ZXJ A;  5CJ9 A;  3BJA A;  3KP3 A;  3MFK A;  2V79 A;  1F1Z A;  4YFX F;  2OBP A;  2HTS A;  2HR3 A;  1AOY A;  3ABU A;  3TDU C;  2K7L A;  4LLG F;  5LRS A;  1YW7 A;  4MGR A;  4OIP F;  1HBX G;  3RPU A;  2CYY A;  4WXH A;  4Z2Y A;  4GGG A;  1D8J A;  5L3B A;  3P9K A;  5HS9 A;  4KFC A;  2CFX A;  2D1V A;  2A61 A;  4EM0 B;  2FU4 A;  4LB5 A;  2DO7 A;  1UHM A;  3E5U A;  2YR2 A;  2TDX A;  5KVR A;  3RDI A;  3BPV A;  4FX0 A;  2QBY A;  1U8R A;  2OU2 A;  4N9H A;  5E1Z B;  5BPD A;  5KK1 A;  1REP C;  2MC3 A;  3WTS C;  2ZFW A;  1J9I A;  2Q0O A;  2KIU A;  1MJA A;  1R1V A;  5K1Y A;  1ZAO A;  4UVB A;  1ZN2 A;  5HS7 A;  2COM A;  2ESH A;  1BI1 A;  5CVU A;  2GA1 A;  4EVI A;  2VOP A;  1G3S A;  4OIQ F;  1ZAR A;  3LWF A;  1UCR A;  2MH9 A;  2FRH A;  3MQ0 A;  3KZZ A;  4XSX F;  3ZQ7 A;  2V9V A;  5LEJ A;  4FHT A;  3DPT A;  4G94 A;  4HZF A;  1MZB A;  2GIV A;  3JTG A;  2EJR A;  4HF1 A;  1YTY A;  3BOQ A;  2HEO A;  5FFZ A;  5HS8 A;  1SD7 A;  3R0J A;  1OMI A;  5DCM B;  1G4D A;  4KN7 X;  1XMA A;  5ICG A;  2W85 A;  1MD0 A;  1FBS A;  2VXZ A;  2JPC A;  4QWQ A;  2CWE A;  1UHW A;  2AS5 F;  1U2W A;  2ISZ A;  3FWE A;  4MTE A;  2P8T A;  4EJO A;  5D5V B;  5A2Q Z;  4KDP A;  3WTV C;  2PN6 A;  1HQC A;  1LDK B;  4AIJ A;  2O0Y A;  2MH2 A;  5K5Q A;  1BI3 A;  4PDK A;  4S04 A;  1FY7 A;  1CF7 B;  5EEH A;  5DD4 A;  2QM3 A;  3I58 A;  2P4W A;  3DV8 A;  1PP8 F;  2Y75 A;  3R6S A;  4L9J A;  1XSD A;  5H20 A;  2DBB A;  4ENM A;  3ZMV A;  4CXF A;  1XMK A;  2DAO A;  1H9T A;  2XHK A;  3SQN A;  1QBJ A;  1ZH5 A;  5J6X A;  1BM9 A;  1BBY A;  4L0Z B;  1TNS A;  2KRF A;  4IF4 A;  3F8M A;  4WXC A;  3TO7 A;  2K4J A;  5FLX Z;  2IT0 A;  3V4G A;  2JT1 A;  1RZ4 A;  1LEB A;  2J5P A;  1CGP A;  5LGN A;  3CJN A;  4XSZ F;  4I09 A;  1LNW A;  1OYY A;  5DDG A;  5F1R A;  3ZMD A;  1QO0 D;  2R7F A;  3KP4 A;  4LFU A;  1O7F A;  3M8E A;  3C7J A;  3LQR A;  4O5V A;  3FXQ A;  1QZY A;  3C1D A;  4UXN A;  3DXJ F;  2M45 A;  2QVO A;  4KIG A;  4XLP F;  5FD5 A;  5JHU A;  3WTW C;  4HF2 A;  1Y0U A;  3U9G A;  4HX4 A;  2VOD A;  2BE5 F;  4UV9 A;  1KQ0 A;  3ELK A;  4G8X A;  1E17 A;  1W7P A;  1LEA A;  3GUD A;  1JXS A;  4ENK A;  3I64 A;  4ENJ A;  2MLK A;  2QBY B;  2UXX A;  5DD8 A;  2P6T A;  1OPC A;  3DEU A;  1YO5 C;  2ISY A;  1ULY A;  4ON0 A;  3TGN A;  2P7C B;  3GYH X;  5E18 F;  3ZMZ A;  4CYD A;  1R7J A;  2L02 A;  1G6N A;  4JQF A;  3M8F A;  2A69 F;  3TO9 A;  4GYI A;  1ZRC A;  2VBX A;  3OV8 A;  1HW2 A;  3GW2 A;  1DDN A;  5BQT A;  1IUY A;  2FNA A;  3I59 A;  2CGP A;  1SD6 A;  4M71 A;  3BDD A;  4M74 A;  1YQA A;  2HQN A;  1DPR A;  3FXR A;  1ZRF A;  2ESN A;  1ON2 A;  4WF2 A;  5HLI A;  1S7O A;  1QPM A;  4P9U A;  1IF1 A;  3RI4 A;  3I5U A;  4AD9 A;  4ZYD A;  3GWZ A;  3HRT A;  1B1B A;  3IWZ A;  3FZV A;  3KET A;  3BP8 A;  1YYV A;  1Z7U A;  5BOX A;  4IVN A;  4GYG A;  3COA C;  3KLN A;  4U88 A;  2EWN A;  1TW2 A;  2GZW A;  4PZJ A;  1TW3 A;  2LF7 A;  1P4W A;  2MBF A;  2GA2 A;  5DEQ A;  2VC0 A;  4A5N A;  3V8L A;  2Z9O A;  3J7A O;  2HKX A;  1SMY F;  4FX4 A;  2O6G E;  1XGN A;  4R79 A;  3V7C A;  3I71 A;  2P5V A;  3QPT A;  4HX7 A;  3VOE A;  5ED4 A;  1DUX C;  3KP6 A;  4QLC U;  2O8X A;  4TV7 A;  2M1B A;  3WU0 A;  5LHH A;  1P2F A;  4P96 A;  4RGS A;  2H6B A;  3DP7 A;  4A6E A;  5FFX A;  3O6B B;  2V1D A;  3E3V A;  2PMH A;  1LVA A;  1HKS A;  2X0L A;  4A0X A;  2PG4 A;  2XRO A;  2D2W A;  4RS8 A;  2C6Y A;  2Z33 A;  1K79 A;  1TTY A;  3KLO A;  4R1H A;  5IT9 Z;  3B73 A;  2XGX A;  3EQL F;  2VON A;  3V8J A;  2ZKZ A;  4ZYH A;  2PMU A;  2FF4 A;  1FLI A;  3L00 A;  1J59 A;  1KA8 A;  1XN7 A;  4KMU X;  1K6O A;  1IZ1 A;  3DFG A;  1E2X A;  3PQJ A;  5CVJ A;  1T6S A;  4HQE A;  2IPQ X;  1Z91 A;  4ESF A;  5HOO A;  1OYW A;  4A6D A;  4BHB A;  5LLQ A;  4EJW A;  2WTE A;  2ZO4 A;  2DK8 A;  3CO7 C;  4KUM A;  2FML A;  2VBY A;  3HHH A;  5HDK A;  1J75 A;  3RYP A;  1I1G A;  2DT5 A;  4HQM A;  1S6L A;  2QEN A;  2EK5 A;  5L3E A;  2ZCW A;  1ONV A;  1T2K A;  3CUQ A;  4L9V A;  1ZGJ A;  1BI0 A;  5DCF A;  1BC7 C;  1W7P B;  2RGV A;  4IHS A;  2EA4 A;  2IP2 A;  3Q9S A;  4WCG A;  4IPA A;  3CDH A;  4CDG A;  2DI3 A;  5F6F A;  1Z9C A;  1W5S A;  5ICE A;  2XUB A;  3SFZ A;  3ZN1 A;  2M30 A;  3ISP A;  2HDC A;  3IKT A;  2EV6 A;  4L9N A;  2HQR A;  4IJA A;  2HTJ A;  1FBU A;  3U1D A;  2FBK A;  3W6J B;  4LG0 A;  5FGM A;  2CQK A;  1FZP B;  1KYZ A;  1YS7 A;  2DQL A;  1RIO H;  3WE2 A;  2ETH A;  2EFP A;  2HWV A;  3MAJ A;  3I59 B;  2FBH A;  3PFI A;  2UWM A;  3LQQ A;  3K9T A;  2PI0 A;  3N4M A;  2A07 F;  2A5Y B;  3OOP A;  2H27 A;  4CGZ A;  2MA3 A;  4OOI A;  4O6J A;  3DQV C;  2KJB A;  2Z99 A;  3BPX A;  4LK1 F;  3HRM A;  1A04 A;  3RPQ A;  5H6Q A;  2UXN A;  4CZZ A;  4CO8 A;  4WK8 F;  1XDU A;  3I0T A;  1P92 A;  3J80 Z;  4BHC A;  4BNC A;  1S8N A;  2XAH A;  3R4K A;  4LJZ F;  2X4H A;  2DFI A;  1ZG3 A;  4HW0 A;  5FO5 A;  3TKY A;  1SAX A;  2ZNY A;  1ZRD A;  1R58 A;  4UV8 A;  3L7W A;  3FM3 A;  3L2C A;  2IA0 A;  1WQ2 A;  2GXG A;  5JR3 A;  5K5O A;  3HOS A;  2GAU A;  1R23 A;  2RNJ A;  3Q5F A;  3P9I A;  6PAX A;  4HOB A;  1YW8 A;  3EYI A;  3GVA A;  4B8X A;  3EUH A;  4M6X A;  2F2E A;  4IRI A;  2GQQ A;  1SFX A;  3REO A;  3VOD A;  4ASN A;  3ECO A;  3HRS A;  3IL2 A;  3Q9V A;  4WXD A;  4IRG A;  4HDV A;  4GXO A;  4G7Z F;  1FPQ A;  1BIB A;  1QNT A;  2IJL A;  4NB5 A;  2XAS A;  2JRT A;  2PQ8 A;  3S2W A;  4HDU A;  3I4P A;  2HS5 A;  1O3Q A;  1JHF A;  3AAF A;  1B9N A;  3WTZ A;  1XCB A;  4G9Y A;  3HSE A;  3LA3 A;  3W6K B;  1I5Z A;  2FNP A;  1S3J A;  2XAF A;  1YS6 A;  3CUQ B;  2ELH A;  5LHI A;  1V4R A;  3R60 A;  3BJO A;  3QU6 A;  2JZY A;  2P5L C;  2XV4 S;  4HYE A;  4OIO F;  3WTU C;  1IN5 A;  4Y17 A;  2EV5 A;  3ZPL A;  2V6C A;  3H3U A;  2RDP A;  1IN6 A;  2GXB A;  3JTH A;  2BYV E;  1WI9 A;  2DLL A;  2D1H A;  2EFQ A;  4UHT A;  1FC3 A;  2EA2 A;  3HHG A;  3FMR A;  2JTV A;  1O3S A;  1HW1 A;  1STZ A;  3QPH A;  4LG0 B;  4HA8 A;  4D0P A;  2ZNZ A;  5HDG A;  1DPU A;  4I01 A;  3HRU A;  1ZGA A;  3RYR A;  4YFK F;  1D8K A;  5CVR A;  3KZY A;  1J2X A;  4ZYE A;  1BOA A;  3BZ6 A;  2PJP A;  3HSR A;  3T8R A;  3KEQ A;  5D8K B;  2WC2 A;  5HLG A;  4HV5 A;  3HUG A;  4GO1 A;  2K27 A;  3F8F A;  2LNB A;  1HST A;  1O7L A;  3CLO A;  1UFM A;  2YX4 A;  4L18 B;  3F8N A;  4AVP A;  4YIF A;  4MQV A;  3ZMU A;  3F72 A;  2BEO A;  1TLH B;  1SFE A;  1BIA A;  3BJ6 A;  2R3S A;  1L3L A;  1MDM A;  1J7K A;  1VTN C;  5HLH A;  1QGP A;  2VE8 A;  3J81 K;  3MZH A;  2CO5 A;  3VFZ A;  2V1X A;  1FP1 D;  4F7Z A;  3MWM A;  4MNU A;  4LMY A;  1KU7 A;  4UVA A;  3F6O A;  4RGR A;  2HOE A;  3ERE D;  5DV5 A;  3FF5 A;  2VOO A;  4XRF A;  3ZP5 A;  2NNY A;  4PCQ A;  4L5J A;  3GFM A;  5JVT A;  4KT5 C;  2ZJ2 A;  3TQN A;  1KQ8 A;  1AWC A;  1WWX A;  3GZ6 A;  1HKT A;  1DP7 P;  1UST A;  1WKM A;  2FA5 A;  3FXU A;  3HIF A;  4G6Q A;  3CUQ C;  3KP2 A;  2FSW A;  3NRV A;  2NS0 A;  1RNL A;  4P9F A;  1U5T A;  2QUF A;  4MHG A;  5E1X A;  2L3D A;  1I27 A;  1B6A A;  1V3F A;  3WTY C;  1XGO A;  5LGU A;  2RQP A;  2DTR A;  3KP7 A;  5LBQ A;  3JAM K;  5JFR A;  1NHA A;  5ICC A;  3JW4 A;  4UNO A;  2HYG D;  4CHU A;  2RC4 A;  1ZLJ A;  1JHH A;  3GFI A;  4BXU A;  5BMZ A;  1TBX A;  5CYV A;  5H6R A;  1O3R A;  1QQI A;  3EDP A;  4BQA A;  1OYI A;  4G7H F;  4M6Y A;  3K1P A;  1H0M A;  5LRR A;  1T98 A;  4M73 A;  3R0A A;  4AIK A;  4GCV A;  3SXY A; 
#chains in the Genus database with same CATH topology
 2F5C A;  1RUO A;  2JJ7 A;  3A4C A;  3O8H A;  2CG4 A;  2ECC A;  2OAZ A;  2JSP A;  2XIG A;  1ZRE A;  1HKQ A;  4LB6 B;  5JI6 A;  4LG3 A;  2NOG A;  1A35 A;  5LFA A;  3ZN0 A;  1OCO H;  4B3X A;  4KIT B;  2F5F A;  2MFZ A;  1R36 A;  2PEX A;  4RM2 A;  1MJ9 A;  3DPL C;  3BG6 A;  1IXC A;  3RSN A;  1F4K A;  2DA7 A;  1UHS A;  2KMU A;  3BQZ A;  1YOV B;  4XLN F;  2LFB A;  1B9M A;  2CW8 A;  2NS8 A;  1YJ9 I;  1EA3 A;  3CZ6 A;  2E36 A;  4U7B A;  2PJR B;  3IAM 2;  2V1N A;  3A01 B;  5C3E J;  4NBQ A;  3FXO A;  1JGG A;  3K4J A;  2F5D A;  2GBY A;  3MKW B;  3C2G A;  4UUS B;  2VUM J;  1BA5 A;  1MND A;  1S29 A;  1F9N A;  4KIS A;  2RN7 A;  2R92 J;  4MFE A;  4B09 A;  3RQ4 A;  2K86 A;  2YPR A;  4D5C A;  1ZG1 A;  2LVS A;  4DQ2 A;  1ZGW A;  2JMW A;  4NQW A;  4CCN A;  4M3F A;  1X4O A;  4E7K A;  4FE4 A;  1RES A;  2R7T A;  3PJR A;  5FLM J;  3V42 A;  2DYR H;  3BY6 A;  3F6V A;  4BGD A;  3H35 A;  4ESJ A;  2ZB9 A;  3IKV A;  1IXR C;  3M9A A;  5GPA A;  3BTJ A;  4G6D A;  4JP0 A;  3HTU A;  1YFH A;  4KN4 X;  5D5X B;  4BE2 A;  4IHY A;  2Z5U A;  1R5G A;  3K1M A;  1ZG5 A;  3CDL A;  4PJ0 C;  3HUG B;  3H92 A;  1XGS A;  4ZZD A;  1MBE A;  2LC2 A;  4RAZ A;  2BOL A;  2WAQ N;  2X6X A;  3CCQ I;  4XN3 A;  5KAF C;  3KCC A;  4FT8 A;  3CCJ I;  2ZSI B;  2OPT A;  4I0B A;  4A3C J;  2L9S A;  2QKL B;  5ILV A;  3F9K A;  3T1B A;  4Q4Z F;  3QP6 A;  2DW4 A;  1RI7 A;  4RAY A;  1MDM B;  3ERM A;  3EUH C;  2GLO A;  1KGS A;  1Q1H A;  2VKE A;  2Q1Z B;  3OMY A;  2B7E A;  4FCY A;  1X1A A;  4XOP A;  3CUO A;  3CP2 A;  3BT9 A;  1Z3X A;  5K7H A;  2DOD A;  3ROU A;  4BYY A;  4L5I A;  3S93 A;  3OR2 C;  2RVC A;  2VT3 A;  3RCO A;  2M34 A;  5DYM A;  1C0W A;  3S32 A;  4Z6Y A;  2KDO A;  1KQ9 A;  1FT9 A;  5EEA A;  5CQG A;  3BR0 A;  2A3S A;  3D0S A;  3ZQC A;  5EEG A;  2VT2 A;  1OFC X;  2XPU A;  3KE2 A;  2EFW A;  2D45 A;  2KIQ A;  2LKS A;  4XQF A;  2DQR A;  5L3C A;  3RJP A;  4LD5 A;  2A6E F;  5ERI A;  1SMT A;  1YX3 A;  1Z21 A;  1FOY A;  4U7D A;  1AKH A;  2BY0 A;  3K2Z A;  3L9F A;  1IXS B;  1T56 A;  3TMO A;  3I4N J;  2VKV A;  2Z16 A;  3BR5 A;  4LLL A;  3SZT A;  4CIC A;  1ON1 A;  3AG1 H;  1R00 A;  2W24 A;  4E4H A;  2STW A;  1JE8 A;  1XCV A;  2MD5 A;  4CSW A;  4IX7 A;  5FKO A;  3K69 A;  4E7S A;  2CSO A;  3CMA I;  4M3G A;  3HTS B;  3IRQ A;  2IA2 A;  3DEW A;  4ESB A;  1MNE A;  2ACJ A;  3FHN A;  2LRD A;  5J8C A;  2EIJ H;  4KYW A;  2QQB A;  2M4K A;  3P9C A;  5E8I A;  1U5T B;  2OQG A;  3RKY A;  4R8H A;  4Y15 A;  3M7G A;  3WE3 A;  2M87 A;  3QOP A;  2K02 A;  1VQL I;  3F21 A;  2H09 A;  1FBQ A;  2DA5 A;  2DT7 B;  3G3Z A;  1EH8 A;  2Q8K A;  4BUP A;  3K4L A;  4CYC B;  1X3Z B;  3B6A A;  3U2R A;  4ZDP A;  1A5J A;  1TQP A;  2NVT J;  4GRI A;  1V55 H;  3WG7 H;  1G3W A;  3QAH A;  4AYB A;  3ZR8 X;  2CUE A;  2ICW G;  1Y8Q B;  3TO6 A;  5FRO A;  3OYI A;  2EB7 A;  4BDZ A;  3VYU B;  4I2O A;  1XGM A;  2VPL A;  3E5Q A;  5CVV A;  4XIC A;  3LSR A;  2HFH A;  1I3Q J;  5DUK A;  4YFN F;  3TP0 A;  2HI3 A;  4XL9 A;  1S9H A;  1WSU A;  5IP7 J;  4CA0 A;  3TW6 A;  1GXP A;  1MGT A;  2KLO A;  1EH7 A;  4AIH A;  4A3B J;  3PL8 A;  1X3W B;  2ELJ A;  3VB2 A;  2QWW A;  3FKJ A;  4MO7 A;  1S7A A;  1R5I D;  1LJ9 A;  2I8D A;  5HLT A;  3WG9 A;  4MFD A;  4V2F A;  1ZLK A;  3GTL J;  4DIQ A;  3W2A A;  2XRN A;  2CFO A;  2ME6 A;  4M72 A;  3S3O A;  5LGT A;  2E7X A;  2OZ6 A;  4KA4 A;  1ACI A;  5IPA A;  3TP3 A;  1K78 A;  1J0R A;  1MW7 A;  2W57 A;  1VF9 A;  2K4B A;  2L9N A;  4RGX A;  2W48 A;  1ZKG A;  4OIR F;  2B0L A;  2LH9 A;  5GAD J;  4EMS A;  3H3V K;  3HYI A;  1MMN A;  2RRE A;  1FMW A;  1USS A;  4UVC A;  2IBD A;  4XLC A;  4DYQ A;  3I56 I;  1TQM A;  1YIO A;  2OQR A;  3ZQH A;  4L5E A;  2QA4 I;  1K7A A;  1XG1 A;  3IHU A;  2VJ5 A;  3NQO A;  2KFD A;  1A6I A;  3RPU D;  1YG2 A;  1UMQ A;  3P7N A;  3F23 A;  4BAC A;  4PGH A;  1R6R A;  4D7M A;  2Z2S B;  1QPI A;  3WU2 C;  5E1W A;  1BOB A;  2MLG A;  2VBZ A;  2OF7 A;  3IRR A;  1MIJ A;  3IH3 A;  1EF4 A;  3QU3 A;  2NRA C;  4Q5S F;  1R22 A;  3MCZ A;  2O03 A;  4NQW B;  2ZC2 A;  3LAJ A;  2O3F A;  2LKX A;  2V6E A;  1QVT A;  2VE9 A;  1UB9 A;  2PFB A;  2EH3 A;  2L7F P;  2XKP A;  3ZGK A;  1WGX A;  1QRY A;  2FBI A;  3HOT A;  1KU3 A;  4Y33 A;  2R7D A;  5TIS C;  1GUU A;  2VQH A;  1X3U A;  1LE8 A;  4M9Z A;  2QQ9 A;  2NVX J;  4RB2 C;  1MKM A;  1JJ6 C;  2K40 A;  3HPH A;  2V9K A;  3DBR B;  3GEZ A;  2LDU A;  5AON A;  4A3F J;  3S15 J;  4YEL A;  1EH6 A;  1DU0 A;  3HJE A;  2MYS A;  1QHG A;  1P4X A;  3JSO A;  1IN4 A;  3PNT A;  3ZMS A;  4XBF A;  2KRC A;  1TZL A;  4D9J A;  2PMZ N;  3WTT C;  1B8I A;  1DGW Y;  4A2U A;  5A2Q K;  3PQK A;  3M1C A;  1XSV A;  1G3T A;  2W1O A;  3LSH A;  3IC7 A;  3NAU A;  3A0B C;  1KYW A;  3O3K A;  4Q47 A;  3EUK L;  5L3G A;  2V9P A;  2Z3Y A;  2XAU A;  1E3H A;  4Y52 J;  2EQR A;  4ITV A;  3TDZ C;  4KNY A;  2QSG X;  3W6V A;  3KFW X;  2RV8 A;  5E3N A;  3RKX A;  4GFB A;  3SHF A;  1O57 A;  3BCB A;  1Z05 A;  2LOO A;  5FKK A;  1SD5 A;  1XSX A;  3E6C C;  1ETK A;  1QZE A;  4LK0 F;  1U5T C;  2HKO A;  2KHM A;  3ABL H;  1VQ5 I;  1FX7 A;  2EIN H;  4HEA 2;  3V8K A;  4CCO A;  4WWC A;  1D0Z A;  2F5V A;  3HDD A;  2QLZ A;  4IHX A;  4KIB A;  3M07 A;  1W5T A;  2MG4 A;  2XAG A;  3F3X A;  2NS7 A;  2VIX A;  3BWG A;  3DCF A;  3LST A;  2XB0 X;  4P5O A;  5FKM A;  1SFU A;  4D7N A;  2DJN A;  1IW7 F;  4H0E A;  3H5R A;  3GBG A;  2GWR A;  2WV1 A;  1IRX A;  1LKX A;  1FWZ A;  4MEX F;  4HX8 A;  3FMS A;  4AC0 A;  1GV2 A;  1BR2 A;  2A5W A;  4BXF A;  2QF7 A;  3H5N A;  2VI6 A;  4DNC A;  4QIW N;  2R7Q A;  2KIM A;  1WRJ A;  2OD5 A;  3A0H C;  5K5R A;  4CCJ A;  3QP5 A;  4EV0 A;  3S1R J;  5J47 A;  2EPF A;  3ML6 A;  5DS9 A;  1PYV A;  1VQO I;  1AKH B;  5FLX K;  3H9J A;  2G7U A;  2OA4 A;  3VEP A;  1PP7 U;  4A5M A;  2TRT A;  3IWF A;  3QWL A;  2E1M B;  3DLA A;  3IV5 A;  3GCM A;  4HNU A;  4EJT A;  2I10 A;  4P1W A;  3KP5 A;  3E6B A;  4XON A;  4RGU A;  1FSH A;  2DU9 A;  5IYC J;  4MTD A;  1F5T A;  1E3P A;  3TOB A;  4LLN A;  3K4M A;  4HNV A;  2LKP A;  1J5Y A;  2LY1 A;  3N97 A;  4RB1 A;  2H6C A;  1RUN A;  3AG2 H;  3TL4 X;  4BQQ A;  3CF2 A;  3MN2 A;  4A12 A;  4XLE A;  1KZH A;  1LB2 A;  5IT3 A;  2JQ7 A;  2VBW A;  2R7R A;  1LDJ A;  4DGW B;  4JOM A;  1GHC A;  2XB5 A;  1E0E A;  3HOW J;  3I9V 2;  5GTH C;  1OR7 A;  1WH5 A;  3ABT A;  3NEU A;  3ZRG A;  1YIJ I;  1TWG J;  2BZT A;  1HF0 A;  2FE3 A;  3CCM I;  1IJW C;  5IOY A;  3Q0V A;  1R49 A;  2LSO A;  3E5X A;  3DBL B;  3RZO J;  2JK3 A;  2OJE D;  4P55 A;  3S1Q J;  4N9I A;  5D8L B;  4LGW A;  2ZJP F;  4CH7 A;  2MAB A;  2UV1 A;  3DWL E;  4NHJ A;  3LFK A;  4IXA A;  2JA6 J;  1W4M A;  2FXA A;  3OY9 A;  3EYY A;  2HZT A;  2PBI A;  3RKQ A;  4C2T A;  1ZEL A;  2NYX A;  2V7F A;  4OWR B;  1G3Y A;  1Z6R A;  2XAQ A;  4RM3 A;  2B9S A;  1FYM A;  2KKO A;  3GFJ A;  2R5Z A;  1QU3 A;  2NNN A;  3BQY A;  5KHD A;  3RKW A;  3QOD A;  2DMN A;  4RB0 A;  1R9T J;  1Q1V A;  3ZMT A;  2DA2 A;  5FRM A;  1T95 A;  1Y56 A;  1W1W E;  2ZBK A;  2YSR A;  4KIC A;  4Y13 A;  2ZJR F;  3GXO A;  4OMY A;  2X1D A;  2XDV A;  1IAW A;  2H8R A;  1K78 B;  4UUV A;  4E70 A;  2LY2 A;  2RKH A;  2G9W A;  3P5J A;  5D4R A;  1JKR C;  1B59 A;  4S05 A;  2L4M A;  2EZK A;  3PFY A;  3KYC B;  3OWT A;  3GZ5 A;  2L54 A;  4EGY A;  3GTM J;  2IGN A;  4ZH4 F;  2BY2 A;  1OCP A;  1D3Y A;  4I7H A;  2AQE A;  3JRC A;  2X1C A;  3X2Q H;  3LA7 A;  3EET A;  1WCM J;  5D5W B;  4QSH A;  2CUJ A;  2E7W A;  2L4A A;  1PUE E;  1ETO A;  4YII A;  5GAE J;  2H1L A;  3C18 A;  2WY7 Q;  1XDS A;  3DF8 A;  3T0Y A;  2FEZ A;  2LTP A;  1Y1V J;  1ODD A;  1OKR A;  5D4S A;  3PUF A;  2YU3 A;  3K0L A;  4MIM A;  3WGI A;  1XC5 A;  3FXL A;  1H89 C;  4KMF A;  1U3E M;  3VPR A;  4AWX B;  3LL7 A;  2BY3 A;  5M5W J;  1WJD A;  2LF8 A;  1R1U A;  2AO9 A;  3TOA A;  5L3F A;  1FOK A;  1W7P D;  5K7F A;  3OIP A;  1JUS A;  3ULQ B;  2FOW A;  2XVC A;  2H1K A;  3CO6 C;  2X1E A;  4B48 A;  1T0F A;  1OJL A;  5JLW A;  1LE8 B;  1MBH A;  2DMU A;  1OCT C;  4JBA A;  2ELK A;  2VPR A;  3CDI A;  3RIR A;  3MKZ A;  2K3P A;  4EEF G;  4HLX A;  2CW0 F;  5FRN A;  1IRZ A;  5E8G A;  2QZ8 A;  1G8X A;  1ZHF A;  4N0B A;  1LQ1 A;  1W36 C;  1I6X A;  1EKE A;  3QYF A;  3CLQ A;  1B8I B;  4DBQ A;  2J5O A;  1FNN A;  4MLO A;  1FYL A;  2ZME A;  2HDW A;  1UG0 A;  1SD4 A;  3AG3 H;  2EFN A;  1BC8 C;  4KIF A;  3S2H J;  4AU7 A;  1JT6 A;  2HXI A;  3LOC A;  1IGN A;  1GXQ A;  4G12 A;  2E1M C;  3KEO A;  2Y48 A;  4ETS A;  3T5X A;  2BV6 A;  4L9T A;  3GO5 A;  3FM5 A;  1NK3 P;  2EFO A;  3H9Q A;  1T38 A;  4KT6 A;  3FHZ A;  3C2H A;  1L0O C;  2A68 F;  4I98 B;  5LEK A;  2AXL A;  2R5Y A;  3D5L A;  2JVH A;  4MEY F;  3DKW A;  2DA4 A;  5HOD A;  2XGE A;  2K9N A;  5JHF A;  1QZZ A;  3VSK A;  1OQY A;  5FKN A;  2STT A;  1Z1D A;  3E6M A;  2WV0 A;  4I02 A;  5HVQ C;  2GIZ A;  2ZXW H;  2OZU A;  2W84 A;  3ESW B;  5FD6 A;  1TT5 B;  5EYR A;  4PGG A;  2HPI A;  4N4N B;  3RTR A;  2MGQ A;  3F8B A;  5HDN A;  3A02 A;  4I6Z A;  3LAP A;  1ZR2 A;  2L7Z A;  5L3D A;  4JX4 A;  3BG3 A;  1NK2 P;  1SC7 A;  3PIO F;  1GVJ A;  2WWY A;  3LA2 A;  3MEX A;  4YG2 F;  2JPB A;  1O4X A;  4F93 B;  1FSE A;  2P6S A;  3G71 I;  1FYK A;  3PNY A;  4K2E A;  4OU0 A;  4U0V A;  3V7R A;  5ILU A;  3G4S I;  4RLQ A;  3W3C A;  3J81 Z;  1R1T A;  4PSW A;  5IT9 K;  3MZY A;  2ADU A;  1Z6T A;  1RR7 A;  2EZH A;  3G1L A;  4XNF A;  2DPD A;  4HV6 A;  3GTK J;  1R5H A;  1H9G A;  2P7V B;  2YUS A;  4A0Y A;  2QYO A;  1KU9 A;  3JRA A;  1KU2 A;  2JA2 A;  3E97 A;  5D5U B;  4I0A A;  3NWS A;  2KJC A;  5F64 A;  5TJJ A;  3VYS B;  4F92 B;  1GVD A;  1W0T A;  4HLY A;  4AUX A;  3BG9 A;  1APL C;  2ZJQ F;  2F5E A;  2JA7 J;  4F91 B;  1WZ2 A;  1YJW I;  4IQ4 A;  3KYD B;  2HYF A;  2W25 A;  1MJB A;  4FET A;  5CVI A;  1HSJ A;  3OL4 A;  3A1Y A;  1U6G A;  3E6D A;  1S72 I;  3HGY A;  4IL6 C;  1D5V A;  3FBI B;  4EM1 A;  1ZTR A;  1SFO J;  2BGC A;  1I39 A;  3EPZ A;  5F1J A;  2O61 A;  4U0W A;  5EF6 A;  2I5U A;  2JSC A;  3DLL F;  4IRH A;  3GX4 X;  1BI2 A;  1ZYR F;  3C3W A;  4L0Y B;  3CD6 I;  3W2V A;  1VQ9 I;  4RB3 C;  1P6R A;  3B02 A;  2PLY A;  3QPS A;  2X85 A;  3QRF F;  5FJ8 J;  3K7A J;  1WJ5 A;  2DK5 A;  2BW3 A;  2UZK A;  1YJN I;  5BS6 A;  4PFP A;  1K61 A;  2V1U A;  1TL8 A;  4EQQ A;  3OYJ A;  4C9Y A;  3JRE A;  1IN8 A;  1TWA J;  2L0K A;  4OIN F;  4OAZ A;  4BEH A;  2R5Z B;  2CV0 A;  2GXA A;  3CCR I;  4W97 A;  4O3M A;  2HDD A;  4QPQ A;  2FOK A;  3GLX A;  5CLS A;  4MQ9 F;  1XD7 A;  1FTT A;  3GME A;  1XS9 A;  3JAM Z;  1ZK8 A;  2IW5 A;  1XB4 A;  2M7B A;  3VSL A;  2E1O A;  5BPI A;  2HZD A;  4JK1 X;  3I3L A;  4IHT A;  2A6H F;  1WH7 A;  3K1N A;  4PJM A;  5DTD A;  3G2B A;  1I1S A;  3OIQ A;  1P7I A;  5TRD A;  4ZYA A;  3K4N A;  3G6E I;  4HAM A;  5E17 F;  3H3Z A;  5IP9 J;  2NVU B;  1U0J A;  2Y0S A;  5K7Z A;  4BAY A;  1HW5 A;  5GAG J;  4HF0 A;  4LIU A;  3GFL A;  2CW7 A;  1RKW A;  3QYE A;  3PSI A;  3FMQ A;  3JSP A;  2H8W A;  4Q48 A;  1JGS A;  3TED A;  3IH4 A;  1JJ8 C;  5C4X J;  1MH3 A;  3M1E A;  2FQ3 A;  1JI8 A;  4HBL A;  1YLF A;  3FX3 A;  4A0Z A;  4U87 A;  3SZP A;  3WGH A;  3BTI A;  4DYC A;  2LLK A;  2DPU A;  2AHQ A;  4XKW A;  5CKT A;  2E60 A;  3ZQG A;  1P7J A;  2XKO A;  4UB8 C;  4OMZ A;  4BE0 A;  4EJU A;  5D6E A;  2JA8 J;  2DN0 A;  1T39 A;  2KIF A;  1TNT A;  3CTA A;  2VXD A;  4G6T B;  1G2H A;  5DUI A;  1PDN C;  1IRF A;  1NTC A;  3F22 A;  5ILS A;  2H94 A;  1MMS A;  2E1N A;  2CS3 A;  2K5C A;  2W4S A;  1IN7 A;  3G73 A;  3ZOB A;  3J80 K;  3S14 J;  2IRF G;  2OCC H;  5FB2 A;  4HRI A;  4BBR J;  4ZYG A;  5LHG A;  2G7H A;  3HC7 A;  4BH9 A;  3DKX A;  2DYS H;  1N75 A;  2Q2E A;  3BRO A;  3OSF A;  2IA1 A;  4IEJ A;  2ZME B;  3WGG A;  2KZG A;  3FKI J;  4AYB N;  3WU1 B;  4ZJZ A;  3WTX C;  1Z3Y A;  4RBO A;  5HNF A;  1BR4 A;  4JX5 A;  2XAJ A;  2KP6 A;  3BZC A;  4RLF A;  5F04 A;  1TQI A;  4EJV A;  2OCE A;  1O3T A;  2EV0 A;  4EGZ A;  2HXO A;  2IXS A;  1MBJ A;  5DCM A;  4HSR A;  1P4A A;  2QQA A;  3K70 C;  2LBF A;  3FXJ A;  3O2P E;  4LOC A;  2VKD A;  4M9X A;  5IY5 H;  1BJA A;  2R5Y B;  3V7S A;  2WB1 A;  4C2M J;  3SDG A;  5AIQ A;  4C3H J;  1RET A;  4A3G J;  4PJN A;  3H36 A;  2L2O A;  4ENN A;  2E34 A;  3OL3 A;  1X2M A;  1R4M B;  2LRE A;  2QQ8 A;  5KAI C;  3GF2 A;  4XR6 A;  3L2V A;  1DU6 A;  3F8C A;  2HVR A;  4FQG A;  1MMG A;  5E20 A;  4F3Q A;  1PUF A;  1OR7 C;  2HGC A;  2M5W A;  3HOX J;  3JRG A;  3KIO A;  2VC1 A;  2DFH A;  1EV7 A;  2FMY A;  1K4S A;  2D5V A;  3CC7 I;  3SEZ A;  4LIT A;  1CF7 A;  1FP2 A;  2IVM A;  2P5K A;  3CC2 I;  4U0Y A;  5EGO A;  4C2U A;  4I76 A;  3L09 A;  1B4A A;  4EM2 A;  1FOX A;  5ICF A;  2EIL H;  1HXD A;  3D1N I;  2L01 A;  4M9S A;  3OYF A;  1V5G A;  3CJT B;  4XMY A;  2DFE A;  5EJC A;  3J7Y J;  1RR8 C;  3R61 A;  3HSF A;  4BHP A;  3DEE A;  3WOD F;  3S17 J;  1IRG A;  3T8T A;  2F48 A;  5J8F A;  2YX7 A;  2BBY A;  4YEJ A;  4S0H B;  4C3J J;  3HPG A;  3H5A A;  4B3A A;  1LDD A;  4ZZL A;  1U78 A;  4IHV A;  3CMY A;  2HNH A;  3S16 J;  4G7O F;  1Y1W J;  1YRN A;  3I54 A;  4W1U A;  2CQ7 A;  2KQR A;  5D6F A;  1X2N A;  4WX9 A;  1TP4 A;  1BN5 A;  2COB A;  2M8E A;  1Y0N A;  2VN2 A;  3DU5 A;  3I53 A;  4XOR A;  1EJ9 A;  1YW9 A;  3OR1 C;  5AIP A;  2Y0M A;  4JX6 A;  3ECH A;  2E1C A;  2BVL A;  3HOV J;  2NAZ A;  2ZXJ A;  2R0Q C;  3CCE I;  5CJ9 A;  1IO2 A;  2VQL A;  3BJA A;  3KP3 A;  3MFK A;  1MSF C;  2V79 A;  2XSJ C;  1F1Z A;  4YFX F;  2OBP A;  4Y4R A;  2HTS A;  3BR1 A;  5F27 A;  2HR3 A;  1AOY A;  3ABU A;  2BW3 B;  2VJJ A;  1Z7L A;  3KPH A;  3TDU C;  2A6T A;  1MBK A;  2K7L A;  4LLG F;  1JUP A;  5LRS A;  3SZG A;  1YW7 A;  2R7U A;  4MGR A;  1ENH A;  4OIP F;  1HBX G;  4BEH B;  3RPU A;  3PUB A;  4FE7 A;  1QVU A;  2CYY A;  1G59 A;  3HOU J;  4WXH A;  4Z2Y A;  2QGU A;  2KRH A;  3E1S A;  4GGG A;  1LPQ A;  5L3B A;  1D8J A;  4QPO A;  3P9K A;  4AVZ A;  4CZC A;  2DT6 A;  1VQM I;  1T0F C;  5HS9 A;  1XPX A;  3K6G A;  4JYK A;  4KFC A;  2CFX A;  1B72 A;  2R7Z J;  2D1V A;  2A61 A;  4EM0 B;  3DU6 A;  2FU4 A;  4LB5 A;  2DO7 A;  1UHM A;  4DBR A;  2DMQ A;  3E5U A;  2YR2 A;  2TDX A;  5KVR A;  3RDI A;  3BPV A;  1BW5 A;  3GLL A;  4FX0 A;  3LSP A;  2ZME C;  2L7M P;  4ZC3 A;  2QBY A;  1WJF A;  1U8R A;  2OU2 A;  3ASO H;  4N9H A;  5E1Z B;  3WHC A;  1LFB A;  3SYT A;  2K85 A;  2B63 J;  5BPD A;  2OTJ I;  2LR8 A;  2UUZ A;  1J09 A;  5KK1 A;  1DP3 A;  1REP C;  2MC3 A;  3WTS C;  2ZFW A;  2R7V A;  1X4P A;  2Q0O A;  1J9I A;  3C2B A;  2KIU A;  1MJA A;  1R1V A;  5K1Y A;  1ZAO A;  4RMN A;  5KNL A;  2VB6 A;  1JKQ C;  4UVB A;  2FX0 A;  4A3M J;  1ZN2 A;  5HS7 A;  2COM A;  2ESH A;  1BI1 A;  5CVU A;  2GA1 A;  4EVI A;  2VOP A;  1G3S A;  4OIQ F;  2HYJ A;  3LSJ A;  3FXM A;  1ZAR A;  3FIW A;  3LWF A;  1UCR A;  2MH9 A;  4CCK A;  3MZ8 A;  2L9R A;  1JTX A;  1Y6I A;  1UAA A;  4M3E A;  4F52 A;  2FRH A;  3MQ0 A;  1BR1 A;  1I6H J;  2FD5 A;  3KZZ A;  4XSX F;  3ZQ7 A;  4E7H A;  2V9V A;  5DM7 F;  5LEJ A;  4FHT A;  3DPT A;  4G94 A;  4HZF A;  2CRG A;  1MZB A;  2WBM A;  3BG7 A;  2GIV A;  1WJA A;  3JTG A;  2EJR A;  1WJE A;  3G1M A;  4HF1 A;  3ONQ A;  1YTY A;  2TCT A;  2Q2E B;  1X1D A;  4M3D A;  3OS1 A;  5J3L A;  2R7S A;  3BOQ A;  2HEO A;  1VQP I;  1ORK A;  1X58 A;  2M4G A;  3Q0W A;  5FFZ A;  5HS8 A;  1SD7 A;  2VKH A;  1R71 A;  2EZI A;  1BW6 A;  3R0J A;  3L2R A;  1OMI A;  1HA8 A;  5GP9 A;  5DCM B;  1U9N A;  1G4D A;  1LVK A;  2LBF B;  2HOT A;  4KN7 X;  1XMA A;  2ID3 A;  5ICG A;  2W85 A;  1MD0 A;  2F6C A;  1FBS A;  2KPM A;  2VXZ A;  3HZJ A;  3OYK A;  4ZDO A;  2FQ4 A;  2LYC A;  4DW6 A;  2K9L A;  2JPC A;  2XC7 A;  4QWQ A;  2CWE A;  1UHW A;  2AS5 F;  4D1Q A;  1U2W A;  4A3D J;  4XRS A;  2K9Q A;  2ISZ A;  3IUO A;  3FWE A;  4MTE A;  2P8T A;  3JRB A;  4UUT A;  4EJO A;  5D5V B;  5A2Q Z;  4KDP A;  2CU7 A;  1X19 A;  2DDB A;  2PN6 A;  4BS9 A;  3WTV C;  2DDA A;  1YX5 A;  1HQC A;  2CV2 A;  1LDK B;  2VAS A;  4AIJ A;  2O0Y A;  1PUF B;  2QKM B;  2MH2 A;  5K5Q A;  1BI3 A;  4PDK A;  4S04 A;  5IYD J;  3HKZ A;  3DKY A;  2E2I J;  1FY7 A;  2O9L A;  4XKC A;  1VQ7 I;  2E71 A;  2IGO A;  1XTA A;  2IGK A;  5EEH A;  1CF7 B;  1RKT A;  2WAE A;  5DD4 A;  2QM3 A;  3MKY B;  5EGO B;  3I58 A;  3ZQQ A;  2P4W A;  3DV8 A;  2RAE A;  4A3L J;  1PP8 F;  1FIA A;  3GTO J;  2Y75 A;  3A03 A;  3R6S A;  3BTC A;  3SJM A;  4L9J A;  1XSD A;  5H20 A;  2M2E A;  2DBB A;  3JRF A;  2WAD A;  4ENM A;  3ZMV A;  4CXF A;  1XMK A;  2LP0 A;  2DAO A;  2CV1 A;  3CCU I;  3K4B A;  1H9T A;  2L9V A;  4NDL A;  1SFK A;  2XHK A;  3S3M A;  3SQN A;  3Q0U A;  1QBJ A;  1ZH5 A;  1FOW A;  5B1B H;  1W0U A;  3NWT A;  5J6X A;  4PJL A;  1YRN B;  1BM9 A;  1BBY A;  2DTZ A;  1ZR4 A;  3OOU A;  4L0Z B;  1TNS A;  4OAY A;  2KRF A;  1UZC A;  3OYG A;  1HLV A;  4IF4 A;  1LUJ B;  3F8M A;  4WXC A;  3TO7 A;  2K4J A;  5FLX Z;  2IT0 A;  1WHU A;  3V4G A;  2JT1 A;  1RZ4 A;  2LK2 A;  1LEB A;  2J5P A;  3L1P A;  4IO9 F;  2JUC A;  2VLA A;  1CGP A;  5LGN A;  3CJN A;  2AXT C;  4XSZ F;  4I09 A;  3FK6 A;  4N4O B;  1LNW A;  5M5X J;  4M3B A;  1OYY A;  5DDG A;  4RAF A;  5F1R A;  1MMA A;  3L2Q A;  3FDY A;  5J1U A;  3OYC A;  3ZMD A;  1TWC J;  1QO0 D;  1Y8R B;  3OYH A;  2R7F A;  1MSE C;  3KP4 A;  3LMM A;  4LFU A;  1O7F A;  2HOA A;  4J19 A;  3FK7 A;  5IOZ A;  3M8E A;  3C7J A;  1DQU A;  3LQR A;  1Z67 A;  4O5V A;  3SDB A;  2XGC A;  3FXQ A;  2MW8 A;  5IP6 A;  1QZY A;  3C1D A;  5F0F A;  4UXN A;  3DXJ F;  2M45 A;  2CQN A;  2QVO A;  4KIG A;  4XLP F;  4A3K J;  2EZL A;  5FD5 A;  5KCM A;  5JHU A;  3KEY A;  3WTW C;  1YHQ I;  4IHW A;  3LSI A;  1V54 H;  4HF2 A;  5J1Y A;  1Y0U A;  3U9G A;  4HX4 A;  1I50 J;  4CCM A;  1B72 B;  1OCZ H;  2VOD A;  3CMM A;  3OYD A;  1WI3 A;  4J01 A;  2YS9 A;  2BE5 F;  1T08 B;  4UV9 A;  2VJI A;  1KQ0 A;  3UKG A;  3ELK A;  4G8X A;  5J1R A;  1E17 A;  1W7P A;  1LEA A;  3GUD A;  1JXS A;  4ENK A;  2CH0 A;  1GT0 C;  1AHD P;  2GOM A;  3I64 A;  4ENJ A;  3M4O J;  3PM1 A;  2MLK A;  2QBY B;  2UXX A;  1UG2 A;  3D5S C;  5JVG F;  5DD8 A;  3OYB A;  2P6T A;  1OPC A;  3DEU A;  4D5F A;  1YO5 C;  2ISY A;  4CCL A;  3HBL A;  1ULY A;  4ON0 A;  3TGN A;  3WHB A;  4IQJ A;  1K4T A;  3N05 A;  3GTG J;  3OYE A;  1XMX A;  4F55 A;  3LNQ A;  5E3M A;  2GOX B;  3CQZ J;  2P7C B;  5J40 A;  4B4C A;  3GYH X;  3MMY B;  5E18 F;  3ZMZ A;  3HOZ J;  4CYD A;  1R7J A;  1MMD A;  2L02 A;  1G6N A;  3OS2 A;  5F0C A;  4FAS D;  4JQF A;  4BQO A;  3IH2 A;  3GTJ J;  3CCV I;  1VQ4 I;  3M8F A;  2A69 F;  1HOM A;  3TO9 A;  4GYI A;  2ZSH B;  2M8G X;  2VJ4 A;  2VBX A;  4XRS G;  3OV8 A;  4B47 A;  4E6K G;  1ZRC A;  2WAF A;  1HW2 A;  4CUG A;  2M0C A;  3GW2 A;  1D1B A;  3BC8 A;  1ETQ A;  1DDN A;  2F4I A;  4BJT A;  5BQT A;  4II3 A;  1IUY A;  2FNA A;  2ECB A;  3I59 A;  2CGP A;  1SD6 A;  4M6V A;  4M71 A;  3BDD A;  3ABM H;  4M74 A;  1YQA A;  2HQN A;  4XM3 A;  1DPR A;  3FXR A;  1ZRF A;  1TC3 C;  2ESN A;  1ON2 A;  2KT0 A;  3CCY A;  4WF2 A;  1S7O A;  5HLI A;  1QPM A;  4P9U A;  1IF1 A;  3RI4 A;  3I5U A;  4AD9 A;  4ZYD A;  3GWZ A;  3HRT A;  1JKO C;  1B1B A;  2DMT A;  1QHH D;  3IWZ A;  3LFU A;  3FZV A;  3KET A;  3JRD A;  1VQN I;  1PJR A;  3BP8 A;  2ZXI A;  3KX2 A;  1YYV A;  3OSG A;  4C30 A;  4YRV A;  1Z7U A;  2W82 A;  5BOX A;  4IVN A;  5GAH J;  4GYG A;  3COA C;  3KLN A;  1IDY A;  4U88 A;  3W2W A;  3GTP J;  1X1B A;  2JN6 A;  2LD5 A;  4E7Z A;  4A3J J;  1FMV A;  4XLF A;  2EWN A;  3AG4 H;  1TW2 A;  2GZW A;  3DBH B;  4PZJ A;  4A3I J;  1TW3 A;  3DTI A;  2LF7 A;  1P4W A;  2MBF A;  2GA2 A;  5DEQ A;  2DA6 A;  2VC0 A;  4A5N A;  3LSG A;  3V8L A;  1IC8 A;  2BHY A;  2Z9O A;  1D5Y A;  3J7A O;  1K6Y A;  2HKX A;  5F0H A;  2QCO A;  1SMY F;  4FX4 A;  2K3F A;  4PUS A;  2O6G E;  3U1K A;  1XGN A;  2CQQ A;  2Y0S N;  4R79 A;  3V7C A;  3PIP F;  3I71 A;  2P5V A;  3QPT A;  4HX7 A;  3VOE A;  5ED4 A;  1DUX C;  3KP6 A;  2QSF X;  4QLC U;  4E7J A;  4RDU A;  4PJJ A;  2O8X A;  4TV7 A;  2M1B A;  3WU0 A;  5LHH A;  1P2F A;  4P96 A;  3IAS 2;  3OYN A;  5EDN A;  4RGS A;  3GZN B;  2H6B A;  3DP7 A;  4LIV A;  4A6E A;  5FFX A;  3O6B B;  3HM5 A;  1UEL B;  2V1D A;  2ME0 A;  1WJB A;  3BR6 A;  3E3V A;  1ITY A;  4XID A;  2PMH A;  2VL8 A;  1LVA A;  2XPV A;  1HKS A;  1RC9 A;  2X0L A;  4A0X A;  2PG4 A;  2XRO A;  1UJ8 A;  2D2W A;  4RAG A;  1VI0 A;  4RS8 A;  2C6Y A;  1RPW A;  2Z33 A;  1K79 A;  2IS1 A;  1TTY A;  3KLO A;  1ETX A;  4R1H A;  3OS0 A;  2MC4 A;  3BLY A;  5IT9 Z;  3B73 A;  2XGX A;  3CCS I;  3EQL F;  2VON A;  4B43 A;  3V8J A;  1W36 D;  2ZKZ A;  4ZYH A;  2PMU A;  2FF4 A;  2Y69 H;  1FLI A;  3BTL A;  4BJ5 C;  3L00 A;  2JUG A;  1VQ8 I;  1F43 A;  1J59 A;  1KA8 A;  2OV7 A;  1XN7 A;  1IUF A;  4X6A J;  2WAQ A;  4KMU X;  2X6Y A;  1K6O A;  1IZ1 A;  4PSX A;  4AID A;  1FJL A;  1A6Q A;  4NC6 A;  3DFG A;  3UNG C;  1E2X A;  3PQJ A;  5CVJ A;  1T6S A;  4XKV A;  4HQE A;  2IPQ X;  1Z91 A;  4ESF A;  1NG7 A;  5HOO A;  1OYW A;  4A6D A;  4BHB A;  5LLQ A;  2NVY J;  2IAI A;  4EJW A;  3DTK A;  3VYT B;  2WTE A;  2ZO4 A;  4H4K C;  2FJ1 A;  5EG0 A;  2DK8 A;  2VQG A;  3K10 A;  2OTL I;  2M0M A;  3CO7 C;  4DJA A;  4KUM A;  4E7I A;  2FML A;  2VBY A;  3ZQF A;  3HHH A;  4XRM A;  2KL4 A;  3HXL A;  5HDK A;  4IOC F;  1J75 A;  2BXY A;  3RYP A;  2CJJ A;  2WB1 N;  2IS6 A;  3K4C A;  1I1G A;  2DT5 A;  4HQM A;  2O8K A;  1S6L A;  2QEN A;  5FKL A;  2EK5 A;  1D0Y A;  3SFI A;  1WJC A;  2ZCW A;  5L3E A;  1ERD A;  1ONV A;  1T2K A;  3CUQ A;  4L9V A;  3H0D A;  1ZGJ A;  1XX5 A;  2M9H A;  5B1A H;  1BI0 A;  5DCF A;  1BC7 C;  4ABZ A;  1W7P B;  2RGV A;  2F4O B;  2XGD A;  4IHS A;  2R7X A;  2V26 A;  2EA4 A;  3FXK A;  2IP2 A;  3Q9S A;  4WCG A;  4IPA A;  3FBN B;  3CDH A;  2KZV A;  4CDG A;  2DI3 A;  4BKX A;  1NG6 A;  4XOT A;  5F6F A;  2X6O A;  1Z9C A;  1JKP C;  2GM4 A;  1W5S A;  4BU2 A;  5ICE A;  2XUB A;  3SFZ A;  3ZN1 A;  2P81 A;  4XKB A;  4BY1 J;  2M30 A;  3ISP A;  3IP4 B;  1TT0 A;  2HDC A;  3IKT A;  5LD2 C;  4Y3O A;  3OYA A;  4NUB A;  2EV6 A;  4L9N A;  2HQR A;  4IJA A;  2DOA A;  5CQE A;  3CC4 I;  2DMP A;  2HTJ A;  1IG7 A;  1FBU A;  3U1D A;  2FBK A;  4BY7 J;  2W7N A;  1POG A;  3W6J B;  4LG0 A;  2R7O A;  5FGM A;  2HU9 A;  2CQK A;  2EBI A;  4PFO A;  1FZP B;  1KYZ A;  2A05 A;  1YS7 A;  2DQL A;  1RIO H;  3WE2 A;  2ETH A;  2HQ5 A;  2EFP A;  5DM6 F;  1A31 A;  2HWV A;  2V4J C;  3MAJ A;  1VND A;  2LMD A;  3I59 B;  2FBH A;  2XPW A;  2KDZ A;  3CF5 F;  3AL0 B;  3PFI A;  2UWM A;  3OYM A;  1T8I A;  3LQQ A;  3K9T A;  2PI0 A;  3N4M A;  2A07 F;  2A5Y B;  3OOP A;  2JVG A;  2ID6 A;  1YIT I;  1SVO A;  2JWT A;  2H27 A;  4CGZ A;  2MA3 A;  4X1E A;  2FUG 2;  4OOI A;  4DZP A;  4O6J A;  3DQV C;  4XK4 A;  3LSK A;  1F36 A;  2KJB A;  2Z99 A;  3BPX A;  4LK1 F;  4X0G A;  3BZK A;  1IDZ A;  4E7L A;  3HRM A;  1A04 A;  1IV8 A;  3RPQ A;  1R4N B;  5H6Q A;  2OC6 A;  3S2D J;  2G0E A;  2UXN A;  4CZZ A;  1D1C A;  3LSM A;  1ZQ3 P;  4CO8 A;  2E19 A;  5E3O A;  2LG4 A;  4WK8 F;  1XDU A;  1Z0X A;  3I0T A;  1P92 A;  3J80 Z;  4BHC A;  3E0J B;  4BNC A;  1WFX A;  2E5N A;  1S8N A;  2XAH A;  1Z77 A;  3H1C A;  5CPR B;  2O7O A;  3R4K A;  4LJZ F;  1N78 A;  2N8G A;  2PX9 A;  3DTE A;  3S8P A;  2XF7 A;  3VDX A;  1FIP A;  1SAU A;  2DFI A;  2X4H A;  3S1N J;  4A93 J;  1ZG3 A;  2RNG A;  2ZXH A;  4B1R A;  4HW0 A;  3BR3 A;  5H2F C;  5FO5 A;  1LFU P;  3TKY A;  2XF5 A;  9ANT A;  4UB6 C;  1BL0 A;  4NC8 A;  3U21 A;  1SAX A;  2DFF A;  2ZNY A;  1ZRD A;  1LFP A;  2L7K A;  4BXX J;  1R58 A;  1CQT A;  4UV8 A;  4HNT A;  2R93 J;  3L7W A;  3FM3 A;  3L2C A;  2E35 A;  4V19 K;  1TWH J;  2IA0 A;  1WQ2 A;  1N77 A;  2DA3 A;  2GXG A;  5JR3 A;  5K5O A;  3HOS A;  1E3O C;  1OIS A;  1TWF J;  4XLA A;  2VQC A;  2GAU A;  3ZXS A;  1R23 A;  5IYB J;  2RNJ A;  2WY8 Q;  1OLT A;  2X6W A;  1HDP A;  3Q5F A;  5FLV A;  2CUZ A;  3P9I A;  5JLX A;  4BQN A;  3HB9 A;  5TGT A;  3ABK H;  2DA1 A;  1NH3 A;  6PAX A;  2IS4 A;  2ZFU A;  3RZD J;  4HOB A;  1YW8 A;  4EAT A;  4UY8 I;  3EYI A;  1VQK I;  2EIM H;  2IS2 A;  3GVA A;  4B8X A;  3EUH A;  4M6X A;  3CJR B;  2F2E A;  4IRI A;  2GQQ A;  2NVQ J;  1SFX A;  3REO A;  4BDY A;  2JA5 J;  3TBI A;  3VOD A;  3QPL A;  2HQA A;  1PVE A;  2X48 A;  2NOJ B;  5HNH A;  4FTH A;  3JRH A;  1GDT A;  3PO2 J;  3MD2 A;  5C44 J;  1HC8 A;  4ASN A;  3ECO A;  3HRS A;  4A69 C;  2O5R A;  2Z1D A;  1HCR A;  3IL2 A;  3Q9V A;  2M3A A;  4WXD A;  3QYB A;  1A36 A;  3QQA A;  2DCE A;  4IRG A;  4HDV A;  5M5Y J;  3OIO A;  2PMZ A;  5C4J J;  2K9S A;  1U8B A;  3J7A Y;  4GXO A;  3K4K A;  3DPU A;  4G7Z F;  2K9M A;  1X1C A;  1FPQ A;  1DGR M;  1BIB A;  3HG9 A;  1QNT A;  2IJL A;  4NB5 A;  3A2K A;  3K70 D;  5EG0 B;  2XAS A;  2DOE A;  1JUM A;  2JRT A;  2PQ8 A;  3S2W A;  4NNJ A;  4HDU A;  1KON A;  4ZTJ A;  1WVR A;  3I4P A;  2MD0 A;  1V5F A;  3GTQ J;  2HS5 A;  2RQQ A;  1O3Q A;  1JHF A;  1GLN A;  3AAF A;  1B9N A;  3WTZ A;  3H9G A;  1XCB A;  4G9Y A;  3HSE A;  3LA3 A;  3W6K B;  1I5Z A;  3UR3 C;  2FNP A;  3CES A;  3KYL A;  2QSH X;  1S3J A;  2HOS A;  2XAF A;  1YS6 A;  3NAR A;  1X1P A;  3CUQ B;  3AL0 C;  4B44 A;  5B5E C;  1N25 A;  1T33 A;  2ELH A;  1RRJ A;  3JR9 A;  1D0X A;  5LHI A;  1V4R A;  3HEF A;  3R60 A;  1JT0 A;  3BJO A;  3QU6 A;  2JZY A;  3BG5 A;  4V2G A;  3K2A A;  2XV4 S;  4HYE A;  2P5L C;  4OIO F;  3WTU C;  1IN5 A;  3HKZ N;  2EV5 A;  4Y17 A;  4NC7 A;  5GPC A;  3ZPL A;  2R4G A;  2V6C A;  3H3U A;  4ZTF A;  2RDP A;  1IN6 A;  2GXB A;  3JTH A;  2BYV E;  1WI9 A;  2DLL A;  2D1H A;  2HVS A;  1M1E B;  2EFQ A;  3AFH A;  4UHT A;  1FC3 A;  2EA2 A;  2JRM A;  1MBF A;  3HHG A;  4ZDL A;  5GTI C;  2E2H J;  4DOZ A;  2Y2Z A;  3FMR A;  2HPM A;  2PJR A;  3O8G A;  3A01 A;  2MSY A;  2JTV A;  1O3S A;  1H8A C;  1HW1 A;  1STZ A;  3J7Z I;  3QPH A;  4BJ6 C;  4UUS A;  2IGM A;  1SEU A;  1GV5 A;  2Y31 A;  4LG0 B;  4HA8 A;  1V5E A;  4D0P A;  2ZNZ A;  5M3F J;  5HDG A;  1DPU A;  3MKL A;  4I01 A;  3SEQ A;  3HRU A;  1ZGA A;  3EUA A;  1FEX A;  2E2J J;  3RYR A;  3ZQI A;  1ETV A;  4YFK F;  3AKZ A;  1D8K A;  3HGG A;  3BR2 A;  3VYR B;  4IKF A;  5CVR A;  3BCA A;  4PK4 A;  3KZY A;  1VZ0 A;  3OYL A;  3JCU C;  1J2X A;  3I55 I;  4ZYE A;  3S1M J;  2LY9 A;  2BXZ A;  3FIS A;  4BL0 B;  2E5Z A;  3CCL I;  1BOA A;  3BZ6 A;  1MBG A;  2PJP A;  3HSR A;  1SVM A;  3T8R A;  3KEQ A;  5D8K B;  2WC2 A;  5HLG A;  1K83 J;  4HV5 A;  1ETW A;  3G1O A;  2DOF A;  3HUG A;  4GO1 A;  4Y7N J;  3CME I;  2K27 A;  1VFC A;  3F8F A;  5J4V A;  4AM3 A;  2LNB A;  1HST A;  1O7L A;  2L5Q A;  3CLO A;  2BVM A;  4II2 A;  1UFM A;  2YX4 A;  4HPQ A;  4L18 B;  5BNG A;  1YE9 A;  3ZQL A;  2OUM A;  2XF6 A;  3F8N A;  4AVP A;  4YIF A;  4MQV A;  4RA2 A;  4IOA F;  3ZMU A;  3F72 A;  3L2U A;  5B66 C;  4XLH A;  3HOY J;  4YIR X;  2XRL A;  2BEO A;  3I4M J;  3F0C A;  1TLH B;  1SFE A;  1BIA A;  3BJ6 A;  1AA7 A;  2R3S A;  1L3L A;  1MDM A;  2CQX A;  1J7K A;  3M8J A;  1VTN C;  5HLH A;  1QGP A;  2NXN B;  2VE8 A;  1QA6 A;  3J81 K;  4BBS J;  2F4M B;  4A3E J;  3CJQ B;  3MZH A;  2CO5 A;  4DYR A;  3PO3 J;  3VFZ A;  4BE1 A;  3MVP A;  1P9Q C;  3CP8 A;  2V1X A;  1FP1 D;  4F7Z A;  3MWM A;  3D5R C;  4MNU A;  2IEK A;  4LMY A;  1D1A A;  2QEX I;  2Y9Y A;  2EIK H;  4IZZ A;  1BJZ A;  1KU7 A;  4UVA A;  1WPK A;  3F6O A;  4RGR A;  2KIS A;  2HOE A;  2CMP A;  4HST A;  3PNV A;  5E3L A;  3L2W A;  3ERE D;  1U9O A;  5DV5 A;  3RQI A;  5F08 A;  3FF5 A;  1YI2 I;  2R7W A;  1IV6 A;  3H0G J;  1S7E A;  2VOO A;  1H88 C;  4XRF A;  4DZJ A;  3QOE A;  3ZP5 A;  4XN0 A;  4PCQ A;  2NNY A;  4L5J A;  3GFM A;  3ZCO A;  5JVT A;  4KT5 C;  2ZJ2 A;  3TQN A;  1KQ8 A;  1AWC A;  1WWX A;  3GZ6 A;  3B6C A;  1HKT A;  5EZG A;  3PSF A;  1DP7 P;  2YU9 J;  1UST A;  1VQ6 I;  1WKM A;  2FA5 A;  5J4Y A;  3FXU A;  2W00 A;  2DJI A;  3S3N A;  4QTR A;  3JRI A;  3HIF A;  4G6Q A;  3Q3S A;  4GDF A;  2P0W A;  3CUQ C;  1JTY A;  2M7A A;  3KP2 A;  1Y39 A;  2FSW A;  3NRV A;  2NS0 A;  2BHZ A;  2BY1 A;  2CUF A;  1RNL A;  4HG2 A;  2Y9Z A;  1SVL A;  2XSD C;  4P9F A;  5M3M J;  1U5T A;  1MNM C;  2X51 A;  2QUF A;  1HDD C;  4MHG A;  5E1X A;  4ANJ A;  2L3D A;  1I27 A;  1B6A A;  1AU7 A;  4J00 A;  1V3F A;  2X9D A;  3WTY C;  1XGO A;  2HVQ A;  5LGU A;  2RQP A;  1OCC H;  4CYC A;  3TW7 A;  2DTR A;  1ETY A;  3KP7 A;  5LBQ A;  3JAM K;  2WA0 A;  2DXI A;  5JFR A;  1NHA A;  1MH4 A;  5ICC A;  1FTZ A;  5EZH A;  3KZI C;  3JW4 A;  5E79 C;  1I3A A;  4KJZ A;  4UNO A;  2AQF A;  2HYG D;  4C3I J;  4CHU A;  2RC4 A;  1ZLJ A;  1JHH A;  1W5C C;  3HL2 A;  1SAN A;  3GFI A;  4BXU A;  4I99 C;  5BMZ A;  1TBX A;  5CYV A;  5H6R A;  1O3R A;  2Y30 A;  3E7L A;  5B3S H;  1QQI A;  1S5L C;  3EDP A;  4BQA A;  1OYI A;  4G7H F;  3M3Y J;  1OCR H;  4M6Y A;  3K1P A;  1H0M A;  3VWB A;  5LRR A;  1T98 A;  4M73 A;  4FIS A;  3R0A A;  4AIK A;  3ASN H;  4GCV A;  3SXY A; 
#chains in the Genus database with same CATH homology
 2F5C A;  1RUO A;  2CG4 A;  2OAZ A;  2XIG A;  1ZRE A;  1HKQ A;  4LB6 B;  5JI6 A;  3ZN0 A;  2F5F A;  1R36 A;  2PEX A;  1MJ9 A;  3DPL C;  1IXC A;  1F4K A;  4XLN F;  1B9M A;  4U7B A;  2F5D A;  1S29 A;  1F9N A;  2RN7 A;  4B09 A;  2K86 A;  2YPR A;  1ZG1 A;  4DQ2 A;  4NQW A;  3BY6 A;  3F6V A;  4ESJ A;  3IKV A;  1IXR C;  3M9A A;  4G6D A;  1YFH A;  3HTU A;  4KN4 X;  5D5X B;  2Z5U A;  1R5G A;  3K1M A;  1ZG5 A;  3H92 A;  1XGS A;  4ZZD A;  4RAZ A;  3KCC A;  4FT8 A;  4I0B A;  5ILV A;  3T1B A;  4Q4Z F;  3QP6 A;  2DW4 A;  1RI7 A;  4RAY A;  1MDM B;  1KGS A;  1Q1H A;  3CUO A;  3ROU A;  4BYY A;  4L5I A;  2RVC A;  2VT3 A;  5DYM A;  1C0W A;  1KQ9 A;  1FT9 A;  2A3S A;  3D0S A;  5EEG A;  2VT2 A;  3KE2 A;  2EFW A;  2D45 A;  2DQR A;  5L3C A;  3RJP A;  4LD5 A;  2A6E F;  5ERI A;  1SMT A;  4U7D A;  3K2Z A;  3L9F A;  1IXS B;  4LLL A;  3SZT A;  4CIC A;  1ON1 A;  1R00 A;  2W24 A;  2STW A;  1JE8 A;  1XCV A;  2MD5 A;  3K69 A;  2CSO A;  3HTS B;  3IRQ A;  2IA2 A;  4ESB A;  2ACJ A;  5J8C A;  4KYW A;  2QQB A;  3P9C A;  5E8I A;  1U5T B;  2OQG A;  3RKY A;  4R8H A;  4Y15 A;  3M7G A;  3WE3 A;  2M87 A;  3QOP A;  2K02 A;  3F21 A;  2H09 A;  1FBQ A;  3G3Z A;  1EH8 A;  2Q8K A;  3U2R A;  1TQP A;  1G3W A;  3QAH A;  3TO6 A;  2EB7 A;  4I2O A;  1XGM A;  3E5Q A;  5CVV A;  2HFH A;  5DUK A;  4YFN F;  1WSU A;  1GXP A;  1MGT A;  1EH7 A;  4AIH A;  3VB2 A;  2QWW A;  1S7A A;  1LJ9 A;  3WG9 A;  1ZLK A;  2XRN A;  4M72 A;  5LGT A;  2E7X A;  2OZ6 A;  4KA4 A;  1K78 A;  1J0R A;  2W57 A;  2K4B A;  4RGX A;  4OIR F;  2B0L A;  4EMS A;  3HYI A;  1USS A;  4UVC A;  1TQM A;  1YIO A;  2OQR A;  1K7A A;  3IHU A;  3NQO A;  1YG2 A;  3P7N A;  3F23 A;  4PGH A;  5E1W A;  2MLG A;  2VBZ A;  3IRR A;  3QU3 A;  2NRA C;  4Q5S F;  1R22 A;  3MCZ A;  2O03 A;  3LAJ A;  2O3F A;  2VE9 A;  1UB9 A;  2PFB A;  2XKP A;  2FBI A;  3HOT A;  1KU3 A;  2R7D A;  1X3U A;  4M9Z A;  2QQ9 A;  4RB2 C;  1MKM A;  3GEZ A;  2LDU A;  5AON A;  1EH6 A;  1P4X A;  3JSO A;  1IN4 A;  3ZMS A;  4XBF A;  3WTT C;  5A2Q K;  4A2U A;  3PQK A;  1XSV A;  1G3T A;  3IC7 A;  1KYW A;  3O3K A;  4Q47 A;  5L3G A;  2Z3Y A;  3TDZ C;  4KNY A;  3KFW X;  2RV8 A;  3RKX A;  3SHF A;  1O57 A;  1Z05 A;  1SD5 A;  1XSX A;  3E6C C;  4LK0 F;  1U5T C;  2HKO A;  1FX7 A;  3V8K A;  4WWC A;  2QLZ A;  4KIB A;  1W5T A;  2XAG A;  3F3X A;  3BWG A;  3LST A;  4P5O A;  1SFU A;  1IW7 F;  4H0E A;  2GWR A;  1FWZ A;  4MEX F;  4HX8 A;  3FMS A;  4DNC A;  2KIM A;  1WRJ A;  2OD5 A;  5K5R A;  3QP5 A;  4EV0 A;  3ML6 A;  5FLX K;  2G7U A;  2OA4 A;  3VEP A;  1PP7 U;  4A5M A;  3IWF A;  4EJT A;  3KP5 A;  3E6B A;  4RGU A;  1FSH A;  2DU9 A;  4MTD A;  1F5T A;  3TOB A;  4LLN A;  2LKP A;  1J5Y A;  3N97 A;  4RB1 A;  2H6C A;  1RUN A;  4A12 A;  1LB2 A;  5IT3 A;  2VBW A;  1LDJ A;  1GHC A;  1OR7 A;  3ABT A;  3NEU A;  2FE3 A;  2LSO A;  3E5X A;  4P55 A;  4N9I A;  5D8L B;  4LGW A;  4NHJ A;  3LFK A;  4IXA A;  1W4M A;  2FXA A;  3EYY A;  2HZT A;  2PBI A;  2NYX A;  1G3Y A;  1Z6R A;  2XAQ A;  1FYM A;  2KKO A;  3GFJ A;  2NNN A;  3RKW A;  4RB0 A;  3ZMT A;  2ZBK A;  2YSR A;  4KIC A;  4Y13 A;  3GXO A;  4OMY A;  1IAW A;  1K78 B;  4UUV A;  4E70 A;  2RKH A;  2G9W A;  5D4R A;  1B59 A;  4S05 A;  2L4M A;  3GZ5 A;  2L54 A;  4EGY A;  4ZH4 F;  1D3Y A;  4I7H A;  5D5W B;  3LA7 A;  3EET A;  2E7W A;  2L4A A;  1PUE E;  4YII A;  3C18 A;  1XDS A;  3DF8 A;  3T0Y A;  2FEZ A;  1ODD A;  1OKR A;  5D4S A;  2YU3 A;  3K0L A;  3WGI A;  4KMF A;  1U3E M;  4AWX B;  2LF8 A;  1R1U A;  5L3F A;  3TOA A;  1FOK A;  1W7P D;  3ULQ B;  2XVC A;  3CO6 C;  1T0F A;  4JBA A;  3RIR A;  4HLX A;  2CW0 F;  5E8G A;  2QZ8 A;  1ZHF A;  4N0B A;  1LQ1 A;  1I6X A;  2J5O A;  1FNN A;  1FYL A;  2ZME A;  1SD4 A;  2EFN A;  1BC8 C;  4KIF A;  1GXQ A;  3KEO A;  4ETS A;  2Y48 A;  3T5X A;  2BV6 A;  4L9T A;  3GO5 A;  3FM5 A;  2EFO A;  1T38 A;  3FHZ A;  1L0O C;  2A68 F;  4I98 B;  5LEK A;  2AXL A;  3D5L A;  4MEY F;  3DKW A;  1QZZ A;  2STT A;  1Z1D A;  3E6M A;  2WV0 A;  4I02 A;  5HVQ C;  2W84 A;  2OZU A;  5FD6 A;  4PGG A;  3RTR A;  3F8B A;  5HDN A;  3LAP A;  5L3D A;  1GVJ A;  2WWY A;  3LA2 A;  3MEX A;  4YG2 F;  2JPB A;  1FSE A;  2P6S A;  1FYK A;  4K2E A;  4OU0 A;  4U0V A;  3V7R A;  5ILU A;  3J81 Z;  1R1T A;  5IT9 K;  3MZY A;  2ADU A;  1Z6T A;  2DPD A;  4HV6 A;  1R5H A;  1H9G A;  2P7V B;  4A0Y A;  2QYO A;  1KU9 A;  1KU2 A;  3E97 A;  5D5U B;  4I0A A;  2KJC A;  5F64 A;  5TJJ A;  4HLY A;  2F5E A;  2HYF A;  2W25 A;  1MJB A;  5CVI A;  1HSJ A;  1U6G A;  3E6D A;  1D5V A;  4EM1 A;  2BGC A;  2O61 A;  4U0W A;  2JSC A;  4IRH A;  3GX4 X;  1BI2 A;  1ZYR F;  3C3W A;  4L0Y B;  4RB3 C;  1P6R A;  3B02 A;  2PLY A;  3QRF F;  2DK5 A;  2UZK A;  5BS6 A;  2V1U A;  4EQQ A;  1IN8 A;  4OIN F;  4O3M A;  2FOK A;  3GLX A;  5CLS A;  4MQ9 F;  1XD7 A;  3JAM Z;  2IW5 A;  1XB4 A;  5BPI A;  4JK1 X;  4IHT A;  2A6H F;  3K1N A;  1I1S A;  5TRD A;  4HAM A;  5E17 F;  3H3Z A;  4BAY A;  1HW5 A;  4HF0 A;  3GFL A;  3FMQ A;  3JSP A;  4Q48 A;  1JGS A;  3M1E A;  2FQ3 A;  4HBL A;  1YLF A;  3FX3 A;  4A0Z A;  3SZP A;  3WGH A;  2DPU A;  2XKO A;  4OMZ A;  4EJU A;  5D6E A;  1T39 A;  2KIF A;  1TNT A;  3CTA A;  5DUI A;  1PDN C;  1IRF A;  3F22 A;  5ILS A;  2H94 A;  2E1N A;  1IN7 A;  3G73 A;  3J80 K;  2IRF G;  5FB2 A;  4ZYG A;  5LHG A;  2G7H A;  4BH9 A;  2Q2E A;  3BRO A;  2IA1 A;  2ZME B;  3WGG A;  3WU1 B;  3WTX C;  2XAJ A;  1TQI A;  4EJV A;  1O3T A;  2EV0 A;  4EGZ A;  5DCM A;  1P4A A;  2QQA A;  3O2P E;  4M9X A;  1BJA A;  3V7S A;  5AIQ A;  4ENN A;  3GF2 A;  3F8C A;  5E20 A;  2HGC A;  2M5W A;  2VC1 A;  1EV7 A;  2FMY A;  1CF7 A;  1FP2 A;  2IVM A;  2P5K A;  4U0Y A;  3L09 A;  1B4A A;  4EM2 A;  5ICF A;  1HXD A;  2L01 A;  4M9S A;  3R61 A;  3HSF A;  4BHP A;  3WOD F;  1IRG A;  3T8T A;  5J8F A;  2YX7 A;  2BBY A;  4ZZL A;  1LDD A;  1U78 A;  4G7O F;  3I54 A;  5D6F A;  4WX9 A;  2VN2 A;  1BN5 A;  2M8E A;  3I53 A;  1YW9 A;  5AIP A;  2Y0M A;  3ECH A;  2E1C A;  2NAZ A;  2ZXJ A;  5CJ9 A;  3BJA A;  3KP3 A;  3MFK A;  2V79 A;  1F1Z A;  4YFX F;  2OBP A;  2HTS A;  2HR3 A;  1AOY A;  3ABU A;  3TDU C;  2K7L A;  4LLG F;  5LRS A;  1YW7 A;  4MGR A;  4OIP F;  1HBX G;  3RPU A;  2CYY A;  4WXH A;  4Z2Y A;  4GGG A;  1D8J A;  5L3B A;  3P9K A;  5HS9 A;  4KFC A;  2CFX A;  2D1V A;  2A61 A;  4EM0 B;  2FU4 A;  4LB5 A;  2DO7 A;  1UHM A;  3E5U A;  2YR2 A;  2TDX A;  5KVR A;  3RDI A;  3BPV A;  4FX0 A;  2QBY A;  1U8R A;  2OU2 A;  4N9H A;  5E1Z B;  5BPD A;  5KK1 A;  1REP C;  2MC3 A;  3WTS C;  2ZFW A;  1J9I A;  2Q0O A;  2KIU A;  1MJA A;  1R1V A;  5K1Y A;  1ZAO A;  4UVB A;  1ZN2 A;  5HS7 A;  2COM A;  2ESH A;  1BI1 A;  5CVU A;  2GA1 A;  4EVI A;  2VOP A;  1G3S A;  4OIQ F;  1ZAR A;  3LWF A;  1UCR A;  2MH9 A;  2FRH A;  3MQ0 A;  3KZZ A;  4XSX F;  3ZQ7 A;  2V9V A;  5LEJ A;  4FHT A;  3DPT A;  4G94 A;  4HZF A;  1MZB A;  2GIV A;  3JTG A;  2EJR A;  4HF1 A;  1YTY A;  3BOQ A;  2HEO A;  5FFZ A;  5HS8 A;  1SD7 A;  3R0J A;  1OMI A;  5DCM B;  1G4D A;  4KN7 X;  1XMA A;  5ICG A;  2W85 A;  1MD0 A;  1FBS A;  2VXZ A;  2JPC A;  4QWQ A;  2CWE A;  1UHW A;  2AS5 F;  1U2W A;  2ISZ A;  3FWE A;  4MTE A;  2P8T A;  4EJO A;  5D5V B;  5A2Q Z;  4KDP A;  3WTV C;  2PN6 A;  1HQC A;  1LDK B;  4AIJ A;  2O0Y A;  2MH2 A;  5K5Q A;  1BI3 A;  4PDK A;  4S04 A;  1FY7 A;  1CF7 B;  5EEH A;  5DD4 A;  2QM3 A;  3I58 A;  2P4W A;  3DV8 A;  1PP8 F;  2Y75 A;  3R6S A;  4L9J A;  1XSD A;  5H20 A;  2DBB A;  4ENM A;  3ZMV A;  4CXF A;  1XMK A;  2DAO A;  1H9T A;  2XHK A;  3SQN A;  1QBJ A;  1ZH5 A;  5J6X A;  1BM9 A;  1BBY A;  4L0Z B;  1TNS A;  2KRF A;  4IF4 A;  3F8M A;  4WXC A;  3TO7 A;  2K4J A;  5FLX Z;  2IT0 A;  3V4G A;  2JT1 A;  1RZ4 A;  1LEB A;  2J5P A;  1CGP A;  5LGN A;  3CJN A;  4XSZ F;  4I09 A;  1LNW A;  1OYY A;  5DDG A;  5F1R A;  3ZMD A;  1QO0 D;  2R7F A;  3KP4 A;  4LFU A;  1O7F A;  3M8E A;  3C7J A;  3LQR A;  4O5V A;  3FXQ A;  1QZY A;  3C1D A;  4UXN A;  3DXJ F;  2M45 A;  2QVO A;  4KIG A;  4XLP F;  5FD5 A;  5JHU A;  3WTW C;  4HF2 A;  1Y0U A;  3U9G A;  4HX4 A;  2VOD A;  2BE5 F;  4UV9 A;  1KQ0 A;  3ELK A;  4G8X A;  1E17 A;  1W7P A;  1LEA A;  3GUD A;  1JXS A;  4ENK A;  3I64 A;  4ENJ A;  2MLK A;  2QBY B;  2UXX A;  5DD8 A;  2P6T A;  1OPC A;  3DEU A;  1YO5 C;  2ISY A;  1ULY A;  4ON0 A;  3TGN A;  2P7C B;  3GYH X;  5E18 F;  3ZMZ A;  4CYD A;  1R7J A;  2L02 A;  1G6N A;  4JQF A;  3M8F A;  2A69 F;  3TO9 A;  4GYI A;  1ZRC A;  2VBX A;  3OV8 A;  1HW2 A;  3GW2 A;  1DDN A;  5BQT A;  1IUY A;  2FNA A;  3I59 A;  2CGP A;  1SD6 A;  4M71 A;  3BDD A;  4M74 A;  1YQA A;  2HQN A;  1DPR A;  3FXR A;  1ZRF A;  2ESN A;  1ON2 A;  4WF2 A;  5HLI A;  1S7O A;  1QPM A;  4P9U A;  1IF1 A;  3RI4 A;  3I5U A;  4AD9 A;  4ZYD A;  3GWZ A;  3HRT A;  1B1B A;  3IWZ A;  3FZV A;  3KET A;  3BP8 A;  1YYV A;  1Z7U A;  5BOX A;  4IVN A;  4GYG A;  3COA C;  3KLN A;  4U88 A;  2EWN A;  1TW2 A;  2GZW A;  4PZJ A;  1TW3 A;  2LF7 A;  1P4W A;  2MBF A;  2GA2 A;  5DEQ A;  2VC0 A;  4A5N A;  3V8L A;  2Z9O A;  3J7A O;  2HKX A;  1SMY F;  4FX4 A;  2O6G E;  1XGN A;  4R79 A;  3V7C A;  3I71 A;  2P5V A;  3QPT A;  4HX7 A;  3VOE A;  5ED4 A;  1DUX C;  3KP6 A;  4QLC U;  2O8X A;  4TV7 A;  2M1B A;  3WU0 A;  5LHH A;  1P2F A;  4P96 A;  4RGS A;  2H6B A;  3DP7 A;  4A6E A;  5FFX A;  3O6B B;  2V1D A;  3E3V A;  2PMH A;  1LVA A;  1HKS A;  2X0L A;  4A0X A;  2PG4 A;  2XRO A;  2D2W A;  4RS8 A;  2C6Y A;  2Z33 A;  1K79 A;  1TTY A;  3KLO A;  4R1H A;  5IT9 Z;  3B73 A;  2XGX A;  3EQL F;  2VON A;  3V8J A;  2ZKZ A;  4ZYH A;  2PMU A;  2FF4 A;  1FLI A;  3L00 A;  1J59 A;  1KA8 A;  1XN7 A;  4KMU X;  1K6O A;  1IZ1 A;  3DFG A;  1E2X A;  3PQJ A;  5CVJ A;  1T6S A;  4HQE A;  2IPQ X;  1Z91 A;  4ESF A;  5HOO A;  1OYW A;  4A6D A;  4BHB A;  5LLQ A;  4EJW A;  2WTE A;  2ZO4 A;  2DK8 A;  3CO7 C;  4KUM A;  2FML A;  2VBY A;  3HHH A;  5HDK A;  1J75 A;  3RYP A;  1I1G A;  2DT5 A;  4HQM A;  1S6L A;  2QEN A;  2EK5 A;  5L3E A;  2ZCW A;  1ONV A;  1T2K A;  3CUQ A;  4L9V A;  1ZGJ A;  1BI0 A;  5DCF A;  1BC7 C;  1W7P B;  2RGV A;  4IHS A;  2EA4 A;  2IP2 A;  3Q9S A;  4WCG A;  4IPA A;  3CDH A;  4CDG A;  2DI3 A;  5F6F A;  1Z9C A;  1W5S A;  5ICE A;  2XUB A;  3SFZ A;  3ZN1 A;  2M30 A;  3ISP A;  2HDC A;  3IKT A;  2EV6 A;  4L9N A;  2HQR A;  4IJA A;  2HTJ A;  1FBU A;  3U1D A;  2FBK A;  3W6J B;  4LG0 A;  5FGM A;  2CQK A;  1FZP B;  1KYZ A;  1YS7 A;  2DQL A;  1RIO H;  3WE2 A;  2ETH A;  2EFP A;  2HWV A;  3MAJ A;  3I59 B;  2FBH A;  3PFI A;  2UWM A;  3LQQ A;  3K9T A;  2PI0 A;  3N4M A;  2A07 F;  2A5Y B;  3OOP A;  2H27 A;  4CGZ A;  2MA3 A;  4OOI A;  4O6J A;  3DQV C;  2KJB A;  2Z99 A;  3BPX A;  4LK1 F;  3HRM A;  1A04 A;  3RPQ A;  5H6Q A;  2UXN A;  4CZZ A;  4CO8 A;  4WK8 F;  1XDU A;  3I0T A;  1P92 A;  3J80 Z;  4BHC A;  4BNC A;  1S8N A;  2XAH A;  3R4K A;  4LJZ F;  2X4H A;  2DFI A;  1ZG3 A;  4HW0 A;  5FO5 A;  3TKY A;  1SAX A;  2ZNY A;  1ZRD A;  1R58 A;  4UV8 A;  3L7W A;  3FM3 A;  3L2C A;  2IA0 A;  1WQ2 A;  2GXG A;  5JR3 A;  5K5O A;  3HOS A;  2GAU A;  1R23 A;  2RNJ A;  3Q5F A;  3P9I A;  6PAX A;  4HOB A;  1YW8 A;  3EYI A;  3GVA A;  4B8X A;  3EUH A;  4M6X A;  2F2E A;  4IRI A;  2GQQ A;  1SFX A;  3REO A;  3VOD A;  4ASN A;  3ECO A;  3HRS A;  3IL2 A;  3Q9V A;  4WXD A;  4IRG A;  4HDV A;  4GXO A;  4G7Z F;  1FPQ A;  1BIB A;  1QNT A;  2IJL A;  4NB5 A;  2XAS A;  2JRT A;  2PQ8 A;  3S2W A;  4HDU A;  3I4P A;  2HS5 A;  1O3Q A;  1JHF A;  3AAF A;  1B9N A;  3WTZ A;  1XCB A;  4G9Y A;  3HSE A;  3LA3 A;  3W6K B;  1I5Z A;  2FNP A;  1S3J A;  2XAF A;  1YS6 A;  3CUQ B;  2ELH A;  5LHI A;  1V4R A;  3R60 A;  3BJO A;  3QU6 A;  2JZY A;  2P5L C;  2XV4 S;  4HYE A;  4OIO F;  3WTU C;  1IN5 A;  4Y17 A;  2EV5 A;  3ZPL A;  2V6C A;  3H3U A;  2RDP A;  1IN6 A;  2GXB A;  3JTH A;  2BYV E;  1WI9 A;  2DLL A;  2D1H A;  2EFQ A;  4UHT A;  1FC3 A;  2EA2 A;  3HHG A;  3FMR A;  2JTV A;  1O3S A;  1HW1 A;  1STZ A;  3QPH A;  4LG0 B;  4HA8 A;  4D0P A;  2ZNZ A;  5HDG A;  1DPU A;  4I01 A;  3HRU A;  1ZGA A;  3RYR A;  4YFK F;  1D8K A;  5CVR A;  3KZY A;  1J2X A;  4ZYE A;  1BOA A;  3BZ6 A;  2PJP A;  3HSR A;  3T8R A;  3KEQ A;  5D8K B;  2WC2 A;  5HLG A;  4HV5 A;  3HUG A;  4GO1 A;  2K27 A;  3F8F A;  2LNB A;  1HST A;  1O7L A;  3CLO A;  1UFM A;  2YX4 A;  4L18 B;  3F8N A;  4AVP A;  4YIF A;  4MQV A;  3ZMU A;  3F72 A;  2BEO A;  1TLH B;  1SFE A;  1BIA A;  3BJ6 A;  2R3S A;  1L3L A;  1MDM A;  1J7K A;  1VTN C;  5HLH A;  1QGP A;  2VE8 A;  3J81 K;  3MZH A;  2CO5 A;  3VFZ A;  2V1X A;  1FP1 D;  4F7Z A;  3MWM A;  4MNU A;  4LMY A;  1KU7 A;  4UVA A;  3F6O A;  4RGR A;  2HOE A;  3ERE D;  5DV5 A;  3FF5 A;  2VOO A;  4XRF A;  3ZP5 A;  2NNY A;  4PCQ A;  4L5J A;  3GFM A;  5JVT A;  4KT5 C;  2ZJ2 A;  3TQN A;  1KQ8 A;  1AWC A;  1WWX A;  3GZ6 A;  1HKT A;  1DP7 P;  1UST A;  1WKM A;  2FA5 A;  3FXU A;  3HIF A;  4G6Q A;  3CUQ C;  3KP2 A;  2FSW A;  3NRV A;  2NS0 A;  1RNL A;  4P9F A;  1U5T A;  2QUF A;  4MHG A;  5E1X A;  2L3D A;  1I27 A;  1B6A A;  1V3F A;  3WTY C;  1XGO A;  5LGU A;  2RQP A;  2DTR A;  3KP7 A;  5LBQ A;  3JAM K;  5JFR A;  1NHA A;  5ICC A;  3JW4 A;  4UNO A;  2HYG D;  4CHU A;  2RC4 A;  1ZLJ A;  1JHH A;  3GFI A;  4BXU A;  5BMZ A;  1TBX A;  5CYV A;  5H6R A;  1O3R A;  1QQI A;  3EDP A;  4BQA A;  1OYI A;  4G7H F;  4M6Y A;  3K1P A;  1H0M A;  5LRR A;  1T98 A;  4M73 A;  3R0A A;  4AIK A;  4GCV A;  3SXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...