5HS8A

Crystal structure of the diamide-treated yodb from b. subtilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
HMMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator YodB
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs8A00
3HSEA 5FGMA 3O3KA 3Q5FA 2EFPA 3CUQA 4WXCA 2XHKA 3WTZA 3GX4X 5CLSA 1XGOA 1F1ZA 4HW0A 4KMFA 4A6DA 3V4GA 3DPLC 5HDGA 4XLPF 1FPQA 4RB1A 3ZPLA 1QBJA 3GVAA 5K5QA 5CVRA 2DAOA 2RDPA 3CUOA 3TO7A 3LFKA 4EJUA 4U7BA 3FM5A 5LBQA 2NS0A 3R61A 3ZMDA 4ZYEA 2QQBA 3MQ0A 4A0XA 2XGXA 1MJ9A 1OYIA 5CVIA 1YTYA 1UHMA 2VOOA 2L3DA 2HS5A 1ZRDA 3DKWA 1XB4A 2QBYB 5H6RA 1KYWA 1YLFA 3GYHX 2FMLA 4AVPA 5BMZA 3R0AA 1VTNC 3VEPA 1IXRC 3F8BA 2EV5A 4AIJA 1QPMA 3QPTA 1W7PD 4IJAA 2E7XA 1IN4A 2RVCA 2EV0A 2EJRA 5H6QA 3S2WA 3DPTA 2P8TA 3LA7A 3HTSB 3JSPA 3RKYA 3F8FA 1J9IA 1G4DA 2FF4A 2PQ8A 2QUFA 4BH9A 2UXNA 3W6JB 4KFCA 3FHZA 1BI1A 1DP7P 4GYGA 1LEBA 1E2XA 5EEHA 3KFWX 3M1EA 2PMHA 1G3WA 5D6EA 4GXOA 4EM1A 2PJPA 3KLOA 3V8LA 4KIGA 1HSJA 3P9IA 2ZO4A 4HDUA 1YW7A 4AD9A 5K5OA 3RPUA 2ESHA 3JTHA 5LRRA 4OMYA 3BROA 3GLXA 3HHHA 2E1CA 1OYYA 4L0ZB 1HQCA 2RQPA 2MLKA 4MEXF 3LWFA 3QAHA 2A6EF 5ICGA 2YX4A 3SFZA 2DFIA 1Z7UA 2Q2EA 1HW1A 2L54A 3V8KA 4ETSA 2M45A 4CHUA 2OU2A 5D4SA 5LGTA 2QQAA 1A04A 2R7FA 3BWGA 1I1SA 3QU6A 2XAGA 3P9CA 1O7FA 5AIPA 5DYMA 4KYWA 4GGGA 1PP7U 2VC0A 2HQNA 3KP6A 2XRNA 2FOKA 1NHAA 2WV0A 1W4MA 5F1RA 3KP3A 2QWWA 5FD6A 4WXHA 1B9NA 2Z99A 3K1NA 3KP5A 1TNSA 3DF8A 4ENMA 2MLGA 1FP2A 2A6HF 2F5CA 3KETA 4RGUA 2OA4A 2P4WA 5DUKA 2G9WA 1MDMB 5IT9Z 4KICA 2XKPA 4AWXB 1HSTA 4RAYA 5E8GA 3E5UA 1Z91A 3M8EA 3FX3A 1EH7A 3CTAA 1HW5A 2ZXJA 2RGVA 4K2EA 1H9TA 2GXGA 4L9VA 3N4MA 2W85A 4PCQA 1JXSA 1RUNA 2OQRA 4Y13A 3M7GA 4QWQA 1MDMA 5HOOA 1ZREA 4WX9A 1BC7C 4I98B 1R1VA 3Q9SA 5LEJA 1J2XA 4WWCA 4DQ2A 1XGSA 5ILSA 1W5TA 1PUEE 1Z6RA 4S04A 2V1XA 2AXLA 2DBBA 4Q47A 4UVCA 4A5NA 1R7JA 4M6YA 2IRFG 1OR7A 4RB0A 4IPAA 1FY7A 2BV6A 2Z5UA 5LHGA 3R4KA 4HF0A 1REPC 3LA2A 1OYWA 1XSDA 3SQNA 1ZAOA 4HDVA 1ZRCA 1P6RA 1Q1HA 2P7VB 4ENJA 3K69A 3L2CA 3F8NA 3I5UA 3MFKA 1J59A 2A68F 3GWZA 3ULQB 2HDCA 5L3FA 1AWCA 4A0YA 2ELHA 5LGUA 2DPUA 1WI9A 3L00A 5JR3A 3FZVA 1FOKA 1XGNA 2FQ3A 2UXXA 5L3DA 2XAQA 4U7DA 4HLYA 4KDPA 1XCBA 3J7AO 4LK0F 1LQ1A 3LAPA 3P7NA 1JE8A 4KA4A 4ZYHA 3VFZA 2V1UA 2H94A 1ON2A 2OZUA 2NRAC 5HS7A 1S7OA 2F5FA 5CYVA 5HS8A 3ZN0A 2JZYA 1LVAA 5CVUA 1XDSA 3E6CC 3K2ZA 5FFZA 2Y48A 4L5IA 1PDNC 3C7JA 4R8HA 4G8XA 5A2QK 2HYFA 5HLHA 3H92A 4PGGA 2FEZA 1K6OA 1FP1D 4P9UA 5JVTA 5D6FA 2HZTA 2VBYA 1EV7A 3HOSA 3IKVA 3WODF 3D5LA 3WTWC 2HKOA 2ZJ2A 4HBLA 4MNUA 1O3SA 5IT3A 1LDKB 3WTSC 1R5HA 5FB2A 2HOEA 2PBIA 3RYPA 2KRFA 4UV9A 1PP8F 2ESNA 3EETA 4MHGA 1D3YA 4BHPA 3IHUA 2FBIA 5CJ9A 1Z1DA 4TV7A 4M74A 5JHUA 1T39A 1FYLA 3E5QA 2X0LA 2RV8A 1ZLJA 2Y0MA 2GA2A 1XDUA 4CICA 3RI4A 3WE3A 3ML6A 3RTRA 4HV5A 3ZMVA 4HF1A 4RGRA 3PQKA 5D5VB 4UVBA 4M9SA 2QBYA 1BIBA 3DV8A 2MA3A 3M8FA 3F23A 2VODA 3P9KA 5LRSA 2CSOA 4YFXF 3NEUA 3I59B 1WRJA 3JTGA 2IPQX 3I53A 3ZN1A 2LDUA 3BJAA 4ENNA 4U0WA 3WU0A 3WE2A 1IZ1A 3ZMTA 3GO5A 1HKQA 3I0TA 1E17A 2H27A 4MGRA 2P5LC 2DK5A 1IXSB 3DXJF 1B9MA 6PAXA 2MBFA 5LHIA 2XAJA 3HRMA 1W7PA 4EMSA 2UWMA 4UXNA 2FSWA 5D5UB 2XAFA 3G73A 1LNWA 1LB2A 3R60A 4M9ZA 5HDKA 4HLXA 5JI6A 2VBWA 5D4RA 2W84A 1KQ8A 2W24A 3QRFF 1L3LA 3DFGA 4O5VA 4KN7X 2A07F 2BEOA 1MD0A 4ON0A 4F7ZA 2M30A 4U0VA 4FX4A 4IRIA 5BPDA 2RN7A 1ZGJA 1R36A 1SMTA 5D5WB 5AONA 2EFWA 3BPVA 3CUQC 1J75A 3I4PA 1YW9A 2Q8KA 1WSUA 1ZGAA 4UV8A 1QQIA 3ABTA 4YFNF 1SFXA 5E1ZB 3ISPA 2HFHA 2F5DA 1XCVA 2VBXA 1IRFA 4OOIA 1I1GA 2FU4A 4LLNA 1IAWA 3F72A 1O7LA 4M72A 5CVVA 2LF7A 1LJ9A 4CXFA 1IN7A 4XLNF 4BXUA 4EJTA 3N97A 1WWXA 1LDDA 2QENA 5JFRA 4I02A 3GFMA 2F2EA 1RUOA 1SAXA 2L4MA 5DDGA 3ABUA 1QO0D 5CVJA 1FBUA 2IJLA 2GZWA 5BPIA 4FHTA 2FBKA 4BHBA 5E17F 1KGSA 4I7HA 2KIUA 2CYYA 2KKOA 2O0YA 1BOAA 1H0MA 1BI2A 4GO1A 3I64A 1SMYF 3HRTA 5ICEA 3D0SA 3KEQA 3ROUA 2AS5F 2L4AA 2ZNZA 3SZTA 1S8NA 1HKSA 3I59A 4BHCA 4UUVA 4G6QA 5L3GA 4Y15A 5LGNA 2EA4A 1U2WA 4OMZA 5FD5A 4O6JA 2PN6A 1Z05A 4MTDA 5KK1A 3CDHA 3HUGA 4L9TA 4H0EA 1U5TC 3IWFA 3JSOA 1YG2A 2Z33A 2QYOA 2JTVA 1IN8A 1XN7A 2XUBA 2DU9A 2FRHA 4GCVA 2A3SA 3L09A 2A61A 2ISYA 4KIBA 5L3EA 3C3WA 2ZKZA 1QNTA 1YS7A 5DCFA 2O8XA 2K7LA 5BS6A 1G3TA 1V4RA 1ZLKA 4RGXA 3WGIA 2EWNA 5D8KB 1O3RA 1XGMA 3E6MA 2DT5A 2OD5A 3KP2A 1ZG5A 5E8IA 1IN5A 3F22A 2BBYA 5F6FA 1DPRA 3GFIA 2GIVA 3GF2A 2QLZA 3K0LA 3KP7A 3EYIA 2D1VA 3CUQB 2JT1A 2P5VA 3FMRA 1U6GA 4HX4A 3LAJA 4YG2F 4AIKA 4OU0A 3KEOA 2Z3YA 1CF7A 4MTEA 4A6EA 4UVAA 1MKMA 1TQIA 4KMUX 3K9TA 3B73A 3HSRA 3EUHA 2EFQA 3HSFA 1FZPB 3DP7A 2QZ8A 4LB6B 2J5PA 2FMYA 2A5YB 4O3MA 4Y17A 2VN2A 2P7CB 2ZFWA 2R7DA 3EDPA 1F9NA 4CGZA 2EFOA 2VBZA 1R23A 1KU2A 1JHHA 5EEGA 3WTYC 1ZN2A 5LLQA 2LSOA 1KYZA 1TQMA 2P5KA 1FSEA 4KUMA 2JRTA 4JBAA 4G94A 2IP2A 2FE3A 3AAFA 1F5TA 1TNTA 2VONA 3VODA 3IL2A 2KIMA 2B0LA 4FX0A 1U8RA 4PZJA 4RAZA 5DD8A 1G6NA 3QU3A 4I2OA 3IRRA 2CG4A 3B02A 2ACJA 5DUIA 3GXOA 2EK5A 2OZ6A 2XROA 4HYEA 1K78B 3F6VA 2FXAA 4P5OA 2STTA 5J8FA 5D8LB 1ZG3A 1ZYRF 2X4HA 1W5SA 2FNPA 2GAUA 4Q4ZF 4WF2A 4M6XA 1EH6A 1TTYA 3O6BB 4KN4X 3ERED 1T38A 2O3FA 3U9GA 2TDXA 1ZH5A 2PLYA 2YPRA 4DNCA 1YS6A 1D8KA 1BC8C 4ZYGA 2DQLA 4L18B 1L0OC 3ZMZA 4UNOA 2WC2A 1UCRA 2R3SA 2ETHA 2M1BA 2KJCA 1XD7A 4M73A 3U1DA 5AIQA 3V8JA 3IWZA 3FM3A 2D45A 3HOTA 2V6CA 1YW8A 2OBPA 2H6BA 2MD5A 2M8EA 1ULYA 3F8MA 1U5TA 3I71A 2EV6A 3RPQA 2CW0F 1B6AA 2E7WA 1DPUA 1J0RA 5ILVA 3BJ6A 3WTTC 2EFNA 3E5XA 3KZYA 4OIOF 1T6SA 3O2PE 3R6SA 2V1DA 1SD6A 3RJPA 3PQJA 4IVNA 3I58A 2DO7A 1FC3A 2ZMEA 3F21A 4B8XA 5FLXZ 2YU3A 2NNYA 5HS9A 4QLCU 1OKRA 3GUDA 1Z6TA 4YIFA 3HTUA 1S29A 5K1YA 1X3UA 1T2KA 4ZZLA 1BI0A 1TLHB 3C1DA 4HAMA 1TQPA 2HWVA 2BYVE 2HQRA 5HDNA 2DQRA 3L7WA 2V79A 2NYXA 3KP4A 3I54A 4BAYA 2LKPA 2VE8A 3LQQA 4IRHA 4G7ZF 4U0YA 4E70A 2L01A 2NNNA 3TDZC 2EA2A 3KE2A 2XASA 2NAZA 1G3SA 5LHHA 3BJOA 4BYYA 4N9IA 4G7OF 2XKOA 2MC3A 1B4AA 1UFMA 1USTA 4L5JA 2O6GE 3WTXC 4A0ZA 5FO5A 4I01A 3F8CA 1CGPA 2HR3A 4ZH4F 3RKXA 4XSZF 1J5YA 1OPCA 3FXUA 2F5EA 2QM3A 3QPHA 3IRQA 3ZMSA 2K86A 1I6XA 2DI3A 3VOEA 1SFUA 1Y0UA 2GQQA 4HX8A 2MH2A 4KT5C 3HHGA 4XBFA 5E18F 3ZQ7A 3KCCA 1T98A 1I5ZA 3COAC 1R1UA 4PDKA 3ELKA 4LLGF 2QVOA 2DPDA 2PMUA 1YYVA 4P96A 4ESBA 2VT2A 4HQEA 2Q0OA 4R79A 2HTJA 2YX7A 3ECHA 1GXQA 5ICFA 1MGTA 4ESFA 4EJVA 4ASNA 2VT3A 3RYRA 3QP5A 1D5VA 4HOBA 4Q48A 4HQMA 1TW3A 1FX7A 1BBYA 4UHTA 4IRGA 1O3TA 4G6DA 2O03A 2HTSA 3GFJA 1ODDA 2CFXA 3IKTA 1J7KA 5HLIA 1FSHA 1G3YA 4A12A 3RIRA 4RGSA 2BGCA 2G7HA 2UZKA 1R00A 1TBXA 2DLLA 3GEZA 4LG0B 2O61A 2VXZA 4BQAA 3GFLA 1ZRFA 2D1HA 4NHJA 4CDGA 3F3XA 2DW4A 3H3UA 4WK8F 5L3BA 1O57A 2CO5A 4ESJA 3CO6C 5DCMB 2PEXA 2ZBKA 4OINF 3T8RA 3GZ6A 3KZZA 3BDDA 4RB3C 2PFBA 3EQLF 5ERIA 1BM9A 1RZ4A 2DTRA 1S6LA 5FLXK 2YSRA 1P4AA 3BPXA 5DD4A 4KNYA 3FMSA 4L0YB 3SXYA 4WXDA 5HVQC 1OMIA 3CJNA 3E6BA 1KU3A 3BY6A 5H20A 1LDJA 2ZCWA 1K79A 1JGSA 3TO9A 3Q9VA 5J8CA 3ZP5A 5K5RA 2FA5A 2WWYA 3RKWA 4Q5SF 1MZBA 4CZZA 4MQ9F 1U78A 4EV0A 1S3JA 1YFHA 4OIPF 1SD5A 4IXAA 4RS8A 2Y75A 5J6XA 4I0BA 2XIGA 3PFIA 2IW5A 3SHFA 2KIFA 3V7RA 3C18A 3TGNA 4EJWA 4PGHA 1QGPA 3LQRA 3WGHA 1RI7A 1BIAA 4IF4A 1FBSA 2IVMA 2XV4S 3HRSA 4JQFA 2P6SA 1GXPA 3SZPA 3TQNA 3J80K 1IF1A 1YO5C 4B09A 1S7AA 1STZA 2CGPA 1LEAA 1XMKA 3JAMZ 4ZYDA 3E97A 5DV5A 3K1PA 2KJBA 1ONVA 3NRVA 1FLIA 3BOQA 4BNCA 3T1BA 4M9XA 1C0WA 5E1WA 1UB9A 2W25A 1R58A 3JW4A 5E1XA 1ZHFA 3W6KB 1AOYA 4M71A 1USSA 4A5MA 1Z9CA 5F64A 1MJAA 3F6OA 3U2RA 3R0JA 5TJJA 2QQ9A 1FWZA 2HEOA 3LA3A 5IT9K 2LNBA 4FT8A 3WTVC 2W57A 1P2FA 2Z9OA 2K4JA 5TRDA 4NB5A 3WG9A 2VOPA 1U5TB 1HW2A 1IN6A 2RKHA 1ZG1A 2BE5F 2RNJA 2IA2A 4R1HA 1DUXC 2FNAA 1IUYA 1IW7F 3GW2A 4CYDA 2XVCA 1SD4A 3HIFA 3K1MA 3TDUC 4ZZDA 5E20A 4G9YA 4N9HA 5LEKA 2XAHA 2ISZA 2K27A 5ICCA 2IT0A 3M9AA 1K78A 1GHCA 4HX7A 3FMQA 3GZ5A 2CWEA 3V7CA 3MZHA 2M5WA 5A2QZ 1JHFA 3NQOA 4L9NA 3IC7A 4EJOA 4LFUA 1R5GA 1F4KA 1HBXG 3EYYA 3BP8A 4YIIA 4EM2A 4LLLA 3MEXA 4P9FA 2VE9A 2L02A 1W7PB 3J80Z 1RIOH 1P4XA 3T5XA 3WU1B 3MCZA 4EQQA 1KU7A 3OOPA 2D2WA 1YQAA 4AIHA 2MH9A 1KU9A 4LB5A 1SFEA 3FWEA 1EH8A 1MJBA 4Z2YA 1KQ9A 4HF2A 4A2UA 4WCGA 3RDIA 2HYGD 3TOBA 1KA8A 3WGGA 2IA1A 4YFKF 1XMAA 2JPCA 5FFXA 5KVRA 2GA1A 3T8TA 3CO7C 2JPBA 1FYMA 3DQVC 5DEQA 1D8JA 1K7AA 4EGYA 1B1BA 4G7HF 4HA8A 3HYIA 2CQKA 1RNLA 1SD7A 1BN5A 2FBHA 4XRFA 1R1TA 1CF7B 4LJZF 3J81Z 3HRUA 4XSXF 3MZYA 2IA0A 1FYKA 1GVJA 1BI3A 2ZNYA 2K4BA 3KLNA 3BZ6A 4MEYF 2V9VA 2M87A 1QZZA 1TW2A 3MWMA 2COMA 4RB2C 4OIQF 1V3FA 1ON1A 1ZARA 5HLGA 3FXQA 4LMYA 3ECOA 1HKTA 3V7SA 2DK8A 2ZMEB 3FXRA 3TKYA 1KQ0A 5D5XB 3E3VA 2HGCA 3REOA 3QOPA 2GXBA 3JAMK 2PI0A 4JK1X 2P6TA 3FF5A 2J5OA 1YIOA 3TO6A 5BQTA 1O3QA 2G7UA 4HZFA 1BJAA 1DDNA 4EVIA 2A69F 4D0PA 4KIFA 2C6YA 4MQVA 1P92A 4S05A 1XSXA 1IXCA 4I0AA 2OQGA 3QP6A 1HXDA 1XSVA 4P55A 5DCMA 3WTUC 2GWRA 5ED4A 2K02A 2OAZA 4L9JA 2LF8A 3H3ZA 4U88A 5BOXA 5L3CA 2RC4A 4IHTA 1I27A 4OIRF 4NQWA 4LD5A 4EM0B 4N0BA 2PG4A 2WTEA 4LGWA 2YR2A 2HKXA 4LG0A 3MAJA 1FT9A 1UHWA 3TOAA 4CO8A 4IHSA 3J81K 5ILUA 4LK1F 2E1NA 2JSCA 3OV8A 2H09A 1IRGA 1U3EM 1T0FA 1FBQA 1H9GA 3T0YA 3E6DA 2ADUA 1QZYA 2VC1A 2EB7A 4I09A 3DEUA 3ZMUA 3CLOA 2H6CA 3VB2A 4ENKA 4EGZA 2STWA 1B59A 4HV6A 1P4WA 3G3ZA 3L9FA 4GYIA 1R22A 1WQ2A 3LSTA 1FNNA 1WKMA
chains in the Genus database with same CATH superfamily
3HSEA 3GTKJ 5FGMA 2R7WA 2ME0A 3O3KA 3Q5FA 2EFPA 4RAGA 2ZXHA 4DW6A 5EEAA 2VASA 3S3NA 5IOYA 3CUQA 4WXCA 2XHKA 3WTZA 3GX4X 5CLSA 1XGOA 4F55A 1F1ZA 2NXNB 3V42A 4HW0A 4N4NB 2HPMA 4KMFA 3RZOJ 4A6DA 1UMQA 1ZR2A 2WBMA 3V4GA 2E5ZA 3DPLC 4FQGA 1R71A 5HDGA 4XONA 4XLPF 1Y8QB 2M7BA 1FPQA 4RB1A 2BY2A 3ZPLA 1QBJA 3GVAA 5K5QA 5CVRA 2DAOA 2RDPA 1DQUA 3PIPF 3CUOA 3TO7A 3LFKA 4EJUA 2E35A 4U7BA 3FM5A 5LBQA 2X51A 2M4GA 2NS0A 2M0CA 3R61A 4E7KA 4X0GA 4P1WA 3ZMDA 4ZYEA 1B72B 2QQBA 3MQ0A 4A0XA 2XGXA 2X1DA 3U1KA 2Y9ZA 1MJ9A 2DMUA 1OYIA 4KT6A 5CVIA 3CJTB 1YTYA 1UHMA 2VOOA 4NC8A 2K3PA 2L3DA 2HS5A 1ZRDA 1M1EB 4C30A 1MNEA 1W5CC 3A03A 3DKWA 4B3AA 4PJMA 4XKBA 3K70D 1XB4A 2QBYB 4PK4A 1MW7A 5H6RA 3BQZA 1KYWA 4D7NA 1YLFA 1QRYA 3GYHX 4U87A 2FMLA 4AVPA 5BMZA 2R0QC 3R0AA 4XIDA 1VTNC 3VEPA 1IXRC 3F8BA 4BL0B 2DA2A 2BXYA 2EV5A 3PUBA 4AIJA 2ECBA 3K4LA 4J01A 1Y1VJ 1QPMA 3ZQGA 5J1UA 3QPTA 5FKKA 1S72I 1S5LC 1W7PD 4E7LA 4IJAA 2DT6A 2E7XA 2WADA 1IN4A 4Y33A 2RVCA 1MBJA 2EV0A 3CMAI 4PJ0C 5C44J 2EJRA 5H6QA 3S2WA 3DPTA 3QPSA 2K5CA 2LREA 4A69C 2P8TA 3H3VK 3LA7A 3ESWB 2GIZA 3FDYA 3RKYA 3F8FA 3JSPA 3HTSB 1J9IA 1G4DA 3FKIJ 2FF4A 2PQ8A 2QUFA 1TWHJ 4BH9A 2UXNA 1VQLI 3W6JB 4KFCA 3FHZA 1BI1A 1DP7P 2ZXWH 4GYGA 1LEBA 1E2XA 5EEHA 3KFWX 1MMGA 2PMHA 1G3WA 3M1EA 5D6EA 4XOTA 4GRIA 4GXOA 2A6TA 4D5FA 4EM1A 5C3EJ 4D1QA 1K4TA 3HB9A 2PJPA 3KLOA 3G2BA 3V8LA 4V2FA 4KIGA 1EJ9A 1HSJA 4BY7J 1VZ0A 3P9IA 5F0FA 1ETVA 2ZO4A 3S2DJ 4HDUA 4CSWA 2W4SA 1YW7A 4AD9A 3DCFA 5K5OA 3RPUA 2ESHA 3OYGA 3JCUC 2ZFUA 3JTHA 5LRRA 5FRMA 4OMYA 3W2AA 3GLLA 4Y4RA 1I3QJ 3BROA 3DLAA 1QVTA 3GLXA 3PL8A 3HHHA 1ETKA 1OYYA 2V9KA 3IH2A 2LRDA 2TRTA 1PUFA 2E1CA 4L0ZB 1HQCA 2RQPA 4ZC3A 2MLKA 4MEXF 4F52A 3H9GA 3OIOA 3LWFA 3QAHA 2HDWA 4B47A 1TT5B 2CJJA 4BDZA 2AQEA 2Z1DA 2A6EF 5ICGA 2R92J 2YX4A 1TP4A 2H8WA 2DOAA 2JJ7A 3SYTA 3S3MA 3SFZA 3OR2C 3BR2A 2DFIA 1YX5A 1Z7UA 2Q2EA 2EZLA 3DU6A 4M3FA 1HW1A 2L54A 3V8KA 4ETSA 2M45A 1CQTA 2OTLI 4CHUA 2OU2A 3RQIA 2R5ZA 5D4SA 2JA7J 2CUEA 3K4JA 3CJQB 3G1MA 5LGTA 4CA0A 2QQAA 1A04A 2R7FA 3BWGA 1I1SA 3QU6A 2XAGA 3P9CA 1O7FA 5F0HA 3H9JA 5AIPA 5HODA 4XRSA 1VQKI 2DA7A 4PUSA 5DYMA 4KYWA 1IG7A 2CS3A 4Y52J 2CRGA 4BXFA 4GGGA 1PP7U 2VC0A 4DZJA 1FOWA 2HQNA 2W00A 3KP6A 2XRNA 2FOKA 3OYNA 2QSHX 1NHAA 2WV0A 1W4MA 3SJMA 5F1RA 4KITB 2DA4A 3KP3A 2QWWA 5FD6A 4WXHA 1B9NA 3FXOA 2R5YB 2Z99A 3BCAA 3DBHB 3K1NA 3KP5A 4IQ4A 1TNSA 3DF8A 3OYCA 1IJWC 2VKVA 4ENMA 2MLGA 1FP2A 2HOTA 2A6HF 2AXTC 3MZ8A 2NVQJ 5HNHA 1MBFA 2YS9A 1U9NA 4PJJA 2F5CA 3JRAA 3CDLA 2XSJC 1YJNI 3KETA 4RGUA 2OA4A 2P4WA 5DUKA 3BG7A 4C9YA 1X2MA 2XRLA 3OOUA 1Z21A 3IH3A 3S1QJ 2G9WA 1MDMB 5IT9Z 1VNDA 4KICA 1LPQA 3H35A 2XKPA 3CMMA 1HSTA 4AWXB 4RAYA 1ERDA 5E8GA 1DGWY 3DLLF 1YHQI 3E5UA 1Z91A 4ZJZA 3HGYA 3M8EA 3FX3A 4CCKA 1EH7A 3JRBA 5M3FJ 2Y9YA 1HW5A 3CTAA 1XMXA 2KPMA 2ZXJA 5GAGJ 2RGVA 1HCRA 4K2EA 2LH9A 2WB1N 2F5VA 2MYSA 1H9TA 3OYLA 2EQRA 2PJRB 2OV7A 3P5JA 4XNFA 2GXGA 4L9VA 2LLKA 3GTQJ 3PIOF 3N4MA 5K7HA 2W85A 2IS1A 4PCQA 4XOPA 1ETOA 4FISA 1FJLA 4C2TA 1RUNA 1JXSA 4JOMA 2OQRA 4Y13A 3M7GA 4QWQA 1MDMA 5HOOA 1ZREA 1SC7A 4WX9A 4HSRA 2JN6A 2Y69H 4I98B 1BC7C 2O8KA 1R1VA 3Q9SA 5LEJA 1BL0A 1J2XA 3HM5A 4WWCA 2RAEA 1T33A 1VQ4I 1AKHA 3OIQA 3K4CA 2BW3B 2B7EA 2AQFA 2GM4A 4BEHA 4DQ2A 1XGSA 1Z7LA 5F08A 5ILSA 1W5TA 3ABKH 1RR8C 2L0KA 1PUEE 1WZ2A 5HNFA 2CMPA 1Z6RA 2ZJPF 2KRCA 4S04A 1HDPA 1GDTA 1ZELA 2V1XA 2AXLA 2LY9A 2JA6J 1XPXA 2DBBA 4Q47A 1BR1A 4UVCA 2OF7A 4A5NA 3PO3J 3WHCA 1R7JA 4M6YA 3HL2A 2IRFG 1OR7A 2KQRA 2LR8A 3GTJJ 3HOWJ 4RB0A 4IPAA 3U21A 1FY7A 3PSFA 2BV6A 2ME6A 1YIJI 1Y1WJ 2Z5UA 5LHGA 3R4KA 4NC6A 5EF6A 4HF0A 2JK3A 3LSRA 1REPC 1LE8B 3LA2A 2K9SA 1OYWA 1XSDA 3HKZA 4EEFG 4LG3A 1I50J 1T0FC 3SQNA 1ZAOA 4HDVA 1ZRCA 1P6RA 3CD6I 5JLXA 1KONA 2E2JJ 1Q1HA 2P7VB 4ENJA 2AHQA 5DM7F 2CW7A 3CF2A 3K69A 2X48A 3L2CA 3F8NA 1MIJA 1Y56A 3I5UA 3MFKA 2DA1A 2DDBA 1J59A 2A68F 3GWZA 3ULQB 5L3FA 1AWCA 1YRNB 2HDCA 4A0YA 5J3LA 2ELHA 4A93J 2NS8A 5GADJ 2V4JC 5LGUA 1WI9A 3L00A 5JR3A 4XLEA 2DPUA 3HEFA 3FZVA 1MBKA 1HA8A 1HOMA 1FOKA 2DMNA 5EZHA 4BXXJ 2XPVA 1XGNA 2FQ3A 2UXXA 1ETXA 1OJLA 5L3DA 5IPAA 3H0DA 1AHDP 2XAQA 4U7DA 2XF7A 1DU6A 4HLYA 4II2A 2ZC2A 3L1PA 4KDPA 1XCBA 3J7AO 4BDYA 1BJZA 5IYDJ 4LK0F 1NH3A 1LQ1A 3S3OA 3ZQFA 3LAPA 3P7NA 3RSNA 1JE8A 1IC8A 2X85A 4MIMA 1MMSA 2XGDA 4S0HB 4KA4A 4ZYHA 3VFZA 4XICA 2V1UA 1PVEA 2H94A 1ON2A 2OZUA 1S7OA 5HS7A 2F5FA 2NRAC 5CYVA 3K4KA 5HS8A 1RR7A 3ZN0A 4A3JJ 1SFKA 3S1RJ 2JZYA 1LVAA 5CVUA 1WJAA 1SVLA 3OYDA 2KDOA 3AG2H 2IAIA 1XDSA 3S8PA 1F36A 2O5RA 3G6EI 3E6CC 5M5WJ 3K2ZA 5FFZA 2Y48A 4L5IA 2M3AA 1WGXA 1PDNC 3HZJA 3QODA 2DN0A 2IEKA 3C7JA 4DYRA 4R8HA 4AVZA 2GXAA 4G8XA 5A2QK 2HYFA 5HLHA 2L5QA 3C2BA 3HC7A 3H92A 5HLTA 4PGGA 3HPHA 1TL8A 2FEZA 1FP1D 1K6OA 2KLOA 3Q0UA 3L2WA 4P9UA 3EPZA 5JVTA 5D6FA 2HZTA 2VBYA 4BKXA 2X9DA 2CQNA 3IAS2 2P81A 2VKDA 1EV7A 3HOSA 2G0EA 3BR3A 3IKVA 3WODF 4M6VA 3D5LA 2GOMA 3WTWC 2HKOA 2ZJ2A 3S93A 5IYCJ 3M07A 4HBLA 4MNUA 1O3SA 1A35A 2VLAA 5IT3A 1LDKB 2IS2A 1R49A 3WTSC 1R5HA 2L9SA 5FB2A 4XRSG 2HOEA 1JJ8C 2X6YA 2PBIA 5IY5H 3NARA 3RYPA 2KRFA 1IUFA 2COBA 4UV9A 1PP8F 1BR2A 1WCMJ 2ESNA 4DYQA 3HOYJ 3EETA 3S32A 4XKWA 5E79C 2E5NA 4MHGA 1D3YA 4BHPA 3IHUA 2FBIA 3TP0A 2JUCA 1SVOA 5CJ9A 1Z1DA 4TV7A 2WB1A 4CZCA 4J19A 4M74A 5JHUA 1T39A 1P9QC 1FYLA 3Q3SA 2OTJI 3E5QA 2X0LA 2RV8A 1WJBA 1ZLJA 1X1DA 4LIUA 2EZKA 5E3LA 2Y0MA 2GA2A 1XDUA 4CICA 3RI4A 1W0TA 3WE3A 3ML6A 3RTRA 1D1CA 4HV5A 4MFDA 3ZMVA 4HF1A 3KYDB 4RGRA 3PQKA 1YJ9I 3D1NI 3LOCA 5D5VB 4UVBA 5EG0A 4M9SA 2QBYA 1BIBA 3DV8A 2MA3A 3M8FA 3K4BA 3D5SC 3F23A 5GPAA 1IDZA 2VODA 4XKVA 2F4OB 5M5XJ 3P9KA 5LRSA 2CSOA 4YFXF 2FD5A 3NEUA 3I59B 3AL0C 1WRJA 2LK2A 2XF6A 2L7KA 3JTGA 2IPQX 5FKLA 1RESA 3I53A 3ZN1A 2LDUA 4DZPA 1D0YA 1QU3A 2VJ5A 3BJAA 4AIDA 4ENNA 4U0WA 3KYLA 3WU0A 4XL9A 3WE2A 1IZ1A 3ZMTA 3GO5A 1HKQA 3I0TA 1E17A 3BTJA 4MFEA 4CCOA 5EGOB 2H27A 1IDYA 1UAAA 4X6AJ 4MGRA 2P5LC 3FBIB 2DK5A 1IXSB 3S2HJ 1BW6A 3DXJF 1B9MA 5EG0B 3L2QA 3UKGA 1OQYA 6PAXA 2MBFA 1TC3C 1VQ5I 5J4VA 5LHIA 2XAJA 4XQFA 3VPRA 4PJNA 3CZ6A 3I55I 1RKWA 3JRHA 3HRMA 4XR6A 1MNMC 3AL0B 3DEEA 2L9VA 1W7PA 4BQNA 4EMSA 4IHWA 3M1CA 3I4NJ 2UWMA 4UXNA 1S9HA 2FSWA 5D5UB 2XAFA 3G73A 1LNWA 1LB2A 3R60A 4XMYA 4M9ZA 3G4SI 4PFPA 5HDKA 2R7XA 5FROA 3CMEI 5CPRB 5EJCA 4HLXA 5JI6A 2VBWA 5D4RA 3RZDJ 1SFOJ 2W84A 1KQ8A 2BVLA 2W24A 3QRFF 1L3LA 3DFGA 4O5VA 4KN7X 2A07F 2LOOA 4IHVA 3RQ4A 2BEOA 2E34A 1MD0A 4ON0A 4F7ZA 2M30A 4U0VA 4FX4A 4IRIA 5BPDA 2RN7A 1ZGJA 4JP0A 4IQJA 1R36A 3WHBA 1SMTA 5D5WB 1ZGWA 5AONA 4J00A 2DTZA 3HGGA 2EFWA 2KZGA 3BPVA 3CUQC 2I5UA 1J75A 3I4PA 1YW9A 2VI6A 4A3BJ 3FBNB 3PO2J 2Q8KA 3DTKA 1WSUA 1ZGAA 4UV8A 1H88C 1QQIA 3ABTA 4YFNF 2Y2ZA 1H89C 2H8RA 1SFXA 5E1ZB 3ISPA 2LKXA 2HFHA 2F5DA 1XCVA 3GCMA 4CYCB 2HXOA 3ONQA 3B6CA 2R7SA 2VBXA 5K7ZA 1IRFA 1I3AA 2A05A 4OOIA 4RM3A 2CQQA 2QCOA 1JT6A 1I1GA 2FU4A 2HQ5A 3AG4H 4LLNA 4B48A 1IAWA 1R4MB 3F72A 2H1LA 2TCTA 2XAUA 1O7LA 2Z16A 4QPQA 4ZDPA 4M72A 3OYIA 2IS4A 5CVVA 2LF7A 3CP2A 1LJ9A 4CXFA 2L7MP 1IN7A 1N78A 3FXLA 4XLNF 4BXUA 3MKYB 3CC4I 2WAEA 3ABLH 4A3FJ 4F3QA 1A36A 4EJTA 4HEA2 3N97A 1WWXA 5F04A 2LKSA 1LDDA 2QENA 4JX5A 5JFRA 3LNQA 4I02A 3GFMA 4A3KJ 2F2EA 3LSJA 1RPWA 1RUOA 1JUPA 1SAXA 2GOXB 1XC5A 5C4JJ 3ZRGA 2L4MA 3BCBA 5DDGA 4F92B 3ABUA 1BR4A 4MO7A 4B4CA 2JMWA 1QO0D 1IRXA 5CVJA 2JQ7A 1FBUA 2IJLA 3A0BC 3OYBA 2GZWA 5BPIA 4FHTA 2FBKA 4KJZA 4BHBA 3DPUA 1BW5A 1VI0A 3BTLA 2KL4A 2JRMA 5E17F 1KGSA 3F0CA 3K4MA 2DFHA 4I7HA 2KIUA 1XX5A 2CYYA 2KKOA 3VYSB 2O0YA 1BOAA 3HUGB 1JKRC 2OCCH 1H0MA 4NDLA 1BI2A 4GO1A 3I64A 1SMYF 1X4OA 4DGWB 2L2OA 3HRTA 3GMEA 3D0SA 5ICEA 3KEQA 3HOVJ 1X4PA 1WH5A 3ROUA 2AS5F 2L4AA 2ZNZA 3SZTA 1S8NA 2VQHA 1HKSA 3I59A 5CKTA 4BHCA 4UUVA 2ICWG 4G6QA 5L3GA 2BY3A 4Y15A 5LGNA 2EA4A 2R7QA 2QSFX 1U2WA 4OMZA 5FD5A 4O6JA 3IUOA 1UJ8A 1WJ5A 2PN6A 3N05A 1Z05A 4MTDA 5KK1A 4E7JA 2ID3A 3CDHA 4IKFA 2VQLA 1YRNA 4UY8I 3HUGA 3K70C 4L9TA 3S17J 4H0EA 1U5TC 3IWFA 3JSOA 1YG2A 1A6QA 2LTPA 2Z33A 2YU9J 2QKMB 5J4YA 5E3MA 3OR1C 1V5FA 4AU7A 4NQWB 2R7OA 3MKZA 2ZSHB 2QYOA 4G6TB 1V5GA 4BACA 1X19A 3H0GJ 2JTVA 1IN8A 1XN7A 2D5VA 2XUBA 3K10A 2DU9A 2VL8A 2FRHA 4GCVA 4C3JJ 2A3SA 3L09A 2A61A 2ISYA 4E7SA 1R5ID 3CMYA 2VKHA 1LUJB 4KIBA 5L3EA 3C3WA 2ZKZA 1QNTA 1YS7A 5DCFA 2WA0A 2O8XA 2K7LA 5BS6A 1G3TA 1ZKGA 2DOEA 1V4RA 3OIPA 5IP7J 4DYCA 1ZLKA 1B8IA 4RGXA 2K85A 3WGIA 2EWNA 5D8KB 2B9SA 3QQAA 1O3RA 4FE7A 1XGMA 1AA7A 3E6MA 2DT5A 1EKEA 2VUMJ 2OD5A 1VQMI 2DFFA 4RAFA 3KP2A 1Q1VA 1ZG5A 2IGKA 2DFEA 5E8IA 3OYHA 1IN5A 1QA6A 1FIAA 2JVHA 3F22A 1JKQC 2BBYA 5F6FA 5M5YJ 3J7ZI 3H36A 1JKOC 4D7MA 1IO2A 3GTMJ 1DPRA 4C2UA 3GFIA 2BHZA 3KEYA 4BJTA 2GIVA 5FKOA 3GF2A 3GZNB 2QLZA 3K0LA 1MH4A 3KP7A 3EYIA 1NK3P 2K9LA 2D1VA 4HNTA 1QHHD 3LL7A 5CQGA 3DWLE 3CUQB 2CUFA 2JT1A 2P5VA 3FMRA 1U6GA 1MNDA 4HX4A 4ZDOA 3HOXJ 3LAJA 3PFYA 4YG2F 4C2MJ 4AIKA 4XN3A 4IHXA 4A3GJ 4OU0A 3KEOA 3H5NA 2L7ZA 2Z3YA 2CH0A 1OCRH 2VB6A 1CF7A 2OC6A 4MTEA 3FXMA 4A6EA 2QSGX 4UVAA 1MKMA 3AFHA 3ZQIA 1TQIA 4XK4A 4KMUX 4B1RA 3W2VA 1GVDA 3CCRI 2E1MB 1N77A 4GFBA 3K9TA 4XLFA 1YJWI 1GV2A 3BR0A 3B73A 3ZCOA 1JJ6C 1G8XA 3HSRA 2BHYA 5EYRA 3DEWA 2R93J 3EUHA 2EFQA 3HSFA 1FZPB 3DP7A 2LD5A 2LBFA 2QZ8A 4M3GA 4LB6B 4B3XA 2J5PA 4BBRJ 5EDNA 2RNGA 2FMYA 2A5YB 4O3MA 1D0ZA 4Y17A 2VN2A 4IL6C 2P7CB 3FK6A 2ZFWA 2R7DA 3EDPA 1FTTA 3IV5A 3H1CA 1F9NA 2EFOA 4CGZA 2MFZA 2VBZA 3HBLA 1R23A 1KU2A 1JHHA 1WVRA 5EEGA 2O7OA 3WTYC 3K4NA 1ZN2A 1Z67A 3FISA 1VQ7I 4JX4A 5LLQA 2LSOA 1KYZA 1TQMA 3A01A 2P5KA 1FSEA 3QYEA 4KUMA 1EF4A 3BZCA 2JRTA 3TBIA 1HLVA 1Z77A 4JBAA 4G94A 3UR3C 1R9TJ 2IP2A 4E7ZA 1UG0A 2FE3A 1OCZH 3AAFA 2DJNA 1F5TA 1TNTA 2VONA 3VODA 2VIXA 4PFOA 3IL2A 2KIMA 2B0LA 4FX0A 1U8RA 4PZJA 4FETA 5JVGF 4RAZA 3OL3A 1JGGA 4BE0A 3OYEA 5DD8A 3BG5A 5B3SH 2Y0SA 1G6NA 4QSHA 3M4OJ 2WAQA 2M8GX 4E7IA 3QU3A 4I2OA 3E0JB 3IRRA 2CG4A 1V55H 3B02A 3FK7A 3JRGA 4W97A 2ACJA 3W6VA 2LMDA 5DUIA 2E1MC 3GXOA 4CCLA 3Q0VA 4F93B 2K3FA 2EK5A 2LY2A 1V5EA 2OZ6A 2XROA 2R7RA 1YOVB 4BBSJ 2GBYA 2HOAA 2HYJA 4HYEA 1K78B 3F6VA 2FXAA 4P5OA 3O8HA 2STTA 2XDVA 5D8LB 4B44A 5J8FA 1UHSA 1ZG3A 2HOSA 2QQ8A 1ZYRF 2X4HA 1JUMA 1W5SA 2X6WA 3S15J 2FNPA 1E3HA 5BNGA 2GAUA 4Q4ZF 3PNYA 4WF2A 4M6XA 3MD2A 1VFCA 1EH6A 2MD0A 1TTYA 3O6BB 4RDUA 2NVXJ 3HG9A 4KN4X 3JREA 3PNTA 3ERED 1T38A 2O3FA 3U9GA 2KISA 2TDXA 1LVKA 4DJAA 1ZH5A 2OUMA 2PLYA 2YPRA 4DNCA 4Y7NJ 2UUZA 1APLC 3RCOA 1YS6A 3QPLA 1IRZA 2E19A 3OSGA 1D0XA 1D8KA 2ELJA 4XKCA 4YELA 4B43A 1BC8C 4ZYGA 4IZZA 2O9LA 4CYCA 2DQLA 4L18B 1VQ6I 1L0OC 3A0HC 5FJ8J 3ZMZA 4UNOA 4HNUA 1PUFB 2CV2A 3BG3A 2WC2A 2E1OA 1UCRA 2R3SA 3I56I 2V7FA 2N8GA 4A3DJ 3BZKA 2ETHA 2XGEA 2M1BA 2KJCA 3CCLI 4DOZA 1XD7A 3ABMH 4M73A 3U1DA 3DKXA 5AIQA 3TW7A 4CUGA 3V8JA 4C3IJ 2Q2EB 5FKMA 5LFAA 4AYBA 2HNHA 1W0UA 3IWZA 3LMMA 3CP8A 3ASOH 2IS6A 3FM3A 4C3HJ 2D45A 4E4HA 5TISC 2F4IA 3HOTA 1PYVA 3GBGA 2V6CA 3K6GA 1K61A 3M8JA 5J47A 1YW8A 1MMAA 3FHNA 2CFOA 3C2HA 2OBPA 2F4MB 2H6BA 2MD5A 3JRCA 4HRIA 1MBGA 2M8EA 2M2EA 1ULYA 3F8MA 4RA2A 4XORA 1U5TA 2NVTJ 3I71A 2ZJQF 2EV6A 3NAUA 5GTIC 3RPQA 2CW0F 1B6AA 2DMQA 1Z3XA 5K7FA 2E7WA 1DPUA 1J0RA 1DGRM 5ILVA 3BJ6A 4XLHA 3WTTC 4L5EA 1W36D 2EFNA 3OYMA 2JA8J 3E5XA 1D1AA 3KZYA 3RKQA 2DOFA 3A02A 4OIOF 2KT0A 1T6SA 3BG9A 3O2PE 2ZJRF 2CV0A 2KP6A 1QVUA 1HDDC 3R6SA 3OYJA 2V1DA 1U8BA 1SD6A 1JT0A 3RJPA 3PQJA 4IVNA 2E36A 3I58A 1NK2P 2DO7A 1FC3A 2ZMEA 5IYBJ 3F21A 4CH7A 2DA6A 4UUTA 4AC0A 4B8XA 2E2IJ 3B6AA 2VJJA 5KCMA 5FLXZ 2YU3A 9ANTA 3DBLB 1FMWA 5DTDA 4A3IJ 4UUSA 2EINH 2NNYA 5HS9A 4OAYA 4QLCU 1OKRA 1WH7A 1GV5A 1Y6IA 1Y39A 3GUDA 1Z6TA 1IV8A 3SEQA 4YIFA 4ZDLA 3HTUA 1S29A 2M4KA 2XGCA 5IP6A 5K1YA 1Z3YA 1JTXA 1X3UA 1T2KA 1UELB 4ZZLA 1BI0A 1TLHB 2VJ4A 1A5JA 1OLTA 3ZQLA 3C1DA 2MSYA 4HAMA 1TQPA 1V54H 2HWVA 2CU7A 3IP4B 2BYVE 2HQRA 5GP9A 4BS9A 5HDNA 3PM1A 5LD2C 2DQRA 3L7WA 1MSEC 2V79A 3O8GA 1TWCJ 1J09A 2NYXA 3KP4A 4UB8C 3I54A 4BAYA 1RC9A 2LKPA 5EGOA 1OR7C 2VE8A 4DBQA 3CCYA 3LQQA 2VXDA 3VWBA 2JA2A 4IRHA 4DIQA 4G7ZF 4U0YA 4XM3A 4E70A 4AM3A 1JUSA 3ZXSA 2HDDA 2L01A 1D5YA 1MSFC 2F6CA 3AKZA 2NNNA 1TZLA 2KZVA 2BW3A 3TDZC 2EA2A 1R4NB 4M3EA 2ZSIB 4NC7A 1QZEA 3KE2A 2XASA 2NAZA 2B63J 1G3SA 5LHHA 3BJOA 2R7UA 4BYYA 4N9IA 4G7OF 2XKOA 2MC3A 1RKTA 2VQGA 4Z6YA 4G12A 1I6HJ 4ZTFA 4X1EA 1LFBA 3S16J 3OS0A 1X3ZB 1B4AA 1UFMA 2DYSH 1USTA 4L5JA 3WG7H 2O6GE 3WTXC 4A0ZA 5FO5A 4FTHA 1OFCX 4I01A 3F8CA 3SDGA 1MH3A 2HR3A 1CGPA 4ZH4F 3RKXA 3ZQCA 4XSZF 1J5YA 2EIJH 3OY9A 1OPCA 2V1NA 3FXUA 1YI2I 1WJCA 1R6RA 2F5EA 2QM3A 3QPHA 2M34A 3IRQA 1K4SA 1GUUA 1DP3A 3ZMSA 3J7YJ 1HF0A 5B1AH 2KIQA 3MMYB 2K86A 1I6XA 2X6OA 2DI3A 3OMYA 1IV6A 1ITYA 4BJ5C 2EPFA 3CDIA 4PSXA 3VOEA 4AUXA 5J40A 1SFUA 1Y0UA 2GQQA 4HX8A 1RETA 2MH2A 4KT5C 3HHGA 4XBFA 1A31A 2JVGA 1ENHA 1GLNA 5E18F 3ZQ7A 3KCCA 3DKYA 3BT9A 1T98A 2IBDA 4ITVA 3W3CA 1I5ZA 2DA5A 3COAC 3S1NJ 2HQAA 3D5RC 1R1UA 2QF7A 2BXZA 4E7HA 4PDKA 3JRFA 1NTCA 2PMZA 3ELKA 4LLGF 4A3MJ 2QVOA 1Y0NA 1G59A 2DPDA 2EIKH 2PMUA 1YYVA 4P96A 4IHYA 4ESBA 2VT2A 4HQEA 2Q0OA 4XRMA 1U0JA 1ETWA 3Q0WA 4R79A 2HTJA 1ACIA 2YX7A 3LSKA 1B72A 1WJDA 3ECHA 1GXQA 3OWTA 5ICFA 1MGTA 4ESFA 1ZQ3P 4IOAF 2VPRA 4EJVA 2ZXIA 4ASNA 3CCSI 2VT3A 3RYRA 1POGA 3QP5A 1D5VA 2PJRA 4HOBA 2MW8A 4Q48A 4HQMA 1TW3A 4RLQA 2BVMA 1FX7A 5CQEA 1BBYA 4UHTA 4IRGA 4UUSB 1O3TA 4G6DA 2O03A 1MBHA 2HTSA 3GFJA 3TW6A 1OCPA 2HZDA 1LE8A 3ASNH 1ODDA 2OJED 2CFXA 4ANJA 4BUPA 3IKTA 1J7KA 4HG2A 2K9QA 5HLIA 1FSHA 1G3YA 3OYAA 1XS9A 3KPHA 4A12A 2CW8A 4KISA 4JX6A 3RIRA 1AKHB 1TWAJ 4RGSA 4V19K 5JLWA 4BEHB 2BGCA 2G7HA 4RM2A 2EBIA 2XSDC 2UZKA 3NWTA 4FE4A 4BQQA 1R00A 1TBXA 2DLLA 2KFDA 2EH3A 3GEZA 4LG0B 2O61A 2VXZA 4BQAA 4IX7A 3LSPA 4M3BA 3I4MJ 3GFLA 2ID6A 2IGMA 2Q1ZB 1ZRFA 2D1HA 4NHJA 1D1BA 4CDGA 2KDZA 1YE9A 3KX2A 3F3XA 3VYUB 3VSLA 2XB0X 3FIWA 2DW4A 3BLYA 3H3UA 3CC7I 3NWSA 4WK8F 5L3BA 1O57A 2LVSA 2CO5A 3BR1A 4ESJA 1TWFJ 3CO6C 5DCMB 3VSKA 2PEXA 3J7AY 2ZBKA 3CCVI 4OINF 2HVSA 2CV1A 3T8RA 3GZ6A 3KZZA 1SVMA 3TMOA 1QPIA 3BDDA 2K40A 2FQ4A 2PMZN 4RB3C 2PFBA 3EQLF 5ERIA 1BM9A 1RZ4A 2DTRA 2ECCA 2HVQA 1S6LA 5FLXK 2YSRA 4IEJA 3CQZJ 1P4AA 3BPXA 5DD4A 4KNYA 1LFPA 2QGUA 2W48A 3FMSA 1FOYA 3G1LA 4L0YB 2DJIA 3SXYA 4WXDA 2YUSA 3HOZJ 1X1BA 4HNVA 5HVQC 1OMIA 3L2RA 3CJNA 3E6BA 1KU3A 2K9NA 4RBOA 1WJFA 4ZYAA 5TGTA 3BY6A 5H20A 3K2AA 1LDJA 2ZCWA 1K79A 2V26A 5FRNA 1JGSA 3M3YJ 5IP9J 2HXIA 2NOJB 2WY7Q 3TO9A 3CCJI 3Q9VA 3SFIA 5GPCA 5J8CA 3CESA 3ZP5A 2E2HJ 1ZTRA 2NS7A 5K5RA 3BQYA 1VQ9I 2FA5A 4ZTJA 2WWYA 2L7FP 2BY0A 4I99C 3EUKL 3RKWA 3FKJA 3OYFA 2VQCA 4Q5SF 1MZBA 5F0CA 5FKNA 4MQ9F 3UNGC 4CZZA 1U78A 4EV0A 1S3JA 1YFHA 3TL4X 4OIPF 1SD5A 4IXAA 4RS8A 5KAFC 2DDAA 4IOCF 2Y75A 2VPLA 5J6XA 4I0BA 2XIGA 2OPTA 2IW5A 1TT0A 2EZIA 2JUGA 1OISA 2VKEA 3PFIA 3SHFA 1IGNA 1X3WB 2KIFA 3V7RA 3C18A 3HPGA 1JKPC 3TGNA 1TWGJ 4EJWA 1AU7A 3LSIA 4OWRB 4PGHA 1QGPA 3LQRA 3WGHA 1RI7A 1BIAA 1MMDA 1FBSA 2V9PA 3C2GA 4IF4A 1VQOI 2IVMA 3ZGKA 1U9OA 4Y3OA 1QHGA 2XV4S 1T56A 3HRSA 4JQFA 1OCTC 2P6SA 1GXPA 3SZPA 3TQNA 3J80K 1IF1A 3H5AA 3QOEA 1YO5C 4B09A 1S7AA 1STZA 3KYCB 3AG1H 2I8DA 2R5YA 2CGPA 1X1PA 1LEAA 4D9JA 5KNLA 5E3NA 1XMKA 3JAMZ 5FLMJ 4ZYDA 1YITI 4BQOA 2EIMH 3OS1A 3E97A 3HDDA 2WAFA 5DV5A 4A3EJ 1T95A 3K1PA 3ZQHA 1XTAA 2Y31A 2KJBA 1ONVA 2DA3A 3OYKA 3NRVA 1FLIA 3H9QA 1JI8A 1FTZA 3BOQA 4BNCA 3T1BA 4EATA 4M9XA 2KMUA 2MABA 4F91B 1C0WA 2Y30A 1FMVA 5E1WA 1K83J 3X2QH 2NVYJ 1UB9A 2OCEA 3CCUI 1P7IA 1XG1A 2W25A 4I6ZA 1DU0A 1R58A 4GDFA 3A2KA 2W1OA 1WI3A 1SANA 3JW4A 5E1XA 5IOZA 3ZOBA 1ZHFA 3W6KB 1AOYA 2W82A 4M71A 5M3MJ 1USSA 4A5MA 1Z9CA 5F64A 1LKXA 2DCEA 1MJAA 3F6OA 3U2RA 3WU2C 2DODA 3R0JA 5TJJA 3MKWB 1WPKA 2QQ9A 2LC2A 3QWLA 3MKLA 1FWZA 2HEOA 3LA3A 2GLOA 2MGQA 4D5CA 5IT9K 3E1SA 4OAZA 1BOBA 1FIPA 2LNBA 2H1KA 4FT8A 3WTVC 2W57A 3GTOJ 1P2FA 3S14J 2Z9OA 4CCMA 2K4JA 1X58A 5TRDA 5F27A 4QIWN 4H4KC 4NB5A 3WG9A 3LFUA 2VOPA 1U5TB 1HW2A 1IN6A 2CUZA 2RKHA 1ZG1A 2BE5F 2RNJA 3JR9A 2RQQA 1JTYA 2KHMA 3PUFA 4MLOA 5F1JA 2IA2A 5B66C 3QYFA 4R1HA 2I10A 1DUXC 2FNAA 2XPWA 1IUYA 1IW7F 1WJEA 3GW2A 3RPUD 1PJRA 2XVCA 3OL4A 4CYDA 2HVRA 1SD4A 3HIFA 3K1MA 3TDUC 4ZZDA 4HSTA 5E20A 1H8AC 1FOXA 4G9YA 1UZCA 1YX3A 2NVUB 4N9HA 5JHFA 2A5WA 1G2HA 3BR5A 5LEKA 2R7ZJ 2IGNA 2XAHA 4YIRX 3AG3H 1ETYA 2K27A 4NUBA 2ISZA 3H5RA 5ICCA 2IT0A 3M9AA 3ZR8X 3IH4A 1K78A 1GHCA 3JRIA 4HX7A 3KZIC 3FMQA 3GZ5A 3GTLJ 2CWEA 3V7CA 3MZHA 4A3LJ 2M5WA 5A2QZ 1JHFA 1WHUA 3ERMA 1EA3A 3NQOA 4L9NA 2CQXA 1E3OC 5DM6F 1NG7A 3CCEI 3DTIA 4A3CJ 3IC7A 4EJOA 3OSFA 5J1RA 4LFUA 1R5GA 1X2NA 1F4KA 1T8IA 1HBXG 3EYYA 3BP8A 4YIIA 1LFUP 4NBQA 4LLLA 4EM2A 2JSPA 3MEXA 2QA4I 2DMPA 4P9FA 1ZR4A 5DS9A 2VE9A 2L02A 2DMTA 1W7PB 4BU2A 3J80Z 1RIOH 3SEZA 1P4XA 3T5XA 3WU1B 1MMNA 3MCZA 2L9NA 4EQQA 1KU7A 1BA5A 3OOPA 2D2WA 1GT0C 1YQAA 2AO9A 3HOUJ 1SEUA 3CC2I 4BY1J 2ZB9A 4AIHA 1RRJA 2MH9A 1KU9A 4LB5A 3LSMA 1SFEA 3E7LA 3FWEA 1W1WE 1EH8A 3MVPA 1MJBA 3CJRB 4Z2YA 4FCYA 1KQ9A 4HF2A 4A2UA 3HJEA 5C4XJ 4E6KG 4WCGA 3RDIA 2X1EA 2HYGD 5FLVA 3TOBA 2BZTA 4UB6C 5EZGA 1ZK8A 1KA8A 3G1OA 1FEXA 3WGGA 4QPOA 2KRHA 4II3A 5KAIC 2IA1A 4YFKF 1XMAA 2JA5J 2JPCA 3PNVA 5FFXA 2HI3A 2GA1A 5KVRA 3T8TA 3CO7C 2JPBA 4LIVA 1FYMA 2IXSA 4XN0A 2X6XA 1UG2A 3DU5A 3DQVC 3S1MJ 5DEQA 3EUHC 3LSHA 4EGYA 1K7AA 1VQNI 1ETQA 3DTEA 1D8JA 2FX0A 3BG6A 1B1BA 4G7HF 3I9V2 4HA8A 3HYIA 3A4CA 2MC4A 3CCMI 2HPIA 2CQKA 3CCQI 1RNLA 1SD7A 2BOLA 1BN5A 1OCOH 3A1YA 2V6EA 2FBHA 4XRFA 2Z2SB 3HXLA 4M3DA 5J1YA 1R1TA 1CF7B 3VDXA 1MBEA 4LJZF 2E60A 1Z0XA 1P7JA 2Y0SN 3CF5F 3J81Z 3HRUA 3PJRA 4XSXF 1T08B 3CLQA 3MZYA 2IA0A 2IGOA 2LP0A 3K7AJ 1GVJA 1FYKA 1BI3A 1OCCH 1VF9A 2ZNYA 5E3OA 2K4BA 3KLNA 2QEXI 3BZ6A 2ELKA 4MEYF 2V9VA 2M87A 4LOCA 4XLAA 2M7AA 1QZZA 1TW2A 2R4GA 3BR6A 3TP3A 3MWMA 1VQPI 2COMA 3VYTB 4RB2C 3OS2A 2F48A 4JYKA 4OIQF 1K6YA 1V3FA 3HKZN 1ON1A 2QKLB 1ZARA 5HLGA 4QTRA 3FXQA 1I39A 4LMYA 3ECOA 2LBFB 1HKTA 3V7SA 2DK8A 2ZMEB 3FXRA 3FXJA 3SDBA 1KQ0A 4W1UA 1KZHA 3TKYA 5D5XB 4CCNA 2XB5A 5GTHC 3E3VA 2HGCA 1N25A 3REOA 4XLCA 3QOPA 2GXBA 4HPQA 4ABZA 2DXIA 2UV1A 2WV1A 3JAMK 3PSIA 1VQ8I 4PJLA 4IO9F 2BY1A 2VJIA 2PI0A 2LFBA 2XPUA 4JK1X 4BE1A 2EILH 2P6TA 3FF5A 2JWTA 2J5OA 1YIOA 3TO6A 5BQTA 3ZQQA 1HC8A 1X1CA 2EZHA 2NOGA 2G7UA 4HZFA 1Y8RB 1O3QA 4CCJA 1W36C 1BJAA 5B1BH 1DDNA 2MG4A 4EVIA 3BC8A 1WFXA 2WAQN 3QYBA 4FASD 1A6IA 2A69F 3BTIA 4D0PA 3LSGA 2E71A 3L2UA 2WY8Q 4KIFA 2X1CA 4DBRA 3VYRB 4MQVA 1P92A 3G71I 2C6YA 4S05A 1XSXA 1IXCA 2M0MA 4I0AA 5GAEJ 2L9RA 4BE2A 2K9MA 1O4XA 1B8IB 2LG4A 1X1AA 2OQGA 3QP6A 1HXDA 1XSVA 4P55A 5DCMA 5B5EC 3WTUC 3F9KA 2GWRA 1SAUA 2R7VA 1NG6A 5ED4A 3JRDA 2K02A 2OAZA 4L9JA 1E0EA 2P0WA 2LF8A 2RREA 3DBRB 3H3ZA 2XC7A 4U88A 1S7EA 5BOXA 3SZGA 5L3CA 2RC4A 4IHTA 4V2GA 1N75A 1I27A 4OIRF 4NQWA 4LD5A 4EM0B 4N0BA 4YEJA 2PG4A 2WTEA 4RLFA 4LGWA 2HU9A 2HKXA 2YR2A 3MN2A 2W7NA 4BJ6C 4LG0A 3A01B 2ZMEC 3MAJA 1FT9A 1UHWA 3TOAA 4CO8A 4IHSA 3J81K 5KHDA 2FOWA 3FXKA 5ILUA 4LK1F 4LITA 2E1NA 2JSCA 3BTCA 3OV8A 2R7TA 3I3LA 2H09A 4YRVA 2CUJA 1IRGA 4N4OB 4PSWA 1U3EM 2DYRH 2PX9A 3GTGJ 1T0FA 3L2VA 2CQ7A 1FBQA 5GAHJ 4AYBN 2XF5A 3KIOA 1H9GA 2LYCA 3T0YA 4NNJA 3E6DA 2ADUA 2FUG2 1QZYA 2VC1A 3IAM2 3GTPJ 2EB7A 4I09A 5H2FC 2R5ZB 3W2WA 3DEUA 4I76A 3ZMUA 3CLOA 2H6CA 4BGDA 3VB2A 3TEDA 4ENKA 2LY1A 4EGZA 4RMNA 2STWA 2DT7B 2M9HA 1B59A 4HV6A 1F43A 1P4WA 1ORKA 3EUAA 3G3ZA 2FJ1A 1E3PA 3L9FA 4GYIA 1R22A 1WQ2A 3LSTA 1FNNA 1WKMA
chains in the Genus database with same CATH topology
3HSEA 5FGMA 3O3KA 3Q5FA 2EFPA 3CUQA 4WXCA 2XHKA 3WTZA 3GX4X 5CLSA 1XGOA 1F1ZA 4HW0A 4KMFA 4A6DA 3V4GA 3DPLC 5HDGA 4XLPF 1FPQA 4RB1A 3ZPLA 1QBJA 3GVAA 5K5QA 5CVRA 2DAOA 2RDPA 3CUOA 3TO7A 3LFKA 4EJUA 4U7BA 3FM5A 5LBQA 2NS0A 3R61A 3ZMDA 4ZYEA 2QQBA 3MQ0A 4A0XA 2XGXA 1MJ9A 1OYIA 5CVIA 1YTYA 1UHMA 2VOOA 2L3DA 2HS5A 1ZRDA 3DKWA 1XB4A 2QBYB 5H6RA 1KYWA 1YLFA 3GYHX 2FMLA 4AVPA 5BMZA 3R0AA 1VTNC 3VEPA 1IXRC 3F8BA 2EV5A 4AIJA 1QPMA 3QPTA 1W7PD 4IJAA 2E7XA 1IN4A 2RVCA 2EV0A 2EJRA 5H6QA 3S2WA 3DPTA 2P8TA 3LA7A 3HTSB 3JSPA 3RKYA 3F8FA 1J9IA 1G4DA 2FF4A 2PQ8A 2QUFA 4BH9A 2UXNA 3W6JB 4KFCA 3FHZA 1BI1A 1DP7P 4GYGA 1LEBA 1E2XA 5EEHA 3KFWX 3M1EA 2PMHA 1G3WA 5D6EA 4GXOA 4EM1A 2PJPA 3KLOA 3V8LA 4KIGA 1HSJA 3P9IA 2ZO4A 4HDUA 1YW7A 4AD9A 5K5OA 3RPUA 2ESHA 3JTHA 5LRRA 4OMYA 3BROA 3GLXA 3HHHA 2E1CA 1OYYA 4L0ZB 1HQCA 2RQPA 2MLKA 4MEXF 3LWFA 3QAHA 2A6EF 5ICGA 2YX4A 3SFZA 2DFIA 1Z7UA 2Q2EA 1HW1A 2L54A 3V8KA 4ETSA 2M45A 4CHUA 2OU2A 5D4SA 5LGTA 2QQAA 1A04A 2R7FA 3BWGA 1I1SA 3QU6A 2XAGA 3P9CA 1O7FA 5AIPA 5DYMA 4KYWA 4GGGA 1PP7U 2VC0A 2HQNA 3KP6A 2XRNA 2FOKA 1NHAA 2WV0A 1W4MA 5F1RA 3KP3A 2QWWA 5FD6A 4WXHA 1B9NA 2Z99A 3K1NA 3KP5A 1TNSA 3DF8A 4ENMA 2MLGA 1FP2A 2A6HF 2F5CA 3KETA 4RGUA 2OA4A 2P4WA 5DUKA 2G9WA 1MDMB 5IT9Z 4KICA 2XKPA 4AWXB 1HSTA 4RAYA 5E8GA 3E5UA 1Z91A 3M8EA 3FX3A 1EH7A 3CTAA 1HW5A 2ZXJA 2RGVA 4K2EA 1H9TA 2GXGA 4L9VA 3N4MA 2W85A 4PCQA 1JXSA 1RUNA 2OQRA 4Y13A 3M7GA 4QWQA 1MDMA 5HOOA 1ZREA 4WX9A 1BC7C 4I98B 1R1VA 3Q9SA 5LEJA 1J2XA 4WWCA 4DQ2A 1XGSA 5ILSA 1W5TA 1PUEE 1Z6RA 4S04A 2V1XA 2AXLA 2DBBA 4Q47A 4UVCA 4A5NA 1R7JA 4M6YA 2IRFG 1OR7A 4RB0A 4IPAA 1FY7A 2BV6A 2Z5UA 5LHGA 3R4KA 4HF0A 1REPC 3LA2A 1OYWA 1XSDA 3SQNA 1ZAOA 4HDVA 1ZRCA 1P6RA 1Q1HA 2P7VB 4ENJA 3K69A 3L2CA 3F8NA 3I5UA 3MFKA 1J59A 2A68F 3GWZA 3ULQB 2HDCA 5L3FA 1AWCA 4A0YA 2ELHA 5LGUA 2DPUA 1WI9A 3L00A 5JR3A 3FZVA 1FOKA 1XGNA 2FQ3A 2UXXA 5L3DA 2XAQA 4U7DA 4HLYA 4KDPA 1XCBA 3J7AO 4LK0F 1LQ1A 3LAPA 3P7NA 1JE8A 4KA4A 4ZYHA 3VFZA 2V1UA 2H94A 1ON2A 2OZUA 2NRAC 5HS7A 1S7OA 2F5FA 5CYVA 5HS8A 3ZN0A 2JZYA 1LVAA 5CVUA 1XDSA 3E6CC 3K2ZA 5FFZA 2Y48A 4L5IA 1PDNC 3C7JA 4R8HA 4G8XA 5A2QK 2HYFA 5HLHA 3H92A 4PGGA 2FEZA 1K6OA 1FP1D 4P9UA 5JVTA 5D6FA 2HZTA 2VBYA 1EV7A 3HOSA 3IKVA 3WODF 3D5LA 3WTWC 2HKOA 2ZJ2A 4HBLA 4MNUA 1O3SA 5IT3A 1LDKB 3WTSC 1R5HA 5FB2A 2HOEA 2PBIA 3RYPA 2KRFA 4UV9A 1PP8F 2ESNA 3EETA 4MHGA 1D3YA 4BHPA 3IHUA 2FBIA 5CJ9A 1Z1DA 4TV7A 4M74A 5JHUA 1T39A 1FYLA 3E5QA 2X0LA 2RV8A 1ZLJA 2Y0MA 2GA2A 1XDUA 4CICA 3RI4A 3WE3A 3ML6A 3RTRA 4HV5A 3ZMVA 4HF1A 4RGRA 3PQKA 5D5VB 4UVBA 4M9SA 2QBYA 1BIBA 3DV8A 2MA3A 3M8FA 3F23A 2VODA 3P9KA 5LRSA 2CSOA 4YFXF 3NEUA 3I59B 1WRJA 3JTGA 2IPQX 3I53A 3ZN1A 2LDUA 3BJAA 4ENNA 4U0WA 3WU0A 3WE2A 1IZ1A 3ZMTA 3GO5A 1HKQA 3I0TA 1E17A 2H27A 4MGRA 2P5LC 2DK5A 1IXSB 3DXJF 1B9MA 6PAXA 2MBFA 5LHIA 2XAJA 3HRMA 1W7PA 4EMSA 2UWMA 4UXNA 2FSWA 5D5UB 2XAFA 3G73A 1LNWA 1LB2A 3R60A 4M9ZA 5HDKA 4HLXA 5JI6A 2VBWA 5D4RA 2W84A 1KQ8A 2W24A 3QRFF 1L3LA 3DFGA 4O5VA 4KN7X 2A07F 2BEOA 1MD0A 4ON0A 4F7ZA 2M30A 4U0VA 4FX4A 4IRIA 5BPDA 2RN7A 1ZGJA 1R36A 1SMTA 5D5WB 5AONA 2EFWA 3BPVA 3CUQC 1J75A 3I4PA 1YW9A 2Q8KA 1WSUA 1ZGAA 4UV8A 1QQIA 3ABTA 4YFNF 1SFXA 5E1ZB 3ISPA 2HFHA 2F5DA 1XCVA 2VBXA 1IRFA 4OOIA 1I1GA 2FU4A 4LLNA 1IAWA 3F72A 1O7LA 4M72A 5CVVA 2LF7A 1LJ9A 4CXFA 1IN7A 4XLNF 4BXUA 4EJTA 3N97A 1WWXA 1LDDA 2QENA 5JFRA 4I02A 3GFMA 2F2EA 1RUOA 1SAXA 2L4MA 5DDGA 3ABUA 1QO0D 5CVJA 1FBUA 2IJLA 2GZWA 5BPIA 4FHTA 2FBKA 4BHBA 5E17F 1KGSA 4I7HA 2KIUA 2CYYA 2KKOA 2O0YA 1BOAA 1H0MA 1BI2A 4GO1A 3I64A 1SMYF 3HRTA 5ICEA 3D0SA 3KEQA 3ROUA 2AS5F 2L4AA 2ZNZA 3SZTA 1S8NA 1HKSA 3I59A 4BHCA 4UUVA 4G6QA 5L3GA 4Y15A 5LGNA 2EA4A 1U2WA 4OMZA 5FD5A 4O6JA 2PN6A 1Z05A 4MTDA 5KK1A 3CDHA 3HUGA 4L9TA 4H0EA 1U5TC 3IWFA 3JSOA 1YG2A 2Z33A 2QYOA 2JTVA 1IN8A 1XN7A 2XUBA 2DU9A 2FRHA 4GCVA 2A3SA 3L09A 2A61A 2ISYA 4KIBA 5L3EA 3C3WA 2ZKZA 1QNTA 1YS7A 5DCFA 2O8XA 2K7LA 5BS6A 1G3TA 1V4RA 1ZLKA 4RGXA 3WGIA 2EWNA 5D8KB 1O3RA 1XGMA 3E6MA 2DT5A 2OD5A 3KP2A 1ZG5A 5E8IA 1IN5A 3F22A 2BBYA 5F6FA 1DPRA 3GFIA 2GIVA 3GF2A 2QLZA 3K0LA 3KP7A 3EYIA 2D1VA 3CUQB 2JT1A 2P5VA 3FMRA 1U6GA 4HX4A 3LAJA 4YG2F 4AIKA 4OU0A 3KEOA 2Z3YA 1CF7A 4MTEA 4A6EA 4UVAA 1MKMA 1TQIA 4KMUX 3K9TA 3B73A 3HSRA 3EUHA 2EFQA 3HSFA 1FZPB 3DP7A 2QZ8A 4LB6B 2J5PA 2FMYA 2A5YB 4O3MA 4Y17A 2VN2A 2P7CB 2ZFWA 2R7DA 3EDPA 1F9NA 4CGZA 2EFOA 2VBZA 1R23A 1KU2A 1JHHA 5EEGA 3WTYC 1ZN2A 5LLQA 2LSOA 1KYZA 1TQMA 2P5KA 1FSEA 4KUMA 2JRTA 4JBAA 4G94A 2IP2A 2FE3A 3AAFA 1F5TA 1TNTA 2VONA 3VODA 3IL2A 2KIMA 2B0LA 4FX0A 1U8RA 4PZJA 4RAZA 5DD8A 1G6NA 3QU3A 4I2OA 3IRRA 2CG4A 3B02A 2ACJA 5DUIA 3GXOA 2EK5A 2OZ6A 2XROA 4HYEA 1K78B 3F6VA 2FXAA 4P5OA 2STTA 5J8FA 5D8LB 1ZG3A 1ZYRF 2X4HA 1W5SA 2FNPA 2GAUA 4Q4ZF 4WF2A 4M6XA 1EH6A 1TTYA 3O6BB 4KN4X 3ERED 1T38A 2O3FA 3U9GA 2TDXA 1ZH5A 2PLYA 2YPRA 4DNCA 1YS6A 1D8KA 1BC8C 4ZYGA 2DQLA 4L18B 1L0OC 3ZMZA 4UNOA 2WC2A 1UCRA 2R3SA 2ETHA 2M1BA 2KJCA 1XD7A 4M73A 3U1DA 5AIQA 3V8JA 3IWZA 3FM3A 2D45A 3HOTA 2V6CA 1YW8A 2OBPA 2H6BA 2MD5A 2M8EA 1ULYA 3F8MA 1U5TA 3I71A 2EV6A 3RPQA 2CW0F 1B6AA 2E7WA 1DPUA 1J0RA 5ILVA 3BJ6A 3WTTC 2EFNA 3E5XA 3KZYA 4OIOF 1T6SA 3O2PE 3R6SA 2V1DA 1SD6A 3RJPA 3PQJA 4IVNA 3I58A 2DO7A 1FC3A 2ZMEA 3F21A 4B8XA 5FLXZ 2YU3A 2NNYA 5HS9A 4QLCU 1OKRA 3GUDA 1Z6TA 4YIFA 3HTUA 1S29A 5K1YA 1X3UA 1T2KA 4ZZLA 1BI0A 1TLHB 3C1DA 4HAMA 1TQPA 2HWVA 2BYVE 2HQRA 5HDNA 2DQRA 3L7WA 2V79A 2NYXA 3KP4A 3I54A 4BAYA 2LKPA 2VE8A 3LQQA 4IRHA 4G7ZF 4U0YA 4E70A 2L01A 2NNNA 3TDZC 2EA2A 3KE2A 2XASA 2NAZA 1G3SA 5LHHA 3BJOA 4BYYA 4N9IA 4G7OF 2XKOA 2MC3A 1B4AA 1UFMA 1USTA 4L5JA 2O6GE 3WTXC 4A0ZA 5FO5A 4I01A 3F8CA 1CGPA 2HR3A 4ZH4F 3RKXA 4XSZF 1J5YA 1OPCA 3FXUA 2F5EA 2QM3A 3QPHA 3IRQA 3ZMSA 2K86A 1I6XA 2DI3A 3VOEA 1SFUA 1Y0UA 2GQQA 4HX8A 2MH2A 4KT5C 3HHGA 4XBFA 5E18F 3ZQ7A 3KCCA 1T98A 1I5ZA 3COAC 1R1UA 4PDKA 3ELKA 4LLGF 2QVOA 2DPDA 2PMUA 1YYVA 4P96A 4ESBA 2VT2A 4HQEA 2Q0OA 4R79A 2HTJA 2YX7A 3ECHA 1GXQA 5ICFA 1MGTA 4ESFA 4EJVA 4ASNA 2VT3A 3RYRA 3QP5A 1D5VA 4HOBA 4Q48A 4HQMA 1TW3A 1FX7A 1BBYA 4UHTA 4IRGA 1O3TA 4G6DA 2O03A 2HTSA 3GFJA 1ODDA 2CFXA 3IKTA 1J7KA 5HLIA 1FSHA 1G3YA 4A12A 3RIRA 4RGSA 2BGCA 2G7HA 2UZKA 1R00A 1TBXA 2DLLA 3GEZA 4LG0B 2O61A 2VXZA 4BQAA 3GFLA 1ZRFA 2D1HA 4NHJA 4CDGA 3F3XA 2DW4A 3H3UA 4WK8F 5L3BA 1O57A 2CO5A 4ESJA 3CO6C 5DCMB 2PEXA 2ZBKA 4OINF 3T8RA 3GZ6A 3KZZA 3BDDA 4RB3C 2PFBA 3EQLF 5ERIA 1BM9A 1RZ4A 2DTRA 1S6LA 5FLXK 2YSRA 1P4AA 3BPXA 5DD4A 4KNYA 3FMSA 4L0YB 3SXYA 4WXDA 5HVQC 1OMIA 3CJNA 3E6BA 1KU3A 3BY6A 5H20A 1LDJA 2ZCWA 1K79A 1JGSA 3TO9A 3Q9VA 5J8CA 3ZP5A 5K5RA 2FA5A 2WWYA 3RKWA 4Q5SF 1MZBA 4CZZA 4MQ9F 1U78A 4EV0A 1S3JA 1YFHA 4OIPF 1SD5A 4IXAA 4RS8A 2Y75A 5J6XA 4I0BA 2XIGA 3PFIA 2IW5A 3SHFA 2KIFA 3V7RA 3C18A 3TGNA 4EJWA 4PGHA 1QGPA 3LQRA 3WGHA 1RI7A 1BIAA 4IF4A 1FBSA 2IVMA 2XV4S 3HRSA 4JQFA 2P6SA 1GXPA 3SZPA 3TQNA 3J80K 1IF1A 1YO5C 4B09A 1S7AA 1STZA 2CGPA 1LEAA 1XMKA 3JAMZ 4ZYDA 3E97A 5DV5A 3K1PA 2KJBA 1ONVA 3NRVA 1FLIA 3BOQA 4BNCA 3T1BA 4M9XA 1C0WA 5E1WA 1UB9A 2W25A 1R58A 3JW4A 5E1XA 1ZHFA 3W6KB 1AOYA 4M71A 1USSA 4A5MA 1Z9CA 5F64A 1MJAA 3F6OA 3U2RA 3R0JA 5TJJA 2QQ9A 1FWZA 2HEOA 3LA3A 5IT9K 2LNBA 4FT8A 3WTVC 2W57A 1P2FA 2Z9OA 2K4JA 5TRDA 4NB5A 3WG9A 2VOPA 1U5TB 1HW2A 1IN6A 2RKHA 1ZG1A 2BE5F 2RNJA 2IA2A 4R1HA 1DUXC 2FNAA 1IUYA 1IW7F 3GW2A 4CYDA 2XVCA 1SD4A 3HIFA 3K1MA 3TDUC 4ZZDA 5E20A 4G9YA 4N9HA 5LEKA 2XAHA 2ISZA 2K27A 5ICCA 2IT0A 3M9AA 1K78A 1GHCA 4HX7A 3FMQA 3GZ5A 2CWEA 3V7CA 3MZHA 2M5WA 5A2QZ 1JHFA 3NQOA 4L9NA 3IC7A 4EJOA 4LFUA 1R5GA 1F4KA 1HBXG 3EYYA 3BP8A 4YIIA 4EM2A 4LLLA 3MEXA 4P9FA 2VE9A 2L02A 1W7PB 3J80Z 1RIOH 1P4XA 3T5XA 3WU1B 3MCZA 4EQQA 1KU7A 3OOPA 2D2WA 1YQAA 4AIHA 2MH9A 1KU9A 4LB5A 1SFEA 3FWEA 1EH8A 1MJBA 4Z2YA 1KQ9A 4HF2A 4A2UA 4WCGA 3RDIA 2HYGD 3TOBA 1KA8A 3WGGA 2IA1A 4YFKF 1XMAA 2JPCA 5FFXA 5KVRA 2GA1A 3T8TA 3CO7C 2JPBA 1FYMA 3DQVC 5DEQA 1D8JA 1K7AA 4EGYA 1B1BA 4G7HF 4HA8A 3HYIA 2CQKA 1RNLA 1SD7A 1BN5A 2FBHA 4XRFA 1R1TA 1CF7B 4LJZF 3J81Z 3HRUA 4XSXF 3MZYA 2IA0A 1FYKA 1GVJA 1BI3A 2ZNYA 2K4BA 3KLNA 3BZ6A 4MEYF 2V9VA 2M87A 1QZZA 1TW2A 3MWMA 2COMA 4RB2C 4OIQF 1V3FA 1ON1A 1ZARA 5HLGA 3FXQA 4LMYA 3ECOA 1HKTA 3V7SA 2DK8A 2ZMEB 3FXRA 3TKYA 1KQ0A 5D5XB 3E3VA 2HGCA 3REOA 3QOPA 2GXBA 3JAMK 2PI0A 4JK1X 2P6TA 3FF5A 2J5OA 1YIOA 3TO6A 5BQTA 1O3QA 2G7UA 4HZFA 1BJAA 1DDNA 4EVIA 2A69F 4D0PA 4KIFA 2C6YA 4MQVA 1P92A 4S05A 1XSXA 1IXCA 4I0AA 2OQGA 3QP6A 1HXDA 1XSVA 4P55A 5DCMA 3WTUC 2GWRA 5ED4A 2K02A 2OAZA 4L9JA 2LF8A 3H3ZA 4U88A 5BOXA 5L3CA 2RC4A 4IHTA 1I27A 4OIRF 4NQWA 4LD5A 4EM0B 4N0BA 2PG4A 2WTEA 4LGWA 2YR2A 2HKXA 4LG0A 3MAJA 1FT9A 1UHWA 3TOAA 4CO8A 4IHSA 3J81K 5ILUA 4LK1F 2E1NA 2JSCA 3OV8A 2H09A 1IRGA 1U3EM 1T0FA 1FBQA 1H9GA 3T0YA 3E6DA 2ADUA 1QZYA 2VC1A 2EB7A 4I09A 3DEUA 3ZMUA 3CLOA 2H6CA 3VB2A 4ENKA 4EGZA 2STWA 1B59A 4HV6A 1P4WA 3G3ZA 3L9FA 4GYIA 1R22A 1WQ2A 3LSTA 1FNNA 1WKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSE A;  5FGM A;  3O3K A;  3Q5F A;  2EFP A;  3CUQ A;  4WXC A;  2XHK A;  3WTZ A;  3GX4 X;  5CLS A;  1XGO A;  1F1Z A;  4HW0 A;  4KMF A;  4A6D A;  3V4G A;  3DPL C;  5HDG A;  4XLP F;  1FPQ A;  4RB1 A;  3ZPL A;  1QBJ A;  3GVA A;  5K5Q A;  5CVR A;  2DAO A;  2RDP A;  3CUO A;  3TO7 A;  3LFK A;  4EJU A;  4U7B A;  3FM5 A;  5LBQ A;  2NS0 A;  3R61 A;  3ZMD A;  4ZYE A;  2QQB A;  3MQ0 A;  4A0X A;  2XGX A;  1MJ9 A;  1OYI A;  5CVI A;  1YTY A;  1UHM A;  2VOO A;  2L3D A;  2HS5 A;  1ZRD A;  3DKW A;  1XB4 A;  2QBY B;  5H6R A;  1KYW A;  1YLF A;  3GYH X;  2FML A;  4AVP A;  5BMZ A;  3R0A A;  1VTN C;  3VEP A;  1IXR C;  3F8B A;  2EV5 A;  4AIJ A;  1QPM A;  3QPT A;  1W7P D;  4IJA A;  2E7X A;  1IN4 A;  2RVC A;  2EV0 A;  2EJR A;  5H6Q A;  3S2W A;  3DPT A;  2P8T A;  3LA7 A;  3HTS B;  3JSP A;  3RKY A;  3F8F A;  1J9I A;  1G4D A;  2FF4 A;  2PQ8 A;  2QUF A;  4BH9 A;  2UXN A;  3W6J B;  4KFC A;  3FHZ A;  1BI1 A;  1DP7 P;  4GYG A;  1LEB A;  1E2X A;  5EEH A;  3KFW X;  3M1E A;  2PMH A;  1G3W A;  5D6E A;  4GXO A;  4EM1 A;  2PJP A;  3KLO A;  3V8L A;  4KIG A;  1HSJ A;  3P9I A;  2ZO4 A;  4HDU A;  1YW7 A;  4AD9 A;  5K5O A;  3RPU A;  2ESH A;  3JTH A;  5LRR A;  4OMY A;  3BRO A;  3GLX A;  3HHH A;  2E1C A;  1OYY A;  4L0Z B;  1HQC A;  2RQP A;  2MLK A;  4MEX F;  3LWF A;  3QAH A;  2A6E F;  5ICG A;  2YX4 A;  3SFZ A;  2DFI A;  1Z7U A;  2Q2E A;  1HW1 A;  2L54 A;  3V8K A;  4ETS A;  2M45 A;  4CHU A;  2OU2 A;  5D4S A;  5LGT A;  2QQA A;  1A04 A;  2R7F A;  3BWG A;  1I1S A;  3QU6 A;  2XAG A;  3P9C A;  1O7F A;  5AIP A;  5DYM A;  4KYW A;  4GGG A;  1PP7 U;  2VC0 A;  2HQN A;  3KP6 A;  2XRN A;  2FOK A;  1NHA A;  2WV0 A;  1W4M A;  5F1R A;  3KP3 A;  2QWW A;  5FD6 A;  4WXH A;  1B9N A;  2Z99 A;  3K1N A;  3KP5 A;  1TNS A;  3DF8 A;  4ENM A;  2MLG A;  1FP2 A;  2A6H F;  2F5C A;  3KET A;  4RGU A;  2OA4 A;  2P4W A;  5DUK A;  2G9W A;  1MDM B;  5IT9 Z;  4KIC A;  2XKP A;  4AWX B;  1HST A;  4RAY A;  5E8G A;  3E5U A;  1Z91 A;  3M8E A;  3FX3 A;  1EH7 A;  3CTA A;  1HW5 A;  2ZXJ A;  2RGV A;  4K2E A;  1H9T A;  2GXG A;  4L9V A;  3N4M A;  2W85 A;  4PCQ A;  1JXS A;  1RUN A;  2OQR A;  4Y13 A;  3M7G A;  4QWQ A;  1MDM A;  5HOO A;  1ZRE A;  4WX9 A;  1BC7 C;  4I98 B;  1R1V A;  3Q9S A;  5LEJ A;  1J2X A;  4WWC A;  4DQ2 A;  1XGS A;  5ILS A;  1W5T A;  1PUE E;  1Z6R A;  4S04 A;  2V1X A;  2AXL A;  2DBB A;  4Q47 A;  4UVC A;  4A5N A;  1R7J A;  4M6Y A;  2IRF G;  1OR7 A;  4RB0 A;  4IPA A;  1FY7 A;  2BV6 A;  2Z5U A;  5LHG A;  3R4K A;  4HF0 A;  1REP C;  3LA2 A;  1OYW A;  1XSD A;  3SQN A;  1ZAO A;  4HDV A;  1ZRC A;  1P6R A;  1Q1H A;  2P7V B;  4ENJ A;  3K69 A;  3L2C A;  3F8N A;  3I5U A;  3MFK A;  1J59 A;  2A68 F;  3GWZ A;  3ULQ B;  2HDC A;  5L3F A;  1AWC A;  4A0Y A;  2ELH A;  5LGU A;  2DPU A;  1WI9 A;  3L00 A;  5JR3 A;  3FZV A;  1FOK A;  1XGN A;  2FQ3 A;  2UXX A;  5L3D A;  2XAQ A;  4U7D A;  4HLY A;  4KDP A;  1XCB A;  3J7A O;  4LK0 F;  1LQ1 A;  3LAP A;  3P7N A;  1JE8 A;  4KA4 A;  4ZYH A;  3VFZ A;  2V1U A;  2H94 A;  1ON2 A;  2OZU A;  2NRA C;  5HS7 A;  1S7O A;  2F5F A;  5CYV A;  5HS8 A;  3ZN0 A;  2JZY A;  1LVA A;  5CVU A;  1XDS A;  3E6C C;  3K2Z A;  5FFZ A;  2Y48 A;  4L5I A;  1PDN C;  3C7J A;  4R8H A;  4G8X A;  5A2Q K;  2HYF A;  5HLH A;  3H92 A;  4PGG A;  2FEZ A;  1K6O A;  1FP1 D;  4P9U A;  5JVT A;  5D6F A;  2HZT A;  2VBY A;  1EV7 A;  3HOS A;  3IKV A;  3WOD F;  3D5L A;  3WTW C;  2HKO A;  2ZJ2 A;  4HBL A;  4MNU A;  1O3S A;  5IT3 A;  1LDK B;  3WTS C;  1R5H A;  5FB2 A;  2HOE A;  2PBI A;  3RYP A;  2KRF A;  4UV9 A;  1PP8 F;  2ESN A;  3EET A;  4MHG A;  1D3Y A;  4BHP A;  3IHU A;  2FBI A;  5CJ9 A;  1Z1D A;  4TV7 A;  4M74 A;  5JHU A;  1T39 A;  1FYL A;  3E5Q A;  2X0L A;  2RV8 A;  1ZLJ A;  2Y0M A;  2GA2 A;  1XDU A;  4CIC A;  3RI4 A;  3WE3 A;  3ML6 A;  3RTR A;  4HV5 A;  3ZMV A;  4HF1 A;  4RGR A;  3PQK A;  5D5V B;  4UVB A;  4M9S A;  2QBY A;  1BIB A;  3DV8 A;  2MA3 A;  3M8F A;  3F23 A;  2VOD A;  3P9K A;  5LRS A;  2CSO A;  4YFX F;  3NEU A;  3I59 B;  1WRJ A;  3JTG A;  2IPQ X;  3I53 A;  3ZN1 A;  2LDU A;  3BJA A;  4ENN A;  4U0W A;  3WU0 A;  3WE2 A;  1IZ1 A;  3ZMT A;  3GO5 A;  1HKQ A;  3I0T A;  1E17 A;  2H27 A;  4MGR A;  2P5L C;  2DK5 A;  1IXS B;  3DXJ F;  1B9M A;  6PAX A;  2MBF A;  5LHI A;  2XAJ A;  3HRM A;  1W7P A;  4EMS A;  2UWM A;  4UXN A;  2FSW A;  5D5U B;  2XAF A;  3G73 A;  1LNW A;  1LB2 A;  3R60 A;  4M9Z A;  5HDK A;  4HLX A;  5JI6 A;  2VBW A;  5D4R A;  2W84 A;  1KQ8 A;  2W24 A;  3QRF F;  1L3L A;  3DFG A;  4O5V A;  4KN7 X;  2A07 F;  2BEO A;  1MD0 A;  4ON0 A;  4F7Z A;  2M30 A;  4U0V A;  4FX4 A;  4IRI A;  5BPD A;  2RN7 A;  1ZGJ A;  1R36 A;  1SMT A;  5D5W B;  5AON A;  2EFW A;  3BPV A;  3CUQ C;  1J75 A;  3I4P A;  1YW9 A;  2Q8K A;  1WSU A;  1ZGA A;  4UV8 A;  1QQI A;  3ABT A;  4YFN F;  1SFX A;  5E1Z B;  3ISP A;  2HFH A;  2F5D A;  1XCV A;  2VBX A;  1IRF A;  4OOI A;  1I1G A;  2FU4 A;  4LLN A;  1IAW A;  3F72 A;  1O7L A;  4M72 A;  5CVV A;  2LF7 A;  1LJ9 A;  4CXF A;  1IN7 A;  4XLN F;  4BXU A;  4EJT A;  3N97 A;  1WWX A;  1LDD A;  2QEN A;  5JFR A;  4I02 A;  3GFM A;  2F2E A;  1RUO A;  1SAX A;  2L4M A;  5DDG A;  3ABU A;  1QO0 D;  5CVJ A;  1FBU A;  2IJL A;  2GZW A;  5BPI A;  4FHT A;  2FBK A;  4BHB A;  5E17 F;  1KGS A;  4I7H A;  2KIU A;  2CYY A;  2KKO A;  2O0Y A;  1BOA A;  1H0M A;  1BI2 A;  4GO1 A;  3I64 A;  1SMY F;  3HRT A;  5ICE A;  3D0S A;  3KEQ A;  3ROU A;  2AS5 F;  2L4A A;  2ZNZ A;  3SZT A;  1S8N A;  1HKS A;  3I59 A;  4BHC A;  4UUV A;  4G6Q A;  5L3G A;  4Y15 A;  5LGN A;  2EA4 A;  1U2W A;  4OMZ A;  5FD5 A;  4O6J A;  2PN6 A;  1Z05 A;  4MTD A;  5KK1 A;  3CDH A;  3HUG A;  4L9T A;  4H0E A;  1U5T C;  3IWF A;  3JSO A;  1YG2 A;  2Z33 A;  2QYO A;  2JTV A;  1IN8 A;  1XN7 A;  2XUB A;  2DU9 A;  2FRH A;  4GCV A;  2A3S A;  3L09 A;  2A61 A;  2ISY A;  4KIB A;  5L3E A;  3C3W A;  2ZKZ A;  1QNT A;  1YS7 A;  5DCF A;  2O8X A;  2K7L A;  5BS6 A;  1G3T A;  1V4R A;  1ZLK A;  4RGX A;  3WGI A;  2EWN A;  5D8K B;  1O3R A;  1XGM A;  3E6M A;  2DT5 A;  2OD5 A;  3KP2 A;  1ZG5 A;  5E8I A;  1IN5 A;  3F22 A;  2BBY A;  5F6F A;  1DPR A;  3GFI A;  2GIV A;  3GF2 A;  2QLZ A;  3K0L A;  3KP7 A;  3EYI A;  2D1V A;  3CUQ B;  2JT1 A;  2P5V A;  3FMR A;  1U6G A;  4HX4 A;  3LAJ A;  4YG2 F;  4AIK A;  4OU0 A;  3KEO A;  2Z3Y A;  1CF7 A;  4MTE A;  4A6E A;  4UVA A;  1MKM A;  1TQI A;  4KMU X;  3K9T A;  3B73 A;  3HSR A;  3EUH A;  2EFQ A;  3HSF A;  1FZP B;  3DP7 A;  2QZ8 A;  4LB6 B;  2J5P A;  2FMY A;  2A5Y B;  4O3M A;  4Y17 A;  2VN2 A;  2P7C B;  2ZFW A;  2R7D A;  3EDP A;  1F9N A;  4CGZ A;  2EFO A;  2VBZ A;  1R23 A;  1KU2 A;  1JHH A;  5EEG A;  3WTY C;  1ZN2 A;  5LLQ A;  2LSO A;  1KYZ A;  1TQM A;  2P5K A;  1FSE A;  4KUM A;  2JRT A;  4JBA A;  4G94 A;  2IP2 A;  2FE3 A;  3AAF A;  1F5T A;  1TNT A;  2VON A;  3VOD A;  3IL2 A;  2KIM A;  2B0L A;  4FX0 A;  1U8R A;  4PZJ A;  4RAZ A;  5DD8 A;  1G6N A;  3QU3 A;  4I2O A;  3IRR A;  2CG4 A;  3B02 A;  2ACJ A;  5DUI A;  3GXO A;  2EK5 A;  2OZ6 A;  2XRO A;  4HYE A;  1K78 B;  3F6V A;  2FXA A;  4P5O A;  2STT A;  5J8F A;  5D8L B;  1ZG3 A;  1ZYR F;  2X4H A;  1W5S A;  2FNP A;  2GAU A;  4Q4Z F;  4WF2 A;  4M6X A;  1EH6 A;  1TTY A;  3O6B B;  4KN4 X;  3ERE D;  1T38 A;  2O3F A;  3U9G A;  2TDX A;  1ZH5 A;  2PLY A;  2YPR A;  4DNC A;  1YS6 A;  1D8K A;  1BC8 C;  4ZYG A;  2DQL A;  4L18 B;  1L0O C;  3ZMZ A;  4UNO A;  2WC2 A;  1UCR A;  2R3S A;  2ETH A;  2M1B A;  2KJC A;  1XD7 A;  4M73 A;  3U1D A;  5AIQ A;  3V8J A;  3IWZ A;  3FM3 A;  2D45 A;  3HOT A;  2V6C A;  1YW8 A;  2OBP A;  2H6B A;  2MD5 A;  2M8E A;  1ULY A;  3F8M A;  1U5T A;  3I71 A;  2EV6 A;  3RPQ A;  2CW0 F;  1B6A A;  2E7W A;  1DPU A;  1J0R A;  5ILV A;  3BJ6 A;  3WTT C;  2EFN A;  3E5X A;  3KZY A;  4OIO F;  1T6S A;  3O2P E;  3R6S A;  2V1D A;  1SD6 A;  3RJP A;  3PQJ A;  4IVN A;  3I58 A;  2DO7 A;  1FC3 A;  2ZME A;  3F21 A;  4B8X A;  5FLX Z;  2YU3 A;  2NNY A;  5HS9 A;  4QLC U;  1OKR A;  3GUD A;  1Z6T A;  4YIF A;  3HTU A;  1S29 A;  5K1Y A;  1X3U A;  1T2K A;  4ZZL A;  1BI0 A;  1TLH B;  3C1D A;  4HAM A;  1TQP A;  2HWV A;  2BYV E;  2HQR A;  5HDN A;  2DQR A;  3L7W A;  2V79 A;  2NYX A;  3KP4 A;  3I54 A;  4BAY A;  2LKP A;  2VE8 A;  3LQQ A;  4IRH A;  4G7Z F;  4U0Y A;  4E70 A;  2L01 A;  2NNN A;  3TDZ C;  2EA2 A;  3KE2 A;  2XAS A;  2NAZ A;  1G3S A;  5LHH A;  3BJO A;  4BYY A;  4N9I A;  4G7O F;  2XKO A;  2MC3 A;  1B4A A;  1UFM A;  1UST A;  4L5J A;  2O6G E;  3WTX C;  4A0Z A;  5FO5 A;  4I01 A;  3F8C A;  1CGP A;  2HR3 A;  4ZH4 F;  3RKX A;  4XSZ F;  1J5Y A;  1OPC A;  3FXU A;  2F5E A;  2QM3 A;  3QPH A;  3IRQ A;  3ZMS A;  2K86 A;  1I6X A;  2DI3 A;  3VOE A;  1SFU A;  1Y0U A;  2GQQ A;  4HX8 A;  2MH2 A;  4KT5 C;  3HHG A;  4XBF A;  5E18 F;  3ZQ7 A;  3KCC A;  1T98 A;  1I5Z A;  3COA C;  1R1U A;  4PDK A;  3ELK A;  4LLG F;  2QVO A;  2DPD A;  2PMU A;  1YYV A;  4P96 A;  4ESB A;  2VT2 A;  4HQE A;  2Q0O A;  4R79 A;  2HTJ A;  2YX7 A;  3ECH A;  1GXQ A;  5ICF A;  1MGT A;  4ESF A;  4EJV A;  4ASN A;  2VT3 A;  3RYR A;  3QP5 A;  1D5V A;  4HOB A;  4Q48 A;  4HQM A;  1TW3 A;  1FX7 A;  1BBY A;  4UHT A;  4IRG A;  1O3T A;  4G6D A;  2O03 A;  2HTS A;  3GFJ A;  1ODD A;  2CFX A;  3IKT A;  1J7K A;  5HLI A;  1FSH A;  1G3Y A;  4A12 A;  3RIR A;  4RGS A;  2BGC A;  2G7H A;  2UZK A;  1R00 A;  1TBX A;  2DLL A;  3GEZ A;  4LG0 B;  2O61 A;  2VXZ A;  4BQA A;  3GFL A;  1ZRF A;  2D1H A;  4NHJ A;  4CDG A;  3F3X A;  2DW4 A;  3H3U A;  4WK8 F;  5L3B A;  1O57 A;  2CO5 A;  4ESJ A;  3CO6 C;  5DCM B;  2PEX A;  2ZBK A;  4OIN F;  3T8R A;  3GZ6 A;  3KZZ A;  3BDD A;  4RB3 C;  2PFB A;  3EQL F;  5ERI A;  1BM9 A;  1RZ4 A;  2DTR A;  1S6L A;  5FLX K;  2YSR A;  1P4A A;  3BPX A;  5DD4 A;  4KNY A;  3FMS A;  4L0Y B;  3SXY A;  4WXD A;  5HVQ C;  1OMI A;  3CJN A;  3E6B A;  1KU3 A;  3BY6 A;  5H20 A;  1LDJ A;  2ZCW A;  1K79 A;  1JGS A;  3TO9 A;  3Q9V A;  5J8C A;  3ZP5 A;  5K5R A;  2FA5 A;  2WWY A;  3RKW A;  4Q5S F;  1MZB A;  4CZZ A;  4MQ9 F;  1U78 A;  4EV0 A;  1S3J A;  1YFH A;  4OIP F;  1SD5 A;  4IXA A;  4RS8 A;  2Y75 A;  5J6X A;  4I0B A;  2XIG A;  3PFI A;  2IW5 A;  3SHF A;  2KIF A;  3V7R A;  3C18 A;  3TGN A;  4EJW A;  4PGH A;  1QGP A;  3LQR A;  3WGH A;  1RI7 A;  1BIA A;  4IF4 A;  1FBS A;  2IVM A;  2XV4 S;  3HRS A;  4JQF A;  2P6S A;  1GXP A;  3SZP A;  3TQN A;  3J80 K;  1IF1 A;  1YO5 C;  4B09 A;  1S7A A;  1STZ A;  2CGP A;  1LEA A;  1XMK A;  3JAM Z;  4ZYD A;  3E97 A;  5DV5 A;  3K1P A;  2KJB A;  1ONV A;  3NRV A;  1FLI A;  3BOQ A;  4BNC A;  3T1B A;  4M9X A;  1C0W A;  5E1W A;  1UB9 A;  2W25 A;  1R58 A;  3JW4 A;  5E1X A;  1ZHF A;  3W6K B;  1AOY A;  4M71 A;  1USS A;  4A5M A;  1Z9C A;  5F64 A;  1MJA A;  3F6O A;  3U2R A;  3R0J A;  5TJJ A;  2QQ9 A;  1FWZ A;  2HEO A;  3LA3 A;  5IT9 K;  2LNB A;  4FT8 A;  3WTV C;  2W57 A;  1P2F A;  2Z9O A;  2K4J A;  5TRD A;  4NB5 A;  3WG9 A;  2VOP A;  1U5T B;  1HW2 A;  1IN6 A;  2RKH A;  1ZG1 A;  2BE5 F;  2RNJ A;  2IA2 A;  4R1H A;  1DUX C;  2FNA A;  1IUY A;  1IW7 F;  3GW2 A;  4CYD A;  2XVC A;  1SD4 A;  3HIF A;  3K1M A;  3TDU C;  4ZZD A;  5E20 A;  4G9Y A;  4N9H A;  5LEK A;  2XAH A;  2ISZ A;  2K27 A;  5ICC A;  2IT0 A;  3M9A A;  1K78 A;  1GHC A;  4HX7 A;  3FMQ A;  3GZ5 A;  2CWE A;  3V7C A;  3MZH A;  2M5W A;  5A2Q Z;  1JHF A;  3NQO A;  4L9N A;  3IC7 A;  4EJO A;  4LFU A;  1R5G A;  1F4K A;  1HBX G;  3EYY A;  3BP8 A;  4YII A;  4EM2 A;  4LLL A;  3MEX A;  4P9F A;  2VE9 A;  2L02 A;  1W7P B;  3J80 Z;  1RIO H;  1P4X A;  3T5X A;  3WU1 B;  3MCZ A;  4EQQ A;  1KU7 A;  3OOP A;  2D2W A;  1YQA A;  4AIH A;  2MH9 A;  1KU9 A;  4LB5 A;  1SFE A;  3FWE A;  1EH8 A;  1MJB A;  4Z2Y A;  1KQ9 A;  4HF2 A;  4A2U A;  4WCG A;  3RDI A;  2HYG D;  3TOB A;  1KA8 A;  3WGG A;  2IA1 A;  4YFK F;  1XMA A;  2JPC A;  5FFX A;  5KVR A;  2GA1 A;  3T8T A;  3CO7 C;  2JPB A;  1FYM A;  3DQV C;  5DEQ A;  1D8J A;  1K7A A;  4EGY A;  1B1B A;  4G7H F;  4HA8 A;  3HYI A;  2CQK A;  1RNL A;  1SD7 A;  1BN5 A;  2FBH A;  4XRF A;  1R1T A;  1CF7 B;  4LJZ F;  3J81 Z;  3HRU A;  4XSX F;  3MZY A;  2IA0 A;  1FYK A;  1GVJ A;  1BI3 A;  2ZNY A;  2K4B A;  3KLN A;  3BZ6 A;  4MEY F;  2V9V A;  2M87 A;  1QZZ A;  1TW2 A;  3MWM A;  2COM A;  4RB2 C;  4OIQ F;  1V3F A;  1ON1 A;  1ZAR A;  5HLG A;  3FXQ A;  4LMY A;  3ECO A;  1HKT A;  3V7S A;  2DK8 A;  2ZME B;  3FXR A;  3TKY A;  1KQ0 A;  5D5X B;  3E3V A;  2HGC A;  3REO A;  3QOP A;  2GXB A;  3JAM K;  2PI0 A;  4JK1 X;  2P6T A;  3FF5 A;  2J5O A;  1YIO A;  3TO6 A;  5BQT A;  1O3Q A;  2G7U A;  4HZF A;  1BJA A;  1DDN A;  4EVI A;  2A69 F;  4D0P A;  4KIF A;  2C6Y A;  4MQV A;  1P92 A;  4S05 A;  1XSX A;  1IXC A;  4I0A A;  2OQG A;  3QP6 A;  1HXD A;  1XSV A;  4P55 A;  5DCM A;  3WTU C;  2GWR A;  5ED4 A;  2K02 A;  2OAZ A;  4L9J A;  2LF8 A;  3H3Z A;  4U88 A;  5BOX A;  5L3C A;  2RC4 A;  4IHT A;  1I27 A;  4OIR F;  4NQW A;  4LD5 A;  4EM0 B;  4N0B A;  2PG4 A;  2WTE A;  4LGW A;  2YR2 A;  2HKX A;  4LG0 A;  3MAJ A;  1FT9 A;  1UHW A;  3TOA A;  4CO8 A;  4IHS A;  3J81 K;  5ILU A;  4LK1 F;  2E1N A;  2JSC A;  3OV8 A;  2H09 A;  1IRG A;  1U3E M;  1T0F A;  1FBQ A;  1H9G A;  3T0Y A;  3E6D A;  2ADU A;  1QZY A;  2VC1 A;  2EB7 A;  4I09 A;  3DEU A;  3ZMU A;  3CLO A;  2H6C A;  3VB2 A;  4ENK A;  4EGZ A;  2STW A;  1B59 A;  4HV6 A;  1P4W A;  3G3Z A;  3L9F A;  4GYI A;  1R22 A;  1WQ2 A;  3LST A;  1FNN A;  1WKM A; 
#chains in the Genus database with same CATH topology
 3HSE A;  3GTK J;  5FGM A;  2R7W A;  2ME0 A;  3O3K A;  3Q5F A;  2EFP A;  4RAG A;  2ZXH A;  4DW6 A;  5EEA A;  2VAS A;  3S3N A;  5IOY A;  3CUQ A;  4WXC A;  2XHK A;  3WTZ A;  3GX4 X;  5CLS A;  1XGO A;  4F55 A;  1F1Z A;  2NXN B;  3V42 A;  4HW0 A;  4N4N B;  2HPM A;  4KMF A;  3RZO J;  4A6D A;  1UMQ A;  1ZR2 A;  2WBM A;  3V4G A;  2E5Z A;  3DPL C;  4FQG A;  1R71 A;  5HDG A;  4XON A;  4XLP F;  1Y8Q B;  2M7B A;  1FPQ A;  4RB1 A;  2BY2 A;  3ZPL A;  1QBJ A;  3GVA A;  5K5Q A;  5CVR A;  2DAO A;  2RDP A;  1DQU A;  3PIP F;  3CUO A;  3TO7 A;  3LFK A;  4EJU A;  2E35 A;  4U7B A;  3FM5 A;  5LBQ A;  2X51 A;  2M4G A;  2NS0 A;  2M0C A;  3R61 A;  4E7K A;  4X0G A;  4P1W A;  3ZMD A;  4ZYE A;  1B72 B;  2QQB A;  3MQ0 A;  4A0X A;  2XGX A;  2X1D A;  3U1K A;  2Y9Z A;  1MJ9 A;  2DMU A;  1OYI A;  4KT6 A;  5CVI A;  3CJT B;  1YTY A;  1UHM A;  2VOO A;  4NC8 A;  2K3P A;  2L3D A;  2HS5 A;  1ZRD A;  1M1E B;  4C30 A;  1MNE A;  1W5C C;  3A03 A;  3DKW A;  4B3A A;  4PJM A;  4XKB A;  3K70 D;  1XB4 A;  2QBY B;  4PK4 A;  1MW7 A;  5H6R A;  3BQZ A;  1KYW A;  4D7N A;  1YLF A;  1QRY A;  3GYH X;  4U87 A;  2FML A;  4AVP A;  5BMZ A;  2R0Q C;  3R0A A;  4XID A;  1VTN C;  3VEP A;  1IXR C;  3F8B A;  4BL0 B;  2DA2 A;  2BXY A;  2EV5 A;  3PUB A;  4AIJ A;  2ECB A;  3K4L A;  4J01 A;  1Y1V J;  1QPM A;  3ZQG A;  5J1U A;  3QPT A;  5FKK A;  1S72 I;  1S5L C;  1W7P D;  4E7L A;  4IJA A;  2DT6 A;  2E7X A;  2WAD A;  1IN4 A;  4Y33 A;  2RVC A;  1MBJ A;  2EV0 A;  3CMA I;  4PJ0 C;  5C44 J;  2EJR A;  5H6Q A;  3S2W A;  3DPT A;  3QPS A;  2K5C A;  2LRE A;  4A69 C;  2P8T A;  3H3V K;  3LA7 A;  3ESW B;  2GIZ A;  3FDY A;  3RKY A;  3F8F A;  3JSP A;  3HTS B;  1J9I A;  1G4D A;  3FKI J;  2FF4 A;  2PQ8 A;  2QUF A;  1TWH J;  4BH9 A;  2UXN A;  1VQL I;  3W6J B;  4KFC A;  3FHZ A;  1BI1 A;  1DP7 P;  2ZXW H;  4GYG A;  1LEB A;  1E2X A;  5EEH A;  3KFW X;  1MMG A;  2PMH A;  1G3W A;  3M1E A;  5D6E A;  4XOT A;  4GRI A;  4GXO A;  2A6T A;  4D5F A;  4EM1 A;  5C3E J;  4D1Q A;  1K4T A;  3HB9 A;  2PJP A;  3KLO A;  3G2B A;  3V8L A;  4V2F A;  4KIG A;  1EJ9 A;  1HSJ A;  4BY7 J;  1VZ0 A;  3P9I A;  5F0F A;  1ETV A;  2ZO4 A;  3S2D J;  4HDU A;  4CSW A;  2W4S A;  1YW7 A;  4AD9 A;  3DCF A;  5K5O A;  3RPU A;  2ESH A;  3OYG A;  3JCU C;  2ZFU A;  3JTH A;  5LRR A;  5FRM A;  4OMY A;  3W2A A;  3GLL A;  4Y4R A;  1I3Q J;  3BRO A;  3DLA A;  1QVT A;  3GLX A;  3PL8 A;  3HHH A;  1ETK A;  1OYY A;  2V9K A;  3IH2 A;  2LRD A;  2TRT A;  1PUF A;  2E1C A;  4L0Z B;  1HQC A;  2RQP A;  4ZC3 A;  2MLK A;  4MEX F;  4F52 A;  3H9G A;  3OIO A;  3LWF A;  3QAH A;  2HDW A;  4B47 A;  1TT5 B;  2CJJ A;  4BDZ A;  2AQE A;  2Z1D A;  2A6E F;  5ICG A;  2R92 J;  2YX4 A;  1TP4 A;  2H8W A;  2DOA A;  2JJ7 A;  3SYT A;  3S3M A;  3SFZ A;  3OR2 C;  3BR2 A;  2DFI A;  1YX5 A;  1Z7U A;  2Q2E A;  2EZL A;  3DU6 A;  4M3F A;  1HW1 A;  2L54 A;  3V8K A;  4ETS A;  2M45 A;  1CQT A;  2OTL I;  4CHU A;  2OU2 A;  3RQI A;  2R5Z A;  5D4S A;  2JA7 J;  2CUE A;  3K4J A;  3CJQ B;  3G1M A;  5LGT A;  4CA0 A;  2QQA A;  1A04 A;  2R7F A;  3BWG A;  1I1S A;  3QU6 A;  2XAG A;  3P9C A;  1O7F A;  5F0H A;  3H9J A;  5AIP A;  5HOD A;  4XRS A;  1VQK I;  2DA7 A;  4PUS A;  5DYM A;  4KYW A;  1IG7 A;  2CS3 A;  4Y52 J;  2CRG A;  4BXF A;  4GGG A;  1PP7 U;  2VC0 A;  4DZJ A;  1FOW A;  2HQN A;  2W00 A;  3KP6 A;  2XRN A;  2FOK A;  3OYN A;  2QSH X;  1NHA A;  2WV0 A;  1W4M A;  3SJM A;  5F1R A;  4KIT B;  2DA4 A;  3KP3 A;  2QWW A;  5FD6 A;  4WXH A;  1B9N A;  3FXO A;  2R5Y B;  2Z99 A;  3BCA A;  3DBH B;  3K1N A;  3KP5 A;  4IQ4 A;  1TNS A;  3DF8 A;  3OYC A;  1IJW C;  2VKV A;  4ENM A;  2MLG A;  1FP2 A;  2HOT A;  2A6H F;  2AXT C;  3MZ8 A;  2NVQ J;  5HNH A;  1MBF A;  2YS9 A;  1U9N A;  4PJJ A;  2F5C A;  3JRA A;  3CDL A;  2XSJ C;  1YJN I;  3KET A;  4RGU A;  2OA4 A;  2P4W A;  5DUK A;  3BG7 A;  4C9Y A;  1X2M A;  2XRL A;  3OOU A;  1Z21 A;  3IH3 A;  3S1Q J;  2G9W A;  1MDM B;  5IT9 Z;  1VND A;  4KIC A;  1LPQ A;  3H35 A;  2XKP A;  3CMM A;  1HST A;  4AWX B;  4RAY A;  1ERD A;  5E8G A;  1DGW Y;  3DLL F;  1YHQ I;  3E5U A;  1Z91 A;  4ZJZ A;  3HGY A;  3M8E A;  3FX3 A;  4CCK A;  1EH7 A;  3JRB A;  5M3F J;  2Y9Y A;  1HW5 A;  3CTA A;  1XMX A;  2KPM A;  2ZXJ A;  5GAG J;  2RGV A;  1HCR A;  4K2E A;  2LH9 A;  2WB1 N;  2F5V A;  2MYS A;  1H9T A;  3OYL A;  2EQR A;  2PJR B;  2OV7 A;  3P5J A;  4XNF A;  2GXG A;  4L9V A;  2LLK A;  3GTQ J;  3PIO F;  3N4M A;  5K7H A;  2W85 A;  2IS1 A;  4PCQ A;  4XOP A;  1ETO A;  4FIS A;  1FJL A;  4C2T A;  1RUN A;  1JXS A;  4JOM A;  2OQR A;  4Y13 A;  3M7G A;  4QWQ A;  1MDM A;  5HOO A;  1ZRE A;  1SC7 A;  4WX9 A;  4HSR A;  2JN6 A;  2Y69 H;  4I98 B;  1BC7 C;  2O8K A;  1R1V A;  3Q9S A;  5LEJ A;  1BL0 A;  1J2X A;  3HM5 A;  4WWC A;  2RAE A;  1T33 A;  1VQ4 I;  1AKH A;  3OIQ A;  3K4C A;  2BW3 B;  2B7E A;  2AQF A;  2GM4 A;  4BEH A;  4DQ2 A;  1XGS A;  1Z7L A;  5F08 A;  5ILS A;  1W5T A;  3ABK H;  1RR8 C;  2L0K A;  1PUE E;  1WZ2 A;  5HNF A;  2CMP A;  1Z6R A;  2ZJP F;  2KRC A;  4S04 A;  1HDP A;  1GDT A;  1ZEL A;  2V1X A;  2AXL A;  2LY9 A;  2JA6 J;  1XPX A;  2DBB A;  4Q47 A;  1BR1 A;  4UVC A;  2OF7 A;  4A5N A;  3PO3 J;  3WHC A;  1R7J A;  4M6Y A;  3HL2 A;  2IRF G;  1OR7 A;  2KQR A;  2LR8 A;  3GTJ J;  3HOW J;  4RB0 A;  4IPA A;  3U21 A;  1FY7 A;  3PSF A;  2BV6 A;  2ME6 A;  1YIJ I;  1Y1W J;  2Z5U A;  5LHG A;  3R4K A;  4NC6 A;  5EF6 A;  4HF0 A;  2JK3 A;  3LSR A;  1REP C;  1LE8 B;  3LA2 A;  2K9S A;  1OYW A;  1XSD A;  3HKZ A;  4EEF G;  4LG3 A;  1I50 J;  1T0F C;  3SQN A;  1ZAO A;  4HDV A;  1ZRC A;  1P6R A;  3CD6 I;  5JLX A;  1KON A;  2E2J J;  1Q1H A;  2P7V B;  4ENJ A;  2AHQ A;  5DM7 F;  2CW7 A;  3CF2 A;  3K69 A;  2X48 A;  3L2C A;  3F8N A;  1MIJ A;  1Y56 A;  3I5U A;  3MFK A;  2DA1 A;  2DDB A;  1J59 A;  2A68 F;  3GWZ A;  3ULQ B;  5L3F A;  1AWC A;  1YRN B;  2HDC A;  4A0Y A;  5J3L A;  2ELH A;  4A93 J;  2NS8 A;  5GAD J;  2V4J C;  5LGU A;  1WI9 A;  3L00 A;  5JR3 A;  4XLE A;  2DPU A;  3HEF A;  3FZV A;  1MBK A;  1HA8 A;  1HOM A;  1FOK A;  2DMN A;  5EZH A;  4BXX J;  2XPV A;  1XGN A;  2FQ3 A;  2UXX A;  1ETX A;  1OJL A;  5L3D A;  5IPA A;  3H0D A;  1AHD P;  2XAQ A;  4U7D A;  2XF7 A;  1DU6 A;  4HLY A;  4II2 A;  2ZC2 A;  3L1P A;  4KDP A;  1XCB A;  3J7A O;  4BDY A;  1BJZ A;  5IYD J;  4LK0 F;  1NH3 A;  1LQ1 A;  3S3O A;  3ZQF A;  3LAP A;  3P7N A;  3RSN A;  1JE8 A;  1IC8 A;  2X85 A;  4MIM A;  1MMS A;  2XGD A;  4S0H B;  4KA4 A;  4ZYH A;  3VFZ A;  4XIC A;  2V1U A;  1PVE A;  2H94 A;  1ON2 A;  2OZU A;  1S7O A;  5HS7 A;  2F5F A;  2NRA C;  5CYV A;  3K4K A;  5HS8 A;  1RR7 A;  3ZN0 A;  4A3J J;  1SFK A;  3S1R J;  2JZY A;  1LVA A;  5CVU A;  1WJA A;  1SVL A;  3OYD A;  2KDO A;  3AG2 H;  2IAI A;  1XDS A;  3S8P A;  1F36 A;  2O5R A;  3G6E I;  3E6C C;  5M5W J;  3K2Z A;  5FFZ A;  2Y48 A;  4L5I A;  2M3A A;  1WGX A;  1PDN C;  3HZJ A;  3QOD A;  2DN0 A;  2IEK A;  3C7J A;  4DYR A;  4R8H A;  4AVZ A;  2GXA A;  4G8X A;  5A2Q K;  2HYF A;  5HLH A;  2L5Q A;  3C2B A;  3HC7 A;  3H92 A;  5HLT A;  4PGG A;  3HPH A;  1TL8 A;  2FEZ A;  1FP1 D;  1K6O A;  2KLO A;  3Q0U A;  3L2W A;  4P9U A;  3EPZ A;  5JVT A;  5D6F A;  2HZT A;  2VBY A;  4BKX A;  2X9D A;  2CQN A;  3IAS 2;  2P81 A;  2VKD A;  1EV7 A;  3HOS A;  2G0E A;  3BR3 A;  3IKV A;  3WOD F;  4M6V A;  3D5L A;  2GOM A;  3WTW C;  2HKO A;  2ZJ2 A;  3S93 A;  5IYC J;  3M07 A;  4HBL A;  4MNU A;  1O3S A;  1A35 A;  2VLA A;  5IT3 A;  1LDK B;  2IS2 A;  1R49 A;  3WTS C;  1R5H A;  2L9S A;  5FB2 A;  4XRS G;  2HOE A;  1JJ8 C;  2X6Y A;  2PBI A;  5IY5 H;  3NAR A;  3RYP A;  2KRF A;  1IUF A;  2COB A;  4UV9 A;  1PP8 F;  1BR2 A;  1WCM J;  2ESN A;  4DYQ A;  3HOY J;  3EET A;  3S32 A;  4XKW A;  5E79 C;  2E5N A;  4MHG A;  1D3Y A;  4BHP A;  3IHU A;  2FBI A;  3TP0 A;  2JUC A;  1SVO A;  5CJ9 A;  1Z1D A;  4TV7 A;  2WB1 A;  4CZC A;  4J19 A;  4M74 A;  5JHU A;  1T39 A;  1P9Q C;  1FYL A;  3Q3S A;  2OTJ I;  3E5Q A;  2X0L A;  2RV8 A;  1WJB A;  1ZLJ A;  1X1D A;  4LIU A;  2EZK A;  5E3L A;  2Y0M A;  2GA2 A;  1XDU A;  4CIC A;  3RI4 A;  1W0T A;  3WE3 A;  3ML6 A;  3RTR A;  1D1C A;  4HV5 A;  4MFD A;  3ZMV A;  4HF1 A;  3KYD B;  4RGR A;  3PQK A;  1YJ9 I;  3D1N I;  3LOC A;  5D5V B;  4UVB A;  5EG0 A;  4M9S A;  2QBY A;  1BIB A;  3DV8 A;  2MA3 A;  3M8F A;  3K4B A;  3D5S C;  3F23 A;  5GPA A;  1IDZ A;  2VOD A;  4XKV A;  2F4O B;  5M5X J;  3P9K A;  5LRS A;  2CSO A;  4YFX F;  2FD5 A;  3NEU A;  3I59 B;  3AL0 C;  1WRJ A;  2LK2 A;  2XF6 A;  2L7K A;  3JTG A;  2IPQ X;  5FKL A;  1RES A;  3I53 A;  3ZN1 A;  2LDU A;  4DZP A;  1D0Y A;  1QU3 A;  2VJ5 A;  3BJA A;  4AID A;  4ENN A;  4U0W A;  3KYL A;  3WU0 A;  4XL9 A;  3WE2 A;  1IZ1 A;  3ZMT A;  3GO5 A;  1HKQ A;  3I0T A;  1E17 A;  3BTJ A;  4MFE A;  4CCO A;  5EGO B;  2H27 A;  1IDY A;  1UAA A;  4X6A J;  4MGR A;  2P5L C;  3FBI B;  2DK5 A;  1IXS B;  3S2H J;  1BW6 A;  3DXJ F;  1B9M A;  5EG0 B;  3L2Q A;  3UKG A;  1OQY A;  6PAX A;  2MBF A;  1TC3 C;  1VQ5 I;  5J4V A;  5LHI A;  2XAJ A;  4XQF A;  3VPR A;  4PJN A;  3CZ6 A;  3I55 I;  1RKW A;  3JRH A;  3HRM A;  4XR6 A;  1MNM C;  3AL0 B;  3DEE A;  2L9V A;  1W7P A;  4BQN A;  4EMS A;  4IHW A;  3M1C A;  3I4N J;  2UWM A;  4UXN A;  1S9H A;  2FSW A;  5D5U B;  2XAF A;  3G73 A;  1LNW A;  1LB2 A;  3R60 A;  4XMY A;  4M9Z A;  3G4S I;  4PFP A;  5HDK A;  2R7X A;  5FRO A;  3CME I;  5CPR B;  5EJC A;  4HLX A;  5JI6 A;  2VBW A;  5D4R A;  3RZD J;  1SFO J;  2W84 A;  1KQ8 A;  2BVL A;  2W24 A;  3QRF F;  1L3L A;  3DFG A;  4O5V A;  4KN7 X;  2A07 F;  2LOO A;  4IHV A;  3RQ4 A;  2BEO A;  2E34 A;  1MD0 A;  4ON0 A;  4F7Z A;  2M30 A;  4U0V A;  4FX4 A;  4IRI A;  5BPD A;  2RN7 A;  1ZGJ A;  4JP0 A;  4IQJ A;  1R36 A;  3WHB A;  1SMT A;  5D5W B;  1ZGW A;  5AON A;  4J00 A;  2DTZ A;  3HGG A;  2EFW A;  2KZG A;  3BPV A;  3CUQ C;  2I5U A;  1J75 A;  3I4P A;  1YW9 A;  2VI6 A;  4A3B J;  3FBN B;  3PO2 J;  2Q8K A;  3DTK A;  1WSU A;  1ZGA A;  4UV8 A;  1H88 C;  1QQI A;  3ABT A;  4YFN F;  2Y2Z A;  1H89 C;  2H8R A;  1SFX A;  5E1Z B;  3ISP A;  2LKX A;  2HFH A;  2F5D A;  1XCV A;  3GCM A;  4CYC B;  2HXO A;  3ONQ A;  3B6C A;  2R7S A;  2VBX A;  5K7Z A;  1IRF A;  1I3A A;  2A05 A;  4OOI A;  4RM3 A;  2CQQ A;  2QCO A;  1JT6 A;  1I1G A;  2FU4 A;  2HQ5 A;  3AG4 H;  4LLN A;  4B48 A;  1IAW A;  1R4M B;  3F72 A;  2H1L A;  2TCT A;  2XAU A;  1O7L A;  2Z16 A;  4QPQ A;  4ZDP A;  4M72 A;  3OYI A;  2IS4 A;  5CVV A;  2LF7 A;  3CP2 A;  1LJ9 A;  4CXF A;  2L7M P;  1IN7 A;  1N78 A;  3FXL A;  4XLN F;  4BXU A;  3MKY B;  3CC4 I;  2WAE A;  3ABL H;  4A3F J;  4F3Q A;  1A36 A;  4EJT A;  4HEA 2;  3N97 A;  1WWX A;  5F04 A;  2LKS A;  1LDD A;  2QEN A;  4JX5 A;  5JFR A;  3LNQ A;  4I02 A;  3GFM A;  4A3K J;  2F2E A;  3LSJ A;  1RPW A;  1RUO A;  1JUP A;  1SAX A;  2GOX B;  1XC5 A;  5C4J J;  3ZRG A;  2L4M A;  3BCB A;  5DDG A;  4F92 B;  3ABU A;  1BR4 A;  4MO7 A;  4B4C A;  2JMW A;  1QO0 D;  1IRX A;  5CVJ A;  2JQ7 A;  1FBU A;  2IJL A;  3A0B C;  3OYB A;  2GZW A;  5BPI A;  4FHT A;  2FBK A;  4KJZ A;  4BHB A;  3DPU A;  1BW5 A;  1VI0 A;  3BTL A;  2KL4 A;  2JRM A;  5E17 F;  1KGS A;  3F0C A;  3K4M A;  2DFH A;  4I7H A;  2KIU A;  1XX5 A;  2CYY A;  2KKO A;  3VYS B;  2O0Y A;  1BOA A;  3HUG B;  1JKR C;  2OCC H;  1H0M A;  4NDL A;  1BI2 A;  4GO1 A;  3I64 A;  1SMY F;  1X4O A;  4DGW B;  2L2O A;  3HRT A;  3GME A;  3D0S A;  5ICE A;  3KEQ A;  3HOV J;  1X4P A;  1WH5 A;  3ROU A;  2AS5 F;  2L4A A;  2ZNZ A;  3SZT A;  1S8N A;  2VQH A;  1HKS A;  3I59 A;  5CKT A;  4BHC A;  4UUV A;  2ICW G;  4G6Q A;  5L3G A;  2BY3 A;  4Y15 A;  5LGN A;  2EA4 A;  2R7Q A;  2QSF X;  1U2W A;  4OMZ A;  5FD5 A;  4O6J A;  3IUO A;  1UJ8 A;  1WJ5 A;  2PN6 A;  3N05 A;  1Z05 A;  4MTD A;  5KK1 A;  4E7J A;  2ID3 A;  3CDH A;  4IKF A;  2VQL A;  1YRN A;  4UY8 I;  3HUG A;  3K70 C;  4L9T A;  3S17 J;  4H0E A;  1U5T C;  3IWF A;  3JSO A;  1YG2 A;  1A6Q A;  2LTP A;  2Z33 A;  2YU9 J;  2QKM B;  5J4Y A;  5E3M A;  3OR1 C;  1V5F A;  4AU7 A;  4NQW B;  2R7O A;  3MKZ A;  2ZSH B;  2QYO A;  4G6T B;  1V5G A;  4BAC A;  1X19 A;  3H0G J;  2JTV A;  1IN8 A;  1XN7 A;  2D5V A;  2XUB A;  3K10 A;  2DU9 A;  2VL8 A;  2FRH A;  4GCV A;  4C3J J;  2A3S A;  3L09 A;  2A61 A;  2ISY A;  4E7S A;  1R5I D;  3CMY A;  2VKH A;  1LUJ B;  4KIB A;  5L3E A;  3C3W A;  2ZKZ A;  1QNT A;  1YS7 A;  5DCF A;  2WA0 A;  2O8X A;  2K7L A;  5BS6 A;  1G3T A;  1ZKG A;  2DOE A;  1V4R A;  3OIP A;  5IP7 J;  4DYC A;  1ZLK A;  1B8I A;  4RGX A;  2K85 A;  3WGI A;  2EWN A;  5D8K B;  2B9S A;  3QQA A;  1O3R A;  4FE7 A;  1XGM A;  1AA7 A;  3E6M A;  2DT5 A;  1EKE A;  2VUM J;  2OD5 A;  1VQM I;  2DFF A;  4RAF A;  3KP2 A;  1Q1V A;  1ZG5 A;  2IGK A;  2DFE A;  5E8I A;  3OYH A;  1IN5 A;  1QA6 A;  1FIA A;  2JVH A;  3F22 A;  1JKQ C;  2BBY A;  5F6F A;  5M5Y J;  3J7Z I;  3H36 A;  1JKO C;  4D7M A;  1IO2 A;  3GTM J;  1DPR A;  4C2U A;  3GFI A;  2BHZ A;  3KEY A;  4BJT A;  2GIV A;  5FKO A;  3GF2 A;  3GZN B;  2QLZ A;  3K0L A;  1MH4 A;  3KP7 A;  3EYI A;  1NK3 P;  2K9L A;  2D1V A;  4HNT A;  1QHH D;  3LL7 A;  5CQG A;  3DWL E;  3CUQ B;  2CUF A;  2JT1 A;  2P5V A;  3FMR A;  1U6G A;  1MND A;  4HX4 A;  4ZDO A;  3HOX J;  3LAJ A;  3PFY A;  4YG2 F;  4C2M J;  4AIK A;  4XN3 A;  4IHX A;  4A3G J;  4OU0 A;  3KEO A;  3H5N A;  2L7Z A;  2Z3Y A;  2CH0 A;  1OCR H;  2VB6 A;  1CF7 A;  2OC6 A;  4MTE A;  3FXM A;  4A6E A;  2QSG X;  4UVA A;  1MKM A;  3AFH A;  3ZQI A;  1TQI A;  4XK4 A;  4KMU X;  4B1R A;  3W2V A;  1GVD A;  3CCR I;  2E1M B;  1N77 A;  4GFB A;  3K9T A;  4XLF A;  1YJW I;  1GV2 A;  3BR0 A;  3B73 A;  3ZCO A;  1JJ6 C;  1G8X A;  3HSR A;  2BHY A;  5EYR A;  3DEW A;  2R93 J;  3EUH A;  2EFQ A;  3HSF A;  1FZP B;  3DP7 A;  2LD5 A;  2LBF A;  2QZ8 A;  4M3G A;  4LB6 B;  4B3X A;  2J5P A;  4BBR J;  5EDN A;  2RNG A;  2FMY A;  2A5Y B;  4O3M A;  1D0Z A;  4Y17 A;  2VN2 A;  4IL6 C;  2P7C B;  3FK6 A;  2ZFW A;  2R7D A;  3EDP A;  1FTT A;  3IV5 A;  3H1C A;  1F9N A;  2EFO A;  4CGZ A;  2MFZ A;  2VBZ A;  3HBL A;  1R23 A;  1KU2 A;  1JHH A;  1WVR A;  5EEG A;  2O7O A;  3WTY C;  3K4N A;  1ZN2 A;  1Z67 A;  3FIS A;  1VQ7 I;  4JX4 A;  5LLQ A;  2LSO A;  1KYZ A;  1TQM A;  3A01 A;  2P5K A;  1FSE A;  3QYE A;  4KUM A;  1EF4 A;  3BZC A;  2JRT A;  3TBI A;  1HLV A;  1Z77 A;  4JBA A;  4G94 A;  3UR3 C;  1R9T J;  2IP2 A;  4E7Z A;  1UG0 A;  2FE3 A;  1OCZ H;  3AAF A;  2DJN A;  1F5T A;  1TNT A;  2VON A;  3VOD A;  2VIX A;  4PFO A;  3IL2 A;  2KIM A;  2B0L A;  4FX0 A;  1U8R A;  4PZJ A;  4FET A;  5JVG F;  4RAZ A;  3OL3 A;  1JGG A;  4BE0 A;  3OYE A;  5DD8 A;  3BG5 A;  5B3S H;  2Y0S A;  1G6N A;  4QSH A;  3M4O J;  2WAQ A;  2M8G X;  4E7I A;  3QU3 A;  4I2O A;  3E0J B;  3IRR A;  2CG4 A;  1V55 H;  3B02 A;  3FK7 A;  3JRG A;  4W97 A;  2ACJ A;  3W6V A;  2LMD A;  5DUI A;  2E1M C;  3GXO A;  4CCL A;  3Q0V A;  4F93 B;  2K3F A;  2EK5 A;  2LY2 A;  1V5E A;  2OZ6 A;  2XRO A;  2R7R A;  1YOV B;  4BBS J;  2GBY A;  2HOA A;  2HYJ A;  4HYE A;  1K78 B;  3F6V A;  2FXA A;  4P5O A;  3O8H A;  2STT A;  2XDV A;  5D8L B;  4B44 A;  5J8F A;  1UHS A;  1ZG3 A;  2HOS A;  2QQ8 A;  1ZYR F;  2X4H A;  1JUM A;  1W5S A;  2X6W A;  3S15 J;  2FNP A;  1E3H A;  5BNG A;  2GAU A;  4Q4Z F;  3PNY A;  4WF2 A;  4M6X A;  3MD2 A;  1VFC A;  1EH6 A;  2MD0 A;  1TTY A;  3O6B B;  4RDU A;  2NVX J;  3HG9 A;  4KN4 X;  3JRE A;  3PNT A;  3ERE D;  1T38 A;  2O3F A;  3U9G A;  2KIS A;  2TDX A;  1LVK A;  4DJA A;  1ZH5 A;  2OUM A;  2PLY A;  2YPR A;  4DNC A;  4Y7N J;  2UUZ A;  1APL C;  3RCO A;  1YS6 A;  3QPL A;  1IRZ A;  2E19 A;  3OSG A;  1D0X A;  1D8K A;  2ELJ A;  4XKC A;  4YEL A;  4B43 A;  1BC8 C;  4ZYG A;  4IZZ A;  2O9L A;  4CYC A;  2DQL A;  4L18 B;  1VQ6 I;  1L0O C;  3A0H C;  5FJ8 J;  3ZMZ A;  4UNO A;  4HNU A;  1PUF B;  2CV2 A;  3BG3 A;  2WC2 A;  2E1O A;  1UCR A;  2R3S A;  3I56 I;  2V7F A;  2N8G A;  4A3D J;  3BZK A;  2ETH A;  2XGE A;  2M1B A;  2KJC A;  3CCL I;  4DOZ A;  1XD7 A;  3ABM H;  4M73 A;  3U1D A;  3DKX A;  5AIQ A;  3TW7 A;  4CUG A;  3V8J A;  4C3I J;  2Q2E B;  5FKM A;  5LFA A;  4AYB A;  2HNH A;  1W0U A;  3IWZ A;  3LMM A;  3CP8 A;  3ASO H;  2IS6 A;  3FM3 A;  4C3H J;  2D45 A;  4E4H A;  5TIS C;  2F4I A;  3HOT A;  1PYV A;  3GBG A;  2V6C A;  3K6G A;  1K61 A;  3M8J A;  5J47 A;  1YW8 A;  1MMA A;  3FHN A;  2CFO A;  3C2H A;  2OBP A;  2F4M B;  2H6B A;  2MD5 A;  3JRC A;  4HRI A;  1MBG A;  2M8E A;  2M2E A;  1ULY A;  3F8M A;  4RA2 A;  4XOR A;  1U5T A;  2NVT J;  3I71 A;  2ZJQ F;  2EV6 A;  3NAU A;  5GTI C;  3RPQ A;  2CW0 F;  1B6A A;  2DMQ A;  1Z3X A;  5K7F A;  2E7W A;  1DPU A;  1J0R A;  1DGR M;  5ILV A;  3BJ6 A;  4XLH A;  3WTT C;  4L5E A;  1W36 D;  2EFN A;  3OYM A;  2JA8 J;  3E5X A;  1D1A A;  3KZY A;  3RKQ A;  2DOF A;  3A02 A;  4OIO F;  2KT0 A;  1T6S A;  3BG9 A;  3O2P E;  2ZJR F;  2CV0 A;  2KP6 A;  1QVU A;  1HDD C;  3R6S A;  3OYJ A;  2V1D A;  1U8B A;  1SD6 A;  1JT0 A;  3RJP A;  3PQJ A;  4IVN A;  2E36 A;  3I58 A;  1NK2 P;  2DO7 A;  1FC3 A;  2ZME A;  5IYB J;  3F21 A;  4CH7 A;  2DA6 A;  4UUT A;  4AC0 A;  4B8X A;  2E2I J;  3B6A A;  2VJJ A;  5KCM A;  5FLX Z;  2YU3 A;  9ANT A;  3DBL B;  1FMW A;  5DTD A;  4A3I J;  4UUS A;  2EIN H;  2NNY A;  5HS9 A;  4OAY A;  4QLC U;  1OKR A;  1WH7 A;  1GV5 A;  1Y6I A;  1Y39 A;  3GUD A;  1Z6T A;  1IV8 A;  3SEQ A;  4YIF A;  4ZDL A;  3HTU A;  1S29 A;  2M4K A;  2XGC A;  5IP6 A;  5K1Y A;  1Z3Y A;  1JTX A;  1X3U A;  1T2K A;  1UEL B;  4ZZL A;  1BI0 A;  1TLH B;  2VJ4 A;  1A5J A;  1OLT A;  3ZQL A;  3C1D A;  2MSY A;  4HAM A;  1TQP A;  1V54 H;  2HWV A;  2CU7 A;  3IP4 B;  2BYV E;  2HQR A;  5GP9 A;  4BS9 A;  5HDN A;  3PM1 A;  5LD2 C;  2DQR A;  3L7W A;  1MSE C;  2V79 A;  3O8G A;  1TWC J;  1J09 A;  2NYX A;  3KP4 A;  4UB8 C;  3I54 A;  4BAY A;  1RC9 A;  2LKP A;  5EGO A;  1OR7 C;  2VE8 A;  4DBQ A;  3CCY A;  3LQQ A;  2VXD A;  3VWB A;  2JA2 A;  4IRH A;  4DIQ A;  4G7Z F;  4U0Y A;  4XM3 A;  4E70 A;  4AM3 A;  1JUS A;  3ZXS A;  2HDD A;  2L01 A;  1D5Y A;  1MSF C;  2F6C A;  3AKZ A;  2NNN A;  1TZL A;  2KZV A;  2BW3 A;  3TDZ C;  2EA2 A;  1R4N B;  4M3E A;  2ZSI B;  4NC7 A;  1QZE A;  3KE2 A;  2XAS A;  2NAZ A;  2B63 J;  1G3S A;  5LHH A;  3BJO A;  2R7U A;  4BYY A;  4N9I A;  4G7O F;  2XKO A;  2MC3 A;  1RKT A;  2VQG A;  4Z6Y A;  4G12 A;  1I6H J;  4ZTF A;  4X1E A;  1LFB A;  3S16 J;  3OS0 A;  1X3Z B;  1B4A A;  1UFM A;  2DYS H;  1UST A;  4L5J A;  3WG7 H;  2O6G E;  3WTX C;  4A0Z A;  5FO5 A;  4FTH A;  1OFC X;  4I01 A;  3F8C A;  3SDG A;  1MH3 A;  2HR3 A;  1CGP A;  4ZH4 F;  3RKX A;  3ZQC A;  4XSZ F;  1J5Y A;  2EIJ H;  3OY9 A;  1OPC A;  2V1N A;  3FXU A;  1YI2 I;  1WJC A;  1R6R A;  2F5E A;  2QM3 A;  3QPH A;  2M34 A;  3IRQ A;  1K4S A;  1GUU A;  1DP3 A;  3ZMS A;  3J7Y J;  1HF0 A;  5B1A H;  2KIQ A;  3MMY B;  2K86 A;  1I6X A;  2X6O A;  2DI3 A;  3OMY A;  1IV6 A;  1ITY A;  4BJ5 C;  2EPF A;  3CDI A;  4PSX A;  3VOE A;  4AUX A;  5J40 A;  1SFU A;  1Y0U A;  2GQQ A;  4HX8 A;  1RET A;  2MH2 A;  4KT5 C;  3HHG A;  4XBF A;  1A31 A;  2JVG A;  1ENH A;  1GLN A;  5E18 F;  3ZQ7 A;  3KCC A;  3DKY A;  3BT9 A;  1T98 A;  2IBD A;  4ITV A;  3W3C A;  1I5Z A;  2DA5 A;  3COA C;  3S1N J;  2HQA A;  3D5R C;  1R1U A;  2QF7 A;  2BXZ A;  4E7H A;  4PDK A;  3JRF A;  1NTC A;  2PMZ A;  3ELK A;  4LLG F;  4A3M J;  2QVO A;  1Y0N A;  1G59 A;  2DPD A;  2EIK H;  2PMU A;  1YYV A;  4P96 A;  4IHY A;  4ESB A;  2VT2 A;  4HQE A;  2Q0O A;  4XRM A;  1U0J A;  1ETW A;  3Q0W A;  4R79 A;  2HTJ A;  1ACI A;  2YX7 A;  3LSK A;  1B72 A;  1WJD A;  3ECH A;  1GXQ A;  3OWT A;  5ICF A;  1MGT A;  4ESF A;  1ZQ3 P;  4IOA F;  2VPR A;  4EJV A;  2ZXI A;  4ASN A;  3CCS I;  2VT3 A;  3RYR A;  1POG A;  3QP5 A;  1D5V A;  2PJR A;  4HOB A;  2MW8 A;  4Q48 A;  4HQM A;  1TW3 A;  4RLQ A;  2BVM A;  1FX7 A;  5CQE A;  1BBY A;  4UHT A;  4IRG A;  4UUS B;  1O3T A;  4G6D A;  2O03 A;  1MBH A;  2HTS A;  3GFJ A;  3TW6 A;  1OCP A;  2HZD A;  1LE8 A;  3ASN H;  1ODD A;  2OJE D;  2CFX A;  4ANJ A;  4BUP A;  3IKT A;  1J7K A;  4HG2 A;  2K9Q A;  5HLI A;  1FSH A;  1G3Y A;  3OYA A;  1XS9 A;  3KPH A;  4A12 A;  2CW8 A;  4KIS A;  4JX6 A;  3RIR A;  1AKH B;  1TWA J;  4RGS A;  4V19 K;  5JLW A;  4BEH B;  2BGC A;  2G7H A;  4RM2 A;  2EBI A;  2XSD C;  2UZK A;  3NWT A;  4FE4 A;  4BQQ A;  1R00 A;  1TBX A;  2DLL A;  2KFD A;  2EH3 A;  3GEZ A;  4LG0 B;  2O61 A;  2VXZ A;  4BQA A;  4IX7 A;  3LSP A;  4M3B A;  3I4M J;  3GFL A;  2ID6 A;  2IGM A;  2Q1Z B;  1ZRF A;  2D1H A;  4NHJ A;  1D1B A;  4CDG A;  2KDZ A;  1YE9 A;  3KX2 A;  3F3X A;  3VYU B;  3VSL A;  2XB0 X;  3FIW A;  2DW4 A;  3BLY A;  3H3U A;  3CC7 I;  3NWS A;  4WK8 F;  5L3B A;  1O57 A;  2LVS A;  2CO5 A;  3BR1 A;  4ESJ A;  1TWF J;  3CO6 C;  5DCM B;  3VSK A;  2PEX A;  3J7A Y;  2ZBK A;  3CCV I;  4OIN F;  2HVS A;  2CV1 A;  3T8R A;  3GZ6 A;  3KZZ A;  1SVM A;  3TMO A;  1QPI A;  3BDD A;  2K40 A;  2FQ4 A;  2PMZ N;  4RB3 C;  2PFB A;  3EQL F;  5ERI A;  1BM9 A;  1RZ4 A;  2DTR A;  2ECC A;  2HVQ A;  1S6L A;  5FLX K;  2YSR A;  4IEJ A;  3CQZ J;  1P4A A;  3BPX A;  5DD4 A;  4KNY A;  1LFP A;  2QGU A;  2W48 A;  3FMS A;  1FOY A;  3G1L A;  4L0Y B;  2DJI A;  3SXY A;  4WXD A;  2YUS A;  3HOZ J;  1X1B A;  4HNV A;  5HVQ C;  1OMI A;  3L2R A;  3CJN A;  3E6B A;  1KU3 A;  2K9N A;  4RBO A;  1WJF A;  4ZYA A;  5TGT A;  3BY6 A;  5H20 A;  3K2A A;  1LDJ A;  2ZCW A;  1K79 A;  2V26 A;  5FRN A;  1JGS A;  3M3Y J;  5IP9 J;  2HXI A;  2NOJ B;  2WY7 Q;  3TO9 A;  3CCJ I;  3Q9V A;  3SFI A;  5GPC A;  5J8C A;  3CES A;  3ZP5 A;  2E2H J;  1ZTR A;  2NS7 A;  5K5R A;  3BQY A;  1VQ9 I;  2FA5 A;  4ZTJ A;  2WWY A;  2L7F P;  2BY0 A;  4I99 C;  3EUK L;  3RKW A;  3FKJ A;  3OYF A;  2VQC A;  4Q5S F;  1MZB A;  5F0C A;  5FKN A;  4MQ9 F;  3UNG C;  4CZZ A;  1U78 A;  4EV0 A;  1S3J A;  1YFH A;  3TL4 X;  4OIP F;  1SD5 A;  4IXA A;  4RS8 A;  5KAF C;  2DDA A;  4IOC F;  2Y75 A;  2VPL A;  5J6X A;  4I0B A;  2XIG A;  2OPT A;  2IW5 A;  1TT0 A;  2EZI A;  2JUG A;  1OIS A;  2VKE A;  3PFI A;  3SHF A;  1IGN A;  1X3W B;  2KIF A;  3V7R A;  3C18 A;  3HPG A;  1JKP C;  3TGN A;  1TWG J;  4EJW A;  1AU7 A;  3LSI A;  4OWR B;  4PGH A;  1QGP A;  3LQR A;  3WGH A;  1RI7 A;  1BIA A;  1MMD A;  1FBS A;  2V9P A;  3C2G A;  4IF4 A;  1VQO I;  2IVM A;  3ZGK A;  1U9O A;  4Y3O A;  1QHG A;  2XV4 S;  1T56 A;  3HRS A;  4JQF A;  1OCT C;  2P6S A;  1GXP A;  3SZP A;  3TQN A;  3J80 K;  1IF1 A;  3H5A A;  3QOE A;  1YO5 C;  4B09 A;  1S7A A;  1STZ A;  3KYC B;  3AG1 H;  2I8D A;  2R5Y A;  2CGP A;  1X1P A;  1LEA A;  4D9J A;  5KNL A;  5E3N A;  1XMK A;  3JAM Z;  5FLM J;  4ZYD A;  1YIT I;  4BQO A;  2EIM H;  3OS1 A;  3E97 A;  3HDD A;  2WAF A;  5DV5 A;  4A3E J;  1T95 A;  3K1P A;  3ZQH A;  1XTA A;  2Y31 A;  2KJB A;  1ONV A;  2DA3 A;  3OYK A;  3NRV A;  1FLI A;  3H9Q A;  1JI8 A;  1FTZ A;  3BOQ A;  4BNC A;  3T1B A;  4EAT A;  4M9X A;  2KMU A;  2MAB A;  4F91 B;  1C0W A;  2Y30 A;  1FMV A;  5E1W A;  1K83 J;  3X2Q H;  2NVY J;  1UB9 A;  2OCE A;  3CCU I;  1P7I A;  1XG1 A;  2W25 A;  4I6Z A;  1DU0 A;  1R58 A;  4GDF A;  3A2K A;  2W1O A;  1WI3 A;  1SAN A;  3JW4 A;  5E1X A;  5IOZ A;  3ZOB A;  1ZHF A;  3W6K B;  1AOY A;  2W82 A;  4M71 A;  5M3M J;  1USS A;  4A5M A;  1Z9C A;  5F64 A;  1LKX A;  2DCE A;  1MJA A;  3F6O A;  3U2R A;  3WU2 C;  2DOD A;  3R0J A;  5TJJ A;  3MKW B;  1WPK A;  2QQ9 A;  2LC2 A;  3QWL A;  3MKL A;  1FWZ A;  2HEO A;  3LA3 A;  2GLO A;  2MGQ A;  4D5C A;  5IT9 K;  3E1S A;  4OAZ A;  1BOB A;  1FIP A;  2LNB A;  2H1K A;  4FT8 A;  3WTV C;  2W57 A;  3GTO J;  1P2F A;  3S14 J;  2Z9O A;  4CCM A;  2K4J A;  1X58 A;  5TRD A;  5F27 A;  4QIW N;  4H4K C;  4NB5 A;  3WG9 A;  3LFU A;  2VOP A;  1U5T B;  1HW2 A;  1IN6 A;  2CUZ A;  2RKH A;  1ZG1 A;  2BE5 F;  2RNJ A;  3JR9 A;  2RQQ A;  1JTY A;  2KHM A;  3PUF A;  4MLO A;  5F1J A;  2IA2 A;  5B66 C;  3QYF A;  4R1H A;  2I10 A;  1DUX C;  2FNA A;  2XPW A;  1IUY A;  1IW7 F;  1WJE A;  3GW2 A;  3RPU D;  1PJR A;  2XVC A;  3OL4 A;  4CYD A;  2HVR A;  1SD4 A;  3HIF A;  3K1M A;  3TDU C;  4ZZD A;  4HST A;  5E20 A;  1H8A C;  1FOX A;  4G9Y A;  1UZC A;  1YX3 A;  2NVU B;  4N9H A;  5JHF A;  2A5W A;  1G2H A;  3BR5 A;  5LEK A;  2R7Z J;  2IGN A;  2XAH A;  4YIR X;  3AG3 H;  1ETY A;  2K27 A;  4NUB A;  2ISZ A;  3H5R A;  5ICC A;  2IT0 A;  3M9A A;  3ZR8 X;  3IH4 A;  1K78 A;  1GHC A;  3JRI A;  4HX7 A;  3KZI C;  3FMQ A;  3GZ5 A;  3GTL J;  2CWE A;  3V7C A;  3MZH A;  4A3L J;  2M5W A;  5A2Q Z;  1JHF A;  1WHU A;  3ERM A;  1EA3 A;  3NQO A;  4L9N A;  2CQX A;  1E3O C;  5DM6 F;  1NG7 A;  3CCE I;  3DTI A;  4A3C J;  3IC7 A;  4EJO A;  3OSF A;  5J1R A;  4LFU A;  1R5G A;  1X2N A;  1F4K A;  1T8I A;  1HBX G;  3EYY A;  3BP8 A;  4YII A;  1LFU P;  4NBQ A;  4LLL A;  4EM2 A;  2JSP A;  3MEX A;  2QA4 I;  2DMP A;  4P9F A;  1ZR4 A;  5DS9 A;  2VE9 A;  2L02 A;  2DMT A;  1W7P B;  4BU2 A;  3J80 Z;  1RIO H;  3SEZ A;  1P4X A;  3T5X A;  3WU1 B;  1MMN A;  3MCZ A;  2L9N A;  4EQQ A;  1KU7 A;  1BA5 A;  3OOP A;  2D2W A;  1GT0 C;  1YQA A;  2AO9 A;  3HOU J;  1SEU A;  3CC2 I;  4BY1 J;  2ZB9 A;  4AIH A;  1RRJ A;  2MH9 A;  1KU9 A;  4LB5 A;  3LSM A;  1SFE A;  3E7L A;  3FWE A;  1W1W E;  1EH8 A;  3MVP A;  1MJB A;  3CJR B;  4Z2Y A;  4FCY A;  1KQ9 A;  4HF2 A;  4A2U A;  3HJE A;  5C4X J;  4E6K G;  4WCG A;  3RDI A;  2X1E A;  2HYG D;  5FLV A;  3TOB A;  2BZT A;  4UB6 C;  5EZG A;  1ZK8 A;  1KA8 A;  3G1O A;  1FEX A;  3WGG A;  4QPO A;  2KRH A;  4II3 A;  5KAI C;  2IA1 A;  4YFK F;  1XMA A;  2JA5 J;  2JPC A;  3PNV A;  5FFX A;  2HI3 A;  2GA1 A;  5KVR A;  3T8T A;  3CO7 C;  2JPB A;  4LIV A;  1FYM A;  2IXS A;  4XN0 A;  2X6X A;  1UG2 A;  3DU5 A;  3DQV C;  3S1M J;  5DEQ A;  3EUH C;  3LSH A;  4EGY A;  1K7A A;  1VQN I;  1ETQ A;  3DTE A;  1D8J A;  2FX0 A;  3BG6 A;  1B1B A;  4G7H F;  3I9V 2;  4HA8 A;  3HYI A;  3A4C A;  2MC4 A;  3CCM I;  2HPI A;  2CQK A;  3CCQ I;  1RNL A;  1SD7 A;  2BOL A;  1BN5 A;  1OCO H;  3A1Y A;  2V6E A;  2FBH A;  4XRF A;  2Z2S B;  3HXL A;  4M3D A;  5J1Y A;  1R1T A;  1CF7 B;  3VDX A;  1MBE A;  4LJZ F;  2E60 A;  1Z0X A;  1P7J A;  2Y0S N;  3CF5 F;  3J81 Z;  3HRU A;  3PJR A;  4XSX F;  1T08 B;  3CLQ A;  3MZY A;  2IA0 A;  2IGO A;  2LP0 A;  3K7A J;  1GVJ A;  1FYK A;  1BI3 A;  1OCC H;  1VF9 A;  2ZNY A;  5E3O A;  2K4B A;  3KLN A;  2QEX I;  3BZ6 A;  2ELK A;  4MEY F;  2V9V A;  2M87 A;  4LOC A;  4XLA A;  2M7A A;  1QZZ A;  1TW2 A;  2R4G A;  3BR6 A;  3TP3 A;  3MWM A;  1VQP I;  2COM A;  3VYT B;  4RB2 C;  3OS2 A;  2F48 A;  4JYK A;  4OIQ F;  1K6Y A;  1V3F A;  3HKZ N;  1ON1 A;  2QKL B;  1ZAR A;  5HLG A;  4QTR A;  3FXQ A;  1I39 A;  4LMY A;  3ECO A;  2LBF B;  1HKT A;  3V7S A;  2DK8 A;  2ZME B;  3FXR A;  3FXJ A;  3SDB A;  1KQ0 A;  4W1U A;  1KZH A;  3TKY A;  5D5X B;  4CCN A;  2XB5 A;  5GTH C;  3E3V A;  2HGC A;  1N25 A;  3REO A;  4XLC A;  3QOP A;  2GXB A;  4HPQ A;  4ABZ A;  2DXI A;  2UV1 A;  2WV1 A;  3JAM K;  3PSI A;  1VQ8 I;  4PJL A;  4IO9 F;  2BY1 A;  2VJI A;  2PI0 A;  2LFB A;  2XPU A;  4JK1 X;  4BE1 A;  2EIL H;  2P6T A;  3FF5 A;  2JWT A;  2J5O A;  1YIO A;  3TO6 A;  5BQT A;  3ZQQ A;  1HC8 A;  1X1C A;  2EZH A;  2NOG A;  2G7U A;  4HZF A;  1Y8R B;  1O3Q A;  4CCJ A;  1W36 C;  1BJA A;  5B1B H;  1DDN A;  2MG4 A;  4EVI A;  3BC8 A;  1WFX A;  2WAQ N;  3QYB A;  4FAS D;  1A6I A;  2A69 F;  3BTI A;  4D0P A;  3LSG A;  2E71 A;  3L2U A;  2WY8 Q;  4KIF A;  2X1C A;  4DBR A;  3VYR B;  4MQV A;  1P92 A;  3G71 I;  2C6Y A;  4S05 A;  1XSX A;  1IXC A;  2M0M A;  4I0A A;  5GAE J;  2L9R A;  4BE2 A;  2K9M A;  1O4X A;  1B8I B;  2LG4 A;  1X1A A;  2OQG A;  3QP6 A;  1HXD A;  1XSV A;  4P55 A;  5DCM A;  5B5E C;  3WTU C;  3F9K A;  2GWR A;  1SAU A;  2R7V A;  1NG6 A;  5ED4 A;  3JRD A;  2K02 A;  2OAZ A;  4L9J A;  1E0E A;  2P0W A;  2LF8 A;  2RRE A;  3DBR B;  3H3Z A;  2XC7 A;  4U88 A;  1S7E A;  5BOX A;  3SZG A;  5L3C A;  2RC4 A;  4IHT A;  4V2G A;  1N75 A;  1I27 A;  4OIR F;  4NQW A;  4LD5 A;  4EM0 B;  4N0B A;  4YEJ A;  2PG4 A;  2WTE A;  4RLF A;  4LGW A;  2HU9 A;  2HKX A;  2YR2 A;  3MN2 A;  2W7N A;  4BJ6 C;  4LG0 A;  3A01 B;  2ZME C;  3MAJ A;  1FT9 A;  1UHW A;  3TOA A;  4CO8 A;  4IHS A;  3J81 K;  5KHD A;  2FOW A;  3FXK A;  5ILU A;  4LK1 F;  4LIT A;  2E1N A;  2JSC A;  3BTC A;  3OV8 A;  2R7T A;  3I3L A;  2H09 A;  4YRV A;  2CUJ A;  1IRG A;  4N4O B;  4PSW A;  1U3E M;  2DYR H;  2PX9 A;  3GTG J;  1T0F A;  3L2V A;  2CQ7 A;  1FBQ A;  5GAH J;  4AYB N;  2XF5 A;  3KIO A;  1H9G A;  2LYC A;  3T0Y A;  4NNJ A;  3E6D A;  2ADU A;  2FUG 2;  1QZY A;  2VC1 A;  3IAM 2;  3GTP J;  2EB7 A;  4I09 A;  5H2F C;  2R5Z B;  3W2W A;  3DEU A;  4I76 A;  3ZMU A;  3CLO A;  2H6C A;  4BGD A;  3VB2 A;  3TED A;  4ENK A;  2LY1 A;  4EGZ A;  4RMN A;  2STW A;  2DT7 B;  2M9H A;  1B59 A;  4HV6 A;  1F43 A;  1P4W A;  1ORK A;  3EUA A;  3G3Z A;  2FJ1 A;  1E3P A;  3L9F A;  4GYI A;  1R22 A;  1WQ2 A;  3LST A;  1FNN A;  1WKM A; 
#chains in the Genus database with same CATH homology
 3HSE A;  5FGM A;  3O3K A;  3Q5F A;  2EFP A;  3CUQ A;  4WXC A;  2XHK A;  3WTZ A;  3GX4 X;  5CLS A;  1XGO A;  1F1Z A;  4HW0 A;  4KMF A;  4A6D A;  3V4G A;  3DPL C;  5HDG A;  4XLP F;  1FPQ A;  4RB1 A;  3ZPL A;  1QBJ A;  3GVA A;  5K5Q A;  5CVR A;  2DAO A;  2RDP A;  3CUO A;  3TO7 A;  3LFK A;  4EJU A;  4U7B A;  3FM5 A;  5LBQ A;  2NS0 A;  3R61 A;  3ZMD A;  4ZYE A;  2QQB A;  3MQ0 A;  4A0X A;  2XGX A;  1MJ9 A;  1OYI A;  5CVI A;  1YTY A;  1UHM A;  2VOO A;  2L3D A;  2HS5 A;  1ZRD A;  3DKW A;  1XB4 A;  2QBY B;  5H6R A;  1KYW A;  1YLF A;  3GYH X;  2FML A;  4AVP A;  5BMZ A;  3R0A A;  1VTN C;  3VEP A;  1IXR C;  3F8B A;  2EV5 A;  4AIJ A;  1QPM A;  3QPT A;  1W7P D;  4IJA A;  2E7X A;  1IN4 A;  2RVC A;  2EV0 A;  2EJR A;  5H6Q A;  3S2W A;  3DPT A;  2P8T A;  3LA7 A;  3HTS B;  3JSP A;  3RKY A;  3F8F A;  1J9I A;  1G4D A;  2FF4 A;  2PQ8 A;  2QUF A;  4BH9 A;  2UXN A;  3W6J B;  4KFC A;  3FHZ A;  1BI1 A;  1DP7 P;  4GYG A;  1LEB A;  1E2X A;  5EEH A;  3KFW X;  3M1E A;  2PMH A;  1G3W A;  5D6E A;  4GXO A;  4EM1 A;  2PJP A;  3KLO A;  3V8L A;  4KIG A;  1HSJ A;  3P9I A;  2ZO4 A;  4HDU A;  1YW7 A;  4AD9 A;  5K5O A;  3RPU A;  2ESH A;  3JTH A;  5LRR A;  4OMY A;  3BRO A;  3GLX A;  3HHH A;  2E1C A;  1OYY A;  4L0Z B;  1HQC A;  2RQP A;  2MLK A;  4MEX F;  3LWF A;  3QAH A;  2A6E F;  5ICG A;  2YX4 A;  3SFZ A;  2DFI A;  1Z7U A;  2Q2E A;  1HW1 A;  2L54 A;  3V8K A;  4ETS A;  2M45 A;  4CHU A;  2OU2 A;  5D4S A;  5LGT A;  2QQA A;  1A04 A;  2R7F A;  3BWG A;  1I1S A;  3QU6 A;  2XAG A;  3P9C A;  1O7F A;  5AIP A;  5DYM A;  4KYW A;  4GGG A;  1PP7 U;  2VC0 A;  2HQN A;  3KP6 A;  2XRN A;  2FOK A;  1NHA A;  2WV0 A;  1W4M A;  5F1R A;  3KP3 A;  2QWW A;  5FD6 A;  4WXH A;  1B9N A;  2Z99 A;  3K1N A;  3KP5 A;  1TNS A;  3DF8 A;  4ENM A;  2MLG A;  1FP2 A;  2A6H F;  2F5C A;  3KET A;  4RGU A;  2OA4 A;  2P4W A;  5DUK A;  2G9W A;  1MDM B;  5IT9 Z;  4KIC A;  2XKP A;  4AWX B;  1HST A;  4RAY A;  5E8G A;  3E5U A;  1Z91 A;  3M8E A;  3FX3 A;  1EH7 A;  3CTA A;  1HW5 A;  2ZXJ A;  2RGV A;  4K2E A;  1H9T A;  2GXG A;  4L9V A;  3N4M A;  2W85 A;  4PCQ A;  1JXS A;  1RUN A;  2OQR A;  4Y13 A;  3M7G A;  4QWQ A;  1MDM A;  5HOO A;  1ZRE A;  4WX9 A;  1BC7 C;  4I98 B;  1R1V A;  3Q9S A;  5LEJ A;  1J2X A;  4WWC A;  4DQ2 A;  1XGS A;  5ILS A;  1W5T A;  1PUE E;  1Z6R A;  4S04 A;  2V1X A;  2AXL A;  2DBB A;  4Q47 A;  4UVC A;  4A5N A;  1R7J A;  4M6Y A;  2IRF G;  1OR7 A;  4RB0 A;  4IPA A;  1FY7 A;  2BV6 A;  2Z5U A;  5LHG A;  3R4K A;  4HF0 A;  1REP C;  3LA2 A;  1OYW A;  1XSD A;  3SQN A;  1ZAO A;  4HDV A;  1ZRC A;  1P6R A;  1Q1H A;  2P7V B;  4ENJ A;  3K69 A;  3L2C A;  3F8N A;  3I5U A;  3MFK A;  1J59 A;  2A68 F;  3GWZ A;  3ULQ B;  2HDC A;  5L3F A;  1AWC A;  4A0Y A;  2ELH A;  5LGU A;  2DPU A;  1WI9 A;  3L00 A;  5JR3 A;  3FZV A;  1FOK A;  1XGN A;  2FQ3 A;  2UXX A;  5L3D A;  2XAQ A;  4U7D A;  4HLY A;  4KDP A;  1XCB A;  3J7A O;  4LK0 F;  1LQ1 A;  3LAP A;  3P7N A;  1JE8 A;  4KA4 A;  4ZYH A;  3VFZ A;  2V1U A;  2H94 A;  1ON2 A;  2OZU A;  2NRA C;  5HS7 A;  1S7O A;  2F5F A;  5CYV A;  5HS8 A;  3ZN0 A;  2JZY A;  1LVA A;  5CVU A;  1XDS A;  3E6C C;  3K2Z A;  5FFZ A;  2Y48 A;  4L5I A;  1PDN C;  3C7J A;  4R8H A;  4G8X A;  5A2Q K;  2HYF A;  5HLH A;  3H92 A;  4PGG A;  2FEZ A;  1K6O A;  1FP1 D;  4P9U A;  5JVT A;  5D6F A;  2HZT A;  2VBY A;  1EV7 A;  3HOS A;  3IKV A;  3WOD F;  3D5L A;  3WTW C;  2HKO A;  2ZJ2 A;  4HBL A;  4MNU A;  1O3S A;  5IT3 A;  1LDK B;  3WTS C;  1R5H A;  5FB2 A;  2HOE A;  2PBI A;  3RYP A;  2KRF A;  4UV9 A;  1PP8 F;  2ESN A;  3EET A;  4MHG A;  1D3Y A;  4BHP A;  3IHU A;  2FBI A;  5CJ9 A;  1Z1D A;  4TV7 A;  4M74 A;  5JHU A;  1T39 A;  1FYL A;  3E5Q A;  2X0L A;  2RV8 A;  1ZLJ A;  2Y0M A;  2GA2 A;  1XDU A;  4CIC A;  3RI4 A;  3WE3 A;  3ML6 A;  3RTR A;  4HV5 A;  3ZMV A;  4HF1 A;  4RGR A;  3PQK A;  5D5V B;  4UVB A;  4M9S A;  2QBY A;  1BIB A;  3DV8 A;  2MA3 A;  3M8F A;  3F23 A;  2VOD A;  3P9K A;  5LRS A;  2CSO A;  4YFX F;  3NEU A;  3I59 B;  1WRJ A;  3JTG A;  2IPQ X;  3I53 A;  3ZN1 A;  2LDU A;  3BJA A;  4ENN A;  4U0W A;  3WU0 A;  3WE2 A;  1IZ1 A;  3ZMT A;  3GO5 A;  1HKQ A;  3I0T A;  1E17 A;  2H27 A;  4MGR A;  2P5L C;  2DK5 A;  1IXS B;  3DXJ F;  1B9M A;  6PAX A;  2MBF A;  5LHI A;  2XAJ A;  3HRM A;  1W7P A;  4EMS A;  2UWM A;  4UXN A;  2FSW A;  5D5U B;  2XAF A;  3G73 A;  1LNW A;  1LB2 A;  3R60 A;  4M9Z A;  5HDK A;  4HLX A;  5JI6 A;  2VBW A;  5D4R A;  2W84 A;  1KQ8 A;  2W24 A;  3QRF F;  1L3L A;  3DFG A;  4O5V A;  4KN7 X;  2A07 F;  2BEO A;  1MD0 A;  4ON0 A;  4F7Z A;  2M30 A;  4U0V A;  4FX4 A;  4IRI A;  5BPD A;  2RN7 A;  1ZGJ A;  1R36 A;  1SMT A;  5D5W B;  5AON A;  2EFW A;  3BPV A;  3CUQ C;  1J75 A;  3I4P A;  1YW9 A;  2Q8K A;  1WSU A;  1ZGA A;  4UV8 A;  1QQI A;  3ABT A;  4YFN F;  1SFX A;  5E1Z B;  3ISP A;  2HFH A;  2F5D A;  1XCV A;  2VBX A;  1IRF A;  4OOI A;  1I1G A;  2FU4 A;  4LLN A;  1IAW A;  3F72 A;  1O7L A;  4M72 A;  5CVV A;  2LF7 A;  1LJ9 A;  4CXF A;  1IN7 A;  4XLN F;  4BXU A;  4EJT A;  3N97 A;  1WWX A;  1LDD A;  2QEN A;  5JFR A;  4I02 A;  3GFM A;  2F2E A;  1RUO A;  1SAX A;  2L4M A;  5DDG A;  3ABU A;  1QO0 D;  5CVJ A;  1FBU A;  2IJL A;  2GZW A;  5BPI A;  4FHT A;  2FBK A;  4BHB A;  5E17 F;  1KGS A;  4I7H A;  2KIU A;  2CYY A;  2KKO A;  2O0Y A;  1BOA A;  1H0M A;  1BI2 A;  4GO1 A;  3I64 A;  1SMY F;  3HRT A;  5ICE A;  3D0S A;  3KEQ A;  3ROU A;  2AS5 F;  2L4A A;  2ZNZ A;  3SZT A;  1S8N A;  1HKS A;  3I59 A;  4BHC A;  4UUV A;  4G6Q A;  5L3G A;  4Y15 A;  5LGN A;  2EA4 A;  1U2W A;  4OMZ A;  5FD5 A;  4O6J A;  2PN6 A;  1Z05 A;  4MTD A;  5KK1 A;  3CDH A;  3HUG A;  4L9T A;  4H0E A;  1U5T C;  3IWF A;  3JSO A;  1YG2 A;  2Z33 A;  2QYO A;  2JTV A;  1IN8 A;  1XN7 A;  2XUB A;  2DU9 A;  2FRH A;  4GCV A;  2A3S A;  3L09 A;  2A61 A;  2ISY A;  4KIB A;  5L3E A;  3C3W A;  2ZKZ A;  1QNT A;  1YS7 A;  5DCF A;  2O8X A;  2K7L A;  5BS6 A;  1G3T A;  1V4R A;  1ZLK A;  4RGX A;  3WGI A;  2EWN A;  5D8K B;  1O3R A;  1XGM A;  3E6M A;  2DT5 A;  2OD5 A;  3KP2 A;  1ZG5 A;  5E8I A;  1IN5 A;  3F22 A;  2BBY A;  5F6F A;  1DPR A;  3GFI A;  2GIV A;  3GF2 A;  2QLZ A;  3K0L A;  3KP7 A;  3EYI A;  2D1V A;  3CUQ B;  2JT1 A;  2P5V A;  3FMR A;  1U6G A;  4HX4 A;  3LAJ A;  4YG2 F;  4AIK A;  4OU0 A;  3KEO A;  2Z3Y A;  1CF7 A;  4MTE A;  4A6E A;  4UVA A;  1MKM A;  1TQI A;  4KMU X;  3K9T A;  3B73 A;  3HSR A;  3EUH A;  2EFQ A;  3HSF A;  1FZP B;  3DP7 A;  2QZ8 A;  4LB6 B;  2J5P A;  2FMY A;  2A5Y B;  4O3M A;  4Y17 A;  2VN2 A;  2P7C B;  2ZFW A;  2R7D A;  3EDP A;  1F9N A;  4CGZ A;  2EFO A;  2VBZ A;  1R23 A;  1KU2 A;  1JHH A;  5EEG A;  3WTY C;  1ZN2 A;  5LLQ A;  2LSO A;  1KYZ A;  1TQM A;  2P5K A;  1FSE A;  4KUM A;  2JRT A;  4JBA A;  4G94 A;  2IP2 A;  2FE3 A;  3AAF A;  1F5T A;  1TNT A;  2VON A;  3VOD A;  3IL2 A;  2KIM A;  2B0L A;  4FX0 A;  1U8R A;  4PZJ A;  4RAZ A;  5DD8 A;  1G6N A;  3QU3 A;  4I2O A;  3IRR A;  2CG4 A;  3B02 A;  2ACJ A;  5DUI A;  3GXO A;  2EK5 A;  2OZ6 A;  2XRO A;  4HYE A;  1K78 B;  3F6V A;  2FXA A;  4P5O A;  2STT A;  5J8F A;  5D8L B;  1ZG3 A;  1ZYR F;  2X4H A;  1W5S A;  2FNP A;  2GAU A;  4Q4Z F;  4WF2 A;  4M6X A;  1EH6 A;  1TTY A;  3O6B B;  4KN4 X;  3ERE D;  1T38 A;  2O3F A;  3U9G A;  2TDX A;  1ZH5 A;  2PLY A;  2YPR A;  4DNC A;  1YS6 A;  1D8K A;  1BC8 C;  4ZYG A;  2DQL A;  4L18 B;  1L0O C;  3ZMZ A;  4UNO A;  2WC2 A;  1UCR A;  2R3S A;  2ETH A;  2M1B A;  2KJC A;  1XD7 A;  4M73 A;  3U1D A;  5AIQ A;  3V8J A;  3IWZ A;  3FM3 A;  2D45 A;  3HOT A;  2V6C A;  1YW8 A;  2OBP A;  2H6B A;  2MD5 A;  2M8E A;  1ULY A;  3F8M A;  1U5T A;  3I71 A;  2EV6 A;  3RPQ A;  2CW0 F;  1B6A A;  2E7W A;  1DPU A;  1J0R A;  5ILV A;  3BJ6 A;  3WTT C;  2EFN A;  3E5X A;  3KZY A;  4OIO F;  1T6S A;  3O2P E;  3R6S A;  2V1D A;  1SD6 A;  3RJP A;  3PQJ A;  4IVN A;  3I58 A;  2DO7 A;  1FC3 A;  2ZME A;  3F21 A;  4B8X A;  5FLX Z;  2YU3 A;  2NNY A;  5HS9 A;  4QLC U;  1OKR A;  3GUD A;  1Z6T A;  4YIF A;  3HTU A;  1S29 A;  5K1Y A;  1X3U A;  1T2K A;  4ZZL A;  1BI0 A;  1TLH B;  3C1D A;  4HAM A;  1TQP A;  2HWV A;  2BYV E;  2HQR A;  5HDN A;  2DQR A;  3L7W A;  2V79 A;  2NYX A;  3KP4 A;  3I54 A;  4BAY A;  2LKP A;  2VE8 A;  3LQQ A;  4IRH A;  4G7Z F;  4U0Y A;  4E70 A;  2L01 A;  2NNN A;  3TDZ C;  2EA2 A;  3KE2 A;  2XAS A;  2NAZ A;  1G3S A;  5LHH A;  3BJO A;  4BYY A;  4N9I A;  4G7O F;  2XKO A;  2MC3 A;  1B4A A;  1UFM A;  1UST A;  4L5J A;  2O6G E;  3WTX C;  4A0Z A;  5FO5 A;  4I01 A;  3F8C A;  1CGP A;  2HR3 A;  4ZH4 F;  3RKX A;  4XSZ F;  1J5Y A;  1OPC A;  3FXU A;  2F5E A;  2QM3 A;  3QPH A;  3IRQ A;  3ZMS A;  2K86 A;  1I6X A;  2DI3 A;  3VOE A;  1SFU A;  1Y0U A;  2GQQ A;  4HX8 A;  2MH2 A;  4KT5 C;  3HHG A;  4XBF A;  5E18 F;  3ZQ7 A;  3KCC A;  1T98 A;  1I5Z A;  3COA C;  1R1U A;  4PDK A;  3ELK A;  4LLG F;  2QVO A;  2DPD A;  2PMU A;  1YYV A;  4P96 A;  4ESB A;  2VT2 A;  4HQE A;  2Q0O A;  4R79 A;  2HTJ A;  2YX7 A;  3ECH A;  1GXQ A;  5ICF A;  1MGT A;  4ESF A;  4EJV A;  4ASN A;  2VT3 A;  3RYR A;  3QP5 A;  1D5V A;  4HOB A;  4Q48 A;  4HQM A;  1TW3 A;  1FX7 A;  1BBY A;  4UHT A;  4IRG A;  1O3T A;  4G6D A;  2O03 A;  2HTS A;  3GFJ A;  1ODD A;  2CFX A;  3IKT A;  1J7K A;  5HLI A;  1FSH A;  1G3Y A;  4A12 A;  3RIR A;  4RGS A;  2BGC A;  2G7H A;  2UZK A;  1R00 A;  1TBX A;  2DLL A;  3GEZ A;  4LG0 B;  2O61 A;  2VXZ A;  4BQA A;  3GFL A;  1ZRF A;  2D1H A;  4NHJ A;  4CDG A;  3F3X A;  2DW4 A;  3H3U A;  4WK8 F;  5L3B A;  1O57 A;  2CO5 A;  4ESJ A;  3CO6 C;  5DCM B;  2PEX A;  2ZBK A;  4OIN F;  3T8R A;  3GZ6 A;  3KZZ A;  3BDD A;  4RB3 C;  2PFB A;  3EQL F;  5ERI A;  1BM9 A;  1RZ4 A;  2DTR A;  1S6L A;  5FLX K;  2YSR A;  1P4A A;  3BPX A;  5DD4 A;  4KNY A;  3FMS A;  4L0Y B;  3SXY A;  4WXD A;  5HVQ C;  1OMI A;  3CJN A;  3E6B A;  1KU3 A;  3BY6 A;  5H20 A;  1LDJ A;  2ZCW A;  1K79 A;  1JGS A;  3TO9 A;  3Q9V A;  5J8C A;  3ZP5 A;  5K5R A;  2FA5 A;  2WWY A;  3RKW A;  4Q5S F;  1MZB A;  4CZZ A;  4MQ9 F;  1U78 A;  4EV0 A;  1S3J A;  1YFH A;  4OIP F;  1SD5 A;  4IXA A;  4RS8 A;  2Y75 A;  5J6X A;  4I0B A;  2XIG A;  3PFI A;  2IW5 A;  3SHF A;  2KIF A;  3V7R A;  3C18 A;  3TGN A;  4EJW A;  4PGH A;  1QGP A;  3LQR A;  3WGH A;  1RI7 A;  1BIA A;  4IF4 A;  1FBS A;  2IVM A;  2XV4 S;  3HRS A;  4JQF A;  2P6S A;  1GXP A;  3SZP A;  3TQN A;  3J80 K;  1IF1 A;  1YO5 C;  4B09 A;  1S7A A;  1STZ A;  2CGP A;  1LEA A;  1XMK A;  3JAM Z;  4ZYD A;  3E97 A;  5DV5 A;  3K1P A;  2KJB A;  1ONV A;  3NRV A;  1FLI A;  3BOQ A;  4BNC A;  3T1B A;  4M9X A;  1C0W A;  5E1W A;  1UB9 A;  2W25 A;  1R58 A;  3JW4 A;  5E1X A;  1ZHF A;  3W6K B;  1AOY A;  4M71 A;  1USS A;  4A5M A;  1Z9C A;  5F64 A;  1MJA A;  3F6O A;  3U2R A;  3R0J A;  5TJJ A;  2QQ9 A;  1FWZ A;  2HEO A;  3LA3 A;  5IT9 K;  2LNB A;  4FT8 A;  3WTV C;  2W57 A;  1P2F A;  2Z9O A;  2K4J A;  5TRD A;  4NB5 A;  3WG9 A;  2VOP A;  1U5T B;  1HW2 A;  1IN6 A;  2RKH A;  1ZG1 A;  2BE5 F;  2RNJ A;  2IA2 A;  4R1H A;  1DUX C;  2FNA A;  1IUY A;  1IW7 F;  3GW2 A;  4CYD A;  2XVC A;  1SD4 A;  3HIF A;  3K1M A;  3TDU C;  4ZZD A;  5E20 A;  4G9Y A;  4N9H A;  5LEK A;  2XAH A;  2ISZ A;  2K27 A;  5ICC A;  2IT0 A;  3M9A A;  1K78 A;  1GHC A;  4HX7 A;  3FMQ A;  3GZ5 A;  2CWE A;  3V7C A;  3MZH A;  2M5W A;  5A2Q Z;  1JHF A;  3NQO A;  4L9N A;  3IC7 A;  4EJO A;  4LFU A;  1R5G A;  1F4K A;  1HBX G;  3EYY A;  3BP8 A;  4YII A;  4EM2 A;  4LLL A;  3MEX A;  4P9F A;  2VE9 A;  2L02 A;  1W7P B;  3J80 Z;  1RIO H;  1P4X A;  3T5X A;  3WU1 B;  3MCZ A;  4EQQ A;  1KU7 A;  3OOP A;  2D2W A;  1YQA A;  4AIH A;  2MH9 A;  1KU9 A;  4LB5 A;  1SFE A;  3FWE A;  1EH8 A;  1MJB A;  4Z2Y A;  1KQ9 A;  4HF2 A;  4A2U A;  4WCG A;  3RDI A;  2HYG D;  3TOB A;  1KA8 A;  3WGG A;  2IA1 A;  4YFK F;  1XMA A;  2JPC A;  5FFX A;  5KVR A;  2GA1 A;  3T8T A;  3CO7 C;  2JPB A;  1FYM A;  3DQV C;  5DEQ A;  1D8J A;  1K7A A;  4EGY A;  1B1B A;  4G7H F;  4HA8 A;  3HYI A;  2CQK A;  1RNL A;  1SD7 A;  1BN5 A;  2FBH A;  4XRF A;  1R1T A;  1CF7 B;  4LJZ F;  3J81 Z;  3HRU A;  4XSX F;  3MZY A;  2IA0 A;  1FYK A;  1GVJ A;  1BI3 A;  2ZNY A;  2K4B A;  3KLN A;  3BZ6 A;  4MEY F;  2V9V A;  2M87 A;  1QZZ A;  1TW2 A;  3MWM A;  2COM A;  4RB2 C;  4OIQ F;  1V3F A;  1ON1 A;  1ZAR A;  5HLG A;  3FXQ A;  4LMY A;  3ECO A;  1HKT A;  3V7S A;  2DK8 A;  2ZME B;  3FXR A;  3TKY A;  1KQ0 A;  5D5X B;  3E3V A;  2HGC A;  3REO A;  3QOP A;  2GXB A;  3JAM K;  2PI0 A;  4JK1 X;  2P6T A;  3FF5 A;  2J5O A;  1YIO A;  3TO6 A;  5BQT A;  1O3Q A;  2G7U A;  4HZF A;  1BJA A;  1DDN A;  4EVI A;  2A69 F;  4D0P A;  4KIF A;  2C6Y A;  4MQV A;  1P92 A;  4S05 A;  1XSX A;  1IXC A;  4I0A A;  2OQG A;  3QP6 A;  1HXD A;  1XSV A;  4P55 A;  5DCM A;  3WTU C;  2GWR A;  5ED4 A;  2K02 A;  2OAZ A;  4L9J A;  2LF8 A;  3H3Z A;  4U88 A;  5BOX A;  5L3C A;  2RC4 A;  4IHT A;  1I27 A;  4OIR F;  4NQW A;  4LD5 A;  4EM0 B;  4N0B A;  2PG4 A;  2WTE A;  4LGW A;  2YR2 A;  2HKX A;  4LG0 A;  3MAJ A;  1FT9 A;  1UHW A;  3TOA A;  4CO8 A;  4IHS A;  3J81 K;  5ILU A;  4LK1 F;  2E1N A;  2JSC A;  3OV8 A;  2H09 A;  1IRG A;  1U3E M;  1T0F A;  1FBQ A;  1H9G A;  3T0Y A;  3E6D A;  2ADU A;  1QZY A;  2VC1 A;  2EB7 A;  4I09 A;  3DEU A;  3ZMU A;  3CLO A;  2H6C A;  3VB2 A;  4ENK A;  4EGZ A;  2STW A;  1B59 A;  4HV6 A;  1P4W A;  3G3Z A;  3L9F A;  4GYI A;  1R22 A;  1WQ2 A;  3LST A;  1FNN A;  1WKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...