5HS8A

Crystal structure of the diamide-treated yodb from b. subtilis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
101
structure length
101
Chain Sequence
HMMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator YodB
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 32
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs8A00
1R1UA 1P2FA 1FSHA 3CUQB 1QGPA 1K7AA 1IXSB 2CWEA 2B0LA 5K5OA 5AIQA 2UZKA 4KN7X 3P9CA 2UXXA 1O3QA 1SFXA 1HXDA 4OOIA 3WODF 2YSRA 4L9NA 4UVAA 3VEPA 4PGHA 1CF7A 2CO5A 3TKYA 2NAZA 1BJAA 1Z9CA 4KA4A 4LK1F 5E18F 2KJBA 2M5WA 5D5WB 4PGGA 4HDUA 3PFIA 3WE2A 4EJWA 3BPXA 2HKXA 2OBPA 3KE2A 4OU0A 3T5XA 3DQVC 4YFNF 1UCRA 5FLXK 4UXNA 3L09A 3IKTA 2FEZA 4KIGA 2NRAC 5DUKA 1PUEE 5TJJA 2P8TA 1IF1A 2VBYA 1YLFA 1XMAA 3REOA 4B8XA 2MC3A 1ZG5A 5CVUA 2P7CB 3LA3A 1FNNA 1KYWA 2ISYA 1FYMA 4UUVA 1V3FA 2W24A 4MGRA 1YYVA 3LFKA 4ESBA 1ZAOA 1YW8A 2ZXJA 2WTEA 4LB5A 2MH9A 5FLXZ 4P9UA 2DPUA 2COMA 5J8CA 1G3TA 2GXBA 5ICGA 2PMHA 1WWXA 3E3VA 1OMIA 3OV8A 4M74A 3HTUA 3AAFA 3HTSB 1DDNA 3G3ZA 2HGCA 2F2EA 4XLNF 4EGYA 1ZRFA 2FBKA 4M9SA 2RDPA 1DPRA 3K1NA 3LWFA 2EFOA 1XSVA 2JPCA 4RB3C 4MEXF 3KCCA 2DQLA 3ZMTA 4HF1A 5HOOA 3F8BA 2VT3A 4L9JA 1YFHA 3DEUA 1R7JA 4G6QA 4ESFA 1XD7A 3DKWA 4CYDA 2IJLA 2A6EF 4RAZA 4EJOA 3IL2A 4Q4ZF 1D8JA 1T39A 4WXHA 4QLCU 3L9FA 4WK8F 1D3YA 3V7RA 5E1ZB 3S2WA 4EM1A 2P6TA 5L3BA 2M45A 4IVNA 1LEBA 4L9VA 4PCQA 1MJ9A 1JXSA 5D6EA 4U0YA 4U7DA 1J2XA 2W84A 1D8KA 2ETHA 5D8KB 5E8IA 3U2RA 2ZJ2A 3WGHA 2QQAA 1RIOH 3R61A 4ON0A 1ON2A 3I54A 3ML6A 5ICFA 1YTYA 4EGZA 4KFCA 1USSA 4XSXF 2MH2A 4R1HA 1R22A 5KVRA 5ICCA 1K78A 1UHMA 5HLHA 4R8HA 5DCFA 2QUFA 2EV6A 1KU2A 3SZPA 4L5IA 1GVJA 4M71A 5ERIA 1FWZA 2QVOA 3C18A 3WTWC 2HR3A 3K69A 2ZBKA 3IHUA 1QNTA 1S7OA 1XGMA 4Y13A 4CO8A 1MGTA 4LG0B 1T38A 3FF5A 5BQTA 2A5YB 2BV6A 2NNNA 1ZARA 3ROUA 2C6YA 1B9MA 1KQ8A 3ZP5A 1TQIA 1O7LA 2QZ8A 2VE8A 4M72A 1U8RA 2FBIA 2D45A 4A6DA 1IN6A 4G6DA 3RYPA 2CG4A 1I1GA 1IW7F 3TO9A 3GVAA 5LRSA 3BDDA 2FF4A 2K4BA 3BPVA 4G7OF 3RKXA 3ZN1A 4EJTA 1ZHFA 3EETA 3HSFA 2IA1A 1CF7B 1VTNC 3VB2A 1SFUA 1WKMA 2H09A 2PFBA 3B02A 2V9VA 1ZRCA 3GZ6A 2EA4A 4LFUA 1R00A 2CFXA 2PLYA 3CTAA 2HZTA 1ZG1A 2LSOA 2EV0A 2IW5A 4IRGA 1ULYA 4M6YA 2GAUA 3LAJA 3FXQA 3ELKA 1OKRA 3RI4A 2JT1A 4OMZA 1QBJA 3DXJF 3P7NA 1G3YA 5F6FA 1JHHA 1TW2A 2X4HA 4N9IA 1LQ1A 2FNAA 2MLGA 4Y17A 3BP8A 4I0AA 2XAQA 2STTA 4U0VA 5HS9A 4L9TA 2L54A 1XDSA 3V7CA 4MQVA 2QQ9A 3ZMSA 4FX4A 1RUOA 1MDMA 4HLXA 4AVPA 3LQRA 4RS8A 5KK1A 2J5OA 3KEOA 2XAFA 4I7HA 1G6NA 2BGCA 5F64A 1FSEA 1P92A 1BI1A 1Q1HA 3GWZA 1Z7UA 1YIOA 1W5TA 3M8EA 2PJPA 1KQ0A 2YX7A 3HRTA 3TDUC 3E6MA 3GFLA 1IRGA 2MBFA 2CW0F 1CGPA 2ZFWA 3TO6A 2FMLA 3WU1B 2HYGD 4EM2A 1PDNC 2DLLA 2VN2A 4E70A 5JHUA 2RGVA 4A0YA 3BWGA 5D8LB 2OQRA 4ESJA 2RV8A 2OA4A 2NYXA 2XKOA 3FMQA 4GGGA 4F7ZA 3GO5A 1XGNA 2E1NA 2H6CA 2E7WA 2QWWA 1YO5C 2ZNYA 2UXNA 1ZN2A 2QYOA 3GXOA 2EJRA 1DUXC 1J0RA 4CDGA 4I2OA 1KQ9A 2XV4S 3KP6A 4IJAA 1STZA 3EDPA 3BJOA 2VBWA 5LHGA 3GF2A 5DD8A 2JZYA 3C3WA 4WF2A 2E7XA 1ZLJA 3MCZA 2EFQA 5L3FA 3CO7C 2VE9A 4UV9A 3LAPA 2DT5A 5HDNA 1G3WA 4KMUX 1ON1A 5DDGA 2IT0A 1TW3A 2W25A 1U78A 3F21A 4HQEA 1K78B 2VODA 1EH6A 4WWCA 3WTYC 2XAJA 3ISPA 2Y48A 5HLGA 2GA1A 4FHTA 3M9AA 2ISZA 3T8TA 4KIBA 3ZQ7A 1KYZA 4S05A 1Z1DA 4CICA 2L4AA 1YW9A 2FU4A 2RN7A 3N97A 3L2CA 3QU3A 1IN7A 4DNCA 1BN5A 5IT9K 4BH9A 2OZUA 2V6CA 2M8EA 1BOAA 4HX8A 1TBXA 2P6SA 3TDZC 3E5UA 1B9NA 3WTSC 2FBHA 3WGIA 3GYHX 2P5KA 2OQGA 3M8FA 2XAHA 2A68F 3ERED 3F8CA 4I02A 5IT9Z 1O57A 1FBUA 3QPHA 2A3SA 1E17A 4D0PA 3R4KA 5IT3A 3QRFF 1XSDA 3E5QA 4JBAA 3JSPA 4IHSA 4ZZDA 5BMZA 5CVRA 2VXZA 1YS7A 1X3UA 4HV6A 2MD5A 4I01A 5BPIA 3HOTA 3MAJA 4A5NA 4HF0A 4KDPA 2HFHA 2V79A 2G9WA 1FC3A 4KNYA 1QZYA 1BM9A 1BI2A 3FMSA 1J7KA 2BE5F 5LBQA 1I27A 3ZMUA 1FP2A 4OMYA 3DPLC 1B4AA 2HYFA 1U3EM 3BZ6A 2D2WA 4ZYDA 3K1MA 3ECHA 3O2PE 2O6GE 4LLLA 5H6QA 1IXRC 1OR7A 1F9NA 3CO6C 1TNSA 3T0YA 1MDMB 1YS6A 3V8JA 1UB9A 3KFWX 4RGRA 2OZ6A 2NS0A 5ILVA 4ZYEA 4LMYA 3BJ6A 3F72A 4K2EA 2L3DA 2ZKZA 1DPUA 2NNYA 2DFIA 3VODA 5CVJA 2Z9OA 4EMSA 5LGNA 3HHHA 3MZHA 1SAXA 2GIVA 5HLIA 2A6HF 1ZRDA 5EEHA 1O3RA 3H3ZA 1HKQA 1AWCA 2VC1A 4G7HF 5HDGA 2K02A 2HQNA 1T2KA 2HWVA 5DCMA 1BC8C 3R6SA 2F5CA 4I09A 4OINF 1L0OC 1UHWA 4FT8A 4MQ9F 1P4AA 2LF7A 2H94A 2KIFA 1U5TC 5AIPA 4BAYA 3KLOA 5JR3A 3KZZA 2M87A 4ASNA 3PQJA 2J5PA 4M73A 2H6BA 1FBSA 3ZPLA 3I4PA 3H3UA 5AONA 2MLKA 2EFNA 3FM3A 2DTRA 5LHIA 1W4MA 5CJ9A 4UVBA 3GFJA 4Q5SF 1XGOA 3V8LA 4L18B 3BY6A 4KYWA 4WXDA 1LDDA 3F3XA 2Q2EA 3F23A 4MEYF 3FXUA 5LRRA 1AOYA 3WTUC 1BIAA 1SD4A 3V7SA 4NHJA 1IN4A 1HKSA 3CUOA 1ZLKA 1HBXG 4XSZF 1T98A 5E20A 1U6GA 2FXAA 1HW1A 3HUGA 4CXFA 3F6VA 3J81K 4BXUA 4HW0A 2L02A 3HRSA 2ADUA 2Q8KA 3VFZA 2XUBA 4YFXF 4BNCA 1R1VA 1FPQA 3T1BA 3WTZA 1H9TA 4BHBA 4P5OA 3K1PA 1KU3A 1F4KA 1KU7A 3HSRA 1HW5A 5ICEA 2QENA 2F5FA 5J6XA 3E6DA 3T8RA 3J81Z 4ENKA 3ZMDA 2Z3YA 4KMFA 2M1BA 2A07F 1O3TA 1BC7C 1EV7A 2W57A 4GYGA 4A6EA 1Z6RA 4Q48A 1S7AA 1NHAA 2W85A 3SQNA 1J75A 1LDJA 1W7PA 2HDCA 3GFMA 1W5SA 3K2ZA 3SZTA 2Z99A 3KP4A 2O8XA 4BQAA 1WI9A 1LNWA 2HOEA 4XRFA 1C0WA 2OAZA 4N0BA 3DFGA 5H6RA 3DF8A 2PN6A 4LLNA 1OPCA 5L3CA 2R3SA 1W7PD 5BPDA 4Z2YA 1TLHB 2YU3A 5L3DA 4I98B 1R36A 4HQMA 3TGNA 4IHTA 2PG4A 3EYYA 2VONA 1IUYA 1F5TA 1IN5A 2JRTA 2VBZA 4UV8A 1MJBA 5HS7A 4IPAA 4M9XA 4HX7A 1IXCA 3FZVA 1XSXA 4MTEA 1H9GA 5F1RA 4GCVA 1JGSA 2Y0MA 4XBFA 1A04A 2DK8A 5D6FA 1FP1D 3EQLF 3J7AO 1XCVA 2ELHA 3HRMA 1B6AA 1TTYA 3KP2A 2VT2A 2YPRA 2D1HA 4LK0F 3C1DA 4IF4A 2HKOA 1Z91A 3GFIA 3WGGA 2ZMEA 3GEZA 1FBQA 3I59A 2A69F 1PP8F 2G7HA 1R23A 4O3MA 3JTHA 2VOOA 1EH8A 1ZGAA 4RB1A 3HSEA 3Q9VA 1V4RA 3CDHA 4O6JA 1J5YA 2EFWA 5E17F 3F8NA 2EB7A 4YIFA 1FT9A 3O6BB 1RUNA 3E5XA 1FZPB 3LA7A 2KIMA 5TRDA 5L3EA 3TOAA 3Q5FA 5J8FA 2Z33A 5K5QA 2CQKA 4GO1A 3F6OA 2EK5A 4AIHA 3RDIA 2IRFG 5HDKA 1U5TA 2XRNA 3E6BA 2EWNA 2GXGA 2ZO4A 2FNPA 5DCMB 3FX3A 4NB5A 5E1XA 4A0XA 2TDXA 2XHKA 5LLQA 4WXCA 1R58A 3QP5A 1U2WA 3LA2A 3F22A 3HYIA 4HLYA 6PAXA 3G73A 3E6CC 1T0FA 4JQFA 4YIIA 2PBIA 5E1WA 3F8FA 3NEUA 5D5VB 1FLIA 3ZMVA 1JHFA 4A0ZA 4IRHA 1Y0UA 1D5VA 4U0WA 2O03A 4EM0B 2RQPA 2L01A 2V1DA 5HS8A 3KEQA 1SD7A 4OIQF 5BOXA 4MTDA 4HA8A 4OIPF 4A2UA 4ENNA 3PQKA 1HKTA 4LGWA 4WX9A 2EV5A 3KLNA 2JSCA 1MJAA 5L3GA 3W6KB 3FWEA 1P4WA 2LKPA 2DPDA 2CGPA 1ODDA 1E2XA 2BEOA 3RTRA 4ZYGA 1LJ9A 2M30A 1K79A 2A61A 1RI7A 2XAGA 3COAC 3RPUA 2KJCA 3R0AA 2JPBA 1QPMA 2QBYA 3KETA 2ZNZA 2QQBA 3IRRA 3H92A 1L3LA 2FE3A 1W7PB 4UVCA 4B09A 3W6JB 3CUQC 2PMUA 2CYYA 3C7JA 3V8KA 4G7ZF 1OYWA 3ABTA 4DQ2A 1SFEA 3QOPA 4MNUA 3J80K 4HX4A 3DPTA 3N4MA 1ZGJA 1HW2A 4EJUA 4OIRF 2CSOA 2O0YA 3DV8A 2GZWA 1P6RA 2KKOA 3RKYA 1XDUA 1F1ZA 2HS5A 4AD9A 2K4JA 4RB2C 2K27A 4L0YB 2ESHA 1XN7A 2F5EA 3OOPA 3BOQA 1GXQA 4ZYHA 1SD6A 3J80Z 2G7UA 4XLPF 2YR2A 3MQ0A 2DBBA 2STWA 2FA5A 3O3KA 3DP7A 2YX4A 1GXPA 4ZH4F 3I58A 2WC2A 2XKPA 1XMKA 3TOBA 3JTGA 3FXRA 1QZZA 3U1DA 1IRFA 4YFKF 3GX4X 2R7FA 3KZYA 2LDUA 4HDVA 2Z5UA 4LJZF 3IWZA 2HEOA 1J59A 1ZYRF 5FFXA 1S3JA 1J9IA 1WSUA 1YQAA 1QO0D 3GZ5A 1WRJA 4EV0A 3M7GA 1SMTA 2ZMEB 1ZREA 3I59B 2KIUA 2ACJA 1MZBA 2XGXA 2HQRA 1YG2A 1H0MA 3P9IA 1XGSA 1Z05A 3IKVA 3KP3A 2P4WA 3FMRA 4RAYA 4HZFA 1QQIA 3ZMZA 4BHPA 4MHGA 2Y75A 2DW4A 4L5JA 2QLZA 3V4GA 3I5UA 2FOKA 1BIBA 3KP5A 1LEAA 4HOBA 1U5TB 1FYKA 4M9ZA 4KICA 4CZZA 3NRVA 1G3SA 4FX0A 2AS5F 5CYVA 1B59A 4IXAA 3TO7A 2DI3A 1MD0A 1BI3A 1S6LA 5JI6A 5JFRA 2BYVE 3B73A 2IVMA 4OIOF 3M1EA 4KT5C 3P9KA 3BJAA 2OD5A 4O5VA 2PQ8A 1LVAA 1LB2A 1O7FA 3SXYA 1ONVA 1PP7U 3CJNA 1B1BA 2FMYA 3L7WA 3WG9A 4KIFA 5EEGA 1OYIA 3BROA 4KN4X 4P96A 4A5MA 3RIRA 4TV7A 2L4MA 4RGUA 5K1YA 2AXLA 2LNBA 2EA2A 3KP7A 3ZN0A 5LEJA 3WU0A 1GHCA 5BS6A 3I0TA 2MA3A 4L0ZB 2O3FA 1WQ2A 3IWFA 5CVIA 5DD4A 3IC7A 2XASA 3GLXA 5HVQC 4CGZA 3MWMA 4AWXB 1HQCA 2F5DA 3CUQA 5A2QK 4HAMA 2FRHA 3QPTA 1KA8A 2BBYA 3WTVC 2DK5A 3ECOA 3WE3A 4HYEA 3TQNA 5D4RA 2V1UA 5ED4A 1DP7P 4I0BA 2ZCWA 4U88A 2R7DA 3HIFA 2QBYB 3F8MA 1ZH5A 2ESNA 1TQMA 2P5LC 3WTTC 1REPC 3RYRA 1T6SA 5CLSA 4NQWA 3NQOA 3I53A 5FFZA 1HSJA 4HV5A 2IPQX 5A2QZ 2GA2A 2RC4A 3QP6A 4PDKA 1KU9A 2WWYA 2GQQA 4CHUA 3CLOA 3EUHA 2RVCA 3FM5A 2O61A 4IRIA 4H0EA 1I6XA 4EVIA 4EQQA 1IN8A 5FB2A 4GYIA 1FOKA 3LQQA 1SD5A 4UHTA 4BHCA 4A12A 3RPQA 1RZ4A 3EYIA 2XROA 2XVCA 2FSWA 4AIKA 5H20A 1EH7A 4GXOA 3SFZA 1IAWA 4ENJA 5FD5A 1SMYF 2E1CA 1KGSA 2V1XA 3RJPA 3QU6A 3MEXA 4JK1X 2DU9A 2FQ3A 3JAMK 3K9TA 1XCBA 2IP2A 3I71A 4RB0A 4UNOA 1HSTA 2KRFA 4G9YA 1YW7A 2GWRA 1USTA 2DAOA 4P9FA 4PZJA 4HF2A 5FD6A 4Y15A 1I1SA 2VBXA 2K7LA 3JSOA 3JAMZ 3R60A 1R5GA 5DUIA 3VOEA 3I64A 5E8GA 5DYMA 5LEKA 2D1VA 3HOSA 3E97A 1S29A 1BI0A 4QWQA 4HBLA 2P5VA 1FYLA 1FY7A 4KUMA 4P55A 4G8XA 1ZG3A 5ILUA 4AIJA 5JVTA 1P4XA 4RGSA 3IRQA 2RKHA 3JW4A 4G94A 1Z6TA 3D5LA 1R1TA 1UFMA 3SHFA 2VC0A 3Q9SA 5LHHA 2PI0A 3U9GA 2UWMA 2WV0A 5LGUA 4U7BA 1TQPA 1TNTA 3L00A 1RNLA 2Q0OA 2DO7A 4ENMA 3D0SA 3HHGA 2HTJA 4EJVA 1FX7A 2VOPA 4LB6B 3GW2A 2K86A 2X0LA 1JE8A 5K5RA 4LD5A 4N9HA 1MKMA 4LLGF 2H27A 4Q47A 1BBYA 1G4DA 5D5UB 3WTXC 3HRUA 2JTVA 1LDKB 5D5XB 4R79A 2LF8A 5LGTA 5FO5A 4ETSA 3LSTA 2XIGA 1XB4A 2HTSA 2IA0A 5FGMA 4BYYA 4S04A 1S8NA 5CVVA 1K6OA 3GUDA 3RKWA 1I5ZA 3R0JA 4RGXA 4LG0A 5D4SA 4M6XA 5DEQA 2DQRA 2QM3A 3K0LA 3ULQB 5DV5A 3MFKA 2RNJA 3ABUA 5ILSA 1OYYA 2EFPA 1IZ1A 4YG2F 1O3SA 2IA2A 2P7VB 2PEXA 3QAHA 3MZYA 4ZZLA 4WCGA 3FHZA 2OU2A 1R5HA
chains in the Genus database with same CATH superfamily
1R1UA 1P2FA 4CH7A 1FSHA 2NS8A 3CUQB 1QGPA 3C2BA 1K7AA 1IXSB 2PJRB 4HNUA 4D1QA 2LREA 2CWEA 5CQEA 2B0LA 2EQRA 5AIQA 5K5OA 2UZKA 4BKXA 4KN7X 3P9CA 4EATA 3HG9A 5IOYA 2Y69H 2UXXA 4PFPA 3G1LA 1O3QA 1SFXA 4LG3A 1HXDA 2E5ZA 4M3BA 4OOIA 2R92J 2DA7A 3WODF 3PO3J 2YSRA 4L9NA 3BCBA 4UVAA 3VEPA 2H1KA 4PGHA 1CF7A 2CO5A 3TKYA 2NAZA 4AUXA 4FETA 1BJAA 1PYVA 1Z9CA 2XF7A 2L7ZA 4KA4A 4NQWB 4LK1F 1SVOA 2VJ4A 5C4JJ 2JUCA 5E18F 2KJBA 2M5WA 2LP0A 2L0KA 2VIXA 5D5WB 5IYBJ 1YJ9I 4PGGA 4HDUA 3PFIA 3WE2A 1B8IB 2DA5A 2VXDA 4E6KG 4EJWA 3BPXA 2HKXA 2OBPA 2W1OA 3KE2A 4OU0A 1W5CC 5M5YJ 3T5XA 3DQVC 4YFNF 1JKQC 1UCRA 3M8JA 5FLXK 1A36A 4UXNA 4A3CJ 1MNEA 3L09A 3TW7A 3IKTA 2FEZA 2L5QA 4KIGA 3W2AA 3JR9A 5EGOB 5DUKA 1PUEE 2NRAC 1BL0A 5GTHC 5TJJA 2P8TA 1IF1A 2VBYA 1HDDC 1YLFA 1XMAA 3FDYA 3REOA 4B8XA 2W7NA 4A3IJ 1SEUA 5J3LA 2MC3A 1ZG5A 4J01A 1YIJI 1RRJA 5J1UA 5CVUA 2P7CB 3LA3A 1POGA 1FNNA 1KYWA 2ISYA 5CKTA 3PSIA 2XGCA 1FYMA 4Y33A 1V3FA 2CQQA 2W24A 4MGRA 1GLNA 1YX5A 1YYVA 2GOMA 3LFKA 4ESBA 1ZAOA 1YW8A 2ZXJA 2WTEA 1BR2A 4LB5A 5J1YA 2MH9A 1PUFB 5FLXZ 3CCSI 4P9UA 2R7QA 2DPUA 4XN0A 2VKDA 2COMA 5J8CA 1LFBA 3CP2A 1G3TA 2GXBA 5ICGA 1LPQA 2W00A 2CUFA 2ELJA 3M4OJ 2PMHA 1WWXA 2PMZA 2NVYJ 3G71I 3OYKA 4CCKA 5H2FC 3E3VA 1OMIA 3OV8A 1MSEC 4XRSG 3ZQQA 4M74A 3U21A 3HTUA 2IS6A 3AAFA 3EUAA 3HTSB 3F9KA 1OLTA 1DDNA 1X2MA 3G3ZA 2E1MB 3GZNB 2XC7A 3DBRB 2HGCA 1IRZA 2F2EA 4XLNF 2LFBA 4EGYA 3K6GA 1ZRFA 2FBKA 4M9SA 2RDPA 1DPRA 2VQCA 3K1NA 3VPRA 3CCVI 2KP6A 3OWTA 3LWFA 2EFOA 4PSXA 2M9HA 1XSVA 2JPCA 4RB3C 2XRLA 1RKTA 1XTAA 4MEXF 3KCCA 3LSMA 2DQLA 1VI0A 4G6TB 3ZMTA 4NC8A 5HOOA 4HF1A 3F8BA 2VT3A 4L9JA 1YFHA 2ZB9A 4QTRA 3DEUA 1R7JA 4JX4A 4G6QA 2F5VA 4ESFA 2HPIA 2KDZA 3JRDA 3RZOJ 1XD7A 3DKWA 3K7AJ 4CYDA 4YRVA 4F92B 3HKZA 2IJLA 1JGGA 1F36A 1DU6A 2A6EF 4RAZA 4EJOA 3IL2A 1WGXA 4Q4ZF 1D8JA 4UUSA 1T39A 4WXHA 4QLCU 1J09A 5JLXA 3L9FA 4CCMA 2ME6A 4WK8F 4CCLA 1D3YA 3V7RA 1SFOJ 2JA5J 5E1ZB 3S2WA 4EM1A 1X1BA 2P6TA 5L3BA 4BDYA 2M45A 3I56I 4IVNA 5TGTA 5CPRB 1LEBA 2CUZA 4L9VA 1NK3P 4PCQA 1MJ9A 3UKGA 5D6EA 1JXSA 4U0YA 1MBJA 4U7DA 1IDYA 1J2XA 4JYKA 2EH3A 2W84A 4W97A 3LSPA 1HA8A 1D8KA 2ETHA 5D8KB 5E8IA 3U2RA 5FRNA 1UAAA 2LRDA 3S3OA 4ZYAA 1BW6A 3IP4B 2HQ5A 3JREA 2XGEA 3RQIA 2ZJ2A 1VQ9I 3WGHA 2QQAA 1RIOH 3R61A 4ON0A 1ON2A 4NC7A 5E3MA 2DJIA 3I54A 4AYBA 2V26A 4XONA 2OTLI 2R7UA 5EYRA 2F48A 3ML6A 4YEJA 2AQFA 5ICFA 1YTYA 2HDWA 4EGZA 1B72B 1VQKI 4BJ6C 2GBYA 3AG4H 4KFCA 2Z16A 1USSA 3PIOF 4XSXF 3X2QH 2MH2A 2CV0A 4IQ4A 4R1HA 1D5YA 2NVXJ 1R22A 4PJ0C 3CF5F 2LK2A 5KVRA 1ENHA 1DU0A 2X85A 5ICCA 1K78A 2HXIA 4AC0A 3ABLH 1UHMA 5HLHA 4R8HA 5DCFA 3HGYA 2JA7J 1IG7A 2QUFA 2EV6A 1X19A 1P7IA 3H35A 3IH3A 4BL0B 1KU2A 3W6VA 4XLEA 2D5VA 1VQMI 3UR3C 4BS9A 1EA3A 2R7XA 3KEYA 1S5LC 2M8GX 3SZPA 5E3NA 3S3MA 4L5IA 3FXMA 1GVJA 4M71A 3OYFA 3ASOH 2IGNA 1FWZA 2QVOA 5ERIA 2WAEA 3C18A 3WTWC 2HR3A 3K69A 2DJNA 2ZBKA 2ZSHB 2COBA 9ANTA 5IY5H 1JTYA 3HKZN 3IHUA 4Y3OA 3BR2A 1QNTA 1S7OA 1XGMA 4Y13A 1A6IA 4CO8A 2ECBA 1MGTA 4LG0B 1V5EA 1T38A 3FF5A 5BQTA 2A5YB 2HZDA 5KHDA 4X6AJ 1E0EA 2BXYA 2BV6A 4XMYA 2NNNA 2WA0A 3JRAA 1ZARA 2A6TA 3ROUA 3CMMA 2C6YA 1B9MA 4ZJZA 4W1UA 4IHWA 4A3GJ 1KQ8A 3ZP5A 1OCRH 2KZVA 2Y31A 2O5RA 3BZCA 1TQIA 1OJLA 2QF7A 4XL9A 1O7LA 1H89C 2QZ8A 2VE8A 4M72A 4AM3A 5EJCA 1U8RA 2FBIA 2CRGA 4QPQA 2JVHA 4X0GA 4A6DA 2D45A 1WHUA 3D1NI 1IC8A 4F3QA 4HEA2 3DTEA 3SEQA 1W0TA 1IN6A 4G6DA 3CP8A 3K4NA 2X1EA 3RYPA 3HEFA 3FHNA 4C3HJ 3WU2C 2CG4A 1I1GA 1IW7F 3TO9A 3GVAA 5LRSA 5M3MJ 3BDDA 2FF4A 3OS1A 2K4BA 3BPVA 4QPOA 2X1CA 3S17J 4G7OF 3RKXA 3ZN1A 4EJTA 5C4XJ 1ZR2A 3PNYA 4NUBA 1E3OC 1ZHFA 2QSHX 2VQHA 3EETA 3HSFA 3GTOJ 4AYBN 5KNLA 2IA1A 5FLMJ 1ZR4A 1CF7B 2DFFA 1VTNC 3VB2A 1MH4A 3OIQA 1SFUA 4BQNA 1WKMA 2H09A 2PFBA 3B02A 3BCAA 4D7MA 2V9VA 4E7KA 1ZRCA 3GZ6A 5F0HA 2EA4A 4LFUA 5EGOA 1R00A 2KLOA 2R7TA 2CFXA 1MBEA 2PLYA 4BE1A 3CTAA 1WJBA 1VQOI 3GTGJ 3TP3A 2HZTA 3FKJA 1ZG1A 2LSOA 2EV0A 2IW5A 4IRGA 3S15J 1ULYA 4M6YA 2GAUA 2M4KA 3LAJA 3FXQA 2X48A 3ELKA 2YU9J 1OKRA 4P1WA 1V54H 3CLQA 3PM1A 1UZCA 3RI4A 2JT1A 4OMZA 2ME0A 2CW7A 1QBJA 2AO9A 4BUPA 2V7FA 2XF5A 2ZJPF 3CMAI 1Y0NA 4XRMA 2BW3A 3BTLA 3DXJF 3I4MJ 3G1MA 1XPXA 3P7NA 3VSKA 1K83J 3DBHB 2CUEA 3TW6A 1G3YA 2JRMA 1JHHA 2TRTA 1TW2A 2X4HA 4N9IA 5F6FA 5GPAA 1LQ1A 2FUG2 1Q1VA 2FNAA 2MLGA 4C2MJ 4Y17A 3BP8A 5EG0A 4I0AA 2XAQA 2LG4A 4U0VA 2STTA 5HS9A 4L9TA 2L54A 1XDSA 3ABKH 3V7CA 4MQVA 2CMPA 2QQ9A 1A5JA 3QYFA 3ZMSA 4FX4A 1RUOA 3PL8A 2AQEA 2BZTA 1MDMA 4HLXA 4AVPA 1MNDA 2DFEA 3LQRA 4RS8A 4XLCA 2ZJQF 4CCOA 5KK1A 2ZJRF 2J5OA 1X1PA 3KEOA 4NNJA 2LKSA 3WHBA 2XAFA 3CF2A 2X6YA 4S0HB 4I7HA 1G6NA 2KIQA 4XKCA 2BGCA 5F64A 1FSEA 1XC5A 1P92A 4BACA 1BI1A 1Q1HA 3GWZA 2JUGA 5EDNA 4OAZA 1Z7UA 2WAQA 1YIOA 2EPFA 4H4KC 1W5TA 3M8EA 2PJPA 4ZC3A 1KQ0A 2YX7A 1OR7C 3HRTA 3TDUC 2K3PA 2VL8A 3E6MA 3GFLA 1VQ5I 2L9RA 3HPGA 2L2OA 1GT0C 4F52A 2DA3A 1IRGA 2MBFA 1Y8QB 2O7OA 2W82A 1IV6A 1RR8C 2CW0F 2IS1A 4XNFA 1CGPA 2ZFWA 3QPLA 3CJRB 3TO6A 2FMLA 3WU1B 2HYGD 3QOEA 4EM2A 1PDNC 2DLLA 5IYDJ 2IEKA 2VN2A 4E70A 5JHUA 2RGVA 2R4GA 2LY2A 1V5GA 4LIUA 3U1KA 3FBIB 4A0YA 3K4LA 3PNVA 2Y0SA 2LMDA 3BWGA 3HL2A 4AVZA 3ASNH 2OQRA 3BTIA 5D8LB 4ESJA 2RV8A 2OA4A 2NYXA 2E1OA 2M0CA 4M3FA 4UUSB 1N25A 2XKOA 3FMQA 4GGGA 4F7ZA 3GO5A 1XGNA 2XPUA 2E1NA 2H6CA 2E7WA 2QWWA 3J7YJ 2HVRA 1YO5C 1LKXA 2ZNYA 2ICWG 1BW5A 1ETOA 1FIAA 2DN0A 2UXNA 4BE2A 1ZN2A 1HC8A 2KL4A 3VDXA 4HRIA 2QYOA 3GXOA 3GTKJ 2E34A 2EJRA 1DUXC 4BEHA 3OL3A 1J0RA 4CDGA 2L7KA 5GP9A 3K4MA 1MMSA 3H9QA 4I2OA 1KQ9A 2XV4S 1D1CA 3KP6A 4IJAA 1STZA 3I4NJ 2V9KA 1QHGA 3EDPA 3BJOA 3B6AA 2MW8A 2VBWA 5LHGA 3J7AY 1LFPA 3OR1C 3GF2A 5DD8A 2JZYA 3C3WA 3H5NA 2E7XA 4WF2A 3ZQCA 5KAFC 1ZLJA 3MCZA 4DYRA 2OV7A 2RAEA 3CZ6A 4ZTJA 1X3WB 2HYJA 2EFQA 5F04A 2ZSIB 5L3FA 3CO7C 2VE9A 3K70C 4UV9A 3K4CA 3OSGA 3LAPA 2DT5A 5IP6A 5HDNA 2DMQA 4BDZA 2E2HJ 1G3WA 4KMUX 3RZDJ 1ON1A 3ESWB 3BR1A 5DDGA 2IT0A 1TW3A 2WAQN 3ZRGA 1YI2I 2W25A 2Q2EB 3K4KA 1U78A 3F21A 2KISA 1OFCX 3JRFA 4HQEA 1K78B 4B1RA 1MMGA 3CDLA 3L2UA 1SVMA 1ITYA 4MIMA 2VODA 1EH6A 3IAM2 4WWCA 3WTYC 2LYCA 2XAJA 3ISPA 3K2AA 2HOTA 2Y48A 1IRXA 2MYSA 2IXSA 4M6VA 5HLGA 2GA1A 2H8WA 4FHTA 5HLTA 3M9AA 2ISZA 3H9GA 1GVDA 3ZR8X 3T8TA 4KIBA 1BJZA 3ZQ7A 1X1DA 1TWCJ 1OQYA 1KYZA 4ZDLA 2OCEA 4S05A 1VQNI 2Y0SN 1Z1DA 3MN2A 4CICA 4MO7A 1R6RA 2MABA 2L4AA 1YW9A 2FU4A 2RN7A 3N97A 4M3DA 4ANJA 3L2CA 3QU3A 4ZDPA 1IN7A 2V6EA 4DNCA 1Y8RB 1IGNA 1BN5A 2K40A 4AIDA 1ORKA 5IT9K 4BH9A 2OZUA 2V6CA 4HSTA 2M8EA 2VASA 1BOAA 5BNGA 1AHDP 1FMWA 4CYCB 4HX8A 1TBXA 2P6SA 3TDZC 2GXAA 4L5EA 4Y7NJ 3E5UA 4RDUA 1B9NA 3LOCA 3WTSC 2FBHA 3WGIA 3GYHX 2P5KA 2OQGA 3M8FA 2P0WA 3GTMJ 4A3MJ 3RKQA 3KPHA 2XAHA 2A68F 3ERED 2L9VA 3F8CA 3WHCA 3BR3A 4I02A 1HOMA 3LSIA 4IZZA 3S2HJ 2O9LA 1K4TA 5IT9Z 1QRYA 3OYEA 1O57A 1FBUA 2RQQA 3OYBA 3A4CA 3QPHA 2A3SA 1TWAJ 2CH0A 2XGDA 1E17A 4D0PA 4IHXA 3A0HC 1WJFA 3R4KA 3RPUD 1A35A 1N77A 5IT3A 3QRFF 1XSDA 3E5QA 4V2FA 4A3FJ 4V2GA 3PJRA 1G2HA 4JBAA 3JSPA 5KCMA 2Y30A 4IHSA 2OC6A 1FJLA 5F27A 4ZZDA 3BTCA 1N75A 4FQGA 5BMZA 2HXOA 5CVRA 2VXZA 1YS7A 2JK3A 1X3UA 4HV6A 3FBNB 2MD5A 3CCYA 4B43A 4I01A 2CQXA 4C2TA 3JRGA 1M1EB 3AG2H 5BPIA 4E7SA 3HOTA 3KIOA 4ABZA 2JVGA 3L2VA 1ZELA 3MAJA 2LVSA 1WJCA 2BY1A 4A5NA 1TWFJ 3OY9A 4HF0A 4KDPA 2HFHA 1ACIA 2V79A 2G9WA 1FC3A 4KNYA 1WVRA 1Y6IA 1QZYA 4XN3A 2HNHA 1BM9A 4RAFA 1BI2A 1OCZH 3H0DA 3MKWB 4QSHA 4XICA 3FMSA 2BW3B 1J7KA 2BE5F 3BR5A 5LBQA 1I27A 3RSNA 3ZMUA 3DU5A 1FP2A 4OMYA 5B5EC 2O8KA 4GFBA 5CQGA 3DPLC 1B4AA 2HYFA 3DCFA 1U3EM 2IS4A 3BZ6A 2D2WA 4IKFA 1WH7A 1Y39A 3ZQGA 4ZYDA 4IHYA 5EG0B 3K1MA 3CESA 3E1SA 3HC7A 3ECHA 3O2PE 2O6GE 1UG0A 5H6QA 4LLLA 1OCPA 4BQOA 5DS9A 3S2DJ 1IXRC 4XM3A 4DOZA 1OR7A 2DTZA 1F9NA 2LR8A 1TNSA 5JHFA 3CO6C 3T0YA 1MDMB 1YS6A 4XORA 3V8JA 5IP9J 2JJ7A 1JJ8C 3BQZA 1UB9A 3DKXA 3KFWX 4RGRA 2OZ6A 2NS0A 5ILVA 4ZYEA 2XDVA 3VYUB 2JQ7A 4LMYA 3BJ6A 3F72A 1T56A 4K2EA 5GPCA 3ZOBA 1DQUA 2L3DA 3KX2A 2ZKZA 2OF7A 1UJ8A 4CUGA 4BJTA 1PVEA 3J7ZI 4NDLA 1DPUA 2ZMEC 2CFOA 2NNYA 2DFIA 3VODA 2QKLB 3GTPJ 3A01A 2UUZA 5FRMA 3OS0A 3N05A 5CVJA 2R5ZA 2HPMA 2Z9OA 4EMSA 2RREA 5LGNA 3HHHA 2X51A 1S72I 3MZHA 1SAXA 1ETVA 2GIVA 5HLIA 3HOYJ 2EIKH 3JRIA 4KISA 2A6HF 1RETA 4RAGA 1ZRDA 4BE0A 5EEHA 2L7MP 1O3RA 3BR0A 3PIPF 2Z2SB 1HKQA 3H3ZA 1AWCA 2VC1A 1WH5A 4G7HF 1OCOH 2DMNA 2HQNA 2K02A 5HDGA 2IGKA 4IEJA 1SANA 1T2KA 1W36C 1SFKA 2HWVA 1BOBA 5DCMA 3CCUI 1BC8C 2GIZA 2Z1DA 4PJJA 3R6SA 2F4IA 5M3FJ 2F5CA 4CCNA 2BY2A 3LSJA 2WAFA 4I09A 4OINF 2IAIA 2XB5A 1L0OC 1UHWA 3NWTA 4FT8A 4MQ9F 2VB6A 1P4AA 2LF7A 2H94A 2KIFA 4UUVA 4ITVA 3KZIC 2KDOA 3VYRB 1U5TC 5AIPA 4BAYA 3KLOA 5JR3A 3KZZA 3Q3SA 1LVKA 2M87A 4ASNA 4A3LJ 3PQJA 4PFOA 2J5PA 4M73A 4BEHB 1S9HA 5F08A 2E2IJ 2H6BA 1FBSA 3ZPLA 3I4PA 3H3UA 5AONA 2MLKA 4FASD 2EFNA 1YHQI 3C2HA 2PMZN 3CCJI 5B1BH 2ZXIA 3S1MJ 1V5FA 5JLWA 3FM3A 2DTRA 4XR6A 5LHIA 1W4MA 3HOWJ 2BHYA 2LBFA 3QYEA 3OS2A 1ZK8A 5CJ9A 4UVBA 3GFJA 4Q5SF 1JKOC 1I39A 1XGOA 2DCEA 5J4VA 2IGOA 5FKMA 1YJNI 3V8LA 4L18B 3BY6A 2VKHA 4D7NA 4Z6YA 4KYWA 4WXDA 2KFDA 1LDDA 3F3XA 3JRHA 3ZQFA 2Q2EA 1T0FC 1XS9A 3F23A 4MEYF 1CQTA 3OYCA 3FXUA 4IL6C 2P81A 1D1AA 5LRRA 3K70D 1AOYA 3WTUC 1BIAA 2VLAA 1SD4A 1NG7A 4RMNA 3V7SA 3RQ4A 3TP0A 2B63J 2YS9A 1X2NA 3AL0C 4MFDA 5FKOA 2Y9ZA 3HOXJ 4DZJA 4NHJA 2X6WA 2KT0A 1IN4A 1HKSA 3CUOA 4B3XA 4E7JA 1ZLKA 1HBXG 3BQYA 3MKLA 4XSZF 1K4SA 1T98A 5E20A 1ERDA 1U6GA 2FXAA 1HW1A 2Y9YA 1JT6A 3HUGA 4CXFA 3F6VA 2IGMA 3J81K 2JSPA 2QCOA 4HW0A 4BXUA 2L02A 3HRSA 2ADUA 1VQ8I 2Q8KA 3VFZA 2XUBA 4BBSJ 1U9NA 4YFXF 4BNCA 1R1VA 1FPQA 3MKZA 1BA5A 3T1BA 3WTZA 1H9TA 4BHBA 2LY1A 4P5OA 3K1PA 1KU3A 1F4KA 3S32A 1KU7A 4I76A 3HSRA 2CUJA 4XLFA 5DM7F 4ZTFA 1HW5A 5ICEA 2QENA 2F5FA 5J6XA 2I10A 3E6DA 3T8RA 4E7LA 2DDBA 3J81Z 2GLOA 5K7FA 4ENKA 4PK4A 1A6QA 3ZMDA 4I6ZA 3OSFA 2M7BA 2Z3YA 4KMFA 2M1BA 5JVGF 2A07F 3OR2C 1O3TA 1BC7C 1EV7A 2W57A 5B1AH 4XIDA 4GYGA 3FXJA 4A6EA 1Z6RA 4Q48A 1S7AA 1NHAA 2W85A 3SQNA 2HDDA 2JWTA 1LDJA 1TWGJ 1W7PA 1J75A 2HDCA 3GFMA 1W5SA 4YELA 1IUFA 5FJ8J 3K2ZA 3OOUA 2E19A 3OYHA 3SZTA 4N4NB 2Z99A 3LFUA 3KP4A 2O8XA 4BQAA 2VQLA 1T95A 1WI9A 2ID6A 4XOTA 3W2WA 1LNWA 2HOEA 1GV2A 4XRFA 1C0WA 4ZDOA 2OAZA 1JI8A 3GCMA 4N0BA 3DFGA 5H6RA 3FXKA 3DF8A 4RA2A 2PN6A 2CV1A 4DGWB 4LLNA 1OPCA 5L3CA 2R3SA 2ZC2A 1W7PD 5BPDA 4Z2YA 3JRBA 3SDBA 1TLHB 2YU3A 1TWHJ 5L3DA 3CC4I 2VJ5A 3S93A 1TL8A 4I98B 3MKYB 3TL4X 4B3AA 1R36A 4HQMA 3TGNA 2ZFUA 1FTZA 4IHTA 3LNQA 2PG4A 2VUMJ 1MW7A 5C3EJ 3EYYA 2VONA 1IUYA 1F5TA 1IN5A 2JRTA 2VBZA 4UV8A 1MJBA 5HS7A 4IPAA 3QODA 4M9XA 1FTTA 4HX7A 1IXCA 1ZKGA 3FZVA 2OPTA 1XSXA 4MTEA 2CS3A 1H9GA 5F1RA 2R93J 2DA2A 4GCVA 1JGSA 1TC3C 2Y0MA 1VQ4I 3GTQJ 4XBFA 4DJAA 1AU7A 1MSFC 1A04A 5B3SH 2DK8A 5D6FA 5LD2C 4J00A 1FP1D 3EQLF 1APLC 3OYJA 3J7AO 1XCVA 3K4JA 2ELHA 3HRMA 1B6AA 1TTYA 1Y1VJ 3KP2A 1H88C 1QZEA 1X3ZB 2VT2A 1P9QC 2OCCH 2YPRA 2D1HA 4LIVA 3HJEA 4LK0F 3OYIA 5FLVA 3C1DA 4IF4A 2HKOA 1HCRA 3PO2J 1Z91A 2WY8Q 4DBRA 3WGGA 3GFIA 2ZMEA 3GEZA 3GTLJ 1FBQA 2HU9A 3LL7A 2NOGA 3SJMA 4DZPA 3I59A 5M5WJ 4C3IJ 2DYSH 3GBGA 1RR7A 2A69F 1PP8F 2G7HA 3DEWA 1R23A 2F4MB 3QWLA 3JTHA 4O3MA 3NARA 2NVUB 2VOOA 1EH8A 1ZGAA 4DIQA 4RB1A 2Q1ZB 3S1QJ 3DTIA 3HSEA 3Q9VA 1V4RA 2X6OA 2JN6A 3CDHA 2KMUA 4O6JA 1J5YA 2EFWA 4A3JJ 2VPLA 5E17F 1MBKA 3F8NA 3O8GA 2EB7A 2XF6A 4D9JA 3HBLA 3Q0VA 4YIFA 1FT9A 4BXFA 3O6BB 1RUNA 3A2KA 3SDGA 3E5XA 1D1BA 3M07A 3LA7A 2KIMA 3A01B 1FZPB 4XOPA 4E7IA 5TRDA 2R5ZB 4A3BJ 5L3EA 5GTIC 3TOAA 3Q5FA 5J8FA 2V9PA 2Z33A 2FQ4A 5K5QA 4F91B 2QA4I 2CQKA 4GO1A 3F6OA 2EK5A 4AIHA 2MGQA 4PUSA 3G4SI 3RDIA 4GDFA 3ZQLA 4IOCF 2IRFG 3PNTA 4BY1J 5IYCJ 5HDKA 2DA6A 1U5TA 2XRNA 2R0QC 2WBMA 3E6BA 2JA8J 1WPKA 2EWNA 3HZJA 4E4HA 2GXGA 2WADA 3EUKL 1SAUA 1EJ9A 3H0GJ 1W36D 1MBGA 2ZO4A 2FNPA 5DCMB 3VWBA 3CCLI 3FX3A 3GTJJ 3FK7A 4NB5A 5E1XA 4FISA 4A0XA 2TDXA 2XHKA 2AHQA 5LLQA 3BLYA 2EZHA 4N4OB 2DDAA 1ZGWA 4WXCA 3A03A 2BY0A 1R58A 3QP5A 3BZKA 2CQ7A 1U2WA 3IV5A 3LA2A 5FKNA 1Y56A 5LFAA 1X4OA 2FD5A 5M5XJ 3F22A 3HYIA 4RM2A 4HLYA 6PAXA 3OYMA 2VI6A 1K6YA 3G73A 3BG9A 3E6CC 1T0FA 4JQFA 4RLQA 1MIJA 4YIIA 4CSWA 1U0JA 2CJJA 2NVTJ 2PBIA 5E1WA 3F8FA 2F4OB 3NEUA 3Q0WA 3HM5A 5D5VB 4XLHA 1FLIA 2LY9A 3ZMVA 2DFHA 1MNMC 1JHFA 4A0ZA 2ELKA 2LBFB 3H1CA 4IRHA 1Y0UA 1D5VA 4PJNA 4U0WA 2O03A 2FJ1A 5E3LA 4EM0B 3RCOA 2RQPA 2L01A 1ETQA 1JUSA 2V1DA 5HS8A 4BU2A 3KEQA 1SD7A 2XB0X 4OIQF 5BOXA 1FEXA 4MTDA 2NS7A 1LUJB 4HA8A 3HDDA 4OIPF 5HNFA 4PJMA 3DKYA 4OAYA 5E79C 4A2UA 1JKPC 3OL4A 1VQLI 4ENNA 4HPQA 2E60A 4HG2A 3PQKA 3MD2A 3IH4A 4XLAA 1WZ2A 3HUGB 3BG3A 4I99C 3S1RJ 1HKTA 3CDIA 1EKEA 1IO2A 4LGWA 2MC4A 4WX9A 2EV5A 4IX7A 3KLNA 2DMUA 2JSCA 1MJAA 2NVQJ 5L3GA 3W6KB 1UELB 3BC8A 3FWEA 1P4WA 2LKPA 2DPDA 4E7HA 2BY3A 3GMEA 2H1LA 3AFHA 2CGPA 1ODDA 2MG4A 2UV1A 1W1WE 1BR4A 1E2XA 2BEOA 3RTRA 4ZYGA 4UB6C 2ZXHA 1LJ9A 2M30A 1K79A 2A61A 1RI7A 1HF0A 2XAGA 4UB8C 1ZTRA 1X1AA 3COAC 3RPUA 1MBHA 4B48A 3A1YA 2NXNB 3L2QA 5IP7J 2KJCA 3R0AA 2JPBA 4GRIA 1QPMA 4OWRB 4PJLA 2QBYA 4BBRJ 2K3FA 3KETA 2ZNZA 2QQBA 3IRRA 4KT6A 1D0ZA 3H92A 1L3LA 2FE3A 1W7PB 3IH2A 1Z0XA 2XSJC 4UVCA 4B09A 1MMDA 1Y1WJ 3W6JB 2R5YA 3CUQC 2HVQA 2E71A 2DOEA 2PMUA 3SEZA 2CYYA 1TZLA 2LH9A 2B9SA 4UY8I 2TCTA 3C7JA 3V8KA 4G7ZF 1OYWA 3ABTA 4DQ2A 1XMXA 3FXLA 1SFEA 3QOPA 1ETKA 4MNUA 3J80K 4HX4A 2DMPA 2HI3A 1DGRM 4C30A 1KONA 3DPTA 3N4MA 1ZGJA 1HW2A 4EJUA 2YUSA 4OIRF 4J19A 4MFEA 2QQ8A 2CSOA 2O0YA 2V1NA 3DV8A 2GZWA 1P6RA 2KKOA 3RKYA 1XDUA 1F1ZA 2HS5A 3KYDB 2VKVA 1UG2A 3PSFA 3CQZJ 2K4JA 4AD9A 2WV1A 4RB2C 2K27A 2NOJB 4L0YB 2ESHA 1XN7A 2F5EA 3OOPA 3BOQA 1GXQA 3ZXSA 4D5CA 1RKWA 1WJDA 4ZYHA 3TEDA 3EUHC 1SD6A 1SVLA 2XPWA 3FKIJ 3J80Z 1WJAA 2G7UA 3DWLE 1QVUA 4XLPF 2YR2A 1YJWI 2BOLA 1OCTC 2K9NA 4E7ZA 3MQ0A 2DBBA 3ZCOA 3E0JB 1GDTA 2JMWA 2STWA 1EF4A 1BR1A 2E5NA 2FA5A 3O3KA 3CC7I 3DP7A 2YX4A 3FXOA 1GXPA 2EZLA 4ZH4F 1QPIA 3ZQHA 3I58A 1X1CA 4JOMA 1QVTA 2WC2A 4RLFA 2DT7B 2IBDA 2XKPA 4FTHA 1XMKA 3TOBA 5K7ZA 3HXLA 3JTGA 2A5WA 1AA7A 3FXRA 3WG7H 1QZZA 3U1DA 1IRFA 1Z7LA 4YFKF 5HODA 2VPRA 2R7FA 3GX4X 2X9DA 5GAHJ 3KZYA 2LDUA 4LJZF 2Z5UA 4HDVA 3IWZA 1YITI 2LD5A 4BGDA 2HEOA 2ECCA 3ERMA 5KAIC 1J59A 1O4XA 1ZYRF 2M4GA 2HOAA 2R7WA 1NK2P 5FFXA 1S3JA 1J9IA 1WSUA 2CW8A 1YQAA 3H9JA 3I3LA 1QO0D 3GZ5A 1WRJA 4EV0A 3M7GA 1SMTA 4A93J 2ZMEB 4FE7A 1ZREA 4PSWA 3I59B 3D5SC 2KIUA 2ACJA 1AKHA 1MZBA 3ONQA 3CMEI 2KQRA 2XGXA 3MZ8A 2HQRA 2I8DA 1YG2A 1H0MA 3P9IA 3CMYA 2WY7Q 4CCJA 1JUMA 3LSKA 3DEEA 4II3A 1XGSA 2E1MC 3OYAA 1Z05A 1YOVB 3KYCB 2VJIA 3IKVA 3KP3A 2P4WA 4V19K 3BTJA 2KPMA 5B66C 1DGWY 3FMRA 1R5ID 1T33A 4RAYA 1LE8A 2K9MA 4HZFA 1QQIA 2LOOA 3ZMZA 4BHPA 3BG6A 4MHGA 4JX5A 2Y75A 2M2EA 5EZHA 2DW4A 4L5JA 2QLZA 4F93B 1I3QJ 3AG1H 3V4GA 2AXTC 3I5UA 1G59A 2FOKA 1I6HJ 5J47A 1BIBA 3ZQIA 4UUTA 3KP5A 3SFIA 1LEAA 4HOBA 5F0FA 1U5TB 1FYKA 1XG1A 4M9ZA 3DTKA 2G0EA 4KICA 3OYDA 3I55I 4CZZA 3NRVA 1G3SA 3K4BA 4FX0A 5DTDA 2AS5F 5CYVA 1B59A 3S8PA 3EPZA 3P5JA 3QQAA 4IXAA 4HNTA 3TO7A 2DI3A 3QPSA 1JUPA 3S14J 4C9YA 1VQ6I 1MD0A 1BI3A 1S6LA 4XQFA 4XRSA 5JI6A 5JFRA 5EF6A 2BYVE 2DODA 2W48A 3B73A 2IVMA 4OIOF 3M1EA 4KT5C 2KHMA 4KJZA 1ZQ3P 3P9KA 3BJAA 1IDZA 2OD5A 5FKLA 4B44A 1JJ6C 4O5VA 2PQ8A 1LVAA 3K10A 4EEFG 4CA0A 1YE9A 3KYLA 3S3NA 4DBQA 1LB2A 1O7FA 4Y4RA 1HLVA 2BVLA 3SXYA 1ONVA 1PP7U 3CJNA 3AL0B 4II2A 2LTPA 1B1BA 1YRNA 2DYRH 2FMYA 3L7WA 5GADJ 3WG9A 2XSDC 1TT0A 1ETWA 3LSHA 3OMYA 4BXXJ 3S1NJ 4KIFA 5EEGA 5GAGJ 2LC2A 1VZ0A 2EBIA 1TP4A 1OYIA 4XK4A 2PX9A 3BROA 4KN4X 3W3CA 4P96A 2CU7A 4B4CA 4A5MA 2R7RA 3RIRA 4D5FA 4CYCA 3CCEI 4M3GA 4TV7A 2L4MA 2B7EA 4RGUA 3HOVJ 3HB9A 4A69C 2AXLA 5K1YA 2H8RA 2LNBA 1Z21A 2EA2A 3O8HA 4F55A 3KP7A 3B6CA 1VQPI 3ZN0A 2HOSA 2K9SA 5LEJA 1H8AC 3WU0A 1GHCA 2DA1A 2K9LA 1PJRA 3CD6I 2M34A 3H3VK 1VQ7I 2N8GA 5BS6A 2OUMA 4BQQA 3I0TA 1XX5A 2DA4A 4YIRX 2MA3A 4L0ZB 1WI3A 3LSRA 2O3FA 4XKVA 3OYNA 1WQ2A 3I9V2 3IWFA 2LKXA 5CVIA 3HOUJ 1GV5A 5DD4A 3IC7A 2XASA 3GLXA 5J4YA 5HVQC 4CGZA 3MWMA 1N78A 2L9SA 5J40A 4AWXB 3H36A 1RESA 1HQCA 3DPUA 4XKBA 1IV8A 1R9TJ 3DU6A 1FMVA 2F5DA 4JP0A 1RC9A 3CUQA 3C2GA 5A2QK 1WCMJ 3PFYA 3V42A 1QU3A 2PJRA 5HNHA 4HAMA 2FRHA 3QPTA 1KA8A 2BBYA 4B47A 3WTVC 2DK5A 2K9QA 3ECOA 2KRHA 3WE3A 4HYEA 3TQNA 3A0BC 5K7HA 5D4RA 2V1UA 1MMNA 3BR6A 5ED4A 1DP7P 4I0BA 2ZCWA 2E36A 4U88A 1Z67A 2R7DA 3HIFA 2QBYB 3F8MA 1ZH5A 2GM4A 2ESNA 1TQMA 2P5LC 3BG7A 3WTTC 1REPC 3HGGA 3RYRA 1T6SA 5CLSA 4CZCA 4DYCA 4NQWA 2DXIA 3CJTB 3CCQI 3NQOA 2R5YB 3I53A 1YX3A 5FFZA 4FCYA 1HSJA 4HV5A 3DLLF 2IPQX 1R4MB 2FX0A 3CCRI 3TBIA 5A2QZ 2GA2A 1U9OA 3FISA 2RC4A 3QP6A 4Y52J 4PDKA 2VJJA 1KU9A 2WWYA 1B8IA 2GQQA 4A3EJ 4CHUA 1FOYA 4A3KJ 3E7LA 3CLOA 3EUHA 3IAS2 2JA6J 2RVCA 1G8XA 3FM5A 2O61A 4IRIA 4KITB 3M1CA 4H0EA 1I6XA 2W4SA 4EVIA 1UMQA 2M7AA 4EQQA 5C44J 1IN8A 3W2VA 1DP3A 3FK6A 5FB2A 4GYIA 3AKZA 1FOKA 3LQQA 3OIPA 1SD5A 3CJQB 4UHTA 4BHCA 2EILH 1IJWC 1VNDA 1W0UA 3CC2I 4AU7A 4A12A 5IOZA 2IS2A 2GOXB 3RPQA 1RZ4A 3EYIA 2WB1A 1HDPA 3JRCA 5J1RA 2XROA 2XVCA 4IO9F 2FSWA 1PUFA 1D0XA 5H20A 4AIKA 1EH7A 4GXOA 2R7SA 3SFZA 1IAWA 4ENJA 5FD5A 1SMYF 2E1CA 2CV2A 1KGSA 2V1XA 1OISA 1R4NB 2OTJI 2K85A 3LSGA 3RJPA 3QU6A 1P7JA 5GAEJ 3MEXA 4JK1X 2DU9A 2FQ3A 3JAMK 3K9TA 1XCBA 2F6CA 1D0YA 1Z77A 2IP2A 3I71A 1FOXA 1T8IA 4RB0A 2R7VA 4LOCA 3L2RA 1FIPA 2QKMB 1QA6A 4UNOA 3SZGA 1HSTA 5DM6F 2KRFA 3H5RA 2L9NA 4G9YA 1SC7A 1OCCH 1YW7A 2E35A 1ETYA 2GWRA 5F1JA 1USTA 2DAOA 4P9FA 2R7ZJ 2Y2ZA 4PZJA 4M3EA 4HF2A 5FD6A 4IHVA 5FROA 2V4JC 4Y15A 1I1SA 2VBXA 2K7LA 3JSOA 3TMOA 3JAMZ 4DW6A 3R60A 1R5GA 1AKHB 1RPWA 5DUIA 3VOEA 3I64A 3HPHA 5E8GA 2QGUA 3GLLA 5DYMA 2EZKA 5LEKA 4HNVA 3G2BA 3CCMI 2D1VA 3Q0UA 3HOSA 3E97A 1S29A 4C2UA 1BI0A 2L7FP 4QWQA 1GUUA 3SYTA 4HBLA 2DMTA 3FIWA 3VYSB 2P5VA 1FYLA 1FY7A 4HSRA 2HVSA 1LE8B 4MLOA 4KUMA 4LITA 2LLKA 3QYBA 4FE4A 2DOAA 1JT0A 4BJ5C 4P55A 3LMMA 1V55H 4G8XA 1ZG3A 2K5CA 4RM3A 4U87A 4RBOA 5ILUA 3MVPA 5F0CA 1WJEA 4AIJA 2KRCA 5JVTA 1K61A 1MBFA 3G1OA 1P4XA 2DOFA 5TISC 4RGSA 3DBLB 3IRQA 1R71A 1E3HA 1Z3XA 2RKHA 2MD0A 3JW4A 4G94A 1Z6TA 3D5LA 3AG3H 4C3JJ 1X4PA 4A3DJ 1R1TA 1UFMA 3UNGC 3SHFA 5EEAA 2EIMH 1WFXA 2VC0A 4G12A 3Q9SA 2E2JJ 2WB1N 4JX6A 4DYQA 5LHHA 1WJ5A 3VSLA 2PI0A 3U9GA 2UWMA 2KZGA 1S7EA 2R7OA 2WV0A 5FKKA 3PUBA 2ZXWH 5LGUA 1MMAA 1NTCA 4U7BA 2FOWA 2EIJH 3M3YJ 1TQPA 1TNTA 3L00A 5IPAA 1RNLA 2Q0OA 3VYTB 2DO7A 3ABMH 2QEXI 1F43A 3S16J 3OIOA 4ENMA 1NH3A 1I50J 1QHHD 3D0SA 3HHGA 2HTJA 4EJVA 1FX7A 4BY7J 2VOPA 1U8BA 3L2WA 3MMYB 1JTXA 4LB6B 1B72A 1FOWA 3GW2A 4IOAF 3F0CA 2K86A 2X0LA 1JE8A 2RNGA 5K5RA 4LD5A 3D5RC 4N9HA 3JCUC 1R49A 1MKMA 4LLGF 2CQNA 2H27A 4Q47A 2HQAA 5EZGA 2M0MA 4XKWA 1YRNB 1BBYA 1G4DA 4IQJA 5D5UB 3WTXC 3HRUA 2M3AA 2JTVA 2MSYA 1NG6A 1ETXA 1LDKB 5D5XB 4R79A 2LF8A 3HOZJ 2X1DA 1JKRC 2DT6A 5LGTA 5FO5A 1T08B 1X58A 3LSTA 4ETSA 2QSGX 4NBQA 2XIGA 1XB4A 2HTSA 2IA0A 2XAUA 3NWSA 5FGMA 1E3PA 1S8NA 4BYYA 5CVVA 4S04A 3OYGA 1Z3YA 1K6OA 1VF9A 1A31A 3H5AA 2X6XA 2BVMA 1LFUP 3GUDA 3RKWA 1I5ZA 4X1EA 5E3OA 4NC6A 3R0JA 3ZGKA 3NAUA 2MFZA 2XPVA 1I3AA 1UHSA 3DLAA 1MH3A 4RGXA 4LG0A 5D4SA 3L1PA 2BHZA 1TT5B 3OYLA 3IUOA 2QSFX 4M6XA 5DEQA 2DQRA 2QM3A 3PUFA 1VFCA 2EINH 2I5UA 3K0LA 2VQGA 5DV5A 3ULQB 2RNJA 3MFKA 2EZIA 3ABUA 2ID3A 3BG5A 5ILSA 1OYYA 2EFPA 1IZ1A 4YG2F 3G6EI 1O3SA 2IA2A 3BT9A 2P7VB 2PEXA 2A05A 2BXZA 4QIWN 3QAHA 3MZYA 4ZZLA 4WCGA 3FHZA 2OU2A 1KZHA 3A02A 1R5HA 2JA2A 2VKEA 2OJED
chains in the Genus database with same CATH topology
1R1UA 1P2FA 1FSHA 3CUQB 1QGPA 1K7AA 1IXSB 2CWEA 2B0LA 5K5OA 5AIQA 2UZKA 4KN7X 3P9CA 2UXXA 1O3QA 1SFXA 1HXDA 4OOIA 3WODF 2YSRA 4L9NA 4UVAA 3VEPA 4PGHA 1CF7A 2CO5A 3TKYA 2NAZA 1BJAA 1Z9CA 4KA4A 4LK1F 5E18F 2KJBA 2M5WA 5D5WB 4PGGA 4HDUA 3PFIA 3WE2A 4EJWA 3BPXA 2HKXA 2OBPA 3KE2A 4OU0A 3T5XA 3DQVC 4YFNF 1UCRA 5FLXK 4UXNA 3L09A 3IKTA 2FEZA 4KIGA 2NRAC 5DUKA 1PUEE 5TJJA 2P8TA 1IF1A 2VBYA 1YLFA 1XMAA 3REOA 4B8XA 2MC3A 1ZG5A 5CVUA 2P7CB 3LA3A 1FNNA 1KYWA 2ISYA 1FYMA 4UUVA 1V3FA 2W24A 4MGRA 1YYVA 3LFKA 4ESBA 1ZAOA 1YW8A 2ZXJA 2WTEA 4LB5A 2MH9A 5FLXZ 4P9UA 2DPUA 2COMA 5J8CA 1G3TA 2GXBA 5ICGA 2PMHA 1WWXA 3E3VA 1OMIA 3OV8A 4M74A 3HTUA 3AAFA 3HTSB 1DDNA 3G3ZA 2HGCA 2F2EA 4XLNF 4EGYA 1ZRFA 2FBKA 4M9SA 2RDPA 1DPRA 3K1NA 3LWFA 2EFOA 1XSVA 2JPCA 4RB3C 4MEXF 3KCCA 2DQLA 3ZMTA 4HF1A 5HOOA 3F8BA 2VT3A 4L9JA 1YFHA 3DEUA 1R7JA 4G6QA 4ESFA 1XD7A 3DKWA 4CYDA 2IJLA 2A6EF 4RAZA 4EJOA 3IL2A 4Q4ZF 1D8JA 1T39A 4WXHA 4QLCU 3L9FA 4WK8F 1D3YA 3V7RA 5E1ZB 3S2WA 4EM1A 2P6TA 5L3BA 2M45A 4IVNA 1LEBA 4L9VA 4PCQA 1MJ9A 1JXSA 5D6EA 4U0YA 4U7DA 1J2XA 2W84A 1D8KA 2ETHA 5D8KB 5E8IA 3U2RA 2ZJ2A 3WGHA 2QQAA 1RIOH 3R61A 4ON0A 1ON2A 3I54A 3ML6A 5ICFA 1YTYA 4EGZA 4KFCA 1USSA 4XSXF 2MH2A 4R1HA 1R22A 5KVRA 5ICCA 1K78A 1UHMA 5HLHA 4R8HA 5DCFA 2QUFA 2EV6A 1KU2A 3SZPA 4L5IA 1GVJA 4M71A 5ERIA 1FWZA 2QVOA 3C18A 3WTWC 2HR3A 3K69A 2ZBKA 3IHUA 1QNTA 1S7OA 1XGMA 4Y13A 4CO8A 1MGTA 4LG0B 1T38A 3FF5A 5BQTA 2A5YB 2BV6A 2NNNA 1ZARA 3ROUA 2C6YA 1B9MA 1KQ8A 3ZP5A 1TQIA 1O7LA 2QZ8A 2VE8A 4M72A 1U8RA 2FBIA 2D45A 4A6DA 1IN6A 4G6DA 3RYPA 2CG4A 1I1GA 1IW7F 3TO9A 3GVAA 5LRSA 3BDDA 2FF4A 2K4BA 3BPVA 4G7OF 3RKXA 3ZN1A 4EJTA 1ZHFA 3EETA 3HSFA 2IA1A 1CF7B 1VTNC 3VB2A 1SFUA 1WKMA 2H09A 2PFBA 3B02A 2V9VA 1ZRCA 3GZ6A 2EA4A 4LFUA 1R00A 2CFXA 2PLYA 3CTAA 2HZTA 1ZG1A 2LSOA 2EV0A 2IW5A 4IRGA 1ULYA 4M6YA 2GAUA 3LAJA 3FXQA 3ELKA 1OKRA 3RI4A 2JT1A 4OMZA 1QBJA 3DXJF 3P7NA 1G3YA 5F6FA 1JHHA 1TW2A 2X4HA 4N9IA 1LQ1A 2FNAA 2MLGA 4Y17A 3BP8A 4I0AA 2XAQA 2STTA 4U0VA 5HS9A 4L9TA 2L54A 1XDSA 3V7CA 4MQVA 2QQ9A 3ZMSA 4FX4A 1RUOA 1MDMA 4HLXA 4AVPA 3LQRA 4RS8A 5KK1A 2J5OA 3KEOA 2XAFA 4I7HA 1G6NA 2BGCA 5F64A 1FSEA 1P92A 1BI1A 1Q1HA 3GWZA 1Z7UA 1YIOA 1W5TA 3M8EA 2PJPA 1KQ0A 2YX7A 3HRTA 3TDUC 3E6MA 3GFLA 1IRGA 2MBFA 2CW0F 1CGPA 2ZFWA 3TO6A 2FMLA 3WU1B 2HYGD 4EM2A 1PDNC 2DLLA 2VN2A 4E70A 5JHUA 2RGVA 4A0YA 3BWGA 5D8LB 2OQRA 4ESJA 2RV8A 2OA4A 2NYXA 2XKOA 3FMQA 4GGGA 4F7ZA 3GO5A 1XGNA 2E1NA 2H6CA 2E7WA 2QWWA 1YO5C 2ZNYA 2UXNA 1ZN2A 2QYOA 3GXOA 2EJRA 1DUXC 1J0RA 4CDGA 4I2OA 1KQ9A 2XV4S 3KP6A 4IJAA 1STZA 3EDPA 3BJOA 2VBWA 5LHGA 3GF2A 5DD8A 2JZYA 3C3WA 4WF2A 2E7XA 1ZLJA 3MCZA 2EFQA 5L3FA 3CO7C 2VE9A 4UV9A 3LAPA 2DT5A 5HDNA 1G3WA 4KMUX 1ON1A 5DDGA 2IT0A 1TW3A 2W25A 1U78A 3F21A 4HQEA 1K78B 2VODA 1EH6A 4WWCA 3WTYC 2XAJA 3ISPA 2Y48A 5HLGA 2GA1A 4FHTA 3M9AA 2ISZA 3T8TA 4KIBA 3ZQ7A 1KYZA 4S05A 1Z1DA 4CICA 2L4AA 1YW9A 2FU4A 2RN7A 3N97A 3L2CA 3QU3A 1IN7A 4DNCA 1BN5A 5IT9K 4BH9A 2OZUA 2V6CA 2M8EA 1BOAA 4HX8A 1TBXA 2P6SA 3TDZC 3E5UA 1B9NA 3WTSC 2FBHA 3WGIA 3GYHX 2P5KA 2OQGA 3M8FA 2XAHA 2A68F 3ERED 3F8CA 4I02A 5IT9Z 1O57A 1FBUA 3QPHA 2A3SA 1E17A 4D0PA 3R4KA 5IT3A 3QRFF 1XSDA 3E5QA 4JBAA 3JSPA 4IHSA 4ZZDA 5BMZA 5CVRA 2VXZA 1YS7A 1X3UA 4HV6A 2MD5A 4I01A 5BPIA 3HOTA 3MAJA 4A5NA 4HF0A 4KDPA 2HFHA 2V79A 2G9WA 1FC3A 4KNYA 1QZYA 1BM9A 1BI2A 3FMSA 1J7KA 2BE5F 5LBQA 1I27A 3ZMUA 1FP2A 4OMYA 3DPLC 1B4AA 2HYFA 1U3EM 3BZ6A 2D2WA 4ZYDA 3K1MA 3ECHA 3O2PE 2O6GE 4LLLA 5H6QA 1IXRC 1OR7A 1F9NA 3CO6C 1TNSA 3T0YA 1MDMB 1YS6A 3V8JA 1UB9A 3KFWX 4RGRA 2OZ6A 2NS0A 5ILVA 4ZYEA 4LMYA 3BJ6A 3F72A 4K2EA 2L3DA 2ZKZA 1DPUA 2NNYA 2DFIA 3VODA 5CVJA 2Z9OA 4EMSA 5LGNA 3HHHA 3MZHA 1SAXA 2GIVA 5HLIA 2A6HF 1ZRDA 5EEHA 1O3RA 3H3ZA 1HKQA 1AWCA 2VC1A 4G7HF 5HDGA 2K02A 2HQNA 1T2KA 2HWVA 5DCMA 1BC8C 3R6SA 2F5CA 4I09A 4OINF 1L0OC 1UHWA 4FT8A 4MQ9F 1P4AA 2LF7A 2H94A 2KIFA 1U5TC 5AIPA 4BAYA 3KLOA 5JR3A 3KZZA 2M87A 4ASNA 3PQJA 2J5PA 4M73A 2H6BA 1FBSA 3ZPLA 3I4PA 3H3UA 5AONA 2MLKA 2EFNA 3FM3A 2DTRA 5LHIA 1W4MA 5CJ9A 4UVBA 3GFJA 4Q5SF 1XGOA 3V8LA 4L18B 3BY6A 4KYWA 4WXDA 1LDDA 3F3XA 2Q2EA 3F23A 4MEYF 3FXUA 5LRRA 1AOYA 3WTUC 1BIAA 1SD4A 3V7SA 4NHJA 1IN4A 1HKSA 3CUOA 1ZLKA 1HBXG 4XSZF 1T98A 5E20A 1U6GA 2FXAA 1HW1A 3HUGA 4CXFA 3F6VA 3J81K 4BXUA 4HW0A 2L02A 3HRSA 2ADUA 2Q8KA 3VFZA 2XUBA 4YFXF 4BNCA 1R1VA 1FPQA 3T1BA 3WTZA 1H9TA 4BHBA 4P5OA 3K1PA 1KU3A 1F4KA 1KU7A 3HSRA 1HW5A 5ICEA 2QENA 2F5FA 5J6XA 3E6DA 3T8RA 3J81Z 4ENKA 3ZMDA 2Z3YA 4KMFA 2M1BA 2A07F 1O3TA 1BC7C 1EV7A 2W57A 4GYGA 4A6EA 1Z6RA 4Q48A 1S7AA 1NHAA 2W85A 3SQNA 1J75A 1LDJA 1W7PA 2HDCA 3GFMA 1W5SA 3K2ZA 3SZTA 2Z99A 3KP4A 2O8XA 4BQAA 1WI9A 1LNWA 2HOEA 4XRFA 1C0WA 2OAZA 4N0BA 3DFGA 5H6RA 3DF8A 2PN6A 4LLNA 1OPCA 5L3CA 2R3SA 1W7PD 5BPDA 4Z2YA 1TLHB 2YU3A 5L3DA 4I98B 1R36A 4HQMA 3TGNA 4IHTA 2PG4A 3EYYA 2VONA 1IUYA 1F5TA 1IN5A 2JRTA 2VBZA 4UV8A 1MJBA 5HS7A 4IPAA 4M9XA 4HX7A 1IXCA 3FZVA 1XSXA 4MTEA 1H9GA 5F1RA 4GCVA 1JGSA 2Y0MA 4XBFA 1A04A 2DK8A 5D6FA 1FP1D 3EQLF 3J7AO 1XCVA 2ELHA 3HRMA 1B6AA 1TTYA 3KP2A 2VT2A 2YPRA 2D1HA 4LK0F 3C1DA 4IF4A 2HKOA 1Z91A 3GFIA 3WGGA 2ZMEA 3GEZA 1FBQA 3I59A 2A69F 1PP8F 2G7HA 1R23A 4O3MA 3JTHA 2VOOA 1EH8A 1ZGAA 4RB1A 3HSEA 3Q9VA 1V4RA 3CDHA 4O6JA 1J5YA 2EFWA 5E17F 3F8NA 2EB7A 4YIFA 1FT9A 3O6BB 1RUNA 3E5XA 1FZPB 3LA7A 2KIMA 5TRDA 5L3EA 3TOAA 3Q5FA 5J8FA 2Z33A 5K5QA 2CQKA 4GO1A 3F6OA 2EK5A 4AIHA 3RDIA 2IRFG 5HDKA 1U5TA 2XRNA 3E6BA 2EWNA 2GXGA 2ZO4A 2FNPA 5DCMB 3FX3A 4NB5A 5E1XA 4A0XA 2TDXA 2XHKA 5LLQA 4WXCA 1R58A 3QP5A 1U2WA 3LA2A 3F22A 3HYIA 4HLYA 6PAXA 3G73A 3E6CC 1T0FA 4JQFA 4YIIA 2PBIA 5E1WA 3F8FA 3NEUA 5D5VB 1FLIA 3ZMVA 1JHFA 4A0ZA 4IRHA 1Y0UA 1D5VA 4U0WA 2O03A 4EM0B 2RQPA 2L01A 2V1DA 5HS8A 3KEQA 1SD7A 4OIQF 5BOXA 4MTDA 4HA8A 4OIPF 4A2UA 4ENNA 3PQKA 1HKTA 4LGWA 4WX9A 2EV5A 3KLNA 2JSCA 1MJAA 5L3GA 3W6KB 3FWEA 1P4WA 2LKPA 2DPDA 2CGPA 1ODDA 1E2XA 2BEOA 3RTRA 4ZYGA 1LJ9A 2M30A 1K79A 2A61A 1RI7A 2XAGA 3COAC 3RPUA 2KJCA 3R0AA 2JPBA 1QPMA 2QBYA 3KETA 2ZNZA 2QQBA 3IRRA 3H92A 1L3LA 2FE3A 1W7PB 4UVCA 4B09A 3W6JB 3CUQC 2PMUA 2CYYA 3C7JA 3V8KA 4G7ZF 1OYWA 3ABTA 4DQ2A 1SFEA 3QOPA 4MNUA 3J80K 4HX4A 3DPTA 3N4MA 1ZGJA 1HW2A 4EJUA 4OIRF 2CSOA 2O0YA 3DV8A 2GZWA 1P6RA 2KKOA 3RKYA 1XDUA 1F1ZA 2HS5A 4AD9A 2K4JA 4RB2C 2K27A 4L0YB 2ESHA 1XN7A 2F5EA 3OOPA 3BOQA 1GXQA 4ZYHA 1SD6A 3J80Z 2G7UA 4XLPF 2YR2A 3MQ0A 2DBBA 2STWA 2FA5A 3O3KA 3DP7A 2YX4A 1GXPA 4ZH4F 3I58A 2WC2A 2XKPA 1XMKA 3TOBA 3JTGA 3FXRA 1QZZA 3U1DA 1IRFA 4YFKF 3GX4X 2R7FA 3KZYA 2LDUA 4HDVA 2Z5UA 4LJZF 3IWZA 2HEOA 1J59A 1ZYRF 5FFXA 1S3JA 1J9IA 1WSUA 1YQAA 1QO0D 3GZ5A 1WRJA 4EV0A 3M7GA 1SMTA 2ZMEB 1ZREA 3I59B 2KIUA 2ACJA 1MZBA 2XGXA 2HQRA 1YG2A 1H0MA 3P9IA 1XGSA 1Z05A 3IKVA 3KP3A 2P4WA 3FMRA 4RAYA 4HZFA 1QQIA 3ZMZA 4BHPA 4MHGA 2Y75A 2DW4A 4L5JA 2QLZA 3V4GA 3I5UA 2FOKA 1BIBA 3KP5A 1LEAA 4HOBA 1U5TB 1FYKA 4M9ZA 4KICA 4CZZA 3NRVA 1G3SA 4FX0A 2AS5F 5CYVA 1B59A 4IXAA 3TO7A 2DI3A 1MD0A 1BI3A 1S6LA 5JI6A 5JFRA 2BYVE 3B73A 2IVMA 4OIOF 3M1EA 4KT5C 3P9KA 3BJAA 2OD5A 4O5VA 2PQ8A 1LVAA 1LB2A 1O7FA 3SXYA 1ONVA 1PP7U 3CJNA 1B1BA 2FMYA 3L7WA 3WG9A 4KIFA 5EEGA 1OYIA 3BROA 4KN4X 4P96A 4A5MA 3RIRA 4TV7A 2L4MA 4RGUA 5K1YA 2AXLA 2LNBA 2EA2A 3KP7A 3ZN0A 5LEJA 3WU0A 1GHCA 5BS6A 3I0TA 2MA3A 4L0ZB 2O3FA 1WQ2A 3IWFA 5CVIA 5DD4A 3IC7A 2XASA 3GLXA 5HVQC 4CGZA 3MWMA 4AWXB 1HQCA 2F5DA 3CUQA 5A2QK 4HAMA 2FRHA 3QPTA 1KA8A 2BBYA 3WTVC 2DK5A 3ECOA 3WE3A 4HYEA 3TQNA 5D4RA 2V1UA 5ED4A 1DP7P 4I0BA 2ZCWA 4U88A 2R7DA 3HIFA 2QBYB 3F8MA 1ZH5A 2ESNA 1TQMA 2P5LC 3WTTC 1REPC 3RYRA 1T6SA 5CLSA 4NQWA 3NQOA 3I53A 5FFZA 1HSJA 4HV5A 2IPQX 5A2QZ 2GA2A 2RC4A 3QP6A 4PDKA 1KU9A 2WWYA 2GQQA 4CHUA 3CLOA 3EUHA 2RVCA 3FM5A 2O61A 4IRIA 4H0EA 1I6XA 4EVIA 4EQQA 1IN8A 5FB2A 4GYIA 1FOKA 3LQQA 1SD5A 4UHTA 4BHCA 4A12A 3RPQA 1RZ4A 3EYIA 2XROA 2XVCA 2FSWA 4AIKA 5H20A 1EH7A 4GXOA 3SFZA 1IAWA 4ENJA 5FD5A 1SMYF 2E1CA 1KGSA 2V1XA 3RJPA 3QU6A 3MEXA 4JK1X 2DU9A 2FQ3A 3JAMK 3K9TA 1XCBA 2IP2A 3I71A 4RB0A 4UNOA 1HSTA 2KRFA 4G9YA 1YW7A 2GWRA 1USTA 2DAOA 4P9FA 4PZJA 4HF2A 5FD6A 4Y15A 1I1SA 2VBXA 2K7LA 3JSOA 3JAMZ 3R60A 1R5GA 5DUIA 3VOEA 3I64A 5E8GA 5DYMA 5LEKA 2D1VA 3HOSA 3E97A 1S29A 1BI0A 4QWQA 4HBLA 2P5VA 1FYLA 1FY7A 4KUMA 4P55A 4G8XA 1ZG3A 5ILUA 4AIJA 5JVTA 1P4XA 4RGSA 3IRQA 2RKHA 3JW4A 4G94A 1Z6TA 3D5LA 1R1TA 1UFMA 3SHFA 2VC0A 3Q9SA 5LHHA 2PI0A 3U9GA 2UWMA 2WV0A 5LGUA 4U7BA 1TQPA 1TNTA 3L00A 1RNLA 2Q0OA 2DO7A 4ENMA 3D0SA 3HHGA 2HTJA 4EJVA 1FX7A 2VOPA 4LB6B 3GW2A 2K86A 2X0LA 1JE8A 5K5RA 4LD5A 4N9HA 1MKMA 4LLGF 2H27A 4Q47A 1BBYA 1G4DA 5D5UB 3WTXC 3HRUA 2JTVA 1LDKB 5D5XB 4R79A 2LF8A 5LGTA 5FO5A 4ETSA 3LSTA 2XIGA 1XB4A 2HTSA 2IA0A 5FGMA 4BYYA 4S04A 1S8NA 5CVVA 1K6OA 3GUDA 3RKWA 1I5ZA 3R0JA 4RGXA 4LG0A 5D4SA 4M6XA 5DEQA 2DQRA 2QM3A 3K0LA 3ULQB 5DV5A 3MFKA 2RNJA 3ABUA 5ILSA 1OYYA 2EFPA 1IZ1A 4YG2F 1O3SA 2IA2A 2P7VB 2PEXA 3QAHA 3MZYA 4ZZLA 4WCGA 3FHZA 2OU2A 1R5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1U A;  1P2F A;  1FSH A;  3CUQ B;  1QGP A;  1K7A A;  1IXS B;  2CWE A;  2B0L A;  5K5O A;  5AIQ A;  2UZK A;  4KN7 X;  3P9C A;  2UXX A;  1O3Q A;  1SFX A;  1HXD A;  4OOI A;  3WOD F;  2YSR A;  4L9N A;  4UVA A;  3VEP A;  4PGH A;  1CF7 A;  2CO5 A;  3TKY A;  2NAZ A;  1BJA A;  1Z9C A;  4KA4 A;  4LK1 F;  5E18 F;  2KJB A;  2M5W A;  5D5W B;  4PGG A;  4HDU A;  3PFI A;  3WE2 A;  4EJW A;  3BPX A;  2HKX A;  2OBP A;  3KE2 A;  4OU0 A;  3T5X A;  3DQV C;  4YFN F;  1UCR A;  5FLX K;  4UXN A;  3L09 A;  3IKT A;  2FEZ A;  4KIG A;  2NRA C;  5DUK A;  1PUE E;  5TJJ A;  2P8T A;  1IF1 A;  2VBY A;  1YLF A;  1XMA A;  3REO A;  4B8X A;  2MC3 A;  1ZG5 A;  5CVU A;  2P7C B;  3LA3 A;  1FNN A;  1KYW A;  2ISY A;  1FYM A;  4UUV A;  1V3F A;  2W24 A;  4MGR A;  1YYV A;  3LFK A;  4ESB A;  1ZAO A;  1YW8 A;  2ZXJ A;  2WTE A;  4LB5 A;  2MH9 A;  5FLX Z;  4P9U A;  2DPU A;  2COM A;  5J8C A;  1G3T A;  2GXB A;  5ICG A;  2PMH A;  1WWX A;  3E3V A;  1OMI A;  3OV8 A;  4M74 A;  3HTU A;  3AAF A;  3HTS B;  1DDN A;  3G3Z A;  2HGC A;  2F2E A;  4XLN F;  4EGY A;  1ZRF A;  2FBK A;  4M9S A;  2RDP A;  1DPR A;  3K1N A;  3LWF A;  2EFO A;  1XSV A;  2JPC A;  4RB3 C;  4MEX F;  3KCC A;  2DQL A;  3ZMT A;  4HF1 A;  5HOO A;  3F8B A;  2VT3 A;  4L9J A;  1YFH A;  3DEU A;  1R7J A;  4G6Q A;  4ESF A;  1XD7 A;  3DKW A;  4CYD A;  2IJL A;  2A6E F;  4RAZ A;  4EJO A;  3IL2 A;  4Q4Z F;  1D8J A;  1T39 A;  4WXH A;  4QLC U;  3L9F A;  4WK8 F;  1D3Y A;  3V7R A;  5E1Z B;  3S2W A;  4EM1 A;  2P6T A;  5L3B A;  2M45 A;  4IVN A;  1LEB A;  4L9V A;  4PCQ A;  1MJ9 A;  1JXS A;  5D6E A;  4U0Y A;  4U7D A;  1J2X A;  2W84 A;  1D8K A;  2ETH A;  5D8K B;  5E8I A;  3U2R A;  2ZJ2 A;  3WGH A;  2QQA A;  1RIO H;  3R61 A;  4ON0 A;  1ON2 A;  3I54 A;  3ML6 A;  5ICF A;  1YTY A;  4EGZ A;  4KFC A;  1USS A;  4XSX F;  2MH2 A;  4R1H A;  1R22 A;  5KVR A;  5ICC A;  1K78 A;  1UHM A;  5HLH A;  4R8H A;  5DCF A;  2QUF A;  2EV6 A;  1KU2 A;  3SZP A;  4L5I A;  1GVJ A;  4M71 A;  5ERI A;  1FWZ A;  2QVO A;  3C18 A;  3WTW C;  2HR3 A;  3K69 A;  2ZBK A;  3IHU A;  1QNT A;  1S7O A;  1XGM A;  4Y13 A;  4CO8 A;  1MGT A;  4LG0 B;  1T38 A;  3FF5 A;  5BQT A;  2A5Y B;  2BV6 A;  2NNN A;  1ZAR A;  3ROU A;  2C6Y A;  1B9M A;  1KQ8 A;  3ZP5 A;  1TQI A;  1O7L A;  2QZ8 A;  2VE8 A;  4M72 A;  1U8R A;  2FBI A;  2D45 A;  4A6D A;  1IN6 A;  4G6D A;  3RYP A;  2CG4 A;  1I1G A;  1IW7 F;  3TO9 A;  3GVA A;  5LRS A;  3BDD A;  2FF4 A;  2K4B A;  3BPV A;  4G7O F;  3RKX A;  3ZN1 A;  4EJT A;  1ZHF A;  3EET A;  3HSF A;  2IA1 A;  1CF7 B;  1VTN C;  3VB2 A;  1SFU A;  1WKM A;  2H09 A;  2PFB A;  3B02 A;  2V9V A;  1ZRC A;  3GZ6 A;  2EA4 A;  4LFU A;  1R00 A;  2CFX A;  2PLY A;  3CTA A;  2HZT A;  1ZG1 A;  2LSO A;  2EV0 A;  2IW5 A;  4IRG A;  1ULY A;  4M6Y A;  2GAU A;  3LAJ A;  3FXQ A;  3ELK A;  1OKR A;  3RI4 A;  2JT1 A;  4OMZ A;  1QBJ A;  3DXJ F;  3P7N A;  1G3Y A;  5F6F A;  1JHH A;  1TW2 A;  2X4H A;  4N9I A;  1LQ1 A;  2FNA A;  2MLG A;  4Y17 A;  3BP8 A;  4I0A A;  2XAQ A;  2STT A;  4U0V A;  5HS9 A;  4L9T A;  2L54 A;  1XDS A;  3V7C A;  4MQV A;  2QQ9 A;  3ZMS A;  4FX4 A;  1RUO A;  1MDM A;  4HLX A;  4AVP A;  3LQR A;  4RS8 A;  5KK1 A;  2J5O A;  3KEO A;  2XAF A;  4I7H A;  1G6N A;  2BGC A;  5F64 A;  1FSE A;  1P92 A;  1BI1 A;  1Q1H A;  3GWZ A;  1Z7U A;  1YIO A;  1W5T A;  3M8E A;  2PJP A;  1KQ0 A;  2YX7 A;  3HRT A;  3TDU C;  3E6M A;  3GFL A;  1IRG A;  2MBF A;  2CW0 F;  1CGP A;  2ZFW A;  3TO6 A;  2FML A;  3WU1 B;  2HYG D;  4EM2 A;  1PDN C;  2DLL A;  2VN2 A;  4E70 A;  5JHU A;  2RGV A;  4A0Y A;  3BWG A;  5D8L B;  2OQR A;  4ESJ A;  2RV8 A;  2OA4 A;  2NYX A;  2XKO A;  3FMQ A;  4GGG A;  4F7Z A;  3GO5 A;  1XGN A;  2E1N A;  2H6C A;  2E7W A;  2QWW A;  1YO5 C;  2ZNY A;  2UXN A;  1ZN2 A;  2QYO A;  3GXO A;  2EJR A;  1DUX C;  1J0R A;  4CDG A;  4I2O A;  1KQ9 A;  2XV4 S;  3KP6 A;  4IJA A;  1STZ A;  3EDP A;  3BJO A;  2VBW A;  5LHG A;  3GF2 A;  5DD8 A;  2JZY A;  3C3W A;  4WF2 A;  2E7X A;  1ZLJ A;  3MCZ A;  2EFQ A;  5L3F A;  3CO7 C;  2VE9 A;  4UV9 A;  3LAP A;  2DT5 A;  5HDN A;  1G3W A;  4KMU X;  1ON1 A;  5DDG A;  2IT0 A;  1TW3 A;  2W25 A;  1U78 A;  3F21 A;  4HQE A;  1K78 B;  2VOD A;  1EH6 A;  4WWC A;  3WTY C;  2XAJ A;  3ISP A;  2Y48 A;  5HLG A;  2GA1 A;  4FHT A;  3M9A A;  2ISZ A;  3T8T A;  4KIB A;  3ZQ7 A;  1KYZ A;  4S05 A;  1Z1D A;  4CIC A;  2L4A A;  1YW9 A;  2FU4 A;  2RN7 A;  3N97 A;  3L2C A;  3QU3 A;  1IN7 A;  4DNC A;  1BN5 A;  5IT9 K;  4BH9 A;  2OZU A;  2V6C A;  2M8E A;  1BOA A;  4HX8 A;  1TBX A;  2P6S A;  3TDZ C;  3E5U A;  1B9N A;  3WTS C;  2FBH A;  3WGI A;  3GYH X;  2P5K A;  2OQG A;  3M8F A;  2XAH A;  2A68 F;  3ERE D;  3F8C A;  4I02 A;  5IT9 Z;  1O57 A;  1FBU A;  3QPH A;  2A3S A;  1E17 A;  4D0P A;  3R4K A;  5IT3 A;  3QRF F;  1XSD A;  3E5Q A;  4JBA A;  3JSP A;  4IHS A;  4ZZD A;  5BMZ A;  5CVR A;  2VXZ A;  1YS7 A;  1X3U A;  4HV6 A;  2MD5 A;  4I01 A;  5BPI A;  3HOT A;  3MAJ A;  4A5N A;  4HF0 A;  4KDP A;  2HFH A;  2V79 A;  2G9W A;  1FC3 A;  4KNY A;  1QZY A;  1BM9 A;  1BI2 A;  3FMS A;  1J7K A;  2BE5 F;  5LBQ A;  1I27 A;  3ZMU A;  1FP2 A;  4OMY A;  3DPL C;  1B4A A;  2HYF A;  1U3E M;  3BZ6 A;  2D2W A;  4ZYD A;  3K1M A;  3ECH A;  3O2P E;  2O6G E;  4LLL A;  5H6Q A;  1IXR C;  1OR7 A;  1F9N A;  3CO6 C;  1TNS A;  3T0Y A;  1MDM B;  1YS6 A;  3V8J A;  1UB9 A;  3KFW X;  4RGR A;  2OZ6 A;  2NS0 A;  5ILV A;  4ZYE A;  4LMY A;  3BJ6 A;  3F72 A;  4K2E A;  2L3D A;  2ZKZ A;  1DPU A;  2NNY A;  2DFI A;  3VOD A;  5CVJ A;  2Z9O A;  4EMS A;  5LGN A;  3HHH A;  3MZH A;  1SAX A;  2GIV A;  5HLI A;  2A6H F;  1ZRD A;  5EEH A;  1O3R A;  3H3Z A;  1HKQ A;  1AWC A;  2VC1 A;  4G7H F;  5HDG A;  2K02 A;  2HQN A;  1T2K A;  2HWV A;  5DCM A;  1BC8 C;  3R6S A;  2F5C A;  4I09 A;  4OIN F;  1L0O C;  1UHW A;  4FT8 A;  4MQ9 F;  1P4A A;  2LF7 A;  2H94 A;  2KIF A;  1U5T C;  5AIP A;  4BAY A;  3KLO A;  5JR3 A;  3KZZ A;  2M87 A;  4ASN A;  3PQJ A;  2J5P A;  4M73 A;  2H6B A;  1FBS A;  3ZPL A;  3I4P A;  3H3U A;  5AON A;  2MLK A;  2EFN A;  3FM3 A;  2DTR A;  5LHI A;  1W4M A;  5CJ9 A;  4UVB A;  3GFJ A;  4Q5S F;  1XGO A;  3V8L A;  4L18 B;  3BY6 A;  4KYW A;  4WXD A;  1LDD A;  3F3X A;  2Q2E A;  3F23 A;  4MEY F;  3FXU A;  5LRR A;  1AOY A;  3WTU C;  1BIA A;  1SD4 A;  3V7S A;  4NHJ A;  1IN4 A;  1HKS A;  3CUO A;  1ZLK A;  1HBX G;  4XSZ F;  1T98 A;  5E20 A;  1U6G A;  2FXA A;  1HW1 A;  3HUG A;  4CXF A;  3F6V A;  3J81 K;  4BXU A;  4HW0 A;  2L02 A;  3HRS A;  2ADU A;  2Q8K A;  3VFZ A;  2XUB A;  4YFX F;  4BNC A;  1R1V A;  1FPQ A;  3T1B A;  3WTZ A;  1H9T A;  4BHB A;  4P5O A;  3K1P A;  1KU3 A;  1F4K A;  1KU7 A;  3HSR A;  1HW5 A;  5ICE A;  2QEN A;  2F5F A;  5J6X A;  3E6D A;  3T8R A;  3J81 Z;  4ENK A;  3ZMD A;  2Z3Y A;  4KMF A;  2M1B A;  2A07 F;  1O3T A;  1BC7 C;  1EV7 A;  2W57 A;  4GYG A;  4A6E A;  1Z6R A;  4Q48 A;  1S7A A;  1NHA A;  2W85 A;  3SQN A;  1J75 A;  1LDJ A;  1W7P A;  2HDC A;  3GFM A;  1W5S A;  3K2Z A;  3SZT A;  2Z99 A;  3KP4 A;  2O8X A;  4BQA A;  1WI9 A;  1LNW A;  2HOE A;  4XRF A;  1C0W A;  2OAZ A;  4N0B A;  3DFG A;  5H6R A;  3DF8 A;  2PN6 A;  4LLN A;  1OPC A;  5L3C A;  2R3S A;  1W7P D;  5BPD A;  4Z2Y A;  1TLH B;  2YU3 A;  5L3D A;  4I98 B;  1R36 A;  4HQM A;  3TGN A;  4IHT A;  2PG4 A;  3EYY A;  2VON A;  1IUY A;  1F5T A;  1IN5 A;  2JRT A;  2VBZ A;  4UV8 A;  1MJB A;  5HS7 A;  4IPA A;  4M9X A;  4HX7 A;  1IXC A;  3FZV A;  1XSX A;  4MTE A;  1H9G A;  5F1R A;  4GCV A;  1JGS A;  2Y0M A;  4XBF A;  1A04 A;  2DK8 A;  5D6F A;  1FP1 D;  3EQL F;  3J7A O;  1XCV A;  2ELH A;  3HRM A;  1B6A A;  1TTY A;  3KP2 A;  2VT2 A;  2YPR A;  2D1H A;  4LK0 F;  3C1D A;  4IF4 A;  2HKO A;  1Z91 A;  3GFI A;  3WGG A;  2ZME A;  3GEZ A;  1FBQ A;  3I59 A;  2A69 F;  1PP8 F;  2G7H A;  1R23 A;  4O3M A;  3JTH A;  2VOO A;  1EH8 A;  1ZGA A;  4RB1 A;  3HSE A;  3Q9V A;  1V4R A;  3CDH A;  4O6J A;  1J5Y A;  2EFW A;  5E17 F;  3F8N A;  2EB7 A;  4YIF A;  1FT9 A;  3O6B B;  1RUN A;  3E5X A;  1FZP B;  3LA7 A;  2KIM A;  5TRD A;  5L3E A;  3TOA A;  3Q5F A;  5J8F A;  2Z33 A;  5K5Q A;  2CQK A;  4GO1 A;  3F6O A;  2EK5 A;  4AIH A;  3RDI A;  2IRF G;  5HDK A;  1U5T A;  2XRN A;  3E6B A;  2EWN A;  2GXG A;  2ZO4 A;  2FNP A;  5DCM B;  3FX3 A;  4NB5 A;  5E1X A;  4A0X A;  2TDX A;  2XHK A;  5LLQ A;  4WXC A;  1R58 A;  3QP5 A;  1U2W A;  3LA2 A;  3F22 A;  3HYI A;  4HLY A;  6PAX A;  3G73 A;  3E6C C;  1T0F A;  4JQF A;  4YII A;  2PBI A;  5E1W A;  3F8F A;  3NEU A;  5D5V B;  1FLI A;  3ZMV A;  1JHF A;  4A0Z A;  4IRH A;  1Y0U A;  1D5V A;  4U0W A;  2O03 A;  4EM0 B;  2RQP A;  2L01 A;  2V1D A;  5HS8 A;  3KEQ A;  1SD7 A;  4OIQ F;  5BOX A;  4MTD A;  4HA8 A;  4OIP F;  4A2U A;  4ENN A;  3PQK A;  1HKT A;  4LGW A;  4WX9 A;  2EV5 A;  3KLN A;  2JSC A;  1MJA A;  5L3G A;  3W6K B;  3FWE A;  1P4W A;  2LKP A;  2DPD A;  2CGP A;  1ODD A;  1E2X A;  2BEO A;  3RTR A;  4ZYG A;  1LJ9 A;  2M30 A;  1K79 A;  2A61 A;  1RI7 A;  2XAG A;  3COA C;  3RPU A;  2KJC A;  3R0A A;  2JPB A;  1QPM A;  2QBY A;  3KET A;  2ZNZ A;  2QQB A;  3IRR A;  3H92 A;  1L3L A;  2FE3 A;  1W7P B;  4UVC A;  4B09 A;  3W6J B;  3CUQ C;  2PMU A;  2CYY A;  3C7J A;  3V8K A;  4G7Z F;  1OYW A;  3ABT A;  4DQ2 A;  1SFE A;  3QOP A;  4MNU A;  3J80 K;  4HX4 A;  3DPT A;  3N4M A;  1ZGJ A;  1HW2 A;  4EJU A;  4OIR F;  2CSO A;  2O0Y A;  3DV8 A;  2GZW A;  1P6R A;  2KKO A;  3RKY A;  1XDU A;  1F1Z A;  2HS5 A;  4AD9 A;  2K4J A;  4RB2 C;  2K27 A;  4L0Y B;  2ESH A;  1XN7 A;  2F5E A;  3OOP A;  3BOQ A;  1GXQ A;  4ZYH A;  1SD6 A;  3J80 Z;  2G7U A;  4XLP F;  2YR2 A;  3MQ0 A;  2DBB A;  2STW A;  2FA5 A;  3O3K A;  3DP7 A;  2YX4 A;  1GXP A;  4ZH4 F;  3I58 A;  2WC2 A;  2XKP A;  1XMK A;  3TOB A;  3JTG A;  3FXR A;  1QZZ A;  3U1D A;  1IRF A;  4YFK F;  3GX4 X;  2R7F A;  3KZY A;  2LDU A;  4HDV A;  2Z5U A;  4LJZ F;  3IWZ A;  2HEO A;  1J59 A;  1ZYR F;  5FFX A;  1S3J A;  1J9I A;  1WSU A;  1YQA A;  1QO0 D;  3GZ5 A;  1WRJ A;  4EV0 A;  3M7G A;  1SMT A;  2ZME B;  1ZRE A;  3I59 B;  2KIU A;  2ACJ A;  1MZB A;  2XGX A;  2HQR A;  1YG2 A;  1H0M A;  3P9I A;  1XGS A;  1Z05 A;  3IKV A;  3KP3 A;  2P4W A;  3FMR A;  4RAY A;  4HZF A;  1QQI A;  3ZMZ A;  4BHP A;  4MHG A;  2Y75 A;  2DW4 A;  4L5J A;  2QLZ A;  3V4G A;  3I5U A;  2FOK A;  1BIB A;  3KP5 A;  1LEA A;  4HOB A;  1U5T B;  1FYK A;  4M9Z A;  4KIC A;  4CZZ A;  3NRV A;  1G3S A;  4FX0 A;  2AS5 F;  5CYV A;  1B59 A;  4IXA A;  3TO7 A;  2DI3 A;  1MD0 A;  1BI3 A;  1S6L A;  5JI6 A;  5JFR A;  2BYV E;  3B73 A;  2IVM A;  4OIO F;  3M1E A;  4KT5 C;  3P9K A;  3BJA A;  2OD5 A;  4O5V A;  2PQ8 A;  1LVA A;  1LB2 A;  1O7F A;  3SXY A;  1ONV A;  1PP7 U;  3CJN A;  1B1B A;  2FMY A;  3L7W A;  3WG9 A;  4KIF A;  5EEG A;  1OYI A;  3BRO A;  4KN4 X;  4P96 A;  4A5M A;  3RIR A;  4TV7 A;  2L4M A;  4RGU A;  5K1Y A;  2AXL A;  2LNB A;  2EA2 A;  3KP7 A;  3ZN0 A;  5LEJ A;  3WU0 A;  1GHC A;  5BS6 A;  3I0T A;  2MA3 A;  4L0Z B;  2O3F A;  1WQ2 A;  3IWF A;  5CVI A;  5DD4 A;  3IC7 A;  2XAS A;  3GLX A;  5HVQ C;  4CGZ A;  3MWM A;  4AWX B;  1HQC A;  2F5D A;  3CUQ A;  5A2Q K;  4HAM A;  2FRH A;  3QPT A;  1KA8 A;  2BBY A;  3WTV C;  2DK5 A;  3ECO A;  3WE3 A;  4HYE A;  3TQN A;  5D4R A;  2V1U A;  5ED4 A;  1DP7 P;  4I0B A;  2ZCW A;  4U88 A;  2R7D A;  3HIF A;  2QBY B;  3F8M A;  1ZH5 A;  2ESN A;  1TQM A;  2P5L C;  3WTT C;  1REP C;  3RYR A;  1T6S A;  5CLS A;  4NQW A;  3NQO A;  3I53 A;  5FFZ A;  1HSJ A;  4HV5 A;  2IPQ X;  5A2Q Z;  2GA2 A;  2RC4 A;  3QP6 A;  4PDK A;  1KU9 A;  2WWY A;  2GQQ A;  4CHU A;  3CLO A;  3EUH A;  2RVC A;  3FM5 A;  2O61 A;  4IRI A;  4H0E A;  1I6X A;  4EVI A;  4EQQ A;  1IN8 A;  5FB2 A;  4GYI A;  1FOK A;  3LQQ A;  1SD5 A;  4UHT A;  4BHC A;  4A12 A;  3RPQ A;  1RZ4 A;  3EYI A;  2XRO A;  2XVC A;  2FSW A;  4AIK A;  5H20 A;  1EH7 A;  4GXO A;  3SFZ A;  1IAW A;  4ENJ A;  5FD5 A;  1SMY F;  2E1C A;  1KGS A;  2V1X A;  3RJP A;  3QU6 A;  3MEX A;  4JK1 X;  2DU9 A;  2FQ3 A;  3JAM K;  3K9T A;  1XCB A;  2IP2 A;  3I71 A;  4RB0 A;  4UNO A;  1HST A;  2KRF A;  4G9Y A;  1YW7 A;  2GWR A;  1UST A;  2DAO A;  4P9F A;  4PZJ A;  4HF2 A;  5FD6 A;  4Y15 A;  1I1S A;  2VBX A;  2K7L A;  3JSO A;  3JAM Z;  3R60 A;  1R5G A;  5DUI A;  3VOE A;  3I64 A;  5E8G A;  5DYM A;  5LEK A;  2D1V A;  3HOS A;  3E97 A;  1S29 A;  1BI0 A;  4QWQ A;  4HBL A;  2P5V A;  1FYL A;  1FY7 A;  4KUM A;  4P55 A;  4G8X A;  1ZG3 A;  5ILU A;  4AIJ A;  5JVT A;  1P4X A;  4RGS A;  3IRQ A;  2RKH A;  3JW4 A;  4G94 A;  1Z6T A;  3D5L A;  1R1T A;  1UFM A;  3SHF A;  2VC0 A;  3Q9S A;  5LHH A;  2PI0 A;  3U9G A;  2UWM A;  2WV0 A;  5LGU A;  4U7B A;  1TQP A;  1TNT A;  3L00 A;  1RNL A;  2Q0O A;  2DO7 A;  4ENM A;  3D0S A;  3HHG A;  2HTJ A;  4EJV A;  1FX7 A;  2VOP A;  4LB6 B;  3GW2 A;  2K86 A;  2X0L A;  1JE8 A;  5K5R A;  4LD5 A;  4N9H A;  1MKM A;  4LLG F;  2H27 A;  4Q47 A;  1BBY A;  1G4D A;  5D5U B;  3WTX C;  3HRU A;  2JTV A;  1LDK B;  5D5X B;  4R79 A;  2LF8 A;  5LGT A;  5FO5 A;  4ETS A;  3LST A;  2XIG A;  1XB4 A;  2HTS A;  2IA0 A;  5FGM A;  4BYY A;  4S04 A;  1S8N A;  5CVV A;  1K6O A;  3GUD A;  3RKW A;  1I5Z A;  3R0J A;  4RGX A;  4LG0 A;  5D4S A;  4M6X A;  5DEQ A;  2DQR A;  2QM3 A;  3K0L A;  3ULQ B;  5DV5 A;  3MFK A;  2RNJ A;  3ABU A;  5ILS A;  1OYY A;  2EFP A;  1IZ1 A;  4YG2 F;  1O3S A;  2IA2 A;  2P7V B;  2PEX A;  3QAH A;  3MZY A;  4ZZL A;  4WCG A;  3FHZ A;  2OU2 A;  1R5H A; 
#chains in the Genus database with same CATH topology
 1R1U A;  1P2F A;  4CH7 A;  1FSH A;  2NS8 A;  3CUQ B;  1QGP A;  3C2B A;  1K7A A;  1IXS B;  2PJR B;  4HNU A;  4D1Q A;  2LRE A;  2CWE A;  5CQE A;  2B0L A;  2EQR A;  5AIQ A;  5K5O A;  2UZK A;  4BKX A;  4KN7 X;  3P9C A;  4EAT A;  3HG9 A;  5IOY A;  2Y69 H;  2UXX A;  4PFP A;  3G1L A;  1O3Q A;  1SFX A;  4LG3 A;  1HXD A;  2E5Z A;  4M3B A;  4OOI A;  2R92 J;  2DA7 A;  3WOD F;  3PO3 J;  2YSR A;  4L9N A;  3BCB A;  4UVA A;  3VEP A;  2H1K A;  4PGH A;  1CF7 A;  2CO5 A;  3TKY A;  2NAZ A;  4AUX A;  4FET A;  1BJA A;  1PYV A;  1Z9C A;  2XF7 A;  2L7Z A;  4KA4 A;  4NQW B;  4LK1 F;  1SVO A;  2VJ4 A;  5C4J J;  2JUC A;  5E18 F;  2KJB A;  2M5W A;  2LP0 A;  2L0K A;  2VIX A;  5D5W B;  5IYB J;  1YJ9 I;  4PGG A;  4HDU A;  3PFI A;  3WE2 A;  1B8I B;  2DA5 A;  2VXD A;  4E6K G;  4EJW A;  3BPX A;  2HKX A;  2OBP A;  2W1O A;  3KE2 A;  4OU0 A;  1W5C C;  5M5Y J;  3T5X A;  3DQV C;  4YFN F;  1JKQ C;  1UCR A;  3M8J A;  5FLX K;  1A36 A;  4UXN A;  4A3C J;  1MNE A;  3L09 A;  3TW7 A;  3IKT A;  2FEZ A;  2L5Q A;  4KIG A;  3W2A A;  3JR9 A;  5EGO B;  5DUK A;  1PUE E;  2NRA C;  1BL0 A;  5GTH C;  5TJJ A;  2P8T A;  1IF1 A;  2VBY A;  1HDD C;  1YLF A;  1XMA A;  3FDY A;  3REO A;  4B8X A;  2W7N A;  4A3I J;  1SEU A;  5J3L A;  2MC3 A;  1ZG5 A;  4J01 A;  1YIJ I;  1RRJ A;  5J1U A;  5CVU A;  2P7C B;  3LA3 A;  1POG A;  1FNN A;  1KYW A;  2ISY A;  5CKT A;  3PSI A;  2XGC A;  1FYM A;  4Y33 A;  1V3F A;  2CQQ A;  2W24 A;  4MGR A;  1GLN A;  1YX5 A;  1YYV A;  2GOM A;  3LFK A;  4ESB A;  1ZAO A;  1YW8 A;  2ZXJ A;  2WTE A;  1BR2 A;  4LB5 A;  5J1Y A;  2MH9 A;  1PUF B;  5FLX Z;  3CCS I;  4P9U A;  2R7Q A;  2DPU A;  4XN0 A;  2VKD A;  2COM A;  5J8C A;  1LFB A;  3CP2 A;  1G3T A;  2GXB A;  5ICG A;  1LPQ A;  2W00 A;  2CUF A;  2ELJ A;  3M4O J;  2PMH A;  1WWX A;  2PMZ A;  2NVY J;  3G71 I;  3OYK A;  4CCK A;  5H2F C;  3E3V A;  1OMI A;  3OV8 A;  1MSE C;  4XRS G;  3ZQQ A;  4M74 A;  3U21 A;  3HTU A;  2IS6 A;  3AAF A;  3EUA A;  3HTS B;  3F9K A;  1OLT A;  1DDN A;  1X2M A;  3G3Z A;  2E1M B;  3GZN B;  2XC7 A;  3DBR B;  2HGC A;  1IRZ A;  2F2E A;  4XLN F;  2LFB A;  4EGY A;  3K6G A;  1ZRF A;  2FBK A;  4M9S A;  2RDP A;  1DPR A;  2VQC A;  3K1N A;  3VPR A;  3CCV I;  2KP6 A;  3OWT A;  3LWF A;  2EFO A;  4PSX A;  2M9H A;  1XSV A;  2JPC A;  4RB3 C;  2XRL A;  1RKT A;  1XTA A;  4MEX F;  3KCC A;  3LSM A;  2DQL A;  1VI0 A;  4G6T B;  3ZMT A;  4NC8 A;  5HOO A;  4HF1 A;  3F8B A;  2VT3 A;  4L9J A;  1YFH A;  2ZB9 A;  4QTR A;  3DEU A;  1R7J A;  4JX4 A;  4G6Q A;  2F5V A;  4ESF A;  2HPI A;  2KDZ A;  3JRD A;  3RZO J;  1XD7 A;  3DKW A;  3K7A J;  4CYD A;  4YRV A;  4F92 B;  3HKZ A;  2IJL A;  1JGG A;  1F36 A;  1DU6 A;  2A6E F;  4RAZ A;  4EJO A;  3IL2 A;  1WGX A;  4Q4Z F;  1D8J A;  4UUS A;  1T39 A;  4WXH A;  4QLC U;  1J09 A;  5JLX A;  3L9F A;  4CCM A;  2ME6 A;  4WK8 F;  4CCL A;  1D3Y A;  3V7R A;  1SFO J;  2JA5 J;  5E1Z B;  3S2W A;  4EM1 A;  1X1B A;  2P6T A;  5L3B A;  4BDY A;  2M45 A;  3I56 I;  4IVN A;  5TGT A;  5CPR B;  1LEB A;  2CUZ A;  4L9V A;  1NK3 P;  4PCQ A;  1MJ9 A;  3UKG A;  5D6E A;  1JXS A;  4U0Y A;  1MBJ A;  4U7D A;  1IDY A;  1J2X A;  4JYK A;  2EH3 A;  2W84 A;  4W97 A;  3LSP A;  1HA8 A;  1D8K A;  2ETH A;  5D8K B;  5E8I A;  3U2R A;  5FRN A;  1UAA A;  2LRD A;  3S3O A;  4ZYA A;  1BW6 A;  3IP4 B;  2HQ5 A;  3JRE A;  2XGE A;  3RQI A;  2ZJ2 A;  1VQ9 I;  3WGH A;  2QQA A;  1RIO H;  3R61 A;  4ON0 A;  1ON2 A;  4NC7 A;  5E3M A;  2DJI A;  3I54 A;  4AYB A;  2V26 A;  4XON A;  2OTL I;  2R7U A;  5EYR A;  2F48 A;  3ML6 A;  4YEJ A;  2AQF A;  5ICF A;  1YTY A;  2HDW A;  4EGZ A;  1B72 B;  1VQK I;  4BJ6 C;  2GBY A;  3AG4 H;  4KFC A;  2Z16 A;  1USS A;  3PIO F;  4XSX F;  3X2Q H;  2MH2 A;  2CV0 A;  4IQ4 A;  4R1H A;  1D5Y A;  2NVX J;  1R22 A;  4PJ0 C;  3CF5 F;  2LK2 A;  5KVR A;  1ENH A;  1DU0 A;  2X85 A;  5ICC A;  1K78 A;  2HXI A;  4AC0 A;  3ABL H;  1UHM A;  5HLH A;  4R8H A;  5DCF A;  3HGY A;  2JA7 J;  1IG7 A;  2QUF A;  2EV6 A;  1X19 A;  1P7I A;  3H35 A;  3IH3 A;  4BL0 B;  1KU2 A;  3W6V A;  4XLE A;  2D5V A;  1VQM I;  3UR3 C;  4BS9 A;  1EA3 A;  2R7X A;  3KEY A;  1S5L C;  2M8G X;  3SZP A;  5E3N A;  3S3M A;  4L5I A;  3FXM A;  1GVJ A;  4M71 A;  3OYF A;  3ASO H;  2IGN A;  1FWZ A;  2QVO A;  5ERI A;  2WAE A;  3C18 A;  3WTW C;  2HR3 A;  3K69 A;  2DJN A;  2ZBK A;  2ZSH B;  2COB A;  9ANT A;  5IY5 H;  1JTY A;  3HKZ N;  3IHU A;  4Y3O A;  3BR2 A;  1QNT A;  1S7O A;  1XGM A;  4Y13 A;  1A6I A;  4CO8 A;  2ECB A;  1MGT A;  4LG0 B;  1V5E A;  1T38 A;  3FF5 A;  5BQT A;  2A5Y B;  2HZD A;  5KHD A;  4X6A J;  1E0E A;  2BXY A;  2BV6 A;  4XMY A;  2NNN A;  2WA0 A;  3JRA A;  1ZAR A;  2A6T A;  3ROU A;  3CMM A;  2C6Y A;  1B9M A;  4ZJZ A;  4W1U A;  4IHW A;  4A3G J;  1KQ8 A;  3ZP5 A;  1OCR H;  2KZV A;  2Y31 A;  2O5R A;  3BZC A;  1TQI A;  1OJL A;  2QF7 A;  4XL9 A;  1O7L A;  1H89 C;  2QZ8 A;  2VE8 A;  4M72 A;  4AM3 A;  5EJC A;  1U8R A;  2FBI A;  2CRG A;  4QPQ A;  2JVH A;  4X0G A;  4A6D A;  2D45 A;  1WHU A;  3D1N I;  1IC8 A;  4F3Q A;  4HEA 2;  3DTE A;  3SEQ A;  1W0T A;  1IN6 A;  4G6D A;  3CP8 A;  3K4N A;  2X1E A;  3RYP A;  3HEF A;  3FHN A;  4C3H J;  3WU2 C;  2CG4 A;  1I1G A;  1IW7 F;  3TO9 A;  3GVA A;  5LRS A;  5M3M J;  3BDD A;  2FF4 A;  3OS1 A;  2K4B A;  3BPV A;  4QPO A;  2X1C A;  3S17 J;  4G7O F;  3RKX A;  3ZN1 A;  4EJT A;  5C4X J;  1ZR2 A;  3PNY A;  4NUB A;  1E3O C;  1ZHF A;  2QSH X;  2VQH A;  3EET A;  3HSF A;  3GTO J;  4AYB N;  5KNL A;  2IA1 A;  5FLM J;  1ZR4 A;  1CF7 B;  2DFF A;  1VTN C;  3VB2 A;  1MH4 A;  3OIQ A;  1SFU A;  4BQN A;  1WKM A;  2H09 A;  2PFB A;  3B02 A;  3BCA A;  4D7M A;  2V9V A;  4E7K A;  1ZRC A;  3GZ6 A;  5F0H A;  2EA4 A;  4LFU A;  5EGO A;  1R00 A;  2KLO A;  2R7T A;  2CFX A;  1MBE A;  2PLY A;  4BE1 A;  3CTA A;  1WJB A;  1VQO I;  3GTG J;  3TP3 A;  2HZT A;  3FKJ A;  1ZG1 A;  2LSO A;  2EV0 A;  2IW5 A;  4IRG A;  3S15 J;  1ULY A;  4M6Y A;  2GAU A;  2M4K A;  3LAJ A;  3FXQ A;  2X48 A;  3ELK A;  2YU9 J;  1OKR A;  4P1W A;  1V54 H;  3CLQ A;  3PM1 A;  1UZC A;  3RI4 A;  2JT1 A;  4OMZ A;  2ME0 A;  2CW7 A;  1QBJ A;  2AO9 A;  4BUP A;  2V7F A;  2XF5 A;  2ZJP F;  3CMA I;  1Y0N A;  4XRM A;  2BW3 A;  3BTL A;  3DXJ F;  3I4M J;  3G1M A;  1XPX A;  3P7N A;  3VSK A;  1K83 J;  3DBH B;  2CUE A;  3TW6 A;  1G3Y A;  2JRM A;  1JHH A;  2TRT A;  1TW2 A;  2X4H A;  4N9I A;  5F6F A;  5GPA A;  1LQ1 A;  2FUG 2;  1Q1V A;  2FNA A;  2MLG A;  4C2M J;  4Y17 A;  3BP8 A;  5EG0 A;  4I0A A;  2XAQ A;  2LG4 A;  4U0V A;  2STT A;  5HS9 A;  4L9T A;  2L54 A;  1XDS A;  3ABK H;  3V7C A;  4MQV A;  2CMP A;  2QQ9 A;  1A5J A;  3QYF A;  3ZMS A;  4FX4 A;  1RUO A;  3PL8 A;  2AQE A;  2BZT A;  1MDM A;  4HLX A;  4AVP A;  1MND A;  2DFE A;  3LQR A;  4RS8 A;  4XLC A;  2ZJQ F;  4CCO A;  5KK1 A;  2ZJR F;  2J5O A;  1X1P A;  3KEO A;  4NNJ A;  2LKS A;  3WHB A;  2XAF A;  3CF2 A;  2X6Y A;  4S0H B;  4I7H A;  1G6N A;  2KIQ A;  4XKC A;  2BGC A;  5F64 A;  1FSE A;  1XC5 A;  1P92 A;  4BAC A;  1BI1 A;  1Q1H A;  3GWZ A;  2JUG A;  5EDN A;  4OAZ A;  1Z7U A;  2WAQ A;  1YIO A;  2EPF A;  4H4K C;  1W5T A;  3M8E A;  2PJP A;  4ZC3 A;  1KQ0 A;  2YX7 A;  1OR7 C;  3HRT A;  3TDU C;  2K3P A;  2VL8 A;  3E6M A;  3GFL A;  1VQ5 I;  2L9R A;  3HPG A;  2L2O A;  1GT0 C;  4F52 A;  2DA3 A;  1IRG A;  2MBF A;  1Y8Q B;  2O7O A;  2W82 A;  1IV6 A;  1RR8 C;  2CW0 F;  2IS1 A;  4XNF A;  1CGP A;  2ZFW A;  3QPL A;  3CJR B;  3TO6 A;  2FML A;  3WU1 B;  2HYG D;  3QOE A;  4EM2 A;  1PDN C;  2DLL A;  5IYD J;  2IEK A;  2VN2 A;  4E70 A;  5JHU A;  2RGV A;  2R4G A;  2LY2 A;  1V5G A;  4LIU A;  3U1K A;  3FBI B;  4A0Y A;  3K4L A;  3PNV A;  2Y0S A;  2LMD A;  3BWG A;  3HL2 A;  4AVZ A;  3ASN H;  2OQR A;  3BTI A;  5D8L B;  4ESJ A;  2RV8 A;  2OA4 A;  2NYX A;  2E1O A;  2M0C A;  4M3F A;  4UUS B;  1N25 A;  2XKO A;  3FMQ A;  4GGG A;  4F7Z A;  3GO5 A;  1XGN A;  2XPU A;  2E1N A;  2H6C A;  2E7W A;  2QWW A;  3J7Y J;  2HVR A;  1YO5 C;  1LKX A;  2ZNY A;  2ICW G;  1BW5 A;  1ETO A;  1FIA A;  2DN0 A;  2UXN A;  4BE2 A;  1ZN2 A;  1HC8 A;  2KL4 A;  3VDX A;  4HRI A;  2QYO A;  3GXO A;  3GTK J;  2E34 A;  2EJR A;  1DUX C;  4BEH A;  3OL3 A;  1J0R A;  4CDG A;  2L7K A;  5GP9 A;  3K4M A;  1MMS A;  3H9Q A;  4I2O A;  1KQ9 A;  2XV4 S;  1D1C A;  3KP6 A;  4IJA A;  1STZ A;  3I4N J;  2V9K A;  1QHG A;  3EDP A;  3BJO A;  3B6A A;  2MW8 A;  2VBW A;  5LHG A;  3J7A Y;  1LFP A;  3OR1 C;  3GF2 A;  5DD8 A;  2JZY A;  3C3W A;  3H5N A;  2E7X A;  4WF2 A;  3ZQC A;  5KAF C;  1ZLJ A;  3MCZ A;  4DYR A;  2OV7 A;  2RAE A;  3CZ6 A;  4ZTJ A;  1X3W B;  2HYJ A;  2EFQ A;  5F04 A;  2ZSI B;  5L3F A;  3CO7 C;  2VE9 A;  3K70 C;  4UV9 A;  3K4C A;  3OSG A;  3LAP A;  2DT5 A;  5IP6 A;  5HDN A;  2DMQ A;  4BDZ A;  2E2H J;  1G3W A;  4KMU X;  3RZD J;  1ON1 A;  3ESW B;  3BR1 A;  5DDG A;  2IT0 A;  1TW3 A;  2WAQ N;  3ZRG A;  1YI2 I;  2W25 A;  2Q2E B;  3K4K A;  1U78 A;  3F21 A;  2KIS A;  1OFC X;  3JRF A;  4HQE A;  1K78 B;  4B1R A;  1MMG A;  3CDL A;  3L2U A;  1SVM A;  1ITY A;  4MIM A;  2VOD A;  1EH6 A;  3IAM 2;  4WWC A;  3WTY C;  2LYC A;  2XAJ A;  3ISP A;  3K2A A;  2HOT A;  2Y48 A;  1IRX A;  2MYS A;  2IXS A;  4M6V A;  5HLG A;  2GA1 A;  2H8W A;  4FHT A;  5HLT A;  3M9A A;  2ISZ A;  3H9G A;  1GVD A;  3ZR8 X;  3T8T A;  4KIB A;  1BJZ A;  3ZQ7 A;  1X1D A;  1TWC J;  1OQY A;  1KYZ A;  4ZDL A;  2OCE A;  4S05 A;  1VQN I;  2Y0S N;  1Z1D A;  3MN2 A;  4CIC A;  4MO7 A;  1R6R A;  2MAB A;  2L4A A;  1YW9 A;  2FU4 A;  2RN7 A;  3N97 A;  4M3D A;  4ANJ A;  3L2C A;  3QU3 A;  4ZDP A;  1IN7 A;  2V6E A;  4DNC A;  1Y8R B;  1IGN A;  1BN5 A;  2K40 A;  4AID A;  1ORK A;  5IT9 K;  4BH9 A;  2OZU A;  2V6C A;  4HST A;  2M8E A;  2VAS A;  1BOA A;  5BNG A;  1AHD P;  1FMW A;  4CYC B;  4HX8 A;  1TBX A;  2P6S A;  3TDZ C;  2GXA A;  4L5E A;  4Y7N J;  3E5U A;  4RDU A;  1B9N A;  3LOC A;  3WTS C;  2FBH A;  3WGI A;  3GYH X;  2P5K A;  2OQG A;  3M8F A;  2P0W A;  3GTM J;  4A3M J;  3RKQ A;  3KPH A;  2XAH A;  2A68 F;  3ERE D;  2L9V A;  3F8C A;  3WHC A;  3BR3 A;  4I02 A;  1HOM A;  3LSI A;  4IZZ A;  3S2H J;  2O9L A;  1K4T A;  5IT9 Z;  1QRY A;  3OYE A;  1O57 A;  1FBU A;  2RQQ A;  3OYB A;  3A4C A;  3QPH A;  2A3S A;  1TWA J;  2CH0 A;  2XGD A;  1E17 A;  4D0P A;  4IHX A;  3A0H C;  1WJF A;  3R4K A;  3RPU D;  1A35 A;  1N77 A;  5IT3 A;  3QRF F;  1XSD A;  3E5Q A;  4V2F A;  4A3F J;  4V2G A;  3PJR A;  1G2H A;  4JBA A;  3JSP A;  5KCM A;  2Y30 A;  4IHS A;  2OC6 A;  1FJL A;  5F27 A;  4ZZD A;  3BTC A;  1N75 A;  4FQG A;  5BMZ A;  2HXO A;  5CVR A;  2VXZ A;  1YS7 A;  2JK3 A;  1X3U A;  4HV6 A;  3FBN B;  2MD5 A;  3CCY A;  4B43 A;  4I01 A;  2CQX A;  4C2T A;  3JRG A;  1M1E B;  3AG2 H;  5BPI A;  4E7S A;  3HOT A;  3KIO A;  4ABZ A;  2JVG A;  3L2V A;  1ZEL A;  3MAJ A;  2LVS A;  1WJC A;  2BY1 A;  4A5N A;  1TWF J;  3OY9 A;  4HF0 A;  4KDP A;  2HFH A;  1ACI A;  2V79 A;  2G9W A;  1FC3 A;  4KNY A;  1WVR A;  1Y6I A;  1QZY A;  4XN3 A;  2HNH A;  1BM9 A;  4RAF A;  1BI2 A;  1OCZ H;  3H0D A;  3MKW B;  4QSH A;  4XIC A;  3FMS A;  2BW3 B;  1J7K A;  2BE5 F;  3BR5 A;  5LBQ A;  1I27 A;  3RSN A;  3ZMU A;  3DU5 A;  1FP2 A;  4OMY A;  5B5E C;  2O8K A;  4GFB A;  5CQG A;  3DPL C;  1B4A A;  2HYF A;  3DCF A;  1U3E M;  2IS4 A;  3BZ6 A;  2D2W A;  4IKF A;  1WH7 A;  1Y39 A;  3ZQG A;  4ZYD A;  4IHY A;  5EG0 B;  3K1M A;  3CES A;  3E1S A;  3HC7 A;  3ECH A;  3O2P E;  2O6G E;  1UG0 A;  5H6Q A;  4LLL A;  1OCP A;  4BQO A;  5DS9 A;  3S2D J;  1IXR C;  4XM3 A;  4DOZ A;  1OR7 A;  2DTZ A;  1F9N A;  2LR8 A;  1TNS A;  5JHF A;  3CO6 C;  3T0Y A;  1MDM B;  1YS6 A;  4XOR A;  3V8J A;  5IP9 J;  2JJ7 A;  1JJ8 C;  3BQZ A;  1UB9 A;  3DKX A;  3KFW X;  4RGR A;  2OZ6 A;  2NS0 A;  5ILV A;  4ZYE A;  2XDV A;  3VYU B;  2JQ7 A;  4LMY A;  3BJ6 A;  3F72 A;  1T56 A;  4K2E A;  5GPC A;  3ZOB A;  1DQU A;  2L3D A;  3KX2 A;  2ZKZ A;  2OF7 A;  1UJ8 A;  4CUG A;  4BJT A;  1PVE A;  3J7Z I;  4NDL A;  1DPU A;  2ZME C;  2CFO A;  2NNY A;  2DFI A;  3VOD A;  2QKL B;  3GTP J;  3A01 A;  2UUZ A;  5FRM A;  3OS0 A;  3N05 A;  5CVJ A;  2R5Z A;  2HPM A;  2Z9O A;  4EMS A;  2RRE A;  5LGN A;  3HHH A;  2X51 A;  1S72 I;  3MZH A;  1SAX A;  1ETV A;  2GIV A;  5HLI A;  3HOY J;  2EIK H;  3JRI A;  4KIS A;  2A6H F;  1RET A;  4RAG A;  1ZRD A;  4BE0 A;  5EEH A;  2L7M P;  1O3R A;  3BR0 A;  3PIP F;  2Z2S B;  1HKQ A;  3H3Z A;  1AWC A;  2VC1 A;  1WH5 A;  4G7H F;  1OCO H;  2DMN A;  2HQN A;  2K02 A;  5HDG A;  2IGK A;  4IEJ A;  1SAN A;  1T2K A;  1W36 C;  1SFK A;  2HWV A;  1BOB A;  5DCM A;  3CCU I;  1BC8 C;  2GIZ A;  2Z1D A;  4PJJ A;  3R6S A;  2F4I A;  5M3F J;  2F5C A;  4CCN A;  2BY2 A;  3LSJ A;  2WAF A;  4I09 A;  4OIN F;  2IAI A;  2XB5 A;  1L0O C;  1UHW A;  3NWT A;  4FT8 A;  4MQ9 F;  2VB6 A;  1P4A A;  2LF7 A;  2H94 A;  2KIF A;  4UUV A;  4ITV A;  3KZI C;  2KDO A;  3VYR B;  1U5T C;  5AIP A;  4BAY A;  3KLO A;  5JR3 A;  3KZZ A;  3Q3S A;  1LVK A;  2M87 A;  4ASN A;  4A3L J;  3PQJ A;  4PFO A;  2J5P A;  4M73 A;  4BEH B;  1S9H A;  5F08 A;  2E2I J;  2H6B A;  1FBS A;  3ZPL A;  3I4P A;  3H3U A;  5AON A;  2MLK A;  4FAS D;  2EFN A;  1YHQ I;  3C2H A;  2PMZ N;  3CCJ I;  5B1B H;  2ZXI A;  3S1M J;  1V5F A;  5JLW A;  3FM3 A;  2DTR A;  4XR6 A;  5LHI A;  1W4M A;  3HOW J;  2BHY A;  2LBF A;  3QYE A;  3OS2 A;  1ZK8 A;  5CJ9 A;  4UVB A;  3GFJ A;  4Q5S F;  1JKO C;  1I39 A;  1XGO A;  2DCE A;  5J4V A;  2IGO A;  5FKM A;  1YJN I;  3V8L A;  4L18 B;  3BY6 A;  2VKH A;  4D7N A;  4Z6Y A;  4KYW A;  4WXD A;  2KFD A;  1LDD A;  3F3X A;  3JRH A;  3ZQF A;  2Q2E A;  1T0F C;  1XS9 A;  3F23 A;  4MEY F;  1CQT A;  3OYC A;  3FXU A;  4IL6 C;  2P81 A;  1D1A A;  5LRR A;  3K70 D;  1AOY A;  3WTU C;  1BIA A;  2VLA A;  1SD4 A;  1NG7 A;  4RMN A;  3V7S A;  3RQ4 A;  3TP0 A;  2B63 J;  2YS9 A;  1X2N A;  3AL0 C;  4MFD A;  5FKO A;  2Y9Z A;  3HOX J;  4DZJ A;  4NHJ A;  2X6W A;  2KT0 A;  1IN4 A;  1HKS A;  3CUO A;  4B3X A;  4E7J A;  1ZLK A;  1HBX G;  3BQY A;  3MKL A;  4XSZ F;  1K4S A;  1T98 A;  5E20 A;  1ERD A;  1U6G A;  2FXA A;  1HW1 A;  2Y9Y A;  1JT6 A;  3HUG A;  4CXF A;  3F6V A;  2IGM A;  3J81 K;  2JSP A;  2QCO A;  4HW0 A;  4BXU A;  2L02 A;  3HRS A;  2ADU A;  1VQ8 I;  2Q8K A;  3VFZ A;  2XUB A;  4BBS J;  1U9N A;  4YFX F;  4BNC A;  1R1V A;  1FPQ A;  3MKZ A;  1BA5 A;  3T1B A;  3WTZ A;  1H9T A;  4BHB A;  2LY1 A;  4P5O A;  3K1P A;  1KU3 A;  1F4K A;  3S32 A;  1KU7 A;  4I76 A;  3HSR A;  2CUJ A;  4XLF A;  5DM7 F;  4ZTF A;  1HW5 A;  5ICE A;  2QEN A;  2F5F A;  5J6X A;  2I10 A;  3E6D A;  3T8R A;  4E7L A;  2DDB A;  3J81 Z;  2GLO A;  5K7F A;  4ENK A;  4PK4 A;  1A6Q A;  3ZMD A;  4I6Z A;  3OSF A;  2M7B A;  2Z3Y A;  4KMF A;  2M1B A;  5JVG F;  2A07 F;  3OR2 C;  1O3T A;  1BC7 C;  1EV7 A;  2W57 A;  5B1A H;  4XID A;  4GYG A;  3FXJ A;  4A6E A;  1Z6R A;  4Q48 A;  1S7A A;  1NHA A;  2W85 A;  3SQN A;  2HDD A;  2JWT A;  1LDJ A;  1TWG J;  1W7P A;  1J75 A;  2HDC A;  3GFM A;  1W5S A;  4YEL A;  1IUF A;  5FJ8 J;  3K2Z A;  3OOU A;  2E19 A;  3OYH A;  3SZT A;  4N4N B;  2Z99 A;  3LFU A;  3KP4 A;  2O8X A;  4BQA A;  2VQL A;  1T95 A;  1WI9 A;  2ID6 A;  4XOT A;  3W2W A;  1LNW A;  2HOE A;  1GV2 A;  4XRF A;  1C0W A;  4ZDO A;  2OAZ A;  1JI8 A;  3GCM A;  4N0B A;  3DFG A;  5H6R A;  3FXK A;  3DF8 A;  4RA2 A;  2PN6 A;  2CV1 A;  4DGW B;  4LLN A;  1OPC A;  5L3C A;  2R3S A;  2ZC2 A;  1W7P D;  5BPD A;  4Z2Y A;  3JRB A;  3SDB A;  1TLH B;  2YU3 A;  1TWH J;  5L3D A;  3CC4 I;  2VJ5 A;  3S93 A;  1TL8 A;  4I98 B;  3MKY B;  3TL4 X;  4B3A A;  1R36 A;  4HQM A;  3TGN A;  2ZFU A;  1FTZ A;  4IHT A;  3LNQ A;  2PG4 A;  2VUM J;  1MW7 A;  5C3E J;  3EYY A;  2VON A;  1IUY A;  1F5T A;  1IN5 A;  2JRT A;  2VBZ A;  4UV8 A;  1MJB A;  5HS7 A;  4IPA A;  3QOD A;  4M9X A;  1FTT A;  4HX7 A;  1IXC A;  1ZKG A;  3FZV A;  2OPT A;  1XSX A;  4MTE A;  2CS3 A;  1H9G A;  5F1R A;  2R93 J;  2DA2 A;  4GCV A;  1JGS A;  1TC3 C;  2Y0M A;  1VQ4 I;  3GTQ J;  4XBF A;  4DJA A;  1AU7 A;  1MSF C;  1A04 A;  5B3S H;  2DK8 A;  5D6F A;  5LD2 C;  4J00 A;  1FP1 D;  3EQL F;  1APL C;  3OYJ A;  3J7A O;  1XCV A;  3K4J A;  2ELH A;  3HRM A;  1B6A A;  1TTY A;  1Y1V J;  3KP2 A;  1H88 C;  1QZE A;  1X3Z B;  2VT2 A;  1P9Q C;  2OCC H;  2YPR A;  2D1H A;  4LIV A;  3HJE A;  4LK0 F;  3OYI A;  5FLV A;  3C1D A;  4IF4 A;  2HKO A;  1HCR A;  3PO2 J;  1Z91 A;  2WY8 Q;  4DBR A;  3WGG A;  3GFI A;  2ZME A;  3GEZ A;  3GTL J;  1FBQ A;  2HU9 A;  3LL7 A;  2NOG A;  3SJM A;  4DZP A;  3I59 A;  5M5W J;  4C3I J;  2DYS H;  3GBG A;  1RR7 A;  2A69 F;  1PP8 F;  2G7H A;  3DEW A;  1R23 A;  2F4M B;  3QWL A;  3JTH A;  4O3M A;  3NAR A;  2NVU B;  2VOO A;  1EH8 A;  1ZGA A;  4DIQ A;  4RB1 A;  2Q1Z B;  3S1Q J;  3DTI A;  3HSE A;  3Q9V A;  1V4R A;  2X6O A;  2JN6 A;  3CDH A;  2KMU A;  4O6J A;  1J5Y A;  2EFW A;  4A3J J;  2VPL A;  5E17 F;  1MBK A;  3F8N A;  3O8G A;  2EB7 A;  2XF6 A;  4D9J A;  3HBL A;  3Q0V A;  4YIF A;  1FT9 A;  4BXF A;  3O6B B;  1RUN A;  3A2K A;  3SDG A;  3E5X A;  1D1B A;  3M07 A;  3LA7 A;  2KIM A;  3A01 B;  1FZP B;  4XOP A;  4E7I A;  5TRD A;  2R5Z B;  4A3B J;  5L3E A;  5GTI C;  3TOA A;  3Q5F A;  5J8F A;  2V9P A;  2Z33 A;  2FQ4 A;  5K5Q A;  4F91 B;  2QA4 I;  2CQK A;  4GO1 A;  3F6O A;  2EK5 A;  4AIH A;  2MGQ A;  4PUS A;  3G4S I;  3RDI A;  4GDF A;  3ZQL A;  4IOC F;  2IRF G;  3PNT A;  4BY1 J;  5IYC J;  5HDK A;  2DA6 A;  1U5T A;  2XRN A;  2R0Q C;  2WBM A;  3E6B A;  2JA8 J;  1WPK A;  2EWN A;  3HZJ A;  4E4H A;  2GXG A;  2WAD A;  3EUK L;  1SAU A;  1EJ9 A;  3H0G J;  1W36 D;  1MBG A;  2ZO4 A;  2FNP A;  5DCM B;  3VWB A;  3CCL I;  3FX3 A;  3GTJ J;  3FK7 A;  4NB5 A;  5E1X A;  4FIS A;  4A0X A;  2TDX A;  2XHK A;  2AHQ A;  5LLQ A;  3BLY A;  2EZH A;  4N4O B;  2DDA A;  1ZGW A;  4WXC A;  3A03 A;  2BY0 A;  1R58 A;  3QP5 A;  3BZK A;  2CQ7 A;  1U2W A;  3IV5 A;  3LA2 A;  5FKN A;  1Y56 A;  5LFA A;  1X4O A;  2FD5 A;  5M5X J;  3F22 A;  3HYI A;  4RM2 A;  4HLY A;  6PAX A;  3OYM A;  2VI6 A;  1K6Y A;  3G73 A;  3BG9 A;  3E6C C;  1T0F A;  4JQF A;  4RLQ A;  1MIJ A;  4YII A;  4CSW A;  1U0J A;  2CJJ A;  2NVT J;  2PBI A;  5E1W A;  3F8F A;  2F4O B;  3NEU A;  3Q0W A;  3HM5 A;  5D5V B;  4XLH A;  1FLI A;  2LY9 A;  3ZMV A;  2DFH A;  1MNM C;  1JHF A;  4A0Z A;  2ELK A;  2LBF B;  3H1C A;  4IRH A;  1Y0U A;  1D5V A;  4PJN A;  4U0W A;  2O03 A;  2FJ1 A;  5E3L A;  4EM0 B;  3RCO A;  2RQP A;  2L01 A;  1ETQ A;  1JUS A;  2V1D A;  5HS8 A;  4BU2 A;  3KEQ A;  1SD7 A;  2XB0 X;  4OIQ F;  5BOX A;  1FEX A;  4MTD A;  2NS7 A;  1LUJ B;  4HA8 A;  3HDD A;  4OIP F;  5HNF A;  4PJM A;  3DKY A;  4OAY A;  5E79 C;  4A2U A;  1JKP C;  3OL4 A;  1VQL I;  4ENN A;  4HPQ A;  2E60 A;  4HG2 A;  3PQK A;  3MD2 A;  3IH4 A;  4XLA A;  1WZ2 A;  3HUG B;  3BG3 A;  4I99 C;  3S1R J;  1HKT A;  3CDI A;  1EKE A;  1IO2 A;  4LGW A;  2MC4 A;  4WX9 A;  2EV5 A;  4IX7 A;  3KLN A;  2DMU A;  2JSC A;  1MJA A;  2NVQ J;  5L3G A;  3W6K B;  1UEL B;  3BC8 A;  3FWE A;  1P4W A;  2LKP A;  2DPD A;  4E7H A;  2BY3 A;  3GME A;  2H1L A;  3AFH A;  2CGP A;  1ODD A;  2MG4 A;  2UV1 A;  1W1W E;  1BR4 A;  1E2X A;  2BEO A;  3RTR A;  4ZYG A;  4UB6 C;  2ZXH A;  1LJ9 A;  2M30 A;  1K79 A;  2A61 A;  1RI7 A;  1HF0 A;  2XAG A;  4UB8 C;  1ZTR A;  1X1A A;  3COA C;  3RPU A;  1MBH A;  4B48 A;  3A1Y A;  2NXN B;  3L2Q A;  5IP7 J;  2KJC A;  3R0A A;  2JPB A;  4GRI A;  1QPM A;  4OWR B;  4PJL A;  2QBY A;  4BBR J;  2K3F A;  3KET A;  2ZNZ A;  2QQB A;  3IRR A;  4KT6 A;  1D0Z A;  3H92 A;  1L3L A;  2FE3 A;  1W7P B;  3IH2 A;  1Z0X A;  2XSJ C;  4UVC A;  4B09 A;  1MMD A;  1Y1W J;  3W6J B;  2R5Y A;  3CUQ C;  2HVQ A;  2E71 A;  2DOE A;  2PMU A;  3SEZ A;  2CYY A;  1TZL A;  2LH9 A;  2B9S A;  4UY8 I;  2TCT A;  3C7J A;  3V8K A;  4G7Z F;  1OYW A;  3ABT A;  4DQ2 A;  1XMX A;  3FXL A;  1SFE A;  3QOP A;  1ETK A;  4MNU A;  3J80 K;  4HX4 A;  2DMP A;  2HI3 A;  1DGR M;  4C30 A;  1KON A;  3DPT A;  3N4M A;  1ZGJ A;  1HW2 A;  4EJU A;  2YUS A;  4OIR F;  4J19 A;  4MFE A;  2QQ8 A;  2CSO A;  2O0Y A;  2V1N A;  3DV8 A;  2GZW A;  1P6R A;  2KKO A;  3RKY A;  1XDU A;  1F1Z A;  2HS5 A;  3KYD B;  2VKV A;  1UG2 A;  3PSF A;  3CQZ J;  2K4J A;  4AD9 A;  2WV1 A;  4RB2 C;  2K27 A;  2NOJ B;  4L0Y B;  2ESH A;  1XN7 A;  2F5E A;  3OOP A;  3BOQ A;  1GXQ A;  3ZXS A;  4D5C A;  1RKW A;  1WJD A;  4ZYH A;  3TED A;  3EUH C;  1SD6 A;  1SVL A;  2XPW A;  3FKI J;  3J80 Z;  1WJA A;  2G7U A;  3DWL E;  1QVU A;  4XLP F;  2YR2 A;  1YJW I;  2BOL A;  1OCT C;  2K9N A;  4E7Z A;  3MQ0 A;  2DBB A;  3ZCO A;  3E0J B;  1GDT A;  2JMW A;  2STW A;  1EF4 A;  1BR1 A;  2E5N A;  2FA5 A;  3O3K A;  3CC7 I;  3DP7 A;  2YX4 A;  3FXO A;  1GXP A;  2EZL A;  4ZH4 F;  1QPI A;  3ZQH A;  3I58 A;  1X1C A;  4JOM A;  1QVT A;  2WC2 A;  4RLF A;  2DT7 B;  2IBD A;  2XKP A;  4FTH A;  1XMK A;  3TOB A;  5K7Z A;  3HXL A;  3JTG A;  2A5W A;  1AA7 A;  3FXR A;  3WG7 H;  1QZZ A;  3U1D A;  1IRF A;  1Z7L A;  4YFK F;  5HOD A;  2VPR A;  2R7F A;  3GX4 X;  2X9D A;  5GAH J;  3KZY A;  2LDU A;  4LJZ F;  2Z5U A;  4HDV A;  3IWZ A;  1YIT I;  2LD5 A;  4BGD A;  2HEO A;  2ECC A;  3ERM A;  5KAI C;  1J59 A;  1O4X A;  1ZYR F;  2M4G A;  2HOA A;  2R7W A;  1NK2 P;  5FFX A;  1S3J A;  1J9I A;  1WSU A;  2CW8 A;  1YQA A;  3H9J A;  3I3L A;  1QO0 D;  3GZ5 A;  1WRJ A;  4EV0 A;  3M7G A;  1SMT A;  4A93 J;  2ZME B;  4FE7 A;  1ZRE A;  4PSW A;  3I59 B;  3D5S C;  2KIU A;  2ACJ A;  1AKH A;  1MZB A;  3ONQ A;  3CME I;  2KQR A;  2XGX A;  3MZ8 A;  2HQR A;  2I8D A;  1YG2 A;  1H0M A;  3P9I A;  3CMY A;  2WY7 Q;  4CCJ A;  1JUM A;  3LSK A;  3DEE A;  4II3 A;  1XGS A;  2E1M C;  3OYA A;  1Z05 A;  1YOV B;  3KYC B;  2VJI A;  3IKV A;  3KP3 A;  2P4W A;  4V19 K;  3BTJ A;  2KPM A;  5B66 C;  1DGW Y;  3FMR A;  1R5I D;  1T33 A;  4RAY A;  1LE8 A;  2K9M A;  4HZF A;  1QQI A;  2LOO A;  3ZMZ A;  4BHP A;  3BG6 A;  4MHG A;  4JX5 A;  2Y75 A;  2M2E A;  5EZH A;  2DW4 A;  4L5J A;  2QLZ A;  4F93 B;  1I3Q J;  3AG1 H;  3V4G A;  2AXT C;  3I5U A;  1G59 A;  2FOK A;  1I6H J;  5J47 A;  1BIB A;  3ZQI A;  4UUT A;  3KP5 A;  3SFI A;  1LEA A;  4HOB A;  5F0F A;  1U5T B;  1FYK A;  1XG1 A;  4M9Z A;  3DTK A;  2G0E A;  4KIC A;  3OYD A;  3I55 I;  4CZZ A;  3NRV A;  1G3S A;  3K4B A;  4FX0 A;  5DTD A;  2AS5 F;  5CYV A;  1B59 A;  3S8P A;  3EPZ A;  3P5J A;  3QQA A;  4IXA A;  4HNT A;  3TO7 A;  2DI3 A;  3QPS A;  1JUP A;  3S14 J;  4C9Y A;  1VQ6 I;  1MD0 A;  1BI3 A;  1S6L A;  4XQF A;  4XRS A;  5JI6 A;  5JFR A;  5EF6 A;  2BYV E;  2DOD A;  2W48 A;  3B73 A;  2IVM A;  4OIO F;  3M1E A;  4KT5 C;  2KHM A;  4KJZ A;  1ZQ3 P;  3P9K A;  3BJA A;  1IDZ A;  2OD5 A;  5FKL A;  4B44 A;  1JJ6 C;  4O5V A;  2PQ8 A;  1LVA A;  3K10 A;  4EEF G;  4CA0 A;  1YE9 A;  3KYL A;  3S3N A;  4DBQ A;  1LB2 A;  1O7F A;  4Y4R A;  1HLV A;  2BVL A;  3SXY A;  1ONV A;  1PP7 U;  3CJN A;  3AL0 B;  4II2 A;  2LTP A;  1B1B A;  1YRN A;  2DYR H;  2FMY A;  3L7W A;  5GAD J;  3WG9 A;  2XSD C;  1TT0 A;  1ETW A;  3LSH A;  3OMY A;  4BXX J;  3S1N J;  4KIF A;  5EEG A;  5GAG J;  2LC2 A;  1VZ0 A;  2EBI A;  1TP4 A;  1OYI A;  4XK4 A;  2PX9 A;  3BRO A;  4KN4 X;  3W3C A;  4P96 A;  2CU7 A;  4B4C A;  4A5M A;  2R7R A;  3RIR A;  4D5F A;  4CYC A;  3CCE I;  4M3G A;  4TV7 A;  2L4M A;  2B7E A;  4RGU A;  3HOV J;  3HB9 A;  4A69 C;  2AXL A;  5K1Y A;  2H8R A;  2LNB A;  1Z21 A;  2EA2 A;  3O8H A;  4F55 A;  3KP7 A;  3B6C A;  1VQP I;  3ZN0 A;  2HOS A;  2K9S A;  5LEJ A;  1H8A C;  3WU0 A;  1GHC A;  2DA1 A;  2K9L A;  1PJR A;  3CD6 I;  2M34 A;  3H3V K;  1VQ7 I;  2N8G A;  5BS6 A;  2OUM A;  4BQQ A;  3I0T A;  1XX5 A;  2DA4 A;  4YIR X;  2MA3 A;  4L0Z B;  1WI3 A;  3LSR A;  2O3F A;  4XKV A;  3OYN A;  1WQ2 A;  3I9V 2;  3IWF A;  2LKX A;  5CVI A;  3HOU J;  1GV5 A;  5DD4 A;  3IC7 A;  2XAS A;  3GLX A;  5J4Y A;  5HVQ C;  4CGZ A;  3MWM A;  1N78 A;  2L9S A;  5J40 A;  4AWX B;  3H36 A;  1RES A;  1HQC A;  3DPU A;  4XKB A;  1IV8 A;  1R9T J;  3DU6 A;  1FMV A;  2F5D A;  4JP0 A;  1RC9 A;  3CUQ A;  3C2G A;  5A2Q K;  1WCM J;  3PFY A;  3V42 A;  1QU3 A;  2PJR A;  5HNH A;  4HAM A;  2FRH A;  3QPT A;  1KA8 A;  2BBY A;  4B47 A;  3WTV C;  2DK5 A;  2K9Q A;  3ECO A;  2KRH A;  3WE3 A;  4HYE A;  3TQN A;  3A0B C;  5K7H A;  5D4R A;  2V1U A;  1MMN A;  3BR6 A;  5ED4 A;  1DP7 P;  4I0B A;  2ZCW A;  2E36 A;  4U88 A;  1Z67 A;  2R7D A;  3HIF A;  2QBY B;  3F8M A;  1ZH5 A;  2GM4 A;  2ESN A;  1TQM A;  2P5L C;  3BG7 A;  3WTT C;  1REP C;  3HGG A;  3RYR A;  1T6S A;  5CLS A;  4CZC A;  4DYC A;  4NQW A;  2DXI A;  3CJT B;  3CCQ I;  3NQO A;  2R5Y B;  3I53 A;  1YX3 A;  5FFZ A;  4FCY A;  1HSJ A;  4HV5 A;  3DLL F;  2IPQ X;  1R4M B;  2FX0 A;  3CCR I;  3TBI A;  5A2Q Z;  2GA2 A;  1U9O A;  3FIS A;  2RC4 A;  3QP6 A;  4Y52 J;  4PDK A;  2VJJ A;  1KU9 A;  2WWY A;  1B8I A;  2GQQ A;  4A3E J;  4CHU A;  1FOY A;  4A3K J;  3E7L A;  3CLO A;  3EUH A;  3IAS 2;  2JA6 J;  2RVC A;  1G8X A;  3FM5 A;  2O61 A;  4IRI A;  4KIT B;  3M1C A;  4H0E A;  1I6X A;  2W4S A;  4EVI A;  1UMQ A;  2M7A A;  4EQQ A;  5C44 J;  1IN8 A;  3W2V A;  1DP3 A;  3FK6 A;  5FB2 A;  4GYI A;  3AKZ A;  1FOK A;  3LQQ A;  3OIP A;  1SD5 A;  3CJQ B;  4UHT A;  4BHC A;  2EIL H;  1IJW C;  1VND A;  1W0U A;  3CC2 I;  4AU7 A;  4A12 A;  5IOZ A;  2IS2 A;  2GOX B;  3RPQ A;  1RZ4 A;  3EYI A;  2WB1 A;  1HDP A;  3JRC A;  5J1R A;  2XRO A;  2XVC A;  4IO9 F;  2FSW A;  1PUF A;  1D0X A;  5H20 A;  4AIK A;  1EH7 A;  4GXO A;  2R7S A;  3SFZ A;  1IAW A;  4ENJ A;  5FD5 A;  1SMY F;  2E1C A;  2CV2 A;  1KGS A;  2V1X A;  1OIS A;  1R4N B;  2OTJ I;  2K85 A;  3LSG A;  3RJP A;  3QU6 A;  1P7J A;  5GAE J;  3MEX A;  4JK1 X;  2DU9 A;  2FQ3 A;  3JAM K;  3K9T A;  1XCB A;  2F6C A;  1D0Y A;  1Z77 A;  2IP2 A;  3I71 A;  1FOX A;  1T8I A;  4RB0 A;  2R7V A;  4LOC A;  3L2R A;  1FIP A;  2QKM B;  1QA6 A;  4UNO A;  3SZG A;  1HST A;  5DM6 F;  2KRF A;  3H5R A;  2L9N A;  4G9Y A;  1SC7 A;  1OCC H;  1YW7 A;  2E35 A;  1ETY A;  2GWR A;  5F1J A;  1UST A;  2DAO A;  4P9F A;  2R7Z J;  2Y2Z A;  4PZJ A;  4M3E A;  4HF2 A;  5FD6 A;  4IHV A;  5FRO A;  2V4J C;  4Y15 A;  1I1S A;  2VBX A;  2K7L A;  3JSO A;  3TMO A;  3JAM Z;  4DW6 A;  3R60 A;  1R5G A;  1AKH B;  1RPW A;  5DUI A;  3VOE A;  3I64 A;  3HPH A;  5E8G A;  2QGU A;  3GLL A;  5DYM A;  2EZK A;  5LEK A;  4HNV A;  3G2B A;  3CCM I;  2D1V A;  3Q0U A;  3HOS A;  3E97 A;  1S29 A;  4C2U A;  1BI0 A;  2L7F P;  4QWQ A;  1GUU A;  3SYT A;  4HBL A;  2DMT A;  3FIW A;  3VYS B;  2P5V A;  1FYL A;  1FY7 A;  4HSR A;  2HVS A;  1LE8 B;  4MLO A;  4KUM A;  4LIT A;  2LLK A;  3QYB A;  4FE4 A;  2DOA A;  1JT0 A;  4BJ5 C;  4P55 A;  3LMM A;  1V55 H;  4G8X A;  1ZG3 A;  2K5C A;  4RM3 A;  4U87 A;  4RBO A;  5ILU A;  3MVP A;  5F0C A;  1WJE A;  4AIJ A;  2KRC A;  5JVT A;  1K61 A;  1MBF A;  3G1O A;  1P4X A;  2DOF A;  5TIS C;  4RGS A;  3DBL B;  3IRQ A;  1R71 A;  1E3H A;  1Z3X A;  2RKH A;  2MD0 A;  3JW4 A;  4G94 A;  1Z6T A;  3D5L A;  3AG3 H;  4C3J J;  1X4P A;  4A3D J;  1R1T A;  1UFM A;  3UNG C;  3SHF A;  5EEA A;  2EIM H;  1WFX A;  2VC0 A;  4G12 A;  3Q9S A;  2E2J J;  2WB1 N;  4JX6 A;  4DYQ A;  5LHH A;  1WJ5 A;  3VSL A;  2PI0 A;  3U9G A;  2UWM A;  2KZG A;  1S7E A;  2R7O A;  2WV0 A;  5FKK A;  3PUB A;  2ZXW H;  5LGU A;  1MMA A;  1NTC A;  4U7B A;  2FOW A;  2EIJ H;  3M3Y J;  1TQP A;  1TNT A;  3L00 A;  5IPA A;  1RNL A;  2Q0O A;  3VYT B;  2DO7 A;  3ABM H;  2QEX I;  1F43 A;  3S16 J;  3OIO A;  4ENM A;  1NH3 A;  1I50 J;  1QHH D;  3D0S A;  3HHG A;  2HTJ A;  4EJV A;  1FX7 A;  4BY7 J;  2VOP A;  1U8B A;  3L2W A;  3MMY B;  1JTX A;  4LB6 B;  1B72 A;  1FOW A;  3GW2 A;  4IOA F;  3F0C A;  2K86 A;  2X0L A;  1JE8 A;  2RNG A;  5K5R A;  4LD5 A;  3D5R C;  4N9H A;  3JCU C;  1R49 A;  1MKM A;  4LLG F;  2CQN A;  2H27 A;  4Q47 A;  2HQA A;  5EZG A;  2M0M A;  4XKW A;  1YRN B;  1BBY A;  1G4D A;  4IQJ A;  5D5U B;  3WTX C;  3HRU A;  2M3A A;  2JTV A;  2MSY A;  1NG6 A;  1ETX A;  1LDK B;  5D5X B;  4R79 A;  2LF8 A;  3HOZ J;  2X1D A;  1JKR C;  2DT6 A;  5LGT A;  5FO5 A;  1T08 B;  1X58 A;  3LST A;  4ETS A;  2QSG X;  4NBQ A;  2XIG A;  1XB4 A;  2HTS A;  2IA0 A;  2XAU A;  3NWS A;  5FGM A;  1E3P A;  1S8N A;  4BYY A;  5CVV A;  4S04 A;  3OYG A;  1Z3Y A;  1K6O A;  1VF9 A;  1A31 A;  3H5A A;  2X6X A;  2BVM A;  1LFU P;  3GUD A;  3RKW A;  1I5Z A;  4X1E A;  5E3O A;  4NC6 A;  3R0J A;  3ZGK A;  3NAU A;  2MFZ A;  2XPV A;  1I3A A;  1UHS A;  3DLA A;  1MH3 A;  4RGX A;  4LG0 A;  5D4S A;  3L1P A;  2BHZ A;  1TT5 B;  3OYL A;  3IUO A;  2QSF X;  4M6X A;  5DEQ A;  2DQR A;  2QM3 A;  3PUF A;  1VFC A;  2EIN H;  2I5U A;  3K0L A;  2VQG A;  5DV5 A;  3ULQ B;  2RNJ A;  3MFK A;  2EZI A;  3ABU A;  2ID3 A;  3BG5 A;  5ILS A;  1OYY A;  2EFP A;  1IZ1 A;  4YG2 F;  3G6E I;  1O3S A;  2IA2 A;  3BT9 A;  2P7V B;  2PEX A;  2A05 A;  2BXZ A;  4QIW N;  3QAH A;  3MZY A;  4ZZL A;  4WCG A;  3FHZ A;  2OU2 A;  1KZH A;  3A02 A;  1R5H A;  2JA2 A;  2VKE A;  2OJE D; 
#chains in the Genus database with same CATH homology
 1R1U A;  1P2F A;  1FSH A;  3CUQ B;  1QGP A;  1K7A A;  1IXS B;  2CWE A;  2B0L A;  5K5O A;  5AIQ A;  2UZK A;  4KN7 X;  3P9C A;  2UXX A;  1O3Q A;  1SFX A;  1HXD A;  4OOI A;  3WOD F;  2YSR A;  4L9N A;  4UVA A;  3VEP A;  4PGH A;  1CF7 A;  2CO5 A;  3TKY A;  2NAZ A;  1BJA A;  1Z9C A;  4KA4 A;  4LK1 F;  5E18 F;  2KJB A;  2M5W A;  5D5W B;  4PGG A;  4HDU A;  3PFI A;  3WE2 A;  4EJW A;  3BPX A;  2HKX A;  2OBP A;  3KE2 A;  4OU0 A;  3T5X A;  3DQV C;  4YFN F;  1UCR A;  5FLX K;  4UXN A;  3L09 A;  3IKT A;  2FEZ A;  4KIG A;  2NRA C;  5DUK A;  1PUE E;  5TJJ A;  2P8T A;  1IF1 A;  2VBY A;  1YLF A;  1XMA A;  3REO A;  4B8X A;  2MC3 A;  1ZG5 A;  5CVU A;  2P7C B;  3LA3 A;  1FNN A;  1KYW A;  2ISY A;  1FYM A;  4UUV A;  1V3F A;  2W24 A;  4MGR A;  1YYV A;  3LFK A;  4ESB A;  1ZAO A;  1YW8 A;  2ZXJ A;  2WTE A;  4LB5 A;  2MH9 A;  5FLX Z;  4P9U A;  2DPU A;  2COM A;  5J8C A;  1G3T A;  2GXB A;  5ICG A;  2PMH A;  1WWX A;  3E3V A;  1OMI A;  3OV8 A;  4M74 A;  3HTU A;  3AAF A;  3HTS B;  1DDN A;  3G3Z A;  2HGC A;  2F2E A;  4XLN F;  4EGY A;  1ZRF A;  2FBK A;  4M9S A;  2RDP A;  1DPR A;  3K1N A;  3LWF A;  2EFO A;  1XSV A;  2JPC A;  4RB3 C;  4MEX F;  3KCC A;  2DQL A;  3ZMT A;  4HF1 A;  5HOO A;  3F8B A;  2VT3 A;  4L9J A;  1YFH A;  3DEU A;  1R7J A;  4G6Q A;  4ESF A;  1XD7 A;  3DKW A;  4CYD A;  2IJL A;  2A6E F;  4RAZ A;  4EJO A;  3IL2 A;  4Q4Z F;  1D8J A;  1T39 A;  4WXH A;  4QLC U;  3L9F A;  4WK8 F;  1D3Y A;  3V7R A;  5E1Z B;  3S2W A;  4EM1 A;  2P6T A;  5L3B A;  2M45 A;  4IVN A;  1LEB A;  4L9V A;  4PCQ A;  1MJ9 A;  1JXS A;  5D6E A;  4U0Y A;  4U7D A;  1J2X A;  2W84 A;  1D8K A;  2ETH A;  5D8K B;  5E8I A;  3U2R A;  2ZJ2 A;  3WGH A;  2QQA A;  1RIO H;  3R61 A;  4ON0 A;  1ON2 A;  3I54 A;  3ML6 A;  5ICF A;  1YTY A;  4EGZ A;  4KFC A;  1USS A;  4XSX F;  2MH2 A;  4R1H A;  1R22 A;  5KVR A;  5ICC A;  1K78 A;  1UHM A;  5HLH A;  4R8H A;  5DCF A;  2QUF A;  2EV6 A;  1KU2 A;  3SZP A;  4L5I A;  1GVJ A;  4M71 A;  5ERI A;  1FWZ A;  2QVO A;  3C18 A;  3WTW C;  2HR3 A;  3K69 A;  2ZBK A;  3IHU A;  1QNT A;  1S7O A;  1XGM A;  4Y13 A;  4CO8 A;  1MGT A;  4LG0 B;  1T38 A;  3FF5 A;  5BQT A;  2A5Y B;  2BV6 A;  2NNN A;  1ZAR A;  3ROU A;  2C6Y A;  1B9M A;  1KQ8 A;  3ZP5 A;  1TQI A;  1O7L A;  2QZ8 A;  2VE8 A;  4M72 A;  1U8R A;  2FBI A;  2D45 A;  4A6D A;  1IN6 A;  4G6D A;  3RYP A;  2CG4 A;  1I1G A;  1IW7 F;  3TO9 A;  3GVA A;  5LRS A;  3BDD A;  2FF4 A;  2K4B A;  3BPV A;  4G7O F;  3RKX A;  3ZN1 A;  4EJT A;  1ZHF A;  3EET A;  3HSF A;  2IA1 A;  1CF7 B;  1VTN C;  3VB2 A;  1SFU A;  1WKM A;  2H09 A;  2PFB A;  3B02 A;  2V9V A;  1ZRC A;  3GZ6 A;  2EA4 A;  4LFU A;  1R00 A;  2CFX A;  2PLY A;  3CTA A;  2HZT A;  1ZG1 A;  2LSO A;  2EV0 A;  2IW5 A;  4IRG A;  1ULY A;  4M6Y A;  2GAU A;  3LAJ A;  3FXQ A;  3ELK A;  1OKR A;  3RI4 A;  2JT1 A;  4OMZ A;  1QBJ A;  3DXJ F;  3P7N A;  1G3Y A;  5F6F A;  1JHH A;  1TW2 A;  2X4H A;  4N9I A;  1LQ1 A;  2FNA A;  2MLG A;  4Y17 A;  3BP8 A;  4I0A A;  2XAQ A;  2STT A;  4U0V A;  5HS9 A;  4L9T A;  2L54 A;  1XDS A;  3V7C A;  4MQV A;  2QQ9 A;  3ZMS A;  4FX4 A;  1RUO A;  1MDM A;  4HLX A;  4AVP A;  3LQR A;  4RS8 A;  5KK1 A;  2J5O A;  3KEO A;  2XAF A;  4I7H A;  1G6N A;  2BGC A;  5F64 A;  1FSE A;  1P92 A;  1BI1 A;  1Q1H A;  3GWZ A;  1Z7U A;  1YIO A;  1W5T A;  3M8E A;  2PJP A;  1KQ0 A;  2YX7 A;  3HRT A;  3TDU C;  3E6M A;  3GFL A;  1IRG A;  2MBF A;  2CW0 F;  1CGP A;  2ZFW A;  3TO6 A;  2FML A;  3WU1 B;  2HYG D;  4EM2 A;  1PDN C;  2DLL A;  2VN2 A;  4E70 A;  5JHU A;  2RGV A;  4A0Y A;  3BWG A;  5D8L B;  2OQR A;  4ESJ A;  2RV8 A;  2OA4 A;  2NYX A;  2XKO A;  3FMQ A;  4GGG A;  4F7Z A;  3GO5 A;  1XGN A;  2E1N A;  2H6C A;  2E7W A;  2QWW A;  1YO5 C;  2ZNY A;  2UXN A;  1ZN2 A;  2QYO A;  3GXO A;  2EJR A;  1DUX C;  1J0R A;  4CDG A;  4I2O A;  1KQ9 A;  2XV4 S;  3KP6 A;  4IJA A;  1STZ A;  3EDP A;  3BJO A;  2VBW A;  5LHG A;  3GF2 A;  5DD8 A;  2JZY A;  3C3W A;  4WF2 A;  2E7X A;  1ZLJ A;  3MCZ A;  2EFQ A;  5L3F A;  3CO7 C;  2VE9 A;  4UV9 A;  3LAP A;  2DT5 A;  5HDN A;  1G3W A;  4KMU X;  1ON1 A;  5DDG A;  2IT0 A;  1TW3 A;  2W25 A;  1U78 A;  3F21 A;  4HQE A;  1K78 B;  2VOD A;  1EH6 A;  4WWC A;  3WTY C;  2XAJ A;  3ISP A;  2Y48 A;  5HLG A;  2GA1 A;  4FHT A;  3M9A A;  2ISZ A;  3T8T A;  4KIB A;  3ZQ7 A;  1KYZ A;  4S05 A;  1Z1D A;  4CIC A;  2L4A A;  1YW9 A;  2FU4 A;  2RN7 A;  3N97 A;  3L2C A;  3QU3 A;  1IN7 A;  4DNC A;  1BN5 A;  5IT9 K;  4BH9 A;  2OZU A;  2V6C A;  2M8E A;  1BOA A;  4HX8 A;  1TBX A;  2P6S A;  3TDZ C;  3E5U A;  1B9N A;  3WTS C;  2FBH A;  3WGI A;  3GYH X;  2P5K A;  2OQG A;  3M8F A;  2XAH A;  2A68 F;  3ERE D;  3F8C A;  4I02 A;  5IT9 Z;  1O57 A;  1FBU A;  3QPH A;  2A3S A;  1E17 A;  4D0P A;  3R4K A;  5IT3 A;  3QRF F;  1XSD A;  3E5Q A;  4JBA A;  3JSP A;  4IHS A;  4ZZD A;  5BMZ A;  5CVR A;  2VXZ A;  1YS7 A;  1X3U A;  4HV6 A;  2MD5 A;  4I01 A;  5BPI A;  3HOT A;  3MAJ A;  4A5N A;  4HF0 A;  4KDP A;  2HFH A;  2V79 A;  2G9W A;  1FC3 A;  4KNY A;  1QZY A;  1BM9 A;  1BI2 A;  3FMS A;  1J7K A;  2BE5 F;  5LBQ A;  1I27 A;  3ZMU A;  1FP2 A;  4OMY A;  3DPL C;  1B4A A;  2HYF A;  1U3E M;  3BZ6 A;  2D2W A;  4ZYD A;  3K1M A;  3ECH A;  3O2P E;  2O6G E;  4LLL A;  5H6Q A;  1IXR C;  1OR7 A;  1F9N A;  3CO6 C;  1TNS A;  3T0Y A;  1MDM B;  1YS6 A;  3V8J A;  1UB9 A;  3KFW X;  4RGR A;  2OZ6 A;  2NS0 A;  5ILV A;  4ZYE A;  4LMY A;  3BJ6 A;  3F72 A;  4K2E A;  2L3D A;  2ZKZ A;  1DPU A;  2NNY A;  2DFI A;  3VOD A;  5CVJ A;  2Z9O A;  4EMS A;  5LGN A;  3HHH A;  3MZH A;  1SAX A;  2GIV A;  5HLI A;  2A6H F;  1ZRD A;  5EEH A;  1O3R A;  3H3Z A;  1HKQ A;  1AWC A;  2VC1 A;  4G7H F;  5HDG A;  2K02 A;  2HQN A;  1T2K A;  2HWV A;  5DCM A;  1BC8 C;  3R6S A;  2F5C A;  4I09 A;  4OIN F;  1L0O C;  1UHW A;  4FT8 A;  4MQ9 F;  1P4A A;  2LF7 A;  2H94 A;  2KIF A;  1U5T C;  5AIP A;  4BAY A;  3KLO A;  5JR3 A;  3KZZ A;  2M87 A;  4ASN A;  3PQJ A;  2J5P A;  4M73 A;  2H6B A;  1FBS A;  3ZPL A;  3I4P A;  3H3U A;  5AON A;  2MLK A;  2EFN A;  3FM3 A;  2DTR A;  5LHI A;  1W4M A;  5CJ9 A;  4UVB A;  3GFJ A;  4Q5S F;  1XGO A;  3V8L A;  4L18 B;  3BY6 A;  4KYW A;  4WXD A;  1LDD A;  3F3X A;  2Q2E A;  3F23 A;  4MEY F;  3FXU A;  5LRR A;  1AOY A;  3WTU C;  1BIA A;  1SD4 A;  3V7S A;  4NHJ A;  1IN4 A;  1HKS A;  3CUO A;  1ZLK A;  1HBX G;  4XSZ F;  1T98 A;  5E20 A;  1U6G A;  2FXA A;  1HW1 A;  3HUG A;  4CXF A;  3F6V A;  3J81 K;  4BXU A;  4HW0 A;  2L02 A;  3HRS A;  2ADU A;  2Q8K A;  3VFZ A;  2XUB A;  4YFX F;  4BNC A;  1R1V A;  1FPQ A;  3T1B A;  3WTZ A;  1H9T A;  4BHB A;  4P5O A;  3K1P A;  1KU3 A;  1F4K A;  1KU7 A;  3HSR A;  1HW5 A;  5ICE A;  2QEN A;  2F5F A;  5J6X A;  3E6D A;  3T8R A;  3J81 Z;  4ENK A;  3ZMD A;  2Z3Y A;  4KMF A;  2M1B A;  2A07 F;  1O3T A;  1BC7 C;  1EV7 A;  2W57 A;  4GYG A;  4A6E A;  1Z6R A;  4Q48 A;  1S7A A;  1NHA A;  2W85 A;  3SQN A;  1J75 A;  1LDJ A;  1W7P A;  2HDC A;  3GFM A;  1W5S A;  3K2Z A;  3SZT A;  2Z99 A;  3KP4 A;  2O8X A;  4BQA A;  1WI9 A;  1LNW A;  2HOE A;  4XRF A;  1C0W A;  2OAZ A;  4N0B A;  3DFG A;  5H6R A;  3DF8 A;  2PN6 A;  4LLN A;  1OPC A;  5L3C A;  2R3S A;  1W7P D;  5BPD A;  4Z2Y A;  1TLH B;  2YU3 A;  5L3D A;  4I98 B;  1R36 A;  4HQM A;  3TGN A;  4IHT A;  2PG4 A;  3EYY A;  2VON A;  1IUY A;  1F5T A;  1IN5 A;  2JRT A;  2VBZ A;  4UV8 A;  1MJB A;  5HS7 A;  4IPA A;  4M9X A;  4HX7 A;  1IXC A;  3FZV A;  1XSX A;  4MTE A;  1H9G A;  5F1R A;  4GCV A;  1JGS A;  2Y0M A;  4XBF A;  1A04 A;  2DK8 A;  5D6F A;  1FP1 D;  3EQL F;  3J7A O;  1XCV A;  2ELH A;  3HRM A;  1B6A A;  1TTY A;  3KP2 A;  2VT2 A;  2YPR A;  2D1H A;  4LK0 F;  3C1D A;  4IF4 A;  2HKO A;  1Z91 A;  3GFI A;  3WGG A;  2ZME A;  3GEZ A;  1FBQ A;  3I59 A;  2A69 F;  1PP8 F;  2G7H A;  1R23 A;  4O3M A;  3JTH A;  2VOO A;  1EH8 A;  1ZGA A;  4RB1 A;  3HSE A;  3Q9V A;  1V4R A;  3CDH A;  4O6J A;  1J5Y A;  2EFW A;  5E17 F;  3F8N A;  2EB7 A;  4YIF A;  1FT9 A;  3O6B B;  1RUN A;  3E5X A;  1FZP B;  3LA7 A;  2KIM A;  5TRD A;  5L3E A;  3TOA A;  3Q5F A;  5J8F A;  2Z33 A;  5K5Q A;  2CQK A;  4GO1 A;  3F6O A;  2EK5 A;  4AIH A;  3RDI A;  2IRF G;  5HDK A;  1U5T A;  2XRN A;  3E6B A;  2EWN A;  2GXG A;  2ZO4 A;  2FNP A;  5DCM B;  3FX3 A;  4NB5 A;  5E1X A;  4A0X A;  2TDX A;  2XHK A;  5LLQ A;  4WXC A;  1R58 A;  3QP5 A;  1U2W A;  3LA2 A;  3F22 A;  3HYI A;  4HLY A;  6PAX A;  3G73 A;  3E6C C;  1T0F A;  4JQF A;  4YII A;  2PBI A;  5E1W A;  3F8F A;  3NEU A;  5D5V B;  1FLI A;  3ZMV A;  1JHF A;  4A0Z A;  4IRH A;  1Y0U A;  1D5V A;  4U0W A;  2O03 A;  4EM0 B;  2RQP A;  2L01 A;  2V1D A;  5HS8 A;  3KEQ A;  1SD7 A;  4OIQ F;  5BOX A;  4MTD A;  4HA8 A;  4OIP F;  4A2U A;  4ENN A;  3PQK A;  1HKT A;  4LGW A;  4WX9 A;  2EV5 A;  3KLN A;  2JSC A;  1MJA A;  5L3G A;  3W6K B;  3FWE A;  1P4W A;  2LKP A;  2DPD A;  2CGP A;  1ODD A;  1E2X A;  2BEO A;  3RTR A;  4ZYG A;  1LJ9 A;  2M30 A;  1K79 A;  2A61 A;  1RI7 A;  2XAG A;  3COA C;  3RPU A;  2KJC A;  3R0A A;  2JPB A;  1QPM A;  2QBY A;  3KET A;  2ZNZ A;  2QQB A;  3IRR A;  3H92 A;  1L3L A;  2FE3 A;  1W7P B;  4UVC A;  4B09 A;  3W6J B;  3CUQ C;  2PMU A;  2CYY A;  3C7J A;  3V8K A;  4G7Z F;  1OYW A;  3ABT A;  4DQ2 A;  1SFE A;  3QOP A;  4MNU A;  3J80 K;  4HX4 A;  3DPT A;  3N4M A;  1ZGJ A;  1HW2 A;  4EJU A;  4OIR F;  2CSO A;  2O0Y A;  3DV8 A;  2GZW A;  1P6R A;  2KKO A;  3RKY A;  1XDU A;  1F1Z A;  2HS5 A;  4AD9 A;  2K4J A;  4RB2 C;  2K27 A;  4L0Y B;  2ESH A;  1XN7 A;  2F5E A;  3OOP A;  3BOQ A;  1GXQ A;  4ZYH A;  1SD6 A;  3J80 Z;  2G7U A;  4XLP F;  2YR2 A;  3MQ0 A;  2DBB A;  2STW A;  2FA5 A;  3O3K A;  3DP7 A;  2YX4 A;  1GXP A;  4ZH4 F;  3I58 A;  2WC2 A;  2XKP A;  1XMK A;  3TOB A;  3JTG A;  3FXR A;  1QZZ A;  3U1D A;  1IRF A;  4YFK F;  3GX4 X;  2R7F A;  3KZY A;  2LDU A;  4HDV A;  2Z5U A;  4LJZ F;  3IWZ A;  2HEO A;  1J59 A;  1ZYR F;  5FFX A;  1S3J A;  1J9I A;  1WSU A;  1YQA A;  1QO0 D;  3GZ5 A;  1WRJ A;  4EV0 A;  3M7G A;  1SMT A;  2ZME B;  1ZRE A;  3I59 B;  2KIU A;  2ACJ A;  1MZB A;  2XGX A;  2HQR A;  1YG2 A;  1H0M A;  3P9I A;  1XGS A;  1Z05 A;  3IKV A;  3KP3 A;  2P4W A;  3FMR A;  4RAY A;  4HZF A;  1QQI A;  3ZMZ A;  4BHP A;  4MHG A;  2Y75 A;  2DW4 A;  4L5J A;  2QLZ A;  3V4G A;  3I5U A;  2FOK A;  1BIB A;  3KP5 A;  1LEA A;  4HOB A;  1U5T B;  1FYK A;  4M9Z A;  4KIC A;  4CZZ A;  3NRV A;  1G3S A;  4FX0 A;  2AS5 F;  5CYV A;  1B59 A;  4IXA A;  3TO7 A;  2DI3 A;  1MD0 A;  1BI3 A;  1S6L A;  5JI6 A;  5JFR A;  2BYV E;  3B73 A;  2IVM A;  4OIO F;  3M1E A;  4KT5 C;  3P9K A;  3BJA A;  2OD5 A;  4O5V A;  2PQ8 A;  1LVA A;  1LB2 A;  1O7F A;  3SXY A;  1ONV A;  1PP7 U;  3CJN A;  1B1B A;  2FMY A;  3L7W A;  3WG9 A;  4KIF A;  5EEG A;  1OYI A;  3BRO A;  4KN4 X;  4P96 A;  4A5M A;  3RIR A;  4TV7 A;  2L4M A;  4RGU A;  5K1Y A;  2AXL A;  2LNB A;  2EA2 A;  3KP7 A;  3ZN0 A;  5LEJ A;  3WU0 A;  1GHC A;  5BS6 A;  3I0T A;  2MA3 A;  4L0Z B;  2O3F A;  1WQ2 A;  3IWF A;  5CVI A;  5DD4 A;  3IC7 A;  2XAS A;  3GLX A;  5HVQ C;  4CGZ A;  3MWM A;  4AWX B;  1HQC A;  2F5D A;  3CUQ A;  5A2Q K;  4HAM A;  2FRH A;  3QPT A;  1KA8 A;  2BBY A;  3WTV C;  2DK5 A;  3ECO A;  3WE3 A;  4HYE A;  3TQN A;  5D4R A;  2V1U A;  5ED4 A;  1DP7 P;  4I0B A;  2ZCW A;  4U88 A;  2R7D A;  3HIF A;  2QBY B;  3F8M A;  1ZH5 A;  2ESN A;  1TQM A;  2P5L C;  3WTT C;  1REP C;  3RYR A;  1T6S A;  5CLS A;  4NQW A;  3NQO A;  3I53 A;  5FFZ A;  1HSJ A;  4HV5 A;  2IPQ X;  5A2Q Z;  2GA2 A;  2RC4 A;  3QP6 A;  4PDK A;  1KU9 A;  2WWY A;  2GQQ A;  4CHU A;  3CLO A;  3EUH A;  2RVC A;  3FM5 A;  2O61 A;  4IRI A;  4H0E A;  1I6X A;  4EVI A;  4EQQ A;  1IN8 A;  5FB2 A;  4GYI A;  1FOK A;  3LQQ A;  1SD5 A;  4UHT A;  4BHC A;  4A12 A;  3RPQ A;  1RZ4 A;  3EYI A;  2XRO A;  2XVC A;  2FSW A;  4AIK A;  5H20 A;  1EH7 A;  4GXO A;  3SFZ A;  1IAW A;  4ENJ A;  5FD5 A;  1SMY F;  2E1C A;  1KGS A;  2V1X A;  3RJP A;  3QU6 A;  3MEX A;  4JK1 X;  2DU9 A;  2FQ3 A;  3JAM K;  3K9T A;  1XCB A;  2IP2 A;  3I71 A;  4RB0 A;  4UNO A;  1HST A;  2KRF A;  4G9Y A;  1YW7 A;  2GWR A;  1UST A;  2DAO A;  4P9F A;  4PZJ A;  4HF2 A;  5FD6 A;  4Y15 A;  1I1S A;  2VBX A;  2K7L A;  3JSO A;  3JAM Z;  3R60 A;  1R5G A;  5DUI A;  3VOE A;  3I64 A;  5E8G A;  5DYM A;  5LEK A;  2D1V A;  3HOS A;  3E97 A;  1S29 A;  1BI0 A;  4QWQ A;  4HBL A;  2P5V A;  1FYL A;  1FY7 A;  4KUM A;  4P55 A;  4G8X A;  1ZG3 A;  5ILU A;  4AIJ A;  5JVT A;  1P4X A;  4RGS A;  3IRQ A;  2RKH A;  3JW4 A;  4G94 A;  1Z6T A;  3D5L A;  1R1T A;  1UFM A;  3SHF A;  2VC0 A;  3Q9S A;  5LHH A;  2PI0 A;  3U9G A;  2UWM A;  2WV0 A;  5LGU A;  4U7B A;  1TQP A;  1TNT A;  3L00 A;  1RNL A;  2Q0O A;  2DO7 A;  4ENM A;  3D0S A;  3HHG A;  2HTJ A;  4EJV A;  1FX7 A;  2VOP A;  4LB6 B;  3GW2 A;  2K86 A;  2X0L A;  1JE8 A;  5K5R A;  4LD5 A;  4N9H A;  1MKM A;  4LLG F;  2H27 A;  4Q47 A;  1BBY A;  1G4D A;  5D5U B;  3WTX C;  3HRU A;  2JTV A;  1LDK B;  5D5X B;  4R79 A;  2LF8 A;  5LGT A;  5FO5 A;  4ETS A;  3LST A;  2XIG A;  1XB4 A;  2HTS A;  2IA0 A;  5FGM A;  4BYY A;  4S04 A;  1S8N A;  5CVV A;  1K6O A;  3GUD A;  3RKW A;  1I5Z A;  3R0J A;  4RGX A;  4LG0 A;  5D4S A;  4M6X A;  5DEQ A;  2DQR A;  2QM3 A;  3K0L A;  3ULQ B;  5DV5 A;  3MFK A;  2RNJ A;  3ABU A;  5ILS A;  1OYY A;  2EFP A;  1IZ1 A;  4YG2 F;  1O3S A;  2IA2 A;  2P7V B;  2PEX A;  3QAH A;  3MZY A;  4ZZL A;  4WCG A;  3FHZ A;  2OU2 A;  1R5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...