3PIPF

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3pipF00
5GAGJ 5DM7F 1YI2I 1VQKI 3CCSI 2ZJRF 2QEXI 1YJ9I 1YJNI 3PIOF 1YIJI 3CCUI 2ZJPF 2JQ7A 3CMAI 1YITI 1VQLI 4V19K 1VQ7I 3CCVI 1Y39A 1YHQI 1ACIA 4IO9F 1YJWI 3CMEI 5JVGF 2OTJI 3CCRI 3CJTB 1HC8A 1VQ5I 3CC7I 4UY8I 3DLLF 2QA4I 1FOXA 2K3FA 1VQ6I 2ZJQF 3CF5F 2E34A 3CCEI 5GADJ 1VQMI 1FOYA 2OTLI 3G4SI 1VQOI 4IOCF 3G6EI 3CCLI 2H8WA 3J7YJ 1VQ4I 1VQNI 1FOWA 1QA6A 5GAEJ 2FOWA 2E36A 3CCQI 1MMSA 3CC2I 2NXNB 5DM6F 4IOAF 3G71I 3PIPF 3I55I 3J7ZI 3CCMI 1VQ8I 3CCJI 3CD6I 1VQPI 5GAHJ 2E35A 3I56I 3CC4I 1S72I 1VQ9I
chains in the Genus database with same CATH superfamily
1BR4A 1I6HJ 2R7XA 1Z0XA 3F8NA 5FROA 5DV5A 3RPQA 2Y48A 2I8DA 3BG7A 4XL9A 2KP6A 1ZN2A 1YJ9I 2EK5A 4G7HF 1W5SA 3U1KA 3E1SA 3TO7A 1TQPA 2HWVA 2QSGX 2JPCA 3FMRA 3LSTA 3KETA 5DDGA 3PNVA 4AYBA 1XS9A 5E8IA 2CW8A 3FBIB 4M9ZA 5ICCA 1T38A 3PQJA 1TWGJ 3KE2A 3QP5A 1MDMB 1AA7A 3E5QA 1S29A 3WTYC 3W6JB 4S05A 4IRGA 2E2HJ 2F5VA 4XLHA 3ZRGA 3JRCA 4BXXJ 1HQCA 5HLHA 2HU9A 2HVQA 4D5CA 2O0YA 2K4BA 2OJED 3BPVA 3W2VA 2A07F 1O3QA 3OIOA 2L5QA 2OU2A 4MNUA 2L7KA 4ZTFA 2O9LA 2XUBA 4Y52J 2JVHA 2F2EA 4A0XA 1KU7A 3W6VA 2NVQJ 1KQ8A 2W1OA 3CCRI 2GM4A 5J1UA 4R8HA 3TP0A 1OMIA 3RTRA 1HC8A 1TTYA 1VF9A 4XKBA 4HEA2 2KT0A 1QPMA 2Y9YA 2R0QC 3ZMTA 1V55H 2V4JC 3JR9A 2XSDC 2KJCA 3ZMZA 4BHPA 2XROA 1XDUA 2K3FA 2HQ5A 3BTLA 3FXOA 5E3MA 4ZZLA 4A3FJ 5BPDA 1KQ0A 3GTGJ 2FUG2 3BDDA 4B43A 3GUDA 3WHCA 4XSXF 3A02A 2OD5A 3MMYB 5FO5A 1H9TA 4CCMA 1K61A 5GADJ 1IUYA 2XDVA 4HDVA 4M73A 4KDPA 4IQJA 1WJ5A 1JT6A 5ED4A 2X1DA 1GT0C 1ITYA 1JT0A 5K7ZA 4CCLA 3OV8A 4RB2C 3DEUA 3E5XA 3JRIA 2EQRA 3K1NA 2K27A 5HVQC 1RPWA 3SDBA 3SJMA 3HOWJ 4XICA 1RRJA 1LUJB 3D0SA 5C3EJ 2QGUA 1BN5A 3H35A 1HW5A 2VLAA 1ZYRF 2DA4A 2FQ3A 3FKJA 1P7JA 4FHTA 4A3EJ 1G59A 3M1CA 3HSEA 3K69A 1Q1VA 3LOCA 2WAFA 3NWSA 3T0YA 2R3SA 2EV0A 3E5UA 1OCOH 1ON1A 3V8JA 5M5WJ 3F3XA 5DUKA 3BG3A 1R1VA 4IZZA 4A3LJ 1ETWA 2LBFA 5HLGA 1K79A 3DKWA 3KP3A 5GPCA 1ZRCA 4ON0A 2Y0SA 5IP7J 2JZYA 1VFCA 1V54H 4BY1J 5HOOA 4A3JJ 1YJNI 2IS2A 1FNNA 2GIVA 2MBFA 2QQAA 1FYMA 5LRRA 2XPVA 4P5OA 2F6CA 2XPUA 4Y17A 5DCMA 4HOBA 2R92J 4IHYA 2GZWA 4BY7J 3MZYA 1JKPC 2KZVA 2ZB9A 3OS0A 2DDAA 2JTVA 1R1TA 4FE7A 1PYVA 3WGIA 4CSWA 3L2VA 3K4LA 2KMUA 3W3CA 1OYWA 4G9YA 2BW3B 2B0LA 3U1DA 2DOFA 4IO9F 1YJWI 3HHHA 3IKVA 3F6OA 3E97A 1WPKA 1Z91A 3I59A 5AIPA 2NVYJ 1X3UA 1Q1HA 4M9SA 4OIPF 3KFWX 2RKHA 3HTUA 3M8FA 4XN3A 1MIJA 2RQPA 3I64A 2GBYA 4JYKA 4JOMA 2X51A 1TWAJ 2Z5UA 1A04A 5F08A 4FETA 1JE8A 4CYCB 5E18F 2P7VB 3MKZA 5DTDA 4S04A 4G6TB 3IV5A 4C30A 3FISA 1EH8A 1MD0A 1QZEA 4BJTA 3PO3J 4X0GA 1TW2A 1D1AA 3NAUA 1LFUP 3UR3C 1W0UA 2HDCA 4CXFA 4MEYF 2O5RA 2M0MA 4M3FA 3CJNA 3IWZA 3GF2A 3BJ6A 1O57A 4NUBA 3S17J 3HSRA 3J7YJ 4L9JA 3HOUJ 1SFKA 2QF7A 4Z2YA 2EV6A 1VQNI 2D1HA 4BBRJ 5KCMA 5K5OA 5F6FA 1RIOH 1IXSB 4CCOA 3IKTA 2UWMA 2DA5A 2FRHA 3RCOA 3E6CC 2P6SA 2XV4S 2PJPA 3ZN1A 4KIBA 2ID6A 4NC6A 4YFKF 2STTA 3JRGA 1K4TA 2OUMA 1QHGA 2Z16A 4KUMA 3K4BA 4X1EA 1FBSA 4HNTA 5L3CA 2IEKA 1IRXA 3A0BC 4I02A 5TISC 3GTOJ 3HUGB 4WX9A 2VQCA 3OMYA 1W0TA 2M3AA 3VOEA 3DKYA 1R58A 4RM2A 4EM1A 1FOXA 4E7LA 2XF7A 3DBLB 5EZGA 1ZRFA 3BQYA 5GAGJ 3SQNA 2OV7A 2WAEA 1YQAA 5D4RA 2P81A 1O7FA 1MDMA 3C2HA 3WTSC 1XGOA 2E1OA 5FFXA 2JSPA 2FF4A 1X4PA 2X6YA 1ZG1A 2WB1N 2LKSA 1R7JA 2P5LC 4HF1A 4G7OF 3S2DJ 3QYEA 2VBXA 1JXSA 3QWLA 1XSDA 3ZQCA 5EEAA 4EJUA 2DT6A 2ZJPF 1S7AA 2HR3A 1V5EA 4FQGA 1PP8F 4UV9A 3BR6A 5JFRA 3JTGA 1F5TA 2MD0A 5D5WB 3OYBA 3MVPA 1O4XA 4HDUA 3D5SC 4BBSJ 2V7FA 1EH6A 2XAUA 4FISA 1YHQI 1O3SA 3RKWA 3HPHA 2VL8A 2CW7A 2EJRA 4RGSA 5LEJA 2P5KA 3S16J 3OS1A 5JVGF 3D5RC 1Z05A 1TQMA 3S3NA 3LQQA 2HQAA 2K9QA 1XD7A 2X48A 2QBYB 3WGGA 1HCRA 3HOSA 4IKFA 2B7EA 3W2AA 1KYZA 4BEHB 2R5ZA 4L9NA 1T6SA 4YEJA 1G3SA 4B09A 4AUXA 3CUQB 2E5ZA 5HNFA 3I5UA 3OY9A 2HVSA 3LWFA 3HEFA 3C18A 3Q9VA 2K9MA 3GFIA 3QPHA 3ZQLA 1W36D 1HKTA 3SDGA 2A6HF 1PP7U 5FRMA 2PMZA 4Y13A 2BHYA 5LLQA 2IS4A 2HOSA 4ZJZA 4IQ4A 1ETXA 3TDZC 4N4OB 3ZMUA 4BU2A 1EH7A 1J9IA 1AOYA 3V8KA 5H20A 3WTVC 2JPBA 3IAS2 3G3ZA 5D8LB 4IX7A 1JGSA 1HBXG 1STZA 4GCVA 5E17F 1EF4A 1R4NB 3OYEA 5BMZA 3P9IA 4M9XA 3FF5A 2PI0A 2HYFA 1PDNC 1KGSA 2MLKA 2EA4A 1Y1VJ 1MMNA 2M30A 1U9NA 3CC2I 2HOEA 4IXAA 3M4OJ 3HYIA 1SFXA 3J81K 4ZYEA 1MJBA 2GIZA 3HXLA 4ANJA 4PFPA 5D5UB 4ABZA 2KZGA 2M7AA 1YOVB 1NH3A 3ZQ7A 1S7EA 4ESFA 3J80Z 3FM3A 4XR6A 1FEXA 2M1BA 4WXDA 3SXYA 1DUXC 1UZCA 2MFZA 2EPFA 6PAXA 3Q9SA 1QRYA 2DO7A 2DW4A 4IVNA 2HXOA 5BOXA 4Q5SF 2LLKA 3GYHX 2F4OB 3H9QA 4U87A 3KZIC 4RAFA 2HTJA 3FX3A 1QO0D 1QVUA 4C9YA 1JHHA 4LJZF 1RZ4A 2FSWA 1IN4A 4I0AA 1ZLJA 3H92A 2IA1A 1WSUA 3E6BA 2ZNZA 2UV1A 1U5TC 4BYYA 4E7SA 4LB5A 3DXJF 5E3OA 2VC0A 2ZXIA 2JQ7A 1A6QA 3CMAI 1MGTA 3V42A 3H36A 2E60A 1PVEA 4BE0A 1FLIA 1MSEC 2A05A 4AYBN 2W82A 3I4MJ 1YE9A 4G94A 4XKCA 3H0DA 1MJAA 5ERIA 3VEPA 4I7HA 2BYVE 1A5JA 1ACIA 2VN2A 5IOYA 4CYCA 4BJ5C 5GP9A 4A5NA 5J4YA 2NS8A 1H89C 2R7FA 1U6GA 3M8JA 2FMYA 1YW9A 3OIQA 1R5HA 4LK1F 1XN7A 2DPUA 2DMNA 2R7WA 3ABTA 3VPRA 4HLYA 3W6KB 3F8FA 1ZARA 2DA3A 3CUQC 2L7ZA 3KZZA 4D0PA 1D5YA 2V9KA 4E70A 3BG5A 4MLOA 2VUMJ 1Z9CA 3L2QA 2ZSIB 5EG0B 4U0WA 2QZ8A 2VKVA 4HX8A 4KMFA 2IA2A 2WAQA 5F1JA 3G4SI 4L0YB 1PJRA 1F9NA 1G4DA 4YELA 2NRAC 5HS9A 1FZPB 2DA7A 5KAFC 3RPUA 2BY2A 1F1ZA 3ABKH 3ELKA 1SAXA 1PUFA 2O8KA 1WI9A 4A2UA 2UXNA 4R79A 3H9JA 3WU1B 5DEQA 1DPRA 4B47A 3S32A 3SZPA 3F23A 1XCBA 2OA4A 2STWA 2D5VA 1DPUA 1Z1DA 3CD6I 3WE2A 3K4MA 3OWTA 2HQRA 1ETVA 4Y4RA 1PUEE 2AS5F 2DT5A 1WKMA 1S72I 3FZVA 3TBIA 2I5UA 3GTMJ 3JRHA 4EJWA 4HX4A 3F72A 3GTQJ 1U5TA 5D5XB 5C4XJ 3KYDB 5DUIA 4DBQA 3BR2A 4ITVA 4L5IA 3SHFA 3PUFA 2MH2A 3ECOA 2VKHA 5K7HA 3GFLA 3U9GA 5EGOA 5CJ9A 3R0JA 4H0EA 3OYNA 1HW2A 3L9FA 2DOEA 5CVUA 3NQOA 4BQOA 3OYDA 1T56A 1BM9A 3HM5A 2X85A 2O7OA 2ZO4A 2Y0SN 3LSPA 4OU0A 1JTXA 2QSFX 1YITI 1G8XA 2WV0A 2LY2A 4KFCA 2WADA 3MEXA 4BDZA 4O5VA 2V1NA 3JSPA 3JRFA 2LK2A 4NC8A 4CYDA 4ESBA 2KLOA 2VJIA 2HDWA 2A5YB 5C44J 4KICA 2G9WA 3CMEI 2Z3YA 1DU0A 1D1BA 3K4KA 2OAZA 3N97A 3CUQA 2R5YB 1E17A 4RA2A 3T5XA 1R49A 3C2GA 4HNVA 2CO5A 3M07A 4LLNA 2P6TA 1KU2A 5E1ZB 2AQEA 4KISA 1E2XA 1I6XA 3K70D 1RC9A 1DP7P 1B72B 1MJ9A 1FBQA 2VOOA 2DA2A 1JUPA 2DJIA 3KIOA 1Z7LA 2VKDA 3S8PA 3KP6A 2WTEA 4DYCA 1IRZA 2RQQA 4A5MA 3QODA 3JSOA 1A31A 2L9VA 3H3UA 3RQIA 1RI7A 2JN6A 4PJNA 1E3HA 3KLOA 4OAYA 3M3YJ 2L0KA 1WH7A 1D8JA 3O8HA 2A68F 4HV6A 3RSNA 2LRDA 2BY3A 5LGNA 4OIOF 3EYIA 1T33A 1RR7A 5L3GA 2F5FA 1GXPA 3OYKA 3LSIA 3RKQA 3HGYA 2VOPA 1EKEA 2XAHA 2JK3A 2P5VA 2E36A 4RMNA 5FGMA 2RV8A 4BNCA 2VBZA 3KPHA 1R36A 3R0AA 4IRIA 5L3EA 2BVMA 1O7LA 3LAPA 4I0BA 5IYCJ 1OCRH 2IGMA 1YIOA 1OISA 2E5NA 4PGHA 4RB0A 2KISA 2ZFUA 1JUMA 4QWQA 2CUFA 4XLNF 1H88C 2E35A 3ZP5A 4CZZA 2O03A 2R7VA 2H94A 3DQVC 4EGZA 3RYPA 3WODF 3J80K 3A03A 4XORA 5IPAA 4G6DA 2KDZA 2JT1A 2RDPA 1Y56A 3VODA 1U9OA 3PUBA 3PFIA 1R5GA 3RDIA 2VIXA 3LQRA 1WJDA 1LDDA 4G12A 3TQNA 5JVTA 1Z77A 3OYHA 1SFUA 1Z3XA 1IN8A 2L4AA 5CYVA 5J6XA 2DLLA 1DQUA 4IEJA 4DIQA 5H6RA 3OOUA 2W4SA 3CDHA 4CCNA 2QWWA 3HHGA 3RIRA 1HKSA 1IN5A 1ZKGA 2VQHA 1IDYA 1EJ9A 1WQ2A 3JAMZ 2PX9A 2FX0A 5HODA 2P7CB 2FNPA 3BR3A 5KVRA 1EA3A 1H9GA 4Y33A 5L3DA 5J47A 1J5YA 5FLXZ 2HI3A 1ETOA 4XRSA 4GXOA 2PBIA 3HGGA 4DW6A 2H1KA 3CJTB 5EEHA 1G3YA 3FXRA 3KCCA 3K0LA 1IZ1A 1KZHA 3V7CA 3K1MA 4HAMA 1LVAA 4UVAA 3DV8A 2CYYA 2BGCA 3ZN0A 5J1RA 2HYJA 2PMHA 3PSFA 5KHDA 5A2QZ 4DOZA 9ANTA 2RNGA 5GPAA 4F55A 3GLLA 1UELB 1AU7A 2BXYA 5JHFA 2VC1A 2E34A 1XSXA 3W2WA 4RBOA 2CG4A 1JHFA 4LOCA 4DBRA 1IC8A 2R7TA 5IT9Z 3KEOA 2H6BA 2Y69H 1FOYA 2HKXA 1YW8A 3TGNA 1MMGA 3PSIA 5E3NA 1JUSA 4NQWB 1D0XA 3CCLI 2F4MB 2G0EA 2CJJA 3O6BB 4A6EA 4BHBA 4L9TA 4H4KC 2PMZN 5CVVA 3MFKA 2FOWA 2LC2A 3HRSA 1W7PD 4B3AA 2BEOA 2VPLA 4XONA 2NXNB 3ERMA 3G71I 3PIPF 1ETQA 1QQIA 2B9SA 1BC7C 4XLPF 3BOQA 4B44A 1LFPA 1FSEA 3S1RJ 4M71A 4CCKA 4MQVA 4RGRA 2ZSHB 5DYMA 5JLXA 2Y0MA 2X4HA 2VE8A 1RKTA 5HS8A 4NB5A 1XGMA 4EGYA 1O3TA 2RREA 3F0CA 4EATA 2R4GA 5CPRB 3DBHB 4CGZA 4OINF 2PJRA 5H2FC 1KQ9A 1YI2I 2K85A 1FBUA 2YX4A 3DU6A 2G7HA 2ZKZA 1ZH5A 1MNDA 4JP0A 4U7BA 3WU0A 1ZGAA 4NHJA 3LFUA 4ESJA 4RLQA 3OOPA 3B73A 4QIWN 2RGVA 2E71A 5EF6A 3MZHA 1CF7B 3C7JA 2BZTA 1YIJI 1XCVA 5LHGA 2K9NA 2LR8A 1P6RA 2QENA 3K2AA 1SEUA 4IJAA 3WE3A 2R5YA 3DBRB 3WTZA 4D1QA 2MA3A 2LP0A 5LGUA 4GDFA 2DFHA 1TL8A 3EPZA 2CH0A 2YX7A 2FA5A 1I5ZA 2ACJA 4BH9A 1B72A 4QTRA 1QVTA 2ZFWA 4CO8A 1A35A 2F5EA 3ROUA 1B6AA 2IGKA 2IVMA 4RGXA 2UXXA 1C0WA 1TBXA 4EVIA 2WY7Q 2PN6A 1WH5A 4DQ2A 2XRNA 5J40A 4BQNA 2L7MP 5HS7A 3KLNA 2VODA 1R9TJ 5M3MJ 2ECBA 2M2EA 1FPQA 2L7FP 2HVRA 4YRVA 4XLCA 5HDGA 3KP4A 3LSMA 5FKKA 2QSHX 1T98A 1VQMI 2IA0A 4Y3OA 4OIQF 2W00A 1XSVA 1SMYF 1GXQA 2DU9A 3ABUA 2QVOA 1BOAA 2DMUA 4L5EA 1E3PA 1XMXA 3JRDA 1YFHA 3PQKA 3OYJA 2CSOA 3C3WA 2EA2A 3L00A 3I71A 1YLFA 3OYAA 1Z7UA 3BG6A 1AKHB 2WAQN 3TKYA 3CF2A 4MHGA 1HKQA 2YS9A 3LA2A 2FXAA 4Q48A 2GLOA 4M74A 2QLZA 4IHSA 1ZTRA 1MBFA 2JUCA 3BCAA 3ASNH 2G7UA 1BA5A 3Q0WA 4EM0B 3F22A 2FNAA 2MABA 3ESWB 2DFIA 3AL0B 3KP7A 4HSTA 2ISZA 4MTDA 2FMLA 3ABLH 1R6RA 2OZ6A 2GXBA 1X1BA 2IPQX 5DM7F 4M72A 4ZDOA 4CDGA 3BZKA 1MH4A 3S15J 3RZOJ 2ZJRF 1N77A 2VXDA 1K7AA 1SVMA 2OCEA 3J7AY 4PSXA 2RN7A 1GV5A 1JTYA 4LB6B 3MAJA 3O2PE 4YIIA 3C1DA 1R22A 2TDXA 4I09A 4X6AJ 4M3BA 2UUZA 3EUHC 2LF8A 5H6QA 1KU9A 5IP9J 2MC4A 3DFGA 3P5JA 4MO7A 1AHDP 4AD9A 4DZJA 4QSHA 2WBMA 2XGXA 2GAUA 3BZCA 3MKYB 3DPLC 4UVCA 5TGTA 4RAYA 1ONVA 2Q2EB 4HRIA 1J59A 4EJVA 3JAMK 3L2UA 2CU7A 4AM3A 2DI3A 2OTJI 1D0ZA 2LMDA 3GFMA 1TT0A 3TL4X 2PFBA 5IY5H 4MGRA 2NAZA 3BCBA 4IF4A 2K9LA 4LIUA 2XHKA 1ZG3A 3NRVA 2IW5A 3CMYA 2HOAA 3FWEA 5E79C 5ILUA 1ZGWA 4LFUA 4ENJA 1VQ6I 2JJ7A 2R7QA 1GVJA 2EFPA 4NQWA 2COBA 4NBQA 4TV7A 1U8BA 3FK7A 1UMQA 3K70C 2HYGD 3MCZA 3M9AA 3GTKJ 3V4GA 4HZFA 4CUGA 3HKZA 2Y75A 3BP8A 1U2WA 3H1CA 2HKOA 3HC7A 4JX5A 4P96A 2ZCWA 3F8BA 4CHUA 2W57A 1LEBA 1FP2A 2KHMA 2WA0A 1P2FA 1R71A 4IOCF 3K4NA 3VFZA 1ZR2A 4ZZDA 2H8WA 2A6TA 4DJAA 2Y30A 1FOWA 2Y2ZA 2QQBA 4LLLA 2A6EF 3I4PA 2V26A 4RB3C 5JHUA 4XRFA 5LBQA 4E4HA 3WG7H 2Z2SB 3ZMVA 2EZIA 3I3LA 4GO1A 2CV0A 4UV8A 4N0BA 3WGHA 4E6KG 1W7PB 3RKXA 4FTHA 2JA2A 4JQFA 3GWZA 1ZR4A 4HG2A 2X6OA 1ZGJA 4OMYA 1POGA 3HRMA 4HX7A 5LD2C 3AL0C 1K78B 1I1GA 3BZ6A 3ZQIA 3G1OA 4I6ZA 3CC4I 2J5PA 3TW6A 2FE3A 1IAWA 2JA5J 3K10A 1CF7A 2EZHA 3CCSI 4CA0A 2CUZA 4KITB 1Z67A 2LSOA 5JR3A 5D4SA 3EUHA 2R7ZJ 5J3LA 4KYWA 3BQZA 4KN7X 1V5FA 4B4CA 2LOOA 2NS7A 2HTSA 2IP2A 2W25A 1XB4A 2Z9OA 3DF8A 2LVSA 1FIPA 3L09A 1ETKA 4M6XA 1QPIA 1T08B 3OYIA 1I27A 3S1NJ 2ID3A 1T39A 1D0YA 4G6QA 1IW7F 3RJPA 2XASA 5B5EC 3DU5A 1AWCA 1F43A 2E1CA 3GX4X 1DGWY 2GXGA 4J01A 4LGWA 4JBAA 2QUFA 4PJJA 3VB2A 1TNTA 1I3AA 2VQGA 4NC7A 5K7FA 4II2A 5KNLA 4A3KJ 3HDDA 3GEZA 4P9FA 4ETSA 2IXSA 3QYFA 5KAIC 1WJFA 2E7XA 4MIMA 2XKPA 1MMAA 1SD4A 4V2GA 5CVRA 2EBIA 4UVBA 4BHCA 5J8FA 1BL0A 1X1PA 4ZYGA 2LG4A 2PMUA 3CC7I 3HOYJ 1B1BA 2BW3A 3HSFA 4LIVA 5BQTA 3HZJA 3DLLF 2QA4I 3QAHA 5F27A 4KA4A 3KX2A 3REOA 4BQAA 2PLYA 2WC2A 2Z99A 1P92A 3L7WA 5AONA 2XKOA 3DEWA 3QP6A 4BAYA 3S2WA 3CO6C 4RB1A 1WZ2A 2VT2A 3BWGA 4XK4A 1QU3A 2VT3A 1IXCA 4IL6C 3UNGC 2ZMEB 3HOTA 2FU4A 3HRTA 1OCZH 5CLSA 1WRJA 4IHTA 4A3GJ 3GZ5A 1VQ4I 4QPOA 3FHZA 3GLXA 2LNBA 1U8RA 1K6OA 2EV5A 3PO2J 3ZOBA 2H1LA 1BI1A 3SEQA 5ILVA 3CZ6A 1WHUA 1D3YA 1EV7A 2F48A 1I50J 2DDBA 3VYUB 2GXAA 4HF0A 1Y6IA 2A3SA 4NNJA 5EYRA 5DM6F 4LD5A 2BOLA 4XNFA 1V4RA 4UUSB 1VI0A 2R7UA 1Z21A 1XDSA 3ISPA 4L5JA 3J7ZI 4MTEA 3R6SA 1LQ1A 3PM1A 2Z33A 2R93J 1TNSA 1G3TA 3KP5A 3CCJI 1BJZA 1JI8A 3NEUA 2FOKA 1W5TA 1LNWA 5GAHJ 3L1PA 1MSFC 2JVGA 3MWMA 5JI6A 4HLXA 1WGXA 3DPUA 4AU7A 2JUGA 2EIMH 5B3SH 1TWFJ 3L2CA 2DMPA 2M4GA 5HNHA 2GOXB 3I9V2 5K5RA 1REPC 2A61A 3HUGA 1I39A 3K9TA 3ZQFA 1G2HA 3A4CA 4KT5C 2CUJA 3NWTA 2CS3A 1JJ8C 1FT9A 4OOIA 3ZCOA 3DCFA 1Y1WJ 2L02A 4P55A 2CQNA 1K6YA 2EH3A 1K83J 2V9VA 2NVXJ 3LMMA 3CCUI 3VYSB 2MD5A 1WI3A 4PCQA 3IH4A 3FBNB 3IUOA 4UXNA 2MGQA 4V19K 3VWBA 4BXUA 3JRAA 3GZNB 3SEZA 4HNUA 4QPQA 1VQ7I 3CCYA 4EV0A 2R7RA 5EJCA 1R1UA 4XQFA 1YS7A 2EIJH 1U3EM 2JMWA 4RS8A 4WXCA 2OZUA 3G1MA 1LE8B 5JLWA 1SD5A 3LA7A 3HOZJ 2PG4A 3QOEA 3D1NI 5CVJA 1WCMJ 2BBYA 3B6AA 3F9KA 3IP4B 4MFEA 3IL2A 4GFBA 3TDUC 4D7NA 3BLYA 2KIQA 4Y15A 4IHWA 2CQKA 2VBYA 2QBYA 1SFOJ 2XSJC 4RM3A 2AHQA 4W1UA 2QKMB 2WV1A 1UB9A 1HLVA 2XB5A 2D2WA 4BEHA 2ZMEC 4MFDA 1FTZA 2DN0A 4LG0B 4A6DA 5EZHA 3BG9A 3EDPA 2KRCA 1IUFA 2X0LA 1WJBA 4KN4X 2KIUA 4I98B 3FIWA 3I0TA 4BXFA 1XPXA 5B66C 4LITA 4ENKA 3GBGA 3OS2A 4PSWA 4HF2A 2E2JJ 1YW7A 1UG0A 3U2RA 4XIDA 1NTCA 2RVCA 3EUAA 5DS9A 4KNYA 3WTXC 2WWYA 1D5VA 2HZTA 1FTTA 3QPSA 2OF7A 3SFZA 1D1CA 3KYCB 2EZKA 1FJLA 3U21A 4F7ZA 1S3JA 2LBFB 5D6EA 5BPIA 4GYIA 1Y0UA 4P9UA 2DAOA 2IS6A 2EFWA 1X58A 2K02A 3B02A 3QYBA 3OYGA 2B63J 2E7WA 4PGGA 2NVTJ 5J8CA 2JA7J 2QQ8A 1B9MA 2DA6A 3MQ0A 5L3FA 1J75A 2A5WA 5FKOA 3QPTA 2X6XA 3BJOA 3K1PA 1KA8A 1LKXA 2XAJA 3PL8A 2BHZA 1DU6A 2KFDA 1KONA 3FK6A 3TW7A 2KPMA 4DZPA 4XOPA 1LVKA 2IAIA 3RQ4A 3FDYA 3PIOF 3IH2A 4UUVA 1J0RA 1UFMA 3F8CA 4M3DA 1B9NA 3GXOA 2QM3A 4BUPA 1IF1A 1ZG5A 1E3OC 2ELHA 2K40A 3E6DA 3K2ZA 2IJLA 2W84A 4HQEA 2DTZA 3ZQQA 1VQLI 3OYMA 5B1AH 3DP7A 1Y8RB 3I59B 1HSTA 2V9PA 2EFOA 1Z6RA 3M1EA 4A3DJ 2K5CA 4RAZA 4L0ZB 1SFEA 1SANA 4AIKA 3GMEA 1D8KA 4JK1X 4RDUA 5DCFA 4HV5A 5E3LA 2ME6A 1TWCJ 3F6VA 3BR0A 1RUOA 3BTCA 2AO9A 4GGGA 2K7LA 2O6GE 1LDKB 2DPDA 1A36A 2YR2A 4AIDA 1HOMA 2JA6J 2ZMEA 2V79A 2XRLA 2W24A 2VQLA 4YIRX 1T2KA 1FMVA 1MW7A 3DTIA 2VJJA 1G6NA 5BNGA 2CWEA 1QBJA 2LD5A 1TQIA 1FWZA 4WWCA 4HSRA 4XOTA 1GDTA 2BE5F 2VI6A 3G73A 3AG2H 2CGPA 1H8AC 3IHUA 2UZKA 1FYLA 3C2BA 3FXQA 1U78A 2OQRA 5EG0A 4BGDA 4UUSA 2JRTA 3AG3H 1SMTA 5GAEJ 2E1MB 2JWTA 3HKZN 4KIGA 1MNEA 3EYYA 2HZDA 3FXKA 4D9JA 1BBYA 1V5GA 2M4KA 2M8EA 4RGUA 2XF6A 3CP2A 3COAC 1OLTA 1QNTA 4DYRA 2DODA 3LSRA 1XGSA 2NNYA 2MYSA 3WTWC 4BKXA 2IBDA 3ONQA 1W36C 3WHBA 1S9HA 1VQ8I 4PJLA 4ZH4F 1JJ6C 1R00A 3LSHA 3LA3A 1XMKA 1MBHA 2XGEA 3E0JB 2AXTC 5HDNA 2H09A 4U0VA 1ORKA 2HQNA 2XAFA 1L0OC 3TMOA 3DTEA 3MN2A 4BE1A 1VTNC 2ELKA 3H0GJ 2XGCA 4DGWB 4C3HJ 4IHXA 3HOXJ 5FFZA 1UHWA 1K4SA 1LDJA 2NNNA 3CUOA 4O3MA 4D5FA 2ADUA 2EINH 3DKXA 3V8LA 4A3CJ 1FOKA 5HLIA 3E7LA 1MBGA 1X2NA 4HPQA 5DD4A 4U7DA 4ZTJA 1X3ZB 1FC3A 1QZZA 3I53A 3ZMDA 1XG1A 2M8GX 1HW1A 2KRFA 2FEZA 3P7NA 3PNYA 1LE8A 1F4KA 2H8RA 3GTLJ 1IRGA 3AKZA 1OCTC 2O61A 2ISYA 1IV8A 1YYVA 3DWLE 4BL0B 3LNQA 2XVCA 1RNLA 3H5NA 3A2KA 3CCVI 1GLNA 1X19A 5LFAA 1T8IA 3JRBA 5IP6A 2HPMA 2LTPA 4HW0A 5F64A 2HNHA 2GWRA 1P9QC 1OFCX 4ENMA 2R5ZB 3H5AA 1X4OA 3IRRA 4MQ9F 2V6EA 2GA2A 1S8NA 3EQLF 3WG9A 4AVZA 4UY8I 4XMYA 2JRMA 4G8XA 5J1YA 2DMTA 2IGOA 5ILSA 4LG0A 3J81Z 1JKQC 4U0YA 4XSZF 2EILH 3OR1C 4EJTA 3WTUC 1USSA 2P8TA 2LH9A 2YPRA 3OL4A 2EIKH 5J4VA 4KT6A 1Y0NA 3IRQA 4FASD 2OTLI 3M7GA 3OYFA 3S2HJ 1UAAA 1BC8C 2ZNYA 2CRGA 4IRHA 2YUSA 2ESHA 3G6EI 5F0HA 5E1WA 2RNJA 3T1BA 3EUKL 1L3LA 1NK2P 5DD8A 3NARA 2E1MC 3X2QH 1B8IB 2E2IJ 3S93A 1HDDC 5E1XA 3QQAA 2HEOA 2Q0OA 3I54A 1SC7A 2X6WA 5K5QA 5FRNA 3FMSA 3A01B 2V1DA 5F0CA 1NG7A 1R4MB 3DPTA 4N4NB 1SVOA 4N9IA 4FX4A 1MNMC 1OCPA 3G2BA 1RESA 4FCYA 4I01A 2OCCH 3GW2A 2DYRH 1OR7C 2BV6A 2VKEA 3KEYA 3EETA 5CQGA 1LJ9A 2ECCA 1MBJA 1FYKA 1VQPI 3ZR8X 3J7AO 2DK8A 1YX5A 4E7ZA 5FLMJ 3A1YA 3PFYA 5ICEA 3I56I 1WWXA 2FBHA 1ZREA 3ZQGA 2CW0F 4FE4A 1YRNB 2FJ1A 3ABMH 5AIQA 1ZLKA 2MC3A 4BS9A 5LHIA 2DJNA 1DGRM 2WY8Q 2XF5A 4ZYAA 5ICGA 4C2UA 3VSKA 4F91B 1BIAA 1OJLA 3BROA 2DBBA 2XC7A 4R1HA 4PDKA 5D5VB 4RLFA 3H3VK 2A69F 2BY0A 2Q8KA 2L2OA 1MKMA 5FKLA 4YFNF 5CKTA 1RETA 2XAQA 3RI4A 4UHTA 5IYDJ 2FQ4A 4A69C 1HA8A 2KJBA 2J5OA 2RC4A 3GFJA 4GRIA 1FMWA 4YFXF 1G3WA 1BJAA 1MMDA 4LLGF 1HDPA 3ECHA 2ZXJA 4NDLA 3O3KA 4DYQA 3VYTB 2XGDA 3QU6A 3A0HC 3PNTA 1IGNA 2F5CA 1KU3A 3S1QJ 2K86A 2F5DA 4E7JA 5EDNA 4XN0A 4A3BJ 3G1LA 4E7IA 2NYXA 2M45A 1YTYA 1VQ5I 3GCMA 1O3RA 4LMYA 2KIFA 2L9SA 2QKLB 3IC7A 4M6YA 1USTA 1YS6A 2BVLA 2DFFA 3CP8A 4CH7A 2DOAA 2HFHA 4F3QA 4A3IJ 2Y9ZA 1VZ0A 1IG7A 2NOJB 3AG4H 3K6GA 4L9VA 4FX0A 5F04A 1JKOC 2LFBA 3D5LA 1OCCH 4OWRB 3N4MA 2ZJ2A 2TRTA 2R7SA 4XRSG 3ZXSA 3KYLA 2Q1ZB 1IRFA 1FY7A 1N75A 3KEQA 1X1CA 4JX4A 4BQQA 1PUFB 4ZYHA 4I99C 5BS6A 3IAM2 4E7HA 4HBLA 4ENNA 5FLXK 2ESNA 2FD5A 1LFBA 1GUUA 2OBPA 1E0EA 1RKWA 1MBKA 3ZQHA 3DEEA 1HF0A 5LHHA 1OR7A 1XX5A 3HG9A 4F52A 1QGPA 3DTKA 1T0FC 5FJ8J 4W97A 2V1XA 5CQEA 3CCQI 2XPWA 1IV6A 3FXLA 1OPCA 1VNDA 2EB7A 4DNCA 3LAJA 2X1EA 4UUTA 5A2QK 3O8GA 4ZC3A 3VSLA 2BY1A 5F1RA 3GTJJ 1UHMA 4UNOA 1CQTA 2VB6A 4A0YA 3Q5FA 1U5TB 1B59A 4A93J 3IH3A 2VE9A 5TJJA 1MH3A 2NOGA 2XAGA 3GO5A 1VQ9I 2MLGA 4F92B 2XB0X 4XLEA 4P1WA 5EGOB 1UCRA 1VQKI 2AQFA 2KRHA 3AAFA 2AXLA 2P4WA 4A0ZA 3R60A 1N25A 4FT8A 4A12A 4EEFG 3MD2A 2QEXI 1I1SA 3HJEA 1TLHB 2DYSH 2OPTA 3V7SA 1CGPA 4BACA 3L2WA 1M1EB 3BC8A 1X2MA 5ICFA 1ERDA 4Q47A 4YIFA 4B1RA 1FP1D 4LG3A 1MZBA 4EMSA 4ZDPA 3OIPA 2NS0A 2PQ8A 3MKLA 4PUSA 4D7MA 5M3FJ 2C6YA 3TEDA 3Q0UA 2CMPA 2LKXA 1XMAA 3FXUA 3OR2C 1X1DA 2CFOA 4JX6A 2VASA 1IN6A 4V2FA 3SFIA 1XC5A 3AG1H 1IXRC 4LK0F 3FM5A 3DLAA 2MG4A 4B3XA 3CLQA 1BI3A 3BTJA 2W7NA 2EFQA 2Y31A 3OSGA 2LKPA 2W85A 3HIFA 2F4IA 3ZPLA 1Z3YA 2ZXWH 4XBFA 2Z1DA 3K7AJ 2VPRA 4G7ZF 2CUEA 3MZ8A 2GOMA 3AFHA 1P4XA 2KL4A 3OYCA 2M9HA 4UB8C 1RUNA 5IT9K 3S14J 2L3DA 3CF5F 2XIGA 4B8XA 3UKGA 2JSCA 1DP3A 2KIMA 2LY1A 5HDKA 1B8IA 1APLC 2HDDA 1XGNA 3S3OA 1T0FA 1BIBA 3ERED 1WJEA 2VXZA 3E3VA 3A01A 2QQ9A 3TO9A 4I2OA 5C4JJ 4PZJA 1LPQA 3GVAA 1P4WA 5HLTA 4AIHA 1S6LA 3L2RA 1ZHFA 3H3ZA 4WCGA 4XKVA 2CFXA 3RKYA 3QU3A 2OQGA 1MMSA 4PFOA 4U88A 3OSFA 4YG2F 4Q4ZF 4IOAF 2FBIA 1BI2A 2D1VA 1FX7A 4WF2A 2DFEA 3I55I 1X3WB 1YRNA 1AKHA 3ZMSA 2EWNA 4C2TA 4BDYA 4XLAA 3M8EA 4ZDLA 2DQRA 2VBWA 4XKWA 5IOZA 4C3IJ 4GYGA 1U0JA 3FKIJ 4EM2A 1UJ8A 2H6CA 2MSYA 4AWXB 1W4MA 1J7KA 2ETHA 1QHHD 2RAEA 2FBKA 2IS1A 3CJRB 2IGNA 1J2XA 3SZTA 3KP2A 5LGTA 5LEKA 5FLVA 1TW3A 2GA1A 3HRUA 3IWFA 3K4CA 3QOPA 1H0MA 3ULQB 5GTIC 4C3JJ 3OL3A 2W48A 2ZBKA 5EEGA 2YSRA 3ASOH 1OQYA 1SAUA 2M34A 3FHNA 4M3EA 1ZQ3P 1NG6A 2N8GA 3HPGA 1JKRC 2L9NA 3JCUC 2LREA 2HOTA 1OYIA 3QRFF 1ETYA 4II3A 1QZYA 3BT9A 2DK5A 4HYEA 2H27A 1SD6A 4WK8F 1XTAA 1BR1A 3JW4A 1BW5A 1DDNA 3I58A 1GHCA 2D45A 1WJAA 2L9RA 3E6MA 2L4MA 2R7OA 3HOVJ 3H9GA 2Q2EA 4EQQA 3HL2A 5FB2A 2IRFG 4PK4A 3P9CA 2VONA 2L54A 4HQMA 3CTAA 4M6VA 3P9KA 3RZDJ 1WFXA 4AC0A 3H5RA 2ZJQF 4CICA 5TRDA 2ZC2A 4XM3A 2YU3A 3MKWB 2EZLA 1ZK8A 4J00A 3TO6A 2L01A 3RYRA 4RAGA 5GTHC 1YG2A 4O6JA 4XRMA 4AVPA 3VDXA 4Z6YA 1UHSA 5D8KB 1BR2A 1JGGA 3CJQB 3QPLA 2M87A 1YO5C 4E7KA 4PJ0C 3CLOA 3N05A 1IJWC 2P0WA 1F36A 1X1AA 3V7RA 4QLCU 1A6IA 1TZLA 2DA1A 4K2EA 2DXIA 2IT0A 2M7BA 3BY6A 2CV1A 2YU9J 2KKOA 4XLFA 3S3MA 1TT5B 2CV2A 3GZ6A 3CQZJ 3ZGKA 4BJ6C 2MW8A 2ICWG 2K4JA 1LEAA 4CZCA 2HS5A 3BJAA 4IHVA 2PJRB 4KIFA 5LRSA 3BR5A 1KYWA 2O3FA 5FKMA 2E1NA 2OC6A 5KK1A 2WB1A 1S7OA 3Q3SA 2ME0A 1W7PA 3LSKA 4IPAA 3KZYA 5E8GA 3SZGA 2LY9A 1ZELA 1T95A 3GTPJ 4KMUX 2M0CA 1W5CC 1Z6TA 3SYTA 3F21A 1GVDA 1WJCA 4UB6C 5B1BH 2V6CA 3R4KA 1K78A 3I4NJ 5FKNA 1TP4A 1P7IA 4WXHA 3TOBA 3CESA 3K4JA 4C2MJ 1NK3P 1TC3C 3JTHA 2ELJA 2VJ4A 1B4AA 2JA8J 5M5XJ 4BE2A 5IT3A 2KDOA 1LB2A 1SVLA 1IN7A 3OYLA 1ENHA 1WVRA 3WTTC 4CCJA 2HXIA 1TWHJ 3LSJA 4OAZA 1FSHA 4ASNA 2MH9A 5FD6A 1Y39A 4L18B 1ODDA 1GV2A 1ON2A 3LSGA 4OMZA 1BI0A 1V3FA 2DMQA 2R7DA 5DCMB 4OIRF 1SD7A 2X1CA 2CQXA 2K9SA 2X9DA 2DQLA 3TP3A 1P4AA 5M5YJ 4Y7NJ 3PJRA 2V1UA 2QYOA 1HXDA 2DCEA 3JREA 4M3GA 4MEXF 2CQ7A 1I3QJ 3FXMA 4HA8A 1R23A 1ZAOA 2KQRA 5D6FA 1IO2A 1OYYA 1RR8C 3HB9A 3BPXA 1FIAA 3HTSB 1OKRA 2E19A 1HSJA 3LL7A 2I10A 2LF7A 2ZXHA 3CCEI 2CQQA 2HPIA 2K3PA 2EFNA 3F8MA 3FMQA 4B48A 4AIJA 3BTIA 2LDUA 4S0HB 2LYCA 3CMMA 1W1WE 1VQOI 1ULYA 1BOBA 2O8XA 3HBLA 5K1YA 2BXZA 3CO7C 1IDZA 2QCOA 5IYBJ 1NHAA 2M5WA 1ZRDA 4F93B 3S1MJ 3R61A 1QA6A 2DT7B 4KJZA 5F0FA 4I76A 2HGCA 3T8RA 1BW6A 3FXJA 3RPUD 5L3BA 2NVUB 1Y8QB 4A3MJ 3VYRB 1R5ID 3WU2C 4J19A 5E20A 1UG2A 2DTRA 2VJ5A 4EJOA 1N78A 1MBEA 4N9HA 3B6CA 3CDLA 3CCMI 1J09A 3Q0VA 2GQQA 3LFKA 4PJMA 2COMA 3BR1A 3TOAA 3ML6A 1YX3A 3T8TA 5CVIA 3CDIA 4ZYDA 5FD5A 2TCTA 1S5LC 2PEXA
chains in the Genus database with same CATH topology
5GAGJ 5DM7F 1YI2I 1VQKI 3CCSI 2ZJRF 2QEXI 1YJ9I 1YJNI 3PIOF 1YIJI 3CCUI 2ZJPF 2JQ7A 3CMAI 1YITI 1VQLI 4V19K 1VQ7I 3CCVI 1Y39A 1YHQI 1ACIA 4IO9F 1YJWI 3CMEI 5JVGF 2OTJI 3CCRI 3CJTB 1HC8A 1VQ5I 3CC7I 4UY8I 3DLLF 2QA4I 1FOXA 2K3FA 1VQ6I 2ZJQF 3CF5F 2E34A 3CCEI 5GADJ 1VQMI 1FOYA 2OTLI 3G4SI 1VQOI 4IOCF 3G6EI 3CCLI 2H8WA 3J7YJ 1VQ4I 1VQNI 1FOWA 1QA6A 5GAEJ 2FOWA 2E36A 3CCQI 1MMSA 3CC2I 2NXNB 5DM6F 4IOAF 3G71I 3PIPF 3I55I 3J7ZI 3CCMI 1VQ8I 3CCJI 3CD6I 1VQPI 5GAHJ 2E35A 3I56I 3CC4I 1S72I 1VQ9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAG J;  5DM7 F;  1YI2 I;  1VQK I;  3CCS I;  2ZJR F;  2QEX I;  1YJ9 I;  1YJN I;  3PIO F;  1YIJ I;  3CCU I;  2ZJP F;  2JQ7 A;  3CMA I;  1YIT I;  1VQL I;  4V19 K;  1VQ7 I;  3CCV I;  1Y39 A;  1YHQ I;  1ACI A;  4IO9 F;  1YJW I;  3CME I;  5JVG F;  2OTJ I;  3CCR I;  3CJT B;  1HC8 A;  1VQ5 I;  3CC7 I;  4UY8 I;  3DLL F;  2QA4 I;  1FOX A;  2K3F A;  1VQ6 I;  2ZJQ F;  3CF5 F;  2E34 A;  3CCE I;  5GAD J;  1VQM I;  1FOY A;  2OTL I;  3G4S I;  1VQO I;  4IOC F;  3G6E I;  3CCL I;  2H8W A;  3J7Y J;  1VQ4 I;  1VQN I;  1FOW A;  1QA6 A;  5GAE J;  2FOW A;  2E36 A;  3CCQ I;  1MMS A;  3CC2 I;  2NXN B;  5DM6 F;  4IOA F;  3G71 I;  3PIP F;  3I55 I;  3J7Z I;  3CCM I;  1VQ8 I;  3CCJ I;  3CD6 I;  1VQP I;  5GAH J;  2E35 A;  3I56 I;  3CC4 I;  1S72 I;  1VQ9 I; 
#chains in the Genus database with same CATH topology
 1BR4 A;  1I6H J;  2R7X A;  1Z0X A;  3F8N A;  5FRO A;  5DV5 A;  3RPQ A;  2Y48 A;  2I8D A;  3BG7 A;  4XL9 A;  2KP6 A;  1ZN2 A;  1YJ9 I;  2EK5 A;  4G7H F;  1W5S A;  3U1K A;  3E1S A;  3TO7 A;  1TQP A;  2HWV A;  2QSG X;  2JPC A;  3FMR A;  3LST A;  3KET A;  5DDG A;  3PNV A;  4AYB A;  1XS9 A;  5E8I A;  2CW8 A;  3FBI B;  4M9Z A;  5ICC A;  1T38 A;  3PQJ A;  1TWG J;  3KE2 A;  3QP5 A;  1MDM B;  1AA7 A;  3E5Q A;  1S29 A;  3WTY C;  3W6J B;  4S05 A;  4IRG A;  2E2H J;  2F5V A;  4XLH A;  3ZRG A;  3JRC A;  4BXX J;  1HQC A;  5HLH A;  2HU9 A;  2HVQ A;  4D5C A;  2O0Y A;  2K4B A;  2OJE D;  3BPV A;  3W2V A;  2A07 F;  1O3Q A;  3OIO A;  2L5Q A;  2OU2 A;  4MNU A;  2L7K A;  4ZTF A;  2O9L A;  2XUB A;  4Y52 J;  2JVH A;  2F2E A;  4A0X A;  1KU7 A;  3W6V A;  2NVQ J;  1KQ8 A;  2W1O A;  3CCR I;  2GM4 A;  5J1U A;  4R8H A;  3TP0 A;  1OMI A;  3RTR A;  1HC8 A;  1TTY A;  1VF9 A;  4XKB A;  4HEA 2;  2KT0 A;  1QPM A;  2Y9Y A;  2R0Q C;  3ZMT A;  1V55 H;  2V4J C;  3JR9 A;  2XSD C;  2KJC A;  3ZMZ A;  4BHP A;  2XRO A;  1XDU A;  2K3F A;  2HQ5 A;  3BTL A;  3FXO A;  5E3M A;  4ZZL A;  4A3F J;  5BPD A;  1KQ0 A;  3GTG J;  2FUG 2;  3BDD A;  4B43 A;  3GUD A;  3WHC A;  4XSX F;  3A02 A;  2OD5 A;  3MMY B;  5FO5 A;  1H9T A;  4CCM A;  1K61 A;  5GAD J;  1IUY A;  2XDV A;  4HDV A;  4M73 A;  4KDP A;  4IQJ A;  1WJ5 A;  1JT6 A;  5ED4 A;  2X1D A;  1GT0 C;  1ITY A;  1JT0 A;  5K7Z A;  4CCL A;  3OV8 A;  4RB2 C;  3DEU A;  3E5X A;  3JRI A;  2EQR A;  3K1N A;  2K27 A;  5HVQ C;  1RPW A;  3SDB A;  3SJM A;  3HOW J;  4XIC A;  1RRJ A;  1LUJ B;  3D0S A;  5C3E J;  2QGU A;  1BN5 A;  3H35 A;  1HW5 A;  2VLA A;  1ZYR F;  2DA4 A;  2FQ3 A;  3FKJ A;  1P7J A;  4FHT A;  4A3E J;  1G59 A;  3M1C A;  3HSE A;  3K69 A;  1Q1V A;  3LOC A;  2WAF A;  3NWS A;  3T0Y A;  2R3S A;  2EV0 A;  3E5U A;  1OCO H;  1ON1 A;  3V8J A;  5M5W J;  3F3X A;  5DUK A;  3BG3 A;  1R1V A;  4IZZ A;  4A3L J;  1ETW A;  2LBF A;  5HLG A;  1K79 A;  3DKW A;  3KP3 A;  5GPC A;  1ZRC A;  4ON0 A;  2Y0S A;  5IP7 J;  2JZY A;  1VFC A;  1V54 H;  4BY1 J;  5HOO A;  4A3J J;  1YJN I;  2IS2 A;  1FNN A;  2GIV A;  2MBF A;  2QQA A;  1FYM A;  5LRR A;  2XPV A;  4P5O A;  2F6C A;  2XPU A;  4Y17 A;  5DCM A;  4HOB A;  2R92 J;  4IHY A;  2GZW A;  4BY7 J;  3MZY A;  1JKP C;  2KZV A;  2ZB9 A;  3OS0 A;  2DDA A;  2JTV A;  1R1T A;  4FE7 A;  1PYV A;  3WGI A;  4CSW A;  3L2V A;  3K4L A;  2KMU A;  3W3C A;  1OYW A;  4G9Y A;  2BW3 B;  2B0L A;  3U1D A;  2DOF A;  4IO9 F;  1YJW I;  3HHH A;  3IKV A;  3F6O A;  3E97 A;  1WPK A;  1Z91 A;  3I59 A;  5AIP A;  2NVY J;  1X3U A;  1Q1H A;  4M9S A;  4OIP F;  3KFW X;  2RKH A;  3HTU A;  3M8F A;  4XN3 A;  1MIJ A;  2RQP A;  3I64 A;  2GBY A;  4JYK A;  4JOM A;  2X51 A;  1TWA J;  2Z5U A;  1A04 A;  5F08 A;  4FET A;  1JE8 A;  4CYC B;  5E18 F;  2P7V B;  3MKZ A;  5DTD A;  4S04 A;  4G6T B;  3IV5 A;  4C30 A;  3FIS A;  1EH8 A;  1MD0 A;  1QZE A;  4BJT A;  3PO3 J;  4X0G A;  1TW2 A;  1D1A A;  3NAU A;  1LFU P;  3UR3 C;  1W0U A;  2HDC A;  4CXF A;  4MEY F;  2O5R A;  2M0M A;  4M3F A;  3CJN A;  3IWZ A;  3GF2 A;  3BJ6 A;  1O57 A;  4NUB A;  3S17 J;  3HSR A;  3J7Y J;  4L9J A;  3HOU J;  1SFK A;  2QF7 A;  4Z2Y A;  2EV6 A;  1VQN I;  2D1H A;  4BBR J;  5KCM A;  5K5O A;  5F6F A;  1RIO H;  1IXS B;  4CCO A;  3IKT A;  2UWM A;  2DA5 A;  2FRH A;  3RCO A;  3E6C C;  2P6S A;  2XV4 S;  2PJP A;  3ZN1 A;  4KIB A;  2ID6 A;  4NC6 A;  4YFK F;  2STT A;  3JRG A;  1K4T A;  2OUM A;  1QHG A;  2Z16 A;  4KUM A;  3K4B A;  4X1E A;  1FBS A;  4HNT A;  5L3C A;  2IEK A;  1IRX A;  3A0B C;  4I02 A;  5TIS C;  3GTO J;  3HUG B;  4WX9 A;  2VQC A;  3OMY A;  1W0T A;  2M3A A;  3VOE A;  3DKY A;  1R58 A;  4RM2 A;  4EM1 A;  1FOX A;  4E7L A;  2XF7 A;  3DBL B;  5EZG A;  1ZRF A;  3BQY A;  5GAG J;  3SQN A;  2OV7 A;  2WAE A;  1YQA A;  5D4R A;  2P81 A;  1O7F A;  1MDM A;  3C2H A;  3WTS C;  1XGO A;  2E1O A;  5FFX A;  2JSP A;  2FF4 A;  1X4P A;  2X6Y A;  1ZG1 A;  2WB1 N;  2LKS A;  1R7J A;  2P5L C;  4HF1 A;  4G7O F;  3S2D J;  3QYE A;  2VBX A;  1JXS A;  3QWL A;  1XSD A;  3ZQC A;  5EEA A;  4EJU A;  2DT6 A;  2ZJP F;  1S7A A;  2HR3 A;  1V5E A;  4FQG A;  1PP8 F;  4UV9 A;  3BR6 A;  5JFR A;  3JTG A;  1F5T A;  2MD0 A;  5D5W B;  3OYB A;  3MVP A;  1O4X A;  4HDU A;  3D5S C;  4BBS J;  2V7F A;  1EH6 A;  2XAU A;  4FIS A;  1YHQ I;  1O3S A;  3RKW A;  3HPH A;  2VL8 A;  2CW7 A;  2EJR A;  4RGS A;  5LEJ A;  2P5K A;  3S16 J;  3OS1 A;  5JVG F;  3D5R C;  1Z05 A;  1TQM A;  3S3N A;  3LQQ A;  2HQA A;  2K9Q A;  1XD7 A;  2X48 A;  2QBY B;  3WGG A;  1HCR A;  3HOS A;  4IKF A;  2B7E A;  3W2A A;  1KYZ A;  4BEH B;  2R5Z A;  4L9N A;  1T6S A;  4YEJ A;  1G3S A;  4B09 A;  4AUX A;  3CUQ B;  2E5Z A;  5HNF A;  3I5U A;  3OY9 A;  2HVS A;  3LWF A;  3HEF A;  3C18 A;  3Q9V A;  2K9M A;  3GFI A;  3QPH A;  3ZQL A;  1W36 D;  1HKT A;  3SDG A;  2A6H F;  1PP7 U;  5FRM A;  2PMZ A;  4Y13 A;  2BHY A;  5LLQ A;  2IS4 A;  2HOS A;  4ZJZ A;  4IQ4 A;  1ETX A;  3TDZ C;  4N4O B;  3ZMU A;  4BU2 A;  1EH7 A;  1J9I A;  1AOY A;  3V8K A;  5H20 A;  3WTV C;  2JPB A;  3IAS 2;  3G3Z A;  5D8L B;  4IX7 A;  1JGS A;  1HBX G;  1STZ A;  4GCV A;  5E17 F;  1EF4 A;  1R4N B;  3OYE A;  5BMZ A;  3P9I A;  4M9X A;  3FF5 A;  2PI0 A;  2HYF A;  1PDN C;  1KGS A;  2MLK A;  2EA4 A;  1Y1V J;  1MMN A;  2M30 A;  1U9N A;  3CC2 I;  2HOE A;  4IXA A;  3M4O J;  3HYI A;  1SFX A;  3J81 K;  4ZYE A;  1MJB A;  2GIZ A;  3HXL A;  4ANJ A;  4PFP A;  5D5U B;  4ABZ A;  2KZG A;  2M7A A;  1YOV B;  1NH3 A;  3ZQ7 A;  1S7E A;  4ESF A;  3J80 Z;  3FM3 A;  4XR6 A;  1FEX A;  2M1B A;  4WXD A;  3SXY A;  1DUX C;  1UZC A;  2MFZ A;  2EPF A;  6PAX A;  3Q9S A;  1QRY A;  2DO7 A;  2DW4 A;  4IVN A;  2HXO A;  5BOX A;  4Q5S F;  2LLK A;  3GYH X;  2F4O B;  3H9Q A;  4U87 A;  3KZI C;  4RAF A;  2HTJ A;  3FX3 A;  1QO0 D;  1QVU A;  4C9Y A;  1JHH A;  4LJZ F;  1RZ4 A;  2FSW A;  1IN4 A;  4I0A A;  1ZLJ A;  3H92 A;  2IA1 A;  1WSU A;  3E6B A;  2ZNZ A;  2UV1 A;  1U5T C;  4BYY A;  4E7S A;  4LB5 A;  3DXJ F;  5E3O A;  2VC0 A;  2ZXI A;  2JQ7 A;  1A6Q A;  3CMA I;  1MGT A;  3V42 A;  3H36 A;  2E60 A;  1PVE A;  4BE0 A;  1FLI A;  1MSE C;  2A05 A;  4AYB N;  2W82 A;  3I4M J;  1YE9 A;  4G94 A;  4XKC A;  3H0D A;  1MJA A;  5ERI A;  3VEP A;  4I7H A;  2BYV E;  1A5J A;  1ACI A;  2VN2 A;  5IOY A;  4CYC A;  4BJ5 C;  5GP9 A;  4A5N A;  5J4Y A;  2NS8 A;  1H89 C;  2R7F A;  1U6G A;  3M8J A;  2FMY A;  1YW9 A;  3OIQ A;  1R5H A;  4LK1 F;  1XN7 A;  2DPU A;  2DMN A;  2R7W A;  3ABT A;  3VPR A;  4HLY A;  3W6K B;  3F8F A;  1ZAR A;  2DA3 A;  3CUQ C;  2L7Z A;  3KZZ A;  4D0P A;  1D5Y A;  2V9K A;  4E70 A;  3BG5 A;  4MLO A;  2VUM J;  1Z9C A;  3L2Q A;  2ZSI B;  5EG0 B;  4U0W A;  2QZ8 A;  2VKV A;  4HX8 A;  4KMF A;  2IA2 A;  2WAQ A;  5F1J A;  3G4S I;  4L0Y B;  1PJR A;  1F9N A;  1G4D A;  4YEL A;  2NRA C;  5HS9 A;  1FZP B;  2DA7 A;  5KAF C;  3RPU A;  2BY2 A;  1F1Z A;  3ABK H;  3ELK A;  1SAX A;  1PUF A;  2O8K A;  1WI9 A;  4A2U A;  2UXN A;  4R79 A;  3H9J A;  3WU1 B;  5DEQ A;  1DPR A;  4B47 A;  3S32 A;  3SZP A;  3F23 A;  1XCB A;  2OA4 A;  2STW A;  2D5V A;  1DPU A;  1Z1D A;  3CD6 I;  3WE2 A;  3K4M A;  3OWT A;  2HQR A;  1ETV A;  4Y4R A;  1PUE E;  2AS5 F;  2DT5 A;  1WKM A;  1S72 I;  3FZV A;  3TBI A;  2I5U A;  3GTM J;  3JRH A;  4EJW A;  4HX4 A;  3F72 A;  3GTQ J;  1U5T A;  5D5X B;  5C4X J;  3KYD B;  5DUI A;  4DBQ A;  3BR2 A;  4ITV A;  4L5I A;  3SHF A;  3PUF A;  2MH2 A;  3ECO A;  2VKH A;  5K7H A;  3GFL A;  3U9G A;  5EGO A;  5CJ9 A;  3R0J A;  4H0E A;  3OYN A;  1HW2 A;  3L9F A;  2DOE A;  5CVU A;  3NQO A;  4BQO A;  3OYD A;  1T56 A;  1BM9 A;  3HM5 A;  2X85 A;  2O7O A;  2ZO4 A;  2Y0S N;  3LSP A;  4OU0 A;  1JTX A;  2QSF X;  1YIT I;  1G8X A;  2WV0 A;  2LY2 A;  4KFC A;  2WAD A;  3MEX A;  4BDZ A;  4O5V A;  2V1N A;  3JSP A;  3JRF A;  2LK2 A;  4NC8 A;  4CYD A;  4ESB A;  2KLO A;  2VJI A;  2HDW A;  2A5Y B;  5C44 J;  4KIC A;  2G9W A;  3CME I;  2Z3Y A;  1DU0 A;  1D1B A;  3K4K A;  2OAZ A;  3N97 A;  3CUQ A;  2R5Y B;  1E17 A;  4RA2 A;  3T5X A;  1R49 A;  3C2G A;  4HNV A;  2CO5 A;  3M07 A;  4LLN A;  2P6T A;  1KU2 A;  5E1Z B;  2AQE A;  4KIS A;  1E2X A;  1I6X A;  3K70 D;  1RC9 A;  1DP7 P;  1B72 B;  1MJ9 A;  1FBQ A;  2VOO A;  2DA2 A;  1JUP A;  2DJI A;  3KIO A;  1Z7L A;  2VKD A;  3S8P A;  3KP6 A;  2WTE A;  4DYC A;  1IRZ A;  2RQQ A;  4A5M A;  3QOD A;  3JSO A;  1A31 A;  2L9V A;  3H3U A;  3RQI A;  1RI7 A;  2JN6 A;  4PJN A;  1E3H A;  3KLO A;  4OAY A;  3M3Y J;  2L0K A;  1WH7 A;  1D8J A;  3O8H A;  2A68 F;  4HV6 A;  3RSN A;  2LRD A;  2BY3 A;  5LGN A;  4OIO F;  3EYI A;  1T33 A;  1RR7 A;  5L3G A;  2F5F A;  1GXP A;  3OYK A;  3LSI A;  3RKQ A;  3HGY A;  2VOP A;  1EKE A;  2XAH A;  2JK3 A;  2P5V A;  2E36 A;  4RMN A;  5FGM A;  2RV8 A;  4BNC A;  2VBZ A;  3KPH A;  1R36 A;  3R0A A;  4IRI A;  5L3E A;  2BVM A;  1O7L A;  3LAP A;  4I0B A;  5IYC J;  1OCR H;  2IGM A;  1YIO A;  1OIS A;  2E5N A;  4PGH A;  4RB0 A;  2KIS A;  2ZFU A;  1JUM A;  4QWQ A;  2CUF A;  4XLN F;  1H88 C;  2E35 A;  3ZP5 A;  4CZZ A;  2O03 A;  2R7V A;  2H94 A;  3DQV C;  4EGZ A;  3RYP A;  3WOD F;  3J80 K;  3A03 A;  4XOR A;  5IPA A;  4G6D A;  2KDZ A;  2JT1 A;  2RDP A;  1Y56 A;  3VOD A;  1U9O A;  3PUB A;  3PFI A;  1R5G A;  3RDI A;  2VIX A;  3LQR A;  1WJD A;  1LDD A;  4G12 A;  3TQN A;  5JVT A;  1Z77 A;  3OYH A;  1SFU A;  1Z3X A;  1IN8 A;  2L4A A;  5CYV A;  5J6X A;  2DLL A;  1DQU A;  4IEJ A;  4DIQ A;  5H6R A;  3OOU A;  2W4S A;  3CDH A;  4CCN A;  2QWW A;  3HHG A;  3RIR A;  1HKS A;  1IN5 A;  1ZKG A;  2VQH A;  1IDY A;  1EJ9 A;  1WQ2 A;  3JAM Z;  2PX9 A;  2FX0 A;  5HOD A;  2P7C B;  2FNP A;  3BR3 A;  5KVR A;  1EA3 A;  1H9G A;  4Y33 A;  5L3D A;  5J47 A;  1J5Y A;  5FLX Z;  2HI3 A;  1ETO A;  4XRS A;  4GXO A;  2PBI A;  3HGG A;  4DW6 A;  2H1K A;  3CJT B;  5EEH A;  1G3Y A;  3FXR A;  3KCC A;  3K0L A;  1IZ1 A;  1KZH A;  3V7C A;  3K1M A;  4HAM A;  1LVA A;  4UVA A;  3DV8 A;  2CYY A;  2BGC A;  3ZN0 A;  5J1R A;  2HYJ A;  2PMH A;  3PSF A;  5KHD A;  5A2Q Z;  4DOZ A;  9ANT A;  2RNG A;  5GPA A;  4F55 A;  3GLL A;  1UEL B;  1AU7 A;  2BXY A;  5JHF A;  2VC1 A;  2E34 A;  1XSX A;  3W2W A;  4RBO A;  2CG4 A;  1JHF A;  4LOC A;  4DBR A;  1IC8 A;  2R7T A;  5IT9 Z;  3KEO A;  2H6B A;  2Y69 H;  1FOY A;  2HKX A;  1YW8 A;  3TGN A;  1MMG A;  3PSI A;  5E3N A;  1JUS A;  4NQW B;  1D0X A;  3CCL I;  2F4M B;  2G0E A;  2CJJ A;  3O6B B;  4A6E A;  4BHB A;  4L9T A;  4H4K C;  2PMZ N;  5CVV A;  3MFK A;  2FOW A;  2LC2 A;  3HRS A;  1W7P D;  4B3A A;  2BEO A;  2VPL A;  4XON A;  2NXN B;  3ERM A;  3G71 I;  3PIP F;  1ETQ A;  1QQI A;  2B9S A;  1BC7 C;  4XLP F;  3BOQ A;  4B44 A;  1LFP A;  1FSE A;  3S1R J;  4M71 A;  4CCK A;  4MQV A;  4RGR A;  2ZSH B;  5DYM A;  5JLX A;  2Y0M A;  2X4H A;  2VE8 A;  1RKT A;  5HS8 A;  4NB5 A;  1XGM A;  4EGY A;  1O3T A;  2RRE A;  3F0C A;  4EAT A;  2R4G A;  5CPR B;  3DBH B;  4CGZ A;  4OIN F;  2PJR A;  5H2F C;  1KQ9 A;  1YI2 I;  2K85 A;  1FBU A;  2YX4 A;  3DU6 A;  2G7H A;  2ZKZ A;  1ZH5 A;  1MND A;  4JP0 A;  4U7B A;  3WU0 A;  1ZGA A;  4NHJ A;  3LFU A;  4ESJ A;  4RLQ A;  3OOP A;  3B73 A;  4QIW N;  2RGV A;  2E71 A;  5EF6 A;  3MZH A;  1CF7 B;  3C7J A;  2BZT A;  1YIJ I;  1XCV A;  5LHG A;  2K9N A;  2LR8 A;  1P6R A;  2QEN A;  3K2A A;  1SEU A;  4IJA A;  3WE3 A;  2R5Y A;  3DBR B;  3WTZ A;  4D1Q A;  2MA3 A;  2LP0 A;  5LGU A;  4GDF A;  2DFH A;  1TL8 A;  3EPZ A;  2CH0 A;  2YX7 A;  2FA5 A;  1I5Z A;  2ACJ A;  4BH9 A;  1B72 A;  4QTR A;  1QVT A;  2ZFW A;  4CO8 A;  1A35 A;  2F5E A;  3ROU A;  1B6A A;  2IGK A;  2IVM A;  4RGX A;  2UXX A;  1C0W A;  1TBX A;  4EVI A;  2WY7 Q;  2PN6 A;  1WH5 A;  4DQ2 A;  2XRN A;  5J40 A;  4BQN A;  2L7M P;  5HS7 A;  3KLN A;  2VOD A;  1R9T J;  5M3M J;  2ECB A;  2M2E A;  1FPQ A;  2L7F P;  2HVR A;  4YRV A;  4XLC A;  5HDG A;  3KP4 A;  3LSM A;  5FKK A;  2QSH X;  1T98 A;  1VQM I;  2IA0 A;  4Y3O A;  4OIQ F;  2W00 A;  1XSV A;  1SMY F;  1GXQ A;  2DU9 A;  3ABU A;  2QVO A;  1BOA A;  2DMU A;  4L5E A;  1E3P A;  1XMX A;  3JRD A;  1YFH A;  3PQK A;  3OYJ A;  2CSO A;  3C3W A;  2EA2 A;  3L00 A;  3I71 A;  1YLF A;  3OYA A;  1Z7U A;  3BG6 A;  1AKH B;  2WAQ N;  3TKY A;  3CF2 A;  4MHG A;  1HKQ A;  2YS9 A;  3LA2 A;  2FXA A;  4Q48 A;  2GLO A;  4M74 A;  2QLZ A;  4IHS A;  1ZTR A;  1MBF A;  2JUC A;  3BCA A;  3ASN H;  2G7U A;  1BA5 A;  3Q0W A;  4EM0 B;  3F22 A;  2FNA A;  2MAB A;  3ESW B;  2DFI A;  3AL0 B;  3KP7 A;  4HST A;  2ISZ A;  4MTD A;  2FML A;  3ABL H;  1R6R A;  2OZ6 A;  2GXB A;  1X1B A;  2IPQ X;  5DM7 F;  4M72 A;  4ZDO A;  4CDG A;  3BZK A;  1MH4 A;  3S15 J;  3RZO J;  2ZJR F;  1N77 A;  2VXD A;  1K7A A;  1SVM A;  2OCE A;  3J7A Y;  4PSX A;  2RN7 A;  1GV5 A;  1JTY A;  4LB6 B;  3MAJ A;  3O2P E;  4YII A;  3C1D A;  1R22 A;  2TDX A;  4I09 A;  4X6A J;  4M3B A;  2UUZ A;  3EUH C;  2LF8 A;  5H6Q A;  1KU9 A;  5IP9 J;  2MC4 A;  3DFG A;  3P5J A;  4MO7 A;  1AHD P;  4AD9 A;  4DZJ A;  4QSH A;  2WBM A;  2XGX A;  2GAU A;  3BZC A;  3MKY B;  3DPL C;  4UVC A;  5TGT A;  4RAY A;  1ONV A;  2Q2E B;  4HRI A;  1J59 A;  4EJV A;  3JAM K;  3L2U A;  2CU7 A;  4AM3 A;  2DI3 A;  2OTJ I;  1D0Z A;  2LMD A;  3GFM A;  1TT0 A;  3TL4 X;  2PFB A;  5IY5 H;  4MGR A;  2NAZ A;  3BCB A;  4IF4 A;  2K9L A;  4LIU A;  2XHK A;  1ZG3 A;  3NRV A;  2IW5 A;  3CMY A;  2HOA A;  3FWE A;  5E79 C;  5ILU A;  1ZGW A;  4LFU A;  4ENJ A;  1VQ6 I;  2JJ7 A;  2R7Q A;  1GVJ A;  2EFP A;  4NQW A;  2COB A;  4NBQ A;  4TV7 A;  1U8B A;  3FK7 A;  1UMQ A;  3K70 C;  2HYG D;  3MCZ A;  3M9A A;  3GTK J;  3V4G A;  4HZF A;  4CUG A;  3HKZ A;  2Y75 A;  3BP8 A;  1U2W A;  3H1C A;  2HKO A;  3HC7 A;  4JX5 A;  4P96 A;  2ZCW A;  3F8B A;  4CHU A;  2W57 A;  1LEB A;  1FP2 A;  2KHM A;  2WA0 A;  1P2F A;  1R71 A;  4IOC F;  3K4N A;  3VFZ A;  1ZR2 A;  4ZZD A;  2H8W A;  2A6T A;  4DJA A;  2Y30 A;  1FOW A;  2Y2Z A;  2QQB A;  4LLL A;  2A6E F;  3I4P A;  2V26 A;  4RB3 C;  5JHU A;  4XRF A;  5LBQ A;  4E4H A;  3WG7 H;  2Z2S B;  3ZMV A;  2EZI A;  3I3L A;  4GO1 A;  2CV0 A;  4UV8 A;  4N0B A;  3WGH A;  4E6K G;  1W7P B;  3RKX A;  4FTH A;  2JA2 A;  4JQF A;  3GWZ A;  1ZR4 A;  4HG2 A;  2X6O A;  1ZGJ A;  4OMY A;  1POG A;  3HRM A;  4HX7 A;  5LD2 C;  3AL0 C;  1K78 B;  1I1G A;  3BZ6 A;  3ZQI A;  3G1O A;  4I6Z A;  3CC4 I;  2J5P A;  3TW6 A;  2FE3 A;  1IAW A;  2JA5 J;  3K10 A;  1CF7 A;  2EZH A;  3CCS I;  4CA0 A;  2CUZ A;  4KIT B;  1Z67 A;  2LSO A;  5JR3 A;  5D4S A;  3EUH A;  2R7Z J;  5J3L A;  4KYW A;  3BQZ A;  4KN7 X;  1V5F A;  4B4C A;  2LOO A;  2NS7 A;  2HTS A;  2IP2 A;  2W25 A;  1XB4 A;  2Z9O A;  3DF8 A;  2LVS A;  1FIP A;  3L09 A;  1ETK A;  4M6X A;  1QPI A;  1T08 B;  3OYI A;  1I27 A;  3S1N J;  2ID3 A;  1T39 A;  1D0Y A;  4G6Q A;  1IW7 F;  3RJP A;  2XAS A;  5B5E C;  3DU5 A;  1AWC A;  1F43 A;  2E1C A;  3GX4 X;  1DGW Y;  2GXG A;  4J01 A;  4LGW A;  4JBA A;  2QUF A;  4PJJ A;  3VB2 A;  1TNT A;  1I3A A;  2VQG A;  4NC7 A;  5K7F A;  4II2 A;  5KNL A;  4A3K J;  3HDD A;  3GEZ A;  4P9F A;  4ETS A;  2IXS A;  3QYF A;  5KAI C;  1WJF A;  2E7X A;  4MIM A;  2XKP A;  1MMA A;  1SD4 A;  4V2G A;  5CVR A;  2EBI A;  4UVB A;  4BHC A;  5J8F A;  1BL0 A;  1X1P A;  4ZYG A;  2LG4 A;  2PMU A;  3CC7 I;  3HOY J;  1B1B A;  2BW3 A;  3HSF A;  4LIV A;  5BQT A;  3HZJ A;  3DLL F;  2QA4 I;  3QAH A;  5F27 A;  4KA4 A;  3KX2 A;  3REO A;  4BQA A;  2PLY A;  2WC2 A;  2Z99 A;  1P92 A;  3L7W A;  5AON A;  2XKO A;  3DEW A;  3QP6 A;  4BAY A;  3S2W A;  3CO6 C;  4RB1 A;  1WZ2 A;  2VT2 A;  3BWG A;  4XK4 A;  1QU3 A;  2VT3 A;  1IXC A;  4IL6 C;  3UNG C;  2ZME B;  3HOT A;  2FU4 A;  3HRT A;  1OCZ H;  5CLS A;  1WRJ A;  4IHT A;  4A3G J;  3GZ5 A;  1VQ4 I;  4QPO A;  3FHZ A;  3GLX A;  2LNB A;  1U8R A;  1K6O A;  2EV5 A;  3PO2 J;  3ZOB A;  2H1L A;  1BI1 A;  3SEQ A;  5ILV A;  3CZ6 A;  1WHU A;  1D3Y A;  1EV7 A;  2F48 A;  1I50 J;  2DDB A;  3VYU B;  2GXA A;  4HF0 A;  1Y6I A;  2A3S A;  4NNJ A;  5EYR A;  5DM6 F;  4LD5 A;  2BOL A;  4XNF A;  1V4R A;  4UUS B;  1VI0 A;  2R7U A;  1Z21 A;  1XDS A;  3ISP A;  4L5J A;  3J7Z I;  4MTE A;  3R6S A;  1LQ1 A;  3PM1 A;  2Z33 A;  2R93 J;  1TNS A;  1G3T A;  3KP5 A;  3CCJ I;  1BJZ A;  1JI8 A;  3NEU A;  2FOK A;  1W5T A;  1LNW A;  5GAH J;  3L1P A;  1MSF C;  2JVG A;  3MWM A;  5JI6 A;  4HLX A;  1WGX A;  3DPU A;  4AU7 A;  2JUG A;  2EIM H;  5B3S H;  1TWF J;  3L2C A;  2DMP A;  2M4G A;  5HNH A;  2GOX B;  3I9V 2;  5K5R A;  1REP C;  2A61 A;  3HUG A;  1I39 A;  3K9T A;  3ZQF A;  1G2H A;  3A4C A;  4KT5 C;  2CUJ A;  3NWT A;  2CS3 A;  1JJ8 C;  1FT9 A;  4OOI A;  3ZCO A;  3DCF A;  1Y1W J;  2L02 A;  4P55 A;  2CQN A;  1K6Y A;  2EH3 A;  1K83 J;  2V9V A;  2NVX J;  3LMM A;  3CCU I;  3VYS B;  2MD5 A;  1WI3 A;  4PCQ A;  3IH4 A;  3FBN B;  3IUO A;  4UXN A;  2MGQ A;  4V19 K;  3VWB A;  4BXU A;  3JRA A;  3GZN B;  3SEZ A;  4HNU A;  4QPQ A;  1VQ7 I;  3CCY A;  4EV0 A;  2R7R A;  5EJC A;  1R1U A;  4XQF A;  1YS7 A;  2EIJ H;  1U3E M;  2JMW A;  4RS8 A;  4WXC A;  2OZU A;  3G1M A;  1LE8 B;  5JLW A;  1SD5 A;  3LA7 A;  3HOZ J;  2PG4 A;  3QOE A;  3D1N I;  5CVJ A;  1WCM J;  2BBY A;  3B6A A;  3F9K A;  3IP4 B;  4MFE A;  3IL2 A;  4GFB A;  3TDU C;  4D7N A;  3BLY A;  2KIQ A;  4Y15 A;  4IHW A;  2CQK A;  2VBY A;  2QBY A;  1SFO J;  2XSJ C;  4RM3 A;  2AHQ A;  4W1U A;  2QKM B;  2WV1 A;  1UB9 A;  1HLV A;  2XB5 A;  2D2W A;  4BEH A;  2ZME C;  4MFD A;  1FTZ A;  2DN0 A;  4LG0 B;  4A6D A;  5EZH A;  3BG9 A;  3EDP A;  2KRC A;  1IUF A;  2X0L A;  1WJB A;  4KN4 X;  2KIU A;  4I98 B;  3FIW A;  3I0T A;  4BXF A;  1XPX A;  5B66 C;  4LIT A;  4ENK A;  3GBG A;  3OS2 A;  4PSW A;  4HF2 A;  2E2J J;  1YW7 A;  1UG0 A;  3U2R A;  4XID A;  1NTC A;  2RVC A;  3EUA A;  5DS9 A;  4KNY A;  3WTX C;  2WWY A;  1D5V A;  2HZT A;  1FTT A;  3QPS A;  2OF7 A;  3SFZ A;  1D1C A;  3KYC B;  2EZK A;  1FJL A;  3U21 A;  4F7Z A;  1S3J A;  2LBF B;  5D6E A;  5BPI A;  4GYI A;  1Y0U A;  4P9U A;  2DAO A;  2IS6 A;  2EFW A;  1X58 A;  2K02 A;  3B02 A;  3QYB A;  3OYG A;  2B63 J;  2E7W A;  4PGG A;  2NVT J;  5J8C A;  2JA7 J;  2QQ8 A;  1B9M A;  2DA6 A;  3MQ0 A;  5L3F A;  1J75 A;  2A5W A;  5FKO A;  3QPT A;  2X6X A;  3BJO A;  3K1P A;  1KA8 A;  1LKX A;  2XAJ A;  3PL8 A;  2BHZ A;  1DU6 A;  2KFD A;  1KON A;  3FK6 A;  3TW7 A;  2KPM A;  4DZP A;  4XOP A;  1LVK A;  2IAI A;  3RQ4 A;  3FDY A;  3PIO F;  3IH2 A;  4UUV A;  1J0R A;  1UFM A;  3F8C A;  4M3D A;  1B9N A;  3GXO A;  2QM3 A;  4BUP A;  1IF1 A;  1ZG5 A;  1E3O C;  2ELH A;  2K40 A;  3E6D A;  3K2Z A;  2IJL A;  2W84 A;  4HQE A;  2DTZ A;  3ZQQ A;  1VQL I;  3OYM A;  5B1A H;  3DP7 A;  1Y8R B;  3I59 B;  1HST A;  2V9P A;  2EFO A;  1Z6R A;  3M1E A;  4A3D J;  2K5C A;  4RAZ A;  4L0Z B;  1SFE A;  1SAN A;  4AIK A;  3GME A;  1D8K A;  4JK1 X;  4RDU A;  5DCF A;  4HV5 A;  5E3L A;  2ME6 A;  1TWC J;  3F6V A;  3BR0 A;  1RUO A;  3BTC A;  2AO9 A;  4GGG A;  2K7L A;  2O6G E;  1LDK B;  2DPD A;  1A36 A;  2YR2 A;  4AID A;  1HOM A;  2JA6 J;  2ZME A;  2V79 A;  2XRL A;  2W24 A;  2VQL A;  4YIR X;  1T2K A;  1FMV A;  1MW7 A;  3DTI A;  2VJJ A;  1G6N A;  5BNG A;  2CWE A;  1QBJ A;  2LD5 A;  1TQI A;  1FWZ A;  4WWC A;  4HSR A;  4XOT A;  1GDT A;  2BE5 F;  2VI6 A;  3G73 A;  3AG2 H;  2CGP A;  1H8A C;  3IHU A;  2UZK A;  1FYL A;  3C2B A;  3FXQ A;  1U78 A;  2OQR A;  5EG0 A;  4BGD A;  4UUS A;  2JRT A;  3AG3 H;  1SMT A;  5GAE J;  2E1M B;  2JWT A;  3HKZ N;  4KIG A;  1MNE A;  3EYY A;  2HZD A;  3FXK A;  4D9J A;  1BBY A;  1V5G A;  2M4K A;  2M8E A;  4RGU A;  2XF6 A;  3CP2 A;  3COA C;  1OLT A;  1QNT A;  4DYR A;  2DOD A;  3LSR A;  1XGS A;  2NNY A;  2MYS A;  3WTW C;  4BKX A;  2IBD A;  3ONQ A;  1W36 C;  3WHB A;  1S9H A;  1VQ8 I;  4PJL A;  4ZH4 F;  1JJ6 C;  1R00 A;  3LSH A;  3LA3 A;  1XMK A;  1MBH A;  2XGE A;  3E0J B;  2AXT C;  5HDN A;  2H09 A;  4U0V A;  1ORK A;  2HQN A;  2XAF A;  1L0O C;  3TMO A;  3DTE A;  3MN2 A;  4BE1 A;  1VTN C;  2ELK A;  3H0G J;  2XGC A;  4DGW B;  4C3H J;  4IHX A;  3HOX J;  5FFZ A;  1UHW A;  1K4S A;  1LDJ A;  2NNN A;  3CUO A;  4O3M A;  4D5F A;  2ADU A;  2EIN H;  3DKX A;  3V8L A;  4A3C J;  1FOK A;  5HLI A;  3E7L A;  1MBG A;  1X2N A;  4HPQ A;  5DD4 A;  4U7D A;  4ZTJ A;  1X3Z B;  1FC3 A;  1QZZ A;  3I53 A;  3ZMD A;  1XG1 A;  2M8G X;  1HW1 A;  2KRF A;  2FEZ A;  3P7N A;  3PNY A;  1LE8 A;  1F4K A;  2H8R A;  3GTL J;  1IRG A;  3AKZ A;  1OCT C;  2O61 A;  2ISY A;  1IV8 A;  1YYV A;  3DWL E;  4BL0 B;  3LNQ A;  2XVC A;  1RNL A;  3H5N A;  3A2K A;  3CCV I;  1GLN A;  1X19 A;  5LFA A;  1T8I A;  3JRB A;  5IP6 A;  2HPM A;  2LTP A;  4HW0 A;  5F64 A;  2HNH A;  2GWR A;  1P9Q C;  1OFC X;  4ENM A;  2R5Z B;  3H5A A;  1X4O A;  3IRR A;  4MQ9 F;  2V6E A;  2GA2 A;  1S8N A;  3EQL F;  3WG9 A;  4AVZ A;  4UY8 I;  4XMY A;  2JRM A;  4G8X A;  5J1Y A;  2DMT A;  2IGO A;  5ILS A;  4LG0 A;  3J81 Z;  1JKQ C;  4U0Y A;  4XSZ F;  2EIL H;  3OR1 C;  4EJT A;  3WTU C;  1USS A;  2P8T A;  2LH9 A;  2YPR A;  3OL4 A;  2EIK H;  5J4V A;  4KT6 A;  1Y0N A;  3IRQ A;  4FAS D;  2OTL I;  3M7G A;  3OYF A;  3S2H J;  1UAA A;  1BC8 C;  2ZNY A;  2CRG A;  4IRH A;  2YUS A;  2ESH A;  3G6E I;  5F0H A;  5E1W A;  2RNJ A;  3T1B A;  3EUK L;  1L3L A;  1NK2 P;  5DD8 A;  3NAR A;  2E1M C;  3X2Q H;  1B8I B;  2E2I J;  3S93 A;  1HDD C;  5E1X A;  3QQA A;  2HEO A;  2Q0O A;  3I54 A;  1SC7 A;  2X6W A;  5K5Q A;  5FRN A;  3FMS A;  3A01 B;  2V1D A;  5F0C A;  1NG7 A;  1R4M B;  3DPT A;  4N4N B;  1SVO A;  4N9I A;  4FX4 A;  1MNM C;  1OCP A;  3G2B A;  1RES A;  4FCY A;  4I01 A;  2OCC H;  3GW2 A;  2DYR H;  1OR7 C;  2BV6 A;  2VKE A;  3KEY A;  3EET A;  5CQG A;  1LJ9 A;  2ECC A;  1MBJ A;  1FYK A;  1VQP I;  3ZR8 X;  3J7A O;  2DK8 A;  1YX5 A;  4E7Z A;  5FLM J;  3A1Y A;  3PFY A;  5ICE A;  3I56 I;  1WWX A;  2FBH A;  1ZRE A;  3ZQG A;  2CW0 F;  4FE4 A;  1YRN B;  2FJ1 A;  3ABM H;  5AIQ A;  1ZLK A;  2MC3 A;  4BS9 A;  5LHI A;  2DJN A;  1DGR M;  2WY8 Q;  2XF5 A;  4ZYA A;  5ICG A;  4C2U A;  3VSK A;  4F91 B;  1BIA A;  1OJL A;  3BRO A;  2DBB A;  2XC7 A;  4R1H A;  4PDK A;  5D5V B;  4RLF A;  3H3V K;  2A69 F;  2BY0 A;  2Q8K A;  2L2O A;  1MKM A;  5FKL A;  4YFN F;  5CKT A;  1RET A;  2XAQ A;  3RI4 A;  4UHT A;  5IYD J;  2FQ4 A;  4A69 C;  1HA8 A;  2KJB A;  2J5O A;  2RC4 A;  3GFJ A;  4GRI A;  1FMW A;  4YFX F;  1G3W A;  1BJA A;  1MMD A;  4LLG F;  1HDP A;  3ECH A;  2ZXJ A;  4NDL A;  3O3K A;  4DYQ A;  3VYT B;  2XGD A;  3QU6 A;  3A0H C;  3PNT A;  1IGN A;  2F5C A;  1KU3 A;  3S1Q J;  2K86 A;  2F5D A;  4E7J A;  5EDN A;  4XN0 A;  4A3B J;  3G1L A;  4E7I A;  2NYX A;  2M45 A;  1YTY A;  1VQ5 I;  3GCM A;  1O3R A;  4LMY A;  2KIF A;  2L9S A;  2QKL B;  3IC7 A;  4M6Y A;  1UST A;  1YS6 A;  2BVL A;  2DFF A;  3CP8 A;  4CH7 A;  2DOA A;  2HFH A;  4F3Q A;  4A3I J;  2Y9Z A;  1VZ0 A;  1IG7 A;  2NOJ B;  3AG4 H;  3K6G A;  4L9V A;  4FX0 A;  5F04 A;  1JKO C;  2LFB A;  3D5L A;  1OCC H;  4OWR B;  3N4M A;  2ZJ2 A;  2TRT A;  2R7S A;  4XRS G;  3ZXS A;  3KYL A;  2Q1Z B;  1IRF A;  1FY7 A;  1N75 A;  3KEQ A;  1X1C A;  4JX4 A;  4BQQ A;  1PUF B;  4ZYH A;  4I99 C;  5BS6 A;  3IAM 2;  4E7H A;  4HBL A;  4ENN A;  5FLX K;  2ESN A;  2FD5 A;  1LFB A;  1GUU A;  2OBP A;  1E0E A;  1RKW A;  1MBK A;  3ZQH A;  3DEE A;  1HF0 A;  5LHH A;  1OR7 A;  1XX5 A;  3HG9 A;  4F52 A;  1QGP A;  3DTK A;  1T0F C;  5FJ8 J;  4W97 A;  2V1X A;  5CQE A;  3CCQ I;  2XPW A;  1IV6 A;  3FXL A;  1OPC A;  1VND A;  2EB7 A;  4DNC A;  3LAJ A;  2X1E A;  4UUT A;  5A2Q K;  3O8G A;  4ZC3 A;  3VSL A;  2BY1 A;  5F1R A;  3GTJ J;  1UHM A;  4UNO A;  1CQT A;  2VB6 A;  4A0Y A;  3Q5F A;  1U5T B;  1B59 A;  4A93 J;  3IH3 A;  2VE9 A;  5TJJ A;  1MH3 A;  2NOG A;  2XAG A;  3GO5 A;  1VQ9 I;  2MLG A;  4F92 B;  2XB0 X;  4XLE A;  4P1W A;  5EGO B;  1UCR A;  1VQK I;  2AQF A;  2KRH A;  3AAF A;  2AXL A;  2P4W A;  4A0Z A;  3R60 A;  1N25 A;  4FT8 A;  4A12 A;  4EEF G;  3MD2 A;  2QEX I;  1I1S A;  3HJE A;  1TLH B;  2DYS H;  2OPT A;  3V7S A;  1CGP A;  4BAC A;  3L2W A;  1M1E B;  3BC8 A;  1X2M A;  5ICF A;  1ERD A;  4Q47 A;  4YIF A;  4B1R A;  1FP1 D;  4LG3 A;  1MZB A;  4EMS A;  4ZDP A;  3OIP A;  2NS0 A;  2PQ8 A;  3MKL A;  4PUS A;  4D7M A;  5M3F J;  2C6Y A;  3TED A;  3Q0U A;  2CMP A;  2LKX A;  1XMA A;  3FXU A;  3OR2 C;  1X1D A;  2CFO A;  4JX6 A;  2VAS A;  1IN6 A;  4V2F A;  3SFI A;  1XC5 A;  3AG1 H;  1IXR C;  4LK0 F;  3FM5 A;  3DLA A;  2MG4 A;  4B3X A;  3CLQ A;  1BI3 A;  3BTJ A;  2W7N A;  2EFQ A;  2Y31 A;  3OSG A;  2LKP A;  2W85 A;  3HIF A;  2F4I A;  3ZPL A;  1Z3Y A;  2ZXW H;  4XBF A;  2Z1D A;  3K7A J;  2VPR A;  4G7Z F;  2CUE A;  3MZ8 A;  2GOM A;  3AFH A;  1P4X A;  2KL4 A;  3OYC A;  2M9H A;  4UB8 C;  1RUN A;  5IT9 K;  3S14 J;  2L3D A;  3CF5 F;  2XIG A;  4B8X A;  3UKG A;  2JSC A;  1DP3 A;  2KIM A;  2LY1 A;  5HDK A;  1B8I A;  1APL C;  2HDD A;  1XGN A;  3S3O A;  1T0F A;  1BIB A;  3ERE D;  1WJE A;  2VXZ A;  3E3V A;  3A01 A;  2QQ9 A;  3TO9 A;  4I2O A;  5C4J J;  4PZJ A;  1LPQ A;  3GVA A;  1P4W A;  5HLT A;  4AIH A;  1S6L A;  3L2R A;  1ZHF A;  3H3Z A;  4WCG A;  4XKV A;  2CFX A;  3RKY A;  3QU3 A;  2OQG A;  1MMS A;  4PFO A;  4U88 A;  3OSF A;  4YG2 F;  4Q4Z F;  4IOA F;  2FBI A;  1BI2 A;  2D1V A;  1FX7 A;  4WF2 A;  2DFE A;  3I55 I;  1X3W B;  1YRN A;  1AKH A;  3ZMS A;  2EWN A;  4C2T A;  4BDY A;  4XLA A;  3M8E A;  4ZDL A;  2DQR A;  2VBW A;  4XKW A;  5IOZ A;  4C3I J;  4GYG A;  1U0J A;  3FKI J;  4EM2 A;  1UJ8 A;  2H6C A;  2MSY A;  4AWX B;  1W4M A;  1J7K A;  2ETH A;  1QHH D;  2RAE A;  2FBK A;  2IS1 A;  3CJR B;  2IGN A;  1J2X A;  3SZT A;  3KP2 A;  5LGT A;  5LEK A;  5FLV A;  1TW3 A;  2GA1 A;  3HRU A;  3IWF A;  3K4C A;  3QOP A;  1H0M A;  3ULQ B;  5GTI C;  4C3J J;  3OL3 A;  2W48 A;  2ZBK A;  5EEG A;  2YSR A;  3ASO H;  1OQY A;  1SAU A;  2M34 A;  3FHN A;  4M3E A;  1ZQ3 P;  1NG6 A;  2N8G A;  3HPG A;  1JKR C;  2L9N A;  3JCU C;  2LRE A;  2HOT A;  1OYI A;  3QRF F;  1ETY A;  4II3 A;  1QZY A;  3BT9 A;  2DK5 A;  4HYE A;  2H27 A;  1SD6 A;  4WK8 F;  1XTA A;  1BR1 A;  3JW4 A;  1BW5 A;  1DDN A;  3I58 A;  1GHC A;  2D45 A;  1WJA A;  2L9R A;  3E6M A;  2L4M A;  2R7O A;  3HOV J;  3H9G A;  2Q2E A;  4EQQ A;  3HL2 A;  5FB2 A;  2IRF G;  4PK4 A;  3P9C A;  2VON A;  2L54 A;  4HQM A;  3CTA A;  4M6V A;  3P9K A;  3RZD J;  1WFX A;  4AC0 A;  3H5R A;  2ZJQ F;  4CIC A;  5TRD A;  2ZC2 A;  4XM3 A;  2YU3 A;  3MKW B;  2EZL A;  1ZK8 A;  4J00 A;  3TO6 A;  2L01 A;  3RYR A;  4RAG A;  5GTH C;  1YG2 A;  4O6J A;  4XRM A;  4AVP A;  3VDX A;  4Z6Y A;  1UHS A;  5D8K B;  1BR2 A;  1JGG A;  3CJQ B;  3QPL A;  2M87 A;  1YO5 C;  4E7K A;  4PJ0 C;  3CLO A;  3N05 A;  1IJW C;  2P0W A;  1F36 A;  1X1A A;  3V7R A;  4QLC U;  1A6I A;  1TZL A;  2DA1 A;  4K2E A;  2DXI A;  2IT0 A;  2M7B A;  3BY6 A;  2CV1 A;  2YU9 J;  2KKO A;  4XLF A;  3S3M A;  1TT5 B;  2CV2 A;  3GZ6 A;  3CQZ J;  3ZGK A;  4BJ6 C;  2MW8 A;  2ICW G;  2K4J A;  1LEA A;  4CZC A;  2HS5 A;  3BJA A;  4IHV A;  2PJR B;  4KIF A;  5LRS A;  3BR5 A;  1KYW A;  2O3F A;  5FKM A;  2E1N A;  2OC6 A;  5KK1 A;  2WB1 A;  1S7O A;  3Q3S A;  2ME0 A;  1W7P A;  3LSK A;  4IPA A;  3KZY A;  5E8G A;  3SZG A;  2LY9 A;  1ZEL A;  1T95 A;  3GTP J;  4KMU X;  2M0C A;  1W5C C;  1Z6T A;  3SYT A;  3F21 A;  1GVD A;  1WJC A;  4UB6 C;  5B1B H;  2V6C A;  3R4K A;  1K78 A;  3I4N J;  5FKN A;  1TP4 A;  1P7I A;  4WXH A;  3TOB A;  3CES A;  3K4J A;  4C2M J;  1NK3 P;  1TC3 C;  3JTH A;  2ELJ A;  2VJ4 A;  1B4A A;  2JA8 J;  5M5X J;  4BE2 A;  5IT3 A;  2KDO A;  1LB2 A;  1SVL A;  1IN7 A;  3OYL A;  1ENH A;  1WVR A;  3WTT C;  4CCJ A;  2HXI A;  1TWH J;  3LSJ A;  4OAZ A;  1FSH A;  4ASN A;  2MH9 A;  5FD6 A;  1Y39 A;  4L18 B;  1ODD A;  1GV2 A;  1ON2 A;  3LSG A;  4OMZ A;  1BI0 A;  1V3F A;  2DMQ A;  2R7D A;  5DCM B;  4OIR F;  1SD7 A;  2X1C A;  2CQX A;  2K9S A;  2X9D A;  2DQL A;  3TP3 A;  1P4A A;  5M5Y J;  4Y7N J;  3PJR A;  2V1U A;  2QYO A;  1HXD A;  2DCE A;  3JRE A;  4M3G A;  4MEX F;  2CQ7 A;  1I3Q J;  3FXM A;  4HA8 A;  1R23 A;  1ZAO A;  2KQR A;  5D6F A;  1IO2 A;  1OYY A;  1RR8 C;  3HB9 A;  3BPX A;  1FIA A;  3HTS B;  1OKR A;  2E19 A;  1HSJ A;  3LL7 A;  2I10 A;  2LF7 A;  2ZXH A;  3CCE I;  2CQQ A;  2HPI A;  2K3P A;  2EFN A;  3F8M A;  3FMQ A;  4B48 A;  4AIJ A;  3BTI A;  2LDU A;  4S0H B;  2LYC A;  3CMM A;  1W1W E;  1VQO I;  1ULY A;  1BOB A;  2O8X A;  3HBL A;  5K1Y A;  2BXZ A;  3CO7 C;  1IDZ A;  2QCO A;  5IYB J;  1NHA A;  2M5W A;  1ZRD A;  4F93 B;  3S1M J;  3R61 A;  1QA6 A;  2DT7 B;  4KJZ A;  5F0F A;  4I76 A;  2HGC A;  3T8R A;  1BW6 A;  3FXJ A;  3RPU D;  5L3B A;  2NVU B;  1Y8Q B;  4A3M J;  3VYR B;  1R5I D;  3WU2 C;  4J19 A;  5E20 A;  1UG2 A;  2DTR A;  2VJ5 A;  4EJO A;  1N78 A;  1MBE A;  4N9H A;  3B6C A;  3CDL A;  3CCM I;  1J09 A;  3Q0V A;  2GQQ A;  3LFK A;  4PJM A;  2COM A;  3BR1 A;  3TOA A;  3ML6 A;  1YX3 A;  3T8T A;  5CVI A;  3CDI A;  4ZYD A;  5FD5 A;  2TCT A;  1S5L C;  2PEX A; 
#chains in the Genus database with same CATH homology
 5GAG J;  5DM7 F;  1YI2 I;  1VQK I;  3CCS I;  2ZJR F;  2QEX I;  1YJ9 I;  1YJN I;  3PIO F;  1YIJ I;  3CCU I;  2ZJP F;  2JQ7 A;  3CMA I;  1YIT I;  1VQL I;  4V19 K;  1VQ7 I;  3CCV I;  1Y39 A;  1YHQ I;  1ACI A;  4IO9 F;  1YJW I;  3CME I;  5JVG F;  2OTJ I;  3CCR I;  3CJT B;  1HC8 A;  1VQ5 I;  3CC7 I;  4UY8 I;  3DLL F;  2QA4 I;  1FOX A;  2K3F A;  1VQ6 I;  2ZJQ F;  3CF5 F;  2E34 A;  3CCE I;  5GAD J;  1VQM I;  1FOY A;  2OTL I;  3G4S I;  1VQO I;  4IOC F;  3G6E I;  3CCL I;  2H8W A;  3J7Y J;  1VQ4 I;  1VQN I;  1FOW A;  1QA6 A;  5GAE J;  2FOW A;  2E36 A;  3CCQ I;  1MMS A;  3CC2 I;  2NXN B;  5DM6 F;  4IOA F;  3G71 I;  3PIP F;  3I55 I;  3J7Z I;  3CCM I;  1VQ8 I;  3CCJ I;  3CD6 I;  1VQP I;  5GAH J;  2E35 A;  3I56 I;  3CC4 I;  1S72 I;  1VQ9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...