3I4MJ

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3i4mJ00
1S7EA 4M3DA 3H3VK 4C3HJ 1FJLA 1TWCJ 3A01B 3OIOA 1RR7A 2M9HA 1RETA 1K83J 3JRAA 2DA1A 5GP9A 3ZQGA 2AO9A 2XGDA 3TP0A 2NS8A 3WHBA 1VFCA 1B8IB 2KT0A 3BTIA 1HF0A 1DU0A 1RPWA 4M3FA 5F0HA 1UMQA 4CYCB 5DTDA 1ITYA 5M3MJ 1U9OA 3I4MJ 2OF7A 3Q0UA 5FLVA 2NOGA 2HI3A 1QVTA 4B4CA 4DZPA 1WCMJ 2H8RA 4Y52J 1JTXA 1ZTRA 4BY1J 3HEFA 2Y31A 2X6OA 2ELKA 2LD5A 2L7MP 3GTMJ 1E3OC 1ZQ3P 1XG1A 5M5YJ 2DMTA 1JT6A 5E3OA 3VPRA 3FK6A 1R9TJ 1MBKA 3OOUA 4JYKA 2HXOA 4A3IJ 3S1MJ 1HOMA 2XRLA 1O4XA 5IP6A 5J1YA 2O9LA 2VI6A 4A3BJ 1P7IA 1U78A 5C4JJ 4IHYA 3K2AA 1X58A 3HOZJ 1HLVA 3HM5A 4I76A 1JJ8C 1IUFA 5K7FA 1ETXA 5F04A 3DCFA 3FISA 2IAIA 5F0FA 4V2GA 3GTOJ 1OJLA 2WB1N 3IH2A 2VUMJ 2WAQN 5IOYA 2MSYA 3MKLA 4M3BA 5IP9J 4MFEA 2Y9YA 5J1RA 2D5VA 1WI3A 2TRTA 1ZR4A 2MG4A 4MLOA 1Z77A 1FIPA 3BR0A 5FKNA 3BQZA 1VI0A 1IV6A 3TEDA 3JRFA 1AHDP 1G2HA 2E19A 4MO7A 2HXIA 2CUFA 2L9RA 5EG0B 1PUFB 3A03A 3S15J 2LFBA 2CQQA 4A3JJ 5JLXA 3SJMA 5EGOB 3S2HJ 3BTCA 5M5XJ 1GV2A 1MBFA 2NS7A 3JRBA 3OSFA 2WV1A 2VPRA 4G12A 3S17J 1LFUP 4A3LJ 4IHVA 3S16J 1BJZA 1UHSA 4M3GA 2DJNA 5J1UA 3UKGA 4XIDA 2XGCA 1BL0A 3G1MA 1Y1VJ 2EBIA 3WHCA 1MSEC 2JWTA 3FIWA 5FKOA 1ZGWA 4UUSB 3JREA 2XPUA 2JMWA 1MBJA 3LSJA 5FKLA 5EDNA 1ETYA 4DYCA 2DMQA 2K9QA 1B72B 2W48A 3HOWJ 2YS9A 2Y30A 1IRZA 3ZQCA 4B3AA 1X2MA 2R0QC 2R5YB 1X2NA 4A3KJ 2K9NA 4DYRA 4RDUA 1FEXA 1H89C 2L7ZA 2EH3A 3HOYJ 5K7ZA 1YRNA 1UG2A 1APLC 3GTLJ 3O8HA 1RESA 4I6ZA 3HB9A 3D1NI 1HDDC 3A01A 3FKIJ 3PO2J 1HDPA 2ME0A 2DMPA 3QPSA 4FISA 5E3LA 3HDDA 3ZQIA 4QSHA 2ID3A 5FJ8J 1POGA 1A6IA 4JP0A 1Y1WJ 4MFDA 4QTRA 2P81A 3A02A 2FJ1A 3BTLA 1P7JA 2I10A 4L5EA 3ZQFA 1FTTA 3GTJJ 3GTKJ 2LY9A 1SFOJ 3BR6A 5JLWA 2M0CA 4BY7J 1JUPA 1BW5A 3Q3SA 4JX6A 1F43A 3H0GJ 3G1OA 3GTGJ 2O7OA 3ZQLA 4W1UA 1TWFJ 1DU6A 1AKHB 4M6VA 2CRGA 4BKXA 2TCTA 1JKRC 2XB5A 3OSGA 2EZLA 4B1RA 1JKPC 1ORKA 3O8GA 5E3MA 1QPIA 4M3EA 1VNDA 1I3QJ 4XICA 1BA5A 1FIAA 1U8BA 4D5CA 5IYCJ 3PM1A 1ZK8A 2FD5A 2EZIA 3TW7A 1OCTC 3JRGA 1WPKA 5J3LA 4XRSA 4A69C 2Y2ZA 4MIMA 4A93J 2JA6J 5C44J 5M5WJ 4XK4A 2LR8A 2ID6A 3S1NJ 2XSDC 3ZOBA 1MBHA 3CQZJ 4DYQA 4EEFG 1H8AC 2EZKA 2DA4A 2CQXA 1OCPA 2LKXA 2E2JJ 2R93J 2DA6A 3LSPA 5IYBJ 1JT0A 2K9SA 2R5ZA 1FTZA 4FE4A 1NK3P 2DA7A 3LOCA 2DMUA 4DZJA 1XC5A 3BG9A 2CUEA 2HOTA 1ETWA 4W97A 3BQYA 2EQRA 4X6AJ 3F0CA 3K7AJ 3BR5A 3DEWA 3S14J 3RKQA 3HGGA 4C2MJ 1NK2P 1LFBA 2VKEA 2IEKA 1Q1VA 4AC0A 1TWHJ 3HGYA 2R7ZJ 2DA2A 4AUXA 3HOVJ 4X1EA 1JTYA 3NARA 3M4OJ 3RQIA 4A3FJ 4FTHA 3GTPJ 3HKZN 1OFCX 2CU7A 4C3IJ 3IH4A 2LLKA 3LSGA 2GBYA 1LE8A 2RAEA 2JN6A 1AU7A 1BW6A 4LOCA 4A3EJ 2MGQA 4J19A 4IHXA 4ABZA 4D7MA 1HCRA 2COBA 1D5YA 3JRHA 2Y0SN 4UUTA 3MN2A 5EZGA 1ZR2A 3QQAA 5K7HA 4FCYA 2LK2A 3E7LA 2DA3A 4S0HB 1ETOA 1TWGJ 2Y9ZA 1XS9A 1T33A 3S1QJ 1MH3A 2H1KA 2JA8J 1ETQA 2NVXJ 3JRCA 1WGXA 3SFIA 5GPCA 5EEAA 1I6HJ 1GT0C 2FQ4A 4AYBN 3HOXJ 2QF7A 3RZOJ 5IPAA 2LVSA 3QPLA 1Z0XA 2JA7J 2R92J 1QRYA 3S1RJ 1MBEA 3PO3J 5IP7J 2ZB9A 4A3MJ 3IH3A 2YUSA 1QVUA 3BG3A 1B8IA 1I50J 4RBOA 2L0KA 1MSFC 3BR1A 1F36A 1JJ6C 1GVDA 2XPVA 2LTPA 1TC3C 2X48A 3BT9A 4CYCA 1CQTA 4IHWA 5HODA 3G1LA 2JA5J 2HOAA 4GFBA 3TW6A 1IDZA 2GLOA 1IGNA 5F0CA 5EF6A 5C4XJ 3I4NJ 2OPTA 2YU9J 1ETVA 3NAUA 2EZHA 1A5JA 5FKKA 2X9DA 4V2FA 2M8GX 4C3JJ 2MW8A 2XGEA 5IOZA 1TWAJ 1K61A 1GV5A 3S2DJ 2E1OA 3Q0WA 3IV5A 1JUMA 1U9NA 4HNVA 1JKQC 1AKHA 4A3DJ 4Y7NJ 3JRIA 3JR9A 2NVQJ 2HOSA 2QCOA 2LP0A 1MH4A 2XB0X 5M3FJ 2ME6A 1IDYA 3SDGA 4BBSJ 2VKVA 2DTZA 2G0EA 5F08A 3W6VA 1ENHA 3BTJA 2HYJA 2E2IJ 5C3EJ 3ZQHA 1IC8A 2ECCA 3FK7A 3RZDJ 3BG5A 3Q0VA 1RKTA 2HQ5A 1JGGA 5IYDJ 2E2HJ 4D7NA 2PMZN 1GDTA 3B6CA 2R5ZB 3GTQJ 1IG7A 4NDLA 3CDLA 2FX0A 4A3CJ 1SANA 1ZKGA 2NVYJ 2CJJA 2JJ7A 1MNMC 4FE7A 1JKOC 3C2BA 2JK3A 1WH7A 2M2EA 4XRMA 1RKWA 2DN0A 3MVPA 5EG0A 1PUFA 2DA5A 5F27A 4BBRJ 2GM4A 2N8GA 3BR3A 5BNGA 5EGOA 3B6AA 4A3GJ 2HDDA 1IJWC 3GBGA 2K40A 3LNQA 1MBGA 3HBLA 1T56A 2KDZA 5FKMA 2NVTJ 1LE8B 1EF4A 9ANTA 5FLMJ 1H88C 3L1PA 5E3NA 2B63J 3CMYA 1ETKA 3TP3A 4DW6A 3CCYA 4XRSG 2M34A 3HOUJ 1JUSA 1WH5A 2O8KA 5EZHA 4QIWN 1W0TA 1W0UA 1VF9A 4UUSA 4JX5A 5GPAA 4D5FA 2IBDA 2AHQA 1NTCA 2L7FP 2XPWA 5DS9A 5EYRA 3BR2A 3JRDA 1B72A 3M3YJ 4JX4A 4IEJA 3LSRA 1GUUA 2DMNA 5F1JA 4BXXJ 1YRNB 2R5YA 2ECBA
chains in the Genus database with same CATH superfamily
3V8KA 2VE9A 5HLIA 2XKOA 3F23A 1X19A 4G94A 1TWCJ 3VYSB 2M9HA 4RLFA 2DT5A 3ZQGA 3A0HC 2KT0A 2E1CA 2X6XA 4CZZA 2C6YA 5DM6F 2MABA 5DV5A 2L02A 5LHIA 1RPWA 4M3FA 3QU6A 1DP3A 4II2A 1ITYA 1U9OA 2OF7A 1TT0A 3W2VA 2I5UA 4BHPA 2F5FA 2NS0A 1R5HA 5HLTA 3K1NA 2VQCA 2Y31A 1T98A 2IGNA 1ZQ3P 2K85A 3AG1H 2DMTA 2OU2A 1V3FA 4CH7A 5HNFA 2YSRA 1A31A 1F5TA 1J7KA 1DUXC 3CCSI 3ZN0A 5IP6A 2MFZA 5J1YA 3I56I 1UAAA 2O9LA 2VI6A 1Q1HA 5DD4A 3U1KA 1XCBA 4OU0A 2KHMA 1U78A 2XKPA 3ABTA 5C4JJ 4AIKA 3HOZJ 2ZC2A 3GW2A 5GTIC 2YU3A 5L3CA 4NHJA 4L9NA 1IUFA 5K7FA 1ETXA 5F04A 4XLNF 5F0FA 4EGZA 2WB1A 1OJLA 1RI7A 2L7KA 5TGTA 3C2HA 1YIJI 2GOXB 3W6KB 4E7JA 1F4KA 3H3UA 3TDZC 5CVUA 2RNGA 2MSYA 2CV2A 2W25A 3MKLA 3T8RA 1XGOA 2VJJA 2OD5A 1W7PD 2Q0OA 3BZCA 3IUOA 5LEKA 3RCOA 2DQLA 4P9FA 1E3HA 3WGHA 2TRTA 3MKWB 3BQZA 3DLLF 1IV6A 4XKVA 2JSPA 2XVCA 1K78B 2MA3A 4KMFA 4XNFA 3A03A 2KP6A 2LFBA 1G4DA 3SJMA 2BY0A 5EGOB 2PJPA 1E17A 3K4NA 2CUJA 3OYNA 1GV2A 1YHQI 4CSWA 2G7UA 2JZYA 3QYFA 1YW8A 3IRQA 3G2BA 5GAEJ 3EUAA 5D4RA 4HNTA 1U6GA 4M3GA 5JHFA 1S8NA 1FX7A 3CCVI 2KKOA 2XGCA 2EB7A 1BL0A 3G1MA 1Y1VJ 3RKWA 4G7ZF 1SVMA 2R7QA 2R3SA 2V4JC 3WHCA 5D8KB 2A5WA 4BJTA 5FKOA 3OYMA 3JREA 1MBJA 4UVAA 2EIJH 4BE1A 4OOIA 1OQYA 3VODA 3K4KA 4BEHA 4CO8A 1BR2A 3LWFA 2W48A 1XPXA 2R7UA 3HOWJ 3WGGA 5LLQA 5D5XB 2R5YB 3PJRA 2R4GA 2D1HA 3QOEA 3JSPA 1J75A 2FOKA 2QLZA 1BOAA 1H89C 2QM3A 2OTJI 2H09A 4NC7A 3E97A 5J4YA 3GTLJ 2MD5A 1WJ5A 3O8HA 1FBSA 2JVHA 4A6EA 5CVIA 3VWBA 5DUIA 3WE3A 1HDDC 6PAXA 1S7AA 5H2FC 2DMPA 3QPSA 4P5OA 3ZQIA 1IZ1A 3G73A 2ZJPF 2R7WA 2PQ8A 2EIKH 1H9GA 4MFDA 1SFXA 3ZGKA 4L5EA 4DJAA 2CSOA 1KQ8A 1FTTA 2DT7B 3G4SI 3GTKJ 1RUNA 1TL8A 1TW2A 2WY8Q 5LD2C 2LREA 2XSJC 3PNTA 4YRVA 3D5SC 3PFYA 1WVRA 2K4BA 4JX6A 2J5OA 3OYEA 4PJJA 5FFXA 2NRAC 3V8LA 2FMYA 3HPGA 1V5EA 2Z5UA 1GHCA 2WWYA 4U0YA 4YFKF 3ZMSA 3PIOF 5LRSA 3LFUA 2VJ4A 1MJ9A 3W6JB 3OSGA 1MD0A 4BDYA 1Z9CA 2R7VA 3QPTA 4EV0A 2E60A 1I3QJ 2HFHA 4RA2A 1U8BA 4KYWA 3K4CA 5IYCJ 3I54A 3PM1A 3F8BA 4XOPA 5CKTA 4ZYGA 4WXDA 5ICEA 1OCTC 2QUFA 1YS7A 1WPKA 3BZKA 3OS0A 1ZREA 2HZTA 1WWXA 1I6XA 4DYQA 3HJEA 4NQWB 5J6XA 2LKPA 1ZN2A 2TDXA 5FD6A 2HDWA 3BWGA 3K9TA 4HSTA 1VQKI 3LSPA 2EV5A 2DA7A 2DMUA 2UV1A 3I0TA 1FOWA 3J80Z 3PQKA 1UHMA 2RGVA 2H27A 4ZDOA 3S14J 3BR5A 3BCBA 1E2XA 3C1DA 4C2MJ 1Y0NA 4Y3OA 3M8FA 2VKEA 1NG6A 2A69F 3RYPA 5FB2A 2A07F 2OBPA 1SFEA 2VKDA 1ZH5A 4LITA 4NBQA 1TNTA 3SYTA 4N0BA 4A3FJ 4U7BA 1OFCX 2CU7A 1Z3YA 2LLKA 1LE8A 1R22A 1XGSA 2DPDA 2RAEA 3HSFA 4PSXA 5E17F 3QYBA 4BNCA 1J09A 2UUZA 3ZMUA 1R36A 1BW6A 1SAUA 2EILH 4B8XA 1LQ1A 1XSVA 2MGQA 4IHXA 5KCMA 2DAOA 4ABZA 2V1UA 1N75A 1FT9A 4QLCU 4MEYF 4ESBA 1XB4A 2DDAA 3CESA 4U0VA 3OYDA 1ZR2A 3QQAA 4IVNA 3E6CC 4FCYA 2LK2A 4S0HB 4ITVA 1W7PB 1TWGJ 3E6BA 4C2TA 1XS9A 3S1QJ 3OYCA 2W00A 2XAJA 1Y8RB 2IGKA 3G71I 2AS5F 3ERMA 3BPVA 1I6HJ 1T0FA 4AYBA 4QPOA 2DOFA 4XLHA 3RZOJ 2DFIA 3A0BC 2LVSA 1SVLA 3CUQB 1EA3A 2JA7J 5DEQA 4EJUA 2R7XA 2KIQA 1P92A 2Z99A 1XDSA 4A3MJ 3DKYA 4BU2A 4F91B 2V6EA 1D1AA 2YUSA 2DO7A 1XDUA 3VOEA 1VQLI 4ENKA 1JE8A 4BUPA 1YJ9I 1B8IA 1I50J 3QPHA 4EM0B 3K1PA 1F36A 2H94A 4EJOA 2Y48A 1TC3C 2X48A 4RLQA 1REPC 3GWZA 2FE3A 1HKSA 3ZCOA 3GXOA 1R1TA 2F4MB 5KVRA 2DDBA 2CQ7A 2VJIA 1FYKA 5LGUA 2GLOA 1IGNA 5F0CA 3I4NJ 1ONVA 4NC6A 2EV6A 3NAUA 4BS9A 2JUCA 1MIJA 2X9DA 2CFOA 2EK5A 3GEZA 3Q9SA 4P1WA 2MW8A 4CZCA 5J47A 3ABMH 3GVAA 3IV5A 1P4AA 2R7SA 1FOYA 1JUMA 1R1VA 5HLHA 4GO1A 1AKHA 1BBYA 3RI4A 4A3DJ 2NXNB 2LC2A 2HDCA 1UZCA 1MMGA 3JRIA 1K7AA 4XQFA 2NVQJ 2QCOA 1MH4A 2FSWA 3I71A 3H92A 2ME6A 2VKVA 2DTZA 2Y69H 3ZQ7A 2ICWG 2VL8A 3Q5FA 3BTJA 1MZBA 2HYJA 3J7YJ 3ESWB 2KIUA 3PUBA 2DT6A 3ZQHA 4N9IA 4XM3A 3ELKA 3RZDJ 1RKTA 3J7AO 1USTA 2EV0A 1S5LC 3OMYA 5DM7F 3DFGA 2QQ8A 5J8FA 3RTRA 2KRFA 4NDLA 3WTVC 3LSIA 1XGNA 4CUGA 4KN4X 1LDKB 3AKZA 2XIGA 4FE7A 3HG9A 2ZXJA 2FF4A 4BAYA 1C0WA 1WQ2A 3H9JA 3I64A 2EPFA 1YX3A 2F5VA 4KUMA 2K27A 4RB0A 3SDBA 5EG0A 1PUFA 1ZELA 2DFEA 2WY7Q 3FHNA 4CCOA 1SD5A 3HKZA 3IAS2 3B6AA 2BHYA 2H1LA 3F22A 1AWCA 2K40A 2HR3A 2ISZA 2ZNYA 1MBGA 3I58A 4B43A 3Q9VA 2F5EA 3DV8A 4BJ6C 1V5GA 4HX8A 4E70A 2O8XA 4I02A 1MNDA 1STZA 2XF5A 4DW6A 1QZYA 5CQGA 1EJ9A 3SEQA 4OAYA 3BJAA 4XRSG 1YLFA 3RYRA 4D1QA 5EZHA 1P6RA 2HVQA 2DK8A 4MTEA 2V9KA 3DXJF 2K4JA 3DEEA 2BV6A 2OUMA 1BR4A 2FU4A 5EYRA 3BR2A 4HDVA 4PGHA 2MLGA 2V9PA 4BQQA 4M72A 5F1JA 4K2EA 4OIPF 2DI3A 2QSFX 3F6OA 2FUG2 1IUYA 4L5JA 4HF2A 2A61A 4A2UA 1GXQA 2LYCA 5CVJA 5ERIA 3A01B 1RR7A 3JRAA 1RETA 1D1CA 1GXPA 4M6YA 5DCMB 3AFHA 1YJWI 4ZYDA 1FP2A 2BE5F 2GA2A 1G3WA 2LBFA 2QSGX 3OYHA 1Z7UA 2HGCA 2MH9A 3FXQA 1TLHB 4Q48A 4FX4A 1VQPI 4CYCB 5DTDA 2RVCA 1O3TA 1YW7A 1VQOI 4NUBA 5FLVA 2OJED 2M45A 1QVTA 4B4CA 1WCMJ 1HKTA 4XL9A 3IC7A 1ZTRA 4BY1J 3CDHA 2BHZA 1CF7A 2XF6A 1LEBA 1DPUA 2ELKA 5FRMA 1FPQA 1ACIA 3GTMJ 5M5YJ 3IL2A 1IN4A 3TBIA 5E3OA 4YEJA 5CPRB 1MBKA 3MKZA 4A3IJ 3S1MJ 2HXOA 3HRMA 1XMXA 1Z7LA 3CLQA 3K69A 2Z3YA 2OV7A 1P7IA 3KP7A 3SZPA 2KRCA 4IHYA 4RGXA 1WJDA 1FMVA 2EFPA 5HS9A 1W36D 1J5YA 5E8IA 1JJ8C 2DJIA 4H0EA 2BW3A 4A12A 4G7OF 4UV8A 2YX4A 4DBQA 3RQ4A 2STTA 1LDJA 1R23A 1UJ8A 3EPZA 3IH2A 2D45A 4AIJA 4L5IA 2WAQN 3OYLA 1PDNC 2P5KA 2PMZA 2ISYA 2I8DA 3IRRA 5IP9J 4LG0A 1WJCA 2COMA 2PJRA 4MFEA 2WAEA 4MQ9F 1J9IA 3KE2A 2IS4A 1MGTA 2OAZA 2D5VA 2B7EA 2CS3A 3DKXA 3TKYA 3HUGA 1U5TC 2QEXI 1QBJA 4MLOA 3MQ0A 2BEOA 3BR0A 5FKNA 1VI0A 2IGMA 1LUJB 3TEDA 4GRIA 3VYTB 1PYVA 1Y6IA 2L3DA 2ZKZA 2HNHA 2LH9A 2OA4A 3BDDA 4HLYA 1BI0A 4UB6C 4LIUA 3CF2A 3H9QA 3UR3C 2DLLA 3M7GA 2VJ5A 2GWRA 2ZSIB 4ZYHA 2IRFG 3BTCA 1XN7A 3RIRA 4X0GA 5M5XJ 3JSOA 3FWEA 4XSZF 1MBFA 4LB5A 4HNUA 1RR8C 2NAZA 1FLIA 3CJTB 5BMZA 1NG7A 2HPMA 2JQ7A 3ABUA 4G7HF 2KL4A 4A0YA 2OCEA 3S17J 1QGPA 3HPHA 3S16J 3LA7A 5J1UA 1ZG5A 3WE2A 5HS8A 4B3XA 3KX2A 1BR1A 4XIDA 3LSMA 3DLAA 2E71A 3EETA 3K4BA 3EUKL 2L4MA 2PX9A 1ODDA 2X1CA 1OYYA 3FMRA 1XTAA 1L0OC 4UUSB 2JMWA 2P4WA 1W5CC 1ETYA 5EDNA 3ONQA 2BVLA 3MEXA 3H5AA 2K9QA 4S05A 1B72B 1IRZA 4M73A 1YYVA 1X2MA 3M9AA 5TRDA 2JT1A 4A3KJ 2K9NA 2X1EA 1KQ0A 1MJBA 2LOOA 4AU7A 2ADUA 4J00A 3OL4A 2L7ZA 2NVUB 5E8GA 2M4GA 2HTJA 4HPQA 3CCLI 1APLC 1RESA 2M5WA 5HDGA 3SZGA 1MMSA 3L9FA 2UXXA 3BPXA 1U5TA 4KIGA 3VSKA 3KP2A 1KU9A 1TW3A 4XR6A 1TQMA 4FISA 5E3LA 5KAIC 4PJMA 4QSHA 4LD5A 3HDDA 2X85A 4ZJZA 4JP0A 1P7JA 1EV7A 3GTJJ 3K6GA 2LY9A 4GYGA 2ZMEC 2ZNZA 2F5DA 1BC7C 2M0CA 4BY7J 2V1DA 1BW5A 1FP1D 3Q3SA 1SEUA 4PFOA 3M8JA 3TO7A 3GTGJ 3ZQLA 1WI9A 5BQTA 2P7CB 2MD0A 2Z9OA 4M6VA 1LJ9A 2CRGA 4FHTA 2M87A 3AL0B 1X1CA 1B9NA 2EZLA 4L9TA 2E5ZA 2EA2A 1L3LA 2K02A 2HOEA 3ZQQA 5HVQC 1ORKA 2PBIA 4P55A 3L2VA 2FOWA 4O3MA 3PFIA 4XICA 1BA5A 1SFUA 1FY7A 3HRUA 3MZ8A 4MGRA 1OR7C 2O6GE 3QRFF 4YELA 4JK1X 3SEZA 3OWTA 5K5QA 3TQNA 4G6DA 4XRSA 1X3WB 3GFLA 3WODF 3FHZA 4CXFA 4XK4A 2LR8A 2ID6A 2Q1ZB 3QWLA 5BS6A 3L2QA 2XSDC 3ZOBA 3CQZJ 4ESFA 1KU2A 3O3KA 1OCRH 3SXYA 2DA4A 2CQXA 2CUZA 2X0LA 5E1XA 2ACJA 2IS6A 1BC8C 5IYBJ 2R5ZA 2BZTA 3HSRA 1FTZA 5J4VA 1XC5A 3HSEA 2CUEA 1P4WA 4BH9A 2HOTA 4W97A 3BQYA 1OPCA 4A0ZA 2FEZA 3OYFA 2HYFA 2ESNA 2AQEA 4F55A 1O7FA 2HKOA 3K7AJ 2IVMA 5L3FA 3HGGA 1K6YA 2QKLB 1K78A 1NK2P 3ZPLA 3DEUA 3ABLH 1Z05A 3NWSA 3V8JA 2V1NA 3GO5A 1TWHJ 3HGYA 1KYZA 2R7ZJ 4AUXA 4IQJA 2ZMEA 1S7OA 2JPBA 1DP7P 4FTHA 4HAMA 4OIQF 3GTPJ 3RKYA 4BQAA 3H5NA 2RQQA 2V6CA 1JHFA 5A2QZ 3KP5A 3LSGA 2VC1A 3DTKA 5ILVA 3PNYA 3JAMZ 2HQRA 4LOCA 4QPQA 4J19A 2F48A 3RJPA 3ROUA 2AXLA 1HCRA 1R4NB 2COBA 3C7JA 2FXAA 2Y0SN 4UUTA 5EZGA 1S6LA 3E7LA 2DA3A 3KLNA 4PDKA 4F93B 3LA2A 3CCQI 1MH3A 4BEHB 2F5CA 3DPTA 2VASA 4L18B 2JA8J 2EA4A 2NVXJ 3FM5A 3JRCA 1WJBA 1OR7A 4I98B 1WGXA 5GAHJ 4PJLA 5EEAA 5FFZA 4LK0F 1E0EA 1GT0C 4XKBA 4OIOF 3HOXJ 2QF7A 2LMDA 2K86A 1IRFA 5IPAA 2W84A 3J81K 3OYJA 3QPLA 1LVAA 3R61A 1R5ID 4UUVA 1QRYA 2QZ8A 2R92J 1MBEA 3PO3J 5IP7J 3KZZA 4AIDA 1X4OA 3R4KA 3IH3A 4LFUA 2BY1A 2VKHA 3V7RA 1QVUA 3BG3A 4RBOA 4PUSA 5B1BH 1MSFC 1P4XA 2JUGA 3L2WA 3FX3A 4BE0A 4P96A 3P9IA 2XASA 1OYWA 1XD7A 2KZGA 2DYSH 3CC7I 5E20A 3FBNB 3OY9A 4XMYA 3V4GA 1VQ6I 3WG7H 1IDZA 2ZSHB 2CW7A 5EF6A 3T5XA 2OPTA 3G6EI 4I0AA 2EZHA 3ECOA 4CGZA 4AD9A 4C3JJ 4R79A 3J81Z 3S32A 3WTXC 5FO5A 2XGEA 2M7BA 2W82A 4WXHA 5B66C 4ETSA 1TWAJ 3R0AA 3J80K 1GV5A 2L5QA 5L3BA 4AVZA 3H9GA 1W5SA 4GGGA 2BBYA 3F8CA 5ILSA 1JKQC 1WHUA 3ML6A 3M1CA 4J01A 3JR9A 3QP5A 2HQAA 2LP0A 1T0FC 2CQKA 4LB6B 1K4SA 5M3FJ 4HZFA 4Y4RA 3W3CA 3SDGA 4F92B 3DU6A 5F08A 5B3SH 4MHGA 4E7HA 3IWFA 5H6RA 2E2IJ 2BY2A 2FBIA 3HTSB 3I3LA 3FK7A 3BG5A 1DQUA 3Q0VA 1R58A 1ZRFA 2LNBA 2XF7A 3NEUA 4UY8I 1Z3XA 5IYDJ 3VDXA 5CJ9A 3I4PA 1YW9A 3ISPA 3BLYA 5D6FA 4EATA 2VOPA 4RGUA 5JVGF 1O3RA 2FMLA 4GCVA 1ZRCA 4IX7A 2O03A 3FMSA 2DYRH 5KAFC 4A3CJ 2VT3A 4CHUA 1OCOH 3GFIA 4IXAA 1QO0D 2X6YA 1SFKA 3CCUI 1MNMC 4V19K 2VQGA 4DGWB 5LBQA 3TMOA 1GLNA 4IPAA 1O57A 4PFPA 2JK3A 2M2EA 4HF1A 2VQLA 3LL7A 5EEHA 4U88A 3GX4X 4BBRJ 2NNNA 2GOMA 2J5PA 2QKMB 5E79C 2CG4A 2XHKA 5BNGA 2WBMA 5FGMA 5GADJ 4A3GJ 1FBQA 2HDDA 2B0LA 1IJWC 2MLKA 3LNQA 4E7SA 1OLTA 1T56A 1FSHA 3KZIC 3BZ6A 2KDZA 5FKMA 3CCMI 1LE8B 3OS1A 2JA2A 2LDUA 1IN5A 4IRIA 3L1PA 3NQOA 2B63J 2KZVA 3CMYA 3TP3A 5F64A 4F3QA 2EWNA 3TOAA 4LG3A 1VZ0A 3CCYA 1SMTA 5ICCA 3FZVA 3WG9A 3V7CA 1XSDA 5E1ZB 2MYSA 4DOZA 2O8KA 5ED4A 1W0TA 3F8MA 3FXLA 4ENJA 2HVSA 2W24A 4JX5A 4XN3A 2IBDA 4XRFA 2IXSA 1NTCA 2L7FP 3FXJA 3ECHA 2GIVA 1BJAA 1RZ4A 2HS5A 3CC4I 1QNTA 4PK4A 1GUUA 2DMNA 3SHFA 5ICGA 4RAZA 2ELJA 1YRNB 5ILUA 5LEJA 3MD2A 4XKCA 2OZUA 3H3VK 4C3HJ 1FJLA 3OV8A 2ZJQF 5KHDA 1Z6RA 3H5RA 4KITB 3A4CA 3WTUC 3OIOA 3TO9A 5CVRA 1Y0UA 3RPQA 4OAZA 2AO9A 2DBBA 2QWWA 2NS8A 4A5MA 3WHBA 1IF1A 4ZTFA 2B9SA 1ZAOA 1B8IB 1D0YA 2OZ6A 3R6SA 2O3FA 1U8RA 3BTIA 2IA0A 1NH3A 1YS6A 5F0HA 1X1PA 1A35A 1UMQA 1T38A 3E3VA 4YIRX 5M3MJ 3HXLA 4BYYA 2XROA 2DCEA 2QBYA 1VTNC 2NOGA 2X4HA 2HI3A 3WU0A 2H8RA 1YG2A 1JTXA 1S72I 1MNEA 3CJQB 3ZP5A 3HEFA 1YI2I 2DTRA 2L7MP 1E3OC 2VBYA 1XG1A 1YQAA 1JT6A 3LA3A 2XAHA 3B73A 3VPRA 1IXCA 4PGGA 3AAFA 4HLXA 1TP4A 1ZLJA 4RM2A 4JYKA 2R7DA 4H4KC 1HOMA 1X4PA 5IY5H 1QU3A 3NRVA 4A3BJ 1FOKA 1VQ5I 3EYIA 3K2AA 1X58A 1OKRA 3CO7C 3LAJA 4WF2A 1PJRA 1R7JA 2G9WA 3N4MA 1LB2A 5HDNA 3K70C 3DCFA 3NWTA 3J7ZI 1ZHFA 1YJNI 3FISA 5L3EA 3KP4A 4FETA 4V2GA 1R6RA 5D5WB 5L3DA 1BN5A 2MBFA 3RPUA 4IQ4A 1KQ9A 4M3BA 3FBIB 4LIVA 2XV4S 4FX0A 3KYCB 5J1RA 3PSFA 2EFNA 1LFPA 1B59A 1I27A 1IXSB 2M30A 1J2XA 1F9NA 2MG4A 4JOMA 1ZR4A 1SD6A 1Z77A 4HF0A 1MMDA 1QQIA 3JRFA 3V7SA 1AHDP 2E1NA 1G2HA 2E19A 3UNGC 3H0DA 1JI8A 1V4RA 1UCRA 5EG0B 1PUFB 2K7LA 2ZXIA 3LSHA 5FRNA 3S15J 3BP8A 4IHSA 4MEXF 3CZ6A 4A3JJ 4C9YA 4HRIA 1R4MB 4CYDA 2NNYA 1PUEE 4HSRA 3LMMA 2A5YB 2NS7A 4DBRA 3R0JA 3CTAA 3E0JB 3V42A 2WV1A 2KMUA 3DPUA 1LVKA 3IKVA 4RB3C 4ENMA 4LK1F 1LFUP 4IHVA 5HOOA 4E4HA 4Z2YA 2E7XA 3CD6I 1UHSA 1V5FA 2HU9A 3KCCA 3DQVC 2V9VA 2O61A 4ZYEA 1SD7A 1KONA 3UKGA 2WAFA 5FROA 2EBIA 1EH7A 2JWTA 4XORA 2LY1A 1Y56A 3G3ZA 4DYCA 3E5QA 2DMQA 3GLXA 3DBLB 1HA8A 4WCGA 3SQNA 1D3YA 3U1DA 2KRHA 3GZNB 1BOBA 2VLAA 4E7ZA 4B3AA 4ZZLA 3ZQCA 2R0QC 1ZGJA 5E18F 1G3SA 3CLOA 1T95A 1XX5A 3FXRA 4UV9A 2GXAA 1QHHD 4XLAA 2GAUA 2JRMA 4RDUA 3DBHB 2IW5A 2EH3A 3LFKA 3MZYA 4G6QA 3WTZA 3MFKA 3HOYJ 5K7ZA 4WXCA 2KJCA 5CLSA 4CA0A 2KDOA 3IAM2 1OCZH 2XAGA 4HX4A 3HB9A 3DKWA 4HOBA 3D1NI 1TTYA 2LBFB 3A01A 2CV0A 2ME0A 5DCMA 2ZO4A 4UNOA 3B02A 2GA1A 5FJ8J 3ZRGA 3HOSA 2GXGA 2DK5A 1Y1WJ 4QTRA 1IN7A 3A02A 2FJ1A 3I59A 3JCUC 4PJ0C 3ZQFA 4BQNA 4UVBA 2MC4A 2X1DA 3MWMA 2E5NA 3BR6A 1CF7B 1D1BA 3M8EA 2L9SA 2A6EF 4XLEA 3H0GJ 4R1HA 1EKEA 3W2WA 2XAFA 1RNLA 2O7OA 1IXRC 5LHHA 1FWZA 2F6CA 5D5VB 4LLLA 4N9HA 4CDGA 1FMWA 3FXUA 2FQ3A 4Y15A 5K1YA 3HYIA 1VQ9I 1JKRC 4GDFA 4B1RA 2BGCA 3HHHA 3PQJA 2XC7A 1SAXA 4R8HA 1QPIA 1MDMA 1FYMA 3ERED 3KLOA 1R1UA 1FIAA 4EJWA 2OQRA 3CF5F 4D5CA 3L2RA 1RUOA 4LLNA 4ZDLA 3DF8A 1ZK8A 4CCKA 3WTYC 4BACA 1D0ZA 3JRGA 2FBKA 1O3SA 2RQPA 4A69C 2W57A 3HHGA 5LHGA 4MIMA 2JA6J 4I09A 5M5WJ 4YIIA 4DIQA 1CGPA 1HXDA 3EQLF 3S1NJ 2PJRB 3W2AA 3KFWX 4EEFG 3C3WA 3RSNA 1FZPB 4M74A 1VQMI 2LKXA 1BM9A 3T8TA 3HUGB 2E2JJ 2DA6A 2A6TA 2JPCA 2Q2EA 4AWXB 4KDPA 1TZLA 2DQRA 3VYUB 4A0XA 4DZJA 3AG4H 2XAQA 2XUBA 4Q4ZF 1ETWA 5EJCA 1YFHA 4X6AJ 5DYMA 4EM2A 1WRJA 4M9ZA 2P6SA 3F0CA 1WZ2A 1I3AA 1T08B 3RKQA 2VODA 4E7KA 2BY3A 4FQGA 1LFBA 4AVPA 2MC3A 3U21A 3L2UA 1Q1VA 3ZMTA 4AC0A 2OQGA 3JTGA 2FA5A 1QPMA 5HDKA 3F21A 4II3A 4X1EA 2F4IA 3NARA 2ESHA 3RQIA 2VBZA 2VE8A 3A1YA 3S8PA 3HKZN 3REOA 3CMAI 1KZHA 3LAPA 4C3IJ 2GBYA 4YFNF 1YE9A 4KJZA 3VB2A 4HQEA 2EIMH 2CV1A 3LSTA 1AOYA 1AU7A 1PP8F 1RC9A 4KIFA 1R71A 4FASD 3PSIA 3IWZA 2Y0SA 3JRHA 3GYHX 2QQ9A 4BE2A 5K7HA 4EJVA 3SZTA 4D9JA 2JSCA 3J7AY 5JR3A 2CW8A 2IJLA 3CCEI 4KFCA 4Y13A 1BI1A 1ETQA 2P5VA 3ASNH 3OR2C 1X3ZB 2FQ4A 1GVJA 5BPIA 1HC8A 2BXZA 5KK1A 1W5TA 1HW1A 1YTYA 1Z0XA 2BXYA 2K5CA 3C18A 3KETA 3S1RJ 2Z1DA 2W7NA 5KNLA 2GXBA 1KYWA 4ANJA 4C2UA 2KJBA 5BPDA 1FOXA 4U0WA 1U5TB 4XONA 3WTSC 2L0KA 5FD5A 1DGWY 4DNCA 2M4KA 4RGRA 2X51A 4QWQA 3ULQB 1GVDA 2LTPA 2ZFWA 3OIPA 4KIBA 4Z6YA 2M0MA 1FNNA 3WGIA 1D8JA 3G1LA 1LDDA 2STWA 2RN7A 2DFFA 2HOAA 2DOAA 1HSJA 3TW6A 5C4XJ 1W4MA 4XLPF 2VXDA 2DU9A 2WTEA 1ETVA 4EGYA 4S04A 3OS2A 5FKKA 2KISA 2JVGA 1W36C 3COAC 4V2FA 1DGRM 1UB9A 2M8GX 4BHCA 4EM1A 3KEYA 1Z6TA 1A6QA 2L4AA 2IT0A 1T6SA 4A5NA 2HZDA 1K79A 1U9NA 2Z16A 1AA7A 2BVMA 4Y7NJ 1MJAA 5JVTA 2IA2A 3FXOA 1IAWA 2HOSA 1Z91A 1W1WE 1XSXA 2CFXA 4XKWA 1YX5A 3BOQA 3DBRB 4HYEA 4BBSJ 4HV5A 4M6XA 4LLGF 3W6VA 2CH0A 1IRXA 3E5UA 4DQ2A 4RAFA 5A2QK 2XDVA 1IN6A 2FBHA 5HS7A 3JAMK 2HTSA 1ZGAA 2X6WA 5C3EJ 1QHGA 2ETHA 2A3SA 2LSOA 1ZLKA 3QODA 4RMNA 3VEPA 3K4JA 4IF4A 2E2HJ 4D7NA 2PMZN 3CDIA 4XN0A 5J40A 3B6CA 4WK8F 2R5ZB 2FNPA 4HQMA 5HNHA 4PJNA 3WTTC 3GTQJ 1IG7A 3CDLA 3O2PE 5D5UB 1SANA 2L9VA 2NVYJ 2R7OA 3JTHA 4HG2A 1MKMA 2RKHA 5TJJA 3L2CA 1ERDA 3X2QH 2M1BA 4OINF 3C2BA 1RKWA 2DA5A 2E35A 2VPLA 3OIQA 1JHHA 3BR3A 3KEOA 5EGOA 1X1DA 1D8KA 2ZMEB 1Z67A 2P8TA 3GBGA 4E6KG 3E6MA 3HBLA 2RDPA 4I0BA 1O3QA 3MMYB 3GCMA 3OYAA 1TNSA 2MH2A 5FLMJ 1K6OA 1H88C 2IPQX 1G3YA 5H20A 1B4AA 1Y8QB 5E3NA 4KNYA 3TDUC 1UG0A 1ETKA 5L3GA 3GLLA 4NC8A 2DOEA 2K3PA 3LQQA 2QVOA 2QQAA 2HKXA 1N77A 2M34A 1QZZA 3HOUJ 1JUSA 2ZXWH 1WH5A 1N78A 2BYVE 1W0UA 2V26A 1VF9A 3P9CA 3FXKA 4C30A 5GPAA 4D5FA 2M8EA 4MTDA 3JRDA 1UELB 3M3YJ 3D5LA 3CCRI 4JX4A 2EFQA 2H6BA 4PZJA 3LSRA 4HEA2 2Y75A 2DPUA 3P7NA 4B47A 3U9GA 4BXXJ 4D0PA 4EQQA 2R5YA 1WJEA 2DODA 2IA1A 2VT2A 1S7EA 4M3DA 2PEXA 3DU5A 2Y0MA 1S3JA 1TBXA 3GFJA 4CCMA 1K83J 1RRJA 2DA1A 5GP9A 2PMHA 4M9XA 2XGDA 3TP0A 5LRRA 1VFCA 4PSWA 2Z33A 3P5JA 3EUHC 3JW4A 3RPUD 3PNVA 1EH6A 3BY6A 4JBAA 4IZZA 4L9VA 1HF0A 1DU0A 2GIZA 3PUFA 2QENA 3H35A 1MMAA 5EEGA 3I4MJ 1ZARA 3Q0UA 5JHUA 4DZPA 4F52A 4Y52J 4UXNA 3ZXSA 1I1GA 4UHTA 3KYLA 1NHAA 2W1OA 2X6OA 5AIQA 5F1RA 2LD5A 1MMNA 1G8XA 2KFDA 3WU1B 1IO2A 1QZEA 4ZC3A 4EMSA 2RNJA 3FK6A 1R9TJ 1IRGA 3OOUA 1ON2A 2XRLA 3F6VA 3H1CA 4LJZF 1O4XA 3CP2A 4ASNA 3OL3A 3M07A 1S9HA 1PVEA 4EVIA 3QAHA 2VBWA 3IHUA 4LGWA 2LG4A 4FT8A 1HLVA 3HM5A 4I76A 3ZR8X 1YIOA 3HZJA 2VB6A 4BHBA 1PP7U 2KQRA 2IAIA 2RREA 3KP6A 3GTOJ 4ZYAA 2WB1N 2M3AA 1YO5C 2VUMJ 2V1XA 2ZJ2A 4O6JA 4RAGA 5IOYA 1P9QC 2GQQA 1UFMA 1IV8A 2VC0A 3CUQC 3HRTA 4U7DA 3R60A 4Y33A 2OTLI 2JRTA 2M7AA 4IOCF 3FM3A 3GZ5A 4ZZDA 2WADA 1XMKA 4NQWA 5B5EC 2Y9YA 1TQPA 1WI3A 3D0SA 3I55I 3OYKA 3T0YA 3PIPF 3H36A 1YITI 3K70D 3KZYA 1D5VA 1BI3A 1FIPA 2L01A 3O6BB 2G7HA 4KN7X 3S2WA 3OYIA 4L0ZB 2PMUA 1BI2A 5JI6A 2IP2A 1Z1DA 2ZBKA 4MO7A 3EUHA 2ZXHA 2HXIA 2EFWA 3A2KA 2CUFA 2L9RA 2VIXA 3C2GA 1JGSA 2PG4A 2P5LC 3EYYA 2CQQA 2LF7A 4BJ5C 4WWCA 5JLXA 4B48A 3S2HJ 4ESJA 2YPRA 3H3ZA 3ZMDA 4F7ZA 5H6QA 2R7FA 3OOPA 3WU2C 4P9UA 3I53A 3JRBA 3OSFA 5D4SA 2VPRA 3KPHA 4Y17A 1WKMA 1XCVA 1LEAA 4G12A 3TOBA 5LFAA 1HKQA 1ULYA 2QQBA 1J59A 1OYIA 4A3LJ 1BJZA 1WJFA 3BG7A 3S3MA 3N05A 2DJNA 2GZWA 3E1SA 2P6TA 5JFRA 4E7IA 2PN6A 2KLOA 1MSEC 1VQ8I 1ZRDA 3FIWA 3FDYA 4EJTA 1ZGWA 2XPUA 2AXTC 1W7PA 3LSJA 1LNWA 5FKLA 1KGSA 3K10A 1XMAA 1G59A 3AG2H 3K4LA 1X1AA 4RM3A 3WTWC 2W85A 3I5UA 4L9JA 2YS9A 4G9YA 2Y30A 3DPLC 2VOOA 2YX7A 1OCCH 2K9LA 3ASOH 1BIAA 1QA6A 1X2NA 2A68F 2LKSA 1WJAA 3HC7A 4BL0B 4BQOA 1HQCA 4CCLA 4DYRA 3CUQA 1FEXA 4XLFA 3F8NA 3IKTA 1B6AA 3LSKA 2L9NA 4HW0A 1YRNA 3GUDA 1UG2A 1RIOH 4HBLA 1XGMA 4I6ZA 1G6NA 5K5OA 3FF5A 2D1VA 2IGOA 2HPIA 3E5XA 1HDPA 3FKIJ 1T8IA 3PO2J 4YIFA 4KA4A 4MNUA 3RDIA 4Q47A 2A05A 2ID3A 1POGA 1A6IA 4B44A 3DTEA 4G6TB 3FKJA 2UXNA 2E34A 2P81A 3BTLA 2QBYB 4ZH4F 2I10A 2H6CA 2XAUA 1SFOJ 5JLWA 2AQFA 2RC4A 1JUPA 3DTIA 4JQFA 4AM3A 3L7WA 3ZMZA 1F43A 1TQIA 2LRDA 4HV6A 3G1OA 1ZG1A 5DCFA 2HEOA 4W1UA 2OC6A 1TWFJ 1DU6A 1AKHB 2HYGD 3RKXA 1Z21A 2TCTA 4BKXA 4L0YB 5BOXA 3KEQA 3ZN1A 2XB5A 3U2RA 3OR1C 5LGTA 1JKPC 4RB2C 2VN2A 3O8GA 2HQNA 1F1ZA 3QYEA 5E3MA 4M3EA 1VNDA 3S3NA 1WFXA 3QP6A 5LGNA 1H0MA 1A04A 2WAQA 4GXOA 4RB1A 1OMIA 2CW0F 4BXFA 2FD5A 2EZIA 2EFOA 3TW7A 2BOLA 1LKXA 3K2ZA 2IS2A 5J3LA 3GZ6A 3ZMVA 3GF2A 2Y2ZA 3TL4X 4A93J 3CO6C 4OIRF 2QGUA 5C44J 2Q8KA 1ZG3A 3MZHA 1MBHA 2DFHA 1ZYRF 4IHTA 1H8AC 2EZKA 4I01A 3F3XA 2XGXA 1OCPA 3L00A 2R93J 3BJ6A 3TO6A 5CYVA 1JT0A 2K9SA 2CMPA 1HW2A 4FE4A 1NK3P 2KIMA 3LOCA 3K4MA 1IN8A 3BG9A 1B1BA 2CQNA 4IL6C 1FYLA 2WA0A 4M9SA 2V7FA 3AG3H 2EQRA 1FBUA 2CWEA 1P2FA 3K0LA 3CC2I 2VQHA 4CCJA 3DEWA 1DPRA 3CCJI 2QA4I 1B9MA 1S29A 4M71A 2IEKA 3BC8A 4ZTJA 3HRSA 2DA2A 3HOVJ 1JTYA 2QSHX 3K1MA 2K9MA 2E7WA 3HTUA 2CYYA 4G8XA 1VQ7I 3M4OJ 2DW4A 2PFBA 3VYRB 3IH4A 5HLGA 2V79A 3F9KA 4I99C 3KIOA 1X3UA 1OISA 2JN6A 3I9V2 2LY2A 4A3EJ 1KU7A 4D7MA 4HX7A 2XRNA 3MKYB 3T1BA 1D5YA 5CQEA 2D2WA 3MN2A 3KP3A 1G3TA 4UB8C 3HOTA 1ETOA 1U3EM 2Y9ZA 2QYOA 1T33A 4KISA 3CJRB 2H1KA 2WV0A 2P7VB 4IJAA 5DD8A 3BROA 3SFIA 2NYXA 4AIHA 2O5RA 5GPCA 1H9TA 4AYBN 1BIBA 1O7LA 4LMYA 4RS8A 1U0JA 3CJNA 2IS1A 2KPMA 2ZB9A 5GTHC 3GFMA 3MCZA 1M1EB 2LF8A 4NB5A 3N97A 3EDPA 3BR1A 5J8CA 4IO9F 1Y39A 1JJ6C 3E6DA 2XPVA 4KT6A 2ZJRF 2VONA 3BT9A 2E36A 3GMEA 1J0RA 4CYCA 5GAGJ 1CQTA 4IHWA 2YR2A 3F8FA 3I59B 5HODA 5AIPA 4HA8A 5DUKA 2JA5J 5TISC 4OMZA 4GFBA 4A6DA 4N4NB 1FSEA 2W4SA 3QOPA 1I5ZA 3FXMA 4ENNA 3CP8A 2YU9J 1A5JA 5IT9Z 2E1MC 2EINH 1ON1A 3BCAA 1A36A 1I1SA 4U87A 1SVOA 4XSXF 1VQ4I 4IKFA 5IOZA 2NOJB 1K61A 1KA8A 5CVVA 3S2DJ 2E1OA 3Q0WA 1R00A 3DWLE 5F6FA 2R7TA 2BW3B 3PL8A 2CO5A 4GYIA 1E3PA 4PCQA 1USSA 4HNVA 1SD4A 1UHWA 1MW7A 2EJRA 1MDMB 4CCNA 3CMMA 4BGDA 5DDGA 2XB0X 2O0YA 2VXZA 1IDYA 2FNAA 4HDUA 2PLYA 2G0EA 2ZFUA 2FRHA 3CUOA 3DP7A 4KT5C 4ON0A 1T39A 2K3FA 1ENHA 4YFXF 3BJOA 4LG0B 5FLXK 4CICA 4UVCA 4IRGA 2ZCWA 2PI0A 4OWRB 2RV8A 3QU3A 4XOTA 2ECCA 5D6EA 1WSUA 1IC8A 1SMYF 1X1BA 1JGGA 2HQ5A 4I7HA 4OMYA 1V54H 2R7RA 4BDZA 3VSLA 1GDTA 2Q2EB 3MAJA 2L54A 2VBXA 3S3OA 2WC2A 2UWMA 2CGPA 3F72A 3VFZA 2FX0A 1ZKGA 2CJJA 2L2OA 3D5RC 2JJ7A 5E1WA 1SC7A 1JKOC 2HVRA 1IW7F 1WH7A 4XRMA 2DN0A 3MVPA 5F27A 4BXUA 1T2KA 2Z2SB 2GM4A 2N8GA 3LQRA 1I39A 5AONA 3TGNA 4Q5SF 3HIFA 2A6HF 2DXIA 3L09A 5IT9K 1D0XA 2UZKA 5FLXZ 3OYGA 1R5GA 2OCCH 1HW5A 2KIFA 4B09A 3HL2A 1VQNI 3CMEI 1K4TA 2ELHA 2NVTJ 1EF4A 9ANTA 3M1EA 1LPQA 5ICFA 3ABKH 4IOAF 1JXSA 4XBFA 3FMQA 3AL0C 2P0WA 5B1AH 3S93A 4YG2F 2F2EA 1U2WA 1V55H 1R49A 2H8WA 3KYDB 4O5VA 2E1MB 1EH8A 1N25A 4RAYA 4WX9A 5D8LB 1TT5B 4RGSA 1HBXG 2HWVA 3P9KA 4QIWN 4UUSA 4TV7A 3IP4B 4ZDPA 4KICA 1HSTA 2AHQA 2XPWA 5DS9A 4I2OA 5IT3A 1B72A 2JTVA 3BG6A 1DDNA 4IEJA 3SFZA 4NNJA 3OYBA 4IRHA 4MQVA 1KU3A 4E7LA 2F4OB 1YOVB 4XLCA 4N4OB 4KMUX 5K5RA 1FC3A 2ECBA
chains in the Genus database with same CATH topology
1S7EA 4M3DA 3H3VK 4C3HJ 1FJLA 1TWCJ 3A01B 3OIOA 1RR7A 2M9HA 1RETA 1K83J 3JRAA 2DA1A 5GP9A 3ZQGA 2AO9A 2XGDA 3TP0A 2NS8A 3WHBA 1VFCA 1B8IB 2KT0A 3BTIA 1HF0A 1DU0A 1RPWA 4M3FA 5F0HA 1UMQA 4CYCB 5DTDA 1ITYA 5M3MJ 1U9OA 3I4MJ 2OF7A 3Q0UA 5FLVA 2NOGA 2HI3A 1QVTA 4B4CA 4DZPA 1WCMJ 2H8RA 4Y52J 1JTXA 1ZTRA 4BY1J 3HEFA 2Y31A 2X6OA 2ELKA 2LD5A 2L7MP 3GTMJ 1E3OC 1ZQ3P 1XG1A 5M5YJ 2DMTA 1JT6A 5E3OA 3VPRA 3FK6A 1R9TJ 1MBKA 3OOUA 4JYKA 2HXOA 4A3IJ 3S1MJ 1HOMA 2XRLA 1O4XA 5IP6A 5J1YA 2O9LA 2VI6A 4A3BJ 1P7IA 1U78A 5C4JJ 4IHYA 3K2AA 1X58A 3HOZJ 1HLVA 3HM5A 4I76A 1JJ8C 1IUFA 5K7FA 1ETXA 5F04A 3DCFA 3FISA 2IAIA 5F0FA 4V2GA 3GTOJ 1OJLA 2WB1N 3IH2A 2VUMJ 2WAQN 5IOYA 2MSYA 3MKLA 4M3BA 5IP9J 4MFEA 2Y9YA 5J1RA 2D5VA 1WI3A 2TRTA 1ZR4A 2MG4A 4MLOA 1Z77A 1FIPA 3BR0A 5FKNA 3BQZA 1VI0A 1IV6A 3TEDA 3JRFA 1AHDP 1G2HA 2E19A 4MO7A 2HXIA 2CUFA 2L9RA 5EG0B 1PUFB 3A03A 3S15J 2LFBA 2CQQA 4A3JJ 5JLXA 3SJMA 5EGOB 3S2HJ 3BTCA 5M5XJ 1GV2A 1MBFA 2NS7A 3JRBA 3OSFA 2WV1A 2VPRA 4G12A 3S17J 1LFUP 4A3LJ 4IHVA 3S16J 1BJZA 1UHSA 4M3GA 2DJNA 5J1UA 3UKGA 4XIDA 2XGCA 1BL0A 3G1MA 1Y1VJ 2EBIA 3WHCA 1MSEC 2JWTA 3FIWA 5FKOA 1ZGWA 4UUSB 3JREA 2XPUA 2JMWA 1MBJA 3LSJA 5FKLA 5EDNA 1ETYA 4DYCA 2DMQA 2K9QA 1B72B 2W48A 3HOWJ 2YS9A 2Y30A 1IRZA 3ZQCA 4B3AA 1X2MA 2R0QC 2R5YB 1X2NA 4A3KJ 2K9NA 4DYRA 4RDUA 1FEXA 1H89C 2L7ZA 2EH3A 3HOYJ 5K7ZA 1YRNA 1UG2A 1APLC 3GTLJ 3O8HA 1RESA 4I6ZA 3HB9A 3D1NI 1HDDC 3A01A 3FKIJ 3PO2J 1HDPA 2ME0A 2DMPA 3QPSA 4FISA 5E3LA 3HDDA 3ZQIA 4QSHA 2ID3A 5FJ8J 1POGA 1A6IA 4JP0A 1Y1WJ 4MFDA 4QTRA 2P81A 3A02A 2FJ1A 3BTLA 1P7JA 2I10A 4L5EA 3ZQFA 1FTTA 3GTJJ 3GTKJ 2LY9A 1SFOJ 3BR6A 5JLWA 2M0CA 4BY7J 1JUPA 1BW5A 3Q3SA 4JX6A 1F43A 3H0GJ 3G1OA 3GTGJ 2O7OA 3ZQLA 4W1UA 1TWFJ 1DU6A 1AKHB 4M6VA 2CRGA 4BKXA 2TCTA 1JKRC 2XB5A 3OSGA 2EZLA 4B1RA 1JKPC 1ORKA 3O8GA 5E3MA 1QPIA 4M3EA 1VNDA 1I3QJ 4XICA 1BA5A 1FIAA 1U8BA 4D5CA 5IYCJ 3PM1A 1ZK8A 2FD5A 2EZIA 3TW7A 1OCTC 3JRGA 1WPKA 5J3LA 4XRSA 4A69C 2Y2ZA 4MIMA 4A93J 2JA6J 5C44J 5M5WJ 4XK4A 2LR8A 2ID6A 3S1NJ 2XSDC 3ZOBA 1MBHA 3CQZJ 4DYQA 4EEFG 1H8AC 2EZKA 2DA4A 2CQXA 1OCPA 2LKXA 2E2JJ 2R93J 2DA6A 3LSPA 5IYBJ 1JT0A 2K9SA 2R5ZA 1FTZA 4FE4A 1NK3P 2DA7A 3LOCA 2DMUA 4DZJA 1XC5A 3BG9A 2CUEA 2HOTA 1ETWA 4W97A 3BQYA 2EQRA 4X6AJ 3F0CA 3K7AJ 3BR5A 3DEWA 3S14J 3RKQA 3HGGA 4C2MJ 1NK2P 1LFBA 2VKEA 2IEKA 1Q1VA 4AC0A 1TWHJ 3HGYA 2R7ZJ 2DA2A 4AUXA 3HOVJ 4X1EA 1JTYA 3NARA 3M4OJ 3RQIA 4A3FJ 4FTHA 3GTPJ 3HKZN 1OFCX 2CU7A 4C3IJ 3IH4A 2LLKA 3LSGA 2GBYA 1LE8A 2RAEA 2JN6A 1AU7A 1BW6A 4LOCA 4A3EJ 2MGQA 4J19A 4IHXA 4ABZA 4D7MA 1HCRA 2COBA 1D5YA 3JRHA 2Y0SN 4UUTA 3MN2A 5EZGA 1ZR2A 3QQAA 5K7HA 4FCYA 2LK2A 3E7LA 2DA3A 4S0HB 1ETOA 1TWGJ 2Y9ZA 1XS9A 1T33A 3S1QJ 1MH3A 2H1KA 2JA8J 1ETQA 2NVXJ 3JRCA 1WGXA 3SFIA 5GPCA 5EEAA 1I6HJ 1GT0C 2FQ4A 4AYBN 3HOXJ 2QF7A 3RZOJ 5IPAA 2LVSA 3QPLA 1Z0XA 2JA7J 2R92J 1QRYA 3S1RJ 1MBEA 3PO3J 5IP7J 2ZB9A 4A3MJ 3IH3A 2YUSA 1QVUA 3BG3A 1B8IA 1I50J 4RBOA 2L0KA 1MSFC 3BR1A 1F36A 1JJ6C 1GVDA 2XPVA 2LTPA 1TC3C 2X48A 3BT9A 4CYCA 1CQTA 4IHWA 5HODA 3G1LA 2JA5J 2HOAA 4GFBA 3TW6A 1IDZA 2GLOA 1IGNA 5F0CA 5EF6A 5C4XJ 3I4NJ 2OPTA 2YU9J 1ETVA 3NAUA 2EZHA 1A5JA 5FKKA 2X9DA 4V2FA 2M8GX 4C3JJ 2MW8A 2XGEA 5IOZA 1TWAJ 1K61A 1GV5A 3S2DJ 2E1OA 3Q0WA 3IV5A 1JUMA 1U9NA 4HNVA 1JKQC 1AKHA 4A3DJ 4Y7NJ 3JRIA 3JR9A 2NVQJ 2HOSA 2QCOA 2LP0A 1MH4A 2XB0X 5M3FJ 2ME6A 1IDYA 3SDGA 4BBSJ 2VKVA 2DTZA 2G0EA 5F08A 3W6VA 1ENHA 3BTJA 2HYJA 2E2IJ 5C3EJ 3ZQHA 1IC8A 2ECCA 3FK7A 3RZDJ 3BG5A 3Q0VA 1RKTA 2HQ5A 1JGGA 5IYDJ 2E2HJ 4D7NA 2PMZN 1GDTA 3B6CA 2R5ZB 3GTQJ 1IG7A 4NDLA 3CDLA 2FX0A 4A3CJ 1SANA 1ZKGA 2NVYJ 2CJJA 2JJ7A 1MNMC 4FE7A 1JKOC 3C2BA 2JK3A 1WH7A 2M2EA 4XRMA 1RKWA 2DN0A 3MVPA 5EG0A 1PUFA 2DA5A 5F27A 4BBRJ 2GM4A 2N8GA 3BR3A 5BNGA 5EGOA 3B6AA 4A3GJ 2HDDA 1IJWC 3GBGA 2K40A 3LNQA 1MBGA 3HBLA 1T56A 2KDZA 5FKMA 2NVTJ 1LE8B 1EF4A 9ANTA 5FLMJ 1H88C 3L1PA 5E3NA 2B63J 3CMYA 1ETKA 3TP3A 4DW6A 3CCYA 4XRSG 2M34A 3HOUJ 1JUSA 1WH5A 2O8KA 5EZHA 4QIWN 1W0TA 1W0UA 1VF9A 4UUSA 4JX5A 5GPAA 4D5FA 2IBDA 2AHQA 1NTCA 2L7FP 2XPWA 5DS9A 5EYRA 3BR2A 3JRDA 1B72A 3M3YJ 4JX4A 4IEJA 3LSRA 1GUUA 2DMNA 5F1JA 4BXXJ 1YRNB 2R5YA 2ECBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7E A;  4M3D A;  3H3V K;  4C3H J;  1FJL A;  1TWC J;  3A01 B;  3OIO A;  1RR7 A;  2M9H A;  1RET A;  1K83 J;  3JRA A;  2DA1 A;  5GP9 A;  3ZQG A;  2AO9 A;  2XGD A;  3TP0 A;  2NS8 A;  3WHB A;  1VFC A;  1B8I B;  2KT0 A;  3BTI A;  1HF0 A;  1DU0 A;  1RPW A;  4M3F A;  5F0H A;  1UMQ A;  4CYC B;  5DTD A;  1ITY A;  5M3M J;  1U9O A;  3I4M J;  2OF7 A;  3Q0U A;  5FLV A;  2NOG A;  2HI3 A;  1QVT A;  4B4C A;  4DZP A;  1WCM J;  2H8R A;  4Y52 J;  1JTX A;  1ZTR A;  4BY1 J;  3HEF A;  2Y31 A;  2X6O A;  2ELK A;  2LD5 A;  2L7M P;  3GTM J;  1E3O C;  1ZQ3 P;  1XG1 A;  5M5Y J;  2DMT A;  1JT6 A;  5E3O A;  3VPR A;  3FK6 A;  1R9T J;  1MBK A;  3OOU A;  4JYK A;  2HXO A;  4A3I J;  3S1M J;  1HOM A;  2XRL A;  1O4X A;  5IP6 A;  5J1Y A;  2O9L A;  2VI6 A;  4A3B J;  1P7I A;  1U78 A;  5C4J J;  4IHY A;  3K2A A;  1X58 A;  3HOZ J;  1HLV A;  3HM5 A;  4I76 A;  1JJ8 C;  1IUF A;  5K7F A;  1ETX A;  5F04 A;  3DCF A;  3FIS A;  2IAI A;  5F0F A;  4V2G A;  3GTO J;  1OJL A;  2WB1 N;  3IH2 A;  2VUM J;  2WAQ N;  5IOY A;  2MSY A;  3MKL A;  4M3B A;  5IP9 J;  4MFE A;  2Y9Y A;  5J1R A;  2D5V A;  1WI3 A;  2TRT A;  1ZR4 A;  2MG4 A;  4MLO A;  1Z77 A;  1FIP A;  3BR0 A;  5FKN A;  3BQZ A;  1VI0 A;  1IV6 A;  3TED A;  3JRF A;  1AHD P;  1G2H A;  2E19 A;  4MO7 A;  2HXI A;  2CUF A;  2L9R A;  5EG0 B;  1PUF B;  3A03 A;  3S15 J;  2LFB A;  2CQQ A;  4A3J J;  5JLX A;  3SJM A;  5EGO B;  3S2H J;  3BTC A;  5M5X J;  1GV2 A;  1MBF A;  2NS7 A;  3JRB A;  3OSF A;  2WV1 A;  2VPR A;  4G12 A;  3S17 J;  1LFU P;  4A3L J;  4IHV A;  3S16 J;  1BJZ A;  1UHS A;  4M3G A;  2DJN A;  5J1U A;  3UKG A;  4XID A;  2XGC A;  1BL0 A;  3G1M A;  1Y1V J;  2EBI A;  3WHC A;  1MSE C;  2JWT A;  3FIW A;  5FKO A;  1ZGW A;  4UUS B;  3JRE A;  2XPU A;  2JMW A;  1MBJ A;  3LSJ A;  5FKL A;  5EDN A;  1ETY A;  4DYC A;  2DMQ A;  2K9Q A;  1B72 B;  2W48 A;  3HOW J;  2YS9 A;  2Y30 A;  1IRZ A;  3ZQC A;  4B3A A;  1X2M A;  2R0Q C;  2R5Y B;  1X2N A;  4A3K J;  2K9N A;  4DYR A;  4RDU A;  1FEX A;  1H89 C;  2L7Z A;  2EH3 A;  3HOY J;  5K7Z A;  1YRN A;  1UG2 A;  1APL C;  3GTL J;  3O8H A;  1RES A;  4I6Z A;  3HB9 A;  3D1N I;  1HDD C;  3A01 A;  3FKI J;  3PO2 J;  1HDP A;  2ME0 A;  2DMP A;  3QPS A;  4FIS A;  5E3L A;  3HDD A;  3ZQI A;  4QSH A;  2ID3 A;  5FJ8 J;  1POG A;  1A6I A;  4JP0 A;  1Y1W J;  4MFD A;  4QTR A;  2P81 A;  3A02 A;  2FJ1 A;  3BTL A;  1P7J A;  2I10 A;  4L5E A;  3ZQF A;  1FTT A;  3GTJ J;  3GTK J;  2LY9 A;  1SFO J;  3BR6 A;  5JLW A;  2M0C A;  4BY7 J;  1JUP A;  1BW5 A;  3Q3S A;  4JX6 A;  1F43 A;  3H0G J;  3G1O A;  3GTG J;  2O7O A;  3ZQL A;  4W1U A;  1TWF J;  1DU6 A;  1AKH B;  4M6V A;  2CRG A;  4BKX A;  2TCT A;  1JKR C;  2XB5 A;  3OSG A;  2EZL A;  4B1R A;  1JKP C;  1ORK A;  3O8G A;  5E3M A;  1QPI A;  4M3E A;  1VND A;  1I3Q J;  4XIC A;  1BA5 A;  1FIA A;  1U8B A;  4D5C A;  5IYC J;  3PM1 A;  1ZK8 A;  2FD5 A;  2EZI A;  3TW7 A;  1OCT C;  3JRG A;  1WPK A;  5J3L A;  4XRS A;  4A69 C;  2Y2Z A;  4MIM A;  4A93 J;  2JA6 J;  5C44 J;  5M5W J;  4XK4 A;  2LR8 A;  2ID6 A;  3S1N J;  2XSD C;  3ZOB A;  1MBH A;  3CQZ J;  4DYQ A;  4EEF G;  1H8A C;  2EZK A;  2DA4 A;  2CQX A;  1OCP A;  2LKX A;  2E2J J;  2R93 J;  2DA6 A;  3LSP A;  5IYB J;  1JT0 A;  2K9S A;  2R5Z A;  1FTZ A;  4FE4 A;  1NK3 P;  2DA7 A;  3LOC A;  2DMU A;  4DZJ A;  1XC5 A;  3BG9 A;  2CUE A;  2HOT A;  1ETW A;  4W97 A;  3BQY A;  2EQR A;  4X6A J;  3F0C A;  3K7A J;  3BR5 A;  3DEW A;  3S14 J;  3RKQ A;  3HGG A;  4C2M J;  1NK2 P;  1LFB A;  2VKE A;  2IEK A;  1Q1V A;  4AC0 A;  1TWH J;  3HGY A;  2R7Z J;  2DA2 A;  4AUX A;  3HOV J;  4X1E A;  1JTY A;  3NAR A;  3M4O J;  3RQI A;  4A3F J;  4FTH A;  3GTP J;  3HKZ N;  1OFC X;  2CU7 A;  4C3I J;  3IH4 A;  2LLK A;  3LSG A;  2GBY A;  1LE8 A;  2RAE A;  2JN6 A;  1AU7 A;  1BW6 A;  4LOC A;  4A3E J;  2MGQ A;  4J19 A;  4IHX A;  4ABZ A;  4D7M A;  1HCR A;  2COB A;  1D5Y A;  3JRH A;  2Y0S N;  4UUT A;  3MN2 A;  5EZG A;  1ZR2 A;  3QQA A;  5K7H A;  4FCY A;  2LK2 A;  3E7L A;  2DA3 A;  4S0H B;  1ETO A;  1TWG J;  2Y9Z A;  1XS9 A;  1T33 A;  3S1Q J;  1MH3 A;  2H1K A;  2JA8 J;  1ETQ A;  2NVX J;  3JRC A;  1WGX A;  3SFI A;  5GPC A;  5EEA A;  1I6H J;  1GT0 C;  2FQ4 A;  4AYB N;  3HOX J;  2QF7 A;  3RZO J;  5IPA A;  2LVS A;  3QPL A;  1Z0X A;  2JA7 J;  2R92 J;  1QRY A;  3S1R J;  1MBE A;  3PO3 J;  5IP7 J;  2ZB9 A;  4A3M J;  3IH3 A;  2YUS A;  1QVU A;  3BG3 A;  1B8I A;  1I50 J;  4RBO A;  2L0K A;  1MSF C;  3BR1 A;  1F36 A;  1JJ6 C;  1GVD A;  2XPV A;  2LTP A;  1TC3 C;  2X48 A;  3BT9 A;  4CYC A;  1CQT A;  4IHW A;  5HOD A;  3G1L A;  2JA5 J;  2HOA A;  4GFB A;  3TW6 A;  1IDZ A;  2GLO A;  1IGN A;  5F0C A;  5EF6 A;  5C4X J;  3I4N J;  2OPT A;  2YU9 J;  1ETV A;  3NAU A;  2EZH A;  1A5J A;  5FKK A;  2X9D A;  4V2F A;  2M8G X;  4C3J J;  2MW8 A;  2XGE A;  5IOZ A;  1TWA J;  1K61 A;  1GV5 A;  3S2D J;  2E1O A;  3Q0W A;  3IV5 A;  1JUM A;  1U9N A;  4HNV A;  1JKQ C;  1AKH A;  4A3D J;  4Y7N J;  3JRI A;  3JR9 A;  2NVQ J;  2HOS A;  2QCO A;  2LP0 A;  1MH4 A;  2XB0 X;  5M3F J;  2ME6 A;  1IDY A;  3SDG A;  4BBS J;  2VKV A;  2DTZ A;  2G0E A;  5F08 A;  3W6V A;  1ENH A;  3BTJ A;  2HYJ A;  2E2I J;  5C3E J;  3ZQH A;  1IC8 A;  2ECC A;  3FK7 A;  3RZD J;  3BG5 A;  3Q0V A;  1RKT A;  2HQ5 A;  1JGG A;  5IYD J;  2E2H J;  4D7N A;  2PMZ N;  1GDT A;  3B6C A;  2R5Z B;  3GTQ J;  1IG7 A;  4NDL A;  3CDL A;  2FX0 A;  4A3C J;  1SAN A;  1ZKG A;  2NVY J;  2CJJ A;  2JJ7 A;  1MNM C;  4FE7 A;  1JKO C;  3C2B A;  2JK3 A;  1WH7 A;  2M2E A;  4XRM A;  1RKW A;  2DN0 A;  3MVP A;  5EG0 A;  1PUF A;  2DA5 A;  5F27 A;  4BBR J;  2GM4 A;  2N8G A;  3BR3 A;  5BNG A;  5EGO A;  3B6A A;  4A3G J;  2HDD A;  1IJW C;  3GBG A;  2K40 A;  3LNQ A;  1MBG A;  3HBL A;  1T56 A;  2KDZ A;  5FKM A;  2NVT J;  1LE8 B;  1EF4 A;  9ANT A;  5FLM J;  1H88 C;  3L1P A;  5E3N A;  2B63 J;  3CMY A;  1ETK A;  3TP3 A;  4DW6 A;  3CCY A;  4XRS G;  2M34 A;  3HOU J;  1JUS A;  1WH5 A;  2O8K A;  5EZH A;  4QIW N;  1W0T A;  1W0U A;  1VF9 A;  4UUS A;  4JX5 A;  5GPA A;  4D5F A;  2IBD A;  2AHQ A;  1NTC A;  2L7F P;  2XPW A;  5DS9 A;  5EYR A;  3BR2 A;  3JRD A;  1B72 A;  3M3Y J;  4JX4 A;  4IEJ A;  3LSR A;  1GUU A;  2DMN A;  5F1J A;  4BXX J;  1YRN B;  2R5Y A;  2ECB A; 
#chains in the Genus database with same CATH topology
 3V8K A;  2VE9 A;  5HLI A;  2XKO A;  3F23 A;  1X19 A;  4G94 A;  1TWC J;  3VYS B;  2M9H A;  4RLF A;  2DT5 A;  3ZQG A;  3A0H C;  2KT0 A;  2E1C A;  2X6X A;  4CZZ A;  2C6Y A;  5DM6 F;  2MAB A;  5DV5 A;  2L02 A;  5LHI A;  1RPW A;  4M3F A;  3QU6 A;  1DP3 A;  4II2 A;  1ITY A;  1U9O A;  2OF7 A;  1TT0 A;  3W2V A;  2I5U A;  4BHP A;  2F5F A;  2NS0 A;  1R5H A;  5HLT A;  3K1N A;  2VQC A;  2Y31 A;  1T98 A;  2IGN A;  1ZQ3 P;  2K85 A;  3AG1 H;  2DMT A;  2OU2 A;  1V3F A;  4CH7 A;  5HNF A;  2YSR A;  1A31 A;  1F5T A;  1J7K A;  1DUX C;  3CCS I;  3ZN0 A;  5IP6 A;  2MFZ A;  5J1Y A;  3I56 I;  1UAA A;  2O9L A;  2VI6 A;  1Q1H A;  5DD4 A;  3U1K A;  1XCB A;  4OU0 A;  2KHM A;  1U78 A;  2XKP A;  3ABT A;  5C4J J;  4AIK A;  3HOZ J;  2ZC2 A;  3GW2 A;  5GTI C;  2YU3 A;  5L3C A;  4NHJ A;  4L9N A;  1IUF A;  5K7F A;  1ETX A;  5F04 A;  4XLN F;  5F0F A;  4EGZ A;  2WB1 A;  1OJL A;  1RI7 A;  2L7K A;  5TGT A;  3C2H A;  1YIJ I;  2GOX B;  3W6K B;  4E7J A;  1F4K A;  3H3U A;  3TDZ C;  5CVU A;  2RNG A;  2MSY A;  2CV2 A;  2W25 A;  3MKL A;  3T8R A;  1XGO A;  2VJJ A;  2OD5 A;  1W7P D;  2Q0O A;  3BZC A;  3IUO A;  5LEK A;  3RCO A;  2DQL A;  4P9F A;  1E3H A;  3WGH A;  2TRT A;  3MKW B;  3BQZ A;  3DLL F;  1IV6 A;  4XKV A;  2JSP A;  2XVC A;  1K78 B;  2MA3 A;  4KMF A;  4XNF A;  3A03 A;  2KP6 A;  2LFB A;  1G4D A;  3SJM A;  2BY0 A;  5EGO B;  2PJP A;  1E17 A;  3K4N A;  2CUJ A;  3OYN A;  1GV2 A;  1YHQ I;  4CSW A;  2G7U A;  2JZY A;  3QYF A;  1YW8 A;  3IRQ A;  3G2B A;  5GAE J;  3EUA A;  5D4R A;  4HNT A;  1U6G A;  4M3G A;  5JHF A;  1S8N A;  1FX7 A;  3CCV I;  2KKO A;  2XGC A;  2EB7 A;  1BL0 A;  3G1M A;  1Y1V J;  3RKW A;  4G7Z F;  1SVM A;  2R7Q A;  2R3S A;  2V4J C;  3WHC A;  5D8K B;  2A5W A;  4BJT A;  5FKO A;  3OYM A;  3JRE A;  1MBJ A;  4UVA A;  2EIJ H;  4BE1 A;  4OOI A;  1OQY A;  3VOD A;  3K4K A;  4BEH A;  4CO8 A;  1BR2 A;  3LWF A;  2W48 A;  1XPX A;  2R7U A;  3HOW J;  3WGG A;  5LLQ A;  5D5X B;  2R5Y B;  3PJR A;  2R4G A;  2D1H A;  3QOE A;  3JSP A;  1J75 A;  2FOK A;  2QLZ A;  1BOA A;  1H89 C;  2QM3 A;  2OTJ I;  2H09 A;  4NC7 A;  3E97 A;  5J4Y A;  3GTL J;  2MD5 A;  1WJ5 A;  3O8H A;  1FBS A;  2JVH A;  4A6E A;  5CVI A;  3VWB A;  5DUI A;  3WE3 A;  1HDD C;  6PAX A;  1S7A A;  5H2F C;  2DMP A;  3QPS A;  4P5O A;  3ZQI A;  1IZ1 A;  3G73 A;  2ZJP F;  2R7W A;  2PQ8 A;  2EIK H;  1H9G A;  4MFD A;  1SFX A;  3ZGK A;  4L5E A;  4DJA A;  2CSO A;  1KQ8 A;  1FTT A;  2DT7 B;  3G4S I;  3GTK J;  1RUN A;  1TL8 A;  1TW2 A;  2WY8 Q;  5LD2 C;  2LRE A;  2XSJ C;  3PNT A;  4YRV A;  3D5S C;  3PFY A;  1WVR A;  2K4B A;  4JX6 A;  2J5O A;  3OYE A;  4PJJ A;  5FFX A;  2NRA C;  3V8L A;  2FMY A;  3HPG A;  1V5E A;  2Z5U A;  1GHC A;  2WWY A;  4U0Y A;  4YFK F;  3ZMS A;  3PIO F;  5LRS A;  3LFU A;  2VJ4 A;  1MJ9 A;  3W6J B;  3OSG A;  1MD0 A;  4BDY A;  1Z9C A;  2R7V A;  3QPT A;  4EV0 A;  2E60 A;  1I3Q J;  2HFH A;  4RA2 A;  1U8B A;  4KYW A;  3K4C A;  5IYC J;  3I54 A;  3PM1 A;  3F8B A;  4XOP A;  5CKT A;  4ZYG A;  4WXD A;  5ICE A;  1OCT C;  2QUF A;  1YS7 A;  1WPK A;  3BZK A;  3OS0 A;  1ZRE A;  2HZT A;  1WWX A;  1I6X A;  4DYQ A;  3HJE A;  4NQW B;  5J6X A;  2LKP A;  1ZN2 A;  2TDX A;  5FD6 A;  2HDW A;  3BWG A;  3K9T A;  4HST A;  1VQK I;  3LSP A;  2EV5 A;  2DA7 A;  2DMU A;  2UV1 A;  3I0T A;  1FOW A;  3J80 Z;  3PQK A;  1UHM A;  2RGV A;  2H27 A;  4ZDO A;  3S14 J;  3BR5 A;  3BCB A;  1E2X A;  3C1D A;  4C2M J;  1Y0N A;  4Y3O A;  3M8F A;  2VKE A;  1NG6 A;  2A69 F;  3RYP A;  5FB2 A;  2A07 F;  2OBP A;  1SFE A;  2VKD A;  1ZH5 A;  4LIT A;  4NBQ A;  1TNT A;  3SYT A;  4N0B A;  4A3F J;  4U7B A;  1OFC X;  2CU7 A;  1Z3Y A;  2LLK A;  1LE8 A;  1R22 A;  1XGS A;  2DPD A;  2RAE A;  3HSF A;  4PSX A;  5E17 F;  3QYB A;  4BNC A;  1J09 A;  2UUZ A;  3ZMU A;  1R36 A;  1BW6 A;  1SAU A;  2EIL H;  4B8X A;  1LQ1 A;  1XSV A;  2MGQ A;  4IHX A;  5KCM A;  2DAO A;  4ABZ A;  2V1U A;  1N75 A;  1FT9 A;  4QLC U;  4MEY F;  4ESB A;  1XB4 A;  2DDA A;  3CES A;  4U0V A;  3OYD A;  1ZR2 A;  3QQA A;  4IVN A;  3E6C C;  4FCY A;  2LK2 A;  4S0H B;  4ITV A;  1W7P B;  1TWG J;  3E6B A;  4C2T A;  1XS9 A;  3S1Q J;  3OYC A;  2W00 A;  2XAJ A;  1Y8R B;  2IGK A;  3G71 I;  2AS5 F;  3ERM A;  3BPV A;  1I6H J;  1T0F A;  4AYB A;  4QPO A;  2DOF A;  4XLH A;  3RZO J;  2DFI A;  3A0B C;  2LVS A;  1SVL A;  3CUQ B;  1EA3 A;  2JA7 J;  5DEQ A;  4EJU A;  2R7X A;  2KIQ A;  1P92 A;  2Z99 A;  1XDS A;  4A3M J;  3DKY A;  4BU2 A;  4F91 B;  2V6E A;  1D1A A;  2YUS A;  2DO7 A;  1XDU A;  3VOE A;  1VQL I;  4ENK A;  1JE8 A;  4BUP A;  1YJ9 I;  1B8I A;  1I50 J;  3QPH A;  4EM0 B;  3K1P A;  1F36 A;  2H94 A;  4EJO A;  2Y48 A;  1TC3 C;  2X48 A;  4RLQ A;  1REP C;  3GWZ A;  2FE3 A;  1HKS A;  3ZCO A;  3GXO A;  1R1T A;  2F4M B;  5KVR A;  2DDB A;  2CQ7 A;  2VJI A;  1FYK A;  5LGU A;  2GLO A;  1IGN A;  5F0C A;  3I4N J;  1ONV A;  4NC6 A;  2EV6 A;  3NAU A;  4BS9 A;  2JUC A;  1MIJ A;  2X9D A;  2CFO A;  2EK5 A;  3GEZ A;  3Q9S A;  4P1W A;  2MW8 A;  4CZC A;  5J47 A;  3ABM H;  3GVA A;  3IV5 A;  1P4A A;  2R7S A;  1FOY A;  1JUM A;  1R1V A;  5HLH A;  4GO1 A;  1AKH A;  1BBY A;  3RI4 A;  4A3D J;  2NXN B;  2LC2 A;  2HDC A;  1UZC A;  1MMG A;  3JRI A;  1K7A A;  4XQF A;  2NVQ J;  2QCO A;  1MH4 A;  2FSW A;  3I71 A;  3H92 A;  2ME6 A;  2VKV A;  2DTZ A;  2Y69 H;  3ZQ7 A;  2ICW G;  2VL8 A;  3Q5F A;  3BTJ A;  1MZB A;  2HYJ A;  3J7Y J;  3ESW B;  2KIU A;  3PUB A;  2DT6 A;  3ZQH A;  4N9I A;  4XM3 A;  3ELK A;  3RZD J;  1RKT A;  3J7A O;  1UST A;  2EV0 A;  1S5L C;  3OMY A;  5DM7 F;  3DFG A;  2QQ8 A;  5J8F A;  3RTR A;  2KRF A;  4NDL A;  3WTV C;  3LSI A;  1XGN A;  4CUG A;  4KN4 X;  1LDK B;  3AKZ A;  2XIG A;  4FE7 A;  3HG9 A;  2ZXJ A;  2FF4 A;  4BAY A;  1C0W A;  1WQ2 A;  3H9J A;  3I64 A;  2EPF A;  1YX3 A;  2F5V A;  4KUM A;  2K27 A;  4RB0 A;  3SDB A;  5EG0 A;  1PUF A;  1ZEL A;  2DFE A;  2WY7 Q;  3FHN A;  4CCO A;  1SD5 A;  3HKZ A;  3IAS 2;  3B6A A;  2BHY A;  2H1L A;  3F22 A;  1AWC A;  2K40 A;  2HR3 A;  2ISZ A;  2ZNY A;  1MBG A;  3I58 A;  4B43 A;  3Q9V A;  2F5E A;  3DV8 A;  4BJ6 C;  1V5G A;  4HX8 A;  4E70 A;  2O8X A;  4I02 A;  1MND A;  1STZ A;  2XF5 A;  4DW6 A;  1QZY A;  5CQG A;  1EJ9 A;  3SEQ A;  4OAY A;  3BJA A;  4XRS G;  1YLF A;  3RYR A;  4D1Q A;  5EZH A;  1P6R A;  2HVQ A;  2DK8 A;  4MTE A;  2V9K A;  3DXJ F;  2K4J A;  3DEE A;  2BV6 A;  2OUM A;  1BR4 A;  2FU4 A;  5EYR A;  3BR2 A;  4HDV A;  4PGH A;  2MLG A;  2V9P A;  4BQQ A;  4M72 A;  5F1J A;  4K2E A;  4OIP F;  2DI3 A;  2QSF X;  3F6O A;  2FUG 2;  1IUY A;  4L5J A;  4HF2 A;  2A61 A;  4A2U A;  1GXQ A;  2LYC A;  5CVJ A;  5ERI A;  3A01 B;  1RR7 A;  3JRA A;  1RET A;  1D1C A;  1GXP A;  4M6Y A;  5DCM B;  3AFH A;  1YJW I;  4ZYD A;  1FP2 A;  2BE5 F;  2GA2 A;  1G3W A;  2LBF A;  2QSG X;  3OYH A;  1Z7U A;  2HGC A;  2MH9 A;  3FXQ A;  1TLH B;  4Q48 A;  4FX4 A;  1VQP I;  4CYC B;  5DTD A;  2RVC A;  1O3T A;  1YW7 A;  1VQO I;  4NUB A;  5FLV A;  2OJE D;  2M45 A;  1QVT A;  4B4C A;  1WCM J;  1HKT A;  4XL9 A;  3IC7 A;  1ZTR A;  4BY1 J;  3CDH A;  2BHZ A;  1CF7 A;  2XF6 A;  1LEB A;  1DPU A;  2ELK A;  5FRM A;  1FPQ A;  1ACI A;  3GTM J;  5M5Y J;  3IL2 A;  1IN4 A;  3TBI A;  5E3O A;  4YEJ A;  5CPR B;  1MBK A;  3MKZ A;  4A3I J;  3S1M J;  2HXO A;  3HRM A;  1XMX A;  1Z7L A;  3CLQ A;  3K69 A;  2Z3Y A;  2OV7 A;  1P7I A;  3KP7 A;  3SZP A;  2KRC A;  4IHY A;  4RGX A;  1WJD A;  1FMV A;  2EFP A;  5HS9 A;  1W36 D;  1J5Y A;  5E8I A;  1JJ8 C;  2DJI A;  4H0E A;  2BW3 A;  4A12 A;  4G7O F;  4UV8 A;  2YX4 A;  4DBQ A;  3RQ4 A;  2STT A;  1LDJ A;  1R23 A;  1UJ8 A;  3EPZ A;  3IH2 A;  2D45 A;  4AIJ A;  4L5I A;  2WAQ N;  3OYL A;  1PDN C;  2P5K A;  2PMZ A;  2ISY A;  2I8D A;  3IRR A;  5IP9 J;  4LG0 A;  1WJC A;  2COM A;  2PJR A;  4MFE A;  2WAE A;  4MQ9 F;  1J9I A;  3KE2 A;  2IS4 A;  1MGT A;  2OAZ A;  2D5V A;  2B7E A;  2CS3 A;  3DKX A;  3TKY A;  3HUG A;  1U5T C;  2QEX I;  1QBJ A;  4MLO A;  3MQ0 A;  2BEO A;  3BR0 A;  5FKN A;  1VI0 A;  2IGM A;  1LUJ B;  3TED A;  4GRI A;  3VYT B;  1PYV A;  1Y6I A;  2L3D A;  2ZKZ A;  2HNH A;  2LH9 A;  2OA4 A;  3BDD A;  4HLY A;  1BI0 A;  4UB6 C;  4LIU A;  3CF2 A;  3H9Q A;  3UR3 C;  2DLL A;  3M7G A;  2VJ5 A;  2GWR A;  2ZSI B;  4ZYH A;  2IRF G;  3BTC A;  1XN7 A;  3RIR A;  4X0G A;  5M5X J;  3JSO A;  3FWE A;  4XSZ F;  1MBF A;  4LB5 A;  4HNU A;  1RR8 C;  2NAZ A;  1FLI A;  3CJT B;  5BMZ A;  1NG7 A;  2HPM A;  2JQ7 A;  3ABU A;  4G7H F;  2KL4 A;  4A0Y A;  2OCE A;  3S17 J;  1QGP A;  3HPH A;  3S16 J;  3LA7 A;  5J1U A;  1ZG5 A;  3WE2 A;  5HS8 A;  4B3X A;  3KX2 A;  1BR1 A;  4XID A;  3LSM A;  3DLA A;  2E71 A;  3EET A;  3K4B A;  3EUK L;  2L4M A;  2PX9 A;  1ODD A;  2X1C A;  1OYY A;  3FMR A;  1XTA A;  1L0O C;  4UUS B;  2JMW A;  2P4W A;  1W5C C;  1ETY A;  5EDN A;  3ONQ A;  2BVL A;  3MEX A;  3H5A A;  2K9Q A;  4S05 A;  1B72 B;  1IRZ A;  4M73 A;  1YYV A;  1X2M A;  3M9A A;  5TRD A;  2JT1 A;  4A3K J;  2K9N A;  2X1E A;  1KQ0 A;  1MJB A;  2LOO A;  4AU7 A;  2ADU A;  4J00 A;  3OL4 A;  2L7Z A;  2NVU B;  5E8G A;  2M4G A;  2HTJ A;  4HPQ A;  3CCL I;  1APL C;  1RES A;  2M5W A;  5HDG A;  3SZG A;  1MMS A;  3L9F A;  2UXX A;  3BPX A;  1U5T A;  4KIG A;  3VSK A;  3KP2 A;  1KU9 A;  1TW3 A;  4XR6 A;  1TQM A;  4FIS A;  5E3L A;  5KAI C;  4PJM A;  4QSH A;  4LD5 A;  3HDD A;  2X85 A;  4ZJZ A;  4JP0 A;  1P7J A;  1EV7 A;  3GTJ J;  3K6G A;  2LY9 A;  4GYG A;  2ZME C;  2ZNZ A;  2F5D A;  1BC7 C;  2M0C A;  4BY7 J;  2V1D A;  1BW5 A;  1FP1 D;  3Q3S A;  1SEU A;  4PFO A;  3M8J A;  3TO7 A;  3GTG J;  3ZQL A;  1WI9 A;  5BQT A;  2P7C B;  2MD0 A;  2Z9O A;  4M6V A;  1LJ9 A;  2CRG A;  4FHT A;  2M87 A;  3AL0 B;  1X1C A;  1B9N A;  2EZL A;  4L9T A;  2E5Z A;  2EA2 A;  1L3L A;  2K02 A;  2HOE A;  3ZQQ A;  5HVQ C;  1ORK A;  2PBI A;  4P55 A;  3L2V A;  2FOW A;  4O3M A;  3PFI A;  4XIC A;  1BA5 A;  1SFU A;  1FY7 A;  3HRU A;  3MZ8 A;  4MGR A;  1OR7 C;  2O6G E;  3QRF F;  4YEL A;  4JK1 X;  3SEZ A;  3OWT A;  5K5Q A;  3TQN A;  4G6D A;  4XRS A;  1X3W B;  3GFL A;  3WOD F;  3FHZ A;  4CXF A;  4XK4 A;  2LR8 A;  2ID6 A;  2Q1Z B;  3QWL A;  5BS6 A;  3L2Q A;  2XSD C;  3ZOB A;  3CQZ J;  4ESF A;  1KU2 A;  3O3K A;  1OCR H;  3SXY A;  2DA4 A;  2CQX A;  2CUZ A;  2X0L A;  5E1X A;  2ACJ A;  2IS6 A;  1BC8 C;  5IYB J;  2R5Z A;  2BZT A;  3HSR A;  1FTZ A;  5J4V A;  1XC5 A;  3HSE A;  2CUE A;  1P4W A;  4BH9 A;  2HOT A;  4W97 A;  3BQY A;  1OPC A;  4A0Z A;  2FEZ A;  3OYF A;  2HYF A;  2ESN A;  2AQE A;  4F55 A;  1O7F A;  2HKO A;  3K7A J;  2IVM A;  5L3F A;  3HGG A;  1K6Y A;  2QKL B;  1K78 A;  1NK2 P;  3ZPL A;  3DEU A;  3ABL H;  1Z05 A;  3NWS A;  3V8J A;  2V1N A;  3GO5 A;  1TWH J;  3HGY A;  1KYZ A;  2R7Z J;  4AUX A;  4IQJ A;  2ZME A;  1S7O A;  2JPB A;  1DP7 P;  4FTH A;  4HAM A;  4OIQ F;  3GTP J;  3RKY A;  4BQA A;  3H5N A;  2RQQ A;  2V6C A;  1JHF A;  5A2Q Z;  3KP5 A;  3LSG A;  2VC1 A;  3DTK A;  5ILV A;  3PNY A;  3JAM Z;  2HQR A;  4LOC A;  4QPQ A;  4J19 A;  2F48 A;  3RJP A;  3ROU A;  2AXL A;  1HCR A;  1R4N B;  2COB A;  3C7J A;  2FXA A;  2Y0S N;  4UUT A;  5EZG A;  1S6L A;  3E7L A;  2DA3 A;  3KLN A;  4PDK A;  4F93 B;  3LA2 A;  3CCQ I;  1MH3 A;  4BEH B;  2F5C A;  3DPT A;  2VAS A;  4L18 B;  2JA8 J;  2EA4 A;  2NVX J;  3FM5 A;  3JRC A;  1WJB A;  1OR7 A;  4I98 B;  1WGX A;  5GAH J;  4PJL A;  5EEA A;  5FFZ A;  4LK0 F;  1E0E A;  1GT0 C;  4XKB A;  4OIO F;  3HOX J;  2QF7 A;  2LMD A;  2K86 A;  1IRF A;  5IPA A;  2W84 A;  3J81 K;  3OYJ A;  3QPL A;  1LVA A;  3R61 A;  1R5I D;  4UUV A;  1QRY A;  2QZ8 A;  2R92 J;  1MBE A;  3PO3 J;  5IP7 J;  3KZZ A;  4AID A;  1X4O A;  3R4K A;  3IH3 A;  4LFU A;  2BY1 A;  2VKH A;  3V7R A;  1QVU A;  3BG3 A;  4RBO A;  4PUS A;  5B1B H;  1MSF C;  1P4X A;  2JUG A;  3L2W A;  3FX3 A;  4BE0 A;  4P96 A;  3P9I A;  2XAS A;  1OYW A;  1XD7 A;  2KZG A;  2DYS H;  3CC7 I;  5E20 A;  3FBN B;  3OY9 A;  4XMY A;  3V4G A;  1VQ6 I;  3WG7 H;  1IDZ A;  2ZSH B;  2CW7 A;  5EF6 A;  3T5X A;  2OPT A;  3G6E I;  4I0A A;  2EZH A;  3ECO A;  4CGZ A;  4AD9 A;  4C3J J;  4R79 A;  3J81 Z;  3S32 A;  3WTX C;  5FO5 A;  2XGE A;  2M7B A;  2W82 A;  4WXH A;  5B66 C;  4ETS A;  1TWA J;  3R0A A;  3J80 K;  1GV5 A;  2L5Q A;  5L3B A;  4AVZ A;  3H9G A;  1W5S A;  4GGG A;  2BBY A;  3F8C A;  5ILS A;  1JKQ C;  1WHU A;  3ML6 A;  3M1C A;  4J01 A;  3JR9 A;  3QP5 A;  2HQA A;  2LP0 A;  1T0F C;  2CQK A;  4LB6 B;  1K4S A;  5M3F J;  4HZF A;  4Y4R A;  3W3C A;  3SDG A;  4F92 B;  3DU6 A;  5F08 A;  5B3S H;  4MHG A;  4E7H A;  3IWF A;  5H6R A;  2E2I J;  2BY2 A;  2FBI A;  3HTS B;  3I3L A;  3FK7 A;  3BG5 A;  1DQU A;  3Q0V A;  1R58 A;  1ZRF A;  2LNB A;  2XF7 A;  3NEU A;  4UY8 I;  1Z3X A;  5IYD J;  3VDX A;  5CJ9 A;  3I4P A;  1YW9 A;  3ISP A;  3BLY A;  5D6F A;  4EAT A;  2VOP A;  4RGU A;  5JVG F;  1O3R A;  2FML A;  4GCV A;  1ZRC A;  4IX7 A;  2O03 A;  3FMS A;  2DYR H;  5KAF C;  4A3C J;  2VT3 A;  4CHU A;  1OCO H;  3GFI A;  4IXA A;  1QO0 D;  2X6Y A;  1SFK A;  3CCU I;  1MNM C;  4V19 K;  2VQG A;  4DGW B;  5LBQ A;  3TMO A;  1GLN A;  4IPA A;  1O57 A;  4PFP A;  2JK3 A;  2M2E A;  4HF1 A;  2VQL A;  3LL7 A;  5EEH A;  4U88 A;  3GX4 X;  4BBR J;  2NNN A;  2GOM A;  2J5P A;  2QKM B;  5E79 C;  2CG4 A;  2XHK A;  5BNG A;  2WBM A;  5FGM A;  5GAD J;  4A3G J;  1FBQ A;  2HDD A;  2B0L A;  1IJW C;  2MLK A;  3LNQ A;  4E7S A;  1OLT A;  1T56 A;  1FSH A;  3KZI C;  3BZ6 A;  2KDZ A;  5FKM A;  3CCM I;  1LE8 B;  3OS1 A;  2JA2 A;  2LDU A;  1IN5 A;  4IRI A;  3L1P A;  3NQO A;  2B63 J;  2KZV A;  3CMY A;  3TP3 A;  5F64 A;  4F3Q A;  2EWN A;  3TOA A;  4LG3 A;  1VZ0 A;  3CCY A;  1SMT A;  5ICC A;  3FZV A;  3WG9 A;  3V7C A;  1XSD A;  5E1Z B;  2MYS A;  4DOZ A;  2O8K A;  5ED4 A;  1W0T A;  3F8M A;  3FXL A;  4ENJ A;  2HVS A;  2W24 A;  4JX5 A;  4XN3 A;  2IBD A;  4XRF A;  2IXS A;  1NTC A;  2L7F P;  3FXJ A;  3ECH A;  2GIV A;  1BJA A;  1RZ4 A;  2HS5 A;  3CC4 I;  1QNT A;  4PK4 A;  1GUU A;  2DMN A;  3SHF A;  5ICG A;  4RAZ A;  2ELJ A;  1YRN B;  5ILU A;  5LEJ A;  3MD2 A;  4XKC A;  2OZU A;  3H3V K;  4C3H J;  1FJL A;  3OV8 A;  2ZJQ F;  5KHD A;  1Z6R A;  3H5R A;  4KIT B;  3A4C A;  3WTU C;  3OIO A;  3TO9 A;  5CVR A;  1Y0U A;  3RPQ A;  4OAZ A;  2AO9 A;  2DBB A;  2QWW A;  2NS8 A;  4A5M A;  3WHB A;  1IF1 A;  4ZTF A;  2B9S A;  1ZAO A;  1B8I B;  1D0Y A;  2OZ6 A;  3R6S A;  2O3F A;  1U8R A;  3BTI A;  2IA0 A;  1NH3 A;  1YS6 A;  5F0H A;  1X1P A;  1A35 A;  1UMQ A;  1T38 A;  3E3V A;  4YIR X;  5M3M J;  3HXL A;  4BYY A;  2XRO A;  2DCE A;  2QBY A;  1VTN C;  2NOG A;  2X4H A;  2HI3 A;  3WU0 A;  2H8R A;  1YG2 A;  1JTX A;  1S72 I;  1MNE A;  3CJQ B;  3ZP5 A;  3HEF A;  1YI2 I;  2DTR A;  2L7M P;  1E3O C;  2VBY A;  1XG1 A;  1YQA A;  1JT6 A;  3LA3 A;  2XAH A;  3B73 A;  3VPR A;  1IXC A;  4PGG A;  3AAF A;  4HLX A;  1TP4 A;  1ZLJ A;  4RM2 A;  4JYK A;  2R7D A;  4H4K C;  1HOM A;  1X4P A;  5IY5 H;  1QU3 A;  3NRV A;  4A3B J;  1FOK A;  1VQ5 I;  3EYI A;  3K2A A;  1X58 A;  1OKR A;  3CO7 C;  3LAJ A;  4WF2 A;  1PJR A;  1R7J A;  2G9W A;  3N4M A;  1LB2 A;  5HDN A;  3K70 C;  3DCF A;  3NWT A;  3J7Z I;  1ZHF A;  1YJN I;  3FIS A;  5L3E A;  3KP4 A;  4FET A;  4V2G A;  1R6R A;  5D5W B;  5L3D A;  1BN5 A;  2MBF A;  3RPU A;  4IQ4 A;  1KQ9 A;  4M3B A;  3FBI B;  4LIV A;  2XV4 S;  4FX0 A;  3KYC B;  5J1R A;  3PSF A;  2EFN A;  1LFP A;  1B59 A;  1I27 A;  1IXS B;  2M30 A;  1J2X A;  1F9N A;  2MG4 A;  4JOM A;  1ZR4 A;  1SD6 A;  1Z77 A;  4HF0 A;  1MMD A;  1QQI A;  3JRF A;  3V7S A;  1AHD P;  2E1N A;  1G2H A;  2E19 A;  3UNG C;  3H0D A;  1JI8 A;  1V4R A;  1UCR A;  5EG0 B;  1PUF B;  2K7L A;  2ZXI A;  3LSH A;  5FRN A;  3S15 J;  3BP8 A;  4IHS A;  4MEX F;  3CZ6 A;  4A3J J;  4C9Y A;  4HRI A;  1R4M B;  4CYD A;  2NNY A;  1PUE E;  4HSR A;  3LMM A;  2A5Y B;  2NS7 A;  4DBR A;  3R0J A;  3CTA A;  3E0J B;  3V42 A;  2WV1 A;  2KMU A;  3DPU A;  1LVK A;  3IKV A;  4RB3 C;  4ENM A;  4LK1 F;  1LFU P;  4IHV A;  5HOO A;  4E4H A;  4Z2Y A;  2E7X A;  3CD6 I;  1UHS A;  1V5F A;  2HU9 A;  3KCC A;  3DQV C;  2V9V A;  2O61 A;  4ZYE A;  1SD7 A;  1KON A;  3UKG A;  2WAF A;  5FRO A;  2EBI A;  1EH7 A;  2JWT A;  4XOR A;  2LY1 A;  1Y56 A;  3G3Z A;  4DYC A;  3E5Q A;  2DMQ A;  3GLX A;  3DBL B;  1HA8 A;  4WCG A;  3SQN A;  1D3Y A;  3U1D A;  2KRH A;  3GZN B;  1BOB A;  2VLA A;  4E7Z A;  4B3A A;  4ZZL A;  3ZQC A;  2R0Q C;  1ZGJ A;  5E18 F;  1G3S A;  3CLO A;  1T95 A;  1XX5 A;  3FXR A;  4UV9 A;  2GXA A;  1QHH D;  4XLA A;  2GAU A;  2JRM A;  4RDU A;  3DBH B;  2IW5 A;  2EH3 A;  3LFK A;  3MZY A;  4G6Q A;  3WTZ A;  3MFK A;  3HOY J;  5K7Z A;  4WXC A;  2KJC A;  5CLS A;  4CA0 A;  2KDO A;  3IAM 2;  1OCZ H;  2XAG A;  4HX4 A;  3HB9 A;  3DKW A;  4HOB A;  3D1N I;  1TTY A;  2LBF B;  3A01 A;  2CV0 A;  2ME0 A;  5DCM A;  2ZO4 A;  4UNO A;  3B02 A;  2GA1 A;  5FJ8 J;  3ZRG A;  3HOS A;  2GXG A;  2DK5 A;  1Y1W J;  4QTR A;  1IN7 A;  3A02 A;  2FJ1 A;  3I59 A;  3JCU C;  4PJ0 C;  3ZQF A;  4BQN A;  4UVB A;  2MC4 A;  2X1D A;  3MWM A;  2E5N A;  3BR6 A;  1CF7 B;  1D1B A;  3M8E A;  2L9S A;  2A6E F;  4XLE A;  3H0G J;  4R1H A;  1EKE A;  3W2W A;  2XAF A;  1RNL A;  2O7O A;  1IXR C;  5LHH A;  1FWZ A;  2F6C A;  5D5V B;  4LLL A;  4N9H A;  4CDG A;  1FMW A;  3FXU A;  2FQ3 A;  4Y15 A;  5K1Y A;  3HYI A;  1VQ9 I;  1JKR C;  4GDF A;  4B1R A;  2BGC A;  3HHH A;  3PQJ A;  2XC7 A;  1SAX A;  4R8H A;  1QPI A;  1MDM A;  1FYM A;  3ERE D;  3KLO A;  1R1U A;  1FIA A;  4EJW A;  2OQR A;  3CF5 F;  4D5C A;  3L2R A;  1RUO A;  4LLN A;  4ZDL A;  3DF8 A;  1ZK8 A;  4CCK A;  3WTY C;  4BAC A;  1D0Z A;  3JRG A;  2FBK A;  1O3S A;  2RQP A;  4A69 C;  2W57 A;  3HHG A;  5LHG A;  4MIM A;  2JA6 J;  4I09 A;  5M5W J;  4YII A;  4DIQ A;  1CGP A;  1HXD A;  3EQL F;  3S1N J;  2PJR B;  3W2A A;  3KFW X;  4EEF G;  3C3W A;  3RSN A;  1FZP B;  4M74 A;  1VQM I;  2LKX A;  1BM9 A;  3T8T A;  3HUG B;  2E2J J;  2DA6 A;  2A6T A;  2JPC A;  2Q2E A;  4AWX B;  4KDP A;  1TZL A;  2DQR A;  3VYU B;  4A0X A;  4DZJ A;  3AG4 H;  2XAQ A;  2XUB A;  4Q4Z F;  1ETW A;  5EJC A;  1YFH A;  4X6A J;  5DYM A;  4EM2 A;  1WRJ A;  4M9Z A;  2P6S A;  3F0C A;  1WZ2 A;  1I3A A;  1T08 B;  3RKQ A;  2VOD A;  4E7K A;  2BY3 A;  4FQG A;  1LFB A;  4AVP A;  2MC3 A;  3U21 A;  3L2U A;  1Q1V A;  3ZMT A;  4AC0 A;  2OQG A;  3JTG A;  2FA5 A;  1QPM A;  5HDK A;  3F21 A;  4II3 A;  4X1E A;  2F4I A;  3NAR A;  2ESH A;  3RQI A;  2VBZ A;  2VE8 A;  3A1Y A;  3S8P A;  3HKZ N;  3REO A;  3CMA I;  1KZH A;  3LAP A;  4C3I J;  2GBY A;  4YFN F;  1YE9 A;  4KJZ A;  3VB2 A;  4HQE A;  2EIM H;  2CV1 A;  3LST A;  1AOY A;  1AU7 A;  1PP8 F;  1RC9 A;  4KIF A;  1R71 A;  4FAS D;  3PSI A;  3IWZ A;  2Y0S A;  3JRH A;  3GYH X;  2QQ9 A;  4BE2 A;  5K7H A;  4EJV A;  3SZT A;  4D9J A;  2JSC A;  3J7A Y;  5JR3 A;  2CW8 A;  2IJL A;  3CCE I;  4KFC A;  4Y13 A;  1BI1 A;  1ETQ A;  2P5V A;  3ASN H;  3OR2 C;  1X3Z B;  2FQ4 A;  1GVJ A;  5BPI A;  1HC8 A;  2BXZ A;  5KK1 A;  1W5T A;  1HW1 A;  1YTY A;  1Z0X A;  2BXY A;  2K5C A;  3C18 A;  3KET A;  3S1R J;  2Z1D A;  2W7N A;  5KNL A;  2GXB A;  1KYW A;  4ANJ A;  4C2U A;  2KJB A;  5BPD A;  1FOX A;  4U0W A;  1U5T B;  4XON A;  3WTS C;  2L0K A;  5FD5 A;  1DGW Y;  4DNC A;  2M4K A;  4RGR A;  2X51 A;  4QWQ A;  3ULQ B;  1GVD A;  2LTP A;  2ZFW A;  3OIP A;  4KIB A;  4Z6Y A;  2M0M A;  1FNN A;  3WGI A;  1D8J A;  3G1L A;  1LDD A;  2STW A;  2RN7 A;  2DFF A;  2HOA A;  2DOA A;  1HSJ A;  3TW6 A;  5C4X J;  1W4M A;  4XLP F;  2VXD A;  2DU9 A;  2WTE A;  1ETV A;  4EGY A;  4S04 A;  3OS2 A;  5FKK A;  2KIS A;  2JVG A;  1W36 C;  3COA C;  4V2F A;  1DGR M;  1UB9 A;  2M8G X;  4BHC A;  4EM1 A;  3KEY A;  1Z6T A;  1A6Q A;  2L4A A;  2IT0 A;  1T6S A;  4A5N A;  2HZD A;  1K79 A;  1U9N A;  2Z16 A;  1AA7 A;  2BVM A;  4Y7N J;  1MJA A;  5JVT A;  2IA2 A;  3FXO A;  1IAW A;  2HOS A;  1Z91 A;  1W1W E;  1XSX A;  2CFX A;  4XKW A;  1YX5 A;  3BOQ A;  3DBR B;  4HYE A;  4BBS J;  4HV5 A;  4M6X A;  4LLG F;  3W6V A;  2CH0 A;  1IRX A;  3E5U A;  4DQ2 A;  4RAF A;  5A2Q K;  2XDV A;  1IN6 A;  2FBH A;  5HS7 A;  3JAM K;  2HTS A;  1ZGA A;  2X6W A;  5C3E J;  1QHG A;  2ETH A;  2A3S A;  2LSO A;  1ZLK A;  3QOD A;  4RMN A;  3VEP A;  3K4J A;  4IF4 A;  2E2H J;  4D7N A;  2PMZ N;  3CDI A;  4XN0 A;  5J40 A;  3B6C A;  4WK8 F;  2R5Z B;  2FNP A;  4HQM A;  5HNH A;  4PJN A;  3WTT C;  3GTQ J;  1IG7 A;  3CDL A;  3O2P E;  5D5U B;  1SAN A;  2L9V A;  2NVY J;  2R7O A;  3JTH A;  4HG2 A;  1MKM A;  2RKH A;  5TJJ A;  3L2C A;  1ERD A;  3X2Q H;  2M1B A;  4OIN F;  3C2B A;  1RKW A;  2DA5 A;  2E35 A;  2VPL A;  3OIQ A;  1JHH A;  3BR3 A;  3KEO A;  5EGO A;  1X1D A;  1D8K A;  2ZME B;  1Z67 A;  2P8T A;  3GBG A;  4E6K G;  3E6M A;  3HBL A;  2RDP A;  4I0B A;  1O3Q A;  3MMY B;  3GCM A;  3OYA A;  1TNS A;  2MH2 A;  5FLM J;  1K6O A;  1H88 C;  2IPQ X;  1G3Y A;  5H20 A;  1B4A A;  1Y8Q B;  5E3N A;  4KNY A;  3TDU C;  1UG0 A;  1ETK A;  5L3G A;  3GLL A;  4NC8 A;  2DOE A;  2K3P A;  3LQQ A;  2QVO A;  2QQA A;  2HKX A;  1N77 A;  2M34 A;  1QZZ A;  3HOU J;  1JUS A;  2ZXW H;  1WH5 A;  1N78 A;  2BYV E;  1W0U A;  2V26 A;  1VF9 A;  3P9C A;  3FXK A;  4C30 A;  5GPA A;  4D5F A;  2M8E A;  4MTD A;  3JRD A;  1UEL B;  3M3Y J;  3D5L A;  3CCR I;  4JX4 A;  2EFQ A;  2H6B A;  4PZJ A;  3LSR A;  4HEA 2;  2Y75 A;  2DPU A;  3P7N A;  4B47 A;  3U9G A;  4BXX J;  4D0P A;  4EQQ A;  2R5Y A;  1WJE A;  2DOD A;  2IA1 A;  2VT2 A;  1S7E A;  4M3D A;  2PEX A;  3DU5 A;  2Y0M A;  1S3J A;  1TBX A;  3GFJ A;  4CCM A;  1K83 J;  1RRJ A;  2DA1 A;  5GP9 A;  2PMH A;  4M9X A;  2XGD A;  3TP0 A;  5LRR A;  1VFC A;  4PSW A;  2Z33 A;  3P5J A;  3EUH C;  3JW4 A;  3RPU D;  3PNV A;  1EH6 A;  3BY6 A;  4JBA A;  4IZZ A;  4L9V A;  1HF0 A;  1DU0 A;  2GIZ A;  3PUF A;  2QEN A;  3H35 A;  1MMA A;  5EEG A;  3I4M J;  1ZAR A;  3Q0U A;  5JHU A;  4DZP A;  4F52 A;  4Y52 J;  4UXN A;  3ZXS A;  1I1G A;  4UHT A;  3KYL A;  1NHA A;  2W1O A;  2X6O A;  5AIQ A;  5F1R A;  2LD5 A;  1MMN A;  1G8X A;  2KFD A;  3WU1 B;  1IO2 A;  1QZE A;  4ZC3 A;  4EMS A;  2RNJ A;  3FK6 A;  1R9T J;  1IRG A;  3OOU A;  1ON2 A;  2XRL A;  3F6V A;  3H1C A;  4LJZ F;  1O4X A;  3CP2 A;  4ASN A;  3OL3 A;  3M07 A;  1S9H A;  1PVE A;  4EVI A;  3QAH A;  2VBW A;  3IHU A;  4LGW A;  2LG4 A;  4FT8 A;  1HLV A;  3HM5 A;  4I76 A;  3ZR8 X;  1YIO A;  3HZJ A;  2VB6 A;  4BHB A;  1PP7 U;  2KQR A;  2IAI A;  2RRE A;  3KP6 A;  3GTO J;  4ZYA A;  2WB1 N;  2M3A A;  1YO5 C;  2VUM J;  2V1X A;  2ZJ2 A;  4O6J A;  4RAG A;  5IOY A;  1P9Q C;  2GQQ A;  1UFM A;  1IV8 A;  2VC0 A;  3CUQ C;  3HRT A;  4U7D A;  3R60 A;  4Y33 A;  2OTL I;  2JRT A;  2M7A A;  4IOC F;  3FM3 A;  3GZ5 A;  4ZZD A;  2WAD A;  1XMK A;  4NQW A;  5B5E C;  2Y9Y A;  1TQP A;  1WI3 A;  3D0S A;  3I55 I;  3OYK A;  3T0Y A;  3PIP F;  3H36 A;  1YIT I;  3K70 D;  3KZY A;  1D5V A;  1BI3 A;  1FIP A;  2L01 A;  3O6B B;  2G7H A;  4KN7 X;  3S2W A;  3OYI A;  4L0Z B;  2PMU A;  1BI2 A;  5JI6 A;  2IP2 A;  1Z1D A;  2ZBK A;  4MO7 A;  3EUH A;  2ZXH A;  2HXI A;  2EFW A;  3A2K A;  2CUF A;  2L9R A;  2VIX A;  3C2G A;  1JGS A;  2PG4 A;  2P5L C;  3EYY A;  2CQQ A;  2LF7 A;  4BJ5 C;  4WWC A;  5JLX A;  4B48 A;  3S2H J;  4ESJ A;  2YPR A;  3H3Z A;  3ZMD A;  4F7Z A;  5H6Q A;  2R7F A;  3OOP A;  3WU2 C;  4P9U A;  3I53 A;  3JRB A;  3OSF A;  5D4S A;  2VPR A;  3KPH A;  4Y17 A;  1WKM A;  1XCV A;  1LEA A;  4G12 A;  3TOB A;  5LFA A;  1HKQ A;  1ULY A;  2QQB A;  1J59 A;  1OYI A;  4A3L J;  1BJZ A;  1WJF A;  3BG7 A;  3S3M A;  3N05 A;  2DJN A;  2GZW A;  3E1S A;  2P6T A;  5JFR A;  4E7I A;  2PN6 A;  2KLO A;  1MSE C;  1VQ8 I;  1ZRD A;  3FIW A;  3FDY A;  4EJT A;  1ZGW A;  2XPU A;  2AXT C;  1W7P A;  3LSJ A;  1LNW A;  5FKL A;  1KGS A;  3K10 A;  1XMA A;  1G59 A;  3AG2 H;  3K4L A;  1X1A A;  4RM3 A;  3WTW C;  2W85 A;  3I5U A;  4L9J A;  2YS9 A;  4G9Y A;  2Y30 A;  3DPL C;  2VOO A;  2YX7 A;  1OCC H;  2K9L A;  3ASO H;  1BIA A;  1QA6 A;  1X2N A;  2A68 F;  2LKS A;  1WJA A;  3HC7 A;  4BL0 B;  4BQO A;  1HQC A;  4CCL A;  4DYR A;  3CUQ A;  1FEX A;  4XLF A;  3F8N A;  3IKT A;  1B6A A;  3LSK A;  2L9N A;  4HW0 A;  1YRN A;  3GUD A;  1UG2 A;  1RIO H;  4HBL A;  1XGM A;  4I6Z A;  1G6N A;  5K5O A;  3FF5 A;  2D1V A;  2IGO A;  2HPI A;  3E5X A;  1HDP A;  3FKI J;  1T8I A;  3PO2 J;  4YIF A;  4KA4 A;  4MNU A;  3RDI A;  4Q47 A;  2A05 A;  2ID3 A;  1POG A;  1A6I A;  4B44 A;  3DTE A;  4G6T B;  3FKJ A;  2UXN A;  2E34 A;  2P81 A;  3BTL A;  2QBY B;  4ZH4 F;  2I10 A;  2H6C A;  2XAU A;  1SFO J;  5JLW A;  2AQF A;  2RC4 A;  1JUP A;  3DTI A;  4JQF A;  4AM3 A;  3L7W A;  3ZMZ A;  1F43 A;  1TQI A;  2LRD A;  4HV6 A;  3G1O A;  1ZG1 A;  5DCF A;  2HEO A;  4W1U A;  2OC6 A;  1TWF J;  1DU6 A;  1AKH B;  2HYG D;  3RKX A;  1Z21 A;  2TCT A;  4BKX A;  4L0Y B;  5BOX A;  3KEQ A;  3ZN1 A;  2XB5 A;  3U2R A;  3OR1 C;  5LGT A;  1JKP C;  4RB2 C;  2VN2 A;  3O8G A;  2HQN A;  1F1Z A;  3QYE A;  5E3M A;  4M3E A;  1VND A;  3S3N A;  1WFX A;  3QP6 A;  5LGN A;  1H0M A;  1A04 A;  2WAQ A;  4GXO A;  4RB1 A;  1OMI A;  2CW0 F;  4BXF A;  2FD5 A;  2EZI A;  2EFO A;  3TW7 A;  2BOL A;  1LKX A;  3K2Z A;  2IS2 A;  5J3L A;  3GZ6 A;  3ZMV A;  3GF2 A;  2Y2Z A;  3TL4 X;  4A93 J;  3CO6 C;  4OIR F;  2QGU A;  5C44 J;  2Q8K A;  1ZG3 A;  3MZH A;  1MBH A;  2DFH A;  1ZYR F;  4IHT A;  1H8A C;  2EZK A;  4I01 A;  3F3X A;  2XGX A;  1OCP A;  3L00 A;  2R93 J;  3BJ6 A;  3TO6 A;  5CYV A;  1JT0 A;  2K9S A;  2CMP A;  1HW2 A;  4FE4 A;  1NK3 P;  2KIM A;  3LOC A;  3K4M A;  1IN8 A;  3BG9 A;  1B1B A;  2CQN A;  4IL6 C;  1FYL A;  2WA0 A;  4M9S A;  2V7F A;  3AG3 H;  2EQR A;  1FBU A;  2CWE A;  1P2F A;  3K0L A;  3CC2 I;  2VQH A;  4CCJ A;  3DEW A;  1DPR A;  3CCJ I;  2QA4 I;  1B9M A;  1S29 A;  4M71 A;  2IEK A;  3BC8 A;  4ZTJ A;  3HRS A;  2DA2 A;  3HOV J;  1JTY A;  2QSH X;  3K1M A;  2K9M A;  2E7W A;  3HTU A;  2CYY A;  4G8X A;  1VQ7 I;  3M4O J;  2DW4 A;  2PFB A;  3VYR B;  3IH4 A;  5HLG A;  2V79 A;  3F9K A;  4I99 C;  3KIO A;  1X3U A;  1OIS A;  2JN6 A;  3I9V 2;  2LY2 A;  4A3E J;  1KU7 A;  4D7M A;  4HX7 A;  2XRN A;  3MKY B;  3T1B A;  1D5Y A;  5CQE A;  2D2W A;  3MN2 A;  3KP3 A;  1G3T A;  4UB8 C;  3HOT A;  1ETO A;  1U3E M;  2Y9Z A;  2QYO A;  1T33 A;  4KIS A;  3CJR B;  2H1K A;  2WV0 A;  2P7V B;  4IJA A;  5DD8 A;  3BRO A;  3SFI A;  2NYX A;  4AIH A;  2O5R A;  5GPC A;  1H9T A;  4AYB N;  1BIB A;  1O7L A;  4LMY A;  4RS8 A;  1U0J A;  3CJN A;  2IS1 A;  2KPM A;  2ZB9 A;  5GTH C;  3GFM A;  3MCZ A;  1M1E B;  2LF8 A;  4NB5 A;  3N97 A;  3EDP A;  3BR1 A;  5J8C A;  4IO9 F;  1Y39 A;  1JJ6 C;  3E6D A;  2XPV A;  4KT6 A;  2ZJR F;  2VON A;  3BT9 A;  2E36 A;  3GME A;  1J0R A;  4CYC A;  5GAG J;  1CQT A;  4IHW A;  2YR2 A;  3F8F A;  3I59 B;  5HOD A;  5AIP A;  4HA8 A;  5DUK A;  2JA5 J;  5TIS C;  4OMZ A;  4GFB A;  4A6D A;  4N4N B;  1FSE A;  2W4S A;  3QOP A;  1I5Z A;  3FXM A;  4ENN A;  3CP8 A;  2YU9 J;  1A5J A;  5IT9 Z;  2E1M C;  2EIN H;  1ON1 A;  3BCA A;  1A36 A;  1I1S A;  4U87 A;  1SVO A;  4XSX F;  1VQ4 I;  4IKF A;  5IOZ A;  2NOJ B;  1K61 A;  1KA8 A;  5CVV A;  3S2D J;  2E1O A;  3Q0W A;  1R00 A;  3DWL E;  5F6F A;  2R7T A;  2BW3 B;  3PL8 A;  2CO5 A;  4GYI A;  1E3P A;  4PCQ A;  1USS A;  4HNV A;  1SD4 A;  1UHW A;  1MW7 A;  2EJR A;  1MDM B;  4CCN A;  3CMM A;  4BGD A;  5DDG A;  2XB0 X;  2O0Y A;  2VXZ A;  1IDY A;  2FNA A;  4HDU A;  2PLY A;  2G0E A;  2ZFU A;  2FRH A;  3CUO A;  3DP7 A;  4KT5 C;  4ON0 A;  1T39 A;  2K3F A;  1ENH A;  4YFX F;  3BJO A;  4LG0 B;  5FLX K;  4CIC A;  4UVC A;  4IRG A;  2ZCW A;  2PI0 A;  4OWR B;  2RV8 A;  3QU3 A;  4XOT A;  2ECC A;  5D6E A;  1WSU A;  1IC8 A;  1SMY F;  1X1B A;  1JGG A;  2HQ5 A;  4I7H A;  4OMY A;  1V54 H;  2R7R A;  4BDZ A;  3VSL A;  1GDT A;  2Q2E B;  3MAJ A;  2L54 A;  2VBX A;  3S3O A;  2WC2 A;  2UWM A;  2CGP A;  3F72 A;  3VFZ A;  2FX0 A;  1ZKG A;  2CJJ A;  2L2O A;  3D5R C;  2JJ7 A;  5E1W A;  1SC7 A;  1JKO C;  2HVR A;  1IW7 F;  1WH7 A;  4XRM A;  2DN0 A;  3MVP A;  5F27 A;  4BXU A;  1T2K A;  2Z2S B;  2GM4 A;  2N8G A;  3LQR A;  1I39 A;  5AON A;  3TGN A;  4Q5S F;  3HIF A;  2A6H F;  2DXI A;  3L09 A;  5IT9 K;  1D0X A;  2UZK A;  5FLX Z;  3OYG A;  1R5G A;  2OCC H;  1HW5 A;  2KIF A;  4B09 A;  3HL2 A;  1VQN I;  3CME I;  1K4T A;  2ELH A;  2NVT J;  1EF4 A;  9ANT A;  3M1E A;  1LPQ A;  5ICF A;  3ABK H;  4IOA F;  1JXS A;  4XBF A;  3FMQ A;  3AL0 C;  2P0W A;  5B1A H;  3S93 A;  4YG2 F;  2F2E A;  1U2W A;  1V55 H;  1R49 A;  2H8W A;  3KYD B;  4O5V A;  2E1M B;  1EH8 A;  1N25 A;  4RAY A;  4WX9 A;  5D8L B;  1TT5 B;  4RGS A;  1HBX G;  2HWV A;  3P9K A;  4QIW N;  4UUS A;  4TV7 A;  3IP4 B;  4ZDP A;  4KIC A;  1HST A;  2AHQ A;  2XPW A;  5DS9 A;  4I2O A;  5IT3 A;  1B72 A;  2JTV A;  3BG6 A;  1DDN A;  4IEJ A;  3SFZ A;  4NNJ A;  3OYB A;  4IRH A;  4MQV A;  1KU3 A;  4E7L A;  2F4O B;  1YOV B;  4XLC A;  4N4O B;  4KMU X;  5K5R A;  1FC3 A;  2ECB A; 
#chains in the Genus database with same CATH homology
 1S7E A;  4M3D A;  3H3V K;  4C3H J;  1FJL A;  1TWC J;  3A01 B;  3OIO A;  1RR7 A;  2M9H A;  1RET A;  1K83 J;  3JRA A;  2DA1 A;  5GP9 A;  3ZQG A;  2AO9 A;  2XGD A;  3TP0 A;  2NS8 A;  3WHB A;  1VFC A;  1B8I B;  2KT0 A;  3BTI A;  1HF0 A;  1DU0 A;  1RPW A;  4M3F A;  5F0H A;  1UMQ A;  4CYC B;  5DTD A;  1ITY A;  5M3M J;  1U9O A;  3I4M J;  2OF7 A;  3Q0U A;  5FLV A;  2NOG A;  2HI3 A;  1QVT A;  4B4C A;  4DZP A;  1WCM J;  2H8R A;  4Y52 J;  1JTX A;  1ZTR A;  4BY1 J;  3HEF A;  2Y31 A;  2X6O A;  2ELK A;  2LD5 A;  2L7M P;  3GTM J;  1E3O C;  1ZQ3 P;  1XG1 A;  5M5Y J;  2DMT A;  1JT6 A;  5E3O A;  3VPR A;  3FK6 A;  1R9T J;  1MBK A;  3OOU A;  4JYK A;  2HXO A;  4A3I J;  3S1M J;  1HOM A;  2XRL A;  1O4X A;  5IP6 A;  5J1Y A;  2O9L A;  2VI6 A;  4A3B J;  1P7I A;  1U78 A;  5C4J J;  4IHY A;  3K2A A;  1X58 A;  3HOZ J;  1HLV A;  3HM5 A;  4I76 A;  1JJ8 C;  1IUF A;  5K7F A;  1ETX A;  5F04 A;  3DCF A;  3FIS A;  2IAI A;  5F0F A;  4V2G A;  3GTO J;  1OJL A;  2WB1 N;  3IH2 A;  2VUM J;  2WAQ N;  5IOY A;  2MSY A;  3MKL A;  4M3B A;  5IP9 J;  4MFE A;  2Y9Y A;  5J1R A;  2D5V A;  1WI3 A;  2TRT A;  1ZR4 A;  2MG4 A;  4MLO A;  1Z77 A;  1FIP A;  3BR0 A;  5FKN A;  3BQZ A;  1VI0 A;  1IV6 A;  3TED A;  3JRF A;  1AHD P;  1G2H A;  2E19 A;  4MO7 A;  2HXI A;  2CUF A;  2L9R A;  5EG0 B;  1PUF B;  3A03 A;  3S15 J;  2LFB A;  2CQQ A;  4A3J J;  5JLX A;  3SJM A;  5EGO B;  3S2H J;  3BTC A;  5M5X J;  1GV2 A;  1MBF A;  2NS7 A;  3JRB A;  3OSF A;  2WV1 A;  2VPR A;  4G12 A;  3S17 J;  1LFU P;  4A3L J;  4IHV A;  3S16 J;  1BJZ A;  1UHS A;  4M3G A;  2DJN A;  5J1U A;  3UKG A;  4XID A;  2XGC A;  1BL0 A;  3G1M A;  1Y1V J;  2EBI A;  3WHC A;  1MSE C;  2JWT A;  3FIW A;  5FKO A;  1ZGW A;  4UUS B;  3JRE A;  2XPU A;  2JMW A;  1MBJ A;  3LSJ A;  5FKL A;  5EDN A;  1ETY A;  4DYC A;  2DMQ A;  2K9Q A;  1B72 B;  2W48 A;  3HOW J;  2YS9 A;  2Y30 A;  1IRZ A;  3ZQC A;  4B3A A;  1X2M A;  2R0Q C;  2R5Y B;  1X2N A;  4A3K J;  2K9N A;  4DYR A;  4RDU A;  1FEX A;  1H89 C;  2L7Z A;  2EH3 A;  3HOY J;  5K7Z A;  1YRN A;  1UG2 A;  1APL C;  3GTL J;  3O8H A;  1RES A;  4I6Z A;  3HB9 A;  3D1N I;  1HDD C;  3A01 A;  3FKI J;  3PO2 J;  1HDP A;  2ME0 A;  2DMP A;  3QPS A;  4FIS A;  5E3L A;  3HDD A;  3ZQI A;  4QSH A;  2ID3 A;  5FJ8 J;  1POG A;  1A6I A;  4JP0 A;  1Y1W J;  4MFD A;  4QTR A;  2P81 A;  3A02 A;  2FJ1 A;  3BTL A;  1P7J A;  2I10 A;  4L5E A;  3ZQF A;  1FTT A;  3GTJ J;  3GTK J;  2LY9 A;  1SFO J;  3BR6 A;  5JLW A;  2M0C A;  4BY7 J;  1JUP A;  1BW5 A;  3Q3S A;  4JX6 A;  1F43 A;  3H0G J;  3G1O A;  3GTG J;  2O7O A;  3ZQL A;  4W1U A;  1TWF J;  1DU6 A;  1AKH B;  4M6V A;  2CRG A;  4BKX A;  2TCT A;  1JKR C;  2XB5 A;  3OSG A;  2EZL A;  4B1R A;  1JKP C;  1ORK A;  3O8G A;  5E3M A;  1QPI A;  4M3E A;  1VND A;  1I3Q J;  4XIC A;  1BA5 A;  1FIA A;  1U8B A;  4D5C A;  5IYC J;  3PM1 A;  1ZK8 A;  2FD5 A;  2EZI A;  3TW7 A;  1OCT C;  3JRG A;  1WPK A;  5J3L A;  4XRS A;  4A69 C;  2Y2Z A;  4MIM A;  4A93 J;  2JA6 J;  5C44 J;  5M5W J;  4XK4 A;  2LR8 A;  2ID6 A;  3S1N J;  2XSD C;  3ZOB A;  1MBH A;  3CQZ J;  4DYQ A;  4EEF G;  1H8A C;  2EZK A;  2DA4 A;  2CQX A;  1OCP A;  2LKX A;  2E2J J;  2R93 J;  2DA6 A;  3LSP A;  5IYB J;  1JT0 A;  2K9S A;  2R5Z A;  1FTZ A;  4FE4 A;  1NK3 P;  2DA7 A;  3LOC A;  2DMU A;  4DZJ A;  1XC5 A;  3BG9 A;  2CUE A;  2HOT A;  1ETW A;  4W97 A;  3BQY A;  2EQR A;  4X6A J;  3F0C A;  3K7A J;  3BR5 A;  3DEW A;  3S14 J;  3RKQ A;  3HGG A;  4C2M J;  1NK2 P;  1LFB A;  2VKE A;  2IEK A;  1Q1V A;  4AC0 A;  1TWH J;  3HGY A;  2R7Z J;  2DA2 A;  4AUX A;  3HOV J;  4X1E A;  1JTY A;  3NAR A;  3M4O J;  3RQI A;  4A3F J;  4FTH A;  3GTP J;  3HKZ N;  1OFC X;  2CU7 A;  4C3I J;  3IH4 A;  2LLK A;  3LSG A;  2GBY A;  1LE8 A;  2RAE A;  2JN6 A;  1AU7 A;  1BW6 A;  4LOC A;  4A3E J;  2MGQ A;  4J19 A;  4IHX A;  4ABZ A;  4D7M A;  1HCR A;  2COB A;  1D5Y A;  3JRH A;  2Y0S N;  4UUT A;  3MN2 A;  5EZG A;  1ZR2 A;  3QQA A;  5K7H A;  4FCY A;  2LK2 A;  3E7L A;  2DA3 A;  4S0H B;  1ETO A;  1TWG J;  2Y9Z A;  1XS9 A;  1T33 A;  3S1Q J;  1MH3 A;  2H1K A;  2JA8 J;  1ETQ A;  2NVX J;  3JRC A;  1WGX A;  3SFI A;  5GPC A;  5EEA A;  1I6H J;  1GT0 C;  2FQ4 A;  4AYB N;  3HOX J;  2QF7 A;  3RZO J;  5IPA A;  2LVS A;  3QPL A;  1Z0X A;  2JA7 J;  2R92 J;  1QRY A;  3S1R J;  1MBE A;  3PO3 J;  5IP7 J;  2ZB9 A;  4A3M J;  3IH3 A;  2YUS A;  1QVU A;  3BG3 A;  1B8I A;  1I50 J;  4RBO A;  2L0K A;  1MSF C;  3BR1 A;  1F36 A;  1JJ6 C;  1GVD A;  2XPV A;  2LTP A;  1TC3 C;  2X48 A;  3BT9 A;  4CYC A;  1CQT A;  4IHW A;  5HOD A;  3G1L A;  2JA5 J;  2HOA A;  4GFB A;  3TW6 A;  1IDZ A;  2GLO A;  1IGN A;  5F0C A;  5EF6 A;  5C4X J;  3I4N J;  2OPT A;  2YU9 J;  1ETV A;  3NAU A;  2EZH A;  1A5J A;  5FKK A;  2X9D A;  4V2F A;  2M8G X;  4C3J J;  2MW8 A;  2XGE A;  5IOZ A;  1TWA J;  1K61 A;  1GV5 A;  3S2D J;  2E1O A;  3Q0W A;  3IV5 A;  1JUM A;  1U9N A;  4HNV A;  1JKQ C;  1AKH A;  4A3D J;  4Y7N J;  3JRI A;  3JR9 A;  2NVQ J;  2HOS A;  2QCO A;  2LP0 A;  1MH4 A;  2XB0 X;  5M3F J;  2ME6 A;  1IDY A;  3SDG A;  4BBS J;  2VKV A;  2DTZ A;  2G0E A;  5F08 A;  3W6V A;  1ENH A;  3BTJ A;  2HYJ A;  2E2I J;  5C3E J;  3ZQH A;  1IC8 A;  2ECC A;  3FK7 A;  3RZD J;  3BG5 A;  3Q0V A;  1RKT A;  2HQ5 A;  1JGG A;  5IYD J;  2E2H J;  4D7N A;  2PMZ N;  1GDT A;  3B6C A;  2R5Z B;  3GTQ J;  1IG7 A;  4NDL A;  3CDL A;  2FX0 A;  4A3C J;  1SAN A;  1ZKG A;  2NVY J;  2CJJ A;  2JJ7 A;  1MNM C;  4FE7 A;  1JKO C;  3C2B A;  2JK3 A;  1WH7 A;  2M2E A;  4XRM A;  1RKW A;  2DN0 A;  3MVP A;  5EG0 A;  1PUF A;  2DA5 A;  5F27 A;  4BBR J;  2GM4 A;  2N8G A;  3BR3 A;  5BNG A;  5EGO A;  3B6A A;  4A3G J;  2HDD A;  1IJW C;  3GBG A;  2K40 A;  3LNQ A;  1MBG A;  3HBL A;  1T56 A;  2KDZ A;  5FKM A;  2NVT J;  1LE8 B;  1EF4 A;  9ANT A;  5FLM J;  1H88 C;  3L1P A;  5E3N A;  2B63 J;  3CMY A;  1ETK A;  3TP3 A;  4DW6 A;  3CCY A;  4XRS G;  2M34 A;  3HOU J;  1JUS A;  1WH5 A;  2O8K A;  5EZH A;  4QIW N;  1W0T A;  1W0U A;  1VF9 A;  4UUS A;  4JX5 A;  5GPA A;  4D5F A;  2IBD A;  2AHQ A;  1NTC A;  2L7F P;  2XPW A;  5DS9 A;  5EYR A;  3BR2 A;  3JRD A;  1B72 A;  3M3Y J;  4JX4 A;  4IEJ A;  3LSR A;  1GUU A;  2DMN A;  5F1J A;  4BXX J;  1YRN B;  2R5Y A;  2ECB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...