3I4MJ

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3i4mJ00
3HKZN 3A01B 5FKOA 1CQTA 3UKGA 5E3OA 5E3NA 1MBKA 2JJ7A 3BR1A 3BTIA 2Y9ZA 3Q0UA 2IEKA 5IPAA 3DCFA 3RQIA 3RKQA 1H88C 2E2JJ 3HOUJ 1OCPA 2EZKA 2YU9J 3LSGA 2ECBA 2L0KA 4IHWA 4FE4A 1B8IB 1JT6A 1Y1VJ 3JRFA 4IEJA 1TWHJ 5E3LA 1ETQA 3ZQIA 5FKMA 1B72B 2KDZA 1LE8A 3FK6A 3JR9A 2DTZA 1XS9A 3HBLA 1MSEC 2LR8A 2VPRA 3JRHA 2X9DA 2XGCA 1GUUA 5IYBJ 1RKWA 3JRCA 4XRSA 2LVSA 3A03A 1O4XA 2HOSA 3GTMJ 4A3BJ 1FIAA 2MSYA 2RAEA 3BTLA 1YRNA 3S15J 3LSPA 2VKEA 1JJ8C 4D5CA 1U9OA 2CQXA 1P7IA 1QPIA 1X2MA 1JJ6C 2YUSA 3S2HJ 4BXXJ 4M3DA 4C3IJ 3PM1A 3G1LA 3BG5A 1K83J 1AU7A 3HOVJ 2WB1N 1F36A 2DA2A 1JUMA 1WPKA 2LFBA 2YS9A 3JREA 3S14J 3BQZA 4IHXA 1EF4A 3PO2J 2GBYA 4X6AJ 5FLVA 2LY9A 2VKVA 2XGEA 3GTJJ 4Y7NJ 1HF0A 1PUFA 2VUMJ 1NTCA 3G1MA 2E19A 1ETXA 5GPAA 1ETWA 2OPTA 3OSFA 2HOTA 3M3YJ 1JKQC 2XRLA 4CYCA 2M34A 3HOXJ 3RZDJ 3K2AA 3SDGA 2Y0SN 2DMUA 2JN6A 1PUFB 2KT0A 4DW6A 2JA8J 2HQ5A 5EGOA 1WGXA 1Z0XA 2NOGA 5M3FJ 1H8AC 3JRBA 1TC3C 1D5YA 5J1YA 3HDDA 4B4CA 2IBDA 3QPLA 4M3GA 1FTTA 1XC5A 1QVTA 3FKIJ 5EZHA 1P7JA 1RR7A 2ID3A 1JT0A 1NK3P 2LD5A 4V2GA 3RZOJ 4B3AA 4D7NA 5BNGA 3TEDA 1T56A 2ECCA 3TP0A 2R5ZB 4A3MJ 2JA6J 1ORKA 2L7ZA 4BBRJ 1R9TJ 4IHVA 2Y30A 1FTZA 2ELKA 5F08A 2H1KA 4DYRA 2R5YA 4BY1J 2L7FP 1W0UA 9ANTA 3HOZJ 4DZPA 1I3QJ 1Z77A 3L1PA 1RKTA 5J1RA 2HOAA 3BG9A 1TWAJ 2R5YB 1I50J 1BJZA 2G0EA 1W0TA 1OCTC 4MFDA 3F0CA 2FX0A 5EZGA 4A3JJ 4J19A 2P81A 2XSDC 1ETYA 3HGGA 5IYDJ 2M8GX 1B8IA 2K9QA 1IDZA 3O8HA 1B72A 1GDTA 4AYBN 1APLC 1H89C 2R0QC 2DMQA 1MBFA 3B6CA 1JUSA 1JTXA 1IGNA 2GM4A 5F0HA 4QTRA 1IJWC 1IG7A 1VI0A 4A3KJ 5EG0B 4M3BA 1GV5A 2H8RA 3MVPA 5J3LA 4RBOA 1AKHB 3HOWJ 3S1NJ 1ZKGA 1DU0A 2I10A 4MO7A 1VNDA 1T33A 2N8GA 5FKNA 3H3VK 1MBGA 1AHDP 1JKRC 1FJLA 3W6VA 5EF6A 1VFCA 3G1OA 4A3LJ 1F43A 4MFEA 2DA3A 4X1EA 4A69C 5FJ8J 5C4XJ 2CJJA 1QRYA 1G2HA 2LLKA 3IH3A 2TRTA 1JKOC 2DA5A 2NS7A 2D5VA 1MBJA 4A3EJ 3E7LA 3LNQA 4XK4A 2E2IJ 2AHQA 1HOMA 1DU6A 2CU7A 4D7MA 1WCMJ 2WV1A 4DYCA 2AO9A 4M3FA 2HYJA 4G12A 2L9RA 2MGQA 2O7OA 4M3EA 3GTLJ 5JLWA 2GLOA 4D5FA 1ZR4A 2DN0A 2COBA 4W97A 3VPRA 4RDUA 3MN2A 2EQRA 3HGYA 1JKPC 2LKXA 5GPCA 4BBSJ 2NVTJ 3HB9A 5C3EJ 2O9LA 4XICA 1HDDC 2L7MP 1ITYA 1BW5A 3SFIA 4A3FJ 3BQYA 2Y2ZA 4AC0A 5IP9J 5M5WJ 2R93J 3IV5A 1QVUA 4JX5A 2MG4A 3JRGA 3WHCA 2R5ZA 3BR3A 1TWFJ 5IP7J 2NVYJ 2JA7J 2CQQA 3C2BA 3CQZJ 4XRSG 1E3OC 4C2MJ 1A6IA 1K61A 3BTCA 2CUFA 3NAUA 3M4OJ 3JRAA 1ZQ3P 4FISA 5GP9A 1LFBA 4QSHA 5DS9A 1UMQA 3Q0WA 4FE7A 4A93J 3JRIA 5HODA 2FQ4A 2IAIA 5F1JA 3GBGA 1MBHA 5E3MA 4A3CJ 1XG1A 3JRDA 2O8KA 2PMZN 1WH7A 1X58A 2VI6A 3DEWA 3LOCA 4JP0A 5FLMJ 2DA4A 1LFUP 3ZQFA 2DMNA 2XGDA 3TW7A 2K9NA 3I4NJ 3HM5A 5M5YJ 3CMYA 4A3IJ 1JUPA 3D1NI 2M0CA 5EDNA 1I6HJ 1A5JA 5EG0A 2OF7A 3H0GJ 3ZQHA 1X2NA 4AUXA 1U9NA 3S1QJ 1ETOA 1AKHA 2DA7A 1OFCX 3OIOA 5F27A 1SANA 2R7ZJ 3GTQJ 2DMTA 3ZQGA 2XPVA 1YRNB 3PO3J 3Q3SA 2HXOA 2E2HJ 4XRMA 2K9SA 3ZQLA 3FISA 1TWGJ 1WH5A 1OJLA 2LTPA 3S1MJ 3ZQCA 2JK3A 4BY7J 1S7EA 1IDYA 3SJMA 4MLOA 4DYQA 4MIMA 4JYKA 4Y52J 2NVQJ 1ENHA 3S2DJ 1JGGA 5IOYA 1LE8B 4UUSA 3TP3A 2EZIA 4NDLA 2HDDA 3S16J 2B63J 3B6AA 2JMWA 3OOUA 1FIPA 3GTOJ 4I6ZA 2XPUA 2ID6A 1Q1VA 3BTJA 2DA6A 4IHYA 1FEXA 3CDLA 4JX4A 2ZB9A 5J1UA 5JLXA 3BT9A 3NARA 1MNMC 2DMPA 1MH4A 2M2EA 5M3MJ 4UUSB 1ZTRA 5IP6A 1IV6A 3O8GA 4XIDA 3LSJA 5DTDA 4FCYA 2EZLA 4M6VA 5C44J 4W1UA 5EEAA 5K7HA 3QQAA 2K40A 1ZR2A 1JTYA 3A02A 3IH4A 4B1RA 1VF9A 1HCRA 1ETKA 1POGA 3GTPJ 4BKXA 2HI3A 4V2FA 3Q0VA 5K7ZA 1RETA 5EYRA 3BR6A 1ETVA 4FTHA 1RPWA 4GFBA 2W48A 2Y31A 1BL0A 1ZGWA 2CUEA 3BR0A 1MSFC 3S1RJ 2TCTA 1BA5A 1UHSA 1HLVA 2XB5A 3I4MJ 1ZK8A 1WI3A 4C3JJ 1GV2A 2CRGA 2LK2A 1NK2P 4LOCA 4CYCB 2M9HA 2ME6A 4L5EA 3WHBA 1MBEA 1Y1WJ 1GVDA 2ME0A 2X48A 2FD5A 3CCYA 1U8BA 2XB0X 3QPSA 3K7AJ 1IRZA 3S17J 5EGOB 2E1OA 1U78A 3TW6A 3GTGJ 4A3DJ 2DA1A 2Y9YA 2QCOA 5IYCJ 2EH3A 2MW8A 5M5XJ 1UG2A 1RESA 4JX6A 1IUFA 1TWCJ 5IOZA 5FKLA 2LP0A 2NVXJ 4UUTA 3BR2A 3HEFA 4DZJA 2DJNA 4S0HB 2WAQN 5F04A 4I76A 3ZOBA 2R92J 3IH2A 2X6OA 1SFOJ 5K7FA 4A3GJ 5F0FA 1HDPA 3MKLA 2JA5J 2FJ1A 5F0CA 4QIWN 2QF7A 2EBIA 3FIWA 2JWTA 1GT0C 4C3HJ 3OSGA 1BW6A 3A01A 5C4JJ 2EZHA 4EEFG 2NS8A 5FKKA 4HNVA 3FK7A 1MH3A 3BG3A 3BR5A 3LSRA 1IC8A 3GTKJ 3HOYJ 2XPWA 4ABZA 2HXIA
chains in the Genus database with same CATH superfamily
3V4GA 3VSKA 3A01B 3WGHA 5FKOA 1YTYA 5J6XA 1MBKA 3S2WA 1PUEE 3BR1A 3JTGA 3Q0UA 2V26A 3QODA 3KP7A 3RQIA 1H88C 2E2JJ 4PJMA 2MC4A 4BHCA 2DQLA 2HZDA 2DO7A 2NYXA 2VC1A 2VT3A 4G7HF 1JT6A 2ELJA 3ASNH 3ZMSA 1TWHJ 4U0VA 3TBIA 5FKMA 2ZXJA 3K2ZA 3DEEA 1MMAA 4KA4A 2NNYA 3TDZC 1LE8A 2CH0A 3JR9A 2HEOA 3CC4I 4MGRA 3HBLA 2CV0A 2KMUA 4AD9A 3JRHA 3OR1C 3IKVA 3P9KA 2VJ5A 1F5TA 3K4BA 3JRCA 4XRSA 2LVSA 3A03A 2FOKA 5H6QA 5F6FA 2CFOA 2R7VA 3PSFA 4EGYA 5E18F 1SAXA 2DQRA 3KIOA 2DOEA 1SMYF 2QSFX 1D1CA 2LREA 1HKSA 4D5CA 1P7IA 3DLLF 2HZTA 1XSVA 3TOAA 4D0PA 2EK5A 4ENKA 5F64A 2EFWA 3PM1A 2VKDA 2R7TA 1IRFA 2KRHA 2X6YA 5CVVA 1F36A 1Y0NA 2DA2A 2JTVA 3BJAA 3T8RA 2UWMA 3J7ZI 2QENA 4CCKA 4DBRA 2DDAA 3P9IA 1R7JA 2A6EF 4XLNF 4M72A 2QBYA 3S8PA 5FLVA 3EUHC 3CMMA 1BIAA 1UELB 2QGUA 4XONA 4PK4A 3GTJJ 3PL8A 1HF0A 1GHCA 2CO5A 3G1MA 1GXPA 3WTXC 2HOTA 3M3YJ 3ERMA 2RNGA 5CVIA 3HOXJ 3SHFA 4WF2A 1I1SA 4QPQA 3IHUA 2QYOA 2RREA 2JN6A 5JI6A 4DW6A 2JA8J 4BJTA 3BP8A 4BDYA 1HKQA 1Z0XA 2A6HF 2NOGA 2VJ4A 1OR7A 1H8AC 2M7BA 2ZFUA 1MKMA 2HR3A 3HOTA 1MDMA 1D5YA 2R7QA 4B4CA 5E8GA 1FTTA 1O3QA 2W85A 1QVTA 2H6BA 1P7JA 1UZCA 3I58A 4M74A 3OYAA 2W25A 4HX7A 4NQWA 1TL8A 1S3JA 3M7GA 2LD5A 4B3AA 1KU3A 2FSWA 3HG9A 5BNGA 3J7AY 4IF4A 2X1DA 4U0YA 4A3MJ 1JHHA 2L7ZA 2XKOA 3F8BA 2J5OA 1R9TJ 2Y30A 4IHVA 1FTZA 1KU7A 3H5RA 1KQ9A 3DF8A 4CCMA 2IA2A 1H9GA 5H20A 4ZDPA 3ZQQA 1H0MA 1Z77A 2CG4A 5CVUA 3L2VA 3BG9A 1RRJA 3K0LA 3BY6A 4E4HA 4OINF 2IS6A 4WCGA 3RDIA 3VFZA 1C0WA 1W0TA 1WJFA 3QPTA 5LGUA 3F8MA 3QPHA 4O3MA 4A3JJ 4LIVA 5J8CA 4J19A 3DPLC 4UV9A 2E36A 2XAJA 5B1BH 5K5RA 3CDIA 1VTNC 2GIVA 3BJ6A 3KEYA 4E7HA 3CCLI 2E71A 4KJZA 3K4CA 4WK8F 1IDZA 3KX2A 2IA1A 1ZAOA 1B72A 4A5MA 1CGPA 2ESHA 3BZKA 1APLC 5JFRA 1H89C 3FF5A 1SC7A 2DMQA 1MBFA 1QHGA 2PJRB 4AWXB 1JUSA 4XLPF 2JUCA 5IT3A 1IGNA 2BEOA 2OD5A 3CUQA 4QTRA 4EGZA 4GCVA 2HVQA 3HXLA 1V5EA 1GV5A 1ZREA 2H8RA 5J3LA 5BOXA 4RBOA 2IT0A 1LVKA 3BG7A 2JVHA 4AIDA 1AKHB 3S1NJ 4PCQA 3E6DA 4BQQA 4IHTA 1QZEA 3OYLA 1ULYA 2M1BA 2O61A 1U6GA 1VNDA 1T38A 1AHDP 1W5CC 3OYJA 4J01A 1JKRC 4G94A 1VFCA 4MFEA 4DQ2A 1SFEA 1P4AA 1EJ9A 4PFOA 2CSOA 1Z91A 1JHFA 2LLKA 4WXCA 1S72I 1BI1A 1MBJA 2BY2A 3GFMA 4BXUA 3PFIA 1D0YA 3RKWA 3LNQA 1YJWI 1O57A 2E2IJ 1SMTA 2AHQA 5DYMA 1DU6A 1K78A 2CU7A 4LFUA 1WCMJ 5HOOA 1B6AA 1XCVA 4OIQF 2HYJA 2P5LC 3GTLJ 2WADA 4D1QA 5IT9K 4LK1F 1ZR4A 2JUGA 2COBA 3F6VA 4LJZF 4HNTA 2BVLA 3CCMI 2JZYA 3CCRI 2EFQA 3H9JA 3P9CA 4BBSJ 2HPIA 3K69A 4I99C 1HDDC 3B02A 3KEQA 4HNUA 4R79A 4HYEA 3BQYA 4N9IA 2Y2ZA 5IP9J 3Q5FA 4G9YA 1QVUA 2Q1ZB 4JBAA 2DOFA 5ILUA 3ERED 2X85A 1F1ZA 2M45A 1Z05A 1D5VA 1TWFJ 4A6DA 5IP7J 3BZ6A 2NVYJ 2XF6A 3Q9SA 3U1KA 4KMFA 4KN4X 4U87A 2DAOA 3CQZJ 5EEGA 2K4JA 1Y8QB 3KP2A 1E17A 3H1CA 4C2MJ 4XLFA 1JGSA 1SVOA 1T08B 5HDKA 2BOLA 1MGTA 2Z9OA 3M4OJ 4MEXF 1R1UA 4FISA 5GP9A 2F4IA 5DS9A 3DXJF 1UMQA 1VQMI 4FE7A 3MWMA 2FQ4A 4JQFA 2KP6A 1X1PA 3QU6A 4EJTA 5JVTA 4PUSA 3KLOA 5E3MA 1R58A 3LWFA 2VXDA 1ON1A 2BVMA 3FZVA 3V8LA 2STTA 3A2KA 3ZMTA 2CQKA 2XC7A 1FZPB 4ZZLA 2WY8Q 2EJRA 4PJLA 2LSOA 3DEWA 2ZBKA 3HRUA 3ZGKA 2R7OA 4LMYA 4FASD 5FD6A 3OS2A 1X1BA 1CF7B 5H2FC 3H92A 4XL9A 2Z33A 3E5UA 2DMNA 4DJAA 2K9NA 3I4NJ 3MEXA 5M5YJ 5J40A 1JUPA 5JVGF 5ICCA 1A5JA 5EG0A 4G6TB 4LLGF 2OF7A 1SVMA 3H0GJ 3FXJA 2HTJA 3ZQHA 4U7BA 1U9NA 2KJCA 2EV5A 1ETOA 4XORA 1STZA 1V3FA 2KHMA 4FQGA 4LK0F 4HAMA 5F27A 1SANA 1SEUA 2EFNA 1J75A 2RVCA 2PQ8A 1A35A 2XPVA 4HQMA 2K3FA 4KN7X 3BCAA 3PO3J 1XN7A 2JRTA 2E2HJ 2K9SA 3RPUD 2FRHA 3OS1A 3EQLF 3U21A 1ZN2A 1PDNC 4IRIA 3F6OA 1D3YA 2F2EA 3FISA 3CJRB 3BC8A 3HL2A 2EIMH 1WH5A 2RC4A 5BMZA 2JK3A 2P6SA 4MLOA 2F4OB 4MIMA 5GADJ 2NVQJ 3DPUA 1ZRDA 3LSTA 2V1UA 4Y15A 1YQAA 1QZZA 1W36C 3P5JA 2E34A 3HIFA 3S16J 1OYWA 5DUKA 3R0JA 1M1EB 2B63J 3B6AA 1U2WA 3LFKA 1HA8A 3E5QA 2XPUA 2ID6A 4UVAA 4O5VA 1IN6A 2IGOA 3F21A 2DA6A 4HSRA 3VEPA 2H94A 3CDLA 1EV7A 1X4PA 4JX4A 4IHYA 2A5WA 2ESNA 3NARA 2DMPA 5M3MJ 1BIBA 3JAMZ 1MNMC 1LQ1A 3O8GA 2Z1DA 3LSJA 5DTDA 2EZLA 1QZYA 5C44J 5EEAA 2XF7A 3QQAA 1ZR2A 2L4MA 2KIQA 3E1SA 3ISPA 3L09A 2A05A 1HCRA 1Z7UA 3GTPJ 3HKZA 5TJJA 4V2FA 1IO2A 4BE1A 3LFUA 1BJAA 2GIZA 2FQ3A 4ZYEA 1RPWA 2RGVA 2DFHA 3HUGA 3BR0A 4YFXF 2GOXB 2DK5A 2L9VA 4IPAA 4PJJA 1BA5A 1ZELA 4BUPA 4HF0A 3DKYA 4MQVA 2XROA 2VOOA 2I5UA 3HSRA 1GV2A 2CRGA 3WU2C 5K5QA 3H36A 3OYBA 1XB4A 2M9HA 2GA1A 3G2BA 2IRFG 1O7FA 1G8XA 5LHHA 4RM2A 3K7AJ 3KETA 5H6RA 1XPXA 2DPUA 3S17J 3GMEA 1U78A 5KAIC 3TW6A 2Y9YA 1S8NA 3TO7A 2ETHA 3KYLA 1YG2A 1R5HA 2EH3A 2V79A 4P5OA 1UG2A 1OPCA 2FMLA 2HNHA 1W4MA 3GZ5A 3CMEI 2O3FA 2NVXJ 2WB1A 2A68F 4UUTA 2CYYA 3BR2A 1DUXC 1QNTA 2WAQN 1XSDA 1XD7A 3OYGA 4I76A 1IXRC 3PQJA 2BBYA 2X6OA 3IH2A 3FXRA 1SFOJ 5B66C 3WTUC 2VLAA 1HDPA 1T0FA 3DTKA 3HTUA 1FNNA 4QIWN 5JHUA 3FIWA 2NNNA 1KA8A 3VODA 1MMDA 1P2FA 3W6KB 4KIBA 2DBBA 3A01A 4I01A 2BV6A 2IGKA 2R3SA 3OWTA 5ILSA 2NS8A 1V5FA 3H0DA 5FKKA 4HDVA 2DYRH 1T0FC 3F9KA 2GA2A 2HS5A 4N4NB 2VODA 1IC8A 1YI2I 2HXIA 2NXNB 2FU4A 3HKZN 1EH7A 3B73A 2EV6A 2MA3A 1BR2A 1T98A 2JJ7A 2R7DA 3BTIA 4B3XA 2IEKA 3TMOA 2IP2A 1G4DA 2PI0A 4GYGA 2EZKA 2YU9J 2ECBA 2L3DA 2PLYA 2OQGA 2AXLA 4ZZDA 1Y1VJ 3JRFA 1OCOH 2ZXWH 3PQKA 1L3LA 5ERIA 1D8JA 2BGCA 2VQCA 1MNDA 2DTZA 2KQRA 3F3XA 4L9TA 2VPRA 4LG0A 1MSEC 2X9DA 2XAFA 1TZLA 2O0YA 1SAUA 2ZJQF 1O4XA 3GTMJ 2FBHA 2CW0F 1FIAA 1XDUA 1U0JA 2RAEA 4F93B 3LSPA 2VKEA 3BPVA 2E1CA 2PMHA 2DODA 2FNPA 4IO9F 4M71A 3TL4X 3MZYA 5LLQA 4C3IJ 3I5UA 1EH8A 3LQRA 4ITVA 1K83J 4ZYAA 3GCMA 2WAEA 3F8FA 2WB1N 3ZCOA 1JUMA 2YS9A 1OCZH 2ZNYA 2KRCA 1IXCA 4ZYDA 3S32A 4EV0A 3P7NA 5CVRA 1E2XA 1BR1A 2ZXIA 3HPGA 1FYKA 5FRMA 1H9TA 2XHKA 4XN0A 4N9HA 4A6EA 4Y7NJ 4HBLA 3OMYA 3L2QA 1TT5B 1X3UA 1ETXA 3CP8A 1ETWA 4AYBA 3A0HC 1SFXA 4CCNA 4DGWB 2XRLA 5K5OA 5E8IA 4CYCA 3RZDJ 4CZZA 3ABUA 3DLAA 3MZ8A 4CICA 2PFBA 3VYRB 4GRIA 1PUFB 1VQ8I 2KT0A 2HQ5A 4OIRF 5EGOA 2NOJB 4ZH4F 3JSOA 5M3FJ 4BJ5C 1BR4A 5DCMB 1TC3C 2Y75A 1IN4A 4P55A 5D4RA 1R5ID 1EKEA 1OLTA 3CESA 3ELKA 3FXQA 1XC5A 4M3GA 4ESBA 2VPLA 3OYNA 2GZWA 1XMXA 1RR7A 2ID3A 4NUBA 2MC3A 1JT0A 1NK3P 2DI3A 4LB5A 4AVZA 2M4KA 2R5ZB 2V1NA 4ZTJA 1ORKA 3AG3H 4BAYA 2XGXA 1R49A 2A6TA 4G7ZF 5ILVA 4DYRA 3PNVA 1EH6A 2L7FP 1W0UA 1HC8A 1MJAA 2QSHX 1DP7P 1SVLA 3I71A 1PJRA 4XNFA 3L1PA 1P92A 3K4JA 1E3HA 4XLEA 4S05A 1FOYA 3C3WA 1NG7A 1TWAJ 3U2RA 5B5EC 1YIJI 2RV8A 2R5YB 1X4OA 1TT0A 2CW7A 1WJAA 4MFDA 1L0OC 4IOCF 5EZGA 1XMKA 1DQUA 1BC8C 2F5CA 3A0BC 1B4AA 1D1AA 3WU1B 1B8IA 1DGRM 4GYIA 4RLFA 2D1VA 2QQ8A 1GDTA 1YJNI 4AYBN 4L0YB 2YU3A 2L9NA 4E7SA 3B6CA 4MEYF 4RB2C 1D0XA 1JTXA 2VASA 4XR6A 5F0HA 5TRDA 4N4OB 2NS0A 2P7CB 1VI0A 3HRSA 4BEHA 2AQEA 4YIFA 1WQ2A 3CCSI 2WY7Q 2E60A 2ISYA 3FBNB 1S9HA 4F55A 3IRQA 4I2OA 1W36D 1UB9A 2HVSA 4L0ZB 3KZIC 3DTEA 1ZKGA 1TW2A 4XMYA 4RAZA 4OIPF 4RGXA 3GYHX 3RTRA 3PNTA 2N8GA 3CJQB 4UV8A 4H0EA 1YOVB 2FA5A 1P9QC 5EF6A 3W6VA 4UUVA 2DA3A 4X1EA 5C4XJ 3R0AA 2B7EA 2XUBA 1QRYA 4BQOA 3RJPA 3IH3A 4HA8A 3WTVC 3TQNA 2ZC2A 4A3EJ 5LHGA 2CUJA 3ZQ7A 3BZCA 2OCEA 3VDXA 3HSFA 4ZYGA 4RA2A 4DYCA 4L5JA 3KP6A 2QVOA 2MLGA 5JLWA 5GAGJ 4XOPA 1FYLA 1FBQA 2JVGA 1LEBA 4W97A 3V42A 3KP5A 4JOMA 1WKMA 5KHDA 4IJAA 3JW4A 1XCBA 2EQRA 3ABTA 3HGYA 1MD0A 4RGUA 1A04A 2HVRA 1ZG1A 3BLYA 3OL3A 5TISC 3G3ZA 4XICA 4CZCA 2KPMA 1V5GA 3AL0B 3DKWA 5M5WJ 3NQOA 4EM1A 2ADUA 3EPZA 4JX5A 1I5ZA 3JRGA 2LOOA 3WHCA 1XSXA 5CQEA 1K79A 4RAGA 2CQQA 1OR7C 2NVUB 4KIFA 4ASNA 1RR8C 3HHGA 2D45A 1A6IA 1R71A 2X0LA 4IL6C 5CYVA 1K61A 1O7LA 3CCQI 3V8KA 1ZG3A 2D2WA 4QSHA 1FY7A 4ZTFA 3SXYA 4A93J 1LPQA 5IT9Z 3LSIA 4RM3A 3VYTB 5F1RA 5J47A 1LUJB 4I09A 2Z3YA 2IAIA 1JI8A 2DFIA 3IRRA 3GWZA 2ZCWA 2FUG2 3GBGA 1MBHA 4A3CJ 4LITA 3S3MA 4AIHA 4EJVA 1XG1A 3JRDA 2XF5A 5EEHA 4C30A 1CF7A 1DDNA 3WTSC 1YFHA 1IXSB 4BJ6C 2O8KA 3HZJA 3RKYA 3T8TA 1LKXA 3DFGA 3K1NA 1RZ4A 1YIOA 4CDGA 1K4SA 1K4TA 5JR3A 2W00A 1OCRH 2IVMA 4XQFA 2PBIA 1QBJA 4CCLA 1WZ2A 3CMYA 1XMAA 1I6HJ 3D1NI 4IZZA 1FOXA 1X2NA 2FMYA 4I0BA 2ZJ2A 5A2QK 3ML6A 3F22A 2QQ9A 4HZFA 2P4WA 5K1YA 2DA7A 4WX9A 1OFCX 3KZYA 3FHNA 5E1ZB 1G3TA 2R7XA 1LDDA 3I59A 1UG0A 2DLLA 3CMAI 2KIFA 3CUQC 4BE2A 4S04A 3TO6A 3J7YJ 3QYEA 1ZGAA 3Q3SA 3CCJI 5J4VA 2HXOA 3FX3A 2KLOA 3I9V2 1PYVA 1FBSA 5D6FA 2P0WA 1RNLA 3R6SA 1VQNI 1T39A 2CUZA 1VQLI 1OJLA 3S1MJ 2LH9A 4EJWA 3A4CA 2P6TA 1S7EA 3IWZA 3GUDA 3WTZA 4KITB 4DYQA 3GO5A 4TV7A 3N05A 4JYKA 4Y33A 4Y52J 3CCVI 1ENHA 3C1DA 3FMQA 1Z1DA 4M6YA 3ESWB 1ODDA 1YLFA 4IRGA 4CA0A 1LE8B 2EZIA 2HDDA 2HYGD 3FXUA 4GGGA 3OOUA 1FIPA 4I6ZA 1Q1VA 3BTJA 4GO1A 4DIQA 2M7AA 2V9VA 2A69F 3NEUA 1YS7A 1R00A 3I64A 3HJEA 3BT9A 5JLXA 4BQNA 1MMGA 1Z9CA 2Q8KA 3PIPF 4KIGA 2JSCA 1O3SA 1I27A 4UY8I 2FXAA 3K4NA 1LDKB 3EETA 2DK8A 2KDOA 4PFPA 2GXBA 5CQGA 1JTYA 5KAFC 3M8EA 4B1RA 1ETKA 3OYHA 3WODF 3Q0VA 1VQKI 4Y17A 4QWQA 2VBWA 4FTHA 3ZPLA 4GFBA 4B43A 2Y31A 4A0YA 4L9NA 4KUMA 4BACA 3A1YA 2CUEA 1ZGWA 1MSFC 4CCOA 2QBYB 1V55H 2DT5A 2TCTA 1OYIA 2QSGX 2F5VA 3R60A 1HLVA 1N75A 4OMYA 2XB5A 5L3FA 1IV8A 4AIKA 1WI3A 2BYVE 2HFHA 3I55I 1MBEA 1GVDA 2HQRA 4L9VA 4ESFA 4HF2A 4G6QA 4II3A 2XB0X 1QGPA 3QPSA 2QLZA 3CO6C 4FETA 4PGGA 2LF8A 3L9FA 5KCMA 2ZMEA 2QCOA 3WGIA 3L2CA 2P5KA 3TO9A 5M5XJ 2VKHA 4JX6A 1TWCJ 1FPQA 5IOZA 2LP0A 2IJLA 2RQPA 4U0WA 2WTEA 3HEFA 4DZJA 3FXLA 3OYFA 2OU2A 3OV8A 4Z2YA 3ZOBA 3E5XA 4G8XA 1RUOA 3GVAA 2E5NA 2JA2A 5K7FA 5DM6F 4A3GJ 5F0FA 3UNGC 4IHSA 1W7PA 2P7VB 5LEJA 4XSXF 5F0CA 3PJRA 2EBIA 2ZXHA 3I3LA 4C3HJ 3GF2A 5LD2C 3ZRGA 3M9AA 4Z6YA 3IL2A 4OIOF 4HNVA 2JRMA 1W1WE 3FK7A 3E0JB 1MH3A 3BR5A 4MHGA 2Y0SA 3FMRA 4P1WA 3AG2H 2ZFWA 3C2GA 4RLQA 5HDNA 5E3OA 3UKGA 1CQTA 5HVQC 4D9JA 1LFPA 2Y9ZA 1ZYRF 3G6EI 2V6EA 2JT1A 4UB8C 3HOUJ 1OCPA 3GXOA 4Q47A 1IUYA 3LSGA 1WFXA 2L0KA 4IHWA 2CV1A 1S29A 3LA7A 2P8TA 3DU6A 5CKTA 5E3LA 1ETQA 4PSXA 3ZQIA 1B72B 2RDPA 5DD4A 4P9UA 5KNLA 3SFZA 4ZC3A 3WTWC 1TTYA 3DU5A 3PUBA 2LR8A 1KYZA 2XGCA 1IN7A 1GUUA 3GFJA 4XLHA 3H9GA 5IYBJ 1RKWA 1B9NA 3PUFA 4ON0A 2XSJC 2WAQA 2MSYA 3EDPA 3BTLA 1YRNA 3S15J 3ZMUA 2K7LA 2FEZA 3T0YA 4PGHA 3ULQB 2KFDA 1X1DA 2CQXA 1QPIA 4YG2F 4XKVA 1JJ6C 1K6OA 2VOPA 5AONA 5HDGA 1G3WA 2VBZA 3G1LA 1XDSA 4L9JA 3COAC 3ONQA 1FOKA 2Y0MA 2V9KA 5EJCA 4NHJA 2LFBA 2VB6A 2LG4A 2XAQA 3BQZA 2EPFA 5KK1A 1FX7A 2AS5F 1EF4A 3U1DA 2GBYA 3FXOA 1ERDA 3LSHA 4LLNA 2LY9A 2VKVA 1VQ5I 2R7FA 4FT8A 2IS4A 2LMDA 2XGEA 3O6BB 1PUFA 1NTCA 4G7OF 1UHMA 3OSFA 2UXXA 1U5TA 3HRTA 3NRVA 3RI4A 2C6YA 3K4MA 4E6KG 1I1GA 3KPHA 1G3SA 3K2AA 2W7NA 5DCMA 2M3AA 3K10A 3SDGA 2G9WA 1BBYA 3QOEA 4O6JA 2Y0SN 5CLSA 2DMUA 1ON2A 1YHQI 1U5TC 5D4SA 2H27A 3MZHA 5L3EA 2E1MC 2OA4A 2M8EA 3JRBA 2YX7A 1P4WA 3M1CA 5J1YA 3HDDA 1AOYA 2BXZA 1OISA 3FKIJ 3SEZA 5EZHA 2BW3B 3DKXA 3M8JA 5L3DA 1MZBA 2OC6A 2DDBA 3ZMVA 3RZOJ 5FLXK 1FMWA 1T6SA 4D7NA 2ZJPF 1ZH5A 3TEDA 1T56A 1O3TA 4KFCA 3E6MA 3LSKA 5DM7F 1ZHFA 1YW9A 4BBRJ 2CV2A 3PSIA 5E20A 5HLGA 2ELKA 2TDXA 2V1DA 1S7OA 1LVAA 5F08A 1IN8A 2R5YA 3I53A 3HOZJ 9ANTA 1R36A 4ZDLA 4F52A 2K9MA 3CTAA 3W3CA 2ZSHB 3L2RA 2YPRA 1J7KA 4DOZA 4CCJA 3FXKA 3RCOA 5J1RA 2E1NA 4Y3OA 3EYYA 4LB6B 2HOAA 3O2PE 2CQNA 3BCBA 1ZG5A 2XIGA 3KLNA 1QO0D 1I50J 3OY9A 2X1EA 3MKYB 4E7IA 1OCTC 3KP3A 3H35A 5DV5A 3LL7A 4I7HA 2FX0A 2MFZA 1QQIA 1TQPA 1TBXA 2MH9A 2XSDC 1ETYA 3HGGA 2OUMA 2M0MA 2XAGA 2DYSH 5J4YA 1IRGA 2LYCA 2M8GX 4OOIA 2L9SA 2UV1A 2BY3A 4HOBA 4RAFA 3O8HA 4LGWA 1G6NA 3H9QA 4XM3A 2WV0A 2LY1A 5CPRB 3VYUB 2BZTA 2GM4A 3DQVC 3KZZA 2F4MB 1FT9A 1Z21A 1IG7A 1P6RA 2DFFA 4DNCA 4CHUA 4PJNA 3K9TA 1EA3A 1Y8RB 4A3KJ 5EG0B 1TQMA 2DU9A 2ISZA 1R4NB 1Z6RA 1J0RA 4IRHA 2KKOA 5E17F 2E7XA 2LC2A 2M30A 4WXHA 1FOWA 3WE3A 4BHPA 5HNHA 1NG6A 3I0TA 1ZGJA 4ANJA 3GFIA 1T33A 3GEZA 1VQ6I 3CF2A 1FC3A 3ABLH 3H3VK 5L3BA 1BN5A 2HGCA 3W2WA 4AM3A 1F43A 5LGTA 2HKOA 4A69C 3AFHA 1J9IA 4JK1X 4BNCA 2FBIA 1G2HA 2L7KA 2PMZA 1JKOC 4M9ZA 2NS7A 1LDJA 2BY1A 3Q9VA 3E7LA 2H6CA 4BL0B 4XK4A 4OWRB 3C7JA 2QKMB 2K02A 3R61A 4E70A 4D7MA 3FMSA 2WV1A 2V6CA 2BE5F 3LA2A 4RMNA 2AO9A 2EILH 3D5LA 1R22A 2L9RA 2MGQA 4G12A 4L5IA 2GLOA 4D5FA 2DN0A 5BQTA 1YYVA 3BG6A 3LQQA 3VPRA 4RDUA 3K1PA 3MN2A 4MQ9F 4UVBA 2IS1A 1S5LC 2LKSA 4HX4A 4BH9A 1IN5A 3DP7A 2IXSA 2L7MP 3CO7C 1ITYA 2OBPA 3I4PA 1BW5A 2NRAC 1WHUA 3SFIA 2GXAA 5TGTA 4V19K 2MYSA 2W1OA 4AC0A 2B0LA 3CCEI 3IV5A 3J80K 2MG4A 1Z3XA 2EFPA 1V4RA 3F8NA 1USTA 1XGOA 5HS8A 3C2BA 2Q2EB 5LGNA 1JE8A 1I39A 3MMYB 2OQRA 1PP8F 2W57A 3M1EA 3MQ0A 3BTCA 2CUFA 2X1CA 2L02A 2VT2A 3FBIB 3WG9A 4XRFA 1ZQ3P 2E1MB 4YFNF 2WAFA 1LFBA 3GZNB 3KP4A 2HDCA 3Q0WA 5FFZA 3JRIA 1BC7C 1ZRCA 3CJNA 3T1BA 4M9XA 5F1JA 4A2UA 5AIQA 3ZP5A 1FP2A 1VQ9I 4OU0A 2M4GA 3LAPA 3ECOA 1J59A 2ZJRF 2ZNZA 4A0XA 2PMZN 2VE9A 1HW2A 4C9YA 3GW2A 2VI6A 3LMMA 2CQ7A 2GOMA 3MKZA 5FLMJ 1KZHA 4Q48A 2PJRA 3ROUA 1LFUP 3ZQFA 2XGDA 1WJCA 3K4KA 3DBLB 1ZLKA 2BY0A 3HM5A 4WWCA 2JSPA 2MD5A 1JXSA 4AUXA 2H8WA 4CXFA 3S1QJ 1X1AA 1AKHA 4IX7A 2OTJI 3OIOA 2WBMA 4NC6A 1Y0UA 2JPCA 4BDZA 3QP5A 1R4MB 4U7DA 1OYYA 2KIUA 4CUGA 1MJBA 1YJ9I 3ZQGA 2KL4A 4K2EA 2O6GE 4RAYA 4UXNA 1X3WB 4HV6A 1SFKA 4XRMA 2K3PA 3ZQLA 6PAXA 3VOEA 2CGPA 2L4AA 3RPQA 4CH7A 3S3NA 5DEQA 2WA0A 2VJIA 4Y13A 2LTPA 3SYTA 3ZQCA 3ABMH 4XLAA 1IDYA 2X6WA 5L3CA 1HSJA 3IWFA 1TNTA 1SD5A 3J81K 2IS2A 3RPUA 1IRXA 3LAJA 3X2QH 2FOWA 1K6YA 2PN6A 5IOYA 3CF5F 3GLXA 3E6BA 4EQQA 5A2QZ 4X0GA 3V7SA 1GLNA 2NAZA 2XDVA 3WTTC 5KVRA 4LG0B 5FFXA 3GTOJ 2DXIA 2VBXA 3C2HA 3LA3A 1FEXA 1IZ1A 2ZB9A 2OZUA 2YX4A 2EWNA 1R6RA 4UUSB 1WJBA 3EUHA 4NC8A 3RYRA 4XIDA 4FCYA 4M6VA 5DCFA 4ZYHA 3FHZA 1WJDA 1HBXG 1WI9A 4N0BA 3V7RA 5ICEA 3A02A 4ENJA 1VF9A 2M5WA 3E3VA 3DTIA 4BKXA 5K7ZA 1G59A 1RETA 2QZ8A 5EYRA 4HLYA 1E0EA 4YEJA 1WVRA 2L2OA 4F92B 3OYEA 3N97A 1FSEA 1Z67A 3TGNA 1FYMA 3S1RJ 2ICWG 1WJEA 4F3QA 2R7RA 1UHSA 3JSPA 4MTDA 1UHWA 4NBQA 3I4MJ 3FDYA 1ZK8A 5D6EA 4C3JJ 4BHBA 1FBUA 2PEXA 4BU2A 4CYCB 1Y1WJ 5IY5H 3WHBA 1F9NA 4L5EA 3IP4B 4R1HA 5JHFA 2X48A 3IC7A 3HOSA 4Q4ZF 1IRZA 1LJ9A 2HU9A 3DBRB 5EGOB 2XVCA 3SZGA 3GTGJ 2F6CA 5E79C 1MIJA 3SEQA 4XOTA 1REPC 1QHHD 1NHAA 1RESA 2PMUA 3IUOA 2EA2A 2UUZA 2IGNA 3RSNA 2QEXI 3MD2A 2KRFA 4XSZF 1HW1A 2DW4A 2RNJA 5GAHJ 5CJ9A 1XX5A 3VB2A 2VQHA 3DV8A 2FBKA 3U9GA 2DJNA 2QQBA 3CZ6A 1J2XA 3SQNA 3REOA 1R5GA 5F04A 1K7AA 2R92J 4RB0A 4LIUA 2LKPA 4KDPA 3RYPA 4HEA2 1D1BA 5GTIC 3MKLA 2FJ1A 1WWXA 2QKLB 2O5RA 5LRSA 1GT0C 1SD4A 3OSGA 5C4JJ 1N78A 1RC9A 2X6XA 3I56I 2Z5UA 2ZKZA 3BG3A 3GTKJ 1BOBA 2XPWA 3HOYJ 2MABA 2LBFB 4KMUX 1V54H 3QYFA 2VE8A 4HF1A 4PSWA 1UFMA 4M73A 5E3NA 1SFUA 2HTSA 2VBYA 5DDGA 5IPAA 3DCFA 3QYBA 3RKQA 1NH3A 2YSRA 1T2KA 1BM9A 4FE4A 4YFKF 1ONVA 4ESJA 1B8IB 1MMSA 2JPBA 4YIRX 2WWYA 5FRNA 4IEJA 3OYCA 4B09A 4AVPA 2V9PA 2KDZA 4EJOA 5D8KB 1Z6TA 4XLCA 5D5VB 2IGMA 4RS8A 4AU7A 1YO5C 4L18B 3FK6A 5FROA 4G6DA 1XS9A 5DUIA 2H1LA 2L5QA 1A36A 2A07F 1J5YA 4A3BJ 4OAYA 2HOSA 4BEHB 1HQCA 2KZGA 5D5XB 2H09A 3CLOA 2FNAA 4KICA 3G71I 5J8FA 1JJ8C 1U9OA 4YELA 1X2MA 4FX0A 2YUSA 3S2HJ 4BXXJ 2RQQA 2GQQA 4M3DA 3BG5A 2KIMA 4HG2A 1AU7A 3HOVJ 5ICGA 2XKPA 1FP1D 1WPKA 3OL4A 3JREA 3ZN0A 3S14J 1BI2A 2COMA 4IHXA 1AA7A 4OAZA 3PO2J 4C2UA 4X6AJ 2MD0A 1O3RA 2A61A 4ZDOA 3MFKA 4ENNA 3HYIA 4HQEA 1FWZA 1GXQA 2RKHA 3EUAA 3HC7A 4B47A 2K85A 5ED4A 2VUMJ 2E19A 4A5NA 5GPAA 2OPTA 3OYMA 1JKQC 4KYWA 3KFWX 2M34A 2VL8A 5LBQA 2R7SA 2DCEA 2VQLA 3CUOA 4UNOA 2EIJH 2L54A 2V4JC 2BW3A 5E1XA 1N25A 1LEAA 1WGXA 3OS0A 2AXTC 4GDFA 1D0ZA 4P96A 3W2AA 4I02A 1PVEA 4CGZA 2IBDA 3QPLA 4WXDA 1AWCA 3DPTA 3VYSB 2QQAA 1ZRFA 3W6JB 4BS9A 3H3ZA 4V2GA 5E1WA 2CS3A 2OTLI 2F48A 1MDMB 4F91B 2ECCA 3TP0A 3ZN1A 1HSTA 1A31A 2FE3A 3OR2C 2CW8A 3IKTA 1YS6A 1RI7A 3VWBA 2JA6J 2XAUA 2E7WA 3VSLA 3MAJA 1Y6IA 2B9SA 3ASOH 1XGSA 1VZ0A 2K9LA 2M87A 2ZMEC 4NQWB 4BQAA 3F72A 3G4SI 2H1KA 4BY1J 3CD6I 2VJJA 4DZPA 2CMPA 1I3QJ 4UHTA 4MNUA 3K70C 1D8KA 2X51A 1XTAA 3ZMZA 1RKTA 4KT6A 5LEKA 3V7CA 1R1TA 1UAAA 2QM3A 2KZVA 3GX4X 2HQAA 4BE0A 2G0EA 1BJZA 4LD5A 4PDKA 2IPQX 3PIOF 1KU2A 2A5YB 4RB3C 1J09A 3BDDA 4QPOA 3F0CA 2HKXA 4J00A 4LLLA 1SD7A 4H4KC 2R7UA 2P81A 1A6QA 3NWTA 1MMNA 3CJTB 1N77A 2R7WA 5IYDJ 4IVNA 4QLCU 5HS7A 4RGSA 5BPDA 2IW5A 4XBFA 1IAWA 2K9QA 3H5NA 2XV4S 2GXGA 3WE2A 2HWVA 1BOAA 1RUNA 2R4GA 4U88A 5FLXZ 4Q5SF 2G7UA 3D5RC 2R0QC 2MH2A 5HLHA 1UJ8A 1IJWC 3H5AA 4YIIA 3FWEA 5CVJA 4CYDA 2GAUA 4EJUA 5ICFA 4M3BA 1OCCH 3MVPA 2O03A 2Y69H 2OZ6A 4NC7A 2V7FA 1Z3YA 3OIQA 4KISA 3QP6A 3CUQB 3HOWJ 1DU0A 4LG3A 2I10A 3IAM2 4HW0A 2DFEA 1BI0A 4MO7A 2W24A 3KYDB 3I59B 1S6LA 3FM5A 3BWGA 5FKNA 1KU9A 5B3SH 1MBGA 4XN3A 1B1BA 3ZXSA 4AIJA 1TQIA 4I0AA 3HTSB 4EM2A 1FJLA 3CP2A 3G1OA 4A3LJ 5FJ8J 1X19A 3JTHA 4Y4RA 1TW3A 1R1VA 3CCUI 2BHZA 4A12A 2BHYA 3H3UA 1HKTA 1Y56A 5FB2A 2CJJA 4ETSA 1E3PA 3PNYA 1YW8A 2Y48A 2MBFA 2EINH 2TRTA 2EFOA 2DA5A 2D5VA 2P5VA 4DBQA 2F5FA 3UR3C 2W84A 2QUFA 3L2UA 1TNSA 4B8XA 2DPDA 1HOMA 3R4KA 3G73A 1DPRA 3DWLE 3V8JA 2OCCH 2HPMA 2EA4A 4M3FA 4M3EA 2O7OA 4IQ4A 3T5XA 1QA6A 3M8FA 2K5CA 4UVCA 1WRJA 1K78B 4HPQA 2WC2A 3SZTA 1BI3A 1JKPC 4CO8A 2LKXA 4IQJA 1I3AA 3OYIA 5GPCA 3L2WA 3KE2A 3OOPA 1Y39A 2NVTJ 3HB9A 5C3EJ 2O9LA 1P4XA 2DJIA 3S93A 4E7ZA 4FHTA 4A3FJ 3S3OA 3K6GA 2Q2EA 1XGMA 2XASA 4C2TA 2R93J 1B59A 1LB2A 4XKCA 2KISA 2Z99A 2HYFA 3DBHB 2VONA 4ENMA 4IXAA 2R5ZA 3BR3A 1MW7A 4F7ZA 4EVIA 2JA7J 3J7AO 4E7KA 2OAZA 3C18A 4RGRA 4XRSG 5D5WB 3QWLA 5FD5A 1E3OC 4PJ0C 3AG4H 4IOAF 3FXMA 1S7AA 2HDWA 4E7JA 5D8LB 2W4SA 3NAUA 1YX3A 3RQ4A 3TDUC 4BYYA 3JRAA 2JQ7A 2L01A 4YRVA 3QU3A 1ZARA 3HRMA 4HV5A 5HODA 3M07A 1KYWA 1IF1A 2J5PA 5FO5A 2CFXA 3BPXA 1KQ0A 5DD8A 1G3YA 4I98B 1LNWA 2HOEA 3ZR8X 1VQPI 4HX8A 1RIOH 2UXNA 3D0SA 1WH7A 3E97A 1X58A 4EM0B 3WGGA 2Q0OA 1YE9A 3SDBA 1W5SA 3LOCA 4JP0A 3I54A 3J80Z 2ZMEB 5LFAA 2DA4A 2HQNA 1DGWY 1T95A 3TW7A 4NNJA 5FGMA 3K1MA 5L3GA 4XKWA 1KQ8A 1UCRA 2QA4I 2K4BA 3F8CA 4A3IJ 1VQ4I 2M0CA 4ZJZA 5EDNA 2BXYA 2MLKA 1HW5A 2Z16A 2A3SA 3GLLA 2LDUA 1Z7LA 2K86A 2OV7A 3IAS2 1U3EM 1OKRA 3JCUC 1FLIA 2I8DA 2EV0A 3CC7I 3L7WA 2D1HA 4BXFA 4BGDA 4KNYA 2LRDA 2VIXA 1W7PB 3K4LA 3E6CC 2ACJA 1TP4A 3KEOA 2RN7A 3BROA 3BOQA 2R7ZJ 2DT7B 3GTQJ 3JAMK 1DP3A 1I6XA 3FKJA 2LY2A 2CWEA 1GVJA 5BPIA 3SZPA 2DMTA 5GAEJ 3BJOA 1X3ZB 3GZ6A 2LNBA 3WG7H 2VXZA 3FM3A 1KONA 4HRIA 2IA0A 2GWRA 4OMZA 1XGNA 3HPHA 2UZKA 1ZLJA 3HSEA 4R8HA 3DEUA 5BS6A 1KGSA 2XRNA 5LRRA 1TWGJ 1Q1HA 3OYDA 3CDHA 4BY7J 3SJMA 4PZJA 1ACIA 4HLXA 1W5TA 2STWA 3S2DJ 1JGGA 3WTYC 3GFLA 3QAHA 2DOAA 2W82A 1OQYA 1YX5A 3TP3A 4NDLA 4UUSA 2V1XA 4HSTA 1USSA 2JMWA 3WU0A 3HHHA 3OIPA 1U8RA 4FX4A 1TLHB 5J1UA 1YRNB 2M2EA 1MH4A 1IV6A 1QPMA 1ZTRA 2Z2SB 5IP6A 3RKXA 1T8IA 2ELHA 4W1UA 4EATA 5K7HA 1MNEA 2F5EA 2K27A 2K40A 3PFYA 2ZO4A 3EUKL 1WJ5A 2AQFA 2EIKH 3IH4A 4NB5A 3AL0C 1YITI 4XKBA 4M6XA 1POGA 3TKYA 1FSHA 2HI3A 3F23A 3BR6A 4II2A 1ETVA 2OJED 3AKZA 2W48A 1BL0A 1DPUA 2EB7A 3D5SC 3ECHA 3MKWB 3AAFA 1QU3A 5AIPA 2X4HA 3KYCB 2KJBA 3MCZA 3TOBA 1B9MA 3J81Z 4A0ZA 3W2VA 3L00A 3O3KA 1U5TB 2LK2A 3HUGB 1NK2P 4LOCA 2ME6A 3NWSA 3K70D 1MJ9A 2ME0A 3QOPA 2FD5A 3CCYA 2LF7A 1PP7U 1U8BA 2DTRA 2VQGA 4UB6C 2O8XA 5B1AH 2XAHA 2VC0A 1VQ7I 1R23A 2E1OA 3KCCA 1YW7A 4A3DJ 2DA1A 1VQOI 3EYIA 5IYCJ 3AG1H 2PG4A 4KT5C 2VN2A 2MW8A 1W7PD 4P9FA 1IUFA 2PJPA 2E5ZA 2PX9A 1FMVA 4IKFA 5FKLA 2DT6A 5HS9A 4CSWA 1HXDA 3LSMA 3N4MA 2FF4A 3QRFF 5LHIA 4S0HB 2QWWA 5HLTA 3OYKA 4GXOA 3RIRA 4EMSA 5D5UB 4HDUA 4M9SA 2YR2A 3ZMDA 3CC2I 1SD6A 5HLIA 2JA5J 1OMIA 2QF7A 3CLQA 1WSUA 2JWTA 4RB1A 2LBFA 4B48A 1BW6A 2F5DA 3ABKH 4B44A 4MTEA 1X1CA 2E35A 2EZHA 4EEFG 2ZSIB 1F4KA 2G7HA 3LSRA 5HNFA 4ABZA 1IW7F 4E7LA 5GTHC
chains in the Genus database with same CATH topology
3HKZN 3A01B 5FKOA 1CQTA 3UKGA 5E3OA 5E3NA 1MBKA 2JJ7A 3BR1A 3BTIA 2Y9ZA 3Q0UA 2IEKA 5IPAA 3DCFA 3RQIA 3RKQA 1H88C 2E2JJ 3HOUJ 1OCPA 2EZKA 2YU9J 3LSGA 2ECBA 2L0KA 4IHWA 4FE4A 1B8IB 1JT6A 1Y1VJ 3JRFA 4IEJA 1TWHJ 5E3LA 1ETQA 3ZQIA 5FKMA 1B72B 2KDZA 1LE8A 3FK6A 3JR9A 2DTZA 1XS9A 3HBLA 1MSEC 2LR8A 2VPRA 3JRHA 2X9DA 2XGCA 1GUUA 5IYBJ 1RKWA 3JRCA 4XRSA 2LVSA 3A03A 1O4XA 2HOSA 3GTMJ 4A3BJ 1FIAA 2MSYA 2RAEA 3BTLA 1YRNA 3S15J 3LSPA 2VKEA 1JJ8C 4D5CA 1U9OA 2CQXA 1P7IA 1QPIA 1X2MA 1JJ6C 2YUSA 3S2HJ 4BXXJ 4M3DA 4C3IJ 3PM1A 3G1LA 3BG5A 1K83J 1AU7A 3HOVJ 2WB1N 1F36A 2DA2A 1JUMA 1WPKA 2LFBA 2YS9A 3JREA 3S14J 3BQZA 4IHXA 1EF4A 3PO2J 2GBYA 4X6AJ 5FLVA 2LY9A 2VKVA 2XGEA 3GTJJ 4Y7NJ 1HF0A 1PUFA 2VUMJ 1NTCA 3G1MA 2E19A 1ETXA 5GPAA 1ETWA 2OPTA 3OSFA 2HOTA 3M3YJ 1JKQC 2XRLA 4CYCA 2M34A 3HOXJ 3RZDJ 3K2AA 3SDGA 2Y0SN 2DMUA 2JN6A 1PUFB 2KT0A 4DW6A 2JA8J 2HQ5A 5EGOA 1WGXA 1Z0XA 2NOGA 5M3FJ 1H8AC 3JRBA 1TC3C 1D5YA 5J1YA 3HDDA 4B4CA 2IBDA 3QPLA 4M3GA 1FTTA 1XC5A 1QVTA 3FKIJ 5EZHA 1P7JA 1RR7A 2ID3A 1JT0A 1NK3P 2LD5A 4V2GA 3RZOJ 4B3AA 4D7NA 5BNGA 3TEDA 1T56A 2ECCA 3TP0A 2R5ZB 4A3MJ 2JA6J 1ORKA 2L7ZA 4BBRJ 1R9TJ 4IHVA 2Y30A 1FTZA 2ELKA 5F08A 2H1KA 4DYRA 2R5YA 4BY1J 2L7FP 1W0UA 9ANTA 3HOZJ 4DZPA 1I3QJ 1Z77A 3L1PA 1RKTA 5J1RA 2HOAA 3BG9A 1TWAJ 2R5YB 1I50J 1BJZA 2G0EA 1W0TA 1OCTC 4MFDA 3F0CA 2FX0A 5EZGA 4A3JJ 4J19A 2P81A 2XSDC 1ETYA 3HGGA 5IYDJ 2M8GX 1B8IA 2K9QA 1IDZA 3O8HA 1B72A 1GDTA 4AYBN 1APLC 1H89C 2R0QC 2DMQA 1MBFA 3B6CA 1JUSA 1JTXA 1IGNA 2GM4A 5F0HA 4QTRA 1IJWC 1IG7A 1VI0A 4A3KJ 5EG0B 4M3BA 1GV5A 2H8RA 3MVPA 5J3LA 4RBOA 1AKHB 3HOWJ 3S1NJ 1ZKGA 1DU0A 2I10A 4MO7A 1VNDA 1T33A 2N8GA 5FKNA 3H3VK 1MBGA 1AHDP 1JKRC 1FJLA 3W6VA 5EF6A 1VFCA 3G1OA 4A3LJ 1F43A 4MFEA 2DA3A 4X1EA 4A69C 5FJ8J 5C4XJ 2CJJA 1QRYA 1G2HA 2LLKA 3IH3A 2TRTA 1JKOC 2DA5A 2NS7A 2D5VA 1MBJA 4A3EJ 3E7LA 3LNQA 4XK4A 2E2IJ 2AHQA 1HOMA 1DU6A 2CU7A 4D7MA 1WCMJ 2WV1A 4DYCA 2AO9A 4M3FA 2HYJA 4G12A 2L9RA 2MGQA 2O7OA 4M3EA 3GTLJ 5JLWA 2GLOA 4D5FA 1ZR4A 2DN0A 2COBA 4W97A 3VPRA 4RDUA 3MN2A 2EQRA 3HGYA 1JKPC 2LKXA 5GPCA 4BBSJ 2NVTJ 3HB9A 5C3EJ 2O9LA 4XICA 1HDDC 2L7MP 1ITYA 1BW5A 3SFIA 4A3FJ 3BQYA 2Y2ZA 4AC0A 5IP9J 5M5WJ 2R93J 3IV5A 1QVUA 4JX5A 2MG4A 3JRGA 3WHCA 2R5ZA 3BR3A 1TWFJ 5IP7J 2NVYJ 2JA7J 2CQQA 3C2BA 3CQZJ 4XRSG 1E3OC 4C2MJ 1A6IA 1K61A 3BTCA 2CUFA 3NAUA 3M4OJ 3JRAA 1ZQ3P 4FISA 5GP9A 1LFBA 4QSHA 5DS9A 1UMQA 3Q0WA 4FE7A 4A93J 3JRIA 5HODA 2FQ4A 2IAIA 5F1JA 3GBGA 1MBHA 5E3MA 4A3CJ 1XG1A 3JRDA 2O8KA 2PMZN 1WH7A 1X58A 2VI6A 3DEWA 3LOCA 4JP0A 5FLMJ 2DA4A 1LFUP 3ZQFA 2DMNA 2XGDA 3TW7A 2K9NA 3I4NJ 3HM5A 5M5YJ 3CMYA 4A3IJ 1JUPA 3D1NI 2M0CA 5EDNA 1I6HJ 1A5JA 5EG0A 2OF7A 3H0GJ 3ZQHA 1X2NA 4AUXA 1U9NA 3S1QJ 1ETOA 1AKHA 2DA7A 1OFCX 3OIOA 5F27A 1SANA 2R7ZJ 3GTQJ 2DMTA 3ZQGA 2XPVA 1YRNB 3PO3J 3Q3SA 2HXOA 2E2HJ 4XRMA 2K9SA 3ZQLA 3FISA 1TWGJ 1WH5A 1OJLA 2LTPA 3S1MJ 3ZQCA 2JK3A 4BY7J 1S7EA 1IDYA 3SJMA 4MLOA 4DYQA 4MIMA 4JYKA 4Y52J 2NVQJ 1ENHA 3S2DJ 1JGGA 5IOYA 1LE8B 4UUSA 3TP3A 2EZIA 4NDLA 2HDDA 3S16J 2B63J 3B6AA 2JMWA 3OOUA 1FIPA 3GTOJ 4I6ZA 2XPUA 2ID6A 1Q1VA 3BTJA 2DA6A 4IHYA 1FEXA 3CDLA 4JX4A 2ZB9A 5J1UA 5JLXA 3BT9A 3NARA 1MNMC 2DMPA 1MH4A 2M2EA 5M3MJ 4UUSB 1ZTRA 5IP6A 1IV6A 3O8GA 4XIDA 3LSJA 5DTDA 4FCYA 2EZLA 4M6VA 5C44J 4W1UA 5EEAA 5K7HA 3QQAA 2K40A 1ZR2A 1JTYA 3A02A 3IH4A 4B1RA 1VF9A 1HCRA 1ETKA 1POGA 3GTPJ 4BKXA 2HI3A 4V2FA 3Q0VA 5K7ZA 1RETA 5EYRA 3BR6A 1ETVA 4FTHA 1RPWA 4GFBA 2W48A 2Y31A 1BL0A 1ZGWA 2CUEA 3BR0A 1MSFC 3S1RJ 2TCTA 1BA5A 1UHSA 1HLVA 2XB5A 3I4MJ 1ZK8A 1WI3A 4C3JJ 1GV2A 2CRGA 2LK2A 1NK2P 4LOCA 4CYCB 2M9HA 2ME6A 4L5EA 3WHBA 1MBEA 1Y1WJ 1GVDA 2ME0A 2X48A 2FD5A 3CCYA 1U8BA 2XB0X 3QPSA 3K7AJ 1IRZA 3S17J 5EGOB 2E1OA 1U78A 3TW6A 3GTGJ 4A3DJ 2DA1A 2Y9YA 2QCOA 5IYCJ 2EH3A 2MW8A 5M5XJ 1UG2A 1RESA 4JX6A 1IUFA 1TWCJ 5IOZA 5FKLA 2LP0A 2NVXJ 4UUTA 3BR2A 3HEFA 4DZJA 2DJNA 4S0HB 2WAQN 5F04A 4I76A 3ZOBA 2R92J 3IH2A 2X6OA 1SFOJ 5K7FA 4A3GJ 5F0FA 1HDPA 3MKLA 2JA5J 2FJ1A 5F0CA 4QIWN 2QF7A 2EBIA 3FIWA 2JWTA 1GT0C 4C3HJ 3OSGA 1BW6A 3A01A 5C4JJ 2EZHA 4EEFG 2NS8A 5FKKA 4HNVA 3FK7A 1MH3A 3BG3A 3BR5A 3LSRA 1IC8A 3GTKJ 3HOYJ 2XPWA 4ABZA 2HXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ N;  3A01 B;  5FKO A;  1CQT A;  3UKG A;  5E3O A;  5E3N A;  1MBK A;  2JJ7 A;  3BR1 A;  3BTI A;  2Y9Z A;  3Q0U A;  2IEK A;  5IPA A;  3DCF A;  3RQI A;  3RKQ A;  1H88 C;  2E2J J;  3HOU J;  1OCP A;  2EZK A;  2YU9 J;  3LSG A;  2ECB A;  2L0K A;  4IHW A;  4FE4 A;  1B8I B;  1JT6 A;  1Y1V J;  3JRF A;  4IEJ A;  1TWH J;  5E3L A;  1ETQ A;  3ZQI A;  5FKM A;  1B72 B;  2KDZ A;  1LE8 A;  3FK6 A;  3JR9 A;  2DTZ A;  1XS9 A;  3HBL A;  1MSE C;  2LR8 A;  2VPR A;  3JRH A;  2X9D A;  2XGC A;  1GUU A;  5IYB J;  1RKW A;  3JRC A;  4XRS A;  2LVS A;  3A03 A;  1O4X A;  2HOS A;  3GTM J;  4A3B J;  1FIA A;  2MSY A;  2RAE A;  3BTL A;  1YRN A;  3S15 J;  3LSP A;  2VKE A;  1JJ8 C;  4D5C A;  1U9O A;  2CQX A;  1P7I A;  1QPI A;  1X2M A;  1JJ6 C;  2YUS A;  3S2H J;  4BXX J;  4M3D A;  4C3I J;  3PM1 A;  3G1L A;  3BG5 A;  1K83 J;  1AU7 A;  3HOV J;  2WB1 N;  1F36 A;  2DA2 A;  1JUM A;  1WPK A;  2LFB A;  2YS9 A;  3JRE A;  3S14 J;  3BQZ A;  4IHX A;  1EF4 A;  3PO2 J;  2GBY A;  4X6A J;  5FLV A;  2LY9 A;  2VKV A;  2XGE A;  3GTJ J;  4Y7N J;  1HF0 A;  1PUF A;  2VUM J;  1NTC A;  3G1M A;  2E19 A;  1ETX A;  5GPA A;  1ETW A;  2OPT A;  3OSF A;  2HOT A;  3M3Y J;  1JKQ C;  2XRL A;  4CYC A;  2M34 A;  3HOX J;  3RZD J;  3K2A A;  3SDG A;  2Y0S N;  2DMU A;  2JN6 A;  1PUF B;  2KT0 A;  4DW6 A;  2JA8 J;  2HQ5 A;  5EGO A;  1WGX A;  1Z0X A;  2NOG A;  5M3F J;  1H8A C;  3JRB A;  1TC3 C;  1D5Y A;  5J1Y A;  3HDD A;  4B4C A;  2IBD A;  3QPL A;  4M3G A;  1FTT A;  1XC5 A;  1QVT A;  3FKI J;  5EZH A;  1P7J A;  1RR7 A;  2ID3 A;  1JT0 A;  1NK3 P;  2LD5 A;  4V2G A;  3RZO J;  4B3A A;  4D7N A;  5BNG A;  3TED A;  1T56 A;  2ECC A;  3TP0 A;  2R5Z B;  4A3M J;  2JA6 J;  1ORK A;  2L7Z A;  4BBR J;  1R9T J;  4IHV A;  2Y30 A;  1FTZ A;  2ELK A;  5F08 A;  2H1K A;  4DYR A;  2R5Y A;  4BY1 J;  2L7F P;  1W0U A;  9ANT A;  3HOZ J;  4DZP A;  1I3Q J;  1Z77 A;  3L1P A;  1RKT A;  5J1R A;  2HOA A;  3BG9 A;  1TWA J;  2R5Y B;  1I50 J;  1BJZ A;  2G0E A;  1W0T A;  1OCT C;  4MFD A;  3F0C A;  2FX0 A;  5EZG A;  4A3J J;  4J19 A;  2P81 A;  2XSD C;  1ETY A;  3HGG A;  5IYD J;  2M8G X;  1B8I A;  2K9Q A;  1IDZ A;  3O8H A;  1B72 A;  1GDT A;  4AYB N;  1APL C;  1H89 C;  2R0Q C;  2DMQ A;  1MBF A;  3B6C A;  1JUS A;  1JTX A;  1IGN A;  2GM4 A;  5F0H A;  4QTR A;  1IJW C;  1IG7 A;  1VI0 A;  4A3K J;  5EG0 B;  4M3B A;  1GV5 A;  2H8R A;  3MVP A;  5J3L A;  4RBO A;  1AKH B;  3HOW J;  3S1N J;  1ZKG A;  1DU0 A;  2I10 A;  4MO7 A;  1VND A;  1T33 A;  2N8G A;  5FKN A;  3H3V K;  1MBG A;  1AHD P;  1JKR C;  1FJL A;  3W6V A;  5EF6 A;  1VFC A;  3G1O A;  4A3L J;  1F43 A;  4MFE A;  2DA3 A;  4X1E A;  4A69 C;  5FJ8 J;  5C4X J;  2CJJ A;  1QRY A;  1G2H A;  2LLK A;  3IH3 A;  2TRT A;  1JKO C;  2DA5 A;  2NS7 A;  2D5V A;  1MBJ A;  4A3E J;  3E7L A;  3LNQ A;  4XK4 A;  2E2I J;  2AHQ A;  1HOM A;  1DU6 A;  2CU7 A;  4D7M A;  1WCM J;  2WV1 A;  4DYC A;  2AO9 A;  4M3F A;  2HYJ A;  4G12 A;  2L9R A;  2MGQ A;  2O7O A;  4M3E A;  3GTL J;  5JLW A;  2GLO A;  4D5F A;  1ZR4 A;  2DN0 A;  2COB A;  4W97 A;  3VPR A;  4RDU A;  3MN2 A;  2EQR A;  3HGY A;  1JKP C;  2LKX A;  5GPC A;  4BBS J;  2NVT J;  3HB9 A;  5C3E J;  2O9L A;  4XIC A;  1HDD C;  2L7M P;  1ITY A;  1BW5 A;  3SFI A;  4A3F J;  3BQY A;  2Y2Z A;  4AC0 A;  5IP9 J;  5M5W J;  2R93 J;  3IV5 A;  1QVU A;  4JX5 A;  2MG4 A;  3JRG A;  3WHC A;  2R5Z A;  3BR3 A;  1TWF J;  5IP7 J;  2NVY J;  2JA7 J;  2CQQ A;  3C2B A;  3CQZ J;  4XRS G;  1E3O C;  4C2M J;  1A6I A;  1K61 A;  3BTC A;  2CUF A;  3NAU A;  3M4O J;  3JRA A;  1ZQ3 P;  4FIS A;  5GP9 A;  1LFB A;  4QSH A;  5DS9 A;  1UMQ A;  3Q0W A;  4FE7 A;  4A93 J;  3JRI A;  5HOD A;  2FQ4 A;  2IAI A;  5F1J A;  3GBG A;  1MBH A;  5E3M A;  4A3C J;  1XG1 A;  3JRD A;  2O8K A;  2PMZ N;  1WH7 A;  1X58 A;  2VI6 A;  3DEW A;  3LOC A;  4JP0 A;  5FLM J;  2DA4 A;  1LFU P;  3ZQF A;  2DMN A;  2XGD A;  3TW7 A;  2K9N A;  3I4N J;  3HM5 A;  5M5Y J;  3CMY A;  4A3I J;  1JUP A;  3D1N I;  2M0C A;  5EDN A;  1I6H J;  1A5J A;  5EG0 A;  2OF7 A;  3H0G J;  3ZQH A;  1X2N A;  4AUX A;  1U9N A;  3S1Q J;  1ETO A;  1AKH A;  2DA7 A;  1OFC X;  3OIO A;  5F27 A;  1SAN A;  2R7Z J;  3GTQ J;  2DMT A;  3ZQG A;  2XPV A;  1YRN B;  3PO3 J;  3Q3S A;  2HXO A;  2E2H J;  4XRM A;  2K9S A;  3ZQL A;  3FIS A;  1TWG J;  1WH5 A;  1OJL A;  2LTP A;  3S1M J;  3ZQC A;  2JK3 A;  4BY7 J;  1S7E A;  1IDY A;  3SJM A;  4MLO A;  4DYQ A;  4MIM A;  4JYK A;  4Y52 J;  2NVQ J;  1ENH A;  3S2D J;  1JGG A;  5IOY A;  1LE8 B;  4UUS A;  3TP3 A;  2EZI A;  4NDL A;  2HDD A;  3S16 J;  2B63 J;  3B6A A;  2JMW A;  3OOU A;  1FIP A;  3GTO J;  4I6Z A;  2XPU A;  2ID6 A;  1Q1V A;  3BTJ A;  2DA6 A;  4IHY A;  1FEX A;  3CDL A;  4JX4 A;  2ZB9 A;  5J1U A;  5JLX A;  3BT9 A;  3NAR A;  1MNM C;  2DMP A;  1MH4 A;  2M2E A;  5M3M J;  4UUS B;  1ZTR A;  5IP6 A;  1IV6 A;  3O8G A;  4XID A;  3LSJ A;  5DTD A;  4FCY A;  2EZL A;  4M6V A;  5C44 J;  4W1U A;  5EEA A;  5K7H A;  3QQA A;  2K40 A;  1ZR2 A;  1JTY A;  3A02 A;  3IH4 A;  4B1R A;  1VF9 A;  1HCR A;  1ETK A;  1POG A;  3GTP J;  4BKX A;  2HI3 A;  4V2F A;  3Q0V A;  5K7Z A;  1RET A;  5EYR A;  3BR6 A;  1ETV A;  4FTH A;  1RPW A;  4GFB A;  2W48 A;  2Y31 A;  1BL0 A;  1ZGW A;  2CUE A;  3BR0 A;  1MSF C;  3S1R J;  2TCT A;  1BA5 A;  1UHS A;  1HLV A;  2XB5 A;  3I4M J;  1ZK8 A;  1WI3 A;  4C3J J;  1GV2 A;  2CRG A;  2LK2 A;  1NK2 P;  4LOC A;  4CYC B;  2M9H A;  2ME6 A;  4L5E A;  3WHB A;  1MBE A;  1Y1W J;  1GVD A;  2ME0 A;  2X48 A;  2FD5 A;  3CCY A;  1U8B A;  2XB0 X;  3QPS A;  3K7A J;  1IRZ A;  3S17 J;  5EGO B;  2E1O A;  1U78 A;  3TW6 A;  3GTG J;  4A3D J;  2DA1 A;  2Y9Y A;  2QCO A;  5IYC J;  2EH3 A;  2MW8 A;  5M5X J;  1UG2 A;  1RES A;  4JX6 A;  1IUF A;  1TWC J;  5IOZ A;  5FKL A;  2LP0 A;  2NVX J;  4UUT A;  3BR2 A;  3HEF A;  4DZJ A;  2DJN A;  4S0H B;  2WAQ N;  5F04 A;  4I76 A;  3ZOB A;  2R92 J;  3IH2 A;  2X6O A;  1SFO J;  5K7F A;  4A3G J;  5F0F A;  1HDP A;  3MKL A;  2JA5 J;  2FJ1 A;  5F0C A;  4QIW N;  2QF7 A;  2EBI A;  3FIW A;  2JWT A;  1GT0 C;  4C3H J;  3OSG A;  1BW6 A;  3A01 A;  5C4J J;  2EZH A;  4EEF G;  2NS8 A;  5FKK A;  4HNV A;  3FK7 A;  1MH3 A;  3BG3 A;  3BR5 A;  3LSR A;  1IC8 A;  3GTK J;  3HOY J;  2XPW A;  4ABZ A;  2HXI A; 
#chains in the Genus database with same CATH topology
 3V4G A;  3VSK A;  3A01 B;  3WGH A;  5FKO A;  1YTY A;  5J6X A;  1MBK A;  3S2W A;  1PUE E;  3BR1 A;  3JTG A;  3Q0U A;  2V26 A;  3QOD A;  3KP7 A;  3RQI A;  1H88 C;  2E2J J;  4PJM A;  2MC4 A;  4BHC A;  2DQL A;  2HZD A;  2DO7 A;  2NYX A;  2VC1 A;  2VT3 A;  4G7H F;  1JT6 A;  2ELJ A;  3ASN H;  3ZMS A;  1TWH J;  4U0V A;  3TBI A;  5FKM A;  2ZXJ A;  3K2Z A;  3DEE A;  1MMA A;  4KA4 A;  2NNY A;  3TDZ C;  1LE8 A;  2CH0 A;  3JR9 A;  2HEO A;  3CC4 I;  4MGR A;  3HBL A;  2CV0 A;  2KMU A;  4AD9 A;  3JRH A;  3OR1 C;  3IKV A;  3P9K A;  2VJ5 A;  1F5T A;  3K4B A;  3JRC A;  4XRS A;  2LVS A;  3A03 A;  2FOK A;  5H6Q A;  5F6F A;  2CFO A;  2R7V A;  3PSF A;  4EGY A;  5E18 F;  1SAX A;  2DQR A;  3KIO A;  2DOE A;  1SMY F;  2QSF X;  1D1C A;  2LRE A;  1HKS A;  4D5C A;  1P7I A;  3DLL F;  2HZT A;  1XSV A;  3TOA A;  4D0P A;  2EK5 A;  4ENK A;  5F64 A;  2EFW A;  3PM1 A;  2VKD A;  2R7T A;  1IRF A;  2KRH A;  2X6Y A;  5CVV A;  1F36 A;  1Y0N A;  2DA2 A;  2JTV A;  3BJA A;  3T8R A;  2UWM A;  3J7Z I;  2QEN A;  4CCK A;  4DBR A;  2DDA A;  3P9I A;  1R7J A;  2A6E F;  4XLN F;  4M72 A;  2QBY A;  3S8P A;  5FLV A;  3EUH C;  3CMM A;  1BIA A;  1UEL B;  2QGU A;  4XON A;  4PK4 A;  3GTJ J;  3PL8 A;  1HF0 A;  1GHC A;  2CO5 A;  3G1M A;  1GXP A;  3WTX C;  2HOT A;  3M3Y J;  3ERM A;  2RNG A;  5CVI A;  3HOX J;  3SHF A;  4WF2 A;  1I1S A;  4QPQ A;  3IHU A;  2QYO A;  2RRE A;  2JN6 A;  5JI6 A;  4DW6 A;  2JA8 J;  4BJT A;  3BP8 A;  4BDY A;  1HKQ A;  1Z0X A;  2A6H F;  2NOG A;  2VJ4 A;  1OR7 A;  1H8A C;  2M7B A;  2ZFU A;  1MKM A;  2HR3 A;  3HOT A;  1MDM A;  1D5Y A;  2R7Q A;  4B4C A;  5E8G A;  1FTT A;  1O3Q A;  2W85 A;  1QVT A;  2H6B A;  1P7J A;  1UZC A;  3I58 A;  4M74 A;  3OYA A;  2W25 A;  4HX7 A;  4NQW A;  1TL8 A;  1S3J A;  3M7G A;  2LD5 A;  4B3A A;  1KU3 A;  2FSW A;  3HG9 A;  5BNG A;  3J7A Y;  4IF4 A;  2X1D A;  4U0Y A;  4A3M J;  1JHH A;  2L7Z A;  2XKO A;  3F8B A;  2J5O A;  1R9T J;  2Y30 A;  4IHV A;  1FTZ A;  1KU7 A;  3H5R A;  1KQ9 A;  3DF8 A;  4CCM A;  2IA2 A;  1H9G A;  5H20 A;  4ZDP A;  3ZQQ A;  1H0M A;  1Z77 A;  2CG4 A;  5CVU A;  3L2V A;  3BG9 A;  1RRJ A;  3K0L A;  3BY6 A;  4E4H A;  4OIN F;  2IS6 A;  4WCG A;  3RDI A;  3VFZ A;  1C0W A;  1W0T A;  1WJF A;  3QPT A;  5LGU A;  3F8M A;  3QPH A;  4O3M A;  4A3J J;  4LIV A;  5J8C A;  4J19 A;  3DPL C;  4UV9 A;  2E36 A;  2XAJ A;  5B1B H;  5K5R A;  3CDI A;  1VTN C;  2GIV A;  3BJ6 A;  3KEY A;  4E7H A;  3CCL I;  2E71 A;  4KJZ A;  3K4C A;  4WK8 F;  1IDZ A;  3KX2 A;  2IA1 A;  1ZAO A;  1B72 A;  4A5M A;  1CGP A;  2ESH A;  3BZK A;  1APL C;  5JFR A;  1H89 C;  3FF5 A;  1SC7 A;  2DMQ A;  1MBF A;  1QHG A;  2PJR B;  4AWX B;  1JUS A;  4XLP F;  2JUC A;  5IT3 A;  1IGN A;  2BEO A;  2OD5 A;  3CUQ A;  4QTR A;  4EGZ A;  4GCV A;  2HVQ A;  3HXL A;  1V5E A;  1GV5 A;  1ZRE A;  2H8R A;  5J3L A;  5BOX A;  4RBO A;  2IT0 A;  1LVK A;  3BG7 A;  2JVH A;  4AID A;  1AKH B;  3S1N J;  4PCQ A;  3E6D A;  4BQQ A;  4IHT A;  1QZE A;  3OYL A;  1ULY A;  2M1B A;  2O61 A;  1U6G A;  1VND A;  1T38 A;  1AHD P;  1W5C C;  3OYJ A;  4J01 A;  1JKR C;  4G94 A;  1VFC A;  4MFE A;  4DQ2 A;  1SFE A;  1P4A A;  1EJ9 A;  4PFO A;  2CSO A;  1Z91 A;  1JHF A;  2LLK A;  4WXC A;  1S72 I;  1BI1 A;  1MBJ A;  2BY2 A;  3GFM A;  4BXU A;  3PFI A;  1D0Y A;  3RKW A;  3LNQ A;  1YJW I;  1O57 A;  2E2I J;  1SMT A;  2AHQ A;  5DYM A;  1DU6 A;  1K78 A;  2CU7 A;  4LFU A;  1WCM J;  5HOO A;  1B6A A;  1XCV A;  4OIQ F;  2HYJ A;  2P5L C;  3GTL J;  2WAD A;  4D1Q A;  5IT9 K;  4LK1 F;  1ZR4 A;  2JUG A;  2COB A;  3F6V A;  4LJZ F;  4HNT A;  2BVL A;  3CCM I;  2JZY A;  3CCR I;  2EFQ A;  3H9J A;  3P9C A;  4BBS J;  2HPI A;  3K69 A;  4I99 C;  1HDD C;  3B02 A;  3KEQ A;  4HNU A;  4R79 A;  4HYE A;  3BQY A;  4N9I A;  2Y2Z A;  5IP9 J;  3Q5F A;  4G9Y A;  1QVU A;  2Q1Z B;  4JBA A;  2DOF A;  5ILU A;  3ERE D;  2X85 A;  1F1Z A;  2M45 A;  1Z05 A;  1D5V A;  1TWF J;  4A6D A;  5IP7 J;  3BZ6 A;  2NVY J;  2XF6 A;  3Q9S A;  3U1K A;  4KMF A;  4KN4 X;  4U87 A;  2DAO A;  3CQZ J;  5EEG A;  2K4J A;  1Y8Q B;  3KP2 A;  1E17 A;  3H1C A;  4C2M J;  4XLF A;  1JGS A;  1SVO A;  1T08 B;  5HDK A;  2BOL A;  1MGT A;  2Z9O A;  3M4O J;  4MEX F;  1R1U A;  4FIS A;  5GP9 A;  2F4I A;  5DS9 A;  3DXJ F;  1UMQ A;  1VQM I;  4FE7 A;  3MWM A;  2FQ4 A;  4JQF A;  2KP6 A;  1X1P A;  3QU6 A;  4EJT A;  5JVT A;  4PUS A;  3KLO A;  5E3M A;  1R58 A;  3LWF A;  2VXD A;  1ON1 A;  2BVM A;  3FZV A;  3V8L A;  2STT A;  3A2K A;  3ZMT A;  2CQK A;  2XC7 A;  1FZP B;  4ZZL A;  2WY8 Q;  2EJR A;  4PJL A;  2LSO A;  3DEW A;  2ZBK A;  3HRU A;  3ZGK A;  2R7O A;  4LMY A;  4FAS D;  5FD6 A;  3OS2 A;  1X1B A;  1CF7 B;  5H2F C;  3H92 A;  4XL9 A;  2Z33 A;  3E5U A;  2DMN A;  4DJA A;  2K9N A;  3I4N J;  3MEX A;  5M5Y J;  5J40 A;  1JUP A;  5JVG F;  5ICC A;  1A5J A;  5EG0 A;  4G6T B;  4LLG F;  2OF7 A;  1SVM A;  3H0G J;  3FXJ A;  2HTJ A;  3ZQH A;  4U7B A;  1U9N A;  2KJC A;  2EV5 A;  1ETO A;  4XOR A;  1STZ A;  1V3F A;  2KHM A;  4FQG A;  4LK0 F;  4HAM A;  5F27 A;  1SAN A;  1SEU A;  2EFN A;  1J75 A;  2RVC A;  2PQ8 A;  1A35 A;  2XPV A;  4HQM A;  2K3F A;  4KN7 X;  3BCA A;  3PO3 J;  1XN7 A;  2JRT A;  2E2H J;  2K9S A;  3RPU D;  2FRH A;  3OS1 A;  3EQL F;  3U21 A;  1ZN2 A;  1PDN C;  4IRI A;  3F6O A;  1D3Y A;  2F2E A;  3FIS A;  3CJR B;  3BC8 A;  3HL2 A;  2EIM H;  1WH5 A;  2RC4 A;  5BMZ A;  2JK3 A;  2P6S A;  4MLO A;  2F4O B;  4MIM A;  5GAD J;  2NVQ J;  3DPU A;  1ZRD A;  3LST A;  2V1U A;  4Y15 A;  1YQA A;  1QZZ A;  1W36 C;  3P5J A;  2E34 A;  3HIF A;  3S16 J;  1OYW A;  5DUK A;  3R0J A;  1M1E B;  2B63 J;  3B6A A;  1U2W A;  3LFK A;  1HA8 A;  3E5Q A;  2XPU A;  2ID6 A;  4UVA A;  4O5V A;  1IN6 A;  2IGO A;  3F21 A;  2DA6 A;  4HSR A;  3VEP A;  2H94 A;  3CDL A;  1EV7 A;  1X4P A;  4JX4 A;  4IHY A;  2A5W A;  2ESN A;  3NAR A;  2DMP A;  5M3M J;  1BIB A;  3JAM Z;  1MNM C;  1LQ1 A;  3O8G A;  2Z1D A;  3LSJ A;  5DTD A;  2EZL A;  1QZY A;  5C44 J;  5EEA A;  2XF7 A;  3QQA A;  1ZR2 A;  2L4M A;  2KIQ A;  3E1S A;  3ISP A;  3L09 A;  2A05 A;  1HCR A;  1Z7U A;  3GTP J;  3HKZ A;  5TJJ A;  4V2F A;  1IO2 A;  4BE1 A;  3LFU A;  1BJA A;  2GIZ A;  2FQ3 A;  4ZYE A;  1RPW A;  2RGV A;  2DFH A;  3HUG A;  3BR0 A;  4YFX F;  2GOX B;  2DK5 A;  2L9V A;  4IPA A;  4PJJ A;  1BA5 A;  1ZEL A;  4BUP A;  4HF0 A;  3DKY A;  4MQV A;  2XRO A;  2VOO A;  2I5U A;  3HSR A;  1GV2 A;  2CRG A;  3WU2 C;  5K5Q A;  3H36 A;  3OYB A;  1XB4 A;  2M9H A;  2GA1 A;  3G2B A;  2IRF G;  1O7F A;  1G8X A;  5LHH A;  4RM2 A;  3K7A J;  3KET A;  5H6R A;  1XPX A;  2DPU A;  3S17 J;  3GME A;  1U78 A;  5KAI C;  3TW6 A;  2Y9Y A;  1S8N A;  3TO7 A;  2ETH A;  3KYL A;  1YG2 A;  1R5H A;  2EH3 A;  2V79 A;  4P5O A;  1UG2 A;  1OPC A;  2FML A;  2HNH A;  1W4M A;  3GZ5 A;  3CME I;  2O3F A;  2NVX J;  2WB1 A;  2A68 F;  4UUT A;  2CYY A;  3BR2 A;  1DUX C;  1QNT A;  2WAQ N;  1XSD A;  1XD7 A;  3OYG A;  4I76 A;  1IXR C;  3PQJ A;  2BBY A;  2X6O A;  3IH2 A;  3FXR A;  1SFO J;  5B66 C;  3WTU C;  2VLA A;  1HDP A;  1T0F A;  3DTK A;  3HTU A;  1FNN A;  4QIW N;  5JHU A;  3FIW A;  2NNN A;  1KA8 A;  3VOD A;  1MMD A;  1P2F A;  3W6K B;  4KIB A;  2DBB A;  3A01 A;  4I01 A;  2BV6 A;  2IGK A;  2R3S A;  3OWT A;  5ILS A;  2NS8 A;  1V5F A;  3H0D A;  5FKK A;  4HDV A;  2DYR H;  1T0F C;  3F9K A;  2GA2 A;  2HS5 A;  4N4N B;  2VOD A;  1IC8 A;  1YI2 I;  2HXI A;  2NXN B;  2FU4 A;  3HKZ N;  1EH7 A;  3B73 A;  2EV6 A;  2MA3 A;  1BR2 A;  1T98 A;  2JJ7 A;  2R7D A;  3BTI A;  4B3X A;  2IEK A;  3TMO A;  2IP2 A;  1G4D A;  2PI0 A;  4GYG A;  2EZK A;  2YU9 J;  2ECB A;  2L3D A;  2PLY A;  2OQG A;  2AXL A;  4ZZD A;  1Y1V J;  3JRF A;  1OCO H;  2ZXW H;  3PQK A;  1L3L A;  5ERI A;  1D8J A;  2BGC A;  2VQC A;  1MND A;  2DTZ A;  2KQR A;  3F3X A;  4L9T A;  2VPR A;  4LG0 A;  1MSE C;  2X9D A;  2XAF A;  1TZL A;  2O0Y A;  1SAU A;  2ZJQ F;  1O4X A;  3GTM J;  2FBH A;  2CW0 F;  1FIA A;  1XDU A;  1U0J A;  2RAE A;  4F93 B;  3LSP A;  2VKE A;  3BPV A;  2E1C A;  2PMH A;  2DOD A;  2FNP A;  4IO9 F;  4M71 A;  3TL4 X;  3MZY A;  5LLQ A;  4C3I J;  3I5U A;  1EH8 A;  3LQR A;  4ITV A;  1K83 J;  4ZYA A;  3GCM A;  2WAE A;  3F8F A;  2WB1 N;  3ZCO A;  1JUM A;  2YS9 A;  1OCZ H;  2ZNY A;  2KRC A;  1IXC A;  4ZYD A;  3S32 A;  4EV0 A;  3P7N A;  5CVR A;  1E2X A;  1BR1 A;  2ZXI A;  3HPG A;  1FYK A;  5FRM A;  1H9T A;  2XHK A;  4XN0 A;  4N9H A;  4A6E A;  4Y7N J;  4HBL A;  3OMY A;  3L2Q A;  1TT5 B;  1X3U A;  1ETX A;  3CP8 A;  1ETW A;  4AYB A;  3A0H C;  1SFX A;  4CCN A;  4DGW B;  2XRL A;  5K5O A;  5E8I A;  4CYC A;  3RZD J;  4CZZ A;  3ABU A;  3DLA A;  3MZ8 A;  4CIC A;  2PFB A;  3VYR B;  4GRI A;  1PUF B;  1VQ8 I;  2KT0 A;  2HQ5 A;  4OIR F;  5EGO A;  2NOJ B;  4ZH4 F;  3JSO A;  5M3F J;  4BJ5 C;  1BR4 A;  5DCM B;  1TC3 C;  2Y75 A;  1IN4 A;  4P55 A;  5D4R A;  1R5I D;  1EKE A;  1OLT A;  3CES A;  3ELK A;  3FXQ A;  1XC5 A;  4M3G A;  4ESB A;  2VPL A;  3OYN A;  2GZW A;  1XMX A;  1RR7 A;  2ID3 A;  4NUB A;  2MC3 A;  1JT0 A;  1NK3 P;  2DI3 A;  4LB5 A;  4AVZ A;  2M4K A;  2R5Z B;  2V1N A;  4ZTJ A;  1ORK A;  3AG3 H;  4BAY A;  2XGX A;  1R49 A;  2A6T A;  4G7Z F;  5ILV A;  4DYR A;  3PNV A;  1EH6 A;  2L7F P;  1W0U A;  1HC8 A;  1MJA A;  2QSH X;  1DP7 P;  1SVL A;  3I71 A;  1PJR A;  4XNF A;  3L1P A;  1P92 A;  3K4J A;  1E3H A;  4XLE A;  4S05 A;  1FOY A;  3C3W A;  1NG7 A;  1TWA J;  3U2R A;  5B5E C;  1YIJ I;  2RV8 A;  2R5Y B;  1X4O A;  1TT0 A;  2CW7 A;  1WJA A;  4MFD A;  1L0O C;  4IOC F;  5EZG A;  1XMK A;  1DQU A;  1BC8 C;  2F5C A;  3A0B C;  1B4A A;  1D1A A;  3WU1 B;  1B8I A;  1DGR M;  4GYI A;  4RLF A;  2D1V A;  2QQ8 A;  1GDT A;  1YJN I;  4AYB N;  4L0Y B;  2YU3 A;  2L9N A;  4E7S A;  3B6C A;  4MEY F;  4RB2 C;  1D0X A;  1JTX A;  2VAS A;  4XR6 A;  5F0H A;  5TRD A;  4N4O B;  2NS0 A;  2P7C B;  1VI0 A;  3HRS A;  4BEH A;  2AQE A;  4YIF A;  1WQ2 A;  3CCS I;  2WY7 Q;  2E60 A;  2ISY A;  3FBN B;  1S9H A;  4F55 A;  3IRQ A;  4I2O A;  1W36 D;  1UB9 A;  2HVS A;  4L0Z B;  3KZI C;  3DTE A;  1ZKG A;  1TW2 A;  4XMY A;  4RAZ A;  4OIP F;  4RGX A;  3GYH X;  3RTR A;  3PNT A;  2N8G A;  3CJQ B;  4UV8 A;  4H0E A;  1YOV B;  2FA5 A;  1P9Q C;  5EF6 A;  3W6V A;  4UUV A;  2DA3 A;  4X1E A;  5C4X J;  3R0A A;  2B7E A;  2XUB A;  1QRY A;  4BQO A;  3RJP A;  3IH3 A;  4HA8 A;  3WTV C;  3TQN A;  2ZC2 A;  4A3E J;  5LHG A;  2CUJ A;  3ZQ7 A;  3BZC A;  2OCE A;  3VDX A;  3HSF A;  4ZYG A;  4RA2 A;  4DYC A;  4L5J A;  3KP6 A;  2QVO A;  2MLG A;  5JLW A;  5GAG J;  4XOP A;  1FYL A;  1FBQ A;  2JVG A;  1LEB A;  4W97 A;  3V42 A;  3KP5 A;  4JOM A;  1WKM A;  5KHD A;  4IJA A;  3JW4 A;  1XCB A;  2EQR A;  3ABT A;  3HGY A;  1MD0 A;  4RGU A;  1A04 A;  2HVR A;  1ZG1 A;  3BLY A;  3OL3 A;  5TIS C;  3G3Z A;  4XIC A;  4CZC A;  2KPM A;  1V5G A;  3AL0 B;  3DKW A;  5M5W J;  3NQO A;  4EM1 A;  2ADU A;  3EPZ A;  4JX5 A;  1I5Z A;  3JRG A;  2LOO A;  3WHC A;  1XSX A;  5CQE A;  1K79 A;  4RAG A;  2CQQ A;  1OR7 C;  2NVU B;  4KIF A;  4ASN A;  1RR8 C;  3HHG A;  2D45 A;  1A6I A;  1R71 A;  2X0L A;  4IL6 C;  5CYV A;  1K61 A;  1O7L A;  3CCQ I;  3V8K A;  1ZG3 A;  2D2W A;  4QSH A;  1FY7 A;  4ZTF A;  3SXY A;  4A93 J;  1LPQ A;  5IT9 Z;  3LSI A;  4RM3 A;  3VYT B;  5F1R A;  5J47 A;  1LUJ B;  4I09 A;  2Z3Y A;  2IAI A;  1JI8 A;  2DFI A;  3IRR A;  3GWZ A;  2ZCW A;  2FUG 2;  3GBG A;  1MBH A;  4A3C J;  4LIT A;  3S3M A;  4AIH A;  4EJV A;  1XG1 A;  3JRD A;  2XF5 A;  5EEH A;  4C30 A;  1CF7 A;  1DDN A;  3WTS C;  1YFH A;  1IXS B;  4BJ6 C;  2O8K A;  3HZJ A;  3RKY A;  3T8T A;  1LKX A;  3DFG A;  3K1N A;  1RZ4 A;  1YIO A;  4CDG A;  1K4S A;  1K4T A;  5JR3 A;  2W00 A;  1OCR H;  2IVM A;  4XQF A;  2PBI A;  1QBJ A;  4CCL A;  1WZ2 A;  3CMY A;  1XMA A;  1I6H J;  3D1N I;  4IZZ A;  1FOX A;  1X2N A;  2FMY A;  4I0B A;  2ZJ2 A;  5A2Q K;  3ML6 A;  3F22 A;  2QQ9 A;  4HZF A;  2P4W A;  5K1Y A;  2DA7 A;  4WX9 A;  1OFC X;  3KZY A;  3FHN A;  5E1Z B;  1G3T A;  2R7X A;  1LDD A;  3I59 A;  1UG0 A;  2DLL A;  3CMA I;  2KIF A;  3CUQ C;  4BE2 A;  4S04 A;  3TO6 A;  3J7Y J;  3QYE A;  1ZGA A;  3Q3S A;  3CCJ I;  5J4V A;  2HXO A;  3FX3 A;  2KLO A;  3I9V 2;  1PYV A;  1FBS A;  5D6F A;  2P0W A;  1RNL A;  3R6S A;  1VQN I;  1T39 A;  2CUZ A;  1VQL I;  1OJL A;  3S1M J;  2LH9 A;  4EJW A;  3A4C A;  2P6T A;  1S7E A;  3IWZ A;  3GUD A;  3WTZ A;  4KIT B;  4DYQ A;  3GO5 A;  4TV7 A;  3N05 A;  4JYK A;  4Y33 A;  4Y52 J;  3CCV I;  1ENH A;  3C1D A;  3FMQ A;  1Z1D A;  4M6Y A;  3ESW B;  1ODD A;  1YLF A;  4IRG A;  4CA0 A;  1LE8 B;  2EZI A;  2HDD A;  2HYG D;  3FXU A;  4GGG A;  3OOU A;  1FIP A;  4I6Z A;  1Q1V A;  3BTJ A;  4GO1 A;  4DIQ A;  2M7A A;  2V9V A;  2A69 F;  3NEU A;  1YS7 A;  1R00 A;  3I64 A;  3HJE A;  3BT9 A;  5JLX A;  4BQN A;  1MMG A;  1Z9C A;  2Q8K A;  3PIP F;  4KIG A;  2JSC A;  1O3S A;  1I27 A;  4UY8 I;  2FXA A;  3K4N A;  1LDK B;  3EET A;  2DK8 A;  2KDO A;  4PFP A;  2GXB A;  5CQG A;  1JTY A;  5KAF C;  3M8E A;  4B1R A;  1ETK A;  3OYH A;  3WOD F;  3Q0V A;  1VQK I;  4Y17 A;  4QWQ A;  2VBW A;  4FTH A;  3ZPL A;  4GFB A;  4B43 A;  2Y31 A;  4A0Y A;  4L9N A;  4KUM A;  4BAC A;  3A1Y A;  2CUE A;  1ZGW A;  1MSF C;  4CCO A;  2QBY B;  1V55 H;  2DT5 A;  2TCT A;  1OYI A;  2QSG X;  2F5V A;  3R60 A;  1HLV A;  1N75 A;  4OMY A;  2XB5 A;  5L3F A;  1IV8 A;  4AIK A;  1WI3 A;  2BYV E;  2HFH A;  3I55 I;  1MBE A;  1GVD A;  2HQR A;  4L9V A;  4ESF A;  4HF2 A;  4G6Q A;  4II3 A;  2XB0 X;  1QGP A;  3QPS A;  2QLZ A;  3CO6 C;  4FET A;  4PGG A;  2LF8 A;  3L9F A;  5KCM A;  2ZME A;  2QCO A;  3WGI A;  3L2C A;  2P5K A;  3TO9 A;  5M5X J;  2VKH A;  4JX6 A;  1TWC J;  1FPQ A;  5IOZ A;  2LP0 A;  2IJL A;  2RQP A;  4U0W A;  2WTE A;  3HEF A;  4DZJ A;  3FXL A;  3OYF A;  2OU2 A;  3OV8 A;  4Z2Y A;  3ZOB A;  3E5X A;  4G8X A;  1RUO A;  3GVA A;  2E5N A;  2JA2 A;  5K7F A;  5DM6 F;  4A3G J;  5F0F A;  3UNG C;  4IHS A;  1W7P A;  2P7V B;  5LEJ A;  4XSX F;  5F0C A;  3PJR A;  2EBI A;  2ZXH A;  3I3L A;  4C3H J;  3GF2 A;  5LD2 C;  3ZRG A;  3M9A A;  4Z6Y A;  3IL2 A;  4OIO F;  4HNV A;  2JRM A;  1W1W E;  3FK7 A;  3E0J B;  1MH3 A;  3BR5 A;  4MHG A;  2Y0S A;  3FMR A;  4P1W A;  3AG2 H;  2ZFW A;  3C2G A;  4RLQ A;  5HDN A;  5E3O A;  3UKG A;  1CQT A;  5HVQ C;  4D9J A;  1LFP A;  2Y9Z A;  1ZYR F;  3G6E I;  2V6E A;  2JT1 A;  4UB8 C;  3HOU J;  1OCP A;  3GXO A;  4Q47 A;  1IUY A;  3LSG A;  1WFX A;  2L0K A;  4IHW A;  2CV1 A;  1S29 A;  3LA7 A;  2P8T A;  3DU6 A;  5CKT A;  5E3L A;  1ETQ A;  4PSX A;  3ZQI A;  1B72 B;  2RDP A;  5DD4 A;  4P9U A;  5KNL A;  3SFZ A;  4ZC3 A;  3WTW C;  1TTY A;  3DU5 A;  3PUB A;  2LR8 A;  1KYZ A;  2XGC A;  1IN7 A;  1GUU A;  3GFJ A;  4XLH A;  3H9G A;  5IYB J;  1RKW A;  1B9N A;  3PUF A;  4ON0 A;  2XSJ C;  2WAQ A;  2MSY A;  3EDP A;  3BTL A;  1YRN A;  3S15 J;  3ZMU A;  2K7L A;  2FEZ A;  3T0Y A;  4PGH A;  3ULQ B;  2KFD A;  1X1D A;  2CQX A;  1QPI A;  4YG2 F;  4XKV A;  1JJ6 C;  1K6O A;  2VOP A;  5AON A;  5HDG A;  1G3W A;  2VBZ A;  3G1L A;  1XDS A;  4L9J A;  3COA C;  3ONQ A;  1FOK A;  2Y0M A;  2V9K A;  5EJC A;  4NHJ A;  2LFB A;  2VB6 A;  2LG4 A;  2XAQ A;  3BQZ A;  2EPF A;  5KK1 A;  1FX7 A;  2AS5 F;  1EF4 A;  3U1D A;  2GBY A;  3FXO A;  1ERD A;  3LSH A;  4LLN A;  2LY9 A;  2VKV A;  1VQ5 I;  2R7F A;  4FT8 A;  2IS4 A;  2LMD A;  2XGE A;  3O6B B;  1PUF A;  1NTC A;  4G7O F;  1UHM A;  3OSF A;  2UXX A;  1U5T A;  3HRT A;  3NRV A;  3RI4 A;  2C6Y A;  3K4M A;  4E6K G;  1I1G A;  3KPH A;  1G3S A;  3K2A A;  2W7N A;  5DCM A;  2M3A A;  3K10 A;  3SDG A;  2G9W A;  1BBY A;  3QOE A;  4O6J A;  2Y0S N;  5CLS A;  2DMU A;  1ON2 A;  1YHQ I;  1U5T C;  5D4S A;  2H27 A;  3MZH A;  5L3E A;  2E1M C;  2OA4 A;  2M8E A;  3JRB A;  2YX7 A;  1P4W A;  3M1C A;  5J1Y A;  3HDD A;  1AOY A;  2BXZ A;  1OIS A;  3FKI J;  3SEZ A;  5EZH A;  2BW3 B;  3DKX A;  3M8J A;  5L3D A;  1MZB A;  2OC6 A;  2DDB A;  3ZMV A;  3RZO J;  5FLX K;  1FMW A;  1T6S A;  4D7N A;  2ZJP F;  1ZH5 A;  3TED A;  1T56 A;  1O3T A;  4KFC A;  3E6M A;  3LSK A;  5DM7 F;  1ZHF A;  1YW9 A;  4BBR J;  2CV2 A;  3PSI A;  5E20 A;  5HLG A;  2ELK A;  2TDX A;  2V1D A;  1S7O A;  1LVA A;  5F08 A;  1IN8 A;  2R5Y A;  3I53 A;  3HOZ J;  9ANT A;  1R36 A;  4ZDL A;  4F52 A;  2K9M A;  3CTA A;  3W3C A;  2ZSH B;  3L2R A;  2YPR A;  1J7K A;  4DOZ A;  4CCJ A;  3FXK A;  3RCO A;  5J1R A;  2E1N A;  4Y3O A;  3EYY A;  4LB6 B;  2HOA A;  3O2P E;  2CQN A;  3BCB A;  1ZG5 A;  2XIG A;  3KLN A;  1QO0 D;  1I50 J;  3OY9 A;  2X1E A;  3MKY B;  4E7I A;  1OCT C;  3KP3 A;  3H35 A;  5DV5 A;  3LL7 A;  4I7H A;  2FX0 A;  2MFZ A;  1QQI A;  1TQP A;  1TBX A;  2MH9 A;  2XSD C;  1ETY A;  3HGG A;  2OUM A;  2M0M A;  2XAG A;  2DYS H;  5J4Y A;  1IRG A;  2LYC A;  2M8G X;  4OOI A;  2L9S A;  2UV1 A;  2BY3 A;  4HOB A;  4RAF A;  3O8H A;  4LGW A;  1G6N A;  3H9Q A;  4XM3 A;  2WV0 A;  2LY1 A;  5CPR B;  3VYU B;  2BZT A;  2GM4 A;  3DQV C;  3KZZ A;  2F4M B;  1FT9 A;  1Z21 A;  1IG7 A;  1P6R A;  2DFF A;  4DNC A;  4CHU A;  4PJN A;  3K9T A;  1EA3 A;  1Y8R B;  4A3K J;  5EG0 B;  1TQM A;  2DU9 A;  2ISZ A;  1R4N B;  1Z6R A;  1J0R A;  4IRH A;  2KKO A;  5E17 F;  2E7X A;  2LC2 A;  2M30 A;  4WXH A;  1FOW A;  3WE3 A;  4BHP A;  5HNH A;  1NG6 A;  3I0T A;  1ZGJ A;  4ANJ A;  3GFI A;  1T33 A;  3GEZ A;  1VQ6 I;  3CF2 A;  1FC3 A;  3ABL H;  3H3V K;  5L3B A;  1BN5 A;  2HGC A;  3W2W A;  4AM3 A;  1F43 A;  5LGT A;  2HKO A;  4A69 C;  3AFH A;  1J9I A;  4JK1 X;  4BNC A;  2FBI A;  1G2H A;  2L7K A;  2PMZ A;  1JKO C;  4M9Z A;  2NS7 A;  1LDJ A;  2BY1 A;  3Q9V A;  3E7L A;  2H6C A;  4BL0 B;  4XK4 A;  4OWR B;  3C7J A;  2QKM B;  2K02 A;  3R61 A;  4E70 A;  4D7M A;  3FMS A;  2WV1 A;  2V6C A;  2BE5 F;  3LA2 A;  4RMN A;  2AO9 A;  2EIL H;  3D5L A;  1R22 A;  2L9R A;  2MGQ A;  4G12 A;  4L5I A;  2GLO A;  4D5F A;  2DN0 A;  5BQT A;  1YYV A;  3BG6 A;  3LQQ A;  3VPR A;  4RDU A;  3K1P A;  3MN2 A;  4MQ9 F;  4UVB A;  2IS1 A;  1S5L C;  2LKS A;  4HX4 A;  4BH9 A;  1IN5 A;  3DP7 A;  2IXS A;  2L7M P;  3CO7 C;  1ITY A;  2OBP A;  3I4P A;  1BW5 A;  2NRA C;  1WHU A;  3SFI A;  2GXA A;  5TGT A;  4V19 K;  2MYS A;  2W1O A;  4AC0 A;  2B0L A;  3CCE I;  3IV5 A;  3J80 K;  2MG4 A;  1Z3X A;  2EFP A;  1V4R A;  3F8N A;  1UST A;  1XGO A;  5HS8 A;  3C2B A;  2Q2E B;  5LGN A;  1JE8 A;  1I39 A;  3MMY B;  2OQR A;  1PP8 F;  2W57 A;  3M1E A;  3MQ0 A;  3BTC A;  2CUF A;  2X1C A;  2L02 A;  2VT2 A;  3FBI B;  3WG9 A;  4XRF A;  1ZQ3 P;  2E1M B;  4YFN F;  2WAF A;  1LFB A;  3GZN B;  3KP4 A;  2HDC A;  3Q0W A;  5FFZ A;  3JRI A;  1BC7 C;  1ZRC A;  3CJN A;  3T1B A;  4M9X A;  5F1J A;  4A2U A;  5AIQ A;  3ZP5 A;  1FP2 A;  1VQ9 I;  4OU0 A;  2M4G A;  3LAP A;  3ECO A;  1J59 A;  2ZJR F;  2ZNZ A;  4A0X A;  2PMZ N;  2VE9 A;  1HW2 A;  4C9Y A;  3GW2 A;  2VI6 A;  3LMM A;  2CQ7 A;  2GOM A;  3MKZ A;  5FLM J;  1KZH A;  4Q48 A;  2PJR A;  3ROU A;  1LFU P;  3ZQF A;  2XGD A;  1WJC A;  3K4K A;  3DBL B;  1ZLK A;  2BY0 A;  3HM5 A;  4WWC A;  2JSP A;  2MD5 A;  1JXS A;  4AUX A;  2H8W A;  4CXF A;  3S1Q J;  1X1A A;  1AKH A;  4IX7 A;  2OTJ I;  3OIO A;  2WBM A;  4NC6 A;  1Y0U A;  2JPC A;  4BDZ A;  3QP5 A;  1R4M B;  4U7D A;  1OYY A;  2KIU A;  4CUG A;  1MJB A;  1YJ9 I;  3ZQG A;  2KL4 A;  4K2E A;  2O6G E;  4RAY A;  4UXN A;  1X3W B;  4HV6 A;  1SFK A;  4XRM A;  2K3P A;  3ZQL A;  6PAX A;  3VOE A;  2CGP A;  2L4A A;  3RPQ A;  4CH7 A;  3S3N A;  5DEQ A;  2WA0 A;  2VJI A;  4Y13 A;  2LTP A;  3SYT A;  3ZQC A;  3ABM H;  4XLA A;  1IDY A;  2X6W A;  5L3C A;  1HSJ A;  3IWF A;  1TNT A;  1SD5 A;  3J81 K;  2IS2 A;  3RPU A;  1IRX A;  3LAJ A;  3X2Q H;  2FOW A;  1K6Y A;  2PN6 A;  5IOY A;  3CF5 F;  3GLX A;  3E6B A;  4EQQ A;  5A2Q Z;  4X0G A;  3V7S A;  1GLN A;  2NAZ A;  2XDV A;  3WTT C;  5KVR A;  4LG0 B;  5FFX A;  3GTO J;  2DXI A;  2VBX A;  3C2H A;  3LA3 A;  1FEX A;  1IZ1 A;  2ZB9 A;  2OZU A;  2YX4 A;  2EWN A;  1R6R A;  4UUS B;  1WJB A;  3EUH A;  4NC8 A;  3RYR A;  4XID A;  4FCY A;  4M6V A;  5DCF A;  4ZYH A;  3FHZ A;  1WJD A;  1HBX G;  1WI9 A;  4N0B A;  3V7R A;  5ICE A;  3A02 A;  4ENJ A;  1VF9 A;  2M5W A;  3E3V A;  3DTI A;  4BKX A;  5K7Z A;  1G59 A;  1RET A;  2QZ8 A;  5EYR A;  4HLY A;  1E0E A;  4YEJ A;  1WVR A;  2L2O A;  4F92 B;  3OYE A;  3N97 A;  1FSE A;  1Z67 A;  3TGN A;  1FYM A;  3S1R J;  2ICW G;  1WJE A;  4F3Q A;  2R7R A;  1UHS A;  3JSP A;  4MTD A;  1UHW A;  4NBQ A;  3I4M J;  3FDY A;  1ZK8 A;  5D6E A;  4C3J J;  4BHB A;  1FBU A;  2PEX A;  4BU2 A;  4CYC B;  1Y1W J;  5IY5 H;  3WHB A;  1F9N A;  4L5E A;  3IP4 B;  4R1H A;  5JHF A;  2X48 A;  3IC7 A;  3HOS A;  4Q4Z F;  1IRZ A;  1LJ9 A;  2HU9 A;  3DBR B;  5EGO B;  2XVC A;  3SZG A;  3GTG J;  2F6C A;  5E79 C;  1MIJ A;  3SEQ A;  4XOT A;  1REP C;  1QHH D;  1NHA A;  1RES A;  2PMU A;  3IUO A;  2EA2 A;  2UUZ A;  2IGN A;  3RSN A;  2QEX I;  3MD2 A;  2KRF A;  4XSZ F;  1HW1 A;  2DW4 A;  2RNJ A;  5GAH J;  5CJ9 A;  1XX5 A;  3VB2 A;  2VQH A;  3DV8 A;  2FBK A;  3U9G A;  2DJN A;  2QQB A;  3CZ6 A;  1J2X A;  3SQN A;  3REO A;  1R5G A;  5F04 A;  1K7A A;  2R92 J;  4RB0 A;  4LIU A;  2LKP A;  4KDP A;  3RYP A;  4HEA 2;  1D1B A;  5GTI C;  3MKL A;  2FJ1 A;  1WWX A;  2QKL B;  2O5R A;  5LRS A;  1GT0 C;  1SD4 A;  3OSG A;  5C4J J;  1N78 A;  1RC9 A;  2X6X A;  3I56 I;  2Z5U A;  2ZKZ A;  3BG3 A;  3GTK J;  1BOB A;  2XPW A;  3HOY J;  2MAB A;  2LBF B;  4KMU X;  1V54 H;  3QYF A;  2VE8 A;  4HF1 A;  4PSW A;  1UFM A;  4M73 A;  5E3N A;  1SFU A;  2HTS A;  2VBY A;  5DDG A;  5IPA A;  3DCF A;  3QYB A;  3RKQ A;  1NH3 A;  2YSR A;  1T2K A;  1BM9 A;  4FE4 A;  4YFK F;  1ONV A;  4ESJ A;  1B8I B;  1MMS A;  2JPB A;  4YIR X;  2WWY A;  5FRN A;  4IEJ A;  3OYC A;  4B09 A;  4AVP A;  2V9P A;  2KDZ A;  4EJO A;  5D8K B;  1Z6T A;  4XLC A;  5D5V B;  2IGM A;  4RS8 A;  4AU7 A;  1YO5 C;  4L18 B;  3FK6 A;  5FRO A;  4G6D A;  1XS9 A;  5DUI A;  2H1L A;  2L5Q A;  1A36 A;  2A07 F;  1J5Y A;  4A3B J;  4OAY A;  2HOS A;  4BEH B;  1HQC A;  2KZG A;  5D5X B;  2H09 A;  3CLO A;  2FNA A;  4KIC A;  3G71 I;  5J8F A;  1JJ8 C;  1U9O A;  4YEL A;  1X2M A;  4FX0 A;  2YUS A;  3S2H J;  4BXX J;  2RQQ A;  2GQQ A;  4M3D A;  3BG5 A;  2KIM A;  4HG2 A;  1AU7 A;  3HOV J;  5ICG A;  2XKP A;  1FP1 D;  1WPK A;  3OL4 A;  3JRE A;  3ZN0 A;  3S14 J;  1BI2 A;  2COM A;  4IHX A;  1AA7 A;  4OAZ A;  3PO2 J;  4C2U A;  4X6A J;  2MD0 A;  1O3R A;  2A61 A;  4ZDO A;  3MFK A;  4ENN A;  3HYI A;  4HQE A;  1FWZ A;  1GXQ A;  2RKH A;  3EUA A;  3HC7 A;  4B47 A;  2K85 A;  5ED4 A;  2VUM J;  2E19 A;  4A5N A;  5GPA A;  2OPT A;  3OYM A;  1JKQ C;  4KYW A;  3KFW X;  2M34 A;  2VL8 A;  5LBQ A;  2R7S A;  2DCE A;  2VQL A;  3CUO A;  4UNO A;  2EIJ H;  2L54 A;  2V4J C;  2BW3 A;  5E1X A;  1N25 A;  1LEA A;  1WGX A;  3OS0 A;  2AXT C;  4GDF A;  1D0Z A;  4P96 A;  3W2A A;  4I02 A;  1PVE A;  4CGZ A;  2IBD A;  3QPL A;  4WXD A;  1AWC A;  3DPT A;  3VYS B;  2QQA A;  1ZRF A;  3W6J B;  4BS9 A;  3H3Z A;  4V2G A;  5E1W A;  2CS3 A;  2OTL I;  2F48 A;  1MDM B;  4F91 B;  2ECC A;  3TP0 A;  3ZN1 A;  1HST A;  1A31 A;  2FE3 A;  3OR2 C;  2CW8 A;  3IKT A;  1YS6 A;  1RI7 A;  3VWB A;  2JA6 J;  2XAU A;  2E7W A;  3VSL A;  3MAJ A;  1Y6I A;  2B9S A;  3ASO H;  1XGS A;  1VZ0 A;  2K9L A;  2M87 A;  2ZME C;  4NQW B;  4BQA A;  3F72 A;  3G4S I;  2H1K A;  4BY1 J;  3CD6 I;  2VJJ A;  4DZP A;  2CMP A;  1I3Q J;  4UHT A;  4MNU A;  3K70 C;  1D8K A;  2X51 A;  1XTA A;  3ZMZ A;  1RKT A;  4KT6 A;  5LEK A;  3V7C A;  1R1T A;  1UAA A;  2QM3 A;  2KZV A;  3GX4 X;  2HQA A;  4BE0 A;  2G0E A;  1BJZ A;  4LD5 A;  4PDK A;  2IPQ X;  3PIO F;  1KU2 A;  2A5Y B;  4RB3 C;  1J09 A;  3BDD A;  4QPO A;  3F0C A;  2HKX A;  4J00 A;  4LLL A;  1SD7 A;  4H4K C;  2R7U A;  2P81 A;  1A6Q A;  3NWT A;  1MMN A;  3CJT B;  1N77 A;  2R7W A;  5IYD J;  4IVN A;  4QLC U;  5HS7 A;  4RGS A;  5BPD A;  2IW5 A;  4XBF A;  1IAW A;  2K9Q A;  3H5N A;  2XV4 S;  2GXG A;  3WE2 A;  2HWV A;  1BOA A;  1RUN A;  2R4G A;  4U88 A;  5FLX Z;  4Q5S F;  2G7U A;  3D5R C;  2R0Q C;  2MH2 A;  5HLH A;  1UJ8 A;  1IJW C;  3H5A A;  4YII A;  3FWE A;  5CVJ A;  4CYD A;  2GAU A;  4EJU A;  5ICF A;  4M3B A;  1OCC H;  3MVP A;  2O03 A;  2Y69 H;  2OZ6 A;  4NC7 A;  2V7F A;  1Z3Y A;  3OIQ A;  4KIS A;  3QP6 A;  3CUQ B;  3HOW J;  1DU0 A;  4LG3 A;  2I10 A;  3IAM 2;  4HW0 A;  2DFE A;  1BI0 A;  4MO7 A;  2W24 A;  3KYD B;  3I59 B;  1S6L A;  3FM5 A;  3BWG A;  5FKN A;  1KU9 A;  5B3S H;  1MBG A;  4XN3 A;  1B1B A;  3ZXS A;  4AIJ A;  1TQI A;  4I0A A;  3HTS B;  4EM2 A;  1FJL A;  3CP2 A;  3G1O A;  4A3L J;  5FJ8 J;  1X19 A;  3JTH A;  4Y4R A;  1TW3 A;  1R1V A;  3CCU I;  2BHZ A;  4A12 A;  2BHY A;  3H3U A;  1HKT A;  1Y56 A;  5FB2 A;  2CJJ A;  4ETS A;  1E3P A;  3PNY A;  1YW8 A;  2Y48 A;  2MBF A;  2EIN H;  2TRT A;  2EFO A;  2DA5 A;  2D5V A;  2P5V A;  4DBQ A;  2F5F A;  3UR3 C;  2W84 A;  2QUF A;  3L2U A;  1TNS A;  4B8X A;  2DPD A;  1HOM A;  3R4K A;  3G73 A;  1DPR A;  3DWL E;  3V8J A;  2OCC H;  2HPM A;  2EA4 A;  4M3F A;  4M3E A;  2O7O A;  4IQ4 A;  3T5X A;  1QA6 A;  3M8F A;  2K5C A;  4UVC A;  1WRJ A;  1K78 B;  4HPQ A;  2WC2 A;  3SZT A;  1BI3 A;  1JKP C;  4CO8 A;  2LKX A;  4IQJ A;  1I3A A;  3OYI A;  5GPC A;  3L2W A;  3KE2 A;  3OOP A;  1Y39 A;  2NVT J;  3HB9 A;  5C3E J;  2O9L A;  1P4X A;  2DJI A;  3S93 A;  4E7Z A;  4FHT A;  4A3F J;  3S3O A;  3K6G A;  2Q2E A;  1XGM A;  2XAS A;  4C2T A;  2R93 J;  1B59 A;  1LB2 A;  4XKC A;  2KIS A;  2Z99 A;  2HYF A;  3DBH B;  2VON A;  4ENM A;  4IXA A;  2R5Z A;  3BR3 A;  1MW7 A;  4F7Z A;  4EVI A;  2JA7 J;  3J7A O;  4E7K A;  2OAZ A;  3C18 A;  4RGR A;  4XRS G;  5D5W B;  3QWL A;  5FD5 A;  1E3O C;  4PJ0 C;  3AG4 H;  4IOA F;  3FXM A;  1S7A A;  2HDW A;  4E7J A;  5D8L B;  2W4S A;  3NAU A;  1YX3 A;  3RQ4 A;  3TDU C;  4BYY A;  3JRA A;  2JQ7 A;  2L01 A;  4YRV A;  3QU3 A;  1ZAR A;  3HRM A;  4HV5 A;  5HOD A;  3M07 A;  1KYW A;  1IF1 A;  2J5P A;  5FO5 A;  2CFX A;  3BPX A;  1KQ0 A;  5DD8 A;  1G3Y A;  4I98 B;  1LNW A;  2HOE A;  3ZR8 X;  1VQP I;  4HX8 A;  1RIO H;  2UXN A;  3D0S A;  1WH7 A;  3E97 A;  1X58 A;  4EM0 B;  3WGG A;  2Q0O A;  1YE9 A;  3SDB A;  1W5S A;  3LOC A;  4JP0 A;  3I54 A;  3J80 Z;  2ZME B;  5LFA A;  2DA4 A;  2HQN A;  1DGW Y;  1T95 A;  3TW7 A;  4NNJ A;  5FGM A;  3K1M A;  5L3G A;  4XKW A;  1KQ8 A;  1UCR A;  2QA4 I;  2K4B A;  3F8C A;  4A3I J;  1VQ4 I;  2M0C A;  4ZJZ A;  5EDN A;  2BXY A;  2MLK A;  1HW5 A;  2Z16 A;  2A3S A;  3GLL A;  2LDU A;  1Z7L A;  2K86 A;  2OV7 A;  3IAS 2;  1U3E M;  1OKR A;  3JCU C;  1FLI A;  2I8D A;  2EV0 A;  3CC7 I;  3L7W A;  2D1H A;  4BXF A;  4BGD A;  4KNY A;  2LRD A;  2VIX A;  1W7P B;  3K4L A;  3E6C C;  2ACJ A;  1TP4 A;  3KEO A;  2RN7 A;  3BRO A;  3BOQ A;  2R7Z J;  2DT7 B;  3GTQ J;  3JAM K;  1DP3 A;  1I6X A;  3FKJ A;  2LY2 A;  2CWE A;  1GVJ A;  5BPI A;  3SZP A;  2DMT A;  5GAE J;  3BJO A;  1X3Z B;  3GZ6 A;  2LNB A;  3WG7 H;  2VXZ A;  3FM3 A;  1KON A;  4HRI A;  2IA0 A;  2GWR A;  4OMZ A;  1XGN A;  3HPH A;  2UZK A;  1ZLJ A;  3HSE A;  4R8H A;  3DEU A;  5BS6 A;  1KGS A;  2XRN A;  5LRR A;  1TWG J;  1Q1H A;  3OYD A;  3CDH A;  4BY7 J;  3SJM A;  4PZJ A;  1ACI A;  4HLX A;  1W5T A;  2STW A;  3S2D J;  1JGG A;  3WTY C;  3GFL A;  3QAH A;  2DOA A;  2W82 A;  1OQY A;  1YX5 A;  3TP3 A;  4NDL A;  4UUS A;  2V1X A;  4HST A;  1USS A;  2JMW A;  3WU0 A;  3HHH A;  3OIP A;  1U8R A;  4FX4 A;  1TLH B;  5J1U A;  1YRN B;  2M2E A;  1MH4 A;  1IV6 A;  1QPM A;  1ZTR A;  2Z2S B;  5IP6 A;  3RKX A;  1T8I A;  2ELH A;  4W1U A;  4EAT A;  5K7H A;  1MNE A;  2F5E A;  2K27 A;  2K40 A;  3PFY A;  2ZO4 A;  3EUK L;  1WJ5 A;  2AQF A;  2EIK H;  3IH4 A;  4NB5 A;  3AL0 C;  1YIT I;  4XKB A;  4M6X A;  1POG A;  3TKY A;  1FSH A;  2HI3 A;  3F23 A;  3BR6 A;  4II2 A;  1ETV A;  2OJE D;  3AKZ A;  2W48 A;  1BL0 A;  1DPU A;  2EB7 A;  3D5S C;  3ECH A;  3MKW B;  3AAF A;  1QU3 A;  5AIP A;  2X4H A;  3KYC B;  2KJB A;  3MCZ A;  3TOB A;  1B9M A;  3J81 Z;  4A0Z A;  3W2V A;  3L00 A;  3O3K A;  1U5T B;  2LK2 A;  3HUG B;  1NK2 P;  4LOC A;  2ME6 A;  3NWS A;  3K70 D;  1MJ9 A;  2ME0 A;  3QOP A;  2FD5 A;  3CCY A;  2LF7 A;  1PP7 U;  1U8B A;  2DTR A;  2VQG A;  4UB6 C;  2O8X A;  5B1A H;  2XAH A;  2VC0 A;  1VQ7 I;  1R23 A;  2E1O A;  3KCC A;  1YW7 A;  4A3D J;  2DA1 A;  1VQO I;  3EYI A;  5IYC J;  3AG1 H;  2PG4 A;  4KT5 C;  2VN2 A;  2MW8 A;  1W7P D;  4P9F A;  1IUF A;  2PJP A;  2E5Z A;  2PX9 A;  1FMV A;  4IKF A;  5FKL A;  2DT6 A;  5HS9 A;  4CSW A;  1HXD A;  3LSM A;  3N4M A;  2FF4 A;  3QRF F;  5LHI A;  4S0H B;  2QWW A;  5HLT A;  3OYK A;  4GXO A;  3RIR A;  4EMS A;  5D5U B;  4HDU A;  4M9S A;  2YR2 A;  3ZMD A;  3CC2 I;  1SD6 A;  5HLI A;  2JA5 J;  1OMI A;  2QF7 A;  3CLQ A;  1WSU A;  2JWT A;  4RB1 A;  2LBF A;  4B48 A;  1BW6 A;  2F5D A;  3ABK H;  4B44 A;  4MTE A;  1X1C A;  2E35 A;  2EZH A;  4EEF G;  2ZSI B;  1F4K A;  2G7H A;  3LSR A;  5HNF A;  4ABZ A;  1IW7 F;  4E7L A;  5GTH C; 
#chains in the Genus database with same CATH homology
 3HKZ N;  3A01 B;  5FKO A;  1CQT A;  3UKG A;  5E3O A;  5E3N A;  1MBK A;  2JJ7 A;  3BR1 A;  3BTI A;  2Y9Z A;  3Q0U A;  2IEK A;  5IPA A;  3DCF A;  3RQI A;  3RKQ A;  1H88 C;  2E2J J;  3HOU J;  1OCP A;  2EZK A;  2YU9 J;  3LSG A;  2ECB A;  2L0K A;  4IHW A;  4FE4 A;  1B8I B;  1JT6 A;  1Y1V J;  3JRF A;  4IEJ A;  1TWH J;  5E3L A;  1ETQ A;  3ZQI A;  5FKM A;  1B72 B;  2KDZ A;  1LE8 A;  3FK6 A;  3JR9 A;  2DTZ A;  1XS9 A;  3HBL A;  1MSE C;  2LR8 A;  2VPR A;  3JRH A;  2X9D A;  2XGC A;  1GUU A;  5IYB J;  1RKW A;  3JRC A;  4XRS A;  2LVS A;  3A03 A;  1O4X A;  2HOS A;  3GTM J;  4A3B J;  1FIA A;  2MSY A;  2RAE A;  3BTL A;  1YRN A;  3S15 J;  3LSP A;  2VKE A;  1JJ8 C;  4D5C A;  1U9O A;  2CQX A;  1P7I A;  1QPI A;  1X2M A;  1JJ6 C;  2YUS A;  3S2H J;  4BXX J;  4M3D A;  4C3I J;  3PM1 A;  3G1L A;  3BG5 A;  1K83 J;  1AU7 A;  3HOV J;  2WB1 N;  1F36 A;  2DA2 A;  1JUM A;  1WPK A;  2LFB A;  2YS9 A;  3JRE A;  3S14 J;  3BQZ A;  4IHX A;  1EF4 A;  3PO2 J;  2GBY A;  4X6A J;  5FLV A;  2LY9 A;  2VKV A;  2XGE A;  3GTJ J;  4Y7N J;  1HF0 A;  1PUF A;  2VUM J;  1NTC A;  3G1M A;  2E19 A;  1ETX A;  5GPA A;  1ETW A;  2OPT A;  3OSF A;  2HOT A;  3M3Y J;  1JKQ C;  2XRL A;  4CYC A;  2M34 A;  3HOX J;  3RZD J;  3K2A A;  3SDG A;  2Y0S N;  2DMU A;  2JN6 A;  1PUF B;  2KT0 A;  4DW6 A;  2JA8 J;  2HQ5 A;  5EGO A;  1WGX A;  1Z0X A;  2NOG A;  5M3F J;  1H8A C;  3JRB A;  1TC3 C;  1D5Y A;  5J1Y A;  3HDD A;  4B4C A;  2IBD A;  3QPL A;  4M3G A;  1FTT A;  1XC5 A;  1QVT A;  3FKI J;  5EZH A;  1P7J A;  1RR7 A;  2ID3 A;  1JT0 A;  1NK3 P;  2LD5 A;  4V2G A;  3RZO J;  4B3A A;  4D7N A;  5BNG A;  3TED A;  1T56 A;  2ECC A;  3TP0 A;  2R5Z B;  4A3M J;  2JA6 J;  1ORK A;  2L7Z A;  4BBR J;  1R9T J;  4IHV A;  2Y30 A;  1FTZ A;  2ELK A;  5F08 A;  2H1K A;  4DYR A;  2R5Y A;  4BY1 J;  2L7F P;  1W0U A;  9ANT A;  3HOZ J;  4DZP A;  1I3Q J;  1Z77 A;  3L1P A;  1RKT A;  5J1R A;  2HOA A;  3BG9 A;  1TWA J;  2R5Y B;  1I50 J;  1BJZ A;  2G0E A;  1W0T A;  1OCT C;  4MFD A;  3F0C A;  2FX0 A;  5EZG A;  4A3J J;  4J19 A;  2P81 A;  2XSD C;  1ETY A;  3HGG A;  5IYD J;  2M8G X;  1B8I A;  2K9Q A;  1IDZ A;  3O8H A;  1B72 A;  1GDT A;  4AYB N;  1APL C;  1H89 C;  2R0Q C;  2DMQ A;  1MBF A;  3B6C A;  1JUS A;  1JTX A;  1IGN A;  2GM4 A;  5F0H A;  4QTR A;  1IJW C;  1IG7 A;  1VI0 A;  4A3K J;  5EG0 B;  4M3B A;  1GV5 A;  2H8R A;  3MVP A;  5J3L A;  4RBO A;  1AKH B;  3HOW J;  3S1N J;  1ZKG A;  1DU0 A;  2I10 A;  4MO7 A;  1VND A;  1T33 A;  2N8G A;  5FKN A;  3H3V K;  1MBG A;  1AHD P;  1JKR C;  1FJL A;  3W6V A;  5EF6 A;  1VFC A;  3G1O A;  4A3L J;  1F43 A;  4MFE A;  2DA3 A;  4X1E A;  4A69 C;  5FJ8 J;  5C4X J;  2CJJ A;  1QRY A;  1G2H A;  2LLK A;  3IH3 A;  2TRT A;  1JKO C;  2DA5 A;  2NS7 A;  2D5V A;  1MBJ A;  4A3E J;  3E7L A;  3LNQ A;  4XK4 A;  2E2I J;  2AHQ A;  1HOM A;  1DU6 A;  2CU7 A;  4D7M A;  1WCM J;  2WV1 A;  4DYC A;  2AO9 A;  4M3F A;  2HYJ A;  4G12 A;  2L9R A;  2MGQ A;  2O7O A;  4M3E A;  3GTL J;  5JLW A;  2GLO A;  4D5F A;  1ZR4 A;  2DN0 A;  2COB A;  4W97 A;  3VPR A;  4RDU A;  3MN2 A;  2EQR A;  3HGY A;  1JKP C;  2LKX A;  5GPC A;  4BBS J;  2NVT J;  3HB9 A;  5C3E J;  2O9L A;  4XIC A;  1HDD C;  2L7M P;  1ITY A;  1BW5 A;  3SFI A;  4A3F J;  3BQY A;  2Y2Z A;  4AC0 A;  5IP9 J;  5M5W J;  2R93 J;  3IV5 A;  1QVU A;  4JX5 A;  2MG4 A;  3JRG A;  3WHC A;  2R5Z A;  3BR3 A;  1TWF J;  5IP7 J;  2NVY J;  2JA7 J;  2CQQ A;  3C2B A;  3CQZ J;  4XRS G;  1E3O C;  4C2M J;  1A6I A;  1K61 A;  3BTC A;  2CUF A;  3NAU A;  3M4O J;  3JRA A;  1ZQ3 P;  4FIS A;  5GP9 A;  1LFB A;  4QSH A;  5DS9 A;  1UMQ A;  3Q0W A;  4FE7 A;  4A93 J;  3JRI A;  5HOD A;  2FQ4 A;  2IAI A;  5F1J A;  3GBG A;  1MBH A;  5E3M A;  4A3C J;  1XG1 A;  3JRD A;  2O8K A;  2PMZ N;  1WH7 A;  1X58 A;  2VI6 A;  3DEW A;  3LOC A;  4JP0 A;  5FLM J;  2DA4 A;  1LFU P;  3ZQF A;  2DMN A;  2XGD A;  3TW7 A;  2K9N A;  3I4N J;  3HM5 A;  5M5Y J;  3CMY A;  4A3I J;  1JUP A;  3D1N I;  2M0C A;  5EDN A;  1I6H J;  1A5J A;  5EG0 A;  2OF7 A;  3H0G J;  3ZQH A;  1X2N A;  4AUX A;  1U9N A;  3S1Q J;  1ETO A;  1AKH A;  2DA7 A;  1OFC X;  3OIO A;  5F27 A;  1SAN A;  2R7Z J;  3GTQ J;  2DMT A;  3ZQG A;  2XPV A;  1YRN B;  3PO3 J;  3Q3S A;  2HXO A;  2E2H J;  4XRM A;  2K9S A;  3ZQL A;  3FIS A;  1TWG J;  1WH5 A;  1OJL A;  2LTP A;  3S1M J;  3ZQC A;  2JK3 A;  4BY7 J;  1S7E A;  1IDY A;  3SJM A;  4MLO A;  4DYQ A;  4MIM A;  4JYK A;  4Y52 J;  2NVQ J;  1ENH A;  3S2D J;  1JGG A;  5IOY A;  1LE8 B;  4UUS A;  3TP3 A;  2EZI A;  4NDL A;  2HDD A;  3S16 J;  2B63 J;  3B6A A;  2JMW A;  3OOU A;  1FIP A;  3GTO J;  4I6Z A;  2XPU A;  2ID6 A;  1Q1V A;  3BTJ A;  2DA6 A;  4IHY A;  1FEX A;  3CDL A;  4JX4 A;  2ZB9 A;  5J1U A;  5JLX A;  3BT9 A;  3NAR A;  1MNM C;  2DMP A;  1MH4 A;  2M2E A;  5M3M J;  4UUS B;  1ZTR A;  5IP6 A;  1IV6 A;  3O8G A;  4XID A;  3LSJ A;  5DTD A;  4FCY A;  2EZL A;  4M6V A;  5C44 J;  4W1U A;  5EEA A;  5K7H A;  3QQA A;  2K40 A;  1ZR2 A;  1JTY A;  3A02 A;  3IH4 A;  4B1R A;  1VF9 A;  1HCR A;  1ETK A;  1POG A;  3GTP J;  4BKX A;  2HI3 A;  4V2F A;  3Q0V A;  5K7Z A;  1RET A;  5EYR A;  3BR6 A;  1ETV A;  4FTH A;  1RPW A;  4GFB A;  2W48 A;  2Y31 A;  1BL0 A;  1ZGW A;  2CUE A;  3BR0 A;  1MSF C;  3S1R J;  2TCT A;  1BA5 A;  1UHS A;  1HLV A;  2XB5 A;  3I4M J;  1ZK8 A;  1WI3 A;  4C3J J;  1GV2 A;  2CRG A;  2LK2 A;  1NK2 P;  4LOC A;  4CYC B;  2M9H A;  2ME6 A;  4L5E A;  3WHB A;  1MBE A;  1Y1W J;  1GVD A;  2ME0 A;  2X48 A;  2FD5 A;  3CCY A;  1U8B A;  2XB0 X;  3QPS A;  3K7A J;  1IRZ A;  3S17 J;  5EGO B;  2E1O A;  1U78 A;  3TW6 A;  3GTG J;  4A3D J;  2DA1 A;  2Y9Y A;  2QCO A;  5IYC J;  2EH3 A;  2MW8 A;  5M5X J;  1UG2 A;  1RES A;  4JX6 A;  1IUF A;  1TWC J;  5IOZ A;  5FKL A;  2LP0 A;  2NVX J;  4UUT A;  3BR2 A;  3HEF A;  4DZJ A;  2DJN A;  4S0H B;  2WAQ N;  5F04 A;  4I76 A;  3ZOB A;  2R92 J;  3IH2 A;  2X6O A;  1SFO J;  5K7F A;  4A3G J;  5F0F A;  1HDP A;  3MKL A;  2JA5 J;  2FJ1 A;  5F0C A;  4QIW N;  2QF7 A;  2EBI A;  3FIW A;  2JWT A;  1GT0 C;  4C3H J;  3OSG A;  1BW6 A;  3A01 A;  5C4J J;  2EZH A;  4EEF G;  2NS8 A;  5FKK A;  4HNV A;  3FK7 A;  1MH3 A;  3BG3 A;  3BR5 A;  3LSR A;  1IC8 A;  3GTK J;  3HOY J;  2XPW A;  4ABZ A;  2HXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...