3I4MJ

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3i4mJ00
5E3OA 4M3FA 1MSFC 2DA4A 2AHQA 5K7FA 3MN2A 1JJ6C 4D5FA 1JUPA 2XPVA 5IYCJ 1MBEA 3JR9A 4M3EA 1D5YA 2DMTA 2VKEA 2HDDA 4XICA 2FX0A 1WPKA 3HKZN 3UKGA 1GDTA 2XGEA 1A6IA 3GBGA 2DA7A 2LKXA 3JREA 2ECCA 4MIMA 3LSPA 1E3OC 1IDYA 2ELKA 4DW6A 2G0EA 3GTKJ 5E3NA 2LVSA 2E2HJ 5EGOB 4J19A 2X9DA 4D7NA 3JRDA 4C2MJ 3MKLA 1K83J 3NAUA 1GV5A 2X48A 2JA7J 3JRFA 2DN0A 2NVXJ 2YS9A 2JMWA 1FTTA 5EGOA 1QVTA 2GBYA 5M5YJ 3GTOJ 3S1QJ 2MG4A 5FKNA 1QPIA 3RQIA 3S2DJ 2LP0A 3HGYA 4UUSA 2TCTA 3DEWA 2R7ZJ 2EZIA 2LD5A 1TWCJ 2VI6A 1X2NA 2ID3A 2HYJA 3HBLA 5FKMA 3W6VA 1T33A 5F04A 1VI0A 2B63J 2VUMJ 2AO9A 4UUTA 3ZOBA 2JA5J 2K9SA 1VNDA 1U78A 2DJNA 2LR8A 3F0CA 3BR2A 1H89C 5GPAA 4FCYA 1RR7A 5FLMJ 4W97A 2M2EA 3IV5A 1I6HJ 1JUMA 1AKHB 3A03A 4DYRA 3ZQFA 1MBGA 2L7FP 1MH3A 1UMQA 2XGCA 1U8BA 2JA8J 4B4CA 1RETA 1AKHA 1FEXA 2LLKA 2EBIA 5BNGA 1ETKA 2DMQA 2OF7A 5EG0B 3CCYA 1WH7A 1OCPA 1HLVA 2COBA 5JLWA 3LSGA 2GLOA 2K9NA 2O7OA 3RKQA 5EG0A 1MH4A 1JKQC 3HOWJ 4BY7J 1MSEC 3CMYA 1F43A 1TWAJ 3GTLJ 3Q0VA 4B1RA 1AHDP 1X58A 3BT9A 3FK6A 1ZQ3P 1OFCX 1U9NA 4A3GJ 4BXXJ 2X6OA 3JRIA 5M5XJ 2M8GX 4QTRA 2O9LA 1WH5A 2DTZA 1IJWC 1RKWA 4Y52J 1IC8A 3S1RJ 3HOZJ 2K9QA 2E1OA 4Y7NJ 1FIAA 5E3LA 3PO2J 1LFUP 4A3KJ 2YU9J 3GTQJ 2M0CA 5F0CA 1ITYA 2PMZN 2OPTA 4W1UA 2ME0A 1ORKA 2D5VA 4IHXA 4JYKA 1Y1WJ 5M3FJ 3A02A 4D7MA 2R0QC 1EF4A 4V2GA 3GTPJ 3TEDA 4JX4A 4M3DA 3BQYA 3OIOA 3M3YJ 2MSYA 3LSJA 2TRTA 4G12A 4L5EA 3K2AA 3HB9A 2R92J 4A3EJ 1ZTRA 1MBKA 5C4JJ 1MNMC 3ZQGA 1F36A 4I6ZA 1ZKGA 3BG3A 2CRGA 2HOSA 3Q0WA 2NVYJ 1LFBA 2N8GA 2ECBA 1ENHA 4CYCB 1APLC 1GVDA 4QIWN 2W48A 5J1UA 2VKVA 1SFOJ 4ABZA 1BA5A 3PO3J 1IV6A 2EZKA 2CJJA 5J3LA 4UUSB 2HXIA 3HEFA 3QPLA 1Z0XA 2K40A 2KT0A 5HODA 1GT0C 4B3AA 4CYCA 3DCFA 2Y2ZA 1BW5A 1HDPA 2E2IJ 1BJZA 3JRAA 5K7ZA 1SANA 4A3FJ 1Z77A 5GP9A 3JRBA 2KDZA 2FJ1A 2EQRA 5J1RA 2EH3A 3FKIJ 3TP0A 3FIWA 1PUFB 2NVQJ 4M6VA 3LOCA 1HCRA 4V2FA 4RBOA 3SDGA 3H0GJ 1I50J 4DYQA 3BTCA 3GTJJ 2WV1A 4X1EA 5IYDJ 5F1JA 2IBDA 2JWTA 5IP6A 1PUFA 3JRGA 2L7ZA 5IOZA 2LY9A 4AUXA 2ID6A 3G1LA 4JX5A 1JTXA 1JTYA 3HM5A 1XC5A 4FE4A 1CQTA 4X6AJ 2M9HA 3BQZA 4EEFG 1ZR4A 1Q1VA 2Y31A 4C3JJ 2DA3A 1UHSA 4A93J 1NK2P 1JKOC 3IH2A 3MVPA 1IUFA 2Y0SN 4D5CA 3SJMA 2WAQN 4XRSG 5FJ8J 3HOVJ 1DU6A 2IEKA 1AU7A 3HOUJ 4AYBN 3BR3A 4MFDA 4BY1J 1TWHJ 1VF9A 2LTPA 3TP3A 3C2BA 3TW7A 3BR6A 3S1NJ 3S17J 3S16J 2O8KA 4IHYA 4LOCA 1NTCA 1FTZA 5EDNA 4RDUA 2ME6A 4GFBA 1WCMJ 3WHCA 3ZQLA 4DYCA 2EZHA 4QSHA 5GPCA 1H8AC 1S7EA 2XPWA 2MGQA 5M5WJ 3IH3A 2LK2A 3B6AA 3K7AJ 2FQ4A 1B8IB 3JRHA 1LE8B 1YRNA 4BBRJ 1HDDC 3HOYJ 1A5JA 4A3CJ 5C44J 5F0FA 1B8IA 5IP9J 3SFIA 1FIPA 3RZOJ 2HI3A 4XIDA 3TW6A 1MBFA 3NARA 1W0TA 1LE8A 2IAIA 4A3IJ 2H1KA 1JGGA 3LNQA 5EZGA 1RESA 4A3JJ 4XRMA 1JT0A 2L7MP 1GUUA 5FKOA 5J1YA 1HOMA 3PM1A 3HGGA 3QPSA 4A3DJ 3G1MA 5JLXA 5M3MJ 1MBHA 2LFBA 1W0UA 3I4NJ 2M34A 2XB0X 3BTJA 4XRSA 1XG1A 5FLVA 4FISA 1B72B 2H8RA 1ETXA 1UG2A 3IH4A 5C4XJ 2ZB9A 2FD5A 3BG5A 1P7IA 2JJ7A 1B72A 4M3BA 1NK3P 4JX6A 2CQXA 1JKPC 2VPRA 1DU0A 4I76A 3M4OJ 4BKXA 3S15J 2MW8A 1FJLA 4AC0A 1QRYA 3A01B 3BR5A 3L1PA 4A3MJ 2R93J 3CDLA 4C3HJ 2HOAA 2Y30A 4IEJA 3B6CA 3A01A 1JT6A 1TWFJ 5E3MA 3H3VK 3ZQCA 1H88C 1Y1VJ 5FKLA 5K7HA 2EZLA 1RKTA 3OSGA 1X2MA 2XB5A 1IG7A 4IHWA 3VPRA 3Q3SA 1OCTC 3ZQIA 3I4MJ 2JN6A 2Y9ZA 4MFEA 3HDDA 3S1MJ 5F27A 1RPWA 5EEAA 2WB1N 2E19A 3BTIA 1JJ8C 1POGA 3BR1A 4IHVA 3Q0UA 1ZK8A 2CU7A 1JUSA 4A3LJ 2P81A 2JK3A 3RZDJ 3BTLA 4M3GA 2YUSA 1ETQA 1HF0A 1O4XA 3GTMJ 4XK4A 2E2JJ 2XRLA 1R9TJ 1WI3A 4HNVA 4FE7A 2NS7A 1VFCA 5F0HA 2GM4A 1ZR2A 1JKRC 1XS9A 2DA1A 2NOGA 2NVTJ 1P7JA 4FTHA 4BBSJ 5EYRA 1GV2A 1IDZA 4NDLA 5IYBJ 4MO7A 1WGXA 2L9RA 1MBJA 1U9OA 5FKKA 1TWGJ 2R5YB 4C3IJ 5EZHA 3S2HJ 3FK7A 9ANTA 2QF7A 5EF6A 2RAEA 5DTDA 4A3BJ 2XSDC 2DA6A 4JP0A 2DMNA 1YRNB 2R5YA 4A69C 2QCOA 1ETOA 2Y9YA 3QQAA 1ETYA 2DA5A 1IRZA 1ZGWA 1G2HA 3O8GA 1I3QJ 2CQQA 3O8HA 1K61A 2HOTA 3JRCA 2CUFA 4DZPA 1QVUA 3HOXJ 3D1NI 4DZJA 3LSRA 3BG9A 2DMUA 3OOUA 1ETWA 3BR0A 5IP7J 2JA6J 2CUEA 2L0KA 3FISA 4MLOA 1ETVA 3S14J 2HXOA 4S0HB 5DS9A 1T56A 2HQ5A 5F08A 2XPUA 2R5ZB 2I10A 1BL0A 1IGNA 3E7LA 5IPAA 1TC3C 2XGDA 3CQZJ 3G1OA 1BW6A 2DMPA 3GTGJ 2DA2A 2NS8A 3OSFA 5C3EJ 5IOYA 3WHBA 1OJLA 3ZQHA 2R5ZA
chains in the Genus database with same CATH superfamily
3HG9A 2DW4A 4UV8A 5E3OA 4M3FA 3U9GA 5K7FA 1JJ6C 4KT5C 2F5VA 1JUPA 3BWGA 3ZMSA 3DU6A 4EJWA 5FO5A 4M3EA 4HQMA 3BG7A 2D2WA 2HNHA 5FB2A 4XICA 1G3TA 1TQPA 4L9TA 1WPKA 3I71A 5FD5A 3UKGA 4M6XA 2LG4A 3H9QA 1MJAA 2XGEA 4GRIA 1YQAA 2H94A 3GBGA 1R4NB 4MIMA 5D8LB 3P9KA 3GTKJ 2VJIA 1W1WE 2LVSA 2FOWA 4B43A 4CO8A 4XLPF 1ON1A 3SDBA 1G8XA 1X1CA 2X9DA 1OCZH 4IO9F 3OS1A 2PG4A 4XKCA 4G7HF 1GV5A 5CLSA 4BS9A 1JE8A 4GYGA 4JK1X 2H8WA 3K4MA 2F5FA 1I39A 3V42A 2HQNA 2PMZA 3S32A 4U0WA 2O5RA 3X2QH 2GBYA 2E5NA 3OYDA 1VQNI 3RQIA 2LP0A 2EZIA 3W2VA 1DPUA 1VZ0A 2FNAA 2VI6A 1XCVA 2Z5UA 4GXOA 3W2WA 3OOPA 3R0AA 3KP3A 2DLLA 5FKMA 4L9JA 2VUMJ 2IP2A 5E18F 1Z05A 2JA5J 1VNDA 4XORA 3F0CA 3BR2A 2JSPA 2V26A 4MQ9F 1H89C 2HDWA 3OS0A 3U2RA 2X6WA 1DP3A 5JHFA 2KRFA 3D5LA 1D0XA 4BQNA 1MBGA 2G7UA 1TZLA 2XC7A 1UMQA 2GQQA 2XGCA 3ABKH 3KCCA 1WKMA 1UHMA 2WWYA 4UVCA 2P5LC 2LLKA 3K1MA 5BNGA 2DMQA 1OCPA 1N25A 3KFWX 3GZ5A 1BI2A 3RKWA 2VQHA 1YI2I 5JLWA 1X1AA 3LSGA 4YRVA 2OTJI 4AIDA 3RKQA 1YFHA 5ICCA 3DFGA 3U1KA 4BJ5C 1MH4A 4IVNA 4Y33A 3OYAA 2EFNA 3QU3A 3IAM2 5B5EC 2EFQA 1Z6TA 4RS8A 2KRHA 5DM7F 5FFZA 2K4BA 4RB3C 4B1RA 1MDMA 3I4PA 3RPQA 1X58A 4D1QA 4BQAA 1OMIA 3BJAA 4OAYA 3MFKA 2QGUA 3LA7A 4A3GJ 3H1CA 3FHNA 3HPGA 4ASNA 4AVPA 2HEOA 3DXJF 3JRIA 2M8GX 2HU9A 2CGPA 4U7DA 2CW7A 3DBRB 2DTZA 3MQ0A 2W1OA 1RZ4A 3HOZJ 3S1RJ 4CZZA 4ZDLA 1EH6A 4CCOA 1N78A 2E35A 1B9MA 1V4RA 3GTQJ 2PMZN 4AYBA 5J40A 5J8FA 2D5VA 3K0LA 3O3KA 4JYKA 1UG0A 1FBUA 3OYNA 4R79A 3FF5A 1EF4A 3VB2A 3GTPJ 2OQRA 3BQYA 1FLIA 3DEUA 2IVMA 2UXXA 2NAZA 1P2FA 1X1PA 2CW0F 2L9SA 1R36A 2X51A 5C4JJ 3HXLA 4OINF 1TNTA 2TDXA 4M72A 3NWSA 2QEXI 1ZHFA 5D4RA 3BJOA 2HOSA 4CCNA 2CV1A 4UV9A 2JPBA 2M7AA 3CF2A 1XGSA 4CYCB 1MIJA 4R1HA 1FOYA 2QZ8A 2Z99A 5DCMA 4ABZA 5A2QK 1SFOJ 3T1BA 1H0MA 4LD5A 3S8PA 3K2ZA 2EZKA 2NRAC 2UZKA 4A12A 2WY7Q 5FLXK 2XAFA 4MGRA 3TO9A 3LA2A 3HSEA 3REOA 2B0LA 2ZXHA 3I56I 3DBHB 1HDPA 3QAHA 4RB1A 4ITVA 3F8CA 4LGWA 3OR1C 2M30A 4IKFA 2L02A 3J80K 1BI3A 5GP9A 4AIHA 4CDGA 1HW5A 3SZTA 3CUQB 2FEZA 2DODA 2XROA 4RM2A 3MCZA 1PUFB 2O3FA 2FU4A 5K5RA 2ZJPF 2F48A 3TO6A 3OYHA 1HCRA 3IWFA 2KIMA 3I54A 3F22A 3SDGA 3E3VA 1FSEA 3J81K 4X1EA 5LEKA 5F1JA 2IBDA 2Z2SB 2GAUA 1A31A 2BY1A 3ISPA 3QOEA 1RIOH 3W2AA 2XAQA 1U5TB 3C1DA 3SFZA 1E3PA 4AUXA 2GXAA 3PJRA 1JTYA 2QWWA 1HSJA 1CQTA 4ESFA 4C3JJ 2NNNA 3SZGA 4A93J 3MVPA 4KUMA 3HRSA 2CH0A 2BGCA 1Z67A 4HRIA 2FXAA 2CYYA 3BDDA 3MZ8A 5HDNA 1R5HA 4G6DA 2Z1DA 1SAXA 3HOVJ 4PZJA 1AU7A 2DOAA 1ZYRF 4AYBN 2EJRA 2MD5A 2HWVA 1XGNA 2QLZA 3K4LA 3HRTA 1FY7A 4ETSA 1Z3YA 3J7ZI 3PSFA 4D9JA 1P92A 1J59A 1NHAA 5B1BH 2VKDA 3I59A 4E7IA 1FC3A 1BR4A 1P4WA 3LFUA 4KIGA 2W82A 2ZJQF 2MA3A 4RDUA 3PNYA 3CP2A 1AA7A 5L3BA 4UB8C 4ZYDA 3H0DA 5J8CA 4GFBA 3WHCA 2EA4A 2EZHA 2AQEA 2XVCA 3NRVA 4ZYAA 2PJRA 3GW2A 5EEHA 1S7EA 3FMSA 2KIUA 3H5RA 3L2RA 5M5WJ 4BUPA 1X3ZB 1LUJB 3B6AA 3TBIA 1WSUA 3KZIC 1D8JA 3HOTA 3GFLA 2Y0SA 4BBRJ 2Z9OA 2L3DA 1OQYA 4PDKA 2WAQA 3G71I 4B48A 2CQ7A 4BDYA 2HI3A 1EJ9A 4HSRA 4HDVA 1R49A 2DOFA 1IN4A 4A3JJ 1XCBA 2XIGA 1ZAOA 4BXUA 1TQIA 1XMXA 1JT0A 5FKOA 2VONA 2F5EA 2XF6A 5J1YA 3PM1A 3QPSA 2DTRA 2LKPA 5M3MJ 3FM3A 1MBHA 2LFBA 3ULQB 3GLLA 4PSXA 1W0UA 2M34A 3WGHA 2FOKA 4ZZDA 3EYIA 5L3GA 1SFEA 4M74A 1TQMA 2XGXA 1UG2A 2F4OB 4HDUA 5KNLA 2P6TA 2KIQA 3B02A 2QA4I 2JJ7A 4EJVA 4LFUA 2EIKH 4M3BA 1W36C 1BOAA 1K4TA 3C2HA 1DU0A 4I76A 4II2A 2QSHX 4XLCA 2MW8A 1YW9A 3A01B 1X3WB 3CDLA 4C3HJ 3D5SC 2FBIA 3OWTA 1WVRA 3R6SA 4ZDPA 1X4PA 2HDCA 1MMDA 2E1CA 3LWFA 5F1RA 3I5UA 2NNYA 2KQRA 5K7HA 1LJ9A 4CCLA 4IHWA 3VSLA 2DDAA 4E7LA 1U0JA 2BOLA 3ZQIA 2LREA 2V4JC 3HZJA 3ECHA 4XKVA 4XNFA 2Y9ZA 4MFEA 2Q2EB 2BW3A 2VE8A 1IN6A 4ON0A 5EEAA 1FMWA 1G3SA 5LHIA 1LQ1A 1POGA 1YE9A 1T8IA 3HKZA 4ZTJA 1DGRM 3E6DA 3OYGA 4IHVA 1BN5A 3B73A 3K70D 2AXTC 3TMOA 3PL8A 1R7JA 1R5GA 3F3XA 4XK4A 2EILH 4FX4A 2XRLA 1ULYA 3ASNH 4RAFA 3SEQA 4R8HA 1QHHD 2Z3YA 3WTVC 3I58A 4QPOA 4YFXF 2A61A 2NOGA 3K6GA 4JBAA 3QWLA 1P7JA 2K86A 2ZXWH 3CJRB 3EUAA 3LSHA 4WXHA 4M6YA 1K7AA 4BBSJ 4Y3OA 1IRXA 1IDZA 2R7DA 4NDLA 5TJJA 1WGXA 3L9FA 1TWGJ 3I64A 4C3IJ 3KZZA 5DV5A 5EZHA 4BEHA 9ANTA 2MC3A 3GXOA 4A3BJ 2DA6A 1RUNA 2DMNA 3CLOA 2IS6A 3E6BA 5E8GA 5BPDA 3RKXA 2R5YA 2QCOA 2W24A 5FROA 2Y48A 3WE2A 2M3AA 2DYRH 4GCVA 4O6JA 3QQAA 2OA4A 4RGXA 3UNGC 2PLYA 1BI0A 4XOTA 2KHMA 2KDOA 4IQJA 3OR2C 4NC6A 5HDGA 2JQ7A 2O03A 2CQQA 3RDIA 1V5EA 2X6XA 2CWEA 3OL3A 3JRCA 2WAEA 4DZPA 1QVUA 3HOXJ 3D1NI 4DZJA 4B47A 4YIFA 4BHCA 3BG9A 2QSGX 2DMUA 5FD6A 1MJBA 1ETWA 3BR0A 3C2GA 1KONA 5IP7J 2JA6J 3FISA 1ETVA 5DS9A 3BG6A 3EQLF 2KISA 2XPUA 4NNJA 2CMPA 1BL0A 1TC3C 1XGOA 2XGDA 2XAGA 3G1OA 1BW6A 1D0ZA 3O2PE 1TL8A 4NUBA 1W7PA 3OYFA 3T8TA 5C3EJ 5IOYA 2L7KA 2L9NA 3JW4A 1WJCA 2VODA 1FX7A 1MKMA 4EATA 1G6NA 3MN2A 3RIRA 5D4SA 4YELA 2MABA 2VJJA 1MBEA 2HQAA 4HPQA 1D5YA 1ON2A 5CJ9A 2HDDA 4KYWA 3QU6A 2HKXA 2W4SA 2UXNA 3HKZN 3LSTA 1GDTA 2LSOA 4WF2A 1WWXA 2GIVA 3TDZC 1XPXA 3CZ6A 3RSNA 3QP6A 4IOAF 3LSPA 4A2UA 3FHZA 3RYRA 1IDYA 2ELKA 2K27A 2EIJH 4DW6A 1UB9A 1W5SA 2E2HJ 3VFZA 3I9V2 3OMYA 1QO0D 1BR1A 4F92B 3D5RC 1SD6A 3KIOA 2WADA 1DGWY 2A6HF 2OD5A 3ECOA 3MKLA 3JRDA 1B6AA 3NAUA 2RC4A 2X48A 3T8RA 3WODF 3JRFA 1UHWA 3F8NA 2OZ6A 4NB5A 3EUHC 5B66C 2NVXJ 4Y4RA 5HS7A 1PDNC 2JMWA 4AD9A 1J0RA 1IXCA 5EGOA 3E1SA 2IA1A 1GVJA 1ZH5A 2BBYA 1WRJA 1QVTA 1FBSA 3GTOJ 2W25A 3WTXC 2H6CA 5B1AH 4D0PA 4UUSA 4IJAA 1BIAA 3DEWA 2B7EA 4LMYA 2GWRA 3WG7H 4C9YA 2LD5A 2Y69H 2X0LA 3KYCB 1TWCJ 2L54A 3R61A 1J75A 5ILUA 2HGCA 2UUZA 3HBLA 3E97A 3HRMA 2KPMA 4F52A 1T33A 3W6VA 2K85A 4LLLA 2HR3A 4M71A 3FXKA 5L3DA 2LR8A 5D5XB 2E34A 3BZ6A 3U1DA 4HF1A 5FLMJ 2M2EA 4WK8F 3W3CA 1I6HJ 3FKJA 4Z6YA 2PQ8A 1SMTA 1BJAA 3A03A 2L9VA 4DYRA 2XF7A 3N97A 4WX9A 1P4AA 4XOPA 1MH3A 4LG0B 5IT3A 3G73A 2A3SA 1E17A 1OLTA 1U8BA 3VYUB 2W00A 3WGGA 4B4CA 2PMHA 1FEXA 4LLNA 1R58A 2EBIA 4BJTA 4L5IA 1ZGAA 2P4WA 4CCJA 2HZDA 2LRDA 2G7HA 3NQOA 4YG2F 3M07A 2V79A 2K9NA 2CO5A 2RQQA 1MDMB 2LYCA 5EG0A 5E1WA 4NQWA 3RKYA 2A07F 3HOWJ 2MFZA 3HTSB 4IHTA 2PBIA 1D1AA 3GTLJ 5JR3A 4PJJA 2VPLA 4XRFA 2R7FA 4E6KG 3H3UA 3BT9A 4PK4A 1RRJA 1D1BA 1K79A 1ZQ3P 2MC4A 4UVBA 1U9NA 2KLOA 4L9VA 2HQRA 2ZMEC 5K1YA 4PJMA 1WH5A 2KJBA 1IXRC 4LK0F 1IJWC 2BXYA 4YIIA 1RKWA 4E7ZA 5HOOA 2A68F 3HHGA 2E1OA 4HLYA 4IHSA 5HVQC 2YU9J 2XV4S 4PCQA 1VQPI 2OV7A 4CCKA 2ZJ2A 1Q1HA 2BYVE 2OPTA 3QODA 4W1UA 2L4MA 3H35A 3GZ6A 4YEJA 2QBYB 2HOEA 4XONA 5CVUA 2R0QC 1S6LA 3F72A 3FM5A 1JHFA 1XSXA 1V55H 3F8MA 3N05A 4JX4A 3TEDA 2CQKA 3OIOA 3K4JA 3GWZA 4BE2A 2DXIA 3LSJA 5CYVA 3HB9A 2DYSH 2K4JA 4DJAA 1UFMA 2F6CA 4LLGF 3H3ZA 4ZYEA 4I6ZA 1F36A 2V9KA 1YJNI 1ZKGA 2X1DA 1BBYA 3QYFA 2IA0A 2CRGA 2XAJA 2NVYJ 2GOMA 1LFBA 1OCCH 1DP7P 2ECBA 1ENHA 2M45A 2W48A 2VKVA 4A5MA 1DUXC 4J00A 1K6YA 3F8BA 3PO3J 2CJJA 5J3LA 1BM9A 2E1MB 1Z0XA 3H92A 3OV8A 5HODA 1K78A 1SFXA 2ZSHB 4FX0A 4MHGA 4KA4A 3DCFA 2DPDA 2Y2ZA 2P8TA 1BJZA 2DDBA 2EPFA 5K7ZA 2KMUA 1ZLKA 2KIFA 2HVQA 1YX3A 1S7OA 4L5JA 4KDPA 3JRBA 2BVMA 2FJ1A 2EH3A 4F7ZA 2D1VA 1FP1D 4G9YA 2ZO4A 5FGMA 1S3JA 1Z91A 1LDJA 4RAGA 3ZQ7A 1WJEA 3BTCA 4MEYF 1QBJA 1ZGJA 5GAEJ 2PJPA 3A0BC 2EIMH 3H36A 5IP6A 3PQJA 5EJCA 1TBXA 4A0YA 3S3MA 1CGPA 3W6KB 2R7XA 3ABUA 3ZQQA 1KU7A 2IS1A 2AQFA 3HHHA 5IOZA 2LY9A 4OIOF 2ID6A 2E7XA 4XN0A 1Y39A 1JTXA 2DFEA 2O0YA 1R1UA 3HM5A 3K4BA 3NWTA 2M9HA 3BQZA 4FE4A 1X1DA 4EM0B 1U3EM 2Y31A 3ZR8X 3G2BA 2FNPA 3FMRA 3M8FA 5DYMA 2XKOA 4IRHA 2EFOA 2MYSA 1IUFA 4NC8A 4KFCA 2EFPA 3P5JA 3QYBA 3SJMA 3CJQB 1L0OC 3GZNB 1A35A 3MMYB 3WTUC 4XRSG 4O5VA 5FJ8J 1DU6A 3SZPA 1T2KA 2IEKA 1B1BA 3HOUJ 3ZMUA 2P0WA 3BR3A 3I59B 4OIRF 1TWHJ 1IZ1A 2M87A 2YU3A 3TP3A 4A0XA 3BR6A 1MNDA 3S1NJ 3IKVA 2VB6A 3QPTA 2LOOA 2WTEA 2HKOA 2HZTA 1NTCA 4ENJA 2PJRB 3FX3A 4KT6A 1YLFA 2JA2A 3LAPA 3WTTC 1XMKA 2WB1A 5ILSA 1T95A 2RDPA 3WU2C 3E5UA 3R60A 1WCMJ 2IW5A 3IP4B 4G6TB 3EUHA 3ONQA 1Z9CA 2XAUA 3OIQA 4HG2A 4IL6C 4S04A 1QHGA 3DKWA 4GGGA 3LQQA 5KVRA 2LK2A 3K7AJ 1XN7A 4S05A 3KEQA 3JRHA 1KQ0A 4H4KC 4ZYGA 2YSRA 3HOYJ 1A5JA 5HLTA 4KN4X 1ZG3A 3CTAA 1QZEA 5F0FA 3SFIA 4HNTA 1SD4A 4XIDA 1MBFA 2CW8A 3NARA 1W0TA 4E7SA 4C30A 1JGGA 3LNQA 3T0YA 1T38A 4EMSA 2X85A 3HIFA 3ZN1A 5J4VA 4XRMA 4F91B 4CSWA 1GUUA 4OIQF 1HOMA 3CLQA 4XM3A 5JLXA 5F6FA 3HYIA 1XX5A 4QPQA 2XB0X 4UUVA 3M9AA 3ZGKA 4B09A 2ISYA 2CQNA 1YO5C 3HUGB 2PMUA 4ZJZA 4C2TA 3IH4A 1VQ6I 3BY6A 1Y0NA 3PNVA 2ZB9A 5LRSA 2FD5A 3BG5A 4MEXF 4BU2A 2MH9A 1OPCA 3F9KA 4UNOA 3HOSA 2V9VA 2VJ4A 2CQXA 3QP5A 4BGDA 4ZYHA 4FQGA 4Y17A 3M4OJ 3VDXA 1FJLA 5LD2C 4HF2A 4KICA 3GVAA 5A2QZ 2STWA 1G3YA 3JAMZ 2R93J 2HTJA 3OYMA 1NG6A 2Y30A 4RMNA 4IEJA 5GTHC 1ZRDA 2VXDA 1I6XA 3B6CA 3WU0A 1JT6A 1Y56A 1TWFJ 5E3MA 1W7PD 2V7FA 3ZN0A 2BW3B 2EZLA 3VWBA 3OSGA 1IW7F 1X2MA 4G94A 4MTEA 3VPRA 5LRRA 2VXZA 4EJTA 3J80Z 3I4MJ 4RB0A 1SVOA 2GA1A 1XSVA 2ZMEA 2JN6A 4XSXF 3HDDA 1IN7A 1HQCA 3F6VA 2L01A 1RPWA 4BQOA 3K4CA 2WB1N 2E19A 3TL4X 5BS6A 2R7QA 1VQ4I 3CDIA 4PJ0C 3BR1A 3J81Z 1YS6A 1G4DA 1QGPA 1S7AA 2A6EF 1T98A 1Y6IA 4XLNF 1USTA 1ZK8A 4I0BA 1SVLA 4U7BA 2VOPA 4G8XA 3BTLA 2ZJRF 3L09A 5J47A 1HF0A 3ERED 2MD0A 3CUOA 3L7WA 1SFUA 3A0HC 2F4MB 2RREA 4KJZA 4M73A 2YX4A 2LBFA 2GA2A 1B59A 4FE7A 3W6JB 1F5TA 2XHKA 3HJEA 4UVAA 5AIPA 4E7KA 2ZXJA 2JTVA 4XKWA 4BEHB 1D0YA 2CFXA 3BPXA 5GAHJ 2RNGA 5IY5H 1YHQI 1ZELA 5FKKA 1MBJA 1YOVB 3BPVA 2K7LA 4IXAA 4CYDA 2R5YB 3MD2A 1K6OA 3S2HJ 3FK7A 5ICEA 1VQLI 1Z3XA 5DUIA 4KITB 2EWNA 2RAEA 2I8DA 5DTDA 2XSDC 2VBXA 5GAGJ 3OYKA 3LSMA 5D5WB 1H9TA 2E71A 1YRNB 1QU3A 3KEYA 4WXCA 2CUJA 4II3A 1R00A 3TO7A 2DK5A 2Y9YA 3OY9A 2FUG2 1LB2A 3CCRI 1ETYA 4NC7A 1ZREA 1IXSB 3PUFA 1IRZA 5L3FA 3U21A 1FT9A 1D5VA 2BEOA 1O7LA 2X1CA 2M0MA 3CD6I 4ANJA 1NG7A 4FETA 2HOTA 2DJIA 3V8LA 2CUFA 2IA2A 2M7BA 3Q5FA 3FBNB 4LB6B 4ZZLA 4P5OA 1W7PB 3FXLA 2CUEA 3MWMA 5LBQA 4MLOA 4XLEA 1PP7U 1R5ID 1YW7A 3MZYA 2X6YA 3MKWB 2R7TA 2M5WA 1G59A 2DMPA 1KU2A 5LEJA 3GTGJ 2VE9A 1J5YA 2A5YB 4I09A 1LNWA 1BW5A 2V6CA 5ED4A 4BJ6C 1ZARA 1MSFC 2RKHA 4HW0A 2NXNB 5GTIC 2VLAA 4D5FA 3AAFA 2RVCA 4HX4A 2PX9A 2R7WA 5IYCJ 2DFHA 1E3HA 4HX8A 4BACA 2DMTA 2VKEA 4HZFA 1OCOH 1GXQA 3PQKA 2FX0A 3G3ZA 1A6IA 2DA7A 1XMAA 2V1XA 4I01A 4JQFA 4BXFA 3K4KA 4CH7A 2ECCA 1E3OC 2ISZA 1ZLJA 3MKYB 2G0EA 3HC7A 5E3NA 4WCGA 1SD5A 4BH9A 2XSJC 5EGOB 4N9IA 4D7NA 1V5FA 4HQEA 1K83J 2JA7J 3L2CA 2DN0A 3KX2A 2Q0OA 2VQCA 5H2FC 3HSRA 2JVGA 3DLLF 1LDKB 4EQQA 1FTTA 2QQAA 2R3SA 3QOPA 1YIJI 1B4AA 2VC0A 2O6GE 2VJ5A 1RNLA 3S1QJ 2BY3A 2MG4A 5FKNA 2E1NA 4CXFA 1USSA 2R7ZJ 5LHHA 1O7FA 1X2NA 2HYJA 1ACIA 2DQLA 4AIKA 5F04A 3AL0C 4LK1F 1U78A 4U0YA 2OC6A 2DJNA 3KLNA 4XN3A 1FOWA 3BZKA 3RTRA 4FCYA 1RR7A 1DPRA 3DTKA 3UR3C 3IV5A 1JUMA 5LLQA 3WE3A 2VQGA 2COMA 3ZQFA 5LFAA 5HS9A 4KNYA 1T08B 3M7GA 1S72I 2M4GA 2P5KA 2LH9A 2JA8J 1PVEA 1RETA 3D0SA 3KEOA 1AKHA 4RGSA 1ETKA 1O3SA 3E5QA 4BNCA 5EG0B 3CCYA 1HLVA 5CVJA 4KMFA 2DPUA 1T0FC 3KYDB 2ICWG 2GLOA 3AKZA 2O7OA 5CVRA 4LG3A 1FBQA 1MMNA 2H27A 1JKQC 4TV7A 2QKMB 5HLHA 4BY7J 3GX4X 1X19A 4IRGA 3JSPA 1TWAJ 3Q0VA 1NH3A 4LB5A 5KAIC 1FYLA 2FQ3A 1AHDP 2DT5A 1AWCA 3FXJA 2VC1A 3FK6A 4GDFA 3VEPA 4Q4ZF 2GIZA 1YS7A 3MAJA 1OFCX 3I3LA 5BMZA 1KU9A 2L2OA 3K4NA 4BHPA 4BXXJ 2JT1A 2X6OA 3FZVA 2KL4A 3VOEA 4PFPA 4A0ZA 2O9LA 1IRGA 3SQNA 2HYFA 1T6SA 4A5NA 2F2EA 5CQEA 4Y7NJ 2XAHA 3KYLA 4QWQA 3EETA 1HW2A 1XB4A 4EVIA 2W85A 5F0CA 3DKXA 1ZRCA 1ITYA 3M8JA 3OYEA 1CF7A 5JVGF 1Y1WJ 2CG4A 1KA8A 4EGYA 4NBQA 2R7UA 4V2GA 5FRMA 3IUOA 4M3DA 3V7RA 3V4GA 3RI4A 2HVRA 1MMAA 3BCAA 2TRTA 4L5EA 3K2AA 4ENKA 2R92J 4FHTA 3E5XA 2Q8KA 1MBKA 4IZZA 2EA2A 2P5VA 4DIQA 1MNMC 5ICFA 3ZQGA 3BG3A 1IN5A 3Q0WA 2N8GA 4CGZA 2BHZA 1K78B 2XKPA 1APLC 5J1UA 4Q5SF 4FT8A 3BJ6A 3IKTA 4XQFA 1IV6A 1Z7UA 1JXSA 2QVOA 3KP4A 3QPLA 2K40A 1R6RA 4OAZA 4EGZA 1X1BA 2JUGA 4E4HA 2E2IJ 3JSOA 3FXRA 3GLXA 2VKHA 2V9PA 2YPRA 5CPRB 1Z77A 3O6BB 2WAFA 4J01A 1I1GA 1H9GA 2EQRA 3HSFA 3K9TA 3FXUA 3TOAA 3FIWA 4HOBA 3TP0A 4XLFA 5H6RA 3LOCA 4CUGA 4V2FA 4Z2YA 4RBOA 1I50J 3H0GJ 2WV1A 1FPQA 3IHUA 2VQLA 1A36A 5FFXA 2JWTA 3MEXA 4F3QA 1EH8A 4NHJA 3OYLA 1K4SA 3QYEA 2G9WA 2L7ZA 1HSTA 3G1LA 1J2XA 2XRNA 4JX5A 5TRDA 1XC5A 2CV0A 1UAAA 1Q1VA 2DFFA 5E79C 2XDVA 2DA3A 4E7JA 1UHSA 1NK2P 1JKOC 3GO5A 3IH2A 3GFIA 2KRCA 4RGRA 2VN2A 3L2QA 2R4GA 3KP6A 1VQOI 1LPQA 5IT9Z 4E70A 2CS3A 4PJNA 2OJED 3DTEA 3V8JA 1J7KA 3KPHA 2L5QA 1EA3A 3EYYA 2EINH 5HS8A 5BQTA 4F93B 1Z21A 1U8RA 3J7AO 1D8KA 2JUCA 4MFDA 1DQUA 1VF9A 3KE2A 3GYHX 3ML6A 2QENA 1WZ2A 3C3WA 2IGOA 3BP8A 4HA8A 1IUYA 2FA5A 4IHYA 4LOCA 3V7SA 1UZCA 2DBBA 2R7RA 1T39A 3HPHA 5L3EA 1FTZA 3S2WA 5KHDA 3FXOA 1UELB 2FBHA 4XR6A 5E1ZB 4L9NA 4KISA 2ME6A 4LJZF 3VSKA 1PYVA 3ZQLA 4DYCA 5GPCA 4QSHA 1ZN2A 1LDDA 3WGIA 1H8AC 2XPWA 4EV0A 2MGQA 2WBMA 1QQIA 2XASA 3G4SI 3IH3A 5HLIA 2FQ4A 3TOBA 2E1MC 4HV5A 3A4CA 4M9XA 5BOXA 3L2VA 2QQBA 5JFRA 1HDDC 3RCOA 4A3CJ 2BVLA 5C44J 2IGMA 3GFMA 3CO6C 2QUFA 3K10A 3WTZA 5IP9J 1B8IA 2DCEA 3CCUI 3KP5A 4ZC3A 4OMZA 3KZYA 3RQ4A 3DWLE 1MGTA 2ZSIB 3TW6A 1LE8A 1IO2A 3P9IA 5JI6A 4A3IJ 2H1KA 5EZGA 1R71A 3VYSB 3P7NA 3ZXSA 4BHBA 4RLFA 3ZRGA 4WWCA 3VYTB 2Z16A 4UY8I 3CESA 1HA8A 1YJ9I 3EDPA 4Q48A 5LGTA 4HYEA 1R1VA 1YTYA 5JVTA 5FLVA 1XG1A 1PP8F 1IV8A 4FISA 1B9NA 5DCMB 4MTDA 1YJWI 4IQ4A 3KLOA 4I2OA 1O57A 1TT5B 1HW1A 4B44A 3GMEA 1ETXA 1IRFA 3FMQA 4XBFA 2OCEA 5C4XJ 1KYZA 2BHYA 5EEGA 3ZP5A 1B72A 1NK3P 4JX6A 1T0FA 1P6RA 5D5VB 3I55I 4UB6C 3DU5A 5AIQA 3DKYA 1Z7LA 5ILVA 2YR2A 2VT3A 4BDZA 1QRYA 3CO7C 2KP6A 1MJ9A 4A3MJ 1TLHB 4HSTA 3CCMI 2HOAA 3HL2A 1HKQA 4U87A 3CMEI 4BL0B 1AOYA 1ONVA 4CHUA 1SFKA 3LL7A 3FWEA 2IS2A 2ZMEB 3PUBA 2QM3A 3ZQCA 1H88C 1HBXG 1Y1VJ 3CCSI 4L18B 3PSIA 4OU0A 1RKTA 5LGNA 2DFIA 2XB5A 3LA3A 2HTSA 1P4XA 1OCTC 2LF7A 1G3WA 3V8KA 1MMSA 1STZA 1SD7A 5DDGA 1TNSA 1KZHA 1S9HA 2H6BA 5F27A 2O8XA 3S1MJ 3DEEA 3BTIA 2M4KA 1BC7C 5HNFA 3G6EI 1OR7C 2HFHA 4KIBA 5J4YA 3PFYA 2CU7A 2LBFB 3TQNA 1VQ7I 3BC8A 2JK3A 2IRFG 3RZDJ 4M3GA 1SMYF 2X4HA 1ETQA 1VQMI 4DNCA 3GTMJ 2ETHA 1V3FA 2E2JJ 1WI3A 4G7ZF 4I0AA 1I1SA 5F0HA 1ZR2A 1JKRC 1XS9A 2NVTJ 3QRFF 5H20A 4FTHA 1GV2A 2BE5F 1F1ZA 5IYBJ 2L9RA 1TT0A 4IPAA 2GOXB 5CQGA 3L2UA 3VYRB 2K9LA 2BXZA 2KZVA 2LDUA 4LG0A 3F6OA 5EF6A 4HAMA 3Q9SA 4A6EA 3L00A 4M9SA 4A69C 1J9IA 3A2KA 4HV6A 1WJBA 2GXBA 1MNEA 5J6XA 1FMVA 2DA5A 3CC2I 2HPMA 2UV1A 1YW8A 2VBWA 3GEZA 2C6YA 3O8HA 1K61A 2MH2A 2JSCA 3BROA 1WJDA 4N4OB 1EV7A 2ZNZA 3DBLB 3ESWB 2CFOA 3LQRA 2VBYA 1BC8C 3K1NA 5D6EA 3OOUA 3WTSC 4B8XA 1VQ9I 1VTNC 2L0KA 3I0TA 1ZG5A 5CVIA 2BV6A 4FASD 1SEUA 4S0HB 1QA6A 3CUQC 5DD8A 5LGUA 2A05A 2I10A 4IRIA 1IGNA 4OIPF 3CQZJ 4N0BA 4RAZA 2ZKZA 2GXGA 3OSFA 1Y8QB 3WHBA 4XKBA 2R5ZA 3FXQA 4LIUA 2LMDA 3ABLH 5AONA 2DA4A 2AHQA 6PAXA 1U5TC 4DBQA 4AU7A 2XPVA 1VQ5I 3JR9A 2QKLB 3BCBA 3WG9A 3SEZA 3S93A 2EV6A 3CDHA 3M1CA 3OYIA 3EPZA 2QBYA 2IGNA 3M1EA 1TW2A 4M9ZA 3MKZA 3LSIA 4ZTFA 2LKXA 3JREA 2Z33A 1L3LA 3ZPLA 4UHTA 3ZCOA 2ZNYA 2UWMA 3FXMA 5FLXZ 1D1CA 1XGMA 4J19A 2AXLA 2E36A 3HRUA 4C2MJ 1GHCA 4UXNA 4XLHA 4RA2A 5K5QA 3BZCA 3JAMK 1LFPA 1F4KA 2V1DA 2YS9A 2AS5F 2K5CA 5CVVA 2DT7B 1S5LC 5M5YJ 2V1NA 3DLAA 4DGWB 3S2DJ 1QPIA 4HX7A 4GO1A 3HGYA 2ESHA 2TCTA 4X0GA 5KAFC 4QLCU 2R7OA 2VOOA 2RNJA 3C7JA 4U88A 2Y0MA 2ID3A 3IWZA 3L2WA 2IGKA 1WQ2A 2B63J 1VI0A 1HKTA 2AO9A 2OCCH 1JHHA 3CP8A 4LIVA 4UUTA 2FF4A 3ZOBA 5LHGA 2K9SA 4E7HA 4RLQA 4ESJA 4B3XA 4G7OF 3F8FA 5E17F 4RAYA 1I27A 3Q9VA 3OYCA 1MMGA 5GPAA 4W97A 2H1LA 1YX5A 2XF5A 1GLNA 1AKHB 2ESNA 2F5CA 3RPUA 1WHUA 3V7CA 4HNUA 3H5NA 2L7FP 3CCQI 4YFNF 3OS2A 3S3NA 1BR2A 3JCUC 4BAYA 4EM1A 3ABMH 1FOXA 2JRMA 1PJRA 2LC2A 3GCMA 2OF7A 1FYKA 1WH7A 2JPCA 4L0YB 2COBA 1XD7A 4RM3A 4PFOA 3TKYA 1FWZA 1HC8A 2DOEA 3DQVC 3ABTA 3BOQA 2KKOA 1ERDA 1MW7A 2VASA 3AG3H 3EUKL 3T5XA 2WA0A 3ELKA 2EV0A 2ACJA 4I02A 1FNNA 3CMYA 1MSEC 1R1TA 1F43A 2DO7A 3F21A 2WC2A 1O3QA 3QPHA 4CZCA 2Y75A 1YIOA 1UJ8A 2ZBKA 3RYPA 2V1UA 4BE0A 1U2WA 5ICGA 2LY1A 5FRNA 1LKXA 2JZYA 4A6DA 5M5XJ 1RI7A 4QTRA 4ZDOA 3BLYA 3CCJI 2D45A 2BZTA 4O3MA 5TGTA 3OYJA 4PUSA 4OMYA 1YYVA 2XUBA 4Y52J 1CF7B 1IC8A 2K9QA 4WXDA 2M1BA 3IRRA 4I7HA 1FIAA 5E3LA 2HPIA 3PO2J 1LFUP 2VIXA 4A3KJ 1W36D 1OR7A 3CF5F 1PUEE 2M0CA 3R0JA 3ZMVA 1A6QA 2ME0A 1ORKA 4DQ2A 2FMYA 4IHXA 2A69F 3TDUC 5GADJ 1F9NA 2EV5A 3IAS2 3CMMA 3A02A 5M3FJ 4D7MA 1KGSA 5HNHA 4PGGA 3IRQA 1IF1A 3M3YJ 2MSYA 4MNUA 2E60A 4HF0A 1BIBA 3E6CC 4G12A 4BQQA 4A3EJ 1ZTRA 2FSWA 4CICA 2JRTA 2RQPA 4KMUX 5DD4A 1TW3A 2FMLA 2DU9A 2NS0A 1SC7A 1GVDA 3DP7A 4QIWN 3C18A 2QYOA 2EFWA 3H5AA 5TISC 2A6TA 3A1YA 1RR8C 1BA5A 3GUDA 3HUGA 5JHUA 3LFKA 4G6QA 4UUSB 2HXIA 3HEFA 1E0EA 1KQ9A 2KT0A 1VQKI 4C2UA 2PN6A 1W4MA 1GT0C 4B3AA 4CYCA 5D8KB 2W84A 2FE3A 2J5PA 2LNBA 1P9QC 3JRAA 2PFBA 4P9FA 1SANA 4ESBA 3SXYA 4A3FJ 3JTGA 3JTHA 2KDZA 2A5WA 3H9JA 5J1RA 1JGSA 3FKIJ 4PJLA 2KZGA 3R4KA 4XSZF 3WU1B 2NVQJ 1OKRA 4M6VA 4N9HA 1EKEA 4DYQA 4PGHA 1S8NA 3P9CA 3GTJJ 5IYDJ 2ELHA 3PFIA 3CUQA 1PUFA 1FOKA 1I5ZA 1V54H 2V6EA 3JRGA 5H6QA 1IN8A 1FYMA 1LVKA 1FSHA 5KK1A 1W5TA 3VODA 4X6AJ 3ROUA 2P7CB 4EEFG 1ZR4A 2ZCWA 2F4IA 1U5TA 1WJ5A 2P6SA 4H0EA 2OTLI 5D5UB 4NQWB 2DT6A 4IX7A 5HDKA 1WJAA 1I3AA 2Y0SN 4D5CA 4AWXB 4YIRX 3WTWC 3COAC 2RN7A 2WAQN 2DQRA 4K2EA 3K70C 4Y13A 1W5CC 4IF4A 4BY1J 3MZHA 2LTPA 2LY2A 4RGUA 3C2BA 3TW7A 2QQ8A 2DAOA 1UCRA 2OAZA 3S17J 4EJUA 5DEQA 4IOCF 3S16J 2O8KA 2HYGD 2NYXA 2B9SA 2W7NA 4V19K 1YG2A 4F55A 5L3CA 1LVAA 1REPC 4AM3A 4XLAA 1R23A 5EDNA 1V5GA 2IPQX 1QPMA 3FBIB 3CC7I 1TP4A 1OYIA 2BY0A 1GXPA 4YFKF 1BOBA 4MQVA 1B8IB 1JI8A 2QQ9A 2W57A 2HVSA 3DPLC 1LE8B 1YRNA 1OCRH 1ZRFA 1U6GA 1S29A 3AL0B 2CUZA 1FP2A 2X1EA 2JVHA 3K69A 3DF8A 3CC4I 2KJCA 2MLKA 1WJFA 1FIPA 1ODDA 5E8IA 4P9UA 3RZOJ 2IAIA 2O61A 3DPTA 1RESA 3ERMA 2OU2A 3AG4H 4HEA2 1X3UA 2L7MP 4HBLA 3HGGA 4OOIA 4XMYA 4A3DJ 3G1MA 4P55A 2YX7A 5DUKA 2OUMA 2VL8A 3PIOF 3I4NJ 5DCFA 3BTJA 4XRSA 4AIJA 3I53A 3LSKA 1O3TA 1B72B 4Q47A 4GYIA 3GF2A 2H8RA 1MZBA 2IT0A 1C0WA 1P7IA 4JOMA 3SHFA 2NOJB 1Y8RB 3F23A 3DPUA 1JKPC 2VPRA 4EM2A 2J5OA 2WV0A 4DBRA 4P1WA 1M1EB 2STTA 2M8EA 4BKXA 1OISA 3S15J 4AC0A 2ZFWA 2I5UA 2LKSA 3BR5A 1OYYA 1LEBA 2F5DA 2P7VB 3L1PA 1KQ8A 2EK5A 2RV8A 3OYBA 3LMMA 2CSOA 4ENNA 3PNTA 3E0JB 3A01A 1MD0A 5F64A 3PIPF 1WFXA 3AG1H 3H3VK 1Y0UA 2ZXIA 1A04A 1HKSA 5FKLA 3TGNA 5DM6F 1KU3A 3DTIA 1IG7A 1OYWA 3Q3SA 2WY8Q 1LEAA 3OIPA 2LF8A 5BPIA 1N77A 3KP2A 1VQ8I 5K5OA 1J09A 4L0ZB 2IJLA 2FRHA 2OZUA 3LAJA 5CKTA 2E5ZA 3KP7A 3S3OA 2R7SA 2ELJA 1JJ8C 4ZH4F 3AFHA 3AG2H 1SAUA 3HTUA 2MLGA 3N4MA 1O3RA 2PI0A 3SYTA 1QZYA 2FBKA 3Q0UA 2K3FA 4N4NB 3NEUA 5E1XA 1HXDA 1JUSA 2Q2EA 5KCMA 3ZMTA 4A3LJ 2P81A 5HLGA 1WI9A 4BYYA 1N75A 2OQGA 2PEXA 4KN7X 2YUSA 4U0VA 1O4XA 1ZG1A 5ERIA 1R4MB 3J7YJ 1R9TJ 4CCMA 4HNVA 2NS7A 1VFCA 2OBPA 1RUOA 2GM4A 2L4AA 3CJNA 2DA1A 5IT9K 2K9MA 2D1HA 3GFJA 3IL2A 2HS5A 3WTYC 5EYRA 2DK8A 1R22A 2K3PA 4EJOA 3CJTB 4MO7A 4BE1A 1U9OA 3H9GA 3FDYA 2VT2A 1E2XA 2ADUA 4KIFA 2IXSA 2MBFA 1XSDA 2GZWA 1Z6RA 2H09A 2QF7A 3CCEI 1X4OA 2DI3A 3KETA 4JP0A 4ENMA 5B3SH 2CV2A 4CA0A 1QZZA 2ZC2A 4DOZA 1ETOA 1XDUA 3ASOH 2VBZA 1EH7A 1D3YA 1KYWA 1XTAA 3J7AY 3CCLI 1ZGWA 1G2HA 3O8GA 1SVMA 1I3QJ 1XDSA 1FZPB 5E20A 2IS4A 3DV8A 3M8EA 4LITA 4I98B 4Y15A 3ZMDA 1YITI 1BI1A 1TTYA 3OL4A 3RPUD 4AVZA 3LSRA 3K1PA 1QNTA 4I99C 4XL9A 2BY2A 3CCVI 1IAWA 2E7WA 2RGVA 3S14J 2HXOA 3E6MA 1T56A 2HQ5A 3ZMZA 1Z1DA 5F08A 2R5ZB 2R7VA 4RB2C 2Q1ZB 3CMAI 1RC9A 4PSWA 2NVUB 2KFDA 3E7LA 5IPAA 4HLXA 1DDNA 2ZFUA 4P96A 3IC7A 2QSFX 2DA2A 3RJPA 2NS8A 4OWRB 2EB7A 5D6FA 1OJLA 3ZQHA 2K02A
chains in the Genus database with same CATH topology
5E3OA 4M3FA 1MSFC 2DA4A 2AHQA 5K7FA 3MN2A 1JJ6C 4D5FA 1JUPA 2XPVA 5IYCJ 1MBEA 3JR9A 4M3EA 1D5YA 2DMTA 2VKEA 2HDDA 4XICA 2FX0A 1WPKA 3HKZN 3UKGA 1GDTA 2XGEA 1A6IA 3GBGA 2DA7A 2LKXA 3JREA 2ECCA 4MIMA 3LSPA 1E3OC 1IDYA 2ELKA 4DW6A 2G0EA 3GTKJ 5E3NA 2LVSA 2E2HJ 5EGOB 4J19A 2X9DA 4D7NA 3JRDA 4C2MJ 3MKLA 1K83J 3NAUA 1GV5A 2X48A 2JA7J 3JRFA 2DN0A 2NVXJ 2YS9A 2JMWA 1FTTA 5EGOA 1QVTA 2GBYA 5M5YJ 3GTOJ 3S1QJ 2MG4A 5FKNA 1QPIA 3RQIA 3S2DJ 2LP0A 3HGYA 4UUSA 2TCTA 3DEWA 2R7ZJ 2EZIA 2LD5A 1TWCJ 2VI6A 1X2NA 2ID3A 2HYJA 3HBLA 5FKMA 3W6VA 1T33A 5F04A 1VI0A 2B63J 2VUMJ 2AO9A 4UUTA 3ZOBA 2JA5J 2K9SA 1VNDA 1U78A 2DJNA 2LR8A 3F0CA 3BR2A 1H89C 5GPAA 4FCYA 1RR7A 5FLMJ 4W97A 2M2EA 3IV5A 1I6HJ 1JUMA 1AKHB 3A03A 4DYRA 3ZQFA 1MBGA 2L7FP 1MH3A 1UMQA 2XGCA 1U8BA 2JA8J 4B4CA 1RETA 1AKHA 1FEXA 2LLKA 2EBIA 5BNGA 1ETKA 2DMQA 2OF7A 5EG0B 3CCYA 1WH7A 1OCPA 1HLVA 2COBA 5JLWA 3LSGA 2GLOA 2K9NA 2O7OA 3RKQA 5EG0A 1MH4A 1JKQC 3HOWJ 4BY7J 1MSEC 3CMYA 1F43A 1TWAJ 3GTLJ 3Q0VA 4B1RA 1AHDP 1X58A 3BT9A 3FK6A 1ZQ3P 1OFCX 1U9NA 4A3GJ 4BXXJ 2X6OA 3JRIA 5M5XJ 2M8GX 4QTRA 2O9LA 1WH5A 2DTZA 1IJWC 1RKWA 4Y52J 1IC8A 3S1RJ 3HOZJ 2K9QA 2E1OA 4Y7NJ 1FIAA 5E3LA 3PO2J 1LFUP 4A3KJ 2YU9J 3GTQJ 2M0CA 5F0CA 1ITYA 2PMZN 2OPTA 4W1UA 2ME0A 1ORKA 2D5VA 4IHXA 4JYKA 1Y1WJ 5M3FJ 3A02A 4D7MA 2R0QC 1EF4A 4V2GA 3GTPJ 3TEDA 4JX4A 4M3DA 3BQYA 3OIOA 3M3YJ 2MSYA 3LSJA 2TRTA 4G12A 4L5EA 3K2AA 3HB9A 2R92J 4A3EJ 1ZTRA 1MBKA 5C4JJ 1MNMC 3ZQGA 1F36A 4I6ZA 1ZKGA 3BG3A 2CRGA 2HOSA 3Q0WA 2NVYJ 1LFBA 2N8GA 2ECBA 1ENHA 4CYCB 1APLC 1GVDA 4QIWN 2W48A 5J1UA 2VKVA 1SFOJ 4ABZA 1BA5A 3PO3J 1IV6A 2EZKA 2CJJA 5J3LA 4UUSB 2HXIA 3HEFA 3QPLA 1Z0XA 2K40A 2KT0A 5HODA 1GT0C 4B3AA 4CYCA 3DCFA 2Y2ZA 1BW5A 1HDPA 2E2IJ 1BJZA 3JRAA 5K7ZA 1SANA 4A3FJ 1Z77A 5GP9A 3JRBA 2KDZA 2FJ1A 2EQRA 5J1RA 2EH3A 3FKIJ 3TP0A 3FIWA 1PUFB 2NVQJ 4M6VA 3LOCA 1HCRA 4V2FA 4RBOA 3SDGA 3H0GJ 1I50J 4DYQA 3BTCA 3GTJJ 2WV1A 4X1EA 5IYDJ 5F1JA 2IBDA 2JWTA 5IP6A 1PUFA 3JRGA 2L7ZA 5IOZA 2LY9A 4AUXA 2ID6A 3G1LA 4JX5A 1JTXA 1JTYA 3HM5A 1XC5A 4FE4A 1CQTA 4X6AJ 2M9HA 3BQZA 4EEFG 1ZR4A 1Q1VA 2Y31A 4C3JJ 2DA3A 1UHSA 4A93J 1NK2P 1JKOC 3IH2A 3MVPA 1IUFA 2Y0SN 4D5CA 3SJMA 2WAQN 4XRSG 5FJ8J 3HOVJ 1DU6A 2IEKA 1AU7A 3HOUJ 4AYBN 3BR3A 4MFDA 4BY1J 1TWHJ 1VF9A 2LTPA 3TP3A 3C2BA 3TW7A 3BR6A 3S1NJ 3S17J 3S16J 2O8KA 4IHYA 4LOCA 1NTCA 1FTZA 5EDNA 4RDUA 2ME6A 4GFBA 1WCMJ 3WHCA 3ZQLA 4DYCA 2EZHA 4QSHA 5GPCA 1H8AC 1S7EA 2XPWA 2MGQA 5M5WJ 3IH3A 2LK2A 3B6AA 3K7AJ 2FQ4A 1B8IB 3JRHA 1LE8B 1YRNA 4BBRJ 1HDDC 3HOYJ 1A5JA 4A3CJ 5C44J 5F0FA 1B8IA 5IP9J 3SFIA 1FIPA 3RZOJ 2HI3A 4XIDA 3TW6A 1MBFA 3NARA 1W0TA 1LE8A 2IAIA 4A3IJ 2H1KA 1JGGA 3LNQA 5EZGA 1RESA 4A3JJ 4XRMA 1JT0A 2L7MP 1GUUA 5FKOA 5J1YA 1HOMA 3PM1A 3HGGA 3QPSA 4A3DJ 3G1MA 5JLXA 5M3MJ 1MBHA 2LFBA 1W0UA 3I4NJ 2M34A 2XB0X 3BTJA 4XRSA 1XG1A 5FLVA 4FISA 1B72B 2H8RA 1ETXA 1UG2A 3IH4A 5C4XJ 2ZB9A 2FD5A 3BG5A 1P7IA 2JJ7A 1B72A 4M3BA 1NK3P 4JX6A 2CQXA 1JKPC 2VPRA 1DU0A 4I76A 3M4OJ 4BKXA 3S15J 2MW8A 1FJLA 4AC0A 1QRYA 3A01B 3BR5A 3L1PA 4A3MJ 2R93J 3CDLA 4C3HJ 2HOAA 2Y30A 4IEJA 3B6CA 3A01A 1JT6A 1TWFJ 5E3MA 3H3VK 3ZQCA 1H88C 1Y1VJ 5FKLA 5K7HA 2EZLA 1RKTA 3OSGA 1X2MA 2XB5A 1IG7A 4IHWA 3VPRA 3Q3SA 1OCTC 3ZQIA 3I4MJ 2JN6A 2Y9ZA 4MFEA 3HDDA 3S1MJ 5F27A 1RPWA 5EEAA 2WB1N 2E19A 3BTIA 1JJ8C 1POGA 3BR1A 4IHVA 3Q0UA 1ZK8A 2CU7A 1JUSA 4A3LJ 2P81A 2JK3A 3RZDJ 3BTLA 4M3GA 2YUSA 1ETQA 1HF0A 1O4XA 3GTMJ 4XK4A 2E2JJ 2XRLA 1R9TJ 1WI3A 4HNVA 4FE7A 2NS7A 1VFCA 5F0HA 2GM4A 1ZR2A 1JKRC 1XS9A 2DA1A 2NOGA 2NVTJ 1P7JA 4FTHA 4BBSJ 5EYRA 1GV2A 1IDZA 4NDLA 5IYBJ 4MO7A 1WGXA 2L9RA 1MBJA 1U9OA 5FKKA 1TWGJ 2R5YB 4C3IJ 5EZHA 3S2HJ 3FK7A 9ANTA 2QF7A 5EF6A 2RAEA 5DTDA 4A3BJ 2XSDC 2DA6A 4JP0A 2DMNA 1YRNB 2R5YA 4A69C 2QCOA 1ETOA 2Y9YA 3QQAA 1ETYA 2DA5A 1IRZA 1ZGWA 1G2HA 3O8GA 1I3QJ 2CQQA 3O8HA 1K61A 2HOTA 3JRCA 2CUFA 4DZPA 1QVUA 3HOXJ 3D1NI 4DZJA 3LSRA 3BG9A 2DMUA 3OOUA 1ETWA 3BR0A 5IP7J 2JA6J 2CUEA 2L0KA 3FISA 4MLOA 1ETVA 3S14J 2HXOA 4S0HB 5DS9A 1T56A 2HQ5A 5F08A 2XPUA 2R5ZB 2I10A 1BL0A 1IGNA 3E7LA 5IPAA 1TC3C 2XGDA 3CQZJ 3G1OA 1BW6A 2DMPA 3GTGJ 2DA2A 2NS8A 3OSFA 5C3EJ 5IOYA 3WHBA 1OJLA 3ZQHA 2R5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3O A;  4M3F A;  1MSF C;  2DA4 A;  2AHQ A;  5K7F A;  3MN2 A;  1JJ6 C;  4D5F A;  1JUP A;  2XPV A;  5IYC J;  1MBE A;  3JR9 A;  4M3E A;  1D5Y A;  2DMT A;  2VKE A;  2HDD A;  4XIC A;  2FX0 A;  1WPK A;  3HKZ N;  3UKG A;  1GDT A;  2XGE A;  1A6I A;  3GBG A;  2DA7 A;  2LKX A;  3JRE A;  2ECC A;  4MIM A;  3LSP A;  1E3O C;  1IDY A;  2ELK A;  4DW6 A;  2G0E A;  3GTK J;  5E3N A;  2LVS A;  2E2H J;  5EGO B;  4J19 A;  2X9D A;  4D7N A;  3JRD A;  4C2M J;  3MKL A;  1K83 J;  3NAU A;  1GV5 A;  2X48 A;  2JA7 J;  3JRF A;  2DN0 A;  2NVX J;  2YS9 A;  2JMW A;  1FTT A;  5EGO A;  1QVT A;  2GBY A;  5M5Y J;  3GTO J;  3S1Q J;  2MG4 A;  5FKN A;  1QPI A;  3RQI A;  3S2D J;  2LP0 A;  3HGY A;  4UUS A;  2TCT A;  3DEW A;  2R7Z J;  2EZI A;  2LD5 A;  1TWC J;  2VI6 A;  1X2N A;  2ID3 A;  2HYJ A;  3HBL A;  5FKM A;  3W6V A;  1T33 A;  5F04 A;  1VI0 A;  2B63 J;  2VUM J;  2AO9 A;  4UUT A;  3ZOB A;  2JA5 J;  2K9S A;  1VND A;  1U78 A;  2DJN A;  2LR8 A;  3F0C A;  3BR2 A;  1H89 C;  5GPA A;  4FCY A;  1RR7 A;  5FLM J;  4W97 A;  2M2E A;  3IV5 A;  1I6H J;  1JUM A;  1AKH B;  3A03 A;  4DYR A;  3ZQF A;  1MBG A;  2L7F P;  1MH3 A;  1UMQ A;  2XGC A;  1U8B A;  2JA8 J;  4B4C A;  1RET A;  1AKH A;  1FEX A;  2LLK A;  2EBI A;  5BNG A;  1ETK A;  2DMQ A;  2OF7 A;  5EG0 B;  3CCY A;  1WH7 A;  1OCP A;  1HLV A;  2COB A;  5JLW A;  3LSG A;  2GLO A;  2K9N A;  2O7O A;  3RKQ A;  5EG0 A;  1MH4 A;  1JKQ C;  3HOW J;  4BY7 J;  1MSE C;  3CMY A;  1F43 A;  1TWA J;  3GTL J;  3Q0V A;  4B1R A;  1AHD P;  1X58 A;  3BT9 A;  3FK6 A;  1ZQ3 P;  1OFC X;  1U9N A;  4A3G J;  4BXX J;  2X6O A;  3JRI A;  5M5X J;  2M8G X;  4QTR A;  2O9L A;  1WH5 A;  2DTZ A;  1IJW C;  1RKW A;  4Y52 J;  1IC8 A;  3S1R J;  3HOZ J;  2K9Q A;  2E1O A;  4Y7N J;  1FIA A;  5E3L A;  3PO2 J;  1LFU P;  4A3K J;  2YU9 J;  3GTQ J;  2M0C A;  5F0C A;  1ITY A;  2PMZ N;  2OPT A;  4W1U A;  2ME0 A;  1ORK A;  2D5V A;  4IHX A;  4JYK A;  1Y1W J;  5M3F J;  3A02 A;  4D7M A;  2R0Q C;  1EF4 A;  4V2G A;  3GTP J;  3TED A;  4JX4 A;  4M3D A;  3BQY A;  3OIO A;  3M3Y J;  2MSY A;  3LSJ A;  2TRT A;  4G12 A;  4L5E A;  3K2A A;  3HB9 A;  2R92 J;  4A3E J;  1ZTR A;  1MBK A;  5C4J J;  1MNM C;  3ZQG A;  1F36 A;  4I6Z A;  1ZKG A;  3BG3 A;  2CRG A;  2HOS A;  3Q0W A;  2NVY J;  1LFB A;  2N8G A;  2ECB A;  1ENH A;  4CYC B;  1APL C;  1GVD A;  4QIW N;  2W48 A;  5J1U A;  2VKV A;  1SFO J;  4ABZ A;  1BA5 A;  3PO3 J;  1IV6 A;  2EZK A;  2CJJ A;  5J3L A;  4UUS B;  2HXI A;  3HEF A;  3QPL A;  1Z0X A;  2K40 A;  2KT0 A;  5HOD A;  1GT0 C;  4B3A A;  4CYC A;  3DCF A;  2Y2Z A;  1BW5 A;  1HDP A;  2E2I J;  1BJZ A;  3JRA A;  5K7Z A;  1SAN A;  4A3F J;  1Z77 A;  5GP9 A;  3JRB A;  2KDZ A;  2FJ1 A;  2EQR A;  5J1R A;  2EH3 A;  3FKI J;  3TP0 A;  3FIW A;  1PUF B;  2NVQ J;  4M6V A;  3LOC A;  1HCR A;  4V2F A;  4RBO A;  3SDG A;  3H0G J;  1I50 J;  4DYQ A;  3BTC A;  3GTJ J;  2WV1 A;  4X1E A;  5IYD J;  5F1J A;  2IBD A;  2JWT A;  5IP6 A;  1PUF A;  3JRG A;  2L7Z A;  5IOZ A;  2LY9 A;  4AUX A;  2ID6 A;  3G1L A;  4JX5 A;  1JTX A;  1JTY A;  3HM5 A;  1XC5 A;  4FE4 A;  1CQT A;  4X6A J;  2M9H A;  3BQZ A;  4EEF G;  1ZR4 A;  1Q1V A;  2Y31 A;  4C3J J;  2DA3 A;  1UHS A;  4A93 J;  1NK2 P;  1JKO C;  3IH2 A;  3MVP A;  1IUF A;  2Y0S N;  4D5C A;  3SJM A;  2WAQ N;  4XRS G;  5FJ8 J;  3HOV J;  1DU6 A;  2IEK A;  1AU7 A;  3HOU J;  4AYB N;  3BR3 A;  4MFD A;  4BY1 J;  1TWH J;  1VF9 A;  2LTP A;  3TP3 A;  3C2B A;  3TW7 A;  3BR6 A;  3S1N J;  3S17 J;  3S16 J;  2O8K A;  4IHY A;  4LOC A;  1NTC A;  1FTZ A;  5EDN A;  4RDU A;  2ME6 A;  4GFB A;  1WCM J;  3WHC A;  3ZQL A;  4DYC A;  2EZH A;  4QSH A;  5GPC A;  1H8A C;  1S7E A;  2XPW A;  2MGQ A;  5M5W J;  3IH3 A;  2LK2 A;  3B6A A;  3K7A J;  2FQ4 A;  1B8I B;  3JRH A;  1LE8 B;  1YRN A;  4BBR J;  1HDD C;  3HOY J;  1A5J A;  4A3C J;  5C44 J;  5F0F A;  1B8I A;  5IP9 J;  3SFI A;  1FIP A;  3RZO J;  2HI3 A;  4XID A;  3TW6 A;  1MBF A;  3NAR A;  1W0T A;  1LE8 A;  2IAI A;  4A3I J;  2H1K A;  1JGG A;  3LNQ A;  5EZG A;  1RES A;  4A3J J;  4XRM A;  1JT0 A;  2L7M P;  1GUU A;  5FKO A;  5J1Y A;  1HOM A;  3PM1 A;  3HGG A;  3QPS A;  4A3D J;  3G1M A;  5JLX A;  5M3M J;  1MBH A;  2LFB A;  1W0U A;  3I4N J;  2M34 A;  2XB0 X;  3BTJ A;  4XRS A;  1XG1 A;  5FLV A;  4FIS A;  1B72 B;  2H8R A;  1ETX A;  1UG2 A;  3IH4 A;  5C4X J;  2ZB9 A;  2FD5 A;  3BG5 A;  1P7I A;  2JJ7 A;  1B72 A;  4M3B A;  1NK3 P;  4JX6 A;  2CQX A;  1JKP C;  2VPR A;  1DU0 A;  4I76 A;  3M4O J;  4BKX A;  3S15 J;  2MW8 A;  1FJL A;  4AC0 A;  1QRY A;  3A01 B;  3BR5 A;  3L1P A;  4A3M J;  2R93 J;  3CDL A;  4C3H J;  2HOA A;  2Y30 A;  4IEJ A;  3B6C A;  3A01 A;  1JT6 A;  1TWF J;  5E3M A;  3H3V K;  3ZQC A;  1H88 C;  1Y1V J;  5FKL A;  5K7H A;  2EZL A;  1RKT A;  3OSG A;  1X2M A;  2XB5 A;  1IG7 A;  4IHW A;  3VPR A;  3Q3S A;  1OCT C;  3ZQI A;  3I4M J;  2JN6 A;  2Y9Z A;  4MFE A;  3HDD A;  3S1M J;  5F27 A;  1RPW A;  5EEA A;  2WB1 N;  2E19 A;  3BTI A;  1JJ8 C;  1POG A;  3BR1 A;  4IHV A;  3Q0U A;  1ZK8 A;  2CU7 A;  1JUS A;  4A3L J;  2P81 A;  2JK3 A;  3RZD J;  3BTL A;  4M3G A;  2YUS A;  1ETQ A;  1HF0 A;  1O4X A;  3GTM J;  4XK4 A;  2E2J J;  2XRL A;  1R9T J;  1WI3 A;  4HNV A;  4FE7 A;  2NS7 A;  1VFC A;  5F0H A;  2GM4 A;  1ZR2 A;  1JKR C;  1XS9 A;  2DA1 A;  2NOG A;  2NVT J;  1P7J A;  4FTH A;  4BBS J;  5EYR A;  1GV2 A;  1IDZ A;  4NDL A;  5IYB J;  4MO7 A;  1WGX A;  2L9R A;  1MBJ A;  1U9O A;  5FKK A;  1TWG J;  2R5Y B;  4C3I J;  5EZH A;  3S2H J;  3FK7 A;  9ANT A;  2QF7 A;  5EF6 A;  2RAE A;  5DTD A;  4A3B J;  2XSD C;  2DA6 A;  4JP0 A;  2DMN A;  1YRN B;  2R5Y A;  4A69 C;  2QCO A;  1ETO A;  2Y9Y A;  3QQA A;  1ETY A;  2DA5 A;  1IRZ A;  1ZGW A;  1G2H A;  3O8G A;  1I3Q J;  2CQQ A;  3O8H A;  1K61 A;  2HOT A;  3JRC A;  2CUF A;  4DZP A;  1QVU A;  3HOX J;  3D1N I;  4DZJ A;  3LSR A;  3BG9 A;  2DMU A;  3OOU A;  1ETW A;  3BR0 A;  5IP7 J;  2JA6 J;  2CUE A;  2L0K A;  3FIS A;  4MLO A;  1ETV A;  3S14 J;  2HXO A;  4S0H B;  5DS9 A;  1T56 A;  2HQ5 A;  5F08 A;  2XPU A;  2R5Z B;  2I10 A;  1BL0 A;  1IGN A;  3E7L A;  5IPA A;  1TC3 C;  2XGD A;  3CQZ J;  3G1O A;  1BW6 A;  2DMP A;  3GTG J;  2DA2 A;  2NS8 A;  3OSF A;  5C3E J;  5IOY A;  3WHB A;  1OJL A;  3ZQH A;  2R5Z A; 
#chains in the Genus database with same CATH topology
 3HG9 A;  2DW4 A;  4UV8 A;  5E3O A;  4M3F A;  3U9G A;  5K7F A;  1JJ6 C;  4KT5 C;  2F5V A;  1JUP A;  3BWG A;  3ZMS A;  3DU6 A;  4EJW A;  5FO5 A;  4M3E A;  4HQM A;  3BG7 A;  2D2W A;  2HNH A;  5FB2 A;  4XIC A;  1G3T A;  1TQP A;  4L9T A;  1WPK A;  3I71 A;  5FD5 A;  3UKG A;  4M6X A;  2LG4 A;  3H9Q A;  1MJA A;  2XGE A;  4GRI A;  1YQA A;  2H94 A;  3GBG A;  1R4N B;  4MIM A;  5D8L B;  3P9K A;  3GTK J;  2VJI A;  1W1W E;  2LVS A;  2FOW A;  4B43 A;  4CO8 A;  4XLP F;  1ON1 A;  3SDB A;  1G8X A;  1X1C A;  2X9D A;  1OCZ H;  4IO9 F;  3OS1 A;  2PG4 A;  4XKC A;  4G7H F;  1GV5 A;  5CLS A;  4BS9 A;  1JE8 A;  4GYG A;  4JK1 X;  2H8W A;  3K4M A;  2F5F A;  1I39 A;  3V42 A;  2HQN A;  2PMZ A;  3S32 A;  4U0W A;  2O5R A;  3X2Q H;  2GBY A;  2E5N A;  3OYD A;  1VQN I;  3RQI A;  2LP0 A;  2EZI A;  3W2V A;  1DPU A;  1VZ0 A;  2FNA A;  2VI6 A;  1XCV A;  2Z5U A;  4GXO A;  3W2W A;  3OOP A;  3R0A A;  3KP3 A;  2DLL A;  5FKM A;  4L9J A;  2VUM J;  2IP2 A;  5E18 F;  1Z05 A;  2JA5 J;  1VND A;  4XOR A;  3F0C A;  3BR2 A;  2JSP A;  2V26 A;  4MQ9 F;  1H89 C;  2HDW A;  3OS0 A;  3U2R A;  2X6W A;  1DP3 A;  5JHF A;  2KRF A;  3D5L A;  1D0X A;  4BQN A;  1MBG A;  2G7U A;  1TZL A;  2XC7 A;  1UMQ A;  2GQQ A;  2XGC A;  3ABK H;  3KCC A;  1WKM A;  1UHM A;  2WWY A;  4UVC A;  2P5L C;  2LLK A;  3K1M A;  5BNG A;  2DMQ A;  1OCP A;  1N25 A;  3KFW X;  3GZ5 A;  1BI2 A;  3RKW A;  2VQH A;  1YI2 I;  5JLW A;  1X1A A;  3LSG A;  4YRV A;  2OTJ I;  4AID A;  3RKQ A;  1YFH A;  5ICC A;  3DFG A;  3U1K A;  4BJ5 C;  1MH4 A;  4IVN A;  4Y33 A;  3OYA A;  2EFN A;  3QU3 A;  3IAM 2;  5B5E C;  2EFQ A;  1Z6T A;  4RS8 A;  2KRH A;  5DM7 F;  5FFZ A;  2K4B A;  4RB3 C;  4B1R A;  1MDM A;  3I4P A;  3RPQ A;  1X58 A;  4D1Q A;  4BQA A;  1OMI A;  3BJA A;  4OAY A;  3MFK A;  2QGU A;  3LA7 A;  4A3G J;  3H1C A;  3FHN A;  3HPG A;  4ASN A;  4AVP A;  2HEO A;  3DXJ F;  3JRI A;  2M8G X;  2HU9 A;  2CGP A;  4U7D A;  2CW7 A;  3DBR B;  2DTZ A;  3MQ0 A;  2W1O A;  1RZ4 A;  3HOZ J;  3S1R J;  4CZZ A;  4ZDL A;  1EH6 A;  4CCO A;  1N78 A;  2E35 A;  1B9M A;  1V4R A;  3GTQ J;  2PMZ N;  4AYB A;  5J40 A;  5J8F A;  2D5V A;  3K0L A;  3O3K A;  4JYK A;  1UG0 A;  1FBU A;  3OYN A;  4R79 A;  3FF5 A;  1EF4 A;  3VB2 A;  3GTP J;  2OQR A;  3BQY A;  1FLI A;  3DEU A;  2IVM A;  2UXX A;  2NAZ A;  1P2F A;  1X1P A;  2CW0 F;  2L9S A;  1R36 A;  2X51 A;  5C4J J;  3HXL A;  4OIN F;  1TNT A;  2TDX A;  4M72 A;  3NWS A;  2QEX I;  1ZHF A;  5D4R A;  3BJO A;  2HOS A;  4CCN A;  2CV1 A;  4UV9 A;  2JPB A;  2M7A A;  3CF2 A;  1XGS A;  4CYC B;  1MIJ A;  4R1H A;  1FOY A;  2QZ8 A;  2Z99 A;  5DCM A;  4ABZ A;  5A2Q K;  1SFO J;  3T1B A;  1H0M A;  4LD5 A;  3S8P A;  3K2Z A;  2EZK A;  2NRA C;  2UZK A;  4A12 A;  2WY7 Q;  5FLX K;  2XAF A;  4MGR A;  3TO9 A;  3LA2 A;  3HSE A;  3REO A;  2B0L A;  2ZXH A;  3I56 I;  3DBH B;  1HDP A;  3QAH A;  4RB1 A;  4ITV A;  3F8C A;  4LGW A;  3OR1 C;  2M30 A;  4IKF A;  2L02 A;  3J80 K;  1BI3 A;  5GP9 A;  4AIH A;  4CDG A;  1HW5 A;  3SZT A;  3CUQ B;  2FEZ A;  2DOD A;  2XRO A;  4RM2 A;  3MCZ A;  1PUF B;  2O3F A;  2FU4 A;  5K5R A;  2ZJP F;  2F48 A;  3TO6 A;  3OYH A;  1HCR A;  3IWF A;  2KIM A;  3I54 A;  3F22 A;  3SDG A;  3E3V A;  1FSE A;  3J81 K;  4X1E A;  5LEK A;  5F1J A;  2IBD A;  2Z2S B;  2GAU A;  1A31 A;  2BY1 A;  3ISP A;  3QOE A;  1RIO H;  3W2A A;  2XAQ A;  1U5T B;  3C1D A;  3SFZ A;  1E3P A;  4AUX A;  2GXA A;  3PJR A;  1JTY A;  2QWW A;  1HSJ A;  1CQT A;  4ESF A;  4C3J J;  2NNN A;  3SZG A;  4A93 J;  3MVP A;  4KUM A;  3HRS A;  2CH0 A;  2BGC A;  1Z67 A;  4HRI A;  2FXA A;  2CYY A;  3BDD A;  3MZ8 A;  5HDN A;  1R5H A;  4G6D A;  2Z1D A;  1SAX A;  3HOV J;  4PZJ A;  1AU7 A;  2DOA A;  1ZYR F;  4AYB N;  2EJR A;  2MD5 A;  2HWV A;  1XGN A;  2QLZ A;  3K4L A;  3HRT A;  1FY7 A;  4ETS A;  1Z3Y A;  3J7Z I;  3PSF A;  4D9J A;  1P92 A;  1J59 A;  1NHA A;  5B1B H;  2VKD A;  3I59 A;  4E7I A;  1FC3 A;  1BR4 A;  1P4W A;  3LFU A;  4KIG A;  2W82 A;  2ZJQ F;  2MA3 A;  4RDU A;  3PNY A;  3CP2 A;  1AA7 A;  5L3B A;  4UB8 C;  4ZYD A;  3H0D A;  5J8C A;  4GFB A;  3WHC A;  2EA4 A;  2EZH A;  2AQE A;  2XVC A;  3NRV A;  4ZYA A;  2PJR A;  3GW2 A;  5EEH A;  1S7E A;  3FMS A;  2KIU A;  3H5R A;  3L2R A;  5M5W J;  4BUP A;  1X3Z B;  1LUJ B;  3B6A A;  3TBI A;  1WSU A;  3KZI C;  1D8J A;  3HOT A;  3GFL A;  2Y0S A;  4BBR J;  2Z9O A;  2L3D A;  1OQY A;  4PDK A;  2WAQ A;  3G71 I;  4B48 A;  2CQ7 A;  4BDY A;  2HI3 A;  1EJ9 A;  4HSR A;  4HDV A;  1R49 A;  2DOF A;  1IN4 A;  4A3J J;  1XCB A;  2XIG A;  1ZAO A;  4BXU A;  1TQI A;  1XMX A;  1JT0 A;  5FKO A;  2VON A;  2F5E A;  2XF6 A;  5J1Y A;  3PM1 A;  3QPS A;  2DTR A;  2LKP A;  5M3M J;  3FM3 A;  1MBH A;  2LFB A;  3ULQ B;  3GLL A;  4PSX A;  1W0U A;  2M34 A;  3WGH A;  2FOK A;  4ZZD A;  3EYI A;  5L3G A;  1SFE A;  4M74 A;  1TQM A;  2XGX A;  1UG2 A;  2F4O B;  4HDU A;  5KNL A;  2P6T A;  2KIQ A;  3B02 A;  2QA4 I;  2JJ7 A;  4EJV A;  4LFU A;  2EIK H;  4M3B A;  1W36 C;  1BOA A;  1K4T A;  3C2H A;  1DU0 A;  4I76 A;  4II2 A;  2QSH X;  4XLC A;  2MW8 A;  1YW9 A;  3A01 B;  1X3W B;  3CDL A;  4C3H J;  3D5S C;  2FBI A;  3OWT A;  1WVR A;  3R6S A;  4ZDP A;  1X4P A;  2HDC A;  1MMD A;  2E1C A;  3LWF A;  5F1R A;  3I5U A;  2NNY A;  2KQR A;  5K7H A;  1LJ9 A;  4CCL A;  4IHW A;  3VSL A;  2DDA A;  4E7L A;  1U0J A;  2BOL A;  3ZQI A;  2LRE A;  2V4J C;  3HZJ A;  3ECH A;  4XKV A;  4XNF A;  2Y9Z A;  4MFE A;  2Q2E B;  2BW3 A;  2VE8 A;  1IN6 A;  4ON0 A;  5EEA A;  1FMW A;  1G3S A;  5LHI A;  1LQ1 A;  1POG A;  1YE9 A;  1T8I A;  3HKZ A;  4ZTJ A;  1DGR M;  3E6D A;  3OYG A;  4IHV A;  1BN5 A;  3B73 A;  3K70 D;  2AXT C;  3TMO A;  3PL8 A;  1R7J A;  1R5G A;  3F3X A;  4XK4 A;  2EIL H;  4FX4 A;  2XRL A;  1ULY A;  3ASN H;  4RAF A;  3SEQ A;  4R8H A;  1QHH D;  2Z3Y A;  3WTV C;  3I58 A;  4QPO A;  4YFX F;  2A61 A;  2NOG A;  3K6G A;  4JBA A;  3QWL A;  1P7J A;  2K86 A;  2ZXW H;  3CJR B;  3EUA A;  3LSH A;  4WXH A;  4M6Y A;  1K7A A;  4BBS J;  4Y3O A;  1IRX A;  1IDZ A;  2R7D A;  4NDL A;  5TJJ A;  1WGX A;  3L9F A;  1TWG J;  3I64 A;  4C3I J;  3KZZ A;  5DV5 A;  5EZH A;  4BEH A;  9ANT A;  2MC3 A;  3GXO A;  4A3B J;  2DA6 A;  1RUN A;  2DMN A;  3CLO A;  2IS6 A;  3E6B A;  5E8G A;  5BPD A;  3RKX A;  2R5Y A;  2QCO A;  2W24 A;  5FRO A;  2Y48 A;  3WE2 A;  2M3A A;  2DYR H;  4GCV A;  4O6J A;  3QQA A;  2OA4 A;  4RGX A;  3UNG C;  2PLY A;  1BI0 A;  4XOT A;  2KHM A;  2KDO A;  4IQJ A;  3OR2 C;  4NC6 A;  5HDG A;  2JQ7 A;  2O03 A;  2CQQ A;  3RDI A;  1V5E A;  2X6X A;  2CWE A;  3OL3 A;  3JRC A;  2WAE A;  4DZP A;  1QVU A;  3HOX J;  3D1N I;  4DZJ A;  4B47 A;  4YIF A;  4BHC A;  3BG9 A;  2QSG X;  2DMU A;  5FD6 A;  1MJB A;  1ETW A;  3BR0 A;  3C2G A;  1KON A;  5IP7 J;  2JA6 J;  3FIS A;  1ETV A;  5DS9 A;  3BG6 A;  3EQL F;  2KIS A;  2XPU A;  4NNJ A;  2CMP A;  1BL0 A;  1TC3 C;  1XGO A;  2XGD A;  2XAG A;  3G1O A;  1BW6 A;  1D0Z A;  3O2P E;  1TL8 A;  4NUB A;  1W7P A;  3OYF A;  3T8T A;  5C3E J;  5IOY A;  2L7K A;  2L9N A;  3JW4 A;  1WJC A;  2VOD A;  1FX7 A;  1MKM A;  4EAT A;  1G6N A;  3MN2 A;  3RIR A;  5D4S A;  4YEL A;  2MAB A;  2VJJ A;  1MBE A;  2HQA A;  4HPQ A;  1D5Y A;  1ON2 A;  5CJ9 A;  2HDD A;  4KYW A;  3QU6 A;  2HKX A;  2W4S A;  2UXN A;  3HKZ N;  3LST A;  1GDT A;  2LSO A;  4WF2 A;  1WWX A;  2GIV A;  3TDZ C;  1XPX A;  3CZ6 A;  3RSN A;  3QP6 A;  4IOA F;  3LSP A;  4A2U A;  3FHZ A;  3RYR A;  1IDY A;  2ELK A;  2K27 A;  2EIJ H;  4DW6 A;  1UB9 A;  1W5S A;  2E2H J;  3VFZ A;  3I9V 2;  3OMY A;  1QO0 D;  1BR1 A;  4F92 B;  3D5R C;  1SD6 A;  3KIO A;  2WAD A;  1DGW Y;  2A6H F;  2OD5 A;  3ECO A;  3MKL A;  3JRD A;  1B6A A;  3NAU A;  2RC4 A;  2X48 A;  3T8R A;  3WOD F;  3JRF A;  1UHW A;  3F8N A;  2OZ6 A;  4NB5 A;  3EUH C;  5B66 C;  2NVX J;  4Y4R A;  5HS7 A;  1PDN C;  2JMW A;  4AD9 A;  1J0R A;  1IXC A;  5EGO A;  3E1S A;  2IA1 A;  1GVJ A;  1ZH5 A;  2BBY A;  1WRJ A;  1QVT A;  1FBS A;  3GTO J;  2W25 A;  3WTX C;  2H6C A;  5B1A H;  4D0P A;  4UUS A;  4IJA A;  1BIA A;  3DEW A;  2B7E A;  4LMY A;  2GWR A;  3WG7 H;  4C9Y A;  2LD5 A;  2Y69 H;  2X0L A;  3KYC B;  1TWC J;  2L54 A;  3R61 A;  1J75 A;  5ILU A;  2HGC A;  2UUZ A;  3HBL A;  3E97 A;  3HRM A;  2KPM A;  4F52 A;  1T33 A;  3W6V A;  2K85 A;  4LLL A;  2HR3 A;  4M71 A;  3FXK A;  5L3D A;  2LR8 A;  5D5X B;  2E34 A;  3BZ6 A;  3U1D A;  4HF1 A;  5FLM J;  2M2E A;  4WK8 F;  3W3C A;  1I6H J;  3FKJ A;  4Z6Y A;  2PQ8 A;  1SMT A;  1BJA A;  3A03 A;  2L9V A;  4DYR A;  2XF7 A;  3N97 A;  4WX9 A;  1P4A A;  4XOP A;  1MH3 A;  4LG0 B;  5IT3 A;  3G73 A;  2A3S A;  1E17 A;  1OLT A;  1U8B A;  3VYU B;  2W00 A;  3WGG A;  4B4C A;  2PMH A;  1FEX A;  4LLN A;  1R58 A;  2EBI A;  4BJT A;  4L5I A;  1ZGA A;  2P4W A;  4CCJ A;  2HZD A;  2LRD A;  2G7H A;  3NQO A;  4YG2 F;  3M07 A;  2V79 A;  2K9N A;  2CO5 A;  2RQQ A;  1MDM B;  2LYC A;  5EG0 A;  5E1W A;  4NQW A;  3RKY A;  2A07 F;  3HOW J;  2MFZ A;  3HTS B;  4IHT A;  2PBI A;  1D1A A;  3GTL J;  5JR3 A;  4PJJ A;  2VPL A;  4XRF A;  2R7F A;  4E6K G;  3H3U A;  3BT9 A;  4PK4 A;  1RRJ A;  1D1B A;  1K79 A;  1ZQ3 P;  2MC4 A;  4UVB A;  1U9N A;  2KLO A;  4L9V A;  2HQR A;  2ZME C;  5K1Y A;  4PJM A;  1WH5 A;  2KJB A;  1IXR C;  4LK0 F;  1IJW C;  2BXY A;  4YII A;  1RKW A;  4E7Z A;  5HOO A;  2A68 F;  3HHG A;  2E1O A;  4HLY A;  4IHS A;  5HVQ C;  2YU9 J;  2XV4 S;  4PCQ A;  1VQP I;  2OV7 A;  4CCK A;  2ZJ2 A;  1Q1H A;  2BYV E;  2OPT A;  3QOD A;  4W1U A;  2L4M A;  3H35 A;  3GZ6 A;  4YEJ A;  2QBY B;  2HOE A;  4XON A;  5CVU A;  2R0Q C;  1S6L A;  3F72 A;  3FM5 A;  1JHF A;  1XSX A;  1V55 H;  3F8M A;  3N05 A;  4JX4 A;  3TED A;  2CQK A;  3OIO A;  3K4J A;  3GWZ A;  4BE2 A;  2DXI A;  3LSJ A;  5CYV A;  3HB9 A;  2DYS H;  2K4J A;  4DJA A;  1UFM A;  2F6C A;  4LLG F;  3H3Z A;  4ZYE A;  4I6Z A;  1F36 A;  2V9K A;  1YJN I;  1ZKG A;  2X1D A;  1BBY A;  3QYF A;  2IA0 A;  2CRG A;  2XAJ A;  2NVY J;  2GOM A;  1LFB A;  1OCC H;  1DP7 P;  2ECB A;  1ENH A;  2M45 A;  2W48 A;  2VKV A;  4A5M A;  1DUX C;  4J00 A;  1K6Y A;  3F8B A;  3PO3 J;  2CJJ A;  5J3L A;  1BM9 A;  2E1M B;  1Z0X A;  3H92 A;  3OV8 A;  5HOD A;  1K78 A;  1SFX A;  2ZSH B;  4FX0 A;  4MHG A;  4KA4 A;  3DCF A;  2DPD A;  2Y2Z A;  2P8T A;  1BJZ A;  2DDB A;  2EPF A;  5K7Z A;  2KMU A;  1ZLK A;  2KIF A;  2HVQ A;  1YX3 A;  1S7O A;  4L5J A;  4KDP A;  3JRB A;  2BVM A;  2FJ1 A;  2EH3 A;  4F7Z A;  2D1V A;  1FP1 D;  4G9Y A;  2ZO4 A;  5FGM A;  1S3J A;  1Z91 A;  1LDJ A;  4RAG A;  3ZQ7 A;  1WJE A;  3BTC A;  4MEY F;  1QBJ A;  1ZGJ A;  5GAE J;  2PJP A;  3A0B C;  2EIM H;  3H36 A;  5IP6 A;  3PQJ A;  5EJC A;  1TBX A;  4A0Y A;  3S3M A;  1CGP A;  3W6K B;  2R7X A;  3ABU A;  3ZQQ A;  1KU7 A;  2IS1 A;  2AQF A;  3HHH A;  5IOZ A;  2LY9 A;  4OIO F;  2ID6 A;  2E7X A;  4XN0 A;  1Y39 A;  1JTX A;  2DFE A;  2O0Y A;  1R1U A;  3HM5 A;  3K4B A;  3NWT A;  2M9H A;  3BQZ A;  4FE4 A;  1X1D A;  4EM0 B;  1U3E M;  2Y31 A;  3ZR8 X;  3G2B A;  2FNP A;  3FMR A;  3M8F A;  5DYM A;  2XKO A;  4IRH A;  2EFO A;  2MYS A;  1IUF A;  4NC8 A;  4KFC A;  2EFP A;  3P5J A;  3QYB A;  3SJM A;  3CJQ B;  1L0O C;  3GZN B;  1A35 A;  3MMY B;  3WTU C;  4XRS G;  4O5V A;  5FJ8 J;  1DU6 A;  3SZP A;  1T2K A;  2IEK A;  1B1B A;  3HOU J;  3ZMU A;  2P0W A;  3BR3 A;  3I59 B;  4OIR F;  1TWH J;  1IZ1 A;  2M87 A;  2YU3 A;  3TP3 A;  4A0X A;  3BR6 A;  1MND A;  3S1N J;  3IKV A;  2VB6 A;  3QPT A;  2LOO A;  2WTE A;  2HKO A;  2HZT A;  1NTC A;  4ENJ A;  2PJR B;  3FX3 A;  4KT6 A;  1YLF A;  2JA2 A;  3LAP A;  3WTT C;  1XMK A;  2WB1 A;  5ILS A;  1T95 A;  2RDP A;  3WU2 C;  3E5U A;  3R60 A;  1WCM J;  2IW5 A;  3IP4 B;  4G6T B;  3EUH A;  3ONQ A;  1Z9C A;  2XAU A;  3OIQ A;  4HG2 A;  4IL6 C;  4S04 A;  1QHG A;  3DKW A;  4GGG A;  3LQQ A;  5KVR A;  2LK2 A;  3K7A J;  1XN7 A;  4S05 A;  3KEQ A;  3JRH A;  1KQ0 A;  4H4K C;  4ZYG A;  2YSR A;  3HOY J;  1A5J A;  5HLT A;  4KN4 X;  1ZG3 A;  3CTA A;  1QZE A;  5F0F A;  3SFI A;  4HNT A;  1SD4 A;  4XID A;  1MBF A;  2CW8 A;  3NAR A;  1W0T A;  4E7S A;  4C30 A;  1JGG A;  3LNQ A;  3T0Y A;  1T38 A;  4EMS A;  2X85 A;  3HIF A;  3ZN1 A;  5J4V A;  4XRM A;  4F91 B;  4CSW A;  1GUU A;  4OIQ F;  1HOM A;  3CLQ A;  4XM3 A;  5JLX A;  5F6F A;  3HYI A;  1XX5 A;  4QPQ A;  2XB0 X;  4UUV A;  3M9A A;  3ZGK A;  4B09 A;  2ISY A;  2CQN A;  1YO5 C;  3HUG B;  2PMU A;  4ZJZ A;  4C2T A;  3IH4 A;  1VQ6 I;  3BY6 A;  1Y0N A;  3PNV A;  2ZB9 A;  5LRS A;  2FD5 A;  3BG5 A;  4MEX F;  4BU2 A;  2MH9 A;  1OPC A;  3F9K A;  4UNO A;  3HOS A;  2V9V A;  2VJ4 A;  2CQX A;  3QP5 A;  4BGD A;  4ZYH A;  4FQG A;  4Y17 A;  3M4O J;  3VDX A;  1FJL A;  5LD2 C;  4HF2 A;  4KIC A;  3GVA A;  5A2Q Z;  2STW A;  1G3Y A;  3JAM Z;  2R93 J;  2HTJ A;  3OYM A;  1NG6 A;  2Y30 A;  4RMN A;  4IEJ A;  5GTH C;  1ZRD A;  2VXD A;  1I6X A;  3B6C A;  3WU0 A;  1JT6 A;  1Y56 A;  1TWF J;  5E3M A;  1W7P D;  2V7F A;  3ZN0 A;  2BW3 B;  2EZL A;  3VWB A;  3OSG A;  1IW7 F;  1X2M A;  4G94 A;  4MTE A;  3VPR A;  5LRR A;  2VXZ A;  4EJT A;  3J80 Z;  3I4M J;  4RB0 A;  1SVO A;  2GA1 A;  1XSV A;  2ZME A;  2JN6 A;  4XSX F;  3HDD A;  1IN7 A;  1HQC A;  3F6V A;  2L01 A;  1RPW A;  4BQO A;  3K4C A;  2WB1 N;  2E19 A;  3TL4 X;  5BS6 A;  2R7Q A;  1VQ4 I;  3CDI A;  4PJ0 C;  3BR1 A;  3J81 Z;  1YS6 A;  1G4D A;  1QGP A;  1S7A A;  2A6E F;  1T98 A;  1Y6I A;  4XLN F;  1UST A;  1ZK8 A;  4I0B A;  1SVL A;  4U7B A;  2VOP A;  4G8X A;  3BTL A;  2ZJR F;  3L09 A;  5J47 A;  1HF0 A;  3ERE D;  2MD0 A;  3CUO A;  3L7W A;  1SFU A;  3A0H C;  2F4M B;  2RRE A;  4KJZ A;  4M73 A;  2YX4 A;  2LBF A;  2GA2 A;  1B59 A;  4FE7 A;  3W6J B;  1F5T A;  2XHK A;  3HJE A;  4UVA A;  5AIP A;  4E7K A;  2ZXJ A;  2JTV A;  4XKW A;  4BEH B;  1D0Y A;  2CFX A;  3BPX A;  5GAH J;  2RNG A;  5IY5 H;  1YHQ I;  1ZEL A;  5FKK A;  1MBJ A;  1YOV B;  3BPV A;  2K7L A;  4IXA A;  4CYD A;  2R5Y B;  3MD2 A;  1K6O A;  3S2H J;  3FK7 A;  5ICE A;  1VQL I;  1Z3X A;  5DUI A;  4KIT B;  2EWN A;  2RAE A;  2I8D A;  5DTD A;  2XSD C;  2VBX A;  5GAG J;  3OYK A;  3LSM A;  5D5W B;  1H9T A;  2E71 A;  1YRN B;  1QU3 A;  3KEY A;  4WXC A;  2CUJ A;  4II3 A;  1R00 A;  3TO7 A;  2DK5 A;  2Y9Y A;  3OY9 A;  2FUG 2;  1LB2 A;  3CCR I;  1ETY A;  4NC7 A;  1ZRE A;  1IXS B;  3PUF A;  1IRZ A;  5L3F A;  3U21 A;  1FT9 A;  1D5V A;  2BEO A;  1O7L A;  2X1C A;  2M0M A;  3CD6 I;  4ANJ A;  1NG7 A;  4FET A;  2HOT A;  2DJI A;  3V8L A;  2CUF A;  2IA2 A;  2M7B A;  3Q5F A;  3FBN B;  4LB6 B;  4ZZL A;  4P5O A;  1W7P B;  3FXL A;  2CUE A;  3MWM A;  5LBQ A;  4MLO A;  4XLE A;  1PP7 U;  1R5I D;  1YW7 A;  3MZY A;  2X6Y A;  3MKW B;  2R7T A;  2M5W A;  1G59 A;  2DMP A;  1KU2 A;  5LEJ A;  3GTG J;  2VE9 A;  1J5Y A;  2A5Y B;  4I09 A;  1LNW A;  1BW5 A;  2V6C A;  5ED4 A;  4BJ6 C;  1ZAR A;  1MSF C;  2RKH A;  4HW0 A;  2NXN B;  5GTI C;  2VLA A;  4D5F A;  3AAF A;  2RVC A;  4HX4 A;  2PX9 A;  2R7W A;  5IYC J;  2DFH A;  1E3H A;  4HX8 A;  4BAC A;  2DMT A;  2VKE A;  4HZF A;  1OCO H;  1GXQ A;  3PQK A;  2FX0 A;  3G3Z A;  1A6I A;  2DA7 A;  1XMA A;  2V1X A;  4I01 A;  4JQF A;  4BXF A;  3K4K A;  4CH7 A;  2ECC A;  1E3O C;  2ISZ A;  1ZLJ A;  3MKY B;  2G0E A;  3HC7 A;  5E3N A;  4WCG A;  1SD5 A;  4BH9 A;  2XSJ C;  5EGO B;  4N9I A;  4D7N A;  1V5F A;  4HQE A;  1K83 J;  2JA7 J;  3L2C A;  2DN0 A;  3KX2 A;  2Q0O A;  2VQC A;  5H2F C;  3HSR A;  2JVG A;  3DLL F;  1LDK B;  4EQQ A;  1FTT A;  2QQA A;  2R3S A;  3QOP A;  1YIJ I;  1B4A A;  2VC0 A;  2O6G E;  2VJ5 A;  1RNL A;  3S1Q J;  2BY3 A;  2MG4 A;  5FKN A;  2E1N A;  4CXF A;  1USS A;  2R7Z J;  5LHH A;  1O7F A;  1X2N A;  2HYJ A;  1ACI A;  2DQL A;  4AIK A;  5F04 A;  3AL0 C;  4LK1 F;  1U78 A;  4U0Y A;  2OC6 A;  2DJN A;  3KLN A;  4XN3 A;  1FOW A;  3BZK A;  3RTR A;  4FCY A;  1RR7 A;  1DPR A;  3DTK A;  3UR3 C;  3IV5 A;  1JUM A;  5LLQ A;  3WE3 A;  2VQG A;  2COM A;  3ZQF A;  5LFA A;  5HS9 A;  4KNY A;  1T08 B;  3M7G A;  1S72 I;  2M4G A;  2P5K A;  2LH9 A;  2JA8 J;  1PVE A;  1RET A;  3D0S A;  3KEO A;  1AKH A;  4RGS A;  1ETK A;  1O3S A;  3E5Q A;  4BNC A;  5EG0 B;  3CCY A;  1HLV A;  5CVJ A;  4KMF A;  2DPU A;  1T0F C;  3KYD B;  2ICW G;  2GLO A;  3AKZ A;  2O7O A;  5CVR A;  4LG3 A;  1FBQ A;  1MMN A;  2H27 A;  1JKQ C;  4TV7 A;  2QKM B;  5HLH A;  4BY7 J;  3GX4 X;  1X19 A;  4IRG A;  3JSP A;  1TWA J;  3Q0V A;  1NH3 A;  4LB5 A;  5KAI C;  1FYL A;  2FQ3 A;  1AHD P;  2DT5 A;  1AWC A;  3FXJ A;  2VC1 A;  3FK6 A;  4GDF A;  3VEP A;  4Q4Z F;  2GIZ A;  1YS7 A;  3MAJ A;  1OFC X;  3I3L A;  5BMZ A;  1KU9 A;  2L2O A;  3K4N A;  4BHP A;  4BXX J;  2JT1 A;  2X6O A;  3FZV A;  2KL4 A;  3VOE A;  4PFP A;  4A0Z A;  2O9L A;  1IRG A;  3SQN A;  2HYF A;  1T6S A;  4A5N A;  2F2E A;  5CQE A;  4Y7N J;  2XAH A;  3KYL A;  4QWQ A;  3EET A;  1HW2 A;  1XB4 A;  4EVI A;  2W85 A;  5F0C A;  3DKX A;  1ZRC A;  1ITY A;  3M8J A;  3OYE A;  1CF7 A;  5JVG F;  1Y1W J;  2CG4 A;  1KA8 A;  4EGY A;  4NBQ A;  2R7U A;  4V2G A;  5FRM A;  3IUO A;  4M3D A;  3V7R A;  3V4G A;  3RI4 A;  2HVR A;  1MMA A;  3BCA A;  2TRT A;  4L5E A;  3K2A A;  4ENK A;  2R92 J;  4FHT A;  3E5X A;  2Q8K A;  1MBK A;  4IZZ A;  2EA2 A;  2P5V A;  4DIQ A;  1MNM C;  5ICF A;  3ZQG A;  3BG3 A;  1IN5 A;  3Q0W A;  2N8G A;  4CGZ A;  2BHZ A;  1K78 B;  2XKP A;  1APL C;  5J1U A;  4Q5S F;  4FT8 A;  3BJ6 A;  3IKT A;  4XQF A;  1IV6 A;  1Z7U A;  1JXS A;  2QVO A;  3KP4 A;  3QPL A;  2K40 A;  1R6R A;  4OAZ A;  4EGZ A;  1X1B A;  2JUG A;  4E4H A;  2E2I J;  3JSO A;  3FXR A;  3GLX A;  2VKH A;  2V9P A;  2YPR A;  5CPR B;  1Z77 A;  3O6B B;  2WAF A;  4J01 A;  1I1G A;  1H9G A;  2EQR A;  3HSF A;  3K9T A;  3FXU A;  3TOA A;  3FIW A;  4HOB A;  3TP0 A;  4XLF A;  5H6R A;  3LOC A;  4CUG A;  4V2F A;  4Z2Y A;  4RBO A;  1I50 J;  3H0G J;  2WV1 A;  1FPQ A;  3IHU A;  2VQL A;  1A36 A;  5FFX A;  2JWT A;  3MEX A;  4F3Q A;  1EH8 A;  4NHJ A;  3OYL A;  1K4S A;  3QYE A;  2G9W A;  2L7Z A;  1HST A;  3G1L A;  1J2X A;  2XRN A;  4JX5 A;  5TRD A;  1XC5 A;  2CV0 A;  1UAA A;  1Q1V A;  2DFF A;  5E79 C;  2XDV A;  2DA3 A;  4E7J A;  1UHS A;  1NK2 P;  1JKO C;  3GO5 A;  3IH2 A;  3GFI A;  2KRC A;  4RGR A;  2VN2 A;  3L2Q A;  2R4G A;  3KP6 A;  1VQO I;  1LPQ A;  5IT9 Z;  4E70 A;  2CS3 A;  4PJN A;  2OJE D;  3DTE A;  3V8J A;  1J7K A;  3KPH A;  2L5Q A;  1EA3 A;  3EYY A;  2EIN H;  5HS8 A;  5BQT A;  4F93 B;  1Z21 A;  1U8R A;  3J7A O;  1D8K A;  2JUC A;  4MFD A;  1DQU A;  1VF9 A;  3KE2 A;  3GYH X;  3ML6 A;  2QEN A;  1WZ2 A;  3C3W A;  2IGO A;  3BP8 A;  4HA8 A;  1IUY A;  2FA5 A;  4IHY A;  4LOC A;  3V7S A;  1UZC A;  2DBB A;  2R7R A;  1T39 A;  3HPH A;  5L3E A;  1FTZ A;  3S2W A;  5KHD A;  3FXO A;  1UEL B;  2FBH A;  4XR6 A;  5E1Z B;  4L9N A;  4KIS A;  2ME6 A;  4LJZ F;  3VSK A;  1PYV A;  3ZQL A;  4DYC A;  5GPC A;  4QSH A;  1ZN2 A;  1LDD A;  3WGI A;  1H8A C;  2XPW A;  4EV0 A;  2MGQ A;  2WBM A;  1QQI A;  2XAS A;  3G4S I;  3IH3 A;  5HLI A;  2FQ4 A;  3TOB A;  2E1M C;  4HV5 A;  3A4C A;  4M9X A;  5BOX A;  3L2V A;  2QQB A;  5JFR A;  1HDD C;  3RCO A;  4A3C J;  2BVL A;  5C44 J;  2IGM A;  3GFM A;  3CO6 C;  2QUF A;  3K10 A;  3WTZ A;  5IP9 J;  1B8I A;  2DCE A;  3CCU I;  3KP5 A;  4ZC3 A;  4OMZ A;  3KZY A;  3RQ4 A;  3DWL E;  1MGT A;  2ZSI B;  3TW6 A;  1LE8 A;  1IO2 A;  3P9I A;  5JI6 A;  4A3I J;  2H1K A;  5EZG A;  1R71 A;  3VYS B;  3P7N A;  3ZXS A;  4BHB A;  4RLF A;  3ZRG A;  4WWC A;  3VYT B;  2Z16 A;  4UY8 I;  3CES A;  1HA8 A;  1YJ9 I;  3EDP A;  4Q48 A;  5LGT A;  4HYE A;  1R1V A;  1YTY A;  5JVT A;  5FLV A;  1XG1 A;  1PP8 F;  1IV8 A;  4FIS A;  1B9N A;  5DCM B;  4MTD A;  1YJW I;  4IQ4 A;  3KLO A;  4I2O A;  1O57 A;  1TT5 B;  1HW1 A;  4B44 A;  3GME A;  1ETX A;  1IRF A;  3FMQ A;  4XBF A;  2OCE A;  5C4X J;  1KYZ A;  2BHY A;  5EEG A;  3ZP5 A;  1B72 A;  1NK3 P;  4JX6 A;  1T0F A;  1P6R A;  5D5V B;  3I55 I;  4UB6 C;  3DU5 A;  5AIQ A;  3DKY A;  1Z7L A;  5ILV A;  2YR2 A;  2VT3 A;  4BDZ A;  1QRY A;  3CO7 C;  2KP6 A;  1MJ9 A;  4A3M J;  1TLH B;  4HST A;  3CCM I;  2HOA A;  3HL2 A;  1HKQ A;  4U87 A;  3CME I;  4BL0 B;  1AOY A;  1ONV A;  4CHU A;  1SFK A;  3LL7 A;  3FWE A;  2IS2 A;  2ZME B;  3PUB A;  2QM3 A;  3ZQC A;  1H88 C;  1HBX G;  1Y1V J;  3CCS I;  4L18 B;  3PSI A;  4OU0 A;  1RKT A;  5LGN A;  2DFI A;  2XB5 A;  3LA3 A;  2HTS A;  1P4X A;  1OCT C;  2LF7 A;  1G3W A;  3V8K A;  1MMS A;  1STZ A;  1SD7 A;  5DDG A;  1TNS A;  1KZH A;  1S9H A;  2H6B A;  5F27 A;  2O8X A;  3S1M J;  3DEE A;  3BTI A;  2M4K A;  1BC7 C;  5HNF A;  3G6E I;  1OR7 C;  2HFH A;  4KIB A;  5J4Y A;  3PFY A;  2CU7 A;  2LBF B;  3TQN A;  1VQ7 I;  3BC8 A;  2JK3 A;  2IRF G;  3RZD J;  4M3G A;  1SMY F;  2X4H A;  1ETQ A;  1VQM I;  4DNC A;  3GTM J;  2ETH A;  1V3F A;  2E2J J;  1WI3 A;  4G7Z F;  4I0A A;  1I1S A;  5F0H A;  1ZR2 A;  1JKR C;  1XS9 A;  2NVT J;  3QRF F;  5H20 A;  4FTH A;  1GV2 A;  2BE5 F;  1F1Z A;  5IYB J;  2L9R A;  1TT0 A;  4IPA A;  2GOX B;  5CQG A;  3L2U A;  3VYR B;  2K9L A;  2BXZ A;  2KZV A;  2LDU A;  4LG0 A;  3F6O A;  5EF6 A;  4HAM A;  3Q9S A;  4A6E A;  3L00 A;  4M9S A;  4A69 C;  1J9I A;  3A2K A;  4HV6 A;  1WJB A;  2GXB A;  1MNE A;  5J6X A;  1FMV A;  2DA5 A;  3CC2 I;  2HPM A;  2UV1 A;  1YW8 A;  2VBW A;  3GEZ A;  2C6Y A;  3O8H A;  1K61 A;  2MH2 A;  2JSC A;  3BRO A;  1WJD A;  4N4O B;  1EV7 A;  2ZNZ A;  3DBL B;  3ESW B;  2CFO A;  3LQR A;  2VBY A;  1BC8 C;  3K1N A;  5D6E A;  3OOU A;  3WTS C;  4B8X A;  1VQ9 I;  1VTN C;  2L0K A;  3I0T A;  1ZG5 A;  5CVI A;  2BV6 A;  4FAS D;  1SEU A;  4S0H B;  1QA6 A;  3CUQ C;  5DD8 A;  5LGU A;  2A05 A;  2I10 A;  4IRI A;  1IGN A;  4OIP F;  3CQZ J;  4N0B A;  4RAZ A;  2ZKZ A;  2GXG A;  3OSF A;  1Y8Q B;  3WHB A;  4XKB A;  2R5Z A;  3FXQ A;  4LIU A;  2LMD A;  3ABL H;  5AON A;  2DA4 A;  2AHQ A;  6PAX A;  1U5T C;  4DBQ A;  4AU7 A;  2XPV A;  1VQ5 I;  3JR9 A;  2QKL B;  3BCB A;  3WG9 A;  3SEZ A;  3S93 A;  2EV6 A;  3CDH A;  3M1C A;  3OYI A;  3EPZ A;  2QBY A;  2IGN A;  3M1E A;  1TW2 A;  4M9Z A;  3MKZ A;  3LSI A;  4ZTF A;  2LKX A;  3JRE A;  2Z33 A;  1L3L A;  3ZPL A;  4UHT A;  3ZCO A;  2ZNY A;  2UWM A;  3FXM A;  5FLX Z;  1D1C A;  1XGM A;  4J19 A;  2AXL A;  2E36 A;  3HRU A;  4C2M J;  1GHC A;  4UXN A;  4XLH A;  4RA2 A;  5K5Q A;  3BZC A;  3JAM K;  1LFP A;  1F4K A;  2V1D A;  2YS9 A;  2AS5 F;  2K5C A;  5CVV A;  2DT7 B;  1S5L C;  5M5Y J;  2V1N A;  3DLA A;  4DGW B;  3S2D J;  1QPI A;  4HX7 A;  4GO1 A;  3HGY A;  2ESH A;  2TCT A;  4X0G A;  5KAF C;  4QLC U;  2R7O A;  2VOO A;  2RNJ A;  3C7J A;  4U88 A;  2Y0M A;  2ID3 A;  3IWZ A;  3L2W A;  2IGK A;  1WQ2 A;  2B63 J;  1VI0 A;  1HKT A;  2AO9 A;  2OCC H;  1JHH A;  3CP8 A;  4LIV A;  4UUT A;  2FF4 A;  3ZOB A;  5LHG A;  2K9S A;  4E7H A;  4RLQ A;  4ESJ A;  4B3X A;  4G7O F;  3F8F A;  5E17 F;  4RAY A;  1I27 A;  3Q9V A;  3OYC A;  1MMG A;  5GPA A;  4W97 A;  2H1L A;  1YX5 A;  2XF5 A;  1GLN A;  1AKH B;  2ESN A;  2F5C A;  3RPU A;  1WHU A;  3V7C A;  4HNU A;  3H5N A;  2L7F P;  3CCQ I;  4YFN F;  3OS2 A;  3S3N A;  1BR2 A;  3JCU C;  4BAY A;  4EM1 A;  3ABM H;  1FOX A;  2JRM A;  1PJR A;  2LC2 A;  3GCM A;  2OF7 A;  1FYK A;  1WH7 A;  2JPC A;  4L0Y B;  2COB A;  1XD7 A;  4RM3 A;  4PFO A;  3TKY A;  1FWZ A;  1HC8 A;  2DOE A;  3DQV C;  3ABT A;  3BOQ A;  2KKO A;  1ERD A;  1MW7 A;  2VAS A;  3AG3 H;  3EUK L;  3T5X A;  2WA0 A;  3ELK A;  2EV0 A;  2ACJ A;  4I02 A;  1FNN A;  3CMY A;  1MSE C;  1R1T A;  1F43 A;  2DO7 A;  3F21 A;  2WC2 A;  1O3Q A;  3QPH A;  4CZC A;  2Y75 A;  1YIO A;  1UJ8 A;  2ZBK A;  3RYP A;  2V1U A;  4BE0 A;  1U2W A;  5ICG A;  2LY1 A;  5FRN A;  1LKX A;  2JZY A;  4A6D A;  5M5X J;  1RI7 A;  4QTR A;  4ZDO A;  3BLY A;  3CCJ I;  2D45 A;  2BZT A;  4O3M A;  5TGT A;  3OYJ A;  4PUS A;  4OMY A;  1YYV A;  2XUB A;  4Y52 J;  1CF7 B;  1IC8 A;  2K9Q A;  4WXD A;  2M1B A;  3IRR A;  4I7H A;  1FIA A;  5E3L A;  2HPI A;  3PO2 J;  1LFU P;  2VIX A;  4A3K J;  1W36 D;  1OR7 A;  3CF5 F;  1PUE E;  2M0C A;  3R0J A;  3ZMV A;  1A6Q A;  2ME0 A;  1ORK A;  4DQ2 A;  2FMY A;  4IHX A;  2A69 F;  3TDU C;  5GAD J;  1F9N A;  2EV5 A;  3IAS 2;  3CMM A;  3A02 A;  5M3F J;  4D7M A;  1KGS A;  5HNH A;  4PGG A;  3IRQ A;  1IF1 A;  3M3Y J;  2MSY A;  4MNU A;  2E60 A;  4HF0 A;  1BIB A;  3E6C C;  4G12 A;  4BQQ A;  4A3E J;  1ZTR A;  2FSW A;  4CIC A;  2JRT A;  2RQP A;  4KMU X;  5DD4 A;  1TW3 A;  2FML A;  2DU9 A;  2NS0 A;  1SC7 A;  1GVD A;  3DP7 A;  4QIW N;  3C18 A;  2QYO A;  2EFW A;  3H5A A;  5TIS C;  2A6T A;  3A1Y A;  1RR8 C;  1BA5 A;  3GUD A;  3HUG A;  5JHU A;  3LFK A;  4G6Q A;  4UUS B;  2HXI A;  3HEF A;  1E0E A;  1KQ9 A;  2KT0 A;  1VQK I;  4C2U A;  2PN6 A;  1W4M A;  1GT0 C;  4B3A A;  4CYC A;  5D8K B;  2W84 A;  2FE3 A;  2J5P A;  2LNB A;  1P9Q C;  3JRA A;  2PFB A;  4P9F A;  1SAN A;  4ESB A;  3SXY A;  4A3F J;  3JTG A;  3JTH A;  2KDZ A;  2A5W A;  3H9J A;  5J1R A;  1JGS A;  3FKI J;  4PJL A;  2KZG A;  3R4K A;  4XSZ F;  3WU1 B;  2NVQ J;  1OKR A;  4M6V A;  4N9H A;  1EKE A;  4DYQ A;  4PGH A;  1S8N A;  3P9C A;  3GTJ J;  5IYD J;  2ELH A;  3PFI A;  3CUQ A;  1PUF A;  1FOK A;  1I5Z A;  1V54 H;  2V6E A;  3JRG A;  5H6Q A;  1IN8 A;  1FYM A;  1LVK A;  1FSH A;  5KK1 A;  1W5T A;  3VOD A;  4X6A J;  3ROU A;  2P7C B;  4EEF G;  1ZR4 A;  2ZCW A;  2F4I A;  1U5T A;  1WJ5 A;  2P6S A;  4H0E A;  2OTL I;  5D5U B;  4NQW B;  2DT6 A;  4IX7 A;  5HDK A;  1WJA A;  1I3A A;  2Y0S N;  4D5C A;  4AWX B;  4YIR X;  3WTW C;  3COA C;  2RN7 A;  2WAQ N;  2DQR A;  4K2E A;  3K70 C;  4Y13 A;  1W5C C;  4IF4 A;  4BY1 J;  3MZH A;  2LTP A;  2LY2 A;  4RGU A;  3C2B A;  3TW7 A;  2QQ8 A;  2DAO A;  1UCR A;  2OAZ A;  3S17 J;  4EJU A;  5DEQ A;  4IOC F;  3S16 J;  2O8K A;  2HYG D;  2NYX A;  2B9S A;  2W7N A;  4V19 K;  1YG2 A;  4F55 A;  5L3C A;  1LVA A;  1REP C;  4AM3 A;  4XLA A;  1R23 A;  5EDN A;  1V5G A;  2IPQ X;  1QPM A;  3FBI B;  3CC7 I;  1TP4 A;  1OYI A;  2BY0 A;  1GXP A;  4YFK F;  1BOB A;  4MQV A;  1B8I B;  1JI8 A;  2QQ9 A;  2W57 A;  2HVS A;  3DPL C;  1LE8 B;  1YRN A;  1OCR H;  1ZRF A;  1U6G A;  1S29 A;  3AL0 B;  2CUZ A;  1FP2 A;  2X1E A;  2JVH A;  3K69 A;  3DF8 A;  3CC4 I;  2KJC A;  2MLK A;  1WJF A;  1FIP A;  1ODD A;  5E8I A;  4P9U A;  3RZO J;  2IAI A;  2O61 A;  3DPT A;  1RES A;  3ERM A;  2OU2 A;  3AG4 H;  4HEA 2;  1X3U A;  2L7M P;  4HBL A;  3HGG A;  4OOI A;  4XMY A;  4A3D J;  3G1M A;  4P55 A;  2YX7 A;  5DUK A;  2OUM A;  2VL8 A;  3PIO F;  3I4N J;  5DCF A;  3BTJ A;  4XRS A;  4AIJ A;  3I53 A;  3LSK A;  1O3T A;  1B72 B;  4Q47 A;  4GYI A;  3GF2 A;  2H8R A;  1MZB A;  2IT0 A;  1C0W A;  1P7I A;  4JOM A;  3SHF A;  2NOJ B;  1Y8R B;  3F23 A;  3DPU A;  1JKP C;  2VPR A;  4EM2 A;  2J5O A;  2WV0 A;  4DBR A;  4P1W A;  1M1E B;  2STT A;  2M8E A;  4BKX A;  1OIS A;  3S15 J;  4AC0 A;  2ZFW A;  2I5U A;  2LKS A;  3BR5 A;  1OYY A;  1LEB A;  2F5D A;  2P7V B;  3L1P A;  1KQ8 A;  2EK5 A;  2RV8 A;  3OYB A;  3LMM A;  2CSO A;  4ENN A;  3PNT A;  3E0J B;  3A01 A;  1MD0 A;  5F64 A;  3PIP F;  1WFX A;  3AG1 H;  3H3V K;  1Y0U A;  2ZXI A;  1A04 A;  1HKS A;  5FKL A;  3TGN A;  5DM6 F;  1KU3 A;  3DTI A;  1IG7 A;  1OYW A;  3Q3S A;  2WY8 Q;  1LEA A;  3OIP A;  2LF8 A;  5BPI A;  1N77 A;  3KP2 A;  1VQ8 I;  5K5O A;  1J09 A;  4L0Z B;  2IJL A;  2FRH A;  2OZU A;  3LAJ A;  5CKT A;  2E5Z A;  3KP7 A;  3S3O A;  2R7S A;  2ELJ A;  1JJ8 C;  4ZH4 F;  3AFH A;  3AG2 H;  1SAU A;  3HTU A;  2MLG A;  3N4M A;  1O3R A;  2PI0 A;  3SYT A;  1QZY A;  2FBK A;  3Q0U A;  2K3F A;  4N4N B;  3NEU A;  5E1X A;  1HXD A;  1JUS A;  2Q2E A;  5KCM A;  3ZMT A;  4A3L J;  2P81 A;  5HLG A;  1WI9 A;  4BYY A;  1N75 A;  2OQG A;  2PEX A;  4KN7 X;  2YUS A;  4U0V A;  1O4X A;  1ZG1 A;  5ERI A;  1R4M B;  3J7Y J;  1R9T J;  4CCM A;  4HNV A;  2NS7 A;  1VFC A;  2OBP A;  1RUO A;  2GM4 A;  2L4A A;  3CJN A;  2DA1 A;  5IT9 K;  2K9M A;  2D1H A;  3GFJ A;  3IL2 A;  2HS5 A;  3WTY C;  5EYR A;  2DK8 A;  1R22 A;  2K3P A;  4EJO A;  3CJT B;  4MO7 A;  4BE1 A;  1U9O A;  3H9G A;  3FDY A;  2VT2 A;  1E2X A;  2ADU A;  4KIF A;  2IXS A;  2MBF A;  1XSD A;  2GZW A;  1Z6R A;  2H09 A;  2QF7 A;  3CCE I;  1X4O A;  2DI3 A;  3KET A;  4JP0 A;  4ENM A;  5B3S H;  2CV2 A;  4CA0 A;  1QZZ A;  2ZC2 A;  4DOZ A;  1ETO A;  1XDU A;  3ASO H;  2VBZ A;  1EH7 A;  1D3Y A;  1KYW A;  1XTA A;  3J7A Y;  3CCL I;  1ZGW A;  1G2H A;  3O8G A;  1SVM A;  1I3Q J;  1XDS A;  1FZP B;  5E20 A;  2IS4 A;  3DV8 A;  3M8E A;  4LIT A;  4I98 B;  4Y15 A;  3ZMD A;  1YIT I;  1BI1 A;  1TTY A;  3OL4 A;  3RPU D;  4AVZ A;  3LSR A;  3K1P A;  1QNT A;  4I99 C;  4XL9 A;  2BY2 A;  3CCV I;  1IAW A;  2E7W A;  2RGV A;  3S14 J;  2HXO A;  3E6M A;  1T56 A;  2HQ5 A;  3ZMZ A;  1Z1D A;  5F08 A;  2R5Z B;  2R7V A;  4RB2 C;  2Q1Z B;  3CMA I;  1RC9 A;  4PSW A;  2NVU B;  2KFD A;  3E7L A;  5IPA A;  4HLX A;  1DDN A;  2ZFU A;  4P96 A;  3IC7 A;  2QSF X;  2DA2 A;  3RJP A;  2NS8 A;  4OWR B;  2EB7 A;  5D6F A;  1OJL A;  3ZQH A;  2K02 A; 
#chains in the Genus database with same CATH homology
 5E3O A;  4M3F A;  1MSF C;  2DA4 A;  2AHQ A;  5K7F A;  3MN2 A;  1JJ6 C;  4D5F A;  1JUP A;  2XPV A;  5IYC J;  1MBE A;  3JR9 A;  4M3E A;  1D5Y A;  2DMT A;  2VKE A;  2HDD A;  4XIC A;  2FX0 A;  1WPK A;  3HKZ N;  3UKG A;  1GDT A;  2XGE A;  1A6I A;  3GBG A;  2DA7 A;  2LKX A;  3JRE A;  2ECC A;  4MIM A;  3LSP A;  1E3O C;  1IDY A;  2ELK A;  4DW6 A;  2G0E A;  3GTK J;  5E3N A;  2LVS A;  2E2H J;  5EGO B;  4J19 A;  2X9D A;  4D7N A;  3JRD A;  4C2M J;  3MKL A;  1K83 J;  3NAU A;  1GV5 A;  2X48 A;  2JA7 J;  3JRF A;  2DN0 A;  2NVX J;  2YS9 A;  2JMW A;  1FTT A;  5EGO A;  1QVT A;  2GBY A;  5M5Y J;  3GTO J;  3S1Q J;  2MG4 A;  5FKN A;  1QPI A;  3RQI A;  3S2D J;  2LP0 A;  3HGY A;  4UUS A;  2TCT A;  3DEW A;  2R7Z J;  2EZI A;  2LD5 A;  1TWC J;  2VI6 A;  1X2N A;  2ID3 A;  2HYJ A;  3HBL A;  5FKM A;  3W6V A;  1T33 A;  5F04 A;  1VI0 A;  2B63 J;  2VUM J;  2AO9 A;  4UUT A;  3ZOB A;  2JA5 J;  2K9S A;  1VND A;  1U78 A;  2DJN A;  2LR8 A;  3F0C A;  3BR2 A;  1H89 C;  5GPA A;  4FCY A;  1RR7 A;  5FLM J;  4W97 A;  2M2E A;  3IV5 A;  1I6H J;  1JUM A;  1AKH B;  3A03 A;  4DYR A;  3ZQF A;  1MBG A;  2L7F P;  1MH3 A;  1UMQ A;  2XGC A;  1U8B A;  2JA8 J;  4B4C A;  1RET A;  1AKH A;  1FEX A;  2LLK A;  2EBI A;  5BNG A;  1ETK A;  2DMQ A;  2OF7 A;  5EG0 B;  3CCY A;  1WH7 A;  1OCP A;  1HLV A;  2COB A;  5JLW A;  3LSG A;  2GLO A;  2K9N A;  2O7O A;  3RKQ A;  5EG0 A;  1MH4 A;  1JKQ C;  3HOW J;  4BY7 J;  1MSE C;  3CMY A;  1F43 A;  1TWA J;  3GTL J;  3Q0V A;  4B1R A;  1AHD P;  1X58 A;  3BT9 A;  3FK6 A;  1ZQ3 P;  1OFC X;  1U9N A;  4A3G J;  4BXX J;  2X6O A;  3JRI A;  5M5X J;  2M8G X;  4QTR A;  2O9L A;  1WH5 A;  2DTZ A;  1IJW C;  1RKW A;  4Y52 J;  1IC8 A;  3S1R J;  3HOZ J;  2K9Q A;  2E1O A;  4Y7N J;  1FIA A;  5E3L A;  3PO2 J;  1LFU P;  4A3K J;  2YU9 J;  3GTQ J;  2M0C A;  5F0C A;  1ITY A;  2PMZ N;  2OPT A;  4W1U A;  2ME0 A;  1ORK A;  2D5V A;  4IHX A;  4JYK A;  1Y1W J;  5M3F J;  3A02 A;  4D7M A;  2R0Q C;  1EF4 A;  4V2G A;  3GTP J;  3TED A;  4JX4 A;  4M3D A;  3BQY A;  3OIO A;  3M3Y J;  2MSY A;  3LSJ A;  2TRT A;  4G12 A;  4L5E A;  3K2A A;  3HB9 A;  2R92 J;  4A3E J;  1ZTR A;  1MBK A;  5C4J J;  1MNM C;  3ZQG A;  1F36 A;  4I6Z A;  1ZKG A;  3BG3 A;  2CRG A;  2HOS A;  3Q0W A;  2NVY J;  1LFB A;  2N8G A;  2ECB A;  1ENH A;  4CYC B;  1APL C;  1GVD A;  4QIW N;  2W48 A;  5J1U A;  2VKV A;  1SFO J;  4ABZ A;  1BA5 A;  3PO3 J;  1IV6 A;  2EZK A;  2CJJ A;  5J3L A;  4UUS B;  2HXI A;  3HEF A;  3QPL A;  1Z0X A;  2K40 A;  2KT0 A;  5HOD A;  1GT0 C;  4B3A A;  4CYC A;  3DCF A;  2Y2Z A;  1BW5 A;  1HDP A;  2E2I J;  1BJZ A;  3JRA A;  5K7Z A;  1SAN A;  4A3F J;  1Z77 A;  5GP9 A;  3JRB A;  2KDZ A;  2FJ1 A;  2EQR A;  5J1R A;  2EH3 A;  3FKI J;  3TP0 A;  3FIW A;  1PUF B;  2NVQ J;  4M6V A;  3LOC A;  1HCR A;  4V2F A;  4RBO A;  3SDG A;  3H0G J;  1I50 J;  4DYQ A;  3BTC A;  3GTJ J;  2WV1 A;  4X1E A;  5IYD J;  5F1J A;  2IBD A;  2JWT A;  5IP6 A;  1PUF A;  3JRG A;  2L7Z A;  5IOZ A;  2LY9 A;  4AUX A;  2ID6 A;  3G1L A;  4JX5 A;  1JTX A;  1JTY A;  3HM5 A;  1XC5 A;  4FE4 A;  1CQT A;  4X6A J;  2M9H A;  3BQZ A;  4EEF G;  1ZR4 A;  1Q1V A;  2Y31 A;  4C3J J;  2DA3 A;  1UHS A;  4A93 J;  1NK2 P;  1JKO C;  3IH2 A;  3MVP A;  1IUF A;  2Y0S N;  4D5C A;  3SJM A;  2WAQ N;  4XRS G;  5FJ8 J;  3HOV J;  1DU6 A;  2IEK A;  1AU7 A;  3HOU J;  4AYB N;  3BR3 A;  4MFD A;  4BY1 J;  1TWH J;  1VF9 A;  2LTP A;  3TP3 A;  3C2B A;  3TW7 A;  3BR6 A;  3S1N J;  3S17 J;  3S16 J;  2O8K A;  4IHY A;  4LOC A;  1NTC A;  1FTZ A;  5EDN A;  4RDU A;  2ME6 A;  4GFB A;  1WCM J;  3WHC A;  3ZQL A;  4DYC A;  2EZH A;  4QSH A;  5GPC A;  1H8A C;  1S7E A;  2XPW A;  2MGQ A;  5M5W J;  3IH3 A;  2LK2 A;  3B6A A;  3K7A J;  2FQ4 A;  1B8I B;  3JRH A;  1LE8 B;  1YRN A;  4BBR J;  1HDD C;  3HOY J;  1A5J A;  4A3C J;  5C44 J;  5F0F A;  1B8I A;  5IP9 J;  3SFI A;  1FIP A;  3RZO J;  2HI3 A;  4XID A;  3TW6 A;  1MBF A;  3NAR A;  1W0T A;  1LE8 A;  2IAI A;  4A3I J;  2H1K A;  1JGG A;  3LNQ A;  5EZG A;  1RES A;  4A3J J;  4XRM A;  1JT0 A;  2L7M P;  1GUU A;  5FKO A;  5J1Y A;  1HOM A;  3PM1 A;  3HGG A;  3QPS A;  4A3D J;  3G1M A;  5JLX A;  5M3M J;  1MBH A;  2LFB A;  1W0U A;  3I4N J;  2M34 A;  2XB0 X;  3BTJ A;  4XRS A;  1XG1 A;  5FLV A;  4FIS A;  1B72 B;  2H8R A;  1ETX A;  1UG2 A;  3IH4 A;  5C4X J;  2ZB9 A;  2FD5 A;  3BG5 A;  1P7I A;  2JJ7 A;  1B72 A;  4M3B A;  1NK3 P;  4JX6 A;  2CQX A;  1JKP C;  2VPR A;  1DU0 A;  4I76 A;  3M4O J;  4BKX A;  3S15 J;  2MW8 A;  1FJL A;  4AC0 A;  1QRY A;  3A01 B;  3BR5 A;  3L1P A;  4A3M J;  2R93 J;  3CDL A;  4C3H J;  2HOA A;  2Y30 A;  4IEJ A;  3B6C A;  3A01 A;  1JT6 A;  1TWF J;  5E3M A;  3H3V K;  3ZQC A;  1H88 C;  1Y1V J;  5FKL A;  5K7H A;  2EZL A;  1RKT A;  3OSG A;  1X2M A;  2XB5 A;  1IG7 A;  4IHW A;  3VPR A;  3Q3S A;  1OCT C;  3ZQI A;  3I4M J;  2JN6 A;  2Y9Z A;  4MFE A;  3HDD A;  3S1M J;  5F27 A;  1RPW A;  5EEA A;  2WB1 N;  2E19 A;  3BTI A;  1JJ8 C;  1POG A;  3BR1 A;  4IHV A;  3Q0U A;  1ZK8 A;  2CU7 A;  1JUS A;  4A3L J;  2P81 A;  2JK3 A;  3RZD J;  3BTL A;  4M3G A;  2YUS A;  1ETQ A;  1HF0 A;  1O4X A;  3GTM J;  4XK4 A;  2E2J J;  2XRL A;  1R9T J;  1WI3 A;  4HNV A;  4FE7 A;  2NS7 A;  1VFC A;  5F0H A;  2GM4 A;  1ZR2 A;  1JKR C;  1XS9 A;  2DA1 A;  2NOG A;  2NVT J;  1P7J A;  4FTH A;  4BBS J;  5EYR A;  1GV2 A;  1IDZ A;  4NDL A;  5IYB J;  4MO7 A;  1WGX A;  2L9R A;  1MBJ A;  1U9O A;  5FKK A;  1TWG J;  2R5Y B;  4C3I J;  5EZH A;  3S2H J;  3FK7 A;  9ANT A;  2QF7 A;  5EF6 A;  2RAE A;  5DTD A;  4A3B J;  2XSD C;  2DA6 A;  4JP0 A;  2DMN A;  1YRN B;  2R5Y A;  4A69 C;  2QCO A;  1ETO A;  2Y9Y A;  3QQA A;  1ETY A;  2DA5 A;  1IRZ A;  1ZGW A;  1G2H A;  3O8G A;  1I3Q J;  2CQQ A;  3O8H A;  1K61 A;  2HOT A;  3JRC A;  2CUF A;  4DZP A;  1QVU A;  3HOX J;  3D1N I;  4DZJ A;  3LSR A;  3BG9 A;  2DMU A;  3OOU A;  1ETW A;  3BR0 A;  5IP7 J;  2JA6 J;  2CUE A;  2L0K A;  3FIS A;  4MLO A;  1ETV A;  3S14 J;  2HXO A;  4S0H B;  5DS9 A;  1T56 A;  2HQ5 A;  5F08 A;  2XPU A;  2R5Z B;  2I10 A;  1BL0 A;  1IGN A;  3E7L A;  5IPA A;  1TC3 C;  2XGD A;  3CQZ J;  3G1O A;  1BW6 A;  2DMP A;  3GTG J;  2DA2 A;  2NS8 A;  3OSF A;  5C3E J;  5IOY A;  3WHB A;  1OJL A;  3ZQH A;  2R5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...