3J7ZI

Structure of the e. coli 50s subunit with ermcl nascent chain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
141
structure length
141
Chain Sequence
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L32
publication title Drug Sensing by the Ribosome Induces Translational Arrest via Active Site Perturbation.
pubmed doi rcsb
total genus 17
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3j7zI02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3j7zI01
5DM6F 1YJ9I 1VQ7I 3EGVB 1YI2I 3CC4I 3DLLF 1YJWI 4UY8I 3CCQI 1Y39A 5GAEJ 3CJTB 2E35A 1QA6A 3CCSI 1VQ5I 2JQ7A 3CMEI 1VQOI 4IOAF 1HC8A 3J7YJ 1VQKI 2K3FA 4IOCF 3I55I 3CCRI 5GAHJ 3PIOF 1VQMI 2OTJI 1YITI 1VQNI 3CCMI 2NXNB 2ZJQF 3I56I 1VQ8I 1VQPI 1VQ9I 5DM7F 1YIJI 3CC2I 5JVGF 2FOWA 2H8WA 2E36A 3G4SI 1MMSA 3CCEI 3PIPF 1S72I 3CJQB 3CCVI 4V19K 2QA4I 2OTLI 1VQ6I 1WIBA 2ZJPF 1VQLI 5GAGJ 3CCJI 1FOXA 4IO9F 3CF5F 2E34A 3CJRB 1VQ4I 3CCUI 5GADJ 1FOWA 3G6EI 3G71I 3J7ZI 1FOYA 3CC7I 2ZJRF 1YJNI 3CJSB 2QEXI 1YHQI 3CD6I 1ACIA 3CMAI 3CCLI
chains in the Genus database with same CATH superfamily
3E6DA 2BW3B 3GXOA 2PN6A 4ZDLA 2E2JJ 4BGDA 1IRGA 4PGGA 3OYEA 2B0LA 4EJOA 2NOJB 3F8NA 5D8KB 2V1UA 4Y52J 4HX7A 4C2UA 3GFJA 4J19A 4M3EA 2P4WA 2K9SA 4HOBA 1RUOA 2FQ4A 1ZGJA 2EZLA 1QA6A 4XLAA 2MA3A 2QQ8A 3SZPA 4LGWA 4G7HF 2A5YB 3BR5A 3RZOJ 4A3MJ 1MW7A 4EEFG 3Q0UA 3MMYB 2K3FA 4AVZA 1TQPA 3V4GA 4QTRA 4C9YA 3GMEA 3FZVA 1A36A 4AC0A 3V7RA 4P96A 3M1CA 3OR2C 2FSWA 2MW8A 4HNTA 4HNVA 1WH5A 2X6OA 4M6VA 2KIQA 2CUZA 2DLLA 5BOXA 2LSOA 3LSGA 3ISPA 3K4JA 2VE8A 3CTAA 2ZBKA 3B6CA 3F72A 4F93B 2HVQA 5LBQA 2VKDA 4F91B 2HDCA 5LHHA 3LA3A 3AAFA 3EUKL 2RKHA 2Z5UA 3KPHA 4HPQA 1Z91A 2R7XA 1HF0A 2NVYJ 5DS9A 2DW4A 5DCFA 4F55A 5HLHA 2VBWA 2G7UA 3HB9A 1BJZA 3HG9A 5IP9J 4RAZA 2OU2A 3ABKH 1WPKA 3W2WA 3C18A 3QYBA 2LBFB 4F7ZA 4IHVA 5J4VA 3RKYA 4GGGA 1ENHA 5EF6A 1I5ZA 2H1KA 4OAYA 3L00A 1Q1VA 2ICWG 2RC4A 1ZG3A 4N9HA 1FYMA 1VI0A 4PJMA 3VEPA 2YUSA 3K69A 3L09A 4HF0A 1A5JA 3DEEA 2X6WA 3G73A 1QZEA 1XMKA 3I4PA 3H3UA 3ZMTA 3DU6A 4G7ZF 1BM9A 3BR3A 4D5CA 1R5GA 2WV1A 3CF5F 2R7ZJ 4CZCA 2Y9ZA 5FLXK 3CJRB 2MC4A 3IP4B 4BS9A 3OS1A 1MMAA 5GADJ 2VE9A 2KLOA 2ZSIB 3LSTA 1OCZH 5EG0B 1FWZA 1T08B 3ASOH 3DPUA 3NWTA 1MSFC 1R58A 3KP5A 1YJNI 3HKZA 4XSZF 5IY5H 5DYMA 1XSDA 1GVJA 4KISA 1MBKA 3VYSB 2KDZA 1V5FA 2IGKA 1D1AA 1BIBA 2CUEA 4ESFA 4L18B 2W48A 4M6YA 3MZHA 2V26A 3ABMH 4XL9A 1U2WA 1UB9A 2QQAA 3RPUD 3GX4X 2MH9A 4U7DA 4XRSG 1HQCA 3DTKA 2EZKA 2CFXA 2OCEA 3K4LA 1FLIA 3NAUA 2ISZA 3OYLA 3KLNA 1RZ4A 3WU0A 3MKYB 2CW7A 2X85A 1B59A 3C3WA 5DUIA 4RB1A 4L0YB 4ZZDA 1K79A 3H9QA 3HOVJ 3RCOA 4CA0A 5DV5A 2CFOA 3F0CA 2VJ4A 2DCEA 4KIBA 4KDPA 4AIHA 1R4NB 3FX3A 4LFUA 5FROA 3QU6A 4HF2A 3H3VK 2FX0A 1GUUA 3KYLA 2IBDA 5J1YA 3PIOF 3HIFA 1VQMI 4LLNA 3MWMA 3HRTA 4JX6A 2EPFA 1VF9A 2CQNA 1JUPA 1R1UA 3ZMVA 3NWSA 1G59A 4J00A 4HX8A 1JKOC 4U87A 4ENMA 3QP6A 1VQ8I 1ITYA 1ULYA 3EPZA 3PQJA 4F52A 1TP4A 3BQYA 3CO7C 3FXMA 4KITB 2NOGA 1U5TA 3NEUA 3HGGA 4UHTA 1CQTA 3RDIA 1QRYA 2TCTA 2F2EA 2QCOA 4QPOA 1QVUA 2KRCA 2K85A 2M30A 3RYRA 1OYYA 5ICFA 4F3QA 2WB1A 1XB4A 4F92B 2O0YA 2XHKA 1UCRA 1USSA 2NVQJ 2VBYA 2AHQA 4MFEA 5HDKA 4A0ZA 3RZDJ 3NARA 2DDAA 5E1XA 5CKTA 2H1LA 3OYIA 4MHGA 2JRTA 1R22A 1TWAJ 3BCBA 1ZGWA 2L4AA 2JWTA 3T1BA 2L9NA 5CJ9A 4CZZA 2TDXA 1BI3A 1G8XA 2RQQA 5K7HA 3I54A 5J6XA 3DWLE 1TW3A 1R00A 3Q0VA 4IF4A 4IQ4A 5GTIC 3QPHA 1ETYA 4KUMA 4RB2C 1RUNA 3OOPA 1ZGAA 3WTTC 3I71A 3OYAA 4M3GA 2DI3A 2V6CA 1MBFA 1V3FA 2KJBA 4XR6A 1Y8RB 2HDWA 4I6ZA 1OCRH 2L5QA 4RLQA 1Z05A 4MNUA 4B1RA 4B43A 3WTWC 3FF5A 1ZR4A 1ETXA 1VZ0A 2M3AA 2W4SA 2IAIA 1ZRCA 4BBSJ 2Y48A 4LG0A 2P0WA 1D5VA 3OL4A 2O61A 1ETQA 2W85A 1YJWI 1QVTA 4YIRX 2V9VA 2CG4A 1WQ2A 3A03A 4LMYA 5D5WB 3E6MA 1K78B 4B48A 2R7SA 5KVRA 3RPQA 1WJEA 1ORKA 2PMZA 3ZMSA 3TP0A 3JRBA 5ERIA 1Z6RA 3BWGA 4NC6A 2R93J 2OQRA 3SEZA 2M8GX 1P4AA 3D0SA 2GIVA 4XORA 1IN5A 1XSXA 4ANJA 2DMUA 3DP7A 3MZYA 1IN7A 2E1OA 2R7FA 2XGEA 1PUFA 3MKLA 1GXQA 1PYVA 1UELB 2UV1A 4M3DA 4A3EJ 4QWQA 2EFPA 2F5EA 2PMHA 2VKHA 4M72A 5E79C 4EVIA 2MH2A 2BEOA 2WY7Q 3ZXSA 5BPDA 1XC5A 1LFPA 1WRJA 1LE8B 2PLYA 3UR3C 1PVEA 3E1SA 1O7LA 1VQ9I 1W5SA 2R7UA 1BC8C 5CLSA 2JA7J 3J81Z 1E3OC 1W1WE 4CXFA 2PJPA 5GPCA 2H8WA 1O3SA 2HZDA 1N25A 1BJAA 3O2PE 4R8HA 3RQ4A 3VYTB 3WGGA 4WXDA 4OIPF 2BXYA 2AQEA 1Y0NA 2QBYB 1JKQC 3BG6A 2BVLA 1IG7A 4EGZA 1W7PA 3A0BC 4Z6YA 2O3FA 2DOAA 2D1HA 5J47A 3I59B 2EBIA 2Q1ZB 1K4TA 2XSDC 5EZGA 5JHFA 1B4AA 4JBAA 1IXCA 2GA1A 3TW7A 5EJCA 4DJAA 1P4XA 3FIWA 3K4NA 3GEZA 1MMNA 3MVPA 5M3FJ 1WSUA 2M4KA 1MBGA 5FD6A 4RB0A 1B72B 2H27A 4Y7NJ 2RREA 1ETVA 1L0OC 2KRHA 3BR2A 3CZ6A 3K7AJ 3MZ8A 5DCMB 4XK4A 1Z3XA 5CVUA 4DGWB 4AIJA 4NUBA 3EUHA 4H4KC 3OYKA 3LQQA 1K61A 2JVHA 5EG0A 3BQZA 5HDGA 2FXAA 4FTHA 3BR1A 1BR1A 1O7FA 1R1VA 1LDKB 4EMSA 3OSGA 2L2OA 2RV8A 2QENA 1RETA 1ZARA 5ILUA 5GP9A 3WTXC 1RPWA 1S7EA 2MYSA 4M74A 2OA4A 5KAFC 3K1MA 1MH3A 2VJJA 3S17J 3GLLA 2CUJA 5B3SH 1SMYF 3HUGB 2QKMB 1OYWA 3CP8A 3DPLC 1DU6A 5IP7J 1EH8A 2WV0A 3GTMJ 3SEQA 1E3HA 1XCVA 2O9LA 3TOBA 4G8XA 1KONA 4FQGA 4ZDPA 3ZN0A 1VQOI 1IUFA 2CS3A 3WG7H 4BACA 1T2KA 2R7RA 1DPRA 3DKXA 5E3OA 3S1RJ 3GZ5A 4OU0A 1HOMA 3HXLA 2MLGA 1O3TA 2JUCA 2BY0A 5HOOA 4LB6B 1V5GA 5E1WA 1U9OA 3R0AA 1BC7C 2DA3A 3HPGA 1W36C 1IRFA 2JA5J 2VB6A 2DPDA 2ADUA 2VODA 3GBGA 5J8CA 1MD0A 2COMA 1I3AA 4OIRF 5K5RA 1EF4A 3I53A 2EB7A 2NXNB 4P9UA 2FOKA 3T5XA 2M8EA 3FXUA 5IPAA 4HYEA 4XMYA 4Q5SF 3KYCB 4BHCA 5KHDA 1TT5B 1J2XA 1R6RA 1G3WA 1XGSA 2ZXIA 2BYVE 1B1BA 1S5LC 2HZTA 3OIOA 4CO8A 4KJZA 2EA2A 1I1GA 2L9VA 3S16J 1YIOA 5D8LB 1D0XA 1S72I 4RM2A 4BQAA 1ONVA 1IRXA 3F8FA 1HKSA 2K9NA 5IYBJ 1TWCJ 4JX5A 5FJ8J 3TEDA 4YELA 2LD5A 2OBPA 3H5RA 3TBIA 2EINH 3K4KA 3FK7A 3QYEA 5CVVA 4B8XA 4ABZA 5D6FA 4CICA 5IT3A 5J8FA 1F5TA 1RKWA 2ZNZA 2P6SA 1FNNA 2ZJPF 2DYSH 4KIGA 1FP2A 4XQFA 1SFUA 5EGOA 1T95A 3BG5A 2F5VA 5LEJA 1SD4A 1XMAA 2DFHA 2V1NA 1WH7A 4P9FA 1FC3A 4GFBA 5D6EA 2HYFA 1SVMA 2V9KA 3L1PA 2QYOA 1JTXA 5K7ZA 2IA0A 1QU3A 1M1EB 5AIPA 5K5OA 2L9RA 1W0UA 2ZSHB 1D0ZA 4Y3OA 3BROA 1UJ8A 1FOYA 3WU1B 3IRQA 1DPUA 1G2HA 1TW2A 1SC7A 1F1ZA 3UNGC 3HL2A 3CJSB 3H9GA 1X58A 2IP2A 2P8TA 2E7XA 1X3UA 3F6OA 3KX2A 2A6HF 4S04A 3E5QA 3RIRA 1VQ7I 2RAEA 4XLNF 1MIJA 2M7AA 3A01A 4A12A 3U1DA 3LAPA 4IHTA 2EA4A 2QSHX 2HVSA 2WY8Q 1EKEA 2X4HA 5FFXA 2BZTA 4CSWA 2BVMA 5GAEJ 3VODA 1YO5C 1Z7LA 2ME0A 1TQMA 1KU7A 1JKRC 2M2EA 2P7CB 3RYPA 2R5YA 1IGNA 3BR0A 2K86A 2CV0A 1DQUA 3LOCA 3FXQA 4BY1J 4HV5A 1OMIA 2FNAA 4IOAF 1ERDA 3BG3A 4A3LJ 1FYKA 3LSMA 1LEAA 2JPCA 3KP6A 2FE3A 2X9DA 3BPXA 3R4KA 3VWBA 3PQKA 4MQ9F 4A3KJ 3K2ZA 2VOOA 2HKOA 2HFHA 2OTJI 4I7HA 1LPQA 3S14J 2HS5A 2LVSA 2LRDA 4EM0B 4B3AA 3IUOA 3HJEA 1KU2A 4BXFA 4R79A 4Y33A 4ETSA 3GTJJ 1SFEA 1MNMC 5D4RA 3GFIA 2R92J 1I1SA 2DK8A 1YIJI 1LE8A 5E3NA 2XRLA 1HW1A 1SANA 3HKZN 4ZTJA 3WE2A 3G4SI 2RGVA 1UMQA 2Z33A 1X1CA 2QUFA 1I3QJ 4N4OB 4LB5A 3FXRA 3C2HA 2WBMA 3F8MA 3PFIA 1BN5A 2ZB9A 1FBQA 3IH3A 2JSPA 4PJNA 4BYYA 4RA2A 1H9TA 2QBYA 3S2HJ 2VQCA 2CJJA 1S7AA 2K40A 1U5TB 2ISYA 2F5FA 4BL0B 3OYDA 1GT0C 4HQEA 2CQ7A 3QOPA 1B9NA 4UNOA 3JRIA 5L3GA 2HTJA 4G94A 1MNDA 3E6CC 3K4MA 4M6XA 4Y17A 2XSJC 4HDVA 1B8IB 4KMFA 3HM5A 4JP0A 4KIFA 1FEXA 2E34A 2EZHA 1X19A 3K4CA 4XLCA 2CU7A 1LDJA 2PI0A 1OPCA 2DT6A 2FA5A 3VYRB 2D45A 5F04A 1VNDA 1I27A 1WJCA 3ZQFA 2VONA 4M9XA 2F4OB 4QPQA 1U3EM 5CPRB 4LLLA 3OV8A 2VQLA 3V8KA 2HPIA 1E17A 5B1AH 1U5TC 3FMSA 4PGHA 3ZQGA 4FE4A 5J4YA 1IO2A 4ITVA 2CV2A 5CVRA 2VXDA 1IV8A 2PBIA 2AS5F 3WHCA 5FKNA 5ICCA 1UG0A 2LKXA 3VB2A 3AKZA 3O6BB 3EDPA 5F08A 1QZYA 2W24A 2XKOA 1YYVA 1NHAA 4L9VA 1VQ5I 1R71A 2MD0A 4BQOA 1YRNA 4XLFA 2BY3A 4LIUA 1J5YA 2L01A 2Z99A 2X1CA 1NH3A 1X1BA 1HKTA 2HGCA 4E7ZA 1YLFA 3FXKA 3WG9A 1VQKI 1EH7A 4IZZA 1HW5A 2GZWA 3BCAA 2LFBA 2EFWA 5BPIA 3WTSC 2MSYA 2L7ZA 2JVGA 2MD5A 2XB0X 4JOMA 2OZ6A 1K6YA 3QWLA 5AIQA 3BR6A 3G3ZA 1KQ0A 1FY7A 1RKTA 2F5CA 2OD5A 3KFWX 4DYQA 5BS6A 1FBUA 2YPRA 3QPSA 4CDGA 4XRSA 3TDZC 4HW0A 2O8KA 5E3LA 1TZLA 2ELJA 4Y4RA 2M5WA 2XGXA 1UFMA 1KGSA 4YG2F 1PUFB 1LVAA 1R23A 3JTHA 1X3ZB 4CCMA 1IW7F 3PIPF 1I50J 1G3SA 1T56A 4LG3A 4XOTA 2E5ZA 2MBFA 2PX9A 4NNJA 4OINF 2PJRA 4HAMA 4HG2A 4IRIA 4BY7J 3J80Z 2NNYA 1Y1VJ 2OQGA 1Z9CA 1W5CC 1O3QA 2UZKA 1ZKGA 2D1VA 4NBQA 2J5PA 5C44J 2VN2A 1UZCA 4HLXA 2E2IJ 4PDKA 3V8JA 4AM3A 2NYXA 4L9NA 3SHFA 2PMZN 4YEJA 2PQ8A 2DQRA 3PL8A 3Q0WA 1OJLA 3LNQA 4RS8A 5LHIA 3Q9VA 2XRNA 1ETWA 1W7PB 4EQQA 2B63J 4KN4X 4EV0A 2A5WA 4WWCA 3WTYC 5HODA 1XCBA 2M0MA 2QWWA 1E3PA 3S2DJ 3CC7I 3HSRA 4BBRJ 1OCCH 2XASA 2F4MB 2DBBA 3ERMA 3I9V2 4PCQA 3R6SA 1QHGA 2XDVA 2CSOA 3H9JA 3TKYA 1X2NA 3P7NA 4OIOF 4ON0A 3SXYA 3J7AY 2GIZA 2HYGD 2K3PA 4IKFA 3RJPA 2EJRA 5DM6F 3B73A 3ZCOA 4BJTA 2VXZA 5F64A 2R4GA 1WI3A 2ECBA 1R5HA 4IRHA 4FETA 2M45A 5D4SA 3NQOA 3K70D 3JSPA 3CCQI 2HYJA 1YX5A 4FISA 3QU3A 1G3YA 2KRFA 1JHHA 5M5YJ 3M8JA 1T38A 1P92A 1JGSA 3I3LA 3EUAA 2HEOA 3E97A 2OCCH 1S3JA 5LRRA 2NNNA 3J7YJ 2HVRA 4FX4A 3OYNA 1APLC 3ONQA 5FGMA 3I4NJ 2MABA 2X1DA 2IVMA 4A5NA 4IL6C 2EFQA 2Y0SN 4UB8C 4HSTA 3H35A 3BTJA 3P5JA 2H6BA 3V8LA 2XKPA 1OCOH 2CYYA 3CLOA 2IGMA 3RKWA 1IDZA 4XONA 2VASA 1BI1A 2ZMEB 3EUHC 3I56I 1XS9A 3JCUC 3CMMA 3OYJA 2DA2A 4E7IA 2Z9OA 2Y31A 2ZCWA 2P5VA 5DM7F 4A6DA 4BQQA 4B44A 3KEYA 1T8IA 1AOYA 4N4NB 3SZGA 2WADA 4B3XA 4XIDA 4L5IA 3FMRA 1R49A 2ME6A 4C3JJ 2GXBA 2BE5F 4UUVA 3HZJA 5FKLA 1RIOH 2EH3A 4LLGF 4ESBA 5ILSA 2HI3A 3ROUA 5HDNA 4ZJZA 3ZR8X 1I6XA 1GHCA 3GO5A 2OF7A 1TWGJ 2CV1A 2CQQA 3OMYA 3FM3A 4HA8A 4XLHA 9ANTA 1XPXA 1HBXG 1RESA 2NAZA 3EYYA 5KK1A 3ASNH 2RQPA 5F0HA 2V79A 3DFGA 1MZBA 2EV6A 3DBLB 1B8IA 1RR7A 2EK5A 4DOZA 1J75A 2H8RA 3B6AA 3OS0A 2YSRA 3DQVC 4LIVA 1J0RA 1ETOA 4D9JA 1OCPA 5TISC 4FX0A 3HOYJ 4G6QA 5F6FA 1ZELA 1K4SA 4IHSA 4P5OA 2O6GE 5EGOB 2Z1DA 2X51A 4JK1X 2EFNA 3DU5A 3JRHA 5K5QA 3QYFA 1JXSA 1TBXA 4IX7A 2F4IA 2QZ8A 4XN3A 3M7GA 3FXJA 1MMGA 1IDYA 2A6TA 3F9KA 3LA2A 4WXHA 1OQYA 4D1QA 5ILVA 1V4RA 1C0WA 2FMYA 3FWEA 4PJLA 3MEXA 2CQKA 2BGCA 3DV8A 3HRSA 2J5OA 4BEHB 1QHHD 2DMQA 5EDNA 3M07A 2H94A 1IC8A 3FKJA 2O8XA 2RDPA 2L4MA 2XF7A 2EIJH 3A01B 4I02A 5J3LA 4LJZF 1W4MA 3VPRA 2ZFUA 4QSHA 3J80K 1A6IA 2QM3A 5TRDA 1YS7A 2R5YB 1P6RA 1Z7UA 3B02A 2O03A 2CH0A 5LD2C 4ZC3A 2M34A 3OIPA 1HA8A 3E3VA 1FTZA 5AONA 3OIQA 3ZMUA 5E3MA 4EJTA 4MO7A 2F5DA 4A5MA 4L5JA 2A61A 2L9SA 3ZQCA 4XSXF 1XTAA 2G7HA 3GZ6A 2COBA 1FYLA 3OYCA 3ZGKA 3DTIA 3GVAA 4PUSA 1HLVA 1XGOA 2ELKA 2XVCA 2VQGA 1EA3A 1W0TA 1MJ9A 3JAMZ 1CF7A 4RGUA 1SFOJ 3CDIA 1JHFA 1YW7A 1MBEA 1R7JA 3QPLA 1ZLKA 5EZHA 1EJ9A 3LSKA 3FHZA 4E7SA 5L3FA 2KJCA 2UWMA 1NK2P 2DMPA 4HZFA 5B66C 3C2GA 4KT6A 2HKXA 4KA4A 3DBHB 5FKOA 2KPMA 3ABTA 3W3CA 3D1NI 3ULQB 4B47A 3PNVA 1AU7A 3SDBA 3RKXA 2GAUA 2O5RA 3BTIA 3P9KA 4AWXB 5KAIC 2IGOA 2XGDA 3MQ0A 4S05A 4DBQA 4I2OA 3LWFA 3WE3A 1FOWA 2HTSA 2LF7A 3BT9A 3KE2A 2HWVA 3SDGA 4V2FA 4M3FA 4MTDA 4BDYA 3ECOA 2KFDA 4PSXA 2Y0SA 4M3BA 3L9FA 4N9IA 4OIQF 1AA7A 5LFAA 5EEHA 2M1BA 1WHUA 1YHQI 3E5XA 3F3XA 3KCCA 4P55A 4EJUA 1ZRDA 2ACJA 2VUMJ 1FTTA 3X2QH 1OCTC 3TO9A 2FD5A 3BZKA 2BBYA 3K1NA 2JA6J 1X4PA 1Y39A 1J7KA 2ID6A 3P9IA 2OAZA 2FJ1A 3E7LA 3I58A 4XN0A 2DU9A 3ECHA 1TNTA 2RNGA 2EFOA 2IT0A 2PFBA 3TGNA 4CCLA 1YS6A 2RNJA 1IXSB 4C3IJ 5M5XJ 4RGXA 3O8GA 4II2A 4EGYA 3WGIA 3MN2A 3L2CA 4ENNA 2XPUA 4MQVA 5IOYA 2QLZA 4UV9A 2ZXHA 4WXCA 4RGSA 4D0PA 3KIOA 1IF1A 2KT0A 4B4CA 1YRNB 2IJLA 4IJAA 3CCMI 1LQ1A 2XAUA 5F1RA 5GPAA 2XROA 2WAEA 2ZMEA 2GQQA 4XOPA 2JZYA 3K10A 3HHHA 2XAGA 3DEUA 3HRUA 3PM1A 3L2VA 3ZQ7A 5IT9Z 3BTLA 3FK6A 3N05A 5JVGF 1F4KA 1MGTA 3HSEA 4YFKF 2HXIA 4MTEA 4I09A 3GTGJ 5EEGA 2EIKH 1GV5A 3BJOA 3GFLA 3WODF 3KP7A 4JQFA 1QZZA 4U0WA 4WCGA 1JJ6C 3D5LA 3KP3A 1ODDA 2CW8A 3QQAA 1PUEE 4M71A 1OYIA 2ZNYA 5DEQA 2K02A 2XAHA 2YR2A 1WIBA 4QIWN 2G9WA 2HOAA 3T8TA 1YTYA 3DLAA 3G1MA 3KEOA 4A93J 1RC9A 2NS7A 1BW5A 5B1BH 5ED4A 4HV6A 2ESHA 4QLCU 2K4JA 2OC6A 2IXSA 3WU2C 1MBHA 4A3FJ 2KP6A 4AD9A 4DQ2A 4PJJA 1Z6TA 2YU3A 2PJRB 5JFRA 2JT1A 1D1BA 3H92A 4RAYA 1BOAA 2CO5A 4FT8A 1FSHA 2IPQX 2DMTA 3G6EI 3G71I 1IRZA 3DCFA 4E7JA 5LGTA 3IRRA 4EJVA 2HR3A 3MFKA 1OISA 1REPC 3PO3J 3VFZA 1P2FA 3LA7A 2QEXI 4E7HA 3HPHA 1HC8A 3T8RA 3H5AA 1VFCA 1B6AA 2DTRA 2W7NA 1GDTA 2KZVA 1IZ1A 1GXPA 4I98B 4UVBA 3BPVA 3OY9A 1U78A 4XLEA 4PFPA 1TL8A 3GW2A 2Y9YA 1Z67A 4IHWA 1NK3P 1RR8C 2DPUA 1X3WB 1X2MA 4W97A 4O5VA 4E7KA 3JSOA 4GYIA 2M9HA 1MMDA 3CMEI 5BNGA 2W82A 2XV4S 2NVTJ 2M0CA 4BEHA 2K4BA 3LSPA 3JAMK 3CCYA 3SZTA 3I55I 3REOA 3F8CA 4BJ6C 3W6VA 3TDUC 3EYIA 4G6DA 1HCRA 3JR9A 5H6RA 1FX7A 3KP2A 5JVTA 1ZHFA 2FBIA 2JPBA 1ZREA 4KNYA 1PDNC 3FMQA 1K7AA 5A2QZ 2W1OA 1T98A 1VTNC 3EQLF 3A02A 3AL0B 5LEKA 3QODA 1O57A 3FKIJ 2YS9A 4MLOA 1Z21A 3H1CA 1WJ5A 3PUFA 1TQIA 2O7OA 2LC2A 2BXZA 5E20A 2JUGA 1ZAOA 2ZJ2A 2XUBA 1SD5A 1XN7A 2DTZA 3GZNB 4OWRB 2FQ3A 3RQIA 1TTYA 4Q48A 5HLIA 1SAXA 5FB2A 3N4MA 2OUMA 3R61A 4IQJA 2CUFA 2XB5A 1JT6A 4UUTA 4A3DJ 3ZPLA 4A3CJ 1QO0D 1XDSA 1Y0UA 1D0YA 3AL0C 3KP4A 3FXLA 4A3JJ 1VQLI 3IAM2 2R7OA 1IUYA 2DO7A 3U21A 3HOUJ 2VKVA 4HEA2 1SFXA 2V1XA 2WC2A 4E70A 3OYBA 5LHGA 3GYHX 3DF8A 2STTA 5TJJA 1RNLA 2L7MP 3CCUI 4KT5C 2QQBA 3MD2A 3ZQIA 5LGUA 2Y69H 1FMVA 1D3YA 1Z3YA 4MEXF 1J59A 4NQWA 4I0BA 4L0ZB 4ENKA 5DD8A 1TWFJ 1UHMA 3K9TA 4BJ5C 2R5ZA 2IGNA 1A6QA 4UVCA 3CCLI 1YJ9I 3L2QA 3HTSB 1WJFA 1FBSA 3GFMA 4Q47A 2WWYA 2R0QC 5LRSA 2LH9A 3U2RA 2GA2A 1J9IA 3S8PA 1T0FA 2MC3A 2GLOA 1ON1A 2X6XA 1YG2A 2CWEA 2HQRA 3OOUA 2BOLA 2JA2A 4WK8F 1KQ9A 3QPTA 2KKOA 4RLFA 3OWTA 5HS7A 1ZK8A 2LMDA 5IT9K 2JQ7A 1JJ8C 1GVDA 1JKPC 1R4MB 1IXRC 3WHBA 1OFCX 2DFFA 1MH4A 4DYRA 4XM3A 1UHWA 3E6BA 5DTDA 3H3ZA 5CVIA 5TGTA 5E18F 1MDMA 2CW0F 5JLXA 1JE8A 2LG4A 2MGQA 2Y75A 4C2TA 4ZYHA 3GF2A 4FCYA 1DP7P 5J40A 4IEJA 4LK0F 3UKGA 4BH9A 4AIDA 2R7TA 4X0GA 3LSHA 1YITI 2DFIA 1KZHA 4A3GJ 3WTVC 4AUXA 1IAWA 2VT2A 1TWHJ 2IW5A 2ZO4A 4CUGA 2KL4A 2JA8J 1YOVB 2DFEA 4K2EA 4I0AA 1HDDC 2ZXJA 1NG7A 1SAUA 4GRIA 4D7NA 3OYMA 3AG1H 3IAS2 3LSRA 2GBYA 3CO6C 4BE2A 2FOWA 1DU0A 2V7FA 5FFZA 1IJWC 4D7MA 3CCEI 1EV7A 3I64A 4GO1A 3CF2A 3S2WA 4IXAA 4S0HB 3JRFA 1Z0XA 1W36D 1ZLJA 1A31A 5F0FA 4PK4A 2OZUA 5K1YA 2DK5A 2ZC2A 1BOBA 1WJAA 4PZJA 5IYDJ 5DDGA 1FT9A 4I01A 2QA4I 1WFXA 1Z1DA 2VIXA 4P1WA 4BE1A 1QGPA 3KYDB 4AIKA 2DJNA 1R9TJ 1WKMA 5D5UB 3CJNA 1U9NA 5IYCJ 3F8BA 3SFZA 3U1KA 1T39A 4BKXA 1CF7B 2Q8KA 2OJED 4L9TA 2VJIA 4IHXA 3RI4A 3K1PA 1Q1HA 4AVPA 1SVOA 4W1UA 4A3BJ 2EIMH 1HKQA 1ZR2A 4G6TB 1D8JA 3PNTA 4M73A 3J7ZI 2WA0A 4FHTA 2HQAA 2LP0A 2STWA 4WF2A 2QSFX 4BAYA 3L2UA 4RBOA 2LKPA 4I99C 4BDZA 5L3BA 3SQNA 1Z77A 1P9QC 2F6CA 2LY9A 4ZZLA 3BJ6A 3KEQA 3COAC 2BY1A 3MCZA 3HOWJ 3CMAI 2AO9A 5FLVA 1MJAA 5IOZA 3IKTA 4A6EA 2X48A 3C1DA 3EGVB 5M5WJ 5A2QK 1YI2I 1ZYRF 1SVLA 2K5CA 3LMMA 2ZFWA 2KIUA 1PJRA 4BUPA 4CYDA 4RB3C 1X1DA 4OOIA 5F0CA 1DUXC 2A07F 5FKKA 1RI7A 4ZDOA 2E1NA 2DN0A 4BHPA 3ESWB 2R7WA 4XBFA 2E35A 4BXXJ 1WCMJ 4HBLA 1P4WA 1N77A 4O3MA 4A0YA 1YX3A 3HOXJ 3IL2A 1Y1WJ 4HF1A 1IN4A 1LKXA 5E1ZB 3OS2A 2E5NA 2MG4A 3S3OA 2Y2ZA 1WI9A 1OR7A 2LY2A 3LSJA 2BHYA 4DBRA 1TLHB 2ECCA 2E7WA 5H20A 1N75A 3ABUA 1EH6A 2LKSA 4Z2YA 3TMOA 3GTLJ 3AG2H 5DD4A 1SMTA 3CUQA 2W00A 1Y6IA 4Y15A 5FKMA 1KYZA 1LJ9A 1QPMA 2P6TA 3HGYA 4OMZA 1UHSA 3HDDA 1L3LA 3BY6A 3O8HA 3U9GA 4NHJA 2VPLA 1IV6A 1UG2A 5L3EA 2IS2A 3JRDA 5LGNA 4XICA 1U8RA 4ZYGA 3FBNB 5D5VB 2CRGA 2XAJA 2ID3A 2GM4A 3BOQA 3A2KA 2V6EA 3ZMZA 1B9MA 2ZKZA 4MGRA 2K9MA 3RPUA 5L3DA 3VSKA 3I0TA 2JRMA 3S1NJ 2X1EA 2HOEA 3L2RA 1TNSA 4UXNA 5D5XB 3K6GA 3LSIA 2OTLI 1FZPB 1MJBA 3GTOJ 2EZIA 5HLTA 3JRCA 3BC8A 2OV7A 4CYCA 1FOXA 2L7FP 2LF8A 4II3A 2Y0MA 1H9GA 2VC0A 2R3SA 3OYGA 1BA5A 1LVKA 2DODA 2HDDA 1QPIA 2VC1A 1JUMA 2Q0OA 1A04A 1GV2A 1S8NA 4J01A 1TC3C 5BQTA 2LR8A 2M7BA 1HSTA 1KQ8A 4DYCA 3T0YA 2ZJRF 2ZMEC 4MEYF 2HXOA 3JTGA 3WTUC 2LDUA 3JRGA 5L3CA 3CUOA 1NTCA 4EJWA 1ACIA 2HOTA 2L0KA 1QNTA 5CQEA 1S9HA 4UUSA 1P7JA 2MFZA 4U0VA 1DGRM 2E19A 1FOKA 3CC4I 1PP7U 3DPTA 3H0DA 4U0YA 5LLQA 2JN6A 2YX7A 1H8AC 2JK3A 2DDBA 2OPTA 3AFHA 3BTCA 3CCSI 2P5LC 4HSRA 1GLNA 1WWXA 4HLYA 3LAJA 2N8GA 3KZYA 1D8KA 2DAOA 2LLKA 4M9ZA 2HPMA 4B09A 1YE9A 3LFKA 2EILH 2DOFA 1ZG5A 4XLPF 2I8DA 5C4JJ 3S3MA 3CCRI 2IS6A 2E60A 1R1TA 1SD7A 5K7FA 2DQLA 3CDLA 1F9NA 3QAHA 3KLOA 1BR2A 3PFYA 1V55H 4XKWA 2R7VA 3GTQJ 2AQFA 3G1LA 2V9PA 1WGXA 3HYIA 3IWZA 5M3MJ 4KMUX 1AHDP 1JT0A 1SFKA 2FBKA 4X6AJ 1ZN2A 3BZ6A 2DA1A 2KZGA 1FIAA 2FRHA 2XIGA 3BDDA 4XNFA 3QRFF 4HQMA 1T6SA 1VQPI 4X1EA 5F27A 4CGZA 2VOPA 1E0EA 2UXXA 4L5EA 3OYFA 2CGPA 4C30A 3EETA 3KETA 3ZQLA 1AKHA 2WTEA 2H6CA 2A05A 3DKWA 3M4OJ 3J7AO 2VBZA 4ZYDA 1MSEC 4JX4A 1HW2A 4AYBN 3D5SC 3M8EA 4HNUA 4IHYA 2EQRA 2NRAC 1XX5A 1POGA 4V2GA 2QVOA 2LNBA 2Q2EB 2DA6A 2DMNA 3R60A 4MIMA 3W6JB 3A0HC 2I5UA 3HTUA 3M9AA 2QSGX 1BBYA 1Y8QB 4U7BA 5GAGJ 4CCNA 6PAXA 4BU2A 2RN7A 1FJLA 4GCVA 3RKQA 1FMWA 4D5FA 3JREA 3C7JA 2KMUA 5H6QA 2E1MB 3G2BA 2VQHA 4IO9F 1WJBA 1QBJA 2LREA 4IRGA 2DA7A 1VQ4I 4NC8A 2BW3A 2W25A 2R7QA 3CLQA 1XDUA 2DYRH 2Z16A 2HU9A 3TQNA 5DUKA 3F6VA 3V7SA 3FXOA 3HSFA 4JYKA 1JI8A 3HOZJ 1S29A 4LITA 1USTA 4XKCA 1BW6A 2DT5A 4YIFA 3L7WA 3DEWA 2XC7A 3LFUA 2FU4A 3ZQHA 3LQRA 4BE0A 4LOCA 2GXGA 4ZH4F 4Q4ZF 3IV5A 3DLLF 2E1MC 3D5RC 2K9QA 2HQNA 1U6GA 1ON2A 3W6KB 4DIQA 1HXDA 1FP1D 2A68F 4NQWB 4ZYAA 3KZIC 4R1HA 2P5KA 2VPRA 3IHUA 3FBIB 4KYWA 2HOSA 1QQIA 2NS0A 2R5ZB 1D1CA 2XPVA 1H88C 2H09A 3MKWB 2KDOA 3H5NA 3GCMA 3PJRA 2UXNA 1AWCA 5FD5A 4CCKA 4GDFA 2P7VB 1XD7A 4GXOA 3TO7A 2Y30A 3IC7A 1K6OA 1TT0A 3PSFA 2V1DA 3S32A 4CH7A 1HSJA 1VQNI 3QP5A 3DBRB 4DW6A 1W7PD 2IS4A 5CVJA 2BHZA 2VL8A 4LK1F 4RAGA 2LBFA 2EWNA 3IH4A 3TP3A 1MDMB 1J09A 3CMYA 5FRNA 2B7EA 2XAQA 4XKVA 2KIFA 1STZA 4ESJA 4ASNA 5GTHC 3CC2I 1U8BA 2DJIA 5E8GA 4A3IJ 1DP3A 2JTVA 2KHMA 3ML6A 4XKBA 4NB5A 2KISA 2E36A 4A69C 3RSNA 1R36A 1U0JA 2QGUA 2QQ9A 3BZCA 1T0FC 3CJQB 3PUBA 4PSWA 4YIIA 4EM2A 1T33A 2X0LA 1ZG1A 1X1AA 2VKEA 2Z2SB 2M4GA 3CCVI 3W2AA 2NVUB 1JTYA 4DNCA 3FDYA 3HBLA 2ELHA 2C6YA 1JUSA 3BG7A 4DZPA 2BV6A 3S93A 3NRVA 1A35A 2JJ7A 4BQNA 2VT3A 3OR1C 4IVNA 2G0EA 2NS8A 3ERED 5E8IA 1HDPA 1CGPA 4UV8A 3DTEA 5EEAA 1YQAA 5JHUA 3DXJF 5HS8A 2CQXA 3H0GJ 4ENJA 3HRMA 4E7LA 4KFCA 3V42A 2FNPA 3FM5A 2VBXA 2WAQN 3ZP5A 1E2XA 3GWZA 3CQZJ 3VSLA 3OSFA 4RAFA 1YW9A 4KN7X 3JW4A 1BL0A 3AG4H 3HC7A 4EM1A 3F22A 2YX4A 2XF5A 4L9JA 3SJMA 4HRIA 1S7OA 4BHBA 3BLYA 5ICEA 2IEKA 2W57A 1KA8A 2DOEA 2E71A 2VI6A 3HOTA 2X6YA 4UY8I 1SD6A 2AXTC 3MKZA 1Y56A 3GTPJ 4BNCA 1RRJA 1R5ID 3CJTB 1X1PA 4PJ0C 2PG4A 3ABLH 3CESA 4A2UA 1LEBA 2IA2A 5KCMA 1WZ2A 4AU7A 5F1JA 5JR3A 1OKRA 1BR4A 5J1UA 2ETHA 4PFOA 3S15J 2MLKA 2D5VA 3KZZA 3A1YA 3SFIA 4RDUA 3W2VA 1BI2A 5FLMJ 4U88A 5HLGA 3V7CA 4O6JA 4AYBA 2FUG2 1K83J 3WTZA 2PEXA 2DT7B 3F23A 2JMWA 4KICA 4CHUA 3IWFA 1LUJB 2HQ5A 3CP2A 3TOAA 3TO6A 1W5TA 2XPWA 1X4OA 2ZJQF 4HDUA 2FBHA 1I39A 5ICGA 1KYWA 3K0LA 2QKLB 3DKYA 5HNHA 3BG9A 4ZYEA 3R0JA 3CUQB 4RGRA 1NG6A 3PSIA 4E4HA 3VDXA 1MMSA 2E2HJ 3LL7A 2QF7A 2GWRA 1ETKA 1V5EA 2GOXB 3CDHA 1S6LA 5C4XJ 2L54A 1KU3A 2FF4A 2FMLA 4YRVA 4FE7A 3K4BA 3VOEA 3PNYA 4H0EA 5CYVA 3HOSA 4ZTFA 1MNEA 2L02A 1UAAA 3S3NA 3FHNA 2IRFG 1OR7C 3ZMDA 2Q2EA 1LNWA 4YFNF 2K9LA 1OLTA 1WVRA 1O4XA 5BMZA 4OAZA 2UUZA 2LOOA 3CUQC 3M8FA 4CCJA 2RVCA 3O3KA 4YFXF 5JI6A 3K70C 3M1EA 1LFBA 1XGNA 4XRFA 2IA1A 3G1OA 1LFUP 3PO2J 4GYGA 3P9CA 5H2FC 1IN8A 3Q3SA 3JRAA 3J81K 1ZH5A 2PMUA 3ELKA 3HEFA 4I76A 2VJ5A 5CQGA 3S1QJ 2D2WA 1K78A 2E1CA 4CYCB 4LD5A 3SYTA 3ZQQA 1ZTRA 1LB2A 2JSCA 4OMYA 4EATA 3Q9SA 5FO5A 4TV7A 3GUDA 2DA4A 2LK2A 2WAFA 3QOEA 4CCOA 1MKMA 2XF6A 4HX4A 2B9SA 1H89C 1YW8A 3ZOBA 1O3RA 3RTRA 1XG1A 1F36A 4Y13A 1XMXA 3C2BA 5JLWA 2FEZA 2DA5A 3E5UA 4G7OF 3Q5FA 5FLXZ 1ZQ3P 2XAFA 2YU9J 1ZRFA 2ESNA 2V4JC 4UUSB 5HVQC 1I6HJ 2W84A 4UB6C 2LTPA 4IOCF 1G6NA 3FISA 4NC7A 5GAHJ 1IN6A 2L3DA 1P7IA 1LDDA 4N0BA 2IS1A 3M3YJ 5HNFA 2ZXWH 3ZN1A 1DDNA 2LY1A 3MAJA 3E0JB 3N97A 3AG3H 1G3TA 3F21A 5KNLA 1XSVA 2VLAA 1YFHA 3HHGA 4WX9A 2AXLA 1N78A 2F48A 2K7LA 1BIAA 2DXIA 1FIPA 5B5EC 2L7KA 2LYCA 3I5UA 1PP8F 2P81A 3H36A 3A4CA 3I59A 4IPAA 1V54H 3WGHA 5J1RA 2GXAA 4FASD 4A0XA 5C3EJ 4C3HJ 1D5YA 2I10A 2A3SA 1WJDA 2NVXJ 5EYRA 2Z3YA 3BJAA 5E17F 2WAQA 1KU9A 4G9YA 2EV0A 1BI0A 1G4DA 1B72A 3TW6A 4RM3A 4BXUA 2BY2A 4DZJA 4V19K 1F43A 3I4MJ 2KIMA 2KQRA 5DCMA 3L2WA 1VQ6I 2A6EF 3GLXA 1H0MA 2GOMA 1JGGA 3IH2A 3CCJI 5IP6A 1DGWY 2K27A 1AKHB 4UVAA 4C2MJ 1MBJA 3IKVA 2EV5A 3K2AA 3TL4X 1SEUA 4RMNA 3ZRGA 4XRMA 2HNHA 4NDLA 2TRTA 2M87A 2CMPA 3OYHA 4M9SA 1XGMA 5FRMA 2WB1N 2XGCA 3BP8A 3GTKJ 3HUGA 3VYUB 4LG0B 4MFDA 4G12A 2A69F 2R7DA 3S1MJ 1FSEA 5HS9A 3CD6I 1FPQA 3OL3A 4E6KG
chains in the Genus database with same CATH topology
5DM6F 1YJ9I 1VQ7I 3EGVB 1YI2I 3CC4I 3DLLF 1YJWI 4UY8I 3CCQI 1Y39A 5GAEJ 3CJTB 2E35A 1QA6A 3CCSI 1VQ5I 2JQ7A 3CMEI 1VQOI 4IOAF 1HC8A 3J7YJ 1VQKI 2K3FA 4IOCF 3I55I 3CCRI 5GAHJ 3PIOF 1VQMI 2OTJI 1YITI 1VQNI 3CCMI 2NXNB 2ZJQF 3I56I 1VQ8I 1VQPI 1VQ9I 5DM7F 1YIJI 3CC2I 5JVGF 2FOWA 2H8WA 2E36A 3G4SI 1MMSA 3CCEI 3PIPF 1S72I 3CJQB 3CCVI 4V19K 2QA4I 2OTLI 1VQ6I 1WIBA 2ZJPF 1VQLI 5GAGJ 3CCJI 1FOXA 4IO9F 3CF5F 2E34A 3CJRB 1VQ4I 3CCUI 5GADJ 1FOWA 3G6EI 3G71I 3J7ZI 1FOYA 3CC7I 2ZJRF 1YJNI 3CJSB 2QEXI 1YHQI 3CD6I 1ACIA 3CMAI 3CCLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 F;  1YJ9 I;  1VQ7 I;  3EGV B;  1YI2 I;  3CC4 I;  3DLL F;  1YJW I;  4UY8 I;  3CCQ I;  1Y39 A;  5GAE J;  3CJT B;  2E35 A;  1QA6 A;  3CCS I;  1VQ5 I;  2JQ7 A;  3CME I;  1VQO I;  4IOA F;  1HC8 A;  3J7Y J;  1VQK I;  2K3F A;  4IOC F;  3I55 I;  3CCR I;  5GAH J;  3PIO F;  1VQM I;  2OTJ I;  1YIT I;  1VQN I;  3CCM I;  2NXN B;  2ZJQ F;  3I56 I;  1VQ8 I;  1VQP I;  1VQ9 I;  5DM7 F;  1YIJ I;  3CC2 I;  5JVG F;  2FOW A;  2H8W A;  2E36 A;  3G4S I;  1MMS A;  3CCE I;  3PIP F;  1S72 I;  3CJQ B;  3CCV I;  4V19 K;  2QA4 I;  2OTL I;  1VQ6 I;  1WIB A;  2ZJP F;  1VQL I;  5GAG J;  3CCJ I;  1FOX A;  4IO9 F;  3CF5 F;  2E34 A;  3CJR B;  1VQ4 I;  3CCU I;  5GAD J;  1FOW A;  3G6E I;  3G71 I;  3J7Z I;  1FOY A;  3CC7 I;  2ZJR F;  1YJN I;  3CJS B;  2QEX I;  1YHQ I;  3CD6 I;  1ACI A;  3CMA I;  3CCL I; 
#chains in the Genus database with same CATH topology
 3E6D A;  2BW3 B;  3GXO A;  2PN6 A;  4ZDL A;  2E2J J;  4BGD A;  1IRG A;  4PGG A;  3OYE A;  2B0L A;  4EJO A;  2NOJ B;  3F8N A;  5D8K B;  2V1U A;  4Y52 J;  4HX7 A;  4C2U A;  3GFJ A;  4J19 A;  4M3E A;  2P4W A;  2K9S A;  4HOB A;  1RUO A;  2FQ4 A;  1ZGJ A;  2EZL A;  1QA6 A;  4XLA A;  2MA3 A;  2QQ8 A;  3SZP A;  4LGW A;  4G7H F;  2A5Y B;  3BR5 A;  3RZO J;  4A3M J;  1MW7 A;  4EEF G;  3Q0U A;  3MMY B;  2K3F A;  4AVZ A;  1TQP A;  3V4G A;  4QTR A;  4C9Y A;  3GME A;  3FZV A;  1A36 A;  4AC0 A;  3V7R A;  4P96 A;  3M1C A;  3OR2 C;  2FSW A;  2MW8 A;  4HNT A;  4HNV A;  1WH5 A;  2X6O A;  4M6V A;  2KIQ A;  2CUZ A;  2DLL A;  5BOX A;  2LSO A;  3LSG A;  3ISP A;  3K4J A;  2VE8 A;  3CTA A;  2ZBK A;  3B6C A;  3F72 A;  4F93 B;  2HVQ A;  5LBQ A;  2VKD A;  4F91 B;  2HDC A;  5LHH A;  3LA3 A;  3AAF A;  3EUK L;  2RKH A;  2Z5U A;  3KPH A;  4HPQ A;  1Z91 A;  2R7X A;  1HF0 A;  2NVY J;  5DS9 A;  2DW4 A;  5DCF A;  4F55 A;  5HLH A;  2VBW A;  2G7U A;  3HB9 A;  1BJZ A;  3HG9 A;  5IP9 J;  4RAZ A;  2OU2 A;  3ABK H;  1WPK A;  3W2W A;  3C18 A;  3QYB A;  2LBF B;  4F7Z A;  4IHV A;  5J4V A;  3RKY A;  4GGG A;  1ENH A;  5EF6 A;  1I5Z A;  2H1K A;  4OAY A;  3L00 A;  1Q1V A;  2ICW G;  2RC4 A;  1ZG3 A;  4N9H A;  1FYM A;  1VI0 A;  4PJM A;  3VEP A;  2YUS A;  3K69 A;  3L09 A;  4HF0 A;  1A5J A;  3DEE A;  2X6W A;  3G73 A;  1QZE A;  1XMK A;  3I4P A;  3H3U A;  3ZMT A;  3DU6 A;  4G7Z F;  1BM9 A;  3BR3 A;  4D5C A;  1R5G A;  2WV1 A;  3CF5 F;  2R7Z J;  4CZC A;  2Y9Z A;  5FLX K;  3CJR B;  2MC4 A;  3IP4 B;  4BS9 A;  3OS1 A;  1MMA A;  5GAD J;  2VE9 A;  2KLO A;  2ZSI B;  3LST A;  1OCZ H;  5EG0 B;  1FWZ A;  1T08 B;  3ASO H;  3DPU A;  3NWT A;  1MSF C;  1R58 A;  3KP5 A;  1YJN I;  3HKZ A;  4XSZ F;  5IY5 H;  5DYM A;  1XSD A;  1GVJ A;  4KIS A;  1MBK A;  3VYS B;  2KDZ A;  1V5F A;  2IGK A;  1D1A A;  1BIB A;  2CUE A;  4ESF A;  4L18 B;  2W48 A;  4M6Y A;  3MZH A;  2V26 A;  3ABM H;  4XL9 A;  1U2W A;  1UB9 A;  2QQA A;  3RPU D;  3GX4 X;  2MH9 A;  4U7D A;  4XRS G;  1HQC A;  3DTK A;  2EZK A;  2CFX A;  2OCE A;  3K4L A;  1FLI A;  3NAU A;  2ISZ A;  3OYL A;  3KLN A;  1RZ4 A;  3WU0 A;  3MKY B;  2CW7 A;  2X85 A;  1B59 A;  3C3W A;  5DUI A;  4RB1 A;  4L0Y B;  4ZZD A;  1K79 A;  3H9Q A;  3HOV J;  3RCO A;  4CA0 A;  5DV5 A;  2CFO A;  3F0C A;  2VJ4 A;  2DCE A;  4KIB A;  4KDP A;  4AIH A;  1R4N B;  3FX3 A;  4LFU A;  5FRO A;  3QU6 A;  4HF2 A;  3H3V K;  2FX0 A;  1GUU A;  3KYL A;  2IBD A;  5J1Y A;  3PIO F;  3HIF A;  1VQM I;  4LLN A;  3MWM A;  3HRT A;  4JX6 A;  2EPF A;  1VF9 A;  2CQN A;  1JUP A;  1R1U A;  3ZMV A;  3NWS A;  1G59 A;  4J00 A;  4HX8 A;  1JKO C;  4U87 A;  4ENM A;  3QP6 A;  1VQ8 I;  1ITY A;  1ULY A;  3EPZ A;  3PQJ A;  4F52 A;  1TP4 A;  3BQY A;  3CO7 C;  3FXM A;  4KIT B;  2NOG A;  1U5T A;  3NEU A;  3HGG A;  4UHT A;  1CQT A;  3RDI A;  1QRY A;  2TCT A;  2F2E A;  2QCO A;  4QPO A;  1QVU A;  2KRC A;  2K85 A;  2M30 A;  3RYR A;  1OYY A;  5ICF A;  4F3Q A;  2WB1 A;  1XB4 A;  4F92 B;  2O0Y A;  2XHK A;  1UCR A;  1USS A;  2NVQ J;  2VBY A;  2AHQ A;  4MFE A;  5HDK A;  4A0Z A;  3RZD J;  3NAR A;  2DDA A;  5E1X A;  5CKT A;  2H1L A;  3OYI A;  4MHG A;  2JRT A;  1R22 A;  1TWA J;  3BCB A;  1ZGW A;  2L4A A;  2JWT A;  3T1B A;  2L9N A;  5CJ9 A;  4CZZ A;  2TDX A;  1BI3 A;  1G8X A;  2RQQ A;  5K7H A;  3I54 A;  5J6X A;  3DWL E;  1TW3 A;  1R00 A;  3Q0V A;  4IF4 A;  4IQ4 A;  5GTI C;  3QPH A;  1ETY A;  4KUM A;  4RB2 C;  1RUN A;  3OOP A;  1ZGA A;  3WTT C;  3I71 A;  3OYA A;  4M3G A;  2DI3 A;  2V6C A;  1MBF A;  1V3F A;  2KJB A;  4XR6 A;  1Y8R B;  2HDW A;  4I6Z A;  1OCR H;  2L5Q A;  4RLQ A;  1Z05 A;  4MNU A;  4B1R A;  4B43 A;  3WTW C;  3FF5 A;  1ZR4 A;  1ETX A;  1VZ0 A;  2M3A A;  2W4S A;  2IAI A;  1ZRC A;  4BBS J;  2Y48 A;  4LG0 A;  2P0W A;  1D5V A;  3OL4 A;  2O61 A;  1ETQ A;  2W85 A;  1YJW I;  1QVT A;  4YIR X;  2V9V A;  2CG4 A;  1WQ2 A;  3A03 A;  4LMY A;  5D5W B;  3E6M A;  1K78 B;  4B48 A;  2R7S A;  5KVR A;  3RPQ A;  1WJE A;  1ORK A;  2PMZ A;  3ZMS A;  3TP0 A;  3JRB A;  5ERI A;  1Z6R A;  3BWG A;  4NC6 A;  2R93 J;  2OQR A;  3SEZ A;  2M8G X;  1P4A A;  3D0S A;  2GIV A;  4XOR A;  1IN5 A;  1XSX A;  4ANJ A;  2DMU A;  3DP7 A;  3MZY A;  1IN7 A;  2E1O A;  2R7F A;  2XGE A;  1PUF A;  3MKL A;  1GXQ A;  1PYV A;  1UEL B;  2UV1 A;  4M3D A;  4A3E J;  4QWQ A;  2EFP A;  2F5E A;  2PMH A;  2VKH A;  4M72 A;  5E79 C;  4EVI A;  2MH2 A;  2BEO A;  2WY7 Q;  3ZXS A;  5BPD A;  1XC5 A;  1LFP A;  1WRJ A;  1LE8 B;  2PLY A;  3UR3 C;  1PVE A;  3E1S A;  1O7L A;  1VQ9 I;  1W5S A;  2R7U A;  1BC8 C;  5CLS A;  2JA7 J;  3J81 Z;  1E3O C;  1W1W E;  4CXF A;  2PJP A;  5GPC A;  2H8W A;  1O3S A;  2HZD A;  1N25 A;  1BJA A;  3O2P E;  4R8H A;  3RQ4 A;  3VYT B;  3WGG A;  4WXD A;  4OIP F;  2BXY A;  2AQE A;  1Y0N A;  2QBY B;  1JKQ C;  3BG6 A;  2BVL A;  1IG7 A;  4EGZ A;  1W7P A;  3A0B C;  4Z6Y A;  2O3F A;  2DOA A;  2D1H A;  5J47 A;  3I59 B;  2EBI A;  2Q1Z B;  1K4T A;  2XSD C;  5EZG A;  5JHF A;  1B4A A;  4JBA A;  1IXC A;  2GA1 A;  3TW7 A;  5EJC A;  4DJA A;  1P4X A;  3FIW A;  3K4N A;  3GEZ A;  1MMN A;  3MVP A;  5M3F J;  1WSU A;  2M4K A;  1MBG A;  5FD6 A;  4RB0 A;  1B72 B;  2H27 A;  4Y7N J;  2RRE A;  1ETV A;  1L0O C;  2KRH A;  3BR2 A;  3CZ6 A;  3K7A J;  3MZ8 A;  5DCM B;  4XK4 A;  1Z3X A;  5CVU A;  4DGW B;  4AIJ A;  4NUB A;  3EUH A;  4H4K C;  3OYK A;  3LQQ A;  1K61 A;  2JVH A;  5EG0 A;  3BQZ A;  5HDG A;  2FXA A;  4FTH A;  3BR1 A;  1BR1 A;  1O7F A;  1R1V A;  1LDK B;  4EMS A;  3OSG A;  2L2O A;  2RV8 A;  2QEN A;  1RET A;  1ZAR A;  5ILU A;  5GP9 A;  3WTX C;  1RPW A;  1S7E A;  2MYS A;  4M74 A;  2OA4 A;  5KAF C;  3K1M A;  1MH3 A;  2VJJ A;  3S17 J;  3GLL A;  2CUJ A;  5B3S H;  1SMY F;  3HUG B;  2QKM B;  1OYW A;  3CP8 A;  3DPL C;  1DU6 A;  5IP7 J;  1EH8 A;  2WV0 A;  3GTM J;  3SEQ A;  1E3H A;  1XCV A;  2O9L A;  3TOB A;  4G8X A;  1KON A;  4FQG A;  4ZDP A;  3ZN0 A;  1VQO I;  1IUF A;  2CS3 A;  3WG7 H;  4BAC A;  1T2K A;  2R7R A;  1DPR A;  3DKX A;  5E3O A;  3S1R J;  3GZ5 A;  4OU0 A;  1HOM A;  3HXL A;  2MLG A;  1O3T A;  2JUC A;  2BY0 A;  5HOO A;  4LB6 B;  1V5G A;  5E1W A;  1U9O A;  3R0A A;  1BC7 C;  2DA3 A;  3HPG A;  1W36 C;  1IRF A;  2JA5 J;  2VB6 A;  2DPD A;  2ADU A;  2VOD A;  3GBG A;  5J8C A;  1MD0 A;  2COM A;  1I3A A;  4OIR F;  5K5R A;  1EF4 A;  3I53 A;  2EB7 A;  2NXN B;  4P9U A;  2FOK A;  3T5X A;  2M8E A;  3FXU A;  5IPA A;  4HYE A;  4XMY A;  4Q5S F;  3KYC B;  4BHC A;  5KHD A;  1TT5 B;  1J2X A;  1R6R A;  1G3W A;  1XGS A;  2ZXI A;  2BYV E;  1B1B A;  1S5L C;  2HZT A;  3OIO A;  4CO8 A;  4KJZ A;  2EA2 A;  1I1G A;  2L9V A;  3S16 J;  1YIO A;  5D8L B;  1D0X A;  1S72 I;  4RM2 A;  4BQA A;  1ONV A;  1IRX A;  3F8F A;  1HKS A;  2K9N A;  5IYB J;  1TWC J;  4JX5 A;  5FJ8 J;  3TED A;  4YEL A;  2LD5 A;  2OBP A;  3H5R A;  3TBI A;  2EIN H;  3K4K A;  3FK7 A;  3QYE A;  5CVV A;  4B8X A;  4ABZ A;  5D6F A;  4CIC A;  5IT3 A;  5J8F A;  1F5T A;  1RKW A;  2ZNZ A;  2P6S A;  1FNN A;  2ZJP F;  2DYS H;  4KIG A;  1FP2 A;  4XQF A;  1SFU A;  5EGO A;  1T95 A;  3BG5 A;  2F5V A;  5LEJ A;  1SD4 A;  1XMA A;  2DFH A;  2V1N A;  1WH7 A;  4P9F A;  1FC3 A;  4GFB A;  5D6E A;  2HYF A;  1SVM A;  2V9K A;  3L1P A;  2QYO A;  1JTX A;  5K7Z A;  2IA0 A;  1QU3 A;  1M1E B;  5AIP A;  5K5O A;  2L9R A;  1W0U A;  2ZSH B;  1D0Z A;  4Y3O A;  3BRO A;  1UJ8 A;  1FOY A;  3WU1 B;  3IRQ A;  1DPU A;  1G2H A;  1TW2 A;  1SC7 A;  1F1Z A;  3UNG C;  3HL2 A;  3CJS B;  3H9G A;  1X58 A;  2IP2 A;  2P8T A;  2E7X A;  1X3U A;  3F6O A;  3KX2 A;  2A6H F;  4S04 A;  3E5Q A;  3RIR A;  1VQ7 I;  2RAE A;  4XLN F;  1MIJ A;  2M7A A;  3A01 A;  4A12 A;  3U1D A;  3LAP A;  4IHT A;  2EA4 A;  2QSH X;  2HVS A;  2WY8 Q;  1EKE A;  2X4H A;  5FFX A;  2BZT A;  4CSW A;  2BVM A;  5GAE J;  3VOD A;  1YO5 C;  1Z7L A;  2ME0 A;  1TQM A;  1KU7 A;  1JKR C;  2M2E A;  2P7C B;  3RYP A;  2R5Y A;  1IGN A;  3BR0 A;  2K86 A;  2CV0 A;  1DQU A;  3LOC A;  3FXQ A;  4BY1 J;  4HV5 A;  1OMI A;  2FNA A;  4IOA F;  1ERD A;  3BG3 A;  4A3L J;  1FYK A;  3LSM A;  1LEA A;  2JPC A;  3KP6 A;  2FE3 A;  2X9D A;  3BPX A;  3R4K A;  3VWB A;  3PQK A;  4MQ9 F;  4A3K J;  3K2Z A;  2VOO A;  2HKO A;  2HFH A;  2OTJ I;  4I7H A;  1LPQ A;  3S14 J;  2HS5 A;  2LVS A;  2LRD A;  4EM0 B;  4B3A A;  3IUO A;  3HJE A;  1KU2 A;  4BXF A;  4R79 A;  4Y33 A;  4ETS A;  3GTJ J;  1SFE A;  1MNM C;  5D4R A;  3GFI A;  2R92 J;  1I1S A;  2DK8 A;  1YIJ I;  1LE8 A;  5E3N A;  2XRL A;  1HW1 A;  1SAN A;  3HKZ N;  4ZTJ A;  3WE2 A;  3G4S I;  2RGV A;  1UMQ A;  2Z33 A;  1X1C A;  2QUF A;  1I3Q J;  4N4O B;  4LB5 A;  3FXR A;  3C2H A;  2WBM A;  3F8M A;  3PFI A;  1BN5 A;  2ZB9 A;  1FBQ A;  3IH3 A;  2JSP A;  4PJN A;  4BYY A;  4RA2 A;  1H9T A;  2QBY A;  3S2H J;  2VQC A;  2CJJ A;  1S7A A;  2K40 A;  1U5T B;  2ISY A;  2F5F A;  4BL0 B;  3OYD A;  1GT0 C;  4HQE A;  2CQ7 A;  3QOP A;  1B9N A;  4UNO A;  3JRI A;  5L3G A;  2HTJ A;  4G94 A;  1MND A;  3E6C C;  3K4M A;  4M6X A;  4Y17 A;  2XSJ C;  4HDV A;  1B8I B;  4KMF A;  3HM5 A;  4JP0 A;  4KIF A;  1FEX A;  2E34 A;  2EZH A;  1X19 A;  3K4C A;  4XLC A;  2CU7 A;  1LDJ A;  2PI0 A;  1OPC A;  2DT6 A;  2FA5 A;  3VYR B;  2D45 A;  5F04 A;  1VND A;  1I27 A;  1WJC A;  3ZQF A;  2VON A;  4M9X A;  2F4O B;  4QPQ A;  1U3E M;  5CPR B;  4LLL A;  3OV8 A;  2VQL A;  3V8K A;  2HPI A;  1E17 A;  5B1A H;  1U5T C;  3FMS A;  4PGH A;  3ZQG A;  4FE4 A;  5J4Y A;  1IO2 A;  4ITV A;  2CV2 A;  5CVR A;  2VXD A;  1IV8 A;  2PBI A;  2AS5 F;  3WHC A;  5FKN A;  5ICC A;  1UG0 A;  2LKX A;  3VB2 A;  3AKZ A;  3O6B B;  3EDP A;  5F08 A;  1QZY A;  2W24 A;  2XKO A;  1YYV A;  1NHA A;  4L9V A;  1VQ5 I;  1R71 A;  2MD0 A;  4BQO A;  1YRN A;  4XLF A;  2BY3 A;  4LIU A;  1J5Y A;  2L01 A;  2Z99 A;  2X1C A;  1NH3 A;  1X1B A;  1HKT A;  2HGC A;  4E7Z A;  1YLF A;  3FXK A;  3WG9 A;  1VQK I;  1EH7 A;  4IZZ A;  1HW5 A;  2GZW A;  3BCA A;  2LFB A;  2EFW A;  5BPI A;  3WTS C;  2MSY A;  2L7Z A;  2JVG A;  2MD5 A;  2XB0 X;  4JOM A;  2OZ6 A;  1K6Y A;  3QWL A;  5AIQ A;  3BR6 A;  3G3Z A;  1KQ0 A;  1FY7 A;  1RKT A;  2F5C A;  2OD5 A;  3KFW X;  4DYQ A;  5BS6 A;  1FBU A;  2YPR A;  3QPS A;  4CDG A;  4XRS A;  3TDZ C;  4HW0 A;  2O8K A;  5E3L A;  1TZL A;  2ELJ A;  4Y4R A;  2M5W A;  2XGX A;  1UFM A;  1KGS A;  4YG2 F;  1PUF B;  1LVA A;  1R23 A;  3JTH A;  1X3Z B;  4CCM A;  1IW7 F;  3PIP F;  1I50 J;  1G3S A;  1T56 A;  4LG3 A;  4XOT A;  2E5Z A;  2MBF A;  2PX9 A;  4NNJ A;  4OIN F;  2PJR A;  4HAM A;  4HG2 A;  4IRI A;  4BY7 J;  3J80 Z;  2NNY A;  1Y1V J;  2OQG A;  1Z9C A;  1W5C C;  1O3Q A;  2UZK A;  1ZKG A;  2D1V A;  4NBQ A;  2J5P A;  5C44 J;  2VN2 A;  1UZC A;  4HLX A;  2E2I J;  4PDK A;  3V8J A;  4AM3 A;  2NYX A;  4L9N A;  3SHF A;  2PMZ N;  4YEJ A;  2PQ8 A;  2DQR A;  3PL8 A;  3Q0W A;  1OJL A;  3LNQ A;  4RS8 A;  5LHI A;  3Q9V A;  2XRN A;  1ETW A;  1W7P B;  4EQQ A;  2B63 J;  4KN4 X;  4EV0 A;  2A5W A;  4WWC A;  3WTY C;  5HOD A;  1XCB A;  2M0M A;  2QWW A;  1E3P A;  3S2D J;  3CC7 I;  3HSR A;  4BBR J;  1OCC H;  2XAS A;  2F4M B;  2DBB A;  3ERM A;  3I9V 2;  4PCQ A;  3R6S A;  1QHG A;  2XDV A;  2CSO A;  3H9J A;  3TKY A;  1X2N A;  3P7N A;  4OIO F;  4ON0 A;  3SXY A;  3J7A Y;  2GIZ A;  2HYG D;  2K3P A;  4IKF A;  3RJP A;  2EJR A;  5DM6 F;  3B73 A;  3ZCO A;  4BJT A;  2VXZ A;  5F64 A;  2R4G A;  1WI3 A;  2ECB A;  1R5H A;  4IRH A;  4FET A;  2M45 A;  5D4S A;  3NQO A;  3K70 D;  3JSP A;  3CCQ I;  2HYJ A;  1YX5 A;  4FIS A;  3QU3 A;  1G3Y A;  2KRF A;  1JHH A;  5M5Y J;  3M8J A;  1T38 A;  1P92 A;  1JGS A;  3I3L A;  3EUA A;  2HEO A;  3E97 A;  2OCC H;  1S3J A;  5LRR A;  2NNN A;  3J7Y J;  2HVR A;  4FX4 A;  3OYN A;  1APL C;  3ONQ A;  5FGM A;  3I4N J;  2MAB A;  2X1D A;  2IVM A;  4A5N A;  4IL6 C;  2EFQ A;  2Y0S N;  4UB8 C;  4HST A;  3H35 A;  3BTJ A;  3P5J A;  2H6B A;  3V8L A;  2XKP A;  1OCO H;  2CYY A;  3CLO A;  2IGM A;  3RKW A;  1IDZ A;  4XON A;  2VAS A;  1BI1 A;  2ZME B;  3EUH C;  3I56 I;  1XS9 A;  3JCU C;  3CMM A;  3OYJ A;  2DA2 A;  4E7I A;  2Z9O A;  2Y31 A;  2ZCW A;  2P5V A;  5DM7 F;  4A6D A;  4BQQ A;  4B44 A;  3KEY A;  1T8I A;  1AOY A;  4N4N B;  3SZG A;  2WAD A;  4B3X A;  4XID A;  4L5I A;  3FMR A;  1R49 A;  2ME6 A;  4C3J J;  2GXB A;  2BE5 F;  4UUV A;  3HZJ A;  5FKL A;  1RIO H;  2EH3 A;  4LLG F;  4ESB A;  5ILS A;  2HI3 A;  3ROU A;  5HDN A;  4ZJZ A;  3ZR8 X;  1I6X A;  1GHC A;  3GO5 A;  2OF7 A;  1TWG J;  2CV1 A;  2CQQ A;  3OMY A;  3FM3 A;  4HA8 A;  4XLH A;  9ANT A;  1XPX A;  1HBX G;  1RES A;  2NAZ A;  3EYY A;  5KK1 A;  3ASN H;  2RQP A;  5F0H A;  2V79 A;  3DFG A;  1MZB A;  2EV6 A;  3DBL B;  1B8I A;  1RR7 A;  2EK5 A;  4DOZ A;  1J75 A;  2H8R A;  3B6A A;  3OS0 A;  2YSR A;  3DQV C;  4LIV A;  1J0R A;  1ETO A;  4D9J A;  1OCP A;  5TIS C;  4FX0 A;  3HOY J;  4G6Q A;  5F6F A;  1ZEL A;  1K4S A;  4IHS A;  4P5O A;  2O6G E;  5EGO B;  2Z1D A;  2X51 A;  4JK1 X;  2EFN A;  3DU5 A;  3JRH A;  5K5Q A;  3QYF A;  1JXS A;  1TBX A;  4IX7 A;  2F4I A;  2QZ8 A;  4XN3 A;  3M7G A;  3FXJ A;  1MMG A;  1IDY A;  2A6T A;  3F9K A;  3LA2 A;  4WXH A;  1OQY A;  4D1Q A;  5ILV A;  1V4R A;  1C0W A;  2FMY A;  3FWE A;  4PJL A;  3MEX A;  2CQK A;  2BGC A;  3DV8 A;  3HRS A;  2J5O A;  4BEH B;  1QHH D;  2DMQ A;  5EDN A;  3M07 A;  2H94 A;  1IC8 A;  3FKJ A;  2O8X A;  2RDP A;  2L4M A;  2XF7 A;  2EIJ H;  3A01 B;  4I02 A;  5J3L A;  4LJZ F;  1W4M A;  3VPR A;  2ZFU A;  4QSH A;  3J80 K;  1A6I A;  2QM3 A;  5TRD A;  1YS7 A;  2R5Y B;  1P6R A;  1Z7U A;  3B02 A;  2O03 A;  2CH0 A;  5LD2 C;  4ZC3 A;  2M34 A;  3OIP A;  1HA8 A;  3E3V A;  1FTZ A;  5AON A;  3OIQ A;  3ZMU A;  5E3M A;  4EJT A;  4MO7 A;  2F5D A;  4A5M A;  4L5J A;  2A61 A;  2L9S A;  3ZQC A;  4XSX F;  1XTA A;  2G7H A;  3GZ6 A;  2COB A;  1FYL A;  3OYC A;  3ZGK A;  3DTI A;  3GVA A;  4PUS A;  1HLV A;  1XGO A;  2ELK A;  2XVC A;  2VQG A;  1EA3 A;  1W0T A;  1MJ9 A;  3JAM Z;  1CF7 A;  4RGU A;  1SFO J;  3CDI A;  1JHF A;  1YW7 A;  1MBE A;  1R7J A;  3QPL A;  1ZLK A;  5EZH A;  1EJ9 A;  3LSK A;  3FHZ A;  4E7S A;  5L3F A;  2KJC A;  2UWM A;  1NK2 P;  2DMP A;  4HZF A;  5B66 C;  3C2G A;  4KT6 A;  2HKX A;  4KA4 A;  3DBH B;  5FKO A;  2KPM A;  3ABT A;  3W3C A;  3D1N I;  3ULQ B;  4B47 A;  3PNV A;  1AU7 A;  3SDB A;  3RKX A;  2GAU A;  2O5R A;  3BTI A;  3P9K A;  4AWX B;  5KAI C;  2IGO A;  2XGD A;  3MQ0 A;  4S05 A;  4DBQ A;  4I2O A;  3LWF A;  3WE3 A;  1FOW A;  2HTS A;  2LF7 A;  3BT9 A;  3KE2 A;  2HWV A;  3SDG A;  4V2F A;  4M3F A;  4MTD A;  4BDY A;  3ECO A;  2KFD A;  4PSX A;  2Y0S A;  4M3B A;  3L9F A;  4N9I A;  4OIQ F;  1AA7 A;  5LFA A;  5EEH A;  2M1B A;  1WHU A;  1YHQ I;  3E5X A;  3F3X A;  3KCC A;  4P55 A;  4EJU A;  1ZRD A;  2ACJ A;  2VUM J;  1FTT A;  3X2Q H;  1OCT C;  3TO9 A;  2FD5 A;  3BZK A;  2BBY A;  3K1N A;  2JA6 J;  1X4P A;  1Y39 A;  1J7K A;  2ID6 A;  3P9I A;  2OAZ A;  2FJ1 A;  3E7L A;  3I58 A;  4XN0 A;  2DU9 A;  3ECH A;  1TNT A;  2RNG A;  2EFO A;  2IT0 A;  2PFB A;  3TGN A;  4CCL A;  1YS6 A;  2RNJ A;  1IXS B;  4C3I J;  5M5X J;  4RGX A;  3O8G A;  4II2 A;  4EGY A;  3WGI A;  3MN2 A;  3L2C A;  4ENN A;  2XPU A;  4MQV A;  5IOY A;  2QLZ A;  4UV9 A;  2ZXH A;  4WXC A;  4RGS A;  4D0P A;  3KIO A;  1IF1 A;  2KT0 A;  4B4C A;  1YRN B;  2IJL A;  4IJA A;  3CCM I;  1LQ1 A;  2XAU A;  5F1R A;  5GPA A;  2XRO A;  2WAE A;  2ZME A;  2GQQ A;  4XOP A;  2JZY A;  3K10 A;  3HHH A;  2XAG A;  3DEU A;  3HRU A;  3PM1 A;  3L2V A;  3ZQ7 A;  5IT9 Z;  3BTL A;  3FK6 A;  3N05 A;  5JVG F;  1F4K A;  1MGT A;  3HSE A;  4YFK F;  2HXI A;  4MTE A;  4I09 A;  3GTG J;  5EEG A;  2EIK H;  1GV5 A;  3BJO A;  3GFL A;  3WOD F;  3KP7 A;  4JQF A;  1QZZ A;  4U0W A;  4WCG A;  1JJ6 C;  3D5L A;  3KP3 A;  1ODD A;  2CW8 A;  3QQA A;  1PUE E;  4M71 A;  1OYI A;  2ZNY A;  5DEQ A;  2K02 A;  2XAH A;  2YR2 A;  1WIB A;  4QIW N;  2G9W A;  2HOA A;  3T8T A;  1YTY A;  3DLA A;  3G1M A;  3KEO A;  4A93 J;  1RC9 A;  2NS7 A;  1BW5 A;  5B1B H;  5ED4 A;  4HV6 A;  2ESH A;  4QLC U;  2K4J A;  2OC6 A;  2IXS A;  3WU2 C;  1MBH A;  4A3F J;  2KP6 A;  4AD9 A;  4DQ2 A;  4PJJ A;  1Z6T A;  2YU3 A;  2PJR B;  5JFR A;  2JT1 A;  1D1B A;  3H92 A;  4RAY A;  1BOA A;  2CO5 A;  4FT8 A;  1FSH A;  2IPQ X;  2DMT A;  3G6E I;  3G71 I;  1IRZ A;  3DCF A;  4E7J A;  5LGT A;  3IRR A;  4EJV A;  2HR3 A;  3MFK A;  1OIS A;  1REP C;  3PO3 J;  3VFZ A;  1P2F A;  3LA7 A;  2QEX I;  4E7H A;  3HPH A;  1HC8 A;  3T8R A;  3H5A A;  1VFC A;  1B6A A;  2DTR A;  2W7N A;  1GDT A;  2KZV A;  1IZ1 A;  1GXP A;  4I98 B;  4UVB A;  3BPV A;  3OY9 A;  1U78 A;  4XLE A;  4PFP A;  1TL8 A;  3GW2 A;  2Y9Y A;  1Z67 A;  4IHW A;  1NK3 P;  1RR8 C;  2DPU A;  1X3W B;  1X2M A;  4W97 A;  4O5V A;  4E7K A;  3JSO A;  4GYI A;  2M9H A;  1MMD A;  3CME I;  5BNG A;  2W82 A;  2XV4 S;  2NVT J;  2M0C A;  4BEH A;  2K4B A;  3LSP A;  3JAM K;  3CCY A;  3SZT A;  3I55 I;  3REO A;  3F8C A;  4BJ6 C;  3W6V A;  3TDU C;  3EYI A;  4G6D A;  1HCR A;  3JR9 A;  5H6R A;  1FX7 A;  3KP2 A;  5JVT A;  1ZHF A;  2FBI A;  2JPB A;  1ZRE A;  4KNY A;  1PDN C;  3FMQ A;  1K7A A;  5A2Q Z;  2W1O A;  1T98 A;  1VTN C;  3EQL F;  3A02 A;  3AL0 B;  5LEK A;  3QOD A;  1O57 A;  3FKI J;  2YS9 A;  4MLO A;  1Z21 A;  3H1C A;  1WJ5 A;  3PUF A;  1TQI A;  2O7O A;  2LC2 A;  2BXZ A;  5E20 A;  2JUG A;  1ZAO A;  2ZJ2 A;  2XUB A;  1SD5 A;  1XN7 A;  2DTZ A;  3GZN B;  4OWR B;  2FQ3 A;  3RQI A;  1TTY A;  4Q48 A;  5HLI A;  1SAX A;  5FB2 A;  3N4M A;  2OUM A;  3R61 A;  4IQJ A;  2CUF A;  2XB5 A;  1JT6 A;  4UUT A;  4A3D J;  3ZPL A;  4A3C J;  1QO0 D;  1XDS A;  1Y0U A;  1D0Y A;  3AL0 C;  3KP4 A;  3FXL A;  4A3J J;  1VQL I;  3IAM 2;  2R7O A;  1IUY A;  2DO7 A;  3U21 A;  3HOU J;  2VKV A;  4HEA 2;  1SFX A;  2V1X A;  2WC2 A;  4E70 A;  3OYB A;  5LHG A;  3GYH X;  3DF8 A;  2STT A;  5TJJ A;  1RNL A;  2L7M P;  3CCU I;  4KT5 C;  2QQB A;  3MD2 A;  3ZQI A;  5LGU A;  2Y69 H;  1FMV A;  1D3Y A;  1Z3Y A;  4MEX F;  1J59 A;  4NQW A;  4I0B A;  4L0Z B;  4ENK A;  5DD8 A;  1TWF J;  1UHM A;  3K9T A;  4BJ5 C;  2R5Z A;  2IGN A;  1A6Q A;  4UVC A;  3CCL I;  1YJ9 I;  3L2Q A;  3HTS B;  1WJF A;  1FBS A;  3GFM A;  4Q47 A;  2WWY A;  2R0Q C;  5LRS A;  2LH9 A;  3U2R A;  2GA2 A;  1J9I A;  3S8P A;  1T0F A;  2MC3 A;  2GLO A;  1ON1 A;  2X6X A;  1YG2 A;  2CWE A;  2HQR A;  3OOU A;  2BOL A;  2JA2 A;  4WK8 F;  1KQ9 A;  3QPT A;  2KKO A;  4RLF A;  3OWT A;  5HS7 A;  1ZK8 A;  2LMD A;  5IT9 K;  2JQ7 A;  1JJ8 C;  1GVD A;  1JKP C;  1R4M B;  1IXR C;  3WHB A;  1OFC X;  2DFF A;  1MH4 A;  4DYR A;  4XM3 A;  1UHW A;  3E6B A;  5DTD A;  3H3Z A;  5CVI A;  5TGT A;  5E18 F;  1MDM A;  2CW0 F;  5JLX A;  1JE8 A;  2LG4 A;  2MGQ A;  2Y75 A;  4C2T A;  4ZYH A;  3GF2 A;  4FCY A;  1DP7 P;  5J40 A;  4IEJ A;  4LK0 F;  3UKG A;  4BH9 A;  4AID A;  2R7T A;  4X0G A;  3LSH A;  1YIT I;  2DFI A;  1KZH A;  4A3G J;  3WTV C;  4AUX A;  1IAW A;  2VT2 A;  1TWH J;  2IW5 A;  2ZO4 A;  4CUG A;  2KL4 A;  2JA8 J;  1YOV B;  2DFE A;  4K2E A;  4I0A A;  1HDD C;  2ZXJ A;  1NG7 A;  1SAU A;  4GRI A;  4D7N A;  3OYM A;  3AG1 H;  3IAS 2;  3LSR A;  2GBY A;  3CO6 C;  4BE2 A;  2FOW A;  1DU0 A;  2V7F A;  5FFZ A;  1IJW C;  4D7M A;  3CCE I;  1EV7 A;  3I64 A;  4GO1 A;  3CF2 A;  3S2W A;  4IXA A;  4S0H B;  3JRF A;  1Z0X A;  1W36 D;  1ZLJ A;  1A31 A;  5F0F A;  4PK4 A;  2OZU A;  5K1Y A;  2DK5 A;  2ZC2 A;  1BOB A;  1WJA A;  4PZJ A;  5IYD J;  5DDG A;  1FT9 A;  4I01 A;  2QA4 I;  1WFX A;  1Z1D A;  2VIX A;  4P1W A;  4BE1 A;  1QGP A;  3KYD B;  4AIK A;  2DJN A;  1R9T J;  1WKM A;  5D5U B;  3CJN A;  1U9N A;  5IYC J;  3F8B A;  3SFZ A;  3U1K A;  1T39 A;  4BKX A;  1CF7 B;  2Q8K A;  2OJE D;  4L9T A;  2VJI A;  4IHX A;  3RI4 A;  3K1P A;  1Q1H A;  4AVP A;  1SVO A;  4W1U A;  4A3B J;  2EIM H;  1HKQ A;  1ZR2 A;  4G6T B;  1D8J A;  3PNT A;  4M73 A;  3J7Z I;  2WA0 A;  4FHT A;  2HQA A;  2LP0 A;  2STW A;  4WF2 A;  2QSF X;  4BAY A;  3L2U A;  4RBO A;  2LKP A;  4I99 C;  4BDZ A;  5L3B A;  3SQN A;  1Z77 A;  1P9Q C;  2F6C A;  2LY9 A;  4ZZL A;  3BJ6 A;  3KEQ A;  3COA C;  2BY1 A;  3MCZ A;  3HOW J;  3CMA I;  2AO9 A;  5FLV A;  1MJA A;  5IOZ A;  3IKT A;  4A6E A;  2X48 A;  3C1D A;  3EGV B;  5M5W J;  5A2Q K;  1YI2 I;  1ZYR F;  1SVL A;  2K5C A;  3LMM A;  2ZFW A;  2KIU A;  1PJR A;  4BUP A;  4CYD A;  4RB3 C;  1X1D A;  4OOI A;  5F0C A;  1DUX C;  2A07 F;  5FKK A;  1RI7 A;  4ZDO A;  2E1N A;  2DN0 A;  4BHP A;  3ESW B;  2R7W A;  4XBF A;  2E35 A;  4BXX J;  1WCM J;  4HBL A;  1P4W A;  1N77 A;  4O3M A;  4A0Y A;  1YX3 A;  3HOX J;  3IL2 A;  1Y1W J;  4HF1 A;  1IN4 A;  1LKX A;  5E1Z B;  3OS2 A;  2E5N A;  2MG4 A;  3S3O A;  2Y2Z A;  1WI9 A;  1OR7 A;  2LY2 A;  3LSJ A;  2BHY A;  4DBR A;  1TLH B;  2ECC A;  2E7W A;  5H20 A;  1N75 A;  3ABU A;  1EH6 A;  2LKS A;  4Z2Y A;  3TMO A;  3GTL J;  3AG2 H;  5DD4 A;  1SMT A;  3CUQ A;  2W00 A;  1Y6I A;  4Y15 A;  5FKM A;  1KYZ A;  1LJ9 A;  1QPM A;  2P6T A;  3HGY A;  4OMZ A;  1UHS A;  3HDD A;  1L3L A;  3BY6 A;  3O8H A;  3U9G A;  4NHJ A;  2VPL A;  1IV6 A;  1UG2 A;  5L3E A;  2IS2 A;  3JRD A;  5LGN A;  4XIC A;  1U8R A;  4ZYG A;  3FBN B;  5D5V B;  2CRG A;  2XAJ A;  2ID3 A;  2GM4 A;  3BOQ A;  3A2K A;  2V6E A;  3ZMZ A;  1B9M A;  2ZKZ A;  4MGR A;  2K9M A;  3RPU A;  5L3D A;  3VSK A;  3I0T A;  2JRM A;  3S1N J;  2X1E A;  2HOE A;  3L2R A;  1TNS A;  4UXN A;  5D5X B;  3K6G A;  3LSI A;  2OTL I;  1FZP B;  1MJB A;  3GTO J;  2EZI A;  5HLT A;  3JRC A;  3BC8 A;  2OV7 A;  4CYC A;  1FOX A;  2L7F P;  2LF8 A;  4II3 A;  2Y0M A;  1H9G A;  2VC0 A;  2R3S A;  3OYG A;  1BA5 A;  1LVK A;  2DOD A;  2HDD A;  1QPI A;  2VC1 A;  1JUM A;  2Q0O A;  1A04 A;  1GV2 A;  1S8N A;  4J01 A;  1TC3 C;  5BQT A;  2LR8 A;  2M7B A;  1HST A;  1KQ8 A;  4DYC A;  3T0Y A;  2ZJR F;  2ZME C;  4MEY F;  2HXO A;  3JTG A;  3WTU C;  2LDU A;  3JRG A;  5L3C A;  3CUO A;  1NTC A;  4EJW A;  1ACI A;  2HOT A;  2L0K A;  1QNT A;  5CQE A;  1S9H A;  4UUS A;  1P7J A;  2MFZ A;  4U0V A;  1DGR M;  2E19 A;  1FOK A;  3CC4 I;  1PP7 U;  3DPT A;  3H0D A;  4U0Y A;  5LLQ A;  2JN6 A;  2YX7 A;  1H8A C;  2JK3 A;  2DDB A;  2OPT A;  3AFH A;  3BTC A;  3CCS I;  2P5L C;  4HSR A;  1GLN A;  1WWX A;  4HLY A;  3LAJ A;  2N8G A;  3KZY A;  1D8K A;  2DAO A;  2LLK A;  4M9Z A;  2HPM A;  4B09 A;  1YE9 A;  3LFK A;  2EIL H;  2DOF A;  1ZG5 A;  4XLP F;  2I8D A;  5C4J J;  3S3M A;  3CCR I;  2IS6 A;  2E60 A;  1R1T A;  1SD7 A;  5K7F A;  2DQL A;  3CDL A;  1F9N A;  3QAH A;  3KLO A;  1BR2 A;  3PFY A;  1V55 H;  4XKW A;  2R7V A;  3GTQ J;  2AQF A;  3G1L A;  2V9P A;  1WGX A;  3HYI A;  3IWZ A;  5M3M J;  4KMU X;  1AHD P;  1JT0 A;  1SFK A;  2FBK A;  4X6A J;  1ZN2 A;  3BZ6 A;  2DA1 A;  2KZG A;  1FIA A;  2FRH A;  2XIG A;  3BDD A;  4XNF A;  3QRF F;  4HQM A;  1T6S A;  1VQP I;  4X1E A;  5F27 A;  4CGZ A;  2VOP A;  1E0E A;  2UXX A;  4L5E A;  3OYF A;  2CGP A;  4C30 A;  3EET A;  3KET A;  3ZQL A;  1AKH A;  2WTE A;  2H6C A;  2A05 A;  3DKW A;  3M4O J;  3J7A O;  2VBZ A;  4ZYD A;  1MSE C;  4JX4 A;  1HW2 A;  4AYB N;  3D5S C;  3M8E A;  4HNU A;  4IHY A;  2EQR A;  2NRA C;  1XX5 A;  1POG A;  4V2G A;  2QVO A;  2LNB A;  2Q2E B;  2DA6 A;  2DMN A;  3R60 A;  4MIM A;  3W6J B;  3A0H C;  2I5U A;  3HTU A;  3M9A A;  2QSG X;  1BBY A;  1Y8Q B;  4U7B A;  5GAG J;  4CCN A;  6PAX A;  4BU2 A;  2RN7 A;  1FJL A;  4GCV A;  3RKQ A;  1FMW A;  4D5F A;  3JRE A;  3C7J A;  2KMU A;  5H6Q A;  2E1M B;  3G2B A;  2VQH A;  4IO9 F;  1WJB A;  1QBJ A;  2LRE A;  4IRG A;  2DA7 A;  1VQ4 I;  4NC8 A;  2BW3 A;  2W25 A;  2R7Q A;  3CLQ A;  1XDU A;  2DYR H;  2Z16 A;  2HU9 A;  3TQN A;  5DUK A;  3F6V A;  3V7S A;  3FXO A;  3HSF A;  4JYK A;  1JI8 A;  3HOZ J;  1S29 A;  4LIT A;  1UST A;  4XKC A;  1BW6 A;  2DT5 A;  4YIF A;  3L7W A;  3DEW A;  2XC7 A;  3LFU A;  2FU4 A;  3ZQH A;  3LQR A;  4BE0 A;  4LOC A;  2GXG A;  4ZH4 F;  4Q4Z F;  3IV5 A;  3DLL F;  2E1M C;  3D5R C;  2K9Q A;  2HQN A;  1U6G A;  1ON2 A;  3W6K B;  4DIQ A;  1HXD A;  1FP1 D;  2A68 F;  4NQW B;  4ZYA A;  3KZI C;  4R1H A;  2P5K A;  2VPR A;  3IHU A;  3FBI B;  4KYW A;  2HOS A;  1QQI A;  2NS0 A;  2R5Z B;  1D1C A;  2XPV A;  1H88 C;  2H09 A;  3MKW B;  2KDO A;  3H5N A;  3GCM A;  3PJR A;  2UXN A;  1AWC A;  5FD5 A;  4CCK A;  4GDF A;  2P7V B;  1XD7 A;  4GXO A;  3TO7 A;  2Y30 A;  3IC7 A;  1K6O A;  1TT0 A;  3PSF A;  2V1D A;  3S32 A;  4CH7 A;  1HSJ A;  1VQN I;  3QP5 A;  3DBR B;  4DW6 A;  1W7P D;  2IS4 A;  5CVJ A;  2BHZ A;  2VL8 A;  4LK1 F;  4RAG A;  2LBF A;  2EWN A;  3IH4 A;  3TP3 A;  1MDM B;  1J09 A;  3CMY A;  5FRN A;  2B7E A;  2XAQ A;  4XKV A;  2KIF A;  1STZ A;  4ESJ A;  4ASN A;  5GTH C;  3CC2 I;  1U8B A;  2DJI A;  5E8G A;  4A3I J;  1DP3 A;  2JTV A;  2KHM A;  3ML6 A;  4XKB A;  4NB5 A;  2KIS A;  2E36 A;  4A69 C;  3RSN A;  1R36 A;  1U0J A;  2QGU A;  2QQ9 A;  3BZC A;  1T0F C;  3CJQ B;  3PUB A;  4PSW A;  4YII A;  4EM2 A;  1T33 A;  2X0L A;  1ZG1 A;  1X1A A;  2VKE A;  2Z2S B;  2M4G A;  3CCV I;  3W2A A;  2NVU B;  1JTY A;  4DNC A;  3FDY A;  3HBL A;  2ELH A;  2C6Y A;  1JUS A;  3BG7 A;  4DZP A;  2BV6 A;  3S93 A;  3NRV A;  1A35 A;  2JJ7 A;  4BQN A;  2VT3 A;  3OR1 C;  4IVN A;  2G0E A;  2NS8 A;  3ERE D;  5E8I A;  1HDP A;  1CGP A;  4UV8 A;  3DTE A;  5EEA A;  1YQA A;  5JHU A;  3DXJ F;  5HS8 A;  2CQX A;  3H0G J;  4ENJ A;  3HRM A;  4E7L A;  4KFC A;  3V42 A;  2FNP A;  3FM5 A;  2VBX A;  2WAQ N;  3ZP5 A;  1E2X A;  3GWZ A;  3CQZ J;  3VSL A;  3OSF A;  4RAF A;  1YW9 A;  4KN7 X;  3JW4 A;  1BL0 A;  3AG4 H;  3HC7 A;  4EM1 A;  3F22 A;  2YX4 A;  2XF5 A;  4L9J A;  3SJM A;  4HRI A;  1S7O A;  4BHB A;  3BLY A;  5ICE A;  2IEK A;  2W57 A;  1KA8 A;  2DOE A;  2E71 A;  2VI6 A;  3HOT A;  2X6Y A;  4UY8 I;  1SD6 A;  2AXT C;  3MKZ A;  1Y56 A;  3GTP J;  4BNC A;  1RRJ A;  1R5I D;  3CJT B;  1X1P A;  4PJ0 C;  2PG4 A;  3ABL H;  3CES A;  4A2U A;  1LEB A;  2IA2 A;  5KCM A;  1WZ2 A;  4AU7 A;  5F1J A;  5JR3 A;  1OKR A;  1BR4 A;  5J1U A;  2ETH A;  4PFO A;  3S15 J;  2MLK A;  2D5V A;  3KZZ A;  3A1Y A;  3SFI A;  4RDU A;  3W2V A;  1BI2 A;  5FLM J;  4U88 A;  5HLG A;  3V7C A;  4O6J A;  4AYB A;  2FUG 2;  1K83 J;  3WTZ A;  2PEX A;  2DT7 B;  3F23 A;  2JMW A;  4KIC A;  4CHU A;  3IWF A;  1LUJ B;  2HQ5 A;  3CP2 A;  3TOA A;  3TO6 A;  1W5T A;  2XPW A;  1X4O A;  2ZJQ F;  4HDU A;  2FBH A;  1I39 A;  5ICG A;  1KYW A;  3K0L A;  2QKL B;  3DKY A;  5HNH A;  3BG9 A;  4ZYE A;  3R0J A;  3CUQ B;  4RGR A;  1NG6 A;  3PSI A;  4E4H A;  3VDX A;  1MMS A;  2E2H J;  3LL7 A;  2QF7 A;  2GWR A;  1ETK A;  1V5E A;  2GOX B;  3CDH A;  1S6L A;  5C4X J;  2L54 A;  1KU3 A;  2FF4 A;  2FML A;  4YRV A;  4FE7 A;  3K4B A;  3VOE A;  3PNY A;  4H0E A;  5CYV A;  3HOS A;  4ZTF A;  1MNE A;  2L02 A;  1UAA A;  3S3N A;  3FHN A;  2IRF G;  1OR7 C;  3ZMD A;  2Q2E A;  1LNW A;  4YFN F;  2K9L A;  1OLT A;  1WVR A;  1O4X A;  5BMZ A;  4OAZ A;  2UUZ A;  2LOO A;  3CUQ C;  3M8F A;  4CCJ A;  2RVC A;  3O3K A;  4YFX F;  5JI6 A;  3K70 C;  3M1E A;  1LFB A;  1XGN A;  4XRF A;  2IA1 A;  3G1O A;  1LFU P;  3PO2 J;  4GYG A;  3P9C A;  5H2F C;  1IN8 A;  3Q3S A;  3JRA A;  3J81 K;  1ZH5 A;  2PMU A;  3ELK A;  3HEF A;  4I76 A;  2VJ5 A;  5CQG A;  3S1Q J;  2D2W A;  1K78 A;  2E1C A;  4CYC B;  4LD5 A;  3SYT A;  3ZQQ A;  1ZTR A;  1LB2 A;  2JSC A;  4OMY A;  4EAT A;  3Q9S A;  5FO5 A;  4TV7 A;  3GUD A;  2DA4 A;  2LK2 A;  2WAF A;  3QOE A;  4CCO A;  1MKM A;  2XF6 A;  4HX4 A;  2B9S A;  1H89 C;  1YW8 A;  3ZOB A;  1O3R A;  3RTR A;  1XG1 A;  1F36 A;  4Y13 A;  1XMX A;  3C2B A;  5JLW A;  2FEZ A;  2DA5 A;  3E5U A;  4G7O F;  3Q5F A;  5FLX Z;  1ZQ3 P;  2XAF A;  2YU9 J;  1ZRF A;  2ESN A;  2V4J C;  4UUS B;  5HVQ C;  1I6H J;  2W84 A;  4UB6 C;  2LTP A;  4IOC F;  1G6N A;  3FIS A;  4NC7 A;  5GAH J;  1IN6 A;  2L3D A;  1P7I A;  1LDD A;  4N0B A;  2IS1 A;  3M3Y J;  5HNF A;  2ZXW H;  3ZN1 A;  1DDN A;  2LY1 A;  3MAJ A;  3E0J B;  3N97 A;  3AG3 H;  1G3T A;  3F21 A;  5KNL A;  1XSV A;  2VLA A;  1YFH A;  3HHG A;  4WX9 A;  2AXL A;  1N78 A;  2F48 A;  2K7L A;  1BIA A;  2DXI A;  1FIP A;  5B5E C;  2L7K A;  2LYC A;  3I5U A;  1PP8 F;  2P81 A;  3H36 A;  3A4C A;  3I59 A;  4IPA A;  1V54 H;  3WGH A;  5J1R A;  2GXA A;  4FAS D;  4A0X A;  5C3E J;  4C3H J;  1D5Y A;  2I10 A;  2A3S A;  1WJD A;  2NVX J;  5EYR A;  2Z3Y A;  3BJA A;  5E17 F;  2WAQ A;  1KU9 A;  4G9Y A;  2EV0 A;  1BI0 A;  1G4D A;  1B72 A;  3TW6 A;  4RM3 A;  4BXU A;  2BY2 A;  4DZJ A;  4V19 K;  1F43 A;  3I4M J;  2KIM A;  2KQR A;  5DCM A;  3L2W A;  1VQ6 I;  2A6E F;  3GLX A;  1H0M A;  2GOM A;  1JGG A;  3IH2 A;  3CCJ I;  5IP6 A;  1DGW Y;  2K27 A;  1AKH B;  4UVA A;  4C2M J;  1MBJ A;  3IKV A;  2EV5 A;  3K2A A;  3TL4 X;  1SEU A;  4RMN A;  3ZRG A;  4XRM A;  2HNH A;  4NDL A;  2TRT A;  2M87 A;  2CMP A;  3OYH A;  4M9S A;  1XGM A;  5FRM A;  2WB1 N;  2XGC A;  3BP8 A;  3GTK J;  3HUG A;  3VYU B;  4LG0 B;  4MFD A;  4G12 A;  2A69 F;  2R7D A;  3S1M J;  1FSE A;  5HS9 A;  3CD6 I;  1FPQ A;  3OL3 A;  4E6K G; 
#chains in the Genus database with same CATH homology
 5DM6 F;  1YJ9 I;  1VQ7 I;  3EGV B;  1YI2 I;  3CC4 I;  3DLL F;  1YJW I;  4UY8 I;  3CCQ I;  1Y39 A;  5GAE J;  3CJT B;  2E35 A;  1QA6 A;  3CCS I;  1VQ5 I;  2JQ7 A;  3CME I;  1VQO I;  4IOA F;  1HC8 A;  3J7Y J;  1VQK I;  2K3F A;  4IOC F;  3I55 I;  3CCR I;  5GAH J;  3PIO F;  1VQM I;  2OTJ I;  1YIT I;  1VQN I;  3CCM I;  2NXN B;  2ZJQ F;  3I56 I;  1VQ8 I;  1VQP I;  1VQ9 I;  5DM7 F;  1YIJ I;  3CC2 I;  5JVG F;  2FOW A;  2H8W A;  2E36 A;  3G4S I;  1MMS A;  3CCE I;  3PIP F;  1S72 I;  3CJQ B;  3CCV I;  4V19 K;  2QA4 I;  2OTL I;  1VQ6 I;  1WIB A;  2ZJP F;  1VQL I;  5GAG J;  3CCJ I;  1FOX A;  4IO9 F;  3CF5 F;  2E34 A;  3CJR B;  1VQ4 I;  3CCU I;  5GAD J;  1FOW A;  3G6E I;  3G71 I;  3J7Z I;  1FOY A;  3CC7 I;  2ZJR F;  1YJN I;  3CJS B;  2QEX I;  1YHQ I;  3CD6 I;  1ACI A;  3CMA I;  3CCL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...