3J7ZI

Structure of the e. coli 50s subunit with ermcl nascent chain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
141
structure length
141
Chain Sequence
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L32
publication title Drug Sensing by the Ribosome Induces Translational Arrest via Active Site Perturbation.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3j7zI02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3j7zI01
3CMEI 3CD6I 2QA4I 2H8WA 3G6EI 3EGVB 4IOAF 1VQ6I 5GADJ 2FOWA 5GAGJ 5GAEJ 4V19K 5JVGF 1YJWI 3CJSB 1VQ9I 1VQ7I 3CC2I 1WIBA 2OTJI 2K3FA 1VQPI 2E34A 5DM7F 1S72I 1ACIA 2ZJRF 1Y39A 3CCRI 3CCQI 3CCMI 3CCSI 3CMAI 3PIPF 3DLLF 3CJTB 1YIJI 1VQ5I 3CJRB 4IO9F 1VQOI 3J7YJ 1FOXA 2E36A 1VQKI 2NXNB 2ZJPF 2JQ7A 1VQ8I 3I55I 1FOYA 2E35A 1YJNI 1YHQI 3PIOF 1MMSA 1YI2I 3CCJI 3CC7I 5GAHJ 4IOCF 3CF5F 5DM6F 3CCEI 3CC4I 2OTLI 1VQNI 1HC8A 3I56I 1YJ9I 1YITI 3G4SI 3J7ZI 2QEXI 1VQMI 3CCVI 1FOWA 3CCUI 2ZJQF 1VQLI 3CJQB 4UY8I 1VQ4I 3CCLI 1QA6A 3G71I
chains in the Genus database with same CATH superfamily
4JBAA 4PJNA 5FLXZ 2FNAA 3QPTA 2JMWA 1F43A 1ZARA 3EGVB 4HBLA 3Q9VA 1IC8A 2EV6A 3KEQA 3HPHA 1AHDP 1B72A 4FCYA 3BR1A 2GBYA 1VFCA 3PFYA 3BOQA 4A69C 1D1BA 1WJAA 3FXUA 3IH4A 3HZJA 1FBUA 5CQEA 4A12A 2MA3A 4PJLA 1ERDA 5AONA 1XGOA 2W85A 1I6HJ 1WIBA 1ZHFA 4I99C 3HKZA 2IA0A 4RLQA 1DGRM 3HRMA 3JR9A 4D5CA 2CW0F 3VFZA 3HRUA 4BQQA 2A5YB 4HZFA 4A93J 2O0YA 3CCQI 2R5YA 3I3LA 3I9V2 1G8XA 4H4KC 2DA5A 3H9JA 1LDJA 1AA7A 4PSWA 1VQ5I 2JPBA 1QPMA 2ZSIB 3W6KB 4A0ZA 3KP6A 5BQTA 1A36A 3BR6A 4IZZA 3C18A 4PDKA 4IO9F 1NHAA 5BS6A 2XGDA 4X6AJ 1E2XA 2LK2A 4RB2C 3LAPA 1XCBA 3AG3H 2XAHA 3SZGA 1YOVB 2AXLA 1TWAJ 2VJ4A 2GA2A 1HBXG 2BHYA 2DXIA 2WB1A 1OCZH 1BOBA 3WGGA 5FJ8J 2DT5A 1Y1WJ 1GVDA 4G6QA 2QGUA 1H9TA 1MMNA 5LRSA 5FGMA 1XS9A 5D5UB 5BPIA 4AIKA 1MW7A 1GXPA 5EDNA 2BY3A 2Z16A 1BI0A 3T8RA 2AHQA 4AVPA 1Y0NA 1IV6A 1HC8A 2M9HA 2VI6A 5GTIC 1FP2A 2DMPA 2WTEA 4QIWN 2LR8A 4I02A 2IS4A 2WAQN 3GTLJ 3FM3A 4K2EA 3CCVI 3R0JA 2IP2A 2XGEA 4CICA 3DKXA 1HSJA 2KJBA 1R49A 4W97A 1G6NA 4BXFA 1T6SA 3J7AY 3I4PA 2H6CA 2CG4A 1U0JA 3N4MA 2K02A 2D1VA 1CQTA 1BM9A 4CZCA 2R4GA 5F27A 3L2RA 5HS7A 1UHWA 1VQLI 1ZLJA 2K9QA 1YX3A 5EEGA 3RYRA 3E5QA 3VDXA 3WG9A 4DYCA 1S8NA 3TMOA 4HF2A 2EIMH 4BU2A 4UUTA 2H1KA 3KETA 3TQNA 2KKOA 4BHPA 2L7MP 1TQIA 2M4GA 5DDGA 5GAGJ 3K0LA 3I4MJ 3CESA 3WTXC 4A5MA 5GPCA 3AL0B 5HNFA 2IS6A 3MD2A 1TW3A 3KYLA 3GTPJ 2IA1A 4A3CJ 5L3BA 2NOGA 2KIMA 4G9YA 2VC0A 2VL8A 4KICA 2R7UA 2DMUA 3CDLA 1N75A 4OWRB 1AWCA 4M3DA 5E1XA 1R1VA 3QPLA 4QTRA 2ESNA 4ENNA 4BNCA 1UFMA 2P0WA 2L4AA 1TNTA 3HOVJ 1ACIA 1XCVA 1YIOA 4JK1X 3HSFA 3D5LA 4HF1A 4F3QA 1RESA 4ESBA 3WE3A 3U2RA 4FE4A 1FBQA 2MH9A 5EZHA 4GFBA 1FSEA 1G3TA 2NVUB 2FMYA 3K4JA 1ZTRA 1P7IA 1K78A 2JRTA 1GT0C 3HTSB 2H94A 5E8IA 2F5VA 2L9VA 4BL0B 3HB9A 1DU0A 4NBQA 3OS2A 2HQRA 2UV1A 2HVSA 1OFCX 1ZG1A 3FXKA 4ZDLA 3GFMA 3HUGA 4MGRA 3OYEA 3M3YJ 4RGUA 2CH0A 2JRMA 3GXOA 2VXZA 2RQQA 1DPUA 5H6RA 1X3UA 5EZGA 1H8AC 1DU6A 3TGNA 4ZYGA 3JREA 1KU7A 1IRGA 3F9KA 3VOEA 4CGZA 2Y9ZA 2XRLA 2DBBA 2L2OA 1BIAA 1FMVA 2ECBA 1LPQA 2A61A 5HLGA 5H6QA 3ZMSA 3HPGA 3ZQGA 3S3OA 2R7TA 4UV8A 1I50J 1ZAOA 1ODDA 3L7WA 2PJRB 1XGNA 2R7ZJ 3OR1C 2AS5F 1VF9A 5D5VB 1VQMI 5IT3A 2BVMA 5LHHA 4XLFA 1YO5C 4GYIA 4U7BA 2MLGA 1W5CC 5TJJA 1GDTA 2L9NA 1ETOA 2LBFB 3WODF 1J75A 1Z9CA 3DU6A 2CQQA 1VZ0A 1G3WA 2QUFA 1JJ6C 1RUOA 4BQAA 3OS0A 1BR4A 2BHZA 2F4OB 3C2GA 3OIOA 4BY1J 2DDBA 1ON2A 4PSXA 3Q5FA 1WFXA 2A6TA 2XPUA 4I0BA 5EYRA 4UVAA 3FXLA 1LE8A 1JKPC 2ZMEB 3EPZA 1MBGA 2E60A 1K7AA 2VUMJ 3LA3A 4IOAF 1JTYA 2MH2A 2EFNA 3E1SA 2LG4A 2M87A 2XKOA 1UG2A 2GIZA 1ZLKA 4Y3OA 4LLLA 4BH9A 3KEOA 5JVGF 1RUNA 4MEYF 2FA5A 1J7KA 4CSWA 3F8BA 1QGPA 4ZYDA 2FQ4A 1OCOH 3IAS2 2HQAA 5GTHC 3LMMA 2DK8A 3DCFA 1FEXA 1DUXC 4XICA 3GVAA 4YFNF 2DLLA 2FBHA 2OJED 1UMQA 1O3RA 3HOTA 3I58A 3EQLF 5K7HA 3S14J 4ETSA 3QU6A 2GXGA 2LMDA 3IAM2 4M71A 1GV5A 5HNHA 1JT0A 2A6EF 2CSOA 3COAC 5B3SH 3BG7A 3G3ZA 5ICFA 3WTUC 5JFRA 4S05A 1JGSA 2EFQA 4BXUA 1J0RA 1QZYA 3OYBA 2BY1A 5DCMB 1HW2A 2M4KA 3W2AA 1FX7A 2X4HA 3CJRB 5CPRB 2MD0A 3WTYC 4IEJA 1SAUA 3J7YJ 4KYWA 2KDZA 1ORKA 4Y4RA 4YIRX 2DA2A 1SVOA 3WGIA 3DBLB 3P9IA 4F55A 3TOBA 2A3SA 2LFBA 1YX5A 1LDDA 1N25A 1Z7UA 1PJRA 1KGSA 4FETA 1MBFA 1K79A 1BJZA 4OOIA 3ZN0A 1WKMA 3W6JB 2ISYA 2Y48A 2VJ5A 3JSOA 5FFZA 3L2CA 2HOSA 3SFZA 3IKTA 5DEQA 3G73A 3OSFA 1USSA 3A4CA 2E1MC 4ZDPA 3NQOA 4II2A 2AQEA 2R7WA 4XN3A 4DQ2A 1QVUA 2XB0X 2DODA 3R61A 3F21A 2FQ3A 2YU3A 1T39A 4DW6A 2F5DA 2LD5A 2KRHA 3TW6A 4G7ZF 1E3HA 3JRFA 4DJAA 2VT2A 2W25A 3MEXA 1KU2A 3FHZA 1W7PB 3ABMH 2LF8A 4MIMA 5K1YA 2XKPA 4HNVA 1MBKA 1SFUA 1DP7P 2DMNA 3LSMA 1PUFB 3CUQB 4RM2A 3S16J 3DEWA 4OMYA 2DFHA 1R36A 4GRIA 3SYTA 1MDMA 1K6OA 2VBZA 4HW0A 2RQPA 4B3XA 2ETHA 2NOJB 3F8FA 5GADJ 3BZ6A 2GXAA 2CRGA 1D1AA 1UAAA 3OL3A 4S0HB 1V4RA 3OYNA 1X1CA 4M73A 2E7WA 5D6EA 5F64A 1VQ9I 5K5QA 5EG0A 1Z1DA 2GQQA 2P8TA 3GYHX 1ZKGA 3FMQA 3W2VA 4HOBA 2Z3YA 1VQPI 5KVRA 2EIJH 3K10A 1U5TB 2RNJA 3FBIB 5DYMA 5ERIA 2HYGD 4J00A 4CHUA 4HQMA 3ZPLA 2W57A 2CW7A 2WBMA 3OYHA 4PK4A 3RJPA 3FX3A 3WTTC 2IGMA 2QLZA 3MKZA 3CCSI 5LRRA 1M1EB 2QCOA 4YG2F 2EFWA 3VODA 5FKKA 2F6CA 2HXIA 5EGOB 3GLLA 3JRGA 5IYDJ 2CFOA 2V9VA 3AFHA 1AU7A 4M3BA 4FASD 2L01A 3DEEA 2HPIA 1ZELA 2V79A 4HX4A 2F5EA 2LY9A 4LK0F 2MABA 5ILVA 2R7DA 2B63J 5FLMJ 3CDHA 2EQRA 3GMEA 1MMSA 1ENHA 2FMLA 3TBIA 1WH7A 3CC7I 2ZSHB 4IOCF 2UXNA 4E7JA 2CQKA 1FY7A 3CCEI 1Y8QB 5LFAA 5J1YA 2LYCA 2K9SA 2JA2A 3ZMVA 5FLVA 2W82A 2ZXWH 3OOPA 4FHTA 4HYEA 1VQNI 2JA6J 1YW8A 2F4MB 4DYRA 2W7NA 2CGPA 4XORA 5HOOA 1IJWC 3REOA 3LSHA 2XPWA 3K7AJ 1U9NA 3S3NA 4HRIA 5F0HA 4XLEA 3SHFA 1R5GA 4MQ9F 1Z6TA 4HPQA 4Y52J 3K2ZA 1T0FC 2DA7A 2ZO4A 4C2TA 3GTKJ 4OIPF 3IKVA 2UUZA 1B72B 5D8LB 2EA4A 2H27A 3ZQFA 2JA8J 4ITVA 2ZJQF 3ZQIA 2P7CB 3RKXA 2I10A 3CP2A 4AU7A 3P5JA 1S7AA 1TWGJ 2CUJA 2WY7Q 3F6OA 4L5IA 3TW7A 4LK1F 3TO9A 4BBSJ 2QENA 1HKQA 2KISA 2IT0A 2OCCH 4B48A 2X1DA 1IG7A 1U78A 5GAEJ 3QPSA 2M8EA 3R4KA 2E5NA 3OL4A 4DZJA 4I98B 2R5YB 2PMZA 1IN5A 2VBXA 1A04A 4IF4A 4KUMA 3GW2A 4I2OA 1EKEA 4IKFA 2D45A 1I5ZA 2XAQA 3V7SA 3DTKA 1WPKA 4A3EJ 1WJ5A 4A3BJ 3AG2H 3V8JA 3VYSB 4M6VA 1MIJA 3E6BA 5IPAA 2JZYA 2DI3A 3H3ZA 2W24A 1EA3A 4TV7A 1YRNA 1EJ9A 4LG0A 2IGOA 1HDPA 1Z6RA 3CMAI 1B6AA 2HGCA 2Q2EA 3V7RA 3PFIA 2DTZA 2M30A 2JVGA 4M9XA 2WAEA 2X85A 4CCNA 4I6ZA 1FYMA 3B73A 2HPMA 2FE3A 4NC7A 3RKQA 1V54H 2LOOA 1MMAA 3DPUA 3VYUB 2XF7A 5M3FJ 3HIFA 1FOXA 2VOPA 3MN2A 3PQJA 2HTSA 5CYVA 1TT5B 1I1GA 1E0EA 3IHUA 2CQ7A 1H88C 2H8RA 1SD4A 4CXFA 3K70D 1FT9A 3DV8A 2R7FA 1BIBA 2QM3A 1UJ8A 2LVSA 1UELB 3PSFA 3H3UA 5BNGA 3I56I 2GAUA 2F5CA 4HG2A 5FKOA 4LIUA 4U0YA 2XAGA 4GCVA 1X19A 2X9DA 1F9NA 5J6XA 5JR3A 1IAWA 2XC7A 3LSPA 1RRJA 2VBWA 1IN4A 1ZR2A 4OINF 3N97A 1OCTC 1HKTA 1WJEA 2O6GE 4ZTFA 2GIVA 3QPHA 3ONQA 3GTJJ 1IUYA 2HKOA 2A5WA 1MZBA 2KRFA 2F5FA 2RC4A 3LA2A 3PJRA 1X1AA 4WF2A 2PMZN 3ABLH 5GP9A 3V8LA 4EQQA 3A03A 3R0AA 1BI2A 2H8WA 2JWTA 4BYYA 2MC4A 3M8EA 4XRFA 1N78A 1Z77A 1MH4A 2M45A 5J47A 2PFBA 5E3OA 3H36A 5KHDA 3IWFA 4Z6YA 2VPLA 4M6XA 3EETA 4XOPA 3LFKA 5FO5A 3CJSB 2HQNA 2EZLA 5L3GA 2QWWA 1PP8F 2XSJC 2JN6A 1IN7A 1T33A 4BE2A 1K78B 4XLAA 2XUBA 2BXZA 2K9NA 3R60A 5AIQA 2ID6A 2KIQA 3JSPA 1SD7A 4IPAA 1YFHA 1NG7A 3KLOA 4AIDA 3CCRI 5LEJA 1SD6A 2Q0OA 3HUGB 4YFKF 3BWGA 1J5YA 3BTCA 3K9TA 3F22A 1LFBA 1UB9A 4AYBA 4O5VA 1JKRC 2DJNA 2X1CA 3QQAA 1QZEA 2EZHA 2X6WA 1W4MA 4A6DA 1KU3A 3LSTA 3J80K 5E17F 4XK4A 3OIQA 4A2UA 4C3JJ 3OS1A 5LD2C 1VQOI 3RCOA 2Y31A 4CYCA 5E3NA 2QQAA 4BQOA 4XKVA 2HI3A 2QBYA 5HDNA 1MNMC 2ME6A 1IGNA 1TWFJ 3IUOA 3K4LA 3SEZA 2GA1A 3BQYA 2L9SA 4M74A 4UUSA 3D1NI 1YJNI 2RDPA 3MMYB 1XG1A 1YHQI 4BHBA 3PNTA 4PCQA 1ZQ3P 2IEKA 2QF7A 4ANJA 4XRSG 3EDPA 3I59A 5ED4A 2VXDA 5J1UA 1FNNA 4LJZF 2QKMB 1OQYA 1OPCA 2Y0SA 3M1EA 3K4KA 1NH3A 3B6AA 4BQNA 4F52A 4BBRJ 3BC8A 2OUMA 3F8MA 1O4XA 4WXCA 1XB4A 4NQWA 2PI0A 1Z3XA 1LE8B 3IWZA 3CCUI 4IHWA 1ETWA 4E7HA 4FE7A 3PO3J 2FD5A 2NNNA 1T2KA 1ONVA 4DBRA 2CV2A 3GUDA 2LTPA 2M2EA 2IXSA 4XRSA 1BR1A 4PJMA 4UY8I 2EH3A 3BR5A 3RQIA 3CCLI 4C3IJ 4Q48A 2OF7A 4XSZF 3CMEI 2V9KA 2ADUA 2QQBA 2X6XA 3G6EI 4HSRA 5KAFC 4EEFG 1EH8A 2IRFG 4XLPF 4A3DJ 4RB3C 2MW8A 1WJCA 3S2WA 4MEXF 2Q8KA 4C2MJ 3FXRA 1FSHA 2LSOA 3PUFA 2QQ9A 1B9MA 3L9FA 1SMYF 1S7EA 2XF5A 4G6TB 1G3SA 1IUFA 3IP4B 2DK5A 2KIUA 3CC2I 2DT7B 3M8FA 3CCYA 2E34A 1T0FA 4GDFA 1BR2A 1A35A 2VONA 1MJAA 1J59A 3HKZN 3H0DA 3KYCB 3LNQA 4M3EA 2MLKA 4NB5A 2E2JJ 2XVCA 3ZR8X 2IBDA 1FZPB 3L2VA 3UKGA 2ELJA 2BEOA 2RAEA 3PL8A 1K83J 2X0LA 5KK1A 2NVYJ 1I39A 4B44A 5CVVA 2VKEA 5E8GA 3LSJA 3S17J 4ESJA 1OISA 1MKMA 1XDSA 2P4WA 4YEJA 3ABTA 2TRTA 2O8KA 2Y0SN 1B4AA 3FXQA 3SXYA 5CVUA 4IVNA 4PFPA 2JA7J 5C44J 1OYWA 1FP1D 2B7EA 2M8GX 3C2HA 3HSRA 4HF0A 4ZDOA 1JKQC 4NUBA 4XL9A 5A2QK 4JP0A 3U21A 1QBJA 2WB1N 2YUSA 1BBYA 2KPMA 1Y8RB 2G9WA 1ZRCA 1IN8A 3LSIA 5M3MJ 1K4SA 4CO8A 2VBYA 1FYLA 1TQPA 2JK3A 1O57A 4KN7X 2QSHX 4XBFA 4R1HA 1SD5A 3CO7C 3SDBA 1ETQA 5L3CA 2LLKA 3WTSC 1WSUA 2HWVA 1HCRA 3QP5A 4IQ4A 3BZCA 1W36C 1JHFA 4PJJA 4OIRF 1R1UA 2IPQX 3OMYA 4FISA 4ZTJA 3JRDA 2BE5F 3VSKA 4RDUA 4C30A 1MDMB 2LKPA 1HA8A 1LJ9A 3PNYA 4HSTA 3ASNH 4B47A 3FKIJ 3EYYA 5J8CA 4M3FA 2O3FA 4XRMA 1CF7A 3WTWC 1KQ0A 2Y75A 2MG4A 2X48A 1FPQA 4DIQA 1D8KA 2KZGA 5FRNA 1IN6A 4Y33A 1YTYA 5IT9K 2L4MA 3CJNA 5J4YA 3OYAA 4IJAA 3JRBA 1NK2P 4L0ZB 2UZKA 5EG0B 2CJJA 1S5LC 3CP8A 3FK7A 5TGTA 4L5EA 1VQ6I 2PBIA 3OYLA 1T95A 3K4BA 3ECHA 1TTYA 4L5JA 2FOWA 2HOEA 2HVQA 2TCTA 2FXAA 5IP7J 1S3JA 4NC6A 1RI7A 3JAMK 2LY1A 3FMRA 2VQHA 4AWXB 2W1OA 6PAXA 5B1AH 2MFZA 3AG1H 2VQCA 5M5XJ 2HDWA 5DD8A 1PDNC 1UCRA 1T8IA 2ECCA 3W6VA 1UZCA 3O8GA 3WG7H 2UWMA 3WE2A 3MAJA 3S2HJ 3HHGA 2BYVE 2V1DA 4CCKA 1PVEA 2R5ZA 2K4BA 3C7JA 1XPXA 2ZCWA 4S04A 5K7ZA 2MSYA 3FXOA 3M8JA 3OYJA 3PIPF 3OYCA 1FTTA 5HLIA 2EA2A 2DA3A 4LGWA 2LY2A 1RR7A 2FBIA 1JUSA 4AM3A 1OYIA 2EZIA 3KCCA 1TP4A 2ACJA 2FNPA 1BW6A 3LFUA 4JOMA 1PUEE 3B6CA 3SJMA 1AOYA 3OYDA 2ICWG 2RKHA 5LGNA 1H0MA 4EJWA 1W0TA 1X1BA 2VC1A 3J80Z 1IF1A 4MNUA 1XDUA 2OU2A 2ZNYA 3C1DA 4Y15A 2ZXJA 4B09A 2R92J 5DM6F 4B4CA 3U1DA 2VODA 3HOZJ 1B9NA 3GTOJ 3BDDA 4MLOA 1YJ9I 1U9OA 3CUOA 5LGUA 4J19A 3ABKH 4NHJA 1N77A 2DA4A 4RBOA 4HV5A 1B8IA 1U5TC 2DA6A 2G7HA 2GOMA 1X1PA 3A1YA 4PZJA 1U6GA 1AKHA 3A01A 3ML6A 2EIKH 4XMYA 4DYQA 3CMYA 4E7IA 2HDCA 2XIGA 4Q4ZF 2VJJA 1SC7A 1QQIA 2KLOA 2BBYA 2L54A 1PYVA 4EJOA 1HLVA 3ZQLA 1ZGWA 3BCAA 1I1SA 5IYBJ 3JRAA 2V9PA 3KFWX 2V7FA 2BZTA 2QA4I 4A3IJ 4B8XA 5HVQC 2EBIA 3T0YA 5FD5A 4I0AA 4I09A 3EYIA 2PQ8A 4MFDA 2QQ8A 2LREA 3M7GA 4G7OF 1BI1A 2Z1DA 2B0LA 3BR0A 4X0GA 1A6QA 3HC7A 1YW9A 1YRNB 4LG0B 1G59A 4J01A 2DQLA 4H0EA 4MHGA 2BGCA 2Q2EB 2CUFA 2CFXA 4UVBA 2XSDC 4A0YA 5ICEA 1P2FA 2HS5A 4ZYEA 4M9ZA 5DM7F 2WAFA 4L9VA 4BEHA 2NVQJ 3E6CC 1ETYA 3GTGJ 1NK3P 1BI3A 1Y0UA 3RDIA 3EUHC 5CVJA 3EUKL 3CDIA 4N4NB 4IHVA 3GTMJ 4LB6B 2HNHA 1R5ID 1MH3A 5DS9A 4BDZA 3SZTA 2HQ5A 2I8DA 1ZGAA 4XLNF 2CS3A 4YELA 3S15J 4BE0A 1XGSA 4PGHA 5B1BH 4A3FJ 2R7VA 2FRHA 3QYFA 4A3MJ 1QHGA 4I7HA 2PJPA 3WU2C 3BCBA 1HQCA 1IXCA 4BY7J 1T56A 4DGWB 2E36A 1OMIA 2EFOA 2NXNB 3ASOH 4HLYA 2ME0A 2EB7A 2JQ7A 3Q0UA 1RKTA 1WJDA 3W3CA 3DTIA 3S32A 5FRMA 5CJ9A 2E35A 1VTNC 1Z7LA 2DTRA 3O6BB 1LDKB 4WXDA 3DU5A 1R5HA 3RSNA 1WJFA 1LVAA 2WV0A 3MZ8A 4F93B 1E3OC 5CVRA 2BY0A 1YE9A 3T5XA 1R4MB 5KNLA 3SZPA 3CLOA 1SMTA 4CZZA 5E3MA 2IGNA 3PSIA 3RKWA 1P92A 2KQRA 3KEYA 5TRDA 3HL2A 4KFCA 2MBFA 1L3LA 1JGGA 1O7LA 5A2QZ 1YITI 3DPTA 3TP3A 2Y69H 1LNWA 3ULQB 3Q9SA 2XASA 3TOAA 1FJLA 5JVTA 4FX0A 2VE9A 3L2UA 2V26A 2DYRH 2XAUA 3GZNB 1FOWA 2ESHA 2HTJA 3RKYA 1S9HA 2V6EA 3GZ5A 1PP7U 4IHXA 2H1LA 3S1MJ 5LBQA 2MYSA 4ZC3A 2Y2ZA 3DP7A 1D3YA 4JX4A 3H5AA 2E1MB 2DFEA 1F36A 3BQZA 2NVTJ 2P6SA 1MMDA 2LP0A 3MQ0A 1EH7A 5LHGA 2JUGA 3KZYA 2Q1ZB 2OCEA 4D1QA 1LB2A 5DUKA 4BXXJ 4RGXA 3QRFF 2VQGA 4X1EA 3RZOJ 3CZ6A 2IJLA 2DFIA 2NS0A 3Q3SA 4G6DA 1ON1A 4I76A 5IT9Z 4C3HJ 4O3MA 1D0XA 2ZJ2A 3FZVA 4RAFA 4C2UA 3I4NJ 1VQ7I 1BL0A 2R93J 3DEUA 5J3LA 1JJ8C 1XX5A 2MC3A 1TLHB 5ICCA 2K3FA 3MZYA 1UHMA 1TWCJ 4IRGA 4RM3A 5GPAA 3P7NA 4BAYA 3QOEA 3JAMZ 4P96A 4HX8A 3FISA 3MFKA 2EWNA 4CYCB 1X3WB 4U7DA 3F8CA 3KP4A 3FWEA 1P6RA 1GVJA 4P1WA 4D7MA 4WCGA 4WXHA 2QBYB 3K6GA 1QPIA 4A3KJ 4DNCA 2XRNA 1BA5A 4UUSB 1UHSA 2DOFA 4Y17A 2QYOA 1Z05A 3CF2A 3S1QJ 3LWFA 1RNLA 1WH5A 4E7SA 3L00A 3IH3A 2ZXIA 3GFJA 3TDUC 4QPOA 2DA1A 3I59B 2PN6A 3KPHA 5FD6A 1IDZA 4WWCA 4M3GA 1O3TA 3HOYJ 4LMYA 1MNEA 2ZJPF 2DW4A 2ZBKA 4XKBA 1LFUP 2IS1A 1D0ZA 1WGXA 1HW5A 5IY5H 2CYYA 5DD4A 2FSWA 3MVPA 1ZN2A 2VIXA 3NRVA 2E71A 2O03A 1DPRA 3S93A 1SFKA 3RPUA 1DGWY 2O9LA 4RA2A 4NQWB 3T8TA 1QZZA 1R23A 1IW7F 1H89C 4XIDA 5LEKA 1FMWA 2EINH 4QWQA 2DCEA 2OV7A 3BTLA 4GYGA 4XNFA 2E1OA 3U9GA 3J7ZI 1MD0A 5KCMA 1HKSA 3DPLC 4IQJA 2HOTA 2P81A 3GF2A 3NWTA 3V7CA 1G4DA 2VT3A 3OR2C 3TKYA 1ZRDA 4II3A 4C9YA 5JI6A 3E7LA 9ANTA 5F0CA 1KU9A 4A6EA 3WHCA 3A0HC 4FQGA 1X1DA 2I5UA 4U0VA 1HW1A 2V1XA 1IZ1A 1P9QC 2STWA 1MJBA 4V2FA 4U0WA 3GFIA 4EV0A 1D5YA 1VQ4I 2DOEA 2CUZA 4XKWA 4RAGA 3CD6I 4CUGA 3HOSA 2R3SA 2XGCA 5B5EC 2QSGX 3M4OJ 2VE8A 3LOCA 3QYBA 1FIPA 1GUUA 1E3PA 1EH6A 3FK6A 3G1LA 3O8HA 4EM1A 2Y30A 2FU4A 5FROA 1GLNA 1QRYA 1R9TJ 4KT5C 2NYXA 4RB0A 2OZ6A 4OAYA 3OOUA 5LLQA 3K2AA 3MKLA 2XAFA 1ZG5A 2L7KA 1TNSA 4BJ5C 5J8FA 3ZMUA 2OC6A 1TQMA 3ECOA 3H92A 2CQXA 2J5OA 4KITB 4RB1A 2EFPA 3QWLA 4Q5SF 2K85A 4Y13A 3H5NA 4RMNA 3ZXSA 4HAMA 4L9JA 3S3MA 3SQNA 4KJZA 3MCZA 3TO6A 4M6YA 2M1BA 4RAYA 2ZJRF 3UR3C 5H2FC 5F1RA 3BR3A 3S1NJ 4A3GJ 3RIRA 1V5FA 4G8XA 4U87A 3ELKA 2FEZA 1GHCA 5JHFA 1XN7A 3H3VK 4CCLA 2VKDA 5D5XB 2YR2A 3DLLF 2FUG2 2DFFA 3HOUJ 1MJ9A 2IGKA 4D5FA 3OY9A 4JX5A 5JLXA 3DF8A 4P5OA 2KMUA 2OAZA 3K1PA 3OWTA 2XROA 1IRZA 2DMTA 3SDGA 1MNDA 2O7OA 1RPWA 1TL8A 1OKRA 1RC9A 4ABZA 5IP6A 3H9QA 1QNTA 3H5RA 1X2NA 4CH7A 1WHUA 2QZ8A 2Y9YA 2LKXA 3HG9A 3ZOBA 2DMQA 2KHMA 2GXBA 1A31A 4AIJA 2HVRA 2BV6A 2HYFA 3OSGA 4Q47A 2V1UA 2COBA 2NRAC 3IV5A 2RN7A 1OJLA 2IAIA 2CWEA 2E7XA 1J09A 2XDVA 3WHBA 5ILSA 4N9HA 4R79A 4O6JA 1W5SA 1HXDA 3D5RC 3HBLA 2EZKA 1YYVA 5HS8A 2LKSA 3EUHA 2NS8A 2WAQA 3I64A 3G4SI 1CF7B 1BW5A 3IH2A 1SFOJ 4G7HF 4BJTA 2QEXI 3KZIC 3TO7A 1S29A 3E97A 1EV7A 3ZGKA 5E1WA 2EV5A 4XOTA 4LITA 4EATA 4LG3A 2X1EA 1B59A 3DTEA 3H1CA 1DQUA 4ZYAA 3OIPA 3AL0C 2HOAA 1R4NB 1SEUA 5ILUA 4KIFA 3CJQB 1TBXA 4Y7NJ 5L3EA 2X51A 4DZPA 2G0EA 2L9RA 2G7UA 1WQ2A 3G71I 3CTAA 2E1NA 2JSCA 1P4AA 3ERMA 4RLFA 5EF6A 2ZC2A 3JRCA 1XMAA 2P5KA 3F72A 3GX4X 4ZYHA 3CMMA 4PUSA 2K4JA 4L0YB 2R5ZB 4HDUA 5BOXA 2BW3A 4UV9A 4OMZA 5K5RA 4BE1A 3HM5A 2A07F 1HSTA 3E5XA 3ZN1A 1ETVA 3R6SA 3MKWB 1YW7A 2D5VA 1WZ2A 2OTJI 1U3EM 4XR6A 2DAOA 3DXJF 3VEPA 1LFPA 5E79C 3WTVC 3GO5A 1S72I 3B02A 3HTUA 1WVRA 1WWXA 4B1RA 4BACA 1X2MA 4CA0A 1JE8A 3TL4X 4KIGA 2Z2SB 3OYFA 3E0JB 3HOWJ 4LIVA 1CGPA 1F1ZA 3K4NA 3RPQA 2KRCA 1YIJI 2ZFUA 4EGZA 1TC3C 2NNYA 3BLYA 1Z91A 4ENMA 3I5UA 2OBPA 3ESWB 4AYBN 3ERED 5IP9J 2CW8A 1ZH5A 3FHNA 2VJIA 2LF7A 1T98A 3QP6A 3FM5A 4IX7A 4KIBA 4A5NA 3JTGA 3A2KA 5M5YJ 1D1CA 1W5TA 1Q1VA 3BPXA 4QPQA 5K7FA 2MGQA 2W00A 3BTJA 1ZGJA 2O61A 1B8IB 2KL4A 5GAHJ 1AKHB 4AIHA 4BHCA 3A01B 3CC4I 1C0WA 2R7RA 4IHSA 1R00A 5HLHA 2OTLI 1K6YA 2ZFWA 3BJOA 3KZZA 3LQQA 3P9KA 1IO2A 4BKXA 1IXSB 4ZH4F 4XQFA 4QLCU 3S8PA 2K9MA 2AO9A 1RETA 1Y1VJ 4MTDA 2ZMEC 4MFEA 4F7ZA 2QSFX 1TW2A 1IV8A 2YX4A 3NARA 3HJEA 2FJ1A 2DDAA 2N8GA 5B66C 4MTEA 1P4WA 2VKVA 3GLXA 2LH9A 5FKMA 3E6MA 1X3ZB 4UB8C 2O5RA 3HSEA 3DWLE 3HGGA 3PUBA 4UB6C 3T1BA 5TISC 4UHTA 1OR7C 4HNTA 1OYYA 2RV8A 3HGYA 3BG9A 4IHTA 4KN4X 4BEHB 4UNOA 1JTXA 1DDNA 1D0YA 2VLAA 4V19K 1FYKA 4EJUA 3VSLA 4YIIA 2WC2A 3OV8A 2PMUA 3ZQHA 5IYCJ 2GOXB 3CO6C 2DPUA 4CDGA 2FOKA 3DLAA 3J7AO 2XB5A 4XM3A 5FFXA 1A6IA 4ENJA 2YPRA 5AIPA 1IRFA 2R7QA 2KDOA 2ZXHA 1XD7A 3VYTB 4A0XA 4HNUA 1APLC 2ISZA 3C3WA 5D6FA 3BT9A 1ZR4A 2E2HJ 1JT6A 2L5QA 3KP3A 3ZQQA 4IL6C 1WJBA 4YIFA 3ISPA 1Y39A 4RAZA 2WADA 5FKNA 3RI4A 2R7SA 3KIOA 2K5CA 3LQRA 3QAHA 5ICGA 4R8HA 3BJAA 1D8JA 4HEA2 1KZHA 3CCMI 1KYZA 2GLOA 1IXRC 2ZKZA 3J81K 3CJTB 1WCMJ 5JHUA 2HYJA 2AXTC 3GTQJ 2MD5A 1Y6IA 3N05A 2CV0A 3M9AA 1TWHJ 2KT0A 1MMGA 2L0KA 2HKXA 2R0QC 3A02A 1KQ9A 2E19A 4LD5A 3HOXJ 1U8BA 4FTHA 3OYMA 1VQ8I 3BTIA 4HX7A 4M72A 1XSXA 3L2QA 3TEDA 4UUVA 1FOYA 2Z5UA 4NDLA 2FX0A 3V8KA 4L18B 5BMZA 2LNBA 2CV1A 1B1BA 4JX6A 4BS9A 2M7BA 1A5JA 3G1OA 2XF6A 2V1NA 4EJTA 3CCJI 1MBEA 2IW5A 4BUPA 4W1UA 3H0GJ 2RNGA 1ETKA 3SEQA 2HU9A 1LUJB 1O3SA 2ID3A 1LKXA 2UXXA 5FB2A 4NNJA 1Z3YA 1STZA 1FC3A 2VB6A 2EJRA 2OPTA 4HV6A 1NG6A 3CUQC 3ZMDA 1F5TA 1QU3A 5F08A 5EEAA 3K4CA 2PG4A 4D7NA 3AAFA 5LHIA 1MSEC 4DOZA 2K7LA 4DBQA 3L09A 1R6RA 2IVMA 2KIFA 5HDKA 3E3VA 3RTRA 1H9GA 4ZJZA 3BG5A 3HHHA 2DN0A 5DTDA 4E7LA 3PQKA 1NTCA 2A6HF 3W2WA 1W36D 3K69A 3UNGC 2VASA 4P9UA 2BOLA 3WGHA 3HDDA 1BN5A 3ABUA 2HZDA 2R7XA 4KMFA 2RREA 5J40A 2XPVA 2ELHA 4EM2A 1RR8C 2RVCA 1V5EA 4OIOF 1Y56A 3L2WA 3RZDJ 4L9NA 3GBGA 1WRJA 1X58A 4PFOA 1D5VA 1ZG3A 4G12A 3MZHA 3HRSA 2BXYA 3G2BA 5DV5A 3GWZA 3L1PA 1T38A 3D0SA 2DYSH 5L3FA 3GZ6A 2C6YA 3JW4A 1YJWI 4KT6A 3MWMA 4LLGF 2QKLB 3WU1B 1YG2A 2XGXA 1HF0A 2D1HA 1GXQA 3IRRA 3AG4H 3CQZJ 3S2DJ 4LFUA 4N4OB 4A3LJ 4HLXA 5L3DA 3F8NA 2NAZA 1MSFC 2FBKA 3VB2A 3GCMA 2W84A 1X4OA 3IL2A 4LB5A 1I3AA 3I71A 2O8XA 4NC8A 2STTA 3LA7A 5DCFA 2P6TA 3M07A 4LOCA 3RPUD 3X2QH 5D4SA 1BC8C 2DU9A 3ZMTA 1KYWA 5CLSA 2IS2A 1XSVA 3QU3A 4UVCA 5LGTA 4YFXF 5M5WJ 2K40A 3KP2A 2F48A 2LC2A 1V3FA 4UXNA 2GM4A 1QVTA 4CYDA 1O3QA 5E3LA 1ZREA 3TDZC 1O7FA 4MQVA 4HDVA 1Z21A 3P9CA 1VQKI 3BY6A 1W7PD 3PNVA 4WX9A 1FBSA 2K86A 3H9GA 1FTZA 1GV2A 4IRHA 3BROA 2YX7A 1XTAA 2WY8Q 1JHHA 2W48A 4RS8A 2CO5A 2EK5A 3FKJA 3C2BA 2L7FP 1YI2I 2ELKA 2E5ZA 3ZP5A 5JLWA 1P7JA 5EJCA 3CF5F 5F1JA 1K61A 1OCRH 2OD5A 3H35A 3O3KA 2BVLA 1I3QJ 4XKCA 2M7AA 5HLTA 1XGMA 2JPCA 2JA5J 2XHKA 1XMKA 2HR3A 1VI0A 4CCJA 4Z2YA 5HDGA 3FXJA 4LLNA 3JRIA 2W4SA 1R58A 3E6DA 2LRDA 4QSHA 4KDPA 1T08B 2PMHA 4RGRA 5FLXK 1LQ1A 2HDDA 2DQRA 1FOKA 4CCMA 2PJRA 1S6LA 3VPRA 1WI9A 3QYEA 3U1KA 2KJCA 2DJIA 4GO1A 3K4MA 3FXMA 1OCCH 3RYPA 4E7KA 1R22A 2OA4A 4B43A 4P9FA 4A3JJ 3PO2J 2LBFA 1REPC 1XSDA 3K1NA 3DKYA 3VYRB 2OZUA 1LEAA 1W0UA 2P5VA 4XONA 5D5WB 2JJ7A 4D0PA 2DOAA 3QOPA 5F04A 2COMA 2WWYA 5D4RA 3PM1A 3FBNB 5CQGA 5BPDA 2NVXJ 3ZQ7A 1FIAA 2TDXA 2K3PA 4F91B 4KMUX 1ULYA 2A69F 2JVHA 4M9SA 3V4GA 3HYIA 1IDYA 2JTVA 3TP0A 5C4JJ 2ZMEA 3BZKA 1QHHD 2VKHA 5E20A 1G3YA 1ITYA 2B9SA 1U2WA 2A68F 1E17A 3K1MA 3FMSA 1MGTA 4ZZLA 4GGGA 2L02A 2YSRA 4E6KG 1XC5A 3O2PE 2E1CA 5IOYA 3M1CA 4KISA 2Y0MA 2AQFA 2Z33A 4OIQF 1OR7A 1YS7A 1OCPA 2P5LC 3Q0VA 4ON0A 2CMPA 2WV1A 3ZRGA 5C4XJ 2CUEA 3RQ4A 4KA4A 1W1WE 3MKYB 3SFIA 2CQNA 4JYKA 1IRXA 1R1TA 1WI3A 3K70C 1SVMA 1ZK8A 2M0MA 1U8RA 5HODA 1R71A 2M0CA 3ZQCA 1I27A 3J81Z 2OQGA 2H09A 2P7VB 3WU0A 1KONA 3KLNA 4E70A 1BJAA 2V6CA 4B3AA 4OU0A 1SFEA 5DCMA 5IOZA 2F4IA 3G1MA 2F2EA 2DPDA 3A0BC 1KQ8A 1Q1HA 2PLYA 3E5UA 2ZNZA 3FDYA 1F4KA 1SFXA 4P55A 2L7ZA 3EUAA 3DFGA 4XLHA 5H20A 3GFLA 4N0BA 1FLIA 3D5SC 3BR2A 4AVZA 3GEZA 3NAUA 3OYIA 3LSKA 4N9IA 3BJ6A 3BG3A 5D8KB 2M34A 3BPVA 3LL7A 4KNYA 5J4VA 1FWZA 1MBJA 1G2HA 4PJ0C 5CKTA 2Z9OA 4WK8F 1HOMA 4AC0A 2HEOA 2FF4A 2HZTA 1ZYRF 1XMXA 3LAJA 3NWSA 5HS9A 2VOOA 2HFHA 3BP8A 1RZ4A 1HDDC 2K27A 4IXAA 2BW3B 2M5WA 5F6FA 2E2IJ 1RIOH 1V55H 5KAIC 3IC7A 3HEFA 1LEBA 3HXLA 5F0FA 2BY2A 4BJ6C 1JUMA 1R7JA 2V4JC 1W7PA 5FKLA 4EJVA 3Q0WA 2H6BA 2KZVA 3CLQA 4HA8A 1L0OC 1PUFA 3S1RJ 4BGDA 4EVIA 1DP3A 2WA0A 3CUQA 2M3AA 2NS7A 2VPRA 2JSPA 2VN2A 3IRQA 2YU9J 1LVKA 2ZB9A 1QO0D 1USTA 3DQVC 1Z67A 1BOAA 2YS9A 3I53A 3V42A 3FF5A 3ZCOA 5C3EJ 1VNDA 2EILH 5DUIA 2PX9A 3QODA 4CCOA 4BDYA 4E7ZA 4V2GA 2JUCA 4XN0A 1JXSA 4YRVA 5CVIA 3FIWA 2Z99A 2L3DA 3NEUA 3ZMZA 4D9JA 5K5OA 4I01A 2X6YA 2D2WA 2XAJA 2LDUA 4MO7A 4L9TA 4F92B 2VQLA 3HRTA 5E18F 4XSXF 3I0TA 4EGYA 1J9IA 1ETXA 1YLFA 1JUPA 2J5PA 2OQRA 1U5TA 5J1RA 1I6XA 4FT8A 1BC7C 1KA8A 3KE2A 2CU7A 1SAXA 2X6OA 1JI8A 4EM0B 3LSGA 3OYKA 1YQAA 4PGGA 4GXOA 2KFDA 3JTHA 3KP7A 3F0CA 4JQFA 4HQEA 4AD9A 4IHYA 1POGA 3I55I 1S7OA 1UG0A 2DO7A 2QVOA 1X4PA 3DBHB 2GWRA 3WTZA 2A05A 3PIOF 5E1ZB 1TT0A 1TZLA 4ASNA 5EGOA 1K4TA 1ZRFA 2IA2A 3KYDB 2XV4S 4ZZDA 3JRHA 3F23A 2R7OA 2EPFA 5EEHA 2JT1A 3F6VA 4G94A 4ENKA 3VWBA 4RGSA 4E4HA 2DT6A 3I54A 4FX4A 1J2XA 1Z0XA 1SVLA 1SANA 1V5GA 4AUXA 4IRIA 3OYGA 4XLCA 1P4XA 2PEXA 2KP6A 2RGVA 1MBHA 3DKWA 1RKWA 3KX2A 3LSRA 4U88A 4ESFA 3AKZA 2EV0A 3ROUA 1JKOC 2GZWA 4OAZA 3BG6A 1EF4A 1YS6A 3JCUC 2HXOA 1QA6A 4EMSA 3F3XA 3DBRB 3KP5A 1OLTA 2K9LA
chains in the Genus database with same CATH topology
3CMEI 3CD6I 2QA4I 2H8WA 3G6EI 3EGVB 4IOAF 1VQ6I 5GADJ 2FOWA 5GAGJ 5GAEJ 4V19K 5JVGF 1YJWI 3CJSB 1VQ9I 1VQ7I 3CC2I 1WIBA 2OTJI 2K3FA 1VQPI 2E34A 5DM7F 1S72I 1ACIA 2ZJRF 1Y39A 3CCRI 3CCQI 3CCMI 3CCSI 3CMAI 3PIPF 3DLLF 3CJTB 1YIJI 1VQ5I 3CJRB 4IO9F 1VQOI 3J7YJ 1FOXA 2E36A 1VQKI 2NXNB 2ZJPF 2JQ7A 1VQ8I 3I55I 1FOYA 2E35A 1YJNI 1YHQI 3PIOF 1MMSA 1YI2I 3CCJI 3CC7I 5GAHJ 4IOCF 3CF5F 5DM6F 3CCEI 3CC4I 2OTLI 1VQNI 1HC8A 3I56I 1YJ9I 1YITI 3G4SI 3J7ZI 2QEXI 1VQMI 3CCVI 1FOWA 3CCUI 2ZJQF 1VQLI 3CJQB 4UY8I 1VQ4I 3CCLI 1QA6A 3G71I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME I;  3CD6 I;  2QA4 I;  2H8W A;  3G6E I;  3EGV B;  4IOA F;  1VQ6 I;  5GAD J;  2FOW A;  5GAG J;  5GAE J;  4V19 K;  5JVG F;  1YJW I;  3CJS B;  1VQ9 I;  1VQ7 I;  3CC2 I;  1WIB A;  2OTJ I;  2K3F A;  1VQP I;  2E34 A;  5DM7 F;  1S72 I;  1ACI A;  2ZJR F;  1Y39 A;  3CCR I;  3CCQ I;  3CCM I;  3CCS I;  3CMA I;  3PIP F;  3DLL F;  3CJT B;  1YIJ I;  1VQ5 I;  3CJR B;  4IO9 F;  1VQO I;  3J7Y J;  1FOX A;  2E36 A;  1VQK I;  2NXN B;  2ZJP F;  2JQ7 A;  1VQ8 I;  3I55 I;  1FOY A;  2E35 A;  1YJN I;  1YHQ I;  3PIO F;  1MMS A;  1YI2 I;  3CCJ I;  3CC7 I;  5GAH J;  4IOC F;  3CF5 F;  5DM6 F;  3CCE I;  3CC4 I;  2OTL I;  1VQN I;  1HC8 A;  3I56 I;  1YJ9 I;  1YIT I;  3G4S I;  3J7Z I;  2QEX I;  1VQM I;  3CCV I;  1FOW A;  3CCU I;  2ZJQ F;  1VQL I;  3CJQ B;  4UY8 I;  1VQ4 I;  3CCL I;  1QA6 A;  3G71 I; 
#chains in the Genus database with same CATH topology
 4JBA A;  4PJN A;  5FLX Z;  2FNA A;  3QPT A;  2JMW A;  1F43 A;  1ZAR A;  3EGV B;  4HBL A;  3Q9V A;  1IC8 A;  2EV6 A;  3KEQ A;  3HPH A;  1AHD P;  1B72 A;  4FCY A;  3BR1 A;  2GBY A;  1VFC A;  3PFY A;  3BOQ A;  4A69 C;  1D1B A;  1WJA A;  3FXU A;  3IH4 A;  3HZJ A;  1FBU A;  5CQE A;  4A12 A;  2MA3 A;  4PJL A;  1ERD A;  5AON A;  1XGO A;  2W85 A;  1I6H J;  1WIB A;  1ZHF A;  4I99 C;  3HKZ A;  2IA0 A;  4RLQ A;  1DGR M;  3HRM A;  3JR9 A;  4D5C A;  2CW0 F;  3VFZ A;  3HRU A;  4BQQ A;  2A5Y B;  4HZF A;  4A93 J;  2O0Y A;  3CCQ I;  2R5Y A;  3I3L A;  3I9V 2;  1G8X A;  4H4K C;  2DA5 A;  3H9J A;  1LDJ A;  1AA7 A;  4PSW A;  1VQ5 I;  2JPB A;  1QPM A;  2ZSI B;  3W6K B;  4A0Z A;  3KP6 A;  5BQT A;  1A36 A;  3BR6 A;  4IZZ A;  3C18 A;  4PDK A;  4IO9 F;  1NHA A;  5BS6 A;  2XGD A;  4X6A J;  1E2X A;  2LK2 A;  4RB2 C;  3LAP A;  1XCB A;  3AG3 H;  2XAH A;  3SZG A;  1YOV B;  2AXL A;  1TWA J;  2VJ4 A;  2GA2 A;  1HBX G;  2BHY A;  2DXI A;  2WB1 A;  1OCZ H;  1BOB A;  3WGG A;  5FJ8 J;  2DT5 A;  1Y1W J;  1GVD A;  4G6Q A;  2QGU A;  1H9T A;  1MMN A;  5LRS A;  5FGM A;  1XS9 A;  5D5U B;  5BPI A;  4AIK A;  1MW7 A;  1GXP A;  5EDN A;  2BY3 A;  2Z16 A;  1BI0 A;  3T8R A;  2AHQ A;  4AVP A;  1Y0N A;  1IV6 A;  1HC8 A;  2M9H A;  2VI6 A;  5GTI C;  1FP2 A;  2DMP A;  2WTE A;  4QIW N;  2LR8 A;  4I02 A;  2IS4 A;  2WAQ N;  3GTL J;  3FM3 A;  4K2E A;  3CCV I;  3R0J A;  2IP2 A;  2XGE A;  4CIC A;  3DKX A;  1HSJ A;  2KJB A;  1R49 A;  4W97 A;  1G6N A;  4BXF A;  1T6S A;  3J7A Y;  3I4P A;  2H6C A;  2CG4 A;  1U0J A;  3N4M A;  2K02 A;  2D1V A;  1CQT A;  1BM9 A;  4CZC A;  2R4G A;  5F27 A;  3L2R A;  5HS7 A;  1UHW A;  1VQL I;  1ZLJ A;  2K9Q A;  1YX3 A;  5EEG A;  3RYR A;  3E5Q A;  3VDX A;  3WG9 A;  4DYC A;  1S8N A;  3TMO A;  4HF2 A;  2EIM H;  4BU2 A;  4UUT A;  2H1K A;  3KET A;  3TQN A;  2KKO A;  4BHP A;  2L7M P;  1TQI A;  2M4G A;  5DDG A;  5GAG J;  3K0L A;  3I4M J;  3CES A;  3WTX C;  4A5M A;  5GPC A;  3AL0 B;  5HNF A;  2IS6 A;  3MD2 A;  1TW3 A;  3KYL A;  3GTP J;  2IA1 A;  4A3C J;  5L3B A;  2NOG A;  2KIM A;  4G9Y A;  2VC0 A;  2VL8 A;  4KIC A;  2R7U A;  2DMU A;  3CDL A;  1N75 A;  4OWR B;  1AWC A;  4M3D A;  5E1X A;  1R1V A;  3QPL A;  4QTR A;  2ESN A;  4ENN A;  4BNC A;  1UFM A;  2P0W A;  2L4A A;  1TNT A;  3HOV J;  1ACI A;  1XCV A;  1YIO A;  4JK1 X;  3HSF A;  3D5L A;  4HF1 A;  4F3Q A;  1RES A;  4ESB A;  3WE3 A;  3U2R A;  4FE4 A;  1FBQ A;  2MH9 A;  5EZH A;  4GFB A;  1FSE A;  1G3T A;  2NVU B;  2FMY A;  3K4J A;  1ZTR A;  1P7I A;  1K78 A;  2JRT A;  1GT0 C;  3HTS B;  2H94 A;  5E8I A;  2F5V A;  2L9V A;  4BL0 B;  3HB9 A;  1DU0 A;  4NBQ A;  3OS2 A;  2HQR A;  2UV1 A;  2HVS A;  1OFC X;  1ZG1 A;  3FXK A;  4ZDL A;  3GFM A;  3HUG A;  4MGR A;  3OYE A;  3M3Y J;  4RGU A;  2CH0 A;  2JRM A;  3GXO A;  2VXZ A;  2RQQ A;  1DPU A;  5H6R A;  1X3U A;  5EZG A;  1H8A C;  1DU6 A;  3TGN A;  4ZYG A;  3JRE A;  1KU7 A;  1IRG A;  3F9K A;  3VOE A;  4CGZ A;  2Y9Z A;  2XRL A;  2DBB A;  2L2O A;  1BIA A;  1FMV A;  2ECB A;  1LPQ A;  2A61 A;  5HLG A;  5H6Q A;  3ZMS A;  3HPG A;  3ZQG A;  3S3O A;  2R7T A;  4UV8 A;  1I50 J;  1ZAO A;  1ODD A;  3L7W A;  2PJR B;  1XGN A;  2R7Z J;  3OR1 C;  2AS5 F;  1VF9 A;  5D5V B;  1VQM I;  5IT3 A;  2BVM A;  5LHH A;  4XLF A;  1YO5 C;  4GYI A;  4U7B A;  2MLG A;  1W5C C;  5TJJ A;  1GDT A;  2L9N A;  1ETO A;  2LBF B;  3WOD F;  1J75 A;  1Z9C A;  3DU6 A;  2CQQ A;  1VZ0 A;  1G3W A;  2QUF A;  1JJ6 C;  1RUO A;  4BQA A;  3OS0 A;  1BR4 A;  2BHZ A;  2F4O B;  3C2G A;  3OIO A;  4BY1 J;  2DDB A;  1ON2 A;  4PSX A;  3Q5F A;  1WFX A;  2A6T A;  2XPU A;  4I0B A;  5EYR A;  4UVA A;  3FXL A;  1LE8 A;  1JKP C;  2ZME B;  3EPZ A;  1MBG A;  2E60 A;  1K7A A;  2VUM J;  3LA3 A;  4IOA F;  1JTY A;  2MH2 A;  2EFN A;  3E1S A;  2LG4 A;  2M87 A;  2XKO A;  1UG2 A;  2GIZ A;  1ZLK A;  4Y3O A;  4LLL A;  4BH9 A;  3KEO A;  5JVG F;  1RUN A;  4MEY F;  2FA5 A;  1J7K A;  4CSW A;  3F8B A;  1QGP A;  4ZYD A;  2FQ4 A;  1OCO H;  3IAS 2;  2HQA A;  5GTH C;  3LMM A;  2DK8 A;  3DCF A;  1FEX A;  1DUX C;  4XIC A;  3GVA A;  4YFN F;  2DLL A;  2FBH A;  2OJE D;  1UMQ A;  1O3R A;  3HOT A;  3I58 A;  3EQL F;  5K7H A;  3S14 J;  4ETS A;  3QU6 A;  2GXG A;  2LMD A;  3IAM 2;  4M71 A;  1GV5 A;  5HNH A;  1JT0 A;  2A6E F;  2CSO A;  3COA C;  5B3S H;  3BG7 A;  3G3Z A;  5ICF A;  3WTU C;  5JFR A;  4S05 A;  1JGS A;  2EFQ A;  4BXU A;  1J0R A;  1QZY A;  3OYB A;  2BY1 A;  5DCM B;  1HW2 A;  2M4K A;  3W2A A;  1FX7 A;  2X4H A;  3CJR B;  5CPR B;  2MD0 A;  3WTY C;  4IEJ A;  1SAU A;  3J7Y J;  4KYW A;  2KDZ A;  1ORK A;  4Y4R A;  4YIR X;  2DA2 A;  1SVO A;  3WGI A;  3DBL B;  3P9I A;  4F55 A;  3TOB A;  2A3S A;  2LFB A;  1YX5 A;  1LDD A;  1N25 A;  1Z7U A;  1PJR A;  1KGS A;  4FET A;  1MBF A;  1K79 A;  1BJZ A;  4OOI A;  3ZN0 A;  1WKM A;  3W6J B;  2ISY A;  2Y48 A;  2VJ5 A;  3JSO A;  5FFZ A;  3L2C A;  2HOS A;  3SFZ A;  3IKT A;  5DEQ A;  3G73 A;  3OSF A;  1USS A;  3A4C A;  2E1M C;  4ZDP A;  3NQO A;  4II2 A;  2AQE A;  2R7W A;  4XN3 A;  4DQ2 A;  1QVU A;  2XB0 X;  2DOD A;  3R61 A;  3F21 A;  2FQ3 A;  2YU3 A;  1T39 A;  4DW6 A;  2F5D A;  2LD5 A;  2KRH A;  3TW6 A;  4G7Z F;  1E3H A;  3JRF A;  4DJA A;  2VT2 A;  2W25 A;  3MEX A;  1KU2 A;  3FHZ A;  1W7P B;  3ABM H;  2LF8 A;  4MIM A;  5K1Y A;  2XKP A;  4HNV A;  1MBK A;  1SFU A;  1DP7 P;  2DMN A;  3LSM A;  1PUF B;  3CUQ B;  4RM2 A;  3S16 J;  3DEW A;  4OMY A;  2DFH A;  1R36 A;  4GRI A;  3SYT A;  1MDM A;  1K6O A;  2VBZ A;  4HW0 A;  2RQP A;  4B3X A;  2ETH A;  2NOJ B;  3F8F A;  5GAD J;  3BZ6 A;  2GXA A;  2CRG A;  1D1A A;  1UAA A;  3OL3 A;  4S0H B;  1V4R A;  3OYN A;  1X1C A;  4M73 A;  2E7W A;  5D6E A;  5F64 A;  1VQ9 I;  5K5Q A;  5EG0 A;  1Z1D A;  2GQQ A;  2P8T A;  3GYH X;  1ZKG A;  3FMQ A;  3W2V A;  4HOB A;  2Z3Y A;  1VQP I;  5KVR A;  2EIJ H;  3K10 A;  1U5T B;  2RNJ A;  3FBI B;  5DYM A;  5ERI A;  2HYG D;  4J00 A;  4CHU A;  4HQM A;  3ZPL A;  2W57 A;  2CW7 A;  2WBM A;  3OYH A;  4PK4 A;  3RJP A;  3FX3 A;  3WTT C;  2IGM A;  2QLZ A;  3MKZ A;  3CCS I;  5LRR A;  1M1E B;  2QCO A;  4YG2 F;  2EFW A;  3VOD A;  5FKK A;  2F6C A;  2HXI A;  5EGO B;  3GLL A;  3JRG A;  5IYD J;  2CFO A;  2V9V A;  3AFH A;  1AU7 A;  4M3B A;  4FAS D;  2L01 A;  3DEE A;  2HPI A;  1ZEL A;  2V79 A;  4HX4 A;  2F5E A;  2LY9 A;  4LK0 F;  2MAB A;  5ILV A;  2R7D A;  2B63 J;  5FLM J;  3CDH A;  2EQR A;  3GME A;  1MMS A;  1ENH A;  2FML A;  3TBI A;  1WH7 A;  3CC7 I;  2ZSH B;  4IOC F;  2UXN A;  4E7J A;  2CQK A;  1FY7 A;  3CCE I;  1Y8Q B;  5LFA A;  5J1Y A;  2LYC A;  2K9S A;  2JA2 A;  3ZMV A;  5FLV A;  2W82 A;  2ZXW H;  3OOP A;  4FHT A;  4HYE A;  1VQN I;  2JA6 J;  1YW8 A;  2F4M B;  4DYR A;  2W7N A;  2CGP A;  4XOR A;  5HOO A;  1IJW C;  3REO A;  3LSH A;  2XPW A;  3K7A J;  1U9N A;  3S3N A;  4HRI A;  5F0H A;  4XLE A;  3SHF A;  1R5G A;  4MQ9 F;  1Z6T A;  4HPQ A;  4Y52 J;  3K2Z A;  1T0F C;  2DA7 A;  2ZO4 A;  4C2T A;  3GTK J;  4OIP F;  3IKV A;  2UUZ A;  1B72 B;  5D8L B;  2EA4 A;  2H27 A;  3ZQF A;  2JA8 J;  4ITV A;  2ZJQ F;  3ZQI A;  2P7C B;  3RKX A;  2I10 A;  3CP2 A;  4AU7 A;  3P5J A;  1S7A A;  1TWG J;  2CUJ A;  2WY7 Q;  3F6O A;  4L5I A;  3TW7 A;  4LK1 F;  3TO9 A;  4BBS J;  2QEN A;  1HKQ A;  2KIS A;  2IT0 A;  2OCC H;  4B48 A;  2X1D A;  1IG7 A;  1U78 A;  5GAE J;  3QPS A;  2M8E A;  3R4K A;  2E5N A;  3OL4 A;  4DZJ A;  4I98 B;  2R5Y B;  2PMZ A;  1IN5 A;  2VBX A;  1A04 A;  4IF4 A;  4KUM A;  3GW2 A;  4I2O A;  1EKE A;  4IKF A;  2D45 A;  1I5Z A;  2XAQ A;  3V7S A;  3DTK A;  1WPK A;  4A3E J;  1WJ5 A;  4A3B J;  3AG2 H;  3V8J A;  3VYS B;  4M6V A;  1MIJ A;  3E6B A;  5IPA A;  2JZY A;  2DI3 A;  3H3Z A;  2W24 A;  1EA3 A;  4TV7 A;  1YRN A;  1EJ9 A;  4LG0 A;  2IGO A;  1HDP A;  1Z6R A;  3CMA I;  1B6A A;  2HGC A;  2Q2E A;  3V7R A;  3PFI A;  2DTZ A;  2M30 A;  2JVG A;  4M9X A;  2WAE A;  2X85 A;  4CCN A;  4I6Z A;  1FYM A;  3B73 A;  2HPM A;  2FE3 A;  4NC7 A;  3RKQ A;  1V54 H;  2LOO A;  1MMA A;  3DPU A;  3VYU B;  2XF7 A;  5M3F J;  3HIF A;  1FOX A;  2VOP A;  3MN2 A;  3PQJ A;  2HTS A;  5CYV A;  1TT5 B;  1I1G A;  1E0E A;  3IHU A;  2CQ7 A;  1H88 C;  2H8R A;  1SD4 A;  4CXF A;  3K70 D;  1FT9 A;  3DV8 A;  2R7F A;  1BIB A;  2QM3 A;  1UJ8 A;  2LVS A;  1UEL B;  3PSF A;  3H3U A;  5BNG A;  3I56 I;  2GAU A;  2F5C A;  4HG2 A;  5FKO A;  4LIU A;  4U0Y A;  2XAG A;  4GCV A;  1X19 A;  2X9D A;  1F9N A;  5J6X A;  5JR3 A;  1IAW A;  2XC7 A;  3LSP A;  1RRJ A;  2VBW A;  1IN4 A;  1ZR2 A;  4OIN F;  3N97 A;  1OCT C;  1HKT A;  1WJE A;  2O6G E;  4ZTF A;  2GIV A;  3QPH A;  3ONQ A;  3GTJ J;  1IUY A;  2HKO A;  2A5W A;  1MZB A;  2KRF A;  2F5F A;  2RC4 A;  3LA2 A;  3PJR A;  1X1A A;  4WF2 A;  2PMZ N;  3ABL H;  5GP9 A;  3V8L A;  4EQQ A;  3A03 A;  3R0A A;  1BI2 A;  2H8W A;  2JWT A;  4BYY A;  2MC4 A;  3M8E A;  4XRF A;  1N78 A;  1Z77 A;  1MH4 A;  2M45 A;  5J47 A;  2PFB A;  5E3O A;  3H36 A;  5KHD A;  3IWF A;  4Z6Y A;  2VPL A;  4M6X A;  3EET A;  4XOP A;  3LFK A;  5FO5 A;  3CJS B;  2HQN A;  2EZL A;  5L3G A;  2QWW A;  1PP8 F;  2XSJ C;  2JN6 A;  1IN7 A;  1T33 A;  4BE2 A;  1K78 B;  4XLA A;  2XUB A;  2BXZ A;  2K9N A;  3R60 A;  5AIQ A;  2ID6 A;  2KIQ A;  3JSP A;  1SD7 A;  4IPA A;  1YFH A;  1NG7 A;  3KLO A;  4AID A;  3CCR I;  5LEJ A;  1SD6 A;  2Q0O A;  3HUG B;  4YFK F;  3BWG A;  1J5Y A;  3BTC A;  3K9T A;  3F22 A;  1LFB A;  1UB9 A;  4AYB A;  4O5V A;  1JKR C;  2DJN A;  2X1C A;  3QQA A;  1QZE A;  2EZH A;  2X6W A;  1W4M A;  4A6D A;  1KU3 A;  3LST A;  3J80 K;  5E17 F;  4XK4 A;  3OIQ A;  4A2U A;  4C3J J;  3OS1 A;  5LD2 C;  1VQO I;  3RCO A;  2Y31 A;  4CYC A;  5E3N A;  2QQA A;  4BQO A;  4XKV A;  2HI3 A;  2QBY A;  5HDN A;  1MNM C;  2ME6 A;  1IGN A;  1TWF J;  3IUO A;  3K4L A;  3SEZ A;  2GA1 A;  3BQY A;  2L9S A;  4M74 A;  4UUS A;  3D1N I;  1YJN I;  2RDP A;  3MMY B;  1XG1 A;  1YHQ I;  4BHB A;  3PNT A;  4PCQ A;  1ZQ3 P;  2IEK A;  2QF7 A;  4ANJ A;  4XRS G;  3EDP A;  3I59 A;  5ED4 A;  2VXD A;  5J1U A;  1FNN A;  4LJZ F;  2QKM B;  1OQY A;  1OPC A;  2Y0S A;  3M1E A;  3K4K A;  1NH3 A;  3B6A A;  4BQN A;  4F52 A;  4BBR J;  3BC8 A;  2OUM A;  3F8M A;  1O4X A;  4WXC A;  1XB4 A;  4NQW A;  2PI0 A;  1Z3X A;  1LE8 B;  3IWZ A;  3CCU I;  4IHW A;  1ETW A;  4E7H A;  4FE7 A;  3PO3 J;  2FD5 A;  2NNN A;  1T2K A;  1ONV A;  4DBR A;  2CV2 A;  3GUD A;  2LTP A;  2M2E A;  2IXS A;  4XRS A;  1BR1 A;  4PJM A;  4UY8 I;  2EH3 A;  3BR5 A;  3RQI A;  3CCL I;  4C3I J;  4Q48 A;  2OF7 A;  4XSZ F;  3CME I;  2V9K A;  2ADU A;  2QQB A;  2X6X A;  3G6E I;  4HSR A;  5KAF C;  4EEF G;  1EH8 A;  2IRF G;  4XLP F;  4A3D J;  4RB3 C;  2MW8 A;  1WJC A;  3S2W A;  4MEX F;  2Q8K A;  4C2M J;  3FXR A;  1FSH A;  2LSO A;  3PUF A;  2QQ9 A;  1B9M A;  3L9F A;  1SMY F;  1S7E A;  2XF5 A;  4G6T B;  1G3S A;  1IUF A;  3IP4 B;  2DK5 A;  2KIU A;  3CC2 I;  2DT7 B;  3M8F A;  3CCY A;  2E34 A;  1T0F A;  4GDF A;  1BR2 A;  1A35 A;  2VON A;  1MJA A;  1J59 A;  3HKZ N;  3H0D A;  3KYC B;  3LNQ A;  4M3E A;  2MLK A;  4NB5 A;  2E2J J;  2XVC A;  3ZR8 X;  2IBD A;  1FZP B;  3L2V A;  3UKG A;  2ELJ A;  2BEO A;  2RAE A;  3PL8 A;  1K83 J;  2X0L A;  5KK1 A;  2NVY J;  1I39 A;  4B44 A;  5CVV A;  2VKE A;  5E8G A;  3LSJ A;  3S17 J;  4ESJ A;  1OIS A;  1MKM A;  1XDS A;  2P4W A;  4YEJ A;  3ABT A;  2TRT A;  2O8K A;  2Y0S N;  1B4A A;  3FXQ A;  3SXY A;  5CVU A;  4IVN A;  4PFP A;  2JA7 J;  5C44 J;  1OYW A;  1FP1 D;  2B7E A;  2M8G X;  3C2H A;  3HSR A;  4HF0 A;  4ZDO A;  1JKQ C;  4NUB A;  4XL9 A;  5A2Q K;  4JP0 A;  3U21 A;  1QBJ A;  2WB1 N;  2YUS A;  1BBY A;  2KPM A;  1Y8R B;  2G9W A;  1ZRC A;  1IN8 A;  3LSI A;  5M3M J;  1K4S A;  4CO8 A;  2VBY A;  1FYL A;  1TQP A;  2JK3 A;  1O57 A;  4KN7 X;  2QSH X;  4XBF A;  4R1H A;  1SD5 A;  3CO7 C;  3SDB A;  1ETQ A;  5L3C A;  2LLK A;  3WTS C;  1WSU A;  2HWV A;  1HCR A;  3QP5 A;  4IQ4 A;  3BZC A;  1W36 C;  1JHF A;  4PJJ A;  4OIR F;  1R1U A;  2IPQ X;  3OMY A;  4FIS A;  4ZTJ A;  3JRD A;  2BE5 F;  3VSK A;  4RDU A;  4C30 A;  1MDM B;  2LKP A;  1HA8 A;  1LJ9 A;  3PNY A;  4HST A;  3ASN H;  4B47 A;  3FKI J;  3EYY A;  5J8C A;  4M3F A;  2O3F A;  4XRM A;  1CF7 A;  3WTW C;  1KQ0 A;  2Y75 A;  2MG4 A;  2X48 A;  1FPQ A;  4DIQ A;  1D8K A;  2KZG A;  5FRN A;  1IN6 A;  4Y33 A;  1YTY A;  5IT9 K;  2L4M A;  3CJN A;  5J4Y A;  3OYA A;  4IJA A;  3JRB A;  1NK2 P;  4L0Z B;  2UZK A;  5EG0 B;  2CJJ A;  1S5L C;  3CP8 A;  3FK7 A;  5TGT A;  4L5E A;  1VQ6 I;  2PBI A;  3OYL A;  1T95 A;  3K4B A;  3ECH A;  1TTY A;  4L5J A;  2FOW A;  2HOE A;  2HVQ A;  2TCT A;  2FXA A;  5IP7 J;  1S3J A;  4NC6 A;  1RI7 A;  3JAM K;  2LY1 A;  3FMR A;  2VQH A;  4AWX B;  2W1O A;  6PAX A;  5B1A H;  2MFZ A;  3AG1 H;  2VQC A;  5M5X J;  2HDW A;  5DD8 A;  1PDN C;  1UCR A;  1T8I A;  2ECC A;  3W6V A;  1UZC A;  3O8G A;  3WG7 H;  2UWM A;  3WE2 A;  3MAJ A;  3S2H J;  3HHG A;  2BYV E;  2V1D A;  4CCK A;  1PVE A;  2R5Z A;  2K4B A;  3C7J A;  1XPX A;  2ZCW A;  4S04 A;  5K7Z A;  2MSY A;  3FXO A;  3M8J A;  3OYJ A;  3PIP F;  3OYC A;  1FTT A;  5HLI A;  2EA2 A;  2DA3 A;  4LGW A;  2LY2 A;  1RR7 A;  2FBI A;  1JUS A;  4AM3 A;  1OYI A;  2EZI A;  3KCC A;  1TP4 A;  2ACJ A;  2FNP A;  1BW6 A;  3LFU A;  4JOM A;  1PUE E;  3B6C A;  3SJM A;  1AOY A;  3OYD A;  2ICW G;  2RKH A;  5LGN A;  1H0M A;  4EJW A;  1W0T A;  1X1B A;  2VC1 A;  3J80 Z;  1IF1 A;  4MNU A;  1XDU A;  2OU2 A;  2ZNY A;  3C1D A;  4Y15 A;  2ZXJ A;  4B09 A;  2R92 J;  5DM6 F;  4B4C A;  3U1D A;  2VOD A;  3HOZ J;  1B9N A;  3GTO J;  3BDD A;  4MLO A;  1YJ9 I;  1U9O A;  3CUO A;  5LGU A;  4J19 A;  3ABK H;  4NHJ A;  1N77 A;  2DA4 A;  4RBO A;  4HV5 A;  1B8I A;  1U5T C;  2DA6 A;  2G7H A;  2GOM A;  1X1P A;  3A1Y A;  4PZJ A;  1U6G A;  1AKH A;  3A01 A;  3ML6 A;  2EIK H;  4XMY A;  4DYQ A;  3CMY A;  4E7I A;  2HDC A;  2XIG A;  4Q4Z F;  2VJJ A;  1SC7 A;  1QQI A;  2KLO A;  2BBY A;  2L54 A;  1PYV A;  4EJO A;  1HLV A;  3ZQL A;  1ZGW A;  3BCA A;  1I1S A;  5IYB J;  3JRA A;  2V9P A;  3KFW X;  2V7F A;  2BZT A;  2QA4 I;  4A3I J;  4B8X A;  5HVQ C;  2EBI A;  3T0Y A;  5FD5 A;  4I0A A;  4I09 A;  3EYI A;  2PQ8 A;  4MFD A;  2QQ8 A;  2LRE A;  3M7G A;  4G7O F;  1BI1 A;  2Z1D A;  2B0L A;  3BR0 A;  4X0G A;  1A6Q A;  3HC7 A;  1YW9 A;  1YRN B;  4LG0 B;  1G59 A;  4J01 A;  2DQL A;  4H0E A;  4MHG A;  2BGC A;  2Q2E B;  2CUF A;  2CFX A;  4UVB A;  2XSD C;  4A0Y A;  5ICE A;  1P2F A;  2HS5 A;  4ZYE A;  4M9Z A;  5DM7 F;  2WAF A;  4L9V A;  4BEH A;  2NVQ J;  3E6C C;  1ETY A;  3GTG J;  1NK3 P;  1BI3 A;  1Y0U A;  3RDI A;  3EUH C;  5CVJ A;  3EUK L;  3CDI A;  4N4N B;  4IHV A;  3GTM J;  4LB6 B;  2HNH A;  1R5I D;  1MH3 A;  5DS9 A;  4BDZ A;  3SZT A;  2HQ5 A;  2I8D A;  1ZGA A;  4XLN F;  2CS3 A;  4YEL A;  3S15 J;  4BE0 A;  1XGS A;  4PGH A;  5B1B H;  4A3F J;  2R7V A;  2FRH A;  3QYF A;  4A3M J;  1QHG A;  4I7H A;  2PJP A;  3WU2 C;  3BCB A;  1HQC A;  1IXC A;  4BY7 J;  1T56 A;  4DGW B;  2E36 A;  1OMI A;  2EFO A;  2NXN B;  3ASO H;  4HLY A;  2ME0 A;  2EB7 A;  2JQ7 A;  3Q0U A;  1RKT A;  1WJD A;  3W3C A;  3DTI A;  3S32 A;  5FRM A;  5CJ9 A;  2E35 A;  1VTN C;  1Z7L A;  2DTR A;  3O6B B;  1LDK B;  4WXD A;  3DU5 A;  1R5H A;  3RSN A;  1WJF A;  1LVA A;  2WV0 A;  3MZ8 A;  4F93 B;  1E3O C;  5CVR A;  2BY0 A;  1YE9 A;  3T5X A;  1R4M B;  5KNL A;  3SZP A;  3CLO A;  1SMT A;  4CZZ A;  5E3M A;  2IGN A;  3PSI A;  3RKW A;  1P92 A;  2KQR A;  3KEY A;  5TRD A;  3HL2 A;  4KFC A;  2MBF A;  1L3L A;  1JGG A;  1O7L A;  5A2Q Z;  1YIT I;  3DPT A;  3TP3 A;  2Y69 H;  1LNW A;  3ULQ B;  3Q9S A;  2XAS A;  3TOA A;  1FJL A;  5JVT A;  4FX0 A;  2VE9 A;  3L2U A;  2V26 A;  2DYR H;  2XAU A;  3GZN B;  1FOW A;  2ESH A;  2HTJ A;  3RKY A;  1S9H A;  2V6E A;  3GZ5 A;  1PP7 U;  4IHX A;  2H1L A;  3S1M J;  5LBQ A;  2MYS A;  4ZC3 A;  2Y2Z A;  3DP7 A;  1D3Y A;  4JX4 A;  3H5A A;  2E1M B;  2DFE A;  1F36 A;  3BQZ A;  2NVT J;  2P6S A;  1MMD A;  2LP0 A;  3MQ0 A;  1EH7 A;  5LHG A;  2JUG A;  3KZY A;  2Q1Z B;  2OCE A;  4D1Q A;  1LB2 A;  5DUK A;  4BXX J;  4RGX A;  3QRF F;  2VQG A;  4X1E A;  3RZO J;  3CZ6 A;  2IJL A;  2DFI A;  2NS0 A;  3Q3S A;  4G6D A;  1ON1 A;  4I76 A;  5IT9 Z;  4C3H J;  4O3M A;  1D0X A;  2ZJ2 A;  3FZV A;  4RAF A;  4C2U A;  3I4N J;  1VQ7 I;  1BL0 A;  2R93 J;  3DEU A;  5J3L A;  1JJ8 C;  1XX5 A;  2MC3 A;  1TLH B;  5ICC A;  2K3F A;  3MZY A;  1UHM A;  1TWC J;  4IRG A;  4RM3 A;  5GPA A;  3P7N A;  4BAY A;  3QOE A;  3JAM Z;  4P96 A;  4HX8 A;  3FIS A;  3MFK A;  2EWN A;  4CYC B;  1X3W B;  4U7D A;  3F8C A;  3KP4 A;  3FWE A;  1P6R A;  1GVJ A;  4P1W A;  4D7M A;  4WCG A;  4WXH A;  2QBY B;  3K6G A;  1QPI A;  4A3K J;  4DNC A;  2XRN A;  1BA5 A;  4UUS B;  1UHS A;  2DOF A;  4Y17 A;  2QYO A;  1Z05 A;  3CF2 A;  3S1Q J;  3LWF A;  1RNL A;  1WH5 A;  4E7S A;  3L00 A;  3IH3 A;  2ZXI A;  3GFJ A;  3TDU C;  4QPO A;  2DA1 A;  3I59 B;  2PN6 A;  3KPH A;  5FD6 A;  1IDZ A;  4WWC A;  4M3G A;  1O3T A;  3HOY J;  4LMY A;  1MNE A;  2ZJP F;  2DW4 A;  2ZBK A;  4XKB A;  1LFU P;  2IS1 A;  1D0Z A;  1WGX A;  1HW5 A;  5IY5 H;  2CYY A;  5DD4 A;  2FSW A;  3MVP A;  1ZN2 A;  2VIX A;  3NRV A;  2E71 A;  2O03 A;  1DPR A;  3S93 A;  1SFK A;  3RPU A;  1DGW Y;  2O9L A;  4RA2 A;  4NQW B;  3T8T A;  1QZZ A;  1R23 A;  1IW7 F;  1H89 C;  4XID A;  5LEK A;  1FMW A;  2EIN H;  4QWQ A;  2DCE A;  2OV7 A;  3BTL A;  4GYG A;  4XNF A;  2E1O A;  3U9G A;  3J7Z I;  1MD0 A;  5KCM A;  1HKS A;  3DPL C;  4IQJ A;  2HOT A;  2P81 A;  3GF2 A;  3NWT A;  3V7C A;  1G4D A;  2VT3 A;  3OR2 C;  3TKY A;  1ZRD A;  4II3 A;  4C9Y A;  5JI6 A;  3E7L A;  9ANT A;  5F0C A;  1KU9 A;  4A6E A;  3WHC A;  3A0H C;  4FQG A;  1X1D A;  2I5U A;  4U0V A;  1HW1 A;  2V1X A;  1IZ1 A;  1P9Q C;  2STW A;  1MJB A;  4V2F A;  4U0W A;  3GFI A;  4EV0 A;  1D5Y A;  1VQ4 I;  2DOE A;  2CUZ A;  4XKW A;  4RAG A;  3CD6 I;  4CUG A;  3HOS A;  2R3S A;  2XGC A;  5B5E C;  2QSG X;  3M4O J;  2VE8 A;  3LOC A;  3QYB A;  1FIP A;  1GUU A;  1E3P A;  1EH6 A;  3FK6 A;  3G1L A;  3O8H A;  4EM1 A;  2Y30 A;  2FU4 A;  5FRO A;  1GLN A;  1QRY A;  1R9T J;  4KT5 C;  2NYX A;  4RB0 A;  2OZ6 A;  4OAY A;  3OOU A;  5LLQ A;  3K2A A;  3MKL A;  2XAF A;  1ZG5 A;  2L7K A;  1TNS A;  4BJ5 C;  5J8F A;  3ZMU A;  2OC6 A;  1TQM A;  3ECO A;  3H92 A;  2CQX A;  2J5O A;  4KIT B;  4RB1 A;  2EFP A;  3QWL A;  4Q5S F;  2K85 A;  4Y13 A;  3H5N A;  4RMN A;  3ZXS A;  4HAM A;  4L9J A;  3S3M A;  3SQN A;  4KJZ A;  3MCZ A;  3TO6 A;  4M6Y A;  2M1B A;  4RAY A;  2ZJR F;  3UR3 C;  5H2F C;  5F1R A;  3BR3 A;  3S1N J;  4A3G J;  3RIR A;  1V5F A;  4G8X A;  4U87 A;  3ELK A;  2FEZ A;  1GHC A;  5JHF A;  1XN7 A;  3H3V K;  4CCL A;  2VKD A;  5D5X B;  2YR2 A;  3DLL F;  2FUG 2;  2DFF A;  3HOU J;  1MJ9 A;  2IGK A;  4D5F A;  3OY9 A;  4JX5 A;  5JLX A;  3DF8 A;  4P5O A;  2KMU A;  2OAZ A;  3K1P A;  3OWT A;  2XRO A;  1IRZ A;  2DMT A;  3SDG A;  1MND A;  2O7O A;  1RPW A;  1TL8 A;  1OKR A;  1RC9 A;  4ABZ A;  5IP6 A;  3H9Q A;  1QNT A;  3H5R A;  1X2N A;  4CH7 A;  1WHU A;  2QZ8 A;  2Y9Y A;  2LKX A;  3HG9 A;  3ZOB A;  2DMQ A;  2KHM A;  2GXB A;  1A31 A;  4AIJ A;  2HVR A;  2BV6 A;  2HYF A;  3OSG A;  4Q47 A;  2V1U A;  2COB A;  2NRA C;  3IV5 A;  2RN7 A;  1OJL A;  2IAI A;  2CWE A;  2E7X A;  1J09 A;  2XDV A;  3WHB A;  5ILS A;  4N9H A;  4R79 A;  4O6J A;  1W5S A;  1HXD A;  3D5R C;  3HBL A;  2EZK A;  1YYV A;  5HS8 A;  2LKS A;  3EUH A;  2NS8 A;  2WAQ A;  3I64 A;  3G4S I;  1CF7 B;  1BW5 A;  3IH2 A;  1SFO J;  4G7H F;  4BJT A;  2QEX I;  3KZI C;  3TO7 A;  1S29 A;  3E97 A;  1EV7 A;  3ZGK A;  5E1W A;  2EV5 A;  4XOT A;  4LIT A;  4EAT A;  4LG3 A;  2X1E A;  1B59 A;  3DTE A;  3H1C A;  1DQU A;  4ZYA A;  3OIP A;  3AL0 C;  2HOA A;  1R4N B;  1SEU A;  5ILU A;  4KIF A;  3CJQ B;  1TBX A;  4Y7N J;  5L3E A;  2X51 A;  4DZP A;  2G0E A;  2L9R A;  2G7U A;  1WQ2 A;  3G71 I;  3CTA A;  2E1N A;  2JSC A;  1P4A A;  3ERM A;  4RLF A;  5EF6 A;  2ZC2 A;  3JRC A;  1XMA A;  2P5K A;  3F72 A;  3GX4 X;  4ZYH A;  3CMM A;  4PUS A;  2K4J A;  4L0Y B;  2R5Z B;  4HDU A;  5BOX A;  2BW3 A;  4UV9 A;  4OMZ A;  5K5R A;  4BE1 A;  3HM5 A;  2A07 F;  1HST A;  3E5X A;  3ZN1 A;  1ETV A;  3R6S A;  3MKW B;  1YW7 A;  2D5V A;  1WZ2 A;  2OTJ I;  1U3E M;  4XR6 A;  2DAO A;  3DXJ F;  3VEP A;  1LFP A;  5E79 C;  3WTV C;  3GO5 A;  1S72 I;  3B02 A;  3HTU A;  1WVR A;  1WWX A;  4B1R A;  4BAC A;  1X2M A;  4CA0 A;  1JE8 A;  3TL4 X;  4KIG A;  2Z2S B;  3OYF A;  3E0J B;  3HOW J;  4LIV A;  1CGP A;  1F1Z A;  3K4N A;  3RPQ A;  2KRC A;  1YIJ I;  2ZFU A;  4EGZ A;  1TC3 C;  2NNY A;  3BLY A;  1Z91 A;  4ENM A;  3I5U A;  2OBP A;  3ESW B;  4AYB N;  3ERE D;  5IP9 J;  2CW8 A;  1ZH5 A;  3FHN A;  2VJI A;  2LF7 A;  1T98 A;  3QP6 A;  3FM5 A;  4IX7 A;  4KIB A;  4A5N A;  3JTG A;  3A2K A;  5M5Y J;  1D1C A;  1W5T A;  1Q1V A;  3BPX A;  4QPQ A;  5K7F A;  2MGQ A;  2W00 A;  3BTJ A;  1ZGJ A;  2O61 A;  1B8I B;  2KL4 A;  5GAH J;  1AKH B;  4AIH A;  4BHC A;  3A01 B;  3CC4 I;  1C0W A;  2R7R A;  4IHS A;  1R00 A;  5HLH A;  2OTL I;  1K6Y A;  2ZFW A;  3BJO A;  3KZZ A;  3LQQ A;  3P9K A;  1IO2 A;  4BKX A;  1IXS B;  4ZH4 F;  4XQF A;  4QLC U;  3S8P A;  2K9M A;  2AO9 A;  1RET A;  1Y1V J;  4MTD A;  2ZME C;  4MFE A;  4F7Z A;  2QSF X;  1TW2 A;  1IV8 A;  2YX4 A;  3NAR A;  3HJE A;  2FJ1 A;  2DDA A;  2N8G A;  5B66 C;  4MTE A;  1P4W A;  2VKV A;  3GLX A;  2LH9 A;  5FKM A;  3E6M A;  1X3Z B;  4UB8 C;  2O5R A;  3HSE A;  3DWL E;  3HGG A;  3PUB A;  4UB6 C;  3T1B A;  5TIS C;  4UHT A;  1OR7 C;  4HNT A;  1OYY A;  2RV8 A;  3HGY A;  3BG9 A;  4IHT A;  4KN4 X;  4BEH B;  4UNO A;  1JTX A;  1DDN A;  1D0Y A;  2VLA A;  4V19 K;  1FYK A;  4EJU A;  3VSL A;  4YII A;  2WC2 A;  3OV8 A;  2PMU A;  3ZQH A;  5IYC J;  2GOX B;  3CO6 C;  2DPU A;  4CDG A;  2FOK A;  3DLA A;  3J7A O;  2XB5 A;  4XM3 A;  5FFX A;  1A6I A;  4ENJ A;  2YPR A;  5AIP A;  1IRF A;  2R7Q A;  2KDO A;  2ZXH A;  1XD7 A;  3VYT B;  4A0X A;  4HNU A;  1APL C;  2ISZ A;  3C3W A;  5D6F A;  3BT9 A;  1ZR4 A;  2E2H J;  1JT6 A;  2L5Q A;  3KP3 A;  3ZQQ A;  4IL6 C;  1WJB A;  4YIF A;  3ISP A;  1Y39 A;  4RAZ A;  2WAD A;  5FKN A;  3RI4 A;  2R7S A;  3KIO A;  2K5C A;  3LQR A;  3QAH A;  5ICG A;  4R8H A;  3BJA A;  1D8J A;  4HEA 2;  1KZH A;  3CCM I;  1KYZ A;  2GLO A;  1IXR C;  2ZKZ A;  3J81 K;  3CJT B;  1WCM J;  5JHU A;  2HYJ A;  2AXT C;  3GTQ J;  2MD5 A;  1Y6I A;  3N05 A;  2CV0 A;  3M9A A;  1TWH J;  2KT0 A;  1MMG A;  2L0K A;  2HKX A;  2R0Q C;  3A02 A;  1KQ9 A;  2E19 A;  4LD5 A;  3HOX J;  1U8B A;  4FTH A;  3OYM A;  1VQ8 I;  3BTI A;  4HX7 A;  4M72 A;  1XSX A;  3L2Q A;  3TED A;  4UUV A;  1FOY A;  2Z5U A;  4NDL A;  2FX0 A;  3V8K A;  4L18 B;  5BMZ A;  2LNB A;  2CV1 A;  1B1B A;  4JX6 A;  4BS9 A;  2M7B A;  1A5J A;  3G1O A;  2XF6 A;  2V1N A;  4EJT A;  3CCJ I;  1MBE A;  2IW5 A;  4BUP A;  4W1U A;  3H0G J;  2RNG A;  1ETK A;  3SEQ A;  2HU9 A;  1LUJ B;  1O3S A;  2ID3 A;  1LKX A;  2UXX A;  5FB2 A;  4NNJ A;  1Z3Y A;  1STZ A;  1FC3 A;  2VB6 A;  2EJR A;  2OPT A;  4HV6 A;  1NG6 A;  3CUQ C;  3ZMD A;  1F5T A;  1QU3 A;  5F08 A;  5EEA A;  3K4C A;  2PG4 A;  4D7N A;  3AAF A;  5LHI A;  1MSE C;  4DOZ A;  2K7L A;  4DBQ A;  3L09 A;  1R6R A;  2IVM A;  2KIF A;  5HDK A;  3E3V A;  3RTR A;  1H9G A;  4ZJZ A;  3BG5 A;  3HHH A;  2DN0 A;  5DTD A;  4E7L A;  3PQK A;  1NTC A;  2A6H F;  3W2W A;  1W36 D;  3K69 A;  3UNG C;  2VAS A;  4P9U A;  2BOL A;  3WGH A;  3HDD A;  1BN5 A;  3ABU A;  2HZD A;  2R7X A;  4KMF A;  2RRE A;  5J40 A;  2XPV A;  2ELH A;  4EM2 A;  1RR8 C;  2RVC A;  1V5E A;  4OIO F;  1Y56 A;  3L2W A;  3RZD J;  4L9N A;  3GBG A;  1WRJ A;  1X58 A;  4PFO A;  1D5V A;  1ZG3 A;  4G12 A;  3MZH A;  3HRS A;  2BXY A;  3G2B A;  5DV5 A;  3GWZ A;  3L1P A;  1T38 A;  3D0S A;  2DYS H;  5L3F A;  3GZ6 A;  2C6Y A;  3JW4 A;  1YJW I;  4KT6 A;  3MWM A;  4LLG F;  2QKL B;  3WU1 B;  1YG2 A;  2XGX A;  1HF0 A;  2D1H A;  1GXQ A;  3IRR A;  3AG4 H;  3CQZ J;  3S2D J;  4LFU A;  4N4O B;  4A3L J;  4HLX A;  5L3D A;  3F8N A;  2NAZ A;  1MSF C;  2FBK A;  3VB2 A;  3GCM A;  2W84 A;  1X4O A;  3IL2 A;  4LB5 A;  1I3A A;  3I71 A;  2O8X A;  4NC8 A;  2STT A;  3LA7 A;  5DCF A;  2P6T A;  3M07 A;  4LOC A;  3RPU D;  3X2Q H;  5D4S A;  1BC8 C;  2DU9 A;  3ZMT A;  1KYW A;  5CLS A;  2IS2 A;  1XSV A;  3QU3 A;  4UVC A;  5LGT A;  4YFX F;  5M5W J;  2K40 A;  3KP2 A;  2F48 A;  2LC2 A;  1V3F A;  4UXN A;  2GM4 A;  1QVT A;  4CYD A;  1O3Q A;  5E3L A;  1ZRE A;  3TDZ C;  1O7F A;  4MQV A;  4HDV A;  1Z21 A;  3P9C A;  1VQK I;  3BY6 A;  1W7P D;  3PNV A;  4WX9 A;  1FBS A;  2K86 A;  3H9G A;  1FTZ A;  1GV2 A;  4IRH A;  3BRO A;  2YX7 A;  1XTA A;  2WY8 Q;  1JHH A;  2W48 A;  4RS8 A;  2CO5 A;  2EK5 A;  3FKJ A;  3C2B A;  2L7F P;  1YI2 I;  2ELK A;  2E5Z A;  3ZP5 A;  5JLW A;  1P7J A;  5EJC A;  3CF5 F;  5F1J A;  1K61 A;  1OCR H;  2OD5 A;  3H35 A;  3O3K A;  2BVL A;  1I3Q J;  4XKC A;  2M7A A;  5HLT A;  1XGM A;  2JPC A;  2JA5 J;  2XHK A;  1XMK A;  2HR3 A;  1VI0 A;  4CCJ A;  4Z2Y A;  5HDG A;  3FXJ A;  4LLN A;  3JRI A;  2W4S A;  1R58 A;  3E6D A;  2LRD A;  4QSH A;  4KDP A;  1T08 B;  2PMH A;  4RGR A;  5FLX K;  1LQ1 A;  2HDD A;  2DQR A;  1FOK A;  4CCM A;  2PJR A;  1S6L A;  3VPR A;  1WI9 A;  3QYE A;  3U1K A;  2KJC A;  2DJI A;  4GO1 A;  3K4M A;  3FXM A;  1OCC H;  3RYP A;  4E7K A;  1R22 A;  2OA4 A;  4B43 A;  4P9F A;  4A3J J;  3PO2 J;  2LBF A;  1REP C;  1XSD A;  3K1N A;  3DKY A;  3VYR B;  2OZU A;  1LEA A;  1W0U A;  2P5V A;  4XON A;  5D5W B;  2JJ7 A;  4D0P A;  2DOA A;  3QOP A;  5F04 A;  2COM A;  2WWY A;  5D4R A;  3PM1 A;  3FBN B;  5CQG A;  5BPD A;  2NVX J;  3ZQ7 A;  1FIA A;  2TDX A;  2K3P A;  4F91 B;  4KMU X;  1ULY A;  2A69 F;  2JVH A;  4M9S A;  3V4G A;  3HYI A;  1IDY A;  2JTV A;  3TP0 A;  5C4J J;  2ZME A;  3BZK A;  1QHH D;  2VKH A;  5E20 A;  1G3Y A;  1ITY A;  2B9S A;  1U2W A;  2A68 F;  1E17 A;  3K1M A;  3FMS A;  1MGT A;  4ZZL A;  4GGG A;  2L02 A;  2YSR A;  4E6K G;  1XC5 A;  3O2P E;  2E1C A;  5IOY A;  3M1C A;  4KIS A;  2Y0M A;  2AQF A;  2Z33 A;  4OIQ F;  1OR7 A;  1YS7 A;  1OCP A;  2P5L C;  3Q0V A;  4ON0 A;  2CMP A;  2WV1 A;  3ZRG A;  5C4X J;  2CUE A;  3RQ4 A;  4KA4 A;  1W1W E;  3MKY B;  3SFI A;  2CQN A;  4JYK A;  1IRX A;  1R1T A;  1WI3 A;  3K70 C;  1SVM A;  1ZK8 A;  2M0M A;  1U8R A;  5HOD A;  1R71 A;  2M0C A;  3ZQC A;  1I27 A;  3J81 Z;  2OQG A;  2H09 A;  2P7V B;  3WU0 A;  1KON A;  3KLN A;  4E70 A;  1BJA A;  2V6C A;  4B3A A;  4OU0 A;  1SFE A;  5DCM A;  5IOZ A;  2F4I A;  3G1M A;  2F2E A;  2DPD A;  3A0B C;  1KQ8 A;  1Q1H A;  2PLY A;  3E5U A;  2ZNZ A;  3FDY A;  1F4K A;  1SFX A;  4P55 A;  2L7Z A;  3EUA A;  3DFG A;  4XLH A;  5H20 A;  3GFL A;  4N0B A;  1FLI A;  3D5S C;  3BR2 A;  4AVZ A;  3GEZ A;  3NAU A;  3OYI A;  3LSK A;  4N9I A;  3BJ6 A;  3BG3 A;  5D8K B;  2M34 A;  3BPV A;  3LL7 A;  4KNY A;  5J4V A;  1FWZ A;  1MBJ A;  1G2H A;  4PJ0 C;  5CKT A;  2Z9O A;  4WK8 F;  1HOM A;  4AC0 A;  2HEO A;  2FF4 A;  2HZT A;  1ZYR F;  1XMX A;  3LAJ A;  3NWS A;  5HS9 A;  2VOO A;  2HFH A;  3BP8 A;  1RZ4 A;  1HDD C;  2K27 A;  4IXA A;  2BW3 B;  2M5W A;  5F6F A;  2E2I J;  1RIO H;  1V55 H;  5KAI C;  3IC7 A;  3HEF A;  1LEB A;  3HXL A;  5F0F A;  2BY2 A;  4BJ6 C;  1JUM A;  1R7J A;  2V4J C;  1W7P A;  5FKL A;  4EJV A;  3Q0W A;  2H6B A;  2KZV A;  3CLQ A;  4HA8 A;  1L0O C;  1PUF A;  3S1R J;  4BGD A;  4EVI A;  1DP3 A;  2WA0 A;  3CUQ A;  2M3A A;  2NS7 A;  2VPR A;  2JSP A;  2VN2 A;  3IRQ A;  2YU9 J;  1LVK A;  2ZB9 A;  1QO0 D;  1UST A;  3DQV C;  1Z67 A;  1BOA A;  2YS9 A;  3I53 A;  3V42 A;  3FF5 A;  3ZCO A;  5C3E J;  1VND A;  2EIL H;  5DUI A;  2PX9 A;  3QOD A;  4CCO A;  4BDY A;  4E7Z A;  4V2G A;  2JUC A;  4XN0 A;  1JXS A;  4YRV A;  5CVI A;  3FIW A;  2Z99 A;  2L3D A;  3NEU A;  3ZMZ A;  4D9J A;  5K5O A;  4I01 A;  2X6Y A;  2D2W A;  2XAJ A;  2LDU A;  4MO7 A;  4L9T A;  4F92 B;  2VQL A;  3HRT A;  5E18 F;  4XSX F;  3I0T A;  4EGY A;  1J9I A;  1ETX A;  1YLF A;  1JUP A;  2J5P A;  2OQR A;  1U5T A;  5J1R A;  1I6X A;  4FT8 A;  1BC7 C;  1KA8 A;  3KE2 A;  2CU7 A;  1SAX A;  2X6O A;  1JI8 A;  4EM0 B;  3LSG A;  3OYK A;  1YQA A;  4PGG A;  4GXO A;  2KFD A;  3JTH A;  3KP7 A;  3F0C A;  4JQF A;  4HQE A;  4AD9 A;  4IHY A;  1POG A;  3I55 I;  1S7O A;  1UG0 A;  2DO7 A;  2QVO A;  1X4P A;  3DBH B;  2GWR A;  3WTZ A;  2A05 A;  3PIO F;  5E1Z B;  1TT0 A;  1TZL A;  4ASN A;  5EGO A;  1K4T A;  1ZRF A;  2IA2 A;  3KYD B;  2XV4 S;  4ZZD A;  3JRH A;  3F23 A;  2R7O A;  2EPF A;  5EEH A;  2JT1 A;  3F6V A;  4G94 A;  4ENK A;  3VWB A;  4RGS A;  4E4H A;  2DT6 A;  3I54 A;  4FX4 A;  1J2X A;  1Z0X A;  1SVL A;  1SAN A;  1V5G A;  4AUX A;  4IRI A;  3OYG A;  4XLC A;  1P4X A;  2PEX A;  2KP6 A;  2RGV A;  1MBH A;  3DKW A;  1RKW A;  3KX2 A;  3LSR A;  4U88 A;  4ESF A;  3AKZ A;  2EV0 A;  3ROU A;  1JKO C;  2GZW A;  4OAZ A;  3BG6 A;  1EF4 A;  1YS6 A;  3JCU C;  2HXO A;  1QA6 A;  4EMS A;  3F3X A;  3DBR B;  3KP5 A;  1OLT A;  2K9L A; 
#chains in the Genus database with same CATH homology
 3CME I;  3CD6 I;  2QA4 I;  2H8W A;  3G6E I;  3EGV B;  4IOA F;  1VQ6 I;  5GAD J;  2FOW A;  5GAG J;  5GAE J;  4V19 K;  5JVG F;  1YJW I;  3CJS B;  1VQ9 I;  1VQ7 I;  3CC2 I;  1WIB A;  2OTJ I;  2K3F A;  1VQP I;  2E34 A;  5DM7 F;  1S72 I;  1ACI A;  2ZJR F;  1Y39 A;  3CCR I;  3CCQ I;  3CCM I;  3CCS I;  3CMA I;  3PIP F;  3DLL F;  3CJT B;  1YIJ I;  1VQ5 I;  3CJR B;  4IO9 F;  1VQO I;  3J7Y J;  1FOX A;  2E36 A;  1VQK I;  2NXN B;  2ZJP F;  2JQ7 A;  1VQ8 I;  3I55 I;  1FOY A;  2E35 A;  1YJN I;  1YHQ I;  3PIO F;  1MMS A;  1YI2 I;  3CCJ I;  3CC7 I;  5GAH J;  4IOC F;  3CF5 F;  5DM6 F;  3CCE I;  3CC4 I;  2OTL I;  1VQN I;  1HC8 A;  3I56 I;  1YJ9 I;  1YIT I;  3G4S I;  3J7Z I;  2QEX I;  1VQM I;  3CCV I;  1FOW A;  3CCU I;  2ZJQ F;  1VQL I;  3CJQ B;  4UY8 I;  1VQ4 I;  3CCL I;  1QA6 A;  3G71 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...