3J7ZI

Structure of the e. coli 50s subunit with ermcl nascent chain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
141
structure length
141
Chain Sequence
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L32
publication title Drug Sensing by the Ribosome Induces Translational Arrest via Active Site Perturbation.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3j7zI02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3j7zI01
3G6EI 3J7ZI 2E34A 2E35A 2H8WA 1YJWI 1YHQI 4IOAF 2ZJRF 5GAEJ 3CCMI 5GAGJ 4IOCF 5JVGF 1VQ9I 3CCUI 4UY8I 1S72I 3I56I 5GAHJ 1YJ9I 1VQ5I 1VQOI 3CCSI 3G71I 3CMAI 2ZJPF 4V19K 3G4SI 3J7YJ 1VQ8I 1YIJI 2ZJQF 1YJNI 1VQ6I 1HC8A 1VQMI 1YITI 3CJQB 2QA4I 2OTJI 5GADJ 1VQKI 2QEXI 1YI2I 3PIOF 2FOWA 2K3FA 1QA6A 1VQ4I 3CCLI 1ACIA 3CCVI 1VQ7I 3PIPF 1VQLI 3CF5F 1FOXA 4IO9F 5DM7F 2JQ7A 3CCEI 3CJRB 3CJSB 5DM6F 1Y39A 3CC2I 3EGVB 3CC7I 1VQNI 2NXNB 1FOWA 3CD6I 3I55I 1FOYA 3CCRI 1VQPI 3CCJI 3CCQI 3DLLF 1MMSA 3CJTB 3CMEI 2OTLI 1WIBA 2E36A 3CC4I
chains in the Genus database with same CATH superfamily
2OQRA 4U88A 2DA5A 5FLXK 1QZYA 2TDXA 3EUHC 3E97A 1R1VA 2ZJ2A 2YS9A 2HDWA 3L2CA 2LBFA 1QHGA 2DMQA 1IN6A 2OCEA 5TGTA 1WGXA 2HDCA 2VE8A 2DAOA 3C3WA 4MQVA 4IXAA 1VQ9I 2WAQN 4OWRB 5FB2A 3OYKA 5IPAA 5D6FA 2EFNA 1FY7A 4CYCB 1VNDA 1ZARA 1FYMA 1S7OA 1CF7A 3K2ZA 2XSJC 3H3ZA 1YJ9I 1FWZA 5EEHA 2LF8A 5LGTA 2DMTA 1VQOI 3E0JB 4ZYDA 2F4MB 5FO5A 5DD8A 3GTMJ 1S29A 3SZGA 3W2WA 1B72B 2CW7A 2JMWA 2CV2A 1W7PA 4F93B 2LR8A 3HGGA 5K7FA 3L00A 2WB1A 4ZTFA 3K4NA 3ZMDA 2VPRA 2V9PA 3QU3A 4XKVA 3OSFA 1WPKA 4UUSA 4PCQA 1MSEC 4BE1A 2H94A 2ZXHA 2HQNA 2PI0A 4PSXA 3UNGC 2VPLA 3HRTA 2DA3A 3CMMA 1WJFA 2VL8A 1DU0A 1Z6TA 3BG7A 1R4MB 1OCOH 2K3FA 2ZNYA 3IH3A 3M9AA 1VQ4I 1GVDA 2FNAA 3DKXA 2EV5A 1W1WE 3R60A 1WSUA 2COMA 2KIFA 3GTKJ 1S8NA 2FMLA 2HU9A 4K2EA 5BPDA 5DM7F 1HSTA 3KX2A 2H09A 5J8FA 4G94A 2HXOA 2GA2A 2JWTA 5CVUA 2FJ1A 3BTIA 3OR1C 3OMYA 2VXZA 2CQ7A 2AQEA 4M3EA 1T56A 2PMHA 5EF6A 4IHYA 3SXYA 5M5YJ 3MZ8A 3CO7C 1JKQC 2L7MP 1ETKA 1HLVA 1F9NA 2AQFA 1B8IA 2YSRA 3BG6A 3CD6I 2E7XA 4A93J 2R7SA 4PJMA 2VUMJ 5KHDA 2MLKA 1ZLKA 2DJNA 3G73A 4M3BA 3SEZA 1X4OA 4XORA 5J3LA 6PAXA 2MD0A 4M72A 3HZJA 4ZYGA 2BY1A 2TCTA 4HEA2 2DN0A 2WY7Q 2CWEA 2XF7A 4JBAA 4V2GA 4KIFA 2DT7B 4Y4RA 2A3SA 1FIPA 4FX4A 3JAMZ 2HOEA 3FKJA 3TO9A 2IJLA 3I58A 4HX8A 2HXIA 4ABZA 4HLXA 1YJWI 2Q2EA 1ORKA 3BR0A 2DK5A 4C2MJ 4M73A 5FD5A 3RCOA 5LGNA 5CJ9A 2EIJH 4CICA 5ERIA 3GO5A 2WA0A 2YX7A 2VKVA 3CP8A 2R7XA 2CUEA 4A3KJ 4HF1A 1RI7A 4P96A 2ICWG 1BI0A 3I56I 2NVQJ 1S7EA 5EEAA 3MKZA 3KYLA 1WI9A 5TRDA 5D5UB 3BG9A 3JREA 1BIBA 5FFXA 3T8RA 2D45A 3HRUA 1FTTA 2ZB9A 5HS9A 1UFMA 3KP2A 4MO7A 3F8CA 1F5TA 4BUPA 4N4NB 1HXDA 4MEYF 4U7DA 3S8PA 3RQIA 5IT9K 2K9MA 3K69A 4P5OA 2P0WA 4C30A 1XSDA 4NQWB 4RB1A 2Z3YA 4ZDLA 4AM3A 4LMYA 1F1ZA 3S93A 3ZMTA 1UHSA 2HTSA 3ERMA 1VFCA 3CF2A 3DPUA 1PP7U 4FISA 4LIUA 1SVOA 2EBIA 4M9ZA 3GYHX 2NS7A 1KU9A 2W25A 1TW2A 2EILH 1XC5A 4IKFA 3BG3A 5HNHA 3BJAA 2P4WA 1FOXA 3I5UA 2EA2A 4WXCA 3W2AA 4N0BA 3RZOJ 1WWXA 2F5EA 1MNMC 3DQVC 2VBZA 5CVVA 1B59A 2HKOA 4I6ZA 2OPTA 2KDOA 2L9NA 2QSFX 5E18F 4A3EJ 4ZDOA 5F1RA 5JLXA 3K70D 4PFOA 2L9RA 1Z21A 2FMYA 3C1DA 4UHTA 1BN5A 4ENJA 2NOGA 1BIAA 2LVSA 1IRGA 3A01B 4II2A 2VC0A 3IUOA 3WTVC 2K86A 1K83J 2H1KA 1ZYRF 2M8EA 1UAAA 4B1RA 1BOAA 1K6YA 3G2BA 5IP9J 3CCRI 2GBYA 4YIIA 2UUZA 2XAGA 2VT3A 2CV0A 4BXFA 1BBYA 1JHHA 4NDLA 3M8JA 3JRFA 5J47A 1JUSA 3P9CA 3GMEA 4PK4A 5GP9A 2XSDC 1MBHA 4HV6A 4GO1A 4HX4A 4CYCA 1AOYA 2OA4A 2DO7A 4MEXF 2K27A 4G7HF 1XD7A 1BW5A 1R58A 4ZYAA 2KIUA 2DFFA 3F3XA 5CKTA 1A35A 4G12A 2P6SA 5GAGJ 5E79C 4RDUA 1B72A 1V55H 5FKMA 5DS9A 2KPMA 1FOKA 1FLIA 3VB2A 4L5EA 5LFAA 3OYAA 2HFHA 5IP7J 2IGKA 2EFWA 1UHWA 1A36A 4IF4A 5FGMA 5GAHJ 4ESFA 5F1JA 3MKWB 2IGNA 2VKHA 2K40A 3WE2A 4C3IJ 1QVTA 2ZJQF 3A1YA 2GAUA 1LFBA 2RDPA 2BW3B 5BOXA 1LB2A 1PJRA 4PJLA 1TQMA 3CO6C 1Z3YA 4M9XA 5HLGA 4WWCA 2K9LA 4OINF 3EUHA 2IAIA 4OAZA 2L3DA 1REPC 1HCRA 3D5RC 2XIGA 5B1BH 3GTPJ 5F64A 1QA6A 2EFQA 3BTCA 4S05A 1XGMA 1D1AA 1P4WA 4B48A 3OOUA 2R7TA 2KRHA 4G6TB 5M3MJ 2R3SA 4RAYA 3VWBA 1O4XA 4NHJA 1ON1A 4DBQA 1I27A 2DQRA 4AVPA 4IHVA 3A4CA 1Y39A 3EGVB 3KLNA 4L9TA 3WTYC 1G59A 3CESA 4KMUX 2E5NA 1IN4A 2IBDA 3V8JA 4ON0A 2HYFA 4JK1X 3BOQA 2HVRA 1D1BA 2XUBA 3CMYA 5CPRB 1YYVA 4BHBA 2P7CB 2PLYA 5EDNA 2GOMA 2R5ZB 2ESHA 3IAM2 1LDKB 3IC7A 2JUCA 3Q3SA 3JCUC 1D0ZA 1TL8A 5HLIA 2D5VA 1KQ8A 2KIMA 4L18B 4PFPA 3LSPA 1E0EA 1K61A 4HAMA 3S2DJ 3L2QA 2A07F 5F0CA 3V8KA 3QRFF 4OIOF 4A3CJ 2DT5A 2FUG2 2MG4A 4CCOA 2CUJA 1XMAA 3MEXA 1D1CA 1ZQ3P 5JVTA 2V9KA 3JRCA 4O5VA 2JZYA 4ENKA 1P4XA 2A68F 4XLNF 4ZDPA 5JI6A 3RPUA 1BC7C 2DQLA 2JSCA 2XAQA 3CCUI 2R92J 4QSHA 2BVMA 4WF2A 2BOLA 4UY8I 4NQWA 1L0OC 1R23A 4E7JA 1U2WA 1PVEA 3O8GA 2OUMA 3BQZA 2RNGA 2DLLA 1R71A 3IWFA 4F3QA 5J40A 5BS6A 4A0ZA 1KONA 1XN7A 2XAJA 3TKYA 1NG7A 4V19K 1LQ1A 3F8NA 3P9IA 4U0YA 3PL8A 1LUJB 1VQ8I 2F5DA 3HKZA 3T8TA 2IS1A 1Z91A 4YIFA 1CQTA 2OZUA 1Y0UA 3KEYA 2NRAC 2E1NA 1ETYA 1IF1A 3Q0VA 5DTDA 2Y75A 3A03A 3HOXJ 4EGZA 2DMUA 5F04A 4M6XA 1YX3A 1SFKA 4RGUA 4XL9A 2ELHA 4UNOA 2RV8A 2V7FA 3OY9A 1WJAA 2KDZA 3NQOA 4HX7A 1R36A 4UVAA 2STTA 1IXCA 1ZN2A 2VN2A 3MFKA 1X3UA 3JSPA 2L7FP 5EJCA 4DNCA 5J6XA 1HF0A 2RN7A 2CW0F 3OS2A 3ZP5A 5FKNA 1R7JA 3A01A 2ZSHB 3FXKA 1F4KA 1U9OA 1Y1VJ 2OJED 2X9DA 1ZREA 3CC2I 2BE5F 3EPZA 3HSFA 2ACJA 1FMVA 1MNDA 1G2HA 3WHBA 1USTA 3M3YJ 3GUDA 1SVLA 2L54A 3QYEA 4IVNA 1W7PB 4XQFA 1X1PA 3OYCA 3OWTA 2WV0A 1S9HA 1JKRC 4YELA 3S3MA 1FOYA 2MFZA 3OV8A 3GTOJ 4W1UA 4M9SA 4UUSB 1ZGAA 1JT6A 4PUSA 4NC6A 2HOTA 4XNFA 2LFBA 3KP5A 3RKXA 4GYIA 3SJMA 4XK4A 1W0TA 4EJTA 2EQRA 3J7AY 1MMSA 4C3JJ 2ZKZA 1DPRA 3GZNB 1PDNC 3HDDA 5E17F 2CGPA 2F48A 4IRIA 2F5FA 3EQLF 2VE9A 4YEJA 4N9HA 1ZR4A 1OYYA 3OR2C 2A61A 1YO5C 3LSMA 1S3JA 3RYRA 4OAYA 2CV1A 3RQ4A 1IXSB 2E71A 1N25A 4EATA 5JVGF 1I5ZA 3WODF 3FXLA 3HHGA 1R9TJ 1R49A 2HVQA 3FXRA 3BTLA 2BW3A 2OV7A 1G3WA 3KPHA 3H5RA 1AU7A 2HEOA 1MZBA 1G4DA 2LYCA 2H8RA 4UUTA 3E3VA 1J5YA 2EB7A 4RBOA 3QPHA 2BYVE 3A02A 4LB6B 4NB5A 3FXQA 5C44J 4JOMA 3K4BA 1Z1DA 1JT0A 2FSWA 4UVBA 1LFUP 3FHZA 1MBGA 4JX6A 3ZMZA 4LJZF 3QQAA 2R0QC 1W5CC 3CLOA 1ONVA 3MZYA 2OTJI 2CS3A 3H92A 1MW7A 5JFRA 1WH7A 1XGNA 3OIQA 4QTRA 1XG1A 1U6GA 2Y0SA 2KMUA 3KP4A 3BC8A 2L7ZA 2AXLA 2EIKH 1JJ8C 2M87A 2P7VB 4JQFA 1POGA 1YS6A 3RPQA 2JK3A 3LNQA 4CHUA 1JJ6C 5IY5H 2L4AA 2HS5A 3I4NJ 2R5ZA 2K9QA 3GZ6A 2LREA 2JSPA 4N4OB 5FJ8J 1GLNA 2M45A 3LOCA 2Y2ZA 1YRNB 2Z9OA 1OLTA 2JT1A 2Z5UA 2IVMA 2VJ4A 4CGZA 5D5XB 3TW6A 3UKGA 5B3SH 1WVRA 1VQNI 5EYRA 1W36C 1TNSA 2NAZA 4II3A 5A2QK 3CP2A 2QUFA 3DV8A 1WFXA 1W0UA 4HA8A 1HKSA 4U7BA 1QPIA 4EM1A 4BDYA 1J9IA 4ZZLA 2FXAA 4UVCA 2IGOA 3L2WA 5EG0B 3O6BB 4IHXA 2QVOA 1TBXA 4S0HB 2CUFA 1XMXA 5KAFC 2V6EA 2LY2A 1ERDA 3OYDA 2CW8A 3C7JA 5FROA 2BV6A 3LA2A 3W6JB 4KUMA 1U5TC 4F7ZA 2BHZA 1FBUA 5IYBJ 2W24A 3ZGKA 1S5LC 4P1WA 2NNNA 5H6RA 2HQAA 2YR2A 2LKSA 1V54H 2VJ5A 3JW4A 1XB4A 4EVIA 5L3FA 2KL4A 1OCCH 2DA7A 3PO2J 2KIQA 1RC9A 4DW6A 1P2FA 3KP6A 1X2NA 3FXUA 1QPMA 1FNNA 2DK8A 1J59A 2W48A 3HJEA 2M3AA 3WU2C 5B5EC 4XIDA 4KA4A 4I2OA 3JSOA 4ZZDA 2DPUA 5EZGA 3K9TA 1U8RA 1GVJA 1MBFA 2OAZA 4XM3A 3J81Z 2VC1A 3HUGB 4FE4A 3TP3A 2HR3A 2V26A 1QQIA 1RKTA 2W85A 4FT8A 3O3KA 3M07A 2FRHA 4JX5A 3CDIA 3CJQB 3E6BA 4M3DA 1XS9A 4DJAA 1KQ0A 3B6CA 1A04A 3HL2A 2STWA 1V4RA 2BVLA 4RS8A 2FOWA 1XCBA 3S3OA 4D5CA 2M5WA 2LSOA 4EM0B 3GW2A 4P9UA 2DJIA 2X1DA 5D5WB 2DFHA 4GCVA 1STZA 5LHGA 4KN4X 3HOSA 4BQNA 2CFXA 1GXQA 4F55A 3SFZA 1MJAA 3HSEA 2O3FA 4XSXF 3CF5F 3Q5FA 4IO9F 4HNUA 3SQNA 4MIMA 2OQGA 1J0RA 2ECBA 2IEKA 3DLAA 3H9QA 3OYJA 1FJLA 3C18A 3KYCB 3QPSA 1C0WA 3FMSA 1H9TA 2BY0A 4PZJA 1BI3A 4HNTA 3S15J 1I3AA 1LDDA 5E3MA 2F2EA 1EKEA 5F0HA 1I6XA 3TDZC 3GX4X 2Y9YA 4H4KC 3RDIA 3O8HA 1E3OC 3LWFA 3A2KA 1V5FA 1WJEA 3KIOA 3SDBA 4AWXB 3MAJA 4B3AA 3LSJA 3ML6A 3BR6A 3TO6A 1B6AA 3DLLF 1SD4A 1MSFC 1XTAA 3MVPA 2FQ4A 2X85A 2XASA 2WWYA 1KU7A 2P5VA 2JRMA 5HLTA 1GUUA 4PSWA 1K78A 2LG4A 2OTLI 2HPMA 4L9NA 4LG3A 2G9WA 1JKPC 2DMNA 3S32A 1OJLA 2YUSA 1F36A 3R4KA 4KISA 2DA4A 3QPLA 3HIFA 3U2RA 1TQPA 4RA2A 2LKPA 2M4GA 1BI2A 3AL0C 3FF5A 5FD6A 1O3SA 4IOCF 3V42A 3GTQJ 2K7LA 1ON2A 2ME0A 1B4AA 1FP2A 1ZLJA 4PGGA 3I4MJ 3V7RA 2O03A 2V79A 2Z33A 4RB0A 4L0ZB 3DCFA 5L3EA 4CCMA 1TT5B 2JPCA 5E3NA 3LMMA 3P5JA 5L3GA 3ZN0A 3WTTC 4A3MJ 4BNCA 2P5KA 4ZYHA 4CCKA 3CUQC 5H2FC 1I1GA 2ZJPF 2WV1A 3HKZN 2KP6A 2WTEA 2D2WA 4LG0B 4UB6C 3O2PE 5ICEA 1D5VA 3AG1H 2LP0A 2JN6A 2K4BA 1GHCA 2DOEA 2QA4I 2ZFWA 4EGYA 2FQ3A 4B43A 4MGRA 1VQKI 1RPWA 4B44A 3PIOF 2Y9ZA 1A6IA 1GV5A 3GTGJ 3U21A 1YRNA 4XKBA 3FK7A 2K85A 2X6WA 3Q0WA 3TEDA 1P9QC 2Z99A 1ACIA 5E20A 3LFKA 3PIPF 1ZTRA 3J80Z 3F9KA 2VONA 5DV5A 1YOVB 1XMKA 2NYXA 3IAS2 3OL4A 5FFZA 4B4CA 2CU7A 3RSNA 3K4CA 4C2TA 2W00A 1FT9A 2WAFA 1BI1A 3LFUA 1KZHA 2M30A 2QBYB 4XN3A 1OPCA 1MMNA 3OL3A 2IA2A 3DEEA 2O61A 5C4XJ 3ZQIA 1R5GA 4RM2A 4ETSA 3MKYB 3KE2A 3FWEA 3DKYA 5EG0A 3WTWC 4XRMA 1T2KA 1AKHB 5H20A 1UG0A 1SFXA 2PN6A 4UB8C 1DQUA 4LOCA 4Y52J 2EZKA 2JA5J 3FMQA 4R79A 3S14J 1YW8A 2HTJA 2IS6A 1QRYA 4M6VA 3OOPA 1D8JA 3CUQB 3MWMA 1IV6A 3ISPA 4A3FJ 2W1OA 4IRGA 3HRSA 2PBIA 2RGVA 2QSGX 2FBHA 2GOXB 3VFZA 1FBQA 3BPXA 1HKQA 2EZLA 2R5YB 3IL2A 2AHQA 2MD5A 3H9JA 1W7PD 2VBWA 4M3FA 3QOPA 4G7OF 1QBJA 2E34A 2X48A 3JRIA 1ZG3A 3DFGA 1T39A 2VOOA 2DPDA 1IN7A 3CCMI 4IHTA 3BR3A 2LOOA 1JI8A 2L9VA 1EH8A 1GXPA 3E6DA 3H9GA 4RGXA 3DBHB 4QWQA 4HW0A 1O57A 4YRVA 3HUGA 1TW3A 4MLOA 3KP7A 1UCRA 1ENHA 5H6QA 3LAJA 2PFBA 1YQAA 3BZCA 2KT0A 3LL7A 2XGEA 4PJ0C 2E7WA 3ZPLA 1BA5A 3D5LA 3ZQGA 2EPFA 4DYQA 1MDMA 3KZIC 1KU2A 1RZ4A 2O6GE 3CZ6A 1LEBA 2M4KA 2DTZA 3BJ6A 3DEUA 3HYIA 3ZQHA 2DA1A 4HG2A 5CLSA 1T0FC 3DU5A 2AO9A 2IPQX 4IJAA 2K5CA 3RKQA 4HBLA 2H1LA 3FZVA 4Y33A 4HDVA 2QQBA 4IPAA 3R0AA 4B8XA 4Q47A 1EH7A 1TWAJ 1GT0C 1GV2A 5IP6A 2FE3A 5JR3A 1KU3A 1RUOA 3FIWA 3ROUA 5L3BA 1OCTC 4O6JA 1V3FA 1YI2I 4J00A 2Y0SN 4BU2A 1U0JA 1Z7UA 1TTYA 5E1WA 4CCLA 1DDNA 1MIJA 3TL4X 1DP3A 2A69F 3DBRB 4XRSA 3CCVI 1I6HJ 2L01A 1WRJA 2LTPA 3BZ6A 2DOFA 2BXYA 1ETVA 1P92A 3MKLA 3SYTA 3VYTB 2P6TA 3KZZA 1N77A 2XV4S 2BEOA 4B3XA 2JQ7A 5BNGA 2HNHA 1J7KA 2R7OA 3IP4B 1LPQA 3EYIA 4HNVA 2HPIA 4DGWB 2E5ZA 4LGWA 2I10A 1TWGJ 2JRTA 2XB0X 2QZ8A 1RETA 2C6YA 1HSJA 3E5UA 3M4OJ 1H0MA 2QSHX 1IUYA 1IGNA 1SFUA 4D7NA 1QGPA 2M9HA 2FEZA 3QYBA 2VQGA 5IOYA 5ILUA 2XHKA 1ZK8A 3V7SA 4ZYEA 1K4TA 2F5CA 2QCOA 4X6AJ 3PO3J 1YLFA 3QWLA 4KJZA 1NK3P 1LDJA 2XAFA 4EEFG 4TV7A 4F91B 4RLFA 1G6NA 1JUPA 3CTAA 2RNJA 2V1UA 5E3LA 3BCBA 3ZCOA 1FC3A 4Q5SF 3BR2A 2EWNA 2DYSH 3JTGA 2QLZA 1WQ2A 4HOBA 1T38A 1SFOJ 4IL6C 3JRHA 2KRFA 1OCZH 4IOAF 2XVCA 1LVAA 1ZG1A 4JYKA 3JRBA 3K1MA 4ZTJA 3S17J 2A6TA 3GFJA 3K1PA 5CVIA 3DTKA 2P81A 4AIKA 3WGIA 3EYYA 2KFDA 2GM4A 4LG0A 3LQRA 4BJTA 1SC7A 3ZN1A 2ME6A 3I64A 1KGSA 5E8GA 3L09A 3BG5A 1X4PA 4IQ4A 3JAMK 5KNLA 5M5WJ 2NVTJ 3F8FA 4KYWA 4YFNF 1FSHA 4UUVA 3I3LA 3L2RA 4LD5A 1RKWA 1EV7A 4HF2A 2OC6A 5C3EJ 3Q9SA 2X0LA 3J7YJ 3G1MA 5FLVA 2GLOA 1ZAOA 4I98B 1BR4A 4G6QA 1IO2A 3GVAA 1FYLA 4PJNA 1H9GA 2HOAA 2QBYA 1A5JA 2E2HJ 2DU9A 2RVCA 2HOSA 4XKWA 4KIGA 3KEQA 4I0BA 5CYVA 1R5HA 3HG9A 3TGNA 4FASD 3FBIB 2IRFG 4DOZA 2AS5F 1XX5A 1RUNA 2CJJA 3I54A 2O8KA 4MFEA 3CCLI 1QZZA 1YW9A 3H5NA 3N97A 1AKHA 2H6CA 1IDZA 1ZR2A 4IRHA 2XROA 3N4MA 1LNWA 3KEOA 4XONA 1TNTA 1H8AC 2RAEA 3JRDA 2XGXA 3F8MA 3CUQA 3GFLA 3FDYA 3ZMUA 1H89C 4A3IJ 2COBA 2OF7A 1Y8RB 3P7NA 3K70C 1EF4A 3FXOA 2R5YA 2K3PA 2V9VA 3ZXSA 4E70A 3IWZA 2JA8J 3TP0A 1E3HA 2EZIA 4BHPA 3KYDB 2UXNA 9ANTA 4CO8A 5FLXZ 1Z7LA 4RGRA 4DYCA 4KITB 3KETA 3IHUA 2XC7A 3HOYJ 4BBSJ 2PQ8A 4Y15A 2ZC2A 2ZFUA 1OISA 3GBGA 3NAUA 2X1EA 3AG2H 1G3SA 2OU2A 1OR7C 2O5RA 1X58A 1DU6A 4LLGF 1APLC 3P9KA 1BR2A 2BZTA 3GTJJ 1U78A 1LE8B 5GPCA 2NVYJ 1X1DA 5ILVA 3EDPA 4XLHA 4P55A 3IH2A 4A6DA 1VF9A 5J1YA 5E1XA 4B47A 4IQJA 1YFHA 1IAWA 1LEAA 1XGSA 5EZHA 2GQQA 4GYGA 1JGSA 1A31A 4NNJA 3ULQB 4D7MA 5HS8A 3I9V2 4IX7A 3HHHA 4LB5A 2CQNA 2FBIA 2A05A 2X4HA 3GCMA 2CQKA 4AIHA 4AU7A 3G1LA 3DF8A 3BCAA 4A0YA 3T0YA 4ANJA 3LSHA 4BAYA 3TO7A 2YU3A 3HXLA 1OMIA 1J2XA 1R22A 1K6OA 1BL0A 4KDPA 3TMOA 4IEJA 3PM1A 3FKIJ 3Q0UA 2RQPA 2DTRA 3JR9A 5GTIC 3G4SI 5BPIA 4D5FA 2LNBA 1YJNI 2FF4A 4M6YA 4E7IA 3MMYB 1JTYA 3HM5A 3R61A 2EA4A 2G0EA 4BKXA 1YITI 1K78B 2F4IA 3AFHA 3WTZA 3JRAA 1Z77A 2R7DA 5B1AH 4N9IA 3S2HJ 1SMTA 1Y0NA 1WH5A 2XKPA 1SAXA 2J5PA 1DUXC 2V1DA 1YX5A 4OOIA 5F0FA 2L4MA 4U0WA 3KLOA 1T95A 4A5NA 2E60A 1VQLI 4OMZA 1W5TA 3WG9A 1JTXA 2JJ7A 5D4RA 3CCYA 1N78A 3KP3A 1Z67A 4DIQA 1H88C 3I4PA 2DW4A 3FHNA 4ITVA 2M2EA 1HQCA 3CJRB 3L9FA 1USSA 1J09A 1MMDA 2XPUA 3TOAA 1ULYA 2HKXA 2MSYA 3WTXC 4EJOA 3FM5A 1EA3A 3W2VA 2X1CA 4EV0A 1T0FA 1EJ9A 3RPUD 3RZDJ 1HA8A 1FX7A 2KJBA 5K5OA 3HBLA 1FOWA 1QO0D 5KVRA 2R7RA 1ZRCA 5LRRA 1FEXA 3K4LA 2F4OB 1P4AA 2R4GA 1FP1D 3G1OA 4HSTA 2KQRA 3TW7A 3W6VA 4L9JA 2GIZA 1TLHB 1MNEA 2DDBA 3F6OA 3COAC 5GPAA 1EH6A 1R5ID 2IGMA 2JA2A 4XR6A 3E5XA 1Z9CA 2JVHA 1FYKA 3NRVA 2QKLB 2E36A 2DCEA 2JPBA 2NNYA 3CC4I 3G6EI 4BEHA 2PX9A 3LA7A 2AXTC 2LRDA 4LK0F 4A3GJ 3GWZA 1BC8C 2ZJRF 3CDHA 2DYRH 2DFEA 1X3WB 3WE3A 4FQGA 1YW7A 1RIOH 4G7ZF 2UZKA 1D0XA 4OIPF 1FTZA 3BR5A 5HVQC 3ZQCA 3F22A 5IT9Z 4RMNA 1Z6RA 3IKVA 5CQEA 4AYBA 4LLLA 3H0GJ 3LQQA 3ZOBA 5BMZA 2VQCA 4XOPA 3AAFA 3BPVA 5E8IA 2WAEA 4BY7J 4WK8F 4Y13A 2W84A 3EUAA 4WXHA 1S72I 2LH9A 1Z3XA 2IW5A 1SEUA 3IV5A 1IRFA 2MH2A 1Q1HA 4PJJA 4KNYA 3C2GA 3WG7H 3FX3A 2LLKA 3OIOA 4MFDA 2E1CA 3ASOH 1NTCA 3CLQA 3CCSI 5DUKA 2VXDA 4DZPA 3VSKA 2M7BA 4NC7A 1XPXA 2GIVA 3E6MA 3K4KA 3ABMH 3OYFA 3OYEA 5DUIA 1FPQA 2V1NA 4D0PA 1VQ6I 1HC8A 1NH3A 2L2OA 1HOMA 1WHUA 5D6EA 2HQ5A 1HDDC 2XAHA 3VSLA 2HDDA 1MMAA 2UV1A 4XRFA 1IN5A 2KJCA 3GLXA 3QODA 4XLEA 2VB6A 1MJ9A 3ZQLA 5J4VA 4U0VA 3ZQ7A 4BDZA 4OIQF 4B09A 2L0KA 2Q0OA 2CSOA 2R7FA 2ZXIA 4MQ9F 5KAIC 1WJCA 3WGGA 5J4YA 4FE7A 1AA7A 2W57A 2XAUA 5LRSA 1TC3C 5HDGA 4GFBA 1IDYA 2LC2A 3U1DA 2MBFA 5HDKA 2GXGA 1G3TA 3F0CA 3CJSB 3WTUC 3H3VK 5L3DA 3ASNH 2LDUA 3DTEA 1FZPB 4S04A 5DEQA 3TQNA 1XSVA 2K4JA 3QOEA 1MDMB 1R00A 3FM3A 3CDLA 2QF7A 2YU9J 4MTEA 1G8XA 3KZYA 3H1CA 4KIBA 1JHFA 3R0JA 5ICFA 4WX9A 4FTHA 1GDTA 1LE8A 2GZWA 4A5MA 1N75A 2X6YA 1U5TB 4BYYA 1SFEA 2E1OA 4I99C 1QVUA 3KFWX 5KCMA 2FU4A 2Y31A 4YFKF 1DGWY 3MN2A 2WADA 4ENNA 3PNTA 1ZH5A 1CGPA 1QU3A 2HI3A 2F5VA 3V4GA 3HOUJ 3GF2A 2VQLA 3ZRGA 3EETA 2FX0A 2LK2A 5K7ZA 2DI3A 5JHUA 4ASNA 2I8DA 2BHYA 4KT5C 3IKTA 2DT6A 1XGOA 3ABLH 2QQ8A 4OIRF 1P7JA 2Z16A 4MHGA 3F72A 2E35A 2PG4A 1ZG5A 2H8WA 3BT9A 2K02A 4BXXJ 2NOJB 1SD6A 1BJAA 2WC2A 3F8BA 3BP8A 4E7SA 1MJBA 2ZSIB 5GAEJ 1AHDP 4A3BJ 5EGOB 2I5UA 3SFIA 5DYMA 4C2UA 2CG4A 2DDAA 4CYDA 1RR7A 2VQHA 1DPUA 4QPQA 2V1XA 5LBQA 3AG3H 2NS0A 1Y8QB 1IJWC 1A6QA 4KMFA 2LMDA 5LD2C 2HQRA 2QM3A 1ZGJA 5D8KB 4CCNA 4X0GA 4CUGA 5E1ZB 4PGHA 3ABUA 1PP8F 5AONA 3H36A 2O7OA 3CMAI 2L7KA 4ZH4F 2R7QA 1SANA 4A6EA 3ZMVA 1OR7A 1HW1A 3ECOA 4BXUA 1X2MA 1K79A 2XRNA 1ETXA 3PFIA 3PSIA 2EK5A 3QP5A 5AIPA 3MQ0A 2KRCA 2N8GA 4UXNA 3IRQA 1HW5A 2DBBA 2JTVA 1KYZA 5L3CA 4XN0A 2B63J 2MW8A 2FD5A 2CQXA 2ZMEC 4RM3A 1UJ8A 2LF7A 2CFOA 2L5QA 2KKOA 1XCVA 2YX4A 2EIMH 3K10A 2Q8KA 2KZGA 3M8FA 3HTSB 4HF0A 3GXOA 3W6KB 4A0XA 3I59B 5FKKA 4FHTA 2Q1ZB 3DBLB 4G8XA 1HBXG 4O3MA 2DMPA 2RKHA 4CZCA 4BE2A 1UB9A 2XB5A 1AWCA 1IUFA 3QAHA 1M1EB 1X19A 2ETHA 4Y3OA 1G3YA 1ZKGA 2ZXJA 1IZ1A 2QQAA 5GTHC 5DM6F 4H0EA 2Y0MA 2XGDA 2PEXA 2E2JJ 1UELB 4Q48A 1HW2A 2CO5A 2PJPA 5DD4A 3OS0A 2KHMA 3RI4A 4GGGA 3NWSA 2NXNB 3OYNA 2GXAA 2O8XA 3M1EA 1SMYF 3ERED 1HDPA 1X1AA 2PMZN 2HYJA 3VEPA 1RR8C 4M71A 2HWVA 5ILSA 2VKDA 3VYUB 4LLNA 5HNFA 2O9LA 3WTSC 4I02A 1Y6IA 1Q1VA 5HOOA 2JUGA 4CA0A 3PJRA 4RAGA 1VQPI 1I50J 2OZ6A 4L0YB 3B6AA 3H3UA 3FXMA 2B0LA 4Y7NJ 4A12A 1V5EA 4J01A 2CRGA 3AL0B 3L7WA 4ESBA 5LEKA 2Z2SB 1NG6A 4AIDA 2E1MC 4CH7A 3OYHA 1SD7A 4MNUA 1TWHJ 3LSKA 3J7ZI 3VODA 3BDDA 2ZMEB 2PJRB 3LSRA 2W4SA 3ZR8X 4LITA 3ONQA 2R7VA 4EM2A 1ETWA 1IRXA 3DKWA 4WXDA 2W7NA 1B1BA 3BTJA 5FRMA 1QNTA 1T08B 3K4MA 1ZHFA 5LHIA 5LGUA 3SEQA 2ISYA 4FETA 4G9YA 4NBQA 4MTDA 4GXOA 3QU6A 2BGCA 3ZQFA 1QHHD 3PNYA 2EJRA 4KICA 5IOZA 2V4JC 2VKEA 1WJDA 3S3NA 4XSZF 1VQ5I 1W5SA 3PSFA 2A6EF 2VIXA 3RKYA 1T33A 3S2WA 3K6GA 3BJOA 4YFXF 4RB3C 1X3ZB 5D5VB 1IG7A 3BR1A 2EFOA 5FKOA 1YIJI 3TBIA 4L5IA 2H27A 2EFPA 1ETQA 4R8HA 3K4JA 1OCPA 1UG2A 3MD2A 1BJZA 2WY8Q 2HYGD 3G3ZA 3ZQQA 4JX4A 3HRMA 3GZ5A 2ADUA 2E2IJ 1TT0A 5TISC 3QP6A 2LY1A 2CH0A 1RRJA 4XOTA 2O0YA 2MLGA 1T8IA 1QZEA 1XDSA 2PMUA 2DOAA 3SZTA 1VQ7I 4YIRX 4DQ2A 4L5JA 4AVZA 2E1MB 4WCGA 3K0LA 2MGQA 2A6HF 3J81K 5CVJA 5HODA 3L1PA 1XDUA 4W97A 2ID3A 1IN8A 5J1RA 3N05A 4CSWA 3CCEI 3VYRB 1U5TA 4HDUA 1V5GA 4BBRJ 2Y30A 4A3LJ 4AUXA 4XKCA 2FOKA 1OFCX 1TP4A 3T5XA 3W3CA 3FMRA 1MBEA 1TQIA 1LFPA 2FNPA 3V7CA 2LY9A 4XLCA 3NARA 3I55I 2IA1A 3Q9VA 1TZLA 1JE8A 2EINH 1WCMJ 1ZRFA 3ECHA 3CQZJ 4ZC3A 2QGUA 3HGYA 4LK1F 4LIVA 3CCQI 3S16J 5EGOA 3M8EA 2MH9A 4U87A 1K4SA 3CJTB 3RYPA 3HPGA 4AC0A 4E7LA 2VOPA 5F6FA 5DCMB 2L9SA 2VBYA 1WIBA 3OYMA 4XLPF 3GLLA 4FX0A 1PYVA 2MA3A 1U3EM 4BJ5C 3ABKH 4P9FA 5M5XJ 3GFMA 1BOBA 2ZNZA 3M1CA 3U1KA 4BACA 3EUKL 2XF5A 3WU1B 3RJPA 2ZO4A 3S1MJ 2VJIA 2Y48A 3IH4A 1SVMA 2P5LC 4AYBN 2DA6A 3B73A 3QPTA 4HRIA 2XF6A 3RTRA 3VPRA 1D0YA 3J7AO 4ESJA 4IHSA 3C2BA 2CYYA 2WAQA 2X6XA 3S1QJ 3OYLA 2XPVA 3TDUC 2EH3A 1WJBA 2DFIA 4JP0A 2HVSA 5EEGA 1O7LA 2EV0A 3BLYA 3I71A 3G71I 4ZJZA 3S1RJ 2J5OA 5LLQA 4BY1J 3BWGA 1U9NA 2BY2A 2YPRA 2VBXA 3I59A 1L3LA 4AD9A 2TRTA 2M7AA 1ZGWA 3HSRA 2HZDA 1LVKA 3C2HA 1OYWA 3PFYA 2E19A 4D9JA 5LEJA 5CQGA 5IYDJ 2RQQA 3NWTA 1MGTA 3E5QA 4M3GA 4BL0B 4IHWA 2MC4A 4XBFA 3OSGA 2QEXI 4ENMA 4BEHB 3OYIA 4OMYA 3D0SA 4KFCA 1U8BA 1FSEA 3PQJA 3DWLE 2ID6A 1DP7P 5DCFA 4C9YA 4KN7X 5A2QZ 2KISA 1JKOC 4EJVA 5JLWA 3WGHA 4RLQA 1R6RA 2DXIA 2X51A 2XPWA 3F6VA 3S1NJ 2EV6A 2XGCA 3A0HC 3B02A 3JTHA 5B66C 3HOTA 5TJJA 2HZTA 1E3PA 1S7AA 1TWCJ 4HLYA 3I0TA 1SD5A 2FA5A 2W82A 5J8CA 3K1NA 3NEUA 1D5YA 2JA6J 4G6DA 1W36D 3J80K 1E2XA 2VT2A 4E7ZA 4E7KA 5F08A 3HTUA 3WHCA 1D3YA 1J75A 2IP2A 4AIJA 1Y1WJ 3K7AJ 2MYSA 1JGGA 3ABTA 3FK6A 3RKWA 4Q4ZF 3E6CC 3AG4H 2ZMEA 1UHMA 2PJRA 4BE0A 2K9SA 1RNLA 2CQQA 3BY6A 3E7LA 3CCJI 3FISA 4FCYA 2VODA 2M1BA 5BQTA 4QPOA 1PUFB 2RC4A 4EQQA 4V2FA 3F23A 1K7AA 5CVRA 1MH3A 2XDVA 2ISZA 2DODA 1OKRA 3BQYA 3BZKA 4E6KG 3HOZJ 1ODDA 1ZELA 1KQ9A 3CUOA 2R7UA 2PMZA 3DTIA 4OU0A 2WB1N 1T98A 1IC8A 5FLMJ 5IT3A 1R1UA 3KCCA 1Z05A 3MCZA 1FMWA 2CUZA 3OYGA 2IS2A 4Z2YA 1F43A 4GDFA 2V6CA 1UZCA 1O3TA 4BQAA 4BH9A 3LA3A 4XMYA 4EMSA 3UR3C 3LSTA 3FXJA 3DPTA 4J19A 2R7WA 2R93J 2X6OA 2JA7J 3V8LA 1YIOA 2LBFB 4I01A 3DEWA 4BJ6C 5HLHA 1I3QJ 3DXJF 3SHFA 4L9VA 2R7ZJ 1YS7A 3HOVJ 5ED4A 4BQQA 3X2QH 2ECCA 1VQMI 1BR1A 3LSIA 1D8KA 4BGDA 3L2VA 4DBRA 1CF7B 2DA2A 5D8LB 1HKTA 2CMPA 2ZBKA 1VTNC 4A3DJ 1ITYA 4C3HJ 3JRGA 1WJ5A 2ELKA 4D1QA 3DPLC 4HPQA 4YG2F 2QKMB 2UXXA 2ZXWH 1B9MA 2A5WA 3A0BC 4GRIA 3VOEA 2GA1A 2IS4A 2G7HA 2Z1DA 4RAFA 1KA8A 1LKXA 5K1YA 2NVUB 4Y17A 3HEFA 3MZHA 1IRZA 4LFUA 3PNVA 2XKOA 2BBYA 3ESWB 5FKLA 1NHAA 4RAZA 3CC7I 2IXSA 2IT0A 2IA0A 2KZVA 3U9GA 1R4NB 1YE9A 4UV9A 1YTYA 3K2AA 5K7HA 5DCMA 4A69C 5HDNA 4Z6YA 4RGSA 2VJJA 3LAPA 1KYWA 4EJUA 3M7GA 3SZPA 1SAUA 2M34A 2GWRA 4PDKA 1FIAA 1O3RA 2GXBA 3PQKA 2H6BA 1X1BA 4HV5A 5IYCJ 4I7HA 1B8IB 3R6SA 1OQYA 1OYIA 4A2UA 2K9NA 1WKMA 3OIPA 3TOBA 4CDGA 5E3OA 2ELJA 2VLAA 1P7IA 4HYEA 4HZFA 2QWWA 4NC8A 1YHQI 2RREA 4UV8A 2QYOA 2LKXA 1MMGA 5FRNA 2BXZA 3E1SA 4CXFA 3PUFA 3I53A 2OCCH 3LSGA 2LD5A 2M0MA 1R1TA 4HSRA 1MKMA 1ZRDA 3QYFA 2D1HA 4I0AA 2BY3A 4F52A 4QLCU 5D4SA 2P8TA 4BHCA 1MH4A 4CCJA 5M3FJ 2Q2EB 4XRSG 4CZZA 1WZ2A 1TWFJ 1B9NA 2ESNA 1JUMA 2OBPA 2HGCA 1VZ0A 1BM9A 3OS1A 5C4JJ 3HB9A 2NS8A 2NVXJ 1IXRC 4BQOA 2M0CA 2MABA 5F27A 4I76A 1I39A 1BW6A 4XICA 4IZZA 5DDGA 1NK2P 3VDXA 3ZMSA 5JHFA 5ICCA 5K5RA 4HQEA 1T6SA 3HPHA 4X1EA 2QENA 1XSXA 2KLOA 3H0DA 5GADJ 3PUBA 3GEZA 2EZHA 3FBNB 3T1BA 2M8GX 1P6RA 1WI3A 1IV8A 5KK1A 4E4HA 3H35A 1X1CA 2A5YB 4M74A 4DZJA 5ICGA 1LJ9A 3ELKA 4KT6A 4A3JJ 2MC3A 4RB2C 3AKZA 3HOWJ 2FBKA 2QQ9A 2F6CA 3REOA 5LHHA 3RIRA 4DYRA 2L02A 2G7UA 4I09A 3DU6A 3F21A 2B7EA 3HC7A 3VYSB 1YG2A 2UWMA 5AIQA 1E17A 1FBSA 1JXSA 2D1VA 1UMQA 1MBKA 3GFIA 1PUFA 4QIWN 1IW7F 1MBJA 3WU0A 3SDGA 1DGRM 3L2UA 3OYBA 4R1HA 2ZCWA 1Z0XA 2OD5A 3BROA 4XLFA 2VI6A 3D1NI 4XLAA 1VI0A 1RESA 1Y56A 2WBMA 1MD0A 5HS7A 4E7HA 2XRLA 4BS9A 3CJNA 3IRRA 1W4MA 4EJWA 1PUEE 3GTLJ 1O3QA 4NUBA 5J1UA 5K5QA 2VASA 1O7FA 1ETOA 4F92B 1I1SA 3CMEI 3DP7A 1S6LA 2Y69H 4HQMA 3D5SC 2JVGA 2B9SA 3H5AA 1OCRH
chains in the Genus database with same CATH topology
3G6EI 3J7ZI 2E34A 2E35A 2H8WA 1YJWI 1YHQI 4IOAF 2ZJRF 5GAEJ 3CCMI 5GAGJ 4IOCF 5JVGF 1VQ9I 3CCUI 4UY8I 1S72I 3I56I 5GAHJ 1YJ9I 1VQ5I 1VQOI 3CCSI 3G71I 3CMAI 2ZJPF 4V19K 3G4SI 3J7YJ 1VQ8I 1YIJI 2ZJQF 1YJNI 1VQ6I 1HC8A 1VQMI 1YITI 3CJQB 2QA4I 2OTJI 5GADJ 1VQKI 2QEXI 1YI2I 3PIOF 2FOWA 2K3FA 1QA6A 1VQ4I 3CCLI 1ACIA 3CCVI 1VQ7I 3PIPF 1VQLI 3CF5F 1FOXA 4IO9F 5DM7F 2JQ7A 3CCEI 3CJRB 3CJSB 5DM6F 1Y39A 3CC2I 3EGVB 3CC7I 1VQNI 2NXNB 1FOWA 3CD6I 3I55I 1FOYA 3CCRI 1VQPI 3CCJI 3CCQI 3DLLF 1MMSA 3CJTB 3CMEI 2OTLI 1WIBA 2E36A 3CC4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E I;  3J7Z I;  2E34 A;  2E35 A;  2H8W A;  1YJW I;  1YHQ I;  4IOA F;  2ZJR F;  5GAE J;  3CCM I;  5GAG J;  4IOC F;  5JVG F;  1VQ9 I;  3CCU I;  4UY8 I;  1S72 I;  3I56 I;  5GAH J;  1YJ9 I;  1VQ5 I;  1VQO I;  3CCS I;  3G71 I;  3CMA I;  2ZJP F;  4V19 K;  3G4S I;  3J7Y J;  1VQ8 I;  1YIJ I;  2ZJQ F;  1YJN I;  1VQ6 I;  1HC8 A;  1VQM I;  1YIT I;  3CJQ B;  2QA4 I;  2OTJ I;  5GAD J;  1VQK I;  2QEX I;  1YI2 I;  3PIO F;  2FOW A;  2K3F A;  1QA6 A;  1VQ4 I;  3CCL I;  1ACI A;  3CCV I;  1VQ7 I;  3PIP F;  1VQL I;  3CF5 F;  1FOX A;  4IO9 F;  5DM7 F;  2JQ7 A;  3CCE I;  3CJR B;  3CJS B;  5DM6 F;  1Y39 A;  3CC2 I;  3EGV B;  3CC7 I;  1VQN I;  2NXN B;  1FOW A;  3CD6 I;  3I55 I;  1FOY A;  3CCR I;  1VQP I;  3CCJ I;  3CCQ I;  3DLL F;  1MMS A;  3CJT B;  3CME I;  2OTL I;  1WIB A;  2E36 A;  3CC4 I; 
#chains in the Genus database with same CATH topology
 2OQR A;  4U88 A;  2DA5 A;  5FLX K;  1QZY A;  2TDX A;  3EUH C;  3E97 A;  1R1V A;  2ZJ2 A;  2YS9 A;  2HDW A;  3L2C A;  2LBF A;  1QHG A;  2DMQ A;  1IN6 A;  2OCE A;  5TGT A;  1WGX A;  2HDC A;  2VE8 A;  2DAO A;  3C3W A;  4MQV A;  4IXA A;  1VQ9 I;  2WAQ N;  4OWR B;  5FB2 A;  3OYK A;  5IPA A;  5D6F A;  2EFN A;  1FY7 A;  4CYC B;  1VND A;  1ZAR A;  1FYM A;  1S7O A;  1CF7 A;  3K2Z A;  2XSJ C;  3H3Z A;  1YJ9 I;  1FWZ A;  5EEH A;  2LF8 A;  5LGT A;  2DMT A;  1VQO I;  3E0J B;  4ZYD A;  2F4M B;  5FO5 A;  5DD8 A;  3GTM J;  1S29 A;  3SZG A;  3W2W A;  1B72 B;  2CW7 A;  2JMW A;  2CV2 A;  1W7P A;  4F93 B;  2LR8 A;  3HGG A;  5K7F A;  3L00 A;  2WB1 A;  4ZTF A;  3K4N A;  3ZMD A;  2VPR A;  2V9P A;  3QU3 A;  4XKV A;  3OSF A;  1WPK A;  4UUS A;  4PCQ A;  1MSE C;  4BE1 A;  2H94 A;  2ZXH A;  2HQN A;  2PI0 A;  4PSX A;  3UNG C;  2VPL A;  3HRT A;  2DA3 A;  3CMM A;  1WJF A;  2VL8 A;  1DU0 A;  1Z6T A;  3BG7 A;  1R4M B;  1OCO H;  2K3F A;  2ZNY A;  3IH3 A;  3M9A A;  1VQ4 I;  1GVD A;  2FNA A;  3DKX A;  2EV5 A;  1W1W E;  3R60 A;  1WSU A;  2COM A;  2KIF A;  3GTK J;  1S8N A;  2FML A;  2HU9 A;  4K2E A;  5BPD A;  5DM7 F;  1HST A;  3KX2 A;  2H09 A;  5J8F A;  4G94 A;  2HXO A;  2GA2 A;  2JWT A;  5CVU A;  2FJ1 A;  3BTI A;  3OR1 C;  3OMY A;  2VXZ A;  2CQ7 A;  2AQE A;  4M3E A;  1T56 A;  2PMH A;  5EF6 A;  4IHY A;  3SXY A;  5M5Y J;  3MZ8 A;  3CO7 C;  1JKQ C;  2L7M P;  1ETK A;  1HLV A;  1F9N A;  2AQF A;  1B8I A;  2YSR A;  3BG6 A;  3CD6 I;  2E7X A;  4A93 J;  2R7S A;  4PJM A;  2VUM J;  5KHD A;  2MLK A;  1ZLK A;  2DJN A;  3G73 A;  4M3B A;  3SEZ A;  1X4O A;  4XOR A;  5J3L A;  6PAX A;  2MD0 A;  4M72 A;  3HZJ A;  4ZYG A;  2BY1 A;  2TCT A;  4HEA 2;  2DN0 A;  2WY7 Q;  2CWE A;  2XF7 A;  4JBA A;  4V2G A;  4KIF A;  2DT7 B;  4Y4R A;  2A3S A;  1FIP A;  4FX4 A;  3JAM Z;  2HOE A;  3FKJ A;  3TO9 A;  2IJL A;  3I58 A;  4HX8 A;  2HXI A;  4ABZ A;  4HLX A;  1YJW I;  2Q2E A;  1ORK A;  3BR0 A;  2DK5 A;  4C2M J;  4M73 A;  5FD5 A;  3RCO A;  5LGN A;  5CJ9 A;  2EIJ H;  4CIC A;  5ERI A;  3GO5 A;  2WA0 A;  2YX7 A;  2VKV A;  3CP8 A;  2R7X A;  2CUE A;  4A3K J;  4HF1 A;  1RI7 A;  4P96 A;  2ICW G;  1BI0 A;  3I56 I;  2NVQ J;  1S7E A;  5EEA A;  3MKZ A;  3KYL A;  1WI9 A;  5TRD A;  5D5U B;  3BG9 A;  3JRE A;  1BIB A;  5FFX A;  3T8R A;  2D45 A;  3HRU A;  1FTT A;  2ZB9 A;  5HS9 A;  1UFM A;  3KP2 A;  4MO7 A;  3F8C A;  1F5T A;  4BUP A;  4N4N B;  1HXD A;  4MEY F;  4U7D A;  3S8P A;  3RQI A;  5IT9 K;  2K9M A;  3K69 A;  4P5O A;  2P0W A;  4C30 A;  1XSD A;  4NQW B;  4RB1 A;  2Z3Y A;  4ZDL A;  4AM3 A;  4LMY A;  1F1Z A;  3S93 A;  3ZMT A;  1UHS A;  2HTS A;  3ERM A;  1VFC A;  3CF2 A;  3DPU A;  1PP7 U;  4FIS A;  4LIU A;  1SVO A;  2EBI A;  4M9Z A;  3GYH X;  2NS7 A;  1KU9 A;  2W25 A;  1TW2 A;  2EIL H;  1XC5 A;  4IKF A;  3BG3 A;  5HNH A;  3BJA A;  2P4W A;  1FOX A;  3I5U A;  2EA2 A;  4WXC A;  3W2A A;  4N0B A;  3RZO J;  1WWX A;  2F5E A;  1MNM C;  3DQV C;  2VBZ A;  5CVV A;  1B59 A;  2HKO A;  4I6Z A;  2OPT A;  2KDO A;  2L9N A;  2QSF X;  5E18 F;  4A3E J;  4ZDO A;  5F1R A;  5JLX A;  3K70 D;  4PFO A;  2L9R A;  1Z21 A;  2FMY A;  3C1D A;  4UHT A;  1BN5 A;  4ENJ A;  2NOG A;  1BIA A;  2LVS A;  1IRG A;  3A01 B;  4II2 A;  2VC0 A;  3IUO A;  3WTV C;  2K86 A;  1K83 J;  2H1K A;  1ZYR F;  2M8E A;  1UAA A;  4B1R A;  1BOA A;  1K6Y A;  3G2B A;  5IP9 J;  3CCR I;  2GBY A;  4YII A;  2UUZ A;  2XAG A;  2VT3 A;  2CV0 A;  4BXF A;  1BBY A;  1JHH A;  4NDL A;  3M8J A;  3JRF A;  5J47 A;  1JUS A;  3P9C A;  3GME A;  4PK4 A;  5GP9 A;  2XSD C;  1MBH A;  4HV6 A;  4GO1 A;  4HX4 A;  4CYC A;  1AOY A;  2OA4 A;  2DO7 A;  4MEX F;  2K27 A;  4G7H F;  1XD7 A;  1BW5 A;  1R58 A;  4ZYA A;  2KIU A;  2DFF A;  3F3X A;  5CKT A;  1A35 A;  4G12 A;  2P6S A;  5GAG J;  5E79 C;  4RDU A;  1B72 A;  1V55 H;  5FKM A;  5DS9 A;  2KPM A;  1FOK A;  1FLI A;  3VB2 A;  4L5E A;  5LFA A;  3OYA A;  2HFH A;  5IP7 J;  2IGK A;  2EFW A;  1UHW A;  1A36 A;  4IF4 A;  5FGM A;  5GAH J;  4ESF A;  5F1J A;  3MKW B;  2IGN A;  2VKH A;  2K40 A;  3WE2 A;  4C3I J;  1QVT A;  2ZJQ F;  3A1Y A;  2GAU A;  1LFB A;  2RDP A;  2BW3 B;  5BOX A;  1LB2 A;  1PJR A;  4PJL A;  1TQM A;  3CO6 C;  1Z3Y A;  4M9X A;  5HLG A;  4WWC A;  2K9L A;  4OIN F;  3EUH A;  2IAI A;  4OAZ A;  2L3D A;  1REP C;  1HCR A;  3D5R C;  2XIG A;  5B1B H;  3GTP J;  5F64 A;  1QA6 A;  2EFQ A;  3BTC A;  4S05 A;  1XGM A;  1D1A A;  1P4W A;  4B48 A;  3OOU A;  2R7T A;  2KRH A;  4G6T B;  5M3M J;  2R3S A;  4RAY A;  3VWB A;  1O4X A;  4NHJ A;  1ON1 A;  4DBQ A;  1I27 A;  2DQR A;  4AVP A;  4IHV A;  3A4C A;  1Y39 A;  3EGV B;  3KLN A;  4L9T A;  3WTY C;  1G59 A;  3CES A;  4KMU X;  2E5N A;  1IN4 A;  2IBD A;  3V8J A;  4ON0 A;  2HYF A;  4JK1 X;  3BOQ A;  2HVR A;  1D1B A;  2XUB A;  3CMY A;  5CPR B;  1YYV A;  4BHB A;  2P7C B;  2PLY A;  5EDN A;  2GOM A;  2R5Z B;  2ESH A;  3IAM 2;  1LDK B;  3IC7 A;  2JUC A;  3Q3S A;  3JCU C;  1D0Z A;  1TL8 A;  5HLI A;  2D5V A;  1KQ8 A;  2KIM A;  4L18 B;  4PFP A;  3LSP A;  1E0E A;  1K61 A;  4HAM A;  3S2D J;  3L2Q A;  2A07 F;  5F0C A;  3V8K A;  3QRF F;  4OIO F;  4A3C J;  2DT5 A;  2FUG 2;  2MG4 A;  4CCO A;  2CUJ A;  1XMA A;  3MEX A;  1D1C A;  1ZQ3 P;  5JVT A;  2V9K A;  3JRC A;  4O5V A;  2JZY A;  4ENK A;  1P4X A;  2A68 F;  4XLN F;  4ZDP A;  5JI6 A;  3RPU A;  1BC7 C;  2DQL A;  2JSC A;  2XAQ A;  3CCU I;  2R92 J;  4QSH A;  2BVM A;  4WF2 A;  2BOL A;  4UY8 I;  4NQW A;  1L0O C;  1R23 A;  4E7J A;  1U2W A;  1PVE A;  3O8G A;  2OUM A;  3BQZ A;  2RNG A;  2DLL A;  1R71 A;  3IWF A;  4F3Q A;  5J40 A;  5BS6 A;  4A0Z A;  1KON A;  1XN7 A;  2XAJ A;  3TKY A;  1NG7 A;  4V19 K;  1LQ1 A;  3F8N A;  3P9I A;  4U0Y A;  3PL8 A;  1LUJ B;  1VQ8 I;  2F5D A;  3HKZ A;  3T8T A;  2IS1 A;  1Z91 A;  4YIF A;  1CQT A;  2OZU A;  1Y0U A;  3KEY A;  2NRA C;  2E1N A;  1ETY A;  1IF1 A;  3Q0V A;  5DTD A;  2Y75 A;  3A03 A;  3HOX J;  4EGZ A;  2DMU A;  5F04 A;  4M6X A;  1YX3 A;  1SFK A;  4RGU A;  4XL9 A;  2ELH A;  4UNO A;  2RV8 A;  2V7F A;  3OY9 A;  1WJA A;  2KDZ A;  3NQO A;  4HX7 A;  1R36 A;  4UVA A;  2STT A;  1IXC A;  1ZN2 A;  2VN2 A;  3MFK A;  1X3U A;  3JSP A;  2L7F P;  5EJC A;  4DNC A;  5J6X A;  1HF0 A;  2RN7 A;  2CW0 F;  3OS2 A;  3ZP5 A;  5FKN A;  1R7J A;  3A01 A;  2ZSH B;  3FXK A;  1F4K A;  1U9O A;  1Y1V J;  2OJE D;  2X9D A;  1ZRE A;  3CC2 I;  2BE5 F;  3EPZ A;  3HSF A;  2ACJ A;  1FMV A;  1MND A;  1G2H A;  3WHB A;  1UST A;  3M3Y J;  3GUD A;  1SVL A;  2L54 A;  3QYE A;  4IVN A;  1W7P B;  4XQF A;  1X1P A;  3OYC A;  3OWT A;  2WV0 A;  1S9H A;  1JKR C;  4YEL A;  3S3M A;  1FOY A;  2MFZ A;  3OV8 A;  3GTO J;  4W1U A;  4M9S A;  4UUS B;  1ZGA A;  1JT6 A;  4PUS A;  4NC6 A;  2HOT A;  4XNF A;  2LFB A;  3KP5 A;  3RKX A;  4GYI A;  3SJM A;  4XK4 A;  1W0T A;  4EJT A;  2EQR A;  3J7A Y;  1MMS A;  4C3J J;  2ZKZ A;  1DPR A;  3GZN B;  1PDN C;  3HDD A;  5E17 F;  2CGP A;  2F48 A;  4IRI A;  2F5F A;  3EQL F;  2VE9 A;  4YEJ A;  4N9H A;  1ZR4 A;  1OYY A;  3OR2 C;  2A61 A;  1YO5 C;  3LSM A;  1S3J A;  3RYR A;  4OAY A;  2CV1 A;  3RQ4 A;  1IXS B;  2E71 A;  1N25 A;  4EAT A;  5JVG F;  1I5Z A;  3WOD F;  3FXL A;  3HHG A;  1R9T J;  1R49 A;  2HVQ A;  3FXR A;  3BTL A;  2BW3 A;  2OV7 A;  1G3W A;  3KPH A;  3H5R A;  1AU7 A;  2HEO A;  1MZB A;  1G4D A;  2LYC A;  2H8R A;  4UUT A;  3E3V A;  1J5Y A;  2EB7 A;  4RBO A;  3QPH A;  2BYV E;  3A02 A;  4LB6 B;  4NB5 A;  3FXQ A;  5C44 J;  4JOM A;  3K4B A;  1Z1D A;  1JT0 A;  2FSW A;  4UVB A;  1LFU P;  3FHZ A;  1MBG A;  4JX6 A;  3ZMZ A;  4LJZ F;  3QQA A;  2R0Q C;  1W5C C;  3CLO A;  1ONV A;  3MZY A;  2OTJ I;  2CS3 A;  3H92 A;  1MW7 A;  5JFR A;  1WH7 A;  1XGN A;  3OIQ A;  4QTR A;  1XG1 A;  1U6G A;  2Y0S A;  2KMU A;  3KP4 A;  3BC8 A;  2L7Z A;  2AXL A;  2EIK H;  1JJ8 C;  2M87 A;  2P7V B;  4JQF A;  1POG A;  1YS6 A;  3RPQ A;  2JK3 A;  3LNQ A;  4CHU A;  1JJ6 C;  5IY5 H;  2L4A A;  2HS5 A;  3I4N J;  2R5Z A;  2K9Q A;  3GZ6 A;  2LRE A;  2JSP A;  4N4O B;  5FJ8 J;  1GLN A;  2M45 A;  3LOC A;  2Y2Z A;  1YRN B;  2Z9O A;  1OLT A;  2JT1 A;  2Z5U A;  2IVM A;  2VJ4 A;  4CGZ A;  5D5X B;  3TW6 A;  3UKG A;  5B3S H;  1WVR A;  1VQN I;  5EYR A;  1W36 C;  1TNS A;  2NAZ A;  4II3 A;  5A2Q K;  3CP2 A;  2QUF A;  3DV8 A;  1WFX A;  1W0U A;  4HA8 A;  1HKS A;  4U7B A;  1QPI A;  4EM1 A;  4BDY A;  1J9I A;  4ZZL A;  2FXA A;  4UVC A;  2IGO A;  3L2W A;  5EG0 B;  3O6B B;  4IHX A;  2QVO A;  1TBX A;  4S0H B;  2CUF A;  1XMX A;  5KAF C;  2V6E A;  2LY2 A;  1ERD A;  3OYD A;  2CW8 A;  3C7J A;  5FRO A;  2BV6 A;  3LA2 A;  3W6J B;  4KUM A;  1U5T C;  4F7Z A;  2BHZ A;  1FBU A;  5IYB J;  2W24 A;  3ZGK A;  1S5L C;  4P1W A;  2NNN A;  5H6R A;  2HQA A;  2YR2 A;  2LKS A;  1V54 H;  2VJ5 A;  3JW4 A;  1XB4 A;  4EVI A;  5L3F A;  2KL4 A;  1OCC H;  2DA7 A;  3PO2 J;  2KIQ A;  1RC9 A;  4DW6 A;  1P2F A;  3KP6 A;  1X2N A;  3FXU A;  1QPM A;  1FNN A;  2DK8 A;  1J59 A;  2W48 A;  3HJE A;  2M3A A;  3WU2 C;  5B5E C;  4XID A;  4KA4 A;  4I2O A;  3JSO A;  4ZZD A;  2DPU A;  5EZG A;  3K9T A;  1U8R A;  1GVJ A;  1MBF A;  2OAZ A;  4XM3 A;  3J81 Z;  2VC1 A;  3HUG B;  4FE4 A;  3TP3 A;  2HR3 A;  2V26 A;  1QQI A;  1RKT A;  2W85 A;  4FT8 A;  3O3K A;  3M07 A;  2FRH A;  4JX5 A;  3CDI A;  3CJQ B;  3E6B A;  4M3D A;  1XS9 A;  4DJA A;  1KQ0 A;  3B6C A;  1A04 A;  3HL2 A;  2STW A;  1V4R A;  2BVL A;  4RS8 A;  2FOW A;  1XCB A;  3S3O A;  4D5C A;  2M5W A;  2LSO A;  4EM0 B;  3GW2 A;  4P9U A;  2DJI A;  2X1D A;  5D5W B;  2DFH A;  4GCV A;  1STZ A;  5LHG A;  4KN4 X;  3HOS A;  4BQN A;  2CFX A;  1GXQ A;  4F55 A;  3SFZ A;  1MJA A;  3HSE A;  2O3F A;  4XSX F;  3CF5 F;  3Q5F A;  4IO9 F;  4HNU A;  3SQN A;  4MIM A;  2OQG A;  1J0R A;  2ECB A;  2IEK A;  3DLA A;  3H9Q A;  3OYJ A;  1FJL A;  3C18 A;  3KYC B;  3QPS A;  1C0W A;  3FMS A;  1H9T A;  2BY0 A;  4PZJ A;  1BI3 A;  4HNT A;  3S15 J;  1I3A A;  1LDD A;  5E3M A;  2F2E A;  1EKE A;  5F0H A;  1I6X A;  3TDZ C;  3GX4 X;  2Y9Y A;  4H4K C;  3RDI A;  3O8H A;  1E3O C;  3LWF A;  3A2K A;  1V5F A;  1WJE A;  3KIO A;  3SDB A;  4AWX B;  3MAJ A;  4B3A A;  3LSJ A;  3ML6 A;  3BR6 A;  3TO6 A;  1B6A A;  3DLL F;  1SD4 A;  1MSF C;  1XTA A;  3MVP A;  2FQ4 A;  2X85 A;  2XAS A;  2WWY A;  1KU7 A;  2P5V A;  2JRM A;  5HLT A;  1GUU A;  4PSW A;  1K78 A;  2LG4 A;  2OTL I;  2HPM A;  4L9N A;  4LG3 A;  2G9W A;  1JKP C;  2DMN A;  3S32 A;  1OJL A;  2YUS A;  1F36 A;  3R4K A;  4KIS A;  2DA4 A;  3QPL A;  3HIF A;  3U2R A;  1TQP A;  4RA2 A;  2LKP A;  2M4G A;  1BI2 A;  3AL0 C;  3FF5 A;  5FD6 A;  1O3S A;  4IOC F;  3V42 A;  3GTQ J;  2K7L A;  1ON2 A;  2ME0 A;  1B4A A;  1FP2 A;  1ZLJ A;  4PGG A;  3I4M J;  3V7R A;  2O03 A;  2V79 A;  2Z33 A;  4RB0 A;  4L0Z B;  3DCF A;  5L3E A;  4CCM A;  1TT5 B;  2JPC A;  5E3N A;  3LMM A;  3P5J A;  5L3G A;  3ZN0 A;  3WTT C;  4A3M J;  4BNC A;  2P5K A;  4ZYH A;  4CCK A;  3CUQ C;  5H2F C;  1I1G A;  2ZJP F;  2WV1 A;  3HKZ N;  2KP6 A;  2WTE A;  2D2W A;  4LG0 B;  4UB6 C;  3O2P E;  5ICE A;  1D5V A;  3AG1 H;  2LP0 A;  2JN6 A;  2K4B A;  1GHC A;  2DOE A;  2QA4 I;  2ZFW A;  4EGY A;  2FQ3 A;  4B43 A;  4MGR A;  1VQK I;  1RPW A;  4B44 A;  3PIO F;  2Y9Z A;  1A6I A;  1GV5 A;  3GTG J;  3U21 A;  1YRN A;  4XKB A;  3FK7 A;  2K85 A;  2X6W A;  3Q0W A;  3TED A;  1P9Q C;  2Z99 A;  1ACI A;  5E20 A;  3LFK A;  3PIP F;  1ZTR A;  3J80 Z;  3F9K A;  2VON A;  5DV5 A;  1YOV B;  1XMK A;  2NYX A;  3IAS 2;  3OL4 A;  5FFZ A;  4B4C A;  2CU7 A;  3RSN A;  3K4C A;  4C2T A;  2W00 A;  1FT9 A;  2WAF A;  1BI1 A;  3LFU A;  1KZH A;  2M30 A;  2QBY B;  4XN3 A;  1OPC A;  1MMN A;  3OL3 A;  2IA2 A;  3DEE A;  2O61 A;  5C4X J;  3ZQI A;  1R5G A;  4RM2 A;  4ETS A;  3MKY B;  3KE2 A;  3FWE A;  3DKY A;  5EG0 A;  3WTW C;  4XRM A;  1T2K A;  1AKH B;  5H20 A;  1UG0 A;  1SFX A;  2PN6 A;  4UB8 C;  1DQU A;  4LOC A;  4Y52 J;  2EZK A;  2JA5 J;  3FMQ A;  4R79 A;  3S14 J;  1YW8 A;  2HTJ A;  2IS6 A;  1QRY A;  4M6V A;  3OOP A;  1D8J A;  3CUQ B;  3MWM A;  1IV6 A;  3ISP A;  4A3F J;  2W1O A;  4IRG A;  3HRS A;  2PBI A;  2RGV A;  2QSG X;  2FBH A;  2GOX B;  3VFZ A;  1FBQ A;  3BPX A;  1HKQ A;  2EZL A;  2R5Y B;  3IL2 A;  2AHQ A;  2MD5 A;  3H9J A;  1W7P D;  2VBW A;  4M3F A;  3QOP A;  4G7O F;  1QBJ A;  2E34 A;  2X48 A;  3JRI A;  1ZG3 A;  3DFG A;  1T39 A;  2VOO A;  2DPD A;  1IN7 A;  3CCM I;  4IHT A;  3BR3 A;  2LOO A;  1JI8 A;  2L9V A;  1EH8 A;  1GXP A;  3E6D A;  3H9G A;  4RGX A;  3DBH B;  4QWQ A;  4HW0 A;  1O57 A;  4YRV A;  3HUG A;  1TW3 A;  4MLO A;  3KP7 A;  1UCR A;  1ENH A;  5H6Q A;  3LAJ A;  2PFB A;  1YQA A;  3BZC A;  2KT0 A;  3LL7 A;  2XGE A;  4PJ0 C;  2E7W A;  3ZPL A;  1BA5 A;  3D5L A;  3ZQG A;  2EPF A;  4DYQ A;  1MDM A;  3KZI C;  1KU2 A;  1RZ4 A;  2O6G E;  3CZ6 A;  1LEB A;  2M4K A;  2DTZ A;  3BJ6 A;  3DEU A;  3HYI A;  3ZQH A;  2DA1 A;  4HG2 A;  5CLS A;  1T0F C;  3DU5 A;  2AO9 A;  2IPQ X;  4IJA A;  2K5C A;  3RKQ A;  4HBL A;  2H1L A;  3FZV A;  4Y33 A;  4HDV A;  2QQB A;  4IPA A;  3R0A A;  4B8X A;  4Q47 A;  1EH7 A;  1TWA J;  1GT0 C;  1GV2 A;  5IP6 A;  2FE3 A;  5JR3 A;  1KU3 A;  1RUO A;  3FIW A;  3ROU A;  5L3B A;  1OCT C;  4O6J A;  1V3F A;  1YI2 I;  4J00 A;  2Y0S N;  4BU2 A;  1U0J A;  1Z7U A;  1TTY A;  5E1W A;  4CCL A;  1DDN A;  1MIJ A;  3TL4 X;  1DP3 A;  2A69 F;  3DBR B;  4XRS A;  3CCV I;  1I6H J;  2L01 A;  1WRJ A;  2LTP A;  3BZ6 A;  2DOF A;  2BXY A;  1ETV A;  1P92 A;  3MKL A;  3SYT A;  3VYT B;  2P6T A;  3KZZ A;  1N77 A;  2XV4 S;  2BEO A;  4B3X A;  2JQ7 A;  5BNG A;  2HNH A;  1J7K A;  2R7O A;  3IP4 B;  1LPQ A;  3EYI A;  4HNV A;  2HPI A;  4DGW B;  2E5Z A;  4LGW A;  2I10 A;  1TWG J;  2JRT A;  2XB0 X;  2QZ8 A;  1RET A;  2C6Y A;  1HSJ A;  3E5U A;  3M4O J;  1H0M A;  2QSH X;  1IUY A;  1IGN A;  1SFU A;  4D7N A;  1QGP A;  2M9H A;  2FEZ A;  3QYB A;  2VQG A;  5IOY A;  5ILU A;  2XHK A;  1ZK8 A;  3V7S A;  4ZYE A;  1K4T A;  2F5C A;  2QCO A;  4X6A J;  3PO3 J;  1YLF A;  3QWL A;  4KJZ A;  1NK3 P;  1LDJ A;  2XAF A;  4EEF G;  4TV7 A;  4F91 B;  4RLF A;  1G6N A;  1JUP A;  3CTA A;  2RNJ A;  2V1U A;  5E3L A;  3BCB A;  3ZCO A;  1FC3 A;  4Q5S F;  3BR2 A;  2EWN A;  2DYS H;  3JTG A;  2QLZ A;  1WQ2 A;  4HOB A;  1T38 A;  1SFO J;  4IL6 C;  3JRH A;  2KRF A;  1OCZ H;  4IOA F;  2XVC A;  1LVA A;  1ZG1 A;  4JYK A;  3JRB A;  3K1M A;  4ZTJ A;  3S17 J;  2A6T A;  3GFJ A;  3K1P A;  5CVI A;  3DTK A;  2P81 A;  4AIK A;  3WGI A;  3EYY A;  2KFD A;  2GM4 A;  4LG0 A;  3LQR A;  4BJT A;  1SC7 A;  3ZN1 A;  2ME6 A;  3I64 A;  1KGS A;  5E8G A;  3L09 A;  3BG5 A;  1X4P A;  4IQ4 A;  3JAM K;  5KNL A;  5M5W J;  2NVT J;  3F8F A;  4KYW A;  4YFN F;  1FSH A;  4UUV A;  3I3L A;  3L2R A;  4LD5 A;  1RKW A;  1EV7 A;  4HF2 A;  2OC6 A;  5C3E J;  3Q9S A;  2X0L A;  3J7Y J;  3G1M A;  5FLV A;  2GLO A;  1ZAO A;  4I98 B;  1BR4 A;  4G6Q A;  1IO2 A;  3GVA A;  1FYL A;  4PJN A;  1H9G A;  2HOA A;  2QBY A;  1A5J A;  2E2H J;  2DU9 A;  2RVC A;  2HOS A;  4XKW A;  4KIG A;  3KEQ A;  4I0B A;  5CYV A;  1R5H A;  3HG9 A;  3TGN A;  4FAS D;  3FBI B;  2IRF G;  4DOZ A;  2AS5 F;  1XX5 A;  1RUN A;  2CJJ A;  3I54 A;  2O8K A;  4MFE A;  3CCL I;  1QZZ A;  1YW9 A;  3H5N A;  3N97 A;  1AKH A;  2H6C A;  1IDZ A;  1ZR2 A;  4IRH A;  2XRO A;  3N4M A;  1LNW A;  3KEO A;  4XON A;  1TNT A;  1H8A C;  2RAE A;  3JRD A;  2XGX A;  3F8M A;  3CUQ A;  3GFL A;  3FDY A;  3ZMU A;  1H89 C;  4A3I J;  2COB A;  2OF7 A;  1Y8R B;  3P7N A;  3K70 C;  1EF4 A;  3FXO A;  2R5Y A;  2K3P A;  2V9V A;  3ZXS A;  4E70 A;  3IWZ A;  2JA8 J;  3TP0 A;  1E3H A;  2EZI A;  4BHP A;  3KYD B;  2UXN A;  9ANT A;  4CO8 A;  5FLX Z;  1Z7L A;  4RGR A;  4DYC A;  4KIT B;  3KET A;  3IHU A;  2XC7 A;  3HOY J;  4BBS J;  2PQ8 A;  4Y15 A;  2ZC2 A;  2ZFU A;  1OIS A;  3GBG A;  3NAU A;  2X1E A;  3AG2 H;  1G3S A;  2OU2 A;  1OR7 C;  2O5R A;  1X58 A;  1DU6 A;  4LLG F;  1APL C;  3P9K A;  1BR2 A;  2BZT A;  3GTJ J;  1U78 A;  1LE8 B;  5GPC A;  2NVY J;  1X1D A;  5ILV A;  3EDP A;  4XLH A;  4P55 A;  3IH2 A;  4A6D A;  1VF9 A;  5J1Y A;  5E1X A;  4B47 A;  4IQJ A;  1YFH A;  1IAW A;  1LEA A;  1XGS A;  5EZH A;  2GQQ A;  4GYG A;  1JGS A;  1A31 A;  4NNJ A;  3ULQ B;  4D7M A;  5HS8 A;  3I9V 2;  4IX7 A;  3HHH A;  4LB5 A;  2CQN A;  2FBI A;  2A05 A;  2X4H A;  3GCM A;  2CQK A;  4AIH A;  4AU7 A;  3G1L A;  3DF8 A;  3BCA A;  4A0Y A;  3T0Y A;  4ANJ A;  3LSH A;  4BAY A;  3TO7 A;  2YU3 A;  3HXL A;  1OMI A;  1J2X A;  1R22 A;  1K6O A;  1BL0 A;  4KDP A;  3TMO A;  4IEJ A;  3PM1 A;  3FKI J;  3Q0U A;  2RQP A;  2DTR A;  3JR9 A;  5GTI C;  3G4S I;  5BPI A;  4D5F A;  2LNB A;  1YJN I;  2FF4 A;  4M6Y A;  4E7I A;  3MMY B;  1JTY A;  3HM5 A;  3R61 A;  2EA4 A;  2G0E A;  4BKX A;  1YIT I;  1K78 B;  2F4I A;  3AFH A;  3WTZ A;  3JRA A;  1Z77 A;  2R7D A;  5B1A H;  4N9I A;  3S2H J;  1SMT A;  1Y0N A;  1WH5 A;  2XKP A;  1SAX A;  2J5P A;  1DUX C;  2V1D A;  1YX5 A;  4OOI A;  5F0F A;  2L4M A;  4U0W A;  3KLO A;  1T95 A;  4A5N A;  2E60 A;  1VQL I;  4OMZ A;  1W5T A;  3WG9 A;  1JTX A;  2JJ7 A;  5D4R A;  3CCY A;  1N78 A;  3KP3 A;  1Z67 A;  4DIQ A;  1H88 C;  3I4P A;  2DW4 A;  3FHN A;  4ITV A;  2M2E A;  1HQC A;  3CJR B;  3L9F A;  1USS A;  1J09 A;  1MMD A;  2XPU A;  3TOA A;  1ULY A;  2HKX A;  2MSY A;  3WTX C;  4EJO A;  3FM5 A;  1EA3 A;  3W2V A;  2X1C A;  4EV0 A;  1T0F A;  1EJ9 A;  3RPU D;  3RZD J;  1HA8 A;  1FX7 A;  2KJB A;  5K5O A;  3HBL A;  1FOW A;  1QO0 D;  5KVR A;  2R7R A;  1ZRC A;  5LRR A;  1FEX A;  3K4L A;  2F4O B;  1P4A A;  2R4G A;  1FP1 D;  3G1O A;  4HST A;  2KQR A;  3TW7 A;  3W6V A;  4L9J A;  2GIZ A;  1TLH B;  1MNE A;  2DDB A;  3F6O A;  3COA C;  5GPA A;  1EH6 A;  1R5I D;  2IGM A;  2JA2 A;  4XR6 A;  3E5X A;  1Z9C A;  2JVH A;  1FYK A;  3NRV A;  2QKL B;  2E36 A;  2DCE A;  2JPB A;  2NNY A;  3CC4 I;  3G6E I;  4BEH A;  2PX9 A;  3LA7 A;  2AXT C;  2LRD A;  4LK0 F;  4A3G J;  3GWZ A;  1BC8 C;  2ZJR F;  3CDH A;  2DYR H;  2DFE A;  1X3W B;  3WE3 A;  4FQG A;  1YW7 A;  1RIO H;  4G7Z F;  2UZK A;  1D0X A;  4OIP F;  1FTZ A;  3BR5 A;  5HVQ C;  3ZQC A;  3F22 A;  5IT9 Z;  4RMN A;  1Z6R A;  3IKV A;  5CQE A;  4AYB A;  4LLL A;  3H0G J;  3LQQ A;  3ZOB A;  5BMZ A;  2VQC A;  4XOP A;  3AAF A;  3BPV A;  5E8I A;  2WAE A;  4BY7 J;  4WK8 F;  4Y13 A;  2W84 A;  3EUA A;  4WXH A;  1S72 I;  2LH9 A;  1Z3X A;  2IW5 A;  1SEU A;  3IV5 A;  1IRF A;  2MH2 A;  1Q1H A;  4PJJ A;  4KNY A;  3C2G A;  3WG7 H;  3FX3 A;  2LLK A;  3OIO A;  4MFD A;  2E1C A;  3ASO H;  1NTC A;  3CLQ A;  3CCS I;  5DUK A;  2VXD A;  4DZP A;  3VSK A;  2M7B A;  4NC7 A;  1XPX A;  2GIV A;  3E6M A;  3K4K A;  3ABM H;  3OYF A;  3OYE A;  5DUI A;  1FPQ A;  2V1N A;  4D0P A;  1VQ6 I;  1HC8 A;  1NH3 A;  2L2O A;  1HOM A;  1WHU A;  5D6E A;  2HQ5 A;  1HDD C;  2XAH A;  3VSL A;  2HDD A;  1MMA A;  2UV1 A;  4XRF A;  1IN5 A;  2KJC A;  3GLX A;  3QOD A;  4XLE A;  2VB6 A;  1MJ9 A;  3ZQL A;  5J4V A;  4U0V A;  3ZQ7 A;  4BDZ A;  4OIQ F;  4B09 A;  2L0K A;  2Q0O A;  2CSO A;  2R7F A;  2ZXI A;  4MQ9 F;  5KAI C;  1WJC A;  3WGG A;  5J4Y A;  4FE7 A;  1AA7 A;  2W57 A;  2XAU A;  5LRS A;  1TC3 C;  5HDG A;  4GFB A;  1IDY A;  2LC2 A;  3U1D A;  2MBF A;  5HDK A;  2GXG A;  1G3T A;  3F0C A;  3CJS B;  3WTU C;  3H3V K;  5L3D A;  3ASN H;  2LDU A;  3DTE A;  1FZP B;  4S04 A;  5DEQ A;  3TQN A;  1XSV A;  2K4J A;  3QOE A;  1MDM B;  1R00 A;  3FM3 A;  3CDL A;  2QF7 A;  2YU9 J;  4MTE A;  1G8X A;  3KZY A;  3H1C A;  4KIB A;  1JHF A;  3R0J A;  5ICF A;  4WX9 A;  4FTH A;  1GDT A;  1LE8 A;  2GZW A;  4A5M A;  1N75 A;  2X6Y A;  1U5T B;  4BYY A;  1SFE A;  2E1O A;  4I99 C;  1QVU A;  3KFW X;  5KCM A;  2FU4 A;  2Y31 A;  4YFK F;  1DGW Y;  3MN2 A;  2WAD A;  4ENN A;  3PNT A;  1ZH5 A;  1CGP A;  1QU3 A;  2HI3 A;  2F5V A;  3V4G A;  3HOU J;  3GF2 A;  2VQL A;  3ZRG A;  3EET A;  2FX0 A;  2LK2 A;  5K7Z A;  2DI3 A;  5JHU A;  4ASN A;  2I8D A;  2BHY A;  4KT5 C;  3IKT A;  2DT6 A;  1XGO A;  3ABL H;  2QQ8 A;  4OIR F;  1P7J A;  2Z16 A;  4MHG A;  3F72 A;  2E35 A;  2PG4 A;  1ZG5 A;  2H8W A;  3BT9 A;  2K02 A;  4BXX J;  2NOJ B;  1SD6 A;  1BJA A;  2WC2 A;  3F8B A;  3BP8 A;  4E7S A;  1MJB A;  2ZSI B;  5GAE J;  1AHD P;  4A3B J;  5EGO B;  2I5U A;  3SFI A;  5DYM A;  4C2U A;  2CG4 A;  2DDA A;  4CYD A;  1RR7 A;  2VQH A;  1DPU A;  4QPQ A;  2V1X A;  5LBQ A;  3AG3 H;  2NS0 A;  1Y8Q B;  1IJW C;  1A6Q A;  4KMF A;  2LMD A;  5LD2 C;  2HQR A;  2QM3 A;  1ZGJ A;  5D8K B;  4CCN A;  4X0G A;  4CUG A;  5E1Z B;  4PGH A;  3ABU A;  1PP8 F;  5AON A;  3H36 A;  2O7O A;  3CMA I;  2L7K A;  4ZH4 F;  2R7Q A;  1SAN A;  4A6E A;  3ZMV A;  1OR7 A;  1HW1 A;  3ECO A;  4BXU A;  1X2M A;  1K79 A;  2XRN A;  1ETX A;  3PFI A;  3PSI A;  2EK5 A;  3QP5 A;  5AIP A;  3MQ0 A;  2KRC A;  2N8G A;  4UXN A;  3IRQ A;  1HW5 A;  2DBB A;  2JTV A;  1KYZ A;  5L3C A;  4XN0 A;  2B63 J;  2MW8 A;  2FD5 A;  2CQX A;  2ZME C;  4RM3 A;  1UJ8 A;  2LF7 A;  2CFO A;  2L5Q A;  2KKO A;  1XCV A;  2YX4 A;  2EIM H;  3K10 A;  2Q8K A;  2KZG A;  3M8F A;  3HTS B;  4HF0 A;  3GXO A;  3W6K B;  4A0X A;  3I59 B;  5FKK A;  4FHT A;  2Q1Z B;  3DBL B;  4G8X A;  1HBX G;  4O3M A;  2DMP A;  2RKH A;  4CZC A;  4BE2 A;  1UB9 A;  2XB5 A;  1AWC A;  1IUF A;  3QAH A;  1M1E B;  1X19 A;  2ETH A;  4Y3O A;  1G3Y A;  1ZKG A;  2ZXJ A;  1IZ1 A;  2QQA A;  5GTH C;  5DM6 F;  4H0E A;  2Y0M A;  2XGD A;  2PEX A;  2E2J J;  1UEL B;  4Q48 A;  1HW2 A;  2CO5 A;  2PJP A;  5DD4 A;  3OS0 A;  2KHM A;  3RI4 A;  4GGG A;  3NWS A;  2NXN B;  3OYN A;  2GXA A;  2O8X A;  3M1E A;  1SMY F;  3ERE D;  1HDP A;  1X1A A;  2PMZ N;  2HYJ A;  3VEP A;  1RR8 C;  4M71 A;  2HWV A;  5ILS A;  2VKD A;  3VYU B;  4LLN A;  5HNF A;  2O9L A;  3WTS C;  4I02 A;  1Y6I A;  1Q1V A;  5HOO A;  2JUG A;  4CA0 A;  3PJR A;  4RAG A;  1VQP I;  1I50 J;  2OZ6 A;  4L0Y B;  3B6A A;  3H3U A;  3FXM A;  2B0L A;  4Y7N J;  4A12 A;  1V5E A;  4J01 A;  2CRG A;  3AL0 B;  3L7W A;  4ESB A;  5LEK A;  2Z2S B;  1NG6 A;  4AID A;  2E1M C;  4CH7 A;  3OYH A;  1SD7 A;  4MNU A;  1TWH J;  3LSK A;  3J7Z I;  3VOD A;  3BDD A;  2ZME B;  2PJR B;  3LSR A;  2W4S A;  3ZR8 X;  4LIT A;  3ONQ A;  2R7V A;  4EM2 A;  1ETW A;  1IRX A;  3DKW A;  4WXD A;  2W7N A;  1B1B A;  3BTJ A;  5FRM A;  1QNT A;  1T08 B;  3K4M A;  1ZHF A;  5LHI A;  5LGU A;  3SEQ A;  2ISY A;  4FET A;  4G9Y A;  4NBQ A;  4MTD A;  4GXO A;  3QU6 A;  2BGC A;  3ZQF A;  1QHH D;  3PNY A;  2EJR A;  4KIC A;  5IOZ A;  2V4J C;  2VKE A;  1WJD A;  3S3N A;  4XSZ F;  1VQ5 I;  1W5S A;  3PSF A;  2A6E F;  2VIX A;  3RKY A;  1T33 A;  3S2W A;  3K6G A;  3BJO A;  4YFX F;  4RB3 C;  1X3Z B;  5D5V B;  1IG7 A;  3BR1 A;  2EFO A;  5FKO A;  1YIJ I;  3TBI A;  4L5I A;  2H27 A;  2EFP A;  1ETQ A;  4R8H A;  3K4J A;  1OCP A;  1UG2 A;  3MD2 A;  1BJZ A;  2WY8 Q;  2HYG D;  3G3Z A;  3ZQQ A;  4JX4 A;  3HRM A;  3GZ5 A;  2ADU A;  2E2I J;  1TT0 A;  5TIS C;  3QP6 A;  2LY1 A;  2CH0 A;  1RRJ A;  4XOT A;  2O0Y A;  2MLG A;  1T8I A;  1QZE A;  1XDS A;  2PMU A;  2DOA A;  3SZT A;  1VQ7 I;  4YIR X;  4DQ2 A;  4L5J A;  4AVZ A;  2E1M B;  4WCG A;  3K0L A;  2MGQ A;  2A6H F;  3J81 K;  5CVJ A;  5HOD A;  3L1P A;  1XDU A;  4W97 A;  2ID3 A;  1IN8 A;  5J1R A;  3N05 A;  4CSW A;  3CCE I;  3VYR B;  1U5T A;  4HDU A;  1V5G A;  4BBR J;  2Y30 A;  4A3L J;  4AUX A;  4XKC A;  2FOK A;  1OFC X;  1TP4 A;  3T5X A;  3W3C A;  3FMR A;  1MBE A;  1TQI A;  1LFP A;  2FNP A;  3V7C A;  2LY9 A;  4XLC A;  3NAR A;  3I55 I;  2IA1 A;  3Q9V A;  1TZL A;  1JE8 A;  2EIN H;  1WCM J;  1ZRF A;  3ECH A;  3CQZ J;  4ZC3 A;  2QGU A;  3HGY A;  4LK1 F;  4LIV A;  3CCQ I;  3S16 J;  5EGO A;  3M8E A;  2MH9 A;  4U87 A;  1K4S A;  3CJT B;  3RYP A;  3HPG A;  4AC0 A;  4E7L A;  2VOP A;  5F6F A;  5DCM B;  2L9S A;  2VBY A;  1WIB A;  3OYM A;  4XLP F;  3GLL A;  4FX0 A;  1PYV A;  2MA3 A;  1U3E M;  4BJ5 C;  3ABK H;  4P9F A;  5M5X J;  3GFM A;  1BOB A;  2ZNZ A;  3M1C A;  3U1K A;  4BAC A;  3EUK L;  2XF5 A;  3WU1 B;  3RJP A;  2ZO4 A;  3S1M J;  2VJI A;  2Y48 A;  3IH4 A;  1SVM A;  2P5L C;  4AYB N;  2DA6 A;  3B73 A;  3QPT A;  4HRI A;  2XF6 A;  3RTR A;  3VPR A;  1D0Y A;  3J7A O;  4ESJ A;  4IHS A;  3C2B A;  2CYY A;  2WAQ A;  2X6X A;  3S1Q J;  3OYL A;  2XPV A;  3TDU C;  2EH3 A;  1WJB A;  2DFI A;  4JP0 A;  2HVS A;  5EEG A;  1O7L A;  2EV0 A;  3BLY A;  3I71 A;  3G71 I;  4ZJZ A;  3S1R J;  2J5O A;  5LLQ A;  4BY1 J;  3BWG A;  1U9N A;  2BY2 A;  2YPR A;  2VBX A;  3I59 A;  1L3L A;  4AD9 A;  2TRT A;  2M7A A;  1ZGW A;  3HSR A;  2HZD A;  1LVK A;  3C2H A;  1OYW A;  3PFY A;  2E19 A;  4D9J A;  5LEJ A;  5CQG A;  5IYD J;  2RQQ A;  3NWT A;  1MGT A;  3E5Q A;  4M3G A;  4BL0 B;  4IHW A;  2MC4 A;  4XBF A;  3OSG A;  2QEX I;  4ENM A;  4BEH B;  3OYI A;  4OMY A;  3D0S A;  4KFC A;  1U8B A;  1FSE A;  3PQJ A;  3DWL E;  2ID6 A;  1DP7 P;  5DCF A;  4C9Y A;  4KN7 X;  5A2Q Z;  2KIS A;  1JKO C;  4EJV A;  5JLW A;  3WGH A;  4RLQ A;  1R6R A;  2DXI A;  2X51 A;  2XPW A;  3F6V A;  3S1N J;  2EV6 A;  2XGC A;  3A0H C;  3B02 A;  3JTH A;  5B66 C;  3HOT A;  5TJJ A;  2HZT A;  1E3P A;  1S7A A;  1TWC J;  4HLY A;  3I0T A;  1SD5 A;  2FA5 A;  2W82 A;  5J8C A;  3K1N A;  3NEU A;  1D5Y A;  2JA6 J;  4G6D A;  1W36 D;  3J80 K;  1E2X A;  2VT2 A;  4E7Z A;  4E7K A;  5F08 A;  3HTU A;  3WHC A;  1D3Y A;  1J75 A;  2IP2 A;  4AIJ A;  1Y1W J;  3K7A J;  2MYS A;  1JGG A;  3ABT A;  3FK6 A;  3RKW A;  4Q4Z F;  3E6C C;  3AG4 H;  2ZME A;  1UHM A;  2PJR A;  4BE0 A;  2K9S A;  1RNL A;  2CQQ A;  3BY6 A;  3E7L A;  3CCJ I;  3FIS A;  4FCY A;  2VOD A;  2M1B A;  5BQT A;  4QPO A;  1PUF B;  2RC4 A;  4EQQ A;  4V2F A;  3F23 A;  1K7A A;  5CVR A;  1MH3 A;  2XDV A;  2ISZ A;  2DOD A;  1OKR A;  3BQY A;  3BZK A;  4E6K G;  3HOZ J;  1ODD A;  1ZEL A;  1KQ9 A;  3CUO A;  2R7U A;  2PMZ A;  3DTI A;  4OU0 A;  2WB1 N;  1T98 A;  1IC8 A;  5FLM J;  5IT3 A;  1R1U A;  3KCC A;  1Z05 A;  3MCZ A;  1FMW A;  2CUZ A;  3OYG A;  2IS2 A;  4Z2Y A;  1F43 A;  4GDF A;  2V6C A;  1UZC A;  1O3T A;  4BQA A;  4BH9 A;  3LA3 A;  4XMY A;  4EMS A;  3UR3 C;  3LST A;  3FXJ A;  3DPT A;  4J19 A;  2R7W A;  2R93 J;  2X6O A;  2JA7 J;  3V8L A;  1YIO A;  2LBF B;  4I01 A;  3DEW A;  4BJ6 C;  5HLH A;  1I3Q J;  3DXJ F;  3SHF A;  4L9V A;  2R7Z J;  1YS7 A;  3HOV J;  5ED4 A;  4BQQ A;  3X2Q H;  2ECC A;  1VQM I;  1BR1 A;  3LSI A;  1D8K A;  4BGD A;  3L2V A;  4DBR A;  1CF7 B;  2DA2 A;  5D8L B;  1HKT A;  2CMP A;  2ZBK A;  1VTN C;  4A3D J;  1ITY A;  4C3H J;  3JRG A;  1WJ5 A;  2ELK A;  4D1Q A;  3DPL C;  4HPQ A;  4YG2 F;  2QKM B;  2UXX A;  2ZXW H;  1B9M A;  2A5W A;  3A0B C;  4GRI A;  3VOE A;  2GA1 A;  2IS4 A;  2G7H A;  2Z1D A;  4RAF A;  1KA8 A;  1LKX A;  5K1Y A;  2NVU B;  4Y17 A;  3HEF A;  3MZH A;  1IRZ A;  4LFU A;  3PNV A;  2XKO A;  2BBY A;  3ESW B;  5FKL A;  1NHA A;  4RAZ A;  3CC7 I;  2IXS A;  2IT0 A;  2IA0 A;  2KZV A;  3U9G A;  1R4N B;  1YE9 A;  4UV9 A;  1YTY A;  3K2A A;  5K7H A;  5DCM A;  4A69 C;  5HDN A;  4Z6Y A;  4RGS A;  2VJJ A;  3LAP A;  1KYW A;  4EJU A;  3M7G A;  3SZP A;  1SAU A;  2M34 A;  2GWR A;  4PDK A;  1FIA A;  1O3R A;  2GXB A;  3PQK A;  2H6B A;  1X1B A;  4HV5 A;  5IYC J;  4I7H A;  1B8I B;  3R6S A;  1OQY A;  1OYI A;  4A2U A;  2K9N A;  1WKM A;  3OIP A;  3TOB A;  4CDG A;  5E3O A;  2ELJ A;  2VLA A;  1P7I A;  4HYE A;  4HZF A;  2QWW A;  4NC8 A;  1YHQ I;  2RRE A;  4UV8 A;  2QYO A;  2LKX A;  1MMG A;  5FRN A;  2BXZ A;  3E1S A;  4CXF A;  3PUF A;  3I53 A;  2OCC H;  3LSG A;  2LD5 A;  2M0M A;  1R1T A;  4HSR A;  1MKM A;  1ZRD A;  3QYF A;  2D1H A;  4I0A A;  2BY3 A;  4F52 A;  4QLC U;  5D4S A;  2P8T A;  4BHC A;  1MH4 A;  4CCJ A;  5M3F J;  2Q2E B;  4XRS G;  4CZZ A;  1WZ2 A;  1TWF J;  1B9N A;  2ESN A;  1JUM A;  2OBP A;  2HGC A;  1VZ0 A;  1BM9 A;  3OS1 A;  5C4J J;  3HB9 A;  2NS8 A;  2NVX J;  1IXR C;  4BQO A;  2M0C A;  2MAB A;  5F27 A;  4I76 A;  1I39 A;  1BW6 A;  4XIC A;  4IZZ A;  5DDG A;  1NK2 P;  3VDX A;  3ZMS A;  5JHF A;  5ICC A;  5K5R A;  4HQE A;  1T6S A;  3HPH A;  4X1E A;  2QEN A;  1XSX A;  2KLO A;  3H0D A;  5GAD J;  3PUB A;  3GEZ A;  2EZH A;  3FBN B;  3T1B A;  2M8G X;  1P6R A;  1WI3 A;  1IV8 A;  5KK1 A;  4E4H A;  3H35 A;  1X1C A;  2A5Y B;  4M74 A;  4DZJ A;  5ICG A;  1LJ9 A;  3ELK A;  4KT6 A;  4A3J J;  2MC3 A;  4RB2 C;  3AKZ A;  3HOW J;  2FBK A;  2QQ9 A;  2F6C A;  3REO A;  5LHH A;  3RIR A;  4DYR A;  2L02 A;  2G7U A;  4I09 A;  3DU6 A;  3F21 A;  2B7E A;  3HC7 A;  3VYS B;  1YG2 A;  2UWM A;  5AIQ A;  1E17 A;  1FBS A;  1JXS A;  2D1V A;  1UMQ A;  1MBK A;  3GFI A;  1PUF A;  4QIW N;  1IW7 F;  1MBJ A;  3WU0 A;  3SDG A;  1DGR M;  3L2U A;  3OYB A;  4R1H A;  2ZCW A;  1Z0X A;  2OD5 A;  3BRO A;  4XLF A;  2VI6 A;  3D1N I;  4XLA A;  1VI0 A;  1RES A;  1Y56 A;  2WBM A;  1MD0 A;  5HS7 A;  4E7H A;  2XRL A;  4BS9 A;  3CJN A;  3IRR A;  1W4M A;  4EJW A;  1PUE E;  3GTL J;  1O3Q A;  4NUB A;  5J1U A;  5K5Q A;  2VAS A;  1O7F A;  1ETO A;  4F92 B;  1I1S A;  3CME I;  3DP7 A;  1S6L A;  2Y69 H;  4HQM A;  3D5S C;  2JVG A;  2B9S A;  3H5A A;  1OCR H; 
#chains in the Genus database with same CATH homology
 3G6E I;  3J7Z I;  2E34 A;  2E35 A;  2H8W A;  1YJW I;  1YHQ I;  4IOA F;  2ZJR F;  5GAE J;  3CCM I;  5GAG J;  4IOC F;  5JVG F;  1VQ9 I;  3CCU I;  4UY8 I;  1S72 I;  3I56 I;  5GAH J;  1YJ9 I;  1VQ5 I;  1VQO I;  3CCS I;  3G71 I;  3CMA I;  2ZJP F;  4V19 K;  3G4S I;  3J7Y J;  1VQ8 I;  1YIJ I;  2ZJQ F;  1YJN I;  1VQ6 I;  1HC8 A;  1VQM I;  1YIT I;  3CJQ B;  2QA4 I;  2OTJ I;  5GAD J;  1VQK I;  2QEX I;  1YI2 I;  3PIO F;  2FOW A;  2K3F A;  1QA6 A;  1VQ4 I;  3CCL I;  1ACI A;  3CCV I;  1VQ7 I;  3PIP F;  1VQL I;  3CF5 F;  1FOX A;  4IO9 F;  5DM7 F;  2JQ7 A;  3CCE I;  3CJR B;  3CJS B;  5DM6 F;  1Y39 A;  3CC2 I;  3EGV B;  3CC7 I;  1VQN I;  2NXN B;  1FOW A;  3CD6 I;  3I55 I;  1FOY A;  3CCR I;  1VQP I;  3CCJ I;  3CCQ I;  3DLL F;  1MMS A;  3CJT B;  3CME I;  2OTL I;  1WIB A;  2E36 A;  3CC4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...