3J7ZI

Structure of the e. coli 50s subunit with ermcl nascent chain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
141
structure length
141
Chain Sequence
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Drug Sensing by the Ribosome Induces Translational Arrest via Active Site Perturbation.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L32
total genus 17
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3j7zI02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3j7zI01
4IOAF 3CF5F 1VQ7I 3CC7I 3EGVB 5DM6F 2K3FA 5GADJ 2OTLI 1YHQI 5JVGF 2JQ7A 3CCRI 1FOYA 4V19K 3CC2I 5GAGJ 3CJRB 3PIOF 2H8WA 4IOCF 2ZJRF 1FOXA 1VQLI 2E36A 2QA4I 3CCLI 3I55I 1YITI 3CJQB 3PIPF 3J7ZI 3CMEI 1VQ8I 2OTJI 1MMSA 1VQ6I 1HC8A 3CJSB 3CCVI 2ZJQF 1VQ4I 5GAHJ 1QA6A 3CCSI 3G71I 1VQPI 4UY8I 1YI2I 1YIJI 1YJNI 3DLLF 1VQKI 1ACIA 2QEXI 1WIBA 5DM7F 1VQ9I 1VQMI 3G4SI 1VQNI 3G6EI 1FOWA 1YJ9I 3CCQI 3CD6I 5GAEJ 1YJWI 3CCUI 4IO9F 2E34A 1VQOI 1VQ5I 2E35A 2NXNB 3CCJI 2FOWA 3CCEI 3CMAI 2ZJPF 3CC4I 3CCMI 3I56I 3J7YJ 1S72I 1Y39A 3CJTB
chains in the Genus database with same CATH superfamily
5KCMA 3RKXA 3SEZA 1I3AA 1BC8C 1V3FA 4IHXA 4XRSA 2VN2A 3SEQA 3GFMA 2X1DA 5AIQA 2GA1A 3LSHA 1X4OA 3JSPA 4L0ZB 2M0CA 3DEEA 4ZH4F 1SFOJ 4DYQA 4M6YA 3CC2I 2F5EA 2OZUA 3CP8A 3K4BA 2JPBA 3RQ4A 3WGHA 2LYCA 4LK0F 4HNUA 5BS6A 1G2HA 1DGWY 2BOLA 4XKVA 1IRXA 4F91B 3MAJA 5CJ9A 4IOCF 2DA5A 3JW4A 2GIZA 3TDZC 1FOXA 1MBFA 4QWQA 1LFBA 3DWLE 2XASA 5DCFA 4DJAA 2XSDC 3OYJA 2IGKA 2VC0A 4WWCA 4HYEA 2H6CA 4XLHA 4W1UA 1RKWA 3HXLA 4U7BA 4IQJA 2WV0A 2V79A 4K2EA 5IP6A 3Q9VA 1G3YA 2VPRA 3CJSB 1X2MA 4ENNA 4A5MA 3CCVI 2PFBA 4LJZF 2DT5A 4NC8A 1R6RA 5HLGA 4PSWA 2E1MB 2GXGA 3HJEA 3F3XA 5L3FA 4LG3A 4D1QA 2QBYB 2ELKA 3PFYA 3QU6A 4IF4A 4GO1A 1AOYA 4RB3C 4DBQA 1PUFB 1TL8A 2E1NA 3EUAA 2P5VA 4AYBN 2O61A 2R5ZA 2VKDA 4M71A 1FIAA 1Z21A 3OY9A 1IGNA 4X6AJ 1R1VA 1TWFJ 1G4DA 3WTXC 2EWNA 3R6SA 1WJCA 2RGVA 3RPUA 1R58A 1TQMA 2OAZA 3ZQCA 3BQYA 4MFEA 1VF9A 2ZBKA 2GLOA 2HDDA 1VZ0A 5F27A 2E1CA 2Z99A 4MTEA 3FWEA 2GA2A 4G12A 1R7JA 1GVJA 1MBHA 2EILH 2VB6A 1ORKA 4LOCA 4ZTFA 1AU7A 3L2QA 4WXHA 1MMNA 4FT8A 5F0HA 3FBIB 1YYVA 3MZHA 4UXNA 4B47A 5LGTA 1MZBA 5E3LA 1KYWA 1PJRA 4CH7A 2PMHA 1WSUA 1WFXA 3BR5A 1BR2A 3UNGC 4I02A 1X2NA 1ZAOA 1MKMA 1QO0D 4BHCA 2ZNYA 3IH2A 2LREA 4BDYA 4CCLA 3M9AA 4I01A 2YR2A 5FKMA 4Q48A 1MJ9A 4XKCA 4MGRA 3MZYA 3QPTA 5JHFA 3IL2A 2M3AA 3LA2A 4TV7A 1Y39A 3ZCOA 2OUMA 4AWXB 1MMDA 3HSRA 1REPC 2RQPA 1ZKGA 1VQ7I 3C18A 2ID3A 2DLLA 1O3RA 4KN4X 4LK1F 4LGWA 2MA3A 2W48A 4MTDA 1GXQA 3DU5A 3H9GA 1XSXA 3ABUA 2L7KA 3E7LA 3S1QJ 3CMMA 4MO7A 2P6TA 2L02A 4CICA 1T98A 3IWFA 4CHUA 3E5XA 5L3BA 3BG6A 2E7WA 4BAYA 4BQAA 2LY1A 5HDNA 4EQQA 3ECOA 3L2CA 1VQLI 5H6QA 1YW7A 2ID6A 1PVEA 2ZSIB 3I9V2 5EGOA 1K7AA 2EZLA 2K85A 3CUQB 4A3LJ 5E8GA 4OAZA 2FNPA 3H5AA 2IXSA 1MIJA 2TCTA 2EB7A 4Y52J 4FX4A 2LTPA 3FBNB 2JA7J 2VASA 3S32A 1ETXA 4U88A 3F6OA 2A68F 1VFCA 3PL8A 3LSKA 2EFPA 5TRDA 2B9SA 2Y48A 1FOKA 2V9PA 4HA8A 2ZXIA 1R4NB 2B0LA 1BOAA 2M7AA 2ECCA 3E3VA 3M1EA 3PNTA 3R61A 1R00A 2VQLA 1XCVA 2K7LA 2WBMA 1IDYA 4YIRX 5BPIA 4GRIA 2CV1A 3BR3A 1YRNB 4UB8C 5B1AH 1TQPA 4MEYF 1QU3A 5DCMB 2M9HA 2PQ8A 1ACIA 5M3FJ 1WJ5A 4HLXA 3H35A 1ENHA 3MMYB 4E7JA 2V6CA 3K6GA 3I5UA 1SD4A 2H6BA 2LOOA 1W7PA 4RB0A 4HX8A 3HDDA 5EJCA 3QP5A 3GLLA 3SQNA 4AIDA 2KIUA 2HPMA 3DBRB 2V6EA 2R7SA 1I27A 2NXNB 2FQ4A 1I6XA 5DD8A 5DEQA 2NS7A 3MWMA 3COAC 4WXCA 2CO5A 5HDKA 5IOZA 1UAAA 3WHBA 3BCBA 2FJ1A 2RKHA 3CDLA 1O4XA 4DW6A 5D5WB 3F21A 5EF6A 1LDJA 4IRGA 1EJ9A 1WCMJ 3FK6A 3EUHC 2FMLA 5F0FA 4ZYAA 4G7OF 2R7RA 2EZIA 1SFKA 1ZH5A 2ZC2A 3DTIA 3RPUD 2PN6A 3IWZA 2KIMA 3AL0C 2M2EA 4HSTA 3GUDA 1MMAA 2KDOA 2GIVA 4AD9A 3H9JA 1XPXA 3DP7A 1U6GA 2QF7A 3JRAA 5HNHA 2CV0A 4DNCA 4D7MA 5J8CA 4B1RA 1LKXA 4UV9A 3TOAA 4BL0B 2O8XA 1LE8B 5FGMA 1YRNA 3HPHA 2LMDA 2BY2A 4AVZA 4CCMA 3A0HC 2DA3A 2Q2EA 4P55A 3MCZA 2IT0A 4F55A 3DPLC 2QBYA 4IJAA 4NDLA 5D4SA 5EYRA 5H20A 3KPHA 4F7ZA 2R5ZB 1O3TA 4B09A 5K5QA 2X9DA 1LVKA 2ZSHB 4KA4A 2CYYA 2XIGA 2YU3A 3RSNA 3MN2A 3ZPLA 1R1UA 3E5UA 2X1EA 2R92J 4KMUX 4XQFA 3ASNH 3TDUC 5DYMA 2ADUA 2FD5A 1S8NA 5BOXA 2CS3A 2VL8A 1PYVA 2CUJA 3PQJA 3HHGA 2N8GA 1T38A 2M45A 2LBFA 5H6RA 4PJNA 1VTNC 3C7JA 3DTEA 4Q4ZF 1YS7A 1K79A 1SMTA 3FM3A 1MNDA 5DM7F 1VQ9I 3JRBA 4LIVA 2HXOA 1SD6A 1PP7U 3RZOJ 2JRMA 2VLAA 2E71A 1EV7A 3V7RA 4H0EA 3KX2A 1I6HJ 1TWAJ 1TP4A 3BR1A 1IZ1A 2FBKA 2HFHA 4D5FA 1HW5A 5LEJA 2FOWA 5IPAA 2Y75A 3GTPJ 5LD2C 4IXAA 2VE9A 4DZJA 4EJWA 3B02A 2QKMB 3DLAA 5FKLA 5CVJA 4FCYA 2Z9OA 2BW3A 3WTWC 3QOPA 1T08B 2Z16A 3JTGA 1X4PA 2KP6A 1YX3A 3ZQ7A 2E5NA 4ZYHA 5CVRA 4BXFA 1JUSA 4XICA 3ZRGA 3FZVA 4ASNA 4B44A 1JE8A 1J2XA 2K3FA 4G9YA 2VJ5A 4HDVA 4M9SA 1XSVA 1H0MA 1D1BA 3CLOA 1ZREA 2Z2SB 5ICFA 4E7SA 5EGOB 3CUQA 2DOFA 3HC7A 4Q47A 3V7SA 2HOAA 1Q1VA 2WAEA 3VWBA 3PUBA 5HNFA 4HOBA 3CJNA 3HOXJ 2H8WA 3HRSA 4XLEA 4B4CA 1OJLA 3BJAA 2EJRA 4L9NA 4PUSA 4Y13A 1W36C 2H94A 4M3GA 3TO9A 4HW0A 3LSMA 3ZXSA 1UELB 4RAFA 5ICGA 3SJMA 3CUQC 3BG3A 3GTLJ 1NHAA 2BEOA 5DV5A 3FXMA 3F72A 1QVUA 1G3WA 1S7EA 4P9UA 2R7UA 5E1XA 2F5VA 3ONQA 2DPUA 3SZGA 1BI2A 4E7ZA 1K6OA 2CMPA 1IN4A 2A69F 3BCAA 3H5NA 2HDCA 1GDTA 5JR3A 1Z3XA 2W84A 5EZHA 5F04A 3GFLA 1KU2A 2PMUA 2V1NA 5A2QZ 1XGSA 1EH8A 1S6LA 4M74A 4Z2YA 3P9CA 1R36A 5TGTA 2E5ZA 3DF8A 1SAXA 4XM3A 1GLNA 3DV8A 2MH9A 1JGGA 1VQKI 1E0EA 3T0YA 3BJ6A 1E17A 5JFRA 3G4SI 2QYOA 5KAIC 5DTDA 3VYSB 2ICWG 2XDVA 4II2A 3OYLA 1PUEE 4BEHA 4IHSA 1ON2A 3GFJA 4I0AA 2IPQX 2QZ8A 3KIOA 1ZRDA 2MD5A 1VQOI 1U8RA 2K9SA 1STZA 4XRFA 4PGHA 1RNLA 3M1CA 4A0YA 3UR3C 3CMAI 4PZJA 1KU3A 2AXLA 1BJZA 1X3WB 1D1CA 3G1OA 3HGGA 4A3FJ 1H9GA 2HS5A 5IYCJ 3L2UA 1Z6TA 1WJAA 1WJDA 1ITYA 3E5QA 2CFOA 3LA3A 4LFUA 2DDBA 3GEZA 2ISZA 3J7AY 3CJTB 1D1AA 2X48A 2Q8KA 3RTRA 4HG2A 2F5DA 4S0HB 4D7NA 3W2AA 5LFAA 3VODA 1ZR4A 5DM6F 2HQRA 2XUBA 2VJIA 3BDDA 3TGNA 1RRJA 1CGPA 2OTLI 2O7OA 3TOBA 4MLOA 1HKTA 4Y15A 2JQ7A 4BXUA 1ERDA 1I1SA 4QIWN 3HBLA 5BPDA 2DBBA 4LB5A 3S16J 2Y9ZA 3K0LA 2UUZA 1WJEA 3M8EA 4CCJA 2O03A 3NEUA 3KP2A 1FYMA 2Y0MA 2F5CA 4BHBA 2G0EA 4S04A 1BI1A 2EV6A 4FE7A 2ZJRF 4FX0A 2LKXA 1ZG3A 3DPUA 3NWTA 1DDNA 3BZCA 5E8IA 4BKXA 1JHHA 3HKZA 4OWRB 1ZRFA 2BXZA 1DU0A 3I71A 1IRZA 4E7LA 3FMSA 1MBEA 2IS1A 1DPRA 4WX9A 2V9KA 4IZZA 2D1VA 4PDKA 1TBXA 4EJOA 1K78B 1ETVA 2GQQA 4BEHB 3OYEA 1HW1A 1Y1WJ 3OS1A 2ZNZA 3FDYA 4OIRF 3CDIA 5J1YA 5IT3A 2V1DA 2PX9A 2K9QA 2CUFA 3HHHA 4RB1A 5LEKA 2RN7A 1V54H 3CO7C 1FYLA 2HOSA 1KGSA 1F36A 1N25A 2KRCA 1ZRCA 5DUKA 3ROUA 2DMNA 2R5YA 2K40A 3OYFA 1HW2A 4NNJA 3WTZA 3K70C 2LD5A 1XDUA 4MNUA 1O7LA 2I8DA 2BHYA 4A2UA 2MBFA 1SFUA 2PLYA 1EF4A 2CGPA 5M3MJ 2WA0A 1HLVA 2DYRH 4E6KG 2QEXI 5F0CA 5CVUA 2VJ4A 4BJTA 3P5JA 1D3YA 4A5NA 2HQ5A 4M6VA 1IRFA 2FF4A 1ZTRA 3EDPA 4NQWB 2YSRA 3JRIA 3RQIA 3MD2A 1LQ1A 3T1BA 4BE1A 4HRIA 1GUUA 2DMUA 3Q0WA 3HUGA 2BW3B 4FE4A 1NK2P 4GCVA 2E35A 4HDUA 3JTHA 3FKIJ 1EH6A 2A5WA 2YS9A 3GVAA 2CQNA 3W2VA 2IP2A 1W5TA 2UXNA 5TJJA 3OYHA 3LAPA 2FU4A 4UB6C 1JKOC 5F08A 2DT6A 2XF7A 2LNBA 2NVQJ 1WH7A 2COBA 1FJLA 2CG4A 3E0JB 2W7NA 3HSEA 3WG7H 1G8XA 1JJ8C 3JRGA 2W24A 2XAJA 1RR7A 2MC4A 2Q0OA 4N4NB 1BIBA 5B1BH 3KEOA 5GADJ 1OCZH 4LITA 1SD7A 4M9XA 4LD5A 3QAHA 5FD6A 2K02A 1IN8A 4P5OA 2KJCA 4AIJA 2GM4A 1U78A 2HU9A 1Z9CA 2KRHA 4IRIA 5DDGA 2QQAA 3R60A 4AM3A 2KZVA 5ILVA 3MFKA 3BJOA 1KYZA 1LVAA 5FKNA 2DYSH 3NAUA 2L5QA 1T95A 4GGGA 3DQVC 4M3EA 1MW7A 4D9JA 1X3ZB 1YITI 2R7WA 2KL4A 1JUMA 3L00A 4U87A 4EJVA 2E2JJ 2X6WA 5H2FC 5DS9A 4OU0A 1USTA 2OU2A 3A2KA 1IN6A 1WZ2A 1KQ9A 3K4LA 5C3EJ 2XKOA 4QSHA 4ZDPA 1H9TA 2Z5UA 3QYEA 1WH5A 2V7FA 1UG2A 3FM5A 3EYYA 1B59A 1P7JA 4P1WA 3SZTA 3ZQQA 3GLXA 1NG7A 4CCOA 3FXJA 5D5VB 4EM0B 3VYRB 1JXSA 5J3LA 1HF0A 3F0CA 1XMXA 1TT0A 4NHJA 3V8JA 1H89C 2VQGA 2ZFUA 2LVSA 5E79C 4GDFA 4ESBA 4CXFA 3ZGKA 4IQ4A 4D5CA 4XOTA 4OIOF 1F9NA 4RAYA 4LG0A 1BIAA 2MABA 4N0BA 2Z3YA 2FEZA 2JSCA 3BP8A 2V1XA 4IPAA 2D2WA 3LSGA 1GT0C 3ZN0A 2DO7A 3V7CA 4I99C 2RNJA 1U2WA 3K1PA 4M9ZA 2X85A 2ME0A 2CW8A 1WGXA 3H0GJ 2VONA 2F2EA 1B1BA 4HQEA 1HSJA 1OCPA 1Y1VJ 3H36A 5FRMA 1USSA 5BNGA 2EIKH 5ILSA 1X3UA 3I58A 1IUYA 3WTUC 3HTUA 4L5EA 1TTYA 1S7OA 3I59B 3PNVA 1QHHD 3JR9A 2XPWA 3QU3A 1KU9A 3G2BA 3LSIA 3K9TA 4L9VA 2K86A 1CF7B 2BE5F 1IXRC 2DN0A 4R8HA 1T0FA 4Z6YA 2JA2A 1J59A 4XL9A 1Z67A 1BW6A 2ZMEB 1P9QC 1O3SA 1W7PB 3E6MA 2HR3A 4WK8F 1YTYA 1CQTA 4L9JA 3OIOA 1OR7C 4CYCB 4YEJA 1JJ6C 1N77A 2ISYA 2IRFG 1DPUA 3V42A 1ZELA 4OAYA 1Z05A 1XN7A 2L4AA 3LSTA 3PM1A 1QPMA 1F5TA 3IH4A 4FASD 3T8RA 4UHTA 2XKPA 1DUXC 2XRLA 1IO2A 5K7ZA 3F8BA 3L9FA 1IJWC 4HNTA 3H3VK 4RLFA 4U0WA 2L9NA 1OFCX 2R7TA 3VSKA 4M73A 4KUMA 2Y2ZA 4XN3A 3VDXA 3CCYA 4EM2A 5GTIC 3OIPA 2MC3A 3HOSA 3WTYC 1ZGWA 2P7VB 2DPDA 4UVAA 2PMZN 4X1EA 1HOMA 3RKWA 5FLMJ 1BA5A 2ZJ2A 4A3JJ 2OCEA 1FNNA 1IW7F 3PSFA 5GPCA 2ZB9A 1LE8A 2DA4A 5L3CA 1KZHA 4A93J 1S9HA 2P5KA 5FROA 3G1LA 1MMGA 2QQ8A 4LLGF 5CQEA 5C4XJ 1YG2A 3DKWA 3KLNA 4HLYA 3S3NA 3S17J 2JVHA 4YIFA 3JAMZ 3O2PE 4NQWA 2DA1A 4ENMA 2QUFA 1J0RA 1TT5B 2OPTA 2VE8A 2OJED 3CF2A 4CSWA 1Q1HA 2DOAA 1MSEC 3RZDJ 1XGOA 2W57A 3K4NA 1LDKB 1XDSA 1E3HA 1G3TA 2Y9YA 3G6EI 1XB4A 4O5VA 3FX3A 3W6KB 1DQUA 1JUPA 1GHCA 1YJ9I 1JKRC 4QTRA 3AFHA 4YIIA 2X4HA 5K7FA 3HRMA 4M72A 3GTJJ 2LG4A 2F4IA 2COMA 1FBSA 2MYSA 3KZIC 2M4GA 3N4MA 1W36D 2Y31A 1E2XA 4ENKA 3U2RA 3HOWJ 3BR0A 3LSRA 1S72I 3ZQHA 4DIQA 1WJBA 1ZYRF 4YG2F 4IHWA 5BQTA 3EETA 2KT0A 1YFHA 2F5FA 2K27A 5LHHA 4ZYEA 1OCRH 3QPSA 5CKTA 2EA2A 1AKHA 3HOVJ 1X1CA 2M30A 3VB2A 4A12A 3S15J 2HOTA 3EGVB 1S29A 4ZZDA 2FOKA 1LFPA 1OLTA 2ESNA 4I09A 5FRNA 3ZP5A 4DYCA 2EIJH 2RAEA 2WTEA 3Q0VA 1PP8F 4J00A 2KRFA 5FLVA 5HDGA 2QM3A 2HKOA 3HOZJ 1FYKA 2L3DA 3ZMTA 3REOA 1I1GA 5ERIA 1TW2A 4BGDA 3W6JB 1R49A 3SHFA 3NARA 2L01A 1N75A 3L09A 3M7GA 4HPQA 1PUFA 3H92A 3DEWA 1QZZA 4RDUA 1ONVA 3S93A 4WXDA 3V8LA 2NS8A 1K6YA 3MKYB 1W7PD 1ZLKA 2KKOA 4XONA 3V8KA 5IT9K 3TO7A 2XAHA 1X1DA 5EDNA 4BE0A 3A02A 1P4WA 1X19A 2HTSA 1F1ZA 3Q0UA 3E1SA 4A3MJ 3S2DJ 2XSJC 1KQ8A 2HQNA 3K7AJ 1P92A 3TMOA 4V2GA 2VPLA 5IYBJ 5F1JA 2HYJA 3CUOA 3JRHA 1MNEA 3IHUA 2MH2A 2WADA 4M3DA 2DJNA 1VQPI 2XV4S 4MIMA 1HDDC 4O3MA 3I4NJ 3KP6A 4UV8A 3HB9A 2JUGA 4G94A 3GTMJ 1YIJI 4FHTA 1ZG1A 2EFWA 4CO8A 5FD5A 4Q5SF 1W0TA 1AKHB 4BXXJ 2W4SA 3K2ZA 1TW3A 3KCCA 4GXOA 1EH7A 3WGGA 1JKPC 3S2WA 4M6XA 4ON0A 4DYRA 5KK1A 1WIBA 1SMYF 5JI6A 2M4KA 1BR4A 3GW2A 5IP7J 1A6IA 4JOMA 2CU7A 5TISC 1MD0A 4AVPA 4Y17A 1QHGA 4A3IJ 2GAUA 2GBYA 2XAFA 1AA7A 4RGXA 3OL4A 1I3QJ 4Y3OA 3D5LA 3ZN1A 4RGUA 1D8JA 2CH0A 3O6BB 1FBQA 2E34A 3N05A 3FMRA 1K61A 5D6FA 1F43A 4DZPA 2KQRA 3QWLA 4JX4A 3P9KA 3K4CA 1CF7A 2DT7B 4PJMA 1QZEA 1KA8A 2ME6A 4DQ2A 5L3GA 1Y0UA 3HOTA 3CCEI 1IC8A 1B72B 2EINH 2KIQA 3TO6A 1AHDP 4IHYA 3GF2A 4KNYA 3O8GA 2A6EF 2M87A 1U9OA 3RPQA 4KT6A 2VQCA 2OC6A 2O8KA 3V4GA 2DMTA 3TP3A 3E97A 3KZYA 1OQYA 3HSFA 2DDAA 2A07F 1XCBA 2WAFA 3FXOA 2NNNA 3ABLH 3KZZA 1MGTA 1FSEA 1O7FA 1W5CC 4GYGA 1IN5A 3VFZA 2QGUA 1ULYA 2CV2A 2O9LA 1Y6IA 2FBIA 2X0LA 2XF6A 3DTKA 4LLLA 2MFZA 3BR6A 3R0AA 1R5ID 1B8IB 1OCCH 4JYKA 4PK4A 4J01A 1FOYA 2P8TA 1ZK8A 2DI3A 3GZNB 1WWXA 2DA7A 1JT0A 2HVQA 3HGYA 5GAGJ 5HLHA 1HA8A 2QQ9A 1XG1A 1LFUP 2KDZA 2L54A 4HSRA 2L9VA 2QLZA 2HEOA 4ENJA 3CDHA 2D1HA 2M8GX 2CW7A 2XPUA 3I54A 1YIOA 2QA4I 4QPOA 1U5TB 3CJQB 3W6VA 3J7ZI 2A6TA 3FXRA 2BVMA 5FFZA 1W1WE 1YE9A 4FISA 4ITVA 5KVRA 2JJ7A 2KMUA 3BTIA 5JLWA 2WY8Q 4RAGA 2WB1N 4XOPA 3JAMK 2V1UA 2R3SA 4EATA 5J4VA 3SDBA 4OIQF 2R93J 1IV6A 2Y0SN 2FQ3A 2XVCA 1KU7A 2V4JC 1Z91A 2JA8J 3KE2A 3G73A 1W5SA 3HL2A 2F4MB 3WG9A 2L0KA 3H3ZA 4AIHA 3WTSC 2XAGA 3FK7A 5J4YA 4HF2A 4MEXF 3PUFA 1G3SA 2DU9A 3F9KA 3EQLF 3IKVA 4HF0A 3EYIA 1YJNI 3IH3A 2G7UA 2E2HJ 5J40A 4JK1X 2W82A 3RIRA 1K78A 4HF1A 2R4GA 3K1NA 1B8IA 1VQNI 2ZO4A 1RC9A 3BC8A 3AAFA 1UHMA 2BGCA 3DPTA 2VC1A 1MH4A 5HODA 2GOMA 4GFBA 1ZLJA 1SAUA 2JRTA 2M7BA 2MLKA 2NNYA 2A6HF 5FO5A 1LEAA 3ABKH 2RC4A 1RIOH 4G8XA 3CCJI 3A01A 5JVTA 1BI0A 1XGNA 4PCQA 4RBOA 2HVRA 1U5TA 3H9QA 3D5RC 4L5JA 3L2RA 4C2UA 2BBYA 4DBRA 4F52A 4PFOA 2C6YA 1T56A 1I5ZA 3G3ZA 3M8JA 4BJ6C 2EH3A 4EGZA 2CW0F 1BOBA 2J5PA 3BTJA 2DODA 3KYCB 4JX6A 4XLFA 1XTAA 5JVGF 4H4KC 1WQ2A 1OISA 3GZ6A 5CVVA 5IY5H 2B63J 2AHQA 3HUGB 3L7WA 3LFKA 3GCMA 2ESHA 3RDIA 3BROA 1R22A 3SFIA 4I98B 2PG4A 4C9YA 4A0ZA 3FMQA 1DP3A 4F92B 1RI7A 2K5CA 3PSIA 1ODDA 2EZKA 4KITB 2E7XA 3ZR8X 5ICEA 2OTJI 5EG0B 1FZPB 1MMSA 1ETWA 2W25A 1JTXA 4B43A 2GXAA 2UWMA 1HC8A 1XMAA 2MLGA 3B6CA 1POGA 3S1MJ 5GPAA 3FIWA 3IAS2 3JRFA 4QPQA 3E6CC 4XLCA 1UJ8A 5GAHJ 2VXZA 5EZGA 2H09A 2EV0A 4EGYA 3LMMA 1SD5A 3B73A 3ABTA 4KICA 1D0XA 2JA6J 4G6QA 2R0QC 1APLC 2WAQN 4I7HA 4GYIA 2NVTJ 1FMWA 1Z0XA 4L0YB 4ZZLA 2KJBA 4BS9A 4EMSA 3LL7A 3GYHX 3ELKA 4Y7NJ 2LKSA 2J5OA 1U3EM 2JA5J 2O6GE 2ZFWA 2RQQA 2H8RA 2O5RA 1HCRA 2IA0A 3HIFA 3DU6A 4F3QA 4CZCA 2BV6A 3F8FA 4RA2A 3F8NA 3OR2C 2XGCA 2JUCA 3QODA 3RI4A 1ZQ3P 1SC7A 3TW6A 4ETSA 2P7CB 3TW7A 4L18B 1B4AA 2Z1DA 3VYUB 2IA1A 5E3MA 4ZYGA 1UG0A 3JRDA 1YJWI 3CCUI 1XD7A 1NK3P 2JK3A 2IS6A 5C44J 2HOEA 2VQHA 2F4OB 3QOEA 1BJAA 4HQMA 5HS8A 4RS8A 1N78A 2NVUB 1LJ9A 1YO5C 5L3EA 2VBZA 4PSXA 3VSLA 3KEYA 4E7HA 4XLNF 3CQZJ 2DOEA 2G9WA 1K4TA 2GXBA 3HRUA 4IEJA 3KLOA 1GXPA 3H1CA 5LRSA 2L7ZA 2NVYJ 2LC2A 2LF8A 3CLQA 4PGGA 4OIPF 4YRVA 1JI8A 2P81A 1KQ0A 3HOYJ 2OCCH 2DMPA 4BYYA 2HXIA 3CTAA 2LFBA 1WI3A 2Y69H 3GZ5A 3OR1C 4RGSA 4CZZA 2P6SA 2B7EA 2WY7Q 2LY9A 5LLQA 3CCRI 1ZN2A 3ASOH 2RDPA 2PEXA 3WGIA 4KN7X 1BC7C 3TBIA 2BVLA 5B66C 4YFNF 1WI9A 4ANJA 3VPRA 3G1MA 3OWTA 2E60A 1LPQA 5GP9A 3I59A 3M8FA 2R7DA 2YU9J 2E36A 4KIBA 4JQFA 2VOOA 1SEUA 1PDNC 3CCLI 4G6DA 3I55I 3BTLA 3PIPF 1U9NA 1Z7LA 3AG1H 2NVXJ 4PFPA 2P0WA 1VQ6I 2GZWA 4P96A 2ZMEA 5J47A 1FY7A 2F6CA 3HKZN 2ZJQF 1BI3A 2EA4A 4HEA2 4CCNA 2H1KA 5B5EC 3CMYA 3F23A 2H27A 3LNQA 2BY1A 2MSYA 3I53A 4RB2C 1R5HA 3CCSI 2XGXA 4BQQA 4I76A 1JKQC 3PFIA 1OYIA 3P9IA 2BYVE 1X1AA 4U0VA 3FXQA 1SVLA 2R7XA 3ISPA 3MVPA 1M1EB 3OYAA 5C4JJ 1UCRA 1YI2I 1A36A 4M3BA 1LNWA 2KFDA 2XHKA 1RUOA 2HGCA 4V2FA 2VKEA 4F93B 1SFXA 1VI0A 2QVOA 2PBIA 2HKXA 3L2VA 1LUJB 2IS4A 2ZMEC 2DMQA 2CRGA 1IV8A 2JTVA 3FKJA 2K3PA 1XS9A 1A04A 2M5WA 3A01B 5IOYA 4A3GJ 1SVOA 3QYBA 2VT3A 5GAEJ 3L2WA 3BPVA 2OA4A 3IRQA 4JP0A 2Y30A 3WE3A 1RR8C 1UZCA 2MGQA 2I10A 1TQIA 5ICCA 1VQ5I 4BACA 4X0GA 3OYMA 1NH3A 4L9TA 2BY3A 3LA7A 1TWCJ 2EK5A 2O3FA 1LDDA 4HV5A 3F8MA 1B9NA 2JWTA 3K69A 3LQRA 2IGNA 3J7YJ 2PJRA 3K4JA 2IVMA 3BG7A 5BMZA 1WRJA 5IYDJ 2LH9A 5E20A 1MSFC 4IOAF 4RMNA 4ESFA 3AG2H 2STWA 2BHZA 3LAJA 3B6AA 3A1YA 3ECHA 3VOEA 3HEFA 2L4MA 3KP7A 3GMEA 2IA2A 3BZKA 3NQOA 3J7AO 4XRMA 2XAQA 4RM3A 3CESA 3I64A 4ABZA 4HAMA 4UVBA 1ETOA 5EG0A 4BQOA 2X51A 2CQXA 2LKPA 2LY2A 2YX4A 2QENA 1FLIA 4G7HF 2VOPA 2AQEA 2VJJA 4W97A 4L5IA 5K1YA 2A05A 2CSOA 3HZJA 3T8TA 2R5YB 1FSHA 3MKWB 1A6QA 1VNDA 1J75A 3EUHA 2HWVA 1VQ8I 1BN5A 3QP6A 1HBXG 2EBIA 2L9SA 2QSHX 5L3DA 4I2OA 2FNAA 2HYGD 4XNFA 5F1RA 3J81Z 2ZCWA 4C3IJ 3RYPA 3KETA 1E3OC 2DA2A 3PO2J 1E3PA 4ZDLA 2CQ7A 3A4CA 5CLSA 1U5TC 2ZXWH 3K4MA 3N97A 3NRVA 2NS0A 3BZ6A 2UV1A 3TP0A 5F6FA 4AU7A 5DD4A 3FF5A 4PJ0C 1HQCA 2HTJA 3MQ0A 2PJRB 2JSPA 2L2OA 2NAZA 2VXDA 4UY8I 3E6DA 2ZXJA 1Y8QB 3MKLA 2OQRA 1S7AA 3FXLA 1MBKA 4P9FA 4KIFA 2DAOA 5LHIA 3C2HA 3PQKA 4B3AA 3R4KA 3BQZA 2IAIA 2HZTA 5K5OA 3SXYA 2LP0A 1J9IA 1FX7A 2RREA 4KISA 1R71A 3OS0A 3FXKA 2R7OA 1TLHB 4NC7A 3ZQIA 2R7FA 2FXAA 2IGOA 3WHCA 4R1HA 1RPWA 3SFZA 3LOCA 1OR7A 3ZQGA 3ZMSA 3CCQI 4MQ9F 3S1RJ 5E1WA 5M5WJ 2IW5A 2LBFB 4ESJA 4C3HJ 4XMYA 5J1RA 2HZDA 4Y33A 1DU6A 2K9NA 2RNGA 3C2GA 2DFIA 1P6RA 4XSZF 5E3NA 1AWCA 4I6ZA 2VUMJ 4B48A 4AYBA 4EEFG 1RUNA 2A61A 2KLOA 2DW4A 2DQLA 5D5XB 2V26A 2MD0A 1ZHFA 2P4WA 1QVTA 1U0JA 3EUKL 3I4MJ 4BDZA 4C30A 3W2WA 1FC3A 3GTQJ 4BY1J 2GWRA 3ERMA 1ZGAA 2L9RA 4BH9A 3GTKJ 2BXYA 2FBHA 4BU2A 1T8IA 1YOVB 1T39A 2R7ZJ 1BW5A 1I50J 2EPFA 2IEKA 3RCOA 1FTTA 1V5EA 3DKXA 1ON1A 3RKYA 1TWGJ 4DOZA 1QZYA 4YELA 4OMZA 4UUTA 2LRDA 3DCFA 1ETKA 1Z77A 6PAXA 4LB6B 1TC3C 4XKBA 2E2IJ 3ZQLA 5FLXK 1D8KA 1IAWA 3P7NA 1H88C 5HLTA 3SDGA 4IL6C 3HPGA 4E70A 3TKYA 4EM1A 2BZTA 1GV2A 1HXDA 5HS7A 4XRSG 2QSFX 1LEBA 2QKLB 4HX4A 2ELHA 9ANTA 3OIQA 5CYVA 3IAM2 3HRTA 1LB2A 1HKSA 2NYXA 1GV5A 2DFEA 3H3UA 1BR1A 1WKMA 3RJPA 4UUSB 4PJLA 1UHSA 4HV6A 1D5VA 3HYIA 4ZDOA 4KFCA 1B9MA 4A6DA 2CWEA 2HQAA 4LG0B 5E1ZB 2DQRA 1QA6A 1G59A 1ZGJA 3K4KA 3X2QH 4CUGA 5FKOA 1QQIA 2QQBA 4RAZA 2P5LC 2XB0X 4HNVA 2VI6A 4WF2A 2HI3A 5GTHC 4FQGA 2DCEA 5K7HA 3R0JA 4BY7J 3M3YJ 1Y0NA 2ECBA 3QYFA 3GXOA 3S2HJ 2OF7A 3HOUJ 2EIMH 4ZJZA 1IUFA 3BY6A 3U21A 2LK2A 1YS6A 4RM2A 3ML6A 3WU1B 2V9VA 2F48A 2KHMA 4J19A 4CGZA 3MZ8A 5K5RA 2ZKZA 2FRHA 4U0YA 2CFXA 1P4XA 1R23A 2QCOA 2XGEA 5AIPA 4LIUA 1FWZA 3J80K 3IV5A 1NG6A 2OQGA 5ED4A 2NOJB 3OMYA 2X6XA 4IO9F 1KONA 1Z7UA 2EQRA 1OYWA 2CJJA 1MJAA 2IGMA 1FT9A 5EEGA 4NB5A 3O3KA 2D45A 1S3JA 2ACJA 5LGUA 1Y56A 2ZJPF 1YLFA 2A5YB 4MHGA 2HYFA 2WAQA 4RGRA 1B6AA 5LGNA 3CZ6A 3QPLA 4N4OB 2K4BA 1F4KA 3DBHB 3H5RA 4XBFA 2YPRA 3JSOA 4KYWA 4UUVA 1IN7A 1ETQA 1R1TA 4E4HA 1Z1DA 2K9MA 2WWYA 3GBGA 4UUSA 2FA5A 3OYIA 3KEQA 3GTGJ 2DJIA 3FXUA 3GWZA 4HBLA 1MDMA 1U8BA 3WTVC 2VKHA 1IG7A 2EFQA 4CCKA 4M3FA 3C2BA 2XF5A 2CQKA 3I4PA 5IP9J 1XMKA 1SANA 2CUZA 2HDWA 4IVNA 2RVCA 3E6BA 3WE2A 4AUXA 2LSOA 2CUEA 3J80Z 4FETA 4N9HA 2HNHA 3AKZA 2BY0A 3IRRA 2XC7A 1A5JA 2JPCA 5DCMA 1V5FA 1TNSA 2JN6A 2O0YA 3ESWB 5FFXA 4A69C 3RYRA 1OCTC 1UHWA 4PJJA 3BT9A 4IHVA 2TDXA 2Q1ZB 4A3DJ 3QQAA 5D8LB 1GVDA 4Y4RA 3HM5A 5CVIA 1IXSB 1T33A 1X1PA 3FHNA 5LBQA 4C2MJ 4LMYA 4XSXF 1MH3A 4NUBA 3WTTC 2JZYA 1SVMA 4CDGA 3MKZA 2PMZA 3FISA 2VBXA 4BUPA 1RETA 3IC7A 5LRRA 3G71I 1JT6A 3LFUA 1DP7P 2FUG2 2MW8A 2R7QA 2DTRA 1FIPA 1ZARA 4U7DA 5J8FA 2ELJA 3Q5FA 4A3CJ 1P2FA 1TZLA 3A0BC 4HZFA 3RKQA 1FEXA 4RLQA 3S8PA 3O8HA 3DLLF 4N9IA 2E1OA 4CA0A 1XX5A 2WB1A 4AIKA 3S3OA 5FJ8J 4BE2A 2ZXHA 2K9LA 1TNTA 3WODF 4IKFA 2GOXB 1MJBA 2WC2A 2OBPA 3ERED 3KYDB 4ZYDA 4ZC3A 1YW8A 1Z3YA 2LR8A 1L3LA 1MNMC 2R7VA 5EEHA 2LDUA 3SYTA 4UNOA 1BBYA 3LQQA 3F22A 1WHUA 3L1PA 2KPMA 1HDPA 5KHDA 2VT2A 5CQGA 3ZMDA 5M5YJ 4KMFA 2IJLA 4KIGA 5DUIA 5HOOA 4EJUA 2XGDA 1OYYA 2EZHA 4KT5C 3LSPA 2Q2EB 3OOUA 5KAFC 3ABMH 2ETHA 1IRGA 3OOPA 4XK4A 3BTCA 4G7ZF 1OPCA 3T5XA 3BG5A 2AO9A 4YFKF 1UFMA 2JT1A 5HVQC 4LLNA 5J1UA 3GTOJ 3CF5F 2A3SA 1SFEA 3OSFA 2DTZA 2X6YA 5AONA 4AC0A 1MBGA 2W1OA 5J6XA 3CO6C 4MQVA 4V19K 2L7MP 3DBLB 3OYGA 3FHZA 4I0BA 3Q9SA 2YUSA 3CJRB 4XIDA 3U1KA 3K10A 2NRAC 1FPQA 4OOIA 4R79A 1UMQA 2IBDA 4BHPA 4E7IA 1WVRA 4A3KJ 1C0WA 1BM9A 4BQNA 4NC6A 3K2AA 1JTYA 4D0PA 2JMWA 2VBWA 4A0XA 2M1BA 3CMEI 5E18F 2XRNA 2DFFA 2XAUA 1FMVA 3OYBA 2AS5F 2IS2A 3I0TA 2DK8A 3A03A 4IRHA 4EV0A 1IF1A 4A3BJ 1VQ4I 4BNCA 3HTSB 1S5LC 2LLKA 2EV5A 3JCUC 2I5UA 5A2QK 2PI0A 4JBAA 4E7KA 2KISA 3H0DA 2DK5A 3EPZA 4JX5A 4A3EJ 1X1BA 4OINF 1V5GA 5D6EA 3KYLA 3QPHA 2M0MA 1IXCA 3OYCA 1QPIA 3NWSA 1RKTA 1X58A 1RESA 2M34A 2OZ6A 2FE3A 2W85A 3HG9A 4B8XA 2XPVA 3J81K 2E19A 4IX7A 1ZR2A 5E3OA 2OD5A 3BLYA 3OSGA 2XROA 5D4RA 1Z6RA 1FBUA 2VODA 3VYTB 3TQNA 1B72A 3TL4X 3C1DA 3OV8A 2HPIA 1VQMI 1J7KA 4C3JJ 4B3XA 1D5YA 1G6NA 3KP3A 5E17F 1JHFA 3OS2A 3BOQA 3ZMZA 1FOWA 3CD6I 2AQFA 3LWFA 3U1DA 3JRCA 4XLPF 4C2TA 4NBQA 2EFOA 2K4JA 5JLXA 3S3MA 1QBJA 3DFGA 2DXIA 3DXJF 3KFWX 2RV8A 3D0SA 2WV1A 1EA3A 3CCMI 4G6TB 2KIFA 5CPRB 3GX4X 2FMYA 3OYKA 4FTHA 1OCOH 3OL3A 5FB2A 2W00A 1MDMB 1I39A 3S1NJ 1UB9A 3ZMUA 3F8CA 5EEAA 4EJTA 5IT9Z 3JREA 1O57A 1QNTA 4A6EA 3CC7I 4XR6A 4CYDA 2STTA 2M8EA 4XLAA 5B3SH 4XN0A 2DFHA 1WPKA 3VEPA 2YX7A 1OMIA 2G7HA 3SZPA 3WU0A 1YHQI 1YW9A 1P7IA 3U9GA 1XGMA 3AG4H 5FLXZ 1BL0A 1FTZA 1MBJA 2UZKA 3GO5A 1P4AA 3F6VA 1TWHJ 2QWWA 3AG3H 3PIOF 1R9TJ 3GFIA 4UVCA 5HS9A 4XKWA 1O3QA 3BPXA 2Y0SA 1Y8RB 3PO3J 2JVGA 4IHTA 1D0ZA 1DGRM 3D5SC 3IKTA 5M5XJ 2E1MC 1FP1D 1V55H 5HLIA 1T0FC 2UXXA 4CYCA 3OYDA 3PNYA 2PJPA 1K83J 2KZGA 1ZG5A 1XSDA 1W0UA 3M07A 5JHUA 2DA6A 1EKEA 3Q3SA 3DKYA 3ZQFA 3PJRA 3S14J 2FSWA 5FKKA 4YFXF 2X1CA 1NTCA 4MFDA 2HVSA 3LSJA 4KJZA 1QGPA 1J5YA 4XORA 2FX0A 4HX7A 4OMYA 4BBRJ 4BJ5C 3BWGA 4II3A 3BG9A 2AXTC 3DEUA 3I3LA 1A35A 3ZMVA 1T6SA 3K1MA 1FP2A 2X6OA 2H1LA 3AL0B 1XC5A 1W4MA 4BBSJ 4DGWB 1HSTA 1IDZA 3KP5A 2QSGX 2EFNA 3IP4B 5ILUA 5D5UB 3OYNA 2L7FP 1RZ4A 3MEXA 4S05A 2OV7A 2MG4A 1YX5A 2VBYA 5F64A 2VIXA 1WJFA 3ZOBA 3TEDA 2LF7A 1A31A 3M4OJ 1ETYA 2CQQA 3QRFF 1R4MB 2Z33A 1OKRA 3UKGA 4EVIA 3ULQB 5LHGA 3BR2A 4KDPA 4WCGA 1J09A 1D0YA 1HKQA 3KP4A 3D1NI 4QLCU 1JGSA 3CP2A 4O6JA 1YQAA 5KNLA 3K70D 2TRTA 3WU2C 5D8KB 3CC4I 3C3WA 1K4SA 3I56I 1V4RA 2NOGA 1QRYA 1R5GA 1L0OC 2VKVA 2D5VA 1H8AC 2XB5A 4ZTJA 1T2KA 3W3CA 3IUOA
chains in the Genus database with same CATH topology
4IOAF 3CF5F 1VQ7I 3CC7I 3EGVB 5DM6F 2K3FA 5GADJ 2OTLI 1YHQI 5JVGF 2JQ7A 3CCRI 1FOYA 4V19K 3CC2I 5GAGJ 3CJRB 3PIOF 2H8WA 4IOCF 2ZJRF 1FOXA 1VQLI 2E36A 2QA4I 3CCLI 3I55I 1YITI 3CJQB 3PIPF 3J7ZI 3CMEI 1VQ8I 2OTJI 1MMSA 1VQ6I 1HC8A 3CJSB 3CCVI 2ZJQF 1VQ4I 5GAHJ 1QA6A 3CCSI 3G71I 1VQPI 4UY8I 1YI2I 1YIJI 1YJNI 3DLLF 1VQKI 1ACIA 2QEXI 1WIBA 5DM7F 1VQ9I 1VQMI 3G4SI 1VQNI 3G6EI 1FOWA 1YJ9I 3CCQI 3CD6I 5GAEJ 1YJWI 3CCUI 4IO9F 2E34A 1VQOI 1VQ5I 2E35A 2NXNB 3CCJI 2FOWA 3CCEI 3CMAI 2ZJPF 3CC4I 3CCMI 3I56I 3J7YJ 1S72I 1Y39A 3CJTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOA F;  3CF5 F;  1VQ7 I;  3CC7 I;  3EGV B;  5DM6 F;  2K3F A;  5GAD J;  2OTL I;  1YHQ I;  5JVG F;  2JQ7 A;  3CCR I;  1FOY A;  4V19 K;  3CC2 I;  5GAG J;  3CJR B;  3PIO F;  2H8W A;  4IOC F;  2ZJR F;  1FOX A;  1VQL I;  2E36 A;  2QA4 I;  3CCL I;  3I55 I;  1YIT I;  3CJQ B;  3PIP F;  3J7Z I;  3CME I;  1VQ8 I;  2OTJ I;  1MMS A;  1VQ6 I;  1HC8 A;  3CJS B;  3CCV I;  2ZJQ F;  1VQ4 I;  5GAH J;  1QA6 A;  3CCS I;  3G71 I;  1VQP I;  4UY8 I;  1YI2 I;  1YIJ I;  1YJN I;  3DLL F;  1VQK I;  1ACI A;  2QEX I;  1WIB A;  5DM7 F;  1VQ9 I;  1VQM I;  3G4S I;  1VQN I;  3G6E I;  1FOW A;  1YJ9 I;  3CCQ I;  3CD6 I;  5GAE J;  1YJW I;  3CCU I;  4IO9 F;  2E34 A;  1VQO I;  1VQ5 I;  2E35 A;  2NXN B;  3CCJ I;  2FOW A;  3CCE I;  3CMA I;  2ZJP F;  3CC4 I;  3CCM I;  3I56 I;  3J7Y J;  1S72 I;  1Y39 A;  3CJT B; 
#chains in the Genus database with same CATH topology
 5KCM A;  3RKX A;  3SEZ A;  1I3A A;  1BC8 C;  1V3F A;  4IHX A;  4XRS A;  2VN2 A;  3SEQ A;  3GFM A;  2X1D A;  5AIQ A;  2GA1 A;  3LSH A;  1X4O A;  3JSP A;  4L0Z B;  2M0C A;  3DEE A;  4ZH4 F;  1SFO J;  4DYQ A;  4M6Y A;  3CC2 I;  2F5E A;  2OZU A;  3CP8 A;  3K4B A;  2JPB A;  3RQ4 A;  3WGH A;  2LYC A;  4LK0 F;  4HNU A;  5BS6 A;  1G2H A;  1DGW Y;  2BOL A;  4XKV A;  1IRX A;  4F91 B;  3MAJ A;  5CJ9 A;  4IOC F;  2DA5 A;  3JW4 A;  2GIZ A;  3TDZ C;  1FOX A;  1MBF A;  4QWQ A;  1LFB A;  3DWL E;  2XAS A;  5DCF A;  4DJA A;  2XSD C;  3OYJ A;  2IGK A;  2VC0 A;  4WWC A;  4HYE A;  2H6C A;  4XLH A;  4W1U A;  1RKW A;  3HXL A;  4U7B A;  4IQJ A;  2WV0 A;  2V79 A;  4K2E A;  5IP6 A;  3Q9V A;  1G3Y A;  2VPR A;  3CJS B;  1X2M A;  4ENN A;  4A5M A;  3CCV I;  2PFB A;  4LJZ F;  2DT5 A;  4NC8 A;  1R6R A;  5HLG A;  4PSW A;  2E1M B;  2GXG A;  3HJE A;  3F3X A;  5L3F A;  4LG3 A;  4D1Q A;  2QBY B;  2ELK A;  3PFY A;  3QU6 A;  4IF4 A;  4GO1 A;  1AOY A;  4RB3 C;  4DBQ A;  1PUF B;  1TL8 A;  2E1N A;  3EUA A;  2P5V A;  4AYB N;  2O61 A;  2R5Z A;  2VKD A;  4M71 A;  1FIA A;  1Z21 A;  3OY9 A;  1IGN A;  4X6A J;  1R1V A;  1TWF J;  1G4D A;  3WTX C;  2EWN A;  3R6S A;  1WJC A;  2RGV A;  3RPU A;  1R58 A;  1TQM A;  2OAZ A;  3ZQC A;  3BQY A;  4MFE A;  1VF9 A;  2ZBK A;  2GLO A;  2HDD A;  1VZ0 A;  5F27 A;  2E1C A;  2Z99 A;  4MTE A;  3FWE A;  2GA2 A;  4G12 A;  1R7J A;  1GVJ A;  1MBH A;  2EIL H;  2VB6 A;  1ORK A;  4LOC A;  4ZTF A;  1AU7 A;  3L2Q A;  4WXH A;  1MMN A;  4FT8 A;  5F0H A;  3FBI B;  1YYV A;  3MZH A;  4UXN A;  4B47 A;  5LGT A;  1MZB A;  5E3L A;  1KYW A;  1PJR A;  4CH7 A;  2PMH A;  1WSU A;  1WFX A;  3BR5 A;  1BR2 A;  3UNG C;  4I02 A;  1X2N A;  1ZAO A;  1MKM A;  1QO0 D;  4BHC A;  2ZNY A;  3IH2 A;  2LRE A;  4BDY A;  4CCL A;  3M9A A;  4I01 A;  2YR2 A;  5FKM A;  4Q48 A;  1MJ9 A;  4XKC A;  4MGR A;  3MZY A;  3QPT A;  5JHF A;  3IL2 A;  2M3A A;  3LA2 A;  4TV7 A;  1Y39 A;  3ZCO A;  2OUM A;  4AWX B;  1MMD A;  3HSR A;  1REP C;  2RQP A;  1ZKG A;  1VQ7 I;  3C18 A;  2ID3 A;  2DLL A;  1O3R A;  4KN4 X;  4LK1 F;  4LGW A;  2MA3 A;  2W48 A;  4MTD A;  1GXQ A;  3DU5 A;  3H9G A;  1XSX A;  3ABU A;  2L7K A;  3E7L A;  3S1Q J;  3CMM A;  4MO7 A;  2P6T A;  2L02 A;  4CIC A;  1T98 A;  3IWF A;  4CHU A;  3E5X A;  5L3B A;  3BG6 A;  2E7W A;  4BAY A;  4BQA A;  2LY1 A;  5HDN A;  4EQQ A;  3ECO A;  3L2C A;  1VQL I;  5H6Q A;  1YW7 A;  2ID6 A;  1PVE A;  2ZSI B;  3I9V 2;  5EGO A;  1K7A A;  2EZL A;  2K85 A;  3CUQ B;  4A3L J;  5E8G A;  4OAZ A;  2FNP A;  3H5A A;  2IXS A;  1MIJ A;  2TCT A;  2EB7 A;  4Y52 J;  4FX4 A;  2LTP A;  3FBN B;  2JA7 J;  2VAS A;  3S32 A;  1ETX A;  4U88 A;  3F6O A;  2A68 F;  1VFC A;  3PL8 A;  3LSK A;  2EFP A;  5TRD A;  2B9S A;  2Y48 A;  1FOK A;  2V9P A;  4HA8 A;  2ZXI A;  1R4N B;  2B0L A;  1BOA A;  2M7A A;  2ECC A;  3E3V A;  3M1E A;  3PNT A;  3R61 A;  1R00 A;  2VQL A;  1XCV A;  2K7L A;  2WBM A;  1IDY A;  4YIR X;  5BPI A;  4GRI A;  2CV1 A;  3BR3 A;  1YRN B;  4UB8 C;  5B1A H;  1TQP A;  4MEY F;  1QU3 A;  5DCM B;  2M9H A;  2PQ8 A;  1ACI A;  5M3F J;  1WJ5 A;  4HLX A;  3H35 A;  1ENH A;  3MMY B;  4E7J A;  2V6C A;  3K6G A;  3I5U A;  1SD4 A;  2H6B A;  2LOO A;  1W7P A;  4RB0 A;  4HX8 A;  3HDD A;  5EJC A;  3QP5 A;  3GLL A;  3SQN A;  4AID A;  2KIU A;  2HPM A;  3DBR B;  2V6E A;  2R7S A;  1I27 A;  2NXN B;  2FQ4 A;  1I6X A;  5DD8 A;  5DEQ A;  2NS7 A;  3MWM A;  3COA C;  4WXC A;  2CO5 A;  5HDK A;  5IOZ A;  1UAA A;  3WHB A;  3BCB A;  2FJ1 A;  2RKH A;  3CDL A;  1O4X A;  4DW6 A;  5D5W B;  3F21 A;  5EF6 A;  1LDJ A;  4IRG A;  1EJ9 A;  1WCM J;  3FK6 A;  3EUH C;  2FML A;  5F0F A;  4ZYA A;  4G7O F;  2R7R A;  2EZI A;  1SFK A;  1ZH5 A;  2ZC2 A;  3DTI A;  3RPU D;  2PN6 A;  3IWZ A;  2KIM A;  3AL0 C;  2M2E A;  4HST A;  3GUD A;  1MMA A;  2KDO A;  2GIV A;  4AD9 A;  3H9J A;  1XPX A;  3DP7 A;  1U6G A;  2QF7 A;  3JRA A;  5HNH A;  2CV0 A;  4DNC A;  4D7M A;  5J8C A;  4B1R A;  1LKX A;  4UV9 A;  3TOA A;  4BL0 B;  2O8X A;  1LE8 B;  5FGM A;  1YRN A;  3HPH A;  2LMD A;  2BY2 A;  4AVZ A;  4CCM A;  3A0H C;  2DA3 A;  2Q2E A;  4P55 A;  3MCZ A;  2IT0 A;  4F55 A;  3DPL C;  2QBY A;  4IJA A;  4NDL A;  5D4S A;  5EYR A;  5H20 A;  3KPH A;  4F7Z A;  2R5Z B;  1O3T A;  4B09 A;  5K5Q A;  2X9D A;  1LVK A;  2ZSH B;  4KA4 A;  2CYY A;  2XIG A;  2YU3 A;  3RSN A;  3MN2 A;  3ZPL A;  1R1U A;  3E5U A;  2X1E A;  2R92 J;  4KMU X;  4XQF A;  3ASN H;  3TDU C;  5DYM A;  2ADU A;  2FD5 A;  1S8N A;  5BOX A;  2CS3 A;  2VL8 A;  1PYV A;  2CUJ A;  3PQJ A;  3HHG A;  2N8G A;  1T38 A;  2M45 A;  2LBF A;  5H6R A;  4PJN A;  1VTN C;  3C7J A;  3DTE A;  4Q4Z F;  1YS7 A;  1K79 A;  1SMT A;  3FM3 A;  1MND A;  5DM7 F;  1VQ9 I;  3JRB A;  4LIV A;  2HXO A;  1SD6 A;  1PP7 U;  3RZO J;  2JRM A;  2VLA A;  2E71 A;  1EV7 A;  3V7R A;  4H0E A;  3KX2 A;  1I6H J;  1TWA J;  1TP4 A;  3BR1 A;  1IZ1 A;  2FBK A;  2HFH A;  4D5F A;  1HW5 A;  5LEJ A;  2FOW A;  5IPA A;  2Y75 A;  3GTP J;  5LD2 C;  4IXA A;  2VE9 A;  4DZJ A;  4EJW A;  3B02 A;  2QKM B;  3DLA A;  5FKL A;  5CVJ A;  4FCY A;  2Z9O A;  2BW3 A;  3WTW C;  3QOP A;  1T08 B;  2Z16 A;  3JTG A;  1X4P A;  2KP6 A;  1YX3 A;  3ZQ7 A;  2E5N A;  4ZYH A;  5CVR A;  4BXF A;  1JUS A;  4XIC A;  3ZRG A;  3FZV A;  4ASN A;  4B44 A;  1JE8 A;  1J2X A;  2K3F A;  4G9Y A;  2VJ5 A;  4HDV A;  4M9S A;  1XSV A;  1H0M A;  1D1B A;  3CLO A;  1ZRE A;  2Z2S B;  5ICF A;  4E7S A;  5EGO B;  3CUQ A;  2DOF A;  3HC7 A;  4Q47 A;  3V7S A;  2HOA A;  1Q1V A;  2WAE A;  3VWB A;  3PUB A;  5HNF A;  4HOB A;  3CJN A;  3HOX J;  2H8W A;  3HRS A;  4XLE A;  4B4C A;  1OJL A;  3BJA A;  2EJR A;  4L9N A;  4PUS A;  4Y13 A;  1W36 C;  2H94 A;  4M3G A;  3TO9 A;  4HW0 A;  3LSM A;  3ZXS A;  1UEL B;  4RAF A;  5ICG A;  3SJM A;  3CUQ C;  3BG3 A;  3GTL J;  1NHA A;  2BEO A;  5DV5 A;  3FXM A;  3F72 A;  1QVU A;  1G3W A;  1S7E A;  4P9U A;  2R7U A;  5E1X A;  2F5V A;  3ONQ A;  2DPU A;  3SZG A;  1BI2 A;  4E7Z A;  1K6O A;  2CMP A;  1IN4 A;  2A69 F;  3BCA A;  3H5N A;  2HDC A;  1GDT A;  5JR3 A;  1Z3X A;  2W84 A;  5EZH A;  5F04 A;  3GFL A;  1KU2 A;  2PMU A;  2V1N A;  5A2Q Z;  1XGS A;  1EH8 A;  1S6L A;  4M74 A;  4Z2Y A;  3P9C A;  1R36 A;  5TGT A;  2E5Z A;  3DF8 A;  1SAX A;  4XM3 A;  1GLN A;  3DV8 A;  2MH9 A;  1JGG A;  1VQK I;  1E0E A;  3T0Y A;  3BJ6 A;  1E17 A;  5JFR A;  3G4S I;  2QYO A;  5KAI C;  5DTD A;  3VYS B;  2ICW G;  2XDV A;  4II2 A;  3OYL A;  1PUE E;  4BEH A;  4IHS A;  1ON2 A;  3GFJ A;  4I0A A;  2IPQ X;  2QZ8 A;  3KIO A;  1ZRD A;  2MD5 A;  1VQO I;  1U8R A;  2K9S A;  1STZ A;  4XRF A;  4PGH A;  1RNL A;  3M1C A;  4A0Y A;  3UR3 C;  3CMA I;  4PZJ A;  1KU3 A;  2AXL A;  1BJZ A;  1X3W B;  1D1C A;  3G1O A;  3HGG A;  4A3F J;  1H9G A;  2HS5 A;  5IYC J;  3L2U A;  1Z6T A;  1WJA A;  1WJD A;  1ITY A;  3E5Q A;  2CFO A;  3LA3 A;  4LFU A;  2DDB A;  3GEZ A;  2ISZ A;  3J7A Y;  3CJT B;  1D1A A;  2X48 A;  2Q8K A;  3RTR A;  4HG2 A;  2F5D A;  4S0H B;  4D7N A;  3W2A A;  5LFA A;  3VOD A;  1ZR4 A;  5DM6 F;  2HQR A;  2XUB A;  2VJI A;  3BDD A;  3TGN A;  1RRJ A;  1CGP A;  2OTL I;  2O7O A;  3TOB A;  4MLO A;  1HKT A;  4Y15 A;  2JQ7 A;  4BXU A;  1ERD A;  1I1S A;  4QIW N;  3HBL A;  5BPD A;  2DBB A;  4LB5 A;  3S16 J;  2Y9Z A;  3K0L A;  2UUZ A;  1WJE A;  3M8E A;  4CCJ A;  2O03 A;  3NEU A;  3KP2 A;  1FYM A;  2Y0M A;  2F5C A;  4BHB A;  2G0E A;  4S04 A;  1BI1 A;  2EV6 A;  4FE7 A;  2ZJR F;  4FX0 A;  2LKX A;  1ZG3 A;  3DPU A;  3NWT A;  1DDN A;  3BZC A;  5E8I A;  4BKX A;  1JHH A;  3HKZ A;  4OWR B;  1ZRF A;  2BXZ A;  1DU0 A;  3I71 A;  1IRZ A;  4E7L A;  3FMS A;  1MBE A;  2IS1 A;  1DPR A;  4WX9 A;  2V9K A;  4IZZ A;  2D1V A;  4PDK A;  1TBX A;  4EJO A;  1K78 B;  1ETV A;  2GQQ A;  4BEH B;  3OYE A;  1HW1 A;  1Y1W J;  3OS1 A;  2ZNZ A;  3FDY A;  4OIR F;  3CDI A;  5J1Y A;  5IT3 A;  2V1D A;  2PX9 A;  2K9Q A;  2CUF A;  3HHH A;  4RB1 A;  5LEK A;  2RN7 A;  1V54 H;  3CO7 C;  1FYL A;  2HOS A;  1KGS A;  1F36 A;  1N25 A;  2KRC A;  1ZRC A;  5DUK A;  3ROU A;  2DMN A;  2R5Y A;  2K40 A;  3OYF A;  1HW2 A;  4NNJ A;  3WTZ A;  3K70 C;  2LD5 A;  1XDU A;  4MNU A;  1O7L A;  2I8D A;  2BHY A;  4A2U A;  2MBF A;  1SFU A;  2PLY A;  1EF4 A;  2CGP A;  5M3M J;  2WA0 A;  1HLV A;  2DYR H;  4E6K G;  2QEX I;  5F0C A;  5CVU A;  2VJ4 A;  4BJT A;  3P5J A;  1D3Y A;  4A5N A;  2HQ5 A;  4M6V A;  1IRF A;  2FF4 A;  1ZTR A;  3EDP A;  4NQW B;  2YSR A;  3JRI A;  3RQI A;  3MD2 A;  1LQ1 A;  3T1B A;  4BE1 A;  4HRI A;  1GUU A;  2DMU A;  3Q0W A;  3HUG A;  2BW3 B;  4FE4 A;  1NK2 P;  4GCV A;  2E35 A;  4HDU A;  3JTH A;  3FKI J;  1EH6 A;  2A5W A;  2YS9 A;  3GVA A;  2CQN A;  3W2V A;  2IP2 A;  1W5T A;  2UXN A;  5TJJ A;  3OYH A;  3LAP A;  2FU4 A;  4UB6 C;  1JKO C;  5F08 A;  2DT6 A;  2XF7 A;  2LNB A;  2NVQ J;  1WH7 A;  2COB A;  1FJL A;  2CG4 A;  3E0J B;  2W7N A;  3HSE A;  3WG7 H;  1G8X A;  1JJ8 C;  3JRG A;  2W24 A;  2XAJ A;  1RR7 A;  2MC4 A;  2Q0O A;  4N4N B;  1BIB A;  5B1B H;  3KEO A;  5GAD J;  1OCZ H;  4LIT A;  1SD7 A;  4M9X A;  4LD5 A;  3QAH A;  5FD6 A;  2K02 A;  1IN8 A;  4P5O A;  2KJC A;  4AIJ A;  2GM4 A;  1U78 A;  2HU9 A;  1Z9C A;  2KRH A;  4IRI A;  5DDG A;  2QQA A;  3R60 A;  4AM3 A;  2KZV A;  5ILV A;  3MFK A;  3BJO A;  1KYZ A;  1LVA A;  5FKN A;  2DYS H;  3NAU A;  2L5Q A;  1T95 A;  4GGG A;  3DQV C;  4M3E A;  1MW7 A;  4D9J A;  1X3Z B;  1YIT I;  2R7W A;  2KL4 A;  1JUM A;  3L00 A;  4U87 A;  4EJV A;  2E2J J;  2X6W A;  5H2F C;  5DS9 A;  4OU0 A;  1UST A;  2OU2 A;  3A2K A;  1IN6 A;  1WZ2 A;  1KQ9 A;  3K4L A;  5C3E J;  2XKO A;  4QSH A;  4ZDP A;  1H9T A;  2Z5U A;  3QYE A;  1WH5 A;  2V7F A;  1UG2 A;  3FM5 A;  3EYY A;  1B59 A;  1P7J A;  4P1W A;  3SZT A;  3ZQQ A;  3GLX A;  1NG7 A;  4CCO A;  3FXJ A;  5D5V B;  4EM0 B;  3VYR B;  1JXS A;  5J3L A;  1HF0 A;  3F0C A;  1XMX A;  1TT0 A;  4NHJ A;  3V8J A;  1H89 C;  2VQG A;  2ZFU A;  2LVS A;  5E79 C;  4GDF A;  4ESB A;  4CXF A;  3ZGK A;  4IQ4 A;  4D5C A;  4XOT A;  4OIO F;  1F9N A;  4RAY A;  4LG0 A;  1BIA A;  2MAB A;  4N0B A;  2Z3Y A;  2FEZ A;  2JSC A;  3BP8 A;  2V1X A;  4IPA A;  2D2W A;  3LSG A;  1GT0 C;  3ZN0 A;  2DO7 A;  3V7C A;  4I99 C;  2RNJ A;  1U2W A;  3K1P A;  4M9Z A;  2X85 A;  2ME0 A;  2CW8 A;  1WGX A;  3H0G J;  2VON A;  2F2E A;  1B1B A;  4HQE A;  1HSJ A;  1OCP A;  1Y1V J;  3H36 A;  5FRM A;  1USS A;  5BNG A;  2EIK H;  5ILS A;  1X3U A;  3I58 A;  1IUY A;  3WTU C;  3HTU A;  4L5E A;  1TTY A;  1S7O A;  3I59 B;  3PNV A;  1QHH D;  3JR9 A;  2XPW A;  3QU3 A;  1KU9 A;  3G2B A;  3LSI A;  3K9T A;  4L9V A;  2K86 A;  1CF7 B;  2BE5 F;  1IXR C;  2DN0 A;  4R8H A;  1T0F A;  4Z6Y A;  2JA2 A;  1J59 A;  4XL9 A;  1Z67 A;  1BW6 A;  2ZME B;  1P9Q C;  1O3S A;  1W7P B;  3E6M A;  2HR3 A;  4WK8 F;  1YTY A;  1CQT A;  4L9J A;  3OIO A;  1OR7 C;  4CYC B;  4YEJ A;  1JJ6 C;  1N77 A;  2ISY A;  2IRF G;  1DPU A;  3V42 A;  1ZEL A;  4OAY A;  1Z05 A;  1XN7 A;  2L4A A;  3LST A;  3PM1 A;  1QPM A;  1F5T A;  3IH4 A;  4FAS D;  3T8R A;  4UHT A;  2XKP A;  1DUX C;  2XRL A;  1IO2 A;  5K7Z A;  3F8B A;  3L9F A;  1IJW C;  4HNT A;  3H3V K;  4RLF A;  4U0W A;  2L9N A;  1OFC X;  2R7T A;  3VSK A;  4M73 A;  4KUM A;  2Y2Z A;  4XN3 A;  3VDX A;  3CCY A;  4EM2 A;  5GTI C;  3OIP A;  2MC3 A;  3HOS A;  3WTY C;  1ZGW A;  2P7V B;  2DPD A;  4UVA A;  2PMZ N;  4X1E A;  1HOM A;  3RKW A;  5FLM J;  1BA5 A;  2ZJ2 A;  4A3J J;  2OCE A;  1FNN A;  1IW7 F;  3PSF A;  5GPC A;  2ZB9 A;  1LE8 A;  2DA4 A;  5L3C A;  1KZH A;  4A93 J;  1S9H A;  2P5K A;  5FRO A;  3G1L A;  1MMG A;  2QQ8 A;  4LLG F;  5CQE A;  5C4X J;  1YG2 A;  3DKW A;  3KLN A;  4HLY A;  3S3N A;  3S17 J;  2JVH A;  4YIF A;  3JAM Z;  3O2P E;  4NQW A;  2DA1 A;  4ENM A;  2QUF A;  1J0R A;  1TT5 B;  2OPT A;  2VE8 A;  2OJE D;  3CF2 A;  4CSW A;  1Q1H A;  2DOA A;  1MSE C;  3RZD J;  1XGO A;  2W57 A;  3K4N A;  1LDK B;  1XDS A;  1E3H A;  1G3T A;  2Y9Y A;  3G6E I;  1XB4 A;  4O5V A;  3FX3 A;  3W6K B;  1DQU A;  1JUP A;  1GHC A;  1YJ9 I;  1JKR C;  4QTR A;  3AFH A;  4YII A;  2X4H A;  5K7F A;  3HRM A;  4M72 A;  3GTJ J;  2LG4 A;  2F4I A;  2COM A;  1FBS A;  2MYS A;  3KZI C;  2M4G A;  3N4M A;  1W36 D;  2Y31 A;  1E2X A;  4ENK A;  3U2R A;  3HOW J;  3BR0 A;  3LSR A;  1S72 I;  3ZQH A;  4DIQ A;  1WJB A;  1ZYR F;  4YG2 F;  4IHW A;  5BQT A;  3EET A;  2KT0 A;  1YFH A;  2F5F A;  2K27 A;  5LHH A;  4ZYE A;  1OCR H;  3QPS A;  5CKT A;  2EA2 A;  1AKH A;  3HOV J;  1X1C A;  2M30 A;  3VB2 A;  4A12 A;  3S15 J;  2HOT A;  3EGV B;  1S29 A;  4ZZD A;  2FOK A;  1LFP A;  1OLT A;  2ESN A;  4I09 A;  5FRN A;  3ZP5 A;  4DYC A;  2EIJ H;  2RAE A;  2WTE A;  3Q0V A;  1PP8 F;  4J00 A;  2KRF A;  5FLV A;  5HDG A;  2QM3 A;  2HKO A;  3HOZ J;  1FYK A;  2L3D A;  3ZMT A;  3REO A;  1I1G A;  5ERI A;  1TW2 A;  4BGD A;  3W6J B;  1R49 A;  3SHF A;  3NAR A;  2L01 A;  1N75 A;  3L09 A;  3M7G A;  4HPQ A;  1PUF A;  3H92 A;  3DEW A;  1QZZ A;  4RDU A;  1ONV A;  3S93 A;  4WXD A;  3V8L A;  2NS8 A;  1K6Y A;  3MKY B;  1W7P D;  1ZLK A;  2KKO A;  4XON A;  3V8K A;  5IT9 K;  3TO7 A;  2XAH A;  1X1D A;  5EDN A;  4BE0 A;  3A02 A;  1P4W A;  1X19 A;  2HTS A;  1F1Z A;  3Q0U A;  3E1S A;  4A3M J;  3S2D J;  2XSJ C;  1KQ8 A;  2HQN A;  3K7A J;  1P92 A;  3TMO A;  4V2G A;  2VPL A;  5IYB J;  5F1J A;  2HYJ A;  3CUO A;  3JRH A;  1MNE A;  3IHU A;  2MH2 A;  2WAD A;  4M3D A;  2DJN A;  1VQP I;  2XV4 S;  4MIM A;  1HDD C;  4O3M A;  3I4N J;  3KP6 A;  4UV8 A;  3HB9 A;  2JUG A;  4G94 A;  3GTM J;  1YIJ I;  4FHT A;  1ZG1 A;  2EFW A;  4CO8 A;  5FD5 A;  4Q5S F;  1W0T A;  1AKH B;  4BXX J;  2W4S A;  3K2Z A;  1TW3 A;  3KCC A;  4GXO A;  1EH7 A;  3WGG A;  1JKP C;  3S2W A;  4M6X A;  4ON0 A;  4DYR A;  5KK1 A;  1WIB A;  1SMY F;  5JI6 A;  2M4K A;  1BR4 A;  3GW2 A;  5IP7 J;  1A6I A;  4JOM A;  2CU7 A;  5TIS C;  1MD0 A;  4AVP A;  4Y17 A;  1QHG A;  4A3I J;  2GAU A;  2GBY A;  2XAF A;  1AA7 A;  4RGX A;  3OL4 A;  1I3Q J;  4Y3O A;  3D5L A;  3ZN1 A;  4RGU A;  1D8J A;  2CH0 A;  3O6B B;  1FBQ A;  2E34 A;  3N05 A;  3FMR A;  1K61 A;  5D6F A;  1F43 A;  4DZP A;  2KQR A;  3QWL A;  4JX4 A;  3P9K A;  3K4C A;  1CF7 A;  2DT7 B;  4PJM A;  1QZE A;  1KA8 A;  2ME6 A;  4DQ2 A;  5L3G A;  1Y0U A;  3HOT A;  3CCE I;  1IC8 A;  1B72 B;  2EIN H;  2KIQ A;  3TO6 A;  1AHD P;  4IHY A;  3GF2 A;  4KNY A;  3O8G A;  2A6E F;  2M87 A;  1U9O A;  3RPQ A;  4KT6 A;  2VQC A;  2OC6 A;  2O8K A;  3V4G A;  2DMT A;  3TP3 A;  3E97 A;  3KZY A;  1OQY A;  3HSF A;  2DDA A;  2A07 F;  1XCB A;  2WAF A;  3FXO A;  2NNN A;  3ABL H;  3KZZ A;  1MGT A;  1FSE A;  1O7F A;  1W5C C;  4GYG A;  1IN5 A;  3VFZ A;  2QGU A;  1ULY A;  2CV2 A;  2O9L A;  1Y6I A;  2FBI A;  2X0L A;  2XF6 A;  3DTK A;  4LLL A;  2MFZ A;  3BR6 A;  3R0A A;  1R5I D;  1B8I B;  1OCC H;  4JYK A;  4PK4 A;  4J01 A;  1FOY A;  2P8T A;  1ZK8 A;  2DI3 A;  3GZN B;  1WWX A;  2DA7 A;  1JT0 A;  2HVQ A;  3HGY A;  5GAG J;  5HLH A;  1HA8 A;  2QQ9 A;  1XG1 A;  1LFU P;  2KDZ A;  2L54 A;  4HSR A;  2L9V A;  2QLZ A;  2HEO A;  4ENJ A;  3CDH A;  2D1H A;  2M8G X;  2CW7 A;  2XPU A;  3I54 A;  1YIO A;  2QA4 I;  4QPO A;  1U5T B;  3CJQ B;  3W6V A;  3J7Z I;  2A6T A;  3FXR A;  2BVM A;  5FFZ A;  1W1W E;  1YE9 A;  4FIS A;  4ITV A;  5KVR A;  2JJ7 A;  2KMU A;  3BTI A;  5JLW A;  2WY8 Q;  4RAG A;  2WB1 N;  4XOP A;  3JAM K;  2V1U A;  2R3S A;  4EAT A;  5J4V A;  3SDB A;  4OIQ F;  2R93 J;  1IV6 A;  2Y0S N;  2FQ3 A;  2XVC A;  1KU7 A;  2V4J C;  1Z91 A;  2JA8 J;  3KE2 A;  3G73 A;  1W5S A;  3HL2 A;  2F4M B;  3WG9 A;  2L0K A;  3H3Z A;  4AIH A;  3WTS C;  2XAG A;  3FK7 A;  5J4Y A;  4HF2 A;  4MEX F;  3PUF A;  1G3S A;  2DU9 A;  3F9K A;  3EQL F;  3IKV A;  4HF0 A;  3EYI A;  1YJN I;  3IH3 A;  2G7U A;  2E2H J;  5J40 A;  4JK1 X;  2W82 A;  3RIR A;  1K78 A;  4HF1 A;  2R4G A;  3K1N A;  1B8I A;  1VQN I;  2ZO4 A;  1RC9 A;  3BC8 A;  3AAF A;  1UHM A;  2BGC A;  3DPT A;  2VC1 A;  1MH4 A;  5HOD A;  2GOM A;  4GFB A;  1ZLJ A;  1SAU A;  2JRT A;  2M7B A;  2MLK A;  2NNY A;  2A6H F;  5FO5 A;  1LEA A;  3ABK H;  2RC4 A;  1RIO H;  4G8X A;  3CCJ I;  3A01 A;  5JVT A;  1BI0 A;  1XGN A;  4PCQ A;  4RBO A;  2HVR A;  1U5T A;  3H9Q A;  3D5R C;  4L5J A;  3L2R A;  4C2U A;  2BBY A;  4DBR A;  4F52 A;  4PFO A;  2C6Y A;  1T56 A;  1I5Z A;  3G3Z A;  3M8J A;  4BJ6 C;  2EH3 A;  4EGZ A;  2CW0 F;  1BOB A;  2J5P A;  3BTJ A;  2DOD A;  3KYC B;  4JX6 A;  4XLF A;  1XTA A;  5JVG F;  4H4K C;  1WQ2 A;  1OIS A;  3GZ6 A;  5CVV A;  5IY5 H;  2B63 J;  2AHQ A;  3HUG B;  3L7W A;  3LFK A;  3GCM A;  2ESH A;  3RDI A;  3BRO A;  1R22 A;  3SFI A;  4I98 B;  2PG4 A;  4C9Y A;  4A0Z A;  3FMQ A;  1DP3 A;  4F92 B;  1RI7 A;  2K5C A;  3PSI A;  1ODD A;  2EZK A;  4KIT B;  2E7X A;  3ZR8 X;  5ICE A;  2OTJ I;  5EG0 B;  1FZP B;  1MMS A;  1ETW A;  2W25 A;  1JTX A;  4B43 A;  2GXA A;  2UWM A;  1HC8 A;  1XMA A;  2MLG A;  3B6C A;  1POG A;  3S1M J;  5GPA A;  3FIW A;  3IAS 2;  3JRF A;  4QPQ A;  3E6C C;  4XLC A;  1UJ8 A;  5GAH J;  2VXZ A;  5EZG A;  2H09 A;  2EV0 A;  4EGY A;  3LMM A;  1SD5 A;  3B73 A;  3ABT A;  4KIC A;  1D0X A;  2JA6 J;  4G6Q A;  2R0Q C;  1APL C;  2WAQ N;  4I7H A;  4GYI A;  2NVT J;  1FMW A;  1Z0X A;  4L0Y B;  4ZZL A;  2KJB A;  4BS9 A;  4EMS A;  3LL7 A;  3GYH X;  3ELK A;  4Y7N J;  2LKS A;  2J5O A;  1U3E M;  2JA5 J;  2O6G E;  2ZFW A;  2RQQ A;  2H8R A;  2O5R A;  1HCR A;  2IA0 A;  3HIF A;  3DU6 A;  4F3Q A;  4CZC A;  2BV6 A;  3F8F A;  4RA2 A;  3F8N A;  3OR2 C;  2XGC A;  2JUC A;  3QOD A;  3RI4 A;  1ZQ3 P;  1SC7 A;  3TW6 A;  4ETS A;  2P7C B;  3TW7 A;  4L18 B;  1B4A A;  2Z1D A;  3VYU B;  2IA1 A;  5E3M A;  4ZYG A;  1UG0 A;  3JRD A;  1YJW I;  3CCU I;  1XD7 A;  1NK3 P;  2JK3 A;  2IS6 A;  5C44 J;  2HOE A;  2VQH A;  2F4O B;  3QOE A;  1BJA A;  4HQM A;  5HS8 A;  4RS8 A;  1N78 A;  2NVU B;  1LJ9 A;  1YO5 C;  5L3E A;  2VBZ A;  4PSX A;  3VSL A;  3KEY A;  4E7H A;  4XLN F;  3CQZ J;  2DOE A;  2G9W A;  1K4T A;  2GXB A;  3HRU A;  4IEJ A;  3KLO A;  1GXP A;  3H1C A;  5LRS A;  2L7Z A;  2NVY J;  2LC2 A;  2LF8 A;  3CLQ A;  4PGG A;  4OIP F;  4YRV A;  1JI8 A;  2P81 A;  1KQ0 A;  3HOY J;  2OCC H;  2DMP A;  4BYY A;  2HXI A;  3CTA A;  2LFB A;  1WI3 A;  2Y69 H;  3GZ5 A;  3OR1 C;  4RGS A;  4CZZ A;  2P6S A;  2B7E A;  2WY7 Q;  2LY9 A;  5LLQ A;  3CCR I;  1ZN2 A;  3ASO H;  2RDP A;  2PEX A;  3WGI A;  4KN7 X;  1BC7 C;  3TBI A;  2BVL A;  5B66 C;  4YFN F;  1WI9 A;  4ANJ A;  3VPR A;  3G1M A;  3OWT A;  2E60 A;  1LPQ A;  5GP9 A;  3I59 A;  3M8F A;  2R7D A;  2YU9 J;  2E36 A;  4KIB A;  4JQF A;  2VOO A;  1SEU A;  1PDN C;  3CCL I;  4G6D A;  3I55 I;  3BTL A;  3PIP F;  1U9N A;  1Z7L A;  3AG1 H;  2NVX J;  4PFP A;  2P0W A;  1VQ6 I;  2GZW A;  4P96 A;  2ZME A;  5J47 A;  1FY7 A;  2F6C A;  3HKZ N;  2ZJQ F;  1BI3 A;  2EA4 A;  4HEA 2;  4CCN A;  2H1K A;  5B5E C;  3CMY A;  3F23 A;  2H27 A;  3LNQ A;  2BY1 A;  2MSY A;  3I53 A;  4RB2 C;  1R5H A;  3CCS I;  2XGX A;  4BQQ A;  4I76 A;  1JKQ C;  3PFI A;  1OYI A;  3P9I A;  2BYV E;  1X1A A;  4U0V A;  3FXQ A;  1SVL A;  2R7X A;  3ISP A;  3MVP A;  1M1E B;  3OYA A;  5C4J J;  1UCR A;  1YI2 I;  1A36 A;  4M3B A;  1LNW A;  2KFD A;  2XHK A;  1RUO A;  2HGC A;  4V2F A;  2VKE A;  4F93 B;  1SFX A;  1VI0 A;  2QVO A;  2PBI A;  2HKX A;  3L2V A;  1LUJ B;  2IS4 A;  2ZME C;  2DMQ A;  2CRG A;  1IV8 A;  2JTV A;  3FKJ A;  2K3P A;  1XS9 A;  1A04 A;  2M5W A;  3A01 B;  5IOY A;  4A3G J;  1SVO A;  3QYB A;  2VT3 A;  5GAE J;  3L2W A;  3BPV A;  2OA4 A;  3IRQ A;  4JP0 A;  2Y30 A;  3WE3 A;  1RR8 C;  1UZC A;  2MGQ A;  2I10 A;  1TQI A;  5ICC A;  1VQ5 I;  4BAC A;  4X0G A;  3OYM A;  1NH3 A;  4L9T A;  2BY3 A;  3LA7 A;  1TWC J;  2EK5 A;  2O3F A;  1LDD A;  4HV5 A;  3F8M A;  1B9N A;  2JWT A;  3K69 A;  3LQR A;  2IGN A;  3J7Y J;  2PJR A;  3K4J A;  2IVM A;  3BG7 A;  5BMZ A;  1WRJ A;  5IYD J;  2LH9 A;  5E20 A;  1MSF C;  4IOA F;  4RMN A;  4ESF A;  3AG2 H;  2STW A;  2BHZ A;  3LAJ A;  3B6A A;  3A1Y A;  3ECH A;  3VOE A;  3HEF A;  2L4M A;  3KP7 A;  3GME A;  2IA2 A;  3BZK A;  3NQO A;  3J7A O;  4XRM A;  2XAQ A;  4RM3 A;  3CES A;  3I64 A;  4ABZ A;  4HAM A;  4UVB A;  1ETO A;  5EG0 A;  4BQO A;  2X51 A;  2CQX A;  2LKP A;  2LY2 A;  2YX4 A;  2QEN A;  1FLI A;  4G7H F;  2VOP A;  2AQE A;  2VJJ A;  4W97 A;  4L5I A;  5K1Y A;  2A05 A;  2CSO A;  3HZJ A;  3T8T A;  2R5Y B;  1FSH A;  3MKW B;  1A6Q A;  1VND A;  1J75 A;  3EUH A;  2HWV A;  1VQ8 I;  1BN5 A;  3QP6 A;  1HBX G;  2EBI A;  2L9S A;  2QSH X;  5L3D A;  4I2O A;  2FNA A;  2HYG D;  4XNF A;  5F1R A;  3J81 Z;  2ZCW A;  4C3I J;  3RYP A;  3KET A;  1E3O C;  2DA2 A;  3PO2 J;  1E3P A;  4ZDL A;  2CQ7 A;  3A4C A;  5CLS A;  1U5T C;  2ZXW H;  3K4M A;  3N97 A;  3NRV A;  2NS0 A;  3BZ6 A;  2UV1 A;  3TP0 A;  5F6F A;  4AU7 A;  5DD4 A;  3FF5 A;  4PJ0 C;  1HQC A;  2HTJ A;  3MQ0 A;  2PJR B;  2JSP A;  2L2O A;  2NAZ A;  2VXD A;  4UY8 I;  3E6D A;  2ZXJ A;  1Y8Q B;  3MKL A;  2OQR A;  1S7A A;  3FXL A;  1MBK A;  4P9F A;  4KIF A;  2DAO A;  5LHI A;  3C2H A;  3PQK A;  4B3A A;  3R4K A;  3BQZ A;  2IAI A;  2HZT A;  5K5O A;  3SXY A;  2LP0 A;  1J9I A;  1FX7 A;  2RRE A;  4KIS A;  1R71 A;  3OS0 A;  3FXK A;  2R7O A;  1TLH B;  4NC7 A;  3ZQI A;  2R7F A;  2FXA A;  2IGO A;  3WHC A;  4R1H A;  1RPW A;  3SFZ A;  3LOC A;  1OR7 A;  3ZQG A;  3ZMS A;  3CCQ I;  4MQ9 F;  3S1R J;  5E1W A;  5M5W J;  2IW5 A;  2LBF B;  4ESJ A;  4C3H J;  4XMY A;  5J1R A;  2HZD A;  4Y33 A;  1DU6 A;  2K9N A;  2RNG A;  3C2G A;  2DFI A;  1P6R A;  4XSZ F;  5E3N A;  1AWC A;  4I6Z A;  2VUM J;  4B48 A;  4AYB A;  4EEF G;  1RUN A;  2A61 A;  2KLO A;  2DW4 A;  2DQL A;  5D5X B;  2V26 A;  2MD0 A;  1ZHF A;  2P4W A;  1QVT A;  1U0J A;  3EUK L;  3I4M J;  4BDZ A;  4C30 A;  3W2W A;  1FC3 A;  3GTQ J;  4BY1 J;  2GWR A;  3ERM A;  1ZGA A;  2L9R A;  4BH9 A;  3GTK J;  2BXY A;  2FBH A;  4BU2 A;  1T8I A;  1YOV B;  1T39 A;  2R7Z J;  1BW5 A;  1I50 J;  2EPF A;  2IEK A;  3RCO A;  1FTT A;  1V5E A;  3DKX A;  1ON1 A;  3RKY A;  1TWG J;  4DOZ A;  1QZY A;  4YEL A;  4OMZ A;  4UUT A;  2LRD A;  3DCF A;  1ETK A;  1Z77 A;  6PAX A;  4LB6 B;  1TC3 C;  4XKB A;  2E2I J;  3ZQL A;  5FLX K;  1D8K A;  1IAW A;  3P7N A;  1H88 C;  5HLT A;  3SDG A;  4IL6 C;  3HPG A;  4E70 A;  3TKY A;  4EM1 A;  2BZT A;  1GV2 A;  1HXD A;  5HS7 A;  4XRS G;  2QSF X;  1LEB A;  2QKL B;  4HX4 A;  2ELH A;  9ANT A;  3OIQ A;  5CYV A;  3IAM 2;  3HRT A;  1LB2 A;  1HKS A;  2NYX A;  1GV5 A;  2DFE A;  3H3U A;  1BR1 A;  1WKM A;  3RJP A;  4UUS B;  4PJL A;  1UHS A;  4HV6 A;  1D5V A;  3HYI A;  4ZDO A;  4KFC A;  1B9M A;  4A6D A;  2CWE A;  2HQA A;  4LG0 B;  5E1Z B;  2DQR A;  1QA6 A;  1G59 A;  1ZGJ A;  3K4K A;  3X2Q H;  4CUG A;  5FKO A;  1QQI A;  2QQB A;  4RAZ A;  2P5L C;  2XB0 X;  4HNV A;  2VI6 A;  4WF2 A;  2HI3 A;  5GTH C;  4FQG A;  2DCE A;  5K7H A;  3R0J A;  4BY7 J;  3M3Y J;  1Y0N A;  2ECB A;  3QYF A;  3GXO A;  3S2H J;  2OF7 A;  3HOU J;  2EIM H;  4ZJZ A;  1IUF A;  3BY6 A;  3U21 A;  2LK2 A;  1YS6 A;  4RM2 A;  3ML6 A;  3WU1 B;  2V9V A;  2F48 A;  2KHM A;  4J19 A;  4CGZ A;  3MZ8 A;  5K5R A;  2ZKZ A;  2FRH A;  4U0Y A;  2CFX A;  1P4X A;  1R23 A;  2QCO A;  2XGE A;  5AIP A;  4LIU A;  1FWZ A;  3J80 K;  3IV5 A;  1NG6 A;  2OQG A;  5ED4 A;  2NOJ B;  3OMY A;  2X6X A;  4IO9 F;  1KON A;  1Z7U A;  2EQR A;  1OYW A;  2CJJ A;  1MJA A;  2IGM A;  1FT9 A;  5EEG A;  4NB5 A;  3O3K A;  2D45 A;  1S3J A;  2ACJ A;  5LGU A;  1Y56 A;  2ZJP F;  1YLF A;  2A5Y B;  4MHG A;  2HYF A;  2WAQ A;  4RGR A;  1B6A A;  5LGN A;  3CZ6 A;  3QPL A;  4N4O B;  2K4B A;  1F4K A;  3DBH B;  3H5R A;  4XBF A;  2YPR A;  3JSO A;  4KYW A;  4UUV A;  1IN7 A;  1ETQ A;  1R1T A;  4E4H A;  1Z1D A;  2K9M A;  2WWY A;  3GBG A;  4UUS A;  2FA5 A;  3OYI A;  3KEQ A;  3GTG J;  2DJI A;  3FXU A;  3GWZ A;  4HBL A;  1MDM A;  1U8B A;  3WTV C;  2VKH A;  1IG7 A;  2EFQ A;  4CCK A;  4M3F A;  3C2B A;  2XF5 A;  2CQK A;  3I4P A;  5IP9 J;  1XMK A;  1SAN A;  2CUZ A;  2HDW A;  4IVN A;  2RVC A;  3E6B A;  3WE2 A;  4AUX A;  2LSO A;  2CUE A;  3J80 Z;  4FET A;  4N9H A;  2HNH A;  3AKZ A;  2BY0 A;  3IRR A;  2XC7 A;  1A5J A;  2JPC A;  5DCM A;  1V5F A;  1TNS A;  2JN6 A;  2O0Y A;  3ESW B;  5FFX A;  4A69 C;  3RYR A;  1OCT C;  1UHW A;  4PJJ A;  3BT9 A;  4IHV A;  2TDX A;  2Q1Z B;  4A3D J;  3QQA A;  5D8L B;  1GVD A;  4Y4R A;  3HM5 A;  5CVI A;  1IXS B;  1T33 A;  1X1P A;  3FHN A;  5LBQ A;  4C2M J;  4LMY A;  4XSX F;  1MH3 A;  4NUB A;  3WTT C;  2JZY A;  1SVM A;  4CDG A;  3MKZ A;  2PMZ A;  3FIS A;  2VBX A;  4BUP A;  1RET A;  3IC7 A;  5LRR A;  3G71 I;  1JT6 A;  3LFU A;  1DP7 P;  2FUG 2;  2MW8 A;  2R7Q A;  2DTR A;  1FIP A;  1ZAR A;  4U7D A;  5J8F A;  2ELJ A;  3Q5F A;  4A3C J;  1P2F A;  1TZL A;  3A0B C;  4HZF A;  3RKQ A;  1FEX A;  4RLQ A;  3S8P A;  3O8H A;  3DLL F;  4N9I A;  2E1O A;  4CA0 A;  1XX5 A;  2WB1 A;  4AIK A;  3S3O A;  5FJ8 J;  4BE2 A;  2ZXH A;  2K9L A;  1TNT A;  3WOD F;  4IKF A;  2GOX B;  1MJB A;  2WC2 A;  2OBP A;  3ERE D;  3KYD B;  4ZYD A;  4ZC3 A;  1YW8 A;  1Z3Y A;  2LR8 A;  1L3L A;  1MNM C;  2R7V A;  5EEH A;  2LDU A;  3SYT A;  4UNO A;  1BBY A;  3LQQ A;  3F22 A;  1WHU A;  3L1P A;  2KPM A;  1HDP A;  5KHD A;  2VT2 A;  5CQG A;  3ZMD A;  5M5Y J;  4KMF A;  2IJL A;  4KIG A;  5DUI A;  5HOO A;  4EJU A;  2XGD A;  1OYY A;  2EZH A;  4KT5 C;  3LSP A;  2Q2E B;  3OOU A;  5KAF C;  3ABM H;  2ETH A;  1IRG A;  3OOP A;  4XK4 A;  3BTC A;  4G7Z F;  1OPC A;  3T5X A;  3BG5 A;  2AO9 A;  4YFK F;  1UFM A;  2JT1 A;  5HVQ C;  4LLN A;  5J1U A;  3GTO J;  3CF5 F;  2A3S A;  1SFE A;  3OSF A;  2DTZ A;  2X6Y A;  5AON A;  4AC0 A;  1MBG A;  2W1O A;  5J6X A;  3CO6 C;  4MQV A;  4V19 K;  2L7M P;  3DBL B;  3OYG A;  3FHZ A;  4I0B A;  3Q9S A;  2YUS A;  3CJR B;  4XID A;  3U1K A;  3K10 A;  2NRA C;  1FPQ A;  4OOI A;  4R79 A;  1UMQ A;  2IBD A;  4BHP A;  4E7I A;  1WVR A;  4A3K J;  1C0W A;  1BM9 A;  4BQN A;  4NC6 A;  3K2A A;  1JTY A;  4D0P A;  2JMW A;  2VBW A;  4A0X A;  2M1B A;  3CME I;  5E18 F;  2XRN A;  2DFF A;  2XAU A;  1FMV A;  3OYB A;  2AS5 F;  2IS2 A;  3I0T A;  2DK8 A;  3A03 A;  4IRH A;  4EV0 A;  1IF1 A;  4A3B J;  1VQ4 I;  4BNC A;  3HTS B;  1S5L C;  2LLK A;  2EV5 A;  3JCU C;  2I5U A;  5A2Q K;  2PI0 A;  4JBA A;  4E7K A;  2KIS A;  3H0D A;  2DK5 A;  3EPZ A;  4JX5 A;  4A3E J;  1X1B A;  4OIN F;  1V5G A;  5D6E A;  3KYL A;  3QPH A;  2M0M A;  1IXC A;  3OYC A;  1QPI A;  3NWS A;  1RKT A;  1X58 A;  1RES A;  2M34 A;  2OZ6 A;  2FE3 A;  2W85 A;  3HG9 A;  4B8X A;  2XPV A;  3J81 K;  2E19 A;  4IX7 A;  1ZR2 A;  5E3O A;  2OD5 A;  3BLY A;  3OSG A;  2XRO A;  5D4R A;  1Z6R A;  1FBU A;  2VOD A;  3VYT B;  3TQN A;  1B72 A;  3TL4 X;  3C1D A;  3OV8 A;  2HPI A;  1VQM I;  1J7K A;  4C3J J;  4B3X A;  1D5Y A;  1G6N A;  3KP3 A;  5E17 F;  1JHF A;  3OS2 A;  3BOQ A;  3ZMZ A;  1FOW A;  3CD6 I;  2AQF A;  3LWF A;  3U1D A;  3JRC A;  4XLP F;  4C2T A;  4NBQ A;  2EFO A;  2K4J A;  5JLX A;  3S3M A;  1QBJ A;  3DFG A;  2DXI A;  3DXJ F;  3KFW X;  2RV8 A;  3D0S A;  2WV1 A;  1EA3 A;  3CCM I;  4G6T B;  2KIF A;  5CPR B;  3GX4 X;  2FMY A;  3OYK A;  4FTH A;  1OCO H;  3OL3 A;  5FB2 A;  2W00 A;  1MDM B;  1I39 A;  3S1N J;  1UB9 A;  3ZMU A;  3F8C A;  5EEA A;  4EJT A;  5IT9 Z;  3JRE A;  1O57 A;  1QNT A;  4A6E A;  3CC7 I;  4XR6 A;  4CYD A;  2STT A;  2M8E A;  4XLA A;  5B3S H;  4XN0 A;  2DFH A;  1WPK A;  3VEP A;  2YX7 A;  1OMI A;  2G7H A;  3SZP A;  3WU0 A;  1YHQ I;  1YW9 A;  1P7I A;  3U9G A;  1XGM A;  3AG4 H;  5FLX Z;  1BL0 A;  1FTZ A;  1MBJ A;  2UZK A;  3GO5 A;  1P4A A;  3F6V A;  1TWH J;  2QWW A;  3AG3 H;  3PIO F;  1R9T J;  3GFI A;  4UVC A;  5HS9 A;  4XKW A;  1O3Q A;  3BPX A;  2Y0S A;  1Y8R B;  3PO3 J;  2JVG A;  4IHT A;  1D0Z A;  1DGR M;  3D5S C;  3IKT A;  5M5X J;  2E1M C;  1FP1 D;  1V55 H;  5HLI A;  1T0F C;  2UXX A;  4CYC A;  3OYD A;  3PNY A;  2PJP A;  1K83 J;  2KZG A;  1ZG5 A;  1XSD A;  1W0U A;  3M07 A;  5JHU A;  2DA6 A;  1EKE A;  3Q3S A;  3DKY A;  3ZQF A;  3PJR A;  3S14 J;  2FSW A;  5FKK A;  4YFX F;  2X1C A;  1NTC A;  4MFD A;  2HVS A;  3LSJ A;  4KJZ A;  1QGP A;  1J5Y A;  4XOR A;  2FX0 A;  4HX7 A;  4OMY A;  4BBR J;  4BJ5 C;  3BWG A;  4II3 A;  3BG9 A;  2AXT C;  3DEU A;  3I3L A;  1A35 A;  3ZMV A;  1T6S A;  3K1M A;  1FP2 A;  2X6O A;  2H1L A;  3AL0 B;  1XC5 A;  1W4M A;  4BBS J;  4DGW B;  1HST A;  1IDZ A;  3KP5 A;  2QSG X;  2EFN A;  3IP4 B;  5ILU A;  5D5U B;  3OYN A;  2L7F P;  1RZ4 A;  3MEX A;  4S05 A;  2OV7 A;  2MG4 A;  1YX5 A;  2VBY A;  5F64 A;  2VIX A;  1WJF A;  3ZOB A;  3TED A;  2LF7 A;  1A31 A;  3M4O J;  1ETY A;  2CQQ A;  3QRF F;  1R4M B;  2Z33 A;  1OKR A;  3UKG A;  4EVI A;  3ULQ B;  5LHG A;  3BR2 A;  4KDP A;  4WCG A;  1J09 A;  1D0Y A;  1HKQ A;  3KP4 A;  3D1N I;  4QLC U;  1JGS A;  3CP2 A;  4O6J A;  1YQA A;  5KNL A;  3K70 D;  2TRT A;  3WU2 C;  5D8K B;  3CC4 I;  3C3W A;  1K4S A;  3I56 I;  1V4R A;  2NOG A;  1QRY A;  1R5G A;  1L0O C;  2VKV A;  2D5V A;  1H8A C;  2XB5 A;  4ZTJ A;  1T2K A;  3W3C A;  3IUO A; 
#chains in the Genus database with same CATH homology
 4IOA F;  3CF5 F;  1VQ7 I;  3CC7 I;  3EGV B;  5DM6 F;  2K3F A;  5GAD J;  2OTL I;  1YHQ I;  5JVG F;  2JQ7 A;  3CCR I;  1FOY A;  4V19 K;  3CC2 I;  5GAG J;  3CJR B;  3PIO F;  2H8W A;  4IOC F;  2ZJR F;  1FOX A;  1VQL I;  2E36 A;  2QA4 I;  3CCL I;  3I55 I;  1YIT I;  3CJQ B;  3PIP F;  3J7Z I;  3CME I;  1VQ8 I;  2OTJ I;  1MMS A;  1VQ6 I;  1HC8 A;  3CJS B;  3CCV I;  2ZJQ F;  1VQ4 I;  5GAH J;  1QA6 A;  3CCS I;  3G71 I;  1VQP I;  4UY8 I;  1YI2 I;  1YIJ I;  1YJN I;  3DLL F;  1VQK I;  1ACI A;  2QEX I;  1WIB A;  5DM7 F;  1VQ9 I;  1VQM I;  3G4S I;  1VQN I;  3G6E I;  1FOW A;  1YJ9 I;  3CCQ I;  3CD6 I;  5GAE J;  1YJW I;  3CCU I;  4IO9 F;  2E34 A;  1VQO I;  1VQ5 I;  2E35 A;  2NXN B;  3CCJ I;  2FOW A;  3CCE I;  3CMA I;  2ZJP F;  3CC4 I;  3CCM I;  3I56 I;  3J7Y J;  1S72 I;  1Y39 A;  3CJT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...