2E1NA

Crystal structure of the cyanobacterium circadian clock modifier pex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
110
structure length
110
Chain Sequence
MDFEDIYRFFQDPPPHYLSKELAVCYVLAVLRHEDSYGTELIQHLETHWPNYRLSDTVLYTALKFLEDEQIISGYWKKVEGRGRPRRMYQLAQANDDRSRDLAQLWERYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of a Cyanobacterium Circadian Clock-modifier Protein
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Circadian clock protein
molecule keywords Pex
total genus 34
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2e1nA00
2Z5UA 1LDDA 3F8MA 3EUHA 1IN4A 2Y75A 3SXYA 3K0LA 1XCVA 4HF2A 2G7HA 1SD5A 4KN4X 2XROA 4UVAA 3DXJF 3B02A 1H0MA 1R5HA 1XGSA 2K7LA 4ZYEA 2LKPA 5ICEA 3JW4A 3O2PE 3T1BA 2HS5A 1BIBA 2EFNA 1J9IA 3CTAA 3VB2A 5D5VB 3BROA 1LVAA 2H94A 1ULYA 4CDGA 3ULQB 2L4MA 5IT3A 1IAWA 4EM2A 2PI0A 5E1ZB 3RKWA 1Z9CA 3REOA 3L00A 4M73A 2W25A 2KJBA 2PFBA 2K4JA 2QQAA 2NYXA 1U6GA 4BNCA 1ZHFA 5ERIA 3P9CA 5D6FA 3KEOA 4ESJA 2EWNA 2K02A 5HLHA 1IUYA 4GCVA 1KQ9A 2BGCA 1TNTA 4L9TA 4D0PA 5DDGA 2LSOA 4RGUA 3J80K 1ZGJA 2NNNA 1PP8F 2QWWA 3QP5A 2DK5A 2Z9OA 1FBSA 3BY6A 3DEUA 2MLKA 4LK0F 1FOKA 1ZYRF 3V7SA 1MDMA 3QU3A 4MEYF 2F5FA 1P92A 4IXAA 3F72A 4HLXA 2HKXA 3T8TA 4OIPF 1D8JA 1F4KA 4PCQA 1O3QA 3D5LA 3FM3A 2JPBA 3P9KA 3TO7A 1WKMA 3E3VA 2DT5A 4BH9A 3V7CA 3J80Z 1XB4A 4UVCA 1BM9A 1DPRA 3LSTA 5DD8A 2IT0A 2A68F 5KK1A 4AIKA 3WU0A 1YG2A 2V1UA 1V3FA 2Q8KA 2YX4A 4M9ZA 3HSRA 5D6EA 1HW2A 5HDNA 1K7AA 3SFZA 1XGMA 1B9NA 2IA2A 1YS7A 4HQEA 1WSUA 1XGNA 3IRQA 2A69F 1IF1A 4OMZA 3I0TA 3N4MA 5D5UB 2DK8A 3KP2A 1FT9A 2V1XA 2EFQA 4OU0A 2D1HA 4ENMA 3I5UA 2MH2A 1UB9A 1DDNA 2O03A 3E5UA 5DCFA 4UNOA 3E5QA 2ZNYA 1JHFA 2GXGA 5BQTA 2FNAA 3BJAA 3ZP5A 4RB3C 3BP8A 5KVRA 3DPTA 3OOPA 2O3FA 3O6BB 3COAC 1C0WA 4L5JA 1SAXA 1OYYA 1XGOA 1LNWA 1W5SA 3K9TA 3J81Z 2CW0F 2ZCWA 1LJ9A 2AXLA 2E1CA 1R7JA 4MNUA 3RYRA 4HLYA 1T2KA 2L54A 2ZFWA 2QVOA 3ZMDA 1I1GA 2WTEA 4A5NA 2F2EA 3R0AA 2Q2EA 4WXHA 3HRMA 2IJLA 4MTDA 1FPQA 3I4PA 3BJ6A 5CVIA 2KIFA 2O8XA 1HKSA 4LK1F 3HHGA 2A07F 4CHUA 2ESNA 3C3WA 2QENA 1A04A 4CICA 2R7FA 3KLNA 4EJOA 3SZTA 5LGNA 1ZG1A 4G6DA 2L4AA 2GQQA 3B73A 4OIOF 1KYZA 2KJCA 5BPIA 3EDPA 1GXPA 4ON0A 1Y0UA 3HYIA 2YX7A 3KZZA 3KE2A 1Z6TA 5LHIA 3GZ6A 2R7DA 1Z1DA 2VT3A 1FBQA 4A12A 3GO5A 2HKOA 3RTRA 3RPUA 3F8BA 5E18F 1CF7B 1QPMA 1Z91A 1FY7A 2FA5A 3V7RA 2JT1A 2XKOA 4KNYA 2CFXA 1SMTA 2XV4S 3GVAA 4HF0A 2MBFA 5ICGA 1IN5A 2P7VB 3QAHA 3R60A 1P4WA 4IJAA 4G94A 1MJAA 1R36A 3I64A 5JI6A 3VEPA 2P5KA 1GVJA 4S04A 2DI3A 4YFNF 2CGPA 2EV6A 2E7WA 3F22A 2GXBA 2EB7A 5ILVA 4RGRA 2DU9A 1E17A 4R1HA 3QPHA 4F7ZA 2STWA 3G3ZA 5FD6A 1WI9A 4I02A 4AIHA 2IP2A 4A5MA 1WRJA 3L09A 1HXDA 2IVMA 5FFZA 4QWQA 1O7LA 3K1NA 1U8RA 4BHBA 4I0AA 3MZYA 4GYGA 3RDIA 2D1VA 1IN8A 2M87A 2QQBA 1I6XA 4YG2F 2HTSA 5ICCA 1MDMB 1LEBA 2RNJA 5EEHA 2VC1A 3LA2A 4JBAA 5JVTA 3WTXC 4WCGA 5TRDA 2K86A 2VN2A 4P55A 5H6RA 4OIQF 3HUGA 2K4BA 3QRFF 2JPCA 5JFRA 5CVUA 2TDXA 1G3TA 1YIOA 1EV7A 1I27A 1KGSA 5LGTA 1O57A 1HKTA 2ZMEA 2IRFG 2FEZA 1U2WA 4RB1A 3CDHA 2DO7A 4MHGA 5LGUA 3FZVA 3CO6C 4XSXF 1MGTA 1J59A 2QYOA 4ENJA 3TKYA 4MTEA 4HDUA 2EJRA 1QZZA 5AIPA 3J7AO 1S29A 2A61A 5F64A 1LB2A 2EFOA 4WF2A 2OQGA 4IF4A 2ZJ2A 4GO1A 5K5RA 4DQ2A 3IWFA 1SFXA 4ENNA 4RGXA 1XSDA 5E1XA 1Z05A 3I59A 2LNBA 3VFZA 1R22A 3SZPA 4GXOA 4K2EA 1ZN2A 2VOOA 4M9SA 2FSWA 2HEOA 4FHTA 1IXSB 1T6SA 2YPRA 3C1DA 3KZYA 5EEGA 1FSHA 1MZBA 1BIAA 4KT5C 5HOOA 3LAJA 4FX0A 1S8NA 1R1TA 3HSFA 4EMSA 5HS8A 4OMYA 5BPDA 3HRSA 3GXOA 3NRVA 4ZH4F 2EFPA 2RN7A 4KIGA 3L2CA 1F1ZA 1AWCA 3DFGA 2VODA 3MCZA 3CLOA 4CYDA 1T98A 4IHTA 4I01A 1KU9A 1FNNA 4CGZA 4XLPF 2FMYA 3HRTA 5LRRA 2FF4A 3RYPA 1STZA 4L9JA 4M6YA 2M30A 4L5IA 4FX4A 2FBIA 5CLSA 4L0YB 5DCMA 1RUOA 5BMZA 5FB2A 1TQPA 3BWGA 5FFXA 1KU3A 2G7UA 1F5TA 3FMSA 2PLYA 1OR7A 1ZAOA 4ETSA 4U7BA 4G7HF 2VXZA 4M71A 1TW3A 3CUQC 3T0YA 3ROUA 1BI0A 2NS0A 3VODA 3RIRA 2XAQA 2LF8A 1JHHA 3TDZC 4AVPA 1J75A 4ENKA 3AAFA 2VBZA 3HRUA 4XLNF 1FLIA 1SD7A 3TQNA 2ELHA 1ZLJA 3LQQA 1RI7A 2V6CA 1CGPA 4EVIA 1TLHB 5HS7A 2QUFA 2RC4A 4RB2C 3GFLA 1RUNA 1ZG5A 1ZLKA 3ZMSA 1P4XA 4FT8A 4HV5A 2M8EA 5H6QA 5TJJA 5DCMB 1IXCA 3KETA 1X3UA 4PGHA 1KU7A 3IRRA 3HTUA 2OAZA 5L3GA 5DEQA 1FYLA 4OINF 3TOBA 5LEJA 1XSVA 1K78B 1FX7A 1U5TC 2HTJA 3E97A 3JAMZ 3MEXA 2LDUA 3FF5A 3O3KA 2H6CA 4N9IA 3H92A 4P9UA 3N97A 2DPUA 1KYWA 4I0BA 2P6SA 4DNCA 4KICA 2P6TA 5LHGA 3R6SA 4KN7X 5E8IA 4CXFA 4IRGA 1U5TA 2FOKA 1WQ2A 1R58A 2HR3A 3G73A 2PN6A 3TO9A 4KMFA 1XN7A 2NAZA 3WTSC 5D8LB 3GZ5A 5D5WB 4P9FA 3IL2A 3FXRA 5JHUA 2DW4A 4TV7A 2VOPA 1S7AA 1S6LA 2W84A 1ONVA 3BZ6A 1B1BA 5J8CA 4HW0A 4MQVA 1W5TA 3MZHA 4KMUX 1HKQA 1JXSA 4A0ZA 1I1SA 3E6MA 3HOTA 3EQLF 3KEQA 2QBYA 3EYYA 5K5OA 3FX3A 2ESHA 1ON2A 2PJPA 5JR3A 2VE8A 3SHFA 1OYWA 2FQ3A 3RKXA 5L3FA 1GHCA 2DLLA 4Z2YA 3T5XA 4EGZA 2C6YA 2EFWA 5E1WA 1DPUA 4PZJA 4EJVA 2P5VA 1W7PA 3ZMTA 4EM0B 3WU1B 2K27A 2P7CB 2RV8A 4HX7A 4HZFA 3IKTA 1JE8A 4G9YA 2A6EF 5HLGA 2V9VA 4Y15A 2OD5A 4G8XA 4YFXF 2VC0A 3K69A 5HLIA 1B9MA 1TBXA 2XUBA 3HSEA 5CVJA 5F6FA 2WWYA 1BI3A 2YU3A 2Y0MA 3DP7A 3FWEA 3ABUA 1XDUA 5DUKA 1TNSA 3R0JA 3M1EA 1OPCA 3LQRA 2DAOA 5E20A 3ZQ7A 2OBPA 3KP5A 5LEKA 4RAYA 4ZZLA 4KFCA 1R00A 2QLZA 4ZZDA 3ZPLA 2VE9A 2KRFA 1B6AA 3C18A 1HW5A 2Z3YA 2O61A 2BYVE 2OA4A 3TO6A 1FYMA 2UXNA 3VOEA 1D8KA 2XVCA 3U1DA 1IXRC 3E6CC 5FLXZ 1LQ1A 3JTHA 5E17F 2FBHA 1J2XA 4M6XA 3L9FA 3I58A 4G6QA 3RKYA 1NHAA 4WK8F 4N9HA 2YSRA 4QLCU 2UZKA 2EA4A 2RQPA 3DV8A 4M74A 2HFHA 2GIVA 3CUQB 2L01A 3WGGA 2XAGA 4EGYA 1T39A 1U5TB 5FLXK 3ISPA 2DFIA 1T38A 3ZN1A 2FE3A 5HVQC 2RVCA 3LFKA 1HW1A 1ZREA 4LB5A 2A3SA 2XHKA 1PP7U 3T8RA 2HDCA 3FMQA 5L3DA 5L3CA 4BAYA 4A0YA 1SFEA 1W7PB 1BC8C 3KFWX 2PQ8A 2HWVA 3WTUC 1F9NA 1T0FA 2MH9A 2P5LC 1UHWA 2VBXA 1CF7A 2FXAA 2DQRA 3J81K 3BPVA 3F6OA 5CVRA 4XBFA 2EV5A 3K2ZA 3S2WA 2CO5A 4ZYDA 5HS9A 2W85A 3F8CA 1UHMA 3KP7A 1LDKB 4JK1X 2R3SA 4WWCA 1FP2A 2CSOA 1Q1HA 5D8KB 1K79A 3Q9VA 2COMA 4G7OF 5ILUA 1QNTA 3HHHA 1FWZA 4RS8A 2WC2A 4HX4A 1YW7A 5HDGA 3IHUA 2YR2A 3F6VA 2F5EA 3LA7A 2O0YA 2ETHA 4HX8A 1FZPB 1J5YA 3FHZA 3R61A 4LG0A 5LLQA 2ZNZA 1MJ9A 2H6BA 2XAHA 1BJAA 2J5OA 2DQLA 5L3BA 2HQNA 2EV0A 4UVBA 5LRSA 1YO5C 2ZO4A 3QU6A 3DPLC 2JSCA 4HAMA 3U2RA 1Z6RA 4HOBA 2M45A 3GEZA 1B4AA 3BOQA 3FMRA 4LLGF 1AOYA 4Q5SF 3ZN0A 3PQJA 1ZRDA 2DPDA 4I98B 2JRTA 4RAZA 3MAJA 2L02A 3ELKA 1P2FA 2QBYB 4MEXF 3GFIA 3V8LA 2PG4A 3PFIA 4R79A 1XD7A 3NEUA 4EM1A 5IT9Z 3IC7A 1P4AA 3IKVA 5D5XB 3K1MA 4O3MA 1ZH5A 3L7WA 2FU4A 3KCCA 3OV8A 1ZRCA 1YW8A 2W24A 1YS6A 4CZZA 2O6GE 2V79A 1R23A 2ACJA 2BE5F 3BDDA 2OZ6A 1BI2A 3C7JA 4BQAA 4RB0A 1I5ZA 4KIFA 4U0YA 3WG9A 1SD6A 5L3EA 2GA2A 1R1VA 3ECHA 1P6RA 3GUDA 3DF8A 2BBYA 1Z7UA 2Z33A 1MD0A 3QOPA 4A0XA 3K1PA 3GFJA 3GW2A 1VTNC 3GLXA 5E8GA 2ISZA 1RNLA 3F23A 4PGGA 3LA3A 1K78A 3NQOA 3F8FA 1FSEA 2LF7A 4WX9A 4LJZF 2GA1A 3IWZA 1QBJA 1TW2A 3PQKA 4IHSA 1XSXA 4LB6B 1SD4A 1L3LA 4NB5A 2QZ8A 2BV6A 2M5WA 2DBBA 3RPQA 2D2WA 1OMIA 3V8KA 5ED4A 2E7XA 3M8EA 4KUMA 2OU2A 4GYIA 1USSA 2Q0OA 5DV5A 1BC7C 4I7HA 2RDPA 3LWFA 1K6OA 2NNYA 4O6JA 4L9NA 3I71A 2MD5A 4KA4A 4H0EA 1S7OA 2H27A 1U3EM 1HSTA 4IRHA 3ML6A 3GFMA 4N0BA 6PAXA 2PEXA 1WWXA 2X4HA 2M1BA 4B8XA 1XCBA 5F1RA 4WXCA 3TGNA 1ON1A 2FRHA 3MFKA 4A6EA 3ERED 4GGGA 1J0RA 2QM3A 3FXUA 2MLGA 1G4DA 2QQ9A 1R1UA 3WODF 5J6XA 4L18B 3BPXA 3TOAA 5FD5A 1QQIA 1H9GA 5D4SA 3EYIA 5HDKA 2ZMEB 1YYVA 2HOEA 4EJTA 2JTVA 5BS6A 4ZYGA 3M7GA 3H3ZA 4OIRF 1QGPA 2XAFA 2HYGD 2GWRA 3W6KB 5BOXA 4KYWA 1IW7F 2HQRA 4ESBA 4I2OA 1BN5A 2EK5A 2P4WA 3ZMVA 1KQ8A 3WTYC 1EH6A 4E70A 3JSOA 4KIBA 2VBWA 4HQMA 1MKMA 3I59B 2HZTA 3Q5FA 2XKPA 2HYFA 3LAPA 4WXDA 2IPQX 1BBYA 2FBKA 3H3UA 3F3XA 2B0LA 1IZ1A 3MWMA 1R5GA 4KDPA 3KP6A 4UV9A 2NRAC 4IVNA 3ECOA 3QPTA 2XIGA 1H9TA 3F8NA 4L9VA 2XRNA 4U0WA 1O3RA 2ZXJA 5LHHA 3P7NA 3HOSA 3DQVC 4M9XA 1ZG3A 1U78A 2L3DA 4UXNA 2AS5F 1O3TA 1V4RA 4ASNA 2CQKA 4XSZF 2GAUA 5LBQA 1YW9A 3W6JB 3M9AA 4CO8A 4U0VA 4LGWA 1S3JA 1XMAA 3WTVC 1YTYA 3KLOA 4ESFA 3U9GA 5DYMA 2OZUA 4P96A 1G6NA 3E6BA 3KP3A 1DP7P 3F21A 1UCRA 4LG0B 5FO5A 3E5XA 4MGRA 3CUOA 3CJNA 3FM5A 5CJ9A 2W57A 2ZBKA 3E6DA 4XRFA 1RZ4A 2CG4A 1BOAA 1HQCA 2XAJA 2FNPA 3WGIA 4Y13A 1YQAA 3RI4A 1EH7A 1GXQA 2JZYA 4UV8A 1JGSA 3ABTA 4PDKA 1D3YA 4G7ZF 4YIIA 1YLFA 1FBUA 2CWEA 4U7DA 3D0SA 1FYKA 2UWMA 3WTWC 2MC3A 5ICFA 1SFUA 3QP6A 3RJPA 1HSJA 4IRIA 5K1YA 2OQRA 4L0ZB 1OKRA 4YIFA 2STTA 4I09A 4S05A 4AWXB 2ZKZA 3M8FA 4BHCA 1SMYF 1TQMA 1ZARA 2E1NA 1O3SA 1J7KA 3SQNA 4A2UA 2RKHA 2KIUA 4Q4ZF 2WV0A 2A5YB 2DTRA 1G3WA 3ZMZA 1W4MA 2MA3A 5FGMA 5CVVA 2UXXA 5J8FA 2A6HF 3EETA 2P8TA 2KKOA 3GF2A 1LEAA 4MQ9F 4OOIA 1YFHA 1QZYA 1W7PD 3R4KA 3KP4A 2VONA 4O5VA 5IT9K 4M72A 1OYIA 3GYHX 1EH8A 3MQ0A 4Q47A 4EJWA 3CO7C 1REPC 3CUQA 1UFMA 4JQFA 2D45A 3WE2A 4HF1A 3WTTC 2VT2A 1ODDA 1L0OC 4P5OA 3HIFA 5H20A 4NHJA 5DUIA 1RIOH 1D5VA 4RGSA 4UUVA 1TQIA 4HA8A 1IN6A 2ISYA 2CYYA 2F5CA 3GWZA 2VBYA 4Q48A 4B09A 2PMUA 2J5PA 4EJUA 3I54A 5AONA 4EV0A 3V4GA 2X0LA 3JSPA 4HDVA 1E2XA 4IPAA 2IA0A 1HBXG 4LMYA 4EQQA 3BJOA 3TDUC 1ZRFA 4LLLA 1G3YA 1IRGA 1B59A 1USTA 4ZYHA 4LLNA 2PMHA 1IRFA 1KA8A 5CYVA 1ZGAA 1FC3A 2G9WA 2Z99A 4HV6A 1TTYA 3FXQA 3WTZA 2IW5A 4AD9A 5A2QK 1QO0D 2PBIA 5AIQA 2RGVA 4BHPA 1DUXC 4U88A 2F5DA 3ZMUA 5D4RA 3DKWA 5ILSA 4YFKF 3JAMK 1PUEE 1KQ0A 4Y17A 2ADUA 1G3SA 1FP1D 2EA2A 4AIJA 2KIMA 4BYYA 1LDJA 3P9IA 2IA1A 1MJBA 4HYEA 2Y48A 5DD4A 3JTGA 3HTSB 1XMKA 2V1DA 3WGHA 2BEOA 4R8HA 3V8JA 4NQWA 1XDSA 5A2QZ 4HBLA 4BXUA 2FMLA 2HGCA 2H09A 3WE3A 4LFUA 3GX4X 1PDNC 1IN7A 2XASA 3I53A 4UHTA 3Q9SA 1KU2A 4LD5A 2GZWA 1O7FA 4A6DA 1BI1A 2XGXA 5K5QA
chains in the Genus database with same CATH superfamily
1MMGA 2Z5UA 4I76A 1LDDA 1XX5A 3F8MA 3K4LA 3EUHA 1EJ9A 1HDDC 1IN4A 3D1NI 2Y75A 2O9LA 3SXYA 3K0LA 1XCVA 4HF2A 2G7HA 5FKLA 1SD5A 3DU6A 2DMPA 4KN4X 2XROA 2R7UA 4UVAA 4HSTA 3DXJF 4GDFA 3B02A 5HODA 1H0MA 1R5HA 1XGSA 1JT0A 2K7LA 4ZYEA 2LKPA 3OYFA 5ICEA 3JW4A 2IGMA 1P7JA 3S1QJ 1SVOA 3O2PE 3T1BA 5M5WJ 2HS5A 5TGTA 2EQRA 1QHHD 1BIBA 2EFNA 2DYRH 4Y4RA 4PJMA 1J9IA 1ZGWA 3BZKA 3CTAA 3VB2A 3VYRB 5D5VB 2CFOA 3BROA 1LVAA 2JUCA 2H94A 1ULYA 2JVGA 4CDGA 3ULQB 4AUXA 3OYCA 2L4MA 5IT3A 1IAWA 4YIRX 4EM2A 2PI0A 5E1ZB 2G0EA 4RLFA 3RKWA 1T0FC 1AHDP 1Z9CA 3K70D 3REOA 3SYTA 2MD0A 1HOMA 3L00A 4M73A 3CCJI 2W25A 2KJBA 4DBQA 4D7NA 3BZCA 2PFBA 4BJ5C 3TEDA 1LPQA 1VQNI 2K4JA 1IDYA 1ZR2A 4DGWB 2F4IA 4V2GA 2QQAA 2V1NA 2NYXA 1ITYA 1Y0NA 1U6GA 4BNCA 1ZHFA 5ERIA 3P9CA 5D6FA 3CMYA 2ME6A 2MC4A 1PVEA 2E35A 3KEOA 4ESJA 2EWNA 2PJRB 4NNJA 2K02A 2LLKA 1GV5A 1MBEA 4MIMA 5HLHA 1IUYA 4GCVA 1KQ9A 3W2VA 2BGCA 1TNTA 4L9TA 4D0PA 5DDGA 1RESA 1WPKA 2LSOA 4RGUA 3J80K 1ZGJA 2NNNA 1PP8F 2QWWA 4NC8A 3QP5A 1R6RA 2DK5A 2DMQA 5KHDA 2Z9OA 1FBSA 4FE4A 2NVQJ 3OL3A 1GLNA 3S14J 3M3YJ 3CJRB 3BY6A 4P1WA 3DEUA 2MLKA 1YIJI 2E5ZA 2H8WA 4LK0F 1FOKA 1ZYRF 3V7SA 2VJJA 1MDMA 3QU3A 2M2EA 4MEYF 1N75A 1KONA 2F5FA 2GOMA 1P92A 5C44J 4IXAA 1OR7C 4NC7A 3FISA 3GTGJ 3F72A 4HLXA 2HKXA 3T8TA 4OIPF 4ZTJA 1D8JA 1F4KA 2H1LA 4PCQA 3G1OA 1O3QA 2XAUA 3GMEA 2BOLA 3D5LA 3FM3A 5GAEJ 2JPBA 2LBFB 4A3LJ 3P9KA 2CV1A 3TO7A 5FKKA 1WKMA 3E3VA 2DT5A 4BH9A 3V7CA 4YEJA 3J80Z 1XB4A 4UVCA 1MH3A 4BJ6C 2ZJQF 2CU7A 3TBIA 4E6KG 1BM9A 1DPRA 3LSTA 5DD8A 1YJ9I 3F9KA 2IT0A 2A68F 2VQGA 5KK1A 4AIKA 4XK4A 1QVUA 3WU0A 1YG2A 2V1UA 1V3FA 2Q8KA 2YX4A 1KZHA 2E2HJ 4M9ZA 3HSRA 5D6EA 2KMUA 5EYRA 1HW2A 2HQ5A 5HDNA 5GTHC 1K7AA 3SFZA 1XGMA 2A5WA 3TMOA 2VL8A 4IOCF 1B9NA 1FOYA 2IA2A 5KAFC 1MMSA 2EZLA 3HPHA 2LKXA 1YS7A 4HQEA 2ZB9A 1WSUA 1XGNA 1PUFB 3IRQA 1LFBA 4B48A 2ELJA 2A69F 1UG2A 1IF1A 4OMZA 3V42A 3I0TA 3ESWB 4BGDA 3QODA 1VNDA 5D5UB 3N4MA 1Z77A 2DK8A 3A02A 2KISA 3BC8A 1U0JA 3S32A 4A3MJ 3KP2A 1FT9A 2V1XA 2WV1A 3BR6A 2JWTA 4OWRB 2EFQA 4OU0A 2D1HA 4XNFA 5B3SH 2JQ7A 4ENMA 1YRNA 3I5UA 2MH2A 1UB9A 3H0DA 4BDZA 2R5ZA 1DDNA 3BR1A 2O03A 3E5UA 2ZJPF 5DCFA 5IYDJ 2V9KA 5F1JA 4UNOA 3MKLA 3E5QA 2VKDA 2ZNYA 2WAQN 1JHFA 2GXGA 5BQTA 2FNAA 3BJAA 2DODA 3ZP5A 3O8GA 4RB3C 3BP8A 3DBRB 2BY2A 2W82A 5KVRA 2NS7A 1FOWA 1EF4A 1D0YA 2ECCA 3DPTA 3OOPA 2O3FA 3O6BB 3COAC 1C0WA 1IRXA 2BZTA 1Y1VJ 4L5JA 3CCMI 1SAXA 1YOVB 1OYYA 1XGOA 1LNWA 2LKSA 2FJ1A 4D5CA 1W5SA 3K9TA 3J81Z 3PNVA 1R9TJ 1D1AA 2CW0F 3DLAA 3LFUA 2ZCWA 2E36A 5FRMA 1Y6IA 2HOAA 1S9HA 1UZCA 1H88C 2PJRA 2RQQA 1LJ9A 3VYSB 3ZXSA 2AXLA 2KQRA 2E1CA 3FKIJ 1R7JA 4EATA 2HDDA 4MNUA 2MG4A 3RYRA 4HLYA 1T2KA 2L7FP 2X6XA 4IEJA 2L54A 4M3GA 4IX7A 2ZFWA 1MSEC 1V54H 4IL6C 2QVOA 3BG7A 3DLLF 3Q3SA 4GRIA 1I1GA 3ZMDA 2WTEA 1BJZA 4A5NA 2TRTA 1WJBA 2F2EA 3R0AA 4KISA 2Q2EA 4WXHA 3OOUA 3A4CA 4C3IJ 3HRMA 3A03A 3M07A 2IJLA 4MTDA 2HDWA 1FPQA 1Y56A 3I4PA 3OYIA 3BJ6A 5CVIA 5EGOB 3ASNH 3NARA 2KIFA 2O8XA 1HKSA 4LK1F 3CP2A 3HHGA 2X6WA 4IKFA 1Z0XA 2A07F 4CHUA 2ESNA 3C3WA 2QENA 4Y7NJ 1A04A 1ZQ3P 4CICA 3VYUB 4UB8C 2Q1ZB 2P81A 5JLXA 1VQLI 2R7FA 2Y9ZA 3KLNA 3HPGA 2JUGA 5J4YA 4EJOA 3SZTA 5LGNA 2NVYJ 2QSFX 3KZIC 5B5EC 2E1MB 1ZG1A 3JRIA 4G6DA 2L4AA 5E3OA 3WHCA 3J7AY 2M0MA 2NVTJ 2DXIA 3G2BA 1LKXA 2GQQA 3B73A 3OSFA 3HC7A 1SAUA 2IGOA 4OIOF 1BA5A 2AO9A 3AL0B 2VPRA 4MLOA 1NK2P 1KYZA 2KJCA 5BPIA 4IOAF 3TP0A 3I4NJ 1ETXA 3IUOA 3EDPA 3ZQQA 1GXPA 1YE9A 2DMTA 4ON0A 3RSNA 1Y0UA 3HYIA 2YX7A 3H9JA 1K4SA 3KZZA 3KE2A 5C4JJ 4RM3A 2HNHA 1Z6TA 2QQ8A 4XRSA 5LHIA 5HNFA 3GZ6A 4BACA 2R7DA 4XOTA 1T08B 1Z1DA 2VT3A 3X2QH 1G59A 1FBQA 4A12A 3GO5A 4DZPA 2VLAA 2KHMA 2K3FA 2HKOA 3RTRA 5E79C 3RPUA 3CP8A 3E7LA 3F8BA 4NUBA 1E3PA 1I39A 4RAFA 5E18F 1CF7B 1QPMA 1AKHA 1Z91A 1FY7A 2FA5A 3V7RA 2JT1A 2XKOA 4KNYA 2KLOA 2CFXA 1SMTA 2PMZN 4YELA 2XV4S 3GVAA 4HF0A 2MBFA 2TCTA 5IP9J 5ICGA 1IN5A 2P7VB 1J09A 1GVDA 1MMDA 3QAHA 2WBMA 5TISC 2DDBA 5EG0B 3R60A 1P4WA 1JUSA 4IJAA 4G94A 1MJAA 1R36A 2YUSA 3I64A 5JI6A 3VEPA 4RAGA 2P5KA 4ZDPA 1PUFA 1MIJA 1GVJA 4S04A 3ZCOA 2DI3A 4YFNF 1WH7A 3BG9A 2CGPA 2EV6A 1IRZA 2CH0A 2E7WA 5K7HA 3F22A 2GXBA 2EB7A 5ILVA 4RGRA 3LNQA 2DU9A 4D9JA 1E17A 1IDZA 2DA4A 4R1HA 2QGUA 3QPHA 4F7ZA 2STWA 3GTOJ 3G3ZA 5FD6A 1W5CC 1WI9A 4I02A 4AIHA 2IP2A 2ZXWH 3S8PA 3SEZA 4A5MA 1WRJA 3L09A 3L2WA 3AG4H 4E4HA 1HXDA 2IVMA 5FFZA 4F52A 3IP4B 4QWQA 1O7LA 3K1NA 1U8RA 4BHBA 1RC9A 2LC2A 1I50J 4N4OB 4I0AA 3MZYA 4GYGA 3RDIA 3C2BA 1VZ0A 2D1VA 2WB1A 4QIWN 2AQEA 1YX3A 4LIUA 1IN8A 3G1LA 2M87A 3HDDA 2QQBA 2JA2A 1I6XA 1OCRH 4YG2F 3CCEI 2HTSA 5ICCA 3LSHA 1MDMB 5E3MA 4BY1J 1A6QA 2VPLA 2HI3A 1LEBA 1JUPA 4DBRA 2RNJA 1JKQC 5EEHA 2VC1A 2VIXA 3LA2A 2BY3A 4JBAA 5JVTA 3WTXC 4WCGA 3CD6I 5TRDA 2M7AA 2K86A 4F91B 2VN2A 3A1YA 4P55A 1ETOA 5H6RA 4OIQF 3HUGA 3RKQA 5DTDA 3TL4X 3S3MA 1FTTA 2K4BA 2ME0A 3CF5F 3QRFF 2JPCA 2IXSA 3CCUI 3ZR8X 5FRNA 5JFRA 3N05A 4XMYA 1FIAA 5CVUA 1TT0A 4IHYA 4JX4A 4PFPA 2TDXA 1G3TA 1YIOA 1EV7A 1LE8B 1I27A 2R7TA 3HKZN 1KGSA 5LGTA 2I8DA 1O57A 1HKTA 2LOOA 2ZMEA 2IRFG 2FEZA 2JVHA 1U2WA 1DU0A 4XLEA 4RB1A 3FHNA 3CDHA 3OY9A 2DO7A 2R7VA 1S5LC 4MHGA 3K10A 5LGUA 1SVMA 3FZVA 1U9OA 2XF7A 4IZZA 3QQAA 3CO6C 2VQLA 3FK6A 3U1KA 3M1CA 1X1CA 4XSXF 1IV6A 1MGTA 4PSWA 1J59A 2QYOA 3S93A 1OCTC 2A6TA 2E2JJ 1XC5A 4ENJA 1Z3YA 3AG2H 5J47A 5EEAA 3TKYA 4MTEA 2HOTA 4HDUA 1YJWI 1FMVA 2L9NA 3WU2C 2EJRA 3D5RC 3K4MA 1QPIA 1QZZA 5AIPA 3J7AO 1S29A 1PJRA 2A61A 3LSRA 5IOYA 2K5CA 5F04A 3O8HA 5F64A 5J40A 1T33A 4C2UA 4IHXA 1WJDA 1LB2A 2V26A 4IQJA 2EFOA 4WF2A 2OQGA 2K9MA 4BXXJ 4IF4A 2ZJ2A 4GO1A 2F5VA 3BR3A 2OCEA 1EA3A 3H5RA 5K5RA 4DQ2A 2OCCH 3IWFA 2WY7Q 2DJIA 1SFXA 1B8IB 3SEQA 1V55H 4ENNA 5KAIC 4RGXA 2Y69H 3DTKA 4J19A 3K4NA 5E1XA 1XSDA 1TWAJ 3PIPF 1Z05A 3I59A 2LNBA 1AA7A 3VFZA 1R22A 2KRCA 3SZPA 3RZOJ 4GXOA 4K2EA 1ZN2A 2VOOA 4M9SA 2FSWA 2HEOA 4FHTA 1HA8A 1IXSB 4NQWB 1T6SA 2YPRA 3C1DA 3PFYA 4C3JJ 5F0FA 3KZYA 5EEGA 2DT6A 1FSHA 1MZBA 2FOWA 3OWTA 1BIAA 4G6TB 4KT5C 5HOOA 3LAJA 2QKMB 4FX0A 1S8NA 1R1TA 3HSFA 4EMSA 5HS8A 1V5GA 3MKZA 3BTCA 4OMYA 1FIPA 5BPDA 3HRSA 4E7KA 1MSFC 1LFUP 3GXOA 2WB1N 4A3BJ 4MO7A 3NRVA 4ZH4F 5EDNA 2EFPA 5J1RA 2RN7A 4KIGA 3QPSA 4CCOA 3L2CA 3HL2A 1F1ZA 1AWCA 4F55A 3DFGA 2WA0A 3MCZA 3CLOA 5FJ8J 4CYDA 1T98A 4IHTA 2VODA 1BW5A 4W97A 3OIQA 1K6YA 1KU9A 4I01A 1FNNA 3CCLI 4CGZA 1XTAA 4XLPF 1YHQI 2MW8A 3HG9A 4BQNA 3OYKA 2FMYA 3HRTA 1GV2A 2W48A 1YITI 5LRRA 1Z21A 3VPRA 2LTPA 3L1PA 2FF4A 3RYPA 1STZA 4PSXA 3ZGKA 1ETYA 2MFZA 4L9JA 4M6YA 2M30A 1X4PA 4L5IA 4FX4A 2FBIA 1Z67A 5CLSA 3PM1A 4L0YB 5DCMA 1RUOA 5BMZA 2Y2ZA 5FB2A 1UG0A 2HVRA 1TQPA 3BWGA 4H4KC 5FFXA 1RR7A 4BEHA 1KU3A 2KDOA 3QYBA 4UUSB 2G7UA 3CF2A 4BJTA 1R4NB 1F5TA 3FMSA 2M4KA 2PLYA 3PNYA 1OR7A 4OAZA 3IV5A 1ZAOA 2X85A 4ETSA 1WGXA 5C3EJ 4U7BA 4G7HF 2EZHA 2VXZA 1HDPA 3E0JB 4M71A 1TW3A 3FDYA 1Z3XA 4XQFA 3CUQC 1E0EA 3T0YA 3S3NA 2ZXHA 3ROUA 1BI0A 2NS0A 3VODA 1P9QC 2L0KA 2HPMA 3RIRA 5EG0A 2XAQA 1K4TA 2LF8A 1JHHA 2Z16A 1Z7LA 3MN2A 3P5JA 3TDZC 4AVPA 1J75A 1E3HA 4ENKA 5DM6F 3AAFA 2VBZA 3HRUA 4XLNF 1FLIA 1SD7A 4E7IA 3TQNA 2ELHA 2E1MC 2GXAA 1ZLJA 4A3DJ 3LQQA 4M6VA 1RI7A 1CQTA 2V6CA 3C2GA 1CGPA 4EVIA 3JRHA 1TLHB 5HS7A 1TP4A 2QUFA 2RC4A 3IAM2 1A5JA 1YX5A 4RB2C 2LP0A 4AYBA 2VKEA 3PNTA 3FKJA 3I9V2 1T95A 2EZIA 4C2MJ 3GFLA 3D5SC 3LSJA 1RUNA 4MFEA 2XGEA 1ZG5A 1QHGA 3OYAA 1ZLKA 3LL7A 4C3HJ 1RRJA 2XSJC 1D1CA 2K85A 3HOXJ 4V2FA 1D5YA 3ZMSA 1P4XA 3CMMA 4IQ4A 4FT8A 4HV5A 1JJ8C 4HRIA 2M8EA 2OJED 2XDVA 4HEA2 3LSPA 5H6QA 5TJJA 5DCMB 1IXCA 3KETA 1X3UA 4PGHA 3SJMA 1KU7A 3SDGA 2CRGA 2M34A 3IRRA 3HTUA 1WI3A 2OAZA 5L3GA 3HB9A 5DEQA 1ZK8A 1FYLA 2CV2A 1UJ8A 4OINF 3QOEA 3DTIA 3TOBA 5LEJA 1XSVA 1K78B 5M3MJ 2O8KA 2GOXB 1DGWY 3J7ZI 1APLC 1FX7A 4JP0A 2L7MP 1U5TC 3JRAA 1LUJB 2HTJA 3E97A 3ZQLA 3JAMZ 3MEXA 2LDUA 3FF5A 3O3KA 1VF9A 4AM3A 2H6CA 5IPAA 4DIQA 2KT0A 2NS8A 4N9IA 3CMAI 2KDZA 3H92A 4P9UA 4BQOA 3N97A 2DPUA 2YS9A 3HOYJ 1TC3C 1KYWA 5M5XJ 4I0BA 2P6SA 2CUJA 4DNCA 4KICA 1T8IA 2P6TA 5LHGA 3R6SA 3M8JA 4KN7X 5E8IA 4CSWA 3W2AA 3AFHA 4CXFA 4IRGA 1U5TA 2FOKA 1WQ2A 1R58A 2HR3A 3G73A 2PN6A 3TO9A 4HG2A 3H0GJ 4KMFA 3K2AA 1XN7A 2M9HA 2NAZA 3WTSC 2DOEA 2RAEA 1F36A 5D8LB 3GZ5A 4PK4A 1WJAA 2BXZA 5D5WB 1D0ZA 4P9FA 3IL2A 4BE1A 3OYDA 3FXRA 5K7FA 3H1CA 4CCKA 1TWHJ 4N4NB 2IBDA 5JHUA 4ABZA 2X51A 5GTIC 3PUBA 3VDXA 2E34A 2DW4A 3Q0WA 2MSYA 2R4GA 4TV7A 4A3IJ 2VOPA 1S7AA 1S6LA 2W84A 1ONVA 3BZ6A 1H8AC 1B1BA 2CW8A 2DDAA 5J8CA 1B72A 4HW0A 4MQVA 1W5TA 4HNVA 4M3FA 3MZHA 3Q0UA 2K9LA 4KMUX 1HKQA 1JXSA 4A0ZA 2ELKA 3E6MA 1I1SA 3ZQHA 2RREA 2N8GA 3HOTA 3EQLF 2EINH 3GLLA 3KEQA 2DA1A 2OV7A 2VXDA 3EYYA 2QBYA 3H3VK 3OYHA 1BR1A 5K5OA 3FX3A 2ESHA 1FEXA 5DM7F 4NBQA 1ON2A 2PJPA 2VASA 5JR3A 1GUUA 2VE8A 3SHFA 3UNGC 3L2UA 1OYWA 2FQ3A 3RKXA 1UAAA 5L3FA 1GHCA 3EUHC 2DLLA 1DGRM 3BT9A 1JJ6C 4Z2YA 3T5XA 1LVKA 4EGZA 2C6YA 3CCQI 2EFWA 3A01B 5E3LA 4E7JA 1WH5A 5E1WA 2DMUA 1DPUA 4PZJA 4EJVA 2XB5A 2P5VA 1W7PA 2XRLA 4KJZA 3FK7A 5KCMA 3ZMTA 4RDUA 4EM0B 3WU1B 2K27A 2P7CB 2L7KA 2RV8A 4HX7A 4HZFA 3IKTA 1JE8A 1JI8A 1VQ4I 3S1MJ 4G9YA 4OAYA 3G71I 2A6EF 5HLGA 2HVQA 3HGGA 2V9VA 3OYJA 4Y15A 1QU3A 3DWLE 5CPRB 2GLOA 5J3LA 2OD5A 4U87A 3NAUA 4C30A 4G8XA 2JMWA 5CKTA 4YFXF 4DYCA 3OMYA 2VC0A 2O7OA 3K69A 1B9MA 5HLIA 1TBXA 2XUBA 3HSEA 1WZ2A 3CQZJ 2CQXA 2HYJA 5CVJA 3BG6A 3E1SA 5F6FA 4XICA 2WWYA 3A0HC 1BI3A 2YU3A 2Y0MA 3MMYB 2XPWA 1QA6A 3DBLB 3DP7A 3CESA 3FWEA 1TZLA 3ABUA 3S1NJ 2CQNA 1XDUA 3FXJA 5DUKA 1W0UA 1SFOJ 1TNSA 3R0JA 3M1EA 1OPCA 2XPVA 3LQRA 1HLVA 1POGA 2DAOA 2KPMA 5E20A 3ZQ7A 4ZDLA 2OBPA 4XRMA 3S1RJ 3KP5A 5LEKA 2JRMA 4RAYA 4ZZLA 3MD2A 4KFCA 1R00A 2QLZA 4ZZDA 3ZPLA 2VE9A 2KRFA 1I3AA 3RCOA 5JHFA 1RPWA 1B6AA 3C18A 3HUGB 3LSKA 1HW5A 4CZCA 2Z3YA 2NVXJ 3CMEI 1NG6A 2DT7B 2EIJH 2O61A 3H36A 2BYVE 3K4CA 3OSGA 4BE0A 2OA4A 3TO6A 4XKWA 2CS3A 1FYMA 4M3EA 1VQ9I 2UXNA 3VOEA 4RMNA 1D8KA 3OS2A 4L5EA 2XVCA 2XGCA 3U1DA 2M3AA 3GTPJ 4GFBA 3OIPA 1JGGA 1IXRC 3E6CC 1D0XA 5FLXZ 3Q0VA 1LQ1A 4FASD 1NTCA 3JTHA 4BEHB 5E17F 2FBHA 4XLHA 1J2XA 1N77A 2LYCA 1OCCH 3H5NA 4M6XA 3L9FA 1JUMA 4JX5A 1WJCA 3I58A 4G6QA 4FQGA 2Z1DA 5GPAA 3GTJJ 3RKYA 1NHAA 3HEFA 2EIKH 3BTIA 4WK8F 4BS9A 4IO9F 2D5VA 4II3A 2R92J 4N9HA 2YSRA 4QLCU 2UZKA 2EA4A 1BW6A 2RQPA 4M3BA 3DV8A 4BL0B 1WHUA 4M74A 3GCMA 2P0WA 1ZKGA 2GIVA 2HFHA 3BR5A 3CUQB 4BDYA 2CMPA 5FLVA 1X4OA 1A31A 4DW6A 2L01A 3WGGA 4XKBA 5EJCA 2XAGA 3HM5A 4EGYA 4DJAA 2NVUB 5KNLA 1T39A 2Y0SA 3CC7I 1U5TB 2JA5J 5FLXK 3W2WA 2QA4I 2WY8Q 3ISPA 2DFIA 1G8XA 3ZN1A 4J00A 1T38A 1VQ5I 2K9SA 2FE3A 2E2IJ 5HVQC 4IHVA 3JRBA 2DOAA 2RVCA 1PYVA 3SDBA 4UY8I 2A05A 3LFKA 1HW1A 3TW7A 1A36A 1ZREA 4LB5A 2H8RA 2A3SA 2XHKA 4F93B 2WAFA 5J1YA 1VQKI 1PP7U 3T8RA 3VSKA 1X1DA 3KX2A 2HDCA 2R93J 3FMQA 5L3DA 5L3CA 4BAYA 1IV8A 4CCJA 4A0YA 2R5ZB 2MYSA 4CYCB 1SFEA 1W7PB 1BC8C 3KFWX 3OS1A 2L9VA 2PQ8A 1WCMJ 3KPHA 1R4MB 2B7EA 2HWVA 3OYMA 3BR0A 3WTUC 1F9NA 1T0FA 2FX0A 2MH9A 2P5LC 1UHWA 2VBXA 2R7SA 1CF7A 2W4SA 4B4CA 2K9QA 2FXAA 2DQRA 2ZXIA 1RR8C 3J81K 2GM4A 1RETA 3BPVA 5IYBJ 2MABA 2E1OA 3F6OA 3KYCB 4XN0A 5CVRA 4XBFA 2EV5A 3K2ZA 3S2WA 4JOMA 2KIQA 5LFAA 2CO5A 4RLQA 1WJEA 4ZYDA 5HS9A 3OYLA 2W85A 3F8CA 1UHMA 3KP7A 1LDKB 2OPTA 4JK1X 2K3PA 2R3SA 2OUMA 4WWCA 1FP2A 2CSOA 1Q1HA 2DA2A 4A3KJ 5D8KB 2CUEA 3Q9VA 1K79A 2COMA 3KIOA 4HSRA 4G7OF 5ILUA 4IHWA 2I10A 1QNTA 3HHHA 4BXFA 3JRDA 3DEWA 3F0CA 1SANA 5JLWA 1R49A 5C4XJ 1FWZA 3MKWB 4RS8A 2WC2A 2AQFA 1YW7A 4HX4A 5HDGA 3ABLH 3CDIA 2W00A 3IHUA 2YR2A 4CCLA 3F6VA 2F5EA 1DP3A 2VJ4A 3LA7A 5FKOA 2HVSA 2O0YA 2ETHA 2IGKA 2FUG2 4HX8A 1FZPB 1J5YA 4ZJZA 3FHZA 3R61A 2UV1A 2BVLA 4LG0A 5LLQA 1E3OC 4XRSG 2DN0A 1WJFA 1TWGJ 2ZNZA 1ACIA 1MJ9A 2H6BA 2M4GA 2XF5A 3KYDB 3S2DJ 2XAHA 1BJAA 2J5OA 2DQLA 5B1BH 5L3BA 2HQNA 2EV0A 4UVBA 5EGOA 3S3OA 5LRSA 1YO5C 2BHYA 1ZTRA 2ZO4A 3QU6A 2DFEA 1H89C 3DPLC 2JSCA 4HAMA 3TP3A 3U2RA 2JK3A 1Z6RA 3AG1H 2LH9A 4HOBA 1N78A 2IS2A 2M45A 3GEZA 2K40A 3FMRA 1B4AA 3BOQA 3CDLA 2IGNA 4LLGF 4NC6A 3K4BA 4Q5SF 1AOYA 3DCFA 2HQAA 3PQJA 4XR6A 3ZN0A 2LR8A 1ZRDA 2DPDA 1QVTA 4I98B 2JRTA 5GAGJ 4RAZA 3MAJA 5J1UA 2L02A 4B3AA 4A3EJ 2BY0A 2WAQA 3ELKA 2CW7A 1P2FA 2QBYB 4MEXF 3GFIA 3FBIB 2OC6A 2CQ7A 2YU9J 2EIMH 1EKEA 3V8LA 2PG4A 3PFIA 3ZOBA 2DA3A 1VQMI 2B63J 2V6EA 4A3CJ 4R79A 2ICWG 1XD7A 5HLTA 3W6VA 2CUZA 3DKYA 1ETWA 3NEUA 2VJIA 4EM1A 4I6ZA 5IT9Z 3GZNB 3IC7A 1P4AA 3IKVA 5D5XB 3K1MA 4O3MA 1ZH5A 2L9RA 3L7WA 2BXYA 2FU4A 3ZRGA 3ASOH 1X19A 3KCCA 3OV8A 1ZRCA 1YW8A 2W24A 1YS6A 4CZZA 2BY1A 5IY5H 2O6GE 1LFPA 3OYBA 2V79A 1R23A 4XLCA 1YI2I 1OCOH 2ACJA 2BE5F 1X3ZB 3BDDA 2OZ6A 1BI2A 4PUSA 3G6EI 2IEKA 3C7JA 4BQAA 3DU5A 1OCPA 1SVLA 4RB0A 2M8GX 1I5ZA 4KIFA 1Y8QB 2DTZA 1SC7A 4U0YA 3K70C 4ANJA 3GTMJ 3ZQIA 3WG9A 4LOCA 1SD6A 5L3EA 2GA2A 1R1VA 3ABKH 4CCNA 2IS4A 1QRYA 3H35A 4CUGA 3ECHA 4QSHA 1P6RA 3GUDA 2LVSA 3CCSI 1DQUA 3AL0C 3DF8A 2BBYA 5B66C 1X3WB 1Z7UA 2RNGA 2Z33A 1MD0A 1OQYA 4QPOA 5IOZA 1JT6A 3QOPA 4A0XA 3K1PA 4JYKA 3GFJA 3GW2A 1VTNC 3GLXA 5E8GA 2LY1A 4AIDA 2LD5A 3RQIA 2ISZA 1RNLA 3F23A 5BNGA 4XKVA 4PGGA 3IH4A 2JA7J 3BQZA 3LA3A 4A69C 1K78A 4J01A 3NQOA 1WJ5A 3F8FA 2LMDA 1OFCX 1IJWC 1FSEA 2LF7A 2X48A 4WX9A 4LJZF 3BCBA 2GA1A 4BUPA 2LY2A 3IWZA 4ITVA 2OF7A 3CZ6A 4B47A 1QBJA 1TW2A 3PQKA 4DYQA 1VQPI 4IHSA 4A93J 2M0CA 4RM2A 3GTKJ 1XSXA 1MBGA 3AG3H 2XF6A 4LB6B 2R7RA 1GT0C 2CQQA 2XPUA 2HU9A 2Y0SN 1SD4A 1D1BA 2LRDA 1XG1A 1B72B 1L3LA 4QTRA 4NB5A 4BKXA 2QZ8A 2I5UA 1TWFJ 3NWTA 1XPXA 3A0BC 2BV6A 1AKHB 2M5WA 1YJNI 3K6GA 2DBBA 1IG7A 3RPQA 4MFDA 1X2MA 2D2WA 1OMIA 3LSGA 4D5FA 2AXTC 3V8KA 2KRHA 1MBJA 5ED4A 2E60A 2E7XA 3M8EA 4KUMA 1X1PA 2OU2A 4GYIA 1USSA 5EZGA 5J4VA 4X0GA 3HOZJ 4ZTFA 3CCRI 3CCYA 1G2HA 2VI6A 2Q0OA 4KITB 5DV5A 2HXIA 1BC7C 2DA6A 4I7HA 2L9SA 4DZJA 1W1WE 2RDPA 4RA2A 3LWFA 5GPCA 1K6OA 2NNYA 4O6JA 4L9NA 3I71A 2MD5A 3JR9A 4KA4A 2HPIA 3CC2I 4H0EA 1S7OA 5M3FJ 2H27A 1U3EM 1Y39A 1HSTA 1TL8A 4FETA 5GP9A 4IRHA 5GAHJ 4PJ0C 1FOXA 4XN3A 3ML6A 1Q1VA 3GFMA 4N0BA 6PAXA 2PEXA 1OLTA 4I99C 1XS9A 1WWXA 2X4HA 2M1BA 4W1UA 4B8XA 1XCBA 5F1RA 4A3GJ 2V4JC 4WXCA 4XLAA 3PO2J 3TGNA 1ON1A 4BY7J 2FRHA 4Z6YA 3OL4A 2VQCA 3MFKA 2ZMEC 2KL4A 1BR2A 4A6EA 3ERED 5JVGF 4D7MA 4GGGA 3L2VA 1J0RA 4JX6A 4LG3A 2QM3A 2WADA 2X9DA 3FXUA 2XSDC 2MLGA 1G4DA 3CJTB 2ZSHB 4B3XA 1W36C 3FBNB 2KP6A 4QPQA 1R71A 2QQ9A 1TWCJ 1R1UA 3WODF 3J7YJ 1XMXA 3ABMH 5J6XA 4L18B 4YRVA 2EBIA 3BPXA 3TOAA 1HF0A 1P7IA 1M1EB 5FD5A 1QQIA 1H9GA 4PFOA 3DPUA 5D4SA 4X6AJ 3HOVJ 3EYIA 4G12A 5HDKA 1ETVA 2ZMEB 1VFCA 1YYVA 4HNUA 2HOEA 3CC4I 2EILH 4EJTA 2JTVA 4AU7A 3IAS2 4E7HA 3H5AA 2KZVA 3JRCA 3MZ8A 2L7ZA 3EUKL 5BS6A 4ZYGA 4M3DA 2W1OA 2OTJI 1F43A 1OJLA 3M7GA 3H3ZA 4OIRF 1QGPA 2XAFA 2HYGD 2GWRA 4X1EA 2OTLI 3W6KB 3OS0A 5F0HA 5BOXA 1SEUA 3ZQGA 2BW3B 4XORA 1JKOC 4KYWA 5CQGA 1IW7F 4F3QA 2FD5A 2HQRA 4ESBA 4I2OA 1BN5A 2EK5A 1A6IA 2F4MB 2P4WA 1AU7A 3ZMVA 1KQ8A 2V9PA 3WTYC 1EH6A 4E70A 3JSOA 4KIBA 2VBWA 4HQMA 1Y1WJ 1MKMA 3GBGA 3I59B 4B1RA 2IS1A 2M7BA 2Q2EB 2HZTA 4E7SA 3Q5FA 3CLQA 1IGNA 2L5QA 2XKPA 3JCUC 2HYFA 3LAPA 4WXDA 2IPQX 5FLMJ 1BBYA 1ZR4A 2FBKA 2PMZA 2ZJRF 3MKYB 3L2QA 5F08A 3H3UA 3RPUD 3F3XA 2B0LA 1QZEA 2X1CA 1FJLA 1IZ1A 1S7EA 3EUAA 3MWMA 1R5GA 4KDPA 3KP6A 3W3CA 5F0CA 2DCEA 4UV9A 2NRAC 4IVNA 3ECOA 3QPTA 2XIGA 2L2OA 1H9TA 2ZC2A 3MVPA 3F8NA 3PO3J 1JKPC 3HBLA 1X2NA 2COBA 2QKLB 4L9VA 4LIVA 1NK3P 4A3JJ 2XRNA 4U0WA 1MNEA 2VB6A 4BQQA 1O3RA 1VQ8I 4AC0A 2BHZA 2ZXJA 5LHHA 3P7NA 1S72I 3HOSA 1VQ7I 2R7WA 2IAIA 3DQVC 4M9XA 1ZG3A 4ZC3A 4DOZA 1HCRA 3H9QA 1U78A 2NOJB 2L3DA 1K83J 4UXNA 2X1EA 4FCYA 2AS5F 1O3TA 1V4RA 3VWBA 3QWLA 1BL0A 4ASNA 3SFIA 2CQKA 4XSZF 2GAUA 5LBQA 4A3FJ 1YW9A 3DKXA 3W6JB 2ID3A 3M9AA 4CO8A 4U0VA 3AKZA 2DJNA 4LGWA 4CH7A 1MNDA 1S3JA 1XMAA 2HXOA 2LFBA 3UR3C 2R0QC 2JA8J 3HJEA 1IC8A 1B8IA 4XONA 3I3LA 3WTVC 1YTYA 1ETQA 3I4MJ 2DYSH 4RBOA 3JRGA 2DA5A 3KLOA 4XIDA 3CCVI 2R7XA 4ESFA 3BG3A 3U9GA 3PSFA 5DYMA 2EH3A 2Y31A 4B44A 4HPQA 2H1KA 2OZUA 4P96A 1G6NA 1A35A 2EZKA 2Z2SB 3E6BA 3KP3A 1DP7P 3FXMA 3KYLA 3L2RA 3F21A 2JA6J 1UCRA 2R7OA 4LG0B 1I3QJ 1IO2A 5FO5A 3E5XA 4MGRA 3CUOA 3CJNA 3FM5A 5CJ9A 2W57A 2Y9YA 2ZBKA 5DS9A 3DEEA 3E6DA 4XRFA 1RZ4A 2CG4A 1MBKA 3I55I 3I56I 5EZHA 3OR1C 3A01A 1BOAA 3S2HJ 2IS6A 1HQCA 2GBYA 1ORKA 1VQ6I 2XAJA 4Y3OA 4BU2A 1MH4A 2FNPA 3WGIA 4Y13A 3LSMA 1TT5B 1YQAA 3RI4A 3TW6A 4UUSA 1EH7A 5FKMA 1U8BA 2E19A 1GXQA 5F27A 2E5NA 3LMMA 3OYGA 5EF6A 3HKZA 2JZYA 2VJ5A 3BTLA 2BVMA 2X1DA 4UV8A 3RZDJ 3EPZA 3HOWJ 9ANTA 5IP6A 1JGSA 3DBHB 2FQ4A 4C2TA 3K4KA 3ABTA 4PDKA 2CV0A 1D3YA 1DU6A 5FKNA 3VSLA 4II2A 2CUFA 3JREA 4G7ZF 4YIIA 1YRNB 1YLFA 1FBUA 2KZGA 2CWEA 3PSIA 1SFKA 4U7DA 3RQ4A 3SZGA 3HOUJ 3D0SA 1FYKA 2NXNB 4EEFG 2UWMA 3WTWC 2MC3A 5ICFA 3B6AA 4PJNA 1SFUA 3QP6A 3RJPA 4V19K 1HSJA 1U9NA 4IRIA 1W0TA 2JSPA 4AYBN 3B6CA 5K1YA 3OR2C 2QEXI 2OQRA 3PJRA 4L0ZB 4D1QA 3GTLJ 1NG7A 1OKRA 2ID6A 4YIFA 2STTA 1I6HJ 2NOGA 4I09A 4S05A 1ETKA 4AWXB 1BR4A 2VQHA 2HZDA 4BBSJ 4LITA 2ZKZA 3M8FA 2UUZA 3BR2A 4BHCA 1O4XA 5CQEA 3HZJA 4B43A 1SMYF 1TQMA 1ZARA 2R5YB 2E1NA 3PL8A 1O3SA 1Y8RB 1J7KA 3SQNA 3HXLA 4A2UA 2RKHA 2KIUA 1R5ID 1VQOI 3IH3A 3OYEA 4Q4ZF 2DFFA 2WV0A 2A5YB 2DTRA 3S16J 2XC7A 1G3WA 3ZMZA 2LG4A 4E7LA 3UKGA 3JRFA 1W4MA 1MBFA 2MA3A 5FGMA 2QCOA 2ZSIB 5CVVA 2UXXA 3ZQCA 3ERMA 4XOPA 5J8FA 2DOFA 2W7NA 1MBHA 5K7ZA 2A6HF 5M5YJ 3EETA 1FTZA 3K4JA 2P8TA 4HNTA 2KKOA 2GIZA 3H9GA 3GF2A 1LEAA 4MQ9F 5HNHA 4OOIA 1YFHA 1HC8A 3BLYA 1QZYA 2R7QA 2HOSA 3S17J 1W7PD 1JTYA 3R4KA 3KP4A 3QYEA 3LSIA 3C2HA 5GADJ 2VONA 4O5VA 2X6OA 5IT9K 2F4OB 4XM3A 5IYCJ 4M72A 1OYIA 1RKTA 2WAEA 3GYHX 3DTEA 3KEYA 1EH8A 3MQ0A 4Q47A 4EJWA 2LY9A 2F48A 3CO7C 4NDLA 1REPC 3CUQA 1UFMA 3OYNA 4JQFA 1V5EA 1LE8A 2D45A 1ENHA 1OCZH 1V5FA 3WE2A 4HF1A 2QF7A 2VT2A 1ODDA 3WTTC 3ZQFA 5LD2C 1L0OC 1BOBA 4P5OA 3HIFA 5H20A 4E7ZA 5DUIA 4NHJA 2Y30A 1RIOH 1D5VA 2CJJA 2E71A 3FIWA 3WHBA 4Y52J 1JTXA 5IP7J 3BTJA 4RGSA 4CCMA 1IUFA 4UUVA 2V7FA 3G1MA 2ZFUA 1TQIA 4HA8A 1X58A 1UHSA 1IN6A 1K61A 1X1AA 2ISYA 2CYYA 2F5CA 4CYCA 3GWZA 2VBYA 1UMQA 3BCAA 4Q48A 4B09A 5B1AH 1VI0A 2PMUA 2PX9A 2J5PA 4EJUA 3FXLA 4XKCA 3I54A 5AONA 3VYTB 4UUTA 2LREA 4EV0A 3V4GA 2X0LA 4XLFA 2ECBA 3JSPA 3A2KA 1T56A 4AVZA 1UELB 4HDVA 1E2XA 2B9SA 4IPAA 2IA0A 1ERDA 1HBXG 4LMYA 4EQQA 2DA7A 1N25A 3BJOA 3TDUC 1RKWA 1GDTA 1ZRFA 3PIOF 4LLLA 1G3YA 2X6YA 3BG5A 1MMNA 3PUFA 4F92B 1IRGA 3U21A 3QPLA 1B59A 1USTA 1WFXA 4ZYHA 4LLNA 2PMHA 2VKVA 1IRFA 1KA8A 2MGQA 2R5YA 3ONQA 1W36D 3S15J 5CYVA 1ZGAA 5E3NA 3IH2A 1FC3A 3LOCA 2G9WA 4DYRA 2LBFA 2XB0X 2Z99A 2QSHX 4HV6A 1TTYA 2R7ZJ 3FXQA 4BE2A 1X1BA 4FISA 2AHQA 3WTZA 2IW5A 4AD9A 5A2QK 4KT6A 3NWSA 1QO0D 2PBIA 2XGDA 4Y33A 3OIOA 5H2FC 5AIQA 1MNMC 1ZELA 2RGVA 3HGYA 4BHPA 1DUXC 2JN6A 2QSGX 1FMWA 3M4OJ 4XL9A 2JJ7A 4FE7A 2F5DA 2LK2A 1OISA 4U88A 3G4SI 4UB6C 2K9NA 2VUMJ 3ZMUA 5D4RA 3K7AJ 3DKWA 2F6CA 3FXKA 5ILSA 4YFKF 4PJJA 3JAMK 1PUEE 1KQ0A 3CJQB 4Y17A 2ADUA 4FTHA 4S0HB 1G3SA 1FP1D 2EA2A 4AIJA 2KIMA 4BYYA 1LDJA 4CA0A 3WG7H 2KFDA 3P9IA 2IA1A 4C9YA 1MJBA 2DFHA 4HYEA 2Y48A 3BQYA 5DD4A 3JTGA 1WVRA 1JKRC 2VKHA 3HTSB 1XMKA 2BW3A 4PJLA 2V1DA 3QYFA 2DMNA 3GTQJ 3WGHA 2BEOA 4R8HA 3V8JA 4NQWA 1XDSA 5A2QZ 4HBLA 4BXUA 2FMLA 2HGCA 2H09A 1MW7A 3WE3A 4ZDOA 4LFUA 1NH3A 5FROA 3GX4X 2EPFA 1PDNC 1IN7A 1MMAA 2XASA 3FXOA 3I53A 4UHTA 3Q9SA 4ZYAA 1KU2A 4LD5A 2GZWA 2O5RA 4BBRJ 1O7FA 4A6DA 1BI1A 2XGXA 5K5QA
chains in the Genus database with same CATH topology
2Z5UA 1LDDA 3F8MA 3EUHA 1IN4A 2Y75A 3SXYA 3K0LA 1XCVA 4HF2A 2G7HA 1SD5A 4KN4X 2XROA 4UVAA 3DXJF 3B02A 1H0MA 1R5HA 1XGSA 2K7LA 4ZYEA 2LKPA 5ICEA 3JW4A 3O2PE 3T1BA 2HS5A 1BIBA 2EFNA 1J9IA 3CTAA 3VB2A 5D5VB 3BROA 1LVAA 2H94A 1ULYA 4CDGA 3ULQB 2L4MA 5IT3A 1IAWA 4EM2A 2PI0A 5E1ZB 3RKWA 1Z9CA 3REOA 3L00A 4M73A 2W25A 2KJBA 2PFBA 2K4JA 2QQAA 2NYXA 1U6GA 4BNCA 1ZHFA 5ERIA 3P9CA 5D6FA 3KEOA 4ESJA 2EWNA 2K02A 5HLHA 1IUYA 4GCVA 1KQ9A 2BGCA 1TNTA 4L9TA 4D0PA 5DDGA 2LSOA 4RGUA 3J80K 1ZGJA 2NNNA 1PP8F 2QWWA 3QP5A 2DK5A 2Z9OA 1FBSA 3BY6A 3DEUA 2MLKA 4LK0F 1FOKA 1ZYRF 3V7SA 1MDMA 3QU3A 4MEYF 2F5FA 1P92A 4IXAA 3F72A 4HLXA 2HKXA 3T8TA 4OIPF 1D8JA 1F4KA 4PCQA 1O3QA 3D5LA 3FM3A 2JPBA 3P9KA 3TO7A 1WKMA 3E3VA 2DT5A 4BH9A 3V7CA 3J80Z 1XB4A 4UVCA 1BM9A 1DPRA 3LSTA 5DD8A 2IT0A 2A68F 5KK1A 4AIKA 3WU0A 1YG2A 2V1UA 1V3FA 2Q8KA 2YX4A 4M9ZA 3HSRA 5D6EA 1HW2A 5HDNA 1K7AA 3SFZA 1XGMA 1B9NA 2IA2A 1YS7A 4HQEA 1WSUA 1XGNA 3IRQA 2A69F 1IF1A 4OMZA 3I0TA 3N4MA 5D5UB 2DK8A 3KP2A 1FT9A 2V1XA 2EFQA 4OU0A 2D1HA 4ENMA 3I5UA 2MH2A 1UB9A 1DDNA 2O03A 3E5UA 5DCFA 4UNOA 3E5QA 2ZNYA 1JHFA 2GXGA 5BQTA 2FNAA 3BJAA 3ZP5A 4RB3C 3BP8A 5KVRA 3DPTA 3OOPA 2O3FA 3O6BB 3COAC 1C0WA 4L5JA 1SAXA 1OYYA 1XGOA 1LNWA 1W5SA 3K9TA 3J81Z 2CW0F 2ZCWA 1LJ9A 2AXLA 2E1CA 1R7JA 4MNUA 3RYRA 4HLYA 1T2KA 2L54A 2ZFWA 2QVOA 3ZMDA 1I1GA 2WTEA 4A5NA 2F2EA 3R0AA 2Q2EA 4WXHA 3HRMA 2IJLA 4MTDA 1FPQA 3I4PA 3BJ6A 5CVIA 2KIFA 2O8XA 1HKSA 4LK1F 3HHGA 2A07F 4CHUA 2ESNA 3C3WA 2QENA 1A04A 4CICA 2R7FA 3KLNA 4EJOA 3SZTA 5LGNA 1ZG1A 4G6DA 2L4AA 2GQQA 3B73A 4OIOF 1KYZA 2KJCA 5BPIA 3EDPA 1GXPA 4ON0A 1Y0UA 3HYIA 2YX7A 3KZZA 3KE2A 1Z6TA 5LHIA 3GZ6A 2R7DA 1Z1DA 2VT3A 1FBQA 4A12A 3GO5A 2HKOA 3RTRA 3RPUA 3F8BA 5E18F 1CF7B 1QPMA 1Z91A 1FY7A 2FA5A 3V7RA 2JT1A 2XKOA 4KNYA 2CFXA 1SMTA 2XV4S 3GVAA 4HF0A 2MBFA 5ICGA 1IN5A 2P7VB 3QAHA 3R60A 1P4WA 4IJAA 4G94A 1MJAA 1R36A 3I64A 5JI6A 3VEPA 2P5KA 1GVJA 4S04A 2DI3A 4YFNF 2CGPA 2EV6A 2E7WA 3F22A 2GXBA 2EB7A 5ILVA 4RGRA 2DU9A 1E17A 4R1HA 3QPHA 4F7ZA 2STWA 3G3ZA 5FD6A 1WI9A 4I02A 4AIHA 2IP2A 4A5MA 1WRJA 3L09A 1HXDA 2IVMA 5FFZA 4QWQA 1O7LA 3K1NA 1U8RA 4BHBA 4I0AA 3MZYA 4GYGA 3RDIA 2D1VA 1IN8A 2M87A 2QQBA 1I6XA 4YG2F 2HTSA 5ICCA 1MDMB 1LEBA 2RNJA 5EEHA 2VC1A 3LA2A 4JBAA 5JVTA 3WTXC 4WCGA 5TRDA 2K86A 2VN2A 4P55A 5H6RA 4OIQF 3HUGA 2K4BA 3QRFF 2JPCA 5JFRA 5CVUA 2TDXA 1G3TA 1YIOA 1EV7A 1I27A 1KGSA 5LGTA 1O57A 1HKTA 2ZMEA 2IRFG 2FEZA 1U2WA 4RB1A 3CDHA 2DO7A 4MHGA 5LGUA 3FZVA 3CO6C 4XSXF 1MGTA 1J59A 2QYOA 4ENJA 3TKYA 4MTEA 4HDUA 2EJRA 1QZZA 5AIPA 3J7AO 1S29A 2A61A 5F64A 1LB2A 2EFOA 4WF2A 2OQGA 4IF4A 2ZJ2A 4GO1A 5K5RA 4DQ2A 3IWFA 1SFXA 4ENNA 4RGXA 1XSDA 5E1XA 1Z05A 3I59A 2LNBA 3VFZA 1R22A 3SZPA 4GXOA 4K2EA 1ZN2A 2VOOA 4M9SA 2FSWA 2HEOA 4FHTA 1IXSB 1T6SA 2YPRA 3C1DA 3KZYA 5EEGA 1FSHA 1MZBA 1BIAA 4KT5C 5HOOA 3LAJA 4FX0A 1S8NA 1R1TA 3HSFA 4EMSA 5HS8A 4OMYA 5BPDA 3HRSA 3GXOA 3NRVA 4ZH4F 2EFPA 2RN7A 4KIGA 3L2CA 1F1ZA 1AWCA 3DFGA 2VODA 3MCZA 3CLOA 4CYDA 1T98A 4IHTA 4I01A 1KU9A 1FNNA 4CGZA 4XLPF 2FMYA 3HRTA 5LRRA 2FF4A 3RYPA 1STZA 4L9JA 4M6YA 2M30A 4L5IA 4FX4A 2FBIA 5CLSA 4L0YB 5DCMA 1RUOA 5BMZA 5FB2A 1TQPA 3BWGA 5FFXA 1KU3A 2G7UA 1F5TA 3FMSA 2PLYA 1OR7A 1ZAOA 4ETSA 4U7BA 4G7HF 2VXZA 4M71A 1TW3A 3CUQC 3T0YA 3ROUA 1BI0A 2NS0A 3VODA 3RIRA 2XAQA 2LF8A 1JHHA 3TDZC 4AVPA 1J75A 4ENKA 3AAFA 2VBZA 3HRUA 4XLNF 1FLIA 1SD7A 3TQNA 2ELHA 1ZLJA 3LQQA 1RI7A 2V6CA 1CGPA 4EVIA 1TLHB 5HS7A 2QUFA 2RC4A 4RB2C 3GFLA 1RUNA 1ZG5A 1ZLKA 3ZMSA 1P4XA 4FT8A 4HV5A 2M8EA 5H6QA 5TJJA 5DCMB 1IXCA 3KETA 1X3UA 4PGHA 1KU7A 3IRRA 3HTUA 2OAZA 5L3GA 5DEQA 1FYLA 4OINF 3TOBA 5LEJA 1XSVA 1K78B 1FX7A 1U5TC 2HTJA 3E97A 3JAMZ 3MEXA 2LDUA 3FF5A 3O3KA 2H6CA 4N9IA 3H92A 4P9UA 3N97A 2DPUA 1KYWA 4I0BA 2P6SA 4DNCA 4KICA 2P6TA 5LHGA 3R6SA 4KN7X 5E8IA 4CXFA 4IRGA 1U5TA 2FOKA 1WQ2A 1R58A 2HR3A 3G73A 2PN6A 3TO9A 4KMFA 1XN7A 2NAZA 3WTSC 5D8LB 3GZ5A 5D5WB 4P9FA 3IL2A 3FXRA 5JHUA 2DW4A 4TV7A 2VOPA 1S7AA 1S6LA 2W84A 1ONVA 3BZ6A 1B1BA 5J8CA 4HW0A 4MQVA 1W5TA 3MZHA 4KMUX 1HKQA 1JXSA 4A0ZA 1I1SA 3E6MA 3HOTA 3EQLF 3KEQA 2QBYA 3EYYA 5K5OA 3FX3A 2ESHA 1ON2A 2PJPA 5JR3A 2VE8A 3SHFA 1OYWA 2FQ3A 3RKXA 5L3FA 1GHCA 2DLLA 4Z2YA 3T5XA 4EGZA 2C6YA 2EFWA 5E1WA 1DPUA 4PZJA 4EJVA 2P5VA 1W7PA 3ZMTA 4EM0B 3WU1B 2K27A 2P7CB 2RV8A 4HX7A 4HZFA 3IKTA 1JE8A 4G9YA 2A6EF 5HLGA 2V9VA 4Y15A 2OD5A 4G8XA 4YFXF 2VC0A 3K69A 5HLIA 1B9MA 1TBXA 2XUBA 3HSEA 5CVJA 5F6FA 2WWYA 1BI3A 2YU3A 2Y0MA 3DP7A 3FWEA 3ABUA 1XDUA 5DUKA 1TNSA 3R0JA 3M1EA 1OPCA 3LQRA 2DAOA 5E20A 3ZQ7A 2OBPA 3KP5A 5LEKA 4RAYA 4ZZLA 4KFCA 1R00A 2QLZA 4ZZDA 3ZPLA 2VE9A 2KRFA 1B6AA 3C18A 1HW5A 2Z3YA 2O61A 2BYVE 2OA4A 3TO6A 1FYMA 2UXNA 3VOEA 1D8KA 2XVCA 3U1DA 1IXRC 3E6CC 5FLXZ 1LQ1A 3JTHA 5E17F 2FBHA 1J2XA 4M6XA 3L9FA 3I58A 4G6QA 3RKYA 1NHAA 4WK8F 4N9HA 2YSRA 4QLCU 2UZKA 2EA4A 2RQPA 3DV8A 4M74A 2HFHA 2GIVA 3CUQB 2L01A 3WGGA 2XAGA 4EGYA 1T39A 1U5TB 5FLXK 3ISPA 2DFIA 1T38A 3ZN1A 2FE3A 5HVQC 2RVCA 3LFKA 1HW1A 1ZREA 4LB5A 2A3SA 2XHKA 1PP7U 3T8RA 2HDCA 3FMQA 5L3DA 5L3CA 4BAYA 4A0YA 1SFEA 1W7PB 1BC8C 3KFWX 2PQ8A 2HWVA 3WTUC 1F9NA 1T0FA 2MH9A 2P5LC 1UHWA 2VBXA 1CF7A 2FXAA 2DQRA 3J81K 3BPVA 3F6OA 5CVRA 4XBFA 2EV5A 3K2ZA 3S2WA 2CO5A 4ZYDA 5HS9A 2W85A 3F8CA 1UHMA 3KP7A 1LDKB 4JK1X 2R3SA 4WWCA 1FP2A 2CSOA 1Q1HA 5D8KB 1K79A 3Q9VA 2COMA 4G7OF 5ILUA 1QNTA 3HHHA 1FWZA 4RS8A 2WC2A 4HX4A 1YW7A 5HDGA 3IHUA 2YR2A 3F6VA 2F5EA 3LA7A 2O0YA 2ETHA 4HX8A 1FZPB 1J5YA 3FHZA 3R61A 4LG0A 5LLQA 2ZNZA 1MJ9A 2H6BA 2XAHA 1BJAA 2J5OA 2DQLA 5L3BA 2HQNA 2EV0A 4UVBA 5LRSA 1YO5C 2ZO4A 3QU6A 3DPLC 2JSCA 4HAMA 3U2RA 1Z6RA 4HOBA 2M45A 3GEZA 1B4AA 3BOQA 3FMRA 4LLGF 1AOYA 4Q5SF 3ZN0A 3PQJA 1ZRDA 2DPDA 4I98B 2JRTA 4RAZA 3MAJA 2L02A 3ELKA 1P2FA 2QBYB 4MEXF 3GFIA 3V8LA 2PG4A 3PFIA 4R79A 1XD7A 3NEUA 4EM1A 5IT9Z 3IC7A 1P4AA 3IKVA 5D5XB 3K1MA 4O3MA 1ZH5A 3L7WA 2FU4A 3KCCA 3OV8A 1ZRCA 1YW8A 2W24A 1YS6A 4CZZA 2O6GE 2V79A 1R23A 2ACJA 2BE5F 3BDDA 2OZ6A 1BI2A 3C7JA 4BQAA 4RB0A 1I5ZA 4KIFA 4U0YA 3WG9A 1SD6A 5L3EA 2GA2A 1R1VA 3ECHA 1P6RA 3GUDA 3DF8A 2BBYA 1Z7UA 2Z33A 1MD0A 3QOPA 4A0XA 3K1PA 3GFJA 3GW2A 1VTNC 3GLXA 5E8GA 2ISZA 1RNLA 3F23A 4PGGA 3LA3A 1K78A 3NQOA 3F8FA 1FSEA 2LF7A 4WX9A 4LJZF 2GA1A 3IWZA 1QBJA 1TW2A 3PQKA 4IHSA 1XSXA 4LB6B 1SD4A 1L3LA 4NB5A 2QZ8A 2BV6A 2M5WA 2DBBA 3RPQA 2D2WA 1OMIA 3V8KA 5ED4A 2E7XA 3M8EA 4KUMA 2OU2A 4GYIA 1USSA 2Q0OA 5DV5A 1BC7C 4I7HA 2RDPA 3LWFA 1K6OA 2NNYA 4O6JA 4L9NA 3I71A 2MD5A 4KA4A 4H0EA 1S7OA 2H27A 1U3EM 1HSTA 4IRHA 3ML6A 3GFMA 4N0BA 6PAXA 2PEXA 1WWXA 2X4HA 2M1BA 4B8XA 1XCBA 5F1RA 4WXCA 3TGNA 1ON1A 2FRHA 3MFKA 4A6EA 3ERED 4GGGA 1J0RA 2QM3A 3FXUA 2MLGA 1G4DA 2QQ9A 1R1UA 3WODF 5J6XA 4L18B 3BPXA 3TOAA 5FD5A 1QQIA 1H9GA 5D4SA 3EYIA 5HDKA 2ZMEB 1YYVA 2HOEA 4EJTA 2JTVA 5BS6A 4ZYGA 3M7GA 3H3ZA 4OIRF 1QGPA 2XAFA 2HYGD 2GWRA 3W6KB 5BOXA 4KYWA 1IW7F 2HQRA 4ESBA 4I2OA 1BN5A 2EK5A 2P4WA 3ZMVA 1KQ8A 3WTYC 1EH6A 4E70A 3JSOA 4KIBA 2VBWA 4HQMA 1MKMA 3I59B 2HZTA 3Q5FA 2XKPA 2HYFA 3LAPA 4WXDA 2IPQX 1BBYA 2FBKA 3H3UA 3F3XA 2B0LA 1IZ1A 3MWMA 1R5GA 4KDPA 3KP6A 4UV9A 2NRAC 4IVNA 3ECOA 3QPTA 2XIGA 1H9TA 3F8NA 4L9VA 2XRNA 4U0WA 1O3RA 2ZXJA 5LHHA 3P7NA 3HOSA 3DQVC 4M9XA 1ZG3A 1U78A 2L3DA 4UXNA 2AS5F 1O3TA 1V4RA 4ASNA 2CQKA 4XSZF 2GAUA 5LBQA 1YW9A 3W6JB 3M9AA 4CO8A 4U0VA 4LGWA 1S3JA 1XMAA 3WTVC 1YTYA 3KLOA 4ESFA 3U9GA 5DYMA 2OZUA 4P96A 1G6NA 3E6BA 3KP3A 1DP7P 3F21A 1UCRA 4LG0B 5FO5A 3E5XA 4MGRA 3CUOA 3CJNA 3FM5A 5CJ9A 2W57A 2ZBKA 3E6DA 4XRFA 1RZ4A 2CG4A 1BOAA 1HQCA 2XAJA 2FNPA 3WGIA 4Y13A 1YQAA 3RI4A 1EH7A 1GXQA 2JZYA 4UV8A 1JGSA 3ABTA 4PDKA 1D3YA 4G7ZF 4YIIA 1YLFA 1FBUA 2CWEA 4U7DA 3D0SA 1FYKA 2UWMA 3WTWC 2MC3A 5ICFA 1SFUA 3QP6A 3RJPA 1HSJA 4IRIA 5K1YA 2OQRA 4L0ZB 1OKRA 4YIFA 2STTA 4I09A 4S05A 4AWXB 2ZKZA 3M8FA 4BHCA 1SMYF 1TQMA 1ZARA 2E1NA 1O3SA 1J7KA 3SQNA 4A2UA 2RKHA 2KIUA 4Q4ZF 2WV0A 2A5YB 2DTRA 1G3WA 3ZMZA 1W4MA 2MA3A 5FGMA 5CVVA 2UXXA 5J8FA 2A6HF 3EETA 2P8TA 2KKOA 3GF2A 1LEAA 4MQ9F 4OOIA 1YFHA 1QZYA 1W7PD 3R4KA 3KP4A 2VONA 4O5VA 5IT9K 4M72A 1OYIA 3GYHX 1EH8A 3MQ0A 4Q47A 4EJWA 3CO7C 1REPC 3CUQA 1UFMA 4JQFA 2D45A 3WE2A 4HF1A 3WTTC 2VT2A 1ODDA 1L0OC 4P5OA 3HIFA 5H20A 4NHJA 5DUIA 1RIOH 1D5VA 4RGSA 4UUVA 1TQIA 4HA8A 1IN6A 2ISYA 2CYYA 2F5CA 3GWZA 2VBYA 4Q48A 4B09A 2PMUA 2J5PA 4EJUA 3I54A 5AONA 4EV0A 3V4GA 2X0LA 3JSPA 4HDVA 1E2XA 4IPAA 2IA0A 1HBXG 4LMYA 4EQQA 3BJOA 3TDUC 1ZRFA 4LLLA 1G3YA 1IRGA 1B59A 1USTA 4ZYHA 4LLNA 2PMHA 1IRFA 1KA8A 5CYVA 1ZGAA 1FC3A 2G9WA 2Z99A 4HV6A 1TTYA 3FXQA 3WTZA 2IW5A 4AD9A 5A2QK 1QO0D 2PBIA 5AIQA 2RGVA 4BHPA 1DUXC 4U88A 2F5DA 3ZMUA 5D4RA 3DKWA 5ILSA 4YFKF 3JAMK 1PUEE 1KQ0A 4Y17A 2ADUA 1G3SA 1FP1D 2EA2A 4AIJA 2KIMA 4BYYA 1LDJA 3P9IA 2IA1A 1MJBA 4HYEA 2Y48A 5DD4A 3JTGA 3HTSB 1XMKA 2V1DA 3WGHA 2BEOA 4R8HA 3V8JA 4NQWA 1XDSA 5A2QZ 4HBLA 4BXUA 2FMLA 2HGCA 2H09A 3WE3A 4LFUA 3GX4X 1PDNC 1IN7A 2XASA 3I53A 4UHTA 3Q9SA 1KU2A 4LD5A 2GZWA 1O7FA 4A6DA 1BI1A 2XGXA 5K5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5U A;  1LDD A;  3F8M A;  3EUH A;  1IN4 A;  2Y75 A;  3SXY A;  3K0L A;  1XCV A;  4HF2 A;  2G7H A;  1SD5 A;  4KN4 X;  2XRO A;  4UVA A;  3DXJ F;  3B02 A;  1H0M A;  1R5H A;  1XGS A;  2K7L A;  4ZYE A;  2LKP A;  5ICE A;  3JW4 A;  3O2P E;  3T1B A;  2HS5 A;  1BIB A;  2EFN A;  1J9I A;  3CTA A;  3VB2 A;  5D5V B;  3BRO A;  1LVA A;  2H94 A;  1ULY A;  4CDG A;  3ULQ B;  2L4M A;  5IT3 A;  1IAW A;  4EM2 A;  2PI0 A;  5E1Z B;  3RKW A;  1Z9C A;  3REO A;  3L00 A;  4M73 A;  2W25 A;  2KJB A;  2PFB A;  2K4J A;  2QQA A;  2NYX A;  1U6G A;  4BNC A;  1ZHF A;  5ERI A;  3P9C A;  5D6F A;  3KEO A;  4ESJ A;  2EWN A;  2K02 A;  5HLH A;  1IUY A;  4GCV A;  1KQ9 A;  2BGC A;  1TNT A;  4L9T A;  4D0P A;  5DDG A;  2LSO A;  4RGU A;  3J80 K;  1ZGJ A;  2NNN A;  1PP8 F;  2QWW A;  3QP5 A;  2DK5 A;  2Z9O A;  1FBS A;  3BY6 A;  3DEU A;  2MLK A;  4LK0 F;  1FOK A;  1ZYR F;  3V7S A;  1MDM A;  3QU3 A;  4MEY F;  2F5F A;  1P92 A;  4IXA A;  3F72 A;  4HLX A;  2HKX A;  3T8T A;  4OIP F;  1D8J A;  1F4K A;  4PCQ A;  1O3Q A;  3D5L A;  3FM3 A;  2JPB A;  3P9K A;  3TO7 A;  1WKM A;  3E3V A;  2DT5 A;  4BH9 A;  3V7C A;  3J80 Z;  1XB4 A;  4UVC A;  1BM9 A;  1DPR A;  3LST A;  5DD8 A;  2IT0 A;  2A68 F;  5KK1 A;  4AIK A;  3WU0 A;  1YG2 A;  2V1U A;  1V3F A;  2Q8K A;  2YX4 A;  4M9Z A;  3HSR A;  5D6E A;  1HW2 A;  5HDN A;  1K7A A;  3SFZ A;  1XGM A;  1B9N A;  2IA2 A;  1YS7 A;  4HQE A;  1WSU A;  1XGN A;  3IRQ A;  2A69 F;  1IF1 A;  4OMZ A;  3I0T A;  3N4M A;  5D5U B;  2DK8 A;  3KP2 A;  1FT9 A;  2V1X A;  2EFQ A;  4OU0 A;  2D1H A;  4ENM A;  3I5U A;  2MH2 A;  1UB9 A;  1DDN A;  2O03 A;  3E5U A;  5DCF A;  4UNO A;  3E5Q A;  2ZNY A;  1JHF A;  2GXG A;  5BQT A;  2FNA A;  3BJA A;  3ZP5 A;  4RB3 C;  3BP8 A;  5KVR A;  3DPT A;  3OOP A;  2O3F A;  3O6B B;  3COA C;  1C0W A;  4L5J A;  1SAX A;  1OYY A;  1XGO A;  1LNW A;  1W5S A;  3K9T A;  3J81 Z;  2CW0 F;  2ZCW A;  1LJ9 A;  2AXL A;  2E1C A;  1R7J A;  4MNU A;  3RYR A;  4HLY A;  1T2K A;  2L54 A;  2ZFW A;  2QVO A;  3ZMD A;  1I1G A;  2WTE A;  4A5N A;  2F2E A;  3R0A A;  2Q2E A;  4WXH A;  3HRM A;  2IJL A;  4MTD A;  1FPQ A;  3I4P A;  3BJ6 A;  5CVI A;  2KIF A;  2O8X A;  1HKS A;  4LK1 F;  3HHG A;  2A07 F;  4CHU A;  2ESN A;  3C3W A;  2QEN A;  1A04 A;  4CIC A;  2R7F A;  3KLN A;  4EJO A;  3SZT A;  5LGN A;  1ZG1 A;  4G6D A;  2L4A A;  2GQQ A;  3B73 A;  4OIO F;  1KYZ A;  2KJC A;  5BPI A;  3EDP A;  1GXP A;  4ON0 A;  1Y0U A;  3HYI A;  2YX7 A;  3KZZ A;  3KE2 A;  1Z6T A;  5LHI A;  3GZ6 A;  2R7D A;  1Z1D A;  2VT3 A;  1FBQ A;  4A12 A;  3GO5 A;  2HKO A;  3RTR A;  3RPU A;  3F8B A;  5E18 F;  1CF7 B;  1QPM A;  1Z91 A;  1FY7 A;  2FA5 A;  3V7R A;  2JT1 A;  2XKO A;  4KNY A;  2CFX A;  1SMT A;  2XV4 S;  3GVA A;  4HF0 A;  2MBF A;  5ICG A;  1IN5 A;  2P7V B;  3QAH A;  3R60 A;  1P4W A;  4IJA A;  4G94 A;  1MJA A;  1R36 A;  3I64 A;  5JI6 A;  3VEP A;  2P5K A;  1GVJ A;  4S04 A;  2DI3 A;  4YFN F;  2CGP A;  2EV6 A;  2E7W A;  3F22 A;  2GXB A;  2EB7 A;  5ILV A;  4RGR A;  2DU9 A;  1E17 A;  4R1H A;  3QPH A;  4F7Z A;  2STW A;  3G3Z A;  5FD6 A;  1WI9 A;  4I02 A;  4AIH A;  2IP2 A;  4A5M A;  1WRJ A;  3L09 A;  1HXD A;  2IVM A;  5FFZ A;  4QWQ A;  1O7L A;  3K1N A;  1U8R A;  4BHB A;  4I0A A;  3MZY A;  4GYG A;  3RDI A;  2D1V A;  1IN8 A;  2M87 A;  2QQB A;  1I6X A;  4YG2 F;  2HTS A;  5ICC A;  1MDM B;  1LEB A;  2RNJ A;  5EEH A;  2VC1 A;  3LA2 A;  4JBA A;  5JVT A;  3WTX C;  4WCG A;  5TRD A;  2K86 A;  2VN2 A;  4P55 A;  5H6R A;  4OIQ F;  3HUG A;  2K4B A;  3QRF F;  2JPC A;  5JFR A;  5CVU A;  2TDX A;  1G3T A;  1YIO A;  1EV7 A;  1I27 A;  1KGS A;  5LGT A;  1O57 A;  1HKT A;  2ZME A;  2IRF G;  2FEZ A;  1U2W A;  4RB1 A;  3CDH A;  2DO7 A;  4MHG A;  5LGU A;  3FZV A;  3CO6 C;  4XSX F;  1MGT A;  1J59 A;  2QYO A;  4ENJ A;  3TKY A;  4MTE A;  4HDU A;  2EJR A;  1QZZ A;  5AIP A;  3J7A O;  1S29 A;  2A61 A;  5F64 A;  1LB2 A;  2EFO A;  4WF2 A;  2OQG A;  4IF4 A;  2ZJ2 A;  4GO1 A;  5K5R A;  4DQ2 A;  3IWF A;  1SFX A;  4ENN A;  4RGX A;  1XSD A;  5E1X A;  1Z05 A;  3I59 A;  2LNB A;  3VFZ A;  1R22 A;  3SZP A;  4GXO A;  4K2E A;  1ZN2 A;  2VOO A;  4M9S A;  2FSW A;  2HEO A;  4FHT A;  1IXS B;  1T6S A;  2YPR A;  3C1D A;  3KZY A;  5EEG A;  1FSH A;  1MZB A;  1BIA A;  4KT5 C;  5HOO A;  3LAJ A;  4FX0 A;  1S8N A;  1R1T A;  3HSF A;  4EMS A;  5HS8 A;  4OMY A;  5BPD A;  3HRS A;  3GXO A;  3NRV A;  4ZH4 F;  2EFP A;  2RN7 A;  4KIG A;  3L2C A;  1F1Z A;  1AWC A;  3DFG A;  2VOD A;  3MCZ A;  3CLO A;  4CYD A;  1T98 A;  4IHT A;  4I01 A;  1KU9 A;  1FNN A;  4CGZ A;  4XLP F;  2FMY A;  3HRT A;  5LRR A;  2FF4 A;  3RYP A;  1STZ A;  4L9J A;  4M6Y A;  2M30 A;  4L5I A;  4FX4 A;  2FBI A;  5CLS A;  4L0Y B;  5DCM A;  1RUO A;  5BMZ A;  5FB2 A;  1TQP A;  3BWG A;  5FFX A;  1KU3 A;  2G7U A;  1F5T A;  3FMS A;  2PLY A;  1OR7 A;  1ZAO A;  4ETS A;  4U7B A;  4G7H F;  2VXZ A;  4M71 A;  1TW3 A;  3CUQ C;  3T0Y A;  3ROU A;  1BI0 A;  2NS0 A;  3VOD A;  3RIR A;  2XAQ A;  2LF8 A;  1JHH A;  3TDZ C;  4AVP A;  1J75 A;  4ENK A;  3AAF A;  2VBZ A;  3HRU A;  4XLN F;  1FLI A;  1SD7 A;  3TQN A;  2ELH A;  1ZLJ A;  3LQQ A;  1RI7 A;  2V6C A;  1CGP A;  4EVI A;  1TLH B;  5HS7 A;  2QUF A;  2RC4 A;  4RB2 C;  3GFL A;  1RUN A;  1ZG5 A;  1ZLK A;  3ZMS A;  1P4X A;  4FT8 A;  4HV5 A;  2M8E A;  5H6Q A;  5TJJ A;  5DCM B;  1IXC A;  3KET A;  1X3U A;  4PGH A;  1KU7 A;  3IRR A;  3HTU A;  2OAZ A;  5L3G A;  5DEQ A;  1FYL A;  4OIN F;  3TOB A;  5LEJ A;  1XSV A;  1K78 B;  1FX7 A;  1U5T C;  2HTJ A;  3E97 A;  3JAM Z;  3MEX A;  2LDU A;  3FF5 A;  3O3K A;  2H6C A;  4N9I A;  3H92 A;  4P9U A;  3N97 A;  2DPU A;  1KYW A;  4I0B A;  2P6S A;  4DNC A;  4KIC A;  2P6T A;  5LHG A;  3R6S A;  4KN7 X;  5E8I A;  4CXF A;  4IRG A;  1U5T A;  2FOK A;  1WQ2 A;  1R58 A;  2HR3 A;  3G73 A;  2PN6 A;  3TO9 A;  4KMF A;  1XN7 A;  2NAZ A;  3WTS C;  5D8L B;  3GZ5 A;  5D5W B;  4P9F A;  3IL2 A;  3FXR A;  5JHU A;  2DW4 A;  4TV7 A;  2VOP A;  1S7A A;  1S6L A;  2W84 A;  1ONV A;  3BZ6 A;  1B1B A;  5J8C A;  4HW0 A;  4MQV A;  1W5T A;  3MZH A;  4KMU X;  1HKQ A;  1JXS A;  4A0Z A;  1I1S A;  3E6M A;  3HOT A;  3EQL F;  3KEQ A;  2QBY A;  3EYY A;  5K5O A;  3FX3 A;  2ESH A;  1ON2 A;  2PJP A;  5JR3 A;  2VE8 A;  3SHF A;  1OYW A;  2FQ3 A;  3RKX A;  5L3F A;  1GHC A;  2DLL A;  4Z2Y A;  3T5X A;  4EGZ A;  2C6Y A;  2EFW A;  5E1W A;  1DPU A;  4PZJ A;  4EJV A;  2P5V A;  1W7P A;  3ZMT A;  4EM0 B;  3WU1 B;  2K27 A;  2P7C B;  2RV8 A;  4HX7 A;  4HZF A;  3IKT A;  1JE8 A;  4G9Y A;  2A6E F;  5HLG A;  2V9V A;  4Y15 A;  2OD5 A;  4G8X A;  4YFX F;  2VC0 A;  3K69 A;  5HLI A;  1B9M A;  1TBX A;  2XUB A;  3HSE A;  5CVJ A;  5F6F A;  2WWY A;  1BI3 A;  2YU3 A;  2Y0M A;  3DP7 A;  3FWE A;  3ABU A;  1XDU A;  5DUK A;  1TNS A;  3R0J A;  3M1E A;  1OPC A;  3LQR A;  2DAO A;  5E20 A;  3ZQ7 A;  2OBP A;  3KP5 A;  5LEK A;  4RAY A;  4ZZL A;  4KFC A;  1R00 A;  2QLZ A;  4ZZD A;  3ZPL A;  2VE9 A;  2KRF A;  1B6A A;  3C18 A;  1HW5 A;  2Z3Y A;  2O61 A;  2BYV E;  2OA4 A;  3TO6 A;  1FYM A;  2UXN A;  3VOE A;  1D8K A;  2XVC A;  3U1D A;  1IXR C;  3E6C C;  5FLX Z;  1LQ1 A;  3JTH A;  5E17 F;  2FBH A;  1J2X A;  4M6X A;  3L9F A;  3I58 A;  4G6Q A;  3RKY A;  1NHA A;  4WK8 F;  4N9H A;  2YSR A;  4QLC U;  2UZK A;  2EA4 A;  2RQP A;  3DV8 A;  4M74 A;  2HFH A;  2GIV A;  3CUQ B;  2L01 A;  3WGG A;  2XAG A;  4EGY A;  1T39 A;  1U5T B;  5FLX K;  3ISP A;  2DFI A;  1T38 A;  3ZN1 A;  2FE3 A;  5HVQ C;  2RVC A;  3LFK A;  1HW1 A;  1ZRE A;  4LB5 A;  2A3S A;  2XHK A;  1PP7 U;  3T8R A;  2HDC A;  3FMQ A;  5L3D A;  5L3C A;  4BAY A;  4A0Y A;  1SFE A;  1W7P B;  1BC8 C;  3KFW X;  2PQ8 A;  2HWV A;  3WTU C;  1F9N A;  1T0F A;  2MH9 A;  2P5L C;  1UHW A;  2VBX A;  1CF7 A;  2FXA A;  2DQR A;  3J81 K;  3BPV A;  3F6O A;  5CVR A;  4XBF A;  2EV5 A;  3K2Z A;  3S2W A;  2CO5 A;  4ZYD A;  5HS9 A;  2W85 A;  3F8C A;  1UHM A;  3KP7 A;  1LDK B;  4JK1 X;  2R3S A;  4WWC A;  1FP2 A;  2CSO A;  1Q1H A;  5D8K B;  1K79 A;  3Q9V A;  2COM A;  4G7O F;  5ILU A;  1QNT A;  3HHH A;  1FWZ A;  4RS8 A;  2WC2 A;  4HX4 A;  1YW7 A;  5HDG A;  3IHU A;  2YR2 A;  3F6V A;  2F5E A;  3LA7 A;  2O0Y A;  2ETH A;  4HX8 A;  1FZP B;  1J5Y A;  3FHZ A;  3R61 A;  4LG0 A;  5LLQ A;  2ZNZ A;  1MJ9 A;  2H6B A;  2XAH A;  1BJA A;  2J5O A;  2DQL A;  5L3B A;  2HQN A;  2EV0 A;  4UVB A;  5LRS A;  1YO5 C;  2ZO4 A;  3QU6 A;  3DPL C;  2JSC A;  4HAM A;  3U2R A;  1Z6R A;  4HOB A;  2M45 A;  3GEZ A;  1B4A A;  3BOQ A;  3FMR A;  4LLG F;  1AOY A;  4Q5S F;  3ZN0 A;  3PQJ A;  1ZRD A;  2DPD A;  4I98 B;  2JRT A;  4RAZ A;  3MAJ A;  2L02 A;  3ELK A;  1P2F A;  2QBY B;  4MEX F;  3GFI A;  3V8L A;  2PG4 A;  3PFI A;  4R79 A;  1XD7 A;  3NEU A;  4EM1 A;  5IT9 Z;  3IC7 A;  1P4A A;  3IKV A;  5D5X B;  3K1M A;  4O3M A;  1ZH5 A;  3L7W A;  2FU4 A;  3KCC A;  3OV8 A;  1ZRC A;  1YW8 A;  2W24 A;  1YS6 A;  4CZZ A;  2O6G E;  2V79 A;  1R23 A;  2ACJ A;  2BE5 F;  3BDD A;  2OZ6 A;  1BI2 A;  3C7J A;  4BQA A;  4RB0 A;  1I5Z A;  4KIF A;  4U0Y A;  3WG9 A;  1SD6 A;  5L3E A;  2GA2 A;  1R1V A;  3ECH A;  1P6R A;  3GUD A;  3DF8 A;  2BBY A;  1Z7U A;  2Z33 A;  1MD0 A;  3QOP A;  4A0X A;  3K1P A;  3GFJ A;  3GW2 A;  1VTN C;  3GLX A;  5E8G A;  2ISZ A;  1RNL A;  3F23 A;  4PGG A;  3LA3 A;  1K78 A;  3NQO A;  3F8F A;  1FSE A;  2LF7 A;  4WX9 A;  4LJZ F;  2GA1 A;  3IWZ A;  1QBJ A;  1TW2 A;  3PQK A;  4IHS A;  1XSX A;  4LB6 B;  1SD4 A;  1L3L A;  4NB5 A;  2QZ8 A;  2BV6 A;  2M5W A;  2DBB A;  3RPQ A;  2D2W A;  1OMI A;  3V8K A;  5ED4 A;  2E7X A;  3M8E A;  4KUM A;  2OU2 A;  4GYI A;  1USS A;  2Q0O A;  5DV5 A;  1BC7 C;  4I7H A;  2RDP A;  3LWF A;  1K6O A;  2NNY A;  4O6J A;  4L9N A;  3I71 A;  2MD5 A;  4KA4 A;  4H0E A;  1S7O A;  2H27 A;  1U3E M;  1HST A;  4IRH A;  3ML6 A;  3GFM A;  4N0B A;  6PAX A;  2PEX A;  1WWX A;  2X4H A;  2M1B A;  4B8X A;  1XCB A;  5F1R A;  4WXC A;  3TGN A;  1ON1 A;  2FRH A;  3MFK A;  4A6E A;  3ERE D;  4GGG A;  1J0R A;  2QM3 A;  3FXU A;  2MLG A;  1G4D A;  2QQ9 A;  1R1U A;  3WOD F;  5J6X A;  4L18 B;  3BPX A;  3TOA A;  5FD5 A;  1QQI A;  1H9G A;  5D4S A;  3EYI A;  5HDK A;  2ZME B;  1YYV A;  2HOE A;  4EJT A;  2JTV A;  5BS6 A;  4ZYG A;  3M7G A;  3H3Z A;  4OIR F;  1QGP A;  2XAF A;  2HYG D;  2GWR A;  3W6K B;  5BOX A;  4KYW A;  1IW7 F;  2HQR A;  4ESB A;  4I2O A;  1BN5 A;  2EK5 A;  2P4W A;  3ZMV A;  1KQ8 A;  3WTY C;  1EH6 A;  4E70 A;  3JSO A;  4KIB A;  2VBW A;  4HQM A;  1MKM A;  3I59 B;  2HZT A;  3Q5F A;  2XKP A;  2HYF A;  3LAP A;  4WXD A;  2IPQ X;  1BBY A;  2FBK A;  3H3U A;  3F3X A;  2B0L A;  1IZ1 A;  3MWM A;  1R5G A;  4KDP A;  3KP6 A;  4UV9 A;  2NRA C;  4IVN A;  3ECO A;  3QPT A;  2XIG A;  1H9T A;  3F8N A;  4L9V A;  2XRN A;  4U0W A;  1O3R A;  2ZXJ A;  5LHH A;  3P7N A;  3HOS A;  3DQV C;  4M9X A;  1ZG3 A;  1U78 A;  2L3D A;  4UXN A;  2AS5 F;  1O3T A;  1V4R A;  4ASN A;  2CQK A;  4XSZ F;  2GAU A;  5LBQ A;  1YW9 A;  3W6J B;  3M9A A;  4CO8 A;  4U0V A;  4LGW A;  1S3J A;  1XMA A;  3WTV C;  1YTY A;  3KLO A;  4ESF A;  3U9G A;  5DYM A;  2OZU A;  4P96 A;  1G6N A;  3E6B A;  3KP3 A;  1DP7 P;  3F21 A;  1UCR A;  4LG0 B;  5FO5 A;  3E5X A;  4MGR A;  3CUO A;  3CJN A;  3FM5 A;  5CJ9 A;  2W57 A;  2ZBK A;  3E6D A;  4XRF A;  1RZ4 A;  2CG4 A;  1BOA A;  1HQC A;  2XAJ A;  2FNP A;  3WGI A;  4Y13 A;  1YQA A;  3RI4 A;  1EH7 A;  1GXQ A;  2JZY A;  4UV8 A;  1JGS A;  3ABT A;  4PDK A;  1D3Y A;  4G7Z F;  4YII A;  1YLF A;  1FBU A;  2CWE A;  4U7D A;  3D0S A;  1FYK A;  2UWM A;  3WTW C;  2MC3 A;  5ICF A;  1SFU A;  3QP6 A;  3RJP A;  1HSJ A;  4IRI A;  5K1Y A;  2OQR A;  4L0Z B;  1OKR A;  4YIF A;  2STT A;  4I09 A;  4S05 A;  4AWX B;  2ZKZ A;  3M8F A;  4BHC A;  1SMY F;  1TQM A;  1ZAR A;  2E1N A;  1O3S A;  1J7K A;  3SQN A;  4A2U A;  2RKH A;  2KIU A;  4Q4Z F;  2WV0 A;  2A5Y B;  2DTR A;  1G3W A;  3ZMZ A;  1W4M A;  2MA3 A;  5FGM A;  5CVV A;  2UXX A;  5J8F A;  2A6H F;  3EET A;  2P8T A;  2KKO A;  3GF2 A;  1LEA A;  4MQ9 F;  4OOI A;  1YFH A;  1QZY A;  1W7P D;  3R4K A;  3KP4 A;  2VON A;  4O5V A;  5IT9 K;  4M72 A;  1OYI A;  3GYH X;  1EH8 A;  3MQ0 A;  4Q47 A;  4EJW A;  3CO7 C;  1REP C;  3CUQ A;  1UFM A;  4JQF A;  2D45 A;  3WE2 A;  4HF1 A;  3WTT C;  2VT2 A;  1ODD A;  1L0O C;  4P5O A;  3HIF A;  5H20 A;  4NHJ A;  5DUI A;  1RIO H;  1D5V A;  4RGS A;  4UUV A;  1TQI A;  4HA8 A;  1IN6 A;  2ISY A;  2CYY A;  2F5C A;  3GWZ A;  2VBY A;  4Q48 A;  4B09 A;  2PMU A;  2J5P A;  4EJU A;  3I54 A;  5AON A;  4EV0 A;  3V4G A;  2X0L A;  3JSP A;  4HDV A;  1E2X A;  4IPA A;  2IA0 A;  1HBX G;  4LMY A;  4EQQ A;  3BJO A;  3TDU C;  1ZRF A;  4LLL A;  1G3Y A;  1IRG A;  1B59 A;  1UST A;  4ZYH A;  4LLN A;  2PMH A;  1IRF A;  1KA8 A;  5CYV A;  1ZGA A;  1FC3 A;  2G9W A;  2Z99 A;  4HV6 A;  1TTY A;  3FXQ A;  3WTZ A;  2IW5 A;  4AD9 A;  5A2Q K;  1QO0 D;  2PBI A;  5AIQ A;  2RGV A;  4BHP A;  1DUX C;  4U88 A;  2F5D A;  3ZMU A;  5D4R A;  3DKW A;  5ILS A;  4YFK F;  3JAM K;  1PUE E;  1KQ0 A;  4Y17 A;  2ADU A;  1G3S A;  1FP1 D;  2EA2 A;  4AIJ A;  2KIM A;  4BYY A;  1LDJ A;  3P9I A;  2IA1 A;  1MJB A;  4HYE A;  2Y48 A;  5DD4 A;  3JTG A;  3HTS B;  1XMK A;  2V1D A;  3WGH A;  2BEO A;  4R8H A;  3V8J A;  4NQW A;  1XDS A;  5A2Q Z;  4HBL A;  4BXU A;  2FML A;  2HGC A;  2H09 A;  3WE3 A;  4LFU A;  3GX4 X;  1PDN C;  1IN7 A;  2XAS A;  3I53 A;  4UHT A;  3Q9S A;  1KU2 A;  4LD5 A;  2GZW A;  1O7F A;  4A6D A;  1BI1 A;  2XGX A;  5K5Q A; 
#chains in the Genus database with same CATH topology
 1MMG A;  2Z5U A;  4I76 A;  1LDD A;  1XX5 A;  3F8M A;  3K4L A;  3EUH A;  1EJ9 A;  1HDD C;  1IN4 A;  3D1N I;  2Y75 A;  2O9L A;  3SXY A;  3K0L A;  1XCV A;  4HF2 A;  2G7H A;  5FKL A;  1SD5 A;  3DU6 A;  2DMP A;  4KN4 X;  2XRO A;  2R7U A;  4UVA A;  4HST A;  3DXJ F;  4GDF A;  3B02 A;  5HOD A;  1H0M A;  1R5H A;  1XGS A;  1JT0 A;  2K7L A;  4ZYE A;  2LKP A;  3OYF A;  5ICE A;  3JW4 A;  2IGM A;  1P7J A;  3S1Q J;  1SVO A;  3O2P E;  3T1B A;  5M5W J;  2HS5 A;  5TGT A;  2EQR A;  1QHH D;  1BIB A;  2EFN A;  2DYR H;  4Y4R A;  4PJM A;  1J9I A;  1ZGW A;  3BZK A;  3CTA A;  3VB2 A;  3VYR B;  5D5V B;  2CFO A;  3BRO A;  1LVA A;  2JUC A;  2H94 A;  1ULY A;  2JVG A;  4CDG A;  3ULQ B;  4AUX A;  3OYC A;  2L4M A;  5IT3 A;  1IAW A;  4YIR X;  4EM2 A;  2PI0 A;  5E1Z B;  2G0E A;  4RLF A;  3RKW A;  1T0F C;  1AHD P;  1Z9C A;  3K70 D;  3REO A;  3SYT A;  2MD0 A;  1HOM A;  3L00 A;  4M73 A;  3CCJ I;  2W25 A;  2KJB A;  4DBQ A;  4D7N A;  3BZC A;  2PFB A;  4BJ5 C;  3TED A;  1LPQ A;  1VQN I;  2K4J A;  1IDY A;  1ZR2 A;  4DGW B;  2F4I A;  4V2G A;  2QQA A;  2V1N A;  2NYX A;  1ITY A;  1Y0N A;  1U6G A;  4BNC A;  1ZHF A;  5ERI A;  3P9C A;  5D6F A;  3CMY A;  2ME6 A;  2MC4 A;  1PVE A;  2E35 A;  3KEO A;  4ESJ A;  2EWN A;  2PJR B;  4NNJ A;  2K02 A;  2LLK A;  1GV5 A;  1MBE A;  4MIM A;  5HLH A;  1IUY A;  4GCV A;  1KQ9 A;  3W2V A;  2BGC A;  1TNT A;  4L9T A;  4D0P A;  5DDG A;  1RES A;  1WPK A;  2LSO A;  4RGU A;  3J80 K;  1ZGJ A;  2NNN A;  1PP8 F;  2QWW A;  4NC8 A;  3QP5 A;  1R6R A;  2DK5 A;  2DMQ A;  5KHD A;  2Z9O A;  1FBS A;  4FE4 A;  2NVQ J;  3OL3 A;  1GLN A;  3S14 J;  3M3Y J;  3CJR B;  3BY6 A;  4P1W A;  3DEU A;  2MLK A;  1YIJ I;  2E5Z A;  2H8W A;  4LK0 F;  1FOK A;  1ZYR F;  3V7S A;  2VJJ A;  1MDM A;  3QU3 A;  2M2E A;  4MEY F;  1N75 A;  1KON A;  2F5F A;  2GOM A;  1P92 A;  5C44 J;  4IXA A;  1OR7 C;  4NC7 A;  3FIS A;  3GTG J;  3F72 A;  4HLX A;  2HKX A;  3T8T A;  4OIP F;  4ZTJ A;  1D8J A;  1F4K A;  2H1L A;  4PCQ A;  3G1O A;  1O3Q A;  2XAU A;  3GME A;  2BOL A;  3D5L A;  3FM3 A;  5GAE J;  2JPB A;  2LBF B;  4A3L J;  3P9K A;  2CV1 A;  3TO7 A;  5FKK A;  1WKM A;  3E3V A;  2DT5 A;  4BH9 A;  3V7C A;  4YEJ A;  3J80 Z;  1XB4 A;  4UVC A;  1MH3 A;  4BJ6 C;  2ZJQ F;  2CU7 A;  3TBI A;  4E6K G;  1BM9 A;  1DPR A;  3LST A;  5DD8 A;  1YJ9 I;  3F9K A;  2IT0 A;  2A68 F;  2VQG A;  5KK1 A;  4AIK A;  4XK4 A;  1QVU A;  3WU0 A;  1YG2 A;  2V1U A;  1V3F A;  2Q8K A;  2YX4 A;  1KZH A;  2E2H J;  4M9Z A;  3HSR A;  5D6E A;  2KMU A;  5EYR A;  1HW2 A;  2HQ5 A;  5HDN A;  5GTH C;  1K7A A;  3SFZ A;  1XGM A;  2A5W A;  3TMO A;  2VL8 A;  4IOC F;  1B9N A;  1FOY A;  2IA2 A;  5KAF C;  1MMS A;  2EZL A;  3HPH A;  2LKX A;  1YS7 A;  4HQE A;  2ZB9 A;  1WSU A;  1XGN A;  1PUF B;  3IRQ A;  1LFB A;  4B48 A;  2ELJ A;  2A69 F;  1UG2 A;  1IF1 A;  4OMZ A;  3V42 A;  3I0T A;  3ESW B;  4BGD A;  3QOD A;  1VND A;  5D5U B;  3N4M A;  1Z77 A;  2DK8 A;  3A02 A;  2KIS A;  3BC8 A;  1U0J A;  3S32 A;  4A3M J;  3KP2 A;  1FT9 A;  2V1X A;  2WV1 A;  3BR6 A;  2JWT A;  4OWR B;  2EFQ A;  4OU0 A;  2D1H A;  4XNF A;  5B3S H;  2JQ7 A;  4ENM A;  1YRN A;  3I5U A;  2MH2 A;  1UB9 A;  3H0D A;  4BDZ A;  2R5Z A;  1DDN A;  3BR1 A;  2O03 A;  3E5U A;  2ZJP F;  5DCF A;  5IYD J;  2V9K A;  5F1J A;  4UNO A;  3MKL A;  3E5Q A;  2VKD A;  2ZNY A;  2WAQ N;  1JHF A;  2GXG A;  5BQT A;  2FNA A;  3BJA A;  2DOD A;  3ZP5 A;  3O8G A;  4RB3 C;  3BP8 A;  3DBR B;  2BY2 A;  2W82 A;  5KVR A;  2NS7 A;  1FOW A;  1EF4 A;  1D0Y A;  2ECC A;  3DPT A;  3OOP A;  2O3F A;  3O6B B;  3COA C;  1C0W A;  1IRX A;  2BZT A;  1Y1V J;  4L5J A;  3CCM I;  1SAX A;  1YOV B;  1OYY A;  1XGO A;  1LNW A;  2LKS A;  2FJ1 A;  4D5C A;  1W5S A;  3K9T A;  3J81 Z;  3PNV A;  1R9T J;  1D1A A;  2CW0 F;  3DLA A;  3LFU A;  2ZCW A;  2E36 A;  5FRM A;  1Y6I A;  2HOA A;  1S9H A;  1UZC A;  1H88 C;  2PJR A;  2RQQ A;  1LJ9 A;  3VYS B;  3ZXS A;  2AXL A;  2KQR A;  2E1C A;  3FKI J;  1R7J A;  4EAT A;  2HDD A;  4MNU A;  2MG4 A;  3RYR A;  4HLY A;  1T2K A;  2L7F P;  2X6X A;  4IEJ A;  2L54 A;  4M3G A;  4IX7 A;  2ZFW A;  1MSE C;  1V54 H;  4IL6 C;  2QVO A;  3BG7 A;  3DLL F;  3Q3S A;  4GRI A;  1I1G A;  3ZMD A;  2WTE A;  1BJZ A;  4A5N A;  2TRT A;  1WJB A;  2F2E A;  3R0A A;  4KIS A;  2Q2E A;  4WXH A;  3OOU A;  3A4C A;  4C3I J;  3HRM A;  3A03 A;  3M07 A;  2IJL A;  4MTD A;  2HDW A;  1FPQ A;  1Y56 A;  3I4P A;  3OYI A;  3BJ6 A;  5CVI A;  5EGO B;  3ASN H;  3NAR A;  2KIF A;  2O8X A;  1HKS A;  4LK1 F;  3CP2 A;  3HHG A;  2X6W A;  4IKF A;  1Z0X A;  2A07 F;  4CHU A;  2ESN A;  3C3W A;  2QEN A;  4Y7N J;  1A04 A;  1ZQ3 P;  4CIC A;  3VYU B;  4UB8 C;  2Q1Z B;  2P81 A;  5JLX A;  1VQL I;  2R7F A;  2Y9Z A;  3KLN A;  3HPG A;  2JUG A;  5J4Y A;  4EJO A;  3SZT A;  5LGN A;  2NVY J;  2QSF X;  3KZI C;  5B5E C;  2E1M B;  1ZG1 A;  3JRI A;  4G6D A;  2L4A A;  5E3O A;  3WHC A;  3J7A Y;  2M0M A;  2NVT J;  2DXI A;  3G2B A;  1LKX A;  2GQQ A;  3B73 A;  3OSF A;  3HC7 A;  1SAU A;  2IGO A;  4OIO F;  1BA5 A;  2AO9 A;  3AL0 B;  2VPR A;  4MLO A;  1NK2 P;  1KYZ A;  2KJC A;  5BPI A;  4IOA F;  3TP0 A;  3I4N J;  1ETX A;  3IUO A;  3EDP A;  3ZQQ A;  1GXP A;  1YE9 A;  2DMT A;  4ON0 A;  3RSN A;  1Y0U A;  3HYI A;  2YX7 A;  3H9J A;  1K4S A;  3KZZ A;  3KE2 A;  5C4J J;  4RM3 A;  2HNH A;  1Z6T A;  2QQ8 A;  4XRS A;  5LHI A;  5HNF A;  3GZ6 A;  4BAC A;  2R7D A;  4XOT A;  1T08 B;  1Z1D A;  2VT3 A;  3X2Q H;  1G59 A;  1FBQ A;  4A12 A;  3GO5 A;  4DZP A;  2VLA A;  2KHM A;  2K3F A;  2HKO A;  3RTR A;  5E79 C;  3RPU A;  3CP8 A;  3E7L A;  3F8B A;  4NUB A;  1E3P A;  1I39 A;  4RAF A;  5E18 F;  1CF7 B;  1QPM A;  1AKH A;  1Z91 A;  1FY7 A;  2FA5 A;  3V7R A;  2JT1 A;  2XKO A;  4KNY A;  2KLO A;  2CFX A;  1SMT A;  2PMZ N;  4YEL A;  2XV4 S;  3GVA A;  4HF0 A;  2MBF A;  2TCT A;  5IP9 J;  5ICG A;  1IN5 A;  2P7V B;  1J09 A;  1GVD A;  1MMD A;  3QAH A;  2WBM A;  5TIS C;  2DDB A;  5EG0 B;  3R60 A;  1P4W A;  1JUS A;  4IJA A;  4G94 A;  1MJA A;  1R36 A;  2YUS A;  3I64 A;  5JI6 A;  3VEP A;  4RAG A;  2P5K A;  4ZDP A;  1PUF A;  1MIJ A;  1GVJ A;  4S04 A;  3ZCO A;  2DI3 A;  4YFN F;  1WH7 A;  3BG9 A;  2CGP A;  2EV6 A;  1IRZ A;  2CH0 A;  2E7W A;  5K7H A;  3F22 A;  2GXB A;  2EB7 A;  5ILV A;  4RGR A;  3LNQ A;  2DU9 A;  4D9J A;  1E17 A;  1IDZ A;  2DA4 A;  4R1H A;  2QGU A;  3QPH A;  4F7Z A;  2STW A;  3GTO J;  3G3Z A;  5FD6 A;  1W5C C;  1WI9 A;  4I02 A;  4AIH A;  2IP2 A;  2ZXW H;  3S8P A;  3SEZ A;  4A5M A;  1WRJ A;  3L09 A;  3L2W A;  3AG4 H;  4E4H A;  1HXD A;  2IVM A;  5FFZ A;  4F52 A;  3IP4 B;  4QWQ A;  1O7L A;  3K1N A;  1U8R A;  4BHB A;  1RC9 A;  2LC2 A;  1I50 J;  4N4O B;  4I0A A;  3MZY A;  4GYG A;  3RDI A;  3C2B A;  1VZ0 A;  2D1V A;  2WB1 A;  4QIW N;  2AQE A;  1YX3 A;  4LIU A;  1IN8 A;  3G1L A;  2M87 A;  3HDD A;  2QQB A;  2JA2 A;  1I6X A;  1OCR H;  4YG2 F;  3CCE I;  2HTS A;  5ICC A;  3LSH A;  1MDM B;  5E3M A;  4BY1 J;  1A6Q A;  2VPL A;  2HI3 A;  1LEB A;  1JUP A;  4DBR A;  2RNJ A;  1JKQ C;  5EEH A;  2VC1 A;  2VIX A;  3LA2 A;  2BY3 A;  4JBA A;  5JVT A;  3WTX C;  4WCG A;  3CD6 I;  5TRD A;  2M7A A;  2K86 A;  4F91 B;  2VN2 A;  3A1Y A;  4P55 A;  1ETO A;  5H6R A;  4OIQ F;  3HUG A;  3RKQ A;  5DTD A;  3TL4 X;  3S3M A;  1FTT A;  2K4B A;  2ME0 A;  3CF5 F;  3QRF F;  2JPC A;  2IXS A;  3CCU I;  3ZR8 X;  5FRN A;  5JFR A;  3N05 A;  4XMY A;  1FIA A;  5CVU A;  1TT0 A;  4IHY A;  4JX4 A;  4PFP A;  2TDX A;  1G3T A;  1YIO A;  1EV7 A;  1LE8 B;  1I27 A;  2R7T A;  3HKZ N;  1KGS A;  5LGT A;  2I8D A;  1O57 A;  1HKT A;  2LOO A;  2ZME A;  2IRF G;  2FEZ A;  2JVH A;  1U2W A;  1DU0 A;  4XLE A;  4RB1 A;  3FHN A;  3CDH A;  3OY9 A;  2DO7 A;  2R7V A;  1S5L C;  4MHG A;  3K10 A;  5LGU A;  1SVM A;  3FZV A;  1U9O A;  2XF7 A;  4IZZ A;  3QQA A;  3CO6 C;  2VQL A;  3FK6 A;  3U1K A;  3M1C A;  1X1C A;  4XSX F;  1IV6 A;  1MGT A;  4PSW A;  1J59 A;  2QYO A;  3S93 A;  1OCT C;  2A6T A;  2E2J J;  1XC5 A;  4ENJ A;  1Z3Y A;  3AG2 H;  5J47 A;  5EEA A;  3TKY A;  4MTE A;  2HOT A;  4HDU A;  1YJW I;  1FMV A;  2L9N A;  3WU2 C;  2EJR A;  3D5R C;  3K4M A;  1QPI A;  1QZZ A;  5AIP A;  3J7A O;  1S29 A;  1PJR A;  2A61 A;  3LSR A;  5IOY A;  2K5C A;  5F04 A;  3O8H A;  5F64 A;  5J40 A;  1T33 A;  4C2U A;  4IHX A;  1WJD A;  1LB2 A;  2V26 A;  4IQJ A;  2EFO A;  4WF2 A;  2OQG A;  2K9M A;  4BXX J;  4IF4 A;  2ZJ2 A;  4GO1 A;  2F5V A;  3BR3 A;  2OCE A;  1EA3 A;  3H5R A;  5K5R A;  4DQ2 A;  2OCC H;  3IWF A;  2WY7 Q;  2DJI A;  1SFX A;  1B8I B;  3SEQ A;  1V55 H;  4ENN A;  5KAI C;  4RGX A;  2Y69 H;  3DTK A;  4J19 A;  3K4N A;  5E1X A;  1XSD A;  1TWA J;  3PIP F;  1Z05 A;  3I59 A;  2LNB A;  1AA7 A;  3VFZ A;  1R22 A;  2KRC A;  3SZP A;  3RZO J;  4GXO A;  4K2E A;  1ZN2 A;  2VOO A;  4M9S A;  2FSW A;  2HEO A;  4FHT A;  1HA8 A;  1IXS B;  4NQW B;  1T6S A;  2YPR A;  3C1D A;  3PFY A;  4C3J J;  5F0F A;  3KZY A;  5EEG A;  2DT6 A;  1FSH A;  1MZB A;  2FOW A;  3OWT A;  1BIA A;  4G6T B;  4KT5 C;  5HOO A;  3LAJ A;  2QKM B;  4FX0 A;  1S8N A;  1R1T A;  3HSF A;  4EMS A;  5HS8 A;  1V5G A;  3MKZ A;  3BTC A;  4OMY A;  1FIP A;  5BPD A;  3HRS A;  4E7K A;  1MSF C;  1LFU P;  3GXO A;  2WB1 N;  4A3B J;  4MO7 A;  3NRV A;  4ZH4 F;  5EDN A;  2EFP A;  5J1R A;  2RN7 A;  4KIG A;  3QPS A;  4CCO A;  3L2C A;  3HL2 A;  1F1Z A;  1AWC A;  4F55 A;  3DFG A;  2WA0 A;  3MCZ A;  3CLO A;  5FJ8 J;  4CYD A;  1T98 A;  4IHT A;  2VOD A;  1BW5 A;  4W97 A;  3OIQ A;  1K6Y A;  1KU9 A;  4I01 A;  1FNN A;  3CCL I;  4CGZ A;  1XTA A;  4XLP F;  1YHQ I;  2MW8 A;  3HG9 A;  4BQN A;  3OYK A;  2FMY A;  3HRT A;  1GV2 A;  2W48 A;  1YIT I;  5LRR A;  1Z21 A;  3VPR A;  2LTP A;  3L1P A;  2FF4 A;  3RYP A;  1STZ A;  4PSX A;  3ZGK A;  1ETY A;  2MFZ A;  4L9J A;  4M6Y A;  2M30 A;  1X4P A;  4L5I A;  4FX4 A;  2FBI A;  1Z67 A;  5CLS A;  3PM1 A;  4L0Y B;  5DCM A;  1RUO A;  5BMZ A;  2Y2Z A;  5FB2 A;  1UG0 A;  2HVR A;  1TQP A;  3BWG A;  4H4K C;  5FFX A;  1RR7 A;  4BEH A;  1KU3 A;  2KDO A;  3QYB A;  4UUS B;  2G7U A;  3CF2 A;  4BJT A;  1R4N B;  1F5T A;  3FMS A;  2M4K A;  2PLY A;  3PNY A;  1OR7 A;  4OAZ A;  3IV5 A;  1ZAO A;  2X85 A;  4ETS A;  1WGX A;  5C3E J;  4U7B A;  4G7H F;  2EZH A;  2VXZ A;  1HDP A;  3E0J B;  4M71 A;  1TW3 A;  3FDY A;  1Z3X A;  4XQF A;  3CUQ C;  1E0E A;  3T0Y A;  3S3N A;  2ZXH A;  3ROU A;  1BI0 A;  2NS0 A;  3VOD A;  1P9Q C;  2L0K A;  2HPM A;  3RIR A;  5EG0 A;  2XAQ A;  1K4T A;  2LF8 A;  1JHH A;  2Z16 A;  1Z7L A;  3MN2 A;  3P5J A;  3TDZ C;  4AVP A;  1J75 A;  1E3H A;  4ENK A;  5DM6 F;  3AAF A;  2VBZ A;  3HRU A;  4XLN F;  1FLI A;  1SD7 A;  4E7I A;  3TQN A;  2ELH A;  2E1M C;  2GXA A;  1ZLJ A;  4A3D J;  3LQQ A;  4M6V A;  1RI7 A;  1CQT A;  2V6C A;  3C2G A;  1CGP A;  4EVI A;  3JRH A;  1TLH B;  5HS7 A;  1TP4 A;  2QUF A;  2RC4 A;  3IAM 2;  1A5J A;  1YX5 A;  4RB2 C;  2LP0 A;  4AYB A;  2VKE A;  3PNT A;  3FKJ A;  3I9V 2;  1T95 A;  2EZI A;  4C2M J;  3GFL A;  3D5S C;  3LSJ A;  1RUN A;  4MFE A;  2XGE A;  1ZG5 A;  1QHG A;  3OYA A;  1ZLK A;  3LL7 A;  4C3H J;  1RRJ A;  2XSJ C;  1D1C A;  2K85 A;  3HOX J;  4V2F A;  1D5Y A;  3ZMS A;  1P4X A;  3CMM A;  4IQ4 A;  4FT8 A;  4HV5 A;  1JJ8 C;  4HRI A;  2M8E A;  2OJE D;  2XDV A;  4HEA 2;  3LSP A;  5H6Q A;  5TJJ A;  5DCM B;  1IXC A;  3KET A;  1X3U A;  4PGH A;  3SJM A;  1KU7 A;  3SDG A;  2CRG A;  2M34 A;  3IRR A;  3HTU A;  1WI3 A;  2OAZ A;  5L3G A;  3HB9 A;  5DEQ A;  1ZK8 A;  1FYL A;  2CV2 A;  1UJ8 A;  4OIN F;  3QOE A;  3DTI A;  3TOB A;  5LEJ A;  1XSV A;  1K78 B;  5M3M J;  2O8K A;  2GOX B;  1DGW Y;  3J7Z I;  1APL C;  1FX7 A;  4JP0 A;  2L7M P;  1U5T C;  3JRA A;  1LUJ B;  2HTJ A;  3E97 A;  3ZQL A;  3JAM Z;  3MEX A;  2LDU A;  3FF5 A;  3O3K A;  1VF9 A;  4AM3 A;  2H6C A;  5IPA A;  4DIQ A;  2KT0 A;  2NS8 A;  4N9I A;  3CMA I;  2KDZ A;  3H92 A;  4P9U A;  4BQO A;  3N97 A;  2DPU A;  2YS9 A;  3HOY J;  1TC3 C;  1KYW A;  5M5X J;  4I0B A;  2P6S A;  2CUJ A;  4DNC A;  4KIC A;  1T8I A;  2P6T A;  5LHG A;  3R6S A;  3M8J A;  4KN7 X;  5E8I A;  4CSW A;  3W2A A;  3AFH A;  4CXF A;  4IRG A;  1U5T A;  2FOK A;  1WQ2 A;  1R58 A;  2HR3 A;  3G73 A;  2PN6 A;  3TO9 A;  4HG2 A;  3H0G J;  4KMF A;  3K2A A;  1XN7 A;  2M9H A;  2NAZ A;  3WTS C;  2DOE A;  2RAE A;  1F36 A;  5D8L B;  3GZ5 A;  4PK4 A;  1WJA A;  2BXZ A;  5D5W B;  1D0Z A;  4P9F A;  3IL2 A;  4BE1 A;  3OYD A;  3FXR A;  5K7F A;  3H1C A;  4CCK A;  1TWH J;  4N4N B;  2IBD A;  5JHU A;  4ABZ A;  2X51 A;  5GTI C;  3PUB A;  3VDX A;  2E34 A;  2DW4 A;  3Q0W A;  2MSY A;  2R4G A;  4TV7 A;  4A3I J;  2VOP A;  1S7A A;  1S6L A;  2W84 A;  1ONV A;  3BZ6 A;  1H8A C;  1B1B A;  2CW8 A;  2DDA A;  5J8C A;  1B72 A;  4HW0 A;  4MQV A;  1W5T A;  4HNV A;  4M3F A;  3MZH A;  3Q0U A;  2K9L A;  4KMU X;  1HKQ A;  1JXS A;  4A0Z A;  2ELK A;  3E6M A;  1I1S A;  3ZQH A;  2RRE A;  2N8G A;  3HOT A;  3EQL F;  2EIN H;  3GLL A;  3KEQ A;  2DA1 A;  2OV7 A;  2VXD A;  3EYY A;  2QBY A;  3H3V K;  3OYH A;  1BR1 A;  5K5O A;  3FX3 A;  2ESH A;  1FEX A;  5DM7 F;  4NBQ A;  1ON2 A;  2PJP A;  2VAS A;  5JR3 A;  1GUU A;  2VE8 A;  3SHF A;  3UNG C;  3L2U A;  1OYW A;  2FQ3 A;  3RKX A;  1UAA A;  5L3F A;  1GHC A;  3EUH C;  2DLL A;  1DGR M;  3BT9 A;  1JJ6 C;  4Z2Y A;  3T5X A;  1LVK A;  4EGZ A;  2C6Y A;  3CCQ I;  2EFW A;  3A01 B;  5E3L A;  4E7J A;  1WH5 A;  5E1W A;  2DMU A;  1DPU A;  4PZJ A;  4EJV A;  2XB5 A;  2P5V A;  1W7P A;  2XRL A;  4KJZ A;  3FK7 A;  5KCM A;  3ZMT A;  4RDU A;  4EM0 B;  3WU1 B;  2K27 A;  2P7C B;  2L7K A;  2RV8 A;  4HX7 A;  4HZF A;  3IKT A;  1JE8 A;  1JI8 A;  1VQ4 I;  3S1M J;  4G9Y A;  4OAY A;  3G71 I;  2A6E F;  5HLG A;  2HVQ A;  3HGG A;  2V9V A;  3OYJ A;  4Y15 A;  1QU3 A;  3DWL E;  5CPR B;  2GLO A;  5J3L A;  2OD5 A;  4U87 A;  3NAU A;  4C30 A;  4G8X A;  2JMW A;  5CKT A;  4YFX F;  4DYC A;  3OMY A;  2VC0 A;  2O7O A;  3K69 A;  1B9M A;  5HLI A;  1TBX A;  2XUB A;  3HSE A;  1WZ2 A;  3CQZ J;  2CQX A;  2HYJ A;  5CVJ A;  3BG6 A;  3E1S A;  5F6F A;  4XIC A;  2WWY A;  3A0H C;  1BI3 A;  2YU3 A;  2Y0M A;  3MMY B;  2XPW A;  1QA6 A;  3DBL B;  3DP7 A;  3CES A;  3FWE A;  1TZL A;  3ABU A;  3S1N J;  2CQN A;  1XDU A;  3FXJ A;  5DUK A;  1W0U A;  1SFO J;  1TNS A;  3R0J A;  3M1E A;  1OPC A;  2XPV A;  3LQR A;  1HLV A;  1POG A;  2DAO A;  2KPM A;  5E20 A;  3ZQ7 A;  4ZDL A;  2OBP A;  4XRM A;  3S1R J;  3KP5 A;  5LEK A;  2JRM A;  4RAY A;  4ZZL A;  3MD2 A;  4KFC A;  1R00 A;  2QLZ A;  4ZZD A;  3ZPL A;  2VE9 A;  2KRF A;  1I3A A;  3RCO A;  5JHF A;  1RPW A;  1B6A A;  3C18 A;  3HUG B;  3LSK A;  1HW5 A;  4CZC A;  2Z3Y A;  2NVX J;  3CME I;  1NG6 A;  2DT7 B;  2EIJ H;  2O61 A;  3H36 A;  2BYV E;  3K4C A;  3OSG A;  4BE0 A;  2OA4 A;  3TO6 A;  4XKW A;  2CS3 A;  1FYM A;  4M3E A;  1VQ9 I;  2UXN A;  3VOE A;  4RMN A;  1D8K A;  3OS2 A;  4L5E A;  2XVC A;  2XGC A;  3U1D A;  2M3A A;  3GTP J;  4GFB A;  3OIP A;  1JGG A;  1IXR C;  3E6C C;  1D0X A;  5FLX Z;  3Q0V A;  1LQ1 A;  4FAS D;  1NTC A;  3JTH A;  4BEH B;  5E17 F;  2FBH A;  4XLH A;  1J2X A;  1N77 A;  2LYC A;  1OCC H;  3H5N A;  4M6X A;  3L9F A;  1JUM A;  4JX5 A;  1WJC A;  3I58 A;  4G6Q A;  4FQG A;  2Z1D A;  5GPA A;  3GTJ J;  3RKY A;  1NHA A;  3HEF A;  2EIK H;  3BTI A;  4WK8 F;  4BS9 A;  4IO9 F;  2D5V A;  4II3 A;  2R92 J;  4N9H A;  2YSR A;  4QLC U;  2UZK A;  2EA4 A;  1BW6 A;  2RQP A;  4M3B A;  3DV8 A;  4BL0 B;  1WHU A;  4M74 A;  3GCM A;  2P0W A;  1ZKG A;  2GIV A;  2HFH A;  3BR5 A;  3CUQ B;  4BDY A;  2CMP A;  5FLV A;  1X4O A;  1A31 A;  4DW6 A;  2L01 A;  3WGG A;  4XKB A;  5EJC A;  2XAG A;  3HM5 A;  4EGY A;  4DJA A;  2NVU B;  5KNL A;  1T39 A;  2Y0S A;  3CC7 I;  1U5T B;  2JA5 J;  5FLX K;  3W2W A;  2QA4 I;  2WY8 Q;  3ISP A;  2DFI A;  1G8X A;  3ZN1 A;  4J00 A;  1T38 A;  1VQ5 I;  2K9S A;  2FE3 A;  2E2I J;  5HVQ C;  4IHV A;  3JRB A;  2DOA A;  2RVC A;  1PYV A;  3SDB A;  4UY8 I;  2A05 A;  3LFK A;  1HW1 A;  3TW7 A;  1A36 A;  1ZRE A;  4LB5 A;  2H8R A;  2A3S A;  2XHK A;  4F93 B;  2WAF A;  5J1Y A;  1VQK I;  1PP7 U;  3T8R A;  3VSK A;  1X1D A;  3KX2 A;  2HDC A;  2R93 J;  3FMQ A;  5L3D A;  5L3C A;  4BAY A;  1IV8 A;  4CCJ A;  4A0Y A;  2R5Z B;  2MYS A;  4CYC B;  1SFE A;  1W7P B;  1BC8 C;  3KFW X;  3OS1 A;  2L9V A;  2PQ8 A;  1WCM J;  3KPH A;  1R4M B;  2B7E A;  2HWV A;  3OYM A;  3BR0 A;  3WTU C;  1F9N A;  1T0F A;  2FX0 A;  2MH9 A;  2P5L C;  1UHW A;  2VBX A;  2R7S A;  1CF7 A;  2W4S A;  4B4C A;  2K9Q A;  2FXA A;  2DQR A;  2ZXI A;  1RR8 C;  3J81 K;  2GM4 A;  1RET A;  3BPV A;  5IYB J;  2MAB A;  2E1O A;  3F6O A;  3KYC B;  4XN0 A;  5CVR A;  4XBF A;  2EV5 A;  3K2Z A;  3S2W A;  4JOM A;  2KIQ A;  5LFA A;  2CO5 A;  4RLQ A;  1WJE A;  4ZYD A;  5HS9 A;  3OYL A;  2W85 A;  3F8C A;  1UHM A;  3KP7 A;  1LDK B;  2OPT A;  4JK1 X;  2K3P A;  2R3S A;  2OUM A;  4WWC A;  1FP2 A;  2CSO A;  1Q1H A;  2DA2 A;  4A3K J;  5D8K B;  2CUE A;  3Q9V A;  1K79 A;  2COM A;  3KIO A;  4HSR A;  4G7O F;  5ILU A;  4IHW A;  2I10 A;  1QNT A;  3HHH A;  4BXF A;  3JRD A;  3DEW A;  3F0C A;  1SAN A;  5JLW A;  1R49 A;  5C4X J;  1FWZ A;  3MKW B;  4RS8 A;  2WC2 A;  2AQF A;  1YW7 A;  4HX4 A;  5HDG A;  3ABL H;  3CDI A;  2W00 A;  3IHU A;  2YR2 A;  4CCL A;  3F6V A;  2F5E A;  1DP3 A;  2VJ4 A;  3LA7 A;  5FKO A;  2HVS A;  2O0Y A;  2ETH A;  2IGK A;  2FUG 2;  4HX8 A;  1FZP B;  1J5Y A;  4ZJZ A;  3FHZ A;  3R61 A;  2UV1 A;  2BVL A;  4LG0 A;  5LLQ A;  1E3O C;  4XRS G;  2DN0 A;  1WJF A;  1TWG J;  2ZNZ A;  1ACI A;  1MJ9 A;  2H6B A;  2M4G A;  2XF5 A;  3KYD B;  3S2D J;  2XAH A;  1BJA A;  2J5O A;  2DQL A;  5B1B H;  5L3B A;  2HQN A;  2EV0 A;  4UVB A;  5EGO A;  3S3O A;  5LRS A;  1YO5 C;  2BHY A;  1ZTR A;  2ZO4 A;  3QU6 A;  2DFE A;  1H89 C;  3DPL C;  2JSC A;  4HAM A;  3TP3 A;  3U2R A;  2JK3 A;  1Z6R A;  3AG1 H;  2LH9 A;  4HOB A;  1N78 A;  2IS2 A;  2M45 A;  3GEZ A;  2K40 A;  3FMR A;  1B4A A;  3BOQ A;  3CDL A;  2IGN A;  4LLG F;  4NC6 A;  3K4B A;  4Q5S F;  1AOY A;  3DCF A;  2HQA A;  3PQJ A;  4XR6 A;  3ZN0 A;  2LR8 A;  1ZRD A;  2DPD A;  1QVT A;  4I98 B;  2JRT A;  5GAG J;  4RAZ A;  3MAJ A;  5J1U A;  2L02 A;  4B3A A;  4A3E J;  2BY0 A;  2WAQ A;  3ELK A;  2CW7 A;  1P2F A;  2QBY B;  4MEX F;  3GFI A;  3FBI B;  2OC6 A;  2CQ7 A;  2YU9 J;  2EIM H;  1EKE A;  3V8L A;  2PG4 A;  3PFI A;  3ZOB A;  2DA3 A;  1VQM I;  2B63 J;  2V6E A;  4A3C J;  4R79 A;  2ICW G;  1XD7 A;  5HLT A;  3W6V A;  2CUZ A;  3DKY A;  1ETW A;  3NEU A;  2VJI A;  4EM1 A;  4I6Z A;  5IT9 Z;  3GZN B;  3IC7 A;  1P4A A;  3IKV A;  5D5X B;  3K1M A;  4O3M A;  1ZH5 A;  2L9R A;  3L7W A;  2BXY A;  2FU4 A;  3ZRG A;  3ASO H;  1X19 A;  3KCC A;  3OV8 A;  1ZRC A;  1YW8 A;  2W24 A;  1YS6 A;  4CZZ A;  2BY1 A;  5IY5 H;  2O6G E;  1LFP A;  3OYB A;  2V79 A;  1R23 A;  4XLC A;  1YI2 I;  1OCO H;  2ACJ A;  2BE5 F;  1X3Z B;  3BDD A;  2OZ6 A;  1BI2 A;  4PUS A;  3G6E I;  2IEK A;  3C7J A;  4BQA A;  3DU5 A;  1OCP A;  1SVL A;  4RB0 A;  2M8G X;  1I5Z A;  4KIF A;  1Y8Q B;  2DTZ A;  1SC7 A;  4U0Y A;  3K70 C;  4ANJ A;  3GTM J;  3ZQI A;  3WG9 A;  4LOC A;  1SD6 A;  5L3E A;  2GA2 A;  1R1V A;  3ABK H;  4CCN A;  2IS4 A;  1QRY A;  3H35 A;  4CUG A;  3ECH A;  4QSH A;  1P6R A;  3GUD A;  2LVS A;  3CCS I;  1DQU A;  3AL0 C;  3DF8 A;  2BBY A;  5B66 C;  1X3W B;  1Z7U A;  2RNG A;  2Z33 A;  1MD0 A;  1OQY A;  4QPO A;  5IOZ A;  1JT6 A;  3QOP A;  4A0X A;  3K1P A;  4JYK A;  3GFJ A;  3GW2 A;  1VTN C;  3GLX A;  5E8G A;  2LY1 A;  4AID A;  2LD5 A;  3RQI A;  2ISZ A;  1RNL A;  3F23 A;  5BNG A;  4XKV A;  4PGG A;  3IH4 A;  2JA7 J;  3BQZ A;  3LA3 A;  4A69 C;  1K78 A;  4J01 A;  3NQO A;  1WJ5 A;  3F8F A;  2LMD A;  1OFC X;  1IJW C;  1FSE A;  2LF7 A;  2X48 A;  4WX9 A;  4LJZ F;  3BCB A;  2GA1 A;  4BUP A;  2LY2 A;  3IWZ A;  4ITV A;  2OF7 A;  3CZ6 A;  4B47 A;  1QBJ A;  1TW2 A;  3PQK A;  4DYQ A;  1VQP I;  4IHS A;  4A93 J;  2M0C A;  4RM2 A;  3GTK J;  1XSX A;  1MBG A;  3AG3 H;  2XF6 A;  4LB6 B;  2R7R A;  1GT0 C;  2CQQ A;  2XPU A;  2HU9 A;  2Y0S N;  1SD4 A;  1D1B A;  2LRD A;  1XG1 A;  1B72 B;  1L3L A;  4QTR A;  4NB5 A;  4BKX A;  2QZ8 A;  2I5U A;  1TWF J;  3NWT A;  1XPX A;  3A0B C;  2BV6 A;  1AKH B;  2M5W A;  1YJN I;  3K6G A;  2DBB A;  1IG7 A;  3RPQ A;  4MFD A;  1X2M A;  2D2W A;  1OMI A;  3LSG A;  4D5F A;  2AXT C;  3V8K A;  2KRH A;  1MBJ A;  5ED4 A;  2E60 A;  2E7X A;  3M8E A;  4KUM A;  1X1P A;  2OU2 A;  4GYI A;  1USS A;  5EZG A;  5J4V A;  4X0G A;  3HOZ J;  4ZTF A;  3CCR I;  3CCY A;  1G2H A;  2VI6 A;  2Q0O A;  4KIT B;  5DV5 A;  2HXI A;  1BC7 C;  2DA6 A;  4I7H A;  2L9S A;  4DZJ A;  1W1W E;  2RDP A;  4RA2 A;  3LWF A;  5GPC A;  1K6O A;  2NNY A;  4O6J A;  4L9N A;  3I71 A;  2MD5 A;  3JR9 A;  4KA4 A;  2HPI A;  3CC2 I;  4H0E A;  1S7O A;  5M3F J;  2H27 A;  1U3E M;  1Y39 A;  1HST A;  1TL8 A;  4FET A;  5GP9 A;  4IRH A;  5GAH J;  4PJ0 C;  1FOX A;  4XN3 A;  3ML6 A;  1Q1V A;  3GFM A;  4N0B A;  6PAX A;  2PEX A;  1OLT A;  4I99 C;  1XS9 A;  1WWX A;  2X4H A;  2M1B A;  4W1U A;  4B8X A;  1XCB A;  5F1R A;  4A3G J;  2V4J C;  4WXC A;  4XLA A;  3PO2 J;  3TGN A;  1ON1 A;  4BY7 J;  2FRH A;  4Z6Y A;  3OL4 A;  2VQC A;  3MFK A;  2ZME C;  2KL4 A;  1BR2 A;  4A6E A;  3ERE D;  5JVG F;  4D7M A;  4GGG A;  3L2V A;  1J0R A;  4JX6 A;  4LG3 A;  2QM3 A;  2WAD A;  2X9D A;  3FXU A;  2XSD C;  2MLG A;  1G4D A;  3CJT B;  2ZSH B;  4B3X A;  1W36 C;  3FBN B;  2KP6 A;  4QPQ A;  1R71 A;  2QQ9 A;  1TWC J;  1R1U A;  3WOD F;  3J7Y J;  1XMX A;  3ABM H;  5J6X A;  4L18 B;  4YRV A;  2EBI A;  3BPX A;  3TOA A;  1HF0 A;  1P7I A;  1M1E B;  5FD5 A;  1QQI A;  1H9G A;  4PFO A;  3DPU A;  5D4S A;  4X6A J;  3HOV J;  3EYI A;  4G12 A;  5HDK A;  1ETV A;  2ZME B;  1VFC A;  1YYV A;  4HNU A;  2HOE A;  3CC4 I;  2EIL H;  4EJT A;  2JTV A;  4AU7 A;  3IAS 2;  4E7H A;  3H5A A;  2KZV A;  3JRC A;  3MZ8 A;  2L7Z A;  3EUK L;  5BS6 A;  4ZYG A;  4M3D A;  2W1O A;  2OTJ I;  1F43 A;  1OJL A;  3M7G A;  3H3Z A;  4OIR F;  1QGP A;  2XAF A;  2HYG D;  2GWR A;  4X1E A;  2OTL I;  3W6K B;  3OS0 A;  5F0H A;  5BOX A;  1SEU A;  3ZQG A;  2BW3 B;  4XOR A;  1JKO C;  4KYW A;  5CQG A;  1IW7 F;  4F3Q A;  2FD5 A;  2HQR A;  4ESB A;  4I2O A;  1BN5 A;  2EK5 A;  1A6I A;  2F4M B;  2P4W A;  1AU7 A;  3ZMV A;  1KQ8 A;  2V9P A;  3WTY C;  1EH6 A;  4E70 A;  3JSO A;  4KIB A;  2VBW A;  4HQM A;  1Y1W J;  1MKM A;  3GBG A;  3I59 B;  4B1R A;  2IS1 A;  2M7B A;  2Q2E B;  2HZT A;  4E7S A;  3Q5F A;  3CLQ A;  1IGN A;  2L5Q A;  2XKP A;  3JCU C;  2HYF A;  3LAP A;  4WXD A;  2IPQ X;  5FLM J;  1BBY A;  1ZR4 A;  2FBK A;  2PMZ A;  2ZJR F;  3MKY B;  3L2Q A;  5F08 A;  3H3U A;  3RPU D;  3F3X A;  2B0L A;  1QZE A;  2X1C A;  1FJL A;  1IZ1 A;  1S7E A;  3EUA A;  3MWM A;  1R5G A;  4KDP A;  3KP6 A;  3W3C A;  5F0C A;  2DCE A;  4UV9 A;  2NRA C;  4IVN A;  3ECO A;  3QPT A;  2XIG A;  2L2O A;  1H9T A;  2ZC2 A;  3MVP A;  3F8N A;  3PO3 J;  1JKP C;  3HBL A;  1X2N A;  2COB A;  2QKL B;  4L9V A;  4LIV A;  1NK3 P;  4A3J J;  2XRN A;  4U0W A;  1MNE A;  2VB6 A;  4BQQ A;  1O3R A;  1VQ8 I;  4AC0 A;  2BHZ A;  2ZXJ A;  5LHH A;  3P7N A;  1S72 I;  3HOS A;  1VQ7 I;  2R7W A;  2IAI A;  3DQV C;  4M9X A;  1ZG3 A;  4ZC3 A;  4DOZ A;  1HCR A;  3H9Q A;  1U78 A;  2NOJ B;  2L3D A;  1K83 J;  4UXN A;  2X1E A;  4FCY A;  2AS5 F;  1O3T A;  1V4R A;  3VWB A;  3QWL A;  1BL0 A;  4ASN A;  3SFI A;  2CQK A;  4XSZ F;  2GAU A;  5LBQ A;  4A3F J;  1YW9 A;  3DKX A;  3W6J B;  2ID3 A;  3M9A A;  4CO8 A;  4U0V A;  3AKZ A;  2DJN A;  4LGW A;  4CH7 A;  1MND A;  1S3J A;  1XMA A;  2HXO A;  2LFB A;  3UR3 C;  2R0Q C;  2JA8 J;  3HJE A;  1IC8 A;  1B8I A;  4XON A;  3I3L A;  3WTV C;  1YTY A;  1ETQ A;  3I4M J;  2DYS H;  4RBO A;  3JRG A;  2DA5 A;  3KLO A;  4XID A;  3CCV I;  2R7X A;  4ESF A;  3BG3 A;  3U9G A;  3PSF A;  5DYM A;  2EH3 A;  2Y31 A;  4B44 A;  4HPQ A;  2H1K A;  2OZU A;  4P96 A;  1G6N A;  1A35 A;  2EZK A;  2Z2S B;  3E6B A;  3KP3 A;  1DP7 P;  3FXM A;  3KYL A;  3L2R A;  3F21 A;  2JA6 J;  1UCR A;  2R7O A;  4LG0 B;  1I3Q J;  1IO2 A;  5FO5 A;  3E5X A;  4MGR A;  3CUO A;  3CJN A;  3FM5 A;  5CJ9 A;  2W57 A;  2Y9Y A;  2ZBK A;  5DS9 A;  3DEE A;  3E6D A;  4XRF A;  1RZ4 A;  2CG4 A;  1MBK A;  3I55 I;  3I56 I;  5EZH A;  3OR1 C;  3A01 A;  1BOA A;  3S2H J;  2IS6 A;  1HQC A;  2GBY A;  1ORK A;  1VQ6 I;  2XAJ A;  4Y3O A;  4BU2 A;  1MH4 A;  2FNP A;  3WGI A;  4Y13 A;  3LSM A;  1TT5 B;  1YQA A;  3RI4 A;  3TW6 A;  4UUS A;  1EH7 A;  5FKM A;  1U8B A;  2E19 A;  1GXQ A;  5F27 A;  2E5N A;  3LMM A;  3OYG A;  5EF6 A;  3HKZ A;  2JZY A;  2VJ5 A;  3BTL A;  2BVM A;  2X1D A;  4UV8 A;  3RZD J;  3EPZ A;  3HOW J;  9ANT A;  5IP6 A;  1JGS A;  3DBH B;  2FQ4 A;  4C2T A;  3K4K A;  3ABT A;  4PDK A;  2CV0 A;  1D3Y A;  1DU6 A;  5FKN A;  3VSL A;  4II2 A;  2CUF A;  3JRE A;  4G7Z F;  4YII A;  1YRN B;  1YLF A;  1FBU A;  2KZG A;  2CWE A;  3PSI A;  1SFK A;  4U7D A;  3RQ4 A;  3SZG A;  3HOU J;  3D0S A;  1FYK A;  2NXN B;  4EEF G;  2UWM A;  3WTW C;  2MC3 A;  5ICF A;  3B6A A;  4PJN A;  1SFU A;  3QP6 A;  3RJP A;  4V19 K;  1HSJ A;  1U9N A;  4IRI A;  1W0T A;  2JSP A;  4AYB N;  3B6C A;  5K1Y A;  3OR2 C;  2QEX I;  2OQR A;  3PJR A;  4L0Z B;  4D1Q A;  3GTL J;  1NG7 A;  1OKR A;  2ID6 A;  4YIF A;  2STT A;  1I6H J;  2NOG A;  4I09 A;  4S05 A;  1ETK A;  4AWX B;  1BR4 A;  2VQH A;  2HZD A;  4BBS J;  4LIT A;  2ZKZ A;  3M8F A;  2UUZ A;  3BR2 A;  4BHC A;  1O4X A;  5CQE A;  3HZJ A;  4B43 A;  1SMY F;  1TQM A;  1ZAR A;  2R5Y B;  2E1N A;  3PL8 A;  1O3S A;  1Y8R B;  1J7K A;  3SQN A;  3HXL A;  4A2U A;  2RKH A;  2KIU A;  1R5I D;  1VQO I;  3IH3 A;  3OYE A;  4Q4Z F;  2DFF A;  2WV0 A;  2A5Y B;  2DTR A;  3S16 J;  2XC7 A;  1G3W A;  3ZMZ A;  2LG4 A;  4E7L A;  3UKG A;  3JRF A;  1W4M A;  1MBF A;  2MA3 A;  5FGM A;  2QCO A;  2ZSI B;  5CVV A;  2UXX A;  3ZQC A;  3ERM A;  4XOP A;  5J8F A;  2DOF A;  2W7N A;  1MBH A;  5K7Z A;  2A6H F;  5M5Y J;  3EET A;  1FTZ A;  3K4J A;  2P8T A;  4HNT A;  2KKO A;  2GIZ A;  3H9G A;  3GF2 A;  1LEA A;  4MQ9 F;  5HNH A;  4OOI A;  1YFH A;  1HC8 A;  3BLY A;  1QZY A;  2R7Q A;  2HOS A;  3S17 J;  1W7P D;  1JTY A;  3R4K A;  3KP4 A;  3QYE A;  3LSI A;  3C2H A;  5GAD J;  2VON A;  4O5V A;  2X6O A;  5IT9 K;  2F4O B;  4XM3 A;  5IYC J;  4M72 A;  1OYI A;  1RKT A;  2WAE A;  3GYH X;  3DTE A;  3KEY A;  1EH8 A;  3MQ0 A;  4Q47 A;  4EJW A;  2LY9 A;  2F48 A;  3CO7 C;  4NDL A;  1REP C;  3CUQ A;  1UFM A;  3OYN A;  4JQF A;  1V5E A;  1LE8 A;  2D45 A;  1ENH A;  1OCZ H;  1V5F A;  3WE2 A;  4HF1 A;  2QF7 A;  2VT2 A;  1ODD A;  3WTT C;  3ZQF A;  5LD2 C;  1L0O C;  1BOB A;  4P5O A;  3HIF A;  5H20 A;  4E7Z A;  5DUI A;  4NHJ A;  2Y30 A;  1RIO H;  1D5V A;  2CJJ A;  2E71 A;  3FIW A;  3WHB A;  4Y52 J;  1JTX A;  5IP7 J;  3BTJ A;  4RGS A;  4CCM A;  1IUF A;  4UUV A;  2V7F A;  3G1M A;  2ZFU A;  1TQI A;  4HA8 A;  1X58 A;  1UHS A;  1IN6 A;  1K61 A;  1X1A A;  2ISY A;  2CYY A;  2F5C A;  4CYC A;  3GWZ A;  2VBY A;  1UMQ A;  3BCA A;  4Q48 A;  4B09 A;  5B1A H;  1VI0 A;  2PMU A;  2PX9 A;  2J5P A;  4EJU A;  3FXL A;  4XKC A;  3I54 A;  5AON A;  3VYT B;  4UUT A;  2LRE A;  4EV0 A;  3V4G A;  2X0L A;  4XLF A;  2ECB A;  3JSP A;  3A2K A;  1T56 A;  4AVZ A;  1UEL B;  4HDV A;  1E2X A;  2B9S A;  4IPA A;  2IA0 A;  1ERD A;  1HBX G;  4LMY A;  4EQQ A;  2DA7 A;  1N25 A;  3BJO A;  3TDU C;  1RKW A;  1GDT A;  1ZRF A;  3PIO F;  4LLL A;  1G3Y A;  2X6Y A;  3BG5 A;  1MMN A;  3PUF A;  4F92 B;  1IRG A;  3U21 A;  3QPL A;  1B59 A;  1UST A;  1WFX A;  4ZYH A;  4LLN A;  2PMH A;  2VKV A;  1IRF A;  1KA8 A;  2MGQ A;  2R5Y A;  3ONQ A;  1W36 D;  3S15 J;  5CYV A;  1ZGA A;  5E3N A;  3IH2 A;  1FC3 A;  3LOC A;  2G9W A;  4DYR A;  2LBF A;  2XB0 X;  2Z99 A;  2QSH X;  4HV6 A;  1TTY A;  2R7Z J;  3FXQ A;  4BE2 A;  1X1B A;  4FIS A;  2AHQ A;  3WTZ A;  2IW5 A;  4AD9 A;  5A2Q K;  4KT6 A;  3NWS A;  1QO0 D;  2PBI A;  2XGD A;  4Y33 A;  3OIO A;  5H2F C;  5AIQ A;  1MNM C;  1ZEL A;  2RGV A;  3HGY A;  4BHP A;  1DUX C;  2JN6 A;  2QSG X;  1FMW A;  3M4O J;  4XL9 A;  2JJ7 A;  4FE7 A;  2F5D A;  2LK2 A;  1OIS A;  4U88 A;  3G4S I;  4UB6 C;  2K9N A;  2VUM J;  3ZMU A;  5D4R A;  3K7A J;  3DKW A;  2F6C A;  3FXK A;  5ILS A;  4YFK F;  4PJJ A;  3JAM K;  1PUE E;  1KQ0 A;  3CJQ B;  4Y17 A;  2ADU A;  4FTH A;  4S0H B;  1G3S A;  1FP1 D;  2EA2 A;  4AIJ A;  2KIM A;  4BYY A;  1LDJ A;  4CA0 A;  3WG7 H;  2KFD A;  3P9I A;  2IA1 A;  4C9Y A;  1MJB A;  2DFH A;  4HYE A;  2Y48 A;  3BQY A;  5DD4 A;  3JTG A;  1WVR A;  1JKR C;  2VKH A;  3HTS B;  1XMK A;  2BW3 A;  4PJL A;  2V1D A;  3QYF A;  2DMN A;  3GTQ J;  3WGH A;  2BEO A;  4R8H A;  3V8J A;  4NQW A;  1XDS A;  5A2Q Z;  4HBL A;  4BXU A;  2FML A;  2HGC A;  2H09 A;  1MW7 A;  3WE3 A;  4ZDO A;  4LFU A;  1NH3 A;  5FRO A;  3GX4 X;  2EPF A;  1PDN C;  1IN7 A;  1MMA A;  2XAS A;  3FXO A;  3I53 A;  4UHT A;  3Q9S A;  4ZYA A;  1KU2 A;  4LD5 A;  2GZW A;  2O5R A;  4BBR J;  1O7F A;  4A6D A;  1BI1 A;  2XGX A;  5K5Q A; 
#chains in the Genus database with same CATH homology
 2Z5U A;  1LDD A;  3F8M A;  3EUH A;  1IN4 A;  2Y75 A;  3SXY A;  3K0L A;  1XCV A;  4HF2 A;  2G7H A;  1SD5 A;  4KN4 X;  2XRO A;  4UVA A;  3DXJ F;  3B02 A;  1H0M A;  1R5H A;  1XGS A;  2K7L A;  4ZYE A;  2LKP A;  5ICE A;  3JW4 A;  3O2P E;  3T1B A;  2HS5 A;  1BIB A;  2EFN A;  1J9I A;  3CTA A;  3VB2 A;  5D5V B;  3BRO A;  1LVA A;  2H94 A;  1ULY A;  4CDG A;  3ULQ B;  2L4M A;  5IT3 A;  1IAW A;  4EM2 A;  2PI0 A;  5E1Z B;  3RKW A;  1Z9C A;  3REO A;  3L00 A;  4M73 A;  2W25 A;  2KJB A;  2PFB A;  2K4J A;  2QQA A;  2NYX A;  1U6G A;  4BNC A;  1ZHF A;  5ERI A;  3P9C A;  5D6F A;  3KEO A;  4ESJ A;  2EWN A;  2K02 A;  5HLH A;  1IUY A;  4GCV A;  1KQ9 A;  2BGC A;  1TNT A;  4L9T A;  4D0P A;  5DDG A;  2LSO A;  4RGU A;  3J80 K;  1ZGJ A;  2NNN A;  1PP8 F;  2QWW A;  3QP5 A;  2DK5 A;  2Z9O A;  1FBS A;  3BY6 A;  3DEU A;  2MLK A;  4LK0 F;  1FOK A;  1ZYR F;  3V7S A;  1MDM A;  3QU3 A;  4MEY F;  2F5F A;  1P92 A;  4IXA A;  3F72 A;  4HLX A;  2HKX A;  3T8T A;  4OIP F;  1D8J A;  1F4K A;  4PCQ A;  1O3Q A;  3D5L A;  3FM3 A;  2JPB A;  3P9K A;  3TO7 A;  1WKM A;  3E3V A;  2DT5 A;  4BH9 A;  3V7C A;  3J80 Z;  1XB4 A;  4UVC A;  1BM9 A;  1DPR A;  3LST A;  5DD8 A;  2IT0 A;  2A68 F;  5KK1 A;  4AIK A;  3WU0 A;  1YG2 A;  2V1U A;  1V3F A;  2Q8K A;  2YX4 A;  4M9Z A;  3HSR A;  5D6E A;  1HW2 A;  5HDN A;  1K7A A;  3SFZ A;  1XGM A;  1B9N A;  2IA2 A;  1YS7 A;  4HQE A;  1WSU A;  1XGN A;  3IRQ A;  2A69 F;  1IF1 A;  4OMZ A;  3I0T A;  3N4M A;  5D5U B;  2DK8 A;  3KP2 A;  1FT9 A;  2V1X A;  2EFQ A;  4OU0 A;  2D1H A;  4ENM A;  3I5U A;  2MH2 A;  1UB9 A;  1DDN A;  2O03 A;  3E5U A;  5DCF A;  4UNO A;  3E5Q A;  2ZNY A;  1JHF A;  2GXG A;  5BQT A;  2FNA A;  3BJA A;  3ZP5 A;  4RB3 C;  3BP8 A;  5KVR A;  3DPT A;  3OOP A;  2O3F A;  3O6B B;  3COA C;  1C0W A;  4L5J A;  1SAX A;  1OYY A;  1XGO A;  1LNW A;  1W5S A;  3K9T A;  3J81 Z;  2CW0 F;  2ZCW A;  1LJ9 A;  2AXL A;  2E1C A;  1R7J A;  4MNU A;  3RYR A;  4HLY A;  1T2K A;  2L54 A;  2ZFW A;  2QVO A;  3ZMD A;  1I1G A;  2WTE A;  4A5N A;  2F2E A;  3R0A A;  2Q2E A;  4WXH A;  3HRM A;  2IJL A;  4MTD A;  1FPQ A;  3I4P A;  3BJ6 A;  5CVI A;  2KIF A;  2O8X A;  1HKS A;  4LK1 F;  3HHG A;  2A07 F;  4CHU A;  2ESN A;  3C3W A;  2QEN A;  1A04 A;  4CIC A;  2R7F A;  3KLN A;  4EJO A;  3SZT A;  5LGN A;  1ZG1 A;  4G6D A;  2L4A A;  2GQQ A;  3B73 A;  4OIO F;  1KYZ A;  2KJC A;  5BPI A;  3EDP A;  1GXP A;  4ON0 A;  1Y0U A;  3HYI A;  2YX7 A;  3KZZ A;  3KE2 A;  1Z6T A;  5LHI A;  3GZ6 A;  2R7D A;  1Z1D A;  2VT3 A;  1FBQ A;  4A12 A;  3GO5 A;  2HKO A;  3RTR A;  3RPU A;  3F8B A;  5E18 F;  1CF7 B;  1QPM A;  1Z91 A;  1FY7 A;  2FA5 A;  3V7R A;  2JT1 A;  2XKO A;  4KNY A;  2CFX A;  1SMT A;  2XV4 S;  3GVA A;  4HF0 A;  2MBF A;  5ICG A;  1IN5 A;  2P7V B;  3QAH A;  3R60 A;  1P4W A;  4IJA A;  4G94 A;  1MJA A;  1R36 A;  3I64 A;  5JI6 A;  3VEP A;  2P5K A;  1GVJ A;  4S04 A;  2DI3 A;  4YFN F;  2CGP A;  2EV6 A;  2E7W A;  3F22 A;  2GXB A;  2EB7 A;  5ILV A;  4RGR A;  2DU9 A;  1E17 A;  4R1H A;  3QPH A;  4F7Z A;  2STW A;  3G3Z A;  5FD6 A;  1WI9 A;  4I02 A;  4AIH A;  2IP2 A;  4A5M A;  1WRJ A;  3L09 A;  1HXD A;  2IVM A;  5FFZ A;  4QWQ A;  1O7L A;  3K1N A;  1U8R A;  4BHB A;  4I0A A;  3MZY A;  4GYG A;  3RDI A;  2D1V A;  1IN8 A;  2M87 A;  2QQB A;  1I6X A;  4YG2 F;  2HTS A;  5ICC A;  1MDM B;  1LEB A;  2RNJ A;  5EEH A;  2VC1 A;  3LA2 A;  4JBA A;  5JVT A;  3WTX C;  4WCG A;  5TRD A;  2K86 A;  2VN2 A;  4P55 A;  5H6R A;  4OIQ F;  3HUG A;  2K4B A;  3QRF F;  2JPC A;  5JFR A;  5CVU A;  2TDX A;  1G3T A;  1YIO A;  1EV7 A;  1I27 A;  1KGS A;  5LGT A;  1O57 A;  1HKT A;  2ZME A;  2IRF G;  2FEZ A;  1U2W A;  4RB1 A;  3CDH A;  2DO7 A;  4MHG A;  5LGU A;  3FZV A;  3CO6 C;  4XSX F;  1MGT A;  1J59 A;  2QYO A;  4ENJ A;  3TKY A;  4MTE A;  4HDU A;  2EJR A;  1QZZ A;  5AIP A;  3J7A O;  1S29 A;  2A61 A;  5F64 A;  1LB2 A;  2EFO A;  4WF2 A;  2OQG A;  4IF4 A;  2ZJ2 A;  4GO1 A;  5K5R A;  4DQ2 A;  3IWF A;  1SFX A;  4ENN A;  4RGX A;  1XSD A;  5E1X A;  1Z05 A;  3I59 A;  2LNB A;  3VFZ A;  1R22 A;  3SZP A;  4GXO A;  4K2E A;  1ZN2 A;  2VOO A;  4M9S A;  2FSW A;  2HEO A;  4FHT A;  1IXS B;  1T6S A;  2YPR A;  3C1D A;  3KZY A;  5EEG A;  1FSH A;  1MZB A;  1BIA A;  4KT5 C;  5HOO A;  3LAJ A;  4FX0 A;  1S8N A;  1R1T A;  3HSF A;  4EMS A;  5HS8 A;  4OMY A;  5BPD A;  3HRS A;  3GXO A;  3NRV A;  4ZH4 F;  2EFP A;  2RN7 A;  4KIG A;  3L2C A;  1F1Z A;  1AWC A;  3DFG A;  2VOD A;  3MCZ A;  3CLO A;  4CYD A;  1T98 A;  4IHT A;  4I01 A;  1KU9 A;  1FNN A;  4CGZ A;  4XLP F;  2FMY A;  3HRT A;  5LRR A;  2FF4 A;  3RYP A;  1STZ A;  4L9J A;  4M6Y A;  2M30 A;  4L5I A;  4FX4 A;  2FBI A;  5CLS A;  4L0Y B;  5DCM A;  1RUO A;  5BMZ A;  5FB2 A;  1TQP A;  3BWG A;  5FFX A;  1KU3 A;  2G7U A;  1F5T A;  3FMS A;  2PLY A;  1OR7 A;  1ZAO A;  4ETS A;  4U7B A;  4G7H F;  2VXZ A;  4M71 A;  1TW3 A;  3CUQ C;  3T0Y A;  3ROU A;  1BI0 A;  2NS0 A;  3VOD A;  3RIR A;  2XAQ A;  2LF8 A;  1JHH A;  3TDZ C;  4AVP A;  1J75 A;  4ENK A;  3AAF A;  2VBZ A;  3HRU A;  4XLN F;  1FLI A;  1SD7 A;  3TQN A;  2ELH A;  1ZLJ A;  3LQQ A;  1RI7 A;  2V6C A;  1CGP A;  4EVI A;  1TLH B;  5HS7 A;  2QUF A;  2RC4 A;  4RB2 C;  3GFL A;  1RUN A;  1ZG5 A;  1ZLK A;  3ZMS A;  1P4X A;  4FT8 A;  4HV5 A;  2M8E A;  5H6Q A;  5TJJ A;  5DCM B;  1IXC A;  3KET A;  1X3U A;  4PGH A;  1KU7 A;  3IRR A;  3HTU A;  2OAZ A;  5L3G A;  5DEQ A;  1FYL A;  4OIN F;  3TOB A;  5LEJ A;  1XSV A;  1K78 B;  1FX7 A;  1U5T C;  2HTJ A;  3E97 A;  3JAM Z;  3MEX A;  2LDU A;  3FF5 A;  3O3K A;  2H6C A;  4N9I A;  3H92 A;  4P9U A;  3N97 A;  2DPU A;  1KYW A;  4I0B A;  2P6S A;  4DNC A;  4KIC A;  2P6T A;  5LHG A;  3R6S A;  4KN7 X;  5E8I A;  4CXF A;  4IRG A;  1U5T A;  2FOK A;  1WQ2 A;  1R58 A;  2HR3 A;  3G73 A;  2PN6 A;  3TO9 A;  4KMF A;  1XN7 A;  2NAZ A;  3WTS C;  5D8L B;  3GZ5 A;  5D5W B;  4P9F A;  3IL2 A;  3FXR A;  5JHU A;  2DW4 A;  4TV7 A;  2VOP A;  1S7A A;  1S6L A;  2W84 A;  1ONV A;  3BZ6 A;  1B1B A;  5J8C A;  4HW0 A;  4MQV A;  1W5T A;  3MZH A;  4KMU X;  1HKQ A;  1JXS A;  4A0Z A;  1I1S A;  3E6M A;  3HOT A;  3EQL F;  3KEQ A;  2QBY A;  3EYY A;  5K5O A;  3FX3 A;  2ESH A;  1ON2 A;  2PJP A;  5JR3 A;  2VE8 A;  3SHF A;  1OYW A;  2FQ3 A;  3RKX A;  5L3F A;  1GHC A;  2DLL A;  4Z2Y A;  3T5X A;  4EGZ A;  2C6Y A;  2EFW A;  5E1W A;  1DPU A;  4PZJ A;  4EJV A;  2P5V A;  1W7P A;  3ZMT A;  4EM0 B;  3WU1 B;  2K27 A;  2P7C B;  2RV8 A;  4HX7 A;  4HZF A;  3IKT A;  1JE8 A;  4G9Y A;  2A6E F;  5HLG A;  2V9V A;  4Y15 A;  2OD5 A;  4G8X A;  4YFX F;  2VC0 A;  3K69 A;  5HLI A;  1B9M A;  1TBX A;  2XUB A;  3HSE A;  5CVJ A;  5F6F A;  2WWY A;  1BI3 A;  2YU3 A;  2Y0M A;  3DP7 A;  3FWE A;  3ABU A;  1XDU A;  5DUK A;  1TNS A;  3R0J A;  3M1E A;  1OPC A;  3LQR A;  2DAO A;  5E20 A;  3ZQ7 A;  2OBP A;  3KP5 A;  5LEK A;  4RAY A;  4ZZL A;  4KFC A;  1R00 A;  2QLZ A;  4ZZD A;  3ZPL A;  2VE9 A;  2KRF A;  1B6A A;  3C18 A;  1HW5 A;  2Z3Y A;  2O61 A;  2BYV E;  2OA4 A;  3TO6 A;  1FYM A;  2UXN A;  3VOE A;  1D8K A;  2XVC A;  3U1D A;  1IXR C;  3E6C C;  5FLX Z;  1LQ1 A;  3JTH A;  5E17 F;  2FBH A;  1J2X A;  4M6X A;  3L9F A;  3I58 A;  4G6Q A;  3RKY A;  1NHA A;  4WK8 F;  4N9H A;  2YSR A;  4QLC U;  2UZK A;  2EA4 A;  2RQP A;  3DV8 A;  4M74 A;  2HFH A;  2GIV A;  3CUQ B;  2L01 A;  3WGG A;  2XAG A;  4EGY A;  1T39 A;  1U5T B;  5FLX K;  3ISP A;  2DFI A;  1T38 A;  3ZN1 A;  2FE3 A;  5HVQ C;  2RVC A;  3LFK A;  1HW1 A;  1ZRE A;  4LB5 A;  2A3S A;  2XHK A;  1PP7 U;  3T8R A;  2HDC A;  3FMQ A;  5L3D A;  5L3C A;  4BAY A;  4A0Y A;  1SFE A;  1W7P B;  1BC8 C;  3KFW X;  2PQ8 A;  2HWV A;  3WTU C;  1F9N A;  1T0F A;  2MH9 A;  2P5L C;  1UHW A;  2VBX A;  1CF7 A;  2FXA A;  2DQR A;  3J81 K;  3BPV A;  3F6O A;  5CVR A;  4XBF A;  2EV5 A;  3K2Z A;  3S2W A;  2CO5 A;  4ZYD A;  5HS9 A;  2W85 A;  3F8C A;  1UHM A;  3KP7 A;  1LDK B;  4JK1 X;  2R3S A;  4WWC A;  1FP2 A;  2CSO A;  1Q1H A;  5D8K B;  1K79 A;  3Q9V A;  2COM A;  4G7O F;  5ILU A;  1QNT A;  3HHH A;  1FWZ A;  4RS8 A;  2WC2 A;  4HX4 A;  1YW7 A;  5HDG A;  3IHU A;  2YR2 A;  3F6V A;  2F5E A;  3LA7 A;  2O0Y A;  2ETH A;  4HX8 A;  1FZP B;  1J5Y A;  3FHZ A;  3R61 A;  4LG0 A;  5LLQ A;  2ZNZ A;  1MJ9 A;  2H6B A;  2XAH A;  1BJA A;  2J5O A;  2DQL A;  5L3B A;  2HQN A;  2EV0 A;  4UVB A;  5LRS A;  1YO5 C;  2ZO4 A;  3QU6 A;  3DPL C;  2JSC A;  4HAM A;  3U2R A;  1Z6R A;  4HOB A;  2M45 A;  3GEZ A;  1B4A A;  3BOQ A;  3FMR A;  4LLG F;  1AOY A;  4Q5S F;  3ZN0 A;  3PQJ A;  1ZRD A;  2DPD A;  4I98 B;  2JRT A;  4RAZ A;  3MAJ A;  2L02 A;  3ELK A;  1P2F A;  2QBY B;  4MEX F;  3GFI A;  3V8L A;  2PG4 A;  3PFI A;  4R79 A;  1XD7 A;  3NEU A;  4EM1 A;  5IT9 Z;  3IC7 A;  1P4A A;  3IKV A;  5D5X B;  3K1M A;  4O3M A;  1ZH5 A;  3L7W A;  2FU4 A;  3KCC A;  3OV8 A;  1ZRC A;  1YW8 A;  2W24 A;  1YS6 A;  4CZZ A;  2O6G E;  2V79 A;  1R23 A;  2ACJ A;  2BE5 F;  3BDD A;  2OZ6 A;  1BI2 A;  3C7J A;  4BQA A;  4RB0 A;  1I5Z A;  4KIF A;  4U0Y A;  3WG9 A;  1SD6 A;  5L3E A;  2GA2 A;  1R1V A;  3ECH A;  1P6R A;  3GUD A;  3DF8 A;  2BBY A;  1Z7U A;  2Z33 A;  1MD0 A;  3QOP A;  4A0X A;  3K1P A;  3GFJ A;  3GW2 A;  1VTN C;  3GLX A;  5E8G A;  2ISZ A;  1RNL A;  3F23 A;  4PGG A;  3LA3 A;  1K78 A;  3NQO A;  3F8F A;  1FSE A;  2LF7 A;  4WX9 A;  4LJZ F;  2GA1 A;  3IWZ A;  1QBJ A;  1TW2 A;  3PQK A;  4IHS A;  1XSX A;  4LB6 B;  1SD4 A;  1L3L A;  4NB5 A;  2QZ8 A;  2BV6 A;  2M5W A;  2DBB A;  3RPQ A;  2D2W A;  1OMI A;  3V8K A;  5ED4 A;  2E7X A;  3M8E A;  4KUM A;  2OU2 A;  4GYI A;  1USS A;  2Q0O A;  5DV5 A;  1BC7 C;  4I7H A;  2RDP A;  3LWF A;  1K6O A;  2NNY A;  4O6J A;  4L9N A;  3I71 A;  2MD5 A;  4KA4 A;  4H0E A;  1S7O A;  2H27 A;  1U3E M;  1HST A;  4IRH A;  3ML6 A;  3GFM A;  4N0B A;  6PAX A;  2PEX A;  1WWX A;  2X4H A;  2M1B A;  4B8X A;  1XCB A;  5F1R A;  4WXC A;  3TGN A;  1ON1 A;  2FRH A;  3MFK A;  4A6E A;  3ERE D;  4GGG A;  1J0R A;  2QM3 A;  3FXU A;  2MLG A;  1G4D A;  2QQ9 A;  1R1U A;  3WOD F;  5J6X A;  4L18 B;  3BPX A;  3TOA A;  5FD5 A;  1QQI A;  1H9G A;  5D4S A;  3EYI A;  5HDK A;  2ZME B;  1YYV A;  2HOE A;  4EJT A;  2JTV A;  5BS6 A;  4ZYG A;  3M7G A;  3H3Z A;  4OIR F;  1QGP A;  2XAF A;  2HYG D;  2GWR A;  3W6K B;  5BOX A;  4KYW A;  1IW7 F;  2HQR A;  4ESB A;  4I2O A;  1BN5 A;  2EK5 A;  2P4W A;  3ZMV A;  1KQ8 A;  3WTY C;  1EH6 A;  4E70 A;  3JSO A;  4KIB A;  2VBW A;  4HQM A;  1MKM A;  3I59 B;  2HZT A;  3Q5F A;  2XKP A;  2HYF A;  3LAP A;  4WXD A;  2IPQ X;  1BBY A;  2FBK A;  3H3U A;  3F3X A;  2B0L A;  1IZ1 A;  3MWM A;  1R5G A;  4KDP A;  3KP6 A;  4UV9 A;  2NRA C;  4IVN A;  3ECO A;  3QPT A;  2XIG A;  1H9T A;  3F8N A;  4L9V A;  2XRN A;  4U0W A;  1O3R A;  2ZXJ A;  5LHH A;  3P7N A;  3HOS A;  3DQV C;  4M9X A;  1ZG3 A;  1U78 A;  2L3D A;  4UXN A;  2AS5 F;  1O3T A;  1V4R A;  4ASN A;  2CQK A;  4XSZ F;  2GAU A;  5LBQ A;  1YW9 A;  3W6J B;  3M9A A;  4CO8 A;  4U0V A;  4LGW A;  1S3J A;  1XMA A;  3WTV C;  1YTY A;  3KLO A;  4ESF A;  3U9G A;  5DYM A;  2OZU A;  4P96 A;  1G6N A;  3E6B A;  3KP3 A;  1DP7 P;  3F21 A;  1UCR A;  4LG0 B;  5FO5 A;  3E5X A;  4MGR A;  3CUO A;  3CJN A;  3FM5 A;  5CJ9 A;  2W57 A;  2ZBK A;  3E6D A;  4XRF A;  1RZ4 A;  2CG4 A;  1BOA A;  1HQC A;  2XAJ A;  2FNP A;  3WGI A;  4Y13 A;  1YQA A;  3RI4 A;  1EH7 A;  1GXQ A;  2JZY A;  4UV8 A;  1JGS A;  3ABT A;  4PDK A;  1D3Y A;  4G7Z F;  4YII A;  1YLF A;  1FBU A;  2CWE A;  4U7D A;  3D0S A;  1FYK A;  2UWM A;  3WTW C;  2MC3 A;  5ICF A;  1SFU A;  3QP6 A;  3RJP A;  1HSJ A;  4IRI A;  5K1Y A;  2OQR A;  4L0Z B;  1OKR A;  4YIF A;  2STT A;  4I09 A;  4S05 A;  4AWX B;  2ZKZ A;  3M8F A;  4BHC A;  1SMY F;  1TQM A;  1ZAR A;  2E1N A;  1O3S A;  1J7K A;  3SQN A;  4A2U A;  2RKH A;  2KIU A;  4Q4Z F;  2WV0 A;  2A5Y B;  2DTR A;  1G3W A;  3ZMZ A;  1W4M A;  2MA3 A;  5FGM A;  5CVV A;  2UXX A;  5J8F A;  2A6H F;  3EET A;  2P8T A;  2KKO A;  3GF2 A;  1LEA A;  4MQ9 F;  4OOI A;  1YFH A;  1QZY A;  1W7P D;  3R4K A;  3KP4 A;  2VON A;  4O5V A;  5IT9 K;  4M72 A;  1OYI A;  3GYH X;  1EH8 A;  3MQ0 A;  4Q47 A;  4EJW A;  3CO7 C;  1REP C;  3CUQ A;  1UFM A;  4JQF A;  2D45 A;  3WE2 A;  4HF1 A;  3WTT C;  2VT2 A;  1ODD A;  1L0O C;  4P5O A;  3HIF A;  5H20 A;  4NHJ A;  5DUI A;  1RIO H;  1D5V A;  4RGS A;  4UUV A;  1TQI A;  4HA8 A;  1IN6 A;  2ISY A;  2CYY A;  2F5C A;  3GWZ A;  2VBY A;  4Q48 A;  4B09 A;  2PMU A;  2J5P A;  4EJU A;  3I54 A;  5AON A;  4EV0 A;  3V4G A;  2X0L A;  3JSP A;  4HDV A;  1E2X A;  4IPA A;  2IA0 A;  1HBX G;  4LMY A;  4EQQ A;  3BJO A;  3TDU C;  1ZRF A;  4LLL A;  1G3Y A;  1IRG A;  1B59 A;  1UST A;  4ZYH A;  4LLN A;  2PMH A;  1IRF A;  1KA8 A;  5CYV A;  1ZGA A;  1FC3 A;  2G9W A;  2Z99 A;  4HV6 A;  1TTY A;  3FXQ A;  3WTZ A;  2IW5 A;  4AD9 A;  5A2Q K;  1QO0 D;  2PBI A;  5AIQ A;  2RGV A;  4BHP A;  1DUX C;  4U88 A;  2F5D A;  3ZMU A;  5D4R A;  3DKW A;  5ILS A;  4YFK F;  3JAM K;  1PUE E;  1KQ0 A;  4Y17 A;  2ADU A;  1G3S A;  1FP1 D;  2EA2 A;  4AIJ A;  2KIM A;  4BYY A;  1LDJ A;  3P9I A;  2IA1 A;  1MJB A;  4HYE A;  2Y48 A;  5DD4 A;  3JTG A;  3HTS B;  1XMK A;  2V1D A;  3WGH A;  2BEO A;  4R8H A;  3V8J A;  4NQW A;  1XDS A;  5A2Q Z;  4HBL A;  4BXU A;  2FML A;  2HGC A;  2H09 A;  3WE3 A;  4LFU A;  3GX4 X;  1PDN C;  1IN7 A;  2XAS A;  3I53 A;  4UHT A;  3Q9S A;  1KU2 A;  4LD5 A;  2GZW A;  1O7F A;  4A6D A;  1BI1 A;  2XGX A;  5K5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...