2E1NA

Crystal structure of the cyanobacterium circadian clock modifier pex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
110
structure length
110
Chain Sequence
MDFEDIYRFFQDPPPHYLSKELAVCYVLAVLRHEDSYGTELIQHLETHWPNYRLSDTVLYTALKFLEDEQIISGYWKKVEGRGRPRRMYQLAQANDDRSRDLAQLWERYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pex
publication title Structural and Biochemical Characterization of a Cyanobacterium Circadian Clock-modifier Protein
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Circadian clock protein
total genus 34
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2e1nA00
1ODDA 2OZUA 3LAPA 1YS7A 1U5TC 1G3YA 4A2UA 1SD4A 2JPCA 3SHFA 5KK1A 3BZ6A 1LJ9A 1R7JA 1ZREA 2EV6A 5ED4A 3WTUC 2QQ9A 5KVRA 3L09A 4ZYHA 1OKRA 4TV7A 1XMKA 5IT3A 1ZRDA 4I02A 1DDNA 3WODF 1RI7A 2DI3A 1HBXG 3WTTC 1IN8A 5D5XB 4EJOA 2K86A 3I4PA 4U0YA 3OOPA 2VODA 5D6EA 4MTDA 1YQAA 2M5WA 5E1WA 3E3VA 3K0LA 1U78A 1G3WA 2NAZA 3M7GA 4RB1A 2FBIA 4YFXF 4UHTA 4ESJA 1FLIA 4ZZLA 2LF8A 3RKYA 2STTA 4BXUA 4EJUA 1MDMB 3MEXA 2A68F 3JSOA 4H0EA 3ERED 1GXQA 4MTEA 2WV0A 2UWMA 1Z9CA 2QYOA 1RNLA 5BS6A 3ISPA 1RUNA 2HZTA 2ZFWA 4XBFA 1ZRFA 2K02A 3GUDA 1F9NA 1O7FA 1B59A 2PEXA 2Y75A 3E6MA 1I1SA 2XHKA 3ZMTA 1ZLKA 2ACJA 2IVMA 2HQNA 2IPQX 4HV6A 2PFBA 4XLNF 2EWNA 1L0OC 2UZKA 1RZ4A 1YW9A 2H09A 4RGRA 3K1PA 2YPRA 2LSOA 2GA1A 3IL2A 4GXOA 2EFQA 1PP8F 2O03A 4IRHA 1LQ1A 3FXQA 3HHHA 2QENA 2NS0A 1VTNC 5ILVA 2HEOA 4O5VA 4M6XA 3DPLC 4HZFA 2B0LA 2IA2A 4L0YB 2TDXA 5HVQC 2LKPA 1SAXA 1V4RA 3KZZA 2ELHA 4WXHA 1TNTA 3CDHA 3U9GA 2GXGA 5ICCA 2OQRA 3SXYA 2V1XA 2KJBA 1IXCA 1B9NA 1BC7C 1KQ9A 2W24A 2ZBKA 3C1DA 3QP6A 3RPQA 5E20A 2QUFA 4I2OA 2KRFA 3IC7A 1REPC 3ROUA 1JHHA 4KDPA 4DQ2A 3T5XA 4BAYA 4NB5A 4HDUA 4EJTA 4ENJA 3SZTA 4IJAA 4S04A 3DV8A 1HW1A 2IJLA 5TRDA 4UVCA 3HSEA 2VE8A 5A2QK 1ZG1A 5HDNA 2VBZA 2GZWA 4XSXF 3RIRA 2A3SA 4M73A 5FGMA 2IA0A 2L02A 2DK5A 4IF4A 4OINF 2V9VA 2XV4S 4RB3C 1J2XA 1U2WA 1R1TA 1O7LA 2XROA 1GHCA 3KP5A 5LGTA 1UB9A 5D5WB 1P4AA 5FLXK 5LEKA 1LVAA 3P7NA 3KFWX 1XCBA 3G73A 1SD7A 1TQPA 4G9YA 1KGSA 2XASA 4L9JA 3RYPA 5FD6A 2GWRA 3NEUA 3I59B 4CZZA 4YFNF 2P5KA 2MA3A 3J7AO 1Q1HA 4L0ZB 2EA4A 4K2EA 2FNPA 5K1YA 4JBAA 4PGHA 1YG2A 3HOSA 4EM0B 4Q48A 3H92A 3WTZA 3IRRA 1BOAA 1AOYA 3PQKA 4HDVA 2STWA 4UVAA 4HOBA 3F8BA 1FT9A 3I64A 2V1UA 2FA5A 3LWFA 1QGPA 3HSFA 2RDPA 1ONVA 3CTAA 3ABTA 2ZNYA 3F8FA 5H20A 5EEGA 5ILSA 2BE5F 3HYIA 3CUOA 2DQRA 1NHAA 1LDDA 3IWZA 2Z99A 1CF7B 1ON2A 3RJPA 2L01A 4I98B 3ECHA 4CXFA 5CVIA 1U3EM 1K78A 3L2CA 2ETHA 2RC4A 3KP7A 3WTYC 1OPCA 2M8EA 4U7DA 4L5JA 2BEOA 5CYVA 4ESFA 2RKHA 3M9AA 3FM3A 2P6TA 2JSCA 3I71A 3V8JA 4S05A 3HSRA 2CFXA 1F5TA 3M8FA 1O3QA 4BQAA 1T2KA 2IA1A 2Z33A 3IWFA 3L9FA 4OOIA 1U5TB 3CO6C 1V3FA 2E7WA 1G3TA 1TW2A 3P9CA 5FFXA 4G6QA 3DKWA 4WWCA 5FO5A 3FM5A 1FOKA 2D1HA 1USTA 5L3DA 3HOTA 1OYYA 1ZG5A 3HRSA 4OIRF 1FYKA 2IW5A 3F8CA 5D6FA 1WKMA 1IN7A 2VBWA 4ENMA 2Z3YA 4KYWA 5JFRA 1FWZA 2PN6A 2FU4A 1LB2A 4O3MA 4G8XA 2JZYA 1HXDA 4NQWA 3V7RA 1BI1A 2HOEA 3WE3A 3KEQA 3REOA 1S7OA 3WGHA 2K4JA 4I09A 2Z5UA 2VXZA 1DP7P 1OYWA 2COMA 4ON0A 4YIFA 2Z9OA 3I58A 1GVJA 1O3RA 1IXSB 4KA4A 3R0JA 1WRJA 5LGNA 3GFLA 3ZMSA 4WXCA 3T0YA 3GXOA 5L3GA 3J80K 4IRIA 4LGWA 2PQ8A 4LLGF 3VOEA 1QBJA 3CO7C 2FBHA 4WX9A 4KN7X 3WG9A 3M1EA 4AIJA 3QAHA 1T6SA 1MGTA 2W85A 4Z2YA 1R58A 3MFKA 4RAZA 1R1VA 3LAJA 2M45A 3ZMUA 1E2XA 3EETA 5CVUA 2HYFA 1BJAA 4KUMA 3HRMA 1J59A 2HFHA 2MC3A 3PFIA 2L3DA 4MGRA 2DTRA 4GYGA 3F22A 1MDMA 3B02A 3K2ZA 4ASNA 2DO7A 2LNBA 4OMZA 3Q5FA 4CDGA 1P92A 5IT9Z 1SD5A 1FBQA 3KP6A 3FWEA 3WTXC 1ZRCA 5E8IA 2ZXJA 3KCCA 3CUQC 4PGGA 2O8XA 4UV9A 2W25A 3V4GA 3TGNA 4CO8A 1TTYA 1BC8C 2O61A 3C3WA 3DP7A 2FOKA 4YFKF 3ZMZA 1W5SA 6PAXA 4BHBA 3RI4A 3L7WA 4HV5A 3RDIA 3HHGA 3E6DA 3V8KA 5HDKA 1IZ1A 1IW7F 1MJBA 4M9XA 1FC3A 2D1VA 4U88A 2Y48A 1KYZA 4LB6B 2QM3A 3I54A 4HA8A 1J5YA 4EVIA 2EFPA 3R61A 1WI9A 4MHGA 1K7AA 2DU9A 1BIBA 2JT1A 2RGVA 4NHJA 1MJ9A 3K1NA 3TO7A 4I01A 3MCZA 2D45A 2WC2A 3F72A 2ESNA 4ZYEA 4Y17A 2R7FA 1DUXC 2AS5F 5D4RA 1LDKB 5LGUA 3GW2A 3LA3A 2Q8KA 1I1GA 2P7VB 1SMTA 3ELKA 4KNYA 1BI3A 4PDKA 2FXAA 1MKMA 4XLPF 5BMZA 4UXNA 2HKXA 1DPUA 3F23A 3O6BB 2K4BA 3H3UA 2BV6A 1IN6A 5TJJA 1S7AA 1FNNA 1UHWA 1B6AA 1W7PB 1YO5C 5L3FA 3F6VA 2OU2A 1ZYRF 4EM1A 1ZG3A 1FSEA 3LA2A 2VOOA 5HOOA 2CGPA 4LMYA 5LRSA 4I0BA 1KU7A 3BDDA 2IT0A 1EH7A 2JRTA 3I59A 4FT8A 4BNCA 1EH8A 4I0AA 2CWEA 4Y13A 1KU9A 5DD8A 4HF2A 2XAGA 1IF1A 1GXPA 4U0WA 3GFJA 2P7CB 3E5XA 2LF7A 3GWZA 3QP5A 5H6RA 4LG0B 5DDGA 1BI2A 1ZN2A 4HQMA 4UV8A 5D5UB 4G7OF 5D5VB 5BPIA 4RGUA 2DT5A 3NRVA 4UNOA 4KMUX 4WF2A 3VFZA 3KP2A 3WE2A 3MZYA 4IXAA 4FX0A 2RNJA 1B4AA 3BP8A 2CYYA 5LBQA 4UUVA 2F5EA 1MJAA 3W6KB 4A6EA 3M8EA 2QVOA 2DW4A 1W7PD 1CF7A 5BQTA 1T39A 4HBLA 3D5LA 3DFGA 2G9WA 3WGIA 4RS8A 3KLNA 2C6YA 5E17F 2K27A 1H9TA 2DAOA 4ENNA 2AXLA 5K5OA 2DLLA 3E6BA 4WXDA 2ESHA 1FPQA 5L3EA 3AAFA 2O0YA 2MLGA 2J5OA 1U6GA 2K7LA 4OIPF 3KE2A 4LFUA 3BWGA 1QZYA 1XMAA 2V1DA 4R79A 4A5MA 4G94A 2VN2A 1ZHFA 2CW0F 1U5TA 4RGSA 4F7ZA 1LDJA 5EEHA 1R22A 2F5FA 3DF8A 4IPAA 5LEJA 3RPUA 3LA7A 1I6XA 2ADUA 3K1MA 1IXRC 1KQ8A 4P9FA 1QPMA 2NRAC 3JSPA 3O2PE 4IHTA 4YIIA 2FMYA 3GFMA 1RUOA 5HLGA 2EFOA 3F3XA 1XGSA 3FXUA 5H6QA 2ISYA 1B9MA 3VB2A 2BBYA 3GX4X 4HX8A 1C0WA 2OD5A 2PJPA 3KEOA 2VC1A 3JAMK 1HSJA 2OBPA 1QNTA 1ON1A 4A0ZA 2WWYA 4IVNA 5HS8A 3SFZA 3T1BA 2MH2A 3NQOA 2VBYA 2FEZA 2ZMEB 2DBBA 3TOAA 2CQKA 2H94A 3LFKA 2HDCA 3EYYA 4HLXA 3DQVC 2UXXA 1JGSA 1LEBA 1ZH5A 2PMHA 1O57A 1R00A 1FSHA 2XAFA 1XB4A 4L9NA 4M9SA 4CICA 3CUQB 4A6DA 1TNSA 2GA2A 4P96A 3HRTA 1STZA 2MH9A 5DCMB 1R1UA 1OYIA 2P6SA 2A07F 3QOPA 2IRFG 4MEXF 4KN4X 3TQNA 1XGOA 1S6LA 4JQFA 1YLFA 1QO0D 2BGCA 4HLYA 1BM9A 3WTWC 2HR3A 2HTSA 1XDSA 1XDUA 5L3BA 4EMSA 1XSVA 3R4KA 3FXRA 1O3TA 5E1XA 1XD7A 2J5PA 2P4WA 3GO5A 3SZPA 4CHUA 3C18A 4EJVA 2RN7A 1LNWA 1YYVA 3GF2A 1D8KA 4HQEA 4A5NA 1XSDA 4B09A 3I53A 3DPTA 2CG4A 2Q2EA 2A61A 1HKSA 4Q4ZF 3TO9A 3VEPA 5A2QZ 5E1ZB 1G6NA 1FYMA 4BYYA 1O3SA 4L5IA 1TQMA 2PLYA 4GYIA 1EV7A 3GZ5A 1Z6RA 5DEQA 3BOQA 5AONA 3CJNA 1R36A 3BY6A 1X3UA 3WTSC 2ZCWA 3JTGA 1SMYF 1W4MA 1HKQA 2EB7A 4WCGA 5FLXZ 5CVVA 4HAMA 4RAYA 1HSTA 1S29A 1K79A 3T8RA 3CLOA 2FRHA 2A6EF 2MD5A 4IRGA 3ABUA 2OA4A 1CGPA 2VBXA 2FBKA 2HWVA 2QQAA 1TLHB 3Q9VA 4HF1A 4JK1X 1KYWA 1J75A 4G7HF 4RB2C 2QQBA 2E7XA 4ZZDA 4KIFA 2FSWA 1LEAA 4FHTA 2G7HA 3HUGA 4G6DA 4BHPA 4M9ZA 3N97A 5HLIA 2JPBA 2ZO4A 3FMQA 1FX7A 1HQCA 3FX3A 1T0FA 2HTJA 4HX7A 4CYDA 1TW3A 2KKOA 3PQJA 4LLLA 3E5UA 4EJWA 1ZLJA 2XIGA 3G3ZA 3VODA 3RTRA 3U2RA 1WQ2A 5DCFA 4O6JA 4L18B 1P2FA 2FMLA 2G7UA 3IKTA 3KP3A 3ZPLA 4EGZA 4KT5C 1FYLA 4EM2A 5F64A 3F8NA 1KQ0A 4DNCA 5FB2A 3V7CA 2XVCA 1UCRA 4P55A 4HF0A 3TO6A 1WWXA 1HKTA 1HW2A 1W7PA 2R7DA 2M87A 3K69A 5LHGA 3GFIA 5BOXA 3DXJF 3MZHA 3U1DA 3KZYA 4YG2F 3BPVA 3BJAA 3DEUA 2L4AA 3OV8A 1HW5A 1H9GA 2FF4A 4UVBA 2YSRA 2QBYB 1S8NA 2O6GE 2OZ6A 5E8GA 3EYIA 2YR2A 2XGXA 4LG0A 5E18F 3FMSA 1R23A 2NNYA 2PG4A 1IUYA 2ZNZA 3BJOA 2M1BA 2JTVA 5AIQA 3BJ6A 3R0AA 3JW4A 4BHCA 1A04A 2DPUA 1JHFA 5LHIA 4N9IA 1RIOH 2XAJA 3ECOA 1WSUA 3RKWA 3MWMA 2Y0MA 1FBSA 1FY7A 3QPHA 1XGMA 4GO1A 5HS7A 3S2WA 4M72A 3L00A 4Q5SF 3H3ZA 3HTSB 4XRFA 1ZGJA 2VE9A 4EGYA 2RV8A 4ESBA 2A5YB 3WU1B 4R1HA 1XGNA 2QLZA 1W5TA 4XSZF 2PBIA 2VC0A 1F1ZA 1E17A 5D8LB 5HDGA 1BIAA 4LK0F 1R5HA 4AVPA 4HYEA 4Q47A 4M74A 5JVTA 3HRUA 2W84A 5JHUA 3V7SA 3J80Z 1PDNC 1B1BA 5DUKA 2KIMA 5BPDA 5F1RA 4I7HA 2UXNA 1IRGA 3COAC 1PP7U 2F2EA 1YW8A 2L54A 1UHMA 2DPDA 1OR7A 3D0SA 1FBUA 4ZYGA 1I5ZA 3Q9SA 1DPRA 2EV5A 4L9TA 1EH6A 4HX4A 4G7ZF 4N9HA 3ULQB 2LDUA 5J6XA 2YX7A 3LQRA 2GIVA 5J8CA 3FMRA 2V79A 3K9TA 2F5DA 3GYHX 1QQIA 2IP2A 3P9IA 4CGZA 2A6HF 3J81Z 5CJ9A 2EA2A 1BN5A 2ZMEA 1PUEE 3B73A 3IKVA 1J0RA 1T98A 4BH9A 2GQQA 3I5UA 2D2WA 3TOBA 5ILUA 3KP4A 4RGXA 2DQLA 3GVAA 4AIHA 2VT3A 2P5LC 3QRFF 1FP1D 4HW0A 4U0VA 3CUQA 1SFEA 2MBFA 4D0PA 3IRQA 1YIOA 3R60A 2FQ3A 2EFNA 1ULYA 5DCMA 3N4MA 3E5QA 2PMUA 2H6BA 3V8LA 1IN4A 4P9UA 1FP2A 1G3SA 2HS5A 4MQVA 5DV5A 3P9KA 5HS9A 5K5QA 1R5GA 1P6RA 2CO5A 1F4KA 2MLKA 3TDZC 2KJCA 2VONA 1D3YA 2V6CA 4LD5A 4LB5A 1YW7A 5CVRA 3FHZA 3QPTA 2KIUA 4OU0A 3HTUA 4N0BA 4E70A 2HGCA 5JI6A 1JE8A 4QWQA 2FE3A 4FX4A 4U7BA 1J7KA 2BYVE 4AD9A 2YX4A 3FF5A 2X4HA 2E1CA 1S3JA 4PZJA 3ZN1A 1ZARA 3GZ6A 4ETSA 2F5CA 5LHHA 4MEYF 1XCVA 2PI0A 4KMFA 2VT2A 1D8JA 3EUHA 2KIFA 5IT9K 2OAZA 3KETA 3JTHA 5DYMA 3WTVC 3T8TA 1ZAOA 3ZMDA 1AWCA 4WK8F 5JR3A 5K5RA 1Z6TA 4L9VA 2QZ8A 3F8MA 2NYXA 2XAHA 2HKOA 5ICGA 2EV0A 4KIGA 5D8KB 1IRFA 1ZGAA 1SFXA 4RB0A 2O3FA 2A69F 2W57A 1KA8A 3R6SA 3RYRA 5CLSA 2NNNA 2QWWA 3IHUA 4LLNA 1IN5A 2YU3A 4OIOF 1YFHA 2DK8A 2XRNA 1D5VA 4OMYA 5ICFA 3ZN0A 2XAQA 4A0XA 2P5VA 5ICEA 4GCVA 5CVJA 4R8HA 5DD4A 1SFUA 2GXBA 1T38A 2HYGD 1H0MA 5FFZA 4LJZF 4KFCA 4MQ9F 2ISZA 3ZMVA 2H27A 3FZVA 5F6FA 1KU2A 1K6OA 4M6YA 3TKYA 1Y0UA 1YS6A 2VOPA 2HQRA 3WGGA 5ERIA 4OIQF 1MZBA 1BBYA 2FNAA 1TQIA 4GGGA 5J8FA 4Y15A 1KU3A 4EV0A 4ENKA 1XSXA 5LLQA 2RVCA 3C7JA 2EK5A 1FZPB 5HLHA 3QU3A 5FD5A 1K78B 3F21A 3E97A 2XUBA 2XKOA 4AWXB 3HIFA 5AIPA 3ML6A 4ZH4F 2RQPA 4KICA 1U8RA 4ZYDA 5LRRA 4QLCU 3EQLF 3O3KA 3TDUC 2EFWA 3I0TA 4IHSA 4MNUA 2X0LA 4A12A 4A0YA 2CSOA 3EDPA 3BROA 3WU0A 1G4DA 2WTEA 2QBYA 5D4SA 2OQGA 1YTYA 1JXSA 3KLOA 2EJRA 3LQQA 1P4XA 5DUIA 2GAUA 1QZZA 2Q0OA 3QU6A 4LK1F 2M30A 3MAJA 3GLXA 3SQNA 3MQ0A 4KIBA 4P5OA 3F6OA 3GEZA 1IAWA 2XKPA 1L3LA 1XN7A 2ZKZA 1UFMA 1Z7UA 3W6JB 4B8XA 2L4MA 1BI0A 4M71A 2H6CA 2ZJ2A 2E1NA 2DFIA 1J9IA 3JAMZ 1TBXA 1Z1DA 4PCQA 3ZQ7A 2P8TA 3RKXA 1Z05A 1OMIA 1Z91A 5L3CA 3LSTA 3E6CC 1MD0A 1I27A 1USSA 1P4WA 3J81K 3BPXA 3ZP5A 4EQQA 1SD6A 4AIKA 2R3SA
chains in the Genus database with same CATH superfamily
3TP3A 1ODDA 2OZUA 1SAUA 3LAPA 1YS7A 3H1CA 4X6AJ 3AG2H 1U5TC 4KJZA 4CH7A 2I10A 1G3YA 4GDFA 3J7ZI 1Z3XA 4A2UA 4M3BA 1LE8A 4W1UA 1SD4A 2Y31A 4LIVA 1A6IA 3G1MA 2JPCA 2KISA 3SHFA 5KK1A 3BZ6A 1LJ9A 1R7JA 1ZREA 2EV6A 5ED4A 3WTUC 2QQ9A 5KVRA 1X19A 3L09A 4ZYHA 1DU6A 1OKRA 4XLHA 4TV7A 1XMKA 4RAGA 4PSXA 4X0GA 5IT3A 1ZRDA 4I02A 1DDNA 3WODF 3CDLA 1RI7A 2DI3A 1HBXG 3ONQA 3WTTC 1IN8A 5D5XB 3GTGJ 3LSIA 3BR1A 4EJOA 3SJMA 2K86A 4F91B 3I4PA 5DS9A 2JA2A 1S5LC 4U0YA 3OOPA 2VODA 3GZNB 1J09A 5D6EA 4MTDA 1MIJA 2M3AA 3B6CA 1YQAA 2M5WA 1S9HA 2K40A 3E3VA 3K0LA 5E1WA 5EF6A 4YRVA 4BE1A 1U78A 3CMMA 4QTRA 3S93A 1G3WA 2NAZA 5EG0A 3M7GA 4RB1A 3OSGA 2COBA 1D1BA 5FJ8J 2DOEA 3CLQA 1YJWI 2FBIA 1PUFA 4YFXF 4UHTA 4E4HA 4ESJA 3EUHC 1FLIA 4ZZLA 2LF8A 1KZHA 1V5FA 1APLC 2DDBA 4DYRA 2CQ7A 3RKYA 3MKWB 1AKHB 2STTA 1LFBA 2LG4A 4BXUA 2MGQA 1OQYA 3D5RC 4EJUA 1MDMB 3VYRB 5B66C 2E1OA 3MEXA 2A68F 2I8DA 3ASOH 3JSOA 1SVMA 3RKQA 2Y9ZA 1T33A 2Y30A 4H0EA 4D7MA 3ERED 1TWCJ 1NK2P 1GXQA 4MTEA 2WV0A 2UWMA 1Z9CA 2QYOA 1RNLA 2JK3A 1XC5A 1E3OC 2LY1A 5BS6A 3ISPA 1RUNA 1JI8A 2HZTA 2ZFWA 4XBFA 1ZRFA 2K02A 2K9QA 1F9NA 3GUDA 4IL6C 1O7FA 1B59A 3FBIB 2PEXA 3CJTB 2Y75A 2NVUB 3E6MA 4MFDA 1I1SA 2XHKA 3QPLA 3ZMTA 4B3XA 1ZLKA 1FTTA 3BTCA 4DZJA 2ACJA 2IVMA 3CZ6A 1UG2A 2HQNA 2IPQX 4HV6A 2PFBA 1IO2A 4XLNF 3LSJA 4IOAF 2EWNA 1L0OC 2UZKA 1RZ4A 1YW9A 2H09A 2H1LA 4RGRA 4A69C 3K1PA 3DU6A 2DA3A 2YPRA 3QODA 4BUPA 2LSOA 3L2VA 4DBRA 2GA1A 3LSRA 4A3MJ 3IL2A 4AM3A 4A3DJ 4CCMA 4GXOA 2B9SA 3OSFA 5J1YA 5EGOA 2EFQA 1PP8F 2O03A 4IRHA 1LQ1A 3FXQA 3HHHA 1OISA 1SEUA 2QENA 2NS0A 4QIWN 1VTNC 5ILVA 1R6RA 2HEOA 2M34A 4O5VA 4BQOA 3G6EI 4M6XA 3DPLC 1HF0A 3QOEA 4HZFA 2B0LA 2V9PA 2IA2A 3K6GA 1X1PA 4L0YB 3BR2A 2R0QC 2TDXA 2V7FA 5HVQC 2X6YA 2LKPA 1SAXA 2L9NA 1V4RA 3G2BA 3AG3H 1WI3A 1Z77A 3S1NJ 3KZZA 3GBGA 2ELHA 4I76A 4WXHA 1TNTA 3CDHA 3U9GA 2GXGA 5ICCA 3BTLA 3K4MA 2IGMA 2L9SA 2OQRA 1B72A 3SXYA 2V1XA 2KJBA 1IXCA 4ZDLA 3S17J 1B9NA 1BC7C 1KQ9A 2E1MC 2W24A 2ZBKA 2VKDA 3C1DA 3QP6A 4RLFA 3RPQA 1LPQA 5E20A 2QUFA 4I2OA 2KRFA 2LP0A 1SFOJ 3IC7A 1REPC 1FJLA 5DM6F 3ZQLA 3ROUA 1JHHA 4KDPA 4DQ2A 3T5XA 1YJNI 4BAYA 4BGDA 1X58A 3MKZA 2K9MA 4NB5A 4HDUA 4CYCA 4EJTA 3SDBA 4ENJA 4RA2A 4XLAA 3SZTA 2O7OA 1T56A 4GFBA 4IJAA 3QYBA 4S04A 2R93J 4CCOA 3DV8A 2HVRA 3A4CA 1HW1A 2IJLA 5TRDA 3PUFA 4UVCA 2JA8J 3HSEA 2VE8A 2LY9A 5A2QK 1ZG1A 2DA2A 4YEJA 3MKLA 3CESA 2W00A 3JCUC 5HDNA 2VBZA 2GZWA 4XSXF 2WB1A 3RIRA 3OIOA 1W5CC 2A3SA 2X1DA 1VQ9I 2TCTA 3VPRA 4M73A 5FGMA 2IA0A 2L02A 3GTOJ 2DK5A 4IF4A 4OINF 1AHDP 3SYTA 2LOOA 2V9VA 4A3EJ 3NAUA 2XV4S 2M4KA 2XPWA 1J2XA 5F27A 4RB3C 1U2WA 1R1TA 1O7LA 2XROA 4D5FA 1GHCA 4XLCA 2V9KA 3KP5A 5LGTA 1POGA 2FX0A 1UB9A 1UG0A 5D5WB 3BQYA 1P4AA 5FLXK 3SZGA 3G1OA 5LEKA 1OCPA 1LVAA 3P7NA 3KFWX 1XCBA 5F08A 2NVYJ 2EH3A 3G73A 1SD7A 1TQPA 4G9YA 3KEYA 2LKSA 1KGSA 2XASA 4L9JA 3RYPA 3DBRB 3VYUB 5FD6A 1HC8A 3ZOBA 2GWRA 3NEUA 3I59B 4CZZA 1Y6IA 4YFNF 2P5KA 2MA3A 3J7AO 4BACA 1Q1HA 5B5EC 3OYIA 4L0ZB 3DWLE 3LSHA 2LK2A 2WBMA 4X1EA 2EA4A 4K2EA 2FNPA 1MMNA 4JYKA 5K1YA 4JBAA 3CP2A 4PFOA 4Y52J 2IXSA 4PGHA 4IZZA 1YG2A 3H0DA 1GV5A 1QHGA 3HOSA 3VSLA 3TEDA 4A3FJ 2NOJB 4EM0B 4PSWA 4Q48A 1BR2A 2BY1A 3H92A 3WTZA 1LUJB 3IRRA 1BOAA 1AOYA 3PQKA 2Z1DA 4HDVA 2VXDA 2STWA 5GAHJ 4HRIA 4UVAA 2HZDA 4HOBA 3F8BA 1FT9A 3AKZA 3M8JA 1BL0A 3VYSB 3I64A 1WCMJ 2V1UA 1X1BA 2FA5A 3LWFA 3OYNA 1QGPA 3HSFA 2RDPA 3DKYA 1ONVA 4UUSB 3CTAA 3ABTA 5FLMJ 3BQZA 2ZNYA 3F8FA 5H20A 5EEGA 1WJEA 2MW8A 5ILSA 1B8IB 1MMAA 2BE5F 3HYIA 3HL2A 3CUOA 3TP0A 2DQRA 1QA6A 1NHAA 1LDDA 3IWZA 1R4MB 4ITVA 5E3LA 4XKWA 2Z99A 1CF7B 1BA5A 1ON2A 3RJPA 1TWHJ 2L01A 4I98B 3ECHA 4CXFA 2OTLI 5CVIA 4OWRB 3CF5F 1U3EM 2KHMA 1ETWA 3KYDB 1K78A 4M3FA 2EZLA 3L2CA 2XC7A 2ETHA 2RC4A 4J01A 4MLOA 3VWBA 3KP7A 2QGUA 3DEWA 4OAYA 1OPCA 3WTYC 2X51A 3HOUJ 2M8EA 4U7DA 4N4OB 3PM1A 2LD5A 1WH5A 1BR4A 4L5JA 3IH2A 3HPGA 3HC7A 2BEOA 2X48A 2JJ7A 5CYVA 3A02A 4ESFA 2RKHA 3M9AA 1T08B 1ETXA 5B1BH 1GVDA 3FM3A 2P6TA 2LC2A 2JSCA 2JA7J 3I71A 3V8JA 4S05A 3HSRA 1MW7A 2CFXA 2ZXWH 1F5TA 4BY7J 4YELA 3L2UA 3M8FA 1O3QA 4B44A 4BQAA 2QSFX 2IA1A 1T2KA 3CCSI 2Z33A 3C2GA 5E3NA 3IWFA 3L9FA 4XKCA 1X1DA 4XOTA 5IP9J 4HNVA 4OOIA 1U5TB 4PJJA 2CQQA 1V3FA 2E7WA 4PJNA 5F0FA 4CCJA 3CO6C 1G3TA 1TW2A 3CCYA 1Z21A 2JUGA 3A2KA 3P9CA 2VASA 5FFXA 2O8KA 1ZR2A 2DA6A 2B7EA 4QPQA 4C9YA 1RETA 1I3AA 4G6QA 3DKWA 4WWCA 5FO5A 3FM5A 2DA5A 2VIXA 1ZKGA 2ECCA 3BC8A 1YITI 1FOKA 2OJED 4XMYA 2D1HA 1USTA 5L3DA 3HOTA 1FEXA 1OYYA 3EUKL 1ZG5A 3HRSA 4OIRF 4A3IJ 1FYKA 2IW5A 3F8CA 5M5YJ 5D6FA 1WKMA 2VLAA 2DYSH 1U9NA 1IN7A 2VBWA 3P5JA 4ENMA 1YHQI 2NS8A 2Z3YA 4KYWA 5C4XJ 1I39A 5B3SH 3MMYB 2QA4I 5JFRA 1FWZA 2PN6A 2FU4A 3S1MJ 1LB2A 4O3MA 4G8XA 1QZEA 1ZTRA 4V2FA 2L9VA 1ZK8A 2JZYA 5EJCA 2DTZA 1HXDA 1NG7A 4NQWA 4BXFA 3V7RA 1F36A 4M6VA 1BI1A 5J1RA 2HOEA 3WE3A 3KEQA 2NVXJ 3REOA 1S7OA 4FTHA 3WGHA 5J40A 2LLKA 2K4JA 4I09A 4IQJA 4ZDPA 5LFAA 1VQMI 3W3CA 3G4SI 2OV7A 1RC9A 2Z5UA 2VXZA 3J7YJ 1DP7P 3X2QH 1OYWA 1Y8QB 1K4SA 2COMA 2LRDA 1QVTA 4G12A 4ON0A 4YIFA 3K70C 5J4VA 2Z9OA 3I58A 1K6YA 1WFXA 4BL0B 1GVJA 1O3RA 1IXSB 2VJ4A 4HG2A 4ZDOA 1NG6A 2ICWG 4KA4A 1M1EB 3KX2A 1S7EA 2LTPA 3BG7A 1RKTA 2XGEA 3R0JA 3CC7I 1LFUP 1WRJA 2OF7A 2PJRB 5IOZA 5LGNA 3GFLA 3K4NA 3ZMSA 4WXCA 4ZC3A 4KT6A 3T0YA 4BY1J 3GXOA 1LFPA 5L3GA 3J80K 2E71A 5GAEJ 4IRIA 2FUG2 3HKZA 4LGWA 2PQ8A 1E0EA 4XN0A 4LLGF 4Y3OA 4A3CJ 3VOEA 1QBJA 3CO7C 2QSHX 3PSFA 2RNGA 2FBHA 5M5XJ 4WX9A 2Y2ZA 4KN7X 2XDVA 2KIQA 2CV1A 1AU7A 2LR8A 3JRHA 2F4MB 3WG9A 3M1EA 2QF7A 4AIJA 1FMWA 3QAHA 2HDDA 1Y39A 1IV8A 2HVSA 4V2GA 1T6SA 2F4OB 1MGTA 2W85A 4Z2YA 2UV1A 2GXAA 1R58A 4BU2A 2MG4A 3MFKA 2HOSA 2BZTA 2PX9A 4RAZA 1MMDA 1TT5B 1R1VA 3LAJA 2M45A 3ZMUA 4B3AA 2V1NA 2W7NA 3LNQA 1JGGA 1E2XA 5EZGA 4F52A 3QWLA 2F5VA 3S8PA 3EETA 2DA7A 5CVUA 5DTDA 3E0JB 2JMWA 2HYFA 1BJAA 2XGDA 4KUMA 1XG1A 1DGRM 3HRMA 1J59A 2HFHA 2MC3A 2HYJA 1AKHA 3PFIA 3FIWA 2L3DA 4LITA 4MGRA 4PJLA 2DTRA 4GYGA 3F22A 1MDMA 2ZMEC 3BCAA 3B02A 1VQ6I 2QSGX 1QVUA 2E2IJ 1JKRC 2GOMA 3ZR8X 5F0CA 5GADJ 3K2ZA 4ASNA 5IYCJ 5DM7F 3BZKA 2DO7A 2LNBA 2Q2EB 2XB5A 4OMZA 3L2QA 2L7MP 2E1MB 3Q5FA 4CDGA 2DYRH 2M8GX 3TBIA 1P92A 4D9JA 5IT9Z 3VSKA 2R7QA 1SD5A 4IKFA 1FBQA 3JRDA 3CMEI 3KP6A 3FWEA 3DLLF 2VB6A 4PK4A 4AVZA 3WTXC 2K5CA 3FXKA 5E8IA 1ZRCA 2ZXJA 3KCCA 1NH3A 3CUQC 4PGGA 2VKHA 5M5WJ 2O8XA 4UV9A 2DMPA 2W25A 3V4GA 2WY7Q 4XRSG 3I3LA 4A93J 2DMUA 3TGNA 4CO8A 1TTYA 1MBEA 1BC8C 3AFHA 5BNGA 4S0HB 2O61A 3C3WA 3DP7A 2FOKA 4YFKF 1FOXA 2KQRA 3ZMZA 1W5SA 3CCRI 3AG1H 6PAXA 4BHBA 3RI4A 3L7WA 4IO9F 2RREA 3M3YJ 4HV5A 2AQEA 1X2MA 3RDIA 3HHGA 3E6DA 2VL8A 2JRMA 3V8KA 5HDKA 3HBLA 1WZ2A 3LFUA 1IZ1A 1IW7F 3SEQA 3OYDA 5IYDJ 5CKTA 4CZCA 1MJBA 2W1OA 4M9XA 1FC3A 2D1VA 2EPFA 4U88A 3KIOA 2Y48A 1KYZA 1WJCA 3ESWB 4LB6B 1I3QJ 2QM3A 4B4CA 3DPUA 3I54A 4HA8A 4XM3A 5KAIC 1J5YA 1T8IA 3DBHB 4EVIA 2EFPA 1RR7A 4XK4A 4XONA 2ZSHB 1XTAA 3IH4A 1V5GA 3R61A 4MFEA 4F3QA 5JLXA 1WI9A 2BXZA 4FASD 3BT9A 4MHGA 1K7AA 2KFDA 2ZJRF 1DGWY 1XPXA 2B63J 2DU9A 1MH3A 1BIBA 3S1RJ 2HVQA 2JT1A 2RGVA 4NHJA 1MJ9A 3OL4A 3HUGB 3K1NA 2HOAA 4FCYA 3IH3A 3NWTA 3TO7A 4HNTA 4I01A 2HQAA 1VI0A 3IUOA 3MCZA 4DGWB 2M7AA 2D45A 2WC2A 3F72A 2ESNA 2BY2A 5HLTA 4ZYEA 2ID6A 4Y17A 2R7FA 1DUXC 3LSKA 2AS5F 5D4RA 1LDKB 2Y0SA 5LGUA 3CCMI 3JRBA 1VQNI 3GW2A 3LA3A 4RDUA 3FKIJ 2IGNA 5HODA 2Q8KA 1I1GA 1HLVA 3ZQFA 2R5YB 4XL9A 4BBRJ 2P7VB 4CCNA 1SMTA 3ELKA 4KNYA 3Q0VA 1WPKA 5FKMA 3BR0A 1BI3A 4PDKA 1WJ5A 1QPIA 3DTEA 2FXAA 4E7KA 3I56I 3MZ8A 3S3OA 1MKMA 2M9HA 3H3VK 2R7XA 4XLPF 2K9NA 5BMZA 4UXNA 2CUJA 2R7SA 2HKXA 1DPUA 3F23A 3O6BB 2K4BA 2CQXA 3H3UA 3DTKA 1Z67A 2BV6A 1IN6A 2DCEA 5TJJA 1S7AA 1FNNA 1UHWA 1B6AA 1W7PB 1YO5C 5L3FA 3F6VA 2OU2A 1ZYRF 4EM1A 1DP3A 3W6VA 5FKLA 1ZG3A 1FSEA 2CUEA 2CW7A 3LA2A 4JX4A 4B43A 2VOOA 1UMQA 3RQ4A 5HOOA 2CGPA 4LMYA 4BDYA 1JT6A 4NC7A 2CJJA 2E35A 1R5ID 5LRSA 3FISA 4I0BA 1KU7A 3BDDA 2AHQA 2IT0A 1EH7A 2CMPA 2JRTA 3I59A 1YRNB 2DFHA 4FT8A 2UUZA 4BNCA 1EH8A 5F1JA 2P0WA 3FXOA 3BTIA 3KPHA 4I0AA 2CWEA 4Y13A 1KU9A 3JR9A 3PL8A 3D1NI 3GTLJ 2DDAA 5DD8A 3S32A 1A36A 2XAGA 1IF1A 4HF2A 3PNTA 4U0WA 1GXPA 1PJRA 1ETKA 4AIDA 3OIQA 2KT0A 2W4SA 3GFJA 2P7CB 3E5XA 2LF7A 3GWZA 3QP5A 5H6RA 4LG0B 5DDGA 1I50J 3S3MA 1TWFJ 1BI2A 1N25A 1ZN2A 4HQMA 2IBDA 4UV8A 2ZC2A 5D5VB 5D5UB 4G7OF 4D1QA 2K85A 2WV1A 3OYHA 5BPIA 3CC4I 4RGUA 2DT5A 2LREA 3KZIC 4ZYAA 3NRVA 4UNOA 2QCOA 3BCBA 3TW7A 4KMUX 4WF2A 3VFZA 1FTZA 1TC3C 2VQCA 2XAUA 3KP2A 2IS2A 1E3PA 1MMGA 3WE2A 1G2HA 2JWTA 4RAFA 4V19K 4UB8C 3MZYA 4IXAA 4FX0A 4C2TA 3TL4X 2XRLA 2RNJA 3SFIA 1B4AA 2DMTA 3BP8A 4IOCF 2K3PA 4UUSA 4W97A 2CYYA 1FMVA 1ETVA 5LBQA 2EZIA 4UUVA 1B8IA 2GM4A 2F5EA 2MFZA 2VI6A 1MJAA 3W6KB 1IG7A 4A6EA 3M8EA 5J1UA 1X3WB 2FQ4A 2DW4A 2QVOA 3AL0C 1W7PD 1CF7A 4XR6A 5BQTA 4XIDA 1T39A 3HZJA 3GCMA 5KCMA 2BOLA 4HBLA 3D5LA 3DFGA 2G9WA 3OYEA 3WGIA 2IS6A 4RS8A 3KLNA 2C6YA 1T95A 5E17F 2K27A 1H9TA 1LKXA 2DAOA 2EZKA 3FHNA 4ENNA 2XGCA 2FD5A 3F0CA 3OYBA 2AXLA 2HOTA 1UHSA 5K5OA 1OLTA 2DLLA 3E6BA 4UB6C 4WXDA 4ZTJA 2ESHA 2F4IA 3CDIA 1FPQA 4XRSA 4A3GJ 5L3EA 3AAFA 4PFPA 2O0YA 2MLGA 5KAFC 2J5OA 5J47A 3QYEA 1JUSA 2E19A 1U6GA 2K7LA 3H5AA 1H8AC 4BBSJ 4OIPF 3KE2A 2G0EA 3BWGA 4LFUA 5EEAA 1YX5A 2ID3A 3OR2C 5GTIC 3PNVA 1QZYA 3K4KA 1XMAA 4NC6A 1JUMA 2F6CA 2V1DA 1JJ6C 2HNHA 4R79A 4A5MA 3Q3SA 4G94A 2VN2A 2CV0A 2FJ1A 1ZHFA 2CW0F 1U5TA 3QPSA 4RGSA 4F7ZA 1LDJA 5EEHA 1R22A 2F5FA 3DF8A 4IPAA 2ELKA 1TWAJ 5LEJA 4BE2A 3FDYA 1QHHD 3RPUA 1BR1A 3LA7A 4C3IJ 1NTCA 4XN3A 1I6XA 2ADUA 3K1MA 3K4LA 1IXRC 2DN0A 4IHYA 4RLQA 4JOMA 2JA6J 1KQ8A 4P9FA 1QPMA 3BR6A 2XPVA 5K7ZA 2NRAC 3DTIA 4YIRX 1MBFA 3DLAA 3JRCA 3JSPA 3O2PE 4IHTA 3UR3C 2R7TA 3CP8A 2VKVA 3CF2A 1A31A 2NOGA 4YIIA 3A0HC 4KISA 2FMYA 3GFMA 1RUOA 5HLGA 2EFOA 3F3XA 1XGSA 2Q1ZB 3FXUA 3MN2A 2L7FP 1ENHA 3N05A 5H6QA 1MH4A 3C2HA 2ISYA 1B9MA 1SFKA 2OUMA 2R4GA 2BBYA 3VB2A 3GX4X 4PUSA 4HX8A 5K7FA 1C0WA 2OD5A 5F04A 1G59A 2PJPA 4I6ZA 5M3FJ 3KEOA 2VC1A 3JAMK 1HSJA 1R71A 2OBPA 1QNTA 1VF9A 3HDDA 1ON1A 3ZQHA 2VQHA 1JKOC 3RCOA 3S2DJ 4A0ZA 2R7VA 2WWYA 4IVNA 3VYTB 5HS8A 1MSFC 3SFZA 1WJDA 4NUBA 3T1BA 2MH2A 1TP4A 3WHBA 3CCJI 3NQOA 2VBYA 2DMQA 2EIMH 2FEZA 2ZMEB 2DBBA 3TOAA 1SC7A 2CQKA 3K70D 2H94A 3HJEA 3LFKA 2ZSIB 1Y0NA 2HDCA 2EIJH 3EYYA 3B6AA 3OOUA 3DQVC 4HLXA 2UXXA 3HOWJ 1JGSA 1LEBA 3U21A 4RBOA 5IPAA 1ZH5A 2PMHA 1HA8A 2CV2A 1O57A 3FBNB 1R00A 2DXIA 1F43A 1GLNA 1FSHA 4I99C 2HXIA 2XAFA 3PIOF 1WH7A 3JRGA 2PJRA 5IY5H 3FXJA 4IX7A 1FOWA 1XB4A 4L9NA 4M9SA 1IDYA 3BG5A 2R7UA 1FIPA 4CICA 3CUQB 4QPOA 4A6DA 4A3KJ 1JUPA 1TNSA 2X1EA 2JA5J 2GA2A 4P96A 4B1RA 1GV2A 2BVMA 3A03A 3HRTA 1A35A 1STZA 1CQTA 2MH9A 5DCMB 1IJWC 1R1UA 1OYIA 3HEFA 2L7ZA 2P6SA 4HNUA 1VQPI 3MVPA 5E79C 1BW6A 1Z0XA 4BE0A 3C2BA 3QOPA 1HDDC 2A07F 3A1YA 1VZ0A 5C44J 3CCUI 1YE9A 4KN4X 2M0MA 3TQNA 4MEXF 2IRFG 1XGOA 1S6LA 1BW5A 4JQFA 3A01B 1YLFA 2K9LA 1QO0D 2BGCA 2XPUA 4XOPA 4HLYA 1BM9A 3WTWC 2HR3A 2HTSA 4XLFA 2CQNA 2ZFUA 1XDSA 1XDUA 3PIPF 5L3BA 4EMSA 3JRIA 1XSVA 3R4KA 3FXRA 3RQIA 1RPWA 5E1XA 1O3TA 1XD7A 1MBKA 2J5PA 2P4WA 3GO5A 3SZPA 3ZCOA 1HCRA 4CHUA 3C18A 4EJVA 2LYCA 2RN7A 1LNWA 1YYVA 5CPRB 4HSRA 2H8RA 2KRCA 1JJ8C 3GF2A 1D8KA 5GPAA 3ZQQA 2XSJC 2VJJA 4HQEA 4A5NA 5J3LA 1XSDA 4B09A 3I53A 3DPTA 2CG4A 2R5ZB 2Q2EA 1Y56A 1MNMC 1V55H 2A61A 1HKSA 3W2WA 3WU2C 4UY8I 5IYBJ 1Z7LA 2K9SA 4U87A 1YJ9I 4Q4ZF 3CCQI 3H5RA 2IS4A 5TGTA 4PJMA 3TO9A 3VEPA 4ABZA 5A2QZ 2JN6A 1P9QC 4ZJZA 5E1ZB 1G6NA 1FYMA 2RAEA 4BYYA 1O3SA 3ABLH 4L5IA 5IOYA 3JRFA 3PNYA 1TQMA 2Y9YA 2PLYA 3CCVI 2K3FA 4GYIA 1EV7A 3GZ5A 1Z6RA 3GLLA 3H5NA 5DEQA 3BOQA 5AONA 4DW6A 3CJNA 3ZQIA 1R36A 3BY6A 1X3UA 2ZJQF 1VQ8I 3WTSC 1N77A 2V4JC 2VPLA 2ZCWA 3FXLA 3JTGA 1SMYF 3EUAA 1W4MA 4C2UA 3RZOJ 4E7SA 5J4YA 3PUBA 1HKQA 1PYVA 2EB7A 4WCGA 3K4JA 1DU0A 3RZDJ 3DBLB 1FIAA 1SVLA 2YU9J 1WJFA 1Z3YA 5FLXZ 4XKBA 5CVVA 4HAMA 2GIZA 4RAYA 3HGYA 1A6QA 3GTPJ 1HSTA 3U1KA 4IEJA 1S29A 1JTXA 1WVRA 1WGXA 1K79A 3T8RA 3CLOA 2FRHA 2A6EF 1VQ5I 1OCOH 2MD5A 4IRGA 4AYBN 4DIQA 3ABUA 2OA4A 1TT0A 1CGPA 2VBXA 1VNDA 2O5RA 2FBKA 3CQZJ 2EZHA 2HWVA 1XX5A 2CH0A 2DOAA 2QQAA 5H2FC 5JHFA 3Q0UA 1TLHB 3S1QJ 3Q9VA 2XF7A 4HF1A 4JK1X 3BG9A 1KYWA 1J75A 4G7HF 2M2EA 4LIUA 1XS9A 2AXTC 4QSHA 2DA1A 2R7OA 5LD2C 2P81A 5C4JJ 5CQGA 4RB2C 2QQBA 2E7XA 4ZZDA 4KIFA 2R7WA 2FSWA 1LEAA 4FHTA 2EBIA 2G7HA 1K61A 4LG3A 3HUGA 3H35A 4G6DA 4HSTA 4BHPA 4F93B 4BDZA 4M9ZA 4E7JA 5HLIA 3N97A 1HDPA 2JPBA 3S3NA 3NWSA 3CC2I 2ZO4A 3FMQA 1FX7A 1HQCA 1R49A 1ZR4A 3FX3A 1T0FA 2HTJA 3HPHA 4HX7A 4E7ZA 4CYDA 1TW3A 1G8XA 2KKOA 3PQJA 3OY9A 4LLLA 3M1CA 4N4NB 4BQQA 3E5UA 2MSYA 4CA0A 4EJWA 2OCEA 1ZLJA 2XIGA 2R5YA 3IV5A 4XLEA 2BXYA 3G3ZA 3VODA 4IQ4A 3RTRA 3U2RA 1WQ2A 5DCFA 3OS2A 4O6JA 4L18B 1P2FA 2FMLA 2G7UA 3IKTA 3KP3A 1R4NB 3ZPLA 2PMZN 4EGZA 4KT5C 1FYLA 4EM2A 5F64A 3F8NA 4IHWA 1KQ0A 1X4PA 2R92J 4DNCA 1MNEA 3V7CA 2XVCA 5FB2A 1UCRA 4P55A 2EINH 4HF0A 3TO6A 1WWXA 2DT6A 2H1KA 1HKTA 1HW2A 1W7PA 2BW3B 4CUGA 1ZELA 3KYCB 2WAQN 1W1WE 4C2MJ 1UJ8A 2R7DA 2H8WA 3GTKJ 4E6KG 5C3EJ 2M87A 1MNDA 3K69A 5LHGA 3GFIA 5BOXA 3DXJF 3OYLA 3U1DA 3MZHA 4BKXA 2BVLA 3H9QA 1GUUA 5FRNA 3KZYA 4YG2F 4DOZA 3BPVA 3BJAA 3K10A 3DEUA 2L4AA 3OV8A 1HW5A 2I5UA 1FOYA 1YRNA 2OC6A 1H9GA 1UELB 2FF4A 3DEEA 4DBQA 4BXXJ 4B47A 3OMYA 3BZCA 4UVBA 2TRTA 3BR3A 2L9RA 2YSRA 4HPQA 2X1CA 2LBFB 2QBYB 2ME0A 1S8NA 2O6GE 2OZ6A 5E8GA 3IP4B 3EYIA 2YR2A 2XGXA 4LG0A 1IV6A 3WHCA 5E18F 3FMSA 1R23A 2NNYA 2PG4A 5JVGF 5FKOA 1IUYA 2N8GA 2ZNZA 2DFFA 4CSWA 4C3JJ 3BJOA 2IAIA 4C30A 1WHUA 2E5NA 2M1BA 2XF5A 2JTVA 5AIQA 1DQUA 3BJ6A 3K4CA 2KDZA 3R0AA 3JW4A 3L2RA 4BHCA 1A04A 3FXMA 1JHFA 1GT0C 2DPUA 1IRXA 1D1AA 2W82A 1XMXA 5LHIA 2F48A 4N9IA 1RIOH 2XAJA 3ECOA 1WSUA 2L7KA 3RKWA 3OYGA 3BLYA 1MBHA 3MWMA 1R9TJ 2Y0MA 3CMYA 5E3OA 2JVGA 1FBSA 1FY7A 3QPHA 1XGMA 3M07A 1KONA 4GO1A 5HS7A 2KDOA 2CS3A 3ZQGA 1Q1VA 3QQAA 4AU7A 4J00A 1W36C 3S2WA 3BG6A 3TW6A 3HGGA 1BJZA 4ZTFA 3FK6A 4M72A 3V42A 4E7IA 3SDGA 3FKJA 3L00A 4BS9A 4XRMA 3OYJA 4Q5SF 2ZXIA 3H3ZA 3HTSB 2NXNB 4XRFA 1P7IA 4P1WA 1ZGJA 2VE9A 4EGYA 4D7NA 2RV8A 4ESBA 2LMDA 5KHDA 2HDWA 1P7JA 2A5YB 2KMUA 3WU1B 4R1HA 1EA3A 4BEHB 1YIJI 1JT0A 4BJ6C 1XGNA 2QLZA 4L5EA 1W5TA 3S2HJ 4XSZF 1U9OA 2DJIA 2M7BA 2MD0A 2PBIA 3M4OJ 2VC0A 3HB9A 1F1ZA 4Y7NJ 1O4XA 1N78A 1E17A 1U0JA 3LSMA 2KPMA 4ANJA 4M3EA 5D8LB 5HDGA 3TMOA 1BIAA 4LK0F 1R5HA 1LE8B 4MIMA 5B1AH 3S14J 2R7RA 2KZGA 4AVPA 1MMSA 3E7LA 4HYEA 4Q47A 4M74A 2MC4A 2HPMA 2IEKA 5JVTA 4NC8A 5JLWA 3HRUA 2LFBA 2EQRA 2W84A 2QQ8A 2BHZA 1E3HA 5FKNA 5JHUA 3V7SA 3GTMJ 2Y0SN 3J80Z 1PDNC 1B1BA 5DUKA 2ELJA 2KIMA 5GAGJ 5F1RA 4I7HA 5BPDA 3PFYA 2UXNA 2D5VA 1IRGA 4DYQA 2QEXI 3G71I 2VQGA 3COAC 3OYFA 3OWTA 2BY3A 2E36A 1PP7U 2F2EA 1VQLI 5GTHC 1YW8A 2L54A 1UHMA 2DPDA 1OR7A 2JVHA 3D0SA 1FBUA 5IP7J 4ZYGA 4JP0A 4BJ5C 3ZRGA 1I5ZA 3GTJJ 1MSEC 1EF4A 3Q9SA 2A05A 1DPRA 1ZQ3P 2EV5A 4II3A 2CU7A 5EG0B 4L9TA 1EH6A 1JTYA 4HX4A 2DOFA 3IAM2 4G7ZF 2X9DA 3ASNH 4N9HA 1PUFB 3ULQB 2LDUA 3H36A 1YI2I 5J6XA 2YX7A 1JKPC 2CUFA 3LQRA 2GIVA 3HG9A 2EILH 5J8CA 2NVTJ 1UAAA 1OFCX 4DJAA 5FLVA 3FMRA 5GPCA 2V79A 3K9TA 2GBYA 2F5DA 2M0CA 2CRGA 3GYHX 1QQIA 2IP2A 3P9IA 2L2OA 1A5JA 1TWGJ 5HNFA 4CGZA 3DU5A 4F55A 2X6XA 2JUCA 1OCRH 4G6TB 2AO9A 3GMEA 3CCLI 2A6HF 3J81Z 5CJ9A 2EA2A 4AUXA 4MO7A 3HOXJ 1BN5A 2ZMEA 2EIKH 1PUEE 2WA0A 4A3BJ 3B73A 3IKVA 1J0RA 2YS9A 2KRHA 5IP6A 1T98A 3I4MJ 3UNGC 5FROA 3HOVJ 2XF6A 4BH9A 2GQQA 3I5UA 3CJRB 2D2WA 5KNLA 3S15J 2WAFA 4LOCA 1IDZA 3TOBA 2GOXB 5ILUA 2BY0A 2E5ZA 3CMAI 3KP4A 4RGXA 2VQLA 2DQLA 2E34A 3L2WA 1EJ9A 3A0BC 3GVAA 4AIHA 2VT3A 2P5LC 3QRFF 1FP1D 4HW0A 4U0VA 4M3DA 3CUQA 1SFEA 2MBFA 4D0PA 2XSDC 3IRQA 1H88C 2CUZA 1YIOA 3QYFA 1UZCA 3R60A 2FQ3A 1D0ZA 2EFNA 1ULYA 3HM5A 2X6OA 5DCMA 5EGOB 3E5QA 3N4MA 5EZHA 2PMUA 4XORA 2DT7B 1RESA 2H6BA 3K7AJ 3V8LA 1D5YA 1IN4A 3H0GJ 4P9UA 1FP2A 1ACIA 5EYRA 1AA7A 5FRMA 4BQNA 2DFEA 2V6EA 1G3SA 2HS5A 2IGOA 3A01A 3GTQJ 1Y1WJ 3PSIA 2WB1N 4MQVA 3P9KA 5DV5A 5HS9A 3LSPA 5K5QA 1R5GA 1YOVB 2JSPA 1P6RA 2CO5A 1F4KA 2MLKA 3H9GA 3BR5A 1T0FC 1ORKA 2KJCA 3TDZC 1ZGWA 2VONA 1D3YA 2MABA 4II2A 2V6CA 4LD5A 4LB5A 1YW7A 5CVRA 3FHZA 3QPTA 2KIUA 3JREA 4OU0A 3HTUA 4N0BA 4E70A 2HGCA 1D1CA 3DKXA 1B72B 1WJAA 5JI6A 1JE8A 2NVQJ 4QWQA 2FE3A 2IS1A 4FX4A 4U7BA 1J7KA 2BYVE 1MBJA 3EPZA 2YX4A 3FF5A 4AD9A 1V5EA 2BHYA 2WADA 2X4HA 2E1CA 1S3JA 4PZJA 4XNFA 3W2VA 4NNJA 3ZN1A 4CCLA 1ZARA 2DODA 3GZ6A 4ETSA 2R5ZA 1RRJA 3LOCA 4JX6A 2E60A 2F5CA 5LHHA 2W48A 4MEYF 3ABMH 4CYCB 3OYAA 3WG7H 2E2JJ 1XCVA 2PI0A 4KMFA 2HQ5A 4OAZA 4PJ0C 4DZPA 2VT2A 2Z16A 1D8JA 3EUHA 1RR8C 3JRAA 2KIFA 4A3JJ 1QU3A 5IT9K 3OYKA 2VKEA 3L1PA 2A5WA 2OAZA 3KETA 3JTHA 1X2NA 5DYMA 3WTVC 3T8TA 1ZAOA 2VUMJ 4XICA 2JQ7A 3ZMDA 3ABKH 4J19A 1AWCA 3NARA 4KITB 4XKVA 1X1CA 1OJLA 5FKKA 1S72I 5E3MA 4WK8F 5JR3A 2VJ5A 5K5RA 4HEA2 1Z6TA 4L9VA 2QZ8A 4FE7A 3F8MA 3LL7A 2NYXA 1ETQA 1K83J 3VDXA 3KYLA 2ECBA 1VQ4I 2XAHA 2HKOA 5ICGA 2EV0A 2VPRA 2Y69H 3OIPA 4KIGA 2LVSA 5D8KB 1IRFA 2RQQA 1ZGAA 1ETYA 1SFXA 5M3MJ 4RB0A 1YX3A 2O3FA 2WY8Q 3AG4H 1D0YA 2A69F 3LSGA 4XQFA 3J7AY 1NK3P 2W57A 1KA8A 2L0KA 1ERDA 3R6SA 3RYRA 3W2AA 5CLSA 3HOYJ 3OL3A 2NNNA 5EDNA 3UKGA 2QWWA 3IHUA 4LLNA 1IN5A 2KL4A 2YU3A 3G1LA 4OIOF 1YFHA 2DK8A 2XRNA 2MYSA 1D5VA 4OMYA 3CJQB 9ANTA 5ICFA 3ZN0A 2DA4A 2XAQA 2P5VA 4A0XA 3F9KA 4GCVA 5ICEA 2GLOA 5CVJA 4R8HA 5DD4A 1SFUA 4RMNA 4EEFG 2GXBA 5HNHA 4RM3A 1T38A 2HYGD 1H0MA 3IAS2 5FFZA 2HPIA 4LJZF 4KFCA 4MQ9F 3SEZA 2ISZA 3ZMVA 2H27A 1LVKA 3FZVA 4M3GA 5F6FA 1KU2A 1K6OA 4M6YA 3TKYA 1ITYA 3PO3J 1Y0UA 1YS6A 4JX5A 1IC8A 2VOPA 3HXLA 2V26A 2HQRA 3OYCA 1IUFA 3WGGA 3OS1A 5ERIA 1Y8RB 1VFCA 3PJRA 4OIQF 1RKWA 3D5SC 3O8HA 4IHVA 3DCFA 4A3LJ 4IHXA 1MZBA 1OCZH 1BBYA 2FNAA 5GP9A 1TQIA 4GGGA 2NS7A 4C3HJ 5J8FA 4Y15A 4AYBA 1KU3A 4EV0A 2XB0X 4ENKA 4D5CA 1XSXA 5LLQA 1BOBA 2RVCA 1H89C 3PO2J 1HOMA 3C7JA 2EK5A 3LMMA 1FZPB 2AQFA 5HLHA 2QKLB 3QU3A 3ZXSA 2ZXHA 4FETA 1I6HJ 2CW8A 5FD5A 4B48A 1K78B 2Z2SB 1OCCH 3F21A 3E97A 1WJBA 2XUBA 2KZVA 2XKOA 2HI3A 1W0TA 3ERMA 4AWXB 4BJTA 3HIFA 5AIPA 4NBQA 1IGNA 1V54H 3ML6A 2BW3A 4ZH4F 2A6TA 2RQPA 2R7ZJ 2OCCH 3OS0A 1VQOI 3I55I 2L5QA 1MBGA 4KICA 1U8RA 3E1SA 3H9JA 2QKMB 4ZYDA 5LRRA 3CD6I 1VQKI 1D0XA 4E7HA 4FISA 4QLCU 3RPUD 3EQLF 3O3KA 3TDUC 2EFWA 3O8GA 3RSNA 3FK7A 4E7LA 1OCTC 3I0TA 4IHSA 4MNUA 2X0LA 4A12A 4A0YA 4FE4A 3K4BA 2CSOA 1Y1VJ 2VJIA 2KP6A 3EDPA 4NDLA 2FOWA 3BROA 4CCKA 4FQGA 4UUTA 1JKQC 3WU0A 2X85A 1SVOA 4AC0A 1G4DA 4Z6YA 1OR7C 2LBFA 2WTEA 1QRYA 4GRIA 5D4SA 2OQGA 5CQEA 1YTYA 2QBYA 1IRZA 1JXSA 3K2AA 3I4NJ 3KLOA 2HXOA 1SANA 2PMZA 2EJRA 2E2HJ 1PVEA 1U8BA 3LQQA 1P4XA 4DYCA 5DUIA 2GAUA 1QZZA 2Q0OA 3QU6A 2CFOA 4LK1F 2M30A 3MAJA 2ZJPF 3ZGKA 3GLXA 2LY2A 4Y33A 2DMNA 3MD2A 2KLOA 3SQNA 3MQ0A 4KIBA 4P5OA 3F6OA 3OYMA 3I9V2 4RM2A 3GEZA 2WAEA 1EKEA 1IAWA 2XKPA 1L3LA 2WAQA 2HU9A 4H4KC 1XN7A 2M4GA 1X4OA 2ZKZA 2ME6A 1UFMA 1Z7UA 3W6JB 4B8XA 2L4MA 1BI0A 4M71A 1W36D 2OTJI 2X6WA 2H6CA 2ZJ2A 2E1NA 5TISC 2DFIA 3BG3A 1W0UA 1ETOA 1K4TA 1J9IA 2LKXA 3HKZN 3Q0WA 5K7HA 3JAMZ 1TBXA 1VQ7I 1Z1DA 3BTJA 4NQWB 2LH9A 4PCQA 3ZQ7A 2P8TA 1GDTA 3RKXA 1Z05A 1OMIA 1X3ZB 1Z91A 1N75A 2DJNA 3LSTA 5L3CA 3E6CC 2O9LA 1MD0A 2YUSA 3HOZJ 1TZLA 3S16J 1I27A 2OPTA 2ZB9A 1USSA 1P4WA 4EATA 1X1AA 2IGKA 3OR1C 3J81K 4BEHA 4F92B 3BPXA 3ZP5A 4Y4RA 4EQQA 3MKYB 1SD6A 5F0HA 3AL0B 1TL8A 4AIKA 2R3SA 3CCEI 3ZQCA
chains in the Genus database with same CATH topology
1ODDA 2OZUA 3LAPA 1YS7A 1U5TC 1G3YA 4A2UA 1SD4A 2JPCA 3SHFA 5KK1A 3BZ6A 1LJ9A 1R7JA 1ZREA 2EV6A 5ED4A 3WTUC 2QQ9A 5KVRA 3L09A 4ZYHA 1OKRA 4TV7A 1XMKA 5IT3A 1ZRDA 4I02A 1DDNA 3WODF 1RI7A 2DI3A 1HBXG 3WTTC 1IN8A 5D5XB 4EJOA 2K86A 3I4PA 4U0YA 3OOPA 2VODA 5D6EA 4MTDA 1YQAA 2M5WA 5E1WA 3E3VA 3K0LA 1U78A 1G3WA 2NAZA 3M7GA 4RB1A 2FBIA 4YFXF 4UHTA 4ESJA 1FLIA 4ZZLA 2LF8A 3RKYA 2STTA 4BXUA 4EJUA 1MDMB 3MEXA 2A68F 3JSOA 4H0EA 3ERED 1GXQA 4MTEA 2WV0A 2UWMA 1Z9CA 2QYOA 1RNLA 5BS6A 3ISPA 1RUNA 2HZTA 2ZFWA 4XBFA 1ZRFA 2K02A 3GUDA 1F9NA 1O7FA 1B59A 2PEXA 2Y75A 3E6MA 1I1SA 2XHKA 3ZMTA 1ZLKA 2ACJA 2IVMA 2HQNA 2IPQX 4HV6A 2PFBA 4XLNF 2EWNA 1L0OC 2UZKA 1RZ4A 1YW9A 2H09A 4RGRA 3K1PA 2YPRA 2LSOA 2GA1A 3IL2A 4GXOA 2EFQA 1PP8F 2O03A 4IRHA 1LQ1A 3FXQA 3HHHA 2QENA 2NS0A 1VTNC 5ILVA 2HEOA 4O5VA 4M6XA 3DPLC 4HZFA 2B0LA 2IA2A 4L0YB 2TDXA 5HVQC 2LKPA 1SAXA 1V4RA 3KZZA 2ELHA 4WXHA 1TNTA 3CDHA 3U9GA 2GXGA 5ICCA 2OQRA 3SXYA 2V1XA 2KJBA 1IXCA 1B9NA 1BC7C 1KQ9A 2W24A 2ZBKA 3C1DA 3QP6A 3RPQA 5E20A 2QUFA 4I2OA 2KRFA 3IC7A 1REPC 3ROUA 1JHHA 4KDPA 4DQ2A 3T5XA 4BAYA 4NB5A 4HDUA 4EJTA 4ENJA 3SZTA 4IJAA 4S04A 3DV8A 1HW1A 2IJLA 5TRDA 4UVCA 3HSEA 2VE8A 5A2QK 1ZG1A 5HDNA 2VBZA 2GZWA 4XSXF 3RIRA 2A3SA 4M73A 5FGMA 2IA0A 2L02A 2DK5A 4IF4A 4OINF 2V9VA 2XV4S 4RB3C 1J2XA 1U2WA 1R1TA 1O7LA 2XROA 1GHCA 3KP5A 5LGTA 1UB9A 5D5WB 1P4AA 5FLXK 5LEKA 1LVAA 3P7NA 3KFWX 1XCBA 3G73A 1SD7A 1TQPA 4G9YA 1KGSA 2XASA 4L9JA 3RYPA 5FD6A 2GWRA 3NEUA 3I59B 4CZZA 4YFNF 2P5KA 2MA3A 3J7AO 1Q1HA 4L0ZB 2EA4A 4K2EA 2FNPA 5K1YA 4JBAA 4PGHA 1YG2A 3HOSA 4EM0B 4Q48A 3H92A 3WTZA 3IRRA 1BOAA 1AOYA 3PQKA 4HDVA 2STWA 4UVAA 4HOBA 3F8BA 1FT9A 3I64A 2V1UA 2FA5A 3LWFA 1QGPA 3HSFA 2RDPA 1ONVA 3CTAA 3ABTA 2ZNYA 3F8FA 5H20A 5EEGA 5ILSA 2BE5F 3HYIA 3CUOA 2DQRA 1NHAA 1LDDA 3IWZA 2Z99A 1CF7B 1ON2A 3RJPA 2L01A 4I98B 3ECHA 4CXFA 5CVIA 1U3EM 1K78A 3L2CA 2ETHA 2RC4A 3KP7A 3WTYC 1OPCA 2M8EA 4U7DA 4L5JA 2BEOA 5CYVA 4ESFA 2RKHA 3M9AA 3FM3A 2P6TA 2JSCA 3I71A 3V8JA 4S05A 3HSRA 2CFXA 1F5TA 3M8FA 1O3QA 4BQAA 1T2KA 2IA1A 2Z33A 3IWFA 3L9FA 4OOIA 1U5TB 3CO6C 1V3FA 2E7WA 1G3TA 1TW2A 3P9CA 5FFXA 4G6QA 3DKWA 4WWCA 5FO5A 3FM5A 1FOKA 2D1HA 1USTA 5L3DA 3HOTA 1OYYA 1ZG5A 3HRSA 4OIRF 1FYKA 2IW5A 3F8CA 5D6FA 1WKMA 1IN7A 2VBWA 4ENMA 2Z3YA 4KYWA 5JFRA 1FWZA 2PN6A 2FU4A 1LB2A 4O3MA 4G8XA 2JZYA 1HXDA 4NQWA 3V7RA 1BI1A 2HOEA 3WE3A 3KEQA 3REOA 1S7OA 3WGHA 2K4JA 4I09A 2Z5UA 2VXZA 1DP7P 1OYWA 2COMA 4ON0A 4YIFA 2Z9OA 3I58A 1GVJA 1O3RA 1IXSB 4KA4A 3R0JA 1WRJA 5LGNA 3GFLA 3ZMSA 4WXCA 3T0YA 3GXOA 5L3GA 3J80K 4IRIA 4LGWA 2PQ8A 4LLGF 3VOEA 1QBJA 3CO7C 2FBHA 4WX9A 4KN7X 3WG9A 3M1EA 4AIJA 3QAHA 1T6SA 1MGTA 2W85A 4Z2YA 1R58A 3MFKA 4RAZA 1R1VA 3LAJA 2M45A 3ZMUA 1E2XA 3EETA 5CVUA 2HYFA 1BJAA 4KUMA 3HRMA 1J59A 2HFHA 2MC3A 3PFIA 2L3DA 4MGRA 2DTRA 4GYGA 3F22A 1MDMA 3B02A 3K2ZA 4ASNA 2DO7A 2LNBA 4OMZA 3Q5FA 4CDGA 1P92A 5IT9Z 1SD5A 1FBQA 3KP6A 3FWEA 3WTXC 1ZRCA 5E8IA 2ZXJA 3KCCA 3CUQC 4PGGA 2O8XA 4UV9A 2W25A 3V4GA 3TGNA 4CO8A 1TTYA 1BC8C 2O61A 3C3WA 3DP7A 2FOKA 4YFKF 3ZMZA 1W5SA 6PAXA 4BHBA 3RI4A 3L7WA 4HV5A 3RDIA 3HHGA 3E6DA 3V8KA 5HDKA 1IZ1A 1IW7F 1MJBA 4M9XA 1FC3A 2D1VA 4U88A 2Y48A 1KYZA 4LB6B 2QM3A 3I54A 4HA8A 1J5YA 4EVIA 2EFPA 3R61A 1WI9A 4MHGA 1K7AA 2DU9A 1BIBA 2JT1A 2RGVA 4NHJA 1MJ9A 3K1NA 3TO7A 4I01A 3MCZA 2D45A 2WC2A 3F72A 2ESNA 4ZYEA 4Y17A 2R7FA 1DUXC 2AS5F 5D4RA 1LDKB 5LGUA 3GW2A 3LA3A 2Q8KA 1I1GA 2P7VB 1SMTA 3ELKA 4KNYA 1BI3A 4PDKA 2FXAA 1MKMA 4XLPF 5BMZA 4UXNA 2HKXA 1DPUA 3F23A 3O6BB 2K4BA 3H3UA 2BV6A 1IN6A 5TJJA 1S7AA 1FNNA 1UHWA 1B6AA 1W7PB 1YO5C 5L3FA 3F6VA 2OU2A 1ZYRF 4EM1A 1ZG3A 1FSEA 3LA2A 2VOOA 5HOOA 2CGPA 4LMYA 5LRSA 4I0BA 1KU7A 3BDDA 2IT0A 1EH7A 2JRTA 3I59A 4FT8A 4BNCA 1EH8A 4I0AA 2CWEA 4Y13A 1KU9A 5DD8A 4HF2A 2XAGA 1IF1A 1GXPA 4U0WA 3GFJA 2P7CB 3E5XA 2LF7A 3GWZA 3QP5A 5H6RA 4LG0B 5DDGA 1BI2A 1ZN2A 4HQMA 4UV8A 5D5UB 4G7OF 5D5VB 5BPIA 4RGUA 2DT5A 3NRVA 4UNOA 4KMUX 4WF2A 3VFZA 3KP2A 3WE2A 3MZYA 4IXAA 4FX0A 2RNJA 1B4AA 3BP8A 2CYYA 5LBQA 4UUVA 2F5EA 1MJAA 3W6KB 4A6EA 3M8EA 2QVOA 2DW4A 1W7PD 1CF7A 5BQTA 1T39A 4HBLA 3D5LA 3DFGA 2G9WA 3WGIA 4RS8A 3KLNA 2C6YA 5E17F 2K27A 1H9TA 2DAOA 4ENNA 2AXLA 5K5OA 2DLLA 3E6BA 4WXDA 2ESHA 1FPQA 5L3EA 3AAFA 2O0YA 2MLGA 2J5OA 1U6GA 2K7LA 4OIPF 3KE2A 4LFUA 3BWGA 1QZYA 1XMAA 2V1DA 4R79A 4A5MA 4G94A 2VN2A 1ZHFA 2CW0F 1U5TA 4RGSA 4F7ZA 1LDJA 5EEHA 1R22A 2F5FA 3DF8A 4IPAA 5LEJA 3RPUA 3LA7A 1I6XA 2ADUA 3K1MA 1IXRC 1KQ8A 4P9FA 1QPMA 2NRAC 3JSPA 3O2PE 4IHTA 4YIIA 2FMYA 3GFMA 1RUOA 5HLGA 2EFOA 3F3XA 1XGSA 3FXUA 5H6QA 2ISYA 1B9MA 3VB2A 2BBYA 3GX4X 4HX8A 1C0WA 2OD5A 2PJPA 3KEOA 2VC1A 3JAMK 1HSJA 2OBPA 1QNTA 1ON1A 4A0ZA 2WWYA 4IVNA 5HS8A 3SFZA 3T1BA 2MH2A 3NQOA 2VBYA 2FEZA 2ZMEB 2DBBA 3TOAA 2CQKA 2H94A 3LFKA 2HDCA 3EYYA 4HLXA 3DQVC 2UXXA 1JGSA 1LEBA 1ZH5A 2PMHA 1O57A 1R00A 1FSHA 2XAFA 1XB4A 4L9NA 4M9SA 4CICA 3CUQB 4A6DA 1TNSA 2GA2A 4P96A 3HRTA 1STZA 2MH9A 5DCMB 1R1UA 1OYIA 2P6SA 2A07F 3QOPA 2IRFG 4MEXF 4KN4X 3TQNA 1XGOA 1S6LA 4JQFA 1YLFA 1QO0D 2BGCA 4HLYA 1BM9A 3WTWC 2HR3A 2HTSA 1XDSA 1XDUA 5L3BA 4EMSA 1XSVA 3R4KA 3FXRA 1O3TA 5E1XA 1XD7A 2J5PA 2P4WA 3GO5A 3SZPA 4CHUA 3C18A 4EJVA 2RN7A 1LNWA 1YYVA 3GF2A 1D8KA 4HQEA 4A5NA 1XSDA 4B09A 3I53A 3DPTA 2CG4A 2Q2EA 2A61A 1HKSA 4Q4ZF 3TO9A 3VEPA 5A2QZ 5E1ZB 1G6NA 1FYMA 4BYYA 1O3SA 4L5IA 1TQMA 2PLYA 4GYIA 1EV7A 3GZ5A 1Z6RA 5DEQA 3BOQA 5AONA 3CJNA 1R36A 3BY6A 1X3UA 3WTSC 2ZCWA 3JTGA 1SMYF 1W4MA 1HKQA 2EB7A 4WCGA 5FLXZ 5CVVA 4HAMA 4RAYA 1HSTA 1S29A 1K79A 3T8RA 3CLOA 2FRHA 2A6EF 2MD5A 4IRGA 3ABUA 2OA4A 1CGPA 2VBXA 2FBKA 2HWVA 2QQAA 1TLHB 3Q9VA 4HF1A 4JK1X 1KYWA 1J75A 4G7HF 4RB2C 2QQBA 2E7XA 4ZZDA 4KIFA 2FSWA 1LEAA 4FHTA 2G7HA 3HUGA 4G6DA 4BHPA 4M9ZA 3N97A 5HLIA 2JPBA 2ZO4A 3FMQA 1FX7A 1HQCA 3FX3A 1T0FA 2HTJA 4HX7A 4CYDA 1TW3A 2KKOA 3PQJA 4LLLA 3E5UA 4EJWA 1ZLJA 2XIGA 3G3ZA 3VODA 3RTRA 3U2RA 1WQ2A 5DCFA 4O6JA 4L18B 1P2FA 2FMLA 2G7UA 3IKTA 3KP3A 3ZPLA 4EGZA 4KT5C 1FYLA 4EM2A 5F64A 3F8NA 1KQ0A 4DNCA 5FB2A 3V7CA 2XVCA 1UCRA 4P55A 4HF0A 3TO6A 1WWXA 1HKTA 1HW2A 1W7PA 2R7DA 2M87A 3K69A 5LHGA 3GFIA 5BOXA 3DXJF 3MZHA 3U1DA 3KZYA 4YG2F 3BPVA 3BJAA 3DEUA 2L4AA 3OV8A 1HW5A 1H9GA 2FF4A 4UVBA 2YSRA 2QBYB 1S8NA 2O6GE 2OZ6A 5E8GA 3EYIA 2YR2A 2XGXA 4LG0A 5E18F 3FMSA 1R23A 2NNYA 2PG4A 1IUYA 2ZNZA 3BJOA 2M1BA 2JTVA 5AIQA 3BJ6A 3R0AA 3JW4A 4BHCA 1A04A 2DPUA 1JHFA 5LHIA 4N9IA 1RIOH 2XAJA 3ECOA 1WSUA 3RKWA 3MWMA 2Y0MA 1FBSA 1FY7A 3QPHA 1XGMA 4GO1A 5HS7A 3S2WA 4M72A 3L00A 4Q5SF 3H3ZA 3HTSB 4XRFA 1ZGJA 2VE9A 4EGYA 2RV8A 4ESBA 2A5YB 3WU1B 4R1HA 1XGNA 2QLZA 1W5TA 4XSZF 2PBIA 2VC0A 1F1ZA 1E17A 5D8LB 5HDGA 1BIAA 4LK0F 1R5HA 4AVPA 4HYEA 4Q47A 4M74A 5JVTA 3HRUA 2W84A 5JHUA 3V7SA 3J80Z 1PDNC 1B1BA 5DUKA 2KIMA 5BPDA 5F1RA 4I7HA 2UXNA 1IRGA 3COAC 1PP7U 2F2EA 1YW8A 2L54A 1UHMA 2DPDA 1OR7A 3D0SA 1FBUA 4ZYGA 1I5ZA 3Q9SA 1DPRA 2EV5A 4L9TA 1EH6A 4HX4A 4G7ZF 4N9HA 3ULQB 2LDUA 5J6XA 2YX7A 3LQRA 2GIVA 5J8CA 3FMRA 2V79A 3K9TA 2F5DA 3GYHX 1QQIA 2IP2A 3P9IA 4CGZA 2A6HF 3J81Z 5CJ9A 2EA2A 1BN5A 2ZMEA 1PUEE 3B73A 3IKVA 1J0RA 1T98A 4BH9A 2GQQA 3I5UA 2D2WA 3TOBA 5ILUA 3KP4A 4RGXA 2DQLA 3GVAA 4AIHA 2VT3A 2P5LC 3QRFF 1FP1D 4HW0A 4U0VA 3CUQA 1SFEA 2MBFA 4D0PA 3IRQA 1YIOA 3R60A 2FQ3A 2EFNA 1ULYA 5DCMA 3N4MA 3E5QA 2PMUA 2H6BA 3V8LA 1IN4A 4P9UA 1FP2A 1G3SA 2HS5A 4MQVA 5DV5A 3P9KA 5HS9A 5K5QA 1R5GA 1P6RA 2CO5A 1F4KA 2MLKA 3TDZC 2KJCA 2VONA 1D3YA 2V6CA 4LD5A 4LB5A 1YW7A 5CVRA 3FHZA 3QPTA 2KIUA 4OU0A 3HTUA 4N0BA 4E70A 2HGCA 5JI6A 1JE8A 4QWQA 2FE3A 4FX4A 4U7BA 1J7KA 2BYVE 4AD9A 2YX4A 3FF5A 2X4HA 2E1CA 1S3JA 4PZJA 3ZN1A 1ZARA 3GZ6A 4ETSA 2F5CA 5LHHA 4MEYF 1XCVA 2PI0A 4KMFA 2VT2A 1D8JA 3EUHA 2KIFA 5IT9K 2OAZA 3KETA 3JTHA 5DYMA 3WTVC 3T8TA 1ZAOA 3ZMDA 1AWCA 4WK8F 5JR3A 5K5RA 1Z6TA 4L9VA 2QZ8A 3F8MA 2NYXA 2XAHA 2HKOA 5ICGA 2EV0A 4KIGA 5D8KB 1IRFA 1ZGAA 1SFXA 4RB0A 2O3FA 2A69F 2W57A 1KA8A 3R6SA 3RYRA 5CLSA 2NNNA 2QWWA 3IHUA 4LLNA 1IN5A 2YU3A 4OIOF 1YFHA 2DK8A 2XRNA 1D5VA 4OMYA 5ICFA 3ZN0A 2XAQA 4A0XA 2P5VA 5ICEA 4GCVA 5CVJA 4R8HA 5DD4A 1SFUA 2GXBA 1T38A 2HYGD 1H0MA 5FFZA 4LJZF 4KFCA 4MQ9F 2ISZA 3ZMVA 2H27A 3FZVA 5F6FA 1KU2A 1K6OA 4M6YA 3TKYA 1Y0UA 1YS6A 2VOPA 2HQRA 3WGGA 5ERIA 4OIQF 1MZBA 1BBYA 2FNAA 1TQIA 4GGGA 5J8FA 4Y15A 1KU3A 4EV0A 4ENKA 1XSXA 5LLQA 2RVCA 3C7JA 2EK5A 1FZPB 5HLHA 3QU3A 5FD5A 1K78B 3F21A 3E97A 2XUBA 2XKOA 4AWXB 3HIFA 5AIPA 3ML6A 4ZH4F 2RQPA 4KICA 1U8RA 4ZYDA 5LRRA 4QLCU 3EQLF 3O3KA 3TDUC 2EFWA 3I0TA 4IHSA 4MNUA 2X0LA 4A12A 4A0YA 2CSOA 3EDPA 3BROA 3WU0A 1G4DA 2WTEA 2QBYA 5D4SA 2OQGA 1YTYA 1JXSA 3KLOA 2EJRA 3LQQA 1P4XA 5DUIA 2GAUA 1QZZA 2Q0OA 3QU6A 4LK1F 2M30A 3MAJA 3GLXA 3SQNA 3MQ0A 4KIBA 4P5OA 3F6OA 3GEZA 1IAWA 2XKPA 1L3LA 1XN7A 2ZKZA 1UFMA 1Z7UA 3W6JB 4B8XA 2L4MA 1BI0A 4M71A 2H6CA 2ZJ2A 2E1NA 2DFIA 1J9IA 3JAMZ 1TBXA 1Z1DA 4PCQA 3ZQ7A 2P8TA 3RKXA 1Z05A 1OMIA 1Z91A 5L3CA 3LSTA 3E6CC 1MD0A 1I27A 1USSA 1P4WA 3J81K 3BPXA 3ZP5A 4EQQA 1SD6A 4AIKA 2R3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODD A;  2OZU A;  3LAP A;  1YS7 A;  1U5T C;  1G3Y A;  4A2U A;  1SD4 A;  2JPC A;  3SHF A;  5KK1 A;  3BZ6 A;  1LJ9 A;  1R7J A;  1ZRE A;  2EV6 A;  5ED4 A;  3WTU C;  2QQ9 A;  5KVR A;  3L09 A;  4ZYH A;  1OKR A;  4TV7 A;  1XMK A;  5IT3 A;  1ZRD A;  4I02 A;  1DDN A;  3WOD F;  1RI7 A;  2DI3 A;  1HBX G;  3WTT C;  1IN8 A;  5D5X B;  4EJO A;  2K86 A;  3I4P A;  4U0Y A;  3OOP A;  2VOD A;  5D6E A;  4MTD A;  1YQA A;  2M5W A;  5E1W A;  3E3V A;  3K0L A;  1U78 A;  1G3W A;  2NAZ A;  3M7G A;  4RB1 A;  2FBI A;  4YFX F;  4UHT A;  4ESJ A;  1FLI A;  4ZZL A;  2LF8 A;  3RKY A;  2STT A;  4BXU A;  4EJU A;  1MDM B;  3MEX A;  2A68 F;  3JSO A;  4H0E A;  3ERE D;  1GXQ A;  4MTE A;  2WV0 A;  2UWM A;  1Z9C A;  2QYO A;  1RNL A;  5BS6 A;  3ISP A;  1RUN A;  2HZT A;  2ZFW A;  4XBF A;  1ZRF A;  2K02 A;  3GUD A;  1F9N A;  1O7F A;  1B59 A;  2PEX A;  2Y75 A;  3E6M A;  1I1S A;  2XHK A;  3ZMT A;  1ZLK A;  2ACJ A;  2IVM A;  2HQN A;  2IPQ X;  4HV6 A;  2PFB A;  4XLN F;  2EWN A;  1L0O C;  2UZK A;  1RZ4 A;  1YW9 A;  2H09 A;  4RGR A;  3K1P A;  2YPR A;  2LSO A;  2GA1 A;  3IL2 A;  4GXO A;  2EFQ A;  1PP8 F;  2O03 A;  4IRH A;  1LQ1 A;  3FXQ A;  3HHH A;  2QEN A;  2NS0 A;  1VTN C;  5ILV A;  2HEO A;  4O5V A;  4M6X A;  3DPL C;  4HZF A;  2B0L A;  2IA2 A;  4L0Y B;  2TDX A;  5HVQ C;  2LKP A;  1SAX A;  1V4R A;  3KZZ A;  2ELH A;  4WXH A;  1TNT A;  3CDH A;  3U9G A;  2GXG A;  5ICC A;  2OQR A;  3SXY A;  2V1X A;  2KJB A;  1IXC A;  1B9N A;  1BC7 C;  1KQ9 A;  2W24 A;  2ZBK A;  3C1D A;  3QP6 A;  3RPQ A;  5E20 A;  2QUF A;  4I2O A;  2KRF A;  3IC7 A;  1REP C;  3ROU A;  1JHH A;  4KDP A;  4DQ2 A;  3T5X A;  4BAY A;  4NB5 A;  4HDU A;  4EJT A;  4ENJ A;  3SZT A;  4IJA A;  4S04 A;  3DV8 A;  1HW1 A;  2IJL A;  5TRD A;  4UVC A;  3HSE A;  2VE8 A;  5A2Q K;  1ZG1 A;  5HDN A;  2VBZ A;  2GZW A;  4XSX F;  3RIR A;  2A3S A;  4M73 A;  5FGM A;  2IA0 A;  2L02 A;  2DK5 A;  4IF4 A;  4OIN F;  2V9V A;  2XV4 S;  4RB3 C;  1J2X A;  1U2W A;  1R1T A;  1O7L A;  2XRO A;  1GHC A;  3KP5 A;  5LGT A;  1UB9 A;  5D5W B;  1P4A A;  5FLX K;  5LEK A;  1LVA A;  3P7N A;  3KFW X;  1XCB A;  3G73 A;  1SD7 A;  1TQP A;  4G9Y A;  1KGS A;  2XAS A;  4L9J A;  3RYP A;  5FD6 A;  2GWR A;  3NEU A;  3I59 B;  4CZZ A;  4YFN F;  2P5K A;  2MA3 A;  3J7A O;  1Q1H A;  4L0Z B;  2EA4 A;  4K2E A;  2FNP A;  5K1Y A;  4JBA A;  4PGH A;  1YG2 A;  3HOS A;  4EM0 B;  4Q48 A;  3H92 A;  3WTZ A;  3IRR A;  1BOA A;  1AOY A;  3PQK A;  4HDV A;  2STW A;  4UVA A;  4HOB A;  3F8B A;  1FT9 A;  3I64 A;  2V1U A;  2FA5 A;  3LWF A;  1QGP A;  3HSF A;  2RDP A;  1ONV A;  3CTA A;  3ABT A;  2ZNY A;  3F8F A;  5H20 A;  5EEG A;  5ILS A;  2BE5 F;  3HYI A;  3CUO A;  2DQR A;  1NHA A;  1LDD A;  3IWZ A;  2Z99 A;  1CF7 B;  1ON2 A;  3RJP A;  2L01 A;  4I98 B;  3ECH A;  4CXF A;  5CVI A;  1U3E M;  1K78 A;  3L2C A;  2ETH A;  2RC4 A;  3KP7 A;  3WTY C;  1OPC A;  2M8E A;  4U7D A;  4L5J A;  2BEO A;  5CYV A;  4ESF A;  2RKH A;  3M9A A;  3FM3 A;  2P6T A;  2JSC A;  3I71 A;  3V8J A;  4S05 A;  3HSR A;  2CFX A;  1F5T A;  3M8F A;  1O3Q A;  4BQA A;  1T2K A;  2IA1 A;  2Z33 A;  3IWF A;  3L9F A;  4OOI A;  1U5T B;  3CO6 C;  1V3F A;  2E7W A;  1G3T A;  1TW2 A;  3P9C A;  5FFX A;  4G6Q A;  3DKW A;  4WWC A;  5FO5 A;  3FM5 A;  1FOK A;  2D1H A;  1UST A;  5L3D A;  3HOT A;  1OYY A;  1ZG5 A;  3HRS A;  4OIR F;  1FYK A;  2IW5 A;  3F8C A;  5D6F A;  1WKM A;  1IN7 A;  2VBW A;  4ENM A;  2Z3Y A;  4KYW A;  5JFR A;  1FWZ A;  2PN6 A;  2FU4 A;  1LB2 A;  4O3M A;  4G8X A;  2JZY A;  1HXD A;  4NQW A;  3V7R A;  1BI1 A;  2HOE A;  3WE3 A;  3KEQ A;  3REO A;  1S7O A;  3WGH A;  2K4J A;  4I09 A;  2Z5U A;  2VXZ A;  1DP7 P;  1OYW A;  2COM A;  4ON0 A;  4YIF A;  2Z9O A;  3I58 A;  1GVJ A;  1O3R A;  1IXS B;  4KA4 A;  3R0J A;  1WRJ A;  5LGN A;  3GFL A;  3ZMS A;  4WXC A;  3T0Y A;  3GXO A;  5L3G A;  3J80 K;  4IRI A;  4LGW A;  2PQ8 A;  4LLG F;  3VOE A;  1QBJ A;  3CO7 C;  2FBH A;  4WX9 A;  4KN7 X;  3WG9 A;  3M1E A;  4AIJ A;  3QAH A;  1T6S A;  1MGT A;  2W85 A;  4Z2Y A;  1R58 A;  3MFK A;  4RAZ A;  1R1V A;  3LAJ A;  2M45 A;  3ZMU A;  1E2X A;  3EET A;  5CVU A;  2HYF A;  1BJA A;  4KUM A;  3HRM A;  1J59 A;  2HFH A;  2MC3 A;  3PFI A;  2L3D A;  4MGR A;  2DTR A;  4GYG A;  3F22 A;  1MDM A;  3B02 A;  3K2Z A;  4ASN A;  2DO7 A;  2LNB A;  4OMZ A;  3Q5F A;  4CDG A;  1P92 A;  5IT9 Z;  1SD5 A;  1FBQ A;  3KP6 A;  3FWE A;  3WTX C;  1ZRC A;  5E8I A;  2ZXJ A;  3KCC A;  3CUQ C;  4PGG A;  2O8X A;  4UV9 A;  2W25 A;  3V4G A;  3TGN A;  4CO8 A;  1TTY A;  1BC8 C;  2O61 A;  3C3W A;  3DP7 A;  2FOK A;  4YFK F;  3ZMZ A;  1W5S A;  6PAX A;  4BHB A;  3RI4 A;  3L7W A;  4HV5 A;  3RDI A;  3HHG A;  3E6D A;  3V8K A;  5HDK A;  1IZ1 A;  1IW7 F;  1MJB A;  4M9X A;  1FC3 A;  2D1V A;  4U88 A;  2Y48 A;  1KYZ A;  4LB6 B;  2QM3 A;  3I54 A;  4HA8 A;  1J5Y A;  4EVI A;  2EFP A;  3R61 A;  1WI9 A;  4MHG A;  1K7A A;  2DU9 A;  1BIB A;  2JT1 A;  2RGV A;  4NHJ A;  1MJ9 A;  3K1N A;  3TO7 A;  4I01 A;  3MCZ A;  2D45 A;  2WC2 A;  3F72 A;  2ESN A;  4ZYE A;  4Y17 A;  2R7F A;  1DUX C;  2AS5 F;  5D4R A;  1LDK B;  5LGU A;  3GW2 A;  3LA3 A;  2Q8K A;  1I1G A;  2P7V B;  1SMT A;  3ELK A;  4KNY A;  1BI3 A;  4PDK A;  2FXA A;  1MKM A;  4XLP F;  5BMZ A;  4UXN A;  2HKX A;  1DPU A;  3F23 A;  3O6B B;  2K4B A;  3H3U A;  2BV6 A;  1IN6 A;  5TJJ A;  1S7A A;  1FNN A;  1UHW A;  1B6A A;  1W7P B;  1YO5 C;  5L3F A;  3F6V A;  2OU2 A;  1ZYR F;  4EM1 A;  1ZG3 A;  1FSE A;  3LA2 A;  2VOO A;  5HOO A;  2CGP A;  4LMY A;  5LRS A;  4I0B A;  1KU7 A;  3BDD A;  2IT0 A;  1EH7 A;  2JRT A;  3I59 A;  4FT8 A;  4BNC A;  1EH8 A;  4I0A A;  2CWE A;  4Y13 A;  1KU9 A;  5DD8 A;  4HF2 A;  2XAG A;  1IF1 A;  1GXP A;  4U0W A;  3GFJ A;  2P7C B;  3E5X A;  2LF7 A;  3GWZ A;  3QP5 A;  5H6R A;  4LG0 B;  5DDG A;  1BI2 A;  1ZN2 A;  4HQM A;  4UV8 A;  5D5U B;  4G7O F;  5D5V B;  5BPI A;  4RGU A;  2DT5 A;  3NRV A;  4UNO A;  4KMU X;  4WF2 A;  3VFZ A;  3KP2 A;  3WE2 A;  3MZY A;  4IXA A;  4FX0 A;  2RNJ A;  1B4A A;  3BP8 A;  2CYY A;  5LBQ A;  4UUV A;  2F5E A;  1MJA A;  3W6K B;  4A6E A;  3M8E A;  2QVO A;  2DW4 A;  1W7P D;  1CF7 A;  5BQT A;  1T39 A;  4HBL A;  3D5L A;  3DFG A;  2G9W A;  3WGI A;  4RS8 A;  3KLN A;  2C6Y A;  5E17 F;  2K27 A;  1H9T A;  2DAO A;  4ENN A;  2AXL A;  5K5O A;  2DLL A;  3E6B A;  4WXD A;  2ESH A;  1FPQ A;  5L3E A;  3AAF A;  2O0Y A;  2MLG A;  2J5O A;  1U6G A;  2K7L A;  4OIP F;  3KE2 A;  4LFU A;  3BWG A;  1QZY A;  1XMA A;  2V1D A;  4R79 A;  4A5M A;  4G94 A;  2VN2 A;  1ZHF A;  2CW0 F;  1U5T A;  4RGS A;  4F7Z A;  1LDJ A;  5EEH A;  1R22 A;  2F5F A;  3DF8 A;  4IPA A;  5LEJ A;  3RPU A;  3LA7 A;  1I6X A;  2ADU A;  3K1M A;  1IXR C;  1KQ8 A;  4P9F A;  1QPM A;  2NRA C;  3JSP A;  3O2P E;  4IHT A;  4YII A;  2FMY A;  3GFM A;  1RUO A;  5HLG A;  2EFO A;  3F3X A;  1XGS A;  3FXU A;  5H6Q A;  2ISY A;  1B9M A;  3VB2 A;  2BBY A;  3GX4 X;  4HX8 A;  1C0W A;  2OD5 A;  2PJP A;  3KEO A;  2VC1 A;  3JAM K;  1HSJ A;  2OBP A;  1QNT A;  1ON1 A;  4A0Z A;  2WWY A;  4IVN A;  5HS8 A;  3SFZ A;  3T1B A;  2MH2 A;  3NQO A;  2VBY A;  2FEZ A;  2ZME B;  2DBB A;  3TOA A;  2CQK A;  2H94 A;  3LFK A;  2HDC A;  3EYY A;  4HLX A;  3DQV C;  2UXX A;  1JGS A;  1LEB A;  1ZH5 A;  2PMH A;  1O57 A;  1R00 A;  1FSH A;  2XAF A;  1XB4 A;  4L9N A;  4M9S A;  4CIC A;  3CUQ B;  4A6D A;  1TNS A;  2GA2 A;  4P96 A;  3HRT A;  1STZ A;  2MH9 A;  5DCM B;  1R1U A;  1OYI A;  2P6S A;  2A07 F;  3QOP A;  2IRF G;  4MEX F;  4KN4 X;  3TQN A;  1XGO A;  1S6L A;  4JQF A;  1YLF A;  1QO0 D;  2BGC A;  4HLY A;  1BM9 A;  3WTW C;  2HR3 A;  2HTS A;  1XDS A;  1XDU A;  5L3B A;  4EMS A;  1XSV A;  3R4K A;  3FXR A;  1O3T A;  5E1X A;  1XD7 A;  2J5P A;  2P4W A;  3GO5 A;  3SZP A;  4CHU A;  3C18 A;  4EJV A;  2RN7 A;  1LNW A;  1YYV A;  3GF2 A;  1D8K A;  4HQE A;  4A5N A;  1XSD A;  4B09 A;  3I53 A;  3DPT A;  2CG4 A;  2Q2E A;  2A61 A;  1HKS A;  4Q4Z F;  3TO9 A;  3VEP A;  5A2Q Z;  5E1Z B;  1G6N A;  1FYM A;  4BYY A;  1O3S A;  4L5I A;  1TQM A;  2PLY A;  4GYI A;  1EV7 A;  3GZ5 A;  1Z6R A;  5DEQ A;  3BOQ A;  5AON A;  3CJN A;  1R36 A;  3BY6 A;  1X3U A;  3WTS C;  2ZCW A;  3JTG A;  1SMY F;  1W4M A;  1HKQ A;  2EB7 A;  4WCG A;  5FLX Z;  5CVV A;  4HAM A;  4RAY A;  1HST A;  1S29 A;  1K79 A;  3T8R A;  3CLO A;  2FRH A;  2A6E F;  2MD5 A;  4IRG A;  3ABU A;  2OA4 A;  1CGP A;  2VBX A;  2FBK A;  2HWV A;  2QQA A;  1TLH B;  3Q9V A;  4HF1 A;  4JK1 X;  1KYW A;  1J75 A;  4G7H F;  4RB2 C;  2QQB A;  2E7X A;  4ZZD A;  4KIF A;  2FSW A;  1LEA A;  4FHT A;  2G7H A;  3HUG A;  4G6D A;  4BHP A;  4M9Z A;  3N97 A;  5HLI A;  2JPB A;  2ZO4 A;  3FMQ A;  1FX7 A;  1HQC A;  3FX3 A;  1T0F A;  2HTJ A;  4HX7 A;  4CYD A;  1TW3 A;  2KKO A;  3PQJ A;  4LLL A;  3E5U A;  4EJW A;  1ZLJ A;  2XIG A;  3G3Z A;  3VOD A;  3RTR A;  3U2R A;  1WQ2 A;  5DCF A;  4O6J A;  4L18 B;  1P2F A;  2FML A;  2G7U A;  3IKT A;  3KP3 A;  3ZPL A;  4EGZ A;  4KT5 C;  1FYL A;  4EM2 A;  5F64 A;  3F8N A;  1KQ0 A;  4DNC A;  5FB2 A;  3V7C A;  2XVC A;  1UCR A;  4P55 A;  4HF0 A;  3TO6 A;  1WWX A;  1HKT A;  1HW2 A;  1W7P A;  2R7D A;  2M87 A;  3K69 A;  5LHG A;  3GFI A;  5BOX A;  3DXJ F;  3MZH A;  3U1D A;  3KZY A;  4YG2 F;  3BPV A;  3BJA A;  3DEU A;  2L4A A;  3OV8 A;  1HW5 A;  1H9G A;  2FF4 A;  4UVB A;  2YSR A;  2QBY B;  1S8N A;  2O6G E;  2OZ6 A;  5E8G A;  3EYI A;  2YR2 A;  2XGX A;  4LG0 A;  5E18 F;  3FMS A;  1R23 A;  2NNY A;  2PG4 A;  1IUY A;  2ZNZ A;  3BJO A;  2M1B A;  2JTV A;  5AIQ A;  3BJ6 A;  3R0A A;  3JW4 A;  4BHC A;  1A04 A;  2DPU A;  1JHF A;  5LHI A;  4N9I A;  1RIO H;  2XAJ A;  3ECO A;  1WSU A;  3RKW A;  3MWM A;  2Y0M A;  1FBS A;  1FY7 A;  3QPH A;  1XGM A;  4GO1 A;  5HS7 A;  3S2W A;  4M72 A;  3L00 A;  4Q5S F;  3H3Z A;  3HTS B;  4XRF A;  1ZGJ A;  2VE9 A;  4EGY A;  2RV8 A;  4ESB A;  2A5Y B;  3WU1 B;  4R1H A;  1XGN A;  2QLZ A;  1W5T A;  4XSZ F;  2PBI A;  2VC0 A;  1F1Z A;  1E17 A;  5D8L B;  5HDG A;  1BIA A;  4LK0 F;  1R5H A;  4AVP A;  4HYE A;  4Q47 A;  4M74 A;  5JVT A;  3HRU A;  2W84 A;  5JHU A;  3V7S A;  3J80 Z;  1PDN C;  1B1B A;  5DUK A;  2KIM A;  5BPD A;  5F1R A;  4I7H A;  2UXN A;  1IRG A;  3COA C;  1PP7 U;  2F2E A;  1YW8 A;  2L54 A;  1UHM A;  2DPD A;  1OR7 A;  3D0S A;  1FBU A;  4ZYG A;  1I5Z A;  3Q9S A;  1DPR A;  2EV5 A;  4L9T A;  1EH6 A;  4HX4 A;  4G7Z F;  4N9H A;  3ULQ B;  2LDU A;  5J6X A;  2YX7 A;  3LQR A;  2GIV A;  5J8C A;  3FMR A;  2V79 A;  3K9T A;  2F5D A;  3GYH X;  1QQI A;  2IP2 A;  3P9I A;  4CGZ A;  2A6H F;  3J81 Z;  5CJ9 A;  2EA2 A;  1BN5 A;  2ZME A;  1PUE E;  3B73 A;  3IKV A;  1J0R A;  1T98 A;  4BH9 A;  2GQQ A;  3I5U A;  2D2W A;  3TOB A;  5ILU A;  3KP4 A;  4RGX A;  2DQL A;  3GVA A;  4AIH A;  2VT3 A;  2P5L C;  3QRF F;  1FP1 D;  4HW0 A;  4U0V A;  3CUQ A;  1SFE A;  2MBF A;  4D0P A;  3IRQ A;  1YIO A;  3R60 A;  2FQ3 A;  2EFN A;  1ULY A;  5DCM A;  3N4M A;  3E5Q A;  2PMU A;  2H6B A;  3V8L A;  1IN4 A;  4P9U A;  1FP2 A;  1G3S A;  2HS5 A;  4MQV A;  5DV5 A;  3P9K A;  5HS9 A;  5K5Q A;  1R5G A;  1P6R A;  2CO5 A;  1F4K A;  2MLK A;  3TDZ C;  2KJC A;  2VON A;  1D3Y A;  2V6C A;  4LD5 A;  4LB5 A;  1YW7 A;  5CVR A;  3FHZ A;  3QPT A;  2KIU A;  4OU0 A;  3HTU A;  4N0B A;  4E70 A;  2HGC A;  5JI6 A;  1JE8 A;  4QWQ A;  2FE3 A;  4FX4 A;  4U7B A;  1J7K A;  2BYV E;  4AD9 A;  2YX4 A;  3FF5 A;  2X4H A;  2E1C A;  1S3J A;  4PZJ A;  3ZN1 A;  1ZAR A;  3GZ6 A;  4ETS A;  2F5C A;  5LHH A;  4MEY F;  1XCV A;  2PI0 A;  4KMF A;  2VT2 A;  1D8J A;  3EUH A;  2KIF A;  5IT9 K;  2OAZ A;  3KET A;  3JTH A;  5DYM A;  3WTV C;  3T8T A;  1ZAO A;  3ZMD A;  1AWC A;  4WK8 F;  5JR3 A;  5K5R A;  1Z6T A;  4L9V A;  2QZ8 A;  3F8M A;  2NYX A;  2XAH A;  2HKO A;  5ICG A;  2EV0 A;  4KIG A;  5D8K B;  1IRF A;  1ZGA A;  1SFX A;  4RB0 A;  2O3F A;  2A69 F;  2W57 A;  1KA8 A;  3R6S A;  3RYR A;  5CLS A;  2NNN A;  2QWW A;  3IHU A;  4LLN A;  1IN5 A;  2YU3 A;  4OIO F;  1YFH A;  2DK8 A;  2XRN A;  1D5V A;  4OMY A;  5ICF A;  3ZN0 A;  2XAQ A;  4A0X A;  2P5V A;  5ICE A;  4GCV A;  5CVJ A;  4R8H A;  5DD4 A;  1SFU A;  2GXB A;  1T38 A;  2HYG D;  1H0M A;  5FFZ A;  4LJZ F;  4KFC A;  4MQ9 F;  2ISZ A;  3ZMV A;  2H27 A;  3FZV A;  5F6F A;  1KU2 A;  1K6O A;  4M6Y A;  3TKY A;  1Y0U A;  1YS6 A;  2VOP A;  2HQR A;  3WGG A;  5ERI A;  4OIQ F;  1MZB A;  1BBY A;  2FNA A;  1TQI A;  4GGG A;  5J8F A;  4Y15 A;  1KU3 A;  4EV0 A;  4ENK A;  1XSX A;  5LLQ A;  2RVC A;  3C7J A;  2EK5 A;  1FZP B;  5HLH A;  3QU3 A;  5FD5 A;  1K78 B;  3F21 A;  3E97 A;  2XUB A;  2XKO A;  4AWX B;  3HIF A;  5AIP A;  3ML6 A;  4ZH4 F;  2RQP A;  4KIC A;  1U8R A;  4ZYD A;  5LRR A;  4QLC U;  3EQL F;  3O3K A;  3TDU C;  2EFW A;  3I0T A;  4IHS A;  4MNU A;  2X0L A;  4A12 A;  4A0Y A;  2CSO A;  3EDP A;  3BRO A;  3WU0 A;  1G4D A;  2WTE A;  2QBY A;  5D4S A;  2OQG A;  1YTY A;  1JXS A;  3KLO A;  2EJR A;  3LQQ A;  1P4X A;  5DUI A;  2GAU A;  1QZZ A;  2Q0O A;  3QU6 A;  4LK1 F;  2M30 A;  3MAJ A;  3GLX A;  3SQN A;  3MQ0 A;  4KIB A;  4P5O A;  3F6O A;  3GEZ A;  1IAW A;  2XKP A;  1L3L A;  1XN7 A;  2ZKZ A;  1UFM A;  1Z7U A;  3W6J B;  4B8X A;  2L4M A;  1BI0 A;  4M71 A;  2H6C A;  2ZJ2 A;  2E1N A;  2DFI A;  1J9I A;  3JAM Z;  1TBX A;  1Z1D A;  4PCQ A;  3ZQ7 A;  2P8T A;  3RKX A;  1Z05 A;  1OMI A;  1Z91 A;  5L3C A;  3LST A;  3E6C C;  1MD0 A;  1I27 A;  1USS A;  1P4W A;  3J81 K;  3BPX A;  3ZP5 A;  4EQQ A;  1SD6 A;  4AIK A;  2R3S A; 
#chains in the Genus database with same CATH topology
 3TP3 A;  1ODD A;  2OZU A;  1SAU A;  3LAP A;  1YS7 A;  3H1C A;  4X6A J;  3AG2 H;  1U5T C;  4KJZ A;  4CH7 A;  2I10 A;  1G3Y A;  4GDF A;  3J7Z I;  1Z3X A;  4A2U A;  4M3B A;  1LE8 A;  4W1U A;  1SD4 A;  2Y31 A;  4LIV A;  1A6I A;  3G1M A;  2JPC A;  2KIS A;  3SHF A;  5KK1 A;  3BZ6 A;  1LJ9 A;  1R7J A;  1ZRE A;  2EV6 A;  5ED4 A;  3WTU C;  2QQ9 A;  5KVR A;  1X19 A;  3L09 A;  4ZYH A;  1DU6 A;  1OKR A;  4XLH A;  4TV7 A;  1XMK A;  4RAG A;  4PSX A;  4X0G A;  5IT3 A;  1ZRD A;  4I02 A;  1DDN A;  3WOD F;  3CDL A;  1RI7 A;  2DI3 A;  1HBX G;  3ONQ A;  3WTT C;  1IN8 A;  5D5X B;  3GTG J;  3LSI A;  3BR1 A;  4EJO A;  3SJM A;  2K86 A;  4F91 B;  3I4P A;  5DS9 A;  2JA2 A;  1S5L C;  4U0Y A;  3OOP A;  2VOD A;  3GZN B;  1J09 A;  5D6E A;  4MTD A;  1MIJ A;  2M3A A;  3B6C A;  1YQA A;  2M5W A;  1S9H A;  2K40 A;  3E3V A;  3K0L A;  5E1W A;  5EF6 A;  4YRV A;  4BE1 A;  1U78 A;  3CMM A;  4QTR A;  3S93 A;  1G3W A;  2NAZ A;  5EG0 A;  3M7G A;  4RB1 A;  3OSG A;  2COB A;  1D1B A;  5FJ8 J;  2DOE A;  3CLQ A;  1YJW I;  2FBI A;  1PUF A;  4YFX F;  4UHT A;  4E4H A;  4ESJ A;  3EUH C;  1FLI A;  4ZZL A;  2LF8 A;  1KZH A;  1V5F A;  1APL C;  2DDB A;  4DYR A;  2CQ7 A;  3RKY A;  3MKW B;  1AKH B;  2STT A;  1LFB A;  2LG4 A;  4BXU A;  2MGQ A;  1OQY A;  3D5R C;  4EJU A;  1MDM B;  3VYR B;  5B66 C;  2E1O A;  3MEX A;  2A68 F;  2I8D A;  3ASO H;  3JSO A;  1SVM A;  3RKQ A;  2Y9Z A;  1T33 A;  2Y30 A;  4H0E A;  4D7M A;  3ERE D;  1TWC J;  1NK2 P;  1GXQ A;  4MTE A;  2WV0 A;  2UWM A;  1Z9C A;  2QYO A;  1RNL A;  2JK3 A;  1XC5 A;  1E3O C;  2LY1 A;  5BS6 A;  3ISP A;  1RUN A;  1JI8 A;  2HZT A;  2ZFW A;  4XBF A;  1ZRF A;  2K02 A;  2K9Q A;  1F9N A;  3GUD A;  4IL6 C;  1O7F A;  1B59 A;  3FBI B;  2PEX A;  3CJT B;  2Y75 A;  2NVU B;  3E6M A;  4MFD A;  1I1S A;  2XHK A;  3QPL A;  3ZMT A;  4B3X A;  1ZLK A;  1FTT A;  3BTC A;  4DZJ A;  2ACJ A;  2IVM A;  3CZ6 A;  1UG2 A;  2HQN A;  2IPQ X;  4HV6 A;  2PFB A;  1IO2 A;  4XLN F;  3LSJ A;  4IOA F;  2EWN A;  1L0O C;  2UZK A;  1RZ4 A;  1YW9 A;  2H09 A;  2H1L A;  4RGR A;  4A69 C;  3K1P A;  3DU6 A;  2DA3 A;  2YPR A;  3QOD A;  4BUP A;  2LSO A;  3L2V A;  4DBR A;  2GA1 A;  3LSR A;  4A3M J;  3IL2 A;  4AM3 A;  4A3D J;  4CCM A;  4GXO A;  2B9S A;  3OSF A;  5J1Y A;  5EGO A;  2EFQ A;  1PP8 F;  2O03 A;  4IRH A;  1LQ1 A;  3FXQ A;  3HHH A;  1OIS A;  1SEU A;  2QEN A;  2NS0 A;  4QIW N;  1VTN C;  5ILV A;  1R6R A;  2HEO A;  2M34 A;  4O5V A;  4BQO A;  3G6E I;  4M6X A;  3DPL C;  1HF0 A;  3QOE A;  4HZF A;  2B0L A;  2V9P A;  2IA2 A;  3K6G A;  1X1P A;  4L0Y B;  3BR2 A;  2R0Q C;  2TDX A;  2V7F A;  5HVQ C;  2X6Y A;  2LKP A;  1SAX A;  2L9N A;  1V4R A;  3G2B A;  3AG3 H;  1WI3 A;  1Z77 A;  3S1N J;  3KZZ A;  3GBG A;  2ELH A;  4I76 A;  4WXH A;  1TNT A;  3CDH A;  3U9G A;  2GXG A;  5ICC A;  3BTL A;  3K4M A;  2IGM A;  2L9S A;  2OQR A;  1B72 A;  3SXY A;  2V1X A;  2KJB A;  1IXC A;  4ZDL A;  3S17 J;  1B9N A;  1BC7 C;  1KQ9 A;  2E1M C;  2W24 A;  2ZBK A;  2VKD A;  3C1D A;  3QP6 A;  4RLF A;  3RPQ A;  1LPQ A;  5E20 A;  2QUF A;  4I2O A;  2KRF A;  2LP0 A;  1SFO J;  3IC7 A;  1REP C;  1FJL A;  5DM6 F;  3ZQL A;  3ROU A;  1JHH A;  4KDP A;  4DQ2 A;  3T5X A;  1YJN I;  4BAY A;  4BGD A;  1X58 A;  3MKZ A;  2K9M A;  4NB5 A;  4HDU A;  4CYC A;  4EJT A;  3SDB A;  4ENJ A;  4RA2 A;  4XLA A;  3SZT A;  2O7O A;  1T56 A;  4GFB A;  4IJA A;  3QYB A;  4S04 A;  2R93 J;  4CCO A;  3DV8 A;  2HVR A;  3A4C A;  1HW1 A;  2IJL A;  5TRD A;  3PUF A;  4UVC A;  2JA8 J;  3HSE A;  2VE8 A;  2LY9 A;  5A2Q K;  1ZG1 A;  2DA2 A;  4YEJ A;  3MKL A;  3CES A;  2W00 A;  3JCU C;  5HDN A;  2VBZ A;  2GZW A;  4XSX F;  2WB1 A;  3RIR A;  3OIO A;  1W5C C;  2A3S A;  2X1D A;  1VQ9 I;  2TCT A;  3VPR A;  4M73 A;  5FGM A;  2IA0 A;  2L02 A;  3GTO J;  2DK5 A;  4IF4 A;  4OIN F;  1AHD P;  3SYT A;  2LOO A;  2V9V A;  4A3E J;  3NAU A;  2XV4 S;  2M4K A;  2XPW A;  1J2X A;  5F27 A;  4RB3 C;  1U2W A;  1R1T A;  1O7L A;  2XRO A;  4D5F A;  1GHC A;  4XLC A;  2V9K A;  3KP5 A;  5LGT A;  1POG A;  2FX0 A;  1UB9 A;  1UG0 A;  5D5W B;  3BQY A;  1P4A A;  5FLX K;  3SZG A;  3G1O A;  5LEK A;  1OCP A;  1LVA A;  3P7N A;  3KFW X;  1XCB A;  5F08 A;  2NVY J;  2EH3 A;  3G73 A;  1SD7 A;  1TQP A;  4G9Y A;  3KEY A;  2LKS A;  1KGS A;  2XAS A;  4L9J A;  3RYP A;  3DBR B;  3VYU B;  5FD6 A;  1HC8 A;  3ZOB A;  2GWR A;  3NEU A;  3I59 B;  4CZZ A;  1Y6I A;  4YFN F;  2P5K A;  2MA3 A;  3J7A O;  4BAC A;  1Q1H A;  5B5E C;  3OYI A;  4L0Z B;  3DWL E;  3LSH A;  2LK2 A;  2WBM A;  4X1E A;  2EA4 A;  4K2E A;  2FNP A;  1MMN A;  4JYK A;  5K1Y A;  4JBA A;  3CP2 A;  4PFO A;  4Y52 J;  2IXS A;  4PGH A;  4IZZ A;  1YG2 A;  3H0D A;  1GV5 A;  1QHG A;  3HOS A;  3VSL A;  3TED A;  4A3F J;  2NOJ B;  4EM0 B;  4PSW A;  4Q48 A;  1BR2 A;  2BY1 A;  3H92 A;  3WTZ A;  1LUJ B;  3IRR A;  1BOA A;  1AOY A;  3PQK A;  2Z1D A;  4HDV A;  2VXD A;  2STW A;  5GAH J;  4HRI A;  4UVA A;  2HZD A;  4HOB A;  3F8B A;  1FT9 A;  3AKZ A;  3M8J A;  1BL0 A;  3VYS B;  3I64 A;  1WCM J;  2V1U A;  1X1B A;  2FA5 A;  3LWF A;  3OYN A;  1QGP A;  3HSF A;  2RDP A;  3DKY A;  1ONV A;  4UUS B;  3CTA A;  3ABT A;  5FLM J;  3BQZ A;  2ZNY A;  3F8F A;  5H20 A;  5EEG A;  1WJE A;  2MW8 A;  5ILS A;  1B8I B;  1MMA A;  2BE5 F;  3HYI A;  3HL2 A;  3CUO A;  3TP0 A;  2DQR A;  1QA6 A;  1NHA A;  1LDD A;  3IWZ A;  1R4M B;  4ITV A;  5E3L A;  4XKW A;  2Z99 A;  1CF7 B;  1BA5 A;  1ON2 A;  3RJP A;  1TWH J;  2L01 A;  4I98 B;  3ECH A;  4CXF A;  2OTL I;  5CVI A;  4OWR B;  3CF5 F;  1U3E M;  2KHM A;  1ETW A;  3KYD B;  1K78 A;  4M3F A;  2EZL A;  3L2C A;  2XC7 A;  2ETH A;  2RC4 A;  4J01 A;  4MLO A;  3VWB A;  3KP7 A;  2QGU A;  3DEW A;  4OAY A;  1OPC A;  3WTY C;  2X51 A;  3HOU J;  2M8E A;  4U7D A;  4N4O B;  3PM1 A;  2LD5 A;  1WH5 A;  1BR4 A;  4L5J A;  3IH2 A;  3HPG A;  3HC7 A;  2BEO A;  2X48 A;  2JJ7 A;  5CYV A;  3A02 A;  4ESF A;  2RKH A;  3M9A A;  1T08 B;  1ETX A;  5B1B H;  1GVD A;  3FM3 A;  2P6T A;  2LC2 A;  2JSC A;  2JA7 J;  3I71 A;  3V8J A;  4S05 A;  3HSR A;  1MW7 A;  2CFX A;  2ZXW H;  1F5T A;  4BY7 J;  4YEL A;  3L2U A;  3M8F A;  1O3Q A;  4B44 A;  4BQA A;  2QSF X;  2IA1 A;  1T2K A;  3CCS I;  2Z33 A;  3C2G A;  5E3N A;  3IWF A;  3L9F A;  4XKC A;  1X1D A;  4XOT A;  5IP9 J;  4HNV A;  4OOI A;  1U5T B;  4PJJ A;  2CQQ A;  1V3F A;  2E7W A;  4PJN A;  5F0F A;  4CCJ A;  3CO6 C;  1G3T A;  1TW2 A;  3CCY A;  1Z21 A;  2JUG A;  3A2K A;  3P9C A;  2VAS A;  5FFX A;  2O8K A;  1ZR2 A;  2DA6 A;  2B7E A;  4QPQ A;  4C9Y A;  1RET A;  1I3A A;  4G6Q A;  3DKW A;  4WWC A;  5FO5 A;  3FM5 A;  2DA5 A;  2VIX A;  1ZKG A;  2ECC A;  3BC8 A;  1YIT I;  1FOK A;  2OJE D;  4XMY A;  2D1H A;  1UST A;  5L3D A;  3HOT A;  1FEX A;  1OYY A;  3EUK L;  1ZG5 A;  3HRS A;  4OIR F;  4A3I J;  1FYK A;  2IW5 A;  3F8C A;  5M5Y J;  5D6F A;  1WKM A;  2VLA A;  2DYS H;  1U9N A;  1IN7 A;  2VBW A;  3P5J A;  4ENM A;  1YHQ I;  2NS8 A;  2Z3Y A;  4KYW A;  5C4X J;  1I39 A;  5B3S H;  3MMY B;  2QA4 I;  5JFR A;  1FWZ A;  2PN6 A;  2FU4 A;  3S1M J;  1LB2 A;  4O3M A;  4G8X A;  1QZE A;  1ZTR A;  4V2F A;  2L9V A;  1ZK8 A;  2JZY A;  5EJC A;  2DTZ A;  1HXD A;  1NG7 A;  4NQW A;  4BXF A;  3V7R A;  1F36 A;  4M6V A;  1BI1 A;  5J1R A;  2HOE A;  3WE3 A;  3KEQ A;  2NVX J;  3REO A;  1S7O A;  4FTH A;  3WGH A;  5J40 A;  2LLK A;  2K4J A;  4I09 A;  4IQJ A;  4ZDP A;  5LFA A;  1VQM I;  3W3C A;  3G4S I;  2OV7 A;  1RC9 A;  2Z5U A;  2VXZ A;  3J7Y J;  1DP7 P;  3X2Q H;  1OYW A;  1Y8Q B;  1K4S A;  2COM A;  2LRD A;  1QVT A;  4G12 A;  4ON0 A;  4YIF A;  3K70 C;  5J4V A;  2Z9O A;  3I58 A;  1K6Y A;  1WFX A;  4BL0 B;  1GVJ A;  1O3R A;  1IXS B;  2VJ4 A;  4HG2 A;  4ZDO A;  1NG6 A;  2ICW G;  4KA4 A;  1M1E B;  3KX2 A;  1S7E A;  2LTP A;  3BG7 A;  1RKT A;  2XGE A;  3R0J A;  3CC7 I;  1LFU P;  1WRJ A;  2OF7 A;  2PJR B;  5IOZ A;  5LGN A;  3GFL A;  3K4N A;  3ZMS A;  4WXC A;  4ZC3 A;  4KT6 A;  3T0Y A;  4BY1 J;  3GXO A;  1LFP A;  5L3G A;  3J80 K;  2E71 A;  5GAE J;  4IRI A;  2FUG 2;  3HKZ A;  4LGW A;  2PQ8 A;  1E0E A;  4XN0 A;  4LLG F;  4Y3O A;  4A3C J;  3VOE A;  1QBJ A;  3CO7 C;  2QSH X;  3PSF A;  2RNG A;  2FBH A;  5M5X J;  4WX9 A;  2Y2Z A;  4KN7 X;  2XDV A;  2KIQ A;  2CV1 A;  1AU7 A;  2LR8 A;  3JRH A;  2F4M B;  3WG9 A;  3M1E A;  2QF7 A;  4AIJ A;  1FMW A;  3QAH A;  2HDD A;  1Y39 A;  1IV8 A;  2HVS A;  4V2G A;  1T6S A;  2F4O B;  1MGT A;  2W85 A;  4Z2Y A;  2UV1 A;  2GXA A;  1R58 A;  4BU2 A;  2MG4 A;  3MFK A;  2HOS A;  2BZT A;  2PX9 A;  4RAZ A;  1MMD A;  1TT5 B;  1R1V A;  3LAJ A;  2M45 A;  3ZMU A;  4B3A A;  2V1N A;  2W7N A;  3LNQ A;  1JGG A;  1E2X A;  5EZG A;  4F52 A;  3QWL A;  2F5V A;  3S8P A;  3EET A;  2DA7 A;  5CVU A;  5DTD A;  3E0J B;  2JMW A;  2HYF A;  1BJA A;  2XGD A;  4KUM A;  1XG1 A;  1DGR M;  3HRM A;  1J59 A;  2HFH A;  2MC3 A;  2HYJ A;  1AKH A;  3PFI A;  3FIW A;  2L3D A;  4LIT A;  4MGR A;  4PJL A;  2DTR A;  4GYG A;  3F22 A;  1MDM A;  2ZME C;  3BCA A;  3B02 A;  1VQ6 I;  2QSG X;  1QVU A;  2E2I J;  1JKR C;  2GOM A;  3ZR8 X;  5F0C A;  5GAD J;  3K2Z A;  4ASN A;  5IYC J;  5DM7 F;  3BZK A;  2DO7 A;  2LNB A;  2Q2E B;  2XB5 A;  4OMZ A;  3L2Q A;  2L7M P;  2E1M B;  3Q5F A;  4CDG A;  2DYR H;  2M8G X;  3TBI A;  1P92 A;  4D9J A;  5IT9 Z;  3VSK A;  2R7Q A;  1SD5 A;  4IKF A;  1FBQ A;  3JRD A;  3CME I;  3KP6 A;  3FWE A;  3DLL F;  2VB6 A;  4PK4 A;  4AVZ A;  3WTX C;  2K5C A;  3FXK A;  5E8I A;  1ZRC A;  2ZXJ A;  3KCC A;  1NH3 A;  3CUQ C;  4PGG A;  2VKH A;  5M5W J;  2O8X A;  4UV9 A;  2DMP A;  2W25 A;  3V4G A;  2WY7 Q;  4XRS G;  3I3L A;  4A93 J;  2DMU A;  3TGN A;  4CO8 A;  1TTY A;  1MBE A;  1BC8 C;  3AFH A;  5BNG A;  4S0H B;  2O61 A;  3C3W A;  3DP7 A;  2FOK A;  4YFK F;  1FOX A;  2KQR A;  3ZMZ A;  1W5S A;  3CCR I;  3AG1 H;  6PAX A;  4BHB A;  3RI4 A;  3L7W A;  4IO9 F;  2RRE A;  3M3Y J;  4HV5 A;  2AQE A;  1X2M A;  3RDI A;  3HHG A;  3E6D A;  2VL8 A;  2JRM A;  3V8K A;  5HDK A;  3HBL A;  1WZ2 A;  3LFU A;  1IZ1 A;  1IW7 F;  3SEQ A;  3OYD A;  5IYD J;  5CKT A;  4CZC A;  1MJB A;  2W1O A;  4M9X A;  1FC3 A;  2D1V A;  2EPF A;  4U88 A;  3KIO A;  2Y48 A;  1KYZ A;  1WJC A;  3ESW B;  4LB6 B;  1I3Q J;  2QM3 A;  4B4C A;  3DPU A;  3I54 A;  4HA8 A;  4XM3 A;  5KAI C;  1J5Y A;  1T8I A;  3DBH B;  4EVI A;  2EFP A;  1RR7 A;  4XK4 A;  4XON A;  2ZSH B;  1XTA A;  3IH4 A;  1V5G A;  3R61 A;  4MFE A;  4F3Q A;  5JLX A;  1WI9 A;  2BXZ A;  4FAS D;  3BT9 A;  4MHG A;  1K7A A;  2KFD A;  2ZJR F;  1DGW Y;  1XPX A;  2B63 J;  2DU9 A;  1MH3 A;  1BIB A;  3S1R J;  2HVQ A;  2JT1 A;  2RGV A;  4NHJ A;  1MJ9 A;  3OL4 A;  3HUG B;  3K1N A;  2HOA A;  4FCY A;  3IH3 A;  3NWT A;  3TO7 A;  4HNT A;  4I01 A;  2HQA A;  1VI0 A;  3IUO A;  3MCZ A;  4DGW B;  2M7A A;  2D45 A;  2WC2 A;  3F72 A;  2ESN A;  2BY2 A;  5HLT A;  4ZYE A;  2ID6 A;  4Y17 A;  2R7F A;  1DUX C;  3LSK A;  2AS5 F;  5D4R A;  1LDK B;  2Y0S A;  5LGU A;  3CCM I;  3JRB A;  1VQN I;  3GW2 A;  3LA3 A;  4RDU A;  3FKI J;  2IGN A;  5HOD A;  2Q8K A;  1I1G A;  1HLV A;  3ZQF A;  2R5Y B;  4XL9 A;  4BBR J;  2P7V B;  4CCN A;  1SMT A;  3ELK A;  4KNY A;  3Q0V A;  1WPK A;  5FKM A;  3BR0 A;  1BI3 A;  4PDK A;  1WJ5 A;  1QPI A;  3DTE A;  2FXA A;  4E7K A;  3I56 I;  3MZ8 A;  3S3O A;  1MKM A;  2M9H A;  3H3V K;  2R7X A;  4XLP F;  2K9N A;  5BMZ A;  4UXN A;  2CUJ A;  2R7S A;  2HKX A;  1DPU A;  3F23 A;  3O6B B;  2K4B A;  2CQX A;  3H3U A;  3DTK A;  1Z67 A;  2BV6 A;  1IN6 A;  2DCE A;  5TJJ A;  1S7A A;  1FNN A;  1UHW A;  1B6A A;  1W7P B;  1YO5 C;  5L3F A;  3F6V A;  2OU2 A;  1ZYR F;  4EM1 A;  1DP3 A;  3W6V A;  5FKL A;  1ZG3 A;  1FSE A;  2CUE A;  2CW7 A;  3LA2 A;  4JX4 A;  4B43 A;  2VOO A;  1UMQ A;  3RQ4 A;  5HOO A;  2CGP A;  4LMY A;  4BDY A;  1JT6 A;  4NC7 A;  2CJJ A;  2E35 A;  1R5I D;  5LRS A;  3FIS A;  4I0B A;  1KU7 A;  3BDD A;  2AHQ A;  2IT0 A;  1EH7 A;  2CMP A;  2JRT A;  3I59 A;  1YRN B;  2DFH A;  4FT8 A;  2UUZ A;  4BNC A;  1EH8 A;  5F1J A;  2P0W A;  3FXO A;  3BTI A;  3KPH A;  4I0A A;  2CWE A;  4Y13 A;  1KU9 A;  3JR9 A;  3PL8 A;  3D1N I;  3GTL J;  2DDA A;  5DD8 A;  3S32 A;  1A36 A;  2XAG A;  1IF1 A;  4HF2 A;  3PNT A;  4U0W A;  1GXP A;  1PJR A;  1ETK A;  4AID A;  3OIQ A;  2KT0 A;  2W4S A;  3GFJ A;  2P7C B;  3E5X A;  2LF7 A;  3GWZ A;  3QP5 A;  5H6R A;  4LG0 B;  5DDG A;  1I50 J;  3S3M A;  1TWF J;  1BI2 A;  1N25 A;  1ZN2 A;  4HQM A;  2IBD A;  4UV8 A;  2ZC2 A;  5D5V B;  5D5U B;  4G7O F;  4D1Q A;  2K85 A;  2WV1 A;  3OYH A;  5BPI A;  3CC4 I;  4RGU A;  2DT5 A;  2LRE A;  3KZI C;  4ZYA A;  3NRV A;  4UNO A;  2QCO A;  3BCB A;  3TW7 A;  4KMU X;  4WF2 A;  3VFZ A;  1FTZ A;  1TC3 C;  2VQC A;  2XAU A;  3KP2 A;  2IS2 A;  1E3P A;  1MMG A;  3WE2 A;  1G2H A;  2JWT A;  4RAF A;  4V19 K;  4UB8 C;  3MZY A;  4IXA A;  4FX0 A;  4C2T A;  3TL4 X;  2XRL A;  2RNJ A;  3SFI A;  1B4A A;  2DMT A;  3BP8 A;  4IOC F;  2K3P A;  4UUS A;  4W97 A;  2CYY A;  1FMV A;  1ETV A;  5LBQ A;  2EZI A;  4UUV A;  1B8I A;  2GM4 A;  2F5E A;  2MFZ A;  2VI6 A;  1MJA A;  3W6K B;  1IG7 A;  4A6E A;  3M8E A;  5J1U A;  1X3W B;  2FQ4 A;  2DW4 A;  2QVO A;  3AL0 C;  1W7P D;  1CF7 A;  4XR6 A;  5BQT A;  4XID A;  1T39 A;  3HZJ A;  3GCM A;  5KCM A;  2BOL A;  4HBL A;  3D5L A;  3DFG A;  2G9W A;  3OYE A;  3WGI A;  2IS6 A;  4RS8 A;  3KLN A;  2C6Y A;  1T95 A;  5E17 F;  2K27 A;  1H9T A;  1LKX A;  2DAO A;  2EZK A;  3FHN A;  4ENN A;  2XGC A;  2FD5 A;  3F0C A;  3OYB A;  2AXL A;  2HOT A;  1UHS A;  5K5O A;  1OLT A;  2DLL A;  3E6B A;  4UB6 C;  4WXD A;  4ZTJ A;  2ESH A;  2F4I A;  3CDI A;  1FPQ A;  4XRS A;  4A3G J;  5L3E A;  3AAF A;  4PFP A;  2O0Y A;  2MLG A;  5KAF C;  2J5O A;  5J47 A;  3QYE A;  1JUS A;  2E19 A;  1U6G A;  2K7L A;  3H5A A;  1H8A C;  4BBS J;  4OIP F;  3KE2 A;  2G0E A;  3BWG A;  4LFU A;  5EEA A;  1YX5 A;  2ID3 A;  3OR2 C;  5GTI C;  3PNV A;  1QZY A;  3K4K A;  1XMA A;  4NC6 A;  1JUM A;  2F6C A;  2V1D A;  1JJ6 C;  2HNH A;  4R79 A;  4A5M A;  3Q3S A;  4G94 A;  2VN2 A;  2CV0 A;  2FJ1 A;  1ZHF A;  2CW0 F;  1U5T A;  3QPS A;  4RGS A;  4F7Z A;  1LDJ A;  5EEH A;  1R22 A;  2F5F A;  3DF8 A;  4IPA A;  2ELK A;  1TWA J;  5LEJ A;  4BE2 A;  3FDY A;  1QHH D;  3RPU A;  1BR1 A;  3LA7 A;  4C3I J;  1NTC A;  4XN3 A;  1I6X A;  2ADU A;  3K1M A;  3K4L A;  1IXR C;  2DN0 A;  4IHY A;  4RLQ A;  4JOM A;  2JA6 J;  1KQ8 A;  4P9F A;  1QPM A;  3BR6 A;  2XPV A;  5K7Z A;  2NRA C;  3DTI A;  4YIR X;  1MBF A;  3DLA A;  3JRC A;  3JSP A;  3O2P E;  4IHT A;  3UR3 C;  2R7T A;  3CP8 A;  2VKV A;  3CF2 A;  1A31 A;  2NOG A;  4YII A;  3A0H C;  4KIS A;  2FMY A;  3GFM A;  1RUO A;  5HLG A;  2EFO A;  3F3X A;  1XGS A;  2Q1Z B;  3FXU A;  3MN2 A;  2L7F P;  1ENH A;  3N05 A;  5H6Q A;  1MH4 A;  3C2H A;  2ISY A;  1B9M A;  1SFK A;  2OUM A;  2R4G A;  2BBY A;  3VB2 A;  3GX4 X;  4PUS A;  4HX8 A;  5K7F A;  1C0W A;  2OD5 A;  5F04 A;  1G59 A;  2PJP A;  4I6Z A;  5M3F J;  3KEO A;  2VC1 A;  3JAM K;  1HSJ A;  1R71 A;  2OBP A;  1QNT A;  1VF9 A;  3HDD A;  1ON1 A;  3ZQH A;  2VQH A;  1JKO C;  3RCO A;  3S2D J;  4A0Z A;  2R7V A;  2WWY A;  4IVN A;  3VYT B;  5HS8 A;  1MSF C;  3SFZ A;  1WJD A;  4NUB A;  3T1B A;  2MH2 A;  1TP4 A;  3WHB A;  3CCJ I;  3NQO A;  2VBY A;  2DMQ A;  2EIM H;  2FEZ A;  2ZME B;  2DBB A;  3TOA A;  1SC7 A;  2CQK A;  3K70 D;  2H94 A;  3HJE A;  3LFK A;  2ZSI B;  1Y0N A;  2HDC A;  2EIJ H;  3EYY A;  3B6A A;  3OOU A;  3DQV C;  4HLX A;  2UXX A;  3HOW J;  1JGS A;  1LEB A;  3U21 A;  4RBO A;  5IPA A;  1ZH5 A;  2PMH A;  1HA8 A;  2CV2 A;  1O57 A;  3FBN B;  1R00 A;  2DXI A;  1F43 A;  1GLN A;  1FSH A;  4I99 C;  2HXI A;  2XAF A;  3PIO F;  1WH7 A;  3JRG A;  2PJR A;  5IY5 H;  3FXJ A;  4IX7 A;  1FOW A;  1XB4 A;  4L9N A;  4M9S A;  1IDY A;  3BG5 A;  2R7U A;  1FIP A;  4CIC A;  3CUQ B;  4QPO A;  4A6D A;  4A3K J;  1JUP A;  1TNS A;  2X1E A;  2JA5 J;  2GA2 A;  4P96 A;  4B1R A;  1GV2 A;  2BVM A;  3A03 A;  3HRT A;  1A35 A;  1STZ A;  1CQT A;  2MH9 A;  5DCM B;  1IJW C;  1R1U A;  1OYI A;  3HEF A;  2L7Z A;  2P6S A;  4HNU A;  1VQP I;  3MVP A;  5E79 C;  1BW6 A;  1Z0X A;  4BE0 A;  3C2B A;  3QOP A;  1HDD C;  2A07 F;  3A1Y A;  1VZ0 A;  5C44 J;  3CCU I;  1YE9 A;  4KN4 X;  2M0M A;  3TQN A;  4MEX F;  2IRF G;  1XGO A;  1S6L A;  1BW5 A;  4JQF A;  3A01 B;  1YLF A;  2K9L A;  1QO0 D;  2BGC A;  2XPU A;  4XOP A;  4HLY A;  1BM9 A;  3WTW C;  2HR3 A;  2HTS A;  4XLF A;  2CQN A;  2ZFU A;  1XDS A;  1XDU A;  3PIP F;  5L3B A;  4EMS A;  3JRI A;  1XSV A;  3R4K A;  3FXR A;  3RQI A;  1RPW A;  5E1X A;  1O3T A;  1XD7 A;  1MBK A;  2J5P A;  2P4W A;  3GO5 A;  3SZP A;  3ZCO A;  1HCR A;  4CHU A;  3C18 A;  4EJV A;  2LYC A;  2RN7 A;  1LNW A;  1YYV A;  5CPR B;  4HSR A;  2H8R A;  2KRC A;  1JJ8 C;  3GF2 A;  1D8K A;  5GPA A;  3ZQQ A;  2XSJ C;  2VJJ A;  4HQE A;  4A5N A;  5J3L A;  1XSD A;  4B09 A;  3I53 A;  3DPT A;  2CG4 A;  2R5Z B;  2Q2E A;  1Y56 A;  1MNM C;  1V55 H;  2A61 A;  1HKS A;  3W2W A;  3WU2 C;  4UY8 I;  5IYB J;  1Z7L A;  2K9S A;  4U87 A;  1YJ9 I;  4Q4Z F;  3CCQ I;  3H5R A;  2IS4 A;  5TGT A;  4PJM A;  3TO9 A;  3VEP A;  4ABZ A;  5A2Q Z;  2JN6 A;  1P9Q C;  4ZJZ A;  5E1Z B;  1G6N A;  1FYM A;  2RAE A;  4BYY A;  1O3S A;  3ABL H;  4L5I A;  5IOY A;  3JRF A;  3PNY A;  1TQM A;  2Y9Y A;  2PLY A;  3CCV I;  2K3F A;  4GYI A;  1EV7 A;  3GZ5 A;  1Z6R A;  3GLL A;  3H5N A;  5DEQ A;  3BOQ A;  5AON A;  4DW6 A;  3CJN A;  3ZQI A;  1R36 A;  3BY6 A;  1X3U A;  2ZJQ F;  1VQ8 I;  3WTS C;  1N77 A;  2V4J C;  2VPL A;  2ZCW A;  3FXL A;  3JTG A;  1SMY F;  3EUA A;  1W4M A;  4C2U A;  3RZO J;  4E7S A;  5J4Y A;  3PUB A;  1HKQ A;  1PYV A;  2EB7 A;  4WCG A;  3K4J A;  1DU0 A;  3RZD J;  3DBL B;  1FIA A;  1SVL A;  2YU9 J;  1WJF A;  1Z3Y A;  5FLX Z;  4XKB A;  5CVV A;  4HAM A;  2GIZ A;  4RAY A;  3HGY A;  1A6Q A;  3GTP J;  1HST A;  3U1K A;  4IEJ A;  1S29 A;  1JTX A;  1WVR A;  1WGX A;  1K79 A;  3T8R A;  3CLO A;  2FRH A;  2A6E F;  1VQ5 I;  1OCO H;  2MD5 A;  4IRG A;  4AYB N;  4DIQ A;  3ABU A;  2OA4 A;  1TT0 A;  1CGP A;  2VBX A;  1VND A;  2O5R A;  2FBK A;  3CQZ J;  2EZH A;  2HWV A;  1XX5 A;  2CH0 A;  2DOA A;  2QQA A;  5H2F C;  5JHF A;  3Q0U A;  1TLH B;  3S1Q J;  3Q9V A;  2XF7 A;  4HF1 A;  4JK1 X;  3BG9 A;  1KYW A;  1J75 A;  4G7H F;  2M2E A;  4LIU A;  1XS9 A;  2AXT C;  4QSH A;  2DA1 A;  2R7O A;  5LD2 C;  2P81 A;  5C4J J;  5CQG A;  4RB2 C;  2QQB A;  2E7X A;  4ZZD A;  4KIF A;  2R7W A;  2FSW A;  1LEA A;  4FHT A;  2EBI A;  2G7H A;  1K61 A;  4LG3 A;  3HUG A;  3H35 A;  4G6D A;  4HST A;  4BHP A;  4F93 B;  4BDZ A;  4M9Z A;  4E7J A;  5HLI A;  3N97 A;  1HDP A;  2JPB A;  3S3N A;  3NWS A;  3CC2 I;  2ZO4 A;  3FMQ A;  1FX7 A;  1HQC A;  1R49 A;  1ZR4 A;  3FX3 A;  1T0F A;  2HTJ A;  3HPH A;  4HX7 A;  4E7Z A;  4CYD A;  1TW3 A;  1G8X A;  2KKO A;  3PQJ A;  3OY9 A;  4LLL A;  3M1C A;  4N4N B;  4BQQ A;  3E5U A;  2MSY A;  4CA0 A;  4EJW A;  2OCE A;  1ZLJ A;  2XIG A;  2R5Y A;  3IV5 A;  4XLE A;  2BXY A;  3G3Z A;  3VOD A;  4IQ4 A;  3RTR A;  3U2R A;  1WQ2 A;  5DCF A;  3OS2 A;  4O6J A;  4L18 B;  1P2F A;  2FML A;  2G7U A;  3IKT A;  3KP3 A;  1R4N B;  3ZPL A;  2PMZ N;  4EGZ A;  4KT5 C;  1FYL A;  4EM2 A;  5F64 A;  3F8N A;  4IHW A;  1KQ0 A;  1X4P A;  2R92 J;  4DNC A;  1MNE A;  3V7C A;  2XVC A;  5FB2 A;  1UCR A;  4P55 A;  2EIN H;  4HF0 A;  3TO6 A;  1WWX A;  2DT6 A;  2H1K A;  1HKT A;  1HW2 A;  1W7P A;  2BW3 B;  4CUG A;  1ZEL A;  3KYC B;  2WAQ N;  1W1W E;  4C2M J;  1UJ8 A;  2R7D A;  2H8W A;  3GTK J;  4E6K G;  5C3E J;  2M87 A;  1MND A;  3K69 A;  5LHG A;  3GFI A;  5BOX A;  3DXJ F;  3OYL A;  3U1D A;  3MZH A;  4BKX A;  2BVL A;  3H9Q A;  1GUU A;  5FRN A;  3KZY A;  4YG2 F;  4DOZ A;  3BPV A;  3BJA A;  3K10 A;  3DEU A;  2L4A A;  3OV8 A;  1HW5 A;  2I5U A;  1FOY A;  1YRN A;  2OC6 A;  1H9G A;  1UEL B;  2FF4 A;  3DEE A;  4DBQ A;  4BXX J;  4B47 A;  3OMY A;  3BZC A;  4UVB A;  2TRT A;  3BR3 A;  2L9R A;  2YSR A;  4HPQ A;  2X1C A;  2LBF B;  2QBY B;  2ME0 A;  1S8N A;  2O6G E;  2OZ6 A;  5E8G A;  3IP4 B;  3EYI A;  2YR2 A;  2XGX A;  4LG0 A;  1IV6 A;  3WHC A;  5E18 F;  3FMS A;  1R23 A;  2NNY A;  2PG4 A;  5JVG F;  5FKO A;  1IUY A;  2N8G A;  2ZNZ A;  2DFF A;  4CSW A;  4C3J J;  3BJO A;  2IAI A;  4C30 A;  1WHU A;  2E5N A;  2M1B A;  2XF5 A;  2JTV A;  5AIQ A;  1DQU A;  3BJ6 A;  3K4C A;  2KDZ A;  3R0A A;  3JW4 A;  3L2R A;  4BHC A;  1A04 A;  3FXM A;  1JHF A;  1GT0 C;  2DPU A;  1IRX A;  1D1A A;  2W82 A;  1XMX A;  5LHI A;  2F48 A;  4N9I A;  1RIO H;  2XAJ A;  3ECO A;  1WSU A;  2L7K A;  3RKW A;  3OYG A;  3BLY A;  1MBH A;  3MWM A;  1R9T J;  2Y0M A;  3CMY A;  5E3O A;  2JVG A;  1FBS A;  1FY7 A;  3QPH A;  1XGM A;  3M07 A;  1KON A;  4GO1 A;  5HS7 A;  2KDO A;  2CS3 A;  3ZQG A;  1Q1V A;  3QQA A;  4AU7 A;  4J00 A;  1W36 C;  3S2W A;  3BG6 A;  3TW6 A;  3HGG A;  1BJZ A;  4ZTF A;  3FK6 A;  4M72 A;  3V42 A;  4E7I A;  3SDG A;  3FKJ A;  3L00 A;  4BS9 A;  4XRM A;  3OYJ A;  4Q5S F;  2ZXI A;  3H3Z A;  3HTS B;  2NXN B;  4XRF A;  1P7I A;  4P1W A;  1ZGJ A;  2VE9 A;  4EGY A;  4D7N A;  2RV8 A;  4ESB A;  2LMD A;  5KHD A;  2HDW A;  1P7J A;  2A5Y B;  2KMU A;  3WU1 B;  4R1H A;  1EA3 A;  4BEH B;  1YIJ I;  1JT0 A;  4BJ6 C;  1XGN A;  2QLZ A;  4L5E A;  1W5T A;  3S2H J;  4XSZ F;  1U9O A;  2DJI A;  2M7B A;  2MD0 A;  2PBI A;  3M4O J;  2VC0 A;  3HB9 A;  1F1Z A;  4Y7N J;  1O4X A;  1N78 A;  1E17 A;  1U0J A;  3LSM A;  2KPM A;  4ANJ A;  4M3E A;  5D8L B;  5HDG A;  3TMO A;  1BIA A;  4LK0 F;  1R5H A;  1LE8 B;  4MIM A;  5B1A H;  3S14 J;  2R7R A;  2KZG A;  4AVP A;  1MMS A;  3E7L A;  4HYE A;  4Q47 A;  4M74 A;  2MC4 A;  2HPM A;  2IEK A;  5JVT A;  4NC8 A;  5JLW A;  3HRU A;  2LFB A;  2EQR A;  2W84 A;  2QQ8 A;  2BHZ A;  1E3H A;  5FKN A;  5JHU A;  3V7S A;  3GTM J;  2Y0S N;  3J80 Z;  1PDN C;  1B1B A;  5DUK A;  2ELJ A;  2KIM A;  5GAG J;  5F1R A;  4I7H A;  5BPD A;  3PFY A;  2UXN A;  2D5V A;  1IRG A;  4DYQ A;  2QEX I;  3G71 I;  2VQG A;  3COA C;  3OYF A;  3OWT A;  2BY3 A;  2E36 A;  1PP7 U;  2F2E A;  1VQL I;  5GTH C;  1YW8 A;  2L54 A;  1UHM A;  2DPD A;  1OR7 A;  2JVH A;  3D0S A;  1FBU A;  5IP7 J;  4ZYG A;  4JP0 A;  4BJ5 C;  3ZRG A;  1I5Z A;  3GTJ J;  1MSE C;  1EF4 A;  3Q9S A;  2A05 A;  1DPR A;  1ZQ3 P;  2EV5 A;  4II3 A;  2CU7 A;  5EG0 B;  4L9T A;  1EH6 A;  1JTY A;  4HX4 A;  2DOF A;  3IAM 2;  4G7Z F;  2X9D A;  3ASN H;  4N9H A;  1PUF B;  3ULQ B;  2LDU A;  3H36 A;  1YI2 I;  5J6X A;  2YX7 A;  1JKP C;  2CUF A;  3LQR A;  2GIV A;  3HG9 A;  2EIL H;  5J8C A;  2NVT J;  1UAA A;  1OFC X;  4DJA A;  5FLV A;  3FMR A;  5GPC A;  2V79 A;  3K9T A;  2GBY A;  2F5D A;  2M0C A;  2CRG A;  3GYH X;  1QQI A;  2IP2 A;  3P9I A;  2L2O A;  1A5J A;  1TWG J;  5HNF A;  4CGZ A;  3DU5 A;  4F55 A;  2X6X A;  2JUC A;  1OCR H;  4G6T B;  2AO9 A;  3GME A;  3CCL I;  2A6H F;  3J81 Z;  5CJ9 A;  2EA2 A;  4AUX A;  4MO7 A;  3HOX J;  1BN5 A;  2ZME A;  2EIK H;  1PUE E;  2WA0 A;  4A3B J;  3B73 A;  3IKV A;  1J0R A;  2YS9 A;  2KRH A;  5IP6 A;  1T98 A;  3I4M J;  3UNG C;  5FRO A;  3HOV J;  2XF6 A;  4BH9 A;  2GQQ A;  3I5U A;  3CJR B;  2D2W A;  5KNL A;  3S15 J;  2WAF A;  4LOC A;  1IDZ A;  3TOB A;  2GOX B;  5ILU A;  2BY0 A;  2E5Z A;  3CMA I;  3KP4 A;  4RGX A;  2VQL A;  2DQL A;  2E34 A;  3L2W A;  1EJ9 A;  3A0B C;  3GVA A;  4AIH A;  2VT3 A;  2P5L C;  3QRF F;  1FP1 D;  4HW0 A;  4U0V A;  4M3D A;  3CUQ A;  1SFE A;  2MBF A;  4D0P A;  2XSD C;  3IRQ A;  1H88 C;  2CUZ A;  1YIO A;  3QYF A;  1UZC A;  3R60 A;  2FQ3 A;  1D0Z A;  2EFN A;  1ULY A;  3HM5 A;  2X6O A;  5DCM A;  5EGO B;  3E5Q A;  3N4M A;  5EZH A;  2PMU A;  4XOR A;  2DT7 B;  1RES A;  2H6B A;  3K7A J;  3V8L A;  1D5Y A;  1IN4 A;  3H0G J;  4P9U A;  1FP2 A;  1ACI A;  5EYR A;  1AA7 A;  5FRM A;  4BQN A;  2DFE A;  2V6E A;  1G3S A;  2HS5 A;  2IGO A;  3A01 A;  3GTQ J;  1Y1W J;  3PSI A;  2WB1 N;  4MQV A;  3P9K A;  5DV5 A;  5HS9 A;  3LSP A;  5K5Q A;  1R5G A;  1YOV B;  2JSP A;  1P6R A;  2CO5 A;  1F4K A;  2MLK A;  3H9G A;  3BR5 A;  1T0F C;  1ORK A;  2KJC A;  3TDZ C;  1ZGW A;  2VON A;  1D3Y A;  2MAB A;  4II2 A;  2V6C A;  4LD5 A;  4LB5 A;  1YW7 A;  5CVR A;  3FHZ A;  3QPT A;  2KIU A;  3JRE A;  4OU0 A;  3HTU A;  4N0B A;  4E70 A;  2HGC A;  1D1C A;  3DKX A;  1B72 B;  1WJA A;  5JI6 A;  1JE8 A;  2NVQ J;  4QWQ A;  2FE3 A;  2IS1 A;  4FX4 A;  4U7B A;  1J7K A;  2BYV E;  1MBJ A;  3EPZ A;  2YX4 A;  3FF5 A;  4AD9 A;  1V5E A;  2BHY A;  2WAD A;  2X4H A;  2E1C A;  1S3J A;  4PZJ A;  4XNF A;  3W2V A;  4NNJ A;  3ZN1 A;  4CCL A;  1ZAR A;  2DOD A;  3GZ6 A;  4ETS A;  2R5Z A;  1RRJ A;  3LOC A;  4JX6 A;  2E60 A;  2F5C A;  5LHH A;  2W48 A;  4MEY F;  3ABM H;  4CYC B;  3OYA A;  3WG7 H;  2E2J J;  1XCV A;  2PI0 A;  4KMF A;  2HQ5 A;  4OAZ A;  4PJ0 C;  4DZP A;  2VT2 A;  2Z16 A;  1D8J A;  3EUH A;  1RR8 C;  3JRA A;  2KIF A;  4A3J J;  1QU3 A;  5IT9 K;  3OYK A;  2VKE A;  3L1P A;  2A5W A;  2OAZ A;  3KET A;  3JTH A;  1X2N A;  5DYM A;  3WTV C;  3T8T A;  1ZAO A;  2VUM J;  4XIC A;  2JQ7 A;  3ZMD A;  3ABK H;  4J19 A;  1AWC A;  3NAR A;  4KIT B;  4XKV A;  1X1C A;  1OJL A;  5FKK A;  1S72 I;  5E3M A;  4WK8 F;  5JR3 A;  2VJ5 A;  5K5R A;  4HEA 2;  1Z6T A;  4L9V A;  2QZ8 A;  4FE7 A;  3F8M A;  3LL7 A;  2NYX A;  1ETQ A;  1K83 J;  3VDX A;  3KYL A;  2ECB A;  1VQ4 I;  2XAH A;  2HKO A;  5ICG A;  2EV0 A;  2VPR A;  2Y69 H;  3OIP A;  4KIG A;  2LVS A;  5D8K B;  1IRF A;  2RQQ A;  1ZGA A;  1ETY A;  1SFX A;  5M3M J;  4RB0 A;  1YX3 A;  2O3F A;  2WY8 Q;  3AG4 H;  1D0Y A;  2A69 F;  3LSG A;  4XQF A;  3J7A Y;  1NK3 P;  2W57 A;  1KA8 A;  2L0K A;  1ERD A;  3R6S A;  3RYR A;  3W2A A;  5CLS A;  3HOY J;  3OL3 A;  2NNN A;  5EDN A;  3UKG A;  2QWW A;  3IHU A;  4LLN A;  1IN5 A;  2KL4 A;  2YU3 A;  3G1L A;  4OIO F;  1YFH A;  2DK8 A;  2XRN A;  2MYS A;  1D5V A;  4OMY A;  3CJQ B;  9ANT A;  5ICF A;  3ZN0 A;  2DA4 A;  2XAQ A;  2P5V A;  4A0X A;  3F9K A;  4GCV A;  5ICE A;  2GLO A;  5CVJ A;  4R8H A;  5DD4 A;  1SFU A;  4RMN A;  4EEF G;  2GXB A;  5HNH A;  4RM3 A;  1T38 A;  2HYG D;  1H0M A;  3IAS 2;  5FFZ A;  2HPI A;  4LJZ F;  4KFC A;  4MQ9 F;  3SEZ A;  2ISZ A;  3ZMV A;  2H27 A;  1LVK A;  3FZV A;  4M3G A;  5F6F A;  1KU2 A;  1K6O A;  4M6Y A;  3TKY A;  1ITY A;  3PO3 J;  1Y0U A;  1YS6 A;  4JX5 A;  1IC8 A;  2VOP A;  3HXL A;  2V26 A;  2HQR A;  3OYC A;  1IUF A;  3WGG A;  3OS1 A;  5ERI A;  1Y8R B;  1VFC A;  3PJR A;  4OIQ F;  1RKW A;  3D5S C;  3O8H A;  4IHV A;  3DCF A;  4A3L J;  4IHX A;  1MZB A;  1OCZ H;  1BBY A;  2FNA A;  5GP9 A;  1TQI A;  4GGG A;  2NS7 A;  4C3H J;  5J8F A;  4Y15 A;  4AYB A;  1KU3 A;  4EV0 A;  2XB0 X;  4ENK A;  4D5C A;  1XSX A;  5LLQ A;  1BOB A;  2RVC A;  1H89 C;  3PO2 J;  1HOM A;  3C7J A;  2EK5 A;  3LMM A;  1FZP B;  2AQF A;  5HLH A;  2QKL B;  3QU3 A;  3ZXS A;  2ZXH A;  4FET A;  1I6H J;  2CW8 A;  5FD5 A;  4B48 A;  1K78 B;  2Z2S B;  1OCC H;  3F21 A;  3E97 A;  1WJB A;  2XUB A;  2KZV A;  2XKO A;  2HI3 A;  1W0T A;  3ERM A;  4AWX B;  4BJT A;  3HIF A;  5AIP A;  4NBQ A;  1IGN A;  1V54 H;  3ML6 A;  2BW3 A;  4ZH4 F;  2A6T A;  2RQP A;  2R7Z J;  2OCC H;  3OS0 A;  1VQO I;  3I55 I;  2L5Q A;  1MBG A;  4KIC A;  1U8R A;  3E1S A;  3H9J A;  2QKM B;  4ZYD A;  5LRR A;  3CD6 I;  1VQK I;  1D0X A;  4E7H A;  4FIS A;  4QLC U;  3RPU D;  3EQL F;  3O3K A;  3TDU C;  2EFW A;  3O8G A;  3RSN A;  3FK7 A;  4E7L A;  1OCT C;  3I0T A;  4IHS A;  4MNU A;  2X0L A;  4A12 A;  4A0Y A;  4FE4 A;  3K4B A;  2CSO A;  1Y1V J;  2VJI A;  2KP6 A;  3EDP A;  4NDL A;  2FOW A;  3BRO A;  4CCK A;  4FQG A;  4UUT A;  1JKQ C;  3WU0 A;  2X85 A;  1SVO A;  4AC0 A;  1G4D A;  4Z6Y A;  1OR7 C;  2LBF A;  2WTE A;  1QRY A;  4GRI A;  5D4S A;  2OQG A;  5CQE A;  1YTY A;  2QBY A;  1IRZ A;  1JXS A;  3K2A A;  3I4N J;  3KLO A;  2HXO A;  1SAN A;  2PMZ A;  2EJR A;  2E2H J;  1PVE A;  1U8B A;  3LQQ A;  1P4X A;  4DYC A;  5DUI A;  2GAU A;  1QZZ A;  2Q0O A;  3QU6 A;  2CFO A;  4LK1 F;  2M30 A;  3MAJ A;  2ZJP F;  3ZGK A;  3GLX A;  2LY2 A;  4Y33 A;  2DMN A;  3MD2 A;  2KLO A;  3SQN A;  3MQ0 A;  4KIB A;  4P5O A;  3F6O A;  3OYM A;  3I9V 2;  4RM2 A;  3GEZ A;  2WAE A;  1EKE A;  1IAW A;  2XKP A;  1L3L A;  2WAQ A;  2HU9 A;  4H4K C;  1XN7 A;  2M4G A;  1X4O A;  2ZKZ A;  2ME6 A;  1UFM A;  1Z7U A;  3W6J B;  4B8X A;  2L4M A;  1BI0 A;  4M71 A;  1W36 D;  2OTJ I;  2X6W A;  2H6C A;  2ZJ2 A;  2E1N A;  5TIS C;  2DFI A;  3BG3 A;  1W0U A;  1ETO A;  1K4T A;  1J9I A;  2LKX A;  3HKZ N;  3Q0W A;  5K7H A;  3JAM Z;  1TBX A;  1VQ7 I;  1Z1D A;  3BTJ A;  4NQW B;  2LH9 A;  4PCQ A;  3ZQ7 A;  2P8T A;  1GDT A;  3RKX A;  1Z05 A;  1OMI A;  1X3Z B;  1Z91 A;  1N75 A;  2DJN A;  3LST A;  5L3C A;  3E6C C;  2O9L A;  1MD0 A;  2YUS A;  3HOZ J;  1TZL A;  3S16 J;  1I27 A;  2OPT A;  2ZB9 A;  1USS A;  1P4W A;  4EAT A;  1X1A A;  2IGK A;  3OR1 C;  3J81 K;  4BEH A;  4F92 B;  3BPX A;  3ZP5 A;  4Y4R A;  4EQQ A;  3MKY B;  1SD6 A;  5F0H A;  3AL0 B;  1TL8 A;  4AIK A;  2R3S A;  3CCE I;  3ZQC A; 
#chains in the Genus database with same CATH homology
 1ODD A;  2OZU A;  3LAP A;  1YS7 A;  1U5T C;  1G3Y A;  4A2U A;  1SD4 A;  2JPC A;  3SHF A;  5KK1 A;  3BZ6 A;  1LJ9 A;  1R7J A;  1ZRE A;  2EV6 A;  5ED4 A;  3WTU C;  2QQ9 A;  5KVR A;  3L09 A;  4ZYH A;  1OKR A;  4TV7 A;  1XMK A;  5IT3 A;  1ZRD A;  4I02 A;  1DDN A;  3WOD F;  1RI7 A;  2DI3 A;  1HBX G;  3WTT C;  1IN8 A;  5D5X B;  4EJO A;  2K86 A;  3I4P A;  4U0Y A;  3OOP A;  2VOD A;  5D6E A;  4MTD A;  1YQA A;  2M5W A;  5E1W A;  3E3V A;  3K0L A;  1U78 A;  1G3W A;  2NAZ A;  3M7G A;  4RB1 A;  2FBI A;  4YFX F;  4UHT A;  4ESJ A;  1FLI A;  4ZZL A;  2LF8 A;  3RKY A;  2STT A;  4BXU A;  4EJU A;  1MDM B;  3MEX A;  2A68 F;  3JSO A;  4H0E A;  3ERE D;  1GXQ A;  4MTE A;  2WV0 A;  2UWM A;  1Z9C A;  2QYO A;  1RNL A;  5BS6 A;  3ISP A;  1RUN A;  2HZT A;  2ZFW A;  4XBF A;  1ZRF A;  2K02 A;  3GUD A;  1F9N A;  1O7F A;  1B59 A;  2PEX A;  2Y75 A;  3E6M A;  1I1S A;  2XHK A;  3ZMT A;  1ZLK A;  2ACJ A;  2IVM A;  2HQN A;  2IPQ X;  4HV6 A;  2PFB A;  4XLN F;  2EWN A;  1L0O C;  2UZK A;  1RZ4 A;  1YW9 A;  2H09 A;  4RGR A;  3K1P A;  2YPR A;  2LSO A;  2GA1 A;  3IL2 A;  4GXO A;  2EFQ A;  1PP8 F;  2O03 A;  4IRH A;  1LQ1 A;  3FXQ A;  3HHH A;  2QEN A;  2NS0 A;  1VTN C;  5ILV A;  2HEO A;  4O5V A;  4M6X A;  3DPL C;  4HZF A;  2B0L A;  2IA2 A;  4L0Y B;  2TDX A;  5HVQ C;  2LKP A;  1SAX A;  1V4R A;  3KZZ A;  2ELH A;  4WXH A;  1TNT A;  3CDH A;  3U9G A;  2GXG A;  5ICC A;  2OQR A;  3SXY A;  2V1X A;  2KJB A;  1IXC A;  1B9N A;  1BC7 C;  1KQ9 A;  2W24 A;  2ZBK A;  3C1D A;  3QP6 A;  3RPQ A;  5E20 A;  2QUF A;  4I2O A;  2KRF A;  3IC7 A;  1REP C;  3ROU A;  1JHH A;  4KDP A;  4DQ2 A;  3T5X A;  4BAY A;  4NB5 A;  4HDU A;  4EJT A;  4ENJ A;  3SZT A;  4IJA A;  4S04 A;  3DV8 A;  1HW1 A;  2IJL A;  5TRD A;  4UVC A;  3HSE A;  2VE8 A;  5A2Q K;  1ZG1 A;  5HDN A;  2VBZ A;  2GZW A;  4XSX F;  3RIR A;  2A3S A;  4M73 A;  5FGM A;  2IA0 A;  2L02 A;  2DK5 A;  4IF4 A;  4OIN F;  2V9V A;  2XV4 S;  4RB3 C;  1J2X A;  1U2W A;  1R1T A;  1O7L A;  2XRO A;  1GHC A;  3KP5 A;  5LGT A;  1UB9 A;  5D5W B;  1P4A A;  5FLX K;  5LEK A;  1LVA A;  3P7N A;  3KFW X;  1XCB A;  3G73 A;  1SD7 A;  1TQP A;  4G9Y A;  1KGS A;  2XAS A;  4L9J A;  3RYP A;  5FD6 A;  2GWR A;  3NEU A;  3I59 B;  4CZZ A;  4YFN F;  2P5K A;  2MA3 A;  3J7A O;  1Q1H A;  4L0Z B;  2EA4 A;  4K2E A;  2FNP A;  5K1Y A;  4JBA A;  4PGH A;  1YG2 A;  3HOS A;  4EM0 B;  4Q48 A;  3H92 A;  3WTZ A;  3IRR A;  1BOA A;  1AOY A;  3PQK A;  4HDV A;  2STW A;  4UVA A;  4HOB A;  3F8B A;  1FT9 A;  3I64 A;  2V1U A;  2FA5 A;  3LWF A;  1QGP A;  3HSF A;  2RDP A;  1ONV A;  3CTA A;  3ABT A;  2ZNY A;  3F8F A;  5H20 A;  5EEG A;  5ILS A;  2BE5 F;  3HYI A;  3CUO A;  2DQR A;  1NHA A;  1LDD A;  3IWZ A;  2Z99 A;  1CF7 B;  1ON2 A;  3RJP A;  2L01 A;  4I98 B;  3ECH A;  4CXF A;  5CVI A;  1U3E M;  1K78 A;  3L2C A;  2ETH A;  2RC4 A;  3KP7 A;  3WTY C;  1OPC A;  2M8E A;  4U7D A;  4L5J A;  2BEO A;  5CYV A;  4ESF A;  2RKH A;  3M9A A;  3FM3 A;  2P6T A;  2JSC A;  3I71 A;  3V8J A;  4S05 A;  3HSR A;  2CFX A;  1F5T A;  3M8F A;  1O3Q A;  4BQA A;  1T2K A;  2IA1 A;  2Z33 A;  3IWF A;  3L9F A;  4OOI A;  1U5T B;  3CO6 C;  1V3F A;  2E7W A;  1G3T A;  1TW2 A;  3P9C A;  5FFX A;  4G6Q A;  3DKW A;  4WWC A;  5FO5 A;  3FM5 A;  1FOK A;  2D1H A;  1UST A;  5L3D A;  3HOT A;  1OYY A;  1ZG5 A;  3HRS A;  4OIR F;  1FYK A;  2IW5 A;  3F8C A;  5D6F A;  1WKM A;  1IN7 A;  2VBW A;  4ENM A;  2Z3Y A;  4KYW A;  5JFR A;  1FWZ A;  2PN6 A;  2FU4 A;  1LB2 A;  4O3M A;  4G8X A;  2JZY A;  1HXD A;  4NQW A;  3V7R A;  1BI1 A;  2HOE A;  3WE3 A;  3KEQ A;  3REO A;  1S7O A;  3WGH A;  2K4J A;  4I09 A;  2Z5U A;  2VXZ A;  1DP7 P;  1OYW A;  2COM A;  4ON0 A;  4YIF A;  2Z9O A;  3I58 A;  1GVJ A;  1O3R A;  1IXS B;  4KA4 A;  3R0J A;  1WRJ A;  5LGN A;  3GFL A;  3ZMS A;  4WXC A;  3T0Y A;  3GXO A;  5L3G A;  3J80 K;  4IRI A;  4LGW A;  2PQ8 A;  4LLG F;  3VOE A;  1QBJ A;  3CO7 C;  2FBH A;  4WX9 A;  4KN7 X;  3WG9 A;  3M1E A;  4AIJ A;  3QAH A;  1T6S A;  1MGT A;  2W85 A;  4Z2Y A;  1R58 A;  3MFK A;  4RAZ A;  1R1V A;  3LAJ A;  2M45 A;  3ZMU A;  1E2X A;  3EET A;  5CVU A;  2HYF A;  1BJA A;  4KUM A;  3HRM A;  1J59 A;  2HFH A;  2MC3 A;  3PFI A;  2L3D A;  4MGR A;  2DTR A;  4GYG A;  3F22 A;  1MDM A;  3B02 A;  3K2Z A;  4ASN A;  2DO7 A;  2LNB A;  4OMZ A;  3Q5F A;  4CDG A;  1P92 A;  5IT9 Z;  1SD5 A;  1FBQ A;  3KP6 A;  3FWE A;  3WTX C;  1ZRC A;  5E8I A;  2ZXJ A;  3KCC A;  3CUQ C;  4PGG A;  2O8X A;  4UV9 A;  2W25 A;  3V4G A;  3TGN A;  4CO8 A;  1TTY A;  1BC8 C;  2O61 A;  3C3W A;  3DP7 A;  2FOK A;  4YFK F;  3ZMZ A;  1W5S A;  6PAX A;  4BHB A;  3RI4 A;  3L7W A;  4HV5 A;  3RDI A;  3HHG A;  3E6D A;  3V8K A;  5HDK A;  1IZ1 A;  1IW7 F;  1MJB A;  4M9X A;  1FC3 A;  2D1V A;  4U88 A;  2Y48 A;  1KYZ A;  4LB6 B;  2QM3 A;  3I54 A;  4HA8 A;  1J5Y A;  4EVI A;  2EFP A;  3R61 A;  1WI9 A;  4MHG A;  1K7A A;  2DU9 A;  1BIB A;  2JT1 A;  2RGV A;  4NHJ A;  1MJ9 A;  3K1N A;  3TO7 A;  4I01 A;  3MCZ A;  2D45 A;  2WC2 A;  3F72 A;  2ESN A;  4ZYE A;  4Y17 A;  2R7F A;  1DUX C;  2AS5 F;  5D4R A;  1LDK B;  5LGU A;  3GW2 A;  3LA3 A;  2Q8K A;  1I1G A;  2P7V B;  1SMT A;  3ELK A;  4KNY A;  1BI3 A;  4PDK A;  2FXA A;  1MKM A;  4XLP F;  5BMZ A;  4UXN A;  2HKX A;  1DPU A;  3F23 A;  3O6B B;  2K4B A;  3H3U A;  2BV6 A;  1IN6 A;  5TJJ A;  1S7A A;  1FNN A;  1UHW A;  1B6A A;  1W7P B;  1YO5 C;  5L3F A;  3F6V A;  2OU2 A;  1ZYR F;  4EM1 A;  1ZG3 A;  1FSE A;  3LA2 A;  2VOO A;  5HOO A;  2CGP A;  4LMY A;  5LRS A;  4I0B A;  1KU7 A;  3BDD A;  2IT0 A;  1EH7 A;  2JRT A;  3I59 A;  4FT8 A;  4BNC A;  1EH8 A;  4I0A A;  2CWE A;  4Y13 A;  1KU9 A;  5DD8 A;  4HF2 A;  2XAG A;  1IF1 A;  1GXP A;  4U0W A;  3GFJ A;  2P7C B;  3E5X A;  2LF7 A;  3GWZ A;  3QP5 A;  5H6R A;  4LG0 B;  5DDG A;  1BI2 A;  1ZN2 A;  4HQM A;  4UV8 A;  5D5U B;  4G7O F;  5D5V B;  5BPI A;  4RGU A;  2DT5 A;  3NRV A;  4UNO A;  4KMU X;  4WF2 A;  3VFZ A;  3KP2 A;  3WE2 A;  3MZY A;  4IXA A;  4FX0 A;  2RNJ A;  1B4A A;  3BP8 A;  2CYY A;  5LBQ A;  4UUV A;  2F5E A;  1MJA A;  3W6K B;  4A6E A;  3M8E A;  2QVO A;  2DW4 A;  1W7P D;  1CF7 A;  5BQT A;  1T39 A;  4HBL A;  3D5L A;  3DFG A;  2G9W A;  3WGI A;  4RS8 A;  3KLN A;  2C6Y A;  5E17 F;  2K27 A;  1H9T A;  2DAO A;  4ENN A;  2AXL A;  5K5O A;  2DLL A;  3E6B A;  4WXD A;  2ESH A;  1FPQ A;  5L3E A;  3AAF A;  2O0Y A;  2MLG A;  2J5O A;  1U6G A;  2K7L A;  4OIP F;  3KE2 A;  4LFU A;  3BWG A;  1QZY A;  1XMA A;  2V1D A;  4R79 A;  4A5M A;  4G94 A;  2VN2 A;  1ZHF A;  2CW0 F;  1U5T A;  4RGS A;  4F7Z A;  1LDJ A;  5EEH A;  1R22 A;  2F5F A;  3DF8 A;  4IPA A;  5LEJ A;  3RPU A;  3LA7 A;  1I6X A;  2ADU A;  3K1M A;  1IXR C;  1KQ8 A;  4P9F A;  1QPM A;  2NRA C;  3JSP A;  3O2P E;  4IHT A;  4YII A;  2FMY A;  3GFM A;  1RUO A;  5HLG A;  2EFO A;  3F3X A;  1XGS A;  3FXU A;  5H6Q A;  2ISY A;  1B9M A;  3VB2 A;  2BBY A;  3GX4 X;  4HX8 A;  1C0W A;  2OD5 A;  2PJP A;  3KEO A;  2VC1 A;  3JAM K;  1HSJ A;  2OBP A;  1QNT A;  1ON1 A;  4A0Z A;  2WWY A;  4IVN A;  5HS8 A;  3SFZ A;  3T1B A;  2MH2 A;  3NQO A;  2VBY A;  2FEZ A;  2ZME B;  2DBB A;  3TOA A;  2CQK A;  2H94 A;  3LFK A;  2HDC A;  3EYY A;  4HLX A;  3DQV C;  2UXX A;  1JGS A;  1LEB A;  1ZH5 A;  2PMH A;  1O57 A;  1R00 A;  1FSH A;  2XAF A;  1XB4 A;  4L9N A;  4M9S A;  4CIC A;  3CUQ B;  4A6D A;  1TNS A;  2GA2 A;  4P96 A;  3HRT A;  1STZ A;  2MH9 A;  5DCM B;  1R1U A;  1OYI A;  2P6S A;  2A07 F;  3QOP A;  2IRF G;  4MEX F;  4KN4 X;  3TQN A;  1XGO A;  1S6L A;  4JQF A;  1YLF A;  1QO0 D;  2BGC A;  4HLY A;  1BM9 A;  3WTW C;  2HR3 A;  2HTS A;  1XDS A;  1XDU A;  5L3B A;  4EMS A;  1XSV A;  3R4K A;  3FXR A;  1O3T A;  5E1X A;  1XD7 A;  2J5P A;  2P4W A;  3GO5 A;  3SZP A;  4CHU A;  3C18 A;  4EJV A;  2RN7 A;  1LNW A;  1YYV A;  3GF2 A;  1D8K A;  4HQE A;  4A5N A;  1XSD A;  4B09 A;  3I53 A;  3DPT A;  2CG4 A;  2Q2E A;  2A61 A;  1HKS A;  4Q4Z F;  3TO9 A;  3VEP A;  5A2Q Z;  5E1Z B;  1G6N A;  1FYM A;  4BYY A;  1O3S A;  4L5I A;  1TQM A;  2PLY A;  4GYI A;  1EV7 A;  3GZ5 A;  1Z6R A;  5DEQ A;  3BOQ A;  5AON A;  3CJN A;  1R36 A;  3BY6 A;  1X3U A;  3WTS C;  2ZCW A;  3JTG A;  1SMY F;  1W4M A;  1HKQ A;  2EB7 A;  4WCG A;  5FLX Z;  5CVV A;  4HAM A;  4RAY A;  1HST A;  1S29 A;  1K79 A;  3T8R A;  3CLO A;  2FRH A;  2A6E F;  2MD5 A;  4IRG A;  3ABU A;  2OA4 A;  1CGP A;  2VBX A;  2FBK A;  2HWV A;  2QQA A;  1TLH B;  3Q9V A;  4HF1 A;  4JK1 X;  1KYW A;  1J75 A;  4G7H F;  4RB2 C;  2QQB A;  2E7X A;  4ZZD A;  4KIF A;  2FSW A;  1LEA A;  4FHT A;  2G7H A;  3HUG A;  4G6D A;  4BHP A;  4M9Z A;  3N97 A;  5HLI A;  2JPB A;  2ZO4 A;  3FMQ A;  1FX7 A;  1HQC A;  3FX3 A;  1T0F A;  2HTJ A;  4HX7 A;  4CYD A;  1TW3 A;  2KKO A;  3PQJ A;  4LLL A;  3E5U A;  4EJW A;  1ZLJ A;  2XIG A;  3G3Z A;  3VOD A;  3RTR A;  3U2R A;  1WQ2 A;  5DCF A;  4O6J A;  4L18 B;  1P2F A;  2FML A;  2G7U A;  3IKT A;  3KP3 A;  3ZPL A;  4EGZ A;  4KT5 C;  1FYL A;  4EM2 A;  5F64 A;  3F8N A;  1KQ0 A;  4DNC A;  5FB2 A;  3V7C A;  2XVC A;  1UCR A;  4P55 A;  4HF0 A;  3TO6 A;  1WWX A;  1HKT A;  1HW2 A;  1W7P A;  2R7D A;  2M87 A;  3K69 A;  5LHG A;  3GFI A;  5BOX A;  3DXJ F;  3MZH A;  3U1D A;  3KZY A;  4YG2 F;  3BPV A;  3BJA A;  3DEU A;  2L4A A;  3OV8 A;  1HW5 A;  1H9G A;  2FF4 A;  4UVB A;  2YSR A;  2QBY B;  1S8N A;  2O6G E;  2OZ6 A;  5E8G A;  3EYI A;  2YR2 A;  2XGX A;  4LG0 A;  5E18 F;  3FMS A;  1R23 A;  2NNY A;  2PG4 A;  1IUY A;  2ZNZ A;  3BJO A;  2M1B A;  2JTV A;  5AIQ A;  3BJ6 A;  3R0A A;  3JW4 A;  4BHC A;  1A04 A;  2DPU A;  1JHF A;  5LHI A;  4N9I A;  1RIO H;  2XAJ A;  3ECO A;  1WSU A;  3RKW A;  3MWM A;  2Y0M A;  1FBS A;  1FY7 A;  3QPH A;  1XGM A;  4GO1 A;  5HS7 A;  3S2W A;  4M72 A;  3L00 A;  4Q5S F;  3H3Z A;  3HTS B;  4XRF A;  1ZGJ A;  2VE9 A;  4EGY A;  2RV8 A;  4ESB A;  2A5Y B;  3WU1 B;  4R1H A;  1XGN A;  2QLZ A;  1W5T A;  4XSZ F;  2PBI A;  2VC0 A;  1F1Z A;  1E17 A;  5D8L B;  5HDG A;  1BIA A;  4LK0 F;  1R5H A;  4AVP A;  4HYE A;  4Q47 A;  4M74 A;  5JVT A;  3HRU A;  2W84 A;  5JHU A;  3V7S A;  3J80 Z;  1PDN C;  1B1B A;  5DUK A;  2KIM A;  5BPD A;  5F1R A;  4I7H A;  2UXN A;  1IRG A;  3COA C;  1PP7 U;  2F2E A;  1YW8 A;  2L54 A;  1UHM A;  2DPD A;  1OR7 A;  3D0S A;  1FBU A;  4ZYG A;  1I5Z A;  3Q9S A;  1DPR A;  2EV5 A;  4L9T A;  1EH6 A;  4HX4 A;  4G7Z F;  4N9H A;  3ULQ B;  2LDU A;  5J6X A;  2YX7 A;  3LQR A;  2GIV A;  5J8C A;  3FMR A;  2V79 A;  3K9T A;  2F5D A;  3GYH X;  1QQI A;  2IP2 A;  3P9I A;  4CGZ A;  2A6H F;  3J81 Z;  5CJ9 A;  2EA2 A;  1BN5 A;  2ZME A;  1PUE E;  3B73 A;  3IKV A;  1J0R A;  1T98 A;  4BH9 A;  2GQQ A;  3I5U A;  2D2W A;  3TOB A;  5ILU A;  3KP4 A;  4RGX A;  2DQL A;  3GVA A;  4AIH A;  2VT3 A;  2P5L C;  3QRF F;  1FP1 D;  4HW0 A;  4U0V A;  3CUQ A;  1SFE A;  2MBF A;  4D0P A;  3IRQ A;  1YIO A;  3R60 A;  2FQ3 A;  2EFN A;  1ULY A;  5DCM A;  3N4M A;  3E5Q A;  2PMU A;  2H6B A;  3V8L A;  1IN4 A;  4P9U A;  1FP2 A;  1G3S A;  2HS5 A;  4MQV A;  5DV5 A;  3P9K A;  5HS9 A;  5K5Q A;  1R5G A;  1P6R A;  2CO5 A;  1F4K A;  2MLK A;  3TDZ C;  2KJC A;  2VON A;  1D3Y A;  2V6C A;  4LD5 A;  4LB5 A;  1YW7 A;  5CVR A;  3FHZ A;  3QPT A;  2KIU A;  4OU0 A;  3HTU A;  4N0B A;  4E70 A;  2HGC A;  5JI6 A;  1JE8 A;  4QWQ A;  2FE3 A;  4FX4 A;  4U7B A;  1J7K A;  2BYV E;  4AD9 A;  2YX4 A;  3FF5 A;  2X4H A;  2E1C A;  1S3J A;  4PZJ A;  3ZN1 A;  1ZAR A;  3GZ6 A;  4ETS A;  2F5C A;  5LHH A;  4MEY F;  1XCV A;  2PI0 A;  4KMF A;  2VT2 A;  1D8J A;  3EUH A;  2KIF A;  5IT9 K;  2OAZ A;  3KET A;  3JTH A;  5DYM A;  3WTV C;  3T8T A;  1ZAO A;  3ZMD A;  1AWC A;  4WK8 F;  5JR3 A;  5K5R A;  1Z6T A;  4L9V A;  2QZ8 A;  3F8M A;  2NYX A;  2XAH A;  2HKO A;  5ICG A;  2EV0 A;  4KIG A;  5D8K B;  1IRF A;  1ZGA A;  1SFX A;  4RB0 A;  2O3F A;  2A69 F;  2W57 A;  1KA8 A;  3R6S A;  3RYR A;  5CLS A;  2NNN A;  2QWW A;  3IHU A;  4LLN A;  1IN5 A;  2YU3 A;  4OIO F;  1YFH A;  2DK8 A;  2XRN A;  1D5V A;  4OMY A;  5ICF A;  3ZN0 A;  2XAQ A;  4A0X A;  2P5V A;  5ICE A;  4GCV A;  5CVJ A;  4R8H A;  5DD4 A;  1SFU A;  2GXB A;  1T38 A;  2HYG D;  1H0M A;  5FFZ A;  4LJZ F;  4KFC A;  4MQ9 F;  2ISZ A;  3ZMV A;  2H27 A;  3FZV A;  5F6F A;  1KU2 A;  1K6O A;  4M6Y A;  3TKY A;  1Y0U A;  1YS6 A;  2VOP A;  2HQR A;  3WGG A;  5ERI A;  4OIQ F;  1MZB A;  1BBY A;  2FNA A;  1TQI A;  4GGG A;  5J8F A;  4Y15 A;  1KU3 A;  4EV0 A;  4ENK A;  1XSX A;  5LLQ A;  2RVC A;  3C7J A;  2EK5 A;  1FZP B;  5HLH A;  3QU3 A;  5FD5 A;  1K78 B;  3F21 A;  3E97 A;  2XUB A;  2XKO A;  4AWX B;  3HIF A;  5AIP A;  3ML6 A;  4ZH4 F;  2RQP A;  4KIC A;  1U8R A;  4ZYD A;  5LRR A;  4QLC U;  3EQL F;  3O3K A;  3TDU C;  2EFW A;  3I0T A;  4IHS A;  4MNU A;  2X0L A;  4A12 A;  4A0Y A;  2CSO A;  3EDP A;  3BRO A;  3WU0 A;  1G4D A;  2WTE A;  2QBY A;  5D4S A;  2OQG A;  1YTY A;  1JXS A;  3KLO A;  2EJR A;  3LQQ A;  1P4X A;  5DUI A;  2GAU A;  1QZZ A;  2Q0O A;  3QU6 A;  4LK1 F;  2M30 A;  3MAJ A;  3GLX A;  3SQN A;  3MQ0 A;  4KIB A;  4P5O A;  3F6O A;  3GEZ A;  1IAW A;  2XKP A;  1L3L A;  1XN7 A;  2ZKZ A;  1UFM A;  1Z7U A;  3W6J B;  4B8X A;  2L4M A;  1BI0 A;  4M71 A;  2H6C A;  2ZJ2 A;  2E1N A;  2DFI A;  1J9I A;  3JAM Z;  1TBX A;  1Z1D A;  4PCQ A;  3ZQ7 A;  2P8T A;  3RKX A;  1Z05 A;  1OMI A;  1Z91 A;  5L3C A;  3LST A;  3E6C C;  1MD0 A;  1I27 A;  1USS A;  1P4W A;  3J81 K;  3BPX A;  3ZP5 A;  4EQQ A;  1SD6 A;  4AIK A;  2R3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...