2DA4A

Solution structure of the homeobox domain of the hypothetical protein, dkfzp686k21156
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
80
Chain Sequence
GSSGSSGALQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVATELNVDCEIVRTWIGNRRRKYRLMGIEVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein DKFZp686K21156
publication title Solution structure of the homeobox domain of the hypothetical protein, DKFZp686K21156
rcsb
source organism Homo sapiens
total genus 20
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da4A01
5DS9A 3G1LA 4B4CA 3HEFA 2EZIA 2NVYJ 5E3NA 1BW5A 4AC0A 2DA7A 4QIWN 3JRHA 1BW6A 5E3MA 2DA1A 4C3HJ 2R5ZB 3S1RJ 4X6AJ 2HXOA 2COBA 2DJNA 2XPWA 1G2HA 2LTPA 3OOUA 1APLC 5C3EJ 2DA6A 1ETKA 1TWHJ 1JKOC 3NARA 1ZR4A 1SFOJ 1X58A 3LSPA 4BXXJ 2JJ7A 2DA3A 2R5YA 2ZB9A 3TP0A 4HNVA 1MBJA 4IHVA 4FE4A 1ITYA 1F36A 2I10A 3BQYA 4BBRJ 1Z77A 2WV1A 5EG0A 5EEAA 1GT0C 2L7FP 1IC8A 1LE8A 1LFUP 3IH2A 4BY7J 1MBGA 1RKTA 1TWFJ 2WB1N 1WI3A 3C2BA 5DTDA 3S16J 1TWGJ 2YS9A 2L7ZA 3JRDA 3HOXJ 3I4MJ 2IBDA 1ZK8A 2XRLA 2DA5A 3BR0A 1HF0A 1YRNA 2DA4A 2LKXA 1U8BA 3G1OA 1PUFB 4FISA 4JX6A 3CMYA 4A3IJ 3RZDJ 4AYBN 1FIPA 4V2FA 2AO9A 5HODA 3TW7A 5M3MJ 2YU9J 1A5JA 2NVXJ 2HOAA 2LK2A 3D1NI 4A69C 2XPUA 1ETOA 2DN0A 1BJZA 3OSFA 2E2HJ 5FKKA 1U9OA 4DW6A 2WAQN 3RQIA 4QTRA 4XRMA 3SDGA 2HQ5A 3BQZA 3LNQA 2CU7A 3HDDA 2XB5A 2GBYA 2QCOA 5J1UA 2ID6A 2JA8J 5EZGA 4BY1J 1Y1VJ 5FLMJ 1SANA 4ABZA 4I76A 4C3IJ 1RR7A 3HGGA 3BR5A 3RZOJ 1IDZA 3M3YJ 5M5XJ 1T33A 3B6CA 3HKZN 3A03A 1MBFA 1ZTRA 2FX0A 3GTLJ 2MW8A 3FK7A 4CYCB 2CUFA 3QQAA 1XS9A 2E19A 2JN6A 2LD5A 2N8GA 4BBSJ 3GTPJ 1JT0A 2O7OA 1FTTA 3Q3SA 1I6HJ 3IH4A 5JLXA 2ECCA 1HDPA 1X2NA 1Q1VA 4M3GA 3ZQLA 2X48A 2GLOA 1HDDC 2O9LA 2CQXA 1ETXA 2JA7J 2XGEA 4DZPA 4XK4A 4DZJA 2VI6A 5C44J 2TCTA 3JRFA 3A01B 1AHDP 2D5VA 2JK3A 2R93J 3GTGJ 1MBHA 4A3BJ 1XG1A 5F0HA 4Y52J 4DYQA 2HYJA 3HB9A 3ZQCA 3TW6A 3SJMA 3ZOBA 1UG2A 1HCRA 1S7EA 3PM1A 1GV2A 3JR9A 2XB0X 1P7JA 3HM5A 5EZHA 3GTMJ 2K9SA 1I50J 5FKOA 4JX5A 3WHBA 4L5EA 3H0GJ 1FEXA 4D5CA 2R5ZA 3BR2A 3O8HA 5FKMA 2R92J 3HGYA 3GTQJ 1MBKA 1JTYA 1D5YA 4D5FA 2HOTA 2TRTA 3MN2A 2E2JJ 2W48A 4W1UA 3JRIA 1A6IA 1CQTA 1HLVA 1JJ6C 5EGOB 4JP0A 5EF6A 1Y1WJ 2CJJA 2MGQA 1JUMA 5K7FA 3TEDA 3OIOA 1FTZA 4FCYA 1TWCJ 1VI0A 4A3JJ 2M0CA 1IRZA 5F27A 5M3FJ 5FLVA 1NTCA 2K9NA 4DYRA 2K40A 4UUSB 2VUMJ 2EZLA 3SFIA 1AU7A 2NVQJ 4M3DA 3RKQA 4MFDA 5GP9A 2K9QA 5F08A 3HOZJ 3DEWA 3FIWA 5M5WJ 5FKLA 1PUFA 2ME6A 1U9NA 2JWTA 1MH4A 4QSHA 1Z0XA 1UMQA 3K7AJ 4MO7A 4B1RA 3UKGA 4A3GJ 1ENHA 3NAUA 1RESA 3ZQGA 1B8IB 3BG9A 2AHQA 1W0UA 3JREA 1RETA 4M3EA 5K7HA 1WGXA 5F0FA 2Y9ZA 1ZKGA 3BTJA 1IV6A 5IOZA 1T56A 3ZQHA 5M5YJ 4W97A 1GVDA 1FJLA 4M6VA 1ZR2A 4A3CJ 1ZQ3P 1MSFC 1B72B 2OF7A 3Q0VA 2KDZA 5IYDJ 1JTXA 1JUPA 3GTJJ 4M3BA 4MIMA 1P7IA 3MKLA 3LSJA 4EEFG 2NS8A 4XRSG 1ORKA 2ELKA 2M8GX 1GDTA 1VNDA 4FE7A 1WH5A 4CYCA 5IYBJ 4M3FA 2MG4A 1GV5A 2HDDA 1EF4A 2IEKA 2JA6J 2VKVA 4D7NA 1JKQC 3FK6A 5J1RA 1NK2P 1ETVA 5E3LA 2FD5A 3BG5A 9ANTA 1WCMJ 1QVUA 1OCTC 3MVPA 2NVTJ 4BKXA 3CDLA 4D7MA 3GTOJ 4LOCA 2HOSA 5GPAA 4A3FJ 3OSGA 2M9HA 3A01A 4XICA 3S17J 3HOUJ 1UHSA 1IG7A 2CUEA 3O8GA 3BTLA 1E3OC 4A3KJ 1X2MA 1I3QJ 3S2DJ 4S0HB 1AKHB 5F0CA 3BTIA 5J3LA 2VKEA 3ZQIA 1TWAJ 4IHYA 4GFBA 4J19A 3JRAA 1TC3C 1MH3A 2Y2ZA 1QRYA 2VPRA 1XC5A 2DMQA 3B6AA 3HOVJ 1FIAA 4AUXA 2P81A 1F43A 3K2AA 3LSGA 3JRCA 2E2IJ 2IAIA 2X9DA 5F04A 1R9TJ 1QPIA 4DYCA 2OPTA 1POGA 5IP9J 2GM4A 2CRGA 3LSRA 4IHWA 1MNMC 2EBIA 5EGOA 2XSDC 2LFBA 3CQZJ 4NDLA 1BL0A 4RDUA 3BTCA 4MLOA 2G0EA 5F1JA 5GPCA 2HXIA 1NK3P 1W0TA 2Y31A 3GBGA 5EDNA 4IEJA 2L0KA 1WH7A 3BT9A 3IV5A 2JMWA 4JYKA 4UUSA 1GUUA 2L9RA 3S1QJ 2ECBA 4XIDA 2R5YB 3HOYJ 3TP3A 2ME0A 2LLKA 2XPVA 5EG0B 2M34A 2XGDA 3FKIJ 1ZGWA 1H8AC 1JUSA 1LE8B 2DTZA 3VPRA 1JJ8C 2FJ1A 1VFCA 3Q0UA 2LP0A 1HOMA 5BNGA 1B8IA 3S15J 2Y9YA 2R7ZJ 1YRNB 2R0QC 1JGGA 2FQ4A 2KT0A 3FISA 2DA2A 2NOGA 3BR6A 1JKPC 3E7LA 1OJLA 2H8RA 4A3MJ 4V2GA 3GTKJ 5IYCJ 1JKRC 1IUFA 2Y0SN 2EQRA 5E3OA 1B72A 1K83J 5EYRA 5FKNA 4A3EJ 1U78A 3S1NJ 1IJWC 3BR1A 4FTHA 1MBEA 2DMNA 3PO2J 1IGNA 5J1YA 2JA5J 5IP6A 3LOCA 4Y7NJ 3S2HJ 3F0CA 3DCFA 3JRBA 2QF7A 1ETYA 2X6OA 5C4XJ 1QVTA 2B63J 4MFEA 3Q0WA 3S14J 2PMZN 5FJ8J 1H89C 1RPWA 2DMTA 3WHCA 3IH3A 1K61A 2CQQA 4C2MJ 2LR8A 1RKWA 4I6ZA 4RBOA 5JLWA 4A3LJ 2YUSA 3QPLA 1O4XA 2NS7A 2ID3A 5K7ZA 2Y30A 1IDYA 1WPKA 1VF9A 2LVSA 3HBLA 3QPSA 3BR3A 3G1MA 1LFBA 3JRGA 1BA5A 3HOWJ 2EH3A 5IPAA 3BG3A 2L7MP 3PO3J 2H1KA 1ETWA 3W6VA 1JT6A 4XRSA 3H3VK 1AKHA 4B3AA 1OCPA 1H88C 1DU6A 2DMUA 3ZQFA 2M2EA 2DMPA 1OFCX 2EZKA 5C4JJ 4IHXA 4A3DJ 4UUTA 4A93J 2HI3A 2LY9A 2E1OA 2XGCA 4C3JJ 2MSYA 3I4NJ 5IP7J 3CCYA 3S1MJ 2O8KA 3A02A 3L1PA 3M4OJ 1MSEC 5IOYA 4G12A 1ETQA 2EZHA 4JX4A 1DU0A 4X1EA 2RAEA
chains in the Genus database with same CATH superfamily
3CUQB 5CKTA 3OYLA 5D6EA 1DUXC 4FETA 2LBFA 2ZXWH 2NVYJ 5E3NA 1BW5A 4AC0A 1XGOA 4BQQA 2V6CA 3CC7I 4EJUA 2VLAA 1OCRH 5K5QA 2R5ZB 3S1RJ 2HXOA 3CUQC 1R71A 1F5TA 2XPWA 3VYUB 2NRAC 2RV8A 4IL6C 3U2RA 3SQNA 2VL8A 1ETKA 1TWHJ 1JKOC 3NARA 3WTUC 4UV9A 1SVLA 3GZ6A 4BU2A 1WJDA 4KMFA 3J7ZI 2FNPA 4KFCA 1MBJA 1OQYA 5FROA 2Z9OA 4WF2A 4BQOA 1XPXA 1GT0C 2IA2A 1Y56A 1IC8A 3QU3A 3E6CC 3IH2A 4BY7J 1BIAA 2F6CA 2WB1N 3EETA 3H3UA 2HGCA 2M3AA 3C2BA 2RNJA 2CQNA 1TWGJ 2YS9A 3I4MJ 3HOXJ 4BQNA 2Q2EA 3OYFA 1FOKA 3HUGA 4F3QA 1ZG5A 4JX6A 4DGWB 4AYBN 1P2FA 5CVUA 4F52A 3LA3A 1FIPA 4IOCF 3AG4H 3AG1H 1HW2A 4U87A 2IJLA 2M7AA 4HG2A 2AO9A 4Z2YA 1ZN2A 3QOEA 5HODA 3TW7A 3CP2A 3ZGKA 2NVXJ 2HOAA 2LK2A 3RYPA 3D1NI 3SXYA 3DV8A 4A69C 3H9JA 2XPUA 2QSHX 5E8GA 2E71A 5J4YA 3OSFA 2E2HJ 5FKKA 2VE9A 4QTRA 1ACIA 1RZ4A 2HQ5A 4XOTA 2BY1A 3HOSA 3LNQA 1FBQA 2W57A 3HDDA 1BI3A 1ZH5A 2GBYA 3I53A 4IVNA 5EZGA 2XVCA 2X6WA 3FXMA 5FLMJ 4U0WA 4ABZA 4I76A 4UUVA 4O5VA 3HGGA 5IT9Z 3GCMA 4PZJA 1BIBA 4PJMA 4EQQA 3M3YJ 1RIOH 3B6CA 3K69A 3DPUA 3A03A 1FC3A 1ZTRA 4LLLA 3IUOA 3GTLJ 2MW8A 2LY1A 2PN6A 3KLNA 2PEXA 5DM6F 2DO7A 1V54H 2E19A 3DBRB 1JT0A 2O7OA 2BVLA 3GTPJ 3Q3SA 1P4WA 2ZMEA 5JLXA 5D8KB 4YIFA 1MDMA 2ZXJA 1FOXA 1HDPA 1NG7A 3CO7C 4HX7A 1R1TA 2X48A 2CYYA 2GLOA 5B1BH 2JA7J 3FMRA 2A6TA 4XK4A 4DZPA 4DZJA 4ZZLA 2TCTA 3F72A 1ZELA 1R5HA 1S72I 2R93J 3GTGJ 4PJLA 2I8DA 3V7RA 3CCQI 2H1LA 4A3BJ 5F0HA 4Y52J 4DYQA 1WKMA 3ZMVA 4G8XA 2PJPA 3ZQCA 3SHFA 4A5NA 1KQ0A 1KA8A 4BUPA 5JVTA 1EH8A 2E5NA 3H5AA 1MZBA 2GA2A 2QA4I 4PDKA 3OYJA 3K4KA 4CYDA 4EM0B 1DGWY 1R6RA 3KETA 4ASNA 5DYMA 5ICGA 4ZYGA 3O8HA 2LREA 4QWQA 5DUKA 3BOQA 3M07A 1B4AA 5KAIC 2ESNA 3CF5F 3MN2A 4CCMA 2A68F 2E36A 2WAQA 3ABUA 2A5WA 2CJJA 4OIRF 2L01A 4IRHA 2JRTA 1FTZA 1R1UA 3DPTA 1G3YA 1MJBA 2PJRB 3OR2C 2DI3A 4RGXA 4FCYA 2P5LC 2VASA 1HA8A 5FLVA 3FHNA 2ZSIB 1U2WA 4UUSB 1T6SA 1CGPA 1QA6A 2PMHA 3S93A 2P6SA 4XOPA 1UELB 1LUJB 1KU2A 2IA0A 2K9QA 3GMEA 5F08A 3VODA 3HOZJ 3DEWA 3H9GA 3ECHA 3JSOA 3VOEA 2JWTA 4QSHA 1LEBA 1WJAA 2XIGA 3ESWB 1UMQA 2H6BA 3ROUA 3NAUA 4QLCU 1XSXA 4AIJA 5L3BA 3QYFA 2L9SA 2CUJA 2P5VA 3CJNA 1SVOA 1TTYA 3FXKA 4E7IA 3BTJA 3DWLE 2CGPA 4IX7A 5IOZA 1T56A 3HL2A 4EJVA 4WXCA 4BXUA 1D3YA 4CXFA 4HAMA 4GGGA 1FBSA 4RA2A 4RB3C 1ZQ3P 1QZYA 2IGNA 3Q0VA 1B72B 2ADUA 2R7SA 1JTXA 4LFUA 1JUPA 3GTJJ 1HSJA 5DEQA 3MKLA 3LSJA 4A2UA 2V1NA 1L0OC 1ZRCA 2WY7Q 2MBFA 2M45A 1X19A 3OYDA 3HSRA 1R5GA 2OQRA 1GDTA 1P92A 1VNDA 1VQ5I 5IYBJ 5BQTA 3M8FA 5DV5A 2HDDA 2C6YA 4RAYA 3QPHA 3FK6A 1J2XA 3P9IA 2EIMH 1Z9CA 2LRDA 9ANTA 1D8KA 1WCMJ 3MKYB 2DFFA 2LMDA 3KLOA 1OCTC 1Y0NA 4L9TA 3IKTA 2VBXA 4L5JA 4P1WA 4YFXF 1W5TA 4D7MA 2GIZA 1FT9A 4A0ZA 2R7WA 1G3SA 2M9HA 3VWBA 3A01A 3HPHA 3PIPF 3A4CA 1J0RA 2HU9A 1ON2A 2TDXA 2XKPA 3RPUD 4XLHA 2V9KA 2BW3B 2DXIA 5EEHA 1AKHB 3H36A 1XTAA 2NYXA 4G9YA 5F0CA 5J3LA 3L2QA 4XLFA 3G3ZA 1LNWA 4S04A 3LFKA 3QP6A 4IHYA 2CW7A 1XD7A 5E20A 1MH3A 1YJWI 4UVCA 4XKBA 3ZN0A 2HDCA 4ANJA 2IPQX 4I0AA 1DPRA 5D6FA 1ZGJA 2VBYA 3LSGA 1S5LC 1Z7LA 2VODA 1QPIA 2KZGA 1GXQA 3NEUA 4IJAA 2QSGX 3OYEA 3WTTC 5BMZA 5DCFA 4CCNA 3K70D 5D5UB 3F8MA 4N4OB 2JSPA 1FWZA 4U0VA 2L2OA 1LVKA 4Y13A 1V5EA 3T8TA 2A3SA 4II3A 1W7PD 3MAJA 2RVCA 5HDKA 2EILH 3QWLA 3OWTA 4MLOA 1TBXA 3S32A 4D0PA 3DEUA 1YW9A 1NK3P 4LGWA 3A0HC 2L9RA 3HKZA 3IAM2 4HLXA 4XIDA 1FLIA 4QPQA 3L09A 2HTSA 3RYRA 5EG0B 3FKIJ 2FRHA 1JUSA 2PFBA 4ZYEA 1G59A 5CVVA 4Q47A 1HW1A 1ZREA 3BLYA 3RDIA 2VPLA 3Q0UA 1BN5A 2IGOA 2EFQA 2Q8KA 1B8IA 1ZYRF 5DM7F 3OYIA 2ZNYA 1J59A 4XN3A 2BY0A 1YRNB 2FQ4A 2DA2A 2YSRA 3LA7A 5HNFA 4KUMA 3E7LA 1FP1D 1OJLA 4V19K 4V2GA 5IYCJ 4XKCA 1QGPA 2P7VB 4HSRA 3TBIA 4A6DA 2EV0A 3KP2A 3WGHA 5E3OA 1SMYF 1S3JA 4M73A 2NVUB 1IUYA 2FBHA 5CJ9A 1IJWC 4AIHA 2HKOA 3F22A 1K6YA 3I5UA 3DKYA 3AAFA 2R3SA 5KAFC 5E1XA 5GTHC 4UB8C 2JA5J 3QODA 4FT8A 2O5RA 5J47A 2L5QA 3E5UA 5ERIA 1UJ8A 3JRBA 2QF7A 4BHPA 5GAGJ 2G7HA 2EFOA 2QWWA 4RB2C 1RUOA 3CESA 2AXTC 1FMVA 3RCOA 3V7CA 1D0YA 2Z99A 2KIFA 2FSWA 2W00A 5L3EA 1R49A 4GDFA 2W24A 2XAUA 1YS7A 4C2MJ 1RKWA 1XSVA 4I6ZA 4WWCA 2F5EA 2XF5A 5JLWA 2VQHA 3I58A 3L7WA 2DDAA 3QPLA 4JQFA 2R7UA 2OUMA 3W2AA 2VKDA 2Y30A 4NQWB 3HBLA 4H4KC 1VF9A 1FX7A 1GVJA 1LFBA 5B5EC 4BH9A 1A36A 5K5OA 2L7MP 3CCUI 1AA7A 3TL4X 3TO9A 3PNVA 1MMGA 4P5OA 2VBWA 4MEXF 3DP7A 1WJ5A 3AG3H 2H1KA 1ETWA 4XRSA 3OYBA 5BPDA 3A0BC 4ZH4F 1FYKA 1XDUA 1H88C 2Q1ZB 2QUFA 2DMPA 4KT5C 3OYHA 4DJAA 4PCQA 3ZN1A 1XMXA 2E1OA 2X6XA 1IN5A 1KZHA 1RUNA 2X6YA 5IP7J 4RAZA 3S1MJ 3U9GA 2O8KA 1MJ9A 3BZCA 4ZDPA 4IKFA 3K0LA 4HOBA 4EM1A 5FGMA 2BZTA 4JX4A 4X1EA 2FE3A 1UFMA 1OISA 3G1LA 1U3EM 2L02A 3HEFA 2MA3A 5DDGA 2HS5A 1R00A 3JRHA 2EIJH 1I6XA 1S7AA 2DA1A 3S3OA 2CG4A 4X6AJ 3KYCB 2CS3A 2DJNA 4AVZA 3M1EA 5C3EJ 2ZNZA 5EEGA 2DA6A 4GYGA 4N4NB 1FMWA 1CF7B 1SEUA 2M8EA 1U5TB 2F5FA 4GO1A 5FB2A 4AIKA 2JJ7A 5CLSA 3DEEA 1Z3YA 2LOOA 5E17F 4U88A 2R5YA 2ZB9A 3EUAA 3TP0A 3JW4A 2DU9A 4ESJA 4E4HA 1Z77A 4L9VA 2DTRA 5LEJA 5EEAA 1U5TC 4A6EA 1JI8A 3A1YA 3A2KA 3TKYA 2LDUA 4ZTFA 4PK4A 2LSOA 4YIRX 4BQAA 2WAEA 4L18B 3F8CA 4KN4X 3U21A 5KNLA 2QQAA 3JRDA 1KU7A 3ZPLA 3HHGA 2IS2A 2XRLA 2MLGA 1HF0A 2G9WA 2GWRA 2DDBA 2LKXA 1U8BA 4BNCA 2KIMA 2HNHA 4LK1F 2DPUA 3IP4B 5K5RA 4C2TA 4P55A 1XGSA 1KYZA 1WJFA 3QPTA 4BGDA 1MMSA 3DTKA 4D1QA 1IO2A 3FXOA 4M9ZA 1A5JA 3VYSB 2DN0A 4BDZA 1BJZA 2E1NA 2VT3A 3ABKH 3V8JA 3PQKA 1YIJI 4U7BA 1BOAA 4DW6A 4GXOA 3SDGA 4OIOF 5HS7A 3ZMSA 3WU2C 2ID6A 1SANA 1ZLJA 3TGNA 2KKOA 1FYMA 4CZCA 1S7OA 1T33A 2DOFA 2DT6A 3F3XA 3I64A 3TO7A 4R79A 1R4MB 2K27A 4EGYA 4XR6A 3OS2A 4WXHA 3CCMI 1PUEE 2OTLI 1ZG1A 1B9NA 5F64A 2ZCWA 2LD5A 2V1DA 3OL4A 4N9HA 2CWEA 2H09A 3FF5A 1VZ0A 4G6DA 4BEHA 1OR7A 4XNFA 2MH2A 2ECCA 2CFOA 2KLOA 3CCJI 4M3GA 3ZQLA 4ZDOA 2QM3A 4HA8A 1HDDC 2CQXA 4OIPF 3OMYA 2XGEA 1IW7F 1E2XA 5C44J 2VI6A 1XGMA 3Q9SA 4M71A 5HS8A 2BGCA 2D5VA 1Q1HA 2F4OB 3TOAA 4EATA 1H9TA 4XL9A 4RGUA 1MBHA 1XG1A 2E1MB 3W3CA 3HB9A 1DGRM 3VB2A 4HF0A 1UG2A 1S7EA 1X4OA 1GV2A 3JR9A 2P8TA 3CUQA 4L9JA 3BJOA 4ENMA 2V9VA 3HM5A 2GZWA 4C30A 3RKWA 2QBYB 1GXPA 2Y75A 1P4XA 3C18A 4DOZA 3SZTA 3ERMA 4UVAA 2E1MC 2XAFA 1BJAA 2JPCA 2Y0SA 4YIIA 4UHTA 3WHBA 3ZR8X 2VQCA 1V5GA 4OAYA 2R5ZA 2ZFWA 1BR1A 4OINF 2R92J 3GTQJ 2QQBA 2HVSA 4N0BA 1D5YA 5E8IA 2FMYA 1EKEA 3BY6A 2MC3A 2W48A 4W1UA 3K4JA 2DOEA 3JRIA 2VONA 4PJNA 4P96A 5A2QK 3CCVI 1JJ6C 5EGOB 4NC8A 3OL3A 4NBQA 5L3FA 3KEQA 3OIOA 2DFHA 3RPUA 4IQJA 1O3TA 2K86A 2YX4A 2PMZA 4LG0B 4BS9A 1WJBA 5F27A 3WGIA 3PSIA 1IXCA 4ESBA 3ZXSA 2VUMJ 3X2QH 1AU7A 1RR8C 1D1AA 3RPQA 2ZXHA 3ABLH 4BACA 2HTJA 5LRRA 1RI7A 5FD5A 3W6JB 5F6FA 3OYMA 5GP9A 2VQGA 2CQ7A 2BBYA 4L9NA 3BZ6A 1WJEA 1HBXG 3ABTA 2NOJB 3L2CA 1U9NA 1MH4A 3RKXA 1Z0XA 2OC6A 2CV0A 3F8BA 1WFXA 4Y17A 2R7DA 1W5CC 3KP4A 5HOOA 3K4MA 4AVPA 2HZDA 2X1CA 2IS4A 3ZQGA 5GAHJ 2AHQA 4HX8A 2LC2A 1SD6A 2OBPA 2XRNA 5HS9A 3K9TA 3P5JA 1EA3A 1RETA 4M3EA 2X1EA 5ICCA 5K7HA 4YELA 4KISA 3GZ5A 1W7PB 3OV8A 2VOOA 1ZKGA 1TQPA 2DODA 2OCEA 3GLLA 4RGRA 2RQPA 3KP7A 3HTUA 4CA0A 3ZQHA 5H20A 5M5YJ 4S05A 4W97A 2IRFG 4XKVA 3K70C 2Z33A 4XLEA 1X4PA 3W2VA 1T8IA 4A3CJ 2JUGA 4UY8I 2KDZA 1XCVA 3KEYA 3IRRA 2E1CA 2JRMA 3MKZA 4M3BA 4MIMA 1YE9A 3MZHA 3S2WA 3DKWA 1R58A 3BPVA 4ENNA 2ELKA 3SEQA 3L2UA 4L0YB 3LL7A 1IN4A 2R7XA 3VSLA 3KIOA 4FE7A 3WTWC 3SFZA 2MG4A 3S8PA 1MGTA 1A35A 1EF4A 2VKVA 4YRVA 5H6RA 1JKQC 5D5XB 2KJCA 2DFEA 1NK2P 2H6CA 2FD5A 3OIQA 1QVUA 2OV7A 3TDUC 4B48A 3ASOH 1YG2A 1E3HA 3MVPA 3KYLA 2BOLA 3GXOA 3V8KA 2NVTJ 4ENKA 1W36D 2VXDA 2VIXA 2RNGA 3HRMA 1OMIA 2NS0A 3LQQA 2HOSA 5GPAA 1SD7A 2VE8A 4PJ0C 1T0FC 3S17J 3HOUJ 1UHSA 3O8GA 4EMSA 1MD0A 1OPCA 2CW0F 1X2MA 4A3KJ 3S2DJ 3G73A 3LMMA 3JSPA 3WTXC 4CSWA 3FXUA 3J80Z 1JXSA 3ZQIA 5DD4A 2O8XA 3H1CA 4UV8A 2YX7A 1F1ZA 2R7VA 1X1CA 4J19A 3JRAA 3H92A 5FJ8J 1XC5A 3JAMK 3D0SA 1WWXA 1VQNI 2PMUA 3LA2A 3MEXA 3I56I 3JTGA 2P81A 5LGUA 2FOKA 3WTSC 1R9TJ 1PP7U 4FASD 1U8RA 2L9VA 3ZQ7A 5IP9J 2CMPA 2DYRH 2GM4A 2HPMA 5J4VA 1LKXA 3FXLA 3C3WA 3P9KA 3T5XA 2XSDC 1KQ8A 2DYSH 3VSKA 2LFBA 4NDLA 1C0WA 2FU4A 2R7TA 1MJAA 3CLOA 1J09A 1Z6TA 5A2QZ 2L3DA 2QGUA 2O3FA 2B0LA 4EM2A 6PAXA 4I99C 1SFUA 2PJRA 5F1JA 4CHUA 5GPCA 4BE2A 4B09A 3GBGA 5FO5A 2L0KA 1WI9A 3BT9A 4UUSA 1E0EA 2HFHA 4I98B 2STTA 3HSFA 4OIQF 4PFPA 4RLFA 1YJ9I 2O6GE 1K78B 2V4JC 3HOYJ 4IOAF 2VJ5A 4LD5A 3BG6A 3O3KA 4A12A 3IHUA 2BYVE 2XGDA 3FBIB 5J40A 1H8AC 2HYFA 1SD5A 1SAXA 2ISZA 1LE8B 3J81K 1PJRA 4G6QA 2JT1A 3I0TA 1B1BA 1X1PA 1O3SA 2LP0A 2VB6A 1HOMA 1ZGAA 2HQAA 3M1CA 3H9QA 3EUHC 1OCCH 2EWNA 5TRDA 2R7ZJ 1H0MA 2MLKA 3BR6A 4HZFA 4CDGA 4XORA 4A3MJ 5ICEA 4M9XA 3RIRA 4M9SA 4MGRA 2EFPA 2MD0A 2GOXB 4HYEA 4A0XA 2CSOA 1B72A 2XF7A 3ZMUA 2ZBKA 2FUG2 4E70A 2JSCA 4P9FA 1J9IA 4KNYA 4MQ9F 3HYIA 3CJQB 2ESHA 2WADA 1VQMI 1ONVA 4EJOA 2M87A 2COMA 1K4TA 1HKQA 3G4SI 3E6DA 1MNDA 4Y7NJ 5IP6A 1YO5C 3MKWB 4XONA 1ZRFA 5LEKA 1ETYA 3OYAA 1YOVB 3PSFA 3H0DA 2HZTA 3OIPA 1H89C 1RPWA 3IKVA 3WHCA 4BJ5C 2CQQA 3OY9A 1X3UA 1Z6RA 4HPQA 2H27A 2EA2A 1USSA 1G3TA 3DTIA 2YUSA 1LDJA 3PUBA 3OYCA 1O4XA 2DAOA 1E17A 2ID3A 1IDYA 2ZKZA 2IGMA 3G1MA 3R61A 4WXDA 5D5WB 4JOMA 3JRGA 2EH3A 1W5SA 3M7GA 3I4PA 3BG3A 1Y0UA 5HLHA 4IO9F 5LD2C 2ZC2A 4L5IA 1REPC 2BW3A 1YHQI 1T2KA 5ILUA 1AKHA 4B3AA 3E6MA 1F9NA 5IT3A 2M2EA 3UNGC 3QOPA 4IHXA 2UXNA 4UUTA 3BCAA 4X0GA 2ETHA 3R0JA 1OYWA 4C3JJ 4AD9A 2RGVA 3A02A 4ZC3A 2MFZA 1ETQA 1G4DA 3GYHX 3E5XA 2WBMA 2BE5F 5DCMB 1P4AA 1L3LA 4B4CA 5D4RA 2EZIA 3CDHA 2CV2A 2W7NA 2DA7A 4QIWN 4RM2A 4F7ZA 1IN8A 4XQFA 4BAYA 5E3MA 1S6LA 4C3HJ 3I71A 1VQPI 2HQRA 3SDBA 4D9JA 1G2HA 4O6JA 3OOUA 1S29A 4G94A 2HKXA 3I59B 2PLYA 4QPOA 1BC7C 4E7LA 3HC7A 2FBIA 1JHHA 1SFOJ 2R7OA 2IA1A 3LSPA 2L4AA 4BXXJ 2H94A 2DA3A 1STZA 2DK5A 5LRSA 3GWZA 4HF2A 3I9V2 2DT7B 3BDDA 2F48A 3KP5A 2FBKA 4FE4A 5E1WA 1F36A 1UAAA 3GFMA 5EG0A 2AQEA 2ZJQF 1I1GA 1EH6A 4HSTA 5ILVA 4PSXA 1XN7A 3E5QA 1LFUP 2F5CA 2DOAA 1TWFJ 4MTDA 4A5MA 4Q4ZF 1WI3A 2GXBA 2EJRA 5DTDA 3K1MA 1QZEA 2MD5A 2IBDA 1RNLA 2HOEA 4KIGA 4LB6B 1YRNA 2DA4A 2HEOA 2A6EF 1PUFB 1ZARA 3G1OA 4FISA 4A3IJ 3S3MA 3AL0B 3LFUA 3EYIA 1R4NB 2VJ4A 2NXNB 1I39A 4V2FA 3EDPA 5D5VB 2YU9J 2WAFA 3K1NA 1D8JA 2PG4A 3CJTB 3PNYA 3R0AA 2K9MA 5LGTA 3OYNA 2DPDA 2M4GA 3AL0C 4IPAA 4Z6YA 1WSUA 2XAQA 1G8XA 5FFXA 3RQIA 1TNTA 5F1RA 4XRMA 1WRJA 2QZ8A 3BQZA 2RQQA 1MIJA 2QCOA 3BC8A 2A69F 4LG3A 1XCBA 1H9GA 4BY1J 4BE1A 4DQ2A 4C3IJ 2WWYA 2E60A 3I3LA 3FXJA 1YLFA 2IW5A 1R23A 3VEPA 2R7FA 4M6XA 3ERED 4IHSA 3W6KB 3RZOJ 1IDZA 1TW2A 4IXAA 4ENJA 3WTYC 5L3DA 1AWCA 2DCEA 4OOIA 4BYYA 5LHGA 3HKZN 1P9QC 2FX0A 3PUFA 4N9IA 4OMYA 3FK7A 4CYCB 3KE2A 4NQWA 4PFOA 3ULQB 2I5UA 1YTYA 2JN6A 3B02A 2N8GA 4BBSJ 1NHAA 3KZIC 5FLXK 1RC9A 2LKSA 1I6HJ 1T95A 2HPIA 1K4SA 1X2NA 2YR2A 3WG9A 5L3GA 3E6BA 2O9LA 4WK8F 2K3PA 5HDNA 2QQ8A 3JRFA 2BY3A 1AHDP 3JTHA 3ZMTA 1ZHFA 2JK3A 2XROA 2UUZA 4NUBA 1WQ2A 4O3MA 2M7BA 1TQMA 3UR3C 3TW6A 3SJMA 5LGNA 3QRFF 4HF1A 3KP3A 3ZOBA 1HCRA 2JVHA 4II2A 2QEXI 3M8EA 2X4HA 4F93B 1TT0A 2B9SA 2FF4A 4Q5SF 5EZHA 3CLQA 3GTMJ 1FNNA 3DQVC 3BZKA 5FD6A 3L9FA 1I50J 4EJWA 3L2WA 4JX5A 3KZZA 4KN7X 3FM5A 4LB5A 3H0GJ 4KMUX 3G2BA 4Y15A 2X0LA 2IP2A 4MQVA 4G7HF 5FKMA 4MEYF 1UB9A 3RSNA 3DBHB 3F9KA 2X51A 4D5FA 2PBIA 4XMYA 2HOTA 2TRTA 1D5VA 1CF7A 2DW4A 4UXNA 1U5TA 2Y0MA 3ZP5A 1OLTA 1A6IA 1CQTA 1MMDA 2KMUA 4AWXB 1VTNC 5EJCA 1RRJA 1K79A 1Y1WJ 4K2EA 3CMAI 2JTVA 3TEDA 2P7CB 1IRFA 1HW5A 2WY8Q 3IL2A 2K9LA 1W36C 2FMLA 2NAZA 3CCLI 2M0CA 2P4WA 5HVQC 3S3NA 5M3FJ 2ZO4A 1NTCA 5B1AH 2K9NA 2K40A 5KVRA 1G6NA 2VQLA 2QVOA 1X1DA 3SFIA 3V7SA 3LWFA 1VQ7I 1YYVA 4WCGA 3RKQA 2UZKA 4NB5A 3WU1B 1M1EB 4XSXF 3SZGA 3FIWA 4KICA 3WE2A 2J5PA 2BV6A 2ME6A 3HRUA 3WU0A 3OS1A 3TO6A 3H35A 3F21A 3N97A 2EFWA 4B1RA 4MO7A 3D5SC 1ENHA 1RESA 3J7AO 3BCBA 3BG9A 2NNNA 4CCJA 3J7YJ 5LHIA 2K5CA 2OCCH 2J5OA 2VBZA 1WGXA 2Y9ZA 3LAJA 4XBFA 3CCSI 1DPUA 1IV6A 4RS8A 2Z1DA 1GVDA 3KPHA 1FJLA 4EV0A 1FOWA 1VQKI 2W4SA 1ZR2A 2OTJI 1ERDA 2CH0A 4UVBA 1ZG3A 3NWSA 5IYDJ 2IXSA 2OD5A 2P6TA 5TGTA 1E3PA 3HSEA 4L0ZB 2K02A 4EEFG 4M6YA 1V5FA 2KPMA 3G6EI 2HWVA 5CVRA 2M8GX 1U6GA 3FXRA 1DP3A 2KDOA 3HZJA 3DU6A 4LIUA 3K4BA 1GV5A 4M3FA 5H2FC 4RB1A 3HOTA 3CF2A 2IEKA 2Y48A 3GFLA 2JA6J 3AKZA 3E97A 2UWMA 5J1RA 3W2WA 5HDGA 3LSMA 3ZMDA 1YJNI 3T0YA 4FHTA 2KL4A 2GA1A 4B3XA 3AFHA 3IAS2 4E7KA 4BJTA 2GIVA 2W82A 1TW3A 4BXFA 2EIKH 1UHWA 2QENA 5LFAA 2HVQA 4LOCA 1YIOA 2K7LA 2HQNA 4A3FJ 3C1DA 1TZLA 4XICA 1UCRA 1VQ6I 2OZUA 4LLGF 2BHZA 1IG7A 3IWZA 3BTLA 1E3OC 1T38A 4JK1X 2WB1A 1I3QJ 1T98A 4S0HB 2D45A 2D1HA 2ELJA 3BTIA 3I54A 3N05A 3EQLF 2GQQA 2QKLB 5J8CA 1TWAJ 3MZ8A 1QO0D 2GOMA 2QBYA 3CD6I 3LSIA 3MQ0A 2YPRA 4OU0A 4AYBA 1QRYA 2DBBA 2GAUA 2F2EA 4NC6A 2DMQA 4RMNA 5L3CA 3B6AA 1FIAA 1F43A 2JZYA 3K2AA 2E2IJ 1Z7UA 4A0YA 3FZVA 5JHUA 2X9DA 5F04A 4DYCA 4HRIA 2XDVA 3FDYA 3VFZA 2IVMA 1POGA 3FWEA 2LBFB 1EV7A 1VQOI 3KFWX 1YI2I 1HSTA 2AS5F 2VJJA 4HLYA 4I0BA 2D2WA 4HV5A 5EGOA 3D5LA 1BL0A 4RDUA 1UG0A 1KONA 4Y3OA 3BTCA 2G0EA 3E0JB 3V4GA 1LEAA 1WHUA 2KZVA 1X1AA 4NNJA 2PQ8A 4LG0A 1IRGA 2HXIA 3FX3A 2XC7A 3IV5A 4IEJA 3F23A 1WH7A 2JMWA 3F8FA 4JYKA 4RGSA 2FQ3A 3S1QJ 2XUBA 2LLKA 3GX4X 4IZZA 4KT6A 3WODF 4EGZA 4I09A 2ZXIA 3LSHA 2M34A 3RI4A 5GADJ 1ZGWA 1BI2A 2FA5A 1BC8C 1B9MA 4KIFA 3HHHA 2DTZA 4RLQA 1TP4A 3T1BA 3VPRA 2FJ1A 3ZRGA 1VFCA 1GHCA 2GXAA 1MW7A 2Q2EB 3KZYA 2VC0A 2KJBA 1I5ZA 2R0QC 3HUGB 1W7PA 2KT0A 5KHDA 2K85A 5IY5H 3FMSA 2H8RA 3ML6A 3GTKJ 2VOPA 4ZYHA 1IUFA 2Y0SN 5HLIA 3ECOA 4CCLA 1Z91A 2CFXA 4CCKA 3R4KA 1LFPA 5FKNA 1J75A 4A3EJ 2F4MB 3S1NJ 3CDIA 1J7KA 4YEJA 4P9UA 3BR1A 3KYDB 5D8LB 1MBEA 1ON1A 2DMNA 3NQOA 2P5KA 5ED4A 4IHTA 1IGNA 3PO2J 5J1YA 2KRCA 1MMNA 1TQIA 2MC4A 3DCFA 3H5RA 3LSTA 4MTEA 4I02A 3R6SA 2X6OA 2QYOA 3DLLF 1IN7A 5C4XJ 3KCCA 4HDVA 4MFEA 4J00A 1SAUA 3Q0WA 3FXQA 2RDPA 3S14J 1JGSA 2PMZN 3IWFA 1X1BA 3P9CA 4GYIA 2DMTA 2W85A 1T0FA 4CO8A 3COAC 1K61A 2FNAA 4IF4A 2PI0A 3DF8A 2BY2A 1FY7A 4JBAA 4RBOA 2DJIA 2NS7A 5K7ZA 1HKTA 2D1VA 2LVSA 3KP6A 3QPSA 2V1UA 3BR3A 5E79C 3OYGA 2OQGA 3RJPA 3HOWJ 5IPAA 1FBUA 2ZFUA 1O7LA 1MNEA 1X3ZB 2VKHA 4HX4A 2ZMEB 1N77A 2MH9A 1MDMB 2W25A 1YX3A 5JR3A 2XF6A 5JVGF 1A31A 1JT6A 4Y33A 4RB0A 1FSEA 5HLTA 1DU6A 2DMUA 3ZQFA 4J01A 4B47A 2LH9A 1OFCX 2EZKA 3E1SA 5LHHA 5HLGA 5AIPA 5BOXA 1XX5A 2ZMEC 2LY9A 2O0YA 5E18F 4LIVA 2EPFA 2MSYA 3CJRB 3DU5A 3CCYA 5JHFA 5GAEJ 5J6XA 3OOPA 3FMQA 1N78A 3M4OJ 1MSEC 4UNOA 1LQ1A 4G12A 3TQNA 2E5ZA 3K4CA 2EZHA 1WJCA 1DU0A 2RAEA 4IRIA 2HDWA 2HVRA 2GXGA 4R1HA 1XGNA 5DS9A 1R22A 1SD4A 2FOWA 2KP6A 1BW6A 1VQ8I 5DD8A 2XAJA 1OKRA 5B3SH 3K4NA 5GTIC 3ASNH 3ELKA 2COBA 4ZYAA 1DDNA 4H0EA 3CZ6A 2LTPA 1APLC 4E7JA 3WG7H 4XLAA 1R7JA 4B8XA 2CO5A 2Z2SB 3EUKL 2R4GA 4NHJA 1ZR4A 1FYLA 1X58A 1VQLI 3OS0A 3HRTA 4KYWA 1YW8A 4C9YA 4FX4A 2K4JA 1K78A 1ZLKA 1PYVA 4HNVA 4IHVA 4F92B 4ETSA 1ITYA 2I10A 3BQYA 1Z21A 3EUHA 4BBRJ 4M72A 2WV1A 4KITB 1I1SA 2L7FP 1LDDA 4I01A 3MCZA 1LE8A 1A04A 1MBGA 2DQRA 3GF2A 1RKTA 1HKSA 4KIBA 3KX2A 2OAZA 2E7WA 1LB2A 1K7AA 1V55H 3R60A 3S16J 2KQRA 1HQCA 2L7ZA 2Z3YA 4LK0F 5CQGA 2EB7A 3PQJA 1ZK8A 2DA5A 2KRFA 1IXRC 2XGXA 3BR0A 2RC4A 4RAGA 1WZ2A 4MNUA 2OJED 4AM3A 1XMAA 3CMYA 2M5WA 4BHCA 4XLCA 3RZDJ 1U0JA 2KFDA 3TDZC 3ONQA 1KYWA 4R8HA 5M3MJ 4PUSA 2LKPA 2IT0A 4HQMA 4XKWA 5J8FA 3MWMA 2KRHA 4ZYDA 1ETOA 1TLHB 4UB6C 4LMYA 1U9OA 3K6GA 4OWRB 2WAQN 2IS6A 1LJ9A 2CU7A 2XB5A 2EV5A 1BR4A 1NG6A 2DLLA 5J1UA 4BL0B 5LBQA 2JA8J 3HG9A 1Y1VJ 4G7OF 2A61A 1Y39A 1IZ1A 1RR7A 2KIQA 5AONA 4YG2F 3BR5A 2M4KA 5BS6A 2Z5UA 5M5XJ 2QLZA 2XSJC 2RN7A 1R5ID 2EINH 1I3AA 3H3ZA 1MBFA 3Q9VA 3J7AY 2CUFA 2ZJ2A 1Y8RB 2BXYA 3QQAA 3DFGA 1XS9A 4HV6A 3U1DA 3O6BB 1IN6A 3VDXA 2L7KA 2V79A 2UXXA 4HW0A 3V42A 1UHMA 1LVAA 2V7FA 1FTTA 3IH4A 2EFNA 3IC7A 3RQ4A 4E6KG 3PIOF 5K1YA 4I2OA 2JA2A 4RM3A 1Q1VA 4HQEA 1TL8A 2QKMB 1ETXA 1YS6A 3HRSA 3QYBA 3FHZA 1KU9A 3K4LA 4RAFA 3CMEI 1SC7A 2CUZA 2MABA 2LF7A 2RREA 2Z16A 3A01B 3GFIA 2ACJA 2XV4S 2CW8A 3V8LA 3L00A 3ZQQA 2ICWG 2HYJA 5ILSA 3JAMZ 1QQIA 2HR3A 2MYSA 1J5YA 3QYEA 3BP8A 3PM1A 2EV6A 3C7JA 2XB0X 2W1OA 2XAGA 1P7JA 3REOA 5DCMA 4F91B 1OYYA 2L4MA 3EPZA 4G6TB 2DT5A 3OYKA 1IRXA 2K9SA 5CVJA 1BI0A 2LYCA 1XSDA 2Y69H 5FKOA 3JCUC 4L5EA 1QHGA 1FEXA 4D5CA 1KU3A 3PFIA 1D0ZA 3BR2A 3HGYA 3ZCOA 3ISPA 1MBKA 1JTYA 4OMZA 4FQGA 4PGGA 3I59A 4YFKF 2DQLA 3NRVA 2EA4A 3CC2I 2E2JJ 3GUDA 4CGZA 2X85A 1HLVA 2F5VA 1KQ9A 2A05A 4JP0A 5EF6A 1MMAA 2MGQA 1JUMA 2YU3A 3F6OA 5K7FA 1K6OA 2W84A 2V26A 4EJTA 2A07F 4KJZA 4PGHA 4F55A 1N25A 3RKYA 1TWCJ 1VI0A 1ODDA 4A3JJ 1IRZA 1O3QA 1Z05A 4PJJA 3MZYA 4DYRA 4XRFA 4XLNF 1QNTA 3J81Z 1O57A 2EZLA 3DPLC 1Z1DA 3BPXA 2NVQJ 1OCZH 3D5RC 1FOYA 2IGKA 4M3DA 1GLNA 4U0YA 4MFDA 1TNSA 4LJZF 3QAHA 3F8NA 1Y6IA 2JUCA 3PFYA 3M9AA 4E7ZA 3DLAA 4DBQA 4XLPF 1QU3A 5M5WJ 3TMOA 1YQAA 5FKLA 2X1DA 1PUFA 2O03A 1BM9A 1EJ9A 2Q0OA 4ZZDA 4ESFA 1B6AA 1SFEA 3K7AJ 1VQ4I 4A3GJ 3UKGA 2E34A 1DP7P 1FSHA 2AQFA 1B8IB 3QU6A 1Y8QB 1IF1A 1YX5A 3G71I 1JE8A 5FRNA 1QHHD 3JREA 2IS1A 2FEZA 5FRMA 5F0FA 2AXLA 4HNUA 3O2PE 1D1BA 2LY2A 3MFKA 4B44A 4DNCA 5JI6A 1S9HA 4M6VA 1D1CA 3IRQA 1YFHA 3GO5A 1XDSA 2CQKA 1MSFC 2OF7A 2K4BA 2JQ7A 2M0MA 3BROA 2BEOA 1N75A 2JVGA 3PL8A 1P7IA 1YITI 3FKJA 3BJ6A 2NS8A 4XRSG 3CP8A 1ORKA 1SMTA 1AOYA 2VXZA 1IV8A 1W1WE 2ZSHB 4CYCA 1WH5A 3CCEI 1ZRDA 4ON0A 4OAZA 1XB4A 4BE0A 1MKMA 4D7NA 1SVMA 5LLQA 3HTSB 3B73A 3DXJF 1ETVA 5E3LA 1IAWA 1BOBA 1OYIA 3BG5A 1QBJA 4WX9A 5TISC 4ITVA 1JHFA 4IRGA 3LAPA 2HYGD 3WE3A 2XAHA 3FM3A 4G7ZF 4BKXA 1HXDA 3CDLA 2V1XA 3LQRA 1USTA 4KA4A 2M30A 3Q5FA 3GTOJ 3PJRA 2LNBA 3CCRI 3OSGA 2NNYA 2ELHA 4HBLA 2L54A 3KEOA 1FZPB 2V9PA 3CMMA 1ULYA 3ZMZA 2PX9A 2CUEA 3T8RA 1QZZA 4XM3A 4MHGA 2WV0A 4IQ4A 5CPRB 5BPIA 3ABMH 2R7RA 2WA0A 2XHKA 2P0WA 2VKEA 2E35A 2XASA 5FFZA 3OR1C 4GFBA 2FXAA 4C2UA 2QSFX 1TC3C 3NWTA 2Y2ZA 3QP5A 2ZJRF 4GCVA 2VPRA 4I7HA 3HXLA 3DKXA 3HOVJ 4AUXA 1SFKA 3HIFA 4LITA 5TJJA 1Z3XA 3JRCA 4CH7A 2A5YB 2B7EA 2KIUA 2IAIA 4CCOA 3C2GA 3K10A 2OPTA 4TV7A 2BVMA 2CRGA 4U7DA 3GW2A 3LSRA 4IHWA 5E1ZB 2EBIA 3DTEA 3TOBA 4ZDLA 3LSKA 1MNMC 1FP2A 4AU7A 3CQZJ 1BBYA 4Y4RA 2UV1A 1W4MA 2KISA 3FBNB 2M1BA 1I27A 2STWA 2VC1A 2BHYA 1O3RA 1W0TA 2Y31A 2L9NA 5D4SA 5EDNA 1B59A 4Q48A 1GUUA 4EVIA 2JPBA 2VT2A 2VN2A 5CYVA 2ECBA 3BJAA 4E7SA 3K2ZA 3VYRB 2R5YB 3CUOA 4CUGA 3TP3A 3GZNB 2ME0A 1O7FA 2BXZA 1VQ9I 1BR2A 2XPVA 3PNTA 4BHBA 2DFIA 1BI1A 4HEA2 5B66C 3CTAA 2ZJPF 1QPMA 1T08B 1JJ8C 1T39A 2QQ9A 4XN0A 4ZTJA 1A6QA 2DK8A 2E7XA 1F4KA 3AG2H 5BNGA 3S15J 3SYTA 2A6HF 3EYYA 3L2RA 3GEZA 3E3VA 1V3FA 2Y9YA 1IXSB 2ISYA 2K3FA 2OZ6A 5HNHA 1TT5B 3SZPA 3DBLB 1JGGA 3FISA 2NOGA 2F5DA 1JKPC 2CV1A 1OCOH 5CVIA 5ICFA 1JKRC 2RKHA 1XMKA 3GLXA 3WGGA 2EQRA 5AIQA 4YFNF 1HC8A 1K83J 3HPGA 1X3WB 5EYRA 1FPQA 1U78A 4KDPA 3WTVC 4BDYA 4FTHA 1PP8F 3SEZA 1R1VA 2XKOA 4GRIA 3RTRA 2LF8A 3LOCA 3S2HJ 3F0CA 3F6VA 5H6QA 4AIDA 1DQUA 4FX0A 4CZZA 4ZJZA 3L2VA 1V4RA 4NC7A 5KCMA 1P6RA 4DBRA 2OA4A 2O61A 1QVTA 3N4MA 2KHMA 5DUIA 1D0XA 2B63J 1Z67A 4B43A 5IT9K 5JFRA 3P7NA 5KK1A 1SFXA 3IH3A 2VJIA 1PVEA 3GFJA 5FLXZ 2LR8A 2G7UA 3C2HA 4A3LJ 2F4IA 3CC4I 1LPQA 1WPKA 2OU2A 3GVAA 4HNTA 4M74A 4LLNA 1G3WA 3U1KA 4XSZF 1BA5A 3HJEA 1WVRA 4PSWA 2WTEA 3PO3J 3BG7A 4BEHB 3MD2A 1UZCA 3W6VA 3H3VK 2H8WA 2LG4A 4HDUA 4E7HA 1OCPA 3CO6C 3VYTB 1KGSA 4DIQA 1YW7A 5C4JJ 2V6EA 4A3DJ 3BWGA 4A93J 1S8NA 2HI3A 4CICA 1OR7C 2XGCA 5CQEA 1EH7A 3WTZA 1ZAOA 2R7QA 1R36A 3I55I 3I4NJ 3K1PA 1NH3A 2EK5A 1PDNC 3M8JA 3L1PA 3H5NA 5IOYA 3J80K 3MMYB 4BJ6C 1LDKB 1W0UA 2WC2A
chains in the Genus database with same CATH topology
5DS9A 3G1LA 4B4CA 3HEFA 2EZIA 2NVYJ 5E3NA 1BW5A 4AC0A 2DA7A 4QIWN 3JRHA 1BW6A 5E3MA 2DA1A 4C3HJ 2R5ZB 3S1RJ 4X6AJ 2HXOA 2COBA 2DJNA 2XPWA 1G2HA 2LTPA 3OOUA 1APLC 5C3EJ 2DA6A 1ETKA 1TWHJ 1JKOC 3NARA 1ZR4A 1SFOJ 1X58A 3LSPA 4BXXJ 2JJ7A 2DA3A 2R5YA 2ZB9A 3TP0A 4HNVA 1MBJA 4IHVA 4FE4A 1ITYA 1F36A 2I10A 3BQYA 4BBRJ 1Z77A 2WV1A 5EG0A 5EEAA 1GT0C 2L7FP 1IC8A 1LE8A 1LFUP 3IH2A 4BY7J 1MBGA 1RKTA 1TWFJ 2WB1N 1WI3A 3C2BA 5DTDA 3S16J 1TWGJ 2YS9A 2L7ZA 3JRDA 3HOXJ 3I4MJ 2IBDA 1ZK8A 2XRLA 2DA5A 3BR0A 1HF0A 1YRNA 2DA4A 2LKXA 1U8BA 3G1OA 1PUFB 4FISA 4JX6A 3CMYA 4A3IJ 3RZDJ 4AYBN 1FIPA 4V2FA 2AO9A 5HODA 3TW7A 5M3MJ 2YU9J 1A5JA 2NVXJ 2HOAA 2LK2A 3D1NI 4A69C 2XPUA 1ETOA 2DN0A 1BJZA 3OSFA 2E2HJ 5FKKA 1U9OA 4DW6A 2WAQN 3RQIA 4QTRA 4XRMA 3SDGA 2HQ5A 3BQZA 3LNQA 2CU7A 3HDDA 2XB5A 2GBYA 2QCOA 5J1UA 2ID6A 2JA8J 5EZGA 4BY1J 1Y1VJ 5FLMJ 1SANA 4ABZA 4I76A 4C3IJ 1RR7A 3HGGA 3BR5A 3RZOJ 1IDZA 3M3YJ 5M5XJ 1T33A 3B6CA 3HKZN 3A03A 1MBFA 1ZTRA 2FX0A 3GTLJ 2MW8A 3FK7A 4CYCB 2CUFA 3QQAA 1XS9A 2E19A 2JN6A 2LD5A 2N8GA 4BBSJ 3GTPJ 1JT0A 2O7OA 1FTTA 3Q3SA 1I6HJ 3IH4A 5JLXA 2ECCA 1HDPA 1X2NA 1Q1VA 4M3GA 3ZQLA 2X48A 2GLOA 1HDDC 2O9LA 2CQXA 1ETXA 2JA7J 2XGEA 4DZPA 4XK4A 4DZJA 2VI6A 5C44J 2TCTA 3JRFA 3A01B 1AHDP 2D5VA 2JK3A 2R93J 3GTGJ 1MBHA 4A3BJ 1XG1A 5F0HA 4Y52J 4DYQA 2HYJA 3HB9A 3ZQCA 3TW6A 3SJMA 3ZOBA 1UG2A 1HCRA 1S7EA 3PM1A 1GV2A 3JR9A 2XB0X 1P7JA 3HM5A 5EZHA 3GTMJ 2K9SA 1I50J 5FKOA 4JX5A 3WHBA 4L5EA 3H0GJ 1FEXA 4D5CA 2R5ZA 3BR2A 3O8HA 5FKMA 2R92J 3HGYA 3GTQJ 1MBKA 1JTYA 1D5YA 4D5FA 2HOTA 2TRTA 3MN2A 2E2JJ 2W48A 4W1UA 3JRIA 1A6IA 1CQTA 1HLVA 1JJ6C 5EGOB 4JP0A 5EF6A 1Y1WJ 2CJJA 2MGQA 1JUMA 5K7FA 3TEDA 3OIOA 1FTZA 4FCYA 1TWCJ 1VI0A 4A3JJ 2M0CA 1IRZA 5F27A 5M3FJ 5FLVA 1NTCA 2K9NA 4DYRA 2K40A 4UUSB 2VUMJ 2EZLA 3SFIA 1AU7A 2NVQJ 4M3DA 3RKQA 4MFDA 5GP9A 2K9QA 5F08A 3HOZJ 3DEWA 3FIWA 5M5WJ 5FKLA 1PUFA 2ME6A 1U9NA 2JWTA 1MH4A 4QSHA 1Z0XA 1UMQA 3K7AJ 4MO7A 4B1RA 3UKGA 4A3GJ 1ENHA 3NAUA 1RESA 3ZQGA 1B8IB 3BG9A 2AHQA 1W0UA 3JREA 1RETA 4M3EA 5K7HA 1WGXA 5F0FA 2Y9ZA 1ZKGA 3BTJA 1IV6A 5IOZA 1T56A 3ZQHA 5M5YJ 4W97A 1GVDA 1FJLA 4M6VA 1ZR2A 4A3CJ 1ZQ3P 1MSFC 1B72B 2OF7A 3Q0VA 2KDZA 5IYDJ 1JTXA 1JUPA 3GTJJ 4M3BA 4MIMA 1P7IA 3MKLA 3LSJA 4EEFG 2NS8A 4XRSG 1ORKA 2ELKA 2M8GX 1GDTA 1VNDA 4FE7A 1WH5A 4CYCA 5IYBJ 4M3FA 2MG4A 1GV5A 2HDDA 1EF4A 2IEKA 2JA6J 2VKVA 4D7NA 1JKQC 3FK6A 5J1RA 1NK2P 1ETVA 5E3LA 2FD5A 3BG5A 9ANTA 1WCMJ 1QVUA 1OCTC 3MVPA 2NVTJ 4BKXA 3CDLA 4D7MA 3GTOJ 4LOCA 2HOSA 5GPAA 4A3FJ 3OSGA 2M9HA 3A01A 4XICA 3S17J 3HOUJ 1UHSA 1IG7A 2CUEA 3O8GA 3BTLA 1E3OC 4A3KJ 1X2MA 1I3QJ 3S2DJ 4S0HB 1AKHB 5F0CA 3BTIA 5J3LA 2VKEA 3ZQIA 1TWAJ 4IHYA 4GFBA 4J19A 3JRAA 1TC3C 1MH3A 2Y2ZA 1QRYA 2VPRA 1XC5A 2DMQA 3B6AA 3HOVJ 1FIAA 4AUXA 2P81A 1F43A 3K2AA 3LSGA 3JRCA 2E2IJ 2IAIA 2X9DA 5F04A 1R9TJ 1QPIA 4DYCA 2OPTA 1POGA 5IP9J 2GM4A 2CRGA 3LSRA 4IHWA 1MNMC 2EBIA 5EGOA 2XSDC 2LFBA 3CQZJ 4NDLA 1BL0A 4RDUA 3BTCA 4MLOA 2G0EA 5F1JA 5GPCA 2HXIA 1NK3P 1W0TA 2Y31A 3GBGA 5EDNA 4IEJA 2L0KA 1WH7A 3BT9A 3IV5A 2JMWA 4JYKA 4UUSA 1GUUA 2L9RA 3S1QJ 2ECBA 4XIDA 2R5YB 3HOYJ 3TP3A 2ME0A 2LLKA 2XPVA 5EG0B 2M34A 2XGDA 3FKIJ 1ZGWA 1H8AC 1JUSA 1LE8B 2DTZA 3VPRA 1JJ8C 2FJ1A 1VFCA 3Q0UA 2LP0A 1HOMA 5BNGA 1B8IA 3S15J 2Y9YA 2R7ZJ 1YRNB 2R0QC 1JGGA 2FQ4A 2KT0A 3FISA 2DA2A 2NOGA 3BR6A 1JKPC 3E7LA 1OJLA 2H8RA 4A3MJ 4V2GA 3GTKJ 5IYCJ 1JKRC 1IUFA 2Y0SN 2EQRA 5E3OA 1B72A 1K83J 5EYRA 5FKNA 4A3EJ 1U78A 3S1NJ 1IJWC 3BR1A 4FTHA 1MBEA 2DMNA 3PO2J 1IGNA 5J1YA 2JA5J 5IP6A 3LOCA 4Y7NJ 3S2HJ 3F0CA 3DCFA 3JRBA 2QF7A 1ETYA 2X6OA 5C4XJ 1QVTA 2B63J 4MFEA 3Q0WA 3S14J 2PMZN 5FJ8J 1H89C 1RPWA 2DMTA 3WHCA 3IH3A 1K61A 2CQQA 4C2MJ 2LR8A 1RKWA 4I6ZA 4RBOA 5JLWA 4A3LJ 2YUSA 3QPLA 1O4XA 2NS7A 2ID3A 5K7ZA 2Y30A 1IDYA 1WPKA 1VF9A 2LVSA 3HBLA 3QPSA 3BR3A 3G1MA 1LFBA 3JRGA 1BA5A 3HOWJ 2EH3A 5IPAA 3BG3A 2L7MP 3PO3J 2H1KA 1ETWA 3W6VA 1JT6A 4XRSA 3H3VK 1AKHA 4B3AA 1OCPA 1H88C 1DU6A 2DMUA 3ZQFA 2M2EA 2DMPA 1OFCX 2EZKA 5C4JJ 4IHXA 4A3DJ 4UUTA 4A93J 2HI3A 2LY9A 2E1OA 2XGCA 4C3JJ 2MSYA 3I4NJ 5IP7J 3CCYA 3S1MJ 2O8KA 3A02A 3L1PA 3M4OJ 1MSEC 5IOYA 4G12A 1ETQA 2EZHA 4JX4A 1DU0A 4X1EA 2RAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DS9 A;  3G1L A;  4B4C A;  3HEF A;  2EZI A;  2NVY J;  5E3N A;  1BW5 A;  4AC0 A;  2DA7 A;  4QIW N;  3JRH A;  1BW6 A;  5E3M A;  2DA1 A;  4C3H J;  2R5Z B;  3S1R J;  4X6A J;  2HXO A;  2COB A;  2DJN A;  2XPW A;  1G2H A;  2LTP A;  3OOU A;  1APL C;  5C3E J;  2DA6 A;  1ETK A;  1TWH J;  1JKO C;  3NAR A;  1ZR4 A;  1SFO J;  1X58 A;  3LSP A;  4BXX J;  2JJ7 A;  2DA3 A;  2R5Y A;  2ZB9 A;  3TP0 A;  4HNV A;  1MBJ A;  4IHV A;  4FE4 A;  1ITY A;  1F36 A;  2I10 A;  3BQY A;  4BBR J;  1Z77 A;  2WV1 A;  5EG0 A;  5EEA A;  1GT0 C;  2L7F P;  1IC8 A;  1LE8 A;  1LFU P;  3IH2 A;  4BY7 J;  1MBG A;  1RKT A;  1TWF J;  2WB1 N;  1WI3 A;  3C2B A;  5DTD A;  3S16 J;  1TWG J;  2YS9 A;  2L7Z A;  3JRD A;  3HOX J;  3I4M J;  2IBD A;  1ZK8 A;  2XRL A;  2DA5 A;  3BR0 A;  1HF0 A;  1YRN A;  2DA4 A;  2LKX A;  1U8B A;  3G1O A;  1PUF B;  4FIS A;  4JX6 A;  3CMY A;  4A3I J;  3RZD J;  4AYB N;  1FIP A;  4V2F A;  2AO9 A;  5HOD A;  3TW7 A;  5M3M J;  2YU9 J;  1A5J A;  2NVX J;  2HOA A;  2LK2 A;  3D1N I;  4A69 C;  2XPU A;  1ETO A;  2DN0 A;  1BJZ A;  3OSF A;  2E2H J;  5FKK A;  1U9O A;  4DW6 A;  2WAQ N;  3RQI A;  4QTR A;  4XRM A;  3SDG A;  2HQ5 A;  3BQZ A;  3LNQ A;  2CU7 A;  3HDD A;  2XB5 A;  2GBY A;  2QCO A;  5J1U A;  2ID6 A;  2JA8 J;  5EZG A;  4BY1 J;  1Y1V J;  5FLM J;  1SAN A;  4ABZ A;  4I76 A;  4C3I J;  1RR7 A;  3HGG A;  3BR5 A;  3RZO J;  1IDZ A;  3M3Y J;  5M5X J;  1T33 A;  3B6C A;  3HKZ N;  3A03 A;  1MBF A;  1ZTR A;  2FX0 A;  3GTL J;  2MW8 A;  3FK7 A;  4CYC B;  2CUF A;  3QQA A;  1XS9 A;  2E19 A;  2JN6 A;  2LD5 A;  2N8G A;  4BBS J;  3GTP J;  1JT0 A;  2O7O A;  1FTT A;  3Q3S A;  1I6H J;  3IH4 A;  5JLX A;  2ECC A;  1HDP A;  1X2N A;  1Q1V A;  4M3G A;  3ZQL A;  2X48 A;  2GLO A;  1HDD C;  2O9L A;  2CQX A;  1ETX A;  2JA7 J;  2XGE A;  4DZP A;  4XK4 A;  4DZJ A;  2VI6 A;  5C44 J;  2TCT A;  3JRF A;  3A01 B;  1AHD P;  2D5V A;  2JK3 A;  2R93 J;  3GTG J;  1MBH A;  4A3B J;  1XG1 A;  5F0H A;  4Y52 J;  4DYQ A;  2HYJ A;  3HB9 A;  3ZQC A;  3TW6 A;  3SJM A;  3ZOB A;  1UG2 A;  1HCR A;  1S7E A;  3PM1 A;  1GV2 A;  3JR9 A;  2XB0 X;  1P7J A;  3HM5 A;  5EZH A;  3GTM J;  2K9S A;  1I50 J;  5FKO A;  4JX5 A;  3WHB A;  4L5E A;  3H0G J;  1FEX A;  4D5C A;  2R5Z A;  3BR2 A;  3O8H A;  5FKM A;  2R92 J;  3HGY A;  3GTQ J;  1MBK A;  1JTY A;  1D5Y A;  4D5F A;  2HOT A;  2TRT A;  3MN2 A;  2E2J J;  2W48 A;  4W1U A;  3JRI A;  1A6I A;  1CQT A;  1HLV A;  1JJ6 C;  5EGO B;  4JP0 A;  5EF6 A;  1Y1W J;  2CJJ A;  2MGQ A;  1JUM A;  5K7F A;  3TED A;  3OIO A;  1FTZ A;  4FCY A;  1TWC J;  1VI0 A;  4A3J J;  2M0C A;  1IRZ A;  5F27 A;  5M3F J;  5FLV A;  1NTC A;  2K9N A;  4DYR A;  2K40 A;  4UUS B;  2VUM J;  2EZL A;  3SFI A;  1AU7 A;  2NVQ J;  4M3D A;  3RKQ A;  4MFD A;  5GP9 A;  2K9Q A;  5F08 A;  3HOZ J;  3DEW A;  3FIW A;  5M5W J;  5FKL A;  1PUF A;  2ME6 A;  1U9N A;  2JWT A;  1MH4 A;  4QSH A;  1Z0X A;  1UMQ A;  3K7A J;  4MO7 A;  4B1R A;  3UKG A;  4A3G J;  1ENH A;  3NAU A;  1RES A;  3ZQG A;  1B8I B;  3BG9 A;  2AHQ A;  1W0U A;  3JRE A;  1RET A;  4M3E A;  5K7H A;  1WGX A;  5F0F A;  2Y9Z A;  1ZKG A;  3BTJ A;  1IV6 A;  5IOZ A;  1T56 A;  3ZQH A;  5M5Y J;  4W97 A;  1GVD A;  1FJL A;  4M6V A;  1ZR2 A;  4A3C J;  1ZQ3 P;  1MSF C;  1B72 B;  2OF7 A;  3Q0V A;  2KDZ A;  5IYD J;  1JTX A;  1JUP A;  3GTJ J;  4M3B A;  4MIM A;  1P7I A;  3MKL A;  3LSJ A;  4EEF G;  2NS8 A;  4XRS G;  1ORK A;  2ELK A;  2M8G X;  1GDT A;  1VND A;  4FE7 A;  1WH5 A;  4CYC A;  5IYB J;  4M3F A;  2MG4 A;  1GV5 A;  2HDD A;  1EF4 A;  2IEK A;  2JA6 J;  2VKV A;  4D7N A;  1JKQ C;  3FK6 A;  5J1R A;  1NK2 P;  1ETV A;  5E3L A;  2FD5 A;  3BG5 A;  9ANT A;  1WCM J;  1QVU A;  1OCT C;  3MVP A;  2NVT J;  4BKX A;  3CDL A;  4D7M A;  3GTO J;  4LOC A;  2HOS A;  5GPA A;  4A3F J;  3OSG A;  2M9H A;  3A01 A;  4XIC A;  3S17 J;  3HOU J;  1UHS A;  1IG7 A;  2CUE A;  3O8G A;  3BTL A;  1E3O C;  4A3K J;  1X2M A;  1I3Q J;  3S2D J;  4S0H B;  1AKH B;  5F0C A;  3BTI A;  5J3L A;  2VKE A;  3ZQI A;  1TWA J;  4IHY A;  4GFB A;  4J19 A;  3JRA A;  1TC3 C;  1MH3 A;  2Y2Z A;  1QRY A;  2VPR A;  1XC5 A;  2DMQ A;  3B6A A;  3HOV J;  1FIA A;  4AUX A;  2P81 A;  1F43 A;  3K2A A;  3LSG A;  3JRC A;  2E2I J;  2IAI A;  2X9D A;  5F04 A;  1R9T J;  1QPI A;  4DYC A;  2OPT A;  1POG A;  5IP9 J;  2GM4 A;  2CRG A;  3LSR A;  4IHW A;  1MNM C;  2EBI A;  5EGO A;  2XSD C;  2LFB A;  3CQZ J;  4NDL A;  1BL0 A;  4RDU A;  3BTC A;  4MLO A;  2G0E A;  5F1J A;  5GPC A;  2HXI A;  1NK3 P;  1W0T A;  2Y31 A;  3GBG A;  5EDN A;  4IEJ A;  2L0K A;  1WH7 A;  3BT9 A;  3IV5 A;  2JMW A;  4JYK A;  4UUS A;  1GUU A;  2L9R A;  3S1Q J;  2ECB A;  4XID A;  2R5Y B;  3HOY J;  3TP3 A;  2ME0 A;  2LLK A;  2XPV A;  5EG0 B;  2M34 A;  2XGD A;  3FKI J;  1ZGW A;  1H8A C;  1JUS A;  1LE8 B;  2DTZ A;  3VPR A;  1JJ8 C;  2FJ1 A;  1VFC A;  3Q0U A;  2LP0 A;  1HOM A;  5BNG A;  1B8I A;  3S15 J;  2Y9Y A;  2R7Z J;  1YRN B;  2R0Q C;  1JGG A;  2FQ4 A;  2KT0 A;  3FIS A;  2DA2 A;  2NOG A;  3BR6 A;  1JKP C;  3E7L A;  1OJL A;  2H8R A;  4A3M J;  4V2G A;  3GTK J;  5IYC J;  1JKR C;  1IUF A;  2Y0S N;  2EQR A;  5E3O A;  1B72 A;  1K83 J;  5EYR A;  5FKN A;  4A3E J;  1U78 A;  3S1N J;  1IJW C;  3BR1 A;  4FTH A;  1MBE A;  2DMN A;  3PO2 J;  1IGN A;  5J1Y A;  2JA5 J;  5IP6 A;  3LOC A;  4Y7N J;  3S2H J;  3F0C A;  3DCF A;  3JRB A;  2QF7 A;  1ETY A;  2X6O A;  5C4X J;  1QVT A;  2B63 J;  4MFE A;  3Q0W A;  3S14 J;  2PMZ N;  5FJ8 J;  1H89 C;  1RPW A;  2DMT A;  3WHC A;  3IH3 A;  1K61 A;  2CQQ A;  4C2M J;  2LR8 A;  1RKW A;  4I6Z A;  4RBO A;  5JLW A;  4A3L J;  2YUS A;  3QPL A;  1O4X A;  2NS7 A;  2ID3 A;  5K7Z A;  2Y30 A;  1IDY A;  1WPK A;  1VF9 A;  2LVS A;  3HBL A;  3QPS A;  3BR3 A;  3G1M A;  1LFB A;  3JRG A;  1BA5 A;  3HOW J;  2EH3 A;  5IPA A;  3BG3 A;  2L7M P;  3PO3 J;  2H1K A;  1ETW A;  3W6V A;  1JT6 A;  4XRS A;  3H3V K;  1AKH A;  4B3A A;  1OCP A;  1H88 C;  1DU6 A;  2DMU A;  3ZQF A;  2M2E A;  2DMP A;  1OFC X;  2EZK A;  5C4J J;  4IHX A;  4A3D J;  4UUT A;  4A93 J;  2HI3 A;  2LY9 A;  2E1O A;  2XGC A;  4C3J J;  2MSY A;  3I4N J;  5IP7 J;  3CCY A;  3S1M J;  2O8K A;  3A02 A;  3L1P A;  3M4O J;  1MSE C;  5IOY A;  4G12 A;  1ETQ A;  2EZH A;  4JX4 A;  1DU0 A;  4X1E A;  2RAE A; 
#chains in the Genus database with same CATH topology
 3CUQ B;  5CKT A;  3OYL A;  5D6E A;  1DUX C;  4FET A;  2LBF A;  2ZXW H;  2NVY J;  5E3N A;  1BW5 A;  4AC0 A;  1XGO A;  4BQQ A;  2V6C A;  3CC7 I;  4EJU A;  2VLA A;  1OCR H;  5K5Q A;  2R5Z B;  3S1R J;  2HXO A;  3CUQ C;  1R71 A;  1F5T A;  2XPW A;  3VYU B;  2NRA C;  2RV8 A;  4IL6 C;  3U2R A;  3SQN A;  2VL8 A;  1ETK A;  1TWH J;  1JKO C;  3NAR A;  3WTU C;  4UV9 A;  1SVL A;  3GZ6 A;  4BU2 A;  1WJD A;  4KMF A;  3J7Z I;  2FNP A;  4KFC A;  1MBJ A;  1OQY A;  5FRO A;  2Z9O A;  4WF2 A;  4BQO A;  1XPX A;  1GT0 C;  2IA2 A;  1Y56 A;  1IC8 A;  3QU3 A;  3E6C C;  3IH2 A;  4BY7 J;  1BIA A;  2F6C A;  2WB1 N;  3EET A;  3H3U A;  2HGC A;  2M3A A;  3C2B A;  2RNJ A;  2CQN A;  1TWG J;  2YS9 A;  3I4M J;  3HOX J;  4BQN A;  2Q2E A;  3OYF A;  1FOK A;  3HUG A;  4F3Q A;  1ZG5 A;  4JX6 A;  4DGW B;  4AYB N;  1P2F A;  5CVU A;  4F52 A;  3LA3 A;  1FIP A;  4IOC F;  3AG4 H;  3AG1 H;  1HW2 A;  4U87 A;  2IJL A;  2M7A A;  4HG2 A;  2AO9 A;  4Z2Y A;  1ZN2 A;  3QOE A;  5HOD A;  3TW7 A;  3CP2 A;  3ZGK A;  2NVX J;  2HOA A;  2LK2 A;  3RYP A;  3D1N I;  3SXY A;  3DV8 A;  4A69 C;  3H9J A;  2XPU A;  2QSH X;  5E8G A;  2E71 A;  5J4Y A;  3OSF A;  2E2H J;  5FKK A;  2VE9 A;  4QTR A;  1ACI A;  1RZ4 A;  2HQ5 A;  4XOT A;  2BY1 A;  3HOS A;  3LNQ A;  1FBQ A;  2W57 A;  3HDD A;  1BI3 A;  1ZH5 A;  2GBY A;  3I53 A;  4IVN A;  5EZG A;  2XVC A;  2X6W A;  3FXM A;  5FLM J;  4U0W A;  4ABZ A;  4I76 A;  4UUV A;  4O5V A;  3HGG A;  5IT9 Z;  3GCM A;  4PZJ A;  1BIB A;  4PJM A;  4EQQ A;  3M3Y J;  1RIO H;  3B6C A;  3K69 A;  3DPU A;  3A03 A;  1FC3 A;  1ZTR A;  4LLL A;  3IUO A;  3GTL J;  2MW8 A;  2LY1 A;  2PN6 A;  3KLN A;  2PEX A;  5DM6 F;  2DO7 A;  1V54 H;  2E19 A;  3DBR B;  1JT0 A;  2O7O A;  2BVL A;  3GTP J;  3Q3S A;  1P4W A;  2ZME A;  5JLX A;  5D8K B;  4YIF A;  1MDM A;  2ZXJ A;  1FOX A;  1HDP A;  1NG7 A;  3CO7 C;  4HX7 A;  1R1T A;  2X48 A;  2CYY A;  2GLO A;  5B1B H;  2JA7 J;  3FMR A;  2A6T A;  4XK4 A;  4DZP A;  4DZJ A;  4ZZL A;  2TCT A;  3F72 A;  1ZEL A;  1R5H A;  1S72 I;  2R93 J;  3GTG J;  4PJL A;  2I8D A;  3V7R A;  3CCQ I;  2H1L A;  4A3B J;  5F0H A;  4Y52 J;  4DYQ A;  1WKM A;  3ZMV A;  4G8X A;  2PJP A;  3ZQC A;  3SHF A;  4A5N A;  1KQ0 A;  1KA8 A;  4BUP A;  5JVT A;  1EH8 A;  2E5N A;  3H5A A;  1MZB A;  2GA2 A;  2QA4 I;  4PDK A;  3OYJ A;  3K4K A;  4CYD A;  4EM0 B;  1DGW Y;  1R6R A;  3KET A;  4ASN A;  5DYM A;  5ICG A;  4ZYG A;  3O8H A;  2LRE A;  4QWQ A;  5DUK A;  3BOQ A;  3M07 A;  1B4A A;  5KAI C;  2ESN A;  3CF5 F;  3MN2 A;  4CCM A;  2A68 F;  2E36 A;  2WAQ A;  3ABU A;  2A5W A;  2CJJ A;  4OIR F;  2L01 A;  4IRH A;  2JRT A;  1FTZ A;  1R1U A;  3DPT A;  1G3Y A;  1MJB A;  2PJR B;  3OR2 C;  2DI3 A;  4RGX A;  4FCY A;  2P5L C;  2VAS A;  1HA8 A;  5FLV A;  3FHN A;  2ZSI B;  1U2W A;  4UUS B;  1T6S A;  1CGP A;  1QA6 A;  2PMH A;  3S93 A;  2P6S A;  4XOP A;  1UEL B;  1LUJ B;  1KU2 A;  2IA0 A;  2K9Q A;  3GME A;  5F08 A;  3VOD A;  3HOZ J;  3DEW A;  3H9G A;  3ECH A;  3JSO A;  3VOE A;  2JWT A;  4QSH A;  1LEB A;  1WJA A;  2XIG A;  3ESW B;  1UMQ A;  2H6B A;  3ROU A;  3NAU A;  4QLC U;  1XSX A;  4AIJ A;  5L3B A;  3QYF A;  2L9S A;  2CUJ A;  2P5V A;  3CJN A;  1SVO A;  1TTY A;  3FXK A;  4E7I A;  3BTJ A;  3DWL E;  2CGP A;  4IX7 A;  5IOZ A;  1T56 A;  3HL2 A;  4EJV A;  4WXC A;  4BXU A;  1D3Y A;  4CXF A;  4HAM A;  4GGG A;  1FBS A;  4RA2 A;  4RB3 C;  1ZQ3 P;  1QZY A;  2IGN A;  3Q0V A;  1B72 B;  2ADU A;  2R7S A;  1JTX A;  4LFU A;  1JUP A;  3GTJ J;  1HSJ A;  5DEQ A;  3MKL A;  3LSJ A;  4A2U A;  2V1N A;  1L0O C;  1ZRC A;  2WY7 Q;  2MBF A;  2M45 A;  1X19 A;  3OYD A;  3HSR A;  1R5G A;  2OQR A;  1GDT A;  1P92 A;  1VND A;  1VQ5 I;  5IYB J;  5BQT A;  3M8F A;  5DV5 A;  2HDD A;  2C6Y A;  4RAY A;  3QPH A;  3FK6 A;  1J2X A;  3P9I A;  2EIM H;  1Z9C A;  2LRD A;  9ANT A;  1D8K A;  1WCM J;  3MKY B;  2DFF A;  2LMD A;  3KLO A;  1OCT C;  1Y0N A;  4L9T A;  3IKT A;  2VBX A;  4L5J A;  4P1W A;  4YFX F;  1W5T A;  4D7M A;  2GIZ A;  1FT9 A;  4A0Z A;  2R7W A;  1G3S A;  2M9H A;  3VWB A;  3A01 A;  3HPH A;  3PIP F;  3A4C A;  1J0R A;  2HU9 A;  1ON2 A;  2TDX A;  2XKP A;  3RPU D;  4XLH A;  2V9K A;  2BW3 B;  2DXI A;  5EEH A;  1AKH B;  3H36 A;  1XTA A;  2NYX A;  4G9Y A;  5F0C A;  5J3L A;  3L2Q A;  4XLF A;  3G3Z A;  1LNW A;  4S04 A;  3LFK A;  3QP6 A;  4IHY A;  2CW7 A;  1XD7 A;  5E20 A;  1MH3 A;  1YJW I;  4UVC A;  4XKB A;  3ZN0 A;  2HDC A;  4ANJ A;  2IPQ X;  4I0A A;  1DPR A;  5D6F A;  1ZGJ A;  2VBY A;  3LSG A;  1S5L C;  1Z7L A;  2VOD A;  1QPI A;  2KZG A;  1GXQ A;  3NEU A;  4IJA A;  2QSG X;  3OYE A;  3WTT C;  5BMZ A;  5DCF A;  4CCN A;  3K70 D;  5D5U B;  3F8M A;  4N4O B;  2JSP A;  1FWZ A;  4U0V A;  2L2O A;  1LVK A;  4Y13 A;  1V5E A;  3T8T A;  2A3S A;  4II3 A;  1W7P D;  3MAJ A;  2RVC A;  5HDK A;  2EIL H;  3QWL A;  3OWT A;  4MLO A;  1TBX A;  3S32 A;  4D0P A;  3DEU A;  1YW9 A;  1NK3 P;  4LGW A;  3A0H C;  2L9R A;  3HKZ A;  3IAM 2;  4HLX A;  4XID A;  1FLI A;  4QPQ A;  3L09 A;  2HTS A;  3RYR A;  5EG0 B;  3FKI J;  2FRH A;  1JUS A;  2PFB A;  4ZYE A;  1G59 A;  5CVV A;  4Q47 A;  1HW1 A;  1ZRE A;  3BLY A;  3RDI A;  2VPL A;  3Q0U A;  1BN5 A;  2IGO A;  2EFQ A;  2Q8K A;  1B8I A;  1ZYR F;  5DM7 F;  3OYI A;  2ZNY A;  1J59 A;  4XN3 A;  2BY0 A;  1YRN B;  2FQ4 A;  2DA2 A;  2YSR A;  3LA7 A;  5HNF A;  4KUM A;  3E7L A;  1FP1 D;  1OJL A;  4V19 K;  4V2G A;  5IYC J;  4XKC A;  1QGP A;  2P7V B;  4HSR A;  3TBI A;  4A6D A;  2EV0 A;  3KP2 A;  3WGH A;  5E3O A;  1SMY F;  1S3J A;  4M73 A;  2NVU B;  1IUY A;  2FBH A;  5CJ9 A;  1IJW C;  4AIH A;  2HKO A;  3F22 A;  1K6Y A;  3I5U A;  3DKY A;  3AAF A;  2R3S A;  5KAF C;  5E1X A;  5GTH C;  4UB8 C;  2JA5 J;  3QOD A;  4FT8 A;  2O5R A;  5J47 A;  2L5Q A;  3E5U A;  5ERI A;  1UJ8 A;  3JRB A;  2QF7 A;  4BHP A;  5GAG J;  2G7H A;  2EFO A;  2QWW A;  4RB2 C;  1RUO A;  3CES A;  2AXT C;  1FMV A;  3RCO A;  3V7C A;  1D0Y A;  2Z99 A;  2KIF A;  2FSW A;  2W00 A;  5L3E A;  1R49 A;  4GDF A;  2W24 A;  2XAU A;  1YS7 A;  4C2M J;  1RKW A;  1XSV A;  4I6Z A;  4WWC A;  2F5E A;  2XF5 A;  5JLW A;  2VQH A;  3I58 A;  3L7W A;  2DDA A;  3QPL A;  4JQF A;  2R7U A;  2OUM A;  3W2A A;  2VKD A;  2Y30 A;  4NQW B;  3HBL A;  4H4K C;  1VF9 A;  1FX7 A;  1GVJ A;  1LFB A;  5B5E C;  4BH9 A;  1A36 A;  5K5O A;  2L7M P;  3CCU I;  1AA7 A;  3TL4 X;  3TO9 A;  3PNV A;  1MMG A;  4P5O A;  2VBW A;  4MEX F;  3DP7 A;  1WJ5 A;  3AG3 H;  2H1K A;  1ETW A;  4XRS A;  3OYB A;  5BPD A;  3A0B C;  4ZH4 F;  1FYK A;  1XDU A;  1H88 C;  2Q1Z B;  2QUF A;  2DMP A;  4KT5 C;  3OYH A;  4DJA A;  4PCQ A;  3ZN1 A;  1XMX A;  2E1O A;  2X6X A;  1IN5 A;  1KZH A;  1RUN A;  2X6Y A;  5IP7 J;  4RAZ A;  3S1M J;  3U9G A;  2O8K A;  1MJ9 A;  3BZC A;  4ZDP A;  4IKF A;  3K0L A;  4HOB A;  4EM1 A;  5FGM A;  2BZT A;  4JX4 A;  4X1E A;  2FE3 A;  1UFM A;  1OIS A;  3G1L A;  1U3E M;  2L02 A;  3HEF A;  2MA3 A;  5DDG A;  2HS5 A;  1R00 A;  3JRH A;  2EIJ H;  1I6X A;  1S7A A;  2DA1 A;  3S3O A;  2CG4 A;  4X6A J;  3KYC B;  2CS3 A;  2DJN A;  4AVZ A;  3M1E A;  5C3E J;  2ZNZ A;  5EEG A;  2DA6 A;  4GYG A;  4N4N B;  1FMW A;  1CF7 B;  1SEU A;  2M8E A;  1U5T B;  2F5F A;  4GO1 A;  5FB2 A;  4AIK A;  2JJ7 A;  5CLS A;  3DEE A;  1Z3Y A;  2LOO A;  5E17 F;  4U88 A;  2R5Y A;  2ZB9 A;  3EUA A;  3TP0 A;  3JW4 A;  2DU9 A;  4ESJ A;  4E4H A;  1Z77 A;  4L9V A;  2DTR A;  5LEJ A;  5EEA A;  1U5T C;  4A6E A;  1JI8 A;  3A1Y A;  3A2K A;  3TKY A;  2LDU A;  4ZTF A;  4PK4 A;  2LSO A;  4YIR X;  4BQA A;  2WAE A;  4L18 B;  3F8C A;  4KN4 X;  3U21 A;  5KNL A;  2QQA A;  3JRD A;  1KU7 A;  3ZPL A;  3HHG A;  2IS2 A;  2XRL A;  2MLG A;  1HF0 A;  2G9W A;  2GWR A;  2DDB A;  2LKX A;  1U8B A;  4BNC A;  2KIM A;  2HNH A;  4LK1 F;  2DPU A;  3IP4 B;  5K5R A;  4C2T A;  4P55 A;  1XGS A;  1KYZ A;  1WJF A;  3QPT A;  4BGD A;  1MMS A;  3DTK A;  4D1Q A;  1IO2 A;  3FXO A;  4M9Z A;  1A5J A;  3VYS B;  2DN0 A;  4BDZ A;  1BJZ A;  2E1N A;  2VT3 A;  3ABK H;  3V8J A;  3PQK A;  1YIJ I;  4U7B A;  1BOA A;  4DW6 A;  4GXO A;  3SDG A;  4OIO F;  5HS7 A;  3ZMS A;  3WU2 C;  2ID6 A;  1SAN A;  1ZLJ A;  3TGN A;  2KKO A;  1FYM A;  4CZC A;  1S7O A;  1T33 A;  2DOF A;  2DT6 A;  3F3X A;  3I64 A;  3TO7 A;  4R79 A;  1R4M B;  2K27 A;  4EGY A;  4XR6 A;  3OS2 A;  4WXH A;  3CCM I;  1PUE E;  2OTL I;  1ZG1 A;  1B9N A;  5F64 A;  2ZCW A;  2LD5 A;  2V1D A;  3OL4 A;  4N9H A;  2CWE A;  2H09 A;  3FF5 A;  1VZ0 A;  4G6D A;  4BEH A;  1OR7 A;  4XNF A;  2MH2 A;  2ECC A;  2CFO A;  2KLO A;  3CCJ I;  4M3G A;  3ZQL A;  4ZDO A;  2QM3 A;  4HA8 A;  1HDD C;  2CQX A;  4OIP F;  3OMY A;  2XGE A;  1IW7 F;  1E2X A;  5C44 J;  2VI6 A;  1XGM A;  3Q9S A;  4M71 A;  5HS8 A;  2BGC A;  2D5V A;  1Q1H A;  2F4O B;  3TOA A;  4EAT A;  1H9T A;  4XL9 A;  4RGU A;  1MBH A;  1XG1 A;  2E1M B;  3W3C A;  3HB9 A;  1DGR M;  3VB2 A;  4HF0 A;  1UG2 A;  1S7E A;  1X4O A;  1GV2 A;  3JR9 A;  2P8T A;  3CUQ A;  4L9J A;  3BJO A;  4ENM A;  2V9V A;  3HM5 A;  2GZW A;  4C30 A;  3RKW A;  2QBY B;  1GXP A;  2Y75 A;  1P4X A;  3C18 A;  4DOZ A;  3SZT A;  3ERM A;  4UVA A;  2E1M C;  2XAF A;  1BJA A;  2JPC A;  2Y0S A;  4YII A;  4UHT A;  3WHB A;  3ZR8 X;  2VQC A;  1V5G A;  4OAY A;  2R5Z A;  2ZFW A;  1BR1 A;  4OIN F;  2R92 J;  3GTQ J;  2QQB A;  2HVS A;  4N0B A;  1D5Y A;  5E8I A;  2FMY A;  1EKE A;  3BY6 A;  2MC3 A;  2W48 A;  4W1U A;  3K4J A;  2DOE A;  3JRI A;  2VON A;  4PJN A;  4P96 A;  5A2Q K;  3CCV I;  1JJ6 C;  5EGO B;  4NC8 A;  3OL3 A;  4NBQ A;  5L3F A;  3KEQ A;  3OIO A;  2DFH A;  3RPU A;  4IQJ A;  1O3T A;  2K86 A;  2YX4 A;  2PMZ A;  4LG0 B;  4BS9 A;  1WJB A;  5F27 A;  3WGI A;  3PSI A;  1IXC A;  4ESB A;  3ZXS A;  2VUM J;  3X2Q H;  1AU7 A;  1RR8 C;  1D1A A;  3RPQ A;  2ZXH A;  3ABL H;  4BAC A;  2HTJ A;  5LRR A;  1RI7 A;  5FD5 A;  3W6J B;  5F6F A;  3OYM A;  5GP9 A;  2VQG A;  2CQ7 A;  2BBY A;  4L9N A;  3BZ6 A;  1WJE A;  1HBX G;  3ABT A;  2NOJ B;  3L2C A;  1U9N A;  1MH4 A;  3RKX A;  1Z0X A;  2OC6 A;  2CV0 A;  3F8B A;  1WFX A;  4Y17 A;  2R7D A;  1W5C C;  3KP4 A;  5HOO A;  3K4M A;  4AVP A;  2HZD A;  2X1C A;  2IS4 A;  3ZQG A;  5GAH J;  2AHQ A;  4HX8 A;  2LC2 A;  1SD6 A;  2OBP A;  2XRN A;  5HS9 A;  3K9T A;  3P5J A;  1EA3 A;  1RET A;  4M3E A;  2X1E A;  5ICC A;  5K7H A;  4YEL A;  4KIS A;  3GZ5 A;  1W7P B;  3OV8 A;  2VOO A;  1ZKG A;  1TQP A;  2DOD A;  2OCE A;  3GLL A;  4RGR A;  2RQP A;  3KP7 A;  3HTU A;  4CA0 A;  3ZQH A;  5H20 A;  5M5Y J;  4S05 A;  4W97 A;  2IRF G;  4XKV A;  3K70 C;  2Z33 A;  4XLE A;  1X4P A;  3W2V A;  1T8I A;  4A3C J;  2JUG A;  4UY8 I;  2KDZ A;  1XCV A;  3KEY A;  3IRR A;  2E1C A;  2JRM A;  3MKZ A;  4M3B A;  4MIM A;  1YE9 A;  3MZH A;  3S2W A;  3DKW A;  1R58 A;  3BPV A;  4ENN A;  2ELK A;  3SEQ A;  3L2U A;  4L0Y B;  3LL7 A;  1IN4 A;  2R7X A;  3VSL A;  3KIO A;  4FE7 A;  3WTW C;  3SFZ A;  2MG4 A;  3S8P A;  1MGT A;  1A35 A;  1EF4 A;  2VKV A;  4YRV A;  5H6R A;  1JKQ C;  5D5X B;  2KJC A;  2DFE A;  1NK2 P;  2H6C A;  2FD5 A;  3OIQ A;  1QVU A;  2OV7 A;  3TDU C;  4B48 A;  3ASO H;  1YG2 A;  1E3H A;  3MVP A;  3KYL A;  2BOL A;  3GXO A;  3V8K A;  2NVT J;  4ENK A;  1W36 D;  2VXD A;  2VIX A;  2RNG A;  3HRM A;  1OMI A;  2NS0 A;  3LQQ A;  2HOS A;  5GPA A;  1SD7 A;  2VE8 A;  4PJ0 C;  1T0F C;  3S17 J;  3HOU J;  1UHS A;  3O8G A;  4EMS A;  1MD0 A;  1OPC A;  2CW0 F;  1X2M A;  4A3K J;  3S2D J;  3G73 A;  3LMM A;  3JSP A;  3WTX C;  4CSW A;  3FXU A;  3J80 Z;  1JXS A;  3ZQI A;  5DD4 A;  2O8X A;  3H1C A;  4UV8 A;  2YX7 A;  1F1Z A;  2R7V A;  1X1C A;  4J19 A;  3JRA A;  3H92 A;  5FJ8 J;  1XC5 A;  3JAM K;  3D0S A;  1WWX A;  1VQN I;  2PMU A;  3LA2 A;  3MEX A;  3I56 I;  3JTG A;  2P81 A;  5LGU A;  2FOK A;  3WTS C;  1R9T J;  1PP7 U;  4FAS D;  1U8R A;  2L9V A;  3ZQ7 A;  5IP9 J;  2CMP A;  2DYR H;  2GM4 A;  2HPM A;  5J4V A;  1LKX A;  3FXL A;  3C3W A;  3P9K A;  3T5X A;  2XSD C;  1KQ8 A;  2DYS H;  3VSK A;  2LFB A;  4NDL A;  1C0W A;  2FU4 A;  2R7T A;  1MJA A;  3CLO A;  1J09 A;  1Z6T A;  5A2Q Z;  2L3D A;  2QGU A;  2O3F A;  2B0L A;  4EM2 A;  6PAX A;  4I99 C;  1SFU A;  2PJR A;  5F1J A;  4CHU A;  5GPC A;  4BE2 A;  4B09 A;  3GBG A;  5FO5 A;  2L0K A;  1WI9 A;  3BT9 A;  4UUS A;  1E0E A;  2HFH A;  4I98 B;  2STT A;  3HSF A;  4OIQ F;  4PFP A;  4RLF A;  1YJ9 I;  2O6G E;  1K78 B;  2V4J C;  3HOY J;  4IOA F;  2VJ5 A;  4LD5 A;  3BG6 A;  3O3K A;  4A12 A;  3IHU A;  2BYV E;  2XGD A;  3FBI B;  5J40 A;  1H8A C;  2HYF A;  1SD5 A;  1SAX A;  2ISZ A;  1LE8 B;  3J81 K;  1PJR A;  4G6Q A;  2JT1 A;  3I0T A;  1B1B A;  1X1P A;  1O3S A;  2LP0 A;  2VB6 A;  1HOM A;  1ZGA A;  2HQA A;  3M1C A;  3H9Q A;  3EUH C;  1OCC H;  2EWN A;  5TRD A;  2R7Z J;  1H0M A;  2MLK A;  3BR6 A;  4HZF A;  4CDG A;  4XOR A;  4A3M J;  5ICE A;  4M9X A;  3RIR A;  4M9S A;  4MGR A;  2EFP A;  2MD0 A;  2GOX B;  4HYE A;  4A0X A;  2CSO A;  1B72 A;  2XF7 A;  3ZMU A;  2ZBK A;  2FUG 2;  4E70 A;  2JSC A;  4P9F A;  1J9I A;  4KNY A;  4MQ9 F;  3HYI A;  3CJQ B;  2ESH A;  2WAD A;  1VQM I;  1ONV A;  4EJO A;  2M87 A;  2COM A;  1K4T A;  1HKQ A;  3G4S I;  3E6D A;  1MND A;  4Y7N J;  5IP6 A;  1YO5 C;  3MKW B;  4XON A;  1ZRF A;  5LEK A;  1ETY A;  3OYA A;  1YOV B;  3PSF A;  3H0D A;  2HZT A;  3OIP A;  1H89 C;  1RPW A;  3IKV A;  3WHC A;  4BJ5 C;  2CQQ A;  3OY9 A;  1X3U A;  1Z6R A;  4HPQ A;  2H27 A;  2EA2 A;  1USS A;  1G3T A;  3DTI A;  2YUS A;  1LDJ A;  3PUB A;  3OYC A;  1O4X A;  2DAO A;  1E17 A;  2ID3 A;  1IDY A;  2ZKZ A;  2IGM A;  3G1M A;  3R61 A;  4WXD A;  5D5W B;  4JOM A;  3JRG A;  2EH3 A;  1W5S A;  3M7G A;  3I4P A;  3BG3 A;  1Y0U A;  5HLH A;  4IO9 F;  5LD2 C;  2ZC2 A;  4L5I A;  1REP C;  2BW3 A;  1YHQ I;  1T2K A;  5ILU A;  1AKH A;  4B3A A;  3E6M A;  1F9N A;  5IT3 A;  2M2E A;  3UNG C;  3QOP A;  4IHX A;  2UXN A;  4UUT A;  3BCA A;  4X0G A;  2ETH A;  3R0J A;  1OYW A;  4C3J J;  4AD9 A;  2RGV A;  3A02 A;  4ZC3 A;  2MFZ A;  1ETQ A;  1G4D A;  3GYH X;  3E5X A;  2WBM A;  2BE5 F;  5DCM B;  1P4A A;  1L3L A;  4B4C A;  5D4R A;  2EZI A;  3CDH A;  2CV2 A;  2W7N A;  2DA7 A;  4QIW N;  4RM2 A;  4F7Z A;  1IN8 A;  4XQF A;  4BAY A;  5E3M A;  1S6L A;  4C3H J;  3I71 A;  1VQP I;  2HQR A;  3SDB A;  4D9J A;  1G2H A;  4O6J A;  3OOU A;  1S29 A;  4G94 A;  2HKX A;  3I59 B;  2PLY A;  4QPO A;  1BC7 C;  4E7L A;  3HC7 A;  2FBI A;  1JHH A;  1SFO J;  2R7O A;  2IA1 A;  3LSP A;  2L4A A;  4BXX J;  2H94 A;  2DA3 A;  1STZ A;  2DK5 A;  5LRS A;  3GWZ A;  4HF2 A;  3I9V 2;  2DT7 B;  3BDD A;  2F48 A;  3KP5 A;  2FBK A;  4FE4 A;  5E1W A;  1F36 A;  1UAA A;  3GFM A;  5EG0 A;  2AQE A;  2ZJQ F;  1I1G A;  1EH6 A;  4HST A;  5ILV A;  4PSX A;  1XN7 A;  3E5Q A;  1LFU P;  2F5C A;  2DOA A;  1TWF J;  4MTD A;  4A5M A;  4Q4Z F;  1WI3 A;  2GXB A;  2EJR A;  5DTD A;  3K1M A;  1QZE A;  2MD5 A;  2IBD A;  1RNL A;  2HOE A;  4KIG A;  4LB6 B;  1YRN A;  2DA4 A;  2HEO A;  2A6E F;  1PUF B;  1ZAR A;  3G1O A;  4FIS A;  4A3I J;  3S3M A;  3AL0 B;  3LFU A;  3EYI A;  1R4N B;  2VJ4 A;  2NXN B;  1I39 A;  4V2F A;  3EDP A;  5D5V B;  2YU9 J;  2WAF A;  3K1N A;  1D8J A;  2PG4 A;  3CJT B;  3PNY A;  3R0A A;  2K9M A;  5LGT A;  3OYN A;  2DPD A;  2M4G A;  3AL0 C;  4IPA A;  4Z6Y A;  1WSU A;  2XAQ A;  1G8X A;  5FFX A;  3RQI A;  1TNT A;  5F1R A;  4XRM A;  1WRJ A;  2QZ8 A;  3BQZ A;  2RQQ A;  1MIJ A;  2QCO A;  3BC8 A;  2A69 F;  4LG3 A;  1XCB A;  1H9G A;  4BY1 J;  4BE1 A;  4DQ2 A;  4C3I J;  2WWY A;  2E60 A;  3I3L A;  3FXJ A;  1YLF A;  2IW5 A;  1R23 A;  3VEP A;  2R7F A;  4M6X A;  3ERE D;  4IHS A;  3W6K B;  3RZO J;  1IDZ A;  1TW2 A;  4IXA A;  4ENJ A;  3WTY C;  5L3D A;  1AWC A;  2DCE A;  4OOI A;  4BYY A;  5LHG A;  3HKZ N;  1P9Q C;  2FX0 A;  3PUF A;  4N9I A;  4OMY A;  3FK7 A;  4CYC B;  3KE2 A;  4NQW A;  4PFO A;  3ULQ B;  2I5U A;  1YTY A;  2JN6 A;  3B02 A;  2N8G A;  4BBS J;  1NHA A;  3KZI C;  5FLX K;  1RC9 A;  2LKS A;  1I6H J;  1T95 A;  2HPI A;  1K4S A;  1X2N A;  2YR2 A;  3WG9 A;  5L3G A;  3E6B A;  2O9L A;  4WK8 F;  2K3P A;  5HDN A;  2QQ8 A;  3JRF A;  2BY3 A;  1AHD P;  3JTH A;  3ZMT A;  1ZHF A;  2JK3 A;  2XRO A;  2UUZ A;  4NUB A;  1WQ2 A;  4O3M A;  2M7B A;  1TQM A;  3UR3 C;  3TW6 A;  3SJM A;  5LGN A;  3QRF F;  4HF1 A;  3KP3 A;  3ZOB A;  1HCR A;  2JVH A;  4II2 A;  2QEX I;  3M8E A;  2X4H A;  4F93 B;  1TT0 A;  2B9S A;  2FF4 A;  4Q5S F;  5EZH A;  3CLQ A;  3GTM J;  1FNN A;  3DQV C;  3BZK A;  5FD6 A;  3L9F A;  1I50 J;  4EJW A;  3L2W A;  4JX5 A;  3KZZ A;  4KN7 X;  3FM5 A;  4LB5 A;  3H0G J;  4KMU X;  3G2B A;  4Y15 A;  2X0L A;  2IP2 A;  4MQV A;  4G7H F;  5FKM A;  4MEY F;  1UB9 A;  3RSN A;  3DBH B;  3F9K A;  2X51 A;  4D5F A;  2PBI A;  4XMY A;  2HOT A;  2TRT A;  1D5V A;  1CF7 A;  2DW4 A;  4UXN A;  1U5T A;  2Y0M A;  3ZP5 A;  1OLT A;  1A6I A;  1CQT A;  1MMD A;  2KMU A;  4AWX B;  1VTN C;  5EJC A;  1RRJ A;  1K79 A;  1Y1W J;  4K2E A;  3CMA I;  2JTV A;  3TED A;  2P7C B;  1IRF A;  1HW5 A;  2WY8 Q;  3IL2 A;  2K9L A;  1W36 C;  2FML A;  2NAZ A;  3CCL I;  2M0C A;  2P4W A;  5HVQ C;  3S3N A;  5M3F J;  2ZO4 A;  1NTC A;  5B1A H;  2K9N A;  2K40 A;  5KVR A;  1G6N A;  2VQL A;  2QVO A;  1X1D A;  3SFI A;  3V7S A;  3LWF A;  1VQ7 I;  1YYV A;  4WCG A;  3RKQ A;  2UZK A;  4NB5 A;  3WU1 B;  1M1E B;  4XSX F;  3SZG A;  3FIW A;  4KIC A;  3WE2 A;  2J5P A;  2BV6 A;  2ME6 A;  3HRU A;  3WU0 A;  3OS1 A;  3TO6 A;  3H35 A;  3F21 A;  3N97 A;  2EFW A;  4B1R A;  4MO7 A;  3D5S C;  1ENH A;  1RES A;  3J7A O;  3BCB A;  3BG9 A;  2NNN A;  4CCJ A;  3J7Y J;  5LHI A;  2K5C A;  2OCC H;  2J5O A;  2VBZ A;  1WGX A;  2Y9Z A;  3LAJ A;  4XBF A;  3CCS I;  1DPU A;  1IV6 A;  4RS8 A;  2Z1D A;  1GVD A;  3KPH A;  1FJL A;  4EV0 A;  1FOW A;  1VQK I;  2W4S A;  1ZR2 A;  2OTJ I;  1ERD A;  2CH0 A;  4UVB A;  1ZG3 A;  3NWS A;  5IYD J;  2IXS A;  2OD5 A;  2P6T A;  5TGT A;  1E3P A;  3HSE A;  4L0Z B;  2K02 A;  4EEF G;  4M6Y A;  1V5F A;  2KPM A;  3G6E I;  2HWV A;  5CVR A;  2M8G X;  1U6G A;  3FXR A;  1DP3 A;  2KDO A;  3HZJ A;  3DU6 A;  4LIU A;  3K4B A;  1GV5 A;  4M3F A;  5H2F C;  4RB1 A;  3HOT A;  3CF2 A;  2IEK A;  2Y48 A;  3GFL A;  2JA6 J;  3AKZ A;  3E97 A;  2UWM A;  5J1R A;  3W2W A;  5HDG A;  3LSM A;  3ZMD A;  1YJN I;  3T0Y A;  4FHT A;  2KL4 A;  2GA1 A;  4B3X A;  3AFH A;  3IAS 2;  4E7K A;  4BJT A;  2GIV A;  2W82 A;  1TW3 A;  4BXF A;  2EIK H;  1UHW A;  2QEN A;  5LFA A;  2HVQ A;  4LOC A;  1YIO A;  2K7L A;  2HQN A;  4A3F J;  3C1D A;  1TZL A;  4XIC A;  1UCR A;  1VQ6 I;  2OZU A;  4LLG F;  2BHZ A;  1IG7 A;  3IWZ A;  3BTL A;  1E3O C;  1T38 A;  4JK1 X;  2WB1 A;  1I3Q J;  1T98 A;  4S0H B;  2D45 A;  2D1H A;  2ELJ A;  3BTI A;  3I54 A;  3N05 A;  3EQL F;  2GQQ A;  2QKL B;  5J8C A;  1TWA J;  3MZ8 A;  1QO0 D;  2GOM A;  2QBY A;  3CD6 I;  3LSI A;  3MQ0 A;  2YPR A;  4OU0 A;  4AYB A;  1QRY A;  2DBB A;  2GAU A;  2F2E A;  4NC6 A;  2DMQ A;  4RMN A;  5L3C A;  3B6A A;  1FIA A;  1F43 A;  2JZY A;  3K2A A;  2E2I J;  1Z7U A;  4A0Y A;  3FZV A;  5JHU A;  2X9D A;  5F04 A;  4DYC A;  4HRI A;  2XDV A;  3FDY A;  3VFZ A;  2IVM A;  1POG A;  3FWE A;  2LBF B;  1EV7 A;  1VQO I;  3KFW X;  1YI2 I;  1HST A;  2AS5 F;  2VJJ A;  4HLY A;  4I0B A;  2D2W A;  4HV5 A;  5EGO A;  3D5L A;  1BL0 A;  4RDU A;  1UG0 A;  1KON A;  4Y3O A;  3BTC A;  2G0E A;  3E0J B;  3V4G A;  1LEA A;  1WHU A;  2KZV A;  1X1A A;  4NNJ A;  2PQ8 A;  4LG0 A;  1IRG A;  2HXI A;  3FX3 A;  2XC7 A;  3IV5 A;  4IEJ A;  3F23 A;  1WH7 A;  2JMW A;  3F8F A;  4JYK A;  4RGS A;  2FQ3 A;  3S1Q J;  2XUB A;  2LLK A;  3GX4 X;  4IZZ A;  4KT6 A;  3WOD F;  4EGZ A;  4I09 A;  2ZXI A;  3LSH A;  2M34 A;  3RI4 A;  5GAD J;  1ZGW A;  1BI2 A;  2FA5 A;  1BC8 C;  1B9M A;  4KIF A;  3HHH A;  2DTZ A;  4RLQ A;  1TP4 A;  3T1B A;  3VPR A;  2FJ1 A;  3ZRG A;  1VFC A;  1GHC A;  2GXA A;  1MW7 A;  2Q2E B;  3KZY A;  2VC0 A;  2KJB A;  1I5Z A;  2R0Q C;  3HUG B;  1W7P A;  2KT0 A;  5KHD A;  2K85 A;  5IY5 H;  3FMS A;  2H8R A;  3ML6 A;  3GTK J;  2VOP A;  4ZYH A;  1IUF A;  2Y0S N;  5HLI A;  3ECO A;  4CCL A;  1Z91 A;  2CFX A;  4CCK A;  3R4K A;  1LFP A;  5FKN A;  1J75 A;  4A3E J;  2F4M B;  3S1N J;  3CDI A;  1J7K A;  4YEJ A;  4P9U A;  3BR1 A;  3KYD B;  5D8L B;  1MBE A;  1ON1 A;  2DMN A;  3NQO A;  2P5K A;  5ED4 A;  4IHT A;  1IGN A;  3PO2 J;  5J1Y A;  2KRC A;  1MMN A;  1TQI A;  2MC4 A;  3DCF A;  3H5R A;  3LST A;  4MTE A;  4I02 A;  3R6S A;  2X6O A;  2QYO A;  3DLL F;  1IN7 A;  5C4X J;  3KCC A;  4HDV A;  4MFE A;  4J00 A;  1SAU A;  3Q0W A;  3FXQ A;  2RDP A;  3S14 J;  1JGS A;  2PMZ N;  3IWF A;  1X1B A;  3P9C A;  4GYI A;  2DMT A;  2W85 A;  1T0F A;  4CO8 A;  3COA C;  1K61 A;  2FNA A;  4IF4 A;  2PI0 A;  3DF8 A;  2BY2 A;  1FY7 A;  4JBA A;  4RBO A;  2DJI A;  2NS7 A;  5K7Z A;  1HKT A;  2D1V A;  2LVS A;  3KP6 A;  3QPS A;  2V1U A;  3BR3 A;  5E79 C;  3OYG A;  2OQG A;  3RJP A;  3HOW J;  5IPA A;  1FBU A;  2ZFU A;  1O7L A;  1MNE A;  1X3Z B;  2VKH A;  4HX4 A;  2ZME B;  1N77 A;  2MH9 A;  1MDM B;  2W25 A;  1YX3 A;  5JR3 A;  2XF6 A;  5JVG F;  1A31 A;  1JT6 A;  4Y33 A;  4RB0 A;  1FSE A;  5HLT A;  1DU6 A;  2DMU A;  3ZQF A;  4J01 A;  4B47 A;  2LH9 A;  1OFC X;  2EZK A;  3E1S A;  5LHH A;  5HLG A;  5AIP A;  5BOX A;  1XX5 A;  2ZME C;  2LY9 A;  2O0Y A;  5E18 F;  4LIV A;  2EPF A;  2MSY A;  3CJR B;  3DU5 A;  3CCY A;  5JHF A;  5GAE J;  5J6X A;  3OOP A;  3FMQ A;  1N78 A;  3M4O J;  1MSE C;  4UNO A;  1LQ1 A;  4G12 A;  3TQN A;  2E5Z A;  3K4C A;  2EZH A;  1WJC A;  1DU0 A;  2RAE A;  4IRI A;  2HDW A;  2HVR A;  2GXG A;  4R1H A;  1XGN A;  5DS9 A;  1R22 A;  1SD4 A;  2FOW A;  2KP6 A;  1BW6 A;  1VQ8 I;  5DD8 A;  2XAJ A;  1OKR A;  5B3S H;  3K4N A;  5GTI C;  3ASN H;  3ELK A;  2COB A;  4ZYA A;  1DDN A;  4H0E A;  3CZ6 A;  2LTP A;  1APL C;  4E7J A;  3WG7 H;  4XLA A;  1R7J A;  4B8X A;  2CO5 A;  2Z2S B;  3EUK L;  2R4G A;  4NHJ A;  1ZR4 A;  1FYL A;  1X58 A;  1VQL I;  3OS0 A;  3HRT A;  4KYW A;  1YW8 A;  4C9Y A;  4FX4 A;  2K4J A;  1K78 A;  1ZLK A;  1PYV A;  4HNV A;  4IHV A;  4F92 B;  4ETS A;  1ITY A;  2I10 A;  3BQY A;  1Z21 A;  3EUH A;  4BBR J;  4M72 A;  2WV1 A;  4KIT B;  1I1S A;  2L7F P;  1LDD A;  4I01 A;  3MCZ A;  1LE8 A;  1A04 A;  1MBG A;  2DQR A;  3GF2 A;  1RKT A;  1HKS A;  4KIB A;  3KX2 A;  2OAZ A;  2E7W A;  1LB2 A;  1K7A A;  1V55 H;  3R60 A;  3S16 J;  2KQR A;  1HQC A;  2L7Z A;  2Z3Y A;  4LK0 F;  5CQG A;  2EB7 A;  3PQJ A;  1ZK8 A;  2DA5 A;  2KRF A;  1IXR C;  2XGX A;  3BR0 A;  2RC4 A;  4RAG A;  1WZ2 A;  4MNU A;  2OJE D;  4AM3 A;  1XMA A;  3CMY A;  2M5W A;  4BHC A;  4XLC A;  3RZD J;  1U0J A;  2KFD A;  3TDZ C;  3ONQ A;  1KYW A;  4R8H A;  5M3M J;  4PUS A;  2LKP A;  2IT0 A;  4HQM A;  4XKW A;  5J8F A;  3MWM A;  2KRH A;  4ZYD A;  1ETO A;  1TLH B;  4UB6 C;  4LMY A;  1U9O A;  3K6G A;  4OWR B;  2WAQ N;  2IS6 A;  1LJ9 A;  2CU7 A;  2XB5 A;  2EV5 A;  1BR4 A;  1NG6 A;  2DLL A;  5J1U A;  4BL0 B;  5LBQ A;  2JA8 J;  3HG9 A;  1Y1V J;  4G7O F;  2A61 A;  1Y39 A;  1IZ1 A;  1RR7 A;  2KIQ A;  5AON A;  4YG2 F;  3BR5 A;  2M4K A;  5BS6 A;  2Z5U A;  5M5X J;  2QLZ A;  2XSJ C;  2RN7 A;  1R5I D;  2EIN H;  1I3A A;  3H3Z A;  1MBF A;  3Q9V A;  3J7A Y;  2CUF A;  2ZJ2 A;  1Y8R B;  2BXY A;  3QQA A;  3DFG A;  1XS9 A;  4HV6 A;  3U1D A;  3O6B B;  1IN6 A;  3VDX A;  2L7K A;  2V79 A;  2UXX A;  4HW0 A;  3V42 A;  1UHM A;  1LVA A;  2V7F A;  1FTT A;  3IH4 A;  2EFN A;  3IC7 A;  3RQ4 A;  4E6K G;  3PIO F;  5K1Y A;  4I2O A;  2JA2 A;  4RM3 A;  1Q1V A;  4HQE A;  1TL8 A;  2QKM B;  1ETX A;  1YS6 A;  3HRS A;  3QYB A;  3FHZ A;  1KU9 A;  3K4L A;  4RAF A;  3CME I;  1SC7 A;  2CUZ A;  2MAB A;  2LF7 A;  2RRE A;  2Z16 A;  3A01 B;  3GFI A;  2ACJ A;  2XV4 S;  2CW8 A;  3V8L A;  3L00 A;  3ZQQ A;  2ICW G;  2HYJ A;  5ILS A;  3JAM Z;  1QQI A;  2HR3 A;  2MYS A;  1J5Y A;  3QYE A;  3BP8 A;  3PM1 A;  2EV6 A;  3C7J A;  2XB0 X;  2W1O A;  2XAG A;  1P7J A;  3REO A;  5DCM A;  4F91 B;  1OYY A;  2L4M A;  3EPZ A;  4G6T B;  2DT5 A;  3OYK A;  1IRX A;  2K9S A;  5CVJ A;  1BI0 A;  2LYC A;  1XSD A;  2Y69 H;  5FKO A;  3JCU C;  4L5E A;  1QHG A;  1FEX A;  4D5C A;  1KU3 A;  3PFI A;  1D0Z A;  3BR2 A;  3HGY A;  3ZCO A;  3ISP A;  1MBK A;  1JTY A;  4OMZ A;  4FQG A;  4PGG A;  3I59 A;  4YFK F;  2DQL A;  3NRV A;  2EA4 A;  3CC2 I;  2E2J J;  3GUD A;  4CGZ A;  2X85 A;  1HLV A;  2F5V A;  1KQ9 A;  2A05 A;  4JP0 A;  5EF6 A;  1MMA A;  2MGQ A;  1JUM A;  2YU3 A;  3F6O A;  5K7F A;  1K6O A;  2W84 A;  2V26 A;  4EJT A;  2A07 F;  4KJZ A;  4PGH A;  4F55 A;  1N25 A;  3RKY A;  1TWC J;  1VI0 A;  1ODD A;  4A3J J;  1IRZ A;  1O3Q A;  1Z05 A;  4PJJ A;  3MZY A;  4DYR A;  4XRF A;  4XLN F;  1QNT A;  3J81 Z;  1O57 A;  2EZL A;  3DPL C;  1Z1D A;  3BPX A;  2NVQ J;  1OCZ H;  3D5R C;  1FOY A;  2IGK A;  4M3D A;  1GLN A;  4U0Y A;  4MFD A;  1TNS A;  4LJZ F;  3QAH A;  3F8N A;  1Y6I A;  2JUC A;  3PFY A;  3M9A A;  4E7Z A;  3DLA A;  4DBQ A;  4XLP F;  1QU3 A;  5M5W J;  3TMO A;  1YQA A;  5FKL A;  2X1D A;  1PUF A;  2O03 A;  1BM9 A;  1EJ9 A;  2Q0O A;  4ZZD A;  4ESF A;  1B6A A;  1SFE A;  3K7A J;  1VQ4 I;  4A3G J;  3UKG A;  2E34 A;  1DP7 P;  1FSH A;  2AQF A;  1B8I B;  3QU6 A;  1Y8Q B;  1IF1 A;  1YX5 A;  3G71 I;  1JE8 A;  5FRN A;  1QHH D;  3JRE A;  2IS1 A;  2FEZ A;  5FRM A;  5F0F A;  2AXL A;  4HNU A;  3O2P E;  1D1B A;  2LY2 A;  3MFK A;  4B44 A;  4DNC A;  5JI6 A;  1S9H A;  4M6V A;  1D1C A;  3IRQ A;  1YFH A;  3GO5 A;  1XDS A;  2CQK A;  1MSF C;  2OF7 A;  2K4B A;  2JQ7 A;  2M0M A;  3BRO A;  2BEO A;  1N75 A;  2JVG A;  3PL8 A;  1P7I A;  1YIT I;  3FKJ A;  3BJ6 A;  2NS8 A;  4XRS G;  3CP8 A;  1ORK A;  1SMT A;  1AOY A;  2VXZ A;  1IV8 A;  1W1W E;  2ZSH B;  4CYC A;  1WH5 A;  3CCE I;  1ZRD A;  4ON0 A;  4OAZ A;  1XB4 A;  4BE0 A;  1MKM A;  4D7N A;  1SVM A;  5LLQ A;  3HTS B;  3B73 A;  3DXJ F;  1ETV A;  5E3L A;  1IAW A;  1BOB A;  1OYI A;  3BG5 A;  1QBJ A;  4WX9 A;  5TIS C;  4ITV A;  1JHF A;  4IRG A;  3LAP A;  2HYG D;  3WE3 A;  2XAH A;  3FM3 A;  4G7Z F;  4BKX A;  1HXD A;  3CDL A;  2V1X A;  3LQR A;  1UST A;  4KA4 A;  2M30 A;  3Q5F A;  3GTO J;  3PJR A;  2LNB A;  3CCR I;  3OSG A;  2NNY A;  2ELH A;  4HBL A;  2L54 A;  3KEO A;  1FZP B;  2V9P A;  3CMM A;  1ULY A;  3ZMZ A;  2PX9 A;  2CUE A;  3T8R A;  1QZZ A;  4XM3 A;  4MHG A;  2WV0 A;  4IQ4 A;  5CPR B;  5BPI A;  3ABM H;  2R7R A;  2WA0 A;  2XHK A;  2P0W A;  2VKE A;  2E35 A;  2XAS A;  5FFZ A;  3OR1 C;  4GFB A;  2FXA A;  4C2U A;  2QSF X;  1TC3 C;  3NWT A;  2Y2Z A;  3QP5 A;  2ZJR F;  4GCV A;  2VPR A;  4I7H A;  3HXL A;  3DKX A;  3HOV J;  4AUX A;  1SFK A;  3HIF A;  4LIT A;  5TJJ A;  1Z3X A;  3JRC A;  4CH7 A;  2A5Y B;  2B7E A;  2KIU A;  2IAI A;  4CCO A;  3C2G A;  3K10 A;  2OPT A;  4TV7 A;  2BVM A;  2CRG A;  4U7D A;  3GW2 A;  3LSR A;  4IHW A;  5E1Z B;  2EBI A;  3DTE A;  3TOB A;  4ZDL A;  3LSK A;  1MNM C;  1FP2 A;  4AU7 A;  3CQZ J;  1BBY A;  4Y4R A;  2UV1 A;  1W4M A;  2KIS A;  3FBN B;  2M1B A;  1I27 A;  2STW A;  2VC1 A;  2BHY A;  1O3R A;  1W0T A;  2Y31 A;  2L9N A;  5D4S A;  5EDN A;  1B59 A;  4Q48 A;  1GUU A;  4EVI A;  2JPB A;  2VT2 A;  2VN2 A;  5CYV A;  2ECB A;  3BJA A;  4E7S A;  3K2Z A;  3VYR B;  2R5Y B;  3CUO A;  4CUG A;  3TP3 A;  3GZN B;  2ME0 A;  1O7F A;  2BXZ A;  1VQ9 I;  1BR2 A;  2XPV A;  3PNT A;  4BHB A;  2DFI A;  1BI1 A;  4HEA 2;  5B66 C;  3CTA A;  2ZJP F;  1QPM A;  1T08 B;  1JJ8 C;  1T39 A;  2QQ9 A;  4XN0 A;  4ZTJ A;  1A6Q A;  2DK8 A;  2E7X A;  1F4K A;  3AG2 H;  5BNG A;  3S15 J;  3SYT A;  2A6H F;  3EYY A;  3L2R A;  3GEZ A;  3E3V A;  1V3F A;  2Y9Y A;  1IXS B;  2ISY A;  2K3F A;  2OZ6 A;  5HNH A;  1TT5 B;  3SZP A;  3DBL B;  1JGG A;  3FIS A;  2NOG A;  2F5D A;  1JKP C;  2CV1 A;  1OCO H;  5CVI A;  5ICF A;  1JKR C;  2RKH A;  1XMK A;  3GLX A;  3WGG A;  2EQR A;  5AIQ A;  4YFN F;  1HC8 A;  1K83 J;  3HPG A;  1X3W B;  5EYR A;  1FPQ A;  1U78 A;  4KDP A;  3WTV C;  4BDY A;  4FTH A;  1PP8 F;  3SEZ A;  1R1V A;  2XKO A;  4GRI A;  3RTR A;  2LF8 A;  3LOC A;  3S2H J;  3F0C A;  3F6V A;  5H6Q A;  4AID A;  1DQU A;  4FX0 A;  4CZZ A;  4ZJZ A;  3L2V A;  1V4R A;  4NC7 A;  5KCM A;  1P6R A;  4DBR A;  2OA4 A;  2O61 A;  1QVT A;  3N4M A;  2KHM A;  5DUI A;  1D0X A;  2B63 J;  1Z67 A;  4B43 A;  5IT9 K;  5JFR A;  3P7N A;  5KK1 A;  1SFX A;  3IH3 A;  2VJI A;  1PVE A;  3GFJ A;  5FLX Z;  2LR8 A;  2G7U A;  3C2H A;  4A3L J;  2F4I A;  3CC4 I;  1LPQ A;  1WPK A;  2OU2 A;  3GVA A;  4HNT A;  4M74 A;  4LLN A;  1G3W A;  3U1K A;  4XSZ F;  1BA5 A;  3HJE A;  1WVR A;  4PSW A;  2WTE A;  3PO3 J;  3BG7 A;  4BEH B;  3MD2 A;  1UZC A;  3W6V A;  3H3V K;  2H8W A;  2LG4 A;  4HDU A;  4E7H A;  1OCP A;  3CO6 C;  3VYT B;  1KGS A;  4DIQ A;  1YW7 A;  5C4J J;  2V6E A;  4A3D J;  3BWG A;  4A93 J;  1S8N A;  2HI3 A;  4CIC A;  1OR7 C;  2XGC A;  5CQE A;  1EH7 A;  3WTZ A;  1ZAO A;  2R7Q A;  1R36 A;  3I55 I;  3I4N J;  3K1P A;  1NH3 A;  2EK5 A;  1PDN C;  3M8J A;  3L1P A;  3H5N A;  5IOY A;  3J80 K;  3MMY B;  4BJ6 C;  1LDK B;  1W0U A;  2WC2 A; 
#chains in the Genus database with same CATH homology
 5DS9 A;  3G1L A;  4B4C A;  3HEF A;  2EZI A;  2NVY J;  5E3N A;  1BW5 A;  4AC0 A;  2DA7 A;  4QIW N;  3JRH A;  1BW6 A;  5E3M A;  2DA1 A;  4C3H J;  2R5Z B;  3S1R J;  4X6A J;  2HXO A;  2COB A;  2DJN A;  2XPW A;  1G2H A;  2LTP A;  3OOU A;  1APL C;  5C3E J;  2DA6 A;  1ETK A;  1TWH J;  1JKO C;  3NAR A;  1ZR4 A;  1SFO J;  1X58 A;  3LSP A;  4BXX J;  2JJ7 A;  2DA3 A;  2R5Y A;  2ZB9 A;  3TP0 A;  4HNV A;  1MBJ A;  4IHV A;  4FE4 A;  1ITY A;  1F36 A;  2I10 A;  3BQY A;  4BBR J;  1Z77 A;  2WV1 A;  5EG0 A;  5EEA A;  1GT0 C;  2L7F P;  1IC8 A;  1LE8 A;  1LFU P;  3IH2 A;  4BY7 J;  1MBG A;  1RKT A;  1TWF J;  2WB1 N;  1WI3 A;  3C2B A;  5DTD A;  3S16 J;  1TWG J;  2YS9 A;  2L7Z A;  3JRD A;  3HOX J;  3I4M J;  2IBD A;  1ZK8 A;  2XRL A;  2DA5 A;  3BR0 A;  1HF0 A;  1YRN A;  2DA4 A;  2LKX A;  1U8B A;  3G1O A;  1PUF B;  4FIS A;  4JX6 A;  3CMY A;  4A3I J;  3RZD J;  4AYB N;  1FIP A;  4V2F A;  2AO9 A;  5HOD A;  3TW7 A;  5M3M J;  2YU9 J;  1A5J A;  2NVX J;  2HOA A;  2LK2 A;  3D1N I;  4A69 C;  2XPU A;  1ETO A;  2DN0 A;  1BJZ A;  3OSF A;  2E2H J;  5FKK A;  1U9O A;  4DW6 A;  2WAQ N;  3RQI A;  4QTR A;  4XRM A;  3SDG A;  2HQ5 A;  3BQZ A;  3LNQ A;  2CU7 A;  3HDD A;  2XB5 A;  2GBY A;  2QCO A;  5J1U A;  2ID6 A;  2JA8 J;  5EZG A;  4BY1 J;  1Y1V J;  5FLM J;  1SAN A;  4ABZ A;  4I76 A;  4C3I J;  1RR7 A;  3HGG A;  3BR5 A;  3RZO J;  1IDZ A;  3M3Y J;  5M5X J;  1T33 A;  3B6C A;  3HKZ N;  3A03 A;  1MBF A;  1ZTR A;  2FX0 A;  3GTL J;  2MW8 A;  3FK7 A;  4CYC B;  2CUF A;  3QQA A;  1XS9 A;  2E19 A;  2JN6 A;  2LD5 A;  2N8G A;  4BBS J;  3GTP J;  1JT0 A;  2O7O A;  1FTT A;  3Q3S A;  1I6H J;  3IH4 A;  5JLX A;  2ECC A;  1HDP A;  1X2N A;  1Q1V A;  4M3G A;  3ZQL A;  2X48 A;  2GLO A;  1HDD C;  2O9L A;  2CQX A;  1ETX A;  2JA7 J;  2XGE A;  4DZP A;  4XK4 A;  4DZJ A;  2VI6 A;  5C44 J;  2TCT A;  3JRF A;  3A01 B;  1AHD P;  2D5V A;  2JK3 A;  2R93 J;  3GTG J;  1MBH A;  4A3B J;  1XG1 A;  5F0H A;  4Y52 J;  4DYQ A;  2HYJ A;  3HB9 A;  3ZQC A;  3TW6 A;  3SJM A;  3ZOB A;  1UG2 A;  1HCR A;  1S7E A;  3PM1 A;  1GV2 A;  3JR9 A;  2XB0 X;  1P7J A;  3HM5 A;  5EZH A;  3GTM J;  2K9S A;  1I50 J;  5FKO A;  4JX5 A;  3WHB A;  4L5E A;  3H0G J;  1FEX A;  4D5C A;  2R5Z A;  3BR2 A;  3O8H A;  5FKM A;  2R92 J;  3HGY A;  3GTQ J;  1MBK A;  1JTY A;  1D5Y A;  4D5F A;  2HOT A;  2TRT A;  3MN2 A;  2E2J J;  2W48 A;  4W1U A;  3JRI A;  1A6I A;  1CQT A;  1HLV A;  1JJ6 C;  5EGO B;  4JP0 A;  5EF6 A;  1Y1W J;  2CJJ A;  2MGQ A;  1JUM A;  5K7F A;  3TED A;  3OIO A;  1FTZ A;  4FCY A;  1TWC J;  1VI0 A;  4A3J J;  2M0C A;  1IRZ A;  5F27 A;  5M3F J;  5FLV A;  1NTC A;  2K9N A;  4DYR A;  2K40 A;  4UUS B;  2VUM J;  2EZL A;  3SFI A;  1AU7 A;  2NVQ J;  4M3D A;  3RKQ A;  4MFD A;  5GP9 A;  2K9Q A;  5F08 A;  3HOZ J;  3DEW A;  3FIW A;  5M5W J;  5FKL A;  1PUF A;  2ME6 A;  1U9N A;  2JWT A;  1MH4 A;  4QSH A;  1Z0X A;  1UMQ A;  3K7A J;  4MO7 A;  4B1R A;  3UKG A;  4A3G J;  1ENH A;  3NAU A;  1RES A;  3ZQG A;  1B8I B;  3BG9 A;  2AHQ A;  1W0U A;  3JRE A;  1RET A;  4M3E A;  5K7H A;  1WGX A;  5F0F A;  2Y9Z A;  1ZKG A;  3BTJ A;  1IV6 A;  5IOZ A;  1T56 A;  3ZQH A;  5M5Y J;  4W97 A;  1GVD A;  1FJL A;  4M6V A;  1ZR2 A;  4A3C J;  1ZQ3 P;  1MSF C;  1B72 B;  2OF7 A;  3Q0V A;  2KDZ A;  5IYD J;  1JTX A;  1JUP A;  3GTJ J;  4M3B A;  4MIM A;  1P7I A;  3MKL A;  3LSJ A;  4EEF G;  2NS8 A;  4XRS G;  1ORK A;  2ELK A;  2M8G X;  1GDT A;  1VND A;  4FE7 A;  1WH5 A;  4CYC A;  5IYB J;  4M3F A;  2MG4 A;  1GV5 A;  2HDD A;  1EF4 A;  2IEK A;  2JA6 J;  2VKV A;  4D7N A;  1JKQ C;  3FK6 A;  5J1R A;  1NK2 P;  1ETV A;  5E3L A;  2FD5 A;  3BG5 A;  9ANT A;  1WCM J;  1QVU A;  1OCT C;  3MVP A;  2NVT J;  4BKX A;  3CDL A;  4D7M A;  3GTO J;  4LOC A;  2HOS A;  5GPA A;  4A3F J;  3OSG A;  2M9H A;  3A01 A;  4XIC A;  3S17 J;  3HOU J;  1UHS A;  1IG7 A;  2CUE A;  3O8G A;  3BTL A;  1E3O C;  4A3K J;  1X2M A;  1I3Q J;  3S2D J;  4S0H B;  1AKH B;  5F0C A;  3BTI A;  5J3L A;  2VKE A;  3ZQI A;  1TWA J;  4IHY A;  4GFB A;  4J19 A;  3JRA A;  1TC3 C;  1MH3 A;  2Y2Z A;  1QRY A;  2VPR A;  1XC5 A;  2DMQ A;  3B6A A;  3HOV J;  1FIA A;  4AUX A;  2P81 A;  1F43 A;  3K2A A;  3LSG A;  3JRC A;  2E2I J;  2IAI A;  2X9D A;  5F04 A;  1R9T J;  1QPI A;  4DYC A;  2OPT A;  1POG A;  5IP9 J;  2GM4 A;  2CRG A;  3LSR A;  4IHW A;  1MNM C;  2EBI A;  5EGO A;  2XSD C;  2LFB A;  3CQZ J;  4NDL A;  1BL0 A;  4RDU A;  3BTC A;  4MLO A;  2G0E A;  5F1J A;  5GPC A;  2HXI A;  1NK3 P;  1W0T A;  2Y31 A;  3GBG A;  5EDN A;  4IEJ A;  2L0K A;  1WH7 A;  3BT9 A;  3IV5 A;  2JMW A;  4JYK A;  4UUS A;  1GUU A;  2L9R A;  3S1Q J;  2ECB A;  4XID A;  2R5Y B;  3HOY J;  3TP3 A;  2ME0 A;  2LLK A;  2XPV A;  5EG0 B;  2M34 A;  2XGD A;  3FKI J;  1ZGW A;  1H8A C;  1JUS A;  1LE8 B;  2DTZ A;  3VPR A;  1JJ8 C;  2FJ1 A;  1VFC A;  3Q0U A;  2LP0 A;  1HOM A;  5BNG A;  1B8I A;  3S15 J;  2Y9Y A;  2R7Z J;  1YRN B;  2R0Q C;  1JGG A;  2FQ4 A;  2KT0 A;  3FIS A;  2DA2 A;  2NOG A;  3BR6 A;  1JKP C;  3E7L A;  1OJL A;  2H8R A;  4A3M J;  4V2G A;  3GTK J;  5IYC J;  1JKR C;  1IUF A;  2Y0S N;  2EQR A;  5E3O A;  1B72 A;  1K83 J;  5EYR A;  5FKN A;  4A3E J;  1U78 A;  3S1N J;  1IJW C;  3BR1 A;  4FTH A;  1MBE A;  2DMN A;  3PO2 J;  1IGN A;  5J1Y A;  2JA5 J;  5IP6 A;  3LOC A;  4Y7N J;  3S2H J;  3F0C A;  3DCF A;  3JRB A;  2QF7 A;  1ETY A;  2X6O A;  5C4X J;  1QVT A;  2B63 J;  4MFE A;  3Q0W A;  3S14 J;  2PMZ N;  5FJ8 J;  1H89 C;  1RPW A;  2DMT A;  3WHC A;  3IH3 A;  1K61 A;  2CQQ A;  4C2M J;  2LR8 A;  1RKW A;  4I6Z A;  4RBO A;  5JLW A;  4A3L J;  2YUS A;  3QPL A;  1O4X A;  2NS7 A;  2ID3 A;  5K7Z A;  2Y30 A;  1IDY A;  1WPK A;  1VF9 A;  2LVS A;  3HBL A;  3QPS A;  3BR3 A;  3G1M A;  1LFB A;  3JRG A;  1BA5 A;  3HOW J;  2EH3 A;  5IPA A;  3BG3 A;  2L7M P;  3PO3 J;  2H1K A;  1ETW A;  3W6V A;  1JT6 A;  4XRS A;  3H3V K;  1AKH A;  4B3A A;  1OCP A;  1H88 C;  1DU6 A;  2DMU A;  3ZQF A;  2M2E A;  2DMP A;  1OFC X;  2EZK A;  5C4J J;  4IHX A;  4A3D J;  4UUT A;  4A93 J;  2HI3 A;  2LY9 A;  2E1O A;  2XGC A;  4C3J J;  2MSY A;  3I4N J;  5IP7 J;  3CCY A;  3S1M J;  2O8K A;  3A02 A;  3L1P A;  3M4O J;  1MSE C;  5IOY A;  4G12 A;  1ETQ A;  2EZH A;  4JX4 A;  1DU0 A;  4X1E A;  2RAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...