2DA4A

Solution structure of the homeobox domain of the hypothetical protein, dkfzp686k21156
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
80
Chain Sequence
GSSGSSGALQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVATELNVDCEIVRTWIGNRRRKYRLMGIEVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein DKFZp686K21156
publication title Solution structure of the homeobox domain of the hypothetical protein, DKFZp686K21156
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 20
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2da4A01
3GTQJ 1Q1VA 3ZQGA 3HM5A 2JA6J 2M2EA 2NS7A 1ZR4A 1K61A 1P7IA 2M8GX 3G1OA 3HEFA 4XRSG 5IPAA 1W0UA 4S0HB 1H89C 5M5YJ 1ETQA 5EDNA 4IEJA 5K7HA 2EQRA 2NVTJ 4BBSJ 1RETA 1VNDA 2W48A 3IH3A 1CQTA 2EZKA 1GT0C 2DA6A 3GTOJ 1MSEC 4M3FA 4W1UA 2Y30A 2XPUA 5F04A 2R5ZA 4CYCB 3BTJA 2H8RA 2XB0X 1JJ6C 2HXIA 2DA4A 5EG0B 2CJJA 3HBLA 1HDDC 1UHSA 3G1LA 3O8HA 4BY7J 3Q3SA 1S7EA 3BT9A 2Y2ZA 4IHYA 3OIOA 4AUXA 5IOZA 2ME0A 3BG5A 3HDDA 4BXXJ 3LOCA 1JT6A 2M34A 5C44J 4A3FJ 3RQIA 1Z0XA 1X58A 3WHCA 4LOCA 3ZQIA 3MKLA 2O9LA 2LD5A 3LSJA 5EZHA 4FTHA 1ETYA 1BJZA 4IHVA 1HDPA 2DMPA 3OSFA 1HOMA 4A69C 3W6VA 1WCMJ 4XRMA 1BL0A 1ETXA 2GBYA 1AHDP 2MW8A 3S16J 3BTCA 1MBKA 2TCTA 3BR3A 2I10A 2NVXJ 4D5FA 2RAEA 1XG1A 3D1NI 2Y31A 1ORKA 3IH4A 2GM4A 1EF4A 2DA3A 2ID6A 5M3MJ 5FKOA 1OFCX 3S2HJ 2DA5A 3O8GA 4DZPA 2FX0A 1GVDA 2WB1N 4RBOA 1OJLA 2JMWA 5K7ZA 2EZLA 1WPKA 5J1UA 3HOYJ 1LE8A 2D5VA 5GPAA 1JKPC 1NTCA 2R5YB 1LFUP 5JLXA 4X6AJ 2NVQJ 3BR2A 3G1MA 3IV5A 1TWAJ 5C4JJ 1MBFA 3HOXJ 1UG2A 4FE7A 2DMQA 4A3LJ 2FJ1A 3CMYA 3CQZJ 4M3EA 1I6HJ 5K7FA 1A5JA 1Z77A 2XRLA 4A3MJ 1Y1WJ 1MH4A 1RKWA 2CQXA 4FCYA 1H8AC 3HOUJ 3MVPA 2G0EA 4DW6A 1O4XA 1GV5A 2NVYJ 5E3MA 5GPCA 2JA7J 2E2IJ 2R93J 2CRGA 1TWCJ 5F08A 1AU7A 2XGDA 2L9RA 2WAQN 4ABZA 2VUMJ 5M5XJ 1TWFJ 1B72B 4FISA 2EH3A 2HQ5A 3BR5A 4MFEA 3TW7A 2HDDA 5E3LA 3H0GJ 1TWGJ 2E19A 2DA1A 2ECCA 4JYKA 3M3YJ 2X6OA 3BTLA 2LLKA 3Q0WA 5FKKA 2YS9A 5F0HA 1U9NA 1MBHA 5IYCJ 3ZQLA 2XPWA 2IAIA 4DZJA 4MFDA 3HGYA 4XK4A 5EZGA 4HNVA 4XRSA 1DU6A 5JLWA 2ZB9A 2R7ZJ 4D7NA 2E2HJ 1ETKA 1VI0A 4B4CA 1GV2A 2B63J 4C3JJ 2JN6A 1WH7A 5F0FA 4A3KJ 2K9SA 5E3NA 2R5ZB 5EF6A 2X9DA 2LR8A 4IHWA 4IHXA 5FKMA 1JKQC 1YRNA 2FQ4A 2TRTA 4JX6A 1ITYA 1ETOA 1G2HA 1I3QJ 2DJNA 4QIWN 1K83J 3B6AA 2ECBA 4A3JJ 3K7AJ 1JUMA 3HB9A 4C3IJ 2XGEA 2NS8A 5DTDA 5IOYA 4DYQA 3S1QJ 1X2MA 4C2MJ 4XIDA 3TW6A 3M4OJ 1PUFA 3E7LA 3QPLA 3QPSA 1MSFC 2VPRA 3PO2J 1SFOJ 2OPTA 4MLOA 5C4XJ 5HODA 3OOUA 1ENHA 2QCOA 3DEWA 3L1PA 1RESA 4M6VA 2VI6A 2N8GA 1X2NA 4Y7NJ 5IP9J 4A3GJ 2K9NA 2L7FP 3BTIA 1WGXA 2CU7A 4A3DJ 2P81A 5EYRA 3LNQA 1ZGWA 2R92J 1ETWA 5J1YA 2YU9J 2XSDC 2LVSA 3ZQFA 2HI3A 2PMZN 1T33A 3FK6A 9ANTA 2L0KA 3JRDA 2R0QC 3OSGA 3IH2A 4V2FA 3BR1A 4A3CJ 2Y9YA 3HOZJ 1JGGA 3LSPA 1XC5A 2O8KA 2E2JJ 1ZTRA 1JTYA 4UUTA 3JR9A 1HF0A 1LE8B 4I76A 1FTTA 4J19A 1F36A 2NOGA 1VF9A 1MBEA 5C3EJ 1QVUA 3JRAA 1AKHA 4QTRA 3SDGA 3LSRA 3GTPJ 3I4NJ 1I50J 1P7JA 5GP9A 5M3FJ 2O7OA 1HCRA 3S1MJ 3ZOBA 4AYBN 4UUSA 1NK3P 2DMNA 2YUSA 5F1JA 2KDZA 1IGNA 1QPIA 3MN2A 1DU0A 1TWHJ 1MH3A 2H1KA 1NK2P 4NDLA 1XS9A 3GTGJ 4L5EA 3A01A 2HXOA 4I6ZA 1ZQ3P 3S14J 2EZIA 1HLVA 4B3AA 2CUFA 1MBGA 4A3IJ 1W0TA 1MBJA 3HOWJ 1BA5A 5FJ8J 2XGCA 2K9QA 3I4MJ 1FTZA 2LP0A 5M5WJ 5FLVA 3ZQCA 3RZOJ 3FKIJ 1JKOC 2LKXA 3WHBA 1OCPA 3HOVJ 1BW5A 1B8IB 2LFBA 2KT0A 2MG4A 4V2GA 2DN0A 1QRYA 4A3EJ 1JUSA 1IJWC 1B8IA 3FISA 3TEDA 1YRNB 2MGQA 2JA8J 3GTMJ 1H88C 5EGOA 3GBGA 3ZQHA 1SANA 2AO9A 3BG3A 2Y0SN 3TP0A 2X48A 2L7MP 3JREA 3UKGA 4G12A 4BY1J 2XPVA 4DYRA 2JJ7A 3JRHA 3S2DJ 3JRBA 2FD5A 2XB5A 5J3LA 3K2AA 5E3OA 4M3BA 3F0CA 3FK7A 2AHQA 1IG7A 3S17J 3DCFA 5IYBJ 1POGA 1PUFB 4X1EA 5IP7J 2IEKA 4D7MA 2Y9ZA 3H3VK 2OF7A 1R9TJ 3JRGA 1ZR2A 1ZKGA 1IC8A 1D5YA 2LTPA 3PM1A 2WV1A 2HOSA 2LK2A 1BW6A 4FE4A 4GFBA 2CUEA 3S1RJ 1GUUA 1IDYA 1T56A 2HOTA 1WI3A 2HYJA 4CYCA 1GDTA 2GLOA 3GTKJ 2L7ZA 3C2BA 4JX5A 3NARA 4M3GA 5EG0A 2DMTA 3CCYA 5FKNA 5F27A 4BBRJ 1RPWA 4D5CA 4MIMA 3TP3A 1U9OA 1MNMC 2JA5J 4A93J 2E1OA 3CDLA 1APLC 1RKTA 1IUFA 3JRFA 4DYCA 5DS9A 3HKZN 3BR0A 1FJLA 1AKHB 1JUPA 5EEAA 5IYDJ 2ELKA 3HGGA 5FLMJ 1U78A 1IRZA 4UUSB 4JX4A 1Y1VJ 1A6IA 3JRIA 1ETVA 1JTXA 3LSGA 3RKQA 1IDZA 3BG9A 4QSHA 1FEXA 1TC3C 5J1RA 4BKXA 4XICA 1LFBA 4B1RA 4AC0A 3GTLJ 3BQYA 3NAUA 2LY9A 5F0CA 4RDUA 2HOAA 2ME6A 3S15J 2DTZA 2COBA 2JK3A 3A02A 3FIWA 3A01B 3SJMA 2QF7A 4Y52J 1QVTA 1IV6A 2VKVA 1UMQA 1U8BA 2DA2A 1JKRC 2M0CA 1F43A 5BNGA 3QQAA 3S1NJ 2R5YA 1JT0A 3PO3J 2IBDA 1FIAA 2EZHA 2CQQA 4C3HJ 4M3DA 4W97A 4A3BJ 3BR6A 3JRCA 3SFIA 1OCTC 2K40A 5FKLA 3RZDJ 3A03A 2MSYA 2DA7A 4JP0A 1RR7A 1ZK8A 1VFCA 3BQZA 2EBIA 3Q0UA 5EGOB 3B6CA 2VKEA 1WH5A 1E3OC 5IP6A 3Q0VA 2JWTA 2M9HA 1JJ8C 1FIPA 2DMUA 1B72A 2ID3A 4MO7A 4EEFG 3VPRA 3GTJJ
chains in the Genus database with same CATH superfamily
3L09A 1P9QC 4UXNA 5LGNA 3DLAA 1U5TC 4B09A 3TO9A 1P7IA 3H36A 3KZIC 4PJJA 4IO9F 2KJCA 3CCEI 4MQ9F 4ZZDA 5E8IA 2ZC2A 3TO6A 2P8TA 1ETQA 5M5YJ 3FXUA 2EQRA 5K7HA 4BBSJ 1RETA 2RN7A 3OYEA 4ZJZA 5FD6A 2Y0MA 1XD7A 2VLAA 2KZGA 3CC7I 2DA6A 5A2QZ 4M73A 4GYIA 2PMUA 1KU7A 5F04A 4L0ZB 1SD4A 3K2ZA 2IGNA 2ZFUA 3ZR8X 2F5DA 5DUIA 5EG0B 2COMA 1X19A 3E1SA 1T0FC 3G1LA 3GLLA 4Q47A 3Q3SA 4D1QA 3L7WA 1BR1A 4IHYA 1U5TA 1IN5A 5IOZA 1Y8QB 3BG5A 3HDDA 4BXXJ 1IRGA 3MZ8A 3FHNA 3T1BA 5J47A 3L2UA 3OR1C 4LOCA 3Q9SA 3ZQIA 3KYDB 3HIFA 2Q2EB 1LKXA 2LD5A 3DPLC 3P5JA 2YX7A 3E5UA 1OLTA 1VQ4I 1QPMA 3GO5A 5E18F 4IHVA 3M07A 1T2KA 1WCMJ 4LIVA 2NVUB 2K9LA 1OCCH 3S16J 1FC3A 3BTCA 1JI8A 4NC6A 1MBKA 4UV9A 3HRUA 2NVXJ 4L9VA 1X1AA 1J09A 1T0FA 4FX4A 2EV0A 4B48A 5K5OA 3AL0B 3D1NI 1F9NA 4IL6C 4EJOA 5GTHC 5CKTA 1F5TA 2MA3A 3TOBA 2DDBA 2V6EA 2M0MA 2FUG2 2H8WA 3G6EI 2NRAC 1FPQA 1MW7A 1W5TA 3F21A 4DBQA 1OJLA 2FBIA 1FOYA 2QVOA 3W2WA 5B5EC 5J1UA 4N0BA 4GXOA 1YITI 1LE8A 5GPAA 4IZZA 1TNSA 3ZQQA 2R5YB 2IJLA 3BR2A 2VE9A 3G1MA 3J80Z 5C4JJ 3A2KA 1UG2A 2I5UA 2ACJA 2E1NA 2KHMA 1Z7LA 2VQCA 1SD6A 3CQZJ 2LREA 2XRLA 4A3MJ 1SVOA 2V26A 3IP4B 1U0JA 3MKZA 1LFPA 2MH2A 2QSHX 2OZ6A 4AU7A 2WAQA 3K70D 5FROA 1D3YA 2GWRA 3W3CA 3K69A 2G9WA 1TWCJ 2FRHA 1AU7A 4XLNF 5FO5A 2BZTA 2L9RA 2WAQN 1W5CC 2VUMJ 4RGXA 1B72B 4RB1A 2HQ5A 2GA2A 3BR5A 1QU3A 2E19A 1OPCA 2DA1A 4CXFA 4JYKA 3F8NA 1V4RA 4Y3OA 3BTLA 4B44A 2L9VA 1AOYA 5CJ9A 1P92A 2W1OA 4AVPA 1MBHA 3ZQLA 3P9KA 3J80K 2QM3A 3C3WA 1YO5C 1DU6A 1XSVA 2OA4A 2R7ZJ 2GA1A 2F48A 1ETKA 1VI0A 5D5WB 3LWFA 3I59B 2BVMA 4C3JJ 3K70C 5F0FA 5E3NA 2FMLA 3A4CA 5ILSA 2DYRH 2V1DA 2KRHA 1RNLA 4IHWA 3WTTC 4IHXA 5ICFA 4ZTFA 5FKMA 3P7NA 2DW4A 3CF5F 1ZLKA 2JRMA 1ZG5A 1G2HA 2DJNA 2O61A 2WY7Q 2YU3A 1W5SA 2D1HA 2Z3YA 2F5CA 4A3JJ 1IXSB 2P6SA 3FXOA 5HDKA 1BN5A 1XGNA 4DYQA 4ASNA 3K1PA 1V54H 1ONVA 3KZZA 3BROA 1HSTA 2JA2A 2KIUA 4JQFA 1P4AA 4KICA 5E1WA 5J8FA 3G4SI 1LDKB 3E7LA 3QPLA 5CVIA 1MSFC 4UUVA 2X1EA 3M7GA 5LRSA 3VYRB 4N4OB 5ICGA 2RREA 5HODA 1OR7C 2VJ5A 3GFMA 1HBXG 3RDIA 3X2QH 3V8LA 2A6TA 3RYPA 5L3DA 4G7ZF 5CLSA 4HLXA 3CMEI 2VI6A 5IP9J 4I7HA 3P9CA 4PJ0C 4U7BA 3OY9A 1IXCA 3KE2A 1WGXA 1Z3YA 2X6YA 1PJRA 3H9GA 4XORA 3CMAI 1O3SA 2R7RA 3K1MA 4B3XA 1YG2A 2Z5UA 5KHDA 3H5NA 1T33A 1NG6A 1YJ9I 4OMZA 1H0MA 9ANTA 2L0KA 1R5GA 4DIQA 3TMOA 1TQMA 1OYIA 3IH2A 3U2RA 1T38A 4EVIA 1JGGA 3CO6C 2E2JJ 1QHGA 5LBQA 2W7NA 2A68F 2E1CA 4I76A 3KETA 5TISC 3WTXC 1VF9A 4XLCA 3EQLF 1SMYF 3FWEA 4BNCA 3BZKA 4ANJA 5HLTA 1OR7A 1LUJB 4XMYA 4QTRA 4WWCA 3SDGA 3LSRA 3GTPJ 1BJAA 1TLHB 4BS9A 3NEUA 1K79A 3TGNA 4G7OF 5GP9A 2O7OA 4FX0A 1MIJA 2ZCWA 4M72A 3CCRI 1A6QA 5D8KB 3ZMVA 5F1JA 2KDZA 1IGNA 4CYDA 3MN2A 2BY2A 3EYIA 3ZXSA 3ABUA 3OYCA 2RGVA 1RUOA 2L5QA 2R4GA 3D5LA 1FP2A 3CCSI 2DTRA 3KLNA 3A0BC 1R7JA 1XS9A 4RLQA 3V8JA 3PNTA 1YQAA 2NAZA 2L9SA 4BHCA 3A01A 2QEXI 1LPQA 4UVAA 1YIJI 3CCQI 2HVSA 1ZQ3P 3WG9A 1HLVA 1ZARA 2CUFA 3RJPA 2DOEA 4KA4A 1Z05A 2QSGX 3HTSB 4H0EA 4RS8A 4EGZA 3HOWJ 1MDMA 4BE1A 3E5XA 5TJJA 3BDDA 4FETA 5FLVA 3ZQCA 4IRGA 1WJFA 2GIVA 3SZGA 1T98A 1GHCA 4BUPA 4OIRF 3WTUC 2AQEA 3HOVJ 2LFBA 2HQAA 2KT0A 4A3EJ 4KT6A 3OYKA 4HSRA 3I56I 4ZDPA 3TEDA 3CJRB 3T0YA 3CTAA 4XBFA 2OBPA 3ZMDA 1X1DA 3J7AY 5E79C 4RAYA 3BOQA 4D9JA 1XTAA 2KKOA 2L7MP 4G12A 4EQQA 2Q0OA 2PI0A 2XB5A 1P2FA 1FMWA 4M3BA 2B9SA 3F0CA 2RC4A 1S7AA 1FZPB 2CG4A 1DGWY 1R58A 1N77A 4X1EA 1AA7A 2IEKA 2Y9ZA 3NWSA 3LFKA 2D1VA 1VQ5I 2O0YA 3I55I 4UY8I 5HLIA 3PM1A 2WV1A 1UHMA 4IVNA 1G3TA 1DQUA 2R7UA 4WXDA 1BW6A 1Z1DA 3TDZC 3WU2C 3S1RJ 4Y33A 1ZG3A 3C18A 2HOTA 1WI3A 1GDTA 2GLOA 1RUNA 4OIPF 1I39A 2EIKH 3SQNA 2WAEA 5E1ZB 4M3GA 5DCMB 5EG0A 4MQVA 2XAUA 4OAYA 3AL0C 5KK1A 1RPWA 1GVJA 1XCVA 2ZNYA 1V5GA 3KP4A 2RDPA 3AG1H 3HKZA 4A0XA 4RB0A 1PUEE 4G7HF 1APLC 3KP5A 2LC2A 1WZ2A 3V8KA 1FYKA 4IXAA 4HRIA 4BQQA 3HKZN 5B3SH 1AKHB 2Q2EA 1TQIA 4YFNF 3F8MA 2R7VA 4IF4A 1WVRA 2G7HA 1JUPA 5EEAA 1WJCA 1WRJA 1BI1A 5IYDJ 4CHUA 3FXRA 1E0EA 4AIHA 1GXPA 2IS1A 5FLMJ 2X0LA 4HDVA 2MLGA 2JVGA 1YFHA 3JRIA 4IQ4A 3RKQA 4KUMA 4QSHA 4OU0A 4A2UA 5J1RA 2PN6A 4CCLA 1YTYA 4XN3A 1TT0A 4AC0A 3GTLJ 2BHZA 1TW2A 2V4JC 1S8NA 1XSXA 1YS7A 3DV8A 3GVAA 4RGSA 5F1RA 1A31A 4RAFA 2HOAA 3FMQA 1MNDA 1K6OA 2L02A 2ZSIB 1YOVB 2QF7A 5HOOA 1OCRH 4NB5A 1QVTA 1YW9A 3RKXA 1IV6A 2M3AA 1V55H 1UMQA 2BEOA 3G73A 2M0CA 5LGUA 1REPC 3E5QA 4QPQA 1T6SA 3MZHA 3OS1A 4BACA 2R5YA 4LG3A 2CW7A 1K78B 2CQQA 1IN7A 1BI0A 1JXSA 2NOJB 3E3VA 4A3BJ 4KISA 3SFIA 2M7BA 1IN6A 3RZDJ 3V4GA 2XIGA 2AQFA 3CJQB 3F3XA 2E60A 1ZK8A 2ZXIA 2OCCH 5HLHA 3BQZA 2EBIA 5JHUA 1J9IA 3H92A 2MC3A 1FX7A 4EJVA 5JFRA 2KFDA 4AIKA 4HF2A 5D8LB 3CUQB 2VN2A 4LIUA 2LSOA 1E3OC 5IP6A 1ZGAA 1SMTA 2VJJA 3Q0VA 5B1AH 4XOTA 2F4OB 3BJOA 1B72A 3VFZA 4EEFG 5FRMA 3VPRA 3GTJJ 1GXQA 2OQGA 1Z6RA 1SD5A 3HM5A 3ZMUA 4L9JA 4YELA 5J4YA 2JA6J 3OYDA 3HHHA 1K61A 3QP6A 3KP7A 3HEFA 4E70A 2VOOA 2FMYA 2CFOA 4G94A 1R4NB 2DOAA 5BPDA 2WBMA 4I02A 1LNWA 5BQTA 1VQ8I 4HLYA 1VNDA 5D6EA 2CV0A 3IH3A 2EZKA 5FLXZ 3DKWA 3I59A 1WKMA 2CUJA 1QZYA 3K4BA 5DM6F 2ZXWH 3W6JB 2XAJA 3LA7A 2XPUA 1R00A 2PQ8A 3BTJA 4CYCB 1B6AA 2R7FA 4A5NA 4CZZA 2DA4A 1LDDA 4GGGA 2QKMB 4QWQA 3KCCA 1UHSA 4BY7J 1S7EA 2DAOA 3BT9A 1V5FA 2MBFA 4QLCU 1SEUA 2DU9A 3L9FA 3OIOA 4M6YA 1HKSA 1S5LC 2ME0A 3J7YJ 1WJDA 2UV1A 3LOCA 2HYFA 3FXQA 1A35A 3DQVC 3RQIA 4F3QA 2JUGA 2O9LA 4U0VA 1BC8C 2WTEA 3BZCA 1LQ1A 1IXRC 1ETYA 3GYHX 2DMPA 4I01A 4Y13A 4UNOA 4MEXF 4PJLA 2BHYA 2DBBA 1ETXA 1B1BA 3Q5FA 5BOXA 2BGCA 2VXZA 3S3MA 3WE3A 3KLOA 3WTZA 2RKHA 2I10A 5CQGA 5CQEA 2RAEA 5ERIA 3KYCB 3HOTA 1QQIA 4WXCA 2Y31A 1ORKA 3IH4A 2GM4A 1OFCX 2OAZA 3VYUB 4GRIA 4N9IA 2FX0A 3L00A 1HW2A 4HV6A 2UXXA 1UAAA 2GOXB 2JMWA 3HSEA 4PSXA 3HPHA 2BOLA 3D5RC 2EZLA 2UUZA 2XHKA 3CCVI 1VTNC 1TT5B 4HQMA 3L2CA 2O5RA 1JKPC 1Y0UA 1T39A 2A07F 5DYMA 4GDFA 1LFUP 3OWTA 4X6AJ 1SVMA 1DUXC 2M4GA 4N9HA 1FY7A 2EA2A 3JW4A 3HOXJ 4FE7A 4DQ2A 4CICA 3M8FA 2FJ1A 1ZELA 4ZDLA 4M3EA 2ZBKA 1I6HJ 1JHHA 2Z2SB 3SEQA 3F8FA 1IN4A 3AG4H 2DXIA 3TKYA 4FASD 4FCYA 4NNJA 2L2OA 4HX7A 4CCKA 3MVPA 4DW6A 1O4XA 1UHWA 2NVYJ 3BCBA 2X85A 5ILVA 2HEOA 4IHSA 2E2IJ 3I71A 1T95A 2NYXA 4O6JA 4RGUA 1LVKA 5IY5H 3GCMA 4XLHA 2L4MA 3BJAA 3HTUA 5CVUA 4A6DA 5M5XJ 1PP7U 2KRCA 2VQLA 3ZCOA 2EFPA 4DOZA 4MFEA 2HDDA 3H0GJ 1G8XA 2A6EF 1F4KA 2ECCA 4OMYA 3F8BA 2ICWG 3L2WA 4P9FA 2LLKA 4YFXF 2YS9A 3G71I 5IYCJ 2PEXA 4DZJA 2DPUA 3Q9VA 1MMNA 3PFYA 4I09A 5JLWA 3ZMSA 4E7ZA 4M71A 1BI2A 2Y48A 4D7NA 1F1ZA 2EIMH 3GX4X 2JN6A 1WH7A 3RIRA 2K9SA 4IOCF 2R7SA 2R5ZB 2LYCA 2YSRA 1XDSA 2X9DA 3MCZA 3VYTB 3L2QA 1JKQC 4CCOA 2J5PA 1D8KA 2LDUA 2KZVA 4PZJA 4BYYA 4YIFA 1J0RA 1IF1A 1ETOA 1A36A 4ZYGA 1ITYA 2K9MA 3M8JA 1FT9A 4QIWN 4V19K 1K83J 4EJTA 2XVCA 2FOKA 4E7LA 1PP8F 2PG4A 2L3DA 3HB9A 4C3IJ 2KMUA 3G3ZA 3ASOH 3DEUA 5IOYA 4ENJA 1R1UA 3M1EA 1T8IA 3E6MA 5DDGA 2ESHA 1X2MA 4P1WA 2XV4S 3TO7A 4C2MJ 3M4OJ 3NWTA 2D45A 5HVQC 4MEYF 1SFOJ 1X4PA 4JBAA 1ZGJA 3DBRB 3OYNA 2QCOA 3L1PA 3S93A 4XLAA 2VIXA 5AIPA 5LGTA 4Y7NJ 4A3GJ 5A2QK 2CYYA 1Z6TA 2PMZA 1D0ZA 2K9NA 2L7FP 3DP7A 3FM3A 2CU7A 3NRVA 1TTYA 5LHGA 2XC7A 1LDJA 5EJCA 5EYRA 3LNQA 1HQCA 5GAEJ 1KU3A 5H20A 2DT7B 4WCGA 1ZRDA 5J1YA 5HLGA 3I54A 3ZQFA 2PMZN 5DCMA 3ZMTA 1R49A 2VKHA 4FHTA 5FFZA 3S2WA 1J5YA 4OWRB 1I6XA 4E7SA 3JRDA 2ZJRF 2R0QC 3QRFF 1ACIA 4A3CJ 3OL3A 5B1BH 1RR8C 1MKMA 1USSA 4PUSA 4Y4RA 1S7OA 3GFIA 3QOPA 1JE8A 1FTTA 2DK8A 4LB6B 1Z21A 3BWGA 3JRAA 1AKHA 3RTRA 4A0ZA 3OOPA 1WI9A 3ABKH 2EA4A 1I50J 2FEZA 3MAJA 1USTA 2LF7A 4AYBA 2LRDA 2K3PA 2VODA 1VQNI 4ESJA 5M3FJ 2BYVE 2VL8A 3QU3A 4IHTA 1UZCA 3PIPF 2PJRB 5H6QA 3ZMZA 4AYBN 2LF8A 3K0LA 1MMAA 1RZ4A 4CO8A 2E34A 5IT9Z 1TWHJ 2E35A 1MH3A 1HSJA 2IGMA 1OQYA 1S72I 2H1KA 2QQ9A 3WU1B 4ZC3A 1NK2P 3ECOA 1X1BA 2NNNA 1E3HA 2HDCA 4L5EA 2A61A 3EUKL 2K85A 2K86A 3FM5A 3S14J 3CUQC 4B3AA 4A3IJ 2XF5A 1DP7P 1FBSA 1UJ8A 1FNNA 5M5WJ 3RZOJ 3FKIJ 3WHBA 1K78A 4KIGA 3H3UA 1ZAOA 1XSDA 1OCPA 2HPMA 2A5WA 1W1WE 1TBXA 1YJWI 1B8IB 4HNUA 4XM3A 2X1CA 1JHFA 3I5UA 1R5ID 3SDBA 1X3WB 3FXLA 1JUSA 2K3FA 1XX5A 2FF4A 1BM9A 3EUAA 3FISA 2WWYA 1YRNB 2Y0SA 4YIIA 2QUFA 2EIJH 3DU6A 3R6SA 1VQKI 1YIOA 1SANA 3CUQA 2W84A 4C30A 3OYAA 2Y0SN 4H4KC 2VKDA 1SAUA 4RM3A 2Z1DA 3VDXA 2JJ7A 3HJEA 3JRBA 3WODF 2CV1A 4HBLA 2OCEA 3K2AA 2EK5A 4P9UA 2IRFG 2AHQA 4YFKF 1Y8RB 2BW3B 1POGA 3MFKA 2PFBA 2MD0A 4R79A 1S6LA 2V1NA 3E6CC 4OINF 2BBYA 3JRGA 1VZ0A 2ELHA 1ZR2A 4LB5A 3ROUA 3OL4A 4ENMA 4LMYA 3DU5A 2HOSA 2E1MB 2LK2A 3S3NA 5D4SA 2E7XA 3FMSA 2XF7A 1ZN2A 2HYJA 4CYCA 1FSEA 1KONA 3HYIA 4EM1A 2L7ZA 3C2BA 2DMTA 3K4LA 2CFXA 1BR2A 1S9HA 2PJPA 4I0BA 4KMUX 4MIMA 3TP3A 1MNMC 2JA5J 1KQ0A 2LMDA 2QBYB 1XMXA 2VBYA 3GXOA 2F5VA 3CJNA 3BCAA 2BXYA 3LA3A 3H5RA 4DYCA 1Y56A 1FJLA 2QQBA 3BR0A 3M8EA 1FWZA 3LSIA 3RI4A 1QBJA 5AIQA 2STTA 1VQMI 1R36A 2UWMA 3SZPA 1LEBA 2E5ZA 4RGRA 4ZYDA 3HGGA 3UNGC 1U78A 1IRZA 2XGXA 4M9ZA 2OJED 4UUSB 4JX4A 4PJMA 1ETVA 1IDZA 1V5EA 3BG9A 3PNVA 3VEPA 4XSZF 2HTSA 2HU9A 1TC3C 1FEXA 1LFBA 2MH9A 3K4CA 4B43A 2V1UA 4LLNA 3S15J 2DTZA 3A02A 2Y69H 3DKYA 5J6XA 3LQQA 4HV5A 2ZFWA 2V9VA 4IJAA 2IW5A 3L2RA 1BOBA 3FMRA 3TBIA 3NQOA 2OQRA 4XONA 2JSCA 4CCMA 3R4KA 3ASNH 1JKRC 2W25A 2F2EA 3E6BA 3LL7A 2M7AA 3QYEA 2FXAA 5HS7A 3S1NJ 2I8DA 3T8RA 2IBDA 3A0HC 3GZNB 3LSTA 5BS6A 1KA8A 4XN0A 4C3HJ 2IGOA 3CMMA 4W97A 4BEHB 2HPIA 3BC8A 2ZXJA 3JRCA 2XAHA 1OCTC 3DFGA 3F72A 2K40A 2TDXA 3HRSA 1Z91A 3A03A 2MSYA 4HNTA 2Q1ZB 1XGSA 4PCQA 1G3SA 2DCEA 1FMVA 1QNTA 4L0YB 4RM2A 2OC6A 3Q0UA 4U88A 3E6DA 3SEZA 2VKEA 1WH5A 4ZH4F 1PDNC 4WF2A 2JWTA 4LLLA 2W4SA 3QU6A 1FIPA 2DMUA 4HQEA 3JTGA 3GTQJ 1Q1VA 2XUBA 3GF2A 1YX3A 2QSFX 5FGMA 3AKZA 2NS7A 2HNHA 2M8GX 2IS6A 2EJRA 3G1OA 3VYSB 5D5VB 2A3SA 4U0YA 1TW3A 1ZREA 4HPQA 5L3GA 3IWZA 2O03A 3LSKA 3DXJF 2W48A 2QQ8A 4BXFA 1VQ6I 4AD9A 3GTOJ 2KDOA 3EPZA 4LGWA 4M3FA 4BHPA 3RKYA 2OTJI 2R5ZA 2FNAA 5JI6A 3BG6A 3FXJA 1K4TA 3D5SC 3K4MA 4MHGA 1JJ6C 2HXIA 2CQNA 1B9NA 3OYMA 4K2EA 1H9GA 1NG7A 1O57A 3HBLA 1HDDC 3O8HA 1HKQA 1I27A 4AM3A 1AWCA 2STWA 2VC1A 4L5IA 1XB4A 3WE2A 4ENNA 1K4SA 3ERMA 5LEJA 4AUXA 4C9YA 2JRTA 3EETA 4G6DA 5FB2A 1PYVA 2DK5A 3REOA 3HOSA 1HA8A 1J75A 2HTJA 2M34A 1TZLA 4A3FJ 1O3QA 1Z0XA 3A1YA 3H1CA 2VONA 3RCOA 1X58A 5LHHA 1FBUA 5D5UB 3IL2A 3FKJA 3MKLA 1WJ5A 1C0WA 2VT3A 4NBQA 5GTIC 3LSJA 5EZHA 1HDPA 2OZUA 4WX9A 4MTEA 2EFQA 4U87A 3OSFA 4A69C 3W6VA 2FBHA 1HOMA 1S3JA 4BJ5C 4XRMA 1BL0A 2H94A 1ZLJA 4RLFA 2TCTA 4II3A 2DQLA 2WAFA 4U0WA 3DTEA 4E6KG 4UB6C 2FNPA 4ZYEA 4I2OA 4BJTA 2WB1A 5FKOA 2F6CA 4HOBA 1BI3A 3P9IA 4AWXB 4CSWA 2DA5A 4DZPA 1GVDA 2UXNA 3E97A 2KIMA 4PJNA 4BU2A 2WB1N 5CVRA 2P6TA 3ZPLA 4BE0A 3BLYA 1ZRFA 1WPKA 3F8CA 2K27A 2CQ7A 2JSPA 4BQNA 3ZGKA 1NTCA 2QKLB 5JLXA 2NVQJ 4DNCA 1N78A 2XAGA 4JK1X 1TWAJ 1EH7A 1D1AA 1MBFA 3LSHA 4M74A 1J59A 3JAMZ 2PMHA 4IKFA 2WADA 2DMQA 2XKOA 1ZYRF 2OUMA 1A5JA 4F91B 2IS4A 2CQXA 1RKWA 2L01A 3FX3A 2PJRA 1QA6A 4KN4X 2A05A 4A0YA 4EATA 1GV5A 1B4AA 2L9NA 3K10A 1QGPA 2KRFA 2M8EA 3H0DA 3QAHA 3CC4I 5F08A 2CSOA 2XGDA 4D0PA 3ESWB 4LG0B 1L3LA 4FISA 5AONA 1U6GA 5CVJA 1J7KA 1ZHFA 2M87A 1X3UA 2EH3A 2K7LA 1XMKA 1HC8A 3E0JB 1N25A 2CH0A 1TWGJ 4XSXF 4ITVA 4II2A 3HRTA 3KP3A 5EEGA 2X6OA 3IRRA 4O5VA 4HAMA 5FKKA 4RB2C 2XPWA 2IAIA 3PNYA 4CH7A 3HGYA 4XK4A 4HNVA 4XRSA 2ZB9A 2EILH 4NQWB 3BP8A 4MNUA 3BG7A 4IOAF 2ZKZA 1FOKA 2JPCA 4Q4ZF 4QPOA 3MWMA 2E7WA 4A3KJ 1CF7B 5H2FC 2VBXA 3W2AA 2VPLA 5EF6A 4WK8F 3ULQB 2LR8A 3KFWX 4HEA2 1P6RA 2BXZA 3CP2A 5J40A 1YRNA 3VODA 2FQ4A 1ON2A 3TQNA 2K5CA 1SVLA 3O6BB 2DFEA 3VWBA 1WJAA 1I1GA 3VOEA 3ECHA 3K7AJ 2HVRA 4AVZA 4XRFA 2NS8A 5DTDA 3S1QJ 3IC7A 3LA2A 1XN7A 4HZFA 1SD7A 2HDWA 2BW3A 3SZTA 1VQPI 2XASA 2F4IA 2VPRA 3MQ0A 3N97A 4YIRX 3PO2J 3IHUA 2DYSH 2OPTA 1EH8A 5C4XJ 5LEKA 1ENHA 3DEWA 4KIFA 4MTDA 2KL4A 2GXBA 2HKXA 5FLXK 2JT1A 5E8GA 4YG2F 5ED4A 3GFLA 2HKOA 2P7VB 4A3DJ 3ZQ7A 1IAWA 4HX8A 5J4VA 1ZGWA 2R92J 3H3ZA 1MMDA 4RA2A 3RPQA 1SAXA 2YU9J 1M1EB 2XSDC 1R1VA 1UCRA 2ZO4A 3FK6A 3J81Z 2PBIA 1QZZA 1SC7A 3OSGA 2OU2A 3BR1A 3DBLB 3LSPA 4EGYA 2LBFB 2BV6A 4ZTJA 2QBYA 3F22A 2P5VA 1JTYA 4LK0F 4UUTA 4BH9A 2R7TA 3JR9A 1HF0A 4J19A 1F36A 2LKPA 4YRVA 2IP2A 4E7JA 1SFKA 3CDIA 4A6EA 3CLQA 2ISYA 1FYMA 2L7KA 3I4NJ 5D4RA 3BJ6A 5L3EA 4M9SA 3C2GA 1NHAA 2HZDA 2HZTA 4HA8A 1HCRA 3S1MJ 5K1YA 3ZOBA 2K4JA 4UUSA 2DMNA 1FOWA 2FSWA 3EYYA 3H9JA 2ISZA 1ODDA 1QPIA 5CYVA 2V9KA 1G3WA 3CO7C 3WTSC 1X1CA 3O2PE 2AS5F 4NDLA 3OS2A 3QYBA 3GTGJ 3MKYB 5HDGA 3BPXA 4HF0A 1DPRA 1S29A 2HXOA 2O8XA 1FYLA 1CGPA 2NXNB 3R60A 3HZJA 4I6ZA 4DBRA 5L3FA 1MBGA 4KYWA 3PQKA 1W0TA 4KIBA 1MBJA 4CA0A 2CMPA 1BOAA 1BA5A 5FJ8J 3I4MJ 5ILUA 1UG0A 1FTZA 4J00A 1JKOC 1UFMA 1YW7A 2FU4A 3KZYA 2VC0A 4ZDOA 5DCFA 1YHQI 4KDPA 4BEHA 1BW5A 1RRJA 3CCLI 4BQAA 3K4KA 4CCNA 1QRYA 4ZZLA 3T5XA 3DPTA 3RSNA 1WQ2A 2DJIA 1BIBA 1IJWC 2H6BA 2MFZA 3IAM2 4LD5A 2ZXHA 2HWVA 3H9QA 2JA8J 2L4AA 3TL4X 3U21A 4ETSA 1H88C 2RQQA 3GBGA 3ZQHA 2DI3A 3W6KB 4FQGA 1MJAA 1WHUA 3I53A 2B7EA 2X51A 1SFUA 2X48A 3JREA 3OIQA 3ABMH 1FOXA 3H35A 4DYRA 3IRQA 4NHJA 2FD5A 5E3OA 5J3LA 4TV7A 4OOIA 3RYRA 3VSKA 2GIZA 1ULYA 1X1PA 1MNEA 3DCFA 2ZJ2A 3KP6A 5IYBJ 1PUFB 5IP7J 2P5LC 3VB2A 4D7MA 2OF7A 3QODA 3FXKA 4L5JA 5EEHA 1ZKGA 2DFHA 4BQOA 1MJBA 4XKVA 2JTVA 1Z3XA 1IC8A 1D5YA 2ETHA 4R1HA 2MD5A 2CQKA 2LTPA 2VQGA 4PGGA 4NC7A 2VBZA 2Q8KA 3K4NA 3ZN1A 2Z33A 1O3TA 2QGUA 3EUHC 5DEQA 2HQNA 1L0OC 2QZ8A 3DTIA 1IDYA 1T56A 2XAFA 4XNFA 1I5ZA 5D5XB 3JCUC 3ONQA 4P5OA 4A5MA 3AAFA 4RAZA 5E20A 2BY1A 1MGTA 1W7PB 5B66C 3KP2A 2LY1A 4PFPA 1VQ9I 2XSJC 4F7ZA 1R22A 5F27A 4BBRJ 2HQRA 2CWEA 1WWXA 1Q1HA 4KJZA 3PSFA 2E1OA 3OYLA 3I9V2 3B73A 5FRNA 2JUCA 2WA0A 1HXDA 1MMSA 1KQ9A 1KYZA 3V7RA 3F23A 4P55A 2VOPA 2V1XA 3RKWA 1U2WA 4C2TA 1TQPA 3EUHA 3VSLA 1UB9A 1SFXA 2MLKA 3K6GA 2ZMEB 4KN7X 3W2VA 3KX2A 2PLYA 2IXSA 2KQRA 3FDYA 3HL2A 4CCJA 3OV8A 1Y1VJ 1A6IA 5HS9A 4ON0A 4IQJA 4XICA 2V79A 2HGCA 4LLGF 2ZJQF 3DKXA 4PDKA 2ZSHB 5F0CA 3NAUA 2AXLA 1YE9A 4FT8A 5HS8A 4I98B 2GOMA 4Y17A 4RDUA 2COBA 2DODA 2JK3A 3FIWA 3V42A 5JVGF 4L9TA 1IRXA 2K02A 3U1KA 2X4HA 1YI2I 3I58A 1VQLI 4BJ6C 1OCOH 3HPGA 2DFIA 2VKVA 1V3FA 2W57A 5L3BA 2ADUA 2IGKA 3ABLH 3OYHA 1U8BA 1F43A 3WGHA 1Y6IA 5BNGA 3QQAA 1LEAA 3G2BA 4XKBA 1DPUA 3ZRGA 4LFUA 4AIDA 1FIAA 1IW7F 4OIOF 4PK4A 3WG7H 3DWLE 2ELJA 4M3DA 2ESNA 1OISA 3J7AO 1XGOA 2FQ3A 4NC8A 5FKLA 1Z67A 2YX4A 4IRIA 5BMZA 4F55A 4G6QA 2VASA 2DA7A 3LFUA 1RR7A 2FE3A 4JP0A 1VFCA 3EDPA 4BDZA 4G6TB 5IT9K 2DOFA 5FFXA 3OR2C 3CJTB 1E17A 2AXTC 3DLLF 5EGOB 4G8XA 5ICCA 3CZ6A 4XKCA 4UVCA 4LG0A 3CCJI 2M9HA 4HDUA 4Z6YA 4E7IA 3R61A 4MO7A 1WSUA 4M9XA 4HF1A 3OYJA 2G7UA 1Y39A 4CZCA 3ZQGA 1BR4A 4Q5SF 2CUZA 2NS0A 3QYFA 3R0AA 3FF5A 2M2EA 2R7OA 3ML6A 1ZR4A 5L3CA 4UHTA 5D6FA 1Y0NA 5LD2C 3PIOF 4XRSG 2FOWA 3R0JA 5IPAA 5LFAA 4S0HB 1W0UA 1H89C 2F5FA 3HSFA 5HDNA 3C1DA 2KP6A 1IUYA 4BE2A 5EDNA 4IEJA 2M30A 4NQWA 2NVTJ 4GCVA 1QO0D 3BZ6A 2R7WA 1CQTA 3LAJA 1GT0C 1YX5A 3LSMA 4PSWA 2LOOA 1YLFA 1MSEC 1RI7A 2Y30A 4W1UA 1CF7A 2FA5A 2VQHA 2H8RA 1LJ9A 4HSTA 2WY8Q 2XRNA 3SHFA 2XB0X 4N4NB 3RPUD 2CJJA 2XF6A 1G59A 1DDNA 3CLOA 4EMSA 3DBHB 2R7XA 2Y2ZA 2KISA 2DFFA 3CUOA 3ZN0A 1ERDA 3WU0A 1X4OA 2XDVA 4YEJA 5C44J 1JT6A 2F5EA 1FP1D 1D5VA 4ZYAA 3WHCA 1KQ8A 3GWZA 4BAYA 2W24A 1FSHA 3FZVA 2V7FA 1TNTA 4CDGA 4RMNA 4FTHA 1BJZA 2H09A 5ICEA 2KPMA 2IPQX 2GBYA 1O7FA 1AHDP 3SYTA 1D0XA 1OMIA 1E2XA 2MW8A 5DD4A 3HUGB 3BR3A 2HVQA 1D0YA 2QYOA 4X0GA 4D5FA 2LY2A 3ISPA 1XG1A 1X3ZB 2WC2A 4Q48A 1R71A 1EF4A 3QP5A 2DA3A 2ID6A 1OKRA 5M3MJ 4KMFA 3L2VA 3S2HJ 1D8JA 2LG4A 4RB3C 2A5YB 3O8GA 2P0WA 4MGRA 3OYGA 3S3OA 2VB6A 1G4DA 3HRMA 2H27A 3JTHA 1Z7UA 2QENA 4RBOA 5K7ZA 2LBFA 1R5HA 3PQJA 4DGWB 4XQFA 4ESBA 2JPBA 3AG3H 3HOYJ 2E5NA 2D5VA 1ZG1A 4S04A 1YJNI 1I1SA 2E71A 4IPAA 2MYSA 3WGIA 3DTKA 3IV5A 1IO2A 2WV0A 2QA4I 5LRRA 2W00A 3MZYA 3OYFA 3RPUA 4A3LJ 3CMYA 2VXDA 5K7FA 1XGMA 1Z77A 2EB7A 1GLNA 1MH4A 2V9PA 1Y1WJ 3CD6I 1H8AC 2B0LA 3HOUJ 1EH6A 2G0EA 4BDYA 1A04A 5E3MA 2R3SA 4EJUA 4ESFA 5GPCA 1R23A 2JA7J 4XLPF 2R93J 2CRGA 2Z9OA 4BGDA 5KAFC 4ABZA 2M1BA 3KIOA 4L18B 2LKSA 1TWFJ 2E36A 2IVMA 2DDAA 2HR3A 4PGHA 3HXLA 4LK1F 2RVCA 3TW7A 5E3LA 2M4KA 1W36D 2RNJA 2JVHA 2IS2A 1B59A 3M3YJ 1RC9A 3IWFA 1EA3A 5BPIA 3Q0WA 1W7PD 3AFHA 2O6GE 5F0HA 1U9NA 2VJ4A 1R4MB 4MFDA 2DLLA 4HG2A 5EZGA 2DQRA 2O3FA 3KEOA 4XOPA 2J5OA 4KITB 5JHFA 1K7AA 3BPVA 4XLFA 2E2HJ 1XDUA 2EWNA 4NUBA 4B4CA 1GV2A 3TDUC 2B63J 1BBYA 5JR3A 2LH9A 4UVBA 3FXMA 2HFHA 2BVLA 2CV2A 3WGGA 2L54A 5DD8A 5LLQA 2EFOA 4J01A 3K9TA 4IRHA 3U1DA 3MMYB 1Z9CA 1STZA 3COAC 2LNBA 3N05A 2QWWA 3KEYA 1IRFA 2TRTA 4JX6A 3CCUI 4RAGA 2W82A 1HW1A 1I3QJ 3I64A 2ZJPF 1W36C 3MEXA 3B6AA 2RQPA 3CESA 1U5TB 2ECBA 3O3KA 1JUMA 1UELB 4P96A 1WJBA 2XGEA 4I0AA 4L9NA 5DM7F 3GZ5A 4LJZF 4EM0B 4G9YA 2F4MB 3T8TA 4XIDA 3TW6A 4F52A 3GW2A 5F64A 1JGSA 2HS5A 1PUFA 3QPSA 3PUBA 2BY0A 3TOAA 1PVEA 1P4WA 4MLOA 1K6YA 1O7LA 4AIJA 2CW8A 3KYLA 3OOUA 3CC2I 4HYEA 5F6FA 4JOMA 4GYGA 3OYBA 1RESA 4M6VA 2EPFA 2K4BA 2N8GA 1X2NA 5IT3A 3KPHA 1J2XA 3BTIA 2ZMEC 2GQQA 1D1BA 3M9AA 2P81A 3D0SA 3GFJA 3RQ4A 1EKEA 1ETWA 2A6HF 2P5KA 2LVSA 4CGZA 1KYWA 2HI3A 1U8RA 1W7PA 2EFWA 2IT0A 3GUDA 3QPHA 4R8HA 5J8CA 4V2FA 4UV8A 2Y9YA 3HOZJ 2RV8A 1XC5A 2O8KA 2FBKA 3MKWB 5DV5A 1ZTRA 1LE8B 2HYGD 5GADJ 5KNLA 2XKPA 2NOGA 2CS3A 2VJIA 2YPRA 4I99C 1MBEA 3U9GA 5C3EJ 1QVUA 5KAIC 4KFCA 1QZEA 3WTWC 2M45A 3PUFA 1RIOH 2IA1A 4EV0A 3S32A 1P7JA 1XCBA 3K1NA 2ZMEA 2IA0A 5GAHJ 1LVAA 3LQRA 1NK3P 1EJ9A 2YUSA 5KCMA 3CF2A 3V7CA 4OAZA 1DU0A 4C2UA 3QOEA 4ENKA 2W85A 1XMAA 2RNGA 4IX7A 4Z2YA 3WTVC 2DPDA 1U3EM 2P4WA 3IUOA 4HW0A 2GXGA 4B8XA 4OIQF 2EINH 2EZIA 3J7ZI 1T08B 1KGSA 1NH3A 1BC7C 5TRDA 2GAUA 1R6RA 4BXUA 3CCMI 1FBQA 2XGCA 2K9QA 2LP0A 2VBWA 2LKXA 3K4JA 1IV8A 2NNYA 3IKVA 5CPRB 4XR6A 3JAMK 3IKTA 1IN8A 1OYWA 3F6VA 2MG4A 2CGPA 1MD0A 4V2GA 2DN0A 5DUKA 3GZ6A 2VT2A 1KU2A 3LAPA 3I4PA 2PX9A 3CDHA 1B8IA 1YYVA 4E4HA 2MGQA 2JQ7A 3GTMJ 2QQAA 3DPUA 2KLOA 5EGOA 3HHGA 1QHHD 5TGTA 1XPXA 5FD5A 3BG3A 1MZBA 1WJEA 2AO9A 2E1MC 3HC7A 2C6YA 3TP0A 1SFEA 2JZYA 2A69F 3H5AA 3UKGA 2MABA 4BY1J 2XPVA 4B47A 3JRHA 3S2DJ 3ZP5A 5JVTA 2UZKA 2ZNZA 3FK7A 3OS0A 5HNFA 1IG7A 3BY6A 3C2HA 2VE8A 1KU9A 3V7SA 4KNYA 1W4MA 3S17J 3M1CA 4BL0B 4XLEA 3H3VK 1R9TJ 2OTLI 5GAGJ 4S05A 2XAQA 3GLXA 4E7KA 4F92B 2HOEA 4ZYHA 2QLZA 3ABTA 4CUGA 4FE4A 4GFBA 2CUEA 1GUUA 3GEZA 4UB8C 2EV5A 3GTKJ 4JX5A 2X1DA 3NARA 1DGRM 5E1XA 3F9KA 1B9MA 3CCYA 3ELKA 5FKNA 2YR2A 5KVRA 4KT5C 3PJRA 1YS6A 4D5CA 1U9OA 1D1CA 2V6CA 1DP3A 4A93J 2XROA 2D2WA 2DO7A 3I0TA 3OYIA 3CDLA 1MJ9A 3OIPA 1RKTA 1IUFA 2DT6A 3DF8A 4EM2A 2M5WA 3JRFA 3OMYA 5H6RA 1VQOI 6PAXA 1H9TA 5DS9A 1G3YA 2H6CA 2EV6A 2GXAA 1YW8A 3I3LA 5CVVA 3JSPA 1P4XA 1G6NA 2ELKA 2X6WA 3KEQA 4PFOA 3LSGA 1JTXA 2KIQA 3JSOA 1I3AA 1E3PA 1KZHA 3QWLA 3HUGA 4BKXA 2P7CB 4Y15A 1HKTA 1IZ1A 3IAS2 4LITA 4B1RA 4DJAA 1O3RA 2DT5A 1N75A 3PSIA 3HSRA 1EV7A 3BQYA 3LMMA 2LY9A 2ME6A 3C7JA 3QPTA 4XKWA 3MD2A 3SFZA 4XL9A 2X6XA 4EJWA 2EFNA 3J81K 3A01B 4M6XA 3SJMA 1WFXA 2GZWA 5K5RA 2Z99A 3FBIB 4Y52J 3FHZA 1LB2A 1OCZH 2BE5F 1ZH5A 3PL8A 3N4MA 4F93B 2DA2A 2KIFA 1MDMB 2KJBA 2OD5A 3AG2H 1FLIA 2CO5A 4O3MA 1JT0A 3PO3J 2BY3A 4BHBA 2R7DA 2EZHA 4U7DA 4E7HA 1ON1A 4WXHA 1VQ7I 3GMEA 3BR6A 5E17F 3UR3C 1ZRCA 2Z16A 3ERED 5LHIA 1TP4A 1TL8A 4GO1A 1HW5A 2R7QA 2CW0F 3F6OA 5HNHA 2IA2A 1OYYA 1MMGA 3B02A 3WTYC 1BIAA 4A12A 2MC4A 1R1TA 2Y75A 3B6CA 5K5QA 3SXYA 3CP8A 2H1LA 3PFIA 3FBNB 3DEEA 1JJ8C 4HX4A 2ID3A 3S8PA 3HG9A 2OV7A
chains in the Genus database with same CATH topology
3GTQJ 1Q1VA 3ZQGA 3HM5A 2JA6J 2M2EA 2NS7A 1ZR4A 1K61A 1P7IA 2M8GX 3G1OA 3HEFA 4XRSG 5IPAA 1W0UA 4S0HB 1H89C 5M5YJ 1ETQA 5EDNA 4IEJA 5K7HA 2EQRA 2NVTJ 4BBSJ 1RETA 1VNDA 2W48A 3IH3A 1CQTA 2EZKA 1GT0C 2DA6A 3GTOJ 1MSEC 4M3FA 4W1UA 2Y30A 2XPUA 5F04A 2R5ZA 4CYCB 3BTJA 2H8RA 2XB0X 1JJ6C 2HXIA 2DA4A 5EG0B 2CJJA 3HBLA 1HDDC 1UHSA 3G1LA 3O8HA 4BY7J 3Q3SA 1S7EA 3BT9A 2Y2ZA 4IHYA 3OIOA 4AUXA 5IOZA 2ME0A 3BG5A 3HDDA 4BXXJ 3LOCA 1JT6A 2M34A 5C44J 4A3FJ 3RQIA 1Z0XA 1X58A 3WHCA 4LOCA 3ZQIA 3MKLA 2O9LA 2LD5A 3LSJA 5EZHA 4FTHA 1ETYA 1BJZA 4IHVA 1HDPA 2DMPA 3OSFA 1HOMA 4A69C 3W6VA 1WCMJ 4XRMA 1BL0A 1ETXA 2GBYA 1AHDP 2MW8A 3S16J 3BTCA 1MBKA 2TCTA 3BR3A 2I10A 2NVXJ 4D5FA 2RAEA 1XG1A 3D1NI 2Y31A 1ORKA 3IH4A 2GM4A 1EF4A 2DA3A 2ID6A 5M3MJ 5FKOA 1OFCX 3S2HJ 2DA5A 3O8GA 4DZPA 2FX0A 1GVDA 2WB1N 4RBOA 1OJLA 2JMWA 5K7ZA 2EZLA 1WPKA 5J1UA 3HOYJ 1LE8A 2D5VA 5GPAA 1JKPC 1NTCA 2R5YB 1LFUP 5JLXA 4X6AJ 2NVQJ 3BR2A 3G1MA 3IV5A 1TWAJ 5C4JJ 1MBFA 3HOXJ 1UG2A 4FE7A 2DMQA 4A3LJ 2FJ1A 3CMYA 3CQZJ 4M3EA 1I6HJ 5K7FA 1A5JA 1Z77A 2XRLA 4A3MJ 1Y1WJ 1MH4A 1RKWA 2CQXA 4FCYA 1H8AC 3HOUJ 3MVPA 2G0EA 4DW6A 1O4XA 1GV5A 2NVYJ 5E3MA 5GPCA 2JA7J 2E2IJ 2R93J 2CRGA 1TWCJ 5F08A 1AU7A 2XGDA 2L9RA 2WAQN 4ABZA 2VUMJ 5M5XJ 1TWFJ 1B72B 4FISA 2EH3A 2HQ5A 3BR5A 4MFEA 3TW7A 2HDDA 5E3LA 3H0GJ 1TWGJ 2E19A 2DA1A 2ECCA 4JYKA 3M3YJ 2X6OA 3BTLA 2LLKA 3Q0WA 5FKKA 2YS9A 5F0HA 1U9NA 1MBHA 5IYCJ 3ZQLA 2XPWA 2IAIA 4DZJA 4MFDA 3HGYA 4XK4A 5EZGA 4HNVA 4XRSA 1DU6A 5JLWA 2ZB9A 2R7ZJ 4D7NA 2E2HJ 1ETKA 1VI0A 4B4CA 1GV2A 2B63J 4C3JJ 2JN6A 1WH7A 5F0FA 4A3KJ 2K9SA 5E3NA 2R5ZB 5EF6A 2X9DA 2LR8A 4IHWA 4IHXA 5FKMA 1JKQC 1YRNA 2FQ4A 2TRTA 4JX6A 1ITYA 1ETOA 1G2HA 1I3QJ 2DJNA 4QIWN 1K83J 3B6AA 2ECBA 4A3JJ 3K7AJ 1JUMA 3HB9A 4C3IJ 2XGEA 2NS8A 5DTDA 5IOYA 4DYQA 3S1QJ 1X2MA 4C2MJ 4XIDA 3TW6A 3M4OJ 1PUFA 3E7LA 3QPLA 3QPSA 1MSFC 2VPRA 3PO2J 1SFOJ 2OPTA 4MLOA 5C4XJ 5HODA 3OOUA 1ENHA 2QCOA 3DEWA 3L1PA 1RESA 4M6VA 2VI6A 2N8GA 1X2NA 4Y7NJ 5IP9J 4A3GJ 2K9NA 2L7FP 3BTIA 1WGXA 2CU7A 4A3DJ 2P81A 5EYRA 3LNQA 1ZGWA 2R92J 1ETWA 5J1YA 2YU9J 2XSDC 2LVSA 3ZQFA 2HI3A 2PMZN 1T33A 3FK6A 9ANTA 2L0KA 3JRDA 2R0QC 3OSGA 3IH2A 4V2FA 3BR1A 4A3CJ 2Y9YA 3HOZJ 1JGGA 3LSPA 1XC5A 2O8KA 2E2JJ 1ZTRA 1JTYA 4UUTA 3JR9A 1HF0A 1LE8B 4I76A 1FTTA 4J19A 1F36A 2NOGA 1VF9A 1MBEA 5C3EJ 1QVUA 3JRAA 1AKHA 4QTRA 3SDGA 3LSRA 3GTPJ 3I4NJ 1I50J 1P7JA 5GP9A 5M3FJ 2O7OA 1HCRA 3S1MJ 3ZOBA 4AYBN 4UUSA 1NK3P 2DMNA 2YUSA 5F1JA 2KDZA 1IGNA 1QPIA 3MN2A 1DU0A 1TWHJ 1MH3A 2H1KA 1NK2P 4NDLA 1XS9A 3GTGJ 4L5EA 3A01A 2HXOA 4I6ZA 1ZQ3P 3S14J 2EZIA 1HLVA 4B3AA 2CUFA 1MBGA 4A3IJ 1W0TA 1MBJA 3HOWJ 1BA5A 5FJ8J 2XGCA 2K9QA 3I4MJ 1FTZA 2LP0A 5M5WJ 5FLVA 3ZQCA 3RZOJ 3FKIJ 1JKOC 2LKXA 3WHBA 1OCPA 3HOVJ 1BW5A 1B8IB 2LFBA 2KT0A 2MG4A 4V2GA 2DN0A 1QRYA 4A3EJ 1JUSA 1IJWC 1B8IA 3FISA 3TEDA 1YRNB 2MGQA 2JA8J 3GTMJ 1H88C 5EGOA 3GBGA 3ZQHA 1SANA 2AO9A 3BG3A 2Y0SN 3TP0A 2X48A 2L7MP 3JREA 3UKGA 4G12A 4BY1J 2XPVA 4DYRA 2JJ7A 3JRHA 3S2DJ 3JRBA 2FD5A 2XB5A 5J3LA 3K2AA 5E3OA 4M3BA 3F0CA 3FK7A 2AHQA 1IG7A 3S17J 3DCFA 5IYBJ 1POGA 1PUFB 4X1EA 5IP7J 2IEKA 4D7MA 2Y9ZA 3H3VK 2OF7A 1R9TJ 3JRGA 1ZR2A 1ZKGA 1IC8A 1D5YA 2LTPA 3PM1A 2WV1A 2HOSA 2LK2A 1BW6A 4FE4A 4GFBA 2CUEA 3S1RJ 1GUUA 1IDYA 1T56A 2HOTA 1WI3A 2HYJA 4CYCA 1GDTA 2GLOA 3GTKJ 2L7ZA 3C2BA 4JX5A 3NARA 4M3GA 5EG0A 2DMTA 3CCYA 5FKNA 5F27A 4BBRJ 1RPWA 4D5CA 4MIMA 3TP3A 1U9OA 1MNMC 2JA5J 4A93J 2E1OA 3CDLA 1APLC 1RKTA 1IUFA 3JRFA 4DYCA 5DS9A 3HKZN 3BR0A 1FJLA 1AKHB 1JUPA 5EEAA 5IYDJ 2ELKA 3HGGA 5FLMJ 1U78A 1IRZA 4UUSB 4JX4A 1Y1VJ 1A6IA 3JRIA 1ETVA 1JTXA 3LSGA 3RKQA 1IDZA 3BG9A 4QSHA 1FEXA 1TC3C 5J1RA 4BKXA 4XICA 1LFBA 4B1RA 4AC0A 3GTLJ 3BQYA 3NAUA 2LY9A 5F0CA 4RDUA 2HOAA 2ME6A 3S15J 2DTZA 2COBA 2JK3A 3A02A 3FIWA 3A01B 3SJMA 2QF7A 4Y52J 1QVTA 1IV6A 2VKVA 1UMQA 1U8BA 2DA2A 1JKRC 2M0CA 1F43A 5BNGA 3QQAA 3S1NJ 2R5YA 1JT0A 3PO3J 2IBDA 1FIAA 2EZHA 2CQQA 4C3HJ 4M3DA 4W97A 4A3BJ 3BR6A 3JRCA 3SFIA 1OCTC 2K40A 5FKLA 3RZDJ 3A03A 2MSYA 2DA7A 4JP0A 1RR7A 1ZK8A 1VFCA 3BQZA 2EBIA 3Q0UA 5EGOB 3B6CA 2VKEA 1WH5A 1E3OC 5IP6A 3Q0VA 2JWTA 2M9HA 1JJ8C 1FIPA 2DMUA 1B72A 2ID3A 4MO7A 4EEFG 3VPRA 3GTJJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTQ J;  1Q1V A;  3ZQG A;  3HM5 A;  2JA6 J;  2M2E A;  2NS7 A;  1ZR4 A;  1K61 A;  1P7I A;  2M8G X;  3G1O A;  3HEF A;  4XRS G;  5IPA A;  1W0U A;  4S0H B;  1H89 C;  5M5Y J;  1ETQ A;  5EDN A;  4IEJ A;  5K7H A;  2EQR A;  2NVT J;  4BBS J;  1RET A;  1VND A;  2W48 A;  3IH3 A;  1CQT A;  2EZK A;  1GT0 C;  2DA6 A;  3GTO J;  1MSE C;  4M3F A;  4W1U A;  2Y30 A;  2XPU A;  5F04 A;  2R5Z A;  4CYC B;  3BTJ A;  2H8R A;  2XB0 X;  1JJ6 C;  2HXI A;  2DA4 A;  5EG0 B;  2CJJ A;  3HBL A;  1HDD C;  1UHS A;  3G1L A;  3O8H A;  4BY7 J;  3Q3S A;  1S7E A;  3BT9 A;  2Y2Z A;  4IHY A;  3OIO A;  4AUX A;  5IOZ A;  2ME0 A;  3BG5 A;  3HDD A;  4BXX J;  3LOC A;  1JT6 A;  2M34 A;  5C44 J;  4A3F J;  3RQI A;  1Z0X A;  1X58 A;  3WHC A;  4LOC A;  3ZQI A;  3MKL A;  2O9L A;  2LD5 A;  3LSJ A;  5EZH A;  4FTH A;  1ETY A;  1BJZ A;  4IHV A;  1HDP A;  2DMP A;  3OSF A;  1HOM A;  4A69 C;  3W6V A;  1WCM J;  4XRM A;  1BL0 A;  1ETX A;  2GBY A;  1AHD P;  2MW8 A;  3S16 J;  3BTC A;  1MBK A;  2TCT A;  3BR3 A;  2I10 A;  2NVX J;  4D5F A;  2RAE A;  1XG1 A;  3D1N I;  2Y31 A;  1ORK A;  3IH4 A;  2GM4 A;  1EF4 A;  2DA3 A;  2ID6 A;  5M3M J;  5FKO A;  1OFC X;  3S2H J;  2DA5 A;  3O8G A;  4DZP A;  2FX0 A;  1GVD A;  2WB1 N;  4RBO A;  1OJL A;  2JMW A;  5K7Z A;  2EZL A;  1WPK A;  5J1U A;  3HOY J;  1LE8 A;  2D5V A;  5GPA A;  1JKP C;  1NTC A;  2R5Y B;  1LFU P;  5JLX A;  4X6A J;  2NVQ J;  3BR2 A;  3G1M A;  3IV5 A;  1TWA J;  5C4J J;  1MBF A;  3HOX J;  1UG2 A;  4FE7 A;  2DMQ A;  4A3L J;  2FJ1 A;  3CMY A;  3CQZ J;  4M3E A;  1I6H J;  5K7F A;  1A5J A;  1Z77 A;  2XRL A;  4A3M J;  1Y1W J;  1MH4 A;  1RKW A;  2CQX A;  4FCY A;  1H8A C;  3HOU J;  3MVP A;  2G0E A;  4DW6 A;  1O4X A;  1GV5 A;  2NVY J;  5E3M A;  5GPC A;  2JA7 J;  2E2I J;  2R93 J;  2CRG A;  1TWC J;  5F08 A;  1AU7 A;  2XGD A;  2L9R A;  2WAQ N;  4ABZ A;  2VUM J;  5M5X J;  1TWF J;  1B72 B;  4FIS A;  2EH3 A;  2HQ5 A;  3BR5 A;  4MFE A;  3TW7 A;  2HDD A;  5E3L A;  3H0G J;  1TWG J;  2E19 A;  2DA1 A;  2ECC A;  4JYK A;  3M3Y J;  2X6O A;  3BTL A;  2LLK A;  3Q0W A;  5FKK A;  2YS9 A;  5F0H A;  1U9N A;  1MBH A;  5IYC J;  3ZQL A;  2XPW A;  2IAI A;  4DZJ A;  4MFD A;  3HGY A;  4XK4 A;  5EZG A;  4HNV A;  4XRS A;  1DU6 A;  5JLW A;  2ZB9 A;  2R7Z J;  4D7N A;  2E2H J;  1ETK A;  1VI0 A;  4B4C A;  1GV2 A;  2B63 J;  4C3J J;  2JN6 A;  1WH7 A;  5F0F A;  4A3K J;  2K9S A;  5E3N A;  2R5Z B;  5EF6 A;  2X9D A;  2LR8 A;  4IHW A;  4IHX A;  5FKM A;  1JKQ C;  1YRN A;  2FQ4 A;  2TRT A;  4JX6 A;  1ITY A;  1ETO A;  1G2H A;  1I3Q J;  2DJN A;  4QIW N;  1K83 J;  3B6A A;  2ECB A;  4A3J J;  3K7A J;  1JUM A;  3HB9 A;  4C3I J;  2XGE A;  2NS8 A;  5DTD A;  5IOY A;  4DYQ A;  3S1Q J;  1X2M A;  4C2M J;  4XID A;  3TW6 A;  3M4O J;  1PUF A;  3E7L A;  3QPL A;  3QPS A;  1MSF C;  2VPR A;  3PO2 J;  1SFO J;  2OPT A;  4MLO A;  5C4X J;  5HOD A;  3OOU A;  1ENH A;  2QCO A;  3DEW A;  3L1P A;  1RES A;  4M6V A;  2VI6 A;  2N8G A;  1X2N A;  4Y7N J;  5IP9 J;  4A3G J;  2K9N A;  2L7F P;  3BTI A;  1WGX A;  2CU7 A;  4A3D J;  2P81 A;  5EYR A;  3LNQ A;  1ZGW A;  2R92 J;  1ETW A;  5J1Y A;  2YU9 J;  2XSD C;  2LVS A;  3ZQF A;  2HI3 A;  2PMZ N;  1T33 A;  3FK6 A;  9ANT A;  2L0K A;  3JRD A;  2R0Q C;  3OSG A;  3IH2 A;  4V2F A;  3BR1 A;  4A3C J;  2Y9Y A;  3HOZ J;  1JGG A;  3LSP A;  1XC5 A;  2O8K A;  2E2J J;  1ZTR A;  1JTY A;  4UUT A;  3JR9 A;  1HF0 A;  1LE8 B;  4I76 A;  1FTT A;  4J19 A;  1F36 A;  2NOG A;  1VF9 A;  1MBE A;  5C3E J;  1QVU A;  3JRA A;  1AKH A;  4QTR A;  3SDG A;  3LSR A;  3GTP J;  3I4N J;  1I50 J;  1P7J A;  5GP9 A;  5M3F J;  2O7O A;  1HCR A;  3S1M J;  3ZOB A;  4AYB N;  4UUS A;  1NK3 P;  2DMN A;  2YUS A;  5F1J A;  2KDZ A;  1IGN A;  1QPI A;  3MN2 A;  1DU0 A;  1TWH J;  1MH3 A;  2H1K A;  1NK2 P;  4NDL A;  1XS9 A;  3GTG J;  4L5E A;  3A01 A;  2HXO A;  4I6Z A;  1ZQ3 P;  3S14 J;  2EZI A;  1HLV A;  4B3A A;  2CUF A;  1MBG A;  4A3I J;  1W0T A;  1MBJ A;  3HOW J;  1BA5 A;  5FJ8 J;  2XGC A;  2K9Q A;  3I4M J;  1FTZ A;  2LP0 A;  5M5W J;  5FLV A;  3ZQC A;  3RZO J;  3FKI J;  1JKO C;  2LKX A;  3WHB A;  1OCP A;  3HOV J;  1BW5 A;  1B8I B;  2LFB A;  2KT0 A;  2MG4 A;  4V2G A;  2DN0 A;  1QRY A;  4A3E J;  1JUS A;  1IJW C;  1B8I A;  3FIS A;  3TED A;  1YRN B;  2MGQ A;  2JA8 J;  3GTM J;  1H88 C;  5EGO A;  3GBG A;  3ZQH A;  1SAN A;  2AO9 A;  3BG3 A;  2Y0S N;  3TP0 A;  2X48 A;  2L7M P;  3JRE A;  3UKG A;  4G12 A;  4BY1 J;  2XPV A;  4DYR A;  2JJ7 A;  3JRH A;  3S2D J;  3JRB A;  2FD5 A;  2XB5 A;  5J3L A;  3K2A A;  5E3O A;  4M3B A;  3F0C A;  3FK7 A;  2AHQ A;  1IG7 A;  3S17 J;  3DCF A;  5IYB J;  1POG A;  1PUF B;  4X1E A;  5IP7 J;  2IEK A;  4D7M A;  2Y9Z A;  3H3V K;  2OF7 A;  1R9T J;  3JRG A;  1ZR2 A;  1ZKG A;  1IC8 A;  1D5Y A;  2LTP A;  3PM1 A;  2WV1 A;  2HOS A;  2LK2 A;  1BW6 A;  4FE4 A;  4GFB A;  2CUE A;  3S1R J;  1GUU A;  1IDY A;  1T56 A;  2HOT A;  1WI3 A;  2HYJ A;  4CYC A;  1GDT A;  2GLO A;  3GTK J;  2L7Z A;  3C2B A;  4JX5 A;  3NAR A;  4M3G A;  5EG0 A;  2DMT A;  3CCY A;  5FKN A;  5F27 A;  4BBR J;  1RPW A;  4D5C A;  4MIM A;  3TP3 A;  1U9O A;  1MNM C;  2JA5 J;  4A93 J;  2E1O A;  3CDL A;  1APL C;  1RKT A;  1IUF A;  3JRF A;  4DYC A;  5DS9 A;  3HKZ N;  3BR0 A;  1FJL A;  1AKH B;  1JUP A;  5EEA A;  5IYD J;  2ELK A;  3HGG A;  5FLM J;  1U78 A;  1IRZ A;  4UUS B;  4JX4 A;  1Y1V J;  1A6I A;  3JRI A;  1ETV A;  1JTX A;  3LSG A;  3RKQ A;  1IDZ A;  3BG9 A;  4QSH A;  1FEX A;  1TC3 C;  5J1R A;  4BKX A;  4XIC A;  1LFB A;  4B1R A;  4AC0 A;  3GTL J;  3BQY A;  3NAU A;  2LY9 A;  5F0C A;  4RDU A;  2HOA A;  2ME6 A;  3S15 J;  2DTZ A;  2COB A;  2JK3 A;  3A02 A;  3FIW A;  3A01 B;  3SJM A;  2QF7 A;  4Y52 J;  1QVT A;  1IV6 A;  2VKV A;  1UMQ A;  1U8B A;  2DA2 A;  1JKR C;  2M0C A;  1F43 A;  5BNG A;  3QQA A;  3S1N J;  2R5Y A;  1JT0 A;  3PO3 J;  2IBD A;  1FIA A;  2EZH A;  2CQQ A;  4C3H J;  4M3D A;  4W97 A;  4A3B J;  3BR6 A;  3JRC A;  3SFI A;  1OCT C;  2K40 A;  5FKL A;  3RZD J;  3A03 A;  2MSY A;  2DA7 A;  4JP0 A;  1RR7 A;  1ZK8 A;  1VFC A;  3BQZ A;  2EBI A;  3Q0U A;  5EGO B;  3B6C A;  2VKE A;  1WH5 A;  1E3O C;  5IP6 A;  3Q0V A;  2JWT A;  2M9H A;  1JJ8 C;  1FIP A;  2DMU A;  1B72 A;  2ID3 A;  4MO7 A;  4EEF G;  3VPR A;  3GTJ J; 
#chains in the Genus database with same CATH topology
 3L09 A;  1P9Q C;  4UXN A;  5LGN A;  3DLA A;  1U5T C;  4B09 A;  3TO9 A;  1P7I A;  3H36 A;  3KZI C;  4PJJ A;  4IO9 F;  2KJC A;  3CCE I;  4MQ9 F;  4ZZD A;  5E8I A;  2ZC2 A;  3TO6 A;  2P8T A;  1ETQ A;  5M5Y J;  3FXU A;  2EQR A;  5K7H A;  4BBS J;  1RET A;  2RN7 A;  3OYE A;  4ZJZ A;  5FD6 A;  2Y0M A;  1XD7 A;  2VLA A;  2KZG A;  3CC7 I;  2DA6 A;  5A2Q Z;  4M73 A;  4GYI A;  2PMU A;  1KU7 A;  5F04 A;  4L0Z B;  1SD4 A;  3K2Z A;  2IGN A;  2ZFU A;  3ZR8 X;  2F5D A;  5DUI A;  5EG0 B;  2COM A;  1X19 A;  3E1S A;  1T0F C;  3G1L A;  3GLL A;  4Q47 A;  3Q3S A;  4D1Q A;  3L7W A;  1BR1 A;  4IHY A;  1U5T A;  1IN5 A;  5IOZ A;  1Y8Q B;  3BG5 A;  3HDD A;  4BXX J;  1IRG A;  3MZ8 A;  3FHN A;  3T1B A;  5J47 A;  3L2U A;  3OR1 C;  4LOC A;  3Q9S A;  3ZQI A;  3KYD B;  3HIF A;  2Q2E B;  1LKX A;  2LD5 A;  3DPL C;  3P5J A;  2YX7 A;  3E5U A;  1OLT A;  1VQ4 I;  1QPM A;  3GO5 A;  5E18 F;  4IHV A;  3M07 A;  1T2K A;  1WCM J;  4LIV A;  2NVU B;  2K9L A;  1OCC H;  3S16 J;  1FC3 A;  3BTC A;  1JI8 A;  4NC6 A;  1MBK A;  4UV9 A;  3HRU A;  2NVX J;  4L9V A;  1X1A A;  1J09 A;  1T0F A;  4FX4 A;  2EV0 A;  4B48 A;  5K5O A;  3AL0 B;  3D1N I;  1F9N A;  4IL6 C;  4EJO A;  5GTH C;  5CKT A;  1F5T A;  2MA3 A;  3TOB A;  2DDB A;  2V6E A;  2M0M A;  2FUG 2;  2H8W A;  3G6E I;  2NRA C;  1FPQ A;  1MW7 A;  1W5T A;  3F21 A;  4DBQ A;  1OJL A;  2FBI A;  1FOY A;  2QVO A;  3W2W A;  5B5E C;  5J1U A;  4N0B A;  4GXO A;  1YIT I;  1LE8 A;  5GPA A;  4IZZ A;  1TNS A;  3ZQQ A;  2R5Y B;  2IJL A;  3BR2 A;  2VE9 A;  3G1M A;  3J80 Z;  5C4J J;  3A2K A;  1UG2 A;  2I5U A;  2ACJ A;  2E1N A;  2KHM A;  1Z7L A;  2VQC A;  1SD6 A;  3CQZ J;  2LRE A;  2XRL A;  4A3M J;  1SVO A;  2V26 A;  3IP4 B;  1U0J A;  3MKZ A;  1LFP A;  2MH2 A;  2QSH X;  2OZ6 A;  4AU7 A;  2WAQ A;  3K70 D;  5FRO A;  1D3Y A;  2GWR A;  3W3C A;  3K69 A;  2G9W A;  1TWC J;  2FRH A;  1AU7 A;  4XLN F;  5FO5 A;  2BZT A;  2L9R A;  2WAQ N;  1W5C C;  2VUM J;  4RGX A;  1B72 B;  4RB1 A;  2HQ5 A;  2GA2 A;  3BR5 A;  1QU3 A;  2E19 A;  1OPC A;  2DA1 A;  4CXF A;  4JYK A;  3F8N A;  1V4R A;  4Y3O A;  3BTL A;  4B44 A;  2L9V A;  1AOY A;  5CJ9 A;  1P92 A;  2W1O A;  4AVP A;  1MBH A;  3ZQL A;  3P9K A;  3J80 K;  2QM3 A;  3C3W A;  1YO5 C;  1DU6 A;  1XSV A;  2OA4 A;  2R7Z J;  2GA1 A;  2F48 A;  1ETK A;  1VI0 A;  5D5W B;  3LWF A;  3I59 B;  2BVM A;  4C3J J;  3K70 C;  5F0F A;  5E3N A;  2FML A;  3A4C A;  5ILS A;  2DYR H;  2V1D A;  2KRH A;  1RNL A;  4IHW A;  3WTT C;  4IHX A;  5ICF A;  4ZTF A;  5FKM A;  3P7N A;  2DW4 A;  3CF5 F;  1ZLK A;  2JRM A;  1ZG5 A;  1G2H A;  2DJN A;  2O61 A;  2WY7 Q;  2YU3 A;  1W5S A;  2D1H A;  2Z3Y A;  2F5C A;  4A3J J;  1IXS B;  2P6S A;  3FXO A;  5HDK A;  1BN5 A;  1XGN A;  4DYQ A;  4ASN A;  3K1P A;  1V54 H;  1ONV A;  3KZZ A;  3BRO A;  1HST A;  2JA2 A;  2KIU A;  4JQF A;  1P4A A;  4KIC A;  5E1W A;  5J8F A;  3G4S I;  1LDK B;  3E7L A;  3QPL A;  5CVI A;  1MSF C;  4UUV A;  2X1E A;  3M7G A;  5LRS A;  3VYR B;  4N4O B;  5ICG A;  2RRE A;  5HOD A;  1OR7 C;  2VJ5 A;  3GFM A;  1HBX G;  3RDI A;  3X2Q H;  3V8L A;  2A6T A;  3RYP A;  5L3D A;  4G7Z F;  5CLS A;  4HLX A;  3CME I;  2VI6 A;  5IP9 J;  4I7H A;  3P9C A;  4PJ0 C;  4U7B A;  3OY9 A;  1IXC A;  3KE2 A;  1WGX A;  1Z3Y A;  2X6Y A;  1PJR A;  3H9G A;  4XOR A;  3CMA I;  1O3S A;  2R7R A;  3K1M A;  4B3X A;  1YG2 A;  2Z5U A;  5KHD A;  3H5N A;  1T33 A;  1NG6 A;  1YJ9 I;  4OMZ A;  1H0M A;  9ANT A;  2L0K A;  1R5G A;  4DIQ A;  3TMO A;  1TQM A;  1OYI A;  3IH2 A;  3U2R A;  1T38 A;  4EVI A;  1JGG A;  3CO6 C;  2E2J J;  1QHG A;  5LBQ A;  2W7N A;  2A68 F;  2E1C A;  4I76 A;  3KET A;  5TIS C;  3WTX C;  1VF9 A;  4XLC A;  3EQL F;  1SMY F;  3FWE A;  4BNC A;  3BZK A;  4ANJ A;  5HLT A;  1OR7 A;  1LUJ B;  4XMY A;  4QTR A;  4WWC A;  3SDG A;  3LSR A;  3GTP J;  1BJA A;  1TLH B;  4BS9 A;  3NEU A;  1K79 A;  3TGN A;  4G7O F;  5GP9 A;  2O7O A;  4FX0 A;  1MIJ A;  2ZCW A;  4M72 A;  3CCR I;  1A6Q A;  5D8K B;  3ZMV A;  5F1J A;  2KDZ A;  1IGN A;  4CYD A;  3MN2 A;  2BY2 A;  3EYI A;  3ZXS A;  3ABU A;  3OYC A;  2RGV A;  1RUO A;  2L5Q A;  2R4G A;  3D5L A;  1FP2 A;  3CCS I;  2DTR A;  3KLN A;  3A0B C;  1R7J A;  1XS9 A;  4RLQ A;  3V8J A;  3PNT A;  1YQA A;  2NAZ A;  2L9S A;  4BHC A;  3A01 A;  2QEX I;  1LPQ A;  4UVA A;  1YIJ I;  3CCQ I;  2HVS A;  1ZQ3 P;  3WG9 A;  1HLV A;  1ZAR A;  2CUF A;  3RJP A;  2DOE A;  4KA4 A;  1Z05 A;  2QSG X;  3HTS B;  4H0E A;  4RS8 A;  4EGZ A;  3HOW J;  1MDM A;  4BE1 A;  3E5X A;  5TJJ A;  3BDD A;  4FET A;  5FLV A;  3ZQC A;  4IRG A;  1WJF A;  2GIV A;  3SZG A;  1T98 A;  1GHC A;  4BUP A;  4OIR F;  3WTU C;  2AQE A;  3HOV J;  2LFB A;  2HQA A;  2KT0 A;  4A3E J;  4KT6 A;  3OYK A;  4HSR A;  3I56 I;  4ZDP A;  3TED A;  3CJR B;  3T0Y A;  3CTA A;  4XBF A;  2OBP A;  3ZMD A;  1X1D A;  3J7A Y;  5E79 C;  4RAY A;  3BOQ A;  4D9J A;  1XTA A;  2KKO A;  2L7M P;  4G12 A;  4EQQ A;  2Q0O A;  2PI0 A;  2XB5 A;  1P2F A;  1FMW A;  4M3B A;  2B9S A;  3F0C A;  2RC4 A;  1S7A A;  1FZP B;  2CG4 A;  1DGW Y;  1R58 A;  1N77 A;  4X1E A;  1AA7 A;  2IEK A;  2Y9Z A;  3NWS A;  3LFK A;  2D1V A;  1VQ5 I;  2O0Y A;  3I55 I;  4UY8 I;  5HLI A;  3PM1 A;  2WV1 A;  1UHM A;  4IVN A;  1G3T A;  1DQU A;  2R7U A;  4WXD A;  1BW6 A;  1Z1D A;  3TDZ C;  3WU2 C;  3S1R J;  4Y33 A;  1ZG3 A;  3C18 A;  2HOT A;  1WI3 A;  1GDT A;  2GLO A;  1RUN A;  4OIP F;  1I39 A;  2EIK H;  3SQN A;  2WAE A;  5E1Z B;  4M3G A;  5DCM B;  5EG0 A;  4MQV A;  2XAU A;  4OAY A;  3AL0 C;  5KK1 A;  1RPW A;  1GVJ A;  1XCV A;  2ZNY A;  1V5G A;  3KP4 A;  2RDP A;  3AG1 H;  3HKZ A;  4A0X A;  4RB0 A;  1PUE E;  4G7H F;  1APL C;  3KP5 A;  2LC2 A;  1WZ2 A;  3V8K A;  1FYK A;  4IXA A;  4HRI A;  4BQQ A;  3HKZ N;  5B3S H;  1AKH B;  2Q2E A;  1TQI A;  4YFN F;  3F8M A;  2R7V A;  4IF4 A;  1WVR A;  2G7H A;  1JUP A;  5EEA A;  1WJC A;  1WRJ A;  1BI1 A;  5IYD J;  4CHU A;  3FXR A;  1E0E A;  4AIH A;  1GXP A;  2IS1 A;  5FLM J;  2X0L A;  4HDV A;  2MLG A;  2JVG A;  1YFH A;  3JRI A;  4IQ4 A;  3RKQ A;  4KUM A;  4QSH A;  4OU0 A;  4A2U A;  5J1R A;  2PN6 A;  4CCL A;  1YTY A;  4XN3 A;  1TT0 A;  4AC0 A;  3GTL J;  2BHZ A;  1TW2 A;  2V4J C;  1S8N A;  1XSX A;  1YS7 A;  3DV8 A;  3GVA A;  4RGS A;  5F1R A;  1A31 A;  4RAF A;  2HOA A;  3FMQ A;  1MND A;  1K6O A;  2L02 A;  2ZSI B;  1YOV B;  2QF7 A;  5HOO A;  1OCR H;  4NB5 A;  1QVT A;  1YW9 A;  3RKX A;  1IV6 A;  2M3A A;  1V55 H;  1UMQ A;  2BEO A;  3G73 A;  2M0C A;  5LGU A;  1REP C;  3E5Q A;  4QPQ A;  1T6S A;  3MZH A;  3OS1 A;  4BAC A;  2R5Y A;  4LG3 A;  2CW7 A;  1K78 B;  2CQQ A;  1IN7 A;  1BI0 A;  1JXS A;  2NOJ B;  3E3V A;  4A3B J;  4KIS A;  3SFI A;  2M7B A;  1IN6 A;  3RZD J;  3V4G A;  2XIG A;  2AQF A;  3CJQ B;  3F3X A;  2E60 A;  1ZK8 A;  2ZXI A;  2OCC H;  5HLH A;  3BQZ A;  2EBI A;  5JHU A;  1J9I A;  3H92 A;  2MC3 A;  1FX7 A;  4EJV A;  5JFR A;  2KFD A;  4AIK A;  4HF2 A;  5D8L B;  3CUQ B;  2VN2 A;  4LIU A;  2LSO A;  1E3O C;  5IP6 A;  1ZGA A;  1SMT A;  2VJJ A;  3Q0V A;  5B1A H;  4XOT A;  2F4O B;  3BJO A;  1B72 A;  3VFZ A;  4EEF G;  5FRM A;  3VPR A;  3GTJ J;  1GXQ A;  2OQG A;  1Z6R A;  1SD5 A;  3HM5 A;  3ZMU A;  4L9J A;  4YEL A;  5J4Y A;  2JA6 J;  3OYD A;  3HHH A;  1K61 A;  3QP6 A;  3KP7 A;  3HEF A;  4E70 A;  2VOO A;  2FMY A;  2CFO A;  4G94 A;  1R4N B;  2DOA A;  5BPD A;  2WBM A;  4I02 A;  1LNW A;  5BQT A;  1VQ8 I;  4HLY A;  1VND A;  5D6E A;  2CV0 A;  3IH3 A;  2EZK A;  5FLX Z;  3DKW A;  3I59 A;  1WKM A;  2CUJ A;  1QZY A;  3K4B A;  5DM6 F;  2ZXW H;  3W6J B;  2XAJ A;  3LA7 A;  2XPU A;  1R00 A;  2PQ8 A;  3BTJ A;  4CYC B;  1B6A A;  2R7F A;  4A5N A;  4CZZ A;  2DA4 A;  1LDD A;  4GGG A;  2QKM B;  4QWQ A;  3KCC A;  1UHS A;  4BY7 J;  1S7E A;  2DAO A;  3BT9 A;  1V5F A;  2MBF A;  4QLC U;  1SEU A;  2DU9 A;  3L9F A;  3OIO A;  4M6Y A;  1HKS A;  1S5L C;  2ME0 A;  3J7Y J;  1WJD A;  2UV1 A;  3LOC A;  2HYF A;  3FXQ A;  1A35 A;  3DQV C;  3RQI A;  4F3Q A;  2JUG A;  2O9L A;  4U0V A;  1BC8 C;  2WTE A;  3BZC A;  1LQ1 A;  1IXR C;  1ETY A;  3GYH X;  2DMP A;  4I01 A;  4Y13 A;  4UNO A;  4MEX F;  4PJL A;  2BHY A;  2DBB A;  1ETX A;  1B1B A;  3Q5F A;  5BOX A;  2BGC A;  2VXZ A;  3S3M A;  3WE3 A;  3KLO A;  3WTZ A;  2RKH A;  2I10 A;  5CQG A;  5CQE A;  2RAE A;  5ERI A;  3KYC B;  3HOT A;  1QQI A;  4WXC A;  2Y31 A;  1ORK A;  3IH4 A;  2GM4 A;  1OFC X;  2OAZ A;  3VYU B;  4GRI A;  4N9I A;  2FX0 A;  3L00 A;  1HW2 A;  4HV6 A;  2UXX A;  1UAA A;  2GOX B;  2JMW A;  3HSE A;  4PSX A;  3HPH A;  2BOL A;  3D5R C;  2EZL A;  2UUZ A;  2XHK A;  3CCV I;  1VTN C;  1TT5 B;  4HQM A;  3L2C A;  2O5R A;  1JKP C;  1Y0U A;  1T39 A;  2A07 F;  5DYM A;  4GDF A;  1LFU P;  3OWT A;  4X6A J;  1SVM A;  1DUX C;  2M4G A;  4N9H A;  1FY7 A;  2EA2 A;  3JW4 A;  3HOX J;  4FE7 A;  4DQ2 A;  4CIC A;  3M8F A;  2FJ1 A;  1ZEL A;  4ZDL A;  4M3E A;  2ZBK A;  1I6H J;  1JHH A;  2Z2S B;  3SEQ A;  3F8F A;  1IN4 A;  3AG4 H;  2DXI A;  3TKY A;  4FAS D;  4FCY A;  4NNJ A;  2L2O A;  4HX7 A;  4CCK A;  3MVP A;  4DW6 A;  1O4X A;  1UHW A;  2NVY J;  3BCB A;  2X85 A;  5ILV A;  2HEO A;  4IHS A;  2E2I J;  3I71 A;  1T95 A;  2NYX A;  4O6J A;  4RGU A;  1LVK A;  5IY5 H;  3GCM A;  4XLH A;  2L4M A;  3BJA A;  3HTU A;  5CVU A;  4A6D A;  5M5X J;  1PP7 U;  2KRC A;  2VQL A;  3ZCO A;  2EFP A;  4DOZ A;  4MFE A;  2HDD A;  3H0G J;  1G8X A;  2A6E F;  1F4K A;  2ECC A;  4OMY A;  3F8B A;  2ICW G;  3L2W A;  4P9F A;  2LLK A;  4YFX F;  2YS9 A;  3G71 I;  5IYC J;  2PEX A;  4DZJ A;  2DPU A;  3Q9V A;  1MMN A;  3PFY A;  4I09 A;  5JLW A;  3ZMS A;  4E7Z A;  4M71 A;  1BI2 A;  2Y48 A;  4D7N A;  1F1Z A;  2EIM H;  3GX4 X;  2JN6 A;  1WH7 A;  3RIR A;  2K9S A;  4IOC F;  2R7S A;  2R5Z B;  2LYC A;  2YSR A;  1XDS A;  2X9D A;  3MCZ A;  3VYT B;  3L2Q A;  1JKQ C;  4CCO A;  2J5P A;  1D8K A;  2LDU A;  2KZV A;  4PZJ A;  4BYY A;  4YIF A;  1J0R A;  1IF1 A;  1ETO A;  1A36 A;  4ZYG A;  1ITY A;  2K9M A;  3M8J A;  1FT9 A;  4QIW N;  4V19 K;  1K83 J;  4EJT A;  2XVC A;  2FOK A;  4E7L A;  1PP8 F;  2PG4 A;  2L3D A;  3HB9 A;  4C3I J;  2KMU A;  3G3Z A;  3ASO H;  3DEU A;  5IOY A;  4ENJ A;  1R1U A;  3M1E A;  1T8I A;  3E6M A;  5DDG A;  2ESH A;  1X2M A;  4P1W A;  2XV4 S;  3TO7 A;  4C2M J;  3M4O J;  3NWT A;  2D45 A;  5HVQ C;  4MEY F;  1SFO J;  1X4P A;  4JBA A;  1ZGJ A;  3DBR B;  3OYN A;  2QCO A;  3L1P A;  3S93 A;  4XLA A;  2VIX A;  5AIP A;  5LGT A;  4Y7N J;  4A3G J;  5A2Q K;  2CYY A;  1Z6T A;  2PMZ A;  1D0Z A;  2K9N A;  2L7F P;  3DP7 A;  3FM3 A;  2CU7 A;  3NRV A;  1TTY A;  5LHG A;  2XC7 A;  1LDJ A;  5EJC A;  5EYR A;  3LNQ A;  1HQC A;  5GAE J;  1KU3 A;  5H20 A;  2DT7 B;  4WCG A;  1ZRD A;  5J1Y A;  5HLG A;  3I54 A;  3ZQF A;  2PMZ N;  5DCM A;  3ZMT A;  1R49 A;  2VKH A;  4FHT A;  5FFZ A;  3S2W A;  1J5Y A;  4OWR B;  1I6X A;  4E7S A;  3JRD A;  2ZJR F;  2R0Q C;  3QRF F;  1ACI A;  4A3C J;  3OL3 A;  5B1B H;  1RR8 C;  1MKM A;  1USS A;  4PUS A;  4Y4R A;  1S7O A;  3GFI A;  3QOP A;  1JE8 A;  1FTT A;  2DK8 A;  4LB6 B;  1Z21 A;  3BWG A;  3JRA A;  1AKH A;  3RTR A;  4A0Z A;  3OOP A;  1WI9 A;  3ABK H;  2EA4 A;  1I50 J;  2FEZ A;  3MAJ A;  1UST A;  2LF7 A;  4AYB A;  2LRD A;  2K3P A;  2VOD A;  1VQN I;  4ESJ A;  5M3F J;  2BYV E;  2VL8 A;  3QU3 A;  4IHT A;  1UZC A;  3PIP F;  2PJR B;  5H6Q A;  3ZMZ A;  4AYB N;  2LF8 A;  3K0L A;  1MMA A;  1RZ4 A;  4CO8 A;  2E34 A;  5IT9 Z;  1TWH J;  2E35 A;  1MH3 A;  1HSJ A;  2IGM A;  1OQY A;  1S72 I;  2H1K A;  2QQ9 A;  3WU1 B;  4ZC3 A;  1NK2 P;  3ECO A;  1X1B A;  2NNN A;  1E3H A;  2HDC A;  4L5E A;  2A61 A;  3EUK L;  2K85 A;  2K86 A;  3FM5 A;  3S14 J;  3CUQ C;  4B3A A;  4A3I J;  2XF5 A;  1DP7 P;  1FBS A;  1UJ8 A;  1FNN A;  5M5W J;  3RZO J;  3FKI J;  3WHB A;  1K78 A;  4KIG A;  3H3U A;  1ZAO A;  1XSD A;  1OCP A;  2HPM A;  2A5W A;  1W1W E;  1TBX A;  1YJW I;  1B8I B;  4HNU A;  4XM3 A;  2X1C A;  1JHF A;  3I5U A;  1R5I D;  3SDB A;  1X3W B;  3FXL A;  1JUS A;  2K3F A;  1XX5 A;  2FF4 A;  1BM9 A;  3EUA A;  3FIS A;  2WWY A;  1YRN B;  2Y0S A;  4YII A;  2QUF A;  2EIJ H;  3DU6 A;  3R6S A;  1VQK I;  1YIO A;  1SAN A;  3CUQ A;  2W84 A;  4C30 A;  3OYA A;  2Y0S N;  4H4K C;  2VKD A;  1SAU A;  4RM3 A;  2Z1D A;  3VDX A;  2JJ7 A;  3HJE A;  3JRB A;  3WOD F;  2CV1 A;  4HBL A;  2OCE A;  3K2A A;  2EK5 A;  4P9U A;  2IRF G;  2AHQ A;  4YFK F;  1Y8R B;  2BW3 B;  1POG A;  3MFK A;  2PFB A;  2MD0 A;  4R79 A;  1S6L A;  2V1N A;  3E6C C;  4OIN F;  2BBY A;  3JRG A;  1VZ0 A;  2ELH A;  1ZR2 A;  4LB5 A;  3ROU A;  3OL4 A;  4ENM A;  4LMY A;  3DU5 A;  2HOS A;  2E1M B;  2LK2 A;  3S3N A;  5D4S A;  2E7X A;  3FMS A;  2XF7 A;  1ZN2 A;  2HYJ A;  4CYC A;  1FSE A;  1KON A;  3HYI A;  4EM1 A;  2L7Z A;  3C2B A;  2DMT A;  3K4L A;  2CFX A;  1BR2 A;  1S9H A;  2PJP A;  4I0B A;  4KMU X;  4MIM A;  3TP3 A;  1MNM C;  2JA5 J;  1KQ0 A;  2LMD A;  2QBY B;  1XMX A;  2VBY A;  3GXO A;  2F5V A;  3CJN A;  3BCA A;  2BXY A;  3LA3 A;  3H5R A;  4DYC A;  1Y56 A;  1FJL A;  2QQB A;  3BR0 A;  3M8E A;  1FWZ A;  3LSI A;  3RI4 A;  1QBJ A;  5AIQ A;  2STT A;  1VQM I;  1R36 A;  2UWM A;  3SZP A;  1LEB A;  2E5Z A;  4RGR A;  4ZYD A;  3HGG A;  3UNG C;  1U78 A;  1IRZ A;  2XGX A;  4M9Z A;  2OJE D;  4UUS B;  4JX4 A;  4PJM A;  1ETV A;  1IDZ A;  1V5E A;  3BG9 A;  3PNV A;  3VEP A;  4XSZ F;  2HTS A;  2HU9 A;  1TC3 C;  1FEX A;  1LFB A;  2MH9 A;  3K4C A;  4B43 A;  2V1U A;  4LLN A;  3S15 J;  2DTZ A;  3A02 A;  2Y69 H;  3DKY A;  5J6X A;  3LQQ A;  4HV5 A;  2ZFW A;  2V9V A;  4IJA A;  2IW5 A;  3L2R A;  1BOB A;  3FMR A;  3TBI A;  3NQO A;  2OQR A;  4XON A;  2JSC A;  4CCM A;  3R4K A;  3ASN H;  1JKR C;  2W25 A;  2F2E A;  3E6B A;  3LL7 A;  2M7A A;  3QYE A;  2FXA A;  5HS7 A;  3S1N J;  2I8D A;  3T8R A;  2IBD A;  3A0H C;  3GZN B;  3LST A;  5BS6 A;  1KA8 A;  4XN0 A;  4C3H J;  2IGO A;  3CMM A;  4W97 A;  4BEH B;  2HPI A;  3BC8 A;  2ZXJ A;  3JRC A;  2XAH A;  1OCT C;  3DFG A;  3F72 A;  2K40 A;  2TDX A;  3HRS A;  1Z91 A;  3A03 A;  2MSY A;  4HNT A;  2Q1Z B;  1XGS A;  4PCQ A;  1G3S A;  2DCE A;  1FMV A;  1QNT A;  4L0Y B;  4RM2 A;  2OC6 A;  3Q0U A;  4U88 A;  3E6D A;  3SEZ A;  2VKE A;  1WH5 A;  4ZH4 F;  1PDN C;  4WF2 A;  2JWT A;  4LLL A;  2W4S A;  3QU6 A;  1FIP A;  2DMU A;  4HQE A;  3JTG A;  3GTQ J;  1Q1V A;  2XUB A;  3GF2 A;  1YX3 A;  2QSF X;  5FGM A;  3AKZ A;  2NS7 A;  2HNH A;  2M8G X;  2IS6 A;  2EJR A;  3G1O A;  3VYS B;  5D5V B;  2A3S A;  4U0Y A;  1TW3 A;  1ZRE A;  4HPQ A;  5L3G A;  3IWZ A;  2O03 A;  3LSK A;  3DXJ F;  2W48 A;  2QQ8 A;  4BXF A;  1VQ6 I;  4AD9 A;  3GTO J;  2KDO A;  3EPZ A;  4LGW A;  4M3F A;  4BHP A;  3RKY A;  2OTJ I;  2R5Z A;  2FNA A;  5JI6 A;  3BG6 A;  3FXJ A;  1K4T A;  3D5S C;  3K4M A;  4MHG A;  1JJ6 C;  2HXI A;  2CQN A;  1B9N A;  3OYM A;  4K2E A;  1H9G A;  1NG7 A;  1O57 A;  3HBL A;  1HDD C;  3O8H A;  1HKQ A;  1I27 A;  4AM3 A;  1AWC A;  2STW A;  2VC1 A;  4L5I A;  1XB4 A;  3WE2 A;  4ENN A;  1K4S A;  3ERM A;  5LEJ A;  4AUX A;  4C9Y A;  2JRT A;  3EET A;  4G6D A;  5FB2 A;  1PYV A;  2DK5 A;  3REO A;  3HOS A;  1HA8 A;  1J75 A;  2HTJ A;  2M34 A;  1TZL A;  4A3F J;  1O3Q A;  1Z0X A;  3A1Y A;  3H1C A;  2VON A;  3RCO A;  1X58 A;  5LHH A;  1FBU A;  5D5U B;  3IL2 A;  3FKJ A;  3MKL A;  1WJ5 A;  1C0W A;  2VT3 A;  4NBQ A;  5GTI C;  3LSJ A;  5EZH A;  1HDP A;  2OZU A;  4WX9 A;  4MTE A;  2EFQ A;  4U87 A;  3OSF A;  4A69 C;  3W6V A;  2FBH A;  1HOM A;  1S3J A;  4BJ5 C;  4XRM A;  1BL0 A;  2H94 A;  1ZLJ A;  4RLF A;  2TCT A;  4II3 A;  2DQL A;  2WAF A;  4U0W A;  3DTE A;  4E6K G;  4UB6 C;  2FNP A;  4ZYE A;  4I2O A;  4BJT A;  2WB1 A;  5FKO A;  2F6C A;  4HOB A;  1BI3 A;  3P9I A;  4AWX B;  4CSW A;  2DA5 A;  4DZP A;  1GVD A;  2UXN A;  3E97 A;  2KIM A;  4PJN A;  4BU2 A;  2WB1 N;  5CVR A;  2P6T A;  3ZPL A;  4BE0 A;  3BLY A;  1ZRF A;  1WPK A;  3F8C A;  2K27 A;  2CQ7 A;  2JSP A;  4BQN A;  3ZGK A;  1NTC A;  2QKL B;  5JLX A;  2NVQ J;  4DNC A;  1N78 A;  2XAG A;  4JK1 X;  1TWA J;  1EH7 A;  1D1A A;  1MBF A;  3LSH A;  4M74 A;  1J59 A;  3JAM Z;  2PMH A;  4IKF A;  2WAD A;  2DMQ A;  2XKO A;  1ZYR F;  2OUM A;  1A5J A;  4F91 B;  2IS4 A;  2CQX A;  1RKW A;  2L01 A;  3FX3 A;  2PJR A;  1QA6 A;  4KN4 X;  2A05 A;  4A0Y A;  4EAT A;  1GV5 A;  1B4A A;  2L9N A;  3K10 A;  1QGP A;  2KRF A;  2M8E A;  3H0D A;  3QAH A;  3CC4 I;  5F08 A;  2CSO A;  2XGD A;  4D0P A;  3ESW B;  4LG0 B;  1L3L A;  4FIS A;  5AON A;  1U6G A;  5CVJ A;  1J7K A;  1ZHF A;  2M87 A;  1X3U A;  2EH3 A;  2K7L A;  1XMK A;  1HC8 A;  3E0J B;  1N25 A;  2CH0 A;  1TWG J;  4XSX F;  4ITV A;  4II2 A;  3HRT A;  3KP3 A;  5EEG A;  2X6O A;  3IRR A;  4O5V A;  4HAM A;  5FKK A;  4RB2 C;  2XPW A;  2IAI A;  3PNY A;  4CH7 A;  3HGY A;  4XK4 A;  4HNV A;  4XRS A;  2ZB9 A;  2EIL H;  4NQW B;  3BP8 A;  4MNU A;  3BG7 A;  4IOA F;  2ZKZ A;  1FOK A;  2JPC A;  4Q4Z F;  4QPO A;  3MWM A;  2E7W A;  4A3K J;  1CF7 B;  5H2F C;  2VBX A;  3W2A A;  2VPL A;  5EF6 A;  4WK8 F;  3ULQ B;  2LR8 A;  3KFW X;  4HEA 2;  1P6R A;  2BXZ A;  3CP2 A;  5J40 A;  1YRN A;  3VOD A;  2FQ4 A;  1ON2 A;  3TQN A;  2K5C A;  1SVL A;  3O6B B;  2DFE A;  3VWB A;  1WJA A;  1I1G A;  3VOE A;  3ECH A;  3K7A J;  2HVR A;  4AVZ A;  4XRF A;  2NS8 A;  5DTD A;  3S1Q J;  3IC7 A;  3LA2 A;  1XN7 A;  4HZF A;  1SD7 A;  2HDW A;  2BW3 A;  3SZT A;  1VQP I;  2XAS A;  2F4I A;  2VPR A;  3MQ0 A;  3N97 A;  4YIR X;  3PO2 J;  3IHU A;  2DYS H;  2OPT A;  1EH8 A;  5C4X J;  5LEK A;  1ENH A;  3DEW A;  4KIF A;  4MTD A;  2KL4 A;  2GXB A;  2HKX A;  5FLX K;  2JT1 A;  5E8G A;  4YG2 F;  5ED4 A;  3GFL A;  2HKO A;  2P7V B;  4A3D J;  3ZQ7 A;  1IAW A;  4HX8 A;  5J4V A;  1ZGW A;  2R92 J;  3H3Z A;  1MMD A;  4RA2 A;  3RPQ A;  1SAX A;  2YU9 J;  1M1E B;  2XSD C;  1R1V A;  1UCR A;  2ZO4 A;  3FK6 A;  3J81 Z;  2PBI A;  1QZZ A;  1SC7 A;  3OSG A;  2OU2 A;  3BR1 A;  3DBL B;  3LSP A;  4EGY A;  2LBF B;  2BV6 A;  4ZTJ A;  2QBY A;  3F22 A;  2P5V A;  1JTY A;  4LK0 F;  4UUT A;  4BH9 A;  2R7T A;  3JR9 A;  1HF0 A;  4J19 A;  1F36 A;  2LKP A;  4YRV A;  2IP2 A;  4E7J A;  1SFK A;  3CDI A;  4A6E A;  3CLQ A;  2ISY A;  1FYM A;  2L7K A;  3I4N J;  5D4R A;  3BJ6 A;  5L3E A;  4M9S A;  3C2G A;  1NHA A;  2HZD A;  2HZT A;  4HA8 A;  1HCR A;  3S1M J;  5K1Y A;  3ZOB A;  2K4J A;  4UUS A;  2DMN A;  1FOW A;  2FSW A;  3EYY A;  3H9J A;  2ISZ A;  1ODD A;  1QPI A;  5CYV A;  2V9K A;  1G3W A;  3CO7 C;  3WTS C;  1X1C A;  3O2P E;  2AS5 F;  4NDL A;  3OS2 A;  3QYB A;  3GTG J;  3MKY B;  5HDG A;  3BPX A;  4HF0 A;  1DPR A;  1S29 A;  2HXO A;  2O8X A;  1FYL A;  1CGP A;  2NXN B;  3R60 A;  3HZJ A;  4I6Z A;  4DBR A;  5L3F A;  1MBG A;  4KYW A;  3PQK A;  1W0T A;  4KIB A;  1MBJ A;  4CA0 A;  2CMP A;  1BOA A;  1BA5 A;  5FJ8 J;  3I4M J;  5ILU A;  1UG0 A;  1FTZ A;  4J00 A;  1JKO C;  1UFM A;  1YW7 A;  2FU4 A;  3KZY A;  2VC0 A;  4ZDO A;  5DCF A;  1YHQ I;  4KDP A;  4BEH A;  1BW5 A;  1RRJ A;  3CCL I;  4BQA A;  3K4K A;  4CCN A;  1QRY A;  4ZZL A;  3T5X A;  3DPT A;  3RSN A;  1WQ2 A;  2DJI A;  1BIB A;  1IJW C;  2H6B A;  2MFZ A;  3IAM 2;  4LD5 A;  2ZXH A;  2HWV A;  3H9Q A;  2JA8 J;  2L4A A;  3TL4 X;  3U21 A;  4ETS A;  1H88 C;  2RQQ A;  3GBG A;  3ZQH A;  2DI3 A;  3W6K B;  4FQG A;  1MJA A;  1WHU A;  3I53 A;  2B7E A;  2X51 A;  1SFU A;  2X48 A;  3JRE A;  3OIQ A;  3ABM H;  1FOX A;  3H35 A;  4DYR A;  3IRQ A;  4NHJ A;  2FD5 A;  5E3O A;  5J3L A;  4TV7 A;  4OOI A;  3RYR A;  3VSK A;  2GIZ A;  1ULY A;  1X1P A;  1MNE A;  3DCF A;  2ZJ2 A;  3KP6 A;  5IYB J;  1PUF B;  5IP7 J;  2P5L C;  3VB2 A;  4D7M A;  2OF7 A;  3QOD A;  3FXK A;  4L5J A;  5EEH A;  1ZKG A;  2DFH A;  4BQO A;  1MJB A;  4XKV A;  2JTV A;  1Z3X A;  1IC8 A;  1D5Y A;  2ETH A;  4R1H A;  2MD5 A;  2CQK A;  2LTP A;  2VQG A;  4PGG A;  4NC7 A;  2VBZ A;  2Q8K A;  3K4N A;  3ZN1 A;  2Z33 A;  1O3T A;  2QGU A;  3EUH C;  5DEQ A;  2HQN A;  1L0O C;  2QZ8 A;  3DTI A;  1IDY A;  1T56 A;  2XAF A;  4XNF A;  1I5Z A;  5D5X B;  3JCU C;  3ONQ A;  4P5O A;  4A5M A;  3AAF A;  4RAZ A;  5E20 A;  2BY1 A;  1MGT A;  1W7P B;  5B66 C;  3KP2 A;  2LY1 A;  4PFP A;  1VQ9 I;  2XSJ C;  4F7Z A;  1R22 A;  5F27 A;  4BBR J;  2HQR A;  2CWE A;  1WWX A;  1Q1H A;  4KJZ A;  3PSF A;  2E1O A;  3OYL A;  3I9V 2;  3B73 A;  5FRN A;  2JUC A;  2WA0 A;  1HXD A;  1MMS A;  1KQ9 A;  1KYZ A;  3V7R A;  3F23 A;  4P55 A;  2VOP A;  2V1X A;  3RKW A;  1U2W A;  4C2T A;  1TQP A;  3EUH A;  3VSL A;  1UB9 A;  1SFX A;  2MLK A;  3K6G A;  2ZME B;  4KN7 X;  3W2V A;  3KX2 A;  2PLY A;  2IXS A;  2KQR A;  3FDY A;  3HL2 A;  4CCJ A;  3OV8 A;  1Y1V J;  1A6I A;  5HS9 A;  4ON0 A;  4IQJ A;  4XIC A;  2V79 A;  2HGC A;  4LLG F;  2ZJQ F;  3DKX A;  4PDK A;  2ZSH B;  5F0C A;  3NAU A;  2AXL A;  1YE9 A;  4FT8 A;  5HS8 A;  4I98 B;  2GOM A;  4Y17 A;  4RDU A;  2COB A;  2DOD A;  2JK3 A;  3FIW A;  3V42 A;  5JVG F;  4L9T A;  1IRX A;  2K02 A;  3U1K A;  2X4H A;  1YI2 I;  3I58 A;  1VQL I;  4BJ6 C;  1OCO H;  3HPG A;  2DFI A;  2VKV A;  1V3F A;  2W57 A;  5L3B A;  2ADU A;  2IGK A;  3ABL H;  3OYH A;  1U8B A;  1F43 A;  3WGH A;  1Y6I A;  5BNG A;  3QQA A;  1LEA A;  3G2B A;  4XKB A;  1DPU A;  3ZRG A;  4LFU A;  4AID A;  1FIA A;  1IW7 F;  4OIO F;  4PK4 A;  3WG7 H;  3DWL E;  2ELJ A;  4M3D A;  2ESN A;  1OIS A;  3J7A O;  1XGO A;  2FQ3 A;  4NC8 A;  5FKL A;  1Z67 A;  2YX4 A;  4IRI A;  5BMZ A;  4F55 A;  4G6Q A;  2VAS A;  2DA7 A;  3LFU A;  1RR7 A;  2FE3 A;  4JP0 A;  1VFC A;  3EDP A;  4BDZ A;  4G6T B;  5IT9 K;  2DOF A;  5FFX A;  3OR2 C;  3CJT B;  1E17 A;  2AXT C;  3DLL F;  5EGO B;  4G8X A;  5ICC A;  3CZ6 A;  4XKC A;  4UVC A;  4LG0 A;  3CCJ I;  2M9H A;  4HDU A;  4Z6Y A;  4E7I A;  3R61 A;  4MO7 A;  1WSU A;  4M9X A;  4HF1 A;  3OYJ A;  2G7U A;  1Y39 A;  4CZC A;  3ZQG A;  1BR4 A;  4Q5S F;  2CUZ A;  2NS0 A;  3QYF A;  3R0A A;  3FF5 A;  2M2E A;  2R7O A;  3ML6 A;  1ZR4 A;  5L3C A;  4UHT A;  5D6F A;  1Y0N A;  5LD2 C;  3PIO F;  4XRS G;  2FOW A;  3R0J A;  5IPA A;  5LFA A;  4S0H B;  1W0U A;  1H89 C;  2F5F A;  3HSF A;  5HDN A;  3C1D A;  2KP6 A;  1IUY A;  4BE2 A;  5EDN A;  4IEJ A;  2M30 A;  4NQW A;  2NVT J;  4GCV A;  1QO0 D;  3BZ6 A;  2R7W A;  1CQT A;  3LAJ A;  1GT0 C;  1YX5 A;  3LSM A;  4PSW A;  2LOO A;  1YLF A;  1MSE C;  1RI7 A;  2Y30 A;  4W1U A;  1CF7 A;  2FA5 A;  2VQH A;  2H8R A;  1LJ9 A;  4HST A;  2WY8 Q;  2XRN A;  3SHF A;  2XB0 X;  4N4N B;  3RPU D;  2CJJ A;  2XF6 A;  1G59 A;  1DDN A;  3CLO A;  4EMS A;  3DBH B;  2R7X A;  2Y2Z A;  2KIS A;  2DFF A;  3CUO A;  3ZN0 A;  1ERD A;  3WU0 A;  1X4O A;  2XDV A;  4YEJ A;  5C44 J;  1JT6 A;  2F5E A;  1FP1 D;  1D5V A;  4ZYA A;  3WHC A;  1KQ8 A;  3GWZ A;  4BAY A;  2W24 A;  1FSH A;  3FZV A;  2V7F A;  1TNT A;  4CDG A;  4RMN A;  4FTH A;  1BJZ A;  2H09 A;  5ICE A;  2KPM A;  2IPQ X;  2GBY A;  1O7F A;  1AHD P;  3SYT A;  1D0X A;  1OMI A;  1E2X A;  2MW8 A;  5DD4 A;  3HUG B;  3BR3 A;  2HVQ A;  1D0Y A;  2QYO A;  4X0G A;  4D5F A;  2LY2 A;  3ISP A;  1XG1 A;  1X3Z B;  2WC2 A;  4Q48 A;  1R71 A;  1EF4 A;  3QP5 A;  2DA3 A;  2ID6 A;  1OKR A;  5M3M J;  4KMF A;  3L2V A;  3S2H J;  1D8J A;  2LG4 A;  4RB3 C;  2A5Y B;  3O8G A;  2P0W A;  4MGR A;  3OYG A;  3S3O A;  2VB6 A;  1G4D A;  3HRM A;  2H27 A;  3JTH A;  1Z7U A;  2QEN A;  4RBO A;  5K7Z A;  2LBF A;  1R5H A;  3PQJ A;  4DGW B;  4XQF A;  4ESB A;  2JPB A;  3AG3 H;  3HOY J;  2E5N A;  2D5V A;  1ZG1 A;  4S04 A;  1YJN I;  1I1S A;  2E71 A;  4IPA A;  2MYS A;  3WGI A;  3DTK A;  3IV5 A;  1IO2 A;  2WV0 A;  2QA4 I;  5LRR A;  2W00 A;  3MZY A;  3OYF A;  3RPU A;  4A3L J;  3CMY A;  2VXD A;  5K7F A;  1XGM A;  1Z77 A;  2EB7 A;  1GLN A;  1MH4 A;  2V9P A;  1Y1W J;  3CD6 I;  1H8A C;  2B0L A;  3HOU J;  1EH6 A;  2G0E A;  4BDY A;  1A04 A;  5E3M A;  2R3S A;  4EJU A;  4ESF A;  5GPC A;  1R23 A;  2JA7 J;  4XLP F;  2R93 J;  2CRG A;  2Z9O A;  4BGD A;  5KAF C;  4ABZ A;  2M1B A;  3KIO A;  4L18 B;  2LKS A;  1TWF J;  2E36 A;  2IVM A;  2DDA A;  2HR3 A;  4PGH A;  3HXL A;  4LK1 F;  2RVC A;  3TW7 A;  5E3L A;  2M4K A;  1W36 D;  2RNJ A;  2JVH A;  2IS2 A;  1B59 A;  3M3Y J;  1RC9 A;  3IWF A;  1EA3 A;  5BPI A;  3Q0W A;  1W7P D;  3AFH A;  2O6G E;  5F0H A;  1U9N A;  2VJ4 A;  1R4M B;  4MFD A;  2DLL A;  4HG2 A;  5EZG A;  2DQR A;  2O3F A;  3KEO A;  4XOP A;  2J5O A;  4KIT B;  5JHF A;  1K7A A;  3BPV A;  4XLF A;  2E2H J;  1XDU A;  2EWN A;  4NUB A;  4B4C A;  1GV2 A;  3TDU C;  2B63 J;  1BBY A;  5JR3 A;  2LH9 A;  4UVB A;  3FXM A;  2HFH A;  2BVL A;  2CV2 A;  3WGG A;  2L54 A;  5DD8 A;  5LLQ A;  2EFO A;  4J01 A;  3K9T A;  4IRH A;  3U1D A;  3MMY B;  1Z9C A;  1STZ A;  3COA C;  2LNB A;  3N05 A;  2QWW A;  3KEY A;  1IRF A;  2TRT A;  4JX6 A;  3CCU I;  4RAG A;  2W82 A;  1HW1 A;  1I3Q J;  3I64 A;  2ZJP F;  1W36 C;  3MEX A;  3B6A A;  2RQP A;  3CES A;  1U5T B;  2ECB A;  3O3K A;  1JUM A;  1UEL B;  4P96 A;  1WJB A;  2XGE A;  4I0A A;  4L9N A;  5DM7 F;  3GZ5 A;  4LJZ F;  4EM0 B;  4G9Y A;  2F4M B;  3T8T A;  4XID A;  3TW6 A;  4F52 A;  3GW2 A;  5F64 A;  1JGS A;  2HS5 A;  1PUF A;  3QPS A;  3PUB A;  2BY0 A;  3TOA A;  1PVE A;  1P4W A;  4MLO A;  1K6Y A;  1O7L A;  4AIJ A;  2CW8 A;  3KYL A;  3OOU A;  3CC2 I;  4HYE A;  5F6F A;  4JOM A;  4GYG A;  3OYB A;  1RES A;  4M6V A;  2EPF A;  2K4B A;  2N8G A;  1X2N A;  5IT3 A;  3KPH A;  1J2X A;  3BTI A;  2ZME C;  2GQQ A;  1D1B A;  3M9A A;  2P81 A;  3D0S A;  3GFJ A;  3RQ4 A;  1EKE A;  1ETW A;  2A6H F;  2P5K A;  2LVS A;  4CGZ A;  1KYW A;  2HI3 A;  1U8R A;  1W7P A;  2EFW A;  2IT0 A;  3GUD A;  3QPH A;  4R8H A;  5J8C A;  4V2F A;  4UV8 A;  2Y9Y A;  3HOZ J;  2RV8 A;  1XC5 A;  2O8K A;  2FBK A;  3MKW B;  5DV5 A;  1ZTR A;  1LE8 B;  2HYG D;  5GAD J;  5KNL A;  2XKP A;  2NOG A;  2CS3 A;  2VJI A;  2YPR A;  4I99 C;  1MBE A;  3U9G A;  5C3E J;  1QVU A;  5KAI C;  4KFC A;  1QZE A;  3WTW C;  2M45 A;  3PUF A;  1RIO H;  2IA1 A;  4EV0 A;  3S32 A;  1P7J A;  1XCB A;  3K1N A;  2ZME A;  2IA0 A;  5GAH J;  1LVA A;  3LQR A;  1NK3 P;  1EJ9 A;  2YUS A;  5KCM A;  3CF2 A;  3V7C A;  4OAZ A;  1DU0 A;  4C2U A;  3QOE A;  4ENK A;  2W85 A;  1XMA A;  2RNG A;  4IX7 A;  4Z2Y A;  3WTV C;  2DPD A;  1U3E M;  2P4W A;  3IUO A;  4HW0 A;  2GXG A;  4B8X A;  4OIQ F;  2EIN H;  2EZI A;  3J7Z I;  1T08 B;  1KGS A;  1NH3 A;  1BC7 C;  5TRD A;  2GAU A;  1R6R A;  4BXU A;  3CCM I;  1FBQ A;  2XGC A;  2K9Q A;  2LP0 A;  2VBW A;  2LKX A;  3K4J A;  1IV8 A;  2NNY A;  3IKV A;  5CPR B;  4XR6 A;  3JAM K;  3IKT A;  1IN8 A;  1OYW A;  3F6V A;  2MG4 A;  2CGP A;  1MD0 A;  4V2G A;  2DN0 A;  5DUK A;  3GZ6 A;  2VT2 A;  1KU2 A;  3LAP A;  3I4P A;  2PX9 A;  3CDH A;  1B8I A;  1YYV A;  4E4H A;  2MGQ A;  2JQ7 A;  3GTM J;  2QQA A;  3DPU A;  2KLO A;  5EGO A;  3HHG A;  1QHH D;  5TGT A;  1XPX A;  5FD5 A;  3BG3 A;  1MZB A;  1WJE A;  2AO9 A;  2E1M C;  3HC7 A;  2C6Y A;  3TP0 A;  1SFE A;  2JZY A;  2A69 F;  3H5A A;  3UKG A;  2MAB A;  4BY1 J;  2XPV A;  4B47 A;  3JRH A;  3S2D J;  3ZP5 A;  5JVT A;  2UZK A;  2ZNZ A;  3FK7 A;  3OS0 A;  5HNF A;  1IG7 A;  3BY6 A;  3C2H A;  2VE8 A;  1KU9 A;  3V7S A;  4KNY A;  1W4M A;  3S17 J;  3M1C A;  4BL0 B;  4XLE A;  3H3V K;  1R9T J;  2OTL I;  5GAG J;  4S05 A;  2XAQ A;  3GLX A;  4E7K A;  4F92 B;  2HOE A;  4ZYH A;  2QLZ A;  3ABT A;  4CUG A;  4FE4 A;  4GFB A;  2CUE A;  1GUU A;  3GEZ A;  4UB8 C;  2EV5 A;  3GTK J;  4JX5 A;  2X1D A;  3NAR A;  1DGR M;  5E1X A;  3F9K A;  1B9M A;  3CCY A;  3ELK A;  5FKN A;  2YR2 A;  5KVR A;  4KT5 C;  3PJR A;  1YS6 A;  4D5C A;  1U9O A;  1D1C A;  2V6C A;  1DP3 A;  4A93 J;  2XRO A;  2D2W A;  2DO7 A;  3I0T A;  3OYI A;  3CDL A;  1MJ9 A;  3OIP A;  1RKT A;  1IUF A;  2DT6 A;  3DF8 A;  4EM2 A;  2M5W A;  3JRF A;  3OMY A;  5H6R A;  1VQO I;  6PAX A;  1H9T A;  5DS9 A;  1G3Y A;  2H6C A;  2EV6 A;  2GXA A;  1YW8 A;  3I3L A;  5CVV A;  3JSP A;  1P4X A;  1G6N A;  2ELK A;  2X6W A;  3KEQ A;  4PFO A;  3LSG A;  1JTX A;  2KIQ A;  3JSO A;  1I3A A;  1E3P A;  1KZH A;  3QWL A;  3HUG A;  4BKX A;  2P7C B;  4Y15 A;  1HKT A;  1IZ1 A;  3IAS 2;  4LIT A;  4B1R A;  4DJA A;  1O3R A;  2DT5 A;  1N75 A;  3PSI A;  3HSR A;  1EV7 A;  3BQY A;  3LMM A;  2LY9 A;  2ME6 A;  3C7J A;  3QPT A;  4XKW A;  3MD2 A;  3SFZ A;  4XL9 A;  2X6X A;  4EJW A;  2EFN A;  3J81 K;  3A01 B;  4M6X A;  3SJM A;  1WFX A;  2GZW A;  5K5R A;  2Z99 A;  3FBI B;  4Y52 J;  3FHZ A;  1LB2 A;  1OCZ H;  2BE5 F;  1ZH5 A;  3PL8 A;  3N4M A;  4F93 B;  2DA2 A;  2KIF A;  1MDM B;  2KJB A;  2OD5 A;  3AG2 H;  1FLI A;  2CO5 A;  4O3M A;  1JT0 A;  3PO3 J;  2BY3 A;  4BHB A;  2R7D A;  2EZH A;  4U7D A;  4E7H A;  1ON1 A;  4WXH A;  1VQ7 I;  3GME A;  3BR6 A;  5E17 F;  3UR3 C;  1ZRC A;  2Z16 A;  3ERE D;  5LHI A;  1TP4 A;  1TL8 A;  4GO1 A;  1HW5 A;  2R7Q A;  2CW0 F;  3F6O A;  5HNH A;  2IA2 A;  1OYY A;  1MMG A;  3B02 A;  3WTY C;  1BIA A;  4A12 A;  2MC4 A;  1R1T A;  2Y75 A;  3B6C A;  5K5Q A;  3SXY A;  3CP8 A;  2H1L A;  3PFI A;  3FBN B;  3DEE A;  1JJ8 C;  4HX4 A;  2ID3 A;  3S8P A;  3HG9 A;  2OV7 A; 
#chains in the Genus database with same CATH homology
 3GTQ J;  1Q1V A;  3ZQG A;  3HM5 A;  2JA6 J;  2M2E A;  2NS7 A;  1ZR4 A;  1K61 A;  1P7I A;  2M8G X;  3G1O A;  3HEF A;  4XRS G;  5IPA A;  1W0U A;  4S0H B;  1H89 C;  5M5Y J;  1ETQ A;  5EDN A;  4IEJ A;  5K7H A;  2EQR A;  2NVT J;  4BBS J;  1RET A;  1VND A;  2W48 A;  3IH3 A;  1CQT A;  2EZK A;  1GT0 C;  2DA6 A;  3GTO J;  1MSE C;  4M3F A;  4W1U A;  2Y30 A;  2XPU A;  5F04 A;  2R5Z A;  4CYC B;  3BTJ A;  2H8R A;  2XB0 X;  1JJ6 C;  2HXI A;  2DA4 A;  5EG0 B;  2CJJ A;  3HBL A;  1HDD C;  1UHS A;  3G1L A;  3O8H A;  4BY7 J;  3Q3S A;  1S7E A;  3BT9 A;  2Y2Z A;  4IHY A;  3OIO A;  4AUX A;  5IOZ A;  2ME0 A;  3BG5 A;  3HDD A;  4BXX J;  3LOC A;  1JT6 A;  2M34 A;  5C44 J;  4A3F J;  3RQI A;  1Z0X A;  1X58 A;  3WHC A;  4LOC A;  3ZQI A;  3MKL A;  2O9L A;  2LD5 A;  3LSJ A;  5EZH A;  4FTH A;  1ETY A;  1BJZ A;  4IHV A;  1HDP A;  2DMP A;  3OSF A;  1HOM A;  4A69 C;  3W6V A;  1WCM J;  4XRM A;  1BL0 A;  1ETX A;  2GBY A;  1AHD P;  2MW8 A;  3S16 J;  3BTC A;  1MBK A;  2TCT A;  3BR3 A;  2I10 A;  2NVX J;  4D5F A;  2RAE A;  1XG1 A;  3D1N I;  2Y31 A;  1ORK A;  3IH4 A;  2GM4 A;  1EF4 A;  2DA3 A;  2ID6 A;  5M3M J;  5FKO A;  1OFC X;  3S2H J;  2DA5 A;  3O8G A;  4DZP A;  2FX0 A;  1GVD A;  2WB1 N;  4RBO A;  1OJL A;  2JMW A;  5K7Z A;  2EZL A;  1WPK A;  5J1U A;  3HOY J;  1LE8 A;  2D5V A;  5GPA A;  1JKP C;  1NTC A;  2R5Y B;  1LFU P;  5JLX A;  4X6A J;  2NVQ J;  3BR2 A;  3G1M A;  3IV5 A;  1TWA J;  5C4J J;  1MBF A;  3HOX J;  1UG2 A;  4FE7 A;  2DMQ A;  4A3L J;  2FJ1 A;  3CMY A;  3CQZ J;  4M3E A;  1I6H J;  5K7F A;  1A5J A;  1Z77 A;  2XRL A;  4A3M J;  1Y1W J;  1MH4 A;  1RKW A;  2CQX A;  4FCY A;  1H8A C;  3HOU J;  3MVP A;  2G0E A;  4DW6 A;  1O4X A;  1GV5 A;  2NVY J;  5E3M A;  5GPC A;  2JA7 J;  2E2I J;  2R93 J;  2CRG A;  1TWC J;  5F08 A;  1AU7 A;  2XGD A;  2L9R A;  2WAQ N;  4ABZ A;  2VUM J;  5M5X J;  1TWF J;  1B72 B;  4FIS A;  2EH3 A;  2HQ5 A;  3BR5 A;  4MFE A;  3TW7 A;  2HDD A;  5E3L A;  3H0G J;  1TWG J;  2E19 A;  2DA1 A;  2ECC A;  4JYK A;  3M3Y J;  2X6O A;  3BTL A;  2LLK A;  3Q0W A;  5FKK A;  2YS9 A;  5F0H A;  1U9N A;  1MBH A;  5IYC J;  3ZQL A;  2XPW A;  2IAI A;  4DZJ A;  4MFD A;  3HGY A;  4XK4 A;  5EZG A;  4HNV A;  4XRS A;  1DU6 A;  5JLW A;  2ZB9 A;  2R7Z J;  4D7N A;  2E2H J;  1ETK A;  1VI0 A;  4B4C A;  1GV2 A;  2B63 J;  4C3J J;  2JN6 A;  1WH7 A;  5F0F A;  4A3K J;  2K9S A;  5E3N A;  2R5Z B;  5EF6 A;  2X9D A;  2LR8 A;  4IHW A;  4IHX A;  5FKM A;  1JKQ C;  1YRN A;  2FQ4 A;  2TRT A;  4JX6 A;  1ITY A;  1ETO A;  1G2H A;  1I3Q J;  2DJN A;  4QIW N;  1K83 J;  3B6A A;  2ECB A;  4A3J J;  3K7A J;  1JUM A;  3HB9 A;  4C3I J;  2XGE A;  2NS8 A;  5DTD A;  5IOY A;  4DYQ A;  3S1Q J;  1X2M A;  4C2M J;  4XID A;  3TW6 A;  3M4O J;  1PUF A;  3E7L A;  3QPL A;  3QPS A;  1MSF C;  2VPR A;  3PO2 J;  1SFO J;  2OPT A;  4MLO A;  5C4X J;  5HOD A;  3OOU A;  1ENH A;  2QCO A;  3DEW A;  3L1P A;  1RES A;  4M6V A;  2VI6 A;  2N8G A;  1X2N A;  4Y7N J;  5IP9 J;  4A3G J;  2K9N A;  2L7F P;  3BTI A;  1WGX A;  2CU7 A;  4A3D J;  2P81 A;  5EYR A;  3LNQ A;  1ZGW A;  2R92 J;  1ETW A;  5J1Y A;  2YU9 J;  2XSD C;  2LVS A;  3ZQF A;  2HI3 A;  2PMZ N;  1T33 A;  3FK6 A;  9ANT A;  2L0K A;  3JRD A;  2R0Q C;  3OSG A;  3IH2 A;  4V2F A;  3BR1 A;  4A3C J;  2Y9Y A;  3HOZ J;  1JGG A;  3LSP A;  1XC5 A;  2O8K A;  2E2J J;  1ZTR A;  1JTY A;  4UUT A;  3JR9 A;  1HF0 A;  1LE8 B;  4I76 A;  1FTT A;  4J19 A;  1F36 A;  2NOG A;  1VF9 A;  1MBE A;  5C3E J;  1QVU A;  3JRA A;  1AKH A;  4QTR A;  3SDG A;  3LSR A;  3GTP J;  3I4N J;  1I50 J;  1P7J A;  5GP9 A;  5M3F J;  2O7O A;  1HCR A;  3S1M J;  3ZOB A;  4AYB N;  4UUS A;  1NK3 P;  2DMN A;  2YUS A;  5F1J A;  2KDZ A;  1IGN A;  1QPI A;  3MN2 A;  1DU0 A;  1TWH J;  1MH3 A;  2H1K A;  1NK2 P;  4NDL A;  1XS9 A;  3GTG J;  4L5E A;  3A01 A;  2HXO A;  4I6Z A;  1ZQ3 P;  3S14 J;  2EZI A;  1HLV A;  4B3A A;  2CUF A;  1MBG A;  4A3I J;  1W0T A;  1MBJ A;  3HOW J;  1BA5 A;  5FJ8 J;  2XGC A;  2K9Q A;  3I4M J;  1FTZ A;  2LP0 A;  5M5W J;  5FLV A;  3ZQC A;  3RZO J;  3FKI J;  1JKO C;  2LKX A;  3WHB A;  1OCP A;  3HOV J;  1BW5 A;  1B8I B;  2LFB A;  2KT0 A;  2MG4 A;  4V2G A;  2DN0 A;  1QRY A;  4A3E J;  1JUS A;  1IJW C;  1B8I A;  3FIS A;  3TED A;  1YRN B;  2MGQ A;  2JA8 J;  3GTM J;  1H88 C;  5EGO A;  3GBG A;  3ZQH A;  1SAN A;  2AO9 A;  3BG3 A;  2Y0S N;  3TP0 A;  2X48 A;  2L7M P;  3JRE A;  3UKG A;  4G12 A;  4BY1 J;  2XPV A;  4DYR A;  2JJ7 A;  3JRH A;  3S2D J;  3JRB A;  2FD5 A;  2XB5 A;  5J3L A;  3K2A A;  5E3O A;  4M3B A;  3F0C A;  3FK7 A;  2AHQ A;  1IG7 A;  3S17 J;  3DCF A;  5IYB J;  1POG A;  1PUF B;  4X1E A;  5IP7 J;  2IEK A;  4D7M A;  2Y9Z A;  3H3V K;  2OF7 A;  1R9T J;  3JRG A;  1ZR2 A;  1ZKG A;  1IC8 A;  1D5Y A;  2LTP A;  3PM1 A;  2WV1 A;  2HOS A;  2LK2 A;  1BW6 A;  4FE4 A;  4GFB A;  2CUE A;  3S1R J;  1GUU A;  1IDY A;  1T56 A;  2HOT A;  1WI3 A;  2HYJ A;  4CYC A;  1GDT A;  2GLO A;  3GTK J;  2L7Z A;  3C2B A;  4JX5 A;  3NAR A;  4M3G A;  5EG0 A;  2DMT A;  3CCY A;  5FKN A;  5F27 A;  4BBR J;  1RPW A;  4D5C A;  4MIM A;  3TP3 A;  1U9O A;  1MNM C;  2JA5 J;  4A93 J;  2E1O A;  3CDL A;  1APL C;  1RKT A;  1IUF A;  3JRF A;  4DYC A;  5DS9 A;  3HKZ N;  3BR0 A;  1FJL A;  1AKH B;  1JUP A;  5EEA A;  5IYD J;  2ELK A;  3HGG A;  5FLM J;  1U78 A;  1IRZ A;  4UUS B;  4JX4 A;  1Y1V J;  1A6I A;  3JRI A;  1ETV A;  1JTX A;  3LSG A;  3RKQ A;  1IDZ A;  3BG9 A;  4QSH A;  1FEX A;  1TC3 C;  5J1R A;  4BKX A;  4XIC A;  1LFB A;  4B1R A;  4AC0 A;  3GTL J;  3BQY A;  3NAU A;  2LY9 A;  5F0C A;  4RDU A;  2HOA A;  2ME6 A;  3S15 J;  2DTZ A;  2COB A;  2JK3 A;  3A02 A;  3FIW A;  3A01 B;  3SJM A;  2QF7 A;  4Y52 J;  1QVT A;  1IV6 A;  2VKV A;  1UMQ A;  1U8B A;  2DA2 A;  1JKR C;  2M0C A;  1F43 A;  5BNG A;  3QQA A;  3S1N J;  2R5Y A;  1JT0 A;  3PO3 J;  2IBD A;  1FIA A;  2EZH A;  2CQQ A;  4C3H J;  4M3D A;  4W97 A;  4A3B J;  3BR6 A;  3JRC A;  3SFI A;  1OCT C;  2K40 A;  5FKL A;  3RZD J;  3A03 A;  2MSY A;  2DA7 A;  4JP0 A;  1RR7 A;  1ZK8 A;  1VFC A;  3BQZ A;  2EBI A;  3Q0U A;  5EGO B;  3B6C A;  2VKE A;  1WH5 A;  1E3O C;  5IP6 A;  3Q0V A;  2JWT A;  2M9H A;  1JJ8 C;  1FIP A;  2DMU A;  1B72 A;  2ID3 A;  4MO7 A;  4EEF G;  3VPR A;  3GTJ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...