1XDUA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with sinefungin (sfg)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RdmB
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
total genus 101
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xduA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xduA03
3RPQA 3VFZA 5E17F 4C07A 3ORHA 4DCMA 2EK5A 3QOXA 2P8JA 2AS5F 1ZARA 5EMJA 3O31A 2OD5A 2LDUA 5K0LA 2EV0A 2YXDA 4KN7X 2XAGA 1PJZA 3P71T 5HS8A 2FQ3A 1K7AA 4KFCA 3GX4X 5E2AA 3BWCA 2ZVJA 4DZRA 4YV0A 4EV0A 4OMZA 3U81A 1RUOA 2PX8A 2NNYA 2XKPA 2GS9A 1R18A 3BPVA 3NDIA 3KLNA 3GO5A 3I54A 2QY6A 2O05A 2RGVA 4AIHA 1G4DA 3OU7A 1PP8F 1L3CA 1YYVA 2ZMEB 1ZG5A 5K0GA 1AOYA 2DAOA 4M6YA 3RDIA 3ZQ7A 1RI4A 2O06A 1IRFA 2MLGA 1UHWA 1X1BA 1XXLA 3BDDA 2XAHA 2OXTA 2FHPA 2PX5A 3B3FA 4RTMA 4DM3A 1PRYA 2I9KA 2CKDA 1P4XA 2VE8A 2IJLA 1I1GA 4M72A 4AX8A 5LEJA 4YUWA 4BYYA 3KP2A 2IT0A 3V8LA 2PFBA 2NXCA 4P55A 3G73A 1U3EM 3MTIA 2RQPA 1DL5A 1RJEA 3RI4A 1BOOA 4QLCU 1S7AA 3HCFA 4JBAA 3ELUA 4EK9A 3BZ6A 2PV0A 2ZULA 3GRZA 5HIKA 1B9NA 4X60A 5DTMA 1EG2A 1QBJA 3JWHA 3A27A 4HQMA 2NP7A 1LNWA 4A2UA 2HS5A 2DT5A 2AOTB 3MZHA 1FOKA 4ER5A 4E31A 2FRHA 4GBED 3PVCA 2C6YA 5HEKA 1FLIA 3EETA 3C0KA 5FO5A 4HZFA 3ANXA 4XSZF 5EIFA 2L3DA 4GCVA 1BI3A 4FX0A 2Z5UA 2HQNA 3ISPA 2N47A 3FRIA 2BR5A 3UZUA 1MJAA 3ML6A 3BGIA 3KR0A 3QPHA 2PBIA 2IH2A 4YFNF 4M38A 4DA4A 3KQYA 2PWYA 2P6TA 3M4XA 2CSOA 3J81K 4ER3A 1NV8A 1XMKA 1KR5A 2K4JA 4A5MA 2AOUA 2AOXA 4QTUB 2FA5A 4CHUA 4PYNA 2ZWVA 4BP3A 3WGGA 4LFUA 2BGCA 4RGUA 1NW3A 2IDJA 3SSMA 2OB2A 5T67A 4IRIA 1XDSA 2I6GA 1IZ1A 2ZBRA 5B1SA 2R7DA 2VBWA 2ELHA 2QWWA 3T7RA 1HNNA 1O7FA 1L3BA 2FBIA 1ODDA 3RJPA 4G7OF 2P5LC 2ERCA 3DTNA 5GM2A 3UA4A 2P8TA 4WXHA 3LKDA 3EGEA 2XIGA 4IHSA 2E7WA 2R6ZA 2BR3A 1O9GA 2ZLBA 2VONA 3HA5A 1G3YA 5FTWA 2M87A 4HDVA 4ZYGA 4WCGA 1OR7A 1QO0D 3T5XA 3C3YA 3CCFA 2D1VA 3OU2A 1ZGJA 2YX1A 5DX0A 2QBYA 3CUOA 4BXUA 4JQFA 5LLQA 2OYRA 4BLVA 2UYCA 1G38A 2WC2A 4BLWA 1ULYA 2L01A 3QRFF 3MB5A 1JG1A 2V1XA 2BEOA 2YVLA 1ZREA 2OPBA 4FSXA 2XAFA 4XSXF 4LK0F 2B25A 1Z6TA 4ENKA 3K1NA 1S7OA 2YR0A 2STWA 2JT1A 2BM8A 2ESHA 4EJOA 2G8NA 4EVIA 3AXSA 4OIOF 1XGOA 5CVIA 1EJ6A 5F2KA 1HQCA 3MWMA 1O9HA 4RVHA 1DDNA 4QVGA 3LBYA 5JHUA 5IKMA 3FTEA 3QPTA 1NHAA 5J6XA 1B6AA 1FBQA 1HMYA 4C06A 3FM3A 4GOOD 2E1NA 2MH2A 5FD5A 4HC4A 2NXJA 2JH8A 3E5QA 1Q0SA 2P6SA 3WTYC 1JQ3A 1FNNA 4I02A 4Q4ZF 3EVFA 3RODA 2BE5F 4O29A 2CMHA 5DM2A 3KP4A 4GYIA 2AS0A 5JFRA 3H2BA 3P97A 5K0FA 3L09A 5DUIA 3LSTA 5E8GA 2VDVE 4O5VA 4KWCA 1YO5C 1FX7A 3KQQA 1K78B 3HA7A 2E5WA 3LCUA 3P7NA 9MHTA 2RNJA 3EMBA 2FMLA 1R1TA 3K69A 3V7SA 3V8VA 2EFNA 1R5HA 3TR6A 2KKOA 4YFKF 2QVOA 2VZ9A 1RUNA 5DRTA 5L3FA 5IH3A 5GM1A 5BPIA 2VT2A 3S68A 4R79A 5HLHA 3WU0A 5ICEA 3EVCA 2Z3YA 3GIWA 2IW5A 5E9QA 5LQKA 2XAJA 3DMFA 3QU3A 1WZNA 4I01A 2UYOA 1AV6A 4R8RA 4HX8A 4FT4A 1BC8C 4E32A 4XRFA 3I71A 1U5TA 4RGSA 4ER7A 2DULA 2Q0OA 3C3WA 1TQPA 2OZVA 3DXJF 3FMQA 3O2PE 5DCFA 3HTSB 5M5BA 1IW7F 5K0CA 5HDGA 1YW9A 5FWDA 2ZZMA 5EEHA 3MQ2A 1YG2A 4RX1A 5D8LB 2DI3A 3C1DA 3V7RA 1HW1A 4LK1F 3GFIA 4P7JA 3H3ZA 1LVAA 2V9VA 5DYMA 3A4TA 1U2ZA 4L9JA 2EFPA 2O03A 4YV2A 3OCJA 1LQ1A 5DSTA 3G2PA 2P7VB 5FD6A 1FBUA 3F22A 3TQNA 1LEBA 3KR2A 3U1DA 1D3YA 1S6LA 2WK1A 1G3WA 1R1VA 3F8MA 5E8JA 3THSA 3AAFA 1AQJA 4MHGA 4YFXF 4L7VA 2ZCJA 4PGGA 2XVMA 2F8LA 2QE6A 4EGZA 5EVJA 1J7KA 2H94A 5D5XB 4KN4X 4LG0B 4KDRA 5E8IA 3RW9A 1RJGA 3PLAE 3KQWA 5D6FA 4C08A 5E1DA 3TFWA 2BZGA 2JPBA 2B78A 2HZTA 3MCZA 3FYDA 5A2QK 2Y0MA 5E9JA 3RYRA 3L00A 4GOMD 2XHKA 3EQLF 1WSUA 2HKOA 2EV6A 3OOPA 1ZRFA 2XVAA 4QVKA 3FXQA 4MTEA 5ILSA 4RSRA 2FBHA 2IPQX 5HZMA 1QAMA 4G56A 2Z9OA 1WS6A 3EYYA 2ZO4A 4EM1A 1XSDA 1W5SA 5TJJA 3TDUC 5ILVA 2XYVA 3GO4A 3BT7A 3ELWA 3UJ8A 3KPYA 3RKYA 3TGNA 1U6GA 3EYIA 4HBLA 5FB2A 1IRGA 1Z1DA 2IH5A 2A3SA 4P7GA 5HFJA 3FTFA 3R61A 4K6MA 2M1BA 2BYVE 2V1UA 1HSJA 1KP9A 3WTZA 2O0YA 1N2XA 3IC7A 2PJDA 4N9HA 5C1IA 4OQDA 3TDZC 4KIGA 2W57A 3DLCA 4OIRF 5DX1A 4TV7A 4A0XA 1X1DA 4F86A 1J9IA 3DXZA 5FLXK 4AZSA 4OBWA 1KPGA 2NNWB 2NP6A 1SD4A 2ZBQA 1W7PB 4RTNA 1IAWA 5HS9A 2JHPA 5DD8A 2EWNA 3LDFA 5K01A 1XCJA 3K9TA 4FR0A 4UXNA 4ATNA 3VC2A 1DUSA 1E17A 2KW5A 2I62A 3CJNA 4IF4A 3AWIA 1ZHFA 2ZZKA 5LSAA 3E97A 3W6KB 3MERA 3GUDA 5LQAA 5D4RA 3GJYA 4DF3A 4MQVA 3B73A 2FNAA 3DV8A 1G8AA 2QRVA 1U5TC 3HSFA 2MH9A 3Q9SA 5CM2Z 3NVMB 5A2QZ 1GXPA 2F2EA 3EDPA 2PKWA 1ZQ9A 2RDPA 4XUCA 5BW5A 3DEUA 2YTZA 2FMYA 5GWXA 4CZZA 2P35A 3L2CA 1OKRA 2UXXA 5FULA 1ZGAA 4OA5A 1MKMA 3ELDA 5DWQA 2GLUA 2ZSUA 4WX9A 2JSCA 2XRNA 5E2BA 2GA9A 2HTSA 2A6HF 4PCQA 3E7PA 4KIFA 3RKXA 1YS7A 1MJ9A 2RVCA 2IGTA 4MWZA 1M6EX 1SMTA 2D2WA 3EVZA 5HOQA 4I7HA 4RS8A 1S3JA 3CO7C 1JQEA 1BM9A 2VDUE 2V6CA 4Q48A 3R9XB 4ZZDA 3HVKA 3PFIA 1B1BA 2JJQA 1OYIA 4ETSA 2NXNA 1MZBA 5FCDA 1H1DA 1G55A 1PUEE 3QV2A 1Z6RA 5FGMA 5DM0A 1R36A 1VTNC 2GXBA 1RI5A 4Q47A 2A5YB 3UJ9A 5E1WA 3F8BA 4RB2C 3DOUA 3CJTA 2P5VA 1T38A 3I59B 4FS8A 5FLXZ 1FPQA 2M5WA 4YUVA 3DP7A 2OKCA 5H20A 1JG4A 5LEKA 2HTJA 2OBFA 5DXAA 2OA4A 1FBSA 4HX4A 3SXYA 1NW6A 2HYGD 2OO3A 5F2OA 2HNKA 1SQFA 2IP2A 3KCCA 3LDGA 3KHKA 4UV9A 3WG9A 4E70A 2HOEA 3DPLC 2PN6A 2HR1A 4AIKA 4O6JA 2K27A 2PXAA 3AXTA 1HW2A 3OFJA 5E1MA 4ZYEA 5E1OA 3BGVA 2BM9A 4FX4A 3VYWA 1WWXA 2WV0A 3HM2A 5EZSA 3IHTA 3ZMDA 5FFZA 1JGSA 1Z91A 3DF8A 1MJFA 3TOBA 4C05A 1Z7UA 3E6MA 2VE9A 3ELYA 4DQ2A 3KP6A 1ORHA 4LLGF 2AOWA 4U0YA 1QQIA 1LDJA 2A6EF 3JTHA 1H9TA 1ZH5A 1B59A 1OMIA 4HTFA 3VODA 1FYKA 1PDNC 4C04A 4HF1A 5ICCA 2AOVA 3BWYA 5FA8A 3HRTA 3T1BA 2G9WA 5K05A 1RNLA 3F3XA 4L18B 4RVGA 5JUWA 1XDZA 3M8EA 2DFIA 3LL7A 4N9IA 2H09A 4YIIA 3M8FA 2XYQA 1TBXA 1IXCA 5GINE 3B3GA 3EVGA 5EEGA 5DXJA 3Q5FA 4MQ4A 5EG5A 1X1CA 3MHTA 2FOKA 5HLIA 4RVDA 4OMYA 2V74B 1XJ5A 5D5UB 5GIPE 4IPAA 3W6JB 4RGXA 1D5VA 4CDGA 3P2IA 3F23A 3LCCA 5K0EA 3KKZA 3BOQA 1WQ2A 1T39A 1Q1HA 1MGTA 3COAC 3UJAA 3SHFA 5DDGA 1O3QA 1G6NA 1Z05A 3M1EA 3TPZA 2VDWA 1TPYA 4GEKA 3HOTA 1BI0A 3E5XA 2STTA 3M7GA 3T8RA 5JVTA 2YU3A 1DPRA 1XCLA 4R6XA 2K4BA 1U2WA 3HCEA 1D8JA 4ER0A 4OBXA 3G8BA 3O4FA 1KPIA 1O3SA 3GXOA 3EUHA 2D45A 1XVAA 1N7IA 2FRXA 2Y1WA 2ZBPA 2QM3A 3M70A 1X19A 3P9KA 1QANA 2Z6UA 1EH8A 2O6GE 5FQOA 3HOSA 2ONYA 2LF8A 3I5UA 3BJAA 1IM8A 2AOUB 4IV0A 1R5GA 4M74A 4GC5A 4XBFA 3R60A 3LFKA 3HEMA 1KYWA 1IN4A 2HGCA 3JW4A 5GP1A 4AZVA 3RYPA 1TTYA 1K6OA 3IWZA 2ISZA 2E7XA 4L0ZB 2GA2A 3F6OA 4IXAA 2X4HA 3G5LA 2IBTA 1YW7A 4R6WA 2RN7A 4GUAA 4DCGA 2DK8A 2ZNYA 5L3GA 5KK1A 3TOAA 1LJ9A 3RKWA 3WODF 3P2EA 2O57A 4XUDA 2BR4A 4HG2A 5T64A 4YUYA 4WF2A 4BNCA 1UHMA 3BKXA 2B2CA 3DFGA 3FZVA 4G9YA 3KQTA 1ON2A 4YUZA 4ESBA 1IXRC 3SR4A 1OYYA 4GOND 4M9XA 2BH2A 4Q5SF 5HOOA 1L0OC 2H27A 1VE3A 5FUBA 3U9GA 1HKQA 4HRAA 3LQRA 3ZN1A 1DUXC 5D1NA 2QUFA 3KPUA 2E1CA 2ZTHA 3L8DA 4RAZA 2QBYB 3TO6A 4ZYHA 1BOAA 3RIRA 3IEIA 1REPC 3CUQA 3G88A 4G8XA 2EG5A 2C7OA 2PLWA 5K8VA 5K0NA 4EGYA 2ETHA 1QAQA 2TDXA 4FT8A 3OE4A 2FE3A 2LNBA 3M9AA 2AVDA 2R7FA 4Y15A 3P8ZA 2PXXA 2GAUA 3FTCA 2NS0A 4G7ZF 2Z6AA 3OV8A 2IRFG 1ZLJA 1H0MA 3ER9A 3AJDA 3IHUA 3KPWA 2HDCA 2O8XA 4KMUX 3ELKA 2QYOA 1TNTA 4P58A 4L5JA 4IJAA 4IRHA 3F4KA 4RTLA 1BIBA 3BJ6A 1KU3A 4ZYDA 3E6BA 3PS9A 4A0YA 2IIPA 4GYGA 3LCVB 3FUXA 3GRVA 3LDUA 3GRRA 1JHFA 3BP8A 2IA0A 1AQIA 2L54A 3PX3A 3CJRA 4Y30A 1QPMA 1SD7A 3ZMSA 2XVCA 1KGSA 4CGZA 2CMGA 3SXJA 4HGZA 1KU2A 4HLYA 4I0AA 2G71A 4YV1A 4IRGA 4HF0A 4MEYF 1P2FA 3T7SA 4RGRA 2F5CA 2WWYA 1ZAOA 1X3UA 3P9CA 4R8SA 1BI1A 4X41A 4PINA 5EHGA 2R3SA 2VBZA 5F64A 2FU4A 4NB5A 3EEYA 3X0DA 1IXKA 3GZ6A 4DMGA 1F1ZA 4KA4A 3G89A 5D1HA 4HDUA 3GFJA 4U0WA 4LWPA 1JG2A 5DTRA 2OB1A 4XCXA 3V8JA 2NAZA 3WTTC 4HV6A 3G3ZA 4HX7A 5KVAA 4M73A 2G1PA 2DU9A 2YQZA 4LECA 4KVZA 1EH6A 5LQNA 4A0ZA 4FSDA 2ESRA 1W5TA 3TO9A 2P3LA 3KETA 5BOXA 2VOPA 5LRRA 3B3JA 3J80K 1MD0A 4GO1A 2RC4A 2XYRA 1ZG3A 3GU3A 4UOEA 1G3TA 1SAXA 3SGLA 1U5TB 3SSOA 1VPTA 5CVRA 1XN7A 4HV5A 1BN5A 2Q2EA 4WVLA 1P91A 3TRKA 2HKXA 2CYYA 4PNEA 3IKVA 3TM4A 3KP5A 4O3MA 4PCLA 2VC1A 4FGZA 3F8NA 2UZKA 2P7CB 5ILUA 5D4SA 3KU1A 3QP6A 2FCAA 5LGUA 5H6QA 3R0JA 2J5PA 4CICA 4EJTA 3C6MA 3UWPA 4E30A 3UA3A 1I6XA 3SFZA 4CTKA 1XCBA 1JQDA 1JTEA 1UWVA 3G5TA 3KEQA 3WSTA 3FTDA 2C7RA 4U7PB 3TM5A 5IT3A 4XLPF 4PYQA 5ICFA 4GF5A 4E2WA 1CGPA 4NECA 1F38A 3OPNA 3CUQC 4RWZA 3M6XA 3R4KA 1TQIA 4BHPA 2EJUA 1VBFA 3SZPA 2Q41A 4LLLA 4PONA 2A68F 2QQ9A 1HBXG 2DLLA 3A7EA 4OIPF 5C9ZA 1W4MA 1YTYA 3JWIA 3KQMA 4MTDA 2AN4A 4BY9E 1Q0TA 3UJCA 1FSHA 2X0LA 3FMRA 2JHCA 3VOEA 4JK1X 4OINF 3J80Z 2NYUA 1LDKB 4OA8A 2ZBKA 3CO6C 3ZPLA 3SMQA 1FT9A 4ZTBA 4L9NA 4PCAA 4OOIA 4RAYA 1I5ZA 2YPRA 3FZGA 3FPJA 2A69F 3QP5A 1F3LA 2H6CA 2K86A 4M37A 4EMSA 4B8XA 2UZ4A 4RTSA 4PYLA 3F21A 1LDDA 5H6RA 2PJPA 4IKPA 1U78A 2I7CA 2P1DA 3PB3A 4U7TB 1WG8A 1XSXA 4FP9A 4XUEA 3EGVA 5E18F 2CWWA 3F72A 2ZWAA 2CW0F 4ZH4F 4HW0A 3FPFA 3RIEA 3FF5A 4X1OA 1BIAA 2FPOA 3VB2A 2NXEA 3Q87B 1SG9A 3E23A 5CVDA 3UBTA 1SD6A 3CGGA 3MCTA 1BBYA 1EAMA 5L3CA 1KYZA 1SFEA 3JTGA 3HTUA 4Z2YA 1HKSA 1R74A 2PBFA 4BHBA 4LJZF 2AZTA 1WY7A 3JAMK 3HIFA 3RTRA 2YSRA 3FUUA 1R22A 5BMZA 3HYIA 1XTPA 1XMAA 3FXRA 4E2YA 5F6FA 4N0BA 1XGSA 2QRVB 1GHCA 4QWQA 1G60A 3LBFA 3HCDA 2MBFA 3WTVC 2PSSA 3UJ7A 3IL2A 3THRA 3T8TA 1XGNA 1NBHA 4H0EA 3K2ZA 1KXZA 4KYWA 1MJBA 3CVOA 4MHTA 4KDPA 3ZMVA 2IPXA 3E5UA 4B17A 2LSOA 3LQQA 4UVAA 3BWMA 5L3EA 1U8RA 5HIJA 2GA1A 1F9NA 3MAJA 4EJVA 3HCCA 4RVFA 3I64A 3GFMA 2VN2A 3UJBA 2FNPA 1HSTA 1R1UA 1DP7P 3TKAA 5EMKA 4YUXA 1L9KA 1NW5A 2K4MA 3MFKA 2PQ8A 5DTQA 5T6BA 3FYCA 5KS2A 1VP3A 5HLGA 1I4WA 3BWBA 1AWCA 4CXMA 5DV5A 5LHHA 3U2RA 3DR5A 1XGMA 3HCBA 3K1PA 2K02A 5GIOE 2QQAA 2ZIGA 4U7BA 3H3UA 4R05A 4I98B 2CWEA 1VLMA 2VC0A 4P5OA 3LKZA 3ROUA 2DTRA 3WTXC 2P7IA 2ZIEA 5EC8A 1Z9CA 3NQOA 2KRFA 3QOPA 5EOVA 5KVRA 2FF4A 2MLKA 5KYGA 3EPPA 2VODA 3ZMUA 2WA2A 3R0QA 2IVMA 2P5KA 2ZXJA 2LF7A 3DMGA 3HRUA 3PX2A 1YW8A 4L5IA 2O0LA 3LA7A 3JAMZ 1BKYA 2XKOA 2GB4A 3HSRA 1J2XA 1ZYRF 2PT6A 3LA2A 2ZNZA 4IHTA 2FYTA 5CYVA 1ZLKA 5LQRA 1CF7A 2MD5A 3KP7A 3PTAA 4I09A 5BP7A 5EZQA 3J7AO 2XASA 3E3VA 4CO8A 1P4AA 5ERIA 2P3QA 1JXSA 2ACJA 1FP1D 3D2LA 1VIDA 4LG1A 1YS6A 2UWMA 2FK7A 5L3DA 2NRAC 5LGTA 3FPEA 3VSEA 3GYHX 1G8SA 2HTEA 3BY6A 5DCMA 3M6UA 5D5VB 5AIPA 4GXOA 2G7HA 1FWZA 4HTFB 5FFXA 1FY7A 5FHRA 2GQQA 5LBQA 1RI2A 5DEQA 4QPNA 5MHTA 1KHHA 4RV9A 1E2XA 1UFMA 2FEZA 2P7HA 4Y2HA 5ED4A 3CJQA 3I4PA 1NT2A 1SQGA 3MZYA 2CL5A 3E6DA 4A12A 2PWPA 2W84A 4UHTA 3OU6A 1FP2A 4ENNA 3KFWX 4P9UA 3EEOA 3MGGA 3NDJA 7MHTA 3KP3A 3M6VA 4BH9A 3C18A 1STZA 1YZ3A 4IVNA 1RI1A 5K1YA 2KJCA 2JRTA 4BQAA 4GOLD 1J0RA 3ZP5A 3JWGA 3BJOA 4LB6B 5CLSA 2BBYA 2EA4A 3C3PA 1RIOH 3IKTA 2JH9A 2PX2A 1TW2A 3GWZA 3KZZA 5JR3A 4LGWA 2XROA 3GLXA 1P39A 4A6DA 3F8CA 1AF7A 4S05A 4UVCA 2VS1A 3A25A 4RTKA 3KQPA 4R8HA 1MDMA 1INLA 4A6EA 4M9ZA 3GZ5A 1KU7A 3HRSA 3IYLW 5CUQA 4CWAA 5K0BA 1IN7A 4HA8A 4A5NA 5FQNA 3P2KA 1SVUA 2GXGA 2OU2A 10MHA 3DPTA 3ULQB 3Q9VA 3BKWA 3HVHA 4LMYA 3CC8A 5CIYA 4PWYA 1NKVA 1XDUA 3K0BA 1BJAA 2HR3A 2QZ8A 2WTEA 2HMYB 1SKMA 3ER8A 3DUWA 3HVIA 3V97A 5LRSA 3DMHA 4U7DA 1L3LA 2CGPA 4L9TA 1I9GA 4HF2A 4ASNA 5EMMA 4KMFA 2NYXA 3BROA 2P41A 4PYMA 4QPPA 8MHTA 4I0BA 5K5OA 1QAOA 2Y75A 1P1CA 2EX4A 3UJ6A 3LAJA 2B0LA 2W24A 2ADMA 4EJWA 3GF2A 1O3TA 3V4GA 5K5QA 3GFLA 2GAFA 1YFHA 2ZKZA 2JTVA 5DM1A 3DXYA 1P1BA 5KQRA 5LGNA 3OFKA 1O54A 2P40A 4EKIA 4PIPA 3V7CA 1RI3A 5FA5A 2ZFUA 2RKHA 3OE5A 3ID6C 2G70A 3K1MA 3EVBA 3HP7A 3WGIA 1JR4A 1IN5A 2VBYA 5EQJB 3CUQB 4RTPA 2HWKA 2OAZA 3R6SA 1NW8A 2ZMEA 2H6BA 5K5RA 1GXQA 2UYQA 2OZUA 4PDKA 3HVJA 3WTWC 2KIUA 4UNOA 1D8KA 4YIFA 4KT5C 3M33A 3BPXA 3SQNA 1I1SA 3FUVA 5EIWA 1RJDA 1T2KA 1JE8A 1T0FA 2L4MA 5LR6A 2HYFA 1ZKDA 2B9EA 5E1BA 3FMSA 3TO7A 4H0NA 2PVCA 2YX7A 4MQ9F 2B3TA 1BC7C 1M0EA 3AY0A 4OX9Y 1R00A 4OU0A 5CJ9A 1EH7A 3FM5A 3LECA 5LQJA 3PT9A 3MQ0A 1RI7A 5CVJA 5AIQA 4P7KA 4GC9A 4CTJA 3SSNA 1KQ0A 1HXDA 1D2GA 5DD4A 2HV9A 1QGPA 1ZG1A 1ON1A 3LAPA 2CFXA 5LQCA 3K0LA 2PGXA 5FHQA 4QQKA 4F85A 4LLNA 4MGRA 2QLZA 1TQMA 5E1ZB 4MTLA 1YFLA 4EJUA 5JI6A 2PXCA 1IN8A 2DQLA 3SVZA 2AOTA 1PP7U 3KQVA 2HQRA 4MIKA 2ADUA 5GOZA 5HIMA 3CBGA 3JWJA 2ORED 5D5WB 1SUSA 1QNTA 2D1HA 3GVAA 1OYWA 3WGHA 1F4KA 1UFKA 4PZJA 2PY6A 2PI0A 4PYJA 3KR9A 1WXXA 3NTVA 5TRDA 3WTSC 1BC5A 4I2OA 2EFQA 2L4AA 5K03A 2GZWA 3M6WA 2OQGA 4P7FA 1S29A 2CG4A 4ENMA 1Y8CA 3LX6A 5F2NA 1R23A 4AUKA 4KRGA 1D2HA 4G6DA 3JSOA 2DQRA 2G7UA 3GNLA 3N97A 2M8EA 2PEXA 2YX4A 3FUWA 5CVEA 4KNYA 1P92A 1USTA 1LEAA 3IV6A 5BXYA 2W25A 3G2OA 5CVUA 4DQ0A 2V7EA 4MEXF 4NHJA 4RB0A 1B42A 5E9WA 1A04A 2V79A 5LHGA 1NE2A 5DSXA 2MC3A 4FHTA 3D0SA 1O7LA 1EIZA 3E05A 3G2QA 3ERCA 3K6RA 3REOA 1Y0UA 3L9FA 2OY0A 4QDKA 1J59A 5LQUA 1IN6A 1R8XA 1T43A 3TOSA 3QAHA 4X63A 1ZRCA 1BI2A 4FT2A 2J5OA 1T6SA 3OZSA 4BP1A 3EGIA 1L3IA 3R6TA 2RV8A 3KPVA 3J81Z 1F5TA 1IXSB 1SD5A 1J5YA 3TKYA 1FYMA 1DCTA 5E20A 1JTFA 5EHIA 3FXUA 2GPYA 1KQ9A 2FXAA 3NRVA 1N7JA 4PYIA 1FJXA 5AONA 5HVQC 3MAGA 2AVNA 2AN5A 3SM3A 4EQQA 1YUBA 1R58A 1WXWA 1FSEA 4CXFA 4HQEA 4WK8F 2UYHA 4D0PA 1C0WA 2VBXA 3I53A 3GRUA 1YQAA 2AR0A 4UVBA 5HILA 1K79A 5HS7A 2F5DA 3LGAA 1ZRDA 1R6AA 3RPUA 4B09A 1TW3A 3KQOA 3F6VA 3LWFA 2PLYA 4M9SA 4ER6A 1SUIA 1DPUA 4L0YB 3GCZA 2EB7A 3JSPA 2IH4A 1JSXA 4LWOA 4OQEA 3NWEA 3QU6A 2K7LA 4YMHA 3NJRA 3O3KA 2VP3A 4C03A 2KIMA 2CQKA 4RTOA 5C0OE 5L3BA 1FYLA 5DT2A 1IUYA 5HDNA 1YB2A 2DBBA 2W85A 4PYOA 4ESFA 3BXOA 1HKTA 4CYDA 4LD5A 4ESJA 1TNSA 2L02A 4CKEA 4PIMA 1YIOA 3ABTA 3CKKA 5E8RA 3PQJA 4KDCA 1UB9A 2G72A 1R7JA 4M7RA 2EFJA 3CLOA 1MHTA 4P9FA 3KZYA 3HCAA 1W7PD 5DM4A 5HDKA 4RYLA 2IA1A 1K78A 3F8FA 1QYRA 4RTQA 1S8NA 2EV5A 5CCBA 2XBMA 4QQNA 2GIVA 3E6CC 4KICA 5LHIA 2O61A 1NV9A 3DH0A 3KPJA 4HGYA 4V0RA 2M30A 1SFUA 5KQSA 2Z99A 3HNRA 1XSVA 2GWRA 2OZ6A 2MA3A 2Y48A 3B7PA 3R3HA 2XUBA 3CTAA 3MEXA 3ZMZA 3A7DA 5BPDA 4R1HA 3LPMA 4X61A 2H1RA 4EM0B 5DRYA 5FWAA 3UFBA 1QZZA 2ISYA 2IA2A 2IFTA 2JG3A 2FSWA 4WWCA 1FBNA 3ECHA 1OPCA 4U88A 1XB4A 3NMUF 1EJ0A 2HWVA 4RB1A 2A07F 3I9FA 4E2ZA 2KJBA 3WE2A 5CD1A 2OBPA 3T0YA 4EM2A 1WKMA 2F5FA 2QQBA 3SZTA 3N4MA 2YR2A 4AD9A 3GGDA 1P4WA 2WA1A 1ONVA 4AWXB 1NBIA 1T98A 5DX8A 4K2EA 4BHCA 5U4XA 5E1XA 2DPUA 2Y1XA 2ZFWA 4Y13A 3DKWA 4BLUA 3HA3A 3IWFA 5IT9K 3B5IA 3P9NA 3T7TA 4Y17A 3GRYA 1BHJA 5ICGA 2EFWA 1XCVA 3I58A 4YG2F 4F7ZA 2ZZNA 5DPMA 1KIAA 1FZPB 5CCXA 3ZN0A 3R0AA 5G02A 5K09A 4KIBA 3WU1B 2VXZA 4L9VA 5K0JA 2DO7A 3EVEA 3SX0A 1V4RA 4C4AA 4RTJA 1NW7A 3NVKI 5D8KB 3GDHA 2VT3A 2KIFA 2YUIA 3VC1A 4HYEA 4DNCA 1J75A 1VP9A 1FC3A 3EMDA 2XGXA 4GQBA 4LG0A 1I1NA 3HHHA 2JPCA 1QZYA 3EVAA 4QDJA 3UJDA 3KQSA 4ENJA 1UCRA 3CDHA 2Q8KA 1OR8A 1YLFA 4IWNA 2YXLA 4RTRA 4CKCA 2PG4A 1V39A 3KE2A 3FPHA 1RJFA 2H00A 4EKGA 3NWBA 3WTUC 3GEZA 3BUSA 2P4WA 1JSZA 2DW4A 3ZMTA 3C7JA 4G94A 2EA2A 1D2CA 2H11A 3D5LA 3BGDA 4F84A 4NQWA 1IY9A 3Q7EA 1O3RA 2C7PA 5BQTA 4HH4A 2JHAA 5EKXA 1VQ1A 5BW4A 1XD7A 2A61A 3KR1A 1X1AA 2ZIFA 1CF7B 2UXNA 2ZW9A 4HAMA 4HSGA 1R8YA 1Z3CA 2PMUA 1H9GA 4XLNF 1SFXA 1V3FA 3NEUA 1G6Q1 2EFOA 4HOBA 2EJTA 2PMHA 2JZYA 3ME5A 1JG3A 2IBSA 3G8AA 2QENA 3FX3A 4EQZA 3FUTA 1IF1A 2YXEA 4YMGA 4IV8A 4UV8A 5IT9Z 2LD4A 4P96A 2GH1A 3R24A 3BZBA 2P3OA 3O7WA 3BWGA 3PFHA 2FBKA 5DCMB 3TLJA 1WRJA 4HLXA 1W7PA 2AXLA 5FADA 1GVJA 1YFJA 2ESNA 4G7HF 3LHDA 3FWEA 1KQ8A 4JXJA 2DPMA 4PYKA 1EV7A 2Z33A 3H92A 2OQRA 5ERGB 2DK5A 4PGHA 5H02A 4FZVA 1VL5A 3T0IA 3KEOA 5EPEA 1LB2A 1EQAA 2FK8A 2EJRA 5BS6A 2HFHA 2IDKA 3KLOA 3DQVC 3DULA 2DPDA 3PQKA 1USSA 1JHHA 2AN3A 3DXXA 2HEOA 5DLYA 4RB3C 3MTEA 1YF3A 2O3FA 5D6EA 2V1DA 4M71A 5P8WA 2F5EA 1KPHA 5EGSA 3P9IA 4OIQF 2ZCWA 4G6QA 5CVVA 4ON0A 3EVDA 4AZTA 4AZWA 2COMA 5J8CA 4E2XA 4QTTB 1B9MA 3A26A 2LKPA 1M6YA 3GW2A 2XAQA 2O07A 2PX4A 3S2WA 3HTXA 5J8FA 3O6BB 2ZJ2A 2NNNA 5F1RA 1HW5A 4LB5A 2XV4S 3HSEA 3B89A 4KW7A 1KU9A 1KA8A 1I27A 3B02A 2CO5A 2M45A 2Z6QA 3V8KA 1G3SA 1MDMB 3TQSA 4AVPA 3HRMA 4POOA 3ERED 1ORIA 3OZTA 2ONZA 5DUKA 4ZZLA 1RZ4A 4S04A 3FPGA 3NW9A 2C7QA 3QOWA 5HIIA 3HUGA 6PAXA 4M36A 3C6KA 4BAYA 3WE3A 3L7WA 4GGGA 4UUVA 3I0TA 3HHGA 3LA3A 3IRQA 3TMAA 2BV6A 4WXCA 3FRHA 3G2MA 4WXDA 3G7UA 3ABUA 3I59A 5EMLA 4MNUA 4ISCA 4E33A 3DLIA 1WI9A 4KUMA 4DKJA 4U0VA 3VEPA 4CKBA 4AIJA 2VOOA 1ZN2A 1B4AA 3ECOA 5EKUA 4V0QA 3FHZA 1UIRA 1YZHA 1L1EA 1P6RA 2PT9A 1TLHB 2A14A 1O57A 3IRRA 3OZRA 3E8SA 1SMYF 4M6XA 3PFGA
chains in the Genus database with same CATH superfamily
2ZB2A 3X1WA 2I8DA 4RMNA 2P8JA 2AMLA 3L92A 5EMJA 3M0EA 2OD5A 3R0ZA 4A3BJ 2J3LA 1R88A 1VOTA 1WHTA 3NOQA 3P71T 4FHDA 1U9YA 2CUTA 3L93A 2I4TA 5E2AA 2FFJA 1ODCA 3AEXA 3VZRA 1BRMA 5CFQA 3U81A 4XRGA 1UK8A 4JUIA 2GHTA 4XWYA 4G5SA 3SNKA 3A58B 4CEHA 5DHQA 4Z54A 4LVUA 2JH3A 2ATEA 1IHOA 2PANA 4R9NA 1XJQA 2GZMA 2R5ZB 1DFGA 2BFEA 1UPCA 4M6YA 3ZQ7A 1T5DX 3AG2H 3ZHYA 4ABZA 2IUUA 1BE1A 2PL1A 1Q44A 1YBFA 3ZCSA 5ENDA 1XXLA 4UVHA 1PR3A 3RVJA 4MGZR 1R0XA 3IMKA 4BC1A 2C54A 5D5HA 2FGJA 4HV4A 4BE1A 3EXHC 3IPRA 4ZZ1A 1RQLA 4E7KA 2Q7XA 3L2VA 1P2BA 3RI4A 2OMEA 4B87A 3GVIA 5M5WJ 2H4YA 5FI0B 5B1YA 4EK9A 1IJFA 1Q5PA 1OGIA 4L8FA 5AOVA 1EG2A 3UT6A 4KYIB 1PL7A 2WIKA 3U60B 3LD9A 3ZHUA 2BZSA 4E2FA 1UIMA 2RC6A 4ZEWA 1E3TA 2VJ5A 1WPXA 4Y2JA 5K7SA 4B7ZA 1L1QA 1F9EA 2PBIA 3OFNA 4WY8A 1NV8A 2K4JA 3VU9B 4XIYA 4B3JA 2NSJA 3JQAB 4D0SA 1SC4A 3SSMA 1MAHA 3VNVA 1G7TA 1JJAA 3VI3B 4ZFNA 1Q92A 2IELA 3EW9A 1ZJWA 4GR4A 4JB8A 4IHSA 4H7HA 1EWYA 2BELA 1O9GA 2OGSA 3AF5A 1OR7A 1QO0D 4IMJB 1PR9A 3CEAA 1OLXA 4BXUA 1MNQA 4CR7A 1QQ5A 4WN3A 1MGOA 3SQXA 1AGXA 1RWKA 4QPZA 4H9GA 1EYZA 2STWA 4EWLA 2JFUA 3S4YA 4OIOF 3W7VA 4CM4A 4DMRA 2D74A 4NG5A 2XADA 4D41A 3H8JA 3DMNA 1JLLA 3ABOB 2WU0A 2E1NA 2MH2A 1U90A 4LDJA 3DHYA 1ZTRA 1VQ6I 4DEYA 1CB7A 2PLFA 4WN9B 4O5VA 1P31A 1TWFJ 2J1LA 2L82A 3ASNH 5JZOA 3FMOB 1E2UA 4HMOA 5T4EA 4HDQB 1S3SA 4E5UA 1J4AA 2WNIA 3MFYA 3LQKA 3IGFA 2PEZA 3DMFA 5JAZA 1FTTA 3DOJA 4YJFB 2BEUA 3TOCA 1SBIA 2P4HX 3TVDA 1X94A 2QZZA 3WZMA 5LA6A 3C3WA 3V2HA 4DA7A 3O2PE 1FP4B 3DOIA 3R3WA 1YW9A 2PN1A 2I4IA 2JD0A 1WV1A 4KGVA 1NLZA 4CG1A 4OI2A 1NF9A 3F22A 3K0EA 1S6LA 1R1VA 1OYVA 3HKEB 1HTTA 3WLLA 5CFNA 1ULSA 4KQEA 3DDHA 3UPUA 2UZ1B 2H94A 5D5XB 9ANTA 3LWBA 5IN4A 1OSNA 2Q6IA 3OPMA 5A2QK 3QVXA 2XMCA 2C97A 4N8SA 2XHKA 3CCRI 4G56A 3M89A 2IEAA 3T9EA 3FVWA 5ILVA 1J2YA 1T2CA 4HSEA 1AXEA 3V8RA 3T3MB 4GX2A 4DRXA 1IDOA 3ZTTA 4DCUA 3AFMA 2M1BA 3SIWA 1X4PA 2QKYA 4XIIA 3ZZNA 4KWIA 4EKEA 2XPVA 3C14C 2CBZA 2IW3A 1MX5A 2DH6A 4C0WA 3UIEA 2AFHB 2ISCA 2Z58A 4WZBB 1NX6A 2LP4Y 4OSOA 1A9ZA 3MKLA 4YQEA 3E81A 1XZPA 2FRVA 1A7KA 3JVDA 4ZDJA 3GWGA 2DA7A 2H2IA 3R7LA 2X1DA 5FUMA 2G0NA 4ZTZB 1I7SB 2I65A 4E4RA 3DV8A 3UC5A 4A69C 3DEAA 3ZZ0A 4J4BA 2F2EA 5DVZA 1M2VA 1IVSA 4TMFA 4JJGA 4A91A 3T3EA 3GK3A 3HP1A 3ZS9A 1KETA 1I4TD 3NYIA 3ZTYA 4Q4HA 2HHAA 4YGXB 1U2DC 3FGPA 3RD5A 1I6LA 4RMHA 3FBNB 1E58A 4HLUA 2QM7A 3I39X 1KMNA 3ZE7A 3KHTA 2PRIA 4YRFA 1T2FA 1Z6RA 3A6EA 4C6TB 1E1CB 4WI1A 1N1GA 3PGJA 3DOUA 4P2BA 3LBNA 2P5VA 1T38A 4Y0AA 3GPIA 2HA2A 2OKCA 3ZDAA 3QMWA 1CPYA 4W5JA 4P38A 2VP0A 2DAPA 3E3LA 2DPXA 1NW6A 5IVIA 1Z33A 5FBZA 4O4IB 4K2HA 3PL8A 2PN6A 4RCZA 4ARIA 2QU7A 5L3SA 2FWMX 3E1SA 4B3FX 3DD1A 3EGDB 4N6NA 4KOAA 2O2XA 5A5EA 3ZC3A 1VPWA 1E7QA 2F62A 2FJUA 1CERA 4FQ7A 4D7NA 2ZUTA 1AURA 3I4FA 3FISA 1H1LB 5G3ZA 3B48A 1ZL2A 2C3YA 1JHPA 1G5TA 2VP9A 2G9WA 1WJBA 1Z8HA 1N3BA 2LCFA 3V4RA 2ON6A 5JAMA 1IXCA 5GINE 5JS2A 1G20B 1GLGA 3B1YA 3NALA 4RGXA 3ILXA 1SOAA 1T39A 1G6NA 1TPYA 3PEYA 2QV0A 1YZFA 4RHTA 2FRDC 2Q4OA 3WIEA 5JRJA 1BWPA 1QCDA 1KOLA 3TRIA 5FLYA 1UT6A 1R50A 2YV4A 2RGCA 3I9NA 4MS1A 4FFWA 4C3VA 4OB6A 2R86A 3RUCA 3I2IA 3WLRA 2AOUB 1NG7A 2REQA 2GPJA 3JW4A 1GCUA 1S2GA 2CQQA 4UU7A 5K3CA 2J9FA 4ME6A 4JNCA 2ZNYA 5L3GA 3TOAA 2DQKA 3TUIC 3M9XA 1F0KA 3SEFA 4PTLA 4E94A 1TLTA 5ALWA 4IO0A 3VYSB 2R8YA 2WVAA 3I2FA 1VLVA 4Q6WA 1N1DA 3UK1A 4RMJA 1M75A 5ITZA 1R4ZA 2M3AA 4A3DJ 4H15A 2BH2A 4X1EA 4Q7LA 3GEMA 2ZJ7A 3ZIAA 4YRLA 2PD4A 3E1KA 2FR0A 4FLFA 1ZSNA 1UZAA 2TDXA 1E32A 2LNBA 1OX4B 2B7BA 1I2CA 1MFPA 1OXUA 4DCNA 4YV7A 1HDIA 5I48A 1I4OA 1PV2A 4HDKA 4KQ2A 5IKPA 1GNQA 4ZZIA 2EW8A 3PS9A 4XN0A 3OZDA 4Q21A 4CV3A 2R7XA 4O5AA 2YNMD 1BA2A 4JKOA 2AQFA 1UM9A 3NNSA 4U9HS 4Y30A 4OO3A 1P0IA 2W7TA 1FFDA 5AWFC 1PK9A 4ZC8A 4KQGA 4P4GA 2LUOA 1GV2A 1BG6A 2YV1A 4IRGA 5IPFA 1S7EA 2A86A 1KJNA 4CIBA 1U9JA 4ZQHA 1ZAOA 4R8SA 5LP6A 4EUSA 4HZIA 2C57A 3JQ8A 4WBNB 1CUGA 2DWPA 1LY1A 1F1ZA 1R0ZA 2H3HA 1KDYA 3QQAA 4JYZA 1U9OA 1GGNA 5KVAA 1GZ7A 4NMMA 5E6SB 2OF7A 2XUGA 4GLLA 2C0PA 3D3QA 1BOBA 4JSYA 3R7SA 4FGWA 4UDXX 1JHXA 4KQ1A 1SAXA 3KZOA 3CTPA 3AJEA 4WVLA 3UPDA 3WJAA 2LP0A 1HNZB 2ZBDA 3RRYA 3KZIC 1YZVA 4EW6A 2P7CB 3LG2A 4LIVA 1TJ3A 2IHNA 1N3LA 3C6MA 1U7WA 2WFMA 3GY0A 4DDHA 4FGKA 1UWVA 3NASA 4UARA 4ND7A 1JQ5A 3ROXA 1CUDA 2PX0A 4C1NA 3KUDA 1JFTA 2VPWA 3MCUA 3PGVA 2AHRA 3A2MA 2M1XA 2BI7A 3KELA 1VBFA 1NN0A 4UFPA 1D2RA 4NYJQ 1G3MA 3AGPA 3GLRA 1IPEA 4WUVA 5HTOA 4XTRA 3TLZA 3KD3A 2XC7A 4K46A 3EUAA 3UJCA 3THXA 3Q3IA 1XPUA 4ZZ3A 5JMTA 1LDKB 3V42A 2W00A 5BSVA 4BRWA 1V8PA 1SVWA 3FZGA 1GZSA 1MOQA 1F3LA 4M1OA 2DSNA 2YN0A 2HHCA 4I1OA 5H6RA 1U78A 4MKIA 1I80A 3H1FA 4WINA 2CWWA 5HE8A 3AG4H 4MGHA 3FOFC 3RR2A 2ZPTX 1XAJA 3UBTA 1L7BA 3C5VA 3JCZA 2YV5A 3L2OB 4KI7A 4BP8A 1YE5A 4J3JA 1A31A 3IAUA 1XL0A 4BJ6C 4E7IA 3HDVA 2AK2A 1BYUA 3UH0A 1QRYA 1S7GA 5B58C 4X7BA 4C89A 4V3CA 4CYCA 4MHTA 1BA5A 3P0HA 3ZMVA 3N39C 3Q3EA 3QA9A 3VU0A 2GBLA 3T7DA 3BWMA 4KUEA 3QG1A 1GO2A 2VQEB 4WLUA 3HM5A 4FTHA 2M7AA 3QU9A 2ECCA 5T6BA 3FYCA 3HEAA 4MFDA 2YVUA 3WVNA 5DBHX 3DZIA 1ODIA 2AFVA 1RKWA 5TVGA 2PUGA 3HCBA 1XGMA 3GFQA 1SUAA 4BFUA 1FEZA 4D6YA 3M4ZA 4WXMA 1A27A 3E9QA 3P27A 2WA2A 4F72A 2OZLA 3ONQA 3HRUA 4KMMA 5AR1A 3K70D 4YLEA 4R8LA 1XBTA 2ZDGA 4C7OB 1BS9A 3OZUA 3RHFA 4W7HA 4IP0A 3THYA 5FNZA 2Z08A 4KQWA 4M1WA 3DE1X 1ZOPA 1G3UA 1JXSA 4M55A 4QOHA 1DC5A 2PWZA 2FN8A 4Y33A 3RC2A 3PICA 3PFFA 5DWDA 4ZJZA 4HTFB 4XARA 4BZPA 3GLHB 5BSGA 3L9XA 2WEKA 3RS0A 5AUOB 3NIGB 1Y5NA 2PWPA 1XT6A 4KLNA 3OFND 2OHJA 1KVTA 3Q8XB 3C18A 4MV8A 3MW8A 3HDHA 4ZQGA 3VJRA 3RBVA 3BTOA 5JI2E 2OUKA 1E0KA 2AF3C 2QSZA 1JVSA 2L69A 1QP0A 2BMJA 4IJ6A 3GEGA 2IW1A 2DFFA 4D5CA 2WP8J 1AQLA 4IQJA 2VS1A 3JATB 1O3YA 2UZAA 2BCEA 4F6RB 3M6IA 4W8OA 3ABSB 4UOQA 3LQ4A 3WYGA 3W5HA 5FQNA 1WXFA 5LLSA 3JRDA 2DUJA 2I9PA 2IF0A 2FY8A 3PEUA 3ULQB 1MF7A 5AHWA 3H9JA 3N05A 2AJLI 1V11B 4UTXA 2QZ8A 4HRXA 5IM5A 1SURA 4NJMB 5IDQA 6Q21A 3IH2A 3W5JA 4HAIA 1P1IA 2AJDA 1NULA 1YNOA 2VHCA 1ISIA 2W24A 4EJWA 3GF2A 1KYVA 3IPLA 1G8JA 1FJGB 1OXKB 1QGED 1E3OC 4KAJA 1P1BA 5KQRA 5BWNA 4H7JA 3N7TA 4PIPA 3QWLA 1FFAA 3IUNA 1G1AA 3F47A 3N2GB 1JR4A 4EI2A 3CUQB 1SD2A 3DBHB 5K5RA 2ZTVA 2I33A 5BNWA 3UG7A 2C7BA 3QVGA 1UPXA 4ZEVA 4UNOA 1N4DA 3TE6A 3H6GA 4LZAA 3FLMA 2H7VA 4KSYA 1T8PA 4BNXA 4U1RA 2CJXA 2B3DA 1WDKA 4K9NA 2FP3A 5GJBA 1XZCA 4RELA 4G5HA 3CJRB 1XGKA 4D3FA 3EA0A 5LZ5A 3ZY3A 3KTAB 2RNGA 1W0KA 3AUUA 4ASUA 3A0HC 4HS9A 5IC5A 2HV9A 3PDCA 3LAPA 1QG4A 3K73O 1LI7A 3ULKA 1X38A 2ID6A 4RY2A 2XIJA 1IN8A 3PVZA 1NPDA 4UDOA 3WO1A 3UT5B 4WX2B 3LNCA 2YVKA 3WB2A 3W34A 2WYUA 3QUBA 3N8GA 4QXPA 4HPWA 4U2GA 4ZALA 3VVMA 1RQNA 3JQBA 2XUDA 2F1IA 2W6OA 4MUIA 2FX3A 3DEJA 3I5MA 1TQDA 4P8RA 2XCUA 4L72A 1FMLA 4TYYA 2Y30A 2GHQA 1JPJA 2QAGC 1S29A 3G8DA 1AH2A 5F2NA 4IW3B 1Y8AA 1T0IA 3LO8A 3O2SB 2AHQA 4XM3A 2QQEA 5BXYA 2YWBA 3GZTB 2Z9DA 1ZSYA 3RKSA 1A04A 2Y1CA 4BO2A 3D0SA 3CVUA 1EIZA 1FFXB 2Q2NA 4YJHA 3ERCA 2OY0A 3EQ2A 4NCKA 1SA0A 3COVA 1NQOA 1H8AC 1KH3A 2YJNA 2HRDA 4PS0A 7REQA 1J5YA 1FYMA 1KEPA 1JEYB 1DCTA 5E20A 3WWZA 4Z1MD 3FOZA 4D9EA 2J67A 4JJ8A 3SX2A 3SK0A 2RMKA 1ETKA 2X6RA 1NNI1 2CNLA 3MGKA 4HPJB 4CDRA 2ECOA 4YRBA 4UVDA 5IUKC 3HZOA 1ZRDA 1OCCH 1OVMA 3FLBA 1SUIA 1JHYA 1KI9A 4PANA 1E6UA 1LCIA 1ETXA 4I4TF 1DBVO 2XOKD 3DLPX 4FEAA 5DHRA 4RNDB 4CUJA 2R7MA 1A5ZA 2L02A 3V4PB 1NGSA 3HG9A 3P4XA 2Q2OA 4YAOA 4IM7A 4ENRA 4BKRA 3K2QA 4G8DA 2MC4A 2H52A 2EV5A 1OF1A 4KQMA 1R27A 1W35A 4RZUA 2B2NA 2WR8A 2EHJA 2YOHA 3L06A 1ZI9A 2QLBA 4NABA 2NIPA 1SOUA 1WQ3A 1ZZEA 1T08B 2VH2A 4B3HA 3DYBA 2RG1A 4NPHA 1FMVA 1QFZA 2XZTA 1XUOA 1UJ6A 3Q6IA 2KI5A 1XNJA 3WE2A 1FYEA 3CPHA 5AJVB 2B8WA 4AWXB 1T98A 4OJTA 2ZFWA 4REOA 2XYGA 3ZU5A 3IXMA 3QPLA 3ASOH 4ZYYA 1LNSA 5JYDA 2V9PA 1NM5C 1VYUA 1MBJA 2RHWA 2AK3A 3K8QA 5HMLA 5ISMA 1XCVA 4ENPA 4IHAA 1N8TA 2IYQA 2OBYA 1STOA 3TLCA 3DWFA 4E46A 4MUXA 3SX0A 4RTJA 5BSUA 2ZM6B 2C07A 2Y1EA 2DMNA 1DOAA 4GQBA 1I1NA 4W8HA 2JPCA 2F43B 4LBVA 2ALJA 5JCZA 1OR8A 4IWNA 5JDCC 3Q40A 4CKCA 1NSFA 4BN4A 1PHRA 4N5IX 1DG3A 1OU0A 1GT0C 4N5DA 2JFGA 3T34A 4M1MA 2CJJA 2W6ZA 3UNGC 1XX6A 3KBOA 5ABPA 1LUJB 3MTJA 4WAUA 2HI3A 4HTAA 5GV8A 4CLOA 4B31A 2M4GA 1XRPA 2ZIFA 4PC6A 4RFVA 3BPSA 1MXFA 2FPLA 4LDPA 3GVXA 4URXR 1DOZA 4U8GA 5L4LA 4GL2A 1KHTA 5HBRA 2V59A 1RAFA 5IANA 4J0IA 3BMNB 5FOWA 1RQ2A 1EK2A 4ZEOA 2IYVA 1GVJA 3I9JA 2QSHX 4NYIR 3R74A 3VDRA 2NVTJ 1EB9A 2ASVA 3EXG2 3H92A 4F4FA 3MWEA 3BJIC 3CJQB 1EQAA 5IP5A 5BS6A 3AR5A 3JU3A 2IDKA 2Q3BA 2CNKA 1T0JB 3I8SA 3PUXA 5BSTA 4PZ9A 4BB0A 1YULA 3U17A 4PVDA 1C3OB 3WAGA 5DLYA 3MSCA 2JFNA 3WYDA 3VKUA 4CLRB 2WVGA 3U7QA 2ZVPX 4TSKA 1ETWA 5LDHA 1TGVA 4CN9A 5H3CA 2I2XB 2FSUA 1TKBA 2M45A 1T1JA 3LXMA 2HOAA 1P0CA 2PT7A 3WKDA 1ORIA 3W8RA 2ZYRA 2VCYA 4I2VA 5LL6P 4QO8A 3U7IA 2XQKA 2OFOA 3L6BA 2JEYA 4CL3A 4RD1A 1OXBB 2PKEA 5EZYA 4UNQA 5BW6B 1UIRA 3I1FA 3C48A 3GFSA 4PS1A 3BD7A 2OV4A 3WE7A 5AW3A 2X2FA 5KDLA 4DGWB 4C07A 3CCVI 2XTZA 3EUEA 4E1VA 4XVQA 3VSCA 2YWEA 3DZFA 3KFLA 4ZI7B 4KN7X 2QD4A 2OFFA 5BPHA 4GHWA 4X62B 1FDTA 2KLHA 1FU8A 2ZAGA 4KFCA 4DZRA 3VMFA 1Y4SA 3QODA 2AC7A 2CZGA 5FI5A 1KEEB 2UXBB 3KLNA 4G1EB 2QY6A 1SU6A 2HC9A 4PM4A 5KVQA 3VR4A 3BIJA 3LC2O 1V4VA 5C31A 3OZEA 3MJTA 4YCMA 3RJMA 1EESA 2O3SA 1ARZA 1JIUA 4X7MA 4Y2GA 5A2GA 3FXMA 1DQZA 1DC4A 3I8XA 2VPLA 1CF9A 4M72A 3JY6A 2MHCA 4MI9A 3ESQA 4I1YA 2W4SA 4UB6C 1OZGA 1H5UA 1K2WA 3CT6A 4J7UA 4P86A 4QUBA 4BDTA 4QA9A 4D74A 3PE3A 5FUYA 5C4XJ 3RYIA 2OEPA 4Z53A 3NFYA 3MZHA 5ICSA 2DA4A 1LEHA 4O4LF 2XB9A 3MWYW 5H16A 3OJEA 4CNQA 4HLDA 1BI3A 4YP7A 3ER6A 1PGPA 3LIIA 3C7AA 2BR5A 3FETA 3D4IA 1JYSA 4LZLA 2O8FB 2L9RA 4O2AB 3K32A 2PJRA 4FJ1A 1RPZA 4PYNA 5DIFA 2PU5A 1BJZA 3KV3O 4V1CI 2YWGA 2R66A 1OFTA 3FYUC 2JZNA 2O8CB 1CY4A 2ZI6A 5B1SA 4A16A 4KK3A 3QV1A 4LHYA 1O7FA 2NU7B 1HDOA 4ZPXA 5JLWA 4RVSA 3RRBA 2PUJA 4D8YA 2VWGA 3E6AA 1YDEA 4ANJA 5GONF 1JUSA 4LQ4A 2OOKA 2GA8A 3LMMA 4LDQA 1SR8A 3EDOA 4F7WA 1E2KA 2XB5A 3OU2A 5CKTA 2FX0A 3PZRA 4TVKA 4MP8A 1IHPA 2C9OA 3K0FA 4PAQA 1MMDA 3ZHVA 2OPBA 5EKSA 2JT1A 4H0CA 1BIFA 4NBUA 3QITA 3UMBA 1XPRA 3H5RA 1W6RA 3TIGA 3D31A 4BXXJ 3CH4B 2TRSB 4WXRA 3IBTA 3E5QA 4EW1A 1MA3A 1Q0SA 3HBNA 2I6SA 2VJBA 4IY1A 5BSEA 1JQ3A 1J2UA 2ERXA 1WB5A 2QDKA 2QPTA 5EJMA 3QTBA 1JV2B 5I8PA 2DT7B 5HQTA 3AILA 4DDVA 3UQYS 3GUUA 2GFHA 1OISA 4XSGA 3EBOA 4GUDA 4CI0B 2QRPA 5I9MA 3NWTA 2CD9A 4B40A 3RVQA 3FVVA 4MVXA 3V8VA 2FMLA 2J0QA 1T25A 4LZJA 4B2LA 2ZYWX 3M1AA 4BV9A 4X91A 1NZFA 1MO4A 2LH9A 2DM6A 1ZM3A 3OT1A 4LTDA 1PNOA 5ADWA 4B3AA 1BC8C 1Z3IX 4JYKA 4XRFA 2DULA 1LFBA 4QYMA 3IA2A 1R5ID 5FWDA 4FFVA 4XQ0A 4HOYA 1PZMA 1V7CA 5U4QA 3ZV6A 3WY9A 4XRSG 3KJFA 3GFIA 5ARBA 1LU9A 1LVAA 4MVJG 4WGGA 1ZSVA 4WA7A 4Z0HO 3CIOA 2VAXA 3U1DA 3QG5A 1FJ2A 1Y80A 2VTVA 3NBXX 4IOMA 2FOXA 2J32A 2WTNA 1QO0A 4QDZA 5B64A 1SNYA 1JZQA 4Y7NJ 5E8IA 5K3DA 2KPOA 4RLHA 3UHPA 4NYMQ 1PLKA 2DFLA 3E84A 5IC4A 2QP4A 2E9SA 1C8BA 4QVKA 2FGKA 3L1JA 1SKYE 4F21A 3EYYA 4EM1A 3TDUC 3W1WA 3HGGA 4PX3A 2DY1A 4LXHA 3ZW9A 2LGJA 4D42A 5JXHA 1H05A 3P9PA 1KP9A 1XRQA 5JV5A 3BR0A 1M34A 3IESA 121PA 2WP0A 4BU1A 4GT1A 5AYVA 4KBFA 4Q93A 4Q4AB 3PITA 4ZRNA 5IH7A 4AZSA 3E9RA 1SD4A 2PZJA 2VH5R 2HBZA 2ZJFA 1GZ5A 1ZHOA 5K01A 1QXSA 1CQJB 4YT4A 4JGGA 4RA6B 2YFHA 2BFCA 4NIMA 2AI1A 1I3QJ 3W6KB 3R5HA 1AQUA 3GAAA 2JGRA 4DF3A 2G28A 1E2QA 2C0QA 3SHQA 4C43A 1S89A 1N3IA 4FDLA 2BD0A 1WCWA 1OKRA 4RIIA 1JDBB 1L8LA 2WKWA 5E0OA 1W4AA 4XX0B 2XRNA 1Y5IA 1H2BA 3KSUA 4OLFA 1ZNXA 1CS4C 3NO4A 4RS8A 4ND6A 2YASA 2C42A 3UAZA 3PFIA 4EUHA 3P9XA 1XYGA 1WXQA 2OHXA 1RW4A 2Y99A 1HLPA 2ADOA 4DC1A 4B8ZA 3AJRA 2XH8A 5H20A 3W1VA 1JG4A 2I71A 4G0QA 4EEXA 3EQ9A 1ZC3A 3A28A 3K4BA 1YJ9I 4M0DA 3VH1A 3GTQJ 2IP2A 2HIMA 4PF1A 1RXWA 4N7MA 2IEZA 4BQSA 3GJRA 2K27A 2I1QA 5E1MA 4ZYEA 5PNTA 4FJ2A 5AHXA 4BQQA 4MEJA 4FX4A 1RRVA 1XQWA 5FFZA 4G86A 4C05A 1JEAA 2WMOB 5AW8A 3RT9A 1TUEA 3CR8A 2BHYA 5JSUA 1FRVA 1DNPA 4Q02A 1X7HA 1PT6A 3ZD6A 3VR3D 4QRDA 1HNXB 1QHGA 3BWYA 3O93A 4L18B 4U9UA 1JAIA 1I6KA 4I6GA 4YIIA 3L7YA 4D46A 2FZCA 5HFNA 2VWHA 1Y5MA 3UUGA 3I9KA 1XJ5A 5AKZA 3GVCA 2ICAA 1QG2A 3GBVA 4QVIA 1RD4A 1KIMA 4KQHA 3G49A 2P68A 5KYWB 5KC9A 3OZCA 2CDRA 2PS1A 2OORC 2C03A 1LBTA 1B23P 4P54A 1K08A 2WBMA 4GEKA 3L6DA 3N5CA 4OGLA 3EIHA 1J8FA 2YJZA 4LJ9A 3HBFA 5FKNA 3DUFB 3WYCA 1VJTA 1KPIA 4S24A 4UU0A 4WESA 4RKQA 2MJLA 5FNVF 2NZXA 1T4CB 4E08A 2QLJA 3ZLUA 2PZEA 3R60A 1KYWA 2RFLA 1N9GB 4P3PA 5GP1A 1FUYB 2ISZA 3LC0A 2Q8QA 5KK1A 2O0KA 4YUYA 2FD5A 5A4JA 4HVAA 3GTKJ 1D0YA 1TRHA 2V7TA 3CPSA 3H9GA 3Q8LA 3U9GA 1Y81A 4FFOA 3EMKA 1SU8A 1REPC 1SUCA 4JLBA 4EGYA 1TZJA 1MVOA 4I4LA 3EEBA 2VPTA 1YI1A 2G40A 5J2UB 5GQSA 4PR0A 2BP7B 1NR7A 2PGOA 3BM5A 4HX5A 4B6SA 1TK9A 3FOBA 2P5YA 1YOVA 2HLNA 3FFTA 1SD7A 3RGWS 2CF6A 2J30A 4YI5A 3EAQA 4AQ7A 3IQDB 2CMGA 3GJXC 1JDPA 1NQTA 5K2OA 1GL6A 1BNCA 1PG5A 3QOFA 2O8KA 1Y8RA 3ZVRA 3FZNA 4WDQA 3X0DA 1K1EA 3S1QJ 4KA4A 1WWKA 5D1HA 5JD6A 1PL8A 2NO7A 4K86A 4LYFA 3VUFA 5FPTA 3WTTC 2WM3A 3V46A 1E2JA 2QGFA 2L18A 3JRWA 2G1PA 5D85A 2PGNA 2AXEA 4NH0A 4ND8A 1M76A 1YFKA 2WKSA 1AS0A 4G1UC 1G3TA 9ATCA 3E3MA 1MBHA 3V1UA 2OTLI 1I32A 4F1JA 2CYYA 2BEVA 3D6AA 3JD2A 4II2A 2ZTSA 1Y1SA 3R6GA 1NYRA 1PFVA 3PFNA 4JSTA 4CICA 5JIBA 4RIEA 1H2XA 5TQJA 1VYVA 3EQ6A 4YDSA 4A3MJ 3OPYI 4JSRA 5CNIA 4YCCA 5FI3A 4X64B 2BBTA 7ADHA 1E4YA 2LYCA 3OOHA 2V7VA 3N8IA 2Q6OA 5TXGA 2DLLA 1M2NA 5L8VA 3D2AA 2R93J 2O0HA 4G4GA 3EZ2A 3FMRA 2KB0A 3OLVA 3AHHA 1NJFA 2YNMA 2A5WA 4RAYA 4C6SA 4F1KA 4C2AA 5C7LO 3K4MA 4EMSA 1J2JA 3FPKA 3I2HA 4KAAA 3ABMH 1OWOA 1VJ1A 4JCCA 3HOVJ 1TJ4A 1U7DA 4X00A 3RNOA 1BFUA 1SAYA 4UHKA 2P9TA 1VC2A 3RIEA 3UEOA 4WQMA 2FPOA 2C4NA 5A7FA 1VQNI 2FEPA 1M34E 2VNIA 4BEJA 4DQVA 3HI4A 2I4OA 2E34A 4JR1A 5K3FA 2PBFA 2B8TA 5L6LB 3VPFA 3A1SA 3FUUA 3MOIA 4BX0A 2IWRA 2B1JA 4Y2TA 1XTPA 6PFKA 2QRVB 2XUOA 2XGEA 2QAJA 1G21A 5JHFA 1LE8B 3NTLA 1MAVA 1K9SA 1RAGA 4Z6YA 2MYSA 5C81A 4X3OA 3O83A 3VSLA 5ITWA 3AETA 5F08A 1RESA 2J0UB 4MWCA 4EJVA 2F59A 4UM5A 2JLYA 1WB9A 2FNPA 3F8TA 5EMKA 1I3MA 4GRAA 1CJBA 2WW8A 5EJ5A 1P1FA 2E1RA 4CXMA 3DR5A 2IU3A 1N6OA 4ALNA 3Q3HA 1DIHA 1JKXA 1MW8X 1QVVA 1P18A 2FI1A 2QNRA 2H7YA 5EC8A 4BX9A 2V98A 2HY7A 1ZK2A 4W1RA 3QPBA 2FWAA 2FOWA 1F2TA 2FEMA 4IIXA 3WRWA 1B0AA 4D0RA 1WHSA 1BKYA 2P77A 2GMWA 3KP7A 4XQCA 3CLSC 4MR7A 4HRIA 3J7AO 1F06A 3JQ9C 2GAOA 3WYNA 1DXOA 1PFQA 2IHVA 1FJHA 4YY3B 2NRAC 2F4IA 1R0SA 4O33A 1RHKA 1CU1A 1DC6A 2XUJA 2ZRJA 1CE8A 1FNSA 5FHRA 5K4AA 2OD7A 5TJ9A 2YHIA 1EWRA 2XCOA 3KQNA 3I4PA 2CL5A 1U2RA 3OU6A 4I5EA 4FGUA 2QI9F 2OQ2A 5HZKA 5K1YA 2KJCA 2ZANA 2AQ8A 3VHXB 1KMCA 4UMEA 4BACA 2JH9A 2GFQA 1TW2A 1SXJA 3OG9A 1N6PA 5FTKA 4M0FA 4XWOA 3PSIA 1RYBA 1SHLA 2B36A 2B37A 4A6DA 2WKQA 1CUFA 2HRQA 2PHZA 3TUJC 4R8HA 4ERNA 3CH7A 4KHZA 3KOYA 2QX6A 3EAFA 5L3ZA 4TL6A 2X5JO 4UHCA 1LC0A 1JTVA 2WM9B 2XUHA 1H6BA 10MHA 3BKWA 3HVHA 3PC8C 3BTUA 1BJAA 4OLAA 2HR3A 1KYIA 1S5PA 5AK5A 3TIVA 4EHHA 1KSHA 3DUWA 2DY0A 1DP4A 1Z13A 2HO4A 3K4PA 1GZ6A 2Z1DA 2NYXA 5J47A 3RF7A 5HM8A 2FKNA 2H16A 1IXYA 3AONB 4LHVA 2YYAA 4W97A 2V4MA 4L9RA 2C94A 2GEDA 4IUCS 521PA 5KJ1A 2HUNA 3ZI0A 3IAM6 2HJRA 1CY7A 1P0FA 1BEUB 1QQTA 4TTPA 2BZTA 2JTVA 1R0YA 3Q8MA 5A6SB 1AGPA 1R2QA 3IIIA 4GKBA 2LCQA 1M0WA 1YDWA 4LE0A 1IN5A 2VBYA 2ECFA 2IYTA 1VQMI 2VYQA 2IUTA 4FOPA 1W9HA 1LX7A 2IKQA 5I9SA 3OWOA 5IF9A 1T9ZA 4MVJH 2HAEA 1WCXA 1WPRA 2VHWA 5EIWA 1Y3FE 5ITSA 3E9ZA 1EGMB 3VNRA 2RG7A 5BQFA 5M5XJ 3STXA 1E1MA 3FM5A 1G41A 4AJ4A 3MQ0A 4M8LA 1LTKA 4CTOA 5AJTA 4DCPA 4F6CA 3AU8A 4GU5A 4UFNA 1UBUS 3NC1C 2SKCA 4IMPA 2PXCA 3BHJA 4TN1A 1NE7A 5CW1A 2HZ7A 1PX0A 2CLIB 7YASA 2K9QA 3T99A 2IZ0A 4K9RA 4N0QA 4KR6A 4XD2A 1E5XA 4TTQA 3T1TA 2WV9A 2TECE 1RACA 3LLUA 3OL3A 4OQ4A 5HCIA 2ZITA 2V9CA 2QR2A 3SC2A 1ZOIA 5JECA 3WQSB 4E13A 1S6YA 2VPRA 4G1VA 4QXMA 4HWPA 1KI8A 4IHWA 3O8DA 3RVPA 3W5CA 3V4FA 3I9MA 5ALRA 1XELA 2E4ZA 2R1TA 5HS4A 4HNAB 3TRJA 2HJSA 2B4YA 1GT91 3OL4A 4AMZA 2I1LA 4B43A 4I3HA 5D00A 3CO0S 1DQNA 3GROA 1QFXA 2A4MA 4WK8F 4D0PA 4ZAGA 2ATIA 1EFCA 3X2QH 4DBVO 1V3UA 5HILA 1H2ZA 5CA1A 3F6VA 2PTGA 3RFFA 2IH4A 3ZY6A 3GH3A 1JHMA 1Y3IA 2QI9C 4AT1A 3LUKA 2BT4A 1JG7A 4C03A 5I4CA 2G06A 1SFOJ 2Q46A 1KE1A 4Y1RB 4ESJA 4RZQA 1AOXA 4BCCA 1H5QA 1YDHA 1ICIA 3VR6H 4EYEA 2WD8A 2YMQA 4QDOA 3TF5A 4M76B 1HX7A 2IA1A 3ESZA 4UM9B 1X8XA 3QLEA 2GZAA 3QWAA 3GNTA 4FK8A 4YACA 2IWHA 1PJ4A 4M46A 4CMKA 1YTLA 3LOUA 1MMFB 2P9EA 2J5RA 1F8FA 1HSZA 6REQA 1R5JA 5JJCA 4MV4A 1R6UA 2FSWA 4P98A 1BHQ1 1OH8A 2F3UA 2HWVA 2A07F 2BBSA 4E2ZA 2W4MA 1FFYA 4C2UA 1S01A 4QSMA 3N4MA 2ILTA 1NBIA 3EF3A 3N2EA 2XYPA 3ZLJA 2HI0A 2FOLA 2WMDA 5IT9K 5G4KB 1Z2EA 3ZWKA 1U65A 1DQSA 2E87A 1BHJA 4BBPA 4YCSA 1ZRSA 2O1SA 2GETA 5AVWA 1DTWB 1VDZA 2H9IA 1G21E 3DBRB 4UXIA 5EXDA 3OO0A 5K0JA 2FTKE 4NE7A 2YUIA 1DDIA 3VC1A 5AXCA 2IEGA 4Z1MA 2XGXA 3M1IA 4EFMA 2C4HA 5MGBA 1KQOA 2CHQA 5A05A 1L5HA 1ANKA 4JA0A 4YRGA 2GOXB 2PYDA 4RY0A 2WJZB 1E99A 1VSQA 1J5EB 4C0HA 3D5LA 3CX7A 4MNTA 4UTNA 2OC4A 3TW6A 3X1MA 5BMVB 2DEUA 2ZT6A 5BQTA 2G9UA 3I4MJ 3O8OB 4XA8A 5J1SB 1X1AA 3IHWA 3T5DA 4YWJA 2Q28A 5BT8A 2XOKA 4Y7DA 2PMUA 3S2YA 5FWYA 3VOAA 4FHZA 5BYAA 1XYYA 1D04A 1DU0A 2YWXA 3L7MA 2YXEA 1D5YA 3R24A 5C4JJ 1J49A 3O2QB 2FBKA 5DCMB 1B72B 4LX8A 2YWFA 2PUTA 2VJDA 1ES9A 1SUBA 3V34A 4OQFA 2JI6A 3F6YA 4A27A 2VQDA 4XM2A 1NAHA 3L6OO 4FR5A 3H7AA 1ZD8A 5G0VA 4J6FA 2O3FA 3S40A 3BIXA 3MJSA 4KBGA 1WP9A 1TM2A 1JKOC 1IG7A 3GW2A 3PHLA 3GZJA 5CD9A 3D1LA 3S99A 1OFGA 4HWSA 3KQLA 4TL7A 5B7QA 1KRXA 3HZHA 3ORQA 3H9BA 4IHVA 1SXJE 2R25B 3QOWA 2KFDA 4UUVA 2PZGA 5DCYA 3TIIA 4WXDA 1NP3A 3QLJA 4N01A 1NJ1A 1Z7GA 4AIIA 4FLEA 1BR1A 1DE0A 2PUWA 2FFBA 3ESBA 5TV2A 3F46A 2CC2A 1G19A 1O57A 1DCKA 1IEQA 1EBUA 3NAZA 4JLPA 3T1HB 3QNMA 1PR2A 2Z30A 1IAVA 1U0OC 4BECA 3H4TA 4E22A 2XKAA 4GLBA 2MFZA 4YV0A 3IELA 1A2QA 1MC4A 1OXTA 3NHPA 5J23A 1TIBA 2A7XA 5I7AA 3P0FA 2XDVA 4JR0A 2G1JA 4U7FA 5KOHA 3TZQA 2PL9A 1L4NA 4X9XA 1N75A 2XECA 3TSZA 3CPEA 4URYR 2C4MA 2Z4TA 2Y0SN 3PLRA 1LTHR 4OATA 4PHFA 4TSRA 4E7PA 3LLMA 4YJ2F 2HOTA 2BY3A 3COZA 3UAOA 3UOGA 5GADl 2PYIA 3BH7A 2VJNA 2RAFA 1TA9A 4GI2A 5HGJA 4JYBA 4ETWA 1DCFA 3HNOA 1NC1A 5CBKA 1W73A 1FX0A 1XRSB 3K1AB 3SDGA 1BCRB 1L5FA 1PT5A 1FYFA 2ZYAA 4G9BA 1TLFA 2SECE 3VYVA 2L3DA 1N8NA 2ROQA 3H4VA 1GSHA 4R1QA 2HIHA 4FLMA 5IF3A 4Y9RA 4YFNF 5CEFA 3CCCA 3T4XA 3J81K 4ER3A 4EJ2A 1UBNA 3O5AA 1XTAA 5JD4A 1JJFA 4ZAFA 1T6YA 4YI3A 4JXXA 4BKQA 3HL2A 3ZK8A 2DMRA 3IAS2 3RUDA 4XIFA 2QLFA 4WRRA 4J0CA 2R5YA 1I01A 3CUVA 4G7OF 1EVJA 1U6IA 2P5LC 3N76A 2P6OA 2QU8A 1I4LD 3PBKA 3V1NA 1FCJA 2VT6A 5KJEA 2DOFA 2I34A 3HA5A 1LBIA 4JX9A 5TPWB 1JI3A 4MW7A 4EAQA 3WP1B 4NBQA 1NN1A 7ABPA 2OYRA 3T3IA 4JB3A 4NX2A 3RC3A 3H4IA 4D5GA 1R4MB 1QFSA 3QLVC 4BN0A 3BL6A 1JFVA 4DJTA 5HRAA 1Z2NX 3GLIB 5AP9A 1FNMA 3E2MA 2OGUA 2JD2A 1RSZA 4LYGA 1M7GA 4JENA 4MW2A 1YC5A 2IS1A 4XONA 2XDYA 5IKMA 1B0UA 3FM3A 3GGCA 1Y48E 1G2IA 2OO7A 4B83A 1MC5A 2VKDA 3LSIA 4LSZA 1EINA 3N2KA 3PPWA 4AO8A 2Q1SA 2VZEA 3WMFA 4NCXA 1YHZA 1GA6A 5JFRA 3P97A 3U80A 3IPCA 2J6BA 3IJ5A 1JHAA 2LRHA 3LSTA 5JNSA 2H1IA 3ETLA 3II6X 2BFBB 3BC8A 2ECPA 2NUAA 3N53A 3M4OJ 2JK3A 3H3JA 1AXRA 3W9UA 4LRTB 3UK7A 4ZVVA 3PJFA 3Q7PA 1T29A 3CZ6A 4RNCA 1Z75A 5KKAA 5LQKA 4ARSA 1NHWA 3RKRA 3DDNA 1US8A 2EZUA 2DRIA 4R1OA 4TXNA 5JMWA 5KNLA 2IYUA 3PU6A 5DN9A 1B4DA 3FZYA 3ICEA 2B7LA 5EEHA 3KJIA 5F4ZA 4EYQA 2ZRIA 1JT9A 4LK1F 5C3UA 3BC1A 3QSYA 1IDZA 3NG1A 4MYUA 5J3LA 3RIXA 3IVXA 3INYA 2Q29A 3W78A 3L4BC 1U1GA 3LPDA 4M88A 2ZI5A 1TF5A 3HB4X 1OCZH 1LRJA 3THSA 1GQYA 3K30A 3QU4A 1EH5A 4RACA 5LBUA 4CQLB 2P79A 2X5NA 3ZY5A 4YCBA 2WJ4A 1DAEA 4B80A 3KOMA 3CISA 4KAFA 3UUWA 3D8TA 1SWVA 5L3VA 4CGYA 5BN3A 3KAKA 4DLYA 4JQZA 5EP3A 3IVGA 4FFLA 5ILSA 4M1ZA 2HOQA 5TJJA 2E5NA 3PF9A 3KPYA 4G09A 4DZTA 4DQKA 5A3RA 3W3AD 1QO9A 1TCBA 2P0WA 3FTFA 2OFXA 3R61A 3T1QA 2HDDA 3MD0A 3HQ4O 1TIKA 2F1HA 2O0YA 5CJJA 5DI3B 5EERA 2HMVA 1NUQA 3N74A 4QEKA 4AYXA 3OYCA 5KYKA 3QEMA 1YB7A 5DNVA 1SXJD 3QYJA 1E6MA 1PV4A 1KI2A 3G9UA 3A1CA 4DXAA 3FXOA 2JHPA 4JDPA 3VMMA 4LSMA 5BUCA 3T5GA 4K05A 5AKIA 3PNMA 3N28A 2UUCB 3VH3A 2I62A 2AZXA 5C1DA 2RHCA 3DZHA 1EKXA 4GX0A 3UJ3X 4IDPA 4JBYA 5KNCD 3PUHA 2WABA 3K0AB 2Y6UA 1ODLA 4OAPA 1U5TC 3A04A 3NVMB 1PDWA 3EDPA 4L3VA 5ALJA 5BRJA 2JPDA 4PGMA 4V2UA 1C1DA 5FULA 1BX3A 3AVWA 3IQEA 2G9ZA 1A6IA 2HTSA 3FF1A 4PCQA 1REQA 4JUBA 1IBKB 4H1HA 2VEOA 4NFHA 3ROPA 2QUIA 2IGTA 3KCQA 3JVUA 1QX3A 2CXTA 1DEKA 4Y67A 1V55H 2VDUE 2ZS8A 2HRCA 1AKTA 4J0FA 4EB6A 5KX5B 1U2EA 2GZ2A 4IL6C 3COYA 3E3NA 1SBTA 1KIFA 3GRAA 3X44A 4HX4A 4Z99A 2PV7A 5BUZA 5F2OA 3TWOA 5DM6F 1BOFA 5M04A 3CF4G 2POCA 2IX9A 5B3AA 5C7YA 2UUZA 1LLDA 3CKLA 4K9PA 1PE0A 2W8ZA 1I6WA 3TCKA 4A1FA 5EZSA 4A3EJ 5IARA 2BKLA 2PMZN 4EF5A 4K2AA 3ZCRA 1SIUA 5LBTA 1UG2A 2X6WA 3QJ5A 4KR0A 3MHPA 4F2PA 1BA3A 1QTIA 1PJRA 2W2MA 3VPAA 5D84A 1Z8DA 1FYKA 5GADJ 5ALLA 5ICCA 4W63A 3K6GA 4Q4JB 1YDFA 2DBZA 2RKWA 3U26A 4MPPA 2IS4A 3PFBA 4U0JA 1QGDA 3WJ2A 1G7RA 1BR4A 4RGYA 2MCFA 4BVAA 1ATIA 1P5ZB 4F3YA 1ETQA 1D5VA 3UCEA 4CDGA 3F23A 3EF0A 3BOQA 3KXLA 3FR8A 1YR3A 1Q1HA 1VZ0A 4JYCA 3HADA 5DDGA 5FPPA 5BXQC 4BVKA 5LXTF 3ZWNA 5EJ6A 3MRTA 4U39A 4R41A 1N6HA 1N0VC 2YU3A 2HVSA 2C4WA 1K7YA 3QX8A 5KVCA 4QEZA 1DAOA 2G36A 1QM5A 4PZYA 2BSXA 3KWFA 1EF4A 3M70A 1JJBA 1E7YA 5EUQB 2JK1A 5JFTA 2NSHA 3P4UA 1LW6E 1TA0A 3DL2A 5IJ0B 1YR8A 1D9XA 1IH8A 3V5NA 3RS4A 2HGCA 4QOJA 3WXMA 4OI4A 2X8JB 1LF0A 2CDNA 2HB6A 2C5FA 1NVEA 2C9CA 3KOXA 1FP7A 4DZJA 5CCEA 4H7FA 4PZZA 3A4YA 3RAJA 4A3SA 2QTBA 2YWDA 2X86A 1PDOA 4WECA 5B36A 2DA6A 4RHEA 4OJYA 3AG1H 5JVDF 3CLUC 2JATA 3BXFA 3QLUC 3LF1A 1JKRC 3ZHSA 4M2LA 3A3OA 2QBYB 2HSDA 4RK4A 2G63A 1QRUA 2ZOSA 3M3DA 1LBHA 5C7OO 2QRLA 4JBXA 4J1NA 1QAQA 5B4UA 1JEOA 4WMLA 1RU3A 1XQXA 2UXCB 5FWNA 3FTCA 4DSOA 4N40A 4EG1A 3VR3A 2HDCA 4O2LA 2IOYA 3E1GA 1KU3A 3IEXA 3ZQFA 4A36A 1SUDA 5M7EA 5H4HA 2R7ZJ 3FDZB 3GRVA 2FETA 1SIWA 2P6MA 4L8GA 3NGXA 1BX1A 3JQFA 4RAQA 3O6VA 1OB5A 4IWXA 4HGZA 3ZNPA 2C3PA 2O54A 3EZFA 3QKWA 1ETVA 1Z6ZA 4PINA 3V9AA 1RAHA 4UNSA 4A2PA 3RPEA 2J31A 4LWPA 1DRJA 2A1IA 3G2IA 4M73A 2PMKA 2O7QA 4HH3C 4LECA 1EP3B 1JEQB 3BBPA 3TJMA 3VV3A 4LNHA 3BZWA 2QZJA 4A3LJ 2GCIA 1DAKA 1VPTA 3ZDEA 5ICMA 1YL5A 1TWHJ 1XJCA 1YASA 3P32A 4LFBB 1T6NA 3NHJA 4RS4A 2A9PA 5D4SA 1BW5A 3IMFA 4BLOA 2FCAA 1OBHA 3R0JA 2BF7A 2X9GA 2Z95A 4TKLA 3OF3A 2NVXJ 3IP8A 3KEQA 2IYRA 3FF4A 1DKPA 3THWB 4IS2A 2EKPA 1CHDA 4UCXA 1RZ3A 4MHOA 4R5MA 3Q2IA 2R6AA 4EJ6A 1UK9A 1D4OA 2F3QA 3OPXA 2N8GA 2B35A 3JWIA 4IEFB 2AN4A 5G41A 4EHLA 4F97A 1VIMA 2R6GA 3G9QA 5KAPA 5BQ3A 2CGEA 2V7GA 4CN8A 1IUOA 2YN2A 1H0KA 1UJCA 4LE2A 4TLLB 1U2GA 1I5ZA 3IPYA 2K86A 2CLCX 3ACBA 1YKFA 4RTSA 2CNNA 3F21A 3NJ4A 3GLSA 2FQXA 5BVHB 2YHAA 2ZT8A 4S1TA 1EX1A 4KZKA 3WHIA 3FPFA 3GLUA 3X43A 5JCOA 4DCSA 2NXEA 5JAPA 2BF4A 3BAZA 5TRTA 2ZETA 4URUR 4RLQA 1NZDA 3K2IA 2PIAA 3ZIDA 1K0UA 4BO6A 4E2YA 4KMSA 1MMAA 2ZI4A 3AC0A 2F00A 2IIQA 2LE0A 3JYHA 4DEXA 4GQAA 4MI6A 5A5DA 3GJ0A 2ZS7A 5CG2A 2JIBA 1PR1A 4WCFB 1SC1A 4UUAA 4M6VA 2NQ8A 4UVAA 1T8RA 1A98A 5LMZA 3JRBA 3T5TA 3LGXA 2JLUA 3GLGB 2PQ8A 1DEOA 1ZH2A 3I6MA 4E6EA 5KS2A 3I01M 2NPIA 1NL3A 3JD3A 1XA3A 1T8SA 3LNQA 1TUBA 4TXHA 2W6JD 4WERA 5A3QA 5FBVB 3CJTB 3KIPA 3NETA 4E21A 3TCNA 4ZIRA 3CMMA 1Z4LA 3QOPA 4J0EA 2F1RA 4XKJA 4CEJA 3R0QA 2LF7A 2IY7A 1KWGA 4GAEA 3DQPA 1UJ5A 2DH5A 4JLDA 3EGWA 2PT6A 1ZYRF 2YY6A 2X5OA 2Y2ZA 4EX6A 3E82A 2ZE5A 4IVQA 4PBSA 3CRRA 1UXJA 2LIVA 1QIGA 3E3VA 4O6VA 3JAMA 3V1LA 1VIDA 2P3SA 2EIJH 5L3DA 3NKVA 4OYRA 3K10A 2HTEA 4G1CA 1LVGA 2R48A 4MCHA 1EQUA 4Y2SA 4BVHA 1IIBA 4GXQA 4MPTA 1WVIA 1ZJZA 4MGIR 3OYJA 4UHTA 1AKUA 2R7WA 1YZ3A 3QKRB 3QVUA 3JWGA 3QVTA 4D8TA 2BEJA 4KT6A 3U9TA 2Z6VA 2PX2A 1CEEA 4TTRA 1L4KA 3NEJA 4EG5A 1EXVA 2JIDA 2HPVA 1ONPA 5TS3A 3OM0A 3FTPA 1JIKA 2BSQA 1AF7A 3KZ1E 2EV9A 4A0RA 1E0DA 5IJAA 1QWSA 3CURA 1KYTA 2XRYA 1RE1A 3BMQA 3QX7A 3B3QA 1HKUA 3BILA 4UUTA 2I22A 1EE1A 3ZWXA 5DNDA 4Y6GB 2QL9A 3STTA 3OX2A 3ER8A 2DKFA 5LRSA 5CR9A 1HT1E 4HF2A 4LUCA 3FSJX 2X19A 3FXLA 1BDBA 4N47A 3OZVA 1O58A 1T9BA 1UJBA 4RENA 2NTJA 1UOOA 4PTYA 4HN4B 1X2NA 1PQYA 3CSDA 1Z2AA 1EVEA 5C5IA 3WL3A 1J90A 3DAGA 3L0IB 3U4QB 1H2FA 4RTPA 2R7AA 3TQFA 3LPNA 3MNFA 4P7BA 4PSAA 3HVJA 1ZGHA 4KP7A 4UOZA 2X14A 3UGJA 1RWXA 2A1UA 1O7JA 2GKGA 3IAS6 2CHVA 3HU2A 2PVCA 4KIUA 3AY0A 5FAKA 4BU2A 3PL5A 4NCHA 4Q3CA 4B8YA 4BB9A 4IAOA 3JWEA 1GL7A 1DV2A 1VQ4I 4D8VA 5IMBA 5LQCA 1GCGA 4F85A 2QLZA 5ALMA 3DAYA 4B33A 4LXGA 5LUAA 4MKXA 3KE9A 4TXLA 4KG7A 1RBQA 1C1YA 3HKDA 3ORFA 3IEMA 1KONA 1FFCA 3HYLA 4JYAB 2FFHA 1JX6A 2PY6A 3F6CA 5IAAA 4WK6A 2PKYX 1H2AS 3JARB 3DZBA 1KAOA 3CE9A 5GTHC 1GM5A 3M6WA 1ORVA 3RO7A 2OHOA 4ENMA 1R23A 3DGFC 4TRRA 4JC5A 3FUWA 1Z8NA 4U2BA 5DYYA 3KVVA 4Q18A 1ESNA 4MEXF 1NE2A 4FHTA 4EB0A 2CNBA 3E05A 3W8NA 1U0EA 4LBZA 4ROTA 4RJLA 3LLVA 3R75A 2P5SA 1T10A 1BROA 1W25A 2OV7A