1XDUA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with sinefungin (sfg)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RdmB
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
total genus 101
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xduA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xduA03
4L5JA 2P8TA 4DF3A 4KICA 3HA3A 1PRYA 3UJ7A 2KIMA 2W57A 2FQ3A 4RVHA 5LGNA 1EH6A 2P35A 2CQKA 1BI2A 3PX3A 3RKYA 2PLYA 1KGSA 1QNTA 4L0ZB 1A04A 3WTTC 2OD5A 3G5TA 2JHAA 2RVCA 5E1OA 3DP7A 2EWNA 1IUYA 4ZYDA 3FTEA 4MNUA 2ZZKA 1U78A 2PX4A 3OE5A 5HEKA 3HYIA 3TOBA 4GOMD 2ADMA 1YG2A 2YUIA 2JHPA 5F2OA 1I1SA 3M6VA 3MQ2A 3LL7A 4A0ZA 3CCFA 1OKRA 2X0LA 5KVAA 3I0TA 3KQQA 4ZH4F 4OQDA 4DM3A 1H1DA 5EMMA 3OV8A 4O29A 4GOND 4FR0A 1MZBA 5HS8A 5CVEA 2P3LA 3E97A 1T38A 3C3PA 4X1OA 3TMAA 3I59A 3KZZA 1BBYA 1MJAA 2Y48A 3G73A 3AXTA 1QYRA 3TKYA 2NXJA 3WTVC 3T0IA 1XGNA 1XSDA 5FTWA 3HP7A 1FPQA 3F6OA 5CJ9A 2LKPA 4YV0A 2EA2A 4M7RA 1STZA 1R23A 2IH4A 3T7SA 3E5QA 2I7CA 3EVFA 5DX0A 2QRVB 5C0OE 4U7BA 2C7QA 1QBJA 3BP8A 4PCAA 1HW5A 2V79A 5D5XB 2Z99A 1G8SA 3ABTA 4A12A 1J59A 1PP8F 3V97A 2YR2A 2PKWA 3TKAA 2P6SA 2OQGA 2OO3A 5AONA 2DPDA 2P7VB 4HSGA 2BE5F 4X41A 2F2EA 1EV7A 2DU9A 3EQLF 2O06A 5EQJB 1TNSA 1ORHA 4HC4A 3IL2A 2UYOA 2XVMA 1KQ9A 4JXJA 1O7LA 5LGUA 1MGTA 2WA1A 3L09A 2GIVA 5FFXA 3C6MA 1XSXA 1TNTA 1JXSA 4KT5C 3FRIA 3WGHA 2FPOA 4GBED 2RGVA 2AXLA 3CVOA 3FUUA 1WXXA 4L9VA 4FX4A 2KJCA 1V4RA 3M6XA 2FU4A 5T67A 2O07A 3FYDA 2HZTA 2HTJA 3ERED 4OIOF 4MHGA 3GRRA 4RVDA 3B73A 2H6BA 4YFKF 3IRRA 2K4BA 3O2PE 4L9TA 1I9GA 5GP1A 2LNBA 3OE4A 4EJVA 2F5DA 3A25A 2NS0A 3RDIA 5K03A 3LQRA 3TLJA 3BGDA 2PBFA 3NW9A 2L4AA 1G6NA 4I01A 5EMLA 4XLNF 5GIPE 4ESFA 4GEKA 5K0BA 4QVGA 1IY9A 1W5TA 5ICCA 1TTYA 1KPHA 4C04A 1W4MA 3CJNA 2I62A 2M5WA 4XRFA 4EJTA 2I6GA 4EVIA 1XSVA 3DXJF 3DOUA 2QLZA 2VZ9A 1XMAA 5CVDA 1FBQA 2HEOA 2ADUA 1R18A 3R6TA 3ISPA 3WSTA 3JTGA 5BPDA 2PLWA 4DA4A 4F85A 2IH2A 1ZRCA 1USSA 1SQGA 4FS8A 2BBYA 3U2RA 2ZIGA 1HQCA 1RJEA 4KDRA 2B9EA 4KVZA 2PX8A 3L8DA 4HQEA 3OFJA 3OZSA 4L7VA 2F5FA 3K0LA 5CVRA 1JGSA 2OZ6A 3KP5A 4EJUA 1GXPA 4LLNA 4P58A 4I09A 1KP9A 3NWEA 5DX1A 3M6UA 1O9HA 3TR6A 1FBSA 2FEZA 1IXSB 1SFUA 4RX1A 5BPIA 3SSMA 5DD4A 2KKOA 1R5HA 3M8FA 1D8JA 3BWGA 3GLXA 3KR1A 2JH8A 3QAHA 1OPCA 3RTRA 4WK8F 1GXQA 4F84A 2P7HA 4EM1A 3CLOA 3LQQA 4YIFA 2ERCA 3ELDA 2XV4S 3PVCA 4CHUA 5CCXA 3LCUA 3LHDA 3BKXA 2OYRA 3F8MA 1FX7A 1GHCA 3QOWA 1FYKA 2DBBA 3JWJA 3KPVA 1O3SA 3ECHA 3PFIA 2XVCA 4XLPF 5D1HA 3HHGA 4HW0A 4JBAA 4U7DA 3MB5A 4A0XA 1DP7P 3WE3A 3DTNA 3FPGA 2VDUE 3ZP5A 1FYLA 5LRSA 5CVIA 5FADA 3G88A 1BN5A 2P5KA 3RKXA 1B6AA 2HYGD 2V9VA 2ZNYA 3MWMA 3ZMZA 2PWPA 4M71A 4WXDA 3AY0A 2MH2A 4OOIA 1B59A 1UFMA 4F7ZA 3FUVA 5ED4A 3OPNA 2XIGA 3HTUA 3QP5A 4ENNA 2VC0A 5DDGA 2IP2A 2ZXJA 4U0VA 5M5BA 3BT7A 1W7PD 2FOKA 5A2QZ 1I4WA 1RJGA 4L5IA 3P2EA 4FHTA 1H9GA 3BWBA 3HTXA 2FK8A 4DQ2A 4EJOA 2ZWVA 1BJAA 2V6CA 2M87A 4IRHA 4G8XA 4Y30A 3MERA 4OIRF 4MQVA 2PXXA 1JQEA 5E8IA 4L9JA 4R79A 4EQQA 3DULA 2Z9OA 2PY6A 4IJAA 3J80K 1CF7B 4ETSA 5E1XA 2B2CA 1Y0UA 2QYOA 1X1AA 1R7JA 4C05A 3R4KA 4U0WA 2PWYA 4LLGF 1KIAA 4PYIA 3OZTA 4RAYA 4PGHA 1T0FA 3GJYA 1FBNA 5U4XA 3T7TA 2YTZA 4O5VA 3CUQC 1ZLJA 1QANA 1USTA 5B1SA 5GM1A 3V7SA 3T8TA 5FUBA 2CFXA 1L3LA 1NW7A 5LEJA 5EKXA 4RTRA 2XHKA 5ILVA 5BQTA 2STTA 1L3IA 2RQPA 3DH0A 5KK1A 3HRTA 2AR0A 2G8NA 1L3BA 4AVPA 1IXRC 1R58A 3BGIA 5EIWA 1DCTA 4ENJA 4UNOA 1UHMA 5HLGA 1JTFA 2IDKA 4RTQA 5D5UB 1ZREA 2P40A 4RTSA 2PGXA 1BI0A 2YR0A 4YV2A 1UCRA 1XVAA 4ZTBA 3KQWA 5DPMA 5FO5A 2GXGA 2GLUA 2HKXA 2O8XA 3WTXC 1EQAA 2YVLA 3A7DA 5GWXA 1AQJA 3V4GA 1AF7A 3I54A 1S6LA 4U7PB 1P39A 3OCJA 4PGGA 2L3DA 1H0MA 3FMRA 2DK8A 3TO6A 4RGRA 3KQSA 1O57A 2HS5A 2JZYA 1FC3A 2AOVA 3C3YA 3LWFA 1B4AA 5FLXZ 4Y13A 4ZZLA 3HCBA 4U0YA 4PIMA 2IT0A 1VE3A 5IKMA 3KP7A 2AOXA 1G3WA 1VBFA 4BHPA 1U3EM 4RYLA 5DSXA 3R6SA 3LX6A 4QDJA 3UJ8A 2IA2A 4CDGA 2BZGA 4BP3A 2WC2A 3KKZA 1S7AA 3QP6A 3MHTA 3GU3A 4HG2A 3M9AA 2VN2A 4P9UA 4QWQA 3NVKI 5JFRA 1B42A 1R8YA 3FPFA 4FP9A 1ZYRF 5L3FA 5LHHA 3L7WA 5CLSA 4DMGA 1L9KA 4Q47A 4BH9A 4HRAA 4AZSA 3RI4A 2FBKA 2BM9A 4NHJA 5CIYA 1P91A 2DLLA 1RJDA 3GZ5A 2UXNA 5GM2A 4G56A 5FLXK 2LDUA 3V8JA 5DCFA 5LHGA 3GEZA 3R3HA 4AZWA 3IKTA 1S3JA 4ZYEA 3K1NA 3EVGA 5EPEA 3IHUA 2P7CB 2CG4A 2IA0A 2PJDA 2EFPA 4HDUA 1MJBA 2Q0OA 3VOEA 5K0NA 1ONVA 1HXDA 3MZYA 1RUOA 1Z7UA 3RYPA 1FWZA 5CVUA 3HA7A 2ZMEB 2FSWA 2COMA 1J2XA 3DLCA 4H0NA 2KRFA 5DLYA 4B09A 5LQKA 3K2ZA 3M70A 2XAJA 1P6RA 4E70A 1D2GA 1RI5A 2HFHA 2ZVJA 2HYFA 3CJQA 3KPJA 4O6JA 3VFZA 4PZJA 2Y1WA 2XAQA 3QV2A 3B5IA 5DTQA 4RAZA 4RS8A 2IBSA 4ZZDA 2P1DA 1ORIA 3A26A 3SMQA 4R05A 5EMKA 4M74A 1DPRA 5HIMA 1D5VA 1HKSA 5HILA 4CGZA 4U7TB 5TJJA 1MD0A 5FD6A 3KPYA 2B25A 3GRYA 5FHRA 1Z9CA 2DPUA 3KHKA 2FRXA 2MBFA 5F2KA 2XGXA 4XUEA 3GCZA 3GRZA 2VC1A 3LDFA 3EETA 5FB2A 1WQ2A 4WWCA 3I71A 3ER9A 3JWIA 2EJRA 1ZRFA 3EEYA 2O57A 2DULA 4PYQA 3RYRA 3OU6A 3JWGA 2ZLBA 3ULQB 2G7UA 3S68A 5ICFA 3FXQA 2AZTA 3TOAA 3U1DA 2N47A 2NP6A 3HVKA 4R8SA 4YFXF 5HVQC 3RPQA 3L2CA 4LG0B 5FCDA 2BR3A 3FTDA 1O3QA 5HS7A 3SSOA 3TQSA 2L01A 3HHHA 1E2XA 3H3ZA 1RI7A 5LQUA 4ISCA 3L00A 1X19A 2V1DA 5JHUA 1X1CA 1SD5A 3D5LA 2GA2A 3TO7A 4G7ZF 3V8VA 1UWVA 2W84A 3Q7EA 2R3SA 4A5NA 4PWYA 5LQAA 2BV6A 4WF2A 3UZUA 3T5XA 3HSRA 3VEPA 3EVEA 2KJBA 3FM3A 4A2UA 2PX2A 1D2CA 1T98A 3ML6A 5AIQA 2PXCA 3ORHA 1XCLA 4GC5A 2GB4A 2XUBA 4MEYF 2NNWB 3ZMVA 4AZVA 5CYVA 4P7KA 3B89A 2PN6A 1M6YA 2FBHA 3P9IA 3KZYA 2W25A 3F72A 4CTJA 3A7EA 3W6KB 2HWVA 3UWPA 5LHIA 1YTYA 3EVAA 3RPUA 4A6DA 1VLMA 1LJ9A 3WTSC 1KHHA 3U9GA 4MTDA 4OBWA 4U88A 2B78A 4E33A 2A07F 2DO7A 5GOZA 3HRUA 3HIFA 4UHTA 5BMZA 2FNAA 5LQRA 2D1HA 2K7LA 2YPRA 4CYDA 3EYYA 4OA8A 3EGVA 4CO8A 3A4TA 2FHPA 4V0QA 4HOBA 4MIKA 4EGZA 2BR4A 1XB4A 3GW2A 4RTJA 2XASA 1ZG1A 2R7DA 5CVVA 3AJDA 1N7JA 1FJXA 2BH2A 4ESBA 2ONYA 4HA8A 2FMYA 4EQZA 3OOPA 5E9WA 5BOXA 2IJLA 5J8CA 3DF8A 1NW5A 4PYLA 5EIFA 1VP3A 2XVAA 4PDKA 3LKZA 1JTEA 3B02A 4LK1F 5FULA 3OZRA 4YUVA 4CKCA 3O3KA 2OY0A 4OQEA 4OBXA 3FPHA 5H6RA 1P2FA 5LQJA 2ZMEA 2P41A 3GZ6A 4BYYA 4OIQF 5E8RA 2G9WA 2H09A 5LRRA 4HDVA 2WWYA 2EFOA 3F8FA 3IC7A 1WXWA 5DYMA 1QAQA 2VE8A 1XCJA 3BROA 2FRHA 2OB2A 5K0LA 3DXYA 1IXKA 4GYIA 2Y1XA 1BIAA 2EB7A 2VBWA 3O7WA 3RIEA 2O05A 2ZCJA 3KR0A 1SUSA 2ZO4A 3E23A 2XKOA 2Y0MA 1P1CA 3LDUA 2OKCA 4F86A 3O31A 4B17A 4IRIA 3HCAA 3BOQA 4QQNA 4EKGA 1HKQA 5EGSA 5F2NA 2V7EA 4M6YA 1L1EA 2XAHA 3G8AA 2PEXA 3SX0A 2YSRA 1JHFA 1J5YA 4HX8A 1VQ1A 1KA8A 2WTEA 5K1YA 4QLCU 2HWKA 4QTTB 3SSNA 1RZ4A 4P7JA 4AWXB 4LFUA 3KP4A 4KIGA 3ELYA 5DXAA 1KQ0A 3FPEA 3K0BA 5LQCA 2ACJA 2AN3A 5E1MA 2BYVE 4EK9A 2QBYB 1BC8C 3I5UA 1VP9A 3HCCA 1T43A 4RWZA 2GA1A 2V74B 3TQNA 4DKJA 1YO5C 2ZZMA 3KP2A 1TQMA 1BOAA 2G72A 3TDZC 5KYGA 4GXOA 1FYMA 2PT9A 3P9KA 2PVCA 5DXJA 1DUXC 2EFJA 3EMBA 2ZW9A 4P9FA 5K0FA 4DCGA 3C3WA 4M9XA 3PT9A 2E7XA 4IV0A 1NV9A 3ERCA 6PAXA 1KQ8A 3L9FA 5GINE 4QPNA 4IKPA 4H0EA 4B8XA 1O7FA 2D2WA 4M36A 2LSOA 5EC8A 1WG8A 2XROA 4FSXA 2VT2A 2OB1A 2K02A 1IN7A 3V7RA 3K9TA 4HGYA 2PI0A 1F1ZA 1JG2A 2QQBA 1F9NA 2F5EA 4ASNA 2GXBA 2KIUA 1XMKA 4JK1X 3H2BA 4LB5A 2Q2EA 3ID6C 3PQKA 5LBQA 3C6KA 3GVAA 5E2AA 2JG3A 2IVMA 4HF1A 3CUQB 1D3YA 5HFJA 3WE2A 5ILSA 2L02A 1SUIA 2XYQA 1HBXG 1QO0D 5BP7A 4I02A 4AIHA 1NT2A 4EV0A 4KDCA 4YIIA 4GC9A 5FQOA 3B3FA 3JAMK 2Z3YA 2VBXA 1KU9A 3M33A 2ZFWA 5JVTA 3IV6A 3MTEA 3DQVC 1U6GA 5D4SA 2KW5A 3AWIA 2M45A 1Z05A 3DEUA 1IF1A 3PB3A 4BHBA 1DL5A 1X3UA 3HTSB 5HDNA 3MTIA 4Y17A 3KQMA 3U81A 4RB0A 5FWDA 3LSTA 2B3TA 5EKUA 3TM4A 3EYIA 1AQIA 3EDPA 4MQ4A 2GQQA 2HV9A 1F3LA 1RI1A 4IRGA 4ENKA 4A6EA 3CO6C 5HOQA 4I2OA 1HW1A 5JI6A 1B1BA 3E05A 5F64A 3B7PA 4RGSA 3A27A 1R1UA 3MQ0A 2MLGA 4QQKA 3I58A 2UWMA 1SVUA 1T6SA 3GWZA 3FPJA 2P7IA 4Y2HA 3ANXA 2YX1A 3UJAA 2FBIA 3KU1A 3FHZA 2DAOA 2RDPA 3DUWA 1S7OA 4E2WA 2HDCA 1O9GA 2DI3A 1KU2A 1I1NA 1QGPA 2PMHA 1P1BA 1LB2A 1LDJA 3VYWA 5K0GA 1SMYF 2JHCA 3E3VA 2ESHA 2QENA 1YLFA 3BWYA 3LFKA 4IVNA 3J80Z 3GO4A 3R0JA 1S8NA 4EMSA 2NRAC 5ICGA 1R5GA 5E18F 2Z5UA 3K1PA 4X61A 2DT5A 4RTNA 1P92A 4RB3C 2QRVA 5DM4A 4CWAA 4FSDA 3IWZA 3KE2A 5DCMB 4FGZA 1R74A 4X63A 2J5PA 1F5TA 1W7PB 4YV1A 3E6MA 2ISYA 1AV6A 3HSFA 1U5TB 2CGPA 4UUVA 5G02A 4M9SA 4HF2A 1EIZA 4HTFB 3V7CA 3GYHX 3CJTA 2IW5A 4P96A 2JJQA 3M8EA 1PUEE 3CUOA 1G60A 5EVJA 1L3CA 4RTMA 4UVAA 2HQNA 1YW9A 4OMZA 4YUYA 3D0SA 3FRHA 2OZUA 1JG3A 4HV5A 2ONZA 3JSOA 1T39A 3MAJA 1K78B 5K01A 5AIPA 1J75A 1QQIA 4PYOA 5EMJA 3KLOA 5HLHA 1Z6TA 1YB2A 3JW4A 4ER7A 4PYJA 3HVJA 4RTKA 5E17F 2CL5A 1DUSA 3P2IA 1DDNA 4TV7A 4RTLA 2P5LC 1FBUA 1ON1A 3FWEA 5E1BA 3MAGA 4MQ9F 2ZWAA 1BM9A 2XRNA 1I27A 4LLLA 1XD7A 5H02A 2GPYA 3ELUA 3GDHA 3KQVA 1AOYA 4HLYA 3Q9VA 5H6QA 4KN7X 1Z3CA 3G2PA 2EV6A 5KVRA 4DQ0A 1Z6RA 2EX4A 2QM3A 3RKWA 2P5VA 3ABUA 3FM5A 1SFXA 4QPPA 1XGSA 2WA2A 2NYXA 1YFHA 1HKTA 5DTMA 5CVJA 4XUDA 2GZWA 4LWOA 3KEQA 2VOPA 4AIKA 1PDNC 2ZBPA 1WY7A 2ELHA 3E6BA 4GF5A 5IT9K 3PTAA 3CUQA 3MEXA 2WV0A 2ZNZA 1XDSA 2LF7A 3P8ZA 2YXEA 4KIBA 2W24A 3BZ6A 3SZPA 3T1BA 3G2OA 3ELWA 1EH7A 3P9NA 1NW6A 5DUKA 2FNPA 1WI9A 2AOUB 2QY6A 1TPYA 5K09A 2EJTA 1IZ1A 2ZULA 3THRA 2ISZA 3UJDA 3SVZA 2MD5A 3EVDA 3UBTA 1K7AA 5ILUA 1G3YA 2MA3A 2E5WA 3LA3A 5L3BA 1LQ1A 4L9NA 2ORED 3BDDA 2O3FA 1FNNA 3LBYA 3EGIA 5DM1A 1R00A 3GXOA 2P8JA 1FZPB 4PYKA 4KMUX 4Y15A 2M1BA 3C18A 1JHHA 5K0EA 1HNNA 2YU3A 4LECA 3TO9A 1E17A 5EG5A 2UYQA 3E5XA 5JR3A 4M72A 3HVHA 5C9ZA 2ZFUA 1OMIA 4KYWA 4A0YA 3CGGA 3GNLA 4CKBA 1U5TC 3C1DA 3H3UA 4GO1A 3FYCA 4HV6A 4M6XA 3VB2A 1NBHA 2K4JA 1T2KA 3GFIA 2VS1A 2BEOA 3HNRA 2QQ9A 4KFCA 4LK0F 2NXEA 4E30A 2G7HA 4E2YA 4LD5A 2HMYB 3SGLA 1SAXA 5T6BA 2PJPA 2HKOA 2PQ8A 2BM8A 1W5SA 3BPXA 4A5MA 3F21A 1R8XA 3FXUA 1SQFA 3LBFA 5LSAA 1FSEA 2ZKZA 4HLXA 5JUWA 4GUAA 3GRUA 1LVAA 2AVNA 3GFJA 3CDHA 1J7KA 3B3JA 2TDXA 5T64A 4NB5A 1X1DA 3I59B 3P71T 1ZARA 2XKPA 4BXUA 5KS2A 3I53A 2AOTB 1G55A 2IBTA 5E1DA 3FF5A 1MJ9A 1ZGJA 4BLVA 2D1VA 3DMGA 4S04A 4XSZF 5DM0A 3MZHA 2BGCA 4K2EA 1BC5A 3KP3A 5MHTA 2RV8A 4AD9A 3ECOA 3IKVA 3J7AO 3NVMB 1R36A 1IRFA 4HBLA 2YQZA 4MWZA 3BY6A 3HSEA 3V8KA 1TQPA 4BQAA 3REOA 1CF7A 1HW2A 1TW2A 3LECA 2ZCWA 1VTNC 4L0YB 3GFMA 3M7GA 2VBZA 4IHSA 2ZTHA 3BWCA 1NHAA 2EFQA 4RSRA 4XCXA 1K78A 3E8SA 4ATNA 2K86A 1P4XA 2M30A 4D0PA 2YX7A 10MHA 3KETA 4RVFA 1VPTA 1SD6A 4IHTA 4AUKA 4YMGA 1RJFA 9MHTA 3QOPA 2DQRA 3EPPA 3DXZA 2C6YA 1LEBA 4R6XA 5BS6A 3C0KA 3HM2A 2YXLA 3NDJA 1QPMA 2IIPA 1EJ6A 2ZSUA 3PX2A 3EEOA 5DV5A 3WTZA 1H9TA 4HX4A 3V8LA 1FP1D 2O0YA 1JSZA 1P4WA 1I1GA 4I0AA 3UFBA 3I9FA 1YQAA 1IN5A 2NYUA 2VBYA 3SXJA 4CXMA 5DX8A 1IN6A 5BW4A 1INLA 3VC2A 5D8LB 4EM0B 5DEQA 1ON2A 3M1EA 3DMHA 1QAMA 2MLKA 2IPXA 4P5OA 4KMFA 2AN4A 1Q1HA 3R0AA 2CSOA 1ZGAA 2LD4A 3IRQA 3J81K 3PQJA 1P4AA 3FZVA 5FFZA 3MGGA 4BNCA 4FT4A 3FUWA 4M38A 5CUQA 1VIDA 3D2LA 3SM3A 4WXHA 3F6VA 2GWRA 2G1PA 4LJZF 1EH8A 1R1TA 3BGVA 4RV9A 5EHIA 4BHCA 4PNEA 4ER6A 3FUTA 2KIFA 2AVDA 2M8EA 4CICA 4BAYA 1OYIA 1IN4A 3KEOA 3GF2A 1MDMB 5E8GA 2J5OA 1VL5A 3FZGA 1R22A 3MCTA 3F8CA 2AOWA 4GOOD 3WGIA 1XXLA 1HSTA 3SFZA 3ZPLA 4MGRA 1EG2A 1BC7C 4IF4A 5FHQA 5ERIA 1OR7A 3PS9A 5K5OA 2XBMA 1R6AA 1O3RA 2JRTA 3WTUC 5J8FA 1NV8A 1G8AA 3BZBA 3KFWX 4IWNA 1NKVA 3HCEA 2IFTA 4CTKA 3ME5A 1NW8A 5K05A 3LCVB 2K4MA 4C03A 1LDDA 1U2WA 4GYGA 3TRKA 3N97A 1UB9A 2GAFA 1ZLKA 3NMUF 1ULYA 3CBGA 4RB2C 3FTCA 2GAUA 3DLIA 3IEIA 4RTOA 4HF0A 1ZG5A 4G94A 4ER3A 3F22A 2X4HA 2H94A 5L3CA 1Q0TA 4KWCA 3HOSA 5E2BA 5TRDA 2O6GE 1ZAOA 2UYHA 4ESJA 2DK5A 1EJ0A 4FX0A 3JWHA 3LCCA 3VSEA 2GA9A 2CWWA 1G3SA 4N0BA 1QZZA 5D5WB 2C7RA 2HQRA 2O0LA 5DRYA 2FF4A 2AOTA 1FLIA 2FCAA 2A61A 5HDKA 3FUXA 1ZG3A 3HOTA 4KDPA 3QU6A 2CMGA 3SHFA 4ENMA 2HOEA 1NW3A 4GOLD 4PYMA 4DZRA 3HA5A 2HGCA 5CM2Z 3FMSA 3EGEA 5F1RA 8MHTA 2HR3A 1JQ3A 1ZN2A 3WGGA 2BR5A 4HQMA 4EJWA 4LB6B 2HNKA 1ZKDA 1IN8A 4XBFA 3GO5A 4LG0A 3QRFF 4GCVA 3G89A 2NNNA 4WX9A 1G3TA 2PBIA 4UV9A 3IHTA 2Z33A 2NAZA 3F4KA 1WRJA 1WWXA 2F8LA 5FA8A 2IRFG 3UJ9A 4Z2YA 3KR2A 3G3ZA 5DRTA 2VOOA 5HIJA 1UFKA 1MKMA 3T8RA 4QVKA 5HS9A 1RI3A 1QZYA 3T7RA 3BJOA 3NQOA 3NJRA 4NQWA 2Z6UA 2NXNA 4KW7A 4OIPF 3ZN0A 1RUNA 3R9XB 2A3SA 1KXZA 2A68F 3JAMZ 1YIOA 4I0BA 3COAC 1ZRDA 1M0EA 2F5CA 2Q41A 1YFLA 4KIFA 1XGMA 4RGXA 1YFJA 1UIRA 5IT3A 4UVCA 2C7OA 3WODF 1Z1DA 3EVZA 1SMTA 2CWEA 1IAWA 3M4XA 1BHJA 1SKMA 3R24A 3LKDA 1G6Q1 3EUHA 2NP7A 2YX4A 2MH9A 2CKDA 3QU3A 1RNLA 1C0WA 3IWFA 4OMYA 4E31A 1GVJA 1OYWA 3GGDA 5H20A 1O3TA 2CYYA 4G6DA 1DPUA 1BKYA 3P97A 5L3DA 1BI3A 4M73A 3BJ6A 5EEHA 3RIRA 4BLUA 3AXSA 3CO7C 2Z6AA 2IDJA 5DTRA 2E1NA 2QE6A 2PT6A 4RB1A 1MDMA 3WU1B 2OBFA 3M6WA 3DKWA 5CCBA 2Q8KA 2A69F 3CJRA 1JR4A 2P6TA 3H92A 3P7NA 5E1WA 2DFIA 3HRSA 3NTVA 4E32A 4E2XA 3KR9A 3VODA 2IPQX 5HOOA 3RODA 2PSSA 4X60A 2HR1A 3G2MA 1Q0SA 1BI1A 2IA1A 3LPMA 4FZVA 3CTAA 4Q5SF 2QUFA 1F38A 4XSXF 5E1ZB 3Q9SA 1YZ3A 4C07A 1PJZA 5L3GA 4RVGA 3R0QA 3I4PA 5DT2A 2XAGA 5KQSA 3BWMA 2D45A 4QTUB 5HDGA 4KA4A 1M6EX 3JTHA 4ER0A 2OU2A 3KP6A 2H11A 5E9JA 4IV8A 3HRMA 1FP2A 4AX8A 4L18B 4WVLA 2VONA 2E7WA 1K79A 3P2KA 2ZJ2A 1EAMA 3GFLA 1I6XA 7MHTA 1WKMA 2PG4A 3E6CC 3LAPA 5J6XA 4M9ZA 4GGGA 2GS9A 3PFGA 3PLAE 1I5ZA 1X1BA 4CZZA 1TLHB 2VODA 5K5QA 4RTPA 3KQYA 3UJBA 1NE2A 4FT2A 3DMFA 4N9IA 4PYNA 5D5VB 5FD5A 1JG1A 1SD7A 3DPTA 3QPHA 4EGYA 2HTEA 4MHTA 4C06A 3K1MA 1JE8A 3E7PA 3W6JB 3O6BB 1PP7U 3BUSA 3LGAA 1ZHFA 1KPIA 4LWPA 4HX7A 2EG5A 2QBYA 3JSPA 5D1NA 3LAJA 2ETHA 2DPMA 2EJUA 5KQRA 3K69A 2G71A 3G8BA 2HTSA 2JPBA 4M37A 3KLNA 5P8WA 2AN5A 4G9YA 2OQRA 4RGUA 2A6EF 3GRVA 4HZFA 2H27A 4Q48A 2JT1A 1KYZA 4EM2A 5HLIA 4PCLA 5LEKA 1L0OC 3GIWA 5K5RA 1SD4A 2FA5A 2PFBA 2UZKA 2O61A 4BLWA 4G7OF 2K27A 2H6CA 4R1HA 2IGTA 5GIOE 2XYRA 4OA5A 3FXRA 4HAMA 1YZHA 3MFKA 1N2XA 4GQBA 4QDKA 1MHTA 3RW9A 3ZMSA 3F3XA 4ZYGA 4ZYHA 5IT9Z 4BP1A 1CGPA 4XUCA 5FQNA 1JQDA 1D2HA 1SG9A 3UA4A 1D8KA 2VDVE 3ER8A 2NNYA 2Y75A 3I64A 4V0RA 5DWQA 1XDUA 3WTWC 1FT9A 1Y8CA 5A2QK 3Q5FA 3CC8A 2CMHA 2R7FA 3KCCA 1OR8A 3BPVA 5HIIA 2UXXA 4NECA 5LR6A 2YXDA 3X0DA 3LDGA 4UVBA 3QPTA 1UHWA 4EKIA 2EA4A 3UJ6A 1R1VA 4O3MA 3FMQA 2UYCA 4Q4ZF 2UZ4A 3KPUA 1AWCA 3R61A 1KU3A 2QZ8A 1IXCA 4KRGA 2CW0F 3TGNA 4UOEA 4KNYA 4R8HA 1J9IA 3ZMTA 3GUDA 1G38A 3RJPA 1V3FA 1TW3A 2FXAA 2ZBKA 3SXYA 4I98B 2GH1A 2LF8A 2V1XA 2JPCA 1LDKB 3S2WA 3DV8A 1RI4A 1FSHA 3F23A 3HCDA 4HGZA 4MEXF 1NBIA 3TDUC 2VP3A 5ICEA 3UA3A 2EV0A 2ZIEA 1WZNA 2ESNA 5D6FA 2OPBA 4MTEA 2EFWA 2WK1A 2L54A 5LGTA 1BIBA 1HSJA 4YMHA 2PV0A 3HEMA 4HYEA 2DQLA 2FK7A 3KQPA 4IXAA 1WS6A 2RN7A 2E1CA 5DM2A 3DPLC 4KN4X 2W85A 4AIJA 2VDWA 3OFKA 5E8JA 1N7IA 4OX9Y 3N4MA 4N9HA 2VE9A 4E2ZA 5DD8A 2JSCA 1MJFA 2EFNA 3FTFA 1B9MA 1SFEA 5D4RA 2DTRA 3VC1A 4WCGA 2ZIFA 1IW7F 1ZQ9A 5EZQA 1YS6A 3QOXA 4UV8A 5EHGA 4YUXA 4DCMA 2VT3A 2PXAA 1JG4A 5CD1A 3LA2A 1BOOA 2OZVA 2QVOA 1XN7A 2V1UA 3CKKA 3DFGA 1TQIA 1YW8A 2OAZA 3SQNA 1HMYA 3F8BA 3ZQ7A 3TM5A 3HUGA 4LG1A 3THSA 1F4KA 3DR5A 3EVBA 4YUWA 4G7HF 3HVIA 3WU0A 3E6DA 5FA5A 2A6HF 3IYLW 3SR4A 1XCVA 3DXXA 3NRVA 1Z91A 2ZBRA 3BKWA 2OXTA 3K6RA 3FX3A 4IPAA 3OU2A 2C7PA 4UXNA 5D6EA 4PINA 1KYWA 2ZBQA 1J0RA 5DCMA 3GX4X 2XAFA 3BJAA 1REPC 1ZH5A 2R6ZA 1W7PA 4S05A 5BXYA 3O4FA 1U5TA 4P7GA 4HTFA 1LNWA 1XDZA 2QQAA 4OINF 2RKHA 5K0CA 3LA7A 4YG2F 2QWWA 5LLQA 2JH9A 1YYVA 4LMYA 3TOSA 5K0JA 5L3EA 1YUBA 1S29A 1G4DA 3BXOA 4ON0A 1U8RA 5C1IA 2Z6QA 2MC3A 5HZMA 3B3GA 2P3OA 2FMLA 4I7HA 4YUZA 4R8RA 4YFNF 3T0YA 2IH5A 1XTPA 2CO5A 2AS5F 1RI2A 3P9CA 5ERGB 3R60A 1WSUA 2AS0A 3AAFA 4LGWA 3PFHA 4ER5A 1OYYA 1IM8A 5D8KB 2B0LA 4C4AA 3TFWA 3NWBA 2O03A 1U2ZA 5IH3A 1XCBA 2H1RA 1K6OA 1XJ5A 2A14A 2OA4A 3Q87B 3WTYC 5DSTA 2STWA 2DW4A 5E9QA 1FY7A 2EV5A 2I9KA 5E20A 3J81Z 1O54A 3ZMDA 3ZN1A 3EVCA 2P3QA 1FOKA 1KR5A 3WG9A 3TPZA 4G6QA 1TBXA 3KQTA 2PMUA 4PCQA 5EOVA 4CKEA 2ZZNA 1KU7A 4C08A 2FE3A 1KPGA 4PIPA 2VXZA 5LQNA 2PX5A 5K8VA 4POOA 3F8NA 1YS7A 3C7JA 4R6WA 3ELKA 4KUMA 2OBPA 5BW5A 3NDIA 2AOUA 2H00A 1LEAA 4P55A 4P7FA 1ODDA 5F6FA 1V39A 3HCFA 1XGOA 3NEUA 2JTVA 5FGMA 1QAOA 3KPWA 3OU7A 4BY9E 3G2QA 5HIKA 4K6MA 3SZTA 5EZSA 1IRGA 2NXCA 3G7UA 2L4MA 2P4WA 2FYTA 1B9NA 4HH4A 4DNCA 5DUIA 4OU0A 4PONA 1YF3A 3G5LA 1YW7A 2XYVA 4CXFA 4AZTA 2EK5A 2RC4A 3E5UA 4FT8A 4MTLA 2ESRA 3UJCA 3MCZA 1RIOH 5EEGA 2A5YB 2G70A 3ZMUA 1JSXA 3EMDA 3KQOA 5FWAA 3ROUA 4JQFA 2RNJA 4WXCA
chains in the Genus database with same CATH superfamily
3PDCA 3O74A 4KIUA 4AJOA 5B7QA 1UXHA 3SIRA 4UBKA 3OT1A 2OD5A 2RVCA 3WGVA 5HEKA 1Y3BE 4GOMD 2VJMB 1V1RA 3IV9A 4FK8A 4WK0B 1V8PA 2RBEA 3ZGXA 2MYPA 4HS9A 3PHCA 1FP4B 1SGWA 1Y8QB 4TOIA 3F47A 3UFXA 1KC1A 4CM4A 4NCNA 1MVNA 4QOIA 2A05A 4HSEA 4KG7A 4RF2A 4BN4A 1V8ZA 1JAHA 4RSHA 3ABKH 5IFLA 3LOQA 1ULHA 3BP8A 2HU7A 5JXJA 5D5XB 1LFDB 4N03A 5LZ8A 4FCCA 4E12A 4LXYA 3E82A 5EQJB 5E7JA 3R0XA 2UYOA 2YCLA 4JXJA 4TQUS 2CDAA 1WB5A 1E7WA 2AQEA 3A14A 2WJGA 4Z54A 3MJHA 4R2XA 1DXHA 5U9CA 1NKTA 2D7DA 1FQWA 1J97A 3NTRA 1R8QA 1WFXA 5KVCA 1XZAA 1G4HA 3ACDA 3S32A 2O07A 5JQGB 1DJLA 1NUAA 3RVKA 4D4HA 1E20A 3NYIA 5CK4A 5K03A 1VI5A 1UJBA 3D4OA 2J3IA 4YT2A 2O4CA 3R5SA 1DKMA 3DVLA 1P0PA 4CMGA 1R8SA 3JZMA 5FOVA 5B6IA 4X8OA 1DLIA 3UMYA 2FMKA 1G3MA 2XQVA 4NOMA 4YYEA 2ZTMA 1ZRCA 1USSA 1AT1A 3U2RA 1DG3A 3H5LA 3HJEA 3B9QA 1YK0A 5K9ZA 3TDKA 2WHPB 1ODLA 2XMRA 4HD8A 5M5XJ 1Z2EA 4YBRA 3ZD7A 3KP5A 3S8MA 4P58A 5LZ4A 3HDGA 3TTTA 1Y34E 3ZI7A 1JN0A 3K6SA 3LUAA 4RZHA 1EG7A 1TECE 2NVWA 2XOXA 2VZLA 1YMQA 3DE7X 5IKXA 1JXQA 5J1RA 2O2CA 1YOBA 4N3CA 3ECCA 1XHEA 1RADA 1HLFA 4QYIB 2RSLA 1F7VA 3LQKA 1IEWA 3PEYA 4Z4CA 1KY3A 4HW0A 3MB5A 3OFND 3WE3A 3FPGA 3E4DA 1M7HA 2FZ4A 3ZUGA 2IZ0A 2V9VA 2R6GA 3EOZA 2WKPA 1XMQB 3OPNA 4K2HA 5DYYA 1S2IA 5L4LA 2ZJ5A 2OBYA 3WKDA 5A9SA 3DMNA 3TCKA 2G3YA 2FOKA 1W88B 1YBAA 1QVVA 4MGIR 2PWZA 1MD9A 3MD0A 2WF6A 5F3WB 2FX5A 1XQ9A 1YDWA 2CB9A 2GN6A 5F04A 1U7WA 4ETSA 3DLHA 2ZUWA 3TAXA 1O3YA 5ANRB 4E3ZA 4KFTA 4IBOA 2IRWA 4LX8A 3AERB 3FIWA 3GEDA 1CUHA 4IWXA 2OTJI 1NLZA 4KRFA 3R0IA 1Y6IA 3QYEA 1ABFA 3B8HA 3RUAA 4NQRA 4Q19A 4CUJA 5F33A 5IY5H 1BVHA 4D41A 3HGMA 4FZ5A 4FHZA 4U7PB 2PBLA 3L06A 3HXKA 1W5CC 4PC7A 2GPBA 4KP7A 4HXEB 3ANTA 4N49A 3U7RA 4H4EA 2X5XA 4QDJA 4Q7MB 4PXYA 3UJ8A 1KTVA 2XUDA 4L75A 4QNNA 1DJOA 4A3CJ 3O8RA 1B42A 3FPFA 4LJAA 3L2OB 2YVQA 3PE4A 3H0GJ 1GSIA 4HAOA 3OS1A 1QGDA 4BO7A 3S2DJ 3FSRA 5GM2A 5H5JA 1VIVA 1E2NA 1ULAA 5JMOA 3R3HA 2DFPA 3TL2A 1JT6A 3JYOA 3O75A 2IV3A 3NOQA 2Q0OA 4RJJA 4DZPA 1HXDA 4X6AJ 2PUHA 2HWUA 2JVHA 3BIJA 2KBEA 1FX0A 1Z0JA 2B8NA 1OLTA 3T3GA 4MVJA 3OPVA 4Q6WA 3BMCA 1GGNA 3KPJA 3WGJA 3ZPXA 3EYAA 4OQLA 4S0ZA 3PL8A 2F3SA 2XAQA 3HU1A 1A9PA 1KU6A 2FEOA 1V55H 2FTKE 1MQAA 5ELLA 2HF7A 1A5AB 3A9RA 4I4TB 2K2QB 3WWZA 2VNIA 1IBLB 4U7TB 1RMYA 3Q0IA 1K7CA 5TJJA 4GP6A 3S27A 3DZIA 3KPYA 3ZW8A 1VHLA 4WKNA 4AN1A 3LCJA 3RJMA 3EIHA 3EEYA 4KSCA 4L57A 4DCTA 2RK4A 5FCDA 5HS7A 3SSOA 2L01A 3DV0B 5IZCA 4ZIRB 2LW7A 3MF4A 1GRRA 3CO5A 1J70A 3U3DA 3MGKA 3JRCA 3QKIA 3TO7A 3IR7A 4G7ZF 4ZOQI 5JPCA 3O1LA 3HU5A 1ADGA 5AT1A 1TCVA 1ISJA 2ZRJA 3GGGA 1Q11A 4B7UA 1PWXA 2PX0A 2BRUC 1EFKA 1U8FO 1JMVA 4G12A 1A2BA 3TGWA 2D4HA 2PX2A 3ROMA 1ORVA 1T98A 2ZIXA 4MO2A 3MIIA 2IGOA 4YDRA 4W7SA 3ANMA 2BONA 2NU8A 2PA3A 2KHMA 5GJCA 5KSWB 4AO8A 3FCYA 4BJ5A 4E33A 5FB3A 1NF8A 3GLHB 1UDAA 2BL4A 3HWSA 5C3MA 5KINB 5GADl 4BGIA 4U7JA 1U7ZA 4YAIA 1U4NA 2FAXA 2WWWA 1DU4A 3TVDA 1M6NA 1TU3A 4EIWA 3TZKA 2NT3A 1XCJA 3I73A 3L4SO 5AVOA 3EG9A 2KPMA 1B26A 4NBVA 2O05A 2VP5A 4M0LA 1V1JA 1EVYA 4K9KA 2R86A 1ODKA 4F86A 3A4IA 1RAIA 5AI5A 3FZYA 4E4HA 2VXBA 2Z9BA 5FH9A 2WPDA 4MQBA 3O2JA 1T56A 4EHHA 1GTL1 2YSRA 1G0NA 3HH8A 5HJ2A 3GVCA 1EXDA 1G20E 2YW2A 2AC2A 4MV5A 1V4NA 1U0JA 5KNBA 4DUPA 4NC7A 5LQCA 4ZO4A 5A4DA 2ACJA 4YAKA 1MZPA 2AN3A 1DWUA 4FFPA 2BYVE 1DTSA 2Q49A 3B9BA 2IYSA 1G9TA 3LBAA 2FFHA 4M1ZA 1FUYB 1M76A 1BOAA 5DXJA 4MIYA 1IRIA 4CMKA 4R84A 3EUHC 3JQPA 3S0JA 4L8FA 3BTSA 3G5MA 4NYMQ 4F4DA 3WL5A 5LUAA 5K3FB 2XCUA 4U6NA 3C3XA 2GR9A 3NWTA 1O7FA 4M36A 5CD9A 2XROA 2ZDHA 2WHQA 3MT0A 4AZ3A 3RHZA 3FMGA 1A7JA 2GEUA 2VRCA 5E4FA 5J4VA 1EFPB 2KIUA 2DWQA 3KELA 2IY8A 1ZR4A 1PZXA 2ATCA 2E9SA 2NACA 4YDSA 4RJTA 1B15A 5ILSA 5J2UB 3DT6A 3CNOA 3WDSA 5DASA 4CT0A 2BMAA 1FFAA 3EVNA 1IIRA 4EL5A 2I7XA 3WAJA 4EBFA 2O3RA 1BCRA 2Z9DA 1IF1A 3H87A 4BHBA 3PB3A 2B92A 1G9SA 2ZSJA 4Y17A 1L4GA 3N28A 1DCMA 2QMQA 4FN4A 2W4MA 4QJ4A 4IJKA 2V6FA 1OA1A 4U2FA 5EXEA 2PUEA 4GNRA 2W2MA 4QQKA 3MSCA 4BGUA 5K8TA 5AVWA 4KUHA 2P7IA 1E5XA 4KO2S 1XEWY 1M8KA 3AKYA 2E2HJ 3DUWA 2X9NA 2HDCA 2BC9A 1GQYA 1DRUA 3GR6A 3RS8A 4UBOA 5K0GA 1Q57A 3RKQA 2PLAA 4GICA 1Z25A 4DA9A 3R3YA 3H1BA 4BKPA 1UL1X 1QA6A 4OU5A 2PK3A 4X61A 3AGPA 2F1KA 2KDOA 2K7FA 3H1FA 1V5GA 3HJGA 5LXTB 4B1RA 3TTYA 4KAXA 4DW8A 3DD1A 4BDTA 5A0TA 4U9UA 2F48A 3IMFA 1PNTA 4WOJA 4KWTA 2EZIA 1V41E 2P9BA 2FN7A 4AC9A 4BNUA 1WQ4A 1ZL2A 3F0TA 3HB7A 4WZBA 2I4MA 1G8PA 4HDOB 1VG1A 1IUFA 4WJZA 2X8WA 2C83A 1P2UA 3Q8XB 1WH5A 4OYYA 4ZZ0A 4D9FA 1ZKMA 1NG7A 1JILA 4L50A 3WYEA 5JSZB 4PSVA 1SCJA 4UREA 4O4IA 1AOYA 1ZBQA 3Q9VA 5H6QA 2OZEA 2IEDA 4BO5A 3HNOA 1OHHA 1T0HB 1ZM9A 1CE8A 2ALJA 2I4RA 1I2ZA 2R8BA 3D4BA 1Z4JA 2JIMA 1YU6A 3JZIA 2DA1A 1P7CA 1FSZA 2A6PA 1AM4D 1AN0A 3SZPA 1D1TA 3G2OA 1JUMA 1NW6A 2O2GA 4XYEA 1Q77A 2ZULA 3OOJA 3UJDA 3L7MA 4H9GA 3GFTA 3SVZA 4Q37A 4FDVA 2EARA 5JC1A 1LQ1A 1A9OA 4DNFA 1IEVA 3VDQA 4C7JA 3UWSA 2J6CA 4BO8A 1MFPA 3WK6A 2XMCA 1XJQA 1XALA 1U7TA 3N05A 3IOCA 1UPAA 4UZSA 1Z0XA 1WZUA 4H6WA 3VC3A 5DF1A 3L6CA 5BYKA 4QUGA 1DFGA 4GSLA 2JQ7A 4N0QA 4M6XA 5DNAA 1NBHA 5LQMA 5D3ZA 5ELMA 3A8TA 4JI8B 3QYAA 1YNSA 2MR5A 1HL7A 3R3UA 4E51A 2O5EA 2DYSH 3OPMA 3OC0A 4FCVA 4V0SA 2BM8A 3E9CA 1A8HA 4XFKA 4C20A 3E7XA 4W6ZA 4KGVA 3EXFA 1N5IA 4X20B 3RT7A 3PHGA 1VFCA 2FX2A 3CX8A 1YI1A 1UEXC 4UU8A 2AOTB 3G1OA 1E94E 3UMCA 4Y33A 2GZMA 5E1DA 5BSKA 1ZGJA 3Q3GE 5JRJA 4N0MA 4M0CA 3BMNA 5E3JA 5H0IA 1Z36A 1DS6A 1JLSA 4IIJB 3FMFA 3BXGA 4MGYR 1DRJA 2GDJA 3FNGA 2IEIA 3LKBA 3OEEA 1JG6A 1P2GA 4K9QA 4LMRA 1FFGA 4G1BA 1K3UB 1F36A 4DYDA 3FHJA 3GRFA 4Q01A 2ZUTA 3K0SA 3PTLA 1L7RA 2Q21A 5JOQA 4WESA 4ITRC 3GJ6A 4DW6A 5FOXA 3FCCA 4AJJA 2QUKA 2VPXA 2F2TA 1ES9A 2I91A 3MGGA 1K0FA 3D2LA 4WXHA 2PZKA 1OX5A 2KBFA 4ER6A 1YBMA 4EHKA 4EHLA 2M8EA 1OYIA 1Z8FA 5JADA 2X23A 3W9BA 2AI1A 1JZTA 3RYHA 1A8IA 4F3TA 3AM4A 1OR7A 1O3RA 2Y1FA 2WWHA 3RSFA 3WRXC 1MX5A 5K05A 4P3YA 1T3GA 5ER9A 3TRKA 2GEVA 1ZIYA 2CMKA 4HF0A 1ISHA 3RZOJ 4LOJA 1LKXA 2OCCH 3A32A 2ZSAA 1SKQA 3E70C 1FMJA 3ABMH 2WSMA 4FFRA 1DEXA 4EW3A 3VSEA 2VHXA 2H1HA 1BQEA 4TXNA 3ZQCA 2AV6A 3ASNH 3DMYA 3THWB 1Q7CA 3QU6A 3SHFA 3MBIA 1PEKE 1BJZA 1QOPB 3NM6B 3FMSA 1MABA 2VH2A 1M1YA 1ZN2A 2A0XA 1A50B 3DOIA 2WQZA 4HYQA 1OBFO 4ARZA 2JK1A 5L6MB 2I6SA 3GLIB 1WRJA 3ADKA 3MCAA 1TWHJ 1Z18A 4TUYF 2BVMA 2JJYA 5A9TA 3GAAA 1V9LA 4F3QA 3GTJJ 4UD6A 1QZYA 1XJ0A 1QRUA 3X43A 1NYQA 5TPWB 4OMDA 3COAC 3FTPA 4EFDA 5IDVA 2F00A 4B2PA 4M0PA 4J90A 4KXYA 4J0HA 1SMTA 1BKDR 2FLKA 3WIEA 1ZRHA 1YA8A 1OYWA 1FNMA 1QF7A 3IIJA 3RBAA 2NLOA 2CYYA 1JMYA 4XGKA 2C9OA 4HMOA 3G2BA 5DBHX 4DMHA 2FXVA 4NFHA 4Q02A 3UGTA 3BHIA 3OPYA 3FGZA 3OCYA 4RB1A 2G7MC 4MRMB 3KDAA 3GA5A 4D3SA 4XYMA 1ZD5A 4DG9A 2EL9A 2IA1A 3H65A 4V0NA 2ID8A 1YZ3A 3KXLA 5DI9A 2GCNA 4EYGA 4MR7B 1XLTA 3JTHA 1MJGM 2HZ7A 5DCWA 2W43A 3OS2A 5BORA 1P5RA 1I6XA 3E6AA 2QKYA 1AK2A 1N6OA 3L2WA 2XSJC 4M9ZA 4PPFA 2K85A 4H6VA 2FD5A 3SD7A 1X92A 5ALSA 1GV5A 5K5QA 3K4BA 3USCS 3MJCA 1JALA 1KIMA 1XYGA 4YQYA 3TIGA 4DYQA 5AJYA 4HYTA 3K1MA 2LR8A 4MKIA 1T0FC 2ZE7A 2E1RA 4HX7A 2PZJA 1GG9A 2V55B 3WGQA 4BNVA 5CB4B 2JKVA 1P2TA 3EUFA 1CJTC 2OQRA 4MRSA 3SIXA 4OQ4A 4K40A 5AWFC 1XNQB 1SC3A 3TIVA 3P45A 1CZOA 2R87A 4DJFC 3VMFA 1W75A 2QTWB 3IVGA 3V4PB 3QU5A 1WXQA 3I64A 3LSIA 3N6XA 2CLDX 5A2QK 4UHHA 3MTQA 4TT8A 2ECFA 3Q5GA 5IBQA 5HIIA 1KK1A 4A93J 3L6BA 1EDDA 4Q4ZF 1XG1A 2XVZA 2LRHA 4E88A 3PKZA 2QZ8A 5BW8A 3TGNA 4LXXA 1ZK1A 2Y77A 3QMWA 4AJKA 1KXJA 4YIHA 1AKEA 1V47A 2F43B 1YHYA 1TWFJ 3COJA 2G9VA 3VH1A 2RGRA 1FYVA 2D5AA 2QRUA 2KQRA 4HYEA 1I30A 2HNAA 1GM5A 1YI2I 2E1CA 5LU9A 4URUR 1MB0A 1ATZA 4GX0A 2JATA 4E2ZA 5IKOA 4A8TA 4CHGA 4BVKA 5I7EA 2AZXA 3ZGKA 4WCGA 4DILA 3NM5A 4FWBA 4UV8A 3EA4A 3OZCA 2H3HA 5A0VA 3NGLA 5F08A 4B3AA 3HKCA 1P5JA 4G0WA 2HSGA 3GD7A 1WCV1 2DUMA 2W00A 3IUEA 2YJTD 3S55A 4ZQHA 1G7TA 1JG7A 4DV4B 3OUZA 1I7LA 1MMDA 1G21B 1QGUB 1E5VA 1IQRA 3ONEA 4YELA 2YYAA 1T1RA 2D1QA 1AK9A 2VO1A 3QNWA 3KKLA 5K0CA 1RQNA 4QXAA 1G4DA 4RK6A 4ON0A 1N2IA 2M3AA 1L4FA 5ED0A 3A4VA 2K5UA 1Z4IA 3WIUA 7GPBA 4ZC1A 5D8KB 4KXFB 1M5TA 2GQ0A 1IHDA 5IH3A 4OXQA 1VI0A 1HV8A 2QX8A 4L73A 5ICSA 3HV2A 1WDMA 3CPEA 3LUFA 2TYSB 3OP1A 3VTAA 1QS0A 4P36A 4GSYA 4BBJA 1UJ6A 4W9RA 1N0IA 1VZ3A 3QELA 4ESEA 4EKEA 2H4ZA 2FE3A 1KPGA 3WMWA 4CF4A 1A7KA 4DIOA 3CLRC 4DGSA 5KYUB 5F6FA 1V39A 3HNPA 4I7EA 3OU7A 3DBLB 2HK6A 4KODA 2JFXA 1NVUQ 3OQBA 1PZHA 5D85A 3E5UA 2HIMA 2G70A 3IUYA 2AG0A 2WR8A 2WNIA 4WW0A 3LRPA 1NXQA 4QATA 5HWSA 4RVHA 1QH1B 3YASA 5FWYA 4RZUA 4L0ZB 3ZQLA 1Y6GA 1NRWA 3G5TA 3HLKA 3RK4A 3P32A 3OL4A 3VU9A 4MPTA 2BZ0A 3QLUC 2BFNA 2JLVA 2JJ8A 2V98A 1N33B 3W1VA 3BICA 1JDJA 1ZMTA 4AP9A 1TUBA 2JGDB 4GOND 5HS8A 3I32A 2ZC2A 3ZZ0A 3MLAA 3F67A 1M6VB 2AJ8A 3I59A 1DQNA 4TYYA 1X13A 1KDTA 1J5PA 1U2GA 2ZUEA 1XGNA 5EYPB 4XPIA 1P6QA 4QXPA 1TKRA 2XB4A 4IDDA 3TJRA 3U62A 1TJYA 5KJ1A 4N5LA 4XM2A 2QXYA 1X74A 5EZGA 5DX0A 3HP4A 3JRXA 3ZHSA 4PCAA 5DT9A 5LMCA 1GPAA 1ORTA 1Y4AE 1PX2A 4G1UC 2P6SA 1W0KD 4OHZA 4H6XA 1WNTA 5IXYA 2YS7A 2WIJA 1N6KA 5DKFA 2XV1A 2JLYA 1WPQA 4X41A 3QVLA 2WJZB 4UULA 2D1FA 4I9UA 3RSHA 5LGUA 1MO6A 2R84A 4QYMA 2ZSHB 4U6QA 4RK1A 1DTWB 2R8RA 4L9WA 2REBA 4PZDA 4A15A 1U0LA 4EY8A 3BOSA 3AL2A 1E7RA 4YYZA 3LY9A 4YRBA 5AQEA 2X6TA 4KXLA 3P0FA 4Q1EA 4OGLA 4HEA1 4N01A 3A3KA 3OM0A 4HAVA 1G7SA 1JSLA 1O8BA 2J3EA 1O97C 2RHOA 5LN1A 3WSWA 2FB9A 2RI1A 2W6JD 2I62A 1KZYC 4DA0A 1DSSG 4TV9A 1HA8A 2VZ9A 1GUYA 3HO8A 5CVDA 1U2DC 2DB3A 1LW6E 4HNTA 2PLWA 3QLJA 2JD2A 1DTEA 1VG0B 4QJ5A 1L7OA 4WBSA 2PM8A 4BVFA 3TCXB 1NL3A 3BXZA 5DX1A 2M8GX 4YCBA 2CFRA 1FOYA 5BPIA 2C5FA 2KKOA 1EWTA 1T24A 1RP7A 3R5TA 1Y5RA 2VKTA 1ODTC 1LRKA 3QMPA 2WWRA 3LFHA 5JBQA 3H1EA 2OYRA 4F04A 2CU7A 5J2TB 3JQ8B 3SNHA 1DPGA 4QPJC 5IT4A 2XVCA 3MRXA 2OFXA 4LYDA 5C3EJ 5JYEA 3AL0B 1BN5A 4ZP1A 3IAHA 1WTCA 2HYGD 4BKQA 4QBGB 4RIIA 1B59A 3FUVA 3FPLA 1L5MA 5EIAA 2X6XA 3DKXA 2MINB 5H3LA 1P3Y1 1A77A 3N53A 2WVAA 5HP4A 2SBTA 3BWBA 1I3OA 1BJAA 1GCUA 1E9FA 3JR3A 4DYRA 1JQEA 2O1XA 5E8IA 1KEKA 3IQGX 1D1CA 4R7GA 4IJAA 3J80K 4N7MA 2HJRA 4O02B 1R7JA 5ADUS 1JPVA 1QNLA 3IDAA 1N57A 3NASA 1LI5A 5GM1A 1JPJA 5LEJA 2IGNA 1WVGA 2H7VA 3GPDG 1LBHA 3L2QA 2XHKA 1W96A 5LLDA 4Z86A 2AR0A 3WP1B 4MWDA 3DOOA 4PLFA 2OD9A 3N7AA 1XVAA 4AN4A 2CUEA 2VHQA 3OZEA 2GN8A 3N8DA 4ENPA 3GJSA 1XPUA 1ENYA 3RYIB 2NU7B 1U04A 5F77A 5F4BA 2XCLA 4LSWA 1VSTA 3MYRA 3DAPA 1G3WA 1VBFA 5L3QB 4BDZA 3HFJA 2C3YA 1GO2A 1ILEA 3DBHB 4IIYA 3TXAA 2GOMA 3GN2A 5FPKA 3PHIA 1ZM3A 1R8YA 5LD2C 5LHHA 1P6UA 1RMTA 2BEWA 2GM9A 1E0AA 3DFIA 4HRAA 3GTMJ 1OFHA 2XF6A 3RWMB 3DDSA 3PGMA 3E7WA 1D2AA 1N2JA 5LHGA 3IKTA 5B4VA 1P3DA 1SQSA 2PMBA 4Y3UA 3G68A 3K31A 5BSVA 3H5WA 2VT6A 1FLDA 2FSWA 4MUYA 3CMEI 2ZJZA 4ZTZB 2GZHA 2RGWA 3ZW7A 3W6UA 5LWQA 4KB5A 5A4AA 5LQKA 4AYTA 1P6RA 1Q50A 2HFHA 4F1KA 3QV2A 1HSOA 4FXPA 3CU5A 5E9AA 1J9GA 2GWHA 2FMUA 5JDCC 4KXNA 4GOJA 2QWXA 3AIMA 5SZJA 1RPAA 1BU5A 4ESVA 2J4FA 1ZI6A 1MD0A 4GHWA 3GRYA 3CCSI 3DDZX 2QV0A 2PU7A 3GRZA 3DOEA 4H7KA 1IQUA 2I3BA 4C4SA 3CBQA 3WHBA 4NZYA 3L1UA 5CX1A 4KLAA 3R5JA 1NI4B 4B47A 4BVHA 3TQSA 5KOYA 1GNSA 3IALA 3PYXA 2FHSA 3IJEB 5L7TA 2J5QA 1PT7A 1U5AA 3K0CA 2DF8A 1XMIA 1JDUA 1GGFA 4F2GA 1ADJA 1TVMA 3WY9A 3KVNA 3Q7EA 3TP0A 2BP7B 3N8KA 2W8ZA 3U7QB 3ICCA 3S8YA 1C3XA 1UH5A 2OV3A 3FM3A 1Y33E 3GYBA 2C4KA 3NS7A 3W6OA 1EFVA 3I9V6 4M99A 3B89A 2R5ZA 4QLOA 3T12A 3RRNA 1U0RA 1YTYA 3EVAA 3K16A 3WTSC 4DREA 1M6HA 1QTRA 4WZAA 3W9UA 1ISGA 3ISVA 1E60A 4GP9A 5BMZA 1MP0A 4CO8A 1V8OA 3T9FA 1UP6A 3MWDA 3GW2A 1X8KA 4DR3B 4TKVA 1G6OA 2G5CA 2AT1A 3H9BA 3NBFA 1J2JA 1GRCA 4M46A 2GN4A 4RETA 3K9NA 3GELA 1MEEA 3SJMA 2AUMA 1MVLA 3OZRA 3JQAD 5EDNA 4YUVA 3SQXA 3AL3A 3RKRA 4OBXA 1ETYA 1XEXB 1P2FA 1OLXB 5ENVA 1WXWA 4HX5A 1VPWA 4YPFA 4A8JB 1T2NA 1B2RA 2OB2A 5K0LA 3GNTA 1FDVA 4GD3Q 5EUCA 5K3SA 3CO0S 5B30A 1L5YA 2WE8A 3M0EA 4HBZA 4A3JJ 2XKOA 2G5GX 1P1CA 4Y6OA 3GWGA 2HUPA 5H3CA 5CGZA 4UTPA 5K1YA 4QLCU 4HDCA 1UMCA 4QTTB 4BU0A 5E7IA 5EI5A 3MWFA 4QYXA 4DLPA 2EJCA 3G1LA 1TUGA 3ZDQA 1OZAA 4KI7A 3IDQA 3JAWB 3OX1A 5A03A 1SAUA 4GVPA 3CZ6A 4JKYA 4AL4A 4RIFA 3DTVB 4FU0A 3KIOA 2O3QA 3O94A 3GY0A 4NENB 3X2SA 4KITB 4JHLA 2PAFA 3CZ4A 1QIHA 3X3HA 1L4MA 1CQPA 1Q0UA 3UAGA 1SRQA 4QU5A 3D4IA 1QFMA 3I1JA 3ZWAA 4EHDA 5LYJF 5TS2A 4BXFA 1QIKA 1MZVA 3PQKA 3FE2A 2XQJA 2OWEA 2IVMA 3W4KA 3GCGA 2J67A 3U6KA 2BEKA 4DYCA 2ID7A 4PSKA 4PSUA 2XB0X 1UXKA 1KO1A 1EVIA 3JTEA 4O4JB 2FPGA 4LK2A 3WTBA 1OFVA 2GLOA 4C7KA 5D4SA 1G16A 4C7XA 4R3WA 3R77A 3TW6A 1POXA 4OYLA 5FWDA 1YRNA 1NR5A 4Y6SA 2C2XA 3L0PA 3LPCA 3UV3A 1TWGJ 3K7EA 1MR3F 1UXGA 3Q85A 4XMYA 3A27A 2XWBF 2IW1A 3NGMA 1NRJB 1QP4A 1PD0A 1SVUA 5ILOA 3ZDCA 3ANXA 2N0SA 4J49A 3PHLA 2RDPA 1ZRNA 4BZXA 3ZLJA 2I6TA 5G0WA 5BY2A 1YB6A 2DSTA 4C0JA 1SMYF 1WDWB 3K9QO 3O3CA 5BN5A 4MVJD 2PRSA 4E22A 2LG4A 3MCWA 5KI6A 3BULA 1K4SA 4BNNA 3IBFA 1Z2AA 2BW3B 3C15C 3SKYA 4YV1A 1CNFA 2CGPA 4TTTS 1FSSA 4M6WB 5FKOA 2ZI9A 2OM2A 3V7CA 5HZGA 3Q7PA 1TM2A 4D4MA 3C2HA 1FPMA 1JHXA 2VJIA 5L3SA 3GF4A 4EMUA 2CE7A 2I4OA 1Q3KA 4BO2A 3C1TA 621PA 3QH4A 2FZLA 1DUSA 3AI7A 4MXDA 3S2ZA 2BY4A 4Z4IA 1BM9A 4LLLA 3H5IA 4DA8A 4KNVA 3JD2A 3EZ9A 2D5LA 2C7BA 3OBBA 4DMFA 1H2ZA 4PLWA 4O2BA 3FF1A 4JITA 2SKCA 1Q6ZA 4Q9HA 2JLQA 5CVJA 4TLBA 4YEJA 3UWDA 4YROA 3U3RA 2I1QA 2SKEA 3VTKA 5KYKA 1WY7A 3FSGA 2W6JA 2BE7A 3I3SR 4P3KA 2OV1A 5I51A 4FYXA 2MG4A 3M4ZA 3DBRB 1NMZA 2IGBA 4QZVA 5I9IA 1VYTA 1CR4A 2MA3A 3LA3A 3T3DA 4XDZA 2ZVDA 2VP0A 2RMKA 2Q5HA 3KAQA 2W4IA 4EG5A 2PCLA 4DIMA 1ORKA 4FXOA 4DOMA 1TAHA 4EG0A 4MJXA 3TTWA 1WCIB 1E17A 3QOEA 5JR3A 2A92A 2X5NA 5FOTA 2X1LA 3HCWA 5FJIA 4DV5B 1U5TC 3C1DA 4MYCA 5LKRA 3QITA 1U8UA 1X80B 3AEXA 4LK0F 4QEKA 4ZOLB 4OXKA 3OJ0A 2HMYB 2QAGC 5CH8A 1YQDA 1MNEA 1KU0A 3F21A 2FEXA 1BX3A 3HZHA 3IIIA 4O8CA 2BGIA 4EQ6B 4RGQA 3EWNA 1NVVR 2XKPA 1CEQA 3GGOA 2ZQ5A 3JQ7A 1A76A 1E9DA 2VAMA 1BTOA 2WPDD 3QE4A 2V1NA 3H2KA 4KXVA 2YZNA 5JZMA 1UOQA 2QGZA 1R36A 3HSEA 4BQAA 1W19A 3LECA 5KNBD 2X6YA 2ZRDA 2PGDA 1EINA 3O91A 1XMPA 4JC0A 1KOFA 4KBGA 2ERYA 1JBEA 2C9BA 4GM1A 3FMPB 1D3AA 4AQYB 4PLYA 4FC6A 2G1KA 2BKVA 4Q4CA 1A95A 3EW7A 3RROA 3NDJA 2RARA 3AEKA 5IJAA 3P9PA 2C61A 2VTBA 1H9TA 4NP6A 1RC0A 1U94A 4ZODA 1DGWY 4DB2A 2HYDA 4EB0A 1HFJA 5K3AA 4MDHA 4TMTA 3ZHYA 3D4LA 1RJ9B 3SDBA 1IUNA 4HNGA 4ZMSA 2C2OA 3A6KA 4IMIB 3VC2A 3R76A 1VGQA 2P81A 3DMHA 2VRCD 3UOAB 2JJ2A 2HXSA 5IG2A 5LU8A 4PY2A 2P2ZA 4H4KC 2ZSDA 2GWRA 4HATA 4BZPA 2REQB 4G01B 4D4JA 4GPEA 1HOXA 1CT9A 5D87A 4CICA 4ZXFA 4P9NA 3B5EA 3MWJA 1R22A 5HXAA 3F8CA 3EC7A 2OHXA 3DQZA 3V4FA 3WTUC 3JRIA 1CERA 3GJ0A 4BKOA 3OOEA 2XCQA 1U2WA 2AG1A 3D7NA 1UT8A 3DDOA 3L0SA 1EK6A 2D74A 4CLHA 1TM5E 4G94A 3F22A 1GNQA 2G1AA 5FBQB 4GXQA 5IEBA 3JATA 5CB6A 2O6GE 4UTRA 4JI7B 3BMXA 4N0BA 3JRHA 4AG3A 5CG2A 1HT2E 5AW7A 3ZEIA 4ARSA 1UKAA 5DOZA 3WIDA 4GX5A 4TWJA 3L8ZA 3FUXA 1YJXA 4L4ZA 5FO1A 3TLMA 3HA5A 4R7TA 3CDIA 5F1RA 1RCTE 3HY4A 4HQRA 4W7IA 2K3PA 3E8MA 5FLEX 4BNXA 3VVCA 4PO3X 1M0SA 4LG0A 1NVFA 4L9RA 4EYKA 2Z33A 2ORWA 1DX4A 1AUPA 1YRLA 1R0CA 1C2YA 2BI7A 1YBFA 3PIOF 1XTTA 5DRTA 5CH5A 1BRMA 3T8RA 2ZANA 4OXNA 1L5GB 3A9VA 4Z49A 3I4FA 5DULA 2W6CX 5AVQA 1PZGA 2ZE6A 4DWVA 3C3CA 3JQGA 4LDRA 1YZNA 3LUCA 4CCJA 1YIOA 3T3NA 1K8QA 4AMUA 3RYTC 2Q41A 4I8DA 1SUDA 1YO6A 3FB4A 2F8SA 3M4XA 2VBCA 4FFMA 1OHHD 1G6Q1 2CKDA 2PH1A 3NBQA 1KI4A 3DE3X 3F2IA 3SYMA 3BJ6A 1ADCA 2IT1A 3CLTC 2J3LA 2Q3BA 3CJRA 3L7OA 3VPDA 5JH7F 1M1NB 3NTVA 5HKBA 2XADA 2IPQX 5HM8A 4FCTA 2VPWA 4X60A 2YWHA 4GVXA 2G07A 3LPMA 3JQAA 2QSHX 2C8LA 3SHVA 4IMRA 1ZIDA 1FDOA 4IDGA 1S5PA 4YP0A 1CU1A 1TMGE 1X1BA 3RTEA 4EOGA 4EEFG 4G85A 3GLFB 4K87A 3FMVA 4LZWA 3FLBA 1ENZA 5FUQA 1LC3A 1ECFA 1GVHA 3LGAA 4GZ3A 2GBLC 3ZD6A 3RF6A 3LAJA 1USVA 4UDNA 4B32A 2HTSA 4FBGA 3FSEA 1JHDA 2PRYA 1PW5A 2AYYA 5C34B 1FP6A 3MUOA 5DU2A 2BW0A 2CDCA 4XNFA 2O61A 1XTBA 2ELKA 3HRHA 4UU1A 1YZHA 5BSUA 1HG0A 5BYAA 1HE8B 1GIAA 2ZAMA 2XZPA 4ZYHA 3GTPJ 1CS0A 4S12A 2QSZA 4XUCA 2VBGA 1GGVA 4YO7A 4G4JA 1GCAA 2IZOA 1FT9A 3EGOA 2WI8A 3VOAA 3A9UA 3QFRA 2X6OA 1XTRA 5FF9A 4MQFB 4DT1A 1BHSA 3OEED 4DM4A 1C50A 3F5SA 2HPHA 3QK7A 2Q3DA 1F8FA 1Y0BA 1YJ5A 5BSFA 3AQIA 1DBVO 2JANA 2O8CB 1NF2A 3SFTA 3KXDA 3CG0A 2PL3A 2IXDA 2ZBKA 3QIVA 1QDLB 4I98B 3L1KA 2RHGB 5KTOA 2JFWA 1TO2E 3S2WA 1WHSA 5C1OA 1GZ7A 1JH8A 1M7GA 1EQUA 4BQQA 4OFBA 4HQLA 3RC1A 1PQUA 3CZPA 1I7SB 3SZOA 4L5CA 3P7MA 2PV0A 1U9IC 2WUDA 1T6YA 3K71B 3A28A 3NFRA 4AIJA 4JYAB 3HFSA 4UUQA 2VE9A 1MJFA 4INPA 4UOZA 3P0IA 1B9MA 2Y27A 1KZ6A 4R1LA 4DJAA 2OUMA 3A1FA 5L6LB 1BR2A 3AUTA 4WLFA 4LDZA 1SUFA 3STVA 2EEZA 3KEGA 1Z4OA 1QFSA 3QODA 2QSYA 3GG2A 2LOOA 1ZNYA 4TS4A 3OQNA 3DDWA 2B0CA 3SR4A 5ITSA 3NRVA 2ZBRA 2I8LA 2HQAA 3FX3A 3CURA 4JUCA 2C7PA 2ZBQA 4CM1A 3UENA 5BXYA 4DE5A 4BO4A 3W5BA 4TYPA 3IUJA 1VKZA 5HHTA 2O8EA 3NHFA 1G8XA 2C4MA 1FFCA 4MVJG 1HL3A 1EE2A 4YLYA 1ND5A 3KOXA 1OXTA 2NUTB 5DYIA 1YE3A 3USZA 5I7FA 3N75A 3MPUA 1QQ7A 4DS3A 4BXXJ 1H0HA 5B5EC 1YS9A 2ECOA 2H1LA 3FN4A 3P94A 5CQGA 4COKA 4UNNA 5GPBA 4I1PA 4Y0AA 1UOPA 1KR5A 3CONA 3BFXA 3SU8A 3LBIA 4IIXA 1TC3C 1MOSA 5LQNA 3S5UA 4AW9A 5FFFA 1YS7A 1KFKB 5A7HA 3GVIA 2GTIA 4HFMA 1V5FA 3QE9Y 2R6HA 3KUUA 4GWKA 1Q0QA 2R7OA 4DGWB 2QJRA 2ZTUA 3OEYA 2ETXA 5EZSA 4YP9A 1NXSA 2Z43A 5DBGA 1GGHA 1O6BA 4HH4A 1Z0IA 2ZROA 4J43A 4QNRA 1SRRA 2Q3HA 4DLTA 2DR0A 4JN6B 4F38A 2QRNA 5EE9A 2CV2A 4ZDIA 4N18A 1BHO1 4HB2A 1UXIA 8ATCA 3CPHA 5IBRA 1VE7A 1M9NA 2E4YA 1ZOIA 1RYMA 2P35A 3GIDA 2LVSA 5BN4B 3WTTC 4G26A 2JHAA 2VF7A 2DFEA 2WUEA 1IJKA 1CULC 1X8JA 5E3HA 1TEHA 1B8OA 3CCFA 3UK6A 3WS7A 4PZCA 5KVAA 1TTPB 3M8JA 3VKUA 3PO3J 1V3VA 3NDRA 3CS3A 4X1OA 3N5CA 1ZCZA 1ZINA 3JXEA 4BDYA 1ECGA 3D8BA 1BX1A 2TMYA 3S1AB 3P5SA 1S9HA 2QV7A 2C97A 2DJIA 4D1QA 4ZOAA 2A59A 2QPAA 3T4XA 2VJNA 2EKPA 3TKAA 3RVMA 1KI1A 4KACA 1KS2A 3N7UA 3ML1A 3MWLA 1BZYA 1YR7A 4KUGA 1CUIA 3P2YA 3K6GA 1ONSA 2C7VA 4C4OA 4OGKA 3VRHA 2G9ZA 1BGXT 2OAP1 1UBGA 1QP0A 5CM9C 1D5YA 3HI6A 2KJCA 4LY3A 3G85A 4G0QA 1KWKA 1QXSA 2PR2A 5DNVA 3G13A 3BXFA 2ZIWB 2O1SA 4M8LA 4PCVA 3D6HA 3QFHA 4EEXA 3SXUB 4WN9A 4EJVA 1IBCA 2X1CA 1JUSA 3GLVA 1D1QA 1XDBA 1D1PA 3ABSB 4WMLA 2JI9A 3JCUC 3ICOA 1QF9A 1NZFA 1CJUC 2W58A 5IC5A 5C2JB 2QQGA 4ZRMA 2LKCA 2B4YA 3RUEA 1PVDA 1B93A 2ADUA 2O7VA 3AF2A 4RHTA 1JNXX 1O96A 1JFFB 2PJZA 2YJ5A 4FYWA 2X7XA 5C80A 3N2GA 4JUFA 5D3MB 1QOZA 4EJUA 4LLNA 5TNXA 2HY7A 4ZVRA 1VOTA 3TR6A 3BC8A 2FEZA 3J7YJ 1YH3A 3M8FA 3BWEA 1QYWA 4R2MA 4E03A 4ZQBA 1OPCA 1G20A 1XWWA 5K3DA 3LQQA 2FWBA 4GZ6A 2QI9F 1GQRA 1QU2A 2X5OA 4ZPXA 3F8MA 1Z39A 2C3MA 1EGQA 5B2FA 3C3EA 2JCGA 2OILA 4LUCA 4NZMA 4H1VA 3L77A 3O5AA 4BUCA 1PGNA 4PCUA 5FADA 1EKEA 4CV2A 3KZMA 1WOMA 1BXRB 2PWPA 4M71A 1XAIA 3AY0A 3W2IA 3HTUA 3F8TA 3TTXA 2VC0A 4JYPA 2EZHA 3S3TA 2HJ9A 1U2QA 1RJGA 3W6VA 3HTXA 3GK3A 4OHKA 2F3RA 2MGQA 4DTIA 4YMSA 4PSXA 2VHWA 1Z22A 4CCMA 3D59A 4C05A 2QN6A 5KJEA 5AM3A 1SMKA 4O5VA 3UH1A 2CXPA 3TFQA 7ADHA 4BWYA 5JNLA 1T3SA 4L0CA 3BHNA 1N1DA 3DQPA 1TWCJ 4I50F 3AOEA 5AI4A 1J0AA 4ZTBA 1SUPA 1CK4A 1N5DA 2OO5A 3G2KA 1AF7A 3L93A 1Y9EA 1DQPA 5JD6A 1H0MA 4RLFA 3UM9A 4HEHA 4B84A 3LWFA 3QBVA 2A7XA 2AF3C 3U16A 4MUJA 4DXAA 3IQHX 3PI6A 5EUBA 1FJGB 3EPJA 5TPZD 1RAEA 3B53X 2ME6A 1YQXA 1ISFA 1DHRA 2C92A 1JEDA 4CU2A 3L7WA 2O14A 1MT3A 2JIQA 3I4CA 2C42A 5H83A 1I2BA 3GZ5A 3CH7A 5K6AA 3KSUA 1S3JA 2RAVA 4AF6A 1UKCA 2PJDA 1T5SA 3L41A 2P0YA 1B1AA 2XY4A 1RUOA 2ZBDA 3CISA 3TPFA 4B09A 2WSSA 4E70A 3CJQA 1WXGA 2XXAA 1PZEA 4PFQA 3GEBA 5DGXA 3FI9A 1KO5A 4RU1A 3A3PA 2GESA 5BOSB 2BFOA 4XDHA 3KD3A 4DCNA 3TOVA 4XFDA 4XQEA 6Q21A 5F1KA 4Q7JB 4HLCA 2XE4A 4WCFB 2Y0BA 4Z9XA 2JBAA 3EUKL 3ULQB 1H8AC 2RHWA 4ZD6A 5EN4A 2H85A 4TVBA 3ZJYA 1B8PA 2VPIA 5DV9A 3HBJA 3PR2B 1O3QA 1D0YA 1HCRA 1EUCA 1X1CA 4BJTA 1FTZA 1I0IA 2WWIA 1XP5A 3DXFA 1HETA 3ITDA 4KHPB 2K5CA 4L4YA 1HYBA 2QTTA 1TWAJ 2W84A 5HLTA 4BE2A 1RETA 1Y3HA 1J8VA 4OXRA 1OH5A 4MQ6A 4Z3OA 4LHWA 2KJBA 4L4UA 5JDIA 4B6QA 4GC5A 4DLWA 4AZVA 4C87A 1GL9B 3Q7SA 2KWIA 3T3EA 4N4AA 4BNDA 2HPMA 5C35A 4QLBA 1T33A 4TSKA 3JALA 1VLMA 2AD5A 1BQ3A 3FYTA 2DERA 4V0QA 2BR4A 4CM9D 2B3DA 2DTEA 3AJDA 3B5JA 4NS1A 3KLMX 4AJPA 3EUEA 2EW8A 3GTQJ 1NFQA 1M2NA 4EQZA 3K4KA 3BMQB 3NP9A 1JU9A 7MDHA 2X4GA 2VWGA 3HB1A 1T4CB 1O6GA 3LI2A 4DLUA 1R0BA 4HVLA 5JJ5A 2NO5A 5E3MA 3R74A 1NN0A 3HBNA 5E8RA 2H09A 2X6QA 2GGSA 5DYMA 4M21A 3BROA 3BT9A 4R68A 4I76A 1PE0A 4NR0A 3E7FA 4HN2A 2H9AA 2QTMA 2TCTA 2VIIA 4B17A 2M0MA 2MSWA 2V7EA 4ZCLA 2ZCVA 4V2UA 2Z5LA 3HGTA 1B4DA 4HZUB 1DAKA 2HDOA 4CM8A 3QX7A 3H8VA 4QUAA 2QMUA 1LVUA 5E1MA 2X4LA 3HB4X 1G8HA 2DMUA 1T1IA 1FOXA 5BYBA 1UP4A 4KN6A 4BL0B 1HLDA 4J00A 1EBUA 3QEAZ 1WPKA 2VJCA 1GOTA 1IH8A 5H3HA 2LY9A 2E6KA 1DUXC 2C2MA 3NBZC 4G0PA 1L7XA 3CF2A 1YUNA 3NUZA 4J0IA 1GV2A 1XXHE 1QJCA 1G2IA 2BKXA 3TB4A 4R1NA 2WSLA 4PWZA 5AW2A 1BDJA 1BE0A 3UN1A 4HWRA 3E7DA 2QX7A 3L8YA 2JA8J 3AFNA 4JK1X 2VWQA 3DFKA 2PKEA 4JYKA 1ZM7A 4LFBB 3CX7A 4KLNA 4JEMA 4URVR 3PDHA 2MIIA 2L02A 4LMPA 1QO0D 2AN1A 3CRW1 4XLFA 1CYDA 4EGAA 1HDEA 5FQOA 2Y76A 3QY9A 4FMPA 3RYFA 2WG0A 3N3AC 1H5UA 4A26A 1ORDA 1CLEA 3M33A 4PR3A 1A4XA 1N3YA 4FEGA 3GJ7A 4LWQA 4V2IA 3JQ6A 4IOAF 2C54A 1NXWA 2WKRA 1PW7A 2QTNA 2IY9A 3UB4A 1V3UA 4MUHA 4AY4A 2DFHA 2V7XA 1Q7EA 1W48A 1VQNI 4A6EA 1ZCJA 4NBSA 4TMWA 2V5AA 3NHZA 1RDFA 5J1SB 3FM9A 4IX7A 2C0PA 3QOFA 1RYHA 1P1BA 2DJ5A 2ECPA 3E3VA 2ZJ3A 4M0MA 4W63A 2B34A 3T9AA 3LFUA 2NRAC 5AMXA 4CT5A 4RTNA 1P92A 4FSDA 2A0YA 1OI3A 2XD4A 3K2EA 3PX7A 2BXZA 1V11A 4Y6RA 3KX2A 1JTVA 3EUAA 2XTZA 4ABZA 2D5IA 4XWTA 3TOCA 4RTMA 3INRA 2H9YA 4I5GA 1M2OA 3AZQA 1EFDN 4DDKA 2I5PO 4NFYA 5FJ8J 1QQIA 3G6EI 4L8LA 1UPCA 4NATA 2E4XA 3TO5A 2P5LC 1J24A 1QHHB 4BEHA 5E1BA 3URMA 4JY7A 4A7PA 2Q50A 1EFCA 4PSAA 5DHFA 2BJHA 2MT9A 1WZEA 5KVSA 3ZNOA 4ZRDA 3CLUC 1YQEA 3OIGA 3QF7A 4B45A 1Z0UA 4Y3OA 4P83A 1XKLA 3DEFA 2R8XA 1S5LC 5IXJA 3H2ZA 2GTHA 4I5EA 4LWOA 2W42A 1U3FA 1HQKA 2ZBPA 4XYBA 5DYWA 2RB4A 3B52X 3I30X 2ZNZA 3HR7A 4ZHSA 4H0CA 1GPUA 4QGSA 4C43A 2AOUB 1MW9X 5B3JA 3WYDA 5K09A 2HCRA 5EAIA 3FLEA 1P33A 3PZRA 5KHOC 3IESA 4G9GA 5CIQA 3HDVA 5KQLA 1ZVQA 1I7DA 3LS2A 5AW4A 1MVOA 3U44A 4PYKA 1XTQA 3I9NA 4OB7A 5K0EA 2RIRA 3W9YA 3I0MA 3E5XA 5FXMA 2M0CA 1VMEA 5AO9A 4WJKB 2EFHB 3HXMA 3UC9A 4EUNA 4FYPA 3KJGA 1HRDA 3NHJA 3UG7A 1IRXA 5HBGA 2XDYA 1AGRA 2HF2A 1CP2A 3I5MA 3CDHA 3UK0A 1P75A 1ISPA 3ZCOA 4M1KA 4WD3A 4DBQA 5FV7A 1L5QA 4WL0A 1DKNA 1UEJA 4U02A 4Z4HA 3ZDDA 2OBBA 1FEXA 4CCOA 5B1YA 1KIFA 1JHRA 3DAOA 5MHTA 2Q5FA 3H2GA 3WMGA 4RM3A 3TS1A 1ZWLA 3OOSA 2Y4NA 4WIAA 2Q29A 2NVYJ 1KZ1A 4IHSA 1YDMA 2P2GA 3JQBC 3G23A 2QTFA 1BA2A 1X6VA 3E8SA 2QL7A 1KQNA 2RD2A 3DB2A 2KZGA 1J8QA 1T9DA 4EYOA 3FXKA 3OQHA 2FF7A 4J7CA 3AI2A 4D9JA 2W2QA 5K3OA 3ANSA 4J7UA 2HRDA 3PL5A 1THTA 4TX1A 5IH7A 2ZG6A 1JSZA 4NESA 4CMBA 2GJ9A 2VQEB 1E3IA 1CRWG 4ACAA 1SOAA 1XD9A 2FPIB 2PL9A 1RR6A 2ID6A 1PBTA 3IVAA 4DRXB 1CHDA 4A2WA 4IIBA 4PSCA 4PZ9A 4IKEA 1EP1B 3J81K 4ZMBA 3FZVA 4GPIB 2EBHX 3F6VA 1R1TA 5TPZA 4XLCA 3X1JA 3U4AA 5CNMA 3TL6A 2VTEA 2X9QA 3QYFA 1AV7A 3G1MA 5J1YA 5JI3E 3CCRI 2P30A 1Q12A 1Z47A 4MGRA 4IF4A 3O4HA 1AZSC 3F1LA 3HCEA 4GYWA 3IEVA 4P4SA 1NW8A 1Q1QA 3LCVB 2AK3A 5ADWA 5AXDA 3BF8A 4GYGA 1UANA 2X8LA 1ZLKA 3HDDA 4PC1A 2LPMA 3QYBA 2BHTA 3DKIA 4RD1A 3CX6A 3H2HA 3OZIA 5ILQA 1FFXA 3HEFA 2LY1A 1QC5A 1Q0TA 4H6PA 4KWCA 2AKEA 4OU4A 3E3NA 3S15J 4GWGA 5F3DA 2ABWA 5GTIC 1W59A 2XGEA 1SUBA 3E84A 1XZDA 3OCUA 4NNPA 1CVLA 5HDKA 4RGBA 1NVTA 4F21A 2HOEA 3LK6A 4URXR 4XASA 2HGCA 4DLBA 4I4CA 2HR3A 1KH2A 1C80A 5F9MA 4OLBA 2HNKA 1IN8A 3HBAA 3H4MA 2NNNA 4UV9A 2M7BA 2IRFG 3N0RA 2DHQA 2OESA 1J49A 1HDOA 3G3ZA 4NK5A 4LCJA 3MMNA 3WFJA 1QCZA 3GGPA 2VOJA 1R9GA 2A3SA 3ZKWB 4I8XA 3GFPA 3CZRA 5CLHA 3PGJA 4MZDA 1MB4A 3BCBA 3ZU5A 3U39A 3OWXA 5G4KA 3SBEA 3QWBA 3QKRA 1LH0A 3H99A 1RYYA 4PR0A 1K97A 1KZ9A 4W1RA 1ZVKA 3QU3A 4MR8A 1M8JA 3A1UA 3VBCA 5FFMA 4JKOA 1O3TA 2ORYA 3VMMA 3FSGD 1DWPA 2OFFA 5DNWA 4UEQA 2C5HA 2BGMA 3AXSA 4CM9A 2E1NA 3Q7TA 4JDPA 2EF1A 2HSEA 3TE6A 2AD1A 2BFWA 4OY3A 4M8SA 4OK3A 3H92A 2QZJA 1JKQC 2DBZA 3EPLA 2DZDA 5ARCA 1ATIA 2CFSA 1U8ZA 1N25A 3WK8A 1ZD1A 1E4EB 4RY8A 3O1JC 3PJDA 5IYZF 2OBNA 1ULUA 3I3OA 1DAPA 2WHEA 1EA3A 1A36A 1UBSB 3TBHA 4KT6A 4KQIA 1QTNA 1NP7A 4J03A 3WZ2A 1NQWA 3FR7A 5EEAA 2VQSA 2XRYA 3GFLA 5H9WA 3RUHA 3SF0A 1YDGA 1U1FA 1C3OA 3PTZA 2P0EA 3O8GA 4GGGA 2H4JA 5H68A 3BSWA 5LVAA 2G17A 3WYGA 4Y4RA 3HXTA 1B7GO 4LOIA 5DN6A 2HWYA 1HKHA 1EXVA 2ODPA 3RBZA 4PK4A 4FUTA 4LMAA 1UWKA 1GDDA 3OWHA 3B1YA 2J9FA 1N34B 3FBTA 3GRVA 3RUFA 4EM2A 2I2DA 5LEKA 1SD4A 4B44A 3PUBA 1YASA 4JL8A 4XLLA 1MBHA 1N2XA 4EVRA 1MHTA 4X64B 1TJ4A 5JHFA 4FINA 2PKRA 3IBYA 1N8NA 3CUVA 4DV1B 1QTIA 1PD1A 2Y75A 1F5SA 1QX3A 3NHSA 4II2A 1Y8CA 1FQKA 1P45A 2QRMA 4B0PA 3BPVA 5BVGB 4O2RA 1JLHA 2ZIZA 4U39A 5IKEA 3UJ6A 5IJ0A 3QPAA 3O8DA 1D8TA 2Q46A 2IGKA 2CLFB 3FMQA 5EIXA 2UZ4A 3ZGLA 1GDHA 1FUEA 1BFDA 2AHOA 2I29A 4QUEA 1TW3A