1XDUA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with sinefungin (sfg)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
340
Chain Sequence
b'LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RdmB
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
total genus 101
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xduA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xduA03
2AOUA 1OYWA 4RVGA 3J81K 4YMGA 4YIIA 1K6OA 3LDGA 4Q48A 4XLNF 4AUKA 4Y17A 2C7QA 1H1DA 3M1EA 1X19A 2O05A 2PY6A 7MHTA 2IT0A 3BZ6A 5EIWA 1HKQA 4XUEA 4FP9A 3RDIA 1PJZA 4IRGA 4B09A 1ZLKA 4MTEA 2HDCA 3LBYA 5FHQA 4XRFA 3G2OA 4IPAA 2PSSA 1I1GA 4DZRA 3B73A 2VP3A 3BROA 5CLSA 3HTSB 2PI0A 2OZVA 1KQ8A 5DXAA 1EAMA 2XHKA 4MEXF 4GUAA 1J2XA 1Z91A 1V3FA 2MH9A 3TOAA 1WI9A 2DBBA 1IF1A 4L0YB 1JGSA 4LK1F 5EKUA 2DK8A 2PLWA 2FRXA 3F4KA 2G1PA 1NW3A 4E2XA 3OPNA 3GFMA 5D4RA 2EB7A 3TO9A 2XKPA 3LA2A 5BS6A 5K1YA 2XVAA 2AOWA 1LEAA 1MDMA 5K0CA 3GYHX 2VDVE 1V4RA 2H6BA 4X60A 2ZCJA 4PZJA 4EJVA 5GWXA 3VSEA 2CGPA 2OQRA 2ZMEA 3OE5A 1IN6A 1SD5A 5CVRA 4AZWA 4GOOD 1FJXA 4RSRA 2HKXA 4ON0A 5HLGA 4WXHA 4M71A 4GOLD 2EA2A 2ADUA 4PYMA 5FHRA 1S8NA 5DX1A 4YUVA 4M36A 1B4AA 3TO6A 4YUZA 3F72A 4HGYA 1XCVA 2DQRA 2K4BA 3WGGA 5FGMA 5H6QA 2PJPA 3EGIA 3RKYA 4QWQA 3FTEA 4L9TA 3MCZA 5BW4A 1LNWA 3IEIA 4LG1A 4RTNA 4ENJA 2YUIA 2DAOA 2UYOA 2XVCA 1TQMA 4CWAA 4A0YA 5GM1A 4V0QA 1KYWA 4WXCA 4PINA 5LHGA 5DM4A 5E1DA 2CL5A 3QAHA 3DP7A 4UVCA 2EFJA 1SQGA 4WCGA 3DPTA 2PN6A 3BWGA 2PX5A 2DU9A 3R61A 4R8HA 3WTVC 2AS0A 5K05A 4UHTA 2D2WA 4LECA 2EFWA 4M74A 1SFUA 1ZHFA 2ZW9A 3EEOA 2B25A 1FZPB 5E9WA 3THRA 4PYQA 4YFXF 1K78A 5HS7A 3V8KA 3AXTA 1XSVA 1GHCA 2O03A 1KA8A 5L3FA 2IH2A 4EM1A 5LQNA 1SUSA 3LCVB 3B5IA 4HGZA 3KQOA 5DD4A 3DXYA 5DXJA 4QDKA 3FPEA 3TM4A 1AWCA 3M6UA 1ZGAA 3WTXC 2OO3A 1XVAA 3DULA 2PT6A 3VC2A 5CCXA 2ZO4A 5FUBA 5BXYA 5L3GA 5D1HA 1S7AA 4RAYA 2ZIGA 1T0FA 5LGTA 4DCGA 4LMYA 3HOSA 4DMGA 2ISYA 5KQSA 1N7JA 4Q4ZF 1BC7C 2MA3A 2JH8A 5FADA 2Z3YA 1QPMA 4MQ4A 3LAJA 3UFBA 2AOVA 2ZNZA 2JRTA 2LD4A 4P55A 3A26A 4IV8A 3WODF 3FPJA 2EFNA 1U78A 4KDPA 1XB4A 2E1NA 3DEUA 2NYXA 4PGGA 5DX0A 4O6JA 1G60A 1HMYA 3KE2A 1KPGA 5LSAA 1T39A 3I59A 5DUKA 2IP2A 2OPBA 2FE3A 5FFZA 2AS5F 2F2EA 3CUQB 3LPMA 4EGYA 2KJBA 3F21A 2XKOA 3KP7A 1W5TA 1E2XA 3BP8A 1SQFA 4I09A 3BY6A 5K0FA 3PVCA 3C3WA 3ANXA 5ERIA 3OFJA 4RGXA 2L4AA 1AOYA 4HLXA 2OKCA 1WKMA 4PIMA 1LEBA 5KVRA 1HW1A 5LHHA 5C1IA 1ZARA 3M33A 2GXBA 3E23A 1FP2A 2OZ6A 3KQPA 3WTSC 1NBHA 3DTNA 3PS9A 3MQ2A 4P96A 2RDPA 3UJ9A 1G3WA 2XYRA 3H2BA 5FCDA 1P2FA 3NWBA 3HCBA 2TDXA 3E6MA 3BGIA 1XTPA 5GOZA 2P8JA 1FYKA 3LL7A 1SMTA 4Y2HA 4JQFA 4PYKA 4EM0B 4LG0A 1FBNA 6PAXA 4ASNA 4ER0A 2OQGA 1XCBA 4CHUA 3WU1B 1TLHB 3R9XB 5U4XA 5D5VB 4DM3A 2P4WA 3G2QA 3FUWA 4XUCA 3G5TA 3Q5FA 1I4WA 1U3EM 4KRGA 3UA3A 3LKDA 1XMAA 5J8FA 1EJ6A 3PFGA 10MHA 1NT2A 4HAMA 4OIOF 5DWQA 1KQ0A 3GEZA 3KR0A 4RS8A 3ME5A 5JVTA 3WTUC 5DT2A 3SSNA 2ETHA 4MTLA 1Z05A 1JSXA 1WSUA 1FY7A 3FPGA 1DP7P 4G56A 3V97A 2GIVA 2QLZA 2L02A 2L3DA 4EV0A 5IT9K 2G7HA 2BE5F 5DTMA 4O5VA 1ZREA 2P5KA 2UZKA 1SKMA 1E17A 3DLCA 1HKSA 1NV8A 3DMGA 3HEMA 4I98B 2C7RA 2XYQA 1EIZA 5LQKA 4QVKA 2RVCA 4KUMA 3BDDA 5FD6A 4RX1A 2BV6A 1BIAA 4UXNA 1F3LA 1SUIA 2DT5A 3QOWA 2EG5A 2JPCA 3P9KA 4HF0A 1FC3A 4GF5A 2RGVA 1YB2A 3BGVA 5J6XA 5K0EA 3DUWA 3FYCA 1LJ9A 4QTUB 4U7PB 3ER8A 5KS2A 3UJDA 3BJAA 1GXPA 5DSTA 3L09A 1BC8C 4OINF 5AIPA 1J7KA 1QAQA 1F5TA 2Q8KA 2XYVA 4IRIA 2P5LC 3MAGA 3FUUA 5LLQA 3IV6A 1ZYRF 4QLCU 1ON2A 3B02A 4L7VA 3KQVA 4AIJA 3HNRA 4XLPF 2FHPA 3L00A 3HRUA 5D4SA 4RTOA 3IKVA 4EJUA 1J9IA 5EMMA 3VC1A 2QBYB 1OMIA 3HCAA 4EJWA 5DPMA 4AD9A 2H94A 4YUYA 2ZLBA 3Q9VA 2M45A 3ER9A 3H92A 2HWKA 2K7LA 1WXWA 1ON1A 3T7TA 5DTRA 5HS9A 1KYZA 1R7JA 3UJ6A 1UFMA 1G6Q1 2P3OA 4S04A 5EMKA 4YV2A 4KDCA 2Y75A 3HSFA 3M6WA 2WC2A 2VZ9A 5E18F 4R8RA 1QZYA 2PXAA 4E30A 4EKGA 2D1HA 3OZSA 4QDJA 3P9CA 3J80Z 1IZ1A 3WTWC 2K4MA 3PB3A 1J5YA 1RI1A 4FX0A 2JT1A 2V79A 1VTNC 5EHIA 1B42A 1PDNC 3JW4A 4GO1A 3CJTA 2ORED 4EVIA 1FSEA 2AVNA 5K0JA 3OFKA 2AOTB 1D8KA 2ONYA 4MQ9F 5DEQA 3WTTC 1R1VA 5DTQA 4R6XA 2ZKZA 1IUYA 4WXDA 5T67A 2VT3A 3MHTA 1IXCA 3TO7A 2IFTA 2FMLA 1I1SA 1D2GA 5EG5A 3UJAA 4POOA 4G6DA 1F38A 2ZNYA 3BZBA 1H9TA 3KR1A 4K2EA 3EVAA 2VBYA 2LF8A 3LCCA 2QM3A 2DO7A 3RPQA 3JTHA 3RJPA 1G6NA 4R6WA 2XVMA 1LDKB 3HVIA 4RGSA 5L3EA 4G7OF 3P71T 3F6OA 3R6SA 5DLYA 2ADMA 1MD0A 3V4GA 3IL2A 1EG2A 3ID6C 3LDFA 1GXQA 3H3UA 4BNCA 3LQQA 2HNKA 2BM9A 3C6KA 2QRVB 1W7PD 3I58A 2OBPA 2IH4A 3GRUA 5K8VA 1UCRA 1TW3A 5E20A 4CO8A 1JG3A 4GYIA 2F8LA 5FQOA 4OMYA 3HCDA 1XMKA 4LLGF 5ED4A 1DPUA 1JR4A 3EETA 4X1OA 4X63A 3RODA 2VS1A 5AIQA 3F3XA 5LHIA 2L4MA 4G8XA 3KPWA 4NB5A 4ESBA 2P3QA 2H00A 3GU3A 1JG1A 3OOPA 5D5UB 2ZCWA 5KK1A 2FEZA 1IXRC 2ZBKA 3KP5A 2XROA 3UJBA 5FLXK 4CKBA 3D5LA 4IXAA 1BHJA 4MEYF 3KETA 1L0OC 5HS8A 5E17F 5HDNA 5CUQA 3G73A 4HBLA 3GCZA 3LQRA 3KP2A 2PFBA 4KIBA 3KEQA 5BOXA 3R3HA 1SMYF 3CJNA 2VBWA 2JH9A 3EVEA 1JHHA 4R05A 1T98A 5K5OA 1S3JA 4B8XA 1D8JA 2Y1WA 2NP7A 1KR5A 3HRSA 3IHUA 1IN4A 2R3SA 3KPJA 2HTEA 2VE8A 2YXLA 2BEOA 1AF7A 1EH8A 3L2CA 5T6BA 3HCFA 2ZFWA 3CUQA 2RKHA 3SXJA 3Q9SA 2EFOA 3UJCA 1B6AA 1UHMA 4JK1X 1WG8A 2JJQA 1BOOA 3F8NA 1QANA 3PTAA 2ZXJA 1UB9A 3DF8A 5HOOA 3HVHA 4E33A 3BWBA 4KWCA 3EQLF 3OU6A 3KP6A 2HV9A 2HMYB 3HP7A 5E8IA 2YPRA 1YS6A 2VOPA 2M30A 3DMHA 4RB1A 4A2UA 3HHGA 2AN4A 4BLUA 4U7DA 4NHJA 4PIPA 3A7DA 1QNTA 2JHPA 4M6XA 1H9GA 1LDDA 2HZTA 1TNSA 5H20A 1M0EA 3GZ5A 4BAYA 3CO7C 1T43A 1QQIA 3W6KB 3DR5A 5JI6A 2IA2A 2W25A 1FBUA 3KP3A 3BWMA 3MFKA 2FXAA 1FYLA 4RTRA 4CTKA 1O9GA 2I6GA 4ER3A 2VBXA 2IRFG 4MHTA 2QYOA 4LB6B 2DPMA 3NDIA 1YQAA 3CLOA 1MZBA 4ATNA 3HSEA 1HW5A 5LGNA 4HSGA 4RB0A 3UA4A 1A04A 5IT9Z 2JHCA 1MHTA 1G3TA 2EX4A 3QPHA 2A69F 4GCVA 3E97A 4WVLA 5FA8A 1S7OA 2PWPA 4FSDA 3MZHA 4G9YA 3OU7A 5EEHA 3L7WA 5E8RA 2XUBA 2O07A 3CJRA 5D5WB 3X0DA 3DMFA 4P58A 3KQMA 3G8AA 2PT9A 2QQBA 4PYIA 3EMDA 3R60A 3RYRA 2UXXA 4GOMD 3G5LA 2V6CA 4MGRA 1X1BA 1CF7B 4KMFA 4RWZA 3LFKA 5HLIA 4KA4A 1JXSA 3I9FA 1L3BA 4RVHA 3TOBA 4NQWA 4P9UA 3DQVC 2IVMA 1ZRDA 2PGXA 3WE3A 2UYCA 4KNYA 4Y30A 1OKRA 5JFRA 3GO4A 1K79A 4U88A 1TPYA 4BYYA 1IY9A 4LWPA 5K5QA 3P2IA 5HDKA 4O3MA 2J5PA 3O2PE 2OB2A 3T0YA 5LRSA 1JSZA 4E31A 5A2QZ 5LBQA 2Y48A 1RJEA 2XBMA 1KPHA 1QAOA 3CC8A 2IGTA 2GH1A 1P4AA 4YFKF 3I0TA 4IHTA 3VOEA 1G8SA 2GAFA 3BKWA 1FPQA 1X3UA 2Y0MA 3QOXA 4UUVA 1J0RA 3NVMB 3K0BA 5KVAA 2GAUA 3H3ZA 3B3GA 4FT2A 2E7WA 5K01A 3C6MA 4X41A 1KPIA 4DNCA 2VDWA 3LA7A 1TBXA 2V1XA 2ZIFA 1BI2A 4KVZA 1B59A 1T6SA 5FD5A 2PG4A 2Z9OA 3TQSA 2P7VB 3TFWA 5K0NA 1BC5A 2EV6A 2NXNA 3G88A 2FU4A 4ENKA 3RW9A 1YTYA 5LRRA 3EDPA 1U2WA 2B3TA 1BOAA 3MZYA 4CXMA 2PXXA 2FSWA 1P4WA 2XAFA 4FX4A 4YG2F 5LGUA 5H02A 2K27A 2AOTA 5E8GA 1DPRA 3SHFA 1AQJA 5CD1A 5E9QA 2YTZA 1I9GA 3BPVA 2IDJA 1FBQA 1U6GA 2Y1XA 5K0LA 2UZ4A 3E6DA 3F8FA 3OCJA 4DF3A 1NBIA 3RI4A 2ZWAA 2B9EA 4M38A 4LD5A 1JG2A 4E2WA 3GRVA 1GVJA 1IN5A 4RTLA 5FWAA 3HIFA 3KPYA 4EMSA 5D6EA 4KN4X 4GOND 5DCMA 2FBHA 1DUXC 3JSPA 1UFKA 2YR2A 1ZG5A 1RUOA 3SZTA 2PXCA 4L9NA 4BY9E 2VN2A 4H0NA 3TDZC 4N0BA 2WWYA 3F22A 3EYYA 2UYHA 1RI4A 2RQPA 3QOPA 3GFIA 2ZZNA 2STTA 2QENA 5M5BA 4BHCA 5JR3A 4R8SA 5HIKA 2WV0A 3FMRA 1OYIA 4I0BA 3NDJA 4Q5SF 3ELWA 2QRVA 2N47A 2UXNA 3FX3A 4PWYA 5E9JA 4XBFA 3T8RA 1ONVA 5CVJA 2A68F 4QVGA 3GZ6A 2FBKA 4I7HA 3CDHA 3UJ7A 4D0PA 5F6FA 2PX8A 1HXDA 5K0GA 5HLHA 4L9JA 3KPUA 1X1CA 3MGGA 3PLAE 2M8EA 3KZYA 4FGZA 2XAQA 2ACJA 3JWJA 4RTJA 2K4JA 1HNNA 1PRYA 4KT5C 3U1DA 1KU3A 3K1PA 3REOA 1FYMA 3KKZA 4LWOA 3UJ8A 5L3DA 3QRFF 4OIPF 4C05A 2HYFA 1SFEA 1EV7A 2BH2A 1JG4A 3R4KA 3E6BA 5GINE 5DUIA 4V0RA 2LKPA 2ZIEA 1R22A 1L9KA 3CKKA 1YW9A 2LF7A 3EGEA 4DA4A 3QP6A 4ZYEA 3M6XA 3WU0A 1TQIA 5CVUA 2NS0A 5LQUA 5KYGA 1U5TB 2PMUA 3V8JA 1BI0A 4IWNA 2FNAA 3RIEA 5LEJA 3GRYA 3KQQA 2P7CB 3BGDA 2V9VA 3JWIA 1B9MA 2GA1A 2HGCA 5K5RA 3KFWX 4HV6A 1VQ1A 1YF3A 3ZMZA 3KQTA 3MEXA 3TGNA 1FT9A 1I1NA 3CBGA 3TKYA 2Z6QA 2D1VA 3TQNA 4PYNA 3P7NA 4LB5A 3EVGA 4GC5A 4OQDA 1KHHA 1R00A 3UZUA 4F7ZA 3ZN1A 1QO0D 3Q87B 4KIGA 4CYDA 1FBSA 1G8AA 4HG2A 1I27A 2P7HA 1R58A 2UWMA 5EKXA 1XN7A 1VBFA 3SQNA 3KPVA 5IH3A 3WTYC 2G8NA 2ELHA 3HCCA 4HC4A 2H1RA 1R6AA 3R24A 4ISCA 5DRTA 4R1HA 3VFZA 3J81Z 2OXTA 2AXLA 3C3YA 3CO6C 5L3CA 2D45A 1RIOH 5E1BA 3QP5A 4ESJA 4GXOA 4G7ZF 1P39A 2JHAA 5DM1A 4PCAA 1BBYA 2AZTA 5CVVA 1ZH5A 2XAGA 2M87A 2VBZA 2DLLA 2FQ3A 4AIKA 3SZPA 4HX8A 3EVDA 1INLA 2WA2A 4CKCA 3I53A 4LFUA 4EJTA 3TMAA 3HYIA 4WF2A 1Z1DA 1TQPA 3WGIA 3SXYA 2KIUA 2B78A 2GLUA 2PJDA 1PP8F 4QPPA 2BGCA 4DKJA 3G2MA 3CGGA 3PQJA 2OY0A 2GZWA 2GQQA 5EPEA 3CTAA 2IBSA 1WY7A 4GQBA 1Z7UA 3KP4A 2EFQA 2DTRA 3ULQB 3BPXA 4YUXA 4BLVA 1NW8A 1G3SA 1XGNA 3EYIA 1TW2A 3GGDA 1RZ4A 1BI1A 5ILUA 1DUSA 4KICA 1F1ZA 2HEOA 4IV0A 2W84A 2Q41A 5TJJA 1EH7A 3LDUA 1MDMB 2VOOA 3O6BB 3C18A 2W24A 3EMBA 5P8WA 1D5VA 3GO5A 3ERED 3VODA 3ABTA 1YYVA 4YIFA 4QPNA 2V74B 2XRNA 1FP1D 3RPUA 4EK9A 1ORHA 5E8JA 2FK8A 3OE4A 4RTKA 2IPQX 4UNOA 1UWVA 2NXJA 4WX9A 3P8ZA 2A61A 2E1CA 5GM2A 5GIPE 5F2NA 3WG9A 5F2OA 4YFNF 5DSXA 3HA3A 1O54A 1O3RA 2Z99A 5H6RA 1FX7A 3FXUA 5LQRA 1SVUA 1U5TC 2FRHA 3PX3A 3ORHA 5DM0A 3TM5A 2OAZA 2FMYA 5F2KA 5IT3A 3MQ0A 4JBAA 1N2XA 3E7PA 2G70A 3L8DA 2H27A 2JPBA 1XSDA 4RVFA 4CKEA 4S05A 4GEKA 2X0LA 1RJGA 5F64A 3K69A 2C6YA 3KQWA 4GBED 3A4TA 3E5QA 2ZFUA 2PLYA 3GUDA 5HOQA 1NHAA 2P7IA 3DV8A 1JQDA 1IW7F 2BR5A 4RB2C 3AWIA 3TLJA 4I2OA 1L3LA 1QYRA 3C0KA 3IYLW 2EJTA 3F23A 4Y15A 3O31A 3G2PA 2IA0A 2EJUA 2H09A 2BZGA 2ZBRA 4HTFB 5LQJA 2O6GE 4GGGA 1IXSB 3P9NA 3MWMA 3FPHA 1FOKA 2VXZA 5BPDA 1MJFA 4HQEA 1D2CA 2HQNA 3I4PA 1J59A 3L9FA 2P40A 3S68A 4AZSA 4G94A 4B17A 1T38A 4DQ0A 5D8KB 3SSMA 1MJBA 4N9IA 1XGSA 4RTSA 1SD7A 3G89A 2C7PA 3IWZA 3ZMVA 4FT4A 2M1BA 3S2WA 1YFJA 1HSTA 3RYPA 4P7FA 1P1CA 2IBTA 2YXEA 3BWYA 4U7TB 3CVOA 3P2EA 1JE8A 3M8FA 2GWRA 2ISZA 4RVDA 3FTFA 4UV8A 3NVKI 1RNLA 3FXQA 4HYEA 3KLOA 4ER7A 1K7AA 1HQCA 2O57A 3FMQA 2I9KA 2H6CA 1Z6TA 3IHTA 2G9WA 2KRFA 2FCAA 1G38A 2JZYA 5F1RA 5K03A 3K1MA 5C9ZA 3DH0A 5LQCA 4U0YA 1RJDA 3DFGA 4ZYHA 1REPC 3HVKA 1O7LA 4CICA 1XGMA 4FR0A 2P41A 2OD5A 2KW5A 3C7JA 1OR8A 4HH4A 4PNEA 1XCJA 5DX8A 1YFLA 1O9HA 1P4XA 4RGUA 3T5XA 1ZRCA 4M9ZA 2I62A 5EVJA 1RUNA 4Q47A 5AONA 1Z3CA 3U2RA 1HW2A 4C07A 3WGHA 1XGOA 1RJFA 4BP1A 1NKVA 2CWWA 5LR6A 1W7PB 4U7BA 1R1TA 2HQRA 2ZZMA 4P7KA 1JTEA 3I64A 1BIBA 2IW5A 3GVAA 2HWVA 2DQLA 2P3LA 1KQ9A 2IPXA 1DCTA 2ESHA 4U0VA 4WK8F 2CWEA 1V39A 2EA4A 2I7CA 3HTUA 4HA8A 2STWA 4KDRA 2ZZKA 5HFJA 2AN5A 3SR4A 3GNLA 4HX4A 3WSTA 1WWXA 1TNTA 3M8EA 5ILVA 2LDUA 1BN5A 3K1NA 1YO5C 1YZHA 3E8SA 1ZLJA 3MB5A 1FSHA 1WS6A 4ZZLA 2NXCA 1U8RA 3TDUC 3IRQA 3FPFA 1G55A 1FLIA 3RKXA 3KZZA 2MBFA 4A0ZA 3FRHA 2IJLA 1W5SA 1R74A 3AAFA 1D2HA 4HOBA 4KMUX 3K6RA 1H0MA 4KW7A 3W6JB 3QU3A 5FO5A 1KU9A 2XV4S 2VE9A 3ELKA 3MAJA 1JTFA 3E5UA 2V1DA 3A7EA 2GPYA 2K86A 4OBWA 4X61A 5EQJB 2HTSA 2G71A 2OU2A 4BQAA 2PX4A 5EZSA 4RTQA 5LQAA 1VP3A 4FS8A 3BOQA 3MTEA 2UYQA 3IKTA 4BH9A 2X4HA 4BP3A 4AZTA 4OQEA 4PYOA 4UVBA 1YUBA 5DM2A 3VB2A 3E6CC 9MHTA 3HHHA 5JHUA 3UWPA 3JAMK 4E70A 1RI5A 3HA7A 3VYWA 5FULA 2MLGA 2L54A 3GFJA 1QBJA 3SX0A 4XUDA 4H0EA 1WZNA 4G7HF 4MNUA 5D5XB 3C3PA 2HFHA 2C7OA 4E2ZA 3KR9A 2ZSUA 3E5XA 4M72A 1O3TA 1UIRA 1XD7A 5CVDA 4OX9Y 1IXKA 5KQRA 3JTGA 3RKWA 5EHGA 3ZMSA 3LCUA 2ESRA 3I5UA 2IIPA 1I6XA 3O3KA 3DOUA 2MH2A 2J5OA 4RV9A 1G3YA 1SFXA 3FTCA 4OOIA 1N7IA 1LVAA 2YVLA 3NEUA 4IF4A 4LGWA 4AWXB 2AVDA 4HLYA 1KGSA 3FRIA 1O3QA 2QQ9A 2DW4A 3DXXA 4CTJA 3FMSA 2KIFA 2IDKA 2E7XA 1YG2A 3ZMDA 4ETSA 5G02A 1P92A 3FTDA 1R8XA 4C08A 2HR1A 2QBYA 2O0LA 2BM8A 4ESFA 4E2YA 4ER5A 2QWWA 3KQSA 3LA3A 3P2KA 4F85A 2ZBPA 1R23A 4LLLA 4RB3C 3RIRA 3WTZA 4LJZF 2QVOA 3PX2A 3NTVA 3GX4X 3LX6A 3EPPA 1KIAA 3T1BA 3AY0A 1BKYA 5EZQA 5DV5A 2P1DA 2QQAA 5BQTA 2COMA 3HOTA 1ZQ9A 2ZTHA 2ZWVA 3V7RA 4RTMA 3J80K 1YFHA 1Y8CA 2XASA 4BLWA 2YU3A 1ULYA 4M73A 1R36A 3JWGA 4MTDA 4ZYGA 1L3IA 4YV1A 3EUHA 4A12A 4HZFA 2P5VA 2NNWB 5FWDA 4F84A 2PMHA 1I5ZA 1SD6A 4MIKA 5CCBA 3U9GA 3GFLA 4I02A 4TV7A 3NMUF 1IRFA 3J7AO 4HV5A 2Z6AA 1XSXA 2PEXA 4CZZA 3K9TA 2BR4A 2HTJA 2CKDA 2FPOA 1J75A 1VPTA 2WK1A 5EIFA 2Z5UA 3LGAA 3ERCA 3O4FA 2NYUA 2Z6UA 2VC0A 3JSOA 3WE2A 4HF1A 3LWFA 3M4XA 2GA9A 1Z9CA 2JG3A 5D6FA 3KLNA 5DCFA 3QV2A 4PONA 1EH6A 3IC7A 3ZP5A 5FTWA 3EGVA 4KIFA 3HCEA 1WQ2A 5L3BA 3BUSA 3K2ZA 4IHSA 1BI3A 3GF2A 3ZPLA 1Y0UA 3GIWA 2EV0A 3G8BA 4A0XA 3OZTA 3HM2A 4PGHA 1EJ0A 4PYLA 3B3FA 5E1OA 1WRJA 3LSTA 4HTFA 3FXRA 3DPLC 4PCQA 5BP7A 2HYGD 3R0JA 3MCTA 4FSXA 1STZA 4IKPA 2HS5A 3TRKA 1ZGJA 2PVCA 2GXGA 3TKAA 3E05A 1HKTA 3O7WA 2EWNA 4C03A 4LLNA 1NW7A 1R5HA 4EGZA 2R7DA 2ZJ2A 3K0LA 2O0YA 2Q2EA 1RI7A 1Q1HA 1XXLA 3NW9A 2PBFA 1XDUA 1QGPA 3QPTA 3OV8A 1XCLA 1XDSA 3A25A 1Z6RA 4Z2YA 4HF2A 1VLMA 2OB1A 4PDKA 5FLXZ 3ELYA 4A5MA 2MC3A 3T7SA 1USTA 2MD5A 4NECA 3HTXA 4DQ2A 3M9AA 2DPUA 3ISPA 1JQEA 4F86A 8MHTA 2O8XA 4OU0A 1D3YA 2CMGA 2FK7A 3LKZA 1YZ3A 4RTPA 3FUTA 2VT2A 3NWEA 1VL5A 5DD8A 3FWEA 4BHPA 4L9VA 3KHKA 5EC8A 5ICEA 5BPIA 2AR0A 3MTIA 3EVZA 2FOKA 5K09A 4YUWA 4EQQA 1ZAOA 3SVZA 3CJQA 2GB4A 3SGLA 5ICCA 5ILSA 1LQ1A 4KFCA 5DRYA 1LB2A 3V8LA 1T2KA 1OYYA 1NW6A 5HZMA 4Y13A 4M6YA 4K6MA 2P8TA 5GP1A 2ONZA 4LK0F 5E1WA 3ZMUA 3AXSA 3HSRA 3DXZA 3B3JA 3V7CA 3T0IA 2RNJA 1W7PA 4KN7X 2PWYA 3FYDA 3BJ6A 2CFXA 1BJAA 4OBXA 2HOEA 2YXDA 2MLKA 1ODDA 3U81A 4M9SA 2KIMA 3DXJF 2LSOA 3NJRA 4WWCA 1USSA 5HDGA 1NE2A 2WA1A 4BXUA 4M37A 1FWZA 1FNNA 4AIHA 4R79A 4AZVA 3T7RA 2PBIA 3ABUA 2HR3A 3KQYA 1SD4A 1O3SA 5E2BA 4L18B 2NRAC 4U0WA 1P1BA 2PX2A 2QE6A 1KP9A 3KR2A 1ZG3A 1OR7A 2CSOA 1KU7A 5ICGA 1X1AA 5CIYA 4P5OA 1IAWA 5CJ9A 2CG4A 4G6QA 2O3FA 4KYWA 5E1MA 5EMLA 2OA4A 4I0AA 2YSRA 2IH5A 2V1UA 4QQNA 5EOVA 5TRDA 3MERA 3ECOA 1R8YA 2AOUB 2DK5A 4CXFA 1S6LA 4A6DA 3OZRA 5B1SA 2CYYA 2DI3A 1AQIA 3UBTA 4OA5A 3LECA 5CM2Z 2NNYA 5MHTA 1L1EA 2F5FA 3GW2A 3COAC 1C0WA 4O29A 1MKMA 1P91A 3LHDA 4FZVA 1M6EX 2DFIA 4EQZA 1SG9A 1LDJA 4ZZDA 4HX7A 3HRMA 5IKMA 1ZN2A 3JAMZ 1HSJA 3T8TA 1G4DA 1VP9A 4XSZF 3D2LA 4RGRA 4M7RA 5T64A 2FYTA 4IJAA 2P6TA 2NP6A 4GYGA 4HDVA 3PT9A 1W4MA 4FHTA 3BXOA 2GS9A 4OIQF 3M7GA 1ORIA 2JTVA 3ZQ7A 5ICFA 1CF7A 5DYMA 3PQKA 2V7EA 1SAXA 2XIGA 2O61A 5E1ZB 4CGZA 5FFXA 3GJYA 4L0ZB 2O06A 2FNPA 3LAPA 2R6ZA 3IRRA 2F5DA 2IA1A 4EM2A 2VODA 1BM9A 5C0OE 2YX4A 2ZMEB 3R0QA 2VDUE 1AV6A 2G72A 1P6RA 4EKIA 3DKWA 5EEGA 3A27A 4JXJA 3CUQC 1CGPA 3R0AA 3HVJA 4QQKA 5A2QK 2PKWA 1EQAA 3CUOA 3E3VA 1Q0TA 3HUGA 2HKOA 2A6EF 5J8CA 2Q0OA 4C06A 2KJCA 1IM8A 3EVBA 2DPDA 4ZH4F 1O7FA 2NXEA 5E2AA 1WXXA 2KKOA 3KCCA 3PFHA 2LNBA 2M5WA 4YV0A 2AOXA 1YW7A 2EFPA 2NAZA 3DLIA 1B1BA 1YW8A 2QUFA 2ERCA 5CVIA 5K0BA 3I54A 4OA8A 2A6HF 2E5WA 3HRTA 3EVFA 3NQOA 1L3CA 4AX8A 1ZG1A 3ECHA 1O57A 3N4MA 1XDZA 3OU2A 5D1NA 1MGTA 1XJ5A 4ENNA 3FUXA 1R5GA 2ESNA 3BKXA 3F8CA 2OYRA 2QY6A 1M6YA 5BW5A 1RI3A 3QU6A 2OZUA 3ROUA 1IN8A 1IN7A 5FA5A 1VIDA 1YS7A 3ELDA 4HRAA 4AVPA 3AJDA 5HILA 1R1UA 2ZULA 3BT7A 1K78B 4P7JA 3TR6A 3SFZA 4GC9A 4OMZA 2F5EA 5BMZA 3CCFA 4RAZA 3EEYA 3V8VA 1S29A 5GIOE 1PUEE 4RYLA 5DCMB 3TOSA 5EGSA 4L5JA 1F4KA 4C4AA 4P7GA 5JUWA 3ML6A 1KU2A 1MJ9A 2YX1A 5FB2A 3IWFA 5FQNA 1QZZA 3B7PA 1NV9A 3HA5A 2DULA 4DCMA 1NW5A 3RTRA 3ZN0A 3C1DA 4L5IA 2CO5A 2VC1A 1Q0SA 5CYVA 2EJRA 2A07F 1RI2A 3FM3A 4I01A 2W57A 2EV5A 2RC4A 2BBYA 3KU1A 3PFIA 2P6SA 1YIOA 4EJOA 3BJOA 4P9FA 1B9NA 2CW0F 3SM3A 5E1XA 3D0SA 5DDGA 1JQ3A 1KXZA 2RN7A 4BHBA 3FHZA 3Q7EA 3FZGA 2W85A 4OIRF 5D8LB 4IRHA 3I59B 1OPCA 2B0LA 4UVAA 2XGXA 1HBXG 4IVNA 2H11A 4N9HA 4FT8A 5HVQC 2BYVE 4MWZA 1X1DA 5HIIA 3TPZA 5LEKA 4HQMA 3ZMTA 1UHWA 1YLFA 2BR3A 3P97A 3F6VA 2YX7A 4ENMA 2EK5A 2YQZA 2JSCA 2CMHA 3FZVA 4ZYDA 1DDNA 1PP7U 3JWHA 4XCXA 5HIMA 2CQKA 2PQ8A 1IRGA 3FF5A 4ZTBA 4XSXF 3M6VA 2Z33A 3F8MA 2A3SA 3B89A 2PV0A 4HW0A 3GRRA 2ZBQA 3EVCA 3THSA 2VONA 1VE3A 2L01A 5EMJA 4A5NA 4CDGA 1TTYA 3KEOA 4M9XA 3NRVA 1JHFA 4LG0B 2F5CA 2G7UA 2RV8A 1U2ZA 2P35A 1QAMA 2K02A 2ZVJA 4C04A 3SSOA 1F9NA 1U5TA 3VEPA 4QTTB 1MJAA 2WTEA 2B2CA 5HIJA 2A14A 3BWCA 2FF4A 4MQVA 2AN3A 3M70A 2NNNA 2XAHA 3GLXA 2A5YB 3F8BA 3FM5A 1ZRFA 2GA2A 3G7UA 2OBFA 2YR0A 4ER6A 4E32A 2R7FA 4HDUA 4MHGA 5ERGB 3R6TA 3GDHA 3GWZA 3G3ZA 3I71A 3GRZA 2XAJA 1ZKDA 3N97A 4UV9A 4PCLA 4A6EA 2FBIA 3V7SA 1DL5A 3P9IA 3ELUA 5HEKA 4UOEA 4YMHA 3GXOA 3SMQA 2FA5A 4PYJA 1R18A 3FUVA 2QZ8A 5CVEA 3LBFA
chains in the Genus database with same CATH superfamily
3S2HJ 3ZIAA 1KK1A 3JQRA 1W29A 4AMYA 2EX1A 3C43A 4XX0A 3ZDYB 4FFPA 1IXYA 2I6FA 3CF6R 3LVBA 1FLAA 2VP3A 4Y67A 5DXAA 1HLFA 4W7HA 5GONF 4ZCMA 3TOAA 1JGSA 1GZHB 2DK8A 2PLWA 4W5TA 3OPNA 2WAFA 3L4BC 2FB9A 1LEAA 1QPBA 1T08B 1ZWLA 2WUFA 1H42A 4DHWA 3RKRA 3RREA 2HKXA 5EEAA 4JEMA 1ZFNA 2E5LB 2B7BA 2P68A 4B1FA 3EGIA 5FNVA 2Z2ZA 1KVRA 1VXRA 2IOYA 1LNWA 2FW0A 1EGHA 1QO7A 3I2IA 2YUIA 4J6FA 2FUKA 5I4IA 4DSUA 4ZICA 1EU1A 2F4VB 1ULZA 3WMGA 1BMTA 3TBIA 3THWB 4LNUA 2OK7A 4DYHA 4MWTA 2PN6A 3MZ0A 2WDPA 1CY1A 1A4XA 4R8HA 2E2WA 1OLSB 3CVUA 1UPTA 3IBGA 3G6WA 3H5VA 2ZBEA 3ITEA 3LUHA 1R6BX 2HQ1A 1NVUQ 2QR2A 4MFEA 4OP1A 3AXTA 2QLTA 3MT9A 5BQ3A 3O74A 2O2GA 2J7PA 3DXYA 5BUQA 1OAKA 2C7GA 4GHWA 3OLQA 4RJIA 1PYOA 2WZBA 4DCGA 1X94A 2EFHB 3HOSA 4F8YA 4DLRA 3L0YA 1QPMA 4MQ4A 3UFBA 3B1VA 2JAOA 3H8VA 4G8JA 3AO0B 2VK4A 4EGAA 4BO6A 3IVAA 3HB5X 3O38A 2QE7D 1ETVA 4ZOCA 3DDSA 3ND6A 4D3FA 1X7YB 2DC1A 1U7HA 2R7NA 1OUMA 3DTVA 2Y9MB 3IILA 1VJ5A 5LB4A 4EYQA 1FOEB 2WV7A 5HJ5A 2L4AA 3I3LA 4N8EA 3QX3A 4C22A 1W35A 2VTBA 3M33A 3C16C 1LKZA 3E23A 4CM7A 3DTNA 2NUAA 3JD1A 3KZCA 3Q11A 1LU9A 3QNMA 1EA5A 2P8JA 4JQFA 1PK9A 4DQDA 1Z6ZA 3JAKA 4ER0A 2O3UA 4MGIR 4A82A 2D1QA 4R2IA 2DT7B 3F2VA 1P8JA 3BN3A 4OIOF 1K0UA 3E9CA 3JTMA 1SUEA 1NVXQ 1IBCA 1LXCA 1AF4A 2VKVA 1X86B 4DSTA 5IWAB 5LP1A 1ZREA 1TLFA 2P5KA 2UZKA 1PS9A 3TD9A 2XUJA 2E89A 4DSAA 5JH7F 3N8NA 1COZA 1ONSA 4UXNA 1SA0A 1YE5A 4FDVA 5LQDA 3D1LA 1T0IA 4E7ZA 1FC3A 4IQ4A 3KKQA 5BR7A 1XDGA 2V7QD 2FAXA 3CUWA 3QPBA 3E58A 1OBOA 4UUMA 3VH4A 3JSXA 4JT8A 4MVJH 1HKUA 1PFVA 3OJOA 1Z88A 1VKNA 4Z4QA 1ON2A 4N8DA 2WIJA 2RD2A 4XLPF 4JFRA 4ZVUA 1E3SA 1G5IA 3K3PA 3ZU5A 3ER9A 1WXWA 2R6DA 4EM6A 3L7IA 4JP5A 4DDTA 3R7LA 3DM5A 1DFGA 4XRRA 3NUZA 4YAWA 1W4BA 4J19A 4YT2A 5I9IA 3PB3A 4W99A 2II6A 5KMGB 1CY7A 4RE6A 2W6QA 4AJJA 1U7OA 1TUBB 1LK7A 4DCJA 4NQRA 5TPZA 2BBWA 3TX6A 2FEWB 3COPA 4FX2A 2ZKZA 4QNNA 4RE5A 4LMRA 2P5YA 4F5WA 5EG5A 2XB8A 5GAEJ 2D54A 3D7RA 1RMQA 1A7JA 4DMCA 1BFDA 2PL9A 1E2KA 1NG9A 5JRJA 3M34A 5AXDA 2X23A 4GBJA 3ID6C 3GT4A 3H3UA 1RQXA 4TXJA 3WIEA 4YJ3F 4DUZB 4XVRA 3I58A 6GPBA 1JHPA 4EABA 1MVLA 2FX0A 3IR6A 4OMYA 4B87A 1ZI6A 4JJIA 1EXDA 2X6TA 4R1MA 4HDNA 3FDFA 1Z5GA 3ZZTA 1JG1A 3NHPA 4CPDA 1IXRC 3BWDD 2OYSA 1N75A 4LZOA 5EWLA 1SVLA 1L0OC 1GWNA 1SY7A 5GTDA 2G28A 1NQ5A 3W1VA 5JARA 3LQRA 4KIBA 4WSOA 1KDOA 3CFYA 4W5RA 3TOCA 4LHZA 1IK4A 1NN5A 1PYDA 1Y6RA 3BIWA 3DCNA 3VHRA 2X15A 2V55B 3HCRA 4C4TA 2RGRA 3KPJA 4ASUD 4G4IA 1AK1A 1UPBA 4NY1A 2BONA 7YASA 1BOOA 4E11A 5BOSB 2ZXJA 1VCOA 5DGCA 1XCPA 3CCEI 2VB6A 3OU6A 3PXCX 3K70D 2Z95A 4KEAA 1Q57A 3TJMA 3SM9A 1CY8A 3I6BA 5IP6A 3H3VK 2HLNA 1VMDA 2G6BA 2XB2A 5C8VA 2IJGX 1ST3A 3QENA 3NR2A 4YMUA 3IQXA 5DOVA 2IRFG 3EGCA 3B38A 2XZLA 2HC9A 4LDJA 1RRPA 1ONPA 1MHTA 1Y3HA 2CLEB 2BUAA 2RGWA 3VV3A 2PWPA 4DADA 3AYZB 1D6NA 2UZIR 1GQSA 1LBQA 2AI3A 2PT9A 4AZ3B 2HK7A 3RYRA 4E46A 4OI2A 1YJBA 4H08A 2A35A 4MGRA 2VATA 1LS6A 4R8LA 3LFKA 4TWAA 2G5TA 1JXSA 4O1IA 4ZT7A 3JQGA 5TY0A 4UHKA 3DFFA 1VQKI 2QPOA 1I7LA 1J2EA 2P9CA 1L4LA 2PGXA 1QRDA 1JMVA 5I4CA 1GT91 4JLUA 1SHUX 4PC6A 1Z6PA 4K6FA 5M3FJ 2H1FA 2HSWA 2F5VA 2NNLD 3E5MA 3NC4A 4PPFA 4P1WA 4UOQA 1L5GB 3AW8A 2Y48A 2CVZA 3FPCA 1ORTA 2V7BA 2Y1LA 5DTDA 1FTSA 5DGIA 3ZCRA 3WGUA 2ZSHB 1E2QA 1W73A 5B58T 3A3KA 2KLOA 3GUUA 4UCQA 4M9RA 4Y52J 3UAWA 5CFMA 3RNOA 1OR7C 4ND8A 1GYQA 1GSAA 1V1MA 1TMKA 2Q62A 3GW8A 1XX6A 1ZK1A 2J9FB 3PUYA 1KR2A 2IEZA 1SUPA 3RWMB 3WGNA 5IEJA 2FSWA 2IGNA 5L6LB 5LGUA 2ECPA 4XDYA 4IINA 1JT9A 5E8GA 3QGMA 1MF7A 2W0MA 2AJLI 1KSHA 2FZLA 4JBIA 4DV2B 2C00A 5D6EA 4MULA 2ZSEA 3KS9A 2ZANA 1WB4A 3L4SO 5FI1B 5LVAA 4OYHA 4FOSA 4I8XA 2BTQA 5DYYA 2VN2A 4CHTA 1T3ZA 2AC7A 4OAQA 2JRMA 1SC1A 3EFEA 3H42B 3I23A 1UPUA 4FZ5A 2R84A 1ULTA 4NBLA 1A4UA 1PL8A 3OR1C 4KQXA 3FCEA 4QVGA 3Q9LA 1Y48E 3QU2A 1K06A 1HLGA 3JRXA 5AUQA 1BCSA 3LGXA 1CUZA 4QYIA 2P78A 1RE1A 4M3EA 1U8FO 4DV1B 2ACJA 2B7LA 1A71A 4RTJA 1DIAA 1ECJA 3U1DA 1V8FA 3LL4A 4LWOA 2PZJA 4CQMD 3ZV3A 4OB7A 5AW5A 2XE6A 1R22A 2PUCA 3RUDA 3PD1A 2VUMJ 3QP6A 4C5AA 4ZYEA 3HZZA 3M6XA 5G3YA 1H6DA 1O94D 1KJNA 4F3CA 1ZHHA 5TLSA 5REQA 2OGTA 1J97A 3FNEA 3C8DA 1I3NA 4D4HA 1FFGA 3WV4A 3URKA 1B74A 3A37A 1AK2A 3EVGA 4A6PA 3CISA 3ZW7A 1WJGA 3JYPA 1GEGA 4P1ZA 2DOFA 3KJFA 3AM3A 1QGYA 1SBQA 4N0MA 5EKXA 4P0TA 3SQNA 3PEEA 3ZHTA 2DMTA 5GVRA 1L1RA 3HS3A 1SB8A 4C9BA 3QP5A 1G1AA 3GMTA 1UKEA 3RRBA 2XAGA 5AJVB 5C80A 1Z0KA 4XX0B 3OLXA 4XVHA 1INLA 4B35A 3W3AD 1TQPA 2PKRA 1U8AA 2B78A 2GLUA 2RIRA 4OQYA 1ZA2A 1RWBA 3ABSB 5JVGF 1O1YA 1F5SA 2IZ6A 4GOXA 4A6XA 3FNBA 1A9PA 3H0DA 1RXUA 4IV0A 5BN1A 5CYGA 2PL5A 3EIWA 5ILOA 3GO5A 3ULKA 3E0XA 2PUTA 5IXYA 1DEXA 1DCKA 5IJ0B 3Q2IA 3U80A 2VOJA 1H9AA 4S2UA 4RNCA 1SVUA 1VQOI 1H3FA 3IAXA 4QOGA 1N2XA 5C51B 1M2OB 1U8UA 3L8DA 1DKOA 2JPBA 2XZTA 2CLFB 1WXGA 3ZE6A 2JIOA 1W9HA 1KJIA 1RHUA 5IDVA 1AGPA 2JI6A 2JAWA 2DOKA 1M8FA 3VX3A 2JLAA 1QUEA 4Y15A 3O31A 2C9YA 4XLLA 2O6GE 1Q5PA 3ZDEA 2QGNA 2YWGA 1Z39A 2WT4A 2H6EA 4BJ6C 2VK8A 2FW6A 2HQNA 1XNHA 4ZQGA 3SIXA 3DBHA 3WNBA 4N9IA 2IC5A 5C1BA 5ADHA 1H5NA 4DQLA 3VR1A 2QA5A 1TT0A 2ZI9A 3KAQA 3PR3A 2ZRDA 4ZVNA 5KWVA 1IOLA 1CB0A 1GPWB 3CINA 4U7TB 3HXPA 2XGMA 5KNCH 1G3QA 4YNBA 3C70A 4FXOA 3I0NA 2HO5A 3ZWCA 4D46A 3NIDB 3X1DA 1OCRH 2Q5JA 3PI7A 1V55H 2JARA 4A15A 4KSBA 2X7HA 1THGA 4S1TA 3IEMA 1X1EA 4R1OA 3L2RA 1XCJA 2P67A 3AR9A 3PWTA 5DX8A 3RUHA 3EXHA 3VSKA 1L5HB 1RUNA 2AJTA 5KJ6A 1G2HA 3L1PA 2FJPA 3WYGA 4CM1A 3WYAA 5CIQA 4Q1CA 3O9ZA 5LR6A 2IOFA 3M1YA 5I3ZA 3THOA 1TL8A 2VH1A 3NO4A 5TJHA 3LIIA 1XZEA 2XJ4A 5TQ2B 3RBZA 4BO2A 2NUAB 4HLNA 4JQCA 4J91A 5HF5A 2WJ6A 3QEBZ 3M8EA 1HLVA 1LEHA 2X0JA 5HA5A 3R6WA 4FI3C 3WNZA 4Y2QA 2N8GA 1Q21A 2ZSJA 3IEXA 1WOMA 4B3IA 1HQDA 5IVIA 1KVQA 1KY5A 1MX5A 3W5SA 2YKGA 1M2NA 1NJSA 3WR5A 2HQBA 2FWAA 4ZGGA 1Y8AA 1O08A 5L3SA 4IG9A 2VUSA 1SA0B 2OEPA 1JUDA 2JD0A 2BY1A 1BD4A 2VPTA 2ZQYA 5DM2A 2Y0CA 1RWWA 2Z09A 3VYWA 5FULA 3GFJA 3F5QA 3O84A 5FPHA 3G7SA 3CLUC 4ZK6A 1VRVA 2HIHA 1RTTA 2MH2A 4JZYA 2GYYA 4YJHB 4NFLA 2YVLA 1ZH2A 4OEHA 4X92A 4CLHA 2QRMA 4CEHB 2RAFA 4JDUA 2W82A 5H81A 1W44A 1ZA1A 2ZSKA 2ZJ3A 2I7VA 1R8XA 3RC3A 4ZODA 3SE7A 4E2YA 3IQWA 1TZKA 2XD4A 1JFVA 2QMUA 2JEOA 2FFAA 3EPPA 4LZNA 4IOJA 2K6GA 1FW8A 4D5GA 3VPGA 5BQTA 4JXXA 4UM8B 3ZGXA 1PUFB 5CYFA 2NU8B 3H2SA 4Q05A 2FUG6 4ZVMA 2EC5A 2AMLA 4TT8A 4EA7A 3NHSA 3REFA 4AP5A 4WLNA 4B6OA 3O8CA 2PMHA 3DPSA 1RHRA 4XIDA 2PEXA 4XOTA 2JIZA 2P90A 1VPTA 4UVEA 3UKDA 1HYQA 3O4FA 2Z6UA 3L06A 4HF1A 4UMFA 2JJ7A 3NHMA 3GD5A 1YUMA 1A1VA 1MORA 1UADA 3GMEA 1T10A 4J9UE 3BF8A 3DE1X 3O21A 1E9DA 2VTKA 4X0EA 4RD4A 4JAVC 4L4XA 2LK2A 1Y56A 3DMYA 2HS5A 4L75A 1ISSA 4ACBA 2YQ5A 2WAEA 4UBNA 3TW8B 1R5HA 3D6MA 2JFYA 1CCWA 1XDUA 3FGPA 4Z1MD 5EWLB 1MQ9A 5K2OA 4JXZA 5AKXA 4YLGA 3BB3A 4DMFA 4LGCA 3BD8A 2XDAA 2RAPA 3RTDA 5DEOA 3ABQB 5ICEA 2XTNA 1TVMA 1EB9A 2G5CA 5CLGA 4J3FA 4XI9A 2I4RA 4OLBA 5JEDA 2WC1A 4ENSA 2NOJB 3CZ6A 2O23A 2OZLB 1TZCA 3IJRA 2DCMA 2CFXA 3C6YA 1F1BA 4FB4A 1CW2B 3M6AA 3GAMA 3HVRA 1FNNA 4RQBA 4AIHA 3PNKA 3H0EA 1R4AA 3BJZA 4FFRA 3D7MA 3TL6A 1PYVA 4XQCA 1O3SA 3GEMA 1ZG3A 4BNHA 4E94A 2OILA 2FUG2 3NBUA 1ZMTA 2NT4A 1HOXA 4QJ4A 2MD0A 2G7ZA 2JFNA 4NK4A 1E18A 3TFQA 2M4GA 2YSRA 2E4XA 4UEWA 4IDAA 4AYTA 1HY3A 1O87A 3CT4A 1R8YA 4U8HA 5IT0A 3P32A 5AHKA 4OA5A 3NHWA 3N3BC 1XD2A 1QQTA 1FJLA 2OD2A 3GW2A 3COAC 1RXIA 8OHMA 4C0HA 3C24A 1GV0A 3RFFA 1XVLA 2X9GA 3TTTA 1RZ3A 5T64A 4IXWA 1U8XX 1KJ8A 2BHYA 3OMYA 1N3LA 4HI0E 4HDVA 4HB2A 4XOIA 1IMOA 3AHHA 3AUJB 3N2KB 2R62A 3WAJA 4XDZA 1XS9A 1J8VA 3ZU4A 2C2GA 4G2NA 3PRHA 1N6KA 3I04M 1TF2A 4IBOA 2CE7A 1MB3A 5K0SA 3H9QA 2QPLA 3GGPA 4JP1A 3T8YA 3ENVA 1QVUA 1WDLA 3R0AA 2K3PA 2P9ZA 2JCXA 4ZHSA 4FC7A 3PPIA 1E3WA 1P73A 4KQHA 3DLIA 1ZXLA 4O02B 3E27A 4D92A 3DTIA 2YMLA 5ARDA 1VHLA 4F4DA 2VQ6A 1EVKA 3CMAI 4IHVA 5G1NA 2PKYX 3VC3A 4YRKA 221PA 1H2YA 3OU2A 2MSKA 3AIOA 4Y2JA 2HU8A 2A0XA 3PQ5A 4EI7A 3VV2A 5HE9A 3DLPX 3ROUA 4P35A 4FYVA 3AJDA 3T9CA 3MSXA 5AM0A 3WHCA 1BS1A 3QVGA 2QL7A 1QK4A 4TOIA 5C32A 3QQPA 3HCOA 2G67A 4UHJA 1L4MA 2QVLA 1IY1A 3GTQJ 3LKVA 4Y1RB 1QZZA 3CSDA 4QJBA 1I7DA 5BMVA 1P6XA 3VKFA 3C7KA 3DWIA 3H2IA 5KKAA 4K2HA 3FM3A 4I9NA 3S8PA 3NHUA 3PFIA 4LG3A 3OESA 4UULA 3OX1A 3KOYA 3VO2A 4ZTJA 3EGWA 2VKQA 4QTRA 3WIBA 2HF2A 4QYIB 2GILA 1X1DA 2WM9B 4WJZA 4I99C 4DA7A 2W9XA 4Q4HB 3S8YA 5IFKA 2HPAA 5B5SA 1DI0A 4Z2AA 1M34A 2WNSA 4RPHA 3LAWA 2A9PA 3F6EX 1J25A 4OXRA 1Q3KA 4LTNA 3FF5A 1XU7A 1GRVA 3UXEA 1QVRA 4QNRA 2LREA 1PFKA 2C4TA 1KH3A 2PNFA 1L5FA 1NURA 3EFOA 1NXVA 2OPTA 3I8XA 4KIJA 4CMBA 2I55A 4IIGA 4DABA 5E0KB 3VHLB 2A5YB 3FM5A 5FD8A 1WGXA 3MOIA 2LBPA 1B8UA 3D6AA 4CDMA 2ZRLA 5IXSA 5TT1A 2ZYUX 4UV9A 4WRRA 5ESRA 5IPAA 4A6EA 1DIHA 4M55A 2KZVA 1W5EA 4B7XA 5U1PA 3BQMB 4PC7A 4F1JA 2RAEA 1C4WA 2C4UA 3U19A 3FDZA 2Y66A 3RGGA 1AMNA 3C3BA 2P4SA 3A3PA 3DE3X 4GRDA 3OJEA 2IWRA 1JT2A 1JHMA 2WIDA 3B73A 3UANA 2XNHA 5FOVA 2XHKA 1Y3AA 4MEXF 4V1CI 2Q2OA 1KMIY 1ZD5A 3QXJA 1JR3D 2CJFA 4L0YB 3CLHA 4M0CA 1IDZA 4ALKA 4C0WA 4LF4B 5B30A 1ISRA 4C3JJ 2QZZA 4YGXB 3D7KA 3HI4A 4CNBA 2CGPA 3HK2A 2OQRA 3E15A 2RQQA 2VL8A 2YC4C 4D3YA 4OMFG 4EY6A 2ADUA 2O5EA 1S8NA 3IPXA 4RD2A 4BNTA 4FMDF 3EXIB 4V2IA 4EQ6A 4MYDA 1QBKC 1GN8A 4ND1A 3VWBA 2R1VA 4LG1A 2OV8A 4JYPA 3HGTA 3SHVA 1NVKA 2B1RA 4A0YA 1BCRB 4KL8S 1GNVA 3K0HA 5KYUA 1O96A 1NYQA 2N1MA 1RCFA 3IDZA 5FI3A 1QP0A 3A70A 3CUUA 1FNMA 1LVUA 1ZJ4A 2VPWA 3ET5A 1TCUA 3JTEA 1JJIA 3GVHA 3B1KA 1ZJ6A 2NT3A 4LRUA 2A30A 2GCOB 2JLXA 4LYFA 2XLBA 2BPOA 4HGZA 1ZJZA 5IZ4A 3E9ZA 5AK4A 4QDKA 3T6KA 4JI8B 3ZU6A 2CXTA 2PRZA 3DULA 1KQFA 4RAYA 4TSFA 4CKWA 3DTYA 3LS2A 1JT6A 5IAOA 5KQSA 4KVFA 4R0MA 2KX7A 2QMOA 1ZAYA 4QUHA 5CLFA 5KTMA 3EE6A 3V1YA 4WCFC 3SEZA 4G0NA 4IOCF 5TEVA 4O6JA 1IATA 4QU8A 3V6LA 1MO2A 3TCXB 3KT3A 5G40A 3L4KA 2KJBA 5FLYA 1W5TA 1WDTA 3CDIA 4FYKA 1S7CA 5GTIC 2JK1A 3M4ZA 3C87A 5ERIA 3UMYA 2AZMA 3VTKA 2IYVA 2PLRA 4WY2A 2OKCA 3ABKH 2WWGA 5FR1A 1LEBA 1UXKA 4QX6A 3CBQA 3DNMA 2I6TA 5BRNA 1J5XA 2BGUA 5KO2A 1CHNA 4Q7QA 4G65A 3G68A 3STXA 4RMJA 4D6PA 4LNHA 1AZLA 1KJZA 4AMVA 4H35A 3G2QA 2NVQJ 4CR7A 2HYDA 1NT2A 2V0CA 3VR4H 2REOA 1VE9A 1L7PA 1WV0A 4DMRA 1Y6FA 1J2RA 1M0WA 2JJ1A 2ZB9A 5IM4A 3IP4B 3GRCA 1GPMA 2DJNA 2HEGA 1T4GA 3O3CA 5SZHB 1SKMA 3D2BA 3RVQA 1QIDA 2X4LA 4MDHA 3S2GA 1M7GA 1P3DA 2DZDA 1W1WE 2NM0A 1Y89A 1XFDA 3UJDA 1SU4A 4OINF 2QIPA 3FSGA 3HWRA 1APLC 3TTVA 1I7NA 1HA8A 3B02A 4H4CA 2YWFA 2FHPA 2E18A 5H70A 1OMIA 5L95A 3Q3SA 2XZDA 2G1AA 2M45A 1Y3IA 4B3TB 3T7TA 4HAZA 3CCLI 3NYIA 3TFOA 4OG2A 1G5QA 3H84A 3J80Z 5JZBA 4RAGA 3KK0A 3F9IA 5I01A 3AONB 1DAMA 5EHIA 4GOJA 4MP6A 1MMDA 2RJ3A 2OMEA 2AVNA 121PA 4UTNA 2YVUA 4TZKA 1D8KA 4OGKA 4NCHA 4PZ9A 1FVHA 1QG6A 1V47A 1D2GA 3UJAA 3QMVA 1KEVA 2OP1A 4B71A 2Q6IA 3GA5A 3Q7IA 2HQAA 2H1VA 2IYUA 3THWA 4P0PB 1BHSA 2IKQA 3LUJA 1JJBA 2BIFA 1T3LA 4BN4A 3V4GA 3ACDA 4UM7A 4MDFA 3A1CA 4H7IA 1ESCA 3E9MA 4I9FA 2XF8A 2DPXA 4A3FJ 5E20A 4EHIA 5B2FA 3ZXIA 3A4CA 2W48A 3EETA 5AIQA 5A6SB 3F3XA 1T3TA 1KDTA 2CHUA 4RY2A 3VXKA 1Y1TA 1IRXA 3MMSA 2HRCA 3JV7A 2H5JA 3VH3A 3ZQ4A 3GFGA 3NTLA 4DMMA 2EEZA 5DIZA 1TYEB 2ANBA 5E17F 5CUQA 4DMUB 3EDQA 3OIVA 5AFSA 2NVYJ 1X3WB 4AVYA 4CLRB 4E5SA 1X1TA 2B4YA 3UCEA 4RXMA 4KPGA 2E0IA 2NP7A 3CW2A 3WHBA 3A1FA 1X7YA 5I9LA 3TQFA 3AP3A 1QANA 5CCEA 1UB9A 1SIWA 1OBCA 2HV9A 2HF8A 2OFPA 4LKRA 4FNOA 4PIPA 1G7SA 3TI9A 4M6XA 1LDDA 4UTOA 1MO3A 4M4SA 1NPYA 3WHPA 1RWVA 3QRWA 1ECLA 1XHFA 2CF6A 4ZQHA 1SIBE 3PNMA 1XD2B 4LB6B 1B23P 3G1MA 3H5LA 2C5GA 3DGEC 1H05A 1HK7A 4FDUA 4GKAA 1JB9A 1A04A 3RS3A 1G3TA 4U2FA 3DAYA 3MZHA 4G9YA 5KYNA 3WOHA 1RE0A 4YJ2B 3G8AA 3UGKA 1DAIA 1FF9A 2CYAA 1IBKB 1RRVA 2RC6A 4HYQA 2YVKA 3QTBA 1LPPA 1AUOA 2BFPA 2I7XA 5KNBA 1AKTA 3LX8A 2ZYHA 1NNSA 3BJEA 1M8KA 3C3CA 1V54H 3V7WA 2R66A 3H35A 1WV1A 2P75A 2CUZA 4GXTA 2I71A 1I4DD 2B1GA 4WCFB 1L4FA 3CNNA 4MB2A 4E31A 5AKKA 2NO4A 4FMCF 2HU5A 2DT8A 1QAOA 5HK8A 1ECCA 2ZJ1A 4EG0A 4BJ3A 4J16C 1X3UA 1WUYA 2Y0MA 3CXUA 4X65B 3NVMB 5DCLA 5JZOA 2E7WA 1J5PA 1KOJA 2NV6A 4QATA 5BW6B 4D45A 2V1XA 4QG3A 3FGOA 3EG5A 2J3DA 4M76B 1JIIA 2PJUA 1KQPA 2O3QA 1RACA 5CNMA 1IB0A 5LRRA 4KK4A 1BOAA 1TUBA 3GLSA 5CD1A 3S2IA 2CS3A 4NCAA 1ZM9A 4I2VA 1ZK0A 2FDCA 3E9QA 3EDMA 4E2WA 3HIFA 2CL0X 4GGPA 4GOND 1X8KA 1ZG5A 4DR2B 1BNCA 2W37A 3LLCA 3FBTA 4DJAA 3TDZC 2WWYA 1W25A 3K70C 3R44A 1CUUA 3B82A 5KTTA 3LYLA 3K4PA 4HZIA 1XQ9A 3ELBA 2A1TS 4W82A 1SU6A 5TJ9A 4WA7A 3DVRX 4BKUA 2A05A 2BEWB 5HLHA 2M8EA 1H4TA 1D5CA 3AIMA 1ZSVA 5LYJB 2K4JA 2B1QA 3MA0A 3RVOA 1HYHA 1P7YA 3D5SC 2DLNA 2XCRB 4DIKA 2BZ0A 4C0QC 3P9YA 1KARA 3L4BA 1MB2A 2LKXA 2LF7A 2RCYA 3C98A 5COAA 5AKYA 2QMEA 2I3AA 5SYAA 1GQRA 1M76A 2Z1NA 2MGQA 5EPUA 4PSWA 1P7ZA 3TSZA 2IVFA 2G4LA 1HKHA 4CMIA 2PYIA 4INJA 2HGCA 5F7ZA 3U37A 1NIPA 5BOSA 1W4AA 3LHIA 5C52B 4IL6C 4ARBA 4QFDA 2Z6QA 3BSSA 4C2MJ 3TWOA 3WK4A 3O3OB 3V1LA 3HKEA 1JI0A 2CMKA 1QPIA 1NG7A 3UNGC 5SY6A 3WTYC 2AE2A 5ADUS 5DLQC 1SOMA 2G8LA 3W90A 6CHYA 3ZWKA 4GMHA 3WA6A 5CIWA 3V8NA 3DD1A 3UK6A 3ANLA 1ZH5A 2QOEA 1QZEA 1RMTA 2P9QA 5B7PA 3MT8A 3F5MA 2L0KA 3PIIA 1MC4A 1X8XA 4EJTA 1XLTC 4HX9A 2XNJA 4RLFA 4B3RB 2NVTJ 1PCXA 4G1FA 1E2PA 4AZ3A 4H2DA 5B7QA 2RIPA 3AF3A 2J4DA 3MD9A 2FFBA 1KEZA 5JAIA 1HL3A 3MJRA 4LC9A 2PV7A 3PHLA 4FINA 4AYWA 4BNVA 2EZ9A 4ND3A 1TJ4A 1KXJA 1TJ3A 3IOBA 3RPUA 5CYPA 4R2WA 4EQ6B 4PJJA 4X3PA 2YFQA 5JCZA 3WG9A 4YFNF 2CXQA 1KI7A 4MI3A 4Q1BA 1NVDA 4KGVA 1Q1NA 4ZEVA 3GT7A 4JBAA 2Z5GA 5F64A 4TMFA 1U7WA 1QFMA 1NXSA 5KYUB 4XMYA 3BR6A 2ZEJA 3DV8A 3WHKA 3COJA 1PDVA 3CX7A 3GELA 4QXPA 4RIFA 2EJTA 5FO1A 1E77A 1V6CA 3OKPA 2J9FA 4LJ5A 1E0DA 3AUXA 3FPHA 2HPHA 1YVPA 5FOSA 2VT7A 3H4TA 3P5SA 3BB1A 3SSMA 1IQ0A 5LKAA 4K26A 1I13A 1HX7A 3G02A 2DFEA 2QT0A 1O94C 1I1HA 2M1BA 4HDSB 4U0KA 4BS9A 2VYVA 4NUBA 4RW0A 1S72I 1UZMA 4CKWB 4C4OA 2X9DA 3W2HA 2ISZA 2PKXA 1JFSA 4RQAA 1DXHA 4ZVRA 5SY4A 4U0YA 3WBFA 1REPC 4OUDA 1QQAA 5CLQA 2KW5A 4O1HA 1AKEA 5H80A 1WW3A 5CT8A 4E7LA 1GV5A 3T1YB 1P4XA 5CX4A 5AONA 5JT1A 3RJZA 4BP9A 3EISA 2WLSA 1MCZA 5C3EJ 2QA4I 2H0AA 1A9TA 4D4MA 3VGPA 3DEIA 2Y77A 1MBZA 1K86A 1SU7A 1KQ9A 4XYGA 4Q3DA 3ZCSA 2I7CA 3HTUA 2ZB8A 2H4YA 1PJTA 1RRJA 2RB4A 2UYYA 4CODB 3OTQA 3T0GA 3WSTA 5IJWA 2LDUA 3ESQA 1BN5A 2WSSD 3K1NA 1VA4A 3BTCA 4NE2A 4KR3A 3DDOA 1CJUC 2ORVA 2ZUEA 1L8XA 2IZ7A 2JVIA 3JY6A 2H4FA 1ZELA 4MWEA 3T95A 5DOZA 1V8ZA 3VAZA 4GMKA 4TLCA 4IEEA 2J3JA 4KITB 1OX4A 1AQLA 4R5HA 4X61A 4B3GA 4KREA 1A2QA 1TYBE 5EXDA 2YZGA 2QVBA 3G9QA 4UVGA 3K70B 1Z12A 4HAYA 1MA0A 1UOQA 2E4VA 5TF4A 4N65A 1YVDA 5FX2A 4XUDA 4G7HF 4RLQA 2XNDA 4YN3A 4ZYVA 2BTEA 3PDJA 4IHWA 2V98A 5KQRA 4XKJA 3PBKA 2DA1A 1E9EA 2HCBA 1E6MA 5C4GB 4JR0A 3GEDA 4CTJA 1ZYUA 1EH5A 2E7XA 2D1FA 4PO1A 3R4VA 1SFKA 2QBYA 3L04A 3RU7A 4F92B 2JCYA 1U2RA 2AI2A 1N6OA 4DDMA 4HRYA 2IZOA 9GPBA 2P1DA 2DF8A 4XD2A 3RSFA 3KXDA 5IJ0A 2RH8A 2GSDA 2P2LA 1J8FA 1YIAA 5FLVA 4BLWA 1HDOA 2H9AA 1YOBA 5CW2A 4LOIA 4ZYGA 1XMQB 2P5VA 1NUPA 2NNWB 2KQRA 5JLAA 3E0JB 5E3OA 1PIWA 1JA1A 3SC4A 4M83A 5DWVA 3IAHA 1M2OA 3CKMA 2KL4A 5A6VA 3J81k 2COBA 3WE2A 1NPDA 1Y0NA 1J56A 1X3ZB 3NNDA 5DYNA 5I7HA 3GG2A 4S24A 2K5UA 3HCEA 1GZUA 1FYVA 2EV0A 3LA8A 2P0YA 5BP7A 4FQ5A 2H54A 5IT9A 4IKPA 5H9WA 3Q40A 2RGDA 2ZJ2A 5JQGF 3OPYA 3ETLA 2I29A 3OZBA 1MZPA 4EPRA 3NUGA 3LIPA 2HFKA 4CFSA 4WNCA 3T7SA 2C5LA 5HSGA 3RFCA 3H7AA 1D3YA 4ZO4A 2WB1N 4RV4A 4GM0A 1SBHA 1QGED 3ZZ1A 5C8XA 1LSSA 2X5NA 3LTEA 3L8ZA 1JPJA 4O63O 1L4KA 1LB2A 1I2MA 2Q1TA 1R71A 5ECDA 1OYYA 4WX2B 4C21A 4RHXA 3V4LA 3MUEA 4FSHA 1L5HA 4XJVA 2F9LA 4ZU3A 1D7AA 4BQOA 1QV9A 3ZMUA 1KYXA 3T0IA 2VJOA 2PWYA 3CCSI 4B4DA 2MLKA 1W0JD 5DEIA 4M37A 4IFTA 5TQ2A 1WH7A 2EJCA 1QIMA 2BOVA 3OH8A 2Z57A 5E2BA 1U1FA 2NRAC 1OR7A 1ZRHA 4ZA2A 4ZMRA 4BVEA 3QOYA 5CIYA 4B81A 1Q7RA 1WZEA 3S2DJ 4G6QA 5JS2A 5E1MA 5EMLA 2OA4A 4LBWA 1PI3A 2XWJI 4CQMB 3GNTA 3TYXA 4JJ4A 1VIMA 2RFLA 3RI3A 1NWCA 4MQEA 4KO3S 5CM2Z 2P9FA 3RS8A 1JA0A 4B76A 5T41A 3N0WA 1J24A 4X90A 4LRSB 3B6KA 2ZYSA 2Z43A 4B3DA 4XSZF 1XRMA 1YUNA 1C14A 1Q50A 4D9IA 2R7MA 3ZQ7A 3BRWD 3PQKA 3ITKA 3E22A 4ZHQF 2P9HA 4E03A 2YBDA 1PFUA 4JVSB 3IRRA 3KCNA 2QT1A 3CP8A 3BT9A 1JIQA 2LCQA 4X91A 1PJCA 1R4NB 4JBNA 1NKSA 1P6RA 2ZVPX 3RH0A 2D5VA 4YJHA 2NSHA 2O7OA 1CT9A 3V32A 2HKOA 4CEHA 2CHQA 5B4TA 4ZRNA 3ZVMA 3OF3A 3TIVA 5CMLA 2VHWA 2ELJA 5EY5B 4I4IA 1JF8A 4AJNA 2PMBA 2XEDA 3H1GA 3JZIA 2WTAA 5THQA 4RGVA 9LDTA 3HRTA 5F77A 1WPQA 1E6KA 1PUFA 2NU8A 3WYDA 2VAVA 2WT9A 1ZHOA 4LUCA 3LF1A 3QU6A 1TZLA 2ISQA 2QVXX 3KJXA 3OJXA 3P9SA 4DIUA 4NMXB 2RHGB 5KVVA 1EBBA 2ZDQA 3LVQE 5FUXA 4PRZA 4L5JA 4DC1A 4CMEA 5EUMA 1XQWA 4X24A 5CPFA 2ACVA 3IWFA 2V5AA 1D8TA 3C5WP 1N8TA 3ZWQA 4IEIA 2ES4A 4FFVA 4P5DA 3BSWA 3B6ZA 3UG7A 4LGYA 4IMRA 1ORRA 2OWDA 2JIPA 1TUIA 3TW8A 4I66A 4EECA 1APBA 1T3HA 3BWVA 1FFAA 5JQWA 5CHEA 1FVFA 2IP1A 1B4DA 5EXXA 1TM4E 3D0OA 2P9GA 3KVVA 3HGGA 3NHRA 4N39A 4DIEA 4A3BJ 2AKAB 1DBVO 3FR8A 2JAQA 1YK1A 2FUCA 5D7BA 3GT3A 2EJWA 1FOXA 4P3YA 3GRRA 3G8DA 4EHHA 1F4PA 2DSNA 5DTIA 3P9PA 3QUTA 4CMIB 4H17A 3HJCA 3PHCA 3WYBA 2P35A 4RKFA 2XZPA 2OZLA 3JATB 2GZAA 4Y1FA 1JDTA 2EXXA 1MJAA 5EE1A 2WHRA 2A14A 5B3KA 3HKEB 4Y2VA 1T4BA 4HWKA 4F5ZA 2I2BA 1YWGO 621PA 2R8YA 2IXDA 3HBFA 4M1SA 4MVJP 4I50B 4KXWA 4PCLA 4N3BA 1YZNA 3LLMA 5TB5A 1U1DA 2HUPA 5LA6F 2POCA 4L8FA 2B3DA 3HXQA 4C0LA 3R5TA 3JRFA 5FTJA 3WGMA 4G1CA 4BJ6A 2XZOA 1Q14A 1Z5PA 5HE8A 1NF2A 1P81A 1QHIA 1NSYA 3OZUA 4EBBA 2EF1A 4YP0A 1YU9A 1RR8C 1RZVA 3OVMA 4IRGA 4B09A 2UUBB 1BMQA 3G2OA 4D8XA 4Y6OA 2ZR8A 1UL1X 3KEMA 5AI5A 2PI0A 4YLEA 3JALB 2PRJA 5IP9J 5JDCA 1NJ1A 3G1OA 3N2KA 2VI6A 1EXVA 4UTZA 4LHSA 2XKPA 2B34A 3W6NA 5C81A 1MDMA 2ZCJA 3GYHX 3HZRA 2H6BA 4X60A 3X1WA 1ADBA 3DDNA 3PE6A 2HRRA 3KUDA 5D87A 5EMHA 1AS3A 4HPXB 4QREA 3QUBA 2D62A 4HGYA 4BFUA 5LUAA 2K4BA 3WGGA 3IMFA 3H05A 3UJNA 2PJPA 2XUIA 2CLOB 4UQLA 4EPVA 2XQJA 2ZCVA 2DAOA 1G3MA 1ONOA 5E1DA 3PGVA 2CL5A 3GA7A 3DOHA 4HH0A 3H1FA 4QPOA 2ONKA 2PX5A 1SHJA 1H65A 2VHEA 3GARA 5MDHA 2F3TA 1K6IA 3NYRA 3NC1C 3BXFA 3WWZA 4ZYWA 2PMZN 1ZR2A 3R77A 3EEOA 4Z4CA 4ZU1X 1BWSA 1NBAA 4ZJYA 3V8KA 4Q15A 2O03A 5E4JA 2QMQA 2IYRA 5LQNA 3TZKA 4BO3A 3OMWA 4K40A 1NJ8A 4B3JA 3BAZA 5IW8A 4PTYA 2OO3A 1F8UA 4Y1RA 2ZO4A 3PNLA 1MQ8B 5FRMA 1O4VA 5FBRB 1XWIA 3GJ7A 4OUDB 1VJDA 1QK5A 1G8KA 3PQ3A 1XMPA 3LKBA 3FPJA 2YWDA 1CRZA 1IUKA 3OYHA 3TBHA 4TS1A 1RYHA 2I91A 1DSSG 3LMKA 4EL0A 5F1PA 5AOAA 3WMWA 4Q4HA 1EP3B 3K73O 3SYMA 3PVCA 1WZCA 4D8YA 1U8TA 1XQYA 3FRJA 4AICA 3PC2A 1W6UA 3U7GA 1ZARA 1WSBA 4HXEB 1HUQA 4R1UA 2O0MA 4DHEA 4MUJA 4D9HA 2R8BA 1XR3A 4YCMA 4MVJD 4ASNA 2W6OA 4DM3A 3UXHA 4BE0A 1BWPA 1DTEA 4YEDA 2O3TA 3RCOA 3OOJA 1AKYA 1CX9B 3PFGA 5B64A 1OX4B 2OGSA 5DWQA 2P4UA 3T15A 4C0KA 4UW9A 3KR0A 2Q29A 4CMEC 5C37A 3UAYA 4MTLA 5CDUA 2FKAA 1HR0B 4G37A 3WB2A 2K9LA 1EUYA 1N8SA 4QBTA 2RONA 1KKUA 1V95A 3DMGA 1I2AA 3GJQA 4D97A 1SUIA 1CJKC 1D1SA 1VDZA 3BGVA 3I92A 3E70C 3QHQA 2N75A 3OYNA 5DE3A 1GXPA 4FE4A 2BJHA 1F5TA 5CNJA 1NBOA 2ZKIA 4EJMA 1ZGHA 3S2SA 5LLQA 1ZYRF 2CJJA 4ZQBA 4AIJA 3VC1A 2QBYB 2I34A 1SURA 3UW3A 2VAWA 3ZCPA 1U2QA 3C8MA 3ZV7A 3WE7A 2HWKA 2WPDD 3JD2A 3NKVA 2WIFA 4R9RA 2R7ZJ 3Q1LA 1ADFA 2K4MA 3CEPB 5CVTA 4EUKA 2RKBA 2JT1A 1Z0XA 2JGKA 3S1NJ 3JW4A 4HAXA 2HF7A 3EXIA 1C8KA 5IOYA 3IIIA 1UXHA 3KB8A 2Y6VA 4R9VA 5EUQB 2BI4A 1IXCA 2LRHA 3DOEA 4FHGA 4DSZA 5BUZA 2XKBA 1YB6A 1IQUA 5A02A 1BCRA 3LCCA 1XUOA 4TLBA 5ERXA 1LDKB 3OZ7A 4Z7NB 2IUYA 2XDYA 3F6OA 3NIFB 5ADVA 4CDNA 1HSZA 3DQPA 3NOQA 4KB5A 2V6IA 1S2NA 3NHFA 3IV7A 4WFJA 1YVRA 4UTXA 1VSBA 1R3UA 1XVTA 3C7CB 4I1YA 6Q21A 5DN9A 3OPYB 1W7PD 3WGJA 2GD0A 3GRUA 3E7FA 721PA 4IIUA 2IYZA 3MK31 2WTNA 2GCOA 3C7AA 4KYUA 2PZLA 3UK2A 4O2AF 2RK4A 1L8OA 2B99A 3NT4A 1NVMB 2H00A 5ECGC 3FK7A 5JDCC 5KKNB 2FEZA 1BR2A 5FTMA 3TG8A 2G1KA 2FPXA 4J2TA 4EARA 3LT4A 4XEHA 4ZEWA 4FASD 4YYEA 4BAZA 3NBQA 2PK3A 1TXGA 2V7VA 2J9ZB 1T5HX 1P61B 2HQSA 4AJOA 3BE6A 2HZDA 2R3SA 4II7A 1A50B 4RU1A 2XB0X 2V6FA 1E4YA 3IO3A 1S3GA 1F8XA 5U4QA 1AO0A 3EUAA 2A7QA 4KFSA 3UJCA 2TCTA 3EUHC 3ES9A 2Q5FA 4RL4A 4UNNA 1Z83A 4HPQA 3OCVA 1FIAA 3IEVA 2QMHA 1BFKA 3KLBA 2C4NA 3SWWA 2QSHX 2C04A 4ZYTA 1TWCJ 4RB1A 4A2UA 1DU0A 1GVDA 4RJLA 1T0PA 2WJVA 1H9GA 2X14A 1D07A 3FDXA 1M0EA 1RM3A 5AW4A 3V8EA 3QEOA 1W8DA 3R3YA 5CQEA 5IRCD 4MQEB 1O0SA 3HSEA 4E5PA 2JHFA 4CM8B 4YQZA 1HYBA 1E2UA 2I54A 4RFLA 1H0RA 4WVLA 4IIVA 5D5WB 3VR2A 2CV2A 4F11A 3QY9A 4JMPA 5NLLA 2CH0A 3BTLA 1C9DB 1EJ9A 2NZ2A 3E22B 4BGUA 3JARB 5HLIA 3TEDA 2TS1A 4UNRA 4H3SA 4QO8A 5D85A 3VU1A 4UFOA 2WU8A 4WACA 3I42A 4ZYYA 2O14A 2X8AA 1JVBA 4R7GA 1EP9A 4LVNA 3DLAA 1UK8A 4OHVA 4HFNA 5CB6A 3X2EA 2CDRA 4P53A 3LV8A 4I99A 2VVTA 1XAJA 4EW3A 2WJHA 3M1CA 1E96A 4XSVA 3VOEA 2GN1A 2O1EA 3A06A 1Q7BA 5IARA 4JJFA 1ZJYA 2MSNA 1UWCA 4I4TF 2GEFA 1A5AB 4Y2SA 3W8DA 2QD1A 3IULA 4P6VF 3AJ9A 2DVMA 1XEWX 1QU2A 5TF0A 2IYQA 5BWNA 2ZB3A 3SKYA 3ZJYA 1Q7CA 1U0RA 1OA1A 1RZRA 1YQWA 4XLEA 5BWMA 5DCWA 4MLDA 5DNWA 3NM6B 3AVYA 3OWXA 1OTYA 1IZ7A 2XAFA 4GDFA 4CQLB 2ETVA 4R3UC 2P2SA 3ZJUA 1F8GA 4ZOLA 1WB9A 2Y1XA 4JI6B 2OXFA 4CCLA 3GRVA 1PJAA 2JH3A 3SYLA 2SECE 3UV6A 1DCFA 5DCMA 4URFA 4JOMA 1L5QA 1UFKA 2YFHA 3TQTA 1YI8A 4L9NA 1NDUA 4BY9E 2AG5A 2C97A 2RQPA 2QENA 5JR3A 3A8TA 4D9BA 2CVOA 3FMRA 4D6YA 5SV2A 1WKBA 3CTPA 5UKDA 2A5LA 5M04A 3CDHA 1U1EA 5A6SA 4PFKA 4GLBA 2WB4A 3ZLUA 4HUTA 3TOZA 4NDNE 3TLBA 1EK2A 1X1CA 4B2IA 3PKZA 3STUA 4FGZA 1D1CA 2GM5A 2VA9A 4WFIA 3FAKA 5CFZA 3KD2A 3HWSA 5BQPA 1PLJA 3F49S 5ERYA 4OIPF 1R9TJ 3B8HA 4C05A 3AI3A 1QTIA 3R4KA 2DBZA 3NZEA 3VNQA 3HYLA 4CLRA 3MXOA 2GBGA 1L9KA 4LZZA 4AG5A 4FDMA 3RVNA 2DUWA 5B66C 4DR6B 4AU7A 1I0LA 2F9MA 1M67A 1MJ5A 5J5VA 2C03A 2BMAA 2B5WA 3B7GA 3O3NB 3UHJA 1OOEA 2VF4X 1NFFA 3OY7A 2BFCB 1R6TA 3NHZA 1ZBDA 2W0SA 2H1CA 4Z4GA 3CBGA 3UT5A 3IUQA 5FJ8J 1QO0D 1QZXA 4M3DA 4GI1A 3TB4A 4D44A 4UATA 2VTEA 2MDTA 1BMDA 4URUR 3JRAA 4U2EA 4KDEA 2NVWA 2H1RA 4ZCTA 3PUIA 5I9NA 2QB5A 3ZV4A 1G64A 2YOHA 5IVHA 1XBTA 2AXLA 4JR2A 3CO6C 4IZOA 1P39A 1MUUA 4PBRA 1XEAA 2VJDA 2M87A 2WUGA 3GX1A 1CJSA 3A01A 3VX4A 1PP4A 1G8GA 4RAOA 4JLAA 4YJ2A 3J7AC 5FPYA 2FQXA 2GZWA 2MOKA 4M0EA 2VSQA 1TLLA 1WZIA 3BPXA 1Z3XA 2TMDA 1KYYA 1QPZA 1JDSA 1MDMB 3KDAA 2VLBA 4LOCA 3VBEA 4DC0A 2AJBA 1NI5A 1QPGA 3ERED 2CNNA 1G8MA 4WCFA 1CR0A 4YIKA 2XMCA 4FEYA 4BZQA 1ZK2A 2PD6A 4WX9A 3EULA 4OJQA 5ESDA 4KG7A 3A14A 5K4GA 5LXTF 3ECSA 5D6NA 1A5ZA 4NYMQ 4B82A 1H23A 1J4AA 1BEEA 1YC5A 1IOVA 1FK8A 5KNCD 3K8OE 1PJRA 1NQVA 1R8SA 4GEKA 5D3KA 4BACA 2HIAA 4H1TA 1K1EA 3IQDB 1WP9A 3GLLA 2J3EA 4ZAXA 4JP0A 2GEVA 3ZV6A 5ECWA 1IW7F 3G2HA 4TLDA 2BF4A 1ORKA 2LE0A 4XRSA 1MV5A 5TMDA 3NX4A 2WF5A 3HG9A 2GBPA 5KPDA 5KAFC 1JI8A 2O7RA 3FHJA 5LM3A 2JI7A 2GN0A 2NX2A 1XGSA 1GPAA 4DR7B 2FJ0A 3U4IA 1Z7WA 1GAXA 5JFOA 3KJEA 3PITA 2VJ5A 2ZPAA 1MC5A 1TO6A 2CLDX 4LIUA 2VSNA 1RNLA 5JAQA 4G6ZA 1OMOA 3ZVLA 3GF4A 5DHTA 2KRFA 5KYTA 3K1MA 5JRDS 1RJDA 1LV8A 3LDAA 4HDRA 4LE0A 4JYCA 2LY2A 1IZ0A 3LVRE 3ILXA 3FA2A 1A1SA 4ALJA 1K66A 2Z1DA 1GQFA 3OX2A 2BEWA 2A9RA 3NHLA 4YCNA 3M89A 2CWWA 4D43A 1I9CA 3ZVNA 2HQRA 2WTXA 2ZZMA 3ST7A 4XPIB 1LPQA 1BIBA 5LYJA 2HWVA 1UDAA 1XVIA 4BMPB 3TW0A 3C4QA 2FFJA 2UUZA 3TW7A 3TEJA 5CDSA 2PS3A 3G6KA 1V1JA 5CBKA 3CR3C 4LXIA 4HX4A 1MDBA 1BVRA 1XL0A 2REBA 4K9OA 2B9SA 3Q0IA 1T25A 2FH5B 1NJ2A 1CK4A 2HMVA 2Q28A 1NLYA 4A0ZA 4PO9A 2IJLA 4K8RB 1KSFX 3IBTA 3K6RA 5CKTA 2QE7A 3KZIC 4P81A 1ACMA 3A7EA 2WIKA 1DPFA 3R0VA 2PX4A 2X9NA 5EZSA 4EUEA 3UNXA 1MH1A 5LQAA 3V4ZA 1FDUA 2FN3A 5DJ5A 2CXOA 1UXGA 4PPQA 3SZLA 3EBOA 1AU9A 2QKMB 2GN4A 3HA7A 3SX0A 4ZOQI 3BE8A 1IDN1 4UE3S 3PDIA 1Z68A 2OA0A 2EIMH 3ZK7A 4A03A 2ZSUA 4M72A 1X2NA 5TGDA 3T5TA 3LCUA 1GILA 2QRLA 1I6XA 4JLWA 1OIXA 5BXQC 3TP0A 3HKCA 2CVHA 4KZPA 1QVZA 2Q8NA 3FRIA 1O3QA 1TECE 2G4VA 4XTCS 4HGQA 2KIFA 2IDKA 4KODA 1UP7A 5J2TF 4UOZA 4C08A 1CZLA 2O0LA 3EZGA 2ZBPA 4BMYA 4ESHA 1R0RE 1H3EA 4RPCA 1O03A 4LJ9A 1F8YA 1KIAA 5JSYA 1ISHA 3MJTA 3CYFA 3T35A 3HCNA 3JAWB 5KYWB 1ML4A 4IMIB 4QAJA 1IFXA 4E7OA 4M73A 3I28A 1UDBA 3IFSA 4M8IA 4A12A 4V2UA 2V7QA 4EY4A 1T8SA 3NMUF 2FEMA 3LY7A 3VZCA 2BR4A 3TVYA 1W88B 1A5SB 3BERA 4LY9A 3LWFA 4MKZA 1CUJA 2XW6A 1ZL0A 3SC6A 5D6FA 1ONNA 4PAOA 2X1EA 1EFRD 3E4DA 3HBAA 3VKVA 5D00A 4BTEA 3UHAA 1UKAA 1FDVA 3HM2A 5FXMA 2VI5A 4AT1A 2P91A 1YAHA 4AO8A 1STZA 3ZPXA 1YS9A 3O7WA 3RVPA 4RIIA 1U31A 3IC5A 1DAGA 2FPWA 3NW9A 3N58A 5H4HA 5C1PA 4HDSA 5JTUA 4M1TA 3SLRA 5K3EA 1M8PA 4A5MA 4XIYA 4DQ2A 1RM4A 4C89A 1IEQA 1GKLA 5F3RA 1GG9A 4PQEA 4BE4A 5JSFA 1QOPB 3UC9A 1RAGA 1AT1A 3H18A 1XF1A 4KK3A 1YR8A 4FMBB 1VZ2A 2AYXA 2PNJA 5KYKA 3DMTC 3ZE2B 4AXBA 4M6YA 4H7JA 2DMRA 4PNPA 3H11B 3BA1A 1VCIA 1VCNA 1XRPA 4BTLA 4J16A 1LF0A 2CFOA 2HOEA 3JRCA 3U81A 2WSYB 1XXHB 4RZ2A 2PBIA 5F51A 2G63A 1Y63A 1JH9A 1FDIA 1ZVMA 3W78A 3TAXA 2I3ZA 2GCIA 5JADA 1TZ2A 4BBSJ 3OQJA 2QRHA 3NRCA 4JJZA 2HA5A 5EOVA 4UE6A 4F91B 4CXFA 1E3JA 1GAEO 3TR0A 1OWMA 4L5YA 4DWJA 5MHTA 4ASUA