1XDUA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with sinefungin (sfg)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein RdmB
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
total genus 101
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xduA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xduA03
3M8EA 3KLNA 4HF0A 4IRHA 1JQ3A 2O05A 3PT9A 4RTMA 3GZ6A 5DUKA 2A68F 4LK0F 3MGGA 2Y1WA 2CSOA 3ML6A 1M0EA 1OYWA 1L3CA 1VE3A 4A2UA 5CLSA 4A5NA 1JHHA 1YW9A 3DUWA 4KUMA 3FTCA 4DZRA 2HZTA 2ESRA 2PG4A 3KPVA 3CJNA 1VL5A 2ETHA 4UUVA 3AXSA 1IXKA 1R5HA 2B9EA 5K03A 1ONVA 5L3BA 1D8KA 4H0EA 3TQNA 2ZNYA 5DTQA 3LHDA 3I4PA 3RDIA 4P9UA 2UYCA 4C07A 1Z7UA 3ID6C 1DP7P 2C7RA 2DULA 2PSSA 4EQZA 3B5IA 3WE3A 2CW0F 3KR2A 4G9YA 5IT9K 4HYEA 1FX7A 1X1AA 3KPYA 4F86A 5DM2A 1YUBA 2YX1A 5LRSA 5DXAA 4KICA 1LDDA 5K1YA 2CMHA 2WC2A 3R6SA 2P8TA 3OOPA 1VLMA 2DO7A 4U88A 4H0NA 1ZRCA 3KQSA 1XCBA 5HDNA 3LDFA 5HS7A 2YU3A 2HOEA 1DUXC 4RB3C 5FUBA 3T7TA 3UJ7A 4YMHA 1JQEA 5DM1A 5LQAA 2DLLA 1HKTA 3BZBA 2FBKA 3T0YA 4P7FA 2FRXA 1BC8C 2B25A 3FPJA 2OBFA 5F2OA 2K4MA 3VC2A 2XIGA 2IW5A 1MD0A 3GFJA 3HCCA 5HVQC 1IRGA 1AWCA 5CVDA 3FMQA 4BLVA 1WY7A 2ZULA 5BOXA 1QAOA 4R6WA 1F9NA 1XSVA 2ZVJA 3KR0A 5JI6A 1FBUA 3BKWA 1EH8A 2ZZNA 3LA3A 1ZG3A 3FHZA 3C0KA 1O7FA 3IV6A 5E1OA 3HP7A 2A6HF 3RI4A 5IH3A 2NNNA 2XUBA 4LFUA 3F23A 1O54A 4KVZA 1D2CA 1R00A 1XVAA 3WTVC 2EJTA 5L3GA 4PYKA 1P92A 2EA4A 3F4KA 3VFZA 3HCFA 4KMFA 5D1HA 1Q1HA 3R61A 3ROUA 1OR8A 3BWBA 1U3EM 3ZN0A 4PYJA 3KPWA 3P2IA 4A12A 2VE8A 2GLUA 2OBPA 2PVCA 4YV2A 2FOKA 5CVRA 2IGTA 4PYLA 3BPVA 2Q41A 1HW5A 2A14A 4O6JA 1U2WA 2I62A 2P5LC 3BROA 4ASNA 3FUWA 3HCBA 2MH9A 3BZ6A 1RIOH 4CHUA 4BP1A 3KKZA 2BE5F 2ONZA 5EC8A 1U5TC 4HF2A 4AZTA 2YQZA 2FMYA 1H0MA 3KHKA 3M7GA 1R58A 2ZMEB 4RAYA 5HZMA 3IL2A 3BWCA 2PX2A 2L4AA 5E8RA 2XYRA 2V1XA 5D5XB 5HFJA 4EJVA 4E70A 2HEOA 3OZSA 4MTEA 3I59A 1KQ8A 1YFJA 1DCTA 4A6EA 3FRHA 1N7JA 2QQAA 4LB6B 3NDIA 1CF7B 4FT4A 3R24A 3HA5A 3ZMTA 4E31A 4EJUA 5P8WA 5LQJA 1W5SA 2AN5A 1SVUA 3GLXA 3KQWA 2PY6A 2ERCA 1BI0A 1VPTA 4GXOA 1KHHA 2QY6A 3I58A 2PKWA 3J81Z 1QPMA 1IRFA 2Q0OA 3VSEA 3WTZA 4QQKA 5DD4A 5LBQA 5DT2A 3EVDA 4M73A 4RTLA 2A5YB 2ISYA 2IFTA 2ZSUA 3NWEA 4IV0A 4AIJA 1QAQA 3HVHA 3C3YA 2GA2A 4PONA 3WGHA 2G70A 3I64A 1P6RA 4PZJA 2KRFA 2AOUB 4WVLA 3PQKA 1I1GA 2IH4A 2STTA 2R7DA 1I1NA 2CKDA 5LGTA 3P71T 5AIPA 3H3ZA 4UV9A 2HDCA 3WTYC 5ICFA 1N2XA 3M6XA 1BM9A 3U2RA 3EEOA 4A6DA 1XSXA 5C9ZA 1P39A 1SG9A 3B02A 3E6DA 2PMHA 3LQRA 4UV8A 2CL5A 3TO7A 2JHCA 3KP4A 2DBBA 4ZTBA 1WSUA 3THRA 2F5FA 4FX0A 3BJAA 2V1DA 2AN3A 1NBIA 4R8SA 1LNWA 3GEZA 4MEYF 5DCMA 3RW9A 2G72A 4GF5A 5EMMA 3C6MA 3F8CA 4RGRA 4RGXA 3R0JA 4U0YA 2ZLBA 4UVBA 4QVKA 4RWZA 1NV8A 2FNAA 4L7VA 5EGSA 1S6LA 3GCZA 2F5CA 3WODF 2ZO4A 5JHUA 1BI2A 1KXZA 2EFOA 1QNTA 4FP9A 2PEXA 5FLXK 4HGYA 4K2EA 4E2YA 3DR5A 1MZBA 2K4JA 3X0DA 2QLZA 1HW1A 3HVKA 3UZUA 5ERIA 1B9NA 2KJCA 1U8RA 2K86A 3RPUA 2IA1A 5EZQA 1ZRDA 4O5VA 2YSRA 4WWCA 2HTSA 2VP3A 2DI3A 5HIIA 1G60A 2EV0A 2JT1A 3MAJA 2PT6A 3CO7C 3UFBA 1REPC 1XDZA 2ZBQA 2L3DA 4XLNF 4KDCA 4ENNA 2HR1A 2IVMA 1T2KA 3LCVB 2BR3A 3EGVA 4A5MA 4RSRA 4BHCA 4DCMA 3ZMSA 1B9MA 4LJZF 1I6XA 5U4XA 1HSJA 3T5XA 1PP7U 2DT5A 1OMIA 3M33A 3FTFA 5LEKA 2CFXA 4G94A 1BIBA 2HQNA 1LDJA 2PWPA 3F3XA 2ZTHA 4WF2A 4KW7A 1ZKDA 5FFZA 2ZXJA 3C3PA 1EH6A 5E2BA 3AXTA 1QZYA 3E8SA 2XKPA 3L7WA 3HCAA 2GA9A 3OE4A 2FRHA 2A69F 1T98A 3BY6A 3WU1B 3FTDA 2V6CA 2Z3YA 2ZBRA 1YZ3A 1XGOA 1E2XA 1ON1A 3GX4X 5G02A 2M5WA 2KW5A 3B73A 2C7PA 1Q0SA 3MERA 2PMUA 1AV6A 4HTFB 1L3IA 3E6BA 4AZVA 5T6BA 2L54A 3GU3A 3LA7A 1KQ0A 5DD8A 4CYDA 4HX4A 3F8NA 3G2QA 4M6YA 1O3TA 2AR0A 4ESBA 1P2FA 1L3LA 1G8AA 3BWGA 1DUSA 3DP7A 2QRVB 3GRVA 4ISCA 3EEYA 4AVPA 1SMYF 1KIAA 4CKCA 1FSEA 2Z99A 4GC5A 3NVKI 4M7RA 2QQBA 1FYMA 4BHBA 3JW4A 3L2CA 1P91A 3H3UA 3CUQC 4OBWA 2BGCA 3DULA 2O3FA 5K0EA 4UNOA 1SAXA 1NE2A 4C04A 3KQYA 2VONA 4FS8A 1D2HA 2O03A 3TOSA 1BI3A 1TNSA 4HA8A 1QANA 1LQ1A 4ER6A 3KP7A 4CGZA 2O07A 5HOQA 2B0LA 3BGVA 4YV0A 3LA2A 3GYHX 4M36A 3L00A 4CKEA 5CUQA 4P58A 1ON2A 2FF4A 3LX6A 3A7DA 1DPRA 4KYWA 2N47A 4Z2YA 4OQDA 1FY7A 1FNNA 4HZFA 3GO5A 2A3SA 3F21A 4YIFA 3P9NA 3BJOA 2IDKA 3MCZA 5J8CA 1B42A 2UZKA 5FD6A 2YVLA 1EJ0A 1Y8CA 5GWXA 4GYGA 4L0YB 3MCTA 4Y17A 2QWWA 1NT2A 4O3MA 3CTAA 2C7QA 4U7BA 1UIRA 3M70A 5HIJA 1QGPA 4DA4A 1XCLA 1J9IA 2QBYA 2E1NA 1H1DA 3A27A 3BWMA 1SMTA 1ODDA 3M1EA 2XAHA 2PX8A 3K0BA 1QZZA 4HH4A 1JSXA 3KETA 4Y15A 2KIMA 3SM3A 2GAFA 4EK9A 2OO3A 4DNCA 2HYFA 2P6SA 5LQUA 2DPDA 1TW2A 2BYVE 1S29A 2P7IA 2VC0A 1ZG5A 4EJTA 2ADMA 3PFGA 1IW7F 4B17A 4M9XA 1NW5A 3IRQA 3T8RA 4LMYA 5JVTA 3THSA 3FUUA 2A6EF 3TRKA 3QRFF 5C0OE 4EM0B 5C1IA 4DQ0A 1MKMA 3CKKA 4N0BA 2AOWA 3VOEA 4XSXF 2O0LA 1G8SA 3TM4A 3UJDA 4CZZA 4YFXF 1S3JA 2V74B 5D8LB 2PWYA 3RYPA 3QPHA 5H20A 3OCJA 5ICGA 3F6VA 3M4XA 1FZPB 3KR1A 4OINF 1F4KA 3WE2A 1J75A 2ADUA 3V8LA 3HM2A 3KPJA 1ULYA 4ATNA 2DFIA 3ULQB 1AOYA 4AWXB 3NEUA 4EMSA 1TW3A 2P7CB 3H2BA 2JRTA 3ABTA 4KDPA 4RTQA 2D1VA 3D5LA 3NJRA 1V4RA 4GEKA 2KJBA 4OBXA 1WRJA 3BGDA 5EIFA 4ZYHA 5D6FA 4LGWA 1KR5A 4BAYA 4MTLA 5K5QA 3GRZA 1KU3A 4HSGA 2C6YA 5FWAA 5K05A 2M30A 2D1HA 3R60A 2JHPA 1TQPA 4Y13A 3EETA 4GYIA 3GW2A 2P3QA 4WXHA 3TM5A 2EG5A 2EV5A 5LGNA 2GH1A 1R1TA 5HLGA 5LQKA 3AY0A 3LKZA 1P1BA 1NW8A 3EVGA 3O31A 4S05A 1GVJA 4D0PA 4G6QA 1RI3A 3SZPA 5K5OA 1LEBA 1GXPA 5A2QZ 2VDUE 1FP2A 5TRDA 1WWXA 4LG1A 4AX8A 4KDRA 4KIFA 5E1BA 1YZHA 1WXXA 2VXZA 2A61A 3T1BA 2VDWA 2VDVE 2YTZA 5F2KA 5T64A 1HNNA 3FM5A 1UHWA 4GC9A 3R6TA 2DQLA 4IF4A 2GB4A 2I6GA 4RTJA 4I7HA 1IXCA 1JG2A 2IA2A 3AWIA 4CTJA 1YS7A 2CWWA 3DXYA 4ZYEA 1YB2A 3BP8A 5GIOE 3GRUA 5JR3A 4A0ZA 3J80K 2YR2A 5LSAA 1W4MA 2P1DA 1VQ1A 4I0BA 1BBYA 2CO5A 4PIPA 4P5OA 5K0NA 3DLCA 1K79A 4RTKA 2F8LA 2FE3A 2ZWVA 2IH5A 4NB5A 3QOXA 3ZP5A 4EKIA 5D5WB 5FWDA 3FPFA 1TLHB 2HGCA 4PYNA 1YF3A 2JPBA 4HQMA 1FT9A 5HOOA 3CUOA 1HSTA 1KYZA 3G2PA 3LBFA 1BI1A 3CCFA 3RTRA 3G5TA 2G7UA 3FZVA 2AOXA 3BOQA 2PBIA 3V4GA 1FOKA 2HKXA 4IWNA 2VZ9A 3CBGA 1KA8A 3ZQ7A 4RV9A 1T39A 3I59B 1PJZA 3BPXA 2YUIA 1IN8A 4E30A 1G6NA 4I02A 3FUVA 3G8BA 5E8JA 2FBIA 5LLQA 2F5EA 5LQCA 3FM3A 1G55A 4IHSA 2AVNA 5E2AA 3HOSA 4X1OA 4HX7A 3F22A 3LPMA 4HAMA 4R1HA 4P7KA 2QM3A 3KP5A 4BY9E 1XDUA 4QDJA 5EKXA 1I5ZA 2BEOA 4UVCA 4M37A 3TOAA 3NQOA 3KQVA 5KVAA 3IHUA 2EFQA 3P2EA 2Q8KA 3T0IA 5CVVA 1S7AA 4FGZA 1R8YA 5IT3A 1L9KA 3MB5A 5KK1A 3EVAA 2W84A 4YFNF 3SGLA 4OIOF 1BIAA 1R1UA 3E5UA 2V9VA 4MEXF 2ISZA 3LCCA 1IXSB 2K4BA 1WXWA 2B78A 4KIGA 4YUXA 3QOPA 5HS8A 1DPUA 4OU0A 4PCQA 2K02A 2UYOA 1NKVA 5KQRA 1TQIA 1EIZA 1XGSA 1OPCA 4CO8A 4ER3A 2JSCA 4IRIA 4XBFA 2VBXA 4PYIA 5EMLA 4PINA 1TPYA 1DL5A 3JAMK 3E7PA 2Z9OA 3CLOA 2ZIEA 4RB2C 3SSMA 4RVFA 3B89A 2MLGA 5D5VB 3EVEA 2FMLA 5DCMB 1FYKA 1JHFA 2M87A 1U2ZA 1XGNA 4BQAA 2HTJA 2O8XA 4ENMA 2PXXA 2C7OA 3N97A 2P41A 1J5YA 3HTXA 2MH2A 3V8JA 4EJWA 4M9SA 4LECA 4RYLA 3P97A 5FCDA 1V3FA 4C05A 5TJJA 1IF1A 2P7HA 5HLIA 4EKGA 2HYGD 3C7JA 2FHPA 2RGVA 5EHIA 5LEJA 1G38A 5BQTA 2EFWA 2IP2A 3HCDA 3EYIA 4B8XA 1NW6A 1BN5A 1FBSA 1YLFA 1HKQA 1R22A 4AZSA 4U0WA 1AF7A 3ORHA 2OY0A 4P96A 3DOUA 1FWZA 2M8EA 3ELUA 3KP3A 3M8FA 4XRFA 2ORED 4WXCA 5J6XA 4UHTA 1VIDA 3WG9A 3F8FA 1VP3A 4HGZA 1H9GA 4FT2A 1HQCA 4P7JA 3I54A 3RKXA 4FX4A 4QQNA 2DK5A 3OU2A 3BUSA 1KP9A 2FCAA 5L3EA 3K2ZA 2XROA 5ILSA 5DSTA 4N9IA 1R23A 1U78A 4GOMD 3TGNA 3U9GA 2BM8A 3FWEA 3TO9A 1LB2A 5EOVA 2O61A 1FSHA 2NXCA 3EVBA 3RODA 2HR3A 2VODA 5D6EA 1X3UA 5E8IA 5AIQA 2HWVA 1QAMA 3KQQA 1F38A 4IKPA 5BW5A 5LRRA 1JG1A 3GGDA 3G88A 5DRYA 5EKUA 3R4KA 1LVAA 5EEHA 4AD9A 4QLCU 3QU3A 5CVIA 3OZRA 5L3DA 4YV1A 4CXMA 3UJAA 4BHPA 3HTSB 3MTEA 4MNUA 1C0WA 4V0RA 2KKOA 4NECA 1FJXA 2FXAA 2OU2A 2PGXA 3KZYA 3UJ6A 1MDMA 3EQLF 5L3FA 3G3ZA 3IRRA 3L9FA 1S7OA 2NXJA 3REOA 2MBFA 1XSDA 2IIPA 1NBHA 4JBAA 4P9FA 3GXOA 1I27A 5DTMA 3V8VA 4YFKF 4PYQA 2NS0A 3SVZA 1W7PA 3UJ9A 1STZA 3GFMA 5CIYA 3HEMA 2V7EA 3UA3A 4HBLA 3EMBA 1QYRA 3KU1A 3WGGA 1SFUA 1O7LA 3GRRA 4S04A 2O0YA 5CCBA 3G89A 5GIPE 4FSXA 5HILA 5EVJA 2HTEA 1EAMA 4DF3A 3O3KA 2OKCA 3MQ2A 2K27A 2MD5A 3JTHA 2STWA 1ZG1A 3ER8A 3S68A 1B4AA 4P7GA 3FYCA 1UFMA 4RTSA 4DMGA 5E9JA 5K09A 2B3TA 3FZGA 4BH9A 4MIKA 2CYYA 1QBJA 1D2GA 2H1RA 3ZMUA 2J5PA 1J7KA 3EGEA 3C1DA 3TR6A 5GP1A 1JGSA 4HLXA 2J5OA 1SQFA 4EV0A 1R8XA 2QBYB 4GBED 4ZZLA 3DKWA 2VBWA 1F1ZA 2BV6A 4I09A 1ZLKA 3P2KA 3DPTA 2EWNA 1SFEA 1IN7A 8MHTA 4LD5A 3BKXA 3SXJA 4CTKA 1VP9A 4PCLA 1ZAOA 4QWQA 5LHGA 4PIMA 2NNWB 2WA2A 1PDNC 4KIBA 5CCXA 2RN7A 3ABUA 3FYDA 1SUSA 5D8KB 2Y75A 2LF8A 3CJQA 5ERGB 3DPLC 1YW7A 2FEZA 4L18B 4E2XA 5FA5A 2TDXA 4X60A 3ELDA 1BC7C 3IHTA 3FUXA 4G7OF 2XYQA 2QENA 3J81K 5BPDA 4KN4X 4Q47A 1USTA 5FHQA 3KZZA 1I9GA 3T8TA 2G9WA 2O57A 4X63A 3SFZA 2YXDA 3EGIA 2RNJA 2FBHA 3NTVA 2IDJA 1DDNA 3MZHA 3L09A 3G73A 2EX4A 5ILUA 4A0XA 5KS2A 4HQEA 2PX5A 3HSFA 3RKWA 2EJRA 3LSTA 1PUEE 5DXJA 1FC3A 1SD7A 1X1BA 3QPTA 1FYLA 1ZARA 2IBTA 3SQNA 3NDJA 3PS9A 3WSTA 1RJEA 5E1ZB 5GOZA 3ELWA 2P5KA 5D5UB 3HRTA 3LFKA 3QAHA 2X0LA 2E7WA 3M9AA 2YX4A 3IEIA 5E18F 4Y30A 3RPQA 4CDGA 5ILVA 3DXXA 5B1SA 2XRNA 1HMYA 4NQWA 3DH0A 2XYVA 2Y48A 2VT3A 5E1WA 4OMYA 4RX1A 2W85A 1K7AA 5E9QA 5L3CA 3WTTC 2VBYA 3HHHA 4RB1A 1HBXG 2BR5A 3P8ZA 1G3YA 4V0QA 3KEOA 1WG8A 3HUGA 4MHTA 3UBTA 2OB2A 3W6KB 1UWVA 1R7JA 4KFCA 2E7XA 2L02A 1ZRFA 1XGMA 2YR0A 4Q48A 3Q9VA 2RVCA 3MFKA 2BZGA 4E2WA 1G6Q1 1UCRA 2ZIGA 4XLPF 3WU0A 4R6XA 4POOA 1SD5A 1X19A 3A7EA 2W25A 4QVGA 4PGGA 5DUIA 3I9FA 3WTUC 3FPEA 3TPZA 2RKHA 4JQFA 3NW9A 1P4WA 5E9WA 4P55A 3EPPA 5HIMA 2XHKA 3V97A 3QP6A 3KE2A 1KU2A 2OZ6A 2ZFWA 1PRYA 2HV9A 3BDDA 5FULA 4C4AA 1QO0D 4MGRA 2M45A 3J80Z 3AAFA 1O57A 3OE5A 2XGXA 2EV6A 1IY9A 3UA4A 4JXJA 3G7UA 1HKSA 3WTWC 4PNEA 2PBFA 4RTNA 1YS6A 4U7PB 2ZJ2A 3A26A 4RTOA 3GO4A 2K7LA 2YXEA 2ZBPA 5DRTA 3ECHA 5DSXA 2GQQA 4PWYA 2RC4A 3VYWA 2ZCWA 3T7RA 2HMYB 3B3JA 4MQVA 3FRIA 4OIRF 1JG4A 4KRGA 5EHGA 2KIFA 2F5DA 4YG2F 3LBYA 1X1DA 4IV8A 1D8JA 4R05A 4GO1A 5J8FA 3BXOA 5E20A 4O29A 5EQJB 4BLWA 4C06A 1MGTA 2HQRA 1G3TA 3EUHA 4M74A 2JJQA 4BXUA 4LWPA 3TDZC 5IT9Z 2ZKZA 3G8AA 3KFWX 4QPNA 2RQPA 4LG0A 5ICCA 3O6BB 3PX3A 1FBNA 4HV6A 2ZIFA 5E8GA 5LR6A 5EMKA 1LEAA 3MZYA 3A4TA 4PDKA 1HXDA 2G1PA 3KP6A 3BT7A 2X4HA 3GUDA 1KU7A 2PI0A 5D4RA 4N9HA 3GJYA 3HA3A 3LKDA 1OYYA 3U1DA 4C08A 1JXSA 2VT2A 4MWZA 1MJ9A 4IJAA 4OMZA 4KNYA 3Q87B 2OYRA 4MQ9F 2LSOA 2PFBA 5HS9A 1Z1DA 1SQGA 3NRVA 2D45A 3SXYA 1LJ9A 5H6QA 3KR9A 5FO5A 3JTGA 2FPOA 2D2WA 1RI2A 5BXYA 3M6VA 3FMSA 2HFHA 3JSOA 4RTRA 4G6DA 1FBQA 4Q4ZF 3ELYA 1OKRA 4YUYA 3SR4A 4M71A 4GOOD 2FA5A 5CVJA 4GOND 3DMGA 2XKOA 3GF2A 3CDHA 4GQBA 3OU6A 4DKJA 4A0YA 4XUDA 3FXQA 3LGAA 5FQOA 3O4FA 3MEXA 4AIKA 3K1MA 1YFHA 3GFIA 3VODA 3DMFA 5BP7A 1L1EA 2EK5A 2Y1XA 3OZTA 2LF7A 1JG3A 2R6ZA 2OAZA 5KVRA 1TBXA 4BNCA 1EJ6A 3HVIA 1U6GA 2DW4A 3EVFA 2IPXA 2H09A 4IRGA 4X41A 4YUVA 2VOOA 3FTEA 4FHTA 1XMAA 1ZQ9A 4HDVA 3ERCA 3HRSA 1RUOA 2E1CA 2AOVA 2XVMA 2EFPA 4E33A 1RNLA 3HSEA 2QUFA 2JPCA 3K0LA 1W5TA 5CM2Z 2AZTA 4U7TB 5FB2A 1G4DA 4Y2HA 2LKPA 2HKOA 1UFKA 3P7NA 3KQMA 1RJDA 2H6CA 4M9ZA 4KWCA 4ENJA 1XN7A 4ER0A 3B7PA 3FPHA 3TLJA 3R3HA 3PVCA 2AXLA 3UWPA 2ESHA 1K78A 3QOWA 3Q5FA 2OPBA 2V1UA 3NVMB 2ZZKA 5E1DA 2IJLA 5EEGA 4GUAA 4KT5C 2JH8A 1IUYA 3K9TA 1XDSA 3I5UA 2CG4A 2FYTA 4EGYA 2HS5A 4I98B 4L9VA 2O06A 3EVCA 1SKMA 1ORHA 4RVGA 3F6OA 2ZCJA 2NAZA 3S2WA 4F85A 2P3OA 3JWHA 2JHAA 1Y0UA 3ELKA 4G7HF 2ONYA 2ELHA 2NXEA 4XCXA 2WTEA 5K0LA 5K5RA 5KQSA 4U0VA 4U7DA 4FSDA 4FT8A 3IKTA 1MDMB 3VEPA 1D3YA 3SMQA 1XTPA 5LQRA 4PCAA 1GHCA 4RVHA 2YX7A 3V7CA 2HWKA 3E5XA 1IAWA 3B3FA 2P35A 1S8NA 3PQJA 4HC4A 2WWYA 3QV2A 3I53A 1R6AA 2P7VB 4B09A 1RUNA 4GGGA 1ZHFA 3GIWA 4XUCA 2XASA 3COAC 1R74A 2ZFUA 3K69A 1W7PB 2BM9A 1KPGA 5K0CA 3P9KA 3TFWA 5A2QK 1AQIA 2Y0MA 2CGPA 5FADA 4WCGA 3TKAA 2FSWA 4LK1F 3BWYA 3HVJA 10MHA 5K0GA 4Q5SF 2QYOA 3SZTA 4HOBA 3LDGA 3E05A 4LB5A 2VE9A 2H94A 4L9TA 3BJ6A 3RKYA 2R7FA 1J2XA 1MJAA 2IBSA 5GM1A 2AOTA 1PP8F 2MC3A 3GNLA 4QTUB 4HDUA 1KGSA 4DM3A 2AS0A 2NYXA 3G2MA 3LECA 4ESFA 2L4MA 1JSZA 4YMGA 3C18A 1YIOA 1U5TA 3RIEA 3JWIA 1FP1D 5MHTA 2GAUA 5FLXZ 1RI5A 2LD4A 2WA1A 4M6XA 1W7PD 2VOPA 4ON0A 1F3LA 3R0QA 1G3SA 4GOLD 3ZMZA 1TTYA 4CICA 4YUWA 1KYWA 1R18A 3G5LA 3FXUA 3Q7EA 1CGPA 5K0BA 2P6TA 3MTIA 3TQSA 6PAXA 4AUKA 2LNBA 4OIPF 4DCGA 5HLHA 3ERED 3HTUA 2OQGA 4ETSA 3DTNA 1ZN2A 3C3WA 2FK7A 1IM8A 1Z91A 1BKYA 2XAJA 4IVNA 2EJUA 3HYIA 3P9IA 3QP5A 1ZREA 3CJRA 5T67A 5BS6A 1BOAA 3MQ0A 2W57A 2YXLA 3SHFA 3CVOA 4L5IA 1ZLJA 5DX1A 1IXRC 2DK8A 2G71A 3GVAA 2QE6A 3CGGA 3PFHA 3ECOA 1YO5C 1L0OC 1ORIA 2Z6UA 2QZ8A 2XVAA 1M6YA 1T38A 2DAOA 5D1NA 2CMGA 4HX8A 2I9KA 2ESNA 2W24A 3TOBA 3KQPA 3T7SA 2IPQX 5BMZA 2GXGA 1RJFA 4RS8A 1IN5A 1RZ4A 1EG2A 1E17A 2NYUA 3C6KA 4TV7A 5D4SA 1R5GA 1J59A 4GCVA 2G8NA 2PJPA 3GDHA 5EIWA 2PQ8A 3K1PA 9MHTA 1FLIA 3Q9SA 3QU6A 4HLYA 1P1CA 5CYVA 3CUQB 1YQAA 3V7RA 4G7ZF 2KIUA 3SSNA 5CVEA 1SFXA 1MJFA 2PXCA 1RI4A 4QTTB 2H11A 3DMHA 2GZWA 5DX8A 3LAJA 4ESJA 2HNKA 4E2ZA 4ENKA 3UJ8A 2PLYA 1OYIA 3KEQA 3UJBA 5HDKA 1YG2A 3TKYA 2ZW9A 1Z9CA 4ZYGA 1WKMA 1FPQA 3DEUA 3ER9A 1SD6A 5K0FA 1ZGJA 3L8DA 5DLYA 1MJBA 3KQTA 5H02A 3HIFA 1NV9A 2PLWA 1BC5A 1X1CA 5JFRA 2UYHA 4WXDA 2ACJA 2OA4A 2UXNA 3E97A 3IC7A 1ZYRF 3KQOA 2BH2A 4LLNA 2XVCA 1BJAA 4EM2A 5K0JA 3D2LA 5E17F 2OD5A 5EPEA 3HHGA 1ZGAA 2XAFA 2OQRA 1XCVA 1K6OA 4E32A 3MHTA 4EQQA 4QPPA 5LHIA 5H6RA 4RAZA 1BHJA 5ICEA 4I01A 3F72A 2P4WA 5FGMA 4ZYDA 3ZMDA 3K6RA 1D5VA 2PX4A 3OU7A 2ZWAA 3CJTA 1O3SA 5ED4A 5K01A 2IH2A 3ZN1A 2AS5F 5DTRA 2H00A 5DM0A 2NP7A 5FTWA 3KCCA 3FMRA 2XAGA 3E6MA 2GXBA 2DTRA 5KYGA 5JUWA 1AQJA 2M1BA 4ER7A 3PB3A 3IKVA 4G8XA 3H92A 2WK1A 5DPMA 2ZMEA 1KPHA 1YYVA 2QQ9A 1BOOA 3JWJA 1Z6TA 5FD5A 2H27A 2P3LA 4PYMA 1EQAA 3NWBA 3I71A 1NW3A 4IPAA 5M5BA 3O2PE 2OZUA 4EGZA 1VTNC 2L01A 1R1VA 4M72A 3FF5A 1IN4A 1XJ5A 1JTFA 1Z05A 4MHGA 4DQ2A 1B1BA 2GWRA 1CF7A 4BP3A 3LDUA 5F2NA 3DV8A 4I0AA 2UYQA 4CXFA 3AJDA 1WI9A 3ZPLA 5E1XA 1LDKB 4RGSA 1J0RA 2RV8A 2PV0A 3M6WA 3RJPA 1T6SA 2UWMA 3DXZA 2WV0A 4F84A 3JWGA 3IYLW 4AZWA 2Z6AA 4UVAA 2UZ4A 1I4WA 3KPUA 4X61A 3E23A 5EZSA 3GFLA 2NXNA 2P40A 5K8VA 5LQNA 3EVZA 1RI1A 3PX2A 3CUQA 2Z6QA 1KPIA 1I1SA 5DYMA 5HEKA 3V7SA 1T43A 4L9NA 3E3VA 1YTYA 2B2CA 2I7CA 1EH7A 2FU4A 5CJ9A 7MHTA 2F2EA 4OOIA 5LGUA 2AOUA 2AVDA 4LG0B 2PXAA 1USSA 4PYOA 2JZYA 3ANXA 4ZH4F 2Q2EA 2NNYA 3WTXC 4UXNA 3HRUA 3LWFA 4IHTA 5LHHA 3IWFA 2GS9A 5HDGA 4XSZF 4K6MA 3VC1A 3DF8A 1OR7A 4HG2A 2XV4S 4HRAA 2MLKA 2PJDA 4OQEA 3A25A 3WGIA 4FZVA 1VBFA 1RI7A 2BBYA 3DXJF 4R79A 4OX9Y 3DFGA 3OV8A 3MAGA 3R9XB 1IZ1A 2XBMA 3N4MA 4M38A 2EA2A 3NMUF 3EYYA 4RGUA 2DU9A 3G2OA 3GWZA 1NW7A 4HV5A 2MA3A 3KLOA 1P4XA 3SX0A 5EG5A 4OA5A 5FFXA 4LWOA 3P9CA 1XB4A 2O6GE 4UOEA 3BGIA 3EMDA 5F1RA 2VS1A 2ZBKA 1HW2A 1L3BA 5DCFA 2G7HA 4ZZDA 3PLAE 2H6BA 4KN7X 5GINE 2EB7A 4QDKA 3KP2A 5DM4A 2EFNA 4KMUX 1JQDA 3LL7A 3SSOA 4HF1A 3VB2A 1WZNA 3F8MA 1QQIA 1XCJA 3ZMVA 5FHRA 2FNPA 1WS6A 3ISPA 2COMA 1O3QA 5F6FA 4MQ4A 3RYRA 3CO6C 5DEQA 3UJCA 3WTSC 3DLIA 1G3WA 2V79A 3HRMA 4OA8A 3W6JB 2DPMA 5IKMA 1TQMA 2JTVA 1B59A 3F8BA 2P8JA 1IN6A 2ZNZA 2IA0A 3DQVC 1T0FA 5BPIA 4L0ZB 4I2OA 3HOTA 2UXXA 4FR0A 5GM2A 1UHMA 4L5JA 4YIIA 3I0TA 4LLLA 1WQ2A 3OFKA 3FUTA 4F7ZA 1M6EX 2XAQA 4R8RA 2NP6A 3RIRA 3TO6A 5FA8A 5DDGA 1SUIA 4XUEA 1Q0TA 4JK1X 3LAPA 3PTAA 1K78B 1RJGA 1SD4A 1INLA 2GPYA 2GA1A 4HTFA 4C03A 2OZVA 5BW4A 2AN4A 1YFLA 4RTPA 4EJOA 3R0AA 2ZZMA 4BLUA 3FXRA 2R3SA 3PFIA 1Z6RA 4PGHA 1KQ9A 1JR4A 1Z3CA 3B3GA 5DX0A 3E6CC 2QRVA 4NHJA 2YPRA 2BR4A 1MHTA 4R8HA 4YUZA 4G56A 3JSPA 5DWQA 4CKBA 3U81A 3TMAA 4MTDA 1P4AA 2FK8A 2QVOA 3IWZA 4CWAA 1B6AA 2E5WA 2IT0A 1NHAA 5HIKA 2NRAC 1V39A 1KU9A 4OIQF 3CC8A 3HA7A 1YW8A 1ZH5A 1O9HA 4RVDA 5EMJA 2OXTA 3OFJA 1GXQA 4EM1A 2PT9A 5F64A 2VN2A 4LLGF 2OB1A 5E1MA 3LQQA 1A04A 3E5QA 3M6UA 4WX9A 1N7IA 2RDPA 2DQRA 2VC1A 3EDPA 2CWEA 3K1NA 2DPUA 3TDUC 3J7AO 2LDUA 4KA4A 3GRYA 2CQKA 5CVUA 3JAMZ 5AONA 3ME5A 3GZ5A 5FQNA 1JE8A 4IXAA 1XMKA 3HNRA 2Z5UA 4WK8F 4ER5A 3HSRA 2JH9A 3OPNA 2EFJA 2AOTB 3HCEA 3LCUA 1XD7A 1JTEA 3MWMA 4BYYA 4EVIA 3V8KA 2VBZA 3FPGA 1TNTA 4RB0A 1UB9A 2PN6A 2Z33A 2GIVA 1R36A 2JG3A 1U5TB 5DV5A 4AIHA 2A07F 4L9JA 1O9GA 5CD1A 3FX3A 1O3RA 2FQ3A 1EV7A 4HW0A 3O7WA 2P5VA 2IRFG 1XXLA 1F5TA 1H9TA 3D0SA
chains in the Genus database with same CATH superfamily
5KQLA 5FROA 4GXQA 4XR4A 1UBSB 5CPBA 3LSYA 5JNUA 2Z09A 2YFQA 1EYZA 4A2UA 3MOSA 4EFNA 4JP1A 4PNPA 4A5NA 3P52A 2X8BA 1EDDA 1TM1E 2BVLA 4DMCA 3A2LA 5L3BA 3ETNA 1QE5A 2PA0A 3JYOA 2A30A 4MFDA 1MIHA 2DFTA 1ACIA 1DTEA 3NCTA 2CW0F 3TCKA 4FFVA 4F86A 1M1YA 2BHRA 2PU5A 1T9DA 1LBQA 4E3ZA 3IS3A 3T4XA 5FLXA 1DUXC 4IM7A 4JT9A 3KZKA 1US8A 2PRZA 1ZRSA 2QSJA 1AZTA 3T7JA 3X44A 4MI1A 2XIGA 1JDBB 5A4KA 1I2BA 3S8PA 4FI3C 3LXRA 4M3GA 2VPPA 1YA4A 6ADHA 1ZWKA 4ZZ3A 3LA3A 5G53C 2TMYA 3IHWA 1VLVA 3IV6A 5E1OA 4AN0A 1PK7A 4DM4A 1C9JA 4PYKA 4AU1A 5M3FJ 4Y2SA 4JQZA 4OU5A 1E58A 1VHLA 3W1WA 1U2WA 1K27A 2M7AA 3RFCA 1E2IA 4D0RA 3T1TA 2HNHA 1GGHA 1G2IA 1BAPA 1X7GA 1CULC 3OX4A 4BACA 3R3UA 2NU7A 4E4TA 3IL2A 3G1TA 3VC7A 4G85A 3OZSA 3ASVA 3BC8A 3I2FA 1SUWA 1ETHA 3ZR4B 1VFNA 3QEKA 2MSNA 4UOZA 8GPBA 3V1TC 4XSHA 3FB4A 1J9GA 1E0AA 3ZW7A 2RHJA 4CT0A 4KP7A 4CCKA 1N57A 3PQKA 3VJLA 5JC8A 4LBZA 1VIYA 3BJRA 3M1LA 1CVIA 3B13B 4BIIA 3EEOA 1W36C 1XTIA 1SG9A 2ZXHA 1KH2A 3DDHA 4ZOLF 4UY8I 1L7XA 1PTKA 2XNHA 2VZEA 2G72A 4RGRA 3K2AA 2PSJA 1IG7A 2H1FA 3DEIA 5EGSA 5JRZA 4OL0A 8ABPA 1DX9A 1KXZA 4X54A 1G21A 4K2EA 3F96A 4KGXA 1MZBA 5DM7F 1Y4SA 2BMFA 1B9NA 1H5QA 4HNUA 3RPUA 5JFOA 4HBGA 3CKLA 4A2WA 3P0EA 3NVAA 1XQ1A 3QNUA 4FYMA 4CNQA 5KQGA 1Q6YA 3A9RA 4F0JA 1OKKA 4ZYXA 2QRLA 4D4LA 2EFHB 4IICA 1A8SA 4RSRA 2H8KA 3KE8A 3MWGA 3ZMSA 4GMKA 5IASA 1B9MA 2C5AA 1MQ9A 4TZ0A 1N2EA 1UODA 4YYEA 2QPAA 1MNEA 4KW7A 2Y1KA 2ZXIA 4IJKA 3AXTA 3OO1A 4TMXA 2ZMEC 4NZ9A 1NDUA 2V6CA 1TYDE 1SC7A 3ZY6A 4I50F 4MDFA 5FLMJ 4NNOA 4L5CA 3R9IA 5ALXA 1SBZA 4K46A 1IRXA 1RWBA 1EBUA 1JSRA 4WXPA 2BELA 4G8JA 4CKBB 3LYHA 2XOXA 4AQ7A 2ZPTX 1GRCA 2OV1A 3F7NA 3L1VA 1D03A 1CZRA 4Z8YA 2PRSA 3W3AH 4QHTA 5K45A 2M6RA 1PJ3A 3UHFA 4YV0A 1VKRA 3L00A 4KOEC 5CUQA 4KREA 2RQQA 2FEXA 2VTKA 4KYWA 2FZEA 1OR7C 4OQDA 3PPXA 5CJ2A 1VOTA 1LLQA 4ZAXA 3BQ9A 1WW8A 5FD6A 1GL9B 4L0YB 5CG1A 3MT9A 4DJFC 3CEJA 1XHFA 3HOWJ 1I1HA 4JI1B 3VDQA 2ARKA 5BVGA 3ULKA 1BEUB 1M1NB 2PUDA 1TAHA 3MLEA 3KDSE 1WJCA 1OUMA 2FGJA 2JWTA 3DMTC 5AM3A 1IUOA 4QU8A 3KSMA 2BMAA 3LZDA 1KBZA 2P2DA 4UPDA 4PFOA 4V24A 2Z2SB 1T2UA 3TRKA 3QRFF 4TYPA 3LC0A 4FYVA 5BV7A 1G3RA 1MKMA 1QHXA 5ESDA 4PG8A 4XM3A 1ZCFA 3S7ZA 1NPTO 1JIUA 1DGRM 1MVOA 5JSFA 3OCJA 1L5GB 1NBMD 3WE2A 5C4XJ 3Q0EA 3B5JA 3IB3A 3QFHA 2G9NA 2WWWA 1EKEA 3DKIA 4DC9A 2FSVC 3N8IA 4KDPA 3ABTA 2WABA 3F97A 4OHXA 4OBXA 3LWBA 1VZ2A 4MKFA 1DRWA 4P80A 3IIKA 2OR3A 3ZRGA 3LL4A 1FDIA 1VPEA 2C5BA 1V5GA 1J0CA 2FPIB 3AY0A 3LKZA 4H59A 3RQSA 4QOJA 4KDRA 3ADDA 2A61A 4D0GA 3IURA 1USWA 4KPYA 4KQEA 4CTJA 4XN0A 3OUTA 2R1VA 2P1DA 1VSVA 2PD3A 3LE8A 4PIPA 4E21A 4RTKA 3RV3A 4KXMA 3TPFA 3CS3A 4U3JA 4AK9A 4XKJA 2DQSA 3I5XA 4HDRA 3PZBA 1RT9A 2VRCD 2Z04A 5HNKA 2WY2D 3CBGA 3FIJA 2QTAA 5KYVA 2Y68A 3OQMA 1CF2O 3PRYA 1LBHA 5KKNB 5JVDF 5FOQA 3TRIA 4ABYA 1QDUA 4QDJA 1OI3A 3UT6A 3NXSA 4MW7A 1OCEA 1IBMB 3IHUA 2Q8KA 1S7AA 1QPIA 3IOBA 4ZHQA 4B79A 2JIDA 2B78A 5A03A 4E11A 2BVNA 5I3CA 2ZQ5A 3GJ3A 3WYAA 2IVFA 1AN0A 3L1KA 3S3OA 1UBOS 2A9VA 3E84A 3N8HA 5D5VB 5BYBA 3IULA 2XMRA 4NBUA 2MCFA 1B8IB 4EGQA 3DOHA 4IIJB 4R8KA 4ZAGA 3WYCA 3SX2A 4OYHA 4TRNA 3HGMA 1CUEA 4CM1A 1FX0A 2KQUA 2RHHA 1NJSA 5BQTA 1YFZA 2VH2A 2YXPX 4FFNA 2H3EA 4NK4A 1NHGA 3ELUA 2QDXA 1TYAE 3TS1A 3H99A 3TQCA 1PFGA 3G1OA 2BF7A 3QJYA 4QQNA 4F5DA 4GM1A 4PK4A 1QQ7A 3D0OA 1N0WA 3X1ZA 5KWVA 3LGXA 3GJ8A 3R0VA 5AIQA 2OSVA 4FTWA 4LGYA 1CQWA 4G0XA 2ZIVB 1DEHA 3KUDA 3EUEA 1YB6A 2I1LA 3LSHA 3CV3A 2GXAA 1OY1A 3D6HA 4W1SA 3UJ6A 5SZIA 3KYCB 2VHUA 1U0NA 4UBKA 5ALSA 2XJ9A 3JCZA 1FYFA 4LISA 3FAZA 1TECE 4NESA 1JE0A 1FNMA 2VNKA 3G2HA 4PO9A 1TEHA 4MKRA 2WMNB 3EQ9A 3UHAA 4QGBA 4B2YA 3INGA 4L9WA 2CE7A 1ZL2A 2DBRA 3X2FA 5JBQA 4FSXA 2WM3A 3TLCA 1E1NA 3O3KA 3ZEIA 2NTVA 2BHTA 3CLVA 3DFZA 4IIFA 3PUJA 4RTSA 4GR9A 4BH9A 3EEQA 3ZVNA 1X2BA 4PVDA 2HCTA 5IOYA 3S17J 1ERDA 3DE1X 4P1WA 1R8XA 4GBED 4AJ9A 2NU8B 3QW4B 3OWXA 1E9CA 3FLMA 4I09A 4JP8A 3FCXA 2YOHA 4XIYA 4Q7MB 6REQA 1X3WB 2QRHA 4JITA 5U9CA 3O8NA 4N9WA 4GOXA 1NYRA 2A9QA 4EFDA 3CNNA 1WOMA 3H3VK 3DPLC 1YW7A 2WJYA 4L08A 2TDXA 2BCJQ 2A35A 3J81K 1IZ9A 1FRFS 3OFNA 4F3RA 5FHQA 2PYIA 4XIIA 5D01A 3C3DA 4FDLA 3MZHA 1U6KA 4D3DA 2HSWA 4W7HA 3EXG1 2QTFA 5C8YF 1GXSA 3QU2A 3W2HA 5CXQA 3NDJA 4F1KA 2DCUA 4G1EB 4WKBA 4V2FA 4BUJA 2LKCA 3TQHA 3RPQA 4CDGA 1RC1A 4G86A 4KR9A 3KEOA 1ULBA 1MQSA 4UJ3A 1AB5A 3CTMA 1O96B 1WW2A 2L02A 1XLTA 5F4BA 1AT1A 2CDAA 1GFIA 2AMJA 1QIGA 1PS8A 4HWSA 5BV8A 1EQUA 2QX6A 2GUGA 3U48A 1AHHA 2IOFA 1JQAA 1IHYA 2VP6A 5JSYA 4XZ3A 2GXSA 5DGCA 2QL7A 5F3WB 2XTAA 4TRJA 1P4WA 4QWWA 3K9NA 4B2IA 4CM9D 1EJBA 1Z4MA 4X1YA 2ZJ6A 5AW9A 3EH2A 5I48A 4AKSA 3DBIA 4LYJA 3ONVA 3O4VA 2YFKA 2DU8A 4E03A 2Q3BA 1LW7A 3GDFA 3GUZA 3EFOA 2ZATA 5I7HA 2Q49A 3E9RA 1HURA 3W34A 2W6ID 3B78A 3OA2A 1GT6A 4TTSA 4A8JB 4KT6A 4EJFA 3LBYA 4V1CA 1KMNA 1Y3IA 2DWQA 2DSTA 3T6KA 3QUQA 2ERYA 1G6HA 4QDOA 3RGWS 3BXXA 4PDKA 1C0EA 2D1RA 2X4HA 5FWYB 3MN2A 4D9KA 5A7HA 3FWNA 2BONA 4DEVA 1JWLA 3FNHA 5IMBA 4BJ5C 4Y1EA 1Z1DA 3DVQX 4P7BA 1DCMA 3PR3A 2LY1A 4CA0A 5C32A 3HN2A 3EPHA 2E6KA 3U80A 4TM7A 3FYUC 3DMGA 1QIMA 1QF6A 4OJMX 2GLOA 3MEXA 2EL7A 1ISGA 3O0DA 4LF8B 3ZU6A 4U9HS 2E4AA 5BP7A 4QELA 2ID6A 2R84A 2CUFA 3DTVA 3GJ5A 2JVJA 4LCBA 1EJ6A 4DA0A 3WB1A 4ILKA 3H2IA 2LKSA 2XT6A 3FTEA 3WADA 2JHGA 3LVFO 3HRSA 2AOVA 3L0OA 4EHKA 5C34B 3PI7A 4HQRA 2AZMA 2GEUA 3CDIA 4TYNA 3MZ8A 2HCJB 1NL3A 5EJGA 1JHQA 4M1QA 4Y2JA 3Q5FA 3NVMB 2WI8A 2CQNA 2C8JA 1PV1A 3QF4B 3PQ6A 2HS5A 3U7EB 2Y0DA 5FFMA 2QMYA 1XO1A 3F6OA 1NQ5A 4DCUA 2P3OA 2EBIA 3DMRA 3D81A 1C8VB 1CQIB 4DHWA 2RAPA 3L8MA 1PD0A 5JT1A 1L7RA 4JL6A 3FH0A 5GJWC 3FVQA 4Q9LA 1Q74A 2X51A 4B09A 1OQAA 1Y8RB 4WBNB 3G0OA 3EXHB 1FW8A 1R74A 2ZFUA 3QEBZ 5AJYA 1W7PB 1KPGA 3LBAA 2PS0A 1HDPA 1BJZA 1KMCA 2FSWA 4LK1F 5K6TA 2YIVX 1M2OA 1G41A 4A8PA 1K3TA 3IOEA 3U6KA 2IBSA 1DJPA 3OYDA 4GNRA 1G5TA 3RG2A 2XDAA 4HAZA 2FZ5A 2NYXA 3B2QA 2W2NA 1FUIA 2LE0A 2FA9A 1YIOA 4S0XA 4YHHB 3MYRA 3MJDA 1XZEA 1W7PD 1KH3A 4DLXA 5FUVA 3CH4B 5JCXA 3F7TA 1H89C 3BG3A 1L5MA 3FR8A 3H1FA 2RGBA 3TQSA 1JJ6C 5DTEA 2EERA 4IXWA 2A7XA 4WEOA 5SYAA 3TMOA 2WIDA 4QJIA 1NVUQ 2A88A 3NZEA 3WXMA 2PL3A 1HYEA 2V0CA 1RRFA 4ZA2A 1GJRA 1P2SA 3D4IA 1KQGA 4WCVA 1A9OA 3BXEA 4XIGS 2OZKA 1SU6A 3AM3A 621PA 3TDMA 3AR2A 4MS3A 3W9UA 3C85A 5C80A 4OPMA 3PUZA 3PIIA 4TV7A 3CEHA 1XNHA 4MRPA 5EIWA 3JQBA 4D9EA 1UFVA 2ILTA 1KAQA 1GPMA 3JTEA 3WBKA 4Z7QB 3CIOA 1RKTA 2BE7A 4D8VA 1AQYA 2HF7A 3GLVA 3N0VA 3RASA 1G9XA 2F4MB 1G42A 4YRRA 1FOYA 2QR5A 5H02A 4C21A 1X1CA 3AF2A 8ADHA 1JHZA 1P9RA 2BGIA 4KE8A 1QOPB 1U2PA 1K98A 1X7XA 1R64A 2H5EA 4Q03A 2ZBEA 4IZ6A 4C1BA 1LJUA 2OHXA 2VUUA 1TO2E 3L8CA 1DIAA 4I01A 1NVBA 3DO5A 3K6RA 1ZJZA 4PVCA 1GUUA 2LD5A 4UDXX 3JZAA 5DM0A 3ZYZA 2PR2A 3E35A 3RC9A 3K4LA 1D2EA 2ZBGA 3PB3A 3GARA 4KAJA 4KIWA 3DTTA 3NHFA 1T6ZA 5CH3A 1AJEA 2VJQA 1R0RE 3K8ZA 4FDUA 4G5SA 1HDXA 4IXTA 3CZQA 1GNRA 4OM7A 2IU6A 5E1XA 1OFUA 4UASA 2PNFA 3RRZA 1FZQA 5EXDA 2HJ9A 4QICA 5CD9A 4O4HB 2ZU0C 4EI2A 4JA0A 4RZIA 3FLAA 4EA6A 4CIAA 2O0HA 5DYGA 1X42A 3R7WA 1OWPA 4OI0A 2B2CA 5TVKA 3D5EA 2XCSB 5JI2E 4OOIA 1C9DB 3MJFA 1N6HA 3A1NA 1NQVA 5HQTA 4QYWA 2HIGA 4MO2A 3E81A 2X2PA 2L2OA 5GP9A 2PANA 3FA2A 4TN5A 3J7TA 3BSSA 2PQ6A 2PZEA 4HG2A 3DFFA 3IAS1 2D1YA 4QGFA 4MR9B 5I8PA 1NLFA 5ITSA 4R79A 3SZUA 2XBMA 3KM0A 4L8YA 4D8XA 3K1ZA 4LWOA 7REQB 1M1ZA 1K8QA 1CHDA 3EA5A 3FBWA 3LSIA 4GSKA 5DM4A 2KFDA 3HB0A 4E5NA 2O9JA 1KO4A 5JRJA 5L6LB 4CMKA 2Y67A 3P32A 1PUFB 1B76A 3HYRA 1KEUA 4BTVA 3KHTA 2NTYC 3VJRA 4D57A 5IKMA 1YZKA 1EFTA 1QQTA 1UHMA 4MGZR 4OAPA 2LW7A 4OFBA 3QXXA 5KNDA 4O4HA 2A58A 2JA1A 3MWEA 5A5EA 2AQHA 4EO7A 2C3MA 4BEJA 2A0KA 4ZI7F 1EINA 1INLA 3MOIA 2OZVA 4BLSA 4JQYA 4EJOA 1Y1VJ 1KOGA 1Z6RA 1Z3CA 1KQ9A 5SYMA 4ND6A 2W58A 1T36B 4IX9A 2C2GA 5KYYA 1KVRA 3AU9A 2B5VA 3O90A 2JFOA 4JX9A 3GLKA 3BG9A 2IXFA 4CCAA 3FTQA 4ZDWA 2VJDA 1ZH5A 1J2JA 4QDUA 2ZIUB 4IG4A 3T54A 4D9HA 4LLGF 2JJ1A 4PPYA 3L7NA 4B4CA 4QYIA 3FOFC 3RRBA 1D4AA 1BROA 1QQ6A 1FJHA 3K4JA 5LMCA 3SYMA 4J1SA 4C0BA 3N28A 5J1YA 5MGNA 5FT9A 3ME5A 4P2GA 3A1SA 5CP8A 4KN8A 4IDDA 4URZR 5IUJC 1KQFA 1ETKA 2IE8A 5H1YA 4HMOA 1TK3A 2Y6UA 1V37A 3FPGA 3A6KA 1RZ3A 1YHZA 3T61A 2XB0X 1XMQB 2A07F 3N8KA 3E5RA 4Q9NA 3TRDA 2BMWA 1KE1A 4ZT6A 3DOJA 3I34X 1KI4A 1CUGA 2LKDA 1K8XB 3D4BA 1OXVA 1MV5A 1Z75A 3FPCA 5DCYA 5J40A 1UDRA 4RH3A 1DBQA 2HBYA 1OYWA 2EZIA 3LSMA 1H65A 3CJRB 1JHHA 3GFGA 4IZHA 4UHHA 1KEEA 1MOSA 3E15A 2WU4A 3ZNNA 3TQNA 1NP6A 4TV8F 4GPZA 2UYCA 2AFIE 4RCYA 4C5AA 5DNCA 4B48A 1U9JA 5CQGA 1B0PA 2W2KA 1TTHA 2DULA 3UXEA 3LWNA 3KR2A 2AJTA 1FX7A 4JYZA 4RE6A 3NTXA 4DWJA 3UCXA 1E61A 4KICA 1ECFA 3E9CA 1DKMA 5LOVA 3LC1O 3OOPA 1S0UA 3HYSA 1P4SA 2RHDA 2Q0QA 2CW7A 3AJAA 4V0NA 1SY7A 1PEAA 4RVCA 3IX7A 4E4YA 3JRWA 4US0R 3BWVA 1SC9A 3HCCA 4L5AA 5EXXA 5EL0A 1XSVA 1E2FA 2XMQA 3N5KA 3W79A 2JLWA 3FB1A 4MUKA 2B4YA 3NUZA 1DDOA 2XUBA 3WICA 3WU2C 1HF0A 4F4FA 4O2BF 3NCHA 4NEQA 1P92A 2SHKA 3VFZA 1Q2UA 4DIKA 4G81A 3IT3A 3SVLA 2WAFA 4RO0A 5JD6A 3ASYA 4XPIA 1H5NA 4D9JA 1T9AA 3L7CA 1VLLA 3W2AA 3BROA 1XDWA 1GV0A 2BE5F 2HTFA 4GPD1 4X3CA 2XTZA 3QEOA 1UPXA 2XUKA 2FPWA 1A9XA 4ARZB 2M9MA 3V1KA 3B6KA 4G5XA 2QQGA 3DL0A 2MTBA 4UBLA 5BN3A 1CF7B 3H86A 4ARIA 1YTLA 3STYA 2WUEA 4GOJA 1PFUA 3K9QO 4G84A 4KU4A 4BNMA 2C92A 2DMTA 3HB5X 3BGOS 5TGTA 4OAQA 2VKTA 1OASA 4UEKA 4M99A 4P08A 3DMNA 2CJJA 4FB5A 1U8CB 2FSPA 4PONA 1V2GA 3GA5A 1SCUB 5J2UB 3V6MA 2R7DA 2CKDA 2PKYX 2HMSA 4I55F 2ZRJA 3W3CA 1W6RA 4OHRA 3G7SA 4NBTA 1XZKA 4XXHA 1H2BA 5LZ4A 1LFUP 3HACA 1BX1A 5HF8A 3ZV7A 2UYYA 1MV8A 2CLSA 1YQWA 4LV8B 1EHYA 5LZ2A 3F8CA 2DY1A 2VDPB 2ZLBA 3D02A 2CQ7A 4AIDA 4C0LA 3IELA 3DAYA 1X0XA 3K0HA 1NXPA 1VLHA 2YJTD 3EIFA 3X0DA 3IIMA 2QW0X 1GPH1 4UUAA 1JALA 4LC0A 5ERIA 1VIAA 1FRQA 1X8XA 3W5UA 1GV1A 3RM3A 5A0TA 4U2CA 2AH5A 2C99A 1GDHA 1A2BA 3UMCA 2L3DA 4XLNF 1D09A 2C5SA 3ZQLA 3IT1A 1MW7A 3TDKA 1SWVA 4QXMA 4U2FA 5ETJA 2XQJA 4BVFA 1U0LA 4KVAA 3F3XA 1GRQA 1X1SA 3ADBA 1NG6A 1GUBA 1RYBA 5AK0A 4TPKA 1QZYA 3HCAA 4CCOA 1NBOA 2J9ZB 1KO1A 4MPJA 1QB8A 2B1RA 3JQ6A 3BY6A 4W7IA 2V9ZA 1XMXA 1ON1A 4HH0A 2KW5A 3WLPA 2PMUA 3GMEA 1JH9A 2H0QA 4YJ2A 1TMKA 3KQNA 4JN6B 1ODTC 2VC2B 1SCUA 3R76A 2AC2A 3BWGA 1EXDA 5EUMA 4ZICA 3FPAA 3JR9A 1KIAA 2E7ZA 1MZPA 5FOWA 1ZLYA 2DOEA 3GTLJ 3S4YA 4JJAA 2G4CA 3RYHA 1R6DA 5K3BA 1QANA 4D5CA 1F2TB 3LA2A 3D1VA 2DF8A 1VMAA 1CRWG 2OXIA 4M36A 3E7LA 3AL0B 4UU7A 3K2EA 2QMZA 4GE3A 2E4VA 1FY7A 3IE1A 4OQYA 1LPAB 3ZE8A 3MMSA 1GEGA 4HLQB 5MN4A 1LFPA 1Y8CA 4F38A 1OF1A 4CBVA 5C53B 3BDIA 5IJ0A 1E1QA 1UIRA 1V25A 2PX3A 3KQLA 1SVSA 4LYAA 4L6CA 3K0BA 2YJ3A 1FEZA 1IG3A 5CB4B 2Q1ZB 3WIBA 2XUIA 4EK9A 5UKDA 2P6PA 3L2RA 2AX3A 8ATCA 2GEBA 4DKXA 3LFHA 4BN5A 2OCPA 2R9VA 1VSUA 1ZG5A 2R4GA 4M9XA 1UPTA 1ZMOA 2W00A 1EPUA 1Z16A 1WKBA 2A6EF 3EC1A 2JAXA 1IB6A 5AM0A 3DBHB 1DT3A 4A8TA 1CJVC 4NMMA 5KVVA 5CFOA 3PEWA 2NVYJ 3O5AA 3OFSA 5LDDC 1W4RA 4MV4A 2HPZA 4PCUA 1QLJA 1J75A 1MJGA 1PJ4A 4GGOA 2Z57A 1S2DA 2C31A 2WP8J 4G1VA 2D1VA 5JWRA 2LLKA 4ZYHA 4PGAA 5JMTA 1E32A 1K2WA 2XWPA 3CDLA 1UXKA 1FMVA 1SR8A 2GNPA 3PC4A 3EIEA 3Q8MA 1FP4A 5LA6B 1U9NA 4EPTA 1UP4A 2ZVQX 3NTRA 3OQPA 4CTMA 2CT8A 4F55A 1GNPA 4YP6A 4LG1A 4CLRB 4YX9A 3ZWCA 2VHXA 3GRPA 4Y9SA 4Z4FA 3WB2A 2LGJA 4L4XA 2YNMC 2JVKA 2D0IA 1ONNA 1ISRA 1RWNA 4LRSB 3I6MA 2ZR0A 5T4HA 5CB4A 4XKBA 4ID9A 5HCUA 3QWAA 4G0WA 4D4JA 1UBUS 1C0KA 1S3SA 1Q17A 5DBHX 2CU7A 3FISA 2W6JD 1HSTA 3FZVA 4CV3A 2PBIA 1GDTA 4XGNA 5TJ9A 2VL7A 4PPGA 3GGSA 2W2XA 2QIPA 2N1BA 3GVCA 4JLWA 4NFHA 1IN8A 5E6SB 4DG5A 1F7VA 1R66A 3QX8A 2O59A 1PHRA 3FFAA 3ZY5A 4P38A 4LJSA 1FU4A 3KQVA 1NMSA 2BBTA 4TUYF 2WSBA 4HGNA 1E0KA 2WVHA 4YFNF 4BAUA 2E5NA 2CF5A 4XFKA 1V8FA 2IUYA 5ECYA 5BQOA 3MS2A 4KAXA 3V00A 4K2HA 4BN0A 1SKUA 2D3TA 3RYCB 3GZJA 3UMVA 3E1SA 5KSWB 4DADA 2VBXA 3OIPA 1CRZA 1D3AA 3LQFA 2YY6A 4IMPA 1MAVA 2LK2A 1WUJS 1BXGA 3PNVA 1YO6A 4PLHA 1SHTX 1P4GA 3BRWD 2BAGA 4EKYA 3QA3E 5K5EA 3GBVA 4PC2A 4Z99A 3ZPXA 1RMYA 3ETCA 2MH2A 3EJWA 4XX0B 4A1FA 4MMZB 4XWGA 4IEFB 2GPNA 4HXGA 2JFWA 2IIBA 2HYGD 3E2PA 3NALA 2ZUCA 3OY7A 2EFWA 3TQRA 4B3IA 1VKZA 3EYIA 1TTTA 3CCYA 1ZKGA 1FTTA 9ATCA 2ZRLA 4MYUA 1XD9A 3VNBA 3HRIA 1NVMB 4UVIA 1EK6A 1MJGM 1VP3A 3N2LA 1HQCA 3OU2A 4CI0B 1ZH2A 5JASA 1GTRA 4BLTA 2B0CA 1QO9A 1OYVA 1V95A 3TRFA 4P8RA 4ZTFA 4FOLA 1PE0A 3T7AA 2VXOA 4UNQA 1UWKA 2ZYDA 1TCCA 2D7DA 1VE1A 4UAJA 5LYJF 5I7UA 1XJQA 1FUYB 3FHLA 3R4KA 4MULA 4XWAA 3QUSA 5L3DA 1GUFA 4QPZA 1KERA 2AEEA 5DM6F 1GZSA 1Z35A 1C81A 4IF6A 3RYCA 3EF3A 3QKRA 3I92A 2X5XA 3BYZA 2IHUA 1TA4A 4IDAA 3RLIA 5CIYA 5J4HA 3GEPA 2V7EA 4MJ7A 1MGPA 5GGYA 1RVDA 4LFAB 1I7NA 2G9ZA 5CKTA 1RE1A 1MKYA 4CKEB 4S24A 2M1XA 1LVGA 1X14A 2EH3A 3QU7A 3D8TA 4B33A 4OHUA 3RPEA 3IALA 1N2IA 1E7RA 2WW8A 1RWVA 2ZJYA 3KELA 4YAFA 2XA1A 4WZAA 1Z33A 2GHRA 4PRKA 4MEAA 1XRPA 3QX3A 1CZKA 3FG9A 2PAFA 1F2DA 3IQHX 2QVGA 2R4QA 3HGTA 5C44J 1VYUA 3ZK7A 4ENRA 4AP6A 3WSWA 4PIMA 2JRLA 1XELA 2YWFA 2HSDA 4EH1A 2BN4A 2V6EA 3N86A 1FQJA 3KD3A 4AO7A 1E8MA 3IP6A 3EZ7A 1MPTA 4E2XA 1B4DA 4RZHA 2RCNA 3JALA 1JT2A 2R6DA 5HTOA 3CX8A 1MO2A 3KZZA 1VFCA 3C5VA 4UEOA 3RO7A 3RBAA 2PUWA 2YRWA 2QRNA 4G67A 4A0XA 1ZU5A 2AFIB 1XF9A 1SD7A 2YYYA 4LHEA 2E3JA 1R9MA 3SQNA 1WBDA 1ZI6A 1FFWA 3FDYA 5KNBH 2GBCA 1WJAA 3TJMA 1FFEA 1I14A 3LFKA 3H9QA 3SNHA 1PR0A 3DXXA 5JYDA 3NIGB 1J00A 3CWCA 2GEFA 1T5SA 2R7UA 4OI1A 1WG8A 1HDOA 4HDCA 3X1DA 5HPYB 3GGOA 4RENA 3TW8A 3J7AC 4J1NA 4MITA 2OMKA 4MVJE 4KRYA 5BUZA 1OE0A 4AJKA 4OUDB 5JSZB 3K09A 3CNOA 4QVGA 2JATA 5G40A 5TQ0B 2LR8A 3OEED 4B6JA 5K8CA 2OBYA 2MABA 4X8HA 2YMMA 1KU2A 4Q4AB 5B53A 3BDDA 2ORWA 3UTCA 3H0GJ 1T0UA 3OCWA 3TFQA 1KY2A 3G13A 3N2KA 2VXDA 1FMTA 3LTEA 1RLJA 2WVAA 4IW3B 5ADUS 5DCWA 3N6VA 2V0NA 1UZCA 4R8LA 1SG6A 3B3JA 5JY6A 4PE5B 1YR6A 4HQOA 3TFOA 4YEDA 4UBIA 1EWVA 4BLWA 3TLMA 2XB2A 1U9YA 5KNDH 4HNTA 1E3PA 5IT9Z 2J5RA 2A67A 5FKMA 3EGOA 5AJVB 4Q9HA 2I67A 2AXPA 3QLJA 2C07A 1AOXA 4NICA 5D4RA 3IH5A 2HB6A 3LKDA 3U9SA 1GN8A 3EIOA 2AHRA 4HFJA 3AR7A 1T3ZA 1J2YA 1S8FA 1F9EA 1XIVA 3JTGA 1GGNA 1JIQA 2X7JA 4KLNA 2CW5A 2I6SA 2AD5A 3GA7A 1MH1A 3WL3A 2X0EA 5JD3A 4YUYA 5HRUA 1OKRA 4CU5A 4QJ5A 5CVJA 3PNPA 4ZYLA 4U1RA 3C3AA 5TQ0A 3O4FA 2W37A 5HJ2A 3UOAB 4RPKA 5ELLA 4RLQA 2XODA 2AK3A 1RJWA 3RABA 4A0GA 3IJRA 1JLRA 2R44A 5M2QA 1XAIA 1T5LA 2EFPA 3ESWB 1R0LA 1SH7A 3GN1A 3BE6A 4C6RA 3YASA 5IARA 2JVGA 4M9ZA 3QPBA 3CO5A 4AYXA 3UWPA 3OQJA 2VHCA 1TXGA 2CHGA 3RTCA 5EEGA 1K4TA 4FASD 3I5UA 1B0ZA 1KGDA 4PZLA 2Q1SA 4F85A 4OLBA 1H1TA 3GLGA 1J0BA 1EJ2A 1I5EA 1AGRA 4C22A 1U7WA 1U0EA 5C1BA 2CV0A 4EJ2A 3LUJA 3WLLA 2QD4A 4YPVA 5F77A 3EDCA 3E5NA 2XSDC 3DDOA 1VG9B 2H2WA 2WHPB 1ZS9A 1ZFNA 1WGXA 5BPFA 2IY7A 5AR1A 5K0CA 2IK8A 3KB2A 4RKQA 2CJWB 4JX5A 2YOGA 3QU5A 1QHHD 3A32A 2B8EA 2X1DA 1UBEA 2QYOA 4AI6A 3E05A 4H16A 3LSJA 4B3BA 1J2XA 4LE1A 1MJAA 3ASNH 1UPUA 4PXYA 3HU1A 3T4UA 1X1RA 5MDHA 4FQ7A 5DIZA 4OU4A 2VYFA 2GAAA 5LZ9A 4B5KA 2R11A 2IIQA 1QKKA 1TTYA 4CICA 1R18A 3G5LA 1A8QA 1NZFA 3GP8A 3E3NA 1ZN2A 2FK7A 3P9IA 2EDAA 2RC6A 2BI4A 4TRMA 3GPBA 3ROPA 1CR2A 5TVGA 1E7MA 1QVAA 4X7BA 5KWIA 1FRNA 3MKYB 3D7LA 5CBPB 4YRZA 3AF5A 1KBOA 3TBKA 4GPIB 3FLBA 2W24A 3TCXB 4POAA 1X7HA 2H0RA 2NYUA 1Z0ZA 1CIJA 1JNYA 2J6IA 2V7WA 1YV9A 2WYHA 2PJPA 3CH7A 1YQAA 3TOXA 2BJWA 1L8XA 2VAVA 1CNEA 1FFBA 1M6HA 3LAJA 4ESJA 3L93A 4E2ZA 3UJ8A 2W4MA 1XC7A 4H4EA 2CSUA 3OM9A 1HQDA 4XOTA 4JLPA 3SLRA 1MJBA 4MKZA 1BE0A 2PLWA 3W5IA 4PNZA 1XTTA 4WLVA 2X8LA 3A6PC 3OZXA 2WAXA 1SBTA 3VBCA 4JI2B 5TQVA 4GKVA 2WWGA 3B82A 2YDYA 1DXHA 3JD2A 4TSFD 4E32A 3MT0A 3E7WA 1A7UA 4YCMA 2P4WA 1VQ9I 3OU7A 4E07A 4YPFA 2XAAA 4IYRA 4KG7A 5K01A 4KCGA 1QRUA 4GMFA 4C3HJ 4PAOA 4EY7A 1YS1X 4EFMA 2WLTA 3WY9A 2FUG6 2DEUA 2OCXA 3IAFA 2CDRA 3A1WA 1Q50A 2OORA 2O5CA 5C4MA 2H2FA 2ABWA 4RL4A 1Y5RA 5F23A 3WL4A 4RGSA 2DOFA 4BAGA 3NASA 3MD2A 1JJBA 2Q5QA 4C0AC 5FTNA 3JWGA 5AKEA 3PHIA 3NAGA 4PM4A 4OQQA 5F1PA 4HRIA 3FYSA 3A1EA 4LXTA 4JT2A 4QNMA 1I1SA 2ZYRA 3E3VA 4J3FA 3PI6A 5TRTA 2HHAA 1QWOA 2F2EA 2MSDB 4RNCA 4GBJA 4LC1A 1B14A 3ANXA 3D5QA 3EEFA 2XV4S 2H1CA 2XA2A 1H2XA 3OM0A 1D2MA 1TLLA 1HOMA 1Q57A 3CMEI 4MVXA 4FZVA 4MCAA 4P4UA 2GR9A 1MQ8B 3JRDA 3G2OA 4HV5A 1OBHA 1JKQC 1EIWA 4ZZDA 3R8XA 2KMLA 1FOXA 1K8YB 3L1JA 3HV2A 1EDBA 3MWLA 4JBHA 2QIOA 3SEQA 1PZEA 5CNKA 2VPYA 1QQIA 3LIPA 3OPMA 2D8AA 4XDYA 4PUSA 5FHRA 5T3UA 4OQXA 4J16C 4ID3A 2PAAA 2J7PD 2P6UA 2DHCA 4KE6A 4DCNA 2AA3A 1G8YA 4C6SA 1OI2A 4WXEA 3LVQE 1G1AA 2DFLA 4WA7A 5KYKA 1OB5A 2CQXA 2C9ZA 4K8RB 3VTAA 3K9CA 2OESA 1ZQ1A 4Z9BA 4W8OA 4PLYA 4X1EA 4M9UA 5GAGJ 1O3YA 4KXUA 1ISIA 1SVKA 4K9MA 4RMNA 1D07A 3RT1A 1RJGA 1SD4A 2GPYA 3K73O 2MW8A 5EJEA 4UTVA 4A0FA 4MI6A 1XMVA 2OXCA 3FN4A 3BR1A 3MIZA 5B2FA 4D6PA 4MW6A 4YUZA 4CKBA 3TMAA 3SS9X 2IA5A 1OH8A 4KYIB 1RYFA 2W6NA 4GE0A 2L19A 1HY3A 1QVVA 4CMEC 4QPQA 1KU9A 1PU2A 5EMJA 3UJHA 1CX9B 3L4JA 1A6QA 4DSNA 5J63A 1TO1E 1QF7A 1A8UA 4AY2A 3K71B 1RKWA 1YKFA 1MG5A 1APLC 4QUAA 1U1DA 3A01B 3P9SA 5AONA 4IXAA 2QX9A 2IGKA 3WGQA 4X6YA 1K75A 1XKTA 3GMIA 4ER5A 2YIDA 2DFNA 5EP2A 4KOAA 1EMDA 1SEUA 1KSHA 2WB1A 3AINA 2VUTA 3AVWA 1E3LA 1E7QA 1U5TB 2VQ6A 5TARA 1UOQA 3FOWA 1A1VA 1M1NA 3TRJA 3F6RA 2XUJA 3Q72A 2Z3WA 2F55A 2JI4A 2W2MA 1JXMA 1NBMA 3N53A 3HKEB 4CLOB 3PJGA 2P8SA 1KKMA 5ES3A 2I8CA 3SZLA 3GZ6A 3CW2A 3L0IB 4AF7A 3VU0A 1EHIA 4LOLA 4FHFA 1VE3A 4UEQA 3A37A 3ESCA 2XNSA 1VL5A 1TDJA 3RSOA 2PGAA 3LHDA 4RVSA 1EF4A 3RS5A 2O6HA 4GYJA 1HBJA 3L7DA 4P86A 2R8PA 2HQAA 4FNAA 1AHIA 2I10A 2P8TA 4TS9A 2DO7A 4MWCA 4P35A 4FISA 2OHOA 3KQSA 3TNLA 3PUVA 5L4LA 1GNLA 1L9XA 5KI6A 2I3BA 3CW8X 2FBKA 4MWGA 3BWEA 2A9RA 5BSFA 2FPIA 3NBZC 2AZXA 4D5EA 5HVQC 3K0FB 4BLVA 2V59A 3TOVA 3AI7A 1P3DA 3PC8C 1U63A 5IWAB 1O7FA 2O0JA 2YV4A 3VSDA 1H6DA 3WTVC 2A1UB 5KNCD 4KMFA 1II9A 3GOHA 4F4JA 1KVTA 2TS1A 3I6YA 4YV2A 1J8DA 2WJGA 5HF9A 1A96A 4ANJA 3IIJA 3RH0A 1VBMA 1GRNA 1RIOH 1WMBA 4HWOA 4FFPA 1KJ9A 1UINA 1A27A 1F51E 1RSZA 3V4PB 3A9WA 1SQ6A 5FRNA 2JGDB 1Y3BE 2F8TA 3JQCA 2OAGA 5HODA 2H2DA 4CHGA 4FBMA 3COYA 5JS6A 4JI4B 4J4HA 3UWKA 4MVJD 1JG6A 4MB2A 5IZ4A 3U6BA 4YVFA 3BR6A 3GLXA 2WYUA 3PGA1 2O2EA 4K88A 1IRFA 2FW0A 3LDAA 2HZDA 1Q21A 3ANSA 5D5QA 4B3CA 2ID4A 4R71A 2GAIA 1K66A 3NWEA 4IV0A 2IOQA 2PMBA 4NE7A 3WRVA 2FWBA 3GVXA 1P6RA 4XD2A 1VF9A 3T3NA 5EYPB 3RBVA 2O8KA 4QEDA 2AN9A 1J21A 2Q2EB 4F4HA 1WQ1R 3U2RA 4FLFA 3K0FA 4OYLA 4WACA 5EZGA 5JD5A 4UV8A 1AMUA 3Q7SA 2I5PO 1MX1A 4HQKA 1N4DA 1ETVA 3ES9A 2HWXA 3AMVA 1XQXA 1B8IA 1VQLI 4IIJA 1M67A 4H7KA 3S1QJ 1SCIA 2RHWA 1QNTA 1R8SA 2P9CA 3CCLI 3WDKA 1XVLA 1F0KA 2D1QA 2CMFA 1XCPA 1QFYA 4TWAA 3U7HB 4OCZA 5IFKA 3D4LA 1ESCA 1MMNA 1CKEA 3NPAA 2QTCA 3MJEA 2ODTX 4FNMA 5FRMA 2JD2A 3G85A 4EABA 5DBGA 4I3HA 4ZREA 4G0VA 3M33A 3QJ5A 3CG4A 1XZBA 1BOBA 2QTGA 4GKBA 4TWZA 1VL0A 5HZKA 3NBAA 1EH6A 1JHVA 2WHYA 3GGPA 1XGOA 2R8YA 1YR1A 5E3IA 2A0XA 4HTFB 1L3IA 4DJAA 3BZWA 4AZVA 2L54A 4WI1A 3G2QA 1XL0A 1RBQA 4RPIA 1CUUA 1AXRA 2B1IA 3KYCA 4Q1DA 4AVPA 5ALFA 2CLIB 4XVRA 4RM2A 5CLQA 3WMWA 3HPQA 1DC4A 1W75A 3ZE9A 3QIVA 4QYXA 3IJEB 3JRXA 1WH5A 1KI3A 3T7CA 4GWLA 4MLDA 1NQWA 4F3NA 1W49A 2WAMA 3SHWA 3CF2A 3RS2A 4BJTA 4CGZA 2B0LA 2QTTA 3CUUA 1NH3A 4ERNA 4Z7JA 2VOJA 2OK8A 1VA4A 2Y3IA 4Y2QA 3BQYA 1Z38A 2CLLB 2QKLB 3C16C 2MMCA 1BN6A 5CNMA 3F21A 4GL2A 2HIAA 5JRDS 3WA7A 5AKYA 2WTUA 4L6AA 3WGUA 1QGPA 1XCLA 2NU8A 3PJDA 3LQYA 1TRHA 3U7IA 4QO7A 3D5TA 2WSIA 4D9NA 3KETA 3AUJB 2GYUA 3RIGA 3KWLA 1ABFA 3EBPA 4HL6A 4TYWA 1QGUB 5K6AA 1YFKA 1OU0A 2RD2A 1IW7F 2QPTA 2RGDA 5F1KA 5LZ7A 1C8BA 2WADA 2BPOA 5EPUA 4TWRA 2EIHA 1TZBA 4LHYA 2IEZA 5E0KB 4YRSA 1XUOA 4JVSB 2SBTA 4PPFA 4B82A 3TI7A 2XF8A 1OGJA 2OFPA 2HHJA 2FPXA 5TT0A 1I7LA 1TW3A 3RK1A 4N01A 1SIBE 2V8OA 4IUDS 4EVRA 5KINB 4OJKA 1UPAA 3QODA 2JLQA 4BAYA 2C6YA 4B9AA 1J09A 4CM9A 1O96A 2YCBA 4ZCIA 1P1RA 5ELXA 1KORA 1JR6A 5GTIC 1QRRA 2O2DA 1JHUA 2OECA 5JPCA 3K4QA 2JD0A 4RLFA 3RBXA 3OPXA 3EZXA 2DQLA 1CFZA 2I6GA 4OXYA 4L0DA 4EYEA 3L7YA 1XMPA 3AWIA 4C7OB 2W6IA 4JYKA 4GVLA 4U0JA 3GJQA 5DYTA 2GOMA 1RRPA 4Q9IA 3IXQA 3UAWA 3BTJA 3E3AA 2QL5A 1ZZGA 3QOXA 3O47A 2PYDA 2Y93A 5FL3A 1QGUA 4H7DA 1ULSA 2E60A 2EBFX 1BI1A 2X4DA 3RTRA 1PCXA 5IZCC 4X1KB 4XJVA 2JFYA 3AHJA 3D6JA 3OHSX 2VZ9A 2VJ4A 3ZDFA 4A8JA 3LUDA 2ZRBA 2Z08A 4YMTA 2EFYA 5CA1F 5FDFA 2L2QA 1RIFA 3ZR8X 2C5GA 2HMUA 3MB5A 4YMIA 5CYGA 1ZXXA 2C8KA 3NKFA 3VSBA 5FWYA 1FFCA 4C2BA 1CY2A 5HS8A 5CURA 2NO1A 2UYOA 1XPXA 2GM5A 4Q7JB 1M5TA 4A6PA 2R7OA 1T25A 3LY8A 1TPYA 5CX4A 1WHSB 3B89A 2ZE7A 5FAXA 1VHQA 2IPLA 1A36A 1JKPC 3V2HA 4YJFB 2PXXA 2K3FA 4BE9A 4H17A 4LECA 2FFAA 2Y1FA 5GZ1A 2JLBA 1HNWB 1W581 2AYYA 1POXA 3QE2A 3NARA 2NOGA 3WK4A 3QTTA 3TLXA 2EZ4A 4RK4A 3NKLA 3FY4A 4CF6A 2CXOA 4YP0A 2ECFA 4EW6A 1FWZA 1XTUA 3KP3A 1SRRA 3PD1A 1ORRA 1VJCA 4KEAA 1TUGA 2N9UA 3ZHUA 5ABPA 1KP9A 3UGJA 4N3BA 4O2LA 2XROA 3HBAA 2ZR7A 1Y4UA 5DSTA 3D3QA 1FSHA 4QUKA 1EXMA 3OKCA 1U7TA 4NCIA 3QF4A 3IAUA 4C3VA 4Z9YA 1O94D 5EKUA 3RVJA 1D0YA 5EEHA 3QU3A 4V03A 3VI3B 1CUWA 4HWPA 1MOPA 2C4UA 3DMDA 1CQIA 4NZOA 3KZYA 3DVLA 1XTRA 3GUVA 4E1BA 1GKYA 1NVKA 3L9FA 1AGYA 3KZNA 1M2JA 2CNOA 3B8HA 2H06A 2IIPA 2IYOA 4MWOA 4URWR 3TW7A 2Y1EA 5I9SA 1I27A 1NI5A 1Y8RA 4WBNA 3EXHA 4ZDOA 1W7PA 7MDHA 2HIMA 5BY2A 1ZM3A 3H1AA 3H0CA 3EMBA 4YK7A 3P2MA 1NXSA 1COWD 2JLCA 2O0YA 4HUQB 1JDBC 4HNHA 1P6XA 1R0CA 4WUVA 1ORVA 1NJGA 3G89A 2PUJA 2GBIA 2OKCA 5AICA 4PO1A 3CLUC 3S68A 4P7GA 5J9FA 4RSMA 4PW0A 4JNKA 4N5IX 1Z21A 2H1RA 3AY6A 2GXUA 1AKYA 2J5PA 4RKWA 4RMIA 1JGSA 1AS2A 3K94A 1OSNA 3CO0S 1WP4A 4AMGA 2VQLA 4CW7A 3DOIA 4HQNA 4QWQA 3L04A 1Y3FE 2AXEA 3ZZ1A 5FUQA 2OV4A 2PUFA 2G5TA 5ENDA 5IP9J 3UH1A 1AK9A 1FOWA 4WN9B 4KAFA 2Z8YM 5I9NA 1JI0A 3GY0A 2IEIA 5FLEX 2O57A 1QHYA 1NU8A 3MPUA 1DDNA 4E4RA 2VCEA 2EX4A 2OPHA 1AMOA 4HQEA 3ADOA 5CPFA 1YR3A 3FNEA 2NZWA 1F0PA 2IBTA 2XUZA 5ALGA 2BHSA 3TIIA 3GXBA 13PKA 4F7WA 4Y30A 3N0XA 1NG9A 4HN9A 4I1SA 5ADWA 5JARA 3ZWYA 1K8RA 1N1EA 3PYMA 1VDMA 1MA3A 4A0HA 1XGMA 1K06A 2VWGA 4R2IA 2B1QA 1G6Q1 1PX2A 4DQLA 3NOVA 2Q3FA 4LZZA 4R6XA 4BE0A 4EYKA 2HYIC 4LTNA 3GCMA 4CRWB 4O8ZA 1UBCA 2PBRA 3WLOA 2HK6A 4KWHA 5HIMA 4LYGA 2OZ6A 4E5SA 1NOKA 2PZJA 2XZDA 1Y7IA 1XL1A 2ZRHA 1SXJD 1HKSA 1XP8A 1SU7A 1G8KA 1A82A 3IR7A 3TIVA 2QTNA 3ZHXA 1ZSVA 1BQEA 9ANTA 5SY4A 2G77B 3IUNA 4AO6A 3WKAA 3CQ9A 4IV8A 4KXQA 3QXJA 2HLHA 3BXOA 1I1OA 4DLPA 4PRZA 4Q00A 5KU7A 5BNZA 1SB8A 4NXNB 5CIQA 3PUXA 4BFLA 2WMDA 4U7JA 4KFTA 1O0BA 1XU4A 5G0VA 5A4DA 3KP6A 1SCKA 2IEAA 3ITKA 2DTZA 5EINA 4MR9A 2ECKA 1Y6RA 4L6IA 4DSZA 1HFKA 1XRRA 3CLKA 3CKMA 1NUPA 5ENZA 3VH4A 4CMJA 3K1TA 3JSOA 3DAFA 4FLEA 7REQA 2MT9A 4R2KA 1FBQA 1TYBE 5TSDA 4Q4ZF 5LXTF 2P6NA 4EVSA 1P5RA 4GOOD 4V0OA 4DZTA 2BMDA 2XKOA 2NG1A 3MJCA 2ZYTX 4E7OA 2R2AA 4KO1S 3JRBA 4AIKA 5HKAA 1YBMA 1TWCJ 2Y4NA 3AW9A 5CDFE 2VSXA 1KTIA 1PUFA 4HAYA 2ZREA 2COKA 3V7FA 2BY0A 3HVIA 5CB0A 2DW4A 4RZ3A 1RJ9B 3NVDA 4IRGA 3PXCX 1HZJA 5EWMB 1GPJA 1COZA 2AT1A 3BJIC 2E1CA 4US2R 2ZGVA 4ZVOA 1KEKA 1H8HD 3RU3A 1NR7A 3BICA 3LI2A 1L8OA 1U8EA 2A0WA 3KQMA 5HKKA 2RGNA 1OISA 5JCZA 4ENJA 4BY1J 3FPHA 3TLJA 5EJCA 2EZ9A 3PDJA 4FKZA 3VZPA 3IPYA 2E5LB 4R2WA 3K9TA 1U0GA 3UQYS 5I7WA 4Z1OA 1F6WA 2OV3A 5EJ7A 1T36A 5T3YA 3OC6A 2RBKA 3TLYA 2WTEA 3VR5A 1MDMB 3VEPA 1XD2B 2B4AA 3SMQA 3JZMA 2AG1A 4V2GA 3RQ4A 2IYAA 3FDJA 2SNIE 3Q2KA 1TK2A 2P35A 3C3CA 3HZZA 2WWYA 5BRNA 2R7AA 2P7VB 2XASA 4C9YA 3RUDA 3QYBA 2FFJA 1VHDA 3N8DA 1CS4C 4Q3OA 3LKBA 3LX8A 4IEEA 1YC5A 2EF0A 3U56A 4LY0A 1L1QA 1WZEA 1W8DA 3BJ6A 2NNLD 1YONA 2ZJ1A 4QFBA 1I10A 1MLDA 3DBLB 1RAAA 3GC6A 2H08A 4X62B 2L4MA 1VYVA 4RGBA 2D2FA 3IKMB 3S8EA 1ZRHA 2JLSA 3WYNA 5FPTA 2AQIA 3EFHA 3T52A 3FXUA 4P4SB 3MTIA 4MRAA 2WJVA 4AUKA 1QU3A 1GFSA 4U8GA 4B84A 2DPYA 2OBLA 3CJRA 3VO9A 1RBYA 1QF9A 2W57A 4I1RA 5FV4A 4TKVB 1R6XA 4Z49A 1SVMA 4QBIA 1F8UA 3CGGA 3RAJA 3WL8A 3M9WA 3AGQA 1L0OC 3D1LA 3U13A 2YHUA 1N5IA 1OXKB 2WIJA 3G17A 3KJNA 4BKQA 1ECJA 4O5OA 1RZ4A 1E17A 1VG8A 2ZYHA 3URKA 4ISBA 4EUSA 3K1PA 5JAOA 3OICA 5EIHA 3FSRA 5DGTA 3KNZA 1R0YA 2FZCA 1U2RA 4J76A 4JELA 1YG2A 1W0JD 5B58C 4L7QA 4D9FA 3OP1A 1NV9A 3PDHA 3A9SA 2UYHA 4Q3DA 1T3HA 2QM7A 1UKYA 3IBGA 4TMKA 5BT9A 3N2IA 2OQRA 1YZYA 2YDXA 2GBLA 5LHIA 1Z22A 2V6JA 4OMCA 1HA3A 2HA3A 5B5SA 1Y9DA 4JI7B 2TYSB 1RHMA 4JJGA 3K35A 4M83A 1HZZA 3EMVA 3C8UA 4GICA 1ZW6A 5CEFA 5KYGA 1RU3A 2FU5C 2Q4OA 3WLTA 4TKVA 2JVHA 4NMHA 4LVCA 3GLLA 4ARZA 1RQRA 3T7IA 4NULA 1ORWA 3KWMA 3K0KA 3T3IA 4Y9TA 3RC7A 3PSAA 1XJ5A 3AKCA 4F3YA 1CF7A 2R4UA 3W8NA 1M34E 4K1LA 3O8LA 2BEWB 5LLSA 4JFRA 4MSUA 1DO8A 2FKAA 4ND7A 3WMGA 4LXXA 3AHFA 2LRDA 1IATA 4ZGWA 1YU9A 1GILA 3UK1A 1VQ8I 3HU2A 5J2UA 3IDFA 4Z6KA 3D6AA 2G0AA 1LJLA 4UXNA 1BWQA 1HV8A 2ZRGA 1CYDA 2XWJI 3BREA 4CL0A 1NKTA 1VPLA 4J1TA 4E0BA 3DM9B 2O50A 3A25A 1PWEA 4EY6A 4MUYA 1BFUA 4TKUB 2QWXA 2BBYA 4DGQA 1Z2AA 2WIBA 1NTCA 2X9VA 3K4BA 3T3GA 3GTJJ 4AKTA 4RD1A 3QFFA 3SF8B 4JBIA 2QI9C 4QGHA 2Z2XA