1XDUA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with sinefungin (sfg)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
molecule keywords Protein RdmB
total genus 101
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xduA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xduA03
2YXDA 2FF4A 5K5OA 3V97A 2PBIA 3RI4A 1MJBA 4ZZDA 4RTKA 2P1DA 3K0BA 3WSTA 4G7OF 5EQJB 2QBYA 2JHPA 4BXUA 2P35A 1YG2A 2A14A 5K0CA 3OFJA 4PYQA 3RTRA 3LHDA 2PWYA 3FUUA 1ZRFA 3C1DA 1H9GA 1OYWA 1SFEA 1UHWA 1XSVA 2ETHA 2NAZA 4QDJA 4F7ZA 4LK1F 3HM2A 5EMJA 2YXLA 4YMHA 2Z33A 1SVUA 1QPMA 2KJBA 5HS9A 2YX1A 4CKCA 2BR5A 3R0JA 2IDJA 3TFWA 2D2WA 4PONA 2DPMA 3DH0A 2C7OA 2IBTA 1BKYA 1BHJA 4Y13A 5FCDA 5LBQA 2GH1A 1IN8A 1XSXA 2P7CB 4EQQA 1B9NA 3KPVA 1TPYA 3UJAA 4EJTA 1P39A 3E05A 1P2FA 3FM5A 4OBXA 3K6RA 4XSZF 2P3OA 5G02A 1ONVA 2HWVA 2LDUA 5KK1A 1IXKA 2ESNA 5LQUA 1XB4A 4HF1A 1Z6RA 4ZH4F 2G1PA 3UJ9A 3D0SA 3T8TA 4IRHA 5EEHA 4YG2F 2AOUA 3O4FA 1U5TA 2HFHA 2JPBA 1EH6A 1LQ1A 4MGRA 2OU2A 4A0ZA 3DTNA 5CCXA 4KYWA 3HVJA 1JHFA 3IYLW 3HP7A 2XV4S 4QVKA 4FX4A 4M71A 4GOND 2AOVA 3ZMSA 3C3PA 1J5YA 5EIWA 3J80K 4RGXA 3RKYA 4X41A 3FYDA 5LQRA 3F8NA 4ENKA 5IH3A 2EG5A 2P5LC 3KPYA 2ZBPA 4EV0A 1XGMA 3KKZA 3RODA 4M9SA 1YLFA 1VIDA 1D2HA 1XCLA 1MHTA 3LCCA 3BWGA 2E7WA 4HAMA 1XGSA 2MH2A 2PJPA 3BOQA 4WF2A 3GRRA 3P9NA 4OIRF 1ZREA 4KIBA 4EJUA 3C0KA 2ERCA 1BIBA 2J5OA 5F64A 5E8RA 4C03A 4UVAA 2YR2A 2JHAA 3BGVA 3CVOA 3KP6A 5T67A 1DCTA 3ZQ7A 1R74A 1BOAA 2L01A 3TOSA 5EKUA 2DQLA 5DCMA 1S7AA 3HOSA 4KRGA 5FQOA 5FFXA 2F5EA 3HRMA 1SD6A 4G6QA 5BOXA 3ECHA 3JWHA 2V1XA 1RJFA 3BDDA 4Z2YA 2OD5A 4KIFA 5HIKA 1BIAA 4NB5A 2AN3A 3FPHA 1AQJA 1TNTA 3MGGA 1REPC 1IN7A 3DULA 3FM3A 3SQNA 2IFTA 3R61A 1RJDA 1HW5A 2FMLA 5AIQA 2V6CA 3MQ0A 3WTTC 3BWYA 4X1OA 4Q47A 4KUMA 2ISZA 3UZUA 1G3SA 2R3SA 2QVOA 3ORHA 1T39A 4PCLA 2PBFA 1XSDA 4WVLA 4ER6A 2PX4A 1B4AA 3P2IA 1S3JA 4EM2A 2HOEA 3BXOA 5GWXA 5EC8A 1D2GA 3ECOA 3WGGA 3H3UA 2OZ6A 1W4MA 1KIAA 4GGGA 5KVAA 3OU7A 2PGXA 2EV6A 4UVBA 2CWWA 2OBFA 4MNUA 2B78A 2CSOA 1WS6A 1YZHA 3A7EA 2P8TA 3E8SA 2W84A 1JXSA 3HVHA 1O9GA 3CJTA 1BC5A 4E32A 3CUQB 2VT3A 2VOOA 3DMHA 2L02A 1M0EA 4LLGF 2AOXA 3A7DA 3MCTA 1G6NA 3RPUA 3N97A 3PX2A 4RV9A 3G5LA 3THSA 3MAJA 4IHTA 1OPCA 2ZIGA 2XYVA 4WK8F 4FT4A 3X0DA 4IHSA 3T7RA 3I0TA 4HGYA 1EG2A 3UA3A 1ZAOA 4MTEA 4EM0B 1W5TA 2P8JA 3ZMZA 4BYYA 3PVCA 2BZGA 3KQYA 2PKWA 1RZ4A 4IV8A 5EZQA 2I6GA 2MLKA 4RTNA 4LB6B 1D3YA 3BKXA 2DFIA 1G3TA 4BAYA 5EG5A 4RTQA 5DCMB 2W57A 1ZKDA 1HQCA 3ZN0A 2PX2A 2RDPA 3TM4A 2ZULA 3FXRA 4M7RA 1BC8C 1K78A 3HSEA 4KT5C 3V7SA 4RB2C 3BPVA 4WXCA 1IF1A 2ZNYA 4XBFA 3F4KA 3BGIA 5FULA 1QNTA 1UWVA 3E6BA 1KPIA 2DPDA 4HLXA 5L3CA 3TDUC 4WX9A 3TRKA 3EGEA 3WTYC 3ZMDA 5ILSA 2DW4A 4LGWA 5EGSA 4R8HA 1JTFA 1SMYF 3B3JA 3UJCA 2Z5UA 3ME5A 3V4GA 3WTZA 4LMYA 5LLQA 4FX0A 2F8LA 5D6EA 3HOTA 1R23A 1AQIA 3FUWA 4FT2A 1JGSA 1YS7A 1FYLA 1W7PB 5D4SA 1CF7B 4P9UA 5CVUA 5E18F 2V1UA 1JG4A 5GP1A 3C7JA 1DUXC 4V0RA 1W5SA 4I01A 4AD9A 3PT9A 3UFBA 3F3XA 5HDGA 4YV2A 3OPNA 2EA4A 2AVNA 2CWEA 1L0OC 2MC3A 3TQNA 5DLYA 2HTSA 3SSOA 2STTA 3GX4X 2NS0A 1ZN2A 1Y8CA 2PVCA 2LNBA 2ONZA 3T0IA 1R6AA 1RI2A 3I5UA 4QTUB 1QYRA 2FXAA 5GOZA 2FOKA 5HDNA 4IXAA 4HW0A 3HSFA 1J75A 4XUEA 4LLNA 1PP8F 5EHIA 3K69A 5DPMA 4HBLA 3NWBA 4M73A 5H02A 2XGXA 3VEPA 1MKMA 1XVAA 5BW5A 3VC2A 3UJ8A 4AIHA 3KU1A 3OZSA 3M4XA 4YV1A 2UYHA 2EK5A 2BR4A 3LSTA 2Z6AA 1XMKA 2CYYA 3QU6A 3FRIA 1QAOA 1EAMA 5F2NA 2DK5A 3IWFA 2IGTA 4GBED 2ZFUA 3CUOA 2LD4A 4BLWA 5ICCA 5E1DA 4U0VA 3CJNA 5FTWA 1L3IA 2P3QA 3KP7A 1RNLA 5ICEA 2HR1A 2UWMA 2ZBQA 4R05A 3KPWA 1NV9A 2O07A 2BE5F 2EFJA 4LECA 4YUVA 3NVKI 2BV6A 1KGSA 1TW2A 4A12A 2XAHA 4C06A 3VODA 3M7GA 1BI1A 4QWQA 1R8YA 2Y1XA 3HCEA 3E6DA 3M6WA 5CD1A 4EQZA 1TNSA 1EV7A 3L2CA 1FBQA 3K1NA 1HKSA 3L7WA 4MEYF 3TO6A 3HCFA 1AV6A 1BBYA 5BMZA 2G72A 4O6JA 1XN7A 2YX4A 3OFKA 1B59A 2RC4A 2KW5A 2XVMA 1RI5A 4KVZA 5FUBA 4O5VA 1FY7A 2PX8A 2F5DA 1R7JA 5LGNA 3PFIA 2Y1WA 4FT8A 1DP7P 3BJAA 3OZRA 2FBKA 1H1DA 1F3LA 5FQNA 3LAPA 1FNNA 4HV5A 1U2WA 4EJVA 4GQBA 3O31A 2V9VA 5HLGA 3DXYA 3CO6C 3DPTA 3L09A 1NV8A 1I1NA 2ADMA 2UXXA 2AOTA 2AOTB 4LG0B 3F8CA 4EJWA 4OBWA 3BROA 5DYMA 1SFXA 2ZXJA 3I58A 2UZKA 1G6Q1 3P97A 1QANA 3I4PA 4OIOF 3EMDA 4RTJA 5TJJA 5L3GA 3R24A 1IW7F 4ENMA 2P41A 4OIQF 1Q0SA 2VDWA 1J7KA 3BZBA 1Z9CA 2PLYA 3HTSB 1XMAA 1GXQA 1OR7A 1G55A 2H6BA 3F8FA 3ERED 1O3TA 2JRTA 2K4MA 5JUWA 1EIZA 5DDGA 2ZFWA 1NE2A 1BI3A 5LQJA 1YO5C 3PB3A 3KCCA 4G6DA 4LG0A 3RYRA 5E8IA 4ENNA 1R8XA 3LKZA 1BI2A 1O7LA 2I9KA 1WQ2A 4RAZA 2UZ4A 4GOLD 4WXDA 3T1BA 2VBXA 5L3FA 3RKXA 4PYOA 1SD7A 1TQIA 3GFMA 4RVHA 1UHMA 1HW2A 2M45A 3EVDA 2FEZA 3FWEA 1UIRA 5IT9K 4ZYEA 2EB7A 2ADUA 3GIWA 5LHHA 2H1RA 4G9YA 3KZYA 4HX8A 5H6RA 1SD4A 1UFMA 2VOPA 1P1BA 1U78A 3B7PA 3KHKA 2MBFA 2QRVB 3V8VA 5B1SA 3MWMA 2ZTHA 1H9TA 4KN4X 2IW5A 2ISYA 3P2EA 1JSXA 4RTOA 5EZSA 1WY7A 4JXJA 2E1NA 4EGZA 3TKYA 3GFIA 2P6TA 2OQRA 1PP7U 2CGPA 3LAJA 1YIOA 4PYKA 2IT0A 1TBXA 2DK8A 2PY6A 1VBFA 5EVJA 3FPEA 2VDUE 4A5NA 3KLNA 1YQAA 2ZCJA 3F8BA 4CZZA 2ZZMA 4KFCA 1INLA 2G9WA 2VONA 3G8AA 2JZYA 2OZVA 2NNWB 1FP2A 5D5VB 1XCBA 5CVRA 3NTVA 3TO9A 2AVDA 1XCVA 4CO8A 1LEAA 1PJZA 1NHAA 1PRYA 2GXBA 1CF7A 4RYLA 5A2QZ 4G56A 4AZWA 1EJ6A 2ZLBA 3COAC 4WCGA 1XDZA 3M6VA 2PX5A 1HBXG 2F2EA 2CMGA 1Z1DA 4KNYA 2IA2A 3ML6A 4IVNA 1AF7A 3V7RA 1FT9A 1L3LA 2IJLA 2XIGA 3QP6A 1DUSA 1IXSB 2MLGA 2WV0A 1QGPA 3KQPA 5D1NA 5DWQA 2ZBKA 2DTRA 3E5QA 1O9HA 1ZG5A 2Y0MA 1YF3A 4N9IA 2GWRA 2YPRA 2V74B 1VP9A 2EX4A 4AZTA 3FPGA 3ISPA 3DP7A 3NJRA 5DM2A 3H3ZA 2IA0A 3BWCA 5LHGA 1I5ZA 5FADA 1XXLA 2G7UA 2H09A 2HWKA 4UXNA 2PT9A 3JWJA 5IT3A 2L4MA 3AY0A 4A0YA 4E2ZA 2Q8KA 2E5WA 1KA8A 1K79A 4Y2HA 1IXCA 3HA5A 4DQ0A 1TQMA 4RVGA 2HGCA 3TOBA 2XKOA 2DT5A 2Z6UA 2ONYA 5K5RA 2ZW9A 3SMQA 2DBBA 4CTJA 1X1DA 3RIEA 2PJDA 2J5PA 3TMAA 2CQKA 3GYHX 3FMQA 5EMLA 5T64A 1T0FA 3HCBA 4DMGA 2VP3A 2QRVA 2ZSUA 5BP7A 5C1IA 5DXAA 4CWAA 3TKAA 2VDVE 1YFJA 2O0YA 2ZMEA 5HOQA 3EETA 2MH9A 3SGLA 2A07F 5GINE 4AVPA 4RB0A 4M74A 5K0FA 3Q7EA 1A04A 3EMBA 4GOOD 2COMA 2OBPA 10MHA 4I98B 5H20A 1F38A 3BWMA 4HX7A 3FF5A 3B3FA 1XGNA 3WTXC 1XDSA 5K8VA 3M8EA 3E23A 1G3WA 1XCJA 3C18A 3LQQA 1R1TA 2WK1A 2CW0F 4FZVA 5HDKA 4OQEA 3L00A 5HVQC 4HTFB 2HYGD 6PAXA 5DRTA 4BHPA 2PT6A 4YFNF 2EJRA 1Z3CA 1K7AA 3A25A 4R6WA 4AWXB 3IWZA 3FTEA 1KYZA 1C0WA 2HDCA 3WODF 2KRFA 1JTEA 2A6EF 1FBSA 3W6KB 1I6XA 3I59A 3K1MA 4UUVA 3WG9A 3KP2A 1Q1HA 2YTZA 4BP1A 5HLHA 1JR4A 1L3BA 4LG1A 2ESRA 4B17A 4OA8A 3GNLA 2EFQA 3N4MA 3G8BA 4OX9Y 3HSRA 3ID6C 2XYQA 2OKCA 2DO7A 2F5FA 5LQAA 5DRYA 2D45A 1MDMB 3IKVA 2IBSA 5E2BA 5K09A 1LVAA 5E20A 1F4KA 2N47A 3DR5A 3KP4A 4HSGA 2DPUA 2C6YA 5D8LB 3HUGA 1ON1A 4M9XA 4PYNA 3GWZA 4OU0A 3KPUA 2BEOA 5CYVA 4XRFA 2VS1A 3J80Z 2CO5A 3GW2A 4S05A 3DMFA 3SHFA 1R18A 3I9FA 3Q5FA 3EGVA 5ILUA 3KQOA 3MEXA 4UV9A 3FZVA 2E1CA 3GLXA 4BQAA 3K2ZA 5L3DA 1IN4A 2GXGA 3TQSA 1S6LA 3TGNA 2JHCA 3IV6A 4YUZA 2HTEA 4RTRA 5FWAA 1FC3A 1U6GA 3J81Z 2IP2A 2K86A 1HW1A 3M9AA 1X3UA 4XLNF 3KR9A 3FUTA 3RKWA 2CFXA 2GAFA 2YR0A 1IN6A 3SR4A 3F22A 5CVJA 1WSUA 3WGHA 2O61A 5E1XA 5MHTA 2PEXA 3UBTA 2W25A 4LWOA 3AJDA 2HR3A 4E2YA 1I9GA 4KDPA 2EV0A 1V3FA 2EWNA 3TR6A 1W7PA 3GZ5A 2XAQA 4GYGA 1J0RA 1KR5A 1NBHA 1HKQA 5CM2Z 1ZGAA 3GJYA 4MHGA 4OMYA 5JFRA 4RTSA 3DOUA 1D8JA 1P91A 4HRAA 2RQPA 2ZIFA 1LNWA 3UJDA 4KA4A 4L0ZB 4K2EA 1M6EX 3RYPA 4P5OA 2M5WA 2PQ8A 3TM5A 2QQBA 1F5TA 3JWGA 2O0LA 5E8JA 3G2PA 5BPIA 4IWNA 1YYVA 1JQDA 3GCZA 3ZPLA 2P3LA 4F85A 2M1BA 3V7CA 5CUQA 4G8XA 3KP5A 3CDHA 5DTMA 3IKTA 3ER8A 3HHHA 5AONA 4E31A 2JJQA 1K6OA 3FPFA 4BHCA 5CJ9A 1O57A 3MAGA 1WXXA 4UOEA 2IA1A 1LB2A 4L9JA 3VB2A 2C7QA 2DI3A 2DLLA 2BYVE 1JG2A 1EQAA 3EVCA 4YFXF 2GS9A 2RGVA 3PTAA 2UXNA 1UCRA 2AS0A 3LL7A 2G70A 2VE8A 2ZIEA 1NT2A 4XCXA 1Y0UA 4CGZA 1BM9A 3K9TA 3MCZA 4OOIA 3FUVA 3KE2A 3KP3A 3RIRA 2RN7A 1G60A 4PZJA 4ETSA 3IRQA 1XJ5A 3LPMA 1B1BA 2P6SA 3QPTA 3RPQA 3B89A 1DPRA 5FFZA 1T98A 2OXTA 1D2CA 2PXXA 1V39A 2B25A 4M6XA 5CVEA 1RUOA 4PINA 2VZ9A 3KEQA 3HEMA 1U5TC 2BBYA 4ESBA 2L4AA 3DPLC 3LKDA 2P5VA 2VE9A 1T38A 4Q48A 3DXZA 2O05A 2ZBRA 4QDKA 3CKKA 4PCQA 3FX3A 1HXDA 2XRNA 1NW7A 3KQVA 2YXEA 5BXYA 2K4BA 3T7TA 1SD5A 3SZTA 4POOA 4IV0A 4B8XA 3MZYA 4A5MA 4YUYA 2QQ9A 1IXRC 4PYLA 3U1DA 4CXMA 3E97A 3EDPA 3Q9SA 1JE8A 4PIPA 4I09A 5E1BA 3G2MA 5FA8A 1X1CA 1P1CA 2OAZA 2FA5A 3PX3A 3E6MA 1DDNA 3EVEA 5GM1A 4Q5SF 2NP7A 4Y30A 5GM2A 2UYQA 3IRRA 3WTUC 2AN4A 5K03A 1GXPA 3J81K 2Z3YA 4DZRA 2NP6A 1WKMA 1NW5A 4DCGA 2VBWA 1FYKA 4CICA 2HZTA 2WA2A 1R22A 3LDFA 1FJXA 1FWZA 3AXSA 5FLXZ 1RI3A 3T8RA 2JH8A 3U9GA 1W7PD 3WU1B 3P9IA 1XGOA 4MEXF 3VC1A 4OMZA 3RDIA 1SG9A 2PXCA 4L9NA 3QU3A 2HQNA 2P7IA 1N7JA 4PYJA 1MJ9A 4PYIA 2ACJA 5CVIA 5C9ZA 3OE4A 1BN5A 3FTDA 3G2QA 2ZCWA 2IPXA 3KQTA 5DM0A 1J9IA 2YQZA 2ESHA 3PQKA 3C6MA 3LECA 3M8FA 3HVKA 4PWYA 2RKHA 2Q41A 1KYWA 1IRFA 2Q0OA 3ZMTA 4ER7A 4C05A 4RB1A 2H94A 4E33A 1TTYA 2JT1A 3AWIA 2IPQX 1LJ9A 2KIMA 2OA4A 2ZNZA 4UV8A 3W6JB 3TPZA 4RTPA 3OOPA 4A6DA 1YZ3A 2FBHA 2YX7A 4ASNA 2NYXA 3ELDA 3EVFA 4I0BA 4U7BA 1SUSA 5LQCA 3HVIA 5DCFA 1KPHA 1PUEE 1YS6A 4I0AA 2QQAA 4A0XA 2V1DA 5F1RA 5DUIA 3SVZA 4ER0A 2WWYA 2PMUA 1BOOA 5DTRA 4AIKA 4XSXF 4C4AA 2FCAA 3P9CA 1P4AA 2NXJA 1WG8A 1P6RA 1IY9A 5E1MA 4CDGA 3AXTA 1BJAA 5E8GA 3CGGA 2O06A 3IHUA 1S7OA 3DQVC 3HRTA 4LK0F 1O3QA 3AAFA 4C07A 5AIPA 4EMSA 3HTUA 3OZTA 1FSHA 2CL5A 3JTGA 2QY6A 5HIMA 2LF8A 4YIIA 5KQRA 3JAMZ 2JH9A 4N9HA 3BUSA 2CMHA 3GFLA 2IIPA 4H0NA 4BHBA 1ODDA 4RGSA 2XUBA 2B9EA 4L9VA 1IRGA 1FBNA 2WC2A 3CJQA 4WWCA 1L3CA 4G94A 2AOUB 3GZ6A 1R36A 4MWZA 5TRDA 4BP3A 4GXOA 5LRSA 5HZMA 2NXCA 3F72A 3CC8A 4ER5A 3LCUA 3ZN1A 1G3YA 2KJCA 4HC4A 4I02A 3O3KA 3F21A 1YW9A 1R5GA 3LQRA 3LGAA 2M8EA 3R6TA 4CTKA 4AIJA 4R8RA 4Y17A 2XYRA 3HA7A 3MHTA 4RVDA 2A69F 3WE2A 4M36A 1ORIA 5CVDA 5DXJA 3ULQB 1JQ3A 5E9QA 2HMYB 1FZPB 4MHTA 4CHUA 3GEZA 1LDKB 3PFHA 5DT2A 4R6XA 2EJUA 3PFGA 1ZLJA 3CUQC 5KS2A 4I7HA 1J59A 3LA7A 4PDKA 4XUCA 2UYOA 1KP9A 1NBIA 2KIUA 5K0JA 1HSTA 4Q4ZF 2Q2EA 3WTVC 4ESJA 1ZYRF 4ZYDA 3QOWA 4HTFA 3C3YA 2VT2A 4EKGA 3UJBA 5E1WA 2OPBA 5K0EA 4HQMA 4RGRA 1WI9A 2Z99A 2OO3A 2RVCA 1SKMA 3TDZC 5CVVA 2HQRA 3E6CC 1KU9A 5LQNA 4YUWA 3G3ZA 2HEOA 2P7VB 1V4RA 4P55A 2A68F 1H0MA 4GUAA 1P4XA 2NNYA 1O3RA 2G8NA 2IDKA 2K4JA 1FYMA 3SXYA 3FHZA 2P7HA 2GIVA 2P4WA 3J7AO 4QQNA 3CUQA 1YUBA 1USSA 2WA1A 3A27A 5EHGA 5D5UB 1G8AA 3EGIA 4GEKA 4A2UA 1FLIA 2IRFG 1WZNA 2O03A 1TW3A 3TO7A 2Y48A 4FHTA 3BGDA 4PGHA 5BQTA 1D5VA 2QENA 2KKOA 5DSXA 2QZ8A 5D6FA 1SQGA 3ELWA 3B3GA 3THRA 2JG3A 3DFGA 2VN2A 3HHGA 2TDXA 2NYUA 2O6GE 3SXJA 4BY9E 3I64A 3EEYA 3M6UA 3KEOA 2IH5A 5IKMA 2O3FA 3EUHA 5ICFA 2YU3A 4NECA 5A2QK 2EA2A 1EH7A 3C3WA 1STZA 2JSCA 1JG1A 3CBGA 3DUWA 3G88A 2AZTA 4U0YA 1WRJA 2EV5A 1ORHA 5LQKA 1VE3A 2XAFA 5LGUA 1P4WA 1QAQA 3NQOA 2OB1A 2L3DA 3JTHA 3F6VA 4JK1X 3JAMK 5K05A 2ORED 4HH4A 1X1BA 5ED4A 1E2XA 2DU9A 2EJTA 1QAMA 3NW9A 4BNCA 2JPCA 1FOKA 3DV8A 4KMUX 5K0LA 5E1OA 3E3VA 1FSEA 3FPJA 4QTTB 1S8NA 3R3HA 5FHQA 5CIYA 3HRUA 2ZWAA 4FSXA 4IF4A 3G89A 4TV7A 3K1PA 1MZBA 1U8RA 1U5TB 4P9FA 5EEGA 4LLLA 4B09A 3SSMA 1KU2A 2XBMA 2FHPA 3V8JA 5K01A 3Q87B 1YW7A 3EPPA 5F2OA 2XAJA 1Q0TA 2HKOA 4IRGA 4HG2A 5CCBA 3EVAA 2KIFA 5M5BA 3Q9VA 5J8CA 4D0PA 3QOXA 4MTLA 4GCVA 3WTWC 1F1ZA 3JW4A 2V7EA 5EKXA 3REOA 3M1EA 3R4KA 4WXHA 1HMYA 1X1AA 2PN6A 4IPAA 4EVIA 1IN5A 2Z6QA 5HLIA 2NXEA 4DKJA 2GZWA 1P92A 3HYIA 1ZG3A 1ZH5A 4QLCU 1SMTA 4L0YB 5E2AA 5D8KB 2A3SA 2UYCA 5K0BA 4P7KA 4CYDA 4RTMA 1ZG1A 4U7TB 2ELHA 1SAXA 5LEJA 3NEUA 2OB2A 4GO1A 3IL2A 2AOWA 1R1VA 4P96A 1O7FA 3T5XA 2FRHA 3NMUF 2MD5A 5DTQA 2H27A 5H6QA 3KQWA 3BP8A 3QP5A 5HS7A 5ICGA 3V8KA 2PV0A 4MQ9F 3H92A 2W85A 3R0QA 1B9MA 5LR6A 2PXAA 4M37A 5FO5A 1XDUA 1ZQ9A 4YFKF 3DKWA 1JQEA 3BJ6A 3GVAA 1VPTA 5K0GA 4S04A 4PYMA 2AS5F 1AWCA 3I71A 4O3MA 3MERA 1K78B 1N7IA 4PCAA 2A5YB 3MTIA 4R79A 2ZVJA 5EOVA 2XAGA 1RIOH 7MHTA 3TLJA 5FB2A 3LA3A 3B73A 3DMGA 4AUKA 4JQFA 5T6BA 3BT7A 3HCDA 4DF3A 1XTPA 3SSNA 3O2PE 4I2OA 4P7JA 5GIOE 5DX0A 3KETA 1KQ9A 3WE3A 2QBYB 2B2CA 2JTVA 1B6AA 4EM1A 4BLVA 3KR2A 4NQWA 4HLYA 4AX8A 4LJZF 3QOPA 3GUDA 5ERIA 1DL5A 3KQSA 1RI7A 4HF0A 4KDCA 3JWIA 5F6FA 2C7PA 3ZMUA 3ABUA 4P58A 3S2WA 3TOAA 3KPJA 4KICA 9MHTA 3SZPA 3OU2A 5K0NA 1YTYA 1FX7A 3UA4A 3BJOA 4L9TA 3OCJA 3ZP5A 2P40A 4KW7A 1JSZA 5HEKA 3DEUA 3ELUA 4AZVA 3C6KA 2H00A 3KLOA 2K02A 2HS5A 4P7GA 5FWDA 3CLOA 3KQMA 1KU3A 5L3EA 5F2KA 5K1YA 5HIJA 2YSRA 2YVLA 1G4DA 5DX1A 1TLHB 5J6XA 3F6OA 1KHHA 3ABTA 3FXUA 2H6CA 1OR8A 3O6BB 3DLIA 3F8MA 3LDGA 3FMSA 4KN7X 2LF7A 3LCVB 2WTEA 3UWPA 4DCMA 2R6ZA 5U4XA 4E2XA 5D4RA 3KFWX 2ZMEB 3WTSC 4HQEA 4U88A 2QUFA 1VQ1A 2BH2A 2OY0A 4RWZA 2MA3A 2PMHA 3M70A 4C08A 5DD4A 1SUIA 1QQIA 1VP3A 4RB3C 1I27A 3NVMB 3A4TA 1QZYA 4U7PB 1CGPA 4HV6A 3EVGA 3EVBA 4R1HA 4RVFA 2H11A 5E9WA 1U2ZA 1OKRA 3HTXA 2NRAC 2HV9A 4ZYHA 1XD7A 1KQ0A 3SM3A 4HF2A 3IHTA 2HYFA 1IAWA 4IJAA 5JR3A 1VL5A 1GVJA 2EFPA 1SFUA 2W24A 4M72A 2LKPA 3LBFA 2HTJA 2XVCA 4H0EA 3P2KA 4A6EA 1F9NA 3L9FA 1BC7C 1RJEA 4RAYA 1YW8A 3I53A 3GO4A 4DNCA 2X4HA 3KQQA 1R1UA 2F5CA 3PQJA 4X61A 1I1GA 2HKXA 1IUYA 2BM9A 3WU0A 2P5KA 5E17F 3FMRA 2FMYA 2NNNA 5JVTA 4E2WA 2AXLA 4KMFA 4HOBA 1L9KA 2XVAA 3P71T 4HGZA 4ZTBA 4L7VA 2ZWVA 5FHRA 3DXXA 4YMGA 4QVGA 4EK9A 3GDHA 5FD5A 3R60A 2FYTA 3LBYA 5HIIA 3P9KA 1LDJA 2K7LA 5J8FA 2FNPA 2PWPA 3G7UA 4QPPA 2STWA 1S29A 1IM8A 4DM3A 5K5QA 3PS9A 3MQ2A 4G7ZF 4OQDA 1Z6TA 5EMKA 1UFKA 2DAOA 3G73A 4C04A 4OIPF 2VC0A 4O29A 5LHIA 2D1HA 1U3EM 1WWXA 3LWFA 5LRRA 4AZSA 1ZARA 3FUXA 2FNAA 4X60A 4K6MA 3P7NA 4F86A 4IRIA 4PNEA 2QM3A 2G7HA 2VBYA 1NKVA 4FGZA 2ZJ2A 1ZLKA 3H2BA 4UHTA 1KPGA 1KU7A 4LWPA 1HNNA 2RNJA 5EPEA 1FPQA 4HDUA 3KR0A 4N0BA 4GF5A 2PI0A 3HCCA 1LDDA 2FQ3A 2ZKZA 3HCAA 3EYYA 1SQFA 2PSSA 3A26A 4E70A 5BS6A 4CKEA 1MGTA 4UVCA 3GRUA 3EQLF 3D5LA 4MTDA 4CKBA 5HILA 4LD5A 3CCFA 3I59B 2FK7A 4HDVA 4M6YA 3LX6A 4OINF 4RGUA 3NDIA 3UJ7A 1X19A 2C7RA 4NHJA 5JHUA 3F23A 2A6HF 4U0WA 4M38A 2FK8A 2GA2A 3B5IA 2CG4A 2I7CA 4V0QA 3OU6A 1O3SA 1I4WA 2EFNA 3VYWA 2L54A 2I62A 1MJFA 4GC9A 2O57A 2B3TA 2D1VA 1USTA 2R7FA 4FS8A 5HS8A 2GA1A 3DXJF 4PGGA 3CJRA 5D1HA 1OYYA 3ELYA 1R00A 3DLCA 1QO0D 3MZHA 4MQ4A 5FGMA 1OYIA 2G71A 4L5IA 5CLSA 4YV0A 2ZO4A 4MQVA 3MFKA 3E5UA 2ZZKA 4Y15A 3JSPA 2GQQA 5P8WA 1WXWA 1OMIA 2PLWA 3EYIA 2FPOA 2IVMA 2NXNA 1N2XA 1NW8A 3WGIA 3VOEA 3MTEA 2K27A 2HNKA 5DX8A 1E17A 1YB2A 3E5XA 3M33A 4DA4A 1EJ0A 2QWWA 1FP1D 5DEQA 5FA5A 3VFZA 3R9XB 2CKDA 4KDRA 3LA2A 2GAUA 4UNOA 4KWCA 1EH8A 5DUKA 5C0OE 3ROUA 3JSOA 3OE5A 3I54A 2FSWA 3GU3A 5D5WB 5LGTA 1AOYA 4FP9A 3T7SA 2FBIA 4CXFA 1RI4A 4XUDA 3U2RA 3S68A 3BZ6A 1RJGA 3G2OA 3P8ZA 1R58A 4E30A 5GIPE 4ON0A 4DQ2A 3CTAA 3R6SA 3M6XA 4EKIA 2X0LA 1B42A 4R8SA 4OA5A 3EEOA 5KQSA 3L8DA 3RW9A 4MIKA 5HFJA 3E7PA 5ERGB 1ZRDA 5LSAA 1HKTA 3FZGA 3QAHA 2Y75A 2XASA 4ATNA 3CO7C 2LSOA 2AR0A 2VC1A 1T2KA 3LDUA 5EIFA 3UJ6A 3HNRA 5FD6A 1VLMA 3BKWA 2GPYA 4ZZLA 3U81A 4RS8A 4PIMA 3FXQA 2DQRA 4RX1A 3KZZA 5IT9Z 4FSDA 4QPNA 1G38A 2VODA 1IZ1A 1GHCA 1NW3A 2GLUA 4F84A 1LEBA 2GA9A 3MB5A 5LEKA 5L3BA 1UB9A 5DSTA 3FTFA 2XHKA 2OYRA 3ERCA 2FU4A 3V8LA 1T43A 2DULA 2FRXA 2M87A 4YIFA 3EVZA 3NRVA 1MJAA 2VBZA 3OV8A 2IH4A 1QBJA 2AN5A 4GC5A 5DD8A 4QQKA 3GRVA 1T6SA 3FTCA 2A61A 2B0LA 1QZZA 3HA3A 4ZYGA 1ZHFA 2E7XA 2EFOA 2QE6A 1Z05A 2XKPA 4GYIA 1YFLA 2R7DA 2Z9OA 1ULYA 5BW4A 1M6YA 3DF8A 2RV8A 3SX0A 3NWEA 2QYOA 4LFUA 3GXOA 1ZGJA 2YUIA 3GGDA 3QPHA 1YFHA 5BPDA 4IKPA 3QRFF 1G8SA 4BLUA 4HX4A 4L18B 3PLAE 2OZUA 1MD0A 2ZZNA 4ER3A 3GRZA 2QLZA 4JBAA 1J2XA 3VSEA 3G5TA 3SFZA 2BGCA 3NDJA 4M9ZA 3QV2A 3FRHA 4BH9A 4RSRA 4HYEA 2O8XA 3BPXA 5E9JA 1NW6A 1JHHA 1R5HA 5DM4A 4YUXA 2PG4A 3HIFA 1HSJA 2OQGA 3BY6A 4ENJA 3GF2A 1O54A 3O7WA 3R0AA 4X63A 5E1ZB 1PDNC 1DPUA 1D8KA 5DM1A 2BM8A 3B02A 5JI6A 3GFJA 4L5JA 5EMMA 4G7HF 1ZRCA 4XLPF 1TQPA 4LB5A 2FE3A 5KYGA 3ELKA 3ER9A 4U7DA 1RI1A 1BI0A 1MDMA 1RUNA 3HRSA 1Z7UA 3ANXA 4HA8A 3BWBA 5DV5A 4EGYA 5FLXK 1KXZA 4RTLA 2V79A 1I1SA 2BR3A 4FR0A 3T0YA 3LFKA 4HZFA 4GOMD 5HOOA 1JG3A 3D2LA 3ZMVA 3FYCA 5KVRA 3IEIA 5D5XB 5ILVA 1KQ8A 4ISCA 2EFWA 8MHTA 4EJOA 1Z91A 4KIGA 3IC7A 3GO5A 2PFBA 3GRYA 1L1EA 2GB4A 1ON2A 2IH2A 2XROA 3KR1A 4P7FA 3RJPA 2M30A 2VXZA 1VTNC 3K0LA 1FBUA 4ESFA
chains in the Genus database with same CATH superfamily
3JVDA 1DB3A 2YXDA 4KFRA 2CK3D 2QXUA 5JSQA 1M33A 1MJBA 1XHLA 2O1EA 4JEHA 2P1DA 3FCXA 2EKZA 2F64A 2WYVA 3WSTA 5M2QA 4MQBA 3MLBA 3QYBA 1AG9A 2YV3A 4ZYWA 5JAPA 2XNDA 1XPRA 2P35A 4WZAA 1XB2A 2ISSD 4MYHA 5DEOA 2ZB2A 2IXDA 2Z1MA 3OFJA 1OCCH 5CCEA 3OMWA 1YI0A 4KH1A 4LMPA 2ODPA 4O4LF 5B1BH 3WS7A 2QYTA 3VBCA 3QF7A 2Q1WA 3HL2A 5K4GA 3ZWKA 2H9AA 2P65A 4MA0A 4BUCA 1E2HA 1XFAA 3JQFC 2FMIA 4J0EA 1OZAA 4YHHB 4C4RA 3FUUA 1JHAA 1RETA 2WDPA 1ZRFA 5DGXA 3A4MA 1Q6ZA 2PZBA 4D9JA 3ESWB 3C16C 4NMXB 5JARA 1T3SA 4CHTA 3T1HB 4QDJA 4UZFA 3W5JA 2HAEA 4F7ZA 1U2SA 5AK4A 1FUKA 1NXPA 3HM2A 3LC0A 5AOCA 4HLNA 3JQRA 4HSEA 2E1MC 1DXQA 4JLPA 5A7GA 2Z33A 4FEEA 3FSEA 2BKUA 1SVUA 3I2JA 5CXXA 1QPMA 4AYBA 5HS9A 3USZA 4QUBA 4X62B 1QU3A 3WL3A 2VTBB 3O0TA 4EB6B 4G12A 1QE5A 2I29A 4ZQIA 2AZXA 3EISA 4S0ZA 3TFWA 2D2WA 2BSQA 3O8GA 3F5QA 2PL9A 4IBOA 1V5GA 2M2IA 5LA6B 4BMCA 3B2EA 2IBTA 1DC3A 3K9HA 4GP9A 4HYYA 2VL7A 3FVWA 1OBHA 2XA2A 5AXBA 5JZOA 2ECCA 1S72I 1JBQA 2XNDD 4CMHA 1Y4UA 4M8LA 4PHFA 1CFZA 1RDFA 3WQBA 3IV5A 2GCOA 2JFGA 2H29A 4KXMA 2P6UA 2C4KA 4W1RA 5BWOA 2Z3ZA 2HOQA 3IR5A 4NFLA 3KPVA 4U3JB 3UJAA 5AFSA 1P39A 2KE5A 3E05A 1P2FA 2VJKA 3E9YA 2LRDA 4MWOA 3K6RA 4OBXA 4DCPA 1COWA 1GRRA 2IELA 3CW8X 5G02A 3CY6A 2E85A 1ONVA 2LDUA 1TEHA 2P9BA 2XWBF 3A6GA 4P80A 1EU1A 4H1HA 1IXKA 3WGQA 4L73A 4ZEOA 4CT5A 1R27A 2QVBA 3IUMA 4IKFA 2WA0A 1Y3AA 4OQNA 2G1PA 1GL7A 1P2SA 4B33A 2Q3CA 4K6FA 3H11A 5C7OO 3T8TA 2VP6A 3VISA 3MKLA 2OV1A 3U16A 5EEHA 4YG2F 1AUQA 5DP2A 1JJIA 3O4FA 2O48X 2HFHA 2XV1A 4L51A 4MI6A 4Q3BA 5KSPA 4GKVA 1EHIA 5JMOA 1K7SN 4A0ZA 1E2FA 2Y0EA 4LJKA 1T91A 1F1JA 3JARA 4TTPA 3ZZUA 3HVJA 4XRRA 3WNZA 2OTJI 1XA4A 3Q0IA 4WUVA 2OKGA 2XV4S 2CQ7A 2MGQA 4B6QA 4LYFA 4Q9HA 3B1JA 2AOVA 3ZMSA 2RIRA 3FOAA 1J5YA 1KYYA 2OVBA 1QHHD 5EIWA 3UGKA 3CCCA 2ZS7A 2OXIA 3RARA 3QITA 1D7AA 1RABA 4UPVA 4J0FA 5FLXA 2XXBA 2M7BA 1J5PA 2AFHE 2EG5A 3QKUA 5IH3A 4DPMA 1Z0KA 1HORA 1Q7CA 3KM0A 4RKFA 2QSGX 2DTXA 4DMLA 1FUUA 4OLBA 4EV0A 3ASYA 1W2WB 2HO5A 2Z3WA 2BYTA 2C5EA 2JJ1D 2FE1A 3RODA 2D2IA 3ZGVA 1ZCFA 2FOWA 4B3RB 1T0FC 5L3QB 2Q5JA 2W2MA 4FCWA 1NVXQ 4X94A 1HZZC 4A3BJ 3LCCA 5CW1A 3OG9A 5IX8A 3ZHZA 4HAMA 2MH2A 2PJPA 3GRRA 3VVBA 3P9NA 2B9VA 4X6LA 1GFZA 4OIRF 2G5CA 2W93A 1R64A 4KIBA 4EJUA 1TU0A 1UT6A 2FDXA 4GOJA 4TLAA 1O7JA 2ZB8A 3IOEA 4WE3A 1G1MA 4MRRA 3UJ3X 4QKQA 4QASA 2YOHA 3ZIAA 1Z5PA 4QPJC 3GDOA 2NO4A 5F64A 3QX7A 2PSDA 4X44A 3AHHA 5SYNA 3RVSA 3WQRA 2PUVA 4UVAA 4C03A 1RRVA 2JHAA 2C92A 1S4MA 4UNQA 4D1QA 3OYJA 4CM4A 4PLYA 1CJVC 3KP6A 1DCTA 4G4GA 3V1KA 2O2JA 1ZD2P 4AJLA 4BKRA 1SOVA 5EMHA 4E1BA 2BVLA 1R0BA 4BO9A 1BOAA 2L01A 1JQKA 1KEWA 1VPEA 2EBWA 2YVAA 3M9XA 4FONA 5EKUA 4AYXA 2QAJA 4YCNA 3U1TA 4CIBA 1IULA 3J81k 5DZSA 4WD3A 5EIXA 5K8JB 3T1VA 2AJDA 3AI2A 3FGOA 3I37X 3PSAA 4BEVA 1K08A 3R3ZA 5K9ZA 5BYBA 1F0KA 1Y0NA 4K9DA 1L5FA 3HRMA 2VWGA 4XGRA 1JWBB 1G7CA 4IV5A 2F43A 3JRNA 5TJHA 2AJTA 3DZCA 3RF6A 1IHYA 2XZOA 3ECHA 3K9BA 4UJ3A 2VJJA 3HBJA 3ZX4A 1O0CA 4TMWA 5JQGF 1T1RA 4Z2YA 2OD5A 4KIFA 3W2AA 1ZQ1A 1VHWA 4TYPA 5HF5A 4TSFD 5LBUA 3N2YA 1CQJA 1H2WA 4CCLA 3FPHA 3CSUA 3KCQA 2P9JA 5E4TA 3ZWXA 4KAAA 5HIKA 4ETWA 5B2EA 2NLOA 4BRUA 3DULA 3A6ZA 4MWTA 2Z2ZA 2IFTA 4HS9A 3Q2IA 2GKGA 2FMLA 2V6CA 3BWYA 1NJ8A 4IZIA 1MH4A 4NZYA 5HUJA 2LRHA 4Y2TA 2QX9A 4KUMA 4XIYA 3HOXJ 1PR4A 3K0CC 3WMGA 1G3SA 2QVOA 3KOXA 1RKUA 1T39A 1E6LA 1SBTA 2UZAA 4FTHA 3ANSA 1YFKA 3CPEA 3CUWA 2PBFA 4XKJA 5B7GA 4WVLA 4OI4A 4EHAA 5JH7F 1BJZA 2COBA 1MH1A 1LPPA 3B36A 2DYRH 1SVLA 1T6BY 5KAMA 1MMGA 3EVNA 3R3UA 1WBJB 2QZ9A 3IVGA 2R86A 1WVGA 2Q1ZB 4HWOA 4RAGA 4R8KA 1A7JA 1VZ0A 2R0QC 4D9KA 2FR8A 2BJHA 2X4GA 3UOWA 4LEIA 5CGZA 3U21A 2VSNA 1W4MA 1GZ3A 2VSYA 3I9JA 1HG0A 1D8AA 2BKAA 3EQ8A 2YZMA 4G0OA 1UMCA 3LY5A 2R1ZA 3SXUB 1JQBA 2QAGB 5HRCA 5KVAA 2BMAA 2R00A 2G83A 1RWVA 4D9CA 3BBLA 4RLHA 4CEJA 1KKMA 1K98A 4XLHA 2QN1A 2EV6A 4UVBA 1DSSG 4ZEMA 1A4XA 1AX9A 2CWWA 4FMDB 4YTEA 1DRWA 2B78A 1WS6A 2J3LA 2PEZA 1YZHA 3H1FA 4YMUA 1ZNWA 2AFIA 3E8SA 3HS3A 1T2AA 1Y9ZA 1IY0A 2CN1A 3HVHA 2BGKA 4OMDA 5D3QA 2JFYA 5EWLB 2QTRA 5JDCC 3VZBA 4LKOA 1HDCA 4BVJA 1ZELA 4G0UA 3CUQB 2OZEA 4BNXA 1PYOA 1R0YA 2BEWA 2VT3A 3CVVA 3DMHA 1M0EA 3LFHA 1ZGHA 1Y6ZA 3A7DA 3FMOB 4FUTA 2LH9A 3NWOA 1AK2A 2PUTA 3GRCA 3N97A 4GSLA 4MMXB 3PX2A 4QU9A 3G5LA 3JRXA 4TS1A 4A23A 5DGDA 3R3SA 4DBQA 5JRDS 2YBEA 4JJAA 1B8IA 1HF3A 4DEYA 4EEKA 3FVVA 1P44A 1XN4A 4MV4A 4NMWA 4IHSA 2ODAA 2P4EA 3FHTA 1Z2OX 5G4KA 3H2GA 5E7QA 5KKNB 4UEKA 2VQHA 3VWBA 2AQHA 4PF1A 3LC1O 3ZMZA 4RM2A 2ALJA 3IIJA 4GRDA 3HUTA 3TLZA 2D1QA 1WMBA 1Y4AE 4WASA 5EZQA 4JUBA 2PNJA 2X9NA 5MN6A 1ZPDA 2ZUCA 2I6GA 3NKVA 1DZIA 4LTMA 4BEBA 3N53A 3O9ZA 3ZE6A 4GVLA 1BJRE 1BMTA 1P1HA 1Q77A 3LOPA 1KL7A 3AHJA 2PMZA 3TIVA 4MPJA 2XT0A 4UD2A 3A32A 4IDCA 4I99A 2QORA 2QDXA 4BWYA 4EPRA 3EMKA 4GX0A 1ZKDA 4J94A 4MRAA 4UXHA 5FLEX 2EFGA 1F0NA 1XP8A 1M0TA 3ABOB 3CO0S 4IDGA 1NJ5A 3IA2A 3T4EA 3LVBA 2GEKA 3ZR4B 2D2EA 4DLSA 3IMEA 2F4IA 1WVMA 1SPXA 1UBTS 4S2EA 4V38A 5DYYA 1W0TA 1RJ9B 4FHZA 4PYRA 4X8LA 5LQSA 4CR7A 1XAIA 4EO4A 3FXRA 3HSEA 1HEYA 2XMQA 4J76A 1ZI9A 3RRYA 5IM4F 4ABZA 2ZNYA 3TUZC 2GN9A 4OUKX 4XBFA 1F06A 4TKVA 3S16J 5A5FA 1MMNA 1NNEA 4HEJA 2IJGX 3BGIA 4RD3A 3GVHA 5FULA 4CRWB 3UVEA 3FFAA 2RH4A 1UWVA 3EBPA 4KMRA 5IF3A 5EL0A 3PYXA 3S70A 4B4WA 5KOHB 1KF0A 5L3CA 1ND6A 4LNAA 4QUDA 3R0ZA 1NYRA 4WX9A 4PPYA 4BE9A 3TRKA 4A6PA 2JFPA 1E2PA 2HGSA 2ID4A 1P1FA 2WIFA 2ZJOA 4MB0A 4GI1A 5CMLA 4ZT6A 1ESEA 2R66A 2VKTA 2DW4A 2ACEA 1NG9A 1XVVA 1QYCA 1LC0A 1MV5A 2A9QA 1I30A 3CCYA 1Y9AA 2QJOA 1IB0A 1XQ1A 2FFJA 2SKEA 2X1DA 3JQ8A 3K0EA 1T34A 4JIGA 5B58T 4O2RA 4ZVTA 4M6WB 4Q1VA 3WYDA 2BOLA 2PRKA 3VGJA 3OM8A 5JEEA 3I01M 4FNMA 2CNWD 1XLUA 2VHUA 4KX3A 3TEFA 1P4RA 4US0R 2J9RA 2QRQA 4KBYA 2VJAA 1Z7LA 1SOAA 5IUKC 5AOAA 1P5RA 1DAEA 1EXWA 3HSYA 4A9AA 5LWQA 3H8JA 2BGGA 1KFEB 1M6VB 1TZKA 2W11A 1G2HA 2I5PO 2C7GA 2JLRA 4UJ5A 3OYNA 2SBTA 3QM1A 1NSFA 3AR4A 1Y3IA 5SZJA 3O8HA 1UQTA 1QGOA 2V1UA 1SNYA 2PR7A 1DVRA 3OIYA 5J3JA 3DEJA 4EUEA 4F8EA 5GPAA 3HXLA 1W5SA 4I01A 4M3BA 4CNBA 4RH1A 3F3XA 5HDGA 1SCBA 3N2IA 5BURA 2EA4A 2FE4A 5L3ZA 4DV4B 2UUPA 1TQ6A 2MC3A 3TQNA 1SO8A 1GN8A 1VLQA 1KARA 2ZYDA 5ALHA 1T9CA 2STTA 5A2QA 3GX4X 3EDYA 1KYXA 2P2CA 2ZSHA 1H05A 2OLJA 3TN7A 2QJRA 3L7LA 3MD2A 4KIUA 4QTUB 4CE6A 3KJGA 1QYRA 2QTHA 5JTTA 4XD7D 3R74A 4IVQA 2ZJ0A 2IUTA 1I0IA 1POXA 4ENUA 2JVHA 3RPUD 5HX7A 4HW0A 3HSFA 1J75A 4OLFA 3M7IA 5DPMA 2VAWA 4IYRA 3KTAB 4BL5A 1L8OA 4RBNA 3NWBA 3EZFA 5IKEA 1OYOA 2LP0A 3CUYA 2H57A 4EGAA 3O4JA 5BNTA 3H5AA 1MAAA 3WYCA 4W9MC 1MKMA 1XVAA 2OCGA 5ICSA 1Y6JA 5ALMA 2V96A 3UJ8A 3PNLA 3VC2A 3OZ7A 4AIHA 3KU1A 4Q4AB 1NNI1 2GK6A 4FHGA 3P32A 4L72A 5LDHA 2UYYA 2EK5A 4YVFA 1HL3A 1FP4A 1BOBA 1LFAA 1O2DA 2PVPA 5FJJA 5KTTA 1EFHA 2CYYA 1JHMA 1ZH0A 4D9IA 4CEIB 3OZWA 1E6MA 2PUHA 3FRIA 4TQUS 5F2NA 1QOQB 1ZSVA 3K15A 3GX1A 4OTZA 4GBED 5IVDA 4XK4A 1DCFA 1RLTA 1L6RA 1X7XB 3U3XA 2X48A 1GPNA 1XDGA 2ZGVA 3KB6A 1GGMA 3PUIA 4FYHA 4Q3LA 2P3QA 3LQ4A 4G5QA 1A9OA 2GD2A 4YRFA 5DNAA 4ZV7A 3JAMA 5HA5A 2GXAA 1T9GR 1RNLA 1U3GA 2J9FB 2XTAA 4FKBA 3WOHA 1L8AA 5DWDA 1DPGA 4P5DA 4B7CA 5JUWA 4G8CA 3UUGA 1EUQA 1U8FO 3GTKJ 1YQWA 1NQ5A 4YUVA 5CDFE 4UMEA 1W87A 2KI5A 4RABA 1XELA 4A12A 5IBCA 1DADA 3FWNA 1V4NA 3R0VA 3E6DA 3INRA 2G9ZA 2IYTA 1YS2X 2IA5A 5HG0A 1OU4A 1TNSA 2C54A 3BG3A 3DC2A 2VF7A 1D4FA 2ILTA 3L0SA 1EV7A 1KBOA 3NHMA 1OE0A 1CZRA 2W2LA 4ARZA 3K1NA 9ANTA 2CKMA 2X3YA 3L7WA 2BZ0A 2MINB 2RI0A 1JXOA 2NXNB 1BBYA 2RIPA 3JD2A 4FHEA 3DCYA 4GHWA 4G0VA 4B4DA 2O8KA 4AJKA 4E4RA 4HGNA 3RSZA 4BNUA 4GBMA 5J3LA 2P0EA 5TQVA 4F1WA 2ZJRF 2OG2A 2JJMA 2VK4A 4QRDA 4EI8A 5KOJA 3MT9A 2RC4A 2HZBA 4V1CI 2CFRA 1RI5A 4IJWA 4EA6A 2QL5A 4KVZA 2IYYA 4R2JA 5IC4A 3NFRA 4HK4A 1Z22A 2X42A 2P75A 3PGLA 4JX4A 1U3VA 1KEZA 3V4RA 4BXOB 1U02A 2ZRJA 1YQXA 1X0VA 3A4IA 1E8MA 1WXFA 5JEDA 1Y63A 2Y1WA 4IIGA 3GBVA 4PBRA 4TMXA 3OZRA 4KVFA 4LXGA 2CBZA 3TKLA 4Y4RA 1B72B 1H1DA 1GJRA 1M8PA 1Q15A 2IUEA 3GTMJ 3Q7QA 5CIWA 4LC9A 5IDXA 4NU5A 1SUBA 5FUWA 5TV2A 4OQFA 4C0WA 1GILA 2AEEA 4IEIA 4GW3A 5HLGA 1ECBA 3H8SA 1KO1A 1NV8A 4BNNA 1VHLA 1S89A 3NT2A 2ADMA 4K46A 5F12A 2XE7A 4LE1A 4O4HA 4MYRA 3H8WA 2Z9DA 4LG0B 4UUPA 1KMQA 4YRQA 5M3BA 4YT5A 4BMYA 3WHKA 1F8GA 5HRAA 1W85A 4P5PA 1H4VB 2XECA 4KHPB 3EF1A 1NM5C 4IEFB 5FFMA 3ZWQA 1UP7A 3MOIA 3QLVC 3S5JA 5E3LA 4GPEA 4HPJB 4XLEA 2YJNA 4JKYA 4Q1BA 4RD0A 2PX6A 3FVQA 5EP4A 1G17A 5A3QA 5J2UA 2G9VA 2QQFA 3OA2A 5IYZF 4UZEA 1NGSA 4UOQA 2QRUA 3AZQA 5DGHA 4FXOA 3O91A 2JFZA 4Y6PA 1FYDA 3Q3VA 3BLYA 4FYKA 5AJVB 2GPAA 1Q0SA 3GEGA 1XRNA 5A4KA 1TADA 2VDWA 5BXQC 1J0DA 1FXUA 1Z9CA 1T2VA 2PBRA 3ZLTA 3ZY5A 5FLYA 2AJBA 1XMAA 3KOOA 4PW0A 4A3EJ 2IVFA 3OUUA 3R5SA 3L82B 2XMBA 4GIBA 2KMUA 1EHYA 1TMGE 5ENZA 4GKBA 3GLIE 1O3TA 2VJOA 2JRTA 3JZMA 2RH5A 1HYHA 3PT5A 3ZYZA 5DDGA 2KMLA 2Q1TA 2DLCX 1WQ1R 3LHIA 2WD7B 1XAHA 3LYAA 3K1TA 2HJVA 3PR2B 3H75A 1S0UA 2VF2A 1YO5C 2YRXA 3PUXA 3PB3A 3KCCA 4G6DA 3CRZA 3LKZA 1JLRA 2VHJA 1CPYA 2ZTMA 3KT0A 1W94A 2CLCX 4B6EA 3TPCA 3ZJ5A 1W25A 4FFRA 4H17A 3KAPA 1I4EB 1GXSA 1NNSA 2FMUA 3NZEA 2VBXA 4AUEA 1YR3A 1SD7A 1JFRA 4UUNA 4OH7A 1CRLA 2I7TA 3WB9A 1RBQA 2QGZA 5CLJA 1COWD 4OSPA 3FKSD 5JVDA 1Z0ZA 4N4NB 4KL8S 4NP6A 4OPMA 1TQIA 3GFMA 2XZTA 3IVXA 2JLWA 1Y3DE 1HW2A 3DT9A 2M45A 2LIPA 2HPIA 3EVDA 2PMEA 1YONA 4E5NA 3MVPA 3T5BA 5I4CA 2GHTA 3F3SA 3D5QA 3WK8A 2DA2A 3NWSA 1D2EA 2DQYA 5H6RA 3MVEA 3ROTA 1N2OA 3BIOA 2C4MA 1ADCA 1U78A 1P7VA 2V7QD 1WPKA 5DM7F 2X9VA 3V8VA 4A0RA 5BT8A 3K4MA 1EFVA 3IJRA 2CVZA 3TOCA 1ZIDA 4AZ0B 1P6XA 4MI9A 4EG1A 1XA3A 4KN4X 2IW5A 2D7CA 2GKOA 3OSGA 4X54A 1E3WB 2ZR8A 4I1VA 4Z3KA 3PPYA 2R6HA 3HYCA 5ALEA 5F7JA 2WICA 4JXJA 1S3IA 2P9GA 3PDIB 1THTA 4C0BA 4EGZA 3GFIA 1TXGA 4N18A 4ZO7A 3N7TA 3TTYA 2NV6A 1U7XA 4PZ9A 4TWBA 2IT0A 2G4VA 1XRMA 3W3AA 2DK8A 4LZZA 3UB2A 2JQ7A 1YU9A 4CT4B 3OMLA 5IJ9B 2HZ7A 3CNLA 3FAZA 2IEBA 1ZC3A 2AX3A 4XRSG 3FPEA 3KE9A 3RS8A 2GCNA 2O8VA 3BQNB 4PSVA 3RVMA 3DAHA 4EHKA 1DDGA 4UU0A 3NHKA 3D5RC 1Y37A 3A0RB 3CKLA 2YNMC 4FDLA 4N0EA 1YOVA 2QD3A 4LY9A 2RCYA 4Q01A 3VX4A 1YVDA 2X14A 1PEAA 5IY5H 3P0EA 1ZINA 1YRAA 4ZQBA 3TLAA 2G9WA 4CCOA 2PZMA 3G8AA 2MC4A 2X0IA 4OKSA 2X6YA 4OVKA 2O1XA 4B34A 3GPLA 1BYIA 2OZVA 1S2OA 4WKPA 4BVEA 5D5VB 4K8RB 1MBEA 1NTRA 4FEYA 2ZP1A 4CUGA 2V6EA 1XCVA 4CO8A 1LEAA 1PJZA 4DM4A 1PEYA 3AX6A 3B1KA 4HDSB 1BA3A 2HU5A 3O8OB 4QOJA 4ZYXA 5DI9A 2GD0A 4K9LA 5LXTA 2IOQA 2PH1A 3ZI4A 4LXHA 1QZTA 3ZCSA 1YUNA 3OBBA 1CZHA 4UCQA 4HDMB 5HBRA 2B5WA 3FDYA 1Z5OA 2ZQ5A 3NIWA 3OY2A 3OOYA 5BRNA 4D8VA 4ZDJA 721PA 2H1VA 3KXIA 2CBGA 3LQ1A 3VPHA 5FUQA 4DV2B 3QUQA 3CG4A 1N5KA 2CNKA 4EENA 3COAC 3M6VA 2VHTA 5FL3A 3AG1H 1Z4JA 3HO8A 2OK8A 1RQPA 5CA0F 1XZPA 3TNYA 3FJOA 2CUTA 1OJLA 3HJCA 2VR1A 4IHKA 3QF4A 4F55A 1BDBA 1L4MA 1JHPA 1YWGO 4J0HA 1AF7A 5GVSA 1NUHA 1XA0A 4J9UE 1FT9A 1CEYA 2E4AA 4IJ5A 4E21A 1EDOA 1ITYA 2P2GA 1P4HA 3IAM1 4H7KA 3ORSA 2FDCA 2QMYA 2PX0A 1QGPA 3Q7TA 3KQPA 2GEBA 5D1NA 2YIVX 5EXSA 2WY2D 5T4BA 4ZGWA 1SHJA 1I3KA 4IIXA 3F1LA 1KEEB 2DTRA 3E5QA 2GEJA 1O9HA 2A67A 2HA5A 3DEHA 3C7KA 3GR6A 4AU7A 3OFNA 4EJ2A 2IYVA 1ATZA 5E3OA 3D8SA 2CXQA 2GWRA 4PC1A 3UV6A 2R7QA 1Q7TA 2P1ZA 4HRXA 4E7HA 4YBZA 2O8DA 1Q5PA 1BVUA 1YI8A 4XQ0A 1P17A 3MYYA 1EM8A 2ORYA 3ZE0B 5BORA 5FRNA 5HP4A 3GV0A 1GYQA 1PTKA 4OP3A 5AJUA 2HWKA 3WOVA 2FMTA 2X0NA 2R9VA 5EP2A 3ETJA 1Q1VA 1JKFA 3DDHA 4NMMA 4A0YA 1DV2A 3UH1A 4YCMA 2QQ8A 4DV0B 1KA8A 5FWYB 1ZISA 4D0NA 3ANYB 3IBGA 1P5ZB 2V45A 4Y2HA 1VLJA 1GZDA 4RHUA 4ZTUB 2M6RA 1ZOPA 2EFDB 4RVGA 2O3TA 1RTTA 3BE6A 3A9VA 2FFHA 2Z98A 3F0TA 2EDCA 3F5SA 5T5QA 2O5EA 1I1HA 3PGXA 5A5DA 3E8MA 5K5RA 1ORVA 2Q46A 4LXTA 5CA1A 3CV3A 3IPCA 3SMQA 5C1DA 4UULA 2VBCA 4KQMA 4KQXA 2FP4B 3CVUA 3RIEA 1A9RA 2C1ZA 2G40A 2J5PA 1KJJA 2CQKA 1P73A 1XCGB 2ILVA 3RS3A 3TJZA 4CI9A 5KWSA 1VMEA 1C1HA 3FMQA 5T64A 1RWBA 1T0FA 3DZDA 3LRTA 1YACA 5FAXA 2IIBA 3UYKA 1P4JA 2PHZA 2Q4RA 4G63A 1E3PA 4CWAA 5CT6A 4I0WB 3BGWA 5DHTA 1DARA 3ZZMA 3RBZA 2I2AA 1EGQA 1YFJA 1VI2A 3D8UA 3LG2A 5A71A 3SGLA 1K8ZB 5JD6A 2X9DA 3ZZTA 2VXYA 1U31A 1P3DA 3HDTA 3ISVA 4X91A 2VL8A 3RYIB 5KOIA 1OCOH 2Z4TA 3L9XA 4GMDA 1PV4A 2IYOA 1QYXA 4WKGA 5E95A 4EELA 2COMA 2OBPA 2OPTA 1YCHA 2O7SA 3MA0A 2H1OA 1NQUA 4HX7A 1Y8QA 3THOA 5E6UA 1IZ0A 3CC4I 1JBEA 1XGNA 1O8CA 1T9DA 3VC3A 3G0OA 5FORA 4LDPA 3M8EA 5CLGA 2KZVA 1XKTA 2IV3A 5ALSA 2BMEA 3N7UA 5JWRA 5KZMB 3LAWA 1NJ6A 2ZYSA 4GLFA 5EGOB 1EUCB 2FEOA 2VEOA 3FNBA 1J1IA 3PC2A 4Q12A 4LBZA 1OBFO 2H5IA 3OZXA 4J00A 5D00A 5HDKA 3OS0A 1NXWA 1V3UA 3AM4A 1SUCA 3L00A 2YZKA 1W7AA 2XHZA 2C3PA 4CG1A 3TZ6A 2E55A 3QH4A 1KVRA 5DRTA 4GBGA 4DUZB 2EJRA 2CZGA 1R4ZA 5C3EJ 4AP5A 3WKBA 1DIOB 1E1MA 3HHPA 3LZ6A 4OHRA 1I01A 4J3JA 3WXMA 1ZHOA 1ORKA 3FTEA 3IWZA 3E5MA 4N7BA 2C59A 4NS1A 1JFVA 2Z95A 3WODF 2FPIA 3N58A 1XEXA 4P35A 2RKBA 3RKSA 1M2JA 1FBSA 3DTYA 4B3HA 1XZEA 2WINI 4LZNA 2BEUB 4RQTA 3QK7A 2BEWB 3CLVA 3A31A 1XMXA 2NS7A 4NTZA 5ALTA 4ZXFA 9GPBA 3DE4X 3W0LB 2FR0A 2CUNA 4OJKA 5EFZA 2EIJH 3ADKA 5HLHA 2BFAA 1JR4A 2V5VA 3F96A 3HO6A 4LQLA 3BTSA 4RMGA 1QKJA 2H7YA 4LHXA 2ESRA 3K4KA 2YVUA 3CEPB 3TEMA 2A9FA 1VMAA 1TD1A 2AQKA 2HJHA 3A10A 3FR7A 7ADHA 4F4CA 1NASA 1FNSA 3ABRB 2EBIA 1ATIA 3A3PA 3PE3A 5CT5A 4MGYR 2V3CC 3M6IA 4KI7A 4PG4A 3I9V1 4U7HA 3WNBA 1Z36A 2OOKA 4B3XA 3L02A 2C57A 3PJDA 4BCCA 2OKCA 4F92B 1E92A 3KUKA 4DRZA 2DHDA 2RGNA 4XMYA 5IRCD 3KSAC 2H48A 2IBSA 1G9SA 1N2BA 4YP1A 3MJDA 1G5FA 4QBHA 5E2BA 4CLHA 1ACMA 3EFOB 5K3CA 3THXB 2CB0A 2HM7A 3R3WA 4TSRA 3TCNA 3KP4A 4HSGA 2JA7J 2DPUA 2A59A 3MCVA 5HCIA 3C2HA 3N39C 5JFOA 4IVPA 3ZNNA 4BE7B 1AUXA 4FBMA 2NO7A 4GEGA 4IIJF 4JNCA 5KWVA 3I92A 1CY4A 5HZKA 1T2NA 2AYXA 3R7BA 1F5SA 2QMUA 2OV8A 3WK4A 3B9QA 3IMCA 1IBMB 4S05A 1ID1A 1H4QA 2R79A 5DMHA 3SHFA 1U28A 1ZMXA 5CTAA 2YKGA 2ZETA 2LZ0A 2DCEA 3EGVA 5ILUA 1W1UA 3KO8A 3SLRA 4IP0A 1U7UA 3MEXA 1ZN8A 2OGUA 5KB3A 1PVEA 4A03A 3CKYA 3K2ZA 3B78A 3LS2A 1LPQA 5BNFA 3OZBA 3TGNA 1NMSA 5CD9A 3I28A 2XPVA 2TRSB 3ICCA 3GHYA 4LXQA 1QH1A 4AB1A 5IT5A 4QU5A 5LD2C 4V0SA 2F62A 2ZI3A 5FF9A 2WSYB 1X0XA 1OBVA 5CRIA 5I01A 1Y8RB 2AF4C 3GARA 4Y2QA 3RVKA 5BO5A 3BIWA 1BXGB 2R4TA 3DZBA 3J81Z 3OLYA 4J2HA 1E0DA 4EB0A 1NF9A 1OOEA 1KP2A 3Q3SA 4FFDA 4TLDA 3UMBA 2DA7A 3M9AA 1X3UA 3COPA 4J0IA 5JROA 3Q3JB 3KR9A 3RPEA 4AMVA 3ZVMA 1J0XO 1A9PA 3FUTA 3E1KA 3N70A 1H5QA 1LVGA 3TNDA 3KSBC 3B8EA 3DE1X 1N3BA 2GAFA 3OZFA 2O8FA 2XUOA 3SR4A 4PM4A 3EC7A 3LPNA 2IXFA 4JJIA 4FKZA 4XXHA 4ME6A 4YCDA 5AI8A 4LYDA 3AVTA 1L5KA 1ODLA 3BR5A 1UXOA 1MX9A 4ZDLA 5DYTA 4L08A 4TZKA 4B3BA 1UELB 3JRHA 1L8XA 3UBTA 1OB5A 4QNNA 3RWMB 3L7AA 4O2AA 3DKPA 3TIGA 3ZE2B 3FFWA 1DJOA 3OOSA 1SXPA 2O8FB 4NZMA 2EWNA 1NHGA 3TR6A 3GZ5A 3ZJTA 3Q9NA 2WWGA 2DPGA 4ON9A 2DTDA 2QTNA 2ZXEA 2NM0A 3WGTA 1F8YA 1SQ6A 1QMPA 2LOOA 1NBHA 2EZ8A 2YMPA 5CM2Z 1W49A 1F2TA 3PM1A 3M6AA 3GJYA 5GGXA 2W6JD 4MHGA 1XVTA 4FHCA 4RSMA 3RYHA 3VUFA 4OMYA 5JFRA 4I3FA 4RTSA 2KDZA 2DU8A 4YR7A 2V7QA 3LWDA 3KZIC 5WRFA 5K3EA 1E7SA 2EFEB 4MVJD 4LRYA 2XTNA 3IQIX 1FFCA 4K2EA 4XE5A 3TL6A 3IJEB 3OQ1A 5JU6A 2M5WA 2PQ8A 4F3QA 3TM5A 3TXXA 4OM8A 3RYHB 4U2FA 3EGXB 3PWSA 4YDSA 3JWGA 4UHHA 1OXKB 5ENVA 1GQOA 4DWOA 3G2PA 5BPIA 3EFHA 4IWNA 4TZ0A 4BC1A 1W2GA 1VXRA 1XHFA 2BFEB 2WP8J 3GCZA 4GXRA 4WFIA 2PZEA 4HQRA 3STWA 3N8IA 4UW9A 1V3VA 5AMXA 2NQ8A 4DMCA 5AICA 2XD9A 3KJFA 1FTNA 4Z3OA 2WJYA 1IY2A 1RFGE 1T4GA 4G8XA 1ZK3A 3CDHA 3D0QA 2X0FA 3IAEA 4BV3A 4A3KJ 1E62A 2O3RA 2DWUA 3AU8A 3GJZA 4ALMA 4AWAA 2PTHA 1D6JA 1YRYE 3HHHA 3KLMX 4INZA 2JJQA 3ZLBA 4NDZA 4A69C 1N3YA 1AKHA 3FPFA 1DWOA 4QJ5A 1RC1A 4E4HA 5E0KB 3QXHA 4J8PA 1OFUX 1WXXA 3UIEA 4BN4A 3ADOA 5JVDF 3K4NA 4LI0A 4A0FA 1LB2A 1CTQA 2ZE5A 3BMQA 1EJBA 5G1NA 2DLLA 2PM8A 1QIIA 3FMPB 2FPGB 2ZJBA 1AT1A 2WD9A 3CP8A 1FL9A 4JP8A 4MUNA 4FE4A 3T9BA 1YHQI 2V7TA 2GEVA 3T3NA 1ZOSA 2GS9A 4HL6A 2QIOA 1UCRA 3A58B 1GN9A 4BFSA 1FFYA 4CQMD 2G70A 2IYSA 3R2JA 4G09A 3RDPA 2H5LA 1ZMRA 1K5GA 4FGSA 4BXFA 1NT2A 2JASA 5COBA 4Z9AA 1XZDA 4TYMA 5A6SB 1C7QA 2IWHA 4RXTA 3VR6A 4DMUB 3K9TA 4Y7CA 2HF2A 3ZU5A 3AG4H 3I0MA 3D81A 3KFLA 1E32A 4QQFA 3AFGA 1I5OA 2ZRFA 4HNHA 4OHKA 4PNZA 3AB3A 3O74A 3ZZ1A 3KE2A 3KP3A 3OYMA 4KXWA 3BM5A 1H66A 4I8DA 2F6CA 3RIRA 1FXWF 1XTRA 2CE7A 2XODA 1H3NA 1CSEE 4W82A 3UUEA 4CZCA 1AKMA 2ISCA 4IDBA 5T3UA 3LPMA 5TB5A 1IBKB 2Y2VA 1POGA 2KS6A 1Q95A 3OZUA 3IQFA 1G3UA 1RC9A 3F2VA 1T98A 2VHXA 5JQGA 3ZGZA 2OXTA 4E5DA 4FS3A 4N82A 1P4SA 5JO9A 3W9UA 3AH8A 4CSWA 2DDAA 1O87A 4EPYA 3A4CA 1K6IA 4PINA 4ZCLA 5AVZA 3RU7A 3KEQA 1WZUA 3I32A 4IS3A 1Z82A 3UAVA 3S8EA 3PA6A 2RJOA 4ESBA 1R10A 3R09A 4WBNF 2LCIA 2ZDHA 1X74A 4PZ0A 1M2VB 4ZV9A 4CFYA 4YAKA 2JW5A 3OPQA 4ZJZA 2D00A 5IPAA 2MW8A 1A7KA 1V48A 1WA5A 2BH9A 3TP3A 2JC3A 1WPXA 2O05A 2CXOA 3IEPA 2HT6A 2PMZN 1N2CB 3PDWA 1TWCJ 4NHOA 4W8OA 3ROXA 2DMQA 4BBZA 4DJJA 3TG8A 4MA4A 1NW7A 3EQ9A 2YXEA 3KBOA 5CJ2A 5IJXA 3DHVA 5CB0A 2K4BA 1ENHA 4RJLA 2BY0A 1SD5A 3LDAA 3R5HA 4POOA 1WW8A 2FX5A 3GEBA 3QW4B 3T4UA 3H2YA 4GXNA 4B8XA 3A1UA 3L2OB 5E4JA 1VMKA 2X1CA 5TQ0B 3KIOA 2X0RA 3C5WP 3I2YX 2YHIA 2QQ9A 4FSHA 3AHIA 4B40A 1DEHA 4BWVA 1IXRC 3KEYA 3LDHA 4EBBA 6ADHA 1JE1A 1DKMA 2VYVA 2WG0A 4BQEA 3ETNA 4IJKA 4ZQFA 2I3BA 1IBLB 2QYHA 2WKWA 1HYEA 1N8TA 1T8WA 3H13A 4I5DA 1YR7A 4EG4A 4I09A 4UAUA 1PQWA 1FBTA 4C6TB 1WBBA 5IBQA 1BA2A 2XPUA 1P1CA 2OAZA 2AFIB 5HJEA 3E6MA 3OIPA 1DDNA 3EVEA 3I9KA 1XEAA 4DPKA 4F56A 5BT9A 3ZBQA 5TPWA 2GOMA 1YVRA 1ONOA 1XR3A 3HUDA 4XPIB 2VO1A 2OQ2A 5DHFA 5TARA 1UPXA 2BFOA 2CDBA 2Z3YA 3D54D 5JS2A 4ZAGA 3MF4A 4DZRA 5LZ9A 5EAIA 2NP6A 1F7UA 1MJNA 1H8HD 4J2TA 1IOZA 1Q7EA 1TT5B 1OJ7A 4G4SO 1EXMA 2QJFA 4XQFA 3T9AA 1R22A 2DMNA 1PFGA 2CNOA 4QGBA 4U0JA 3FK6A 4LSWA 1X87A 1XEFA 4H15A 4PFKA 1LTKA 1W4CA 1CQIA 2YY6A 2R84A 3SJ7A 3GELA 3KOYA 1RI3A 3GVCA 3A1YA 1L7NA 3CONA 4CV0A 3PXCX 3FYTA 2VHYA 5BSHA 3A06A 4NDNE 5B4VA 1L4LA 3LU1A 1AIPA 3VO8A 3WO0A 5C35A 1V47A 3R40A 1IJEA 2HUPA 1A5TA 3AG5A 1BDHA 3RDIA 2W2VA 4LOLA 4OH1A 3BQYA 5F7XA 1Y6QA 3S55A 4HO1X 3QU3A 4F11A 1TJ3A 1N7JA 1C9MA 1E1QA 2F4MB 3JQPA 4ND4A 5CVIA 3HJHA 5E6RB 1Y1LA 2QL7A 3U9TA 4MUEA 3IS3A 4FQ5A 4R8VA 3RUDA 4KPUB 3G2QA 1DMRA 4D9MA 3BX1A 2ZCWA 3V1YA 2IZ1A 1M74A 2RREA 4TWZA 3DO6A 4YJ3B 1JKIA 4BLPA 4HDCA 1TLLA 3STUA 3LECA 1C1DA 2JLAA 2Q1UA 2RKHA 4Y6SA 2CUEA 4CN9A 1IRFA 2VJPA 2XEXA 4CL3A 1U98A 1I13A 1MX1A 3CZCA 4C05A 2H94A 2AQFA 4AT1A 1Y6IA 4BO7A 4E33A 4DW6A 2KLHA 3IPXA 4ARVA 3L2WA 2UZ3A 1L7EA 1Z6PA 1I6LA 4JT9A 3AWIA 4IMIB 2IPQX 1LJ9A 3L2UA 2EKDA 2IYNA 3HJRA 3I83A 4W4TA 2HTFA 3U7QB 2JLZA 3KQNA 3CEMA 2O2GA 3W6JB 3PO3J 4K9SA 4UHEA 1WCIA 3RFXA 2GPSA 2FBHA 2YX7A 3BBPA 1NFQA 1IONA 4HLDA 3ELDA 3UXEA 1GPWB 4I0BA 1SUSA 1I6MA 2WWXA 1O96B 3BT9A 2KRCA 1B23P 1PUEE 4I0AA 2Z2SB 4HRIA 1I2DA 1T8SA 2DFKB 2O2ZA 2VPPA 3ND9A 1X4OA 2V1DA 2PLNA 2W6QA 3FMFA 3FYUA 1OPXA 5CA0A 2OWEA 2XNKA 3VHXA 1WU7A 4ER0A 2GCEA 5E7JA 4NU0A 2WYWA 3NDPA 1O77A 3I23A 2GF9A 2K7ZA 3L0IB 4TVBA 5AKEA 3UQYS 2FZ5A 3VPDA 4V0NA 1Y7PA 4BJHB 5CBKA 3ZG6A 4LSZA 4EJSA 3CN9A 2D1RA 3I39X 2PRSA 3I52A 5AKGA 2O54A 1RYDA 3VR6D 4H7JA 4HVAA 3QJGA 3PHIA 2RONA 4TMFA 1ELOA 2KBFA 5E1MA 1QE3A 3EGXA 2KYRA 5E8GA 3CGGA 2O06A 4BVFA 4C22A 3W8DA 2UZIR 1T10A 4OXYA 4H35A 1LXCA 5ALOA 1I3CA 1TD9A 2FWJA 2IXTA 2P5UA 3C7TA 1LZLA 4CTMA 4NXMB 4RZQA 1Y8RA 2CYBA 2DWCA 1F12A 4WW0A 5A9SA 1FSHA 2CL5A 3IMFA 3Q2OA 3JTGA 4DARA 1PKEA 4NOKA 3T5AA 1W0UA 3D3NA 2FEXA 4OF4A 1S4QA 3JAMZ 1U3DA 2JH9A 1PR6A 2JGMA 2AD1A 1ENZA 3HYSA 1XDDA 3GFLA 1KFCB 2J30A 2XOKD 2E71A 4B1RA 4P93A 2FSFA 4WERA 4H0NA 4WX2B 3L93A 3A9WA 4DA0A 5J4KA 3DDUA 5AM3A 5JYEA 4RGSA 3WLMA 4B7XA 4WEOA 4MUHA 1C14A 3CLTC 1GADO 1P9OA 5C3MA 1MZVA 1CS4C 1SFOJ 1FBNA 3NIDB 3A0UA 3CJQA 4B7ZA 1ABBA 1DJMA 1NDHA 1GU7A 4R83A 4WWCA 3IILA 1R6XA 1AE1A 3PE4A 3GJ8A 4Q1DA 4JP0A 2X3UA 1VKZA 3LD9A 1VL6A 3N2EA 4G36A 2JCGA 4OGKA 3PL5A 4UUQA 1CY0A 4MWZA 3WL4A 5TRDA 5KHLB 4ZGBA 1DELA 1GPDG 3H9CA 3K73O 3C2GA 4IIYA 3U4CA 5HZMA 3F72A 5K5EA 2UAGA 3KDPA 4QUGA 4ER5A 3P7MA 1IY1A 4EO9A 3ILHA 1TL8A 3GNSA 1NURA 4I02A 3O3KA 3F21A 2ONKA 3JRCA 3AFMA 3SJMA 3GOQA 3WB1A 2PNFA 2R7OA 4U3JA 2A4MA 3LA8A 2Q4OA 1GXSB 5DW0A 5J4LA 1LVHA 5KNDA 2WEKA 3H99A 3X2SA 4B2YA 2OC6A 1QLHA 4RIHA 1QHIA 4TUYA 1ZX1A 5DB4A 1KQPA 2NO9A 3FYHA 3P0HA 1C8BA 5CLLA 5K8IA 3ZDZB 1H9BA 3GYBA 4JQYA 3ZOZA 3PO2J 2DJ5A 3PDCA 4ZCMA 1HY3A 4LE2A 2C3OA 3MKYB 4X3PA 2B35A 2W6JA 1WMSA 4BDYA 3QTLA 4H9GA 3HCNA 3WRXA 4FIDA 4JXXA 3S1AB 3GTGJ 5G4KB 3NI2A 3TJMA 6REQA 2I7VA 1XC7A 5EZ6B 5DYWA 5LB2A 1BFUA 3CX3A 5LUAA 2RAPA 2EJUA 4BO6A 2ZIWB 3PFGA 1WJCA 1RRJA 4TL7A 1C7FA 1GZSA 5E6RA 6Q21A 2XCUA 4BX3A 2QW0X 2F3QA 5LP6A 3CPJB 2YUSA 2NU9B 2B6NA 1EZ1A 1YI1A 3RASA 3WP0A 3LA7A 4PDKA 4Y33A 2QUIA 4CQLB 4BYMA 2W2KA 2B8JA 5DLQC 3W78A 3TLXA 3I5YA 4KLCA 5ES3A 2UVPA 4MK4A 1NXOA 4H6WA 5IWAB 5DCLA 4F4IA 3N3BC 3A05A 4D3ZA 4DEXA 1U90A 1HSTA 3ASUA 3F9CA 4Y2SA 4COKA 5IYZB 3ZJVA 2D6FA 2C1XA 4KQKA 4LV8B 3OR1C 2OGTA 3SFTA 1ZYRF 3QOWA 1XPXA 2EX1A 1TTQB 3PIPF 1H4TA 3UJBA 5GTHC 1TZBA 3ESXA 3I09A 2CT8A 1NUUA 1QLJA 1DWUA 5TS2A 2Y0CA 2OP1A 3NG1A 4YELA 4HQMA 1U2GC 1PFKA 2FZGA 5FLKA 1UMCB 4EZBA 2OO3A 1M1EB 4OD0A 2PPVA 2R2AA 3TDZC 3EBOA 4IWXA 3SYNA 5FTKA 1SBHA 2XE6A 3BZUA 5GMOA 5DNUA 3E6CC 1KU9A 5EESA 4RFSB 2XWSA 2VPRA 4KXFB 4YUWA 1JHUA 3RJMA 4EDHA 1EDDA 1V4RA 2A68F 3W7AA 1NUSA 1O0BA 3ODGA 1O3RA 2G8NA 1FY2A 1YR8A 3OY7A 3PQ5A 3IAM2 1SWWA 1MG0A 1RZRA 4DMKA 1FX1A 3CSSA 4M86A 2B21A 3HXKA 3WYGA 1NG6A 4IJUA 2A0XA 2JIPA 2PZ8A 4DSAA 3P9YA 4Q3NA 3V33A 5K45A 1ETKA 5K8TA 1U1IA 2HXSA 5IDYA 3CUQA 5CEJA 2RHJA 1E3QA 1B00A 1YUBA 4BXXJ 1RHQA 1VI6A 1GDDA 3A27A 3OYKA 3AJ9A 2A3NA 4M99A 3UMGA 4XA8A 4DQVA 4UHBA 2PUFA 2VK2A 4GEKA 1PQYA 3LUFA 1KH1A 3I1JA 4J0CA 2ECOA 3K4QA 5G41A 5TMDA 2P90A 4RZUA 4CKEB 2AIRA 1U63A 1WZNA 5EZYF 1T1GA 3LV8A 4PZAA 3ZCRA 1TW3A 1LX6A 3TFOA 2IEKA 3WIDA 2OHJA 4PANA 2CUFA 1Y5MA 3BGDA 4PGHA 1G4UR 4LS3A 5B7QA 3PENA 2LKXA 1D5VA 2ASVA 4C4YA 4CLXA 5JLXA 1DEAA 2EQBA 2QZ8A 2ZS9A 3BFPA 1MIHA 1W19A 3SX2A 4E6EA 1PNRA 3HMKA 1PQUA 1KJYA 4MINA 2LV8A 4AS2A 2HD4A 4U87A 3L9WA 2QRLA 4MKIA 5JI2E 2JG3A 3DFGA 2VN2A 1CUVA 2TDXA 2NYUA 1Q0PA 4MV7A 4XAQA 2W8BB 1IOVA 3DE6X 5DBFA 2WHYA 2G9UA 1RACA 2F17A 2B34A 4P3XA 2IZZA 1WF3A 1GQ2A 2D74A 1G3QA 4RHTA 1GL6A 1ADJA 2ZYAA 2Z43A 4X6AJ 5ALYA 3C8ZA 4XD2A 1OROA 4CBVA 2WR8A 4NECA 3TDNA 4CM8A 3KKEA 1SKUA 1FUIA 5K3FB 5BR8B 1STZA 2O8DB 2JSCA 3CF6R 5D85A 2RBKA 3LMKA 1ZNXA 3RRNA 1KMHB 3DUWA 5BN1A 5EJ8A 4O0MA 3ZHXA 3AG6A 3I76A 2IX3A 3G88A 2QT9A 1Z4OA 2W98A 2F90A 2V5AA 4NBRA 3ZBTA 1G66A 3FCAA 1WRJA 2EV5A 2NVUA 1P77A 1LX7A 1X3LA 3NFYA 4F04A 3CH6A 5LGUA 5ES4B 2LG4A 4N5IX 1BRMA 1QAQA 3NQOA 3RHFA 1HTWA 4JLNA 1CUEA 1KR2A 1WABA 2PUJA 3CF0A 1NVEA 3JVIA 3VPXA 3Q9UA 2ORED 4PWZA 4BP9A 1QH9A 2ZJFA 3TVDA 4HQ6A 2BTQA 1ZI8A 4P2GA 2EZKA 1VCIA 2Q2OA 4HFMA 4KEAA 5H0IA 4D9HA 2EJTA 1S9HA 3TQHA 1QAMA 3NW9A 1Z63A 4V0LA 4AF8A 1VIYA 1ZW6A 1YGYA 1YRWA 1LH0A 1XF9A 3AV0B 4OKIA 2R7WA 1QUEA 5KAIC 4QTTB 3SHWA 1FMFA 3BS4A 2J6HA 4YAIA 3R3HA 1MNQA 2RHMA 1QH0A 5EHQA 4C7JA 1YC2A 1VSVA 2PFKA 1LFBA 4RJJA 4DJEC 2W4QA 2I2BA 1JXQA 3MWDA 5GTIC 4PSDA 1C3XA 2BHNA 1JA1A 4URHA 5J2TF 1DQYA 2J3HA 2JK0A 3D1NI 4Z1MD 4TV7A 5BRAA 2X9QA 1K89A 2E36A 3CZ5A 3LXMA 3OX4A 3K09A 5AW3A 1OF1A 1MMFB 1N2IA 1SXHA 1ZH8A 1LJLA 2AFVA 1X7ZA 1E2KA 3QKRB 1U5TB 3S2YA 3DTVD 5JBNA 5BOSA 1WD7A 2O2EA 1OTHA 3MWDB 4ZI2A 3DTIA 1ECJA 2FPMA 3HJGA 2FHPA 3D8NA 3V8JA 4GI7A 4KYVA 4OQZA 1US8A 5AJHA 3EPPA 2GQ0A 2XAJA 2P6RA 2OENG 1V5IA 3K9WA 4YJDA 1UPUA 2Z2IA 3E81A 3HRHA 5IZCC 1I10A 1RIIA 2BFMA 1RYMA 2F59A 2GPNA 4HG2A 5CCBA 3EVAA 4AKSA 2KIFA 2PBLA 4GX2A 3Q9VA 2A94A 2AFHB 4UUSB 4G1EB 2CW8A 3QOXA 3L84A 1F1ZA 2WT8A 4ZJPA 2QNRA 2KHZA 1X1AA 1G20E 2VF4X 5CIQA 3T12A 1VJCA 4NJEA 4PN3A 1U1EA 2FZCA 2V7VA 3OJOA 4HQKA 1JKJB 1IN5A 4IH4A 3R6LA 4XB1A 2YYSA 4JT2A 4JVOA 4JOCA 3V42A 1LNSA 4JJKA 3UTCA 2HBYA 5AKLA 2IV7A 1F7VA 2E1MB 2Q3DA 2Y8EA 1NJFA 3AEZA 4QLCU 3WLIA 4PJLA 2OQVA 3ZE8A 3NHJA 1SMTA 4LXXA 4L0YB 1TM2A 3WLFA 2A3SA 3EOBI 3K32A 4LWQA 1ETUA 4E13A 5CB6A 4DCSA 4PFSA 1KY4A 1TCCA 2Y1CA 3HWSA 4P7KA 3CCJI 5EMNA 4HAYA 3ZY2A 1P8AA 2FW9A 3NC0C 3SIPA 1ID8A 2ATEA 1D0XA 4MAFA 5BW6B 3DL2A 1XWFA 4O63O 5C44J 1M7GA 4P0QB 1BR1A 1SAXA 1J9ZA 1OLOA 5LEJA 4TS9A 1O3YA 1SXIA 3QBVA 4TZTA 2FLKA 4WJKB 4FCYA 1O9BA 2E89A 2EHDA 1MAVA 2WLSA 4URYR 1YI2I 5DVZA 3VDQA 1UEXC 2K5CA 4P96A 1A36A 1UBNA 3KKOA 2FRHA 1FFHA 1GPKA 1VIMA 3QMWA 4M3DA 4YHBA 5TF0A 2MD5A 3K4CA 2IU3A 3PJGA 2IYRA 1TUBB 2JAQA 121PA 4KR2A 2H07A 4HPWA 1RS0A 1CZOA 1KYVA 3O73A 1RADA 3BP8A 4KOAA 4PZDA 1YQ9A 5C1PA 3VKVA 2GXSA 1Q7BA 2GIZA 1SOWA 5LZ7A 1QIKA 1KMNA 2OUMA 5ICGA 2OCBA 4IS2A 1K66A 3OQOA 4Z2AA 2GASA 2VK8A 3ASZA 3QA9A 1B9MA 2B8NA 5AHXA 2QMHA 1AS3A 1WY5A 2CS3A 1ZQ9A 5J1YA 3W2EA 4YFKF 4J6FA 3TX6A 4BNDA 4AZ0A 3MMYB 4XM1A 1VPTA 5BPFA 3FFBA 1FOYA 4C6TA 2XGJA 3TD2A 4GYYA 1P1IA 1P5FA 3HGGA