1XDUA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with sinefungin (sfg)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
molecule keywords Protein RdmB
total genus 101
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xduA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xduA03
1XMKA 1BOOA 3B89A 4PYMA 1HMYA 1YW8A 2ZNZA 4RB0A 5DYMA 1R74A 3GJYA 1FT9A 4BNCA 2XBMA 1IM8A 4D0PA 2J5OA 3G73A 3GDHA 2PVCA 3HSRA 5LGUA 5CUQA 1YLFA 2UYCA 4CXFA 4MHTA 3VFZA 3ELKA 3KEQA 3QAHA 3GRRA 3P9IA 2QQ9A 1ZLJA 4L9VA 4Y15A 5EZSA 3MCZA 3PTAA 1FBSA 2VC0A 2PN6A 3X0DA 1ZG3A 1IRGA 5LEJA 2VODA 1R18A 5K0JA 4KDPA 3QP5A 2ZIGA 3PQKA 5TRDA 5EKUA 1SKMA 1HKSA 2AOWA 4HYEA 1N7IA 2H27A 5LR6A 2BZGA 1RNLA 2CO5A 2M8EA 5EEGA 4YIIA 2L4MA 5A2QZ 4Q4ZF 3LAJA 3P2EA 4MTDA 1PP7U 3KU1A 5ICGA 2FXAA 5CVVA 3HOTA 5GWXA 2AOUA 2ESHA 2XAFA 2FU4A 2JRTA 1RJGA 4UXNA 3JTGA 1USTA 2R3SA 2QENA 2CQKA 2HR3A 4PZJA 4BYYA 2GAUA 4HAMA 3DXYA 1TQMA 2LF7A 5DM0A 4GQBA 3NTVA 3UJ7A 5CVDA 2JHPA 1SUSA 3G2PA 4UV9A 4EJVA 1DL5A 1I9GA 4FP9A 3UA4A 1Q0TA 2HTEA 1USSA 3LECA 4QTUB 3P2KA 3ER9A 3O2PE 1ULYA 2PSSA 2YX1A 4R8SA 3V8JA 4WXCA 1XGSA 2G72A 4E30A 2OZ6A 4RB3C 2ZFWA 2OD5A 3I64A 2PY6A 1YZHA 3A7DA 1P92A 4E33A 2NXCA 4X63A 3C6MA 3UA3A 1AQIA 1BJAA 3RJPA 2XAJA 4N0BA 1ZYRF 3UWPA 5JI6A 2ZCJA 3IWZA 4XUCA 4M71A 3BZBA 3HTSB 4U7BA 3R4KA 1P39A 5D5VB 3KR1A 4GEKA 1ZH5A 1ZGJA 5L3CA 3GU3A 4HTFA 2K4BA 3BWGA 3RKXA 3I9FA 1L3BA 3SXYA 4RTNA 3GFLA 2IIPA 1NW7A 3WTZA 5D1NA 3LX6A 5ICEA 1NW6A 2FMYA 4A5MA 1V3FA 3GFJA 3NEUA 4WVLA 4EMSA 5L3EA 5EPEA 3ECHA 2GLUA 3FMRA 2UXXA 5P8WA 1EH7A 4MIKA 4RVHA 3E5QA 5EG5A 4LMYA 1R1VA 3NRVA 5E20A 4O6JA 4HX7A 2A3SA 2FEZA 1RJEA 1CF7A 3CJRA 4S04A 2ZVJA 3F4KA 5K0GA 4ENKA 1EH6A 1SFEA 3C7JA 4P7FA 1U5TA 1LDDA 1U2ZA 3LDFA 1IRFA 3JSOA 5DCMA 4DCMA 2MA3A 1S7AA 2QQBA 1DPUA 2XV4S 3R61A 3EVEA 4GOLD 3OE4A 5EOVA 1MHTA 3W6KB 4AZVA 1ZRDA 5FFXA 3EVFA 3P2IA 1P1BA 4A6EA 4IVNA 1W7PD 4RGRA 2KJCA 4M9SA 2IH4A 4V0QA 1M6YA 2V79A 4NQWA 3EEOA 2M1BA 1LEBA 1SVUA 5K09A 5EMMA 1D5VA 1R6AA 5DPMA 1N2XA 2UYQA 3FMQA 4LJZF 4OMZA 3WU1B 5K0CA 4ENNA 4XUDA 4G56A 2RN7A 2OQRA 2UZKA 2HFHA 3M8FA 4PINA 3F8NA 1L9KA 5EEHA 4KT5C 4YIFA 4ER0A 3RIEA 4LB5A 5E1XA 3GIWA 4HTFB 3T7RA 2UWMA 2KRFA 3IWFA 4HDVA 1G3YA 3WGIA 1AWCA 3G3ZA 3OCJA 4AIHA 2YTZA 3JWHA 3I53A 5KQRA 4Y13A 3FYDA 1MD0A 2L02A 2I6GA 4YMHA 4G8XA 4UVCA 2QUFA 3IKVA 5HS7A 2GA9A 2C7QA 2ONYA 1ZRFA 1RJDA 1XJ5A 1X3UA 4DA4A 4E32A 2ZMEB 3KQTA 3QV2A 3LBFA 4HF2A 3SM3A 2WC2A 2YXEA 5CVJA 2PLYA 4EQQA 1BI3A 1UFMA 2OZVA 2R7FA 2OA4A 3IHTA 3E6DA 1O9GA 1TLHB 4AIKA 4L5JA 2EJUA 2P3OA 3WE3A 2VP3A 1U8RA 4G7HF 3EYYA 3HYIA 4E2WA 2O06A 1ODDA 2P3LA 2ZLBA 2HMYB 4RGXA 3TQNA 1EH8A 3WTUC 4OBWA 2K86A 4GO1A 2ZKZA 5GIPE 1E17A 2FSWA 1J9IA 3EDPA 4PYOA 3VB2A 3K1NA 4QTTB 5E1DA 2ZNYA 2BM8A 2O61A 3JWGA 2Q8KA 4KDRA 4M9ZA 3UZUA 2A6HF 2A6EF 4Q47A 1U3EM 4GF5A 4L18B 1KPGA 3FTCA 4WCGA 4QDKA 2L3DA 2ZTHA 2H11A 3EMBA 5JHUA 3G8AA 3O6BB 1NKVA 3JTHA 2P41A 4HV6A 4JK1X 5LRSA 2AR0A 4MWZA 5FFZA 4M37A 1TPYA 4IHTA 1I27A 3NVKI 2D1VA 8MHTA 1BIAA 2P6TA 2F5CA 1FLIA 4E31A 1HQCA 5EZQA 3V8VA 1D3YA 2H09A 3LSTA 3WTYC 3DLIA 3EGVA 4M7RA 2EJTA 4CYDA 3MGGA 4XRFA 2FK7A 3KE2A 1S7OA 3VC2A 2JTVA 3I59A 4XSZF 4DF3A 4FSXA 3BKWA 2ZULA 3P71T 1MKMA 5K05A 3WG9A 1WZNA 4YV1A 3OU2A 1YW7A 3KQQA 2TDXA 1ORIA 5G02A 3FPJA 4RVFA 5HDKA 3WTXC 5K01A 2EFNA 1B1BA 1AV6A 2YU3A 4UV8A 2VE8A 3HRMA 4R79A 1HSTA 2MBFA 4KUMA 4RTKA 2QE6A 3HCDA 2IJLA 1O7FA 2GAFA 2EFOA 5DX0A 1G3SA 3LA7A 3FXUA 4GYIA 4CWAA 4I0BA 3MAGA 1VLMA 2NYUA 2PX8A 3T0IA 3IL2A 3C1DA 4KA4A 2HQNA 3B73A 5FD5A 4XLPF 1XVAA 5C0OE 4KFCA 4HF0A 2IDKA 1SFUA 3HP7A 1G38A 5D5WB 4EJTA 1T6SA 4RTPA 1BI1A 5BS6A 1Z7UA 4BLVA 5F2NA 2ZJ2A 3ZN0A 2UYOA 3N97A 1WI9A 5BPIA 1J7KA 1JG2A 1EAMA 4P58A 5DD8A 1R36A 2OY0A 4FZVA 3KLNA 3KFWX 1SMTA 1UHWA 2XVMA 3G88A 1IXSB 3FUUA 1P2FA 4JBAA 2B3TA 5D6FA 4RB2C 2IDJA 4E70A 3IEIA 4ER3A 2AZTA 5HFJA 2BBYA 3G8BA 2ZWVA 1XMAA 3FYCA 4OINF 1BC7C 4I2OA 4NB5A 4JXJA 1UHMA 2FRXA 4IF4A 2GA2A 1YTYA 4AZSA 5L3BA 1RI5A 6PAXA 1FOKA 3I71A 2PEXA 4WX9A 4EGYA 1TBXA 3UJDA 3MAJA 4PWYA 3TGNA 3D5LA 2JH8A 4QDJA 1ZARA 3L8DA 1JXSA 4M74A 3CUQC 2JH9A 2ZCWA 4RTMA 3NWEA 2HQRA 1B6AA 1MJAA 4I7HA 4Y2HA 1IXRC 1JHFA 4IV0A 1ZHFA 1MDMA 2E5WA 2E1CA 2WWYA 2O8XA 1O3RA 3CJTA 5LQKA 3SMQA 5LQJA 1IUYA 2OZUA 1PP8F 3ABUA 2CMHA 1BI2A 4CO8A 1NBIA 5GOZA 5K5OA 3BKXA 2K4JA 3ULQB 4Y30A 3LDUA 2RQPA 1FWZA 4R1HA 3HCBA 4GXOA 1TW3A 5L3FA 3PFIA 3UJAA 2O05A 2XUBA 5E1ZB 2Q0OA 1F3LA 2NP6A 2YVLA 4P7JA 1ON1A 2P35A 1QGPA 3MQ0A 2BM9A 1NV8A 3L9FA 3QOWA 5DM2A 2ESNA 2Z6UA 2FBIA 3MERA 4ATNA 2CSOA 4LGWA 3AWIA 1WS6A 3FF5A 1S6LA 2O3FA 2D45A 3IYLW 2VZ9A 5C1IA 1IZ1A 3SZTA 4UVAA 2PWYA 2DPMA 5FUBA 3FXRA 5LQAA 5DV5A 4LLLA 1R1UA 3E97A 3GO4A 1RI7A 2FNPA 1F9NA 5D1HA 4YFKF 3E5UA 3LAPA 3ZP5A 4CICA 3EVAA 3WTSC 4ESFA 2XHKA 5GP1A 3FZGA 2BEOA 3RIRA 3V7RA 1WKMA 4BLWA 4CGZA 1Y0UA 2Y75A 5FD6A 4HOBA 3G2OA 5FULA 4EKGA 2VC1A 2ZWAA 4O29A 5JVTA 3CC8A 3DH0A 2G7HA 1ZGAA 3O4FA 3J80K 3KQVA 4F7ZA 4LK0F 2FCAA 2ZIFA 4C08A 1S8NA 4O3MA 3EGEA 2HEOA 4OQEA 2G1PA 4BY9E 2QRVA 5FWAA 2Z9OA 4RTRA 1JG4A 2Z3YA 4EM0B 2JG3A 2FYTA 1KQ8A 1ZLKA 4OOIA 1YFHA 3JSPA 4LG0B 2RVCA 4HSGA 5K1YA 5ILUA 3R6SA 3HRUA 2K02A 5DXJA 1OR7A 4AVPA 5IKMA 2RV8A 2VS1A 1RJFA 2V9VA 3EGIA 3MEXA 3DPLC 5E8RA 4M73A 3S68A 2IPXA 1OMIA 3P9KA 3BUSA 3FTFA 2BR3A 4LB6B 2IP2A 1XN7A 2PMUA 2AN5A 2HYGD 2OB2A 3LPMA 3RKYA 2CWWA 3CDHA 2C7RA 2W25A 3KP2A 2DULA 3BROA 2AN3A 1XGOA 5HOQA 1SFXA 3LKZA 3HNRA 3BY6A 2PXAA 1Z05A 2EX4A 3FM5A 2VBXA 2FK8A 3OZSA 3C3YA 2RC4A 1M6EX 4A12A 5E17F 3NW9A 4GC9A 1W4MA 2NS0A 5J8CA 3L7WA 3I54A 1H9TA 5IH3A 4C03A 1DDNA 3BPVA 2P5VA 4IWNA 1HW1A 4G6DA 3QU6A 3V4GA 1G60A 1TQIA 5FWDA 1D8JA 1JG1A 4I02A 1IW7F 5K5QA 1U78A 2JHCA 4P9UA 4EGZA 2STTA 1WRJA 2XVAA 5EMKA 1GXQA 3HCFA 3DFGA 4X61A 5H6QA 3BXOA 2XIGA 3ISPA 4LLNA 2Q41A 4IV8A 3FM3A 4I09A 4PCQA 3GRYA 3WTVC 2QZ8A 2PFBA 3FUVA 2QY6A 4F86A 1SG9A 2GH1A 2NXEA 4GC5A 3KQPA 2Y48A 1K7AA 3CTAA 3O3KA 1Q0SA 2LDUA 3H3ZA 5E18F 4AUKA 2ZZMA 2NXJA 2P1DA 5EIWA 3LQQA 4CDGA 1EJ6A 3FUXA 1FNNA 3V8LA 4YUXA 1B9MA 3HIFA 5KVAA 2GB4A 4QPNA 2CWEA 1LNWA 1TQPA 3TKYA 5MHTA 3H92A 1W5TA 5F6FA 2BR4A 3LKDA 1LDKB 5EIFA 3C18A 2AN4A 2KW5A 3C0KA 2LF8A 1H0MA 2STWA 3FXQA 1HW2A 1JG3A 2L54A 1FC3A 4M38A 4CXMA 2IVMA 3HTUA 1FY7A 3M33A 1P91A 1RZ4A 4TV7A 4Y17A 2XGXA 4GGGA 2FPOA 3U2RA 2NNWB 4ETSA 2QYOA 3ER8A 3E5XA 4RVDA 1BC8C 3J81Z 10MHA 3M4XA 4Z2YA 2A07F 2DAOA 5L3GA 4B17A 2QBYB 1U2WA 4OIOF 4GOOD 4F84A 4B8XA 1CF7B 3TO9A 1GXPA 5BXYA 4RTJA 1LEAA 4R6XA 1FYMA 5TJJA 3B02A 3CVOA 3JWJA 1R8XA 3KQOA 1QYRA 3H2BA 4ZTBA 1HKTA 1J2XA 4MQ9F 3LCUA 3DMHA 5E8GA 3GYHX 3SX0A 3DP7A 4IRIA 1OR8A 3GRVA 2VOPA 3J7AO 1EJ0A 4PNEA 2QM3A 3CJNA 1UWVA 2VOOA 2ADMA 5T67A 1IXCA 5HIJA 3BWBA 3GRUA 2COMA 2YX7A 4KMUX 2V1DA 3WGGA 1XDUA 3SSOA 3TOSA 2IH2A 1NW8A 3GX4X 1JSXA 3HRTA 1X19A 3HA5A 3WSTA 5LQRA 1E2XA 2V74B 2CGPA 2RDPA 5AIQA 5EHIA 4C04A 3PX2A 2DBBA 3KP4A 1KQ0A 3IRRA 4DZRA 3J80Z 1I1GA 2CG4A 2W85A 2K4MA 3HVIA 3FTEA 4KICA 3OPNA 4L7VA 2EA4A 4BXUA 2K7LA 4LK1F 1FZPB 3M8EA 2HDCA 4DM3A 1YS6A 1KA8A 2P7IA 2VXZA 5EVJA 2AS0A 3GVAA 1TNTA 1IN5A 3GXOA 1Z1DA 2ZBKA 3UJ9A 3DXJF 2EJRA 3M6VA 3K9TA 4YUZA 4EKIA 2XVCA 3G2QA 3FMSA 3DTNA 4MNUA 3ERED 3ZPLA 4Q48A 5DD4A 2QRVB 2M5WA 3IV6A 2CFXA 2DPUA 3LQRA 5D5UB 3SXJA 4DKJA 4U0VA 2I9KA 5E9JA 5LEKA 1MJBA 1EV7A 4ZYEA 2B0LA 5DX8A 1BC5A 3PVCA 1PRYA 1ORHA 3EQLF 1H9GA 2L01A 2P7VB 2HWKA 3KHKA 5HEKA 2IBSA 3G7UA 1O3TA 3GW2A 1OYWA 4E2ZA 1HKQA 4X41A 3HUGA 5DCMB 4R05A 4ON0A 1BN5A 2UXNA 4ESBA 3F72A 3DPTA 4YV0A 4PONA 1KXZA 2FF4A 1KHHA 2WTEA 2PX5A 2BH2A 5K0BA 2HOEA 3KPWA 2W24A 1SMYF 4I01A 5IT9K 5K5RA 2EFWA 3TLJA 5HOOA 4PGGA 2MH9A 2YPRA 1G8AA 3GF2A 5BOXA 4CKBA 1YFLA 2ISYA 3EPPA 2JT1A 5FA8A 2YR0A 4KDCA 4EQZA 2UYHA 1D2GA 3UJCA 3UJ6A 4HRAA 2ACJA 2B25A 1IF1A 1I1SA 1VPTA 1I1NA 3PT9A 1TNSA 2EFPA 5GIOE 2F5DA 5HIMA 3RPUA 3ANXA 1KYZA 3LA3A 5D8KB 2DLLA 3LGAA 4F85A 5FHRA 1XGNA 2NAZA 2GS9A 2JHAA 2QLZA 2IA1A 3Q87B 2RGVA 3DMGA 4YFNF 1RI2A 4RS8A 3GLXA 2V1UA 2QQAA 2HS5A 2ZMEA 2JZYA 2F2EA 1LVAA 1XSVA 5DCFA 3VOEA 4MHGA 3M1EA 1F1ZA 3CBGA 1RUNA 1BOAA 1O9HA 4OQDA 2HKXA 2KKOA 3T8TA 1XCJA 3A4TA 5F1RA 4GOMD 3BZ6A 1YB2A 3GUDA 5DSXA 3VSEA 3DOUA 4ENJA 3FRHA 4RGUA 4CHUA 2K27A 3KPVA 3F21A 1U6GA 3KQMA 2EA2A 3LBYA 5EMLA 4A5NA 3GZ6A 3DULA 1FYKA 4IHSA 1SQGA 2Y1XA 4PIMA 4L5IA 2OXTA 3JAMK 1KU2A 3OE5A 1QZZA 2D1HA 5DT2A 1BIBA 1ZG5A 2YSRA 2WV0A 3JWIA 4RAZA 4ZZLA 2P4WA 4BAYA 1EIZA 2I62A 2CL5A 3R60A 2B9EA 1LDJA 2KIMA 2VDUE 5D6EA 1YIOA 4PYNA 5DRTA 2PXCA 2EFQA 3QPTA 1XDSA 1T39A 2P5KA 5FGMA 5FA5A 1XXLA 3MCTA 3K2ZA 5ILVA 4P7KA 4ER5A 2PLWA 2FBHA 1F5TA 1O57A 5E1WA 2VDWA 5GM1A 3F3XA 3SSMA 5LBQA 3E8SA 1ZN2A 1V39A 3BWMA 5BW4A 3HCAA 2ZW9A 4UVBA 2V1XA 3EVBA 3I0TA 5E8JA 3K1PA 3K0BA 3I4PA 4G7OF 2IGTA 4ZYDA 1Z3CA 2JPBA 3R0AA 4EM2A 5A2QK 1V4RA 3LA2A 5DSTA 3P8ZA 4RVGA 1DCTA 1KIAA 1UFKA 4PCAA 4POOA 2IW5A 3KZYA 4AWXB 5BPDA 1LJ9A 1K78B 4R6WA 2P40A 4M36A 1H1DA 2HKOA 3BWYA 5ED4A 2E7WA 1J75A 5DEQA 5CVIA 2WA2A 4V0RA 2DU9A 2EK5A 1T2KA 1KP9A 3KP5A 4YV2A 2Y0MA 3TOBA 4U7PB 4KIFA 2PT9A 3FUTA 5K8VA 3OU6A 2P7CB 5LHIA 1QO0D 1XCBA 4FHTA 4HX4A 1RI1A 4XBFA 2YXDA 3TMAA 3MHTA 2VBZA 4JQFA 3MTIA 4XUEA 3FZVA 3WE2A 1B4AA 3THSA 1I4WA 5FLXK 4OU0A 3DF8A 3M70A 2EB7A 3IHUA 2BR5A 1JGSA 2OYRA 3CJQA 5CVEA 1P4AA 1IAWA 3LWFA 5DDGA 5EQJB 2NXNA 4HLYA 3AXTA 3P9CA 2ONZA 1XSXA 4AZWA 2J5PA 1AF7A 4YUYA 2BV6A 2O0LA 4RTLA 3RW9A 4HBLA 3ZMVA 4ZYHA 4KMFA 2O07A 5LSAA 3EVCA 2WA1A 1FBUA 3D0SA 4HC4A 3RKWA 4EM1A 3OZRA 4G7ZF 5CCXA 3I59B 4OIQF 5LRRA 5CM2Z 2GXBA 4KN4X 3PLAE 4IRHA 3F8FA 1G8SA 4PCLA 4NECA 4LFUA 3DEUA 1L3LA 2CMGA 1YG2A 2OKCA 3D2LA 4KWCA 4IKPA 4U7DA 3ZMUA 2AOXA 3FPGA 3H3UA 2VE9A 3ROUA 2EV6A 1W7PB 4U88A 1L3CA 1R22A 2PT6A 4BHBA 3R0JA 1R7JA 1HXDA 5DM1A 5ERIA 3SQNA 1PUEE 4BLUA 3EETA 3OU7A 4ASNA 2HNKA 4XLNF 1LQ1A 2KIFA 4FS8A 5HLIA 1PJZA 4UNOA 2ESRA 1ZRCA 2XKOA 3KR0A 3DQVC 4IPAA 2IRFG 3AY0A 4OIRF 5FCDA 2DW4A 3KP7A 4RAYA 2AVDA 1IXKA 4EK9A 2RKHA 3FUWA 1NV9A 1J5YA 4RTQA 4EJOA 1BHJA 1FX7A 5AONA 1I5ZA 4WXHA 2A5YB 3LFKA 3GZ5A 1T98A 1VBFA 2NP7A 3OFKA 3VC1A 3E6BA 2ZXJA 5K03A 4EJUA 4MEXF 3TPZA 3TM5A 1AOYA 2N47A 4A0YA 2ZBQA 2G70A 3TDZC 5KK1A 1KPHA 4RV9A 1UCRA 3ZMZA 3IKTA 3VEPA 2XASA 3A27A 2C6YA 2KIUA 1NBHA 3W6JB 3NQOA 3F8BA 1YZ3A 2GZWA 2LNBA 4ZH4F 2IA0A 2MD5A 3CKKA 3P7NA 3KR9A 1T43A 4QLCU 3PX3A 3LCCA 1XB4A 5K0FA 3AAFA 1G3WA 1MGTA 2PXXA 1L3IA 4QVKA 5HIIA 1FJXA 3HTXA 4L0ZB 1FSEA 4GCVA 2OO3A 5EGSA 4MEYF 2ZBPA 3EUHA 4KNYA 2B78A 1PDNC 2MLGA 1EQAA 5H20A 1JQEA 1FPQA 2H6BA 5E1MA 5LHHA 5LGNA 1L1EA 3T7SA 5GM2A 2GXGA 4HG2A 2IPQX 2JPCA 1Z6RA 1QANA 4R8HA 2AOUB 3GGDA 3R6TA 1BI0A 1IN7A 3KCCA 3QOPA 1N7JA 3F23A 3KLOA 3KPYA 4HLXA 3EVZA 2M87A 2PJPA 2YQZA 2Z5UA 3L00A 5C9ZA 5E2BA 3E7PA 3RPQA 3WTWC 1CGPA 3DXXA 4C06A 3GEZA 4BHCA 2B2CA 3A7EA 2HTSA 3HVKA 3I5UA 4EJWA 4DQ2A 5EMJA 2C7OA 5DTQA 4P9FA 3UJBA 2NNYA 1NT2A 2ZSUA 5JUWA 3SR4A 4A0ZA 4CZZA 3TDUC 4BHPA 2RNJA 2DO7A 5T64A 1JQDA 1SD6A 2M30A 2FOKA 3O7WA 3BPXA 4P5OA 2DT5A 1XCLA 1SD4A 3OZTA 2VONA 3WU0A 1U5TB 3M6UA 4G94A 1XD7A 1VL5A 5E1BA 4CKEA 2FA5A 3KPJA 3NMUF 4KVZA 5GINE 1ZG1A 1JSZA 4FT8A 1SD7A 2P5LC 4CTJA 3BP8A 3F6OA 5JFRA 2QBYA 9MHTA 3F8CA 1F38A 3REOA 3SFZA 1S3JA 3AXSA 1IN4A 4NHJA 4ER7A 4IJAA 3TR6A 3G5LA 1DP7P 3EEYA 1QAMA 2O57A 5ERGB 5FQNA 1QPMA 2FNAA 2D2WA 3DLCA 1DPRA 2IFTA 3DMFA 3F8MA 4DNCA 3HEMA 1QBJA 3K69A 4OA5A 2FQ3A 3M7GA 2A14A 5BMZA 1ONVA 1W5SA 5DRYA 1YF3A 2PMHA 1TTYA 3B3JA 3C3WA 3QOXA 3NJRA 1RI3A 3M9AA 5K0NA 2G7UA 1UIRA 1X1AA 5F2KA 2H00A 4HF1A 4ER6A 3UJ8A 1KU9A 3BJOA 3CGGA 3Q7EA 4GOND 2PWPA 4LG1A 1ON2A 5FB2A 2WK1A 3IRQA 1RI4A 5CJ9A 4O5VA 5LLQA 2YXLA 1J0RA 3ZMDA 3QPHA 3EMDA 2ETHA 3HA3A 1D2HA 2X4HA 3FRIA 3CO7C 3V7SA 3GFIA 5DX1A 2QWWA 2P8TA 2LSOA 5J8FA 3HHGA 3BOQA 1BBYA 3FPEA 1KU3A 3COAC 3LDGA 2CKDA 3UFBA 3KPUA 5CLSA 4HX8A 3NDJA 3CUOA 4PGHA 2VN2A 3C6KA 3E6CC 5E1OA 4RGSA 2HZTA 3E6MA 4I98B 1QAOA 1G6NA 2DTRA 2Q2EA 1AQJA 3TM4A 1XCVA 4ZZDA 3DUWA 2PJDA 3CUQA 3OV8A 3P9NA 5FLXZ 1OYYA 4E2YA 3BT7A 3V8KA 1X1DA 1XGMA 4MQVA 5M5BA 4FT2A 4RX1A 1MJFA 1JQ3A 5KVRA 3F22A 4X60A 1VQ1A 2DK8A 5U4XA 4QQKA 4H0EA 1D2CA 5FADA 2AXLA 1P4WA 3HVHA 1ZREA 3CLOA 4KN7X 3G89A 1QNTA 2O03A 5EHGA 1YFJA 1K79A 3RYPA 3PS9A 4MTEA 4OMYA 4EVIA 1R5GA 1TW2A 1UB9A 4DCGA 5T6BA 3RDIA 4MQ4A 3ZN1A 1P6RA 3GRZA 1S29A 3ABTA 3KQYA 3GCZA 3TKAA 2XAQA 3KZZA 3O31A 4A2UA 2F5FA 2XYQA 4AIJA 5DWQA 4G9YA 5K0LA 3TOAA 3KP6A 4UOEA 3T5XA 4U7TB 5CCBA 2DQLA 1B42A 3RYRA 2XRNA 2F5EA 3J81K 4ESJA 4G6QA 1QAQA 1DUXC 3QRFF 2L4AA 4A0XA 3U1DA 1IN8A 3E3VA 1G55A 3IC7A 1YO5C 4KW7A 3EYIA 3T8RA 1FP2A 4WWCA 5LGTA 3ELUA 4N9IA 4YMGA 1INLA 2PGXA 4PYIA 3ME5A 5HZMA 1XTPA 2I7CA 2HTJA 2AVNA 3L2CA 2P8JA 3KETA 2VT2A 5BQTA 2XYRA 1C0WA 3JAMZ 3ECOA 2PI0A 4HH4A 1B9NA 1O3SA 5CD1A 3DXZA 2VBYA 4A6DA 1SAXA 5D4SA 3V97A 5FO5A 1HSJA 4PIPA 4N9HA 3M6WA 2IT0A 3B3FA 2YX4A 2MH2A 1NE2A 1VP9A 1ZAOA 3U81A 2E7XA 3T7TA 2E1NA 4CTKA 2V7EA 4MGRA 4LG0A 1WY7A 5HILA 2EV5A 3OFJA 3KKZA 2BE5F 3TQSA 3K1MA 1FSHA 2BYVE 5BP7A 4YG2F 4WK8F 3L09A 5DXAA 2GA1A 2ZO4A 4UHTA 3ORHA 1WXXA 2Y1WA 5KQSA 2XKPA 2EV0A 3T0YA 4ENMA 4DQ0A 1XSDA 4K2EA 2GIVA 3WTTC 3G5TA 3PQJA 2ZFUA 4QVGA 3TO6A 5KS2A 2PX4A 3DKWA 4HZFA 1WG8A 2IA2A 2HR1A 1F4KA 3B3GA 3HSEA 1O3QA 1MZBA 5CYVA 2DPDA 3E05A 1DUSA 3KQWA 1I6XA 5CVUA 3MZYA 4DMGA 1KGSA 2G9WA 2KJBA 2F8LA 1RIOH 3N4MA 1K6OA 2IH5A 4PDKA 5LQUA 3FHZA 3HCCA 2GQQA 4OIPF 1JE8A 1R00A 4Q5SF 3F6VA 4EV0A 2AS5F 5HVQC 3SVZA 2DQRA 3BGIA 4M9XA 1REPC 4WF2A 5D8LB 3NWBA 4KRGA 4QQNA 2HWVA 4M6YA 2R6ZA 3P97A 1NW5A 2ELHA 5F2OA 3GFMA 3RTRA 2OPBA 5HLGA 3RI4A 1GHCA 1G4DA 3MB5A 1SD5A 5FHQA 4C07A 1Y8CA 1KPIA 2LD4A 2V6CA 4KYWA 2Z6AA 1MJ9A 1QQIA 5DTRA 1WWXA 2YUIA 4BP3A 2VT3A 5IT9Z 1R5HA 1T0FA 2H94A 1OYIA 4BQAA 4XSXF 3ELWA 1BM9A 1X1CA 2XYVA 3HOSA 1OPCA 5D5XB 2PKWA 1EG2A 2CW0F 1R58A 4YUWA 4YFXF 3R0QA 2PQ8A 4AD9A 2ZZNA 3A25A 1YS7A 3VYWA 4WXDA 4L9TA 3PFHA 3ZMSA 1FBQA 4FX0A 1SQFA 2DFIA 3B5IA 5H6RA 4BP1A 4HQMA 3FWEA 1IY9A 4RTSA 4X1OA 1X1BA 2NYXA 5BW5A 4OX9Y 3GWZA 3NVMB 3MTEA 2ISZA 2ORED 5DTMA 4AX8A 1Z6TA 4IRGA 1SUIA 5HIKA 3G2MA 1MDMB 3VODA 5E9WA 2M45A 1ZQ9A 2G8NA 1M0EA 4UUVA 3EVGA 4OBXA 4PYJA 3DR5A 4RSRA 5JR3A 4HA8A 2OBFA 2NRAC 3ZQ7A 2VDVE 3E23A 1KYWA 3M6XA 5E9QA 3CO6C 1A04A 3WGHA 2X0LA 1YQAA 3R3HA 3U9GA 3Q9VA 1VIDA 3BGDA 1R1TA 3NDIA 2GWRA 2OB1A 4RWZA 5DLYA 5ICCA 5HDGA 3QU3A 1QZYA 2PBFA 5IT3A 4FX4A 3PFGA 3ELYA 2FBKA 2P6SA 2HYFA 2XAGA 1D8KA 2A69F 2MC3A 1HW5A 2P3QA 3CCFA 3R24A 4R8RA 3HVJA 5DUIA 2A68F 3FPHA 3HA7A 3FTDA 2PV0A 4HW0A 1VE3A 2EWNA 2OBPA 4IXAA 5LHGA 4KIGA 1HNNA 1L0OC 2GPYA 2JJQA 4P96A 4RYLA 3ML6A 5AIPA 2R7DA 1O54A 4FSDA 4PYQA 2VBWA 3BGVA 2OQGA 1WSUA 1G6Q1 1FBNA 5HS9A 1IN6A 3R9XB 2Z33A 2CYYA 2OU2A 1KQ9A 1T38A 2HGCA 5HS8A 3B7PA 3TRKA 4HV5A 2H6CA 1KU7A 3V7CA 2ZIEA 2IBTA 3AJDA 5FTWA 3HM2A 3ERCA 4RB1A 3K6RA 3DV8A 2Z99A 5E2AA 2FHPA 3FX3A 1HBXG 2FMLA 3ZMTA 5CIYA 1K78A 4L9JA 2O6GE 2HV9A 3BDDA 4M6XA 5HDNA 1JTFA 4B09A 2W84A 4PYLA 4L0YB 4M72A 3BJAA 2XROA 4HDUA 4KIBA 4HGZA 4OA8A 4XCXA 3ELDA 1STZA 4P7GA 2C7PA 4QWQA 1O7LA 3HRSA 4PYKA 5EKXA 1YYVA 1FP1D 2A61A 5ICFA 3HCEA 2ERCA 4YUVA 1B59A 1J59A 4LWOA 4AZTA 2Z6QA 3A26A 2EFJA 1LB2A 3MWMA 1XDZA 4LLGF 2P7HA 3UBTA 5E8IA 5DUKA 3THRA 2JSCA 3OOPA 2AOTA 2G71A 2DI3A 3MQ2A 1VP3A 3C3PA 4GUAA 2FRHA 1KR5A 3LL7A 5K0EA 3BJ6A 4S05A 3BWCA 3TO7A 4HGYA 5ILSA 2ZBRA 3Q9SA 4P55A 1P1CA 2PX2A 4C05A 5EC8A 2H1RA 1Q1HA 3MZHA 1Z91A 3S2WA 4CKCA 2LKPA 3FPFA 5H02A 4LD5A 5FQOA 1P4XA 1R8YA 2AOVA 3LHDA 3HSFA 1Z9CA 5DM4A 3T1BA 1JTEA 3Q5FA 2ADUA 1VTNC 4U0YA 1W7PA 1JR4A 3GO5A 1U5TC 4RTOA 4FT4A 3KP3A 2O0YA 3SSNA 4GBED 1G3TA 2PG4A 4HQEA 1RUOA 5HLHA 1NW3A 3LCVB 3JW4A 4LECA 4E2XA 4ISCA 2NNNA 2QVOA 3TFWA 1R23A 4MTLA 4QPPA 5LQNA 3QP6A 3KR2A 5J6XA 1BKYA 5D4RA 1NHAA 3GNLA 1YW9A 2ZZKA 5CVRA 2FE3A 3SGLA 4FR0A 4FGZA 3EVDA 3KEOA 3HHHA 4L9NA 3KQSA 2YR2A 4I0AA 1ZKDA 3ID6C 1JHHA 1OKRA 3SZPA 3MFKA 5KYGA 4K6MA 3SHFA 1WQ2A 4C4AA 5F64A 3CUQB 7MHTA 2DK5A 3PB3A 4LWPA 4ZYGA 4GYGA 2BGCA 4U0WA 2W57A 3RODA 3K0LA 2AOTB 3WODF 2PBIA 2XAHA 4H0NA 3I58A 1WXWA 1YUBA 2OAZA 2MLKA 5LQCA 4BH9A 1GVJA 2UZ4A 5L3DA 1FYLA 2EG5A 5B1SA
chains in the Genus database with same CATH superfamily
3BD7A 3B89A 3FVWA 3MRSA 1KFKB 1I3QJ 1Y4AE 5F2EA 1E3IA 3DMYA 1FFDA 3BM5A 3HLYA 2H29A 3R7SA 5JUWA 1V1RB 2BTEA 4BNCA 1NP6A 2HF2A 3K0KA 3K5WA 3KAQA 4OHOA 2PA3A 2J5OA 2WP0A 4D5EA 2XBMA 1DQNA 1P19A 3GZJA 3GDHA 4PO1A 4QX6A 5A04A 4WKPA 1RZVA 4DA0A 3JAKA 3LSKA 4GZ6A 5LMNB 1JEYA 1WCMJ 3QVKA 2ODBA 4CXFA 2QGZA 3PZBA 1DIOB 3OJFA 3ELKA 3GLIE 3KEQA 1MTOA 1Y48E 3QAHA 1SKBA 1EVQA 3LP6A 4NFSA 4YQYA 4CT5A 2QQ9A 1TI7A 4FONA 1ZLJA 2G4CA 4Z0PA 3T3IA 4ZDJA 4XWTA 4L9VA 3L1JA 4GT1A 2NSDA 1S3GA 2IHVA 1NJSA 2IDMA 1GP2A 2JGEA 3RQIA 2FP4A 2A0KA 1PUJA 4OSEA 1EVLA 2VC0A 5EIBC 4PHGA 3ZBPA 3NWPA 1RAIA 5F1KA 3GFFA 3VSKA 1ZG3A 3OYKA 2W2NA 5IEBA 4LV8B 4EY3A 4ZP1A 4QT4A 5GPAA 4CKWA 2CVQA 1NUAA 5B4TA 3FNGA 5BUCA 4KDPA 3W6VA 1PJRA 3GMEA 1Q0ZA 3A32A 4F6RB 3V6LA 5CPFA 2G0AA 1AKEA 3P52A 3L8CA 2Q6TA 3C2QA 4HYEA 4MWGA 1GZUA 1RJ9A 1V37A 3ANYB 2I4OA 2IRWA 3PQ6A 2HFJA 3QYPA 2XVZA 1JFTA 5EP2A 3COWA 4J0QA 3EUWA 4MEBA 4QTYA 3JRFA 5EEGA 5LM3A 4YIIA 3D8TA 1GUUA 1QF7A 2CYAA 5H80A 4C7VA 4ZJPA 3IIMA 5A2QZ 1P7WA 4EYQA 2AN9A 3KUUA 4QYMA 1JWLA 3LAJA 1GCIA 2HB6A 1XN4A 5ICGA 3RS7A 2GN1A 4Y6GB 4CMIA 4XVQA 5CVVA 3MINB 5H3CA 4J0IA 5CA1A 2BT4A 4K7JA 5HDBB 2YYSA 3U1TA 1M83A 4OHRA 1OZAA 2EP5A 5D6NA 5CFNA 3UHJA 3KUXA 4PRZA 5K8UA 1PT6A 2IW1A 3RVDA 4AY5A 3JTGA 1USTA 2DFEA 1FIUA 2ZQYA 1WPRA 1NJ1A 4CFSA 3RB8A 3NGLA 1IUOA 2XMDA 3M6AA 1E9SA 1CJVC 1PJAA 3OG9A 3RTEA 4PICA 5KJFA 1QRUA 4HAMA 1SBIA 1W5BA 2R47A 3QUBA 2O9JA 4H77A 4O08A 1PJ3A 2VP6A 3U60B 3HDTA 4R54A 3PC7A 4BWYA 4YPOA 3A31A 1EFKA 1QO7A 1SHLA 3BC8A 2X6YA 1M1YB 5JEDA 1LRJA 2I4TA 4WWHA 1PS9A 2CE2X 1BU5A 2V6MA 1XG1A 2ATCA 2XQVA 3OPYI 5HNHA 1EUCA 4UV9A 1I9GA 4BMXA 5JS6A 1P4JA 4LRQA 3SHQA 4BFWA 3N0XA 1Q0TA 1LKXA 2VQLA 2HTEA 4JX9A 1NMYA 2YMQA 1Y1VJ 4EFKA 2HA2A 3K4LA 4ZVQA 3P2KA 2DQSA 3P9ZA 4ZFNA 2VA8A 3PJDA 4RS3A 4WV3A 5MFPA 1ULYA 2EILH 3ZV7A 4Q4HB 3E58A 3CB4A 4XSVA 3LH5A 4WXCA 1ZD1A 2UVQA 3LLVA 3DAOA 4LX8A 2Q6LA 2KPOA 2BGLA 4NEHB 3L4BA 1RYEA 4XKJA 4F9GA 3BR5A 3RVOA 5EJEA 1RM3A 4DWOA 3DQQA 4RB3C 2EAUA 2ZFWA 3ETGA 3DTVB 2X2EA 5DN6A 5CB0A 3J81A 4A69C 2O20A 1QVVA 4X63A 5IAGA 1PW7A 3LA6A 5BWNA 3UYKA 1PG2A 2PQ2A 1ZQ1A 2R8PA 3H5VA 4MDHA 3NM4A 1FTWA 1ZYRF 5FRNA 1EAYA 4MPDA 4GFBA 3T7CA 5EIBD 3WE7A 5JI6A 3DW3X 4XUCA 3U3DA 2OV3A 3B5JA 4M8KA 4AKHA 4JEUA 4R9NA 5K4HA 3EHDA 1SBQA 1QYIA 3KR1A 3Q3HA 3URKA 2QVBA 3ZQJA 1IXYA 1U8FO 3BWGA 4RFSB 1OH5A 1EK0A 3TLBA 1ODIA 2IXEA 3RKXA 3AOGA 1L6RA 2BFCA 2FWPA 2FU5C 3CR3C 4REQA 4X1IA 4M53A 5JZSA 2O8KA 2IIPA 1NW7A 3WTZA 3QENA 4RTNA 3S27A 5ICEA 4MR7B 2F9LA 1NW6A 2FMYA 1XZMA 4IDPA 4XKVA 1U0EA 3GFJA 3D4LA 3NEUA 2K9NA 4J7XA 4EMSA 4NC6A 2YDYA 3FN4A 5KTMA 3ECHA 3WLRA 2XOEA 5G41A 1BFDA 1DKOA 1XROA 3NHYA 4U00A 5P8WA 1WB9A 2UU9B 5KQLA 3NDRA 1DV1A 4OQNA 1R1VA 2GEVA 3CC2I 2VTBA 1OHHA 1W19A 3A4LA 3CLHA 3WGUA 5KCMA 4EPXA 2FEZA 3Q0TA 3SK0A 1CF7A 3OJXA 4MB2A 3L4EA 1BFUA 1WETA 3I83A 2PUJA 1EH6A 1DJPA 1Z6YA 1SFEA 1R1DA 4P7FA 3DP9A 5KNDA 4BX0A 4R2MA 3PGXA 4ICIA 3JSOA 2HV8A 2Z08A 5FR1A 2G8LA 5BN5A 2BGTA 2H7VA 4HUTA 3A6LA 1FDTA 4BUPA 2ZRMA 3EJWA 3R61A 4GOLD 5EOVA 2GM9A 3OE4A 3U4CA 4QU0A 3PNBA 1IUNA 1H85A 5FFXA 1TNDA 3EVFA 4DVJA 4HY3A 1YE9A 1K4MA 3CRVA 5CA0B 3FCAA 3I09A 4RGRA 3WY9A 1BMFA 1KFBB 2HRDA 4DHEA 2KJCA 4FCCA 5D5QA 1BRTA 2TMGA 2NS7A 3FLMA 3FH0A 4OP2A 1TKRA 3F5QA 2V79A 4NQWA 3V6MA 3ZVLA 4EG5A 4KR3A 1CP2A 1Y8AA 5DEIA 1LEBA 2MW8A 1JLSA 2J4FA 2WSBA 4IQ8A 4ZYXA 3DHEA 1D5VA 2EU8A 5KI6A 4YAEA 2Y27A 5C3MA 1SFOJ 2UYQA 3GW8A 3OR1C 3O4VA 4YCAA 4ZVKA 2Q5EA 4JBWA 1NHGA 4HZUB 5B3LA 2QRHA 3HJEA 5JROA 1F1BA 3KHSA 1WCV1 4ENNA 4XUDA 2OSBA 4G56A 2ZPAA 2IVZA 2VPIA 1PX2A 2HFHA 4R0NA 4DRYA 3ICQB 1Z33A 4EAAA 1VKZA 1Z83A 1CF9A 3IULA 4PINA 3KFVA 2Q50A 2XEDA 4V1CI 4R40A 4W1PA 1LS6A 3GTKJ 4J4TA 2A3RA 3QE2A 1WJAA 5JZOA 4YIFA 1GXSB 1W47A 3OPYB 1D2NA 4HTFB 3TW6A 3RFVA 3RIEA 2EFHB 3SXJA 3T7RA 1ZFNA 2R8RA 4F5DA 3N53A 1AWCA 1Q1NA 3RLFA 1QYCA 5CM9C 3BHNA 4CMIB 5JPIA 1HEYA 1H2AS 3OCJA 5CMLA 1W5EA 2HOAA 1W0JD 1ZONA 4NJEB 2M6KA 2OQVA 4EKNB 2D5BA 3HCPA 4LK3A 5JPDA 3ZDCA 1DO8A 1EWKA 1UBHS 2GD1O 2IYAA 3EFEA 4HGOA 4D9MA 4DLNA 3MGAA 1MD0A 2L02A 2W71A 3PIOF 1UM8A 1SQ5A 4MS3B 4LJSA 1U5BB 1XUOA 3KRTA 4DY4A 2YFYA 2B2XA 1N2JA 4IM7A 2WJPA 3Q9UA 3T7DA 1EPUA 3JCZA 1C50A 1G9TA 4PLHA 5HA5A 2IHTA 5DGTA 4DA4A 2XAAA 4EPVA 4E32A 2ZMEB 1EP9A 3KQTA 1IJEA 3PPIA 5DB4A 3WLQA 3KE8A 1OHHD 3I2GA 4Y33A 3MWGA 3ORFA 4BVKA 5IUJC 2FH5B 1XP5A 1B0ZA 4QJIA 2D0PB 3ML1A 3K4HA 5DI3B 5CVJA 4YIRX 4I3FA 2PLYA 2KLHA 2FSFA 3L8EA 1WW2A 3KCQA 1UFMA 2OZVA 4LGCA 2OA4A 2QRPA 3ECSA 3IVGA 2X0KA 1BA5A 5IAKA 4BB9A 3OOEA 4KFTA 2REOA 2E35A 2VHTA 3ENVA 3E8MA 3H11B 5EHQA 4E7OA 3AW8A 4L5JA 4C1BA 1CVRA 3HFRA 4DLRA 3A03A 1GFZA 1WQ3A 1XEXB 1CWUA 3BTSA 3MN2A 1I2CA 3HDQA 2H0RA 1NKTA 4MINA 3EZ9A 3EYYA 4FCTA 2V7XA 2DUWA 3VKHA 9GPBA 3FETA 3FZYA 2B4KA 1J0EA 1YQ9A 3HXQA 4WAUA 1ZP6A 4CI9A 4PE5B 4E6PA 1TJ3A 4IIHA 4D7AA 3H1BA 1WMSA 1ZA1A 4X7MA 1NJFA 4WZBB 4A23A 3H4IA 4KODA 4DJAA 2HU8A 2W4MA 5ALGA 3WMXA 1TLFA 4TPKA 5AVZA 3MSCA 4OBWA 5B1DA 2WQ6A 1DWQA 1WU7A 3FYUB 5H3HA 2PH3A 2E49A 2R44A 4BDTA 1H4QA 2LG4A 2E6KA 4ARUA 4CCKA 1N1EA 5JJKA 2WINI 4URVR 1HG0A 1XZIA 5I9MA 1V8BA 2Q3JA 4FFMA 2ZWMA 4WQMA 2XMPA 3RPEA 1L7MA 2CNWD 2GFQA 2VC2B 2Q8PA 3PQEA 4KLAA 1HE2A 1NBMD 1DS6A 3JQFA 2A6HF 3AHFA 3TS1A 1E2BA 4XFDA 4WNIA 4HEQA 2VEOA 5HG0A 4IINA 1F6WA 3MRTA 1LW7A 1B72B 3OQBA 1P5RA 2NMVA 1R4ZA 3FX2A 2CLOB 2OHGA 4DIEA 4WCGA 1F3OA 1NYLA 2Y2ZA 3PHBE 4LHEA 4EG7A 3DZBA 2ICAA 5BVHA 2O54A 4DTIA 3JTHA 1MC5A 3KOMA 2QROA 2LKCA 1P0MA 1VIVA 1YR3A 4EJSA 5BSTA 4FQ8A 3ACBA 3I61A 1ZOPA 1MJGM 2MABA 1IMOA 4JK1X 5LRSA 2XD9A 2XUQA 1FK8A 3R7NA 4E5SA 4YRFA 3NHKA 4TUYF 2FX2A 5HCIA 3I01A 3VTFA 5LDHA 2C9BA 2FE4A 2HX1A 3E2IA 4MV4A 4B4OA 2I2DA 5EXSA 3Q5DA 8MHTA 3C1OA 4K9OA 1T6BY 2P6TA 2A1UB 2HSZA 4ZTUB 3LVRE 1FLIA 3PPXA 3ZVNA 1B2RA 2CLHB 3ZE1B 1GKKA 2XF7A 1RXCA 3OC0A 3A9WA 3V8VA 3S3TA 3R3JA 3BIJA 3Q40A 2DLDA 4JB2A 2ECOA 1ND6A 5J63A 3KE2A 1GGEA 5ESWA 1E0DA 3W5VA 5CFLA 2JTVA 1Y4DE 2VOJA 4FSXA 3ETJA 1QTRA 4KYIB 4XDZA 5EXXA 4XGIA 1ZIDA 4C4XA 2CL7X 4UASA 1BR2A 1I10A 2XB5A 2HPIA 1NOJA 1MKMA 2YU9J 3ZUGA 4A3GJ 2BN4A 4TYYA 4FFDA 1AKQA 1NUHA 3I1JA 3MK31 2TDXA 2GA8A 1YZUA 3TNLA 4ZQCB 1H88C 3CLTD 2WOJA 1JMKC 3F2VA 2FEMA 3BH7A 4FC6A 4N40A 3JRIA 4OQXA 4QGGA 1O5IA 2PKQP 2EXXA 3A1EA 3HRMA 3E82A 5ARBA 4KIUA 1HSTA 3MMYB 2IWHA 1WHTB 2MBFA 4B9AA 3SVTA 4KRYA 1SCAA 1AMNA 1IWBB 1PK8A 3FIUA 1P4HA 3P94A 3AK4A 4BO6A 1O7FA 3COSA 2BTQB 5DX0A 4WDRA 1BXRB 1TZBA 3DBLA 1W73A 1BDBA 1W46A 3H4MA 2CT8A 3V97A 1KSFX 4DSTA 2XCOA 3EF1A 2WWWA 2WYVA 3R8XA 1OCRH 4KK3A 4EELA 1OTYA 3MAGA 3ISTA 5AOAA 4F38A 5BRJA 1JE1A 1TTQB 3DFKA 3KUCA 4Q4JA 4EECA 4HOYA 4KA4A 3RC2A 4QOEA 1RR6A 2HQNA 3DEZA 3ICVA 3E48A 4AKTA 4BNXA 5A62A 1NK2P 2QDXA 3QRWA 4BFVA 3FCYA 5LYJA 1XVAA 3OOHA 3PJGA 3VZDA 3S3OA 1QSGA 5C0OE 3C97A 2XPCA 5G3ZA 4DG9A 4ES6A 3CLRD 4L28A 5IJ9A 1X7ZA 4HZGA 2IXAA 2PJRA 2LIVA 4IGIA 5H7XA 4CQJA 2ASVA 1WWKA 5D5WB 1ZR2A 4P81A 1DAHA 3SIRA 5HDQA 4B3BA 3WA7A 3QSYA 1YUMA 1OLSB 4DZPA 1Z7UA 1SVWA 4CMEA 1JDTA 3ILSA 1JDVA 5KAFC 1G21B 3ZTTA 3HPHA 3NOQA 4JROA 2QUHA 4YRSA 4DBLE 1L1QA 4F3RA 4F2PA 5C4IA 5JCJD 2Y0DA 3N97A 1Z4MA 3UR3C 2R4UA 3G2LA 5BPIA 4B2IA 4KHPB 2IBDA 2J9XB 3ZDXB 3VWBA 3N0WA 4X20B 1DI0A 1ZH0A 1FFEA 4HB4A 1COZA 3GRKA 1QZXA 4PTYA 2ZM5A 3GMSA 3TOCA 5IS2A 1T3ZA 4BNVA 4AZ0B 5DD8A 2VKDA 2C5AA 1L5ZA 2I5PO 3KFWX 4TMFA 5YASA 3W6ZA 4CCYB 4PUSA 2WZDA 3L0IB 4ZVUA 4D42A 1WABA 1Z38A 5B5EC 1KJNA 4JBAA 3F4LA 1B0AA 2B3TA 2JK1A 3FUUA 3L1KA 3LW7A 5D6FA 2GM5A 4Z5XA 2EQRA 2V7FA 3NBXX 1C4OA 5K2MA 1QM5A 2NZUG 2BE9A 4HAWA 4I50A 4PU0A 3UXMA 4F2GA 1TT5A 1YRBA 3G8BA 1UAYA 3AV3A 5L8VA 4PBRA 3A2KA 2KJQA 3JQDA 4YDRA 1SVOA 4F06A 5IM5A 3VC3A 2Q3FA 4BTEA 1SJ9A 4I2OA 2DHCA 4GMFA 4B4CA 1UHMA 2V4MA 4FX2A 2VK2A 5L3BA 2GERA 4YCLA 2C94A 3WDSA 5C81A 2V54A 2D0DA 2BHYA 1CZUA 3BXGA 3W4JA 1TBXA 4A3FJ 4JJAA 5JMWA 4PFQA 4K0KB 3ASVA 4PWYA 4CETA 2X8JA 2P9BA 1K7SN 2CYCA 2J3IA 2RIRA 4XPIA 5FAKA 3TGNA 5TEVA 3IOBA 4D96A 3W77A 5AI4A 2RGGA 3I9JA 1PGNA 2WTUA 3MJ4A 2TMDA 2OCAA 4LQ4A 2X77A 2EWMA 2Y66A 3UAGA 1XALA 3CUQC 1SURA 2ZRJA 3D3WB 2ONJA 3K4CA 1SN7A 4XIJA 4D6YA 2AO9A 4LTMA 2XTNA 4MUJA 4Q7LA 3NWEA 2HQRA 1ZH6A 5CQEA 2HWUA 1T5HX 1VFNA 3UMSA 1T8TA 2WLTA 1EHCA 1JHFA 4LDQA 5CYPA 3DLTA 3VVLA 2E5WA 3D7NA 2E1CA 3DCFA 2HO5A 3ILHA 3SWWA 3C2HA 1WDMA 1G4HA 1VSTA 2WWYA 3MWJA 2Q2NA 5EJGA 5AXCA 3S1AA 4H3KB 4DTCA 1JJ6C 1XZBA 2CH0A 1JR3A 2XUDA 3QW4B 1O3RA 1E61A 5C46F 2QTGA 5CNJA 3TF5A 3MMNA 1LE8B 3CUYA 1TYBE 4QASA 3SMQA 3WV5A 1FFXB 2BBSA 2VNJA 4Q9AA 1U2TA 1PP8F 3ABUA 1EX6A 5E0OA 3RNLA 3TRJA 1XRSB 1YDEA 3AR2A 1BI2A 4HCJA 3RRNA 4CO8A 3R3VA 2QRGA 2CUFA 2ZUBA 1BO6A 5K5OA 1BS9A 3DCYA 4E3ZA 4MKRA 3WZ2A 3CN7A 2K4JA 4RA9B 4AJOA 1RHRA 2QTVB 4OSPA 3ULQB 2PO5A 2RQPA 1USKA 3UV7A 2WFMA 2BEUB 3RANA 1QIEA 4IO9F 4GXOA 1Z75A 2M2EA 1CR0A 1OT5A 3A1UA 3AHIA 3ZZTA 1AHIA 5JNUA 5ALIA 4NF2A 2BEVB 3PFIA 1NBEA 1LPMA 1K98A 5JU6A 3G6EI 2J3MA 3TL3A 4RFLA 2VEDA 5IN5A 4CCWA 2O05A 5HF6A 4D4GA 1IY0A 5K5EA 5JJIA 1LB1B 1U0HC 2N8GA 2P9EA 4IQFA 4MS3A 1F3LA 4OF4A 1CIPA 4A8HA 5I7EA 2H07A 4OI4A 2YV5A 4X93A 2YDXA 3O1JC 1TZ2A 1VQ6I 3IAHA 2G9UA 1NV8A 4PW0A 4QYXA 3N86A 3L9FA 2X1EA 3W2AA 2BGJA 3OX4A 5AK0A 3PO2J 4GDMA 5FO0A 3S1NJ 2ZT8A 3RHZA 4U4AA 1O87A 2P27A 4QA9A 5A2QA 3IJ5A 2GBCA 1R4NA 2R5ZA 5B1EA 1XRLA 5GONA 2XBUA 2B61A 2VXDA 3JZFA 3U7QA 5IOZA 3CPHA 4LGWA 2HK9A 4U87A 3Q5GA 2VUTA 3AWIA 3TVYA 3V8NA 1O6FA 4H1TA 3PXAA 1JXOA 2C03A 2P2YA 1A2OA 2VZEA 3L46A 3PUIA 4TRJA 3FK7A 4WOPA 4URZR 5J5AA 2DH5A 4IO0A 5B1IA 3SLGA 3SJBA 4OQZA 4M9RA 5C1IA 4P34A 4B0OA 5KJCA 2JL1A 4DQ0A 4X3CA 5IARA 2RGNC 1JPVA 2Q45A 4PN3A 3N2KB 2O3UA 4KO4S 4UOZA 4UVAA 2PWYA 4B3MB 2FUKA 3GRFA 3W5SA 5BWOA 3FXRA 2R7TA 1PGJA 1XYGA 1SPBS 2JJ2A 1Y1KE 3CCYA 3CNLA 1MT0A 3QIAA 5H70A 4BHTA 4LLLA 4MMXB 5IK2D 1FZTA 1R1UA 2PUTA 2XOXA 5F73A 3W9BA 1CQWA 4UPVA 5C3EJ 1EWQA 1YRNB 5TF4A 2FNPA 1HURA 1J21A 3FFTA 4FLMA 3QY9A 4MLDA 3E5UA 5D1HA 3WK8A 4IX9A 3ZP5A 1W4AA 1U3CA 1DEAA 1XYVA 3N2KA 4M6WA 3G1OA 4Q9NA 1JLLA 3USES 3RIRA 1TB4A 5KOYA 2GN2A 2NS8A 1N2SA 5KAIC 1WKMA 1Q2UA 2XWSA 1XEWY 3S2FA 3DE3X 4F4CA 5BSRA 5M3MJ 1Z0JA 1QWSA 3DFFA 5ED0A 1ADGA 5LU8A 1AF4A 2NN3C 2Q4DA 1WCIA 1KMNA 1PGQA 1WZCA 2AG8A 2MSKA 4M1SA 3OQMA 2Y3IA 3FCUB 1SH7A 3E2MA 2AEFA 2MWMA 4OAQA 4CQLB 1JI3A 2G7HA 1BXRA 1NVGA 3DH0A 1ZGAA 2L7FP 2SKDA 1GV0A 2WSYB 3MF4A 3KQVA 4KE6A 5KDOA 2FDCA 4Z4EA 1T8PA 3UNXA 1M1EB 4LK0F 2I10A 4FLEA 4BQPA 3K1AA 1A95A 4C5CA 2FGJA 4COOA 2XZOA 1YS4A 1IY2A 1XELA 3K70D 1YI1A 2ZUWA 2F3TA 3D59A 2AJTA 3FZQA 4L0MA 4NABA 4PC2A 5J59A 4X84A 4UQLA 3B9QA 4BNGA 1DIGA 1WCIB 2FSSA 4FMCB 2JI9A 4LCJA 2PMZN 4B71A 3GZNA 1RC0A 1Q1ZA 1LD3A 4JB8A 1N6RA 1N2IA 4Q1BA 3O4IA 4BY9E 2OT3B 2QRLA 4PFPA 5EXDA 5FWAA 1W88B 1VCMA 2Y1OA 3D6HA 3V5NA 5KTSA 2WILA 2WVHA 5IYBJ 1JG4A 2YV2A 5BQPA 2NU9B 2IHZA 1SOWA 2HPMA 2DMRA 1VI5A 3OPXA 1Y6FA 4CQNA 3JSPA 4LG0B 1E92A 1OVGA 1QQ7A 5KHOC 2Q4OA 2ROQA 4KXQA 5DS9A 2BKVA 5JD3A 5C31A 3RR2A 4RA2A 1U99A 1KAQA 3EY4A 4TOIA 3HRUA 2GCEA 2LIPA 2VH1A 2DMQA 5J4YA 4AVPA 2YL2A 1H42A 2RV8A 1N9GA 2CFOA 2QE7D 3EGIA 3MEXA 2GKSA 3DPLC 5E8RA 3PFNA 1RM5A 1JQBA 2G36A 2IPXA 3A9RA 4YGXB 3I5XA 3WGZA 1GUDA 3P9KA 4TL7A 1OFUA 3RUCA 4ARBA 1EFVB 3BRQA 2XE6A 2J9YB 1E2NA 1OOEA 3BUSA 2XCRB 2BR3A 4OHPA 4H3HB 1U63A 1TQ6A 5BNFA 2HYGD 2OB2A 4EYGA 4X7RA 4JLMA 4IHVA 2PU5A 3L2VA 3CDHA 3HMKA 2EJCA 1E2UA 1H89C 4UUQA 2DULA 3BROA 2RGUA 5AJVB 1XGOA 5FJ8J 1C9NA 1SFXA 3LKZA 1IOZA 4PX9A 2Y68A 3IV9A 1AN0A 4LV6A 5DI3A 2QUIA 3BY6A 1SC6A 1MAHA 3TTSA 2PXAA 4OL0A 1Z05A 4J03A 4AU1A 4EYOA 3FM5A 4BQSA 2QW1A 1S3IA 3OZSA 3PEFA 3OM8A 2RC4A 4HDCA 1V5EA 2BDEA 4JLOA 1QG4A 4OGGA 5FF9A 3SQLA 3VX4A 1XAGA 1UOQA 5LMUB 1SC9A 1ZIXA 3FGZA 4TMZA 1J0CA 2NS0A 1TUEA 3L7WA 2AFHE 3BL5A 4JJEA 1M2HA 3TAXA 4TYPA 3IQEA 3SVLA 1UPTA 5AJZA 1M7GA 1U9IA 3WJ1A 3AZQA 5C5CA 3K1TA 1DDNA 2BEUA 1V54H 3BPVA 2HD4A 1RP1A 2PDAA 3JQRA 4KE8A 2P5VA 4IWNA 4TUYB 2NU8B 1XEFA 1HW1A 2QTVA 4FR5A 4IHJF 3C6YA 4KYTA 4N82A 4E4TA 4ABTA 3EEQA 3AVUA 2H85A 1R0WA 3V4GA 2JKYA 2OV6A 3KSZO 4XEHA 4HSRA 2JIBA 5ERXA 1KC1A 4BASA 2QDKA 2GJ4A 2WFLB 3FNRA 4C87A 2JHCA 5MN5A 1PVEA 4C0SA 1WRJA 2XVAA 2H31A 5FD8A 1GXQA 2MU1A 3HCFA 2OCIA 3VPDA 2V55B 5H6QA 2ODWA 4M0LA 4FGSA 1BXGA 5D7NA 4A0RA 4DB2A 5HRCA 1E98A 4LLNA 3AZPA 3O8GA 4YT4A 1A97A 1XZCA 3LPAA 2O2XA 4PCQA 1E9CA 4IV8A 3OMYA 4QO7A 1NVXQ 3MN1A 1DAIA 3FUVA 4QRHA 2QY6A 5JFTA 3DVAA 3B6CA 4ZMBA 1UMKA 4F86A 4KUEA 4CA0A 1NURA 1UDCA 1PK7A 3DF9A 1RJ9B 3DQZA 2ZIZA 3KQPA 2HNHA 2AC7A 4K9NA 4WA7A 1LX7A 5H9WA 3O3KA 2LDUA 3R6LA 3ZWYA 3NHJA 4ABZA 2HMUA 4ZKDA 2AHOA 4JX6A 2DSNA 3K0HA 4PC7A 4MWDA 1GAEO 3H3ZA 4RCYA 3DVQX 3KOZA 4NX2A 4TWBA 2QT1A 4G09A 3TNJA 1FMWA 2NXJA 2R8YA 4GECA 3M81A 5EIWA 3LQQA 4D9KA 1QS0B 1CQJB 2G0NA 4WH0A 1F0YA 3IHWA 2I99A 1FNNA 1X94A 2CN1A 4KR7A 1Y3AA 3V8LA 4RSMA 4RABA 3QLUC 1NN5A 2F1KA 1UT6A 3E9MA 4E21A 3RREA 4YUXA 5KVAA 3RVMA 3T5AA 2ZBDA 1OXVA 4JXZA 3FA2A 1SBYA 2QX9A 3DL7A 4EB3A 3H92A 1W5TA 1M67A 3LKDA 1DU6A 1IEQA 3O8OB 4PCVA 3IJRA 2YZNA 3C24A 2X2OA 2JCSA 4JH0A 4B6FA 2QN2A 4X64B 4YX9A 1D6MA 5I7WA 3BSWA 3AU9A 3SYMA 1ID8A 2X8WA 5JJLA 2STWA 3V2HA 1K3UB 1G5QA 3FXQA 1HW2A 1AUQA 1J0BA 1JG3A 2BDTA 2DQKA 3CEPB 3DT9A 4M38A 3L7MA 4MRMA 2WBLC 4R8KA 1K89A 1PV2A 3RH0A 3EDOA 3JYHA 4ENSA 4REOA 3T3MB 1NXVA 2QD5A 4WNCA 4FMDF 1HDXA 3VH4A 5IFLA 3DZFA 2J0UB 3O8OA 4E5VA 4EF5A 3HUGB 4TV7A 2DJ5A 2LGJA 3O9ZA 3GVPA 4IVQA 4RULA 2XGXA 3SBEA 2RHDA 3VTKA 1WMEA 2IHJA 2ZREA 2AJCA 2ECKA 2X4LA 1RKXA 2NNWB 2PLRA 2MOKA 3BJMA 1UWKA 5IT0A 4BO3A 1BHQ1 5AXBA 1OQAA 3H8WA 1CQJA 2NSHA 5T4FA 3C3EA 3F1KA 3G17A 4OH7A 5FORA 4Z2YA 2A07F 1A5TA 2UZAA 2B9SA 2FG6C 3UJHA 4B17A 4RD3A 4BAGA 2FQ4A 3H6KA 3I4FA 1FNBA 4GOOD 3E7XA 5JSQA 3OZEA 3RRMA 2XWJI 1XDDA 2YC4C 4RIHA 2VI6A 1A2QA 3PHCA 4RTJA 1XPJA 1X2EA 2ZUEA 4US1R 1FTZA 1E3WB 3TLAA 1I1OA 1RPTA 3GLVA 1U0SY 2ZSJA 4LKOA 1XOIA 5TJJA 2V7BA 2VJOA 2YS6A 1PZGA 5FV7A 1L8QA 1M72A 4RV4A 2HN9A 1GTSA 3OR2C 3AM4A 3EIWA 3VTZA 1QYRA 5DCYA 4ZOLB 3F3YA 4ZTBA 3WLMA 2R7WA 4L8LA 3IQFA 3VR4A 3VX3A 3G82C 4DLSA 5H8WA 3LCUA 4WOCA 3CUWA 2C2GA 1KU6A 5D00A 1YQWA 1MP0A 3GRVA 4IIEA 2JA2A 3J7AO 3LA8A 4MJ3A 5IC6A 2NG1A 3P20A 2QKMB 1WZEA 3DTYA 1EJ0A 3BILA 3DDCA 2ID6A 5TIIA 4HWSA 5M3BA 2JA5J 2DFNA 4PTZA 3SHVA 4F56A 3CJNA 4LBWA 1CQXA 5TS2A 2VOOA 4AF6A 5CG1A 1A1SA 1NKSA 5IFKA 3DLAA 3T5PA 2JLSA 5EZ6B 4P4LA 1OU4A 2OOKA 5HIJA 16PKA 3K5PA 1N0WA 1YKFA 2B3DA 2COMA 4HB2A 5F9MA 4D9EA 2LKSA 2ISCA 2ICWG 2V1DA 1JT9A 2CHVA 2QY9A 2QMOA 3A6DA 5AT1A 4U8HA 4B6OA 5I3ZA 1XX6A 3K0FB 1XDUA 4DV3B 4RHFA 3SSOA 4A73A 3GLFA 2CUNA 4MYRA 2C61A 1TVMA 1X7YA 2BF4A 2E3JA 3A6GA 4ZQIA 1EP3B 4BV8A 3EC7A 1N2CB 5IJ0A 3ZWQA 1VPVA 3I1FA 1X19A 1U7DA 2BZ0A 2QRKA 2A1UA 3HA5A 3WSTA 2CGPA 2AX3A 4NJOA 1W0KA 4KMRA 3M5PA 4CKEB 1H9BA 3RS8A 3AL3A 1JQLB 5EHIA 1QDLB 2YWXA 1JIIA 3DS8A 3OT1A 3KP4A 3DPUA 1ORRA 4U2DA 4NCAA 2BBOA 1I1GA 2QOEA 3FIWA 2NO0A 4U6QA 2XRYA 4Z9AA 1M6VA 4DA8A 1NJ2A 2CG4A 1P80A 2OV2A 3G9TA 4BDSA 1WMAA 4CMGA 4YCSA 3H11A 4PSKA 2XB4A 3ZQ4A 3OYIA 1N5IA 4MR8B 1OXTA 3EDRA 3HVIA 4EHHA 3OPNA 3RVQA 2MINB 4DE5A 3SBDA 4BXUA 1TWGJ 1VZ3A 4MITA 2H1FA 5K45A 2FQXA 1FZPB 3KVRA 2HDCA 4QWWA 3GXBA 1YS6A 2HEGA 1NI5A 1RWXA 3EA4A 5HF5A 3SDGA 3GLLA 1W0JA 3JVDA 1WR8A 4MKFA 1DFGA 3IKLA 1Q7GA 4Q3KA 1IBCA 2O2SA 2P7IA 1OX4A 4O2AB 4RVCA 2VTKA 5EVJA 3TDMA 1NM5A 4HGQA 1KZ4A 5FDFA 1KC3A 1JAIA 2LUOA 1TNTA 2P4UA 4LJ8A 1WBBA 5KKAA 1U1EA 1PGPA 1XN1A 2BMJA 2W00A 1E18A 2QORA 3AI3A 4QEDA 1BH2A 2BONA 2XCLA 2N1BA 1N4DA 2POCA 3UJ9A 5HHTA 5L6MB 3ZXUB 4DAOA 2X0EA 1YIDA 2REQA 1RHQA 1DAFA 1QIIA 2R5WA 3D6AA 3PQ8A 4BLTA 3ODPA 1ACLA 3AF4A 3SQWA 3ZDDA 3ERED 1MNDA 4TKMA 3T5TA 4NBNA 1FNCA 4Q48A 3VU9A 1KI7A 3Q3VA 1CNEA 2JCXA 821PA 2DPUA 3LQRA 1BYUA 3ZHQA 1VSUA 4DKJA 4J7CA 5AKEA 1L7RA 4Q9DA 5LEKA 3K2AA 3GJ7A 3SDBA 1D6JA 1MJBA 1FF9A 1JZTA 2ES4A 1G98A 2E4ZA 3ASZA 1SC7A 4U2BA 3WMGA 4ZYEA 1CUSA 3D5RC 4O5OA 2HQSA 4L3OA 4DM4A 2FZ5A 1JILA 4LOKA 4FZJA 1BQEA 1IOLA 3PVCA 1PRYA 3WIEA 1V1RA 3LP8A 4FBMA 1AE1A 4OQFA 4PY2A 4QOIA 2ECPA 5IJWA 2P7VB 4DQUA 1SHTX 2WF5A 1QVZA 4DV5B 1QIMA 3AWDA 2QRJA 2PGJA 1BZYA 1L8OA 1XKXA 3ASNH 1Z9BA 3OM9A 4FOTA 2A0XA 5FKLA 4M2LA 4N0DA 5HEKA 5FTKA 3ZHCA 2XDQA 3RRBA 4N8EA 1S9DA 4UVHA 2FEPA 4RJIA 4A5SA 2TCTA 2P4SA 1N5DA 4JBLA 4E2ZA 1WVGA 4IMPA 3PDIA 4X41A 1E4YA 1I36A 3ND6A 1E3PA 1PJCA 4QUJA 4Y98A 1EXWA 4DWWA 2PV7A 3AGPA 3O95A 2WWFA 3QXSA 1UOOA 4K9SA 3TLMA 4FWIB 2J3DA 1QBKC 1QFZA 2X8BA 5I01A 3HBJA 1SOAA 3GTLJ 1XEWX 4JIMA 4DGSA 3DPTA 4N9WA 1Y82A 2C9MA 2NADA 2WD8A 4M3GA 3PNLA 2YS9A 5EZYB 3ZXIA 1YVRA 4YV0A 2K7FA 1KHHA 4ODIA 1GVNB 2BW3B 2PX5A 2QJWA 3N1UA 4NC7A 3ZV5A 5BN4A 5JOQA 5EYPB 3ZKAA 4RDXA 2V4UA 5K4AA 4JQZA 2AXPA 3EXIA 5TJHA 1SHUX 1HA8A 1Z0KA 3C6XA 1E5TA 1K6JA 1KR2A 4HQLA 2I71A 1LDEA 2ZG6A 3NBAA 5DYTA 4BUCA 4C7KA 1V4NA 3FKSA 1SK8A 4EATA 5I7VA 5JD6A 3UFXB 2Q0HA 4TV9F 4IH9A 4URXR 1XZDA 3H5WA 3N2YA 5JHHB 4N7RA 1MIOA 3MJFA 5BOXA 3QVMA 4Q3AA 3A4CA 2WZQA 2X7HA 1I14A 4DPLA 3BBPA 2ISYA 2MSNA 5M5WJ 3JQ6A 3ZBQA 4R1TA 1KEEA 1UJ2A 2D2FA 3BVPA 4DYHA 4N5IX 1E9AA 1D2GA 3AM5A 3U3MA 3UJCA 1ESCA 1VKOA 3BLYA 4MS4B 1TL7C 2IWRA 4HVCA 5IG2A 2Z2JA 4PEVA 3RS4A 4EHFA 2G4VA 2R6FA 1T0PA 1WXQA 3D81A 1VPTA 4LZAA 5A4MS 2CW5A 2FEOA 2KMUA 1DAMA 2CXHA 3CSDA 4NJMA 3SXPA 3CDIA 1Z36A 3TG2A 1TNSA 3HBLA 4AF7A 1MAWA 2IOFA 5GIOE 2DPHA 2PSJA 4CMKA 4G2TA 3HNOA 1PKEA 3L2WA 5B3SH 2X8JB 3HPQA 3P2OA 4MKZA 5HKOA 2LNDA 3LA3A 4HZUA 5EZ5A 1QE5A 3H9CA 4F85A 4ESEA 2PGAA 2DWCA 4DQDA 3NEYA 5FHRA 1UJCA 2BISA 2IXTA 4HDMB 1DCKA 1XXHE 4MSUA 4O2LA 1TJYA 4B7XA 4R9SA 3KV3O 3UIEA 2IY7A 2M7BA 2ZI4A 3GA5A 3TUIC 2JLCA 1Z73A 2XA2A 6REQB 4XZ3A 5AVXA 4D25A 2QLZA 3P2YA 3Q87B 1JWAB 3BCSA 1QRRA 1N9KA 2M9HA 2XZPA 4YFNF 4CV1A 1RI2A 4FGJA 1U2QA 1SVLA 1I4LD 1XYYA 3IQWA 3V8EA 5E6UB 3A9UA 4Q1AA 5E7QA 2BSQA 1CBUA 1LPOA 2JZYA 1JH8A 5DCFA 3WLPA 1GA4A 1X0XA 4D8YA 1WTCA 1MMFB 3L0BA 1DSSG 3RJ9A 4NV1A 6CHYA 2O59A 1BXGB 1RUNA 4OBBA 4P93A 4C7JA 4JXXA 1BOAA 1O9HA 1XU7A 3M5CA 3P5BA 4LWZA 4QGAA 4AZ0A 2JUGA 4UXIA 2KKOA 2JBHA 2RREA 1XCJA 2SECE 5KSOA 4GOMD 5F1RA 3LVQE 3ZRGA 2HLDA 1U3DA 3C8UA 1MGPA 3KELA 3L8MA 1XAIA 3GUDA 1YRLA 4M0DA 3FD8A 3DOUA 1N78A 1M75A 1QTNA 4RGQA 5DSXA 3WXMA 4PX5A 4XQGA 5K6RA 2L2OA 2K27A 1TCCA 4HNUA 1NONA 1M7HA 1X3SA 2KBEA 2PCJA 2UZ1A 1T0IA 4PZEA 1U6GA 3T7JA 1XNGA 4WFKA 2BI8A 4O2BF 5CNIA 3VTAA 1HNZB 4A5NA 2XF8A 1UFOA 3CZ9A 3DULA 2IXBA 2J48A 1EFUA 3G1LA 1PEDA 5K6TA 1ADBA 1Q7RA 1WEKA 1SU6A 2GCGA 2HJRA 3GP3A 3HO8A 4L5IA 1IM2A 3ZQKA 1A5JA 4KR6A 5KNLA 1QZZA 1W34A 4YJ3F 2D1HA 3GLUA 3PGLA 1T2DA 3Q3IA 3T99A 1BIBA 3JX9A 4ZTJA 4FFVA 4ZCSA 4DEYA 2YSRA 5BQ3A 1GPKA 2BEWB 3EULA 5E6SB 2CNOA 4RJKA 2XDWA 1OZHA 4BAYA 4IGFA 3ZW7A 1HTTA 2F59A 3ET5A 4BO7A 1ACJA 1KZGB 2MYTA 3VOSA 4MH0R 2OUKA 1LDJA 3NTXA 4DADA 2IPLA 4P2BA 1YIOA 3IO5A 3L82B 3VR3A 4B74A 5C1BA 5DRTA 2AJBA 2R6AA 2RH8A 1JEQA 2O3JA 2WPDD 2QN8A 5LFAA 4GOJA 4HR7A 3S8EA 1TZJA 2GUGA 2UXCB 4K6KA 1AZSC 1KI6B 2QZJA 3KE9A 1NVBA 4UDOA 3M4NA 3H2SA 3PFFA 1YDWA 3JQBA 2P5KA 5FGMA 2GUWA 2QT9A 5JD4A 3K9QO 2EX0A 1IULA 2RJOA 4MQ5A 1E3WA 1V71A 3CP8A 2M4GA 1A4UA 2CVOA 2PRKA 2FBHA 2XV1A 3LYUA 1OLXB 2D8MA 1D9ZA 1Z16A 1YX5A 2CFIA 4S0ZA 5E1WA 3D7RA 4BB5A 1EH5A 4UEKA 3F3XA 3HKZN 4ZCQA 2W83A 4XLLA 5FTMA 4V38A 1IUKA 4LS3A 2NT3A 2OYCA 2GWHA 2EZ8A 1CD5A 1NIJA 2RI6A 1XSEA 1V39A 5EJMA 5BV1A 3HCAA 1TLTA 6ADHA 1AXRA 4N6GA 2ZW9A 1EYZA 2V1XA 2GI4A 3RSFA 2P6OA 5A5FA 4K9RA 2GT1A 2NUPA 3GV0A 3M9LA 5SZKB 4UTVA 2H1LA 4ZYDA 2IGKA 4I9FA 2JPBA 4BATA 3QQAA 2D1YA 2IZ5A 3HDVA 3ZHRA 4NK5A 2M0CA 4IH4A 3C14C 3VOTA 1KAMA 4I4NA 1V95A 3ZHBA 2NUAB 4Q7JB 3OYEA 1NQAO 4D46A 1UFKA 4NUBA 2HU2A 4E6KG 4C7MA 4F7WA 3TINA 2C29D 2XMRA 5G0TA 3EX7C 3KZYA 2CJWB 2OGUA 5FB3A 3AG4H 3VKFA 2P40A 4M36A 4LJ7A 3IILA 1H1DA 2GKOA 4N47A 5EJ8A 4LJ6A 1II0A 4CODB 3BTUA 2DEUA 4WJKB 3QX3A 1J75A 4V0RA 4WXRA 4ZAVA 4BVEA 4CM4A 2DU9A 4NNJA 1P61B 2ZSHB 1T2KA 1W29A 2F7SA 1SVIA 2IZ6A 2W4IA 2IGNA 3EG9B 2W5UA 4U7PB 5LOVA 5IVKA 2PT9A 2R62A 4UBMA 5K8VA 2AWOA 3ZYCA 4DDTA 2P7CB 2Y99A 1XWIA 1UINA 4NU8X 1F7UA 2Y8EA 1QO0D 1XCBA 4AFNA 1JA9A 1RI1A 2Y1LA 5EHNA 2YXDA 3W2GA 5HKBA 2JD0A 3HC7A 3OEWA 5TARA 2JJMA 5LVAA 5HNKA 4BRUA 2VUIB 3NIFB 4M86A 3QE3A 4JDPA 3CLRC 4P38A 1L7XA 1RQXA 2JCYA 3T7EA 1U28A 2VJMA 4X1YA 1KHTA 3WE2A 1SKYB 2CHQA 4OU0A 5J1UA 3DF8A 1MBHA 3RT1A 2VSXA 4AK9A 3IQGX 5A5EA 2WV7A 1PYOA 3EPRA 4QARA 2BGNA 3NXKA 5D3QA 3V8MA 1GZSA 1LBSA 4D4JA 1ANKA 3JALB 4ZC3A 4X66B 2FA9A 3H18A 4L27A 4YNBA 2DUNA 1JU4A 3LPCA 4KQXA 4UE3S 5J2UA 1N3LA 3PUHA 3KXIA 5LA6B 2ONZA 4R9RA 5KTYA 1Q16A 2CQQA 4A1FA 4YUYA 1YT5A 3GHYA 1AGXA 3CTPA 1VF9A 2O0LA 4OU4A 5CK4A 2ST1A 2BI7A 3DWFA 2BOLA 2JJ2D 3ZMVA 3D6FA 3J7TA 3VMFA 3A1DA 1PDOA 4ZYHA 1GUYA 2FLKA 2O07A 3EVCA 2M4KA 1O08A 1ZJ5A 3OUTA 2DOFA 4RSHA 4M4SA 1ZZGA 4NONA 5F1PA 3B38A 3D0SA 1A76A 4EM1A 1EM6A 1RWMA 3GELA 3BWXA 4QQ8A 4B6SA 4ETNA 3QWLA 4RZSA 2B1QA 1F8YA 2BUAA 2ZIAA 3PXXA 1C8VB 3A10A 4XUGB 2EJVA 4ZCIA 1YBAA 2WJJA 4OIQF 3I6IA 2NZYA 3C4JA 3L93A 4KLCA 1E2PA 3PIRA 1I3CA 1KZYC 1UMCB 3WKDA 4BLQA 4EB6B 5JH7B 4II2A 1DTSA 3PLAE 4JSRA 2QMZA 4WKBA 5FNVA 2QGFA 3DEUA 1JSRA 1W49A 3B6JA 3WGOA 3OICA 3NHMA 4YRLA 2NYAA 2QJTA 4KSBA 4FASD 3K5IA 2UZ3A 5HZGA 3ZHVA 4GIBA 2JKZA 4Y67A 4KWCA 2PQ0A 2GK7A 3F6EX 4DZZA 3TQTA 4HLUC 5JS1A 1W52X 5CNMA 2OWEA 1GPNA 1EQUA 4FI3F 3SHTA 4KWHA 2NUTA 1MUUA 1M1UA 1T3LA 2YJ3A 1W7PB 2ZTSA 2GN0A 4M3BA 4DMCA 2Q7OE 2B83A 5B57C 2W4SA 1S2LA 4LSGA 5DBEX 2VJMB 5LJIA 1LSUA 3GLRA 4AMGA 4AJEA 2V6IA 1R9JA 2R79A 1SWVA 2Q2QA 2QI9F 1N92A 1JZSA 2KQUA 2IE8A 5ALFA 3SF8B 1PP4A 3R7BA 2LLKA 4K05A 4LDAA 5JAPA 2FPWA 1IK6A 3WLFA 3ND7A 1B8OA 3DWLE 4ASNA 2OV7A 5INTA 3BXZA 4MGIR 1LQ1A 2KIFA 3PHJA 4C0XA 3JR7A 3CNHA 2ZRNA 1WI3A 2GD0A 1E3LA 1L5KA 3R4CA 5JH7A 1U7HA 3LO5A 4RY8A 2ZJ4A 2Q2VA 5IDQA 2EFDB 2FI1A 3WJ2A 2X41A 3STWA 4IPAA 3P7MA 4N3AA 3HKDB 4KIWA 4AS2A 3KP7A 1Z62A 2VPQA 3A37A 3QELB 1RWKA 4R1UA 4Q7QA 4WKNA 5IAAA 4QEZA 1OXSC 1XTZA 1BU8A 1NXPA 2P6NA 1MB2A 4I4CA 1NV9A 4JODA 3IUYA 1ADJA 3KWLA 4RTQA 4KR0A 3P1JA 4R0VA 3LU1A 4D43A 3BWVA 5ADUS 3RBXA 5FTJA 4P3PA 4CMJA 3F47A 1YA4A 2GILA 4X1EA 1XAJA 1FX7A 1X4PA 3KKKA 1C41A 3GZ5A 2DA4A 2XZDA 1VBFA 2LRDA 1YIJI 2ID7A 2IP1A 4GVPA 3VPSA 1SVSA 3UEOA 1P7ZA 1HDCA 3DE7X 4GE3A 2X0NA 3MFYA 1RAAA 1EWVA 2R7KA 2YIMA 3NIDB 4UE6A 4UU8A 3HP4A 3ZWKA 1R10A 4F5WA 1Q22A 5K03A 5KSYA 3HKBB 4GZ5A 5AJUA 5KREA 3P96A 2G17A 1AOYA 1NNI1 1X74A 3ZVRA 1OYVA 1E2EA 3BA6A 3W7BA 4A4DA 4DL9A 4C3IJ 1Z4NA 3TDZC 4L4ZA 2QE7A 4RV9A 4NEQA 3SHWA 4AJ9A 1M76A 3QHPA 3ZMZA 1VE1A 2Q8NA 2W6OA 4YJHB 3WGMA 2ZI9A 1X80B 2IEGA 2KIUA 4A2QA 3CMAI 1G5RA 1HH4A 2PYIA 4IXTA 1YZFA 4WUTA 4MQBA 5CW1A 4UMFA 4HX5A 1F2VA 2VQ6A 1BX3A 4M7PA 3ADCA 1RXWA 3HK2A 2ISQA 4JCCA 2GF2A 3HO6A 1HG1A 4GSLA 5GZ6A 1ORKA 2Y71A 4BMZA 1JNXX 4GMGA 5G0UA 3CKKA 5DM60 1NNEA 1HSOA 3KR9A 1H69A 1BSVA 2P69A 2Q5QA 4J0FA 3B1KA 3PKJA 3PX3A 4JS0A 5K0FA 2FWNA 2V03A 2R7ZJ 3O4GA 4G1UC 4RUKA 4C0KA 5B12A 3O9VA 4ESVA 2FUNB 5CTAA 3JCUC 4XLEA 2OO3A 3BRSA 3MAAC 4M1YA 4AN1A 1GKUB 4LAFA 1QF6A 1EFDN 1PDNC 1EQAA 1TAHA 4UJ5A 1JQEA 1NMQA 4G9EA 4WACA 4RM2A 4WIAA 5DGCA 2VJQA 4MUKA 1YJNI 4PAOA 3V4OA 3X2FA 2GXGA 2IXSA 1K7XB 2PGDA 3L3BA 4IRMA 4LYAA 4R8HA 1GGMA 1XV5A 2AOUB 3VR5D 4DBZA 1BI0A 1IN7A 3W2VA 1JEJA 1J7JA 4E7ZA 3C2GA 4J00A 1N7JA 2XMZA 3F23A 3KLOA 4IOLA 4HLXA 1K4YA 4BQFA 1A1VA 2QUAA 2KWIA 1IC6A 1HNWB 3JAWB 2Z5UA 4BQEA 3L00A 1XMXA 4B1FA 4Y0AA 5LD2B 4XVRA 3WTWC 3DXXA 4GS5A 4RJLA 1B6SA 1TF2A 2Y0SN 1Y5RA 3ROTA 1NGSA 1KVTA 1GAWA 1N2HA 2FPMA 2L0KA 3ACDA 4BKXA 3C5HA 1O8CA 3CCQI 2PZJA 4BHCA 3HUUA 4OKSA 3WQBA 1GTL1 2I8AA 3AEQA 2C9CA 1W6RA 3HVKA 2AG6A 2C5LA 4G5SA 4LXQA 2VP9A 2WHEA 3L92A 3U5ZB 1W94A 3JQAD 4JLKA 4K2HA 3CUVA 1NC1A 2RCYA 3KBBA 4UNRA 1I3MA 1Z7YA 3TL6A 4BXOA 3NIBA 4LCBA 1NT2A 2F3RA 4XYBA 3EFOB 1ZYUA 4CLDA 3E7LA 1GRRA 2A3NA 3SR4A 5A4JA 2FPUA 1ZNQO 2RC5A 3OF2A 4HDKB 2BHTA 3T35A 4A0ZA 1UJMA 4KXNA 1CY7A 3CRZA 4Z49A 5F9HA 3ZC3A 4NOLA 2HHCA 2RNJA 5F52A 1G8GA 4UVDA 4YJGB 1NTCA 3R1IA 1P4RA 1G7TA 3FK6A 4FS3A 1SD6A 2ZTLA 4YRCA 3UXHA 3TSYA 7MDHA 5FO1A 1C3LA 1XZLA 2JGJA 4M7WA 3IQXA 1V25A 1QJCA 1ZY2A 2FFRA 1XPXA 3QSGA 4QC2A 1QORA 1CERA 4W97A 1A9RA 1HFKA 1XVLA 2FA5A 1CZKA 2UYGA 5E1BA 3P9SA 1ML4A 4KBYA 1MIJA 3NMUF 1T1SA 3R7DA 3OA2A 3QE0A 1ZG1A 3QKRB 1JSZA 3QYEA 1M66A 2MMGA 1ZCZA 4QU8A 3T5DA 4CTJA 4EW6A 5JFRA 4D9FA 3RAPR 1GAJA 2WSSA 2A67A 1X2NA 4FOSA 4LE1A 9MHTA 3REOA 4RD1A 5TB5A 3QE4A 1IQ0A 4YT2A 4ER7A 2EF0A 1C81A 1WJEA 4JKIA 3W7AA 5CLFA 3FJ1A 1DWPA 4TZKA 5AM3A 5TQVA 1DP7P 1QP0A 2I66A 5JARA 1VJCA 4XDHA 5A7GA 1E1RA 2XNDA 3NS7A 1ZELA 5FI3A 2FZKA 3DVLA 2GRJA 4NZOA 3N2EA 1U2RA 3DLCA 4NPAA 1K8ZB 1L1FA 4FFPA 3S29A 3KLBA 4A0GA 2H8KA 5NULA 4WBNF 3JR9A 2A14A 3WLAA