3MN2A

The crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
SNAVRQVEEYIEANWMRPITIEKLTALTGISSRGIFKAFQRSRGYSPMAFAKRVRLQHAHNLLSDGATPTTVTAAALSCGFSNLGHFARDYRDMFGEKPSETLQRARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords probable AraC family transcriptional regulator
publication title The crystal structure of a probable AraC family transcriptional regulator from Rhodopseudomonas palustris CGA009
rcsb
source organism Rhodopseudomonas palustris
total genus 38
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mn2A00
1S7EA 2E1OA 4S0HB 2VUMJ 3BTLA 3HOWJ 3GTJJ 2VPRA 1O4XA 1GV5A 1RESA 5C3EJ 2EZIA 2DMUA 2CUEA 4D7NA 5IP9J 3S1MJ 1ETQA 4X6AJ 5IP7J 5J1UA 2KT0A 5F0HA 1APLC 2YUSA 1IDZA 1YRNB 4W1UA 2NVQJ 1WH7A 3QPLA 1MH3A 1MBGA 4UUSA 1ETVA 1BA5A 3BR5A 3W6VA 1H8AC 1HOMA 3S15J 2Y2ZA 3OSGA 5F27A 1F43A 3CCYA 1TWFJ 1XC5A 2Y9YA 1WPKA 2Y30A 3CMYA 2HDDA 4FE4A 3VPRA 1FTZA 1EF4A 2DTZA 1ETKA 1QRYA 5FKMA 4BY7J 1E3OC 5JLWA 4IHXA 5F1JA 3JRHA 1JT6A 3O8HA 4FTHA 5E3LA 3G1LA 5FLMJ 1RKWA 2IAIA 4JP0A 5DTDA 3HGGA 4A3IJ 2L0KA 4QIWN 2HOAA 3C2BA 5K7ZA 3WHBA 3HEFA 4JX5A 5IOYA 3OOUA 1WH5A 3JRDA 1XG1A 2ID6A 2HI3A 2LP0A 4JX4A 1Y1VJ 2JJ7A 2LKXA 2EZKA 4Y52J 1G2HA 2NVTJ 3S16J 3QQAA 1GV2A 1RKTA 1MSFC 1NK3P 3S2HJ 3IV5A 2IBDA 1ZR4A 2NVXJ 5JLXA 4A3CJ 5IYCJ 2M2EA 3BTJA 1JUPA 3JRBA 5M5WJ 5GPCA 4FE7A 1ETOA 3O8GA 5E3NA 4A3MJ 1B72B 2R93J 5C44J 3ZOBA 1GT0C 3S2DJ 1JUMA 1IGNA 3HOUJ 3LNQA 4CYCB 2P81A 1JKRC 1POGA 4DYQA 2FQ4A 2FX0A 2YU9J 5E3MA 4C3IJ 1CQTA 1FTTA 1A6IA 1ZTRA 2EQRA 1OFCX 2ME6A 2DMQA 3K2AA 5EG0B 3ZQHA 2OPTA 5K7FA 1WCMJ 2ECBA 1OCTC 3Q0VA 2L7ZA 2M8GX 2R0QC 2E2JJ 5IP6A 2K9SA 1U9NA 1JTYA 3IH2A 2HXIA 2DA4A 2QF7A 1Q1VA 2TRTA 3HBLA 4V2FA 5C4XJ 5EF6A 2XGCA 1IDYA 2XGDA 2K9QA 3GBGA 3GTOJ 1B72A 1H89C 5FKNA 3D1NI 4M3EA 4G12A 2PMZN 4L5EA 1ZKGA 5FJ8J 5EZHA 2DA3A 2LD5A 4XRMA 1ENHA 4CYCA 3TP0A 2E2HJ 3FIWA 3LOCA 3G1MA 4JYKA 2DN0A 5F0CA 1MBHA 4QTRA 3TEDA 1QVTA 2W48A 4Y7NJ 1JKPC 5EG0A 2DMTA 1ETXA 2XPVA 1ZR2A 2ZB9A 1MSEC 4RBOA 3F0CA 5IYDJ 5F08A 1LE8B 4MO7A 5M3MJ 1HDPA 2HOTA 2DA5A 1IRZA 1RETA 3BR2A 5EDNA 3MN2A 2XSDC 4NDLA 3PO2J 2JMWA 3LSPA 1IJWC 2L7MP 2H8RA 2FD5A 2O8KA 1X2MA 2WV1A 3PO3J 1ETWA 4A3KJ 3BG5A 3OSFA 2NS7A 1ZGWA 2DMNA 1GUUA 3GTKJ 3MKLA 5FKKA 2E2IJ 3OIOA 4MFDA 1ETYA 4V2GA 3IH4A 1MH4A 1IV6A 4DZPA 4MLOA 1D5YA 3IH3A 1AHDP 1BL0A 2N8GA 2XB5A 4M3GA 1HF0A 2LY9A 2LK2A 3JRGA 3BTIA 1WI3A 3HM5A 2CJJA 3JRIA 3HGYA 4XIDA 5M5YJ 1YRNA 2CQQA 4I6ZA 9ANTA 1T33A 2R92J 2JWTA 3GTGJ 3GTQJ 2CRGA 3S1RJ 2X6OA 3S14J 3A01B 2E19A 1FIPA 4C3HJ 1VFCA 1BJZA 2LVSA 3DCFA 5GP9A 4FISA 2VKVA 1LFUP 4IHVA 1BW6A 4EEFG 2VI6A 1QPIA 1MBEA 4BBRJ 2CU7A 1PUFB 5HODA 4MFEA 3PM1A 1SANA 2NS8A 1OCPA 1JKQC 1I3QJ 2R5YB 3DEWA 3BR0A 3TW6A 4A3BJ 4B1RA 3GTLJ 4D5FA 4DYCA 2L7FP 1X58A 3BG9A 1P7JA 3ZQIA 2R5ZB 4A3LJ 3CDLA 3Q0WA 3RKQA 2XRLA 3E7LA 4RDUA 3NAUA 3NARA 3A01A 4BXXJ 2CUFA 4A3EJ 2LTPA 2JA8J 5EYRA 2JA7J 3JREA 1JTXA 3JRCA 3S17J 1Z0XA 3K7AJ 3BT9A 4AUXA 2K40A 1HDDC 2GBYA 1DU0A 1F36A 4BKXA 1UG2A 2H1KA 3A02A 3JRFA 3B6CA 1MBKA 4XICA 3RZDJ 5IPAA 2R5YA 3FISA 2JK3A 3FKIJ 2B63J 2XPWA 5J1RA 1JGGA 5EGOB 3ZQCA 2AO9A 4M3DA 5C4JJ 2ID3A 5EZGA 2O9LA 1K61A 1VI0A 4D7MA 4FCYA 4W97A 2MGQA 1HCRA 2HXOA 4A3GJ 2L9RA 3ZQFA 2EZHA 2WB1N 3QPSA 3HOVJ 2XGEA 1H88C 1RR7A 2DJNA 2EH3A 4ABZA 1R9TJ 1K83J 1U78A 2XPUA 4UUSB 2JN6A 3BR6A 4I76A 1MBJA 1A5JA 2LFBA 4D5CA 3BG3A 3BQYA 2KDZA 5DS9A 3M3YJ 1TWCJ 2ME0A 2Y31A 2WAQN 5IOZA 3HOYJ 5M3FJ 2LLKA 4BY1J 3CQZJ 4M3FA 3HOZJ 1UMQA 3A03A 3UKGA 4UUTA 5FKOA 5EEAA 5EGOA 3MVPA 1SFOJ 2VKEA 1W0TA 1VF9A 2M9HA 1AKHB 1I50J 1IUFA 3TP3A 5J3LA 2ELKA 4GFBA 2DMPA 2JA6J 2DA2A 3FK7A 4HNVA 5FKLA 4AC0A 5FLVA 4B4CA 1P7IA 3JRAA 4C2MJ 3RQIA 1I6HJ 2RAEA 3I4NJ 4DW6A 4J19A 3BR1A 4A3DJ 2GM4A 3SFIA 1RPWA 1LE8A 1JJ8C 2YS9A 4C3JJ 1ITYA 5GPAA 2FJ1A 3M4OJ 4XRSA 1ZK8A 3WHCA 1MNMC 4IHWA 1UHSA 2JA5J 2CQXA 3ZQGA 1GDTA 2DA7A 1AKHA 3S1NJ 3SDGA 3L1PA 1W0UA 2GLOA 1IC8A 2ECCA 1B8IB 1GVDA 1WGXA 2X48A 4BBSJ 1OJLA 3HDDA 2HQ5A 4AYBN 1AU7A 1Z77A 2R7ZJ 2QCOA 1TWAJ 3HB9A 1VNDA 4A93J 3JR9A 3LSJA 4IHYA 2TCTA 1HLVA 2LR8A 1JJ6C 4DYRA 3Q0UA 2I10A 2X9DA 3HKZN 1U8BA 2G0EA 5J1YA 3RZOJ 2IEKA 2M0CA 3G1OA 2NOGA 1ZQ3P 5BNGA 2MW8A 2AHQA 4A3JJ 3B6AA 3SJMA 1FIAA 2Y0SN 3BQZA 1JT0A 3TW7A 3LSGA 5IYBJ 2K9NA 2XB0X 3Q3SA 1QVUA 2DA6A 1PUFA 1B8IA 1XS9A 5K7HA 4LOCA 3FK6A 1FJLA 4X1EA 4XRSG 5F0FA 1IG7A 2DA1A 2EZLA 1TWGJ 1TC3C 1NK2P 2M34A 2OF7A 4A69C 2HYJA 1DU6A 1NTCA 5E3OA 2HOSA 2D5VA 1T56A 1TWHJ 2R5ZA 3HOXJ 1Y1WJ 2O7OA 3BR3A 4QSHA 4A3FJ 3GTMJ 2EBIA 3LSRA 3S1QJ 5M5XJ 4JX6A 3H0GJ 4M6VA 4MIMA 1ORKA 1X2NA 3ZQLA 2MSYA 3GTPJ 2MG4A 4B3AA 1JUSA 2NVYJ 3I4MJ 1MBFA 1U9OA 2COBA 1BW5A 3BTCA 4DZJA 5F04A 4XK4A 1JKOC 1FEXA 3H3VK 4M3BA 2Y9ZA 1LFBA 4IEJA
chains in the Genus database with same CATH superfamily
3E5QA 2W84A 1XSXA 3AG2H 3HOWJ 3W3CA 1S9HA 5E8IA 1O4XA 3M1CA 4UVCA 1GV5A 4M6XA 3CO7C 3OYDA 4L18B 2EZIA 2XV4S 2JRMA 1ONVA 2CUEA 4LMYA 1FX7A 4D7NA 4UUVA 3WGIA 2DJIA 4X6AJ 4PJNA 1QZEA 5IP7J 2DU9A 2AQFA 2KT0A 4ZYHA 1IDZA 2K5CA 1YRNB 1G3TA 4LD5A 3CCQI 3EUHA 1MH3A 1MBGA 4OIPF 3C7JA 1BA5A 1BIBA 2DK8A 4ON0A 3V8LA 2Z9OA 3OYEA 4U0YA 3SEZA 2DI3A 2OA4A 2Y2ZA 5F27A 1XCVA 4CH7A 1F43A 1TWFJ 3L00A 1WPKA 2DPUA 3S93A 1X1AA 5B66C 4FE4A 1FTZA 2HWVA 2L54A 1EF4A 4BY7J 3I64A 1W7PD 4KN7X 2CQNA 3ESWB 1ZLJA 2NRAC 3PUFA 4I0BA 4OWRB 4ESFA 2R7OA 1UAAA 1JT6A 2BXZA 3QPHA 2IAIA 4LK1F 2OBPA 3SZPA 5DTDA 3DEUA 3DLLF 1YW8A 3LSHA 2L0KA 3I59A 1AA7A 2W1OA 2HOAA 3C2BA 5EEHA 2P6TA 4JX5A 3WTXC 4M6YA 1PYVA 2V26A 3OOUA 3QYEA 5K5OA 3KE2A 2ID6A 4HG2A 4Z2YA 2PI0A 3L09A 2BHZA 2M0MA 2ZMEA 1W36C 1Y1VJ 3CDIA 3DF8A 4DIQA 2NVTJ 2PMZA 2DCEA 5L3EA 4R8HA 1HW5A 3IV5A 2ISZA 2IBDA 4E4HA 4RB1A 2EV0A 2JA2A 1HC8A 5JLXA 4A3CJ 1TQIA 3W6KB 1KU7A 2HR3A 2H09A 2EV6A 3Q9SA 2M2EA 4UNOA 3OS0A 3F23A 2V1UA 5M5WJ 4FE7A 2CQ7A 1ETOA 4UVBA 5E3NA 2ACJA 3IP4B 2J5PA 2X85A 1VQ9I 2HGCA 2KMUA 5ILSA 2Y69H 2XF6A 3DTEA 2VJ5A 3HOUJ 2KJCA 2X1DA 2F5DA 1MZBA 2GQQA 5TRDA 4CZZA 2FQ4A 4CCLA 1G59A 3DU5A 4C3IJ 5DM6F 2XKPA 1IXCA 4DNCA 1FTTA 1SMYF 1ZTRA 2KLOA 2UXNA 3K2AA 2OPTA 2X6YA 1WCMJ 4IRGA 4N9HA 2RREA 3TO7A 2E2JJ 3ZGKA 5IP6A 2K3FA 1U9NA 3K2ZA 2HXIA 4NQWB 2DA4A 3J7AO 2QF7A 3ECHA 4AVPA 4AVZA 2CFOA 3BG6A 2DBBA 5EF6A 5DM7F 1IDYA 3LA2A 3JW4A 3PSFA 1J7KA 3CJNA 4KIBA 4OAYA 1H89C 5FKNA 4M3EA 4XLCA 4ZDLA 4RAFA 4NUBA 4OMZA 3OS2A 1O3RA 1ZKGA 3BJOA 1YQAA 2DA3A 4L9JA 3TP0A 3HTSB 2EPFA 3DKWA 2X4HA 4GRIA 3G1MA 3W2AA 2DN0A 2HS5A 3FXRA 4QTRA 2HZDA 1R58A 2F4MB 4PJJA 2HVRA 1XB4A 3CJQB 2W48A 4G8XA 4TV7A 1JKPC 3B02A 2DMTA 4WF2A 3IUOA 4RBOA 1FBUA 3LMMA 3SQNA 5CVRA 1EA3A 3O6BB 3O3KA 4F92B 3GLXA 2DT7B 4HAMA 2JSPA 5CYVA 3R0JA 4E7SA 1Y39A 2HOTA 3TO9A 4NQWA 5HLTA 2KP6A 2AXLA 3J81Z 3BR2A 3WU2C 5EDNA 3G4SI 3BY6A 3F8MA 3JTHA 3KEOA 1XMXA 5CVUA 2MLKA 2FOKA 2WV1A 3RQ4A 1ETWA 2XF7A 4EQQA 3BG5A 5JI6A 4A3KJ 3A2KA 3CZ6A 2NS7A 3OSFA 4OIRF 4NBQA 2DMNA 1G6NA 4HSTA 4RM3A 5BS6A 3I9V2 3OIOA 2V9VA 5DDGA 2L5QA 2MC4A 4II3A 1ZHFA 3IH4A 1S72I 1IV6A 2DO7A 4OU0A 3HPHA 2JPCA 3QWLA 3OMYA 2LSOA 1D1AA 3WTTC 4RAGA 2VQCA 1LUJB 3FKJA 3DXJF 1ERDA 2VASA 2P5KA 5HDGA 4HF2A 3HGYA 4XIDA 4G7ZF 3MKZA 1T33A 4BHBA 2R7XA 2OTLI 5CVJA 4A5MA 4ZJZA 5GADJ 1JHFA 1R1UA 3ABUA 1R5GA 1O3TA 3A01B 1FIPA 4M73A 1XMAA 2VKVA 3HYIA 1LFUP 1VQPI 3TO6A 2EK5A 2NNYA 3AAFA 3D0SA 5D6FA 2DYSH 2FUG2 1R5HA 4MFEA 2Z33A 2IS4A 2F6CA 4ZZDA 1BN5A 2NS8A 3M8EA 4CCNA 1FOYA 1O3QA 4G7OF 1ZG3A 2R5YB 1R4MB 4MGRA 1QHHD 3V7SA 2V79A 2WAEA 4D5FA 4HPQA 1R23A 3BG9A 2XDVA 3LWFA 4YG2F 2I5UA 2E5ZA 1T98A 1W5CC 1E2XA 1YX3A 1WVRA 2R7FA 4NB5A 3A01A 2LTPA 3WGGA 3AL0C 1L0OC 4IJAA 3JREA 2RNGA 2QYOA 1IN5A 1SD7A 4BL0B 1Z0XA 3K7AJ 2E1MB 2E1NA 3U9GA 5CKTA 4A0YA 3MCZA 3SXYA 1TT0A 2P6SA 1UG2A 1RRJA 2H1KA 1Y6IA 2VE9A 3B6CA 3FF5A 3VFZA 3KZYA 3Q9VA 3J7AY 2R5YA 3FISA 5ICEA 2JK3A 4BQQA 1YITI 1F1ZA 4L0YB 5EGOB 4M3DA 4UHTA 1IO2A 4BEHA 1XD7A 3O2PE 3ZMVA 1K61A 3V7CA 3OYBA 4NC8A 1VI0A 1I1GA 1IW7F 1R1VA 2V6CA 3WGHA 1HCRA 1DPUA 3CMMA 1KQ0A 1IAWA 5D6EA 2A07F 4KMUX 2XAHA 2XGEA 3VYRB 5ICFA 2DJNA 3CUQC 1K83J 2XPUA 4UVAA 4I01A 3BC8A 3CJTB 4I76A 4BE0A 4XN0A 4LLLA 1MBJA 3BQYA 2FMYA 4UV8A 1SD6A 4Y33A 2K4JA 3DBRB 3FXKA 1TWCJ 1WKMA 5F1RA 1FBQA 3DFGA 4HNTA 3QOPA 3HOZJ 2FA5A 2R7UA 4UUTA 3CUOA 5EGOA 3GMEA 5E1WA 2OU2A 2VKEA 1VF9A 1AKHB 2DYRH 2K7LA 1HKTA 4ZTJA 1MNEA 5J3LA 2ELKA 1ON2A 1UELB 3BOQA 1BOAA 3OYAA 4C2MJ 3TDUC 1UG0A 3HG9A 4O5VA 4U7BA 4XN3A 2GM4A 3MKYB 4Y4RA 1LDKB 3K4BA 2ZBKA 1RPWA 3H3UA 3GZ6A 4P1WA 2Y0SA 2YS9A 5H2FC 3ASOH 4ZYGA 2GXAA 1FP1D 3BCAA 5B5EC 1IN7A 2FF4A 4XRSA 1ZK8A 2ZNYA 3CDHA 3KP3A 1MNMC 3MEXA 3DPUA 1S7OA 4XSZF 4AM3A 2CQXA 2KZGA 2P5VA 2VBWA 4Q5SF 1P9QC 2X6WA 3BZCA 5GTIC 1AKHA 5LRRA 1MJ9A 3G73A 3S1NJ 3SDGA 3FM3A 3L1PA 1OR7C 2RNJA 3LSMA 2H27A 2UV1A 2QZ8A 2HTSA 2H94A 3K1MA 1D8KA 1AWCA 1B8IB 1GVDA 2DLLA 5DUKA 2GIZA 4ENNA 2R7ZJ 1Z77A 3KLOA 4Q48A 4IZZA 3S3MA 2OJED 4A6DA 4KYWA 1XGMA 1B4AA 5J4VA 1QBJA 1H9TA 1JJ6C 2O5RA 3Q0UA 3CMAI 2L01A 3CP2A 1BR4A 2BV6A 2FSWA 2IEKA 1R7JA 1T08B 4M74A 4PDKA 1DGRM 2NOGA 3RPQA 1AOYA 2W24A 4XNFA 2VOOA 2G7UA 2IA1A 1FIAA 3OL4A 5IYBJ 4Y15A 1IUYA 1MMGA 1B8IA 3R60A 4QPQA 4LK0F 5HLGA 3HOTA 3ZXSA 4XKBA 2E7XA 1X1CA 1Y0NA 3QP5A 1J09A 5F0FA 2EZLA 2OAZA 3WG9A 4XLFA 1W5SA 2WBMA 1KQ8A 3DPLC 2A69F 4RAYA 2IW5A 1NTCA 3ZP5A 2VB6A 5FRMA 2XVCA 3LA7A 3F8CA 2R5ZA 1Y1WJ 2ESNA 2VKDA 3GW2A 2B0LA 2O7OA 2EBIA 3P9CA 3HHGA 4L0ZB 3QP6A 2VBXA 3KP7A 5M5XJ 5F64A 5AIPA 4JX6A 3LAPA 2KISA 1MMSA 1HBXG 4R1HA 2KQRA 3ZQLA 1BI2A 3ZMTA 4PK4A 1U9OA 4BE1A 4L9VA 1ZYRF 2MABA 1N25A 1WJEA 4XLHA 5A2QZ 4ZTFA 2VONA 1KGSA 3FHNA 1T0FC 5F6FA 2EA4A 1S8NA 1JKQC 2HQRA 3DEEA 4IEJA 3S3NA 3IAM2 1WSUA 3BTLA 3T5XA 4ETSA 3GTJJ 3ZMUA 1BI1A 4HDVA 2PJPA 5H6QA 1VQOI 2IT0A 5C3EJ 1OQYA 3R6SA 3F8FA 2LOOA 3S1MJ 3DPTA 3NWSA 4L5JA 1U0JA 5J1UA 5F0HA 2VT3A 1T39A 2YUSA 2NVQJ 1BC7C 2KDOA 3ISPA 3TOAA 3E97A 3BR5A 1QQIA 1H8AC 3W6VA 4H4KC 1HOMA 4KT6A 5FD5A 3DU6A 3OYKA 5IT3A 3PFIA 5J47A 4BQNA 4AIJA 3OSGA 3SFZA 2QKMB 1Z6RA 3CCYA 2AXTC 2Y30A 2V9PA 3BPXA 3Q5FA 2K3PA 4DBQA 1Z91A 3BDDA 3S8PA 3VPRA 2LRDA 3WTYC 2DTZA 5K1YA 3KPHA 2HFHA 4PGHA 4RA2A 5FKMA 3HHHA 1IRXA 4OIQF 4IHXA 4HV5A 5F1JA 3JRHA 3O8HA 5E3LA 4F52A 1IZ1A 3G1LA 5FLMJ 1RKWA 5HDNA 4MEYF 2O03A 3D5SC 3JAMK 4A3IJ 3HGGA 1VQMI 2DAOA 4CA0A 2CWEA 2BGCA 4CICA 4UB6C 3WTVC 1HXDA 3JRDA 4EJUA 1D0ZA 4BNCA 3KYDB 1ACIA 4CDGA 3GF2A 5JVGF 1ZG1A 1Y8RB 3S16J 3QQAA 1GV2A 2KHMA 1SFKA 3GXOA 2KPMA 4E7KA 1OCOH 3ML6A 1C0WA 2KFDA 4RB3C 1QO0D 1XN7A 3J80Z 3VWBA 3CCUI 5GPCA 3PIOF 1IRGA 3O8GA 3EYIA 2WV0A 5B1BH 1X4PA 1X4OA 1Q1HA 1KONA 1S29A 3SHFA 5D5WB 3S2DJ 1JUMA 4HEA2 4D9JA 3EDPA 2HU9A 3BLYA 3OL3A 2A68F 1POGA 2DQLA 4P55A 1P4XA 3PSIA 1R6RA 2IA2A 5CVVA 3OYFA 4C30A 4MQVA 4B09A 2HPIA 1HSTA 3E3VA 1SEUA 5EG0B 3ZQHA 1P4WA 2ELJA 1FLIA 1OCTC 1F9NA 3FWEA 1QU3A 1OYYA 2R0QC 1J59A 2A6HF 3FBIB 4CCMA 4HW0A 2CG4A 1Q1VA 2F5VA 5HOOA 2K9MA 5C4XJ 2XGCA 1R22A 2GA2A 2ELHA 1ZG5A 3GTOJ 3SZTA 2CH0A 3DV8A 1E3PA 3SDBA 4G12A 2PMZN 1Z6TA 3I0TA 4L5EA 3LFKA 4ESBA 4XRMA 1MDMB 2E2HJ 3F21A 4F93B 2ZJRF 4JQFA 4ANJA 4UY8I 1SD5A 3MMYB 3G71I 4PJ0C 1KZHA 1TQPA 4ZDOA 2PJRB 5LEJA 5EG0A 4WXDA 4LG3A 5IYDJ 2MH2A 4K2EA 2EILH 2Z1DA 5F08A 3U2RA 3OYLA 2IJLA 4RGSA 4CHUA 1YLFA 5M3MJ 1QZZA 2LKSA 2L9SA 3IKTA 4XLAA 2BXYA 4RM2A 3PO2J 5FFXA 3DBLB 2QENA 1IJWC 1FSEA 2L7MP 2FD5A 2LC2A 1K4TA 2ZCWA 3BG7A 5H6RA 2EFOA 2KL4A 2Z99A 1A6QA 1SD4A 3L9FA 5J8CA 1PDNC 2E7WA 1XDUA 4I7HA 3RKXA 1MDMA 3H36A 3VDXA 2F4OB 2RV8A 1LKXA 1YS7A 4MFDA 3OOPA 3CCLI 1Z3XA 1OCRH 3CUQB 4XONA 3L2RA 3H92A 1O57A 2CV2A 1RI7A 2E35A 3KP4A 4MLOA 2PJRA 1REPC 1ZH5A 2EA2A 3FBNB 4BJ6C 3ABLH 4M3GA 1U5TC 2X1CA 2LK2A 1WI9A 3JRGA 1FYKA 1T6SA 3KZZA 4IO9F 5HVQC 1WI3A 5J4YA 3JRIA 2H1LA 1GXPA 1YRNA 2PLYA 1XDSA 4B43A 2CQQA 4I6ZA 1R00A 2V6EA 2D1HA 4AIHA 4JK1X 3F8NA 2DOFA 1TT5B 2JWTA 3GTQJ 2CRGA 1IXSB 3M8JA 2M45A 1F5TA 3T1BA 3S14J 2ETHA 1ON1A 2E19A 2XSJC 2HVSA 4C3HJ 2NNNA 5HLIA 4FISA 5LRSA 3GX4X 2M5WA 3MFKA 1IN6A 2FRHA 1MBEA 4HRIA 2OCEA 1VTNC 5HODA 3PM1A 2IGNA 1SANA 2WB1A 1VQLI 1FP2A 2VOPA 2V1NA 4C9YA 3BR0A 1T8IA 5L3GA 4BE2A 4B1RA 3K1PA 3QRFF 3RSNA 1FYMA 3COAC 1X58A 2A5YB 4AWXB 2TDXA 5DCMB 4B44A 5TISC 3HRUA 3GEZA 2ZFUA 4HF0A 2ZO4A 5J6XA 3ABTA 4HX8A 3LFUA 3OYMA 3HRTA 5KAIC 3UR3C 4ESJA 3Q0WA 5GAEJ 1LQ1A 4RDUA 4J00A 1VQNI 2J5OA 4GGGA 2XROA 4A3EJ 3TGNA 2JA8J 5EYRA 1UZCA 3CC2I 1D8JA 3EUKL 1JTXA 3U21A 3JRCA 1NH3A 1V5GA 1TBXA 1X1BA 3I55I 3CCEI 4WWCA 4AUXA 1M1EB 2DFFA 2RGVA 5HS9A 3GWZA 2VQHA 1F36A 2QBYB 2Y48A 1D1BA 1RNLA 3A02A 2ISYA 2IRFG 2JVHA 1I1SA 2XPWA 1XSDA 5J1RA 1JGGA 1XGSA 3ZQCA 1OISA 1K79A 5DCMA 2ID3A 2BE5F 2IVMA 3AFHA 3DKYA 2KIQA 1KQ9A 1S3JA 1S7AA 3F6OA 3FXUA 4D7MA 1ZGAA 4W97A 4KITB 2HXOA 3PUBA 1Z3YA 4WXHA 4G6QA 4A3GJ 3ZQFA 1RR7A 4ABZA 5FFZA 1R9TJ 2VT2A 3HJEA 3ABMH 4UUSB 3GFIA 3BR6A 2ZC2A 5HNHA 2LFBA 3M3YJ 2QBYA 1RC9A 1UFMA 2PX9A 2EFQA 4XKVA 2H6CA 2ZJ2A 1P2FA 2L7KA 3OY9A 1HKSA 3HOYJ 5M3FJ 4I99C 2LLKA 2OZ6A 3PJRA 4AYBA 1UMQA 5GAHJ 3UKGA 1Z21A 2CS3A 3M9AA 4WK8F 2OD5A 2WY8Q 2L02A 4BQOA 4LB6B 1SFOJ 1LVKA 2WTEA 2EV5A 2OV7A 2Z5UA 1I50J 3LSTA 3J81K 3L2QA 2HKXA 2O8XA 2KKOA 1WJDA 2GOXB 3HSFA 3HKZA 5B1AH 3RTRA 3ZN0A 3L2WA 4EM1A 5FKLA 4AC0A 2VL8A 5FLVA 1P7IA 2DOEA 3KZIC 3E1SA 1F4KA 2M4GA 1TL8A 3I4NJ 2A3SA 2OC6A 3FXJA 1Z1DA 2M1BA 2QKLB 3CF5F 1Z9CA 4KJZA 2LBFB 3BZKA 1G3WA 3C2GA 5GPAA 2QM3A 2FJ1A 1KU9A 4HLYA 5D8KB 4BHPA 4I2OA 3FXLA 3ZQQA 2CSOA 2XASA 3WHCA 1IN8A 4RLFA 5AONA 2CV0A 4IHWA 2OCCH 2MFZA 3E5XA 1UHSA 2JA5J 3ZQGA 3CMEI 2NYXA 2DDBA 4IOAF 4ZYAA 2EFNA 1RR8C 3OR1C 3K4JA 1XGOA 2GLOA 1UHWA 1X3ZB 3ZMSA 2KRCA 1IC8A 1EKEA 1LDJA 3C3WA 3H9QA 4BBSJ 2K86A 4WX9A 4XORA 2UZKA 1OJLA 3HDDA 2W82A 1V5FA 1TWAJ 4A93J 1VNDA 1T0FA 3JR9A 2LBFA 3F6VA 3MAJA 1N78A 5FRNA 1HLVA 3PNTA 4XKCA 3TQNA 2QUFA 4FETA 1HW2A 1OMIA 4JOMA 2NS0A 3H35A 4IPAA 1TQMA 3TBIA 5J1YA 3NRVA 3AG4H 3J7YJ 1XCBA 3N05A 1RZ4A 1B9MA 1BI3A 2Y0SN 2F5CA 1R1TA 3OYNA 4UXNA 2XB0X 3IWFA 1QVUA 2HDWA 2DA6A 3PIPF 3CO6C 2O3FA 4HX4A 1XS9A 1YIOA 2DT6A 2DXIA 5K7HA 3EUHC 2A6TA 5E8GA 3TOBA 2K27A 3EUAA 3OYHA 4X1EA 4U87A 3SZGA 2YX7A 2KIMA 1B9NA 4IL6C 2ZXJA 1NK2P 2M34A 2GOMA 1I3AA 4CO8A 5E3OA 1W5TA 2IS1A 2D5VA 3ZR8X 2LY1A 1P6RA 3CLQA 5KAFC 4RLQA 5L3DA 3GTMJ 2LDUA 4A3FJ 3H1CA 2QSFX 1YJNI 4BQAA 5BOXA 3H0GJ 1WJFA 2H8WA 4M6VA 1D0YA 2VC1A 5CJ9A 1VQ5I 4EM0B 2MSYA 3GTPJ 4LJZF 4ZYDA 5IY5H 3CC4I 2CW0F 2NVYJ 2STTA 3ULQB 2W7NA 5KNLA 2O61A 1DDNA 4FX4A 5F04A 3ZMDA 4DQ2A 1JI8A 3H3VK 1VQKI 3MD2A 4B3XA 2Y9ZA 5IT9Z 2ZMEC 2CJJA 1S7EA 2E1OA 4S0HB 3WTSC 4L5IA 2HDCA 2CMPA 3DTIA 4B8XA 3A0HC 3NWTA 1V54H 5FGMA 2QWWA 2KRFA 4E7JA 3RI4A 1FWZA 2DMUA 4MEXF 2NVUB 1YFHA 1OYWA 5IP9J 4FQGA 2BY1A 1A04A 3ERED 1MJAA 3E0JB 1T2KA 3HPGA 3QPLA 1XGNA 3U1KA 1ETVA 5EJCA 5FLXK 2E60A 2VPLA 4M71A 2RQQA 3S15J 3I58A 2FMLA 2K02A 2HYGD 2AS5F 2F5FA 1MKMA 1XC5A 4RMNA 2BYVE 4X0GA 4EV0A 4D0PA 1O7LA 4PSWA 1ETKA 1QRYA 3FZVA 1YS6A 4BAYA 2FNAA 3HUGB 2XAJA 5JLWA 1Z05A 1XPXA 2XHKA 2Z2SB 3CTAA 4A12A 4JP0A 4YFKF 2RDPA 4RGUA 3RJPA 2A61A 1SMTA 2QGUA 2BY2A 4QIWN 4KMFA 3WHBA 1K7AA 4XOPA 5IOYA 2R7QA 1YHQI 3OWTA 4IRHA 3W2WA 1KYZA 2H6BA 1XG1A 3RKYA 2JT1A 4CYDA 4IX7A 2JPBA 3KEQA 4KISA 3FMQA 4ZDPA 1GHCA 2JQ7A 1YIJI 5LHHA 2LP0A 3JTGA 2IS2A 3BPVA 4Y52J 1G2HA 2QSGX 5LBQA 3REOA 5J40A 4OINF 1MSFC 2M7AA 2CUZA 3S2HJ 2MC3A 2X0LA 3IAS2 5LLQA 1JXSA 2OZUA 1ZR4A 2NVXJ 4KA4A 3HUGA 2VC0A 3CJRB 2IS6A 2G7HA 5JVTA 4BU2A 3HSEA 2P5LC 3L2CA 4LG0B 2JUCA 5H20A 2R7WA 4MHGA 1GVJA 1B72B 1V4RA 4XQFA 4P9UA 3CCMI 2CFXA 4MTDA 1N77A 2RKHA 3ZOBA 3CESA 1FOWA 2RN7A 1GT0C 2L4MA 2FNPA 3LA3A 4GCVA 1RUNA 2GZWA 1QNTA 4E7LA 1KU2A 3FM5A 3LNQA 2VBYA 4CYCB 4E7IA 1O3SA 2P81A 4DYQA 2FX0A 5E3MA 1W7PB 2WY7Q 4BACA 4BJTA 1V55H 2WC2A 2Q0OA 1A6IA 4AD9A 2ZFWA 1YW7A 4P9FA 1FYLA 5K7FA 3GUDA 3Q0VA 2KIUA 3ERMA 3BJAA 2L7ZA 1VQ8I 3FHZA 1YOVB 1JE8A 3VEPA 3WE3A 1JTYA 3IH2A 4LG0A 2HEOA 2Q1ZB 2TRTA 3HBLA 3H0DA 2V1XA 2Q8KA 2XGDA 3GBGA 1B72A 2R7TA 5ICGA 3D1NI 2VKHA 2ZNZA 2WA0A 2I8DA 1J2XA 3KIOA 2LD5A 4CYCA 1ENHA 1OYIA 5E20A 1MJBA 3FIWA 2F4IA 4XL9A 3SEQA 4JYKA 1MBHA 2P0WA 3TEDA 2VQGA 3E6CC 1NG6A 4HLXA 4BDZA 1MGTA 1QVTA 3AG1H 1ETXA 2JUGA 3LSIA 5A2QK 1MSEC 2ZB9A 2ZXWH 2MD5A 1VQ7I 2Z3YA 5E18F 1LE8B 2V4JC 2E71A 4MO7A 1HKQA 1HDPA 3C1DA 3KYCB 2CGPA 3VOEA 1IRZA 3HSRA 1RETA 2DOAA 2D2WA 2NAZA 2V1DA 1CGPA 3DTKA 5BPDA 2XSDC 4NDLA 3FMSA 4L9NA 3FXQA 4QLCU 2O8KA 1R4NB 3PO3J 2JVGA 2CUJA 4M9XA 1GUUA 5D8LB 4IRIA 2W25A 5LGNA 2E2IJ 2ICWG 4V2GA 1BJAA 1I6XA 2MBFA 2GAUA 2LKPA 1D5YA 3IH3A 1AHDP 2YU3A 1BL0A 2XB5A 4YFXF 1HF0A 1S5LC 5KK1A 2DW4A 3S3OA 4ZH4F 2O6GE 3GFMA 2L4AA 2LY9A 1SAUA 3GLLA 4PUSA 1XTAA 2BY3A 3OV8A 4V19K 3HXLA 4BH9A 1ZARA 5TJJA 5ED4A 5M5YJ 1R36A 3IWZA 1FZPB 2VBZA 3EYYA 5D5VB 1U3EM 2DDAA 1UB9A 4O3MA 3V4GA 1JGSA 3IC7A 2R92J 2RVCA 3RCOA 3VYSB 3HIFA 3GTGJ 2WAFA 3DBHB 2HKOA 2LYCA 4ENKA 1GXQA 1UHMA 5K5QA 1SC7A 1V5EA 2X51A 2X6OA 4CCOA 1VFCA 1BJZA 2LVSA 3BP8A 3F9KA 1DP7P 3OS1A 1YYVA 4IHVA 1EV7A 3MQ0A 4EEFG 1QPIA 2CU7A 1BOBA 1PUFB 3KP6A 4IVNA 2EIJH 5B3SH 3AKZA 2LF8A 3H9JA 1OCPA 5LGUA 1U6GA 2OTJI 4RGXA 3DEWA 3D5LA 3ONQA 2BBYA 4A3BJ 2XKOA 1SFEA 2L7FP 2W85A 4EM2A 2E1CA 3V7RA 1P7JA 3ZQIA 3IRRA 4PFOA 2WAQA 2XRLA 2W00A 2EFPA 3E7LA 3NAUA 3NARA 3QYFA 1VQ6I 4BXXJ 2XUBA 2E34A 1N75A 2WADA 1WQ2A 3RYPA 4AU7A 3S17J 5LFAA 1I5ZA 5E17F 2K40A 1HDDC 2GBYA 1DU0A 1SAXA 4MQ9F 1YO5C 5J8FA 3WU1B 3QU6A 1MBKA 3LSKA 3A1YA 4PSXA 1A35A 2K9LA 4EJVA 2B63J 1DQUA 1IN4A 3OYCA 3K4LA 2FBHA 2XAUA 5C4JJ 4DGWB 1Z7UA 4E6KG 2O9LA 1FSHA 1SFUA 1ZREA 4E7HA 3BCBA 3L2VA 5LHIA 2L2OA 4FCYA 1XX5A 3AL0B 2A5WA 2ZXIA 3LL7A 1MMNA 2FXAA 2E5NA 2L9RA 1W1WE 2VE8A 2WB1N 3QPSA 1HQCA 2IGKA 4NNJA 3HOVJ 2FEZA 2EH3A 3ECOA 2HYFA 3VODA 3GVAA 2ZXHA 4G6TB 2P7VB 2CYYA 4XBFA 1A5JA 4GYIA 4FASD 3E5UA 3BG3A 3K1NA 5K5RA 5DS9A 2KDZA 3DKXA 2FBKA 1QHGA 1WHUA 2B7EA 2ME0A 5HS8A 2XAGA 2DT5A 2HVQA 5IOZA 2XC7A 3KEYA 3K4KA 3CQZJ 4M3FA 4BY1J 3MZ8A 3A03A 3DP7A 1EH7A 5EEAA 1RIOH 1W0TA 2XIGA 1ZGJA 1EH6A 4XKWA 4EGYA 1DUXC 1LPQA 1IUFA 4MNUA 1SVOA 2OUMA 2DMPA 1XSVA 4A0XA 4YRVA 2DA2A 3FK7A 2V7FA 5KVRA 2DQRA 3I59B 4B4CA 3RQIA 4YIFA 2ZKZA 4DW6A 1D1CA 4J19A 4A3DJ 2BOLA 2RC4A 4HNUA 3SFIA 1JJ8C 4J01A 1YX5A 4C3JJ 2QQAA 4XLEA 2M87A 2ZMEB 3QPTA 1FBSA 1TLHB 3M4OJ 1W36D 2VXZA 4N4OB 3L2UA 4KIFA 3NQOA 4XMYA 3H5NA 1GDTA 3E6MA 2OQGA 3F3XA 3GYHX 2EFWA 1Y8QB 3ZN1A 2VJIA 3A4CA 1QGPA 4NHJA 3TMOA 3CUQA 1W0UA 2EB7A 4P5OA 4HV6A 3M07A 2ZSIB 2PFBA 2KIFA 2ECCA 4HDUA 4M9SA 5L3BA 2X48A 1LVAA 3VYUB 2JSCA 4I02A 1YE9A 1EH8A 2HQ5A 4EMSA 4AYBN 4E70A 3WTWC 1AU7A 2QCOA 3HB9A 1H0MA 2PBIA 2PMUA 1YW9A 2FBIA 4IHYA 2TCTA 5D5UB 4FX0A 2XAQA 3RPUA 3OR2C 4DYRA 3S2WA 2I10A 4A5NA 1UJ8A 5JR3A 3K0LA 3HKZN 1U8BA 2G0EA 1D5VA 4N0BA 5CPRB 1A36A 3UNGC 2RQPA 3RZOJ 4R79A 2HZTA 2M0CA 4BGDA 4LIVA 2UWMA 5BNGA 1YI2I 2AHQA 2CW7A 4A3JJ 3B6AA 3SJMA 3IRQA 4KN4X 3BQZA 3TW7A 4UB8C 1V3FA 2K9NA 2MH9A 3Q3SA 3KFWX 2YR2A 4XR6A 2HNHA 1KA8A 4LOCA 1FJLA 1RUOA 1UCRA 1FOKA 4IQJA 1ZRFA 1LEAA 4XRSG 1L3LA 1FOXA 2DA1A 3CP8A 4HA8A 1YJWI 2GXBA 3RYRA 2LREA 3GZ5A 4MTEA 3EQLF 5BPIA 2A05A 2OF7A 4KIGA 2HYJA 1DU6A 2Y75A 4GO1A 3OYJA 2HOSA 1OKRA 3GFJA 3PL8A 1TWHJ 2ESHA 2K4BA 3A0BC 2V9KA 3BR3A 4U0VA 4WXCA 3WTUC 2W4SA 1B6AA 3KP5A 1OR7A 2X6XA 3WODF 5TGTA 2PMHA 3PNYA 1G3SA 1I39A 1WJAA 2W57A 4LLGF 4F55A 3JSPA 4E7ZA 2M3AA 3JSOA 1MW7A 1ORKA 1PVEA 2MLGA 5GAGJ 1X2NA 2IXSA 4EJOA 4B3AA 2PN6A 4CCJA 4LFUA 3T8TA 3I4MJ 2XF5A 1BR2A 4PFPA 3PQKA 1BW5A 3KP2A 1FEXA 1PP7U 1SFXA 5BQTA 2VUMJ 3P9KA 3KCCA 2B9SA 3CC7I 2DFHA 2VPRA 3JCUC 3LQQA 1IV8A 3FXMA 4Z6YA 4ZYEA 3I54A 2KRHA 3E6DA 1RESA 4ENMA 3WTZA 3H3ZA 2UUZA 3FX3A 1ETQA 4LITA 4N4NB 4BXUA 1J75A 1APLC 4W1UA 1WH7A 4IKFA 3R61A 3I5UA 4ZC3A 2F5EA 3RIRA 4UUSA 4HBLA 1MD0A 2HOEA 2BZTA 3CCRI 4PJMA 1MMAA 2GIVA 2QVOA 2Y9YA 1X19A 3CMYA 2HDDA 4Y17A 3W2VA 1TTYA 4HF1A 2M8EA 3S32A 1R71A 3G3ZA 4F91B 2CW8A 3BROA 1E3OC 4CGZA 1O7FA 2DPDA 1Y0UA 4BUPA 3PFYA 4JBAA 4BS9A 3U1DA 4FTHA 5HNFA 2Y0MA 1VZ0A 2KJBA 3I56I 5L3CA 2F2EA 4IHTA 4BDYA 5K7ZA 3HEFA 4LIUA 5BMZA 1WH5A 1WJBA 4XLPF 4XM3A 4G6DA 5DEQA 4ZZLA 2YPRA 4HQEA 1G3YA 2DTRA 2HQAA 3QOEA 2GA1A 4GXOA 2HI3A 4JX4A 4LGWA 2LKXA 2JJ7A 1IF1A 2EZKA 3IHUA 1PP8F 2L9NA 2QEXI 1RKTA 3AG3H 5E1XA 1NK3P 3H9GA 4PZJA 4G7HF 2LMDA 4HSRA 5IYCJ 1WFXA 1U2WA 4I0AA 3BTJA 1FPQA 1JUPA 2COMA 3JRBA 1H9GA 1S6LA 2Q2EB 2FE3A 3PNVA 1LB2A 3I53A 2XRNA 4A3MJ 1WWXA 1YJ9I 2R93J 3L7WA 5C44J 2KZVA 4M9ZA 4B48A 1WRJA 1ZELA 1W4MA 3CCJI 1IGNA 4BEHB 4HZFA 2ZSHB 3BWGA 1T95A 4IHSA 1JKRC 5DUIA 2YU9J 3FDYA 3OIPA 1ZRCA 2X1EA 4YFNF 5L3FA 3IL2A 4A6EA 3CCSI 3TL4X 3K69A 4IXAA 1CQTA 2R4GA 4HOBA 2EQRA 1OFCX 2ME6A 2DMQA 4S05A 1E17A 1WJCA 2ECBA 4LLNA 1Y56A 2F48A 5GTHC 2M8GX 1BI0A 2DK5A 2K9SA 3KLNA 2QA4I 3HRMA 2LG4A 3BJ6A 2ZJQF 2NXNB 5HLHA 1PUEE 5HS7A 4V2FA 2DFEA 2Q2EA 3H5RA 3DQVC 2K9QA 2Z16A 2IGOA 2M30A 2R7SA 4BYYA 4D1QA 1LDDA 5ERIA 1G4DA 3RPUD 2IA0A 1MIJA 4Q4ZF 2VXDA 1QZYA 4XSXF 1D0XA 5FJ8J 1TW2A 2ADUA 5EZHA 3J7ZI 1ZAOA 3OYIA 4AIKA 3LOCA 5F0CA 5JHFA 1YG2A 3QODA 3M1EA 3V42A 4GDFA 1VQ4I 2VN2A 1J0RA 3P9IA 4Y7NJ 1DP3A 2XPVA 3K70D 4RGRA 1ZR2A 3F0CA 2XGXA 2E36A 1TW3A 4KT5C 5IT9K 5FB2A 2DA5A 1TNSA 4IF4A 2M7BA 3MN2A 2BY0A 2G9WA 2D45A 4YEJA 2JMWA 3FXOA 3LSPA 2H8RA 3ABKH 4RB0A 4U0WA 6PAXA 1ULYA 3KETA 1X2MA 5E1ZB 3HTUA 1Z67A 3CD6I 3QU3A 4DJAA 1ZGWA 1T38A 4A0ZA 4B47A 3MKLA 2R3SA 5FKKA 3GTKJ 5FLXZ 3V8JA 5LGTA 2R7DA 3K4CA 1ETYA 4U88A 4UV9A 3R0AA 3D5RC 4CSWA 1MH4A 4DZPA 4OIOF 1J5YA 3K70C 2LH9A 3DWLE 2N8GA 3HZJA 4BXFA 4CXFA 4YIIA 1OCCH 4OAZA 3X2QH 4G94A 3BTIA 1USTA 3WE2A 2LY2A 3HM5A 3ZMZA 2P7CB 3N4MA 4KFCA 2K85A 5LEKA 4A2UA 1FT9A 9ANTA 1HA8A 1OCZH 4CUGA 3SYTA 4HX7A 3TDZC 4IQ4A 2JZYA 4EJTA 3VSKA 4KNYA 4Y13A 4U7DA 3S1RJ 3ELKA 4G9YA 3T0YA 1ODDA 4I09A 4BHCA 2IP2A 1R5ID 3B73A 1ZN2A 1IRFA 3V8KA 1P4AA 3GO5A 2OQRA 3OIQA 3I71A 3K10A 5LHGA 5E79C 5EEGA 3DCFA 5GP9A 2FU4A 5DCFA 1BW6A 2O0YA 2VI6A 1G8XA 3ASNH 1U5TB 4BBRJ 2IGMA 1JHHA 2HQNA 2QLZA 3ZPLA 2BVLA 5CQEA 1R49A 2STWA 1PJRA 1X1DA 2YX4A 2EWNA 2QQ8A 2LF7A 3KYLA 1I3QJ 2DODA 2YSRA 3TW6A 2P4WA 3IKVA 2PG4A 4RS8A 4WCGA 4OOIA 4CZCA 3GTLJ 5JFRA 5D4RA 4DYCA 4HYEA 2NOJB 4ITVA 2R5ZB 1BC8C 5D5XB 1IXRC 4N9IA 4A3LJ 4LB5A 1NHAA 1P92A 2R7RA 3CDLA 3RKQA 1STZA 3NEUA 4FHTA 1USSA 5AIQA 2CUFA 3F22A 2DFIA 2JA7J 3I3LA 1LJ9A 2VIXA 2JTVA 1BR1A 4YIRX 4QPOA 2MD0A 2GWRA 1U5TA 3BT9A 3W6JB 4C2UA 3HL2A 4P96A 3HOSA 3K4NA 2A6EF 4BKXA 5JHUA 3WG7H 3JRFA 3MWMA 4XICA 3RZDJ 5IPAA 1E3HA 2FQ3A 4DOZA 3FKIJ 3K4MA 3G6EI 1DGWY 5DD8A 2VQLA 1X3UA 3R4KA 2AO9A 5EZGA 1OLTA 2BEOA 2QSHX 1J9IA 2VODA 4EJWA 4F7ZA 5DYMA 4II2A 2MGQA 3C2HA 1TZLA 4ENJA 1W7PA 3CLOA 3C18A 2L9VA 1B59A 1SVMA 2EZHA 2CQKA 1H88C 3QYBA 1U78A 2C6YA 2M4KA 1TNTA 1K78B 4NC6A 1CF7B 1DPRA 3E6BA 2JN6A 5FD6A 3M7GA 4D5CA 3GFLA 3HRSA 3GZNB 2UXXA 2Y31A 5HDKA 4PJLA 1FMVA 3MKWB 2HPMA 2WAQN 1LFPA 5ILVA 4F3QA 4QWQA 2XAFA 4OMYA 5CLSA 4L9TA 5FKOA 3F72A 2D1VA 1FMWA 3BZ6A 3MVPA 4KUMA 1E0EA 2M9HA 3RKWA 1BIAA 3RDIA 3TP3A 1FNNA 4XRFA 4GFBA 3M8FA 2JA6J 3VSLA 4HNVA 3JRAA 1NG7A 1YTYA 3MZYA 3LAJA 1I6HJ 4Q47A 2VLAA 2RAEA 3ROUA 1OPCA 3BR1A 2WWYA 1K78A 4Y3OA 1CF7A 1K4SA 1LE8A 1HSJA 2BHYA 2CO5A 5FO5A 1ITYA 4I98B 4EATA 5DV5A 1FY7A 2BVMA 2EINH 2L3DA 3EPZA 5ILUA 2AQEA 1BM9A 1ZLKA 3F8BA 1Z7LA 4C2TA 5FROA 3JAMZ 4S04A 4PCQA 3FMRA 4KICA 4HQMA 5KCMA 1LNWA 1WZ2A 2DA7A 2QQ9A 3G2BA 3ZRGA 2EIMH 1HW1A 4RAZA 4ASNA 3PQJA 4KDPA 4FT8A 1ZRDA 2CV1A 2MYSA 1WGXA 1A31A 3WU0A 2BW3B 1XMKA 2E1MC 3GCMA 4DBRA 4GYGA 3QAHA 3VYTB 4O6JA 3LSJA 3T8RA 2GXGA 1BBYA 2LR8A 3J80K 3TKYA 4IOCF 5ICCA 2X9DA 5KHDA 1K6OA 2LNBA 3P5JA 2FOWA 3K6GA 1U8RA 1FC3A 3G1OA 1ZQ3P 5CVIA 3DLAA 2MW8A 1LEBA 1B1BA 1D3YA 2ZJPF 2IPQX 1JT0A 3LSGA 4H0EA 1TP4A 1WJ5A 5DD4A 1MMDA 2VJJA 3N97A 3ZCOA 1PUFA 5D4SA 2EIKH 1X3WB 3P7NA 2HTJA 3FK6A 2BW3A 3K9TA 1EJ9A 1IG7A 4EGZA 1TWGJ 4RB2C 1TC3C 2PEXA 1K6YA 2VJ4A 3CF2A 4A69C 4BJ5C 1GLNA 4XOTA 1MNDA 1T56A 4PGGA 1X1PA 4M72A 4YELA 3HOXJ 4AIDA 4CCKA 4EVIA 4QSHA 3CCVI 2QQBA 3LSRA 1QA6A 3H5AA 4NC7A 3S1QJ 3KX2A 1SVLA 2EJRA 4MIMA 1KYWA 3I4PA 2R7VA 2JRTA 3OYGA 2MG4A 3EETA 1JUSA 3ZQ7A 1MBFA 2P8TA 2COBA 1QPMA 3BTCA 4DZJA 3LQRA 4XK4A 5LD2C 3MZHA 2MA3A 3VB2A 1JKOC 4M3BA 5CQGA 1I27A 1KU3A 4XLNF 2PQ8A 1LFBA 3HC7A
chains in the Genus database with same CATH topology
1S7EA 2E1OA 4S0HB 2VUMJ 3BTLA 3HOWJ 3GTJJ 2VPRA 1O4XA 1GV5A 1RESA 5C3EJ 2EZIA 2DMUA 2CUEA 4D7NA 5IP9J 3S1MJ 1ETQA 4X6AJ 5IP7J 5J1UA 2KT0A 5F0HA 1APLC 2YUSA 1IDZA 1YRNB 4W1UA 2NVQJ 1WH7A 3QPLA 1MH3A 1MBGA 4UUSA 1ETVA 1BA5A 3BR5A 3W6VA 1H8AC 1HOMA 3S15J 2Y2ZA 3OSGA 5F27A 1F43A 3CCYA 1TWFJ 1XC5A 2Y9YA 1WPKA 2Y30A 3CMYA 2HDDA 4FE4A 3VPRA 1FTZA 1EF4A 2DTZA 1ETKA 1QRYA 5FKMA 4BY7J 1E3OC 5JLWA 4IHXA 5F1JA 3JRHA 1JT6A 3O8HA 4FTHA 5E3LA 3G1LA 5FLMJ 1RKWA 2IAIA 4JP0A 5DTDA 3HGGA 4A3IJ 2L0KA 4QIWN 2HOAA 3C2BA 5K7ZA 3WHBA 3HEFA 4JX5A 5IOYA 3OOUA 1WH5A 3JRDA 1XG1A 2ID6A 2HI3A 2LP0A 4JX4A 1Y1VJ 2JJ7A 2LKXA 2EZKA 4Y52J 1G2HA 2NVTJ 3S16J 3QQAA 1GV2A 1RKTA 1MSFC 1NK3P 3S2HJ 3IV5A 2IBDA 1ZR4A 2NVXJ 5JLXA 4A3CJ 5IYCJ 2M2EA 3BTJA 1JUPA 3JRBA 5M5WJ 5GPCA 4FE7A 1ETOA 3O8GA 5E3NA 4A3MJ 1B72B 2R93J 5C44J 3ZOBA 1GT0C 3S2DJ 1JUMA 1IGNA 3HOUJ 3LNQA 4CYCB 2P81A 1JKRC 1POGA 4DYQA 2FQ4A 2FX0A 2YU9J 5E3MA 4C3IJ 1CQTA 1FTTA 1A6IA 1ZTRA 2EQRA 1OFCX 2ME6A 2DMQA 3K2AA 5EG0B 3ZQHA 2OPTA 5K7FA 1WCMJ 2ECBA 1OCTC 3Q0VA 2L7ZA 2M8GX 2R0QC 2E2JJ 5IP6A 2K9SA 1U9NA 1JTYA 3IH2A 2HXIA 2DA4A 2QF7A 1Q1VA 2TRTA 3HBLA 4V2FA 5C4XJ 5EF6A 2XGCA 1IDYA 2XGDA 2K9QA 3GBGA 3GTOJ 1B72A 1H89C 5FKNA 3D1NI 4M3EA 4G12A 2PMZN 4L5EA 1ZKGA 5FJ8J 5EZHA 2DA3A 2LD5A 4XRMA 1ENHA 4CYCA 3TP0A 2E2HJ 3FIWA 3LOCA 3G1MA 4JYKA 2DN0A 5F0CA 1MBHA 4QTRA 3TEDA 1QVTA 2W48A 4Y7NJ 1JKPC 5EG0A 2DMTA 1ETXA 2XPVA 1ZR2A 2ZB9A 1MSEC 4RBOA 3F0CA 5IYDJ 5F08A 1LE8B 4MO7A 5M3MJ 1HDPA 2HOTA 2DA5A 1IRZA 1RETA 3BR2A 5EDNA 3MN2A 2XSDC 4NDLA 3PO2J 2JMWA 3LSPA 1IJWC 2L7MP 2H8RA 2FD5A 2O8KA 1X2MA 2WV1A 3PO3J 1ETWA 4A3KJ 3BG5A 3OSFA 2NS7A 1ZGWA 2DMNA 1GUUA 3GTKJ 3MKLA 5FKKA 2E2IJ 3OIOA 4MFDA 1ETYA 4V2GA 3IH4A 1MH4A 1IV6A 4DZPA 4MLOA 1D5YA 3IH3A 1AHDP 1BL0A 2N8GA 2XB5A 4M3GA 1HF0A 2LY9A 2LK2A 3JRGA 3BTIA 1WI3A 3HM5A 2CJJA 3JRIA 3HGYA 4XIDA 5M5YJ 1YRNA 2CQQA 4I6ZA 9ANTA 1T33A 2R92J 2JWTA 3GTGJ 3GTQJ 2CRGA 3S1RJ 2X6OA 3S14J 3A01B 2E19A 1FIPA 4C3HJ 1VFCA 1BJZA 2LVSA 3DCFA 5GP9A 4FISA 2VKVA 1LFUP 4IHVA 1BW6A 4EEFG 2VI6A 1QPIA 1MBEA 4BBRJ 2CU7A 1PUFB 5HODA 4MFEA 3PM1A 1SANA 2NS8A 1OCPA 1JKQC 1I3QJ 2R5YB 3DEWA 3BR0A 3TW6A 4A3BJ 4B1RA 3GTLJ 4D5FA 4DYCA 2L7FP 1X58A 3BG9A 1P7JA 3ZQIA 2R5ZB 4A3LJ 3CDLA 3Q0WA 3RKQA 2XRLA 3E7LA 4RDUA 3NAUA 3NARA 3A01A 4BXXJ 2CUFA 4A3EJ 2LTPA 2JA8J 5EYRA 2JA7J 3JREA 1JTXA 3JRCA 3S17J 1Z0XA 3K7AJ 3BT9A 4AUXA 2K40A 1HDDC 2GBYA 1DU0A 1F36A 4BKXA 1UG2A 2H1KA 3A02A 3JRFA 3B6CA 1MBKA 4XICA 3RZDJ 5IPAA 2R5YA 3FISA 2JK3A 3FKIJ 2B63J 2XPWA 5J1RA 1JGGA 5EGOB 3ZQCA 2AO9A 4M3DA 5C4JJ 2ID3A 5EZGA 2O9LA 1K61A 1VI0A 4D7MA 4FCYA 4W97A 2MGQA 1HCRA 2HXOA 4A3GJ 2L9RA 3ZQFA 2EZHA 2WB1N 3QPSA 3HOVJ 2XGEA 1H88C 1RR7A 2DJNA 2EH3A 4ABZA 1R9TJ 1K83J 1U78A 2XPUA 4UUSB 2JN6A 3BR6A 4I76A 1MBJA 1A5JA 2LFBA 4D5CA 3BG3A 3BQYA 2KDZA 5DS9A 3M3YJ 1TWCJ 2ME0A 2Y31A 2WAQN 5IOZA 3HOYJ 5M3FJ 2LLKA 4BY1J 3CQZJ 4M3FA 3HOZJ 1UMQA 3A03A 3UKGA 4UUTA 5FKOA 5EEAA 5EGOA 3MVPA 1SFOJ 2VKEA 1W0TA 1VF9A 2M9HA 1AKHB 1I50J 1IUFA 3TP3A 5J3LA 2ELKA 4GFBA 2DMPA 2JA6J 2DA2A 3FK7A 4HNVA 5FKLA 4AC0A 5FLVA 4B4CA 1P7IA 3JRAA 4C2MJ 3RQIA 1I6HJ 2RAEA 3I4NJ 4DW6A 4J19A 3BR1A 4A3DJ 2GM4A 3SFIA 1RPWA 1LE8A 1JJ8C 2YS9A 4C3JJ 1ITYA 5GPAA 2FJ1A 3M4OJ 4XRSA 1ZK8A 3WHCA 1MNMC 4IHWA 1UHSA 2JA5J 2CQXA 3ZQGA 1GDTA 2DA7A 1AKHA 3S1NJ 3SDGA 3L1PA 1W0UA 2GLOA 1IC8A 2ECCA 1B8IB 1GVDA 1WGXA 2X48A 4BBSJ 1OJLA 3HDDA 2HQ5A 4AYBN 1AU7A 1Z77A 2R7ZJ 2QCOA 1TWAJ 3HB9A 1VNDA 4A93J 3JR9A 3LSJA 4IHYA 2TCTA 1HLVA 2LR8A 1JJ6C 4DYRA 3Q0UA 2I10A 2X9DA 3HKZN 1U8BA 2G0EA 5J1YA 3RZOJ 2IEKA 2M0CA 3G1OA 2NOGA 1ZQ3P 5BNGA 2MW8A 2AHQA 4A3JJ 3B6AA 3SJMA 1FIAA 2Y0SN 3BQZA 1JT0A 3TW7A 3LSGA 5IYBJ 2K9NA 2XB0X 3Q3SA 1QVUA 2DA6A 1PUFA 1B8IA 1XS9A 5K7HA 4LOCA 3FK6A 1FJLA 4X1EA 4XRSG 5F0FA 1IG7A 2DA1A 2EZLA 1TWGJ 1TC3C 1NK2P 2M34A 2OF7A 4A69C 2HYJA 1DU6A 1NTCA 5E3OA 2HOSA 2D5VA 1T56A 1TWHJ 2R5ZA 3HOXJ 1Y1WJ 2O7OA 3BR3A 4QSHA 4A3FJ 3GTMJ 2EBIA 3LSRA 3S1QJ 5M5XJ 4JX6A 3H0GJ 4M6VA 4MIMA 1ORKA 1X2NA 3ZQLA 2MSYA 3GTPJ 2MG4A 4B3AA 1JUSA 2NVYJ 3I4MJ 1MBFA 1U9OA 2COBA 1BW5A 3BTCA 4DZJA 5F04A 4XK4A 1JKOC 1FEXA 3H3VK 4M3BA 2Y9ZA 1LFBA 4IEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7E A;  2E1O A;  4S0H B;  2VUM J;  3BTL A;  3HOW J;  3GTJ J;  2VPR A;  1O4X A;  1GV5 A;  1RES A;  5C3E J;  2EZI A;  2DMU A;  2CUE A;  4D7N A;  5IP9 J;  3S1M J;  1ETQ A;  4X6A J;  5IP7 J;  5J1U A;  2KT0 A;  5F0H A;  1APL C;  2YUS A;  1IDZ A;  1YRN B;  4W1U A;  2NVQ J;  1WH7 A;  3QPL A;  1MH3 A;  1MBG A;  4UUS A;  1ETV A;  1BA5 A;  3BR5 A;  3W6V A;  1H8A C;  1HOM A;  3S15 J;  2Y2Z A;  3OSG A;  5F27 A;  1F43 A;  3CCY A;  1TWF J;  1XC5 A;  2Y9Y A;  1WPK A;  2Y30 A;  3CMY A;  2HDD A;  4FE4 A;  3VPR A;  1FTZ A;  1EF4 A;  2DTZ A;  1ETK A;  1QRY A;  5FKM A;  4BY7 J;  1E3O C;  5JLW A;  4IHX A;  5F1J A;  3JRH A;  1JT6 A;  3O8H A;  4FTH A;  5E3L A;  3G1L A;  5FLM J;  1RKW A;  2IAI A;  4JP0 A;  5DTD A;  3HGG A;  4A3I J;  2L0K A;  4QIW N;  2HOA A;  3C2B A;  5K7Z A;  3WHB A;  3HEF A;  4JX5 A;  5IOY A;  3OOU A;  1WH5 A;  3JRD A;  1XG1 A;  2ID6 A;  2HI3 A;  2LP0 A;  4JX4 A;  1Y1V J;  2JJ7 A;  2LKX A;  2EZK A;  4Y52 J;  1G2H A;  2NVT J;  3S16 J;  3QQA A;  1GV2 A;  1RKT A;  1MSF C;  1NK3 P;  3S2H J;  3IV5 A;  2IBD A;  1ZR4 A;  2NVX J;  5JLX A;  4A3C J;  5IYC J;  2M2E A;  3BTJ A;  1JUP A;  3JRB A;  5M5W J;  5GPC A;  4FE7 A;  1ETO A;  3O8G A;  5E3N A;  4A3M J;  1B72 B;  2R93 J;  5C44 J;  3ZOB A;  1GT0 C;  3S2D J;  1JUM A;  1IGN A;  3HOU J;  3LNQ A;  4CYC B;  2P81 A;  1JKR C;  1POG A;  4DYQ A;  2FQ4 A;  2FX0 A;  2YU9 J;  5E3M A;  4C3I J;  1CQT A;  1FTT A;  1A6I A;  1ZTR A;  2EQR A;  1OFC X;  2ME6 A;  2DMQ A;  3K2A A;  5EG0 B;  3ZQH A;  2OPT A;  5K7F A;  1WCM J;  2ECB A;  1OCT C;  3Q0V A;  2L7Z A;  2M8G X;  2R0Q C;  2E2J J;  5IP6 A;  2K9S A;  1U9N A;  1JTY A;  3IH2 A;  2HXI A;  2DA4 A;  2QF7 A;  1Q1V A;  2TRT A;  3HBL A;  4V2F A;  5C4X J;  5EF6 A;  2XGC A;  1IDY A;  2XGD A;  2K9Q A;  3GBG A;  3GTO J;  1B72 A;  1H89 C;  5FKN A;  3D1N I;  4M3E A;  4G12 A;  2PMZ N;  4L5E A;  1ZKG A;  5FJ8 J;  5EZH A;  2DA3 A;  2LD5 A;  4XRM A;  1ENH A;  4CYC A;  3TP0 A;  2E2H J;  3FIW A;  3LOC A;  3G1M A;  4JYK A;  2DN0 A;  5F0C A;  1MBH A;  4QTR A;  3TED A;  1QVT A;  2W48 A;  4Y7N J;  1JKP C;  5EG0 A;  2DMT A;  1ETX A;  2XPV A;  1ZR2 A;  2ZB9 A;  1MSE C;  4RBO A;  3F0C A;  5IYD J;  5F08 A;  1LE8 B;  4MO7 A;  5M3M J;  1HDP A;  2HOT A;  2DA5 A;  1IRZ A;  1RET A;  3BR2 A;  5EDN A;  3MN2 A;  2XSD C;  4NDL A;  3PO2 J;  2JMW A;  3LSP A;  1IJW C;  2L7M P;  2H8R A;  2FD5 A;  2O8K A;  1X2M A;  2WV1 A;  3PO3 J;  1ETW A;  4A3K J;  3BG5 A;  3OSF A;  2NS7 A;  1ZGW A;  2DMN A;  1GUU A;  3GTK J;  3MKL A;  5FKK A;  2E2I J;  3OIO A;  4MFD A;  1ETY A;  4V2G A;  3IH4 A;  1MH4 A;  1IV6 A;  4DZP A;  4MLO A;  1D5Y A;  3IH3 A;  1AHD P;  1BL0 A;  2N8G A;  2XB5 A;  4M3G A;  1HF0 A;  2LY9 A;  2LK2 A;  3JRG A;  3BTI A;  1WI3 A;  3HM5 A;  2CJJ A;  3JRI A;  3HGY A;  4XID A;  5M5Y J;  1YRN A;  2CQQ A;  4I6Z A;  9ANT A;  1T33 A;  2R92 J;  2JWT A;  3GTG J;  3GTQ J;  2CRG A;  3S1R J;  2X6O A;  3S14 J;  3A01 B;  2E19 A;  1FIP A;  4C3H J;  1VFC A;  1BJZ A;  2LVS A;  3DCF A;  5GP9 A;  4FIS A;  2VKV A;  1LFU P;  4IHV A;  1BW6 A;  4EEF G;  2VI6 A;  1QPI A;  1MBE A;  4BBR J;  2CU7 A;  1PUF B;  5HOD A;  4MFE A;  3PM1 A;  1SAN A;  2NS8 A;  1OCP A;  1JKQ C;  1I3Q J;  2R5Y B;  3DEW A;  3BR0 A;  3TW6 A;  4A3B J;  4B1R A;  3GTL J;  4D5F A;  4DYC A;  2L7F P;  1X58 A;  3BG9 A;  1P7J A;  3ZQI A;  2R5Z B;  4A3L J;  3CDL A;  3Q0W A;  3RKQ A;  2XRL A;  3E7L A;  4RDU A;  3NAU A;  3NAR A;  3A01 A;  4BXX J;  2CUF A;  4A3E J;  2LTP A;  2JA8 J;  5EYR A;  2JA7 J;  3JRE A;  1JTX A;  3JRC A;  3S17 J;  1Z0X A;  3K7A J;  3BT9 A;  4AUX A;  2K40 A;  1HDD C;  2GBY A;  1DU0 A;  1F36 A;  4BKX A;  1UG2 A;  2H1K A;  3A02 A;  3JRF A;  3B6C A;  1MBK A;  4XIC A;  3RZD J;  5IPA A;  2R5Y A;  3FIS A;  2JK3 A;  3FKI J;  2B63 J;  2XPW A;  5J1R A;  1JGG A;  5EGO B;  3ZQC A;  2AO9 A;  4M3D A;  5C4J J;  2ID3 A;  5EZG A;  2O9L A;  1K61 A;  1VI0 A;  4D7M A;  4FCY A;  4W97 A;  2MGQ A;  1HCR A;  2HXO A;  4A3G J;  2L9R A;  3ZQF A;  2EZH A;  2WB1 N;  3QPS A;  3HOV J;  2XGE A;  1H88 C;  1RR7 A;  2DJN A;  2EH3 A;  4ABZ A;  1R9T J;  1K83 J;  1U78 A;  2XPU A;  4UUS B;  2JN6 A;  3BR6 A;  4I76 A;  1MBJ A;  1A5J A;  2LFB A;  4D5C A;  3BG3 A;  3BQY A;  2KDZ A;  5DS9 A;  3M3Y J;  1TWC J;  2ME0 A;  2Y31 A;  2WAQ N;  5IOZ A;  3HOY J;  5M3F J;  2LLK A;  4BY1 J;  3CQZ J;  4M3F A;  3HOZ J;  1UMQ A;  3A03 A;  3UKG A;  4UUT A;  5FKO A;  5EEA A;  5EGO A;  3MVP A;  1SFO J;  2VKE A;  1W0T A;  1VF9 A;  2M9H A;  1AKH B;  1I50 J;  1IUF A;  3TP3 A;  5J3L A;  2ELK A;  4GFB A;  2DMP A;  2JA6 J;  2DA2 A;  3FK7 A;  4HNV A;  5FKL A;  4AC0 A;  5FLV A;  4B4C A;  1P7I A;  3JRA A;  4C2M J;  3RQI A;  1I6H J;  2RAE A;  3I4N J;  4DW6 A;  4J19 A;  3BR1 A;  4A3D J;  2GM4 A;  3SFI A;  1RPW A;  1LE8 A;  1JJ8 C;  2YS9 A;  4C3J J;  1ITY A;  5GPA A;  2FJ1 A;  3M4O J;  4XRS A;  1ZK8 A;  3WHC A;  1MNM C;  4IHW A;  1UHS A;  2JA5 J;  2CQX A;  3ZQG A;  1GDT A;  2DA7 A;  1AKH A;  3S1N J;  3SDG A;  3L1P A;  1W0U A;  2GLO A;  1IC8 A;  2ECC A;  1B8I B;  1GVD A;  1WGX A;  2X48 A;  4BBS J;  1OJL A;  3HDD A;  2HQ5 A;  4AYB N;  1AU7 A;  1Z77 A;  2R7Z J;  2QCO A;  1TWA J;  3HB9 A;  1VND A;  4A93 J;  3JR9 A;  3LSJ A;  4IHY A;  2TCT A;  1HLV A;  2LR8 A;  1JJ6 C;  4DYR A;  3Q0U A;  2I10 A;  2X9D A;  3HKZ N;  1U8B A;  2G0E A;  5J1Y A;  3RZO J;  2IEK A;  2M0C A;  3G1O A;  2NOG A;  1ZQ3 P;  5BNG A;  2MW8 A;  2AHQ A;  4A3J J;  3B6A A;  3SJM A;  1FIA A;  2Y0S N;  3BQZ A;  1JT0 A;  3TW7 A;  3LSG A;  5IYB J;  2K9N A;  2XB0 X;  3Q3S A;  1QVU A;  2DA6 A;  1PUF A;  1B8I A;  1XS9 A;  5K7H A;  4LOC A;  3FK6 A;  1FJL A;  4X1E A;  4XRS G;  5F0F A;  1IG7 A;  2DA1 A;  2EZL A;  1TWG J;  1TC3 C;  1NK2 P;  2M34 A;  2OF7 A;  4A69 C;  2HYJ A;  1DU6 A;  1NTC A;  5E3O A;  2HOS A;  2D5V A;  1T56 A;  1TWH J;  2R5Z A;  3HOX J;  1Y1W J;  2O7O A;  3BR3 A;  4QSH A;  4A3F J;  3GTM J;  2EBI A;  3LSR A;  3S1Q J;  5M5X J;  4JX6 A;  3H0G J;  4M6V A;  4MIM A;  1ORK A;  1X2N A;  3ZQL A;  2MSY A;  3GTP J;  2MG4 A;  4B3A A;  1JUS A;  2NVY J;  3I4M J;  1MBF A;  1U9O A;  2COB A;  1BW5 A;  3BTC A;  4DZJ A;  5F04 A;  4XK4 A;  1JKO C;  1FEX A;  3H3V K;  4M3B A;  2Y9Z A;  1LFB A;  4IEJ A; 
#chains in the Genus database with same CATH topology
 3E5Q A;  2W84 A;  1XSX A;  3AG2 H;  3HOW J;  3W3C A;  1S9H A;  5E8I A;  1O4X A;  3M1C A;  4UVC A;  1GV5 A;  4M6X A;  3CO7 C;  3OYD A;  4L18 B;  2EZI A;  2XV4 S;  2JRM A;  1ONV A;  2CUE A;  4LMY A;  1FX7 A;  4D7N A;  4UUV A;  3WGI A;  2DJI A;  4X6A J;  4PJN A;  1QZE A;  5IP7 J;  2DU9 A;  2AQF A;  2KT0 A;  4ZYH A;  1IDZ A;  2K5C A;  1YRN B;  1G3T A;  4LD5 A;  3CCQ I;  3EUH A;  1MH3 A;  1MBG A;  4OIP F;  3C7J A;  1BA5 A;  1BIB A;  2DK8 A;  4ON0 A;  3V8L A;  2Z9O A;  3OYE A;  4U0Y A;  3SEZ A;  2DI3 A;  2OA4 A;  2Y2Z A;  5F27 A;  1XCV A;  4CH7 A;  1F43 A;  1TWF J;  3L00 A;  1WPK A;  2DPU A;  3S93 A;  1X1A A;  5B66 C;  4FE4 A;  1FTZ A;  2HWV A;  2L54 A;  1EF4 A;  4BY7 J;  3I64 A;  1W7P D;  4KN7 X;  2CQN A;  3ESW B;  1ZLJ A;  2NRA C;  3PUF A;  4I0B A;  4OWR B;  4ESF A;  2R7O A;  1UAA A;  1JT6 A;  2BXZ A;  3QPH A;  2IAI A;  4LK1 F;  2OBP A;  3SZP A;  5DTD A;  3DEU A;  3DLL F;  1YW8 A;  3LSH A;  2L0K A;  3I59 A;  1AA7 A;  2W1O A;  2HOA A;  3C2B A;  5EEH A;  2P6T A;  4JX5 A;  3WTX C;  4M6Y A;  1PYV A;  2V26 A;  3OOU A;  3QYE A;  5K5O A;  3KE2 A;  2ID6 A;  4HG2 A;  4Z2Y A;  2PI0 A;  3L09 A;  2BHZ A;  2M0M A;  2ZME A;  1W36 C;  1Y1V J;  3CDI A;  3DF8 A;  4DIQ A;  2NVT J;  2PMZ A;  2DCE A;  5L3E A;  4R8H A;  1HW5 A;  3IV5 A;  2ISZ A;  2IBD A;  4E4H A;  4RB1 A;  2EV0 A;  2JA2 A;  1HC8 A;  5JLX A;  4A3C J;  1TQI A;  3W6K B;  1KU7 A;  2HR3 A;  2H09 A;  2EV6 A;  3Q9S A;  2M2E A;  4UNO A;  3OS0 A;  3F23 A;  2V1U A;  5M5W J;  4FE7 A;  2CQ7 A;  1ETO A;  4UVB A;  5E3N A;  2ACJ A;  3IP4 B;  2J5P A;  2X85 A;  1VQ9 I;  2HGC A;  2KMU A;  5ILS A;  2Y69 H;  2XF6 A;  3DTE A;  2VJ5 A;  3HOU J;  2KJC A;  2X1D A;  2F5D A;  1MZB A;  2GQQ A;  5TRD A;  4CZZ A;  2FQ4 A;  4CCL A;  1G59 A;  3DU5 A;  4C3I J;  5DM6 F;  2XKP A;  1IXC A;  4DNC A;  1FTT A;  1SMY F;  1ZTR A;  2KLO A;  2UXN A;  3K2A A;  2OPT A;  2X6Y A;  1WCM J;  4IRG A;  4N9H A;  2RRE A;  3TO7 A;  2E2J J;  3ZGK A;  5IP6 A;  2K3F A;  1U9N A;  3K2Z A;  2HXI A;  4NQW B;  2DA4 A;  3J7A O;  2QF7 A;  3ECH A;  4AVP A;  4AVZ A;  2CFO A;  3BG6 A;  2DBB A;  5EF6 A;  5DM7 F;  1IDY A;  3LA2 A;  3JW4 A;  3PSF A;  1J7K A;  3CJN A;  4KIB A;  4OAY A;  1H89 C;  5FKN A;  4M3E A;  4XLC A;  4ZDL A;  4RAF A;  4NUB A;  4OMZ A;  3OS2 A;  1O3R A;  1ZKG A;  3BJO A;  1YQA A;  2DA3 A;  4L9J A;  3TP0 A;  3HTS B;  2EPF A;  3DKW A;  2X4H A;  4GRI A;  3G1M A;  3W2A A;  2DN0 A;  2HS5 A;  3FXR A;  4QTR A;  2HZD A;  1R58 A;  2F4M B;  4PJJ A;  2HVR A;  1XB4 A;  3CJQ B;  2W48 A;  4G8X A;  4TV7 A;  1JKP C;  3B02 A;  2DMT A;  4WF2 A;  3IUO A;  4RBO A;  1FBU A;  3LMM A;  3SQN A;  5CVR A;  1EA3 A;  3O6B B;  3O3K A;  4F92 B;  3GLX A;  2DT7 B;  4HAM A;  2JSP A;  5CYV A;  3R0J A;  4E7S A;  1Y39 A;  2HOT A;  3TO9 A;  4NQW A;  5HLT A;  2KP6 A;  2AXL A;  3J81 Z;  3BR2 A;  3WU2 C;  5EDN A;  3G4S I;  3BY6 A;  3F8M A;  3JTH A;  3KEO A;  1XMX A;  5CVU A;  2MLK A;  2FOK A;  2WV1 A;  3RQ4 A;  1ETW A;  2XF7 A;  4EQQ A;  3BG5 A;  5JI6 A;  4A3K J;  3A2K A;  3CZ6 A;  2NS7 A;  3OSF A;  4OIR F;  4NBQ A;  2DMN A;  1G6N A;  4HST A;  4RM3 A;  5BS6 A;  3I9V 2;  3OIO A;  2V9V A;  5DDG A;  2L5Q A;  2MC4 A;  4II3 A;  1ZHF A;  3IH4 A;  1S72 I;  1IV6 A;  2DO7 A;  4OU0 A;  3HPH A;  2JPC A;  3QWL A;  3OMY A;  2LSO A;  1D1A A;  3WTT C;  4RAG A;  2VQC A;  1LUJ B;  3FKJ A;  3DXJ F;  1ERD A;  2VAS A;  2P5K A;  5HDG A;  4HF2 A;  3HGY A;  4XID A;  4G7Z F;  3MKZ A;  1T33 A;  4BHB A;  2R7X A;  2OTL I;  5CVJ A;  4A5M A;  4ZJZ A;  5GAD J;  1JHF A;  1R1U A;  3ABU A;  1R5G A;  1O3T A;  3A01 B;  1FIP A;  4M73 A;  1XMA A;  2VKV A;  3HYI A;  1LFU P;  1VQP I;  3TO6 A;  2EK5 A;  2NNY A;  3AAF A;  3D0S A;  5D6F A;  2DYS H;  2FUG 2;  1R5H A;  4MFE A;  2Z33 A;  2IS4 A;  2F6C A;  4ZZD A;  1BN5 A;  2NS8 A;  3M8E A;  4CCN A;  1FOY A;  1O3Q A;  4G7O F;  1ZG3 A;  2R5Y B;  1R4M B;  4MGR A;  1QHH D;  3V7S A;  2V79 A;  2WAE A;  4D5F A;  4HPQ A;  1R23 A;  3BG9 A;  2XDV A;  3LWF A;  4YG2 F;  2I5U A;  2E5Z A;  1T98 A;  1W5C C;  1E2X A;  1YX3 A;  1WVR A;  2R7F A;  4NB5 A;  3A01 A;  2LTP A;  3WGG A;  3AL0 C;  1L0O C;  4IJA A;  3JRE A;  2RNG A;  2QYO A;  1IN5 A;  1SD7 A;  4BL0 B;  1Z0X A;  3K7A J;  2E1M B;  2E1N A;  3U9G A;  5CKT A;  4A0Y A;  3MCZ A;  3SXY A;  1TT0 A;  2P6S A;  1UG2 A;  1RRJ A;  2H1K A;  1Y6I A;  2VE9 A;  3B6C A;  3FF5 A;  3VFZ A;  3KZY A;  3Q9V A;  3J7A Y;  2R5Y A;  3FIS A;  5ICE A;  2JK3 A;  4BQQ A;  1YIT I;  1F1Z A;  4L0Y B;  5EGO B;  4M3D A;  4UHT A;  1IO2 A;  4BEH A;  1XD7 A;  3O2P E;  3ZMV A;  1K61 A;  3V7C A;  3OYB A;  4NC8 A;  1VI0 A;  1I1G A;  1IW7 F;  1R1V A;  2V6C A;  3WGH A;  1HCR A;  1DPU A;  3CMM A;  1KQ0 A;  1IAW A;  5D6E A;  2A07 F;  4KMU X;  2XAH A;  2XGE A;  3VYR B;  5ICF A;  2DJN A;  3CUQ C;  1K83 J;  2XPU A;  4UVA A;  4I01 A;  3BC8 A;  3CJT B;  4I76 A;  4BE0 A;  4XN0 A;  4LLL A;  1MBJ A;  3BQY A;  2FMY A;  4UV8 A;  1SD6 A;  4Y33 A;  2K4J A;  3DBR B;  3FXK A;  1TWC J;  1WKM A;  5F1R A;  1FBQ A;  3DFG A;  4HNT A;  3QOP A;  3HOZ J;  2FA5 A;  2R7U A;  4UUT A;  3CUO A;  5EGO A;  3GME A;  5E1W A;  2OU2 A;  2VKE A;  1VF9 A;  1AKH B;  2DYR H;  2K7L A;  1HKT A;  4ZTJ A;  1MNE A;  5J3L A;  2ELK A;  1ON2 A;  1UEL B;  3BOQ A;  1BOA A;  3OYA A;  4C2M J;  3TDU C;  1UG0 A;  3HG9 A;  4O5V A;  4U7B A;  4XN3 A;  2GM4 A;  3MKY B;  4Y4R A;  1LDK B;  3K4B A;  2ZBK A;  1RPW A;  3H3U A;  3GZ6 A;  4P1W A;  2Y0S A;  2YS9 A;  5H2F C;  3ASO H;  4ZYG A;  2GXA A;  1FP1 D;  3BCA A;  5B5E C;  1IN7 A;  2FF4 A;  4XRS A;  1ZK8 A;  2ZNY A;  3CDH A;  3KP3 A;  1MNM C;  3MEX A;  3DPU A;  1S7O A;  4XSZ F;  4AM3 A;  2CQX A;  2KZG A;  2P5V A;  2VBW A;  4Q5S F;  1P9Q C;  2X6W A;  3BZC A;  5GTI C;  1AKH A;  5LRR A;  1MJ9 A;  3G73 A;  3S1N J;  3SDG A;  3FM3 A;  3L1P A;  1OR7 C;  2RNJ A;  3LSM A;  2H27 A;  2UV1 A;  2QZ8 A;  2HTS A;  2H94 A;  3K1M A;  1D8K A;  1AWC A;  1B8I B;  1GVD A;  2DLL A;  5DUK A;  2GIZ A;  4ENN A;  2R7Z J;  1Z77 A;  3KLO A;  4Q48 A;  4IZZ A;  3S3M A;  2OJE D;  4A6D A;  4KYW A;  1XGM A;  1B4A A;  5J4V A;  1QBJ A;  1H9T A;  1JJ6 C;  2O5R A;  3Q0U A;  3CMA I;  2L01 A;  3CP2 A;  1BR4 A;  2BV6 A;  2FSW A;  2IEK A;  1R7J A;  1T08 B;  4M74 A;  4PDK A;  1DGR M;  2NOG A;  3RPQ A;  1AOY A;  2W24 A;  4XNF A;  2VOO A;  2G7U A;  2IA1 A;  1FIA A;  3OL4 A;  5IYB J;  4Y15 A;  1IUY A;  1MMG A;  1B8I A;  3R60 A;  4QPQ A;  4LK0 F;  5HLG A;  3HOT A;  3ZXS A;  4XKB A;  2E7X A;  1X1C A;  1Y0N A;  3QP5 A;  1J09 A;  5F0F A;  2EZL A;  2OAZ A;  3WG9 A;  4XLF A;  1W5S A;  2WBM A;  1KQ8 A;  3DPL C;  2A69 F;  4RAY A;  2IW5 A;  1NTC A;  3ZP5 A;  2VB6 A;  5FRM A;  2XVC A;  3LA7 A;  3F8C A;  2R5Z A;  1Y1W J;  2ESN A;  2VKD A;  3GW2 A;  2B0L A;  2O7O A;  2EBI A;  3P9C A;  3HHG A;  4L0Z B;  3QP6 A;  2VBX A;  3KP7 A;  5M5X J;  5F64 A;  5AIP A;  4JX6 A;  3LAP A;  2KIS A;  1MMS A;  1HBX G;  4R1H A;  2KQR A;  3ZQL A;  1BI2 A;  3ZMT A;  4PK4 A;  1U9O A;  4BE1 A;  4L9V A;  1ZYR F;  2MAB A;  1N25 A;  1WJE A;  4XLH A;  5A2Q Z;  4ZTF A;  2VON A;  1KGS A;  3FHN A;  1T0F C;  5F6F A;  2EA4 A;  1S8N A;  1JKQ C;  2HQR A;  3DEE A;  4IEJ A;  3S3N A;  3IAM 2;  1WSU A;  3BTL A;  3T5X A;  4ETS A;  3GTJ J;  3ZMU A;  1BI1 A;  4HDV A;  2PJP A;  5H6Q A;  1VQO I;  2IT0 A;  5C3E J;  1OQY A;  3R6S A;  3F8F A;  2LOO A;  3S1M J;  3DPT A;  3NWS A;  4L5J A;  1U0J A;  5J1U A;  5F0H A;  2VT3 A;  1T39 A;  2YUS A;  2NVQ J;  1BC7 C;  2KDO A;  3ISP A;  3TOA A;  3E97 A;  3BR5 A;  1QQI A;  1H8A C;  3W6V A;  4H4K C;  1HOM A;  4KT6 A;  5FD5 A;  3DU6 A;  3OYK A;  5IT3 A;  3PFI A;  5J47 A;  4BQN A;  4AIJ A;  3OSG A;  3SFZ A;  2QKM B;  1Z6R A;  3CCY A;  2AXT C;  2Y30 A;  2V9P A;  3BPX A;  3Q5F A;  2K3P A;  4DBQ A;  1Z91 A;  3BDD A;  3S8P A;  3VPR A;  2LRD A;  3WTY C;  2DTZ A;  5K1Y A;  3KPH A;  2HFH A;  4PGH A;  4RA2 A;  5FKM A;  3HHH A;  1IRX A;  4OIQ F;  4IHX A;  4HV5 A;  5F1J A;  3JRH A;  3O8H A;  5E3L A;  4F52 A;  1IZ1 A;  3G1L A;  5FLM J;  1RKW A;  5HDN A;  4MEY F;  2O03 A;  3D5S C;  3JAM K;  4A3I J;  3HGG A;  1VQM I;  2DAO A;  4CA0 A;  2CWE A;  2BGC A;  4CIC A;  4UB6 C;  3WTV C;  1HXD A;  3JRD A;  4EJU A;  1D0Z A;  4BNC A;  3KYD B;  1ACI A;  4CDG A;  3GF2 A;  5JVG F;  1ZG1 A;  1Y8R B;  3S16 J;  3QQA A;  1GV2 A;  2KHM A;  1SFK A;  3GXO A;  2KPM A;  4E7K A;  1OCO H;  3ML6 A;  1C0W A;  2KFD A;  4RB3 C;  1QO0 D;  1XN7 A;  3J80 Z;  3VWB A;  3CCU I;  5GPC A;  3PIO F;  1IRG A;  3O8G A;  3EYI A;  2WV0 A;  5B1B H;  1X4P A;  1X4O A;  1Q1H A;  1KON A;  1S29 A;  3SHF A;  5D5W B;  3S2D J;  1JUM A;  4HEA 2;  4D9J A;  3EDP A;  2HU9 A;  3BLY A;  3OL3 A;  2A68 F;  1POG A;  2DQL A;  4P55 A;  1P4X A;  3PSI A;  1R6R A;  2IA2 A;  5CVV A;  3OYF A;  4C30 A;  4MQV A;  4B09 A;  2HPI A;  1HST A;  3E3V A;  1SEU A;  5EG0 B;  3ZQH A;  1P4W A;  2ELJ A;  1FLI A;  1OCT C;  1F9N A;  3FWE A;  1QU3 A;  1OYY A;  2R0Q C;  1J59 A;  2A6H F;  3FBI B;  4CCM A;  4HW0 A;  2CG4 A;  1Q1V A;  2F5V A;  5HOO A;  2K9M A;  5C4X J;  2XGC A;  1R22 A;  2GA2 A;  2ELH A;  1ZG5 A;  3GTO J;  3SZT A;  2CH0 A;  3DV8 A;  1E3P A;  3SDB A;  4G12 A;  2PMZ N;  1Z6T A;  3I0T A;  4L5E A;  3LFK A;  4ESB A;  4XRM A;  1MDM B;  2E2H J;  3F21 A;  4F93 B;  2ZJR F;  4JQF A;  4ANJ A;  4UY8 I;  1SD5 A;  3MMY B;  3G71 I;  4PJ0 C;  1KZH A;  1TQP A;  4ZDO A;  2PJR B;  5LEJ A;  5EG0 A;  4WXD A;  4LG3 A;  5IYD J;  2MH2 A;  4K2E A;  2EIL H;  2Z1D A;  5F08 A;  3U2R A;  3OYL A;  2IJL A;  4RGS A;  4CHU A;  1YLF A;  5M3M J;  1QZZ A;  2LKS A;  2L9S A;  3IKT A;  4XLA A;  2BXY A;  4RM2 A;  3PO2 J;  5FFX A;  3DBL B;  2QEN A;  1IJW C;  1FSE A;  2L7M P;  2FD5 A;  2LC2 A;  1K4T A;  2ZCW A;  3BG7 A;  5H6R A;  2EFO A;  2KL4 A;  2Z99 A;  1A6Q A;  1SD4 A;  3L9F A;  5J8C A;  1PDN C;  2E7W A;  1XDU A;  4I7H A;  3RKX A;  1MDM A;  3H36 A;  3VDX A;  2F4O B;  2RV8 A;  1LKX A;  1YS7 A;  4MFD A;  3OOP A;  3CCL I;  1Z3X A;  1OCR H;  3CUQ B;  4XON A;  3L2R A;  3H92 A;  1O57 A;  2CV2 A;  1RI7 A;  2E35 A;  3KP4 A;  4MLO A;  2PJR A;  1REP C;  1ZH5 A;  2EA2 A;  3FBN B;  4BJ6 C;  3ABL H;  4M3G A;  1U5T C;  2X1C A;  2LK2 A;  1WI9 A;  3JRG A;  1FYK A;  1T6S A;  3KZZ A;  4IO9 F;  5HVQ C;  1WI3 A;  5J4Y A;  3JRI A;  2H1L A;  1GXP A;  1YRN A;  2PLY A;  1XDS A;  4B43 A;  2CQQ A;  4I6Z A;  1R00 A;  2V6E A;  2D1H A;  4AIH A;  4JK1 X;  3F8N A;  2DOF A;  1TT5 B;  2JWT A;  3GTQ J;  2CRG A;  1IXS B;  3M8J A;  2M45 A;  1F5T A;  3T1B A;  3S14 J;  2ETH A;  1ON1 A;  2E19 A;  2XSJ C;  2HVS A;  4C3H J;  2NNN A;  5HLI A;  4FIS A;  5LRS A;  3GX4 X;  2M5W A;  3MFK A;  1IN6 A;  2FRH A;  1MBE A;  4HRI A;  2OCE A;  1VTN C;  5HOD A;  3PM1 A;  2IGN A;  1SAN A;  2WB1 A;  1VQL I;  1FP2 A;  2VOP A;  2V1N A;  4C9Y A;  3BR0 A;  1T8I A;  5L3G A;  4BE2 A;  4B1R A;  3K1P A;  3QRF F;  3RSN A;  1FYM A;  3COA C;  1X58 A;  2A5Y B;  4AWX B;  2TDX A;  5DCM B;  4B44 A;  5TIS C;  3HRU A;  3GEZ A;  2ZFU A;  4HF0 A;  2ZO4 A;  5J6X A;  3ABT A;  4HX8 A;  3LFU A;  3OYM A;  3HRT A;  5KAI C;  3UR3 C;  4ESJ A;  3Q0W A;  5GAE J;  1LQ1 A;  4RDU A;  4J00 A;  1VQN I;  2J5O A;  4GGG A;  2XRO A;  4A3E J;  3TGN A;  2JA8 J;  5EYR A;  1UZC A;  3CC2 I;  1D8J A;  3EUK L;  1JTX A;  3U21 A;  3JRC A;  1NH3 A;  1V5G A;  1TBX A;  1X1B A;  3I55 I;  3CCE I;  4WWC A;  4AUX A;  1M1E B;  2DFF A;  2RGV A;  5HS9 A;  3GWZ A;  2VQH A;  1F36 A;  2QBY B;  2Y48 A;  1D1B A;  1RNL A;  3A02 A;  2ISY A;  2IRF G;  2JVH A;  1I1S A;  2XPW A;  1XSD A;  5J1R A;  1JGG A;  1XGS A;  3ZQC A;  1OIS A;  1K79 A;  5DCM A;  2ID3 A;  2BE5 F;  2IVM A;  3AFH A;  3DKY A;  2KIQ A;  1KQ9 A;  1S3J A;  1S7A A;  3F6O A;  3FXU A;  4D7M A;  1ZGA A;  4W97 A;  4KIT B;  2HXO A;  3PUB A;  1Z3Y A;  4WXH A;  4G6Q A;  4A3G J;  3ZQF A;  1RR7 A;  4ABZ A;  5FFZ A;  1R9T J;  2VT2 A;  3HJE A;  3ABM H;  4UUS B;  3GFI A;  3BR6 A;  2ZC2 A;  5HNH A;  2LFB A;  3M3Y J;  2QBY A;  1RC9 A;  1UFM A;  2PX9 A;  2EFQ A;  4XKV A;  2H6C A;  2ZJ2 A;  1P2F A;  2L7K A;  3OY9 A;  1HKS A;  3HOY J;  5M3F J;  4I99 C;  2LLK A;  2OZ6 A;  3PJR A;  4AYB A;  1UMQ A;  5GAH J;  3UKG A;  1Z21 A;  2CS3 A;  3M9A A;  4WK8 F;  2OD5 A;  2WY8 Q;  2L02 A;  4BQO A;  4LB6 B;  1SFO J;  1LVK A;  2WTE A;  2EV5 A;  2OV7 A;  2Z5U A;  1I50 J;  3LST A;  3J81 K;  3L2Q A;  2HKX A;  2O8X A;  2KKO A;  1WJD A;  2GOX B;  3HSF A;  3HKZ A;  5B1A H;  3RTR A;  3ZN0 A;  3L2W A;  4EM1 A;  5FKL A;  4AC0 A;  2VL8 A;  5FLV A;  1P7I A;  2DOE A;  3KZI C;  3E1S A;  1F4K A;  2M4G A;  1TL8 A;  3I4N J;  2A3S A;  2OC6 A;  3FXJ A;  1Z1D A;  2M1B A;  2QKL B;  3CF5 F;  1Z9C A;  4KJZ A;  2LBF B;  3BZK A;  1G3W A;  3C2G A;  5GPA A;  2QM3 A;  2FJ1 A;  1KU9 A;  4HLY A;  5D8K B;  4BHP A;  4I2O A;  3FXL A;  3ZQQ A;  2CSO A;  2XAS A;  3WHC A;  1IN8 A;  4RLF A;  5AON A;  2CV0 A;  4IHW A;  2OCC H;  2MFZ A;  3E5X A;  1UHS A;  2JA5 J;  3ZQG A;  3CME I;  2NYX A;  2DDB A;  4IOA F;  4ZYA A;  2EFN A;  1RR8 C;  3OR1 C;  3K4J A;  1XGO A;  2GLO A;  1UHW A;  1X3Z B;  3ZMS A;  2KRC A;  1IC8 A;  1EKE A;  1LDJ A;  3C3W A;  3H9Q A;  4BBS J;  2K86 A;  4WX9 A;  4XOR A;  2UZK A;  1OJL A;  3HDD A;  2W82 A;  1V5F A;  1TWA J;  4A93 J;  1VND A;  1T0F A;  3JR9 A;  2LBF A;  3F6V A;  3MAJ A;  1N78 A;  5FRN A;  1HLV A;  3PNT A;  4XKC A;  3TQN A;  2QUF A;  4FET A;  1HW2 A;  1OMI A;  4JOM A;  2NS0 A;  3H35 A;  4IPA A;  1TQM A;  3TBI A;  5J1Y A;  3NRV A;  3AG4 H;  3J7Y J;  1XCB A;  3N05 A;  1RZ4 A;  1B9M A;  1BI3 A;  2Y0S N;  2F5C A;  1R1T A;  3OYN A;  4UXN A;  2XB0 X;  3IWF A;  1QVU A;  2HDW A;  2DA6 A;  3PIP F;  3CO6 C;  2O3F A;  4HX4 A;  1XS9 A;  1YIO A;  2DT6 A;  2DXI A;  5K7H A;  3EUH C;  2A6T A;  5E8G A;  3TOB A;  2K27 A;  3EUA A;  3OYH A;  4X1E A;  4U87 A;  3SZG A;  2YX7 A;  2KIM A;  1B9N A;  4IL6 C;  2ZXJ A;  1NK2 P;  2M34 A;  2GOM A;  1I3A A;  4CO8 A;  5E3O A;  1W5T A;  2IS1 A;  2D5V A;  3ZR8 X;  2LY1 A;  1P6R A;  3CLQ A;  5KAF C;  4RLQ A;  5L3D A;  3GTM J;  2LDU A;  4A3F J;  3H1C A;  2QSF X;  1YJN I;  4BQA A;  5BOX A;  3H0G J;  1WJF A;  2H8W A;  4M6V A;  1D0Y A;  2VC1 A;  5CJ9 A;  1VQ5 I;  4EM0 B;  2MSY A;  3GTP J;  4LJZ F;  4ZYD A;  5IY5 H;  3CC4 I;  2CW0 F;  2NVY J;  2STT A;  3ULQ B;  2W7N A;  5KNL A;  2O61 A;  1DDN A;  4FX4 A;  5F04 A;  3ZMD A;  4DQ2 A;  1JI8 A;  3H3V K;  1VQK I;  3MD2 A;  4B3X A;  2Y9Z A;  5IT9 Z;  2ZME C;  2CJJ A;  1S7E A;  2E1O A;  4S0H B;  3WTS C;  4L5I A;  2HDC A;  2CMP A;  3DTI A;  4B8X A;  3A0H C;  3NWT A;  1V54 H;  5FGM A;  2QWW A;  2KRF A;  4E7J A;  3RI4 A;  1FWZ A;  2DMU A;  4MEX F;  2NVU B;  1YFH A;  1OYW A;  5IP9 J;  4FQG A;  2BY1 A;  1A04 A;  3ERE D;  1MJA A;  3E0J B;  1T2K A;  3HPG A;  3QPL A;  1XGN A;  3U1K A;  1ETV A;  5EJC A;  5FLX K;  2E60 A;  2VPL A;  4M71 A;  2RQQ A;  3S15 J;  3I58 A;  2FML A;  2K02 A;  2HYG D;  2AS5 F;  2F5F A;  1MKM A;  1XC5 A;  4RMN A;  2BYV E;  4X0G A;  4EV0 A;  4D0P A;  1O7L A;  4PSW A;  1ETK A;  1QRY A;  3FZV A;  1YS6 A;  4BAY A;  2FNA A;  3HUG B;  2XAJ A;  5JLW A;  1Z05 A;  1XPX A;  2XHK A;  2Z2S B;  3CTA A;  4A12 A;  4JP0 A;  4YFK F;  2RDP A;  4RGU A;  3RJP A;  2A61 A;  1SMT A;  2QGU A;  2BY2 A;  4QIW N;  4KMF A;  3WHB A;  1K7A A;  4XOP A;  5IOY A;  2R7Q A;  1YHQ I;  3OWT A;  4IRH A;  3W2W A;  1KYZ A;  2H6B A;  1XG1 A;  3RKY A;  2JT1 A;  4CYD A;  4IX7 A;  2JPB A;  3KEQ A;  4KIS A;  3FMQ A;  4ZDP A;  1GHC A;  2JQ7 A;  1YIJ I;  5LHH A;  2LP0 A;  3JTG A;  2IS2 A;  3BPV A;  4Y52 J;  1G2H A;  2QSG X;  5LBQ A;  3REO A;  5J40 A;  4OIN F;  1MSF C;  2M7A A;  2CUZ A;  3S2H J;  2MC3 A;  2X0L A;  3IAS 2;  5LLQ A;  1JXS A;  2OZU A;  1ZR4 A;  2NVX J;  4KA4 A;  3HUG A;  2VC0 A;  3CJR B;  2IS6 A;  2G7H A;  5JVT A;  4BU2 A;  3HSE A;  2P5L C;  3L2C A;  4LG0 B;  2JUC A;  5H20 A;  2R7W A;  4MHG A;  1GVJ A;  1B72 B;  1V4R A;  4XQF A;  4P9U A;  3CCM I;  2CFX A;  4MTD A;  1N77 A;  2RKH A;  3ZOB A;  3CES A;  1FOW A;  2RN7 A;  1GT0 C;  2L4M A;  2FNP A;  3LA3 A;  4GCV A;  1RUN A;  2GZW A;  1QNT A;  4E7L A;  1KU2 A;  3FM5 A;  3LNQ A;  2VBY A;  4CYC B;  4E7I A;  1O3S A;  2P81 A;  4DYQ A;  2FX0 A;  5E3M A;  1W7P B;  2WY7 Q;  4BAC A;  4BJT A;  1V55 H;  2WC2 A;  2Q0O A;  1A6I A;  4AD9 A;  2ZFW A;  1YW7 A;  4P9F A;  1FYL A;  5K7F A;  3GUD A;  3Q0V A;  2KIU A;  3ERM A;  3BJA A;  2L7Z A;  1VQ8 I;  3FHZ A;  1YOV B;  1JE8 A;  3VEP A;  3WE3 A;  1JTY A;  3IH2 A;  4LG0 A;  2HEO A;  2Q1Z B;  2TRT A;  3HBL A;  3H0D A;  2V1X A;  2Q8K A;  2XGD A;  3GBG A;  1B72 A;  2R7T A;  5ICG A;  3D1N I;  2VKH A;  2ZNZ A;  2WA0 A;  2I8D A;  1J2X A;  3KIO A;  2LD5 A;  4CYC A;  1ENH A;  1OYI A;  5E20 A;  1MJB A;  3FIW A;  2F4I A;  4XL9 A;  3SEQ A;  4JYK A;  1MBH A;  2P0W A;  3TED A;  2VQG A;  3E6C C;  1NG6 A;  4HLX A;  4BDZ A;  1MGT A;  1QVT A;  3AG1 H;  1ETX A;  2JUG A;  3LSI A;  5A2Q K;  1MSE C;  2ZB9 A;  2ZXW H;  2MD5 A;  1VQ7 I;  2Z3Y A;  5E18 F;  1LE8 B;  2V4J C;  2E71 A;  4MO7 A;  1HKQ A;  1HDP A;  3C1D A;  3KYC B;  2CGP A;  3VOE A;  1IRZ A;  3HSR A;  1RET A;  2DOA A;  2D2W A;  2NAZ A;  2V1D A;  1CGP A;  3DTK A;  5BPD A;  2XSD C;  4NDL A;  3FMS A;  4L9N A;  3FXQ A;  4QLC U;  2O8K A;  1R4N B;  3PO3 J;  2JVG A;  2CUJ A;  4M9X A;  1GUU A;  5D8L B;  4IRI A;  2W25 A;  5LGN A;  2E2I J;  2ICW G;  4V2G A;  1BJA A;  1I6X A;  2MBF A;  2GAU A;  2LKP A;  1D5Y A;  3IH3 A;  1AHD P;  2YU3 A;  1BL0 A;  2XB5 A;  4YFX F;  1HF0 A;  1S5L C;  5KK1 A;  2DW4 A;  3S3O A;  4ZH4 F;  2O6G E;  3GFM A;  2L4A A;  2LY9 A;  1SAU A;  3GLL A;  4PUS A;  1XTA A;  2BY3 A;  3OV8 A;  4V19 K;  3HXL A;  4BH9 A;  1ZAR A;  5TJJ A;  5ED4 A;  5M5Y J;  1R36 A;  3IWZ A;  1FZP B;  2VBZ A;  3EYY A;  5D5V B;  1U3E M;  2DDA A;  1UB9 A;  4O3M A;  3V4G A;  1JGS A;  3IC7 A;  2R92 J;  2RVC A;  3RCO A;  3VYS B;  3HIF A;  3GTG J;  2WAF A;  3DBH B;  2HKO A;  2LYC A;  4ENK A;  1GXQ A;  1UHM A;  5K5Q A;  1SC7 A;  1V5E A;  2X51 A;  2X6O A;  4CCO A;  1VFC A;  1BJZ A;  2LVS A;  3BP8 A;  3F9K A;  1DP7 P;  3OS1 A;  1YYV A;  4IHV A;  1EV7 A;  3MQ0 A;  4EEF G;  1QPI A;  2CU7 A;  1BOB A;  1PUF B;  3KP6 A;  4IVN A;  2EIJ H;  5B3S H;  3AKZ A;  2LF8 A;  3H9J A;  1OCP A;  5LGU A;  1U6G A;  2OTJ I;  4RGX A;  3DEW A;  3D5L A;  3ONQ A;  2BBY A;  4A3B J;  2XKO A;  1SFE A;  2L7F P;  2W85 A;  4EM2 A;  2E1C A;  3V7R A;  1P7J A;  3ZQI A;  3IRR A;  4PFO A;  2WAQ A;  2XRL A;  2W00 A;  2EFP A;  3E7L A;  3NAU A;  3NAR A;  3QYF A;  1VQ6 I;  4BXX J;  2XUB A;  2E34 A;  1N75 A;  2WAD A;  1WQ2 A;  3RYP A;  4AU7 A;  3S17 J;  5LFA A;  1I5Z A;  5E17 F;  2K40 A;  1HDD C;  2GBY A;  1DU0 A;  1SAX A;  4MQ9 F;  1YO5 C;  5J8F A;  3WU1 B;  3QU6 A;  1MBK A;  3LSK A;  3A1Y A;  4PSX A;  1A35 A;  2K9L A;  4EJV A;  2B63 J;  1DQU A;  1IN4 A;  3OYC A;  3K4L A;  2FBH A;  2XAU A;  5C4J J;  4DGW B;  1Z7U A;  4E6K G;  2O9L A;  1FSH A;  1SFU A;  1ZRE A;  4E7H A;  3BCB A;  3L2V A;  5LHI A;  2L2O A;  4FCY A;  1XX5 A;  3AL0 B;  2A5W A;  2ZXI A;  3LL7 A;  1MMN A;  2FXA A;  2E5N A;  2L9R A;  1W1W E;  2VE8 A;  2WB1 N;  3QPS A;  1HQC A;  2IGK A;  4NNJ A;  3HOV J;  2FEZ A;  2EH3 A;  3ECO A;  2HYF A;  3VOD A;  3GVA A;  2ZXH A;  4G6T B;  2P7V B;  2CYY A;  4XBF A;  1A5J A;  4GYI A;  4FAS D;  3E5U A;  3BG3 A;  3K1N A;  5K5R A;  5DS9 A;  2KDZ A;  3DKX A;  2FBK A;  1QHG A;  1WHU A;  2B7E A;  2ME0 A;  5HS8 A;  2XAG A;  2DT5 A;  2HVQ A;  5IOZ A;  2XC7 A;  3KEY A;  3K4K A;  3CQZ J;  4M3F A;  4BY1 J;  3MZ8 A;  3A03 A;  3DP7 A;  1EH7 A;  5EEA A;  1RIO H;  1W0T A;  2XIG A;  1ZGJ A;  1EH6 A;  4XKW A;  4EGY A;  1DUX C;  1LPQ A;  1IUF A;  4MNU A;  1SVO A;  2OUM A;  2DMP A;  1XSV A;  4A0X A;  4YRV A;  2DA2 A;  3FK7 A;  2V7F A;  5KVR A;  2DQR A;  3I59 B;  4B4C A;  3RQI A;  4YIF A;  2ZKZ A;  4DW6 A;  1D1C A;  4J19 A;  4A3D J;  2BOL A;  2RC4 A;  4HNU A;  3SFI A;  1JJ8 C;  4J01 A;  1YX5 A;  4C3J J;  2QQA A;  4XLE A;  2M87 A;  2ZME B;  3QPT A;  1FBS A;  1TLH B;  3M4O J;  1W36 D;  2VXZ A;  4N4O B;  3L2U A;  4KIF A;  3NQO A;  4XMY A;  3H5N A;  1GDT A;  3E6M A;  2OQG A;  3F3X A;  3GYH X;  2EFW A;  1Y8Q B;  3ZN1 A;  2VJI A;  3A4C A;  1QGP A;  4NHJ A;  3TMO A;  3CUQ A;  1W0U A;  2EB7 A;  4P5O A;  4HV6 A;  3M07 A;  2ZSI B;  2PFB A;  2KIF A;  2ECC A;  4HDU A;  4M9S A;  5L3B A;  2X48 A;  1LVA A;  3VYU B;  2JSC A;  4I02 A;  1YE9 A;  1EH8 A;  2HQ5 A;  4EMS A;  4AYB N;  4E70 A;  3WTW C;  1AU7 A;  2QCO A;  3HB9 A;  1H0M A;  2PBI A;  2PMU A;  1YW9 A;  2FBI A;  4IHY A;  2TCT A;  5D5U B;  4FX0 A;  2XAQ A;  3RPU A;  3OR2 C;  4DYR A;  3S2W A;  2I10 A;  4A5N A;  1UJ8 A;  5JR3 A;  3K0L A;  3HKZ N;  1U8B A;  2G0E A;  1D5V A;  4N0B A;  5CPR B;  1A36 A;  3UNG C;  2RQP A;  3RZO J;  4R79 A;  2HZT A;  2M0C A;  4BGD A;  4LIV A;  2UWM A;  5BNG A;  1YI2 I;  2AHQ A;  2CW7 A;  4A3J J;  3B6A A;  3SJM A;  3IRQ A;  4KN4 X;  3BQZ A;  3TW7 A;  4UB8 C;  1V3F A;  2K9N A;  2MH9 A;  3Q3S A;  3KFW X;  2YR2 A;  4XR6 A;  2HNH A;  1KA8 A;  4LOC A;  1FJL A;  1RUO A;  1UCR A;  1FOK A;  4IQJ A;  1ZRF A;  1LEA A;  4XRS G;  1L3L A;  1FOX A;  2DA1 A;  3CP8 A;  4HA8 A;  1YJW I;  2GXB A;  3RYR A;  2LRE A;  3GZ5 A;  4MTE A;  3EQL F;  5BPI A;  2A05 A;  2OF7 A;  4KIG A;  2HYJ A;  1DU6 A;  2Y75 A;  4GO1 A;  3OYJ A;  2HOS A;  1OKR A;  3GFJ A;  3PL8 A;  1TWH J;  2ESH A;  2K4B A;  3A0B C;  2V9K A;  3BR3 A;  4U0V A;  4WXC A;  3WTU C;  2W4S A;  1B6A A;  3KP5 A;  1OR7 A;  2X6X A;  3WOD F;  5TGT A;  2PMH A;  3PNY A;  1G3S A;  1I39 A;  1WJA A;  2W57 A;  4LLG F;  4F55 A;  3JSP A;  4E7Z A;  2M3A A;  3JSO A;  1MW7 A;  1ORK A;  1PVE A;  2MLG A;  5GAG J;  1X2N A;  2IXS A;  4EJO A;  4B3A A;  2PN6 A;  4CCJ A;  4LFU A;  3T8T A;  3I4M J;  2XF5 A;  1BR2 A;  4PFP A;  3PQK A;  1BW5 A;  3KP2 A;  1FEX A;  1PP7 U;  1SFX A;  5BQT A;  2VUM J;  3P9K A;  3KCC A;  2B9S A;  3CC7 I;  2DFH A;  2VPR A;  3JCU C;  3LQQ A;  1IV8 A;  3FXM A;  4Z6Y A;  4ZYE A;  3I54 A;  2KRH A;  3E6D A;  1RES A;  4ENM A;  3WTZ A;  3H3Z A;  2UUZ A;  3FX3 A;  1ETQ A;  4LIT A;  4N4N B;  4BXU A;  1J75 A;  1APL C;  4W1U A;  1WH7 A;  4IKF A;  3R61 A;  3I5U A;  4ZC3 A;  2F5E A;  3RIR A;  4UUS A;  4HBL A;  1MD0 A;  2HOE A;  2BZT A;  3CCR I;  4PJM A;  1MMA A;  2GIV A;  2QVO A;  2Y9Y A;  1X19 A;  3CMY A;  2HDD A;  4Y17 A;  3W2V A;  1TTY A;  4HF1 A;  2M8E A;  3S32 A;  1R71 A;  3G3Z A;  4F91 B;  2CW8 A;  3BRO A;  1E3O C;  4CGZ A;  1O7F A;  2DPD A;  1Y0U A;  4BUP A;  3PFY A;  4JBA A;  4BS9 A;  3U1D A;  4FTH A;  5HNF A;  2Y0M A;  1VZ0 A;  2KJB A;  3I56 I;  5L3C A;  2F2E A;  4IHT A;  4BDY A;  5K7Z A;  3HEF A;  4LIU A;  5BMZ A;  1WH5 A;  1WJB A;  4XLP F;  4XM3 A;  4G6D A;  5DEQ A;  4ZZL A;  2YPR A;  4HQE A;  1G3Y A;  2DTR A;  2HQA A;  3QOE A;  2GA1 A;  4GXO A;  2HI3 A;  4JX4 A;  4LGW A;  2LKX A;  2JJ7 A;  1IF1 A;  2EZK A;  3IHU A;  1PP8 F;  2L9N A;  2QEX I;  1RKT A;  3AG3 H;  5E1X A;  1NK3 P;  3H9G A;  4PZJ A;  4G7H F;  2LMD A;  4HSR A;  5IYC J;  1WFX A;  1U2W A;  4I0A A;  3BTJ A;  1FPQ A;  1JUP A;  2COM A;  3JRB A;  1H9G A;  1S6L A;  2Q2E B;  2FE3 A;  3PNV A;  1LB2 A;  3I53 A;  2XRN A;  4A3M J;  1WWX A;  1YJ9 I;  2R93 J;  3L7W A;  5C44 J;  2KZV A;  4M9Z A;  4B48 A;  1WRJ A;  1ZEL A;  1W4M A;  3CCJ I;  1IGN A;  4BEH B;  4HZF A;  2ZSH B;  3BWG A;  1T95 A;  4IHS A;  1JKR C;  5DUI A;  2YU9 J;  3FDY A;  3OIP A;  1ZRC A;  2X1E A;  4YFN F;  5L3F A;  3IL2 A;  4A6E A;  3CCS I;  3TL4 X;  3K69 A;  4IXA A;  1CQT A;  2R4G A;  4HOB A;  2EQR A;  1OFC X;  2ME6 A;  2DMQ A;  4S05 A;  1E17 A;  1WJC A;  2ECB A;  4LLN A;  1Y56 A;  2F48 A;  5GTH C;  2M8G X;  1BI0 A;  2DK5 A;  2K9S A;  3KLN A;  2QA4 I;  3HRM A;  2LG4 A;  3BJ6 A;  2ZJQ F;  2NXN B;  5HLH A;  1PUE E;  5HS7 A;  4V2F A;  2DFE A;  2Q2E A;  3H5R A;  3DQV C;  2K9Q A;  2Z16 A;  2IGO A;  2M30 A;  2R7S A;  4BYY A;  4D1Q A;  1LDD A;  5ERI A;  1G4D A;  3RPU D;  2IA0 A;  1MIJ A;  4Q4Z F;  2VXD A;  1QZY A;  4XSX F;  1D0X A;  5FJ8 J;  1TW2 A;  2ADU A;  5EZH A;  3J7Z I;  1ZAO A;  3OYI A;  4AIK A;  3LOC A;  5F0C A;  5JHF A;  1YG2 A;  3QOD A;  3M1E A;  3V42 A;  4GDF A;  1VQ4 I;  2VN2 A;  1J0R A;  3P9I A;  4Y7N J;  1DP3 A;  2XPV A;  3K70 D;  4RGR A;  1ZR2 A;  3F0C A;  2XGX A;  2E36 A;  1TW3 A;  4KT5 C;  5IT9 K;  5FB2 A;  2DA5 A;  1TNS A;  4IF4 A;  2M7B A;  3MN2 A;  2BY0 A;  2G9W A;  2D45 A;  4YEJ A;  2JMW A;  3FXO A;  3LSP A;  2H8R A;  3ABK H;  4RB0 A;  4U0W A;  6PAX A;  1ULY A;  3KET A;  1X2M A;  5E1Z B;  3HTU A;  1Z67 A;  3CD6 I;  3QU3 A;  4DJA A;  1ZGW A;  1T38 A;  4A0Z A;  4B47 A;  3MKL A;  2R3S A;  5FKK A;  3GTK J;  5FLX Z;  3V8J A;  5LGT A;  2R7D A;  3K4C A;  1ETY A;  4U88 A;  4UV9 A;  3R0A A;  3D5R C;  4CSW A;  1MH4 A;  4DZP A;  4OIO F;  1J5Y A;  3K70 C;  2LH9 A;  3DWL E;  2N8G A;  3HZJ A;  4BXF A;  4CXF A;  4YII A;  1OCC H;  4OAZ A;  3X2Q H;  4G94 A;  3BTI A;  1UST A;  3WE2 A;  2LY2 A;  3HM5 A;  3ZMZ A;  2P7C B;  3N4M A;  4KFC A;  2K85 A;  5LEK A;  4A2U A;  1FT9 A;  9ANT A;  1HA8 A;  1OCZ H;  4CUG A;  3SYT A;  4HX7 A;  3TDZ C;  4IQ4 A;  2JZY A;  4EJT A;  3VSK A;  4KNY A;  4Y13 A;  4U7D A;  3S1R J;  3ELK A;  4G9Y A;  3T0Y A;  1ODD A;  4I09 A;  4BHC A;  2IP2 A;  1R5I D;  3B73 A;  1ZN2 A;  1IRF A;  3V8K A;  1P4A A;  3GO5 A;  2OQR A;  3OIQ A;  3I71 A;  3K10 A;  5LHG A;  5E79 C;  5EEG A;  3DCF A;  5GP9 A;  2FU4 A;  5DCF A;  1BW6 A;  2O0Y A;  2VI6 A;  1G8X A;  3ASN H;  1U5T B;  4BBR J;  2IGM A;  1JHH A;  2HQN A;  2QLZ A;  3ZPL A;  2BVL A;  5CQE A;  1R49 A;  2STW A;  1PJR A;  1X1D A;  2YX4 A;  2EWN A;  2QQ8 A;  2LF7 A;  3KYL A;  1I3Q J;  2DOD A;  2YSR A;  3TW6 A;  2P4W A;  3IKV A;  2PG4 A;  4RS8 A;  4WCG A;  4OOI A;  4CZC A;  3GTL J;  5JFR A;  5D4R A;  4DYC A;  4HYE A;  2NOJ B;  4ITV A;  2R5Z B;  1BC8 C;  5D5X B;  1IXR C;  4N9I A;  4A3L J;  4LB5 A;  1NHA A;  1P92 A;  2R7R A;  3CDL A;  3RKQ A;  1STZ A;  3NEU A;  4FHT A;  1USS A;  5AIQ A;  2CUF A;  3F22 A;  2DFI A;  2JA7 J;  3I3L A;  1LJ9 A;  2VIX A;  2JTV A;  1BR1 A;  4YIR X;  4QPO A;  2MD0 A;  2GWR A;  1U5T A;  3BT9 A;  3W6J B;  4C2U A;  3HL2 A;  4P96 A;  3HOS A;  3K4N A;  2A6E F;  4BKX A;  5JHU A;  3WG7 H;  3JRF A;  3MWM A;  4XIC A;  3RZD J;  5IPA A;  1E3H A;  2FQ3 A;  4DOZ A;  3FKI J;  3K4M A;  3G6E I;  1DGW Y;  5DD8 A;  2VQL A;  1X3U A;  3R4K A;  2AO9 A;  5EZG A;  1OLT A;  2BEO A;  2QSH X;  1J9I A;  2VOD A;  4EJW A;  4F7Z A;  5DYM A;  4II2 A;  2MGQ A;  3C2H A;  1TZL A;  4ENJ A;  1W7P A;  3CLO A;  3C18 A;  2L9V A;  1B59 A;  1SVM A;  2EZH A;  2CQK A;  1H88 C;  3QYB A;  1U78 A;  2C6Y A;  2M4K A;  1TNT A;  1K78 B;  4NC6 A;  1CF7 B;  1DPR A;  3E6B A;  2JN6 A;  5FD6 A;  3M7G A;  4D5C A;  3GFL A;  3HRS A;  3GZN B;  2UXX A;  2Y31 A;  5HDK A;  4PJL A;  1FMV A;  3MKW B;  2HPM A;  2WAQ N;  1LFP A;  5ILV A;  4F3Q A;  4QWQ A;  2XAF A;  4OMY A;  5CLS A;  4L9T A;  5FKO A;  3F72 A;  2D1V A;  1FMW A;  3BZ6 A;  3MVP A;  4KUM A;  1E0E A;  2M9H A;  3RKW A;  1BIA A;  3RDI A;  3TP3 A;  1FNN A;  4XRF A;  4GFB A;  3M8F A;  2JA6 J;  3VSL A;  4HNV A;  3JRA A;  1NG7 A;  1YTY A;  3MZY A;  3LAJ A;  1I6H J;  4Q47 A;  2VLA A;  2RAE A;  3ROU A;  1OPC A;  3BR1 A;  2WWY A;  1K78 A;  4Y3O A;  1CF7 A;  1K4S A;  1LE8 A;  1HSJ A;  2BHY A;  2CO5 A;  5FO5 A;  1ITY A;  4I98 B;  4EAT A;  5DV5 A;  1FY7 A;  2BVM A;  2EIN H;  2L3D A;  3EPZ A;  5ILU A;  2AQE A;  1BM9 A;  1ZLK A;  3F8B A;  1Z7L A;  4C2T A;  5FRO A;  3JAM Z;  4S04 A;  4PCQ A;  3FMR A;  4KIC A;  4HQM A;  5KCM A;  1LNW A;  1WZ2 A;  2DA7 A;  2QQ9 A;  3G2B A;  3ZRG A;  2EIM H;  1HW1 A;  4RAZ A;  4ASN A;  3PQJ A;  4KDP A;  4FT8 A;  1ZRD A;  2CV1 A;  2MYS A;  1WGX A;  1A31 A;  3WU0 A;  2BW3 B;  1XMK A;  2E1M C;  3GCM A;  4DBR A;  4GYG A;  3QAH A;  3VYT B;  4O6J A;  3LSJ A;  3T8R A;  2GXG A;  1BBY A;  2LR8 A;  3J80 K;  3TKY A;  4IOC F;  5ICC A;  2X9D A;  5KHD A;  1K6O A;  2LNB A;  3P5J A;  2FOW A;  3K6G A;  1U8R A;  1FC3 A;  3G1O A;  1ZQ3 P;  5CVI A;  3DLA A;  2MW8 A;  1LEB A;  1B1B A;  1D3Y A;  2ZJP F;  2IPQ X;  1JT0 A;  3LSG A;  4H0E A;  1TP4 A;  1WJ5 A;  5DD4 A;  1MMD A;  2VJJ A;  3N97 A;  3ZCO A;  1PUF A;  5D4S A;  2EIK H;  1X3W B;  3P7N A;  2HTJ A;  3FK6 A;  2BW3 A;  3K9T A;  1EJ9 A;  1IG7 A;  4EGZ A;  1TWG J;  4RB2 C;  1TC3 C;  2PEX A;  1K6Y A;  2VJ4 A;  3CF2 A;  4A69 C;  4BJ5 C;  1GLN A;  4XOT A;  1MND A;  1T56 A;  4PGG A;  1X1P A;  4M72 A;  4YEL A;  3HOX J;  4AID A;  4CCK A;  4EVI A;  4QSH A;  3CCV I;  2QQB A;  3LSR A;  1QA6 A;  3H5A A;  4NC7 A;  3S1Q J;  3KX2 A;  1SVL A;  2EJR A;  4MIM A;  1KYW A;  3I4P A;  2R7V A;  2JRT A;  3OYG A;  2MG4 A;  3EET A;  1JUS A;  3ZQ7 A;  1MBF A;  2P8T A;  2COB A;  1QPM A;  3BTC A;  4DZJ A;  3LQR A;  4XK4 A;  5LD2 C;  3MZH A;  2MA3 A;  3VB2 A;  1JKO C;  4M3B A;  5CQG A;  1I27 A;  1KU3 A;  4XLN F;  2PQ8 A;  1LFB A;  3HC7 A; 
#chains in the Genus database with same CATH homology
 1S7E A;  2E1O A;  4S0H B;  2VUM J;  3BTL A;  3HOW J;  3GTJ J;  2VPR A;  1O4X A;  1GV5 A;  1RES A;  5C3E J;  2EZI A;  2DMU A;  2CUE A;  4D7N A;  5IP9 J;  3S1M J;  1ETQ A;  4X6A J;  5IP7 J;  5J1U A;  2KT0 A;  5F0H A;  1APL C;  2YUS A;  1IDZ A;  1YRN B;  4W1U A;  2NVQ J;  1WH7 A;  3QPL A;  1MH3 A;  1MBG A;  4UUS A;  1ETV A;  1BA5 A;  3BR5 A;  3W6V A;  1H8A C;  1HOM A;  3S15 J;  2Y2Z A;  3OSG A;  5F27 A;  1F43 A;  3CCY A;  1TWF J;  1XC5 A;  2Y9Y A;  1WPK A;  2Y30 A;  3CMY A;  2HDD A;  4FE4 A;  3VPR A;  1FTZ A;  1EF4 A;  2DTZ A;  1ETK A;  1QRY A;  5FKM A;  4BY7 J;  1E3O C;  5JLW A;  4IHX A;  5F1J A;  3JRH A;  1JT6 A;  3O8H A;  4FTH A;  5E3L A;  3G1L A;  5FLM J;  1RKW A;  2IAI A;  4JP0 A;  5DTD A;  3HGG A;  4A3I J;  2L0K A;  4QIW N;  2HOA A;  3C2B A;  5K7Z A;  3WHB A;  3HEF A;  4JX5 A;  5IOY A;  3OOU A;  1WH5 A;  3JRD A;  1XG1 A;  2ID6 A;  2HI3 A;  2LP0 A;  4JX4 A;  1Y1V J;  2JJ7 A;  2LKX A;  2EZK A;  4Y52 J;  1G2H A;  2NVT J;  3S16 J;  3QQA A;  1GV2 A;  1RKT A;  1MSF C;  1NK3 P;  3S2H J;  3IV5 A;  2IBD A;  1ZR4 A;  2NVX J;  5JLX A;  4A3C J;  5IYC J;  2M2E A;  3BTJ A;  1JUP A;  3JRB A;  5M5W J;  5GPC A;  4FE7 A;  1ETO A;  3O8G A;  5E3N A;  4A3M J;  1B72 B;  2R93 J;  5C44 J;  3ZOB A;  1GT0 C;  3S2D J;  1JUM A;  1IGN A;  3HOU J;  3LNQ A;  4CYC B;  2P81 A;  1JKR C;  1POG A;  4DYQ A;  2FQ4 A;  2FX0 A;  2YU9 J;  5E3M A;  4C3I J;  1CQT A;  1FTT A;  1A6I A;  1ZTR A;  2EQR A;  1OFC X;  2ME6 A;  2DMQ A;  3K2A A;  5EG0 B;  3ZQH A;  2OPT A;  5K7F A;  1WCM J;  2ECB A;  1OCT C;  3Q0V A;  2L7Z A;  2M8G X;  2R0Q C;  2E2J J;  5IP6 A;  2K9S A;  1U9N A;  1JTY A;  3IH2 A;  2HXI A;  2DA4 A;  2QF7 A;  1Q1V A;  2TRT A;  3HBL A;  4V2F A;  5C4X J;  5EF6 A;  2XGC A;  1IDY A;  2XGD A;  2K9Q A;  3GBG A;  3GTO J;  1B72 A;  1H89 C;  5FKN A;  3D1N I;  4M3E A;  4G12 A;  2PMZ N;  4L5E A;  1ZKG A;  5FJ8 J;  5EZH A;  2DA3 A;  2LD5 A;  4XRM A;  1ENH A;  4CYC A;  3TP0 A;  2E2H J;  3FIW A;  3LOC A;  3G1M A;  4JYK A;  2DN0 A;  5F0C A;  1MBH A;  4QTR A;  3TED A;  1QVT A;  2W48 A;  4Y7N J;  1JKP C;  5EG0 A;  2DMT A;  1ETX A;  2XPV A;  1ZR2 A;  2ZB9 A;  1MSE C;  4RBO A;  3F0C A;  5IYD J;  5F08 A;  1LE8 B;  4MO7 A;  5M3M J;  1HDP A;  2HOT A;  2DA5 A;  1IRZ A;  1RET A;  3BR2 A;  5EDN A;  3MN2 A;  2XSD C;  4NDL A;  3PO2 J;  2JMW A;  3LSP A;  1IJW C;  2L7M P;  2H8R A;  2FD5 A;  2O8K A;  1X2M A;  2WV1 A;  3PO3 J;  1ETW A;  4A3K J;  3BG5 A;  3OSF A;  2NS7 A;  1ZGW A;  2DMN A;  1GUU A;  3GTK J;  3MKL A;  5FKK A;  2E2I J;  3OIO A;  4MFD A;  1ETY A;  4V2G A;  3IH4 A;  1MH4 A;  1IV6 A;  4DZP A;  4MLO A;  1D5Y A;  3IH3 A;  1AHD P;  1BL0 A;  2N8G A;  2XB5 A;  4M3G A;  1HF0 A;  2LY9 A;  2LK2 A;  3JRG A;  3BTI A;  1WI3 A;  3HM5 A;  2CJJ A;  3JRI A;  3HGY A;  4XID A;  5M5Y J;  1YRN A;  2CQQ A;  4I6Z A;  9ANT A;  1T33 A;  2R92 J;  2JWT A;  3GTG J;  3GTQ J;  2CRG A;  3S1R J;  2X6O A;  3S14 J;  3A01 B;  2E19 A;  1FIP A;  4C3H J;  1VFC A;  1BJZ A;  2LVS A;  3DCF A;  5GP9 A;  4FIS A;  2VKV A;  1LFU P;  4IHV A;  1BW6 A;  4EEF G;  2VI6 A;  1QPI A;  1MBE A;  4BBR J;  2CU7 A;  1PUF B;  5HOD A;  4MFE A;  3PM1 A;  1SAN A;  2NS8 A;  1OCP A;  1JKQ C;  1I3Q J;  2R5Y B;  3DEW A;  3BR0 A;  3TW6 A;  4A3B J;  4B1R A;  3GTL J;  4D5F A;  4DYC A;  2L7F P;  1X58 A;  3BG9 A;  1P7J A;  3ZQI A;  2R5Z B;  4A3L J;  3CDL A;  3Q0W A;  3RKQ A;  2XRL A;  3E7L A;  4RDU A;  3NAU A;  3NAR A;  3A01 A;  4BXX J;  2CUF A;  4A3E J;  2LTP A;  2JA8 J;  5EYR A;  2JA7 J;  3JRE A;  1JTX A;  3JRC A;  3S17 J;  1Z0X A;  3K7A J;  3BT9 A;  4AUX A;  2K40 A;  1HDD C;  2GBY A;  1DU0 A;  1F36 A;  4BKX A;  1UG2 A;  2H1K A;  3A02 A;  3JRF A;  3B6C A;  1MBK A;  4XIC A;  3RZD J;  5IPA A;  2R5Y A;  3FIS A;  2JK3 A;  3FKI J;  2B63 J;  2XPW A;  5J1R A;  1JGG A;  5EGO B;  3ZQC A;  2AO9 A;  4M3D A;  5C4J J;  2ID3 A;  5EZG A;  2O9L A;  1K61 A;  1VI0 A;  4D7M A;  4FCY A;  4W97 A;  2MGQ A;  1HCR A;  2HXO A;  4A3G J;  2L9R A;  3ZQF A;  2EZH A;  2WB1 N;  3QPS A;  3HOV J;  2XGE A;  1H88 C;  1RR7 A;  2DJN A;  2EH3 A;  4ABZ A;  1R9T J;  1K83 J;  1U78 A;  2XPU A;  4UUS B;  2JN6 A;  3BR6 A;  4I76 A;  1MBJ A;  1A5J A;  2LFB A;  4D5C A;  3BG3 A;  3BQY A;  2KDZ A;  5DS9 A;  3M3Y J;  1TWC J;  2ME0 A;  2Y31 A;  2WAQ N;  5IOZ A;  3HOY J;  5M3F J;  2LLK A;  4BY1 J;  3CQZ J;  4M3F A;  3HOZ J;  1UMQ A;  3A03 A;  3UKG A;  4UUT A;  5FKO A;  5EEA A;  5EGO A;  3MVP A;  1SFO J;  2VKE A;  1W0T A;  1VF9 A;  2M9H A;  1AKH B;  1I50 J;  1IUF A;  3TP3 A;  5J3L A;  2ELK A;  4GFB A;  2DMP A;  2JA6 J;  2DA2 A;  3FK7 A;  4HNV A;  5FKL A;  4AC0 A;  5FLV A;  4B4C A;  1P7I A;  3JRA A;  4C2M J;  3RQI A;  1I6H J;  2RAE A;  3I4N J;  4DW6 A;  4J19 A;  3BR1 A;  4A3D J;  2GM4 A;  3SFI A;  1RPW A;  1LE8 A;  1JJ8 C;  2YS9 A;  4C3J J;  1ITY A;  5GPA A;  2FJ1 A;  3M4O J;  4XRS A;  1ZK8 A;  3WHC A;  1MNM C;  4IHW A;  1UHS A;  2JA5 J;  2CQX A;  3ZQG A;  1GDT A;  2DA7 A;  1AKH A;  3S1N J;  3SDG A;  3L1P A;  1W0U A;  2GLO A;  1IC8 A;  2ECC A;  1B8I B;  1GVD A;  1WGX A;  2X48 A;  4BBS J;  1OJL A;  3HDD A;  2HQ5 A;  4AYB N;  1AU7 A;  1Z77 A;  2R7Z J;  2QCO A;  1TWA J;  3HB9 A;  1VND A;  4A93 J;  3JR9 A;  3LSJ A;  4IHY A;  2TCT A;  1HLV A;  2LR8 A;  1JJ6 C;  4DYR A;  3Q0U A;  2I10 A;  2X9D A;  3HKZ N;  1U8B A;  2G0E A;  5J1Y A;  3RZO J;  2IEK A;  2M0C A;  3G1O A;  2NOG A;  1ZQ3 P;  5BNG A;  2MW8 A;  2AHQ A;  4A3J J;  3B6A A;  3SJM A;  1FIA A;  2Y0S N;  3BQZ A;  1JT0 A;  3TW7 A;  3LSG A;  5IYB J;  2K9N A;  2XB0 X;  3Q3S A;  1QVU A;  2DA6 A;  1PUF A;  1B8I A;  1XS9 A;  5K7H A;  4LOC A;  3FK6 A;  1FJL A;  4X1E A;  4XRS G;  5F0F A;  1IG7 A;  2DA1 A;  2EZL A;  1TWG J;  1TC3 C;  1NK2 P;  2M34 A;  2OF7 A;  4A69 C;  2HYJ A;  1DU6 A;  1NTC A;  5E3O A;  2HOS A;  2D5V A;  1T56 A;  1TWH J;  2R5Z A;  3HOX J;  1Y1W J;  2O7O A;  3BR3 A;  4QSH A;  4A3F J;  3GTM J;  2EBI A;  3LSR A;  3S1Q J;  5M5X J;  4JX6 A;  3H0G J;  4M6V A;  4MIM A;  1ORK A;  1X2N A;  3ZQL A;  2MSY A;  3GTP J;  2MG4 A;  4B3A A;  1JUS A;  2NVY J;  3I4M J;  1MBF A;  1U9O A;  2COB A;  1BW5 A;  3BTC A;  4DZJ A;  5F04 A;  4XK4 A;  1JKO C;  1FEX A;  3H3V K;  4M3B A;  2Y9Z A;  1LFB A;  4IEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...